2LF7A

Intramolecular regulation of the ets domain within etv6 sequence r335 to q436
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
GSHMRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription factor ETV6
publication title Autoinhibition of ETV6 (TEL) DNA Binding: Appended Helices Sterically Block the ETS Domain.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lf7A01
2M45A 1U78A 2OAZA 4KMUX 4LB5A 4LGWA 1HXDA 4HA8A 3QP5A 3FWEA 3W6JB 4M9SA 3F8MA 4B8XA 1SFEA 2IA2A 2XRNA 2EV0A 1C0WA 3M1EA 3ZMZA 3JTHA 2M5WA 1U5TC 2JPBA 1BIAA 2Z5UA 4CZZA 4Q4ZF 2XAFA 2D45A 2F5EA 1BM9A 3WE2A 2P5LC 5D8LB 4WWCA 3GLXA 3JTGA 4BHCA 1B59A 1W7PD 1BI2A 2QM3A 4Y15A 1HKSA 3L7WA 3KFWX 3NEUA 3P9CA 1QGPA 1RIOH 4Z2YA 1YFHA 1AWCA 1YLFA 1ZYRF 2UXXA 3K1PA 3CUQA 4M9ZA 5L3DA 5D8KB 2CG4A 3WGHA 3WTWC 5AIPA 3BY6A 3K0LA 2VN2A 3U9GA 1IXSB 2FE3A 2ESNA 2NS0A 2DK8A 3EYIA 4L18B 3QU3A 1YS7A 5LEKA 4P9FA 3TGNA 2DPUA 2KIMA 5ILUA 1U6GA 1EH6A 3EYYA 4P9UA 3HSRA 3V8KA 1L0OC 4HAMA 5CLSA 2M1BA 4NHJA 2V1XA 2COMA 4FX0A 4S05A 1O57A 2K27A 4F7ZA 3I53A 3TO7A 4ZYEA 1EV7A 1W5SA 2X4HA 5BPDA 3F22A 2CGPA 4ZYHA 1XGNA 3TQNA 4HQMA 4KN7X 2VOOA 3LQQA 5DD8A 3R60A 5DCFA 2MLGA 2FSWA 3EDPA 3CJNA 3ZPLA 3ZMSA 1O3QA 5L3EA 5FB2A 5JI6A 5DYMA 4ETSA 1T38A 4I0AA 2PI0A 5D5WB 3QPTA 1U2WA 5FD6A 1YG2A 1G4DA 4ENNA 3I0TA 1SFXA 2E1NA 4ASNA 2L54A 3ZN1A 1JGSA 5D4SA 1J5YA 2F5FA 4G8XA 4KN4X 1XGOA 4LMYA 1FYKA 2OA4A 4OMYA 4LG0A 1MDMA 4HBLA 3SHFA 4A5NA 3IWZA 2JZYA 2ELHA 1E17A 5F1RA 1R7JA 3E5XA 2EV6A 5LGNA 2DU9A 4UV8A 1QO0D 5K5OA 2DAOA 2GXBA 1BBYA 5LBQA 4RGXA 3BPXA 3MWMA 3DV8A 1IRFA 2F5CA 5EEGA 3ZMVA 4KYWA 3N4MA 5HDNA 3RKWA 2EFWA 3ISPA 2GWRA 3DXJF 3PFIA 1YIOA 4MHGA 1A04A 1LEBA 3HSEA 3GZ5A 2FNAA 3L2CA 2PFBA 2XGXA 3BJ6A 1ZG3A 5ICCA 4YG2F 1FSHA 2WC2A 4ZYGA 2ISZA 4MNUA 1J59A 1MJAA 2YR2A 4D0PA 2LNBA 5HLGA 2W57A 4A0ZA 4KIBA 1V3FA 1OYYA 1HW2A 1ZRFA 3F6VA 5D6FA 2Q8KA 2IPQX 4I09A 3GYHX 1D8JA 3L09A 1FLIA 3O3KA 1O7FA 5D5XB 2H27A 2Z99A 3BROA 4CYDA 5KK1A 5CVUA 2R7FA 4EJVA 5DDGA 4U7DA 3LWFA 2EFOA 2JPCA 1K7AA 3QAHA 2W25A 2GA2A 5ICGA 2EA2A 2G7HA 3DPTA 2A6EF 3FM5A 4A12A 3BP8A 4KT5C 4A5MA 1T0FA 2V79A 5E8IA 1O3TA 5CVIA 5E1ZB 2V1UA 1I1SA 4LK0F 1BN5A 5H20A 3WTSC 1DDNA 3WTXC 1T39A 3ML6A 5ED4A 1PUEE 4FHTA 4G7HF 1W7PA 3SQNA 1MJ9A 4DQ2A 3JAMK 1ON2A 3I4PA 3HIFA 1R00A 3GO5A 4M6YA 3GFJA 1CF7B 1XB4A 2OQRA 1KQ9A 2J5PA 2XUBA 4BAYA 3NQOA 4I01A 3WG9A 3Q9VA 4XLPF 2PQ8A 2ZBKA 3IWFA 4UVCA 5E1XA 3WTUC 2AS5F 4IHSA 1K78B 5E1WA 1LDJA 1KU7A 3MQ0A 4PGGA 2HS5A 1R36A 2A68F 4HW0A 4IF4A 1FYLA 5HS7A 1HW5A 5D6EA 3F8FA 3HRUA 4AIKA 1AOYA 3TOBA 2G7UA 4EM1A 2EA4A 2CW0F 2XHKA 2KIUA 1B4AA 1SD7A 1KYZA 3DF8A 2KIFA 2A69F 4M74A 2V9VA 2ESHA 2YU3A 1P92A 1GXQA 5FLXZ 4KUMA 1D5VA 4UVAA 2EFNA 4RB3C 4HZFA 1FX7A 1LQ1A 1KU2A 2XASA 2HFHA 3I59B 2ZMEB 2OD5A 1BIBA 3MEXA 3ROUA 3ERED 2VE8A 5LRSA 2STTA 1FBSA 2K4JA 1ON1A 1SD6A 2IP2A 2VBZA 1MGTA 2TDXA 1XMAA 4I02A 4U88A 5L3FA 3SZPA 4MQVA 1LDDA 2Y75A 1QZYA 4I0BA 1WQ2A 1TW2A 5E17F 2BGCA 3EUHA 4EGYA 1LDKB 3WGIA 3BOQA 4M73A 1ODDA 3VEPA 2FXAA 2JSCA 4ZYDA 3G73A 2L01A 3IKTA 2DFIA 3LAJA 2P6SA 3L9FA 4KDPA 1K6OA 4ESBA 3E6DA 2DW4A 1WKMA 2BBYA 2CSOA 5FGMA 4L0ZB 1Z91A 3I71A 2RGVA 4EV0A 4MTDA 5LHIA 4H0EA 3RYRA 3VODA 3V7SA 1E2XA 2QBYA 2FMLA 1TQMA 3M8EA 5CVJA 5TRDA 1Z9CA 3KZZA 4KMFA 1IZ1A 3P9IA 5K5QA 1ULYA 4I98B 1HBXG 1S29A 3ZMUA 1Z05A 2D1HA 3FMQA 2PMUA 2DBBA 1TBXA 3I58A 3FXQA 2V1DA 2ZKZA 3B73A 3LA3A 4OOIA 3GEZA 2GAUA 3B02A 5FO5A 3IRQA 2K02A 2RV8A 4BH9A 2P7VB 3HRMA 4QLCU 1SD4A 2KKOA 2C6YA 2K4BA 3L00A 4EGZA 4B09A 1S8NA 1QQIA 3D0SA 1R22A 2VODA 3QP6A 1H9TA 3W6KB 5LHHA 3IL2A 2DI3A 4R8HA 1U5TA 2UWMA 4O6JA 2A3SA 2EFPA 1LVAA 4ZZDA 4FX4A 1BI1A 3JSPA 5IT9K 2HEOA 2W85A 4QWQA 3RDIA 5EEHA 3RIRA 1R58A 3QU6A 4ENMA 2O61A 5D5VB 2XAGA 1ZH5A 2RDPA 2V6CA 1G3YA 3JAMZ 4HYEA 1TW3A 3WU0A 1P6RA 4ENJA 2QUFA 3WTTC 3FXRA 1KQ8A 2KRFA 1P4WA 3KP3A 2IRFG 1ZAOA 3E5UA 1QPMA 1XD7A 1YS6A 2O6GE 3DFGA 2IT0A 5ERIA 1P4AA 3HRTA 2WV0A 1I5ZA 1IXCA 1H9GA 4A0XA 3K2ZA 5L3CA 1K78A 1GXPA 4PDKA 3CO6C 3V7CA 4GYIA 3C18A 3MZHA 2HTSA 2HDCA 4BQAA 1XGSA 2IA1A 3O6BB 1LB2A 4Y17A 3C1DA 2FMYA 2G9WA 4O5VA 4BNCA 2L4MA 5DD4A 2BYVE 5A2QK 2XKOA 3T8RA 5FLXK 4L0YB 1B1BA 2Z33A 2DT5A 3RTRA 5DUKA 3GX4X 2EFQA 3F72A 1J7KA 2Q0OA 4YFNF 2HQRA 1TTYA 3GZ6A 3FHZA 4ESFA 1OMIA 3FZVA 1TLHB 4XSXF 1YO5C 5CVVA 3IHUA 1WRJA 1YW8A 1UCRA 5HS9A 1HSTA 5JVTA 2MH9A 4EJWA 3E6MA 3V8LA 2PG4A 2O8XA 1SMYF 2IJLA 4U0VA 1WSUA 1HQCA 1W4MA 2VXZA 3HUGA 5TJJA 2XIGA 4TV7A 4G7OF 3J80K 1XN7A 4LLNA 1XCVA 2VBWA 3T8TA 3RPUA 4UV9A 3HSFA 2XKPA 4CO8A 4L5IA 1W5TA 1ZG5A 1TQIA 4OIQF 4IRIA 4P5OA 4HV5A 2FBKA 4RGUA 4A2UA 2RKHA 4A6DA 2DTRA 3KLNA 2FOKA 1XSXA 3J81K 4XLNF 2FA5A 1R1TA 1IN6A 2IVMA 3ABTA 2A5YB 2E1CA 2A61A 1F9NA 2J5OA 3ZMTA 1Z1DA 1T98A 2PJPA 3T0YA 2JRTA 1OR7A 4FT8A 1FT9A 4S04A 1FSEA 2FRHA 3F3XA 2O03A 3C3WA 2Z3YA 5AIQA 4K2EA 2DLLA 2HOEA 4RGRA 2ISYA 1BC8C 1S7AA 1BOAA 1I27A 1SMTA 4EQQA 4IXAA 1HSJA 3PQJA 2E7WA 2JT1A 1UFMA 3CUOA 1D8KA 1PP7U 1S6LA 3ZQ7A 4KICA 4WXDA 3QOPA 4HOBA 4CDGA 5LEJA 1EH8A 1QNTA 2P7CB 1ZRDA 1J9IA 2IA0A 2XVCA 2VC0A 3LFKA 5LRRA 4IHTA 2HQNA 4M71A 1HW1A 2DK5A 3ECHA 1YQAA 2VC1A 1KGSA 3RPQA 4ZZLA 4WXHA 1TNTA 3K1MA 5HDKA 5IT9Z 4KIGA 5H6RA 5ICEA 4IVNA 4I7HA 3LAPA 3SZTA 3KP4A 3R61A 4CGZA 5E18F 1FY7A 4HF1A 3WGGA 1FBUA 3JSOA 1F5TA 2R7DA 3GXOA 2GXGA 3MZYA 1B9NA 4OINF 1USTA 3K69A 2KJBA 2A6HF 2OU2A 4RAZA 2VBYA 2PBIA 2FBIA 2NRAC 1TQPA 3TO6A 4O3MA 2RQPA 4BHPA 3KP6A 2STWA 2XAQA 3ULQB 1G3WA 2O3FA 1IUYA 3CDHA 5BPIA 3TKYA 5L3BA 2E7XA 4KNYA 2AXLA 2ZJ2A 3DEUA 2RC4A 1IF1A 4OIPF 3H3UA 3TOAA 2QQ9A 5A2QZ 1USSA 4RB1A 2MC3A 5CVRA 4CICA 4N9HA 1HKQA 5BS6A 4HDUA 3NRVA 2VOPA 4LLGF 4EMSA 5KVRA 4A0YA 3GWZA 3MCZA 2BE5F 1QZZA 3F8NA 2YX4A 4UNOA 2NAZA 3MAJA 1BC7C 4HF0A 3E5QA 4LG0B 2FF4A 1MDMB 4GCVA 4L9TA 3FX3A 1DP7P 3WODF 1S3JA 1STZA 2WTEA 2ACJA 2QQBA 5D5UB 1CGPA 5ICFA 1FBQA 4I2OA 2QVOA 4U0WA 1IN5A 3FM3A 3SXYA 1RNLA 2NNYA 4RS8A 4WX9A 4MEXF 5J8CA 1XSDA 1F1ZA 4U0YA 1XCBA 2ZXJA 1XMKA 2W84A 3HOSA 2W24A 4LD5A 2M87A 5IT3A 4YFXF 4CXFA 3J80Z 4A6EA 3KP2A 4LJZF 5AONA 1FP2A 1F4KA 5J8FA 1R5HA 1DPRA 2JTVA 1P2FA 2VT3A 1I1GA 1REPC 1IRGA 4EVIA 1U3EM 3ZP5A 4PCQA 4LFUA 4LB6B 3J81Z 4HF2A 2HGCA 1Y0UA 2NNNA 2Y0MA 2QYOA 5FD5A 4DNCA 3M7GA 4CHUA 4PGHA 3I5UA 4AIJA 3HOTA 3WTVC 3OOPA 3KP7A 4G7ZF 1J2XA 1SAXA 4E70A 1G3SA 1NHAA 3KP5A 3GFLA 3TDUC 4M9XA 5HLHA 1ZGAA 3WE3A 5BMZA 2VONA 3P7NA 2GIVA 1YW9A 3PQKA 2QZ8A 1IN8A 2F5DA 3ABUA 3AAFA 4OIOF 2HYFA 3DKWA 2HWVA 3RI4A 5LGTA 4AVPA 1FC3A 3BDDA 5H6QA 1KU9A 4GYGA 2MD5A 3M8FA 3DQVC 2OBPA 1L3LA 1RUNA 3ELKA 3COAC 4KFCA 1B6AA 1Z6RA 4L9NA 5D4RA 5HOOA 3F21A 3HYIA 3KE2A 2P6TA 2DO7A 2ADUA 2HKXA 3E6BA 1WWXA 1YYVA 3KEOA 3BWGA 3CUQC 2YPRA 2XAJA 3LA7A 1W7PB 1FWZA 4ENKA 2PMHA 1Z6TA 3F8CA 4WK8F 3G3ZA 3RKYA 1DPUA 4HQEA 1I6XA 2PLYA 2ZO4A 4NQWA 2ZCWA 1CF7A 1H0MA 4GXOA 3HHGA 3K9TA 1MJBA 3BJOA 4HX8A 3FMRA 3GFIA 5DUIA 2L02A 1BI0A 2P8TA 4UXNA 3GVAA 2H6BA 1YW7A 3KEQA 4IRHA 4MEYF 1SD5A 2XV4S 3V8JA 2K86A 3CLOA 2R3SA 3I54A 2P4WA 2L4AA 3LSTA 5HVQC 1FPQA 1R5GA 1ZLKA 2F2EA 4ESJA 1RZ4A 3EETA 4MTEA 2CQKA 4PZJA 2RNJA 3V4GA 2CYYA 5L3GA 3WU1B 1IAWA 3CTAA 4Q48A 2FQ3A 5FFXA 5DCMB 1QBJA 2DQLA 1GHCA 3QRFF 1KA8A 4G94A 2VBXA 3FMSA 4HX4A 3LQRA 4IPAA 4RAYA 2QLZA 1RUOA 2HYGD 3N97A 3MFKA 3R6SA 2DPDA 5BQTA 1JE8A 3I59A 2ZMEA 4N0BA 3ZMDA 1JXSA 2M8EA 3OV8A 3HTSB 2EB7A 4ZH4F 1LNWA 5LHGA 3BJAA 3C7JA 3IRRA 3IC7A 3RKXA 3E97A 3FXUA 1FP1D 4IRGA 3GUDA 2HKOA 2DQRA 1XSVA 1DUXC 4L5JA 3F8BA 5ILSA 5K1YA 2KJCA 2QQAA 1OKRA 4UHTA 2ZNYA 1FNNA 5JFRA 5DV5A 1JHHA 2LF8A 1HKTA 2H09A 1FYMA 2EV5A 4BHBA 1Q1HA 1Z7UA 1KQ0A 2X0LA 2Y48A 1KU3A 1G6NA 4HX7A 2LSOA 4GGGA 2H6CA 2D1VA 4XBFA 1ONVA 2BV6A 4HLXA 2QBYB 2HZTA 3EQLF 3HTUA 1GVJA 4IJAA 3VOEA 2FNPA 4HV6A 1RI7A 3LA2A 1D3YA 1IW7F 4P96A 2D2WA 2A07F 1OPCA 5F64A 2VT2A 5LGUA 5LLQA 4Q5SF 3ZN0A 2FEZA 2XAHA 5FFZA 6PAXA 4KIFA 3HHHA 2HTJA 4EM2A 1TNSA 4MQ9F 3GF2A 1O3SA 2YSRA 2VE9A 1ZN2A 4GO1A 4UVBA 1IN4A 1LEAA 3U1DA 1K79A 4JQFA 1J0RA 4WF2A 4G9YA 2FBHA 4EJTA 4Y13A 3KCCA 1J75A 3E3VA 1BI3A 4AD9A 4AWXB 1T2KA 1U5TB 5J6XA 3T1BA 2ZNZA 2M30A 1ZLJA 3J7AO 1B9MA 1WI9A 3H92A 4ON0A 2ETHA 5DEQA 1YTYA 2CO5A 3BPVA 4L9JA 3CUQB 1ZGJA 1ZARA 2O0YA 2LDUA 1OYWA 5HS8A 4BYYA 1UB9A 3REOA 1P4XA 3R0JA 3GW2A 4YIFA 3E6CC 1JHFA 5F6FA 1IXRC 4L9VA 5JHUA 1S7OA 2QWWA 1FOKA 1XDSA 1R1VA 1UHWA 4UUVA 3F23A 4P55A 1O3RA 4U7BA 1PDNC 5ILVA 4OIRF 3WTYC 5CJ9A 4YFKF 2IW5A 1FZPB 3HRSA 1LJ9A 1X3UA 4RB2C 2WWYA 3GFMA 4R1HA 2GZWA 3KZYA 3FF5A 5E20A 3K1NA 2OZUA 4HLYA 2YX7A 1ZREA 2OQGA 3I64A 3CO7C 2MBFA 3Q9SA 3H3ZA 1V4RA 4WXCA 1ZRCA 3VFZA 2MA3A 1ZHFA 2ZFWA 1G3TA 2BEOA 4EM0B 3T5XA 4LK1F 4Q47A 1T6SA 3DPLC 4M6XA 5K5RA 1VTNC 2RN7A 2PEXA 3S2WA 5DCMA 3F6OA 2HR3A 2EK5A 4YIIA 2P5KA 2RVCA 3RYPA 2LF7A 2EWNA 4AIHA 4OU0A 1BJAA 3U2RA 1IN7A 4XRFA 3R0AA 3Q5FA 4N9IA 4MGRA 3SFZA 3P9KA 1EH7A 4JBAA 2UZKA 3IKVA 1MD0A 4XSZF 1PP8F 4RB0A 3ECOA 5HDGA 2L3DA 2MH2A 5BOXA 2CFXA 3M9AA 2NYXA 1SFUA 3R4KA 4G6QA 4OMZA 1XGMA 2EJRA 1MKMA 5HLIA 4NB5A 3KETA 3V7RA 2GA1A 1MZBA 2PN6A 2CWEA 5E8GA 2UXNA 1KYWA 2B0LA 3RJPA 2OZ6A 2FU4A 4M72A 1ZG1A 3TO9A 4WCGA 3KLOA 5CYVA 2Z9OA 4G6DA 1UHMA 4EJUA 1R23A 5JR3A 2H94A 3TDZC 4EJOA 2Q2EA 4BXUA 2LKPA 2GQQA 1U8RA 4JK1X 3O2PE 4HDVA 3VB2A 1XDUA 4KA4A 2XROA 1OYIA 1R1UA 2MLKA 1O7LA 2P5VA 4RGSA 4LLLA 3QPHA 3D5LA 3WTZA 4R79A 2K7LA 3BZ6A 3DP7A 2QENA 3JW4A
chains in the Genus database with same CATH superfamily
2M45A 1U78A 5E3NA 2OAZA 4KMUX 3O8GA 4LB5A 4LGWA 1HXDA 2ID3A 4HA8A 2VIXA 3CCMI 3S1RJ 3QP5A 5EYRA 2LBFA 1V5EA 3FWEA 3TBIA 5IOZA 3W6JB 4M9SA 3PIOF 3F8MA 4B8XA 1MBEA 1SFEA 4CH7A 4M3FA 2IA2A 2H8WA 3A2KA 2M7BA 2VB6A 3PL8A 4PFOA 1T56A 4XLHA 1LPQA 2XRNA 2FOWA 2EV0A 2QSGX 1C0WA 3M1EA 3TW7A 3ZMZA 1IV6A 3JTHA 3KYCB 2M5WA 1U5TC 2JPBA 2V4JC 3IUOA 1BIAA 2Z5UA 2GM4A 2XB0X 1WH5A 4CZZA 4Q4ZF 2XAFA 1K6YA 2UV1A 3DU6A 2D45A 5LD2C 2F5EA 2ZC2A 1BM9A 5GAHJ 2E2IJ 3WE2A 2Y9ZA 2P5LC 3QYBA 5D8LB 4D7NA 4WWCA 3L2UA 3NAUA 3HPGA 3GLXA 4LOCA 2LTPA 2VPLA 4CZCA 3VYTB 1EA3A 2F4MB 3JTGA 3Q0VA 4BHCA 4XLFA 1B59A 4UUTA 4GFBA 1W7PD 1BI2A 2QM3A 4Y15A 3U1KA 4RA2A 3TMOA 1HKSA 5HNFA 3L7WA 1D0XA 3OYCA 2VLAA 3KFWX 3NEUA 3GTOJ 2V26A 1D0ZA 3P9CA 1QGPA 1ZKGA 2DFEA 2QSHX 1RIOH 4Z2YA 1YFHA 1AWCA 1YLFA 3OYIA 1ZYRF 2UXXA 3K1PA 1UMQA 2LG4A 3CUQA 4M9ZA 4Y4RA 5L3DA 5D8KB 2ME6A 3AG3H 3CZ6A 2CG4A 2FX0A 2BXZA 3WGHA 3WTWC 5AIPA 3BY6A 3K0LA 2VN2A 3U9GA 1IXSB 1Y8RB 2EQRA 2FE3A 1SVMA 5EZHA 2ESNA 2NS0A 2DK8A 3EYIA 4L18B 3S2HJ 4XKCA 3QU3A 1V54H 1YS7A 5LEKA 1ERDA 4P9FA 5F27A 3TGNA 2DPUA 3CCEI 3AKZA 3RKQA 1RR8C 1X19A 1WJBA 2KIMA 5ILUA 4XN0A 3DLAA 1U6GA 2NVXJ 3QPLA 1EH6A 3H3VK 3EYYA 3JRDA 4P9UA 5E79C 3HSRA 3V8KA 1L0OC 4HAMA 5CLSA 2M1BA 4NHJA 3CCYA 2V1XA 4XOPA 2ZB9A 2COMA 4FX0A 4S05A 2K3FA 1O57A 2K27A 4F7ZA 3I53A 3TO7A 4ZYEA 1EV7A 1W5SA 2E1MB 1IV8A 2K85A 2X4HA 5BPDA 3F22A 4XLCA 3L2VA 2CGPA 4ZYHA 1XGNA 4FASD 3TQNA 4HQMA 5DM6F 4KN7X 1YITI 3S14J 5J1YA 2R7WA 3LQQA 2XSJC 2VOOA 5DD8A 3R60A 2H1KA 5DCFA 4IQ4A 3BG3A 2MLGA 2FSWA 3BCBA 3EDPA 3CJNA 3ZPLA 3ZMSA 1O3QA 4G12A 5L3EA 5FB2A 5JI6A 1Z77A 5DYMA 4ETSA 1T38A 4I0AA 2PI0A 3QPTA 1U2WA 2OJED 4NC6A 5FD6A 5D5WB 1YG2A 1R49A 1G4DA 4ENNA 3I0TA 3IH4A 1SFXA 2ZMEC 1VQOI 1I39A 2E1NA 1QU3A 3VYSB 2L54A 4NBQA 4ASNA 4H4KC 1JGSA 2E36A 3ZN1A 5D4SA 1NK2P 1A35A 1J5YA 2DA3A 2F5FA 4G8XA 4KN4X 1S72I 2KRHA 2BW3A 2OTJI 1XGOA 4LMYA 4HEA2 4PJJA 1FYKA 1Z3YA 3LL7A 2OA4A 4OMYA 3DTIA 4LG0A 1MDMA 2JA2A 2WAQA 5F0HA 4HBLA 3SHFA 2QCOA 4A5NA 3IWZA 2JZYA 2ELHA 5M5XJ 1E17A 1HDDC 3FXLA 5F1RA 4OAZA 3VSKA 4ZDPA 1R7JA 3E5XA 4BJ6C 2IS1A 2EV6A 3AG4H 4ZC3A 5LGNA 2DU9A 1A5JA 4UV8A 5GPAA 2JA8J 4W97A 1QO0D 1ITYA 5K5OA 2DAOA 4LG3A 3OYBA 2GXBA 1BBYA 3S1QJ 5KNLA 4IEJA 5LBQA 3GBGA 1EF4A 2KZVA 1UELB 2E71A 4RGXA 3BPXA 3MWMA 3SZGA 4DZPA 2CRGA 3DV8A 1IRFA 2F5CA 5EEGA 5EZGA 3ZMVA 4KYWA 2WADA 3ASNH 2M7AA 3N4MA 4FETA 3W2WA 4B43A 5HDNA 1JJ8C 3RKWA 2EFWA 4MFEA 3ISPA 2A5WA 2GWRA 3DXJF 1U9OA 3PFIA 4QSHA 1YIOA 4MHGA 2DA1A 3KEYA 1A04A 1LEBA 3DBHB 3HSEA 3GZ5A 2FNAA 3L2CA 2PFBA 2XGXA 3BJ6A 3HB9A 1E3PA 3OYJA 2R7QA 1ZG3A 2HI3A 3BR0A 4YG2F 5ICCA 4BQQA 1FSHA 2WC2A 4ZYGA 1U9NA 2RREA 2ISZA 4MNUA 3PNVA 1TC3C 1J59A 4A3MJ 1BW5A 2GOMA 1MJAA 5FKOA 1I3QJ 3GMEA 2WA0A 2PJRA 1BJZA 1GVDA 4YELA 5FKKA 2YR2A 4Y3OA 4D0PA 1ZK8A 2R0QC 2R5YA 2LNBA 5HLGA 2W57A 4A0ZA 4KIBA 4MIMA 1YJWI 4RM2A 1OR7C 1V3FA 1OYYA 4KJZA 3VYUB 3H9GA 3PSIA 2VKVA 1HW2A 1ZRFA 3F6VA 2HPIA 5D6FA 3OYGA 4JOMA 2IPQX 2Q8KA 4I09A 3D1NI 1W36C 3CCJI 3GYHX 1D8JA 3L09A 2GOXB 4ZYAA 2AO9A 1FLIA 1WCMJ 3O3KA 2LP0A 2R7SA 2QKMB 3W2VA 2NVQJ 4BACA 1O7FA 5D5XB 3OS0A 2H27A 2Z99A 3BROA 4CYDA 4NC8A 5KK1A 1X1BA 1AU7A 2GXAA 5CVUA 3BZCA 2R7FA 4EJVA 1VF9A 2YS9A 3LSIA 1Z67A 3J7ZI 1LVKA 3HEFA 2NOJB 5DDGA 3PJRA 5IY5H 3IAM2 4U7DA 2DN0A 1WI3A 3LWFA 3CCVI 3FBIB 3JREA 2EFOA 3Q0WA 2JPCA 1K7AA 3QAHA 2W25A 4ZDLA 2GA2A 3KZIC 1A6QA 5ICGA 2EA2A 2G7HA 2HNHA 4XKWA 5JLWA 4FE7A 2MSYA 2O7OA 3CF2A 1VQMI 5C4JJ 3DPTA 3BTJA 2A6EF 1IJWC 3FM5A 4A12A 3PNYA 3BP8A 4KT5C 5C44J 1WZ2A 4A5MA 5FLMJ 3OS2A 1T0FA 2V79A 2HOAA 3HG9A 4QPOA 5E8IA 1O3TA 5CVIA 3WHBA 3KYDB 5E1ZB 4CA0A 2V1UA 2KIQA 4BU2A 1I1SA 1SANA 2XGDA 3BR5A 1NTCA 4LK0F 4PUSA 3IV5A 1BN5A 3PO2J 4BQNA 5H20A 3WTSC 1DDNA 2X1CA 2MABA 5J1RA 3WTXC 3QODA 1T39A 5GPCA 3ML6A 5ED4A 1PUEE 4FHTA 4G7HF 1W7PA 3SQNA 3CCRI 1WPKA 1MJ9A 4DQ2A 3JAMK 3QYEA 1ON2A 3I4PA 3JRFA 3HIFA 1R00A 1FIAA 3GO5A 4M6YA 2GBYA 2E5NA 4NQWB 3QWLA 4IHYA 3GFJA 1CF7B 1XB4A 2OQRA 1KQ9A 2J5PA 2XUBA 1FOYA 4BAYA 3NQOA 3I4NJ 4C2MJ 3K2AA 4I01A 2V9KA 3WG9A 3Q9VA 4XLPF 4V2FA 2PQ8A 2ZBKA 3IWFA 4UVCA 5E1XA 3D5SC 3WTUC 2AS5F 5TISC 3X2QH 2EZIA 3LSRA 2QGUA 4IHSA 4IHVA 1K78B 5E1WA 3OOUA 1LDJA 1R4NB 1KU7A 2IGKA 4AC0A 1XPXA 3MQ0A 4PGGA 2HS5A 4C2UA 3DBRB 1R36A 3H5NA 4B44A 2A68F 4HW0A 3BG6A 4IF4A 1IUFA 4ANJA 1FYLA 1VQ6I 2EPFA 5HS7A 3AFHA 4CCLA 5HLTA 1HW5A 3BZKA 4PSXA 1A6IA 5D6EA 3F8FA 2TRTA 3HRUA 4AIKA 3BT9A 2O5RA 3TOBA 1AOYA 3IH2A 4BDYA 2G7UA 1WH7A 3ONQA 4HNVA 4J19A 3CMMA 4B1RA 5EGOB 4EM1A 2G0EA 1BW6A 1VNDA 2EA4A 3CCUI 2VKHA 2CW0F 3JCUC 2XHKA 1QHGA 3AL0C 1ZELA 2KIUA 2DDAA 1B4AA 2QQ8A 1SD7A 1KYZA 3DF8A 2K40A 1G8XA 3BR6A 2KIFA 5JVGF 1R6RA 2LMDA 3M07A 3TP3A 2A69F 4M74A 2V9VA 2ESHA 2YU3A 1P92A 2WY8Q 1GXQA 5FLXZ 4KUMA 1D5VA 4UVAA 2JRMA 2HPMA 3K10A 4CCOA 3K4KA 3MN2A 2EFNA 4RB3C 4HZFA 4BEHB 1FX7A 5JHFA 1LQ1A 1U8BA 2LKXA 1KU2A 2DMTA 2XASA 4XNFA 1HLVA 2XPUA 2XPVA 2HFHA 2IBDA 3I59B 4CYCA 2NS7A 2ZMEB 1IRZA 2OD5A 3H9JA 1BIBA 1FJLA 4PSWA 3MEXA 2DJNA 3DEWA 2CH0A 4KITB 2I8DA 2F5VA 1T95A 1LE8B 1QPIA 3ROUA 3ERED 2VE8A 5LRSA 2STTA 1JT6A 2ZXHA 1FBSA 4GRIA 5CKTA 2H8RA 2K4JA 3ZQCA 1ON1A 1SD6A 2IP2A 2VBZA 1MGTA 3OYHA 3CCQI 2AQFA 2F6CA 2TDXA 1XMAA 4I02A 1IGNA 3CCLI 4U88A 5L3FA 1RKWA 3SZPA 3CMYA 2M8GX 3HUGB 1SVLA 1I3AA 2MD0A 3ZQGA 5GTIC 4MQVA 4XM3A 2BY3A 1LDDA 1X1PA 2Y75A 1QZYA 4I0BA 2CUFA 1WQ2A 1TW2A 5E17F 2RAEA 2BGCA 4X0GA 3GTLJ 3EUHA 4AU7A 2DA5A 3RPUD 4EGYA 1LDKB 3WGIA 3BOQA 1YE9A 4M73A 1ODDA 3VEPA 1MIJA 4RAGA 2FXAA 4A3FJ 2L2OA 2JSCA 2M3AA 4ZYDA 1UJ8A 1WJFA 2WAQN 3G73A 2L01A 3NARA 4LIVA 2RQQA 2WAFA 3IKTA 2DFIA 3DWLE 1HCRA 3LAJA 2WAEA 2NXNB 2P6SA 3L9FA 2W7NA 2Y30A 4KDPA 1K6OA 3G1OA 4BXFA 4ESBA 3E6DA 3GLLA 2DW4A 5IPAA 1MW7A 1WKMA 2BBYA 5IYDJ 2CSOA 5FGMA 4L0ZB 1Z91A 3I71A 2RGVA 4EV0A 4MTDA 5LHIA 4H0EA 1GLNA 3HBLA 1N78A 2OF7A 3RYRA 1Z7LA 3VODA 2K9QA 3V7SA 1E2XA 3ZOBA 2B63J 2QBYA 2FMLA 1TQMA 3G1MA 3RZDJ 2P0WA 1FOWA 3M8EA 2EILH 5CVJA 3GTGJ 5TRDA 2LRDA 1Z9CA 3KZZA 3FXMA 4FISA 4KMFA 1IZ1A 4RAFA 2FD5A 2E1OA 4NDLA 3P9IA 2CUZA 5K5QA 1ULYA 3C2GA 4I98B 4F52A 1HBXG 1S29A 3ZMUA 1Z05A 2D1HA 3BTIA 3FMQA 2PMUA 1ENHA 1W36D 2DBBA 1AKHB 3W6VA 2HU9A 1TBXA 3I58A 2VQLA 1Q1VA 3FXQA 2OCEA 2V1DA 2ZKZA 3B73A 4RBOA 3LA3A 4OOIA 3GEZA 1VQ4I 2H1LA 1TT5B 3MVPA 2GAUA 3B02A 4PJLA 3L2QA 2K3PA 1IG7A 5FO5A 3IRQA 2K02A 2JUGA 2RV8A 3CDIA 4BH9A 2JA7J 1KONA 2MG4A 2LD5A 4IQJA 1FTZA 2P7VB 4PK4A 3HRMA 4QLCU 4JYKA 2HDWA 1SD4A 2K9LA 4A3LJ 2R7OA 2KKOA 2C6YA 2K4BA 4DBQA 2PMZN 3L00A 1N75A 3OYAA 4EGZA 4B09A 2HVSA 1S8NA 4XR6A 1QQIA 2VJ4A 4EEFG 2V9PA 2XGCA 3D0SA 1MNEA 3FKIJ 3K6GA 1R22A 2IS2A 2VODA 3QP6A 1H9TA 1OCTC 1OCOH 3O8HA 3W6KB 3GTPJ 5LHHA 3IL2A 2DI3A 4R8HA 1U5TA 2DJIA 2UWMA 1K4TA 4ZJZA 2VKEA 2ZXIA 4O6JA 1XS9A 2A3SA 3MKLA 1LVAA 2EFPA 4ZZDA 4FX4A 1BI1A 3JSPA 5IT9K 4A93J 2HEOA 2KPMA 2VI6A 2W85A 5TGTA 4QWQA 3RDIA 5EEHA 2QF7A 3HKZN 3RIRA 1R58A 2E60A 2MYSA 2OTLI 3QU6A 4ENMA 4EATA 2O61A 5D5VB 2R5ZB 2XAGA 5HNHA 1ZH5A 2RDPA 2DXIA 2V6CA 1G3YA 3JAMZ 1ZR2A 1XG1A 3S3MA 1VQKI 5CQEA 4HYEA 5EEAA 1TW3A 1VQ5I 2VPRA 3LOCA 1P6RA 3WU0A 5F0FA 4ENJA 2DFHA 2Y31A 1ETVA 4X1EA 2QUFA 3QQAA 1S7EA 2ID6A 3WTTC 3DTEA 5FRNA 3FXRA 2CMPA 1KQ8A 3OR1C 2KRFA 1P4WA 1VI0A 2KLOA 1WGXA 3KP3A 2IRFG 1ZAOA 3E5UA 1QPMA 4B3AA 1XD7A 1YS6A 2CV2A 2O6GE 2M4GA 2DCEA 3DFGA 2LREA 3SJMA 2IT0A 5ERIA 1P4AA 3HRTA 2COBA 2WV0A 1I5ZA 1IXCA 1X2NA 1H9GA 4A0XA 3K2ZA 4D5FA 5L3CA 3HM5A 1K78A 1JTXA 1XMXA 4PDKA 1GXPA 4ZDOA 5CPRB 1T33A 2E2HJ 3BR2A 3CO6C 4UY8I 2QA4I 2IGMA 3V7CA 5DS9A 4GYIA 2ZSIB 3C18A 3MZHA 1E0EA 1XTAA 4F3QA 1PUFB 2HTSA 3DKXA 2Z2SB 4AYBN 2HDCA 4BQAA 1XGSA 2IA1A 2XB5A 3O6BB 1LB2A 4Y17A 3C1DA 5DM7F 3E0JB 2FMYA 2G9WA 2R92J 2V6EA 4O5VA 1OCPA 2L4MA 5B66C 4ZTJA 5DD4A 2VJ5A 2BYVE 5A2QK 4BNCA 2XKOA 3T8RA 5FLXK 5EGOA 3AL0B 4L0YB 1B1BA 2Z33A 2IXSA 2F4OB 1H8AC 2DT5A 2QSFX 3RTRA 5DUKA 5EF6A 3GX4X 2EFQA 4E7LA 2NVYJ 3F72A 4E7HA 4QPQA 2L9RA 2BVLA 1JKRC 1JTYA 2DA7A 1J7KA 3MKWB 2X1DA 1B8IA 2Q0OA 5BNGA 4YFNF 2HQRA 4XRSA 1TTYA 3BG7A 3GZ6A 3FHZA 4ESFA 2D5VA 2Q1ZB 3SDGA 1OMIA 3BG5A 3N05A 2CQQA 2PX9A 3FZVA 1TLHB 4BEHA 4XSXF 1YO5C 2LR8A 4B3XA 2W4SA 5CVVA 1ZTRA 3IHUA 1WRJA 1YW8A 1UCRA 1X4OA 5HS9A 3GCMA 1HSTA 5EG0A 5JVTA 2MH9A 4EJWA 3E6MA 2HOTA 3OR2C 3JRAA 2VASA 1JI8A 5FKNA 3V8LA 2CUJA 3RSNA 4UB8C 2VL8A 3HOZJ 2PG4A 3RCOA 1HA8A 4I76A 3D5RC 2O8XA 3OYNA 1WJ5A 4Y33A 3EUKL 3HOWJ 1SMYF 4XIDA 2BHZA 2KT0A 1W1WE 3ABMH 4XLAA 5B1BH 2IJLA 4BY1J 1ACIA 2YUSA 3CC2I 4U0VA 4RLQA 1WSUA 1HQCA 1W4MA 2R7VA 2HZDA 5GAGJ 1RPWA 4QIWN 2VXZA 3HUGA 3CF5F 5TJJA 2XIGA 1X1DA 3GZNB 4TV7A 3I4MJ 2LKSA 4G7OF 3J80K 2ZJPF 5KHDA 3K4JA 1XN7A 2E35A 4LLNA 1XCVA 3FK7A 4JX5A 1OFCX 2VBWA 3T8TA 3RPUA 3OY9A 4UV9A 3MKYB 4W1UA 3HSFA 2XKPA 3E7LA 4CO8A 3H35A 4L5IA 1W5TA 1ZG5A 1TQIA 1DU0A 4OIQF 2AHQA 5F04A 3K4LA 5FRMA 4IRIA 1W0UA 2JK3A 4P5OA 1YOVB 2CQXA 3CD6I 4HV5A 2FBKA 4RGUA 4A2UA 2RKHA 4A6DA 4UUSA 2DTRA 3KLNA 2FOKA 2XC7A 3OSFA 1XSXA 2PMZA 3J81K 3VWBA 3OIOA 4XLNF 2XRLA 2FA5A 1R1TA 2OUMA 1OCCH 1Y8QB 1IN6A 2LY2A 2IVMA 4C3JJ 4MFDA 3ABTA 2Q2EB 4XMYA 4DZJA 2A5YB 3WHCA 2E34A 3LMMA 1OLTA 2MW8A 2E1CA 4M3BA 2A61A 3ZQFA 1F9NA 2J5OA 3ZMTA 1Z1DA 1T98A 2PJPA 3T0YA 1P7JA 2JRTA 1OR7A 2M4KA 4G6TB 4FT8A 2QEXI 3ZR8X 2X51A 1FT9A 3CESA 4S04A 1D1BA 2JWTA 5IP6A 3AG1H 3PFYA 1FSEA 2FRHA 3F3XA 3C3WA 2O03A 3BG9A 4AVZA 2Z3YA 4K2EA 5AIQA 2DLLA 3HKZA 2HOEA 2KDZA 5GAEJ 2LBFB 4RGRA 2HXOA 2ISYA 2UUZA 1BC8C 2DA4A 1S7AA 3GTJJ 1BOAA 1I27A 3S16J 3H0DA 4YIRX 1MMGA 1SMTA 4EQQA 4IXAA 4A3KJ 1HSJA 3PQJA 2E7WA 4RDUA 2JT1A 1UFMA 3CUOA 5KCMA 3G1LA 4XL9A 1D8KA 1OISA 1LKXA 1PP7U 1S6LA 3ZQ7A 2CUEA 1ETWA 4KICA 2DMQA 1QZEA 4WXDA 1MBJA 3BQYA 3QOPA 4HOBA 1F43A 4CDGA 5LEJA 1EH8A 4OAYA 1QNTA 4D5CA 2P7CB 3HGYA 2VXDA 1ZRDA 1J9IA 2IA0A 2XVCA 4B48A 4XRSG 2VUMJ 2VC0A 3LFKA 3JR9A 4DYCA 5LRRA 4IHTA 2HQNA 2KQRA 1SEUA 4M71A 1HW1A 1IDZA 2DK5A 3ECHA 3H36A 1YQAA 2I5UA 4CCKA 2B7EA 2VC1A 1JUMA 2NVUB 2L0KA 1KGSA 3RPQA 4ZZLA 2X6WA 1XX5A 4WXHA 1MMAA 1TNTA 1WJEA 2EH3A 3K1MA 5HDKA 5IT9Z 4NUBA 1QRYA 4KIGA 1W0TA 1SVOA 5H6RA 5ICEA 4AYBA 3LNQA 3TP0A 4IVNA 4I7HA 3S3OA 3LAPA 3SZTA 3KP4A 3R61A 2E2JJ 4CGZA 5E18F 1FY7A 1MNMC 4HF1A 3WGGA 1FBUA 3HGGA 1APLC 3JSOA 1F5TA 1LUJB 2R7DA 3GXOA 2GXGA 2K9SA 3MZYA 4XKVA 1V5FA 1JKQC 4JX4A 3NWSA 1B9NA 4F55A 4OINF 1JUSA 1USTA 3UNGC 3VYRB 1BL0A 3K69A 4IHXA 1Y1VJ 1X2MA 2KJBA 2A6HF 3OYKA 1K61A 3CP2A 2OU2A 1YIJI 4RAZA 2VBYA 2PBIA 4CCMA 2LFBA 2FBIA 4E7ZA 1S9HA 2L7MP 1NG6A 1TQPA 1WVRA 1CQTA 2NRAC 3TO6A 4E7KA 4O3MA 1V5GA 2AXTC 2CW8A 2RQPA 3A01B 2ELKA 2CV0A 2CS3A 4E7IA 4BHPA 3KP6A 2STWA 1YRNB 2XAQA 2L5QA 3ULQB 1G3WA 2O3FA 1IUYA 2JVHA 4I99C 3CDHA 3L2RA 2Y2ZA 5BPIA 1GV2A 3TKYA 2E5ZA 1Z21A 5L3BA 2E7XA 4PJMA 4QTRA 2LOOA 4KNYA 1IO2A 2AXLA 2ZJ2A 3DEUA 2RC4A 2V1NA 2ZSHB 5B1AH 3V42A 3FXOA 3CJQB 3IH3A 1TWCJ 1IF1A 4OIPF 2Y0SN 2OC6A 3L1PA 1PUFA 3H3UA 2M0MA 3TOAA 2QQ9A 5A2QZ 1USSA 4RB1A 2MC3A 2E19A 5CVRA 4CICA 4BGDA 4N9HA 3Q3SA 1WJDA 3BQZA 1HKQA 1NG7A 3L2WA 5BS6A 2HVRA 4HDUA 5J4YA 3NRVA 2VOPA 2L7KA 4LLGF 2XSDC 1ORKA 4BDZA 1NK3P 3M4OJ 4EMSA 1Y56A 5KVRA 3F0CA 4A0YA 3GWZA 3MCZA 3ZXSA 3DCFA 3IAS2 4XK4A 4BQOA 2BE5F 1QZZA 3F8NA 2M9HA 2YX4A 2HXIA 1K4SA 4UNOA 2NAZA 3MAJA 1BC7C 4HF0A 2HDDA 3BCAA 3E5QA 2BY1A 4KISA 1VQPI 3S1MJ 4LG0B 2FF4A 1MDMB 2F48A 3LFUA 4GCVA 1VFCA 3HOVJ 4L9TA 4FQGA 3FX3A 1DP7P 2EIMH 3RZOJ 2LH9A 4YRVA 5C4XJ 3WODF 1X1AA 3S2DJ 2DMPA 2BY2A 1JT0A 1YHQI 2JA6J 1S3JA 3SFIA 3PNTA 1STZA 3VDXA 2WTEA 3JRCA 2ACJA 2QQBA 5D5UB 3LSMA 1CGPA 5ICFA 2CFOA 1FBQA 3CP8A 4I2OA 2QVOA 1PVEA 3CC7I 4U0WA 1IN5A 5K7ZA 3FM3A 2R7TA 5IYBJ 2X9DA 4HRIA 3SXYA 5M5WJ 1RNLA 4L5EA 4DYRA 2NNYA 1MBHA 4RS8A 1EJ9A 4WX9A 3B6AA 4MEXF 3CC4I 2XAUA 1BOBA 5J8CA 1VQ9I 4C3HJ 1XSDA 1F1ZA 3DU5A 1LFBA 4U0YA 2CW7A 1XCBA 2ZXJA 1XMKA 5IOYA 2W84A 1TWHJ 3FKJA 2W24A 3HOSA 1G2HA 2BY0A 4E7JA 4LD5A 4IOAF 2M87A 5IT3A 4YFXF 5J1UA 4CXFA 3J80Z 3Q0UA 1MSFC 2M34A 4A6EA 3KP2A 2ZFUA 1EKEA 1ETQA 2X6XA 3QPSA 3OIPA 4M3DA 2DFFA 4LJZF 5H2FC 5AONA 3JRGA 1R5ID 1FP2A 3BR3A 1F4KA 1VZ0A 2DA2A 2OV7A 4ITVA 1R5HA 5J8FA 3KIOA 1DPRA 1MH3A 3K4BA 3H9QA 3DKYA 3BR1A 1X1CA 1GUUA 2JTVA 3E1SA 1BA5A 1P2FA 2VT3A 3TL4X 1I1GA 4HG2A 1REPC 1IRGA 2W1OA 4EVIA 1DU6A 2R7UA 1U3EM 2RNGA 2BVMA 4RMNA 3ZP5A 1MMNA 3PIPF 1PYVA 4PCQA 4S0HB 1QA6A 4LFUA 4LB6B 4NNJA 3J81Z 4HF2A 2ZXWH 3QOEA 2HGCA 2LY9A 4NC7A 1Y0UA 1MNDA 1X58A 2NNNA 2QYOA 2Y0MA 5FD5A 4IL6C 1JKPC 4DNCA 3M7GA 4CHUA 4BJ5C 4PGHA 2L9SA 3I5UA 2BXYA 4AIJA 3KX2A 3HOTA 3WTVC 3OOPA 1NH3A 3KP7A 4G7ZF 2XF7A 4E4HA 4IOCF 5EJCA 2VQGA 2IAIA 1J2XA 1SAXA 4PJNA 4E70A 1G3SA 2IEKA 1NHAA 3KP5A 4BUPA 3GFLA 2WB1N 3TDUC 5LFAA 4M9XA 2W48A 5HLHA 1UHSA 2VQCA 3HOUJ 1ZGAA 3WE3A 2N8GA 5BMZA 1H89C 1HF0A 3B6CA 2EIJH 2VONA 1GV5A 1K83J 3P7NA 1X3WB 1RR7A 2FJ1A 1I6HJ 4Y52J 2GIVA 3ABKH 1YW9A 3PQKA 2QZ8A 1IN8A 2F5DA 3LSHA 3ABUA 2X6OA 3M8JA 2HQAA 3AAFA 4OIOF 3I9V2 2HYFA 4A3IJ 3DKWA 2DYRH 2L9NA 2HWVA 1GDTA 3RI4A 5LGTA 4YEJA 2LC2A 4AVPA 1FC3A 2AQEA 3BDDA 5H6QA 3PM1A 1KU9A 3EUAA 3OWTA 4XOTA 4GYGA 3ZQQA 2MD5A 1FIPA 3M8FA 3DQVC 2OBPA 4FTHA 3G2BA 1L3LA 4D1QA 1RUNA 3ELKA 3COAC 2W00A 4DGWB 3OL4A 4KFCA 1B6AA 5J40A 1Z6RA 2ECCA 4L9NA 1KZHA 5D4RA 4IKFA 3K4MA 5HOOA 3F21A 3HYIA 1U0JA 2DYSH 3KE2A 3K70C 2P6TA 3PUBA 2HVQA 2DO7A 2ADUA 2HKXA 3E6BA 1ETYA 1ZQ3P 4XN3A 5E3OA 4A3EJ 1WWXA 1YYVA 3KEOA 4HNUA 1FOXA 1RETA 5E3MA 3BWGA 2MGQA 3CUQC 2YPRA 2XAJA 3LA7A 4C30A 1YJ9I 2JA5J 4N4OB 3A0BC 1W7PB 2XF6A 4D9JA 3J7AY 4OWRB 1FWZA 4F91B 2XDVA 4UB6C 3GTQJ 4J01A 3GTKJ 2NOGA 3OYMA 4ENKA 2M2EA 2PMHA 2Y0SA 1Z6TA 3F8CA 1UAAA 3S32A 2ZJQF 4WK8F 2EINH 3G3ZA 3MD2A 1JGGA 3RKYA 1DPUA 4A3DJ 4HQEA 3LSJA 4BE2A 1I6XA 1VQNI 4XICA 2PLYA 2ZO4A 4NQWA 2ZCWA 1CF7A 1H0MA 1ZGWA 1WHUA 4GXOA 3HC7A 1UG0A 3FK6A 3HHGA 4M3EA 3K9TA 1MJBA 3BJOA 4E6KG 4HX8A 3FMRA 2DA6A 3GFIA 2L9VA 3UR3C 1J09A 5DUIA 2L02A 1BI0A 3CMAI 2P8TA 4UXNA 3GVAA 1BR2A 1P9QC 2VJIA 2JSPA 1WJCA 4BJTA 2H6BA 3PSFA 3S3NA 4DYQA 3HXLA 1YW7A 2LLKA 3KEQA 4DBRA 1LFPA 4IRHA 4A3CJ 4MEYF 4DIQA 1VQ7I 1SD5A 2XV4S 3V8JA 2HYJA 3S1NJ 2K86A 2O8KA 3CLOA 2ECBA 1Y0NA 2R3SA 1OQYA 3I54A 4M6VA 2P4WA 3J7YJ 1WJAA 1B72B 2L4AA 3LSTA 5HVQC 3A01A 1Y1WJ 1FPQA 2K9NA 5IP9J 2X48A 3FBNB 1R5GA 1ZLKA 1YRNA 5M3FJ 1MSEC 2F2EA 4ESJA 1RZ4A 3EETA 4RLFA 3LSKA 4MTEA 1SAUA 3I3LA 2CQKA 5JLXA 4PZJA 3BTCA 2RNJA 3V4GA 2CYYA 5L3GA 3WU1B 1IAWA 4XORA 3CTAA 4Q48A 3OS1A 2FQ3A 2XGEA 1YX3A 5IYCJ 5GADJ 5FFXA 1SC7A 4A3BJ 5DCMB 1QHHD 1R9TJ 1QBJA 2DQLA 3H0GJ 4IX7A 3ZRGA 4F92B 3OL3A 2Y9YA 1IDYA 4RM3A 1RRJA 1A36A 3H5RA 2KDOA 2R93J 1GHCA 3CCSI 3QRFF 1KA8A 4MLOA 2DMNA 4G94A 4LIUA 3FHNA 2VBXA 5GTHC 3FMSA 2EIKH 4HX4A 3LQRA 3S8PA 3M1CA 4IPAA 4RAYA 3SEQA 2QLZA 1RUOA 4CYCB 4XLEA 2HYGD 2A6TA 3N97A 3MFKA 2GIZA 3R6SA 2DPDA 2CJJA 5BQTA 1JE8A 3I59A 9ANTA 1TL8A 2ZMEA 4N0BA 3ZMDA 1BR1A 1JXSA 2M8EA 3OV8A 3HTSB 3F9KA 2EB7A 4ZH4F 1LNWA 5LHGA 3BJAA 3C7JA 2R7XA 3IRRA 1LE8A 3K4NA 3IC7A 3RKXA 2L7ZA 2IGOA 3PO3J 2Y69H 3E97A 4D7MA 3FXUA 1FP1D 3OIQA 4IRGA 3HOXJ 3S15J 1TWFJ 3GUDA 2HKOA 2DQRA 1XSVA 2Z1DA 3K4CA 4AIDA 1DUXC 4L5JA 3F8BA 3MZ8A 3I55I 1T8IA 3H5AA 5ILSA 5K1YA 1FTTA 2NVTJ 2KJCA 2QQAA 1OKRA 4UHTA 2Z16A 2ZNYA 2DT7B 1FNNA 5JFRA 2KHMA 5DV5A 1JHHA 2X6YA 4M3GA 5KAIC 2LF8A 1UG2A 2KISA 3HDDA 1HKTA 2LYCA 2H09A 1FYMA 2EV5A 2FUG2 4BHBA 1Q1HA 3OYEA 2WB1A 1Z7UA 3VSLA 1TWAJ 2CV1A 2DDBA 1KQ0A 2X0LA 2Y48A 3P5JA 3ASOH 1KU3A 1G6NA 3FXKA 1QVTA 5M3MJ 3FIWA 3CJTB 4HX7A 2LSOA 5B5EC 1T08B 4V19K 1FEXA 4GGGA 2OPTA 1Y39A 2H6CA 2DT6A 2D1VA 1TZLA 3OMYA 3OYLA 4XBFA 1ONVA 2BV6A 4HLXA 2QBYB 2HZTA 3CJRB 4F93B 4HSRA 1JJ6C 3G6EI 2OCCH 3EQLF 5EDNA 3SDBA 4C9YA 3HTUA 1GVJA 2BHYA 2JJ7A 2X1EA 3FISA 4IJAA 3VOEA 2FNPA 3BLYA 4II2A 3I56I 2JMWA 4HV6A 1RI7A 4HPQA 3LSPA 3LA2A 1TP4A 2VJJA 1D3YA 3G71I 1IW7F 4P96A 2D2WA 2A07F 1MMSA 1OPCA 2DTZA 1ZR4A 5F64A 4A3JJ 3S93A 5FLVA 2EZHA 4II3A 2VT2A 5LGUA 2VKDA 5LLQA 4Q5SF 3ZN0A 1HOMA 2FEZA 3ZQLA 2XAHA 2KZGA 5FFZA 2IS6A 6PAXA 2BOLA 4KIFA 3HHHA 2MC4A 2HTJA 1O4XA 4EM2A 2HOSA 1E3OC 1AKHA 1Y6IA 1AHDP 3LSGA 1TNSA 2DODA 4MQ9F 3GF2A 3EPZA 1O3SA 1MMDA 2YSRA 1DQUA 3ESWB 2VE9A 1X4PA 1X3ZB 1ZN2A 4GO1A 4IO9F 2YU9J 2QKLB 3RQIA 1DP3A 1I50J 4UVBA 1IN4A 3BTLA 4BL0B 1LEAA 3C2BA 1OCZH 3U1DA 2LK2A 1K79A 3ZQIA 4JQFA 3GTMJ 1VQ8I 1J0RA 4N4NB 5F0CA 2KFDA 5K7HA 4WF2A 2DMUA 4G9YA 1FMVA 3SEZA 1T0FC 2FBHA 4EJTA 4AUXA 2W82A 4JP0A 4Y13A 3KCCA 3DTKA 2EZLA 1J75A 4A69C 2R4GA 3CDLA 3E3VA 5HODA 3A0HC 4CCNA 4JX6A 3ZQHA 1YJNI 1VQLI 1DGWY 3ZCOA 1BI3A 2F4IA 4AD9A 4AWXB 3JRHA 1T2KA 1H88C 1U5TB 5J6XA 3T1BA 2KRCA 2ZNZA 2ICWG 3ABLH 2M30A 3OYDA 1ETOA 1ZLJA 3J7AO 2CU7A 1B9MA 1WI9A 3H92A 4ON0A 2CQ7A 2ETHA 2L7FP 5DEQA 3K70D 2GLOA 1YTYA 2K5CA 2CO5A 2WY7Q 3BPVA 4L9JA 3RQ4A 4GDFA 5F08A 2JUCA 3AG2H 1TWGJ 3CUQB 1SFKA 4C2TA 1ZGJA 1QVUA 1ZARA 5FROA 1BR4A 1JKOC 1MBKA 2O0YA 1MBGA 2LDUA 4CSWA 4I6ZA 1S5LC 1OYWA 4E7SA 5HS8A 4Z6YA 1G59A 4BYYA 1UB9A 2DOAA 3G4SI 3REOA 1M1EB 1P4XA 1W5CC 3R0JA 3GW2A 1A31A 2R5ZA 4BY7J 1D1AA 2A05A 4YIFA 3E6CC 1RC9A 4B47A 1JHFA 5F6FA 1IXRC 4L9VA 5JHUA 2O9LA 1S7OA 2QWWA 1FOKA 1XDSA 1R1VA 1UHWA 4UUVA 3F23A 4P55A 1O3RA 1N25A 4U7BA 1PDNC 2XPWA 5ILVA 4OIRF 3WTYC 5CJ9A 1OJLA 4YFKF 1D1CA 2IW5A 1FZPB 3HRSA 1LJ9A 4C3IJ 4ZTFA 1X3UA 5KAFC 4RB2C 2WWYA 2BZTA 3GFMA 2GZWA 4R1HA 3KZYA 2K9MA 3FF5A 5E20A 3FXJA 4BXXJ 3K1NA 2OZUA 4HLYA 2YX7A 2WBMA 2JN6A 3JRBA 1ZREA 3HJEA 2OQGA 3A4CA 3I64A 1AA7A 3VPRA 3CO7C 4HNTA 5B3SH 4J00A 2MBFA 3Q9SA 3H3ZA 5FJ8J 2EZKA 4U87A 3UKGA 1V4RA 3NWTA 4WXCA 1ZRCA 2E1MC 3JRIA 3VFZA 1HDPA 2MA3A 2DOEA 2XF5A 1ZHFA 5C3EJ 2ZFWA 1G3TA 3CLQA 1POGA 1LFUP 1B72A 2BEOA 3ZGKA 4XONA 4EM0B 2FQ4A 5K7FA 3OSGA 4BBSJ 2MFZA 1MBFA 3T5XA 4LK1F 4XRMA 3IP4B 4Q47A 1T6SA 3DPLC 4M6XA 1XC5A 5K5RA 1VTNC 3S17J 3MMYB 2RN7A 1ETKA 5J47A 2KP6A 4DJAA 4XQFA 2JVGA 2ZJRF 3OYFA 1E3HA 2PEXA 3A1YA 4BS9A 3S2WA 5DCMA 1B8IB 3F6OA 3KYLA 1WFXA 2X85A 3MKZA 3BC8A 1V55H 4BE1A 2BW3B 1D5YA 1IRXA 2LY1A 2HR3A 2EK5A 4YIIA 1FMWA 2P5KA 2CQNA 1IC8A 3CMEI 2RVCA 3TW6A 1D0YA 2R7ZJ 2NS8A 4B4CA 1R71A 1MH4A 3RYPA 3H1CA 2LF7A 2EWNA 3ERMA 4XKBA 2VQHA 5J3LA 4AIHA 4OU0A 1BJAA 1F36A 3TEDA 3U2RA 5EG0B 1IN7A 2R7RA 4XRFA 2IS4A 3R0AA 1HC8A 3Q5FA 4N9IA 3WG7H 4MGRA 5E3LA 2JQ7A 3SFZA 1Z0XA 3P9KA 1EH7A 3A02A 1YI2I 4JBAA 2UZKA 3IKVA 3QYFA 5FKMA 1MD0A 3FDYA 4XSZF 1PP8F 2HQ5A 4RB0A 3ECOA 4HSTA 5HDGA 3DPUA 2L3DA 4CUGA 2MH2A 5BOXA 3EUHC 2CFXA 4A3GJ 1YX5A 3M9AA 2NYXA 1SFUA 3R4KA 3M3YJ 4G6QA 4OMZA 3HPHA 1XGMA 2EJRA 4BKXA 3DEEA 4ABZA 1MKMA 1ETXA 4PFPA 1SFOJ 5HLIA 4NB5A 2TCTA 4MO7A 2ME0A 3CQZJ 2LVSA 3KETA 2KL4A 3V7RA 2GA1A 1MZBA 1DGRM 2V7FA 1OCRH 3K7AJ 4PJ0C 4BE0A 2PN6A 2CWEA 1RKTA 4IZZA 1PJRA 5E8GA 2UXNA 3WU2C 2ELJA 1KYWA 2B0LA 2KMUA 3W3CA 1RESA 3RJPA 3HL2A 2OZ6A 2DOFA 4CCJA 2FU4A 4M72A 1ZG1A 3KPHA 2PJRB 3TO9A 4IHWA 4DOZA 4WCGA 3KLOA 4FCYA 5GP9A 4KT6A 5CYVA 3C2HA 2R5YB 2Z9OA 5M5YJ 4G6DA 4UUSB 3HOYJ 1UHMA 4AM3A 3PUFA 4EJUA 1N77A 2EBIA 2M0CA 3HZJA 1R23A 3SYTA 5JR3A 3W2AA 1GT0C 1Z3XA 2H94A 3TDZC 5CQGA 4EJOA 3DBLB 4Y7NJ 5F1JA 1P7IA 2Q2EA 5DTDA 4BBRJ 4P1WA 3DLLF 5J4VA 2B9SA 4BXUA 1UZCA 2I10A 4V2GA 2LKPA 3A03A 2GQQA 4X6AJ 1U8RA 4JK1X 3O2PE 4HDVA 3VB2A 1R4MB 1XDUA 4KA4A 2XROA 1OYIA 1R1UA 5FKLA 1JUPA 2IGNA 2MLKA 1O7LA 2P5VA 4RGSA 1TT0A 4LLLA 5IP7J 3QPHA 3D5LA 4FE4A 4LITA 3WTZA 4DW6A 4R79A 3U21A 2K7LA 3BZ6A 2P81A 3DP7A 2WV1A 2QENA 3JW4A
chains in the Genus database with same CATH topology
2M45A 1U78A 2OAZA 4KMUX 4LB5A 4LGWA 1HXDA 4HA8A 3QP5A 3FWEA 3W6JB 4M9SA 3F8MA 4B8XA 1SFEA 2IA2A 2XRNA 2EV0A 1C0WA 3M1EA 3ZMZA 3JTHA 2M5WA 1U5TC 2JPBA 1BIAA 2Z5UA 4CZZA 4Q4ZF 2XAFA 2D45A 2F5EA 1BM9A 3WE2A 2P5LC 5D8LB 4WWCA 3GLXA 3JTGA 4BHCA 1B59A 1W7PD 1BI2A 2QM3A 4Y15A 1HKSA 3L7WA 3KFWX 3NEUA 3P9CA 1QGPA 1RIOH 4Z2YA 1YFHA 1AWCA 1YLFA 1ZYRF 2UXXA 3K1PA 3CUQA 4M9ZA 5L3DA 5D8KB 2CG4A 3WGHA 3WTWC 5AIPA 3BY6A 3K0LA 2VN2A 3U9GA 1IXSB 2FE3A 2ESNA 2NS0A 2DK8A 3EYIA 4L18B 3QU3A 1YS7A 5LEKA 4P9FA 3TGNA 2DPUA 2KIMA 5ILUA 1U6GA 1EH6A 3EYYA 4P9UA 3HSRA 3V8KA 1L0OC 4HAMA 5CLSA 2M1BA 4NHJA 2V1XA 2COMA 4FX0A 4S05A 1O57A 2K27A 4F7ZA 3I53A 3TO7A 4ZYEA 1EV7A 1W5SA 2X4HA 5BPDA 3F22A 2CGPA 4ZYHA 1XGNA 3TQNA 4HQMA 4KN7X 2VOOA 3LQQA 5DD8A 3R60A 5DCFA 2MLGA 2FSWA 3EDPA 3CJNA 3ZPLA 3ZMSA 1O3QA 5L3EA 5FB2A 5JI6A 5DYMA 4ETSA 1T38A 4I0AA 2PI0A 5D5WB 3QPTA 1U2WA 5FD6A 1YG2A 1G4DA 4ENNA 3I0TA 1SFXA 2E1NA 4ASNA 2L54A 3ZN1A 1JGSA 5D4SA 1J5YA 2F5FA 4G8XA 4KN4X 1XGOA 4LMYA 1FYKA 2OA4A 4OMYA 4LG0A 1MDMA 4HBLA 3SHFA 4A5NA 3IWZA 2JZYA 2ELHA 1E17A 5F1RA 1R7JA 3E5XA 2EV6A 5LGNA 2DU9A 4UV8A 1QO0D 5K5OA 2DAOA 2GXBA 1BBYA 5LBQA 4RGXA 3BPXA 3MWMA 3DV8A 1IRFA 2F5CA 5EEGA 3ZMVA 4KYWA 3N4MA 5HDNA 3RKWA 2EFWA 3ISPA 2GWRA 3DXJF 3PFIA 1YIOA 4MHGA 1A04A 1LEBA 3HSEA 3GZ5A 2FNAA 3L2CA 2PFBA 2XGXA 3BJ6A 1ZG3A 5ICCA 4YG2F 1FSHA 2WC2A 4ZYGA 2ISZA 4MNUA 1J59A 1MJAA 2YR2A 4D0PA 2LNBA 5HLGA 2W57A 4A0ZA 4KIBA 1V3FA 1OYYA 1HW2A 1ZRFA 3F6VA 5D6FA 2Q8KA 2IPQX 4I09A 3GYHX 1D8JA 3L09A 1FLIA 3O3KA 1O7FA 5D5XB 2H27A 2Z99A 3BROA 4CYDA 5KK1A 5CVUA 2R7FA 4EJVA 5DDGA 4U7DA 3LWFA 2EFOA 2JPCA 1K7AA 3QAHA 2W25A 2GA2A 5ICGA 2EA2A 2G7HA 3DPTA 2A6EF 3FM5A 4A12A 3BP8A 4KT5C 4A5MA 1T0FA 2V79A 5E8IA 1O3TA 5CVIA 5E1ZB 2V1UA 1I1SA 4LK0F 1BN5A 5H20A 3WTSC 1DDNA 3WTXC 1T39A 3ML6A 5ED4A 1PUEE 4FHTA 4G7HF 1W7PA 3SQNA 1MJ9A 4DQ2A 3JAMK 1ON2A 3I4PA 3HIFA 1R00A 3GO5A 4M6YA 3GFJA 1CF7B 1XB4A 2OQRA 1KQ9A 2J5PA 2XUBA 4BAYA 3NQOA 4I01A 3WG9A 3Q9VA 4XLPF 2PQ8A 2ZBKA 3IWFA 4UVCA 5E1XA 3WTUC 2AS5F 4IHSA 1K78B 5E1WA 1LDJA 1KU7A 3MQ0A 4PGGA 2HS5A 1R36A 2A68F 4HW0A 4IF4A 1FYLA 5HS7A 1HW5A 5D6EA 3F8FA 3HRUA 4AIKA 1AOYA 3TOBA 2G7UA 4EM1A 2EA4A 2CW0F 2XHKA 2KIUA 1B4AA 1SD7A 1KYZA 3DF8A 2KIFA 2A69F 4M74A 2V9VA 2ESHA 2YU3A 1P92A 1GXQA 5FLXZ 4KUMA 1D5VA 4UVAA 2EFNA 4RB3C 4HZFA 1FX7A 1LQ1A 1KU2A 2XASA 2HFHA 3I59B 2ZMEB 2OD5A 1BIBA 3MEXA 3ROUA 3ERED 2VE8A 5LRSA 2STTA 1FBSA 2K4JA 1ON1A 1SD6A 2IP2A 2VBZA 1MGTA 2TDXA 1XMAA 4I02A 4U88A 5L3FA 3SZPA 4MQVA 1LDDA 2Y75A 1QZYA 4I0BA 1WQ2A 1TW2A 5E17F 2BGCA 3EUHA 4EGYA 1LDKB 3WGIA 3BOQA 4M73A 1ODDA 3VEPA 2FXAA 2JSCA 4ZYDA 3G73A 2L01A 3IKTA 2DFIA 3LAJA 2P6SA 3L9FA 4KDPA 1K6OA 4ESBA 3E6DA 2DW4A 1WKMA 2BBYA 2CSOA 5FGMA 4L0ZB 1Z91A 3I71A 2RGVA 4EV0A 4MTDA 5LHIA 4H0EA 3RYRA 3VODA 3V7SA 1E2XA 2QBYA 2FMLA 1TQMA 3M8EA 5CVJA 5TRDA 1Z9CA 3KZZA 4KMFA 1IZ1A 3P9IA 5K5QA 1ULYA 4I98B 1HBXG 1S29A 3ZMUA 1Z05A 2D1HA 3FMQA 2PMUA 2DBBA 1TBXA 3I58A 3FXQA 2V1DA 2ZKZA 3B73A 3LA3A 4OOIA 3GEZA 2GAUA 3B02A 5FO5A 3IRQA 2K02A 2RV8A 4BH9A 2P7VB 3HRMA 4QLCU 1SD4A 2KKOA 2C6YA 2K4BA 3L00A 4EGZA 4B09A 1S8NA 1QQIA 3D0SA 1R22A 2VODA 3QP6A 1H9TA 3W6KB 5LHHA 3IL2A 2DI3A 4R8HA 1U5TA 2UWMA 4O6JA 2A3SA 2EFPA 1LVAA 4ZZDA 4FX4A 1BI1A 3JSPA 5IT9K 2HEOA 2W85A 4QWQA 3RDIA 5EEHA 3RIRA 1R58A 3QU6A 4ENMA 2O61A 5D5VB 2XAGA 1ZH5A 2RDPA 2V6CA 1G3YA 3JAMZ 4HYEA 1TW3A 3WU0A 1P6RA 4ENJA 2QUFA 3WTTC 3FXRA 1KQ8A 2KRFA 1P4WA 3KP3A 2IRFG 1ZAOA 3E5UA 1QPMA 1XD7A 1YS6A 2O6GE 3DFGA 2IT0A 5ERIA 1P4AA 3HRTA 2WV0A 1I5ZA 1IXCA 1H9GA 4A0XA 3K2ZA 5L3CA 1K78A 1GXPA 4PDKA 3CO6C 3V7CA 4GYIA 3C18A 3MZHA 2HTSA 2HDCA 4BQAA 1XGSA 2IA1A 3O6BB 1LB2A 4Y17A 3C1DA 2FMYA 2G9WA 4O5VA 4BNCA 2L4MA 5DD4A 2BYVE 5A2QK 2XKOA 3T8RA 5FLXK 4L0YB 1B1BA 2Z33A 2DT5A 3RTRA 5DUKA 3GX4X 2EFQA 3F72A 1J7KA 2Q0OA 4YFNF 2HQRA 1TTYA 3GZ6A 3FHZA 4ESFA 1OMIA 3FZVA 1TLHB 4XSXF 1YO5C 5CVVA 3IHUA 1WRJA 1YW8A 1UCRA 5HS9A 1HSTA 5JVTA 2MH9A 4EJWA 3E6MA 3V8LA 2PG4A 2O8XA 1SMYF 2IJLA 4U0VA 1WSUA 1HQCA 1W4MA 2VXZA 3HUGA 5TJJA 2XIGA 4TV7A 4G7OF 3J80K 1XN7A 4LLNA 1XCVA 2VBWA 3T8TA 3RPUA 4UV9A 3HSFA 2XKPA 4CO8A 4L5IA 1W5TA 1ZG5A 1TQIA 4OIQF 4IRIA 4P5OA 4HV5A 2FBKA 4RGUA 4A2UA 2RKHA 4A6DA 2DTRA 3KLNA 2FOKA 1XSXA 3J81K 4XLNF 2FA5A 1R1TA 1IN6A 2IVMA 3ABTA 2A5YB 2E1CA 2A61A 1F9NA 2J5OA 3ZMTA 1Z1DA 1T98A 2PJPA 3T0YA 2JRTA 1OR7A 4FT8A 1FT9A 4S04A 1FSEA 2FRHA 3F3XA 2O03A 3C3WA 2Z3YA 5AIQA 4K2EA 2DLLA 2HOEA 4RGRA 2ISYA 1BC8C 1S7AA 1BOAA 1I27A 1SMTA 4EQQA 4IXAA 1HSJA 3PQJA 2E7WA 2JT1A 1UFMA 3CUOA 1D8KA 1PP7U 1S6LA 3ZQ7A 4KICA 4WXDA 3QOPA 4HOBA 4CDGA 5LEJA 1EH8A 1QNTA 2P7CB 1ZRDA 1J9IA 2IA0A 2XVCA 2VC0A 3LFKA 5LRRA 4IHTA 2HQNA 4M71A 1HW1A 2DK5A 3ECHA 1YQAA 2VC1A 1KGSA 3RPQA 4ZZLA 4WXHA 1TNTA 3K1MA 5HDKA 5IT9Z 4KIGA 5H6RA 5ICEA 4IVNA 4I7HA 3LAPA 3SZTA 3KP4A 3R61A 4CGZA 5E18F 1FY7A 4HF1A 3WGGA 1FBUA 3JSOA 1F5TA 2R7DA 3GXOA 2GXGA 3MZYA 1B9NA 4OINF 1USTA 3K69A 2KJBA 2A6HF 2OU2A 4RAZA 2VBYA 2PBIA 2FBIA 2NRAC 1TQPA 3TO6A 4O3MA 2RQPA 4BHPA 3KP6A 2STWA 2XAQA 3ULQB 1G3WA 2O3FA 1IUYA 3CDHA 5BPIA 3TKYA 5L3BA 2E7XA 4KNYA 2AXLA 2ZJ2A 3DEUA 2RC4A 1IF1A 4OIPF 3H3UA 3TOAA 2QQ9A 5A2QZ 1USSA 4RB1A 2MC3A 5CVRA 4CICA 4N9HA 1HKQA 5BS6A 4HDUA 3NRVA 2VOPA 4LLGF 4EMSA 5KVRA 4A0YA 3GWZA 3MCZA 2BE5F 1QZZA 3F8NA 2YX4A 4UNOA 2NAZA 3MAJA 1BC7C 4HF0A 3E5QA 4LG0B 2FF4A 1MDMB 4GCVA 4L9TA 3FX3A 1DP7P 3WODF 1S3JA 1STZA 2WTEA 2ACJA 2QQBA 5D5UB 1CGPA 5ICFA 1FBQA 4I2OA 2QVOA 4U0WA 1IN5A 3FM3A 3SXYA 1RNLA 2NNYA 4RS8A 4WX9A 4MEXF 5J8CA 1XSDA 1F1ZA 4U0YA 1XCBA 2ZXJA 1XMKA 2W84A 3HOSA 2W24A 4LD5A 2M87A 5IT3A 4YFXF 4CXFA 3J80Z 4A6EA 3KP2A 4LJZF 5AONA 1FP2A 1F4KA 5J8FA 1R5HA 1DPRA 2JTVA 1P2FA 2VT3A 1I1GA 1REPC 1IRGA 4EVIA 1U3EM 3ZP5A 4PCQA 4LFUA 4LB6B 3J81Z 4HF2A 2HGCA 1Y0UA 2NNNA 2Y0MA 2QYOA 5FD5A 4DNCA 3M7GA 4CHUA 4PGHA 3I5UA 4AIJA 3HOTA 3WTVC 3OOPA 3KP7A 4G7ZF 1J2XA 1SAXA 4E70A 1G3SA 1NHAA 3KP5A 3GFLA 3TDUC 4M9XA 5HLHA 1ZGAA 3WE3A 5BMZA 2VONA 3P7NA 2GIVA 1YW9A 3PQKA 2QZ8A 1IN8A 2F5DA 3ABUA 3AAFA 4OIOF 2HYFA 3DKWA 2HWVA 3RI4A 5LGTA 4AVPA 1FC3A 3BDDA 5H6QA 1KU9A 4GYGA 2MD5A 3M8FA 3DQVC 2OBPA 1L3LA 1RUNA 3ELKA 3COAC 4KFCA 1B6AA 1Z6RA 4L9NA 5D4RA 5HOOA 3F21A 3HYIA 3KE2A 2P6TA 2DO7A 2ADUA 2HKXA 3E6BA 1WWXA 1YYVA 3KEOA 3BWGA 3CUQC 2YPRA 2XAJA 3LA7A 1W7PB 1FWZA 4ENKA 2PMHA 1Z6TA 3F8CA 4WK8F 3G3ZA 3RKYA 1DPUA 4HQEA 1I6XA 2PLYA 2ZO4A 4NQWA 2ZCWA 1CF7A 1H0MA 4GXOA 3HHGA 3K9TA 1MJBA 3BJOA 4HX8A 3FMRA 3GFIA 5DUIA 2L02A 1BI0A 2P8TA 4UXNA 3GVAA 2H6BA 1YW7A 3KEQA 4IRHA 4MEYF 1SD5A 2XV4S 3V8JA 2K86A 3CLOA 2R3SA 3I54A 2P4WA 2L4AA 3LSTA 5HVQC 1FPQA 1R5GA 1ZLKA 2F2EA 4ESJA 1RZ4A 3EETA 4MTEA 2CQKA 4PZJA 2RNJA 3V4GA 2CYYA 5L3GA 3WU1B 1IAWA 3CTAA 4Q48A 2FQ3A 5FFXA 5DCMB 1QBJA 2DQLA 1GHCA 3QRFF 1KA8A 4G94A 2VBXA 3FMSA 4HX4A 3LQRA 4IPAA 4RAYA 2QLZA 1RUOA 2HYGD 3N97A 3MFKA 3R6SA 2DPDA 5BQTA 1JE8A 3I59A 2ZMEA 4N0BA 3ZMDA 1JXSA 2M8EA 3OV8A 3HTSB 2EB7A 4ZH4F 1LNWA 5LHGA 3BJAA 3C7JA 3IRRA 3IC7A 3RKXA 3E97A 3FXUA 1FP1D 4IRGA 3GUDA 2HKOA 2DQRA 1XSVA 1DUXC 4L5JA 3F8BA 5ILSA 5K1YA 2KJCA 2QQAA 1OKRA 4UHTA 2ZNYA 1FNNA 5JFRA 5DV5A 1JHHA 2LF8A 1HKTA 2H09A 1FYMA 2EV5A 4BHBA 1Q1HA 1Z7UA 1KQ0A 2X0LA 2Y48A 1KU3A 1G6NA 4HX7A 2LSOA 4GGGA 2H6CA 2D1VA 4XBFA 1ONVA 2BV6A 4HLXA 2QBYB 2HZTA 3EQLF 3HTUA 1GVJA 4IJAA 3VOEA 2FNPA 4HV6A 1RI7A 3LA2A 1D3YA 1IW7F 4P96A 2D2WA 2A07F 1OPCA 5F64A 2VT2A 5LGUA 5LLQA 4Q5SF 3ZN0A 2FEZA 2XAHA 5FFZA 6PAXA 4KIFA 3HHHA 2HTJA 4EM2A 1TNSA 4MQ9F 3GF2A 1O3SA 2YSRA 2VE9A 1ZN2A 4GO1A 4UVBA 1IN4A 1LEAA 3U1DA 1K79A 4JQFA 1J0RA 4WF2A 4G9YA 2FBHA 4EJTA 4Y13A 3KCCA 1J75A 3E3VA 1BI3A 4AD9A 4AWXB 1T2KA 1U5TB 5J6XA 3T1BA 2ZNZA 2M30A 1ZLJA 3J7AO 1B9MA 1WI9A 3H92A 4ON0A 2ETHA 5DEQA 1YTYA 2CO5A 3BPVA 4L9JA 3CUQB 1ZGJA 1ZARA 2O0YA 2LDUA 1OYWA 5HS8A 4BYYA 1UB9A 3REOA 1P4XA 3R0JA 3GW2A 4YIFA 3E6CC 1JHFA 5F6FA 1IXRC 4L9VA 5JHUA 1S7OA 2QWWA 1FOKA 1XDSA 1R1VA 1UHWA 4UUVA 3F23A 4P55A 1O3RA 4U7BA 1PDNC 5ILVA 4OIRF 3WTYC 5CJ9A 4YFKF 2IW5A 1FZPB 3HRSA 1LJ9A 1X3UA 4RB2C 2WWYA 3GFMA 4R1HA 2GZWA 3KZYA 3FF5A 5E20A 3K1NA 2OZUA 4HLYA 2YX7A 1ZREA 2OQGA 3I64A 3CO7C 2MBFA 3Q9SA 3H3ZA 1V4RA 4WXCA 1ZRCA 3VFZA 2MA3A 1ZHFA 2ZFWA 1G3TA 2BEOA 4EM0B 3T5XA 4LK1F 4Q47A 1T6SA 3DPLC 4M6XA 5K5RA 1VTNC 2RN7A 2PEXA 3S2WA 5DCMA 3F6OA 2HR3A 2EK5A 4YIIA 2P5KA 2RVCA 3RYPA 2LF7A 2EWNA 4AIHA 4OU0A 1BJAA 3U2RA 1IN7A 4XRFA 3R0AA 3Q5FA 4N9IA 4MGRA 3SFZA 3P9KA 1EH7A 4JBAA 2UZKA 3IKVA 1MD0A 4XSZF 1PP8F 4RB0A 3ECOA 5HDGA 2L3DA 2MH2A 5BOXA 2CFXA 3M9AA 2NYXA 1SFUA 3R4KA 4G6QA 4OMZA 1XGMA 2EJRA 1MKMA 5HLIA 4NB5A 3KETA 3V7RA 2GA1A 1MZBA 2PN6A 2CWEA 5E8GA 2UXNA 1KYWA 2B0LA 3RJPA 2OZ6A 2FU4A 4M72A 1ZG1A 3TO9A 4WCGA 3KLOA 5CYVA 2Z9OA 4G6DA 1UHMA 4EJUA 1R23A 5JR3A 2H94A 3TDZC 4EJOA 2Q2EA 4BXUA 2LKPA 2GQQA 1U8RA 4JK1X 3O2PE 4HDVA 3VB2A 1XDUA 4KA4A 2XROA 1OYIA 1R1UA 2MLKA 1O7LA 2P5VA 4RGSA 4LLLA 3QPHA 3D5LA 3WTZA 4R79A 2K7LA 3BZ6A 3DP7A 2QENA 3JW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M45 A;  1U78 A;  2OAZ A;  4KMU X;  4LB5 A;  4LGW A;  1HXD A;  4HA8 A;  3QP5 A;  3FWE A;  3W6J B;  4M9S A;  3F8M A;  4B8X A;  1SFE A;  2IA2 A;  2XRN A;  2EV0 A;  1C0W A;  3M1E A;  3ZMZ A;  3JTH A;  2M5W A;  1U5T C;  2JPB A;  1BIA A;  2Z5U A;  4CZZ A;  4Q4Z F;  2XAF A;  2D45 A;  2F5E A;  1BM9 A;  3WE2 A;  2P5L C;  5D8L B;  4WWC A;  3GLX A;  3JTG A;  4BHC A;  1B59 A;  1W7P D;  1BI2 A;  2QM3 A;  4Y15 A;  1HKS A;  3L7W A;  3KFW X;  3NEU A;  3P9C A;  1QGP A;  1RIO H;  4Z2Y A;  1YFH A;  1AWC A;  1YLF A;  1ZYR F;  2UXX A;  3K1P A;  3CUQ A;  4M9Z A;  5L3D A;  5D8K B;  2CG4 A;  3WGH A;  3WTW C;  5AIP A;  3BY6 A;  3K0L A;  2VN2 A;  3U9G A;  1IXS B;  2FE3 A;  2ESN A;  2NS0 A;  2DK8 A;  3EYI A;  4L18 B;  3QU3 A;  1YS7 A;  5LEK A;  4P9F A;  3TGN A;  2DPU A;  2KIM A;  5ILU A;  1U6G A;  1EH6 A;  3EYY A;  4P9U A;  3HSR A;  3V8K A;  1L0O C;  4HAM A;  5CLS A;  2M1B A;  4NHJ A;  2V1X A;  2COM A;  4FX0 A;  4S05 A;  1O57 A;  2K27 A;  4F7Z A;  3I53 A;  3TO7 A;  4ZYE A;  1EV7 A;  1W5S A;  2X4H A;  5BPD A;  3F22 A;  2CGP A;  4ZYH A;  1XGN A;  3TQN A;  4HQM A;  4KN7 X;  2VOO A;  3LQQ A;  5DD8 A;  3R60 A;  5DCF A;  2MLG A;  2FSW A;  3EDP A;  3CJN A;  3ZPL A;  3ZMS A;  1O3Q A;  5L3E A;  5FB2 A;  5JI6 A;  5DYM A;  4ETS A;  1T38 A;  4I0A A;  2PI0 A;  5D5W B;  3QPT A;  1U2W A;  5FD6 A;  1YG2 A;  1G4D A;  4ENN A;  3I0T A;  1SFX A;  2E1N A;  4ASN A;  2L54 A;  3ZN1 A;  1JGS A;  5D4S A;  1J5Y A;  2F5F A;  4G8X A;  4KN4 X;  1XGO A;  4LMY A;  1FYK A;  2OA4 A;  4OMY A;  4LG0 A;  1MDM A;  4HBL A;  3SHF A;  4A5N A;  3IWZ A;  2JZY A;  2ELH A;  1E17 A;  5F1R A;  1R7J A;  3E5X A;  2EV6 A;  5LGN A;  2DU9 A;  4UV8 A;  1QO0 D;  5K5O A;  2DAO A;  2GXB A;  1BBY A;  5LBQ A;  4RGX A;  3BPX A;  3MWM A;  3DV8 A;  1IRF A;  2F5C A;  5EEG A;  3ZMV A;  4KYW A;  3N4M A;  5HDN A;  3RKW A;  2EFW A;  3ISP A;  2GWR A;  3DXJ F;  3PFI A;  1YIO A;  4MHG A;  1A04 A;  1LEB A;  3HSE A;  3GZ5 A;  2FNA A;  3L2C A;  2PFB A;  2XGX A;  3BJ6 A;  1ZG3 A;  5ICC A;  4YG2 F;  1FSH A;  2WC2 A;  4ZYG A;  2ISZ A;  4MNU A;  1J59 A;  1MJA A;  2YR2 A;  4D0P A;  2LNB A;  5HLG A;  2W57 A;  4A0Z A;  4KIB A;  1V3F A;  1OYY A;  1HW2 A;  1ZRF A;  3F6V A;  5D6F A;  2Q8K A;  2IPQ X;  4I09 A;  3GYH X;  1D8J A;  3L09 A;  1FLI A;  3O3K A;  1O7F A;  5D5X B;  2H27 A;  2Z99 A;  3BRO A;  4CYD A;  5KK1 A;  5CVU A;  2R7F A;  4EJV A;  5DDG A;  4U7D A;  3LWF A;  2EFO A;  2JPC A;  1K7A A;  3QAH A;  2W25 A;  2GA2 A;  5ICG A;  2EA2 A;  2G7H A;  3DPT A;  2A6E F;  3FM5 A;  4A12 A;  3BP8 A;  4KT5 C;  4A5M A;  1T0F A;  2V79 A;  5E8I A;  1O3T A;  5CVI A;  5E1Z B;  2V1U A;  1I1S A;  4LK0 F;  1BN5 A;  5H20 A;  3WTS C;  1DDN A;  3WTX C;  1T39 A;  3ML6 A;  5ED4 A;  1PUE E;  4FHT A;  4G7H F;  1W7P A;  3SQN A;  1MJ9 A;  4DQ2 A;  3JAM K;  1ON2 A;  3I4P A;  3HIF A;  1R00 A;  3GO5 A;  4M6Y A;  3GFJ A;  1CF7 B;  1XB4 A;  2OQR A;  1KQ9 A;  2J5P A;  2XUB A;  4BAY A;  3NQO A;  4I01 A;  3WG9 A;  3Q9V A;  4XLP F;  2PQ8 A;  2ZBK A;  3IWF A;  4UVC A;  5E1X A;  3WTU C;  2AS5 F;  4IHS A;  1K78 B;  5E1W A;  1LDJ A;  1KU7 A;  3MQ0 A;  4PGG A;  2HS5 A;  1R36 A;  2A68 F;  4HW0 A;  4IF4 A;  1FYL A;  5HS7 A;  1HW5 A;  5D6E A;  3F8F A;  3HRU A;  4AIK A;  1AOY A;  3TOB A;  2G7U A;  4EM1 A;  2EA4 A;  2CW0 F;  2XHK A;  2KIU A;  1B4A A;  1SD7 A;  1KYZ A;  3DF8 A;  2KIF A;  2A69 F;  4M74 A;  2V9V A;  2ESH A;  2YU3 A;  1P92 A;  1GXQ A;  5FLX Z;  4KUM A;  1D5V A;  4UVA A;  2EFN A;  4RB3 C;  4HZF A;  1FX7 A;  1LQ1 A;  1KU2 A;  2XAS A;  2HFH A;  3I59 B;  2ZME B;  2OD5 A;  1BIB A;  3MEX A;  3ROU A;  3ERE D;  2VE8 A;  5LRS A;  2STT A;  1FBS A;  2K4J A;  1ON1 A;  1SD6 A;  2IP2 A;  2VBZ A;  1MGT A;  2TDX A;  1XMA A;  4I02 A;  4U88 A;  5L3F A;  3SZP A;  4MQV A;  1LDD A;  2Y75 A;  1QZY A;  4I0B A;  1WQ2 A;  1TW2 A;  5E17 F;  2BGC A;  3EUH A;  4EGY A;  1LDK B;  3WGI A;  3BOQ A;  4M73 A;  1ODD A;  3VEP A;  2FXA A;  2JSC A;  4ZYD A;  3G73 A;  2L01 A;  3IKT A;  2DFI A;  3LAJ A;  2P6S A;  3L9F A;  4KDP A;  1K6O A;  4ESB A;  3E6D A;  2DW4 A;  1WKM A;  2BBY A;  2CSO A;  5FGM A;  4L0Z B;  1Z91 A;  3I71 A;  2RGV A;  4EV0 A;  4MTD A;  5LHI A;  4H0E A;  3RYR A;  3VOD A;  3V7S A;  1E2X A;  2QBY A;  2FML A;  1TQM A;  3M8E A;  5CVJ A;  5TRD A;  1Z9C A;  3KZZ A;  4KMF A;  1IZ1 A;  3P9I A;  5K5Q A;  1ULY A;  4I98 B;  1HBX G;  1S29 A;  3ZMU A;  1Z05 A;  2D1H A;  3FMQ A;  2PMU A;  2DBB A;  1TBX A;  3I58 A;  3FXQ A;  2V1D A;  2ZKZ A;  3B73 A;  3LA3 A;  4OOI A;  3GEZ A;  2GAU A;  3B02 A;  5FO5 A;  3IRQ A;  2K02 A;  2RV8 A;  4BH9 A;  2P7V B;  3HRM A;  4QLC U;  1SD4 A;  2KKO A;  2C6Y A;  2K4B A;  3L00 A;  4EGZ A;  4B09 A;  1S8N A;  1QQI A;  3D0S A;  1R22 A;  2VOD A;  3QP6 A;  1H9T A;  3W6K B;  5LHH A;  3IL2 A;  2DI3 A;  4R8H A;  1U5T A;  2UWM A;  4O6J A;  2A3S A;  2EFP A;  1LVA A;  4ZZD A;  4FX4 A;  1BI1 A;  3JSP A;  5IT9 K;  2HEO A;  2W85 A;  4QWQ A;  3RDI A;  5EEH A;  3RIR A;  1R58 A;  3QU6 A;  4ENM A;  2O61 A;  5D5V B;  2XAG A;  1ZH5 A;  2RDP A;  2V6C A;  1G3Y A;  3JAM Z;  4HYE A;  1TW3 A;  3WU0 A;  1P6R A;  4ENJ A;  2QUF A;  3WTT C;  3FXR A;  1KQ8 A;  2KRF A;  1P4W A;  3KP3 A;  2IRF G;  1ZAO A;  3E5U A;  1QPM A;  1XD7 A;  1YS6 A;  2O6G E;  3DFG A;  2IT0 A;  5ERI A;  1P4A A;  3HRT A;  2WV0 A;  1I5Z A;  1IXC A;  1H9G A;  4A0X A;  3K2Z A;  5L3C A;  1K78 A;  1GXP A;  4PDK A;  3CO6 C;  3V7C A;  4GYI A;  3C18 A;  3MZH A;  2HTS A;  2HDC A;  4BQA A;  1XGS A;  2IA1 A;  3O6B B;  1LB2 A;  4Y17 A;  3C1D A;  2FMY A;  2G9W A;  4O5V A;  4BNC A;  2L4M A;  5DD4 A;  2BYV E;  5A2Q K;  2XKO A;  3T8R A;  5FLX K;  4L0Y B;  1B1B A;  2Z33 A;  2DT5 A;  3RTR A;  5DUK A;  3GX4 X;  2EFQ A;  3F72 A;  1J7K A;  2Q0O A;  4YFN F;  2HQR A;  1TTY A;  3GZ6 A;  3FHZ A;  4ESF A;  1OMI A;  3FZV A;  1TLH B;  4XSX F;  1YO5 C;  5CVV A;  3IHU A;  1WRJ A;  1YW8 A;  1UCR A;  5HS9 A;  1HST A;  5JVT A;  2MH9 A;  4EJW A;  3E6M A;  3V8L A;  2PG4 A;  2O8X A;  1SMY F;  2IJL A;  4U0V A;  1WSU A;  1HQC A;  1W4M A;  2VXZ A;  3HUG A;  5TJJ A;  2XIG A;  4TV7 A;  4G7O F;  3J80 K;  1XN7 A;  4LLN A;  1XCV A;  2VBW A;  3T8T A;  3RPU A;  4UV9 A;  3HSF A;  2XKP A;  4CO8 A;  4L5I A;  1W5T A;  1ZG5 A;  1TQI A;  4OIQ F;  4IRI A;  4P5O A;  4HV5 A;  2FBK A;  4RGU A;  4A2U A;  2RKH A;  4A6D A;  2DTR A;  3KLN A;  2FOK A;  1XSX A;  3J81 K;  4XLN F;  2FA5 A;  1R1T A;  1IN6 A;  2IVM A;  3ABT A;  2A5Y B;  2E1C A;  2A61 A;  1F9N A;  2J5O A;  3ZMT A;  1Z1D A;  1T98 A;  2PJP A;  3T0Y A;  2JRT A;  1OR7 A;  4FT8 A;  1FT9 A;  4S04 A;  1FSE A;  2FRH A;  3F3X A;  2O03 A;  3C3W A;  2Z3Y A;  5AIQ A;  4K2E A;  2DLL A;  2HOE A;  4RGR A;  2ISY A;  1BC8 C;  1S7A A;  1BOA A;  1I27 A;  1SMT A;  4EQQ A;  4IXA A;  1HSJ A;  3PQJ A;  2E7W A;  2JT1 A;  1UFM A;  3CUO A;  1D8K A;  1PP7 U;  1S6L A;  3ZQ7 A;  4KIC A;  4WXD A;  3QOP A;  4HOB A;  4CDG A;  5LEJ A;  1EH8 A;  1QNT A;  2P7C B;  1ZRD A;  1J9I A;  2IA0 A;  2XVC A;  2VC0 A;  3LFK A;  5LRR A;  4IHT A;  2HQN A;  4M71 A;  1HW1 A;  2DK5 A;  3ECH A;  1YQA A;  2VC1 A;  1KGS A;  3RPQ A;  4ZZL A;  4WXH A;  1TNT A;  3K1M A;  5HDK A;  5IT9 Z;  4KIG A;  5H6R A;  5ICE A;  4IVN A;  4I7H A;  3LAP A;  3SZT A;  3KP4 A;  3R61 A;  4CGZ A;  5E18 F;  1FY7 A;  4HF1 A;  3WGG A;  1FBU A;  3JSO A;  1F5T A;  2R7D A;  3GXO A;  2GXG A;  3MZY A;  1B9N A;  4OIN F;  1UST A;  3K69 A;  2KJB A;  2A6H F;  2OU2 A;  4RAZ A;  2VBY A;  2PBI A;  2FBI A;  2NRA C;  1TQP A;  3TO6 A;  4O3M A;  2RQP A;  4BHP A;  3KP6 A;  2STW A;  2XAQ A;  3ULQ B;  1G3W A;  2O3F A;  1IUY A;  3CDH A;  5BPI A;  3TKY A;  5L3B A;  2E7X A;  4KNY A;  2AXL A;  2ZJ2 A;  3DEU A;  2RC4 A;  1IF1 A;  4OIP F;  3H3U A;  3TOA A;  2QQ9 A;  5A2Q Z;  1USS A;  4RB1 A;  2MC3 A;  5CVR A;  4CIC A;  4N9H A;  1HKQ A;  5BS6 A;  4HDU A;  3NRV A;  2VOP A;  4LLG F;  4EMS A;  5KVR A;  4A0Y A;  3GWZ A;  3MCZ A;  2BE5 F;  1QZZ A;  3F8N A;  2YX4 A;  4UNO A;  2NAZ A;  3MAJ A;  1BC7 C;  4HF0 A;  3E5Q A;  4LG0 B;  2FF4 A;  1MDM B;  4GCV A;  4L9T A;  3FX3 A;  1DP7 P;  3WOD F;  1S3J A;  1STZ A;  2WTE A;  2ACJ A;  2QQB A;  5D5U B;  1CGP A;  5ICF A;  1FBQ A;  4I2O A;  2QVO A;  4U0W A;  1IN5 A;  3FM3 A;  3SXY A;  1RNL A;  2NNY A;  4RS8 A;  4WX9 A;  4MEX F;  5J8C A;  1XSD A;  1F1Z A;  4U0Y A;  1XCB A;  2ZXJ A;  1XMK A;  2W84 A;  3HOS A;  2W24 A;  4LD5 A;  2M87 A;  5IT3 A;  4YFX F;  4CXF A;  3J80 Z;  4A6E A;  3KP2 A;  4LJZ F;  5AON A;  1FP2 A;  1F4K A;  5J8F A;  1R5H A;  1DPR A;  2JTV A;  1P2F A;  2VT3 A;  1I1G A;  1REP C;  1IRG A;  4EVI A;  1U3E M;  3ZP5 A;  4PCQ A;  4LFU A;  4LB6 B;  3J81 Z;  4HF2 A;  2HGC A;  1Y0U A;  2NNN A;  2Y0M A;  2QYO A;  5FD5 A;  4DNC A;  3M7G A;  4CHU A;  4PGH A;  3I5U A;  4AIJ A;  3HOT A;  3WTV C;  3OOP A;  3KP7 A;  4G7Z F;  1J2X A;  1SAX A;  4E70 A;  1G3S A;  1NHA A;  3KP5 A;  3GFL A;  3TDU C;  4M9X A;  5HLH A;  1ZGA A;  3WE3 A;  5BMZ A;  2VON A;  3P7N A;  2GIV A;  1YW9 A;  3PQK A;  2QZ8 A;  1IN8 A;  2F5D A;  3ABU A;  3AAF A;  4OIO F;  2HYF A;  3DKW A;  2HWV A;  3RI4 A;  5LGT A;  4AVP A;  1FC3 A;  3BDD A;  5H6Q A;  1KU9 A;  4GYG A;  2MD5 A;  3M8F A;  3DQV C;  2OBP A;  1L3L A;  1RUN A;  3ELK A;  3COA C;  4KFC A;  1B6A A;  1Z6R A;  4L9N A;  5D4R A;  5HOO A;  3F21 A;  3HYI A;  3KE2 A;  2P6T A;  2DO7 A;  2ADU A;  2HKX A;  3E6B A;  1WWX A;  1YYV A;  3KEO A;  3BWG A;  3CUQ C;  2YPR A;  2XAJ A;  3LA7 A;  1W7P B;  1FWZ A;  4ENK A;  2PMH A;  1Z6T A;  3F8C A;  4WK8 F;  3G3Z A;  3RKY A;  1DPU A;  4HQE A;  1I6X A;  2PLY A;  2ZO4 A;  4NQW A;  2ZCW A;  1CF7 A;  1H0M A;  4GXO A;  3HHG A;  3K9T A;  1MJB A;  3BJO A;  4HX8 A;  3FMR A;  3GFI A;  5DUI A;  2L02 A;  1BI0 A;  2P8T A;  4UXN A;  3GVA A;  2H6B A;  1YW7 A;  3KEQ A;  4IRH A;  4MEY F;  1SD5 A;  2XV4 S;  3V8J A;  2K86 A;  3CLO A;  2R3S A;  3I54 A;  2P4W A;  2L4A A;  3LST A;  5HVQ C;  1FPQ A;  1R5G A;  1ZLK A;  2F2E A;  4ESJ A;  1RZ4 A;  3EET A;  4MTE A;  2CQK A;  4PZJ A;  2RNJ A;  3V4G A;  2CYY A;  5L3G A;  3WU1 B;  1IAW A;  3CTA A;  4Q48 A;  2FQ3 A;  5FFX A;  5DCM B;  1QBJ A;  2DQL A;  1GHC A;  3QRF F;  1KA8 A;  4G94 A;  2VBX A;  3FMS A;  4HX4 A;  3LQR A;  4IPA A;  4RAY A;  2QLZ A;  1RUO A;  2HYG D;  3N97 A;  3MFK A;  3R6S A;  2DPD A;  5BQT A;  1JE8 A;  3I59 A;  2ZME A;  4N0B A;  3ZMD A;  1JXS A;  2M8E A;  3OV8 A;  3HTS B;  2EB7 A;  4ZH4 F;  1LNW A;  5LHG A;  3BJA A;  3C7J A;  3IRR A;  3IC7 A;  3RKX A;  3E97 A;  3FXU A;  1FP1 D;  4IRG A;  3GUD A;  2HKO A;  2DQR A;  1XSV A;  1DUX C;  4L5J A;  3F8B A;  5ILS A;  5K1Y A;  2KJC A;  2QQA A;  1OKR A;  4UHT A;  2ZNY A;  1FNN A;  5JFR A;  5DV5 A;  1JHH A;  2LF8 A;  1HKT A;  2H09 A;  1FYM A;  2EV5 A;  4BHB A;  1Q1H A;  1Z7U A;  1KQ0 A;  2X0L A;  2Y48 A;  1KU3 A;  1G6N A;  4HX7 A;  2LSO A;  4GGG A;  2H6C A;  2D1V A;  4XBF A;  1ONV A;  2BV6 A;  4HLX A;  2QBY B;  2HZT A;  3EQL F;  3HTU A;  1GVJ A;  4IJA A;  3VOE A;  2FNP A;  4HV6 A;  1RI7 A;  3LA2 A;  1D3Y A;  1IW7 F;  4P96 A;  2D2W A;  2A07 F;  1OPC A;  5F64 A;  2VT2 A;  5LGU A;  5LLQ A;  4Q5S F;  3ZN0 A;  2FEZ A;  2XAH A;  5FFZ A;  6PAX A;  4KIF A;  3HHH A;  2HTJ A;  4EM2 A;  1TNS A;  4MQ9 F;  3GF2 A;  1O3S A;  2YSR A;  2VE9 A;  1ZN2 A;  4GO1 A;  4UVB A;  1IN4 A;  1LEA A;  3U1D A;  1K79 A;  4JQF A;  1J0R A;  4WF2 A;  4G9Y A;  2FBH A;  4EJT A;  4Y13 A;  3KCC A;  1J75 A;  3E3V A;  1BI3 A;  4AD9 A;  4AWX B;  1T2K A;  1U5T B;  5J6X A;  3T1B A;  2ZNZ A;  2M30 A;  1ZLJ A;  3J7A O;  1B9M A;  1WI9 A;  3H92 A;  4ON0 A;  2ETH A;  5DEQ A;  1YTY A;  2CO5 A;  3BPV A;  4L9J A;  3CUQ B;  1ZGJ A;  1ZAR A;  2O0Y A;  2LDU A;  1OYW A;  5HS8 A;  4BYY A;  1UB9 A;  3REO A;  1P4X A;  3R0J A;  3GW2 A;  4YIF A;  3E6C C;  1JHF A;  5F6F A;  1IXR C;  4L9V A;  5JHU A;  1S7O A;  2QWW A;  1FOK A;  1XDS A;  1R1V A;  1UHW A;  4UUV A;  3F23 A;  4P55 A;  1O3R A;  4U7B A;  1PDN C;  5ILV A;  4OIR F;  3WTY C;  5CJ9 A;  4YFK F;  2IW5 A;  1FZP B;  3HRS A;  1LJ9 A;  1X3U A;  4RB2 C;  2WWY A;  3GFM A;  4R1H A;  2GZW A;  3KZY A;  3FF5 A;  5E20 A;  3K1N A;  2OZU A;  4HLY A;  2YX7 A;  1ZRE A;  2OQG A;  3I64 A;  3CO7 C;  2MBF A;  3Q9S A;  3H3Z A;  1V4R A;  4WXC A;  1ZRC A;  3VFZ A;  2MA3 A;  1ZHF A;  2ZFW A;  1G3T A;  2BEO A;  4EM0 B;  3T5X A;  4LK1 F;  4Q47 A;  1T6S A;  3DPL C;  4M6X A;  5K5R A;  1VTN C;  2RN7 A;  2PEX A;  3S2W A;  5DCM A;  3F6O A;  2HR3 A;  2EK5 A;  4YII A;  2P5K A;  2RVC A;  3RYP A;  2LF7 A;  2EWN A;  4AIH A;  4OU0 A;  1BJA A;  3U2R A;  1IN7 A;  4XRF A;  3R0A A;  3Q5F A;  4N9I A;  4MGR A;  3SFZ A;  3P9K A;  1EH7 A;  4JBA A;  2UZK A;  3IKV A;  1MD0 A;  4XSZ F;  1PP8 F;  4RB0 A;  3ECO A;  5HDG A;  2L3D A;  2MH2 A;  5BOX A;  2CFX A;  3M9A A;  2NYX A;  1SFU A;  3R4K A;  4G6Q A;  4OMZ A;  1XGM A;  2EJR A;  1MKM A;  5HLI A;  4NB5 A;  3KET A;  3V7R A;  2GA1 A;  1MZB A;  2PN6 A;  2CWE A;  5E8G A;  2UXN A;  1KYW A;  2B0L A;  3RJP A;  2OZ6 A;  2FU4 A;  4M72 A;  1ZG1 A;  3TO9 A;  4WCG A;  3KLO A;  5CYV A;  2Z9O A;  4G6D A;  1UHM A;  4EJU A;  1R23 A;  5JR3 A;  2H94 A;  3TDZ C;  4EJO A;  2Q2E A;  4BXU A;  2LKP A;  2GQQ A;  1U8R A;  4JK1 X;  3O2P E;  4HDV A;  3VB2 A;  1XDU A;  4KA4 A;  2XRO A;  1OYI A;  1R1U A;  2MLK A;  1O7L A;  2P5V A;  4RGS A;  4LLL A;  3QPH A;  3D5L A;  3WTZ A;  4R79 A;  2K7L A;  3BZ6 A;  3DP7 A;  2QEN A;  3JW4 A; 
#chains in the Genus database with same CATH topology
 2M45 A;  1U78 A;  5E3N A;  2OAZ A;  4KMU X;  3O8G A;  4LB5 A;  4LGW A;  1HXD A;  2ID3 A;  4HA8 A;  2VIX A;  3CCM I;  3S1R J;  3QP5 A;  5EYR A;  2LBF A;  1V5E A;  3FWE A;  3TBI A;  5IOZ A;  3W6J B;  4M9S A;  3PIO F;  3F8M A;  4B8X A;  1MBE A;  1SFE A;  4CH7 A;  4M3F A;  2IA2 A;  2H8W A;  3A2K A;  2M7B A;  2VB6 A;  3PL8 A;  4PFO A;  1T56 A;  4XLH A;  1LPQ A;  2XRN A;  2FOW A;  2EV0 A;  2QSG X;  1C0W A;  3M1E A;  3TW7 A;  3ZMZ A;  1IV6 A;  3JTH A;  3KYC B;  2M5W A;  1U5T C;  2JPB A;  2V4J C;  3IUO A;  1BIA A;  2Z5U A;  2GM4 A;  2XB0 X;  1WH5 A;  4CZZ A;  4Q4Z F;  2XAF A;  1K6Y A;  2UV1 A;  3DU6 A;  2D45 A;  5LD2 C;  2F5E A;  2ZC2 A;  1BM9 A;  5GAH J;  2E2I J;  3WE2 A;  2Y9Z A;  2P5L C;  3QYB A;  5D8L B;  4D7N A;  4WWC A;  3L2U A;  3NAU A;  3HPG A;  3GLX A;  4LOC A;  2LTP A;  2VPL A;  4CZC A;  3VYT B;  1EA3 A;  2F4M B;  3JTG A;  3Q0V A;  4BHC A;  4XLF A;  1B59 A;  4UUT A;  4GFB A;  1W7P D;  1BI2 A;  2QM3 A;  4Y15 A;  3U1K A;  4RA2 A;  3TMO A;  1HKS A;  5HNF A;  3L7W A;  1D0X A;  3OYC A;  2VLA A;  3KFW X;  3NEU A;  3GTO J;  2V26 A;  1D0Z A;  3P9C A;  1QGP A;  1ZKG A;  2DFE A;  2QSH X;  1RIO H;  4Z2Y A;  1YFH A;  1AWC A;  1YLF A;  3OYI A;  1ZYR F;  2UXX A;  3K1P A;  1UMQ A;  2LG4 A;  3CUQ A;  4M9Z A;  4Y4R A;  5L3D A;  5D8K B;  2ME6 A;  3AG3 H;  3CZ6 A;  2CG4 A;  2FX0 A;  2BXZ A;  3WGH A;  3WTW C;  5AIP A;  3BY6 A;  3K0L A;  2VN2 A;  3U9G A;  1IXS B;  1Y8R B;  2EQR A;  2FE3 A;  1SVM A;  5EZH A;  2ESN A;  2NS0 A;  2DK8 A;  3EYI A;  4L18 B;  3S2H J;  4XKC A;  3QU3 A;  1V54 H;  1YS7 A;  5LEK A;  1ERD A;  4P9F A;  5F27 A;  3TGN A;  2DPU A;  3CCE I;  3AKZ A;  3RKQ A;  1RR8 C;  1X19 A;  1WJB A;  2KIM A;  5ILU A;  4XN0 A;  3DLA A;  1U6G A;  2NVX J;  3QPL A;  1EH6 A;  3H3V K;  3EYY A;  3JRD A;  4P9U A;  5E79 C;  3HSR A;  3V8K A;  1L0O C;  4HAM A;  5CLS A;  2M1B A;  4NHJ A;  3CCY A;  2V1X A;  4XOP A;  2ZB9 A;  2COM A;  4FX0 A;  4S05 A;  2K3F A;  1O57 A;  2K27 A;  4F7Z A;  3I53 A;  3TO7 A;  4ZYE A;  1EV7 A;  1W5S A;  2E1M B;  1IV8 A;  2K85 A;  2X4H A;  5BPD A;  3F22 A;  4XLC A;  3L2V A;  2CGP A;  4ZYH A;  1XGN A;  4FAS D;  3TQN A;  4HQM A;  5DM6 F;  4KN7 X;  1YIT I;  3S14 J;  5J1Y A;  2R7W A;  3LQQ A;  2XSJ C;  2VOO A;  5DD8 A;  3R60 A;  2H1K A;  5DCF A;  4IQ4 A;  3BG3 A;  2MLG A;  2FSW A;  3BCB A;  3EDP A;  3CJN A;  3ZPL A;  3ZMS A;  1O3Q A;  4G12 A;  5L3E A;  5FB2 A;  5JI6 A;  1Z77 A;  5DYM A;  4ETS A;  1T38 A;  4I0A A;  2PI0 A;  3QPT A;  1U2W A;  2OJE D;  4NC6 A;  5FD6 A;  5D5W B;  1YG2 A;  1R49 A;  1G4D A;  4ENN A;  3I0T A;  3IH4 A;  1SFX A;  2ZME C;  1VQO I;  1I39 A;  2E1N A;  1QU3 A;  3VYS B;  2L54 A;  4NBQ A;  4ASN A;  4H4K C;  1JGS A;  2E36 A;  3ZN1 A;  5D4S A;  1NK2 P;  1A35 A;  1J5Y A;  2DA3 A;  2F5F A;  4G8X A;  4KN4 X;  1S72 I;  2KRH A;  2BW3 A;  2OTJ I;  1XGO A;  4LMY A;  4HEA 2;  4PJJ A;  1FYK A;  1Z3Y A;  3LL7 A;  2OA4 A;  4OMY A;  3DTI A;  4LG0 A;  1MDM A;  2JA2 A;  2WAQ A;  5F0H A;  4HBL A;  3SHF A;  2QCO A;  4A5N A;  3IWZ A;  2JZY A;  2ELH A;  5M5X J;  1E17 A;  1HDD C;  3FXL A;  5F1R A;  4OAZ A;  3VSK A;  4ZDP A;  1R7J A;  3E5X A;  4BJ6 C;  2IS1 A;  2EV6 A;  3AG4 H;  4ZC3 A;  5LGN A;  2DU9 A;  1A5J A;  4UV8 A;  5GPA A;  2JA8 J;  4W97 A;  1QO0 D;  1ITY A;  5K5O A;  2DAO A;  4LG3 A;  3OYB A;  2GXB A;  1BBY A;  3S1Q J;  5KNL A;  4IEJ A;  5LBQ A;  3GBG A;  1EF4 A;  2KZV A;  1UEL B;  2E71 A;  4RGX A;  3BPX A;  3MWM A;  3SZG A;  4DZP A;  2CRG A;  3DV8 A;  1IRF A;  2F5C A;  5EEG A;  5EZG A;  3ZMV A;  4KYW A;  2WAD A;  3ASN H;  2M7A A;  3N4M A;  4FET A;  3W2W A;  4B43 A;  5HDN A;  1JJ8 C;  3RKW A;  2EFW A;  4MFE A;  3ISP A;  2A5W A;  2GWR A;  3DXJ F;  1U9O A;  3PFI A;  4QSH A;  1YIO A;  4MHG A;  2DA1 A;  3KEY A;  1A04 A;  1LEB A;  3DBH B;  3HSE A;  3GZ5 A;  2FNA A;  3L2C A;  2PFB A;  2XGX A;  3BJ6 A;  3HB9 A;  1E3P A;  3OYJ A;  2R7Q A;  1ZG3 A;  2HI3 A;  3BR0 A;  4YG2 F;  5ICC A;  4BQQ A;  1FSH A;  2WC2 A;  4ZYG A;  1U9N A;  2RRE A;  2ISZ A;  4MNU A;  3PNV A;  1TC3 C;  1J59 A;  4A3M J;  1BW5 A;  2GOM A;  1MJA A;  5FKO A;  1I3Q J;  3GME A;  2WA0 A;  2PJR A;  1BJZ A;  1GVD A;  4YEL A;  5FKK A;  2YR2 A;  4Y3O A;  4D0P A;  1ZK8 A;  2R0Q C;  2R5Y A;  2LNB A;  5HLG A;  2W57 A;  4A0Z A;  4KIB A;  4MIM A;  1YJW I;  4RM2 A;  1OR7 C;  1V3F A;  1OYY A;  4KJZ A;  3VYU B;  3H9G A;  3PSI A;  2VKV A;  1HW2 A;  1ZRF A;  3F6V A;  2HPI A;  5D6F A;  3OYG A;  4JOM A;  2IPQ X;  2Q8K A;  4I09 A;  3D1N I;  1W36 C;  3CCJ I;  3GYH X;  1D8J A;  3L09 A;  2GOX B;  4ZYA A;  2AO9 A;  1FLI A;  1WCM J;  3O3K A;  2LP0 A;  2R7S A;  2QKM B;  3W2V A;  2NVQ J;  4BAC A;  1O7F A;  5D5X B;  3OS0 A;  2H27 A;  2Z99 A;  3BRO A;  4CYD A;  4NC8 A;  5KK1 A;  1X1B A;  1AU7 A;  2GXA A;  5CVU A;  3BZC A;  2R7F A;  4EJV A;  1VF9 A;  2YS9 A;  3LSI A;  1Z67 A;  3J7Z I;  1LVK A;  3HEF A;  2NOJ B;  5DDG A;  3PJR A;  5IY5 H;  3IAM 2;  4U7D A;  2DN0 A;  1WI3 A;  3LWF A;  3CCV I;  3FBI B;  3JRE A;  2EFO A;  3Q0W A;  2JPC A;  1K7A A;  3QAH A;  2W25 A;  4ZDL A;  2GA2 A;  3KZI C;  1A6Q A;  5ICG A;  2EA2 A;  2G7H A;  2HNH A;  4XKW A;  5JLW A;  4FE7 A;  2MSY A;  2O7O A;  3CF2 A;  1VQM I;  5C4J J;  3DPT A;  3BTJ A;  2A6E F;  1IJW C;  3FM5 A;  4A12 A;  3PNY A;  3BP8 A;  4KT5 C;  5C44 J;  1WZ2 A;  4A5M A;  5FLM J;  3OS2 A;  1T0F A;  2V79 A;  2HOA A;  3HG9 A;  4QPO A;  5E8I A;  1O3T A;  5CVI A;  3WHB A;  3KYD B;  5E1Z B;  4CA0 A;  2V1U A;  2KIQ A;  4BU2 A;  1I1S A;  1SAN A;  2XGD A;  3BR5 A;  1NTC A;  4LK0 F;  4PUS A;  3IV5 A;  1BN5 A;  3PO2 J;  4BQN A;  5H20 A;  3WTS C;  1DDN A;  2X1C A;  2MAB A;  5J1R A;  3WTX C;  3QOD A;  1T39 A;  5GPC A;  3ML6 A;  5ED4 A;  1PUE E;  4FHT A;  4G7H F;  1W7P A;  3SQN A;  3CCR I;  1WPK A;  1MJ9 A;  4DQ2 A;  3JAM K;  3QYE A;  1ON2 A;  3I4P A;  3JRF A;  3HIF A;  1R00 A;  1FIA A;  3GO5 A;  4M6Y A;  2GBY A;  2E5N A;  4NQW B;  3QWL A;  4IHY A;  3GFJ A;  1CF7 B;  1XB4 A;  2OQR A;  1KQ9 A;  2J5P A;  2XUB A;  1FOY A;  4BAY A;  3NQO A;  3I4N J;  4C2M J;  3K2A A;  4I01 A;  2V9K A;  3WG9 A;  3Q9V A;  4XLP F;  4V2F A;  2PQ8 A;  2ZBK A;  3IWF A;  4UVC A;  5E1X A;  3D5S C;  3WTU C;  2AS5 F;  5TIS C;  3X2Q H;  2EZI A;  3LSR A;  2QGU A;  4IHS A;  4IHV A;  1K78 B;  5E1W A;  3OOU A;  1LDJ A;  1R4N B;  1KU7 A;  2IGK A;  4AC0 A;  1XPX A;  3MQ0 A;  4PGG A;  2HS5 A;  4C2U A;  3DBR B;  1R36 A;  3H5N A;  4B44 A;  2A68 F;  4HW0 A;  3BG6 A;  4IF4 A;  1IUF A;  4ANJ A;  1FYL A;  1VQ6 I;  2EPF A;  5HS7 A;  3AFH A;  4CCL A;  5HLT A;  1HW5 A;  3BZK A;  4PSX A;  1A6I A;  5D6E A;  3F8F A;  2TRT A;  3HRU A;  4AIK A;  3BT9 A;  2O5R A;  3TOB A;  1AOY A;  3IH2 A;  4BDY A;  2G7U A;  1WH7 A;  3ONQ A;  4HNV A;  4J19 A;  3CMM A;  4B1R A;  5EGO B;  4EM1 A;  2G0E A;  1BW6 A;  1VND A;  2EA4 A;  3CCU I;  2VKH A;  2CW0 F;  3JCU C;  2XHK A;  1QHG A;  3AL0 C;  1ZEL A;  2KIU A;  2DDA A;  1B4A A;  2QQ8 A;  1SD7 A;  1KYZ A;  3DF8 A;  2K40 A;  1G8X A;  3BR6 A;  2KIF A;  5JVG F;  1R6R A;  2LMD A;  3M07 A;  3TP3 A;  2A69 F;  4M74 A;  2V9V A;  2ESH A;  2YU3 A;  1P92 A;  2WY8 Q;  1GXQ A;  5FLX Z;  4KUM A;  1D5V A;  4UVA A;  2JRM A;  2HPM A;  3K10 A;  4CCO A;  3K4K A;  3MN2 A;  2EFN A;  4RB3 C;  4HZF A;  4BEH B;  1FX7 A;  5JHF A;  1LQ1 A;  1U8B A;  2LKX A;  1KU2 A;  2DMT A;  2XAS A;  4XNF A;  1HLV A;  2XPU A;  2XPV A;  2HFH A;  2IBD A;  3I59 B;  4CYC A;  2NS7 A;  2ZME B;  1IRZ A;  2OD5 A;  3H9J A;  1BIB A;  1FJL A;  4PSW A;  3MEX A;  2DJN A;  3DEW A;  2CH0 A;  4KIT B;  2I8D A;  2F5V A;  1T95 A;  1LE8 B;  1QPI A;  3ROU A;  3ERE D;  2VE8 A;  5LRS A;  2STT A;  1JT6 A;  2ZXH A;  1FBS A;  4GRI A;  5CKT A;  2H8R A;  2K4J A;  3ZQC A;  1ON1 A;  1SD6 A;  2IP2 A;  2VBZ A;  1MGT A;  3OYH A;  3CCQ I;  2AQF A;  2F6C A;  2TDX A;  1XMA A;  4I02 A;  1IGN A;  3CCL I;  4U88 A;  5L3F A;  1RKW A;  3SZP A;  3CMY A;  2M8G X;  3HUG B;  1SVL A;  1I3A A;  2MD0 A;  3ZQG A;  5GTI C;  4MQV A;  4XM3 A;  2BY3 A;  1LDD A;  1X1P A;  2Y75 A;  1QZY A;  4I0B A;  2CUF A;  1WQ2 A;  1TW2 A;  5E17 F;  2RAE A;  2BGC A;  4X0G A;  3GTL J;  3EUH A;  4AU7 A;  2DA5 A;  3RPU D;  4EGY A;  1LDK B;  3WGI A;  3BOQ A;  1YE9 A;  4M73 A;  1ODD A;  3VEP A;  1MIJ A;  4RAG A;  2FXA A;  4A3F J;  2L2O A;  2JSC A;  2M3A A;  4ZYD A;  1UJ8 A;  1WJF A;  2WAQ N;  3G73 A;  2L01 A;  3NAR A;  4LIV A;  2RQQ A;  2WAF A;  3IKT A;  2DFI A;  3DWL E;  1HCR A;  3LAJ A;  2WAE A;  2NXN B;  2P6S A;  3L9F A;  2W7N A;  2Y30 A;  4KDP A;  1K6O A;  3G1O A;  4BXF A;  4ESB A;  3E6D A;  3GLL A;  2DW4 A;  5IPA A;  1MW7 A;  1WKM A;  2BBY A;  5IYD J;  2CSO A;  5FGM A;  4L0Z B;  1Z91 A;  3I71 A;  2RGV A;  4EV0 A;  4MTD A;  5LHI A;  4H0E A;  1GLN A;  3HBL A;  1N78 A;  2OF7 A;  3RYR A;  1Z7L A;  3VOD A;  2K9Q A;  3V7S A;  1E2X A;  3ZOB A;  2B63 J;  2QBY A;  2FML A;  1TQM A;  3G1M A;  3RZD J;  2P0W A;  1FOW A;  3M8E A;  2EIL H;  5CVJ A;  3GTG J;  5TRD A;  2LRD A;  1Z9C A;  3KZZ A;  3FXM A;  4FIS A;  4KMF A;  1IZ1 A;  4RAF A;  2FD5 A;  2E1O A;  4NDL A;  3P9I A;  2CUZ A;  5K5Q A;  1ULY A;  3C2G A;  4I98 B;  4F52 A;  1HBX G;  1S29 A;  3ZMU A;  1Z05 A;  2D1H A;  3BTI A;  3FMQ A;  2PMU A;  1ENH A;  1W36 D;  2DBB A;  1AKH B;  3W6V A;  2HU9 A;  1TBX A;  3I58 A;  2VQL A;  1Q1V A;  3FXQ A;  2OCE A;  2V1D A;  2ZKZ A;  3B73 A;  4RBO A;  3LA3 A;  4OOI A;  3GEZ A;  1VQ4 I;  2H1L A;  1TT5 B;  3MVP A;  2GAU A;  3B02 A;  4PJL A;  3L2Q A;  2K3P A;  1IG7 A;  5FO5 A;  3IRQ A;  2K02 A;  2JUG A;  2RV8 A;  3CDI A;  4BH9 A;  2JA7 J;  1KON A;  2MG4 A;  2LD5 A;  4IQJ A;  1FTZ A;  2P7V B;  4PK4 A;  3HRM A;  4QLC U;  4JYK A;  2HDW A;  1SD4 A;  2K9L A;  4A3L J;  2R7O A;  2KKO A;  2C6Y A;  2K4B A;  4DBQ A;  2PMZ N;  3L00 A;  1N75 A;  3OYA A;  4EGZ A;  4B09 A;  2HVS A;  1S8N A;  4XR6 A;  1QQI A;  2VJ4 A;  4EEF G;  2V9P A;  2XGC A;  3D0S A;  1MNE A;  3FKI J;  3K6G A;  1R22 A;  2IS2 A;  2VOD A;  3QP6 A;  1H9T A;  1OCT C;  1OCO H;  3O8H A;  3W6K B;  3GTP J;  5LHH A;  3IL2 A;  2DI3 A;  4R8H A;  1U5T A;  2DJI A;  2UWM A;  1K4T A;  4ZJZ A;  2VKE A;  2ZXI A;  4O6J A;  1XS9 A;  2A3S A;  3MKL A;  1LVA A;  2EFP A;  4ZZD A;  4FX4 A;  1BI1 A;  3JSP A;  5IT9 K;  4A93 J;  2HEO A;  2KPM A;  2VI6 A;  2W85 A;  5TGT A;  4QWQ A;  3RDI A;  5EEH A;  2QF7 A;  3HKZ N;  3RIR A;  1R58 A;  2E60 A;  2MYS A;  2OTL I;  3QU6 A;  4ENM A;  4EAT A;  2O61 A;  5D5V B;  2R5Z B;  2XAG A;  5HNH A;  1ZH5 A;  2RDP A;  2DXI A;  2V6C A;  1G3Y A;  3JAM Z;  1ZR2 A;  1XG1 A;  3S3M A;  1VQK I;  5CQE A;  4HYE A;  5EEA A;  1TW3 A;  1VQ5 I;  2VPR A;  3LOC A;  1P6R A;  3WU0 A;  5F0F A;  4ENJ A;  2DFH A;  2Y31 A;  1ETV A;  4X1E A;  2QUF A;  3QQA A;  1S7E A;  2ID6 A;  3WTT C;  3DTE A;  5FRN A;  3FXR A;  2CMP A;  1KQ8 A;  3OR1 C;  2KRF A;  1P4W A;  1VI0 A;  2KLO A;  1WGX A;  3KP3 A;  2IRF G;  1ZAO A;  3E5U A;  1QPM A;  4B3A A;  1XD7 A;  1YS6 A;  2CV2 A;  2O6G E;  2M4G A;  2DCE A;  3DFG A;  2LRE A;  3SJM A;  2IT0 A;  5ERI A;  1P4A A;  3HRT A;  2COB A;  2WV0 A;  1I5Z A;  1IXC A;  1X2N A;  1H9G A;  4A0X A;  3K2Z A;  4D5F A;  5L3C A;  3HM5 A;  1K78 A;  1JTX A;  1XMX A;  4PDK A;  1GXP A;  4ZDO A;  5CPR B;  1T33 A;  2E2H J;  3BR2 A;  3CO6 C;  4UY8 I;  2QA4 I;  2IGM A;  3V7C A;  5DS9 A;  4GYI A;  2ZSI B;  3C18 A;  3MZH A;  1E0E A;  1XTA A;  4F3Q A;  1PUF B;  2HTS A;  3DKX A;  2Z2S B;  4AYB N;  2HDC A;  4BQA A;  1XGS A;  2IA1 A;  2XB5 A;  3O6B B;  1LB2 A;  4Y17 A;  3C1D A;  5DM7 F;  3E0J B;  2FMY A;  2G9W A;  2R92 J;  2V6E A;  4O5V A;  1OCP A;  2L4M A;  5B66 C;  4ZTJ A;  5DD4 A;  2VJ5 A;  2BYV E;  5A2Q K;  4BNC A;  2XKO A;  3T8R A;  5FLX K;  5EGO A;  3AL0 B;  4L0Y B;  1B1B A;  2Z33 A;  2IXS A;  2F4O B;  1H8A C;  2DT5 A;  2QSF X;  3RTR A;  5DUK A;  5EF6 A;  3GX4 X;  2EFQ A;  4E7L A;  2NVY J;  3F72 A;  4E7H A;  4QPQ A;  2L9R A;  2BVL A;  1JKR C;  1JTY A;  2DA7 A;  1J7K A;  3MKW B;  2X1D A;  1B8I A;  2Q0O A;  5BNG A;  4YFN F;  2HQR A;  4XRS A;  1TTY A;  3BG7 A;  3GZ6 A;  3FHZ A;  4ESF A;  2D5V A;  2Q1Z B;  3SDG A;  1OMI A;  3BG5 A;  3N05 A;  2CQQ A;  2PX9 A;  3FZV A;  1TLH B;  4BEH A;  4XSX F;  1YO5 C;  2LR8 A;  4B3X A;  2W4S A;  5CVV A;  1ZTR A;  3IHU A;  1WRJ A;  1YW8 A;  1UCR A;  1X4O A;  5HS9 A;  3GCM A;  1HST A;  5EG0 A;  5JVT A;  2MH9 A;  4EJW A;  3E6M A;  2HOT A;  3OR2 C;  3JRA A;  2VAS A;  1JI8 A;  5FKN A;  3V8L A;  2CUJ A;  3RSN A;  4UB8 C;  2VL8 A;  3HOZ J;  2PG4 A;  3RCO A;  1HA8 A;  4I76 A;  3D5R C;  2O8X A;  3OYN A;  1WJ5 A;  4Y33 A;  3EUK L;  3HOW J;  1SMY F;  4XID A;  2BHZ A;  2KT0 A;  1W1W E;  3ABM H;  4XLA A;  5B1B H;  2IJL A;  4BY1 J;  1ACI A;  2YUS A;  3CC2 I;  4U0V A;  4RLQ A;  1WSU A;  1HQC A;  1W4M A;  2R7V A;  2HZD A;  5GAG J;  1RPW A;  4QIW N;  2VXZ A;  3HUG A;  3CF5 F;  5TJJ A;  2XIG A;  1X1D A;  3GZN B;  4TV7 A;  3I4M J;  2LKS A;  4G7O F;  3J80 K;  2ZJP F;  5KHD A;  3K4J A;  1XN7 A;  2E35 A;  4LLN A;  1XCV A;  3FK7 A;  4JX5 A;  1OFC X;  2VBW A;  3T8T A;  3RPU A;  3OY9 A;  4UV9 A;  3MKY B;  4W1U A;  3HSF A;  2XKP A;  3E7L A;  4CO8 A;  3H35 A;  4L5I A;  1W5T A;  1ZG5 A;  1TQI A;  1DU0 A;  4OIQ F;  2AHQ A;  5F04 A;  3K4L A;  5FRM A;  4IRI A;  1W0U A;  2JK3 A;  4P5O A;  1YOV B;  2CQX A;  3CD6 I;  4HV5 A;  2FBK A;  4RGU A;  4A2U A;  2RKH A;  4A6D A;  4UUS A;  2DTR A;  3KLN A;  2FOK A;  2XC7 A;  3OSF A;  1XSX A;  2PMZ A;  3J81 K;  3VWB A;  3OIO A;  4XLN F;  2XRL A;  2FA5 A;  1R1T A;  2OUM A;  1OCC H;  1Y8Q B;  1IN6 A;  2LY2 A;  2IVM A;  4C3J J;  4MFD A;  3ABT A;  2Q2E B;  4XMY A;  4DZJ A;  2A5Y B;  3WHC A;  2E34 A;  3LMM A;  1OLT A;  2MW8 A;  2E1C A;  4M3B A;  2A61 A;  3ZQF A;  1F9N A;  2J5O A;  3ZMT A;  1Z1D A;  1T98 A;  2PJP A;  3T0Y A;  1P7J A;  2JRT A;  1OR7 A;  2M4K A;  4G6T B;  4FT8 A;  2QEX I;  3ZR8 X;  2X51 A;  1FT9 A;  3CES A;  4S04 A;  1D1B A;  2JWT A;  5IP6 A;  3AG1 H;  3PFY A;  1FSE A;  2FRH A;  3F3X A;  3C3W A;  2O03 A;  3BG9 A;  4AVZ A;  2Z3Y A;  4K2E A;  5AIQ A;  2DLL A;  3HKZ A;  2HOE A;  2KDZ A;  5GAE J;  2LBF B;  4RGR A;  2HXO A;  2ISY A;  2UUZ A;  1BC8 C;  2DA4 A;  1S7A A;  3GTJ J;  1BOA A;  1I27 A;  3S16 J;  3H0D A;  4YIR X;  1MMG A;  1SMT A;  4EQQ A;  4IXA A;  4A3K J;  1HSJ A;  3PQJ A;  2E7W A;  4RDU A;  2JT1 A;  1UFM A;  3CUO A;  5KCM A;  3G1L A;  4XL9 A;  1D8K A;  1OIS A;  1LKX A;  1PP7 U;  1S6L A;  3ZQ7 A;  2CUE A;  1ETW A;  4KIC A;  2DMQ A;  1QZE A;  4WXD A;  1MBJ A;  3BQY A;  3QOP A;  4HOB A;  1F43 A;  4CDG A;  5LEJ A;  1EH8 A;  4OAY A;  1QNT A;  4D5C A;  2P7C B;  3HGY A;  2VXD A;  1ZRD A;  1J9I A;  2IA0 A;  2XVC A;  4B48 A;  4XRS G;  2VUM J;  2VC0 A;  3LFK A;  3JR9 A;  4DYC A;  5LRR A;  4IHT A;  2HQN A;  2KQR A;  1SEU A;  4M71 A;  1HW1 A;  1IDZ A;  2DK5 A;  3ECH A;  3H36 A;  1YQA A;  2I5U A;  4CCK A;  2B7E A;  2VC1 A;  1JUM A;  2NVU B;  2L0K A;  1KGS A;  3RPQ A;  4ZZL A;  2X6W A;  1XX5 A;  4WXH A;  1MMA A;  1TNT A;  1WJE A;  2EH3 A;  3K1M A;  5HDK A;  5IT9 Z;  4NUB A;  1QRY A;  4KIG A;  1W0T A;  1SVO A;  5H6R A;  5ICE A;  4AYB A;  3LNQ A;  3TP0 A;  4IVN A;  4I7H A;  3S3O A;  3LAP A;  3SZT A;  3KP4 A;  3R61 A;  2E2J J;  4CGZ A;  5E18 F;  1FY7 A;  1MNM C;  4HF1 A;  3WGG A;  1FBU A;  3HGG A;  1APL C;  3JSO A;  1F5T A;  1LUJ B;  2R7D A;  3GXO A;  2GXG A;  2K9S A;  3MZY A;  4XKV A;  1V5F A;  1JKQ C;  4JX4 A;  3NWS A;  1B9N A;  4F55 A;  4OIN F;  1JUS A;  1UST A;  3UNG C;  3VYR B;  1BL0 A;  3K69 A;  4IHX A;  1Y1V J;  1X2M A;  2KJB A;  2A6H F;  3OYK A;  1K61 A;  3CP2 A;  2OU2 A;  1YIJ I;  4RAZ A;  2VBY A;  2PBI A;  4CCM A;  2LFB A;  2FBI A;  4E7Z A;  1S9H A;  2L7M P;  1NG6 A;  1TQP A;  1WVR A;  1CQT A;  2NRA C;  3TO6 A;  4E7K A;  4O3M A;  1V5G A;  2AXT C;  2CW8 A;  2RQP A;  3A01 B;  2ELK A;  2CV0 A;  2CS3 A;  4E7I A;  4BHP A;  3KP6 A;  2STW A;  1YRN B;  2XAQ A;  2L5Q A;  3ULQ B;  1G3W A;  2O3F A;  1IUY A;  2JVH A;  4I99 C;  3CDH A;  3L2R A;  2Y2Z A;  5BPI A;  1GV2 A;  3TKY A;  2E5Z A;  1Z21 A;  5L3B A;  2E7X A;  4PJM A;  4QTR A;  2LOO A;  4KNY A;  1IO2 A;  2AXL A;  2ZJ2 A;  3DEU A;  2RC4 A;  2V1N A;  2ZSH B;  5B1A H;  3V42 A;  3FXO A;  3CJQ B;  3IH3 A;  1TWC J;  1IF1 A;  4OIP F;  2Y0S N;  2OC6 A;  3L1P A;  1PUF A;  3H3U A;  2M0M A;  3TOA A;  2QQ9 A;  5A2Q Z;  1USS A;  4RB1 A;  2MC3 A;  2E19 A;  5CVR A;  4CIC A;  4BGD A;  4N9H A;  3Q3S A;  1WJD A;  3BQZ A;  1HKQ A;  1NG7 A;  3L2W A;  5BS6 A;  2HVR A;  4HDU A;  5J4Y A;  3NRV A;  2VOP A;  2L7K A;  4LLG F;  2XSD C;  1ORK A;  4BDZ A;  1NK3 P;  3M4O J;  4EMS A;  1Y56 A;  5KVR A;  3F0C A;  4A0Y A;  3GWZ A;  3MCZ A;  3ZXS A;  3DCF A;  3IAS 2;  4XK4 A;  4BQO A;  2BE5 F;  1QZZ A;  3F8N A;  2M9H A;  2YX4 A;  2HXI A;  1K4S A;  4UNO A;  2NAZ A;  3MAJ A;  1BC7 C;  4HF0 A;  2HDD A;  3BCA A;  3E5Q A;  2BY1 A;  4KIS A;  1VQP I;  3S1M J;  4LG0 B;  2FF4 A;  1MDM B;  2F48 A;  3LFU A;  4GCV A;  1VFC A;  3HOV J;  4L9T A;  4FQG A;  3FX3 A;  1DP7 P;  2EIM H;  3RZO J;  2LH9 A;  4YRV A;  5C4X J;  3WOD F;  1X1A A;  3S2D J;  2DMP A;  2BY2 A;  1JT0 A;  1YHQ I;  2JA6 J;  1S3J A;  3SFI A;  3PNT A;  1STZ A;  3VDX A;  2WTE A;  3JRC A;  2ACJ A;  2QQB A;  5D5U B;  3LSM A;  1CGP A;  5ICF A;  2CFO A;  1FBQ A;  3CP8 A;  4I2O A;  2QVO A;  1PVE A;  3CC7 I;  4U0W A;  1IN5 A;  5K7Z A;  3FM3 A;  2R7T A;  5IYB J;  2X9D A;  4HRI A;  3SXY A;  5M5W J;  1RNL A;  4L5E A;  4DYR A;  2NNY A;  1MBH A;  4RS8 A;  1EJ9 A;  4WX9 A;  3B6A A;  4MEX F;  3CC4 I;  2XAU A;  1BOB A;  5J8C A;  1VQ9 I;  4C3H J;  1XSD A;  1F1Z A;  3DU5 A;  1LFB A;  4U0Y A;  2CW7 A;  1XCB A;  2ZXJ A;  1XMK A;  5IOY A;  2W84 A;  1TWH J;  3FKJ A;  2W24 A;  3HOS A;  1G2H A;  2BY0 A;  4E7J A;  4LD5 A;  4IOA F;  2M87 A;  5IT3 A;  4YFX F;  5J1U A;  4CXF A;  3J80 Z;  3Q0U A;  1MSF C;  2M34 A;  4A6E A;  3KP2 A;  2ZFU A;  1EKE A;  1ETQ A;  2X6X A;  3QPS A;  3OIP A;  4M3D A;  2DFF A;  4LJZ F;  5H2F C;  5AON A;  3JRG A;  1R5I D;  1FP2 A;  3BR3 A;  1F4K A;  1VZ0 A;  2DA2 A;  2OV7 A;  4ITV A;  1R5H A;  5J8F A;  3KIO A;  1DPR A;  1MH3 A;  3K4B A;  3H9Q A;  3DKY A;  3BR1 A;  1X1C A;  1GUU A;  2JTV A;  3E1S A;  1BA5 A;  1P2F A;  2VT3 A;  3TL4 X;  1I1G A;  4HG2 A;  1REP C;  1IRG A;  2W1O A;  4EVI A;  1DU6 A;  2R7U A;  1U3E M;  2RNG A;  2BVM A;  4RMN A;  3ZP5 A;  1MMN A;  3PIP F;  1PYV A;  4PCQ A;  4S0H B;  1QA6 A;  4LFU A;  4LB6 B;  4NNJ A;  3J81 Z;  4HF2 A;  2ZXW H;  3QOE A;  2HGC A;  2LY9 A;  4NC7 A;  1Y0U A;  1MND A;  1X58 A;  2NNN A;  2QYO A;  2Y0M A;  5FD5 A;  4IL6 C;  1JKP C;  4DNC A;  3M7G A;  4CHU A;  4BJ5 C;  4PGH A;  2L9S A;  3I5U A;  2BXY A;  4AIJ A;  3KX2 A;  3HOT A;  3WTV C;  3OOP A;  1NH3 A;  3KP7 A;  4G7Z F;  2XF7 A;  4E4H A;  4IOC F;  5EJC A;  2VQG A;  2IAI A;  1J2X A;  1SAX A;  4PJN A;  4E70 A;  1G3S A;  2IEK A;  1NHA A;  3KP5 A;  4BUP A;  3GFL A;  2WB1 N;  3TDU C;  5LFA A;  4M9X A;  2W48 A;  5HLH A;  1UHS A;  2VQC A;  3HOU J;  1ZGA A;  3WE3 A;  2N8G A;  5BMZ A;  1H89 C;  1HF0 A;  3B6C A;  2EIJ H;  2VON A;  1GV5 A;  1K83 J;  3P7N A;  1X3W B;  1RR7 A;  2FJ1 A;  1I6H J;  4Y52 J;  2GIV A;  3ABK H;  1YW9 A;  3PQK A;  2QZ8 A;  1IN8 A;  2F5D A;  3LSH A;  3ABU A;  2X6O A;  3M8J A;  2HQA A;  3AAF A;  4OIO F;  3I9V 2;  2HYF A;  4A3I J;  3DKW A;  2DYR H;  2L9N A;  2HWV A;  1GDT A;  3RI4 A;  5LGT A;  4YEJ A;  2LC2 A;  4AVP A;  1FC3 A;  2AQE A;  3BDD A;  5H6Q A;  3PM1 A;  1KU9 A;  3EUA A;  3OWT A;  4XOT A;  4GYG A;  3ZQQ A;  2MD5 A;  1FIP A;  3M8F A;  3DQV C;  2OBP A;  4FTH A;  3G2B A;  1L3L A;  4D1Q A;  1RUN A;  3ELK A;  3COA C;  2W00 A;  4DGW B;  3OL4 A;  4KFC A;  1B6A A;  5J40 A;  1Z6R A;  2ECC A;  4L9N A;  1KZH A;  5D4R A;  4IKF A;  3K4M A;  5HOO A;  3F21 A;  3HYI A;  1U0J A;  2DYS H;  3KE2 A;  3K70 C;  2P6T A;  3PUB A;  2HVQ A;  2DO7 A;  2ADU A;  2HKX A;  3E6B A;  1ETY A;  1ZQ3 P;  4XN3 A;  5E3O A;  4A3E J;  1WWX A;  1YYV A;  3KEO A;  4HNU A;  1FOX A;  1RET A;  5E3M A;  3BWG A;  2MGQ A;  3CUQ C;  2YPR A;  2XAJ A;  3LA7 A;  4C30 A;  1YJ9 I;  2JA5 J;  4N4O B;  3A0B C;  1W7P B;  2XF6 A;  4D9J A;  3J7A Y;  4OWR B;  1FWZ A;  4F91 B;  2XDV A;  4UB6 C;  3GTQ J;  4J01 A;  3GTK J;  2NOG A;  3OYM A;  4ENK A;  2M2E A;  2PMH A;  2Y0S A;  1Z6T A;  3F8C A;  1UAA A;  3S32 A;  2ZJQ F;  4WK8 F;  2EIN H;  3G3Z A;  3MD2 A;  1JGG A;  3RKY A;  1DPU A;  4A3D J;  4HQE A;  3LSJ A;  4BE2 A;  1I6X A;  1VQN I;  4XIC A;  2PLY A;  2ZO4 A;  4NQW A;  2ZCW A;  1CF7 A;  1H0M A;  1ZGW A;  1WHU A;  4GXO A;  3HC7 A;  1UG0 A;  3FK6 A;  3HHG A;  4M3E A;  3K9T A;  1MJB A;  3BJO A;  4E6K G;  4HX8 A;  3FMR A;  2DA6 A;  3GFI A;  2L9V A;  3UR3 C;  1J09 A;  5DUI A;  2L02 A;  1BI0 A;  3CMA I;  2P8T A;  4UXN A;  3GVA A;  1BR2 A;  1P9Q C;  2VJI A;  2JSP A;  1WJC A;  4BJT A;  2H6B A;  3PSF A;  3S3N A;  4DYQ A;  3HXL A;  1YW7 A;  2LLK A;  3KEQ A;  4DBR A;  1LFP A;  4IRH A;  4A3C J;  4MEY F;  4DIQ A;  1VQ7 I;  1SD5 A;  2XV4 S;  3V8J A;  2HYJ A;  3S1N J;  2K86 A;  2O8K A;  3CLO A;  2ECB A;  1Y0N A;  2R3S A;  1OQY A;  3I54 A;  4M6V A;  2P4W A;  3J7Y J;  1WJA A;  1B72 B;  2L4A A;  3LST A;  5HVQ C;  3A01 A;  1Y1W J;  1FPQ A;  2K9N A;  5IP9 J;  2X48 A;  3FBN B;  1R5G A;  1ZLK A;  1YRN A;  5M3F J;  1MSE C;  2F2E A;  4ESJ A;  1RZ4 A;  3EET A;  4RLF A;  3LSK A;  4MTE A;  1SAU A;  3I3L A;  2CQK A;  5JLX A;  4PZJ A;  3BTC A;  2RNJ A;  3V4G A;  2CYY A;  5L3G A;  3WU1 B;  1IAW A;  4XOR A;  3CTA A;  4Q48 A;  3OS1 A;  2FQ3 A;  2XGE A;  1YX3 A;  5IYC J;  5GAD J;  5FFX A;  1SC7 A;  4A3B J;  5DCM B;  1QHH D;  1R9T J;  1QBJ A;  2DQL A;  3H0G J;  4IX7 A;  3ZRG A;  4F92 B;  3OL3 A;  2Y9Y A;  1IDY A;  4RM3 A;  1RRJ A;  1A36 A;  3H5R A;  2KDO A;  2R93 J;  1GHC A;  3CCS I;  3QRF F;  1KA8 A;  4MLO A;  2DMN A;  4G94 A;  4LIU A;  3FHN A;  2VBX A;  5GTH C;  3FMS A;  2EIK H;  4HX4 A;  3LQR A;  3S8P A;  3M1C A;  4IPA A;  4RAY A;  3SEQ A;  2QLZ A;  1RUO A;  4CYC B;  4XLE A;  2HYG D;  2A6T A;  3N97 A;  3MFK A;  2GIZ A;  3R6S A;  2DPD A;  2CJJ A;  5BQT A;  1JE8 A;  3I59 A;  9ANT A;  1TL8 A;  2ZME A;  4N0B A;  3ZMD A;  1BR1 A;  1JXS A;  2M8E A;  3OV8 A;  3HTS B;  3F9K A;  2EB7 A;  4ZH4 F;  1LNW A;  5LHG A;  3BJA A;  3C7J A;  2R7X A;  3IRR A;  1LE8 A;  3K4N A;  3IC7 A;  3RKX A;  2L7Z A;  2IGO A;  3PO3 J;  2Y69 H;  3E97 A;  4D7M A;  3FXU A;  1FP1 D;  3OIQ A;  4IRG A;  3HOX J;  3S15 J;  1TWF J;  3GUD A;  2HKO A;  2DQR A;  1XSV A;  2Z1D A;  3K4C A;  4AID A;  1DUX C;  4L5J A;  3F8B A;  3MZ8 A;  3I55 I;  1T8I A;  3H5A A;  5ILS A;  5K1Y A;  1FTT A;  2NVT J;  2KJC A;  2QQA A;  1OKR A;  4UHT A;  2Z16 A;  2ZNY A;  2DT7 B;  1FNN A;  5JFR A;  2KHM A;  5DV5 A;  1JHH A;  2X6Y A;  4M3G A;  5KAI C;  2LF8 A;  1UG2 A;  2KIS A;  3HDD A;  1HKT A;  2LYC A;  2H09 A;  1FYM A;  2EV5 A;  2FUG 2;  4BHB A;  1Q1H A;  3OYE A;  2WB1 A;  1Z7U A;  3VSL A;  1TWA J;  2CV1 A;  2DDB A;  1KQ0 A;  2X0L A;  2Y48 A;  3P5J A;  3ASO H;  1KU3 A;  1G6N A;  3FXK A;  1QVT A;  5M3M J;  3FIW A;  3CJT B;  4HX7 A;  2LSO A;  5B5E C;  1T08 B;  4V19 K;  1FEX A;  4GGG A;  2OPT A;  1Y39 A;  2H6C A;  2DT6 A;  2D1V A;  1TZL A;  3OMY A;  3OYL A;  4XBF A;  1ONV A;  2BV6 A;  4HLX A;  2QBY B;  2HZT A;  3CJR B;  4F93 B;  4HSR A;  1JJ6 C;  3G6E I;  2OCC H;  3EQL F;  5EDN A;  3SDB A;  4C9Y A;  3HTU A;  1GVJ A;  2BHY A;  2JJ7 A;  2X1E A;  3FIS A;  4IJA A;  3VOE A;  2FNP A;  3BLY A;  4II2 A;  3I56 I;  2JMW A;  4HV6 A;  1RI7 A;  4HPQ A;  3LSP A;  3LA2 A;  1TP4 A;  2VJJ A;  1D3Y A;  3G71 I;  1IW7 F;  4P96 A;  2D2W A;  2A07 F;  1MMS A;  1OPC A;  2DTZ A;  1ZR4 A;  5F64 A;  4A3J J;  3S93 A;  5FLV A;  2EZH A;  4II3 A;  2VT2 A;  5LGU A;  2VKD A;  5LLQ A;  4Q5S F;  3ZN0 A;  1HOM A;  2FEZ A;  3ZQL A;  2XAH A;  2KZG A;  5FFZ A;  2IS6 A;  6PAX A;  2BOL A;  4KIF A;  3HHH A;  2MC4 A;  2HTJ A;  1O4X A;  4EM2 A;  2HOS A;  1E3O C;  1AKH A;  1Y6I A;  1AHD P;  3LSG A;  1TNS A;  2DOD A;  4MQ9 F;  3GF2 A;  3EPZ A;  1O3S A;  1MMD A;  2YSR A;  1DQU A;  3ESW B;  2VE9 A;  1X4P A;  1X3Z B;  1ZN2 A;  4GO1 A;  4IO9 F;  2YU9 J;  2QKL B;  3RQI A;  1DP3 A;  1I50 J;  4UVB A;  1IN4 A;  3BTL A;  4BL0 B;  1LEA A;  3C2B A;  1OCZ H;  3U1D A;  2LK2 A;  1K79 A;  3ZQI A;  4JQF A;  3GTM J;  1VQ8 I;  1J0R A;  4N4N B;  5F0C A;  2KFD A;  5K7H A;  4WF2 A;  2DMU A;  4G9Y A;  1FMV A;  3SEZ A;  1T0F C;  2FBH A;  4EJT A;  4AUX A;  2W82 A;  4JP0 A;  4Y13 A;  3KCC A;  3DTK A;  2EZL A;  1J75 A;  4A69 C;  2R4G A;  3CDL A;  3E3V A;  5HOD A;  3A0H C;  4CCN A;  4JX6 A;  3ZQH A;  1YJN I;  1VQL I;  1DGW Y;  3ZCO A;  1BI3 A;  2F4I A;  4AD9 A;  4AWX B;  3JRH A;  1T2K A;  1H88 C;  1U5T B;  5J6X A;  3T1B A;  2KRC A;  2ZNZ A;  2ICW G;  3ABL H;  2M30 A;  3OYD A;  1ETO A;  1ZLJ A;  3J7A O;  2CU7 A;  1B9M A;  1WI9 A;  3H92 A;  4ON0 A;  2CQ7 A;  2ETH A;  2L7F P;  5DEQ A;  3K70 D;  2GLO A;  1YTY A;  2K5C A;  2CO5 A;  2WY7 Q;  3BPV A;  4L9J A;  3RQ4 A;  4GDF A;  5F08 A;  2JUC A;  3AG2 H;  1TWG J;  3CUQ B;  1SFK A;  4C2T A;  1ZGJ A;  1QVU A;  1ZAR A;  5FRO A;  1BR4 A;  1JKO C;  1MBK A;  2O0Y A;  1MBG A;  2LDU A;  4CSW A;  4I6Z A;  1S5L C;  1OYW A;  4E7S A;  5HS8 A;  4Z6Y A;  1G59 A;  4BYY A;  1UB9 A;  2DOA A;  3G4S I;  3REO A;  1M1E B;  1P4X A;  1W5C C;  3R0J A;  3GW2 A;  1A31 A;  2R5Z A;  4BY7 J;  1D1A A;  2A05 A;  4YIF A;  3E6C C;  1RC9 A;  4B47 A;  1JHF A;  5F6F A;  1IXR C;  4L9V A;  5JHU A;  2O9L A;  1S7O A;  2QWW A;  1FOK A;  1XDS A;  1R1V A;  1UHW A;  4UUV A;  3F23 A;  4P55 A;  1O3R A;  1N25 A;  4U7B A;  1PDN C;  2XPW A;  5ILV A;  4OIR F;  3WTY C;  5CJ9 A;  1OJL A;  4YFK F;  1D1C A;  2IW5 A;  1FZP B;  3HRS A;  1LJ9 A;  4C3I J;  4ZTF A;  1X3U A;  5KAF C;  4RB2 C;  2WWY A;  2BZT A;  3GFM A;  2GZW A;  4R1H A;  3KZY A;  2K9M A;  3FF5 A;  5E20 A;  3FXJ A;  4BXX J;  3K1N A;  2OZU A;  4HLY A;  2YX7 A;  2WBM A;  2JN6 A;  3JRB A;  1ZRE A;  3HJE A;  2OQG A;  3A4C A;  3I64 A;  1AA7 A;  3VPR A;  3CO7 C;  4HNT A;  5B3S H;  4J00 A;  2MBF A;  3Q9S A;  3H3Z A;  5FJ8 J;  2EZK A;  4U87 A;  3UKG A;  1V4R A;  3NWT A;  4WXC A;  1ZRC A;  2E1M C;  3JRI A;  3VFZ A;  1HDP A;  2MA3 A;  2DOE A;  2XF5 A;  1ZHF A;  5C3E J;  2ZFW A;  1G3T A;  3CLQ A;  1POG A;  1LFU P;  1B72 A;  2BEO A;  3ZGK A;  4XON A;  4EM0 B;  2FQ4 A;  5K7F A;  3OSG A;  4BBS J;  2MFZ A;  1MBF A;  3T5X A;  4LK1 F;  4XRM A;  3IP4 B;  4Q47 A;  1T6S A;  3DPL C;  4M6X A;  1XC5 A;  5K5R A;  1VTN C;  3S17 J;  3MMY B;  2RN7 A;  1ETK A;  5J47 A;  2KP6 A;  4DJA A;  4XQF A;  2JVG A;  2ZJR F;  3OYF A;  1E3H A;  2PEX A;  3A1Y A;  4BS9 A;  3S2W A;  5DCM A;  1B8I B;  3F6O A;  3KYL A;  1WFX A;  2X85 A;  3MKZ A;  3BC8 A;  1V55 H;  4BE1 A;  2BW3 B;  1D5Y A;  1IRX A;  2LY1 A;  2HR3 A;  2EK5 A;  4YII A;  1FMW A;  2P5K A;  2CQN A;  1IC8 A;  3CME I;  2RVC A;  3TW6 A;  1D0Y A;  2R7Z J;  2NS8 A;  4B4C A;  1R71 A;  1MH4 A;  3RYP A;  3H1C A;  2LF7 A;  2EWN A;  3ERM A;  4XKB A;  2VQH A;  5J3L A;  4AIH A;  4OU0 A;  1BJA A;  1F36 A;  3TED A;  3U2R A;  5EG0 B;  1IN7 A;  2R7R A;  4XRF A;  2IS4 A;  3R0A A;  1HC8 A;  3Q5F A;  4N9I A;  3WG7 H;  4MGR A;  5E3L A;  2JQ7 A;  3SFZ A;  1Z0X A;  3P9K A;  1EH7 A;  3A02 A;  1YI2 I;  4JBA A;  2UZK A;  3IKV A;  3QYF A;  5FKM A;  1MD0 A;  3FDY A;  4XSZ F;  1PP8 F;  2HQ5 A;  4RB0 A;  3ECO A;  4HST A;  5HDG A;  3DPU A;  2L3D A;  4CUG A;  2MH2 A;  5BOX A;  3EUH C;  2CFX A;  4A3G J;  1YX5 A;  3M9A A;  2NYX A;  1SFU A;  3R4K A;  3M3Y J;  4G6Q A;  4OMZ A;  3HPH A;  1XGM A;  2EJR A;  4BKX A;  3DEE A;  4ABZ A;  1MKM A;  1ETX A;  4PFP A;  1SFO J;  5HLI A;  4NB5 A;  2TCT A;  4MO7 A;  2ME0 A;  3CQZ J;  2LVS A;  3KET A;  2KL4 A;  3V7R A;  2GA1 A;  1MZB A;  1DGR M;  2V7F A;  1OCR H;  3K7A J;  4PJ0 C;  4BE0 A;  2PN6 A;  2CWE A;  1RKT A;  4IZZ A;  1PJR A;  5E8G A;  2UXN A;  3WU2 C;  2ELJ A;  1KYW A;  2B0L A;  2KMU A;  3W3C A;  1RES A;  3RJP A;  3HL2 A;  2OZ6 A;  2DOF A;  4CCJ A;  2FU4 A;  4M72 A;  1ZG1 A;  3KPH A;  2PJR B;  3TO9 A;  4IHW A;  4DOZ A;  4WCG A;  3KLO A;  4FCY A;  5GP9 A;  4KT6 A;  5CYV A;  3C2H A;  2R5Y B;  2Z9O A;  5M5Y J;  4G6D A;  4UUS B;  3HOY J;  1UHM A;  4AM3 A;  3PUF A;  4EJU A;  1N77 A;  2EBI A;  2M0C A;  3HZJ A;  1R23 A;  3SYT A;  5JR3 A;  3W2A A;  1GT0 C;  1Z3X A;  2H94 A;  3TDZ C;  5CQG A;  4EJO A;  3DBL B;  4Y7N J;  5F1J A;  1P7I A;  2Q2E A;  5DTD A;  4BBR J;  4P1W A;  3DLL F;  5J4V A;  2B9S A;  4BXU A;  1UZC A;  2I10 A;  4V2G A;  2LKP A;  3A03 A;  2GQQ A;  4X6A J;  1U8R A;  4JK1 X;  3O2P E;  4HDV A;  3VB2 A;  1R4M B;  1XDU A;  4KA4 A;  2XRO A;  1OYI A;  1R1U A;  5FKL A;  1JUP A;  2IGN A;  2MLK A;  1O7L A;  2P5V A;  4RGS A;  1TT0 A;  4LLL A;  5IP7 J;  3QPH A;  3D5L A;  4FE4 A;  4LIT A;  3WTZ A;  4DW6 A;  4R79 A;  3U21 A;  2K7L A;  3BZ6 A;  2P81 A;  3DP7 A;  2WV1 A;  2QEN A;  3JW4 A; 
#chains in the Genus database with same CATH homology
 2M45 A;  1U78 A;  2OAZ A;  4KMU X;  4LB5 A;  4LGW A;  1HXD A;  4HA8 A;  3QP5 A;  3FWE A;  3W6J B;  4M9S A;  3F8M A;  4B8X A;  1SFE A;  2IA2 A;  2XRN A;  2EV0 A;  1C0W A;  3M1E A;  3ZMZ A;  3JTH A;  2M5W A;  1U5T C;  2JPB A;  1BIA A;  2Z5U A;  4CZZ A;  4Q4Z F;  2XAF A;  2D45 A;  2F5E A;  1BM9 A;  3WE2 A;  2P5L C;  5D8L B;  4WWC A;  3GLX A;  3JTG A;  4BHC A;  1B59 A;  1W7P D;  1BI2 A;  2QM3 A;  4Y15 A;  1HKS A;  3L7W A;  3KFW X;  3NEU A;  3P9C A;  1QGP A;  1RIO H;  4Z2Y A;  1YFH A;  1AWC A;  1YLF A;  1ZYR F;  2UXX A;  3K1P A;  3CUQ A;  4M9Z A;  5L3D A;  5D8K B;  2CG4 A;  3WGH A;  3WTW C;  5AIP A;  3BY6 A;  3K0L A;  2VN2 A;  3U9G A;  1IXS B;  2FE3 A;  2ESN A;  2NS0 A;  2DK8 A;  3EYI A;  4L18 B;  3QU3 A;  1YS7 A;  5LEK A;  4P9F A;  3TGN A;  2DPU A;  2KIM A;  5ILU A;  1U6G A;  1EH6 A;  3EYY A;  4P9U A;  3HSR A;  3V8K A;  1L0O C;  4HAM A;  5CLS A;  2M1B A;  4NHJ A;  2V1X A;  2COM A;  4FX0 A;  4S05 A;  1O57 A;  2K27 A;  4F7Z A;  3I53 A;  3TO7 A;  4ZYE A;  1EV7 A;  1W5S A;  2X4H A;  5BPD A;  3F22 A;  2CGP A;  4ZYH A;  1XGN A;  3TQN A;  4HQM A;  4KN7 X;  2VOO A;  3LQQ A;  5DD8 A;  3R60 A;  5DCF A;  2MLG A;  2FSW A;  3EDP A;  3CJN A;  3ZPL A;  3ZMS A;  1O3Q A;  5L3E A;  5FB2 A;  5JI6 A;  5DYM A;  4ETS A;  1T38 A;  4I0A A;  2PI0 A;  5D5W B;  3QPT A;  1U2W A;  5FD6 A;  1YG2 A;  1G4D A;  4ENN A;  3I0T A;  1SFX A;  2E1N A;  4ASN A;  2L54 A;  3ZN1 A;  1JGS A;  5D4S A;  1J5Y A;  2F5F A;  4G8X A;  4KN4 X;  1XGO A;  4LMY A;  1FYK A;  2OA4 A;  4OMY A;  4LG0 A;  1MDM A;  4HBL A;  3SHF A;  4A5N A;  3IWZ A;  2JZY A;  2ELH A;  1E17 A;  5F1R A;  1R7J A;  3E5X A;  2EV6 A;  5LGN A;  2DU9 A;  4UV8 A;  1QO0 D;  5K5O A;  2DAO A;  2GXB A;  1BBY A;  5LBQ A;  4RGX A;  3BPX A;  3MWM A;  3DV8 A;  1IRF A;  2F5C A;  5EEG A;  3ZMV A;  4KYW A;  3N4M A;  5HDN A;  3RKW A;  2EFW A;  3ISP A;  2GWR A;  3DXJ F;  3PFI A;  1YIO A;  4MHG A;  1A04 A;  1LEB A;  3HSE A;  3GZ5 A;  2FNA A;  3L2C A;  2PFB A;  2XGX A;  3BJ6 A;  1ZG3 A;  5ICC A;  4YG2 F;  1FSH A;  2WC2 A;  4ZYG A;  2ISZ A;  4MNU A;  1J59 A;  1MJA A;  2YR2 A;  4D0P A;  2LNB A;  5HLG A;  2W57 A;  4A0Z A;  4KIB A;  1V3F A;  1OYY A;  1HW2 A;  1ZRF A;  3F6V A;  5D6F A;  2Q8K A;  2IPQ X;  4I09 A;  3GYH X;  1D8J A;  3L09 A;  1FLI A;  3O3K A;  1O7F A;  5D5X B;  2H27 A;  2Z99 A;  3BRO A;  4CYD A;  5KK1 A;  5CVU A;  2R7F A;  4EJV A;  5DDG A;  4U7D A;  3LWF A;  2EFO A;  2JPC A;  1K7A A;  3QAH A;  2W25 A;  2GA2 A;  5ICG A;  2EA2 A;  2G7H A;  3DPT A;  2A6E F;  3FM5 A;  4A12 A;  3BP8 A;  4KT5 C;  4A5M A;  1T0F A;  2V79 A;  5E8I A;  1O3T A;  5CVI A;  5E1Z B;  2V1U A;  1I1S A;  4LK0 F;  1BN5 A;  5H20 A;  3WTS C;  1DDN A;  3WTX C;  1T39 A;  3ML6 A;  5ED4 A;  1PUE E;  4FHT A;  4G7H F;  1W7P A;  3SQN A;  1MJ9 A;  4DQ2 A;  3JAM K;  1ON2 A;  3I4P A;  3HIF A;  1R00 A;  3GO5 A;  4M6Y A;  3GFJ A;  1CF7 B;  1XB4 A;  2OQR A;  1KQ9 A;  2J5P A;  2XUB A;  4BAY A;  3NQO A;  4I01 A;  3WG9 A;  3Q9V A;  4XLP F;  2PQ8 A;  2ZBK A;  3IWF A;  4UVC A;  5E1X A;  3WTU C;  2AS5 F;  4IHS A;  1K78 B;  5E1W A;  1LDJ A;  1KU7 A;  3MQ0 A;  4PGG A;  2HS5 A;  1R36 A;  2A68 F;  4HW0 A;  4IF4 A;  1FYL A;  5HS7 A;  1HW5 A;  5D6E A;  3F8F A;  3HRU A;  4AIK A;  1AOY A;  3TOB A;  2G7U A;  4EM1 A;  2EA4 A;  2CW0 F;  2XHK A;  2KIU A;  1B4A A;  1SD7 A;  1KYZ A;  3DF8 A;  2KIF A;  2A69 F;  4M74 A;  2V9V A;  2ESH A;  2YU3 A;  1P92 A;  1GXQ A;  5FLX Z;  4KUM A;  1D5V A;  4UVA A;  2EFN A;  4RB3 C;  4HZF A;  1FX7 A;  1LQ1 A;  1KU2 A;  2XAS A;  2HFH A;  3I59 B;  2ZME B;  2OD5 A;  1BIB A;  3MEX A;  3ROU A;  3ERE D;  2VE8 A;  5LRS A;  2STT A;  1FBS A;  2K4J A;  1ON1 A;  1SD6 A;  2IP2 A;  2VBZ A;  1MGT A;  2TDX A;  1XMA A;  4I02 A;  4U88 A;  5L3F A;  3SZP A;  4MQV A;  1LDD A;  2Y75 A;  1QZY A;  4I0B A;  1WQ2 A;  1TW2 A;  5E17 F;  2BGC A;  3EUH A;  4EGY A;  1LDK B;  3WGI A;  3BOQ A;  4M73 A;  1ODD A;  3VEP A;  2FXA A;  2JSC A;  4ZYD A;  3G73 A;  2L01 A;  3IKT A;  2DFI A;  3LAJ A;  2P6S A;  3L9F A;  4KDP A;  1K6O A;  4ESB A;  3E6D A;  2DW4 A;  1WKM A;  2BBY A;  2CSO A;  5FGM A;  4L0Z B;  1Z91 A;  3I71 A;  2RGV A;  4EV0 A;  4MTD A;  5LHI A;  4H0E A;  3RYR A;  3VOD A;  3V7S A;  1E2X A;  2QBY A;  2FML A;  1TQM A;  3M8E A;  5CVJ A;  5TRD A;  1Z9C A;  3KZZ A;  4KMF A;  1IZ1 A;  3P9I A;  5K5Q A;  1ULY A;  4I98 B;  1HBX G;  1S29 A;  3ZMU A;  1Z05 A;  2D1H A;  3FMQ A;  2PMU A;  2DBB A;  1TBX A;  3I58 A;  3FXQ A;  2V1D A;  2ZKZ A;  3B73 A;  3LA3 A;  4OOI A;  3GEZ A;  2GAU A;  3B02 A;  5FO5 A;  3IRQ A;  2K02 A;  2RV8 A;  4BH9 A;  2P7V B;  3HRM A;  4QLC U;  1SD4 A;  2KKO A;  2C6Y A;  2K4B A;  3L00 A;  4EGZ A;  4B09 A;  1S8N A;  1QQI A;  3D0S A;  1R22 A;  2VOD A;  3QP6 A;  1H9T A;  3W6K B;  5LHH A;  3IL2 A;  2DI3 A;  4R8H A;  1U5T A;  2UWM A;  4O6J A;  2A3S A;  2EFP A;  1LVA A;  4ZZD A;  4FX4 A;  1BI1 A;  3JSP A;  5IT9 K;  2HEO A;  2W85 A;  4QWQ A;  3RDI A;  5EEH A;  3RIR A;  1R58 A;  3QU6 A;  4ENM A;  2O61 A;  5D5V B;  2XAG A;  1ZH5 A;  2RDP A;  2V6C A;  1G3Y A;  3JAM Z;  4HYE A;  1TW3 A;  3WU0 A;  1P6R A;  4ENJ A;  2QUF A;  3WTT C;  3FXR A;  1KQ8 A;  2KRF A;  1P4W A;  3KP3 A;  2IRF G;  1ZAO A;  3E5U A;  1QPM A;  1XD7 A;  1YS6 A;  2O6G E;  3DFG A;  2IT0 A;  5ERI A;  1P4A A;  3HRT A;  2WV0 A;  1I5Z A;  1IXC A;  1H9G A;  4A0X A;  3K2Z A;  5L3C A;  1K78 A;  1GXP A;  4PDK A;  3CO6 C;  3V7C A;  4GYI A;  3C18 A;  3MZH A;  2HTS A;  2HDC A;  4BQA A;  1XGS A;  2IA1 A;  3O6B B;  1LB2 A;  4Y17 A;  3C1D A;  2FMY A;  2G9W A;  4O5V A;  4BNC A;  2L4M A;  5DD4 A;  2BYV E;  5A2Q K;  2XKO A;  3T8R A;  5FLX K;  4L0Y B;  1B1B A;  2Z33 A;  2DT5 A;  3RTR A;  5DUK A;  3GX4 X;  2EFQ A;  3F72 A;  1J7K A;  2Q0O A;  4YFN F;  2HQR A;  1TTY A;  3GZ6 A;  3FHZ A;  4ESF A;  1OMI A;  3FZV A;  1TLH B;  4XSX F;  1YO5 C;  5CVV A;  3IHU A;  1WRJ A;  1YW8 A;  1UCR A;  5HS9 A;  1HST A;  5JVT A;  2MH9 A;  4EJW A;  3E6M A;  3V8L A;  2PG4 A;  2O8X A;  1SMY F;  2IJL A;  4U0V A;  1WSU A;  1HQC A;  1W4M A;  2VXZ A;  3HUG A;  5TJJ A;  2XIG A;  4TV7 A;  4G7O F;  3J80 K;  1XN7 A;  4LLN A;  1XCV A;  2VBW A;  3T8T A;  3RPU A;  4UV9 A;  3HSF A;  2XKP A;  4CO8 A;  4L5I A;  1W5T A;  1ZG5 A;  1TQI A;  4OIQ F;  4IRI A;  4P5O A;  4HV5 A;  2FBK A;  4RGU A;  4A2U A;  2RKH A;  4A6D A;  2DTR A;  3KLN A;  2FOK A;  1XSX A;  3J81 K;  4XLN F;  2FA5 A;  1R1T A;  1IN6 A;  2IVM A;  3ABT A;  2A5Y B;  2E1C A;  2A61 A;  1F9N A;  2J5O A;  3ZMT A;  1Z1D A;  1T98 A;  2PJP A;  3T0Y A;  2JRT A;  1OR7 A;  4FT8 A;  1FT9 A;  4S04 A;  1FSE A;  2FRH A;  3F3X A;  2O03 A;  3C3W A;  2Z3Y A;  5AIQ A;  4K2E A;  2DLL A;  2HOE A;  4RGR A;  2ISY A;  1BC8 C;  1S7A A;  1BOA A;  1I27 A;  1SMT A;  4EQQ A;  4IXA A;  1HSJ A;  3PQJ A;  2E7W A;  2JT1 A;  1UFM A;  3CUO A;  1D8K A;  1PP7 U;  1S6L A;  3ZQ7 A;  4KIC A;  4WXD A;  3QOP A;  4HOB A;  4CDG A;  5LEJ A;  1EH8 A;  1QNT A;  2P7C B;  1ZRD A;  1J9I A;  2IA0 A;  2XVC A;  2VC0 A;  3LFK A;  5LRR A;  4IHT A;  2HQN A;  4M71 A;  1HW1 A;  2DK5 A;  3ECH A;  1YQA A;  2VC1 A;  1KGS A;  3RPQ A;  4ZZL A;  4WXH A;  1TNT A;  3K1M A;  5HDK A;  5IT9 Z;  4KIG A;  5H6R A;  5ICE A;  4IVN A;  4I7H A;  3LAP A;  3SZT A;  3KP4 A;  3R61 A;  4CGZ A;  5E18 F;  1FY7 A;  4HF1 A;  3WGG A;  1FBU A;  3JSO A;  1F5T A;  2R7D A;  3GXO A;  2GXG A;  3MZY A;  1B9N A;  4OIN F;  1UST A;  3K69 A;  2KJB A;  2A6H F;  2OU2 A;  4RAZ A;  2VBY A;  2PBI A;  2FBI A;  2NRA C;  1TQP A;  3TO6 A;  4O3M A;  2RQP A;  4BHP A;  3KP6 A;  2STW A;  2XAQ A;  3ULQ B;  1G3W A;  2O3F A;  1IUY A;  3CDH A;  5BPI A;  3TKY A;  5L3B A;  2E7X A;  4KNY A;  2AXL A;  2ZJ2 A;  3DEU A;  2RC4 A;  1IF1 A;  4OIP F;  3H3U A;  3TOA A;  2QQ9 A;  5A2Q Z;  1USS A;  4RB1 A;  2MC3 A;  5CVR A;  4CIC A;  4N9H A;  1HKQ A;  5BS6 A;  4HDU A;  3NRV A;  2VOP A;  4LLG F;  4EMS A;  5KVR A;  4A0Y A;  3GWZ A;  3MCZ A;  2BE5 F;  1QZZ A;  3F8N A;  2YX4 A;  4UNO A;  2NAZ A;  3MAJ A;  1BC7 C;  4HF0 A;  3E5Q A;  4LG0 B;  2FF4 A;  1MDM B;  4GCV A;  4L9T A;  3FX3 A;  1DP7 P;  3WOD F;  1S3J A;  1STZ A;  2WTE A;  2ACJ A;  2QQB A;  5D5U B;  1CGP A;  5ICF A;  1FBQ A;  4I2O A;  2QVO A;  4U0W A;  1IN5 A;  3FM3 A;  3SXY A;  1RNL A;  2NNY A;  4RS8 A;  4WX9 A;  4MEX F;  5J8C A;  1XSD A;  1F1Z A;  4U0Y A;  1XCB A;  2ZXJ A;  1XMK A;  2W84 A;  3HOS A;  2W24 A;  4LD5 A;  2M87 A;  5IT3 A;  4YFX F;  4CXF A;  3J80 Z;  4A6E A;  3KP2 A;  4LJZ F;  5AON A;  1FP2 A;  1F4K A;  5J8F A;  1R5H A;  1DPR A;  2JTV A;  1P2F A;  2VT3 A;  1I1G A;  1REP C;  1IRG A;  4EVI A;  1U3E M;  3ZP5 A;  4PCQ A;  4LFU A;  4LB6 B;  3J81 Z;  4HF2 A;  2HGC A;  1Y0U A;  2NNN A;  2Y0M A;  2QYO A;  5FD5 A;  4DNC A;  3M7G A;  4CHU A;  4PGH A;  3I5U A;  4AIJ A;  3HOT A;  3WTV C;  3OOP A;  3KP7 A;  4G7Z F;  1J2X A;  1SAX A;  4E70 A;  1G3S A;  1NHA A;  3KP5 A;  3GFL A;  3TDU C;  4M9X A;  5HLH A;  1ZGA A;  3WE3 A;  5BMZ A;  2VON A;  3P7N A;  2GIV A;  1YW9 A;  3PQK A;  2QZ8 A;  1IN8 A;  2F5D A;  3ABU A;  3AAF A;  4OIO F;  2HYF A;  3DKW A;  2HWV A;  3RI4 A;  5LGT A;  4AVP A;  1FC3 A;  3BDD A;  5H6Q A;  1KU9 A;  4GYG A;  2MD5 A;  3M8F A;  3DQV C;  2OBP A;  1L3L A;  1RUN A;  3ELK A;  3COA C;  4KFC A;  1B6A A;  1Z6R A;  4L9N A;  5D4R A;  5HOO A;  3F21 A;  3HYI A;  3KE2 A;  2P6T A;  2DO7 A;  2ADU A;  2HKX A;  3E6B A;  1WWX A;  1YYV A;  3KEO A;  3BWG A;  3CUQ C;  2YPR A;  2XAJ A;  3LA7 A;  1W7P B;  1FWZ A;  4ENK A;  2PMH A;  1Z6T A;  3F8C A;  4WK8 F;  3G3Z A;  3RKY A;  1DPU A;  4HQE A;  1I6X A;  2PLY A;  2ZO4 A;  4NQW A;  2ZCW A;  1CF7 A;  1H0M A;  4GXO A;  3HHG A;  3K9T A;  1MJB A;  3BJO A;  4HX8 A;  3FMR A;  3GFI A;  5DUI A;  2L02 A;  1BI0 A;  2P8T A;  4UXN A;  3GVA A;  2H6B A;  1YW7 A;  3KEQ A;  4IRH A;  4MEY F;  1SD5 A;  2XV4 S;  3V8J A;  2K86 A;  3CLO A;  2R3S A;  3I54 A;  2P4W A;  2L4A A;  3LST A;  5HVQ C;  1FPQ A;  1R5G A;  1ZLK A;  2F2E A;  4ESJ A;  1RZ4 A;  3EET A;  4MTE A;  2CQK A;  4PZJ A;  2RNJ A;  3V4G A;  2CYY A;  5L3G A;  3WU1 B;  1IAW A;  3CTA A;  4Q48 A;  2FQ3 A;  5FFX A;  5DCM B;  1QBJ A;  2DQL A;  1GHC A;  3QRF F;  1KA8 A;  4G94 A;  2VBX A;  3FMS A;  4HX4 A;  3LQR A;  4IPA A;  4RAY A;  2QLZ A;  1RUO A;  2HYG D;  3N97 A;  3MFK A;  3R6S A;  2DPD A;  5BQT A;  1JE8 A;  3I59 A;  2ZME A;  4N0B A;  3ZMD A;  1JXS A;  2M8E A;  3OV8 A;  3HTS B;  2EB7 A;  4ZH4 F;  1LNW A;  5LHG A;  3BJA A;  3C7J A;  3IRR A;  3IC7 A;  3RKX A;  3E97 A;  3FXU A;  1FP1 D;  4IRG A;  3GUD A;  2HKO A;  2DQR A;  1XSV A;  1DUX C;  4L5J A;  3F8B A;  5ILS A;  5K1Y A;  2KJC A;  2QQA A;  1OKR A;  4UHT A;  2ZNY A;  1FNN A;  5JFR A;  5DV5 A;  1JHH A;  2LF8 A;  1HKT A;  2H09 A;  1FYM A;  2EV5 A;  4BHB A;  1Q1H A;  1Z7U A;  1KQ0 A;  2X0L A;  2Y48 A;  1KU3 A;  1G6N A;  4HX7 A;  2LSO A;  4GGG A;  2H6C A;  2D1V A;  4XBF A;  1ONV A;  2BV6 A;  4HLX A;  2QBY B;  2HZT A;  3EQL F;  3HTU A;  1GVJ A;  4IJA A;  3VOE A;  2FNP A;  4HV6 A;  1RI7 A;  3LA2 A;  1D3Y A;  1IW7 F;  4P96 A;  2D2W A;  2A07 F;  1OPC A;  5F64 A;  2VT2 A;  5LGU A;  5LLQ A;  4Q5S F;  3ZN0 A;  2FEZ A;  2XAH A;  5FFZ A;  6PAX A;  4KIF A;  3HHH A;  2HTJ A;  4EM2 A;  1TNS A;  4MQ9 F;  3GF2 A;  1O3S A;  2YSR A;  2VE9 A;  1ZN2 A;  4GO1 A;  4UVB A;  1IN4 A;  1LEA A;  3U1D A;  1K79 A;  4JQF A;  1J0R A;  4WF2 A;  4G9Y A;  2FBH A;  4EJT A;  4Y13 A;  3KCC A;  1J75 A;  3E3V A;  1BI3 A;  4AD9 A;  4AWX B;  1T2K A;  1U5T B;  5J6X A;  3T1B A;  2ZNZ A;  2M30 A;  1ZLJ A;  3J7A O;  1B9M A;  1WI9 A;  3H92 A;  4ON0 A;  2ETH A;  5DEQ A;  1YTY A;  2CO5 A;  3BPV A;  4L9J A;  3CUQ B;  1ZGJ A;  1ZAR A;  2O0Y A;  2LDU A;  1OYW A;  5HS8 A;  4BYY A;  1UB9 A;  3REO A;  1P4X A;  3R0J A;  3GW2 A;  4YIF A;  3E6C C;  1JHF A;  5F6F A;  1IXR C;  4L9V A;  5JHU A;  1S7O A;  2QWW A;  1FOK A;  1XDS A;  1R1V A;  1UHW A;  4UUV A;  3F23 A;  4P55 A;  1O3R A;  4U7B A;  1PDN C;  5ILV A;  4OIR F;  3WTY C;  5CJ9 A;  4YFK F;  2IW5 A;  1FZP B;  3HRS A;  1LJ9 A;  1X3U A;  4RB2 C;  2WWY A;  3GFM A;  4R1H A;  2GZW A;  3KZY A;  3FF5 A;  5E20 A;  3K1N A;  2OZU A;  4HLY A;  2YX7 A;  1ZRE A;  2OQG A;  3I64 A;  3CO7 C;  2MBF A;  3Q9S A;  3H3Z A;  1V4R A;  4WXC A;  1ZRC A;  3VFZ A;  2MA3 A;  1ZHF A;  2ZFW A;  1G3T A;  2BEO A;  4EM0 B;  3T5X A;  4LK1 F;  4Q47 A;  1T6S A;  3DPL C;  4M6X A;  5K5R A;  1VTN C;  2RN7 A;  2PEX A;  3S2W A;  5DCM A;  3F6O A;  2HR3 A;  2EK5 A;  4YII A;  2P5K A;  2RVC A;  3RYP A;  2LF7 A;  2EWN A;  4AIH A;  4OU0 A;  1BJA A;  3U2R A;  1IN7 A;  4XRF A;  3R0A A;  3Q5F A;  4N9I A;  4MGR A;  3SFZ A;  3P9K A;  1EH7 A;  4JBA A;  2UZK A;  3IKV A;  1MD0 A;  4XSZ F;  1PP8 F;  4RB0 A;  3ECO A;  5HDG A;  2L3D A;  2MH2 A;  5BOX A;  2CFX A;  3M9A A;  2NYX A;  1SFU A;  3R4K A;  4G6Q A;  4OMZ A;  1XGM A;  2EJR A;  1MKM A;  5HLI A;  4NB5 A;  3KET A;  3V7R A;  2GA1 A;  1MZB A;  2PN6 A;  2CWE A;  5E8G A;  2UXN A;  1KYW A;  2B0L A;  3RJP A;  2OZ6 A;  2FU4 A;  4M72 A;  1ZG1 A;  3TO9 A;  4WCG A;  3KLO A;  5CYV A;  2Z9O A;  4G6D A;  1UHM A;  4EJU A;  1R23 A;  5JR3 A;  2H94 A;  3TDZ C;  4EJO A;  2Q2E A;  4BXU A;  2LKP A;  2GQQ A;  1U8R A;  4JK1 X;  3O2P E;  4HDV A;  3VB2 A;  1XDU A;  4KA4 A;  2XRO A;  1OYI A;  1R1U A;  2MLK A;  1O7L A;  2P5V A;  4RGS A;  4LLL A;  3QPH A;  3D5L A;  3WTZ A;  4R79 A;  2K7L A;  3BZ6 A;  3DP7 A;  2QEN A;  3JW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...