1S7AA

Nmr structure of the la motif of human la protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lupus La protein
publication title Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, translation
total genus 18
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s7aA00
4R1HA 1IN6A 2V6CA 2OAZA 3ROUA 5DD8A 4QLCU 1IN4A 3QPTA 1BM9A 3HRTA 3NQOA 5ILUA 2EFPA 2CO5A 3JSOA 3Q5FA 2RV8A 4KNYA 4O3MA 5ICGA 3KP5A 4U0WA 1MD0A 4B8XA 2HR3A 1Z6TA 3HTUA 1B9NA 4L9JA 4YG2F 4BXUA 1W7PD 1W7PA 3H3ZA 3CO6C 2OBPA 1BIAA 3HTSB 1K7AA 2HWVA 3C7JA 3MCZA 2XAFA 1WKMA 3SFZA 1HSJA 3ZN1A 4L0ZB 2HKXA 1UHWA 1UCRA 1Z1DA 4ZYHA 4EJOA 1R1TA 1A04A 4L0YB 3IHUA 2KIFA 1I27A 2E1CA 2O03A 4CO8A 1XCBA 4RB0A 1KQ0A 4U7DA 1ZYRF 4EMSA 2JZYA 4EJWA 4G8XA 1Z9CA 3KP4A 1YW7A 1QPMA 1R58A 3T5XA 2Z5UA 2GWRA 3FM3A 4R8HA 3K1NA 3WGIA 5F64A 2EA4A 5AONA 2K7LA 1CF7B 1MGTA 3P9IA 3TQNA 1D8KA 4LK0F 5CJ9A 3SZTA 2VOPA 3TDUC 2RGVA 3BJ6A 2E7XA 4KFCA 4YFKF 4PGHA 1S29A 3RYRA 3TGNA 1D8JA 3P9KA 3LQQA 1MJ9A 1USSA 3F8NA 3CUQB 2QBYA 1YFHA 3F22A 2D1HA 5ILVA 1ZRCA 3FMSA 3RDIA 2F5CA 4KN7X 1S7OA 4KUMA 3K0LA 5DV5A 3E5XA 1PP8F 1FYKA 2O0YA 2M5WA 4EGZA 4PCQA 3WE2A 4WX9A 4MNUA 5ICFA 1OR7A 4LJZF 2C6YA 2P8TA 4HYEA 4HX8A 1G3TA 1FBSA 1J7KA 1XD7A 4RGSA 1H9GA 3GF2A 2CGPA 4PDKA 2PJPA 4U0YA 3GEZA 3QP5A 4DQ2A 3CUQC 3WGHA 1FY7A 5BPDA 3HSEA 3GFJA 3ECHA 5BPIA 3LA2A 1MKMA 2ELHA 3L09A 2FEZA 4KDPA 1XMAA 1V4RA 1XDUA 3L2CA 1JXSA 4A6EA 3F6OA 2HTSA 2YSRA 2UXXA 5J6XA 2KRFA 3JTHA 2MD5A 2HQRA 4IRGA 1W4MA 3FXQA 2P4WA 4UXNA 2P5KA 3DP7A 4CHUA 3J80Z 4OIQF 4NB5A 4HF0A 1DP7P 5IT9Z 4S04A 1LDJA 1XGNA 2M30A 3KFWX 5LHIA 1BN5A 2VE9A 4IRHA 3R0JA 2BE5F 3LQRA 3R0AA 1FPQA 2KJBA 3TOAA 2O6GE 3ZMTA 1S8NA 4N9HA 4IVNA 5D8KB 1FZPB 3TO9A 3M7GA 4I2OA 2JSCA 1DPUA 1HKQA 2DLLA 5E1XA 1W7PB 5JFRA 5CVUA 5FLXZ 5LHHA 3SXYA 4FX4A 2IVMA 4RAZA 1K78A 1TW3A 4E70A 2HEOA 2F2EA 3LAJA 1F9NA 1ZH5A 5DCMA 4ZZDA 4XSZF 1ZARA 2MLGA 4GGGA 4U7BA 2ZNZA 3W6KB 2F5FA 2BV6A 3DEUA 3C1DA 3RKYA 2W25A 2ACJA 4KT5C 3HOSA 4HDVA 2GA1A 3R4KA 4KIFA 2NNYA 3FF5A 1KYZA 1P4XA 2IPQX 1QQIA 4UVAA 4IHTA 2Z9OA 2FBIA 1ON1A 5L3CA 3BPVA 4M71A 1USTA 5HS8A 4DNCA 2ZO4A 1KU7A 4P96A 1AOYA 1UFMA 4WXCA 4KMFA 4U88A 1ZLJA 2H6BA 1R23A 2IW5A 2V1UA 2FF4A 4EM2A 5ED4A 3WTWC 3CDHA 3F8BA 2QBYB 2GXGA 1T6SA 2NNNA 4B09A 3WE3A 3GXOA 1REPC 5CVVA 4HW0A 3U9GA 3DQVC 6PAXA 4UNOA 5AIQA 3O3KA 1FLIA 3VOEA 3PFIA 5H6RA 4A0XA 3RTRA 2D1VA 3WTXC 5JI6A 4LMYA 1F1ZA 4WXDA 3DPLC 3BROA 3R60A 1E17A 1DUXC 1I1GA 1V3FA 1BIBA 4IF4A 2A6HF 1Z7UA 2AS5F 2V1DA 1U8RA 1T2KA 2PFBA 3B73A 3KP3A 4LD5A 4I09A 1F4KA 3HIFA 3FMRA 3V8JA 4LK1F 3IKVA 2UZKA 5HVQC 5FB2A 4IRIA 2LNBA 4BHPA 2IA0A 3HHHA 3KP6A 2ZJ2A 5LBQA 3VODA 2IA2A 3LWFA 1ZRDA 2XV4S 5HS9A 4YIIA 1BI0A 5LLQA 5E8GA 3VB2A 3FXRA 4IPAA 2FQ3A 3RPQA 4Z2YA 1FYLA 4CYDA 4I98B 2Y0MA 1XDSA 5DCFA 3GZ6A 1T98A 1OKRA 3E6DA 4OMYA 2PG4A 2Z99A 1WI9A 2QENA 2HYFA 1FT9A 4HAMA 5A2QK 1X3UA 2RQPA 1OYWA 1I1SA 1SD7A 3DV8A 2XHKA 1LVAA 4M9XA 2JRTA 2NS0A 3HSFA 2CW0F 2A68F 1K78B 5IT3A 2KJCA 4P9UA 3KEQA 5L3EA 5E18F 1OPCA 1YIOA 2QQ9A 3EYIA 2E7WA 5DCMB 3IL2A 1IN8A 5FD6A 3TKYA 5HLHA 1R00A 1B4AA 5FD5A 4FHTA 4HA8A 4L9VA 2GA2A 1QZZA 5D6FA 4UVBA 1KGSA 3T1BA 2FRHA 3TO7A 3JAMZ 4JQFA 2K02A 1TQPA 3R61A 2Y75A 2W24A 3QU6A 3MAJA 4G7OF 1OYYA 5D6EA 3ISPA 2L02A 3CTAA 1XSVA 4NQWA 2GQQA 2ETHA 4G7HF 4LFUA 1P6RA 4K2EA 1Q1HA 3EYYA 4UV8A 3PQKA 4FT8A 2EFOA 4G6QA 2ADUA 2J5PA 2X4HA 2BGCA 3JW4A 2X0LA 4HX4A 4L5IA 2XROA 1Z05A 2W57A 2VBWA 2H6CA 2XAJA 3F8MA 3KLOA 2P6TA 4XSXF 2G9WA 4M6YA 5H20A 3ZP5A 3T8TA 2XASA 2Q0OA 2XAHA 3MQ0A 4OOIA 5DUIA 1G3WA 2W84A 3RI4A 1P4WA 2K27A 1HKSA 2DPDA 4PGGA 1R1UA 1BC8C 5HDNA 4KIGA 2CYYA 3OOPA 4ENNA 2KIMA 3GUDA 3U2RA 3TO6A 2VOOA 3M1EA 1FSEA 3KP2A 1KU3A 2STTA 3E5QA 4JK1X 1FWZA 2XUBA 4MQ9F 3DKWA 4G7ZF 1XSDA 1TTYA 2MH2A 5LGNA 5E20A 1S7AA 1P92A 5L3DA 4R79A 2NAZA 4Q4ZF 1O3QA 5D5VB 2VT2A 1ZGAA 3ZMSA 2BEOA 5HS7A 2OA4A 1KU9A 4ZH4F 1XSXA 4M9SA 4ENJA 3TOBA 3HRMA 2FXAA 2KIUA 2K4BA 2XKPA 1BI1A 4PZJA 1YW8A 1AWCA 4YFXF 4ASNA 1FBQA 1UB9A 2HDCA 4M73A 5BQTA 2GIVA 4RGXA 2XRNA 1MDMA 2CSOA 1ON2A 4ESBA 5CYVA 4ENKA 3BY6A 1LB2A 2BYVE 1S3JA 1MJAA 1BBYA 3QU3A 4UVCA 2RDPA 4UHTA 2PQ8A 3HUGA 1YTYA 2YR2A 4RGUA 3VEPA 5TJJA 4AIJA 2DW4A 5FO5A 1ZN2A 5F1RA 2L3DA 3NRVA 5LHGA 2WC2A 1RZ4A 3L9FA 2QVOA 1P4AA 3C18A 1IRFA 3QRFF 1JHHA 1U2WA 2CQKA 2VN2A 3GWZA 4HV6A 2NYXA 4HZFA 2HQNA 1XGOA 3J7AO 5E17F 3VFZA 4RB1A 3JSPA 1J0RA 1U6GA 4WF2A 1BI2A 1TNTA 2P6SA 2WV0A 4HLYA 2QUFA 3J81Z 2EV6A 2YX7A 3FWEA 1GVJA 4MEYF 1WQ2A 1G3YA 4BHBA 1XCVA 3V7SA 1HW5A 3ABTA 4BH9A 3F8CA 4EQQA 1I6XA 1Z91A 3P7NA 1QBJA 2J5OA 5EEHA 2HYGD 3GLXA 2XKOA 3I58A 2IP2A 2AXLA 1E2XA 1J5YA 5BS6A 4LGWA 1MZBA 3KZZA 4L5JA 4YIFA 4A0ZA 3EQLF 1KQ8A 3D5LA 4MTEA 3Q9VA 3GO5A 5ICEA 2P7VB 2DU9A 2FOKA 4EJVA 1ZRFA 1SFUA 1HW2A 5K1YA 1ZREA 2F5EA 4WCGA 2P7CB 2EV5A 2ESNA 1PDNC 2V1XA 1O3RA 3WTTC 5K5RA 5J8FA 4OIRF 3M8FA 3AAFA 2K4JA 5H6QA 1SD6A 2LDUA 3H92A 4RAYA 2IA1A 3SHFA 5CVJA 3DFGA 1VTNC 3E97A 1FX7A 3LA7A 5KVRA 3BP8A 3NEUA 3MZHA 1GHCA 3KLNA 4EM1A 1HKTA 1K6OA 3Q9SA 5DDGA 4O6JA 1ULYA 3WTVC 3L00A 4N0BA 1R5GA 5BMZA 1T39A 2FSWA 2EA2A 4LB5A 2WWYA 4HF2A 1ZLKA 5LEKA 1IN5A 2EB7A 3O2PE 3RJPA 3T0YA 1Z6RA 1FP2A 4HQEA 1R1VA 3G73A 2QZ8A 2VT3A 4KIBA 1JGSA 3KEOA 3ULQB 4ZZLA 1D5VA 1MJBA 4HLXA 1STZA 5EEGA 3V4GA 1KQ9A 1FC3A 2QQBA 5D5UB 4BAYA 2M87A 1KA8A 2Q2EA 4F7ZA 5K5OA 2YPRA 4KICA 3M9AA 3DXJF 1MDMB 1UHMA 2IT0A 2CFXA 1I5ZA 2IJLA 4O5VA 1CGPA 3ZPLA 4ESJA 2VODA 3LFKA 2MA3A 1HW1A 1QNTA 1WRJA 3HYIA 2EJRA 3I71A 3DPTA 5HLIA 2OQGA 2Y48A 1RUNA 5DEQA 2DBBA 4QWQA 4ETSA 3CJNA 1YQAA 3MWMA 1IUYA 2D45A 5AIPA 4AIKA 2R3SA 2H27A 1L0OC 1K79A 5D8LB 3WTYC 3M8EA 4CICA 4L9NA 4U0VA 4TV7A 1FBUA 4Q48A 3F23A 2KKOA 2STWA 5FGMA 4Y15A 2WTEA 2DFIA 4UV9A 5FFZA 1BOAA 3FHZA 2O61A 3EUHA 2K86A 4HQMA 5D5XB 2OZUA 2GAUA 5D4SA 2V9VA 2PLYA 1L3LA 1B9MA 3BJAA 1IN7A 3WU1B 4CDGA 2EWNA 5ERIA 1SFEA 4AVPA 2FE3A 4IXAA 4I02A 3E5UA 3BPXA 3FZVA 1BI3A 4I0BA 4H0EA 4UUVA 2A69F 2ZMEA 2NRAC 2P5VA 5J8CA 1O3TA 2O3FA 1SMYF 2M1BA 5TRDA 4ON0A 2ZFWA 3V7RA 2B0LA 3WTSC 3RKWA 4EV0A 4KN4X 2D2WA 2PI0A 4CZZA 3BOQA 2Z33A 3ML6A 4I01A 1O7FA 4OMZA 3HRUA 1RUOA 2TDXA 4P5OA 2MC3A 2O8XA 4ZYGA 2FNPA 3GZ5A 3WTUC 3FMQA 4HBLA 5LRSA 3J80K 5IT9K 4GYGA 5HDKA 1BJAA 1YW9A 2PEXA 4P9FA 2JT1A 4ZYDA 3V7CA 3E6MA 4M6XA 1DDNA 1TQMA 3L7WA 4RB2C 5D5WB 4L9TA 2ZXJA 3I4PA 2HGCA 2HTJA 5ICCA 1Y0UA 2PMHA 3T8RA 1IW7F 1U5TA 1F5TA 4XLNF 3ZMUA 3WU0A 2JTVA 3HSRA 3KCCA 4EVIA 4BYYA 1FSHA 4XLPF 5FLXK 3QOPA 1LDDA 4GO1A 3I59A 4EJUA 4A5MA 1W5TA 4BQAA 4A5NA 1P2FA 1GXQA 2GXBA 3K1PA 4I7HA 1C0WA 1ZG5A 3E6CC 5DYMA 1EH7A 1YS6A 1FP1D 2FBHA 3ELKA 4EGYA 2FMLA 1GXPA 2A6EF 1O7LA 3HOTA 2MLKA 3I53A 1LEAA 3ZQ7A 1JE8A 2A5YB 3I54A 4LB6B 5D4RA 1RIOH 3U1DA 4MGRA 2G7HA 3GFIA 2ISYA 2Z3YA 1XB4A 2L4MA 2ZKZA 5DUKA 4OU0A 2V79A 3ZMVA 3SZPA 5KK1A 2QQAA 3FX3A 2PBIA 1XGSA 2RKHA 1EH6A 2DPUA 3HRSA 1HQCA 2ZBKA 5LRRA 2COMA 3K9TA 4MEXF 4L18B 5ILSA 2QWWA 2P5LC 1RI7A 2OU2A 1SAXA 4AIHA 1YO5C 2VE8A 5DD4A 4GYIA 2A3SA 2XVCA 5JR3A 1BC7C 2BBYA 4XRFA 1G6NA 4A6DA 3F6VA 2VONA 1EV7A 3V8LA 1TNSA 4YFNF 5L3BA 4LG0A 4G6DA 2FBKA 3QAHA 2EV0A 2F5DA 1J75A 1T0FA 3E3VA 3D0SA 2VC1A 1FYMA 4CXFA 4D0PA 2QYOA 1SFXA 2H94A 3MFKA 1TQIA 5CLSA 1B6AA 1ZAOA 5LEJA 3ECOA 5E8IA 4A12A 3I64A 5A2QZ 1RNLA 4RS8A 3KE2A 4WWCA 3MEXA 1S6LA 1HXDA 1FNNA 2ZMEB 2XAGA 2OQRA 1W5SA 4BHCA 3RKXA 4MTDA 4RB3C 4ESFA 2DQLA 2UWMA 1DPRA 1EH8A 3E6BA 2IRFG 2Q8KA 4MQVA 3BDDA 5JHUA 2VBXA 3JTGA 4A0YA 1LJ9A 2YU3A 3R6SA 3O6BB 1R36A 4AWXB 1TLHB 1KYWA 2CG4A 2FU4A 2EFQA 2RNJA 3COAC 1T38A 2W85A 1LQ1A 2DK5A 3ZN0A 1O3SA 4AD9A 5F6FA 1G4DA 4GCVA 3B02A 1J2XA 1YS7A 2VXZA 1HSTA 3H3UA 4HX7A 1NHAA 3BWGA 3DF8A 1D3YA 1IXCA 1ZGJA 3ZMZA 3P9CA 3LSTA 5LGUA 1YG2A 3N4MA 2JPCA 1SD5A 2EFNA 2HS5A 1IZ1A 3HHGA 2MBFA 4I0AA 3V8KA 2UXNA 2EK5A 3QP6A 1B59A 3RYPA 2VC0A 2OZ6A 1YYVA 4KMUX 2FA5A 1WSUA 4GXOA 1U5TB 3KP7A 3GX4X 2DI3A 2R7FA 2HFHA 2ZCWA 1YLFA 2HOEA 3I59B 2PMUA 4G9YA 3RPUA 1R7JA 2A61A 5HLGA 2VBZA 2QM3A 1ZG1A 3GFLA 3QPHA 1ODDA 2ESHA 4NHJA 5E1ZB 5JVTA 3GW2A 5LGTA 4RGRA 2JPBA 3S2WA 3IC7A 3JAMK 3I5UA 2GZWA 3W6JB 2YX4A 5K5QA 1LEBA 4EJTA 2E1NA 2G7UA 1LNWA 2VBYA 1ONVA 1JHFA 1IXSB 4Y17A 1SD4A 2FMYA 4WXHA 5E1WA 1U5TC 3N97A 3K69A 1H0MA 4WK8F 2L54A 3GFMA 3WG9A 2ISZA 3RIRA 4OINF 4N9IA 1R22A 2H09A 2OD5A 1IXRC 2RC4A 3WODF 3IRQA 3F3XA 3CLOA 4P55A 1QO0D 3SQNA 4HDUA 2LSOA 3I0TA 4CGZA 4LG0B 3ABUA 3MZYA 2XGXA 1LDKB 1PUEE 2L4AA 2RVCA 2DAOA 1HBXG 1SMTA 4LLGF 1XN7A 1XGMA 3WTZA 2ZNYA 4OIPF 3CUOA 1TW2A 5HOOA 1OYIA 3OV8A 1PP7U 1U3EM 1TBXA 2XAQA 3F8FA 3K2ZA 1O57A 1QZYA 4ZYEA 3BZ6A 4EM0B 3K1MA 1ZHFA 4M9ZA 5FFXA 3IWFA 3FXUA 1CF7A 2DK8A 2LKPA 3LAPA 2A07F 2EFWA 2PN6A 3G3ZA 1J9IA 1XMKA 5CVRA 1QGPA 3TDZC 4MHGA 4Y13A 4A2UA 3CUQA 1WWXA 3LA3A 3KETA 4G94A 1OMIA 4KA4A 2R7DA 3ZMDA 1U78A 5L3GA 3REOA 4HV5A 5CVIA 4LLNA 2RN7A 3BJOA 4M72A 5HDGA 1J59A 4OIOF 2DT5A 2M8EA 4FX0A 4BNCA 4ENMA 1IAWA 3ERED 3IRRA 5BOXA 1ZG3A 1B1BA 4KYWA 2DTRA 2L01A 1G3SA 3IWZA 4M74A 4LLLA 3C3WA 3WGGA 4XBFA 2CWEA 4JBAA 3GYHX 3F21A 4Q5SF 2FNAA 2LF7A 3IKTA 2DO7A 3PQJA 3GVAA 3FM5A 2M45A 3EDPA 1H9TA 3F72A 4Q47A 4HOBA 4S05A 4HF1A 1KU2A 2DQRA 1R5HA 2HZTA 2LF8A 4IJAA 3KZYA 3J81K 1IRGA 2QLZA 3CO7C 4IHSA 3EETA 1IF1A 1FOKA 2HKOA 2XIGA 5L3FA 2MH9A
chains in the Genus database with same CATH superfamily
4R1HA 1IN6A 3FHNA 2V6CA 2OAZA 3ROUA 5DD8A 4QLCU 5EG0A 3AG1H 2R7TA 2DN0A 1IN4A 3QPTA 1BM9A 3HRTA 3NQOA 4P1WA 5ILUA 2EFPA 1IUFA 2CO5A 3SYTA 3JSOA 1R4NB 2DA4A 3Q5FA 2NOGA 2RV8A 1R4MB 3KZIC 4KNYA 4CYCA 4O3MA 1I6HJ 5ICGA 3KP5A 3PFYA 1FTTA 2OCEA 4U0WA 1LVKA 1Z3XA 3GMEA 4A69C 1MNDA 1MD0A 4B8XA 1B8IA 2HR3A 1E3PA 1I3AA 1WPKA 1X2NA 1Z6TA 3HTUA 1XTAA 4AYBA 4C2MJ 1B9NA 2H8RA 1E0EA 4L9JA 2GBYA 2IEKA 2VQHA 2WAEA 3BR1A 3OL4A 3OY9A 4YG2F 1BL0A 2MSYA 4J01A 1MBEA 4UUSB 3UNGC 4BXUA 1W7PD 2EZLA 4IHXA 1R49A 1W7PA 3H3ZA 2NVTJ 3CO6C 4NUBA 2OBPA 1BIAA 3HTSB 1K7AA 2HWVA 2LMDA 2XRLA 3C7JA 3MCZA 3CD6I 2XAFA 1WKMA 4RLFA 3SFZA 2H1LA 2DA6A 3QODA 3S1NJ 1HSJA 3ZN1A 4L0ZB 2OJED 2HKXA 1UHWA 1UCRA 3JR9A 3AL0B 3OS0A 1Z1DA 2XGDA 4IL6C 3W3CA 1LE8A 4ZYHA 4D7NA 4EJOA 1R1TA 1A04A 3OIOA 4L0YB 3IHUA 2KIFA 1I27A 2E1CA 4A3JJ 4CCOA 3TP3A 2O03A 4DGWB 4CO8A 4J00A 1Z67A 1XCBA 4RB0A 2YU9J 1KQ0A 4U7DA 1ZYRF 4EMSA 2AQEA 2JZYA 5F1JA 2G0EA 2KDZA 2R7RA 1WVRA 4EJWA 5IYBJ 1IRZA 2IAIA 1U8BA 5DM6F 4G8XA 4PJ0C 1Z9CA 1OCPA 3KP4A 1JT0A 1YW7A 1QPMA 1R58A 3T5XA 2Z5UA 2GWRA 1OJLA 4ZDLA 1SC7A 1QU3A 3FM3A 3DKXA 4R8HA 3K1NA 3WGIA 1BR2A 5F64A 1YIJI 2EA4A 5AONA 2QSHX 2DA7A 5F27A 5FLVA 3L1PA 2K7LA 1CF7B 3Q3SA 3MVPA 1MGTA 2CQ7A 3P9IA 4CCMA 3OYDA 3VYUB 3TQNA 1D8KA 3A2KA 3FXOA 4LK0F 3D5RC 5DM7F 2QKMB 1IO2A 2XGCA 5CJ9A 1Y1WJ 3WHCA 1J09A 3GTMJ 3SZTA 2I8DA 2FUG2 2VOPA 2VJ4A 3TDUC 1YRNB 2X6XA 2RGVA 2L0KA 3JRGA 3BJ6A 2E7XA 4KFCA 2LK2A 4YFKF 4PGHA 1S29A 1Z3YA 3RYRA 3TGNA 1D8JA 3I4MJ 3P9KA 3LQQA 1MJ9A 2K9LA 1USSA 3F8NA 5EF6A 1Z77A 3AL0C 4IQ4A 3CUQB 1OCRH 2QBYA 2E71A 1YFHA 1I50J 3F22A 2D1HA 1IDZA 2KHMA 5ILVA 1W0TA 1ZRCA 3FMSA 3RDIA 3FK6A 2F5CA 4KN7X 3FXMA 2CQQA 1Y6IA 4ZTJA 4HSRA 5KCMA 1S7OA 4KUMA 3OYKA 2HDDA 3K0LA 5DV5A 2XF5A 2QSGX 3E5XA 4XRSA 4M3DA 1M1EB 2OUMA 2DA1A 3S93A 1PP8F 1FYKA 3G2BA 2VL8A 2CFOA 2O0YA 2M5WA 2KT0A 2WV1A 1SVOA 3H0DA 4EGZA 3RQIA 4PCQA 2Z2SB 3WE2A 4E7SA 1SVLA 1H8AC 2A05A 4WX9A 4IHYA 2R5ZB 4MNUA 5ICFA 3A02A 4ZC3A 3RSNA 1OR7A 4LJZF 3PJRA 2DTZA 4LIUA 2C6YA 3MZ8A 4QTRA 1HCRA 1BJZA 2JN6A 2ECBA 3CC7I 3HM5A 2V9KA 3LOCA 3FDYA 2P8TA 4HYEA 1MNMC 4HX8A 5K7FA 1G3TA 1HF0A 3M3YJ 1W5CC 1FBSA 4HNUA 4GRIA 1J7KA 1XD7A 4XNFA 4RGSA 2KLOA 2GOXB 1H9GA 2ME6A 2CW8A 3GF2A 4FCYA 2CGPA 4PDKA 2PJPA 3CC2I 1RC9A 4LOCA 4U0YA 3GEZA 3QP5A 4DQ2A 1LQ1A 2R7QA 3IAM2 1WJEA 4C2UA 3CUQC 3W2WA 3WGHA 1OCTC 3DTEA 1FY7A 5BPDA 4A3DJ 3HSEA 1U9NA 3GFJA 3ECHA 4E7JA 2KQRA 4Y33A 2OTLI 2DMUA 5BPIA 2ECCA 3LA2A 1MKMA 2ELHA 3L09A 3D1NI 2FEZA 1VQ7I 2CV2A 4KDPA 1XMAA 1V4RA 3G1MA 2FJ1A 1LPQA 1XDUA 3L2CA 1JXSA 4A6EA 3F6OA 2E5ZA 2HTSA 2RREA 2YSRA 2UXXA 4AIDA 5J6XA 2KRFA 3SDGA 2F5VA 3JTHA 2MD5A 2L9RA 2HQRA 1JKRC 3PNVA 4IRGA 1W4MA 3FXQA 4XOTA 3DKYA 2P4WA 4UXNA 2P5KA 3DP7A 4CHUA 5B66C 3J80Z 4OIQF 4NB5A 4HF0A 1DP7P 5IT9Z 4S04A 3A01A 2L7KA 3VDXA 1DQUA 1LDJA 3HB9A 1XGNA 2M30A 1JUMA 3KFWX 3G71I 3L2VA 5LHIA 1BN5A 5EG0B 2WBMA 5GPCA 2VE9A 2V4JC 4IRHA 3DLAA 3R0JA 2BE5F 2XSJC 3LQRA 3F0CA 3R0AA 3EPZA 4JX6A 1YOVB 3G1OA 4CYCB 1FPQA 2KISA 4E7KA 1W0UA 3I56I 2KJBA 3CCMI 3TOAA 1B8IB 3H35A 2O6GE 3ZMTA 1S8NA 4N9HA 4IVNA 4OAYA 5D8KB 1FZPB 2ELJA 2W82A 3TO9A 3M7GA 1WJDA 1MBGA 1QRYA 4I2OA 2DT6A 2JSCA 1DPUA 3K4JA 1HKQA 2DLLA 3BG3A 5E1XA 1W7PB 3K4BA 5CVUA 4YELA 5JFRA 3RPUD 5FLXZ 5FJ8J 3BG7A 3SXYA 5LHHA 2LP0A 4CCNA 4FX4A 2IVMA 4RAZA 1K78A 4BJ5C 1JUPA 2AXTC 1TW3A 4PJMA 1D0YA 4E70A 2HEOA 2F2EA 3LAJA 1F9NA 1ZH5A 1Z0XA 3MMYB 5DCMA 2GIZA 4AUXA 4HRIA 4ZZDA 3IV5A 4XSZF 1ZARA 2MLGA 4GGGA 5J1RA 2MG4A 2DA5A 2UUZA 4U7BA 1WFXA 2ZNZA 5GPAA 5DS9A 3HG9A 3W6KB 4HG2A 3CCYA 1LE8B 2F5FA 2BV6A 2DFEA 4BE0A 3DEUA 1S9HA 3C1DA 3E1SA 3RKYA 3GTKJ 3HOZJ 3HGGA 1ETWA 3CJQB 2W25A 4XR6A 2ACJA 2FOWA 4A3GJ 1IV8A 2YS9A 3CF2A 3U21A 4KT5C 3HOSA 1VQMI 1NH3A 3BZKA 4HDVA 2KIQA 3OSGA 1O4XA 2GA1A 1VQ8I 1B72A 1MW7A 2M4KA 3R4KA 4KIFA 4IZZA 2Q1ZB 2BOLA 2NNYA 1JUSA 1KYZA 3FF5A 4RLQA 4X1EA 2DOEA 1P4XA 2IPQX 1QQIA 4UVAA 2GXAA 4IHTA 4II3A 2Z9OA 1VQOI 1TWCJ 2FBIA 2CS3A 1RESA 1ON1A 5L3CA 3P5JA 2VPRA 2A6TA 3EUKL 3BPVA 1Z21A 2E1OA 1USTA 4M71A 5HS8A 3LSIA 2CU7A 3LSJA 1XC5A 4DNCA 2ZO4A 3ZRGA 1KU7A 4JYKA 4ANJA 4HPQA 4UUSA 4P96A 1K6YA 1UJ8A 4YIRX 5JLXA 2HQ5A 1AOYA 1UFMA 4WXCA 4XLFA 4KMFA 4U88A 1LKXA 1ZLJA 2H6BA 1R23A 2IW5A 2V1UA 2FF4A 3FISA 1SAUA 4EM2A 1YITI 5ED4A 3WTWC 1UHSA 5KAFC 4IOAF 1TP4A 3WHBA 3CDHA 2JVGA 2O5RA 3F8BA 1POGA 2QBYB 1A31A 2CV1A 3K4KA 1K4TA 2GXGA 1T6SA 2NNNA 3BCBA 1JJ8C 2XB5A 2ID3A 4B09A 3CCRI 3WE3A 3GXOA 1REPC 3HOUJ 3KPHA 5CVVA 4HW0A 3TL4X 3OYNA 3U9GA 3DQVC 1MH3A 6PAXA 4UNOA 3Q0VA 3O3KA 3OR2C 5AIQA 3C2GA 5IP6A 1FLIA 1WJFA 2Y30A 3BT9A 5GTIC 3VOEA 3PFIA 2Y0SA 5H6RA 2BW3B 1WGXA 4BXFA 1WH7A 4A0XA 2LC2A 4LIVA 3RTRA 3GLLA 3L2WA 4A93J 2OTJI 2D1VA 4E7LA 3CMEI 3WTXC 2DCEA 4PFOA 4LMYA 1F1ZA 3RQ4A 5JI6A 4WXDA 3DPLC 2OPTA 2WA0A 2DFFA 3BROA 4FASD 3R60A 1E17A 2K9NA 1DUXC 1I1GA 3VSLA 3S1QJ 2ICWG 3IH3A 2JRMA 1V3FA 1BIBA 4IF4A 2ZJQF 1Y8QB 2A6HF 2V7FA 2V26A 1Z7UA 5JLWA 2AS5F 2CMPA 2V1DA 1U8RA 3OYBA 1T2KA 3VYTB 1ETQA 2PFBA 3CP2A 3B73A 3KP3A 4LD5A 4I09A 1F4KA 2ZSIB 5EGOA 2JUCA 3HIFA 1EKEA 3CF5F 3FMRA 3V8JA 4LK1F 4F52A 3IKVA 2UZKA 5HVQC 5FB2A 4IRIA 2LNBA 1A5JA 1ZGWA 4BHPA 2IA0A 3HHHA 3KP6A 1ETOA 2ZJ2A 2FD5A 5LBQA 3VODA 2IA2A 3LWFA 1Z7LA 1ZRDA 3LSMA 1BW5A 1V55H 2M0MA 2XV4S 3H9QA 5HS9A 3CMYA 4YIIA 1BI0A 5LLQA 2XC7A 5E8GA 3VB2A 3FXRA 1MH4A 3PL8A 3BR6A 4IPAA 2FQ3A 3RPQA 4Z2YA 1FYLA 2BXYA 4CYDA 1ZKGA 2ZFUA 3LSHA 4I98B 2Y0MA 1S72I 4A3BJ 4RM2A 3FXKA 2D5VA 2W4SA 2CUJA 1XDSA 2L7FP 3A01B 4A3LJ 1OR7C 5DCFA 3GZ6A 1T98A 1OKRA 1VZ0A 4BGDA 1QHHD 3CJRB 2F48A 3E6DA 3HZJA 3UR3C 4OMYA 2PG4A 2Z99A 1WI9A 2QENA 2HYFA 1FT9A 3ZQGA 3HOVJ 4HAMA 3BTJA 5A2QK 4V2FA 3OIPA 1OCZH 5FRMA 1X3UA 2RQPA 3L2QA 2L7MP 1OYWA 1WCMJ 1I1SA 1SD7A 1JT6A 3DV8A 3RCOA 4FETA 4PJJA 2XHKA 2EZHA 1LVAA 4M9XA 2MC4A 1FOWA 2JRTA 2NS0A 1MMGA 1MBJA 2P0WA 2CW0F 3HSFA 1N77A 2A68F 1EF4A 1K78B 2MD0A 5IPAA 1FIPA 5IT3A 4BQQA 2KJCA 4JOMA 3KEQA 2X9DA 4P9UA 1HA8A 5L3EA 5E18F 1RPWA 1OPCA 4XICA 1YIOA 3H9GA 2QQ9A 1W36C 3EYIA 2E7WA 5DCMB 3IL2A 1IN8A 5FD6A 3TKYA 2BVLA 5HLHA 1R00A 2LBFB 1B4AA 1NG7A 2CQNA 2JK3A 2V6EA 4F55A 5FD5A 4FHTA 5LD2C 4HA8A 4L9VA 2GA2A 4BL0B 2M7BA 1QZZA 5D6FA 4UVBA 4RBOA 1MSFC 1KGSA 3CDIA 2O7OA 3T1BA 2FRHA 2HNHA 3RZOJ 2WY7Q 3TO7A 3JAMZ 1JTXA 4JQFA 2K02A 1X3WB 1FIAA 2VJIA 1TQPA 3MD2A 3H3VK 3OYAA 3R61A 2Y75A 2W24A 3PO3J 1BW6A 3QU6A 1R6RA 3MAJA 2DT7B 3NWTA 1B72B 3W2AA 4KITB 4G7OF 3LSKA 4ZJZA 1OYYA 2HYJA 5D6EA 2KMUA 3OYLA 3ISPA 1BA5A 2E1MC 1HDDC 2L02A 3CTAA 1XSVA 4NQWA 2GQQA 1RR8C 2ETHA 4G7HF 1GVDA 4LFUA 1P6RA 3N05A 3RKQA 4K2EA 1Q1HA 3EYYA 4UV8A 3PQKA 4FT8A 2Y2ZA 3E0JB 5HODA 3S1RJ 1FMVA 2IGOA 2EFOA 2X1DA 2GM4A 4G6QA 2ADUA 4JP0A 3QQAA 2J5PA 2X4HA 2BGCA 3JW4A 2XGEA 2X0LA 3TP0A 4HX4A 4L5IA 2TRTA 2XROA 4YEJA 1Z05A 2Y9ZA 2W57A 2X51A 4FE7A 3VPRA 2BVMA 1SEUA 1ORKA 3FK7A 2VBWA 2X85A 2NVXJ 2H6CA 2XAJA 3F8MA 3KLOA 5FKOA 2P6TA 4LITA 4D7MA 4E7IA 4XSXF 2G9WA 4M6YA 5H20A 3BTLA 2AQFA 3PUFA 2R7SA 3ZP5A 1R5ID 3C2BA 3T8TA 2Y31A 3FXLA 2XASA 4XQFA 4RDUA 2Q0OA 2XAHA 3MQ0A 4OOIA 5DUIA 1G3WA 2E2JJ 4BE1A 2W84A 2M9HA 3RI4A 4DIQA 1XMXA 4DJAA 1P4WA 3BG5A 2K27A 1HKSA 2R92J 2DPDA 4PGGA 1R1UA 1BC8C 4XORA 5HDNA 1VNDA 5E3MA 4B3AA 4KIGA 3S3NA 5EYRA 2CYYA 3OOPA 4ENNA 3PUBA 2KIMA 3GUDA 3U2RA 3TO6A 2VOOA 3M1EA 3DLLF 1FSEA 4U87A 4II2A 3KP2A 1I39A 1KU3A 4BBRJ 3HKZN 1NG6A 4DZJA 2STTA 4W1UA 4BQNA 3E5QA 4JK1X 4KT6A 1FWZA 2RQQA 2IS2A 2JWTA 2XUBA 4MQ9F 3DKWA 3DBRB 2R5YA 1VF9A 4G7ZF 5BNGA 1XSDA 5CQGA 3H36A 3BZCA 1TTYA 5EGOB 2MW8A 2MH2A 2DA2A 5LGNA 2Y9YA 5E20A 1Y8RB 1S7AA 4DOZA 1P92A 3K4CA 3IP4B 5L3DA 2QSFX 4C3IJ 4R79A 2NAZA 4Q4ZF 1O3QA 5D5VB 4A3MJ 2VT2A 1ZGAA 2CUEA 1EJ9A 4FISA 3ZMSA 2BEOA 1LFPA 3OS2A 5HS7A 2OF7A 2KP6A 2OA4A 3CESA 1KU9A 4ZH4F 5C44J 2HVRA 3ASNH 1XSXA 1ETXA 4M9SA 4ENJA 3OYGA 3TOBA 3HRMA 4RA2A 2FXAA 2KIUA 4XKBA 2K4BA 1X19A 1E3HA 3GTJJ 4XRSG 2XKPA 1BI1A 2L9SA 4PZJA 1YW8A 1VFCA 1AWCA 5TISC 2BW3A 3SZGA 3A0BC 2P81A 2VQLA 4YFXF 2X48A 4ASNA 1FBQA 3OYIA 1UB9A 3AG2H 2HDCA 4M73A 5BQTA 2GIVA 4C2TA 4RGXA 3HOXJ 1TT5B 2XRNA 2CSOA 1MDMA 1ON2A 3AKZA 4ESBA 1TWGJ 5CYVA 4ENKA 3BY6A 1LB2A 2BYVE 1S3JA 5C3EJ 1MJAA 4DBRA 5HNFA 1IC8A 4D5CA 1BBYA 3QU3A 4UVCA 2RDPA 4UHTA 2PQ8A 4MFDA 3HUGA 4E6KG 2ZC2A 1YTYA 2YR2A 4RGUA 3VEPA 5B5EC 1X1BA 3DBHB 5TJJA 4AIJA 3QPLA 1ITYA 3DEWA 2DW4A 5FO5A 1ZN2A 5F1RA 2L3DA 2VPLA 3NRVA 1G59A 3S15J 5LHGA 2WC2A 1RZ4A 2M34A 3L9FA 2QVOA 1P4AA 2COBA 3C18A 1IRFA 3QRFF 3CCQI 4BDYA 1JHHA 2ZJRF 1ZR4A 1U2WA 2CJJA 2CQKA 2VN2A 3GWZA 4HV6A 1PYVA 2NYXA 5M3MJ 3OYEA 4A3IJ 4HZFA 2HQNA 1XGOA 3J7AO 5E17F 3VFZA 2JQ7A 5M3FJ 5FKKA 4RB1A 3JSPA 2CH0A 4QPOA 2K40A 1J0RA 2NOJB 1U6GA 3I55I 3HOYJ 4WF2A 1BI2A 4M3EA 1VQ5I 3KYDB 1TNTA 1W36D 2P6SA 2WV0A 4HLYA 2QUFA 1RR7A 5J47A 4A3FJ 3J81Z 2EV6A 1I3QJ 2YX7A 3FWEA 4XLEA 1SFOJ 1FJLA 1GVJA 2H8WA 2EIJH 4MEYF 3ASOH 1WQ2A 1WH5A 4M3FA 1G3YA 4B4CA 4BHBA 1XCVA 3V7SA 3PSFA 1HW5A 3JRFA 3PSIA 4M6VA 3ABTA 2LKSA 3B6CA 4D1QA 3BC8A 2ZXWH 3EUHC 4BH9A 3F8CA 3IH4A 1DGRM 4EQQA 4I99C 1UG0A 1I6XA 1Z91A 2QEXI 1K61A 3P7NA 1QBJA 1Y39A 2UV1A 2J5OA 3QWLA 5EEHA 1GV5A 2HYGD 2XKOA 3GLXA 2IP2A 3I58A 4NQWB 2AXLA 1E2XA 1J5YA 2QF7A 1VQLI 5BS6A 4LGWA 1MZBA 2JA2A 4G6TB 4NC8A 3KZZA 4L5JA 4YIFA 4A0ZA 2ZMEC 1IGNA 3EQLF 1KQ8A 4B3XA 3AG3H 1APLC 2DOAA 5M5WJ 4V19K 4YRVA 3D5LA 3OYHA 1OFCX 4MTEA 3Q9VA 4PSXA 3DCFA 3TEDA 3GO5A 5B1AH 2NVQJ 5ICEA 1XG1A 2KZVA 2E2IJ 2P7VB 2DU9A 2O8KA 4BBSJ 1MMDA 4F92B 2VUMJ 1FMWA 2FOKA 3H1CA 4EJVA 3G4SI 1ZRFA 2W7NA 1SFUA 1S7EA 1HW2A 1ERDA 5K1YA 1ZREA 2YUSA 1DGWY 4B44A 5EZGA 2LBFA 3J7ZI 2BY1A 3TW7A 3BR3A 3PIOF 4BQOA 3H5RA 2F5EA 3ZOBA 4IX7A 2W48A 4WCGA 2P7CB 2EV5A 2ESNA 2LOOA 3V42A 1PDNC 2V1XA 1O3RA 2E5NA 1X1DA 3WTTC 5K5RA 4BY7J 5J8FA 1JJ6C 3HDDA 1VQ6I 4OIRF 1SVMA 3M8FA 3L2RA 1ZR2A 1K4SA 2OC6A 4XLHA 3AAFA 2K4JA 3OYMA 5H6QA 1SD6A 4E7HA 1T08B 1OISA 3OR1C 2LDUA 3H92A 4RAYA 5LFAA 2JA7J 2IA1A 3SHFA 2XF7A 5CVJA 4BE2A 3DFGA 1NTCA 4UUTA 1BR4A 1VTNC 3E97A 3KYCB 1FX7A 4FE4A 3ZQQA 3A03A 5GAEJ 3LA7A 5KVRA 3LSGA 3BP8A 5KAIC 3NEUA 3EUAA 3MZHA 3GTGJ 4UB8C 2Z1DA 4C3HJ 1GHCA 4HNTA 3KLNA 4EM1A 1HKTA 2M7AA 1E3OC 1K6OA 3Q9SA 5DDGA 4O6JA 2R5YB 1ULYA 1GDTA 2X6YA 3WTVC 3L00A 1Y56A 1WHUA 3NWSA 4N0BA 4W97A 1R5GA 2EINH 5BMZA 1T39A 3BQZA 2FSWA 1X1CA 5J1UA 4B48A 3BTIA 2X6OA 5FKMA 2PJRA 2EA2A 3CP8A 4LB5A 4N4OB 2HOAA 1A6IA 2WWYA 2QCOA 2X1EA 4HF2A 1A6QA 4ABZA 1ZLKA 3MKZA 4B47A 5LEKA 1IN5A 2EB7A 2VIXA 3O2PE 1X4PA 2EBIA 3RJPA 3T0YA 1F43A 3A1YA 1IRXA 1Z6RA 4XLAA 3GZNB 1FP2A 4HQEA 3ZQCA 4ZDOA 1R1VA 3G73A 2QZ8A 2VT3A 4KIBA 2XAUA 1JGSA 3H5NA 3KEOA 3ULQB 4ZZLA 1D5VA 3JRCA 1MJBA 4HLXA 4UB6C 1STZA 1T8IA 1YHQI 5EEGA 1ZELA 3V4GA 1KQ9A 4MFEA 2HVSA 2DMNA 1FC3A 2O9LA 2QQBA 4BAYA 4RMNA 2M87A 5CKTA 5D5UB 1KA8A 2HXIA 2LH9A 2Q2EA 4F7ZA 3S17J 5K5OA 2YPRA 2WADA 4KICA 1TZLA 3M9AA 4DBQA 3DXJF 1RKTA 1MDMB 1PUFA 1GLNA 3OS1A 2E36A 4BJTA 5HNHA 4CSWA 2QQ8A 1U9OA 4C3JJ 1UHMA 1WJCA 2IT0A 2CFXA 2E60A 3K7AJ 1I5ZA 2IJLA 1IG7A 1WI3A 3IH2A 2R0QC 4O5VA 1CGPA 3ZPLA 4ESJA 2VODA 3HUGB 2IBDA 5TGTA 2BY3A 3LFKA 1UELB 2X1CA 3DTIA 2MA3A 5KNLA 1ZQ3P 4C30A 1HW1A 1VQ4I 3HJEA 3S3OA 2BY0A 1QNTA 4XKVA 1WRJA 3HYIA 4IHVA 2EJRA 3I71A 2M8GX 1HDPA 3D5SC 3DPTA 4KISA 5HLIA 2OQGA 2Y48A 1IJWC 3DBLB 2AO9A 2FX0A 4BEHA 2MYSA 1RUNA 1X1AA 2I10A 4MO7A 1GT0C 1RETA 2QGUA 5DEQA 1MBKA 2DBBA 1ETYA 4QWQA 4ETSA 2NXNB 5IP9J 3CJNA 5GAGJ 1YQAA 4I6ZA 1D1CA 3MWMA 1IUYA 2NVYJ 2D45A 5AIPA 4AIKA 2LY2A 2R3SA 3UKGA 2H27A 3SEQA 1L0OC 1JTYA 2EQRA 1K79A 4A3CJ 5D8LB 3C2HA 1FOXA 1WJBA 3WTYC 3M8EA 4CICA 2VXDA 4L9NA 4XIDA 4U0VA 4TV7A 1FBUA 2K3FA 1FOYA 2DJNA 2HVQA 4NC6A 4Q48A 4ZTFA 2HPIA 3CCLI 4RM3A 3F23A 4NNJA 3LSRA 2KKOA 5F0HA 3CC4I 2STWA 2VKVA 1MMSA 4E4HA 4DW6A 2K3PA 5FGMA 4Y15A 2WTEA 2DFIA 4EEFG 4UV9A 5FFZA 3CCEI 1OCOH 1BOAA 2B63J 3CCSI 2W00A 3FHZA 2O61A 3EUHA 5F0FA 5IP7J 1HOMA 3G6EI 1D5YA 2K86A 4HQMA 4MIMA 5D5XB 3M8JA 1TT0A 3FKIJ 5C4XJ 2OZUA 2GAUA 2DODA 5D4SA 2V9VA 2PLYA 1L3LA 1B9MA 3BJAA 4BUPA 5E79C 1IN7A 2LLKA 1TC3C 1P7JA 3WU1B 3HL2A 4CDGA 2A5WA 2E1MB 2EWNA 5ERIA 1SFEA 3OL3A 1V5FA 4AVPA 4CH7A 3HOWJ 2FE3A 2XDVA 4I02A 3E5UA 2ZB9A 3BPXA 3LL7A 3FZVA 4IXAA 2HOSA 4BS9A 3H0GJ 2HQAA 2VJJA 4IHWA 4NC7A 2IS1A 1BI3A 1Q1VA 4M3BA 4I0BA 4H0EA 4UUVA 1UG2A 2A69F 2ZMEA 2NRAC 2P5VA 5GTHC 4DZPA 5J8CA 1O3TA 2O3FA 2K9MA 1SMYF 4QSHA 2M1BA 4BKXA 3ZQHA 5JVGF 5JHFA 5HLTA 4XRMA 2VB6A 2JSPA 5TRDA 4ON0A 2LG4A 2ZFWA 3HKZA 3V7RA 4GDFA 2B0LA 3A0HC 2L9NA 3WTSC 3RKWA 1D0ZA 1JKPC 4EV0A 1YE9A 4KN4X 5F0CA 2D2WA 3K4MA 3ZGKA 2PI0A 4CZZA 5M5YJ 5K7ZA 4A3EJ 3BOQA 3GTLJ 5E3LA 2Z33A 1IV6A 3ML6A 3PM1A 4I01A 1R9TJ 5IYDJ 3QYFA 1O7FA 4OMZA 3HRUA 3CZ6A 1ZTRA 4IEJA 1RUOA 2DJIA 3PNTA 2TDXA 4P5OA 3IAS2 1UZCA 1DP3A 2MC3A 2O8XA 4ZYGA 2JA6J 2FNPA 2GOMA 3GZ5A 2E34A 3WTUC 3FMQA 4HBLA 2K9QA 5LRSA 1BOBA 1S5LC 3J80K 1H88C 5CQEA 5IT9K 2K9SA 4GYGA 5HDKA 1BJAA 2LREA 1YW9A 2PEXA 4G12A 4P9FA 2JMWA 2Y69H 2ZSHB 4XK4A 4Y7NJ 2JT1A 2TCTA 4ZYDA 3V7CA 3ZR8X 3E6MA 4XN3A 4CCLA 2F4IA 4AC0A 2R7ZJ 2IGMA 4M6XA 2XSDC 1DDNA 1TQMA 3L7WA 1KONA 4RB2C 2DYRH 5D5WB 4L9TA 1VQNI 2ZXJA 3ONQA 3H5AA 3AG4H 3I4PA 2KRHA 3WU2C 2HGCA 2HTJA 1KZHA 2ZJPF 5ICCA 1Y0UA 2PMHA 3T8RA 2PJRB 1IW7F 1U5TA 1F5TA 5E3NA 3QPSA 4XLNF 3ZMUA 3WU0A 5IYCJ 2JTVA 2NVUB 2XB0X 3DEEA 1ETKA 3HSRA 3BR5A 3KCCA 2JUGA 4PSWA 4EVIA 2CV0A 1FTZA 4BYYA 1FSHA 4XLPF 5FLXK 2W1OA 3QOPA 1LDDA 1A36A 2VASA 4GO1A 3I59A 4EJUA 1T95A 2B7EA 5EZHA 4B43A 3GCMA 4A5MA 2MFZA 1TWHJ 1W5TA 4BDZA 4BQAA 2KL4A 4A5NA 1TL8A 3ABLH 1P2FA 1GXQA 3ABMH 2GXBA 3K1PA 4I7HA 1C0WA 2I5UA 3AFHA 3QYBA 1ZG5A 2CUFA 2CW7A 5DYMA 3E6CC 3ZQLA 1EH7A 1YS6A 1FP1D 3K4NA 2FBHA 3ELKA 2DMQA 3JREA 4EGYA 2FMLA 1GXPA 2F4OB 2Q2EB 3S3MA 2A6EF 3O8HA 1O7LA 4N4NB 3HOTA 2ELKA 1U0JA 2DFHA 1V5EA 1PUFB 2M0CA 2MLKA 3I53A 1LEAA 3ZQ7A 1JE8A 2BXZA 2A5YB 3I54A 3HGYA 1G8XA 4LB6B 3X2QH 5D4RA 5FRNA 1RIOH 2M4GA 1QHGA 3MKWB 1P9QC 3U1DA 3JRDA 4MGRA 4IQJA 1PVEA 1NK3P 2G7HA 1MIJA 3GFIA 1YJ9I 3GTPJ 2ISYA 2Z3YA 1XB4A 2L4MA 2ZKZA 5DUKA 4OU0A 2V79A 1MBHA 5EDNA 3ZMVA 3SZPA 5KK1A 2QQAA 2XPUA 3FX3A 2PBIA 1T33A 3GBGA 1XGSA 3CCUI 2RKHA 1EH6A 2DPUA 3HRSA 4IKFA 1HQCA 2ZBKA 5LRRA 2COMA 5J4VA 2R7UA 2VQCA 3K9TA 4MEXF 1UMQA 3M07A 5FROA 5F08A 3DU6A 4ITVA 4BEHB 4L18B 3M4OJ 4CCKA 5ILSA 4E7ZA 2QWWA 2P5LC 1RI7A 3ZXSA 2OU2A 3K70C 1SAXA 3WG7H 4AIHA 1YO5C 2NS7A 2EIMH 2VI6A 2VE8A 5DD4A 3K10A 2QA4I 2JA8J 4GYIA 2A3SA 2XVCA 5CPRB 5JR3A 1BC7C 4CA0A 3BTCA 3OWTA 4J19A 4XLCA 3K2AA 2BBYA 2HU9A 3JRHA 4XRFA 1G6NA 4Y52J 4A6DA 2LR8A 3F6VA 2ZXIA 3S16J 2VONA 4C9YA 1EV7A 1V5GA 2JVHA 3V8LA 2IS6A 3HPHA 1ACIA 4V2GA 1MBFA 1TNSA 4YFNF 5L3BA 2JJ7A 3BR2A 4LG0A 2HI3A 5J1YA 1UAAA 4G6DA 1N75A 2FBKA 3I4NJ 3W2VA 1OLTA 3QAHA 2VKDA 2X6WA 2VKEA 2EV0A 3B6AA 2F5DA 1J75A 1T0FA 3E3VA 3D0SA 1G2HA 2PMZA 2HOTA 2WB1A 4XKWA 1LFBA 2VC1A 3KEYA 4AYBN 3S2HJ 1FYMA 4CXFA 2K5CA 5J40A 4D0PA 2QYOA 4DYQA 1SFXA 2LFBA 4XOPA 2H94A 3MFKA 1TQIA 2L7ZA 5CLSA 2R7OA 1N78A 1B6AA 3OYJA 1ZAOA 5LEJA 3J7YJ 3ECOA 4D9JA 2KZGA 5E8IA 2RAEA 1D1AA 4A12A 3L2UA 3I64A 5A2QZ 4AU7A 1RNLA 1NK2P 4RS8A 3DWLE 3BCAA 3KE2A 3JCUC 4BXXJ 4WWCA 3MEXA 1AKHA 4GFBA 1S6LA 3KYLA 1YX5A 1HXDA 3SJMA 1N25A 1CQTA 1FNNA 3A4CA 2ZMEB 2XAGA 2LTPA 2OQRA 3Q0UA 1W5SA 1XS9A 2IGKA 4XL9A 2WAQA 3GTOJ 4BHCA 4HEA2 5GAHJ 1JKQC 4L5EA 3RKXA 3E7LA 3CCVI 4HNVA 3PIPF 4MTDA 2EZKA 3VYSB 3W6VA 4RB3C 1LFUP 1GV2A 2DQLA 4ESFA 2UWMA 1DPRA 1LUJB 1EH8A 2GLOA 3E6BA 2IRFG 2Q8KA 1OCCH 4MLOA 3LSPA 4MQVA 3CMAI 3BDDA 5JHUA 2VBXA 3JTGA 2HZDA 4PJNA 1WJ5A 3FBIB 3FIWA 4A0YA 1LJ9A 2YU3A 3R6SA 3O6BB 1R36A 5FLMJ 4AWXB 2E19A 5IOZA 4XKCA 1TLHB 1GUUA 2M3AA 1YJNI 1KYWA 5E3OA 2CG4A 2FU4A 2EFQA 2EPFA 2KRCA 2RNJA 2W85A 3HBLA 2DK5A 3COAC 1T38A 3ZN0A 1O3SA 4AD9A 5F6FA 1G4DA 4GCVA 3B02A 1J2XA 1YS7A 2VXZA 1HSTA 4X0GA 2HDWA 3BQYA 4BACA 3H3UA 4HX7A 4XONA 2QKLB 5C4JJ 1NHAA 4NBQA 2IGNA 2DMPA 3BWGA 5GADJ 5EEAA 2IS4A 3DF8A 2CQXA 5GP9A 1BR1A 4XM3A 3ERMA 1D3YA 1IXCA 1ZGJA 3BLYA 3ZMZA 3SFIA 3P9CA 2RNGA 3LSTA 3OYCA 5LGUA 1YG2A 1P7IA 2HPMA 3N4MA 2JPCA 2OV7A 1SD5A 2EFNA 2HS5A 1IZ1A 3HHGA 2MBFA 4I0AA 3V8KA 4AVZA 2UXNA 2EK5A 3QP6A 1YX3A 3ESWB 1B59A 3RYPA 2VC0A 2OZ6A 1YYVA 4KMUX 2FA5A 1WSUA 4Y3OA 4GXOA 4OWRB 2WY8Q 9ANTA 2R7XA 1U5TB 3KP7A 4ZYAA 2VKHA 3GX4X 2BY2A 2MABA 2DI3A 2PMZN 2DMTA 2WB1N 2IXSA 1SANA 2B9SA 3KIOA 3MKYB 2R7FA 2HFHA 2ZCWA 1YLFA 3ABKH 4PUSA 2F6CA 2HOEA 3I59B 2PMUA 3G1LA 4KJZA 1Y0NA 2MGQA 4G9YA 1AU7A 1X3ZB 3RPUA 1R7JA 4A3KJ 3BG9A 2WAFA 4F91B 4I76A 2LD5A 3I9V2 2A61A 1F36A 4XMYA 5FKLA 5HLGA 2VBZA 2QM3A 1ZG1A 3GFLA 3QPHA 1ODDA 2VLAA 1R71A 1XX5A 1AHDP 3CLQA 2ESHA 1IDYA 2Z16A 4BY1J 4NHJA 4PK4A 5E1ZB 2DDAA 4F93B 5JVTA 3GW2A 5LGTA 4RGRA 2JPBA 3GTQJ 1MMNA 4BU2A 2WAQN 3S2WA 3IC7A 2N8GA 5K7HA 3JAMK 3I5UA 5J4YA 2GZWA 3K4LA 1VI0A 2YX4A 3LMMA 3NAUA 4Y4RA 1PJRA 1ZK8A 3W6JB 2DOFA 3I3LA 5K5QA 3JRAA 1LEBA 4EJTA 2H1KA 2E1NA 3PO2J 3RZDJ 2G7UA 5B3SH 1LNWA 2VBYA 2K85A 3CJTB 1ONVA 4PJLA 1JHFA 1V54H 1QVTA 3S2DJ 1IXSB 4Y17A 1SD4A 2FMYA 2VJ5A 3TW6A 5IOYA 4WXHA 5E1WA 3U1KA 4CCJA 2LYCA 2XF6A 3HEFA 3SDBA 2EZIA 2L9VA 1WJAA 1U5TC 3N97A 1K83J 2JA5J 3K69A 1T56A 1H0MA 2LY9A 2R93J 4WK8F 1QVUA 2V9PA 3K70D 2L54A 3GFMA 3WG9A 2ISZA 2OCCH 3RIRA 4OINF 4N9IA 1R22A 2H09A 2OD5A 1IXRC 4AM3A 4UY8I 1VQKI 5FKNA 1AA7A 2RC4A 3WODF 3DU5A 3IRQA 4IO9F 3OYFA 4HSTA 3F3XA 2NS8A 3CLOA 3O8GA 2L5QA 3PNYA 4P55A 1HLVA 1QO0D 3SQNA 4HDUA 1D0XA 3ZQFA 2VQGA 2LSOA 3OSFA 1VQ9I 3DTKA 3I0TA 4CGZA 4LG0B 3ABUA 3MZYA 5B1BH 1JKOC 2XGXA 3OOUA 1LDKB 1PUEE 3QYEA 2L4AA 2RVCA 2DAOA 2DYSH 2FQ4A 1HBXG 3VSKA 1SMTA 4LLGF 1XN7A 1XGMA 2F4MB 2BHYA 3WTZA 4EATA 2ZNYA 2EH3A 4OIPF 3CUOA 2HXOA 4NDLA 1TW2A 2AHQA 4JX5A 5HOOA 1OYIA 3FBNB 2EILH 3OV8A 1PP7U 3M1CA 2LKXA 2E2HJ 3DPUA 4OAZA 1MSEC 2KDOA 1X1PA 5F04A 1TBXA 2XAQA 1U3EM 4ZDPA 3F8FA 3K2ZA 4CZCA 1O57A 3LFUA 5DTDA 1QZYA 1SFKA 3JRIA 3QOEA 3OMYA 4ZYEA 3BZ6A 4BJ6C 4EM0B 3S1MJ 2BZTA 3K1MA 1ZHFA 4M9ZA 5FFXA 2E35A 3CCJI 4D5FA 1AKHB 3J7AY 3IWFA 2R7WA 3CQZJ 5J3LA 3FXUA 3H9JA 4XN0A 1RRJA 4H4KC 5H2FC 4M3GA 3VYRB 4F3QA 1CF7A 2DK8A 2LKPA 1XPXA 5M5XJ 3LAPA 3VWBA 2A07F 2EFWA 2PN6A 2ID6A 3G3ZA 3HXLA 1J9IA 1XMKA 3BR0A 5EJCA 3SEZA 1QPIA 5CVRA 3LNQA 1YRNA 1QGPA 2R4GA 1DU6A 2CUZA 2LY1A 1X58A 3TDZC 1WZ2A 4MHGA 4Y13A 3FXJA 2L2OA 2LVSA 4A2UA 3CUQA 1TWFJ 5IY5H 3MKLA 1T0FC 1WWXA 3LA3A 3KETA 4G94A 1OMIA 3ZQIA 1OQYA 3S14J 3ZCOA 4QPQA 4KA4A 2R7DA 3ZMDA 1W1WE 1U78A 2XPVA 2EIKH 5L3GA 3REOA 4HV5A 5CVIA 3F9KA 1A35A 4LLNA 2M2EA 1D1BA 2KFDA 3HPGA 3KX2A 2RN7A 3BJOA 5KHDA 4M72A 4B1RA 1JI8A 2PX9A 5HDGA 1J59A 4OIOF 2DT5A 2M8EA 2ME0A 3S8PA 1MNEA 3IUOA 4FX0A 4BNCA 4ENMA 2BHZA 1IAWA 3ERED 3IRRA 2R5ZA 5BOXA 1ZG3A 1B1BA 1MMAA 3S32A 1DU0A 1VQPI 1QA6A 2DTRA 4KYWA 2L01A 3MN2A 4CUGA 3JRBA 1G3SA 3IWZA 1EA3A 2LRDA 4M74A 4Z6YA 1Y1VJ 4IOCF 2CRGA 3CDLA 4LLLA 1YI2I 1ENHA 3C3WA 3WGGA 3TBIA 1H89C 1X4OA 4XBFA 2CWEA 4JBAA 4RAFA 3GYHX 3F21A 3HC7A 4Q5SF 2FNAA 2LF7A 3IKTA 2DO7A 1TWAJ 3PQJA 2DA3A 2DDBA 4DYCA 1HC8A 3FKJA 3GVAA 4LG3A 4PFPA 3FM5A 2M45A 3NARA 3EDPA 2Y0SN 4JX4A 1H9TA 4S0HB 3Q0WA 3F72A 3BG6A 4Q47A 3CMMA 2DXIA 1QZEA 4HOBA 4DYRA 2V1NA 4S05A 4FTHA 4HF1A 1KU2A 2DQRA 1R5HA 3K6GA 2XPWA 2ZXHA 1YJWI 2R7VA 2HZTA 4X6AJ 2LF8A 4IJAA 1RKWA 3KZYA 3J81K 1JGGA 3OIQA 2KPMA 1IRGA 2QLZA 3TMOA 3CO7C 1X2MA 4IHSA 1FEXA 4FQGA 3EETA 1IF1A 1FOKA 2HKOA 1ETVA 2XIGA 4QIWN 5L3FA 2MH9A 4RAGA
chains in the Genus database with same CATH topology
4R1HA 1IN6A 2V6CA 2OAZA 3ROUA 5DD8A 4QLCU 1IN4A 3QPTA 1BM9A 3HRTA 3NQOA 5ILUA 2EFPA 2CO5A 3JSOA 3Q5FA 2RV8A 4KNYA 4O3MA 5ICGA 3KP5A 4U0WA 1MD0A 4B8XA 2HR3A 1Z6TA 3HTUA 1B9NA 4L9JA 4YG2F 4BXUA 1W7PD 1W7PA 3H3ZA 3CO6C 2OBPA 1BIAA 3HTSB 1K7AA 2HWVA 3C7JA 3MCZA 2XAFA 1WKMA 3SFZA 1HSJA 3ZN1A 4L0ZB 2HKXA 1UHWA 1UCRA 1Z1DA 4ZYHA 4EJOA 1R1TA 1A04A 4L0YB 3IHUA 2KIFA 1I27A 2E1CA 2O03A 4CO8A 1XCBA 4RB0A 1KQ0A 4U7DA 1ZYRF 4EMSA 2JZYA 4EJWA 4G8XA 1Z9CA 3KP4A 1YW7A 1QPMA 1R58A 3T5XA 2Z5UA 2GWRA 3FM3A 4R8HA 3K1NA 3WGIA 5F64A 2EA4A 5AONA 2K7LA 1CF7B 1MGTA 3P9IA 3TQNA 1D8KA 4LK0F 5CJ9A 3SZTA 2VOPA 3TDUC 2RGVA 3BJ6A 2E7XA 4KFCA 4YFKF 4PGHA 1S29A 3RYRA 3TGNA 1D8JA 3P9KA 3LQQA 1MJ9A 1USSA 3F8NA 3CUQB 2QBYA 1YFHA 3F22A 2D1HA 5ILVA 1ZRCA 3FMSA 3RDIA 2F5CA 4KN7X 1S7OA 4KUMA 3K0LA 5DV5A 3E5XA 1PP8F 1FYKA 2O0YA 2M5WA 4EGZA 4PCQA 3WE2A 4WX9A 4MNUA 5ICFA 1OR7A 4LJZF 2C6YA 2P8TA 4HYEA 4HX8A 1G3TA 1FBSA 1J7KA 1XD7A 4RGSA 1H9GA 3GF2A 2CGPA 4PDKA 2PJPA 4U0YA 3GEZA 3QP5A 4DQ2A 3CUQC 3WGHA 1FY7A 5BPDA 3HSEA 3GFJA 3ECHA 5BPIA 3LA2A 1MKMA 2ELHA 3L09A 2FEZA 4KDPA 1XMAA 1V4RA 1XDUA 3L2CA 1JXSA 4A6EA 3F6OA 2HTSA 2YSRA 2UXXA 5J6XA 2KRFA 3JTHA 2MD5A 2HQRA 4IRGA 1W4MA 3FXQA 2P4WA 4UXNA 2P5KA 3DP7A 4CHUA 3J80Z 4OIQF 4NB5A 4HF0A 1DP7P 5IT9Z 4S04A 1LDJA 1XGNA 2M30A 3KFWX 5LHIA 1BN5A 2VE9A 4IRHA 3R0JA 2BE5F 3LQRA 3R0AA 1FPQA 2KJBA 3TOAA 2O6GE 3ZMTA 1S8NA 4N9HA 4IVNA 5D8KB 1FZPB 3TO9A 3M7GA 4I2OA 2JSCA 1DPUA 1HKQA 2DLLA 5E1XA 1W7PB 5JFRA 5CVUA 5FLXZ 5LHHA 3SXYA 4FX4A 2IVMA 4RAZA 1K78A 1TW3A 4E70A 2HEOA 2F2EA 3LAJA 1F9NA 1ZH5A 5DCMA 4ZZDA 4XSZF 1ZARA 2MLGA 4GGGA 4U7BA 2ZNZA 3W6KB 2F5FA 2BV6A 3DEUA 3C1DA 3RKYA 2W25A 2ACJA 4KT5C 3HOSA 4HDVA 2GA1A 3R4KA 4KIFA 2NNYA 3FF5A 1KYZA 1P4XA 2IPQX 1QQIA 4UVAA 4IHTA 2Z9OA 2FBIA 1ON1A 5L3CA 3BPVA 4M71A 1USTA 5HS8A 4DNCA 2ZO4A 1KU7A 4P96A 1AOYA 1UFMA 4WXCA 4KMFA 4U88A 1ZLJA 2H6BA 1R23A 2IW5A 2V1UA 2FF4A 4EM2A 5ED4A 3WTWC 3CDHA 3F8BA 2QBYB 2GXGA 1T6SA 2NNNA 4B09A 3WE3A 3GXOA 1REPC 5CVVA 4HW0A 3U9GA 3DQVC 6PAXA 4UNOA 5AIQA 3O3KA 1FLIA 3VOEA 3PFIA 5H6RA 4A0XA 3RTRA 2D1VA 3WTXC 5JI6A 4LMYA 1F1ZA 4WXDA 3DPLC 3BROA 3R60A 1E17A 1DUXC 1I1GA 1V3FA 1BIBA 4IF4A 2A6HF 1Z7UA 2AS5F 2V1DA 1U8RA 1T2KA 2PFBA 3B73A 3KP3A 4LD5A 4I09A 1F4KA 3HIFA 3FMRA 3V8JA 4LK1F 3IKVA 2UZKA 5HVQC 5FB2A 4IRIA 2LNBA 4BHPA 2IA0A 3HHHA 3KP6A 2ZJ2A 5LBQA 3VODA 2IA2A 3LWFA 1ZRDA 2XV4S 5HS9A 4YIIA 1BI0A 5LLQA 5E8GA 3VB2A 3FXRA 4IPAA 2FQ3A 3RPQA 4Z2YA 1FYLA 4CYDA 4I98B 2Y0MA 1XDSA 5DCFA 3GZ6A 1T98A 1OKRA 3E6DA 4OMYA 2PG4A 2Z99A 1WI9A 2QENA 2HYFA 1FT9A 4HAMA 5A2QK 1X3UA 2RQPA 1OYWA 1I1SA 1SD7A 3DV8A 2XHKA 1LVAA 4M9XA 2JRTA 2NS0A 3HSFA 2CW0F 2A68F 1K78B 5IT3A 2KJCA 4P9UA 3KEQA 5L3EA 5E18F 1OPCA 1YIOA 2QQ9A 3EYIA 2E7WA 5DCMB 3IL2A 1IN8A 5FD6A 3TKYA 5HLHA 1R00A 1B4AA 5FD5A 4FHTA 4HA8A 4L9VA 2GA2A 1QZZA 5D6FA 4UVBA 1KGSA 3T1BA 2FRHA 3TO7A 3JAMZ 4JQFA 2K02A 1TQPA 3R61A 2Y75A 2W24A 3QU6A 3MAJA 4G7OF 1OYYA 5D6EA 3ISPA 2L02A 3CTAA 1XSVA 4NQWA 2GQQA 2ETHA 4G7HF 4LFUA 1P6RA 4K2EA 1Q1HA 3EYYA 4UV8A 3PQKA 4FT8A 2EFOA 4G6QA 2ADUA 2J5PA 2X4HA 2BGCA 3JW4A 2X0LA 4HX4A 4L5IA 2XROA 1Z05A 2W57A 2VBWA 2H6CA 2XAJA 3F8MA 3KLOA 2P6TA 4XSXF 2G9WA 4M6YA 5H20A 3ZP5A 3T8TA 2XASA 2Q0OA 2XAHA 3MQ0A 4OOIA 5DUIA 1G3WA 2W84A 3RI4A 1P4WA 2K27A 1HKSA 2DPDA 4PGGA 1R1UA 1BC8C 5HDNA 4KIGA 2CYYA 3OOPA 4ENNA 2KIMA 3GUDA 3U2RA 3TO6A 2VOOA 3M1EA 1FSEA 3KP2A 1KU3A 2STTA 3E5QA 4JK1X 1FWZA 2XUBA 4MQ9F 3DKWA 4G7ZF 1XSDA 1TTYA 2MH2A 5LGNA 5E20A 1S7AA 1P92A 5L3DA 4R79A 2NAZA 4Q4ZF 1O3QA 5D5VB 2VT2A 1ZGAA 3ZMSA 2BEOA 5HS7A 2OA4A 1KU9A 4ZH4F 1XSXA 4M9SA 4ENJA 3TOBA 3HRMA 2FXAA 2KIUA 2K4BA 2XKPA 1BI1A 4PZJA 1YW8A 1AWCA 4YFXF 4ASNA 1FBQA 1UB9A 2HDCA 4M73A 5BQTA 2GIVA 4RGXA 2XRNA 1MDMA 2CSOA 1ON2A 4ESBA 5CYVA 4ENKA 3BY6A 1LB2A 2BYVE 1S3JA 1MJAA 1BBYA 3QU3A 4UVCA 2RDPA 4UHTA 2PQ8A 3HUGA 1YTYA 2YR2A 4RGUA 3VEPA 5TJJA 4AIJA 2DW4A 5FO5A 1ZN2A 5F1RA 2L3DA 3NRVA 5LHGA 2WC2A 1RZ4A 3L9FA 2QVOA 1P4AA 3C18A 1IRFA 3QRFF 1JHHA 1U2WA 2CQKA 2VN2A 3GWZA 4HV6A 2NYXA 4HZFA 2HQNA 1XGOA 3J7AO 5E17F 3VFZA 4RB1A 3JSPA 1J0RA 1U6GA 4WF2A 1BI2A 1TNTA 2P6SA 2WV0A 4HLYA 2QUFA 3J81Z 2EV6A 2YX7A 3FWEA 1GVJA 4MEYF 1WQ2A 1G3YA 4BHBA 1XCVA 3V7SA 1HW5A 3ABTA 4BH9A 3F8CA 4EQQA 1I6XA 1Z91A 3P7NA 1QBJA 2J5OA 5EEHA 2HYGD 3GLXA 2XKOA 3I58A 2IP2A 2AXLA 1E2XA 1J5YA 5BS6A 4LGWA 1MZBA 3KZZA 4L5JA 4YIFA 4A0ZA 3EQLF 1KQ8A 3D5LA 4MTEA 3Q9VA 3GO5A 5ICEA 2P7VB 2DU9A 2FOKA 4EJVA 1ZRFA 1SFUA 1HW2A 5K1YA 1ZREA 2F5EA 4WCGA 2P7CB 2EV5A 2ESNA 1PDNC 2V1XA 1O3RA 3WTTC 5K5RA 5J8FA 4OIRF 3M8FA 3AAFA 2K4JA 5H6QA 1SD6A 2LDUA 3H92A 4RAYA 2IA1A 3SHFA 5CVJA 3DFGA 1VTNC 3E97A 1FX7A 3LA7A 5KVRA 3BP8A 3NEUA 3MZHA 1GHCA 3KLNA 4EM1A 1HKTA 1K6OA 3Q9SA 5DDGA 4O6JA 1ULYA 3WTVC 3L00A 4N0BA 1R5GA 5BMZA 1T39A 2FSWA 2EA2A 4LB5A 2WWYA 4HF2A 1ZLKA 5LEKA 1IN5A 2EB7A 3O2PE 3RJPA 3T0YA 1Z6RA 1FP2A 4HQEA 1R1VA 3G73A 2QZ8A 2VT3A 4KIBA 1JGSA 3KEOA 3ULQB 4ZZLA 1D5VA 1MJBA 4HLXA 1STZA 5EEGA 3V4GA 1KQ9A 1FC3A 2QQBA 5D5UB 4BAYA 2M87A 1KA8A 2Q2EA 4F7ZA 5K5OA 2YPRA 4KICA 3M9AA 3DXJF 1MDMB 1UHMA 2IT0A 2CFXA 1I5ZA 2IJLA 4O5VA 1CGPA 3ZPLA 4ESJA 2VODA 3LFKA 2MA3A 1HW1A 1QNTA 1WRJA 3HYIA 2EJRA 3I71A 3DPTA 5HLIA 2OQGA 2Y48A 1RUNA 5DEQA 2DBBA 4QWQA 4ETSA 3CJNA 1YQAA 3MWMA 1IUYA 2D45A 5AIPA 4AIKA 2R3SA 2H27A 1L0OC 1K79A 5D8LB 3WTYC 3M8EA 4CICA 4L9NA 4U0VA 4TV7A 1FBUA 4Q48A 3F23A 2KKOA 2STWA 5FGMA 4Y15A 2WTEA 2DFIA 4UV9A 5FFZA 1BOAA 3FHZA 2O61A 3EUHA 2K86A 4HQMA 5D5XB 2OZUA 2GAUA 5D4SA 2V9VA 2PLYA 1L3LA 1B9MA 3BJAA 1IN7A 3WU1B 4CDGA 2EWNA 5ERIA 1SFEA 4AVPA 2FE3A 4IXAA 4I02A 3E5UA 3BPXA 3FZVA 1BI3A 4I0BA 4H0EA 4UUVA 2A69F 2ZMEA 2NRAC 2P5VA 5J8CA 1O3TA 2O3FA 1SMYF 2M1BA 5TRDA 4ON0A 2ZFWA 3V7RA 2B0LA 3WTSC 3RKWA 4EV0A 4KN4X 2D2WA 2PI0A 4CZZA 3BOQA 2Z33A 3ML6A 4I01A 1O7FA 4OMZA 3HRUA 1RUOA 2TDXA 4P5OA 2MC3A 2O8XA 4ZYGA 2FNPA 3GZ5A 3WTUC 3FMQA 4HBLA 5LRSA 3J80K 5IT9K 4GYGA 5HDKA 1BJAA 1YW9A 2PEXA 4P9FA 2JT1A 4ZYDA 3V7CA 3E6MA 4M6XA 1DDNA 1TQMA 3L7WA 4RB2C 5D5WB 4L9TA 2ZXJA 3I4PA 2HGCA 2HTJA 5ICCA 1Y0UA 2PMHA 3T8RA 1IW7F 1U5TA 1F5TA 4XLNF 3ZMUA 3WU0A 2JTVA 3HSRA 3KCCA 4EVIA 4BYYA 1FSHA 4XLPF 5FLXK 3QOPA 1LDDA 4GO1A 3I59A 4EJUA 4A5MA 1W5TA 4BQAA 4A5NA 1P2FA 1GXQA 2GXBA 3K1PA 4I7HA 1C0WA 1ZG5A 3E6CC 5DYMA 1EH7A 1YS6A 1FP1D 2FBHA 3ELKA 4EGYA 2FMLA 1GXPA 2A6EF 1O7LA 3HOTA 2MLKA 3I53A 1LEAA 3ZQ7A 1JE8A 2A5YB 3I54A 4LB6B 5D4RA 1RIOH 3U1DA 4MGRA 2G7HA 3GFIA 2ISYA 2Z3YA 1XB4A 2L4MA 2ZKZA 5DUKA 4OU0A 2V79A 3ZMVA 3SZPA 5KK1A 2QQAA 3FX3A 2PBIA 1XGSA 2RKHA 1EH6A 2DPUA 3HRSA 1HQCA 2ZBKA 5LRRA 2COMA 3K9TA 4MEXF 4L18B 5ILSA 2QWWA 2P5LC 1RI7A 2OU2A 1SAXA 4AIHA 1YO5C 2VE8A 5DD4A 4GYIA 2A3SA 2XVCA 5JR3A 1BC7C 2BBYA 4XRFA 1G6NA 4A6DA 3F6VA 2VONA 1EV7A 3V8LA 1TNSA 4YFNF 5L3BA 4LG0A 4G6DA 2FBKA 3QAHA 2EV0A 2F5DA 1J75A 1T0FA 3E3VA 3D0SA 2VC1A 1FYMA 4CXFA 4D0PA 2QYOA 1SFXA 2H94A 3MFKA 1TQIA 5CLSA 1B6AA 1ZAOA 5LEJA 3ECOA 5E8IA 4A12A 3I64A 5A2QZ 1RNLA 4RS8A 3KE2A 4WWCA 3MEXA 1S6LA 1HXDA 1FNNA 2ZMEB 2XAGA 2OQRA 1W5SA 4BHCA 3RKXA 4MTDA 4RB3C 4ESFA 2DQLA 2UWMA 1DPRA 1EH8A 3E6BA 2IRFG 2Q8KA 4MQVA 3BDDA 5JHUA 2VBXA 3JTGA 4A0YA 1LJ9A 2YU3A 3R6SA 3O6BB 1R36A 4AWXB 1TLHB 1KYWA 2CG4A 2FU4A 2EFQA 2RNJA 3COAC 1T38A 2W85A 1LQ1A 2DK5A 3ZN0A 1O3SA 4AD9A 5F6FA 1G4DA 4GCVA 3B02A 1J2XA 1YS7A 2VXZA 1HSTA 3H3UA 4HX7A 1NHAA 3BWGA 3DF8A 1D3YA 1IXCA 1ZGJA 3ZMZA 3P9CA 3LSTA 5LGUA 1YG2A 3N4MA 2JPCA 1SD5A 2EFNA 2HS5A 1IZ1A 3HHGA 2MBFA 4I0AA 3V8KA 2UXNA 2EK5A 3QP6A 1B59A 3RYPA 2VC0A 2OZ6A 1YYVA 4KMUX 2FA5A 1WSUA 4GXOA 1U5TB 3KP7A 3GX4X 2DI3A 2R7FA 2HFHA 2ZCWA 1YLFA 2HOEA 3I59B 2PMUA 4G9YA 3RPUA 1R7JA 2A61A 5HLGA 2VBZA 2QM3A 1ZG1A 3GFLA 3QPHA 1ODDA 2ESHA 4NHJA 5E1ZB 5JVTA 3GW2A 5LGTA 4RGRA 2JPBA 3S2WA 3IC7A 3JAMK 3I5UA 2GZWA 3W6JB 2YX4A 5K5QA 1LEBA 4EJTA 2E1NA 2G7UA 1LNWA 2VBYA 1ONVA 1JHFA 1IXSB 4Y17A 1SD4A 2FMYA 4WXHA 5E1WA 1U5TC 3N97A 3K69A 1H0MA 4WK8F 2L54A 3GFMA 3WG9A 2ISZA 3RIRA 4OINF 4N9IA 1R22A 2H09A 2OD5A 1IXRC 2RC4A 3WODF 3IRQA 3F3XA 3CLOA 4P55A 1QO0D 3SQNA 4HDUA 2LSOA 3I0TA 4CGZA 4LG0B 3ABUA 3MZYA 2XGXA 1LDKB 1PUEE 2L4AA 2RVCA 2DAOA 1HBXG 1SMTA 4LLGF 1XN7A 1XGMA 3WTZA 2ZNYA 4OIPF 3CUOA 1TW2A 5HOOA 1OYIA 3OV8A 1PP7U 1U3EM 1TBXA 2XAQA 3F8FA 3K2ZA 1O57A 1QZYA 4ZYEA 3BZ6A 4EM0B 3K1MA 1ZHFA 4M9ZA 5FFXA 3IWFA 3FXUA 1CF7A 2DK8A 2LKPA 3LAPA 2A07F 2EFWA 2PN6A 3G3ZA 1J9IA 1XMKA 5CVRA 1QGPA 3TDZC 4MHGA 4Y13A 4A2UA 3CUQA 1WWXA 3LA3A 3KETA 4G94A 1OMIA 4KA4A 2R7DA 3ZMDA 1U78A 5L3GA 3REOA 4HV5A 5CVIA 4LLNA 2RN7A 3BJOA 4M72A 5HDGA 1J59A 4OIOF 2DT5A 2M8EA 4FX0A 4BNCA 4ENMA 1IAWA 3ERED 3IRRA 5BOXA 1ZG3A 1B1BA 4KYWA 2DTRA 2L01A 1G3SA 3IWZA 4M74A 4LLLA 3C3WA 3WGGA 4XBFA 2CWEA 4JBAA 3GYHX 3F21A 4Q5SF 2FNAA 2LF7A 3IKTA 2DO7A 3PQJA 3GVAA 3FM5A 2M45A 3EDPA 1H9TA 3F72A 4Q47A 4HOBA 4S05A 4HF1A 1KU2A 2DQRA 1R5HA 2HZTA 2LF8A 4IJAA 3KZYA 3J81K 1IRGA 2QLZA 3CO7C 4IHSA 3EETA 1IF1A 1FOKA 2HKOA 2XIGA 5L3FA 2MH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1H A;  1IN6 A;  2V6C A;  2OAZ A;  3ROU A;  5DD8 A;  4QLC U;  1IN4 A;  3QPT A;  1BM9 A;  3HRT A;  3NQO A;  5ILU A;  2EFP A;  2CO5 A;  3JSO A;  3Q5F A;  2RV8 A;  4KNY A;  4O3M A;  5ICG A;  3KP5 A;  4U0W A;  1MD0 A;  4B8X A;  2HR3 A;  1Z6T A;  3HTU A;  1B9N A;  4L9J A;  4YG2 F;  4BXU A;  1W7P D;  1W7P A;  3H3Z A;  3CO6 C;  2OBP A;  1BIA A;  3HTS B;  1K7A A;  2HWV A;  3C7J A;  3MCZ A;  2XAF A;  1WKM A;  3SFZ A;  1HSJ A;  3ZN1 A;  4L0Z B;  2HKX A;  1UHW A;  1UCR A;  1Z1D A;  4ZYH A;  4EJO A;  1R1T A;  1A04 A;  4L0Y B;  3IHU A;  2KIF A;  1I27 A;  2E1C A;  2O03 A;  4CO8 A;  1XCB A;  4RB0 A;  1KQ0 A;  4U7D A;  1ZYR F;  4EMS A;  2JZY A;  4EJW A;  4G8X A;  1Z9C A;  3KP4 A;  1YW7 A;  1QPM A;  1R58 A;  3T5X A;  2Z5U A;  2GWR A;  3FM3 A;  4R8H A;  3K1N A;  3WGI A;  5F64 A;  2EA4 A;  5AON A;  2K7L A;  1CF7 B;  1MGT A;  3P9I A;  3TQN A;  1D8K A;  4LK0 F;  5CJ9 A;  3SZT A;  2VOP A;  3TDU C;  2RGV A;  3BJ6 A;  2E7X A;  4KFC A;  4YFK F;  4PGH A;  1S29 A;  3RYR A;  3TGN A;  1D8J A;  3P9K A;  3LQQ A;  1MJ9 A;  1USS A;  3F8N A;  3CUQ B;  2QBY A;  1YFH A;  3F22 A;  2D1H A;  5ILV A;  1ZRC A;  3FMS A;  3RDI A;  2F5C A;  4KN7 X;  1S7O A;  4KUM A;  3K0L A;  5DV5 A;  3E5X A;  1PP8 F;  1FYK A;  2O0Y A;  2M5W A;  4EGZ A;  4PCQ A;  3WE2 A;  4WX9 A;  4MNU A;  5ICF A;  1OR7 A;  4LJZ F;  2C6Y A;  2P8T A;  4HYE A;  4HX8 A;  1G3T A;  1FBS A;  1J7K A;  1XD7 A;  4RGS A;  1H9G A;  3GF2 A;  2CGP A;  4PDK A;  2PJP A;  4U0Y A;  3GEZ A;  3QP5 A;  4DQ2 A;  3CUQ C;  3WGH A;  1FY7 A;  5BPD A;  3HSE A;  3GFJ A;  3ECH A;  5BPI A;  3LA2 A;  1MKM A;  2ELH A;  3L09 A;  2FEZ A;  4KDP A;  1XMA A;  1V4R A;  1XDU A;  3L2C A;  1JXS A;  4A6E A;  3F6O A;  2HTS A;  2YSR A;  2UXX A;  5J6X A;  2KRF A;  3JTH A;  2MD5 A;  2HQR A;  4IRG A;  1W4M A;  3FXQ A;  2P4W A;  4UXN A;  2P5K A;  3DP7 A;  4CHU A;  3J80 Z;  4OIQ F;  4NB5 A;  4HF0 A;  1DP7 P;  5IT9 Z;  4S04 A;  1LDJ A;  1XGN A;  2M30 A;  3KFW X;  5LHI A;  1BN5 A;  2VE9 A;  4IRH A;  3R0J A;  2BE5 F;  3LQR A;  3R0A A;  1FPQ A;  2KJB A;  3TOA A;  2O6G E;  3ZMT A;  1S8N A;  4N9H A;  4IVN A;  5D8K B;  1FZP B;  3TO9 A;  3M7G A;  4I2O A;  2JSC A;  1DPU A;  1HKQ A;  2DLL A;  5E1X A;  1W7P B;  5JFR A;  5CVU A;  5FLX Z;  5LHH A;  3SXY A;  4FX4 A;  2IVM A;  4RAZ A;  1K78 A;  1TW3 A;  4E70 A;  2HEO A;  2F2E A;  3LAJ A;  1F9N A;  1ZH5 A;  5DCM A;  4ZZD A;  4XSZ F;  1ZAR A;  2MLG A;  4GGG A;  4U7B A;  2ZNZ A;  3W6K B;  2F5F A;  2BV6 A;  3DEU A;  3C1D A;  3RKY A;  2W25 A;  2ACJ A;  4KT5 C;  3HOS A;  4HDV A;  2GA1 A;  3R4K A;  4KIF A;  2NNY A;  3FF5 A;  1KYZ A;  1P4X A;  2IPQ X;  1QQI A;  4UVA A;  4IHT A;  2Z9O A;  2FBI A;  1ON1 A;  5L3C A;  3BPV A;  4M71 A;  1UST A;  5HS8 A;  4DNC A;  2ZO4 A;  1KU7 A;  4P96 A;  1AOY A;  1UFM A;  4WXC A;  4KMF A;  4U88 A;  1ZLJ A;  2H6B A;  1R23 A;  2IW5 A;  2V1U A;  2FF4 A;  4EM2 A;  5ED4 A;  3WTW C;  3CDH A;  3F8B A;  2QBY B;  2GXG A;  1T6S A;  2NNN A;  4B09 A;  3WE3 A;  3GXO A;  1REP C;  5CVV A;  4HW0 A;  3U9G A;  3DQV C;  6PAX A;  4UNO A;  5AIQ A;  3O3K A;  1FLI A;  3VOE A;  3PFI A;  5H6R A;  4A0X A;  3RTR A;  2D1V A;  3WTX C;  5JI6 A;  4LMY A;  1F1Z A;  4WXD A;  3DPL C;  3BRO A;  3R60 A;  1E17 A;  1DUX C;  1I1G A;  1V3F A;  1BIB A;  4IF4 A;  2A6H F;  1Z7U A;  2AS5 F;  2V1D A;  1U8R A;  1T2K A;  2PFB A;  3B73 A;  3KP3 A;  4LD5 A;  4I09 A;  1F4K A;  3HIF A;  3FMR A;  3V8J A;  4LK1 F;  3IKV A;  2UZK A;  5HVQ C;  5FB2 A;  4IRI A;  2LNB A;  4BHP A;  2IA0 A;  3HHH A;  3KP6 A;  2ZJ2 A;  5LBQ A;  3VOD A;  2IA2 A;  3LWF A;  1ZRD A;  2XV4 S;  5HS9 A;  4YII A;  1BI0 A;  5LLQ A;  5E8G A;  3VB2 A;  3FXR A;  4IPA A;  2FQ3 A;  3RPQ A;  4Z2Y A;  1FYL A;  4CYD A;  4I98 B;  2Y0M A;  1XDS A;  5DCF A;  3GZ6 A;  1T98 A;  1OKR A;  3E6D A;  4OMY A;  2PG4 A;  2Z99 A;  1WI9 A;  2QEN A;  2HYF A;  1FT9 A;  4HAM A;  5A2Q K;  1X3U A;  2RQP A;  1OYW A;  1I1S A;  1SD7 A;  3DV8 A;  2XHK A;  1LVA A;  4M9X A;  2JRT A;  2NS0 A;  3HSF A;  2CW0 F;  2A68 F;  1K78 B;  5IT3 A;  2KJC A;  4P9U A;  3KEQ A;  5L3E A;  5E18 F;  1OPC A;  1YIO A;  2QQ9 A;  3EYI A;  2E7W A;  5DCM B;  3IL2 A;  1IN8 A;  5FD6 A;  3TKY A;  5HLH A;  1R00 A;  1B4A A;  5FD5 A;  4FHT A;  4HA8 A;  4L9V A;  2GA2 A;  1QZZ A;  5D6F A;  4UVB A;  1KGS A;  3T1B A;  2FRH A;  3TO7 A;  3JAM Z;  4JQF A;  2K02 A;  1TQP A;  3R61 A;  2Y75 A;  2W24 A;  3QU6 A;  3MAJ A;  4G7O F;  1OYY A;  5D6E A;  3ISP A;  2L02 A;  3CTA A;  1XSV A;  4NQW A;  2GQQ A;  2ETH A;  4G7H F;  4LFU A;  1P6R A;  4K2E A;  1Q1H A;  3EYY A;  4UV8 A;  3PQK A;  4FT8 A;  2EFO A;  4G6Q A;  2ADU A;  2J5P A;  2X4H A;  2BGC A;  3JW4 A;  2X0L A;  4HX4 A;  4L5I A;  2XRO A;  1Z05 A;  2W57 A;  2VBW A;  2H6C A;  2XAJ A;  3F8M A;  3KLO A;  2P6T A;  4XSX F;  2G9W A;  4M6Y A;  5H20 A;  3ZP5 A;  3T8T A;  2XAS A;  2Q0O A;  2XAH A;  3MQ0 A;  4OOI A;  5DUI A;  1G3W A;  2W84 A;  3RI4 A;  1P4W A;  2K27 A;  1HKS A;  2DPD A;  4PGG A;  1R1U A;  1BC8 C;  5HDN A;  4KIG A;  2CYY A;  3OOP A;  4ENN A;  2KIM A;  3GUD A;  3U2R A;  3TO6 A;  2VOO A;  3M1E A;  1FSE A;  3KP2 A;  1KU3 A;  2STT A;  3E5Q A;  4JK1 X;  1FWZ A;  2XUB A;  4MQ9 F;  3DKW A;  4G7Z F;  1XSD A;  1TTY A;  2MH2 A;  5LGN A;  5E20 A;  1S7A A;  1P92 A;  5L3D A;  4R79 A;  2NAZ A;  4Q4Z F;  1O3Q A;  5D5V B;  2VT2 A;  1ZGA A;  3ZMS A;  2BEO A;  5HS7 A;  2OA4 A;  1KU9 A;  4ZH4 F;  1XSX A;  4M9S A;  4ENJ A;  3TOB A;  3HRM A;  2FXA A;  2KIU A;  2K4B A;  2XKP A;  1BI1 A;  4PZJ A;  1YW8 A;  1AWC A;  4YFX F;  4ASN A;  1FBQ A;  1UB9 A;  2HDC A;  4M73 A;  5BQT A;  2GIV A;  4RGX A;  2XRN A;  1MDM A;  2CSO A;  1ON2 A;  4ESB A;  5CYV A;  4ENK A;  3BY6 A;  1LB2 A;  2BYV E;  1S3J A;  1MJA A;  1BBY A;  3QU3 A;  4UVC A;  2RDP A;  4UHT A;  2PQ8 A;  3HUG A;  1YTY A;  2YR2 A;  4RGU A;  3VEP A;  5TJJ A;  4AIJ A;  2DW4 A;  5FO5 A;  1ZN2 A;  5F1R A;  2L3D A;  3NRV A;  5LHG A;  2WC2 A;  1RZ4 A;  3L9F A;  2QVO A;  1P4A A;  3C18 A;  1IRF A;  3QRF F;  1JHH A;  1U2W A;  2CQK A;  2VN2 A;  3GWZ A;  4HV6 A;  2NYX A;  4HZF A;  2HQN A;  1XGO A;  3J7A O;  5E17 F;  3VFZ A;  4RB1 A;  3JSP A;  1J0R A;  1U6G A;  4WF2 A;  1BI2 A;  1TNT A;  2P6S A;  2WV0 A;  4HLY A;  2QUF A;  3J81 Z;  2EV6 A;  2YX7 A;  3FWE A;  1GVJ A;  4MEY F;  1WQ2 A;  1G3Y A;  4BHB A;  1XCV A;  3V7S A;  1HW5 A;  3ABT A;  4BH9 A;  3F8C A;  4EQQ A;  1I6X A;  1Z91 A;  3P7N A;  1QBJ A;  2J5O A;  5EEH A;  2HYG D;  3GLX A;  2XKO A;  3I58 A;  2IP2 A;  2AXL A;  1E2X A;  1J5Y A;  5BS6 A;  4LGW A;  1MZB A;  3KZZ A;  4L5J A;  4YIF A;  4A0Z A;  3EQL F;  1KQ8 A;  3D5L A;  4MTE A;  3Q9V A;  3GO5 A;  5ICE A;  2P7V B;  2DU9 A;  2FOK A;  4EJV A;  1ZRF A;  1SFU A;  1HW2 A;  5K1Y A;  1ZRE A;  2F5E A;  4WCG A;  2P7C B;  2EV5 A;  2ESN A;  1PDN C;  2V1X A;  1O3R A;  3WTT C;  5K5R A;  5J8F A;  4OIR F;  3M8F A;  3AAF A;  2K4J A;  5H6Q A;  1SD6 A;  2LDU A;  3H92 A;  4RAY A;  2IA1 A;  3SHF A;  5CVJ A;  3DFG A;  1VTN C;  3E97 A;  1FX7 A;  3LA7 A;  5KVR A;  3BP8 A;  3NEU A;  3MZH A;  1GHC A;  3KLN A;  4EM1 A;  1HKT A;  1K6O A;  3Q9S A;  5DDG A;  4O6J A;  1ULY A;  3WTV C;  3L00 A;  4N0B A;  1R5G A;  5BMZ A;  1T39 A;  2FSW A;  2EA2 A;  4LB5 A;  2WWY A;  4HF2 A;  1ZLK A;  5LEK A;  1IN5 A;  2EB7 A;  3O2P E;  3RJP A;  3T0Y A;  1Z6R A;  1FP2 A;  4HQE A;  1R1V A;  3G73 A;  2QZ8 A;  2VT3 A;  4KIB A;  1JGS A;  3KEO A;  3ULQ B;  4ZZL A;  1D5V A;  1MJB A;  4HLX A;  1STZ A;  5EEG A;  3V4G A;  1KQ9 A;  1FC3 A;  2QQB A;  5D5U B;  4BAY A;  2M87 A;  1KA8 A;  2Q2E A;  4F7Z A;  5K5O A;  2YPR A;  4KIC A;  3M9A A;  3DXJ F;  1MDM B;  1UHM A;  2IT0 A;  2CFX A;  1I5Z A;  2IJL A;  4O5V A;  1CGP A;  3ZPL A;  4ESJ A;  2VOD A;  3LFK A;  2MA3 A;  1HW1 A;  1QNT A;  1WRJ A;  3HYI A;  2EJR A;  3I71 A;  3DPT A;  5HLI A;  2OQG A;  2Y48 A;  1RUN A;  5DEQ A;  2DBB A;  4QWQ A;  4ETS A;  3CJN A;  1YQA A;  3MWM A;  1IUY A;  2D45 A;  5AIP A;  4AIK A;  2R3S A;  2H27 A;  1L0O C;  1K79 A;  5D8L B;  3WTY C;  3M8E A;  4CIC A;  4L9N A;  4U0V A;  4TV7 A;  1FBU A;  4Q48 A;  3F23 A;  2KKO A;  2STW A;  5FGM A;  4Y15 A;  2WTE A;  2DFI A;  4UV9 A;  5FFZ A;  1BOA A;  3FHZ A;  2O61 A;  3EUH A;  2K86 A;  4HQM A;  5D5X B;  2OZU A;  2GAU A;  5D4S A;  2V9V A;  2PLY A;  1L3L A;  1B9M A;  3BJA A;  1IN7 A;  3WU1 B;  4CDG A;  2EWN A;  5ERI A;  1SFE A;  4AVP A;  2FE3 A;  4IXA A;  4I02 A;  3E5U A;  3BPX A;  3FZV A;  1BI3 A;  4I0B A;  4H0E A;  4UUV A;  2A69 F;  2ZME A;  2NRA C;  2P5V A;  5J8C A;  1O3T A;  2O3F A;  1SMY F;  2M1B A;  5TRD A;  4ON0 A;  2ZFW A;  3V7R A;  2B0L A;  3WTS C;  3RKW A;  4EV0 A;  4KN4 X;  2D2W A;  2PI0 A;  4CZZ A;  3BOQ A;  2Z33 A;  3ML6 A;  4I01 A;  1O7F A;  4OMZ A;  3HRU A;  1RUO A;  2TDX A;  4P5O A;  2MC3 A;  2O8X A;  4ZYG A;  2FNP A;  3GZ5 A;  3WTU C;  3FMQ A;  4HBL A;  5LRS A;  3J80 K;  5IT9 K;  4GYG A;  5HDK A;  1BJA A;  1YW9 A;  2PEX A;  4P9F A;  2JT1 A;  4ZYD A;  3V7C A;  3E6M A;  4M6X A;  1DDN A;  1TQM A;  3L7W A;  4RB2 C;  5D5W B;  4L9T A;  2ZXJ A;  3I4P A;  2HGC A;  2HTJ A;  5ICC A;  1Y0U A;  2PMH A;  3T8R A;  1IW7 F;  1U5T A;  1F5T A;  4XLN F;  3ZMU A;  3WU0 A;  2JTV A;  3HSR A;  3KCC A;  4EVI A;  4BYY A;  1FSH A;  4XLP F;  5FLX K;  3QOP A;  1LDD A;  4GO1 A;  3I59 A;  4EJU A;  4A5M A;  1W5T A;  4BQA A;  4A5N A;  1P2F A;  1GXQ A;  2GXB A;  3K1P A;  4I7H A;  1C0W A;  1ZG5 A;  3E6C C;  5DYM A;  1EH7 A;  1YS6 A;  1FP1 D;  2FBH A;  3ELK A;  4EGY A;  2FML A;  1GXP A;  2A6E F;  1O7L A;  3HOT A;  2MLK A;  3I53 A;  1LEA A;  3ZQ7 A;  1JE8 A;  2A5Y B;  3I54 A;  4LB6 B;  5D4R A;  1RIO H;  3U1D A;  4MGR A;  2G7H A;  3GFI A;  2ISY A;  2Z3Y A;  1XB4 A;  2L4M A;  2ZKZ A;  5DUK A;  4OU0 A;  2V79 A;  3ZMV A;  3SZP A;  5KK1 A;  2QQA A;  3FX3 A;  2PBI A;  1XGS A;  2RKH A;  1EH6 A;  2DPU A;  3HRS A;  1HQC A;  2ZBK A;  5LRR A;  2COM A;  3K9T A;  4MEX F;  4L18 B;  5ILS A;  2QWW A;  2P5L C;  1RI7 A;  2OU2 A;  1SAX A;  4AIH A;  1YO5 C;  2VE8 A;  5DD4 A;  4GYI A;  2A3S A;  2XVC A;  5JR3 A;  1BC7 C;  2BBY A;  4XRF A;  1G6N A;  4A6D A;  3F6V A;  2VON A;  1EV7 A;  3V8L A;  1TNS A;  4YFN F;  5L3B A;  4LG0 A;  4G6D A;  2FBK A;  3QAH A;  2EV0 A;  2F5D A;  1J75 A;  1T0F A;  3E3V A;  3D0S A;  2VC1 A;  1FYM A;  4CXF A;  4D0P A;  2QYO A;  1SFX A;  2H94 A;  3MFK A;  1TQI A;  5CLS A;  1B6A A;  1ZAO A;  5LEJ A;  3ECO A;  5E8I A;  4A12 A;  3I64 A;  5A2Q Z;  1RNL A;  4RS8 A;  3KE2 A;  4WWC A;  3MEX A;  1S6L A;  1HXD A;  1FNN A;  2ZME B;  2XAG A;  2OQR A;  1W5S A;  4BHC A;  3RKX A;  4MTD A;  4RB3 C;  4ESF A;  2DQL A;  2UWM A;  1DPR A;  1EH8 A;  3E6B A;  2IRF G;  2Q8K A;  4MQV A;  3BDD A;  5JHU A;  2VBX A;  3JTG A;  4A0Y A;  1LJ9 A;  2YU3 A;  3R6S A;  3O6B B;  1R36 A;  4AWX B;  1TLH B;  1KYW A;  2CG4 A;  2FU4 A;  2EFQ A;  2RNJ A;  3COA C;  1T38 A;  2W85 A;  1LQ1 A;  2DK5 A;  3ZN0 A;  1O3S A;  4AD9 A;  5F6F A;  1G4D A;  4GCV A;  3B02 A;  1J2X A;  1YS7 A;  2VXZ A;  1HST A;  3H3U A;  4HX7 A;  1NHA A;  3BWG A;  3DF8 A;  1D3Y A;  1IXC A;  1ZGJ A;  3ZMZ A;  3P9C A;  3LST A;  5LGU A;  1YG2 A;  3N4M A;  2JPC A;  1SD5 A;  2EFN A;  2HS5 A;  1IZ1 A;  3HHG A;  2MBF A;  4I0A A;  3V8K A;  2UXN A;  2EK5 A;  3QP6 A;  1B59 A;  3RYP A;  2VC0 A;  2OZ6 A;  1YYV A;  4KMU X;  2FA5 A;  1WSU A;  4GXO A;  1U5T B;  3KP7 A;  3GX4 X;  2DI3 A;  2R7F A;  2HFH A;  2ZCW A;  1YLF A;  2HOE A;  3I59 B;  2PMU A;  4G9Y A;  3RPU A;  1R7J A;  2A61 A;  5HLG A;  2VBZ A;  2QM3 A;  1ZG1 A;  3GFL A;  3QPH A;  1ODD A;  2ESH A;  4NHJ A;  5E1Z B;  5JVT A;  3GW2 A;  5LGT A;  4RGR A;  2JPB A;  3S2W A;  3IC7 A;  3JAM K;  3I5U A;  2GZW A;  3W6J B;  2YX4 A;  5K5Q A;  1LEB A;  4EJT A;  2E1N A;  2G7U A;  1LNW A;  2VBY A;  1ONV A;  1JHF A;  1IXS B;  4Y17 A;  1SD4 A;  2FMY A;  4WXH A;  5E1W A;  1U5T C;  3N97 A;  3K69 A;  1H0M A;  4WK8 F;  2L54 A;  3GFM A;  3WG9 A;  2ISZ A;  3RIR A;  4OIN F;  4N9I A;  1R22 A;  2H09 A;  2OD5 A;  1IXR C;  2RC4 A;  3WOD F;  3IRQ A;  3F3X A;  3CLO A;  4P55 A;  1QO0 D;  3SQN A;  4HDU A;  2LSO A;  3I0T A;  4CGZ A;  4LG0 B;  3ABU A;  3MZY A;  2XGX A;  1LDK B;  1PUE E;  2L4A A;  2RVC A;  2DAO A;  1HBX G;  1SMT A;  4LLG F;  1XN7 A;  1XGM A;  3WTZ A;  2ZNY A;  4OIP F;  3CUO A;  1TW2 A;  5HOO A;  1OYI A;  3OV8 A;  1PP7 U;  1U3E M;  1TBX A;  2XAQ A;  3F8F A;  3K2Z A;  1O57 A;  1QZY A;  4ZYE A;  3BZ6 A;  4EM0 B;  3K1M A;  1ZHF A;  4M9Z A;  5FFX A;  3IWF A;  3FXU A;  1CF7 A;  2DK8 A;  2LKP A;  3LAP A;  2A07 F;  2EFW A;  2PN6 A;  3G3Z A;  1J9I A;  1XMK A;  5CVR A;  1QGP A;  3TDZ C;  4MHG A;  4Y13 A;  4A2U A;  3CUQ A;  1WWX A;  3LA3 A;  3KET A;  4G94 A;  1OMI A;  4KA4 A;  2R7D A;  3ZMD A;  1U78 A;  5L3G A;  3REO A;  4HV5 A;  5CVI A;  4LLN A;  2RN7 A;  3BJO A;  4M72 A;  5HDG A;  1J59 A;  4OIO F;  2DT5 A;  2M8E A;  4FX0 A;  4BNC A;  4ENM A;  1IAW A;  3ERE D;  3IRR A;  5BOX A;  1ZG3 A;  1B1B A;  4KYW A;  2DTR A;  2L01 A;  1G3S A;  3IWZ A;  4M74 A;  4LLL A;  3C3W A;  3WGG A;  4XBF A;  2CWE A;  4JBA A;  3GYH X;  3F21 A;  4Q5S F;  2FNA A;  2LF7 A;  3IKT A;  2DO7 A;  3PQJ A;  3GVA A;  3FM5 A;  2M45 A;  3EDP A;  1H9T A;  3F72 A;  4Q47 A;  4HOB A;  4S05 A;  4HF1 A;  1KU2 A;  2DQR A;  1R5H A;  2HZT A;  2LF8 A;  4IJA A;  3KZY A;  3J81 K;  1IRG A;  2QLZ A;  3CO7 C;  4IHS A;  3EET A;  1IF1 A;  1FOK A;  2HKO A;  2XIG A;  5L3F A;  2MH9 A; 
#chains in the Genus database with same CATH topology
 4R1H A;  1IN6 A;  3FHN A;  2V6C A;  2OAZ A;  3ROU A;  5DD8 A;  4QLC U;  5EG0 A;  3AG1 H;  2R7T A;  2DN0 A;  1IN4 A;  3QPT A;  1BM9 A;  3HRT A;  3NQO A;  4P1W A;  5ILU A;  2EFP A;  1IUF A;  2CO5 A;  3SYT A;  3JSO A;  1R4N B;  2DA4 A;  3Q5F A;  2NOG A;  2RV8 A;  1R4M B;  3KZI C;  4KNY A;  4CYC A;  4O3M A;  1I6H J;  5ICG A;  3KP5 A;  3PFY A;  1FTT A;  2OCE A;  4U0W A;  1LVK A;  1Z3X A;  3GME A;  4A69 C;  1MND A;  1MD0 A;  4B8X A;  1B8I A;  2HR3 A;  1E3P A;  1I3A A;  1WPK A;  1X2N A;  1Z6T A;  3HTU A;  1XTA A;  4AYB A;  4C2M J;  1B9N A;  2H8R A;  1E0E A;  4L9J A;  2GBY A;  2IEK A;  2VQH A;  2WAE A;  3BR1 A;  3OL4 A;  3OY9 A;  4YG2 F;  1BL0 A;  2MSY A;  4J01 A;  1MBE A;  4UUS B;  3UNG C;  4BXU A;  1W7P D;  2EZL A;  4IHX A;  1R49 A;  1W7P A;  3H3Z A;  2NVT J;  3CO6 C;  4NUB A;  2OBP A;  1BIA A;  3HTS B;  1K7A A;  2HWV A;  2LMD A;  2XRL A;  3C7J A;  3MCZ A;  3CD6 I;  2XAF A;  1WKM A;  4RLF A;  3SFZ A;  2H1L A;  2DA6 A;  3QOD A;  3S1N J;  1HSJ A;  3ZN1 A;  4L0Z B;  2OJE D;  2HKX A;  1UHW A;  1UCR A;  3JR9 A;  3AL0 B;  3OS0 A;  1Z1D A;  2XGD A;  4IL6 C;  3W3C A;  1LE8 A;  4ZYH A;  4D7N A;  4EJO A;  1R1T A;  1A04 A;  3OIO A;  4L0Y B;  3IHU A;  2KIF A;  1I27 A;  2E1C A;  4A3J J;  4CCO A;  3TP3 A;  2O03 A;  4DGW B;  4CO8 A;  4J00 A;  1Z67 A;  1XCB A;  4RB0 A;  2YU9 J;  1KQ0 A;  4U7D A;  1ZYR F;  4EMS A;  2AQE A;  2JZY A;  5F1J A;  2G0E A;  2KDZ A;  2R7R A;  1WVR A;  4EJW A;  5IYB J;  1IRZ A;  2IAI A;  1U8B A;  5DM6 F;  4G8X A;  4PJ0 C;  1Z9C A;  1OCP A;  3KP4 A;  1JT0 A;  1YW7 A;  1QPM A;  1R58 A;  3T5X A;  2Z5U A;  2GWR A;  1OJL A;  4ZDL A;  1SC7 A;  1QU3 A;  3FM3 A;  3DKX A;  4R8H A;  3K1N A;  3WGI A;  1BR2 A;  5F64 A;  1YIJ I;  2EA4 A;  5AON A;  2QSH X;  2DA7 A;  5F27 A;  5FLV A;  3L1P A;  2K7L A;  1CF7 B;  3Q3S A;  3MVP A;  1MGT A;  2CQ7 A;  3P9I A;  4CCM A;  3OYD A;  3VYU B;  3TQN A;  1D8K A;  3A2K A;  3FXO A;  4LK0 F;  3D5R C;  5DM7 F;  2QKM B;  1IO2 A;  2XGC A;  5CJ9 A;  1Y1W J;  3WHC A;  1J09 A;  3GTM J;  3SZT A;  2I8D A;  2FUG 2;  2VOP A;  2VJ4 A;  3TDU C;  1YRN B;  2X6X A;  2RGV A;  2L0K A;  3JRG A;  3BJ6 A;  2E7X A;  4KFC A;  2LK2 A;  4YFK F;  4PGH A;  1S29 A;  1Z3Y A;  3RYR A;  3TGN A;  1D8J A;  3I4M J;  3P9K A;  3LQQ A;  1MJ9 A;  2K9L A;  1USS A;  3F8N A;  5EF6 A;  1Z77 A;  3AL0 C;  4IQ4 A;  3CUQ B;  1OCR H;  2QBY A;  2E71 A;  1YFH A;  1I50 J;  3F22 A;  2D1H A;  1IDZ A;  2KHM A;  5ILV A;  1W0T A;  1ZRC A;  3FMS A;  3RDI A;  3FK6 A;  2F5C A;  4KN7 X;  3FXM A;  2CQQ A;  1Y6I A;  4ZTJ A;  4HSR A;  5KCM A;  1S7O A;  4KUM A;  3OYK A;  2HDD A;  3K0L A;  5DV5 A;  2XF5 A;  2QSG X;  3E5X A;  4XRS A;  4M3D A;  1M1E B;  2OUM A;  2DA1 A;  3S93 A;  1PP8 F;  1FYK A;  3G2B A;  2VL8 A;  2CFO A;  2O0Y A;  2M5W A;  2KT0 A;  2WV1 A;  1SVO A;  3H0D A;  4EGZ A;  3RQI A;  4PCQ A;  2Z2S B;  3WE2 A;  4E7S A;  1SVL A;  1H8A C;  2A05 A;  4WX9 A;  4IHY A;  2R5Z B;  4MNU A;  5ICF A;  3A02 A;  4ZC3 A;  3RSN A;  1OR7 A;  4LJZ F;  3PJR A;  2DTZ A;  4LIU A;  2C6Y A;  3MZ8 A;  4QTR A;  1HCR A;  1BJZ A;  2JN6 A;  2ECB A;  3CC7 I;  3HM5 A;  2V9K A;  3LOC A;  3FDY A;  2P8T A;  4HYE A;  1MNM C;  4HX8 A;  5K7F A;  1G3T A;  1HF0 A;  3M3Y J;  1W5C C;  1FBS A;  4HNU A;  4GRI A;  1J7K A;  1XD7 A;  4XNF A;  4RGS A;  2KLO A;  2GOX B;  1H9G A;  2ME6 A;  2CW8 A;  3GF2 A;  4FCY A;  2CGP A;  4PDK A;  2PJP A;  3CC2 I;  1RC9 A;  4LOC A;  4U0Y A;  3GEZ A;  3QP5 A;  4DQ2 A;  1LQ1 A;  2R7Q A;  3IAM 2;  1WJE A;  4C2U A;  3CUQ C;  3W2W A;  3WGH A;  1OCT C;  3DTE A;  1FY7 A;  5BPD A;  4A3D J;  3HSE A;  1U9N A;  3GFJ A;  3ECH A;  4E7J A;  2KQR A;  4Y33 A;  2OTL I;  2DMU A;  5BPI A;  2ECC A;  3LA2 A;  1MKM A;  2ELH A;  3L09 A;  3D1N I;  2FEZ A;  1VQ7 I;  2CV2 A;  4KDP A;  1XMA A;  1V4R A;  3G1M A;  2FJ1 A;  1LPQ A;  1XDU A;  3L2C A;  1JXS A;  4A6E A;  3F6O A;  2E5Z A;  2HTS A;  2RRE A;  2YSR A;  2UXX A;  4AID A;  5J6X A;  2KRF A;  3SDG A;  2F5V A;  3JTH A;  2MD5 A;  2L9R A;  2HQR A;  1JKR C;  3PNV A;  4IRG A;  1W4M A;  3FXQ A;  4XOT A;  3DKY A;  2P4W A;  4UXN A;  2P5K A;  3DP7 A;  4CHU A;  5B66 C;  3J80 Z;  4OIQ F;  4NB5 A;  4HF0 A;  1DP7 P;  5IT9 Z;  4S04 A;  3A01 A;  2L7K A;  3VDX A;  1DQU A;  1LDJ A;  3HB9 A;  1XGN A;  2M30 A;  1JUM A;  3KFW X;  3G71 I;  3L2V A;  5LHI A;  1BN5 A;  5EG0 B;  2WBM A;  5GPC A;  2VE9 A;  2V4J C;  4IRH A;  3DLA A;  3R0J A;  2BE5 F;  2XSJ C;  3LQR A;  3F0C A;  3R0A A;  3EPZ A;  4JX6 A;  1YOV B;  3G1O A;  4CYC B;  1FPQ A;  2KIS A;  4E7K A;  1W0U A;  3I56 I;  2KJB A;  3CCM I;  3TOA A;  1B8I B;  3H35 A;  2O6G E;  3ZMT A;  1S8N A;  4N9H A;  4IVN A;  4OAY A;  5D8K B;  1FZP B;  2ELJ A;  2W82 A;  3TO9 A;  3M7G A;  1WJD A;  1MBG A;  1QRY A;  4I2O A;  2DT6 A;  2JSC A;  1DPU A;  3K4J A;  1HKQ A;  2DLL A;  3BG3 A;  5E1X A;  1W7P B;  3K4B A;  5CVU A;  4YEL A;  5JFR A;  3RPU D;  5FLX Z;  5FJ8 J;  3BG7 A;  3SXY A;  5LHH A;  2LP0 A;  4CCN A;  4FX4 A;  2IVM A;  4RAZ A;  1K78 A;  4BJ5 C;  1JUP A;  2AXT C;  1TW3 A;  4PJM A;  1D0Y A;  4E70 A;  2HEO A;  2F2E A;  3LAJ A;  1F9N A;  1ZH5 A;  1Z0X A;  3MMY B;  5DCM A;  2GIZ A;  4AUX A;  4HRI A;  4ZZD A;  3IV5 A;  4XSZ F;  1ZAR A;  2MLG A;  4GGG A;  5J1R A;  2MG4 A;  2DA5 A;  2UUZ A;  4U7B A;  1WFX A;  2ZNZ A;  5GPA A;  5DS9 A;  3HG9 A;  3W6K B;  4HG2 A;  3CCY A;  1LE8 B;  2F5F A;  2BV6 A;  2DFE A;  4BE0 A;  3DEU A;  1S9H A;  3C1D A;  3E1S A;  3RKY A;  3GTK J;  3HOZ J;  3HGG A;  1ETW A;  3CJQ B;  2W25 A;  4XR6 A;  2ACJ A;  2FOW A;  4A3G J;  1IV8 A;  2YS9 A;  3CF2 A;  3U21 A;  4KT5 C;  3HOS A;  1VQM I;  1NH3 A;  3BZK A;  4HDV A;  2KIQ A;  3OSG A;  1O4X A;  2GA1 A;  1VQ8 I;  1B72 A;  1MW7 A;  2M4K A;  3R4K A;  4KIF A;  4IZZ A;  2Q1Z B;  2BOL A;  2NNY A;  1JUS A;  1KYZ A;  3FF5 A;  4RLQ A;  4X1E A;  2DOE A;  1P4X A;  2IPQ X;  1QQI A;  4UVA A;  2GXA A;  4IHT A;  4II3 A;  2Z9O A;  1VQO I;  1TWC J;  2FBI A;  2CS3 A;  1RES A;  1ON1 A;  5L3C A;  3P5J A;  2VPR A;  2A6T A;  3EUK L;  3BPV A;  1Z21 A;  2E1O A;  1UST A;  4M71 A;  5HS8 A;  3LSI A;  2CU7 A;  3LSJ A;  1XC5 A;  4DNC A;  2ZO4 A;  3ZRG A;  1KU7 A;  4JYK A;  4ANJ A;  4HPQ A;  4UUS A;  4P96 A;  1K6Y A;  1UJ8 A;  4YIR X;  5JLX A;  2HQ5 A;  1AOY A;  1UFM A;  4WXC A;  4XLF A;  4KMF A;  4U88 A;  1LKX A;  1ZLJ A;  2H6B A;  1R23 A;  2IW5 A;  2V1U A;  2FF4 A;  3FIS A;  1SAU A;  4EM2 A;  1YIT I;  5ED4 A;  3WTW C;  1UHS A;  5KAF C;  4IOA F;  1TP4 A;  3WHB A;  3CDH A;  2JVG A;  2O5R A;  3F8B A;  1POG A;  2QBY B;  1A31 A;  2CV1 A;  3K4K A;  1K4T A;  2GXG A;  1T6S A;  2NNN A;  3BCB A;  1JJ8 C;  2XB5 A;  2ID3 A;  4B09 A;  3CCR I;  3WE3 A;  3GXO A;  1REP C;  3HOU J;  3KPH A;  5CVV A;  4HW0 A;  3TL4 X;  3OYN A;  3U9G A;  3DQV C;  1MH3 A;  6PAX A;  4UNO A;  3Q0V A;  3O3K A;  3OR2 C;  5AIQ A;  3C2G A;  5IP6 A;  1FLI A;  1WJF A;  2Y30 A;  3BT9 A;  5GTI C;  3VOE A;  3PFI A;  2Y0S A;  5H6R A;  2BW3 B;  1WGX A;  4BXF A;  1WH7 A;  4A0X A;  2LC2 A;  4LIV A;  3RTR A;  3GLL A;  3L2W A;  4A93 J;  2OTJ I;  2D1V A;  4E7L A;  3CME I;  3WTX C;  2DCE A;  4PFO A;  4LMY A;  1F1Z A;  3RQ4 A;  5JI6 A;  4WXD A;  3DPL C;  2OPT A;  2WA0 A;  2DFF A;  3BRO A;  4FAS D;  3R60 A;  1E17 A;  2K9N A;  1DUX C;  1I1G A;  3VSL A;  3S1Q J;  2ICW G;  3IH3 A;  2JRM A;  1V3F A;  1BIB A;  4IF4 A;  2ZJQ F;  1Y8Q B;  2A6H F;  2V7F A;  2V26 A;  1Z7U A;  5JLW A;  2AS5 F;  2CMP A;  2V1D A;  1U8R A;  3OYB A;  1T2K A;  3VYT B;  1ETQ A;  2PFB A;  3CP2 A;  3B73 A;  3KP3 A;  4LD5 A;  4I09 A;  1F4K A;  2ZSI B;  5EGO A;  2JUC A;  3HIF A;  1EKE A;  3CF5 F;  3FMR A;  3V8J A;  4LK1 F;  4F52 A;  3IKV A;  2UZK A;  5HVQ C;  5FB2 A;  4IRI A;  2LNB A;  1A5J A;  1ZGW A;  4BHP A;  2IA0 A;  3HHH A;  3KP6 A;  1ETO A;  2ZJ2 A;  2FD5 A;  5LBQ A;  3VOD A;  2IA2 A;  3LWF A;  1Z7L A;  1ZRD A;  3LSM A;  1BW5 A;  1V55 H;  2M0M A;  2XV4 S;  3H9Q A;  5HS9 A;  3CMY A;  4YII A;  1BI0 A;  5LLQ A;  2XC7 A;  5E8G A;  3VB2 A;  3FXR A;  1MH4 A;  3PL8 A;  3BR6 A;  4IPA A;  2FQ3 A;  3RPQ A;  4Z2Y A;  1FYL A;  2BXY A;  4CYD A;  1ZKG A;  2ZFU A;  3LSH A;  4I98 B;  2Y0M A;  1S72 I;  4A3B J;  4RM2 A;  3FXK A;  2D5V A;  2W4S A;  2CUJ A;  1XDS A;  2L7F P;  3A01 B;  4A3L J;  1OR7 C;  5DCF A;  3GZ6 A;  1T98 A;  1OKR A;  1VZ0 A;  4BGD A;  1QHH D;  3CJR B;  2F48 A;  3E6D A;  3HZJ A;  3UR3 C;  4OMY A;  2PG4 A;  2Z99 A;  1WI9 A;  2QEN A;  2HYF A;  1FT9 A;  3ZQG A;  3HOV J;  4HAM A;  3BTJ A;  5A2Q K;  4V2F A;  3OIP A;  1OCZ H;  5FRM A;  1X3U A;  2RQP A;  3L2Q A;  2L7M P;  1OYW A;  1WCM J;  1I1S A;  1SD7 A;  1JT6 A;  3DV8 A;  3RCO A;  4FET A;  4PJJ A;  2XHK A;  2EZH A;  1LVA A;  4M9X A;  2MC4 A;  1FOW A;  2JRT A;  2NS0 A;  1MMG A;  1MBJ A;  2P0W A;  2CW0 F;  3HSF A;  1N77 A;  2A68 F;  1EF4 A;  1K78 B;  2MD0 A;  5IPA A;  1FIP A;  5IT3 A;  4BQQ A;  2KJC A;  4JOM A;  3KEQ A;  2X9D A;  4P9U A;  1HA8 A;  5L3E A;  5E18 F;  1RPW A;  1OPC A;  4XIC A;  1YIO A;  3H9G A;  2QQ9 A;  1W36 C;  3EYI A;  2E7W A;  5DCM B;  3IL2 A;  1IN8 A;  5FD6 A;  3TKY A;  2BVL A;  5HLH A;  1R00 A;  2LBF B;  1B4A A;  1NG7 A;  2CQN A;  2JK3 A;  2V6E A;  4F55 A;  5FD5 A;  4FHT A;  5LD2 C;  4HA8 A;  4L9V A;  2GA2 A;  4BL0 B;  2M7B A;  1QZZ A;  5D6F A;  4UVB A;  4RBO A;  1MSF C;  1KGS A;  3CDI A;  2O7O A;  3T1B A;  2FRH A;  2HNH A;  3RZO J;  2WY7 Q;  3TO7 A;  3JAM Z;  1JTX A;  4JQF A;  2K02 A;  1X3W B;  1FIA A;  2VJI A;  1TQP A;  3MD2 A;  3H3V K;  3OYA A;  3R61 A;  2Y75 A;  2W24 A;  3PO3 J;  1BW6 A;  3QU6 A;  1R6R A;  3MAJ A;  2DT7 B;  3NWT A;  1B72 B;  3W2A A;  4KIT B;  4G7O F;  3LSK A;  4ZJZ A;  1OYY A;  2HYJ A;  5D6E A;  2KMU A;  3OYL A;  3ISP A;  1BA5 A;  2E1M C;  1HDD C;  2L02 A;  3CTA A;  1XSV A;  4NQW A;  2GQQ A;  1RR8 C;  2ETH A;  4G7H F;  1GVD A;  4LFU A;  1P6R A;  3N05 A;  3RKQ A;  4K2E A;  1Q1H A;  3EYY A;  4UV8 A;  3PQK A;  4FT8 A;  2Y2Z A;  3E0J B;  5HOD A;  3S1R J;  1FMV A;  2IGO A;  2EFO A;  2X1D A;  2GM4 A;  4G6Q A;  2ADU A;  4JP0 A;  3QQA A;  2J5P A;  2X4H A;  2BGC A;  3JW4 A;  2XGE A;  2X0L A;  3TP0 A;  4HX4 A;  4L5I A;  2TRT A;  2XRO A;  4YEJ A;  1Z05 A;  2Y9Z A;  2W57 A;  2X51 A;  4FE7 A;  3VPR A;  2BVM A;  1SEU A;  1ORK A;  3FK7 A;  2VBW A;  2X85 A;  2NVX J;  2H6C A;  2XAJ A;  3F8M A;  3KLO A;  5FKO A;  2P6T A;  4LIT A;  4D7M A;  4E7I A;  4XSX F;  2G9W A;  4M6Y A;  5H20 A;  3BTL A;  2AQF A;  3PUF A;  2R7S A;  3ZP5 A;  1R5I D;  3C2B A;  3T8T A;  2Y31 A;  3FXL A;  2XAS A;  4XQF A;  4RDU A;  2Q0O A;  2XAH A;  3MQ0 A;  4OOI A;  5DUI A;  1G3W A;  2E2J J;  4BE1 A;  2W84 A;  2M9H A;  3RI4 A;  4DIQ A;  1XMX A;  4DJA A;  1P4W A;  3BG5 A;  2K27 A;  1HKS A;  2R92 J;  2DPD A;  4PGG A;  1R1U A;  1BC8 C;  4XOR A;  5HDN A;  1VND A;  5E3M A;  4B3A A;  4KIG A;  3S3N A;  5EYR A;  2CYY A;  3OOP A;  4ENN A;  3PUB A;  2KIM A;  3GUD A;  3U2R A;  3TO6 A;  2VOO A;  3M1E A;  3DLL F;  1FSE A;  4U87 A;  4II2 A;  3KP2 A;  1I39 A;  1KU3 A;  4BBR J;  3HKZ N;  1NG6 A;  4DZJ A;  2STT A;  4W1U A;  4BQN A;  3E5Q A;  4JK1 X;  4KT6 A;  1FWZ A;  2RQQ A;  2IS2 A;  2JWT A;  2XUB A;  4MQ9 F;  3DKW A;  3DBR B;  2R5Y A;  1VF9 A;  4G7Z F;  5BNG A;  1XSD A;  5CQG A;  3H36 A;  3BZC A;  1TTY A;  5EGO B;  2MW8 A;  2MH2 A;  2DA2 A;  5LGN A;  2Y9Y A;  5E20 A;  1Y8R B;  1S7A A;  4DOZ A;  1P92 A;  3K4C A;  3IP4 B;  5L3D A;  2QSF X;  4C3I J;  4R79 A;  2NAZ A;  4Q4Z F;  1O3Q A;  5D5V B;  4A3M J;  2VT2 A;  1ZGA A;  2CUE A;  1EJ9 A;  4FIS A;  3ZMS A;  2BEO A;  1LFP A;  3OS2 A;  5HS7 A;  2OF7 A;  2KP6 A;  2OA4 A;  3CES A;  1KU9 A;  4ZH4 F;  5C44 J;  2HVR A;  3ASN H;  1XSX A;  1ETX A;  4M9S A;  4ENJ A;  3OYG A;  3TOB A;  3HRM A;  4RA2 A;  2FXA A;  2KIU A;  4XKB A;  2K4B A;  1X19 A;  1E3H A;  3GTJ J;  4XRS G;  2XKP A;  1BI1 A;  2L9S A;  4PZJ A;  1YW8 A;  1VFC A;  1AWC A;  5TIS C;  2BW3 A;  3SZG A;  3A0B C;  2P81 A;  2VQL A;  4YFX F;  2X48 A;  4ASN A;  1FBQ A;  3OYI A;  1UB9 A;  3AG2 H;  2HDC A;  4M73 A;  5BQT A;  2GIV A;  4C2T A;  4RGX A;  3HOX J;  1TT5 B;  2XRN A;  2CSO A;  1MDM A;  1ON2 A;  3AKZ A;  4ESB A;  1TWG J;  5CYV A;  4ENK A;  3BY6 A;  1LB2 A;  2BYV E;  1S3J A;  5C3E J;  1MJA A;  4DBR A;  5HNF A;  1IC8 A;  4D5C A;  1BBY A;  3QU3 A;  4UVC A;  2RDP A;  4UHT A;  2PQ8 A;  4MFD A;  3HUG A;  4E6K G;  2ZC2 A;  1YTY A;  2YR2 A;  4RGU A;  3VEP A;  5B5E C;  1X1B A;  3DBH B;  5TJJ A;  4AIJ A;  3QPL A;  1ITY A;  3DEW A;  2DW4 A;  5FO5 A;  1ZN2 A;  5F1R A;  2L3D A;  2VPL A;  3NRV A;  1G59 A;  3S15 J;  5LHG A;  2WC2 A;  1RZ4 A;  2M34 A;  3L9F A;  2QVO A;  1P4A A;  2COB A;  3C18 A;  1IRF A;  3QRF F;  3CCQ I;  4BDY A;  1JHH A;  2ZJR F;  1ZR4 A;  1U2W A;  2CJJ A;  2CQK A;  2VN2 A;  3GWZ A;  4HV6 A;  1PYV A;  2NYX A;  5M3M J;  3OYE A;  4A3I J;  4HZF A;  2HQN A;  1XGO A;  3J7A O;  5E17 F;  3VFZ A;  2JQ7 A;  5M3F J;  5FKK A;  4RB1 A;  3JSP A;  2CH0 A;  4QPO A;  2K40 A;  1J0R A;  2NOJ B;  1U6G A;  3I55 I;  3HOY J;  4WF2 A;  1BI2 A;  4M3E A;  1VQ5 I;  3KYD B;  1TNT A;  1W36 D;  2P6S A;  2WV0 A;  4HLY A;  2QUF A;  1RR7 A;  5J47 A;  4A3F J;  3J81 Z;  2EV6 A;  1I3Q J;  2YX7 A;  3FWE A;  4XLE A;  1SFO J;  1FJL A;  1GVJ A;  2H8W A;  2EIJ H;  4MEY F;  3ASO H;  1WQ2 A;  1WH5 A;  4M3F A;  1G3Y A;  4B4C A;  4BHB A;  1XCV A;  3V7S A;  3PSF A;  1HW5 A;  3JRF A;  3PSI A;  4M6V A;  3ABT A;  2LKS A;  3B6C A;  4D1Q A;  3BC8 A;  2ZXW H;  3EUH C;  4BH9 A;  3F8C A;  3IH4 A;  1DGR M;  4EQQ A;  4I99 C;  1UG0 A;  1I6X A;  1Z91 A;  2QEX I;  1K61 A;  3P7N A;  1QBJ A;  1Y39 A;  2UV1 A;  2J5O A;  3QWL A;  5EEH A;  1GV5 A;  2HYG D;  2XKO A;  3GLX A;  2IP2 A;  3I58 A;  4NQW B;  2AXL A;  1E2X A;  1J5Y A;  2QF7 A;  1VQL I;  5BS6 A;  4LGW A;  1MZB A;  2JA2 A;  4G6T B;  4NC8 A;  3KZZ A;  4L5J A;  4YIF A;  4A0Z A;  2ZME C;  1IGN A;  3EQL F;  1KQ8 A;  4B3X A;  3AG3 H;  1APL C;  2DOA A;  5M5W J;  4V19 K;  4YRV A;  3D5L A;  3OYH A;  1OFC X;  4MTE A;  3Q9V A;  4PSX A;  3DCF A;  3TED A;  3GO5 A;  5B1A H;  2NVQ J;  5ICE A;  1XG1 A;  2KZV A;  2E2I J;  2P7V B;  2DU9 A;  2O8K A;  4BBS J;  1MMD A;  4F92 B;  2VUM J;  1FMW A;  2FOK A;  3H1C A;  4EJV A;  3G4S I;  1ZRF A;  2W7N A;  1SFU A;  1S7E A;  1HW2 A;  1ERD A;  5K1Y A;  1ZRE A;  2YUS A;  1DGW Y;  4B44 A;  5EZG A;  2LBF A;  3J7Z I;  2BY1 A;  3TW7 A;  3BR3 A;  3PIO F;  4BQO A;  3H5R A;  2F5E A;  3ZOB A;  4IX7 A;  2W48 A;  4WCG A;  2P7C B;  2EV5 A;  2ESN A;  2LOO A;  3V42 A;  1PDN C;  2V1X A;  1O3R A;  2E5N A;  1X1D A;  3WTT C;  5K5R A;  4BY7 J;  5J8F A;  1JJ6 C;  3HDD A;  1VQ6 I;  4OIR F;  1SVM A;  3M8F A;  3L2R A;  1ZR2 A;  1K4S A;  2OC6 A;  4XLH A;  3AAF A;  2K4J A;  3OYM A;  5H6Q A;  1SD6 A;  4E7H A;  1T08 B;  1OIS A;  3OR1 C;  2LDU A;  3H92 A;  4RAY A;  5LFA A;  2JA7 J;  2IA1 A;  3SHF A;  2XF7 A;  5CVJ A;  4BE2 A;  3DFG A;  1NTC A;  4UUT A;  1BR4 A;  1VTN C;  3E97 A;  3KYC B;  1FX7 A;  4FE4 A;  3ZQQ A;  3A03 A;  5GAE J;  3LA7 A;  5KVR A;  3LSG A;  3BP8 A;  5KAI C;  3NEU A;  3EUA A;  3MZH A;  3GTG J;  4UB8 C;  2Z1D A;  4C3H J;  1GHC A;  4HNT A;  3KLN A;  4EM1 A;  1HKT A;  2M7A A;  1E3O C;  1K6O A;  3Q9S A;  5DDG A;  4O6J A;  2R5Y B;  1ULY A;  1GDT A;  2X6Y A;  3WTV C;  3L00 A;  1Y56 A;  1WHU A;  3NWS A;  4N0B A;  4W97 A;  1R5G A;  2EIN H;  5BMZ A;  1T39 A;  3BQZ A;  2FSW A;  1X1C A;  5J1U A;  4B48 A;  3BTI A;  2X6O A;  5FKM A;  2PJR A;  2EA2 A;  3CP8 A;  4LB5 A;  4N4O B;  2HOA A;  1A6I A;  2WWY A;  2QCO A;  2X1E A;  4HF2 A;  1A6Q A;  4ABZ A;  1ZLK A;  3MKZ A;  4B47 A;  5LEK A;  1IN5 A;  2EB7 A;  2VIX A;  3O2P E;  1X4P A;  2EBI A;  3RJP A;  3T0Y A;  1F43 A;  3A1Y A;  1IRX A;  1Z6R A;  4XLA A;  3GZN B;  1FP2 A;  4HQE A;  3ZQC A;  4ZDO A;  1R1V A;  3G73 A;  2QZ8 A;  2VT3 A;  4KIB A;  2XAU A;  1JGS A;  3H5N A;  3KEO A;  3ULQ B;  4ZZL A;  1D5V A;  3JRC A;  1MJB A;  4HLX A;  4UB6 C;  1STZ A;  1T8I A;  1YHQ I;  5EEG A;  1ZEL A;  3V4G A;  1KQ9 A;  4MFE A;  2HVS A;  2DMN A;  1FC3 A;  2O9L A;  2QQB A;  4BAY A;  4RMN A;  2M87 A;  5CKT A;  5D5U B;  1KA8 A;  2HXI A;  2LH9 A;  2Q2E A;  4F7Z A;  3S17 J;  5K5O A;  2YPR A;  2WAD A;  4KIC A;  1TZL A;  3M9A A;  4DBQ A;  3DXJ F;  1RKT A;  1MDM B;  1PUF A;  1GLN A;  3OS1 A;  2E36 A;  4BJT A;  5HNH A;  4CSW A;  2QQ8 A;  1U9O A;  4C3J J;  1UHM A;  1WJC A;  2IT0 A;  2CFX A;  2E60 A;  3K7A J;  1I5Z A;  2IJL A;  1IG7 A;  1WI3 A;  3IH2 A;  2R0Q C;  4O5V A;  1CGP A;  3ZPL A;  4ESJ A;  2VOD A;  3HUG B;  2IBD A;  5TGT A;  2BY3 A;  3LFK A;  1UEL B;  2X1C A;  3DTI A;  2MA3 A;  5KNL A;  1ZQ3 P;  4C30 A;  1HW1 A;  1VQ4 I;  3HJE A;  3S3O A;  2BY0 A;  1QNT A;  4XKV A;  1WRJ A;  3HYI A;  4IHV A;  2EJR A;  3I71 A;  2M8G X;  1HDP A;  3D5S C;  3DPT A;  4KIS A;  5HLI A;  2OQG A;  2Y48 A;  1IJW C;  3DBL B;  2AO9 A;  2FX0 A;  4BEH A;  2MYS A;  1RUN A;  1X1A A;  2I10 A;  4MO7 A;  1GT0 C;  1RET A;  2QGU A;  5DEQ A;  1MBK A;  2DBB A;  1ETY A;  4QWQ A;  4ETS A;  2NXN B;  5IP9 J;  3CJN A;  5GAG J;  1YQA A;  4I6Z A;  1D1C A;  3MWM A;  1IUY A;  2NVY J;  2D45 A;  5AIP A;  4AIK A;  2LY2 A;  2R3S A;  3UKG A;  2H27 A;  3SEQ A;  1L0O C;  1JTY A;  2EQR A;  1K79 A;  4A3C J;  5D8L B;  3C2H A;  1FOX A;  1WJB A;  3WTY C;  3M8E A;  4CIC A;  2VXD A;  4L9N A;  4XID A;  4U0V A;  4TV7 A;  1FBU A;  2K3F A;  1FOY A;  2DJN A;  2HVQ A;  4NC6 A;  4Q48 A;  4ZTF A;  2HPI A;  3CCL I;  4RM3 A;  3F23 A;  4NNJ A;  3LSR A;  2KKO A;  5F0H A;  3CC4 I;  2STW A;  2VKV A;  1MMS A;  4E4H A;  4DW6 A;  2K3P A;  5FGM A;  4Y15 A;  2WTE A;  2DFI A;  4EEF G;  4UV9 A;  5FFZ A;  3CCE I;  1OCO H;  1BOA A;  2B63 J;  3CCS I;  2W00 A;  3FHZ A;  2O61 A;  3EUH A;  5F0F A;  5IP7 J;  1HOM A;  3G6E I;  1D5Y A;  2K86 A;  4HQM A;  4MIM A;  5D5X B;  3M8J A;  1TT0 A;  3FKI J;  5C4X J;  2OZU A;  2GAU A;  2DOD A;  5D4S A;  2V9V A;  2PLY A;  1L3L A;  1B9M A;  3BJA A;  4BUP A;  5E79 C;  1IN7 A;  2LLK A;  1TC3 C;  1P7J A;  3WU1 B;  3HL2 A;  4CDG A;  2A5W A;  2E1M B;  2EWN A;  5ERI A;  1SFE A;  3OL3 A;  1V5F A;  4AVP A;  4CH7 A;  3HOW J;  2FE3 A;  2XDV A;  4I02 A;  3E5U A;  2ZB9 A;  3BPX A;  3LL7 A;  3FZV A;  4IXA A;  2HOS A;  4BS9 A;  3H0G J;  2HQA A;  2VJJ A;  4IHW A;  4NC7 A;  2IS1 A;  1BI3 A;  1Q1V A;  4M3B A;  4I0B A;  4H0E A;  4UUV A;  1UG2 A;  2A69 F;  2ZME A;  2NRA C;  2P5V A;  5GTH C;  4DZP A;  5J8C A;  1O3T A;  2O3F A;  2K9M A;  1SMY F;  4QSH A;  2M1B A;  4BKX A;  3ZQH A;  5JVG F;  5JHF A;  5HLT A;  4XRM A;  2VB6 A;  2JSP A;  5TRD A;  4ON0 A;  2LG4 A;  2ZFW A;  3HKZ A;  3V7R A;  4GDF A;  2B0L A;  3A0H C;  2L9N A;  3WTS C;  3RKW A;  1D0Z A;  1JKP C;  4EV0 A;  1YE9 A;  4KN4 X;  5F0C A;  2D2W A;  3K4M A;  3ZGK A;  2PI0 A;  4CZZ A;  5M5Y J;  5K7Z A;  4A3E J;  3BOQ A;  3GTL J;  5E3L A;  2Z33 A;  1IV6 A;  3ML6 A;  3PM1 A;  4I01 A;  1R9T J;  5IYD J;  3QYF A;  1O7F A;  4OMZ A;  3HRU A;  3CZ6 A;  1ZTR A;  4IEJ A;  1RUO A;  2DJI A;  3PNT A;  2TDX A;  4P5O A;  3IAS 2;  1UZC A;  1DP3 A;  2MC3 A;  2O8X A;  4ZYG A;  2JA6 J;  2FNP A;  2GOM A;  3GZ5 A;  2E34 A;  3WTU C;  3FMQ A;  4HBL A;  2K9Q A;  5LRS A;  1BOB A;  1S5L C;  3J80 K;  1H88 C;  5CQE A;  5IT9 K;  2K9S A;  4GYG A;  5HDK A;  1BJA A;  2LRE A;  1YW9 A;  2PEX A;  4G12 A;  4P9F A;  2JMW A;  2Y69 H;  2ZSH B;  4XK4 A;  4Y7N J;  2JT1 A;  2TCT A;  4ZYD A;  3V7C A;  3ZR8 X;  3E6M A;  4XN3 A;  4CCL A;  2F4I A;  4AC0 A;  2R7Z J;  2IGM A;  4M6X A;  2XSD C;  1DDN A;  1TQM A;  3L7W A;  1KON A;  4RB2 C;  2DYR H;  5D5W B;  4L9T A;  1VQN I;  2ZXJ A;  3ONQ A;  3H5A A;  3AG4 H;  3I4P A;  2KRH A;  3WU2 C;  2HGC A;  2HTJ A;  1KZH A;  2ZJP F;  5ICC A;  1Y0U A;  2PMH A;  3T8R A;  2PJR B;  1IW7 F;  1U5T A;  1F5T A;  5E3N A;  3QPS A;  4XLN F;  3ZMU A;  3WU0 A;  5IYC J;  2JTV A;  2NVU B;  2XB0 X;  3DEE A;  1ETK A;  3HSR A;  3BR5 A;  3KCC A;  2JUG A;  4PSW A;  4EVI A;  2CV0 A;  1FTZ A;  4BYY A;  1FSH A;  4XLP F;  5FLX K;  2W1O A;  3QOP A;  1LDD A;  1A36 A;  2VAS A;  4GO1 A;  3I59 A;  4EJU A;  1T95 A;  2B7E A;  5EZH A;  4B43 A;  3GCM A;  4A5M A;  2MFZ A;  1TWH J;  1W5T A;  4BDZ A;  4BQA A;  2KL4 A;  4A5N A;  1TL8 A;  3ABL H;  1P2F A;  1GXQ A;  3ABM H;  2GXB A;  3K1P A;  4I7H A;  1C0W A;  2I5U A;  3AFH A;  3QYB A;  1ZG5 A;  2CUF A;  2CW7 A;  5DYM A;  3E6C C;  3ZQL A;  1EH7 A;  1YS6 A;  1FP1 D;  3K4N A;  2FBH A;  3ELK A;  2DMQ A;  3JRE A;  4EGY A;  2FML A;  1GXP A;  2F4O B;  2Q2E B;  3S3M A;  2A6E F;  3O8H A;  1O7L A;  4N4N B;  3HOT A;  2ELK A;  1U0J A;  2DFH A;  1V5E A;  1PUF B;  2M0C A;  2MLK A;  3I53 A;  1LEA A;  3ZQ7 A;  1JE8 A;  2BXZ A;  2A5Y B;  3I54 A;  3HGY A;  1G8X A;  4LB6 B;  3X2Q H;  5D4R A;  5FRN A;  1RIO H;  2M4G A;  1QHG A;  3MKW B;  1P9Q C;  3U1D A;  3JRD A;  4MGR A;  4IQJ A;  1PVE A;  1NK3 P;  2G7H A;  1MIJ A;  3GFI A;  1YJ9 I;  3GTP J;  2ISY A;  2Z3Y A;  1XB4 A;  2L4M A;  2ZKZ A;  5DUK A;  4OU0 A;  2V79 A;  1MBH A;  5EDN A;  3ZMV A;  3SZP A;  5KK1 A;  2QQA A;  2XPU A;  3FX3 A;  2PBI A;  1T33 A;  3GBG A;  1XGS A;  3CCU I;  2RKH A;  1EH6 A;  2DPU A;  3HRS A;  4IKF A;  1HQC A;  2ZBK A;  5LRR A;  2COM A;  5J4V A;  2R7U A;  2VQC A;  3K9T A;  4MEX F;  1UMQ A;  3M07 A;  5FRO A;  5F08 A;  3DU6 A;  4ITV A;  4BEH B;  4L18 B;  3M4O J;  4CCK A;  5ILS A;  4E7Z A;  2QWW A;  2P5L C;  1RI7 A;  3ZXS A;  2OU2 A;  3K70 C;  1SAX A;  3WG7 H;  4AIH A;  1YO5 C;  2NS7 A;  2EIM H;  2VI6 A;  2VE8 A;  5DD4 A;  3K10 A;  2QA4 I;  2JA8 J;  4GYI A;  2A3S A;  2XVC A;  5CPR B;  5JR3 A;  1BC7 C;  4CA0 A;  3BTC A;  3OWT A;  4J19 A;  4XLC A;  3K2A A;  2BBY A;  2HU9 A;  3JRH A;  4XRF A;  1G6N A;  4Y52 J;  4A6D A;  2LR8 A;  3F6V A;  2ZXI A;  3S16 J;  2VON A;  4C9Y A;  1EV7 A;  1V5G A;  2JVH A;  3V8L A;  2IS6 A;  3HPH A;  1ACI A;  4V2G A;  1MBF A;  1TNS A;  4YFN F;  5L3B A;  2JJ7 A;  3BR2 A;  4LG0 A;  2HI3 A;  5J1Y A;  1UAA A;  4G6D A;  1N75 A;  2FBK A;  3I4N J;  3W2V A;  1OLT A;  3QAH A;  2VKD A;  2X6W A;  2VKE A;  2EV0 A;  3B6A A;  2F5D A;  1J75 A;  1T0F A;  3E3V A;  3D0S A;  1G2H A;  2PMZ A;  2HOT A;  2WB1 A;  4XKW A;  1LFB A;  2VC1 A;  3KEY A;  4AYB N;  3S2H J;  1FYM A;  4CXF A;  2K5C A;  5J40 A;  4D0P A;  2QYO A;  4DYQ A;  1SFX A;  2LFB A;  4XOP A;  2H94 A;  3MFK A;  1TQI A;  2L7Z A;  5CLS A;  2R7O A;  1N78 A;  1B6A A;  3OYJ A;  1ZAO A;  5LEJ A;  3J7Y J;  3ECO A;  4D9J A;  2KZG A;  5E8I A;  2RAE A;  1D1A A;  4A12 A;  3L2U A;  3I64 A;  5A2Q Z;  4AU7 A;  1RNL A;  1NK2 P;  4RS8 A;  3DWL E;  3BCA A;  3KE2 A;  3JCU C;  4BXX J;  4WWC A;  3MEX A;  1AKH A;  4GFB A;  1S6L A;  3KYL A;  1YX5 A;  1HXD A;  3SJM A;  1N25 A;  1CQT A;  1FNN A;  3A4C A;  2ZME B;  2XAG A;  2LTP A;  2OQR A;  3Q0U A;  1W5S A;  1XS9 A;  2IGK A;  4XL9 A;  2WAQ A;  3GTO J;  4BHC A;  4HEA 2;  5GAH J;  1JKQ C;  4L5E A;  3RKX A;  3E7L A;  3CCV I;  4HNV A;  3PIP F;  4MTD A;  2EZK A;  3VYS B;  3W6V A;  4RB3 C;  1LFU P;  1GV2 A;  2DQL A;  4ESF A;  2UWM A;  1DPR A;  1LUJ B;  1EH8 A;  2GLO A;  3E6B A;  2IRF G;  2Q8K A;  1OCC H;  4MLO A;  3LSP A;  4MQV A;  3CMA I;  3BDD A;  5JHU A;  2VBX A;  3JTG A;  2HZD A;  4PJN A;  1WJ5 A;  3FBI B;  3FIW A;  4A0Y A;  1LJ9 A;  2YU3 A;  3R6S A;  3O6B B;  1R36 A;  5FLM J;  4AWX B;  2E19 A;  5IOZ A;  4XKC A;  1TLH B;  1GUU A;  2M3A A;  1YJN I;  1KYW A;  5E3O A;  2CG4 A;  2FU4 A;  2EFQ A;  2EPF A;  2KRC A;  2RNJ A;  2W85 A;  3HBL A;  2DK5 A;  3COA C;  1T38 A;  3ZN0 A;  1O3S A;  4AD9 A;  5F6F A;  1G4D A;  4GCV A;  3B02 A;  1J2X A;  1YS7 A;  2VXZ A;  1HST A;  4X0G A;  2HDW A;  3BQY A;  4BAC A;  3H3U A;  4HX7 A;  4XON A;  2QKL B;  5C4J J;  1NHA A;  4NBQ A;  2IGN A;  2DMP A;  3BWG A;  5GAD J;  5EEA A;  2IS4 A;  3DF8 A;  2CQX A;  5GP9 A;  1BR1 A;  4XM3 A;  3ERM A;  1D3Y A;  1IXC A;  1ZGJ A;  3BLY A;  3ZMZ A;  3SFI A;  3P9C A;  2RNG A;  3LST A;  3OYC A;  5LGU A;  1YG2 A;  1P7I A;  2HPM A;  3N4M A;  2JPC A;  2OV7 A;  1SD5 A;  2EFN A;  2HS5 A;  1IZ1 A;  3HHG A;  2MBF A;  4I0A A;  3V8K A;  4AVZ A;  2UXN A;  2EK5 A;  3QP6 A;  1YX3 A;  3ESW B;  1B59 A;  3RYP A;  2VC0 A;  2OZ6 A;  1YYV A;  4KMU X;  2FA5 A;  1WSU A;  4Y3O A;  4GXO A;  4OWR B;  2WY8 Q;  9ANT A;  2R7X A;  1U5T B;  3KP7 A;  4ZYA A;  2VKH A;  3GX4 X;  2BY2 A;  2MAB A;  2DI3 A;  2PMZ N;  2DMT A;  2WB1 N;  2IXS A;  1SAN A;  2B9S A;  3KIO A;  3MKY B;  2R7F A;  2HFH A;  2ZCW A;  1YLF A;  3ABK H;  4PUS A;  2F6C A;  2HOE A;  3I59 B;  2PMU A;  3G1L A;  4KJZ A;  1Y0N A;  2MGQ A;  4G9Y A;  1AU7 A;  1X3Z B;  3RPU A;  1R7J A;  4A3K J;  3BG9 A;  2WAF A;  4F91 B;  4I76 A;  2LD5 A;  3I9V 2;  2A61 A;  1F36 A;  4XMY A;  5FKL A;  5HLG A;  2VBZ A;  2QM3 A;  1ZG1 A;  3GFL A;  3QPH A;  1ODD A;  2VLA A;  1R71 A;  1XX5 A;  1AHD P;  3CLQ A;  2ESH A;  1IDY A;  2Z16 A;  4BY1 J;  4NHJ A;  4PK4 A;  5E1Z B;  2DDA A;  4F93 B;  5JVT A;  3GW2 A;  5LGT A;  4RGR A;  2JPB A;  3GTQ J;  1MMN A;  4BU2 A;  2WAQ N;  3S2W A;  3IC7 A;  2N8G A;  5K7H A;  3JAM K;  3I5U A;  5J4Y A;  2GZW A;  3K4L A;  1VI0 A;  2YX4 A;  3LMM A;  3NAU A;  4Y4R A;  1PJR A;  1ZK8 A;  3W6J B;  2DOF A;  3I3L A;  5K5Q A;  3JRA A;  1LEB A;  4EJT A;  2H1K A;  2E1N A;  3PO2 J;  3RZD J;  2G7U A;  5B3S H;  1LNW A;  2VBY A;  2K85 A;  3CJT B;  1ONV A;  4PJL A;  1JHF A;  1V54 H;  1QVT A;  3S2D J;  1IXS B;  4Y17 A;  1SD4 A;  2FMY A;  2VJ5 A;  3TW6 A;  5IOY A;  4WXH A;  5E1W A;  3U1K A;  4CCJ A;  2LYC A;  2XF6 A;  3HEF A;  3SDB A;  2EZI A;  2L9V A;  1WJA A;  1U5T C;  3N97 A;  1K83 J;  2JA5 J;  3K69 A;  1T56 A;  1H0M A;  2LY9 A;  2R93 J;  4WK8 F;  1QVU A;  2V9P A;  3K70 D;  2L54 A;  3GFM A;  3WG9 A;  2ISZ A;  2OCC H;  3RIR A;  4OIN F;  4N9I A;  1R22 A;  2H09 A;  2OD5 A;  1IXR C;  4AM3 A;  4UY8 I;  1VQK I;  5FKN A;  1AA7 A;  2RC4 A;  3WOD F;  3DU5 A;  3IRQ A;  4IO9 F;  3OYF A;  4HST A;  3F3X A;  2NS8 A;  3CLO A;  3O8G A;  2L5Q A;  3PNY A;  4P55 A;  1HLV A;  1QO0 D;  3SQN A;  4HDU A;  1D0X A;  3ZQF A;  2VQG A;  2LSO A;  3OSF A;  1VQ9 I;  3DTK A;  3I0T A;  4CGZ A;  4LG0 B;  3ABU A;  3MZY A;  5B1B H;  1JKO C;  2XGX A;  3OOU A;  1LDK B;  1PUE E;  3QYE A;  2L4A A;  2RVC A;  2DAO A;  2DYS H;  2FQ4 A;  1HBX G;  3VSK A;  1SMT A;  4LLG F;  1XN7 A;  1XGM A;  2F4M B;  2BHY A;  3WTZ A;  4EAT A;  2ZNY A;  2EH3 A;  4OIP F;  3CUO A;  2HXO A;  4NDL A;  1TW2 A;  2AHQ A;  4JX5 A;  5HOO A;  1OYI A;  3FBN B;  2EIL H;  3OV8 A;  1PP7 U;  3M1C A;  2LKX A;  2E2H J;  3DPU A;  4OAZ A;  1MSE C;  2KDO A;  1X1P A;  5F04 A;  1TBX A;  2XAQ A;  1U3E M;  4ZDP A;  3F8F A;  3K2Z A;  4CZC A;  1O57 A;  3LFU A;  5DTD A;  1QZY A;  1SFK A;  3JRI A;  3QOE A;  3OMY A;  4ZYE A;  3BZ6 A;  4BJ6 C;  4EM0 B;  3S1M J;  2BZT A;  3K1M A;  1ZHF A;  4M9Z A;  5FFX A;  2E35 A;  3CCJ I;  4D5F A;  1AKH B;  3J7A Y;  3IWF A;  2R7W A;  3CQZ J;  5J3L A;  3FXU A;  3H9J A;  4XN0 A;  1RRJ A;  4H4K C;  5H2F C;  4M3G A;  3VYR B;  4F3Q A;  1CF7 A;  2DK8 A;  2LKP A;  1XPX A;  5M5X J;  3LAP A;  3VWB A;  2A07 F;  2EFW A;  2PN6 A;  2ID6 A;  3G3Z A;  3HXL A;  1J9I A;  1XMK A;  3BR0 A;  5EJC A;  3SEZ A;  1QPI A;  5CVR A;  3LNQ A;  1YRN A;  1QGP A;  2R4G A;  1DU6 A;  2CUZ A;  2LY1 A;  1X58 A;  3TDZ C;  1WZ2 A;  4MHG A;  4Y13 A;  3FXJ A;  2L2O A;  2LVS A;  4A2U A;  3CUQ A;  1TWF J;  5IY5 H;  3MKL A;  1T0F C;  1WWX A;  3LA3 A;  3KET A;  4G94 A;  1OMI A;  3ZQI A;  1OQY A;  3S14 J;  3ZCO A;  4QPQ A;  4KA4 A;  2R7D A;  3ZMD A;  1W1W E;  1U78 A;  2XPV A;  2EIK H;  5L3G A;  3REO A;  4HV5 A;  5CVI A;  3F9K A;  1A35 A;  4LLN A;  2M2E A;  1D1B A;  2KFD A;  3HPG A;  3KX2 A;  2RN7 A;  3BJO A;  5KHD A;  4M72 A;  4B1R A;  1JI8 A;  2PX9 A;  5HDG A;  1J59 A;  4OIO F;  2DT5 A;  2M8E A;  2ME0 A;  3S8P A;  1MNE A;  3IUO A;  4FX0 A;  4BNC A;  4ENM A;  2BHZ A;  1IAW A;  3ERE D;  3IRR A;  2R5Z A;  5BOX A;  1ZG3 A;  1B1B A;  1MMA A;  3S32 A;  1DU0 A;  1VQP I;  1QA6 A;  2DTR A;  4KYW A;  2L01 A;  3MN2 A;  4CUG A;  3JRB A;  1G3S A;  3IWZ A;  1EA3 A;  2LRD A;  4M74 A;  4Z6Y A;  1Y1V J;  4IOC F;  2CRG A;  3CDL A;  4LLL A;  1YI2 I;  1ENH A;  3C3W A;  3WGG A;  3TBI A;  1H89 C;  1X4O A;  4XBF A;  2CWE A;  4JBA A;  4RAF A;  3GYH X;  3F21 A;  3HC7 A;  4Q5S F;  2FNA A;  2LF7 A;  3IKT A;  2DO7 A;  1TWA J;  3PQJ A;  2DA3 A;  2DDB A;  4DYC A;  1HC8 A;  3FKJ A;  3GVA A;  4LG3 A;  4PFP A;  3FM5 A;  2M45 A;  3NAR A;  3EDP A;  2Y0S N;  4JX4 A;  1H9T A;  4S0H B;  3Q0W A;  3F72 A;  3BG6 A;  4Q47 A;  3CMM A;  2DXI A;  1QZE A;  4HOB A;  4DYR A;  2V1N A;  4S05 A;  4FTH A;  4HF1 A;  1KU2 A;  2DQR A;  1R5H A;  3K6G A;  2XPW A;  2ZXH A;  1YJW I;  2R7V A;  2HZT A;  4X6A J;  2LF8 A;  4IJA A;  1RKW A;  3KZY A;  3J81 K;  1JGG A;  3OIQ A;  2KPM A;  1IRG A;  2QLZ A;  3TMO A;  3CO7 C;  1X2M A;  4IHS A;  1FEX A;  4FQG A;  3EET A;  1IF1 A;  1FOK A;  2HKO A;  1ETV A;  2XIG A;  4QIW N;  5L3F A;  2MH9 A;  4RAG A; 
#chains in the Genus database with same CATH homology
 4R1H A;  1IN6 A;  2V6C A;  2OAZ A;  3ROU A;  5DD8 A;  4QLC U;  1IN4 A;  3QPT A;  1BM9 A;  3HRT A;  3NQO A;  5ILU A;  2EFP A;  2CO5 A;  3JSO A;  3Q5F A;  2RV8 A;  4KNY A;  4O3M A;  5ICG A;  3KP5 A;  4U0W A;  1MD0 A;  4B8X A;  2HR3 A;  1Z6T A;  3HTU A;  1B9N A;  4L9J A;  4YG2 F;  4BXU A;  1W7P D;  1W7P A;  3H3Z A;  3CO6 C;  2OBP A;  1BIA A;  3HTS B;  1K7A A;  2HWV A;  3C7J A;  3MCZ A;  2XAF A;  1WKM A;  3SFZ A;  1HSJ A;  3ZN1 A;  4L0Z B;  2HKX A;  1UHW A;  1UCR A;  1Z1D A;  4ZYH A;  4EJO A;  1R1T A;  1A04 A;  4L0Y B;  3IHU A;  2KIF A;  1I27 A;  2E1C A;  2O03 A;  4CO8 A;  1XCB A;  4RB0 A;  1KQ0 A;  4U7D A;  1ZYR F;  4EMS A;  2JZY A;  4EJW A;  4G8X A;  1Z9C A;  3KP4 A;  1YW7 A;  1QPM A;  1R58 A;  3T5X A;  2Z5U A;  2GWR A;  3FM3 A;  4R8H A;  3K1N A;  3WGI A;  5F64 A;  2EA4 A;  5AON A;  2K7L A;  1CF7 B;  1MGT A;  3P9I A;  3TQN A;  1D8K A;  4LK0 F;  5CJ9 A;  3SZT A;  2VOP A;  3TDU C;  2RGV A;  3BJ6 A;  2E7X A;  4KFC A;  4YFK F;  4PGH A;  1S29 A;  3RYR A;  3TGN A;  1D8J A;  3P9K A;  3LQQ A;  1MJ9 A;  1USS A;  3F8N A;  3CUQ B;  2QBY A;  1YFH A;  3F22 A;  2D1H A;  5ILV A;  1ZRC A;  3FMS A;  3RDI A;  2F5C A;  4KN7 X;  1S7O A;  4KUM A;  3K0L A;  5DV5 A;  3E5X A;  1PP8 F;  1FYK A;  2O0Y A;  2M5W A;  4EGZ A;  4PCQ A;  3WE2 A;  4WX9 A;  4MNU A;  5ICF A;  1OR7 A;  4LJZ F;  2C6Y A;  2P8T A;  4HYE A;  4HX8 A;  1G3T A;  1FBS A;  1J7K A;  1XD7 A;  4RGS A;  1H9G A;  3GF2 A;  2CGP A;  4PDK A;  2PJP A;  4U0Y A;  3GEZ A;  3QP5 A;  4DQ2 A;  3CUQ C;  3WGH A;  1FY7 A;  5BPD A;  3HSE A;  3GFJ A;  3ECH A;  5BPI A;  3LA2 A;  1MKM A;  2ELH A;  3L09 A;  2FEZ A;  4KDP A;  1XMA A;  1V4R A;  1XDU A;  3L2C A;  1JXS A;  4A6E A;  3F6O A;  2HTS A;  2YSR A;  2UXX A;  5J6X A;  2KRF A;  3JTH A;  2MD5 A;  2HQR A;  4IRG A;  1W4M A;  3FXQ A;  2P4W A;  4UXN A;  2P5K A;  3DP7 A;  4CHU A;  3J80 Z;  4OIQ F;  4NB5 A;  4HF0 A;  1DP7 P;  5IT9 Z;  4S04 A;  1LDJ A;  1XGN A;  2M30 A;  3KFW X;  5LHI A;  1BN5 A;  2VE9 A;  4IRH A;  3R0J A;  2BE5 F;  3LQR A;  3R0A A;  1FPQ A;  2KJB A;  3TOA A;  2O6G E;  3ZMT A;  1S8N A;  4N9H A;  4IVN A;  5D8K B;  1FZP B;  3TO9 A;  3M7G A;  4I2O A;  2JSC A;  1DPU A;  1HKQ A;  2DLL A;  5E1X A;  1W7P B;  5JFR A;  5CVU A;  5FLX Z;  5LHH A;  3SXY A;  4FX4 A;  2IVM A;  4RAZ A;  1K78 A;  1TW3 A;  4E70 A;  2HEO A;  2F2E A;  3LAJ A;  1F9N A;  1ZH5 A;  5DCM A;  4ZZD A;  4XSZ F;  1ZAR A;  2MLG A;  4GGG A;  4U7B A;  2ZNZ A;  3W6K B;  2F5F A;  2BV6 A;  3DEU A;  3C1D A;  3RKY A;  2W25 A;  2ACJ A;  4KT5 C;  3HOS A;  4HDV A;  2GA1 A;  3R4K A;  4KIF A;  2NNY A;  3FF5 A;  1KYZ A;  1P4X A;  2IPQ X;  1QQI A;  4UVA A;  4IHT A;  2Z9O A;  2FBI A;  1ON1 A;  5L3C A;  3BPV A;  4M71 A;  1UST A;  5HS8 A;  4DNC A;  2ZO4 A;  1KU7 A;  4P96 A;  1AOY A;  1UFM A;  4WXC A;  4KMF A;  4U88 A;  1ZLJ A;  2H6B A;  1R23 A;  2IW5 A;  2V1U A;  2FF4 A;  4EM2 A;  5ED4 A;  3WTW C;  3CDH A;  3F8B A;  2QBY B;  2GXG A;  1T6S A;  2NNN A;  4B09 A;  3WE3 A;  3GXO A;  1REP C;  5CVV A;  4HW0 A;  3U9G A;  3DQV C;  6PAX A;  4UNO A;  5AIQ A;  3O3K A;  1FLI A;  3VOE A;  3PFI A;  5H6R A;  4A0X A;  3RTR A;  2D1V A;  3WTX C;  5JI6 A;  4LMY A;  1F1Z A;  4WXD A;  3DPL C;  3BRO A;  3R60 A;  1E17 A;  1DUX C;  1I1G A;  1V3F A;  1BIB A;  4IF4 A;  2A6H F;  1Z7U A;  2AS5 F;  2V1D A;  1U8R A;  1T2K A;  2PFB A;  3B73 A;  3KP3 A;  4LD5 A;  4I09 A;  1F4K A;  3HIF A;  3FMR A;  3V8J A;  4LK1 F;  3IKV A;  2UZK A;  5HVQ C;  5FB2 A;  4IRI A;  2LNB A;  4BHP A;  2IA0 A;  3HHH A;  3KP6 A;  2ZJ2 A;  5LBQ A;  3VOD A;  2IA2 A;  3LWF A;  1ZRD A;  2XV4 S;  5HS9 A;  4YII A;  1BI0 A;  5LLQ A;  5E8G A;  3VB2 A;  3FXR A;  4IPA A;  2FQ3 A;  3RPQ A;  4Z2Y A;  1FYL A;  4CYD A;  4I98 B;  2Y0M A;  1XDS A;  5DCF A;  3GZ6 A;  1T98 A;  1OKR A;  3E6D A;  4OMY A;  2PG4 A;  2Z99 A;  1WI9 A;  2QEN A;  2HYF A;  1FT9 A;  4HAM A;  5A2Q K;  1X3U A;  2RQP A;  1OYW A;  1I1S A;  1SD7 A;  3DV8 A;  2XHK A;  1LVA A;  4M9X A;  2JRT A;  2NS0 A;  3HSF A;  2CW0 F;  2A68 F;  1K78 B;  5IT3 A;  2KJC A;  4P9U A;  3KEQ A;  5L3E A;  5E18 F;  1OPC A;  1YIO A;  2QQ9 A;  3EYI A;  2E7W A;  5DCM B;  3IL2 A;  1IN8 A;  5FD6 A;  3TKY A;  5HLH A;  1R00 A;  1B4A A;  5FD5 A;  4FHT A;  4HA8 A;  4L9V A;  2GA2 A;  1QZZ A;  5D6F A;  4UVB A;  1KGS A;  3T1B A;  2FRH A;  3TO7 A;  3JAM Z;  4JQF A;  2K02 A;  1TQP A;  3R61 A;  2Y75 A;  2W24 A;  3QU6 A;  3MAJ A;  4G7O F;  1OYY A;  5D6E A;  3ISP A;  2L02 A;  3CTA A;  1XSV A;  4NQW A;  2GQQ A;  2ETH A;  4G7H F;  4LFU A;  1P6R A;  4K2E A;  1Q1H A;  3EYY A;  4UV8 A;  3PQK A;  4FT8 A;  2EFO A;  4G6Q A;  2ADU A;  2J5P A;  2X4H A;  2BGC A;  3JW4 A;  2X0L A;  4HX4 A;  4L5I A;  2XRO A;  1Z05 A;  2W57 A;  2VBW A;  2H6C A;  2XAJ A;  3F8M A;  3KLO A;  2P6T A;  4XSX F;  2G9W A;  4M6Y A;  5H20 A;  3ZP5 A;  3T8T A;  2XAS A;  2Q0O A;  2XAH A;  3MQ0 A;  4OOI A;  5DUI A;  1G3W A;  2W84 A;  3RI4 A;  1P4W A;  2K27 A;  1HKS A;  2DPD A;  4PGG A;  1R1U A;  1BC8 C;  5HDN A;  4KIG A;  2CYY A;  3OOP A;  4ENN A;  2KIM A;  3GUD A;  3U2R A;  3TO6 A;  2VOO A;  3M1E A;  1FSE A;  3KP2 A;  1KU3 A;  2STT A;  3E5Q A;  4JK1 X;  1FWZ A;  2XUB A;  4MQ9 F;  3DKW A;  4G7Z F;  1XSD A;  1TTY A;  2MH2 A;  5LGN A;  5E20 A;  1S7A A;  1P92 A;  5L3D A;  4R79 A;  2NAZ A;  4Q4Z F;  1O3Q A;  5D5V B;  2VT2 A;  1ZGA A;  3ZMS A;  2BEO A;  5HS7 A;  2OA4 A;  1KU9 A;  4ZH4 F;  1XSX A;  4M9S A;  4ENJ A;  3TOB A;  3HRM A;  2FXA A;  2KIU A;  2K4B A;  2XKP A;  1BI1 A;  4PZJ A;  1YW8 A;  1AWC A;  4YFX F;  4ASN A;  1FBQ A;  1UB9 A;  2HDC A;  4M73 A;  5BQT A;  2GIV A;  4RGX A;  2XRN A;  1MDM A;  2CSO A;  1ON2 A;  4ESB A;  5CYV A;  4ENK A;  3BY6 A;  1LB2 A;  2BYV E;  1S3J A;  1MJA A;  1BBY A;  3QU3 A;  4UVC A;  2RDP A;  4UHT A;  2PQ8 A;  3HUG A;  1YTY A;  2YR2 A;  4RGU A;  3VEP A;  5TJJ A;  4AIJ A;  2DW4 A;  5FO5 A;  1ZN2 A;  5F1R A;  2L3D A;  3NRV A;  5LHG A;  2WC2 A;  1RZ4 A;  3L9F A;  2QVO A;  1P4A A;  3C18 A;  1IRF A;  3QRF F;  1JHH A;  1U2W A;  2CQK A;  2VN2 A;  3GWZ A;  4HV6 A;  2NYX A;  4HZF A;  2HQN A;  1XGO A;  3J7A O;  5E17 F;  3VFZ A;  4RB1 A;  3JSP A;  1J0R A;  1U6G A;  4WF2 A;  1BI2 A;  1TNT A;  2P6S A;  2WV0 A;  4HLY A;  2QUF A;  3J81 Z;  2EV6 A;  2YX7 A;  3FWE A;  1GVJ A;  4MEY F;  1WQ2 A;  1G3Y A;  4BHB A;  1XCV A;  3V7S A;  1HW5 A;  3ABT A;  4BH9 A;  3F8C A;  4EQQ A;  1I6X A;  1Z91 A;  3P7N A;  1QBJ A;  2J5O A;  5EEH A;  2HYG D;  3GLX A;  2XKO A;  3I58 A;  2IP2 A;  2AXL A;  1E2X A;  1J5Y A;  5BS6 A;  4LGW A;  1MZB A;  3KZZ A;  4L5J A;  4YIF A;  4A0Z A;  3EQL F;  1KQ8 A;  3D5L A;  4MTE A;  3Q9V A;  3GO5 A;  5ICE A;  2P7V B;  2DU9 A;  2FOK A;  4EJV A;  1ZRF A;  1SFU A;  1HW2 A;  5K1Y A;  1ZRE A;  2F5E A;  4WCG A;  2P7C B;  2EV5 A;  2ESN A;  1PDN C;  2V1X A;  1O3R A;  3WTT C;  5K5R A;  5J8F A;  4OIR F;  3M8F A;  3AAF A;  2K4J A;  5H6Q A;  1SD6 A;  2LDU A;  3H92 A;  4RAY A;  2IA1 A;  3SHF A;  5CVJ A;  3DFG A;  1VTN C;  3E97 A;  1FX7 A;  3LA7 A;  5KVR A;  3BP8 A;  3NEU A;  3MZH A;  1GHC A;  3KLN A;  4EM1 A;  1HKT A;  1K6O A;  3Q9S A;  5DDG A;  4O6J A;  1ULY A;  3WTV C;  3L00 A;  4N0B A;  1R5G A;  5BMZ A;  1T39 A;  2FSW A;  2EA2 A;  4LB5 A;  2WWY A;  4HF2 A;  1ZLK A;  5LEK A;  1IN5 A;  2EB7 A;  3O2P E;  3RJP A;  3T0Y A;  1Z6R A;  1FP2 A;  4HQE A;  1R1V A;  3G73 A;  2QZ8 A;  2VT3 A;  4KIB A;  1JGS A;  3KEO A;  3ULQ B;  4ZZL A;  1D5V A;  1MJB A;  4HLX A;  1STZ A;  5EEG A;  3V4G A;  1KQ9 A;  1FC3 A;  2QQB A;  5D5U B;  4BAY A;  2M87 A;  1KA8 A;  2Q2E A;  4F7Z A;  5K5O A;  2YPR A;  4KIC A;  3M9A A;  3DXJ F;  1MDM B;  1UHM A;  2IT0 A;  2CFX A;  1I5Z A;  2IJL A;  4O5V A;  1CGP A;  3ZPL A;  4ESJ A;  2VOD A;  3LFK A;  2MA3 A;  1HW1 A;  1QNT A;  1WRJ A;  3HYI A;  2EJR A;  3I71 A;  3DPT A;  5HLI A;  2OQG A;  2Y48 A;  1RUN A;  5DEQ A;  2DBB A;  4QWQ A;  4ETS A;  3CJN A;  1YQA A;  3MWM A;  1IUY A;  2D45 A;  5AIP A;  4AIK A;  2R3S A;  2H27 A;  1L0O C;  1K79 A;  5D8L B;  3WTY C;  3M8E A;  4CIC A;  4L9N A;  4U0V A;  4TV7 A;  1FBU A;  4Q48 A;  3F23 A;  2KKO A;  2STW A;  5FGM A;  4Y15 A;  2WTE A;  2DFI A;  4UV9 A;  5FFZ A;  1BOA A;  3FHZ A;  2O61 A;  3EUH A;  2K86 A;  4HQM A;  5D5X B;  2OZU A;  2GAU A;  5D4S A;  2V9V A;  2PLY A;  1L3L A;  1B9M A;  3BJA A;  1IN7 A;  3WU1 B;  4CDG A;  2EWN A;  5ERI A;  1SFE A;  4AVP A;  2FE3 A;  4IXA A;  4I02 A;  3E5U A;  3BPX A;  3FZV A;  1BI3 A;  4I0B A;  4H0E A;  4UUV A;  2A69 F;  2ZME A;  2NRA C;  2P5V A;  5J8C A;  1O3T A;  2O3F A;  1SMY F;  2M1B A;  5TRD A;  4ON0 A;  2ZFW A;  3V7R A;  2B0L A;  3WTS C;  3RKW A;  4EV0 A;  4KN4 X;  2D2W A;  2PI0 A;  4CZZ A;  3BOQ A;  2Z33 A;  3ML6 A;  4I01 A;  1O7F A;  4OMZ A;  3HRU A;  1RUO A;  2TDX A;  4P5O A;  2MC3 A;  2O8X A;  4ZYG A;  2FNP A;  3GZ5 A;  3WTU C;  3FMQ A;  4HBL A;  5LRS A;  3J80 K;  5IT9 K;  4GYG A;  5HDK A;  1BJA A;  1YW9 A;  2PEX A;  4P9F A;  2JT1 A;  4ZYD A;  3V7C A;  3E6M A;  4M6X A;  1DDN A;  1TQM A;  3L7W A;  4RB2 C;  5D5W B;  4L9T A;  2ZXJ A;  3I4P A;  2HGC A;  2HTJ A;  5ICC A;  1Y0U A;  2PMH A;  3T8R A;  1IW7 F;  1U5T A;  1F5T A;  4XLN F;  3ZMU A;  3WU0 A;  2JTV A;  3HSR A;  3KCC A;  4EVI A;  4BYY A;  1FSH A;  4XLP F;  5FLX K;  3QOP A;  1LDD A;  4GO1 A;  3I59 A;  4EJU A;  4A5M A;  1W5T A;  4BQA A;  4A5N A;  1P2F A;  1GXQ A;  2GXB A;  3K1P A;  4I7H A;  1C0W A;  1ZG5 A;  3E6C C;  5DYM A;  1EH7 A;  1YS6 A;  1FP1 D;  2FBH A;  3ELK A;  4EGY A;  2FML A;  1GXP A;  2A6E F;  1O7L A;  3HOT A;  2MLK A;  3I53 A;  1LEA A;  3ZQ7 A;  1JE8 A;  2A5Y B;  3I54 A;  4LB6 B;  5D4R A;  1RIO H;  3U1D A;  4MGR A;  2G7H A;  3GFI A;  2ISY A;  2Z3Y A;  1XB4 A;  2L4M A;  2ZKZ A;  5DUK A;  4OU0 A;  2V79 A;  3ZMV A;  3SZP A;  5KK1 A;  2QQA A;  3FX3 A;  2PBI A;  1XGS A;  2RKH A;  1EH6 A;  2DPU A;  3HRS A;  1HQC A;  2ZBK A;  5LRR A;  2COM A;  3K9T A;  4MEX F;  4L18 B;  5ILS A;  2QWW A;  2P5L C;  1RI7 A;  2OU2 A;  1SAX A;  4AIH A;  1YO5 C;  2VE8 A;  5DD4 A;  4GYI A;  2A3S A;  2XVC A;  5JR3 A;  1BC7 C;  2BBY A;  4XRF A;  1G6N A;  4A6D A;  3F6V A;  2VON A;  1EV7 A;  3V8L A;  1TNS A;  4YFN F;  5L3B A;  4LG0 A;  4G6D A;  2FBK A;  3QAH A;  2EV0 A;  2F5D A;  1J75 A;  1T0F A;  3E3V A;  3D0S A;  2VC1 A;  1FYM A;  4CXF A;  4D0P A;  2QYO A;  1SFX A;  2H94 A;  3MFK A;  1TQI A;  5CLS A;  1B6A A;  1ZAO A;  5LEJ A;  3ECO A;  5E8I A;  4A12 A;  3I64 A;  5A2Q Z;  1RNL A;  4RS8 A;  3KE2 A;  4WWC A;  3MEX A;  1S6L A;  1HXD A;  1FNN A;  2ZME B;  2XAG A;  2OQR A;  1W5S A;  4BHC A;  3RKX A;  4MTD A;  4RB3 C;  4ESF A;  2DQL A;  2UWM A;  1DPR A;  1EH8 A;  3E6B A;  2IRF G;  2Q8K A;  4MQV A;  3BDD A;  5JHU A;  2VBX A;  3JTG A;  4A0Y A;  1LJ9 A;  2YU3 A;  3R6S A;  3O6B B;  1R36 A;  4AWX B;  1TLH B;  1KYW A;  2CG4 A;  2FU4 A;  2EFQ A;  2RNJ A;  3COA C;  1T38 A;  2W85 A;  1LQ1 A;  2DK5 A;  3ZN0 A;  1O3S A;  4AD9 A;  5F6F A;  1G4D A;  4GCV A;  3B02 A;  1J2X A;  1YS7 A;  2VXZ A;  1HST A;  3H3U A;  4HX7 A;  1NHA A;  3BWG A;  3DF8 A;  1D3Y A;  1IXC A;  1ZGJ A;  3ZMZ A;  3P9C A;  3LST A;  5LGU A;  1YG2 A;  3N4M A;  2JPC A;  1SD5 A;  2EFN A;  2HS5 A;  1IZ1 A;  3HHG A;  2MBF A;  4I0A A;  3V8K A;  2UXN A;  2EK5 A;  3QP6 A;  1B59 A;  3RYP A;  2VC0 A;  2OZ6 A;  1YYV A;  4KMU X;  2FA5 A;  1WSU A;  4GXO A;  1U5T B;  3KP7 A;  3GX4 X;  2DI3 A;  2R7F A;  2HFH A;  2ZCW A;  1YLF A;  2HOE A;  3I59 B;  2PMU A;  4G9Y A;  3RPU A;  1R7J A;  2A61 A;  5HLG A;  2VBZ A;  2QM3 A;  1ZG1 A;  3GFL A;  3QPH A;  1ODD A;  2ESH A;  4NHJ A;  5E1Z B;  5JVT A;  3GW2 A;  5LGT A;  4RGR A;  2JPB A;  3S2W A;  3IC7 A;  3JAM K;  3I5U A;  2GZW A;  3W6J B;  2YX4 A;  5K5Q A;  1LEB A;  4EJT A;  2E1N A;  2G7U A;  1LNW A;  2VBY A;  1ONV A;  1JHF A;  1IXS B;  4Y17 A;  1SD4 A;  2FMY A;  4WXH A;  5E1W A;  1U5T C;  3N97 A;  3K69 A;  1H0M A;  4WK8 F;  2L54 A;  3GFM A;  3WG9 A;  2ISZ A;  3RIR A;  4OIN F;  4N9I A;  1R22 A;  2H09 A;  2OD5 A;  1IXR C;  2RC4 A;  3WOD F;  3IRQ A;  3F3X A;  3CLO A;  4P55 A;  1QO0 D;  3SQN A;  4HDU A;  2LSO A;  3I0T A;  4CGZ A;  4LG0 B;  3ABU A;  3MZY A;  2XGX A;  1LDK B;  1PUE E;  2L4A A;  2RVC A;  2DAO A;  1HBX G;  1SMT A;  4LLG F;  1XN7 A;  1XGM A;  3WTZ A;  2ZNY A;  4OIP F;  3CUO A;  1TW2 A;  5HOO A;  1OYI A;  3OV8 A;  1PP7 U;  1U3E M;  1TBX A;  2XAQ A;  3F8F A;  3K2Z A;  1O57 A;  1QZY A;  4ZYE A;  3BZ6 A;  4EM0 B;  3K1M A;  1ZHF A;  4M9Z A;  5FFX A;  3IWF A;  3FXU A;  1CF7 A;  2DK8 A;  2LKP A;  3LAP A;  2A07 F;  2EFW A;  2PN6 A;  3G3Z A;  1J9I A;  1XMK A;  5CVR A;  1QGP A;  3TDZ C;  4MHG A;  4Y13 A;  4A2U A;  3CUQ A;  1WWX A;  3LA3 A;  3KET A;  4G94 A;  1OMI A;  4KA4 A;  2R7D A;  3ZMD A;  1U78 A;  5L3G A;  3REO A;  4HV5 A;  5CVI A;  4LLN A;  2RN7 A;  3BJO A;  4M72 A;  5HDG A;  1J59 A;  4OIO F;  2DT5 A;  2M8E A;  4FX0 A;  4BNC A;  4ENM A;  1IAW A;  3ERE D;  3IRR A;  5BOX A;  1ZG3 A;  1B1B A;  4KYW A;  2DTR A;  2L01 A;  1G3S A;  3IWZ A;  4M74 A;  4LLL A;  3C3W A;  3WGG A;  4XBF A;  2CWE A;  4JBA A;  3GYH X;  3F21 A;  4Q5S F;  2FNA A;  2LF7 A;  3IKT A;  2DO7 A;  3PQJ A;  3GVA A;  3FM5 A;  2M45 A;  3EDP A;  1H9T A;  3F72 A;  4Q47 A;  4HOB A;  4S05 A;  4HF1 A;  1KU2 A;  2DQR A;  1R5H A;  2HZT A;  2LF8 A;  4IJA A;  3KZY A;  3J81 K;  1IRG A;  2QLZ A;  3CO7 C;  4IHS A;  3EET A;  1IF1 A;  1FOK A;  2HKO A;  2XIG A;  5L3F A;  2MH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...