1S7AA

Nmr structure of the la motif of human la protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lupus La protein
publication title Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, translation
total genus 18
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s7aA00
2IP2A 2PEXA 2JPBA 1ZN2A 5LLQA 1WRJA 1YQAA 2CG4A 1XSXA 5DDGA 2XUBA 4MTEA 4BYYA 2FSWA 4CICA 3FXUA 1JE8A 1LVAA 4G8XA 2QQ9A 3I58A 2KIFA 1I27A 2ZO4A 2K4JA 5JVTA 1GVJA 3H3ZA 4BQAA 1XGOA 4M6YA 4MGRA 2HTSA 2R7FA 2VBYA 1XMAA 2L3DA 2CGPA 4KFCA 4A0XA 2Q8KA 2IA0A 3BJ6A 4WX9A 1W5TA 4EGZA 4UXNA 3IKVA 3BP8A 2PQ8A 3T5XA 3DFGA 4HX4A 3SQNA 1EH8A 1KA8A 3GLXA 3HTSB 5LGUA 3FHZA 1BBYA 1REPC 2EV0A 1XGSA 4HOBA 2E7XA 5H20A 1TQMA 2XROA 1X3UA 3HYIA 1MJAA 2UXNA 3WTUC 2FNPA 2W84A 3L00A 3V7RA 2O0YA 4RB0A 2LF8A 4D0PA 3AAFA 1FPQA 1K79A 3HUGA 3RTRA 3F23A 4UV8A 4HF0A 2ZMEA 2QUFA 4LMYA 1S7OA 4YFNF 2HOEA 3DKWA 1ODDA 1Q1HA 4MHGA 5D5UB 2FMLA 2R7DA 4G7HF 1HW5A 2YSRA 1WKMA 2ZNZA 2X4HA 2EFPA 1JXSA 2Y75A 4N9IA 4ENKA 4A6EA 1SD7A 4ENNA 4XSZF 2E1NA 5EEGA 2D1VA 3WE3A 4G9YA 3NRVA 4M6XA 3W6KB 4MEXF 1GHCA 3IHUA 2YU3A 4XLPF 4XSXF 3P7NA 1U2WA 4PCQA 3KFWX 4I02A 4ZYEA 2UZKA 3LA2A 1HKQA 2AS5F 1VTNC 2IPQX 2FQ3A 2LDUA 1HSJA 3TOAA 4MQ9F 1USTA 1D8JA 5CVVA 5D8KB 3WGIA 3IWFA 1O7LA 4Z2YA 3DV8A 1D3YA 2QM3A 3F8BA 3J80Z 4PZJA 3TO9A 3FMRA 3K69A 4RB2C 3ULQB 3V8KA 3SZTA 3JSPA 4N9HA 4LD5A 3U9GA 1YW7A 2M45A 2QENA 5H6RA 4A5NA 3DEUA 2HEOA 4EQQA 2K86A 1ULYA 4I7HA 5D5XB 2P6TA 4M9XA 2O61A 1OMIA 2W24A 1WQ2A 1J5YA 4FT8A 2FRHA 5HVQC 3KLNA 2ZNYA 4AIHA 2W57A 3I71A 1YW8A 2LF7A 4YFKF 2PLYA 4Q5SF 2BBYA 3DXJF 2NS0A 1IN6A 5LHHA 2A3SA 5IT3A 4G7ZF 3KETA 3P9IA 1R5GA 4H0EA 1USSA 2XIGA 4B8XA 4OOIA 4ASNA 3R0AA 5D5WB 1FP2A 1QBJA 2YPRA 5LEKA 2LNBA 2FOKA 2XAHA 3T1BA 2OZ6A 2EJRA 2QQBA 2RDPA 5HDGA 1XMKA 2CSOA 3E5XA 3MFKA 1TNSA 2BEOA 2HS5A 3E6MA 3ZMUA 2EV6A 2PMUA 4M9SA 5DCFA 1P4WA 3ML6A 4L0ZB 5HS8A 4G6DA 4RAZA 5TJJA 1R22A 1QGPA 2L02A 1K7AA 3KZZA 1RI7A 3GF2A 4RS8A 2P7VB 5E17F 5DCMB 5D8LB 3L09A 4IPAA 3TGNA 3IL2A 2JTVA 2PMHA 1CF7A 4R79A 4LK1F 2A5YB 1P2FA 3CO7C 1BI3A 4P5OA 1STZA 2F2EA 2ZFWA 1ZH5A 3C3WA 2KJCA 2H27A 1L0OC 4WK8F 3F22A 5KK1A 4L5IA 4M73A 5AONA 4EJWA 2FU4A 2K7LA 2VE8A 5E8GA 3JTGA 2QZ8A 4HF1A 3RKWA 5EEHA 3V7SA 2MH9A 2NRAC 4ZH4F 4K2EA 2KKOA 3J80K 1OR7A 2PFBA 1S7AA 5HDKA 2OU2A 4JK1X 2XASA 2L4MA 1B59A 2Y48A 5H6QA 3FMQA 4FHTA 3MQ0A 4MEYF 4AIKA 4I0AA 4EJOA 2EFOA 3COAC 4HX8A 2FXAA 2E7WA 4UHTA 4U0WA 2HR3A 2HDCA 4WF2A 3HSEA 2XAQA 1MZBA 3F8FA 4HW0A 1BJAA 5F64A 4PGGA 4EM1A 4I09A 2Y0MA 5K5QA 5E1WA 1RUNA 4U88A 1Z7UA 4LFUA 3KE2A 5FFXA 2STTA 3BPXA 3HRSA 4KT5C 1FT9A 2M30A 3H92A 1SFUA 2ZKZA 3BWGA 2X0LA 4AIJA 2KJBA 4BHCA 2IA1A 4OIOF 1U5TA 1I1GA 3WTZA 4LG0B 3V8LA 3PQKA 5HLIA 2IVMA 5LEJA 3WU1B 4GO1A 1TW3A 3IWZA 4AVPA 1C0WA 3QAHA 2O3FA 1LJ9A 1YS6A 4Y17A 2AXLA 1FY7A 1BC7C 3KP2A 1KQ0A 5L3FA 4HZFA 4QWQA 4BXUA 2VT3A 5DYMA 2PG4A 4HLXA 1T6SA 1ZYRF 2XAFA 3EUHA 2MH2A 4KUMA 1TTYA 1XSVA 2ZBKA 3DQVC 2HTJA 5BMZA 4YFXF 3HHHA 3K1NA 5FFZA 3RPQA 3LSTA 4GCVA 5J8FA 1KU3A 2KRFA 1H9TA 2H09A 2Q0OA 2RQPA 5CVRA 1KYWA 1FYKA 2DPDA 1I6XA 3FZVA 1KU2A 1KU7A 4XLNF 2DQLA 2YX7A 3T0YA 5JFRA 1FC3A 1TQPA 4JBAA 2P7CB 4AWXB 3JAMZ 4ZYHA 2DQRA 3WGGA 3B73A 3HHGA 4HQMA 3EYIA 5AIQA 4JQFA 1HQCA 1MJ9A 3ABTA 2JT1A 4CYDA 4WWCA 5LRSA 1JHHA 1KU9A 3HRTA 3N4MA 4CHUA 4UVBA 3F3XA 3TOBA 2FA5A 2HKOA 1KQ9A 1O3SA 2C6YA 1R7JA 3LA3A 1IN4A 4ENJA 3LQQA 1ZLKA 1QPMA 3ZMVA 1PP7U 4S04A 1DDNA 3SFZA 2G7HA 3GYHX 1AOYA 3BOQA 2B0LA 3ZN1A 4YIIA 4BAYA 1KQ8A 2WWYA 3QRFF 1O3RA 1P6RA 1IF1A 3FWEA 1ZRDA 3GEZA 2BV6A 3L7WA 4HAMA 5CYVA 4HLYA 3F6OA 1B6AA 1GXQA 3OV8A 2A68F 1XGNA 2Z33A 3U1DA 2V79A 2ZMEB 5ICFA 2IA2A 1ONVA 3O2PE 1I1SA 3G3ZA 1T38A 4L9VA 1ZG3A 1LDKB 4OIPF 4M72A 4E70A 1K78A 3FXRA 3B02A 1R1UA 6PAXA 1UHWA 5CVUA 1WSUA 1LQ1A 4GYGA 3E6DA 4S05A 3M9AA 4O5VA 4YG2F 1WI9A 3GZ5A 3DF8A 3LWFA 3RKXA 1Z9CA 1ON1A 3KP5A 1SD5A 3VFZA 1SMYF 2MLKA 2FF4A 4OIQF 5DD8A 1MDMA 3KP3A 3LA7A 2Z3YA 1XCBA 2RGVA 5LGNA 4TV7A 1EH7A 1D8KA 4ENMA 1IZ1A 3DPTA 1BM9A 4I01A 2QBYA 4GYIA 3HTUA 4IHSA 1S29A 5K1YA 3CUQC 2VONA 1J7KA 3NEUA 5AIPA 4O3MA 4A0ZA 5FD6A 1I5ZA 5A2QK 2D1HA 2W25A 2YX4A 2GXBA 4L9TA 2V1XA 3RDIA 4Y15A 2DFIA 2DTRA 2LSOA 5LHGA 2G7UA 2OA4A 3JAMK 2JZYA 1ZARA 4EJVA 2RNJA 1U5TC 2DI3A 5HOOA 1DPRA 3HRMA 4DNCA 3E97A 2XKOA 1TLHB 3R60A 3I53A 1F4KA 4IHTA 1LEBA 4ZYGA 3KEQA 3JTHA 3IC7A 2G9WA 1U8RA 3RYRA 1UB9A 2WV0A 3LQRA 3GZ6A 3ECOA 3M7GA 1OYYA 1UHMA 5LHIA 4GGGA 3DP7A 5DV5A 5CVJA 2MC3A 2J5OA 1YO5C 4KMFA 5IT9Z 3WU0A 3R0JA 4LB5A 2VBZA 4G6QA 4DQ2A 2IJLA 4IF4A 4OINF 1T39A 1BI2A 3FXQA 5HLGA 3GXOA 4UNOA 4EM0B 3L9FA 1IRGA 1RIOH 4KICA 3TO6A 5ICGA 1J59A 5ILSA 1R5HA 4IVNA 4RB3C 4EVIA 4KIFA 2FBIA 3DPLC 2ISYA 1G4DA 4RB1A 3GFIA 3LAJA 4HV6A 1CF7B 3BZ6A 2HWVA 3QOPA 2NNYA 1J9IA 5BPDA 3MAJA 1G3SA 4WXHA 4HA8A 2ZCWA 2OAZA 2DBBA 2J5PA 3GFMA 4HX7A 4BHBA 1YYVA 1V3FA 3TQNA 3E6CC 2GA2A 1W7PB 1HW2A 2CWEA 2FE3A 4AD9A 1ZGAA 2GQQA 2A6HF 1UCRA 4P96A 1XN7A 4UUVA 4CO8A 4OMZA 1YLFA 3O3KA 4EV0A 1Z91A 3BDDA 3MEXA 3GUDA 3WTVC 3I64A 1BIAA 1P92A 3I0TA 1WWXA 2VOOA 2QQAA 3P9CA 4KN4X 4UV9A 3J7AO 2P4WA 4RGUA 3L2CA 1O3TA 2P6SA 2W85A 2A61A 3Q9VA 5E1ZB 4CXFA 5DEQA 3I59B 3BJAA 2COMA 4KYWA 5DCMA 1LDDA 2D2WA 2VXZA 1TW2A 1IXCA 5DUIA 3R6SA 1R36A 2QLZA 3ZMDA 2IRFG 1QO0D 2DLLA 2YR2A 3EQLF 3J81Z 2FBHA 2GA1A 2QWWA 1HKSA 3D0SA 1A04A 2OZUA 5HS9A 4LB6B 2F5FA 2EB7A 1FSHA 1K6OA 2STWA 2H6BA 2BGCA 3RYPA 2O6GE 3VODA 4U0VA 3ZN0A 4EGYA 2OQRA 3G73A 3C18A 5IT9K 1TBXA 3RPUA 1ZGJA 1BN5A 5D6EA 5HDNA 1FYLA 1SFEA 3QPTA 5K5RA 1G3WA 4WXCA 2VT2A 3CO6C 4A2UA 3GFLA 2Z5UA 4ZYDA 5J6XA 5K5OA 3EDPA 1HW1A 4I98B 3CUQA 1E17A 3EETA 4KDPA 1FP1D 3FX3A 2RVCA 2UWMA 2HKXA 3KEOA 3ZP5A 4CZZA 5FLXZ 2CYYA 5ICEA 5JHUA 3RKYA 4NHJA 5CVIA 5F1RA 2Q2EA 2MD5A 2RV8A 4BH9A 3C1DA 2P5LC 3S2WA 3PFIA 4IRIA 5LRRA 4U7DA 1B9MA 1BOAA 1Z6RA 3WTWC 1U3EM 2LKPA 2VBWA 4OIRF 1IXRC 1XDSA 3I5UA 3BPVA 2VC0A 3GWZA 3ECHA 1IW7F 3RIRA 2QVOA 2XAJA 3I54A 2WTEA 1EV7A 4RGXA 3TO7A 1IN7A 3IRRA 2NNNA 4ZZLA 4MQVA 2JRTA 4HF2A 5D4SA 4KIBA 1HXDA 3MWMA 1YFHA 1HSTA 1MGTA 4LG0A 3WTSC 3ERED 5FO5A 4M9ZA 2CW0F 1T2KA 3K2ZA 3HIFA 3ZMSA 1JHFA 2PJPA 5FB2A 1W4MA 3ZMZA 4UVCA 2HQRA 2F5DA 1V4RA 3V7CA 1R1VA 2RC4A 2DPUA 3W6JB 2P5KA 4LK0F 1FWZA 1B4AA 3GFJA 5DD4A 2A07F 1MKMA 2A6EF 4QLCU 2CO5A 2EFNA 3ZQ7A 3J81K 3F6VA 1JGSA 3VOEA 3LFKA 3GW2A 3FF5A 1ZRFA 2RKHA 1YS7A 1XSDA 2IT0A 3ZMTA 3H3UA 1Y0UA 1YTYA 2ADUA 4EM2A 1RNLA 5CJ9A 3F8CA 1QZYA 1BI0A 1KYZA 1QNTA 2XRNA 3PQJA 2HYFA 1BIBA 5L3CA 2DK8A 5J8CA 2P5VA 3GX4X 4M74A 3Q9SA 2OD5A 5JI6A 1K78B 2K02A 2DT5A 3U2RA 2ZXJA 5HLHA 3P9KA 4P55A 2MLGA 1SAXA 5TRDA 3KP4A 4FX4A 1IRFA 5L3BA 1FBSA 4ON0A 5FLXK 1FOKA 1J2XA 3LAPA 3F21A 4BHPA 1MDMB 1CGPA 2D45A 1EH6A 1W7PD 4ZZDA 2XVCA 1KGSA 1OYIA 1LDJA 3NQOA 2F5EA 1U78A 3WODF 1J0RA 3M8FA 4L18B 2XGXA 4LLNA 2QBYB 5BPIA 3T8RA 3MCZA 2FMYA 4P9FA 1P4XA 2KIMA 3R4KA 2FNAA 1U6GA 2RN7A 2PI0A 3TDZC 3GVAA 2NYXA 1MD0A 2GWRA 4MNUA 1DPUA 2HGCA 2VODA 1IAWA 4HQEA 4HV5A 2PBIA 3CLOA 1OYWA 2K4BA 2ESHA 4NB5A 2OBPA 1BC8C 5E18F 1Z6TA 5HS7A 4KMUX 1RZ4A 1F9NA 2NAZA 1TNTA 1AWCA 2XAGA 4A12A 4KIGA 3E6BA 2VE9A 2FBKA 4ETSA 3FM5A 4RAYA 1XD7A 4MTDA 3F72A 5FGMA 1J75A 1ON2A 4Q4ZF 4XBFA 2OQGA 3QU3A 3ROUA 1SD4A 2XKPA 3CDHA 1GXPA 1NHAA 3Q5FA 4KNYA 4L9NA 4EJTA 3HSRA 4PDKA 2VOPA 1YW9A 1FYMA 3C7JA 4R1HA 4U0YA 1PDNC 4R8HA 2GZWA 3TDUC 3SZPA 5L3EA 1IN5A 2DAOA 2EA4A 3JSOA 2ESNA 2V9VA 5LBQA 1SD6A 3SHFA 5BS6A 1B1BA 2V6CA 4OU0A 2EWNA 2EFWA 5ICCA 1PP8F 1FNNA 3HRUA 5F6FA 1L3LA 3ISPA 3FMSA 4A5MA 1FBQA 1HKTA 4CDGA 1O3QA 3F8NA 3K1MA 1R58A 1TQIA 3O6BB 2EV5A 4HDVA 3REOA 2F5CA 4ESJA 3IRQA 3V4GA 2MA3A 4WXDA 4ESBA 3HOSA 1XDUA 5ED4A 4G94A 1ZAOA 2QYOA 3OOPA 3RI4A 4FX0A 3JW4A 1D5VA 4YIFA 3BY6A 3E3VA 1G6NA 1ZLJA 2XHKA 4IXAA 5DUKA 3KCCA 2EA2A 1ZREA 1ZRCA 2JSCA 3WTYC 3ABUA 5JR3A 3MZYA 2ELHA 1BI1A 2CFXA 3MZHA 3M8EA 4RGRA 4L5JA 4HDUA 1P4AA 2WC2A 1DUXC 2GIVA 2M87A 3IKTA 1FX7A 5ERIA 1W5SA 1B9NA 1R00A 3N97A 1IXSB 3VB2A 2GAUA 4ESFA 3GO5A 1ZG5A 1QZZA 4IRGA 3KP7A 4EMSA 4HYEA 2VC1A 2HZTA 2FEZA 5FD5A 2O03A 3ELKA 2BYVE 4LLLA 4I0BA 4P9UA 4L9JA 1O7FA 1W7PA 3WG9A 3F8MA 1XCVA 3QP6A 5E1XA 4HBLA 2HYGD 1S8NA 4WCGA 5ILUA 1XGMA 1S3JA 1O57A 5E20A 3CUQB 4OMYA 4I2OA 2CQKA 2V1DA 5D5VB 3E5QA 4LLGF 4KN7X 2HFHA 2DK5A 5D6FA 1R1TA 1S6LA 3BROA 4B09A 1UFMA 1FBUA 3ZPLA 1U5TB 3TKYA 1T98A 3FM3A 4Y13A 2H94A 4U7BA 2DW4A 4CGZA 1RUOA 1LEAA 2R3SA 2DO7A 3I59A 3KLOA 1G3TA 4M71A 1Z1DA 4F7ZA 2IW5A 3BJOA 2XV4S 3KP6A 4IJAA 1OPCA 2EK5A 1MJBA 2A69F 3K9TA 2KIUA 3WE2A 4Q47A 1FZPB 2Z99A 3QPHA 3I4PA 1YIOA 2BE5F 2MBFA 2ETHA 5LGTA 2M8EA 3KZYA 2P8TA 2H6CA 2ISZA 2HQNA 4RGSA 3CJNA 5KVRA 1H9GA 2L54A 5BQTA 5CLSA 3VEPA 4A0YA 3R61A 2E1CA 3QP5A 5L3DA 4Q48A 1HBXG 1H0MA 1Z05A 3RJPA 2L01A 3D5LA 2ACJA 4GXOA 2JPCA 1G3YA 1T0FA 4EJUA 4UVAA 3QU6A 2M1BA 3WGHA 1E2XA 4L0YB 2V1UA 5BOXA 4BNCA 4G7OF 3WTXC 1IUYA 2ZJ2A 2DU9A 3WTTC 1YG2A 4A6DA 1DP7P 1SMTA 2EFQA 3CUOA 4PGHA 2VBXA 3K0LA 1PUEE 3M1EA 4NQWA 1FLIA 2UXXA 1OKRA 3K1PA 1LNWA 2Z9OA 3HOTA 3HSFA 1F5TA 2L4AA 4KA4A 1SFXA 1QQIA 3E5UA 5L3GA 5A2QZ 2TDXA 4XRFA 1IN8A 1ZHFA 4IRHA 1LB2A 1R23A 5ILVA 3V8JA 5D4RA 2GXGA 2K27A 4O6JA 3SXYA 3T8TA 1XB4A 2M5WA 4N0BA 4LJZF 2VN2A 4LGWA 3CTAA 2O8XA 3EYYA 5E8IA 1F1ZA 1FSEA 2PN6A 1ZG1A
chains in the Genus database with same CATH superfamily
1OQYA 2IP2A 2PEXA 2JPBA 4PJJA 3X2QH 4C2UA 1ZN2A 2VIXA 1WRJA 3FHNA 5LLQA 1YQAA 4A69C 3BG3A 2CG4A 1XSXA 5DDGA 2E5NA 2XUBA 4MTEA 4BYYA 1JUMA 2QSFX 3DPUA 5EZHA 3BR0A 1OCRH 2FSWA 3AFHA 4XR6A 1SVOA 4DOZA 4BQOA 4CICA 4XICA 3FXUA 3PNTA 1JE8A 1LVAA 4G8XA 3CDLA 2QQ9A 2W7NA 3I58A 2KIFA 1I27A 2ZO4A 3PUBA 4CCKA 5EG0A 2K4JA 3TP3A 5JVTA 1WVRA 3S32A 1B72B 4BJ5C 1MNEA 1GVJA 1BJZA 2W82A 1R9TJ 3H3ZA 1HOMA 4BQAA 2NVTJ 1XGOA 1D0XA 4M6YA 1N75A 4YELA 4MGRA 2CMPA 2KRCA 2HTSA 2R7FA 3L2WA 2VBYA 1XMAA 2L3DA 1VQKI 5EGOB 4BE2A 2OTJI 2CGPA 4KFCA 2LLKA 1I3QJ 3ZQQA 2DA3A 3AG4H 4FE7A 4A0XA 2Q8KA 2IA0A 3ASNH 3BJ6A 2D5VA 1GLNA 3K4BA 1W5TA 4WX9A 4EGZA 5FLMJ 1SFOJ 1Y0NA 4UXNA 3IKVA 3BP8A 2BY3A 2M0CA 2PQ8A 3T5XA 2M8GX 2DDAA 3GZNB 1V55H 3DFGA 1VNDA 4HX4A 3SQNA 1EH8A 3CCRI 1KA8A 3GLXA 3HTSB 5LGUA 3FHZA 1BBYA 1REPC 2EBIA 2EV0A 4ITVA 1XGSA 4RA2A 3BZCA 4HOBA 5B1BH 2E7XA 5H20A 1TQMA 1H88C 2EINH 5HNHA 2ZJPF 2XROA 1X3UA 3HYIA 1MJAA 2UXNA 2DA6A 2GOMA 3WTUC 2FNPA 2W84A 1SAUA 3L00A 3V7RA 2O0YA 1WZ2A 3NARA 4RB0A 2JA8J 2LF8A 1X19A 5K7ZA 5C3EJ 1FMVA 4D0PA 3AAFA 1FPQA 3IH3A 4AM3A 1K79A 1N25A 4UUTA 3HUGA 1HDDC 3OYHA 1Z21A 4EATA 5BNGA 3RTRA 4GRIA 3W2VA 4S0HB 3F23A 4UV8A 2RQQA 4HF0A 2ZMEA 2QUFA 4LMYA 5GADJ 1S7OA 4YFNF 2LTPA 2MW8A 2HOEA 3DKWA 1ODDA 1Q1HA 4MHGA 5D5UB 3RZDJ 2FMLA 3LNQA 2R7DA 4G7HF 2FX0A 1HW5A 2YSRA 1WKMA 1R5ID 1MBEA 2IGNA 2ZNZA 3OYGA 2E1MC 3OYIA 2X4HA 2EFPA 3S1RJ 1JXSA 2Y75A 4N9IA 3SEQA 4A3IJ 1Z3YA 2QF7A 3L2VA 4ENKA 4A6EA 2X6OA 1SD7A 5KCMA 1J09A 2DTZA 4ENNA 4XSZF 2E1NA 1RR7A 2XSJC 2BY0A 3FBIB 2D1VA 5EEGA 3WE3A 4G9YA 3NRVA 3BR1A 2Y31A 4M6XA 4F3QA 2L7ZA 2ZJRF 5JLWA 3DU5A 3W6KB 4B1RA 4PFOA 4MEXF 1GHCA 2VKVA 3HM5A 2YU3A 3IHUA 4XLPF 2VKHA 1VQ8I 4XLFA 3N05A 4XSXF 4E7JA 2DA2A 3P7NA 1Q1VA 3CQZJ 1U2WA 4PCQA 3KFWX 2LC2A 4I02A 4ZYEA 1Z3XA 3LA2A 2UZKA 5CKTA 1HKQA 2AS5F 1VTNC 2IPQX 4BACA 4II2A 3FXKA 2FQ3A 1I50J 2LDUA 1HSJA 2E2HJ 2XRLA 1DU6A 3TOAA 4MQ9F 1USTA 1D8JA 1WJBA 5CVVA 5F08A 5D8KB 3WGIA 3IWFA 3J7YJ 1LFUP 1O7LA 4Z2YA 4A3EJ 2AQFA 3B6AA 2CUJA 1OCCH 3DV8A 1D3YA 3SZGA 3CCJI 5J1RA 4F91B 2QM3A 3F8BA 3S3OA 3J80Z 4PZJA 5J4YA 1JKRC 3TO9A 3FMRA 3K69A 4XLCA 3OS1A 1R49A 4BJ6C 4RB2C 3H5AA 3ULQB 3V8KA 1ETYA 3SZTA 2DA4A 3DBRB 1JJ6C 3CCLI 3JSPA 3BCAA 3QYFA 4N9HA 4BL0B 5J4VA 3OSFA 3VWBA 1AKHB 1VQ5I 1T0FC 4LD5A 2BW3B 1LPQA 3U9GA 1YW7A 2M45A 2QENA 5H6RA 4G12A 3FK7A 4A5NA 3DEUA 5E3OA 3A4CA 2HEOA 4HRIA 4EQQA 1K4SA 3L2RA 2K86A 3HPHA 1PVEA 3LL7A 1ULYA 4I7HA 2B9SA 5D5XB 4LITA 4V2FA 2P6TA 4M9XA 2O61A 4XKCA 1OMIA 2W24A 1WQ2A 2GOXB 1J5YA 4FT8A 4IHYA 2DOFA 2VJ4A 2FRHA 3C2BA 5HVQC 1TZLA 3KLNA 2ZNYA 4AIHA 2LBFA 2W57A 1YHQI 3I71A 1YW8A 2LF7A 2ICWG 4YFKF 2PLYA 3EUHC 4Q5SF 2BBYA 3DXJF 3G1OA 3H5RA 4RLQA 4DYQA 2NS0A 2EZLA 1IN6A 4X6AJ 1VQOI 5LHHA 4PSXA 4CCNA 4J19A 2XB0X 3CJRB 1GUUA 2A3SA 2LKSA 5IT3A 4G7ZF 3SJMA 2V7FA 3DTIA 1MNDA 3KETA 3P9IA 3HKZA 4HNVA 5FKLA 1A5JA 1R5GA 5M5WJ 3CCEI 1FOWA 3C2GA 2QSGX 4H0EA 3WHCA 1JGGA 1BOBA 1UG2A 3WG7H 1USSA 2XIGA 4B8XA 4OOIA 4ASNA 3R0AA 5D5WB 1FP2A 1QBJA 2YPRA 3Q0WA 3HKZN 5LEKA 2LNBA 2FOKA 2XAHA 1ETKA 2VPLA 3T1BA 1P7IA 3MZ8A 2OZ6A 2EJRA 1MW7A 2MFZA 2QQBA 2RDPA 5HDGA 5CQEA 1XMKA 2CSOA 4XN0A 3A1YA 3OYNA 1UAAA 3E5XA 2FUG2 3MFKA 1TNSA 2BEOA 2HS5A 3E6MA 2LMDA 3KX2A 1WJFA 3ZMUA 2EV6A 2PMUA 4M9SA 5DCFA 2JSPA 1T08B 4XK4A 1Z7LA 3ABMH 3DLAA 2IS6A 1P4WA 3ML6A 4L0ZB 1E0EA 5HS8A 2DYSH 2CQXA 2VJJA 4G6DA 4RAZA 5KAIC 5TJJA 1R22A 1QGPA 5FRMA 1GVDA 1QU3A 2EIMH 4B4CA 1OCTC 1WHUA 3JRAA 3CCUI 2L02A 1K7AA 4KISA 1D1AA 2Y69H 2E19A 2E1OA 3KZZA 2F48A 1RI7A 3GF2A 4RS8A 2P7VB 5E17F 3K10A 5DCMB 5D8LB 3K7AJ 2QQ8A 3L09A 5IOYA 3GTPJ 2MD0A 4C30A 4BE0A 4IPAA 1MH4A 2HQAA 3TGNA 4J01A 3TW6A 3IL2A 4LG3A 1U8BA 2JTVA 1DGRM 1QHGA 2PMHA 1DGWY 1CF7A 4R79A 4LK1F 1YX5A 2HXIA 2A5YB 1P2FA 5TGTA 3CO7C 1TT0A 1BI3A 3OR1C 3G6EI 4P5OA 1STZA 3I9V2 4XIDA 3QPLA 2F2EA 2ZFWA 2F6CA 1ZH5A 3C3WA 2KJCA 2H27A 1L0OC 5F0CA 4WK8F 3F22A 2BHZA 5KK1A 5DM7F 4L5IA 3H5NA 4M73A 5AONA 4EJWA 2FU4A 2K7LA 3V42A 3AG3H 3HOWJ 4IO9F 4QPOA 4PUSA 3KYLA 2VE8A 5E8GA 3SDBA 5B5EC 3JTGA 2AO9A 2QZ8A 2VQLA 4HF1A 1FTZA 3RKWA 2AHQA 5EEHA 3V7SA 2MH9A 3I56I 2UUZA 2NRAC 2EQRA 3LOCA 4ZH4F 3DEEA 1IJWC 2DMQA 3EUKL 4K2EA 4NNJA 3FXOA 2KKOA 3J80K 2X6XA 2DA1A 1OR7A 2PFBA 3EPZA 1SC7A 3JRFA 3HG9A 1S7AA 5M3MJ 2XF5A 1V5EA 4UB8C 2P0WA 5HDKA 2OU2A 4JK1X 2XASA 2L4MA 1TWHJ 1B59A 2Y48A 3SDGA 4ZJZA 4IQ4A 5H6QA 3FMQA 4FHTA 3MQ0A 1H89C 2CV0A 4BE1A 4V19K 3H9GA 4MEYF 2Z2SB 3G4SI 4AIKA 3HC7A 4I0AA 4EJOA 2CS3A 2EFOA 3COAC 4HX8A 4X0GA 2DJIA 4FTHA 2FXAA 5IP7J 2E7WA 4UHTA 4U0WA 2HR3A 3FISA 2KZGA 2DJNA 2HDCA 1IRXA 3TP0A 4BBRJ 2CQNA 1H8AC 1K4TA 4BEHB 4WF2A 3HSEA 2XAQA 1MZBA 3F8FA 4HW0A 4JX6A 1BJAA 1QVTA 5F64A 3CMYA 4PGGA 4EM1A 2HU9A 4I09A 4OAYA 3SFIA 4YIRX 2Y0MA 5K5QA 2R5ZA 5E1WA 4DJAA 1RUNA 4U88A 2BOLA 3A03A 1Z7UA 4LFUA 3KE2A 3ZR8X 4Y4RA 5FFXA 4E7KA 2VQCA 2STTA 5GAGJ 3BPXA 3HRSA 2LY9A 4KT5C 1FT9A 2PJRB 2M30A 3H92A 1MMAA 1T95A 1SFUA 2ZKZA 3BWGA 5DM6F 2X0LA 2L9VA 1V5FA 4D1QA 4AIJA 3O8HA 4M6VA 3A2KA 2Y9YA 4XMYA 2QEXI 4DYRA 2KJBA 5B1AH 4BHCA 2IA1A 5F04A 4OIOF 1U5TA 1I1GA 2L7FP 3WTZA 1YE9A 1B8IB 1X2MA 3HGYA 5HLIA 3PQKA 2A5WA 3V8LA 2IVMA 4LG0B 2DCEA 1WI3A 5LEJA 3WU1B 1APLC 3K70D 2XB5A 3DU6A 4BDZA 4GO1A 1TW3A 3S16J 2DFHA 2GIZA 2RNGA 3IWZA 1VQPI 2KT0A 4AVPA 2RREA 1C0WA 1XPXA 2ME6A 4F55A 4OAZA 3S2HJ 3QAHA 2O3FA 3I4MJ 1LJ9A 4DYCA 4MIMA 3F9KA 1YS6A 4Y7NJ 4Y17A 1RKTA 4BS9A 2EILH 3IAM2 3PM1A 2AXLA 1FY7A 1BC7C 3KP2A 1KQ0A 5L3FA 3OYAA 4HZFA 4QWQA 3KYCB 4BXUA 2KP6A 2F4MB 2E35A 4FETA 2VT3A 3RZOJ 5DYMA 3CP8A 2Y2ZA 5HODA 1TL8A 3FDYA 2PG4A 4HLXA 1T6SA 1ZYRF 2HVQA 4DBQA 2XAFA 1WH5A 2IGMA 4ABZA 3EUHA 2MH2A 2K9LA 4KUMA 3GTGJ 2OV7A 1TTYA 1X1DA 3ZQGA 3H9QA 3PSFA 3ZQCA 1XSVA 4BY1J 2ZBKA 3DQVC 2HTJA 5BMZA 1S7EA 4YFXF 3HHHA 3K1NA 1D5YA 1MMGA 5FFZA 1RETA 3RPQA 3JRBA 3LSTA 2ZC2A 4GCVA 5J8FA 1KU3A 4HNUA 1YI2I 2KRFA 3JCUC 1H9TA 2H09A 2Q0OA 2RQPA 5CVRA 1KYWA 1FYKA 3CDIA 3LMMA 2DPDA 1OJLA 2DA5A 1I6XA 3FZVA 5FRNA 1S9HA 3S3NA 1KU2A 1KU7A 3GMEA 4XLNF 2DQLA 2YX7A 3T0YA 5JFRA 1FC3A 1TQPA 4B48A 4JBAA 1RR8C 1SEUA 2JA2A 2P7CB 4HEA2 4AWXB 3JAMZ 4ZYHA 2DQRA 3GBGA 2YU9J 4BXXJ 1Z67A 2L7KA 1YJ9I 3WGGA 2XGDA 3B73A 3HHGA 3M1CA 4HQMA 3EYIA 3DKXA 2DXIA 5EG0B 5AIQA 4JQFA 5M5YJ 1HQCA 1MJ9A 3ABTA 2HYJA 2DN0A 2CH0A 4XKBA 2JT1A 4AU7A 3ZQHA 4CYDA 5IOZA 4WWCA 3OYDA 2TRTA 4BXFA 5LRSA 1JHHA 1FTTA 1E3OC 1KU9A 3HRTA 3N4MA 4CHUA 4UVBA 3F3XA 3TOBA 4BU2A 2FA5A 2HKOA 3CJQB 1KQ9A 2OTLI 1O3SA 2DFEA 3IAS2 2C6YA 1R7JA 5FROA 3LA3A 2ZSIB 1IN4A 4ENJA 2CW8A 3LQQA 2IEKA 1WJ5A 1ZLKA 1QPMA 2NOJB 3ZMVA 1YJWI 1PP7U 1ETXA 1SANA 4XRSG 3NAUA 2NVXJ 1OLTA 4S04A 1DDNA 3SFZA 5GAHJ 2G7HA 4AIDA 2M7AA 4PJNA 3GYHX 4UY8I 1AOYA 1ZTRA 1XMXA 5HLTA 1V54H 3BOQA 2R7RA 1YITI 2K40A 2COBA 2B0LA 4XLAA 5EF6A 2GLOA 4BBSJ 3ZN1A 4YIIA 4BAYA 1KQ8A 2WWYA 3QRFF 3LSHA 1O3RA 2OC6A 3UNGC 1P6RA 1IF1A 3CC4I 3FWEA 2CU7A 1ZRDA 3GEZA 1E3PA 2BV6A 3L7WA 5JHFA 2K9MA 4HAMA 5CYVA 3G2BA 4HLYA 1YOVB 3HOVJ 2KRHA 3F6OA 2JMWA 3FK6A 3MKYB 1FEXA 3OY9A 2XC7A 1B6AA 4A3DJ 2R5YB 3ERMA 1GXQA 3OV8A 2A68F 2CQ7A 2DT6A 2KZVA 4D7NA 1XGNA 2R7OA 2Z33A 3U1DA 1X1CA 3GTQJ 1LUJB 4RAGA 5JVGF 2V79A 2ZMEB 4MLOA 5ICFA 2IA2A 1ONVA 1R71A 4G6TB 1DU0A 3O2PE 4D5CA 1I1SA 3H0DA 3G3ZA 4C2MJ 2DODA 4LIUA 5B3SH 1T38A 1OR7C 4L9VA 4A3MJ 1ZG3A 1A36A 3H0GJ 1LDKB 5KNLA 1SVMA 3EUAA 4OIPF 2L9NA 3VYRB 3BR3A 2WY7Q 3DTEA 4M72A 1K83J 2B63J 4A3BJ 4E70A 1NG6A 4PK4A 1K78A 3FXRA 3B02A 1F43A 1R1UA 6PAXA 1UHWA 5CVUA 3SYTA 1WSUA 1LQ1A 1WJAA 4GYGA 4P1WA 2HPIA 2RAEA 3E6DA 4RAFA 2R7ZJ 4S05A 3M9AA 4N4NB 4DZJA 1B72A 2H1KA 5IYDJ 4O5VA 4YG2F 1WI9A 3GZ5A 5EYRA 3DF8A 3LWFA 3RKXA 1ETQA 2L0KA 1Z9CA 1ON1A 3KP5A 1SD5A 3VFZA 2BY1A 3JREA 2VI6A 3QODA 1YX3A 3RPUD 2VKDA 1SMYF 3LSGA 2MLKA 2FF4A 2K9NA 4OIQF 5DD8A 1MDMA 5LD2C 3AG2H 3KP3A 4UUSB 3LA7A 2Z3YA 1XCBA 2HZDA 2RGVA 4EEFG 5FKOA 5LGNA 4TV7A 1EH7A 1D8KA 4ENMA 2V4JC 1IZ1A 3DPTA 1BM9A 4I01A 3OS2A 2QBYA 2X1DA 4GYIA 3FXMA 3HTUA 4NC8A 3CCVI 1X4PA 3L2UA 4IHSA 1FIPA 2X9DA 3K4MA 1S29A 1EKEA 5K1YA 3S17J 3D5RC 5DS9A 3CUQC 2VONA 1J7KA 3NEUA 2ZFUA 3Q0VA 5AIPA 4A0ZA 4B43A 2ID3A 1ORKA 5CPRB 1A6QA 1I5ZA 5FD6A 5A2QK 1D0ZA 3JRGA 2D1HA 2W25A 2YX4A 2GXBA 3I3LA 4L9TA 2P81A 1YIJI 1YRNA 2KQRA 2V1XA 3RDIA 4Y15A 2DFIA 2DTRA 2LSOA 5LHGA 2G7UA 2OA4A 3S1NJ 4W1UA 3JAMK 2JZYA 1W0TA 1EA3A 1ZARA 5FKKA 2RNJA 4EJVA 1U5TC 2WAEA 3CMAI 1X3WB 1FJLA 2DI3A 5F27A 5HOOA 4Y3OA 1DPRA 2NVUB 3HRMA 4DNCA 1D0YA 3E97A 2XKOA 1TLHB 3R60A 3AL0B 3I53A 1F4KA 4IHTA 3QOEA 1LEBA 4ZYGA 3KEQA 2MC4A 3JTHA 3IC7A 4E6KG 2G9WA 4ANJA 1U8RA 3RYRA 2ZXWH 1UB9A 2WV0A 3LQRA 1S72I 3GZ6A 1FOXA 2CJJA 4C2TA 3ECOA 3M7GA 1OYYA 1UHMA 5LHIA 4GGGA 3HBLA 3DP7A 5DV5A 1AU7A 2K9QA 5CVJA 2MC3A 2J5OA 1YO5C 4KMFA 4YEJA 2Y30A 2O8KA 3NWTA 5IT9Z 3WU0A 1S5LC 3R0JA 4OWRB 4LB5A 3CP2A 2VBZA 4G6QA 1ZKGA 4DQ2A 2IJLA 4A3LJ 3GCMA 4HSTA 4IF4A 4OINF 1T39A 4F93B 1BI2A 3FXQA 2LFBA 2JA5J 3Q0UA 3W3CA 5HLGA 1ERDA 1FOYA 3GXOA 3OL3A 4UNOA 5C4JJ 3L1PA 1X2NA 4EM0B 3L9FA 1IRGA 3BT9A 5GPCA 2DYRH 1RIOH 1HF0A 4KICA 3TO6A 5ICGA 2X6YA 1J59A 3D1NI 2VPRA 4IKFA 2LREA 1O4XA 5ILSA 4M3BA 2R7VA 4IOCF 1R5HA 1T56A 2ECBA 4IVNA 1AKHA 3HOUJ 2BW3A 4RB3C 3S93A 3VPRA 4EVIA 3O8GA 4KIFA 4QSHA 2KFDA 2FBIA 3DPLC 2ISYA 1UZCA 1G4DA 3H9JA 4NDLA 4QIWN 2CW7A 2K3PA 4RB1A 3GFIA 4DBRA 3LAJA 5E3MA 2BXZA 4HV6A 3FKJA 1CF7B 3BZ6A 2ID6A 1I3AA 2HWVA 3LSIA 4N4OB 3QOPA 2NNYA 1A6IA 1VQNI 1D1BA 2YS9A 3QYBA 2Z1DA 4BQNA 1J9IA 5BPDA 2V9KA 3MAJA 1G3SA 2PX9A 4WXHA 4HA8A 2ZCWA 3Q3SA 3OWTA 2OAZA 4E7HA 4ZDLA 2L2OA 2W4SA 2HVRA 4XN3A 2KISA 1QPIA 5FKMA 2DBBA 2J5PA 2YUSA 1X58A 3GFMA 4HX7A 4BHBA 1YYVA 1ZGWA 1V3FA 3TQNA 2E5ZA 1Y1WJ 3E6CC 4O3MA 3LSKA 2GA2A 3S15J 3CMMA 1W7PB 1HW2A 5F0FA 3FKIJ 3BC8A 2CWEA 2FE3A 2KL4A 4AD9A 3JRDA 5IP9J 4XM3A 5J3LA 1ZGAA 2GQQA 3CZ6A 3IH4A 2A6HF 1UCRA 4P96A 1XN7A 4UUVA 4CO8A 4OMZA 1YLFA 2XAUA 2HI3A 3ZXSA 3W2WA 3OYLA 3O3KA 1ITYA 2BZTA 4EV0A 3BG7A 3BDDA 1Z91A 3MEXA 1OISA 3HGGA 3GUDA 4XLHA 2TCTA 3BTCA 3RKQA 2AQEA 4UB6C 3BG6A 1FIAA 3WTVC 3I64A 1BIAA 4XORA 1P92A 2IGKA 3G71I 3I0TA 2MGQA 1WWXA 3SEZA 2VOOA 1UJ8A 1OCZH 2FQ4A 1IDZA 1OCPA 2NXNB 2QQAA 3ABLH 3P9CA 2JN6A 4KN4X 2W00A 1XX5A 2R93J 2DMPA 2IAIA 1VQ6I 4KITB 3PJRA 4UV9A 1JT0A 2QA4I 3KZIC 3J7AO 2P4WA 4RGUA 4BQQA 3L2CA 1O3TA 2P6SA 2W85A 2A61A 2VLAA 2JWTA 3Q9VA 5E1ZB 4CXFA 5DEQA 3I59B 4BKXA 3BJAA 2H8WA 5E3NA 2COMA 2E1MB 4KYWA 5DCMA 1MMDA 1LDDA 1G8XA 2D2WA 2MSYA 2VXZA 4PJLA 1TW2A 3CCYA 3W2AA 1IXCA 2DT7B 1QA6A 5DUIA 3R6SA 1R36A 2QLZA 3ZMDA 2IRFG 2V9PA 1QO0D 1MH3A 2LH9A 5EJCA 2DLLA 2YR2A 3EQLF 3J81Z 2FBHA 2GA1A 2QWWA 3D5SC 3K4NA 1HKSA 3D0SA 4L5EA 2R5ZB 2HPMA 1A04A 2CUEA 2E71A 2OZUA 5HS9A 4LB6B 2F5FA 2OPTA 2EB7A 1FSHA 1K6OA 2HVSA 2STWA 4A93J 2H6BA 2BGCA 1UELB 3RYPA 2O6GE 3VODA 1NTCA 2K85A 2Y0SN 3BCBA 4U0VA 3ZN0A 2FJ1A 4EGYA 2OQRA 1AHDP 3OYCA 3G73A 3P5JA 2VJ5A 5E3LA 1MMNA 3C18A 1LFPA 1RPWA 4FCYA 2BXYA 5IT9K 2QKLB 4B3AA 4D5FA 1TBXA 4MO7A 3RPUA 1ZGJA 2CQQA 3CESA 1P7JA 1BN5A 1W0UA 3KYDB 5D6EA 5HDNA 4BGDA 1FYLA 1Z0XA 1SFEA 1JKQC 3K4JA 3QPTA 1ETVA 1VQMI 4RLFA 5K5RA 5B66C 1G3WA 4CCOA 4WXCA 2VT2A 3CO6C 4A2UA 3GFLA 4A3JJ 2JQ7A 2Z5UA 4ZYDA 3NWSA 5J6XA 1WJCA 5GTHC 5K5OA 5F1JA 3EDPA 1HW1A 3OL4A 2AXTC 3H36A 1GV5A 4I98B 3CUQA 1E17A 2W48A 3ZQLA 3EETA 1E3HA 4KDPA 4NC7A 1FP1D 1VF9A 3S3MA 2EPFA 3VYSB 3FX3A 3OS0A 2RVCA 2UWMA 3BR5A 1RKWA 2DFFA 2HKXA 4F92B 3KEOA 2R7TA 1X1AA 3ZP5A 3K2AA 4CZZA 2BHYA 5FLXZ 2KPMA 2CYYA 5ICEA 1X3ZB 1HLVA 5JHUA 3RKYA 4D7MA 1RESA 2G0EA 5H2FC 4NHJA 1MSFC 2V6EA 2WBMA 5CVIA 5M5XJ 5F1RA 2Q2EA 2MD5A 4NQWB 2RV8A 1HA8A 4BH9A 2JVHA 3C1DA 4JYKA 2P5LC 1FMWA 3BG5A 3S2WA 3PIPF 1D1CA 3PFIA 4IRIA 2VB6A 1Y6IA 5LRRA 4U7DA 1B9MA 1BOAA 1Z6RA 5IY5H 3WTWC 3K70C 1U3EM 1ZR4A 1VQLI 2LKPA 2VBWA 4ZTJA 4OIRF 3PIOF 3CC2I 4ZTFA 2EZHA 4A3KJ 4XNFA 2ZXIA 1IXRC 3MKLA 1XDSA 3I5UA 3BPVA 1PUFA 3ZQFA 2VC0A 3GWZA 3ECHA 1IW7F 3RIRA 3ESWB 1M1EB 2QVOA 2XAJA 3KIOA 3I54A 4IL6C 3J7ZI 2WTEA 1TWGJ 1EV7A 4RGXA 2FD5A 3TO7A 1IN7A 2R7QA 2NNNA 3E7LA 3IRRA 4ZZLA 2PJRA 3OIQA 4RBOA 4MQVA 3A01B 2LKXA 2A6TA 3S2DJ 1G2HA 4CCLA 2JRTA 4JOMA 3RQ4A 3TW7A 4HG2A 2CV1A 1MBGA 1F36A 1TC3C 4PJ0C 5GTIC 4HF2A 4ZDPA 5D4SA 4KIBA 1HXDA 2M7BA 2KDOA 1IGNA 3CD6I 3MWMA 3VSLA 1HSTA 1YFHA 1MGTA 1TWCJ 2DA7A 4J00A 4JP0A 1B8IA 4E7LA 4LG0A 3L2QA 3DBHB 3WTSC 3G1MA 4XKVA 5FO5A 3ERED 1Y39A 4M9ZA 2CW0F 1T2KA 3K2ZA 4B44A 4JX4A 2VASA 5FJ8J 2XPUA 3HIFA 5GPAA 3LFUA 3ZMSA 1JHFA 3DKYA 2H1LA 2PJPA 5FB2A 1W4MA 1LE8A 3ZMZA 3OYKA 4C3HJ 4UVCA 1G59A 2HQRA 2F5DA 1V4RA 3V7CA 1R1VA 2I8DA 2RC4A 3BQYA 2DPUA 3W6JB 3UKGA 2P5KA 4LK0F 2F4IA 1VI0A 1FWZA 1B4AA 2LVSA 3LSRA 3GFJA 2LR8A 4IZZA 5DD4A 4D9JA 2A07F 1MKMA 2A6EF 4CH7A 2M0MA 1WPKA 4QLCU 5TISC 1Y1VJ 2CO5A 2EFNA 1WJDA 4CCMA 1NK2P 2VKEA 3WU2C 3H3VK 3A0BC 3ZGKA 3ZQ7A 4XOPA 1ZQ3P 3J81K 3PL8A 2WV1A 3F6VA 5E79C 1W36D 1JGSA 3VOEA 3LFKA 3GW2A 3FF5A 1ZRFA 1ENHA 1K61A 4AC0A 2RKHA 3VYTB 1WH7A 1YS7A 1XSDA 4B47A 2IT0A 1BR1A 2K9SA 3ZMTA 3H3UA 1Y0UA 1MMSA 1YTYA 2ADUA 4EM2A 1RNLA 1RC9A 3H35A 5CJ9A 2E36A 3F8CA 3CLQA 4A3FJ 1VFCA 2KIQA 5J47A 1QZYA 5KHDA 3DBLB 1BI0A 2MABA 3LSPA 1KYZA 1QNTA 2HDDA 2VUMJ 2MYSA 5J1UA 2XRNA 4YRVA 3PQJA 2L9SA 2HYFA 1BIBA 5L3CA 2DK8A 5J8CA 2P5VA 3GX4X 4PFPA 3HL2A 4DIQA 4ZDOA 4M74A 3Q9SA 5C44J 2EIKH 3IH2A 4CYCA 2OD5A 2DOEA 5JI6A 2LYCA 1K78B 5EEAA 2K02A 4W97A 1KONA 2ZSHB 2DT5A 2WA0A 3CCMI 3U2RA 2WADA 2ZXJA 5HLHA 3P9KA 1U9OA 4P55A 2MLGA 1T33A 1SAXA 1A35A 2V1NA 3HUGB 5TRDA 3KP4A 4FX4A 1IRFA 1EF4A 2EH3A 1U9NA 5L3BA 1FBSA 3JRHA 4ON0A 3W6VA 3DCFA 5FLXK 1ZR2A 1FOKA 1J2XA 3LAPA 3F21A 4BHPA 3M4OJ 2X51A 4E7IA 4C3JJ 1MDMB 1CGPA 2D45A 1JUSA 1EH6A 3BLYA 5K7FA 1W7PD 1MNMC 4ZZDA 2XVCA 1KGSA 3HJEA 3CF5F 1OYIA 1LDJA 3NQOA 2F5EA 4BUPA 1U78A 3WODF 1J0RA 5LFAA 4LIVA 3M8FA 1JUPA 4XKWA 4PSWA 2XGXA 4L18B 2QBYB 4LLNA 3K4CA 5BPIA 1IDYA 1MBFA 4H4KC 3T8RA 3MCZA 1IRZA 2Z16A 2FMYA 3BR2A 4P9FA 1P4XA 2QGUA 2F4OB 2KIMA 4V2GA 1MBKA 2FNAA 3R4KA 1U6GA 2LK2A 2RN7A 2PI0A 2IS4A 1WFXA 3S8PA 2HOAA 3TDZC 2HNHA 3GVAA 3MMYB 2NYXA 5EGOA 3CCSI 1MD0A 2IGOA 5CQGA 1YRNB 4GFBA 2GWRA 4MNUA 1DPUA 2LP0A 2HGCA 3BTJA 3QQAA 3RQIA 4DGWB 2XPVA 2VODA 1IAWA 4HQEA 1BR2A 4HV5A 3GTKJ 2R5YA 2PBIA 1YJNI 3CLOA 3IV5A 1OYWA 2K4BA 2ESHA 4NB5A 2M4KA 2OBPA 3PUFA 4IEJA 1BC8C 5E18F 1Z6TA 5HS7A 4KMUX 3OYJA 1RZ4A 4IX7A 1F9NA 2NAZA 1TNTA 1AWCA 2M4GA 1HC8A 1K6YA 2WB1A 2NVYJ 4KT6A 2XAGA 4A12A 4RMNA 4KIGA 3E6BA 1JI8A 1LKXA 3FBNB 3K6GA 3M07A 1BL0A 2JA6J 3M8JA 2VE9A 2X48A 2HOTA 2FBKA 4ETSA 3HXLA 2WB1N 2M3AA 3FM5A 4RAYA 2XPWA 1XD7A 3CJTB 3F72A 3RSNA 4MTDA 1OCOH 5FGMA 4A3GJ 4Z6YA 3MVPA 3GTJJ 2LOOA 1J75A 4Y52J 1ON2A 1R4NB 4E4HA 4Q4ZF 4XBFA 2OQGA 2UV1A 3FXJA 3QU3A 3ROUA 1SD4A 2XKPA 2LBFB 3CDHA 1GXPA 1NHAA 4C9YA 4QTRA 3Q5FA 4L9NA 3ZQIA 4EJTA 4KNYA 5IYBJ 2NS7A 3HSRA 4IHXA 4A3CJ 2VQHA 2K3FA 4PDKA 2VOPA 3IP4B 3ZCOA 1YW9A 1FYMA 4HNTA 4DW6A 3C7JA 1UMQA 1Z77A 4UUSA 2A05A 4R1HA 4U0YA 1PDNC 1R4MB 4R8HA 3ZRGA 1WCMJ 2GZWA 2M34A 4U87A 3LSMA 5GP9A 4QPQA 3TDUC 1CQTA 2MG4A 1ETWA 1IUFA 3SZPA 5L3EA 1IN5A 2DAOA 3HEFA 3C2HA 3U21A 2EA4A 5EDNA 3JSOA 2ESNA 3OYBA 2V9VA 2R92J 5LBQA 2JA7J 3PFYA 1JJ8C 2GM4A 3PSIA 1SD6A 3SHFA 2XF6A 1N77A 2JUCA 5FKNA 5BS6A 1B1BA 2V6CA 4OU0A 2EWNA 2EFWA 1QRYA 2VQGA 2NVQJ 1TT5B 1ACIA 2IS2A 2FOWA 5ICCA 2ZXHA 1PP8F 4XONA 1FNNA 3HRUA 5F6FA 1L3LA 1JKOC 2KHMA 4I76A 1EJ9A 1W1WE 3HB9A 4CCJA 2N8GA 3ISPA 3FMSA 4A5MA 5IP6A 4M3FA 1FBQA 5J1YA 3OR2C 1HKTA 2XGEA 3MKWB 4KJZA 4CA0A 4CDGA 2ME0A 1O3QA 3F8NA 3K1MA 1R58A 1TQIA 3O6BB 1QHHD 2EV5A 4HDVA 2Y9ZA 3PO3J 3REOA 2JJ7A 4AUXA 2CUFA 2F5CA 4ESJA 3OYMA 2IS1A 4XRMA 4IHVA 2JRMA 2LY2A 3OIPA 3IRQA 3GTLJ 2JUGA 2WAFA 3ONQA 4BJTA 5GAEJ 1XC5A 3QYEA 2L5QA 4BDYA 3V4GA 4LOCA 2MA3A 2X85A 4WXDA 4ESBA 3HOSA 3S14J 3RCOA 1XDUA 2JVGA 5ED4A 4G94A 1ZAOA 2QYOA 3MKZA 2W1OA 3OOPA 2X1EA 3RI4A 4GDFA 4FX0A 1I6HJ 4AVZA 1VZ0A 3JRIA 3JW4A 1UHSA 1UG0A 1IG7A 1D5VA 1NK3P 4YIFA 1DP3A 3BY6A 3E3VA 1G6NA 1ZLJA 2XHKA 4II3A 4IXAA 5DUKA 3KCCA 1NH3A 2ELKA 2EA2A 1ZREA 2HOSA 2X6WA 1ZRCA 2JSCA 3WTYC 3ABUA 5JR3A 2ECCA 2ELHA 3MZYA 3WHBA 1TWFJ 2VL8A 1N78A 1BI1A 2CFXA 3MZHA 3BQZA 3M8EA 4RGRA 4XRSA 2DOAA 4L5JA 3MN2A 3M3YJ 4HDUA 1X4OA 2V26A 3DWLE 9ANTA 2KMUA 3TEDA 1P4AA 2WC2A 4DZPA 3S1QJ 1TP4A 2GXAA 1DUXC 2CUZA 2GIVA 2HDWA 2M87A 3ABKH 1LVKA 3IKTA 1FX7A 5ERIA 2OF7A 1XG1A 3DLLF 1P9QC 1W5SA 4I99C 1JT6A 4JX5A 1B9NA 4IHWA 1VQ4I 4HPQA 1R00A 3N97A 4CUGA 3BR6A 1IC8A 3A02A 1RRJA 2E2IJ 3HOXJ 5HNFA 1IXSB 3KEYA 2OJED 3S1MJ 3VB2A 2GAUA 4ESFA 3GO5A 3U1KA 1ZG5A 1QZZA 3ZOBA 4IOAF 4IRGA 2XF7A 3KP7A 4EMSA 3IUOA 1X1BA 1BW5A 1VQ7I 3K4LA 4BY7J 1SFKA 4HYEA 2LY1A 2Q1ZB 2VC1A 2PMZA 2HZTA 4E7SA 1XTAA 2FEZA 2CV2A 2LD5A 5FD5A 2O03A 2DMNA 5FLVA 4X1EA 3ELKA 2BYVE 4LLLA 2I10A 2WAQA 2R7UA 4I0BA 4P9UA 2E60A 4FASD 4L9JA 3KPHA 3GLLA 2B7EA 1BW6A 2PMZN 1O7FA 3FXLA 1W7PA 3WG9A 3F8MA 1XCVA 2X1CA 1DQUA 2Y0SA 2WAQN 3QP6A 5E1XA 4HBLA 4NC6A 2HYGD 3I4NJ 1S8NA 2K5CA 3DTKA 3VYUB 2LG4A 3HDDA 1IV8A 1HCRA 4WCGA 2NS8A 1SVLA 2QCOA 5ILUA 3OMYA 1GV2A 1XGMA 3TMOA 1S3JA 1O57A 5E20A 4ZYAA 3CUQB 4E7ZA 4OMYA 1Y8QB 2M2EA 4I2OA 2CQKA 5K7HA 1GT0C 1JKPC 1WGXA 2V1DA 3GTMJ 5D5VB 2EIJH 3E5QA 2CFOA 4LLGF 4KN7X 2HFHA 2DK5A 3A0HC 5D6FA 4MFDA 1R1TA 1S6LA 3BROA 1MSEC 2VXDA 3VDXA 4B09A 1UFMA 2BVLA 4RDUA 1FBUA 4B3XA 1XS9A 3AKZA 3ZPLA 1U5TB 5IPAA 3TKYA 1ZELA 3PO2J 2HXOA 1OFCX 1T98A 3FM3A 2ZJQF 2Q2EB 1KZHA 1PJRA 1X1PA 4Y13A 3HOYJ 2H94A 2ZMEC 3H1CA 4U7BA 3J7AY 2DW4A 2DMUA 4CGZA 3HZJA 1PYVA 1RUOA 1U0JA 4AYBA 2R7XA 1LEAA 2R3SA 1POGA 2DO7A 3I59A 1QZEA 3GTOJ 3KLOA 2WY8Q 1G3TA 2F5VA 4M71A 1Z1DA 3FIWA 2OCEA 5JLXA 4F7ZA 2IW5A 3BJOA 2XV4S 5M3FJ 4AYBN 4NBQA 2DDBA 2IBDA 3KP6A 4IJAA 1V5GA 2DMTA 2R0QC 4PJMA 2R7WA 3JRCA 1PUFB 1OPCA 2BY2A 2EK5A 3BTIA 1MJBA 2A69F 3K9TA 2XGCA 2KIUA 2LRDA 4HSRA 3VSKA 3JR9A 3WE2A 1BA5A 2OCCH 4Q47A 1FZPB 2EZIA 2Z99A 2QSHX 1I39A 2BVMA 3QPHA 4FISA 3I4PA 1YIOA 2BE5F 2MBFA 3F0CA 3TL4X 3I55I 2ETHA 5LGTA 1MIJA 2M8EA 3KZYA 2P8TA 2H6CA 3G1LA 1Y8RB 2ISZA 2HQNA 1HDPA 4RGSA 1BR4A 3CJNA 4BEHA 3CMEI 1MBJA 5KVRA 1H9GA 4IQJA 2L54A 4I6ZA 2I5UA 5BQTA 3OIOA 5CLSA 3VEPA 4ZC3A 2CRGA 3R61A 4A0YA 2E1CA 3QP5A 4NUBA 5L3DA 2M9HA 4Q48A 1HBXG 1H0MA 2L7MP 2ZB9A 4M3DA 1Z05A 1R6RA 2L9RA 2VJIA 4XOTA 3RJPA 2L01A 3D5LA 4Y33A 2ACJA 2O5RA 4GXOA 2JPCA 4C3IJ 1T0FA 1G3YA 3ASOH 1JTXA 4EJUA 4UVAA 1NG7A 3QU6A 2M1BA 2XSDC 3WGHA 4RM2A 4CZCA 1LE8B 1E2XA 4L0YB 2QKMB 3DEWA 2R7SA 3CF2A 2O7OA 4MFEA 2V1UA 4XQFA 5BOXA 3OOUA 1IV6A 4BNCA 4G7OF 3WTXC 3QWLA 3UR3C 2H8RA 1IUYA 4RM3A 2ZJ2A 3AG1H 2DU9A 3QPSA 3WTTC 1YG2A 1IO2A 4A6DA 1Y56A 1QVUA 1DP7P 1SMTA 2EFQA 3CUOA 5J40A 4XLEA 3E1SA 3K4KA 5DTDA 4PGHA 2VBXA 1A31A 3K0LA 1PUEE 2JK3A 3CCQI 5KAFC 3M1EA 4NQWA 2HQ5A 1FLIA 3OYFA 1TWAJ 2UXXA 3AL0C 1MBHA 3OYEA 1OKRA 2E34A 3K1PA 1T8IA 1LNWA 2Z9OA 5IYCJ 3HOTA 1LFBA 3HSFA 1W5CC 4XL9A 1F5TA 3PNVA 1AA7A 2L4AA 4KA4A 1SFXA 2O9LA 3OSGA 1QQIA 3BZKA 3TBIA 3E5UA 4M3EA 4FQGA 3CC7I 5C4XJ 3PNYA 2KLOA 5L3GA 1JTYA 5A2QZ 2OUMA 3BG9A 2NOGA 2KDZA 2TDXA 2E2JJ 4XRFA 1IN8A 3HOZJ 1WJEA 1ZHFA 5EZGA 4IRHA 1LB2A 1R23A 2R4GA 5ILVA 4CYCB 1ETOA 3V8JA 4CSWA 3A01A 5D4RA 3LSJA 4M3GA 5F0HA 2GXGA 2K27A 3HPGA 4O6JA 3SXYA 2ELJA 3MD2A 4FE4A 1XB4A 2IXSA 2M5WA 3B6CA 4N0BA 3T8TA 1GDTA 4LJZF 3BTLA 2VN2A 4LGWA 3CTAA 2GBYA 2O8XA 3EYYA 4F52A 1W36C 5E8IA 3E0JB 1F1ZA 1ZK8A 1FSEA 2PN6A 1VQ9I 2EZKA 2XDVA 1ZG1A
chains in the Genus database with same CATH topology
2IP2A 2PEXA 2JPBA 1ZN2A 5LLQA 1WRJA 1YQAA 2CG4A 1XSXA 5DDGA 2XUBA 4MTEA 4BYYA 2FSWA 4CICA 3FXUA 1JE8A 1LVAA 4G8XA 2QQ9A 3I58A 2KIFA 1I27A 2ZO4A 2K4JA 5JVTA 1GVJA 3H3ZA 4BQAA 1XGOA 4M6YA 4MGRA 2HTSA 2R7FA 2VBYA 1XMAA 2L3DA 2CGPA 4KFCA 4A0XA 2Q8KA 2IA0A 3BJ6A 4WX9A 1W5TA 4EGZA 4UXNA 3IKVA 3BP8A 2PQ8A 3T5XA 3DFGA 4HX4A 3SQNA 1EH8A 1KA8A 3GLXA 3HTSB 5LGUA 3FHZA 1BBYA 1REPC 2EV0A 1XGSA 4HOBA 2E7XA 5H20A 1TQMA 2XROA 1X3UA 3HYIA 1MJAA 2UXNA 3WTUC 2FNPA 2W84A 3L00A 3V7RA 2O0YA 4RB0A 2LF8A 4D0PA 3AAFA 1FPQA 1K79A 3HUGA 3RTRA 3F23A 4UV8A 4HF0A 2ZMEA 2QUFA 4LMYA 1S7OA 4YFNF 2HOEA 3DKWA 1ODDA 1Q1HA 4MHGA 5D5UB 2FMLA 2R7DA 4G7HF 1HW5A 2YSRA 1WKMA 2ZNZA 2X4HA 2EFPA 1JXSA 2Y75A 4N9IA 4ENKA 4A6EA 1SD7A 4ENNA 4XSZF 2E1NA 5EEGA 2D1VA 3WE3A 4G9YA 3NRVA 4M6XA 3W6KB 4MEXF 1GHCA 3IHUA 2YU3A 4XLPF 4XSXF 3P7NA 1U2WA 4PCQA 3KFWX 4I02A 4ZYEA 2UZKA 3LA2A 1HKQA 2AS5F 1VTNC 2IPQX 2FQ3A 2LDUA 1HSJA 3TOAA 4MQ9F 1USTA 1D8JA 5CVVA 5D8KB 3WGIA 3IWFA 1O7LA 4Z2YA 3DV8A 1D3YA 2QM3A 3F8BA 3J80Z 4PZJA 3TO9A 3FMRA 3K69A 4RB2C 3ULQB 3V8KA 3SZTA 3JSPA 4N9HA 4LD5A 3U9GA 1YW7A 2M45A 2QENA 5H6RA 4A5NA 3DEUA 2HEOA 4EQQA 2K86A 1ULYA 4I7HA 5D5XB 2P6TA 4M9XA 2O61A 1OMIA 2W24A 1WQ2A 1J5YA 4FT8A 2FRHA 5HVQC 3KLNA 2ZNYA 4AIHA 2W57A 3I71A 1YW8A 2LF7A 4YFKF 2PLYA 4Q5SF 2BBYA 3DXJF 2NS0A 1IN6A 5LHHA 2A3SA 5IT3A 4G7ZF 3KETA 3P9IA 1R5GA 4H0EA 1USSA 2XIGA 4B8XA 4OOIA 4ASNA 3R0AA 5D5WB 1FP2A 1QBJA 2YPRA 5LEKA 2LNBA 2FOKA 2XAHA 3T1BA 2OZ6A 2EJRA 2QQBA 2RDPA 5HDGA 1XMKA 2CSOA 3E5XA 3MFKA 1TNSA 2BEOA 2HS5A 3E6MA 3ZMUA 2EV6A 2PMUA 4M9SA 5DCFA 1P4WA 3ML6A 4L0ZB 5HS8A 4G6DA 4RAZA 5TJJA 1R22A 1QGPA 2L02A 1K7AA 3KZZA 1RI7A 3GF2A 4RS8A 2P7VB 5E17F 5DCMB 5D8LB 3L09A 4IPAA 3TGNA 3IL2A 2JTVA 2PMHA 1CF7A 4R79A 4LK1F 2A5YB 1P2FA 3CO7C 1BI3A 4P5OA 1STZA 2F2EA 2ZFWA 1ZH5A 3C3WA 2KJCA 2H27A 1L0OC 4WK8F 3F22A 5KK1A 4L5IA 4M73A 5AONA 4EJWA 2FU4A 2K7LA 2VE8A 5E8GA 3JTGA 2QZ8A 4HF1A 3RKWA 5EEHA 3V7SA 2MH9A 2NRAC 4ZH4F 4K2EA 2KKOA 3J80K 1OR7A 2PFBA 1S7AA 5HDKA 2OU2A 4JK1X 2XASA 2L4MA 1B59A 2Y48A 5H6QA 3FMQA 4FHTA 3MQ0A 4MEYF 4AIKA 4I0AA 4EJOA 2EFOA 3COAC 4HX8A 2FXAA 2E7WA 4UHTA 4U0WA 2HR3A 2HDCA 4WF2A 3HSEA 2XAQA 1MZBA 3F8FA 4HW0A 1BJAA 5F64A 4PGGA 4EM1A 4I09A 2Y0MA 5K5QA 5E1WA 1RUNA 4U88A 1Z7UA 4LFUA 3KE2A 5FFXA 2STTA 3BPXA 3HRSA 4KT5C 1FT9A 2M30A 3H92A 1SFUA 2ZKZA 3BWGA 2X0LA 4AIJA 2KJBA 4BHCA 2IA1A 4OIOF 1U5TA 1I1GA 3WTZA 4LG0B 3V8LA 3PQKA 5HLIA 2IVMA 5LEJA 3WU1B 4GO1A 1TW3A 3IWZA 4AVPA 1C0WA 3QAHA 2O3FA 1LJ9A 1YS6A 4Y17A 2AXLA 1FY7A 1BC7C 3KP2A 1KQ0A 5L3FA 4HZFA 4QWQA 4BXUA 2VT3A 5DYMA 2PG4A 4HLXA 1T6SA 1ZYRF 2XAFA 3EUHA 2MH2A 4KUMA 1TTYA 1XSVA 2ZBKA 3DQVC 2HTJA 5BMZA 4YFXF 3HHHA 3K1NA 5FFZA 3RPQA 3LSTA 4GCVA 5J8FA 1KU3A 2KRFA 1H9TA 2H09A 2Q0OA 2RQPA 5CVRA 1KYWA 1FYKA 2DPDA 1I6XA 3FZVA 1KU2A 1KU7A 4XLNF 2DQLA 2YX7A 3T0YA 5JFRA 1FC3A 1TQPA 4JBAA 2P7CB 4AWXB 3JAMZ 4ZYHA 2DQRA 3WGGA 3B73A 3HHGA 4HQMA 3EYIA 5AIQA 4JQFA 1HQCA 1MJ9A 3ABTA 2JT1A 4CYDA 4WWCA 5LRSA 1JHHA 1KU9A 3HRTA 3N4MA 4CHUA 4UVBA 3F3XA 3TOBA 2FA5A 2HKOA 1KQ9A 1O3SA 2C6YA 1R7JA 3LA3A 1IN4A 4ENJA 3LQQA 1ZLKA 1QPMA 3ZMVA 1PP7U 4S04A 1DDNA 3SFZA 2G7HA 3GYHX 1AOYA 3BOQA 2B0LA 3ZN1A 4YIIA 4BAYA 1KQ8A 2WWYA 3QRFF 1O3RA 1P6RA 1IF1A 3FWEA 1ZRDA 3GEZA 2BV6A 3L7WA 4HAMA 5CYVA 4HLYA 3F6OA 1B6AA 1GXQA 3OV8A 2A68F 1XGNA 2Z33A 3U1DA 2V79A 2ZMEB 5ICFA 2IA2A 1ONVA 3O2PE 1I1SA 3G3ZA 1T38A 4L9VA 1ZG3A 1LDKB 4OIPF 4M72A 4E70A 1K78A 3FXRA 3B02A 1R1UA 6PAXA 1UHWA 5CVUA 1WSUA 1LQ1A 4GYGA 3E6DA 4S05A 3M9AA 4O5VA 4YG2F 1WI9A 3GZ5A 3DF8A 3LWFA 3RKXA 1Z9CA 1ON1A 3KP5A 1SD5A 3VFZA 1SMYF 2MLKA 2FF4A 4OIQF 5DD8A 1MDMA 3KP3A 3LA7A 2Z3YA 1XCBA 2RGVA 5LGNA 4TV7A 1EH7A 1D8KA 4ENMA 1IZ1A 3DPTA 1BM9A 4I01A 2QBYA 4GYIA 3HTUA 4IHSA 1S29A 5K1YA 3CUQC 2VONA 1J7KA 3NEUA 5AIPA 4O3MA 4A0ZA 5FD6A 1I5ZA 5A2QK 2D1HA 2W25A 2YX4A 2GXBA 4L9TA 2V1XA 3RDIA 4Y15A 2DFIA 2DTRA 2LSOA 5LHGA 2G7UA 2OA4A 3JAMK 2JZYA 1ZARA 4EJVA 2RNJA 1U5TC 2DI3A 5HOOA 1DPRA 3HRMA 4DNCA 3E97A 2XKOA 1TLHB 3R60A 3I53A 1F4KA 4IHTA 1LEBA 4ZYGA 3KEQA 3JTHA 3IC7A 2G9WA 1U8RA 3RYRA 1UB9A 2WV0A 3LQRA 3GZ6A 3ECOA 3M7GA 1OYYA 1UHMA 5LHIA 4GGGA 3DP7A 5DV5A 5CVJA 2MC3A 2J5OA 1YO5C 4KMFA 5IT9Z 3WU0A 3R0JA 4LB5A 2VBZA 4G6QA 4DQ2A 2IJLA 4IF4A 4OINF 1T39A 1BI2A 3FXQA 5HLGA 3GXOA 4UNOA 4EM0B 3L9FA 1IRGA 1RIOH 4KICA 3TO6A 5ICGA 1J59A 5ILSA 1R5HA 4IVNA 4RB3C 4EVIA 4KIFA 2FBIA 3DPLC 2ISYA 1G4DA 4RB1A 3GFIA 3LAJA 4HV6A 1CF7B 3BZ6A 2HWVA 3QOPA 2NNYA 1J9IA 5BPDA 3MAJA 1G3SA 4WXHA 4HA8A 2ZCWA 2OAZA 2DBBA 2J5PA 3GFMA 4HX7A 4BHBA 1YYVA 1V3FA 3TQNA 3E6CC 2GA2A 1W7PB 1HW2A 2CWEA 2FE3A 4AD9A 1ZGAA 2GQQA 2A6HF 1UCRA 4P96A 1XN7A 4UUVA 4CO8A 4OMZA 1YLFA 3O3KA 4EV0A 1Z91A 3BDDA 3MEXA 3GUDA 3WTVC 3I64A 1BIAA 1P92A 3I0TA 1WWXA 2VOOA 2QQAA 3P9CA 4KN4X 4UV9A 3J7AO 2P4WA 4RGUA 3L2CA 1O3TA 2P6SA 2W85A 2A61A 3Q9VA 5E1ZB 4CXFA 5DEQA 3I59B 3BJAA 2COMA 4KYWA 5DCMA 1LDDA 2D2WA 2VXZA 1TW2A 1IXCA 5DUIA 3R6SA 1R36A 2QLZA 3ZMDA 2IRFG 1QO0D 2DLLA 2YR2A 3EQLF 3J81Z 2FBHA 2GA1A 2QWWA 1HKSA 3D0SA 1A04A 2OZUA 5HS9A 4LB6B 2F5FA 2EB7A 1FSHA 1K6OA 2STWA 2H6BA 2BGCA 3RYPA 2O6GE 3VODA 4U0VA 3ZN0A 4EGYA 2OQRA 3G73A 3C18A 5IT9K 1TBXA 3RPUA 1ZGJA 1BN5A 5D6EA 5HDNA 1FYLA 1SFEA 3QPTA 5K5RA 1G3WA 4WXCA 2VT2A 3CO6C 4A2UA 3GFLA 2Z5UA 4ZYDA 5J6XA 5K5OA 3EDPA 1HW1A 4I98B 3CUQA 1E17A 3EETA 4KDPA 1FP1D 3FX3A 2RVCA 2UWMA 2HKXA 3KEOA 3ZP5A 4CZZA 5FLXZ 2CYYA 5ICEA 5JHUA 3RKYA 4NHJA 5CVIA 5F1RA 2Q2EA 2MD5A 2RV8A 4BH9A 3C1DA 2P5LC 3S2WA 3PFIA 4IRIA 5LRRA 4U7DA 1B9MA 1BOAA 1Z6RA 3WTWC 1U3EM 2LKPA 2VBWA 4OIRF 1IXRC 1XDSA 3I5UA 3BPVA 2VC0A 3GWZA 3ECHA 1IW7F 3RIRA 2QVOA 2XAJA 3I54A 2WTEA 1EV7A 4RGXA 3TO7A 1IN7A 3IRRA 2NNNA 4ZZLA 4MQVA 2JRTA 4HF2A 5D4SA 4KIBA 1HXDA 3MWMA 1YFHA 1HSTA 1MGTA 4LG0A 3WTSC 3ERED 5FO5A 4M9ZA 2CW0F 1T2KA 3K2ZA 3HIFA 3ZMSA 1JHFA 2PJPA 5FB2A 1W4MA 3ZMZA 4UVCA 2HQRA 2F5DA 1V4RA 3V7CA 1R1VA 2RC4A 2DPUA 3W6JB 2P5KA 4LK0F 1FWZA 1B4AA 3GFJA 5DD4A 2A07F 1MKMA 2A6EF 4QLCU 2CO5A 2EFNA 3ZQ7A 3J81K 3F6VA 1JGSA 3VOEA 3LFKA 3GW2A 3FF5A 1ZRFA 2RKHA 1YS7A 1XSDA 2IT0A 3ZMTA 3H3UA 1Y0UA 1YTYA 2ADUA 4EM2A 1RNLA 5CJ9A 3F8CA 1QZYA 1BI0A 1KYZA 1QNTA 2XRNA 3PQJA 2HYFA 1BIBA 5L3CA 2DK8A 5J8CA 2P5VA 3GX4X 4M74A 3Q9SA 2OD5A 5JI6A 1K78B 2K02A 2DT5A 3U2RA 2ZXJA 5HLHA 3P9KA 4P55A 2MLGA 1SAXA 5TRDA 3KP4A 4FX4A 1IRFA 5L3BA 1FBSA 4ON0A 5FLXK 1FOKA 1J2XA 3LAPA 3F21A 4BHPA 1MDMB 1CGPA 2D45A 1EH6A 1W7PD 4ZZDA 2XVCA 1KGSA 1OYIA 1LDJA 3NQOA 2F5EA 1U78A 3WODF 1J0RA 3M8FA 4L18B 2XGXA 4LLNA 2QBYB 5BPIA 3T8RA 3MCZA 2FMYA 4P9FA 1P4XA 2KIMA 3R4KA 2FNAA 1U6GA 2RN7A 2PI0A 3TDZC 3GVAA 2NYXA 1MD0A 2GWRA 4MNUA 1DPUA 2HGCA 2VODA 1IAWA 4HQEA 4HV5A 2PBIA 3CLOA 1OYWA 2K4BA 2ESHA 4NB5A 2OBPA 1BC8C 5E18F 1Z6TA 5HS7A 4KMUX 1RZ4A 1F9NA 2NAZA 1TNTA 1AWCA 2XAGA 4A12A 4KIGA 3E6BA 2VE9A 2FBKA 4ETSA 3FM5A 4RAYA 1XD7A 4MTDA 3F72A 5FGMA 1J75A 1ON2A 4Q4ZF 4XBFA 2OQGA 3QU3A 3ROUA 1SD4A 2XKPA 3CDHA 1GXPA 1NHAA 3Q5FA 4KNYA 4L9NA 4EJTA 3HSRA 4PDKA 2VOPA 1YW9A 1FYMA 3C7JA 4R1HA 4U0YA 1PDNC 4R8HA 2GZWA 3TDUC 3SZPA 5L3EA 1IN5A 2DAOA 2EA4A 3JSOA 2ESNA 2V9VA 5LBQA 1SD6A 3SHFA 5BS6A 1B1BA 2V6CA 4OU0A 2EWNA 2EFWA 5ICCA 1PP8F 1FNNA 3HRUA 5F6FA 1L3LA 3ISPA 3FMSA 4A5MA 1FBQA 1HKTA 4CDGA 1O3QA 3F8NA 3K1MA 1R58A 1TQIA 3O6BB 2EV5A 4HDVA 3REOA 2F5CA 4ESJA 3IRQA 3V4GA 2MA3A 4WXDA 4ESBA 3HOSA 1XDUA 5ED4A 4G94A 1ZAOA 2QYOA 3OOPA 3RI4A 4FX0A 3JW4A 1D5VA 4YIFA 3BY6A 3E3VA 1G6NA 1ZLJA 2XHKA 4IXAA 5DUKA 3KCCA 2EA2A 1ZREA 1ZRCA 2JSCA 3WTYC 3ABUA 5JR3A 3MZYA 2ELHA 1BI1A 2CFXA 3MZHA 3M8EA 4RGRA 4L5JA 4HDUA 1P4AA 2WC2A 1DUXC 2GIVA 2M87A 3IKTA 1FX7A 5ERIA 1W5SA 1B9NA 1R00A 3N97A 1IXSB 3VB2A 2GAUA 4ESFA 3GO5A 1ZG5A 1QZZA 4IRGA 3KP7A 4EMSA 4HYEA 2VC1A 2HZTA 2FEZA 5FD5A 2O03A 3ELKA 2BYVE 4LLLA 4I0BA 4P9UA 4L9JA 1O7FA 1W7PA 3WG9A 3F8MA 1XCVA 3QP6A 5E1XA 4HBLA 2HYGD 1S8NA 4WCGA 5ILUA 1XGMA 1S3JA 1O57A 5E20A 3CUQB 4OMYA 4I2OA 2CQKA 2V1DA 5D5VB 3E5QA 4LLGF 4KN7X 2HFHA 2DK5A 5D6FA 1R1TA 1S6LA 3BROA 4B09A 1UFMA 1FBUA 3ZPLA 1U5TB 3TKYA 1T98A 3FM3A 4Y13A 2H94A 4U7BA 2DW4A 4CGZA 1RUOA 1LEAA 2R3SA 2DO7A 3I59A 3KLOA 1G3TA 4M71A 1Z1DA 4F7ZA 2IW5A 3BJOA 2XV4S 3KP6A 4IJAA 1OPCA 2EK5A 1MJBA 2A69F 3K9TA 2KIUA 3WE2A 4Q47A 1FZPB 2Z99A 3QPHA 3I4PA 1YIOA 2BE5F 2MBFA 2ETHA 5LGTA 2M8EA 3KZYA 2P8TA 2H6CA 2ISZA 2HQNA 4RGSA 3CJNA 5KVRA 1H9GA 2L54A 5BQTA 5CLSA 3VEPA 4A0YA 3R61A 2E1CA 3QP5A 5L3DA 4Q48A 1HBXG 1H0MA 1Z05A 3RJPA 2L01A 3D5LA 2ACJA 4GXOA 2JPCA 1G3YA 1T0FA 4EJUA 4UVAA 3QU6A 2M1BA 3WGHA 1E2XA 4L0YB 2V1UA 5BOXA 4BNCA 4G7OF 3WTXC 1IUYA 2ZJ2A 2DU9A 3WTTC 1YG2A 4A6DA 1DP7P 1SMTA 2EFQA 3CUOA 4PGHA 2VBXA 3K0LA 1PUEE 3M1EA 4NQWA 1FLIA 2UXXA 1OKRA 3K1PA 1LNWA 2Z9OA 3HOTA 3HSFA 1F5TA 2L4AA 4KA4A 1SFXA 1QQIA 3E5UA 5L3GA 5A2QZ 2TDXA 4XRFA 1IN8A 1ZHFA 4IRHA 1LB2A 1R23A 5ILVA 3V8JA 5D4RA 2GXGA 2K27A 4O6JA 3SXYA 3T8TA 1XB4A 2M5WA 4N0BA 4LJZF 2VN2A 4LGWA 3CTAA 2O8XA 3EYYA 5E8IA 1F1ZA 1FSEA 2PN6A 1ZG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IP2 A;  2PEX A;  2JPB A;  1ZN2 A;  5LLQ A;  1WRJ A;  1YQA A;  2CG4 A;  1XSX A;  5DDG A;  2XUB A;  4MTE A;  4BYY A;  2FSW A;  4CIC A;  3FXU A;  1JE8 A;  1LVA A;  4G8X A;  2QQ9 A;  3I58 A;  2KIF A;  1I27 A;  2ZO4 A;  2K4J A;  5JVT A;  1GVJ A;  3H3Z A;  4BQA A;  1XGO A;  4M6Y A;  4MGR A;  2HTS A;  2R7F A;  2VBY A;  1XMA A;  2L3D A;  2CGP A;  4KFC A;  4A0X A;  2Q8K A;  2IA0 A;  3BJ6 A;  4WX9 A;  1W5T A;  4EGZ A;  4UXN A;  3IKV A;  3BP8 A;  2PQ8 A;  3T5X A;  3DFG A;  4HX4 A;  3SQN A;  1EH8 A;  1KA8 A;  3GLX A;  3HTS B;  5LGU A;  3FHZ A;  1BBY A;  1REP C;  2EV0 A;  1XGS A;  4HOB A;  2E7X A;  5H20 A;  1TQM A;  2XRO A;  1X3U A;  3HYI A;  1MJA A;  2UXN A;  3WTU C;  2FNP A;  2W84 A;  3L00 A;  3V7R A;  2O0Y A;  4RB0 A;  2LF8 A;  4D0P A;  3AAF A;  1FPQ A;  1K79 A;  3HUG A;  3RTR A;  3F23 A;  4UV8 A;  4HF0 A;  2ZME A;  2QUF A;  4LMY A;  1S7O A;  4YFN F;  2HOE A;  3DKW A;  1ODD A;  1Q1H A;  4MHG A;  5D5U B;  2FML A;  2R7D A;  4G7H F;  1HW5 A;  2YSR A;  1WKM A;  2ZNZ A;  2X4H A;  2EFP A;  1JXS A;  2Y75 A;  4N9I A;  4ENK A;  4A6E A;  1SD7 A;  4ENN A;  4XSZ F;  2E1N A;  5EEG A;  2D1V A;  3WE3 A;  4G9Y A;  3NRV A;  4M6X A;  3W6K B;  4MEX F;  1GHC A;  3IHU A;  2YU3 A;  4XLP F;  4XSX F;  3P7N A;  1U2W A;  4PCQ A;  3KFW X;  4I02 A;  4ZYE A;  2UZK A;  3LA2 A;  1HKQ A;  2AS5 F;  1VTN C;  2IPQ X;  2FQ3 A;  2LDU A;  1HSJ A;  3TOA A;  4MQ9 F;  1UST A;  1D8J A;  5CVV A;  5D8K B;  3WGI A;  3IWF A;  1O7L A;  4Z2Y A;  3DV8 A;  1D3Y A;  2QM3 A;  3F8B A;  3J80 Z;  4PZJ A;  3TO9 A;  3FMR A;  3K69 A;  4RB2 C;  3ULQ B;  3V8K A;  3SZT A;  3JSP A;  4N9H A;  4LD5 A;  3U9G A;  1YW7 A;  2M45 A;  2QEN A;  5H6R A;  4A5N A;  3DEU A;  2HEO A;  4EQQ A;  2K86 A;  1ULY A;  4I7H A;  5D5X B;  2P6T A;  4M9X A;  2O61 A;  1OMI A;  2W24 A;  1WQ2 A;  1J5Y A;  4FT8 A;  2FRH A;  5HVQ C;  3KLN A;  2ZNY A;  4AIH A;  2W57 A;  3I71 A;  1YW8 A;  2LF7 A;  4YFK F;  2PLY A;  4Q5S F;  2BBY A;  3DXJ F;  2NS0 A;  1IN6 A;  5LHH A;  2A3S A;  5IT3 A;  4G7Z F;  3KET A;  3P9I A;  1R5G A;  4H0E A;  1USS A;  2XIG A;  4B8X A;  4OOI A;  4ASN A;  3R0A A;  5D5W B;  1FP2 A;  1QBJ A;  2YPR A;  5LEK A;  2LNB A;  2FOK A;  2XAH A;  3T1B A;  2OZ6 A;  2EJR A;  2QQB A;  2RDP A;  5HDG A;  1XMK A;  2CSO A;  3E5X A;  3MFK A;  1TNS A;  2BEO A;  2HS5 A;  3E6M A;  3ZMU A;  2EV6 A;  2PMU A;  4M9S A;  5DCF A;  1P4W A;  3ML6 A;  4L0Z B;  5HS8 A;  4G6D A;  4RAZ A;  5TJJ A;  1R22 A;  1QGP A;  2L02 A;  1K7A A;  3KZZ A;  1RI7 A;  3GF2 A;  4RS8 A;  2P7V B;  5E17 F;  5DCM B;  5D8L B;  3L09 A;  4IPA A;  3TGN A;  3IL2 A;  2JTV A;  2PMH A;  1CF7 A;  4R79 A;  4LK1 F;  2A5Y B;  1P2F A;  3CO7 C;  1BI3 A;  4P5O A;  1STZ A;  2F2E A;  2ZFW A;  1ZH5 A;  3C3W A;  2KJC A;  2H27 A;  1L0O C;  4WK8 F;  3F22 A;  5KK1 A;  4L5I A;  4M73 A;  5AON A;  4EJW A;  2FU4 A;  2K7L A;  2VE8 A;  5E8G A;  3JTG A;  2QZ8 A;  4HF1 A;  3RKW A;  5EEH A;  3V7S A;  2MH9 A;  2NRA C;  4ZH4 F;  4K2E A;  2KKO A;  3J80 K;  1OR7 A;  2PFB A;  1S7A A;  5HDK A;  2OU2 A;  4JK1 X;  2XAS A;  2L4M A;  1B59 A;  2Y48 A;  5H6Q A;  3FMQ A;  4FHT A;  3MQ0 A;  4MEY F;  4AIK A;  4I0A A;  4EJO A;  2EFO A;  3COA C;  4HX8 A;  2FXA A;  2E7W A;  4UHT A;  4U0W A;  2HR3 A;  2HDC A;  4WF2 A;  3HSE A;  2XAQ A;  1MZB A;  3F8F A;  4HW0 A;  1BJA A;  5F64 A;  4PGG A;  4EM1 A;  4I09 A;  2Y0M A;  5K5Q A;  5E1W A;  1RUN A;  4U88 A;  1Z7U A;  4LFU A;  3KE2 A;  5FFX A;  2STT A;  3BPX A;  3HRS A;  4KT5 C;  1FT9 A;  2M30 A;  3H92 A;  1SFU A;  2ZKZ A;  3BWG A;  2X0L A;  4AIJ A;  2KJB A;  4BHC A;  2IA1 A;  4OIO F;  1U5T A;  1I1G A;  3WTZ A;  4LG0 B;  3V8L A;  3PQK A;  5HLI A;  2IVM A;  5LEJ A;  3WU1 B;  4GO1 A;  1TW3 A;  3IWZ A;  4AVP A;  1C0W A;  3QAH A;  2O3F A;  1LJ9 A;  1YS6 A;  4Y17 A;  2AXL A;  1FY7 A;  1BC7 C;  3KP2 A;  1KQ0 A;  5L3F A;  4HZF A;  4QWQ A;  4BXU A;  2VT3 A;  5DYM A;  2PG4 A;  4HLX A;  1T6S A;  1ZYR F;  2XAF A;  3EUH A;  2MH2 A;  4KUM A;  1TTY A;  1XSV A;  2ZBK A;  3DQV C;  2HTJ A;  5BMZ A;  4YFX F;  3HHH A;  3K1N A;  5FFZ A;  3RPQ A;  3LST A;  4GCV A;  5J8F A;  1KU3 A;  2KRF A;  1H9T A;  2H09 A;  2Q0O A;  2RQP A;  5CVR A;  1KYW A;  1FYK A;  2DPD A;  1I6X A;  3FZV A;  1KU2 A;  1KU7 A;  4XLN F;  2DQL A;  2YX7 A;  3T0Y A;  5JFR A;  1FC3 A;  1TQP A;  4JBA A;  2P7C B;  4AWX B;  3JAM Z;  4ZYH A;  2DQR A;  3WGG A;  3B73 A;  3HHG A;  4HQM A;  3EYI A;  5AIQ A;  4JQF A;  1HQC A;  1MJ9 A;  3ABT A;  2JT1 A;  4CYD A;  4WWC A;  5LRS A;  1JHH A;  1KU9 A;  3HRT A;  3N4M A;  4CHU A;  4UVB A;  3F3X A;  3TOB A;  2FA5 A;  2HKO A;  1KQ9 A;  1O3S A;  2C6Y A;  1R7J A;  3LA3 A;  1IN4 A;  4ENJ A;  3LQQ A;  1ZLK A;  1QPM A;  3ZMV A;  1PP7 U;  4S04 A;  1DDN A;  3SFZ A;  2G7H A;  3GYH X;  1AOY A;  3BOQ A;  2B0L A;  3ZN1 A;  4YII A;  4BAY A;  1KQ8 A;  2WWY A;  3QRF F;  1O3R A;  1P6R A;  1IF1 A;  3FWE A;  1ZRD A;  3GEZ A;  2BV6 A;  3L7W A;  4HAM A;  5CYV A;  4HLY A;  3F6O A;  1B6A A;  1GXQ A;  3OV8 A;  2A68 F;  1XGN A;  2Z33 A;  3U1D A;  2V79 A;  2ZME B;  5ICF A;  2IA2 A;  1ONV A;  3O2P E;  1I1S A;  3G3Z A;  1T38 A;  4L9V A;  1ZG3 A;  1LDK B;  4OIP F;  4M72 A;  4E70 A;  1K78 A;  3FXR A;  3B02 A;  1R1U A;  6PAX A;  1UHW A;  5CVU A;  1WSU A;  1LQ1 A;  4GYG A;  3E6D A;  4S05 A;  3M9A A;  4O5V A;  4YG2 F;  1WI9 A;  3GZ5 A;  3DF8 A;  3LWF A;  3RKX A;  1Z9C A;  1ON1 A;  3KP5 A;  1SD5 A;  3VFZ A;  1SMY F;  2MLK A;  2FF4 A;  4OIQ F;  5DD8 A;  1MDM A;  3KP3 A;  3LA7 A;  2Z3Y A;  1XCB A;  2RGV A;  5LGN A;  4TV7 A;  1EH7 A;  1D8K A;  4ENM A;  1IZ1 A;  3DPT A;  1BM9 A;  4I01 A;  2QBY A;  4GYI A;  3HTU A;  4IHS A;  1S29 A;  5K1Y A;  3CUQ C;  2VON A;  1J7K A;  3NEU A;  5AIP A;  4O3M A;  4A0Z A;  5FD6 A;  1I5Z A;  5A2Q K;  2D1H A;  2W25 A;  2YX4 A;  2GXB A;  4L9T A;  2V1X A;  3RDI A;  4Y15 A;  2DFI A;  2DTR A;  2LSO A;  5LHG A;  2G7U A;  2OA4 A;  3JAM K;  2JZY A;  1ZAR A;  4EJV A;  2RNJ A;  1U5T C;  2DI3 A;  5HOO A;  1DPR A;  3HRM A;  4DNC A;  3E97 A;  2XKO A;  1TLH B;  3R60 A;  3I53 A;  1F4K A;  4IHT A;  1LEB A;  4ZYG A;  3KEQ A;  3JTH A;  3IC7 A;  2G9W A;  1U8R A;  3RYR A;  1UB9 A;  2WV0 A;  3LQR A;  3GZ6 A;  3ECO A;  3M7G A;  1OYY A;  1UHM A;  5LHI A;  4GGG A;  3DP7 A;  5DV5 A;  5CVJ A;  2MC3 A;  2J5O A;  1YO5 C;  4KMF A;  5IT9 Z;  3WU0 A;  3R0J A;  4LB5 A;  2VBZ A;  4G6Q A;  4DQ2 A;  2IJL A;  4IF4 A;  4OIN F;  1T39 A;  1BI2 A;  3FXQ A;  5HLG A;  3GXO A;  4UNO A;  4EM0 B;  3L9F A;  1IRG A;  1RIO H;  4KIC A;  3TO6 A;  5ICG A;  1J59 A;  5ILS A;  1R5H A;  4IVN A;  4RB3 C;  4EVI A;  4KIF A;  2FBI A;  3DPL C;  2ISY A;  1G4D A;  4RB1 A;  3GFI A;  3LAJ A;  4HV6 A;  1CF7 B;  3BZ6 A;  2HWV A;  3QOP A;  2NNY A;  1J9I A;  5BPD A;  3MAJ A;  1G3S A;  4WXH A;  4HA8 A;  2ZCW A;  2OAZ A;  2DBB A;  2J5P A;  3GFM A;  4HX7 A;  4BHB A;  1YYV A;  1V3F A;  3TQN A;  3E6C C;  2GA2 A;  1W7P B;  1HW2 A;  2CWE A;  2FE3 A;  4AD9 A;  1ZGA A;  2GQQ A;  2A6H F;  1UCR A;  4P96 A;  1XN7 A;  4UUV A;  4CO8 A;  4OMZ A;  1YLF A;  3O3K A;  4EV0 A;  1Z91 A;  3BDD A;  3MEX A;  3GUD A;  3WTV C;  3I64 A;  1BIA A;  1P92 A;  3I0T A;  1WWX A;  2VOO A;  2QQA A;  3P9C A;  4KN4 X;  4UV9 A;  3J7A O;  2P4W A;  4RGU A;  3L2C A;  1O3T A;  2P6S A;  2W85 A;  2A61 A;  3Q9V A;  5E1Z B;  4CXF A;  5DEQ A;  3I59 B;  3BJA A;  2COM A;  4KYW A;  5DCM A;  1LDD A;  2D2W A;  2VXZ A;  1TW2 A;  1IXC A;  5DUI A;  3R6S A;  1R36 A;  2QLZ A;  3ZMD A;  2IRF G;  1QO0 D;  2DLL A;  2YR2 A;  3EQL F;  3J81 Z;  2FBH A;  2GA1 A;  2QWW A;  1HKS A;  3D0S A;  1A04 A;  2OZU A;  5HS9 A;  4LB6 B;  2F5F A;  2EB7 A;  1FSH A;  1K6O A;  2STW A;  2H6B A;  2BGC A;  3RYP A;  2O6G E;  3VOD A;  4U0V A;  3ZN0 A;  4EGY A;  2OQR A;  3G73 A;  3C18 A;  5IT9 K;  1TBX A;  3RPU A;  1ZGJ A;  1BN5 A;  5D6E A;  5HDN A;  1FYL A;  1SFE A;  3QPT A;  5K5R A;  1G3W A;  4WXC A;  2VT2 A;  3CO6 C;  4A2U A;  3GFL A;  2Z5U A;  4ZYD A;  5J6X A;  5K5O A;  3EDP A;  1HW1 A;  4I98 B;  3CUQ A;  1E17 A;  3EET A;  4KDP A;  1FP1 D;  3FX3 A;  2RVC A;  2UWM A;  2HKX A;  3KEO A;  3ZP5 A;  4CZZ A;  5FLX Z;  2CYY A;  5ICE A;  5JHU A;  3RKY A;  4NHJ A;  5CVI A;  5F1R A;  2Q2E A;  2MD5 A;  2RV8 A;  4BH9 A;  3C1D A;  2P5L C;  3S2W A;  3PFI A;  4IRI A;  5LRR A;  4U7D A;  1B9M A;  1BOA A;  1Z6R A;  3WTW C;  1U3E M;  2LKP A;  2VBW A;  4OIR F;  1IXR C;  1XDS A;  3I5U A;  3BPV A;  2VC0 A;  3GWZ A;  3ECH A;  1IW7 F;  3RIR A;  2QVO A;  2XAJ A;  3I54 A;  2WTE A;  1EV7 A;  4RGX A;  3TO7 A;  1IN7 A;  3IRR A;  2NNN A;  4ZZL A;  4MQV A;  2JRT A;  4HF2 A;  5D4S A;  4KIB A;  1HXD A;  3MWM A;  1YFH A;  1HST A;  1MGT A;  4LG0 A;  3WTS C;  3ERE D;  5FO5 A;  4M9Z A;  2CW0 F;  1T2K A;  3K2Z A;  3HIF A;  3ZMS A;  1JHF A;  2PJP A;  5FB2 A;  1W4M A;  3ZMZ A;  4UVC A;  2HQR A;  2F5D A;  1V4R A;  3V7C A;  1R1V A;  2RC4 A;  2DPU A;  3W6J B;  2P5K A;  4LK0 F;  1FWZ A;  1B4A A;  3GFJ A;  5DD4 A;  2A07 F;  1MKM A;  2A6E F;  4QLC U;  2CO5 A;  2EFN A;  3ZQ7 A;  3J81 K;  3F6V A;  1JGS A;  3VOE A;  3LFK A;  3GW2 A;  3FF5 A;  1ZRF A;  2RKH A;  1YS7 A;  1XSD A;  2IT0 A;  3ZMT A;  3H3U A;  1Y0U A;  1YTY A;  2ADU A;  4EM2 A;  1RNL A;  5CJ9 A;  3F8C A;  1QZY A;  1BI0 A;  1KYZ A;  1QNT A;  2XRN A;  3PQJ A;  2HYF A;  1BIB A;  5L3C A;  2DK8 A;  5J8C A;  2P5V A;  3GX4 X;  4M74 A;  3Q9S A;  2OD5 A;  5JI6 A;  1K78 B;  2K02 A;  2DT5 A;  3U2R A;  2ZXJ A;  5HLH A;  3P9K A;  4P55 A;  2MLG A;  1SAX A;  5TRD A;  3KP4 A;  4FX4 A;  1IRF A;  5L3B A;  1FBS A;  4ON0 A;  5FLX K;  1FOK A;  1J2X A;  3LAP A;  3F21 A;  4BHP A;  1MDM B;  1CGP A;  2D45 A;  1EH6 A;  1W7P D;  4ZZD A;  2XVC A;  1KGS A;  1OYI A;  1LDJ A;  3NQO A;  2F5E A;  1U78 A;  3WOD F;  1J0R A;  3M8F A;  4L18 B;  2XGX A;  4LLN A;  2QBY B;  5BPI A;  3T8R A;  3MCZ A;  2FMY A;  4P9F A;  1P4X A;  2KIM A;  3R4K A;  2FNA A;  1U6G A;  2RN7 A;  2PI0 A;  3TDZ C;  3GVA A;  2NYX A;  1MD0 A;  2GWR A;  4MNU A;  1DPU A;  2HGC A;  2VOD A;  1IAW A;  4HQE A;  4HV5 A;  2PBI A;  3CLO A;  1OYW A;  2K4B A;  2ESH A;  4NB5 A;  2OBP A;  1BC8 C;  5E18 F;  1Z6T A;  5HS7 A;  4KMU X;  1RZ4 A;  1F9N A;  2NAZ A;  1TNT A;  1AWC A;  2XAG A;  4A12 A;  4KIG A;  3E6B A;  2VE9 A;  2FBK A;  4ETS A;  3FM5 A;  4RAY A;  1XD7 A;  4MTD A;  3F72 A;  5FGM A;  1J75 A;  1ON2 A;  4Q4Z F;  4XBF A;  2OQG A;  3QU3 A;  3ROU A;  1SD4 A;  2XKP A;  3CDH A;  1GXP A;  1NHA A;  3Q5F A;  4KNY A;  4L9N A;  4EJT A;  3HSR A;  4PDK A;  2VOP A;  1YW9 A;  1FYM A;  3C7J A;  4R1H A;  4U0Y A;  1PDN C;  4R8H A;  2GZW A;  3TDU C;  3SZP A;  5L3E A;  1IN5 A;  2DAO A;  2EA4 A;  3JSO A;  2ESN A;  2V9V A;  5LBQ A;  1SD6 A;  3SHF A;  5BS6 A;  1B1B A;  2V6C A;  4OU0 A;  2EWN A;  2EFW A;  5ICC A;  1PP8 F;  1FNN A;  3HRU A;  5F6F A;  1L3L A;  3ISP A;  3FMS A;  4A5M A;  1FBQ A;  1HKT A;  4CDG A;  1O3Q A;  3F8N A;  3K1M A;  1R58 A;  1TQI A;  3O6B B;  2EV5 A;  4HDV A;  3REO A;  2F5C A;  4ESJ A;  3IRQ A;  3V4G A;  2MA3 A;  4WXD A;  4ESB A;  3HOS A;  1XDU A;  5ED4 A;  4G94 A;  1ZAO A;  2QYO A;  3OOP A;  3RI4 A;  4FX0 A;  3JW4 A;  1D5V A;  4YIF A;  3BY6 A;  3E3V A;  1G6N A;  1ZLJ A;  2XHK A;  4IXA A;  5DUK A;  3KCC A;  2EA2 A;  1ZRE A;  1ZRC A;  2JSC A;  3WTY C;  3ABU A;  5JR3 A;  3MZY A;  2ELH A;  1BI1 A;  2CFX A;  3MZH A;  3M8E A;  4RGR A;  4L5J A;  4HDU A;  1P4A A;  2WC2 A;  1DUX C;  2GIV A;  2M87 A;  3IKT A;  1FX7 A;  5ERI A;  1W5S A;  1B9N A;  1R00 A;  3N97 A;  1IXS B;  3VB2 A;  2GAU A;  4ESF A;  3GO5 A;  1ZG5 A;  1QZZ A;  4IRG A;  3KP7 A;  4EMS A;  4HYE A;  2VC1 A;  2HZT A;  2FEZ A;  5FD5 A;  2O03 A;  3ELK A;  2BYV E;  4LLL A;  4I0B A;  4P9U A;  4L9J A;  1O7F A;  1W7P A;  3WG9 A;  3F8M A;  1XCV A;  3QP6 A;  5E1X A;  4HBL A;  2HYG D;  1S8N A;  4WCG A;  5ILU A;  1XGM A;  1S3J A;  1O57 A;  5E20 A;  3CUQ B;  4OMY A;  4I2O A;  2CQK A;  2V1D A;  5D5V B;  3E5Q A;  4LLG F;  4KN7 X;  2HFH A;  2DK5 A;  5D6F A;  1R1T A;  1S6L A;  3BRO A;  4B09 A;  1UFM A;  1FBU A;  3ZPL A;  1U5T B;  3TKY A;  1T98 A;  3FM3 A;  4Y13 A;  2H94 A;  4U7B A;  2DW4 A;  4CGZ A;  1RUO A;  1LEA A;  2R3S A;  2DO7 A;  3I59 A;  3KLO A;  1G3T A;  4M71 A;  1Z1D A;  4F7Z A;  2IW5 A;  3BJO A;  2XV4 S;  3KP6 A;  4IJA A;  1OPC A;  2EK5 A;  1MJB A;  2A69 F;  3K9T A;  2KIU A;  3WE2 A;  4Q47 A;  1FZP B;  2Z99 A;  3QPH A;  3I4P A;  1YIO A;  2BE5 F;  2MBF A;  2ETH A;  5LGT A;  2M8E A;  3KZY A;  2P8T A;  2H6C A;  2ISZ A;  2HQN A;  4RGS A;  3CJN A;  5KVR A;  1H9G A;  2L54 A;  5BQT A;  5CLS A;  3VEP A;  4A0Y A;  3R61 A;  2E1C A;  3QP5 A;  5L3D A;  4Q48 A;  1HBX G;  1H0M A;  1Z05 A;  3RJP A;  2L01 A;  3D5L A;  2ACJ A;  4GXO A;  2JPC A;  1G3Y A;  1T0F A;  4EJU A;  4UVA A;  3QU6 A;  2M1B A;  3WGH A;  1E2X A;  4L0Y B;  2V1U A;  5BOX A;  4BNC A;  4G7O F;  3WTX C;  1IUY A;  2ZJ2 A;  2DU9 A;  3WTT C;  1YG2 A;  4A6D A;  1DP7 P;  1SMT A;  2EFQ A;  3CUO A;  4PGH A;  2VBX A;  3K0L A;  1PUE E;  3M1E A;  4NQW A;  1FLI A;  2UXX A;  1OKR A;  3K1P A;  1LNW A;  2Z9O A;  3HOT A;  3HSF A;  1F5T A;  2L4A A;  4KA4 A;  1SFX A;  1QQI A;  3E5U A;  5L3G A;  5A2Q Z;  2TDX A;  4XRF A;  1IN8 A;  1ZHF A;  4IRH A;  1LB2 A;  1R23 A;  5ILV A;  3V8J A;  5D4R A;  2GXG A;  2K27 A;  4O6J A;  3SXY A;  3T8T A;  1XB4 A;  2M5W A;  4N0B A;  4LJZ F;  2VN2 A;  4LGW A;  3CTA A;  2O8X A;  3EYY A;  5E8I A;  1F1Z A;  1FSE A;  2PN6 A;  1ZG1 A; 
#chains in the Genus database with same CATH topology
 1OQY A;  2IP2 A;  2PEX A;  2JPB A;  4PJJ A;  3X2Q H;  4C2U A;  1ZN2 A;  2VIX A;  1WRJ A;  3FHN A;  5LLQ A;  1YQA A;  4A69 C;  3BG3 A;  2CG4 A;  1XSX A;  5DDG A;  2E5N A;  2XUB A;  4MTE A;  4BYY A;  1JUM A;  2QSF X;  3DPU A;  5EZH A;  3BR0 A;  1OCR H;  2FSW A;  3AFH A;  4XR6 A;  1SVO A;  4DOZ A;  4BQO A;  4CIC A;  4XIC A;  3FXU A;  3PNT A;  1JE8 A;  1LVA A;  4G8X A;  3CDL A;  2QQ9 A;  2W7N A;  3I58 A;  2KIF A;  1I27 A;  2ZO4 A;  3PUB A;  4CCK A;  5EG0 A;  2K4J A;  3TP3 A;  5JVT A;  1WVR A;  3S32 A;  1B72 B;  4BJ5 C;  1MNE A;  1GVJ A;  1BJZ A;  2W82 A;  1R9T J;  3H3Z A;  1HOM A;  4BQA A;  2NVT J;  1XGO A;  1D0X A;  4M6Y A;  1N75 A;  4YEL A;  4MGR A;  2CMP A;  2KRC A;  2HTS A;  2R7F A;  3L2W A;  2VBY A;  1XMA A;  2L3D A;  1VQK I;  5EGO B;  4BE2 A;  2OTJ I;  2CGP A;  4KFC A;  2LLK A;  1I3Q J;  3ZQQ A;  2DA3 A;  3AG4 H;  4FE7 A;  4A0X A;  2Q8K A;  2IA0 A;  3ASN H;  3BJ6 A;  2D5V A;  1GLN A;  3K4B A;  1W5T A;  4WX9 A;  4EGZ A;  5FLM J;  1SFO J;  1Y0N A;  4UXN A;  3IKV A;  3BP8 A;  2BY3 A;  2M0C A;  2PQ8 A;  3T5X A;  2M8G X;  2DDA A;  3GZN B;  1V55 H;  3DFG A;  1VND A;  4HX4 A;  3SQN A;  1EH8 A;  3CCR I;  1KA8 A;  3GLX A;  3HTS B;  5LGU A;  3FHZ A;  1BBY A;  1REP C;  2EBI A;  2EV0 A;  4ITV A;  1XGS A;  4RA2 A;  3BZC A;  4HOB A;  5B1B H;  2E7X A;  5H20 A;  1TQM A;  1H88 C;  2EIN H;  5HNH A;  2ZJP F;  2XRO A;  1X3U A;  3HYI A;  1MJA A;  2UXN A;  2DA6 A;  2GOM A;  3WTU C;  2FNP A;  2W84 A;  1SAU A;  3L00 A;  3V7R A;  2O0Y A;  1WZ2 A;  3NAR A;  4RB0 A;  2JA8 J;  2LF8 A;  1X19 A;  5K7Z A;  5C3E J;  1FMV A;  4D0P A;  3AAF A;  1FPQ A;  3IH3 A;  4AM3 A;  1K79 A;  1N25 A;  4UUT A;  3HUG A;  1HDD C;  3OYH A;  1Z21 A;  4EAT A;  5BNG A;  3RTR A;  4GRI A;  3W2V A;  4S0H B;  3F23 A;  4UV8 A;  2RQQ A;  4HF0 A;  2ZME A;  2QUF A;  4LMY A;  5GAD J;  1S7O A;  4YFN F;  2LTP A;  2MW8 A;  2HOE A;  3DKW A;  1ODD A;  1Q1H A;  4MHG A;  5D5U B;  3RZD J;  2FML A;  3LNQ A;  2R7D A;  4G7H F;  2FX0 A;  1HW5 A;  2YSR A;  1WKM A;  1R5I D;  1MBE A;  2IGN A;  2ZNZ A;  3OYG A;  2E1M C;  3OYI A;  2X4H A;  2EFP A;  3S1R J;  1JXS A;  2Y75 A;  4N9I A;  3SEQ A;  4A3I J;  1Z3Y A;  2QF7 A;  3L2V A;  4ENK A;  4A6E A;  2X6O A;  1SD7 A;  5KCM A;  1J09 A;  2DTZ A;  4ENN A;  4XSZ F;  2E1N A;  1RR7 A;  2XSJ C;  2BY0 A;  3FBI B;  2D1V A;  5EEG A;  3WE3 A;  4G9Y A;  3NRV A;  3BR1 A;  2Y31 A;  4M6X A;  4F3Q A;  2L7Z A;  2ZJR F;  5JLW A;  3DU5 A;  3W6K B;  4B1R A;  4PFO A;  4MEX F;  1GHC A;  2VKV A;  3HM5 A;  2YU3 A;  3IHU A;  4XLP F;  2VKH A;  1VQ8 I;  4XLF A;  3N05 A;  4XSX F;  4E7J A;  2DA2 A;  3P7N A;  1Q1V A;  3CQZ J;  1U2W A;  4PCQ A;  3KFW X;  2LC2 A;  4I02 A;  4ZYE A;  1Z3X A;  3LA2 A;  2UZK A;  5CKT A;  1HKQ A;  2AS5 F;  1VTN C;  2IPQ X;  4BAC A;  4II2 A;  3FXK A;  2FQ3 A;  1I50 J;  2LDU A;  1HSJ A;  2E2H J;  2XRL A;  1DU6 A;  3TOA A;  4MQ9 F;  1UST A;  1D8J A;  1WJB A;  5CVV A;  5F08 A;  5D8K B;  3WGI A;  3IWF A;  3J7Y J;  1LFU P;  1O7L A;  4Z2Y A;  4A3E J;  2AQF A;  3B6A A;  2CUJ A;  1OCC H;  3DV8 A;  1D3Y A;  3SZG A;  3CCJ I;  5J1R A;  4F91 B;  2QM3 A;  3F8B A;  3S3O A;  3J80 Z;  4PZJ A;  5J4Y A;  1JKR C;  3TO9 A;  3FMR A;  3K69 A;  4XLC A;  3OS1 A;  1R49 A;  4BJ6 C;  4RB2 C;  3H5A A;  3ULQ B;  3V8K A;  1ETY A;  3SZT A;  2DA4 A;  3DBR B;  1JJ6 C;  3CCL I;  3JSP A;  3BCA A;  3QYF A;  4N9H A;  4BL0 B;  5J4V A;  3OSF A;  3VWB A;  1AKH B;  1VQ5 I;  1T0F C;  4LD5 A;  2BW3 B;  1LPQ A;  3U9G A;  1YW7 A;  2M45 A;  2QEN A;  5H6R A;  4G12 A;  3FK7 A;  4A5N A;  3DEU A;  5E3O A;  3A4C A;  2HEO A;  4HRI A;  4EQQ A;  1K4S A;  3L2R A;  2K86 A;  3HPH A;  1PVE A;  3LL7 A;  1ULY A;  4I7H A;  2B9S A;  5D5X B;  4LIT A;  4V2F A;  2P6T A;  4M9X A;  2O61 A;  4XKC A;  1OMI A;  2W24 A;  1WQ2 A;  2GOX B;  1J5Y A;  4FT8 A;  4IHY A;  2DOF A;  2VJ4 A;  2FRH A;  3C2B A;  5HVQ C;  1TZL A;  3KLN A;  2ZNY A;  4AIH A;  2LBF A;  2W57 A;  1YHQ I;  3I71 A;  1YW8 A;  2LF7 A;  2ICW G;  4YFK F;  2PLY A;  3EUH C;  4Q5S F;  2BBY A;  3DXJ F;  3G1O A;  3H5R A;  4RLQ A;  4DYQ A;  2NS0 A;  2EZL A;  1IN6 A;  4X6A J;  1VQO I;  5LHH A;  4PSX A;  4CCN A;  4J19 A;  2XB0 X;  3CJR B;  1GUU A;  2A3S A;  2LKS A;  5IT3 A;  4G7Z F;  3SJM A;  2V7F A;  3DTI A;  1MND A;  3KET A;  3P9I A;  3HKZ A;  4HNV A;  5FKL A;  1A5J A;  1R5G A;  5M5W J;  3CCE I;  1FOW A;  3C2G A;  2QSG X;  4H0E A;  3WHC A;  1JGG A;  1BOB A;  1UG2 A;  3WG7 H;  1USS A;  2XIG A;  4B8X A;  4OOI A;  4ASN A;  3R0A A;  5D5W B;  1FP2 A;  1QBJ A;  2YPR A;  3Q0W A;  3HKZ N;  5LEK A;  2LNB A;  2FOK A;  2XAH A;  1ETK A;  2VPL A;  3T1B A;  1P7I A;  3MZ8 A;  2OZ6 A;  2EJR A;  1MW7 A;  2MFZ A;  2QQB A;  2RDP A;  5HDG A;  5CQE A;  1XMK A;  2CSO A;  4XN0 A;  3A1Y A;  3OYN A;  1UAA A;  3E5X A;  2FUG 2;  3MFK A;  1TNS A;  2BEO A;  2HS5 A;  3E6M A;  2LMD A;  3KX2 A;  1WJF A;  3ZMU A;  2EV6 A;  2PMU A;  4M9S A;  5DCF A;  2JSP A;  1T08 B;  4XK4 A;  1Z7L A;  3ABM H;  3DLA A;  2IS6 A;  1P4W A;  3ML6 A;  4L0Z B;  1E0E A;  5HS8 A;  2DYS H;  2CQX A;  2VJJ A;  4G6D A;  4RAZ A;  5KAI C;  5TJJ A;  1R22 A;  1QGP A;  5FRM A;  1GVD A;  1QU3 A;  2EIM H;  4B4C A;  1OCT C;  1WHU A;  3JRA A;  3CCU I;  2L02 A;  1K7A A;  4KIS A;  1D1A A;  2Y69 H;  2E19 A;  2E1O A;  3KZZ A;  2F48 A;  1RI7 A;  3GF2 A;  4RS8 A;  2P7V B;  5E17 F;  3K10 A;  5DCM B;  5D8L B;  3K7A J;  2QQ8 A;  3L09 A;  5IOY A;  3GTP J;  2MD0 A;  4C30 A;  4BE0 A;  4IPA A;  1MH4 A;  2HQA A;  3TGN A;  4J01 A;  3TW6 A;  3IL2 A;  4LG3 A;  1U8B A;  2JTV A;  1DGR M;  1QHG A;  2PMH A;  1DGW Y;  1CF7 A;  4R79 A;  4LK1 F;  1YX5 A;  2HXI A;  2A5Y B;  1P2F A;  5TGT A;  3CO7 C;  1TT0 A;  1BI3 A;  3OR1 C;  3G6E I;  4P5O A;  1STZ A;  3I9V 2;  4XID A;  3QPL A;  2F2E A;  2ZFW A;  2F6C A;  1ZH5 A;  3C3W A;  2KJC A;  2H27 A;  1L0O C;  5F0C A;  4WK8 F;  3F22 A;  2BHZ A;  5KK1 A;  5DM7 F;  4L5I A;  3H5N A;  4M73 A;  5AON A;  4EJW A;  2FU4 A;  2K7L A;  3V42 A;  3AG3 H;  3HOW J;  4IO9 F;  4QPO A;  4PUS A;  3KYL A;  2VE8 A;  5E8G A;  3SDB A;  5B5E C;  3JTG A;  2AO9 A;  2QZ8 A;  2VQL A;  4HF1 A;  1FTZ A;  3RKW A;  2AHQ A;  5EEH A;  3V7S A;  2MH9 A;  3I56 I;  2UUZ A;  2NRA C;  2EQR A;  3LOC A;  4ZH4 F;  3DEE A;  1IJW C;  2DMQ A;  3EUK L;  4K2E A;  4NNJ A;  3FXO A;  2KKO A;  3J80 K;  2X6X A;  2DA1 A;  1OR7 A;  2PFB A;  3EPZ A;  1SC7 A;  3JRF A;  3HG9 A;  1S7A A;  5M3M J;  2XF5 A;  1V5E A;  4UB8 C;  2P0W A;  5HDK A;  2OU2 A;  4JK1 X;  2XAS A;  2L4M A;  1TWH J;  1B59 A;  2Y48 A;  3SDG A;  4ZJZ A;  4IQ4 A;  5H6Q A;  3FMQ A;  4FHT A;  3MQ0 A;  1H89 C;  2CV0 A;  4BE1 A;  4V19 K;  3H9G A;  4MEY F;  2Z2S B;  3G4S I;  4AIK A;  3HC7 A;  4I0A A;  4EJO A;  2CS3 A;  2EFO A;  3COA C;  4HX8 A;  4X0G A;  2DJI A;  4FTH A;  2FXA A;  5IP7 J;  2E7W A;  4UHT A;  4U0W A;  2HR3 A;  3FIS A;  2KZG A;  2DJN A;  2HDC A;  1IRX A;  3TP0 A;  4BBR J;  2CQN A;  1H8A C;  1K4T A;  4BEH B;  4WF2 A;  3HSE A;  2XAQ A;  1MZB A;  3F8F A;  4HW0 A;  4JX6 A;  1BJA A;  1QVT A;  5F64 A;  3CMY A;  4PGG A;  4EM1 A;  2HU9 A;  4I09 A;  4OAY A;  3SFI A;  4YIR X;  2Y0M A;  5K5Q A;  2R5Z A;  5E1W A;  4DJA A;  1RUN A;  4U88 A;  2BOL A;  3A03 A;  1Z7U A;  4LFU A;  3KE2 A;  3ZR8 X;  4Y4R A;  5FFX A;  4E7K A;  2VQC A;  2STT A;  5GAG J;  3BPX A;  3HRS A;  2LY9 A;  4KT5 C;  1FT9 A;  2PJR B;  2M30 A;  3H92 A;  1MMA A;  1T95 A;  1SFU A;  2ZKZ A;  3BWG A;  5DM6 F;  2X0L A;  2L9V A;  1V5F A;  4D1Q A;  4AIJ A;  3O8H A;  4M6V A;  3A2K A;  2Y9Y A;  4XMY A;  2QEX I;  4DYR A;  2KJB A;  5B1A H;  4BHC A;  2IA1 A;  5F04 A;  4OIO F;  1U5T A;  1I1G A;  2L7F P;  3WTZ A;  1YE9 A;  1B8I B;  1X2M A;  3HGY A;  5HLI A;  3PQK A;  2A5W A;  3V8L A;  2IVM A;  4LG0 B;  2DCE A;  1WI3 A;  5LEJ A;  3WU1 B;  1APL C;  3K70 D;  2XB5 A;  3DU6 A;  4BDZ A;  4GO1 A;  1TW3 A;  3S16 J;  2DFH A;  2GIZ A;  2RNG A;  3IWZ A;  1VQP I;  2KT0 A;  4AVP A;  2RRE A;  1C0W A;  1XPX A;  2ME6 A;  4F55 A;  4OAZ A;  3S2H J;  3QAH A;  2O3F A;  3I4M J;  1LJ9 A;  4DYC A;  4MIM A;  3F9K A;  1YS6 A;  4Y7N J;  4Y17 A;  1RKT A;  4BS9 A;  2EIL H;  3IAM 2;  3PM1 A;  2AXL A;  1FY7 A;  1BC7 C;  3KP2 A;  1KQ0 A;  5L3F A;  3OYA A;  4HZF A;  4QWQ A;  3KYC B;  4BXU A;  2KP6 A;  2F4M B;  2E35 A;  4FET A;  2VT3 A;  3RZO J;  5DYM A;  3CP8 A;  2Y2Z A;  5HOD A;  1TL8 A;  3FDY A;  2PG4 A;  4HLX A;  1T6S A;  1ZYR F;  2HVQ A;  4DBQ A;  2XAF A;  1WH5 A;  2IGM A;  4ABZ A;  3EUH A;  2MH2 A;  2K9L A;  4KUM A;  3GTG J;  2OV7 A;  1TTY A;  1X1D A;  3ZQG A;  3H9Q A;  3PSF A;  3ZQC A;  1XSV A;  4BY1 J;  2ZBK A;  3DQV C;  2HTJ A;  5BMZ A;  1S7E A;  4YFX F;  3HHH A;  3K1N A;  1D5Y A;  1MMG A;  5FFZ A;  1RET A;  3RPQ A;  3JRB A;  3LST A;  2ZC2 A;  4GCV A;  5J8F A;  1KU3 A;  4HNU A;  1YI2 I;  2KRF A;  3JCU C;  1H9T A;  2H09 A;  2Q0O A;  2RQP A;  5CVR A;  1KYW A;  1FYK A;  3CDI A;  3LMM A;  2DPD A;  1OJL A;  2DA5 A;  1I6X A;  3FZV A;  5FRN A;  1S9H A;  3S3N A;  1KU2 A;  1KU7 A;  3GME A;  4XLN F;  2DQL A;  2YX7 A;  3T0Y A;  5JFR A;  1FC3 A;  1TQP A;  4B48 A;  4JBA A;  1RR8 C;  1SEU A;  2JA2 A;  2P7C B;  4HEA 2;  4AWX B;  3JAM Z;  4ZYH A;  2DQR A;  3GBG A;  2YU9 J;  4BXX J;  1Z67 A;  2L7K A;  1YJ9 I;  3WGG A;  2XGD A;  3B73 A;  3HHG A;  3M1C A;  4HQM A;  3EYI A;  3DKX A;  2DXI A;  5EG0 B;  5AIQ A;  4JQF A;  5M5Y J;  1HQC A;  1MJ9 A;  3ABT A;  2HYJ A;  2DN0 A;  2CH0 A;  4XKB A;  2JT1 A;  4AU7 A;  3ZQH A;  4CYD A;  5IOZ A;  4WWC A;  3OYD A;  2TRT A;  4BXF A;  5LRS A;  1JHH A;  1FTT A;  1E3O C;  1KU9 A;  3HRT A;  3N4M A;  4CHU A;  4UVB A;  3F3X A;  3TOB A;  4BU2 A;  2FA5 A;  2HKO A;  3CJQ B;  1KQ9 A;  2OTL I;  1O3S A;  2DFE A;  3IAS 2;  2C6Y A;  1R7J A;  5FRO A;  3LA3 A;  2ZSI B;  1IN4 A;  4ENJ A;  2CW8 A;  3LQQ A;  2IEK A;  1WJ5 A;  1ZLK A;  1QPM A;  2NOJ B;  3ZMV A;  1YJW I;  1PP7 U;  1ETX A;  1SAN A;  4XRS G;  3NAU A;  2NVX J;  1OLT A;  4S04 A;  1DDN A;  3SFZ A;  5GAH J;  2G7H A;  4AID A;  2M7A A;  4PJN A;  3GYH X;  4UY8 I;  1AOY A;  1ZTR A;  1XMX A;  5HLT A;  1V54 H;  3BOQ A;  2R7R A;  1YIT I;  2K40 A;  2COB A;  2B0L A;  4XLA A;  5EF6 A;  2GLO A;  4BBS J;  3ZN1 A;  4YII A;  4BAY A;  1KQ8 A;  2WWY A;  3QRF F;  3LSH A;  1O3R A;  2OC6 A;  3UNG C;  1P6R A;  1IF1 A;  3CC4 I;  3FWE A;  2CU7 A;  1ZRD A;  3GEZ A;  1E3P A;  2BV6 A;  3L7W A;  5JHF A;  2K9M A;  4HAM A;  5CYV A;  3G2B A;  4HLY A;  1YOV B;  3HOV J;  2KRH A;  3F6O A;  2JMW A;  3FK6 A;  3MKY B;  1FEX A;  3OY9 A;  2XC7 A;  1B6A A;  4A3D J;  2R5Y B;  3ERM A;  1GXQ A;  3OV8 A;  2A68 F;  2CQ7 A;  2DT6 A;  2KZV A;  4D7N A;  1XGN A;  2R7O A;  2Z33 A;  3U1D A;  1X1C A;  3GTQ J;  1LUJ B;  4RAG A;  5JVG F;  2V79 A;  2ZME B;  4MLO A;  5ICF A;  2IA2 A;  1ONV A;  1R71 A;  4G6T B;  1DU0 A;  3O2P E;  4D5C A;  1I1S A;  3H0D A;  3G3Z A;  4C2M J;  2DOD A;  4LIU A;  5B3S H;  1T38 A;  1OR7 C;  4L9V A;  4A3M J;  1ZG3 A;  1A36 A;  3H0G J;  1LDK B;  5KNL A;  1SVM A;  3EUA A;  4OIP F;  2L9N A;  3VYR B;  3BR3 A;  2WY7 Q;  3DTE A;  4M72 A;  1K83 J;  2B63 J;  4A3B J;  4E70 A;  1NG6 A;  4PK4 A;  1K78 A;  3FXR A;  3B02 A;  1F43 A;  1R1U A;  6PAX A;  1UHW A;  5CVU A;  3SYT A;  1WSU A;  1LQ1 A;  1WJA A;  4GYG A;  4P1W A;  2HPI A;  2RAE A;  3E6D A;  4RAF A;  2R7Z J;  4S05 A;  3M9A A;  4N4N B;  4DZJ A;  1B72 A;  2H1K A;  5IYD J;  4O5V A;  4YG2 F;  1WI9 A;  3GZ5 A;  5EYR A;  3DF8 A;  3LWF A;  3RKX A;  1ETQ A;  2L0K A;  1Z9C A;  1ON1 A;  3KP5 A;  1SD5 A;  3VFZ A;  2BY1 A;  3JRE A;  2VI6 A;  3QOD A;  1YX3 A;  3RPU D;  2VKD A;  1SMY F;  3LSG A;  2MLK A;  2FF4 A;  2K9N A;  4OIQ F;  5DD8 A;  1MDM A;  5LD2 C;  3AG2 H;  3KP3 A;  4UUS B;  3LA7 A;  2Z3Y A;  1XCB A;  2HZD A;  2RGV A;  4EEF G;  5FKO A;  5LGN A;  4TV7 A;  1EH7 A;  1D8K A;  4ENM A;  2V4J C;  1IZ1 A;  3DPT A;  1BM9 A;  4I01 A;  3OS2 A;  2QBY A;  2X1D A;  4GYI A;  3FXM A;  3HTU A;  4NC8 A;  3CCV I;  1X4P A;  3L2U A;  4IHS A;  1FIP A;  2X9D A;  3K4M A;  1S29 A;  1EKE A;  5K1Y A;  3S17 J;  3D5R C;  5DS9 A;  3CUQ C;  2VON A;  1J7K A;  3NEU A;  2ZFU A;  3Q0V A;  5AIP A;  4A0Z A;  4B43 A;  2ID3 A;  1ORK A;  5CPR B;  1A6Q A;  1I5Z A;  5FD6 A;  5A2Q K;  1D0Z A;  3JRG A;  2D1H A;  2W25 A;  2YX4 A;  2GXB A;  3I3L A;  4L9T A;  2P81 A;  1YIJ I;  1YRN A;  2KQR A;  2V1X A;  3RDI A;  4Y15 A;  2DFI A;  2DTR A;  2LSO A;  5LHG A;  2G7U A;  2OA4 A;  3S1N J;  4W1U A;  3JAM K;  2JZY A;  1W0T A;  1EA3 A;  1ZAR A;  5FKK A;  2RNJ A;  4EJV A;  1U5T C;  2WAE A;  3CMA I;  1X3W B;  1FJL A;  2DI3 A;  5F27 A;  5HOO A;  4Y3O A;  1DPR A;  2NVU B;  3HRM A;  4DNC A;  1D0Y A;  3E97 A;  2XKO A;  1TLH B;  3R60 A;  3AL0 B;  3I53 A;  1F4K A;  4IHT A;  3QOE A;  1LEB A;  4ZYG A;  3KEQ A;  2MC4 A;  3JTH A;  3IC7 A;  4E6K G;  2G9W A;  4ANJ A;  1U8R A;  3RYR A;  2ZXW H;  1UB9 A;  2WV0 A;  3LQR A;  1S72 I;  3GZ6 A;  1FOX A;  2CJJ A;  4C2T A;  3ECO A;  3M7G A;  1OYY A;  1UHM A;  5LHI A;  4GGG A;  3HBL A;  3DP7 A;  5DV5 A;  1AU7 A;  2K9Q A;  5CVJ A;  2MC3 A;  2J5O A;  1YO5 C;  4KMF A;  4YEJ A;  2Y30 A;  2O8K A;  3NWT A;  5IT9 Z;  3WU0 A;  1S5L C;  3R0J A;  4OWR B;  4LB5 A;  3CP2 A;  2VBZ A;  4G6Q A;  1ZKG A;  4DQ2 A;  2IJL A;  4A3L J;  3GCM A;  4HST A;  4IF4 A;  4OIN F;  1T39 A;  4F93 B;  1BI2 A;  3FXQ A;  2LFB A;  2JA5 J;  3Q0U A;  3W3C A;  5HLG A;  1ERD A;  1FOY A;  3GXO A;  3OL3 A;  4UNO A;  5C4J J;  3L1P A;  1X2N A;  4EM0 B;  3L9F A;  1IRG A;  3BT9 A;  5GPC A;  2DYR H;  1RIO H;  1HF0 A;  4KIC A;  3TO6 A;  5ICG A;  2X6Y A;  1J59 A;  3D1N I;  2VPR A;  4IKF A;  2LRE A;  1O4X A;  5ILS A;  4M3B A;  2R7V A;  4IOC F;  1R5H A;  1T56 A;  2ECB A;  4IVN A;  1AKH A;  3HOU J;  2BW3 A;  4RB3 C;  3S93 A;  3VPR A;  4EVI A;  3O8G A;  4KIF A;  4QSH A;  2KFD A;  2FBI A;  3DPL C;  2ISY A;  1UZC A;  1G4D A;  3H9J A;  4NDL A;  4QIW N;  2CW7 A;  2K3P A;  4RB1 A;  3GFI A;  4DBR A;  3LAJ A;  5E3M A;  2BXZ A;  4HV6 A;  3FKJ A;  1CF7 B;  3BZ6 A;  2ID6 A;  1I3A A;  2HWV A;  3LSI A;  4N4O B;  3QOP A;  2NNY A;  1A6I A;  1VQN I;  1D1B A;  2YS9 A;  3QYB A;  2Z1D A;  4BQN A;  1J9I A;  5BPD A;  2V9K A;  3MAJ A;  1G3S A;  2PX9 A;  4WXH A;  4HA8 A;  2ZCW A;  3Q3S A;  3OWT A;  2OAZ A;  4E7H A;  4ZDL A;  2L2O A;  2W4S A;  2HVR A;  4XN3 A;  2KIS A;  1QPI A;  5FKM A;  2DBB A;  2J5P A;  2YUS A;  1X58 A;  3GFM A;  4HX7 A;  4BHB A;  1YYV A;  1ZGW A;  1V3F A;  3TQN A;  2E5Z A;  1Y1W J;  3E6C C;  4O3M A;  3LSK A;  2GA2 A;  3S15 J;  3CMM A;  1W7P B;  1HW2 A;  5F0F A;  3FKI J;  3BC8 A;  2CWE A;  2FE3 A;  2KL4 A;  4AD9 A;  3JRD A;  5IP9 J;  4XM3 A;  5J3L A;  1ZGA A;  2GQQ A;  3CZ6 A;  3IH4 A;  2A6H F;  1UCR A;  4P96 A;  1XN7 A;  4UUV A;  4CO8 A;  4OMZ A;  1YLF A;  2XAU A;  2HI3 A;  3ZXS A;  3W2W A;  3OYL A;  3O3K A;  1ITY A;  2BZT A;  4EV0 A;  3BG7 A;  3BDD A;  1Z91 A;  3MEX A;  1OIS A;  3HGG A;  3GUD A;  4XLH A;  2TCT A;  3BTC A;  3RKQ A;  2AQE A;  4UB6 C;  3BG6 A;  1FIA A;  3WTV C;  3I64 A;  1BIA A;  4XOR A;  1P92 A;  2IGK A;  3G71 I;  3I0T A;  2MGQ A;  1WWX A;  3SEZ A;  2VOO A;  1UJ8 A;  1OCZ H;  2FQ4 A;  1IDZ A;  1OCP A;  2NXN B;  2QQA A;  3ABL H;  3P9C A;  2JN6 A;  4KN4 X;  2W00 A;  1XX5 A;  2R93 J;  2DMP A;  2IAI A;  1VQ6 I;  4KIT B;  3PJR A;  4UV9 A;  1JT0 A;  2QA4 I;  3KZI C;  3J7A O;  2P4W A;  4RGU A;  4BQQ A;  3L2C A;  1O3T A;  2P6S A;  2W85 A;  2A61 A;  2VLA A;  2JWT A;  3Q9V A;  5E1Z B;  4CXF A;  5DEQ A;  3I59 B;  4BKX A;  3BJA A;  2H8W A;  5E3N A;  2COM A;  2E1M B;  4KYW A;  5DCM A;  1MMD A;  1LDD A;  1G8X A;  2D2W A;  2MSY A;  2VXZ A;  4PJL A;  1TW2 A;  3CCY A;  3W2A A;  1IXC A;  2DT7 B;  1QA6 A;  5DUI A;  3R6S A;  1R36 A;  2QLZ A;  3ZMD A;  2IRF G;  2V9P A;  1QO0 D;  1MH3 A;  2LH9 A;  5EJC A;  2DLL A;  2YR2 A;  3EQL F;  3J81 Z;  2FBH A;  2GA1 A;  2QWW A;  3D5S C;  3K4N A;  1HKS A;  3D0S A;  4L5E A;  2R5Z B;  2HPM A;  1A04 A;  2CUE A;  2E71 A;  2OZU A;  5HS9 A;  4LB6 B;  2F5F A;  2OPT A;  2EB7 A;  1FSH A;  1K6O A;  2HVS A;  2STW A;  4A93 J;  2H6B A;  2BGC A;  1UEL B;  3RYP A;  2O6G E;  3VOD A;  1NTC A;  2K85 A;  2Y0S N;  3BCB A;  4U0V A;  3ZN0 A;  2FJ1 A;  4EGY A;  2OQR A;  1AHD P;  3OYC A;  3G73 A;  3P5J A;  2VJ5 A;  5E3L A;  1MMN A;  3C18 A;  1LFP A;  1RPW A;  4FCY A;  2BXY A;  5IT9 K;  2QKL B;  4B3A A;  4D5F A;  1TBX A;  4MO7 A;  3RPU A;  1ZGJ A;  2CQQ A;  3CES A;  1P7J A;  1BN5 A;  1W0U A;  3KYD B;  5D6E A;  5HDN A;  4BGD A;  1FYL A;  1Z0X A;  1SFE A;  1JKQ C;  3K4J A;  3QPT A;  1ETV A;  1VQM I;  4RLF A;  5K5R A;  5B66 C;  1G3W A;  4CCO A;  4WXC A;  2VT2 A;  3CO6 C;  4A2U A;  3GFL A;  4A3J J;  2JQ7 A;  2Z5U A;  4ZYD A;  3NWS A;  5J6X A;  1WJC A;  5GTH C;  5K5O A;  5F1J A;  3EDP A;  1HW1 A;  3OL4 A;  2AXT C;  3H36 A;  1GV5 A;  4I98 B;  3CUQ A;  1E17 A;  2W48 A;  3ZQL A;  3EET A;  1E3H A;  4KDP A;  4NC7 A;  1FP1 D;  1VF9 A;  3S3M A;  2EPF A;  3VYS B;  3FX3 A;  3OS0 A;  2RVC A;  2UWM A;  3BR5 A;  1RKW A;  2DFF A;  2HKX A;  4F92 B;  3KEO A;  2R7T A;  1X1A A;  3ZP5 A;  3K2A A;  4CZZ A;  2BHY A;  5FLX Z;  2KPM A;  2CYY A;  5ICE A;  1X3Z B;  1HLV A;  5JHU A;  3RKY A;  4D7M A;  1RES A;  2G0E A;  5H2F C;  4NHJ A;  1MSF C;  2V6E A;  2WBM A;  5CVI A;  5M5X J;  5F1R A;  2Q2E A;  2MD5 A;  4NQW B;  2RV8 A;  1HA8 A;  4BH9 A;  2JVH A;  3C1D A;  4JYK A;  2P5L C;  1FMW A;  3BG5 A;  3S2W A;  3PIP F;  1D1C A;  3PFI A;  4IRI A;  2VB6 A;  1Y6I A;  5LRR A;  4U7D A;  1B9M A;  1BOA A;  1Z6R A;  5IY5 H;  3WTW C;  3K70 C;  1U3E M;  1ZR4 A;  1VQL I;  2LKP A;  2VBW A;  4ZTJ A;  4OIR F;  3PIO F;  3CC2 I;  4ZTF A;  2EZH A;  4A3K J;  4XNF A;  2ZXI A;  1IXR C;  3MKL A;  1XDS A;  3I5U A;  3BPV A;  1PUF A;  3ZQF A;  2VC0 A;  3GWZ A;  3ECH A;  1IW7 F;  3RIR A;  3ESW B;  1M1E B;  2QVO A;  2XAJ A;  3KIO A;  3I54 A;  4IL6 C;  3J7Z I;  2WTE A;  1TWG J;  1EV7 A;  4RGX A;  2FD5 A;  3TO7 A;  1IN7 A;  2R7Q A;  2NNN A;  3E7L A;  3IRR A;  4ZZL A;  2PJR A;  3OIQ A;  4RBO A;  4MQV A;  3A01 B;  2LKX A;  2A6T A;  3S2D J;  1G2H A;  4CCL A;  2JRT A;  4JOM A;  3RQ4 A;  3TW7 A;  4HG2 A;  2CV1 A;  1MBG A;  1F36 A;  1TC3 C;  4PJ0 C;  5GTI C;  4HF2 A;  4ZDP A;  5D4S A;  4KIB A;  1HXD A;  2M7B A;  2KDO A;  1IGN A;  3CD6 I;  3MWM A;  3VSL A;  1HST A;  1YFH A;  1MGT A;  1TWC J;  2DA7 A;  4J00 A;  4JP0 A;  1B8I A;  4E7L A;  4LG0 A;  3L2Q A;  3DBH B;  3WTS C;  3G1M A;  4XKV A;  5FO5 A;  3ERE D;  1Y39 A;  4M9Z A;  2CW0 F;  1T2K A;  3K2Z A;  4B44 A;  4JX4 A;  2VAS A;  5FJ8 J;  2XPU A;  3HIF A;  5GPA A;  3LFU A;  3ZMS A;  1JHF A;  3DKY A;  2H1L A;  2PJP A;  5FB2 A;  1W4M A;  1LE8 A;  3ZMZ A;  3OYK A;  4C3H J;  4UVC A;  1G59 A;  2HQR A;  2F5D A;  1V4R A;  3V7C A;  1R1V A;  2I8D A;  2RC4 A;  3BQY A;  2DPU A;  3W6J B;  3UKG A;  2P5K A;  4LK0 F;  2F4I A;  1VI0 A;  1FWZ A;  1B4A A;  2LVS A;  3LSR A;  3GFJ A;  2LR8 A;  4IZZ A;  5DD4 A;  4D9J A;  2A07 F;  1MKM A;  2A6E F;  4CH7 A;  2M0M A;  1WPK A;  4QLC U;  5TIS C;  1Y1V J;  2CO5 A;  2EFN A;  1WJD A;  4CCM A;  1NK2 P;  2VKE A;  3WU2 C;  3H3V K;  3A0B C;  3ZGK A;  3ZQ7 A;  4XOP A;  1ZQ3 P;  3J81 K;  3PL8 A;  2WV1 A;  3F6V A;  5E79 C;  1W36 D;  1JGS A;  3VOE A;  3LFK A;  3GW2 A;  3FF5 A;  1ZRF A;  1ENH A;  1K61 A;  4AC0 A;  2RKH A;  3VYT B;  1WH7 A;  1YS7 A;  1XSD A;  4B47 A;  2IT0 A;  1BR1 A;  2K9S A;  3ZMT A;  3H3U A;  1Y0U A;  1MMS A;  1YTY A;  2ADU A;  4EM2 A;  1RNL A;  1RC9 A;  3H35 A;  5CJ9 A;  2E36 A;  3F8C A;  3CLQ A;  4A3F J;  1VFC A;  2KIQ A;  5J47 A;  1QZY A;  5KHD A;  3DBL B;  1BI0 A;  2MAB A;  3LSP A;  1KYZ A;  1QNT A;  2HDD A;  2VUM J;  2MYS A;  5J1U A;  2XRN A;  4YRV A;  3PQJ A;  2L9S A;  2HYF A;  1BIB A;  5L3C A;  2DK8 A;  5J8C A;  2P5V A;  3GX4 X;  4PFP A;  3HL2 A;  4DIQ A;  4ZDO A;  4M74 A;  3Q9S A;  5C44 J;  2EIK H;  3IH2 A;  4CYC A;  2OD5 A;  2DOE A;  5JI6 A;  2LYC A;  1K78 B;  5EEA A;  2K02 A;  4W97 A;  1KON A;  2ZSH B;  2DT5 A;  2WA0 A;  3CCM I;  3U2R A;  2WAD A;  2ZXJ A;  5HLH A;  3P9K A;  1U9O A;  4P55 A;  2MLG A;  1T33 A;  1SAX A;  1A35 A;  2V1N A;  3HUG B;  5TRD A;  3KP4 A;  4FX4 A;  1IRF A;  1EF4 A;  2EH3 A;  1U9N A;  5L3B A;  1FBS A;  3JRH A;  4ON0 A;  3W6V A;  3DCF A;  5FLX K;  1ZR2 A;  1FOK A;  1J2X A;  3LAP A;  3F21 A;  4BHP A;  3M4O J;  2X51 A;  4E7I A;  4C3J J;  1MDM B;  1CGP A;  2D45 A;  1JUS A;  1EH6 A;  3BLY A;  5K7F A;  1W7P D;  1MNM C;  4ZZD A;  2XVC A;  1KGS A;  3HJE A;  3CF5 F;  1OYI A;  1LDJ A;  3NQO A;  2F5E A;  4BUP A;  1U78 A;  3WOD F;  1J0R A;  5LFA A;  4LIV A;  3M8F A;  1JUP A;  4XKW A;  4PSW A;  2XGX A;  4L18 B;  2QBY B;  4LLN A;  3K4C A;  5BPI A;  1IDY A;  1MBF A;  4H4K C;  3T8R A;  3MCZ A;  1IRZ A;  2Z16 A;  2FMY A;  3BR2 A;  4P9F A;  1P4X A;  2QGU A;  2F4O B;  2KIM A;  4V2G A;  1MBK A;  2FNA A;  3R4K A;  1U6G A;  2LK2 A;  2RN7 A;  2PI0 A;  2IS4 A;  1WFX A;  3S8P A;  2HOA A;  3TDZ C;  2HNH A;  3GVA A;  3MMY B;  2NYX A;  5EGO A;  3CCS I;  1MD0 A;  2IGO A;  5CQG A;  1YRN B;  4GFB A;  2GWR A;  4MNU A;  1DPU A;  2LP0 A;  2HGC A;  3BTJ A;  3QQA A;  3RQI A;  4DGW B;  2XPV A;  2VOD A;  1IAW A;  4HQE A;  1BR2 A;  4HV5 A;  3GTK J;  2R5Y A;  2PBI A;  1YJN I;  3CLO A;  3IV5 A;  1OYW A;  2K4B A;  2ESH A;  4NB5 A;  2M4K A;  2OBP A;  3PUF A;  4IEJ A;  1BC8 C;  5E18 F;  1Z6T A;  5HS7 A;  4KMU X;  3OYJ A;  1RZ4 A;  4IX7 A;  1F9N A;  2NAZ A;  1TNT A;  1AWC A;  2M4G A;  1HC8 A;  1K6Y A;  2WB1 A;  2NVY J;  4KT6 A;  2XAG A;  4A12 A;  4RMN A;  4KIG A;  3E6B A;  1JI8 A;  1LKX A;  3FBN B;  3K6G A;  3M07 A;  1BL0 A;  2JA6 J;  3M8J A;  2VE9 A;  2X48 A;  2HOT A;  2FBK A;  4ETS A;  3HXL A;  2WB1 N;  2M3A A;  3FM5 A;  4RAY A;  2XPW A;  1XD7 A;  3CJT B;  3F72 A;  3RSN A;  4MTD A;  1OCO H;  5FGM A;  4A3G J;  4Z6Y A;  3MVP A;  3GTJ J;  2LOO A;  1J75 A;  4Y52 J;  1ON2 A;  1R4N B;  4E4H A;  4Q4Z F;  4XBF A;  2OQG A;  2UV1 A;  3FXJ A;  3QU3 A;  3ROU A;  1SD4 A;  2XKP A;  2LBF B;  3CDH A;  1GXP A;  1NHA A;  4C9Y A;  4QTR A;  3Q5F A;  4L9N A;  3ZQI A;  4EJT A;  4KNY A;  5IYB J;  2NS7 A;  3HSR A;  4IHX A;  4A3C J;  2VQH A;  2K3F A;  4PDK A;  2VOP A;  3IP4 B;  3ZCO A;  1YW9 A;  1FYM A;  4HNT A;  4DW6 A;  3C7J A;  1UMQ A;  1Z77 A;  4UUS A;  2A05 A;  4R1H A;  4U0Y A;  1PDN C;  1R4M B;  4R8H A;  3ZRG A;  1WCM J;  2GZW A;  2M34 A;  4U87 A;  3LSM A;  5GP9 A;  4QPQ A;  3TDU C;  1CQT A;  2MG4 A;  1ETW A;  1IUF A;  3SZP A;  5L3E A;  1IN5 A;  2DAO A;  3HEF A;  3C2H A;  3U21 A;  2EA4 A;  5EDN A;  3JSO A;  2ESN A;  3OYB A;  2V9V A;  2R92 J;  5LBQ A;  2JA7 J;  3PFY A;  1JJ8 C;  2GM4 A;  3PSI A;  1SD6 A;  3SHF A;  2XF6 A;  1N77 A;  2JUC A;  5FKN A;  5BS6 A;  1B1B A;  2V6C A;  4OU0 A;  2EWN A;  2EFW A;  1QRY A;  2VQG A;  2NVQ J;  1TT5 B;  1ACI A;  2IS2 A;  2FOW A;  5ICC A;  2ZXH A;  1PP8 F;  4XON A;  1FNN A;  3HRU A;  5F6F A;  1L3L A;  1JKO C;  2KHM A;  4I76 A;  1EJ9 A;  1W1W E;  3HB9 A;  4CCJ A;  2N8G A;  3ISP A;  3FMS A;  4A5M A;  5IP6 A;  4M3F A;  1FBQ A;  5J1Y A;  3OR2 C;  1HKT A;  2XGE A;  3MKW B;  4KJZ A;  4CA0 A;  4CDG A;  2ME0 A;  1O3Q A;  3F8N A;  3K1M A;  1R58 A;  1TQI A;  3O6B B;  1QHH D;  2EV5 A;  4HDV A;  2Y9Z A;  3PO3 J;  3REO A;  2JJ7 A;  4AUX A;  2CUF A;  2F5C A;  4ESJ A;  3OYM A;  2IS1 A;  4XRM A;  4IHV A;  2JRM A;  2LY2 A;  3OIP A;  3IRQ A;  3GTL J;  2JUG A;  2WAF A;  3ONQ A;  4BJT A;  5GAE J;  1XC5 A;  3QYE A;  2L5Q A;  4BDY A;  3V4G A;  4LOC A;  2MA3 A;  2X85 A;  4WXD A;  4ESB A;  3HOS A;  3S14 J;  3RCO A;  1XDU A;  2JVG A;  5ED4 A;  4G94 A;  1ZAO A;  2QYO A;  3MKZ A;  2W1O A;  3OOP A;  2X1E A;  3RI4 A;  4GDF A;  4FX0 A;  1I6H J;  4AVZ A;  1VZ0 A;  3JRI A;  3JW4 A;  1UHS A;  1UG0 A;  1IG7 A;  1D5V A;  1NK3 P;  4YIF A;  1DP3 A;  3BY6 A;  3E3V A;  1G6N A;  1ZLJ A;  2XHK A;  4II3 A;  4IXA A;  5DUK A;  3KCC A;  1NH3 A;  2ELK A;  2EA2 A;  1ZRE A;  2HOS A;  2X6W A;  1ZRC A;  2JSC A;  3WTY C;  3ABU A;  5JR3 A;  2ECC A;  2ELH A;  3MZY A;  3WHB A;  1TWF J;  2VL8 A;  1N78 A;  1BI1 A;  2CFX A;  3MZH A;  3BQZ A;  3M8E A;  4RGR A;  4XRS A;  2DOA A;  4L5J A;  3MN2 A;  3M3Y J;  4HDU A;  1X4O A;  2V26 A;  3DWL E;  9ANT A;  2KMU A;  3TED A;  1P4A A;  2WC2 A;  4DZP A;  3S1Q J;  1TP4 A;  2GXA A;  1DUX C;  2CUZ A;  2GIV A;  2HDW A;  2M87 A;  3ABK H;  1LVK A;  3IKT A;  1FX7 A;  5ERI A;  2OF7 A;  1XG1 A;  3DLL F;  1P9Q C;  1W5S A;  4I99 C;  1JT6 A;  4JX5 A;  1B9N A;  4IHW A;  1VQ4 I;  4HPQ A;  1R00 A;  3N97 A;  4CUG A;  3BR6 A;  1IC8 A;  3A02 A;  1RRJ A;  2E2I J;  3HOX J;  5HNF A;  1IXS B;  3KEY A;  2OJE D;  3S1M J;  3VB2 A;  2GAU A;  4ESF A;  3GO5 A;  3U1K A;  1ZG5 A;  1QZZ A;  3ZOB A;  4IOA F;  4IRG A;  2XF7 A;  3KP7 A;  4EMS A;  3IUO A;  1X1B A;  1BW5 A;  1VQ7 I;  3K4L A;  4BY7 J;  1SFK A;  4HYE A;  2LY1 A;  2Q1Z B;  2VC1 A;  2PMZ A;  2HZT A;  4E7S A;  1XTA A;  2FEZ A;  2CV2 A;  2LD5 A;  5FD5 A;  2O03 A;  2DMN A;  5FLV A;  4X1E A;  3ELK A;  2BYV E;  4LLL A;  2I10 A;  2WAQ A;  2R7U A;  4I0B A;  4P9U A;  2E60 A;  4FAS D;  4L9J A;  3KPH A;  3GLL A;  2B7E A;  1BW6 A;  2PMZ N;  1O7F A;  3FXL A;  1W7P A;  3WG9 A;  3F8M A;  1XCV A;  2X1C A;  1DQU A;  2Y0S A;  2WAQ N;  3QP6 A;  5E1X A;  4HBL A;  4NC6 A;  2HYG D;  3I4N J;  1S8N A;  2K5C A;  3DTK A;  3VYU B;  2LG4 A;  3HDD A;  1IV8 A;  1HCR A;  4WCG A;  2NS8 A;  1SVL A;  2QCO A;  5ILU A;  3OMY A;  1GV2 A;  1XGM A;  3TMO A;  1S3J A;  1O57 A;  5E20 A;  4ZYA A;  3CUQ B;  4E7Z A;  4OMY A;  1Y8Q B;  2M2E A;  4I2O A;  2CQK A;  5K7H A;  1GT0 C;  1JKP C;  1WGX A;  2V1D A;  3GTM J;  5D5V B;  2EIJ H;  3E5Q A;  2CFO A;  4LLG F;  4KN7 X;  2HFH A;  2DK5 A;  3A0H C;  5D6F A;  4MFD A;  1R1T A;  1S6L A;  3BRO A;  1MSE C;  2VXD A;  3VDX A;  4B09 A;  1UFM A;  2BVL A;  4RDU A;  1FBU A;  4B3X A;  1XS9 A;  3AKZ A;  3ZPL A;  1U5T B;  5IPA A;  3TKY A;  1ZEL A;  3PO2 J;  2HXO A;  1OFC X;  1T98 A;  3FM3 A;  2ZJQ F;  2Q2E B;  1KZH A;  1PJR A;  1X1P A;  4Y13 A;  3HOY J;  2H94 A;  2ZME C;  3H1C A;  4U7B A;  3J7A Y;  2DW4 A;  2DMU A;  4CGZ A;  3HZJ A;  1PYV A;  1RUO A;  1U0J A;  4AYB A;  2R7X A;  1LEA A;  2R3S A;  1POG A;  2DO7 A;  3I59 A;  1QZE A;  3GTO J;  3KLO A;  2WY8 Q;  1G3T A;  2F5V A;  4M71 A;  1Z1D A;  3FIW A;  2OCE A;  5JLX A;  4F7Z A;  2IW5 A;  3BJO A;  2XV4 S;  5M3F J;  4AYB N;  4NBQ A;  2DDB A;  2IBD A;  3KP6 A;  4IJA A;  1V5G A;  2DMT A;  2R0Q C;  4PJM A;  2R7W A;  3JRC A;  1PUF B;  1OPC A;  2BY2 A;  2EK5 A;  3BTI A;  1MJB A;  2A69 F;  3K9T A;  2XGC A;  2KIU A;  2LRD A;  4HSR A;  3VSK A;  3JR9 A;  3WE2 A;  1BA5 A;  2OCC H;  4Q47 A;  1FZP B;  2EZI A;  2Z99 A;  2QSH X;  1I39 A;  2BVM A;  3QPH A;  4FIS A;  3I4P A;  1YIO A;  2BE5 F;  2MBF A;  3F0C A;  3TL4 X;  3I55 I;  2ETH A;  5LGT A;  1MIJ A;  2M8E A;  3KZY A;  2P8T A;  2H6C A;  3G1L A;  1Y8R B;  2ISZ A;  2HQN A;  1HDP A;  4RGS A;  1BR4 A;  3CJN A;  4BEH A;  3CME I;  1MBJ A;  5KVR A;  1H9G A;  4IQJ A;  2L54 A;  4I6Z A;  2I5U A;  5BQT A;  3OIO A;  5CLS A;  3VEP A;  4ZC3 A;  2CRG A;  3R61 A;  4A0Y A;  2E1C A;  3QP5 A;  4NUB A;  5L3D A;  2M9H A;  4Q48 A;  1HBX G;  1H0M A;  2L7M P;  2ZB9 A;  4M3D A;  1Z05 A;  1R6R A;  2L9R A;  2VJI A;  4XOT A;  3RJP A;  2L01 A;  3D5L A;  4Y33 A;  2ACJ A;  2O5R A;  4GXO A;  2JPC A;  4C3I J;  1T0F A;  1G3Y A;  3ASO H;  1JTX A;  4EJU A;  4UVA A;  1NG7 A;  3QU6 A;  2M1B A;  2XSD C;  3WGH A;  4RM2 A;  4CZC A;  1LE8 B;  1E2X A;  4L0Y B;  2QKM B;  3DEW A;  2R7S A;  3CF2 A;  2O7O A;  4MFE A;  2V1U A;  4XQF A;  5BOX A;  3OOU A;  1IV6 A;  4BNC A;  4G7O F;  3WTX C;  3QWL A;  3UR3 C;  2H8R A;  1IUY A;  4RM3 A;  2ZJ2 A;  3AG1 H;  2DU9 A;  3QPS A;  3WTT C;  1YG2 A;  1IO2 A;  4A6D A;  1Y56 A;  1QVU A;  1DP7 P;  1SMT A;  2EFQ A;  3CUO A;  5J40 A;  4XLE A;  3E1S A;  3K4K A;  5DTD A;  4PGH A;  2VBX A;  1A31 A;  3K0L A;  1PUE E;  2JK3 A;  3CCQ I;  5KAF C;  3M1E A;  4NQW A;  2HQ5 A;  1FLI A;  3OYF A;  1TWA J;  2UXX A;  3AL0 C;  1MBH A;  3OYE A;  1OKR A;  2E34 A;  3K1P A;  1T8I A;  1LNW A;  2Z9O A;  5IYC J;  3HOT A;  1LFB A;  3HSF A;  1W5C C;  4XL9 A;  1F5T A;  3PNV A;  1AA7 A;  2L4A A;  4KA4 A;  1SFX A;  2O9L A;  3OSG A;  1QQI A;  3BZK A;  3TBI A;  3E5U A;  4M3E A;  4FQG A;  3CC7 I;  5C4X J;  3PNY A;  2KLO A;  5L3G A;  1JTY A;  5A2Q Z;  2OUM A;  3BG9 A;  2NOG A;  2KDZ A;  2TDX A;  2E2J J;  4XRF A;  1IN8 A;  3HOZ J;  1WJE A;  1ZHF A;  5EZG A;  4IRH A;  1LB2 A;  1R23 A;  2R4G A;  5ILV A;  4CYC B;  1ETO A;  3V8J A;  4CSW A;  3A01 A;  5D4R A;  3LSJ A;  4M3G A;  5F0H A;  2GXG A;  2K27 A;  3HPG A;  4O6J A;  3SXY A;  2ELJ A;  3MD2 A;  4FE4 A;  1XB4 A;  2IXS A;  2M5W A;  3B6C A;  4N0B A;  3T8T A;  1GDT A;  4LJZ F;  3BTL A;  2VN2 A;  4LGW A;  3CTA A;  2GBY A;  2O8X A;  3EYY A;  4F52 A;  1W36 C;  5E8I A;  3E0J B;  1F1Z A;  1ZK8 A;  1FSE A;  2PN6 A;  1VQ9 I;  2EZK A;  2XDV A;  1ZG1 A; 
#chains in the Genus database with same CATH homology
 2IP2 A;  2PEX A;  2JPB A;  1ZN2 A;  5LLQ A;  1WRJ A;  1YQA A;  2CG4 A;  1XSX A;  5DDG A;  2XUB A;  4MTE A;  4BYY A;  2FSW A;  4CIC A;  3FXU A;  1JE8 A;  1LVA A;  4G8X A;  2QQ9 A;  3I58 A;  2KIF A;  1I27 A;  2ZO4 A;  2K4J A;  5JVT A;  1GVJ A;  3H3Z A;  4BQA A;  1XGO A;  4M6Y A;  4MGR A;  2HTS A;  2R7F A;  2VBY A;  1XMA A;  2L3D A;  2CGP A;  4KFC A;  4A0X A;  2Q8K A;  2IA0 A;  3BJ6 A;  4WX9 A;  1W5T A;  4EGZ A;  4UXN A;  3IKV A;  3BP8 A;  2PQ8 A;  3T5X A;  3DFG A;  4HX4 A;  3SQN A;  1EH8 A;  1KA8 A;  3GLX A;  3HTS B;  5LGU A;  3FHZ A;  1BBY A;  1REP C;  2EV0 A;  1XGS A;  4HOB A;  2E7X A;  5H20 A;  1TQM A;  2XRO A;  1X3U A;  3HYI A;  1MJA A;  2UXN A;  3WTU C;  2FNP A;  2W84 A;  3L00 A;  3V7R A;  2O0Y A;  4RB0 A;  2LF8 A;  4D0P A;  3AAF A;  1FPQ A;  1K79 A;  3HUG A;  3RTR A;  3F23 A;  4UV8 A;  4HF0 A;  2ZME A;  2QUF A;  4LMY A;  1S7O A;  4YFN F;  2HOE A;  3DKW A;  1ODD A;  1Q1H A;  4MHG A;  5D5U B;  2FML A;  2R7D A;  4G7H F;  1HW5 A;  2YSR A;  1WKM A;  2ZNZ A;  2X4H A;  2EFP A;  1JXS A;  2Y75 A;  4N9I A;  4ENK A;  4A6E A;  1SD7 A;  4ENN A;  4XSZ F;  2E1N A;  5EEG A;  2D1V A;  3WE3 A;  4G9Y A;  3NRV A;  4M6X A;  3W6K B;  4MEX F;  1GHC A;  3IHU A;  2YU3 A;  4XLP F;  4XSX F;  3P7N A;  1U2W A;  4PCQ A;  3KFW X;  4I02 A;  4ZYE A;  2UZK A;  3LA2 A;  1HKQ A;  2AS5 F;  1VTN C;  2IPQ X;  2FQ3 A;  2LDU A;  1HSJ A;  3TOA A;  4MQ9 F;  1UST A;  1D8J A;  5CVV A;  5D8K B;  3WGI A;  3IWF A;  1O7L A;  4Z2Y A;  3DV8 A;  1D3Y A;  2QM3 A;  3F8B A;  3J80 Z;  4PZJ A;  3TO9 A;  3FMR A;  3K69 A;  4RB2 C;  3ULQ B;  3V8K A;  3SZT A;  3JSP A;  4N9H A;  4LD5 A;  3U9G A;  1YW7 A;  2M45 A;  2QEN A;  5H6R A;  4A5N A;  3DEU A;  2HEO A;  4EQQ A;  2K86 A;  1ULY A;  4I7H A;  5D5X B;  2P6T A;  4M9X A;  2O61 A;  1OMI A;  2W24 A;  1WQ2 A;  1J5Y A;  4FT8 A;  2FRH A;  5HVQ C;  3KLN A;  2ZNY A;  4AIH A;  2W57 A;  3I71 A;  1YW8 A;  2LF7 A;  4YFK F;  2PLY A;  4Q5S F;  2BBY A;  3DXJ F;  2NS0 A;  1IN6 A;  5LHH A;  2A3S A;  5IT3 A;  4G7Z F;  3KET A;  3P9I A;  1R5G A;  4H0E A;  1USS A;  2XIG A;  4B8X A;  4OOI A;  4ASN A;  3R0A A;  5D5W B;  1FP2 A;  1QBJ A;  2YPR A;  5LEK A;  2LNB A;  2FOK A;  2XAH A;  3T1B A;  2OZ6 A;  2EJR A;  2QQB A;  2RDP A;  5HDG A;  1XMK A;  2CSO A;  3E5X A;  3MFK A;  1TNS A;  2BEO A;  2HS5 A;  3E6M A;  3ZMU A;  2EV6 A;  2PMU A;  4M9S A;  5DCF A;  1P4W A;  3ML6 A;  4L0Z B;  5HS8 A;  4G6D A;  4RAZ A;  5TJJ A;  1R22 A;  1QGP A;  2L02 A;  1K7A A;  3KZZ A;  1RI7 A;  3GF2 A;  4RS8 A;  2P7V B;  5E17 F;  5DCM B;  5D8L B;  3L09 A;  4IPA A;  3TGN A;  3IL2 A;  2JTV A;  2PMH A;  1CF7 A;  4R79 A;  4LK1 F;  2A5Y B;  1P2F A;  3CO7 C;  1BI3 A;  4P5O A;  1STZ A;  2F2E A;  2ZFW A;  1ZH5 A;  3C3W A;  2KJC A;  2H27 A;  1L0O C;  4WK8 F;  3F22 A;  5KK1 A;  4L5I A;  4M73 A;  5AON A;  4EJW A;  2FU4 A;  2K7L A;  2VE8 A;  5E8G A;  3JTG A;  2QZ8 A;  4HF1 A;  3RKW A;  5EEH A;  3V7S A;  2MH9 A;  2NRA C;  4ZH4 F;  4K2E A;  2KKO A;  3J80 K;  1OR7 A;  2PFB A;  1S7A A;  5HDK A;  2OU2 A;  4JK1 X;  2XAS A;  2L4M A;  1B59 A;  2Y48 A;  5H6Q A;  3FMQ A;  4FHT A;  3MQ0 A;  4MEY F;  4AIK A;  4I0A A;  4EJO A;  2EFO A;  3COA C;  4HX8 A;  2FXA A;  2E7W A;  4UHT A;  4U0W A;  2HR3 A;  2HDC A;  4WF2 A;  3HSE A;  2XAQ A;  1MZB A;  3F8F A;  4HW0 A;  1BJA A;  5F64 A;  4PGG A;  4EM1 A;  4I09 A;  2Y0M A;  5K5Q A;  5E1W A;  1RUN A;  4U88 A;  1Z7U A;  4LFU A;  3KE2 A;  5FFX A;  2STT A;  3BPX A;  3HRS A;  4KT5 C;  1FT9 A;  2M30 A;  3H92 A;  1SFU A;  2ZKZ A;  3BWG A;  2X0L A;  4AIJ A;  2KJB A;  4BHC A;  2IA1 A;  4OIO F;  1U5T A;  1I1G A;  3WTZ A;  4LG0 B;  3V8L A;  3PQK A;  5HLI A;  2IVM A;  5LEJ A;  3WU1 B;  4GO1 A;  1TW3 A;  3IWZ A;  4AVP A;  1C0W A;  3QAH A;  2O3F A;  1LJ9 A;  1YS6 A;  4Y17 A;  2AXL A;  1FY7 A;  1BC7 C;  3KP2 A;  1KQ0 A;  5L3F A;  4HZF A;  4QWQ A;  4BXU A;  2VT3 A;  5DYM A;  2PG4 A;  4HLX A;  1T6S A;  1ZYR F;  2XAF A;  3EUH A;  2MH2 A;  4KUM A;  1TTY A;  1XSV A;  2ZBK A;  3DQV C;  2HTJ A;  5BMZ A;  4YFX F;  3HHH A;  3K1N A;  5FFZ A;  3RPQ A;  3LST A;  4GCV A;  5J8F A;  1KU3 A;  2KRF A;  1H9T A;  2H09 A;  2Q0O A;  2RQP A;  5CVR A;  1KYW A;  1FYK A;  2DPD A;  1I6X A;  3FZV A;  1KU2 A;  1KU7 A;  4XLN F;  2DQL A;  2YX7 A;  3T0Y A;  5JFR A;  1FC3 A;  1TQP A;  4JBA A;  2P7C B;  4AWX B;  3JAM Z;  4ZYH A;  2DQR A;  3WGG A;  3B73 A;  3HHG A;  4HQM A;  3EYI A;  5AIQ A;  4JQF A;  1HQC A;  1MJ9 A;  3ABT A;  2JT1 A;  4CYD A;  4WWC A;  5LRS A;  1JHH A;  1KU9 A;  3HRT A;  3N4M A;  4CHU A;  4UVB A;  3F3X A;  3TOB A;  2FA5 A;  2HKO A;  1KQ9 A;  1O3S A;  2C6Y A;  1R7J A;  3LA3 A;  1IN4 A;  4ENJ A;  3LQQ A;  1ZLK A;  1QPM A;  3ZMV A;  1PP7 U;  4S04 A;  1DDN A;  3SFZ A;  2G7H A;  3GYH X;  1AOY A;  3BOQ A;  2B0L A;  3ZN1 A;  4YII A;  4BAY A;  1KQ8 A;  2WWY A;  3QRF F;  1O3R A;  1P6R A;  1IF1 A;  3FWE A;  1ZRD A;  3GEZ A;  2BV6 A;  3L7W A;  4HAM A;  5CYV A;  4HLY A;  3F6O A;  1B6A A;  1GXQ A;  3OV8 A;  2A68 F;  1XGN A;  2Z33 A;  3U1D A;  2V79 A;  2ZME B;  5ICF A;  2IA2 A;  1ONV A;  3O2P E;  1I1S A;  3G3Z A;  1T38 A;  4L9V A;  1ZG3 A;  1LDK B;  4OIP F;  4M72 A;  4E70 A;  1K78 A;  3FXR A;  3B02 A;  1R1U A;  6PAX A;  1UHW A;  5CVU A;  1WSU A;  1LQ1 A;  4GYG A;  3E6D A;  4S05 A;  3M9A A;  4O5V A;  4YG2 F;  1WI9 A;  3GZ5 A;  3DF8 A;  3LWF A;  3RKX A;  1Z9C A;  1ON1 A;  3KP5 A;  1SD5 A;  3VFZ A;  1SMY F;  2MLK A;  2FF4 A;  4OIQ F;  5DD8 A;  1MDM A;  3KP3 A;  3LA7 A;  2Z3Y A;  1XCB A;  2RGV A;  5LGN A;  4TV7 A;  1EH7 A;  1D8K A;  4ENM A;  1IZ1 A;  3DPT A;  1BM9 A;  4I01 A;  2QBY A;  4GYI A;  3HTU A;  4IHS A;  1S29 A;  5K1Y A;  3CUQ C;  2VON A;  1J7K A;  3NEU A;  5AIP A;  4O3M A;  4A0Z A;  5FD6 A;  1I5Z A;  5A2Q K;  2D1H A;  2W25 A;  2YX4 A;  2GXB A;  4L9T A;  2V1X A;  3RDI A;  4Y15 A;  2DFI A;  2DTR A;  2LSO A;  5LHG A;  2G7U A;  2OA4 A;  3JAM K;  2JZY A;  1ZAR A;  4EJV A;  2RNJ A;  1U5T C;  2DI3 A;  5HOO A;  1DPR A;  3HRM A;  4DNC A;  3E97 A;  2XKO A;  1TLH B;  3R60 A;  3I53 A;  1F4K A;  4IHT A;  1LEB A;  4ZYG A;  3KEQ A;  3JTH A;  3IC7 A;  2G9W A;  1U8R A;  3RYR A;  1UB9 A;  2WV0 A;  3LQR A;  3GZ6 A;  3ECO A;  3M7G A;  1OYY A;  1UHM A;  5LHI A;  4GGG A;  3DP7 A;  5DV5 A;  5CVJ A;  2MC3 A;  2J5O A;  1YO5 C;  4KMF A;  5IT9 Z;  3WU0 A;  3R0J A;  4LB5 A;  2VBZ A;  4G6Q A;  4DQ2 A;  2IJL A;  4IF4 A;  4OIN F;  1T39 A;  1BI2 A;  3FXQ A;  5HLG A;  3GXO A;  4UNO A;  4EM0 B;  3L9F A;  1IRG A;  1RIO H;  4KIC A;  3TO6 A;  5ICG A;  1J59 A;  5ILS A;  1R5H A;  4IVN A;  4RB3 C;  4EVI A;  4KIF A;  2FBI A;  3DPL C;  2ISY A;  1G4D A;  4RB1 A;  3GFI A;  3LAJ A;  4HV6 A;  1CF7 B;  3BZ6 A;  2HWV A;  3QOP A;  2NNY A;  1J9I A;  5BPD A;  3MAJ A;  1G3S A;  4WXH A;  4HA8 A;  2ZCW A;  2OAZ A;  2DBB A;  2J5P A;  3GFM A;  4HX7 A;  4BHB A;  1YYV A;  1V3F A;  3TQN A;  3E6C C;  2GA2 A;  1W7P B;  1HW2 A;  2CWE A;  2FE3 A;  4AD9 A;  1ZGA A;  2GQQ A;  2A6H F;  1UCR A;  4P96 A;  1XN7 A;  4UUV A;  4CO8 A;  4OMZ A;  1YLF A;  3O3K A;  4EV0 A;  1Z91 A;  3BDD A;  3MEX A;  3GUD A;  3WTV C;  3I64 A;  1BIA A;  1P92 A;  3I0T A;  1WWX A;  2VOO A;  2QQA A;  3P9C A;  4KN4 X;  4UV9 A;  3J7A O;  2P4W A;  4RGU A;  3L2C A;  1O3T A;  2P6S A;  2W85 A;  2A61 A;  3Q9V A;  5E1Z B;  4CXF A;  5DEQ A;  3I59 B;  3BJA A;  2COM A;  4KYW A;  5DCM A;  1LDD A;  2D2W A;  2VXZ A;  1TW2 A;  1IXC A;  5DUI A;  3R6S A;  1R36 A;  2QLZ A;  3ZMD A;  2IRF G;  1QO0 D;  2DLL A;  2YR2 A;  3EQL F;  3J81 Z;  2FBH A;  2GA1 A;  2QWW A;  1HKS A;  3D0S A;  1A04 A;  2OZU A;  5HS9 A;  4LB6 B;  2F5F A;  2EB7 A;  1FSH A;  1K6O A;  2STW A;  2H6B A;  2BGC A;  3RYP A;  2O6G E;  3VOD A;  4U0V A;  3ZN0 A;  4EGY A;  2OQR A;  3G73 A;  3C18 A;  5IT9 K;  1TBX A;  3RPU A;  1ZGJ A;  1BN5 A;  5D6E A;  5HDN A;  1FYL A;  1SFE A;  3QPT A;  5K5R A;  1G3W A;  4WXC A;  2VT2 A;  3CO6 C;  4A2U A;  3GFL A;  2Z5U A;  4ZYD A;  5J6X A;  5K5O A;  3EDP A;  1HW1 A;  4I98 B;  3CUQ A;  1E17 A;  3EET A;  4KDP A;  1FP1 D;  3FX3 A;  2RVC A;  2UWM A;  2HKX A;  3KEO A;  3ZP5 A;  4CZZ A;  5FLX Z;  2CYY A;  5ICE A;  5JHU A;  3RKY A;  4NHJ A;  5CVI A;  5F1R A;  2Q2E A;  2MD5 A;  2RV8 A;  4BH9 A;  3C1D A;  2P5L C;  3S2W A;  3PFI A;  4IRI A;  5LRR A;  4U7D A;  1B9M A;  1BOA A;  1Z6R A;  3WTW C;  1U3E M;  2LKP A;  2VBW A;  4OIR F;  1IXR C;  1XDS A;  3I5U A;  3BPV A;  2VC0 A;  3GWZ A;  3ECH A;  1IW7 F;  3RIR A;  2QVO A;  2XAJ A;  3I54 A;  2WTE A;  1EV7 A;  4RGX A;  3TO7 A;  1IN7 A;  3IRR A;  2NNN A;  4ZZL A;  4MQV A;  2JRT A;  4HF2 A;  5D4S A;  4KIB A;  1HXD A;  3MWM A;  1YFH A;  1HST A;  1MGT A;  4LG0 A;  3WTS C;  3ERE D;  5FO5 A;  4M9Z A;  2CW0 F;  1T2K A;  3K2Z A;  3HIF A;  3ZMS A;  1JHF A;  2PJP A;  5FB2 A;  1W4M A;  3ZMZ A;  4UVC A;  2HQR A;  2F5D A;  1V4R A;  3V7C A;  1R1V A;  2RC4 A;  2DPU A;  3W6J B;  2P5K A;  4LK0 F;  1FWZ A;  1B4A A;  3GFJ A;  5DD4 A;  2A07 F;  1MKM A;  2A6E F;  4QLC U;  2CO5 A;  2EFN A;  3ZQ7 A;  3J81 K;  3F6V A;  1JGS A;  3VOE A;  3LFK A;  3GW2 A;  3FF5 A;  1ZRF A;  2RKH A;  1YS7 A;  1XSD A;  2IT0 A;  3ZMT A;  3H3U A;  1Y0U A;  1YTY A;  2ADU A;  4EM2 A;  1RNL A;  5CJ9 A;  3F8C A;  1QZY A;  1BI0 A;  1KYZ A;  1QNT A;  2XRN A;  3PQJ A;  2HYF A;  1BIB A;  5L3C A;  2DK8 A;  5J8C A;  2P5V A;  3GX4 X;  4M74 A;  3Q9S A;  2OD5 A;  5JI6 A;  1K78 B;  2K02 A;  2DT5 A;  3U2R A;  2ZXJ A;  5HLH A;  3P9K A;  4P55 A;  2MLG A;  1SAX A;  5TRD A;  3KP4 A;  4FX4 A;  1IRF A;  5L3B A;  1FBS A;  4ON0 A;  5FLX K;  1FOK A;  1J2X A;  3LAP A;  3F21 A;  4BHP A;  1MDM B;  1CGP A;  2D45 A;  1EH6 A;  1W7P D;  4ZZD A;  2XVC A;  1KGS A;  1OYI A;  1LDJ A;  3NQO A;  2F5E A;  1U78 A;  3WOD F;  1J0R A;  3M8F A;  4L18 B;  2XGX A;  4LLN A;  2QBY B;  5BPI A;  3T8R A;  3MCZ A;  2FMY A;  4P9F A;  1P4X A;  2KIM A;  3R4K A;  2FNA A;  1U6G A;  2RN7 A;  2PI0 A;  3TDZ C;  3GVA A;  2NYX A;  1MD0 A;  2GWR A;  4MNU A;  1DPU A;  2HGC A;  2VOD A;  1IAW A;  4HQE A;  4HV5 A;  2PBI A;  3CLO A;  1OYW A;  2K4B A;  2ESH A;  4NB5 A;  2OBP A;  1BC8 C;  5E18 F;  1Z6T A;  5HS7 A;  4KMU X;  1RZ4 A;  1F9N A;  2NAZ A;  1TNT A;  1AWC A;  2XAG A;  4A12 A;  4KIG A;  3E6B A;  2VE9 A;  2FBK A;  4ETS A;  3FM5 A;  4RAY A;  1XD7 A;  4MTD A;  3F72 A;  5FGM A;  1J75 A;  1ON2 A;  4Q4Z F;  4XBF A;  2OQG A;  3QU3 A;  3ROU A;  1SD4 A;  2XKP A;  3CDH A;  1GXP A;  1NHA A;  3Q5F A;  4KNY A;  4L9N A;  4EJT A;  3HSR A;  4PDK A;  2VOP A;  1YW9 A;  1FYM A;  3C7J A;  4R1H A;  4U0Y A;  1PDN C;  4R8H A;  2GZW A;  3TDU C;  3SZP A;  5L3E A;  1IN5 A;  2DAO A;  2EA4 A;  3JSO A;  2ESN A;  2V9V A;  5LBQ A;  1SD6 A;  3SHF A;  5BS6 A;  1B1B A;  2V6C A;  4OU0 A;  2EWN A;  2EFW A;  5ICC A;  1PP8 F;  1FNN A;  3HRU A;  5F6F A;  1L3L A;  3ISP A;  3FMS A;  4A5M A;  1FBQ A;  1HKT A;  4CDG A;  1O3Q A;  3F8N A;  3K1M A;  1R58 A;  1TQI A;  3O6B B;  2EV5 A;  4HDV A;  3REO A;  2F5C A;  4ESJ A;  3IRQ A;  3V4G A;  2MA3 A;  4WXD A;  4ESB A;  3HOS A;  1XDU A;  5ED4 A;  4G94 A;  1ZAO A;  2QYO A;  3OOP A;  3RI4 A;  4FX0 A;  3JW4 A;  1D5V A;  4YIF A;  3BY6 A;  3E3V A;  1G6N A;  1ZLJ A;  2XHK A;  4IXA A;  5DUK A;  3KCC A;  2EA2 A;  1ZRE A;  1ZRC A;  2JSC A;  3WTY C;  3ABU A;  5JR3 A;  3MZY A;  2ELH A;  1BI1 A;  2CFX A;  3MZH A;  3M8E A;  4RGR A;  4L5J A;  4HDU A;  1P4A A;  2WC2 A;  1DUX C;  2GIV A;  2M87 A;  3IKT A;  1FX7 A;  5ERI A;  1W5S A;  1B9N A;  1R00 A;  3N97 A;  1IXS B;  3VB2 A;  2GAU A;  4ESF A;  3GO5 A;  1ZG5 A;  1QZZ A;  4IRG A;  3KP7 A;  4EMS A;  4HYE A;  2VC1 A;  2HZT A;  2FEZ A;  5FD5 A;  2O03 A;  3ELK A;  2BYV E;  4LLL A;  4I0B A;  4P9U A;  4L9J A;  1O7F A;  1W7P A;  3WG9 A;  3F8M A;  1XCV A;  3QP6 A;  5E1X A;  4HBL A;  2HYG D;  1S8N A;  4WCG A;  5ILU A;  1XGM A;  1S3J A;  1O57 A;  5E20 A;  3CUQ B;  4OMY A;  4I2O A;  2CQK A;  2V1D A;  5D5V B;  3E5Q A;  4LLG F;  4KN7 X;  2HFH A;  2DK5 A;  5D6F A;  1R1T A;  1S6L A;  3BRO A;  4B09 A;  1UFM A;  1FBU A;  3ZPL A;  1U5T B;  3TKY A;  1T98 A;  3FM3 A;  4Y13 A;  2H94 A;  4U7B A;  2DW4 A;  4CGZ A;  1RUO A;  1LEA A;  2R3S A;  2DO7 A;  3I59 A;  3KLO A;  1G3T A;  4M71 A;  1Z1D A;  4F7Z A;  2IW5 A;  3BJO A;  2XV4 S;  3KP6 A;  4IJA A;  1OPC A;  2EK5 A;  1MJB A;  2A69 F;  3K9T A;  2KIU A;  3WE2 A;  4Q47 A;  1FZP B;  2Z99 A;  3QPH A;  3I4P A;  1YIO A;  2BE5 F;  2MBF A;  2ETH A;  5LGT A;  2M8E A;  3KZY A;  2P8T A;  2H6C A;  2ISZ A;  2HQN A;  4RGS A;  3CJN A;  5KVR A;  1H9G A;  2L54 A;  5BQT A;  5CLS A;  3VEP A;  4A0Y A;  3R61 A;  2E1C A;  3QP5 A;  5L3D A;  4Q48 A;  1HBX G;  1H0M A;  1Z05 A;  3RJP A;  2L01 A;  3D5L A;  2ACJ A;  4GXO A;  2JPC A;  1G3Y A;  1T0F A;  4EJU A;  4UVA A;  3QU6 A;  2M1B A;  3WGH A;  1E2X A;  4L0Y B;  2V1U A;  5BOX A;  4BNC A;  4G7O F;  3WTX C;  1IUY A;  2ZJ2 A;  2DU9 A;  3WTT C;  1YG2 A;  4A6D A;  1DP7 P;  1SMT A;  2EFQ A;  3CUO A;  4PGH A;  2VBX A;  3K0L A;  1PUE E;  3M1E A;  4NQW A;  1FLI A;  2UXX A;  1OKR A;  3K1P A;  1LNW A;  2Z9O A;  3HOT A;  3HSF A;  1F5T A;  2L4A A;  4KA4 A;  1SFX A;  1QQI A;  3E5U A;  5L3G A;  5A2Q Z;  2TDX A;  4XRF A;  1IN8 A;  1ZHF A;  4IRH A;  1LB2 A;  1R23 A;  5ILV A;  3V8J A;  5D4R A;  2GXG A;  2K27 A;  4O6J A;  3SXY A;  3T8T A;  1XB4 A;  2M5W A;  4N0B A;  4LJZ F;  2VN2 A;  4LGW A;  3CTA A;  2O8X A;  3EYY A;  5E8I A;  1F1Z A;  1FSE A;  2PN6 A;  1ZG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...