1S7AA

Nmr structure of the la motif of human la protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein, translation
molecule keywords Lupus La protein
publication title Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s7aA00
1YW7A 3R60A 1WRJA 3H92A 1CF7B 3L7WA 5ILVA 2RKHA 2WWYA 4ZYGA 2HOEA 3IC7A 2O03A 4BNCA 3B02A 1KU9A 4L9VA 3SZTA 3LFKA 1LJ9A 3R61A 2FBKA 1R7JA 3REOA 4M72A 3I59A 4FX0A 2JTVA 4HF0A 1SMTA 1KGSA 1R5HA 5LGTA 4ZZLA 2RV8A 1HSJA 5ICEA 1J0RA 4BH9A 3P9IA 1TQIA 1LDKB 3WTXC 2D45A 2NAZA 2DI3A 1TQMA 2HTJA 3C18A 4BXUA 2AS5F 3L9FA 1LQ1A 1XDSA 1TBXA 2DBBA 4DNCA 2RNJA 3TDZC 4HDVA 3SHFA 2Z5UA 4P9UA 1YQAA 3DPTA 5FFXA 4KT5C 3WTUC 2J5OA 3B73A 3FM5A 4L9NA 1MKMA 1MD0A 3GFIA 4AD9A 4XLNF 2A68F 2O3FA 2XHKA 3WTZA 1G3YA 2CSOA 1IN7A 1ZGAA 1Y0UA 1O7FA 3MZHA 4EVIA 1STZA 3K9TA 3GEZA 1T98A 4Q48A 1KA8A 1RUNA 5FFZA 3Q9SA 4HYEA 4A6EA 5HOOA 4HW0A 3WTTC 4LK0F 3DP7A 2HWVA 2M87A 2PJPA 1W7PB 1D8KA 2VBXA 2QENA 2MD5A 3QU6A 4HV6A 4HLYA 4ESJA 3GUDA 4HX4A 2VODA 3WTYC 2VBYA 1S8NA 1LDJA 1J59A 1FX7A 1D3YA 1BOAA 2AXLA 4LMYA 2OD5A 3E6CC 1OYWA 2ELHA 4NHJA 4KNYA 2EFPA 3F6OA 3DXJF 2Y48A 1KQ9A 2GQQA 3V8JA 4MEXF 3OOPA 2ADUA 4WF2A 3VB2A 1HKSA 2STWA 5JHUA 1QZYA 4O3MA 2IW5A 1R5GA 2PQ8A 3ZMTA 5ERIA 1TLHB 4A6DA 2V1UA 4HF2A 4AIHA 3ULQB 1PP8F 1B59A 4L5IA 2YSRA 3F22A 4FHTA 4WCGA 4LG0B 5LEKA 5A2QK 3O6BB 2CW0F 2DQRA 3HRUA 2PFBA 3M9AA 3IHUA 4FT8A 1Z9CA 2QBYA 3FX3A 1Z7UA 3TO7A 4CYDA 2RN7A 1HSTA 5E20A 3BP8A 1C0WA 4UV9A 1XGNA 4UNOA 3FHZA 2FSWA 2CO5A 2XASA 5A2QZ 1SD5A 1KQ8A 4RGXA 2OQRA 3N4MA 2JPBA 2ZMEA 2MA3A 5E8GA 2E1NA 1R36A 4N9IA 3KZZA 4GYGA 2O61A 2OZ6A 5F64A 1YW9A 2FU4A 5D8KB 3ABTA 1DDNA 2K02A 1FP1D 4MQVA 1YLFA 4Y15A 2H94A 2MH9A 3QP6A 4ON0A 2UZKA 4RGUA 1O3TA 2F5FA 1SFUA 3GYHX 3KP4A 1W7PA 2HGCA 3V4GA 4RS8A 3HHHA 3H3UA 3HRSA 4A5MA 3U2RA 1J5YA 4EM0B 3KEQA 3CUQB 2EFQA 1XMAA 1A04A 4PDKA 2NS0A 1UFMA 3KLNA 1P4AA 2ESNA 1XSDA 1K79A 4ENJA 3WGGA 1ZLKA 2P5VA 5BQTA 2HR3A 1CGPA 3HYIA 1OYYA 2FMYA 3VOEA 3KE2A 2L54A 1OMIA 1D5VA 4IHTA 3ML6A 2HYFA 5BPDA 1BI0A 1ODDA 1FC3A 4LLLA 3RJPA 3LAPA 1ZRCA 4M71A 5JFRA 2X4HA 5D5WB 2L3DA 2VONA 1KU2A 3HOSA 2EFNA 1U6GA 2VE8A 1U2WA 2Z9OA 5D5UB 4MQ9F 1FWZA 2K4BA 5H20A 4MHGA 4GO1A 2R3SA 3F72A 2FXAA 3WGIA 4GYIA 5J8FA 2JRTA 2VOOA 1O3RA 4ZYDA 3WU0A 3QOPA 5L3FA 4RB3C 3JAMK 4KMUX 3ZPLA 3E6BA 4UXNA 3KP5A 1IRFA 2LF7A 1MJ9A 4LLGF 2FF4A 4F7ZA 3M8FA 4RAZA 3KZYA 1USTA 2ZKZA 2L01A 1XCVA 4RGSA 1YFHA 2VOPA 3BWGA 6PAXA 5E8IA 3JAMZ 1E2XA 3GZ5A 2DPUA 4OU0A 1WQ2A 2KIMA 4YFNF 2PLYA 2XRNA 3TKYA 5L3BA 3QPHA 2D2WA 5ICGA 4ZH4F 4HX7A 5JI6A 5HS8A 2Z33A 1BJAA 4OOIA 2W25A 5DYMA 2NYXA 1FZPB 1V4RA 3QRFF 1UB9A 1SAXA 1MZBA 4A0YA 4UHTA 2EFWA 5DV5A 3TOBA 2HTSA 1P4WA 2XAHA 3EDPA 4ENKA 2PMUA 3K69A 4BQAA 1W5SA 3C7JA 2P6SA 5FO5A 3RPQA 4YFXF 3JTGA 3LA3A 1U8RA 1SFXA 4U0WA 5DD8A 3F3XA 1BBYA 1T39A 1S3JA 4HV5A 4U0YA 1BC7C 2HFHA 2K86A 1O7LA 1RIOH 2XKOA 3KP2A 4WX9A 2FNPA 4RB2C 2KIUA 5DUIA 4I0AA 2MH2A 2ZNYA 3MFKA 2HKOA 3EQLF 1T6SA 1OKRA 2DU9A 2Z3YA 4EGYA 4IRGA 2PEXA 5L3DA 2Y0MA 3HSEA 3H3ZA 5DCMA 2YR2A 5JVTA 4O6JA 2TDXA 1SD7A 4WXDA 1DUXC 4RB0A 3TO6A 2E1CA 4BYYA 3IWFA 4ZZDA 3RTRA 1REPC 3LA2A 3F21A 2VBZA 2YX4A 2MC3A 3GVAA 2OAZA 3W6JB 3FM3A 3NQOA 5KK1A 1U5TB 1ZRDA 2UXXA 2OU2A 3CTAA 5E1XA 4ASNA 3ELKA 2HS5A 3F8NA 5D4RA 1P2FA 3C1DA 2QYOA 1B6AA 3TQNA 4HAMA 2P5KA 5AIPA 1BIBA 2Q0OA 3K1MA 3DV8A 3ZMVA 3T0YA 5E1ZB 1D8JA 3PQJA 3PQKA 2XV4S 3RIRA 1TQPA 3DEUA 4OIPF 2FNAA 5CVJA 3HTUA 2FBHA 1XDUA 3DF8A 1JHFA 3O2PE 4GCVA 3RKXA 2VN2A 4EM1A 1SFEA 5L3EA 2HQRA 5DDGA 2RDPA 1S7OA 5EEHA 2GAUA 2FMLA 3R4KA 5TJJA 2P7CB 2O0YA 1LVAA 3LQRA 2RVCA 3MZYA 3L00A 2G9WA 1S7AA 4LFUA 2VC0A 1BI3A 1BI2A 5HDNA 2FE3A 1Z05A 2W57A 2LDUA 3V7CA 3ZN0A 4NQWA 2CWEA 1J7KA 2G7HA 2L4MA 2XGXA 1R00A 3S2WA 1DP7P 1P4XA 5E18F 1DPRA 2HYGD 2GWRA 5LHIA 2QQAA 3ECOA 1T38A 2P4WA 4NB5A 4U0VA 1LB2A 3J7AO 2IT0A 1WKMA 1FSHA 1CF7A 3Q9VA 3W6KB 3QAHA 1I6XA 1QQIA 1HBXG 3BPXA 2IJLA 3JW4A 1U5TA 1Z91A 2COMA 4JK1X 3IL2A 2ZCWA 3FXQA 5LHHA 2OZUA 1GHCA 4JBAA 1HXDA 4R8HA 1DPUA 5K5QA 3MCZA 4GGGA 3HSFA 1TW2A 3M7GA 1TTYA 2GXBA 4KN4X 4HQMA 2OBPA 1XSXA 2V6CA 1YIOA 5ED4A 4IHSA 3FXRA 5LEJA 3K1PA 2RGVA 1UHMA 2JSCA 4G8XA 5K5OA 1WI9A 3GFMA 4XSXF 4L9JA 3BY6A 1KU7A 2IA0A 1HW2A 1B4AA 3EYIA 1AOYA 2DLLA 3LSTA 5TRDA 3I54A 1QO0D 4M6XA 3IWZA 1U78A 3RYPA 1IW7F 4ESFA 4G7OF 1G3SA 4KUMA 2GA2A 1RUOA 1HW1A 4G7HF 3DPLC 2VBWA 1XD7A 2X0LA 3E3VA 3P9CA 5H6QA 4CHUA 4CO8A 4Q47A 3KCCA 4S05A 2B0LA 1BIAA 2EV6A 2ISYA 3E5UA 4EJUA 2VC1A 2DK8A 3VODA 5K1YA 5LRRA 4CXFA 2MLKA 5KVRA 3ZMUA 1VTNC 3BPVA 4UV8A 2DO7A 2A5YB 3IKTA 2OQGA 5BS6A 4R79A 3SQNA 3EUHA 2D1VA 5F6FA 1IUYA 3KETA 2A61A 2M30A 1RNLA 3RKWA 2ESHA 3P9KA 4UVCA 3F8BA 5HVQC 1YW8A 3ZP5A 4PGGA 3HTSB 1ZG1A 5E1WA 1MJAA 1J9IA 4QWQA 1IXSB 5HS7A 1E17A 3M8EA 4U7BA 1IXCA 4CICA 2DW4A 5HLHA 2GIVA 1K7AA 2PG4A 2EB7A 4S04A 3CO7C 4HZFA 2L4AA 2EA4A 2FRHA 4A0ZA 2C6YA 1YS7A 3T1BA 2BV6A 1BM9A 2P6TA 4XBFA 4I01A 2KKOA 2DPDA 1JXSA 4EJWA 4I98B 4LG0A 3AAFA 1B1BA 5D5VB 4R1HA 2K7LA 1YG2A 4OIQF 1R1TA 4LK1F 4EJVA 4A12A 1B9NA 4OIRF 4YIFA 5HLGA 1PUEE 3I64A 3FWEA 1XN7A 3PFIA 4XRFA 1F9NA 4U88A 4M9SA 3WE2A 1IN4A 4EJOA 4IRHA 1S29A 3I5UA 4M9ZA 5DD4A 1GVJA 3GLXA 3C3WA 1ZH5A 1X3UA 1ZN2A 2A6EF 2VT2A 1ZLJA 3K2ZA 4I2OA 1XGMA 4WXCA 4WWCA 4CDGA 3OV8A 3FMQA 2D1HA 1JE8A 3J81K 1LNWA 5LRSA 1J75A 3WTSC 3ZMDA 2HQNA 2HEOA 4IJAA 4O5VA 2LF8A 5D6FA 1YYVA 2J5PA 2H6CA 2VXZA 2EJRA 1I27A 4IPAA 3G73A 3HHGA 2R7DA 1T0FA 4PZJA 1HQCA 2JT1A 3CUQA 2MLGA 3J81Z 1I5ZA 3F8FA 4Y17A 4OMYA 3M1EA 1TW3A 2CYYA 1XB4A 1P92A 2DTRA 2H27A 2XAQA 4A0XA 3SZPA 2PI0A 5DEQA 2YX7A 2IA2A 1ZYRF 3V8LA 1Z6RA 1FPQA 5ICCA 4PCQA 2JZYA 3JTHA 1W7PD 3T8RA 4LB5A 5CYVA 3GZ6A 3IKVA 1B9MA 3E5XA 4ENNA 5BOXA 2W24A 4RAYA 2BE5F 3LA7A 3L09A 3ZQ7A 4RB1A 3R0AA 4AWXB 4AVPA 3RKYA 1IN5A 2ACJA 2MBFA 1F1ZA 1RI7A 4JQFA 1Z1DA 4N9HA 1IXRC 1SMYF 3ZMZA 4KN7X 5J8CA 2EA2A 2HZTA 5EEGA 2ETHA 2R7FA 5ILUA 2IPQX 2HDCA 2WTEA 1R58A 2BBYA 1FBSA 2Q8KA 1H9GA 3JSOA 3BROA 1ZRFA 2BGCA 1L3LA 3WU1B 2G7UA 3SXYA 1WSUA 3R0JA 1G4DA 1YO5C 2KIFA 1ZHFA 3F6VA 2M8EA 4TV7A 2VT3A 4AIJA 3GF2A 1FYLA 2Z99A 3FZVA 1O3SA 2P7VB 3KFWX 1XGSA 3LWFA 4CGZA 5D5XB 2DFIA 4EM2A 3D5LA 2PN6A 1HW5A 1BN5A 3J80K 3CUQC 4BHCA 4M73A 4BHPA 4B09A 4XSZF 3GWZA 4WXHA 1FBQA 1EH7A 2DK5A 3HSRA 2EV0A 3E6MA 2QLZA 1ZREA 2M1BA 1KU3A 3J80Z 4LB6B 2XIGA 3MAJA 1H0MA 2ZJ2A 2UWMA 2V1XA 4G7ZF 4KIFA 3I53A 2O8XA 5CVIA 2WC2A 1QBJA 1IF1A 1G3TA 1FNNA 4OIOF 1G6NA 3VEPA 1R22A 1QZZA 2NRAC 4ETSA 2DAOA 2K4JA 3CJNA 1S6LA 2FBIA 1SD6A 1T2KA 3QU3A 4P9FA 3R6SA 4M9XA 4G6QA 1GXQA 1MGTA 2H6BA 5CVUA 4LD5A 3ISPA 2BEOA 2A07F 3HOTA 3L2CA 2QBYB 4KDPA 3RDIA 3I0TA 4IRIA 1TNSA 1IN8A 3K1NA 1L0OC 2LSOA 3VFZA 5LHGA 5BPIA 2CFXA 4B8XA 1P6RA 4KICA 4BAYA 4LLNA 4CZZA 2ZMEB 5F1RA 4I09A 2RC4A 2Q2EA 1OPCA 3TDUC 3N97A 1KYZA 5FD5A 3F8MA 2IRFG 2KJBA 2A69F 3P7NA 2EK5A 2FOKA 4E70A 2VE9A 4EV0A 2V1DA 3I4PA 1FLIA 4HA8A 4WK8F 4GXOA 2DT5A 1UHWA 3WG9A 3HRMA 4L0YB 4P55A 4YG2F 1HKQA 2V9VA 4Q5SF 3DKWA 4I0BA 1FBUA 2YU3A 2PBIA 3RYRA 2XROA 3EETA 1IZ1A 1GXPA 5CVVA 1EV7A 3WGHA 1XMKA 1OR7A 4LGWA 2GZWA 2BYVE 2IP2A 2HKXA 3BJAA 1QNTA 3EYYA 3MEXA 2WV0A 2STTA 2NNNA 4ZYEA 2FEZA 3GW2A 5D6EA 1FP2A 1FSEA 1XSVA 3V8KA 1LEAA 2XKPA 4DQ2A 1KQ0A 4FX4A 1YTYA 3IRQA 2XVCA 2ZFWA 4KYWA 4RGRA 1F5TA 4Y13A 1ZG5A 4ZYHA 1ULYA 5CJ9A 2ISZA 3ERED 1K6OA 2P8TA 1R1VA 4MGRA 3U9GA 1Q1HA 4Z2YA 2YPRA 3BJOA 3BJ6A 4UVAA 3F8CA 3V7RA 3IRRA 4L0ZB 1IN6A 3FMRA 5CVRA 4LJZF 3I58A 1BI1A 2KJCA 3GFJA 1QGPA 2A3SA 3BDDA 1UCRA 1I1GA 2H09A 5E17F 4HOBA 5LGUA 5IT3A 1ZARA 3I71A 3WE3A 1YS6A 4MTEA 4AIKA 3QP5A 1O3QA 2PMHA 4IF4A 4MNUA 4KIBA 5H6RA 2IA1A 4HLXA 1G3WA 3DQVC 1Z6TA 4L18B 2ZBKA 4I02A 1U5TC 5JR3A 1RZ4A 4ESBA 3TGNA 1WWXA 3T5XA 1ZG3A 3ABUA 2A6HF 2GXGA 4QLCU 4UUVA 1JHHA 2ZNZA 3ECHA 2CGPA 4YFKF 5D4SA 3KP7A 4U7DA 1LDDA 1ON2A 2M5WA 1FYKA 1R23A 3LAJA 3KP6A 1XGOA 4KFCA 3NRVA 3MWMA 2CQKA 1V3FA 2NNYA 1JGSA 2LKPA 4G9YA 2P5LC 5DCFA 3CUOA 2V79A 1PDNC 1FYMA 1R1UA 1MDMB 3BOQA 2DQLA 1PP7U 2EFOA 4HQEA 2XAFA 4IVNA 4EJTA 3FF5A 5BMZA 2QUFA 1K78B 1H9TA 2EV5A 2XAGA 1FT9A 3JSPA 5D8LB 3ZMSA 2F5EA 3GFLA 5AIQA 3FXUA 1EH8A 5AONA 1OYIA 1TNTA 1ZAOA 5L3GA 3Q5FA 2E7XA 4M74A 3RI4A 1I1SA 3WTWC 2W85A 2M45A 3CLOA 3HUGA 3NEUA 1LEBA 2QQBA 1ZGJA 5FLXK 5FD6A 5DCMB 3BZ6A 5HS9A 4XLPF 3GO5A 2O6GE 1HKTA 2F2EA 2Y75A 3WODF 3KLOA 2W84A 3KP3A 2XAJA 3O3KA 5HDGA 4KIGA 2QWWA 1IAWA 2UXNA 5FLXZ 4P96A 4A5NA 4BHBA 2JPCA 1USSA 4HDUA 2F5DA 4D0PA 1U3EM 3GXOA 1KYWA 3FMSA 4EMSA 3GX4X 4L9TA 1XCBA 4Q4ZF 4M6YA 5FGMA 2FA5A 5FB2A 3I59B 2OA4A 2K27A 5J6XA 4H0EA 3E6DA 5HDKA 1SD4A 4HBLA 3LQQA 3U1DA 5LBQA 4KMFA 1J2XA 2RQPA 1ON1A 4MTDA 3RPUA 2F5CA 3DFGA 4YIIA 4KA4A 4PGHA 1W5TA 2FQ3A 1O57A 3WTVC 2KRFA 3E97A 4EQQA 4OINF 1W4MA 3F23A 1MDMA 4A2UA 1AWCA 2EWNA 4I7HA 2E7WA 4K2EA 4OMZA 2L02A 3QPTA 3T8TA 3CO6C 2ZXJA 3TOAA 4ENMA 5IT9K 1K78A 3G3ZA 1FY7A 3D0SA 5HLIA 1MJBA 2IVMA 4P5OA 4MEYF 2LNBA 3V7SA 3KEOA 3COAC 1NHAA 4HX8A 4EGZA 2ZO4A 4UVBA 4IXAA 1ONVA 5ICFA 3HRTA 3SFZA 2QQ9A 4L5JA 5LLQA 5IT9Z 4G94A 3CDHA 2CG4A 4HF1A 2GA1A 1FOKA 5K5RA 5LGNA 4G6DA 3HIFA 3K0LA 1QPMA 3TO9A 2QM3A 2XUBA 1EH6A 1IRGA 1BC8C 3ROUA 5ILSA 3MQ0A 4N0BA 3E5QA 5DUKA 5L3CA 3ZN1A 2QVOA 1F4KA 2QZ8A 5CLSA
chains in the Genus database with same CATH superfamily
2K9QA 1YW7A 3R60A 3SDBA 3LSHA 2WY8Q 1F43A 3Q0WA 3OYFA 3E1SA 2H1LA 1WRJA 2V9KA 3H92A 1CF7B 4RBOA 3PFYA 2QCOA 3L7WA 5ILVA 2RKHA 4PK4A 3FKIJ 2WWYA 4ZYGA 2HOEA 3IC7A 4XORA 2XPVA 2O03A 4CYCB 1WZ2A 4BNCA 5H2FC 3B02A 1KU9A 3A1YA 4MO7A 1MNDA 4L9VA 3SZTA 3LFKA 1LJ9A 2WAQA 3ZQHA 2JN6A 2DJIA 2R4GA 3CMEI 1X4PA 2DA5A 2CQXA 3R61A 2FBKA 3KX2A 3K4MA 1R7JA 3REOA 4M72A 3PIPF 4BE1A 3DBHB 3I59A 4FX0A 2JTVA 4HF0A 2L9SA 3K4KA 1MMNA 2DMTA 1SMTA 1KGSA 1R5HA 4G6TB 5LGTA 4ZZLA 2RV8A 4BEHB 4RLFA 1HSJA 2KMUA 5ICEA 1SANA 1FMWA 3D5SC 3HKZA 4XLEA 1J0RA 3IH4A 4BH9A 3H0GJ 2R5YA 3P9IA 3J7ZI 1TQIA 3CCVI 2MABA 1GDTA 1LDKB 3WTXC 2D45A 1XPXA 2NAZA 2K3PA 2DI3A 1TQMA 2HTJA 3C18A 4BXUA 3BR2A 2AS5F 3L9FA 1LQ1A 1XDSA 1TBXA 2DBBA 4DNCA 1BL0A 2RNJA 2L9NA 2MYSA 3TDZC 4HDVA 3PNTA 3W2VA 3SHFA 4BJTA 2MC4A 2Z5UA 1B8IA 4BY1J 1GVDA 4XLCA 4P9UA 1IDZA 1YQAA 3DPTA 3N05A 5FFXA 5EZGA 4BXXJ 4Y4RA 4KT5C 2ICWG 3WTUC 2J5OA 1I39A 1AKHA 2E1MC 3B73A 3FM5A 4L9NA 3CMAI 3HEFA 1MKMA 2R92J 1Y8RB 2IAIA 1MD0A 2VQHA 3ZGKA 3OSGA 1JUPA 3ABLH 3GFIA 2R7XA 4AD9A 4XLNF 2A68F 1UJ8A 2O3FA 2XHKA 4XICA 3DBLB 2JVHA 3WTZA 2LD5A 1G3YA 2CSOA 3NARA 1QVUA 1IN7A 1ZGAA 1Y0UA 1O7FA 3M1CA 1U9OA 4N4OB 3MZHA 4M3BA 2DOFA 2GOXB 3FKJA 4KJZA 1QVTA 4D5CA 3CCEI 4EVIA 1STZA 2CQQA 4C2UA 3K9TA 3BG3A 3GEZA 1NK2P 1T98A 4Q48A 3DCFA 1KA8A 3PO2J 1RUNA 5FFZA 3Q9SA 3S93A 3MKYB 4HYEA 1X1AA 1P9QC 4A6EA 2BY0A 5HOOA 4HW0A 1ETWA 1YJ9I 3WTTC 2EZHA 3DP7A 2HWVA 4LK0F 1D1CA 2V9PA 2Z2SB 1FIAA 1IUFA 4C9YA 4Y52J 2OTLI 2M87A 2PJPA 1W7PB 1D8KA 4E7SA 2VBXA 2QENA 2MD5A 3QU6A 4HV6A 4HLYA 3DBRB 4ESJA 3GUDA 3JRDA 2X6XA 4HX4A 1LFUP 2VODA 3GTPJ 3WTYC 1SVMA 2QQ8A 2VBYA 1S8NA 1LDJA 5CQGA 1J59A 1FX7A 2OCCH 1MH3A 1WI3A 1TT0A 5J3LA 2ECCA 1D3YA 1Y1VJ 2VQGA 2I10A 3WHCA 4MFDA 1BOAA 4JP0A 2KRCA 2AXLA 4LMYA 2L7FP 4AYBN 2OD5A 4XQFA 3E6CC 2HVRA 1OYWA 4IQJA 2ELHA 4NHJA 4KNYA 3NWSA 4HRIA 2LY1A 2WB1A 2EFPA 3F6OA 3DXJF 2ZJRF 2Y48A 3MVPA 3UNGC 3H5AA 1KQ9A 2GQQA 2CV2A 3V8JA 4MEXF 2KISA 3OOPA 2ADUA 4WF2A 5J4YA 2R5ZA 4DJAA 3VB2A 3K7AJ 2FX0A 3RZDJ 1HKSA 1LE8B 4E7JA 2STWA 1ZR4A 2W7NA 5JHUA 3A01B 1QZYA 2KZVA 2HQAA 3HOWJ 4O3MA 2IW5A 1R5GA 4BEHA 4CUGA 2PQ8A 1NG7A 3JRIA 1NH3A 4I99C 2CH0A 3ZMTA 1PUFB 2WAFA 5FKKA 3ABKH 5M3FJ 5ERIA 1TLHB 4A6DA 1SVOA 2V1UA 4HF2A 4AIHA 3ULQB 1DGWY 2L9VA 1PP8F 3FXLA 1B59A 1A35A 4L5IA 4B3AA 2YSRA 3F22A 3D5RC 5B1AH 4FHTA 4WCGA 4LG0B 1HCRA 2VQCA 3JRGA 5LEKA 3O6BB 5A2QK 2VPRA 4NBQA 2CW0F 2DQRA 3HOUJ 3HRUA 2LKXA 1YI2I 2CW7A 4C3IJ 5J1RA 2PFBA 3M4OJ 1SVLA 2GOMA 2DMQA 3M9AA 3C2GA 3IHUA 4FT8A 1Z9CA 4LG3A 2QBYA 3FX3A 1Z7UA 3S14J 2W00A 2WY7Q 2KQRA 3BC8A 4XNFA 3TO7A 4CYDA 4UY8I 2RN7A 1HSTA 5E20A 3DTEA 3BP8A 1C0WA 1JT6A 4UV9A 1XGNA 3PSIA 4UNOA 3FHZA 2FSWA 2R7UA 3S1RJ 2EBIA 2O9LA 2CO5A 2XASA 3JR9A 5A2QZ 1YOVB 2DOEA 3RKQA 2ZSHB 1SD5A 1M1EB 1KQ8A 4RGXA 2OQRA 1XX5A 2NOJB 3N4MA 1TWFJ 3HDDA 4E7KA 2JPBA 2ZMEA 2MA3A 5E8GA 3JREA 1B72B 2E1NA 1R36A 4N9IA 3KZZA 2DA7A 1A6QA 2ID6A 4GYGA 2QSGX 2K9SA 2O61A 2OZ6A 4A3EJ 5F64A 1YW9A 1QHHD 2FU4A 2QGUA 4LIUA 5D8KB 2R7OA 3A03A 3ABTA 1DDNA 2K02A 1FP1D 4MQVA 2BY3A 1YLFA 4Y15A 3RCOA 5HNHA 4J19A 2Y9YA 3EPZA 2H94A 3FXMA 2MH9A 4IO9F 3QP6A 4ABZA 4ON0A 2UZKA 3AL0B 2FQ4A 4XM3A 5CKTA 4RGUA 2K9NA 5DM6F 1O3TA 2JMWA 2F5FA 1SFUA 3GYHX 1D1BA 4FETA 3KP4A 2JA2A 3SEQA 4M3EA 4DIQA 3JRAA 3UR3C 5DTDA 1W7PA 2HGCA 5KHDA 3V4GA 3CJRB 4RS8A 3HHHA 3QWLA 3H3UA 3HRSA 1H88C 4A5MA 3BG7A 3U2RA 1MBGA 1J5YA 4EM0B 3KEQA 2Q1ZB 3CUQB 1V5GA 3OR1C 2EFQA 1XMAA 3O8HA 2VASA 1A04A 2XGEA 4PDKA 2NS0A 3ERMA 1UFMA 3KLNA 1P4AA 4Y7NJ 2ESNA 5FRMA 4UUTA 4CA0A 2H8RA 1XSDA 3KYLA 4FASD 4KITB 1K79A 1X1BA 3FK6A 4ENJA 2DN0A 2M4KA 1VNDA 3QQAA 3WGGA 1ZLKA 1JI8A 2DMUA 2CQ7A 3S1MJ 3OIPA 2P5VA 3FHNA 5BQTA 2HR3A 4AM3A 1E3OC 1CGPA 3HYIA 1U9NA 1LKXA 1OYYA 4GFBA 2FMYA 3VOEA 3KE2A 4BDZA 3LOCA 1MMDA 2DA4A 2L54A 3S1NJ 1OMIA 4LIVA 2DA3A 1D5VA 4IHTA 3ML6A 1ZELA 5J47A 3KYCB 4IX7A 1SC7A 1T8IA 2EIMH 1ENHA 2HYFA 3C2HA 3U1KA 5IP6A 3S2HJ 3OS1A 2JK3A 5BPDA 2R7TA 1RPWA 2LBFA 1BI0A 4PFOA 3F9KA 1G2HA 1APLC 3AKZA 1ODDA 1FC3A 4LLLA 5FKLA 4FE7A 3RJPA 3LAPA 1ZRCA 4M71A 4OAYA 2A05A 5JFRA 5GAEJ 2DFFA 2X4HA 1Z7LA 2L3DA 3SDGA 5D5WB 2VONA 1KU2A 2DXIA 3HOSA 2EFNA 3G6EI 1U6GA 2VE8A 4RAGA 4RDUA 1U2WA 1X1DA 2Z9OA 3BTIA 1ETQA 2LY2A 5D5UB 3ZR8X 4MQ9F 1FWZA 4HNVA 2K4BA 1Q1VA 2YS9A 5H20A 4MHGA 4GO1A 2R3SA 2UUZA 3L2RA 1XMXA 2ZMEC 2I5UA 3F72A 5FLVA 3A4CA 2HQ5A 5F27A 3S32A 2ZB9A 2FXAA 1MBHA 2IGOA 3WGIA 4GYIA 1Z3YA 5J8FA 2JRTA 1DQUA 2VOOA 1O3RA 4ZYDA 3WU0A 3OYMA 1H8AC 3QOPA 1WVRA 5L3FA 4RB3C 4IOAF 2O5RA 2LOOA 2VKDA 3JAMK 2EZIA 4QPQA 4KMUX 3ZPLA 3E6BA 4UXNA 2W82A 3KP5A 1IRFA 2LF7A 4ZJZA 5B5EC 1MJ9A 2PMZA 4LLGF 2DOAA 2FF4A 1BW5A 2R7WA 4F7ZA 2HOTA 2VLAA 3FBNB 3M8FA 3LSMA 4RAZA 3H5NA 3KZYA 1USTA 5M3MJ 1RRJA 3B6CA 3BT9A 2ZKZA 2L01A 4N4NB 1XCVA 4RGSA 1UZCA 1YFHA 1OFCX 1BOBA 3BWGA 6PAXA 5E8IA 2VOPA 3JAMZ 1E2XA 2CU7A 4BXFA 1Y56A 3GZ5A 2DPUA 4OU0A 4A3JJ 1WQ2A 2KIMA 2WAEA 4YFNF 2HXIA 2PLYA 2XRNA 3PO3J 4B44A 3CCUI 3TKYA 1R4MB 2F4MB 5L3BA 3QPHA 3BTLA 2OCEA 3DWLE 1W5CC 2D2WA 2EZLA 4W97A 5ICGA 4ZH4F 4HX7A 5JI6A 3G2BA 1U0JA 3A02A 5B66C 5HS8A 1ZK8A 2Z33A 1BJAA 4OOIA 1IG7A 2W25A 5DYMA 2NYXA 2XPUA 2KPMA 1FZPB 2COBA 1V4RA 3L2UA 2VJ5A 3OY9A 3QRFF 3FK7A 2IGNA 1IJWC 2HOSA 4A3GJ 1UB9A 1SAXA 5FKMA 1MZBA 4A0YA 4UHTA 2EFWA 5DV5A 2FOWA 1MMSA 2LLKA 4XOTA 4AIDA 3TP0A 3TOBA 5IYCJ 2HTSA 2VB6A 4C3HJ 4V19K 1P4WA 2XAHA 3EDPA 1WFXA 4ENKA 2XSDC 2PMUA 3K69A 4BQAA 1W5SA 3J7YJ 1AA7A 1ZGWA 2FUG2 1WH7A 2DTZA 2R7SA 3C7JA 2P6SA 5FO5A 3RPQA 1KONA 4YFXF 3JTGA 3ZQGA 3LA3A 1U8RA 1MSFC 1G8XA 1SFXA 2BY2A 4U0WA 5DD8A 3Q3SA 3F3XA 5LFAA 1FOWA 1RKWA 1VQ7I 2H1KA 3H3VK 1BBYA 2B7EA 5JVGF 1T39A 5J40A 4F3QA 4FTHA 2GM4A 1S3JA 4HV5A 4U0YA 1BC7C 2HFHA 2K86A 1O7LA 2EZKA 1RIOH 2XKOA 3KP2A 1MBEA 3HZJA 3D1NI 4WX9A 4BDYA 2FNPA 4RB2C 5F0CA 2KIUA 1QRYA 5DUIA 4NQWB 4I0AA 1JUMA 2MH2A 2ZNYA 3MFKA 2HKOA 2E2HJ 3EQLF 1T6SA 1OKRA 5KAIC 2DU9A 4HSTA 3CZ6A 2Z3YA 4EGYA 4IRGA 2Q2EB 2CS3A 2F48A 3H0DA 4IHWA 2PEXA 2EPFA 4P1WA 2A5WA 5L3DA 2Y0MA 3HSEA 5J1YA 4X6AJ 3H3ZA 5DCMA 1YITI 3IH3A 2EINH 1DGRM 2YR2A 1OCOH 5JVTA 4O6JA 3VSLA 3ZQQA 1FJLA 4UUSB 4D9JA 4A3MJ 4BBSJ 1WPKA 1D1AA 2DDBA 5B3SH 4LOCA 2DFEA 3PNVA 2TDXA 3JRFA 1SD7A 4WXDA 1DUXC 4RB0A 3TO6A 3OYBA 3BQZA 1VQOI 2DYRH 2E1CA 2X1CA 3HOZJ 5K7FA 1WGXA 1HLVA 4BYYA 3IWFA 3QPLA 2IXSA 1MW7A 2JSPA 4ZZDA 3RTRA 1REPC 3LA2A 3F21A 2VBZA 2YX4A 2BOLA 2MC3A 1AU7A 3GVAA 2HZDA 2OAZA 3W6JB 5DM7F 3FM3A 3NQOA 5KK1A 4JX6A 1U5TB 3GZNB 1ZRDA 4BQNA 1EJ9A 3OYGA 4NC8A 3K4LA 3CD6I 2UXXA 2OU2A 3CTAA 4F93B 2X6OA 5E1XA 2VKEA 1N77A 4ASNA 3ELKA 2VXDA 2XSJC 2HS5A 4AYBA 3F8NA 5D4RA 1X19A 5C4JJ 3I4MJ 1P2FA 3S2DJ 3C1DA 2QYOA 4CH7A 1B6AA 3TQNA 4HAMA 2L7ZA 2P5KA 5AIPA 2XAUA 1BIBA 2Q0OA 2I8DA 3K1MA 5F04A 3DV8A 4B47A 2Y30A 3T0YA 3ZMVA 1D0ZA 5E1ZB 3ASOH 1D8JA 5K7HA 1F36A 3PQJA 2VPLA 3PQKA 1V5FA 2BHZA 2XV4S 2CMPA 2NOGA 3LSRA 2W4SA 2KRHA 3RIRA 1TQPA 3DEUA 3S3OA 4XKBA 3WHBA 4OIPF 2FNAA 2VUMJ 5CVJA 4BKXA 3HTUA 2FBHA 2IGMA 1EKEA 1XDUA 3DF8A 1JHFA 3O2PE 4GCVA 1MMAA 3RKXA 2VN2A 4EM1A 2RQQA 4FQGA 4XN0A 1SFEA 5L3EA 2HQRA 2KT0A 5DDGA 2RDPA 2K5CA 1S7OA 3DEEA 3HC7A 5EEHA 2GAUA 2FMLA 3R4KA 3H35A 3ZXSA 3I55I 5TJJA 2KFDA 3DU5A 2P7CB 2VI6A 4BQQA 2O0YA 4XLAA 1LVAA 3LQRA 2RVCA 3MZYA 3RPUD 3L00A 4CZCA 2G9WA 5JLWA 4D1QA 1S7AA 4LFUA 1MH4A 2VC0A 3AFHA 1BI3A 2GLOA 1BI2A 3VPRA 5HDNA 2FE3A 1Z05A 4A3LJ 2W57A 3DTKA 3LSJA 2LDUA 5C3EJ 3V7CA 4BE2A 2DA2A 3ZN0A 4NQWA 2CWEA 2NVXJ 3HPGA 4PJNA 1J7KA 2G7HA 1ACIA 2IBDA 2L4MA 2XGXA 1R71A 4D7NA 2Y2ZA 1R00A 3S2WA 3VYSB 3KZIC 2L0KA 3CCRI 1VI0A 2F4OB 3GTGJ 3IP4B 1DP7P 5B1BH 2DFHA 2DMPA 1P4XA 5HODA 3WU2C 1RETA 5E18F 1DPRA 2HYGD 4MIMA 2GWRA 3BCBA 5LHIA 2QQAA 3ECOA 1T38A 2P4WA 4NB5A 4BJ6C 4FCYA 5C44J 4U0VA 2R7VA 3CCMI 2DYSH 1Z77A 1LB2A 1WJEA 3TL4X 4B48A 2TCTA 3J7AO 2IT0A 1WKMA 3OYEA 5GTIC 1FSHA 1CF7A 1OCPA 3Q9VA 1JT0A 2V1NA 1IDYA 3W6KB 1VFCA 3K6GA 3QAHA 1I6XA 2YUSA 3MN2A 1QQIA 1HBXG 4CYCA 3BPXA 2IJLA 3ASNH 2AHQA 1U5TA 3JW4A 1Z91A 2COMA 4JK1X 3IL2A 2ZCWA 3FXQA 3VDXA 3TEDA 5LHHA 1A31A 2OZUA 3PNYA 1GHCA 1JTYA 1BW6A 2M2EA 2O7OA 4JBAA 1HXDA 4R8HA 1DPUA 5K5QA 3K70C 2OPTA 4AUXA 3MCZA 1FOYA 4GGGA 3HSFA 4J00A 1TW2A 2DT6A 1FEXA 3M7GA 1TTYA 2GXBA 2X1EA 2Z16A 2NS8A 4KN4X 2NVTJ 4HQMA 2NVUB 1I3QJ 2OBPA 1XSXA 1UMQA 1YIOA 2V6CA 5ED4A 4NUBA 4IHSA 3FXRA 2KHMA 3HOXJ 5LEJA 4ZYAA 3K1PA 2F6CA 2RGVA 1UHMA 2MSYA 2JSCA 3S3MA 1NK3P 4G8XA 4BGDA 3PM1A 2X1DA 5K5OA 1QA6A 2LMDA 5KAFC 1WI9A 2K3FA 3GFMA 3AG1H 4XSXF 4L9JA 3OYHA 3BY6A 1HF0A 1KU7A 2VJJA 3PJRA 2IA0A 2E19A 1HW2A 3FISA 4NNJA 1A36A 4XRMA 3DPUA 1B4AA 3EYIA 3CJTB 1AOYA 2DLLA 3LSTA 5IP9J 2PJRB 1VQNI 4W1UA 4A69C 3AG4H 4Y3OA 5TRDA 4A3BJ 3I54A 1QO0D 1UG2A 4M6XA 3CCJI 3HOVJ 1OQYA 3IWZA 1U78A 3RYPA 1WJDA 1IW7F 4ESFA 2LVSA 4QPOA 1MMGA 1X2MA 4G7OF 4CCKA 2LFBA 4IQ4A 1G3SA 4KUMA 2GA2A 1RUOA 1HW1A 2X85A 4G7HF 3DPLC 5BNGA 4EEFG 2VBWA 5GAGJ 1XD7A 2ME0A 2X0LA 3E3VA 3P9CA 5H6QA 4CHUA 2NVYJ 4CO8A 4Q47A 3KCCA 3CDLA 4S05A 2LK2A 2B0LA 1X2NA 3BZKA 1BIAA 2EV6A 4Y33A 2ISYA 3I56I 3E5UA 1YE9A 1W1WE 4EJUA 2VC1A 2DK8A 3VODA 3HOYJ 1HOMA 2LREA 5K1YA 5LRRA 4CXFA 1ETYA 2MLKA 5KVRA 1YIJI 2Y31A 3ZMUA 2XF5A 1VTNC 4E7IA 3BPVA 3W6VA 2DCEA 3ZRGA 4UV8A 2XB0X 2DO7A 2A5YB 2LR8A 4NDLA 3IV5A 4IHVA 3IKTA 2OQGA 3FXJA 5BS6A 4I76A 2AO9A 4R79A 2BW3B 3AG2H 3QYEA 4GRIA 3SQNA 2JA8J 4BY7J 4A3FJ 3EUHA 2D1VA 4L5EA 4II2A 5F6FA 2E2IJ 3C2BA 2Y69H 1VQPI 4A93J 3L1PA 1IUYA 3HXLA 3KETA 2A61A 1O4XA 2OUMA 1FTTA 2M30A 1N25A 1RNLA 4A3KJ 3RKWA 2ESHA 1S72I 3P9KA 4UVCA 3BR5A 1RC9A 2VKHA 3F8BA 5HVQC 2LTPA 3O8GA 3KIOA 1YW8A 2M34A 3ZP5A 3CLQA 4PGGA 3HTSB 4CCJA 1JGGA 2BXZA 3CF5F 1ZG1A 1ITYA 3L2QA 1NTCA 1SFOJ 2D5VA 4CCOA 2HYJA 5E1WA 5LD2C 4IHYA 1MJAA 1J9IA 4QWQA 1IXSB 3MKLA 1QHGA 5HS7A 1E17A 2JQ7A 3M8EA 3CC2I 4U7BA 1LE8A 1IXCA 4CICA 3SEZA 4CCLA 3BG6A 1QZEA 2DW4A 2VIXA 5HLHA 2GIVA 5CPRB 1K7AA 1XC5A 2PG4A 3ZQCA 2EB7A 3Q0UA 3A01A 2O8KA 4S04A 3CO7C 3NAUA 3BTCA 4XLFA 4HZFA 2L4AA 1KZHA 2EA4A 2IEKA 2FRHA 4A0ZA 1PUFA 2R0QC 2C6YA 1D0YA 1YS7A 2LKSA 1YRNB 3T1BA 2KP6A 2M7AA 3BLYA 1WH5A 2BV6A 2CUFA 4RM3A 1BM9A 1ZKGA 2P6TA 4XBFA 4I01A 2KKOA 3DTIA 2DPDA 2NVQJ 1JXSA 4EJWA 4I98B 4LG0A 3AAFA 1B1BA 4DZPA 5D5VB 2K85A 4B3XA 4R1HA 1X58A 1R49A 2K7LA 2CUEA 5EG0B 1YG2A 4ZDPA 4LITA 4OIQF 1R1TA 4LK1F 4EJVA 4A12A 3L2WA 1B9NA 4YRVA 4XN3A 4OIRF 4YIFA 1BA5A 3OYKA 5HLGA 1VQ4I 1PUEE 4DZJA 3I64A 3FWEA 1R9TJ 3UKGA 1XN7A 1IRXA 3PFIA 1Y39A 1W0UA 4XRFA 2BHYA 2QSHX 2E1MB 4PJMA 5IYBJ 4PSWA 1F9NA 1T33A 4U88A 4M9SA 3WE2A 2BZTA 5F0FA 1IN4A 4EJOA 4IRHA 1S29A 2BXYA 3I5UA 4M9ZA 3K10A 5DD4A 4HNTA 2HI3A 1GVJA 3GLXA 1S5LC 3C3WA 1ZH5A 4E4HA 4BJ5C 3GTMJ 1X3UA 1B72A 3M3YJ 3HGGA 1ZN2A 2A6EF 2IGKA 2VT2A 1ZLJA 3K2ZA 4XL9A 4I2OA 1XGMA 4WXCA 4WWCA 2XRLA 4CDGA 3OV8A 2ELKA 2ELJA 3EUHC 1VQ5I 1UHSA 3FMQA 3QYFA 1FMVA 5FLMJ 2D1HA 1MNMC 3CCYA 5IPAA 1ORKA 5CQEA 1JE8A 4E6KG 3CQZJ 4BE0A 4V2FA 4MLOA 3J81K 1LNWA 5LRSA 1J75A 3WTSC 3ZMDA 1BR2A 2HQNA 2HEOA 4IJAA 1NG6A 4O5VA 3H9JA 3HBLA 3BG5A 1UAAA 1VQKI 2LF8A 1JKQC 5D6FA 3WG7H 1YYVA 2J5PA 1E3HA 4S0HB 2H6CA 2VXZA 2EJRA 1I27A 4IPAA 3BR0A 3G73A 2OTJI 3HHGA 4ANJA 2LH9A 3JCUC 2R7DA 1LPQA 1T0FA 3IAM2 2DODA 4PZJA 1HQCA 4DYRA 5HNFA 2JT1A 3CUQA 2MLGA 3J81Z 1I5ZA 3F8FA 4Y17A 4OMYA 3M1EA 3FBIB 1VQ9I 1TW3A 2CYYA 1XB4A 5IOZA 5DS9A 1P92A 2DTRA 2H27A 2Y0SN 2XAQA 4A0XA 3SZPA 2PI0A 4HSRA 5DEQA 3OYIA 4MFEA 1W36C 2YX7A 2QEXI 2IA2A 3NWTA 3L2VA 2ZC2A 3VYTB 3BR1A 1ZYRF 4M3DA 2JA5J 3V8LA 1Z6RA 1QPIA 2M0CA 2E5NA 2M0MA 4G12A 4C2MJ 1FPQA 5ICCA 2M8GX 3HGYA 2G0EA 4PCQA 2JZYA 2Z1DA 3JTHA 2V4JC 1GV5A 4BU2A 1W7PD 3FXKA 3T8RA 2DA1A 4LB5A 2R7QA 3MD2A 5CYVA 3GZ6A 3IKVA 1TWHJ 1B9MA 3E5XA 3SZGA 4II3A 4ENNA 5BOXA 2W24A 4RAYA 2BE5F 3LA7A 3L09A 3ZQ7A 3B6AA 3VSKA 4RB1A 3R0AA 4AWXB 2ZXHA 2WA0A 4AVPA 2P0WA 1HA8A 1ETOA 4JYKA 1B8IB 3RKYA 1IN5A 2ACJA 2MBFA 2V26A 1F1ZA 4NC6A 4CCNA 1JKOC 1RI7A 4JQFA 1Z1DA 1YRNA 4N9HA 1AKHB 4HPQA 2R7ZJ 4E7LA 1LUJB 2ID3A 1WJFA 1IXRC 1YJWI 2M3AA 1VQ8I 1SMYF 2M7BA 1UG0A 1OCZH 3ZMZA 4KN7X 4ZDLA 5EG0A 5J8CA 4J01A 4AU7A 2EA2A 2HZTA 3H9QA 4IL6C 2ETHA 3BTJA 5EEGA 5JLXA 3CC4I 1UELB 2R7FA 5ILUA 1V5EA 2IPQX 1VZ0A 1QU3A 2HDCA 4M6VA 2WTEA 1R58A 2BBYA 1FBSA 3CCSI 2Q8KA 1H9GA 1K4TA 3JSOA 3BROA 5C4XJ 1ZRFA 2BGCA 1L3LA 1E0EA 2MG4A 5GPCA 3WU1B 2G7UA 4XKVA 4B1RA 3IUOA 3SXYA 3G4SI 3R0JA 1WSUA 3V42A 1YO5C 2KIFA 1W36D 1G4DA 2HVQA 1ZHFA 3F6VA 2M8EA 4TV7A 2DJNA 4B4CA 3S16J 2VT3A 2X9DA 4AIJA 1EF4A 2CRGA 3GF2A 1IV8A 1FYLA 3AL0C 3CCLI 2Z99A 3FZVA 1O3SA 1H89C 2XPWA 2NS7A 2P7VB 3KFWX 2ZJQF 1DU6A 1XGSA 3M8JA 2VL8A 3LWFA 3PSFA 4CGZA 4HG2A 5D5XB 2DFIA 4EM2A 3D5LA 2PN6A 1HW5A 2HDDA 1BN5A 5M5XJ 5EDNA 1YHQI 2R93J 3LL7A 5JHFA 3J80K 2HOAA 3CUQC 4BHCA 1HDDC 3A0BC 4M73A 2HPIA 4BHPA 4B09A 3CJQB 3TP3A 2CUZA 4XSZF 2FJ1A 2M9HA 3GWZA 5GPAA 1J09A 4WXHA 1FBQA 1EH7A 1WJBA 1WJ5A 2DA6A 1FOXA 1R5ID 2DK5A 3HSRA 1P7IA 5GP9A 1RR8C 5E3OA 2EV0A 3E6MA 2QLZA 1ZREA 1X3ZB 3A0HC 1R4NB 2M1BA 3OIQA 1KU3A 5HLTA 3J80Z 4LB6B 2XIGA 1TZLA 1EA3A 1WJAA 4AVZA 5IOYA 2LRDA 3MAJA 1H0MA 4UB6C 3H36A 2HPMA 2ZJ2A 5E3NA 2UWMA 2P81A 2V1XA 4RLQA 5F1JA 1SAUA 3OMYA 4G7ZF 4KIFA 5K7ZA 2CV0A 3I53A 2O8XA 5CVIA 2R5ZB 2WC2A 5E79C 2AQEA 1QBJA 1IF1A 1G3TA 4QTRA 1FNNA 3ZCOA 4OIOF 1YJNI 1G6NA 3VEPA 1R22A 1QZZA 4PJJA 2NRAC 4ETSA 2DAOA 4DBQA 1POGA 1TT5B 1MSEC 4ZTFA 3GTQJ 3JRBA 3W2WA 1CQTA 2Y9ZA 2HDWA 3OWTA 1ZR2A 2K4JA 3LSPA 5EGOB 3CJNA 1S6LA 2FBIA 1SD6A 1RESA 1T2KA 2L5QA 3QU3A 4P9FA 2EQRA 3R6SA 1Z67A 4M9XA 4D5FA 1T56A 2LC2A 4G6QA 4C3JJ 3KPHA 1TC3C 1GXQA 1MGTA 1AHDP 3CESA 3SYTA 2H6BA 5CVUA 5TISC 3S17J 4LD5A 1K61A 1S7EA 2IS6A 2L9RA 3DKXA 3ISPA 2JA7J 2BEOA 3SFIA 2A07F 1ZQ3P 3IAS2 4M3FA 3HOTA 3L2CA 2QBYB 2VQLA 2ZXWH 4BBRJ 1IO2A 1PJRA 4KDPA 3RDIA 3I0TA 4DOZA 4IRIA 1TNSA 5IP7J 1IN8A 3K1NA 1L0OC 2LSOA 3CMMA 2EILH 3Q0VA 3VFZA 5LHGA 1DP3A 1BR4A 3VWBA 2A6TA 1Z0XA 4YIRX 2BVLA 1YX3A 2CFXA 2OF7A 4V2GA 4B8XA 2HNHA 3E0JB 5BPIA 1DU0A 3A2KA 1P6RA 4KICA 4JOMA 4BAYA 4LLNA 4CZZA 3G1OA 2ZMEB 3LSGA 5F1RA 4I09A 4A3IJ 2RC4A 3DEWA 3I4NJ 2Q2EA 1OPCA 3S3NA 3TDUC 3N97A 1KYZA 1TP4A 1XS9A 5FD5A 3F8MA 1Y8QB 2IRFG 2KJBA 2KDZA 2A69F 3GTJJ 2DT7B 4QSHA 3DLLF 3GCMA 3P7NA 5F08A 2EK5A 1K83J 3AG3H 4XONA 1VQLI 3DU6A 2FOKA 1GV2A 3DKYA 4E70A 1JTXA 4UUSA 2VE9A 4EV0A 2V1DA 3I4PA 4Z6YA 4HA8A 4WK8F 3QODA 4GXOA 3GTKJ 2DT5A 1FLIA 4PSXA 1UHWA 3WG9A 2WV1A 3FXOA 3BCAA 3DLAA 3HRMA 4L0YB 1E3PA 4P55A 1V55H 4YG2F 1HKQA 2V9VA 3KYDB 4Q5SF 3DKWA 4I0BA 1FBUA 2YU3A 2PBIA 3RYRA 2WAQN 1D5YA 5FKNA 2XROA 2FD5A 1D0XA 1ETKA 3BZCA 3EETA 2X51A 2CUJA 1IZ1A 2CJJA 4XK4A 1JKPC 1TWAJ 2KDOA 2KZGA 3EUAA 5IYDJ 4NC7A 1GXPA 5CVVA 1EV7A 3WGHA 3TMOA 1XMKA 1OR7A 4LGWA 4ZDOA 4ITVA 2EIKH 2GZWA 2BYVE 2IP2A 2V6EA 1VF9A 2HKXA 3BJAA 1QNTA 2OC6A 3EYYA 3MEXA 2WV0A 4PJLA 3P5JA 5M5WJ 2E71A 3HKZN 2STTA 2PX9A 3JRHA 4A3CJ 2NNNA 3OOUA 4ZYEA 4GDFA 2FEZA 2CFOA 3GW2A 5D6EA 4B43A 1FP2A 4IOCF 1A5JA 1FSEA 3RZOJ 1XSVA 2LY9A 4XMYA 3V8KA 1LEAA 2JWTA 2XKPA 3BQYA 4DQ2A 5GTHC 2L2OA 3W2AA 3E7LA 4XKCA 3PUFA 4UB8C 2LBFB 1IRZA 4A3DJ 4BQOA 1KQ0A 3I9V2 4FE4A 4FX4A 1YTYA 5J4VA 3IRQA 5TGTA 2XVCA 2ZFWA 4KYWA 4FISA 4RGRA 3MZ8A 4F52A 1F5TA 3HPHA 4Y13A 1FTZA 1ZG5A 4ZYHA 2X6YA 1ULYA 3HB9A 5CJ9A 3CCQI 5EGOA 2ISZA 1VQ6I 4EATA 3ERED 4U87A 1K6OA 2P8TA 1R1VA 3ONQA 3W3CA 4XLHA 1T08B 3LFUA 4MGRA 1Q1HA 2E34A 3U9GA 3ZOBA 2L7KA 4Z2YA 2YPRA 3G71I 2W1OA 4ZTJA 3CMYA 3BJOA 3QYBA 3BJ6A 4PJ0C 1HDPA 2NXNB 3HUGB 4UVAA 3F8CA 3V7RA 3LSKA 3IRRA 1K6YA 1LFPA 4L0ZB 1IN6A 3FMRA 2K9LA 5CVRA 1XTAA 2X6WA 3OR2C 3I58A 4LJZF 1IV6A 5EF6A 3K70D 1BI1A 2KJCA 3GFJA 1QGPA 3K4BA 2A3SA 3BDDA 1UCRA 3HJEA 2EH3A 1I1GA 2H09A 3H1CA 4YELA 5E17F 4HOBA 5LGUA 5IT3A 3LSIA 1ZARA 1I50J 3I71A 3WE3A 1YS6A 5FROA 4MTEA 4OWRB 4AIKA 3QP5A 1O3QA 2PMHA 4IF4A 3QPSA 4MNUA 4KIBA 5H6RA 5EZHA 2IA1A 1MBFA 1JJ8C 4HLXA 1G3WA 2QSFX 1Y1WJ 3DQVC 1ETXA 2IS4A 2GXAA 1HC8A 4BACA 1Z6TA 4L18B 2ZBKA 4I02A 1U5TC 3TW7A 4IEJA 5JR3A 1Y0NA 3I3LA 3CF2A 1RZ4A 4I6ZA 4F92B 4ESBA 4RA2A 1WWXA 3T5XA 1ZG3A 3TGNA 3ABUA 1IC8A 2A6HF 3KEYA 2GXGA 4QLCU 1MBKA 3OYLA 1X3WB 4UUVA 1JHHA 2ZNZA 2MD0A 1OR7C 3HG9A 5F0HA 3ECHA 3GMEA 2CGPA 2CQNA 5J1UA 2XDVA 4YFKF 5D4SA 4E7ZA 3OSFA 3PUBA 1U8BA 3VYRB 2WB1N 3OYCA 2MGQA 5KCMA 5E3MA 4IZZA 3KP7A 3ESWB 2E5ZA 4AC0A 4U7DA 1OISA 1LDDA 3GLLA 1ON2A 1X1PA 2M5WA 4RM2A 1FYKA 3RQ4A 1R23A 2AXTC 3ZQLA 2XF7A 3LAJA 3KP6A 1XGOA 4XRSG 9ANTA 4KFCA 3NRVA 3MWMA 2CQKA 1LVKA 3PIOF 2E35A 3ZQIA 1V3FA 1Z21A 2NNYA 4DBRA 3F0CA 2Y0SA 3CP8A 1JGSA 1I6HJ 4KT6A 2CV1A 2LKPA 3TBIA 3SJMA 3MKZA 3K4NA 1G59A 4G9YA 2P5LC 5DCFA 3CUOA 2V79A 1PDNC 1MIJA 2QKLB 4HEA2 1FYMA 1R1UA 1MDMB 2RNGA 4F91B 3BOQA 1MNEA 2DQLA 1PP7U 2EFOA 2MW8A 2VJIA 3IH2A 4HQEA 2XAFA 3CP2A 3K4CA 4IVNA 2AQFA 3OYNA 2KIQA 2OJED 4HNUA 1JJ6C 3FF5A 4EJTA 5BMZA 2QUFA 1K78B 4RMNA 1H9TA 2EV5A 2XAGA 4JX4A 1FT9A 3JSPA 1JKRC 4H4KC 5D8LB 2KLOA 4QIWN 3ZMSA 2F5EA 3GFLA 5AIQA 4C30A 3FXUA 2RAEA 1EH8A 2PJRA 2XF6A 5AONA 1OYIA 1TNTA 2QF7A 3OL3A 2IS2A 2ZFUA 1ZAOA 1WHUA 1X1CA 2JUCA 5L3GA 3OYJA 2E7XA 3Q5FA 4M74A 3OYAA 1WCMJ 1GLNA 5GAHJ 1TWCJ 2LG4A 3VYUB 1ZTRA 3RI4A 1I1SA 3WTWC 3M07A 3OS2A 2B9SA 2W85A 2HU9A 2M45A 3CLOA 3HUGA 3K2AA 2B63J 3TW6A 2JRMA 2F4IA 1RR7A 3NEUA 1LEBA 4YEJA 2M4GA 2QQBA 1WJCA 2ME6A 2E60A 3H5RA 5KNLA 4XIDA 1ZGJA 2JVGA 5FLXK 5EEAA 5FD6A 1X4OA 5DCMB 3BZ6A 5HS9A 3X2QH 4XLPF 3OL4A 3GO5A 2XC7A 3LNQA 2O6GE 4IKFA 4BUPA 1HKTA 2F2EA 4JX5A 5GADJ 1PYVA 2K9MA 2Y75A 3BR3A 5E3LA 3WODF 1PVEA 3KLOA 2W84A 3G1LA 3KP3A 1TWGJ 2XAJA 3ABMH 3O3KA 4KISA 5HDGA 4KIGA 2QWWA 1IAWA 3OS0A 2UXNA 5FLXZ 1I3AA 3JRCA 1S9HA 4P96A 2BW3A 4A5NA 2KL4A 4M3GA 4BHBA 4XOPA 2XGCA 4ZC3A 2XB5A 3OIOA 2JPCA 2ZJPF 3PL8A 1USSA 3J7AY 3G1MA 3S15J 4HDUA 2F5DA 3OYDA 4D0PA 2ZSIB 1U3EM 3GXOA 2LP0A 1KYWA 3FMSA 1Y6IA 4EMSA 2BY1A 1SEUA 5FJ8J 3GX4X 1XCBA 4L9TA 4Q4ZF 4M6YA 5FGMA 2FA5A 3BR6A 4DYQA 5FB2A 1FIPA 1ETVA 2OA4A 3I59B 4X1EA 5M5YJ 2K27A 5J6XA 4H0EA 1Z3XA 3CC7I 2OV7A 4DGWB 3E6DA 2DDAA 5HDKA 2GBYA 1SD4A 3BG9A 2TRTA 1W0TA 2W48A 4HBLA 3LQQA 3U1DA 1GUUA 5LBQA 2UV1A 4KMFA 1J2XA 2R5YB 2QKMB 1P7JA 2RQPA 3U21A 4XR6A 4BL0B 1ON1A 3K4JA 4MTDA 3FIWA 3RPUA 2XGDA 1LFBA 1YX5A 2F5CA 3DFGA 4YIIA 4CSWA 4KA4A 4PGHA 2MFZA 2N8GA 3S8PA 1W5TA 2FQ3A 2LYCA 1O57A 3WTVC 3GTOJ 2KRFA 2JA6J 3E97A 4EQQA 4OINF 3QOEA 1RKTA 1W4MA 1K4SA 2WADA 1A6IA 3F23A 1MDMA 3HM5A 4A2UA 2YU9J 2V7FA 1AWCA 2EWNA 1XG1A 4I7HA 3RQIA 4F55A 2E7WA 2CW8A 4K2EA 4OMZA 1VQMI 2L02A 2EIJH 3QPTA 4CCMA 3MMYB 1N75A 3ZQFA 3T8TA 4BS9A 3CO6C 2GIZA 1IGNA 1MBJA 2ZXJA 3TOAA 1BR1A 4ENMA 4DYCA 1K78A 2H8WA 5IT9K 3G3ZA 1OCCH 1FY7A 3D0SA 4E7HA 5IY5H 1T95A 4X0GA 5HLIA 1MJBA 2IVMA 4IHXA 2E1OA 4P5OA 2JUGA 4MEYF 2HXOA 2IS1A 2LNBA 3V7SA 3KEOA 1SFKA 3RSNA 3COAC 1NHAA 2K40A 4HX8A 4EGZA 1N78A 2JJ7A 2ZO4A 4UVBA 4IXAA 1OCRH 1ONVA 3FDYA 5ICFA 3HRTA 3LMMA 2ZXIA 2BVMA 2QQ9A 4L5JA 3SFZA 5LLQA 4XRSA 5IT9Z 2ECBA 3CDIA 4G94A 3CDHA 2CG4A 2F5VA 2X48A 2GA1A 4HF1A 4D7MA 1FOKA 2PMZN 5K5RA 5EJCA 5FKOA 5LGNA 2QA4I 3H9GA 3S1QJ 4G6DA 4OAZA 3HIFA 3K0LA 1ERDA 1QPMA 3TO9A 3EUKL 2QM3A 2XUBA 2HVSA 4PUSA 3GBGA 1EH6A 1OLTA 2E36A 1BC8C 5FRNA 1IRGA 3ROUA 3HL2A 1OCTC 5ILSA 1R6RA 2DMNA 3MKWB 3MQ0A 2VJ4A 3E5QA 4N0BA 2L7MP 3GTLJ 5DUKA 1T0FC 5L3CA 1V54H 2VKVA 1GT0C 4C2TA 1OJLA 3ZN1A 4XKWA 2WBMA 1BJZA 2QVOA 1JUSA 1TL8A 4RAFA 2RREA 2E2JJ 5EYRA 4PFPA 4DW6A 1F4KA 2R7RA 2QZ8A 5CLSA
chains in the Genus database with same CATH topology
1YW7A 3R60A 1WRJA 3H92A 1CF7B 3L7WA 5ILVA 2RKHA 2WWYA 4ZYGA 2HOEA 3IC7A 2O03A 4BNCA 3B02A 1KU9A 4L9VA 3SZTA 3LFKA 1LJ9A 3R61A 2FBKA 1R7JA 3REOA 4M72A 3I59A 4FX0A 2JTVA 4HF0A 1SMTA 1KGSA 1R5HA 5LGTA 4ZZLA 2RV8A 1HSJA 5ICEA 1J0RA 4BH9A 3P9IA 1TQIA 1LDKB 3WTXC 2D45A 2NAZA 2DI3A 1TQMA 2HTJA 3C18A 4BXUA 2AS5F 3L9FA 1LQ1A 1XDSA 1TBXA 2DBBA 4DNCA 2RNJA 3TDZC 4HDVA 3SHFA 2Z5UA 4P9UA 1YQAA 3DPTA 5FFXA 4KT5C 3WTUC 2J5OA 3B73A 3FM5A 4L9NA 1MKMA 1MD0A 3GFIA 4AD9A 4XLNF 2A68F 2O3FA 2XHKA 3WTZA 1G3YA 2CSOA 1IN7A 1ZGAA 1Y0UA 1O7FA 3MZHA 4EVIA 1STZA 3K9TA 3GEZA 1T98A 4Q48A 1KA8A 1RUNA 5FFZA 3Q9SA 4HYEA 4A6EA 5HOOA 4HW0A 3WTTC 4LK0F 3DP7A 2HWVA 2M87A 2PJPA 1W7PB 1D8KA 2VBXA 2QENA 2MD5A 3QU6A 4HV6A 4HLYA 4ESJA 3GUDA 4HX4A 2VODA 3WTYC 2VBYA 1S8NA 1LDJA 1J59A 1FX7A 1D3YA 1BOAA 2AXLA 4LMYA 2OD5A 3E6CC 1OYWA 2ELHA 4NHJA 4KNYA 2EFPA 3F6OA 3DXJF 2Y48A 1KQ9A 2GQQA 3V8JA 4MEXF 3OOPA 2ADUA 4WF2A 3VB2A 1HKSA 2STWA 5JHUA 1QZYA 4O3MA 2IW5A 1R5GA 2PQ8A 3ZMTA 5ERIA 1TLHB 4A6DA 2V1UA 4HF2A 4AIHA 3ULQB 1PP8F 1B59A 4L5IA 2YSRA 3F22A 4FHTA 4WCGA 4LG0B 5LEKA 5A2QK 3O6BB 2CW0F 2DQRA 3HRUA 2PFBA 3M9AA 3IHUA 4FT8A 1Z9CA 2QBYA 3FX3A 1Z7UA 3TO7A 4CYDA 2RN7A 1HSTA 5E20A 3BP8A 1C0WA 4UV9A 1XGNA 4UNOA 3FHZA 2FSWA 2CO5A 2XASA 5A2QZ 1SD5A 1KQ8A 4RGXA 2OQRA 3N4MA 2JPBA 2ZMEA 2MA3A 5E8GA 2E1NA 1R36A 4N9IA 3KZZA 4GYGA 2O61A 2OZ6A 5F64A 1YW9A 2FU4A 5D8KB 3ABTA 1DDNA 2K02A 1FP1D 4MQVA 1YLFA 4Y15A 2H94A 2MH9A 3QP6A 4ON0A 2UZKA 4RGUA 1O3TA 2F5FA 1SFUA 3GYHX 3KP4A 1W7PA 2HGCA 3V4GA 4RS8A 3HHHA 3H3UA 3HRSA 4A5MA 3U2RA 1J5YA 4EM0B 3KEQA 3CUQB 2EFQA 1XMAA 1A04A 4PDKA 2NS0A 1UFMA 3KLNA 1P4AA 2ESNA 1XSDA 1K79A 4ENJA 3WGGA 1ZLKA 2P5VA 5BQTA 2HR3A 1CGPA 3HYIA 1OYYA 2FMYA 3VOEA 3KE2A 2L54A 1OMIA 1D5VA 4IHTA 3ML6A 2HYFA 5BPDA 1BI0A 1ODDA 1FC3A 4LLLA 3RJPA 3LAPA 1ZRCA 4M71A 5JFRA 2X4HA 5D5WB 2L3DA 2VONA 1KU2A 3HOSA 2EFNA 1U6GA 2VE8A 1U2WA 2Z9OA 5D5UB 4MQ9F 1FWZA 2K4BA 5H20A 4MHGA 4GO1A 2R3SA 3F72A 2FXAA 3WGIA 4GYIA 5J8FA 2JRTA 2VOOA 1O3RA 4ZYDA 3WU0A 3QOPA 5L3FA 4RB3C 3JAMK 4KMUX 3ZPLA 3E6BA 4UXNA 3KP5A 1IRFA 2LF7A 1MJ9A 4LLGF 2FF4A 4F7ZA 3M8FA 4RAZA 3KZYA 1USTA 2ZKZA 2L01A 1XCVA 4RGSA 1YFHA 2VOPA 3BWGA 6PAXA 5E8IA 3JAMZ 1E2XA 3GZ5A 2DPUA 4OU0A 1WQ2A 2KIMA 4YFNF 2PLYA 2XRNA 3TKYA 5L3BA 3QPHA 2D2WA 5ICGA 4ZH4F 4HX7A 5JI6A 5HS8A 2Z33A 1BJAA 4OOIA 2W25A 5DYMA 2NYXA 1FZPB 1V4RA 3QRFF 1UB9A 1SAXA 1MZBA 4A0YA 4UHTA 2EFWA 5DV5A 3TOBA 2HTSA 1P4WA 2XAHA 3EDPA 4ENKA 2PMUA 3K69A 4BQAA 1W5SA 3C7JA 2P6SA 5FO5A 3RPQA 4YFXF 3JTGA 3LA3A 1U8RA 1SFXA 4U0WA 5DD8A 3F3XA 1BBYA 1T39A 1S3JA 4HV5A 4U0YA 1BC7C 2HFHA 2K86A 1O7LA 1RIOH 2XKOA 3KP2A 4WX9A 2FNPA 4RB2C 2KIUA 5DUIA 4I0AA 2MH2A 2ZNYA 3MFKA 2HKOA 3EQLF 1T6SA 1OKRA 2DU9A 2Z3YA 4EGYA 4IRGA 2PEXA 5L3DA 2Y0MA 3HSEA 3H3ZA 5DCMA 2YR2A 5JVTA 4O6JA 2TDXA 1SD7A 4WXDA 1DUXC 4RB0A 3TO6A 2E1CA 4BYYA 3IWFA 4ZZDA 3RTRA 1REPC 3LA2A 3F21A 2VBZA 2YX4A 2MC3A 3GVAA 2OAZA 3W6JB 3FM3A 3NQOA 5KK1A 1U5TB 1ZRDA 2UXXA 2OU2A 3CTAA 5E1XA 4ASNA 3ELKA 2HS5A 3F8NA 5D4RA 1P2FA 3C1DA 2QYOA 1B6AA 3TQNA 4HAMA 2P5KA 5AIPA 1BIBA 2Q0OA 3K1MA 3DV8A 3ZMVA 3T0YA 5E1ZB 1D8JA 3PQJA 3PQKA 2XV4S 3RIRA 1TQPA 3DEUA 4OIPF 2FNAA 5CVJA 3HTUA 2FBHA 1XDUA 3DF8A 1JHFA 3O2PE 4GCVA 3RKXA 2VN2A 4EM1A 1SFEA 5L3EA 2HQRA 5DDGA 2RDPA 1S7OA 5EEHA 2GAUA 2FMLA 3R4KA 5TJJA 2P7CB 2O0YA 1LVAA 3LQRA 2RVCA 3MZYA 3L00A 2G9WA 1S7AA 4LFUA 2VC0A 1BI3A 1BI2A 5HDNA 2FE3A 1Z05A 2W57A 2LDUA 3V7CA 3ZN0A 4NQWA 2CWEA 1J7KA 2G7HA 2L4MA 2XGXA 1R00A 3S2WA 1DP7P 1P4XA 5E18F 1DPRA 2HYGD 2GWRA 5LHIA 2QQAA 3ECOA 1T38A 2P4WA 4NB5A 4U0VA 1LB2A 3J7AO 2IT0A 1WKMA 1FSHA 1CF7A 3Q9VA 3W6KB 3QAHA 1I6XA 1QQIA 1HBXG 3BPXA 2IJLA 3JW4A 1U5TA 1Z91A 2COMA 4JK1X 3IL2A 2ZCWA 3FXQA 5LHHA 2OZUA 1GHCA 4JBAA 1HXDA 4R8HA 1DPUA 5K5QA 3MCZA 4GGGA 3HSFA 1TW2A 3M7GA 1TTYA 2GXBA 4KN4X 4HQMA 2OBPA 1XSXA 2V6CA 1YIOA 5ED4A 4IHSA 3FXRA 5LEJA 3K1PA 2RGVA 1UHMA 2JSCA 4G8XA 5K5OA 1WI9A 3GFMA 4XSXF 4L9JA 3BY6A 1KU7A 2IA0A 1HW2A 1B4AA 3EYIA 1AOYA 2DLLA 3LSTA 5TRDA 3I54A 1QO0D 4M6XA 3IWZA 1U78A 3RYPA 1IW7F 4ESFA 4G7OF 1G3SA 4KUMA 2GA2A 1RUOA 1HW1A 4G7HF 3DPLC 2VBWA 1XD7A 2X0LA 3E3VA 3P9CA 5H6QA 4CHUA 4CO8A 4Q47A 3KCCA 4S05A 2B0LA 1BIAA 2EV6A 2ISYA 3E5UA 4EJUA 2VC1A 2DK8A 3VODA 5K1YA 5LRRA 4CXFA 2MLKA 5KVRA 3ZMUA 1VTNC 3BPVA 4UV8A 2DO7A 2A5YB 3IKTA 2OQGA 5BS6A 4R79A 3SQNA 3EUHA 2D1VA 5F6FA 1IUYA 3KETA 2A61A 2M30A 1RNLA 3RKWA 2ESHA 3P9KA 4UVCA 3F8BA 5HVQC 1YW8A 3ZP5A 4PGGA 3HTSB 1ZG1A 5E1WA 1MJAA 1J9IA 4QWQA 1IXSB 5HS7A 1E17A 3M8EA 4U7BA 1IXCA 4CICA 2DW4A 5HLHA 2GIVA 1K7AA 2PG4A 2EB7A 4S04A 3CO7C 4HZFA 2L4AA 2EA4A 2FRHA 4A0ZA 2C6YA 1YS7A 3T1BA 2BV6A 1BM9A 2P6TA 4XBFA 4I01A 2KKOA 2DPDA 1JXSA 4EJWA 4I98B 4LG0A 3AAFA 1B1BA 5D5VB 4R1HA 2K7LA 1YG2A 4OIQF 1R1TA 4LK1F 4EJVA 4A12A 1B9NA 4OIRF 4YIFA 5HLGA 1PUEE 3I64A 3FWEA 1XN7A 3PFIA 4XRFA 1F9NA 4U88A 4M9SA 3WE2A 1IN4A 4EJOA 4IRHA 1S29A 3I5UA 4M9ZA 5DD4A 1GVJA 3GLXA 3C3WA 1ZH5A 1X3UA 1ZN2A 2A6EF 2VT2A 1ZLJA 3K2ZA 4I2OA 1XGMA 4WXCA 4WWCA 4CDGA 3OV8A 3FMQA 2D1HA 1JE8A 3J81K 1LNWA 5LRSA 1J75A 3WTSC 3ZMDA 2HQNA 2HEOA 4IJAA 4O5VA 2LF8A 5D6FA 1YYVA 2J5PA 2H6CA 2VXZA 2EJRA 1I27A 4IPAA 3G73A 3HHGA 2R7DA 1T0FA 4PZJA 1HQCA 2JT1A 3CUQA 2MLGA 3J81Z 1I5ZA 3F8FA 4Y17A 4OMYA 3M1EA 1TW3A 2CYYA 1XB4A 1P92A 2DTRA 2H27A 2XAQA 4A0XA 3SZPA 2PI0A 5DEQA 2YX7A 2IA2A 1ZYRF 3V8LA 1Z6RA 1FPQA 5ICCA 4PCQA 2JZYA 3JTHA 1W7PD 3T8RA 4LB5A 5CYVA 3GZ6A 3IKVA 1B9MA 3E5XA 4ENNA 5BOXA 2W24A 4RAYA 2BE5F 3LA7A 3L09A 3ZQ7A 4RB1A 3R0AA 4AWXB 4AVPA 3RKYA 1IN5A 2ACJA 2MBFA 1F1ZA 1RI7A 4JQFA 1Z1DA 4N9HA 1IXRC 1SMYF 3ZMZA 4KN7X 5J8CA 2EA2A 2HZTA 5EEGA 2ETHA 2R7FA 5ILUA 2IPQX 2HDCA 2WTEA 1R58A 2BBYA 1FBSA 2Q8KA 1H9GA 3JSOA 3BROA 1ZRFA 2BGCA 1L3LA 3WU1B 2G7UA 3SXYA 1WSUA 3R0JA 1G4DA 1YO5C 2KIFA 1ZHFA 3F6VA 2M8EA 4TV7A 2VT3A 4AIJA 3GF2A 1FYLA 2Z99A 3FZVA 1O3SA 2P7VB 3KFWX 1XGSA 3LWFA 4CGZA 5D5XB 2DFIA 4EM2A 3D5LA 2PN6A 1HW5A 1BN5A 3J80K 3CUQC 4BHCA 4M73A 4BHPA 4B09A 4XSZF 3GWZA 4WXHA 1FBQA 1EH7A 2DK5A 3HSRA 2EV0A 3E6MA 2QLZA 1ZREA 2M1BA 1KU3A 3J80Z 4LB6B 2XIGA 3MAJA 1H0MA 2ZJ2A 2UWMA 2V1XA 4G7ZF 4KIFA 3I53A 2O8XA 5CVIA 2WC2A 1QBJA 1IF1A 1G3TA 1FNNA 4OIOF 1G6NA 3VEPA 1R22A 1QZZA 2NRAC 4ETSA 2DAOA 2K4JA 3CJNA 1S6LA 2FBIA 1SD6A 1T2KA 3QU3A 4P9FA 3R6SA 4M9XA 4G6QA 1GXQA 1MGTA 2H6BA 5CVUA 4LD5A 3ISPA 2BEOA 2A07F 3HOTA 3L2CA 2QBYB 4KDPA 3RDIA 3I0TA 4IRIA 1TNSA 1IN8A 3K1NA 1L0OC 2LSOA 3VFZA 5LHGA 5BPIA 2CFXA 4B8XA 1P6RA 4KICA 4BAYA 4LLNA 4CZZA 2ZMEB 5F1RA 4I09A 2RC4A 2Q2EA 1OPCA 3TDUC 3N97A 1KYZA 5FD5A 3F8MA 2IRFG 2KJBA 2A69F 3P7NA 2EK5A 2FOKA 4E70A 2VE9A 4EV0A 2V1DA 3I4PA 1FLIA 4HA8A 4WK8F 4GXOA 2DT5A 1UHWA 3WG9A 3HRMA 4L0YB 4P55A 4YG2F 1HKQA 2V9VA 4Q5SF 3DKWA 4I0BA 1FBUA 2YU3A 2PBIA 3RYRA 2XROA 3EETA 1IZ1A 1GXPA 5CVVA 1EV7A 3WGHA 1XMKA 1OR7A 4LGWA 2GZWA 2BYVE 2IP2A 2HKXA 3BJAA 1QNTA 3EYYA 3MEXA 2WV0A 2STTA 2NNNA 4ZYEA 2FEZA 3GW2A 5D6EA 1FP2A 1FSEA 1XSVA 3V8KA 1LEAA 2XKPA 4DQ2A 1KQ0A 4FX4A 1YTYA 3IRQA 2XVCA 2ZFWA 4KYWA 4RGRA 1F5TA 4Y13A 1ZG5A 4ZYHA 1ULYA 5CJ9A 2ISZA 3ERED 1K6OA 2P8TA 1R1VA 4MGRA 3U9GA 1Q1HA 4Z2YA 2YPRA 3BJOA 3BJ6A 4UVAA 3F8CA 3V7RA 3IRRA 4L0ZB 1IN6A 3FMRA 5CVRA 4LJZF 3I58A 1BI1A 2KJCA 3GFJA 1QGPA 2A3SA 3BDDA 1UCRA 1I1GA 2H09A 5E17F 4HOBA 5LGUA 5IT3A 1ZARA 3I71A 3WE3A 1YS6A 4MTEA 4AIKA 3QP5A 1O3QA 2PMHA 4IF4A 4MNUA 4KIBA 5H6RA 2IA1A 4HLXA 1G3WA 3DQVC 1Z6TA 4L18B 2ZBKA 4I02A 1U5TC 5JR3A 1RZ4A 4ESBA 3TGNA 1WWXA 3T5XA 1ZG3A 3ABUA 2A6HF 2GXGA 4QLCU 4UUVA 1JHHA 2ZNZA 3ECHA 2CGPA 4YFKF 5D4SA 3KP7A 4U7DA 1LDDA 1ON2A 2M5WA 1FYKA 1R23A 3LAJA 3KP6A 1XGOA 4KFCA 3NRVA 3MWMA 2CQKA 1V3FA 2NNYA 1JGSA 2LKPA 4G9YA 2P5LC 5DCFA 3CUOA 2V79A 1PDNC 1FYMA 1R1UA 1MDMB 3BOQA 2DQLA 1PP7U 2EFOA 4HQEA 2XAFA 4IVNA 4EJTA 3FF5A 5BMZA 2QUFA 1K78B 1H9TA 2EV5A 2XAGA 1FT9A 3JSPA 5D8LB 3ZMSA 2F5EA 3GFLA 5AIQA 3FXUA 1EH8A 5AONA 1OYIA 1TNTA 1ZAOA 5L3GA 3Q5FA 2E7XA 4M74A 3RI4A 1I1SA 3WTWC 2W85A 2M45A 3CLOA 3HUGA 3NEUA 1LEBA 2QQBA 1ZGJA 5FLXK 5FD6A 5DCMB 3BZ6A 5HS9A 4XLPF 3GO5A 2O6GE 1HKTA 2F2EA 2Y75A 3WODF 3KLOA 2W84A 3KP3A 2XAJA 3O3KA 5HDGA 4KIGA 2QWWA 1IAWA 2UXNA 5FLXZ 4P96A 4A5NA 4BHBA 2JPCA 1USSA 4HDUA 2F5DA 4D0PA 1U3EM 3GXOA 1KYWA 3FMSA 4EMSA 3GX4X 4L9TA 1XCBA 4Q4ZF 4M6YA 5FGMA 2FA5A 5FB2A 3I59B 2OA4A 2K27A 5J6XA 4H0EA 3E6DA 5HDKA 1SD4A 4HBLA 3LQQA 3U1DA 5LBQA 4KMFA 1J2XA 2RQPA 1ON1A 4MTDA 3RPUA 2F5CA 3DFGA 4YIIA 4KA4A 4PGHA 1W5TA 2FQ3A 1O57A 3WTVC 2KRFA 3E97A 4EQQA 4OINF 1W4MA 3F23A 1MDMA 4A2UA 1AWCA 2EWNA 4I7HA 2E7WA 4K2EA 4OMZA 2L02A 3QPTA 3T8TA 3CO6C 2ZXJA 3TOAA 4ENMA 5IT9K 1K78A 3G3ZA 1FY7A 3D0SA 5HLIA 1MJBA 2IVMA 4P5OA 4MEYF 2LNBA 3V7SA 3KEOA 3COAC 1NHAA 4HX8A 4EGZA 2ZO4A 4UVBA 4IXAA 1ONVA 5ICFA 3HRTA 3SFZA 2QQ9A 4L5JA 5LLQA 5IT9Z 4G94A 3CDHA 2CG4A 4HF1A 2GA1A 1FOKA 5K5RA 5LGNA 4G6DA 3HIFA 3K0LA 1QPMA 3TO9A 2QM3A 2XUBA 1EH6A 1IRGA 1BC8C 3ROUA 5ILSA 3MQ0A 4N0BA 3E5QA 5DUKA 5L3CA 3ZN1A 2QVOA 1F4KA 2QZ8A 5CLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW7 A;  3R60 A;  1WRJ A;  3H92 A;  1CF7 B;  3L7W A;  5ILV A;  2RKH A;  2WWY A;  4ZYG A;  2HOE A;  3IC7 A;  2O03 A;  4BNC A;  3B02 A;  1KU9 A;  4L9V A;  3SZT A;  3LFK A;  1LJ9 A;  3R61 A;  2FBK A;  1R7J A;  3REO A;  4M72 A;  3I59 A;  4FX0 A;  2JTV A;  4HF0 A;  1SMT A;  1KGS A;  1R5H A;  5LGT A;  4ZZL A;  2RV8 A;  1HSJ A;  5ICE A;  1J0R A;  4BH9 A;  3P9I A;  1TQI A;  1LDK B;  3WTX C;  2D45 A;  2NAZ A;  2DI3 A;  1TQM A;  2HTJ A;  3C18 A;  4BXU A;  2AS5 F;  3L9F A;  1LQ1 A;  1XDS A;  1TBX A;  2DBB A;  4DNC A;  2RNJ A;  3TDZ C;  4HDV A;  3SHF A;  2Z5U A;  4P9U A;  1YQA A;  3DPT A;  5FFX A;  4KT5 C;  3WTU C;  2J5O A;  3B73 A;  3FM5 A;  4L9N A;  1MKM A;  1MD0 A;  3GFI A;  4AD9 A;  4XLN F;  2A68 F;  2O3F A;  2XHK A;  3WTZ A;  1G3Y A;  2CSO A;  1IN7 A;  1ZGA A;  1Y0U A;  1O7F A;  3MZH A;  4EVI A;  1STZ A;  3K9T A;  3GEZ A;  1T98 A;  4Q48 A;  1KA8 A;  1RUN A;  5FFZ A;  3Q9S A;  4HYE A;  4A6E A;  5HOO A;  4HW0 A;  3WTT C;  4LK0 F;  3DP7 A;  2HWV A;  2M87 A;  2PJP A;  1W7P B;  1D8K A;  2VBX A;  2QEN A;  2MD5 A;  3QU6 A;  4HV6 A;  4HLY A;  4ESJ A;  3GUD A;  4HX4 A;  2VOD A;  3WTY C;  2VBY A;  1S8N A;  1LDJ A;  1J59 A;  1FX7 A;  1D3Y A;  1BOA A;  2AXL A;  4LMY A;  2OD5 A;  3E6C C;  1OYW A;  2ELH A;  4NHJ A;  4KNY A;  2EFP A;  3F6O A;  3DXJ F;  2Y48 A;  1KQ9 A;  2GQQ A;  3V8J A;  4MEX F;  3OOP A;  2ADU A;  4WF2 A;  3VB2 A;  1HKS A;  2STW A;  5JHU A;  1QZY A;  4O3M A;  2IW5 A;  1R5G A;  2PQ8 A;  3ZMT A;  5ERI A;  1TLH B;  4A6D A;  2V1U A;  4HF2 A;  4AIH A;  3ULQ B;  1PP8 F;  1B59 A;  4L5I A;  2YSR A;  3F22 A;  4FHT A;  4WCG A;  4LG0 B;  5LEK A;  5A2Q K;  3O6B B;  2CW0 F;  2DQR A;  3HRU A;  2PFB A;  3M9A A;  3IHU A;  4FT8 A;  1Z9C A;  2QBY A;  3FX3 A;  1Z7U A;  3TO7 A;  4CYD A;  2RN7 A;  1HST A;  5E20 A;  3BP8 A;  1C0W A;  4UV9 A;  1XGN A;  4UNO A;  3FHZ A;  2FSW A;  2CO5 A;  2XAS A;  5A2Q Z;  1SD5 A;  1KQ8 A;  4RGX A;  2OQR A;  3N4M A;  2JPB A;  2ZME A;  2MA3 A;  5E8G A;  2E1N A;  1R36 A;  4N9I A;  3KZZ A;  4GYG A;  2O61 A;  2OZ6 A;  5F64 A;  1YW9 A;  2FU4 A;  5D8K B;  3ABT A;  1DDN A;  2K02 A;  1FP1 D;  4MQV A;  1YLF A;  4Y15 A;  2H94 A;  2MH9 A;  3QP6 A;  4ON0 A;  2UZK A;  4RGU A;  1O3T A;  2F5F A;  1SFU A;  3GYH X;  3KP4 A;  1W7P A;  2HGC A;  3V4G A;  4RS8 A;  3HHH A;  3H3U A;  3HRS A;  4A5M A;  3U2R A;  1J5Y A;  4EM0 B;  3KEQ A;  3CUQ B;  2EFQ A;  1XMA A;  1A04 A;  4PDK A;  2NS0 A;  1UFM A;  3KLN A;  1P4A A;  2ESN A;  1XSD A;  1K79 A;  4ENJ A;  3WGG A;  1ZLK A;  2P5V A;  5BQT A;  2HR3 A;  1CGP A;  3HYI A;  1OYY A;  2FMY A;  3VOE A;  3KE2 A;  2L54 A;  1OMI A;  1D5V A;  4IHT A;  3ML6 A;  2HYF A;  5BPD A;  1BI0 A;  1ODD A;  1FC3 A;  4LLL A;  3RJP A;  3LAP A;  1ZRC A;  4M71 A;  5JFR A;  2X4H A;  5D5W B;  2L3D A;  2VON A;  1KU2 A;  3HOS A;  2EFN A;  1U6G A;  2VE8 A;  1U2W A;  2Z9O A;  5D5U B;  4MQ9 F;  1FWZ A;  2K4B A;  5H20 A;  4MHG A;  4GO1 A;  2R3S A;  3F72 A;  2FXA A;  3WGI A;  4GYI A;  5J8F A;  2JRT A;  2VOO A;  1O3R A;  4ZYD A;  3WU0 A;  3QOP A;  5L3F A;  4RB3 C;  3JAM K;  4KMU X;  3ZPL A;  3E6B A;  4UXN A;  3KP5 A;  1IRF A;  2LF7 A;  1MJ9 A;  4LLG F;  2FF4 A;  4F7Z A;  3M8F A;  4RAZ A;  3KZY A;  1UST A;  2ZKZ A;  2L01 A;  1XCV A;  4RGS A;  1YFH A;  2VOP A;  3BWG A;  6PAX A;  5E8I A;  3JAM Z;  1E2X A;  3GZ5 A;  2DPU A;  4OU0 A;  1WQ2 A;  2KIM A;  4YFN F;  2PLY A;  2XRN A;  3TKY A;  5L3B A;  3QPH A;  2D2W A;  5ICG A;  4ZH4 F;  4HX7 A;  5JI6 A;  5HS8 A;  2Z33 A;  1BJA A;  4OOI A;  2W25 A;  5DYM A;  2NYX A;  1FZP B;  1V4R A;  3QRF F;  1UB9 A;  1SAX A;  1MZB A;  4A0Y A;  4UHT A;  2EFW A;  5DV5 A;  3TOB A;  2HTS A;  1P4W A;  2XAH A;  3EDP A;  4ENK A;  2PMU A;  3K69 A;  4BQA A;  1W5S A;  3C7J A;  2P6S A;  5FO5 A;  3RPQ A;  4YFX F;  3JTG A;  3LA3 A;  1U8R A;  1SFX A;  4U0W A;  5DD8 A;  3F3X A;  1BBY A;  1T39 A;  1S3J A;  4HV5 A;  4U0Y A;  1BC7 C;  2HFH A;  2K86 A;  1O7L A;  1RIO H;  2XKO A;  3KP2 A;  4WX9 A;  2FNP A;  4RB2 C;  2KIU A;  5DUI A;  4I0A A;  2MH2 A;  2ZNY A;  3MFK A;  2HKO A;  3EQL F;  1T6S A;  1OKR A;  2DU9 A;  2Z3Y A;  4EGY A;  4IRG A;  2PEX A;  5L3D A;  2Y0M A;  3HSE A;  3H3Z A;  5DCM A;  2YR2 A;  5JVT A;  4O6J A;  2TDX A;  1SD7 A;  4WXD A;  1DUX C;  4RB0 A;  3TO6 A;  2E1C A;  4BYY A;  3IWF A;  4ZZD A;  3RTR A;  1REP C;  3LA2 A;  3F21 A;  2VBZ A;  2YX4 A;  2MC3 A;  3GVA A;  2OAZ A;  3W6J B;  3FM3 A;  3NQO A;  5KK1 A;  1U5T B;  1ZRD A;  2UXX A;  2OU2 A;  3CTA A;  5E1X A;  4ASN A;  3ELK A;  2HS5 A;  3F8N A;  5D4R A;  1P2F A;  3C1D A;  2QYO A;  1B6A A;  3TQN A;  4HAM A;  2P5K A;  5AIP A;  1BIB A;  2Q0O A;  3K1M A;  3DV8 A;  3ZMV A;  3T0Y A;  5E1Z B;  1D8J A;  3PQJ A;  3PQK A;  2XV4 S;  3RIR A;  1TQP A;  3DEU A;  4OIP F;  2FNA A;  5CVJ A;  3HTU A;  2FBH A;  1XDU A;  3DF8 A;  1JHF A;  3O2P E;  4GCV A;  3RKX A;  2VN2 A;  4EM1 A;  1SFE A;  5L3E A;  2HQR A;  5DDG A;  2RDP A;  1S7O A;  5EEH A;  2GAU A;  2FML A;  3R4K A;  5TJJ A;  2P7C B;  2O0Y A;  1LVA A;  3LQR A;  2RVC A;  3MZY A;  3L00 A;  2G9W A;  1S7A A;  4LFU A;  2VC0 A;  1BI3 A;  1BI2 A;  5HDN A;  2FE3 A;  1Z05 A;  2W57 A;  2LDU A;  3V7C A;  3ZN0 A;  4NQW A;  2CWE A;  1J7K A;  2G7H A;  2L4M A;  2XGX A;  1R00 A;  3S2W A;  1DP7 P;  1P4X A;  5E18 F;  1DPR A;  2HYG D;  2GWR A;  5LHI A;  2QQA A;  3ECO A;  1T38 A;  2P4W A;  4NB5 A;  4U0V A;  1LB2 A;  3J7A O;  2IT0 A;  1WKM A;  1FSH A;  1CF7 A;  3Q9V A;  3W6K B;  3QAH A;  1I6X A;  1QQI A;  1HBX G;  3BPX A;  2IJL A;  3JW4 A;  1U5T A;  1Z91 A;  2COM A;  4JK1 X;  3IL2 A;  2ZCW A;  3FXQ A;  5LHH A;  2OZU A;  1GHC A;  4JBA A;  1HXD A;  4R8H A;  1DPU A;  5K5Q A;  3MCZ A;  4GGG A;  3HSF A;  1TW2 A;  3M7G A;  1TTY A;  2GXB A;  4KN4 X;  4HQM A;  2OBP A;  1XSX A;  2V6C A;  1YIO A;  5ED4 A;  4IHS A;  3FXR A;  5LEJ A;  3K1P A;  2RGV A;  1UHM A;  2JSC A;  4G8X A;  5K5O A;  1WI9 A;  3GFM A;  4XSX F;  4L9J A;  3BY6 A;  1KU7 A;  2IA0 A;  1HW2 A;  1B4A A;  3EYI A;  1AOY A;  2DLL A;  3LST A;  5TRD A;  3I54 A;  1QO0 D;  4M6X A;  3IWZ A;  1U78 A;  3RYP A;  1IW7 F;  4ESF A;  4G7O F;  1G3S A;  4KUM A;  2GA2 A;  1RUO A;  1HW1 A;  4G7H F;  3DPL C;  2VBW A;  1XD7 A;  2X0L A;  3E3V A;  3P9C A;  5H6Q A;  4CHU A;  4CO8 A;  4Q47 A;  3KCC A;  4S05 A;  2B0L A;  1BIA A;  2EV6 A;  2ISY A;  3E5U A;  4EJU A;  2VC1 A;  2DK8 A;  3VOD A;  5K1Y A;  5LRR A;  4CXF A;  2MLK A;  5KVR A;  3ZMU A;  1VTN C;  3BPV A;  4UV8 A;  2DO7 A;  2A5Y B;  3IKT A;  2OQG A;  5BS6 A;  4R79 A;  3SQN A;  3EUH A;  2D1V A;  5F6F A;  1IUY A;  3KET A;  2A61 A;  2M30 A;  1RNL A;  3RKW A;  2ESH A;  3P9K A;  4UVC A;  3F8B A;  5HVQ C;  1YW8 A;  3ZP5 A;  4PGG A;  3HTS B;  1ZG1 A;  5E1W A;  1MJA A;  1J9I A;  4QWQ A;  1IXS B;  5HS7 A;  1E17 A;  3M8E A;  4U7B A;  1IXC A;  4CIC A;  2DW4 A;  5HLH A;  2GIV A;  1K7A A;  2PG4 A;  2EB7 A;  4S04 A;  3CO7 C;  4HZF A;  2L4A A;  2EA4 A;  2FRH A;  4A0Z A;  2C6Y A;  1YS7 A;  3T1B A;  2BV6 A;  1BM9 A;  2P6T A;  4XBF A;  4I01 A;  2KKO A;  2DPD A;  1JXS A;  4EJW A;  4I98 B;  4LG0 A;  3AAF A;  1B1B A;  5D5V B;  4R1H A;  2K7L A;  1YG2 A;  4OIQ F;  1R1T A;  4LK1 F;  4EJV A;  4A12 A;  1B9N A;  4OIR F;  4YIF A;  5HLG A;  1PUE E;  3I64 A;  3FWE A;  1XN7 A;  3PFI A;  4XRF A;  1F9N A;  4U88 A;  4M9S A;  3WE2 A;  1IN4 A;  4EJO A;  4IRH A;  1S29 A;  3I5U A;  4M9Z A;  5DD4 A;  1GVJ A;  3GLX A;  3C3W A;  1ZH5 A;  1X3U A;  1ZN2 A;  2A6E F;  2VT2 A;  1ZLJ A;  3K2Z A;  4I2O A;  1XGM A;  4WXC A;  4WWC A;  4CDG A;  3OV8 A;  3FMQ A;  2D1H A;  1JE8 A;  3J81 K;  1LNW A;  5LRS A;  1J75 A;  3WTS C;  3ZMD A;  2HQN A;  2HEO A;  4IJA A;  4O5V A;  2LF8 A;  5D6F A;  1YYV A;  2J5P A;  2H6C A;  2VXZ A;  2EJR A;  1I27 A;  4IPA A;  3G73 A;  3HHG A;  2R7D A;  1T0F A;  4PZJ A;  1HQC A;  2JT1 A;  3CUQ A;  2MLG A;  3J81 Z;  1I5Z A;  3F8F A;  4Y17 A;  4OMY A;  3M1E A;  1TW3 A;  2CYY A;  1XB4 A;  1P92 A;  2DTR A;  2H27 A;  2XAQ A;  4A0X A;  3SZP A;  2PI0 A;  5DEQ A;  2YX7 A;  2IA2 A;  1ZYR F;  3V8L A;  1Z6R A;  1FPQ A;  5ICC A;  4PCQ A;  2JZY A;  3JTH A;  1W7P D;  3T8R A;  4LB5 A;  5CYV A;  3GZ6 A;  3IKV A;  1B9M A;  3E5X A;  4ENN A;  5BOX A;  2W24 A;  4RAY A;  2BE5 F;  3LA7 A;  3L09 A;  3ZQ7 A;  4RB1 A;  3R0A A;  4AWX B;  4AVP A;  3RKY A;  1IN5 A;  2ACJ A;  2MBF A;  1F1Z A;  1RI7 A;  4JQF A;  1Z1D A;  4N9H A;  1IXR C;  1SMY F;  3ZMZ A;  4KN7 X;  5J8C A;  2EA2 A;  2HZT A;  5EEG A;  2ETH A;  2R7F A;  5ILU A;  2IPQ X;  2HDC A;  2WTE A;  1R58 A;  2BBY A;  1FBS A;  2Q8K A;  1H9G A;  3JSO A;  3BRO A;  1ZRF A;  2BGC A;  1L3L A;  3WU1 B;  2G7U A;  3SXY A;  1WSU A;  3R0J A;  1G4D A;  1YO5 C;  2KIF A;  1ZHF A;  3F6V A;  2M8E A;  4TV7 A;  2VT3 A;  4AIJ A;  3GF2 A;  1FYL A;  2Z99 A;  3FZV A;  1O3S A;  2P7V B;  3KFW X;  1XGS A;  3LWF A;  4CGZ A;  5D5X B;  2DFI A;  4EM2 A;  3D5L A;  2PN6 A;  1HW5 A;  1BN5 A;  3J80 K;  3CUQ C;  4BHC A;  4M73 A;  4BHP A;  4B09 A;  4XSZ F;  3GWZ A;  4WXH A;  1FBQ A;  1EH7 A;  2DK5 A;  3HSR A;  2EV0 A;  3E6M A;  2QLZ A;  1ZRE A;  2M1B A;  1KU3 A;  3J80 Z;  4LB6 B;  2XIG A;  3MAJ A;  1H0M A;  2ZJ2 A;  2UWM A;  2V1X A;  4G7Z F;  4KIF A;  3I53 A;  2O8X A;  5CVI A;  2WC2 A;  1QBJ A;  1IF1 A;  1G3T A;  1FNN A;  4OIO F;  1G6N A;  3VEP A;  1R22 A;  1QZZ A;  2NRA C;  4ETS A;  2DAO A;  2K4J A;  3CJN A;  1S6L A;  2FBI A;  1SD6 A;  1T2K A;  3QU3 A;  4P9F A;  3R6S A;  4M9X A;  4G6Q A;  1GXQ A;  1MGT A;  2H6B A;  5CVU A;  4LD5 A;  3ISP A;  2BEO A;  2A07 F;  3HOT A;  3L2C A;  2QBY B;  4KDP A;  3RDI A;  3I0T A;  4IRI A;  1TNS A;  1IN8 A;  3K1N A;  1L0O C;  2LSO A;  3VFZ A;  5LHG A;  5BPI A;  2CFX A;  4B8X A;  1P6R A;  4KIC A;  4BAY A;  4LLN A;  4CZZ A;  2ZME B;  5F1R A;  4I09 A;  2RC4 A;  2Q2E A;  1OPC A;  3TDU C;  3N97 A;  1KYZ A;  5FD5 A;  3F8M A;  2IRF G;  2KJB A;  2A69 F;  3P7N A;  2EK5 A;  2FOK A;  4E70 A;  2VE9 A;  4EV0 A;  2V1D A;  3I4P A;  1FLI A;  4HA8 A;  4WK8 F;  4GXO A;  2DT5 A;  1UHW A;  3WG9 A;  3HRM A;  4L0Y B;  4P55 A;  4YG2 F;  1HKQ A;  2V9V A;  4Q5S F;  3DKW A;  4I0B A;  1FBU A;  2YU3 A;  2PBI A;  3RYR A;  2XRO A;  3EET A;  1IZ1 A;  1GXP A;  5CVV A;  1EV7 A;  3WGH A;  1XMK A;  1OR7 A;  4LGW A;  2GZW A;  2BYV E;  2IP2 A;  2HKX A;  3BJA A;  1QNT A;  3EYY A;  3MEX A;  2WV0 A;  2STT A;  2NNN A;  4ZYE A;  2FEZ A;  3GW2 A;  5D6E A;  1FP2 A;  1FSE A;  1XSV A;  3V8K A;  1LEA A;  2XKP A;  4DQ2 A;  1KQ0 A;  4FX4 A;  1YTY A;  3IRQ A;  2XVC A;  2ZFW A;  4KYW A;  4RGR A;  1F5T A;  4Y13 A;  1ZG5 A;  4ZYH A;  1ULY A;  5CJ9 A;  2ISZ A;  3ERE D;  1K6O A;  2P8T A;  1R1V A;  4MGR A;  3U9G A;  1Q1H A;  4Z2Y A;  2YPR A;  3BJO A;  3BJ6 A;  4UVA A;  3F8C A;  3V7R A;  3IRR A;  4L0Z B;  1IN6 A;  3FMR A;  5CVR A;  4LJZ F;  3I58 A;  1BI1 A;  2KJC A;  3GFJ A;  1QGP A;  2A3S A;  3BDD A;  1UCR A;  1I1G A;  2H09 A;  5E17 F;  4HOB A;  5LGU A;  5IT3 A;  1ZAR A;  3I71 A;  3WE3 A;  1YS6 A;  4MTE A;  4AIK A;  3QP5 A;  1O3Q A;  2PMH A;  4IF4 A;  4MNU A;  4KIB A;  5H6R A;  2IA1 A;  4HLX A;  1G3W A;  3DQV C;  1Z6T A;  4L18 B;  2ZBK A;  4I02 A;  1U5T C;  5JR3 A;  1RZ4 A;  4ESB A;  3TGN A;  1WWX A;  3T5X A;  1ZG3 A;  3ABU A;  2A6H F;  2GXG A;  4QLC U;  4UUV A;  1JHH A;  2ZNZ A;  3ECH A;  2CGP A;  4YFK F;  5D4S A;  3KP7 A;  4U7D A;  1LDD A;  1ON2 A;  2M5W A;  1FYK A;  1R23 A;  3LAJ A;  3KP6 A;  1XGO A;  4KFC A;  3NRV A;  3MWM A;  2CQK A;  1V3F A;  2NNY A;  1JGS A;  2LKP A;  4G9Y A;  2P5L C;  5DCF A;  3CUO A;  2V79 A;  1PDN C;  1FYM A;  1R1U A;  1MDM B;  3BOQ A;  2DQL A;  1PP7 U;  2EFO A;  4HQE A;  2XAF A;  4IVN A;  4EJT A;  3FF5 A;  5BMZ A;  2QUF A;  1K78 B;  1H9T A;  2EV5 A;  2XAG A;  1FT9 A;  3JSP A;  5D8L B;  3ZMS A;  2F5E A;  3GFL A;  5AIQ A;  3FXU A;  1EH8 A;  5AON A;  1OYI A;  1TNT A;  1ZAO A;  5L3G A;  3Q5F A;  2E7X A;  4M74 A;  3RI4 A;  1I1S A;  3WTW C;  2W85 A;  2M45 A;  3CLO A;  3HUG A;  3NEU A;  1LEB A;  2QQB A;  1ZGJ A;  5FLX K;  5FD6 A;  5DCM B;  3BZ6 A;  5HS9 A;  4XLP F;  3GO5 A;  2O6G E;  1HKT A;  2F2E A;  2Y75 A;  3WOD F;  3KLO A;  2W84 A;  3KP3 A;  2XAJ A;  3O3K A;  5HDG A;  4KIG A;  2QWW A;  1IAW A;  2UXN A;  5FLX Z;  4P96 A;  4A5N A;  4BHB A;  2JPC A;  1USS A;  4HDU A;  2F5D A;  4D0P A;  1U3E M;  3GXO A;  1KYW A;  3FMS A;  4EMS A;  3GX4 X;  4L9T A;  1XCB A;  4Q4Z F;  4M6Y A;  5FGM A;  2FA5 A;  5FB2 A;  3I59 B;  2OA4 A;  2K27 A;  5J6X A;  4H0E A;  3E6D A;  5HDK A;  1SD4 A;  4HBL A;  3LQQ A;  3U1D A;  5LBQ A;  4KMF A;  1J2X A;  2RQP A;  1ON1 A;  4MTD A;  3RPU A;  2F5C A;  3DFG A;  4YII A;  4KA4 A;  4PGH A;  1W5T A;  2FQ3 A;  1O57 A;  3WTV C;  2KRF A;  3E97 A;  4EQQ A;  4OIN F;  1W4M A;  3F23 A;  1MDM A;  4A2U A;  1AWC A;  2EWN A;  4I7H A;  2E7W A;  4K2E A;  4OMZ A;  2L02 A;  3QPT A;  3T8T A;  3CO6 C;  2ZXJ A;  3TOA A;  4ENM A;  5IT9 K;  1K78 A;  3G3Z A;  1FY7 A;  3D0S A;  5HLI A;  1MJB A;  2IVM A;  4P5O A;  4MEY F;  2LNB A;  3V7S A;  3KEO A;  3COA C;  1NHA A;  4HX8 A;  4EGZ A;  2ZO4 A;  4UVB A;  4IXA A;  1ONV A;  5ICF A;  3HRT A;  3SFZ A;  2QQ9 A;  4L5J A;  5LLQ A;  5IT9 Z;  4G94 A;  3CDH A;  2CG4 A;  4HF1 A;  2GA1 A;  1FOK A;  5K5R A;  5LGN A;  4G6D A;  3HIF A;  3K0L A;  1QPM A;  3TO9 A;  2QM3 A;  2XUB A;  1EH6 A;  1IRG A;  1BC8 C;  3ROU A;  5ILS A;  3MQ0 A;  4N0B A;  3E5Q A;  5DUK A;  5L3C A;  3ZN1 A;  2QVO A;  1F4K A;  2QZ8 A;  5CLS A; 
#chains in the Genus database with same CATH topology
 2K9Q A;  1YW7 A;  3R60 A;  3SDB A;  3LSH A;  2WY8 Q;  1F43 A;  3Q0W A;  3OYF A;  3E1S A;  2H1L A;  1WRJ A;  2V9K A;  3H92 A;  1CF7 B;  4RBO A;  3PFY A;  2QCO A;  3L7W A;  5ILV A;  2RKH A;  4PK4 A;  3FKI J;  2WWY A;  4ZYG A;  2HOE A;  3IC7 A;  4XOR A;  2XPV A;  2O03 A;  4CYC B;  1WZ2 A;  4BNC A;  5H2F C;  3B02 A;  1KU9 A;  3A1Y A;  4MO7 A;  1MND A;  4L9V A;  3SZT A;  3LFK A;  1LJ9 A;  2WAQ A;  3ZQH A;  2JN6 A;  2DJI A;  2R4G A;  3CME I;  1X4P A;  2DA5 A;  2CQX A;  3R61 A;  2FBK A;  3KX2 A;  3K4M A;  1R7J A;  3REO A;  4M72 A;  3PIP F;  4BE1 A;  3DBH B;  3I59 A;  4FX0 A;  2JTV A;  4HF0 A;  2L9S A;  3K4K A;  1MMN A;  2DMT A;  1SMT A;  1KGS A;  1R5H A;  4G6T B;  5LGT A;  4ZZL A;  2RV8 A;  4BEH B;  4RLF A;  1HSJ A;  2KMU A;  5ICE A;  1SAN A;  1FMW A;  3D5S C;  3HKZ A;  4XLE A;  1J0R A;  3IH4 A;  4BH9 A;  3H0G J;  2R5Y A;  3P9I A;  3J7Z I;  1TQI A;  3CCV I;  2MAB A;  1GDT A;  1LDK B;  3WTX C;  2D45 A;  1XPX A;  2NAZ A;  2K3P A;  2DI3 A;  1TQM A;  2HTJ A;  3C18 A;  4BXU A;  3BR2 A;  2AS5 F;  3L9F A;  1LQ1 A;  1XDS A;  1TBX A;  2DBB A;  4DNC A;  1BL0 A;  2RNJ A;  2L9N A;  2MYS A;  3TDZ C;  4HDV A;  3PNT A;  3W2V A;  3SHF A;  4BJT A;  2MC4 A;  2Z5U A;  1B8I A;  4BY1 J;  1GVD A;  4XLC A;  4P9U A;  1IDZ A;  1YQA A;  3DPT A;  3N05 A;  5FFX A;  5EZG A;  4BXX J;  4Y4R A;  4KT5 C;  2ICW G;  3WTU C;  2J5O A;  1I39 A;  1AKH A;  2E1M C;  3B73 A;  3FM5 A;  4L9N A;  3CMA I;  3HEF A;  1MKM A;  2R92 J;  1Y8R B;  2IAI A;  1MD0 A;  2VQH A;  3ZGK A;  3OSG A;  1JUP A;  3ABL H;  3GFI A;  2R7X A;  4AD9 A;  4XLN F;  2A68 F;  1UJ8 A;  2O3F A;  2XHK A;  4XIC A;  3DBL B;  2JVH A;  3WTZ A;  2LD5 A;  1G3Y A;  2CSO A;  3NAR A;  1QVU A;  1IN7 A;  1ZGA A;  1Y0U A;  1O7F A;  3M1C A;  1U9O A;  4N4O B;  3MZH A;  4M3B A;  2DOF A;  2GOX B;  3FKJ A;  4KJZ A;  1QVT A;  4D5C A;  3CCE I;  4EVI A;  1STZ A;  2CQQ A;  4C2U A;  3K9T A;  3BG3 A;  3GEZ A;  1NK2 P;  1T98 A;  4Q48 A;  3DCF A;  1KA8 A;  3PO2 J;  1RUN A;  5FFZ A;  3Q9S A;  3S93 A;  3MKY B;  4HYE A;  1X1A A;  1P9Q C;  4A6E A;  2BY0 A;  5HOO A;  4HW0 A;  1ETW A;  1YJ9 I;  3WTT C;  2EZH A;  3DP7 A;  2HWV A;  4LK0 F;  1D1C A;  2V9P A;  2Z2S B;  1FIA A;  1IUF A;  4C9Y A;  4Y52 J;  2OTL I;  2M87 A;  2PJP A;  1W7P B;  1D8K A;  4E7S A;  2VBX A;  2QEN A;  2MD5 A;  3QU6 A;  4HV6 A;  4HLY A;  3DBR B;  4ESJ A;  3GUD A;  3JRD A;  2X6X A;  4HX4 A;  1LFU P;  2VOD A;  3GTP J;  3WTY C;  1SVM A;  2QQ8 A;  2VBY A;  1S8N A;  1LDJ A;  5CQG A;  1J59 A;  1FX7 A;  2OCC H;  1MH3 A;  1WI3 A;  1TT0 A;  5J3L A;  2ECC A;  1D3Y A;  1Y1V J;  2VQG A;  2I10 A;  3WHC A;  4MFD A;  1BOA A;  4JP0 A;  2KRC A;  2AXL A;  4LMY A;  2L7F P;  4AYB N;  2OD5 A;  4XQF A;  3E6C C;  2HVR A;  1OYW A;  4IQJ A;  2ELH A;  4NHJ A;  4KNY A;  3NWS A;  4HRI A;  2LY1 A;  2WB1 A;  2EFP A;  3F6O A;  3DXJ F;  2ZJR F;  2Y48 A;  3MVP A;  3UNG C;  3H5A A;  1KQ9 A;  2GQQ A;  2CV2 A;  3V8J A;  4MEX F;  2KIS A;  3OOP A;  2ADU A;  4WF2 A;  5J4Y A;  2R5Z A;  4DJA A;  3VB2 A;  3K7A J;  2FX0 A;  3RZD J;  1HKS A;  1LE8 B;  4E7J A;  2STW A;  1ZR4 A;  2W7N A;  5JHU A;  3A01 B;  1QZY A;  2KZV A;  2HQA A;  3HOW J;  4O3M A;  2IW5 A;  1R5G A;  4BEH A;  4CUG A;  2PQ8 A;  1NG7 A;  3JRI A;  1NH3 A;  4I99 C;  2CH0 A;  3ZMT A;  1PUF B;  2WAF A;  5FKK A;  3ABK H;  5M3F J;  5ERI A;  1TLH B;  4A6D A;  1SVO A;  2V1U A;  4HF2 A;  4AIH A;  3ULQ B;  1DGW Y;  2L9V A;  1PP8 F;  3FXL A;  1B59 A;  1A35 A;  4L5I A;  4B3A A;  2YSR A;  3F22 A;  3D5R C;  5B1A H;  4FHT A;  4WCG A;  4LG0 B;  1HCR A;  2VQC A;  3JRG A;  5LEK A;  3O6B B;  5A2Q K;  2VPR A;  4NBQ A;  2CW0 F;  2DQR A;  3HOU J;  3HRU A;  2LKX A;  1YI2 I;  2CW7 A;  4C3I J;  5J1R A;  2PFB A;  3M4O J;  1SVL A;  2GOM A;  2DMQ A;  3M9A A;  3C2G A;  3IHU A;  4FT8 A;  1Z9C A;  4LG3 A;  2QBY A;  3FX3 A;  1Z7U A;  3S14 J;  2W00 A;  2WY7 Q;  2KQR A;  3BC8 A;  4XNF A;  3TO7 A;  4CYD A;  4UY8 I;  2RN7 A;  1HST A;  5E20 A;  3DTE A;  3BP8 A;  1C0W A;  1JT6 A;  4UV9 A;  1XGN A;  3PSI A;  4UNO A;  3FHZ A;  2FSW A;  2R7U A;  3S1R J;  2EBI A;  2O9L A;  2CO5 A;  2XAS A;  3JR9 A;  5A2Q Z;  1YOV B;  2DOE A;  3RKQ A;  2ZSH B;  1SD5 A;  1M1E B;  1KQ8 A;  4RGX A;  2OQR A;  1XX5 A;  2NOJ B;  3N4M A;  1TWF J;  3HDD A;  4E7K A;  2JPB A;  2ZME A;  2MA3 A;  5E8G A;  3JRE A;  1B72 B;  2E1N A;  1R36 A;  4N9I A;  3KZZ A;  2DA7 A;  1A6Q A;  2ID6 A;  4GYG A;  2QSG X;  2K9S A;  2O61 A;  2OZ6 A;  4A3E J;  5F64 A;  1YW9 A;  1QHH D;  2FU4 A;  2QGU A;  4LIU A;  5D8K B;  2R7O A;  3A03 A;  3ABT A;  1DDN A;  2K02 A;  1FP1 D;  4MQV A;  2BY3 A;  1YLF A;  4Y15 A;  3RCO A;  5HNH A;  4J19 A;  2Y9Y A;  3EPZ A;  2H94 A;  3FXM A;  2MH9 A;  4IO9 F;  3QP6 A;  4ABZ A;  4ON0 A;  2UZK A;  3AL0 B;  2FQ4 A;  4XM3 A;  5CKT A;  4RGU A;  2K9N A;  5DM6 F;  1O3T A;  2JMW A;  2F5F A;  1SFU A;  3GYH X;  1D1B A;  4FET A;  3KP4 A;  2JA2 A;  3SEQ A;  4M3E A;  4DIQ A;  3JRA A;  3UR3 C;  5DTD A;  1W7P A;  2HGC A;  5KHD A;  3V4G A;  3CJR B;  4RS8 A;  3HHH A;  3QWL A;  3H3U A;  3HRS A;  1H88 C;  4A5M A;  3BG7 A;  3U2R A;  1MBG A;  1J5Y A;  4EM0 B;  3KEQ A;  2Q1Z B;  3CUQ B;  1V5G A;  3OR1 C;  2EFQ A;  1XMA A;  3O8H A;  2VAS A;  1A04 A;  2XGE A;  4PDK A;  2NS0 A;  3ERM A;  1UFM A;  3KLN A;  1P4A A;  4Y7N J;  2ESN A;  5FRM A;  4UUT A;  4CA0 A;  2H8R A;  1XSD A;  3KYL A;  4FAS D;  4KIT B;  1K79 A;  1X1B A;  3FK6 A;  4ENJ A;  2DN0 A;  2M4K A;  1VND A;  3QQA A;  3WGG A;  1ZLK A;  1JI8 A;  2DMU A;  2CQ7 A;  3S1M J;  3OIP A;  2P5V A;  3FHN A;  5BQT A;  2HR3 A;  4AM3 A;  1E3O C;  1CGP A;  3HYI A;  1U9N A;  1LKX A;  1OYY A;  4GFB A;  2FMY A;  3VOE A;  3KE2 A;  4BDZ A;  3LOC A;  1MMD A;  2DA4 A;  2L54 A;  3S1N J;  1OMI A;  4LIV A;  2DA3 A;  1D5V A;  4IHT A;  3ML6 A;  1ZEL A;  5J47 A;  3KYC B;  4IX7 A;  1SC7 A;  1T8I A;  2EIM H;  1ENH A;  2HYF A;  3C2H A;  3U1K A;  5IP6 A;  3S2H J;  3OS1 A;  2JK3 A;  5BPD A;  2R7T A;  1RPW A;  2LBF A;  1BI0 A;  4PFO A;  3F9K A;  1G2H A;  1APL C;  3AKZ A;  1ODD A;  1FC3 A;  4LLL A;  5FKL A;  4FE7 A;  3RJP A;  3LAP A;  1ZRC A;  4M71 A;  4OAY A;  2A05 A;  5JFR A;  5GAE J;  2DFF A;  2X4H A;  1Z7L A;  2L3D A;  3SDG A;  5D5W B;  2VON A;  1KU2 A;  2DXI A;  3HOS A;  2EFN A;  3G6E I;  1U6G A;  2VE8 A;  4RAG A;  4RDU A;  1U2W A;  1X1D A;  2Z9O A;  3BTI A;  1ETQ A;  2LY2 A;  5D5U B;  3ZR8 X;  4MQ9 F;  1FWZ A;  4HNV A;  2K4B A;  1Q1V A;  2YS9 A;  5H20 A;  4MHG A;  4GO1 A;  2R3S A;  2UUZ A;  3L2R A;  1XMX A;  2ZME C;  2I5U A;  3F72 A;  5FLV A;  3A4C A;  2HQ5 A;  5F27 A;  3S32 A;  2ZB9 A;  2FXA A;  1MBH A;  2IGO A;  3WGI A;  4GYI A;  1Z3Y A;  5J8F A;  2JRT A;  1DQU A;  2VOO A;  1O3R A;  4ZYD A;  3WU0 A;  3OYM A;  1H8A C;  3QOP A;  1WVR A;  5L3F A;  4RB3 C;  4IOA F;  2O5R A;  2LOO A;  2VKD A;  3JAM K;  2EZI A;  4QPQ A;  4KMU X;  3ZPL A;  3E6B A;  4UXN A;  2W82 A;  3KP5 A;  1IRF A;  2LF7 A;  4ZJZ A;  5B5E C;  1MJ9 A;  2PMZ A;  4LLG F;  2DOA A;  2FF4 A;  1BW5 A;  2R7W A;  4F7Z A;  2HOT A;  2VLA A;  3FBN B;  3M8F A;  3LSM A;  4RAZ A;  3H5N A;  3KZY A;  1UST A;  5M3M J;  1RRJ A;  3B6C A;  3BT9 A;  2ZKZ A;  2L01 A;  4N4N B;  1XCV A;  4RGS A;  1UZC A;  1YFH A;  1OFC X;  1BOB A;  3BWG A;  6PAX A;  5E8I A;  2VOP A;  3JAM Z;  1E2X A;  2CU7 A;  4BXF A;  1Y56 A;  3GZ5 A;  2DPU A;  4OU0 A;  4A3J J;  1WQ2 A;  2KIM A;  2WAE A;  4YFN F;  2HXI A;  2PLY A;  2XRN A;  3PO3 J;  4B44 A;  3CCU I;  3TKY A;  1R4M B;  2F4M B;  5L3B A;  3QPH A;  3BTL A;  2OCE A;  3DWL E;  1W5C C;  2D2W A;  2EZL A;  4W97 A;  5ICG A;  4ZH4 F;  4HX7 A;  5JI6 A;  3G2B A;  1U0J A;  3A02 A;  5B66 C;  5HS8 A;  1ZK8 A;  2Z33 A;  1BJA A;  4OOI A;  1IG7 A;  2W25 A;  5DYM A;  2NYX A;  2XPU A;  2KPM A;  1FZP B;  2COB A;  1V4R A;  3L2U A;  2VJ5 A;  3OY9 A;  3QRF F;  3FK7 A;  2IGN A;  1IJW C;  2HOS A;  4A3G J;  1UB9 A;  1SAX A;  5FKM A;  1MZB A;  4A0Y A;  4UHT A;  2EFW A;  5DV5 A;  2FOW A;  1MMS A;  2LLK A;  4XOT A;  4AID A;  3TP0 A;  3TOB A;  5IYC J;  2HTS A;  2VB6 A;  4C3H J;  4V19 K;  1P4W A;  2XAH A;  3EDP A;  1WFX A;  4ENK A;  2XSD C;  2PMU A;  3K69 A;  4BQA A;  1W5S A;  3J7Y J;  1AA7 A;  1ZGW A;  2FUG 2;  1WH7 A;  2DTZ A;  2R7S A;  3C7J A;  2P6S A;  5FO5 A;  3RPQ A;  1KON A;  4YFX F;  3JTG A;  3ZQG A;  3LA3 A;  1U8R A;  1MSF C;  1G8X A;  1SFX A;  2BY2 A;  4U0W A;  5DD8 A;  3Q3S A;  3F3X A;  5LFA A;  1FOW A;  1RKW A;  1VQ7 I;  2H1K A;  3H3V K;  1BBY A;  2B7E A;  5JVG F;  1T39 A;  5J40 A;  4F3Q A;  4FTH A;  2GM4 A;  1S3J A;  4HV5 A;  4U0Y A;  1BC7 C;  2HFH A;  2K86 A;  1O7L A;  2EZK A;  1RIO H;  2XKO A;  3KP2 A;  1MBE A;  3HZJ A;  3D1N I;  4WX9 A;  4BDY A;  2FNP A;  4RB2 C;  5F0C A;  2KIU A;  1QRY A;  5DUI A;  4NQW B;  4I0A A;  1JUM A;  2MH2 A;  2ZNY A;  3MFK A;  2HKO A;  2E2H J;  3EQL F;  1T6S A;  1OKR A;  5KAI C;  2DU9 A;  4HST A;  3CZ6 A;  2Z3Y A;  4EGY A;  4IRG A;  2Q2E B;  2CS3 A;  2F48 A;  3H0D A;  4IHW A;  2PEX A;  2EPF A;  4P1W A;  2A5W A;  5L3D A;  2Y0M A;  3HSE A;  5J1Y A;  4X6A J;  3H3Z A;  5DCM A;  1YIT I;  3IH3 A;  2EIN H;  1DGR M;  2YR2 A;  1OCO H;  5JVT A;  4O6J A;  3VSL A;  3ZQQ A;  1FJL A;  4UUS B;  4D9J A;  4A3M J;  4BBS J;  1WPK A;  1D1A A;  2DDB A;  5B3S H;  4LOC A;  2DFE A;  3PNV A;  2TDX A;  3JRF A;  1SD7 A;  4WXD A;  1DUX C;  4RB0 A;  3TO6 A;  3OYB A;  3BQZ A;  1VQO I;  2DYR H;  2E1C A;  2X1C A;  3HOZ J;  5K7F A;  1WGX A;  1HLV A;  4BYY A;  3IWF A;  3QPL A;  2IXS A;  1MW7 A;  2JSP A;  4ZZD A;  3RTR A;  1REP C;  3LA2 A;  3F21 A;  2VBZ A;  2YX4 A;  2BOL A;  2MC3 A;  1AU7 A;  3GVA A;  2HZD A;  2OAZ A;  3W6J B;  5DM7 F;  3FM3 A;  3NQO A;  5KK1 A;  4JX6 A;  1U5T B;  3GZN B;  1ZRD A;  4BQN A;  1EJ9 A;  3OYG A;  4NC8 A;  3K4L A;  3CD6 I;  2UXX A;  2OU2 A;  3CTA A;  4F93 B;  2X6O A;  5E1X A;  2VKE A;  1N77 A;  4ASN A;  3ELK A;  2VXD A;  2XSJ C;  2HS5 A;  4AYB A;  3F8N A;  5D4R A;  1X19 A;  5C4J J;  3I4M J;  1P2F A;  3S2D J;  3C1D A;  2QYO A;  4CH7 A;  1B6A A;  3TQN A;  4HAM A;  2L7Z A;  2P5K A;  5AIP A;  2XAU A;  1BIB A;  2Q0O A;  2I8D A;  3K1M A;  5F04 A;  3DV8 A;  4B47 A;  2Y30 A;  3T0Y A;  3ZMV A;  1D0Z A;  5E1Z B;  3ASO H;  1D8J A;  5K7H A;  1F36 A;  3PQJ A;  2VPL A;  3PQK A;  1V5F A;  2BHZ A;  2XV4 S;  2CMP A;  2NOG A;  3LSR A;  2W4S A;  2KRH A;  3RIR A;  1TQP A;  3DEU A;  3S3O A;  4XKB A;  3WHB A;  4OIP F;  2FNA A;  2VUM J;  5CVJ A;  4BKX A;  3HTU A;  2FBH A;  2IGM A;  1EKE A;  1XDU A;  3DF8 A;  1JHF A;  3O2P E;  4GCV A;  1MMA A;  3RKX A;  2VN2 A;  4EM1 A;  2RQQ A;  4FQG A;  4XN0 A;  1SFE A;  5L3E A;  2HQR A;  2KT0 A;  5DDG A;  2RDP A;  2K5C A;  1S7O A;  3DEE A;  3HC7 A;  5EEH A;  2GAU A;  2FML A;  3R4K A;  3H35 A;  3ZXS A;  3I55 I;  5TJJ A;  2KFD A;  3DU5 A;  2P7C B;  2VI6 A;  4BQQ A;  2O0Y A;  4XLA A;  1LVA A;  3LQR A;  2RVC A;  3MZY A;  3RPU D;  3L00 A;  4CZC A;  2G9W A;  5JLW A;  4D1Q A;  1S7A A;  4LFU A;  1MH4 A;  2VC0 A;  3AFH A;  1BI3 A;  2GLO A;  1BI2 A;  3VPR A;  5HDN A;  2FE3 A;  1Z05 A;  4A3L J;  2W57 A;  3DTK A;  3LSJ A;  2LDU A;  5C3E J;  3V7C A;  4BE2 A;  2DA2 A;  3ZN0 A;  4NQW A;  2CWE A;  2NVX J;  3HPG A;  4PJN A;  1J7K A;  2G7H A;  1ACI A;  2IBD A;  2L4M A;  2XGX A;  1R71 A;  4D7N A;  2Y2Z A;  1R00 A;  3S2W A;  3VYS B;  3KZI C;  2L0K A;  3CCR I;  1VI0 A;  2F4O B;  3GTG J;  3IP4 B;  1DP7 P;  5B1B H;  2DFH A;  2DMP A;  1P4X A;  5HOD A;  3WU2 C;  1RET A;  5E18 F;  1DPR A;  2HYG D;  4MIM A;  2GWR A;  3BCB A;  5LHI A;  2QQA A;  3ECO A;  1T38 A;  2P4W A;  4NB5 A;  4BJ6 C;  4FCY A;  5C44 J;  4U0V A;  2R7V A;  3CCM I;  2DYS H;  1Z77 A;  1LB2 A;  1WJE A;  3TL4 X;  4B48 A;  2TCT A;  3J7A O;  2IT0 A;  1WKM A;  3OYE A;  5GTI C;  1FSH A;  1CF7 A;  1OCP A;  3Q9V A;  1JT0 A;  2V1N A;  1IDY A;  3W6K B;  1VFC A;  3K6G A;  3QAH A;  1I6X A;  2YUS A;  3MN2 A;  1QQI A;  1HBX G;  4CYC A;  3BPX A;  2IJL A;  3ASN H;  2AHQ A;  1U5T A;  3JW4 A;  1Z91 A;  2COM A;  4JK1 X;  3IL2 A;  2ZCW A;  3FXQ A;  3VDX A;  3TED A;  5LHH A;  1A31 A;  2OZU A;  3PNY A;  1GHC A;  1JTY A;  1BW6 A;  2M2E A;  2O7O A;  4JBA A;  1HXD A;  4R8H A;  1DPU A;  5K5Q A;  3K70 C;  2OPT A;  4AUX A;  3MCZ A;  1FOY A;  4GGG A;  3HSF A;  4J00 A;  1TW2 A;  2DT6 A;  1FEX A;  3M7G A;  1TTY A;  2GXB A;  2X1E A;  2Z16 A;  2NS8 A;  4KN4 X;  2NVT J;  4HQM A;  2NVU B;  1I3Q J;  2OBP A;  1XSX A;  1UMQ A;  1YIO A;  2V6C A;  5ED4 A;  4NUB A;  4IHS A;  3FXR A;  2KHM A;  3HOX J;  5LEJ A;  4ZYA A;  3K1P A;  2F6C A;  2RGV A;  1UHM A;  2MSY A;  2JSC A;  3S3M A;  1NK3 P;  4G8X A;  4BGD A;  3PM1 A;  2X1D A;  5K5O A;  1QA6 A;  2LMD A;  5KAF C;  1WI9 A;  2K3F A;  3GFM A;  3AG1 H;  4XSX F;  4L9J A;  3OYH A;  3BY6 A;  1HF0 A;  1KU7 A;  2VJJ A;  3PJR A;  2IA0 A;  2E19 A;  1HW2 A;  3FIS A;  4NNJ A;  1A36 A;  4XRM A;  3DPU A;  1B4A A;  3EYI A;  3CJT B;  1AOY A;  2DLL A;  3LST A;  5IP9 J;  2PJR B;  1VQN I;  4W1U A;  4A69 C;  3AG4 H;  4Y3O A;  5TRD A;  4A3B J;  3I54 A;  1QO0 D;  1UG2 A;  4M6X A;  3CCJ I;  3HOV J;  1OQY A;  3IWZ A;  1U78 A;  3RYP A;  1WJD A;  1IW7 F;  4ESF A;  2LVS A;  4QPO A;  1MMG A;  1X2M A;  4G7O F;  4CCK A;  2LFB A;  4IQ4 A;  1G3S A;  4KUM A;  2GA2 A;  1RUO A;  1HW1 A;  2X85 A;  4G7H F;  3DPL C;  5BNG A;  4EEF G;  2VBW A;  5GAG J;  1XD7 A;  2ME0 A;  2X0L A;  3E3V A;  3P9C A;  5H6Q A;  4CHU A;  2NVY J;  4CO8 A;  4Q47 A;  3KCC A;  3CDL A;  4S05 A;  2LK2 A;  2B0L A;  1X2N A;  3BZK A;  1BIA A;  2EV6 A;  4Y33 A;  2ISY A;  3I56 I;  3E5U A;  1YE9 A;  1W1W E;  4EJU A;  2VC1 A;  2DK8 A;  3VOD A;  3HOY J;  1HOM A;  2LRE A;  5K1Y A;  5LRR A;  4CXF A;  1ETY A;  2MLK A;  5KVR A;  1YIJ I;  2Y31 A;  3ZMU A;  2XF5 A;  1VTN C;  4E7I A;  3BPV A;  3W6V A;  2DCE A;  3ZRG A;  4UV8 A;  2XB0 X;  2DO7 A;  2A5Y B;  2LR8 A;  4NDL A;  3IV5 A;  4IHV A;  3IKT A;  2OQG A;  3FXJ A;  5BS6 A;  4I76 A;  2AO9 A;  4R79 A;  2BW3 B;  3AG2 H;  3QYE A;  4GRI A;  3SQN A;  2JA8 J;  4BY7 J;  4A3F J;  3EUH A;  2D1V A;  4L5E A;  4II2 A;  5F6F A;  2E2I J;  3C2B A;  2Y69 H;  1VQP I;  4A93 J;  3L1P A;  1IUY A;  3HXL A;  3KET A;  2A61 A;  1O4X A;  2OUM A;  1FTT A;  2M30 A;  1N25 A;  1RNL A;  4A3K J;  3RKW A;  2ESH A;  1S72 I;  3P9K A;  4UVC A;  3BR5 A;  1RC9 A;  2VKH A;  3F8B A;  5HVQ C;  2LTP A;  3O8G A;  3KIO A;  1YW8 A;  2M34 A;  3ZP5 A;  3CLQ A;  4PGG A;  3HTS B;  4CCJ A;  1JGG A;  2BXZ A;  3CF5 F;  1ZG1 A;  1ITY A;  3L2Q A;  1NTC A;  1SFO J;  2D5V A;  4CCO A;  2HYJ A;  5E1W A;  5LD2 C;  4IHY A;  1MJA A;  1J9I A;  4QWQ A;  1IXS B;  3MKL A;  1QHG A;  5HS7 A;  1E17 A;  2JQ7 A;  3M8E A;  3CC2 I;  4U7B A;  1LE8 A;  1IXC A;  4CIC A;  3SEZ A;  4CCL A;  3BG6 A;  1QZE A;  2DW4 A;  2VIX A;  5HLH A;  2GIV A;  5CPR B;  1K7A A;  1XC5 A;  2PG4 A;  3ZQC A;  2EB7 A;  3Q0U A;  3A01 A;  2O8K A;  4S04 A;  3CO7 C;  3NAU A;  3BTC A;  4XLF A;  4HZF A;  2L4A A;  1KZH A;  2EA4 A;  2IEK A;  2FRH A;  4A0Z A;  1PUF A;  2R0Q C;  2C6Y A;  1D0Y A;  1YS7 A;  2LKS A;  1YRN B;  3T1B A;  2KP6 A;  2M7A A;  3BLY A;  1WH5 A;  2BV6 A;  2CUF A;  4RM3 A;  1BM9 A;  1ZKG A;  2P6T A;  4XBF A;  4I01 A;  2KKO A;  3DTI A;  2DPD A;  2NVQ J;  1JXS A;  4EJW A;  4I98 B;  4LG0 A;  3AAF A;  1B1B A;  4DZP A;  5D5V B;  2K85 A;  4B3X A;  4R1H A;  1X58 A;  1R49 A;  2K7L A;  2CUE A;  5EG0 B;  1YG2 A;  4ZDP A;  4LIT A;  4OIQ F;  1R1T A;  4LK1 F;  4EJV A;  4A12 A;  3L2W A;  1B9N A;  4YRV A;  4XN3 A;  4OIR F;  4YIF A;  1BA5 A;  3OYK A;  5HLG A;  1VQ4 I;  1PUE E;  4DZJ A;  3I64 A;  3FWE A;  1R9T J;  3UKG A;  1XN7 A;  1IRX A;  3PFI A;  1Y39 A;  1W0U A;  4XRF A;  2BHY A;  2QSH X;  2E1M B;  4PJM A;  5IYB J;  4PSW A;  1F9N A;  1T33 A;  4U88 A;  4M9S A;  3WE2 A;  2BZT A;  5F0F A;  1IN4 A;  4EJO A;  4IRH A;  1S29 A;  2BXY A;  3I5U A;  4M9Z A;  3K10 A;  5DD4 A;  4HNT A;  2HI3 A;  1GVJ A;  3GLX A;  1S5L C;  3C3W A;  1ZH5 A;  4E4H A;  4BJ5 C;  3GTM J;  1X3U A;  1B72 A;  3M3Y J;  3HGG A;  1ZN2 A;  2A6E F;  2IGK A;  2VT2 A;  1ZLJ A;  3K2Z A;  4XL9 A;  4I2O A;  1XGM A;  4WXC A;  4WWC A;  2XRL A;  4CDG A;  3OV8 A;  2ELK A;  2ELJ A;  3EUH C;  1VQ5 I;  1UHS A;  3FMQ A;  3QYF A;  1FMV A;  5FLM J;  2D1H A;  1MNM C;  3CCY A;  5IPA A;  1ORK A;  5CQE A;  1JE8 A;  4E6K G;  3CQZ J;  4BE0 A;  4V2F A;  4MLO A;  3J81 K;  1LNW A;  5LRS A;  1J75 A;  3WTS C;  3ZMD A;  1BR2 A;  2HQN A;  2HEO A;  4IJA A;  1NG6 A;  4O5V A;  3H9J A;  3HBL A;  3BG5 A;  1UAA A;  1VQK I;  2LF8 A;  1JKQ C;  5D6F A;  3WG7 H;  1YYV A;  2J5P A;  1E3H A;  4S0H B;  2H6C A;  2VXZ A;  2EJR A;  1I27 A;  4IPA A;  3BR0 A;  3G73 A;  2OTJ I;  3HHG A;  4ANJ A;  2LH9 A;  3JCU C;  2R7D A;  1LPQ A;  1T0F A;  3IAM 2;  2DOD A;  4PZJ A;  1HQC A;  4DYR A;  5HNF A;  2JT1 A;  3CUQ A;  2MLG A;  3J81 Z;  1I5Z A;  3F8F A;  4Y17 A;  4OMY A;  3M1E A;  3FBI B;  1VQ9 I;  1TW3 A;  2CYY A;  1XB4 A;  5IOZ A;  5DS9 A;  1P92 A;  2DTR A;  2H27 A;  2Y0S N;  2XAQ A;  4A0X A;  3SZP A;  2PI0 A;  4HSR A;  5DEQ A;  3OYI A;  4MFE A;  1W36 C;  2YX7 A;  2QEX I;  2IA2 A;  3NWT A;  3L2V A;  2ZC2 A;  3VYT B;  3BR1 A;  1ZYR F;  4M3D A;  2JA5 J;  3V8L A;  1Z6R A;  1QPI A;  2M0C A;  2E5N A;  2M0M A;  4G12 A;  4C2M J;  1FPQ A;  5ICC A;  2M8G X;  3HGY A;  2G0E A;  4PCQ A;  2JZY A;  2Z1D A;  3JTH A;  2V4J C;  1GV5 A;  4BU2 A;  1W7P D;  3FXK A;  3T8R A;  2DA1 A;  4LB5 A;  2R7Q A;  3MD2 A;  5CYV A;  3GZ6 A;  3IKV A;  1TWH J;  1B9M A;  3E5X A;  3SZG A;  4II3 A;  4ENN A;  5BOX A;  2W24 A;  4RAY A;  2BE5 F;  3LA7 A;  3L09 A;  3ZQ7 A;  3B6A A;  3VSK A;  4RB1 A;  3R0A A;  4AWX B;  2ZXH A;  2WA0 A;  4AVP A;  2P0W A;  1HA8 A;  1ETO A;  4JYK A;  1B8I B;  3RKY A;  1IN5 A;  2ACJ A;  2MBF A;  2V26 A;  1F1Z A;  4NC6 A;  4CCN A;  1JKO C;  1RI7 A;  4JQF A;  1Z1D A;  1YRN A;  4N9H A;  1AKH B;  4HPQ A;  2R7Z J;  4E7L A;  1LUJ B;  2ID3 A;  1WJF A;  1IXR C;  1YJW I;  2M3A A;  1VQ8 I;  1SMY F;  2M7B A;  1UG0 A;  1OCZ H;  3ZMZ A;  4KN7 X;  4ZDL A;  5EG0 A;  5J8C A;  4J01 A;  4AU7 A;  2EA2 A;  2HZT A;  3H9Q A;  4IL6 C;  2ETH A;  3BTJ A;  5EEG A;  5JLX A;  3CC4 I;  1UEL B;  2R7F A;  5ILU A;  1V5E A;  2IPQ X;  1VZ0 A;  1QU3 A;  2HDC A;  4M6V A;  2WTE A;  1R58 A;  2BBY A;  1FBS A;  3CCS I;  2Q8K A;  1H9G A;  1K4T A;  3JSO A;  3BRO A;  5C4X J;  1ZRF A;  2BGC A;  1L3L A;  1E0E A;  2MG4 A;  5GPC A;  3WU1 B;  2G7U A;  4XKV A;  4B1R A;  3IUO A;  3SXY A;  3G4S I;  3R0J A;  1WSU A;  3V42 A;  1YO5 C;  2KIF A;  1W36 D;  1G4D A;  2HVQ A;  1ZHF A;  3F6V A;  2M8E A;  4TV7 A;  2DJN A;  4B4C A;  3S16 J;  2VT3 A;  2X9D A;  4AIJ A;  1EF4 A;  2CRG A;  3GF2 A;  1IV8 A;  1FYL A;  3AL0 C;  3CCL I;  2Z99 A;  3FZV A;  1O3S A;  1H89 C;  2XPW A;  2NS7 A;  2P7V B;  3KFW X;  2ZJQ F;  1DU6 A;  1XGS A;  3M8J A;  2VL8 A;  3LWF A;  3PSF A;  4CGZ A;  4HG2 A;  5D5X B;  2DFI A;  4EM2 A;  3D5L A;  2PN6 A;  1HW5 A;  2HDD A;  1BN5 A;  5M5X J;  5EDN A;  1YHQ I;  2R93 J;  3LL7 A;  5JHF A;  3J80 K;  2HOA A;  3CUQ C;  4BHC A;  1HDD C;  3A0B C;  4M73 A;  2HPI A;  4BHP A;  4B09 A;  3CJQ B;  3TP3 A;  2CUZ A;  4XSZ F;  2FJ1 A;  2M9H A;  3GWZ A;  5GPA A;  1J09 A;  4WXH A;  1FBQ A;  1EH7 A;  1WJB A;  1WJ5 A;  2DA6 A;  1FOX A;  1R5I D;  2DK5 A;  3HSR A;  1P7I A;  5GP9 A;  1RR8 C;  5E3O A;  2EV0 A;  3E6M A;  2QLZ A;  1ZRE A;  1X3Z B;  3A0H C;  1R4N B;  2M1B A;  3OIQ A;  1KU3 A;  5HLT A;  3J80 Z;  4LB6 B;  2XIG A;  1TZL A;  1EA3 A;  1WJA A;  4AVZ A;  5IOY A;  2LRD A;  3MAJ A;  1H0M A;  4UB6 C;  3H36 A;  2HPM A;  2ZJ2 A;  5E3N A;  2UWM A;  2P81 A;  2V1X A;  4RLQ A;  5F1J A;  1SAU A;  3OMY A;  4G7Z F;  4KIF A;  5K7Z A;  2CV0 A;  3I53 A;  2O8X A;  5CVI A;  2R5Z B;  2WC2 A;  5E79 C;  2AQE A;  1QBJ A;  1IF1 A;  1G3T A;  4QTR A;  1FNN A;  3ZCO A;  4OIO F;  1YJN I;  1G6N A;  3VEP A;  1R22 A;  1QZZ A;  4PJJ A;  2NRA C;  4ETS A;  2DAO A;  4DBQ A;  1POG A;  1TT5 B;  1MSE C;  4ZTF A;  3GTQ J;  3JRB A;  3W2W A;  1CQT A;  2Y9Z A;  2HDW A;  3OWT A;  1ZR2 A;  2K4J A;  3LSP A;  5EGO B;  3CJN A;  1S6L A;  2FBI A;  1SD6 A;  1RES A;  1T2K A;  2L5Q A;  3QU3 A;  4P9F A;  2EQR A;  3R6S A;  1Z67 A;  4M9X A;  4D5F A;  1T56 A;  2LC2 A;  4G6Q A;  4C3J J;  3KPH A;  1TC3 C;  1GXQ A;  1MGT A;  1AHD P;  3CES A;  3SYT A;  2H6B A;  5CVU A;  5TIS C;  3S17 J;  4LD5 A;  1K61 A;  1S7E A;  2IS6 A;  2L9R A;  3DKX A;  3ISP A;  2JA7 J;  2BEO A;  3SFI A;  2A07 F;  1ZQ3 P;  3IAS 2;  4M3F A;  3HOT A;  3L2C A;  2QBY B;  2VQL A;  2ZXW H;  4BBR J;  1IO2 A;  1PJR A;  4KDP A;  3RDI A;  3I0T A;  4DOZ A;  4IRI A;  1TNS A;  5IP7 J;  1IN8 A;  3K1N A;  1L0O C;  2LSO A;  3CMM A;  2EIL H;  3Q0V A;  3VFZ A;  5LHG A;  1DP3 A;  1BR4 A;  3VWB A;  2A6T A;  1Z0X A;  4YIR X;  2BVL A;  1YX3 A;  2CFX A;  2OF7 A;  4V2G A;  4B8X A;  2HNH A;  3E0J B;  5BPI A;  1DU0 A;  3A2K A;  1P6R A;  4KIC A;  4JOM A;  4BAY A;  4LLN A;  4CZZ A;  3G1O A;  2ZME B;  3LSG A;  5F1R A;  4I09 A;  4A3I J;  2RC4 A;  3DEW A;  3I4N J;  2Q2E A;  1OPC A;  3S3N A;  3TDU C;  3N97 A;  1KYZ A;  1TP4 A;  1XS9 A;  5FD5 A;  3F8M A;  1Y8Q B;  2IRF G;  2KJB A;  2KDZ A;  2A69 F;  3GTJ J;  2DT7 B;  4QSH A;  3DLL F;  3GCM A;  3P7N A;  5F08 A;  2EK5 A;  1K83 J;  3AG3 H;  4XON A;  1VQL I;  3DU6 A;  2FOK A;  1GV2 A;  3DKY A;  4E70 A;  1JTX A;  4UUS A;  2VE9 A;  4EV0 A;  2V1D A;  3I4P A;  4Z6Y A;  4HA8 A;  4WK8 F;  3QOD A;  4GXO A;  3GTK J;  2DT5 A;  1FLI A;  4PSX A;  1UHW A;  3WG9 A;  2WV1 A;  3FXO A;  3BCA A;  3DLA A;  3HRM A;  4L0Y B;  1E3P A;  4P55 A;  1V55 H;  4YG2 F;  1HKQ A;  2V9V A;  3KYD B;  4Q5S F;  3DKW A;  4I0B A;  1FBU A;  2YU3 A;  2PBI A;  3RYR A;  2WAQ N;  1D5Y A;  5FKN A;  2XRO A;  2FD5 A;  1D0X A;  1ETK A;  3BZC A;  3EET A;  2X51 A;  2CUJ A;  1IZ1 A;  2CJJ A;  4XK4 A;  1JKP C;  1TWA J;  2KDO A;  2KZG A;  3EUA A;  5IYD J;  4NC7 A;  1GXP A;  5CVV A;  1EV7 A;  3WGH A;  3TMO A;  1XMK A;  1OR7 A;  4LGW A;  4ZDO A;  4ITV A;  2EIK H;  2GZW A;  2BYV E;  2IP2 A;  2V6E A;  1VF9 A;  2HKX A;  3BJA A;  1QNT A;  2OC6 A;  3EYY A;  3MEX A;  2WV0 A;  4PJL A;  3P5J A;  5M5W J;  2E71 A;  3HKZ N;  2STT A;  2PX9 A;  3JRH A;  4A3C J;  2NNN A;  3OOU A;  4ZYE A;  4GDF A;  2FEZ A;  2CFO A;  3GW2 A;  5D6E A;  4B43 A;  1FP2 A;  4IOC F;  1A5J A;  1FSE A;  3RZO J;  1XSV A;  2LY9 A;  4XMY A;  3V8K A;  1LEA A;  2JWT A;  2XKP A;  3BQY A;  4DQ2 A;  5GTH C;  2L2O A;  3W2A A;  3E7L A;  4XKC A;  3PUF A;  4UB8 C;  2LBF B;  1IRZ A;  4A3D J;  4BQO A;  1KQ0 A;  3I9V 2;  4FE4 A;  4FX4 A;  1YTY A;  5J4V A;  3IRQ A;  5TGT A;  2XVC A;  2ZFW A;  4KYW A;  4FIS A;  4RGR A;  3MZ8 A;  4F52 A;  1F5T A;  3HPH A;  4Y13 A;  1FTZ A;  1ZG5 A;  4ZYH A;  2X6Y A;  1ULY A;  3HB9 A;  5CJ9 A;  3CCQ I;  5EGO A;  2ISZ A;  1VQ6 I;  4EAT A;  3ERE D;  4U87 A;  1K6O A;  2P8T A;  1R1V A;  3ONQ A;  3W3C A;  4XLH A;  1T08 B;  3LFU A;  4MGR A;  1Q1H A;  2E34 A;  3U9G A;  3ZOB A;  2L7K A;  4Z2Y A;  2YPR A;  3G71 I;  2W1O A;  4ZTJ A;  3CMY A;  3BJO A;  3QYB A;  3BJ6 A;  4PJ0 C;  1HDP A;  2NXN B;  3HUG B;  4UVA A;  3F8C A;  3V7R A;  3LSK A;  3IRR A;  1K6Y A;  1LFP A;  4L0Z B;  1IN6 A;  3FMR A;  2K9L A;  5CVR A;  1XTA A;  2X6W A;  3OR2 C;  3I58 A;  4LJZ F;  1IV6 A;  5EF6 A;  3K70 D;  1BI1 A;  2KJC A;  3GFJ A;  1QGP A;  3K4B A;  2A3S A;  3BDD A;  1UCR A;  3HJE A;  2EH3 A;  1I1G A;  2H09 A;  3H1C A;  4YEL A;  5E17 F;  4HOB A;  5LGU A;  5IT3 A;  3LSI A;  1ZAR A;  1I50 J;  3I71 A;  3WE3 A;  1YS6 A;  5FRO A;  4MTE A;  4OWR B;  4AIK A;  3QP5 A;  1O3Q A;  2PMH A;  4IF4 A;  3QPS A;  4MNU A;  4KIB A;  5H6R A;  5EZH A;  2IA1 A;  1MBF A;  1JJ8 C;  4HLX A;  1G3W A;  2QSF X;  1Y1W J;  3DQV C;  1ETX A;  2IS4 A;  2GXA A;  1HC8 A;  4BAC A;  1Z6T A;  4L18 B;  2ZBK A;  4I02 A;  1U5T C;  3TW7 A;  4IEJ A;  5JR3 A;  1Y0N A;  3I3L A;  3CF2 A;  1RZ4 A;  4I6Z A;  4F92 B;  4ESB A;  4RA2 A;  1WWX A;  3T5X A;  1ZG3 A;  3TGN A;  3ABU A;  1IC8 A;  2A6H F;  3KEY A;  2GXG A;  4QLC U;  1MBK A;  3OYL A;  1X3W B;  4UUV A;  1JHH A;  2ZNZ A;  2MD0 A;  1OR7 C;  3HG9 A;  5F0H A;  3ECH A;  3GME A;  2CGP A;  2CQN A;  5J1U A;  2XDV A;  4YFK F;  5D4S A;  4E7Z A;  3OSF A;  3PUB A;  1U8B A;  3VYR B;  2WB1 N;  3OYC A;  2MGQ A;  5KCM A;  5E3M A;  4IZZ A;  3KP7 A;  3ESW B;  2E5Z A;  4AC0 A;  4U7D A;  1OIS A;  1LDD A;  3GLL A;  1ON2 A;  1X1P A;  2M5W A;  4RM2 A;  1FYK A;  3RQ4 A;  1R23 A;  2AXT C;  3ZQL A;  2XF7 A;  3LAJ A;  3KP6 A;  1XGO A;  4XRS G;  9ANT A;  4KFC A;  3NRV A;  3MWM A;  2CQK A;  1LVK A;  3PIO F;  2E35 A;  3ZQI A;  1V3F A;  1Z21 A;  2NNY A;  4DBR A;  3F0C A;  2Y0S A;  3CP8 A;  1JGS A;  1I6H J;  4KT6 A;  2CV1 A;  2LKP A;  3TBI A;  3SJM A;  3MKZ A;  3K4N A;  1G59 A;  4G9Y A;  2P5L C;  5DCF A;  3CUO A;  2V79 A;  1PDN C;  1MIJ A;  2QKL B;  4HEA 2;  1FYM A;  1R1U A;  1MDM B;  2RNG A;  4F91 B;  3BOQ A;  1MNE A;  2DQL A;  1PP7 U;  2EFO A;  2MW8 A;  2VJI A;  3IH2 A;  4HQE A;  2XAF A;  3CP2 A;  3K4C A;  4IVN A;  2AQF A;  3OYN A;  2KIQ A;  2OJE D;  4HNU A;  1JJ6 C;  3FF5 A;  4EJT A;  5BMZ A;  2QUF A;  1K78 B;  4RMN A;  1H9T A;  2EV5 A;  2XAG A;  4JX4 A;  1FT9 A;  3JSP A;  1JKR C;  4H4K C;  5D8L B;  2KLO A;  4QIW N;  3ZMS A;  2F5E A;  3GFL A;  5AIQ A;  4C30 A;  3FXU A;  2RAE A;  1EH8 A;  2PJR A;  2XF6 A;  5AON A;  1OYI A;  1TNT A;  2QF7 A;  3OL3 A;  2IS2 A;  2ZFU A;  1ZAO A;  1WHU A;  1X1C A;  2JUC A;  5L3G A;  3OYJ A;  2E7X A;  3Q5F A;  4M74 A;  3OYA A;  1WCM J;  1GLN A;  5GAH J;  1TWC J;  2LG4 A;  3VYU B;  1ZTR A;  3RI4 A;  1I1S A;  3WTW C;  3M07 A;  3OS2 A;  2B9S A;  2W85 A;  2HU9 A;  2M45 A;  3CLO A;  3HUG A;  3K2A A;  2B63 J;  3TW6 A;  2JRM A;  2F4I A;  1RR7 A;  3NEU A;  1LEB A;  4YEJ A;  2M4G A;  2QQB A;  1WJC A;  2ME6 A;  2E60 A;  3H5R A;  5KNL A;  4XID A;  1ZGJ A;  2JVG A;  5FLX K;  5EEA A;  5FD6 A;  1X4O A;  5DCM B;  3BZ6 A;  5HS9 A;  3X2Q H;  4XLP F;  3OL4 A;  3GO5 A;  2XC7 A;  3LNQ A;  2O6G E;  4IKF A;  4BUP A;  1HKT A;  2F2E A;  4JX5 A;  5GAD J;  1PYV A;  2K9M A;  2Y75 A;  3BR3 A;  5E3L A;  3WOD F;  1PVE A;  3KLO A;  2W84 A;  3G1L A;  3KP3 A;  1TWG J;  2XAJ A;  3ABM H;  3O3K A;  4KIS A;  5HDG A;  4KIG A;  2QWW A;  1IAW A;  3OS0 A;  2UXN A;  5FLX Z;  1I3A A;  3JRC A;  1S9H A;  4P96 A;  2BW3 A;  4A5N A;  2KL4 A;  4M3G A;  4BHB A;  4XOP A;  2XGC A;  4ZC3 A;  2XB5 A;  3OIO A;  2JPC A;  2ZJP F;  3PL8 A;  1USS A;  3J7A Y;  3G1M A;  3S15 J;  4HDU A;  2F5D A;  3OYD A;  4D0P A;  2ZSI B;  1U3E M;  3GXO A;  2LP0 A;  1KYW A;  3FMS A;  1Y6I A;  4EMS A;  2BY1 A;  1SEU A;  5FJ8 J;  3GX4 X;  1XCB A;  4L9T A;  4Q4Z F;  4M6Y A;  5FGM A;  2FA5 A;  3BR6 A;  4DYQ A;  5FB2 A;  1FIP A;  1ETV A;  2OA4 A;  3I59 B;  4X1E A;  5M5Y J;  2K27 A;  5J6X A;  4H0E A;  1Z3X A;  3CC7 I;  2OV7 A;  4DGW B;  3E6D A;  2DDA A;  5HDK A;  2GBY A;  1SD4 A;  3BG9 A;  2TRT A;  1W0T A;  2W48 A;  4HBL A;  3LQQ A;  3U1D A;  1GUU A;  5LBQ A;  2UV1 A;  4KMF A;  1J2X A;  2R5Y B;  2QKM B;  1P7J A;  2RQP A;  3U21 A;  4XR6 A;  4BL0 B;  1ON1 A;  3K4J A;  4MTD A;  3FIW A;  3RPU A;  2XGD A;  1LFB A;  1YX5 A;  2F5C A;  3DFG A;  4YII A;  4CSW A;  4KA4 A;  4PGH A;  2MFZ A;  2N8G A;  3S8P A;  1W5T A;  2FQ3 A;  2LYC A;  1O57 A;  3WTV C;  3GTO J;  2KRF A;  2JA6 J;  3E97 A;  4EQQ A;  4OIN F;  3QOE A;  1RKT A;  1W4M A;  1K4S A;  2WAD A;  1A6I A;  3F23 A;  1MDM A;  3HM5 A;  4A2U A;  2YU9 J;  2V7F A;  1AWC A;  2EWN A;  1XG1 A;  4I7H A;  3RQI A;  4F55 A;  2E7W A;  2CW8 A;  4K2E A;  4OMZ A;  1VQM I;  2L02 A;  2EIJ H;  3QPT A;  4CCM A;  3MMY B;  1N75 A;  3ZQF A;  3T8T A;  4BS9 A;  3CO6 C;  2GIZ A;  1IGN A;  1MBJ A;  2ZXJ A;  3TOA A;  1BR1 A;  4ENM A;  4DYC A;  1K78 A;  2H8W A;  5IT9 K;  3G3Z A;  1OCC H;  1FY7 A;  3D0S A;  4E7H A;  5IY5 H;  1T95 A;  4X0G A;  5HLI A;  1MJB A;  2IVM A;  4IHX A;  2E1O A;  4P5O A;  2JUG A;  4MEY F;  2HXO A;  2IS1 A;  2LNB A;  3V7S A;  3KEO A;  1SFK A;  3RSN A;  3COA C;  1NHA A;  2K40 A;  4HX8 A;  4EGZ A;  1N78 A;  2JJ7 A;  2ZO4 A;  4UVB A;  4IXA A;  1OCR H;  1ONV A;  3FDY A;  5ICF A;  3HRT A;  3LMM A;  2ZXI A;  2BVM A;  2QQ9 A;  4L5J A;  3SFZ A;  5LLQ A;  4XRS A;  5IT9 Z;  2ECB A;  3CDI A;  4G94 A;  3CDH A;  2CG4 A;  2F5V A;  2X48 A;  2GA1 A;  4HF1 A;  4D7M A;  1FOK A;  2PMZ N;  5K5R A;  5EJC A;  5FKO A;  5LGN A;  2QA4 I;  3H9G A;  3S1Q J;  4G6D A;  4OAZ A;  3HIF A;  3K0L A;  1ERD A;  1QPM A;  3TO9 A;  3EUK L;  2QM3 A;  2XUB A;  2HVS A;  4PUS A;  3GBG A;  1EH6 A;  1OLT A;  2E36 A;  1BC8 C;  5FRN A;  1IRG A;  3ROU A;  3HL2 A;  1OCT C;  5ILS A;  1R6R A;  2DMN A;  3MKW B;  3MQ0 A;  2VJ4 A;  3E5Q A;  4N0B A;  2L7M P;  3GTL J;  5DUK A;  1T0F C;  5L3C A;  1V54 H;  2VKV A;  1GT0 C;  4C2T A;  1OJL A;  3ZN1 A;  4XKW A;  2WBM A;  1BJZ A;  2QVO A;  1JUS A;  1TL8 A;  4RAF A;  2RRE A;  2E2J J;  5EYR A;  4PFP A;  4DW6 A;  1F4K A;  2R7R A;  2QZ8 A;  5CLS A; 
#chains in the Genus database with same CATH homology
 1YW7 A;  3R60 A;  1WRJ A;  3H92 A;  1CF7 B;  3L7W A;  5ILV A;  2RKH A;  2WWY A;  4ZYG A;  2HOE A;  3IC7 A;  2O03 A;  4BNC A;  3B02 A;  1KU9 A;  4L9V A;  3SZT A;  3LFK A;  1LJ9 A;  3R61 A;  2FBK A;  1R7J A;  3REO A;  4M72 A;  3I59 A;  4FX0 A;  2JTV A;  4HF0 A;  1SMT A;  1KGS A;  1R5H A;  5LGT A;  4ZZL A;  2RV8 A;  1HSJ A;  5ICE A;  1J0R A;  4BH9 A;  3P9I A;  1TQI A;  1LDK B;  3WTX C;  2D45 A;  2NAZ A;  2DI3 A;  1TQM A;  2HTJ A;  3C18 A;  4BXU A;  2AS5 F;  3L9F A;  1LQ1 A;  1XDS A;  1TBX A;  2DBB A;  4DNC A;  2RNJ A;  3TDZ C;  4HDV A;  3SHF A;  2Z5U A;  4P9U A;  1YQA A;  3DPT A;  5FFX A;  4KT5 C;  3WTU C;  2J5O A;  3B73 A;  3FM5 A;  4L9N A;  1MKM A;  1MD0 A;  3GFI A;  4AD9 A;  4XLN F;  2A68 F;  2O3F A;  2XHK A;  3WTZ A;  1G3Y A;  2CSO A;  1IN7 A;  1ZGA A;  1Y0U A;  1O7F A;  3MZH A;  4EVI A;  1STZ A;  3K9T A;  3GEZ A;  1T98 A;  4Q48 A;  1KA8 A;  1RUN A;  5FFZ A;  3Q9S A;  4HYE A;  4A6E A;  5HOO A;  4HW0 A;  3WTT C;  4LK0 F;  3DP7 A;  2HWV A;  2M87 A;  2PJP A;  1W7P B;  1D8K A;  2VBX A;  2QEN A;  2MD5 A;  3QU6 A;  4HV6 A;  4HLY A;  4ESJ A;  3GUD A;  4HX4 A;  2VOD A;  3WTY C;  2VBY A;  1S8N A;  1LDJ A;  1J59 A;  1FX7 A;  1D3Y A;  1BOA A;  2AXL A;  4LMY A;  2OD5 A;  3E6C C;  1OYW A;  2ELH A;  4NHJ A;  4KNY A;  2EFP A;  3F6O A;  3DXJ F;  2Y48 A;  1KQ9 A;  2GQQ A;  3V8J A;  4MEX F;  3OOP A;  2ADU A;  4WF2 A;  3VB2 A;  1HKS A;  2STW A;  5JHU A;  1QZY A;  4O3M A;  2IW5 A;  1R5G A;  2PQ8 A;  3ZMT A;  5ERI A;  1TLH B;  4A6D A;  2V1U A;  4HF2 A;  4AIH A;  3ULQ B;  1PP8 F;  1B59 A;  4L5I A;  2YSR A;  3F22 A;  4FHT A;  4WCG A;  4LG0 B;  5LEK A;  5A2Q K;  3O6B B;  2CW0 F;  2DQR A;  3HRU A;  2PFB A;  3M9A A;  3IHU A;  4FT8 A;  1Z9C A;  2QBY A;  3FX3 A;  1Z7U A;  3TO7 A;  4CYD A;  2RN7 A;  1HST A;  5E20 A;  3BP8 A;  1C0W A;  4UV9 A;  1XGN A;  4UNO A;  3FHZ A;  2FSW A;  2CO5 A;  2XAS A;  5A2Q Z;  1SD5 A;  1KQ8 A;  4RGX A;  2OQR A;  3N4M A;  2JPB A;  2ZME A;  2MA3 A;  5E8G A;  2E1N A;  1R36 A;  4N9I A;  3KZZ A;  4GYG A;  2O61 A;  2OZ6 A;  5F64 A;  1YW9 A;  2FU4 A;  5D8K B;  3ABT A;  1DDN A;  2K02 A;  1FP1 D;  4MQV A;  1YLF A;  4Y15 A;  2H94 A;  2MH9 A;  3QP6 A;  4ON0 A;  2UZK A;  4RGU A;  1O3T A;  2F5F A;  1SFU A;  3GYH X;  3KP4 A;  1W7P A;  2HGC A;  3V4G A;  4RS8 A;  3HHH A;  3H3U A;  3HRS A;  4A5M A;  3U2R A;  1J5Y A;  4EM0 B;  3KEQ A;  3CUQ B;  2EFQ A;  1XMA A;  1A04 A;  4PDK A;  2NS0 A;  1UFM A;  3KLN A;  1P4A A;  2ESN A;  1XSD A;  1K79 A;  4ENJ A;  3WGG A;  1ZLK A;  2P5V A;  5BQT A;  2HR3 A;  1CGP A;  3HYI A;  1OYY A;  2FMY A;  3VOE A;  3KE2 A;  2L54 A;  1OMI A;  1D5V A;  4IHT A;  3ML6 A;  2HYF A;  5BPD A;  1BI0 A;  1ODD A;  1FC3 A;  4LLL A;  3RJP A;  3LAP A;  1ZRC A;  4M71 A;  5JFR A;  2X4H A;  5D5W B;  2L3D A;  2VON A;  1KU2 A;  3HOS A;  2EFN A;  1U6G A;  2VE8 A;  1U2W A;  2Z9O A;  5D5U B;  4MQ9 F;  1FWZ A;  2K4B A;  5H20 A;  4MHG A;  4GO1 A;  2R3S A;  3F72 A;  2FXA A;  3WGI A;  4GYI A;  5J8F A;  2JRT A;  2VOO A;  1O3R A;  4ZYD A;  3WU0 A;  3QOP A;  5L3F A;  4RB3 C;  3JAM K;  4KMU X;  3ZPL A;  3E6B A;  4UXN A;  3KP5 A;  1IRF A;  2LF7 A;  1MJ9 A;  4LLG F;  2FF4 A;  4F7Z A;  3M8F A;  4RAZ A;  3KZY A;  1UST A;  2ZKZ A;  2L01 A;  1XCV A;  4RGS A;  1YFH A;  2VOP A;  3BWG A;  6PAX A;  5E8I A;  3JAM Z;  1E2X A;  3GZ5 A;  2DPU A;  4OU0 A;  1WQ2 A;  2KIM A;  4YFN F;  2PLY A;  2XRN A;  3TKY A;  5L3B A;  3QPH A;  2D2W A;  5ICG A;  4ZH4 F;  4HX7 A;  5JI6 A;  5HS8 A;  2Z33 A;  1BJA A;  4OOI A;  2W25 A;  5DYM A;  2NYX A;  1FZP B;  1V4R A;  3QRF F;  1UB9 A;  1SAX A;  1MZB A;  4A0Y A;  4UHT A;  2EFW A;  5DV5 A;  3TOB A;  2HTS A;  1P4W A;  2XAH A;  3EDP A;  4ENK A;  2PMU A;  3K69 A;  4BQA A;  1W5S A;  3C7J A;  2P6S A;  5FO5 A;  3RPQ A;  4YFX F;  3JTG A;  3LA3 A;  1U8R A;  1SFX A;  4U0W A;  5DD8 A;  3F3X A;  1BBY A;  1T39 A;  1S3J A;  4HV5 A;  4U0Y A;  1BC7 C;  2HFH A;  2K86 A;  1O7L A;  1RIO H;  2XKO A;  3KP2 A;  4WX9 A;  2FNP A;  4RB2 C;  2KIU A;  5DUI A;  4I0A A;  2MH2 A;  2ZNY A;  3MFK A;  2HKO A;  3EQL F;  1T6S A;  1OKR A;  2DU9 A;  2Z3Y A;  4EGY A;  4IRG A;  2PEX A;  5L3D A;  2Y0M A;  3HSE A;  3H3Z A;  5DCM A;  2YR2 A;  5JVT A;  4O6J A;  2TDX A;  1SD7 A;  4WXD A;  1DUX C;  4RB0 A;  3TO6 A;  2E1C A;  4BYY A;  3IWF A;  4ZZD A;  3RTR A;  1REP C;  3LA2 A;  3F21 A;  2VBZ A;  2YX4 A;  2MC3 A;  3GVA A;  2OAZ A;  3W6J B;  3FM3 A;  3NQO A;  5KK1 A;  1U5T B;  1ZRD A;  2UXX A;  2OU2 A;  3CTA A;  5E1X A;  4ASN A;  3ELK A;  2HS5 A;  3F8N A;  5D4R A;  1P2F A;  3C1D A;  2QYO A;  1B6A A;  3TQN A;  4HAM A;  2P5K A;  5AIP A;  1BIB A;  2Q0O A;  3K1M A;  3DV8 A;  3ZMV A;  3T0Y A;  5E1Z B;  1D8J A;  3PQJ A;  3PQK A;  2XV4 S;  3RIR A;  1TQP A;  3DEU A;  4OIP F;  2FNA A;  5CVJ A;  3HTU A;  2FBH A;  1XDU A;  3DF8 A;  1JHF A;  3O2P E;  4GCV A;  3RKX A;  2VN2 A;  4EM1 A;  1SFE A;  5L3E A;  2HQR A;  5DDG A;  2RDP A;  1S7O A;  5EEH A;  2GAU A;  2FML A;  3R4K A;  5TJJ A;  2P7C B;  2O0Y A;  1LVA A;  3LQR A;  2RVC A;  3MZY A;  3L00 A;  2G9W A;  1S7A A;  4LFU A;  2VC0 A;  1BI3 A;  1BI2 A;  5HDN A;  2FE3 A;  1Z05 A;  2W57 A;  2LDU A;  3V7C A;  3ZN0 A;  4NQW A;  2CWE A;  1J7K A;  2G7H A;  2L4M A;  2XGX A;  1R00 A;  3S2W A;  1DP7 P;  1P4X A;  5E18 F;  1DPR A;  2HYG D;  2GWR A;  5LHI A;  2QQA A;  3ECO A;  1T38 A;  2P4W A;  4NB5 A;  4U0V A;  1LB2 A;  3J7A O;  2IT0 A;  1WKM A;  1FSH A;  1CF7 A;  3Q9V A;  3W6K B;  3QAH A;  1I6X A;  1QQI A;  1HBX G;  3BPX A;  2IJL A;  3JW4 A;  1U5T A;  1Z91 A;  2COM A;  4JK1 X;  3IL2 A;  2ZCW A;  3FXQ A;  5LHH A;  2OZU A;  1GHC A;  4JBA A;  1HXD A;  4R8H A;  1DPU A;  5K5Q A;  3MCZ A;  4GGG A;  3HSF A;  1TW2 A;  3M7G A;  1TTY A;  2GXB A;  4KN4 X;  4HQM A;  2OBP A;  1XSX A;  2V6C A;  1YIO A;  5ED4 A;  4IHS A;  3FXR A;  5LEJ A;  3K1P A;  2RGV A;  1UHM A;  2JSC A;  4G8X A;  5K5O A;  1WI9 A;  3GFM A;  4XSX F;  4L9J A;  3BY6 A;  1KU7 A;  2IA0 A;  1HW2 A;  1B4A A;  3EYI A;  1AOY A;  2DLL A;  3LST A;  5TRD A;  3I54 A;  1QO0 D;  4M6X A;  3IWZ A;  1U78 A;  3RYP A;  1IW7 F;  4ESF A;  4G7O F;  1G3S A;  4KUM A;  2GA2 A;  1RUO A;  1HW1 A;  4G7H F;  3DPL C;  2VBW A;  1XD7 A;  2X0L A;  3E3V A;  3P9C A;  5H6Q A;  4CHU A;  4CO8 A;  4Q47 A;  3KCC A;  4S05 A;  2B0L A;  1BIA A;  2EV6 A;  2ISY A;  3E5U A;  4EJU A;  2VC1 A;  2DK8 A;  3VOD A;  5K1Y A;  5LRR A;  4CXF A;  2MLK A;  5KVR A;  3ZMU A;  1VTN C;  3BPV A;  4UV8 A;  2DO7 A;  2A5Y B;  3IKT A;  2OQG A;  5BS6 A;  4R79 A;  3SQN A;  3EUH A;  2D1V A;  5F6F A;  1IUY A;  3KET A;  2A61 A;  2M30 A;  1RNL A;  3RKW A;  2ESH A;  3P9K A;  4UVC A;  3F8B A;  5HVQ C;  1YW8 A;  3ZP5 A;  4PGG A;  3HTS B;  1ZG1 A;  5E1W A;  1MJA A;  1J9I A;  4QWQ A;  1IXS B;  5HS7 A;  1E17 A;  3M8E A;  4U7B A;  1IXC A;  4CIC A;  2DW4 A;  5HLH A;  2GIV A;  1K7A A;  2PG4 A;  2EB7 A;  4S04 A;  3CO7 C;  4HZF A;  2L4A A;  2EA4 A;  2FRH A;  4A0Z A;  2C6Y A;  1YS7 A;  3T1B A;  2BV6 A;  1BM9 A;  2P6T A;  4XBF A;  4I01 A;  2KKO A;  2DPD A;  1JXS A;  4EJW A;  4I98 B;  4LG0 A;  3AAF A;  1B1B A;  5D5V B;  4R1H A;  2K7L A;  1YG2 A;  4OIQ F;  1R1T A;  4LK1 F;  4EJV A;  4A12 A;  1B9N A;  4OIR F;  4YIF A;  5HLG A;  1PUE E;  3I64 A;  3FWE A;  1XN7 A;  3PFI A;  4XRF A;  1F9N A;  4U88 A;  4M9S A;  3WE2 A;  1IN4 A;  4EJO A;  4IRH A;  1S29 A;  3I5U A;  4M9Z A;  5DD4 A;  1GVJ A;  3GLX A;  3C3W A;  1ZH5 A;  1X3U A;  1ZN2 A;  2A6E F;  2VT2 A;  1ZLJ A;  3K2Z A;  4I2O A;  1XGM A;  4WXC A;  4WWC A;  4CDG A;  3OV8 A;  3FMQ A;  2D1H A;  1JE8 A;  3J81 K;  1LNW A;  5LRS A;  1J75 A;  3WTS C;  3ZMD A;  2HQN A;  2HEO A;  4IJA A;  4O5V A;  2LF8 A;  5D6F A;  1YYV A;  2J5P A;  2H6C A;  2VXZ A;  2EJR A;  1I27 A;  4IPA A;  3G73 A;  3HHG A;  2R7D A;  1T0F A;  4PZJ A;  1HQC A;  2JT1 A;  3CUQ A;  2MLG A;  3J81 Z;  1I5Z A;  3F8F A;  4Y17 A;  4OMY A;  3M1E A;  1TW3 A;  2CYY A;  1XB4 A;  1P92 A;  2DTR A;  2H27 A;  2XAQ A;  4A0X A;  3SZP A;  2PI0 A;  5DEQ A;  2YX7 A;  2IA2 A;  1ZYR F;  3V8L A;  1Z6R A;  1FPQ A;  5ICC A;  4PCQ A;  2JZY A;  3JTH A;  1W7P D;  3T8R A;  4LB5 A;  5CYV A;  3GZ6 A;  3IKV A;  1B9M A;  3E5X A;  4ENN A;  5BOX A;  2W24 A;  4RAY A;  2BE5 F;  3LA7 A;  3L09 A;  3ZQ7 A;  4RB1 A;  3R0A A;  4AWX B;  4AVP A;  3RKY A;  1IN5 A;  2ACJ A;  2MBF A;  1F1Z A;  1RI7 A;  4JQF A;  1Z1D A;  4N9H A;  1IXR C;  1SMY F;  3ZMZ A;  4KN7 X;  5J8C A;  2EA2 A;  2HZT A;  5EEG A;  2ETH A;  2R7F A;  5ILU A;  2IPQ X;  2HDC A;  2WTE A;  1R58 A;  2BBY A;  1FBS A;  2Q8K A;  1H9G A;  3JSO A;  3BRO A;  1ZRF A;  2BGC A;  1L3L A;  3WU1 B;  2G7U A;  3SXY A;  1WSU A;  3R0J A;  1G4D A;  1YO5 C;  2KIF A;  1ZHF A;  3F6V A;  2M8E A;  4TV7 A;  2VT3 A;  4AIJ A;  3GF2 A;  1FYL A;  2Z99 A;  3FZV A;  1O3S A;  2P7V B;  3KFW X;  1XGS A;  3LWF A;  4CGZ A;  5D5X B;  2DFI A;  4EM2 A;  3D5L A;  2PN6 A;  1HW5 A;  1BN5 A;  3J80 K;  3CUQ C;  4BHC A;  4M73 A;  4BHP A;  4B09 A;  4XSZ F;  3GWZ A;  4WXH A;  1FBQ A;  1EH7 A;  2DK5 A;  3HSR A;  2EV0 A;  3E6M A;  2QLZ A;  1ZRE A;  2M1B A;  1KU3 A;  3J80 Z;  4LB6 B;  2XIG A;  3MAJ A;  1H0M A;  2ZJ2 A;  2UWM A;  2V1X A;  4G7Z F;  4KIF A;  3I53 A;  2O8X A;  5CVI A;  2WC2 A;  1QBJ A;  1IF1 A;  1G3T A;  1FNN A;  4OIO F;  1G6N A;  3VEP A;  1R22 A;  1QZZ A;  2NRA C;  4ETS A;  2DAO A;  2K4J A;  3CJN A;  1S6L A;  2FBI A;  1SD6 A;  1T2K A;  3QU3 A;  4P9F A;  3R6S A;  4M9X A;  4G6Q A;  1GXQ A;  1MGT A;  2H6B A;  5CVU A;  4LD5 A;  3ISP A;  2BEO A;  2A07 F;  3HOT A;  3L2C A;  2QBY B;  4KDP A;  3RDI A;  3I0T A;  4IRI A;  1TNS A;  1IN8 A;  3K1N A;  1L0O C;  2LSO A;  3VFZ A;  5LHG A;  5BPI A;  2CFX A;  4B8X A;  1P6R A;  4KIC A;  4BAY A;  4LLN A;  4CZZ A;  2ZME B;  5F1R A;  4I09 A;  2RC4 A;  2Q2E A;  1OPC A;  3TDU C;  3N97 A;  1KYZ A;  5FD5 A;  3F8M A;  2IRF G;  2KJB A;  2A69 F;  3P7N A;  2EK5 A;  2FOK A;  4E70 A;  2VE9 A;  4EV0 A;  2V1D A;  3I4P A;  1FLI A;  4HA8 A;  4WK8 F;  4GXO A;  2DT5 A;  1UHW A;  3WG9 A;  3HRM A;  4L0Y B;  4P55 A;  4YG2 F;  1HKQ A;  2V9V A;  4Q5S F;  3DKW A;  4I0B A;  1FBU A;  2YU3 A;  2PBI A;  3RYR A;  2XRO A;  3EET A;  1IZ1 A;  1GXP A;  5CVV A;  1EV7 A;  3WGH A;  1XMK A;  1OR7 A;  4LGW A;  2GZW A;  2BYV E;  2IP2 A;  2HKX A;  3BJA A;  1QNT A;  3EYY A;  3MEX A;  2WV0 A;  2STT A;  2NNN A;  4ZYE A;  2FEZ A;  3GW2 A;  5D6E A;  1FP2 A;  1FSE A;  1XSV A;  3V8K A;  1LEA A;  2XKP A;  4DQ2 A;  1KQ0 A;  4FX4 A;  1YTY A;  3IRQ A;  2XVC A;  2ZFW A;  4KYW A;  4RGR A;  1F5T A;  4Y13 A;  1ZG5 A;  4ZYH A;  1ULY A;  5CJ9 A;  2ISZ A;  3ERE D;  1K6O A;  2P8T A;  1R1V A;  4MGR A;  3U9G A;  1Q1H A;  4Z2Y A;  2YPR A;  3BJO A;  3BJ6 A;  4UVA A;  3F8C A;  3V7R A;  3IRR A;  4L0Z B;  1IN6 A;  3FMR A;  5CVR A;  4LJZ F;  3I58 A;  1BI1 A;  2KJC A;  3GFJ A;  1QGP A;  2A3S A;  3BDD A;  1UCR A;  1I1G A;  2H09 A;  5E17 F;  4HOB A;  5LGU A;  5IT3 A;  1ZAR A;  3I71 A;  3WE3 A;  1YS6 A;  4MTE A;  4AIK A;  3QP5 A;  1O3Q A;  2PMH A;  4IF4 A;  4MNU A;  4KIB A;  5H6R A;  2IA1 A;  4HLX A;  1G3W A;  3DQV C;  1Z6T A;  4L18 B;  2ZBK A;  4I02 A;  1U5T C;  5JR3 A;  1RZ4 A;  4ESB A;  3TGN A;  1WWX A;  3T5X A;  1ZG3 A;  3ABU A;  2A6H F;  2GXG A;  4QLC U;  4UUV A;  1JHH A;  2ZNZ A;  3ECH A;  2CGP A;  4YFK F;  5D4S A;  3KP7 A;  4U7D A;  1LDD A;  1ON2 A;  2M5W A;  1FYK A;  1R23 A;  3LAJ A;  3KP6 A;  1XGO A;  4KFC A;  3NRV A;  3MWM A;  2CQK A;  1V3F A;  2NNY A;  1JGS A;  2LKP A;  4G9Y A;  2P5L C;  5DCF A;  3CUO A;  2V79 A;  1PDN C;  1FYM A;  1R1U A;  1MDM B;  3BOQ A;  2DQL A;  1PP7 U;  2EFO A;  4HQE A;  2XAF A;  4IVN A;  4EJT A;  3FF5 A;  5BMZ A;  2QUF A;  1K78 B;  1H9T A;  2EV5 A;  2XAG A;  1FT9 A;  3JSP A;  5D8L B;  3ZMS A;  2F5E A;  3GFL A;  5AIQ A;  3FXU A;  1EH8 A;  5AON A;  1OYI A;  1TNT A;  1ZAO A;  5L3G A;  3Q5F A;  2E7X A;  4M74 A;  3RI4 A;  1I1S A;  3WTW C;  2W85 A;  2M45 A;  3CLO A;  3HUG A;  3NEU A;  1LEB A;  2QQB A;  1ZGJ A;  5FLX K;  5FD6 A;  5DCM B;  3BZ6 A;  5HS9 A;  4XLP F;  3GO5 A;  2O6G E;  1HKT A;  2F2E A;  2Y75 A;  3WOD F;  3KLO A;  2W84 A;  3KP3 A;  2XAJ A;  3O3K A;  5HDG A;  4KIG A;  2QWW A;  1IAW A;  2UXN A;  5FLX Z;  4P96 A;  4A5N A;  4BHB A;  2JPC A;  1USS A;  4HDU A;  2F5D A;  4D0P A;  1U3E M;  3GXO A;  1KYW A;  3FMS A;  4EMS A;  3GX4 X;  4L9T A;  1XCB A;  4Q4Z F;  4M6Y A;  5FGM A;  2FA5 A;  5FB2 A;  3I59 B;  2OA4 A;  2K27 A;  5J6X A;  4H0E A;  3E6D A;  5HDK A;  1SD4 A;  4HBL A;  3LQQ A;  3U1D A;  5LBQ A;  4KMF A;  1J2X A;  2RQP A;  1ON1 A;  4MTD A;  3RPU A;  2F5C A;  3DFG A;  4YII A;  4KA4 A;  4PGH A;  1W5T A;  2FQ3 A;  1O57 A;  3WTV C;  2KRF A;  3E97 A;  4EQQ A;  4OIN F;  1W4M A;  3F23 A;  1MDM A;  4A2U A;  1AWC A;  2EWN A;  4I7H A;  2E7W A;  4K2E A;  4OMZ A;  2L02 A;  3QPT A;  3T8T A;  3CO6 C;  2ZXJ A;  3TOA A;  4ENM A;  5IT9 K;  1K78 A;  3G3Z A;  1FY7 A;  3D0S A;  5HLI A;  1MJB A;  2IVM A;  4P5O A;  4MEY F;  2LNB A;  3V7S A;  3KEO A;  3COA C;  1NHA A;  4HX8 A;  4EGZ A;  2ZO4 A;  4UVB A;  4IXA A;  1ONV A;  5ICF A;  3HRT A;  3SFZ A;  2QQ9 A;  4L5J A;  5LLQ A;  5IT9 Z;  4G94 A;  3CDH A;  2CG4 A;  4HF1 A;  2GA1 A;  1FOK A;  5K5R A;  5LGN A;  4G6D A;  3HIF A;  3K0L A;  1QPM A;  3TO9 A;  2QM3 A;  2XUB A;  1EH6 A;  1IRG A;  1BC8 C;  3ROU A;  5ILS A;  3MQ0 A;  4N0B A;  3E5Q A;  5DUK A;  5L3C A;  3ZN1 A;  2QVO A;  1F4K A;  2QZ8 A;  5CLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...