1S7AA

Nmr structure of the la motif of human la protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, translation
molecule keywords Lupus La protein
total genus 18
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s7aA00
4PGHA 3I71A 4AIKA 2O8XA 1S29A 1TLHB 2NNNA 5ERIA 4ESFA 5L3GA 2PFBA 1B1BA 3JW4A 4IRGA 2YR2A 3R0JA 1FWZA 5L3EA 4I7HA 2K4BA 3R60A 1OYYA 4M72A 1B9NA 1S7OA 2OAZA 1Z7UA 1U78A 2OBPA 4WX9A 3ZQ7A 1J75A 3RDIA 3HUGA 4RGSA 2IPQX 3L09A 1MZBA 3GVAA 1K78A 4RAZA 2D1VA 1XSDA 2CO5A 2COMA 3V7SA 1IXRC 1RUOA 3HSEA 2KKOA 3F8MA 1A04A 5DDGA 5TRDA 1PP8F 2EFOA 5BMZA 1YO5C 2KIUA 1MGTA 2DQRA 4UNOA 1IW7F 3HHHA 4XLNF 4EM2A 3T5XA 3LQRA 4IHTA 2O61A 1VTNC 1HW5A 1R23A 4R1HA 2R7DA 2HZTA 5LHHA 1O3RA 4IRHA 2YX4A 4LK1F 2ESHA 3L2CA 2VBWA 2FSWA 1R36A 4M9ZA 1JHHA 1ZH5A 1T0FA 4K2EA 1Z91A 2IW5A 5JVTA 3J80K 2E1CA 4N9HA 3ZN1A 5D6FA 3GFLA 3HRMA 4G94A 5JR3A 3BWGA 1QPMA 4EGZA 3R0AA 2M87A 1FYLA 4Q47A 1J5YA 5K5QA 4I0BA 2EA4A 4GCVA 1S6LA 1W7PD 2MLKA 1BIAA 1O7LA 5E20A 3TKYA 4IVNA 3GW2A 1TW3A 4L18B 2M30A 2JZYA 2XAHA 3PQJA 3I4PA 3QPTA 3G73A 3DQVC 3ABUA 3WE2A 1OMIA 4N9IA 5E1WA 2NS0A 2HDCA 4YG2F 3E97A 2KIMA 2ETHA 2W57A 5CYVA 1HQCA 4LLLA 3DFGA 2OZUA 4LG0A 1P92A 2VE9A 5BS6A 2MH9A 3DP7A 3T8TA 5LGNA 1F5TA 3DEUA 4U88A 2Q2EA 3U9GA 2EV0A 4PDKA 3KP4A 2VBXA 3GFJA 3C18A 3DV8A 5CJ9A 4L9JA 2HGCA 2GA1A 1BN5A 3HSRA 3KP5A 5DV5A 1LEBA 1HBXG 1OPCA 2LKPA 3ULQB 3V4GA 4NHJA 4KIBA 1Q1HA 3QP6A 1B6AA 2G7UA 2IT0A 1XB4A 2IA2A 2ELHA 1MJAA 3WTVC 4BQAA 5ICEA 2WWYA 2DI3A 1W7PA 1GVJA 1IN4A 3KP6A 4Q48A 3U2RA 4LJZF 4IRIA 4P96A 2ZNYA 2H6CA 4G9YA 4A5MA 1RNLA 3J7AO 2QUFA 2UXNA 1YW8A 1FOKA 4LLNA 5LGUA 3S2WA 1J59A 4BHCA 4BAYA 1YS7A 2P6TA 1TQMA 3F8BA 2FEZA 1SD7A 4KDPA 2FBKA 3VFZA 2VXZA 4GGGA 4LGWA 4L0ZB 1W7PB 1W5SA 2R3SA 3TGNA 3T0YA 2Z5UA 3N97A 5CVUA 1TQPA 2HTSA 1PUEE 3F8CA 2GQQA 2VT2A 3T8RA 3RPUA 1V4RA 1P4WA 1XDSA 1QBJA 1BI0A 5DCFA 2O6GE 3L7WA 3TO6A 1TNTA 2HWVA 4M6XA 2DQLA 1I1SA 1JE8A 1SFUA 2A6HF 2HS5A 2RQPA 3ZMSA 5HDNA 2IRFG 5ED4A 2OQGA 3R61A 4OMYA 3FMQA 3E6DA 2FXAA 4QLCU 4JQFA 4Q5SF 3E3VA 3KZZA 4I02A 5JFRA 1W5TA 1XGMA 3WTYC 2EB7A 2Q8KA 2TDXA 2XAJA 2IP2A 1STZA 1FBSA 4P9UA 1U5TB 4EJUA 4TV7A 3EYYA 2V1UA 3MZYA 1BJAA 2A3SA 2PG4A 1MJBA 1J9IA 2P4WA 1KQ9A 2PEXA 5LGTA 5K5RA 1S7AA 2GXGA 2FA5A 2NYXA 2K02A 1IRGA 1P4XA 2DPDA 3HTUA 3COAC 2VBZA 1G3SA 3SZTA 2OD5A 4B09A 4WXDA 3KFWX 2EWNA 2NNYA 1QGPA 3LWFA 3F21A 3REOA 2RDPA 1KYWA 3NRVA 1ZRCA 2P7CB 1S3JA 1ZLJA 3IC7A 2NRAC 1WI9A 1UCRA 2L4MA 3DXJF 2VN2A 5AIPA 2EK5A 4D0PA 2PI0A 3SZPA 2EV6A 3GEZA 4O5VA 1X3UA 3KEQA 1D8KA 4EVIA 3G3ZA 2DPUA 3LAPA 3BPVA 3V7RA 3F3XA 3IRRA 3QOPA 1HW2A 3J81Z 2B0LA 1W4MA 2LF7A 2QBYB 2VONA 4U0WA 5D5UB 1FLIA 4HDUA 4MEXF 5K5OA 1BC8C 3EYIA 1LQ1A 5F1RA 2UZKA 2P5KA 3GZ6A 1R22A 2DT5A 2RGVA 4L5JA 3RPQA 5L3BA 2QENA 1FSHA 1U5TA 1YW9A 1P4AA 4HX8A 5HLHA 4KNYA 3CDHA 1H0MA 1IAWA 3PQKA 2VOPA 1JGSA 2FNAA 1YFHA 4U0YA 3FWEA 3LA3A 1ZG3A 4KN7X 1ONVA 3F22A 2P5LC 3AAFA 3ZP5A 2WTEA 4HX7A 1FBUA 1PP7U 3ZMZA 3K0LA 4M9XA 3U1DA 4NQWA 2STTA 3FXRA 3IWFA 1Z6TA 2FE3A 3BJ6A 3TDZC 4HW0A 3KE2A 3SHFA 5FLXK 4JBAA 3ZMTA 3QPHA 3HIFA 5DEQA 4MQ9F 4WWCA 3SFZA 1ZLKA 4BHPA 3ML6A 3WU1B 3NQOA 2K7LA 3ABTA 2XUBA 1R5HA 3ZMVA 5IT9K 3IL2A 3EDPA 3VEPA 4I09A 2YU3A 3LSTA 1R7JA 3KCCA 4RGUA 5HDKA 4HQEA 4CYDA 1ZRDA 5IT9Z 1WWXA 2P5VA 2RVCA 1IN5A 5AONA 1XGSA 2M5WA 3LA2A 4LMYA 4UV9A 3B73A 2D45A 4IPAA 3JAMK 4WCGA 1Y0UA 2M8EA 4LK0F 3CUOA 1OYIA 3JSOA 1TBXA 1XGOA 2E1NA 3F72A 2GXBA 1U6GA 3W6JB 2XHKA 3RTRA 2ISZA 2EV5A 5EEHA 2P8TA 3L9FA 3TDUC 2P7VB 1LDJA 4HYEA 2VT3A 4ZZLA 1LDDA 5FD6A 1K7AA 1WKMA 1EH8A 1MJ9A 1R5GA 2JPCA 4EJVA 6PAXA 3O3KA 3EUHA 4HLYA 3D0SA 1E2XA 4HF2A 3LFKA 3F6OA 1EH6A 3KLNA 1FPQA 2XIGA 3IRQA 1MD0A 2LF8A 3K9TA 5D4SA 1HXDA 2DW4A 3LA7A 3TO9A 4KMFA 4KMUX 1YW7A 5ILVA 2F2EA 3KETA 2CG4A 2DO7A 2HYGD 3BJAA 2Z9OA 2EFQA 4O6JA 3PFIA 5FFXA 4IJAA 5A2QZ 2XASA 4EM1A 5AIQA 3QU6A 1HKQA 1H9GA 5E17F 2FMYA 2UWMA 5H20A 2HKOA 3LQQA 4P55A 2CWEA 3BDDA 4AIHA 2J5OA 3GWZA 2L01A 3TO7A 5BPDA 1BI1A 4HF0A 3H3ZA 4ZYEA 3HRSA 1IXSB 3W6KB 1GXPA 2ADUA 4MNUA 1ON2A 1KU2A 1SMYF 4CO8A 1SD5A 3BP8A 4GO1A 2PQ8A 5CVRA 5FGMA 5D5VB 2PN6A 1Z9CA 2W84A 3WTTC 2GWRA 2ZKZA 4KICA 5HLGA 1O57A 2HQRA 1DPUA 2J5PA 5LLQA 5DUKA 1AOYA 2XGXA 3HTSB 1IRFA 2JT1A 5HS8A 3ISPA 1QZYA 2YSRA 4I98B 1FC3A 3MFKA 1T98A 4Q4ZF 2GZWA 3Q9SA 3CO6C 4AWXB 1KQ8A 2QVOA 2BV6A 4HA8A 3FXUA 1ODDA 1U3EM 1XD7A 2LNBA 5D8KB 2L02A 1T6SA 5LEJA 2V1DA 3I54A 1ZYRF 2ZMEB 4UV8A 3RKXA 1IUYA 4A0ZA 3P7NA 4DNCA 2O03A 1L3LA 5CVJA 1KA8A 4LD5A 4ESBA 1IN6A 2CW0F 2KRFA 2FU4A 1YS6A 2M1BA 3BZ6A 3GF2A 2FF4A 1EH7A 3MEXA 2FQ3A 4CXFA 2XROA 3V8LA 4OIRF 2H6BA 5FO5A 4HOBA 2CGPA 5HDGA 3IKTA 2FMLA 2CSOA 5D8LB 1FP1D 2H09A 2O3FA 4YFNF 5DD4A 5L3CA 1U2WA 3WGGA 4PZJA 5FB2A 4HZFA 4F7ZA 2Z3YA 1QNTA 4ENJA 3E6MA 3E5UA 3KP2A 2FNPA 4M71A 1SAXA 2A6EF 2XAGA 1BOAA 4RB3C 3ZMUA 1WRJA 2DU9A 2NAZA 4G7ZF 4P9FA 3E5XA 4A2UA 3P9CA 2W24A 2RNJA 2MC3A 2W25A 2DAOA 2VC0A 3MAJA 4UVBA 2BGCA 2HYFA 1RI7A 2PBIA 4Y13A 5F6FA 3EETA 2YPRA 1B59A 3O2PE 3QAHA 1XCVA 2EA2A 2RKHA 3WGIA 3ZPLA 1XGNA 5ICGA 4A12A 2HFHA 3FHZA 3ZN0A 4S04A 1JXSA 3WODF 1YQAA 3BOQA 1ULYA 2GIVA 3JAMZ 1OYWA 2ESNA 3IKVA 3D5LA 2ZXJA 4ZZDA 5HVQC 4H0EA 4B8XA 4FX0A 3TOBA 3HSFA 5ILUA 2A07F 4LG0B 3DF8A 4ESJA 2D2WA 3ECHA 3CO7C 2G9WA 2JSCA 1O7FA 3C1DA 1FBQA 4CGZA 2C6YA 2K86A 4OMZA 3WG9A 4XRFA 3TOAA 3K1NA 2HTJA 4HAMA 3E6CC 4OIOF 1LB2A 4G7OF 4ETSA 2UXXA 4ZYHA 1KYZA 1TW2A 4Y15A 1BBYA 2EJRA 4L9NA 5HOOA 1LEAA 3OOPA 3VOEA 2XKOA 4AD9A 2LDUA 1KGSA 2XV4S 4HQMA 1QO0D 1BI2A 5LHGA 1P6RA 1CF7A 3ECOA 4KYWA 1HKSA 4A5NA 1UFMA 2QM3A 2XVCA 5F64A 3MWMA 1HSJA 3DPTA 2H94A 4I0AA 1MKMA 4KUMA 3SQNA 2F5EA 2DK8A 1DP7P 3GO5A 1G3YA 1F1ZA 4ENKA 5E1ZB 2V79A 1YG2A 2O0YA 3RKWA 4KT5C 1FZPB 2L3DA 1XMAA 3E5QA 2ZO4A 1G3TA 2E7XA 2MLGA 3EQLF 1C0WA 1HW1A 1T39A 4XBFA 3JTHA 3M8FA 4EJTA 1UHWA 3FXQA 1USTA 4CDGA 5FLXZ 2YX7A 5EEGA 4M73A 4MGRA 1K6OA 2X0LA 2FBHA 1G3WA 4RGRA 4ZYDA 4ON0A 4OU0A 4XSZF 4ENNA 3DKWA 4HX4A 3RYPA 4BHBA 2Z99A 2IA1A 2HOEA 1RUNA 4R8HA 5D4RA 1O3SA 5CLSA 4OIPF 2JPBA 2R7FA 3BY6A 5ILSA 1Z05A 2Y48A 4UUVA 4RB0A 5ICCA 4DQ2A 1AWCA 4HV5A 5J8FA 1Z6RA 3GZ5A 3WGHA 3GFMA 4IF4A 2IJLA 1SD4A 2OU2A 1K78B 1T38A 2XAQA 3K69A 4BYYA 2W85A 3FMSA 1BIBA 4M9SA 2HR3A 1PDNC 2AXLA 5BQTA 2V6CA 3I58A 1SFEA 4MHGA 1YYVA 2QLZA 3RIRA 2RN7A 3ZMDA 2ACJA 2AS5F 4LB5A 4FX4A 3KZYA 2K27A 3HOSA 1ZARA 4R79A 4FHTA 4QWQA 2Y0MA 3GLXA 1TTYA 4A6EA 2VODA 5H6QA 4WF2A 2V9VA 3CTAA 2CYYA 3M7GA 2QZ8A 1ZRFA 4KIGA 1G6NA 1NHAA 4YFXF 3I5UA 5HS9A 3H92A 2PMUA 3FM5A 4L9TA 2HKXA 4M74A 3P9IA 3GXOA 1DPRA 4ZH4F 2HQNA 3K1PA 5LBQA 2A68F 3R4KA 2DK5A 3WE3A 1KU3A 3Q9VA 2HEOA 5E1XA 1F4KA 1HKTA 3NEUA 1LJ9A 5JI6A 3QU3A 3KEOA 1F9NA 5DYMA 1FT9A 4OIQF 4KN4X 4GYGA 3M9AA 4G7HF 2ZMEA 2DFIA 2VC1A 3I59A 1SFXA 1XN7A 4BNCA 3HRUA 2QQAA 5DCMA 2DLLA 1J0RA 4CHUA 1U8RA 2VE8A 2G7HA 2D1HA 4ENMA 2P6SA 1UHMA 1E17A 4JK1X 2QQBA 5J6XA 1FYMA 1FY7A 1KU9A 3GUDA 1G4DA 3KP3A 1WSUA 1EV7A 5BPIA 1T2KA 4RS8A 2E7WA 4KA4A 5A2QK 1R1UA 1ZGAA 4HV6A 3BPXA 2DBBA 3GFIA 2PLYA 1IN7A 3I53A 2F5CA 2XRNA 1I5ZA 1TQIA 3KLOA 2CQKA 2X4HA 2PMHA 4ZYGA 2BE5F 3F6VA 1BM9A 4PGGA 2STWA 1LNWA 4GYIA 5D6EA 3FZVA 2DTRA 1K79A 1CGPA 1Z1DA 3IHUA 2XAFA 5K1YA 3I64A 4OOIA 3KP7A 1FP2A 3ERED 4MTEA 5E8GA 2H27A 2MBFA 4U7DA 1KU7A 3WTWC 4MQVA 3OV8A 3WTZA 1BC7C 2Z33A 1FSEA 3CJNA 2ZJ2A 1ON1A 5CVIA 4A0XA 4PCQA 1ZREA 4XSXF 5J8CA 2JRTA 3CUQB 1IXCA 3N4MA 1ZHFA 4MTDA 4EGYA 2CFXA 4Z2YA 4L9VA 3MCZA 3K2ZA 1MDMB 4WK8F 4WXHA 4A0YA 4EQQA 4EMSA 2IA0A 3M8EA 3QP5A 2KJCA 1IF1A 4LFUA 2BEOA 3HYIA 4S05A 2MA3A 3L00A 5D5WB 1ZGJA 4U7BA 2KJBA 2ZNZA 1XSXA 4WXCA 5BOXA 2VOOA 1ZAOA 1YTYA 1L0OC 2RV8A 4EV0A 3GYHX 1LVAA 3J81K 2WC2A 4CICA 3CLOA 5HLIA 5JHUA 1J2XA 1ZG1A 2EFWA 4Y17A 5L3DA 1WQ2A 3FF5A 3WTSC 1I6XA 3LAJA 4BXUA 4AIJA 1I27A 2L54A 1XSVA 2BBYA 3F23A 5HS7A 2Q0OA 3ROUA 2XKPA 4NB5A 4FT8A 3HRTA 1GHCA 1OR7A 2FOKA 3Q5FA 4RB2C 3FX3A 4EJOA 1OKRA 5IT3A 5LRRA 3CUQC 3HHGA 1FNNA 1XMKA 3I59B 4KIFA 4A6DA 3R6SA 4UVAA 5LEKA 1J7KA 4L0YB 1R1VA 3O6BB 2VBYA 3BJOA 4RB1A 1R58A 3C3WA 2QQ9A 4ASNA 3SXYA 1USSA 2EFPA 2MH2A 2LSOA 3H3UA 2QWWA 2QYOA 1O3TA 1DDNA 4M6YA 5DUIA 1I1GA 5TJJA 1O3QA 4UXNA 5E18F 3FMRA 1R00A 3V8JA 1B9MA 4I01A 1IZ1A 2FRHA 1ZN2A 1D8JA 5LRSA 3C7JA 4LB6B 5DCMB 2JTVA 1ZG5A 2ZFWA 1V3FA 1CF7B 2ZBKA 1B4AA 2FBIA 4YIFA 2BYVE 2GAUA 2A5YB 3RKYA 2KIFA 2Y75A 1TNSA 1U5TC 3K1MA 2QBYA 3T1BA 5LHIA 4U0VA 3VB2A 4UVCA 2MD5A 1QQIA 2A61A 3HOTA 3CUQA 3RI4A 5KK1A 3JTGA 5FD5A 3V8KA 3P9KA 2F5DA 3WU0A 1D3YA 2GA2A 1RZ4A 4HBLA 1KQ0A 1FX7A 4YFKF 3FM3A 2M45A 3TQNA 3VODA 2OA4A 4G6DA 2WV0A 3IWZA 1DUXC 4P5OA 2L4AA 4XLPF 5D5XB 2A69F 3MZHA 3JSPA 4N0BA 5ICFA 4AVPA 3F8FA 4CZZA 1SMTA 4KFCA 1YIOA 4UHTA 1XDUA 4HF1A 3MQ0A 3I0TA 2OQRA 4G8XA 4LLGF 4BH9A 4OINF 1S8NA 1REPC 1P2FA 3WTUC 2F5FA 4IHSA 4HLXA 2ISYA 3RJPA 1GXQA 5CVVA 3ELKA 3M1EA 1IN8A 2ZCWA 4RAYA 3B02A 2V1XA 3V7CA 4GXOA 4MEYF 4YIIA 4EJWA 5L3FA 5E8IA 3GX4X 4G6QA 1D5VA 1YLFA 1MDMA 2OZ6A 1UB9A 1R1TA 2IVMA 1JHFA 2K4JA 1QZZA 4E70A 5DD8A 1RIOH 1HSTA 1FYKA 5FFZA 4L5IA 4O3MA 4RGXA 2RC4A 1LDKB 4I2OA 3BROA 3DPLC 3QRFF 4HDVA 5KVRA 3F8NA 1SD6A 4IXAA 3RYRA 4EM0B 1XCBA 5H6RA 1BI3A 3J80Z 2PJPA 1H9TA 3E6BA 3WTXC 2EFNA
chains in the Genus database with same CATH superfamily
4PGHA 3I71A 5TGTA 3O8GA 4AIKA 2O8XA 1S29A 1TLHB 2NNNA 5ERIA 3CP8A 1D1BA 1DGRM 4ESFA 3PNYA 1D0XA 4QPOA 2CV1A 5L3GA 2PFBA 1B1BA 3JW4A 4IRGA 2DYRH 2YR2A 3HOUJ 3KPHA 3R0JA 2DT6A 1FWZA 5L3EA 5EG0A 1YI2I 4I7HA 2K4BA 5HODA 3R60A 4RDUA 2CMPA 5IPAA 1P9QC 2R5YA 2KP6A 3EUHC 2IS2A 1OYYA 2BW3B 2E2HJ 4M72A 1B9NA 1S7OA 4FISA 2AO9A 2OAZA 3K2AA 3QODA 1Z7UA 2ZC2A 5K7FA 2Y0SA 2R5ZA 1U78A 4UB8C 2OBPA 2JVHA 4HRIA 3K4MA 4WX9A 3ZQ7A 2JA2A 1J75A 3RDIA 3HUGA 3S16J 4RGSA 2IPQX 3L09A 1MZBA 4BBRJ 3GVAA 1K78A 4RAZA 3WG7H 1M1EB 2D1VA 1XSDA 2CO5A 2COMA 3V7SA 1OCCH 1IXRC 4P1WA 1RUOA 3HSEA 2KKOA 3F8MA 1A04A 5DDGA 2QF7A 4J01A 5TRDA 1PP8F 3BR3A 2EFOA 5BMZA 1YO5C 3VYTB 2RAEA 4N4OB 2KIUA 4ITVA 1MGTA 4FE7A 1U9OA 2DQRA 4D7NA 3W6VA 3VPRA 2L7ZA 1YOVB 4UNOA 2LKXA 5IYDJ 2Q1ZB 2EZLA 3I55I 1IW7F 3HHHA 4XLNF 1R4MB 4EM2A 4GDFA 3T5XA 1E0EA 3LQRA 2MW8A 3JRGA 1IGNA 4YEJA 2X48A 3OS1A 1VTNC 1VQPI 1HW5A 4IHTA 2O61A 1YX5A 3KEYA 2AXTC 1R23A 4R1HA 5J3LA 2X6XA 5B66C 2R7DA 2R7UA 2HZTA 3K6GA 3N05A 4BL0B 5LHHA 2X1DA 1O3RA 4IRHA 2KMUA 2YX4A 4LOCA 1K61A 4LK1F 2ESHA 3L2CA 2E2JJ 2VBWA 3HKZN 1DGWY 2FSWA 1WI3A 1R36A 4M9ZA 1JHHA 2UV1A 1ZH5A 2ID3A 2LR8A 1T0FA 4K2EA 1Z91A 4BJ5C 1LE8B 4RLQA 2IW5A 4DOZA 1HC8A 5JVTA 3J80K 3FISA 3SYTA 2E1CA 4BY1J 4N9HA 3MN2A 3ZN1A 5D6FA 1WJ5A 5C4XJ 3GFLA 3HRMA 1N77A 1LPQA 2LBFA 2Y30A 4G94A 3CCUI 2WAEA 3OYDA 1VQ5I 5JR3A 3G6EI 3DTKA 3BWGA 3DBLB 4BY7J 1QPMA 4EGZA 3R0AA 2M87A 3JRDA 1FYLA 4MO7A 4Q47A 3UKGA 1J5YA 5K5QA 1E3OC 5HNHA 4I0BA 2EA4A 3B6CA 2KFDA 3C2BA 3HXLA 4GCVA 1S6LA 1W7PD 3CC4I 2QA4I 2MLKA 1BIAA 2JSPA 1O7LA 2KISA 4EATA 5E20A 3TKYA 3H0GJ 4IVNA 2HXOA 3GW2A 2JVGA 1YJWI 1TW3A 4L18B 1Z77A 2GOMA 3H36A 2VJIA 2M30A 2JZYA 2XAHA 3PQJA 3E0JB 1X1DA 3I4PA 1X4PA 3QPTA 4HNUA 3G73A 1TT5B 4A3FJ 3I9V2 3DQVC 3IV5A 3ABUA 3WE2A 4LITA 1RPWA 1CQTA 4E6KG 1OMIA 4N9IA 1QVTA 3H3VK 5E1WA 2NS0A 3MD2A 2HDCA 4YG2F 3E97A 2KIMA 3PSIA 1V54H 2GBYA 2ETHA 2W57A 5CYVA 1HQCA 4LLLA 1LKXA 3CDLA 2M7AA 3CC2I 3DFGA 2OZUA 4LG0A 1P92A 1VQ9I 4ZDLA 2VE9A 1GVDA 4XORA 1TL8A 5BS6A 2CQXA 2MH9A 3DP7A 3T8TA 5LGNA 1F5TA 1WJDA 3DEUA 4U88A 2Q2EA 3U9GA 2EV0A 4PDKA 4C3IJ 1GLNA 3KP4A 3PFYA 2VBXA 4PFPA 3RZDJ 3GFJA 1S5LC 3C18A 3DV8A 3H1CA 5CJ9A 1P7IA 3CMEI 1MBKA 3S1MJ 2NVUB 4A3BJ 4L9JA 1Z7LA 1TT0A 1Z0XA 2HGCA 1BW6A 2GA1A 4FQGA 1BN5A 3HSRA 1D1CA 5EZGA 2WAFA 3KP5A 5DV5A 2GM4A 1LEBA 1HBXG 1OPCA 2LKPA 3ULQB 3TEDA 2R7QA 3V4GA 2Y9ZA 4NHJA 4KIBA 3ERMA 1Q1HA 3QP6A 1B6AA 2G7UA 3AG4H 4E7IA 4A3MJ 4I99C 2IT0A 1XB4A 2IA2A 1RKWA 2CQ7A 3DPUA 2ELHA 1MJAA 1LFBA 3WTVC 5C3EJ 1IG7A 5GP9A 4BQAA 3IH4A 1WCMJ 2DMUA 3I56I 2PMZN 2HXIA 2NVXJ 5ICEA 4PJJA 2DI3A 3K4JA 2WWYA 2BW3A 1W7PA 2L7KA 1NG7A 4M6VA 3QPSA 2MYSA 1GVJA 4F91B 1IN4A 2QCOA 3KP6A 2FJ1A 2AQFA 4Q48A 1ITYA 3U2RA 4LJZF 1MBHA 4IRIA 4P96A 2ZNYA 2H6CA 4G9YA 4A5MA 1RNLA 1Z3YA 3AG2H 2JQ7A 3J7AO 3K4BA 4UUSA 1SEUA 1ETXA 4D5FA 4E7JA 3BLYA 4C2TA 2QUFA 2UXNA 1YW8A 1FOKA 1TWFJ 4LLNA 1BW5A 1Y8QB 1XTAA 3MKLA 5LGUA 2EZHA 2LFBA 3BTCA 2N8GA 3S2WA 5CQEA 2UUZA 1J59A 4BHCA 1KONA 3BZCA 4X6AJ 4BAYA 1YS7A 2P6TA 2L2OA 2H8WA 1JKPC 2HPMA 3M1CA 3HM5A 1TQMA 2IS4A 2W7NA 3F8BA 2FEZA 3D5SC 1Y0NA 4JYKA 1SD7A 3M4OJ 4KDPA 2FBKA 3VFZA 2VXZA 4GGGA 4LGWA 4L0ZB 1K83J 1W7PB 5C4JJ 1MNMC 1W5SA 1E3HA 3FKJA 2R3SA 3T0YA 3TGNA 4BE1A 1AU7A 3F9KA 2LY9A 3K4LA 3HEFA 1Y56A 2Z5UA 3ESWB 3N97A 2ZSHB 5CVUA 1TQPA 4RA2A 4B3AA 2HTSA 3JRFA 1PUEE 1TWCJ 3F0CA 3F8CA 5EG0B 2GQQA 2BXYA 2VT2A 3ZQFA 3T8RA 5H2FC 3RPUA 1V4RA 2ZJPF 1P4WA 1XDSA 1J09A 1QBJA 2R92J 1BI0A 5J1UA 5DCFA 2O6GE 2LLKA 3L7WA 1UZCA 3TO6A 5M5WJ 3NWTA 2QSGX 1TNTA 2HWVA 2F48A 4M6XA 2DQLA 1I1SA 1JE8A 1I39A 1SFUA 2A6HF 3GTOJ 3EUKL 4XM3A 4BXFA 2HS5A 2RQPA 3ZMSA 4NC6A 2Z1DA 5HDNA 3CJRB 3PO2J 2IRFG 5ED4A 1T95A 5GTHC 3M8JA 2OQGA 3R61A 3BTIA 3FMQA 4OMYA 3E6DA 1PYVA 2BY3A 2FXAA 4QLCU 4JQFA 4Q5SF 3E3VA 3KZZA 1QZEA 3BQZA 1IV8A 4I02A 5JFRA 4XICA 3ZR8X 2OPTA 1W5TA 3RQIA 1OQYA 4A3JJ 1XGMA 3WTYC 2EB7A 5M3FJ 2AQEA 1OLTA 2Q8KA 1DU0A 2EBIA 2TDXA 3FXMA 2XAJA 2IP2A 1STZA 1TWHJ 1FBSA 4P9UA 1UG2A 1IO2A 3IH2A 4XN3A 1U5TB 4EJUA 2PX9A 4TV7A 3I4NJ 3EYYA 2E34A 1VQ4I 5IOZA 2CQNA 2MD0A 5E3MA 2V1UA 4KITB 3MZYA 1BJAA 2VQGA 2A3SA 3GTJJ 3HB9A 3W2VA 1LFPA 2PG4A 3MKWB 1MJBA 3K70C 3CMAI 1J9IA 2P4WA 1KQ9A 1JJ8C 2PEXA 4CSWA 5LGTA 3CF5F 5K5RA 1MMDA 1S7AA 1U0JA 4E7LA 2GXGA 1BR4A 3K4CA 5F0CA 2FA5A 2NYXA 3MMYB 2K02A 4B43A 1IRGA 1P4XA 2CW8A 2DPDA 3HTUA 3DEWA 1X19A 4ZDPA 3COAC 2KDOA 2ZJRF 2VBZA 1G3SA 3SZTA 2OD5A 2RREA 4B09A 4WXDA 1R5ID 3KFWX 2EWNA 3S15J 5DS9A 1RKTA 2NNYA 1QGPA 4DZJA 5E3OA 3LWFA 3F21A 3REOA 2RDPA 1KYWA 1FJLA 2HOSA 3OYKA 3K7AJ 4L5EA 4QIWN 4A93J 1ETWA 1AHDP 1JKOC 3NRVA 2Q2EB 1ZRCA 2B7EA 2P7CB 3BG3A 1S3JA 4PSWA 5GAEJ 1ZLJA 3IC7A 1EF4A 2NRAC 4BKXA 2ZXIA 4XRSG 2YU9J 4G6TB 1WI9A 1H9TA 1UCRA 2L4MA 3DXJF 2VN2A 5AIPA 2EK5A 2KRHA 4D0PA 2PI0A 3SZPA 2H1LA 4DW6A 2EV6A 2Y9YA 5GADJ 2K9MA 4C2MJ 3GEZA 4NUBA 4O5VA 1X3UA 3KEQA 1A6IA 3DCFA 3GTKJ 2CQQA 3CDIA 1D8KA 1MNDA 4EVIA 4BE0A 3G3ZA 3CCJI 4OAYA 2DPUA 4D1QA 3LAPA 3BPVA 3V7RA 3F3XA 3IRRA 3GTPJ 1OFCX 2KT0A 3QOPA 1HW2A 1RESA 3J81Z 3SJMA 2B0LA 3DTIA 4DZPA 1N25A 4U87A 1W4MA 2LF7A 2HI3A 2QBYB 3CD6I 4AYBA 3ASNH 2JJ7A 4AUXA 2VONA 3CCYA 4JP0A 4U0WA 5D5UB 1R49A 1FLIA 2JK3A 4HDUA 4MEXF 1XC5A 5K5OA 4B4CA 1BC8C 3EYIA 3HKZA 3S14J 1LQ1A 2X1CA 5J4YA 5F1RA 2UZKA 2P5KA 3GZ6A 1R22A 2RQQA 2F4IA 2DT5A 3NARA 2RGVA 3LL7A 4L5JA 2OJED 5IP9J 2H1KA 4FE4A 1YIJI 3RPQA 5L3BA 2QENA 5M5YJ 1FSHA 1U5TA 1YW9A 2EIKH 4CCKA 1P4AA 2K3FA 2IGKA 1RR7A 1H88C 4HX8A 5HLHA 4KNYA 4M3FA 3BC8A 2O5RA 3CDHA 1H0MA 1IAWA 1A31A 3PQKA 2VOPA 2LOOA 1JGSA 3FK7A 1B72B 2FNAA 1X1CA 1YFHA 4XONA 5J1YA 4U0YA 4AYBN 3FWEA 5CPRB 2H8RA 3LA3A 1EA3A 1ZG3A 3CCRI 4KN7X 2X6OA 1ONVA 3F22A 5CQGA 2P5LC 3ABLH 3AAFA 3ZQCA 3FHNA 3QYEA 1RC9A 4XKCA 1AA7A 3JRBA 3ZP5A 1XX5A 2DA3A 2WTEA 4HX7A 1FBUA 1PP7U 2EZKA 1ERDA 5B1BH 3ZMZA 3K0LA 4M9XA 3U1DA 4NQWA 2STTA 1X2NA 4KJZA 1WH5A 2XPVA 3FXRA 5KCMA 3IWFA 1Z6TA 5FLMJ 3SEZA 1X58A 2FE3A 2MG4A 3BJ6A 1ETVA 3TDZC 4AM3A 1QHHD 4I6ZA 2K9NA 4HW0A 3Q0VA 4Y3OA 2IS1A 5EGOB 4XLCA 3KE2A 4BS9A 3SHFA 5FLXK 1GDTA 4JBAA 3ZMTA 2EZIA 3QPHA 3HIFA 4B1RA 2YS9A 5DEQA 2KZVA 3OYJA 4MQ9F 4WWCA 3SFZA 2LH9A 3AG1H 3J7YJ 1ZLKA 4BHPA 3ML6A 3WU1B 2MSYA 3NQOA 4IOCF 2IEKA 2K7LA 3C2HA 3S1RJ 2D5VA 1MH4A 3H0DA 3ABTA 2XUBA 5IYBJ 4PJLA 1R5HA 4A69C 3ZMVA 5IT9K 1U9NA 3IL2A 4XLEA 3EDPA 1MBEA 3VEPA 2VQLA 4I09A 2YU3A 4IL6C 3FBIB 1X1BA 4LG3A 5M5XJ 1ETOA 3LSTA 1R7JA 2F5VA 3KCCA 4E7SA 2HQ5A 4RGUA 4F55A 5HDKA 4HQEA 4CYDA 1BR1A 1ZRDA 1AKHB 1WWXA 5IT9Z 3SDGA 2K3PA 4HG2A 3CCQI 2P5VA 1BJZA 2RVCA 5IY5H 1GV5A 3TMOA 1NK3P 4KISA 3H5AA 1IN5A 5AONA 1WZ2A 3RKQA 1JUSA 1XGSA 2M5WA 2GLOA 3LA2A 3QYFA 1IJWC 4LMYA 4C3HJ 2JUCA 4XKBA 4UV9A 1I6HJ 2K9SA 3B73A 2D45A 2E36A 4IPAA 3JAMK 2F4OB 1MNEA 3OR1C 4WCGA 5F1JA 2R7TA 1Y0UA 2COBA 2M8EA 4LK0F 5HLTA 3CUOA 3ZQGA 1OYIA 3JSOA 2E5NA 1TBXA 1XGOA 2E1NA 2EILH 3F72A 2GXBA 1U6GA 2DMNA 3W6JB 2XHKA 1LVKA 1T56A 3RTRA 4XK4A 2ISZA 1V5FA 2EV5A 5EEHA 4BEHA 3KYLA 2MGQA 2P8TA 3OS2A 3L2VA 2LY2A 3FKIJ 2Y69H 3L9FA 3NAUA 3TDUC 2P7VB 1LDJA 3CESA 3DU5A 4HYEA 1XMXA 1B8IB 2DA2A 1BA5A 2VT3A 4CCJA 4ZZLA 1LDDA 5FD6A 3ZQQA 1K7AA 1WKMA 1EH8A 1MJ9A 2XRLA 1R5GA 2JPCA 1JGGA 1MSFC 2W4SA 4EJVA 1NTCA 6PAXA 5EGOA 3O3KA 3EUHA 4HLYA 3D0SA 4DYCA 2R5ZB 1E2XA 3CLQA 4HF2A 3LFKA 4RBOA 4MLOA 3F6OA 1EH6A 3KLNA 1FPQA 2XIGA 2BVMA 5IP6A 3IRQA 1JKQC 1MD0A 2DA4A 2LF8A 2NXNB 2ME0A 5LFAA 3K9TA 5D4SA 3S1NJ 1HXDA 4BACA 2DW4A 3PUFA 1V5EA 3LA7A 2V9KA 4BQNA 3TO9A 4KMFA 2ZXHA 3U1KA 3MKZA 2B9SA 4KMUX 4E4HA 4ZJZA 1YW7A 5ILVA 2F2EA 5B5EC 3KETA 3S3MA 2CG4A 1FMVA 2DO7A 2HYGD 3BJAA 3HGYA 4MIMA 3K4NA 2EFQA 3HL2A 4E7HA 1ETYA 1VQLI 1TWGJ 2DXIA 2Z9OA 4O6JA 3W3CA 4IHYA 3Q0UA 3PFIA 5FFXA 2DT7B 4IJAA 5A2QZ 2XASA 4EM1A 5AIQA 3WHBA 3QU6A 1HKQA 3U21A 1H9GA 5E3NA 5E17F 2FMYA 3PNVA 3OY9A 3BR0A 1RETA 2UWMA 5H20A 2HKOA 5EJCA 2X6YA 3LQQA 2CWEA 4P55A 3BDDA 2JUGA 4AIHA 3VSLA 2J5OA 3GWZA 2L01A 4QSHA 3TO7A 2R7SA 5BPDA 4XOTA 1BI1A 4HF0A 3H3ZA 4ZYEA 3HRSA 2V1NA 1IXSB 1UHSA 2CFOA 2VASA 3W6KB 3HPGA 1GXPA 2QKLB 3FBNB 2ADUA 1VQ8I 4MNUA 3BQYA 2DA6A 1ON2A 1T0FC 2WADA 3G1LA 1KU2A 1UELB 3D1NI 1SMYF 4CO8A 5CKTA 4RLFA 4NQWB 3Q3SA 3HOXJ 1SD5A 2R7WA 3MVPA 3BP8A 2CV0A 4GO1A 3DBRB 1QHGA 2DMQA 2PQ8A 5CVRA 5FGMA 2LTPA 5D5VB 3OSFA 4ZTJA 1DU6A 2PN6A 4RM2A 1X3ZB 4RAFA 1Z9CA 1X2MA 1K6YA 2W84A 3WTTC 2VL8A 1X3WB 2GWRA 2ZKZA 1VQKI 4KICA 3UNGC 5HLGA 3OYGA 1O57A 5J40A 5EDNA 3X2QH 1ZKGA 1BOBA 4IQJA 3ZQHA 2HQRA 4ZTFA 1DPUA 2J5PA 4M3BA 1V55H 3PL8A 5LLQA 5DUKA 2L9RA 1AOYA 2XGXA 1JUPA 1HCRA 2VKHA 3HTSB 2XF6A 1IRFA 2CS3A 2JT1A 1B72A 5HS8A 2DCEA 3SDBA 3ISPA 2M3AA 2XB5A 1QZYA 1XG1A 2M9HA 2YSRA 1YITI 4I98B 1FC3A 3MFKA 1PVEA 2HU9A 1T98A 2CW7A 4Q4ZF 2OTJI 1Z67A 3ASOH 2GZWA 3Q9SA 5EF6A 3CO6C 4AWXB 2DMTA 1KQ8A 1G8XA 3BG9A 2QVOA 1A5JA 2BV6A 4HA8A 3FXUA 1ODDA 1U3EM 1XD7A 3QOEA 1SAUA 2WB1N 2LNBA 5D8KB 2JRMA 2L02A 1T6SA 3BTJA 5LEJA 2V1DA 3I54A 3ZOBA 1ZYRF 2VXDA 2ICWG 2ZMEB 4UV8A 3RKXA 3IAS2 1IUYA 5TISC 5B3SH 4A0ZA 4HPQA 3GTQJ 1G59A 4BDYA 4DBRA 3P7NA 1F36A 1JKRC 4DNCA 5B1AH 2O03A 3KX2A 4QTRA 1L3LA 2LVSA 5CVJA 1JTYA 4CH7A 1GUUA 4DIQA 1E3PA 1KA8A 2L5QA 4LD5A 2VQHA 3OYBA 3H35A 2GOXB 4ESBA 1IN6A 2CW0F 2KRFA 2FU4A 3PIPF 4UY8I 1YS6A 2M1BA 3BZ6A 3KYDB 3GF2A 4XIDA 2FF4A 1EH7A 3MEXA 3AL0B 2FQ3A 4CXFA 4JX5A 2XROA 4J19A 3V8LA 2L7MP 4OIRF 3V42A 4A3CJ 2H6BA 5FO5A 4HOBA 2CGPA 5HDGA 1AKHA 1QA6A 3IKTA 2FMLA 2CSOA 5D8LB 2ZJQF 2HPIA 1Z3XA 3IUOA 1VI0A 1FP1D 2H09A 2O3FA 2DOFA 4YFNF 5DD4A 3FK6A 3FXKA 4IOAF 3ABKH 2HQAA 2KL4A 5L3CA 3OIPA 3LFUA 1U2WA 3WGGA 1WVRA 4PZJA 5FB2A 2NVTJ 4HZFA 4F7ZA 1WJEA 2Z3YA 4BJ6C 1QNTA 4EEFG 3CMYA 4ENJA 3E6MA 3E5UA 3KP2A 2M8GX 1WJCA 2FNPA 1ZTRA 1APLC 4M71A 2F6CA 1SAXA 1W36C 2A6EF 2XAGA 1BOAA 4RB3C 2DTZA 3ZMUA 4DJAA 1WRJA 2DU9A 2NAZA 2R7OA 5HNFA 3S17J 4G7ZF 4P9FA 2JA7J 3E5XA 2B63J 3JRCA 2PJRA 4XLHA 4A2UA 3S3OA 3P9CA 4JOMA 2W24A 3A0HC 2RNJA 2MC3A 3LSGA 2M0CA 4B48A 2W25A 2DAOA 2VC0A 5GPCA 2LG4A 3MAJA 4Y7NJ 3QWLA 4F92B 3OL4A 4UVBA 2BGCA 2HYFA 1RI7A 2PBIA 3ABMH 4Y13A 5F6FA 3EETA 4NNJA 3HC7A 4F93B 2YPRA 3OYIA 2Z16A 3P5JA 2KPMA 1B59A 2JWTA 3O2PE 3QAHA 1XCVA 2EA2A 2RKHA 3WGIA 3OWTA 3SZGA 1XGNA 3ZPLA 5ICGA 2QGUA 4ZYAA 4A12A 2HFHA 3FHZA 3ZN0A 1VNDA 4S04A 3WODF 3GCMA 1OCZH 3Q0WA 1IC8A 1JXSA 1YQAA 4CA0A 3S3NA 3BOQA 2HOAA 1VQ6I 3NWSA 4NC7A 4AVZA 1ULYA 1HF0A 4CYCA 2GIVA 3JAMZ 2E35A 1OYWA 3BR6A 2ESNA 2ECBA 3HGGA 2DOAA 1O4XA 3PIOF 3GZNB 3IKVA 3D5LA 1K4SA 2ZXJA 4JX4A 2Y0SN 3K70D 2DJIA 4ZZDA 5HVQC 1N78A 4H0EA 4B8XA 4FX0A 3TOBA 3HSFA 5ILUA 2A07F 2GIZA 4LG0B 2Y31A 1ORKA 3DF8A 4ESJA 2D2WA 5E79C 2EINH 2OTLI 3ECHA 3CO7C 2G9WA 2JSCA 2HZDA 1O7FA 3C1DA 1FBQA 3ZGKA 3HG9A 4CGZA 2C6YA 2VPLA 2K86A 3IH3A 4F52A 3A2KA 4OMZA 3WG9A 4XRFA 3E7LA 1W0UA 3TOAA 3K1NA 2VJ4A 1YE9A 4YIRX 2QSFX 4IHXA 2M34A 2HTJA 5FKNA 2K40A 4HAMA 2HNHA 1OCTC 3E6CC 4OIOF 1LB2A 2L9VA 4G7OF 4ETSA 2UXXA 1K4TA 2A5WA 4ZYHA 2BY0A 2R5YB 4XR6A 1KYZA 4PJMA 3TP0A 1TW2A 2X9DA 4Y15A 5KAIC 1BBYA 2EJRA 4L9NA 5GAHJ 5HOOA 1LEAA 2V4JC 1W1WE 2WY7Q 3H9GA 4CUGA 3LSKA 1WHUA 3OOPA 3VOEA 1QRYA 2XKOA 3GTGJ 5M3MJ 4AD9A 2LDUA 3M07A 4Y4RA 3IAM2 2IGNA 2GXAA 2KLOA 4PJ0C 2MC4A 1X4OA 5FRMA 4XMYA 4HSTA 1KGSA 2XPWA 2XV4S 1UAAA 3LSPA 4HQMA 1QO0D 1BI2A 1JJ6C 3BR1A 3CQZJ 1HOMA 5LHGA 1P6RA 1EKEA 3OIOA 1CF7A 3ECOA 1JUMA 4KYWA 1HKSA 4A5NA 2XGDA 2I8DA 1MBJA 1SVLA 1UFMA 2QM3A 2XVCA 4LIVA 1Y6IA 5F64A 2XAUA 3ZXSA 3ZCOA 3BT9A 1I50J 3LSMA 3MWMA 1HSJA 4BJTA 3DPTA 1F43A 1X1PA 2H94A 1DQUA 3O8HA 4I0AA 1MKMA 4AC0A 3BG5A 2I5UA 4KUMA 3SQNA 2F5EA 2DK8A 1LUJB 1DP7P 2NVYJ 3GO5A 3PJRA 1G3YA 1W0TA 2JN6A 3LSRA 2LRDA 1F1ZA 4ENKA 5E1ZB 4A3LJ 2XGCA 2V79A 4XQFA 1YG2A 2ID6A 3J7ZI 2LP0A 2O0YA 2TRTA 5FJ8J 3OYCA 3HOYJ 1WH7A 2LD5A 2WAQN 3RKWA 2VPRA 3EPZA 4KT5C 2XPUA 4IX7A 2OV7A 1FZPB 2L3DA 1XMAA 3E5QA 3ZQIA 2ZO4A 4UUTA 4FCYA 4V19K 1G3TA 1A36A 2E7XA 2MLGA 5J1RA 3EQLF 1H8AC 1C0WA 2M4GA 3OYNA 1HW1A 3VDXA 1T39A 4XBFA 2VIXA 3JTHA 4A3IJ 3M8FA 3TW7A 4HSRA 4GRIA 2IXSA 1UHWA 3CZ6A 3DWLE 3VYSB 4EJTA 3FXQA 3K4KA 1H89C 3GLLA 1USTA 2X51A 1FIAA 3CMMA 4IEJA 2EQRA 4CDGA 5FLXZ 2IGMA 3L2RA 1MBFA 3GMEA 4OAZA 1W36D 3VSKA 2YX7A 2YUSA 3QPLA 4BQOA 1YRNA 2VKEA 5EEGA 4M73A 1MBGA 2KIQA 4MGRA 1K6OA 2X0LA 2FBHA 1G3WA 4RGRA 5FLVA 2R93J 4ZYDA 4ON0A 4OU0A 2L7FP 4XSZF 1GV2A 4ENNA 4F3QA 3DKWA 4HX4A 4V2FA 3RYPA 4BHBA 3EUAA 5LD2C 2JA6J 3C2GA 1W5CC 3ZQLA 1NG6A 2Z99A 3MKYB 2IA1A 1ETKA 2HOEA 2OCEA 1FOWA 1JT0A 2K9QA 4YELA 4CCMA 1RUNA 4R8HA 2E2IJ 5D4RA 3CCMI 4N4NB 2X6WA 1O3SA 5CLSA 4OIPF 1ZELA 1POGA 2JPBA 5FKMA 2R7FA 3BY6A 5ILSA 1Z05A 2Y48A 2KRCA 4UUVA 4RB0A 5ICCA 2LYCA 4DQ2A 1AWCA 3CCLI 3RPUD 4Z6YA 3S32A 4H4KC 1Y8RB 4HV5A 5J8FA 4IKFA 1Z6RA 2A05A 4LIUA 5KHDA 3GZ5A 3WGHA 2PMZA 3GFMA 4IF4A 2IJLA 1SD4A 2OU2A 1VFCA 3CC7I 2L9SA 1K78B 1T33A 2QKMB 2XAQA 3K69A 5J47A 1T38A 4XOPA 4BYYA 2W85A 3FMSA 1BIBA 2EPFA 1IDZA 1MMNA 4NC8A 4BUPA 2DYSH 4M9SA 5FKOA 2HR3A 2O9LA 2DJNA 1PDNC 2AXLA 5BQTA 4II3A 3BCBA 2O7OA 2NS7A 1XS9A 2IBDA 3CP2A 2BY1A 1JTXA 5F0HA 2LREA 2V6CA 1IRZA 1FEXA 3I58A 2DDAA 3D5RC 2ELJA 1SFEA 4MHGA 1FTTA 4HEA2 4X0GA 2QLZA 3RIRA 3S93A 1OCOH 2RN7A 3ZMDA 2ACJA 2AS5F 2WB1A 4LB5A 5DTDA 4CZCA 1WJAA 4FETA 4FX4A 3KZYA 2K27A 4BDZA 2M0MA 4OWRB 3HOSA 1ZARA 4R79A 3L2WA 4FHTA 4QWQA 2Y0MA 3GLXA 1TTYA 1Y39A 1ACIA 4A6EA 2VODA 5H6QA 2HDDA 3TBIA 3OIQA 3CCSI 2DFHA 3I3LA 4WF2A 5FROA 1G2HA 2V9VA 3CTAA 2CYYA 2JMWA 4D7MA 3M7GA 2QZ8A 1ZRFA 4KIGA 3LSHA 1G6NA 4FASD 4ABZA 1FTZA 1FIPA 1NHAA 4YFXF 3I5UA 5HS9A 3LSJA 4UB6C 3H92A 2PMUA 3KYCB 3FM5A 4L9TA 2HKXA 3L2QA 4M74A 3P9IA 4IQ4A 3GXOA 1DPRA 4ZH4F 2HQNA 3K1PA 5LBQA 3TP3A 2HYJA 2A68F 3R4KA 3JRAA 2DK5A 2DMPA 2K9LA 3WE3A 1KU3A 3Q9VA 3OYAA 2HEOA 3PUBA 1R6RA 5IYCJ 4B44A 2OF7A 5E1XA 1F4KA 1HKTA 3NEUA 3H5RA 2W48A 1LJ9A 2NOGA 2CU7A 2HVSA 1S7EA 4C9YA 3G4SI 1ZQ3P 3LMMA 4CCOA 5JI6A 3QU3A 3KEOA 1F9NA 3DU6A 5DYMA 1FT9A 4OIQF 3PM1A 4KN4X 2ZXWH 1HA8A 4GYGA 2ZSIB 3WHCA 4IO9F 4HNVA 3OYFA 3M9AA 4G7HF 2ZMEA 4A3DJ 2DFIA 2VC1A 4XRMA 3I59A 2DODA 3BCAA 1SFXA 1XN7A 2ELKA 3A1YA 4BNCA 5JLXA 1S72I 3HRUA 4D9JA 2QQAA 4DGWB 3RSNA 1MH3A 2CUJA 1EJ9A 1YJNI 2CUZA 5DCMA 2DLLA 1Q1VA 1J0RA 4CHUA 2FQ4A 1U8RA 1IDYA 2VE8A 2NVQJ 5GPAA 3TL4X 3DBHB 2G7HA 1SVOA 4W97A 2D1HA 2QEXI 1ENHA 4ENMA 4DYRA 2P6SA 1TWAJ 1UHMA 2W00A 2E60A 4XLFA 1E17A 1YRNB 4JK1X 2P0WA 2HDWA 2QQBA 5J6XA 1MMAA 3DTEA 2OC6A 4FTHA 3VYUB 3S2DJ 1R71A 1FYMA 1FY7A 4IHWA 2XSDC 2MABA 1KU9A 2V9PA 3L2UA 3GUDA 1G4DA 3KP3A 1WSUA 2Z2SB 1EV7A 3AL0C 5BPIA 1T2KA 4RS8A 1VQNI 2E7WA 2E19A 4KA4A 1D0ZA 1R1UA 2R4GA 5A2QK 1ZGAA 4HV6A 1KZHA 3BPXA 3BG7A 2DBBA 3DKXA 3GFIA 1PUFA 2PLYA 1IN7A 3OL3A 3HZJA 4AIDA 1ETQA 3BZKA 2VKDA 5GAGJ 3I53A 2L0KA 2F5CA 2XRNA 1I5ZA 1TQIA 3IP4B 5KAFC 3KLOA 1N75A 4J00A 1SVMA 1YJ9I 2CQKA 2X4HA 3OS0A 2PMHA 4ZYGA 2BVLA 3OSGA 1R4NB 2BE5F 3F6VA 1NH3A 1SFKA 1BM9A 3G71I 2XF7A 3RZOJ 4PGGA 2STWA 1LNWA 2ECCA 3B6AA 2R7ZJ 1LFUP 4GYIA 3PO3J 3OR2C 5D6EA 3FZVA 1FOYA 4IZZA 2DTRA 1U8BA 1K79A 1CGPA 1Z1DA 3IHUA 2DA1A 2XAFA 4M3GA 2X1EA 5K1YA 3FDYA 1XPXA 3I64A 4X1EA 9ANTA 2KQRA 5E3LA 4OOIA 2ZB9A 3KP7A 1FP2A 3ERED 4XKVA 4MFEA 4MTEA 5E8GA 2VJJA 1SFOJ 2H27A 1LE8A 1FOXA 2MBFA 1WGXA 3A0BC 2WV1A 5FKLA 1OCPA 2CJJA 2ZMEC 1D0YA 2DFFA 4U7DA 1KU7A 2NOJB 1A35A 1BR2A 3A02A 3WTWC 2NS8A 4MQVA 3OV8A 4XLAA 3LOCA 3WTZA 4YRVA 2LK2A 4UUSB 1BC7C 4ANJA 2Z33A 3DLAA 2W82A 1FSEA 3CJNA 3KZIC 2ZJ2A 1ON1A 5CVIA 4A0XA 4PCQA 1ZREA 4XSXF 3CJQB 5J8CA 1MSEC 2JRTA 3CUQB 4RM3A 2R0QC 1IXCA 3JRIA 3N4MA 1ZHFA 4MTDA 1TP4A 4BU2A 3HJEA 1Z21A 2E1MB 1HLVA 4EGYA 2FX0A 4A3KJ 2CFXA 2QQ8A 4Z2YA 2IS6A 4L9VA 4BGDA 3MCZA 5K7HA 1GT0C 2F4MB 3K2ZA 5DM7F 1MDMB 1B8IA 4WK8F 2VLAA 4WXHA 2EH3A 2CH0A 4A0YA 4EQQA 3SFIA 4EMSA 4RAGA 2IA0A 4HNTA 3M8EA 4NBQA 1WFXA 3QP5A 2KJCA 1IF1A 2LY1A 2JA8J 1IRXA 1PJRA 2VKVA 2BEOA 3HYIA 3JCUC 4LFUA 4BEHB 3L1PA 3G1MA 4S05A 2MA3A 1T08B 5JVGF 3L00A 1VQMI 5D5WB 1ZGJA 3FXOA 4U7BA 2PJRB 2KJBA 5EYRA 3JREA 2ZNZA 4E7ZA 1XSXA 4WXCA 2V7FA 2ZFUA 4NDLA 5BOXA 4C3JJ 2VOOA 1ZAOA 1YTYA 3FIWA 4BXXJ 1L0OC 5FRNA 2LMDA 2RV8A 4BE2A 2W1OA 4C30A 3UR3C 3I4MJ 4EV0A 3GYHX 1QPIA 1LVAA 2CV2A 3J81K 2WC2A 3CCEI 2KHMA 4CICA 3CLOA 5HLIA 2WAQA 5JHUA 3AKZA 1J2XA 3VYRB 3AG3H 1ZG1A 2EFWA 4Y17A 2DDBA 1T8IA 5L3DA 1WQ2A 2BHZA 3S8PA 3OYEA 3FF5A 1UG0A 3GTLJ 3WTSC 1I6XA 3LAJA 4BXUA 4AIJA 1I27A 4PFOA 4PK4A 4BBSJ 2L54A 4ZDOA 3GBGA 3ZRGA 5F08A 3SEQA 1XSVA 2FUG2 5F0FA 2A6TA 3HOWJ 2BBYA 3KIOA 3F23A 2TCTA 2XC7A 5HS7A 1VF9A 1RRJA 2Q0OA 2XSJC 5JHFA 3ROUA 2JA5J 1TZLA 1Y1WJ 2XKPA 3OMYA 2BY2A 3AFHA 4NB5A 4FT8A 3HRTA 3DKYA 1OCRH 1GHCA 2DN0A 1OR7A 3DEEA 2EIJH 1R9TJ 1WJBA 4XNFA 1IV6A 1ZK8A 4M3DA 5KNLA 2HOTA 2FOKA 3Q5FA 4RB2C 5EZHA 3FX3A 2XF5A 4EJOA 1OKRA 5IT3A 1SC7A 2BOLA 5LRRA 4C2UA 3CUQC 5BNGA 2XB0X 3E1SA 3HHGA 2IAIA 1FNNA 3MZ8A 4B3XA 1XMKA 2M4KA 3I59B 4KIFA 4A6DA 3R6SA 4UVAA 2WY8Q 2XGEA 5LEKA 1J7KA 3H5NA 4L0YB 1R1VA 3O6BB 2VBYA 3BJOA 3BR5A 2VB6A 4RB1A 1R58A 3C3WA 2QQ9A 4ASNA 4KT6A 3SXYA 1USSA 1SANA 2EFPA 2MH2A 2LSOA 3H3UA 2K5CA 5IOYA 2QWWA 4Y52J 5IP7J 3HDDA 2FOWA 2QYOA 1O3TA 1DDNA 4M6YA 5DUIA 4D5CA 1I1GA 5TJJA 3G2BA 2ME6A 4CCNA 1O3QA 4UXNA 2M2EA 5E18F 4ZC3A 3FMRA 3TW6A 2MFZA 4XKWA 1R00A 3V8JA 4MFDA 2VUMJ 1B9MA 5GTIC 4I01A 3OYHA 1IZ1A 2FRHA 1MMSA 2HVQA 4AU7A 1ZN2A 3HOVJ 4JX6A 1D8JA 5LRSA 2L9NA 2RNGA 3C7JA 4LB6B 4CYCB 5FKKA 1YX3A 5DCMB 5F27A 1DP3A 2JTVA 1ZG5A 2V26A 1NK2P 3W2AA 3WU2C 2BHYA 2Y2ZA 3HBLA 4QPQA 1I3QJ 2ZFWA 3G1OA 3JRHA 1V3FA 2R7VA 1CF7B 2BZTA 2ZBKA 1B4AA 3K10A 2LKSA 2FBIA 4YIFA 2BYVE 2R7XA 1V5GA 3S1QJ 2QSHX 2GAUA 2A5YB 3H9JA 3RKYA 3FXJA 2P81A 2KIFA 1OR7C 2AHQA 2Y75A 1ZR2A 1TNSA 2CUEA 4BQQA 1U5TC 3K1MA 2QBYA 1S9HA 3T1BA 5LHIA 1HDDC 4PSXA 4U0VA 4PUSA 3VB2A 4UVCA 3OYMA 2MD5A 1QQIA 4S0HB 3OOUA 2A61A 4GFBA 2DA5A 1PUFB 3HOTA 3CUQA 2BXZA 3RI4A 1IUFA 5KK1A 3JTGA 3DLLF 5FD5A 2K85A 4V2GA 3V8KA 4A3GJ 3P9KA 3QYBA 2V6EA 2DOEA 2F5DA 3WU0A 1VQ7I 1JI8A 1D3YA 2GA2A 2DA7A 1RZ4A 1OJLA 4HBLA 4B47A 1KQ0A 1TC3C 1FX7A 4YFKF 5J4VA 1MW7A 3FM3A 2M45A 3TQNA 3A01A 3CJTB 4II2A 3VODA 3CCVI 2VI6A 4A3EJ 2OA4A 4G6DA 2X85A 2WV0A 3OYLA 3IWZA 2E5ZA 1MMGA 1DUXC 1I3AA 4XN0A 2E1OA 3FXLA 4P5OA 2L4AA 4XLPF 2I10A 3S2HJ 5D5XB 3HPHA 2EIMH 3BTLA 2HVRA 1OISA 2FD5A 3QQAA 1WPKA 2A69F 4XRSA 3MZHA 3JSPA 1YHQI 4N0BA 1A6QA 2XDVA 5ICFA 3F8FA 4AVPA 1ZR4A 3CF2A 1VZ0A 4CZZA 3RCOA 1SMTA 4KFCA 1YIOA 4CCLA 2E71A 4UHTA 1XDUA 3W2WA 4HF1A 3MQ0A 2DFEA 3HUGB 3I0TA 1FMWA 4PJNA 2OQRA 5JLWA 4G8XA 4LLGF 4BH9A 3HOZJ 4OINF 4RMNA 1JT6A 1RR8C 2WBMA 2OCCH 1S8NA 4I76A 1REPC 3GTMJ 1P2FA 3WTUC 3LNQA 2IGOA 3RQ4A 2F5FA 3LSIA 1D1AA 4G12A 4IHSA 4HLXA 3BG6A 2ISYA 3RJPA 1GXQA 3A01B 5CVVA 3ELKA 2KZGA 3M1EA 1IN8A 4DYQA 2ZCWA 4RAYA 1UJ8A 3B02A 2V1XA 3V7CA 1ZGWA 4GXOA 4XL9A 3M3YJ 3PNTA 4MEYF 4YIIA 4EJWA 5L3FA 5E8IA 3GX4X 4G6QA 1D5VA 1YLFA 4E7KA 5C44J 1MDMA 2OZ6A 1UB9A 4W1UA 1R1TA 2IVMA 1JHFA 2K4JA 5EEAA 5DM6F 2WA0A 1QZZA 4E70A 5DD8A 1RIOH 1HSTA 3H9QA 1Y1VJ 2VJ5A 1FYKA 3A03A 1BL0A 5FFZA 4L5IA 4O3MA 1P7JA 4RGXA 4DBQA 4IHVA 1QU3A 2CUFA 2RC4A 1LDKB 4Y33A 1D5YA 4I2OA 3BROA 3DPLC 3ONQA 2OUMA 3A4CA 2LBFB 3QRFF 4HDVA 3VWBA 5KVRA 3PSFA 1HDPA 1QVUA 1MIJA 2CRGA 3F8NA 2E1MC 1SD6A 3BR2A 3JR9A 1WJFA 5F04A 5K7ZA 2LC2A 3J7AY 4IXAA 3RYRA 2KDZA 2VQCA 4EM0B 1XCBA 2O8KA 1UMQA 5H6RA 1BI3A 3J80Z 2G0EA 1VQOI 2R7RA 4M3EA 1X1AA 2PJPA 1YYVA 3E6BA 3WTXC 2M7BA 2EFNA
chains in the Genus database with same CATH topology
4PGHA 3I71A 4AIKA 2O8XA 1S29A 1TLHB 2NNNA 5ERIA 4ESFA 5L3GA 2PFBA 1B1BA 3JW4A 4IRGA 2YR2A 3R0JA 1FWZA 5L3EA 4I7HA 2K4BA 3R60A 1OYYA 4M72A 1B9NA 1S7OA 2OAZA 1Z7UA 1U78A 2OBPA 4WX9A 3ZQ7A 1J75A 3RDIA 3HUGA 4RGSA 2IPQX 3L09A 1MZBA 3GVAA 1K78A 4RAZA 2D1VA 1XSDA 2CO5A 2COMA 3V7SA 1IXRC 1RUOA 3HSEA 2KKOA 3F8MA 1A04A 5DDGA 5TRDA 1PP8F 2EFOA 5BMZA 1YO5C 2KIUA 1MGTA 2DQRA 4UNOA 1IW7F 3HHHA 4XLNF 4EM2A 3T5XA 3LQRA 4IHTA 2O61A 1VTNC 1HW5A 1R23A 4R1HA 2R7DA 2HZTA 5LHHA 1O3RA 4IRHA 2YX4A 4LK1F 2ESHA 3L2CA 2VBWA 2FSWA 1R36A 4M9ZA 1JHHA 1ZH5A 1T0FA 4K2EA 1Z91A 2IW5A 5JVTA 3J80K 2E1CA 4N9HA 3ZN1A 5D6FA 3GFLA 3HRMA 4G94A 5JR3A 3BWGA 1QPMA 4EGZA 3R0AA 2M87A 1FYLA 4Q47A 1J5YA 5K5QA 4I0BA 2EA4A 4GCVA 1S6LA 1W7PD 2MLKA 1BIAA 1O7LA 5E20A 3TKYA 4IVNA 3GW2A 1TW3A 4L18B 2M30A 2JZYA 2XAHA 3PQJA 3I4PA 3QPTA 3G73A 3DQVC 3ABUA 3WE2A 1OMIA 4N9IA 5E1WA 2NS0A 2HDCA 4YG2F 3E97A 2KIMA 2ETHA 2W57A 5CYVA 1HQCA 4LLLA 3DFGA 2OZUA 4LG0A 1P92A 2VE9A 5BS6A 2MH9A 3DP7A 3T8TA 5LGNA 1F5TA 3DEUA 4U88A 2Q2EA 3U9GA 2EV0A 4PDKA 3KP4A 2VBXA 3GFJA 3C18A 3DV8A 5CJ9A 4L9JA 2HGCA 2GA1A 1BN5A 3HSRA 3KP5A 5DV5A 1LEBA 1HBXG 1OPCA 2LKPA 3ULQB 3V4GA 4NHJA 4KIBA 1Q1HA 3QP6A 1B6AA 2G7UA 2IT0A 1XB4A 2IA2A 2ELHA 1MJAA 3WTVC 4BQAA 5ICEA 2WWYA 2DI3A 1W7PA 1GVJA 1IN4A 3KP6A 4Q48A 3U2RA 4LJZF 4IRIA 4P96A 2ZNYA 2H6CA 4G9YA 4A5MA 1RNLA 3J7AO 2QUFA 2UXNA 1YW8A 1FOKA 4LLNA 5LGUA 3S2WA 1J59A 4BHCA 4BAYA 1YS7A 2P6TA 1TQMA 3F8BA 2FEZA 1SD7A 4KDPA 2FBKA 3VFZA 2VXZA 4GGGA 4LGWA 4L0ZB 1W7PB 1W5SA 2R3SA 3TGNA 3T0YA 2Z5UA 3N97A 5CVUA 1TQPA 2HTSA 1PUEE 3F8CA 2GQQA 2VT2A 3T8RA 3RPUA 1V4RA 1P4WA 1XDSA 1QBJA 1BI0A 5DCFA 2O6GE 3L7WA 3TO6A 1TNTA 2HWVA 4M6XA 2DQLA 1I1SA 1JE8A 1SFUA 2A6HF 2HS5A 2RQPA 3ZMSA 5HDNA 2IRFG 5ED4A 2OQGA 3R61A 4OMYA 3FMQA 3E6DA 2FXAA 4QLCU 4JQFA 4Q5SF 3E3VA 3KZZA 4I02A 5JFRA 1W5TA 1XGMA 3WTYC 2EB7A 2Q8KA 2TDXA 2XAJA 2IP2A 1STZA 1FBSA 4P9UA 1U5TB 4EJUA 4TV7A 3EYYA 2V1UA 3MZYA 1BJAA 2A3SA 2PG4A 1MJBA 1J9IA 2P4WA 1KQ9A 2PEXA 5LGTA 5K5RA 1S7AA 2GXGA 2FA5A 2NYXA 2K02A 1IRGA 1P4XA 2DPDA 3HTUA 3COAC 2VBZA 1G3SA 3SZTA 2OD5A 4B09A 4WXDA 3KFWX 2EWNA 2NNYA 1QGPA 3LWFA 3F21A 3REOA 2RDPA 1KYWA 3NRVA 1ZRCA 2P7CB 1S3JA 1ZLJA 3IC7A 2NRAC 1WI9A 1UCRA 2L4MA 3DXJF 2VN2A 5AIPA 2EK5A 4D0PA 2PI0A 3SZPA 2EV6A 3GEZA 4O5VA 1X3UA 3KEQA 1D8KA 4EVIA 3G3ZA 2DPUA 3LAPA 3BPVA 3V7RA 3F3XA 3IRRA 3QOPA 1HW2A 3J81Z 2B0LA 1W4MA 2LF7A 2QBYB 2VONA 4U0WA 5D5UB 1FLIA 4HDUA 4MEXF 5K5OA 1BC8C 3EYIA 1LQ1A 5F1RA 2UZKA 2P5KA 3GZ6A 1R22A 2DT5A 2RGVA 4L5JA 3RPQA 5L3BA 2QENA 1FSHA 1U5TA 1YW9A 1P4AA 4HX8A 5HLHA 4KNYA 3CDHA 1H0MA 1IAWA 3PQKA 2VOPA 1JGSA 2FNAA 1YFHA 4U0YA 3FWEA 3LA3A 1ZG3A 4KN7X 1ONVA 3F22A 2P5LC 3AAFA 3ZP5A 2WTEA 4HX7A 1FBUA 1PP7U 3ZMZA 3K0LA 4M9XA 3U1DA 4NQWA 2STTA 3FXRA 3IWFA 1Z6TA 2FE3A 3BJ6A 3TDZC 4HW0A 3KE2A 3SHFA 5FLXK 4JBAA 3ZMTA 3QPHA 3HIFA 5DEQA 4MQ9F 4WWCA 3SFZA 1ZLKA 4BHPA 3ML6A 3WU1B 3NQOA 2K7LA 3ABTA 2XUBA 1R5HA 3ZMVA 5IT9K 3IL2A 3EDPA 3VEPA 4I09A 2YU3A 3LSTA 1R7JA 3KCCA 4RGUA 5HDKA 4HQEA 4CYDA 1ZRDA 5IT9Z 1WWXA 2P5VA 2RVCA 1IN5A 5AONA 1XGSA 2M5WA 3LA2A 4LMYA 4UV9A 3B73A 2D45A 4IPAA 3JAMK 4WCGA 1Y0UA 2M8EA 4LK0F 3CUOA 1OYIA 3JSOA 1TBXA 1XGOA 2E1NA 3F72A 2GXBA 1U6GA 3W6JB 2XHKA 3RTRA 2ISZA 2EV5A 5EEHA 2P8TA 3L9FA 3TDUC 2P7VB 1LDJA 4HYEA 2VT3A 4ZZLA 1LDDA 5FD6A 1K7AA 1WKMA 1EH8A 1MJ9A 1R5GA 2JPCA 4EJVA 6PAXA 3O3KA 3EUHA 4HLYA 3D0SA 1E2XA 4HF2A 3LFKA 3F6OA 1EH6A 3KLNA 1FPQA 2XIGA 3IRQA 1MD0A 2LF8A 3K9TA 5D4SA 1HXDA 2DW4A 3LA7A 3TO9A 4KMFA 4KMUX 1YW7A 5ILVA 2F2EA 3KETA 2CG4A 2DO7A 2HYGD 3BJAA 2Z9OA 2EFQA 4O6JA 3PFIA 5FFXA 4IJAA 5A2QZ 2XASA 4EM1A 5AIQA 3QU6A 1HKQA 1H9GA 5E17F 2FMYA 2UWMA 5H20A 2HKOA 3LQQA 4P55A 2CWEA 3BDDA 4AIHA 2J5OA 3GWZA 2L01A 3TO7A 5BPDA 1BI1A 4HF0A 3H3ZA 4ZYEA 3HRSA 1IXSB 3W6KB 1GXPA 2ADUA 4MNUA 1ON2A 1KU2A 1SMYF 4CO8A 1SD5A 3BP8A 4GO1A 2PQ8A 5CVRA 5FGMA 5D5VB 2PN6A 1Z9CA 2W84A 3WTTC 2GWRA 2ZKZA 4KICA 5HLGA 1O57A 2HQRA 1DPUA 2J5PA 5LLQA 5DUKA 1AOYA 2XGXA 3HTSB 1IRFA 2JT1A 5HS8A 3ISPA 1QZYA 2YSRA 4I98B 1FC3A 3MFKA 1T98A 4Q4ZF 2GZWA 3Q9SA 3CO6C 4AWXB 1KQ8A 2QVOA 2BV6A 4HA8A 3FXUA 1ODDA 1U3EM 1XD7A 2LNBA 5D8KB 2L02A 1T6SA 5LEJA 2V1DA 3I54A 1ZYRF 2ZMEB 4UV8A 3RKXA 1IUYA 4A0ZA 3P7NA 4DNCA 2O03A 1L3LA 5CVJA 1KA8A 4LD5A 4ESBA 1IN6A 2CW0F 2KRFA 2FU4A 1YS6A 2M1BA 3BZ6A 3GF2A 2FF4A 1EH7A 3MEXA 2FQ3A 4CXFA 2XROA 3V8LA 4OIRF 2H6BA 5FO5A 4HOBA 2CGPA 5HDGA 3IKTA 2FMLA 2CSOA 5D8LB 1FP1D 2H09A 2O3FA 4YFNF 5DD4A 5L3CA 1U2WA 3WGGA 4PZJA 5FB2A 4HZFA 4F7ZA 2Z3YA 1QNTA 4ENJA 3E6MA 3E5UA 3KP2A 2FNPA 4M71A 1SAXA 2A6EF 2XAGA 1BOAA 4RB3C 3ZMUA 1WRJA 2DU9A 2NAZA 4G7ZF 4P9FA 3E5XA 4A2UA 3P9CA 2W24A 2RNJA 2MC3A 2W25A 2DAOA 2VC0A 3MAJA 4UVBA 2BGCA 2HYFA 1RI7A 2PBIA 4Y13A 5F6FA 3EETA 2YPRA 1B59A 3O2PE 3QAHA 1XCVA 2EA2A 2RKHA 3WGIA 3ZPLA 1XGNA 5ICGA 4A12A 2HFHA 3FHZA 3ZN0A 4S04A 1JXSA 3WODF 1YQAA 3BOQA 1ULYA 2GIVA 3JAMZ 1OYWA 2ESNA 3IKVA 3D5LA 2ZXJA 4ZZDA 5HVQC 4H0EA 4B8XA 4FX0A 3TOBA 3HSFA 5ILUA 2A07F 4LG0B 3DF8A 4ESJA 2D2WA 3ECHA 3CO7C 2G9WA 2JSCA 1O7FA 3C1DA 1FBQA 4CGZA 2C6YA 2K86A 4OMZA 3WG9A 4XRFA 3TOAA 3K1NA 2HTJA 4HAMA 3E6CC 4OIOF 1LB2A 4G7OF 4ETSA 2UXXA 4ZYHA 1KYZA 1TW2A 4Y15A 1BBYA 2EJRA 4L9NA 5HOOA 1LEAA 3OOPA 3VOEA 2XKOA 4AD9A 2LDUA 1KGSA 2XV4S 4HQMA 1QO0D 1BI2A 5LHGA 1P6RA 1CF7A 3ECOA 4KYWA 1HKSA 4A5NA 1UFMA 2QM3A 2XVCA 5F64A 3MWMA 1HSJA 3DPTA 2H94A 4I0AA 1MKMA 4KUMA 3SQNA 2F5EA 2DK8A 1DP7P 3GO5A 1G3YA 1F1ZA 4ENKA 5E1ZB 2V79A 1YG2A 2O0YA 3RKWA 4KT5C 1FZPB 2L3DA 1XMAA 3E5QA 2ZO4A 1G3TA 2E7XA 2MLGA 3EQLF 1C0WA 1HW1A 1T39A 4XBFA 3JTHA 3M8FA 4EJTA 1UHWA 3FXQA 1USTA 4CDGA 5FLXZ 2YX7A 5EEGA 4M73A 4MGRA 1K6OA 2X0LA 2FBHA 1G3WA 4RGRA 4ZYDA 4ON0A 4OU0A 4XSZF 4ENNA 3DKWA 4HX4A 3RYPA 4BHBA 2Z99A 2IA1A 2HOEA 1RUNA 4R8HA 5D4RA 1O3SA 5CLSA 4OIPF 2JPBA 2R7FA 3BY6A 5ILSA 1Z05A 2Y48A 4UUVA 4RB0A 5ICCA 4DQ2A 1AWCA 4HV5A 5J8FA 1Z6RA 3GZ5A 3WGHA 3GFMA 4IF4A 2IJLA 1SD4A 2OU2A 1K78B 1T38A 2XAQA 3K69A 4BYYA 2W85A 3FMSA 1BIBA 4M9SA 2HR3A 1PDNC 2AXLA 5BQTA 2V6CA 3I58A 1SFEA 4MHGA 1YYVA 2QLZA 3RIRA 2RN7A 3ZMDA 2ACJA 2AS5F 4LB5A 4FX4A 3KZYA 2K27A 3HOSA 1ZARA 4R79A 4FHTA 4QWQA 2Y0MA 3GLXA 1TTYA 4A6EA 2VODA 5H6QA 4WF2A 2V9VA 3CTAA 2CYYA 3M7GA 2QZ8A 1ZRFA 4KIGA 1G6NA 1NHAA 4YFXF 3I5UA 5HS9A 3H92A 2PMUA 3FM5A 4L9TA 2HKXA 4M74A 3P9IA 3GXOA 1DPRA 4ZH4F 2HQNA 3K1PA 5LBQA 2A68F 3R4KA 2DK5A 3WE3A 1KU3A 3Q9VA 2HEOA 5E1XA 1F4KA 1HKTA 3NEUA 1LJ9A 5JI6A 3QU3A 3KEOA 1F9NA 5DYMA 1FT9A 4OIQF 4KN4X 4GYGA 3M9AA 4G7HF 2ZMEA 2DFIA 2VC1A 3I59A 1SFXA 1XN7A 4BNCA 3HRUA 2QQAA 5DCMA 2DLLA 1J0RA 4CHUA 1U8RA 2VE8A 2G7HA 2D1HA 4ENMA 2P6SA 1UHMA 1E17A 4JK1X 2QQBA 5J6XA 1FYMA 1FY7A 1KU9A 3GUDA 1G4DA 3KP3A 1WSUA 1EV7A 5BPIA 1T2KA 4RS8A 2E7WA 4KA4A 5A2QK 1R1UA 1ZGAA 4HV6A 3BPXA 2DBBA 3GFIA 2PLYA 1IN7A 3I53A 2F5CA 2XRNA 1I5ZA 1TQIA 3KLOA 2CQKA 2X4HA 2PMHA 4ZYGA 2BE5F 3F6VA 1BM9A 4PGGA 2STWA 1LNWA 4GYIA 5D6EA 3FZVA 2DTRA 1K79A 1CGPA 1Z1DA 3IHUA 2XAFA 5K1YA 3I64A 4OOIA 3KP7A 1FP2A 3ERED 4MTEA 5E8GA 2H27A 2MBFA 4U7DA 1KU7A 3WTWC 4MQVA 3OV8A 3WTZA 1BC7C 2Z33A 1FSEA 3CJNA 2ZJ2A 1ON1A 5CVIA 4A0XA 4PCQA 1ZREA 4XSXF 5J8CA 2JRTA 3CUQB 1IXCA 3N4MA 1ZHFA 4MTDA 4EGYA 2CFXA 4Z2YA 4L9VA 3MCZA 3K2ZA 1MDMB 4WK8F 4WXHA 4A0YA 4EQQA 4EMSA 2IA0A 3M8EA 3QP5A 2KJCA 1IF1A 4LFUA 2BEOA 3HYIA 4S05A 2MA3A 3L00A 5D5WB 1ZGJA 4U7BA 2KJBA 2ZNZA 1XSXA 4WXCA 5BOXA 2VOOA 1ZAOA 1YTYA 1L0OC 2RV8A 4EV0A 3GYHX 1LVAA 3J81K 2WC2A 4CICA 3CLOA 5HLIA 5JHUA 1J2XA 1ZG1A 2EFWA 4Y17A 5L3DA 1WQ2A 3FF5A 3WTSC 1I6XA 3LAJA 4BXUA 4AIJA 1I27A 2L54A 1XSVA 2BBYA 3F23A 5HS7A 2Q0OA 3ROUA 2XKPA 4NB5A 4FT8A 3HRTA 1GHCA 1OR7A 2FOKA 3Q5FA 4RB2C 3FX3A 4EJOA 1OKRA 5IT3A 5LRRA 3CUQC 3HHGA 1FNNA 1XMKA 3I59B 4KIFA 4A6DA 3R6SA 4UVAA 5LEKA 1J7KA 4L0YB 1R1VA 3O6BB 2VBYA 3BJOA 4RB1A 1R58A 3C3WA 2QQ9A 4ASNA 3SXYA 1USSA 2EFPA 2MH2A 2LSOA 3H3UA 2QWWA 2QYOA 1O3TA 1DDNA 4M6YA 5DUIA 1I1GA 5TJJA 1O3QA 4UXNA 5E18F 3FMRA 1R00A 3V8JA 1B9MA 4I01A 1IZ1A 2FRHA 1ZN2A 1D8JA 5LRSA 3C7JA 4LB6B 5DCMB 2JTVA 1ZG5A 2ZFWA 1V3FA 1CF7B 2ZBKA 1B4AA 2FBIA 4YIFA 2BYVE 2GAUA 2A5YB 3RKYA 2KIFA 2Y75A 1TNSA 1U5TC 3K1MA 2QBYA 3T1BA 5LHIA 4U0VA 3VB2A 4UVCA 2MD5A 1QQIA 2A61A 3HOTA 3CUQA 3RI4A 5KK1A 3JTGA 5FD5A 3V8KA 3P9KA 2F5DA 3WU0A 1D3YA 2GA2A 1RZ4A 4HBLA 1KQ0A 1FX7A 4YFKF 3FM3A 2M45A 3TQNA 3VODA 2OA4A 4G6DA 2WV0A 3IWZA 1DUXC 4P5OA 2L4AA 4XLPF 5D5XB 2A69F 3MZHA 3JSPA 4N0BA 5ICFA 4AVPA 3F8FA 4CZZA 1SMTA 4KFCA 1YIOA 4UHTA 1XDUA 4HF1A 3MQ0A 3I0TA 2OQRA 4G8XA 4LLGF 4BH9A 4OINF 1S8NA 1REPC 1P2FA 3WTUC 2F5FA 4IHSA 4HLXA 2ISYA 3RJPA 1GXQA 5CVVA 3ELKA 3M1EA 1IN8A 2ZCWA 4RAYA 3B02A 2V1XA 3V7CA 4GXOA 4MEYF 4YIIA 4EJWA 5L3FA 5E8IA 3GX4X 4G6QA 1D5VA 1YLFA 1MDMA 2OZ6A 1UB9A 1R1TA 2IVMA 1JHFA 2K4JA 1QZZA 4E70A 5DD8A 1RIOH 1HSTA 1FYKA 5FFZA 4L5IA 4O3MA 4RGXA 2RC4A 1LDKB 4I2OA 3BROA 3DPLC 3QRFF 4HDVA 5KVRA 3F8NA 1SD6A 4IXAA 3RYRA 4EM0B 1XCBA 5H6RA 1BI3A 3J80Z 2PJPA 1H9TA 3E6BA 3WTXC 2EFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PGH A;  3I71 A;  4AIK A;  2O8X A;  1S29 A;  1TLH B;  2NNN A;  5ERI A;  4ESF A;  5L3G A;  2PFB A;  1B1B A;  3JW4 A;  4IRG A;  2YR2 A;  3R0J A;  1FWZ A;  5L3E A;  4I7H A;  2K4B A;  3R60 A;  1OYY A;  4M72 A;  1B9N A;  1S7O A;  2OAZ A;  1Z7U A;  1U78 A;  2OBP A;  4WX9 A;  3ZQ7 A;  1J75 A;  3RDI A;  3HUG A;  4RGS A;  2IPQ X;  3L09 A;  1MZB A;  3GVA A;  1K78 A;  4RAZ A;  2D1V A;  1XSD A;  2CO5 A;  2COM A;  3V7S A;  1IXR C;  1RUO A;  3HSE A;  2KKO A;  3F8M A;  1A04 A;  5DDG A;  5TRD A;  1PP8 F;  2EFO A;  5BMZ A;  1YO5 C;  2KIU A;  1MGT A;  2DQR A;  4UNO A;  1IW7 F;  3HHH A;  4XLN F;  4EM2 A;  3T5X A;  3LQR A;  4IHT A;  2O61 A;  1VTN C;  1HW5 A;  1R23 A;  4R1H A;  2R7D A;  2HZT A;  5LHH A;  1O3R A;  4IRH A;  2YX4 A;  4LK1 F;  2ESH A;  3L2C A;  2VBW A;  2FSW A;  1R36 A;  4M9Z A;  1JHH A;  1ZH5 A;  1T0F A;  4K2E A;  1Z91 A;  2IW5 A;  5JVT A;  3J80 K;  2E1C A;  4N9H A;  3ZN1 A;  5D6F A;  3GFL A;  3HRM A;  4G94 A;  5JR3 A;  3BWG A;  1QPM A;  4EGZ A;  3R0A A;  2M87 A;  1FYL A;  4Q47 A;  1J5Y A;  5K5Q A;  4I0B A;  2EA4 A;  4GCV A;  1S6L A;  1W7P D;  2MLK A;  1BIA A;  1O7L A;  5E20 A;  3TKY A;  4IVN A;  3GW2 A;  1TW3 A;  4L18 B;  2M30 A;  2JZY A;  2XAH A;  3PQJ A;  3I4P A;  3QPT A;  3G73 A;  3DQV C;  3ABU A;  3WE2 A;  1OMI A;  4N9I A;  5E1W A;  2NS0 A;  2HDC A;  4YG2 F;  3E97 A;  2KIM A;  2ETH A;  2W57 A;  5CYV A;  1HQC A;  4LLL A;  3DFG A;  2OZU A;  4LG0 A;  1P92 A;  2VE9 A;  5BS6 A;  2MH9 A;  3DP7 A;  3T8T A;  5LGN A;  1F5T A;  3DEU A;  4U88 A;  2Q2E A;  3U9G A;  2EV0 A;  4PDK A;  3KP4 A;  2VBX A;  3GFJ A;  3C18 A;  3DV8 A;  5CJ9 A;  4L9J A;  2HGC A;  2GA1 A;  1BN5 A;  3HSR A;  3KP5 A;  5DV5 A;  1LEB A;  1HBX G;  1OPC A;  2LKP A;  3ULQ B;  3V4G A;  4NHJ A;  4KIB A;  1Q1H A;  3QP6 A;  1B6A A;  2G7U A;  2IT0 A;  1XB4 A;  2IA2 A;  2ELH A;  1MJA A;  3WTV C;  4BQA A;  5ICE A;  2WWY A;  2DI3 A;  1W7P A;  1GVJ A;  1IN4 A;  3KP6 A;  4Q48 A;  3U2R A;  4LJZ F;  4IRI A;  4P96 A;  2ZNY A;  2H6C A;  4G9Y A;  4A5M A;  1RNL A;  3J7A O;  2QUF A;  2UXN A;  1YW8 A;  1FOK A;  4LLN A;  5LGU A;  3S2W A;  1J59 A;  4BHC A;  4BAY A;  1YS7 A;  2P6T A;  1TQM A;  3F8B A;  2FEZ A;  1SD7 A;  4KDP A;  2FBK A;  3VFZ A;  2VXZ A;  4GGG A;  4LGW A;  4L0Z B;  1W7P B;  1W5S A;  2R3S A;  3TGN A;  3T0Y A;  2Z5U A;  3N97 A;  5CVU A;  1TQP A;  2HTS A;  1PUE E;  3F8C A;  2GQQ A;  2VT2 A;  3T8R A;  3RPU A;  1V4R A;  1P4W A;  1XDS A;  1QBJ A;  1BI0 A;  5DCF A;  2O6G E;  3L7W A;  3TO6 A;  1TNT A;  2HWV A;  4M6X A;  2DQL A;  1I1S A;  1JE8 A;  1SFU A;  2A6H F;  2HS5 A;  2RQP A;  3ZMS A;  5HDN A;  2IRF G;  5ED4 A;  2OQG A;  3R61 A;  4OMY A;  3FMQ A;  3E6D A;  2FXA A;  4QLC U;  4JQF A;  4Q5S F;  3E3V A;  3KZZ A;  4I02 A;  5JFR A;  1W5T A;  1XGM A;  3WTY C;  2EB7 A;  2Q8K A;  2TDX A;  2XAJ A;  2IP2 A;  1STZ A;  1FBS A;  4P9U A;  1U5T B;  4EJU A;  4TV7 A;  3EYY A;  2V1U A;  3MZY A;  1BJA A;  2A3S A;  2PG4 A;  1MJB A;  1J9I A;  2P4W A;  1KQ9 A;  2PEX A;  5LGT A;  5K5R A;  1S7A A;  2GXG A;  2FA5 A;  2NYX A;  2K02 A;  1IRG A;  1P4X A;  2DPD A;  3HTU A;  3COA C;  2VBZ A;  1G3S A;  3SZT A;  2OD5 A;  4B09 A;  4WXD A;  3KFW X;  2EWN A;  2NNY A;  1QGP A;  3LWF A;  3F21 A;  3REO A;  2RDP A;  1KYW A;  3NRV A;  1ZRC A;  2P7C B;  1S3J A;  1ZLJ A;  3IC7 A;  2NRA C;  1WI9 A;  1UCR A;  2L4M A;  3DXJ F;  2VN2 A;  5AIP A;  2EK5 A;  4D0P A;  2PI0 A;  3SZP A;  2EV6 A;  3GEZ A;  4O5V A;  1X3U A;  3KEQ A;  1D8K A;  4EVI A;  3G3Z A;  2DPU A;  3LAP A;  3BPV A;  3V7R A;  3F3X A;  3IRR A;  3QOP A;  1HW2 A;  3J81 Z;  2B0L A;  1W4M A;  2LF7 A;  2QBY B;  2VON A;  4U0W A;  5D5U B;  1FLI A;  4HDU A;  4MEX F;  5K5O A;  1BC8 C;  3EYI A;  1LQ1 A;  5F1R A;  2UZK A;  2P5K A;  3GZ6 A;  1R22 A;  2DT5 A;  2RGV A;  4L5J A;  3RPQ A;  5L3B A;  2QEN A;  1FSH A;  1U5T A;  1YW9 A;  1P4A A;  4HX8 A;  5HLH A;  4KNY A;  3CDH A;  1H0M A;  1IAW A;  3PQK A;  2VOP A;  1JGS A;  2FNA A;  1YFH A;  4U0Y A;  3FWE A;  3LA3 A;  1ZG3 A;  4KN7 X;  1ONV A;  3F22 A;  2P5L C;  3AAF A;  3ZP5 A;  2WTE A;  4HX7 A;  1FBU A;  1PP7 U;  3ZMZ A;  3K0L A;  4M9X A;  3U1D A;  4NQW A;  2STT A;  3FXR A;  3IWF A;  1Z6T A;  2FE3 A;  3BJ6 A;  3TDZ C;  4HW0 A;  3KE2 A;  3SHF A;  5FLX K;  4JBA A;  3ZMT A;  3QPH A;  3HIF A;  5DEQ A;  4MQ9 F;  4WWC A;  3SFZ A;  1ZLK A;  4BHP A;  3ML6 A;  3WU1 B;  3NQO A;  2K7L A;  3ABT A;  2XUB A;  1R5H A;  3ZMV A;  5IT9 K;  3IL2 A;  3EDP A;  3VEP A;  4I09 A;  2YU3 A;  3LST A;  1R7J A;  3KCC A;  4RGU A;  5HDK A;  4HQE A;  4CYD A;  1ZRD A;  5IT9 Z;  1WWX A;  2P5V A;  2RVC A;  1IN5 A;  5AON A;  1XGS A;  2M5W A;  3LA2 A;  4LMY A;  4UV9 A;  3B73 A;  2D45 A;  4IPA A;  3JAM K;  4WCG A;  1Y0U A;  2M8E A;  4LK0 F;  3CUO A;  1OYI A;  3JSO A;  1TBX A;  1XGO A;  2E1N A;  3F72 A;  2GXB A;  1U6G A;  3W6J B;  2XHK A;  3RTR A;  2ISZ A;  2EV5 A;  5EEH A;  2P8T A;  3L9F A;  3TDU C;  2P7V B;  1LDJ A;  4HYE A;  2VT3 A;  4ZZL A;  1LDD A;  5FD6 A;  1K7A A;  1WKM A;  1EH8 A;  1MJ9 A;  1R5G A;  2JPC A;  4EJV A;  6PAX A;  3O3K A;  3EUH A;  4HLY A;  3D0S A;  1E2X A;  4HF2 A;  3LFK A;  3F6O A;  1EH6 A;  3KLN A;  1FPQ A;  2XIG A;  3IRQ A;  1MD0 A;  2LF8 A;  3K9T A;  5D4S A;  1HXD A;  2DW4 A;  3LA7 A;  3TO9 A;  4KMF A;  4KMU X;  1YW7 A;  5ILV A;  2F2E A;  3KET A;  2CG4 A;  2DO7 A;  2HYG D;  3BJA A;  2Z9O A;  2EFQ A;  4O6J A;  3PFI A;  5FFX A;  4IJA A;  5A2Q Z;  2XAS A;  4EM1 A;  5AIQ A;  3QU6 A;  1HKQ A;  1H9G A;  5E17 F;  2FMY A;  2UWM A;  5H20 A;  2HKO A;  3LQQ A;  4P55 A;  2CWE A;  3BDD A;  4AIH A;  2J5O A;  3GWZ A;  2L01 A;  3TO7 A;  5BPD A;  1BI1 A;  4HF0 A;  3H3Z A;  4ZYE A;  3HRS A;  1IXS B;  3W6K B;  1GXP A;  2ADU A;  4MNU A;  1ON2 A;  1KU2 A;  1SMY F;  4CO8 A;  1SD5 A;  3BP8 A;  4GO1 A;  2PQ8 A;  5CVR A;  5FGM A;  5D5V B;  2PN6 A;  1Z9C A;  2W84 A;  3WTT C;  2GWR A;  2ZKZ A;  4KIC A;  5HLG A;  1O57 A;  2HQR A;  1DPU A;  2J5P A;  5LLQ A;  5DUK A;  1AOY A;  2XGX A;  3HTS B;  1IRF A;  2JT1 A;  5HS8 A;  3ISP A;  1QZY A;  2YSR A;  4I98 B;  1FC3 A;  3MFK A;  1T98 A;  4Q4Z F;  2GZW A;  3Q9S A;  3CO6 C;  4AWX B;  1KQ8 A;  2QVO A;  2BV6 A;  4HA8 A;  3FXU A;  1ODD A;  1U3E M;  1XD7 A;  2LNB A;  5D8K B;  2L02 A;  1T6S A;  5LEJ A;  2V1D A;  3I54 A;  1ZYR F;  2ZME B;  4UV8 A;  3RKX A;  1IUY A;  4A0Z A;  3P7N A;  4DNC A;  2O03 A;  1L3L A;  5CVJ A;  1KA8 A;  4LD5 A;  4ESB A;  1IN6 A;  2CW0 F;  2KRF A;  2FU4 A;  1YS6 A;  2M1B A;  3BZ6 A;  3GF2 A;  2FF4 A;  1EH7 A;  3MEX A;  2FQ3 A;  4CXF A;  2XRO A;  3V8L A;  4OIR F;  2H6B A;  5FO5 A;  4HOB A;  2CGP A;  5HDG A;  3IKT A;  2FML A;  2CSO A;  5D8L B;  1FP1 D;  2H09 A;  2O3F A;  4YFN F;  5DD4 A;  5L3C A;  1U2W A;  3WGG A;  4PZJ A;  5FB2 A;  4HZF A;  4F7Z A;  2Z3Y A;  1QNT A;  4ENJ A;  3E6M A;  3E5U A;  3KP2 A;  2FNP A;  4M71 A;  1SAX A;  2A6E F;  2XAG A;  1BOA A;  4RB3 C;  3ZMU A;  1WRJ A;  2DU9 A;  2NAZ A;  4G7Z F;  4P9F A;  3E5X A;  4A2U A;  3P9C A;  2W24 A;  2RNJ A;  2MC3 A;  2W25 A;  2DAO A;  2VC0 A;  3MAJ A;  4UVB A;  2BGC A;  2HYF A;  1RI7 A;  2PBI A;  4Y13 A;  5F6F A;  3EET A;  2YPR A;  1B59 A;  3O2P E;  3QAH A;  1XCV A;  2EA2 A;  2RKH A;  3WGI A;  3ZPL A;  1XGN A;  5ICG A;  4A12 A;  2HFH A;  3FHZ A;  3ZN0 A;  4S04 A;  1JXS A;  3WOD F;  1YQA A;  3BOQ A;  1ULY A;  2GIV A;  3JAM Z;  1OYW A;  2ESN A;  3IKV A;  3D5L A;  2ZXJ A;  4ZZD A;  5HVQ C;  4H0E A;  4B8X A;  4FX0 A;  3TOB A;  3HSF A;  5ILU A;  2A07 F;  4LG0 B;  3DF8 A;  4ESJ A;  2D2W A;  3ECH A;  3CO7 C;  2G9W A;  2JSC A;  1O7F A;  3C1D A;  1FBQ A;  4CGZ A;  2C6Y A;  2K86 A;  4OMZ A;  3WG9 A;  4XRF A;  3TOA A;  3K1N A;  2HTJ A;  4HAM A;  3E6C C;  4OIO F;  1LB2 A;  4G7O F;  4ETS A;  2UXX A;  4ZYH A;  1KYZ A;  1TW2 A;  4Y15 A;  1BBY A;  2EJR A;  4L9N A;  5HOO A;  1LEA A;  3OOP A;  3VOE A;  2XKO A;  4AD9 A;  2LDU A;  1KGS A;  2XV4 S;  4HQM A;  1QO0 D;  1BI2 A;  5LHG A;  1P6R A;  1CF7 A;  3ECO A;  4KYW A;  1HKS A;  4A5N A;  1UFM A;  2QM3 A;  2XVC A;  5F64 A;  3MWM A;  1HSJ A;  3DPT A;  2H94 A;  4I0A A;  1MKM A;  4KUM A;  3SQN A;  2F5E A;  2DK8 A;  1DP7 P;  3GO5 A;  1G3Y A;  1F1Z A;  4ENK A;  5E1Z B;  2V79 A;  1YG2 A;  2O0Y A;  3RKW A;  4KT5 C;  1FZP B;  2L3D A;  1XMA A;  3E5Q A;  2ZO4 A;  1G3T A;  2E7X A;  2MLG A;  3EQL F;  1C0W A;  1HW1 A;  1T39 A;  4XBF A;  3JTH A;  3M8F A;  4EJT A;  1UHW A;  3FXQ A;  1UST A;  4CDG A;  5FLX Z;  2YX7 A;  5EEG A;  4M73 A;  4MGR A;  1K6O A;  2X0L A;  2FBH A;  1G3W A;  4RGR A;  4ZYD A;  4ON0 A;  4OU0 A;  4XSZ F;  4ENN A;  3DKW A;  4HX4 A;  3RYP A;  4BHB A;  2Z99 A;  2IA1 A;  2HOE A;  1RUN A;  4R8H A;  5D4R A;  1O3S A;  5CLS A;  4OIP F;  2JPB A;  2R7F A;  3BY6 A;  5ILS A;  1Z05 A;  2Y48 A;  4UUV A;  4RB0 A;  5ICC A;  4DQ2 A;  1AWC A;  4HV5 A;  5J8F A;  1Z6R A;  3GZ5 A;  3WGH A;  3GFM A;  4IF4 A;  2IJL A;  1SD4 A;  2OU2 A;  1K78 B;  1T38 A;  2XAQ A;  3K69 A;  4BYY A;  2W85 A;  3FMS A;  1BIB A;  4M9S A;  2HR3 A;  1PDN C;  2AXL A;  5BQT A;  2V6C A;  3I58 A;  1SFE A;  4MHG A;  1YYV A;  2QLZ A;  3RIR A;  2RN7 A;  3ZMD A;  2ACJ A;  2AS5 F;  4LB5 A;  4FX4 A;  3KZY A;  2K27 A;  3HOS A;  1ZAR A;  4R79 A;  4FHT A;  4QWQ A;  2Y0M A;  3GLX A;  1TTY A;  4A6E A;  2VOD A;  5H6Q A;  4WF2 A;  2V9V A;  3CTA A;  2CYY A;  3M7G A;  2QZ8 A;  1ZRF A;  4KIG A;  1G6N A;  1NHA A;  4YFX F;  3I5U A;  5HS9 A;  3H92 A;  2PMU A;  3FM5 A;  4L9T A;  2HKX A;  4M74 A;  3P9I A;  3GXO A;  1DPR A;  4ZH4 F;  2HQN A;  3K1P A;  5LBQ A;  2A68 F;  3R4K A;  2DK5 A;  3WE3 A;  1KU3 A;  3Q9V A;  2HEO A;  5E1X A;  1F4K A;  1HKT A;  3NEU A;  1LJ9 A;  5JI6 A;  3QU3 A;  3KEO A;  1F9N A;  5DYM A;  1FT9 A;  4OIQ F;  4KN4 X;  4GYG A;  3M9A A;  4G7H F;  2ZME A;  2DFI A;  2VC1 A;  3I59 A;  1SFX A;  1XN7 A;  4BNC A;  3HRU A;  2QQA A;  5DCM A;  2DLL A;  1J0R A;  4CHU A;  1U8R A;  2VE8 A;  2G7H A;  2D1H A;  4ENM A;  2P6S A;  1UHM A;  1E17 A;  4JK1 X;  2QQB A;  5J6X A;  1FYM A;  1FY7 A;  1KU9 A;  3GUD A;  1G4D A;  3KP3 A;  1WSU A;  1EV7 A;  5BPI A;  1T2K A;  4RS8 A;  2E7W A;  4KA4 A;  5A2Q K;  1R1U A;  1ZGA A;  4HV6 A;  3BPX A;  2DBB A;  3GFI A;  2PLY A;  1IN7 A;  3I53 A;  2F5C A;  2XRN A;  1I5Z A;  1TQI A;  3KLO A;  2CQK A;  2X4H A;  2PMH A;  4ZYG A;  2BE5 F;  3F6V A;  1BM9 A;  4PGG A;  2STW A;  1LNW A;  4GYI A;  5D6E A;  3FZV A;  2DTR A;  1K79 A;  1CGP A;  1Z1D A;  3IHU A;  2XAF A;  5K1Y A;  3I64 A;  4OOI A;  3KP7 A;  1FP2 A;  3ERE D;  4MTE A;  5E8G A;  2H27 A;  2MBF A;  4U7D A;  1KU7 A;  3WTW C;  4MQV A;  3OV8 A;  3WTZ A;  1BC7 C;  2Z33 A;  1FSE A;  3CJN A;  2ZJ2 A;  1ON1 A;  5CVI A;  4A0X A;  4PCQ A;  1ZRE A;  4XSX F;  5J8C A;  2JRT A;  3CUQ B;  1IXC A;  3N4M A;  1ZHF A;  4MTD A;  4EGY A;  2CFX A;  4Z2Y A;  4L9V A;  3MCZ A;  3K2Z A;  1MDM B;  4WK8 F;  4WXH A;  4A0Y A;  4EQQ A;  4EMS A;  2IA0 A;  3M8E A;  3QP5 A;  2KJC A;  1IF1 A;  4LFU A;  2BEO A;  3HYI A;  4S05 A;  2MA3 A;  3L00 A;  5D5W B;  1ZGJ A;  4U7B A;  2KJB A;  2ZNZ A;  1XSX A;  4WXC A;  5BOX A;  2VOO A;  1ZAO A;  1YTY A;  1L0O C;  2RV8 A;  4EV0 A;  3GYH X;  1LVA A;  3J81 K;  2WC2 A;  4CIC A;  3CLO A;  5HLI A;  5JHU A;  1J2X A;  1ZG1 A;  2EFW A;  4Y17 A;  5L3D A;  1WQ2 A;  3FF5 A;  3WTS C;  1I6X A;  3LAJ A;  4BXU A;  4AIJ A;  1I27 A;  2L54 A;  1XSV A;  2BBY A;  3F23 A;  5HS7 A;  2Q0O A;  3ROU A;  2XKP A;  4NB5 A;  4FT8 A;  3HRT A;  1GHC A;  1OR7 A;  2FOK A;  3Q5F A;  4RB2 C;  3FX3 A;  4EJO A;  1OKR A;  5IT3 A;  5LRR A;  3CUQ C;  3HHG A;  1FNN A;  1XMK A;  3I59 B;  4KIF A;  4A6D A;  3R6S A;  4UVA A;  5LEK A;  1J7K A;  4L0Y B;  1R1V A;  3O6B B;  2VBY A;  3BJO A;  4RB1 A;  1R58 A;  3C3W A;  2QQ9 A;  4ASN A;  3SXY A;  1USS A;  2EFP A;  2MH2 A;  2LSO A;  3H3U A;  2QWW A;  2QYO A;  1O3T A;  1DDN A;  4M6Y A;  5DUI A;  1I1G A;  5TJJ A;  1O3Q A;  4UXN A;  5E18 F;  3FMR A;  1R00 A;  3V8J A;  1B9M A;  4I01 A;  1IZ1 A;  2FRH A;  1ZN2 A;  1D8J A;  5LRS A;  3C7J A;  4LB6 B;  5DCM B;  2JTV A;  1ZG5 A;  2ZFW A;  1V3F A;  1CF7 B;  2ZBK A;  1B4A A;  2FBI A;  4YIF A;  2BYV E;  2GAU A;  2A5Y B;  3RKY A;  2KIF A;  2Y75 A;  1TNS A;  1U5T C;  3K1M A;  2QBY A;  3T1B A;  5LHI A;  4U0V A;  3VB2 A;  4UVC A;  2MD5 A;  1QQI A;  2A61 A;  3HOT A;  3CUQ A;  3RI4 A;  5KK1 A;  3JTG A;  5FD5 A;  3V8K A;  3P9K A;  2F5D A;  3WU0 A;  1D3Y A;  2GA2 A;  1RZ4 A;  4HBL A;  1KQ0 A;  1FX7 A;  4YFK F;  3FM3 A;  2M45 A;  3TQN A;  3VOD A;  2OA4 A;  4G6D A;  2WV0 A;  3IWZ A;  1DUX C;  4P5O A;  2L4A A;  4XLP F;  5D5X B;  2A69 F;  3MZH A;  3JSP A;  4N0B A;  5ICF A;  4AVP A;  3F8F A;  4CZZ A;  1SMT A;  4KFC A;  1YIO A;  4UHT A;  1XDU A;  4HF1 A;  3MQ0 A;  3I0T A;  2OQR A;  4G8X A;  4LLG F;  4BH9 A;  4OIN F;  1S8N A;  1REP C;  1P2F A;  3WTU C;  2F5F A;  4IHS A;  4HLX A;  2ISY A;  3RJP A;  1GXQ A;  5CVV A;  3ELK A;  3M1E A;  1IN8 A;  2ZCW A;  4RAY A;  3B02 A;  2V1X A;  3V7C A;  4GXO A;  4MEY F;  4YII A;  4EJW A;  5L3F A;  5E8I A;  3GX4 X;  4G6Q A;  1D5V A;  1YLF A;  1MDM A;  2OZ6 A;  1UB9 A;  1R1T A;  2IVM A;  1JHF A;  2K4J A;  1QZZ A;  4E70 A;  5DD8 A;  1RIO H;  1HST A;  1FYK A;  5FFZ A;  4L5I A;  4O3M A;  4RGX A;  2RC4 A;  1LDK B;  4I2O A;  3BRO A;  3DPL C;  3QRF F;  4HDV A;  5KVR A;  3F8N A;  1SD6 A;  4IXA A;  3RYR A;  4EM0 B;  1XCB A;  5H6R A;  1BI3 A;  3J80 Z;  2PJP A;  1H9T A;  3E6B A;  3WTX C;  2EFN A; 
#chains in the Genus database with same CATH topology
 4PGH A;  3I71 A;  5TGT A;  3O8G A;  4AIK A;  2O8X A;  1S29 A;  1TLH B;  2NNN A;  5ERI A;  3CP8 A;  1D1B A;  1DGR M;  4ESF A;  3PNY A;  1D0X A;  4QPO A;  2CV1 A;  5L3G A;  2PFB A;  1B1B A;  3JW4 A;  4IRG A;  2DYR H;  2YR2 A;  3HOU J;  3KPH A;  3R0J A;  2DT6 A;  1FWZ A;  5L3E A;  5EG0 A;  1YI2 I;  4I7H A;  2K4B A;  5HOD A;  3R60 A;  4RDU A;  2CMP A;  5IPA A;  1P9Q C;  2R5Y A;  2KP6 A;  3EUH C;  2IS2 A;  1OYY A;  2BW3 B;  2E2H J;  4M72 A;  1B9N A;  1S7O A;  4FIS A;  2AO9 A;  2OAZ A;  3K2A A;  3QOD A;  1Z7U A;  2ZC2 A;  5K7F A;  2Y0S A;  2R5Z A;  1U78 A;  4UB8 C;  2OBP A;  2JVH A;  4HRI A;  3K4M A;  4WX9 A;  3ZQ7 A;  2JA2 A;  1J75 A;  3RDI A;  3HUG A;  3S16 J;  4RGS A;  2IPQ X;  3L09 A;  1MZB A;  4BBR J;  3GVA A;  1K78 A;  4RAZ A;  3WG7 H;  1M1E B;  2D1V A;  1XSD A;  2CO5 A;  2COM A;  3V7S A;  1OCC H;  1IXR C;  4P1W A;  1RUO A;  3HSE A;  2KKO A;  3F8M A;  1A04 A;  5DDG A;  2QF7 A;  4J01 A;  5TRD A;  1PP8 F;  3BR3 A;  2EFO A;  5BMZ A;  1YO5 C;  3VYT B;  2RAE A;  4N4O B;  2KIU A;  4ITV A;  1MGT A;  4FE7 A;  1U9O A;  2DQR A;  4D7N A;  3W6V A;  3VPR A;  2L7Z A;  1YOV B;  4UNO A;  2LKX A;  5IYD J;  2Q1Z B;  2EZL A;  3I55 I;  1IW7 F;  3HHH A;  4XLN F;  1R4M B;  4EM2 A;  4GDF A;  3T5X A;  1E0E A;  3LQR A;  2MW8 A;  3JRG A;  1IGN A;  4YEJ A;  2X48 A;  3OS1 A;  1VTN C;  1VQP I;  1HW5 A;  4IHT A;  2O61 A;  1YX5 A;  3KEY A;  2AXT C;  1R23 A;  4R1H A;  5J3L A;  2X6X A;  5B66 C;  2R7D A;  2R7U A;  2HZT A;  3K6G A;  3N05 A;  4BL0 B;  5LHH A;  2X1D A;  1O3R A;  4IRH A;  2KMU A;  2YX4 A;  4LOC A;  1K61 A;  4LK1 F;  2ESH A;  3L2C A;  2E2J J;  2VBW A;  3HKZ N;  1DGW Y;  2FSW A;  1WI3 A;  1R36 A;  4M9Z A;  1JHH A;  2UV1 A;  1ZH5 A;  2ID3 A;  2LR8 A;  1T0F A;  4K2E A;  1Z91 A;  4BJ5 C;  1LE8 B;  4RLQ A;  2IW5 A;  4DOZ A;  1HC8 A;  5JVT A;  3J80 K;  3FIS A;  3SYT A;  2E1C A;  4BY1 J;  4N9H A;  3MN2 A;  3ZN1 A;  5D6F A;  1WJ5 A;  5C4X J;  3GFL A;  3HRM A;  1N77 A;  1LPQ A;  2LBF A;  2Y30 A;  4G94 A;  3CCU I;  2WAE A;  3OYD A;  1VQ5 I;  5JR3 A;  3G6E I;  3DTK A;  3BWG A;  3DBL B;  4BY7 J;  1QPM A;  4EGZ A;  3R0A A;  2M87 A;  3JRD A;  1FYL A;  4MO7 A;  4Q47 A;  3UKG A;  1J5Y A;  5K5Q A;  1E3O C;  5HNH A;  4I0B A;  2EA4 A;  3B6C A;  2KFD A;  3C2B A;  3HXL A;  4GCV A;  1S6L A;  1W7P D;  3CC4 I;  2QA4 I;  2MLK A;  1BIA A;  2JSP A;  1O7L A;  2KIS A;  4EAT A;  5E20 A;  3TKY A;  3H0G J;  4IVN A;  2HXO A;  3GW2 A;  2JVG A;  1YJW I;  1TW3 A;  4L18 B;  1Z77 A;  2GOM A;  3H36 A;  2VJI A;  2M30 A;  2JZY A;  2XAH A;  3PQJ A;  3E0J B;  1X1D A;  3I4P A;  1X4P A;  3QPT A;  4HNU A;  3G73 A;  1TT5 B;  4A3F J;  3I9V 2;  3DQV C;  3IV5 A;  3ABU A;  3WE2 A;  4LIT A;  1RPW A;  1CQT A;  4E6K G;  1OMI A;  4N9I A;  1QVT A;  3H3V K;  5E1W A;  2NS0 A;  3MD2 A;  2HDC A;  4YG2 F;  3E97 A;  2KIM A;  3PSI A;  1V54 H;  2GBY A;  2ETH A;  2W57 A;  5CYV A;  1HQC A;  4LLL A;  1LKX A;  3CDL A;  2M7A A;  3CC2 I;  3DFG A;  2OZU A;  4LG0 A;  1P92 A;  1VQ9 I;  4ZDL A;  2VE9 A;  1GVD A;  4XOR A;  1TL8 A;  5BS6 A;  2CQX A;  2MH9 A;  3DP7 A;  3T8T A;  5LGN A;  1F5T A;  1WJD A;  3DEU A;  4U88 A;  2Q2E A;  3U9G A;  2EV0 A;  4PDK A;  4C3I J;  1GLN A;  3KP4 A;  3PFY A;  2VBX A;  4PFP A;  3RZD J;  3GFJ A;  1S5L C;  3C18 A;  3DV8 A;  3H1C A;  5CJ9 A;  1P7I A;  3CME I;  1MBK A;  3S1M J;  2NVU B;  4A3B J;  4L9J A;  1Z7L A;  1TT0 A;  1Z0X A;  2HGC A;  1BW6 A;  2GA1 A;  4FQG A;  1BN5 A;  3HSR A;  1D1C A;  5EZG A;  2WAF A;  3KP5 A;  5DV5 A;  2GM4 A;  1LEB A;  1HBX G;  1OPC A;  2LKP A;  3ULQ B;  3TED A;  2R7Q A;  3V4G A;  2Y9Z A;  4NHJ A;  4KIB A;  3ERM A;  1Q1H A;  3QP6 A;  1B6A A;  2G7U A;  3AG4 H;  4E7I A;  4A3M J;  4I99 C;  2IT0 A;  1XB4 A;  2IA2 A;  1RKW A;  2CQ7 A;  3DPU A;  2ELH A;  1MJA A;  1LFB A;  3WTV C;  5C3E J;  1IG7 A;  5GP9 A;  4BQA A;  3IH4 A;  1WCM J;  2DMU A;  3I56 I;  2PMZ N;  2HXI A;  2NVX J;  5ICE A;  4PJJ A;  2DI3 A;  3K4J A;  2WWY A;  2BW3 A;  1W7P A;  2L7K A;  1NG7 A;  4M6V A;  3QPS A;  2MYS A;  1GVJ A;  4F91 B;  1IN4 A;  2QCO A;  3KP6 A;  2FJ1 A;  2AQF A;  4Q48 A;  1ITY A;  3U2R A;  4LJZ F;  1MBH A;  4IRI A;  4P96 A;  2ZNY A;  2H6C A;  4G9Y A;  4A5M A;  1RNL A;  1Z3Y A;  3AG2 H;  2JQ7 A;  3J7A O;  3K4B A;  4UUS A;  1SEU A;  1ETX A;  4D5F A;  4E7J A;  3BLY A;  4C2T A;  2QUF A;  2UXN A;  1YW8 A;  1FOK A;  1TWF J;  4LLN A;  1BW5 A;  1Y8Q B;  1XTA A;  3MKL A;  5LGU A;  2EZH A;  2LFB A;  3BTC A;  2N8G A;  3S2W A;  5CQE A;  2UUZ A;  1J59 A;  4BHC A;  1KON A;  3BZC A;  4X6A J;  4BAY A;  1YS7 A;  2P6T A;  2L2O A;  2H8W A;  1JKP C;  2HPM A;  3M1C A;  3HM5 A;  1TQM A;  2IS4 A;  2W7N A;  3F8B A;  2FEZ A;  3D5S C;  1Y0N A;  4JYK A;  1SD7 A;  3M4O J;  4KDP A;  2FBK A;  3VFZ A;  2VXZ A;  4GGG A;  4LGW A;  4L0Z B;  1K83 J;  1W7P B;  5C4J J;  1MNM C;  1W5S A;  1E3H A;  3FKJ A;  2R3S A;  3T0Y A;  3TGN A;  4BE1 A;  1AU7 A;  3F9K A;  2LY9 A;  3K4L A;  3HEF A;  1Y56 A;  2Z5U A;  3ESW B;  3N97 A;  2ZSH B;  5CVU A;  1TQP A;  4RA2 A;  4B3A A;  2HTS A;  3JRF A;  1PUE E;  1TWC J;  3F0C A;  3F8C A;  5EG0 B;  2GQQ A;  2BXY A;  2VT2 A;  3ZQF A;  3T8R A;  5H2F C;  3RPU A;  1V4R A;  2ZJP F;  1P4W A;  1XDS A;  1J09 A;  1QBJ A;  2R92 J;  1BI0 A;  5J1U A;  5DCF A;  2O6G E;  2LLK A;  3L7W A;  1UZC A;  3TO6 A;  5M5W J;  3NWT A;  2QSG X;  1TNT A;  2HWV A;  2F48 A;  4M6X A;  2DQL A;  1I1S A;  1JE8 A;  1I39 A;  1SFU A;  2A6H F;  3GTO J;  3EUK L;  4XM3 A;  4BXF A;  2HS5 A;  2RQP A;  3ZMS A;  4NC6 A;  2Z1D A;  5HDN A;  3CJR B;  3PO2 J;  2IRF G;  5ED4 A;  1T95 A;  5GTH C;  3M8J A;  2OQG A;  3R61 A;  3BTI A;  3FMQ A;  4OMY A;  3E6D A;  1PYV A;  2BY3 A;  2FXA A;  4QLC U;  4JQF A;  4Q5S F;  3E3V A;  3KZZ A;  1QZE A;  3BQZ A;  1IV8 A;  4I02 A;  5JFR A;  4XIC A;  3ZR8 X;  2OPT A;  1W5T A;  3RQI A;  1OQY A;  4A3J J;  1XGM A;  3WTY C;  2EB7 A;  5M3F J;  2AQE A;  1OLT A;  2Q8K A;  1DU0 A;  2EBI A;  2TDX A;  3FXM A;  2XAJ A;  2IP2 A;  1STZ A;  1TWH J;  1FBS A;  4P9U A;  1UG2 A;  1IO2 A;  3IH2 A;  4XN3 A;  1U5T B;  4EJU A;  2PX9 A;  4TV7 A;  3I4N J;  3EYY A;  2E34 A;  1VQ4 I;  5IOZ A;  2CQN A;  2MD0 A;  5E3M A;  2V1U A;  4KIT B;  3MZY A;  1BJA A;  2VQG A;  2A3S A;  3GTJ J;  3HB9 A;  3W2V A;  1LFP A;  2PG4 A;  3MKW B;  1MJB A;  3K70 C;  3CMA I;  1J9I A;  2P4W A;  1KQ9 A;  1JJ8 C;  2PEX A;  4CSW A;  5LGT A;  3CF5 F;  5K5R A;  1MMD A;  1S7A A;  1U0J A;  4E7L A;  2GXG A;  1BR4 A;  3K4C A;  5F0C A;  2FA5 A;  2NYX A;  3MMY B;  2K02 A;  4B43 A;  1IRG A;  1P4X A;  2CW8 A;  2DPD A;  3HTU A;  3DEW A;  1X19 A;  4ZDP A;  3COA C;  2KDO A;  2ZJR F;  2VBZ A;  1G3S A;  3SZT A;  2OD5 A;  2RRE A;  4B09 A;  4WXD A;  1R5I D;  3KFW X;  2EWN A;  3S15 J;  5DS9 A;  1RKT A;  2NNY A;  1QGP A;  4DZJ A;  5E3O A;  3LWF A;  3F21 A;  3REO A;  2RDP A;  1KYW A;  1FJL A;  2HOS A;  3OYK A;  3K7A J;  4L5E A;  4QIW N;  4A93 J;  1ETW A;  1AHD P;  1JKO C;  3NRV A;  2Q2E B;  1ZRC A;  2B7E A;  2P7C B;  3BG3 A;  1S3J A;  4PSW A;  5GAE J;  1ZLJ A;  3IC7 A;  1EF4 A;  2NRA C;  4BKX A;  2ZXI A;  4XRS G;  2YU9 J;  4G6T B;  1WI9 A;  1H9T A;  1UCR A;  2L4M A;  3DXJ F;  2VN2 A;  5AIP A;  2EK5 A;  2KRH A;  4D0P A;  2PI0 A;  3SZP A;  2H1L A;  4DW6 A;  2EV6 A;  2Y9Y A;  5GAD J;  2K9M A;  4C2M J;  3GEZ A;  4NUB A;  4O5V A;  1X3U A;  3KEQ A;  1A6I A;  3DCF A;  3GTK J;  2CQQ A;  3CDI A;  1D8K A;  1MND A;  4EVI A;  4BE0 A;  3G3Z A;  3CCJ I;  4OAY A;  2DPU A;  4D1Q A;  3LAP A;  3BPV A;  3V7R A;  3F3X A;  3IRR A;  3GTP J;  1OFC X;  2KT0 A;  3QOP A;  1HW2 A;  1RES A;  3J81 Z;  3SJM A;  2B0L A;  3DTI A;  4DZP A;  1N25 A;  4U87 A;  1W4M A;  2LF7 A;  2HI3 A;  2QBY B;  3CD6 I;  4AYB A;  3ASN H;  2JJ7 A;  4AUX A;  2VON A;  3CCY A;  4JP0 A;  4U0W A;  5D5U B;  1R49 A;  1FLI A;  2JK3 A;  4HDU A;  4MEX F;  1XC5 A;  5K5O A;  4B4C A;  1BC8 C;  3EYI A;  3HKZ A;  3S14 J;  1LQ1 A;  2X1C A;  5J4Y A;  5F1R A;  2UZK A;  2P5K A;  3GZ6 A;  1R22 A;  2RQQ A;  2F4I A;  2DT5 A;  3NAR A;  2RGV A;  3LL7 A;  4L5J A;  2OJE D;  5IP9 J;  2H1K A;  4FE4 A;  1YIJ I;  3RPQ A;  5L3B A;  2QEN A;  5M5Y J;  1FSH A;  1U5T A;  1YW9 A;  2EIK H;  4CCK A;  1P4A A;  2K3F A;  2IGK A;  1RR7 A;  1H88 C;  4HX8 A;  5HLH A;  4KNY A;  4M3F A;  3BC8 A;  2O5R A;  3CDH A;  1H0M A;  1IAW A;  1A31 A;  3PQK A;  2VOP A;  2LOO A;  1JGS A;  3FK7 A;  1B72 B;  2FNA A;  1X1C A;  1YFH A;  4XON A;  5J1Y A;  4U0Y A;  4AYB N;  3FWE A;  5CPR B;  2H8R A;  3LA3 A;  1EA3 A;  1ZG3 A;  3CCR I;  4KN7 X;  2X6O A;  1ONV A;  3F22 A;  5CQG A;  2P5L C;  3ABL H;  3AAF A;  3ZQC A;  3FHN A;  3QYE A;  1RC9 A;  4XKC A;  1AA7 A;  3JRB A;  3ZP5 A;  1XX5 A;  2DA3 A;  2WTE A;  4HX7 A;  1FBU A;  1PP7 U;  2EZK A;  1ERD A;  5B1B H;  3ZMZ A;  3K0L A;  4M9X A;  3U1D A;  4NQW A;  2STT A;  1X2N A;  4KJZ A;  1WH5 A;  2XPV A;  3FXR A;  5KCM A;  3IWF A;  1Z6T A;  5FLM J;  3SEZ A;  1X58 A;  2FE3 A;  2MG4 A;  3BJ6 A;  1ETV A;  3TDZ C;  4AM3 A;  1QHH D;  4I6Z A;  2K9N A;  4HW0 A;  3Q0V A;  4Y3O A;  2IS1 A;  5EGO B;  4XLC A;  3KE2 A;  4BS9 A;  3SHF A;  5FLX K;  1GDT A;  4JBA A;  3ZMT A;  2EZI A;  3QPH A;  3HIF A;  4B1R A;  2YS9 A;  5DEQ A;  2KZV A;  3OYJ A;  4MQ9 F;  4WWC A;  3SFZ A;  2LH9 A;  3AG1 H;  3J7Y J;  1ZLK A;  4BHP A;  3ML6 A;  3WU1 B;  2MSY A;  3NQO A;  4IOC F;  2IEK A;  2K7L A;  3C2H A;  3S1R J;  2D5V A;  1MH4 A;  3H0D A;  3ABT A;  2XUB A;  5IYB J;  4PJL A;  1R5H A;  4A69 C;  3ZMV A;  5IT9 K;  1U9N A;  3IL2 A;  4XLE A;  3EDP A;  1MBE A;  3VEP A;  2VQL A;  4I09 A;  2YU3 A;  4IL6 C;  3FBI B;  1X1B A;  4LG3 A;  5M5X J;  1ETO A;  3LST A;  1R7J A;  2F5V A;  3KCC A;  4E7S A;  2HQ5 A;  4RGU A;  4F55 A;  5HDK A;  4HQE A;  4CYD A;  1BR1 A;  1ZRD A;  1AKH B;  1WWX A;  5IT9 Z;  3SDG A;  2K3P A;  4HG2 A;  3CCQ I;  2P5V A;  1BJZ A;  2RVC A;  5IY5 H;  1GV5 A;  3TMO A;  1NK3 P;  4KIS A;  3H5A A;  1IN5 A;  5AON A;  1WZ2 A;  3RKQ A;  1JUS A;  1XGS A;  2M5W A;  2GLO A;  3LA2 A;  3QYF A;  1IJW C;  4LMY A;  4C3H J;  2JUC A;  4XKB A;  4UV9 A;  1I6H J;  2K9S A;  3B73 A;  2D45 A;  2E36 A;  4IPA A;  3JAM K;  2F4O B;  1MNE A;  3OR1 C;  4WCG A;  5F1J A;  2R7T A;  1Y0U A;  2COB A;  2M8E A;  4LK0 F;  5HLT A;  3CUO A;  3ZQG A;  1OYI A;  3JSO A;  2E5N A;  1TBX A;  1XGO A;  2E1N A;  2EIL H;  3F72 A;  2GXB A;  1U6G A;  2DMN A;  3W6J B;  2XHK A;  1LVK A;  1T56 A;  3RTR A;  4XK4 A;  2ISZ A;  1V5F A;  2EV5 A;  5EEH A;  4BEH A;  3KYL A;  2MGQ A;  2P8T A;  3OS2 A;  3L2V A;  2LY2 A;  3FKI J;  2Y69 H;  3L9F A;  3NAU A;  3TDU C;  2P7V B;  1LDJ A;  3CES A;  3DU5 A;  4HYE A;  1XMX A;  1B8I B;  2DA2 A;  1BA5 A;  2VT3 A;  4CCJ A;  4ZZL A;  1LDD A;  5FD6 A;  3ZQQ A;  1K7A A;  1WKM A;  1EH8 A;  1MJ9 A;  2XRL A;  1R5G A;  2JPC A;  1JGG A;  1MSF C;  2W4S A;  4EJV A;  1NTC A;  6PAX A;  5EGO A;  3O3K A;  3EUH A;  4HLY A;  3D0S A;  4DYC A;  2R5Z B;  1E2X A;  3CLQ A;  4HF2 A;  3LFK A;  4RBO A;  4MLO A;  3F6O A;  1EH6 A;  3KLN A;  1FPQ A;  2XIG A;  2BVM A;  5IP6 A;  3IRQ A;  1JKQ C;  1MD0 A;  2DA4 A;  2LF8 A;  2NXN B;  2ME0 A;  5LFA A;  3K9T A;  5D4S A;  3S1N J;  1HXD A;  4BAC A;  2DW4 A;  3PUF A;  1V5E A;  3LA7 A;  2V9K A;  4BQN A;  3TO9 A;  4KMF A;  2ZXH A;  3U1K A;  3MKZ A;  2B9S A;  4KMU X;  4E4H A;  4ZJZ A;  1YW7 A;  5ILV A;  2F2E A;  5B5E C;  3KET A;  3S3M A;  2CG4 A;  1FMV A;  2DO7 A;  2HYG D;  3BJA A;  3HGY A;  4MIM A;  3K4N A;  2EFQ A;  3HL2 A;  4E7H A;  1ETY A;  1VQL I;  1TWG J;  2DXI A;  2Z9O A;  4O6J A;  3W3C A;  4IHY A;  3Q0U A;  3PFI A;  5FFX A;  2DT7 B;  4IJA A;  5A2Q Z;  2XAS A;  4EM1 A;  5AIQ A;  3WHB A;  3QU6 A;  1HKQ A;  3U21 A;  1H9G A;  5E3N A;  5E17 F;  2FMY A;  3PNV A;  3OY9 A;  3BR0 A;  1RET A;  2UWM A;  5H20 A;  2HKO A;  5EJC A;  2X6Y A;  3LQQ A;  2CWE A;  4P55 A;  3BDD A;  2JUG A;  4AIH A;  3VSL A;  2J5O A;  3GWZ A;  2L01 A;  4QSH A;  3TO7 A;  2R7S A;  5BPD A;  4XOT A;  1BI1 A;  4HF0 A;  3H3Z A;  4ZYE A;  3HRS A;  2V1N A;  1IXS B;  1UHS A;  2CFO A;  2VAS A;  3W6K B;  3HPG A;  1GXP A;  2QKL B;  3FBN B;  2ADU A;  1VQ8 I;  4MNU A;  3BQY A;  2DA6 A;  1ON2 A;  1T0F C;  2WAD A;  3G1L A;  1KU2 A;  1UEL B;  3D1N I;  1SMY F;  4CO8 A;  5CKT A;  4RLF A;  4NQW B;  3Q3S A;  3HOX J;  1SD5 A;  2R7W A;  3MVP A;  3BP8 A;  2CV0 A;  4GO1 A;  3DBR B;  1QHG A;  2DMQ A;  2PQ8 A;  5CVR A;  5FGM A;  2LTP A;  5D5V B;  3OSF A;  4ZTJ A;  1DU6 A;  2PN6 A;  4RM2 A;  1X3Z B;  4RAF A;  1Z9C A;  1X2M A;  1K6Y A;  2W84 A;  3WTT C;  2VL8 A;  1X3W B;  2GWR A;  2ZKZ A;  1VQK I;  4KIC A;  3UNG C;  5HLG A;  3OYG A;  1O57 A;  5J40 A;  5EDN A;  3X2Q H;  1ZKG A;  1BOB A;  4IQJ A;  3ZQH A;  2HQR A;  4ZTF A;  1DPU A;  2J5P A;  4M3B A;  1V55 H;  3PL8 A;  5LLQ A;  5DUK A;  2L9R A;  1AOY A;  2XGX A;  1JUP A;  1HCR A;  2VKH A;  3HTS B;  2XF6 A;  1IRF A;  2CS3 A;  2JT1 A;  1B72 A;  5HS8 A;  2DCE A;  3SDB A;  3ISP A;  2M3A A;  2XB5 A;  1QZY A;  1XG1 A;  2M9H A;  2YSR A;  1YIT I;  4I98 B;  1FC3 A;  3MFK A;  1PVE A;  2HU9 A;  1T98 A;  2CW7 A;  4Q4Z F;  2OTJ I;  1Z67 A;  3ASO H;  2GZW A;  3Q9S A;  5EF6 A;  3CO6 C;  4AWX B;  2DMT A;  1KQ8 A;  1G8X A;  3BG9 A;  2QVO A;  1A5J A;  2BV6 A;  4HA8 A;  3FXU A;  1ODD A;  1U3E M;  1XD7 A;  3QOE A;  1SAU A;  2WB1 N;  2LNB A;  5D8K B;  2JRM A;  2L02 A;  1T6S A;  3BTJ A;  5LEJ A;  2V1D A;  3I54 A;  3ZOB A;  1ZYR F;  2VXD A;  2ICW G;  2ZME B;  4UV8 A;  3RKX A;  3IAS 2;  1IUY A;  5TIS C;  5B3S H;  4A0Z A;  4HPQ A;  3GTQ J;  1G59 A;  4BDY A;  4DBR A;  3P7N A;  1F36 A;  1JKR C;  4DNC A;  5B1A H;  2O03 A;  3KX2 A;  4QTR A;  1L3L A;  2LVS A;  5CVJ A;  1JTY A;  4CH7 A;  1GUU A;  4DIQ A;  1E3P A;  1KA8 A;  2L5Q A;  4LD5 A;  2VQH A;  3OYB A;  3H35 A;  2GOX B;  4ESB A;  1IN6 A;  2CW0 F;  2KRF A;  2FU4 A;  3PIP F;  4UY8 I;  1YS6 A;  2M1B A;  3BZ6 A;  3KYD B;  3GF2 A;  4XID A;  2FF4 A;  1EH7 A;  3MEX A;  3AL0 B;  2FQ3 A;  4CXF A;  4JX5 A;  2XRO A;  4J19 A;  3V8L A;  2L7M P;  4OIR F;  3V42 A;  4A3C J;  2H6B A;  5FO5 A;  4HOB A;  2CGP A;  5HDG A;  1AKH A;  1QA6 A;  3IKT A;  2FML A;  2CSO A;  5D8L B;  2ZJQ F;  2HPI A;  1Z3X A;  3IUO A;  1VI0 A;  1FP1 D;  2H09 A;  2O3F A;  2DOF A;  4YFN F;  5DD4 A;  3FK6 A;  3FXK A;  4IOA F;  3ABK H;  2HQA A;  2KL4 A;  5L3C A;  3OIP A;  3LFU A;  1U2W A;  3WGG A;  1WVR A;  4PZJ A;  5FB2 A;  2NVT J;  4HZF A;  4F7Z A;  1WJE A;  2Z3Y A;  4BJ6 C;  1QNT A;  4EEF G;  3CMY A;  4ENJ A;  3E6M A;  3E5U A;  3KP2 A;  2M8G X;  1WJC A;  2FNP A;  1ZTR A;  1APL C;  4M71 A;  2F6C A;  1SAX A;  1W36 C;  2A6E F;  2XAG A;  1BOA A;  4RB3 C;  2DTZ A;  3ZMU A;  4DJA A;  1WRJ A;  2DU9 A;  2NAZ A;  2R7O A;  5HNF A;  3S17 J;  4G7Z F;  4P9F A;  2JA7 J;  3E5X A;  2B63 J;  3JRC A;  2PJR A;  4XLH A;  4A2U A;  3S3O A;  3P9C A;  4JOM A;  2W24 A;  3A0H C;  2RNJ A;  2MC3 A;  3LSG A;  2M0C A;  4B48 A;  2W25 A;  2DAO A;  2VC0 A;  5GPC A;  2LG4 A;  3MAJ A;  4Y7N J;  3QWL A;  4F92 B;  3OL4 A;  4UVB A;  2BGC A;  2HYF A;  1RI7 A;  2PBI A;  3ABM H;  4Y13 A;  5F6F A;  3EET A;  4NNJ A;  3HC7 A;  4F93 B;  2YPR A;  3OYI A;  2Z16 A;  3P5J A;  2KPM A;  1B59 A;  2JWT A;  3O2P E;  3QAH A;  1XCV A;  2EA2 A;  2RKH A;  3WGI A;  3OWT A;  3SZG A;  1XGN A;  3ZPL A;  5ICG A;  2QGU A;  4ZYA A;  4A12 A;  2HFH A;  3FHZ A;  3ZN0 A;  1VND A;  4S04 A;  3WOD F;  3GCM A;  1OCZ H;  3Q0W A;  1IC8 A;  1JXS A;  1YQA A;  4CA0 A;  3S3N A;  3BOQ A;  2HOA A;  1VQ6 I;  3NWS A;  4NC7 A;  4AVZ A;  1ULY A;  1HF0 A;  4CYC A;  2GIV A;  3JAM Z;  2E35 A;  1OYW A;  3BR6 A;  2ESN A;  2ECB A;  3HGG A;  2DOA A;  1O4X A;  3PIO F;  3GZN B;  3IKV A;  3D5L A;  1K4S A;  2ZXJ A;  4JX4 A;  2Y0S N;  3K70 D;  2DJI A;  4ZZD A;  5HVQ C;  1N78 A;  4H0E A;  4B8X A;  4FX0 A;  3TOB A;  3HSF A;  5ILU A;  2A07 F;  2GIZ A;  4LG0 B;  2Y31 A;  1ORK A;  3DF8 A;  4ESJ A;  2D2W A;  5E79 C;  2EIN H;  2OTL I;  3ECH A;  3CO7 C;  2G9W A;  2JSC A;  2HZD A;  1O7F A;  3C1D A;  1FBQ A;  3ZGK A;  3HG9 A;  4CGZ A;  2C6Y A;  2VPL A;  2K86 A;  3IH3 A;  4F52 A;  3A2K A;  4OMZ A;  3WG9 A;  4XRF A;  3E7L A;  1W0U A;  3TOA A;  3K1N A;  2VJ4 A;  1YE9 A;  4YIR X;  2QSF X;  4IHX A;  2M34 A;  2HTJ A;  5FKN A;  2K40 A;  4HAM A;  2HNH A;  1OCT C;  3E6C C;  4OIO F;  1LB2 A;  2L9V A;  4G7O F;  4ETS A;  2UXX A;  1K4T A;  2A5W A;  4ZYH A;  2BY0 A;  2R5Y B;  4XR6 A;  1KYZ A;  4PJM A;  3TP0 A;  1TW2 A;  2X9D A;  4Y15 A;  5KAI C;  1BBY A;  2EJR A;  4L9N A;  5GAH J;  5HOO A;  1LEA A;  2V4J C;  1W1W E;  2WY7 Q;  3H9G A;  4CUG A;  3LSK A;  1WHU A;  3OOP A;  3VOE A;  1QRY A;  2XKO A;  3GTG J;  5M3M J;  4AD9 A;  2LDU A;  3M07 A;  4Y4R A;  3IAM 2;  2IGN A;  2GXA A;  2KLO A;  4PJ0 C;  2MC4 A;  1X4O A;  5FRM A;  4XMY A;  4HST A;  1KGS A;  2XPW A;  2XV4 S;  1UAA A;  3LSP A;  4HQM A;  1QO0 D;  1BI2 A;  1JJ6 C;  3BR1 A;  3CQZ J;  1HOM A;  5LHG A;  1P6R A;  1EKE A;  3OIO A;  1CF7 A;  3ECO A;  1JUM A;  4KYW A;  1HKS A;  4A5N A;  2XGD A;  2I8D A;  1MBJ A;  1SVL A;  1UFM A;  2QM3 A;  2XVC A;  4LIV A;  1Y6I A;  5F64 A;  2XAU A;  3ZXS A;  3ZCO A;  3BT9 A;  1I50 J;  3LSM A;  3MWM A;  1HSJ A;  4BJT A;  3DPT A;  1F43 A;  1X1P A;  2H94 A;  1DQU A;  3O8H A;  4I0A A;  1MKM A;  4AC0 A;  3BG5 A;  2I5U A;  4KUM A;  3SQN A;  2F5E A;  2DK8 A;  1LUJ B;  1DP7 P;  2NVY J;  3GO5 A;  3PJR A;  1G3Y A;  1W0T A;  2JN6 A;  3LSR A;  2LRD A;  1F1Z A;  4ENK A;  5E1Z B;  4A3L J;  2XGC A;  2V79 A;  4XQF A;  1YG2 A;  2ID6 A;  3J7Z I;  2LP0 A;  2O0Y A;  2TRT A;  5FJ8 J;  3OYC A;  3HOY J;  1WH7 A;  2LD5 A;  2WAQ N;  3RKW A;  2VPR A;  3EPZ A;  4KT5 C;  2XPU A;  4IX7 A;  2OV7 A;  1FZP B;  2L3D A;  1XMA A;  3E5Q A;  3ZQI A;  2ZO4 A;  4UUT A;  4FCY A;  4V19 K;  1G3T A;  1A36 A;  2E7X A;  2MLG A;  5J1R A;  3EQL F;  1H8A C;  1C0W A;  2M4G A;  3OYN A;  1HW1 A;  3VDX A;  1T39 A;  4XBF A;  2VIX A;  3JTH A;  4A3I J;  3M8F A;  3TW7 A;  4HSR A;  4GRI A;  2IXS A;  1UHW A;  3CZ6 A;  3DWL E;  3VYS B;  4EJT A;  3FXQ A;  3K4K A;  1H89 C;  3GLL A;  1UST A;  2X51 A;  1FIA A;  3CMM A;  4IEJ A;  2EQR A;  4CDG A;  5FLX Z;  2IGM A;  3L2R A;  1MBF A;  3GME A;  4OAZ A;  1W36 D;  3VSK A;  2YX7 A;  2YUS A;  3QPL A;  4BQO A;  1YRN A;  2VKE A;  5EEG A;  4M73 A;  1MBG A;  2KIQ A;  4MGR A;  1K6O A;  2X0L A;  2FBH A;  1G3W A;  4RGR A;  5FLV A;  2R93 J;  4ZYD A;  4ON0 A;  4OU0 A;  2L7F P;  4XSZ F;  1GV2 A;  4ENN A;  4F3Q A;  3DKW A;  4HX4 A;  4V2F A;  3RYP A;  4BHB A;  3EUA A;  5LD2 C;  2JA6 J;  3C2G A;  1W5C C;  3ZQL A;  1NG6 A;  2Z99 A;  3MKY B;  2IA1 A;  1ETK A;  2HOE A;  2OCE A;  1FOW A;  1JT0 A;  2K9Q A;  4YEL A;  4CCM A;  1RUN A;  4R8H A;  2E2I J;  5D4R A;  3CCM I;  4N4N B;  2X6W A;  1O3S A;  5CLS A;  4OIP F;  1ZEL A;  1POG A;  2JPB A;  5FKM A;  2R7F A;  3BY6 A;  5ILS A;  1Z05 A;  2Y48 A;  2KRC A;  4UUV A;  4RB0 A;  5ICC A;  2LYC A;  4DQ2 A;  1AWC A;  3CCL I;  3RPU D;  4Z6Y A;  3S32 A;  4H4K C;  1Y8R B;  4HV5 A;  5J8F A;  4IKF A;  1Z6R A;  2A05 A;  4LIU A;  5KHD A;  3GZ5 A;  3WGH A;  2PMZ A;  3GFM A;  4IF4 A;  2IJL A;  1SD4 A;  2OU2 A;  1VFC A;  3CC7 I;  2L9S A;  1K78 B;  1T33 A;  2QKM B;  2XAQ A;  3K69 A;  5J47 A;  1T38 A;  4XOP A;  4BYY A;  2W85 A;  3FMS A;  1BIB A;  2EPF A;  1IDZ A;  1MMN A;  4NC8 A;  4BUP A;  2DYS H;  4M9S A;  5FKO A;  2HR3 A;  2O9L A;  2DJN A;  1PDN C;  2AXL A;  5BQT A;  4II3 A;  3BCB A;  2O7O A;  2NS7 A;  1XS9 A;  2IBD A;  3CP2 A;  2BY1 A;  1JTX A;  5F0H A;  2LRE A;  2V6C A;  1IRZ A;  1FEX A;  3I58 A;  2DDA A;  3D5R C;  2ELJ A;  1SFE A;  4MHG A;  1FTT A;  4HEA 2;  4X0G A;  2QLZ A;  3RIR A;  3S93 A;  1OCO H;  2RN7 A;  3ZMD A;  2ACJ A;  2AS5 F;  2WB1 A;  4LB5 A;  5DTD A;  4CZC A;  1WJA A;  4FET A;  4FX4 A;  3KZY A;  2K27 A;  4BDZ A;  2M0M A;  4OWR B;  3HOS A;  1ZAR A;  4R79 A;  3L2W A;  4FHT A;  4QWQ A;  2Y0M A;  3GLX A;  1TTY A;  1Y39 A;  1ACI A;  4A6E A;  2VOD A;  5H6Q A;  2HDD A;  3TBI A;  3OIQ A;  3CCS I;  2DFH A;  3I3L A;  4WF2 A;  5FRO A;  1G2H A;  2V9V A;  3CTA A;  2CYY A;  2JMW A;  4D7M A;  3M7G A;  2QZ8 A;  1ZRF A;  4KIG A;  3LSH A;  1G6N A;  4FAS D;  4ABZ A;  1FTZ A;  1FIP A;  1NHA A;  4YFX F;  3I5U A;  5HS9 A;  3LSJ A;  4UB6 C;  3H92 A;  2PMU A;  3KYC B;  3FM5 A;  4L9T A;  2HKX A;  3L2Q A;  4M74 A;  3P9I A;  4IQ4 A;  3GXO A;  1DPR A;  4ZH4 F;  2HQN A;  3K1P A;  5LBQ A;  3TP3 A;  2HYJ A;  2A68 F;  3R4K A;  3JRA A;  2DK5 A;  2DMP A;  2K9L A;  3WE3 A;  1KU3 A;  3Q9V A;  3OYA A;  2HEO A;  3PUB A;  1R6R A;  5IYC J;  4B44 A;  2OF7 A;  5E1X A;  1F4K A;  1HKT A;  3NEU A;  3H5R A;  2W48 A;  1LJ9 A;  2NOG A;  2CU7 A;  2HVS A;  1S7E A;  4C9Y A;  3G4S I;  1ZQ3 P;  3LMM A;  4CCO A;  5JI6 A;  3QU3 A;  3KEO A;  1F9N A;  3DU6 A;  5DYM A;  1FT9 A;  4OIQ F;  3PM1 A;  4KN4 X;  2ZXW H;  1HA8 A;  4GYG A;  2ZSI B;  3WHC A;  4IO9 F;  4HNV A;  3OYF A;  3M9A A;  4G7H F;  2ZME A;  4A3D J;  2DFI A;  2VC1 A;  4XRM A;  3I59 A;  2DOD A;  3BCA A;  1SFX A;  1XN7 A;  2ELK A;  3A1Y A;  4BNC A;  5JLX A;  1S72 I;  3HRU A;  4D9J A;  2QQA A;  4DGW B;  3RSN A;  1MH3 A;  2CUJ A;  1EJ9 A;  1YJN I;  2CUZ A;  5DCM A;  2DLL A;  1Q1V A;  1J0R A;  4CHU A;  2FQ4 A;  1U8R A;  1IDY A;  2VE8 A;  2NVQ J;  5GPA A;  3TL4 X;  3DBH B;  2G7H A;  1SVO A;  4W97 A;  2D1H A;  2QEX I;  1ENH A;  4ENM A;  4DYR A;  2P6S A;  1TWA J;  1UHM A;  2W00 A;  2E60 A;  4XLF A;  1E17 A;  1YRN B;  4JK1 X;  2P0W A;  2HDW A;  2QQB A;  5J6X A;  1MMA A;  3DTE A;  2OC6 A;  4FTH A;  3VYU B;  3S2D J;  1R71 A;  1FYM A;  1FY7 A;  4IHW A;  2XSD C;  2MAB A;  1KU9 A;  2V9P A;  3L2U A;  3GUD A;  1G4D A;  3KP3 A;  1WSU A;  2Z2S B;  1EV7 A;  3AL0 C;  5BPI A;  1T2K A;  4RS8 A;  1VQN I;  2E7W A;  2E19 A;  4KA4 A;  1D0Z A;  1R1U A;  2R4G A;  5A2Q K;  1ZGA A;  4HV6 A;  1KZH A;  3BPX A;  3BG7 A;  2DBB A;  3DKX A;  3GFI A;  1PUF A;  2PLY A;  1IN7 A;  3OL3 A;  3HZJ A;  4AID A;  1ETQ A;  3BZK A;  2VKD A;  5GAG J;  3I53 A;  2L0K A;  2F5C A;  2XRN A;  1I5Z A;  1TQI A;  3IP4 B;  5KAF C;  3KLO A;  1N75 A;  4J00 A;  1SVM A;  1YJ9 I;  2CQK A;  2X4H A;  3OS0 A;  2PMH A;  4ZYG A;  2BVL A;  3OSG A;  1R4N B;  2BE5 F;  3F6V A;  1NH3 A;  1SFK A;  1BM9 A;  3G71 I;  2XF7 A;  3RZO J;  4PGG A;  2STW A;  1LNW A;  2ECC A;  3B6A A;  2R7Z J;  1LFU P;  4GYI A;  3PO3 J;  3OR2 C;  5D6E A;  3FZV A;  1FOY A;  4IZZ A;  2DTR A;  1U8B A;  1K79 A;  1CGP A;  1Z1D A;  3IHU A;  2DA1 A;  2XAF A;  4M3G A;  2X1E A;  5K1Y A;  3FDY A;  1XPX A;  3I64 A;  4X1E A;  9ANT A;  2KQR A;  5E3L A;  4OOI A;  2ZB9 A;  3KP7 A;  1FP2 A;  3ERE D;  4XKV A;  4MFE A;  4MTE A;  5E8G A;  2VJJ A;  1SFO J;  2H27 A;  1LE8 A;  1FOX A;  2MBF A;  1WGX A;  3A0B C;  2WV1 A;  5FKL A;  1OCP A;  2CJJ A;  2ZME C;  1D0Y A;  2DFF A;  4U7D A;  1KU7 A;  2NOJ B;  1A35 A;  1BR2 A;  3A02 A;  3WTW C;  2NS8 A;  4MQV A;  3OV8 A;  4XLA A;  3LOC A;  3WTZ A;  4YRV A;  2LK2 A;  4UUS B;  1BC7 C;  4ANJ A;  2Z33 A;  3DLA A;  2W82 A;  1FSE A;  3CJN A;  3KZI C;  2ZJ2 A;  1ON1 A;  5CVI A;  4A0X A;  4PCQ A;  1ZRE A;  4XSX F;  3CJQ B;  5J8C A;  1MSE C;  2JRT A;  3CUQ B;  4RM3 A;  2R0Q C;  1IXC A;  3JRI A;  3N4M A;  1ZHF A;  4MTD A;  1TP4 A;  4BU2 A;  3HJE A;  1Z21 A;  2E1M B;  1HLV A;  4EGY A;  2FX0 A;  4A3K J;  2CFX A;  2QQ8 A;  4Z2Y A;  2IS6 A;  4L9V A;  4BGD A;  3MCZ A;  5K7H A;  1GT0 C;  2F4M B;  3K2Z A;  5DM7 F;  1MDM B;  1B8I A;  4WK8 F;  2VLA A;  4WXH A;  2EH3 A;  2CH0 A;  4A0Y A;  4EQQ A;  3SFI A;  4EMS A;  4RAG A;  2IA0 A;  4HNT A;  3M8E A;  4NBQ A;  1WFX A;  3QP5 A;  2KJC A;  1IF1 A;  2LY1 A;  2JA8 J;  1IRX A;  1PJR A;  2VKV A;  2BEO A;  3HYI A;  3JCU C;  4LFU A;  4BEH B;  3L1P A;  3G1M A;  4S05 A;  2MA3 A;  1T08 B;  5JVG F;  3L00 A;  1VQM I;  5D5W B;  1ZGJ A;  3FXO A;  4U7B A;  2PJR B;  2KJB A;  5EYR A;  3JRE A;  2ZNZ A;  4E7Z A;  1XSX A;  4WXC A;  2V7F A;  2ZFU A;  4NDL A;  5BOX A;  4C3J J;  2VOO A;  1ZAO A;  1YTY A;  3FIW A;  4BXX J;  1L0O C;  5FRN A;  2LMD A;  2RV8 A;  4BE2 A;  2W1O A;  4C30 A;  3UR3 C;  3I4M J;  4EV0 A;  3GYH X;  1QPI A;  1LVA A;  2CV2 A;  3J81 K;  2WC2 A;  3CCE I;  2KHM A;  4CIC A;  3CLO A;  5HLI A;  2WAQ A;  5JHU A;  3AKZ A;  1J2X A;  3VYR B;  3AG3 H;  1ZG1 A;  2EFW A;  4Y17 A;  2DDB A;  1T8I A;  5L3D A;  1WQ2 A;  2BHZ A;  3S8P A;  3OYE A;  3FF5 A;  1UG0 A;  3GTL J;  3WTS C;  1I6X A;  3LAJ A;  4BXU A;  4AIJ A;  1I27 A;  4PFO A;  4PK4 A;  4BBS J;  2L54 A;  4ZDO A;  3GBG A;  3ZRG A;  5F08 A;  3SEQ A;  1XSV A;  2FUG 2;  5F0F A;  2A6T A;  3HOW J;  2BBY A;  3KIO A;  3F23 A;  2TCT A;  2XC7 A;  5HS7 A;  1VF9 A;  1RRJ A;  2Q0O A;  2XSJ C;  5JHF A;  3ROU A;  2JA5 J;  1TZL A;  1Y1W J;  2XKP A;  3OMY A;  2BY2 A;  3AFH A;  4NB5 A;  4FT8 A;  3HRT A;  3DKY A;  1OCR H;  1GHC A;  2DN0 A;  1OR7 A;  3DEE A;  2EIJ H;  1R9T J;  1WJB A;  4XNF A;  1IV6 A;  1ZK8 A;  4M3D A;  5KNL A;  2HOT A;  2FOK A;  3Q5F A;  4RB2 C;  5EZH A;  3FX3 A;  2XF5 A;  4EJO A;  1OKR A;  5IT3 A;  1SC7 A;  2BOL A;  5LRR A;  4C2U A;  3CUQ C;  5BNG A;  2XB0 X;  3E1S A;  3HHG A;  2IAI A;  1FNN A;  3MZ8 A;  4B3X A;  1XMK A;  2M4K A;  3I59 B;  4KIF A;  4A6D A;  3R6S A;  4UVA A;  2WY8 Q;  2XGE A;  5LEK A;  1J7K A;  3H5N A;  4L0Y B;  1R1V A;  3O6B B;  2VBY A;  3BJO A;  3BR5 A;  2VB6 A;  4RB1 A;  1R58 A;  3C3W A;  2QQ9 A;  4ASN A;  4KT6 A;  3SXY A;  1USS A;  1SAN A;  2EFP A;  2MH2 A;  2LSO A;  3H3U A;  2K5C A;  5IOY A;  2QWW A;  4Y52 J;  5IP7 J;  3HDD A;  2FOW A;  2QYO A;  1O3T A;  1DDN A;  4M6Y A;  5DUI A;  4D5C A;  1I1G A;  5TJJ A;  3G2B A;  2ME6 A;  4CCN A;  1O3Q A;  4UXN A;  2M2E A;  5E18 F;  4ZC3 A;  3FMR A;  3TW6 A;  2MFZ A;  4XKW A;  1R00 A;  3V8J A;  4MFD A;  2VUM J;  1B9M A;  5GTI C;  4I01 A;  3OYH A;  1IZ1 A;  2FRH A;  1MMS A;  2HVQ A;  4AU7 A;  1ZN2 A;  3HOV J;  4JX6 A;  1D8J A;  5LRS A;  2L9N A;  2RNG A;  3C7J A;  4LB6 B;  4CYC B;  5FKK A;  1YX3 A;  5DCM B;  5F27 A;  1DP3 A;  2JTV A;  1ZG5 A;  2V26 A;  1NK2 P;  3W2A A;  3WU2 C;  2BHY A;  2Y2Z A;  3HBL A;  4QPQ A;  1I3Q J;  2ZFW A;  3G1O A;  3JRH A;  1V3F A;  2R7V A;  1CF7 B;  2BZT A;  2ZBK A;  1B4A A;  3K10 A;  2LKS A;  2FBI A;  4YIF A;  2BYV E;  2R7X A;  1V5G A;  3S1Q J;  2QSH X;  2GAU A;  2A5Y B;  3H9J A;  3RKY A;  3FXJ A;  2P81 A;  2KIF A;  1OR7 C;  2AHQ A;  2Y75 A;  1ZR2 A;  1TNS A;  2CUE A;  4BQQ A;  1U5T C;  3K1M A;  2QBY A;  1S9H A;  3T1B A;  5LHI A;  1HDD C;  4PSX A;  4U0V A;  4PUS A;  3VB2 A;  4UVC A;  3OYM A;  2MD5 A;  1QQI A;  4S0H B;  3OOU A;  2A61 A;  4GFB A;  2DA5 A;  1PUF B;  3HOT A;  3CUQ A;  2BXZ A;  3RI4 A;  1IUF A;  5KK1 A;  3JTG A;  3DLL F;  5FD5 A;  2K85 A;  4V2G A;  3V8K A;  4A3G J;  3P9K A;  3QYB A;  2V6E A;  2DOE A;  2F5D A;  3WU0 A;  1VQ7 I;  1JI8 A;  1D3Y A;  2GA2 A;  2DA7 A;  1RZ4 A;  1OJL A;  4HBL A;  4B47 A;  1KQ0 A;  1TC3 C;  1FX7 A;  4YFK F;  5J4V A;  1MW7 A;  3FM3 A;  2M45 A;  3TQN A;  3A01 A;  3CJT B;  4II2 A;  3VOD A;  3CCV I;  2VI6 A;  4A3E J;  2OA4 A;  4G6D A;  2X85 A;  2WV0 A;  3OYL A;  3IWZ A;  2E5Z A;  1MMG A;  1DUX C;  1I3A A;  4XN0 A;  2E1O A;  3FXL A;  4P5O A;  2L4A A;  4XLP F;  2I10 A;  3S2H J;  5D5X B;  3HPH A;  2EIM H;  3BTL A;  2HVR A;  1OIS A;  2FD5 A;  3QQA A;  1WPK A;  2A69 F;  4XRS A;  3MZH A;  3JSP A;  1YHQ I;  4N0B A;  1A6Q A;  2XDV A;  5ICF A;  3F8F A;  4AVP A;  1ZR4 A;  3CF2 A;  1VZ0 A;  4CZZ A;  3RCO A;  1SMT A;  4KFC A;  1YIO A;  4CCL A;  2E71 A;  4UHT A;  1XDU A;  3W2W A;  4HF1 A;  3MQ0 A;  2DFE A;  3HUG B;  3I0T A;  1FMW A;  4PJN A;  2OQR A;  5JLW A;  4G8X A;  4LLG F;  4BH9 A;  3HOZ J;  4OIN F;  4RMN A;  1JT6 A;  1RR8 C;  2WBM A;  2OCC H;  1S8N A;  4I76 A;  1REP C;  3GTM J;  1P2F A;  3WTU C;  3LNQ A;  2IGO A;  3RQ4 A;  2F5F A;  3LSI A;  1D1A A;  4G12 A;  4IHS A;  4HLX A;  3BG6 A;  2ISY A;  3RJP A;  1GXQ A;  3A01 B;  5CVV A;  3ELK A;  2KZG A;  3M1E A;  1IN8 A;  4DYQ A;  2ZCW A;  4RAY A;  1UJ8 A;  3B02 A;  2V1X A;  3V7C A;  1ZGW A;  4GXO A;  4XL9 A;  3M3Y J;  3PNT A;  4MEY F;  4YII A;  4EJW A;  5L3F A;  5E8I A;  3GX4 X;  4G6Q A;  1D5V A;  1YLF A;  4E7K A;  5C44 J;  1MDM A;  2OZ6 A;  1UB9 A;  4W1U A;  1R1T A;  2IVM A;  1JHF A;  2K4J A;  5EEA A;  5DM6 F;  2WA0 A;  1QZZ A;  4E70 A;  5DD8 A;  1RIO H;  1HST A;  3H9Q A;  1Y1V J;  2VJ5 A;  1FYK A;  3A03 A;  1BL0 A;  5FFZ A;  4L5I A;  4O3M A;  1P7J A;  4RGX A;  4DBQ A;  4IHV A;  1QU3 A;  2CUF A;  2RC4 A;  1LDK B;  4Y33 A;  1D5Y A;  4I2O A;  3BRO A;  3DPL C;  3ONQ A;  2OUM A;  3A4C A;  2LBF B;  3QRF F;  4HDV A;  3VWB A;  5KVR A;  3PSF A;  1HDP A;  1QVU A;  1MIJ A;  2CRG A;  3F8N A;  2E1M C;  1SD6 A;  3BR2 A;  3JR9 A;  1WJF A;  5F04 A;  5K7Z A;  2LC2 A;  3J7A Y;  4IXA A;  3RYR A;  2KDZ A;  2VQC A;  4EM0 B;  1XCB A;  2O8K A;  1UMQ A;  5H6R A;  1BI3 A;  3J80 Z;  2G0E A;  1VQO I;  2R7R A;  4M3E A;  1X1A A;  2PJP A;  1YYV A;  3E6B A;  3WTX C;  2M7B A;  2EFN A; 
#chains in the Genus database with same CATH homology
 4PGH A;  3I71 A;  4AIK A;  2O8X A;  1S29 A;  1TLH B;  2NNN A;  5ERI A;  4ESF A;  5L3G A;  2PFB A;  1B1B A;  3JW4 A;  4IRG A;  2YR2 A;  3R0J A;  1FWZ A;  5L3E A;  4I7H A;  2K4B A;  3R60 A;  1OYY A;  4M72 A;  1B9N A;  1S7O A;  2OAZ A;  1Z7U A;  1U78 A;  2OBP A;  4WX9 A;  3ZQ7 A;  1J75 A;  3RDI A;  3HUG A;  4RGS A;  2IPQ X;  3L09 A;  1MZB A;  3GVA A;  1K78 A;  4RAZ A;  2D1V A;  1XSD A;  2CO5 A;  2COM A;  3V7S A;  1IXR C;  1RUO A;  3HSE A;  2KKO A;  3F8M A;  1A04 A;  5DDG A;  5TRD A;  1PP8 F;  2EFO A;  5BMZ A;  1YO5 C;  2KIU A;  1MGT A;  2DQR A;  4UNO A;  1IW7 F;  3HHH A;  4XLN F;  4EM2 A;  3T5X A;  3LQR A;  4IHT A;  2O61 A;  1VTN C;  1HW5 A;  1R23 A;  4R1H A;  2R7D A;  2HZT A;  5LHH A;  1O3R A;  4IRH A;  2YX4 A;  4LK1 F;  2ESH A;  3L2C A;  2VBW A;  2FSW A;  1R36 A;  4M9Z A;  1JHH A;  1ZH5 A;  1T0F A;  4K2E A;  1Z91 A;  2IW5 A;  5JVT A;  3J80 K;  2E1C A;  4N9H A;  3ZN1 A;  5D6F A;  3GFL A;  3HRM A;  4G94 A;  5JR3 A;  3BWG A;  1QPM A;  4EGZ A;  3R0A A;  2M87 A;  1FYL A;  4Q47 A;  1J5Y A;  5K5Q A;  4I0B A;  2EA4 A;  4GCV A;  1S6L A;  1W7P D;  2MLK A;  1BIA A;  1O7L A;  5E20 A;  3TKY A;  4IVN A;  3GW2 A;  1TW3 A;  4L18 B;  2M30 A;  2JZY A;  2XAH A;  3PQJ A;  3I4P A;  3QPT A;  3G73 A;  3DQV C;  3ABU A;  3WE2 A;  1OMI A;  4N9I A;  5E1W A;  2NS0 A;  2HDC A;  4YG2 F;  3E97 A;  2KIM A;  2ETH A;  2W57 A;  5CYV A;  1HQC A;  4LLL A;  3DFG A;  2OZU A;  4LG0 A;  1P92 A;  2VE9 A;  5BS6 A;  2MH9 A;  3DP7 A;  3T8T A;  5LGN A;  1F5T A;  3DEU A;  4U88 A;  2Q2E A;  3U9G A;  2EV0 A;  4PDK A;  3KP4 A;  2VBX A;  3GFJ A;  3C18 A;  3DV8 A;  5CJ9 A;  4L9J A;  2HGC A;  2GA1 A;  1BN5 A;  3HSR A;  3KP5 A;  5DV5 A;  1LEB A;  1HBX G;  1OPC A;  2LKP A;  3ULQ B;  3V4G A;  4NHJ A;  4KIB A;  1Q1H A;  3QP6 A;  1B6A A;  2G7U A;  2IT0 A;  1XB4 A;  2IA2 A;  2ELH A;  1MJA A;  3WTV C;  4BQA A;  5ICE A;  2WWY A;  2DI3 A;  1W7P A;  1GVJ A;  1IN4 A;  3KP6 A;  4Q48 A;  3U2R A;  4LJZ F;  4IRI A;  4P96 A;  2ZNY A;  2H6C A;  4G9Y A;  4A5M A;  1RNL A;  3J7A O;  2QUF A;  2UXN A;  1YW8 A;  1FOK A;  4LLN A;  5LGU A;  3S2W A;  1J59 A;  4BHC A;  4BAY A;  1YS7 A;  2P6T A;  1TQM A;  3F8B A;  2FEZ A;  1SD7 A;  4KDP A;  2FBK A;  3VFZ A;  2VXZ A;  4GGG A;  4LGW A;  4L0Z B;  1W7P B;  1W5S A;  2R3S A;  3TGN A;  3T0Y A;  2Z5U A;  3N97 A;  5CVU A;  1TQP A;  2HTS A;  1PUE E;  3F8C A;  2GQQ A;  2VT2 A;  3T8R A;  3RPU A;  1V4R A;  1P4W A;  1XDS A;  1QBJ A;  1BI0 A;  5DCF A;  2O6G E;  3L7W A;  3TO6 A;  1TNT A;  2HWV A;  4M6X A;  2DQL A;  1I1S A;  1JE8 A;  1SFU A;  2A6H F;  2HS5 A;  2RQP A;  3ZMS A;  5HDN A;  2IRF G;  5ED4 A;  2OQG A;  3R61 A;  4OMY A;  3FMQ A;  3E6D A;  2FXA A;  4QLC U;  4JQF A;  4Q5S F;  3E3V A;  3KZZ A;  4I02 A;  5JFR A;  1W5T A;  1XGM A;  3WTY C;  2EB7 A;  2Q8K A;  2TDX A;  2XAJ A;  2IP2 A;  1STZ A;  1FBS A;  4P9U A;  1U5T B;  4EJU A;  4TV7 A;  3EYY A;  2V1U A;  3MZY A;  1BJA A;  2A3S A;  2PG4 A;  1MJB A;  1J9I A;  2P4W A;  1KQ9 A;  2PEX A;  5LGT A;  5K5R A;  1S7A A;  2GXG A;  2FA5 A;  2NYX A;  2K02 A;  1IRG A;  1P4X A;  2DPD A;  3HTU A;  3COA C;  2VBZ A;  1G3S A;  3SZT A;  2OD5 A;  4B09 A;  4WXD A;  3KFW X;  2EWN A;  2NNY A;  1QGP A;  3LWF A;  3F21 A;  3REO A;  2RDP A;  1KYW A;  3NRV A;  1ZRC A;  2P7C B;  1S3J A;  1ZLJ A;  3IC7 A;  2NRA C;  1WI9 A;  1UCR A;  2L4M A;  3DXJ F;  2VN2 A;  5AIP A;  2EK5 A;  4D0P A;  2PI0 A;  3SZP A;  2EV6 A;  3GEZ A;  4O5V A;  1X3U A;  3KEQ A;  1D8K A;  4EVI A;  3G3Z A;  2DPU A;  3LAP A;  3BPV A;  3V7R A;  3F3X A;  3IRR A;  3QOP A;  1HW2 A;  3J81 Z;  2B0L A;  1W4M A;  2LF7 A;  2QBY B;  2VON A;  4U0W A;  5D5U B;  1FLI A;  4HDU A;  4MEX F;  5K5O A;  1BC8 C;  3EYI A;  1LQ1 A;  5F1R A;  2UZK A;  2P5K A;  3GZ6 A;  1R22 A;  2DT5 A;  2RGV A;  4L5J A;  3RPQ A;  5L3B A;  2QEN A;  1FSH A;  1U5T A;  1YW9 A;  1P4A A;  4HX8 A;  5HLH A;  4KNY A;  3CDH A;  1H0M A;  1IAW A;  3PQK A;  2VOP A;  1JGS A;  2FNA A;  1YFH A;  4U0Y A;  3FWE A;  3LA3 A;  1ZG3 A;  4KN7 X;  1ONV A;  3F22 A;  2P5L C;  3AAF A;  3ZP5 A;  2WTE A;  4HX7 A;  1FBU A;  1PP7 U;  3ZMZ A;  3K0L A;  4M9X A;  3U1D A;  4NQW A;  2STT A;  3FXR A;  3IWF A;  1Z6T A;  2FE3 A;  3BJ6 A;  3TDZ C;  4HW0 A;  3KE2 A;  3SHF A;  5FLX K;  4JBA A;  3ZMT A;  3QPH A;  3HIF A;  5DEQ A;  4MQ9 F;  4WWC A;  3SFZ A;  1ZLK A;  4BHP A;  3ML6 A;  3WU1 B;  3NQO A;  2K7L A;  3ABT A;  2XUB A;  1R5H A;  3ZMV A;  5IT9 K;  3IL2 A;  3EDP A;  3VEP A;  4I09 A;  2YU3 A;  3LST A;  1R7J A;  3KCC A;  4RGU A;  5HDK A;  4HQE A;  4CYD A;  1ZRD A;  5IT9 Z;  1WWX A;  2P5V A;  2RVC A;  1IN5 A;  5AON A;  1XGS A;  2M5W A;  3LA2 A;  4LMY A;  4UV9 A;  3B73 A;  2D45 A;  4IPA A;  3JAM K;  4WCG A;  1Y0U A;  2M8E A;  4LK0 F;  3CUO A;  1OYI A;  3JSO A;  1TBX A;  1XGO A;  2E1N A;  3F72 A;  2GXB A;  1U6G A;  3W6J B;  2XHK A;  3RTR A;  2ISZ A;  2EV5 A;  5EEH A;  2P8T A;  3L9F A;  3TDU C;  2P7V B;  1LDJ A;  4HYE A;  2VT3 A;  4ZZL A;  1LDD A;  5FD6 A;  1K7A A;  1WKM A;  1EH8 A;  1MJ9 A;  1R5G A;  2JPC A;  4EJV A;  6PAX A;  3O3K A;  3EUH A;  4HLY A;  3D0S A;  1E2X A;  4HF2 A;  3LFK A;  3F6O A;  1EH6 A;  3KLN A;  1FPQ A;  2XIG A;  3IRQ A;  1MD0 A;  2LF8 A;  3K9T A;  5D4S A;  1HXD A;  2DW4 A;  3LA7 A;  3TO9 A;  4KMF A;  4KMU X;  1YW7 A;  5ILV A;  2F2E A;  3KET A;  2CG4 A;  2DO7 A;  2HYG D;  3BJA A;  2Z9O A;  2EFQ A;  4O6J A;  3PFI A;  5FFX A;  4IJA A;  5A2Q Z;  2XAS A;  4EM1 A;  5AIQ A;  3QU6 A;  1HKQ A;  1H9G A;  5E17 F;  2FMY A;  2UWM A;  5H20 A;  2HKO A;  3LQQ A;  4P55 A;  2CWE A;  3BDD A;  4AIH A;  2J5O A;  3GWZ A;  2L01 A;  3TO7 A;  5BPD A;  1BI1 A;  4HF0 A;  3H3Z A;  4ZYE A;  3HRS A;  1IXS B;  3W6K B;  1GXP A;  2ADU A;  4MNU A;  1ON2 A;  1KU2 A;  1SMY F;  4CO8 A;  1SD5 A;  3BP8 A;  4GO1 A;  2PQ8 A;  5CVR A;  5FGM A;  5D5V B;  2PN6 A;  1Z9C A;  2W84 A;  3WTT C;  2GWR A;  2ZKZ A;  4KIC A;  5HLG A;  1O57 A;  2HQR A;  1DPU A;  2J5P A;  5LLQ A;  5DUK A;  1AOY A;  2XGX A;  3HTS B;  1IRF A;  2JT1 A;  5HS8 A;  3ISP A;  1QZY A;  2YSR A;  4I98 B;  1FC3 A;  3MFK A;  1T98 A;  4Q4Z F;  2GZW A;  3Q9S A;  3CO6 C;  4AWX B;  1KQ8 A;  2QVO A;  2BV6 A;  4HA8 A;  3FXU A;  1ODD A;  1U3E M;  1XD7 A;  2LNB A;  5D8K B;  2L02 A;  1T6S A;  5LEJ A;  2V1D A;  3I54 A;  1ZYR F;  2ZME B;  4UV8 A;  3RKX A;  1IUY A;  4A0Z A;  3P7N A;  4DNC A;  2O03 A;  1L3L A;  5CVJ A;  1KA8 A;  4LD5 A;  4ESB A;  1IN6 A;  2CW0 F;  2KRF A;  2FU4 A;  1YS6 A;  2M1B A;  3BZ6 A;  3GF2 A;  2FF4 A;  1EH7 A;  3MEX A;  2FQ3 A;  4CXF A;  2XRO A;  3V8L A;  4OIR F;  2H6B A;  5FO5 A;  4HOB A;  2CGP A;  5HDG A;  3IKT A;  2FML A;  2CSO A;  5D8L B;  1FP1 D;  2H09 A;  2O3F A;  4YFN F;  5DD4 A;  5L3C A;  1U2W A;  3WGG A;  4PZJ A;  5FB2 A;  4HZF A;  4F7Z A;  2Z3Y A;  1QNT A;  4ENJ A;  3E6M A;  3E5U A;  3KP2 A;  2FNP A;  4M71 A;  1SAX A;  2A6E F;  2XAG A;  1BOA A;  4RB3 C;  3ZMU A;  1WRJ A;  2DU9 A;  2NAZ A;  4G7Z F;  4P9F A;  3E5X A;  4A2U A;  3P9C A;  2W24 A;  2RNJ A;  2MC3 A;  2W25 A;  2DAO A;  2VC0 A;  3MAJ A;  4UVB A;  2BGC A;  2HYF A;  1RI7 A;  2PBI A;  4Y13 A;  5F6F A;  3EET A;  2YPR A;  1B59 A;  3O2P E;  3QAH A;  1XCV A;  2EA2 A;  2RKH A;  3WGI A;  3ZPL A;  1XGN A;  5ICG A;  4A12 A;  2HFH A;  3FHZ A;  3ZN0 A;  4S04 A;  1JXS A;  3WOD F;  1YQA A;  3BOQ A;  1ULY A;  2GIV A;  3JAM Z;  1OYW A;  2ESN A;  3IKV A;  3D5L A;  2ZXJ A;  4ZZD A;  5HVQ C;  4H0E A;  4B8X A;  4FX0 A;  3TOB A;  3HSF A;  5ILU A;  2A07 F;  4LG0 B;  3DF8 A;  4ESJ A;  2D2W A;  3ECH A;  3CO7 C;  2G9W A;  2JSC A;  1O7F A;  3C1D A;  1FBQ A;  4CGZ A;  2C6Y A;  2K86 A;  4OMZ A;  3WG9 A;  4XRF A;  3TOA A;  3K1N A;  2HTJ A;  4HAM A;  3E6C C;  4OIO F;  1LB2 A;  4G7O F;  4ETS A;  2UXX A;  4ZYH A;  1KYZ A;  1TW2 A;  4Y15 A;  1BBY A;  2EJR A;  4L9N A;  5HOO A;  1LEA A;  3OOP A;  3VOE A;  2XKO A;  4AD9 A;  2LDU A;  1KGS A;  2XV4 S;  4HQM A;  1QO0 D;  1BI2 A;  5LHG A;  1P6R A;  1CF7 A;  3ECO A;  4KYW A;  1HKS A;  4A5N A;  1UFM A;  2QM3 A;  2XVC A;  5F64 A;  3MWM A;  1HSJ A;  3DPT A;  2H94 A;  4I0A A;  1MKM A;  4KUM A;  3SQN A;  2F5E A;  2DK8 A;  1DP7 P;  3GO5 A;  1G3Y A;  1F1Z A;  4ENK A;  5E1Z B;  2V79 A;  1YG2 A;  2O0Y A;  3RKW A;  4KT5 C;  1FZP B;  2L3D A;  1XMA A;  3E5Q A;  2ZO4 A;  1G3T A;  2E7X A;  2MLG A;  3EQL F;  1C0W A;  1HW1 A;  1T39 A;  4XBF A;  3JTH A;  3M8F A;  4EJT A;  1UHW A;  3FXQ A;  1UST A;  4CDG A;  5FLX Z;  2YX7 A;  5EEG A;  4M73 A;  4MGR A;  1K6O A;  2X0L A;  2FBH A;  1G3W A;  4RGR A;  4ZYD A;  4ON0 A;  4OU0 A;  4XSZ F;  4ENN A;  3DKW A;  4HX4 A;  3RYP A;  4BHB A;  2Z99 A;  2IA1 A;  2HOE A;  1RUN A;  4R8H A;  5D4R A;  1O3S A;  5CLS A;  4OIP F;  2JPB A;  2R7F A;  3BY6 A;  5ILS A;  1Z05 A;  2Y48 A;  4UUV A;  4RB0 A;  5ICC A;  4DQ2 A;  1AWC A;  4HV5 A;  5J8F A;  1Z6R A;  3GZ5 A;  3WGH A;  3GFM A;  4IF4 A;  2IJL A;  1SD4 A;  2OU2 A;  1K78 B;  1T38 A;  2XAQ A;  3K69 A;  4BYY A;  2W85 A;  3FMS A;  1BIB A;  4M9S A;  2HR3 A;  1PDN C;  2AXL A;  5BQT A;  2V6C A;  3I58 A;  1SFE A;  4MHG A;  1YYV A;  2QLZ A;  3RIR A;  2RN7 A;  3ZMD A;  2ACJ A;  2AS5 F;  4LB5 A;  4FX4 A;  3KZY A;  2K27 A;  3HOS A;  1ZAR A;  4R79 A;  4FHT A;  4QWQ A;  2Y0M A;  3GLX A;  1TTY A;  4A6E A;  2VOD A;  5H6Q A;  4WF2 A;  2V9V A;  3CTA A;  2CYY A;  3M7G A;  2QZ8 A;  1ZRF A;  4KIG A;  1G6N A;  1NHA A;  4YFX F;  3I5U A;  5HS9 A;  3H92 A;  2PMU A;  3FM5 A;  4L9T A;  2HKX A;  4M74 A;  3P9I A;  3GXO A;  1DPR A;  4ZH4 F;  2HQN A;  3K1P A;  5LBQ A;  2A68 F;  3R4K A;  2DK5 A;  3WE3 A;  1KU3 A;  3Q9V A;  2HEO A;  5E1X A;  1F4K A;  1HKT A;  3NEU A;  1LJ9 A;  5JI6 A;  3QU3 A;  3KEO A;  1F9N A;  5DYM A;  1FT9 A;  4OIQ F;  4KN4 X;  4GYG A;  3M9A A;  4G7H F;  2ZME A;  2DFI A;  2VC1 A;  3I59 A;  1SFX A;  1XN7 A;  4BNC A;  3HRU A;  2QQA A;  5DCM A;  2DLL A;  1J0R A;  4CHU A;  1U8R A;  2VE8 A;  2G7H A;  2D1H A;  4ENM A;  2P6S A;  1UHM A;  1E17 A;  4JK1 X;  2QQB A;  5J6X A;  1FYM A;  1FY7 A;  1KU9 A;  3GUD A;  1G4D A;  3KP3 A;  1WSU A;  1EV7 A;  5BPI A;  1T2K A;  4RS8 A;  2E7W A;  4KA4 A;  5A2Q K;  1R1U A;  1ZGA A;  4HV6 A;  3BPX A;  2DBB A;  3GFI A;  2PLY A;  1IN7 A;  3I53 A;  2F5C A;  2XRN A;  1I5Z A;  1TQI A;  3KLO A;  2CQK A;  2X4H A;  2PMH A;  4ZYG A;  2BE5 F;  3F6V A;  1BM9 A;  4PGG A;  2STW A;  1LNW A;  4GYI A;  5D6E A;  3FZV A;  2DTR A;  1K79 A;  1CGP A;  1Z1D A;  3IHU A;  2XAF A;  5K1Y A;  3I64 A;  4OOI A;  3KP7 A;  1FP2 A;  3ERE D;  4MTE A;  5E8G A;  2H27 A;  2MBF A;  4U7D A;  1KU7 A;  3WTW C;  4MQV A;  3OV8 A;  3WTZ A;  1BC7 C;  2Z33 A;  1FSE A;  3CJN A;  2ZJ2 A;  1ON1 A;  5CVI A;  4A0X A;  4PCQ A;  1ZRE A;  4XSX F;  5J8C A;  2JRT A;  3CUQ B;  1IXC A;  3N4M A;  1ZHF A;  4MTD A;  4EGY A;  2CFX A;  4Z2Y A;  4L9V A;  3MCZ A;  3K2Z A;  1MDM B;  4WK8 F;  4WXH A;  4A0Y A;  4EQQ A;  4EMS A;  2IA0 A;  3M8E A;  3QP5 A;  2KJC A;  1IF1 A;  4LFU A;  2BEO A;  3HYI A;  4S05 A;  2MA3 A;  3L00 A;  5D5W B;  1ZGJ A;  4U7B A;  2KJB A;  2ZNZ A;  1XSX A;  4WXC A;  5BOX A;  2VOO A;  1ZAO A;  1YTY A;  1L0O C;  2RV8 A;  4EV0 A;  3GYH X;  1LVA A;  3J81 K;  2WC2 A;  4CIC A;  3CLO A;  5HLI A;  5JHU A;  1J2X A;  1ZG1 A;  2EFW A;  4Y17 A;  5L3D A;  1WQ2 A;  3FF5 A;  3WTS C;  1I6X A;  3LAJ A;  4BXU A;  4AIJ A;  1I27 A;  2L54 A;  1XSV A;  2BBY A;  3F23 A;  5HS7 A;  2Q0O A;  3ROU A;  2XKP A;  4NB5 A;  4FT8 A;  3HRT A;  1GHC A;  1OR7 A;  2FOK A;  3Q5F A;  4RB2 C;  3FX3 A;  4EJO A;  1OKR A;  5IT3 A;  5LRR A;  3CUQ C;  3HHG A;  1FNN A;  1XMK A;  3I59 B;  4KIF A;  4A6D A;  3R6S A;  4UVA A;  5LEK A;  1J7K A;  4L0Y B;  1R1V A;  3O6B B;  2VBY A;  3BJO A;  4RB1 A;  1R58 A;  3C3W A;  2QQ9 A;  4ASN A;  3SXY A;  1USS A;  2EFP A;  2MH2 A;  2LSO A;  3H3U A;  2QWW A;  2QYO A;  1O3T A;  1DDN A;  4M6Y A;  5DUI A;  1I1G A;  5TJJ A;  1O3Q A;  4UXN A;  5E18 F;  3FMR A;  1R00 A;  3V8J A;  1B9M A;  4I01 A;  1IZ1 A;  2FRH A;  1ZN2 A;  1D8J A;  5LRS A;  3C7J A;  4LB6 B;  5DCM B;  2JTV A;  1ZG5 A;  2ZFW A;  1V3F A;  1CF7 B;  2ZBK A;  1B4A A;  2FBI A;  4YIF A;  2BYV E;  2GAU A;  2A5Y B;  3RKY A;  2KIF A;  2Y75 A;  1TNS A;  1U5T C;  3K1M A;  2QBY A;  3T1B A;  5LHI A;  4U0V A;  3VB2 A;  4UVC A;  2MD5 A;  1QQI A;  2A61 A;  3HOT A;  3CUQ A;  3RI4 A;  5KK1 A;  3JTG A;  5FD5 A;  3V8K A;  3P9K A;  2F5D A;  3WU0 A;  1D3Y A;  2GA2 A;  1RZ4 A;  4HBL A;  1KQ0 A;  1FX7 A;  4YFK F;  3FM3 A;  2M45 A;  3TQN A;  3VOD A;  2OA4 A;  4G6D A;  2WV0 A;  3IWZ A;  1DUX C;  4P5O A;  2L4A A;  4XLP F;  5D5X B;  2A69 F;  3MZH A;  3JSP A;  4N0B A;  5ICF A;  4AVP A;  3F8F A;  4CZZ A;  1SMT A;  4KFC A;  1YIO A;  4UHT A;  1XDU A;  4HF1 A;  3MQ0 A;  3I0T A;  2OQR A;  4G8X A;  4LLG F;  4BH9 A;  4OIN F;  1S8N A;  1REP C;  1P2F A;  3WTU C;  2F5F A;  4IHS A;  4HLX A;  2ISY A;  3RJP A;  1GXQ A;  5CVV A;  3ELK A;  3M1E A;  1IN8 A;  2ZCW A;  4RAY A;  3B02 A;  2V1X A;  3V7C A;  4GXO A;  4MEY F;  4YII A;  4EJW A;  5L3F A;  5E8I A;  3GX4 X;  4G6Q A;  1D5V A;  1YLF A;  1MDM A;  2OZ6 A;  1UB9 A;  1R1T A;  2IVM A;  1JHF A;  2K4J A;  1QZZ A;  4E70 A;  5DD8 A;  1RIO H;  1HST A;  1FYK A;  5FFZ A;  4L5I A;  4O3M A;  4RGX A;  2RC4 A;  1LDK B;  4I2O A;  3BRO A;  3DPL C;  3QRF F;  4HDV A;  5KVR A;  3F8N A;  1SD6 A;  4IXA A;  3RYR A;  4EM0 B;  1XCB A;  5H6R A;  1BI3 A;  3J80 Z;  2PJP A;  1H9T A;  3E6B A;  3WTX C;  2EFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...