2LF7A

Intramolecular regulation of the ets domain within etv6 sequence r335 to q436
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
GSHMRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor ETV6
publication title Autoinhibition of ETV6 (TEL) DNA Binding: Appended Helices Sterically Block the ETS Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 33
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lf7A01
5FD5A 3D5LA 2HEOA 3K1NA 2E1CA 5K5OA 4I01A 3WTSC 3HHGA 2G9WA 4RGUA 4AIHA 3LA7A 1BI3A 1FP1D 4BHBA 4GYGA 2P5LC 2Z9OA 3WGGA 3Q9SA 1XSDA 2YX4A 2HS5A 4ETSA 1MGTA 1X3UA 4A12A 2XAGA 3ZPLA 3KZYA 1BC8C 4XLNF 4M72A 3GEZA 4UUVA 3KETA 2VT2A 1QNTA 1G4DA 4WCGA 4AIJA 4I0AA 5BPDA 4GO1A 3F8CA 3TO7A 4Q48A 2FXAA 4KMUX 3CUOA 2XROA 4DQ2A 1GXPA 1IN7A 3M8FA 4LG0A 4I0BA 1B4AA 3K69A 3WODF 2CSOA 2D2WA 1STZA 2KIMA 5ICFA 4GXOA 3EYYA 2MD5A 3GFIA 1ZGAA 5CLSA 4E70A 5LRSA 4S05A 3HYIA 2RGVA 4N0BA 2EB7A 4KMFA 1SMYF 4Q5SF 1FLIA 5ICEA 3MCZA 5KVRA 3VB2A 2Z99A 3SFZA 3NRVA 2P5KA 3U9GA 3J7AO 1T39A 1LDKB 4UVBA 2WTEA 1U5TA 5DCFA 4RS8A 4AIKA 3CO6C 5KK1A 1YFHA 5A2QZ 1IN6A 1R1UA 3EYIA 3IC7A 4KIBA 2BYVE 2G7UA 4G94A 2XGXA 2EFNA 4GGGA 4A0XA 2KIUA 2FBKA 2EV6A 5DCMA 3KLNA 3LQQA 3BPVA 5BMZA 1SFEA 1XDSA 2FBHA 1V3FA 2VT3A 4L9NA 1TQIA 2XAJA 2M45A 4HW0A 1ZN2A 3I58A 1HKSA 4WXHA 2ELHA 1P2FA 4ON0A 3F8NA 3QU3A 3IKVA 4B09A 5DD4A 3KP6A 2ESHA 2DAOA 3ELKA 4KUMA 2J5OA 1TW2A 5ERIA 3F72A 5L3DA 1ON2A 3DF8A 2XKPA 2L01A 4PDKA 2MH2A 1J9IA 5K1YA 3FF5A 3CDHA 5HLIA 1YW7A 4KNYA 2EJRA 5ICCA 4XBFA 3ZP5A 2HGCA 2LDUA 2Y0MA 1ZYRF 4JK1X 3NEUA 5D4SA 1R5GA 3Q9VA 5ILVA 3CUQC 3TOBA 1XD7A 1IRFA 4EM0B 2ZMEA 3P9KA 2UZKA 2ZKZA 2BV6A 2QM3A 3ZMUA 3I5UA 4HLXA 1YYVA 2FNAA 4LJZF 5D6EA 4P9UA 3L00A 3CUQB 2O6GE 1JGSA 4Y13A 5ED4A 4U88A 5E18F 3RI4A 1KU9A 3N4MA 1BI2A 5K5QA 2M87A 5CYVA 2GXBA 4BAYA 1BI0A 6PAXA 3DP7A 3LAPA 5LHGA 1PP8F 5ILUA 4KT5C 3TO9A 5HLGA 2OQRA 5LHIA 3DFGA 1UCRA 3FXUA 3F23A 2V1UA 5D5VB 3T5XA 2K4JA 2XASA 1LB2A 3U2RA 3T8TA 1XGSA 2YX7A 5F64A 2V1DA 4WX9A 3HRUA 5DEQA 2ACJA 2OU2A 4IHSA 1EH7A 1LQ1A 1FYKA 4UV8A 2OAZA 4WXDA 2C6YA 1FYLA 1U78A 4L0ZB 2F5DA 5L3GA 1K6OA 3HSRA 3DEUA 2PMUA 3ZMZA 3E6DA 4YG2F 3HRSA 2PBIA 3WTZA 4OOIA 1H9GA 3B73A 2GQQA 1P4XA 2EFOA 3E5UA 2EK5A 2FE3A 2YR2A 3ABTA 1HKQA 4G6DA 5LEKA 3WU1B 3C3WA 2K7LA 2E7WA 4R1HA 3RDIA 2PI0A 4HQMA 3L9FA 3KLOA 5EEHA 3K1PA 1S3JA 4OIQF 2MBFA 4HDVA 5LBQA 1GXQA 5DUKA 2PLYA 4IXAA 2RDPA 3QU6A 2KIFA 3WG9A 5DV5A 1R36A 3GXOA 3ROUA 4OIPF 2EV0A 1Q1HA 2CG4A 2EV5A 4YIIA 1DP7P 1RNLA 1BBYA 3RYRA 4YFNF 2CYYA 2HOEA 3WGHA 4L5IA 3WE2A 4N9HA 2R3SA 2OD5A 2ZXJA 4Z2YA 5LHHA 3C1DA 1O3QA 2H94A 1BJAA 2JPCA 4BQAA 3KP7A 1T98A 2HTSA 1REPC 2F5EA 2FBIA 1DUXC 2NNYA 2COMA 4Y17A 1R23A 2MLGA 1ON1A 2VXZA 3GX4X 2O03A 5LEJA 2V1XA 2PMHA 2KRFA 2F5FA 1AOYA 2Y75A 1YS6A 2FMYA 2VBWA 4KN4X 2VOOA 5HDNA 3MAJA 3DPTA 1R1VA 3VFZA 3KE2A 3G3ZA 3L2CA 1E17A 2YPRA 3P9IA 2XRNA 5E8IA 1BI1A 2QBYA 4HX8A 2JT1A 3C7JA 1FC3A 4HLYA 4CDGA 2FSWA 2XVCA 3BROA 4MTEA 1BC7C 2VBXA 2L4AA 2UXXA 2WV0A 1J5YA 3R60A 2XAQA 1R22A 2KJBA 4M9SA 1FT9A 2QQAA 1MZBA 3TQNA 2RVCA 2NYXA 2RV8A 2ADUA 3P7NA 4LGWA 4L0YB 3EQLF 3EUHA 5BS6A 2IA0A 2K27A 4ZZDA 4ENMA 4EGYA 3E6CC 3E5XA 2HWVA 4HF0A 1S7AA 5JFRA 3KEQA 3J80Z 2E7XA 5FO5A 1WI9A 3I71A 3SZTA 1QO0D 4U0YA 3FM3A 1T38A 4M71A 3FM5A 5LRRA 3ZMTA 1XSXA 2P7CB 4OIOF 5E1WA 4IRGA 1Y0UA 4ZZLA 2RC4A 4HZFA 1QPMA 4RB1A 2YU3A 2DQLA 2ZJ2A 3GO5A 4LG0B 3KP4A 4MQVA 4WK8F 1SFXA 3F6OA 1K78A 3SHFA 2DPDA 2H6CA 3LWFA 2XIGA 2PJPA 4TV7A 2L4MA 1ZH5A 5AONA 2IA2A 1W4MA 1G3WA 4FX0A 3JSPA 4P96A 1U5TC 2QUFA 2DQRA 3IWFA 3LQRA 2EFWA 2DT5A 4FT8A 4KICA 1FYMA 2R7FA 3MFKA 4UHTA 2A6EF 3IWZA 4XLPF 3TOAA 2HTJA 2LF8A 3I59B 1ZGJA 4PGHA 1IXRC 1U3EM 2GAUA 3CLOA 2JPBA 5HDKA 3I53A 5E8GA 4GYIA 2VE8A 1MD0A 5HOOA 4KA4A 4KFCA 2FEZA 1R7JA 3E5QA 3V4GA 4PCQA 4WF2A 5J8CA 2A6HF 1KGSA 1FWZA 4EM2A 5DCMB 4OU0A 4RAYA 3BPXA 1CF7B 1A04A 4M6XA 3QPTA 1P92A 4ZYEA 3LAJA 4LK1F 2RNJA 2A68F 2IW5A 4P55A 2F2EA 2ZNZA 3IKTA 1Z6TA 3HIFA 1WSUA 2CGPA 1ONVA 2NNNA 1MDMA 2DFIA 2CW0F 2QLZA 3JTHA 3PQKA 2B0LA 3RJPA 1XMKA 3DQVC 3J81K 2VBZA 2LKPA 1J2XA 1J0RA 2VC1A 1UHMA 1B9MA 4HAMA 4RGXA 4PGGA 5L3EA 1BIAA 2A07F 1ULYA 4NQWA 1HBXG 4ENJA 1B59A 3GWZA 4I02A 1FBSA 1GHCA 1OMIA 1T2KA 3E3VA 5FLXZ 4KIGA 4PZJA 5LGNA 2GIVA 1KQ8A 5J6XA 1QGPA 2ZNYA 2FQ3A 2Z33A 3LA2A 5D5WB 1KU3A 3GF2A 4MNUA 5A2QK 1LEAA 2ZMEB 4HYEA 1YG2A 1W7PD 1FZPB 2DK8A 3R61A 4YFKF 4BXUA 2CQKA 1UHWA 3L7WA 5CVIA 4CO8A 3WTTC 4EJUA 2OA4A 3ZN0A 1XMAA 2V6CA 2L54A 1JXSA 1OKRA 2QYOA 3JW4A 1IUYA 2PG4A 4L18B 2EWNA 2QQBA 3AAFA 5FFXA 5H20A 3GW2A 1OYWA 1TQPA 3HTSB 4KYWA 3H3UA 4M9XA 2P5VA 1ZLJA 2M1BA 4LLLA 4CGZA 1P6RA 5LGUA 4EMSA 3I4PA 2Z5UA 3ABUA 5L3CA 5IT9Z 4OIRF 4GCVA 2OZ6A 4XRFA 1O3SA 3U1DA 3RKYA 5HVQC 1U8RA 1G6NA 3EDPA 3NQOA 4ASNA 4FHTA 4Q4ZF 4BNCA 1IW7F 4LLNA 3E6BA 1SD7A 1W5SA 3N97A 2DO7A 4EM1A 1XCBA 4YIFA 5K5RA 1PUEE 3RKXA 5E17F 4LB5A 1YIOA 4NB5A 1H9TA 4N9IA 1R58A 4A6DA 2XAFA 2A5YB 1S6LA 1ZLKA 3JTGA 3RTRA 1F9NA 4MEXF 4UVCA 1TQMA 4A0ZA 2PFBA 3PQJA 4UVAA 1LNWA 1R1TA 3BY6A 3BWGA 5HDGA 1JE8A 3KEOA 5BPIA 2XV4S 2XKOA 5JVTA 4Q47A 3F22A 3HUGA 4A2UA 3FX3A 4U0WA 4A6EA 1PP7U 1UFMA 3V7SA 3O3KA 4I09A 2QVOA 1USSA 2E1NA 5FD6A 2LSOA 1ZHFA 1SD6A 1R5HA 3PFIA 4JQFA 1W7PA 5TRDA 1L0OC 4IPAA 4CXFA 1HSJA 4B8XA 4M9ZA 4UXNA 1ZREA 3G73A 2FNPA 1KYZA 3I0TA 5D5UB 5AIPA 2W57A 2GWRA 4EJWA 3F8BA 2D1HA 3RKWA 4ZYDA 4AWXB 1E2XA 4LMYA 4ESJA 1K79A 3FXRA 3V7CA 3WGIA 3K9TA 1TTYA 2IT0A 1BM9A 3H92A 3ZMDA 3KP3A 4RB2C 5ICGA 1DPRA 3QPHA 2IPQX 1YW8A 2P8TA 1TNTA 2IP2A 2JRTA 2FF4A 3M9AA 5BQTA 2RKHA 4EVIA 1VTNC 3RPQA 1QQIA 3QP6A 5JHUA 3MEXA 3T1BA 4M6YA 2MC3A 5FB2A 1ZRFA 1ZAOA 3KCCA 2Q8KA 2QBYB 1FX7A 5JI6A 3F6VA 2HQRA 1XGNA 3P9CA 3R6SA 5D8KB 2ZO4A 3KP5A 4HF2A 4OINF 4KN7X 1HW5A 2ZFWA 2H27A 1U2WA 4I98B 3GLXA 1KU2A 5CVRA 2O0YA 5AIQA 4D0PA 2EA4A 2LNBA 1D3YA 1BN5A 1W5TA 3DKWA 3IRQA 2FOKA 4LK0F 5E20A 4BHPA 2PN6A 2ZCWA 3WTWC 4S04A 4MQ9F 4G7OF 2BBYA 3MZHA 4RB0A 1FBQA 1LVAA 1ZRDA 2NRAC 3Q5FA 1QZYA 2IJLA 3RYPA 3F3XA 3ML6A 1T6SA 1FP2A 1TBXA 5HS9A 3MQ0A 1I1SA 1K78B 1HXDA 5F1RA 2STTA 1G3SA 2LF7A 3HRTA 3ZMSA 1U6GA 3L09A 4QLCU 2IRFG 1D5VA 5HS7A 1J59A 4HQEA 3C18A 4ZYGA 2HFHA 1KYWA 3MZYA 4R79A 3JAMZ 4MHGA 3H3ZA 3WE3A 3SXYA 3M7GA 4G7HF 2BE5F 2H09A 4G7ZF 2CO5A 2MLKA 1XN7A 2DU9A 3WU0A 2CWEA 5D4RA 3V8JA 2XUBA 4O6JA 2P6SA 4EJOA 4CHUA 2MH9A 1O3RA 3JSOA 5IT3A 4A5NA 3S2WA 3J80K 3TO6A 1JHFA 3HHHA 2XHKA 3FHZA 1KQ9A 4BYYA 4WWCA 4IRHA 3B02A 1FOKA 3BJ6A 5F6FA 3DV8A 2HDCA 3QP5A 3R0AA 1EH8A 1MDMB 4LLGF 2OBPA 1WKMA 3GFJA 2W84A 4XSXF 2K86A 3TGNA 4L9VA 3KP2A 4H0EA 3M1EA 1F4KA 4A0YA 4K2EA 1U5TB 3QAHA 3I64A 1P4WA 2DPUA 1RIOH 2NAZA 5TJJA 3ZQ7A 4IJAA 4P5OA 2HKOA 2KKOA 3K0LA 2BGCA 1MKMA 1XGMA 1LJ9A 3I54A 4WXCA 3R0JA 2G7HA 1JHHA 2O3FA 4YFXF 1D8JA 1I5ZA 4RGRA 3K1MA 3FWEA 3RPUA 3HTUA 2VBYA 3GFMA 1B1BA 5D6FA 4U7BA 3BZ6A 1OYIA 1Z6RA 1MJ9A 1F5TA 2P4WA 2UXNA 2OZUA 2FU4A 3DPLC 2FA5A 1S29A 4HBLA 4UNOA 4U7DA 1S8NA 2VN2A 5HLHA 4IRIA 2JSCA 1WWXA 3J81Z 5ILSA 1I1GA 4DNCA 3TKYA 1TLHB 2STWA 1G3TA 2EFPA 2W25A 2FRHA 3IHUA 2W85A 1S7OA 1LEBA 3GUDA 2L3DA 1BIBA 1HW1A 2H6BA 1YW9A 2HYGD 2YSRA 3I59A 1SD4A 3HSFA 3REOA 3TDUC 3LSTA 1B6AA 2P6TA 1QBJA 4ENNA 1BOAA 1OYYA 5BOXA 1I27A 2Y48A 2K02A 1CGPA 4MTDA 2MA3A 1TW3A 1FBUA 2ETHA 2HR3A 2O8XA 3KZZA 2AXLA 1CF7A 3O6BB 1ZG3A 4BHCA 4IHTA 3W6KB 5LLQA 1UB9A 4A5MA 5FLXK 3VEPA 3BDDA 3T8RA 2GZWA 1ZG1A 1F1ZA 4LFUA 4LB6B 4I2OA 3M8EA 4ENKA 5CJ9A 3OV8A 1J7KA 1SD5A 1P4AA 4HV6A 1RZ4A 5DDGA 3GVAA 2X0LA 2HYFA 1GVJA 2PQ8A 1O3TA 1YQAA 1XDUA 4HA8A 1KA8A 3QRFF 4OMYA 3ZN1A 2CFXA 1Z1DA 3KFWX 2DBBA 3T0YA 3E6MA 4MEYF 3WTUC 3GFLA 4CICA 4G6QA 2DK5A 1Z7UA 2F5CA 1D8KA 4ESBA 2ESNA 2P7VB 1SFUA 1W7PB 1IAWA 5CVVA 1C0WA 5IT9K 3VOEA 3WTYC 2ZBKA 2VC0A 1RUNA 4ESFA 2AS5F 2OQGA 2EA2A 2JTVA 3OOPA 5J8FA 2M5WA 2V79A 3HRMA 1HKTA 3WTXC 4NHJA 3V8KA 5EEGA 1HW2A 1G3YA 4LD5A 5L3BA 3ECHA 1H0MA 4KIFA 3CTAA 4HX4A 4BH9A 1SAXA 1WQ2A 3QOPA 4O3MA 5FFZA 4IF4A 3F21A 1SMTA 4HF1A 2D1VA 5DD8A 3CO7C 1RI7A 2DI3A 2M8EA 3F8MA 5E1XA 3IL2A 4P9FA 4L9JA 2RQPA 3BOQA 4EQQA 2VODA 1YS7A 3E97A 2K4BA 3FMRA 1AWCA 2Q2EA 1O57A 2HKXA 4EJTA 2QWWA 3ERED 5H6QA 1TNSA 4I7HA 1KU7A 4CZZA 3CUQA 1IF1A 4F7ZA 1V4RA 4KDPA 4G9YA 3FXQA 2XAHA 4HOBA 2VONA 4HDUA 4U0VA 3WTVC 1EV7A 1WRJA 2IVMA 1USTA 3ISPA 3TDZC 1Z91A 4MGRA 1FSEA 5HS8A 3O2PE 1DPUA 2R7DA 2TDXA 5CVUA 2DLLA 5D5XB 3RIRA 5FGMA 4M74A 1IXCA 4R8HA 1OR7A 3DXJF 1DDNA 2HZTA 2GA2A 1XCVA 4O5VA 3V7RA 2WWYA 1MJAA 2RN7A 5CVJA 4RGSA 2JZYA 3BJOA 2VE9A 1J75A 2QQ9A 3FMQA 3EETA 1XGOA 2GXGA 1L3LA 2EFQA 1I6XA 1LDJA 4AD9A 3GZ5A 1RUOA 1ODDA 1PDNC 4JBAA 3LA3A 1IN8A 1R00A 5LGTA 1ZRCA 1KQ0A 3SQNA 1EH6A 1FPQA 1QZZA 4ZH4F 4ZYHA 1LDDA 4EJVA 4M73A 1K7AA 4EGZA 2D45A 3K2ZA 4Y15A 2BEOA 5JR3A 3MWMA 2QENA 1IRGA 4RAZA 2Q0OA 1IZ1A 1Z05A 4RB3C 2QZ8A 1MJBA 1XSVA 3CJNA 1NHAA 4HX7A 3FMSA 2ISZA 4QWQA 1OPCA 3HOTA 1O7FA 3BJAA 2KJCA 4HV5A 5E1ZB 4EV0A 3ULQB 4AVPA 1ZG5A 3F8FA 3ECOA 4G8XA 4FX4A 2WC2A 3GYHX 4CYDA 2VOPA 3VODA 4L9TA 2Z3YA 3HOSA 4IVNA 1IXSB 1FY7A 2NS0A 2W24A 1ZARA 1O7LA 1Z9CA 5DUIA 2V9VA 3ZMVA 2A61A 3HSEA 2ISYA 5H6RA 3GZ6A 1XB4A 1YTYA 1FNNA 2PEXA 2GA1A 4OMZA 4UV9A 4XSZF 2IA1A 2DW4A 2FMLA 2O61A 3SZPA 3D0SA 3V8LA 1YLFA 1IN4A 2DTRA 5L3FA 2J5PA 3IRRA 2A69F 2UWMA 3BP8A 1FSHA 3LFKA 1IN5A 1HSTA 2L02A 3COAC 1HQCA 2M30A 3JAMK 2X4HA 2A3SA 1YO5C 2HQNA 1B9NA 5DYMA 1T0FA 3R4KA 4L5JA 5D8LB 3W6JB 3FZVA
chains in the Genus database with same CATH superfamily
2MYSA 3IH4A 5FD5A 3D5LA 1YI2I 4CCLA 3AL0B 1S72I 2HEOA 4CYCA 3K1NA 4XLEA 2E1CA 5EEAA 4BUPA 3OYIA 3QOEA 5K5OA 4I01A 3WTSC 1D0XA 3HHGA 2G9WA 3PIPF 3DEEA 4RGUA 4AIHA 3LA7A 3NWSA 2GOMA 1BI3A 2W00A 5EDNA 2DFEA 1FP1D 3CCYA 2DMTA 5EG0A 2QA4I 1FEXA 4BHBA 4GYGA 1E3PA 4H4KC 2K3PA 3JRAA 4A3LJ 2P5LC 2Z9OA 4CH7A 3WGGA 2HPMA 3OOUA 4IEJA 2IXSA 4HNTA 3Q9SA 1XSDA 1S7EA 2R93J 3FISA 2XGDA 2HS5A 2YX4A 3HG9A 1MGTA 1X3UA 4XN0A 2XAGA 4ETSA 1VZ0A 3PNVA 3KZYA 4A12A 3ZPLA 3HOVJ 1POGA 4IL6C 1BC8C 4XLNF 3EUAA 3FXMA 3ASOH 2KFDA 3G1LA 3GEZA 3QWLA 2VPRA 4M72A 4C9YA 4RDUA 3KETA 2VT2A 4S0HB 1QNTA 1G4DA 4UUVA 1F43A 4KITB 4XKVA 4NC6A 2LYCA 4BY1J 3OL3A 4WCGA 4AIJA 1N25A 4I0AA 2XPVA 4XKCA 3BQYA 1DGRM 4RBOA 3W2WA 5BPDA 1WH7A 1RKTA 4GO1A 3F8CA 3TO7A 5FLMJ 4Q48A 3K7AJ 2UV1A 2XF5A 3AG2H 2FXAA 3A2KA 4KMUX 3CUOA 2XROA 2GM4A 3M07A 4DQ2A 1HOMA 2NVYJ 1GXPA 1V5FA 1IN7A 3M8FA 4I0BA 4LG0A 4E7IA 1B4AA 3K69A 2O9LA 3WODF 2JA7J 2WAQA 2GXAA 2CSOA 3HPGA 2D2WA 4A69C 3IV5A 4XL9A 1LE8A 1STZA 1BR4A 2KIMA 5ICFA 4GXOA 3EYYA 2MD5A 5IYBJ 2D5VA 3HB9A 4JX6A 3GFIA 1WJCA 2M0CA 4P1WA 4J01A 1ZGAA 5CLSA 4E70A 5LRSA 4S05A 2HU9A 1JGGA 3HYIA 2LH9A 2RGVA 4CCJA 4DW6A 3OYAA 4N0BA 1A6IA 2EB7A 2DA5A 4KMFA 1SMYF 2KIQA 4Q5SF 2H1LA 1FLIA 4XM3A 1RPWA 5ICEA 3QYBA 3MCZA 2MG4A 5KVRA 2KZGA 3VB2A 1IO2A 2V7FA 2RAEA 4B44A 3RSNA 2Z99A 3SFZA 3L1PA 4JOMA 3NRVA 2FQ4A 3OS1A 3JRDA 3RZOJ 1R6RA 2E19A 2P5KA 2VUMJ 5C44J 3U9GA 1ZELA 3J7AO 4F93B 1T39A 1LDKB 3OIQA 4UVBA 2WTEA 1U5TA 5DCFA 3AG1H 2ID6A 4RS8A 4AIKA 3CO6C 2TRTA 1VNDA 4LG3A 5KK1A 4PJLA 5KNLA 1YFHA 3BC8A 5A2QZ 1SEUA 3ESWB 2ECCA 1IN6A 1R1UA 3LOCA 3IC7A 3EYIA 3DBHB 4KIBA 2BYVE 5FKLA 2G7UA 3S1RJ 4G94A 2XGXA 4IHVA 2EFNA 2VJJA 4GGGA 4A0XA 2R7WA 3HOXJ 2DN0A 4PJ0C 2KIUA 2FBKA 2EV6A 2VL8A 3ZQGA 5DCMA 3KLNA 3K6GA 3LQQA 4AYBA 2XSDC 3BPVA 2WB1A 5BMZA 2M4GA 1D1AA 1GV2A 1SFEA 1XDSA 2FBHA 2Y9ZA 1TT5B 2KP6A 1I50J 1V3FA 1X4PA 3L2UA 1U8BA 3OYDA 2VT3A 1QVTA 4L9NA 1TQIA 2XAJA 2M45A 4HW0A 2PJRA 1ZN2A 2QKLB 1Y6IA 3I58A 1HKSA 4AIDA 1IGNA 4WXHA 3HOWJ 2ELHA 3GTPJ 1GT0C 1P2FA 1Y8RB 3OYHA 4ON0A 3F8NA 3QU3A 1MBGA 5TGTA 3PFYA 3IKVA 2VASA 4B09A 3HEFA 5DD4A 1YHQI 1VQNI 3KP6A 2ESHA 2LKXA 4RAFA 2HXIA 2NS8A 2DAOA 2X6XA 2XF7A 1WGXA 3ELKA 1X2MA 4KUMA 4MIMA 4B4CA 2J5OA 2ICWG 2H8RA 2WY8Q 4JYKA 1TW2A 2GLOA 3U21A 5ERIA 2Y31A 1MMSA 1Z0XA 3F72A 2DA2A 1ON2A 5L3DA 3KX2A 5IOYA 3DF8A 4XRSA 1GUUA 2XKPA 2L01A 4A3EJ 3BZCA 3MD2A 4PDKA 2MH2A 3LFUA 2EIJH 1SFOJ 1IDZA 1J9IA 1MNEA 3KEYA 5K1YA 3M4OJ 3FF5A 1XX5A 3CDHA 1YW7A 1K6YA 5HLIA 4KNYA 2EJRA 3H9GA 5ICCA 1ZKGA 4BE2A 3ZRGA 3AKZA 4NDLA 4XBFA 2V9KA 5E79C 1E3HA 2HZDA 2HGCA 3ZP5A 1YITI 2LDUA 2Y0MA 1ETYA 1X3WB 1ZYRF 2AXTC 4JK1X 4IO9F 1LKXA 2QSHX 3NEUA 2CS3A 5D4SA 1R5GA 3Q9VA 5ILVA 3CUQC 3TOBA 1XD7A 2M34A 1IRFA 4EM0B 4AUXA 2ZMEA 2WBMA 1X1DA 3TW7A 4DZJA 2CUJA 3ONQA 3P9KA 2B7EA 2BOLA 2ZKZA 5F1JA 2UZKA 2BV6A 2QM3A 3ZMUA 3IP4B 1FOYA 5B5EC 3I5UA 4HLXA 1YYVA 5IP6A 4YEJA 2R7UA 2FNAA 4JX4A 3M8JA 4LJZF 3IUOA 1JUPA 5D6EA 1RRJA 4P9UA 3JRCA 3L00A 2EZHA 3EPZA 3FXKA 3K70C 3CUQB 2L7ZA 2EZLA 4EATA 2O6GE 2W48A 3VSLA 1JGSA 5K7FA 4Y13A 3UR3C 5ED4A 1WHUA 3OIOA 3PNTA 3H0GJ 4U88A 5CKTA 3GLLA 5E18F 3RI4A 1KU9A 3RZDJ 3N4MA 1BI2A 3E7LA 1OR7C 3ZXSA 3GTOJ 5K5QA 2M87A 5CYVA 1DU0A 3KIOA 2HPIA 2GXBA 4BAYA 3AG3H 1BI0A 1WFXA 2H8WA 2O7OA 6PAXA 1K4SA 2XGCA 2X1DA 3DP7A 3GTKJ 4FE4A 5GAGJ 1MH3A 3LAPA 5LHGA 1PP8F 5ILUA 4UUTA 5M5WJ 3BR5A 4FTHA 1B8IB 2CQXA 4KT5C 3TO9A 4MO7A 2OQRA 5LHIA 5HLGA 1GLNA 2CUEA 2Z2SB 1UCRA 3BCBA 3DFGA 3LSRA 3S3OA 3FXUA 3F23A 2V1UA 5FKMA 5D5VB 3T5XA 1OCTC 1MNDA 3BLYA 3CQZJ 2K4JA 2XASA 1LB2A 3U2RA 4N4NB 3T8TA 1XGSA 2JK3A 2YX7A 3C2HA 2V1DA 5F64A 4BJ6C 4WX9A 3HRUA 5DEQA 2ACJA 3L2RA 1X1CA 2OU2A 4IHSA 3S2HJ 3GZNB 3HC7A 1EH7A 1Y0NA 5M5YJ 4D5FA 1LQ1A 3HKZN 3I3LA 3N05A 1FYKA 4UV8A 2OAZA 4WXDA 3RCOA 2C6YA 1FYLA 1U78A 4L0ZB 2JA6J 2F5DA 5L3GA 1AU7A 2Z1DA 3BR0A 4C30A 3OYEA 1K6OA 3HSRA 3DEUA 1RESA 2LC2A 3OYCA 1OCZH 2PMUA 3ZMZA 3E6DA 4YG2F 2DA1A 3HRSA 3S14J 2DT7B 3PO2J 2PBIA 2VJ4A 4A93J 3WTZA 4OOIA 4DYCA 1ETKA 2EPFA 1H9GA 3B73A 1IJWC 3PIOF 2GQQA 3CLQA 4B3XA 3DWLE 1P4XA 2EFOA 3E5UA 3J7YJ 3QPSA 2X51A 3L2QA 2EK5A 2FE3A 2YR2A 4XN3A 2JA8J 3ABTA 1HA8A 3HBLA 1HKQA 4G6DA 3K4BA 5LEKA 3WU1B 1EA3A 1Y8QB 4XR6A 1HDPA 3C3WA 1OCRH 2K7LA 4XKBA 4D5CA 3OS2A 2NS7A 2E7WA 4R1HA 5TISC 4BACA 3RDIA 2PI0A 4HQMA 3L9FA 2YU9J 3KLOA 1ZR2A 2DODA 2R7OA 2IS6A 4ANJA 2V6EA 4Y52J 2JUGA 3X2QH 1XS9A 3CJTB 3CCUI 5EEHA 1W5CC 2CH0A 3K1PA 1S3JA 2VLAA 4OIQF 2MBFA 1JTYA 4HDVA 3GTGJ 5LBQA 1TL8A 5JLWA 1GXQA 3CMMA 5DUKA 2PLYA 5J1YA 1YJNI 4IXAA 2RDPA 1Z67A 2UUZA 3CDLA 3QU6A 1I3QJ 3CC2I 2KIFA 3WG9A 5DV5A 2HQ5A 1R36A 3GXOA 2K3FA 3ROUA 4OIPF 2EV0A 4F55A 4M6VA 1Q1HA 2MW8A 2CG4A 4IX7A 2EV5A 4YIIA 3VYRB 1DP7P 1RNLA 2NOGA 1BBYA 2XRLA 4A3GJ 3RYRA 4DZPA 3ABLH 4MFEA 4YFNF 2LBFB 2CYYA 2HOEA 3S16J 4A3BJ 3WGHA 2XAUA 4L5IA 2VKEA 4DBRA 4CCNA 1OCPA 3IAM2 3WE2A 3CF5F 4CSWA 3KYCB 4N9HA 1WJ5A 2R3SA 2OD5A 2ZXJA 4Z2YA 2L9RA 5LHHA 3C1DA 3J7AY 2ZXWH 1BOBA 3PSFA 2BVMA 1O3QA 2H94A 1BJAA 2JPCA 4XONA 3KP7A 3W3CA 4BQAA 1GVDA 1T98A 2HTSA 1REPC 2F5EA 4QIWN 4JP0A 2FBIA 1DUXC 3BR1A 2NNYA 2COMA 1A5JA 1ETWA 4Y17A 2XPWA 1FOWA 1R23A 2MLGA 1ON1A 2VXZA 3BCAA 5IP9J 3GX4X 3A0HC 4KISA 2O03A 3S17J 3I4NJ 5LEJA 4RLQA 5F08A 2V1XA 1R4NB 4J19A 2F4IA 2I8DA 1MBKA 2VQHA 1T0FC 2PMHA 2KRFA 2F5FA 1MSEC 1AOYA 1TWFJ 2X9DA 3JRHA 1DGWY 2Y75A 1VI0A 4X6AJ 1YS6A 2FMYA 2VBWA 4KN4X 5HNFA 5EGOB 3ZQQA 1UJ8A 1UMQA 2FD5A 2VOOA 5F0FA 4II2A 5HDNA 3MAJA 3DPTA 5IY5H 1R1VA 3VFZA 3KE2A 3G3ZA 3L2CA 4IOAF 3WHCA 1E17A 2W82A 2YPRA 2KL4A 2JJ7A 5GPAA 3P9IA 1CQTA 2VQLA 2XRNA 3HOYJ 5E8IA 1U0JA 1BI1A 2KPMA 2QBYA 2A5WA 3TBIA 4HX8A 2JT1A 2NVQJ 3C7JA 3CMAI 1WJAA 3CCJI 2LY9A 4C3JJ 3HDDA 1FC3A 2DMPA 2WAQN 2R7SA 1FJLA 1W36D 2QKMB 2BZTA 4HLYA 4CDGA 2FSWA 2XVCA 3BROA 4MTEA 1BC7C 3TMOA 2VBXA 2L4AA 4CYCB 2UXXA 1I3AA 2WV0A 4BQNA 1J5YA 3R60A 1VQ5I 2XAQA 3CF2A 1R22A 3F0CA 4ZDPA 2KJBA 4M9SA 1FT9A 2QQAA 2ELJA 1MZBA 3TQNA 4G6TB 4UUSA 2RVCA 3LNQA 2NYXA 2RV8A 2ADUA 3P7NA 3PUBA 1F36A 4LGWA 3KYLA 3ZCOA 4L0YB 3EQLF 3EUHA 2E5ZA 5BS6A 2IA0A 2K27A 3S32A 4ZZDA 3GTJJ 4ENMA 5KAFC 2EILH 4EGYA 4PSXA 3E6CC 4A3JJ 4ABZA 2LY2A 3E5XA 2HWVA 5B1BH 3WHBA 2CV2A 4HF0A 1S7AA 2QQ8A 5JFRA 3KEQA 3J80Z 4BJ5C 3S3NA 2E2IJ 2E7XA 4W1UA 5FO5A 3BG6A 1WI9A 3H1CA 3I71A 3OY9A 3SZTA 1QO0D 4U0YA 3FM3A 1T38A 4M71A 2VJIA 4FISA 3FM5A 5LRRA 4PJJA 5FLVA 3ZMTA 5HLTA 1XSXA 2CQNA 2P7CB 3PO3J 4OIOF 3DU6A 4OAZA 4BJTA 5E1WA 4RLFA 3HOUJ 4IRGA 1Y0UA 4ZZLA 2RC4A 4HZFA 3SEZA 1QPMA 2GIZA 4RB1A 2YU3A 4IQ4A 2PX9A 2DQLA 2R5YB 2BY3A 2ZJ2A 2KZVA 3GO5A 5DM6F 4FCYA 2NVXJ 4LG0B 3H5AA 5IYDJ 3KP4A 4AYBN 1NTCA 4B47A 4MQVA 2VB6A 4WK8F 2WB1N 1SFXA 3F6OA 1LE8B 4XICA 1K78A 3SHFA 2DPDA 2H6CA 3LWFA 2KMUA 5JHFA 2XIGA 4AVZA 1JKRC 2PJPA 1MMDA 2P81A 4TV7A 2L4MA 1ZH5A 5AONA 2L7KA 4BS9A 2IA2A 1W4MA 1I6HJ 1G3WA 4FX0A 3JSPA 2JVGA 4YRVA 4LIUA 4P96A 1U5TC 2ZJQF 3SDBA 1TT0A 2QUFA 1UELB 2LTPA 2O5RA 3BG9A 3K4MA 3DKXA 2DQRA 2CJJA 5EZHA 1Y1WJ 3IWFA 3LQRA 4RMNA 2EFWA 2DT5A 4FT8A 4KICA 1FYMA 2R7FA 3MFKA 4GRIA 1VQ9I 2L7FP 2L7MP 4UHTA 2A6EF 1IUFA 3IWZA 4XLPF 3TOAA 4U87A 2A05A 2HTJA 2LF8A 3H5NA 3LL7A 3I59B 1QU3A 1ZGJA 1QHGA 4PGHA 3A01A 1IXRC 5J40A 1U3EM 1GDTA 2GAUA 2P0WA 2R7ZJ 3CLOA 2JPBA 5HDKA 4E7KA 3I53A 2TCTA 5E8GA 4GYIA 3TP3A 2VE8A 1G8XA 1MD0A 5HOOA 4KA4A 1MIJA 4KFCA 2FEZA 1R7JA 3E5QA 1ETOA 3V4GA 4PCQA 3I4MJ 2EBIA 2HYJA 2JN6A 1NG6A 4WF2A 5J8CA 2A6HF 4RAGA 1HLVA 3H9JA 1KGSA 1FWZA 4EM2A 5DCMB 3W6VA 4OU0A 5J1UA 2MSYA 4RAYA 3BPXA 5C3EJ 1CF7B 2E71A 1A04A 4M6XA 3QPTA 2E36A 1P92A 4F91B 1XTAA 5J4VA 4ZYEA 1TWAJ 1IG7A 3LAJA 4LK1F 2PJRB 4QSHA 2RNJA 2A68F 2NOJB 4DYQA 2IW5A 5FJ8J 4P55A 1OFCX 4A3MJ 1AKHA 1GV5A 2F2EA 2ZNZA 3FK7A 3IKTA 3A1YA 2X85A 1Z6TA 3HIFA 1TP4A 2ELKA 1WSUA 2CGPA 1ONVA 2NNNA 4V2FA 2NVUB 2GOXB 1RC9A 5DS9A 1MDMA 2BHZA 2ZXHA 1XMXA 2DFIA 1OCCH 2CW0F 4XRMA 2E1MC 2DDAA 4PFPA 3FK6A 2QLZA 3JTHA 2X1EA 3PQKA 2B0LA 3RJPA 1XMKA 3DQVC 3LSHA 3G2BA 3GTQJ 1NG7A 3J81K 2VBZA 2LKPA 3L2VA 1J2XA 1J0RA 2VC1A 1UHMA 1B9MA 4HAMA 4RGXA 4PGGA 5CQEA 1SAUA 5F04A 5L3EA 3DCFA 1YRNA 1TWHJ 4X0GA 1WJEA 2BXYA 1BIAA 2A07F 2BY2A 1XPXA 2R7QA 1ULYA 4NQWA 1HBXG 2ZMEC 3CCQI 4ENJA 1ZR4A 1ETXA 3VYUB 1I39A 4UB6C 1B59A 3GWZA 3BR6A 4I02A 1FBSA 3S1MJ 2K9QA 3K4CA 1G59A 2WAEA 2R4GA 3RQIA 1GHCA 2R7XA 1OMIA 1Y56A 1T2KA 4IKFA 1SANA 1G2HA 3E3VA 5FLXZ 2M2EA 4KIGA 4PZJA 2MFZA 4MFDA 5LGNA 2EQRA 5FROA 1XG1A 2GIVA 1YX5A 1KQ8A 5E3NA 5J6XA 1QGPA 1FTTA 2ZNYA 5GAEJ 2FQ3A 3LA2A 5D5WB 2Z33A 2L2OA 1KU3A 3GF2A 4MNUA 1X58A 5A2QK 2ZMEB 1LEAA 1R9TJ 4HYEA 1YG2A 3VSKA 2B63J 2VQCA 4XK4A 1W7PD 4PUSA 3S3MA 2DK8A 2EIMH 3P5JA 3R61A 4YFKF 4BXUA 1FZPB 2ZB9A 1H88C 2CQKA 2OV7A 2IAIA 1OISA 1UHWA 5IOZA 3L7WA 4XIDA 2MGQA 5CVIA 2XC7A 4CO8A 2EZIA 3WTTC 1VQPI 2IGMA 4EJUA 2OA4A 1T33A 3ZN0A 1D0YA 1XMAA 2V6CA 4AU7A 4ZC3A 3BG7A 1X1PA 2HVRA 2L54A 1JXSA 1OKRA 3F9KA 4AM3A 2R5ZA 2QYOA 3JW4A 1IUYA 3PL8A 3W2AA 2PG4A 3MZ8A 4L18B 2EWNA 2KISA 2QQBA 3AAFA 1FTZA 5FFXA 5H20A 3GW2A 1SVOA 4BDYA 2KHMA 4PK4A 1PUFA 1OYWA 1TQPA 2F5VA 1P7JA 3HTSB 4PJNA 4D7MA 2VI6A 3H3UA 3LSPA 4KYWA 4M9XA 1VFCA 2P5VA 1ZLJA 2M8GX 4HSTA 3OIPA 2M1BA 4LLLA 3LSMA 4CGZA 1P6RA 5LGUA 3BQZA 1LFUP 4EMSA 1B72A 3I4PA 5F0HA 2Z5UA 3ABUA 4B48A 5L3CA 3K70D 5IT9Z 1DQUA 3DBRB 4OIRF 2L9NA 5GTHC 4GCVA 2CUFA 2OZ6A 1VF9A 2F4OB 4BBSJ 4ZDOA 4XRFA 1O3SA 3U1DA 2M7BA 4C2MJ 3RKYA 1MSFC 5HVQC 1U8RA 1TC3C 1G6NA 3IH2A 3EDPA 3NQOA 5GAHJ 2HDDA 4ASNA 4FHTA 4Q4ZF 2Q2EB 4BNCA 1IW7F 1JKQC 2FJ1A 4LLNA 1BW5A 1S9HA 3E6BA 1K83J 1SD7A 3OYMA 3JCUC 1W5SA 3MVPA 3D1NI 2VKHA 1JT0A 3N97A 2M0MA 5IPAA 1BL0A 4N4OB 2QGUA 2DO7A 4I6ZA 2A6TA 5GPCA 1H89C 1MW7A 5EJCA 4EM1A 2DFFA 1XCBA 3PUFA 4YIFA 2M9HA 2OJED 3NWTA 5K5RA 3ZQHA 1PUEE 1V5GA 3HM5A 3RKXA 4LB5A 5B3SH 5E17F 1MBJA 4YELA 3OMYA 1YIOA 4NB5A 1H9TA 4N9IA 1VQ6I 1R58A 4A6DA 2XAFA 2A5YB 1Z3YA 1S6LA 1ZLKA 3JTGA 3RTRA 1QA6A 1F9NA 1SVLA 4QPOA 4MEXF 2O8KA 1N75A 4UVCA 4DJAA 1TQMA 1LFPA 4A0ZA 2PFBA 1RKWA 3PQJA 4UVAA 3Q0WA 1LNWA 1MBEA 4BXXJ 2HDWA 1R1TA 3BY6A 3MKZA 3BWGA 4A3IJ 5HDGA 1JE8A 3KEOA 5BPIA 2XV4S 2XKOA 2XGEA 5JVTA 4XQFA 4HNUA 1AHDP 4Q47A 1QZEA 3HUGA 4A2UA 3F22A 3FX3A 4U0WA 4A6EA 1PP7U 1UFMA 3V7SA 3I56I 3O3KA 4I09A 2QVOA 5K7HA 1USSA 2E1NA 5FD6A 2CV1A 1RR7A 2LSOA 3FHNA 2VKDA 1ZHFA 1SD6A 3D5RC 3QYFA 4XNFA 1R5HA 1VQLI 3PFIA 1MMAA 2NVTJ 4JQFA 5LD2C 1W7PA 2ZSIB 5TRDA 2E2HJ 1UZCA 1L0OC 3CCEI 4HSRA 2I5UA 1HSJA 4IPAA 4M3DA 4M9ZA 2LLKA 1OQYA 4AC0A 4B8XA 4CXFA 3JRBA 1OJLA 4UXNA 1JKOC 1ZREA 4IHXA 1JT6A 3WU2C 3G73A 1K4TA 2QEXI 2FNPA 1KYZA 3I0TA 5D5UB 5AIPA 2ZXIA 3SYTA 2DMNA 2OTLI 4C2UA 2HQAA 2W57A 2GWRA 4NUBA 4EJWA 1JUSA 3F8BA 2D1HA 3RKWA 1BR1A 5IYCJ 4ZYDA 1TZLA 2LP0A 1E2XA 2LK2A 2V4JC 4LMYA 4AWXB 4ESJA 1K79A 3FXRA 1A36A 3V7CA 2OF7A 3WGIA 1Y1VJ 3K9TA 1TTYA 2IT0A 1BM9A 3H92A 2CQQA 3ZMDA 4NBQA 1QPIA 3ASNH 1KONA 1X4OA 3I55I 3KP3A 4RB2C 2E1OA 5ICGA 1DPRA 1P9QC 3QPHA 4D1QA 2IPQX 1YW8A 5FKNA 2CFOA 2P8TA 1TNTA 2PMZA 2VQGA 2IP2A 1OLTA 2DTZA 2JRTA 2FF4A 3M9AA 1ZQ3P 4RM3A 5BQTA 2RKHA 4EVIA 2ZC2A 1VTNC 4XLFA 2V1NA 3RPQA 4OAYA 1QQIA 3QP6A 5JHUA 3FXJA 3LSJA 3MEXA 5FRNA 4E7SA 4E7LA 3AG4H 3T1BA 4M6YA 2MC3A 5FB2A 1ZRFA 1ZAOA 2K85A 4JX5A 3KCCA 2L5QA 3BTJA 3TEDA 1D5YA 2Q8KA 2QBYB 1FX7A 5JI6A 2IS1A 1E0EA 3F6VA 2DOFA 2HQRA 2BY1A 4BKXA 3EUHC 1XGNA 3S15J 2IBDA 4B1RA 3P9CA 3R6SA 5D8KB 1ETQA 2ZO4A 3KP5A 1IV6A 1V54H 3HJEA 3ZOBA 4OINF 4HF2A 3C2GA 4KN7X 1VQ4I 1HW5A 4E4HA 1YJ9I 4A3KJ 3J7ZI 2RQQA 3NARA 5JVGF 2ZFWA 2H27A 4UUSB 4KT6A 1U2WA 2DYRH 4I98B 4XRSG 3ZR8X 3GLXA 1KU2A 5CVRA 2O0YA 3G1OA 5AIQA 4D0PA 2EA4A 2LNBA 3DLLF 4M3FA 1D3YA 1D1CA 1BN5A 1IRZA 4BEHB 4FASD 4BQOA 2X6OA 1P7IA 4BE1A 1MMGA 1S5LC 3VWBA 4OWRB 4XOTA 4XLHA 2X6YA 1W5TA 3DKWA 1ZTRA 2V9PA 3IRQA 2FOKA 4LK0F 5E20A 3CCVI 3CC4I 3FDYA 4BHPA 2L9VA 2PN6A 2ZCWA 3ERMA 3FKJA 5EZGA 4LIVA 3WTWC 3BTLA 2E5NA 2LKSA 4S04A 4MQ9F 1Z77A 1ORKA 3DTIA 2R7RA 4G7OF 2BBYA 3MZHA 3JRIA 2XPUA 2F6CA 4RB0A 1FBQA 4MLOA 1LVAA 3IAS2 1ZRDA 5DTDA 3RPUD 3G71I 5E3LA 4J00A 2NRAC 3K4KA 3Q5FA 2XSJC 2JSPA 1QZYA 3HKZA 2IJLA 2HOSA 4HRIA 3RYPA 3F3XA 3ML6A 2AQFA 3S1NJ 3OS0A 1T6SA 1FP2A 1TBXA 5HS9A 1O4XA 3MQ0A 2R92J 1I1SA 1K78B 1OCOH 1HXDA 5F1RA 2STTA 2WY7Q 1G3SA 2LF7A 3C2BA 1QVUA 1HDDC 4CCOA 3ZGKA 3DU5A 3HRTA 3ZMSA 3S1QJ 1U6GA 4DBQA 3L09A 1M1EB 2LR8A 2HVQA 4QLCU 5EG0B 5LFAA 2MABA 3OYGA 2IRFG 1BA5A 1D5VA 2HVSA 2X6WA 1LVKA 5HS7A 1J59A 4HQEA 3C18A 3EUKL 2I10A 3H9QA 4ZYGA 1PVEA 2AHQA 2HFHA 3K4NA 1YOVB 3CMYA 1KYWA 2X1CA 2ZSHB 3LMMA 3MZYA 4R79A 2IEKA 4XLCA 2DOEA 3JAMZ 5J47A 4MHGA 3H3ZA 3WE3A 3SXYA 1AA7A 2BVLA 3M7GA 4G7HF 2BE5F 2H09A 4G7ZF 2DYSH 3A01B 2KDOA 2CO5A 4W97A 2MLKA 1SVMA 3DLAA 3G1MA 1XN7A 2LREA 2DU9A 3WU0A 3HL2A 2CWEA 4RA2A 5D4RA 4UY8I 3V8JA 5EGOA 2XUBA 3TP0A 1UG2A 2KLOA 4O6JA 1W36C 2P6SA 4EJOA 3OR2C 4CHUA 2MH9A 3V42A 5H2FC 1O3RA 2CUZA 4Y33A 5J1RA 1LPQA 3JSOA 4I99C 2HNHA 2CU7A 4QTRA 5IT3A 4A5NA 3S2WA 3K10A 2COBA 2L9SA 3LSKA 3M1CA 3J80K 3TO6A 1JHFA 4FETA 1HF0A 3HHHA 2XHKA 3HGGA 3MKYB 3A0BC 3FHZA 1KQ9A 1JI8A 3RQ4A 4BYYA 2YUSA 4WWCA 1IC8A 2QF7A 3PNYA 1JUMA 4IRHA 3B02A 4Z6YA 1H8AC 2JMWA 1AKHB 1FOKA 3BJ6A 5F6FA 3DV8A 1R49A 2HDCA 4II3A 3QP5A 2JUCA 3R0AA 2QSGX 3MMYB 5JLXA 4IZZA 4ITVA 4CCKA 1EH8A 1A35A 5C4JJ 2EZKA 3H0DA 1TWGJ 1U9NA 1MDMB 4LLGF 3U1KA 4CUGA 2OBPA 1WKMA 3GFJA 2W84A 3Q0UA 3PJRA 4XSXF 4DIQA 2K86A 3TGNA 4L9VA 3KP2A 3QYEA 2BW3A 3FBNB 4H0EA 1YX3A 2JA2A 1Z7LA 3M1EA 1F4KA 2ME6A 4A0YA 2E34A 4K2EA 1U5TB 2ZFUA 3QAHA 4D9JA 3I64A 3BT9A 4CZCA 3CCLI 1P4WA 2FX0A 4NC8A 2DPUA 1RIOH 2NAZA 5TJJA 3ZQ7A 4IJAA 1YRNB 3RKQA 4P5OA 3KPHA 2HKOA 2KRHA 1A31A 2KKOA 3K0LA 3SZGA 1W1WE 5BNGA 2BGCA 1MKMA 1XGMA 4NQWB 1LJ9A 5K7ZA 2Y0SA 3I54A 1FMVA 3MKWB 4WXCA 3R0JA 2G7HA 3DBLB 2CRGA 2QCOA 1JHHA 2O3FA 4YFXF 2DA4A 1QHHD 2DJNA 1D8JA 1I5ZA 4RGRA 3K1MA 3FWEA 3RPUA 4FE7A 3HTUA 2EH3A 3CCMI 2VBYA 3GFMA 1B1BA 5D6FA 4U7BA 3SJMA 1JTXA 3BZ6A 1OYIA 1Z6RA 2V26A 3BZKA 1MJ9A 1F5TA 2P4WA 2UXNA 3LSIA 2DA6A 2R5YA 2BHYA 2OZUA 3B6CA 2R0QC 1ERDA 2FU4A 3DPLC 2FA5A 1S29A 2RREA 3NAUA 4HBLA 3CMEI 4UNOA 4U7DA 2W7NA 2ME0A 1S8NA 1IV8A 2VN2A 5HLHA 4IRIA 2EINH 2JSCA 1FIPA 1WWXA 3J81Z 3G4SI 5ILSA 1I1GA 4DNCA 3TKYA 1TLHB 2STWA 1G3TA 3OSFA 3CJQB 2EFPA 2W25A 2ZJRF 2FRHA 3IHUA 2W85A 1BJZA 4Y4RA 2FUG2 1S7OA 2M7AA 1JKPC 2G0EA 3GUDA 1NH3A 1VQKI 1LEBA 4XMYA 2L3DA 1BIBA 3FIWA 1HW1A 2Y9YA 3DTEA 4KJZA 2R5ZB 3QODA 2H6BA 4DYRA 1YW9A 2HYGD 1WZ2A 2YSRA 3I59A 1SD4A 3HSFA 3REOA 3TDUC 3LSTA 1IDYA 1PUFB 3OYNA 2E1MB 2OPTA 1B6AA 4M3GA 2XF6A 4IQJA 2P6TA 1QBJA 1Z3XA 2NXNB 2YS9A 4ENNA 1BOAA 2XB5A 3H36A 3HXLA 1OYYA 5FRMA 4HNVA 5BOXA 1B72B 2Y69H 2WAFA 1I27A 3OYKA 1X1AA 1EJ9A 2Y48A 2K02A 1K61A 1CGPA 4MTDA 2MA3A 1TW3A 1FBUA 2ETHA 2R7TA 2HR3A 2O8XA 3W2VA 3KZZA 2DA3A 1VQ7I 2AXLA 3SFIA 2ECBA 3KZIC 1CF7A 1Q1VA 3O6BB 4HPQA 1ZG3A 1YIJI 3OR1C 4BHCA 4IHTA 3W6KB 2K9NA 5LLQA 1UB9A 1WPKA 3LSGA 4A5MA 2KDZA 5FLXK 3O8GA 3VEPA 3TL4X 4B43A 3BDDA 3T8RA 4XLAA 2VKVA 2E2JJ 2GZWA 1ZG1A 1F1ZA 2K9LA 1NK3P 4LFUA 4LB6B 1LUJB 2F4MB 4I2OA 2DT6A 5CQGA 3M8EA 4ENKA 5CJ9A 3OV8A 4C3HJ 1J7KA 1SD5A 1P4AA 4HV6A 5C4XJ 1RZ4A 4ZTJA 5DDGA 2Y30A 3GVAA 3UKGA 2E35A 2JRMA 4C3IJ 2X0LA 4G12A 2HYFA 2VIXA 1E3OC 1GVJA 4HEA2 3IH3A 1DU6A 1XC5A 2PQ8A 2DFHA 1YQAA 1O3TA 1XDUA 4HA8A 1KA8A 3HOZJ 2W1OA 3QRFF 4GDFA 2FOWA 4OMYA 1IRXA 3ZN1A 2CFXA 2RNGA 2IS2A 1Z1DA 3GCMA 3KFWX 2DBBA 1D1BA 4A3FJ 3T0YA 3H3VK 2IGKA 3E6MA 1BW6A 2PMZN 4MEYF 3S93A 3WTUC 1FIAA 3HUGB 3GFLA 4CICA 2H1KA 1MNMC 4G6QA 2DK5A 4XORA 3DTKA 3CD6I 4BL0B 5B66C 1Z7UA 2F5CA 2L0KA 2WV1A 2EIKH 2K9MA 3H35A 1D8KA 4UB8C 4ESBA 2ESNA 4F52A 1Z21A 2K5CA 1RETA 2P7VB 1SFUA 3JRFA 1W7PB 1IAWA 5CVVA 1ITYA 1C0WA 4Y3OA 2Q1ZB 5IT9K 3VOEA 4RM2A 1HC8A 4CCMA 3WTYC 2LVSA 2ZBKA 4M3EA 3DPUA 2DA7A 3CZ6A 2VC0A 1RUNA 4ESFA 1V5EA 4L5EA 5M3MJ 2AS5F 2OQGA 2EA2A 2JTVA 2OUMA 3BG5A 3OOPA 3FBIB 5J8FA 2M5WA 2V79A 3HRMA 3L2WA 4CA0A 1HKTA 1PYVA 4PSWA 3WTXC 1FOXA 1SC7A 3CP2A 4NHJA 3V8KA 5EEGA 3HPHA 1HW2A 2JQ7A 2CW8A 3FKIJ 3PSIA 5F0CA 1G3YA 4BBRJ 1KZHA 4LD5A 2LG4A 3OWTA 3UNGC 5L3BA 4D7NA 5EF6A 2M3AA 2B9SA 2ID3A 2DDBA 3ECHA 1H0MA 3CESA 4KIFA 3CTAA 4HX4A 4BH9A 1VQMI 2Z16A 2DCEA 4PJMA 1SAXA 2AQEA 1WQ2A 3QOPA 4QPQA 4O3MA 4BXFA 5FFZA 4IF4A 3F21A 1SMTA 4HF1A 2D1VA 5DD8A 5KCMA 3CO7C 1J09A 1V55H 1RI7A 3ZQIA 2DI3A 3CCSI 2KRCA 2M8EA 3F8MA 5E1XA 3IL2A 4P9FA 1X1BA 4L9JA 2RQPA 2LFBA 2LD5A 2XDVA 3BOQA 4EQQA 2VODA 3FXLA 1YS7A 3E97A 5FKOA 1QRYA 3VYSB 1APLC 3BR2A 2K4BA 3FMRA 2WADA 3E0JB 3SDGA 3BTIA 4A3DJ 1YE9A 2DMQA 5HNHA 1AWCA 3CP8A 1ZGWA 1Y39A 3OYLA 2Q2EA 1O57A 2HKXA 4EJTA 2QWWA 3ERED 5H6QA 2X48A 2LOOA 1TNSA 3OL4A 3SEQA 4I7HA 3ABKH 3A4CA 1JJ6C 3GMEA 1KU7A 4CZZA 1UAAA 3CUQA 1IF1A 3HZJA 2HI3A 3B6AA 2R7VA 4EEFG 1WJDA 4F7ZA 3OYJA 1MMNA 1V4RA 5E3MA 4KDPA 2E60A 4G9YA 3FXQA 4F92B 2XAHA 3JR9A 1D0ZA 4HOBA 3G6EI 3D5SC 2VONA 4HDUA 5KAIC 3Q3SA 4U0VA 5CPRB 2IS4A 3MKLA 1T95A 3WTVC 1EV7A 3CDIA 1WRJA 5DM7F 2IVMA 1HCRA 1USTA 3ISPA 2VPLA 3TDZC 2HOAA 3PM1A 1W0UA 1MH4A 2LY1A 3S8PA 1Z91A 5M3FJ 2CQ7A 4MGRA 1FSEA 5HS8A 3O2PE 1DPUA 2R7DA 3M3YJ 2TDXA 5CVUA 1NK2P 2DLLA 1B8IA 5D5XB 4LITA 1ETVA 3RIRA 5FGMA 4M74A 3CCRI 1ZK8A 1ACIA 2CMPA 1IXCA 3FXOA 4R8HA 1VQOI 1OR7A 3DXJF 4BE0A 1DDNA 2HZTA 3VPRA 2GA2A 3AFHA 1XCVA 5F27A 2DJIA 4XKWA 5J3LA 4C2TA 4O5VA 3V7RA 2WWYA 1FMWA 1MJAA 2JWTA 2RN7A 5CVJA 1N77A 4RGSA 4I76A 1JJ8C 2K9SA 2JZYA 1UG0A 3BJOA 3H5RA 2CV0A 4IHYA 1WH5A 3I9V2 2VJ5A 2VE9A 1J75A 3TW6A 2QQ9A 4B3AA 3FMQA 2WA0A 5FKKA 3EETA 1LFBA 1XGOA 2GXGA 1L3LA 2EFQA 1T8IA 1I6XA 1LDJA 4AD9A 2HOTA 4E7HA 3GZ5A 4YIRX 3JRGA 1ODDA 1PDNC 1RUOA 4JBAA 9ANTA 4V2GA 3LA3A 1IN8A 5B1AH 1R00A 5LGTA 1ZRCA 1KQ0A 3SQNA 1EH6A 1FPQA 1QZZA 2JVHA 4ZH4F 2BY0A 3GBGA 4ZYHA 1LDDA 1X2NA 4EJVA 4M73A 1K7AA 4EGZA 2D45A 3K2ZA 4Y15A 1TWCJ 2BEOA 3ZQCA 3DEWA 5JR3A 3ZQFA 4BY7J 4DOZA 3KYDB 1R4MB 3MWMA 2QENA 1IRGA 2CW7A 3A03A 4RAZA 2GBYA 2Q0OA 3QQAA 1IZ1A 1MBHA 1Z05A 4RB3C 1N78A 2W4SA 2QZ8A 4BDZA 1EF4A 1MJBA 1WJFA 2LMDA 4FQGA 4Y7NJ 1XSVA 4F3QA 3CJNA 1NHAA 3OYFA 4HX7A 5HODA 2Y2ZA 4NNJA 5KHDA 3HGYA 2BXZA 3FMSA 2ISZA 4QWQA 3OYBA 3MN2A 4BQQA 1OPCA 3HOTA 3K4LA 1O7FA 3BJAA 3E1SA 2KJCA 3VDXA 3WG7H 4ZDLA 2KQRA 4HV5A 3ZQLA 4GFBA 5E1ZB 4EV0A 4XOPA 2F48A 2M4KA 3ULQB 4NC7A 2Y0SN 1VQ8I 2JA5J 4AVPA 3K2AA 1ZG5A 3F8FA 3K4JA 2N8GA 2ZJPF 5E3OA 4PFOA 3ECOA 3CC7I 2VXDA 1WJBA 4G8XA 2DXIA 2AO9A 3QPLA 4V19K 4FX4A 2WC2A 5M5XJ 2LBFA 4CYDA 3GYHX 4E7JA 4BU2A 3VODA 4L9TA 2Z3YA 3HOSA 2VOPA 1X19A 1ENHA 1WCMJ 3BTCA 4IVNA 2LRDA 1IXSB 1FY7A 2NS0A 5GP9A 1SFKA 2IGOA 4A3CJ 3GTMJ 2W24A 1X3ZB 1ZARA 3Q0VA 1O7LA 1R5ID 1Z9CA 5DUIA 1WVRA 3VYTB 5GADJ 2V9VA 2DMUA 3ZMVA 2A61A 3HSEA 4IOCF 2QSFX 3O8HA 1R71A 1U9OA 2ISYA 4X1EA 2OTJI 5H6RA 1A6QA 3GZ6A 1XB4A 1YTYA 1FNNA 1WI3A 2PEXA 4BGDA 2GA1A 4OMZA 4UV9A 1EKEA 4XSZF 3OSGA 2IA1A 4DGWB 4E7ZA 2DW4A 2FMLA 2O61A 3A02A 3SZPA 3D0SA 3V8LA 1YLFA 1MBFA 1T56A 1IN4A 2KT0A 2DTRA 2XB0X 2MD0A 1DP3A 3CJRB 5J4YA 4ZTFA 2BW3B 5EYRA 2IGNA 4ZYAA 5L3FA 2J5PA 3IRRA 1UHSA 4BEHA 2K40A 2A69F 4E6KG 2UWMA 3BP8A 3JREA 1FSHA 2HXOA 3LFKA 4M3BA 4IHWA 1IN5A 1HSTA 2L02A 4ZJZA 1YJWI 4LOCA 3GTLJ 5IP7J 3DKYA 1HQCA 4HG2A 3COAC 3ABMH 5GTIC 3AL0C 1PJRA 2OCCH 1W0TA 2M30A 1T08B 1RR8C 3JAMK 2X4HA 3S2DJ 2OCEA 2A3SA 1YO5C 2HQNA 1B9NA 3BG3A 1BR2A 2DOAA 5DYMA 1T0FA 3R4KA 4L5JA 5D8LB 3W6JB 2MC4A 2OC6A 3BR3A 3FZVA
chains in the Genus database with same CATH topology
5FD5A 3D5LA 2HEOA 3K1NA 2E1CA 5K5OA 4I01A 3WTSC 3HHGA 2G9WA 4RGUA 4AIHA 3LA7A 1BI3A 1FP1D 4BHBA 4GYGA 2P5LC 2Z9OA 3WGGA 3Q9SA 1XSDA 2YX4A 2HS5A 4ETSA 1MGTA 1X3UA 4A12A 2XAGA 3ZPLA 3KZYA 1BC8C 4XLNF 4M72A 3GEZA 4UUVA 3KETA 2VT2A 1QNTA 1G4DA 4WCGA 4AIJA 4I0AA 5BPDA 4GO1A 3F8CA 3TO7A 4Q48A 2FXAA 4KMUX 3CUOA 2XROA 4DQ2A 1GXPA 1IN7A 3M8FA 4LG0A 4I0BA 1B4AA 3K69A 3WODF 2CSOA 2D2WA 1STZA 2KIMA 5ICFA 4GXOA 3EYYA 2MD5A 3GFIA 1ZGAA 5CLSA 4E70A 5LRSA 4S05A 3HYIA 2RGVA 4N0BA 2EB7A 4KMFA 1SMYF 4Q5SF 1FLIA 5ICEA 3MCZA 5KVRA 3VB2A 2Z99A 3SFZA 3NRVA 2P5KA 3U9GA 3J7AO 1T39A 1LDKB 4UVBA 2WTEA 1U5TA 5DCFA 4RS8A 4AIKA 3CO6C 5KK1A 1YFHA 5A2QZ 1IN6A 1R1UA 3EYIA 3IC7A 4KIBA 2BYVE 2G7UA 4G94A 2XGXA 2EFNA 4GGGA 4A0XA 2KIUA 2FBKA 2EV6A 5DCMA 3KLNA 3LQQA 3BPVA 5BMZA 1SFEA 1XDSA 2FBHA 1V3FA 2VT3A 4L9NA 1TQIA 2XAJA 2M45A 4HW0A 1ZN2A 3I58A 1HKSA 4WXHA 2ELHA 1P2FA 4ON0A 3F8NA 3QU3A 3IKVA 4B09A 5DD4A 3KP6A 2ESHA 2DAOA 3ELKA 4KUMA 2J5OA 1TW2A 5ERIA 3F72A 5L3DA 1ON2A 3DF8A 2XKPA 2L01A 4PDKA 2MH2A 1J9IA 5K1YA 3FF5A 3CDHA 5HLIA 1YW7A 4KNYA 2EJRA 5ICCA 4XBFA 3ZP5A 2HGCA 2LDUA 2Y0MA 1ZYRF 4JK1X 3NEUA 5D4SA 1R5GA 3Q9VA 5ILVA 3CUQC 3TOBA 1XD7A 1IRFA 4EM0B 2ZMEA 3P9KA 2UZKA 2ZKZA 2BV6A 2QM3A 3ZMUA 3I5UA 4HLXA 1YYVA 2FNAA 4LJZF 5D6EA 4P9UA 3L00A 3CUQB 2O6GE 1JGSA 4Y13A 5ED4A 4U88A 5E18F 3RI4A 1KU9A 3N4MA 1BI2A 5K5QA 2M87A 5CYVA 2GXBA 4BAYA 1BI0A 6PAXA 3DP7A 3LAPA 5LHGA 1PP8F 5ILUA 4KT5C 3TO9A 5HLGA 2OQRA 5LHIA 3DFGA 1UCRA 3FXUA 3F23A 2V1UA 5D5VB 3T5XA 2K4JA 2XASA 1LB2A 3U2RA 3T8TA 1XGSA 2YX7A 5F64A 2V1DA 4WX9A 3HRUA 5DEQA 2ACJA 2OU2A 4IHSA 1EH7A 1LQ1A 1FYKA 4UV8A 2OAZA 4WXDA 2C6YA 1FYLA 1U78A 4L0ZB 2F5DA 5L3GA 1K6OA 3HSRA 3DEUA 2PMUA 3ZMZA 3E6DA 4YG2F 3HRSA 2PBIA 3WTZA 4OOIA 1H9GA 3B73A 2GQQA 1P4XA 2EFOA 3E5UA 2EK5A 2FE3A 2YR2A 3ABTA 1HKQA 4G6DA 5LEKA 3WU1B 3C3WA 2K7LA 2E7WA 4R1HA 3RDIA 2PI0A 4HQMA 3L9FA 3KLOA 5EEHA 3K1PA 1S3JA 4OIQF 2MBFA 4HDVA 5LBQA 1GXQA 5DUKA 2PLYA 4IXAA 2RDPA 3QU6A 2KIFA 3WG9A 5DV5A 1R36A 3GXOA 3ROUA 4OIPF 2EV0A 1Q1HA 2CG4A 2EV5A 4YIIA 1DP7P 1RNLA 1BBYA 3RYRA 4YFNF 2CYYA 2HOEA 3WGHA 4L5IA 3WE2A 4N9HA 2R3SA 2OD5A 2ZXJA 4Z2YA 5LHHA 3C1DA 1O3QA 2H94A 1BJAA 2JPCA 4BQAA 3KP7A 1T98A 2HTSA 1REPC 2F5EA 2FBIA 1DUXC 2NNYA 2COMA 4Y17A 1R23A 2MLGA 1ON1A 2VXZA 3GX4X 2O03A 5LEJA 2V1XA 2PMHA 2KRFA 2F5FA 1AOYA 2Y75A 1YS6A 2FMYA 2VBWA 4KN4X 2VOOA 5HDNA 3MAJA 3DPTA 1R1VA 3VFZA 3KE2A 3G3ZA 3L2CA 1E17A 2YPRA 3P9IA 2XRNA 5E8IA 1BI1A 2QBYA 4HX8A 2JT1A 3C7JA 1FC3A 4HLYA 4CDGA 2FSWA 2XVCA 3BROA 4MTEA 1BC7C 2VBXA 2L4AA 2UXXA 2WV0A 1J5YA 3R60A 2XAQA 1R22A 2KJBA 4M9SA 1FT9A 2QQAA 1MZBA 3TQNA 2RVCA 2NYXA 2RV8A 2ADUA 3P7NA 4LGWA 4L0YB 3EQLF 3EUHA 5BS6A 2IA0A 2K27A 4ZZDA 4ENMA 4EGYA 3E6CC 3E5XA 2HWVA 4HF0A 1S7AA 5JFRA 3KEQA 3J80Z 2E7XA 5FO5A 1WI9A 3I71A 3SZTA 1QO0D 4U0YA 3FM3A 1T38A 4M71A 3FM5A 5LRRA 3ZMTA 1XSXA 2P7CB 4OIOF 5E1WA 4IRGA 1Y0UA 4ZZLA 2RC4A 4HZFA 1QPMA 4RB1A 2YU3A 2DQLA 2ZJ2A 3GO5A 4LG0B 3KP4A 4MQVA 4WK8F 1SFXA 3F6OA 1K78A 3SHFA 2DPDA 2H6CA 3LWFA 2XIGA 2PJPA 4TV7A 2L4MA 1ZH5A 5AONA 2IA2A 1W4MA 1G3WA 4FX0A 3JSPA 4P96A 1U5TC 2QUFA 2DQRA 3IWFA 3LQRA 2EFWA 2DT5A 4FT8A 4KICA 1FYMA 2R7FA 3MFKA 4UHTA 2A6EF 3IWZA 4XLPF 3TOAA 2HTJA 2LF8A 3I59B 1ZGJA 4PGHA 1IXRC 1U3EM 2GAUA 3CLOA 2JPBA 5HDKA 3I53A 5E8GA 4GYIA 2VE8A 1MD0A 5HOOA 4KA4A 4KFCA 2FEZA 1R7JA 3E5QA 3V4GA 4PCQA 4WF2A 5J8CA 2A6HF 1KGSA 1FWZA 4EM2A 5DCMB 4OU0A 4RAYA 3BPXA 1CF7B 1A04A 4M6XA 3QPTA 1P92A 4ZYEA 3LAJA 4LK1F 2RNJA 2A68F 2IW5A 4P55A 2F2EA 2ZNZA 3IKTA 1Z6TA 3HIFA 1WSUA 2CGPA 1ONVA 2NNNA 1MDMA 2DFIA 2CW0F 2QLZA 3JTHA 3PQKA 2B0LA 3RJPA 1XMKA 3DQVC 3J81K 2VBZA 2LKPA 1J2XA 1J0RA 2VC1A 1UHMA 1B9MA 4HAMA 4RGXA 4PGGA 5L3EA 1BIAA 2A07F 1ULYA 4NQWA 1HBXG 4ENJA 1B59A 3GWZA 4I02A 1FBSA 1GHCA 1OMIA 1T2KA 3E3VA 5FLXZ 4KIGA 4PZJA 5LGNA 2GIVA 1KQ8A 5J6XA 1QGPA 2ZNYA 2FQ3A 2Z33A 3LA2A 5D5WB 1KU3A 3GF2A 4MNUA 5A2QK 1LEAA 2ZMEB 4HYEA 1YG2A 1W7PD 1FZPB 2DK8A 3R61A 4YFKF 4BXUA 2CQKA 1UHWA 3L7WA 5CVIA 4CO8A 3WTTC 4EJUA 2OA4A 3ZN0A 1XMAA 2V6CA 2L54A 1JXSA 1OKRA 2QYOA 3JW4A 1IUYA 2PG4A 4L18B 2EWNA 2QQBA 3AAFA 5FFXA 5H20A 3GW2A 1OYWA 1TQPA 3HTSB 4KYWA 3H3UA 4M9XA 2P5VA 1ZLJA 2M1BA 4LLLA 4CGZA 1P6RA 5LGUA 4EMSA 3I4PA 2Z5UA 3ABUA 5L3CA 5IT9Z 4OIRF 4GCVA 2OZ6A 4XRFA 1O3SA 3U1DA 3RKYA 5HVQC 1U8RA 1G6NA 3EDPA 3NQOA 4ASNA 4FHTA 4Q4ZF 4BNCA 1IW7F 4LLNA 3E6BA 1SD7A 1W5SA 3N97A 2DO7A 4EM1A 1XCBA 4YIFA 5K5RA 1PUEE 3RKXA 5E17F 4LB5A 1YIOA 4NB5A 1H9TA 4N9IA 1R58A 4A6DA 2XAFA 2A5YB 1S6LA 1ZLKA 3JTGA 3RTRA 1F9NA 4MEXF 4UVCA 1TQMA 4A0ZA 2PFBA 3PQJA 4UVAA 1LNWA 1R1TA 3BY6A 3BWGA 5HDGA 1JE8A 3KEOA 5BPIA 2XV4S 2XKOA 5JVTA 4Q47A 3F22A 3HUGA 4A2UA 3FX3A 4U0WA 4A6EA 1PP7U 1UFMA 3V7SA 3O3KA 4I09A 2QVOA 1USSA 2E1NA 5FD6A 2LSOA 1ZHFA 1SD6A 1R5HA 3PFIA 4JQFA 1W7PA 5TRDA 1L0OC 4IPAA 4CXFA 1HSJA 4B8XA 4M9ZA 4UXNA 1ZREA 3G73A 2FNPA 1KYZA 3I0TA 5D5UB 5AIPA 2W57A 2GWRA 4EJWA 3F8BA 2D1HA 3RKWA 4ZYDA 4AWXB 1E2XA 4LMYA 4ESJA 1K79A 3FXRA 3V7CA 3WGIA 3K9TA 1TTYA 2IT0A 1BM9A 3H92A 3ZMDA 3KP3A 4RB2C 5ICGA 1DPRA 3QPHA 2IPQX 1YW8A 2P8TA 1TNTA 2IP2A 2JRTA 2FF4A 3M9AA 5BQTA 2RKHA 4EVIA 1VTNC 3RPQA 1QQIA 3QP6A 5JHUA 3MEXA 3T1BA 4M6YA 2MC3A 5FB2A 1ZRFA 1ZAOA 3KCCA 2Q8KA 2QBYB 1FX7A 5JI6A 3F6VA 2HQRA 1XGNA 3P9CA 3R6SA 5D8KB 2ZO4A 3KP5A 4HF2A 4OINF 4KN7X 1HW5A 2ZFWA 2H27A 1U2WA 4I98B 3GLXA 1KU2A 5CVRA 2O0YA 5AIQA 4D0PA 2EA4A 2LNBA 1D3YA 1BN5A 1W5TA 3DKWA 3IRQA 2FOKA 4LK0F 5E20A 4BHPA 2PN6A 2ZCWA 3WTWC 4S04A 4MQ9F 4G7OF 2BBYA 3MZHA 4RB0A 1FBQA 1LVAA 1ZRDA 2NRAC 3Q5FA 1QZYA 2IJLA 3RYPA 3F3XA 3ML6A 1T6SA 1FP2A 1TBXA 5HS9A 3MQ0A 1I1SA 1K78B 1HXDA 5F1RA 2STTA 1G3SA 2LF7A 3HRTA 3ZMSA 1U6GA 3L09A 4QLCU 2IRFG 1D5VA 5HS7A 1J59A 4HQEA 3C18A 4ZYGA 2HFHA 1KYWA 3MZYA 4R79A 3JAMZ 4MHGA 3H3ZA 3WE3A 3SXYA 3M7GA 4G7HF 2BE5F 2H09A 4G7ZF 2CO5A 2MLKA 1XN7A 2DU9A 3WU0A 2CWEA 5D4RA 3V8JA 2XUBA 4O6JA 2P6SA 4EJOA 4CHUA 2MH9A 1O3RA 3JSOA 5IT3A 4A5NA 3S2WA 3J80K 3TO6A 1JHFA 3HHHA 2XHKA 3FHZA 1KQ9A 4BYYA 4WWCA 4IRHA 3B02A 1FOKA 3BJ6A 5F6FA 3DV8A 2HDCA 3QP5A 3R0AA 1EH8A 1MDMB 4LLGF 2OBPA 1WKMA 3GFJA 2W84A 4XSXF 2K86A 3TGNA 4L9VA 3KP2A 4H0EA 3M1EA 1F4KA 4A0YA 4K2EA 1U5TB 3QAHA 3I64A 1P4WA 2DPUA 1RIOH 2NAZA 5TJJA 3ZQ7A 4IJAA 4P5OA 2HKOA 2KKOA 3K0LA 2BGCA 1MKMA 1XGMA 1LJ9A 3I54A 4WXCA 3R0JA 2G7HA 1JHHA 2O3FA 4YFXF 1D8JA 1I5ZA 4RGRA 3K1MA 3FWEA 3RPUA 3HTUA 2VBYA 3GFMA 1B1BA 5D6FA 4U7BA 3BZ6A 1OYIA 1Z6RA 1MJ9A 1F5TA 2P4WA 2UXNA 2OZUA 2FU4A 3DPLC 2FA5A 1S29A 4HBLA 4UNOA 4U7DA 1S8NA 2VN2A 5HLHA 4IRIA 2JSCA 1WWXA 3J81Z 5ILSA 1I1GA 4DNCA 3TKYA 1TLHB 2STWA 1G3TA 2EFPA 2W25A 2FRHA 3IHUA 2W85A 1S7OA 1LEBA 3GUDA 2L3DA 1BIBA 1HW1A 2H6BA 1YW9A 2HYGD 2YSRA 3I59A 1SD4A 3HSFA 3REOA 3TDUC 3LSTA 1B6AA 2P6TA 1QBJA 4ENNA 1BOAA 1OYYA 5BOXA 1I27A 2Y48A 2K02A 1CGPA 4MTDA 2MA3A 1TW3A 1FBUA 2ETHA 2HR3A 2O8XA 3KZZA 2AXLA 1CF7A 3O6BB 1ZG3A 4BHCA 4IHTA 3W6KB 5LLQA 1UB9A 4A5MA 5FLXK 3VEPA 3BDDA 3T8RA 2GZWA 1ZG1A 1F1ZA 4LFUA 4LB6B 4I2OA 3M8EA 4ENKA 5CJ9A 3OV8A 1J7KA 1SD5A 1P4AA 4HV6A 1RZ4A 5DDGA 3GVAA 2X0LA 2HYFA 1GVJA 2PQ8A 1O3TA 1YQAA 1XDUA 4HA8A 1KA8A 3QRFF 4OMYA 3ZN1A 2CFXA 1Z1DA 3KFWX 2DBBA 3T0YA 3E6MA 4MEYF 3WTUC 3GFLA 4CICA 4G6QA 2DK5A 1Z7UA 2F5CA 1D8KA 4ESBA 2ESNA 2P7VB 1SFUA 1W7PB 1IAWA 5CVVA 1C0WA 5IT9K 3VOEA 3WTYC 2ZBKA 2VC0A 1RUNA 4ESFA 2AS5F 2OQGA 2EA2A 2JTVA 3OOPA 5J8FA 2M5WA 2V79A 3HRMA 1HKTA 3WTXC 4NHJA 3V8KA 5EEGA 1HW2A 1G3YA 4LD5A 5L3BA 3ECHA 1H0MA 4KIFA 3CTAA 4HX4A 4BH9A 1SAXA 1WQ2A 3QOPA 4O3MA 5FFZA 4IF4A 3F21A 1SMTA 4HF1A 2D1VA 5DD8A 3CO7C 1RI7A 2DI3A 2M8EA 3F8MA 5E1XA 3IL2A 4P9FA 4L9JA 2RQPA 3BOQA 4EQQA 2VODA 1YS7A 3E97A 2K4BA 3FMRA 1AWCA 2Q2EA 1O57A 2HKXA 4EJTA 2QWWA 3ERED 5H6QA 1TNSA 4I7HA 1KU7A 4CZZA 3CUQA 1IF1A 4F7ZA 1V4RA 4KDPA 4G9YA 3FXQA 2XAHA 4HOBA 2VONA 4HDUA 4U0VA 3WTVC 1EV7A 1WRJA 2IVMA 1USTA 3ISPA 3TDZC 1Z91A 4MGRA 1FSEA 5HS8A 3O2PE 1DPUA 2R7DA 2TDXA 5CVUA 2DLLA 5D5XB 3RIRA 5FGMA 4M74A 1IXCA 4R8HA 1OR7A 3DXJF 1DDNA 2HZTA 2GA2A 1XCVA 4O5VA 3V7RA 2WWYA 1MJAA 2RN7A 5CVJA 4RGSA 2JZYA 3BJOA 2VE9A 1J75A 2QQ9A 3FMQA 3EETA 1XGOA 2GXGA 1L3LA 2EFQA 1I6XA 1LDJA 4AD9A 3GZ5A 1RUOA 1ODDA 1PDNC 4JBAA 3LA3A 1IN8A 1R00A 5LGTA 1ZRCA 1KQ0A 3SQNA 1EH6A 1FPQA 1QZZA 4ZH4F 4ZYHA 1LDDA 4EJVA 4M73A 1K7AA 4EGZA 2D45A 3K2ZA 4Y15A 2BEOA 5JR3A 3MWMA 2QENA 1IRGA 4RAZA 2Q0OA 1IZ1A 1Z05A 4RB3C 2QZ8A 1MJBA 1XSVA 3CJNA 1NHAA 4HX7A 3FMSA 2ISZA 4QWQA 1OPCA 3HOTA 1O7FA 3BJAA 2KJCA 4HV5A 5E1ZB 4EV0A 3ULQB 4AVPA 1ZG5A 3F8FA 3ECOA 4G8XA 4FX4A 2WC2A 3GYHX 4CYDA 2VOPA 3VODA 4L9TA 2Z3YA 3HOSA 4IVNA 1IXSB 1FY7A 2NS0A 2W24A 1ZARA 1O7LA 1Z9CA 5DUIA 2V9VA 3ZMVA 2A61A 3HSEA 2ISYA 5H6RA 3GZ6A 1XB4A 1YTYA 1FNNA 2PEXA 2GA1A 4OMZA 4UV9A 4XSZF 2IA1A 2DW4A 2FMLA 2O61A 3SZPA 3D0SA 3V8LA 1YLFA 1IN4A 2DTRA 5L3FA 2J5PA 3IRRA 2A69F 2UWMA 3BP8A 1FSHA 3LFKA 1IN5A 1HSTA 2L02A 3COAC 1HQCA 2M30A 3JAMK 2X4HA 2A3SA 1YO5C 2HQNA 1B9NA 5DYMA 1T0FA 3R4KA 4L5JA 5D8LB 3W6JB 3FZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FD5 A;  3D5L A;  2HEO A;  3K1N A;  2E1C A;  5K5O A;  4I01 A;  3WTS C;  3HHG A;  2G9W A;  4RGU A;  4AIH A;  3LA7 A;  1BI3 A;  1FP1 D;  4BHB A;  4GYG A;  2P5L C;  2Z9O A;  3WGG A;  3Q9S A;  1XSD A;  2YX4 A;  2HS5 A;  4ETS A;  1MGT A;  1X3U A;  4A12 A;  2XAG A;  3ZPL A;  3KZY A;  1BC8 C;  4XLN F;  4M72 A;  3GEZ A;  4UUV A;  3KET A;  2VT2 A;  1QNT A;  1G4D A;  4WCG A;  4AIJ A;  4I0A A;  5BPD A;  4GO1 A;  3F8C A;  3TO7 A;  4Q48 A;  2FXA A;  4KMU X;  3CUO A;  2XRO A;  4DQ2 A;  1GXP A;  1IN7 A;  3M8F A;  4LG0 A;  4I0B A;  1B4A A;  3K69 A;  3WOD F;  2CSO A;  2D2W A;  1STZ A;  2KIM A;  5ICF A;  4GXO A;  3EYY A;  2MD5 A;  3GFI A;  1ZGA A;  5CLS A;  4E70 A;  5LRS A;  4S05 A;  3HYI A;  2RGV A;  4N0B A;  2EB7 A;  4KMF A;  1SMY F;  4Q5S F;  1FLI A;  5ICE A;  3MCZ A;  5KVR A;  3VB2 A;  2Z99 A;  3SFZ A;  3NRV A;  2P5K A;  3U9G A;  3J7A O;  1T39 A;  1LDK B;  4UVB A;  2WTE A;  1U5T A;  5DCF A;  4RS8 A;  4AIK A;  3CO6 C;  5KK1 A;  1YFH A;  5A2Q Z;  1IN6 A;  1R1U A;  3EYI A;  3IC7 A;  4KIB A;  2BYV E;  2G7U A;  4G94 A;  2XGX A;  2EFN A;  4GGG A;  4A0X A;  2KIU A;  2FBK A;  2EV6 A;  5DCM A;  3KLN A;  3LQQ A;  3BPV A;  5BMZ A;  1SFE A;  1XDS A;  2FBH A;  1V3F A;  2VT3 A;  4L9N A;  1TQI A;  2XAJ A;  2M45 A;  4HW0 A;  1ZN2 A;  3I58 A;  1HKS A;  4WXH A;  2ELH A;  1P2F A;  4ON0 A;  3F8N A;  3QU3 A;  3IKV A;  4B09 A;  5DD4 A;  3KP6 A;  2ESH A;  2DAO A;  3ELK A;  4KUM A;  2J5O A;  1TW2 A;  5ERI A;  3F72 A;  5L3D A;  1ON2 A;  3DF8 A;  2XKP A;  2L01 A;  4PDK A;  2MH2 A;  1J9I A;  5K1Y A;  3FF5 A;  3CDH A;  5HLI A;  1YW7 A;  4KNY A;  2EJR A;  5ICC A;  4XBF A;  3ZP5 A;  2HGC A;  2LDU A;  2Y0M A;  1ZYR F;  4JK1 X;  3NEU A;  5D4S A;  1R5G A;  3Q9V A;  5ILV A;  3CUQ C;  3TOB A;  1XD7 A;  1IRF A;  4EM0 B;  2ZME A;  3P9K A;  2UZK A;  2ZKZ A;  2BV6 A;  2QM3 A;  3ZMU A;  3I5U A;  4HLX A;  1YYV A;  2FNA A;  4LJZ F;  5D6E A;  4P9U A;  3L00 A;  3CUQ B;  2O6G E;  1JGS A;  4Y13 A;  5ED4 A;  4U88 A;  5E18 F;  3RI4 A;  1KU9 A;  3N4M A;  1BI2 A;  5K5Q A;  2M87 A;  5CYV A;  2GXB A;  4BAY A;  1BI0 A;  6PAX A;  3DP7 A;  3LAP A;  5LHG A;  1PP8 F;  5ILU A;  4KT5 C;  3TO9 A;  5HLG A;  2OQR A;  5LHI A;  3DFG A;  1UCR A;  3FXU A;  3F23 A;  2V1U A;  5D5V B;  3T5X A;  2K4J A;  2XAS A;  1LB2 A;  3U2R A;  3T8T A;  1XGS A;  2YX7 A;  5F64 A;  2V1D A;  4WX9 A;  3HRU A;  5DEQ A;  2ACJ A;  2OU2 A;  4IHS A;  1EH7 A;  1LQ1 A;  1FYK A;  4UV8 A;  2OAZ A;  4WXD A;  2C6Y A;  1FYL A;  1U78 A;  4L0Z B;  2F5D A;  5L3G A;  1K6O A;  3HSR A;  3DEU A;  2PMU A;  3ZMZ A;  3E6D A;  4YG2 F;  3HRS A;  2PBI A;  3WTZ A;  4OOI A;  1H9G A;  3B73 A;  2GQQ A;  1P4X A;  2EFO A;  3E5U A;  2EK5 A;  2FE3 A;  2YR2 A;  3ABT A;  1HKQ A;  4G6D A;  5LEK A;  3WU1 B;  3C3W A;  2K7L A;  2E7W A;  4R1H A;  3RDI A;  2PI0 A;  4HQM A;  3L9F A;  3KLO A;  5EEH A;  3K1P A;  1S3J A;  4OIQ F;  2MBF A;  4HDV A;  5LBQ A;  1GXQ A;  5DUK A;  2PLY A;  4IXA A;  2RDP A;  3QU6 A;  2KIF A;  3WG9 A;  5DV5 A;  1R36 A;  3GXO A;  3ROU A;  4OIP F;  2EV0 A;  1Q1H A;  2CG4 A;  2EV5 A;  4YII A;  1DP7 P;  1RNL A;  1BBY A;  3RYR A;  4YFN F;  2CYY A;  2HOE A;  3WGH A;  4L5I A;  3WE2 A;  4N9H A;  2R3S A;  2OD5 A;  2ZXJ A;  4Z2Y A;  5LHH A;  3C1D A;  1O3Q A;  2H94 A;  1BJA A;  2JPC A;  4BQA A;  3KP7 A;  1T98 A;  2HTS A;  1REP C;  2F5E A;  2FBI A;  1DUX C;  2NNY A;  2COM A;  4Y17 A;  1R23 A;  2MLG A;  1ON1 A;  2VXZ A;  3GX4 X;  2O03 A;  5LEJ A;  2V1X A;  2PMH A;  2KRF A;  2F5F A;  1AOY A;  2Y75 A;  1YS6 A;  2FMY A;  2VBW A;  4KN4 X;  2VOO A;  5HDN A;  3MAJ A;  3DPT A;  1R1V A;  3VFZ A;  3KE2 A;  3G3Z A;  3L2C A;  1E17 A;  2YPR A;  3P9I A;  2XRN A;  5E8I A;  1BI1 A;  2QBY A;  4HX8 A;  2JT1 A;  3C7J A;  1FC3 A;  4HLY A;  4CDG A;  2FSW A;  2XVC A;  3BRO A;  4MTE A;  1BC7 C;  2VBX A;  2L4A A;  2UXX A;  2WV0 A;  1J5Y A;  3R60 A;  2XAQ A;  1R22 A;  2KJB A;  4M9S A;  1FT9 A;  2QQA A;  1MZB A;  3TQN A;  2RVC A;  2NYX A;  2RV8 A;  2ADU A;  3P7N A;  4LGW A;  4L0Y B;  3EQL F;  3EUH A;  5BS6 A;  2IA0 A;  2K27 A;  4ZZD A;  4ENM A;  4EGY A;  3E6C C;  3E5X A;  2HWV A;  4HF0 A;  1S7A A;  5JFR A;  3KEQ A;  3J80 Z;  2E7X A;  5FO5 A;  1WI9 A;  3I71 A;  3SZT A;  1QO0 D;  4U0Y A;  3FM3 A;  1T38 A;  4M71 A;  3FM5 A;  5LRR A;  3ZMT A;  1XSX A;  2P7C B;  4OIO F;  5E1W A;  4IRG A;  1Y0U A;  4ZZL A;  2RC4 A;  4HZF A;  1QPM A;  4RB1 A;  2YU3 A;  2DQL A;  2ZJ2 A;  3GO5 A;  4LG0 B;  3KP4 A;  4MQV A;  4WK8 F;  1SFX A;  3F6O A;  1K78 A;  3SHF A;  2DPD A;  2H6C A;  3LWF A;  2XIG A;  2PJP A;  4TV7 A;  2L4M A;  1ZH5 A;  5AON A;  2IA2 A;  1W4M A;  1G3W A;  4FX0 A;  3JSP A;  4P96 A;  1U5T C;  2QUF A;  2DQR A;  3IWF A;  3LQR A;  2EFW A;  2DT5 A;  4FT8 A;  4KIC A;  1FYM A;  2R7F A;  3MFK A;  4UHT A;  2A6E F;  3IWZ A;  4XLP F;  3TOA A;  2HTJ A;  2LF8 A;  3I59 B;  1ZGJ A;  4PGH A;  1IXR C;  1U3E M;  2GAU A;  3CLO A;  2JPB A;  5HDK A;  3I53 A;  5E8G A;  4GYI A;  2VE8 A;  1MD0 A;  5HOO A;  4KA4 A;  4KFC A;  2FEZ A;  1R7J A;  3E5Q A;  3V4G A;  4PCQ A;  4WF2 A;  5J8C A;  2A6H F;  1KGS A;  1FWZ A;  4EM2 A;  5DCM B;  4OU0 A;  4RAY A;  3BPX A;  1CF7 B;  1A04 A;  4M6X A;  3QPT A;  1P92 A;  4ZYE A;  3LAJ A;  4LK1 F;  2RNJ A;  2A68 F;  2IW5 A;  4P55 A;  2F2E A;  2ZNZ A;  3IKT A;  1Z6T A;  3HIF A;  1WSU A;  2CGP A;  1ONV A;  2NNN A;  1MDM A;  2DFI A;  2CW0 F;  2QLZ A;  3JTH A;  3PQK A;  2B0L A;  3RJP A;  1XMK A;  3DQV C;  3J81 K;  2VBZ A;  2LKP A;  1J2X A;  1J0R A;  2VC1 A;  1UHM A;  1B9M A;  4HAM A;  4RGX A;  4PGG A;  5L3E A;  1BIA A;  2A07 F;  1ULY A;  4NQW A;  1HBX G;  4ENJ A;  1B59 A;  3GWZ A;  4I02 A;  1FBS A;  1GHC A;  1OMI A;  1T2K A;  3E3V A;  5FLX Z;  4KIG A;  4PZJ A;  5LGN A;  2GIV A;  1KQ8 A;  5J6X A;  1QGP A;  2ZNY A;  2FQ3 A;  2Z33 A;  3LA2 A;  5D5W B;  1KU3 A;  3GF2 A;  4MNU A;  5A2Q K;  1LEA A;  2ZME B;  4HYE A;  1YG2 A;  1W7P D;  1FZP B;  2DK8 A;  3R61 A;  4YFK F;  4BXU A;  2CQK A;  1UHW A;  3L7W A;  5CVI A;  4CO8 A;  3WTT C;  4EJU A;  2OA4 A;  3ZN0 A;  1XMA A;  2V6C A;  2L54 A;  1JXS A;  1OKR A;  2QYO A;  3JW4 A;  1IUY A;  2PG4 A;  4L18 B;  2EWN A;  2QQB A;  3AAF A;  5FFX A;  5H20 A;  3GW2 A;  1OYW A;  1TQP A;  3HTS B;  4KYW A;  3H3U A;  4M9X A;  2P5V A;  1ZLJ A;  2M1B A;  4LLL A;  4CGZ A;  1P6R A;  5LGU A;  4EMS A;  3I4P A;  2Z5U A;  3ABU A;  5L3C A;  5IT9 Z;  4OIR F;  4GCV A;  2OZ6 A;  4XRF A;  1O3S A;  3U1D A;  3RKY A;  5HVQ C;  1U8R A;  1G6N A;  3EDP A;  3NQO A;  4ASN A;  4FHT A;  4Q4Z F;  4BNC A;  1IW7 F;  4LLN A;  3E6B A;  1SD7 A;  1W5S A;  3N97 A;  2DO7 A;  4EM1 A;  1XCB A;  4YIF A;  5K5R A;  1PUE E;  3RKX A;  5E17 F;  4LB5 A;  1YIO A;  4NB5 A;  1H9T A;  4N9I A;  1R58 A;  4A6D A;  2XAF A;  2A5Y B;  1S6L A;  1ZLK A;  3JTG A;  3RTR A;  1F9N A;  4MEX F;  4UVC A;  1TQM A;  4A0Z A;  2PFB A;  3PQJ A;  4UVA A;  1LNW A;  1R1T A;  3BY6 A;  3BWG A;  5HDG A;  1JE8 A;  3KEO A;  5BPI A;  2XV4 S;  2XKO A;  5JVT A;  4Q47 A;  3F22 A;  3HUG A;  4A2U A;  3FX3 A;  4U0W A;  4A6E A;  1PP7 U;  1UFM A;  3V7S A;  3O3K A;  4I09 A;  2QVO A;  1USS A;  2E1N A;  5FD6 A;  2LSO A;  1ZHF A;  1SD6 A;  1R5H A;  3PFI A;  4JQF A;  1W7P A;  5TRD A;  1L0O C;  4IPA A;  4CXF A;  1HSJ A;  4B8X A;  4M9Z A;  4UXN A;  1ZRE A;  3G73 A;  2FNP A;  1KYZ A;  3I0T A;  5D5U B;  5AIP A;  2W57 A;  2GWR A;  4EJW A;  3F8B A;  2D1H A;  3RKW A;  4ZYD A;  4AWX B;  1E2X A;  4LMY A;  4ESJ A;  1K79 A;  3FXR A;  3V7C A;  3WGI A;  3K9T A;  1TTY A;  2IT0 A;  1BM9 A;  3H92 A;  3ZMD A;  3KP3 A;  4RB2 C;  5ICG A;  1DPR A;  3QPH A;  2IPQ X;  1YW8 A;  2P8T A;  1TNT A;  2IP2 A;  2JRT A;  2FF4 A;  3M9A A;  5BQT A;  2RKH A;  4EVI A;  1VTN C;  3RPQ A;  1QQI A;  3QP6 A;  5JHU A;  3MEX A;  3T1B A;  4M6Y A;  2MC3 A;  5FB2 A;  1ZRF A;  1ZAO A;  3KCC A;  2Q8K A;  2QBY B;  1FX7 A;  5JI6 A;  3F6V A;  2HQR A;  1XGN A;  3P9C A;  3R6S A;  5D8K B;  2ZO4 A;  3KP5 A;  4HF2 A;  4OIN F;  4KN7 X;  1HW5 A;  2ZFW A;  2H27 A;  1U2W A;  4I98 B;  3GLX A;  1KU2 A;  5CVR A;  2O0Y A;  5AIQ A;  4D0P A;  2EA4 A;  2LNB A;  1D3Y A;  1BN5 A;  1W5T A;  3DKW A;  3IRQ A;  2FOK A;  4LK0 F;  5E20 A;  4BHP A;  2PN6 A;  2ZCW A;  3WTW C;  4S04 A;  4MQ9 F;  4G7O F;  2BBY A;  3MZH A;  4RB0 A;  1FBQ A;  1LVA A;  1ZRD A;  2NRA C;  3Q5F A;  1QZY A;  2IJL A;  3RYP A;  3F3X A;  3ML6 A;  1T6S A;  1FP2 A;  1TBX A;  5HS9 A;  3MQ0 A;  1I1S A;  1K78 B;  1HXD A;  5F1R A;  2STT A;  1G3S A;  2LF7 A;  3HRT A;  3ZMS A;  1U6G A;  3L09 A;  4QLC U;  2IRF G;  1D5V A;  5HS7 A;  1J59 A;  4HQE A;  3C18 A;  4ZYG A;  2HFH A;  1KYW A;  3MZY A;  4R79 A;  3JAM Z;  4MHG A;  3H3Z A;  3WE3 A;  3SXY A;  3M7G A;  4G7H F;  2BE5 F;  2H09 A;  4G7Z F;  2CO5 A;  2MLK A;  1XN7 A;  2DU9 A;  3WU0 A;  2CWE A;  5D4R A;  3V8J A;  2XUB A;  4O6J A;  2P6S A;  4EJO A;  4CHU A;  2MH9 A;  1O3R A;  3JSO A;  5IT3 A;  4A5N A;  3S2W A;  3J80 K;  3TO6 A;  1JHF A;  3HHH A;  2XHK A;  3FHZ A;  1KQ9 A;  4BYY A;  4WWC A;  4IRH A;  3B02 A;  1FOK A;  3BJ6 A;  5F6F A;  3DV8 A;  2HDC A;  3QP5 A;  3R0A A;  1EH8 A;  1MDM B;  4LLG F;  2OBP A;  1WKM A;  3GFJ A;  2W84 A;  4XSX F;  2K86 A;  3TGN A;  4L9V A;  3KP2 A;  4H0E A;  3M1E A;  1F4K A;  4A0Y A;  4K2E A;  1U5T B;  3QAH A;  3I64 A;  1P4W A;  2DPU A;  1RIO H;  2NAZ A;  5TJJ A;  3ZQ7 A;  4IJA A;  4P5O A;  2HKO A;  2KKO A;  3K0L A;  2BGC A;  1MKM A;  1XGM A;  1LJ9 A;  3I54 A;  4WXC A;  3R0J A;  2G7H A;  1JHH A;  2O3F A;  4YFX F;  1D8J A;  1I5Z A;  4RGR A;  3K1M A;  3FWE A;  3RPU A;  3HTU A;  2VBY A;  3GFM A;  1B1B A;  5D6F A;  4U7B A;  3BZ6 A;  1OYI A;  1Z6R A;  1MJ9 A;  1F5T A;  2P4W A;  2UXN A;  2OZU A;  2FU4 A;  3DPL C;  2FA5 A;  1S29 A;  4HBL A;  4UNO A;  4U7D A;  1S8N A;  2VN2 A;  5HLH A;  4IRI A;  2JSC A;  1WWX A;  3J81 Z;  5ILS A;  1I1G A;  4DNC A;  3TKY A;  1TLH B;  2STW A;  1G3T A;  2EFP A;  2W25 A;  2FRH A;  3IHU A;  2W85 A;  1S7O A;  1LEB A;  3GUD A;  2L3D A;  1BIB A;  1HW1 A;  2H6B A;  1YW9 A;  2HYG D;  2YSR A;  3I59 A;  1SD4 A;  3HSF A;  3REO A;  3TDU C;  3LST A;  1B6A A;  2P6T A;  1QBJ A;  4ENN A;  1BOA A;  1OYY A;  5BOX A;  1I27 A;  2Y48 A;  2K02 A;  1CGP A;  4MTD A;  2MA3 A;  1TW3 A;  1FBU A;  2ETH A;  2HR3 A;  2O8X A;  3KZZ A;  2AXL A;  1CF7 A;  3O6B B;  1ZG3 A;  4BHC A;  4IHT A;  3W6K B;  5LLQ A;  1UB9 A;  4A5M A;  5FLX K;  3VEP A;  3BDD A;  3T8R A;  2GZW A;  1ZG1 A;  1F1Z A;  4LFU A;  4LB6 B;  4I2O A;  3M8E A;  4ENK A;  5CJ9 A;  3OV8 A;  1J7K A;  1SD5 A;  1P4A A;  4HV6 A;  1RZ4 A;  5DDG A;  3GVA A;  2X0L A;  2HYF A;  1GVJ A;  2PQ8 A;  1O3T A;  1YQA A;  1XDU A;  4HA8 A;  1KA8 A;  3QRF F;  4OMY A;  3ZN1 A;  2CFX A;  1Z1D A;  3KFW X;  2DBB A;  3T0Y A;  3E6M A;  4MEY F;  3WTU C;  3GFL A;  4CIC A;  4G6Q A;  2DK5 A;  1Z7U A;  2F5C A;  1D8K A;  4ESB A;  2ESN A;  2P7V B;  1SFU A;  1W7P B;  1IAW A;  5CVV A;  1C0W A;  5IT9 K;  3VOE A;  3WTY C;  2ZBK A;  2VC0 A;  1RUN A;  4ESF A;  2AS5 F;  2OQG A;  2EA2 A;  2JTV A;  3OOP A;  5J8F A;  2M5W A;  2V79 A;  3HRM A;  1HKT A;  3WTX C;  4NHJ A;  3V8K A;  5EEG A;  1HW2 A;  1G3Y A;  4LD5 A;  5L3B A;  3ECH A;  1H0M A;  4KIF A;  3CTA A;  4HX4 A;  4BH9 A;  1SAX A;  1WQ2 A;  3QOP A;  4O3M A;  5FFZ A;  4IF4 A;  3F21 A;  1SMT A;  4HF1 A;  2D1V A;  5DD8 A;  3CO7 C;  1RI7 A;  2DI3 A;  2M8E A;  3F8M A;  5E1X A;  3IL2 A;  4P9F A;  4L9J A;  2RQP A;  3BOQ A;  4EQQ A;  2VOD A;  1YS7 A;  3E97 A;  2K4B A;  3FMR A;  1AWC A;  2Q2E A;  1O57 A;  2HKX A;  4EJT A;  2QWW A;  3ERE D;  5H6Q A;  1TNS A;  4I7H A;  1KU7 A;  4CZZ A;  3CUQ A;  1IF1 A;  4F7Z A;  1V4R A;  4KDP A;  4G9Y A;  3FXQ A;  2XAH A;  4HOB A;  2VON A;  4HDU A;  4U0V A;  3WTV C;  1EV7 A;  1WRJ A;  2IVM A;  1UST A;  3ISP A;  3TDZ C;  1Z91 A;  4MGR A;  1FSE A;  5HS8 A;  3O2P E;  1DPU A;  2R7D A;  2TDX A;  5CVU A;  2DLL A;  5D5X B;  3RIR A;  5FGM A;  4M74 A;  1IXC A;  4R8H A;  1OR7 A;  3DXJ F;  1DDN A;  2HZT A;  2GA2 A;  1XCV A;  4O5V A;  3V7R A;  2WWY A;  1MJA A;  2RN7 A;  5CVJ A;  4RGS A;  2JZY A;  3BJO A;  2VE9 A;  1J75 A;  2QQ9 A;  3FMQ A;  3EET A;  1XGO A;  2GXG A;  1L3L A;  2EFQ A;  1I6X A;  1LDJ A;  4AD9 A;  3GZ5 A;  1RUO A;  1ODD A;  1PDN C;  4JBA A;  3LA3 A;  1IN8 A;  1R00 A;  5LGT A;  1ZRC A;  1KQ0 A;  3SQN A;  1EH6 A;  1FPQ A;  1QZZ A;  4ZH4 F;  4ZYH A;  1LDD A;  4EJV A;  4M73 A;  1K7A A;  4EGZ A;  2D45 A;  3K2Z A;  4Y15 A;  2BEO A;  5JR3 A;  3MWM A;  2QEN A;  1IRG A;  4RAZ A;  2Q0O A;  1IZ1 A;  1Z05 A;  4RB3 C;  2QZ8 A;  1MJB A;  1XSV A;  3CJN A;  1NHA A;  4HX7 A;  3FMS A;  2ISZ A;  4QWQ A;  1OPC A;  3HOT A;  1O7F A;  3BJA A;  2KJC A;  4HV5 A;  5E1Z B;  4EV0 A;  3ULQ B;  4AVP A;  1ZG5 A;  3F8F A;  3ECO A;  4G8X A;  4FX4 A;  2WC2 A;  3GYH X;  4CYD A;  2VOP A;  3VOD A;  4L9T A;  2Z3Y A;  3HOS A;  4IVN A;  1IXS B;  1FY7 A;  2NS0 A;  2W24 A;  1ZAR A;  1O7L A;  1Z9C A;  5DUI A;  2V9V A;  3ZMV A;  2A61 A;  3HSE A;  2ISY A;  5H6R A;  3GZ6 A;  1XB4 A;  1YTY A;  1FNN A;  2PEX A;  2GA1 A;  4OMZ A;  4UV9 A;  4XSZ F;  2IA1 A;  2DW4 A;  2FML A;  2O61 A;  3SZP A;  3D0S A;  3V8L A;  1YLF A;  1IN4 A;  2DTR A;  5L3F A;  2J5P A;  3IRR A;  2A69 F;  2UWM A;  3BP8 A;  1FSH A;  3LFK A;  1IN5 A;  1HST A;  2L02 A;  3COA C;  1HQC A;  2M30 A;  3JAM K;  2X4H A;  2A3S A;  1YO5 C;  2HQN A;  1B9N A;  5DYM A;  1T0F A;  3R4K A;  4L5J A;  5D8L B;  3W6J B;  3FZV A; 
#chains in the Genus database with same CATH topology
 2MYS A;  3IH4 A;  5FD5 A;  3D5L A;  1YI2 I;  4CCL A;  3AL0 B;  1S72 I;  2HEO A;  4CYC A;  3K1N A;  4XLE A;  2E1C A;  5EEA A;  4BUP A;  3OYI A;  3QOE A;  5K5O A;  4I01 A;  3WTS C;  1D0X A;  3HHG A;  2G9W A;  3PIP F;  3DEE A;  4RGU A;  4AIH A;  3LA7 A;  3NWS A;  2GOM A;  1BI3 A;  2W00 A;  5EDN A;  2DFE A;  1FP1 D;  3CCY A;  2DMT A;  5EG0 A;  2QA4 I;  1FEX A;  4BHB A;  4GYG A;  1E3P A;  4H4K C;  2K3P A;  3JRA A;  4A3L J;  2P5L C;  2Z9O A;  4CH7 A;  3WGG A;  2HPM A;  3OOU A;  4IEJ A;  2IXS A;  4HNT A;  3Q9S A;  1XSD A;  1S7E A;  2R93 J;  3FIS A;  2XGD A;  2HS5 A;  2YX4 A;  3HG9 A;  1MGT A;  1X3U A;  4XN0 A;  2XAG A;  4ETS A;  1VZ0 A;  3PNV A;  3KZY A;  4A12 A;  3ZPL A;  3HOV J;  1POG A;  4IL6 C;  1BC8 C;  4XLN F;  3EUA A;  3FXM A;  3ASO H;  2KFD A;  3G1L A;  3GEZ A;  3QWL A;  2VPR A;  4M72 A;  4C9Y A;  4RDU A;  3KET A;  2VT2 A;  4S0H B;  1QNT A;  1G4D A;  4UUV A;  1F43 A;  4KIT B;  4XKV A;  4NC6 A;  2LYC A;  4BY1 J;  3OL3 A;  4WCG A;  4AIJ A;  1N25 A;  4I0A A;  2XPV A;  4XKC A;  3BQY A;  1DGR M;  4RBO A;  3W2W A;  5BPD A;  1WH7 A;  1RKT A;  4GO1 A;  3F8C A;  3TO7 A;  5FLM J;  4Q48 A;  3K7A J;  2UV1 A;  2XF5 A;  3AG2 H;  2FXA A;  3A2K A;  4KMU X;  3CUO A;  2XRO A;  2GM4 A;  3M07 A;  4DQ2 A;  1HOM A;  2NVY J;  1GXP A;  1V5F A;  1IN7 A;  3M8F A;  4I0B A;  4LG0 A;  4E7I A;  1B4A A;  3K69 A;  2O9L A;  3WOD F;  2JA7 J;  2WAQ A;  2GXA A;  2CSO A;  3HPG A;  2D2W A;  4A69 C;  3IV5 A;  4XL9 A;  1LE8 A;  1STZ A;  1BR4 A;  2KIM A;  5ICF A;  4GXO A;  3EYY A;  2MD5 A;  5IYB J;  2D5V A;  3HB9 A;  4JX6 A;  3GFI A;  1WJC A;  2M0C A;  4P1W A;  4J01 A;  1ZGA A;  5CLS A;  4E70 A;  5LRS A;  4S05 A;  2HU9 A;  1JGG A;  3HYI A;  2LH9 A;  2RGV A;  4CCJ A;  4DW6 A;  3OYA A;  4N0B A;  1A6I A;  2EB7 A;  2DA5 A;  4KMF A;  1SMY F;  2KIQ A;  4Q5S F;  2H1L A;  1FLI A;  4XM3 A;  1RPW A;  5ICE A;  3QYB A;  3MCZ A;  2MG4 A;  5KVR A;  2KZG A;  3VB2 A;  1IO2 A;  2V7F A;  2RAE A;  4B44 A;  3RSN A;  2Z99 A;  3SFZ A;  3L1P A;  4JOM A;  3NRV A;  2FQ4 A;  3OS1 A;  3JRD A;  3RZO J;  1R6R A;  2E19 A;  2P5K A;  2VUM J;  5C44 J;  3U9G A;  1ZEL A;  3J7A O;  4F93 B;  1T39 A;  1LDK B;  3OIQ A;  4UVB A;  2WTE A;  1U5T A;  5DCF A;  3AG1 H;  2ID6 A;  4RS8 A;  4AIK A;  3CO6 C;  2TRT A;  1VND A;  4LG3 A;  5KK1 A;  4PJL A;  5KNL A;  1YFH A;  3BC8 A;  5A2Q Z;  1SEU A;  3ESW B;  2ECC A;  1IN6 A;  1R1U A;  3LOC A;  3IC7 A;  3EYI A;  3DBH B;  4KIB A;  2BYV E;  5FKL A;  2G7U A;  3S1R J;  4G94 A;  2XGX A;  4IHV A;  2EFN A;  2VJJ A;  4GGG A;  4A0X A;  2R7W A;  3HOX J;  2DN0 A;  4PJ0 C;  2KIU A;  2FBK A;  2EV6 A;  2VL8 A;  3ZQG A;  5DCM A;  3KLN A;  3K6G A;  3LQQ A;  4AYB A;  2XSD C;  3BPV A;  2WB1 A;  5BMZ A;  2M4G A;  1D1A A;  1GV2 A;  1SFE A;  1XDS A;  2FBH A;  2Y9Z A;  1TT5 B;  2KP6 A;  1I50 J;  1V3F A;  1X4P A;  3L2U A;  1U8B A;  3OYD A;  2VT3 A;  1QVT A;  4L9N A;  1TQI A;  2XAJ A;  2M45 A;  4HW0 A;  2PJR A;  1ZN2 A;  2QKL B;  1Y6I A;  3I58 A;  1HKS A;  4AID A;  1IGN A;  4WXH A;  3HOW J;  2ELH A;  3GTP J;  1GT0 C;  1P2F A;  1Y8R B;  3OYH A;  4ON0 A;  3F8N A;  3QU3 A;  1MBG A;  5TGT A;  3PFY A;  3IKV A;  2VAS A;  4B09 A;  3HEF A;  5DD4 A;  1YHQ I;  1VQN I;  3KP6 A;  2ESH A;  2LKX A;  4RAF A;  2HXI A;  2NS8 A;  2DAO A;  2X6X A;  2XF7 A;  1WGX A;  3ELK A;  1X2M A;  4KUM A;  4MIM A;  4B4C A;  2J5O A;  2ICW G;  2H8R A;  2WY8 Q;  4JYK A;  1TW2 A;  2GLO A;  3U21 A;  5ERI A;  2Y31 A;  1MMS A;  1Z0X A;  3F72 A;  2DA2 A;  1ON2 A;  5L3D A;  3KX2 A;  5IOY A;  3DF8 A;  4XRS A;  1GUU A;  2XKP A;  2L01 A;  4A3E J;  3BZC A;  3MD2 A;  4PDK A;  2MH2 A;  3LFU A;  2EIJ H;  1SFO J;  1IDZ A;  1J9I A;  1MNE A;  3KEY A;  5K1Y A;  3M4O J;  3FF5 A;  1XX5 A;  3CDH A;  1YW7 A;  1K6Y A;  5HLI A;  4KNY A;  2EJR A;  3H9G A;  5ICC A;  1ZKG A;  4BE2 A;  3ZRG A;  3AKZ A;  4NDL A;  4XBF A;  2V9K A;  5E79 C;  1E3H A;  2HZD A;  2HGC A;  3ZP5 A;  1YIT I;  2LDU A;  2Y0M A;  1ETY A;  1X3W B;  1ZYR F;  2AXT C;  4JK1 X;  4IO9 F;  1LKX A;  2QSH X;  3NEU A;  2CS3 A;  5D4S A;  1R5G A;  3Q9V A;  5ILV A;  3CUQ C;  3TOB A;  1XD7 A;  2M34 A;  1IRF A;  4EM0 B;  4AUX A;  2ZME A;  2WBM A;  1X1D A;  3TW7 A;  4DZJ A;  2CUJ A;  3ONQ A;  3P9K A;  2B7E A;  2BOL A;  2ZKZ A;  5F1J A;  2UZK A;  2BV6 A;  2QM3 A;  3ZMU A;  3IP4 B;  1FOY A;  5B5E C;  3I5U A;  4HLX A;  1YYV A;  5IP6 A;  4YEJ A;  2R7U A;  2FNA A;  4JX4 A;  3M8J A;  4LJZ F;  3IUO A;  1JUP A;  5D6E A;  1RRJ A;  4P9U A;  3JRC A;  3L00 A;  2EZH A;  3EPZ A;  3FXK A;  3K70 C;  3CUQ B;  2L7Z A;  2EZL A;  4EAT A;  2O6G E;  2W48 A;  3VSL A;  1JGS A;  5K7F A;  4Y13 A;  3UR3 C;  5ED4 A;  1WHU A;  3OIO A;  3PNT A;  3H0G J;  4U88 A;  5CKT A;  3GLL A;  5E18 F;  3RI4 A;  1KU9 A;  3RZD J;  3N4M A;  1BI2 A;  3E7L A;  1OR7 C;  3ZXS A;  3GTO J;  5K5Q A;  2M87 A;  5CYV A;  1DU0 A;  3KIO A;  2HPI A;  2GXB A;  4BAY A;  3AG3 H;  1BI0 A;  1WFX A;  2H8W A;  2O7O A;  6PAX A;  1K4S A;  2XGC A;  2X1D A;  3DP7 A;  3GTK J;  4FE4 A;  5GAG J;  1MH3 A;  3LAP A;  5LHG A;  1PP8 F;  5ILU A;  4UUT A;  5M5W J;  3BR5 A;  4FTH A;  1B8I B;  2CQX A;  4KT5 C;  3TO9 A;  4MO7 A;  2OQR A;  5LHI A;  5HLG A;  1GLN A;  2CUE A;  2Z2S B;  1UCR A;  3BCB A;  3DFG A;  3LSR A;  3S3O A;  3FXU A;  3F23 A;  2V1U A;  5FKM A;  5D5V B;  3T5X A;  1OCT C;  1MND A;  3BLY A;  3CQZ J;  2K4J A;  2XAS A;  1LB2 A;  3U2R A;  4N4N B;  3T8T A;  1XGS A;  2JK3 A;  2YX7 A;  3C2H A;  2V1D A;  5F64 A;  4BJ6 C;  4WX9 A;  3HRU A;  5DEQ A;  2ACJ A;  3L2R A;  1X1C A;  2OU2 A;  4IHS A;  3S2H J;  3GZN B;  3HC7 A;  1EH7 A;  1Y0N A;  5M5Y J;  4D5F A;  1LQ1 A;  3HKZ N;  3I3L A;  3N05 A;  1FYK A;  4UV8 A;  2OAZ A;  4WXD A;  3RCO A;  2C6Y A;  1FYL A;  1U78 A;  4L0Z B;  2JA6 J;  2F5D A;  5L3G A;  1AU7 A;  2Z1D A;  3BR0 A;  4C30 A;  3OYE A;  1K6O A;  3HSR A;  3DEU A;  1RES A;  2LC2 A;  3OYC A;  1OCZ H;  2PMU A;  3ZMZ A;  3E6D A;  4YG2 F;  2DA1 A;  3HRS A;  3S14 J;  2DT7 B;  3PO2 J;  2PBI A;  2VJ4 A;  4A93 J;  3WTZ A;  4OOI A;  4DYC A;  1ETK A;  2EPF A;  1H9G A;  3B73 A;  1IJW C;  3PIO F;  2GQQ A;  3CLQ A;  4B3X A;  3DWL E;  1P4X A;  2EFO A;  3E5U A;  3J7Y J;  3QPS A;  2X51 A;  3L2Q A;  2EK5 A;  2FE3 A;  2YR2 A;  4XN3 A;  2JA8 J;  3ABT A;  1HA8 A;  3HBL A;  1HKQ A;  4G6D A;  3K4B A;  5LEK A;  3WU1 B;  1EA3 A;  1Y8Q B;  4XR6 A;  1HDP A;  3C3W A;  1OCR H;  2K7L A;  4XKB A;  4D5C A;  3OS2 A;  2NS7 A;  2E7W A;  4R1H A;  5TIS C;  4BAC A;  3RDI A;  2PI0 A;  4HQM A;  3L9F A;  2YU9 J;  3KLO A;  1ZR2 A;  2DOD A;  2R7O A;  2IS6 A;  4ANJ A;  2V6E A;  4Y52 J;  2JUG A;  3X2Q H;  1XS9 A;  3CJT B;  3CCU I;  5EEH A;  1W5C C;  2CH0 A;  3K1P A;  1S3J A;  2VLA A;  4OIQ F;  2MBF A;  1JTY A;  4HDV A;  3GTG J;  5LBQ A;  1TL8 A;  5JLW A;  1GXQ A;  3CMM A;  5DUK A;  2PLY A;  5J1Y A;  1YJN I;  4IXA A;  2RDP A;  1Z67 A;  2UUZ A;  3CDL A;  3QU6 A;  1I3Q J;  3CC2 I;  2KIF A;  3WG9 A;  5DV5 A;  2HQ5 A;  1R36 A;  3GXO A;  2K3F A;  3ROU A;  4OIP F;  2EV0 A;  4F55 A;  4M6V A;  1Q1H A;  2MW8 A;  2CG4 A;  4IX7 A;  2EV5 A;  4YII A;  3VYR B;  1DP7 P;  1RNL A;  2NOG A;  1BBY A;  2XRL A;  4A3G J;  3RYR A;  4DZP A;  3ABL H;  4MFE A;  4YFN F;  2LBF B;  2CYY A;  2HOE A;  3S16 J;  4A3B J;  3WGH A;  2XAU A;  4L5I A;  2VKE A;  4DBR A;  4CCN A;  1OCP A;  3IAM 2;  3WE2 A;  3CF5 F;  4CSW A;  3KYC B;  4N9H A;  1WJ5 A;  2R3S A;  2OD5 A;  2ZXJ A;  4Z2Y A;  2L9R A;  5LHH A;  3C1D A;  3J7A Y;  2ZXW H;  1BOB A;  3PSF A;  2BVM A;  1O3Q A;  2H94 A;  1BJA A;  2JPC A;  4XON A;  3KP7 A;  3W3C A;  4BQA A;  1GVD A;  1T98 A;  2HTS A;  1REP C;  2F5E A;  4QIW N;  4JP0 A;  2FBI A;  1DUX C;  3BR1 A;  2NNY A;  2COM A;  1A5J A;  1ETW A;  4Y17 A;  2XPW A;  1FOW A;  1R23 A;  2MLG A;  1ON1 A;  2VXZ A;  3BCA A;  5IP9 J;  3GX4 X;  3A0H C;  4KIS A;  2O03 A;  3S17 J;  3I4N J;  5LEJ A;  4RLQ A;  5F08 A;  2V1X A;  1R4N B;  4J19 A;  2F4I A;  2I8D A;  1MBK A;  2VQH A;  1T0F C;  2PMH A;  2KRF A;  2F5F A;  1MSE C;  1AOY A;  1TWF J;  2X9D A;  3JRH A;  1DGW Y;  2Y75 A;  1VI0 A;  4X6A J;  1YS6 A;  2FMY A;  2VBW A;  4KN4 X;  5HNF A;  5EGO B;  3ZQQ A;  1UJ8 A;  1UMQ A;  2FD5 A;  2VOO A;  5F0F A;  4II2 A;  5HDN A;  3MAJ A;  3DPT A;  5IY5 H;  1R1V A;  3VFZ A;  3KE2 A;  3G3Z A;  3L2C A;  4IOA F;  3WHC A;  1E17 A;  2W82 A;  2YPR A;  2KL4 A;  2JJ7 A;  5GPA A;  3P9I A;  1CQT A;  2VQL A;  2XRN A;  3HOY J;  5E8I A;  1U0J A;  1BI1 A;  2KPM A;  2QBY A;  2A5W A;  3TBI A;  4HX8 A;  2JT1 A;  2NVQ J;  3C7J A;  3CMA I;  1WJA A;  3CCJ I;  2LY9 A;  4C3J J;  3HDD A;  1FC3 A;  2DMP A;  2WAQ N;  2R7S A;  1FJL A;  1W36 D;  2QKM B;  2BZT A;  4HLY A;  4CDG A;  2FSW A;  2XVC A;  3BRO A;  4MTE A;  1BC7 C;  3TMO A;  2VBX A;  2L4A A;  4CYC B;  2UXX A;  1I3A A;  2WV0 A;  4BQN A;  1J5Y A;  3R60 A;  1VQ5 I;  2XAQ A;  3CF2 A;  1R22 A;  3F0C A;  4ZDP A;  2KJB A;  4M9S A;  1FT9 A;  2QQA A;  2ELJ A;  1MZB A;  3TQN A;  4G6T B;  4UUS A;  2RVC A;  3LNQ A;  2NYX A;  2RV8 A;  2ADU A;  3P7N A;  3PUB A;  1F36 A;  4LGW A;  3KYL A;  3ZCO A;  4L0Y B;  3EQL F;  3EUH A;  2E5Z A;  5BS6 A;  2IA0 A;  2K27 A;  3S32 A;  4ZZD A;  3GTJ J;  4ENM A;  5KAF C;  2EIL H;  4EGY A;  4PSX A;  3E6C C;  4A3J J;  4ABZ A;  2LY2 A;  3E5X A;  2HWV A;  5B1B H;  3WHB A;  2CV2 A;  4HF0 A;  1S7A A;  2QQ8 A;  5JFR A;  3KEQ A;  3J80 Z;  4BJ5 C;  3S3N A;  2E2I J;  2E7X A;  4W1U A;  5FO5 A;  3BG6 A;  1WI9 A;  3H1C A;  3I71 A;  3OY9 A;  3SZT A;  1QO0 D;  4U0Y A;  3FM3 A;  1T38 A;  4M71 A;  2VJI A;  4FIS A;  3FM5 A;  5LRR A;  4PJJ A;  5FLV A;  3ZMT A;  5HLT A;  1XSX A;  2CQN A;  2P7C B;  3PO3 J;  4OIO F;  3DU6 A;  4OAZ A;  4BJT A;  5E1W A;  4RLF A;  3HOU J;  4IRG A;  1Y0U A;  4ZZL A;  2RC4 A;  4HZF A;  3SEZ A;  1QPM A;  2GIZ A;  4RB1 A;  2YU3 A;  4IQ4 A;  2PX9 A;  2DQL A;  2R5Y B;  2BY3 A;  2ZJ2 A;  2KZV A;  3GO5 A;  5DM6 F;  4FCY A;  2NVX J;  4LG0 B;  3H5A A;  5IYD J;  3KP4 A;  4AYB N;  1NTC A;  4B47 A;  4MQV A;  2VB6 A;  4WK8 F;  2WB1 N;  1SFX A;  3F6O A;  1LE8 B;  4XIC A;  1K78 A;  3SHF A;  2DPD A;  2H6C A;  3LWF A;  2KMU A;  5JHF A;  2XIG A;  4AVZ A;  1JKR C;  2PJP A;  1MMD A;  2P81 A;  4TV7 A;  2L4M A;  1ZH5 A;  5AON A;  2L7K A;  4BS9 A;  2IA2 A;  1W4M A;  1I6H J;  1G3W A;  4FX0 A;  3JSP A;  2JVG A;  4YRV A;  4LIU A;  4P96 A;  1U5T C;  2ZJQ F;  3SDB A;  1TT0 A;  2QUF A;  1UEL B;  2LTP A;  2O5R A;  3BG9 A;  3K4M A;  3DKX A;  2DQR A;  2CJJ A;  5EZH A;  1Y1W J;  3IWF A;  3LQR A;  4RMN A;  2EFW A;  2DT5 A;  4FT8 A;  4KIC A;  1FYM A;  2R7F A;  3MFK A;  4GRI A;  1VQ9 I;  2L7F P;  2L7M P;  4UHT A;  2A6E F;  1IUF A;  3IWZ A;  4XLP F;  3TOA A;  4U87 A;  2A05 A;  2HTJ A;  2LF8 A;  3H5N A;  3LL7 A;  3I59 B;  1QU3 A;  1ZGJ A;  1QHG A;  4PGH A;  3A01 A;  1IXR C;  5J40 A;  1U3E M;  1GDT A;  2GAU A;  2P0W A;  2R7Z J;  3CLO A;  2JPB A;  5HDK A;  4E7K A;  3I53 A;  2TCT A;  5E8G A;  4GYI A;  3TP3 A;  2VE8 A;  1G8X A;  1MD0 A;  5HOO A;  4KA4 A;  1MIJ A;  4KFC A;  2FEZ A;  1R7J A;  3E5Q A;  1ETO A;  3V4G A;  4PCQ A;  3I4M J;  2EBI A;  2HYJ A;  2JN6 A;  1NG6 A;  4WF2 A;  5J8C A;  2A6H F;  4RAG A;  1HLV A;  3H9J A;  1KGS A;  1FWZ A;  4EM2 A;  5DCM B;  3W6V A;  4OU0 A;  5J1U A;  2MSY A;  4RAY A;  3BPX A;  5C3E J;  1CF7 B;  2E71 A;  1A04 A;  4M6X A;  3QPT A;  2E36 A;  1P92 A;  4F91 B;  1XTA A;  5J4V A;  4ZYE A;  1TWA J;  1IG7 A;  3LAJ A;  4LK1 F;  2PJR B;  4QSH A;  2RNJ A;  2A68 F;  2NOJ B;  4DYQ A;  2IW5 A;  5FJ8 J;  4P55 A;  1OFC X;  4A3M J;  1AKH A;  1GV5 A;  2F2E A;  2ZNZ A;  3FK7 A;  3IKT A;  3A1Y A;  2X85 A;  1Z6T A;  3HIF A;  1TP4 A;  2ELK A;  1WSU A;  2CGP A;  1ONV A;  2NNN A;  4V2F A;  2NVU B;  2GOX B;  1RC9 A;  5DS9 A;  1MDM A;  2BHZ A;  2ZXH A;  1XMX A;  2DFI A;  1OCC H;  2CW0 F;  4XRM A;  2E1M C;  2DDA A;  4PFP A;  3FK6 A;  2QLZ A;  3JTH A;  2X1E A;  3PQK A;  2B0L A;  3RJP A;  1XMK A;  3DQV C;  3LSH A;  3G2B A;  3GTQ J;  1NG7 A;  3J81 K;  2VBZ A;  2LKP A;  3L2V A;  1J2X A;  1J0R A;  2VC1 A;  1UHM A;  1B9M A;  4HAM A;  4RGX A;  4PGG A;  5CQE A;  1SAU A;  5F04 A;  5L3E A;  3DCF A;  1YRN A;  1TWH J;  4X0G A;  1WJE A;  2BXY A;  1BIA A;  2A07 F;  2BY2 A;  1XPX A;  2R7Q A;  1ULY A;  4NQW A;  1HBX G;  2ZME C;  3CCQ I;  4ENJ A;  1ZR4 A;  1ETX A;  3VYU B;  1I39 A;  4UB6 C;  1B59 A;  3GWZ A;  3BR6 A;  4I02 A;  1FBS A;  3S1M J;  2K9Q A;  3K4C A;  1G59 A;  2WAE A;  2R4G A;  3RQI A;  1GHC A;  2R7X A;  1OMI A;  1Y56 A;  1T2K A;  4IKF A;  1SAN A;  1G2H A;  3E3V A;  5FLX Z;  2M2E A;  4KIG A;  4PZJ A;  2MFZ A;  4MFD A;  5LGN A;  2EQR A;  5FRO A;  1XG1 A;  2GIV A;  1YX5 A;  1KQ8 A;  5E3N A;  5J6X A;  1QGP A;  1FTT A;  2ZNY A;  5GAE J;  2FQ3 A;  3LA2 A;  5D5W B;  2Z33 A;  2L2O A;  1KU3 A;  3GF2 A;  4MNU A;  1X58 A;  5A2Q K;  2ZME B;  1LEA A;  1R9T J;  4HYE A;  1YG2 A;  3VSK A;  2B63 J;  2VQC A;  4XK4 A;  1W7P D;  4PUS A;  3S3M A;  2DK8 A;  2EIM H;  3P5J A;  3R61 A;  4YFK F;  4BXU A;  1FZP B;  2ZB9 A;  1H88 C;  2CQK A;  2OV7 A;  2IAI A;  1OIS A;  1UHW A;  5IOZ A;  3L7W A;  4XID A;  2MGQ A;  5CVI A;  2XC7 A;  4CO8 A;  2EZI A;  3WTT C;  1VQP I;  2IGM A;  4EJU A;  2OA4 A;  1T33 A;  3ZN0 A;  1D0Y A;  1XMA A;  2V6C A;  4AU7 A;  4ZC3 A;  3BG7 A;  1X1P A;  2HVR A;  2L54 A;  1JXS A;  1OKR A;  3F9K A;  4AM3 A;  2R5Z A;  2QYO A;  3JW4 A;  1IUY A;  3PL8 A;  3W2A A;  2PG4 A;  3MZ8 A;  4L18 B;  2EWN A;  2KIS A;  2QQB A;  3AAF A;  1FTZ A;  5FFX A;  5H20 A;  3GW2 A;  1SVO A;  4BDY A;  2KHM A;  4PK4 A;  1PUF A;  1OYW A;  1TQP A;  2F5V A;  1P7J A;  3HTS B;  4PJN A;  4D7M A;  2VI6 A;  3H3U A;  3LSP A;  4KYW A;  4M9X A;  1VFC A;  2P5V A;  1ZLJ A;  2M8G X;  4HST A;  3OIP A;  2M1B A;  4LLL A;  3LSM A;  4CGZ A;  1P6R A;  5LGU A;  3BQZ A;  1LFU P;  4EMS A;  1B72 A;  3I4P A;  5F0H A;  2Z5U A;  3ABU A;  4B48 A;  5L3C A;  3K70 D;  5IT9 Z;  1DQU A;  3DBR B;  4OIR F;  2L9N A;  5GTH C;  4GCV A;  2CUF A;  2OZ6 A;  1VF9 A;  2F4O B;  4BBS J;  4ZDO A;  4XRF A;  1O3S A;  3U1D A;  2M7B A;  4C2M J;  3RKY A;  1MSF C;  5HVQ C;  1U8R A;  1TC3 C;  1G6N A;  3IH2 A;  3EDP A;  3NQO A;  5GAH J;  2HDD A;  4ASN A;  4FHT A;  4Q4Z F;  2Q2E B;  4BNC A;  1IW7 F;  1JKQ C;  2FJ1 A;  4LLN A;  1BW5 A;  1S9H A;  3E6B A;  1K83 J;  1SD7 A;  3OYM A;  3JCU C;  1W5S A;  3MVP A;  3D1N I;  2VKH A;  1JT0 A;  3N97 A;  2M0M A;  5IPA A;  1BL0 A;  4N4O B;  2QGU A;  2DO7 A;  4I6Z A;  2A6T A;  5GPC A;  1H89 C;  1MW7 A;  5EJC A;  4EM1 A;  2DFF A;  1XCB A;  3PUF A;  4YIF A;  2M9H A;  2OJE D;  3NWT A;  5K5R A;  3ZQH A;  1PUE E;  1V5G A;  3HM5 A;  3RKX A;  4LB5 A;  5B3S H;  5E17 F;  1MBJ A;  4YEL A;  3OMY A;  1YIO A;  4NB5 A;  1H9T A;  4N9I A;  1VQ6 I;  1R58 A;  4A6D A;  2XAF A;  2A5Y B;  1Z3Y A;  1S6L A;  1ZLK A;  3JTG A;  3RTR A;  1QA6 A;  1F9N A;  1SVL A;  4QPO A;  4MEX F;  2O8K A;  1N75 A;  4UVC A;  4DJA A;  1TQM A;  1LFP A;  4A0Z A;  2PFB A;  1RKW A;  3PQJ A;  4UVA A;  3Q0W A;  1LNW A;  1MBE A;  4BXX J;  2HDW A;  1R1T A;  3BY6 A;  3MKZ A;  3BWG A;  4A3I J;  5HDG A;  1JE8 A;  3KEO A;  5BPI A;  2XV4 S;  2XKO A;  2XGE A;  5JVT A;  4XQF A;  4HNU A;  1AHD P;  4Q47 A;  1QZE A;  3HUG A;  4A2U A;  3F22 A;  3FX3 A;  4U0W A;  4A6E A;  1PP7 U;  1UFM A;  3V7S A;  3I56 I;  3O3K A;  4I09 A;  2QVO A;  5K7H A;  1USS A;  2E1N A;  5FD6 A;  2CV1 A;  1RR7 A;  2LSO A;  3FHN A;  2VKD A;  1ZHF A;  1SD6 A;  3D5R C;  3QYF A;  4XNF A;  1R5H A;  1VQL I;  3PFI A;  1MMA A;  2NVT J;  4JQF A;  5LD2 C;  1W7P A;  2ZSI B;  5TRD A;  2E2H J;  1UZC A;  1L0O C;  3CCE I;  4HSR A;  2I5U A;  1HSJ A;  4IPA A;  4M3D A;  4M9Z A;  2LLK A;  1OQY A;  4AC0 A;  4B8X A;  4CXF A;  3JRB A;  1OJL A;  4UXN A;  1JKO C;  1ZRE A;  4IHX A;  1JT6 A;  3WU2 C;  3G73 A;  1K4T A;  2QEX I;  2FNP A;  1KYZ A;  3I0T A;  5D5U B;  5AIP A;  2ZXI A;  3SYT A;  2DMN A;  2OTL I;  4C2U A;  2HQA A;  2W57 A;  2GWR A;  4NUB A;  4EJW A;  1JUS A;  3F8B A;  2D1H A;  3RKW A;  1BR1 A;  5IYC J;  4ZYD A;  1TZL A;  2LP0 A;  1E2X A;  2LK2 A;  2V4J C;  4LMY A;  4AWX B;  4ESJ A;  1K79 A;  3FXR A;  1A36 A;  3V7C A;  2OF7 A;  3WGI A;  1Y1V J;  3K9T A;  1TTY A;  2IT0 A;  1BM9 A;  3H92 A;  2CQQ A;  3ZMD A;  4NBQ A;  1QPI A;  3ASN H;  1KON A;  1X4O A;  3I55 I;  3KP3 A;  4RB2 C;  2E1O A;  5ICG A;  1DPR A;  1P9Q C;  3QPH A;  4D1Q A;  2IPQ X;  1YW8 A;  5FKN A;  2CFO A;  2P8T A;  1TNT A;  2PMZ A;  2VQG A;  2IP2 A;  1OLT A;  2DTZ A;  2JRT A;  2FF4 A;  3M9A A;  1ZQ3 P;  4RM3 A;  5BQT A;  2RKH A;  4EVI A;  2ZC2 A;  1VTN C;  4XLF A;  2V1N A;  3RPQ A;  4OAY A;  1QQI A;  3QP6 A;  5JHU A;  3FXJ A;  3LSJ A;  3MEX A;  5FRN A;  4E7S A;  4E7L A;  3AG4 H;  3T1B A;  4M6Y A;  2MC3 A;  5FB2 A;  1ZRF A;  1ZAO A;  2K85 A;  4JX5 A;  3KCC A;  2L5Q A;  3BTJ A;  3TED A;  1D5Y A;  2Q8K A;  2QBY B;  1FX7 A;  5JI6 A;  2IS1 A;  1E0E A;  3F6V A;  2DOF A;  2HQR A;  2BY1 A;  4BKX A;  3EUH C;  1XGN A;  3S15 J;  2IBD A;  4B1R A;  3P9C A;  3R6S A;  5D8K B;  1ETQ A;  2ZO4 A;  3KP5 A;  1IV6 A;  1V54 H;  3HJE A;  3ZOB A;  4OIN F;  4HF2 A;  3C2G A;  4KN7 X;  1VQ4 I;  1HW5 A;  4E4H A;  1YJ9 I;  4A3K J;  3J7Z I;  2RQQ A;  3NAR A;  5JVG F;  2ZFW A;  2H27 A;  4UUS B;  4KT6 A;  1U2W A;  2DYR H;  4I98 B;  4XRS G;  3ZR8 X;  3GLX A;  1KU2 A;  5CVR A;  2O0Y A;  3G1O A;  5AIQ A;  4D0P A;  2EA4 A;  2LNB A;  3DLL F;  4M3F A;  1D3Y A;  1D1C A;  1BN5 A;  1IRZ A;  4BEH B;  4FAS D;  4BQO A;  2X6O A;  1P7I A;  4BE1 A;  1MMG A;  1S5L C;  3VWB A;  4OWR B;  4XOT A;  4XLH A;  2X6Y A;  1W5T A;  3DKW A;  1ZTR A;  2V9P A;  3IRQ A;  2FOK A;  4LK0 F;  5E20 A;  3CCV I;  3CC4 I;  3FDY A;  4BHP A;  2L9V A;  2PN6 A;  2ZCW A;  3ERM A;  3FKJ A;  5EZG A;  4LIV A;  3WTW C;  3BTL A;  2E5N A;  2LKS A;  4S04 A;  4MQ9 F;  1Z77 A;  1ORK A;  3DTI A;  2R7R A;  4G7O F;  2BBY A;  3MZH A;  3JRI A;  2XPU A;  2F6C A;  4RB0 A;  1FBQ A;  4MLO A;  1LVA A;  3IAS 2;  1ZRD A;  5DTD A;  3RPU D;  3G71 I;  5E3L A;  4J00 A;  2NRA C;  3K4K A;  3Q5F A;  2XSJ C;  2JSP A;  1QZY A;  3HKZ A;  2IJL A;  2HOS A;  4HRI A;  3RYP A;  3F3X A;  3ML6 A;  2AQF A;  3S1N J;  3OS0 A;  1T6S A;  1FP2 A;  1TBX A;  5HS9 A;  1O4X A;  3MQ0 A;  2R92 J;  1I1S A;  1K78 B;  1OCO H;  1HXD A;  5F1R A;  2STT A;  2WY7 Q;  1G3S A;  2LF7 A;  3C2B A;  1QVU A;  1HDD C;  4CCO A;  3ZGK A;  3DU5 A;  3HRT A;  3ZMS A;  3S1Q J;  1U6G A;  4DBQ A;  3L09 A;  1M1E B;  2LR8 A;  2HVQ A;  4QLC U;  5EG0 B;  5LFA A;  2MAB A;  3OYG A;  2IRF G;  1BA5 A;  1D5V A;  2HVS A;  2X6W A;  1LVK A;  5HS7 A;  1J59 A;  4HQE A;  3C18 A;  3EUK L;  2I10 A;  3H9Q A;  4ZYG A;  1PVE A;  2AHQ A;  2HFH A;  3K4N A;  1YOV B;  3CMY A;  1KYW A;  2X1C A;  2ZSH B;  3LMM A;  3MZY A;  4R79 A;  2IEK A;  4XLC A;  2DOE A;  3JAM Z;  5J47 A;  4MHG A;  3H3Z A;  3WE3 A;  3SXY A;  1AA7 A;  2BVL A;  3M7G A;  4G7H F;  2BE5 F;  2H09 A;  4G7Z F;  2DYS H;  3A01 B;  2KDO A;  2CO5 A;  4W97 A;  2MLK A;  1SVM A;  3DLA A;  3G1M A;  1XN7 A;  2LRE A;  2DU9 A;  3WU0 A;  3HL2 A;  2CWE A;  4RA2 A;  5D4R A;  4UY8 I;  3V8J A;  5EGO A;  2XUB A;  3TP0 A;  1UG2 A;  2KLO A;  4O6J A;  1W36 C;  2P6S A;  4EJO A;  3OR2 C;  4CHU A;  2MH9 A;  3V42 A;  5H2F C;  1O3R A;  2CUZ A;  4Y33 A;  5J1R A;  1LPQ A;  3JSO A;  4I99 C;  2HNH A;  2CU7 A;  4QTR A;  5IT3 A;  4A5N A;  3S2W A;  3K10 A;  2COB A;  2L9S A;  3LSK A;  3M1C A;  3J80 K;  3TO6 A;  1JHF A;  4FET A;  1HF0 A;  3HHH A;  2XHK A;  3HGG A;  3MKY B;  3A0B C;  3FHZ A;  1KQ9 A;  1JI8 A;  3RQ4 A;  4BYY A;  2YUS A;  4WWC A;  1IC8 A;  2QF7 A;  3PNY A;  1JUM A;  4IRH A;  3B02 A;  4Z6Y A;  1H8A C;  2JMW A;  1AKH B;  1FOK A;  3BJ6 A;  5F6F A;  3DV8 A;  1R49 A;  2HDC A;  4II3 A;  3QP5 A;  2JUC A;  3R0A A;  2QSG X;  3MMY B;  5JLX A;  4IZZ A;  4ITV A;  4CCK A;  1EH8 A;  1A35 A;  5C4J J;  2EZK A;  3H0D A;  1TWG J;  1U9N A;  1MDM B;  4LLG F;  3U1K A;  4CUG A;  2OBP A;  1WKM A;  3GFJ A;  2W84 A;  3Q0U A;  3PJR A;  4XSX F;  4DIQ A;  2K86 A;  3TGN A;  4L9V A;  3KP2 A;  3QYE A;  2BW3 A;  3FBN B;  4H0E A;  1YX3 A;  2JA2 A;  1Z7L A;  3M1E A;  1F4K A;  2ME6 A;  4A0Y A;  2E34 A;  4K2E A;  1U5T B;  2ZFU A;  3QAH A;  4D9J A;  3I64 A;  3BT9 A;  4CZC A;  3CCL I;  1P4W A;  2FX0 A;  4NC8 A;  2DPU A;  1RIO H;  2NAZ A;  5TJJ A;  3ZQ7 A;  4IJA A;  1YRN B;  3RKQ A;  4P5O A;  3KPH A;  2HKO A;  2KRH A;  1A31 A;  2KKO A;  3K0L A;  3SZG A;  1W1W E;  5BNG A;  2BGC A;  1MKM A;  1XGM A;  4NQW B;  1LJ9 A;  5K7Z A;  2Y0S A;  3I54 A;  1FMV A;  3MKW B;  4WXC A;  3R0J A;  2G7H A;  3DBL B;  2CRG A;  2QCO A;  1JHH A;  2O3F A;  4YFX F;  2DA4 A;  1QHH D;  2DJN A;  1D8J A;  1I5Z A;  4RGR A;  3K1M A;  3FWE A;  3RPU A;  4FE7 A;  3HTU A;  2EH3 A;  3CCM I;  2VBY A;  3GFM A;  1B1B A;  5D6F A;  4U7B A;  3SJM A;  1JTX A;  3BZ6 A;  1OYI A;  1Z6R A;  2V26 A;  3BZK A;  1MJ9 A;  1F5T A;  2P4W A;  2UXN A;  3LSI A;  2DA6 A;  2R5Y A;  2BHY A;  2OZU A;  3B6C A;  2R0Q C;  1ERD A;  2FU4 A;  3DPL C;  2FA5 A;  1S29 A;  2RRE A;  3NAU A;  4HBL A;  3CME I;  4UNO A;  4U7D A;  2W7N A;  2ME0 A;  1S8N A;  1IV8 A;  2VN2 A;  5HLH A;  4IRI A;  2EIN H;  2JSC A;  1FIP A;  1WWX A;  3J81 Z;  3G4S I;  5ILS A;  1I1G A;  4DNC A;  3TKY A;  1TLH B;  2STW A;  1G3T A;  3OSF A;  3CJQ B;  2EFP A;  2W25 A;  2ZJR F;  2FRH A;  3IHU A;  2W85 A;  1BJZ A;  4Y4R A;  2FUG 2;  1S7O A;  2M7A A;  1JKP C;  2G0E A;  3GUD A;  1NH3 A;  1VQK I;  1LEB A;  4XMY A;  2L3D A;  1BIB A;  3FIW A;  1HW1 A;  2Y9Y A;  3DTE A;  4KJZ A;  2R5Z B;  3QOD A;  2H6B A;  4DYR A;  1YW9 A;  2HYG D;  1WZ2 A;  2YSR A;  3I59 A;  1SD4 A;  3HSF A;  3REO A;  3TDU C;  3LST A;  1IDY A;  1PUF B;  3OYN A;  2E1M B;  2OPT A;  1B6A A;  4M3G A;  2XF6 A;  4IQJ A;  2P6T A;  1QBJ A;  1Z3X A;  2NXN B;  2YS9 A;  4ENN A;  1BOA A;  2XB5 A;  3H36 A;  3HXL A;  1OYY A;  5FRM A;  4HNV A;  5BOX A;  1B72 B;  2Y69 H;  2WAF A;  1I27 A;  3OYK A;  1X1A A;  1EJ9 A;  2Y48 A;  2K02 A;  1K61 A;  1CGP A;  4MTD A;  2MA3 A;  1TW3 A;  1FBU A;  2ETH A;  2R7T A;  2HR3 A;  2O8X A;  3W2V A;  3KZZ A;  2DA3 A;  1VQ7 I;  2AXL A;  3SFI A;  2ECB A;  3KZI C;  1CF7 A;  1Q1V A;  3O6B B;  4HPQ A;  1ZG3 A;  1YIJ I;  3OR1 C;  4BHC A;  4IHT A;  3W6K B;  2K9N A;  5LLQ A;  1UB9 A;  1WPK A;  3LSG A;  4A5M A;  2KDZ A;  5FLX K;  3O8G A;  3VEP A;  3TL4 X;  4B43 A;  3BDD A;  3T8R A;  4XLA A;  2VKV A;  2E2J J;  2GZW A;  1ZG1 A;  1F1Z A;  2K9L A;  1NK3 P;  4LFU A;  4LB6 B;  1LUJ B;  2F4M B;  4I2O A;  2DT6 A;  5CQG A;  3M8E A;  4ENK A;  5CJ9 A;  3OV8 A;  4C3H J;  1J7K A;  1SD5 A;  1P4A A;  4HV6 A;  5C4X J;  1RZ4 A;  4ZTJ A;  5DDG A;  2Y30 A;  3GVA A;  3UKG A;  2E35 A;  2JRM A;  4C3I J;  2X0L A;  4G12 A;  2HYF A;  2VIX A;  1E3O C;  1GVJ A;  4HEA 2;  3IH3 A;  1DU6 A;  1XC5 A;  2PQ8 A;  2DFH A;  1YQA A;  1O3T A;  1XDU A;  4HA8 A;  1KA8 A;  3HOZ J;  2W1O A;  3QRF F;  4GDF A;  2FOW A;  4OMY A;  1IRX A;  3ZN1 A;  2CFX A;  2RNG A;  2IS2 A;  1Z1D A;  3GCM A;  3KFW X;  2DBB A;  1D1B A;  4A3F J;  3T0Y A;  3H3V K;  2IGK A;  3E6M A;  1BW6 A;  2PMZ N;  4MEY F;  3S93 A;  3WTU C;  1FIA A;  3HUG B;  3GFL A;  4CIC A;  2H1K A;  1MNM C;  4G6Q A;  2DK5 A;  4XOR A;  3DTK A;  3CD6 I;  4BL0 B;  5B66 C;  1Z7U A;  2F5C A;  2L0K A;  2WV1 A;  2EIK H;  2K9M A;  3H35 A;  1D8K A;  4UB8 C;  4ESB A;  2ESN A;  4F52 A;  1Z21 A;  2K5C A;  1RET A;  2P7V B;  1SFU A;  3JRF A;  1W7P B;  1IAW A;  5CVV A;  1ITY A;  1C0W A;  4Y3O A;  2Q1Z B;  5IT9 K;  3VOE A;  4RM2 A;  1HC8 A;  4CCM A;  3WTY C;  2LVS A;  2ZBK A;  4M3E A;  3DPU A;  2DA7 A;  3CZ6 A;  2VC0 A;  1RUN A;  4ESF A;  1V5E A;  4L5E A;  5M3M J;  2AS5 F;  2OQG A;  2EA2 A;  2JTV A;  2OUM A;  3BG5 A;  3OOP A;  3FBI B;  5J8F A;  2M5W A;  2V79 A;  3HRM A;  3L2W A;  4CA0 A;  1HKT A;  1PYV A;  4PSW A;  3WTX C;  1FOX A;  1SC7 A;  3CP2 A;  4NHJ A;  3V8K A;  5EEG A;  3HPH A;  1HW2 A;  2JQ7 A;  2CW8 A;  3FKI J;  3PSI A;  5F0C A;  1G3Y A;  4BBR J;  1KZH A;  4LD5 A;  2LG4 A;  3OWT A;  3UNG C;  5L3B A;  4D7N A;  5EF6 A;  2M3A A;  2B9S A;  2ID3 A;  2DDB A;  3ECH A;  1H0M A;  3CES A;  4KIF A;  3CTA A;  4HX4 A;  4BH9 A;  1VQM I;  2Z16 A;  2DCE A;  4PJM A;  1SAX A;  2AQE A;  1WQ2 A;  3QOP A;  4QPQ A;  4O3M A;  4BXF A;  5FFZ A;  4IF4 A;  3F21 A;  1SMT A;  4HF1 A;  2D1V A;  5DD8 A;  5KCM A;  3CO7 C;  1J09 A;  1V55 H;  1RI7 A;  3ZQI A;  2DI3 A;  3CCS I;  2KRC A;  2M8E A;  3F8M A;  5E1X A;  3IL2 A;  4P9F A;  1X1B A;  4L9J A;  2RQP A;  2LFB A;  2LD5 A;  2XDV A;  3BOQ A;  4EQQ A;  2VOD A;  3FXL A;  1YS7 A;  3E97 A;  5FKO A;  1QRY A;  3VYS B;  1APL C;  3BR2 A;  2K4B A;  3FMR A;  2WAD A;  3E0J B;  3SDG A;  3BTI A;  4A3D J;  1YE9 A;  2DMQ A;  5HNH A;  1AWC A;  3CP8 A;  1ZGW A;  1Y39 A;  3OYL A;  2Q2E A;  1O57 A;  2HKX A;  4EJT A;  2QWW A;  3ERE D;  5H6Q A;  2X48 A;  2LOO A;  1TNS A;  3OL4 A;  3SEQ A;  4I7H A;  3ABK H;  3A4C A;  1JJ6 C;  3GME A;  1KU7 A;  4CZZ A;  1UAA A;  3CUQ A;  1IF1 A;  3HZJ A;  2HI3 A;  3B6A A;  2R7V A;  4EEF G;  1WJD A;  4F7Z A;  3OYJ A;  1MMN A;  1V4R A;  5E3M A;  4KDP A;  2E60 A;  4G9Y A;  3FXQ A;  4F92 B;  2XAH A;  3JR9 A;  1D0Z A;  4HOB A;  3G6E I;  3D5S C;  2VON A;  4HDU A;  5KAI C;  3Q3S A;  4U0V A;  5CPR B;  2IS4 A;  3MKL A;  1T95 A;  3WTV C;  1EV7 A;  3CDI A;  1WRJ A;  5DM7 F;  2IVM A;  1HCR A;  1UST A;  3ISP A;  2VPL A;  3TDZ C;  2HOA A;  3PM1 A;  1W0U A;  1MH4 A;  2LY1 A;  3S8P A;  1Z91 A;  5M3F J;  2CQ7 A;  4MGR A;  1FSE A;  5HS8 A;  3O2P E;  1DPU A;  2R7D A;  3M3Y J;  2TDX A;  5CVU A;  1NK2 P;  2DLL A;  1B8I A;  5D5X B;  4LIT A;  1ETV A;  3RIR A;  5FGM A;  4M74 A;  3CCR I;  1ZK8 A;  1ACI A;  2CMP A;  1IXC A;  3FXO A;  4R8H A;  1VQO I;  1OR7 A;  3DXJ F;  4BE0 A;  1DDN A;  2HZT A;  3VPR A;  2GA2 A;  3AFH A;  1XCV A;  5F27 A;  2DJI A;  4XKW A;  5J3L A;  4C2T A;  4O5V A;  3V7R A;  2WWY A;  1FMW A;  1MJA A;  2JWT A;  2RN7 A;  5CVJ A;  1N77 A;  4RGS A;  4I76 A;  1JJ8 C;  2K9S A;  2JZY A;  1UG0 A;  3BJO A;  3H5R A;  2CV0 A;  4IHY A;  1WH5 A;  3I9V 2;  2VJ5 A;  2VE9 A;  1J75 A;  3TW6 A;  2QQ9 A;  4B3A A;  3FMQ A;  2WA0 A;  5FKK A;  3EET A;  1LFB A;  1XGO A;  2GXG A;  1L3L A;  2EFQ A;  1T8I A;  1I6X A;  1LDJ A;  4AD9 A;  2HOT A;  4E7H A;  3GZ5 A;  4YIR X;  3JRG A;  1ODD A;  1PDN C;  1RUO A;  4JBA A;  9ANT A;  4V2G A;  3LA3 A;  1IN8 A;  5B1A H;  1R00 A;  5LGT A;  1ZRC A;  1KQ0 A;  3SQN A;  1EH6 A;  1FPQ A;  1QZZ A;  2JVH A;  4ZH4 F;  2BY0 A;  3GBG A;  4ZYH A;  1LDD A;  1X2N A;  4EJV A;  4M73 A;  1K7A A;  4EGZ A;  2D45 A;  3K2Z A;  4Y15 A;  1TWC J;  2BEO A;  3ZQC A;  3DEW A;  5JR3 A;  3ZQF A;  4BY7 J;  4DOZ A;  3KYD B;  1R4M B;  3MWM A;  2QEN A;  1IRG A;  2CW7 A;  3A03 A;  4RAZ A;  2GBY A;  2Q0O A;  3QQA A;  1IZ1 A;  1MBH A;  1Z05 A;  4RB3 C;  1N78 A;  2W4S A;  2QZ8 A;  4BDZ A;  1EF4 A;  1MJB A;  1WJF A;  2LMD A;  4FQG A;  4Y7N J;  1XSV A;  4F3Q A;  3CJN A;  1NHA A;  3OYF A;  4HX7 A;  5HOD A;  2Y2Z A;  4NNJ A;  5KHD A;  3HGY A;  2BXZ A;  3FMS A;  2ISZ A;  4QWQ A;  3OYB A;  3MN2 A;  4BQQ A;  1OPC A;  3HOT A;  3K4L A;  1O7F A;  3BJA A;  3E1S A;  2KJC A;  3VDX A;  3WG7 H;  4ZDL A;  2KQR A;  4HV5 A;  3ZQL A;  4GFB A;  5E1Z B;  4EV0 A;  4XOP A;  2F48 A;  2M4K A;  3ULQ B;  4NC7 A;  2Y0S N;  1VQ8 I;  2JA5 J;  4AVP A;  3K2A A;  1ZG5 A;  3F8F A;  3K4J A;  2N8G A;  2ZJP F;  5E3O A;  4PFO A;  3ECO A;  3CC7 I;  2VXD A;  1WJB A;  4G8X A;  2DXI A;  2AO9 A;  3QPL A;  4V19 K;  4FX4 A;  2WC2 A;  5M5X J;  2LBF A;  4CYD A;  3GYH X;  4E7J A;  4BU2 A;  3VOD A;  4L9T A;  2Z3Y A;  3HOS A;  2VOP A;  1X19 A;  1ENH A;  1WCM J;  3BTC A;  4IVN A;  2LRD A;  1IXS B;  1FY7 A;  2NS0 A;  5GP9 A;  1SFK A;  2IGO A;  4A3C J;  3GTM J;  2W24 A;  1X3Z B;  1ZAR A;  3Q0V A;  1O7L A;  1R5I D;  1Z9C A;  5DUI A;  1WVR A;  3VYT B;  5GAD J;  2V9V A;  2DMU A;  3ZMV A;  2A61 A;  3HSE A;  4IOC F;  2QSF X;  3O8H A;  1R71 A;  1U9O A;  2ISY A;  4X1E A;  2OTJ I;  5H6R A;  1A6Q A;  3GZ6 A;  1XB4 A;  1YTY A;  1FNN A;  1WI3 A;  2PEX A;  4BGD A;  2GA1 A;  4OMZ A;  4UV9 A;  1EKE A;  4XSZ F;  3OSG A;  2IA1 A;  4DGW B;  4E7Z A;  2DW4 A;  2FML A;  2O61 A;  3A02 A;  3SZP A;  3D0S A;  3V8L A;  1YLF A;  1MBF A;  1T56 A;  1IN4 A;  2KT0 A;  2DTR A;  2XB0 X;  2MD0 A;  1DP3 A;  3CJR B;  5J4Y A;  4ZTF A;  2BW3 B;  5EYR A;  2IGN A;  4ZYA A;  5L3F A;  2J5P A;  3IRR A;  1UHS A;  4BEH A;  2K40 A;  2A69 F;  4E6K G;  2UWM A;  3BP8 A;  3JRE A;  1FSH A;  2HXO A;  3LFK A;  4M3B A;  4IHW A;  1IN5 A;  1HST A;  2L02 A;  4ZJZ A;  1YJW I;  4LOC A;  3GTL J;  5IP7 J;  3DKY A;  1HQC A;  4HG2 A;  3COA C;  3ABM H;  5GTI C;  3AL0 C;  1PJR A;  2OCC H;  1W0T A;  2M30 A;  1T08 B;  1RR8 C;  3JAM K;  2X4H A;  3S2D J;  2OCE A;  2A3S A;  1YO5 C;  2HQN A;  1B9N A;  3BG3 A;  1BR2 A;  2DOA A;  5DYM A;  1T0F A;  3R4K A;  4L5J A;  5D8L B;  3W6J B;  2MC4 A;  2OC6 A;  3BR3 A;  3FZV A; 
#chains in the Genus database with same CATH homology
 5FD5 A;  3D5L A;  2HEO A;  3K1N A;  2E1C A;  5K5O A;  4I01 A;  3WTS C;  3HHG A;  2G9W A;  4RGU A;  4AIH A;  3LA7 A;  1BI3 A;  1FP1 D;  4BHB A;  4GYG A;  2P5L C;  2Z9O A;  3WGG A;  3Q9S A;  1XSD A;  2YX4 A;  2HS5 A;  4ETS A;  1MGT A;  1X3U A;  4A12 A;  2XAG A;  3ZPL A;  3KZY A;  1BC8 C;  4XLN F;  4M72 A;  3GEZ A;  4UUV A;  3KET A;  2VT2 A;  1QNT A;  1G4D A;  4WCG A;  4AIJ A;  4I0A A;  5BPD A;  4GO1 A;  3F8C A;  3TO7 A;  4Q48 A;  2FXA A;  4KMU X;  3CUO A;  2XRO A;  4DQ2 A;  1GXP A;  1IN7 A;  3M8F A;  4LG0 A;  4I0B A;  1B4A A;  3K69 A;  3WOD F;  2CSO A;  2D2W A;  1STZ A;  2KIM A;  5ICF A;  4GXO A;  3EYY A;  2MD5 A;  3GFI A;  1ZGA A;  5CLS A;  4E70 A;  5LRS A;  4S05 A;  3HYI A;  2RGV A;  4N0B A;  2EB7 A;  4KMF A;  1SMY F;  4Q5S F;  1FLI A;  5ICE A;  3MCZ A;  5KVR A;  3VB2 A;  2Z99 A;  3SFZ A;  3NRV A;  2P5K A;  3U9G A;  3J7A O;  1T39 A;  1LDK B;  4UVB A;  2WTE A;  1U5T A;  5DCF A;  4RS8 A;  4AIK A;  3CO6 C;  5KK1 A;  1YFH A;  5A2Q Z;  1IN6 A;  1R1U A;  3EYI A;  3IC7 A;  4KIB A;  2BYV E;  2G7U A;  4G94 A;  2XGX A;  2EFN A;  4GGG A;  4A0X A;  2KIU A;  2FBK A;  2EV6 A;  5DCM A;  3KLN A;  3LQQ A;  3BPV A;  5BMZ A;  1SFE A;  1XDS A;  2FBH A;  1V3F A;  2VT3 A;  4L9N A;  1TQI A;  2XAJ A;  2M45 A;  4HW0 A;  1ZN2 A;  3I58 A;  1HKS A;  4WXH A;  2ELH A;  1P2F A;  4ON0 A;  3F8N A;  3QU3 A;  3IKV A;  4B09 A;  5DD4 A;  3KP6 A;  2ESH A;  2DAO A;  3ELK A;  4KUM A;  2J5O A;  1TW2 A;  5ERI A;  3F72 A;  5L3D A;  1ON2 A;  3DF8 A;  2XKP A;  2L01 A;  4PDK A;  2MH2 A;  1J9I A;  5K1Y A;  3FF5 A;  3CDH A;  5HLI A;  1YW7 A;  4KNY A;  2EJR A;  5ICC A;  4XBF A;  3ZP5 A;  2HGC A;  2LDU A;  2Y0M A;  1ZYR F;  4JK1 X;  3NEU A;  5D4S A;  1R5G A;  3Q9V A;  5ILV A;  3CUQ C;  3TOB A;  1XD7 A;  1IRF A;  4EM0 B;  2ZME A;  3P9K A;  2UZK A;  2ZKZ A;  2BV6 A;  2QM3 A;  3ZMU A;  3I5U A;  4HLX A;  1YYV A;  2FNA A;  4LJZ F;  5D6E A;  4P9U A;  3L00 A;  3CUQ B;  2O6G E;  1JGS A;  4Y13 A;  5ED4 A;  4U88 A;  5E18 F;  3RI4 A;  1KU9 A;  3N4M A;  1BI2 A;  5K5Q A;  2M87 A;  5CYV A;  2GXB A;  4BAY A;  1BI0 A;  6PAX A;  3DP7 A;  3LAP A;  5LHG A;  1PP8 F;  5ILU A;  4KT5 C;  3TO9 A;  5HLG A;  2OQR A;  5LHI A;  3DFG A;  1UCR A;  3FXU A;  3F23 A;  2V1U A;  5D5V B;  3T5X A;  2K4J A;  2XAS A;  1LB2 A;  3U2R A;  3T8T A;  1XGS A;  2YX7 A;  5F64 A;  2V1D A;  4WX9 A;  3HRU A;  5DEQ A;  2ACJ A;  2OU2 A;  4IHS A;  1EH7 A;  1LQ1 A;  1FYK A;  4UV8 A;  2OAZ A;  4WXD A;  2C6Y A;  1FYL A;  1U78 A;  4L0Z B;  2F5D A;  5L3G A;  1K6O A;  3HSR A;  3DEU A;  2PMU A;  3ZMZ A;  3E6D A;  4YG2 F;  3HRS A;  2PBI A;  3WTZ A;  4OOI A;  1H9G A;  3B73 A;  2GQQ A;  1P4X A;  2EFO A;  3E5U A;  2EK5 A;  2FE3 A;  2YR2 A;  3ABT A;  1HKQ A;  4G6D A;  5LEK A;  3WU1 B;  3C3W A;  2K7L A;  2E7W A;  4R1H A;  3RDI A;  2PI0 A;  4HQM A;  3L9F A;  3KLO A;  5EEH A;  3K1P A;  1S3J A;  4OIQ F;  2MBF A;  4HDV A;  5LBQ A;  1GXQ A;  5DUK A;  2PLY A;  4IXA A;  2RDP A;  3QU6 A;  2KIF A;  3WG9 A;  5DV5 A;  1R36 A;  3GXO A;  3ROU A;  4OIP F;  2EV0 A;  1Q1H A;  2CG4 A;  2EV5 A;  4YII A;  1DP7 P;  1RNL A;  1BBY A;  3RYR A;  4YFN F;  2CYY A;  2HOE A;  3WGH A;  4L5I A;  3WE2 A;  4N9H A;  2R3S A;  2OD5 A;  2ZXJ A;  4Z2Y A;  5LHH A;  3C1D A;  1O3Q A;  2H94 A;  1BJA A;  2JPC A;  4BQA A;  3KP7 A;  1T98 A;  2HTS A;  1REP C;  2F5E A;  2FBI A;  1DUX C;  2NNY A;  2COM A;  4Y17 A;  1R23 A;  2MLG A;  1ON1 A;  2VXZ A;  3GX4 X;  2O03 A;  5LEJ A;  2V1X A;  2PMH A;  2KRF A;  2F5F A;  1AOY A;  2Y75 A;  1YS6 A;  2FMY A;  2VBW A;  4KN4 X;  2VOO A;  5HDN A;  3MAJ A;  3DPT A;  1R1V A;  3VFZ A;  3KE2 A;  3G3Z A;  3L2C A;  1E17 A;  2YPR A;  3P9I A;  2XRN A;  5E8I A;  1BI1 A;  2QBY A;  4HX8 A;  2JT1 A;  3C7J A;  1FC3 A;  4HLY A;  4CDG A;  2FSW A;  2XVC A;  3BRO A;  4MTE A;  1BC7 C;  2VBX A;  2L4A A;  2UXX A;  2WV0 A;  1J5Y A;  3R60 A;  2XAQ A;  1R22 A;  2KJB A;  4M9S A;  1FT9 A;  2QQA A;  1MZB A;  3TQN A;  2RVC A;  2NYX A;  2RV8 A;  2ADU A;  3P7N A;  4LGW A;  4L0Y B;  3EQL F;  3EUH A;  5BS6 A;  2IA0 A;  2K27 A;  4ZZD A;  4ENM A;  4EGY A;  3E6C C;  3E5X A;  2HWV A;  4HF0 A;  1S7A A;  5JFR A;  3KEQ A;  3J80 Z;  2E7X A;  5FO5 A;  1WI9 A;  3I71 A;  3SZT A;  1QO0 D;  4U0Y A;  3FM3 A;  1T38 A;  4M71 A;  3FM5 A;  5LRR A;  3ZMT A;  1XSX A;  2P7C B;  4OIO F;  5E1W A;  4IRG A;  1Y0U A;  4ZZL A;  2RC4 A;  4HZF A;  1QPM A;  4RB1 A;  2YU3 A;  2DQL A;  2ZJ2 A;  3GO5 A;  4LG0 B;  3KP4 A;  4MQV A;  4WK8 F;  1SFX A;  3F6O A;  1K78 A;  3SHF A;  2DPD A;  2H6C A;  3LWF A;  2XIG A;  2PJP A;  4TV7 A;  2L4M A;  1ZH5 A;  5AON A;  2IA2 A;  1W4M A;  1G3W A;  4FX0 A;  3JSP A;  4P96 A;  1U5T C;  2QUF A;  2DQR A;  3IWF A;  3LQR A;  2EFW A;  2DT5 A;  4FT8 A;  4KIC A;  1FYM A;  2R7F A;  3MFK A;  4UHT A;  2A6E F;  3IWZ A;  4XLP F;  3TOA A;  2HTJ A;  2LF8 A;  3I59 B;  1ZGJ A;  4PGH A;  1IXR C;  1U3E M;  2GAU A;  3CLO A;  2JPB A;  5HDK A;  3I53 A;  5E8G A;  4GYI A;  2VE8 A;  1MD0 A;  5HOO A;  4KA4 A;  4KFC A;  2FEZ A;  1R7J A;  3E5Q A;  3V4G A;  4PCQ A;  4WF2 A;  5J8C A;  2A6H F;  1KGS A;  1FWZ A;  4EM2 A;  5DCM B;  4OU0 A;  4RAY A;  3BPX A;  1CF7 B;  1A04 A;  4M6X A;  3QPT A;  1P92 A;  4ZYE A;  3LAJ A;  4LK1 F;  2RNJ A;  2A68 F;  2IW5 A;  4P55 A;  2F2E A;  2ZNZ A;  3IKT A;  1Z6T A;  3HIF A;  1WSU A;  2CGP A;  1ONV A;  2NNN A;  1MDM A;  2DFI A;  2CW0 F;  2QLZ A;  3JTH A;  3PQK A;  2B0L A;  3RJP A;  1XMK A;  3DQV C;  3J81 K;  2VBZ A;  2LKP A;  1J2X A;  1J0R A;  2VC1 A;  1UHM A;  1B9M A;  4HAM A;  4RGX A;  4PGG A;  5L3E A;  1BIA A;  2A07 F;  1ULY A;  4NQW A;  1HBX G;  4ENJ A;  1B59 A;  3GWZ A;  4I02 A;  1FBS A;  1GHC A;  1OMI A;  1T2K A;  3E3V A;  5FLX Z;  4KIG A;  4PZJ A;  5LGN A;  2GIV A;  1KQ8 A;  5J6X A;  1QGP A;  2ZNY A;  2FQ3 A;  2Z33 A;  3LA2 A;  5D5W B;  1KU3 A;  3GF2 A;  4MNU A;  5A2Q K;  1LEA A;  2ZME B;  4HYE A;  1YG2 A;  1W7P D;  1FZP B;  2DK8 A;  3R61 A;  4YFK F;  4BXU A;  2CQK A;  1UHW A;  3L7W A;  5CVI A;  4CO8 A;  3WTT C;  4EJU A;  2OA4 A;  3ZN0 A;  1XMA A;  2V6C A;  2L54 A;  1JXS A;  1OKR A;  2QYO A;  3JW4 A;  1IUY A;  2PG4 A;  4L18 B;  2EWN A;  2QQB A;  3AAF A;  5FFX A;  5H20 A;  3GW2 A;  1OYW A;  1TQP A;  3HTS B;  4KYW A;  3H3U A;  4M9X A;  2P5V A;  1ZLJ A;  2M1B A;  4LLL A;  4CGZ A;  1P6R A;  5LGU A;  4EMS A;  3I4P A;  2Z5U A;  3ABU A;  5L3C A;  5IT9 Z;  4OIR F;  4GCV A;  2OZ6 A;  4XRF A;  1O3S A;  3U1D A;  3RKY A;  5HVQ C;  1U8R A;  1G6N A;  3EDP A;  3NQO A;  4ASN A;  4FHT A;  4Q4Z F;  4BNC A;  1IW7 F;  4LLN A;  3E6B A;  1SD7 A;  1W5S A;  3N97 A;  2DO7 A;  4EM1 A;  1XCB A;  4YIF A;  5K5R A;  1PUE E;  3RKX A;  5E17 F;  4LB5 A;  1YIO A;  4NB5 A;  1H9T A;  4N9I A;  1R58 A;  4A6D A;  2XAF A;  2A5Y B;  1S6L A;  1ZLK A;  3JTG A;  3RTR A;  1F9N A;  4MEX F;  4UVC A;  1TQM A;  4A0Z A;  2PFB A;  3PQJ A;  4UVA A;  1LNW A;  1R1T A;  3BY6 A;  3BWG A;  5HDG A;  1JE8 A;  3KEO A;  5BPI A;  2XV4 S;  2XKO A;  5JVT A;  4Q47 A;  3F22 A;  3HUG A;  4A2U A;  3FX3 A;  4U0W A;  4A6E A;  1PP7 U;  1UFM A;  3V7S A;  3O3K A;  4I09 A;  2QVO A;  1USS A;  2E1N A;  5FD6 A;  2LSO A;  1ZHF A;  1SD6 A;  1R5H A;  3PFI A;  4JQF A;  1W7P A;  5TRD A;  1L0O C;  4IPA A;  4CXF A;  1HSJ A;  4B8X A;  4M9Z A;  4UXN A;  1ZRE A;  3G73 A;  2FNP A;  1KYZ A;  3I0T A;  5D5U B;  5AIP A;  2W57 A;  2GWR A;  4EJW A;  3F8B A;  2D1H A;  3RKW A;  4ZYD A;  4AWX B;  1E2X A;  4LMY A;  4ESJ A;  1K79 A;  3FXR A;  3V7C A;  3WGI A;  3K9T A;  1TTY A;  2IT0 A;  1BM9 A;  3H92 A;  3ZMD A;  3KP3 A;  4RB2 C;  5ICG A;  1DPR A;  3QPH A;  2IPQ X;  1YW8 A;  2P8T A;  1TNT A;  2IP2 A;  2JRT A;  2FF4 A;  3M9A A;  5BQT A;  2RKH A;  4EVI A;  1VTN C;  3RPQ A;  1QQI A;  3QP6 A;  5JHU A;  3MEX A;  3T1B A;  4M6Y A;  2MC3 A;  5FB2 A;  1ZRF A;  1ZAO A;  3KCC A;  2Q8K A;  2QBY B;  1FX7 A;  5JI6 A;  3F6V A;  2HQR A;  1XGN A;  3P9C A;  3R6S A;  5D8K B;  2ZO4 A;  3KP5 A;  4HF2 A;  4OIN F;  4KN7 X;  1HW5 A;  2ZFW A;  2H27 A;  1U2W A;  4I98 B;  3GLX A;  1KU2 A;  5CVR A;  2O0Y A;  5AIQ A;  4D0P A;  2EA4 A;  2LNB A;  1D3Y A;  1BN5 A;  1W5T A;  3DKW A;  3IRQ A;  2FOK A;  4LK0 F;  5E20 A;  4BHP A;  2PN6 A;  2ZCW A;  3WTW C;  4S04 A;  4MQ9 F;  4G7O F;  2BBY A;  3MZH A;  4RB0 A;  1FBQ A;  1LVA A;  1ZRD A;  2NRA C;  3Q5F A;  1QZY A;  2IJL A;  3RYP A;  3F3X A;  3ML6 A;  1T6S A;  1FP2 A;  1TBX A;  5HS9 A;  3MQ0 A;  1I1S A;  1K78 B;  1HXD A;  5F1R A;  2STT A;  1G3S A;  2LF7 A;  3HRT A;  3ZMS A;  1U6G A;  3L09 A;  4QLC U;  2IRF G;  1D5V A;  5HS7 A;  1J59 A;  4HQE A;  3C18 A;  4ZYG A;  2HFH A;  1KYW A;  3MZY A;  4R79 A;  3JAM Z;  4MHG A;  3H3Z A;  3WE3 A;  3SXY A;  3M7G A;  4G7H F;  2BE5 F;  2H09 A;  4G7Z F;  2CO5 A;  2MLK A;  1XN7 A;  2DU9 A;  3WU0 A;  2CWE A;  5D4R A;  3V8J A;  2XUB A;  4O6J A;  2P6S A;  4EJO A;  4CHU A;  2MH9 A;  1O3R A;  3JSO A;  5IT3 A;  4A5N A;  3S2W A;  3J80 K;  3TO6 A;  1JHF A;  3HHH A;  2XHK A;  3FHZ A;  1KQ9 A;  4BYY A;  4WWC A;  4IRH A;  3B02 A;  1FOK A;  3BJ6 A;  5F6F A;  3DV8 A;  2HDC A;  3QP5 A;  3R0A A;  1EH8 A;  1MDM B;  4LLG F;  2OBP A;  1WKM A;  3GFJ A;  2W84 A;  4XSX F;  2K86 A;  3TGN A;  4L9V A;  3KP2 A;  4H0E A;  3M1E A;  1F4K A;  4A0Y A;  4K2E A;  1U5T B;  3QAH A;  3I64 A;  1P4W A;  2DPU A;  1RIO H;  2NAZ A;  5TJJ A;  3ZQ7 A;  4IJA A;  4P5O A;  2HKO A;  2KKO A;  3K0L A;  2BGC A;  1MKM A;  1XGM A;  1LJ9 A;  3I54 A;  4WXC A;  3R0J A;  2G7H A;  1JHH A;  2O3F A;  4YFX F;  1D8J A;  1I5Z A;  4RGR A;  3K1M A;  3FWE A;  3RPU A;  3HTU A;  2VBY A;  3GFM A;  1B1B A;  5D6F A;  4U7B A;  3BZ6 A;  1OYI A;  1Z6R A;  1MJ9 A;  1F5T A;  2P4W A;  2UXN A;  2OZU A;  2FU4 A;  3DPL C;  2FA5 A;  1S29 A;  4HBL A;  4UNO A;  4U7D A;  1S8N A;  2VN2 A;  5HLH A;  4IRI A;  2JSC A;  1WWX A;  3J81 Z;  5ILS A;  1I1G A;  4DNC A;  3TKY A;  1TLH B;  2STW A;  1G3T A;  2EFP A;  2W25 A;  2FRH A;  3IHU A;  2W85 A;  1S7O A;  1LEB A;  3GUD A;  2L3D A;  1BIB A;  1HW1 A;  2H6B A;  1YW9 A;  2HYG D;  2YSR A;  3I59 A;  1SD4 A;  3HSF A;  3REO A;  3TDU C;  3LST A;  1B6A A;  2P6T A;  1QBJ A;  4ENN A;  1BOA A;  1OYY A;  5BOX A;  1I27 A;  2Y48 A;  2K02 A;  1CGP A;  4MTD A;  2MA3 A;  1TW3 A;  1FBU A;  2ETH A;  2HR3 A;  2O8X A;  3KZZ A;  2AXL A;  1CF7 A;  3O6B B;  1ZG3 A;  4BHC A;  4IHT A;  3W6K B;  5LLQ A;  1UB9 A;  4A5M A;  5FLX K;  3VEP A;  3BDD A;  3T8R A;  2GZW A;  1ZG1 A;  1F1Z A;  4LFU A;  4LB6 B;  4I2O A;  3M8E A;  4ENK A;  5CJ9 A;  3OV8 A;  1J7K A;  1SD5 A;  1P4A A;  4HV6 A;  1RZ4 A;  5DDG A;  3GVA A;  2X0L A;  2HYF A;  1GVJ A;  2PQ8 A;  1O3T A;  1YQA A;  1XDU A;  4HA8 A;  1KA8 A;  3QRF F;  4OMY A;  3ZN1 A;  2CFX A;  1Z1D A;  3KFW X;  2DBB A;  3T0Y A;  3E6M A;  4MEY F;  3WTU C;  3GFL A;  4CIC A;  4G6Q A;  2DK5 A;  1Z7U A;  2F5C A;  1D8K A;  4ESB A;  2ESN A;  2P7V B;  1SFU A;  1W7P B;  1IAW A;  5CVV A;  1C0W A;  5IT9 K;  3VOE A;  3WTY C;  2ZBK A;  2VC0 A;  1RUN A;  4ESF A;  2AS5 F;  2OQG A;  2EA2 A;  2JTV A;  3OOP A;  5J8F A;  2M5W A;  2V79 A;  3HRM A;  1HKT A;  3WTX C;  4NHJ A;  3V8K A;  5EEG A;  1HW2 A;  1G3Y A;  4LD5 A;  5L3B A;  3ECH A;  1H0M A;  4KIF A;  3CTA A;  4HX4 A;  4BH9 A;  1SAX A;  1WQ2 A;  3QOP A;  4O3M A;  5FFZ A;  4IF4 A;  3F21 A;  1SMT A;  4HF1 A;  2D1V A;  5DD8 A;  3CO7 C;  1RI7 A;  2DI3 A;  2M8E A;  3F8M A;  5E1X A;  3IL2 A;  4P9F A;  4L9J A;  2RQP A;  3BOQ A;  4EQQ A;  2VOD A;  1YS7 A;  3E97 A;  2K4B A;  3FMR A;  1AWC A;  2Q2E A;  1O57 A;  2HKX A;  4EJT A;  2QWW A;  3ERE D;  5H6Q A;  1TNS A;  4I7H A;  1KU7 A;  4CZZ A;  3CUQ A;  1IF1 A;  4F7Z A;  1V4R A;  4KDP A;  4G9Y A;  3FXQ A;  2XAH A;  4HOB A;  2VON A;  4HDU A;  4U0V A;  3WTV C;  1EV7 A;  1WRJ A;  2IVM A;  1UST A;  3ISP A;  3TDZ C;  1Z91 A;  4MGR A;  1FSE A;  5HS8 A;  3O2P E;  1DPU A;  2R7D A;  2TDX A;  5CVU A;  2DLL A;  5D5X B;  3RIR A;  5FGM A;  4M74 A;  1IXC A;  4R8H A;  1OR7 A;  3DXJ F;  1DDN A;  2HZT A;  2GA2 A;  1XCV A;  4O5V A;  3V7R A;  2WWY A;  1MJA A;  2RN7 A;  5CVJ A;  4RGS A;  2JZY A;  3BJO A;  2VE9 A;  1J75 A;  2QQ9 A;  3FMQ A;  3EET A;  1XGO A;  2GXG A;  1L3L A;  2EFQ A;  1I6X A;  1LDJ A;  4AD9 A;  3GZ5 A;  1RUO A;  1ODD A;  1PDN C;  4JBA A;  3LA3 A;  1IN8 A;  1R00 A;  5LGT A;  1ZRC A;  1KQ0 A;  3SQN A;  1EH6 A;  1FPQ A;  1QZZ A;  4ZH4 F;  4ZYH A;  1LDD A;  4EJV A;  4M73 A;  1K7A A;  4EGZ A;  2D45 A;  3K2Z A;  4Y15 A;  2BEO A;  5JR3 A;  3MWM A;  2QEN A;  1IRG A;  4RAZ A;  2Q0O A;  1IZ1 A;  1Z05 A;  4RB3 C;  2QZ8 A;  1MJB A;  1XSV A;  3CJN A;  1NHA A;  4HX7 A;  3FMS A;  2ISZ A;  4QWQ A;  1OPC A;  3HOT A;  1O7F A;  3BJA A;  2KJC A;  4HV5 A;  5E1Z B;  4EV0 A;  3ULQ B;  4AVP A;  1ZG5 A;  3F8F A;  3ECO A;  4G8X A;  4FX4 A;  2WC2 A;  3GYH X;  4CYD A;  2VOP A;  3VOD A;  4L9T A;  2Z3Y A;  3HOS A;  4IVN A;  1IXS B;  1FY7 A;  2NS0 A;  2W24 A;  1ZAR A;  1O7L A;  1Z9C A;  5DUI A;  2V9V A;  3ZMV A;  2A61 A;  3HSE A;  2ISY A;  5H6R A;  3GZ6 A;  1XB4 A;  1YTY A;  1FNN A;  2PEX A;  2GA1 A;  4OMZ A;  4UV9 A;  4XSZ F;  2IA1 A;  2DW4 A;  2FML A;  2O61 A;  3SZP A;  3D0S A;  3V8L A;  1YLF A;  1IN4 A;  2DTR A;  5L3F A;  2J5P A;  3IRR A;  2A69 F;  2UWM A;  3BP8 A;  1FSH A;  3LFK A;  1IN5 A;  1HST A;  2L02 A;  3COA C;  1HQC A;  2M30 A;  3JAM K;  2X4H A;  2A3S A;  1YO5 C;  2HQN A;  1B9N A;  5DYM A;  1T0F A;  3R4K A;  4L5J A;  5D8L B;  3W6J B;  3FZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...