2LF7A

Intramolecular regulation of the ets domain within etv6 sequence r335 to q436
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
b'GSHMRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor ETV6
publication title Autoinhibition of ETV6 (TEL) DNA Binding: Appended Helices Sterically Block the ETS Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 33
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lf7A01
5LRSA 3HSRA 1G3YA 2P5KA 1BM9A 3L2CA 2GAUA 1HW1A 5EEGA 3B02A 2EA4A 3V8KA 3RDIA 1J59A 1B9MA 2STTA 3JTHA 2VBXA 4S04A 1J9IA 1UCRA 2AXLA 1SD5A 3KZZA 3KLOA 1RIOH 2A6EF 2M8EA 4JQFA 3HRTA 4PGGA 2CQKA 2DBBA 3S2WA 1KQ0A 4PGHA 2OBPA 1K79A 5F64A 1BI1A 1B9NA 3P7NA 5DCFA 2BV6A 3FHZA 1VTNC 3WTXC 3I71A 1EH7A 3ZN1A 2D45A 2LKPA 3U1DA 2CG4A 3P9CA 2KJCA 1LB2A 4D0PA 1ZG3A 4RB3C 2L01A 1SMYF 5LEJA 4I09A 2L4AA 1IXRC 4RGRA 2EWNA 2QWWA 2H94A 2A07F 1IRGA 5D4RA 1EH6A 3Q9SA 5E1WA 5K5RA 3GZ6A 1FP1D 1BI3A 2PG4A 3K69A 2ACJA 5CJ9A 3VEPA 4LMYA 5CVUA 2F5CA 3HHGA 1FT9A 1W7PD 2KIUA 4GGGA 2HQNA 4MQVA 4Z2YA 4LGWA 2XHKA 1PP8F 4GCVA 4IF4A 3DV8A 5E20A 2Z99A 1RZ4A 3PQKA 1T0FA 3V4GA 3FMQA 2IP2A 4U0VA 2M30A 2COMA 2EFQA 2PBIA 2DK8A 5D6EA 2HKXA 1XGNA 4HZFA 2NRAC 5CLSA 3BROA 4KA4A 2MC3A 3MWMA 3WGGA 3HOTA 4KIGA 1RUNA 1R5GA 2ZKZA 1FBUA 5TJJA 4PDKA 1P6RA 1QBJA 2A61A 4UNOA 3LA2A 5D8LB 4RB1A 1YTYA 5AONA 1RNLA 2YX7A 3T1BA 3V8JA 5A2QK 1ZRFA 3FM3A 2LF7A 2VONA 1YW9A 3CUOA 4UVBA 4LG0A 2IT0A 2MH2A 3J7AO 4JBAA 3RPUA 4M72A 4EMSA 3E6DA 5ICFA 2FBKA 2G7HA 1J5YA 2P8TA 1D8KA 1MJ9A 1SFXA 2YSRA 3GFMA 4LG0B 4EM1A 4ZYHA 2A5YB 4G8XA 1G3TA 1TTYA 1OPCA 4AIHA 1BI0A 3E6MA 4UV9A 4MTEA 1HKQA 3DXJF 2VXZA 2H27A 2HOEA 1KU2A 5H6QA 5FB2A 3RJPA 4M9ZA 5E1ZB 2H09A 3F8BA 1IUYA 4A0ZA 4L0ZB 4N0BA 4LLNA 1K7AA 4OU0A 4HV6A 4WCGA 2LDUA 2M1BA 1WKMA 1TNTA 3WU0A 3U2RA 2IPQX 3I5UA 2WC2A 1TNSA 3K0LA 2R7FA 3LA3A 1ZN2A 4XBFA 1MDMA 3ZMZA 1FZPB 4KUMA 1S7OA 4ESBA 5L3GA 5FFXA 4OINF 2FRHA 2F5FA 5DUIA 1MDMB 4KN4X 3NQOA 1T6SA 2RDPA 3W6KB 4EJWA 1IN6A 1B4AA 2RQPA 5HLIA 1MKMA 1BC7C 3K9TA 2QBYA 3BWGA 1SFEA 1Q1HA 2IA2A 2NNNA 4U88A 2ZMEB 4CHUA 5D6FA 2XAGA 2F2EA 4MNUA 2OZUA 2XUBA 3L09A 1CGPA 2QBYB 1FBQA 1Z05A 3JAMK 1WI9A 1ZLJA 5DCMB 3LAJA 3TQNA 4UHTA 3F72A 3VODA 3LQRA 3GEZA 4XLNF 4G6DA 1V3FA 4BQAA 4O5VA 2V1DA 4WXCA 3RKXA 4UVAA 2BEOA 4UUVA 2ELHA 1W5SA 4BH9A 1TQPA 1AWCA 2RC4A 3V7SA 2Z5UA 2GIVA 4AD9A 4F7ZA 3ERED 1Z6RA 4G6QA 1KU3A 1HSTA 1TLHB 5D5UB 2NYXA 3E6BA 3Q5FA 1ZRDA 3L7WA 2XKOA 2HYGD 5ILVA 3F21A 5D8KB 4P96A 3I53A 1WRJA 1UHWA 4OIQF 3ZMSA 3GO5A 2G7UA 3F8MA 3WE3A 2CFXA 4M73A 1T38A 5L3FA 3KZYA 3WTVC 2VT3A 3GWZA 1W5TA 4RAYA 3SXYA 2IW5A 5BS6A 2VE8A 1ZGJA 1LQ1A 1IN7A 4P55A 2DO7A 1ZH5A 4KDPA 3GFIA 5JR3A 1K6OA 3JTGA 1ZREA 3TGNA 5LGTA 2JTVA 2KIMA 5LHHA 3ML6A 1DUXC 2CSOA 4AWXB 1ZAOA 3H3UA 2FNAA 3WGIA 4WK8F 4YIFA 3WTWC 1W4MA 4IHSA 2F5EA 4RGXA 3HRUA 4A0XA 4CO8A 5ICCA 1UB9A 1ZRCA 5BMZA 4L9NA 1LNWA 5J8FA 2OD5A 3HRSA 3ABUA 1USSA 3T8TA 1XSXA 2ZCWA 3MQ0A 4A6DA 4UXNA 2JT1A 3H3ZA 3QP6A 3ECHA 3QOPA 1YS7A 1R5HA 2WWYA 1SFUA 4FT8A 4FHTA 4HBLA 3FM5A 2DI3A 3CO7C 2Y0MA 1FPQA 3T5XA 5HVQC 4OOIA 3LQQA 4CXFA 2V1UA 3BJAA 3JSOA 2M87A 5DEQA 3EYYA 1KU9A 2UXNA 1QO0D 3COAC 2KKOA 1ZG1A 4GYGA 5IT3A 1XSVA 2EB7A 1KQ9A 3WE2A 2O03A 2OU2A 3HYIA 2X0LA 1J2XA 4ESJA 2AS5F 4HF1A 2CW0F 1GVJA 1UFMA 2J5PA 4OIRF 3BOQA 1KQ8A 2HWVA 3I59A 1P4WA 1XMKA 1W7PA 2O0YA 4OMZA 2K27A 4Q47A 3KEQA 3I59B 3CTAA 1FC3A 1F9NA 1ON2A 1BI2A 1W7PB 3K1PA 3JAMZ 2IVMA 5E18F 4KMFA 4HOBA 2BGCA 4KT5C 4NHJA 3F8CA 1QNTA 2TDXA 4HLYA 1ZYRF 3WTZA 5CVJA 2DPUA 2QLZA 2XV4S 5DDGA 2C6YA 1PDNC 3DKWA 1XSDA 2FU4A 4S05A 3M8EA 1P4AA 3E3VA 3R6SA 1S29A 2PJPA 1FP2A 1HSJA 3MCZA 4KMUX 2EV6A 2DTRA 1HQCA 4HF0A 5HOOA 1YQAA 1SD4A 4MTDA 2Y48A 4L9VA 2V1XA 1FYKA 3SFZA 4IRHA 3ZMVA 5JFRA 3HRMA 5HS9A 5LEKA 3BY6A 2J5OA 3SHFA 4EJTA 2EJRA 1G6NA 4G7OF 5AIQA 1XB4A 2IJLA 1TQIA 3CDHA 3HUGA 3RYPA 4GXOA 2ZO4A 4LLGF 5DD4A 4YG2F 2PQ8A 1BOAA 3IRQA 1Z7UA 1HKSA 5J8CA 3QRFF 2FSWA 4LK1F 2RV8A 2YR2A 4HX4A 5D5XB 3ULQB 2HEOA 3IWFA 2ZJ2A 4QLCU 4HAMA 5HDKA 1XGSA 3KP2A 1HXDA 1OMIA 2EFNA 1IN4A 2Z9OA 5BPIA 5KVRA 1R58A 3M8FA 2VBYA 3P9IA 3I64A 3V7RA 2Z33A 1H9GA 5LGUA 4RB2C 3M7GA 3DF8A 2X4HA 5CVVA 1AOYA 2VC0A 2HZTA 1Z9CA 3JW4A 2NAZA 2QYOA 1JHHA 1S3JA 3MZYA 2QENA 3TO6A 3JSPA 4YFXF 2PI0A 4ZYGA 1I1SA 1I1GA 4HQEA 1G4DA 4GYIA 3GX4X 2M45A 3ZMDA 4MQ9F 1YW7A 5JVTA 4NQWA 1MJAA 2FQ3A 4RB0A 3LSTA 1U5TC 1U5TA 3L9FA 1YFHA 2JZYA 1TQMA 5IT9K 3QPHA 1YG2A 4WXDA 5CVIA 1U5TB 2A6HF 4MEXF 2KIFA 2VOPA 3D0SA 3GZ5A 3REOA 2A3SA 3E5UA 4G7ZF 3I58A 4QWQA 5HDNA 4Q5SF 2ESHA 3BP8A 3FF5A 2E1NA 2HR3A 3RI4A 5FGMA 3I4PA 3GW2A 2JPBA 1R1VA 2NNYA 4MGRA 3R4KA 4M6XA 2P4WA 4A12A 4ZZDA 4LB6B 2HFHA 1U2WA 3EETA 4EJUA 3F6VA 4EM2A 1IZ1A 5HDGA 4WXHA 1HKTA 2IA1A 4ASNA 4G9YA 4LJZF 5BQTA 3IRRA 3KCCA 2A68F 3K2ZA 2Y75A 2XAQA 3ELKA 4PZJA 2DFIA 4LB5A 2QUFA 1STZA 2QQAA 4Y17A 3RYRA 3T0YA 3M1EA 3K1MA 2Q0OA 1UHMA 2YPRA 5K5OA 1H9TA 3V8LA 1I5ZA 4A2UA 1IRFA 4ZZLA 1XMAA 3C3WA 3R0JA 2ZMEA 1FBSA 2IA0A 2DAOA 5L3CA 3TO9A 1DPUA 4Q4ZF 1ON1A 5L3DA 4WF2A 2R7DA 1YW8A 5K1YA 2L54A 2E7WA 3N4MA 2XAFA 2H6CA 2W85A 3SZTA 5DCMA 3RKYA 3WTTC 1TW2A 4AIJA 3ZMTA 1BBYA 2XVCA 2ZFWA 4G7HF 3ABTA 3BZ6A 3F6OA 3GF2A 2WTEA 4RAZA 3V7CA 3DEUA 4HW0A 3KP7A 2YX4A 4KIBA 2RN7A 5LRRA 1IAWA 5LGNA 1ONVA 4FX4A 2LF8A 1FSEA 2O3FA 1BIBA 1YYVA 4TV7A 3VFZA 4ENMA 4O6JA 2F5DA 5DV5A 2FMLA 4BYYA 4L5IA 5DD8A 2VT2A 1T98A 1DP7P 3FXRA 2W84A 1XCBA 3TDZC 5FD6A 2L02A 2GXGA 3HSFA 3ZMUA 2MD5A 3OV8A 1KGSA 1ZHFA 2DU9A 4XLPF 1R00A 2FA5A 3L00A 1YO5C 2QVOA 3MZHA 5ED4A 5KK1A 1IN8A 5FFZA 4BHCA 4IHTA 1P2FA 5D5WB 5HS7A 3I54A 3QAHA 2O61A 3SZPA 3E5QA 2GA1A 1R7JA 5E17F 2UWMA 1WWXA 4KYWA 3T8RA 4R79A 5A2QZ 4L5JA 3G3ZA 2Q2EA 4IJAA 3RKWA 2GQQA 3PFIA 1R23A 2FBIA 4M6YA 4ON0A 3J81K 4ENJA 3CUQC 3CUQA 1ZARA 3WTSC 2PN6A 2K02A 4M9XA 2E7XA 3KFWX 1TW3A 4CGZA 1S7AA 1HW5A 1O57A 3CUQB 3LWFA 3HIFA 4AVPA 2QQ9A 3W6JB 2XAHA 1F4KA 1PP7U 3E6CC 4DQ2A 1B1BA 5L3EA 2MH9A 2JSCA 4I02A 1FLIA 2CWEA 5L3BA 2CGPA 1KA8A 1FY7A 4BHPA 1RI7A 1S6LA 1XDUA 5LBQA 5H20A 2XGXA 2QM3A 1O7FA 1LVAA 2HDCA 3F3XA 1J7KA 3IL2A 1C0WA 3ROUA 2DQRA 5J6XA 3FMRA 2JRTA 2UXXA 3DFGA 4FX0A 1BIAA 5K5QA 2A69F 4CICA 2HTJA 1OYWA 3GYHX 2XRNA 5D4SA 1QPMA 3F23A 1MJBA 4N9HA 2GA2A 3BPXA 3IKVA 4B8XA 4A5MA 1ZG5A 2VN2A 4EGZA 3AAFA 2P6SA 1T39A 2JPCA 4I98B 2XIGA 3O3KA 4HYEA 2HQRA 1SMTA 2MBFA 2Q8KA 4B09A 2LSOA 1D5VA 4GO1A 1U78A 1U3EM 2VC1A 3EUHA 2HKOA 3VB2A 3LFKA 3R60A 3QPTA 1LJ9A 3B73A 3DPTA 2PLYA 3EDPA 2K4BA 2EFPA 3IWZA 1HW2A 5EEHA 3QP5A 3C18A 1IXCA 1HBXG 3QU3A 4UV8A 3IKTA 2G9WA 4CYDA 1LDDA 2ISYA 4A5NA 5HLHA 2OAZA 1LEBA 2PMHA 1Z91A 2L4MA 1XDSA 2EV5A 3GLXA 2K86A 4EVIA 4XRFA 2V9VA 1O7LA 1F1ZA 3FXQA 5BPDA 2HYFA 4OMYA 3K1NA 4IRIA 2O6GE 4I2OA 3RTRA 1GHCA 2XASA 5ILSA 1FX7A 4M71A 2Z3YA 4E70A 2XAJA 2CYYA 2BBYA 2DLLA 3HTUA 4LFUA 3WGHA 4HF2A 1O3QA 1Z6TA 4IRGA 5D5VB 3GXOA 4KFCA 4Y15A 4U0WA 3FWEA 1U6GA 2GXBA 4ENNA 5FD5A 2GZWA 2ZNZA 3BJ6A 2RKHA 4N9IA 3R0AA 1ZGAA 3J81Z 3OOPA 2EFOA 2O8XA 1ODDA 2ISZA 4BXUA 3DQVC 5LHGA 4WWCA 2ADUA 3P9KA 5HS8A 2UZKA 2DK5A 1P92A 5FLXK 5FO5A 2W24A 3FXUA 3BDDA 1SD7A 2W25A 4KICA 1IXSB 1NHAA 1FNNA 1I6XA 4U7DA 4L9TA 4I7HA 1MGTA 3WTYC 5HLGA 3LA7A 3KE2A 1Z1DA 3MEXA 1R1TA 1GXPA 1T2KA 4R8HA 5ERIA 1DPRA 4M9SA 3J80K 3KETA 1FYLA 2MA3A 5DYMA 4ZYDA 2P7CB 4YIIA 2OQRA 2KJBA 5E1XA 2K4JA 3O6BB 1O3RA 3HOSA 3O2PE 4HDVA 4XSXF 3IC7A 3GUDA 1WSUA 2V79A 2L3DA 4PCQA 2EV0A 3Q9VA 4KN7X 1LDJA 3TO7A 4Y13A 1KU7A 1LEAA 2DPDA 1MZBA 1OYYA 3GVAA 1XCVA 2V6CA 1CF7A 5TRDA 2VBWA 1FYMA 4BHBA 4IXAA 1XGMA 2BYVE 4WX9A 1BC8C 4K2EA 1SAXA 4HLXA 4L9JA 1CF7B 2RGVA 3HSEA 1R22A 1P4XA 2W57A 2DT5A 5ILUA 4A0YA 4EQQA 1L0OC 2NS0A 2MLKA 2VODA 2WV0A 1S8NA 2GWRA 3KP5A 3I0TA 3RPQA 2XKPA 1XN7A 5E8IA 1OR7A 1KYZA 1XD7A 2OQGA 1IN5A 1ULYA 1YS6A 4EV0A 3ECOA 5F6FA 3U9GA 3KP4A 4NB5A 1QQIA 2ESNA 3WG9A 3MFKA 3WTUC 2K7LA 4OIPF 6PAXA 4G94A 3BPVA 5LHIA 3FMSA 1O3TA 3ISPA 3EQLF 1PUEE 3RIRA 5F1RA 1E17A 2OA4A 1X3UA 3ZN0A 2E1CA 2H6BA 3ZQ7A 1OYIA 1YIOA 4OIOF 1BJAA 3N97A 2HGCA 4I0BA 2VBZA 2FBHA 3KP6A 2P5VA 1JGSA 4RGUA 3HHHA 3R61A 4U7BA 4UVCA 4MHGA 3WODF 3GFLA 4P9FA 5DUKA 4HDUA 2D1VA 1JXSA 5FLXZ 4AIKA 4RS8A 1FSHA 3IHUA 2FOKA 1U8RA 1ZLKA 4DNCA 1G3WA 4Q48A 3F22A 1LDKB 3H92A 1FOKA 1QGPA 3ZP5A 4BNCA 2VE9A 2P7VB 1R1UA 3PQJA 1V4RA 4I01A 2HTSA 2STWA 1GXQA 1IF1A 4A6EA 3CLOA 2CO5A 4ENKA 4KNYA 3EYIA 4P9UA 4BAYA 1KYWA 1K78A 2IRFG 2FXAA 4XSZF 1A04A 1RUOA 3FX3A 4M74A 3J80Z 1J75A 5IT9Z 4HV5A 2EA2A 1I27A 3QU6A 2D1HA 2RNJA 3ZPLA 1D3YA 1K78B 1Y0UA 4HX8A 1XGOA 3TKYA 3LAPA 2XROA 4CZZA 2FNPA 2FEZA 2PEXA 2QQBA 4ZH4F 3C7JA 4O3MA 5ICGA 4EJVA 3M9AA 4H0EA 4I0AA 2B0LA 5LLQA 1OKRA 3F8NA 1QZZA 5AIPA 2VOOA 4EJOA 4U0YA 1E2XA 3KLNA 4R1HA 3TOAA 5ICEA 3CO6C 2ZNYA 1F5TA 5CVRA 1QZYA 4ZYEA 5H6RA 1IW7F 3E97A 5JHUA 1J0RA 2M5WA 4IVNA 4EM0B 3F8FA 1MD0A 2ZXJA 3NRVA 2R3SA 3DP7A 2FMYA 1H0MA 1SD6A 4LK0F 1EH8A 3DPLC 1DDNA 2DQLA 3G73A 4KIFA 1FWZA 1WQ2A 3VOEA 2P6TA 1O3SA 2BE5F 2KRFA 4YFKF 4LD5A 4CDGA 1B6AA 2LNBA 3KEOA 1EV7A 2ZBKA 1D8JA 2EK5A 4ESFA 2DW4A 2FF4A 4JK1X 3HTSB 2EFWA 3TDUC 4ETSA 3BJOA 3MAJA 4L18B 2MLGA 2OZ6A 4EGYA 2RVCA 4L0YB 2P5LC 2ETHA 2HS5A 1YLFA 3GFJA 3NEUA 2FE3A 1JE8A 1JHFA 2YU3A 1TBXA 1USTA 4HX7A 3C1DA 3SQNA 1G3SA 3D5LA 4IPAA 5JI6A 1L3LA 3E5XA 3TOBA 2PFBA 4HA8A 3KP3A 4RGSA 4YFNF 1R36A 4P5OA 1REPC 2PMUA 5E8GA 5CYVA 3FZVA 5BOXA 1B59A 1BN5A 3WU1B 4MEYF 4LLLA 3CJNA 4HQMA 2QZ8A 2D2WA
chains in the Genus database with same CATH superfamily
5LRSA 3FXJA 3HSRA 1G3YA 3B6AA 1APLC 2P5KA 1BM9A 3MKLA 5FJ8J 3L2CA 2ZXWH 1YHQI 1YITI 2GAUA 2CW7A 3PFYA 1HW1A 3L2VA 5EEGA 2EZKA 3B02A 4XLHA 3VYUB 1MBEA 2EA4A 3V8KA 1R9TJ 1XX5A 3RDIA 2EZHA 1J59A 1B9MA 2STTA 3JTHA 2OPTA 2VBXA 2XPWA 4S04A 3OYHA 1TWCJ 1ETVA 2R5YA 1J9IA 1UCRA 2AXLA 1SD5A 4IHWA 3KZZA 2L0KA 3KLOA 1RIOH 2A6EF 1UMQA 2M8EA 4JQFA 5J1UA 1W0TA 2E2JJ 2JA7J 4BJ5C 2YU9J 2M0CA 3HRTA 4V2GA 2FJ1A 4PGGA 2CQKA 2DBBA 3S2WA 3C2GA 2R5YB 1QA6A 2I10A 5LFAA 4DW6A 3K4MA 1OLTA 4A3LJ 1KQ0A 2XF6A 3DTKA 2DMTA 2P81A 2RNGA 2OBPA 4MIMA 4PGHA 1K79A 5F64A 1SFOJ 2VJ4A 4J01A 1BI1A 2HVRA 1B9NA 3I9V2 3OR1C 3P7NA 2QSHX 5DCFA 4AUXA 2BXZA 2BV6A 1F36A 2CUEA 3VSKA 3JR9A 3FHZA 1VTNC 4I6ZA 3WTXC 1SANA 2KLOA 3I71A 1EH7A 3ZN1A 2D45A 5KCMA 2LKPA 4B1RA 3S2HJ 2LR8A 1SEUA 3U1DA 2CG4A 3P9CA 2KJCA 3OIOA 4QPQA 3KYLA 2GXAA 2Y2ZA 3D5SC 1LB2A 4D0PA 3M8JA 1ZG3A 1VQOI 4RB3C 2L01A 1UAAA 3GTOJ 1SMYF 5LEJA 4I09A 2L4AA 3K10A 1IXRC 4F55A 4RGRA 2EWNA 2QWWA 2H94A 2A07F 1AKHB 3W2AA 1WHUA 1IRGA 4CCOA 3ONQA 2BW3B 5D4RA 2E2IJ 1EH6A 3Q9SA 3P5JA 2OCCH 3S1QJ 1UJ8A 2RREA 5E1WA 1QPIA 5K5RA 3H9GA 2E34A 3GZ6A 2CQNA 1FP1D 1BI3A 2PG4A 4W97A 2M4GA 3K69A 5J4YA 4RAFA 4UB8C 4GRIA 3BR0A 2BY1A 4ZJZA 3I56I 4BBRJ 2ACJA 5CJ9A 5JLXA 3SZGA 4EATA 3VEPA 4BEHB 3H35A 1VFCA 1JKRC 4LMYA 4FQGA 3OYEA 4PFOA 5CVUA 2CV0A 1B72A 2F5CA 3HHGA 3ABKH 3UR3C 2ZJQF 1FT9A 1FJLA 1W7PD 2OCEA 2KIUA 4GGGA 2DXIA 1NK3P 2QEXI 4FE7A 2HQNA 4MQVA 2HOAA 3NWTA 4FCYA 4Z2YA 5FKOA 4LGWA 2XHKA 1PP8F 4GCVA 3GTPJ 4IF4A 3DV8A 5E20A 3FXMA 3W2WA 2Z99A 4DBRA 1ZK8A 3VSLA 1V5EA 1T0FC 1RZ4A 3PQKA 5KHDA 5HODA 1T0FA 3V4GA 1VQ7I 3FMQA 2IP2A 4U0VA 2M30A 2DCEA 2COMA 2EFQA 2PBIA 3OSFA 3TL4X 2DK8A 5D6EA 4IZZA 2JN6A 5IYDJ 2IAIA 3GTMJ 4XQFA 3LSPA 2HKXA 1XGNA 1X2NA 4HZFA 2NRAC 1WJCA 5CLSA 3BROA 3BR5A 4KA4A 1JKOC 2MC3A 3MWMA 3WGGA 3MMYB 4XK4A 2TRTA 3HOTA 2HPIA 1JT6A 3CMAI 4KIGA 3A02A 1RUNA 1ERDA 1R5GA 1JUSA 2ZKZA 3MD2A 1FBUA 5TJJA 1FOWA 4PDKA 4BY7J 4XM3A 3W2VA 2HNHA 2MC4A 3FK6A 1P6RA 2LC2A 1QBJA 2A61A 4UNOA 4CYCB 3LA2A 3BG7A 5D8LB 1EKEA 4NQWB 4RB1A 1YTYA 1MIJA 1YE9A 3IP4B 2DA4A 4C3IJ 5AONA 1RKWA 3CCJI 1R4MB 3CMEI 1HDDC 1RNLA 2YX7A 3T1BA 2DA7A 3HJEA 3V8JA 2ZFUA 3K6GA 2DMNA 5A2QK 1ZRFA 1YJWI 5EDNA 3FM3A 1WCMJ 2VKEA 1T33A 2M34A 3PNTA 2BXYA 3PNVA 2LF7A 4XONA 1A5JA 2VONA 1YW9A 3CUOA 1B8IA 3CESA 4UVBA 2R7RA 4LG0A 4BE0A 2IT0A 2MH2A 3J7AO 4JBAA 3RPUA 4M72A 4EMSA 3E6DA 4LIUA 4II3A 3AL0B 1FOXA 5ICFA 1R5ID 2FBKA 3LSHA 2G7HA 1J5YA 4D9JA 2P8TA 1D8KA 3VYTB 3DEWA 4QSHA 3HOZJ 3DCFA 1MJ9A 1SFXA 2L9SA 1B8IB 4C30A 2YSRA 3BR3A 3GFMA 5DM6F 1Z3XA 3VPRA 4LG0B 4U87A 1YOVB 3Q0VA 2DJIA 1QU3A 4IHXA 2KQRA 5J1RA 5FLVA 4E7KA 3ZOBA 4EM1A 4ZYHA 4B44A 2A5YB 1VQKI 2VPRA 4G8XA 2NVYJ 1G3TA 1TTYA 1A6IA 1OPCA 4L5EA 3N05A 4AIHA 3CF2A 1BI0A 3E6MA 4UV9A 4MTEA 4XRSG 3M3YJ 2BHZA 2Z1DA 1HKQA 5EEAA 3DXJF 4XLCA 4E7IA 2VXZA 2Y31A 2HU9A 2H27A 1QZEA 1XC5A 2P0WA 2HOEA 5EF6A 1DP3A 1KU2A 5H6QA 1S9HA 1W5CC 5FB2A 3RJPA 3S32A 3OS1A 4XN3A 1OCOH 1K4SA 4M9ZA 5E1ZB 4AU7A 2LBFB 2R5ZB 4BQNA 1DU0A 2H09A 3F8BA 3BTJA 1IUYA 4Y33A 2AO9A 2VUMJ 3L1PA 2O7OA 4HSTA 4A0ZA 2CQXA 4L0ZB 4N0BA 4LLNA 2DN0A 1K7AA 5EGOA 4OU0A 5H2FC 2R4GA 4HV6A 4WCGA 2LDUA 2M1BA 5GAGJ 1WKMA 2FUG2 3OYNA 1TNTA 3WU0A 3U2RA 2IPQX 3I5UA 2MG4A 2OC6A 2WC2A 2Y0SA 1TNSA 1E0EA 1YX5A 2B7EA 3K0LA 2R7FA 3GBGA 1ZN2A 3LA3A 1OCZH 4MLOA 4XBFA 3ZMZA 1MDMA 1FZPB 4KUMA 1S7OA 5EGOB 1OQYA 5GPAA 4JX6A 4ESBA 1SVMA 5L3GA 3K4BA 3S3NA 5FFXA 4OINF 2FRHA 3BCBA 2F5FA 1NG6A 1SC7A 5DUIA 1MMDA 1MDMB 2ZMEC 4KN4X 3NQOA 1D5YA 1T6SA 2RDPA 3W6KB 4EJWA 1IN6A 1B4AA 2RQPA 5HLIA 3O8HA 1MKMA 2LOOA 4M3GA 3K9TA 4E7LA 1BC7C 2QBYA 3PSFA 3OSGA 3BWGA 2W82A 1Y6IA 3DU6A 3U1KA 1I3AA 5E3LA 1SFEA 1Q1HA 2IA2A 2NNNA 1XG1A 4U88A 3UNGC 5CKTA 2ZMEB 3OYCA 4CHUA 5D6FA 5B5EC 2XAGA 2F2EA 4MNUA 1IC8A 2OZUA 2XUBA 3L09A 1IJWC 1CGPA 1FBQA 1SAUA 4LITA 2QBYB 4BY1J 1Z05A 4A3FJ 3CQZJ 3JAMK 1LKXA 1WI9A 1ZLJA 2E1OA 5DCMB 5IYBJ 3LAJA 3TQNA 4DBQA 2ELJA 4UHTA 3F72A 4KITB 1RRJA 3VODA 3LQRA 3RSNA 1Y1VJ 3GEZA 4JP0A 3RCOA 2HVSA 4A3KJ 2MSYA 4XLNF 2LVSA 4G6DA 3AG3H 3OMYA 1V3FA 4BQAA 4YIRX 4O5VA 2V1DA 4WXCA 3RKXA 4UVAA 2BEOA 2HPMA 4UUVA 2ELHA 1ZR4A 2JK3A 4JX4A 1VI0A 1W5SA 2QQ8A 3W3CA 4BH9A 1TQPA 4IQ4A 1AWCA 2RC4A 1VQ9I 3V7SA 2Z5UA 2GIVA 1DQUA 4AD9A 1ZKGA 4UUSA 1WJDA 5K7HA 3OYAA 1IDYA 4BQQA 4F7ZA 3ERED 1ACIA 1Z6RA 4G6QA 1KU3A 4D7NA 1HSTA 1TLHB 5D5UB 2NYXA 3L2QA 1LVKA 1TZLA 2N8GA 1U9NA 3E6BA 4B3AA 3Q5FA 4F52A 5GTIC 1ZRDA 3HGYA 3ZGKA 3HOYJ 4UUSB 3L7WA 1X1AA 1J09A 3RZDJ 3H3VK 3SEZA 2XKOA 2M9HA 2HYGD 5ILVA 1W36D 3F21A 2VQLA 5D8KB 1NTCA 4P96A 3I53A 1WRJA 2X1EA 2M2EA 1UHWA 4OIQF 2L5QA 5M3MJ 2MW8A 3ZMSA 3GO5A 2G7UA 3F8MA 3WE3A 2CFXA 3A0HC 5JLWA 4M73A 2ZXHA 4G6TB 1T38A 5L3FA 2WY7Q 3KZYA 3WTVC 2ECCA 2VT3A 3CCYA 2H8WA 1HC8A 3GWZA 2R93J 1W5TA 4ZTFA 4RAYA 3SXYA 2IW5A 5IP6A 1RESA 5BS6A 4XOTA 1N77A 4PJMA 2M7BA 2VE8A 1ZGJA 1LQ1A 1OJLA 1IN7A 2NXNB 3X2QH 2VKVA 4P55A 1WGXA 1UG2A 2DO7A 1ZH5A 4KDPA 3GFIA 1VQ4I 5JR3A 3DTIA 3CCEI 1K6OA 3JTGA 4PJLA 1ZREA 3CZ6A 2Z16A 3TGNA 3OL4A 3KX2A 4BUPA 5LGTA 3AG1H 1U0JA 2JTVA 3SYTA 2KIMA 3IH2A 5LHHA 1YRNB 1QRYA 2AHQA 3OS0A 4NC8A 4RLFA 3ML6A 3H5AA 1DUXC 2CSOA 4AWXB 1ZAOA 2Q2EB 3CDIA 3H3UA 4HPQA 4NDLA 2FNAA 3QYBA 3WGIA 4WK8F 2LYCA 4YIFA 3HM5A 2Y9YA 5CQGA 4JX5A 1MBFA 3WTWC 2ZSIB 1W4MA 4IHSA 1P9QC 2BOLA 2F5EA 4RGXA 3H36A 3HRUA 3I3LA 3CCMI 2A6TA 3HXLA 4M3FA 4A0XA 3MKZA 1MMNA 4CO8A 2LH9A 5ICCA 1UB9A 2F4OB 3PO2J 4BE1A 1ZRCA 5BMZA 3F0CA 4BL0B 2CQ7A 1AU7A 2I8DA 4L9NA 1LNWA 2XAUA 2G0EA 3VDXA 2NVQJ 5J8FA 1XTAA 2OD5A 3HRSA 3ABUA 1USSA 4KT6A 5FKKA 3T8TA 1XSXA 2ZCWA 3MQ0A 4A6DA 1LFBA 4UXNA 2JT1A 3H3ZA 3QP6A 1ZGWA 3ECHA 3B6CA 3QOPA 1YS7A 1Y39A 1R5HA 2WWYA 1SFUA 3J7ZI 4FT8A 4FHTA 4HBLA 3FM5A 4HNVA 2L9VA 1JI8A 2DI3A 2GM4A 4AC0A 1Z3YA 3CO7C 2Y0MA 2PMZN 1FPQA 2EPFA 2JVGA 2X6OA 3T5XA 2KHMA 5HVQC 4OOIA 3OYKA 3LQQA 4CXFA 2V1UA 3BJAA 1YX3A 1MNDA 3JSOA 2M87A 5DEQA 3MVPA 3EYYA 1KU9A 2UXNA 1QO0D 5B3SH 3COAC 1FIAA 2KKOA 2Y9ZA 4HSRA 1ZG1A 4GYGA 4CA0A 1N78A 1G2HA 1WH5A 1ZELA 3CC7I 5IT3A 3RQ4A 1XSVA 3LOCA 1R49A 2EB7A 1KQ9A 3WE2A 2O03A 4AYBN 5EG0A 1LUJB 2OU2A 3HYIA 4RM2A 2X0LA 1J2XA 4ESJA 2AS5F 4HF1A 2CW0F 2H8RA 2LTPA 1GVJA 1UFMA 2J5PA 4OIRF 2VQHA 3BOQA 2BVLA 2ME6A 3IAS2 1Y1WJ 5EG0B 4RM3A 1EF4A 1KQ8A 2HWVA 4UB6C 3I59A 2X1CA 1P4WA 1XMKA 2L7MP 3NAUA 1W7PA 4IOAF 2O0YA 3QQAA 4OMZA 3JREA 2X48A 2K27A 1NH3A 4M3EA 4Q47A 2IS2A 3MN2A 1XMXA 3KEQA 3I59B 3CTAA 1EJ9A 1FC3A 1F9NA 1ON2A 1BI2A 1W7PB 3BG5A 2CRGA 5TGTA 3K1PA 3CF5F 3JAMZ 2IVMA 5E18F 4RBOA 4KMFA 4HOBA 3CCRI 1BW5A 2BGCA 4KT5C 4RA2A 4NHJA 1I50J 3F8CA 1QNTA 2TDXA 4HLYA 1HOMA 1ZYRF 3K4CA 3WTZA 5CVJA 2HZDA 2A5WA 2DPUA 1UZCA 3HDDA 2QLZA 2PX9A 2XV4S 5DDGA 4PJJA 5DM7F 2C6YA 1PDNC 1BR2A 2V6EA 2VLAA 2CW8A 2AQEA 3DKWA 2DDAA 1XSDA 2FU4A 5M5WJ 4S05A 2LRDA 4XR6A 3CCVI 3ZQCA 3M8EA 3DWLE 1P4AA 5F27A 3E3VA 3R6SA 1S29A 3IH3A 2IEKA 2PJPA 1FP2A 1HSJA 3BG9A 3MCZA 4KMUX 4NNJA 3H0DA 3K70C 1LE8A 2EV6A 1HQCA 2CUJA 2DTRA 4HF0A 5HOOA 1YQAA 2CJJA 1VQMI 1SD4A 1JJ8C 4MTDA 2Y69H 5CQEA 2Y48A 4L9VA 1CQTA 2V1XA 1FYKA 1SVLA 3SFZA 3A0BC 3S3OA 2L2OA 4IRHA 3ZMVA 2IXSA 5JFRA 1LE8B 3HRMA 4KJZA 5IYCJ 4BXXJ 5HS9A 4ANJA 5LEKA 3BY6A 3OYJA 2J5OA 2QSFX 1K4TA 3TMOA 3SHFA 5F0HA 1AKHA 3I55I 4EJTA 3S8PA 3G1LA 2EJRA 3JRCA 1G6NA 2BW3A 3QPSA 2CV1A 4G7OF 2IS4A 1D1CA 5AIQA 1AHDP 5E3NA 3ZQLA 3VYSB 1XB4A 4XOPA 2IJLA 1TQIA 1IGNA 3CDHA 5GADJ 3HUGA 3RYPA 3ABMH 4N4NB 4GXOA 1MBJA 5HNFA 2ZO4A 4E7JA 3S1MJ 1SVOA 1BOBA 4LLGF 5DD4A 4YG2F 2PQ8A 1BOAA 2YUSA 3IRQA 1Z7UA 2XSDC 1HKSA 3ZQIA 5J8CA 3QRFF 3HEFA 4NBQA 2FSWA 4LK1F 3HUGB 2RV8A 4BEHA 1JKQC 2YR2A 1A6QA 1D0ZA 2EQRA 4HX4A 1YIJI 5D5XB 3ULQB 1Y8QB 4M3DA 3H1CA 2HEOA 3VWBA 1UELB 3IWFA 2PJRA 1TWHJ 2ZJ2A 4X0GA 4QLCU 4HAMA 1P7IA 3BQYA 2R7ZJ 5HDKA 1WI3A 1TP4A 1XGSA 2K9MA 3KP2A 1Y8RB 1HXDA 1OMIA 1E3OC 2E36A 4ZDLA 2EFNA 1IN4A 3S17J 2DJNA 4ZTJA 2Z9OA 1N75A 5BPIA 5KVRA 2PJRB 2WADA 2W4SA 1R58A 3M8FA 2KP6A 2MGQA 2VBYA 5K7ZA 3P9IA 3K4JA 1OISA 3I64A 2VJJA 3V7RA 2Z33A 1H9GA 3LSKA 5LGUA 3DBRB 1D1BA 4C3JJ 4RB2C 2CV2A 3S16J 1R4NB 3DF8A 3M7GA 3HL2A 2QKLB 2X4HA 5CVVA 3DKXA 1AOYA 2VC0A 2HZTA 1Z9CA 4BGDA 1KZHA 3JW4A 2NAZA 2QYOA 1JHHA 1OCTC 2V1NA 1S3JA 3JRFA 3GTKJ 3MZYA 4CH7A 2QENA 3TO6A 3JSPA 4MFDA 4E7SA 1IV8A 4YFXF 3D5RC 2PI0A 3TBIA 1EA3A 4ZYGA 1I1SA 1I1GA 4HQEA 2L7ZA 1G4DA 2JVHA 4N4OB 5JVGF 4GYIA 3GX4X 1XS9A 2M45A 3ZMDA 3GCMA 1YW7A 4MQ9F 4CYCA 5JVTA 2M3AA 1MJAA 3QYEA 4NQWA 1O4XA 2FQ3A 4RB0A 5FKMA 2XB0X 3LSTA 1MW7A 1U5TC 2O8KA 5IP7J 1U5TA 3L9FA 2ZJRF 2BY2A 4ITVA 4J19A 1YFHA 2JZYA 2W7NA 1TQMA 1TT5B 2GOXB 5IT9K 4BXFA 4FE4A 4GFBA 2HXOA 3QPHA 3TW7A 3ZQQA 1YG2A 2GOMA 3DBHB 4WXDA 2MYSA 2NVXJ 5BNGA 1VQ6I 3FBNB 3MKYB 5CVIA 2DA1A 3G2BA 1U5TB 2IGNA 3ASOH 4CCJA 2A6HF 3HKZA 4MEXF 3S1NJ 2KIFA 2VOPA 3D0SA 5IOZA 3GZ5A 4A3CJ 3REOA 2A3SA 3E5UA 4G7ZF 3I58A 4QWQA 5J3LA 5HDNA 4Q5SF 2DYSH 2ESHA 1JUPA 3BP8A 3A2KA 2X9DA 5J40A 3FF5A 2E1NA 2HR3A 1GLNA 3K4KA 3RI4A 2VI6A 4BDZA 4B48A 1Z7LA 2ZJPF 3OY9A 5FGMA 1YJ9I 2MABA 3GW2A 3I4PA 3GTQJ 1D0XA 2JPBA 1R1VA 2LP0A 2NNYA 2ZSHB 4MGRA 5M5XJ 4S0HB 3R4KA 1PUFA 3ZQHA 4M6XA 2P4WA 4A12A 4ZZDA 4LB6B 4Z6YA 2HFHA 1U2WA 3EETA 5F1JA 1JJ6C 2WBMA 3F6VA 4EJUA 4F92B 4LIVA 4EM2A 1IZ1A 1GV2A 1X3ZB 2EH3A 2VKHA 5HDGA 1IG7A 4WXHA 4OAYA 2EIKH 2HOTA 3A4CA 1HKTA 3OIPA 2BVMA 2IA1A 1PUFB 3TP3A 4ASNA 3ERMA 3BCAA 4G9YA 1H89C 1X4PA 2LBFA 2R5ZA 1VQLI 4LJZF 3CCQI 4V2FA 4E4HA 1BL0A 5BQTA 4W1UA 3IRRA 2KDZA 3KCCA 2A68F 3K2ZA 2VJIA 2Y75A 4BACA 2XAQA 3ELKA 1LFPA 3GLLA 4PZJA 1BJZA 1W36C 2OTJI 5J47A 1OFCX 2Y0SN 1KONA 2DFIA 2KZVA 3OWTA 4LB5A 2QUFA 1VQ8I 1X1BA 3BT9A 1STZA 2QQAA 4Y17A 4HNTA 5E79C 3V42A 3RYRA 3T0YA 3M1EA 1VQNI 2E60A 3K1MA 1I3QJ 2Q0OA 1BR1A 1UHMA 3HZJA 1IUFA 2YPRA 1DU6A 5K5OA 3AFHA 1H9TA 3V8LA 2DMUA 1I5ZA 2IBDA 1AA7A 4A2UA 1IRFA 4ZZLA 1XMAA 4OWRB 2WY8Q 3C3WA 4IHVA 5JHFA 4RAGA 3OYFA 3R0JA 5KAIC 3LSMA 2ZMEA 4Y4RA 1FBSA 2IA0A 2DAOA 5L3CA 3SDGA 3TO9A 1A36A 1DPUA 4Q4ZF 4BS9A 1ON1A 1P7JA 2EBIA 3CCUI 5L3DA 1BW6A 4WF2A 2R7DA 1YW8A 1LFUP 4IO9F 5K1YA 1GVDA 2L54A 2E7WA 2I5UA 3N4MA 2JRMA 2XAFA 2H6CA 2VB6A 2CFOA 4RLQA 2W85A 3K4NA 3SZTA 3AKZA 5DCMA 3RKYA 3WTTC 5LD2C 1WJAA 4X1EA 1JGGA 1TW2A 4AIJA 3HC7A 3OYMA 3M4OJ 2DFHA 3CCSI 3ZMTA 2D5VA 1BBYA 2XVCA 3FKJA 2DFEA 2ZFWA 4G7HF 2L9NA 3ABTA 2CUZA 3BZ6A 3FXKA 3F6OA 3GF2A 2WTEA 4RAZA 4DOZA 3V7CA 2M4KA 3CJQB 1X1PA 2AQFA 3DEUA 4HW0A 3KP7A 4D7MA 2F4MB 2YX4A 4DYRA 1Y56A 4GDFA 3FXOA 4KIBA 2DT7B 2RN7A 2WAQN 2R7OA 2M7AA 2KFDA 3QOEA 5LRRA 4AIDA 5HNHA 3FBIB 3AG4H 3ZQGA 1IAWA 5LGNA 1ONVA 2M8GX 4FX4A 4A3DJ 2LF8A 1FSEA 2RAEA 3OR2C 5FLMJ 2O3FA 1BIBA 1E3HA 1YYVA 1QVUA 2JJ7A 4TV7A 3MKWB 2COBA 3VFZA 4ENMA 4O6JA 2F5DA 5DV5A 3RPUD 3OYLA 3RZOJ 3BR6A 4XKBA 2FMLA 2XB5A 4BYYA 2DA5A 2QCOA 1HCRA 4L5IA 2NVTJ 2B9SA 4A69C 3OYDA 3PJRA 5DD8A 1UG0A 2VT2A 1T98A 2NS8A 3F9KA 1DP7P 3FXRA 5F0CA 2W84A 3CP8A 3PSIA 1XCBA 3A01B 3TDZC 4J00A 1X1CA 5FD6A 2L02A 2GXGA 3HSFA 1RETA 3ZMUA 4D1QA 2V9PA 3PIOF 2MD5A 1MSEC 1A31A 3JCUC 4C2MJ 3OV8A 3QWLA 1KGSA 2XGCA 1H8AC 3IAM2 2KISA 2R7SA 1ZHFA 2UUZA 4FETA 1E3PA 2DU9A 3FIWA 4XLPF 1FIPA 3Q0UA 3JRDA 1R00A 2FA5A 3L00A 1YO5C 2QVOA 3MZHA 2VIXA 2LY1A 2GLOA 2DMPA 4JOMA 5ED4A 1MH3A 5KK1A 5E3MA 1IN8A 5FFZA 3WHCA 3KYCB 2B63J 4DIQA 4BHCA 4IHTA 1P2FA 4ZYAA 2DA2A 5D5WB 5HS7A 3I54A 1XPXA 2LK2A 3QAHA 2O61A 5F0FA 5K7FA 3SZPA 3E5QA 2GA1A 2HYJA 3JRHA 1R7JA 2F4IA 5FKNA 5E17F 1VF9A 4YEJA 3EPZA 2HDDA 2UWMA 1WWXA 1JUMA 1YRNA 4KYWA 2FX0A 3T8RA 4R79A 4E7ZA 4L5JA 5F08A 3G3ZA 5EZHA 5A2QZ 2Q2EA 4A3MJ 4IJAA 3RKWA 2GQQA 3PFIA 3SEQA 5J1YA 1R23A 2FBIA 4M6YA 4ON0A 4D5FA 1SFKA 3CUQC 3J81K 4ENJA 3CUQA 1PVEA 4JYKA 3HBLA 1ZARA 3WTSC 4BJ6C 2PN6A 2NOGA 2XF5A 2K02A 4M9XA 2E7XA 3KFWX 3ZXSA 3BR2A 4CUGA 1JT0A 1TW3A 4CGZA 1S7AA 1HW5A 1TC3C 1PJRA 1TWFJ 1O57A 3CUQB 2UV1A 3HIFA 3LWFA 4AVPA 2QQ9A 3W6JB 1WZ2A 2XAHA 1F4KA 1PP7U 2H1KA 3E6CC 3G1OA 4DQ2A 1B1BA 2R7QA 5L3EA 1VQ5I 2MH9A 1TWAJ 1MBHA 2EZLA 2JSCA 4I02A 1TL8A 1FLIA 2R92J 2CWEA 3BTCA 2WB1A 1KA8A 5L3BA 5M5YJ 1FY7A 2GBYA 2CGPA 4BHPA 1IO2A 2BY3A 4II2A 3PNYA 4E7HA 3BLYA 2KPMA 3A03A 1RI7A 1S6LA 2ICWG 2HQ5A 1S72I 1K83J 1XDUA 3KYDB 2IS6A 5LBQA 1OCPA 2XRLA 5H20A 2XGXA 2K3FA 2YS9A 3OYBA 2QM3A 1O7FA 2QKMB 3I4MJ 1LVAA 2HDCA 2FD5A 3F3XA 4A3JJ 1HA8A 1J7KA 3IL2A 4XKWA 3DLAA 1C0WA 3ROUA 2DQRA 5J6XA 3FMRA 2JRTA 3LSIA 2CH0A 2F5VA 2UXXA 3DFGA 4FX0A 5FRMA 1BIAA 5K5QA 2A69F 2IGKA 4XLEA 4DZJA 5M3FJ 3PL8A 4MFEA 3M07A 4CICA 1M1EB 4DJAA 2HTJA 4XN0A 1OYWA 3GYHX 1GT0C 2XRNA 4YRVA 3E7LA 5D4SA 1QPMA 4XRMA 2X6YA 3F23A 2JA5J 1MJBA 4A93J 4N9HA 3RQIA 5IOYA 2GA2A 3BPXA 1Z21A 1G59A 1FMWA 3O8GA 3IKVA 3RKQA 4B8XA 1IDZA 4A5MA 1ORKA 1R6RA 1ZG5A 2VN2A 1V5FA 4EGZA 3AAFA 1QVTA 2P6SA 2PMZA 2JPCA 4I98B 1T39A 2XIGA 3IUOA 3O3KA 4NUBA 4AVZA 4HEA2 2VJ5A 2X1DA 4HYEA 2HQRA 1SMTA 2L7FP 2L9RA 2ZB9A 4DYQA 3WU2C 2MBFA 3LSRA 3ABLH 3HPGA 3GTJJ 2E1MC 1DGRM 3CDLA 3EUAA 2Q8KA 5B66C 3G4SI 4XL9A 4B09A 2LSOA 1D5VA 4GO1A 1U78A 3EUHC 3J7YJ 1U3EM 2OJED 2EILH 2VC1A 3EUHA 2WAFA 2HKOA 2Y30A 3VB2A 1G8XA 1TWGJ 2E1MB 2JA8J 5GPCA 3LFKA 4IQJA 2X85A 2X6WA 4PJNA 1V55H 3R60A 2DT6A 2LKXA 3QPTA 2IGMA 1LJ9A 3B73A 3DTEA 3DPTA 2PLYA 3EDPA 2K4BA 2EFPA 2FOWA 3H9QA 4IHYA 3LSJA 2K5CA 2ID6A 3IWZA 1ZR2A 1HW2A 1MNMC 5EEHA 3QP5A 4DZPA 2HDWA 3C18A 2E2HJ 4D5CA 2HQAA 1IXCA 1HBXG 3QU3A 4UV8A 2E35A 3IKTA 2G9WA 4CYDA 1LDDA 2ISYA 4A5NA 1Z67A 2Z2SB 2JA6J 9ANTA 5HLHA 2OAZA 1LEBA 4CCMA 2PMHA 1Z91A 2F48A 3W6VA 2CS3A 3ZCOA 1Y0NA 2L4MA 2LLKA 3JRIA 1XDSA 2EV5A 3GLXA 5FKLA 3K4LA 2K86A 3BG3A 4ZDPA 4EVIA 1T8IA 2WAEA 4XRFA 2V9VA 5EZGA 1O7LA 1F1ZA 3CMMA 3LFUA 4C2TA 3FXQA 1X1DA 5BPDA 2HYFA 4OMYA 1MMGA 3K1NA 1ZQ3P 4IRIA 5C44J 2O6GE 5CPRB 4I2OA 3RTRA 2DMQA 2LMDA 1GHCA 2XASA 4C2UA 5ILSA 1FX7A 1FTZA 1X4OA 4XICA 4M71A 1GUUA 2Z3YA 4E70A 2R7XA 1WJBA 3WG7H 2XAJA 2CYYA 2BBYA 2DLLA 3HTUA 4LFUA 3WGHA 4EEFG 4HF2A 3PIPF 2R7UA 1O3QA 1X3WB 3G71I 1Z6TA 3H5NA 4IRGA 5D5VB 3GXOA 2JSPA 4BE2A 4KFCA 2LFBA 4PFPA 4Y15A 1HF0A 1WVRA 4U0WA 3FWEA 1U6GA 1JTYA 1PYVA 1HDPA 3BTIA 2CU7A 4IEJA 1K61A 2GXBA 1IRXA 2X6XA 4ENNA 3PUFA 5FD5A 2GZWA 2ZNZA 4IOCF 3BJ6A 4B4CA 2RKHA 4N9IA 4CSWA 3R0AA 1ZGAA 3OYGA 3J81Z 3OOPA 2EFOA 2HXIA 2O8XA 2O9LA 4XKVA 3OIQA 1FEXA 1ODDA 2EIMH 4P1WA 2ISZA 1W1WE 4BXUA 1HLVA 3J7AY 2ECBA 3DQVC 5LHGA 4NC7A 3UKGA 4QTRA 4WWCA 4RMNA 3OL3A 4X6AJ 2ADUA 3P9KA 5HS8A 2UZKA 2DK5A 4BU2A 1P92A 3BR1A 4UY8I 4ZDOA 5FLXK 5FO5A 2W24A 3DPUA 5F04A 3FXUA 3BDDA 1SD7A 2W25A 3CJTB 4KICA 4ZC3A 3KZIC 4Y52J 1WJFA 2ZXIA 3LL7A 1IXSB 1NHAA 1FNNA 1I6XA 1FTTA 4U7DA 3DU5A 4L9TA 3PUBA 1B72B 4I7HA 1MGTA 3HOUJ 2LY9A 1MH4A 4M6VA 4RDUA 3QYFA 5C3EJ 1WJEA 3WTYC 1D0YA 2ME0A 5B1BH 5HLGA 3LA7A 3KE2A 4A3BJ 2DA3A 1ETXA 1Z1DA 2W00A 3LSGA 3K7AJ 3MEXA 4B47A 2VXDA 1R1TA 4C9YA 1I39A 2E71A 4LOCA 1GXPA 1T2KA 4R8HA 4G12A 5ERIA 1A35A 3H9JA 1X2MA 1DPRA 4M9SA 3J80K 4AM3A 3HKZN 3KETA 1FYLA 2MA3A 2DOAA 2V9KA 5DYMA 2LG4A 3JRGA 3GMEA 4XRSA 5IPAA 4ZYDA 2O5RA 2P7CB 2W48A 1X58A 4YIIA 5GP9A 2OQRA 2VKDA 1TT0A 3FDYA 1GDTA 2KJBA 4PJ0C 2R7VA 3K70D 5E1XA 3I4NJ 4OAZA 4FISA 2XPUA 2K4JA 3O6BB 1O3RA 3HOSA 2KL4A 4I76A 3O2PE 3QPLA 4HDVA 4XSXF 1MMAA 3IC7A 3HOXJ 2JQ7A 4MO7A 2QGUA 3GUDA 1K6YA 2AXTC 1WSUA 2HOSA 2V79A 1W0UA 2L3DA 4PCQA 3BG6A 2EV0A 3Q9VA 4F3QA 3DEEA 4BQOA 3L2UA 4KN7X 1LDJA 3TO7A 3E1SA 4Y13A 3DKYA 1KU7A 3AL0C 1T95A 1LEAA 2ID3A 5J4VA 1RR8C 1R71A 5IP9J 2DPDA 1MZBA 1RC9A 2LY2A 1OYYA 3GVAA 1XCVA 2V6CA 4HNUA 5HLTA 2K9SA 1CF7A 5TRDA 2K85A 2VBWA 3HPHA 1DGWY 2W1OA 1FYMA 4FTHA 2OTLI 4BHBA 4IXAA 1XGMA 2BYVE 3ZQFA 3S15J 4WX9A 1BC8C 1NK2P 3IV5A 2MFZA 4K2EA 1SAXA 4HLXA 3KEYA 2LREA 5KAFC 2H1LA 4L9JA 5IY5H 1CF7B 3FISA 4BBSJ 2K3PA 2RGVA 4NC6A 3HSEA 3FHNA 1R22A 3ZRGA 4ABZA 1MMSA 2CQQA 1P4XA 3S14J 2W57A 2DT5A 5ILUA 4A0YA 3ZR8X 4EQQA 1L0OC 3S93A 1FMVA 3BQZA 2IS1A 4XLAA 5E3OA 2ELKA 2NS0A 2MLKA 2VODA 2WV0A 2XGDA 2X51A 1IRZA 1S8NA 2GWRA 1LPQA 1X19A 3KP5A 2NVUB 3I0TA 5TISC 1Q1VA 1ETYA 3RPQA 2XKPA 3CD6I 1XN7A 3C2BA 1OR7C 5E8IA 2MD0A 1OR7A 1KYZA 1XD7A 2GIZA 2EINH 2OQGA 1IN5A 1IV6A 4A3IJ 1ULYA 3G1MA 3NWSA 1YS6A 4B43A 2BY0A 4EV0A 3ECOA 1I6HJ 4CCNA 5F6FA 4DYCA 3U9GA 3KP4A 2KMUA 4NB5A 1QQIA 2ESNA 4IKFA 3HOWJ 4UUTA 3WG9A 3TW6A 3L2RA 3MFKA 5C4JJ 3WTUC 2K7LA 3GTLJ 5DS9A 1BR4A 2D2WA 4OIPF 3Q0WA 3KIOA 3HGGA 5B1AH 6PAXA 3SDBA 4G94A 3BPVA 5LHIA 3FMSA 1O3TA 3ISPA 3EQLF 1PUEE 4A3GJ 2V4JC 3PO3J 2L7KA 3RIRA 5F1RA 1E17A 1GV5A 2OA4A 1X3UA 1ETWA 2NOJB 3ZN0A 3GZNB 2E1CA 4HRIA 3OYIA 4QPOA 2H6BA 3ZQ7A 1Z77A 1OYIA 1YIOA 2JWTA 3SJMA 4OIOF 1MNEA 3CJRB 1BJAA 4PSWA 3N97A 2HGCA 4I0BA 1POGA 3ASNH 5GTHC 2VBZA 2FBHA 3KP6A 1V5GA 3SFIA 2E5NA 2P5VA 3E0JB 1UHSA 2TCTA 4PK4A 2OF7A 4B3XA 2JUGA 2F6CA 3FK7A 1BA5A 3HOVJ 1JGSA 4RGUA 1RKTA 4BDYA 5FROA 3HHHA 3R61A 3C2HA 2DFFA 4M3BA 4U7BA 3BTLA 3DBLB 4UVCA 2CUFA 2A05A 1T08B 2NS7A 3TEDA 4MHGA 1MSFC 2FQ4A 3TP0A 3WODF 3GFLA 4P9FA 3H5RA 3A01A 3AG2H 5DUKA 2KRHA 4HDUA 1RPWA 2D1VA 3JRBA 1JXSA 3DLLF 5FLXZ 4AIKA 2K40A 2IGOA 4RS8A 1FSHA 1RR7A 3IHUA 4LG3A 2FOKA 1U8RA 2EZIA 2JMWA 1ZLKA 4DNCA 1JTXA 1G3WA 1N25A 4Q48A 3F22A 1LDKB 3H92A 1FOKA 2WAQA 1QGPA 3ZP5A 2E19A 4BNCA 1OCCH 5KNLA 2VE9A 5C4XJ 1QHHD 1S5LC 2P7VB 3PM1A 1R1UA 2R0QC 3PQJA 2DYRH 4Y7NJ 2DTZA 1V4RA 4I01A 5FRNA 3U21A 2HTSA 2STWA 1GXQA 1IF1A 4A6EA 3CC4I 3CLOA 2CO5A 4ENKA 4KNYA 3EYIA 4P9UA 4BAYA 1KYWA 1K78A 2IRFG 2FXAA 4XSZF 1A04A 2LD5A 3FX3A 4M74A 1RUOA 3J80Z 4DGWB 2ZC2A 1J75A 3K2AA 2E5ZA 5IT9Z 4HV5A 5GAEJ 2EA2A 3QODA 1I27A 2LKSA 3QU6A 2R7TA 2D1HA 2RNJA 3ZPLA 2VASA 1D3YA 1K78B 1Y0UA 4BKXA 3MZ8A 3CCLI 2JA2A 4HX8A 1XGOA 2HI3A 3TKYA 2XROA 3LAPA 4CZZA 1YI2I 4FASD 2EIJH 4XORA 2FNPA 2FEZA 2KRCA 2VQCA 2PEXA 3CC2I 2QQBA 3CP2A 5EYRA 4ZH4F 1MBGA 1V54H 3C7JA 4A3EJ 4O3MA 3BZCA 5ICGA 2CMPA 1JKPC 4EJVA 3M9AA 3HB9A 4H0EA 4I0AA 2XPVA 2B0LA 3G6EI 5LLQA 1OKRA 3F8NA 1QZZA 2V26A 5AIPA 2VOOA 4EJOA 4XNFA 4U0YA 1ENHA 1E2XA 3KLNA 4R1HA 2KT0A 3WHBA 3BZKA 3TOAA 5ICEA 3CO6C 2QSGX 1VNDA 2BZTA 1H88C 1VZ0A 2ZNYA 1F5TA 2DOEA 2WB1N 5CVRA 1QZYA 5H6RA 4ZYEA 1IW7F 3E97A 5JHUA 3OS2A 4CCLA 1J0RA 4E6KG 2Q1ZB 2M5WA 4IVNA 4EM0B 3F8FA 1MD0A 2DOFA 2ZXJA 4C3HJ 3L2WA 2XF7A 3NRVA 1U8BA 3VYRB 2K9NA 3IH4A 2R3SA 1ITYA 1WH7A 3M1CA 3DP7A 2FMYA 1FOYA 1H0MA 1SD6A 4LK0F 1EH8A 1OCRH 3DPLC 3KPHA 1WPKA 2DQLA 3S1RJ 1DDNA 1NG7A 1S7EA 3CLQA 4F93B 2XDVA 3LMMA 3G73A 4KIFA 4KISA 1FWZA 1WQ2A 3H0GJ 3VOEA 2P6TA 3FKIJ 2OUMA 1VQPI 1O3SA 2BE5F 2KRFA 2QF7A 4YFKF 2WA0A 3HG9A 4LD5A 4HG2A 4CDGA 1B6AA 2LNBA 2VQGA 3KEOA 1EV7A 2ZBKA 1D8JA 2EK5A 4ESFA 2DW4A 2FF4A 4QIWN 4JK1X 3HTSB 4F91B 2EFWA 3FXLA 3D1NI 3TDUC 4ETSA 2K9QA 3BJOA 3MAJA 1ETKA 4CCKA 1ZTRA 3OOUA 3CMYA 4L18B 2MLGA 2OZ6A 4V19K 4EGYA 3JRAA 1ETOA 4IL6C 1U9OA 2RVCA 4CZCA 2VL8A 4L0YB 2P5LC 2ETHA 2OV7A 1YJNI 2HVQA 2HS5A 1YLFA 3GFJA 3NEUA 2VPLA 3BC8A 2FE3A 4Y3OA 1JE8A 1QHGA 4XIDA 1JHFA 2K9LA 3GTGJ 4I99C 2KZGA 2YU3A 1TBXA 1USTA 4HX7A 3C1DA 3EUKL 3SQNA 1G3SA 3D5LA 4IPAA 2XC7A 5JI6A 4BJTA 1L3LA 5EJCA 1T56A 3E5XA 4YELA 3TOBA 2QA4I 2JUCA 4PSXA 3A1YA 2PFBA 3ESWB 3NARA 2DA6A 4HA8A 5GAHJ 4XLFA 3Q3SA 4PUSA 1MBKA 1WJ5A 3KP3A 2KDOA 2DDBA 4RGSA 4YFNF 2RQQA 2V7FA 4H4KC 2R7WA 1ETQA 1R36A 1F43A 4P5OA 2WV1A 3S2DJ 1REPC 2PMUA 1D1AA 4AYBA 5E8GA 5CYVA 5DTDA 3FZVA 5BOXA 1B59A 4XMYA 2BHYA 3S3MA 1BN5A 2XSJC 1WFXA 3WU1B 4MEYF 4LLLA 1Z0XA 4IX7A 3LNQA 2M0MA 2KIQA 4XKCA 3CJNA 4HQMA 2XGEA 2QZ8A 2DODA
chains in the Genus database with same CATH topology
5LRSA 3HSRA 1G3YA 2P5KA 1BM9A 3L2CA 2GAUA 1HW1A 5EEGA 3B02A 2EA4A 3V8KA 3RDIA 1J59A 1B9MA 2STTA 3JTHA 2VBXA 4S04A 1J9IA 1UCRA 2AXLA 1SD5A 3KZZA 3KLOA 1RIOH 2A6EF 2M8EA 4JQFA 3HRTA 4PGGA 2CQKA 2DBBA 3S2WA 1KQ0A 4PGHA 2OBPA 1K79A 5F64A 1BI1A 1B9NA 3P7NA 5DCFA 2BV6A 3FHZA 1VTNC 3WTXC 3I71A 1EH7A 3ZN1A 2D45A 2LKPA 3U1DA 2CG4A 3P9CA 2KJCA 1LB2A 4D0PA 1ZG3A 4RB3C 2L01A 1SMYF 5LEJA 4I09A 2L4AA 1IXRC 4RGRA 2EWNA 2QWWA 2H94A 2A07F 1IRGA 5D4RA 1EH6A 3Q9SA 5E1WA 5K5RA 3GZ6A 1FP1D 1BI3A 2PG4A 3K69A 2ACJA 5CJ9A 3VEPA 4LMYA 5CVUA 2F5CA 3HHGA 1FT9A 1W7PD 2KIUA 4GGGA 2HQNA 4MQVA 4Z2YA 4LGWA 2XHKA 1PP8F 4GCVA 4IF4A 3DV8A 5E20A 2Z99A 1RZ4A 3PQKA 1T0FA 3V4GA 3FMQA 2IP2A 4U0VA 2M30A 2COMA 2EFQA 2PBIA 2DK8A 5D6EA 2HKXA 1XGNA 4HZFA 2NRAC 5CLSA 3BROA 4KA4A 2MC3A 3MWMA 3WGGA 3HOTA 4KIGA 1RUNA 1R5GA 2ZKZA 1FBUA 5TJJA 4PDKA 1P6RA 1QBJA 2A61A 4UNOA 3LA2A 5D8LB 4RB1A 1YTYA 5AONA 1RNLA 2YX7A 3T1BA 3V8JA 5A2QK 1ZRFA 3FM3A 2LF7A 2VONA 1YW9A 3CUOA 4UVBA 4LG0A 2IT0A 2MH2A 3J7AO 4JBAA 3RPUA 4M72A 4EMSA 3E6DA 5ICFA 2FBKA 2G7HA 1J5YA 2P8TA 1D8KA 1MJ9A 1SFXA 2YSRA 3GFMA 4LG0B 4EM1A 4ZYHA 2A5YB 4G8XA 1G3TA 1TTYA 1OPCA 4AIHA 1BI0A 3E6MA 4UV9A 4MTEA 1HKQA 3DXJF 2VXZA 2H27A 2HOEA 1KU2A 5H6QA 5FB2A 3RJPA 4M9ZA 5E1ZB 2H09A 3F8BA 1IUYA 4A0ZA 4L0ZB 4N0BA 4LLNA 1K7AA 4OU0A 4HV6A 4WCGA 2LDUA 2M1BA 1WKMA 1TNTA 3WU0A 3U2RA 2IPQX 3I5UA 2WC2A 1TNSA 3K0LA 2R7FA 3LA3A 1ZN2A 4XBFA 1MDMA 3ZMZA 1FZPB 4KUMA 1S7OA 4ESBA 5L3GA 5FFXA 4OINF 2FRHA 2F5FA 5DUIA 1MDMB 4KN4X 3NQOA 1T6SA 2RDPA 3W6KB 4EJWA 1IN6A 1B4AA 2RQPA 5HLIA 1MKMA 1BC7C 3K9TA 2QBYA 3BWGA 1SFEA 1Q1HA 2IA2A 2NNNA 4U88A 2ZMEB 4CHUA 5D6FA 2XAGA 2F2EA 4MNUA 2OZUA 2XUBA 3L09A 1CGPA 2QBYB 1FBQA 1Z05A 3JAMK 1WI9A 1ZLJA 5DCMB 3LAJA 3TQNA 4UHTA 3F72A 3VODA 3LQRA 3GEZA 4XLNF 4G6DA 1V3FA 4BQAA 4O5VA 2V1DA 4WXCA 3RKXA 4UVAA 2BEOA 4UUVA 2ELHA 1W5SA 4BH9A 1TQPA 1AWCA 2RC4A 3V7SA 2Z5UA 2GIVA 4AD9A 4F7ZA 3ERED 1Z6RA 4G6QA 1KU3A 1HSTA 1TLHB 5D5UB 2NYXA 3E6BA 3Q5FA 1ZRDA 3L7WA 2XKOA 2HYGD 5ILVA 3F21A 5D8KB 4P96A 3I53A 1WRJA 1UHWA 4OIQF 3ZMSA 3GO5A 2G7UA 3F8MA 3WE3A 2CFXA 4M73A 1T38A 5L3FA 3KZYA 3WTVC 2VT3A 3GWZA 1W5TA 4RAYA 3SXYA 2IW5A 5BS6A 2VE8A 1ZGJA 1LQ1A 1IN7A 4P55A 2DO7A 1ZH5A 4KDPA 3GFIA 5JR3A 1K6OA 3JTGA 1ZREA 3TGNA 5LGTA 2JTVA 2KIMA 5LHHA 3ML6A 1DUXC 2CSOA 4AWXB 1ZAOA 3H3UA 2FNAA 3WGIA 4WK8F 4YIFA 3WTWC 1W4MA 4IHSA 2F5EA 4RGXA 3HRUA 4A0XA 4CO8A 5ICCA 1UB9A 1ZRCA 5BMZA 4L9NA 1LNWA 5J8FA 2OD5A 3HRSA 3ABUA 1USSA 3T8TA 1XSXA 2ZCWA 3MQ0A 4A6DA 4UXNA 2JT1A 3H3ZA 3QP6A 3ECHA 3QOPA 1YS7A 1R5HA 2WWYA 1SFUA 4FT8A 4FHTA 4HBLA 3FM5A 2DI3A 3CO7C 2Y0MA 1FPQA 3T5XA 5HVQC 4OOIA 3LQQA 4CXFA 2V1UA 3BJAA 3JSOA 2M87A 5DEQA 3EYYA 1KU9A 2UXNA 1QO0D 3COAC 2KKOA 1ZG1A 4GYGA 5IT3A 1XSVA 2EB7A 1KQ9A 3WE2A 2O03A 2OU2A 3HYIA 2X0LA 1J2XA 4ESJA 2AS5F 4HF1A 2CW0F 1GVJA 1UFMA 2J5PA 4OIRF 3BOQA 1KQ8A 2HWVA 3I59A 1P4WA 1XMKA 1W7PA 2O0YA 4OMZA 2K27A 4Q47A 3KEQA 3I59B 3CTAA 1FC3A 1F9NA 1ON2A 1BI2A 1W7PB 3K1PA 3JAMZ 2IVMA 5E18F 4KMFA 4HOBA 2BGCA 4KT5C 4NHJA 3F8CA 1QNTA 2TDXA 4HLYA 1ZYRF 3WTZA 5CVJA 2DPUA 2QLZA 2XV4S 5DDGA 2C6YA 1PDNC 3DKWA 1XSDA 2FU4A 4S05A 3M8EA 1P4AA 3E3VA 3R6SA 1S29A 2PJPA 1FP2A 1HSJA 3MCZA 4KMUX 2EV6A 2DTRA 1HQCA 4HF0A 5HOOA 1YQAA 1SD4A 4MTDA 2Y48A 4L9VA 2V1XA 1FYKA 3SFZA 4IRHA 3ZMVA 5JFRA 3HRMA 5HS9A 5LEKA 3BY6A 2J5OA 3SHFA 4EJTA 2EJRA 1G6NA 4G7OF 5AIQA 1XB4A 2IJLA 1TQIA 3CDHA 3HUGA 3RYPA 4GXOA 2ZO4A 4LLGF 5DD4A 4YG2F 2PQ8A 1BOAA 3IRQA 1Z7UA 1HKSA 5J8CA 3QRFF 2FSWA 4LK1F 2RV8A 2YR2A 4HX4A 5D5XB 3ULQB 2HEOA 3IWFA 2ZJ2A 4QLCU 4HAMA 5HDKA 1XGSA 3KP2A 1HXDA 1OMIA 2EFNA 1IN4A 2Z9OA 5BPIA 5KVRA 1R58A 3M8FA 2VBYA 3P9IA 3I64A 3V7RA 2Z33A 1H9GA 5LGUA 4RB2C 3M7GA 3DF8A 2X4HA 5CVVA 1AOYA 2VC0A 2HZTA 1Z9CA 3JW4A 2NAZA 2QYOA 1JHHA 1S3JA 3MZYA 2QENA 3TO6A 3JSPA 4YFXF 2PI0A 4ZYGA 1I1SA 1I1GA 4HQEA 1G4DA 4GYIA 3GX4X 2M45A 3ZMDA 4MQ9F 1YW7A 5JVTA 4NQWA 1MJAA 2FQ3A 4RB0A 3LSTA 1U5TC 1U5TA 3L9FA 1YFHA 2JZYA 1TQMA 5IT9K 3QPHA 1YG2A 4WXDA 5CVIA 1U5TB 2A6HF 4MEXF 2KIFA 2VOPA 3D0SA 3GZ5A 3REOA 2A3SA 3E5UA 4G7ZF 3I58A 4QWQA 5HDNA 4Q5SF 2ESHA 3BP8A 3FF5A 2E1NA 2HR3A 3RI4A 5FGMA 3I4PA 3GW2A 2JPBA 1R1VA 2NNYA 4MGRA 3R4KA 4M6XA 2P4WA 4A12A 4ZZDA 4LB6B 2HFHA 1U2WA 3EETA 4EJUA 3F6VA 4EM2A 1IZ1A 5HDGA 4WXHA 1HKTA 2IA1A 4ASNA 4G9YA 4LJZF 5BQTA 3IRRA 3KCCA 2A68F 3K2ZA 2Y75A 2XAQA 3ELKA 4PZJA 2DFIA 4LB5A 2QUFA 1STZA 2QQAA 4Y17A 3RYRA 3T0YA 3M1EA 3K1MA 2Q0OA 1UHMA 2YPRA 5K5OA 1H9TA 3V8LA 1I5ZA 4A2UA 1IRFA 4ZZLA 1XMAA 3C3WA 3R0JA 2ZMEA 1FBSA 2IA0A 2DAOA 5L3CA 3TO9A 1DPUA 4Q4ZF 1ON1A 5L3DA 4WF2A 2R7DA 1YW8A 5K1YA 2L54A 2E7WA 3N4MA 2XAFA 2H6CA 2W85A 3SZTA 5DCMA 3RKYA 3WTTC 1TW2A 4AIJA 3ZMTA 1BBYA 2XVCA 2ZFWA 4G7HF 3ABTA 3BZ6A 3F6OA 3GF2A 2WTEA 4RAZA 3V7CA 3DEUA 4HW0A 3KP7A 2YX4A 4KIBA 2RN7A 5LRRA 1IAWA 5LGNA 1ONVA 4FX4A 2LF8A 1FSEA 2O3FA 1BIBA 1YYVA 4TV7A 3VFZA 4ENMA 4O6JA 2F5DA 5DV5A 2FMLA 4BYYA 4L5IA 5DD8A 2VT2A 1T98A 1DP7P 3FXRA 2W84A 1XCBA 3TDZC 5FD6A 2L02A 2GXGA 3HSFA 3ZMUA 2MD5A 3OV8A 1KGSA 1ZHFA 2DU9A 4XLPF 1R00A 2FA5A 3L00A 1YO5C 2QVOA 3MZHA 5ED4A 5KK1A 1IN8A 5FFZA 4BHCA 4IHTA 1P2FA 5D5WB 5HS7A 3I54A 3QAHA 2O61A 3SZPA 3E5QA 2GA1A 1R7JA 5E17F 2UWMA 1WWXA 4KYWA 3T8RA 4R79A 5A2QZ 4L5JA 3G3ZA 2Q2EA 4IJAA 3RKWA 2GQQA 3PFIA 1R23A 2FBIA 4M6YA 4ON0A 3J81K 4ENJA 3CUQC 3CUQA 1ZARA 3WTSC 2PN6A 2K02A 4M9XA 2E7XA 3KFWX 1TW3A 4CGZA 1S7AA 1HW5A 1O57A 3CUQB 3LWFA 3HIFA 4AVPA 2QQ9A 3W6JB 2XAHA 1F4KA 1PP7U 3E6CC 4DQ2A 1B1BA 5L3EA 2MH9A 2JSCA 4I02A 1FLIA 2CWEA 5L3BA 2CGPA 1KA8A 1FY7A 4BHPA 1RI7A 1S6LA 1XDUA 5LBQA 5H20A 2XGXA 2QM3A 1O7FA 1LVAA 2HDCA 3F3XA 1J7KA 3IL2A 1C0WA 3ROUA 2DQRA 5J6XA 3FMRA 2JRTA 2UXXA 3DFGA 4FX0A 1BIAA 5K5QA 2A69F 4CICA 2HTJA 1OYWA 3GYHX 2XRNA 5D4SA 1QPMA 3F23A 1MJBA 4N9HA 2GA2A 3BPXA 3IKVA 4B8XA 4A5MA 1ZG5A 2VN2A 4EGZA 3AAFA 2P6SA 1T39A 2JPCA 4I98B 2XIGA 3O3KA 4HYEA 2HQRA 1SMTA 2MBFA 2Q8KA 4B09A 2LSOA 1D5VA 4GO1A 1U78A 1U3EM 2VC1A 3EUHA 2HKOA 3VB2A 3LFKA 3R60A 3QPTA 1LJ9A 3B73A 3DPTA 2PLYA 3EDPA 2K4BA 2EFPA 3IWZA 1HW2A 5EEHA 3QP5A 3C18A 1IXCA 1HBXG 3QU3A 4UV8A 3IKTA 2G9WA 4CYDA 1LDDA 2ISYA 4A5NA 5HLHA 2OAZA 1LEBA 2PMHA 1Z91A 2L4MA 1XDSA 2EV5A 3GLXA 2K86A 4EVIA 4XRFA 2V9VA 1O7LA 1F1ZA 3FXQA 5BPDA 2HYFA 4OMYA 3K1NA 4IRIA 2O6GE 4I2OA 3RTRA 1GHCA 2XASA 5ILSA 1FX7A 4M71A 2Z3YA 4E70A 2XAJA 2CYYA 2BBYA 2DLLA 3HTUA 4LFUA 3WGHA 4HF2A 1O3QA 1Z6TA 4IRGA 5D5VB 3GXOA 4KFCA 4Y15A 4U0WA 3FWEA 1U6GA 2GXBA 4ENNA 5FD5A 2GZWA 2ZNZA 3BJ6A 2RKHA 4N9IA 3R0AA 1ZGAA 3J81Z 3OOPA 2EFOA 2O8XA 1ODDA 2ISZA 4BXUA 3DQVC 5LHGA 4WWCA 2ADUA 3P9KA 5HS8A 2UZKA 2DK5A 1P92A 5FLXK 5FO5A 2W24A 3FXUA 3BDDA 1SD7A 2W25A 4KICA 1IXSB 1NHAA 1FNNA 1I6XA 4U7DA 4L9TA 4I7HA 1MGTA 3WTYC 5HLGA 3LA7A 3KE2A 1Z1DA 3MEXA 1R1TA 1GXPA 1T2KA 4R8HA 5ERIA 1DPRA 4M9SA 3J80K 3KETA 1FYLA 2MA3A 5DYMA 4ZYDA 2P7CB 4YIIA 2OQRA 2KJBA 5E1XA 2K4JA 3O6BB 1O3RA 3HOSA 3O2PE 4HDVA 4XSXF 3IC7A 3GUDA 1WSUA 2V79A 2L3DA 4PCQA 2EV0A 3Q9VA 4KN7X 1LDJA 3TO7A 4Y13A 1KU7A 1LEAA 2DPDA 1MZBA 1OYYA 3GVAA 1XCVA 2V6CA 1CF7A 5TRDA 2VBWA 1FYMA 4BHBA 4IXAA 1XGMA 2BYVE 4WX9A 1BC8C 4K2EA 1SAXA 4HLXA 4L9JA 1CF7B 2RGVA 3HSEA 1R22A 1P4XA 2W57A 2DT5A 5ILUA 4A0YA 4EQQA 1L0OC 2NS0A 2MLKA 2VODA 2WV0A 1S8NA 2GWRA 3KP5A 3I0TA 3RPQA 2XKPA 1XN7A 5E8IA 1OR7A 1KYZA 1XD7A 2OQGA 1IN5A 1ULYA 1YS6A 4EV0A 3ECOA 5F6FA 3U9GA 3KP4A 4NB5A 1QQIA 2ESNA 3WG9A 3MFKA 3WTUC 2K7LA 4OIPF 6PAXA 4G94A 3BPVA 5LHIA 3FMSA 1O3TA 3ISPA 3EQLF 1PUEE 3RIRA 5F1RA 1E17A 2OA4A 1X3UA 3ZN0A 2E1CA 2H6BA 3ZQ7A 1OYIA 1YIOA 4OIOF 1BJAA 3N97A 2HGCA 4I0BA 2VBZA 2FBHA 3KP6A 2P5VA 1JGSA 4RGUA 3HHHA 3R61A 4U7BA 4UVCA 4MHGA 3WODF 3GFLA 4P9FA 5DUKA 4HDUA 2D1VA 1JXSA 5FLXZ 4AIKA 4RS8A 1FSHA 3IHUA 2FOKA 1U8RA 1ZLKA 4DNCA 1G3WA 4Q48A 3F22A 1LDKB 3H92A 1FOKA 1QGPA 3ZP5A 4BNCA 2VE9A 2P7VB 1R1UA 3PQJA 1V4RA 4I01A 2HTSA 2STWA 1GXQA 1IF1A 4A6EA 3CLOA 2CO5A 4ENKA 4KNYA 3EYIA 4P9UA 4BAYA 1KYWA 1K78A 2IRFG 2FXAA 4XSZF 1A04A 1RUOA 3FX3A 4M74A 3J80Z 1J75A 5IT9Z 4HV5A 2EA2A 1I27A 3QU6A 2D1HA 2RNJA 3ZPLA 1D3YA 1K78B 1Y0UA 4HX8A 1XGOA 3TKYA 3LAPA 2XROA 4CZZA 2FNPA 2FEZA 2PEXA 2QQBA 4ZH4F 3C7JA 4O3MA 5ICGA 4EJVA 3M9AA 4H0EA 4I0AA 2B0LA 5LLQA 1OKRA 3F8NA 1QZZA 5AIPA 2VOOA 4EJOA 4U0YA 1E2XA 3KLNA 4R1HA 3TOAA 5ICEA 3CO6C 2ZNYA 1F5TA 5CVRA 1QZYA 4ZYEA 5H6RA 1IW7F 3E97A 5JHUA 1J0RA 2M5WA 4IVNA 4EM0B 3F8FA 1MD0A 2ZXJA 3NRVA 2R3SA 3DP7A 2FMYA 1H0MA 1SD6A 4LK0F 1EH8A 3DPLC 1DDNA 2DQLA 3G73A 4KIFA 1FWZA 1WQ2A 3VOEA 2P6TA 1O3SA 2BE5F 2KRFA 4YFKF 4LD5A 4CDGA 1B6AA 2LNBA 3KEOA 1EV7A 2ZBKA 1D8JA 2EK5A 4ESFA 2DW4A 2FF4A 4JK1X 3HTSB 2EFWA 3TDUC 4ETSA 3BJOA 3MAJA 4L18B 2MLGA 2OZ6A 4EGYA 2RVCA 4L0YB 2P5LC 2ETHA 2HS5A 1YLFA 3GFJA 3NEUA 2FE3A 1JE8A 1JHFA 2YU3A 1TBXA 1USTA 4HX7A 3C1DA 3SQNA 1G3SA 3D5LA 4IPAA 5JI6A 1L3LA 3E5XA 3TOBA 2PFBA 4HA8A 3KP3A 4RGSA 4YFNF 1R36A 4P5OA 1REPC 2PMUA 5E8GA 5CYVA 3FZVA 5BOXA 1B59A 1BN5A 3WU1B 4MEYF 4LLLA 3CJNA 4HQMA 2QZ8A 2D2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LRS A;  3HSR A;  1G3Y A;  2P5K A;  1BM9 A;  3L2C A;  2GAU A;  1HW1 A;  5EEG A;  3B02 A;  2EA4 A;  3V8K A;  3RDI A;  1J59 A;  1B9M A;  2STT A;  3JTH A;  2VBX A;  4S04 A;  1J9I A;  1UCR A;  2AXL A;  1SD5 A;  3KZZ A;  3KLO A;  1RIO H;  2A6E F;  2M8E A;  4JQF A;  3HRT A;  4PGG A;  2CQK A;  2DBB A;  3S2W A;  1KQ0 A;  4PGH A;  2OBP A;  1K79 A;  5F64 A;  1BI1 A;  1B9N A;  3P7N A;  5DCF A;  2BV6 A;  3FHZ A;  1VTN C;  3WTX C;  3I71 A;  1EH7 A;  3ZN1 A;  2D45 A;  2LKP A;  3U1D A;  2CG4 A;  3P9C A;  2KJC A;  1LB2 A;  4D0P A;  1ZG3 A;  4RB3 C;  2L01 A;  1SMY F;  5LEJ A;  4I09 A;  2L4A A;  1IXR C;  4RGR A;  2EWN A;  2QWW A;  2H94 A;  2A07 F;  1IRG A;  5D4R A;  1EH6 A;  3Q9S A;  5E1W A;  5K5R A;  3GZ6 A;  1FP1 D;  1BI3 A;  2PG4 A;  3K69 A;  2ACJ A;  5CJ9 A;  3VEP A;  4LMY A;  5CVU A;  2F5C A;  3HHG A;  1FT9 A;  1W7P D;  2KIU A;  4GGG A;  2HQN A;  4MQV A;  4Z2Y A;  4LGW A;  2XHK A;  1PP8 F;  4GCV A;  4IF4 A;  3DV8 A;  5E20 A;  2Z99 A;  1RZ4 A;  3PQK A;  1T0F A;  3V4G A;  3FMQ A;  2IP2 A;  4U0V A;  2M30 A;  2COM A;  2EFQ A;  2PBI A;  2DK8 A;  5D6E A;  2HKX A;  1XGN A;  4HZF A;  2NRA C;  5CLS A;  3BRO A;  4KA4 A;  2MC3 A;  3MWM A;  3WGG A;  3HOT A;  4KIG A;  1RUN A;  1R5G A;  2ZKZ A;  1FBU A;  5TJJ A;  4PDK A;  1P6R A;  1QBJ A;  2A61 A;  4UNO A;  3LA2 A;  5D8L B;  4RB1 A;  1YTY A;  5AON A;  1RNL A;  2YX7 A;  3T1B A;  3V8J A;  5A2Q K;  1ZRF A;  3FM3 A;  2LF7 A;  2VON A;  1YW9 A;  3CUO A;  4UVB A;  4LG0 A;  2IT0 A;  2MH2 A;  3J7A O;  4JBA A;  3RPU A;  4M72 A;  4EMS A;  3E6D A;  5ICF A;  2FBK A;  2G7H A;  1J5Y A;  2P8T A;  1D8K A;  1MJ9 A;  1SFX A;  2YSR A;  3GFM A;  4LG0 B;  4EM1 A;  4ZYH A;  2A5Y B;  4G8X A;  1G3T A;  1TTY A;  1OPC A;  4AIH A;  1BI0 A;  3E6M A;  4UV9 A;  4MTE A;  1HKQ A;  3DXJ F;  2VXZ A;  2H27 A;  2HOE A;  1KU2 A;  5H6Q A;  5FB2 A;  3RJP A;  4M9Z A;  5E1Z B;  2H09 A;  3F8B A;  1IUY A;  4A0Z A;  4L0Z B;  4N0B A;  4LLN A;  1K7A A;  4OU0 A;  4HV6 A;  4WCG A;  2LDU A;  2M1B A;  1WKM A;  1TNT A;  3WU0 A;  3U2R A;  2IPQ X;  3I5U A;  2WC2 A;  1TNS A;  3K0L A;  2R7F A;  3LA3 A;  1ZN2 A;  4XBF A;  1MDM A;  3ZMZ A;  1FZP B;  4KUM A;  1S7O A;  4ESB A;  5L3G A;  5FFX A;  4OIN F;  2FRH A;  2F5F A;  5DUI A;  1MDM B;  4KN4 X;  3NQO A;  1T6S A;  2RDP A;  3W6K B;  4EJW A;  1IN6 A;  1B4A A;  2RQP A;  5HLI A;  1MKM A;  1BC7 C;  3K9T A;  2QBY A;  3BWG A;  1SFE A;  1Q1H A;  2IA2 A;  2NNN A;  4U88 A;  2ZME B;  4CHU A;  5D6F A;  2XAG A;  2F2E A;  4MNU A;  2OZU A;  2XUB A;  3L09 A;  1CGP A;  2QBY B;  1FBQ A;  1Z05 A;  3JAM K;  1WI9 A;  1ZLJ A;  5DCM B;  3LAJ A;  3TQN A;  4UHT A;  3F72 A;  3VOD A;  3LQR A;  3GEZ A;  4XLN F;  4G6D A;  1V3F A;  4BQA A;  4O5V A;  2V1D A;  4WXC A;  3RKX A;  4UVA A;  2BEO A;  4UUV A;  2ELH A;  1W5S A;  4BH9 A;  1TQP A;  1AWC A;  2RC4 A;  3V7S A;  2Z5U A;  2GIV A;  4AD9 A;  4F7Z A;  3ERE D;  1Z6R A;  4G6Q A;  1KU3 A;  1HST A;  1TLH B;  5D5U B;  2NYX A;  3E6B A;  3Q5F A;  1ZRD A;  3L7W A;  2XKO A;  2HYG D;  5ILV A;  3F21 A;  5D8K B;  4P96 A;  3I53 A;  1WRJ A;  1UHW A;  4OIQ F;  3ZMS A;  3GO5 A;  2G7U A;  3F8M A;  3WE3 A;  2CFX A;  4M73 A;  1T38 A;  5L3F A;  3KZY A;  3WTV C;  2VT3 A;  3GWZ A;  1W5T A;  4RAY A;  3SXY A;  2IW5 A;  5BS6 A;  2VE8 A;  1ZGJ A;  1LQ1 A;  1IN7 A;  4P55 A;  2DO7 A;  1ZH5 A;  4KDP A;  3GFI A;  5JR3 A;  1K6O A;  3JTG A;  1ZRE A;  3TGN A;  5LGT A;  2JTV A;  2KIM A;  5LHH A;  3ML6 A;  1DUX C;  2CSO A;  4AWX B;  1ZAO A;  3H3U A;  2FNA A;  3WGI A;  4WK8 F;  4YIF A;  3WTW C;  1W4M A;  4IHS A;  2F5E A;  4RGX A;  3HRU A;  4A0X A;  4CO8 A;  5ICC A;  1UB9 A;  1ZRC A;  5BMZ A;  4L9N A;  1LNW A;  5J8F A;  2OD5 A;  3HRS A;  3ABU A;  1USS A;  3T8T A;  1XSX A;  2ZCW A;  3MQ0 A;  4A6D A;  4UXN A;  2JT1 A;  3H3Z A;  3QP6 A;  3ECH A;  3QOP A;  1YS7 A;  1R5H A;  2WWY A;  1SFU A;  4FT8 A;  4FHT A;  4HBL A;  3FM5 A;  2DI3 A;  3CO7 C;  2Y0M A;  1FPQ A;  3T5X A;  5HVQ C;  4OOI A;  3LQQ A;  4CXF A;  2V1U A;  3BJA A;  3JSO A;  2M87 A;  5DEQ A;  3EYY A;  1KU9 A;  2UXN A;  1QO0 D;  3COA C;  2KKO A;  1ZG1 A;  4GYG A;  5IT3 A;  1XSV A;  2EB7 A;  1KQ9 A;  3WE2 A;  2O03 A;  2OU2 A;  3HYI A;  2X0L A;  1J2X A;  4ESJ A;  2AS5 F;  4HF1 A;  2CW0 F;  1GVJ A;  1UFM A;  2J5P A;  4OIR F;  3BOQ A;  1KQ8 A;  2HWV A;  3I59 A;  1P4W A;  1XMK A;  1W7P A;  2O0Y A;  4OMZ A;  2K27 A;  4Q47 A;  3KEQ A;  3I59 B;  3CTA A;  1FC3 A;  1F9N A;  1ON2 A;  1BI2 A;  1W7P B;  3K1P A;  3JAM Z;  2IVM A;  5E18 F;  4KMF A;  4HOB A;  2BGC A;  4KT5 C;  4NHJ A;  3F8C A;  1QNT A;  2TDX A;  4HLY A;  1ZYR F;  3WTZ A;  5CVJ A;  2DPU A;  2QLZ A;  2XV4 S;  5DDG A;  2C6Y A;  1PDN C;  3DKW A;  1XSD A;  2FU4 A;  4S05 A;  3M8E A;  1P4A A;  3E3V A;  3R6S A;  1S29 A;  2PJP A;  1FP2 A;  1HSJ A;  3MCZ A;  4KMU X;  2EV6 A;  2DTR A;  1HQC A;  4HF0 A;  5HOO A;  1YQA A;  1SD4 A;  4MTD A;  2Y48 A;  4L9V A;  2V1X A;  1FYK A;  3SFZ A;  4IRH A;  3ZMV A;  5JFR A;  3HRM A;  5HS9 A;  5LEK A;  3BY6 A;  2J5O A;  3SHF A;  4EJT A;  2EJR A;  1G6N A;  4G7O F;  5AIQ A;  1XB4 A;  2IJL A;  1TQI A;  3CDH A;  3HUG A;  3RYP A;  4GXO A;  2ZO4 A;  4LLG F;  5DD4 A;  4YG2 F;  2PQ8 A;  1BOA A;  3IRQ A;  1Z7U A;  1HKS A;  5J8C A;  3QRF F;  2FSW A;  4LK1 F;  2RV8 A;  2YR2 A;  4HX4 A;  5D5X B;  3ULQ B;  2HEO A;  3IWF A;  2ZJ2 A;  4QLC U;  4HAM A;  5HDK A;  1XGS A;  3KP2 A;  1HXD A;  1OMI A;  2EFN A;  1IN4 A;  2Z9O A;  5BPI A;  5KVR A;  1R58 A;  3M8F A;  2VBY A;  3P9I A;  3I64 A;  3V7R A;  2Z33 A;  1H9G A;  5LGU A;  4RB2 C;  3M7G A;  3DF8 A;  2X4H A;  5CVV A;  1AOY A;  2VC0 A;  2HZT A;  1Z9C A;  3JW4 A;  2NAZ A;  2QYO A;  1JHH A;  1S3J A;  3MZY A;  2QEN A;  3TO6 A;  3JSP A;  4YFX F;  2PI0 A;  4ZYG A;  1I1S A;  1I1G A;  4HQE A;  1G4D A;  4GYI A;  3GX4 X;  2M45 A;  3ZMD A;  4MQ9 F;  1YW7 A;  5JVT A;  4NQW A;  1MJA A;  2FQ3 A;  4RB0 A;  3LST A;  1U5T C;  1U5T A;  3L9F A;  1YFH A;  2JZY A;  1TQM A;  5IT9 K;  3QPH A;  1YG2 A;  4WXD A;  5CVI A;  1U5T B;  2A6H F;  4MEX F;  2KIF A;  2VOP A;  3D0S A;  3GZ5 A;  3REO A;  2A3S A;  3E5U A;  4G7Z F;  3I58 A;  4QWQ A;  5HDN A;  4Q5S F;  2ESH A;  3BP8 A;  3FF5 A;  2E1N A;  2HR3 A;  3RI4 A;  5FGM A;  3I4P A;  3GW2 A;  2JPB A;  1R1V A;  2NNY A;  4MGR A;  3R4K A;  4M6X A;  2P4W A;  4A12 A;  4ZZD A;  4LB6 B;  2HFH A;  1U2W A;  3EET A;  4EJU A;  3F6V A;  4EM2 A;  1IZ1 A;  5HDG A;  4WXH A;  1HKT A;  2IA1 A;  4ASN A;  4G9Y A;  4LJZ F;  5BQT A;  3IRR A;  3KCC A;  2A68 F;  3K2Z A;  2Y75 A;  2XAQ A;  3ELK A;  4PZJ A;  2DFI A;  4LB5 A;  2QUF A;  1STZ A;  2QQA A;  4Y17 A;  3RYR A;  3T0Y A;  3M1E A;  3K1M A;  2Q0O A;  1UHM A;  2YPR A;  5K5O A;  1H9T A;  3V8L A;  1I5Z A;  4A2U A;  1IRF A;  4ZZL A;  1XMA A;  3C3W A;  3R0J A;  2ZME A;  1FBS A;  2IA0 A;  2DAO A;  5L3C A;  3TO9 A;  1DPU A;  4Q4Z F;  1ON1 A;  5L3D A;  4WF2 A;  2R7D A;  1YW8 A;  5K1Y A;  2L54 A;  2E7W A;  3N4M A;  2XAF A;  2H6C A;  2W85 A;  3SZT A;  5DCM A;  3RKY A;  3WTT C;  1TW2 A;  4AIJ A;  3ZMT A;  1BBY A;  2XVC A;  2ZFW A;  4G7H F;  3ABT A;  3BZ6 A;  3F6O A;  3GF2 A;  2WTE A;  4RAZ A;  3V7C A;  3DEU A;  4HW0 A;  3KP7 A;  2YX4 A;  4KIB A;  2RN7 A;  5LRR A;  1IAW A;  5LGN A;  1ONV A;  4FX4 A;  2LF8 A;  1FSE A;  2O3F A;  1BIB A;  1YYV A;  4TV7 A;  3VFZ A;  4ENM A;  4O6J A;  2F5D A;  5DV5 A;  2FML A;  4BYY A;  4L5I A;  5DD8 A;  2VT2 A;  1T98 A;  1DP7 P;  3FXR A;  2W84 A;  1XCB A;  3TDZ C;  5FD6 A;  2L02 A;  2GXG A;  3HSF A;  3ZMU A;  2MD5 A;  3OV8 A;  1KGS A;  1ZHF A;  2DU9 A;  4XLP F;  1R00 A;  2FA5 A;  3L00 A;  1YO5 C;  2QVO A;  3MZH A;  5ED4 A;  5KK1 A;  1IN8 A;  5FFZ A;  4BHC A;  4IHT A;  1P2F A;  5D5W B;  5HS7 A;  3I54 A;  3QAH A;  2O61 A;  3SZP A;  3E5Q A;  2GA1 A;  1R7J A;  5E17 F;  2UWM A;  1WWX A;  4KYW A;  3T8R A;  4R79 A;  5A2Q Z;  4L5J A;  3G3Z A;  2Q2E A;  4IJA A;  3RKW A;  2GQQ A;  3PFI A;  1R23 A;  2FBI A;  4M6Y A;  4ON0 A;  3J81 K;  4ENJ A;  3CUQ C;  3CUQ A;  1ZAR A;  3WTS C;  2PN6 A;  2K02 A;  4M9X A;  2E7X A;  3KFW X;  1TW3 A;  4CGZ A;  1S7A A;  1HW5 A;  1O57 A;  3CUQ B;  3LWF A;  3HIF A;  4AVP A;  2QQ9 A;  3W6J B;  2XAH A;  1F4K A;  1PP7 U;  3E6C C;  4DQ2 A;  1B1B A;  5L3E A;  2MH9 A;  2JSC A;  4I02 A;  1FLI A;  2CWE A;  5L3B A;  2CGP A;  1KA8 A;  1FY7 A;  4BHP A;  1RI7 A;  1S6L A;  1XDU A;  5LBQ A;  5H20 A;  2XGX A;  2QM3 A;  1O7F A;  1LVA A;  2HDC A;  3F3X A;  1J7K A;  3IL2 A;  1C0W A;  3ROU A;  2DQR A;  5J6X A;  3FMR A;  2JRT A;  2UXX A;  3DFG A;  4FX0 A;  1BIA A;  5K5Q A;  2A69 F;  4CIC A;  2HTJ A;  1OYW A;  3GYH X;  2XRN A;  5D4S A;  1QPM A;  3F23 A;  1MJB A;  4N9H A;  2GA2 A;  3BPX A;  3IKV A;  4B8X A;  4A5M A;  1ZG5 A;  2VN2 A;  4EGZ A;  3AAF A;  2P6S A;  1T39 A;  2JPC A;  4I98 B;  2XIG A;  3O3K A;  4HYE A;  2HQR A;  1SMT A;  2MBF A;  2Q8K A;  4B09 A;  2LSO A;  1D5V A;  4GO1 A;  1U78 A;  1U3E M;  2VC1 A;  3EUH A;  2HKO A;  3VB2 A;  3LFK A;  3R60 A;  3QPT A;  1LJ9 A;  3B73 A;  3DPT A;  2PLY A;  3EDP A;  2K4B A;  2EFP A;  3IWZ A;  1HW2 A;  5EEH A;  3QP5 A;  3C18 A;  1IXC A;  1HBX G;  3QU3 A;  4UV8 A;  3IKT A;  2G9W A;  4CYD A;  1LDD A;  2ISY A;  4A5N A;  5HLH A;  2OAZ A;  1LEB A;  2PMH A;  1Z91 A;  2L4M A;  1XDS A;  2EV5 A;  3GLX A;  2K86 A;  4EVI A;  4XRF A;  2V9V A;  1O7L A;  1F1Z A;  3FXQ A;  5BPD A;  2HYF A;  4OMY A;  3K1N A;  4IRI A;  2O6G E;  4I2O A;  3RTR A;  1GHC A;  2XAS A;  5ILS A;  1FX7 A;  4M71 A;  2Z3Y A;  4E70 A;  2XAJ A;  2CYY A;  2BBY A;  2DLL A;  3HTU A;  4LFU A;  3WGH A;  4HF2 A;  1O3Q A;  1Z6T A;  4IRG A;  5D5V B;  3GXO A;  4KFC A;  4Y15 A;  4U0W A;  3FWE A;  1U6G A;  2GXB A;  4ENN A;  5FD5 A;  2GZW A;  2ZNZ A;  3BJ6 A;  2RKH A;  4N9I A;  3R0A A;  1ZGA A;  3J81 Z;  3OOP A;  2EFO A;  2O8X A;  1ODD A;  2ISZ A;  4BXU A;  3DQV C;  5LHG A;  4WWC A;  2ADU A;  3P9K A;  5HS8 A;  2UZK A;  2DK5 A;  1P92 A;  5FLX K;  5FO5 A;  2W24 A;  3FXU A;  3BDD A;  1SD7 A;  2W25 A;  4KIC A;  1IXS B;  1NHA A;  1FNN A;  1I6X A;  4U7D A;  4L9T A;  4I7H A;  1MGT A;  3WTY C;  5HLG A;  3LA7 A;  3KE2 A;  1Z1D A;  3MEX A;  1R1T A;  1GXP A;  1T2K A;  4R8H A;  5ERI A;  1DPR A;  4M9S A;  3J80 K;  3KET A;  1FYL A;  2MA3 A;  5DYM A;  4ZYD A;  2P7C B;  4YII A;  2OQR A;  2KJB A;  5E1X A;  2K4J A;  3O6B B;  1O3R A;  3HOS A;  3O2P E;  4HDV A;  4XSX F;  3IC7 A;  3GUD A;  1WSU A;  2V79 A;  2L3D A;  4PCQ A;  2EV0 A;  3Q9V A;  4KN7 X;  1LDJ A;  3TO7 A;  4Y13 A;  1KU7 A;  1LEA A;  2DPD A;  1MZB A;  1OYY A;  3GVA A;  1XCV A;  2V6C A;  1CF7 A;  5TRD A;  2VBW A;  1FYM A;  4BHB A;  4IXA A;  1XGM A;  2BYV E;  4WX9 A;  1BC8 C;  4K2E A;  1SAX A;  4HLX A;  4L9J A;  1CF7 B;  2RGV A;  3HSE A;  1R22 A;  1P4X A;  2W57 A;  2DT5 A;  5ILU A;  4A0Y A;  4EQQ A;  1L0O C;  2NS0 A;  2MLK A;  2VOD A;  2WV0 A;  1S8N A;  2GWR A;  3KP5 A;  3I0T A;  3RPQ A;  2XKP A;  1XN7 A;  5E8I A;  1OR7 A;  1KYZ A;  1XD7 A;  2OQG A;  1IN5 A;  1ULY A;  1YS6 A;  4EV0 A;  3ECO A;  5F6F A;  3U9G A;  3KP4 A;  4NB5 A;  1QQI A;  2ESN A;  3WG9 A;  3MFK A;  3WTU C;  2K7L A;  4OIP F;  6PAX A;  4G94 A;  3BPV A;  5LHI A;  3FMS A;  1O3T A;  3ISP A;  3EQL F;  1PUE E;  3RIR A;  5F1R A;  1E17 A;  2OA4 A;  1X3U A;  3ZN0 A;  2E1C A;  2H6B A;  3ZQ7 A;  1OYI A;  1YIO A;  4OIO F;  1BJA A;  3N97 A;  2HGC A;  4I0B A;  2VBZ A;  2FBH A;  3KP6 A;  2P5V A;  1JGS A;  4RGU A;  3HHH A;  3R61 A;  4U7B A;  4UVC A;  4MHG A;  3WOD F;  3GFL A;  4P9F A;  5DUK A;  4HDU A;  2D1V A;  1JXS A;  5FLX Z;  4AIK A;  4RS8 A;  1FSH A;  3IHU A;  2FOK A;  1U8R A;  1ZLK A;  4DNC A;  1G3W A;  4Q48 A;  3F22 A;  1LDK B;  3H92 A;  1FOK A;  1QGP A;  3ZP5 A;  4BNC A;  2VE9 A;  2P7V B;  1R1U A;  3PQJ A;  1V4R A;  4I01 A;  2HTS A;  2STW A;  1GXQ A;  1IF1 A;  4A6E A;  3CLO A;  2CO5 A;  4ENK A;  4KNY A;  3EYI A;  4P9U A;  4BAY A;  1KYW A;  1K78 A;  2IRF G;  2FXA A;  4XSZ F;  1A04 A;  1RUO A;  3FX3 A;  4M74 A;  3J80 Z;  1J75 A;  5IT9 Z;  4HV5 A;  2EA2 A;  1I27 A;  3QU6 A;  2D1H A;  2RNJ A;  3ZPL A;  1D3Y A;  1K78 B;  1Y0U A;  4HX8 A;  1XGO A;  3TKY A;  3LAP A;  2XRO A;  4CZZ A;  2FNP A;  2FEZ A;  2PEX A;  2QQB A;  4ZH4 F;  3C7J A;  4O3M A;  5ICG A;  4EJV A;  3M9A A;  4H0E A;  4I0A A;  2B0L A;  5LLQ A;  1OKR A;  3F8N A;  1QZZ A;  5AIP A;  2VOO A;  4EJO A;  4U0Y A;  1E2X A;  3KLN A;  4R1H A;  3TOA A;  5ICE A;  3CO6 C;  2ZNY A;  1F5T A;  5CVR A;  1QZY A;  4ZYE A;  5H6R A;  1IW7 F;  3E97 A;  5JHU A;  1J0R A;  2M5W A;  4IVN A;  4EM0 B;  3F8F A;  1MD0 A;  2ZXJ A;  3NRV A;  2R3S A;  3DP7 A;  2FMY A;  1H0M A;  1SD6 A;  4LK0 F;  1EH8 A;  3DPL C;  1DDN A;  2DQL A;  3G73 A;  4KIF A;  1FWZ A;  1WQ2 A;  3VOE A;  2P6T A;  1O3S A;  2BE5 F;  2KRF A;  4YFK F;  4LD5 A;  4CDG A;  1B6A A;  2LNB A;  3KEO A;  1EV7 A;  2ZBK A;  1D8J A;  2EK5 A;  4ESF A;  2DW4 A;  2FF4 A;  4JK1 X;  3HTS B;  2EFW A;  3TDU C;  4ETS A;  3BJO A;  3MAJ A;  4L18 B;  2MLG A;  2OZ6 A;  4EGY A;  2RVC A;  4L0Y B;  2P5L C;  2ETH A;  2HS5 A;  1YLF A;  3GFJ A;  3NEU A;  2FE3 A;  1JE8 A;  1JHF A;  2YU3 A;  1TBX A;  1UST A;  4HX7 A;  3C1D A;  3SQN A;  1G3S A;  3D5L A;  4IPA A;  5JI6 A;  1L3L A;  3E5X A;  3TOB A;  2PFB A;  4HA8 A;  3KP3 A;  4RGS A;  4YFN F;  1R36 A;  4P5O A;  1REP C;  2PMU A;  5E8G A;  5CYV A;  3FZV A;  5BOX A;  1B59 A;  1BN5 A;  3WU1 B;  4MEY F;  4LLL A;  3CJN A;  4HQM A;  2QZ8 A;  2D2W A; 
#chains in the Genus database with same CATH topology
 5LRS A;  3FXJ A;  3HSR A;  1G3Y A;  3B6A A;  1APL C;  2P5K A;  1BM9 A;  3MKL A;  5FJ8 J;  3L2C A;  2ZXW H;  1YHQ I;  1YIT I;  2GAU A;  2CW7 A;  3PFY A;  1HW1 A;  3L2V A;  5EEG A;  2EZK A;  3B02 A;  4XLH A;  3VYU B;  1MBE A;  2EA4 A;  3V8K A;  1R9T J;  1XX5 A;  3RDI A;  2EZH A;  1J59 A;  1B9M A;  2STT A;  3JTH A;  2OPT A;  2VBX A;  2XPW A;  4S04 A;  3OYH A;  1TWC J;  1ETV A;  2R5Y A;  1J9I A;  1UCR A;  2AXL A;  1SD5 A;  4IHW A;  3KZZ A;  2L0K A;  3KLO A;  1RIO H;  2A6E F;  1UMQ A;  2M8E A;  4JQF A;  5J1U A;  1W0T A;  2E2J J;  2JA7 J;  4BJ5 C;  2YU9 J;  2M0C A;  3HRT A;  4V2G A;  2FJ1 A;  4PGG A;  2CQK A;  2DBB A;  3S2W A;  3C2G A;  2R5Y B;  1QA6 A;  2I10 A;  5LFA A;  4DW6 A;  3K4M A;  1OLT A;  4A3L J;  1KQ0 A;  2XF6 A;  3DTK A;  2DMT A;  2P81 A;  2RNG A;  2OBP A;  4MIM A;  4PGH A;  1K79 A;  5F64 A;  1SFO J;  2VJ4 A;  4J01 A;  1BI1 A;  2HVR A;  1B9N A;  3I9V 2;  3OR1 C;  3P7N A;  2QSH X;  5DCF A;  4AUX A;  2BXZ A;  2BV6 A;  1F36 A;  2CUE A;  3VSK A;  3JR9 A;  3FHZ A;  1VTN C;  4I6Z A;  3WTX C;  1SAN A;  2KLO A;  3I71 A;  1EH7 A;  3ZN1 A;  2D45 A;  5KCM A;  2LKP A;  4B1R A;  3S2H J;  2LR8 A;  1SEU A;  3U1D A;  2CG4 A;  3P9C A;  2KJC A;  3OIO A;  4QPQ A;  3KYL A;  2GXA A;  2Y2Z A;  3D5S C;  1LB2 A;  4D0P A;  3M8J A;  1ZG3 A;  1VQO I;  4RB3 C;  2L01 A;  1UAA A;  3GTO J;  1SMY F;  5LEJ A;  4I09 A;  2L4A A;  3K10 A;  1IXR C;  4F55 A;  4RGR A;  2EWN A;  2QWW A;  2H94 A;  2A07 F;  1AKH B;  3W2A A;  1WHU A;  1IRG A;  4CCO A;  3ONQ A;  2BW3 B;  5D4R A;  2E2I J;  1EH6 A;  3Q9S A;  3P5J A;  2OCC H;  3S1Q J;  1UJ8 A;  2RRE A;  5E1W A;  1QPI A;  5K5R A;  3H9G A;  2E34 A;  3GZ6 A;  2CQN A;  1FP1 D;  1BI3 A;  2PG4 A;  4W97 A;  2M4G A;  3K69 A;  5J4Y A;  4RAF A;  4UB8 C;  4GRI A;  3BR0 A;  2BY1 A;  4ZJZ A;  3I56 I;  4BBR J;  2ACJ A;  5CJ9 A;  5JLX A;  3SZG A;  4EAT A;  3VEP A;  4BEH B;  3H35 A;  1VFC A;  1JKR C;  4LMY A;  4FQG A;  3OYE A;  4PFO A;  5CVU A;  2CV0 A;  1B72 A;  2F5C A;  3HHG A;  3ABK H;  3UR3 C;  2ZJQ F;  1FT9 A;  1FJL A;  1W7P D;  2OCE A;  2KIU A;  4GGG A;  2DXI A;  1NK3 P;  2QEX I;  4FE7 A;  2HQN A;  4MQV A;  2HOA A;  3NWT A;  4FCY A;  4Z2Y A;  5FKO A;  4LGW A;  2XHK A;  1PP8 F;  4GCV A;  3GTP J;  4IF4 A;  3DV8 A;  5E20 A;  3FXM A;  3W2W A;  2Z99 A;  4DBR A;  1ZK8 A;  3VSL A;  1V5E A;  1T0F C;  1RZ4 A;  3PQK A;  5KHD A;  5HOD A;  1T0F A;  3V4G A;  1VQ7 I;  3FMQ A;  2IP2 A;  4U0V A;  2M30 A;  2DCE A;  2COM A;  2EFQ A;  2PBI A;  3OSF A;  3TL4 X;  2DK8 A;  5D6E A;  4IZZ A;  2JN6 A;  5IYD J;  2IAI A;  3GTM J;  4XQF A;  3LSP A;  2HKX A;  1XGN A;  1X2N A;  4HZF A;  2NRA C;  1WJC A;  5CLS A;  3BRO A;  3BR5 A;  4KA4 A;  1JKO C;  2MC3 A;  3MWM A;  3WGG A;  3MMY B;  4XK4 A;  2TRT A;  3HOT A;  2HPI A;  1JT6 A;  3CMA I;  4KIG A;  3A02 A;  1RUN A;  1ERD A;  1R5G A;  1JUS A;  2ZKZ A;  3MD2 A;  1FBU A;  5TJJ A;  1FOW A;  4PDK A;  4BY7 J;  4XM3 A;  3W2V A;  2HNH A;  2MC4 A;  3FK6 A;  1P6R A;  2LC2 A;  1QBJ A;  2A61 A;  4UNO A;  4CYC B;  3LA2 A;  3BG7 A;  5D8L B;  1EKE A;  4NQW B;  4RB1 A;  1YTY A;  1MIJ A;  1YE9 A;  3IP4 B;  2DA4 A;  4C3I J;  5AON A;  1RKW A;  3CCJ I;  1R4M B;  3CME I;  1HDD C;  1RNL A;  2YX7 A;  3T1B A;  2DA7 A;  3HJE A;  3V8J A;  2ZFU A;  3K6G A;  2DMN A;  5A2Q K;  1ZRF A;  1YJW I;  5EDN A;  3FM3 A;  1WCM J;  2VKE A;  1T33 A;  2M34 A;  3PNT A;  2BXY A;  3PNV A;  2LF7 A;  4XON A;  1A5J A;  2VON A;  1YW9 A;  3CUO A;  1B8I A;  3CES A;  4UVB A;  2R7R A;  4LG0 A;  4BE0 A;  2IT0 A;  2MH2 A;  3J7A O;  4JBA A;  3RPU A;  4M72 A;  4EMS A;  3E6D A;  4LIU A;  4II3 A;  3AL0 B;  1FOX A;  5ICF A;  1R5I D;  2FBK A;  3LSH A;  2G7H A;  1J5Y A;  4D9J A;  2P8T A;  1D8K A;  3VYT B;  3DEW A;  4QSH A;  3HOZ J;  3DCF A;  1MJ9 A;  1SFX A;  2L9S A;  1B8I B;  4C30 A;  2YSR A;  3BR3 A;  3GFM A;  5DM6 F;  1Z3X A;  3VPR A;  4LG0 B;  4U87 A;  1YOV B;  3Q0V A;  2DJI A;  1QU3 A;  4IHX A;  2KQR A;  5J1R A;  5FLV A;  4E7K A;  3ZOB A;  4EM1 A;  4ZYH A;  4B44 A;  2A5Y B;  1VQK I;  2VPR A;  4G8X A;  2NVY J;  1G3T A;  1TTY A;  1A6I A;  1OPC A;  4L5E A;  3N05 A;  4AIH A;  3CF2 A;  1BI0 A;  3E6M A;  4UV9 A;  4MTE A;  4XRS G;  3M3Y J;  2BHZ A;  2Z1D A;  1HKQ A;  5EEA A;  3DXJ F;  4XLC A;  4E7I A;  2VXZ A;  2Y31 A;  2HU9 A;  2H27 A;  1QZE A;  1XC5 A;  2P0W A;  2HOE A;  5EF6 A;  1DP3 A;  1KU2 A;  5H6Q A;  1S9H A;  1W5C C;  5FB2 A;  3RJP A;  3S32 A;  3OS1 A;  4XN3 A;  1OCO H;  1K4S A;  4M9Z A;  5E1Z B;  4AU7 A;  2LBF B;  2R5Z B;  4BQN A;  1DU0 A;  2H09 A;  3F8B A;  3BTJ A;  1IUY A;  4Y33 A;  2AO9 A;  2VUM J;  3L1P A;  2O7O A;  4HST A;  4A0Z A;  2CQX A;  4L0Z B;  4N0B A;  4LLN A;  2DN0 A;  1K7A A;  5EGO A;  4OU0 A;  5H2F C;  2R4G A;  4HV6 A;  4WCG A;  2LDU A;  2M1B A;  5GAG J;  1WKM A;  2FUG 2;  3OYN A;  1TNT A;  3WU0 A;  3U2R A;  2IPQ X;  3I5U A;  2MG4 A;  2OC6 A;  2WC2 A;  2Y0S A;  1TNS A;  1E0E A;  1YX5 A;  2B7E A;  3K0L A;  2R7F A;  3GBG A;  1ZN2 A;  3LA3 A;  1OCZ H;  4MLO A;  4XBF A;  3ZMZ A;  1MDM A;  1FZP B;  4KUM A;  1S7O A;  5EGO B;  1OQY A;  5GPA A;  4JX6 A;  4ESB A;  1SVM A;  5L3G A;  3K4B A;  3S3N A;  5FFX A;  4OIN F;  2FRH A;  3BCB A;  2F5F A;  1NG6 A;  1SC7 A;  5DUI A;  1MMD A;  1MDM B;  2ZME C;  4KN4 X;  3NQO A;  1D5Y A;  1T6S A;  2RDP A;  3W6K B;  4EJW A;  1IN6 A;  1B4A A;  2RQP A;  5HLI A;  3O8H A;  1MKM A;  2LOO A;  4M3G A;  3K9T A;  4E7L A;  1BC7 C;  2QBY A;  3PSF A;  3OSG A;  3BWG A;  2W82 A;  1Y6I A;  3DU6 A;  3U1K A;  1I3A A;  5E3L A;  1SFE A;  1Q1H A;  2IA2 A;  2NNN A;  1XG1 A;  4U88 A;  3UNG C;  5CKT A;  2ZME B;  3OYC A;  4CHU A;  5D6F A;  5B5E C;  2XAG A;  2F2E A;  4MNU A;  1IC8 A;  2OZU A;  2XUB A;  3L09 A;  1IJW C;  1CGP A;  1FBQ A;  1SAU A;  4LIT A;  2QBY B;  4BY1 J;  1Z05 A;  4A3F J;  3CQZ J;  3JAM K;  1LKX A;  1WI9 A;  1ZLJ A;  2E1O A;  5DCM B;  5IYB J;  3LAJ A;  3TQN A;  4DBQ A;  2ELJ A;  4UHT A;  3F72 A;  4KIT B;  1RRJ A;  3VOD A;  3LQR A;  3RSN A;  1Y1V J;  3GEZ A;  4JP0 A;  3RCO A;  2HVS A;  4A3K J;  2MSY A;  4XLN F;  2LVS A;  4G6D A;  3AG3 H;  3OMY A;  1V3F A;  4BQA A;  4YIR X;  4O5V A;  2V1D A;  4WXC A;  3RKX A;  4UVA A;  2BEO A;  2HPM A;  4UUV A;  2ELH A;  1ZR4 A;  2JK3 A;  4JX4 A;  1VI0 A;  1W5S A;  2QQ8 A;  3W3C A;  4BH9 A;  1TQP A;  4IQ4 A;  1AWC A;  2RC4 A;  1VQ9 I;  3V7S A;  2Z5U A;  2GIV A;  1DQU A;  4AD9 A;  1ZKG A;  4UUS A;  1WJD A;  5K7H A;  3OYA A;  1IDY A;  4BQQ A;  4F7Z A;  3ERE D;  1ACI A;  1Z6R A;  4G6Q A;  1KU3 A;  4D7N A;  1HST A;  1TLH B;  5D5U B;  2NYX A;  3L2Q A;  1LVK A;  1TZL A;  2N8G A;  1U9N A;  3E6B A;  4B3A A;  3Q5F A;  4F52 A;  5GTI C;  1ZRD A;  3HGY A;  3ZGK A;  3HOY J;  4UUS B;  3L7W A;  1X1A A;  1J09 A;  3RZD J;  3H3V K;  3SEZ A;  2XKO A;  2M9H A;  2HYG D;  5ILV A;  1W36 D;  3F21 A;  2VQL A;  5D8K B;  1NTC A;  4P96 A;  3I53 A;  1WRJ A;  2X1E A;  2M2E A;  1UHW A;  4OIQ F;  2L5Q A;  5M3M J;  2MW8 A;  3ZMS A;  3GO5 A;  2G7U A;  3F8M A;  3WE3 A;  2CFX A;  3A0H C;  5JLW A;  4M73 A;  2ZXH A;  4G6T B;  1T38 A;  5L3F A;  2WY7 Q;  3KZY A;  3WTV C;  2ECC A;  2VT3 A;  3CCY A;  2H8W A;  1HC8 A;  3GWZ A;  2R93 J;  1W5T A;  4ZTF A;  4RAY A;  3SXY A;  2IW5 A;  5IP6 A;  1RES A;  5BS6 A;  4XOT A;  1N77 A;  4PJM A;  2M7B A;  2VE8 A;  1ZGJ A;  1LQ1 A;  1OJL A;  1IN7 A;  2NXN B;  3X2Q H;  2VKV A;  4P55 A;  1WGX A;  1UG2 A;  2DO7 A;  1ZH5 A;  4KDP A;  3GFI A;  1VQ4 I;  5JR3 A;  3DTI A;  3CCE I;  1K6O A;  3JTG A;  4PJL A;  1ZRE A;  3CZ6 A;  2Z16 A;  3TGN A;  3OL4 A;  3KX2 A;  4BUP A;  5LGT A;  3AG1 H;  1U0J A;  2JTV A;  3SYT A;  2KIM A;  3IH2 A;  5LHH A;  1YRN B;  1QRY A;  2AHQ A;  3OS0 A;  4NC8 A;  4RLF A;  3ML6 A;  3H5A A;  1DUX C;  2CSO A;  4AWX B;  1ZAO A;  2Q2E B;  3CDI A;  3H3U A;  4HPQ A;  4NDL A;  2FNA A;  3QYB A;  3WGI A;  4WK8 F;  2LYC A;  4YIF A;  3HM5 A;  2Y9Y A;  5CQG A;  4JX5 A;  1MBF A;  3WTW C;  2ZSI B;  1W4M A;  4IHS A;  1P9Q C;  2BOL A;  2F5E A;  4RGX A;  3H36 A;  3HRU A;  3I3L A;  3CCM I;  2A6T A;  3HXL A;  4M3F A;  4A0X A;  3MKZ A;  1MMN A;  4CO8 A;  2LH9 A;  5ICC A;  1UB9 A;  2F4O B;  3PO2 J;  4BE1 A;  1ZRC A;  5BMZ A;  3F0C A;  4BL0 B;  2CQ7 A;  1AU7 A;  2I8D A;  4L9N A;  1LNW A;  2XAU A;  2G0E A;  3VDX A;  2NVQ J;  5J8F A;  1XTA A;  2OD5 A;  3HRS A;  3ABU A;  1USS A;  4KT6 A;  5FKK A;  3T8T A;  1XSX A;  2ZCW A;  3MQ0 A;  4A6D A;  1LFB A;  4UXN A;  2JT1 A;  3H3Z A;  3QP6 A;  1ZGW A;  3ECH A;  3B6C A;  3QOP A;  1YS7 A;  1Y39 A;  1R5H A;  2WWY A;  1SFU A;  3J7Z I;  4FT8 A;  4FHT A;  4HBL A;  3FM5 A;  4HNV A;  2L9V A;  1JI8 A;  2DI3 A;  2GM4 A;  4AC0 A;  1Z3Y A;  3CO7 C;  2Y0M A;  2PMZ N;  1FPQ A;  2EPF A;  2JVG A;  2X6O A;  3T5X A;  2KHM A;  5HVQ C;  4OOI A;  3OYK A;  3LQQ A;  4CXF A;  2V1U A;  3BJA A;  1YX3 A;  1MND A;  3JSO A;  2M87 A;  5DEQ A;  3MVP A;  3EYY A;  1KU9 A;  2UXN A;  1QO0 D;  5B3S H;  3COA C;  1FIA A;  2KKO A;  2Y9Z A;  4HSR A;  1ZG1 A;  4GYG A;  4CA0 A;  1N78 A;  1G2H A;  1WH5 A;  1ZEL A;  3CC7 I;  5IT3 A;  3RQ4 A;  1XSV A;  3LOC A;  1R49 A;  2EB7 A;  1KQ9 A;  3WE2 A;  2O03 A;  4AYB N;  5EG0 A;  1LUJ B;  2OU2 A;  3HYI A;  4RM2 A;  2X0L A;  1J2X A;  4ESJ A;  2AS5 F;  4HF1 A;  2CW0 F;  2H8R A;  2LTP A;  1GVJ A;  1UFM A;  2J5P A;  4OIR F;  2VQH A;  3BOQ A;  2BVL A;  2ME6 A;  3IAS 2;  1Y1W J;  5EG0 B;  4RM3 A;  1EF4 A;  1KQ8 A;  2HWV A;  4UB6 C;  3I59 A;  2X1C A;  1P4W A;  1XMK A;  2L7M P;  3NAU A;  1W7P A;  4IOA F;  2O0Y A;  3QQA A;  4OMZ A;  3JRE A;  2X48 A;  2K27 A;  1NH3 A;  4M3E A;  4Q47 A;  2IS2 A;  3MN2 A;  1XMX A;  3KEQ A;  3I59 B;  3CTA A;  1EJ9 A;  1FC3 A;  1F9N A;  1ON2 A;  1BI2 A;  1W7P B;  3BG5 A;  2CRG A;  5TGT A;  3K1P A;  3CF5 F;  3JAM Z;  2IVM A;  5E18 F;  4RBO A;  4KMF A;  4HOB A;  3CCR I;  1BW5 A;  2BGC A;  4KT5 C;  4RA2 A;  4NHJ A;  1I50 J;  3F8C A;  1QNT A;  2TDX A;  4HLY A;  1HOM A;  1ZYR F;  3K4C A;  3WTZ A;  5CVJ A;  2HZD A;  2A5W A;  2DPU A;  1UZC A;  3HDD A;  2QLZ A;  2PX9 A;  2XV4 S;  5DDG A;  4PJJ A;  5DM7 F;  2C6Y A;  1PDN C;  1BR2 A;  2V6E A;  2VLA A;  2CW8 A;  2AQE A;  3DKW A;  2DDA A;  1XSD A;  2FU4 A;  5M5W J;  4S05 A;  2LRD A;  4XR6 A;  3CCV I;  3ZQC A;  3M8E A;  3DWL E;  1P4A A;  5F27 A;  3E3V A;  3R6S A;  1S29 A;  3IH3 A;  2IEK A;  2PJP A;  1FP2 A;  1HSJ A;  3BG9 A;  3MCZ A;  4KMU X;  4NNJ A;  3H0D A;  3K70 C;  1LE8 A;  2EV6 A;  1HQC A;  2CUJ A;  2DTR A;  4HF0 A;  5HOO A;  1YQA A;  2CJJ A;  1VQM I;  1SD4 A;  1JJ8 C;  4MTD A;  2Y69 H;  5CQE A;  2Y48 A;  4L9V A;  1CQT A;  2V1X A;  1FYK A;  1SVL A;  3SFZ A;  3A0B C;  3S3O A;  2L2O A;  4IRH A;  3ZMV A;  2IXS A;  5JFR A;  1LE8 B;  3HRM A;  4KJZ A;  5IYC J;  4BXX J;  5HS9 A;  4ANJ A;  5LEK A;  3BY6 A;  3OYJ A;  2J5O A;  2QSF X;  1K4T A;  3TMO A;  3SHF A;  5F0H A;  1AKH A;  3I55 I;  4EJT A;  3S8P A;  3G1L A;  2EJR A;  3JRC A;  1G6N A;  2BW3 A;  3QPS A;  2CV1 A;  4G7O F;  2IS4 A;  1D1C A;  5AIQ A;  1AHD P;  5E3N A;  3ZQL A;  3VYS B;  1XB4 A;  4XOP A;  2IJL A;  1TQI A;  1IGN A;  3CDH A;  5GAD J;  3HUG A;  3RYP A;  3ABM H;  4N4N B;  4GXO A;  1MBJ A;  5HNF A;  2ZO4 A;  4E7J A;  3S1M J;  1SVO A;  1BOB A;  4LLG F;  5DD4 A;  4YG2 F;  2PQ8 A;  1BOA A;  2YUS A;  3IRQ A;  1Z7U A;  2XSD C;  1HKS A;  3ZQI A;  5J8C A;  3QRF F;  3HEF A;  4NBQ A;  2FSW A;  4LK1 F;  3HUG B;  2RV8 A;  4BEH A;  1JKQ C;  2YR2 A;  1A6Q A;  1D0Z A;  2EQR A;  4HX4 A;  1YIJ I;  5D5X B;  3ULQ B;  1Y8Q B;  4M3D A;  3H1C A;  2HEO A;  3VWB A;  1UEL B;  3IWF A;  2PJR A;  1TWH J;  2ZJ2 A;  4X0G A;  4QLC U;  4HAM A;  1P7I A;  3BQY A;  2R7Z J;  5HDK A;  1WI3 A;  1TP4 A;  1XGS A;  2K9M A;  3KP2 A;  1Y8R B;  1HXD A;  1OMI A;  1E3O C;  2E36 A;  4ZDL A;  2EFN A;  1IN4 A;  3S17 J;  2DJN A;  4ZTJ A;  2Z9O A;  1N75 A;  5BPI A;  5KVR A;  2PJR B;  2WAD A;  2W4S A;  1R58 A;  3M8F A;  2KP6 A;  2MGQ A;  2VBY A;  5K7Z A;  3P9I A;  3K4J A;  1OIS A;  3I64 A;  2VJJ A;  3V7R A;  2Z33 A;  1H9G A;  3LSK A;  5LGU A;  3DBR B;  1D1B A;  4C3J J;  4RB2 C;  2CV2 A;  3S16 J;  1R4N B;  3DF8 A;  3M7G A;  3HL2 A;  2QKL B;  2X4H A;  5CVV A;  3DKX A;  1AOY A;  2VC0 A;  2HZT A;  1Z9C A;  4BGD A;  1KZH A;  3JW4 A;  2NAZ A;  2QYO A;  1JHH A;  1OCT C;  2V1N A;  1S3J A;  3JRF A;  3GTK J;  3MZY A;  4CH7 A;  2QEN A;  3TO6 A;  3JSP A;  4MFD A;  4E7S A;  1IV8 A;  4YFX F;  3D5R C;  2PI0 A;  3TBI A;  1EA3 A;  4ZYG A;  1I1S A;  1I1G A;  4HQE A;  2L7Z A;  1G4D A;  2JVH A;  4N4O B;  5JVG F;  4GYI A;  3GX4 X;  1XS9 A;  2M45 A;  3ZMD A;  3GCM A;  1YW7 A;  4MQ9 F;  4CYC A;  5JVT A;  2M3A A;  1MJA A;  3QYE A;  4NQW A;  1O4X A;  2FQ3 A;  4RB0 A;  5FKM A;  2XB0 X;  3LST A;  1MW7 A;  1U5T C;  2O8K A;  5IP7 J;  1U5T A;  3L9F A;  2ZJR F;  2BY2 A;  4ITV A;  4J19 A;  1YFH A;  2JZY A;  2W7N A;  1TQM A;  1TT5 B;  2GOX B;  5IT9 K;  4BXF A;  4FE4 A;  4GFB A;  2HXO A;  3QPH A;  3TW7 A;  3ZQQ A;  1YG2 A;  2GOM A;  3DBH B;  4WXD A;  2MYS A;  2NVX J;  5BNG A;  1VQ6 I;  3FBN B;  3MKY B;  5CVI A;  2DA1 A;  3G2B A;  1U5T B;  2IGN A;  3ASO H;  4CCJ A;  2A6H F;  3HKZ A;  4MEX F;  3S1N J;  2KIF A;  2VOP A;  3D0S A;  5IOZ A;  3GZ5 A;  4A3C J;  3REO A;  2A3S A;  3E5U A;  4G7Z F;  3I58 A;  4QWQ A;  5J3L A;  5HDN A;  4Q5S F;  2DYS H;  2ESH A;  1JUP A;  3BP8 A;  3A2K A;  2X9D A;  5J40 A;  3FF5 A;  2E1N A;  2HR3 A;  1GLN A;  3K4K A;  3RI4 A;  2VI6 A;  4BDZ A;  4B48 A;  1Z7L A;  2ZJP F;  3OY9 A;  5FGM A;  1YJ9 I;  2MAB A;  3GW2 A;  3I4P A;  3GTQ J;  1D0X A;  2JPB A;  1R1V A;  2LP0 A;  2NNY A;  2ZSH B;  4MGR A;  5M5X J;  4S0H B;  3R4K A;  1PUF A;  3ZQH A;  4M6X A;  2P4W A;  4A12 A;  4ZZD A;  4LB6 B;  4Z6Y A;  2HFH A;  1U2W A;  3EET A;  5F1J A;  1JJ6 C;  2WBM A;  3F6V A;  4EJU A;  4F92 B;  4LIV A;  4EM2 A;  1IZ1 A;  1GV2 A;  1X3Z B;  2EH3 A;  2VKH A;  5HDG A;  1IG7 A;  4WXH A;  4OAY A;  2EIK H;  2HOT A;  3A4C A;  1HKT A;  3OIP A;  2BVM A;  2IA1 A;  1PUF B;  3TP3 A;  4ASN A;  3ERM A;  3BCA A;  4G9Y A;  1H89 C;  1X4P A;  2LBF A;  2R5Z A;  1VQL I;  4LJZ F;  3CCQ I;  4V2F A;  4E4H A;  1BL0 A;  5BQT A;  4W1U A;  3IRR A;  2KDZ A;  3KCC A;  2A68 F;  3K2Z A;  2VJI A;  2Y75 A;  4BAC A;  2XAQ A;  3ELK A;  1LFP A;  3GLL A;  4PZJ A;  1BJZ A;  1W36 C;  2OTJ I;  5J47 A;  1OFC X;  2Y0S N;  1KON A;  2DFI A;  2KZV A;  3OWT A;  4LB5 A;  2QUF A;  1VQ8 I;  1X1B A;  3BT9 A;  1STZ A;  2QQA A;  4Y17 A;  4HNT A;  5E79 C;  3V42 A;  3RYR A;  3T0Y A;  3M1E A;  1VQN I;  2E60 A;  3K1M A;  1I3Q J;  2Q0O A;  1BR1 A;  1UHM A;  3HZJ A;  1IUF A;  2YPR A;  1DU6 A;  5K5O A;  3AFH A;  1H9T A;  3V8L A;  2DMU A;  1I5Z A;  2IBD A;  1AA7 A;  4A2U A;  1IRF A;  4ZZL A;  1XMA A;  4OWR B;  2WY8 Q;  3C3W A;  4IHV A;  5JHF A;  4RAG A;  3OYF A;  3R0J A;  5KAI C;  3LSM A;  2ZME A;  4Y4R A;  1FBS A;  2IA0 A;  2DAO A;  5L3C A;  3SDG A;  3TO9 A;  1A36 A;  1DPU A;  4Q4Z F;  4BS9 A;  1ON1 A;  1P7J A;  2EBI A;  3CCU I;  5L3D A;  1BW6 A;  4WF2 A;  2R7D A;  1YW8 A;  1LFU P;  4IO9 F;  5K1Y A;  1GVD A;  2L54 A;  2E7W A;  2I5U A;  3N4M A;  2JRM A;  2XAF A;  2H6C A;  2VB6 A;  2CFO A;  4RLQ A;  2W85 A;  3K4N A;  3SZT A;  3AKZ A;  5DCM A;  3RKY A;  3WTT C;  5LD2 C;  1WJA A;  4X1E A;  1JGG A;  1TW2 A;  4AIJ A;  3HC7 A;  3OYM A;  3M4O J;  2DFH A;  3CCS I;  3ZMT A;  2D5V A;  1BBY A;  2XVC A;  3FKJ A;  2DFE A;  2ZFW A;  4G7H F;  2L9N A;  3ABT A;  2CUZ A;  3BZ6 A;  3FXK A;  3F6O A;  3GF2 A;  2WTE A;  4RAZ A;  4DOZ A;  3V7C A;  2M4K A;  3CJQ B;  1X1P A;  2AQF A;  3DEU A;  4HW0 A;  3KP7 A;  4D7M A;  2F4M B;  2YX4 A;  4DYR A;  1Y56 A;  4GDF A;  3FXO A;  4KIB A;  2DT7 B;  2RN7 A;  2WAQ N;  2R7O A;  2M7A A;  2KFD A;  3QOE A;  5LRR A;  4AID A;  5HNH A;  3FBI B;  3AG4 H;  3ZQG A;  1IAW A;  5LGN A;  1ONV A;  2M8G X;  4FX4 A;  4A3D J;  2LF8 A;  1FSE A;  2RAE A;  3OR2 C;  5FLM J;  2O3F A;  1BIB A;  1E3H A;  1YYV A;  1QVU A;  2JJ7 A;  4TV7 A;  3MKW B;  2COB A;  3VFZ A;  4ENM A;  4O6J A;  2F5D A;  5DV5 A;  3RPU D;  3OYL A;  3RZO J;  3BR6 A;  4XKB A;  2FML A;  2XB5 A;  4BYY A;  2DA5 A;  2QCO A;  1HCR A;  4L5I A;  2NVT J;  2B9S A;  4A69 C;  3OYD A;  3PJR A;  5DD8 A;  1UG0 A;  2VT2 A;  1T98 A;  2NS8 A;  3F9K A;  1DP7 P;  3FXR A;  5F0C A;  2W84 A;  3CP8 A;  3PSI A;  1XCB A;  3A01 B;  3TDZ C;  4J00 A;  1X1C A;  5FD6 A;  2L02 A;  2GXG A;  3HSF A;  1RET A;  3ZMU A;  4D1Q A;  2V9P A;  3PIO F;  2MD5 A;  1MSE C;  1A31 A;  3JCU C;  4C2M J;  3OV8 A;  3QWL A;  1KGS A;  2XGC A;  1H8A C;  3IAM 2;  2KIS A;  2R7S A;  1ZHF A;  2UUZ A;  4FET A;  1E3P A;  2DU9 A;  3FIW A;  4XLP F;  1FIP A;  3Q0U A;  3JRD A;  1R00 A;  2FA5 A;  3L00 A;  1YO5 C;  2QVO A;  3MZH A;  2VIX A;  2LY1 A;  2GLO A;  2DMP A;  4JOM A;  5ED4 A;  1MH3 A;  5KK1 A;  5E3M A;  1IN8 A;  5FFZ A;  3WHC A;  3KYC B;  2B63 J;  4DIQ A;  4BHC A;  4IHT A;  1P2F A;  4ZYA A;  2DA2 A;  5D5W B;  5HS7 A;  3I54 A;  1XPX A;  2LK2 A;  3QAH A;  2O61 A;  5F0F A;  5K7F A;  3SZP A;  3E5Q A;  2GA1 A;  2HYJ A;  3JRH A;  1R7J A;  2F4I A;  5FKN A;  5E17 F;  1VF9 A;  4YEJ A;  3EPZ A;  2HDD A;  2UWM A;  1WWX A;  1JUM A;  1YRN A;  4KYW A;  2FX0 A;  3T8R A;  4R79 A;  4E7Z A;  4L5J A;  5F08 A;  3G3Z A;  5EZH A;  5A2Q Z;  2Q2E A;  4A3M J;  4IJA A;  3RKW A;  2GQQ A;  3PFI A;  3SEQ A;  5J1Y A;  1R23 A;  2FBI A;  4M6Y A;  4ON0 A;  4D5F A;  1SFK A;  3CUQ C;  3J81 K;  4ENJ A;  3CUQ A;  1PVE A;  4JYK A;  3HBL A;  1ZAR A;  3WTS C;  4BJ6 C;  2PN6 A;  2NOG A;  2XF5 A;  2K02 A;  4M9X A;  2E7X A;  3KFW X;  3ZXS A;  3BR2 A;  4CUG A;  1JT0 A;  1TW3 A;  4CGZ A;  1S7A A;  1HW5 A;  1TC3 C;  1PJR A;  1TWF J;  1O57 A;  3CUQ B;  2UV1 A;  3HIF A;  3LWF A;  4AVP A;  2QQ9 A;  3W6J B;  1WZ2 A;  2XAH A;  1F4K A;  1PP7 U;  2H1K A;  3E6C C;  3G1O A;  4DQ2 A;  1B1B A;  2R7Q A;  5L3E A;  1VQ5 I;  2MH9 A;  1TWA J;  1MBH A;  2EZL A;  2JSC A;  4I02 A;  1TL8 A;  1FLI A;  2R92 J;  2CWE A;  3BTC A;  2WB1 A;  1KA8 A;  5L3B A;  5M5Y J;  1FY7 A;  2GBY A;  2CGP A;  4BHP A;  1IO2 A;  2BY3 A;  4II2 A;  3PNY A;  4E7H A;  3BLY A;  2KPM A;  3A03 A;  1RI7 A;  1S6L A;  2ICW G;  2HQ5 A;  1S72 I;  1K83 J;  1XDU A;  3KYD B;  2IS6 A;  5LBQ A;  1OCP A;  2XRL A;  5H20 A;  2XGX A;  2K3F A;  2YS9 A;  3OYB A;  2QM3 A;  1O7F A;  2QKM B;  3I4M J;  1LVA A;  2HDC A;  2FD5 A;  3F3X A;  4A3J J;  1HA8 A;  1J7K A;  3IL2 A;  4XKW A;  3DLA A;  1C0W A;  3ROU A;  2DQR A;  5J6X A;  3FMR A;  2JRT A;  3LSI A;  2CH0 A;  2F5V A;  2UXX A;  3DFG A;  4FX0 A;  5FRM A;  1BIA A;  5K5Q A;  2A69 F;  2IGK A;  4XLE A;  4DZJ A;  5M3F J;  3PL8 A;  4MFE A;  3M07 A;  4CIC A;  1M1E B;  4DJA A;  2HTJ A;  4XN0 A;  1OYW A;  3GYH X;  1GT0 C;  2XRN A;  4YRV A;  3E7L A;  5D4S A;  1QPM A;  4XRM A;  2X6Y A;  3F23 A;  2JA5 J;  1MJB A;  4A93 J;  4N9H A;  3RQI A;  5IOY A;  2GA2 A;  3BPX A;  1Z21 A;  1G59 A;  1FMW A;  3O8G A;  3IKV A;  3RKQ A;  4B8X A;  1IDZ A;  4A5M A;  1ORK A;  1R6R A;  1ZG5 A;  2VN2 A;  1V5F A;  4EGZ A;  3AAF A;  1QVT A;  2P6S A;  2PMZ A;  2JPC A;  4I98 B;  1T39 A;  2XIG A;  3IUO A;  3O3K A;  4NUB A;  4AVZ A;  4HEA 2;  2VJ5 A;  2X1D A;  4HYE A;  2HQR A;  1SMT A;  2L7F P;  2L9R A;  2ZB9 A;  4DYQ A;  3WU2 C;  2MBF A;  3LSR A;  3ABL H;  3HPG A;  3GTJ J;  2E1M C;  1DGR M;  3CDL A;  3EUA A;  2Q8K A;  5B66 C;  3G4S I;  4XL9 A;  4B09 A;  2LSO A;  1D5V A;  4GO1 A;  1U78 A;  3EUH C;  3J7Y J;  1U3E M;  2OJE D;  2EIL H;  2VC1 A;  3EUH A;  2WAF A;  2HKO A;  2Y30 A;  3VB2 A;  1G8X A;  1TWG J;  2E1M B;  2JA8 J;  5GPC A;  3LFK A;  4IQJ A;  2X85 A;  2X6W A;  4PJN A;  1V55 H;  3R60 A;  2DT6 A;  2LKX A;  3QPT A;  2IGM A;  1LJ9 A;  3B73 A;  3DTE A;  3DPT A;  2PLY A;  3EDP A;  2K4B A;  2EFP A;  2FOW A;  3H9Q A;  4IHY A;  3LSJ A;  2K5C A;  2ID6 A;  3IWZ A;  1ZR2 A;  1HW2 A;  1MNM C;  5EEH A;  3QP5 A;  4DZP A;  2HDW A;  3C18 A;  2E2H J;  4D5C A;  2HQA A;  1IXC A;  1HBX G;  3QU3 A;  4UV8 A;  2E35 A;  3IKT A;  2G9W A;  4CYD A;  1LDD A;  2ISY A;  4A5N A;  1Z67 A;  2Z2S B;  2JA6 J;  9ANT A;  5HLH A;  2OAZ A;  1LEB A;  4CCM A;  2PMH A;  1Z91 A;  2F48 A;  3W6V A;  2CS3 A;  3ZCO A;  1Y0N A;  2L4M A;  2LLK A;  3JRI A;  1XDS A;  2EV5 A;  3GLX A;  5FKL A;  3K4L A;  2K86 A;  3BG3 A;  4ZDP A;  4EVI A;  1T8I A;  2WAE A;  4XRF A;  2V9V A;  5EZG A;  1O7L A;  1F1Z A;  3CMM A;  3LFU A;  4C2T A;  3FXQ A;  1X1D A;  5BPD A;  2HYF A;  4OMY A;  1MMG A;  3K1N A;  1ZQ3 P;  4IRI A;  5C44 J;  2O6G E;  5CPR B;  4I2O A;  3RTR A;  2DMQ A;  2LMD A;  1GHC A;  2XAS A;  4C2U A;  5ILS A;  1FX7 A;  1FTZ A;  1X4O A;  4XIC A;  4M71 A;  1GUU A;  2Z3Y A;  4E70 A;  2R7X A;  1WJB A;  3WG7 H;  2XAJ A;  2CYY A;  2BBY A;  2DLL A;  3HTU A;  4LFU A;  3WGH A;  4EEF G;  4HF2 A;  3PIP F;  2R7U A;  1O3Q A;  1X3W B;  3G71 I;  1Z6T A;  3H5N A;  4IRG A;  5D5V B;  3GXO A;  2JSP A;  4BE2 A;  4KFC A;  2LFB A;  4PFP A;  4Y15 A;  1HF0 A;  1WVR A;  4U0W A;  3FWE A;  1U6G A;  1JTY A;  1PYV A;  1HDP A;  3BTI A;  2CU7 A;  4IEJ A;  1K61 A;  2GXB A;  1IRX A;  2X6X A;  4ENN A;  3PUF A;  5FD5 A;  2GZW A;  2ZNZ A;  4IOC F;  3BJ6 A;  4B4C A;  2RKH A;  4N9I A;  4CSW A;  3R0A A;  1ZGA A;  3OYG A;  3J81 Z;  3OOP A;  2EFO A;  2HXI A;  2O8X A;  2O9L A;  4XKV A;  3OIQ A;  1FEX A;  1ODD A;  2EIM H;  4P1W A;  2ISZ A;  1W1W E;  4BXU A;  1HLV A;  3J7A Y;  2ECB A;  3DQV C;  5LHG A;  4NC7 A;  3UKG A;  4QTR A;  4WWC A;  4RMN A;  3OL3 A;  4X6A J;  2ADU A;  3P9K A;  5HS8 A;  2UZK A;  2DK5 A;  4BU2 A;  1P92 A;  3BR1 A;  4UY8 I;  4ZDO A;  5FLX K;  5FO5 A;  2W24 A;  3DPU A;  5F04 A;  3FXU A;  3BDD A;  1SD7 A;  2W25 A;  3CJT B;  4KIC A;  4ZC3 A;  3KZI C;  4Y52 J;  1WJF A;  2ZXI A;  3LL7 A;  1IXS B;  1NHA A;  1FNN A;  1I6X A;  1FTT A;  4U7D A;  3DU5 A;  4L9T A;  3PUB A;  1B72 B;  4I7H A;  1MGT A;  3HOU J;  2LY9 A;  1MH4 A;  4M6V A;  4RDU A;  3QYF A;  5C3E J;  1WJE A;  3WTY C;  1D0Y A;  2ME0 A;  5B1B H;  5HLG A;  3LA7 A;  3KE2 A;  4A3B J;  2DA3 A;  1ETX A;  1Z1D A;  2W00 A;  3LSG A;  3K7A J;  3MEX A;  4B47 A;  2VXD A;  1R1T A;  4C9Y A;  1I39 A;  2E71 A;  4LOC A;  1GXP A;  1T2K A;  4R8H A;  4G12 A;  5ERI A;  1A35 A;  3H9J A;  1X2M A;  1DPR A;  4M9S A;  3J80 K;  4AM3 A;  3HKZ N;  3KET A;  1FYL A;  2MA3 A;  2DOA A;  2V9K A;  5DYM A;  2LG4 A;  3JRG A;  3GME A;  4XRS A;  5IPA A;  4ZYD A;  2O5R A;  2P7C B;  2W48 A;  1X58 A;  4YII A;  5GP9 A;  2OQR A;  2VKD A;  1TT0 A;  3FDY A;  1GDT A;  2KJB A;  4PJ0 C;  2R7V A;  3K70 D;  5E1X A;  3I4N J;  4OAZ A;  4FIS A;  2XPU A;  2K4J A;  3O6B B;  1O3R A;  3HOS A;  2KL4 A;  4I76 A;  3O2P E;  3QPL A;  4HDV A;  4XSX F;  1MMA A;  3IC7 A;  3HOX J;  2JQ7 A;  4MO7 A;  2QGU A;  3GUD A;  1K6Y A;  2AXT C;  1WSU A;  2HOS A;  2V79 A;  1W0U A;  2L3D A;  4PCQ A;  3BG6 A;  2EV0 A;  3Q9V A;  4F3Q A;  3DEE A;  4BQO A;  3L2U A;  4KN7 X;  1LDJ A;  3TO7 A;  3E1S A;  4Y13 A;  3DKY A;  1KU7 A;  3AL0 C;  1T95 A;  1LEA A;  2ID3 A;  5J4V A;  1RR8 C;  1R71 A;  5IP9 J;  2DPD A;  1MZB A;  1RC9 A;  2LY2 A;  1OYY A;  3GVA A;  1XCV A;  2V6C A;  4HNU A;  5HLT A;  2K9S A;  1CF7 A;  5TRD A;  2K85 A;  2VBW A;  3HPH A;  1DGW Y;  2W1O A;  1FYM A;  4FTH A;  2OTL I;  4BHB A;  4IXA A;  1XGM A;  2BYV E;  3ZQF A;  3S15 J;  4WX9 A;  1BC8 C;  1NK2 P;  3IV5 A;  2MFZ A;  4K2E A;  1SAX A;  4HLX A;  3KEY A;  2LRE A;  5KAF C;  2H1L A;  4L9J A;  5IY5 H;  1CF7 B;  3FIS A;  4BBS J;  2K3P A;  2RGV A;  4NC6 A;  3HSE A;  3FHN A;  1R22 A;  3ZRG A;  4ABZ A;  1MMS A;  2CQQ A;  1P4X A;  3S14 J;  2W57 A;  2DT5 A;  5ILU A;  4A0Y A;  3ZR8 X;  4EQQ A;  1L0O C;  3S93 A;  1FMV A;  3BQZ A;  2IS1 A;  4XLA A;  5E3O A;  2ELK A;  2NS0 A;  2MLK A;  2VOD A;  2WV0 A;  2XGD A;  2X51 A;  1IRZ A;  1S8N A;  2GWR A;  1LPQ A;  1X19 A;  3KP5 A;  2NVU B;  3I0T A;  5TIS C;  1Q1V A;  1ETY A;  3RPQ A;  2XKP A;  3CD6 I;  1XN7 A;  3C2B A;  1OR7 C;  5E8I A;  2MD0 A;  1OR7 A;  1KYZ A;  1XD7 A;  2GIZ A;  2EIN H;  2OQG A;  1IN5 A;  1IV6 A;  4A3I J;  1ULY A;  3G1M A;  3NWS A;  1YS6 A;  4B43 A;  2BY0 A;  4EV0 A;  3ECO A;  1I6H J;  4CCN A;  5F6F A;  4DYC A;  3U9G A;  3KP4 A;  2KMU A;  4NB5 A;  1QQI A;  2ESN A;  4IKF A;  3HOW J;  4UUT A;  3WG9 A;  3TW6 A;  3L2R A;  3MFK A;  5C4J J;  3WTU C;  2K7L A;  3GTL J;  5DS9 A;  1BR4 A;  2D2W A;  4OIP F;  3Q0W A;  3KIO A;  3HGG A;  5B1A H;  6PAX A;  3SDB A;  4G94 A;  3BPV A;  5LHI A;  3FMS A;  1O3T A;  3ISP A;  3EQL F;  1PUE E;  4A3G J;  2V4J C;  3PO3 J;  2L7K A;  3RIR A;  5F1R A;  1E17 A;  1GV5 A;  2OA4 A;  1X3U A;  1ETW A;  2NOJ B;  3ZN0 A;  3GZN B;  2E1C A;  4HRI A;  3OYI A;  4QPO A;  2H6B A;  3ZQ7 A;  1Z77 A;  1OYI A;  1YIO A;  2JWT A;  3SJM A;  4OIO F;  1MNE A;  3CJR B;  1BJA A;  4PSW A;  3N97 A;  2HGC A;  4I0B A;  1POG A;  3ASN H;  5GTH C;  2VBZ A;  2FBH A;  3KP6 A;  1V5G A;  3SFI A;  2E5N A;  2P5V A;  3E0J B;  1UHS A;  2TCT A;  4PK4 A;  2OF7 A;  4B3X A;  2JUG A;  2F6C A;  3FK7 A;  1BA5 A;  3HOV J;  1JGS A;  4RGU A;  1RKT A;  4BDY A;  5FRO A;  3HHH A;  3R61 A;  3C2H A;  2DFF A;  4M3B A;  4U7B A;  3BTL A;  3DBL B;  4UVC A;  2CUF A;  2A05 A;  1T08 B;  2NS7 A;  3TED A;  4MHG A;  1MSF C;  2FQ4 A;  3TP0 A;  3WOD F;  3GFL A;  4P9F A;  3H5R A;  3A01 A;  3AG2 H;  5DUK A;  2KRH A;  4HDU A;  1RPW A;  2D1V A;  3JRB A;  1JXS A;  3DLL F;  5FLX Z;  4AIK A;  2K40 A;  2IGO A;  4RS8 A;  1FSH A;  1RR7 A;  3IHU A;  4LG3 A;  2FOK A;  1U8R A;  2EZI A;  2JMW A;  1ZLK A;  4DNC A;  1JTX A;  1G3W A;  1N25 A;  4Q48 A;  3F22 A;  1LDK B;  3H92 A;  1FOK A;  2WAQ A;  1QGP A;  3ZP5 A;  2E19 A;  4BNC A;  1OCC H;  5KNL A;  2VE9 A;  5C4X J;  1QHH D;  1S5L C;  2P7V B;  3PM1 A;  1R1U A;  2R0Q C;  3PQJ A;  2DYR H;  4Y7N J;  2DTZ A;  1V4R A;  4I01 A;  5FRN A;  3U21 A;  2HTS A;  2STW A;  1GXQ A;  1IF1 A;  4A6E A;  3CC4 I;  3CLO A;  2CO5 A;  4ENK A;  4KNY A;  3EYI A;  4P9U A;  4BAY A;  1KYW A;  1K78 A;  2IRF G;  2FXA A;  4XSZ F;  1A04 A;  2LD5 A;  3FX3 A;  4M74 A;  1RUO A;  3J80 Z;  4DGW B;  2ZC2 A;  1J75 A;  3K2A A;  2E5Z A;  5IT9 Z;  4HV5 A;  5GAE J;  2EA2 A;  3QOD A;  1I27 A;  2LKS A;  3QU6 A;  2R7T A;  2D1H A;  2RNJ A;  3ZPL A;  2VAS A;  1D3Y A;  1K78 B;  1Y0U A;  4BKX A;  3MZ8 A;  3CCL I;  2JA2 A;  4HX8 A;  1XGO A;  2HI3 A;  3TKY A;  2XRO A;  3LAP A;  4CZZ A;  1YI2 I;  4FAS D;  2EIJ H;  4XOR A;  2FNP A;  2FEZ A;  2KRC A;  2VQC A;  2PEX A;  3CC2 I;  2QQB A;  3CP2 A;  5EYR A;  4ZH4 F;  1MBG A;  1V54 H;  3C7J A;  4A3E J;  4O3M A;  3BZC A;  5ICG A;  2CMP A;  1JKP C;  4EJV A;  3M9A A;  3HB9 A;  4H0E A;  4I0A A;  2XPV A;  2B0L A;  3G6E I;  5LLQ A;  1OKR A;  3F8N A;  1QZZ A;  2V26 A;  5AIP A;  2VOO A;  4EJO A;  4XNF A;  4U0Y A;  1ENH A;  1E2X A;  3KLN A;  4R1H A;  2KT0 A;  3WHB A;  3BZK A;  3TOA A;  5ICE A;  3CO6 C;  2QSG X;  1VND A;  2BZT A;  1H88 C;  1VZ0 A;  2ZNY A;  1F5T A;  2DOE A;  2WB1 N;  5CVR A;  1QZY A;  5H6R A;  4ZYE A;  1IW7 F;  3E97 A;  5JHU A;  3OS2 A;  4CCL A;  1J0R A;  4E6K G;  2Q1Z B;  2M5W A;  4IVN A;  4EM0 B;  3F8F A;  1MD0 A;  2DOF A;  2ZXJ A;  4C3H J;  3L2W A;  2XF7 A;  3NRV A;  1U8B A;  3VYR B;  2K9N A;  3IH4 A;  2R3S A;  1ITY A;  1WH7 A;  3M1C A;  3DP7 A;  2FMY A;  1FOY A;  1H0M A;  1SD6 A;  4LK0 F;  1EH8 A;  1OCR H;  3DPL C;  3KPH A;  1WPK A;  2DQL A;  3S1R J;  1DDN A;  1NG7 A;  1S7E A;  3CLQ A;  4F93 B;  2XDV A;  3LMM A;  3G73 A;  4KIF A;  4KIS A;  1FWZ A;  1WQ2 A;  3H0G J;  3VOE A;  2P6T A;  3FKI J;  2OUM A;  1VQP I;  1O3S A;  2BE5 F;  2KRF A;  2QF7 A;  4YFK F;  2WA0 A;  3HG9 A;  4LD5 A;  4HG2 A;  4CDG A;  1B6A A;  2LNB A;  2VQG A;  3KEO A;  1EV7 A;  2ZBK A;  1D8J A;  2EK5 A;  4ESF A;  2DW4 A;  2FF4 A;  4QIW N;  4JK1 X;  3HTS B;  4F91 B;  2EFW A;  3FXL A;  3D1N I;  3TDU C;  4ETS A;  2K9Q A;  3BJO A;  3MAJ A;  1ETK A;  4CCK A;  1ZTR A;  3OOU A;  3CMY A;  4L18 B;  2MLG A;  2OZ6 A;  4V19 K;  4EGY A;  3JRA A;  1ETO A;  4IL6 C;  1U9O A;  2RVC A;  4CZC A;  2VL8 A;  4L0Y B;  2P5L C;  2ETH A;  2OV7 A;  1YJN I;  2HVQ A;  2HS5 A;  1YLF A;  3GFJ A;  3NEU A;  2VPL A;  3BC8 A;  2FE3 A;  4Y3O A;  1JE8 A;  1QHG A;  4XID A;  1JHF A;  2K9L A;  3GTG J;  4I99 C;  2KZG A;  2YU3 A;  1TBX A;  1UST A;  4HX7 A;  3C1D A;  3EUK L;  3SQN A;  1G3S A;  3D5L A;  4IPA A;  2XC7 A;  5JI6 A;  4BJT A;  1L3L A;  5EJC A;  1T56 A;  3E5X A;  4YEL A;  3TOB A;  2QA4 I;  2JUC A;  4PSX A;  3A1Y A;  2PFB A;  3ESW B;  3NAR A;  2DA6 A;  4HA8 A;  5GAH J;  4XLF A;  3Q3S A;  4PUS A;  1MBK A;  1WJ5 A;  3KP3 A;  2KDO A;  2DDB A;  4RGS A;  4YFN F;  2RQQ A;  2V7F A;  4H4K C;  2R7W A;  1ETQ A;  1R36 A;  1F43 A;  4P5O A;  2WV1 A;  3S2D J;  1REP C;  2PMU A;  1D1A A;  4AYB A;  5E8G A;  5CYV A;  5DTD A;  3FZV A;  5BOX A;  1B59 A;  4XMY A;  2BHY A;  3S3M A;  1BN5 A;  2XSJ C;  1WFX A;  3WU1 B;  4MEY F;  4LLL A;  1Z0X A;  4IX7 A;  3LNQ A;  2M0M A;  2KIQ A;  4XKC A;  3CJN A;  4HQM A;  2XGE A;  2QZ8 A;  2DOD A; 
#chains in the Genus database with same CATH homology
 5LRS A;  3HSR A;  1G3Y A;  2P5K A;  1BM9 A;  3L2C A;  2GAU A;  1HW1 A;  5EEG A;  3B02 A;  2EA4 A;  3V8K A;  3RDI A;  1J59 A;  1B9M A;  2STT A;  3JTH A;  2VBX A;  4S04 A;  1J9I A;  1UCR A;  2AXL A;  1SD5 A;  3KZZ A;  3KLO A;  1RIO H;  2A6E F;  2M8E A;  4JQF A;  3HRT A;  4PGG A;  2CQK A;  2DBB A;  3S2W A;  1KQ0 A;  4PGH A;  2OBP A;  1K79 A;  5F64 A;  1BI1 A;  1B9N A;  3P7N A;  5DCF A;  2BV6 A;  3FHZ A;  1VTN C;  3WTX C;  3I71 A;  1EH7 A;  3ZN1 A;  2D45 A;  2LKP A;  3U1D A;  2CG4 A;  3P9C A;  2KJC A;  1LB2 A;  4D0P A;  1ZG3 A;  4RB3 C;  2L01 A;  1SMY F;  5LEJ A;  4I09 A;  2L4A A;  1IXR C;  4RGR A;  2EWN A;  2QWW A;  2H94 A;  2A07 F;  1IRG A;  5D4R A;  1EH6 A;  3Q9S A;  5E1W A;  5K5R A;  3GZ6 A;  1FP1 D;  1BI3 A;  2PG4 A;  3K69 A;  2ACJ A;  5CJ9 A;  3VEP A;  4LMY A;  5CVU A;  2F5C A;  3HHG A;  1FT9 A;  1W7P D;  2KIU A;  4GGG A;  2HQN A;  4MQV A;  4Z2Y A;  4LGW A;  2XHK A;  1PP8 F;  4GCV A;  4IF4 A;  3DV8 A;  5E20 A;  2Z99 A;  1RZ4 A;  3PQK A;  1T0F A;  3V4G A;  3FMQ A;  2IP2 A;  4U0V A;  2M30 A;  2COM A;  2EFQ A;  2PBI A;  2DK8 A;  5D6E A;  2HKX A;  1XGN A;  4HZF A;  2NRA C;  5CLS A;  3BRO A;  4KA4 A;  2MC3 A;  3MWM A;  3WGG A;  3HOT A;  4KIG A;  1RUN A;  1R5G A;  2ZKZ A;  1FBU A;  5TJJ A;  4PDK A;  1P6R A;  1QBJ A;  2A61 A;  4UNO A;  3LA2 A;  5D8L B;  4RB1 A;  1YTY A;  5AON A;  1RNL A;  2YX7 A;  3T1B A;  3V8J A;  5A2Q K;  1ZRF A;  3FM3 A;  2LF7 A;  2VON A;  1YW9 A;  3CUO A;  4UVB A;  4LG0 A;  2IT0 A;  2MH2 A;  3J7A O;  4JBA A;  3RPU A;  4M72 A;  4EMS A;  3E6D A;  5ICF A;  2FBK A;  2G7H A;  1J5Y A;  2P8T A;  1D8K A;  1MJ9 A;  1SFX A;  2YSR A;  3GFM A;  4LG0 B;  4EM1 A;  4ZYH A;  2A5Y B;  4G8X A;  1G3T A;  1TTY A;  1OPC A;  4AIH A;  1BI0 A;  3E6M A;  4UV9 A;  4MTE A;  1HKQ A;  3DXJ F;  2VXZ A;  2H27 A;  2HOE A;  1KU2 A;  5H6Q A;  5FB2 A;  3RJP A;  4M9Z A;  5E1Z B;  2H09 A;  3F8B A;  1IUY A;  4A0Z A;  4L0Z B;  4N0B A;  4LLN A;  1K7A A;  4OU0 A;  4HV6 A;  4WCG A;  2LDU A;  2M1B A;  1WKM A;  1TNT A;  3WU0 A;  3U2R A;  2IPQ X;  3I5U A;  2WC2 A;  1TNS A;  3K0L A;  2R7F A;  3LA3 A;  1ZN2 A;  4XBF A;  1MDM A;  3ZMZ A;  1FZP B;  4KUM A;  1S7O A;  4ESB A;  5L3G A;  5FFX A;  4OIN F;  2FRH A;  2F5F A;  5DUI A;  1MDM B;  4KN4 X;  3NQO A;  1T6S A;  2RDP A;  3W6K B;  4EJW A;  1IN6 A;  1B4A A;  2RQP A;  5HLI A;  1MKM A;  1BC7 C;  3K9T A;  2QBY A;  3BWG A;  1SFE A;  1Q1H A;  2IA2 A;  2NNN A;  4U88 A;  2ZME B;  4CHU A;  5D6F A;  2XAG A;  2F2E A;  4MNU A;  2OZU A;  2XUB A;  3L09 A;  1CGP A;  2QBY B;  1FBQ A;  1Z05 A;  3JAM K;  1WI9 A;  1ZLJ A;  5DCM B;  3LAJ A;  3TQN A;  4UHT A;  3F72 A;  3VOD A;  3LQR A;  3GEZ A;  4XLN F;  4G6D A;  1V3F A;  4BQA A;  4O5V A;  2V1D A;  4WXC A;  3RKX A;  4UVA A;  2BEO A;  4UUV A;  2ELH A;  1W5S A;  4BH9 A;  1TQP A;  1AWC A;  2RC4 A;  3V7S A;  2Z5U A;  2GIV A;  4AD9 A;  4F7Z A;  3ERE D;  1Z6R A;  4G6Q A;  1KU3 A;  1HST A;  1TLH B;  5D5U B;  2NYX A;  3E6B A;  3Q5F A;  1ZRD A;  3L7W A;  2XKO A;  2HYG D;  5ILV A;  3F21 A;  5D8K B;  4P96 A;  3I53 A;  1WRJ A;  1UHW A;  4OIQ F;  3ZMS A;  3GO5 A;  2G7U A;  3F8M A;  3WE3 A;  2CFX A;  4M73 A;  1T38 A;  5L3F A;  3KZY A;  3WTV C;  2VT3 A;  3GWZ A;  1W5T A;  4RAY A;  3SXY A;  2IW5 A;  5BS6 A;  2VE8 A;  1ZGJ A;  1LQ1 A;  1IN7 A;  4P55 A;  2DO7 A;  1ZH5 A;  4KDP A;  3GFI A;  5JR3 A;  1K6O A;  3JTG A;  1ZRE A;  3TGN A;  5LGT A;  2JTV A;  2KIM A;  5LHH A;  3ML6 A;  1DUX C;  2CSO A;  4AWX B;  1ZAO A;  3H3U A;  2FNA A;  3WGI A;  4WK8 F;  4YIF A;  3WTW C;  1W4M A;  4IHS A;  2F5E A;  4RGX A;  3HRU A;  4A0X A;  4CO8 A;  5ICC A;  1UB9 A;  1ZRC A;  5BMZ A;  4L9N A;  1LNW A;  5J8F A;  2OD5 A;  3HRS A;  3ABU A;  1USS A;  3T8T A;  1XSX A;  2ZCW A;  3MQ0 A;  4A6D A;  4UXN A;  2JT1 A;  3H3Z A;  3QP6 A;  3ECH A;  3QOP A;  1YS7 A;  1R5H A;  2WWY A;  1SFU A;  4FT8 A;  4FHT A;  4HBL A;  3FM5 A;  2DI3 A;  3CO7 C;  2Y0M A;  1FPQ A;  3T5X A;  5HVQ C;  4OOI A;  3LQQ A;  4CXF A;  2V1U A;  3BJA A;  3JSO A;  2M87 A;  5DEQ A;  3EYY A;  1KU9 A;  2UXN A;  1QO0 D;  3COA C;  2KKO A;  1ZG1 A;  4GYG A;  5IT3 A;  1XSV A;  2EB7 A;  1KQ9 A;  3WE2 A;  2O03 A;  2OU2 A;  3HYI A;  2X0L A;  1J2X A;  4ESJ A;  2AS5 F;  4HF1 A;  2CW0 F;  1GVJ A;  1UFM A;  2J5P A;  4OIR F;  3BOQ A;  1KQ8 A;  2HWV A;  3I59 A;  1P4W A;  1XMK A;  1W7P A;  2O0Y A;  4OMZ A;  2K27 A;  4Q47 A;  3KEQ A;  3I59 B;  3CTA A;  1FC3 A;  1F9N A;  1ON2 A;  1BI2 A;  1W7P B;  3K1P A;  3JAM Z;  2IVM A;  5E18 F;  4KMF A;  4HOB A;  2BGC A;  4KT5 C;  4NHJ A;  3F8C A;  1QNT A;  2TDX A;  4HLY A;  1ZYR F;  3WTZ A;  5CVJ A;  2DPU A;  2QLZ A;  2XV4 S;  5DDG A;  2C6Y A;  1PDN C;  3DKW A;  1XSD A;  2FU4 A;  4S05 A;  3M8E A;  1P4A A;  3E3V A;  3R6S A;  1S29 A;  2PJP A;  1FP2 A;  1HSJ A;  3MCZ A;  4KMU X;  2EV6 A;  2DTR A;  1HQC A;  4HF0 A;  5HOO A;  1YQA A;  1SD4 A;  4MTD A;  2Y48 A;  4L9V A;  2V1X A;  1FYK A;  3SFZ A;  4IRH A;  3ZMV A;  5JFR A;  3HRM A;  5HS9 A;  5LEK A;  3BY6 A;  2J5O A;  3SHF A;  4EJT A;  2EJR A;  1G6N A;  4G7O F;  5AIQ A;  1XB4 A;  2IJL A;  1TQI A;  3CDH A;  3HUG A;  3RYP A;  4GXO A;  2ZO4 A;  4LLG F;  5DD4 A;  4YG2 F;  2PQ8 A;  1BOA A;  3IRQ A;  1Z7U A;  1HKS A;  5J8C A;  3QRF F;  2FSW A;  4LK1 F;  2RV8 A;  2YR2 A;  4HX4 A;  5D5X B;  3ULQ B;  2HEO A;  3IWF A;  2ZJ2 A;  4QLC U;  4HAM A;  5HDK A;  1XGS A;  3KP2 A;  1HXD A;  1OMI A;  2EFN A;  1IN4 A;  2Z9O A;  5BPI A;  5KVR A;  1R58 A;  3M8F A;  2VBY A;  3P9I A;  3I64 A;  3V7R A;  2Z33 A;  1H9G A;  5LGU A;  4RB2 C;  3M7G A;  3DF8 A;  2X4H A;  5CVV A;  1AOY A;  2VC0 A;  2HZT A;  1Z9C A;  3JW4 A;  2NAZ A;  2QYO A;  1JHH A;  1S3J A;  3MZY A;  2QEN A;  3TO6 A;  3JSP A;  4YFX F;  2PI0 A;  4ZYG A;  1I1S A;  1I1G A;  4HQE A;  1G4D A;  4GYI A;  3GX4 X;  2M45 A;  3ZMD A;  4MQ9 F;  1YW7 A;  5JVT A;  4NQW A;  1MJA A;  2FQ3 A;  4RB0 A;  3LST A;  1U5T C;  1U5T A;  3L9F A;  1YFH A;  2JZY A;  1TQM A;  5IT9 K;  3QPH A;  1YG2 A;  4WXD A;  5CVI A;  1U5T B;  2A6H F;  4MEX F;  2KIF A;  2VOP A;  3D0S A;  3GZ5 A;  3REO A;  2A3S A;  3E5U A;  4G7Z F;  3I58 A;  4QWQ A;  5HDN A;  4Q5S F;  2ESH A;  3BP8 A;  3FF5 A;  2E1N A;  2HR3 A;  3RI4 A;  5FGM A;  3I4P A;  3GW2 A;  2JPB A;  1R1V A;  2NNY A;  4MGR A;  3R4K A;  4M6X A;  2P4W A;  4A12 A;  4ZZD A;  4LB6 B;  2HFH A;  1U2W A;  3EET A;  4EJU A;  3F6V A;  4EM2 A;  1IZ1 A;  5HDG A;  4WXH A;  1HKT A;  2IA1 A;  4ASN A;  4G9Y A;  4LJZ F;  5BQT A;  3IRR A;  3KCC A;  2A68 F;  3K2Z A;  2Y75 A;  2XAQ A;  3ELK A;  4PZJ A;  2DFI A;  4LB5 A;  2QUF A;  1STZ A;  2QQA A;  4Y17 A;  3RYR A;  3T0Y A;  3M1E A;  3K1M A;  2Q0O A;  1UHM A;  2YPR A;  5K5O A;  1H9T A;  3V8L A;  1I5Z A;  4A2U A;  1IRF A;  4ZZL A;  1XMA A;  3C3W A;  3R0J A;  2ZME A;  1FBS A;  2IA0 A;  2DAO A;  5L3C A;  3TO9 A;  1DPU A;  4Q4Z F;  1ON1 A;  5L3D A;  4WF2 A;  2R7D A;  1YW8 A;  5K1Y A;  2L54 A;  2E7W A;  3N4M A;  2XAF A;  2H6C A;  2W85 A;  3SZT A;  5DCM A;  3RKY A;  3WTT C;  1TW2 A;  4AIJ A;  3ZMT A;  1BBY A;  2XVC A;  2ZFW A;  4G7H F;  3ABT A;  3BZ6 A;  3F6O A;  3GF2 A;  2WTE A;  4RAZ A;  3V7C A;  3DEU A;  4HW0 A;  3KP7 A;  2YX4 A;  4KIB A;  2RN7 A;  5LRR A;  1IAW A;  5LGN A;  1ONV A;  4FX4 A;  2LF8 A;  1FSE A;  2O3F A;  1BIB A;  1YYV A;  4TV7 A;  3VFZ A;  4ENM A;  4O6J A;  2F5D A;  5DV5 A;  2FML A;  4BYY A;  4L5I A;  5DD8 A;  2VT2 A;  1T98 A;  1DP7 P;  3FXR A;  2W84 A;  1XCB A;  3TDZ C;  5FD6 A;  2L02 A;  2GXG A;  3HSF A;  3ZMU A;  2MD5 A;  3OV8 A;  1KGS A;  1ZHF A;  2DU9 A;  4XLP F;  1R00 A;  2FA5 A;  3L00 A;  1YO5 C;  2QVO A;  3MZH A;  5ED4 A;  5KK1 A;  1IN8 A;  5FFZ A;  4BHC A;  4IHT A;  1P2F A;  5D5W B;  5HS7 A;  3I54 A;  3QAH A;  2O61 A;  3SZP A;  3E5Q A;  2GA1 A;  1R7J A;  5E17 F;  2UWM A;  1WWX A;  4KYW A;  3T8R A;  4R79 A;  5A2Q Z;  4L5J A;  3G3Z A;  2Q2E A;  4IJA A;  3RKW A;  2GQQ A;  3PFI A;  1R23 A;  2FBI A;  4M6Y A;  4ON0 A;  3J81 K;  4ENJ A;  3CUQ C;  3CUQ A;  1ZAR A;  3WTS C;  2PN6 A;  2K02 A;  4M9X A;  2E7X A;  3KFW X;  1TW3 A;  4CGZ A;  1S7A A;  1HW5 A;  1O57 A;  3CUQ B;  3LWF A;  3HIF A;  4AVP A;  2QQ9 A;  3W6J B;  2XAH A;  1F4K A;  1PP7 U;  3E6C C;  4DQ2 A;  1B1B A;  5L3E A;  2MH9 A;  2JSC A;  4I02 A;  1FLI A;  2CWE A;  5L3B A;  2CGP A;  1KA8 A;  1FY7 A;  4BHP A;  1RI7 A;  1S6L A;  1XDU A;  5LBQ A;  5H20 A;  2XGX A;  2QM3 A;  1O7F A;  1LVA A;  2HDC A;  3F3X A;  1J7K A;  3IL2 A;  1C0W A;  3ROU A;  2DQR A;  5J6X A;  3FMR A;  2JRT A;  2UXX A;  3DFG A;  4FX0 A;  1BIA A;  5K5Q A;  2A69 F;  4CIC A;  2HTJ A;  1OYW A;  3GYH X;  2XRN A;  5D4S A;  1QPM A;  3F23 A;  1MJB A;  4N9H A;  2GA2 A;  3BPX A;  3IKV A;  4B8X A;  4A5M A;  1ZG5 A;  2VN2 A;  4EGZ A;  3AAF A;  2P6S A;  1T39 A;  2JPC A;  4I98 B;  2XIG A;  3O3K A;  4HYE A;  2HQR A;  1SMT A;  2MBF A;  2Q8K A;  4B09 A;  2LSO A;  1D5V A;  4GO1 A;  1U78 A;  1U3E M;  2VC1 A;  3EUH A;  2HKO A;  3VB2 A;  3LFK A;  3R60 A;  3QPT A;  1LJ9 A;  3B73 A;  3DPT A;  2PLY A;  3EDP A;  2K4B A;  2EFP A;  3IWZ A;  1HW2 A;  5EEH A;  3QP5 A;  3C18 A;  1IXC A;  1HBX G;  3QU3 A;  4UV8 A;  3IKT A;  2G9W A;  4CYD A;  1LDD A;  2ISY A;  4A5N A;  5HLH A;  2OAZ A;  1LEB A;  2PMH A;  1Z91 A;  2L4M A;  1XDS A;  2EV5 A;  3GLX A;  2K86 A;  4EVI A;  4XRF A;  2V9V A;  1O7L A;  1F1Z A;  3FXQ A;  5BPD A;  2HYF A;  4OMY A;  3K1N A;  4IRI A;  2O6G E;  4I2O A;  3RTR A;  1GHC A;  2XAS A;  5ILS A;  1FX7 A;  4M71 A;  2Z3Y A;  4E70 A;  2XAJ A;  2CYY A;  2BBY A;  2DLL A;  3HTU A;  4LFU A;  3WGH A;  4HF2 A;  1O3Q A;  1Z6T A;  4IRG A;  5D5V B;  3GXO A;  4KFC A;  4Y15 A;  4U0W A;  3FWE A;  1U6G A;  2GXB A;  4ENN A;  5FD5 A;  2GZW A;  2ZNZ A;  3BJ6 A;  2RKH A;  4N9I A;  3R0A A;  1ZGA A;  3J81 Z;  3OOP A;  2EFO A;  2O8X A;  1ODD A;  2ISZ A;  4BXU A;  3DQV C;  5LHG A;  4WWC A;  2ADU A;  3P9K A;  5HS8 A;  2UZK A;  2DK5 A;  1P92 A;  5FLX K;  5FO5 A;  2W24 A;  3FXU A;  3BDD A;  1SD7 A;  2W25 A;  4KIC A;  1IXS B;  1NHA A;  1FNN A;  1I6X A;  4U7D A;  4L9T A;  4I7H A;  1MGT A;  3WTY C;  5HLG A;  3LA7 A;  3KE2 A;  1Z1D A;  3MEX A;  1R1T A;  1GXP A;  1T2K A;  4R8H A;  5ERI A;  1DPR A;  4M9S A;  3J80 K;  3KET A;  1FYL A;  2MA3 A;  5DYM A;  4ZYD A;  2P7C B;  4YII A;  2OQR A;  2KJB A;  5E1X A;  2K4J A;  3O6B B;  1O3R A;  3HOS A;  3O2P E;  4HDV A;  4XSX F;  3IC7 A;  3GUD A;  1WSU A;  2V79 A;  2L3D A;  4PCQ A;  2EV0 A;  3Q9V A;  4KN7 X;  1LDJ A;  3TO7 A;  4Y13 A;  1KU7 A;  1LEA A;  2DPD A;  1MZB A;  1OYY A;  3GVA A;  1XCV A;  2V6C A;  1CF7 A;  5TRD A;  2VBW A;  1FYM A;  4BHB A;  4IXA A;  1XGM A;  2BYV E;  4WX9 A;  1BC8 C;  4K2E A;  1SAX A;  4HLX A;  4L9J A;  1CF7 B;  2RGV A;  3HSE A;  1R22 A;  1P4X A;  2W57 A;  2DT5 A;  5ILU A;  4A0Y A;  4EQQ A;  1L0O C;  2NS0 A;  2MLK A;  2VOD A;  2WV0 A;  1S8N A;  2GWR A;  3KP5 A;  3I0T A;  3RPQ A;  2XKP A;  1XN7 A;  5E8I A;  1OR7 A;  1KYZ A;  1XD7 A;  2OQG A;  1IN5 A;  1ULY A;  1YS6 A;  4EV0 A;  3ECO A;  5F6F A;  3U9G A;  3KP4 A;  4NB5 A;  1QQI A;  2ESN A;  3WG9 A;  3MFK A;  3WTU C;  2K7L A;  4OIP F;  6PAX A;  4G94 A;  3BPV A;  5LHI A;  3FMS A;  1O3T A;  3ISP A;  3EQL F;  1PUE E;  3RIR A;  5F1R A;  1E17 A;  2OA4 A;  1X3U A;  3ZN0 A;  2E1C A;  2H6B A;  3ZQ7 A;  1OYI A;  1YIO A;  4OIO F;  1BJA A;  3N97 A;  2HGC A;  4I0B A;  2VBZ A;  2FBH A;  3KP6 A;  2P5V A;  1JGS A;  4RGU A;  3HHH A;  3R61 A;  4U7B A;  4UVC A;  4MHG A;  3WOD F;  3GFL A;  4P9F A;  5DUK A;  4HDU A;  2D1V A;  1JXS A;  5FLX Z;  4AIK A;  4RS8 A;  1FSH A;  3IHU A;  2FOK A;  1U8R A;  1ZLK A;  4DNC A;  1G3W A;  4Q48 A;  3F22 A;  1LDK B;  3H92 A;  1FOK A;  1QGP A;  3ZP5 A;  4BNC A;  2VE9 A;  2P7V B;  1R1U A;  3PQJ A;  1V4R A;  4I01 A;  2HTS A;  2STW A;  1GXQ A;  1IF1 A;  4A6E A;  3CLO A;  2CO5 A;  4ENK A;  4KNY A;  3EYI A;  4P9U A;  4BAY A;  1KYW A;  1K78 A;  2IRF G;  2FXA A;  4XSZ F;  1A04 A;  1RUO A;  3FX3 A;  4M74 A;  3J80 Z;  1J75 A;  5IT9 Z;  4HV5 A;  2EA2 A;  1I27 A;  3QU6 A;  2D1H A;  2RNJ A;  3ZPL A;  1D3Y A;  1K78 B;  1Y0U A;  4HX8 A;  1XGO A;  3TKY A;  3LAP A;  2XRO A;  4CZZ A;  2FNP A;  2FEZ A;  2PEX A;  2QQB A;  4ZH4 F;  3C7J A;  4O3M A;  5ICG A;  4EJV A;  3M9A A;  4H0E A;  4I0A A;  2B0L A;  5LLQ A;  1OKR A;  3F8N A;  1QZZ A;  5AIP A;  2VOO A;  4EJO A;  4U0Y A;  1E2X A;  3KLN A;  4R1H A;  3TOA A;  5ICE A;  3CO6 C;  2ZNY A;  1F5T A;  5CVR A;  1QZY A;  4ZYE A;  5H6R A;  1IW7 F;  3E97 A;  5JHU A;  1J0R A;  2M5W A;  4IVN A;  4EM0 B;  3F8F A;  1MD0 A;  2ZXJ A;  3NRV A;  2R3S A;  3DP7 A;  2FMY A;  1H0M A;  1SD6 A;  4LK0 F;  1EH8 A;  3DPL C;  1DDN A;  2DQL A;  3G73 A;  4KIF A;  1FWZ A;  1WQ2 A;  3VOE A;  2P6T A;  1O3S A;  2BE5 F;  2KRF A;  4YFK F;  4LD5 A;  4CDG A;  1B6A A;  2LNB A;  3KEO A;  1EV7 A;  2ZBK A;  1D8J A;  2EK5 A;  4ESF A;  2DW4 A;  2FF4 A;  4JK1 X;  3HTS B;  2EFW A;  3TDU C;  4ETS A;  3BJO A;  3MAJ A;  4L18 B;  2MLG A;  2OZ6 A;  4EGY A;  2RVC A;  4L0Y B;  2P5L C;  2ETH A;  2HS5 A;  1YLF A;  3GFJ A;  3NEU A;  2FE3 A;  1JE8 A;  1JHF A;  2YU3 A;  1TBX A;  1UST A;  4HX7 A;  3C1D A;  3SQN A;  1G3S A;  3D5L A;  4IPA A;  5JI6 A;  1L3L A;  3E5X A;  3TOB A;  2PFB A;  4HA8 A;  3KP3 A;  4RGS A;  4YFN F;  1R36 A;  4P5O A;  1REP C;  2PMU A;  5E8G A;  5CYV A;  3FZV A;  5BOX A;  1B59 A;  1BN5 A;  3WU1 B;  4MEY F;  4LLL A;  3CJN A;  4HQM A;  2QZ8 A;  2D2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...