1S7AA

Nmr structure of the la motif of human la protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein, translation
molecule keywords Lupus La protein
total genus 18
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s7aA00
2WC2A 3PQJA 3B73A 4IVNA 1R1UA 4KFCA 2MBFA 2V9VA 1T98A 5LGUA 2K86A 4G9YA 4EJTA 3DV8A 3TKYA 2MA3A 1WSUA 4NQWA 1XDUA 2PLYA 4CZZA 2ZXJA 5ED4A 3ML6A 2EJRA 2L4AA 4IXAA 3GFMA 5FLXK 1P6RA 2IRFG 2QENA 3E6DA 1JXSA 2Z5UA 3LFKA 2PMHA 5CJ9A 3VOEA 1R36A 4PZJA 4F7ZA 3CUQB 2MH2A 3QP5A 1O3SA 3HHHA 4LK1F 1Z05A 4O6JA 5BQTA 4UVAA 1IRGA 3IKTA 1XD7A 1FT9A 2R3SA 2HZTA 4OINF 1K78B 5ERIA 2FNPA 2VC0A 2JRTA 2EA2A 1P92A 4HX8A 4ESBA 2W25A 1XSXA 1YFHA 3I4PA 4I01A 5AIPA 2HDCA 2G9WA 2PQ8A 3KP5A 3PQKA 3TOBA 1J7KA 1OR7A 1XMAA 1KYZA 1ZRDA 3SFZA 1R1TA 4M72A 2FOKA 2VODA 4L18B 5FD5A 4L9TA 2Y48A 2M87A 2ZCWA 3KZZA 4P55A 4GXOA 2EFWA 2KKOA 4IHTA 1LEAA 1GVJA 2EK5A 1LDJA 2P7VB 1TQMA 3WODF 1YW9A 4MGRA 2P5LC 4GCVA 4QWQA 5E1XA 2QQAA 5DCFA 1IAWA 3K2ZA 4JQFA 5H6QA 1S29A 1SFUA 3FF5A 1W7PD 2O61A 4RS8A 3ERED 3TQNA 2ELHA 1JHHA 3HHGA 5KVRA 5D5XB 3W6KB 4B8XA 5L3FA 4EGZA 2E1CA 1T6SA 1O7FA 4A0XA 1X3UA 2BYVE 5D5UB 2CSOA 2RVCA 2V1UA 1UHMA 2F2EA 1O3RA 3WGGA 2AXLA 1F4KA 3RPUA 2HS5A 2DO7A 4AD9A 1K79A 2E1NA 4HX4A 4P9FA 4HZFA 1U78A 3RI4A 3GLXA 2WV0A 2IPQX 5HLGA 5E1WA 1LEBA 2HQRA 2GA2A 3LSTA 2D1HA 1IZ1A 3IC7A 5DUKA 3FMSA 5DDGA 1WI9A 3DP7A 3NEUA 5L3CA 1XGOA 3J80Z 4DNCA 1KU7A 2F5EA 3ZMUA 1Z91A 4PGGA 3RKXA 1Z6TA 5HOOA 2FBKA 4M9XA 3MQ0A 5K5RA 2O0YA 2W85A 4HF0A 4NB5A 4U7DA 1RZ4A 2LDUA 1W7PB 3I71A 4EMSA 1O7LA 4ASNA 4BHCA 1OPCA 3JTHA 1IN6A 1ZREA 5BPDA 4GYGA 1ZRCA 4E70A 2FA5A 4G7OF 5BOXA 2A68F 2XVCA 3J7AO 3VFZA 1LJ9A 4I0AA 1OYYA 4WWCA 2W84A 2JTVA 5LRRA 2XGXA 4BHPA 2UXNA 3ABTA 3CO7C 3BJOA 1ZAOA 4KIFA 3FM5A 1VTNC 2XASA 1JGSA 3BPVA 1E17A 2XRNA 2Z99A 1KA8A 3R6SA 3DXJF 1REPC 1YS7A 2VBZA 2ZNYA 3O3KA 2DQLA 1B59A 1CF7A 2PG4A 1YTYA 1IXSB 1KQ8A 3DF8A 1ON2A 5IT3A 4Q5SF 3GZ6A 1NHAA 1R58A 1XB4A 3ELKA 2A6EF 1WRJA 4EVIA 3J80K 2HKXA 5A2QZ 1USSA 4LJZF 3IWFA 1OYIA 4P5OA 1I1SA 1FX7A 4QLCU 2IA0A 1S6LA 2JPCA 1TW3A 2FE3A 1FSHA 1R5HA 1TLHB 2ZFWA 3P9KA 1B6AA 1L3LA 1S8NA 1HKSA 3M1EA 3EQLF 5FD6A 3GFLA 3GX4X 1KYWA 4KIBA 2KJBA 2XV4S 2ISZA 1MZBA 1C0WA 4M73A 5FO5A 2KIMA 3O6BB 1WWXA 4O5VA 2YX7A 5F64A 3K1PA 4KA4A 3F8FA 2DBBA 3QU3A 2Q2EA 4RB0A 1EH6A 2BEOA 2DAOA 2FBIA 4L9JA 1I5ZA 3RKYA 1J5YA 4I7HA 3QPHA 3GO5A 2DLLA 3NRVA 1LQ1A 3FWEA 4EM2A 5JI6A 5L3EA 2IP2A 4HLXA 1FC3A 3RYRA 4MHGA 2M1BA 4M71A 2O3FA 3ZN1A 3DPLC 1J75A 3MZYA 2H94A 5CYVA 5LBQA 3ZMSA 3C18A 4LMYA 4B09A 4XBFA 5D8KB 1ULYA 4IPAA 2DQRA 3CUOA 4RB3C 3P9IA 3SZTA 4A5MA 1XSDA 3HSRA 1MKMA 5DEQA 3GFJA 2CFXA 4WK8F 5D6FA 1W5SA 1P4XA 4WF2A 3I5UA 1LDDA 3ZPLA 1U2WA 4IHSA 4FX4A 2GXGA 3I53A 1IW7F 1FPQA 3EETA 1SFXA 1ZG5A 3ZMDA 4BH9A 2DK5A 4ENNA 2F5CA 4I0BA 5LHHA 3R60A 3K1NA 2C6YA 1FYMA 1ZRFA 3QOPA 2UZKA 2O03A 5LGTA 2M45A 5JR3A 3TGNA 2KJCA 4UVCA 1HW5A 1R23A 1QO0D 2FMYA 5L3BA 4UNOA 1D8KA 2G7UA 1FP2A 3G3ZA 3ZMVA 1XSVA 1JE8A 3F8MA 1MD0A 2A3SA 2GWRA 3V7RA 3ABUA 5J8CA 4AVPA 3GFIA 2VXZA 3R4KA 1XDSA 3WTZA 2IVMA 4HDUA 1I27A 2DT5A 5TJJA 1BIAA 2EFQA 3LAPA 4HDVA 1K6OA 3IWZA 1E2XA 3RDIA 2J5OA 2UXXA 2LNBA 4ZYDA 5HS9A 2ZBKA 4K2EA 3TDZC 3ECHA 1ZH5A 4JBAA 3BJAA 2V1DA 1FY7A 1HXDA 1TTYA 4OIRF 4CICA 1TNSA 2PBIA 4LD5A 2HR3A 1BI0A 3CUQC 1J9IA 2GZWA 3ZP5A 5JFRA 3IKVA 3F22A 2XHKA 2JT1A 1SAXA 4UV9A 5E17F 3V8JA 4L5IA 3MEXA 2OQRA 1V4RA 3KFWX 2DI3A 2DTRA 3T1BA 3EYIA 2GQQA 2OU2A 4U7BA 2FSWA 2K4JA 2VN2A 4HW0A 1LB2A 1HKQA 2BGCA 1YW8A 4BYYA 1B1BA 3TOAA 4ENJA 2QQ9A 1MJBA 1PP7U 3K0LA 1U5TB 2ESHA 1ZG3A 1FOKA 3KP7A 3T8TA 3JW4A 4N9HA 1SMYF 2K02A 1SD5A 5J6XA 1D8JA 1UB9A 1FYLA 2RDPA 3I59A 5BMZA 3DFGA 2EA4A 1Z6RA 4XRFA 5FB2A 2P7CB 4MQ9F 4UV8A 2X4HA 4OIPF 4RGRA 4GO1A 2PMUA 3WTSC 4ZZLA 1D3YA 2A5YB 4A0ZA 4BNCA 2MLGA 1ON1A 1TQPA 1IN8A 2ZMEB 3WTYC 3BZ6A 3RTRA 4KICA 1F1ZA 1GXQA 4WXCA 4CDGA 2HOEA 2KIFA 1IN5A 5JVTA 4MEXF 1IXRC 1G3WA 1P2FA 2QQBA 5DCMA 5JHUA 1T0FA 4LG0A 2F5DA 4CYDA 3BWGA 4HQEA 3LQQA 4AIHA 3DKWA 3BP8A 2XKPA 1ODDA 2CWEA 1QQIA 2L01A 4AWXB 1SD6A 4U88A 4Q47A 3KP6A 1TNTA 3VEPA 3E5UA 4PCQA 3KEOA 4ZYGA 1J0RA 3V4GA 2DPDA 1B9MA 1Z9CA 2HKOA 2O6GE 5EEGA 3FXUA 2EFNA 2W24A 2QUFA 1KU3A 1SD4A 4N0BA 3MAJA 2OD5A 5L3GA 1O3QA 3I58A 1BC8C 2YSRA 3SHFA 1R7JA 1YQAA 2Q0OA 1HQCA 5ILVA 2QVOA 5EEHA 3AAFA 1BM9A 2JPBA 3I54A 2OA4A 2UWMA 5ILSA 2FBHA 3I64A 4BQAA 1I6XA 4KYWA 2LF8A 3F72A 3J81K 2AS5F 2Y75A 4CGZA 4ENMA 3LA3A 2COMA 3T5XA 4IJAA 1OYWA 1IRFA 2OAZA 1BI2A 4ENKA 3JAMK 2STWA 2V79A 1S3JA 5D5VB 3CLOA 4XSXF 5FLXZ 4KN7X 3EDPA 3VB2A 3V8KA 2PN6A 1B4AA 1KQ9A 4IRGA 2NRAC 4ESJA 1XGSA 4FX0A 3FXQA 2E7WA 3HRUA 5LLQA 5HDNA 2EV6A 1J2XA 2QBYA 2MD5A 2JZYA 1FLIA 1G3YA 3GYHX 4UVBA 4HQMA 2FMLA 1AWCA 1RNLA 2NS0A 1QGPA 3FHZA 2CW0F 5BS6A 3E6CC 5LHGA 3CUQA 4YG2F 1QZYA 4A12A 1Y0UA 4I2OA 2RV8A 3F8BA 4KIGA 1EV7A 5K1YA 2A61A 5K5QA 4EJWA 2XAQA 1MDMB 4P96A 4WXHA 2ESNA 2M8EA 3M8EA 2MC3A 1T38A 2HGCA 3PFIA 2P6TA 1YS6A 4L0ZB 4OU0A 3ECOA 2RNJA 3CDHA 1QBJA 4G7ZF 1ZN2A 3BDDA 5LGNA 3QU6A 2VBWA 3U9GA 2KIUA 2WTEA 3CO6C 1W7PA 1R22A 2BBYA 1YO5C 5HDGA 5HVQC 4M9ZA 3H3ZA 2DPUA 1MDMA 4CXFA 4HYEA 3WG9A 4HA8A 2X0LA 4HV5A 1BOAA 4HF2A 1HSJA 3Q9SA 2STTA 3E6BA 2FNAA 3FMRA 1U5TA 3C7JA 3L2CA 4EV0A 1UHWA 2GIVA 3B02A 1K7AA 2NAZA 4U0WA 1ZG1A 1PP8F 3DEUA 3L9FA 1DUXC 4RGXA 1QNTA 3KP3A 4HAMA 3WTUC 2NYXA 1FNNA 1DDNA 3ZN0A 4EM1A 4BXUA 3F21A 4OMYA 5FGMA 4LLGF 4MTEA 2L3DA 2OZ6A 1TQIA 2P5KA 4ZYEA 3WTVC 2A07F 2Z9OA 4A6EA 2RC4A 1U8RA 3OOPA 4ON0A 5IT9Z 4OMZA 4L0YB 3EYYA 5AONA 2D45A 3P9CA 2VC1A 3ZMTA 4IRIA 4M6YA 3HUGA 2K27A 3MCZA 2G7HA 3U2RA 1FBUA 4UHTA 1GXPA 1ZGJA 2DFIA 3ISPA 4S04A 1U3EM 3F6VA 3KP4A 2CO5A 3WTWC 2QZ8A 4ZH4F 2VONA 4P9UA 2XROA 5AIQA 4LK0F 2VBYA 1P4WA 1G3TA 2E7XA 5CLSA 1G4DA 5LRSA 3FMQA 2PFBA 5F6FA 2Q8KA 1SD7A 2ETHA 1WKMA 1RIOH 2K4BA 5E8IA 4KDPA 4KNYA 1SFEA 1H9TA 2MLKA 2VOOA 2F5FA 2QWWA 1FP1D 2H27A 2H6BA 3CJNA 4R79A 2XAFA 2XKOA 2DU9A 4N9IA 1FWZA 3O2PE 2VOPA 2R7FA 3QPTA 4HBLA 1MJAA 3E5XA 1WQ2A 4OIOF 3FZVA 4Y13A 5ILUA 2J5PA 3V8LA 2L4MA 5D4RA 2ZNZA 3M8FA 1DPUA 2CGPA 3H92A 4RGSA 3WTXC 3KEQA 4L9VA 4D0PA 3WTTC 4KUMA 4CO8A 3E5QA 1BBYA 2WWYA 5DV5A 2Z33A 3TDUC 1FZPB 2VE8A 3LQRA 4M9SA 3WGHA 2RQPA 3LWFA 2GA1A 3FX3A 2DW4A 1H9GA 1T2KA 3HTUA 4RB2C 1G3SA 3HOSA 1OKRA 2OBPA 3RIRA 4HF1A 2YX4A 2OZUA 4AIJA 4R1HA 5L3DA 1XCVA 5HS7A 3IRQA 3IHUA 2QYOA 5ICGA 4OIQF 4KN4X 2HTSA 5ICFA 1ONVA 3LA2A 4LLLA 1CGPA 3GXOA 5D8LB 1G6NA 2VT2A 1USTA 3JAMZ 3RYPA 2QLZA 1L0OC 1V3FA 4XLPF 1OMIA 2A6HF 4EJVA 2HWVA 4AIKA 1IF1A 4HLYA 4HV6A 3GVAA 3C3WA 3M9AA 1W5TA 1SMTA 4LGWA 2HEOA 3GUDA 5DUIA 1BI3A 1KU2A 3CTAA 3DPTA 2QBYB 4MNUA 1EH8A 1RI7A 2XAGA 4RGUA 4LB6B 1Q1HA 3TO6A 1I1GA 3T0YA 3QRFF 1F9NA 3IL2A 3MWMA 3ULQB 1XCBA 5KK1A 3FXRA 2R7DA 3P7NA 4KMUX 3WU1B 2RN7A 4EJUA 3BROA 2ACJA 3QAHA 3H3UA 2V6CA 3RPQA 3W6JB 1HBXG 2D1VA 1ZGAA 2VBXA 4H0EA 2PI0A 2GAUA 3M7GA 1RUOA 4HX7A 2HYGD 3HSEA 3K1MA 5D4SA 1A04A 3V7SA 3R0JA 2CQKA 2M30A 1FBSA 1YIOA 2OQGA 3HIFA 4YIFA 5LHIA 1IN7A 5HLIA 1YYVA 3COAC 3FM3A 1XGMA 1UCRA 3KCCA 1BC7C 3KLNA 3R61A 1F5TA 1O3TA 2CG4A 2YU3A 3D5LA 4O3MA 4A6DA 3MZHA 5CVIA 3HSFA 4I02A 1FSEA 4I98B 5F1RA 1ZHFA 5HS8A 1S7AA 3BJ6A 4MTDA 4YIIA 5CVJA 1YW7A 3HRSA 2LKPA 4G6DA 4BAYA 3HYIA 3SXYA 4UUVA 1UFMA 4MEYF 4S05A 1BI1A 4ZZDA 3WE3A 4G6QA 3QP6A 4GYIA 2FF4A 1QPMA 3R0AA 2L02A 1YLFA 2W57A 3HOTA 4A0YA 3N97A 3VODA 4YFKF 2XAHA 3GW2A 2H6CA 3N4MA 5LEKA 1GHCA 1PUEE 4BHBA 2FXAA 1HKTA 1CF7B 3GEZA 4R8HA 3HTSB 4DQ2A 4WCGA 3E6MA 2RKHA 4IF4A 2CYYA 2ZMEA 4RAYA 2JSCA 1YG2A 3F3XA 3GF2A 1DPRA 2ADUA 4M6XA 4TV7A 1XGNA 5DD8A 3F8NA 2PEXA 2YPRA 1KQ0A 5H20A 1XN7A 2FU4A 2Y0MA 3S2WA 3ZMZA 1PDNC 3NQOA 3EUHA 4GGGA 1U6GA 1ZYRF 2HTJA 3GZ5A 5FFXA 1ZLKA 2HYFA 3BPXA 1B9NA 5CVVA 1S7OA 5HLHA 1LNWA 1TW2A 1IN4A 5A2QK 3LA7A 3WU0A 1STZA 2NNYA 3KP2A 5ICEA 4EJOA 4G7HF 2A69F 5TRDA 1RUNA 4U0YA 1TBXA 4EGYA 4RB1A 2EV0A 2ISYA 5E1ZB 1DP7P 4Z2YA 1Z1DA 2B0LA 3V7CA 5E8GA 2P4WA 2V1XA 3RJPA 2IT0A 1P4AA 1R00A 4LLNA 4I09A 5CVUA 2IA1A 2GXBA 5LEJA 1U5TC 3T8RA 4MQVA 2VT3A 2EFOA 4XLNF 5CVRA 2RGVA 2DK8A 6PAXA 1BN5A 4HOBA 2HQNA 5DYMA 3J81Z 2LSOA 1D5VA 5HDKA 4JK1X 3WGIA 1EH7A 4FT8A 5K5OA 2VE9A 2EB7A 3SQNA 1AOYA 4L5JA 5J8FA 3JTGA 4U0VA 4EQQA 5H6RA 2D2WA 3HRMA 3F6OA 3KETA 2H09A 1BJAA 2XUBA 5IT9K 4YFNF 3K69A 1XMKA 1J59A 4UXNA 3F8CA 4LB5A 1QZZA 3BY6A 4LFUA 2QM3A 3REOA 2P5VA 5FFZA 2EV5A 1LDKB 1HSTA 2HFHA 2FEZA 3Q9VA 1ZLJA 2TDXA 2EFPA 1T39A 4M74A 2XIGA 3OV8A 2IJLA 4ETSA 2M5WA 4L9NA 4PDKA 4OOIA 3I59B 3WE2A 4A5NA 3D0SA 3ROUA 2BE5F 4A2UA 4CHUA 4ESFA 3BOQA 2Z3YA 2FRHA 4Y17A 2XAJA 4KMFA 3L7WA 3IRRA 1IXCA 4PGHA 3L09A 4EM0B 4RAZA 1FBQA 5DCMB 1W4MA 5ICCA 4XSZF 4LG0B 2ZO4A 5E18F 1FYKA 2P8TA 3MFKA 3KZYA 1K78A 3TO9A 2IA2A 4WX9A 1R5GA 2FQ3A 3I0TA 1JHFA 2PJPA 3JSOA 3HRTA 5D5WB 2ZKZA 4IRHA 5D6EA 1HW1A 5BPIA 1IUYA 4G8XA 3JSPA 3GWZA 1R1VA 4G94A 3U1DA 1LVAA 5DD4A 3KE2A 4Q4ZF 2P6SA 2LF7A 4KT5C 1BIBA 3E97A 3ZQ7A 3LAJA 4Y15A 1H0MA 2K7LA 3Q5FA 2O8XA 2IW5A 2EWNA 3RKWA 3E3VA 5E20A 1ZARA 2ZJ2A 1HW2A 4Q48A 3F23A 2BV6A 4NHJA 3K9TA 3DQVC 2KRFA 4FHTA 1MJ9A 3TO7A 3G73A 1Z7UA 2YR2A 2MH9A 4ZYHA 3KLOA 2L54A 3SZPA 1KGSA 1MGTA 2NNNA 3C1DA 1O57A 3L00A 4YFXF 1KU9A 4WXDA
chains in the Genus database with same CATH superfamily
2VQHA 2WC2A 3PQJA 3JR9A 3B73A 4IVNA 4BJ6C 4ANJA 1R1UA 4KFCA 2MBFA 2CW7A 2V9VA 3HOWJ 1T98A 5LGUA 4XN3A 2K86A 4G9YA 1GV2A 3K6GA 1JUSA 1V54H 2E1MC 3OOUA 4C2MJ 2L7ZA 1VQ7I 1XC5A 3I3LA 4EJTA 1YHQI 3DV8A 3TKYA 2MA3A 1WSUA 1H88C 4NQWA 1XDUA 4E7IA 2MYSA 2R7RA 4BACA 1Z67A 4XR6A 2PLYA 3KIOA 3SEZA 4CZZA 2ZXJA 4PJ0C 5ED4A 1SAUA 3ML6A 2EJRA 2L4AA 4IXAA 4NUBA 2Z2SB 3K4CA 3OYAA 3GFMA 4XLFA 4PJNA 4XKCA 5BNGA 5FLXK 1P6RA 2IRFG 2QENA 3LL7A 3E6DA 1JGGA 1JXSA 2ZJPF 2Z5UA 3EPZA 2PMHA 3LFKA 5CJ9A 2ME6A 3VOEA 1R36A 4PZJA 1ERDA 3PUBA 2DA2A 2E5ZA 4HPQA 4F7ZA 1GLNA 1A31A 2E60A 2BW3B 4B44A 3CUQB 1R6RA 2JK3A 2DMQA 2MH2A 4X1EA 3QP5A 2DT6A 3WU2C 1O4XA 1O3SA 1IV6A 5EG0B 3HHHA 3K2AA 4LK1F 1Z05A 1ZTRA 4O6JA 2M9HA 4XONA 4MFDA 5BQTA 4UVAA 4BUPA 1OCTC 2ME0A 1FEXA 5KAFC 1IRGA 1Y8RB 2CQXA 1BOBA 3IKTA 1XD7A 2Y9YA 4M3GA 3LSMA 1FT9A 1PUFB 2LD5A 2R3SA 2HZTA 2CRGA 4OINF 3FK6A 1OJLA 1GT0C 1K78B 1XS9A 1YX3A 5ERIA 2CV1A 2FNPA 2FX0A 2VC0A 1T33A 2EA2A 2JRTA 2XPUA 3FXKA 1P92A 4HX8A 4ESBA 2W25A 2XF5A 1XSXA 3AKZA 3LOCA 2X48A 3RSNA 1YFHA 4I76A 3I4PA 4B48A 4A3BJ 4I01A 1OCRH 5IP7J 3CCSI 5AIPA 2HDCA 3DLLF 2G9WA 2PQ8A 1PYVA 3KP5A 5IY5H 3A01A 4AU7A 3PQKA 4YELA 3TOBA 1J7KA 1OR7A 1XMAA 1OCOH 1KYZA 4E7KA 1ZRDA 1EKEA 1VQ5I 4BXXJ 3SFZA 1RR8C 1RRJA 1R1TA 4KISA 4IOAF 4M72A 1CQTA 2FOKA 4PFOA 3QOEA 3BZCA 1TL8A 1H89C 2IEKA 2XF7A 2VODA 4L18B 1IDYA 5FD5A 4L9TA 2KQRA 2Y48A 2M87A 3V42A 2ZCWA 2BXYA 4CUGA 3KZZA 4P55A 1VI0A 2VKHA 2VJJA 3EUAA 4GXOA 2R7ZJ 2Z1DA 2EFWA 3CQZJ 2KKOA 1T56A 2X85A 2FQ4A 2LK2A 4IHTA 3QPSA 3A03A 4J01A 2XF6A 2Y9ZA 1LEAA 2CQ7A 3L2RA 1GVJA 2EK5A 1JJ8C 1RETA 2JJ7A 4FASD 1LDJA 1D1CA 4C9YA 4LIVA 2FJ1A 3HKZA 2P7VB 1TQMA 2L5QA 3WODF 4QSHA 5K7FA 1YW9A 5HLTA 2LC2A 4CA0A 4MGRA 1PVEA 2VQGA 1R5ID 1NTCA 2P5LC 3U21A 3OS1A 3HGYA 4GCVA 4QWQA 1VQ6I 1Z77A 3SZGA 2ID3A 1IRXA 5E1XA 2QQAA 3A02A 5LFAA 5DCFA 1IAWA 3K2ZA 1ETWA 4JQFA 5H6QA 4UUSB 3BC8A 1S29A 1SFUA 2K3PA 4XOTA 5EZHA 3FF5A 1W7PD 2JMWA 4IHXA 2O61A 4RS8A 3ERED 2JVGA 4NC7A 3HBLA 3TQNA 2ELHA 3RZOJ 1MNDA 1JHHA 3HHGA 5KVRA 5D5XB 3W6KB 4BY1J 3CF5F 4B8XA 2DMTA 5L3FA 4EGZA 2E1CA 1T6SA 4B43A 3I55I 1O7FA 2NS7A 4A0XA 4DBRA 2RQQA 1X3UA 2BYVE 5D5UB 2CSOA 2RVCA 3JRGA 2V1UA 1UHMA 2F2EA 3PUFA 1O3RA 3PNYA 2AO9A 2M0MA 3WGGA 4DW6A 1DP3A 4IO9F 4AYBA 2AXLA 3E0JB 1F4KA 3RPUA 2HS5A 2DO7A 2DT7B 4AD9A 3JRCA 1K79A 2E1NA 3FKJA 4E7LA 1T95A 1YX5A 4HX4A 3L2UA 3ZQCA 2Q2EB 2CUJA 4P9FA 4HZFA 2IAIA 2DMPA 1U78A 1Y1WJ 4RMNA 1BR1A 3RI4A 1VQPI 4XMYA 2CUFA 1JT6A 3GLXA 2WV0A 2IPQX 5HLGA 5E1WA 2JA7J 2R0QC 1LEBA 1IDZA 2HQRA 3NWSA 4C2UA 2GA2A 3LSTA 2D1HA 1FOWA 1IZ1A 2KT0A 3IC7A 5DUKA 3SDGA 1W36C 1MBEA 3MKWB 3H3VK 3FMSA 4HSTA 5DDGA 1WI9A 3DP7A 3FXOA 3NEUA 3OWTA 3GTMJ 5L3CA 4JP0A 1XGOA 3J80Z 4DNCA 1KU7A 2HVSA 2F5EA 3FHNA 3ZMUA 1Z91A 3CZ6A 4PGGA 1EF4A 3RKXA 1Z6TA 5HOOA 3HJEA 2FBKA 3S15J 1ZELA 3A2KA 4M9XA 3MQ0A 2ELJA 5K5RA 2GXAA 2M7AA 2O0YA 4NQWB 2W85A 4HF0A 5J1UA 4NB5A 1SFOJ 2L0KA 4U7DA 4E7ZA 2H1KA 1RZ4A 1RPWA 2LDUA 1W7PB 3I71A 4EMSA 1AU7A 1O7LA 4ASNA 4BHCA 2E71A 2LY2A 3JRIA 1OPCA 1ETXA 1IN6A 3JTHA 2OJED 2KHMA 4Y4RA 1E3OC 5BPDA 1ZREA 4GYGA 4OWRB 1ZRCA 2DODA 4E70A 4DYRA 2FA5A 1TWFJ 3BQZA 4G7OF 2NVYJ 5IYCJ 5BOXA 4PJJA 2A68F 1MNEA 4DZJA 3DU5A 4J00A 2XVCA 4A3GJ 3J7AO 3VFZA 1BJZA 1LJ9A 4I0AA 1OYYA 4WWCA 2KFDA 2V26A 2W84A 2JTVA 4A93J 3N05A 1H8AC 5KCMA 3S14J 5LRRA 2R7TA 2XGXA 4BHPA 2R7XA 2UXNA 3ABTA 4QTRA 3CO7C 1AA7A 2Y0SN 3GCMA 4BL0B 3BJOA 2X1DA 3GTKJ 3KX2A 2R7QA 1ZAOA 2CH0A 1RC9A 1VQOI 3GLLA 4KIFA 3FM5A 1VTNC 1MBJA 2XASA 3BCAA 1JGSA 3BPVA 1E17A 2EIJH 2XRNA 2Z99A 1KA8A 3R6SA 3DXJF 1REPC 1YS7A 1ZKGA 2R7SA 5CQGA 2VBZA 2ZNYA 3O3KA 1BR4A 3FDYA 2DQLA 5FRMA 2JVHA 1B59A 3Q0UA 1CF7A 2PG4A 1HDPA 3ERMA 2QSGX 1YTYA 4V2GA 1IXSB 1KQ8A 3DF8A 1BW5A 1ON2A 5GPAA 2BY0A 5IT3A 1VQKI 4Q5SF 1VQ9I 3DEEA 3GZ6A 1NHAA 1R58A 1XB4A 3ELKA 3H9QA 4DOZA 2A6EF 2X9DA 1WRJA 4EVIA 3J80K 2HKXA 4BGDA 5A2QZ 1USSA 3LSRA 2R92J 3OYDA 1SC7A 1RR7A 4LJZF 4U87A 3IWFA 1OYIA 1N25A 4P5OA 3K4MA 1I1SA 1FX7A 2XPVA 4QLCU 1FOXA 2IA0A 1S6LA 3GZNB 3IAM2 2JPCA 1YIJI 1TW3A 2FE3A 1FSHA 1R5HA 3OSFA 1TLHB 2ZFWA 3P9KA 3AG3H 1B6AA 1OCCH 1L3LA 3H0DA 1JJ6C 3L2VA 1YJWI 2LBFA 1S8NA 3RKQA 1HKSA 1LE8A 3M1EA 4CCMA 3EQLF 5FD6A 5IYDJ 3GFLA 3GX4X 1KYWA 2RAEA 4KIBA 2KJBA 2XV4S 3H5RA 2E1MB 3O8GA 2V7FA 3FXMA 2ISZA 1K4TA 1MZBA 1C0WA 4M73A 5F1JA 1Z3XA 5FO5A 1QRYA 3BR6A 4BKXA 2KIMA 3O6BB 4J19A 4KT6A 1WWXA 4GDFA 2DA3A 3AG4H 4O5VA 2YX7A 5F64A 3LSGA 3K1PA 3NWTA 4KA4A 3F8FA 2DBBA 1WGXA 3QU3A 1SFKA 2KISA 1R49A 2WY7Q 2Q2EA 1IJWC 1XTAA 3DBRB 4RB0A 2QGUA 2NXNB 1EH6A 3HPGA 3HDDA 2BEOA 2DAOA 2FBIA 1PUFA 3BG3A 4L9JA 4D9JA 1G59A 1I5ZA 3RKYA 1J5YA 5J4VA 3UR3C 2NVXJ 1TT5B 4I7HA 3J7YJ 4E4HA 3QPHA 3GO5A 2G0EA 2DLLA 2VB6A 3UKGA 3BZKA 3OYGA 2OCCH 3G1OA 3NRVA 1LQ1A 3BG9A 3FWEA 4QIWN 4EM2A 5JI6A 4XKBA 2DCEA 1Y0NA 2IP2A 4HLXA 5L3EA 1FC3A 3RYRA 2EINH 2NOGA 3IP4B 4MHGA 1I3AA 2M1BA 4M71A 3S8PA 2O3FA 3BLYA 3ZN1A 3DPLC 1J75A 3MZYA 4AC0A 2DTZA 2H94A 2LREA 3TW6A 5CYVA 4AYBN 5LBQA 3ZMSA 2DMUA 4RBOA 3C18A 1K61A 4LMYA 4B09A 4XBFA 5F08A 1WH7A 5D8KB 1ULYA 3BT9A 1D1AA 4IPAA 2DQRA 2X1EA 3CUOA 4RB3C 3P9IA 3SZTA 4A5MA 1XSDA 3C2HA 3HSRA 1MKMA 1UG2A 3CDLA 5DEQA 3GFJA 2CFXA 3VSLA 4JX4A 4WK8F 5D6FA 4C3HJ 1NK3P 1W5SA 1P4XA 4AUXA 2NVQJ 2V1NA 4WF2A 2ZXHA 4QPOA 3I5UA 1LDDA 3ZPLA 2L9RA 3DPUA 1U2WA 4IHSA 4FX4A 1V55H 2GXGA 1MH3A 3I53A 1IW7F 2I10A 1FPQA 3EETA 1SFXA 4A3KJ 2CU7A 2E2JJ 1ZG5A 2DA4A 5GAHJ 2E5NA 3ZMDA 1X4OA 4BH9A 2EZIA 3OYBA 1W0UA 2BOLA 2DK5A 4ENNA 3RZDJ 1ZK8A 1T08B 2F5CA 4LITA 4I0BA 3HOZJ 5LHHA 2EILH 3R60A 3K1NA 2C6YA 1FYMA 1ZRFA 3QOPA 3VSKA 2O03A 2UZKA 5LGTA 2M45A 1BA5A 2Z16A 5JR3A 2W1OA 1VFCA 1P7JA 2E34A 3CP8A 2Y31A 3DKXA 3TGNA 4V19K 4CZCA 2KJCA 3BR2A 4UVCA 1N77A 1Z3YA 1HW5A 1R23A 1QO0D 2F48A 2FMYA 2X6YA 5L3BA 3CCUI 3LNQA 4UNOA 3ZQHA 1D8KA 2G7UA 1FP2A 3G3ZA 3ZMVA 1XSVA 1JE8A 1TWAJ 3F8MA 5C3EJ 1MD0A 2A3SA 2GWRA 3V7RA 3ABUA 5J8CA 3ABMH 3FIWA 4AVPA 3GFIA 1R4NB 4CSWA 3OMYA 2VXZA 3R4KA 1XDSA 3DEWA 3WTZA 2QF7A 2IVMA 4HDUA 1E3HA 1I27A 1VZ0A 2EZLA 3HM5A 2EBIA 5FKLA 2DT5A 5TJJA 3CESA 5IP6A 1BIAA 2F4IA 3LSKA 2EFQA 2R5YA 5C4JJ 3LAPA 3VDXA 4HDVA 3IWZA 1K6OA 3M4OJ 1E2XA 2OC6A 3RDIA 2J5OA 2UXXA 2O7OA 2LNBA 4ZYDA 5HS9A 1WFXA 2ZBKA 4K2EA 3TDZC 4XRSG 4Y7NJ 2XRLA 3ECHA 3CMYA 1ZH5A 2Y0SA 4JBAA 3BJAA 1NK2P 2V1DA 1FY7A 4ZTJA 4IEJA 1HXDA 1G8XA 4H4KC 1TTYA 4DBQA 1E3PA 4OIRF 3G4SI 3CMMA 1TNSA 4CICA 5DS9A 2PBIA 4LD5A 2HR3A 1BI0A 3CUQC 1J9IA 2GZWA 3ZP5A 5JFRA 4X6AJ 2LKXA 3IKVA 3F22A 2GLOA 2XHKA 2VL8A 2JT1A 4NC6A 1SAXA 4UV9A 5K7HA 5E17F 3V8JA 4L5IA 3MEXA 2OQRA 1V4RA 3KFWX 4PFPA 2DI3A 2MABA 2DTRA 3T1BA 2WAEA 3VYRB 2R7VA 3EYIA 2COBA 4M3BA 2GQQA 2KDOA 2OU2A 1OQYA 3CCEI 1A36A 4U7BA 2FSWA 3I9V2 2K4JA 2R5ZB 2VN2A 2DFFA 4HW0A 1LB2A 1HKQA 2BGCA 1YW8A 4BYYA 1K4SA 1B1BA 3TOAA 4ENJA 1V5FA 1WJEA 2QQ9A 3OYIA 3MVPA 4UUTA 2L7MP 1MJBA 2K9MA 2VJ4A 4XRSA 5EEAA 1PP7U 3K0LA 1U5TB 2ESHA 5GP9A 1ZG3A 5TGTA 1FOKA 3KP7A 3LSIA 2WY8Q 3T8TA 3JW4A 3D5SC 4N9HA 1SMYF 2K02A 5J1RA 4N4NB 1SD5A 5J6XA 1D8JA 5DM6F 2F4MB 1UB9A 9ANTA 1FYLA 2RDPA 3M07A 3I59A 5BMZA 3K4JA 4BQQA 3DFGA 2EA4A 1X1DA 1Z6RA 4N4OB 4XRFA 3RPUD 5FB2A 2P7CB 4MQ9F 3OYEA 5EGOA 4UV8A 5M5WJ 1VNDA 2WBMA 5F0FA 3M8JA 3AL0B 2X4HA 4OIPF 1WJFA 4RGRA 4GO1A 2PMUA 3WTSC 4ZZLA 3MD2A 1D3YA 2A5YB 2LMDA 4XLAA 4A0ZA 4BNCA 2MLGA 3OIOA 1ON1A 1TQPA 2CS3A 4XKVA 3U1KA 1IN8A 2ZMEB 3WTYC 1QPIA 5GADJ 3BZ6A 3RTRA 4KICA 1F1ZA 3HL2A 3VYUB 1LE8B 3HOVJ 2DOEA 2KP6A 1WH5A 2N8GA 1Y1VJ 2UUZA 2HDWA 1GXQA 2CV0A 3LSHA 4WXCA 3ZQQA 4CDGA 2FUG2 3ZQIA 2HOEA 2KIFA 1IN5A 5JVTA 3MKZA 1IXRC 4MEXF 1E0EA 1G3WA 3OL3A 1P2FA 2ZMEC 2QQBA 2ZFUA 1MIJA 5DCMA 3M1CA 2HVRA 5JHUA 4BEHB 4X0GA 2MG4A 5TISC 1T0FA 3CDIA 4LG0A 4A3EJ 3C2BA 2LVSA 1Q1VA 2F5DA 4CYDA 2KRHA 3BWGA 4HQEA 3LQQA 4AIHA 3DTEA 2MD0A 3BP8A 3DKWA 2XKPA 1ODDA 2CWEA 1QQIA 4G12A 2F6CA 2L01A 4AWXB 1SD6A 1I39A 4U88A 4Q47A 3KP6A 1TNTA 3CJQB 2EQRA 1WI3A 2HQ5A 3VEPA 2WB1A 4RLQA 3IH2A 3E5UA 4PCQA 3KEOA 4RAGA 4ZYGA 4JX5A 3PIOF 1ZR2A 1J0RA 3V4GA 4XLHA 2B63J 1K83J 2DPDA 1B9MA 4FETA 2HKOA 5F0CA 2CMPA 1Z9CA 2O6GE 2X51A 5EEGA 4PUSA 3FXUA 3L2QA 1WZ2A 4II3A 3OR2C 2XSJC 2EFNA 2W24A 2QUFA 1JTYA 2K9QA 3DCFA 1KU3A 1VQ8I 1SD4A 3FKIJ 4N0BA 1T0FC 2JUCA 3MAJA 2OD5A 5L3GA 1LUJB 3RQ4A 4BDZA 2CQQA 4RLFA 1O3QA 3I58A 1BC8C 2YSRA 3SHFA 2GBYA 1MNMC 1R7JA 3OIPA 3CCRI 3W2AA 3VYTB 1YQAA 1VQNI 2Q0OA 1HQCA 5ILVA 2NS8A 2QVOA 1LPQA 5EEHA 3K4NA 3AAFA 1MBKA 1BM9A 2CFOA 2M34A 2JPBA 3I54A 2OA4A 3PFYA 1D5YA 2UWMA 5ILSA 5FLMJ 4M3DA 2FBHA 4CH7A 3A01B 3I64A 2XB5A 1I6XA 4BQAA 4KYWA 2XSDC 2LF8A 3F72A 1Y39A 1IO2A 2V9KA 1ETOA 1HA8A 4XOPA 4NNJA 3G71I 5K7ZA 1UAAA 3J81K 5CQEA 2M7BA 2AS5F 2OF7A 2Y75A 5JVGF 1GV5A 2QSHX 4CGZA 4ENMA 5JHFA 4FQGA 3LA3A 2COMA 3T5XA 4IJAA 1OYWA 1IRFA 1YE9A 3SEQA 4ZC3A 1D0XA 2OAZA 1BI2A 4ENKA 2E1OA 3JAMK 2STWA 2V79A 4CYCB 3OYNA 4I99C 1S3JA 2XGEA 5D5VB 3OS0A 1N75A 3EUKL 1RESA 3CLOA 4XSXF 1FTZA 3A4CA 5FLXZ 4CCJA 3JRHA 2H8RA 5KNLA 4DIQA 1SEUA 4KN7X 5FKOA 3EDPA 3VB2A 3BTIA 3K70D 3V8KA 2PN6A 1B4AA 1KQ9A 4IRGA 2NRAC 2ZC2A 4ESJA 1XGSA 3ZQGA 4IOCF 1K6YA 4FX0A 1IGNA 3FXQA 5F0HA 5HNFA 5EGOB 3OSGA 2E7WA 2E35A 3HRUA 5LLQA 2EZHA 2EV6A 5HDNA 3S16J 1J2XA 2QBYA 2R7WA 3CLQA 2MD5A 3AG2H 2JZYA 1FLIA 1G3YA 3GYHX 4UVBA 5LD2C 4HQMA 4XORA 2FMLA 1AWCA 2DA1A 3CC4I 2NVUB 3S3NA 1RNLA 2NS0A 1TZLA 1QGPA 2XB0X 3FHZA 2CW0F 5HODA 4IHVA 5BS6A 4D7NA 4PK4A 5LHGA 3E6CC 3CUQA 2JN6A 4YG2F 2XAUA 1M1EB 1QZYA 4A3FJ 3DWLE 4E6KG 4A12A 1Y0UA 1TC3C 4I2OA 2R5YB 2RV8A 3F8BA 4KIGA 1EV7A 5K1YA 2A61A 3W2VA 2B7EA 5K5QA 4EJWA 1JT0A 2M2EA 2XAQA 2B9SA 2R5ZA 3BR5A 5F04A 5FKMA 1MDMB 4P96A 1X3ZB 4WXHA 2L9VA 2ESNA 2M8EA 3PL8A 3IH4A 3M8EA 2MC3A 2M4GA 1T38A 2WV1A 3BG5A 2HGCA 1ORKA 3PO3J 2EZKA 2VJIA 3PFIA 2P6TA 3TMOA 1YS6A 4L0ZB 4OU0A 3ECOA 4OAZA 2RNJA 4A3LJ 3CDHA 1QBJA 3VPRA 3CC2I 2YU9J 4G7ZF 5IP9J 1ZN2A 5FRNA 3L2WA 3BDDA 1ETQA 5LGNA 2AHQA 1S9HA 3QU6A 4HNUA 2VBWA 3U9GA 2MFZA 2W48A 5B3SH 5B66C 1MBHA 2KIUA 2WTEA 2KMUA 3CO6C 4BE1A 1W7PA 4OAYA 2BVMA 1R22A 1WJAA 2BBYA 1YO5C 3CCQI 1ETYA 1JKQC 5HDGA 3LSPA 4HNVA 3CF2A 2DYSH 2A6TA 4L5EA 1GDTA 3HPHA 5IPAA 5HVQC 4M9ZA 2KRCA 3H3ZA 2DPUA 1Y56A 2LOOA 2L7FP 2XGDA 3HZJA 1MDMA 2BVLA 4CXFA 4F92B 4A69C 4HYEA 3WG9A 4A3IJ 4FE4A 4PSWA 4HA8A 2X0LA 4HV5A 1BOAA 4HF2A 1HSJA 3Q9SA 2STTA 2HXIA 4XRMA 3IAS2 3E6BA 2FNAA 5GTIC 3FMRA 5EJCA 5EF6A 1U5TA 2ZXIA 1ETVA 3C7JA 2O8KA 2JA5J 3L2CA 4LOCA 4EV0A 2LP0A 4IZZA 3BQYA 1G2HA 1UHWA 2GIVA 3HUGB 2KDZA 3B02A 1LFUP 1K7AA 4AM3A 3BTCA 2NAZA 1WHUA 2X6WA 3S1RJ 3SJMA 2D5VA 5FROA 4U0WA 1ZG1A 2EIKH 1PP8F 3DEUA 1SVLA 1Z0XA 1ZGWA 3L9FA 3A0BC 1DUXC 1I50J 2E19A 4RGXA 3CMEI 4DYCA 1QNTA 4FTHA 3C2GA 3KP3A 3QQAA 1Y6IA 3HB9A 4HAMA 3LMMA 3WTUC 2NYXA 1FNNA 1DDNA 2I8DA 3ZN0A 2VKVA 4EM1A 4BXUA 4V2FA 3QYBA 1A6QA 5EG0A 3F21A 1DU6A 4ZJZA 1APLC 4OMYA 5FGMA 1FIAA 4LLGF 5J47A 2DA5A 2XDVA 4MTEA 3PM1A 5IOZA 4PSXA 1TWGJ 2RNGA 3HXLA 2L3DA 2OZ6A 4AIDA 3AL0C 2GOMA 5GPCA 1TQIA 2TCTA 2F4OB 2P5KA 4ZYEA 3WTVC 2A07F 2Z9OA 4A6EA 2RC4A 1U8RA 2HVQA 3OOPA 4DZPA 5M3MJ 3TW7A 4ON0A 3KYLA 5E3OA 3J7ZI 5B1AH 2KPMA 4KJZA 5IT9Z 3JCUC 4OMZA 4L0YB 3ZGKA 3OS2A 3LSJA 3EYYA 3OYHA 4DYQA 3I4MJ 2GIZA 5AONA 2D45A 2X1CA 2X6XA 2VASA 1IG7A 3P9CA 2VC1A 4BBSJ 3ZMTA 2OUMA 4IRIA 4M6YA 3HUGA 2K27A 3MCZA 4B3AA 2G7HA 3U2RA 1FBUA 4BE2A 4UHTA 4PJLA 2VKEA 1GXPA 1ZGJA 2DFIA 3ISPA 2DJIA 4S04A 1U9OA 2HU9A 1U3EM 2JWTA 4W1UA 3F6VA 3KP4A 2CO5A 5CKTA 5B1BH 3PIPF 3WTWC 3JRAA 2QZ8A 4ZH4F 1ITYA 2VONA 1JUPA 4P9UA 2JA6J 1W5CC 4IL6C 2XROA 4BXFA 1I6HJ 5AIQA 4LK0F 2VBYA 1P4WA 1FOYA 4M6VA 1G3TA 3O8HA 2E7XA 5CLSA 1D1BA 1G4DA 5LRSA 2R7OA 1FMWA 1F36A 3FXJA 3WHBA 1MH4A 1R71A 2HPIA 3H9GA 3FMQA 1UELB 2BY2A 2PFBA 2DDBA 5F6FA 2Q8KA 1SD7A 2ETHA 1WKMA 1R9TJ 1RIOH 3PJRA 2CUZA 2K4BA 5E8IA 4KDPA 4KNYA 2JRMA 1X1PA 1SFEA 1H9TA 3FISA 2MLKA 3TEDA 4IKFA 4LG3A 1AKHB 2QKMB 2VOOA 2O9LA 2HI3A 2LRDA 2F5FA 4UUSA 2QWWA 1FP1D 2H27A 2H6BA 3CJNA 4R79A 1FMVA 2XAFA 5E3MA 2XKOA 2DU9A 4N9IA 1R4MB 2IS6A 1FWZA 3O2PE 2HQAA 4XN0A 3TL4X 2VOPA 2R7FA 3AFHA 3QPTA 4HBLA 1MJAA 3ZR8X 3E5XA 1WQ2A 4OIOF 1A35A 3FZVA 4ITVA 4Y13A 4EEFG 5ILUA 3MKYB 2J5PA 3V8LA 1ETKA 2L4MA 3BG7A 1T8IA 1X2MA 5D4RA 3K70C 2ZNZA 3M8FA 4IHWA 5J40A 1DPUA 2CGPA 2LG4A 3H92A 4IX7A 4RGSA 1OLTA 4E7SA 3WTXC 3KEQA 4L9VA 4D0PA 2VPLA 3WTTC 4KUMA 4IHYA 4CO8A 3M3YJ 3E7LA 3E5QA 1BBYA 1OCZH 2H1LA 5DV5A 2WWYA 2Z33A 1P9QC 3S93A 3TDUC 1FZPB 2VE8A 1ACIA 3PSFA 2L9NA 4UB6C 3LQRA 4B3XA 4M9SA 3WGHA 2ICWG 2IS4A 2RQPA 3LWFA 2WAQA 4XL9A 4XICA 2GA1A 4BQOA 2ELKA 3FX3A 2DW4A 3H36A 4RM3A 1H9GA 1T2KA 3HTUA 2LY9A 4RB2C 5F27A 5EDNA 4ZYAA 3H35A 1G3SA 3HOSA 1OKRA 2OBPA 3RIRA 1YITI 4HF1A 2DA6A 4LIUA 2VPRA 3HC7A 2PMZN 3S1QJ 2YX4A 3ABKH 2OZUA 3DBHB 3Q0WA 4AIJA 1MW7A 3K10A 4R1HA 2JA2A 3ZQLA 5L3DA 1LFBA 2AQEA 2FD5A 3S3MA 1XCVA 4W97A 5HS7A 3IRQA 1EJ9A 2IGOA 3IHUA 4F52A 2W00A 1IC8A 3ZRGA 4A3CJ 2QYOA 1X1AA 5ICGA 3CD6I 4OIQF 4KN4X 2HTSA 3OIQA 4BS9A 3X2QH 5ICFA 1ONVA 2DOAA 3LA2A 2WA0A 4LLLA 1CGPA 2ZXWH 3GXOA 5D8LB 1G6NA 2BHZA 2W82A 2VT2A 1USTA 3JAMZ 3KYCB 3RYPA 3P5JA 4UB8C 5DM7F 3BR3A 2QLZA 1L0OC 1ZR4A 3MMYB 1V3FA 4XLPF 2HZDA 1JKPC 1OMIA 2A6HF 4EJVA 2HWVA 4AIKA 3PO2J 1IF1A 4HLYA 1UZCA 4HV6A 3EUHC 2HXOA 1X19A 3CJRB 4BBRJ 3CJTB 3GVAA 3C3WA 5EZGA 2DXIA 2JSPA 2E2IJ 3M9AA 2IGNA 1W5TA 1FJLA 1YOVB 3GTOJ 1GVDA 1D0ZA 1SMTA 3F9KA 4LGWA 4CCNA 4F3QA 2HEOA 3IH3A 3GUDA 5FKNA 3GTLJ 5DUIA 3E1SA 1BI3A 1KU2A 3CTAA 3DPTA 3HOXJ 2QBYB 4MNUA 3H5NA 4XLCA 4FE7A 1EH8A 1RI7A 1NG7A 1DGWY 2XAGA 4RGUA 4C30A 4LB6B 2JQ7A 4ZDPA 1B72B 4A3JJ 2ID6A 2CW8A 2K9SA 2UV1A 1Q1HA 3KPHA 4Y33A 1OR7C 5JLXA 3TO6A 4EATA 1I1GA 1Z7LA 2BW3A 4ZDLA 3T0YA 4XIDA 3QRFF 3MN2A 1F9NA 3IL2A 3MWMA 2VQLA 3ULQB 2LYCA 5J4YA 1XCBA 2BXZA 3ONQA 5KK1A 1RKTA 4M3FA 2H8WA 1YJ9I 3FXRA 2R7DA 3P7NA 1X2NA 1X1CA 1MSEC 4NBQA 3WG7H 4KMUX 2KLOA 3WU1B 3CCJI 2OTLI 2R7UA 4NC8A 2VKDA 2RN7A 4CCOA 4EJUA 3DKYA 3BROA 2ACJA 3QAHA 3H1CA 3H3UA 2V6CA 3RPQA 3CC7I 3W6JB 1HBXG 1JKOC 2D1VA 1S7EA 3OYJA 4E7HA 1ZGAA 4B1RA 1W0TA 3HOYJ 3TP0A 1TT0A 5GAGJ 2VBXA 2CJJA 4H0EA 2PI0A 2QCOA 2GAUA 3M7GA 1RUOA 2KZVA 4HX7A 4BJ5C 2HYGD 3HSEA 2CUEA 4KITB 4B4CA 5E3NA 3K1MA 5D4SA 3CP2A 3CCYA 1A04A 3QYEA 3R0JA 2M0CA 3V7SA 2CQKA 3CCVI 2M30A 4JOMA 1FBSA 5HNHA 2IGMA 1YIOA 4C3IJ 3ESWB 2OQGA 4MFEA 3F0CA 2ZSIB 3HIFA 4D5CA 4YIFA 5LHIA 1IN7A 5HLIA 3ZQFA 1U9NA 3ZXSA 2IS1A 1YYVA 2LH9A 2ZB9A 1GUUA 3ABLH 3COAC 3FM3A 3IV5A 4XQFA 1XGMA 1UCRA 3KCCA 1OCPA 4ZDOA 5FJ8J 1BC7C 3KLNA 1V5GA 1F43A 3R61A 4XLEA 1F5TA 1O3TA 2CG4A 2YU3A 3S17J 3D5LA 3G1LA 2IGKA 4HEA2 4O3MA 2DN0A 4MLOA 4A6DA 3MZHA 5CVIA 1KONA 5E3LA 3GTPJ 3HSFA 4I02A 1FSEA 3OYLA 3PNVA 1YI2I 4I98B 5F1RA 4BE0A 1ZHFA 3DTIA 2PMZA 1Z21A 3LFUA 5HS8A 1S7AA 2P0WA 3BJ6A 4MTDA 4YIIA 5CVJA 2E2HJ 2OPTA 3CCLI 2HYJA 1YW7A 2XPWA 3HRSA 1BL0A 2LKPA 4G6DA 4BAYA 3HYIA 3SXYA 1VQLI 4UUVA 2HOSA 1UFMA 4RM2A 1RKWA 4MEYF 2Y2ZA 1VF9A 3BR1A 2W7NA 1QU3A 2L2OA 4S05A 1BI1A 4HRIA 5JLWA 1HF0A 1UMQA 1W1WE 2DFEA 4ZZDA 3GTGJ 3WE3A 4G6QA 3QP6A 4DJAA 2LR8A 4F93B 2ZJRF 3JREA 4GYIA 1SVMA 2FF4A 1QPMA 3R0AA 2L02A 1YLFA 2W57A 3HOTA 1DQUA 4A0YA 3N97A 5IOYA 4Y3OA 3VODA 4YFKF 1HOMA 4NDLA 2XAHA 3GW2A 3MKLA 2LTPA 2H6CA 2ZSHB 3KYDB 3N4MA 5LEKA 1GHCA 1PUEE 3H5AA 4BHBA 2FXAA 2ECBA 1HKTA 1CF7B 3GEZA 1B8IB 4R8HA 3HTSB 3SDBA 1QZEA 2DJNA 1XX5A 4DQ2A 1OISA 2E36A 4WCGA 3E6MA 2RKHA 2EPFA 3DLAA 2DYRH 4IF4A 2CYYA 3OL4A 2Y69H 2ZMEA 3BTLA 4RAYA 4YEJA 4G6TB 3GBGA 2JSCA 1YG2A 3F3XA 3GF2A 2AQFA 3OR1C 3SYTA 4II2A 3JRBA 1MMNA 2QEXI 1DPRA 1TP4A 3A1YA 1YJNI 2ADUA 4M6XA 4TV7A 1XGNA 5DD8A 5KHDA 3F8NA 4YRVA 2PEXA 2EIMH 2YPRA 3CCMI 4BJTA 3OY9A 3W3CA 1LVKA 2QKLB 5FLVA 2FOWA 1KQ0A 5H20A 4C3JJ 1XN7A 2FU4A 2AXTC 3G1MA 2Y0MA 3S2WA 2PX9A 2R93J 3ZMZA 3D1NI 4IQJA 3FXLA 2YS9A 3OYFA 2HNHA 3ASNH 1PDNC 2K5CA 3NQOA 1YRNA 2VUMJ 3JRFA 3EUHA 4GGGA 4HG2A 1U6GA 1YRNB 1ZYRF 5M5XJ 2CQNA 2HTJA 2LFBA 5E79C 3K4KA 5CPRB 3GZ5A 4FISA 5FFXA 1ZLKA 4A3DJ 2HYFA 3BPXA 1B9NA 1XG1A 4M3EA 3JRDA 1POGA 5CVVA 4RDUA 1S7OA 5HLHA 3H9JA 1LNWA 1TW2A 1X58A 4S0HB 4XNFA 2ZJQF 1IN4A 1OFCX 4BY7J 2GOXB 1TWHJ 2JUGA 5A2QK 3LA7A 3WU0A 1HC8A 2HOAA 4XKWA 4XK4A 1STZA 2MW8A 3DU6A 2NNYA 3BCBA 3BR0A 3KP2A 3Q0VA 5H2FC 4EJOA 5ICEA 3DBLB 1MMAA 4G7HF 2DMNA 2A69F 4BDYA 5TRDA 2L7KA 1U8BA 1RUNA 2MC4A 5KAIC 1TBXA 4U0YA 2VLAA 4EGYA 2W4SA 4RB1A 2EV0A 4MIMA 1VQMI 2ISYA 1BW6A 4BQNA 1BR2A 5E1ZB 3GTJJ 3W6VA 3QWLA 1DP7P 2OV7A 3PSIA 4Z2YA 1Z1DA 2WAQN 2B0LA 1HDDC 3HGGA 3V7CA 5E8GA 2R4GA 2P4WA 1KZHA 2RREA 2V1XA 3OYKA 1HLVA 1EA3A 2BZTA 1W36D 5C44J 3RJPA 2DOFA 3CMAI 2IT0A 1P4AA 3KEYA 1R00A 2IXSA 4LLNA 4I09A 5CVUA 1JTXA 2IA1A 2GXBA 5LEJA 1U5TC 3QODA 3T8RA 3ZOBA 3VWBA 4MQVA 2VT3A 2EFOA 1X4PA 4XLNF 5CVRA 4I6ZA 2RGVA 2DK8A 6PAXA 1BN5A 4HOBA 3OYMA 1A6IA 2HQNA 3FBIB 2BY3A 5DYMA 3UNGC 1P7IA 3J81Z 1IRZA 2XGCA 1QA6A 1HCRA 2LSOA 1D5VA 5HDKA 4JK1X 3GTQJ 2Q1ZB 4GRIA 4ABZA 3WGIA 4IQ4A 3S3OA 1XPXA 1EH7A 4FCYA 4XM3A 2QQ8A 4FT8A 5K5OA 4RA2A 1J09A 1JUMA 1B72A 2VE9A 2VIXA 2EB7A 4B47A 2GM4A 3SQNA 1AHDP 3B6AA 2HDDA 3S32A 4L5JA 5J8FA 1AOYA 3JTGA 4U0VA 3MZ8A 4JX6A 2VXDA 1WCMJ 4EQQA 4GFBA 1IV8A 2Y30A 5H6RA 2D2WA 1LFPA 3HRMA 3F6OA 3KETA 1ZQ3P 2MSYA 2H09A 1BJAA 2XUBA 3S1NJ 2LY1A 2QA4I 1ENHA 4AVZA 2L9SA 5B5EC 5IT9K 4YFNF 2PJRA 4F91B 3K69A 1XMKA 4E7JA 3B6CA 1J59A 4UXNA 3RQIA 2V9PA 4CCKA 3F8CA 2WAFA 4DGWB 5C4XJ 4LB5A 1QZZA 3BY6A 4LFUA 2QM3A 1WJDA 3REOA 2O5RA 1VQ4I 2P5VA 5FFZA 2EV5A 4D5FA 1WJCA 1LDKB 4P1WA 1HSTA 2HFHA 2FEZA 3Q9VA 1ZLJA 2TDXA 2EFPA 4M74A 1T39A 1WJ5A 2XIGA 3OV8A 2IJLA 3KZIC 4ETSA 2M5WA 4L9NA 1MMSA 4PDKA 1NH3A 4OOIA 3S1MJ 5M5YJ 3J7AY 3I59B 3PNTA 3WE2A 2K3FA 3K4LA 5EYRA 3BTJA 3WHCA 1MBGA 2DFHA 4A5NA 4CYCA 1MMGA 3ASOH 3D0SA 3ROUA 2BE5F 1PJRA 4A2UA 4ESFA 5J1YA 3BOQA 1MSFC 4CHUA 3S2HJ 2Z3YA 2FRHA 4Y17A 2XAJA 2HPMA 4C2TA 4CCLA 4KMFA 3K7AJ 2P81A 3L7WA 2KZGA 2MGQA 3IRRA 1A5JA 1IXCA 4PGHA 3L09A 1UG0A 2X6OA 4Y52J 2PJRB 4D7MA 4EM0B 4RAZA 1FBQA 3H0GJ 4QPQA 5DCMB 2EH3A 3TBIA 1W4MA 2WB1N 1DU0A 5ICCA 4XSZF 4LG0B 1X1BA 2ZO4A 5E18F 4JYKA 1FYKA 1JI8A 2P8TA 3W2WA 3MFKA 1Y8QB 2VI6A 3KZYA 1K78A 3RCOA 2OCEA 3TO9A 2NVTJ 1WJBA 3HKZN 5IYBJ 1QVTA 2IA2A 3TP3A 4WX9A 1R5GA 2LLKA 2FQ3A 2K9LA 3BG6A 3AG1H 3I0TA 3OYCA 1JHFA 2PJPA 3JSOA 3HRTA 2ZKZA 5D5WB 4IRHA 5D6EA 1HW1A 5BPIA 3IUOA 1IUYA 3K4BA 4G8XA 3JSPA 3NAUA 2WADA 3GWZA 2V4JC 1R1VA 3VYSB 1I3QJ 4BEHA 4D1QA 4G94A 2M3AA 3U1DA 1LVAA 4MO7A 5DD4A 2IS2A 3KE2A 4Q4ZF 1DGRM 1XMXA 2IBDA 1FIPA 2A5WA 2I5UA 2QSFX 3FBNB 5GAEJ 2BHYA 2P6SA 1WVRA 2LF7A 1X3WB 4YIRX 4KT5C 2NOJB 1BIBA 1S72I 3E97A 1QHHD 1NG6A 4F55A 3ZQ7A 3LAJA 4HNTA 4Y15A 1H0MA 3HG9A 1UHSA 2K7LA 3Q5FA 3FK7A 2ECCA 2VQCA 3SFIA 1LKXA 2O8XA 1UJ8A 2IW5A 2EWNA 3G6EI 3RKWA 2HOTA 2M8GX 3NARA 3E3VA 5E20A 1U0JA 4A3MJ 1ZARA 2VJ5A 3D5RC 1MBFA 4BU2A 2ZJ2A 1HW2A 3GMEA 4Q48A 1WPKA 1MMDA 1S5LC 3Q3SA 1IUFA 3F23A 2OTJI 2BV6A 4NHJA 3QYFA 2K85A 3I4NJ 3I56I 3K9TA 2YUSA 1D0YA 3HEFA 1B8IA 2DDAA 3DQVC 2K40A 2LKSA 2KRFA 2A05A 2V6EA 4FHTA 2LBFB 2BY1A 5FKKA 1MJ9A 3TO7A 2XC7A 3G73A 3L1PA 1Z7UA 1FTTA 2YR2A 2MH9A 4Z6YA 4PJMA 2JA8J 1SVOA 2KIQA 4ZYHA 2M4KA 4UY8I 3KLOA 5GTHC 5M3FJ 1V5EA 2L54A 4HSRA 3SZPA 1SANA 2CV2A 2DA7A 1N78A 1KGSA 1MGTA 2NNNA 1QHGA 1TWCJ 2K9NA 1QVUA 3C1DA 2KL4A 5J3LA 5DTDA 1O57A 4ZTFA 3A0HC 3ZCOA 3HOUJ 1JKRC 3QPLA 3DTKA 3L00A 4YFXF 3G2BA 1AKHA 3S2DJ 1KU9A 4WXDA 4RAFA 2F5VA 2TRTA
chains in the Genus database with same CATH topology
2WC2A 3PQJA 3B73A 4IVNA 1R1UA 4KFCA 2MBFA 2V9VA 1T98A 5LGUA 2K86A 4G9YA 4EJTA 3DV8A 3TKYA 2MA3A 1WSUA 4NQWA 1XDUA 2PLYA 4CZZA 2ZXJA 5ED4A 3ML6A 2EJRA 2L4AA 4IXAA 3GFMA 5FLXK 1P6RA 2IRFG 2QENA 3E6DA 1JXSA 2Z5UA 3LFKA 2PMHA 5CJ9A 3VOEA 1R36A 4PZJA 4F7ZA 3CUQB 2MH2A 3QP5A 1O3SA 3HHHA 4LK1F 1Z05A 4O6JA 5BQTA 4UVAA 1IRGA 3IKTA 1XD7A 1FT9A 2R3SA 2HZTA 4OINF 1K78B 5ERIA 2FNPA 2VC0A 2JRTA 2EA2A 1P92A 4HX8A 4ESBA 2W25A 1XSXA 1YFHA 3I4PA 4I01A 5AIPA 2HDCA 2G9WA 2PQ8A 3KP5A 3PQKA 3TOBA 1J7KA 1OR7A 1XMAA 1KYZA 1ZRDA 3SFZA 1R1TA 4M72A 2FOKA 2VODA 4L18B 5FD5A 4L9TA 2Y48A 2M87A 2ZCWA 3KZZA 4P55A 4GXOA 2EFWA 2KKOA 4IHTA 1LEAA 1GVJA 2EK5A 1LDJA 2P7VB 1TQMA 3WODF 1YW9A 4MGRA 2P5LC 4GCVA 4QWQA 5E1XA 2QQAA 5DCFA 1IAWA 3K2ZA 4JQFA 5H6QA 1S29A 1SFUA 3FF5A 1W7PD 2O61A 4RS8A 3ERED 3TQNA 2ELHA 1JHHA 3HHGA 5KVRA 5D5XB 3W6KB 4B8XA 5L3FA 4EGZA 2E1CA 1T6SA 1O7FA 4A0XA 1X3UA 2BYVE 5D5UB 2CSOA 2RVCA 2V1UA 1UHMA 2F2EA 1O3RA 3WGGA 2AXLA 1F4KA 3RPUA 2HS5A 2DO7A 4AD9A 1K79A 2E1NA 4HX4A 4P9FA 4HZFA 1U78A 3RI4A 3GLXA 2WV0A 2IPQX 5HLGA 5E1WA 1LEBA 2HQRA 2GA2A 3LSTA 2D1HA 1IZ1A 3IC7A 5DUKA 3FMSA 5DDGA 1WI9A 3DP7A 3NEUA 5L3CA 1XGOA 3J80Z 4DNCA 1KU7A 2F5EA 3ZMUA 1Z91A 4PGGA 3RKXA 1Z6TA 5HOOA 2FBKA 4M9XA 3MQ0A 5K5RA 2O0YA 2W85A 4HF0A 4NB5A 4U7DA 1RZ4A 2LDUA 1W7PB 3I71A 4EMSA 1O7LA 4ASNA 4BHCA 1OPCA 3JTHA 1IN6A 1ZREA 5BPDA 4GYGA 1ZRCA 4E70A 2FA5A 4G7OF 5BOXA 2A68F 2XVCA 3J7AO 3VFZA 1LJ9A 4I0AA 1OYYA 4WWCA 2W84A 2JTVA 5LRRA 2XGXA 4BHPA 2UXNA 3ABTA 3CO7C 3BJOA 1ZAOA 4KIFA 3FM5A 1VTNC 2XASA 1JGSA 3BPVA 1E17A 2XRNA 2Z99A 1KA8A 3R6SA 3DXJF 1REPC 1YS7A 2VBZA 2ZNYA 3O3KA 2DQLA 1B59A 1CF7A 2PG4A 1YTYA 1IXSB 1KQ8A 3DF8A 1ON2A 5IT3A 4Q5SF 3GZ6A 1NHAA 1R58A 1XB4A 3ELKA 2A6EF 1WRJA 4EVIA 3J80K 2HKXA 5A2QZ 1USSA 4LJZF 3IWFA 1OYIA 4P5OA 1I1SA 1FX7A 4QLCU 2IA0A 1S6LA 2JPCA 1TW3A 2FE3A 1FSHA 1R5HA 1TLHB 2ZFWA 3P9KA 1B6AA 1L3LA 1S8NA 1HKSA 3M1EA 3EQLF 5FD6A 3GFLA 3GX4X 1KYWA 4KIBA 2KJBA 2XV4S 2ISZA 1MZBA 1C0WA 4M73A 5FO5A 2KIMA 3O6BB 1WWXA 4O5VA 2YX7A 5F64A 3K1PA 4KA4A 3F8FA 2DBBA 3QU3A 2Q2EA 4RB0A 1EH6A 2BEOA 2DAOA 2FBIA 4L9JA 1I5ZA 3RKYA 1J5YA 4I7HA 3QPHA 3GO5A 2DLLA 3NRVA 1LQ1A 3FWEA 4EM2A 5JI6A 5L3EA 2IP2A 4HLXA 1FC3A 3RYRA 4MHGA 2M1BA 4M71A 2O3FA 3ZN1A 3DPLC 1J75A 3MZYA 2H94A 5CYVA 5LBQA 3ZMSA 3C18A 4LMYA 4B09A 4XBFA 5D8KB 1ULYA 4IPAA 2DQRA 3CUOA 4RB3C 3P9IA 3SZTA 4A5MA 1XSDA 3HSRA 1MKMA 5DEQA 3GFJA 2CFXA 4WK8F 5D6FA 1W5SA 1P4XA 4WF2A 3I5UA 1LDDA 3ZPLA 1U2WA 4IHSA 4FX4A 2GXGA 3I53A 1IW7F 1FPQA 3EETA 1SFXA 1ZG5A 3ZMDA 4BH9A 2DK5A 4ENNA 2F5CA 4I0BA 5LHHA 3R60A 3K1NA 2C6YA 1FYMA 1ZRFA 3QOPA 2UZKA 2O03A 5LGTA 2M45A 5JR3A 3TGNA 2KJCA 4UVCA 1HW5A 1R23A 1QO0D 2FMYA 5L3BA 4UNOA 1D8KA 2G7UA 1FP2A 3G3ZA 3ZMVA 1XSVA 1JE8A 3F8MA 1MD0A 2A3SA 2GWRA 3V7RA 3ABUA 5J8CA 4AVPA 3GFIA 2VXZA 3R4KA 1XDSA 3WTZA 2IVMA 4HDUA 1I27A 2DT5A 5TJJA 1BIAA 2EFQA 3LAPA 4HDVA 1K6OA 3IWZA 1E2XA 3RDIA 2J5OA 2UXXA 2LNBA 4ZYDA 5HS9A 2ZBKA 4K2EA 3TDZC 3ECHA 1ZH5A 4JBAA 3BJAA 2V1DA 1FY7A 1HXDA 1TTYA 4OIRF 4CICA 1TNSA 2PBIA 4LD5A 2HR3A 1BI0A 3CUQC 1J9IA 2GZWA 3ZP5A 5JFRA 3IKVA 3F22A 2XHKA 2JT1A 1SAXA 4UV9A 5E17F 3V8JA 4L5IA 3MEXA 2OQRA 1V4RA 3KFWX 2DI3A 2DTRA 3T1BA 3EYIA 2GQQA 2OU2A 4U7BA 2FSWA 2K4JA 2VN2A 4HW0A 1LB2A 1HKQA 2BGCA 1YW8A 4BYYA 1B1BA 3TOAA 4ENJA 2QQ9A 1MJBA 1PP7U 3K0LA 1U5TB 2ESHA 1ZG3A 1FOKA 3KP7A 3T8TA 3JW4A 4N9HA 1SMYF 2K02A 1SD5A 5J6XA 1D8JA 1UB9A 1FYLA 2RDPA 3I59A 5BMZA 3DFGA 2EA4A 1Z6RA 4XRFA 5FB2A 2P7CB 4MQ9F 4UV8A 2X4HA 4OIPF 4RGRA 4GO1A 2PMUA 3WTSC 4ZZLA 1D3YA 2A5YB 4A0ZA 4BNCA 2MLGA 1ON1A 1TQPA 1IN8A 2ZMEB 3WTYC 3BZ6A 3RTRA 4KICA 1F1ZA 1GXQA 4WXCA 4CDGA 2HOEA 2KIFA 1IN5A 5JVTA 4MEXF 1IXRC 1G3WA 1P2FA 2QQBA 5DCMA 5JHUA 1T0FA 4LG0A 2F5DA 4CYDA 3BWGA 4HQEA 3LQQA 4AIHA 3DKWA 3BP8A 2XKPA 1ODDA 2CWEA 1QQIA 2L01A 4AWXB 1SD6A 4U88A 4Q47A 3KP6A 1TNTA 3VEPA 3E5UA 4PCQA 3KEOA 4ZYGA 1J0RA 3V4GA 2DPDA 1B9MA 1Z9CA 2HKOA 2O6GE 5EEGA 3FXUA 2EFNA 2W24A 2QUFA 1KU3A 1SD4A 4N0BA 3MAJA 2OD5A 5L3GA 1O3QA 3I58A 1BC8C 2YSRA 3SHFA 1R7JA 1YQAA 2Q0OA 1HQCA 5ILVA 2QVOA 5EEHA 3AAFA 1BM9A 2JPBA 3I54A 2OA4A 2UWMA 5ILSA 2FBHA 3I64A 4BQAA 1I6XA 4KYWA 2LF8A 3F72A 3J81K 2AS5F 2Y75A 4CGZA 4ENMA 3LA3A 2COMA 3T5XA 4IJAA 1OYWA 1IRFA 2OAZA 1BI2A 4ENKA 3JAMK 2STWA 2V79A 1S3JA 5D5VB 3CLOA 4XSXF 5FLXZ 4KN7X 3EDPA 3VB2A 3V8KA 2PN6A 1B4AA 1KQ9A 4IRGA 2NRAC 4ESJA 1XGSA 4FX0A 3FXQA 2E7WA 3HRUA 5LLQA 5HDNA 2EV6A 1J2XA 2QBYA 2MD5A 2JZYA 1FLIA 1G3YA 3GYHX 4UVBA 4HQMA 2FMLA 1AWCA 1RNLA 2NS0A 1QGPA 3FHZA 2CW0F 5BS6A 3E6CC 5LHGA 3CUQA 4YG2F 1QZYA 4A12A 1Y0UA 4I2OA 2RV8A 3F8BA 4KIGA 1EV7A 5K1YA 2A61A 5K5QA 4EJWA 2XAQA 1MDMB 4P96A 4WXHA 2ESNA 2M8EA 3M8EA 2MC3A 1T38A 2HGCA 3PFIA 2P6TA 1YS6A 4L0ZB 4OU0A 3ECOA 2RNJA 3CDHA 1QBJA 4G7ZF 1ZN2A 3BDDA 5LGNA 3QU6A 2VBWA 3U9GA 2KIUA 2WTEA 3CO6C 1W7PA 1R22A 2BBYA 1YO5C 5HDGA 5HVQC 4M9ZA 3H3ZA 2DPUA 1MDMA 4CXFA 4HYEA 3WG9A 4HA8A 2X0LA 4HV5A 1BOAA 4HF2A 1HSJA 3Q9SA 2STTA 3E6BA 2FNAA 3FMRA 1U5TA 3C7JA 3L2CA 4EV0A 1UHWA 2GIVA 3B02A 1K7AA 2NAZA 4U0WA 1ZG1A 1PP8F 3DEUA 3L9FA 1DUXC 4RGXA 1QNTA 3KP3A 4HAMA 3WTUC 2NYXA 1FNNA 1DDNA 3ZN0A 4EM1A 4BXUA 3F21A 4OMYA 5FGMA 4LLGF 4MTEA 2L3DA 2OZ6A 1TQIA 2P5KA 4ZYEA 3WTVC 2A07F 2Z9OA 4A6EA 2RC4A 1U8RA 3OOPA 4ON0A 5IT9Z 4OMZA 4L0YB 3EYYA 5AONA 2D45A 3P9CA 2VC1A 3ZMTA 4IRIA 4M6YA 3HUGA 2K27A 3MCZA 2G7HA 3U2RA 1FBUA 4UHTA 1GXPA 1ZGJA 2DFIA 3ISPA 4S04A 1U3EM 3F6VA 3KP4A 2CO5A 3WTWC 2QZ8A 4ZH4F 2VONA 4P9UA 2XROA 5AIQA 4LK0F 2VBYA 1P4WA 1G3TA 2E7XA 5CLSA 1G4DA 5LRSA 3FMQA 2PFBA 5F6FA 2Q8KA 1SD7A 2ETHA 1WKMA 1RIOH 2K4BA 5E8IA 4KDPA 4KNYA 1SFEA 1H9TA 2MLKA 2VOOA 2F5FA 2QWWA 1FP1D 2H27A 2H6BA 3CJNA 4R79A 2XAFA 2XKOA 2DU9A 4N9IA 1FWZA 3O2PE 2VOPA 2R7FA 3QPTA 4HBLA 1MJAA 3E5XA 1WQ2A 4OIOF 3FZVA 4Y13A 5ILUA 2J5PA 3V8LA 2L4MA 5D4RA 2ZNZA 3M8FA 1DPUA 2CGPA 3H92A 4RGSA 3WTXC 3KEQA 4L9VA 4D0PA 3WTTC 4KUMA 4CO8A 3E5QA 1BBYA 2WWYA 5DV5A 2Z33A 3TDUC 1FZPB 2VE8A 3LQRA 4M9SA 3WGHA 2RQPA 3LWFA 2GA1A 3FX3A 2DW4A 1H9GA 1T2KA 3HTUA 4RB2C 1G3SA 3HOSA 1OKRA 2OBPA 3RIRA 4HF1A 2YX4A 2OZUA 4AIJA 4R1HA 5L3DA 1XCVA 5HS7A 3IRQA 3IHUA 2QYOA 5ICGA 4OIQF 4KN4X 2HTSA 5ICFA 1ONVA 3LA2A 4LLLA 1CGPA 3GXOA 5D8LB 1G6NA 2VT2A 1USTA 3JAMZ 3RYPA 2QLZA 1L0OC 1V3FA 4XLPF 1OMIA 2A6HF 4EJVA 2HWVA 4AIKA 1IF1A 4HLYA 4HV6A 3GVAA 3C3WA 3M9AA 1W5TA 1SMTA 4LGWA 2HEOA 3GUDA 5DUIA 1BI3A 1KU2A 3CTAA 3DPTA 2QBYB 4MNUA 1EH8A 1RI7A 2XAGA 4RGUA 4LB6B 1Q1HA 3TO6A 1I1GA 3T0YA 3QRFF 1F9NA 3IL2A 3MWMA 3ULQB 1XCBA 5KK1A 3FXRA 2R7DA 3P7NA 4KMUX 3WU1B 2RN7A 4EJUA 3BROA 2ACJA 3QAHA 3H3UA 2V6CA 3RPQA 3W6JB 1HBXG 2D1VA 1ZGAA 2VBXA 4H0EA 2PI0A 2GAUA 3M7GA 1RUOA 4HX7A 2HYGD 3HSEA 3K1MA 5D4SA 1A04A 3V7SA 3R0JA 2CQKA 2M30A 1FBSA 1YIOA 2OQGA 3HIFA 4YIFA 5LHIA 1IN7A 5HLIA 1YYVA 3COAC 3FM3A 1XGMA 1UCRA 3KCCA 1BC7C 3KLNA 3R61A 1F5TA 1O3TA 2CG4A 2YU3A 3D5LA 4O3MA 4A6DA 3MZHA 5CVIA 3HSFA 4I02A 1FSEA 4I98B 5F1RA 1ZHFA 5HS8A 1S7AA 3BJ6A 4MTDA 4YIIA 5CVJA 1YW7A 3HRSA 2LKPA 4G6DA 4BAYA 3HYIA 3SXYA 4UUVA 1UFMA 4MEYF 4S05A 1BI1A 4ZZDA 3WE3A 4G6QA 3QP6A 4GYIA 2FF4A 1QPMA 3R0AA 2L02A 1YLFA 2W57A 3HOTA 4A0YA 3N97A 3VODA 4YFKF 2XAHA 3GW2A 2H6CA 3N4MA 5LEKA 1GHCA 1PUEE 4BHBA 2FXAA 1HKTA 1CF7B 3GEZA 4R8HA 3HTSB 4DQ2A 4WCGA 3E6MA 2RKHA 4IF4A 2CYYA 2ZMEA 4RAYA 2JSCA 1YG2A 3F3XA 3GF2A 1DPRA 2ADUA 4M6XA 4TV7A 1XGNA 5DD8A 3F8NA 2PEXA 2YPRA 1KQ0A 5H20A 1XN7A 2FU4A 2Y0MA 3S2WA 3ZMZA 1PDNC 3NQOA 3EUHA 4GGGA 1U6GA 1ZYRF 2HTJA 3GZ5A 5FFXA 1ZLKA 2HYFA 3BPXA 1B9NA 5CVVA 1S7OA 5HLHA 1LNWA 1TW2A 1IN4A 5A2QK 3LA7A 3WU0A 1STZA 2NNYA 3KP2A 5ICEA 4EJOA 4G7HF 2A69F 5TRDA 1RUNA 4U0YA 1TBXA 4EGYA 4RB1A 2EV0A 2ISYA 5E1ZB 1DP7P 4Z2YA 1Z1DA 2B0LA 3V7CA 5E8GA 2P4WA 2V1XA 3RJPA 2IT0A 1P4AA 1R00A 4LLNA 4I09A 5CVUA 2IA1A 2GXBA 5LEJA 1U5TC 3T8RA 4MQVA 2VT3A 2EFOA 4XLNF 5CVRA 2RGVA 2DK8A 6PAXA 1BN5A 4HOBA 2HQNA 5DYMA 3J81Z 2LSOA 1D5VA 5HDKA 4JK1X 3WGIA 1EH7A 4FT8A 5K5OA 2VE9A 2EB7A 3SQNA 1AOYA 4L5JA 5J8FA 3JTGA 4U0VA 4EQQA 5H6RA 2D2WA 3HRMA 3F6OA 3KETA 2H09A 1BJAA 2XUBA 5IT9K 4YFNF 3K69A 1XMKA 1J59A 4UXNA 3F8CA 4LB5A 1QZZA 3BY6A 4LFUA 2QM3A 3REOA 2P5VA 5FFZA 2EV5A 1LDKB 1HSTA 2HFHA 2FEZA 3Q9VA 1ZLJA 2TDXA 2EFPA 1T39A 4M74A 2XIGA 3OV8A 2IJLA 4ETSA 2M5WA 4L9NA 4PDKA 4OOIA 3I59B 3WE2A 4A5NA 3D0SA 3ROUA 2BE5F 4A2UA 4CHUA 4ESFA 3BOQA 2Z3YA 2FRHA 4Y17A 2XAJA 4KMFA 3L7WA 3IRRA 1IXCA 4PGHA 3L09A 4EM0B 4RAZA 1FBQA 5DCMB 1W4MA 5ICCA 4XSZF 4LG0B 2ZO4A 5E18F 1FYKA 2P8TA 3MFKA 3KZYA 1K78A 3TO9A 2IA2A 4WX9A 1R5GA 2FQ3A 3I0TA 1JHFA 2PJPA 3JSOA 3HRTA 5D5WB 2ZKZA 4IRHA 5D6EA 1HW1A 5BPIA 1IUYA 4G8XA 3JSPA 3GWZA 1R1VA 4G94A 3U1DA 1LVAA 5DD4A 3KE2A 4Q4ZF 2P6SA 2LF7A 4KT5C 1BIBA 3E97A 3ZQ7A 3LAJA 4Y15A 1H0MA 2K7LA 3Q5FA 2O8XA 2IW5A 2EWNA 3RKWA 3E3VA 5E20A 1ZARA 2ZJ2A 1HW2A 4Q48A 3F23A 2BV6A 4NHJA 3K9TA 3DQVC 2KRFA 4FHTA 1MJ9A 3TO7A 3G73A 1Z7UA 2YR2A 2MH9A 4ZYHA 3KLOA 2L54A 3SZPA 1KGSA 1MGTA 2NNNA 3C1DA 1O57A 3L00A 4YFXF 1KU9A 4WXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC2 A;  3PQJ A;  3B73 A;  4IVN A;  1R1U A;  4KFC A;  2MBF A;  2V9V A;  1T98 A;  5LGU A;  2K86 A;  4G9Y A;  4EJT A;  3DV8 A;  3TKY A;  2MA3 A;  1WSU A;  4NQW A;  1XDU A;  2PLY A;  4CZZ A;  2ZXJ A;  5ED4 A;  3ML6 A;  2EJR A;  2L4A A;  4IXA A;  3GFM A;  5FLX K;  1P6R A;  2IRF G;  2QEN A;  3E6D A;  1JXS A;  2Z5U A;  3LFK A;  2PMH A;  5CJ9 A;  3VOE A;  1R36 A;  4PZJ A;  4F7Z A;  3CUQ B;  2MH2 A;  3QP5 A;  1O3S A;  3HHH A;  4LK1 F;  1Z05 A;  4O6J A;  5BQT A;  4UVA A;  1IRG A;  3IKT A;  1XD7 A;  1FT9 A;  2R3S A;  2HZT A;  4OIN F;  1K78 B;  5ERI A;  2FNP A;  2VC0 A;  2JRT A;  2EA2 A;  1P92 A;  4HX8 A;  4ESB A;  2W25 A;  1XSX A;  1YFH A;  3I4P A;  4I01 A;  5AIP A;  2HDC A;  2G9W A;  2PQ8 A;  3KP5 A;  3PQK A;  3TOB A;  1J7K A;  1OR7 A;  1XMA A;  1KYZ A;  1ZRD A;  3SFZ A;  1R1T A;  4M72 A;  2FOK A;  2VOD A;  4L18 B;  5FD5 A;  4L9T A;  2Y48 A;  2M87 A;  2ZCW A;  3KZZ A;  4P55 A;  4GXO A;  2EFW A;  2KKO A;  4IHT A;  1LEA A;  1GVJ A;  2EK5 A;  1LDJ A;  2P7V B;  1TQM A;  3WOD F;  1YW9 A;  4MGR A;  2P5L C;  4GCV A;  4QWQ A;  5E1X A;  2QQA A;  5DCF A;  1IAW A;  3K2Z A;  4JQF A;  5H6Q A;  1S29 A;  1SFU A;  3FF5 A;  1W7P D;  2O61 A;  4RS8 A;  3ERE D;  3TQN A;  2ELH A;  1JHH A;  3HHG A;  5KVR A;  5D5X B;  3W6K B;  4B8X A;  5L3F A;  4EGZ A;  2E1C A;  1T6S A;  1O7F A;  4A0X A;  1X3U A;  2BYV E;  5D5U B;  2CSO A;  2RVC A;  2V1U A;  1UHM A;  2F2E A;  1O3R A;  3WGG A;  2AXL A;  1F4K A;  3RPU A;  2HS5 A;  2DO7 A;  4AD9 A;  1K79 A;  2E1N A;  4HX4 A;  4P9F A;  4HZF A;  1U78 A;  3RI4 A;  3GLX A;  2WV0 A;  2IPQ X;  5HLG A;  5E1W A;  1LEB A;  2HQR A;  2GA2 A;  3LST A;  2D1H A;  1IZ1 A;  3IC7 A;  5DUK A;  3FMS A;  5DDG A;  1WI9 A;  3DP7 A;  3NEU A;  5L3C A;  1XGO A;  3J80 Z;  4DNC A;  1KU7 A;  2F5E A;  3ZMU A;  1Z91 A;  4PGG A;  3RKX A;  1Z6T A;  5HOO A;  2FBK A;  4M9X A;  3MQ0 A;  5K5R A;  2O0Y A;  2W85 A;  4HF0 A;  4NB5 A;  4U7D A;  1RZ4 A;  2LDU A;  1W7P B;  3I71 A;  4EMS A;  1O7L A;  4ASN A;  4BHC A;  1OPC A;  3JTH A;  1IN6 A;  1ZRE A;  5BPD A;  4GYG A;  1ZRC A;  4E70 A;  2FA5 A;  4G7O F;  5BOX A;  2A68 F;  2XVC A;  3J7A O;  3VFZ A;  1LJ9 A;  4I0A A;  1OYY A;  4WWC A;  2W84 A;  2JTV A;  5LRR A;  2XGX A;  4BHP A;  2UXN A;  3ABT A;  3CO7 C;  3BJO A;  1ZAO A;  4KIF A;  3FM5 A;  1VTN C;  2XAS A;  1JGS A;  3BPV A;  1E17 A;  2XRN A;  2Z99 A;  1KA8 A;  3R6S A;  3DXJ F;  1REP C;  1YS7 A;  2VBZ A;  2ZNY A;  3O3K A;  2DQL A;  1B59 A;  1CF7 A;  2PG4 A;  1YTY A;  1IXS B;  1KQ8 A;  3DF8 A;  1ON2 A;  5IT3 A;  4Q5S F;  3GZ6 A;  1NHA A;  1R58 A;  1XB4 A;  3ELK A;  2A6E F;  1WRJ A;  4EVI A;  3J80 K;  2HKX A;  5A2Q Z;  1USS A;  4LJZ F;  3IWF A;  1OYI A;  4P5O A;  1I1S A;  1FX7 A;  4QLC U;  2IA0 A;  1S6L A;  2JPC A;  1TW3 A;  2FE3 A;  1FSH A;  1R5H A;  1TLH B;  2ZFW A;  3P9K A;  1B6A A;  1L3L A;  1S8N A;  1HKS A;  3M1E A;  3EQL F;  5FD6 A;  3GFL A;  3GX4 X;  1KYW A;  4KIB A;  2KJB A;  2XV4 S;  2ISZ A;  1MZB A;  1C0W A;  4M73 A;  5FO5 A;  2KIM A;  3O6B B;  1WWX A;  4O5V A;  2YX7 A;  5F64 A;  3K1P A;  4KA4 A;  3F8F A;  2DBB A;  3QU3 A;  2Q2E A;  4RB0 A;  1EH6 A;  2BEO A;  2DAO A;  2FBI A;  4L9J A;  1I5Z A;  3RKY A;  1J5Y A;  4I7H A;  3QPH A;  3GO5 A;  2DLL A;  3NRV A;  1LQ1 A;  3FWE A;  4EM2 A;  5JI6 A;  5L3E A;  2IP2 A;  4HLX A;  1FC3 A;  3RYR A;  4MHG A;  2M1B A;  4M71 A;  2O3F A;  3ZN1 A;  3DPL C;  1J75 A;  3MZY A;  2H94 A;  5CYV A;  5LBQ A;  3ZMS A;  3C18 A;  4LMY A;  4B09 A;  4XBF A;  5D8K B;  1ULY A;  4IPA A;  2DQR A;  3CUO A;  4RB3 C;  3P9I A;  3SZT A;  4A5M A;  1XSD A;  3HSR A;  1MKM A;  5DEQ A;  3GFJ A;  2CFX A;  4WK8 F;  5D6F A;  1W5S A;  1P4X A;  4WF2 A;  3I5U A;  1LDD A;  3ZPL A;  1U2W A;  4IHS A;  4FX4 A;  2GXG A;  3I53 A;  1IW7 F;  1FPQ A;  3EET A;  1SFX A;  1ZG5 A;  3ZMD A;  4BH9 A;  2DK5 A;  4ENN A;  2F5C A;  4I0B A;  5LHH A;  3R60 A;  3K1N A;  2C6Y A;  1FYM A;  1ZRF A;  3QOP A;  2UZK A;  2O03 A;  5LGT A;  2M45 A;  5JR3 A;  3TGN A;  2KJC A;  4UVC A;  1HW5 A;  1R23 A;  1QO0 D;  2FMY A;  5L3B A;  4UNO A;  1D8K A;  2G7U A;  1FP2 A;  3G3Z A;  3ZMV A;  1XSV A;  1JE8 A;  3F8M A;  1MD0 A;  2A3S A;  2GWR A;  3V7R A;  3ABU A;  5J8C A;  4AVP A;  3GFI A;  2VXZ A;  3R4K A;  1XDS A;  3WTZ A;  2IVM A;  4HDU A;  1I27 A;  2DT5 A;  5TJJ A;  1BIA A;  2EFQ A;  3LAP A;  4HDV A;  1K6O A;  3IWZ A;  1E2X A;  3RDI A;  2J5O A;  2UXX A;  2LNB A;  4ZYD A;  5HS9 A;  2ZBK A;  4K2E A;  3TDZ C;  3ECH A;  1ZH5 A;  4JBA A;  3BJA A;  2V1D A;  1FY7 A;  1HXD A;  1TTY A;  4OIR F;  4CIC A;  1TNS A;  2PBI A;  4LD5 A;  2HR3 A;  1BI0 A;  3CUQ C;  1J9I A;  2GZW A;  3ZP5 A;  5JFR A;  3IKV A;  3F22 A;  2XHK A;  2JT1 A;  1SAX A;  4UV9 A;  5E17 F;  3V8J A;  4L5I A;  3MEX A;  2OQR A;  1V4R A;  3KFW X;  2DI3 A;  2DTR A;  3T1B A;  3EYI A;  2GQQ A;  2OU2 A;  4U7B A;  2FSW A;  2K4J A;  2VN2 A;  4HW0 A;  1LB2 A;  1HKQ A;  2BGC A;  1YW8 A;  4BYY A;  1B1B A;  3TOA A;  4ENJ A;  2QQ9 A;  1MJB A;  1PP7 U;  3K0L A;  1U5T B;  2ESH A;  1ZG3 A;  1FOK A;  3KP7 A;  3T8T A;  3JW4 A;  4N9H A;  1SMY F;  2K02 A;  1SD5 A;  5J6X A;  1D8J A;  1UB9 A;  1FYL A;  2RDP A;  3I59 A;  5BMZ A;  3DFG A;  2EA4 A;  1Z6R A;  4XRF A;  5FB2 A;  2P7C B;  4MQ9 F;  4UV8 A;  2X4H A;  4OIP F;  4RGR A;  4GO1 A;  2PMU A;  3WTS C;  4ZZL A;  1D3Y A;  2A5Y B;  4A0Z A;  4BNC A;  2MLG A;  1ON1 A;  1TQP A;  1IN8 A;  2ZME B;  3WTY C;  3BZ6 A;  3RTR A;  4KIC A;  1F1Z A;  1GXQ A;  4WXC A;  4CDG A;  2HOE A;  2KIF A;  1IN5 A;  5JVT A;  4MEX F;  1IXR C;  1G3W A;  1P2F A;  2QQB A;  5DCM A;  5JHU A;  1T0F A;  4LG0 A;  2F5D A;  4CYD A;  3BWG A;  4HQE A;  3LQQ A;  4AIH A;  3DKW A;  3BP8 A;  2XKP A;  1ODD A;  2CWE A;  1QQI A;  2L01 A;  4AWX B;  1SD6 A;  4U88 A;  4Q47 A;  3KP6 A;  1TNT A;  3VEP A;  3E5U A;  4PCQ A;  3KEO A;  4ZYG A;  1J0R A;  3V4G A;  2DPD A;  1B9M A;  1Z9C A;  2HKO A;  2O6G E;  5EEG A;  3FXU A;  2EFN A;  2W24 A;  2QUF A;  1KU3 A;  1SD4 A;  4N0B A;  3MAJ A;  2OD5 A;  5L3G A;  1O3Q A;  3I58 A;  1BC8 C;  2YSR A;  3SHF A;  1R7J A;  1YQA A;  2Q0O A;  1HQC A;  5ILV A;  2QVO A;  5EEH A;  3AAF A;  1BM9 A;  2JPB A;  3I54 A;  2OA4 A;  2UWM A;  5ILS A;  2FBH A;  3I64 A;  4BQA A;  1I6X A;  4KYW A;  2LF8 A;  3F72 A;  3J81 K;  2AS5 F;  2Y75 A;  4CGZ A;  4ENM A;  3LA3 A;  2COM A;  3T5X A;  4IJA A;  1OYW A;  1IRF A;  2OAZ A;  1BI2 A;  4ENK A;  3JAM K;  2STW A;  2V79 A;  1S3J A;  5D5V B;  3CLO A;  4XSX F;  5FLX Z;  4KN7 X;  3EDP A;  3VB2 A;  3V8K A;  2PN6 A;  1B4A A;  1KQ9 A;  4IRG A;  2NRA C;  4ESJ A;  1XGS A;  4FX0 A;  3FXQ A;  2E7W A;  3HRU A;  5LLQ A;  5HDN A;  2EV6 A;  1J2X A;  2QBY A;  2MD5 A;  2JZY A;  1FLI A;  1G3Y A;  3GYH X;  4UVB A;  4HQM A;  2FML A;  1AWC A;  1RNL A;  2NS0 A;  1QGP A;  3FHZ A;  2CW0 F;  5BS6 A;  3E6C C;  5LHG A;  3CUQ A;  4YG2 F;  1QZY A;  4A12 A;  1Y0U A;  4I2O A;  2RV8 A;  3F8B A;  4KIG A;  1EV7 A;  5K1Y A;  2A61 A;  5K5Q A;  4EJW A;  2XAQ A;  1MDM B;  4P96 A;  4WXH A;  2ESN A;  2M8E A;  3M8E A;  2MC3 A;  1T38 A;  2HGC A;  3PFI A;  2P6T A;  1YS6 A;  4L0Z B;  4OU0 A;  3ECO A;  2RNJ A;  3CDH A;  1QBJ A;  4G7Z F;  1ZN2 A;  3BDD A;  5LGN A;  3QU6 A;  2VBW A;  3U9G A;  2KIU A;  2WTE A;  3CO6 C;  1W7P A;  1R22 A;  2BBY A;  1YO5 C;  5HDG A;  5HVQ C;  4M9Z A;  3H3Z A;  2DPU A;  1MDM A;  4CXF A;  4HYE A;  3WG9 A;  4HA8 A;  2X0L A;  4HV5 A;  1BOA A;  4HF2 A;  1HSJ A;  3Q9S A;  2STT A;  3E6B A;  2FNA A;  3FMR A;  1U5T A;  3C7J A;  3L2C A;  4EV0 A;  1UHW A;  2GIV A;  3B02 A;  1K7A A;  2NAZ A;  4U0W A;  1ZG1 A;  1PP8 F;  3DEU A;  3L9F A;  1DUX C;  4RGX A;  1QNT A;  3KP3 A;  4HAM A;  3WTU C;  2NYX A;  1FNN A;  1DDN A;  3ZN0 A;  4EM1 A;  4BXU A;  3F21 A;  4OMY A;  5FGM A;  4LLG F;  4MTE A;  2L3D A;  2OZ6 A;  1TQI A;  2P5K A;  4ZYE A;  3WTV C;  2A07 F;  2Z9O A;  4A6E A;  2RC4 A;  1U8R A;  3OOP A;  4ON0 A;  5IT9 Z;  4OMZ A;  4L0Y B;  3EYY A;  5AON A;  2D45 A;  3P9C A;  2VC1 A;  3ZMT A;  4IRI A;  4M6Y A;  3HUG A;  2K27 A;  3MCZ A;  2G7H A;  3U2R A;  1FBU A;  4UHT A;  1GXP A;  1ZGJ A;  2DFI A;  3ISP A;  4S04 A;  1U3E M;  3F6V A;  3KP4 A;  2CO5 A;  3WTW C;  2QZ8 A;  4ZH4 F;  2VON A;  4P9U A;  2XRO A;  5AIQ A;  4LK0 F;  2VBY A;  1P4W A;  1G3T A;  2E7X A;  5CLS A;  1G4D A;  5LRS A;  3FMQ A;  2PFB A;  5F6F A;  2Q8K A;  1SD7 A;  2ETH A;  1WKM A;  1RIO H;  2K4B A;  5E8I A;  4KDP A;  4KNY A;  1SFE A;  1H9T A;  2MLK A;  2VOO A;  2F5F A;  2QWW A;  1FP1 D;  2H27 A;  2H6B A;  3CJN A;  4R79 A;  2XAF A;  2XKO A;  2DU9 A;  4N9I A;  1FWZ A;  3O2P E;  2VOP A;  2R7F A;  3QPT A;  4HBL A;  1MJA A;  3E5X A;  1WQ2 A;  4OIO F;  3FZV A;  4Y13 A;  5ILU A;  2J5P A;  3V8L A;  2L4M A;  5D4R A;  2ZNZ A;  3M8F A;  1DPU A;  2CGP A;  3H92 A;  4RGS A;  3WTX C;  3KEQ A;  4L9V A;  4D0P A;  3WTT C;  4KUM A;  4CO8 A;  3E5Q A;  1BBY A;  2WWY A;  5DV5 A;  2Z33 A;  3TDU C;  1FZP B;  2VE8 A;  3LQR A;  4M9S A;  3WGH A;  2RQP A;  3LWF A;  2GA1 A;  3FX3 A;  2DW4 A;  1H9G A;  1T2K A;  3HTU A;  4RB2 C;  1G3S A;  3HOS A;  1OKR A;  2OBP A;  3RIR A;  4HF1 A;  2YX4 A;  2OZU A;  4AIJ A;  4R1H A;  5L3D A;  1XCV A;  5HS7 A;  3IRQ A;  3IHU A;  2QYO A;  5ICG A;  4OIQ F;  4KN4 X;  2HTS A;  5ICF A;  1ONV A;  3LA2 A;  4LLL A;  1CGP A;  3GXO A;  5D8L B;  1G6N A;  2VT2 A;  1UST A;  3JAM Z;  3RYP A;  2QLZ A;  1L0O C;  1V3F A;  4XLP F;  1OMI A;  2A6H F;  4EJV A;  2HWV A;  4AIK A;  1IF1 A;  4HLY A;  4HV6 A;  3GVA A;  3C3W A;  3M9A A;  1W5T A;  1SMT A;  4LGW A;  2HEO A;  3GUD A;  5DUI A;  1BI3 A;  1KU2 A;  3CTA A;  3DPT A;  2QBY B;  4MNU A;  1EH8 A;  1RI7 A;  2XAG A;  4RGU A;  4LB6 B;  1Q1H A;  3TO6 A;  1I1G A;  3T0Y A;  3QRF F;  1F9N A;  3IL2 A;  3MWM A;  3ULQ B;  1XCB A;  5KK1 A;  3FXR A;  2R7D A;  3P7N A;  4KMU X;  3WU1 B;  2RN7 A;  4EJU A;  3BRO A;  2ACJ A;  3QAH A;  3H3U A;  2V6C A;  3RPQ A;  3W6J B;  1HBX G;  2D1V A;  1ZGA A;  2VBX A;  4H0E A;  2PI0 A;  2GAU A;  3M7G A;  1RUO A;  4HX7 A;  2HYG D;  3HSE A;  3K1M A;  5D4S A;  1A04 A;  3V7S A;  3R0J A;  2CQK A;  2M30 A;  1FBS A;  1YIO A;  2OQG A;  3HIF A;  4YIF A;  5LHI A;  1IN7 A;  5HLI A;  1YYV A;  3COA C;  3FM3 A;  1XGM A;  1UCR A;  3KCC A;  1BC7 C;  3KLN A;  3R61 A;  1F5T A;  1O3T A;  2CG4 A;  2YU3 A;  3D5L A;  4O3M A;  4A6D A;  3MZH A;  5CVI A;  3HSF A;  4I02 A;  1FSE A;  4I98 B;  5F1R A;  1ZHF A;  5HS8 A;  1S7A A;  3BJ6 A;  4MTD A;  4YII A;  5CVJ A;  1YW7 A;  3HRS A;  2LKP A;  4G6D A;  4BAY A;  3HYI A;  3SXY A;  4UUV A;  1UFM A;  4MEY F;  4S05 A;  1BI1 A;  4ZZD A;  3WE3 A;  4G6Q A;  3QP6 A;  4GYI A;  2FF4 A;  1QPM A;  3R0A A;  2L02 A;  1YLF A;  2W57 A;  3HOT A;  4A0Y A;  3N97 A;  3VOD A;  4YFK F;  2XAH A;  3GW2 A;  2H6C A;  3N4M A;  5LEK A;  1GHC A;  1PUE E;  4BHB A;  2FXA A;  1HKT A;  1CF7 B;  3GEZ A;  4R8H A;  3HTS B;  4DQ2 A;  4WCG A;  3E6M A;  2RKH A;  4IF4 A;  2CYY A;  2ZME A;  4RAY A;  2JSC A;  1YG2 A;  3F3X A;  3GF2 A;  1DPR A;  2ADU A;  4M6X A;  4TV7 A;  1XGN A;  5DD8 A;  3F8N A;  2PEX A;  2YPR A;  1KQ0 A;  5H20 A;  1XN7 A;  2FU4 A;  2Y0M A;  3S2W A;  3ZMZ A;  1PDN C;  3NQO A;  3EUH A;  4GGG A;  1U6G A;  1ZYR F;  2HTJ A;  3GZ5 A;  5FFX A;  1ZLK A;  2HYF A;  3BPX A;  1B9N A;  5CVV A;  1S7O A;  5HLH A;  1LNW A;  1TW2 A;  1IN4 A;  5A2Q K;  3LA7 A;  3WU0 A;  1STZ A;  2NNY A;  3KP2 A;  5ICE A;  4EJO A;  4G7H F;  2A69 F;  5TRD A;  1RUN A;  4U0Y A;  1TBX A;  4EGY A;  4RB1 A;  2EV0 A;  2ISY A;  5E1Z B;  1DP7 P;  4Z2Y A;  1Z1D A;  2B0L A;  3V7C A;  5E8G A;  2P4W A;  2V1X A;  3RJP A;  2IT0 A;  1P4A A;  1R00 A;  4LLN A;  4I09 A;  5CVU A;  2IA1 A;  2GXB A;  5LEJ A;  1U5T C;  3T8R A;  4MQV A;  2VT3 A;  2EFO A;  4XLN F;  5CVR A;  2RGV A;  2DK8 A;  6PAX A;  1BN5 A;  4HOB A;  2HQN A;  5DYM A;  3J81 Z;  2LSO A;  1D5V A;  5HDK A;  4JK1 X;  3WGI A;  1EH7 A;  4FT8 A;  5K5O A;  2VE9 A;  2EB7 A;  3SQN A;  1AOY A;  4L5J A;  5J8F A;  3JTG A;  4U0V A;  4EQQ A;  5H6R A;  2D2W A;  3HRM A;  3F6O A;  3KET A;  2H09 A;  1BJA A;  2XUB A;  5IT9 K;  4YFN F;  3K69 A;  1XMK A;  1J59 A;  4UXN A;  3F8C A;  4LB5 A;  1QZZ A;  3BY6 A;  4LFU A;  2QM3 A;  3REO A;  2P5V A;  5FFZ A;  2EV5 A;  1LDK B;  1HST A;  2HFH A;  2FEZ A;  3Q9V A;  1ZLJ A;  2TDX A;  2EFP A;  1T39 A;  4M74 A;  2XIG A;  3OV8 A;  2IJL A;  4ETS A;  2M5W A;  4L9N A;  4PDK A;  4OOI A;  3I59 B;  3WE2 A;  4A5N A;  3D0S A;  3ROU A;  2BE5 F;  4A2U A;  4CHU A;  4ESF A;  3BOQ A;  2Z3Y A;  2FRH A;  4Y17 A;  2XAJ A;  4KMF A;  3L7W A;  3IRR A;  1IXC A;  4PGH A;  3L09 A;  4EM0 B;  4RAZ A;  1FBQ A;  5DCM B;  1W4M A;  5ICC A;  4XSZ F;  4LG0 B;  2ZO4 A;  5E18 F;  1FYK A;  2P8T A;  3MFK A;  3KZY A;  1K78 A;  3TO9 A;  2IA2 A;  4WX9 A;  1R5G A;  2FQ3 A;  3I0T A;  1JHF A;  2PJP A;  3JSO A;  3HRT A;  5D5W B;  2ZKZ A;  4IRH A;  5D6E A;  1HW1 A;  5BPI A;  1IUY A;  4G8X A;  3JSP A;  3GWZ A;  1R1V A;  4G94 A;  3U1D A;  1LVA A;  5DD4 A;  3KE2 A;  4Q4Z F;  2P6S A;  2LF7 A;  4KT5 C;  1BIB A;  3E97 A;  3ZQ7 A;  3LAJ A;  4Y15 A;  1H0M A;  2K7L A;  3Q5F A;  2O8X A;  2IW5 A;  2EWN A;  3RKW A;  3E3V A;  5E20 A;  1ZAR A;  2ZJ2 A;  1HW2 A;  4Q48 A;  3F23 A;  2BV6 A;  4NHJ A;  3K9T A;  3DQV C;  2KRF A;  4FHT A;  1MJ9 A;  3TO7 A;  3G73 A;  1Z7U A;  2YR2 A;  2MH9 A;  4ZYH A;  3KLO A;  2L54 A;  3SZP A;  1KGS A;  1MGT A;  2NNN A;  3C1D A;  1O57 A;  3L00 A;  4YFX F;  1KU9 A;  4WXD A; 
#chains in the Genus database with same CATH topology
 2VQH A;  2WC2 A;  3PQJ A;  3JR9 A;  3B73 A;  4IVN A;  4BJ6 C;  4ANJ A;  1R1U A;  4KFC A;  2MBF A;  2CW7 A;  2V9V A;  3HOW J;  1T98 A;  5LGU A;  4XN3 A;  2K86 A;  4G9Y A;  1GV2 A;  3K6G A;  1JUS A;  1V54 H;  2E1M C;  3OOU A;  4C2M J;  2L7Z A;  1VQ7 I;  1XC5 A;  3I3L A;  4EJT A;  1YHQ I;  3DV8 A;  3TKY A;  2MA3 A;  1WSU A;  1H88 C;  4NQW A;  1XDU A;  4E7I A;  2MYS A;  2R7R A;  4BAC A;  1Z67 A;  4XR6 A;  2PLY A;  3KIO A;  3SEZ A;  4CZZ A;  2ZXJ A;  4PJ0 C;  5ED4 A;  1SAU A;  3ML6 A;  2EJR A;  2L4A A;  4IXA A;  4NUB A;  2Z2S B;  3K4C A;  3OYA A;  3GFM A;  4XLF A;  4PJN A;  4XKC A;  5BNG A;  5FLX K;  1P6R A;  2IRF G;  2QEN A;  3LL7 A;  3E6D A;  1JGG A;  1JXS A;  2ZJP F;  2Z5U A;  3EPZ A;  2PMH A;  3LFK A;  5CJ9 A;  2ME6 A;  3VOE A;  1R36 A;  4PZJ A;  1ERD A;  3PUB A;  2DA2 A;  2E5Z A;  4HPQ A;  4F7Z A;  1GLN A;  1A31 A;  2E60 A;  2BW3 B;  4B44 A;  3CUQ B;  1R6R A;  2JK3 A;  2DMQ A;  2MH2 A;  4X1E A;  3QP5 A;  2DT6 A;  3WU2 C;  1O4X A;  1O3S A;  1IV6 A;  5EG0 B;  3HHH A;  3K2A A;  4LK1 F;  1Z05 A;  1ZTR A;  4O6J A;  2M9H A;  4XON A;  4MFD A;  5BQT A;  4UVA A;  4BUP A;  1OCT C;  2ME0 A;  1FEX A;  5KAF C;  1IRG A;  1Y8R B;  2CQX A;  1BOB A;  3IKT A;  1XD7 A;  2Y9Y A;  4M3G A;  3LSM A;  1FT9 A;  1PUF B;  2LD5 A;  2R3S A;  2HZT A;  2CRG A;  4OIN F;  3FK6 A;  1OJL A;  1GT0 C;  1K78 B;  1XS9 A;  1YX3 A;  5ERI A;  2CV1 A;  2FNP A;  2FX0 A;  2VC0 A;  1T33 A;  2EA2 A;  2JRT A;  2XPU A;  3FXK A;  1P92 A;  4HX8 A;  4ESB A;  2W25 A;  2XF5 A;  1XSX A;  3AKZ A;  3LOC A;  2X48 A;  3RSN A;  1YFH A;  4I76 A;  3I4P A;  4B48 A;  4A3B J;  4I01 A;  1OCR H;  5IP7 J;  3CCS I;  5AIP A;  2HDC A;  3DLL F;  2G9W A;  2PQ8 A;  1PYV A;  3KP5 A;  5IY5 H;  3A01 A;  4AU7 A;  3PQK A;  4YEL A;  3TOB A;  1J7K A;  1OR7 A;  1XMA A;  1OCO H;  1KYZ A;  4E7K A;  1ZRD A;  1EKE A;  1VQ5 I;  4BXX J;  3SFZ A;  1RR8 C;  1RRJ A;  1R1T A;  4KIS A;  4IOA F;  4M72 A;  1CQT A;  2FOK A;  4PFO A;  3QOE A;  3BZC A;  1TL8 A;  1H89 C;  2IEK A;  2XF7 A;  2VOD A;  4L18 B;  1IDY A;  5FD5 A;  4L9T A;  2KQR A;  2Y48 A;  2M87 A;  3V42 A;  2ZCW A;  2BXY A;  4CUG A;  3KZZ A;  4P55 A;  1VI0 A;  2VKH A;  2VJJ A;  3EUA A;  4GXO A;  2R7Z J;  2Z1D A;  2EFW A;  3CQZ J;  2KKO A;  1T56 A;  2X85 A;  2FQ4 A;  2LK2 A;  4IHT A;  3QPS A;  3A03 A;  4J01 A;  2XF6 A;  2Y9Z A;  1LEA A;  2CQ7 A;  3L2R A;  1GVJ A;  2EK5 A;  1JJ8 C;  1RET A;  2JJ7 A;  4FAS D;  1LDJ A;  1D1C A;  4C9Y A;  4LIV A;  2FJ1 A;  3HKZ A;  2P7V B;  1TQM A;  2L5Q A;  3WOD F;  4QSH A;  5K7F A;  1YW9 A;  5HLT A;  2LC2 A;  4CA0 A;  4MGR A;  1PVE A;  2VQG A;  1R5I D;  1NTC A;  2P5L C;  3U21 A;  3OS1 A;  3HGY A;  4GCV A;  4QWQ A;  1VQ6 I;  1Z77 A;  3SZG A;  2ID3 A;  1IRX A;  5E1X A;  2QQA A;  3A02 A;  5LFA A;  5DCF A;  1IAW A;  3K2Z A;  1ETW A;  4JQF A;  5H6Q A;  4UUS B;  3BC8 A;  1S29 A;  1SFU A;  2K3P A;  4XOT A;  5EZH A;  3FF5 A;  1W7P D;  2JMW A;  4IHX A;  2O61 A;  4RS8 A;  3ERE D;  2JVG A;  4NC7 A;  3HBL A;  3TQN A;  2ELH A;  3RZO J;  1MND A;  1JHH A;  3HHG A;  5KVR A;  5D5X B;  3W6K B;  4BY1 J;  3CF5 F;  4B8X A;  2DMT A;  5L3F A;  4EGZ A;  2E1C A;  1T6S A;  4B43 A;  3I55 I;  1O7F A;  2NS7 A;  4A0X A;  4DBR A;  2RQQ A;  1X3U A;  2BYV E;  5D5U B;  2CSO A;  2RVC A;  3JRG A;  2V1U A;  1UHM A;  2F2E A;  3PUF A;  1O3R A;  3PNY A;  2AO9 A;  2M0M A;  3WGG A;  4DW6 A;  1DP3 A;  4IO9 F;  4AYB A;  2AXL A;  3E0J B;  1F4K A;  3RPU A;  2HS5 A;  2DO7 A;  2DT7 B;  4AD9 A;  3JRC A;  1K79 A;  2E1N A;  3FKJ A;  4E7L A;  1T95 A;  1YX5 A;  4HX4 A;  3L2U A;  3ZQC A;  2Q2E B;  2CUJ A;  4P9F A;  4HZF A;  2IAI A;  2DMP A;  1U78 A;  1Y1W J;  4RMN A;  1BR1 A;  3RI4 A;  1VQP I;  4XMY A;  2CUF A;  1JT6 A;  3GLX A;  2WV0 A;  2IPQ X;  5HLG A;  5E1W A;  2JA7 J;  2R0Q C;  1LEB A;  1IDZ A;  2HQR A;  3NWS A;  4C2U A;  2GA2 A;  3LST A;  2D1H A;  1FOW A;  1IZ1 A;  2KT0 A;  3IC7 A;  5DUK A;  3SDG A;  1W36 C;  1MBE A;  3MKW B;  3H3V K;  3FMS A;  4HST A;  5DDG A;  1WI9 A;  3DP7 A;  3FXO A;  3NEU A;  3OWT A;  3GTM J;  5L3C A;  4JP0 A;  1XGO A;  3J80 Z;  4DNC A;  1KU7 A;  2HVS A;  2F5E A;  3FHN A;  3ZMU A;  1Z91 A;  3CZ6 A;  4PGG A;  1EF4 A;  3RKX A;  1Z6T A;  5HOO A;  3HJE A;  2FBK A;  3S15 J;  1ZEL A;  3A2K A;  4M9X A;  3MQ0 A;  2ELJ A;  5K5R A;  2GXA A;  2M7A A;  2O0Y A;  4NQW B;  2W85 A;  4HF0 A;  5J1U A;  4NB5 A;  1SFO J;  2L0K A;  4U7D A;  4E7Z A;  2H1K A;  1RZ4 A;  1RPW A;  2LDU A;  1W7P B;  3I71 A;  4EMS A;  1AU7 A;  1O7L A;  4ASN A;  4BHC A;  2E71 A;  2LY2 A;  3JRI A;  1OPC A;  1ETX A;  1IN6 A;  3JTH A;  2OJE D;  2KHM A;  4Y4R A;  1E3O C;  5BPD A;  1ZRE A;  4GYG A;  4OWR B;  1ZRC A;  2DOD A;  4E70 A;  4DYR A;  2FA5 A;  1TWF J;  3BQZ A;  4G7O F;  2NVY J;  5IYC J;  5BOX A;  4PJJ A;  2A68 F;  1MNE A;  4DZJ A;  3DU5 A;  4J00 A;  2XVC A;  4A3G J;  3J7A O;  3VFZ A;  1BJZ A;  1LJ9 A;  4I0A A;  1OYY A;  4WWC A;  2KFD A;  2V26 A;  2W84 A;  2JTV A;  4A93 J;  3N05 A;  1H8A C;  5KCM A;  3S14 J;  5LRR A;  2R7T A;  2XGX A;  4BHP A;  2R7X A;  2UXN A;  3ABT A;  4QTR A;  3CO7 C;  1AA7 A;  2Y0S N;  3GCM A;  4BL0 B;  3BJO A;  2X1D A;  3GTK J;  3KX2 A;  2R7Q A;  1ZAO A;  2CH0 A;  1RC9 A;  1VQO I;  3GLL A;  4KIF A;  3FM5 A;  1VTN C;  1MBJ A;  2XAS A;  3BCA A;  1JGS A;  3BPV A;  1E17 A;  2EIJ H;  2XRN A;  2Z99 A;  1KA8 A;  3R6S A;  3DXJ F;  1REP C;  1YS7 A;  1ZKG A;  2R7S A;  5CQG A;  2VBZ A;  2ZNY A;  3O3K A;  1BR4 A;  3FDY A;  2DQL A;  5FRM A;  2JVH A;  1B59 A;  3Q0U A;  1CF7 A;  2PG4 A;  1HDP A;  3ERM A;  2QSG X;  1YTY A;  4V2G A;  1IXS B;  1KQ8 A;  3DF8 A;  1BW5 A;  1ON2 A;  5GPA A;  2BY0 A;  5IT3 A;  1VQK I;  4Q5S F;  1VQ9 I;  3DEE A;  3GZ6 A;  1NHA A;  1R58 A;  1XB4 A;  3ELK A;  3H9Q A;  4DOZ A;  2A6E F;  2X9D A;  1WRJ A;  4EVI A;  3J80 K;  2HKX A;  4BGD A;  5A2Q Z;  1USS A;  3LSR A;  2R92 J;  3OYD A;  1SC7 A;  1RR7 A;  4LJZ F;  4U87 A;  3IWF A;  1OYI A;  1N25 A;  4P5O A;  3K4M A;  1I1S A;  1FX7 A;  2XPV A;  4QLC U;  1FOX A;  2IA0 A;  1S6L A;  3GZN B;  3IAM 2;  2JPC A;  1YIJ I;  1TW3 A;  2FE3 A;  1FSH A;  1R5H A;  3OSF A;  1TLH B;  2ZFW A;  3P9K A;  3AG3 H;  1B6A A;  1OCC H;  1L3L A;  3H0D A;  1JJ6 C;  3L2V A;  1YJW I;  2LBF A;  1S8N A;  3RKQ A;  1HKS A;  1LE8 A;  3M1E A;  4CCM A;  3EQL F;  5FD6 A;  5IYD J;  3GFL A;  3GX4 X;  1KYW A;  2RAE A;  4KIB A;  2KJB A;  2XV4 S;  3H5R A;  2E1M B;  3O8G A;  2V7F A;  3FXM A;  2ISZ A;  1K4T A;  1MZB A;  1C0W A;  4M73 A;  5F1J A;  1Z3X A;  5FO5 A;  1QRY A;  3BR6 A;  4BKX A;  2KIM A;  3O6B B;  4J19 A;  4KT6 A;  1WWX A;  4GDF A;  2DA3 A;  3AG4 H;  4O5V A;  2YX7 A;  5F64 A;  3LSG A;  3K1P A;  3NWT A;  4KA4 A;  3F8F A;  2DBB A;  1WGX A;  3QU3 A;  1SFK A;  2KIS A;  1R49 A;  2WY7 Q;  2Q2E A;  1IJW C;  1XTA A;  3DBR B;  4RB0 A;  2QGU A;  2NXN B;  1EH6 A;  3HPG A;  3HDD A;  2BEO A;  2DAO A;  2FBI A;  1PUF A;  3BG3 A;  4L9J A;  4D9J A;  1G59 A;  1I5Z A;  3RKY A;  1J5Y A;  5J4V A;  3UR3 C;  2NVX J;  1TT5 B;  4I7H A;  3J7Y J;  4E4H A;  3QPH A;  3GO5 A;  2G0E A;  2DLL A;  2VB6 A;  3UKG A;  3BZK A;  3OYG A;  2OCC H;  3G1O A;  3NRV A;  1LQ1 A;  3BG9 A;  3FWE A;  4QIW N;  4EM2 A;  5JI6 A;  4XKB A;  2DCE A;  1Y0N A;  2IP2 A;  4HLX A;  5L3E A;  1FC3 A;  3RYR A;  2EIN H;  2NOG A;  3IP4 B;  4MHG A;  1I3A A;  2M1B A;  4M71 A;  3S8P A;  2O3F A;  3BLY A;  3ZN1 A;  3DPL C;  1J75 A;  3MZY A;  4AC0 A;  2DTZ A;  2H94 A;  2LRE A;  3TW6 A;  5CYV A;  4AYB N;  5LBQ A;  3ZMS A;  2DMU A;  4RBO A;  3C18 A;  1K61 A;  4LMY A;  4B09 A;  4XBF A;  5F08 A;  1WH7 A;  5D8K B;  1ULY A;  3BT9 A;  1D1A A;  4IPA A;  2DQR A;  2X1E A;  3CUO A;  4RB3 C;  3P9I A;  3SZT A;  4A5M A;  1XSD A;  3C2H A;  3HSR A;  1MKM A;  1UG2 A;  3CDL A;  5DEQ A;  3GFJ A;  2CFX A;  3VSL A;  4JX4 A;  4WK8 F;  5D6F A;  4C3H J;  1NK3 P;  1W5S A;  1P4X A;  4AUX A;  2NVQ J;  2V1N A;  4WF2 A;  2ZXH A;  4QPO A;  3I5U A;  1LDD A;  3ZPL A;  2L9R A;  3DPU A;  1U2W A;  4IHS A;  4FX4 A;  1V55 H;  2GXG A;  1MH3 A;  3I53 A;  1IW7 F;  2I10 A;  1FPQ A;  3EET A;  1SFX A;  4A3K J;  2CU7 A;  2E2J J;  1ZG5 A;  2DA4 A;  5GAH J;  2E5N A;  3ZMD A;  1X4O A;  4BH9 A;  2EZI A;  3OYB A;  1W0U A;  2BOL A;  2DK5 A;  4ENN A;  3RZD J;  1ZK8 A;  1T08 B;  2F5C A;  4LIT A;  4I0B A;  3HOZ J;  5LHH A;  2EIL H;  3R60 A;  3K1N A;  2C6Y A;  1FYM A;  1ZRF A;  3QOP A;  3VSK A;  2O03 A;  2UZK A;  5LGT A;  2M45 A;  1BA5 A;  2Z16 A;  5JR3 A;  2W1O A;  1VFC A;  1P7J A;  2E34 A;  3CP8 A;  2Y31 A;  3DKX A;  3TGN A;  4V19 K;  4CZC A;  2KJC A;  3BR2 A;  4UVC A;  1N77 A;  1Z3Y A;  1HW5 A;  1R23 A;  1QO0 D;  2F48 A;  2FMY A;  2X6Y A;  5L3B A;  3CCU I;  3LNQ A;  4UNO A;  3ZQH A;  1D8K A;  2G7U A;  1FP2 A;  3G3Z A;  3ZMV A;  1XSV A;  1JE8 A;  1TWA J;  3F8M A;  5C3E J;  1MD0 A;  2A3S A;  2GWR A;  3V7R A;  3ABU A;  5J8C A;  3ABM H;  3FIW A;  4AVP A;  3GFI A;  1R4N B;  4CSW A;  3OMY A;  2VXZ A;  3R4K A;  1XDS A;  3DEW A;  3WTZ A;  2QF7 A;  2IVM A;  4HDU A;  1E3H A;  1I27 A;  1VZ0 A;  2EZL A;  3HM5 A;  2EBI A;  5FKL A;  2DT5 A;  5TJJ A;  3CES A;  5IP6 A;  1BIA A;  2F4I A;  3LSK A;  2EFQ A;  2R5Y A;  5C4J J;  3LAP A;  3VDX A;  4HDV A;  3IWZ A;  1K6O A;  3M4O J;  1E2X A;  2OC6 A;  3RDI A;  2J5O A;  2UXX A;  2O7O A;  2LNB A;  4ZYD A;  5HS9 A;  1WFX A;  2ZBK A;  4K2E A;  3TDZ C;  4XRS G;  4Y7N J;  2XRL A;  3ECH A;  3CMY A;  1ZH5 A;  2Y0S A;  4JBA A;  3BJA A;  1NK2 P;  2V1D A;  1FY7 A;  4ZTJ A;  4IEJ A;  1HXD A;  1G8X A;  4H4K C;  1TTY A;  4DBQ A;  1E3P A;  4OIR F;  3G4S I;  3CMM A;  1TNS A;  4CIC A;  5DS9 A;  2PBI A;  4LD5 A;  2HR3 A;  1BI0 A;  3CUQ C;  1J9I A;  2GZW A;  3ZP5 A;  5JFR A;  4X6A J;  2LKX A;  3IKV A;  3F22 A;  2GLO A;  2XHK A;  2VL8 A;  2JT1 A;  4NC6 A;  1SAX A;  4UV9 A;  5K7H A;  5E17 F;  3V8J A;  4L5I A;  3MEX A;  2OQR A;  1V4R A;  3KFW X;  4PFP A;  2DI3 A;  2MAB A;  2DTR A;  3T1B A;  2WAE A;  3VYR B;  2R7V A;  3EYI A;  2COB A;  4M3B A;  2GQQ A;  2KDO A;  2OU2 A;  1OQY A;  3CCE I;  1A36 A;  4U7B A;  2FSW A;  3I9V 2;  2K4J A;  2R5Z B;  2VN2 A;  2DFF A;  4HW0 A;  1LB2 A;  1HKQ A;  2BGC A;  1YW8 A;  4BYY A;  1K4S A;  1B1B A;  3TOA A;  4ENJ A;  1V5F A;  1WJE A;  2QQ9 A;  3OYI A;  3MVP A;  4UUT A;  2L7M P;  1MJB A;  2K9M A;  2VJ4 A;  4XRS A;  5EEA A;  1PP7 U;  3K0L A;  1U5T B;  2ESH A;  5GP9 A;  1ZG3 A;  5TGT A;  1FOK A;  3KP7 A;  3LSI A;  2WY8 Q;  3T8T A;  3JW4 A;  3D5S C;  4N9H A;  1SMY F;  2K02 A;  5J1R A;  4N4N B;  1SD5 A;  5J6X A;  1D8J A;  5DM6 F;  2F4M B;  1UB9 A;  9ANT A;  1FYL A;  2RDP A;  3M07 A;  3I59 A;  5BMZ A;  3K4J A;  4BQQ A;  3DFG A;  2EA4 A;  1X1D A;  1Z6R A;  4N4O B;  4XRF A;  3RPU D;  5FB2 A;  2P7C B;  4MQ9 F;  3OYE A;  5EGO A;  4UV8 A;  5M5W J;  1VND A;  2WBM A;  5F0F A;  3M8J A;  3AL0 B;  2X4H A;  4OIP F;  1WJF A;  4RGR A;  4GO1 A;  2PMU A;  3WTS C;  4ZZL A;  3MD2 A;  1D3Y A;  2A5Y B;  2LMD A;  4XLA A;  4A0Z A;  4BNC A;  2MLG A;  3OIO A;  1ON1 A;  1TQP A;  2CS3 A;  4XKV A;  3U1K A;  1IN8 A;  2ZME B;  3WTY C;  1QPI A;  5GAD J;  3BZ6 A;  3RTR A;  4KIC A;  1F1Z A;  3HL2 A;  3VYU B;  1LE8 B;  3HOV J;  2DOE A;  2KP6 A;  1WH5 A;  2N8G A;  1Y1V J;  2UUZ A;  2HDW A;  1GXQ A;  2CV0 A;  3LSH A;  4WXC A;  3ZQQ A;  4CDG A;  2FUG 2;  3ZQI A;  2HOE A;  2KIF A;  1IN5 A;  5JVT A;  3MKZ A;  1IXR C;  4MEX F;  1E0E A;  1G3W A;  3OL3 A;  1P2F A;  2ZME C;  2QQB A;  2ZFU A;  1MIJ A;  5DCM A;  3M1C A;  2HVR A;  5JHU A;  4BEH B;  4X0G A;  2MG4 A;  5TIS C;  1T0F A;  3CDI A;  4LG0 A;  4A3E J;  3C2B A;  2LVS A;  1Q1V A;  2F5D A;  4CYD A;  2KRH A;  3BWG A;  4HQE A;  3LQQ A;  4AIH A;  3DTE A;  2MD0 A;  3BP8 A;  3DKW A;  2XKP A;  1ODD A;  2CWE A;  1QQI A;  4G12 A;  2F6C A;  2L01 A;  4AWX B;  1SD6 A;  1I39 A;  4U88 A;  4Q47 A;  3KP6 A;  1TNT A;  3CJQ B;  2EQR A;  1WI3 A;  2HQ5 A;  3VEP A;  2WB1 A;  4RLQ A;  3IH2 A;  3E5U A;  4PCQ A;  3KEO A;  4RAG A;  4ZYG A;  4JX5 A;  3PIO F;  1ZR2 A;  1J0R A;  3V4G A;  4XLH A;  2B63 J;  1K83 J;  2DPD A;  1B9M A;  4FET A;  2HKO A;  5F0C A;  2CMP A;  1Z9C A;  2O6G E;  2X51 A;  5EEG A;  4PUS A;  3FXU A;  3L2Q A;  1WZ2 A;  4II3 A;  3OR2 C;  2XSJ C;  2EFN A;  2W24 A;  2QUF A;  1JTY A;  2K9Q A;  3DCF A;  1KU3 A;  1VQ8 I;  1SD4 A;  3FKI J;  4N0B A;  1T0F C;  2JUC A;  3MAJ A;  2OD5 A;  5L3G A;  1LUJ B;  3RQ4 A;  4BDZ A;  2CQQ A;  4RLF A;  1O3Q A;  3I58 A;  1BC8 C;  2YSR A;  3SHF A;  2GBY A;  1MNM C;  1R7J A;  3OIP A;  3CCR I;  3W2A A;  3VYT B;  1YQA A;  1VQN I;  2Q0O A;  1HQC A;  5ILV A;  2NS8 A;  2QVO A;  1LPQ A;  5EEH A;  3K4N A;  3AAF A;  1MBK A;  1BM9 A;  2CFO A;  2M34 A;  2JPB A;  3I54 A;  2OA4 A;  3PFY A;  1D5Y A;  2UWM A;  5ILS A;  5FLM J;  4M3D A;  2FBH A;  4CH7 A;  3A01 B;  3I64 A;  2XB5 A;  1I6X A;  4BQA A;  4KYW A;  2XSD C;  2LF8 A;  3F72 A;  1Y39 A;  1IO2 A;  2V9K A;  1ETO A;  1HA8 A;  4XOP A;  4NNJ A;  3G71 I;  5K7Z A;  1UAA A;  3J81 K;  5CQE A;  2M7B A;  2AS5 F;  2OF7 A;  2Y75 A;  5JVG F;  1GV5 A;  2QSH X;  4CGZ A;  4ENM A;  5JHF A;  4FQG A;  3LA3 A;  2COM A;  3T5X A;  4IJA A;  1OYW A;  1IRF A;  1YE9 A;  3SEQ A;  4ZC3 A;  1D0X A;  2OAZ A;  1BI2 A;  4ENK A;  2E1O A;  3JAM K;  2STW A;  2V79 A;  4CYC B;  3OYN A;  4I99 C;  1S3J A;  2XGE A;  5D5V B;  3OS0 A;  1N75 A;  3EUK L;  1RES A;  3CLO A;  4XSX F;  1FTZ A;  3A4C A;  5FLX Z;  4CCJ A;  3JRH A;  2H8R A;  5KNL A;  4DIQ A;  1SEU A;  4KN7 X;  5FKO A;  3EDP A;  3VB2 A;  3BTI A;  3K70 D;  3V8K A;  2PN6 A;  1B4A A;  1KQ9 A;  4IRG A;  2NRA C;  2ZC2 A;  4ESJ A;  1XGS A;  3ZQG A;  4IOC F;  1K6Y A;  4FX0 A;  1IGN A;  3FXQ A;  5F0H A;  5HNF A;  5EGO B;  3OSG A;  2E7W A;  2E35 A;  3HRU A;  5LLQ A;  2EZH A;  2EV6 A;  5HDN A;  3S16 J;  1J2X A;  2QBY A;  2R7W A;  3CLQ A;  2MD5 A;  3AG2 H;  2JZY A;  1FLI A;  1G3Y A;  3GYH X;  4UVB A;  5LD2 C;  4HQM A;  4XOR A;  2FML A;  1AWC A;  2DA1 A;  3CC4 I;  2NVU B;  3S3N A;  1RNL A;  2NS0 A;  1TZL A;  1QGP A;  2XB0 X;  3FHZ A;  2CW0 F;  5HOD A;  4IHV A;  5BS6 A;  4D7N A;  4PK4 A;  5LHG A;  3E6C C;  3CUQ A;  2JN6 A;  4YG2 F;  2XAU A;  1M1E B;  1QZY A;  4A3F J;  3DWL E;  4E6K G;  4A12 A;  1Y0U A;  1TC3 C;  4I2O A;  2R5Y B;  2RV8 A;  3F8B A;  4KIG A;  1EV7 A;  5K1Y A;  2A61 A;  3W2V A;  2B7E A;  5K5Q A;  4EJW A;  1JT0 A;  2M2E A;  2XAQ A;  2B9S A;  2R5Z A;  3BR5 A;  5F04 A;  5FKM A;  1MDM B;  4P96 A;  1X3Z B;  4WXH A;  2L9V A;  2ESN A;  2M8E A;  3PL8 A;  3IH4 A;  3M8E A;  2MC3 A;  2M4G A;  1T38 A;  2WV1 A;  3BG5 A;  2HGC A;  1ORK A;  3PO3 J;  2EZK A;  2VJI A;  3PFI A;  2P6T A;  3TMO A;  1YS6 A;  4L0Z B;  4OU0 A;  3ECO A;  4OAZ A;  2RNJ A;  4A3L J;  3CDH A;  1QBJ A;  3VPR A;  3CC2 I;  2YU9 J;  4G7Z F;  5IP9 J;  1ZN2 A;  5FRN A;  3L2W A;  3BDD A;  1ETQ A;  5LGN A;  2AHQ A;  1S9H A;  3QU6 A;  4HNU A;  2VBW A;  3U9G A;  2MFZ A;  2W48 A;  5B3S H;  5B66 C;  1MBH A;  2KIU A;  2WTE A;  2KMU A;  3CO6 C;  4BE1 A;  1W7P A;  4OAY A;  2BVM A;  1R22 A;  1WJA A;  2BBY A;  1YO5 C;  3CCQ I;  1ETY A;  1JKQ C;  5HDG A;  3LSP A;  4HNV A;  3CF2 A;  2DYS H;  2A6T A;  4L5E A;  1GDT A;  3HPH A;  5IPA A;  5HVQ C;  4M9Z A;  2KRC A;  3H3Z A;  2DPU A;  1Y56 A;  2LOO A;  2L7F P;  2XGD A;  3HZJ A;  1MDM A;  2BVL A;  4CXF A;  4F92 B;  4A69 C;  4HYE A;  3WG9 A;  4A3I J;  4FE4 A;  4PSW A;  4HA8 A;  2X0L A;  4HV5 A;  1BOA A;  4HF2 A;  1HSJ A;  3Q9S A;  2STT A;  2HXI A;  4XRM A;  3IAS 2;  3E6B A;  2FNA A;  5GTI C;  3FMR A;  5EJC A;  5EF6 A;  1U5T A;  2ZXI A;  1ETV A;  3C7J A;  2O8K A;  2JA5 J;  3L2C A;  4LOC A;  4EV0 A;  2LP0 A;  4IZZ A;  3BQY A;  1G2H A;  1UHW A;  2GIV A;  3HUG B;  2KDZ A;  3B02 A;  1LFU P;  1K7A A;  4AM3 A;  3BTC A;  2NAZ A;  1WHU A;  2X6W A;  3S1R J;  3SJM A;  2D5V A;  5FRO A;  4U0W A;  1ZG1 A;  2EIK H;  1PP8 F;  3DEU A;  1SVL A;  1Z0X A;  1ZGW A;  3L9F A;  3A0B C;  1DUX C;  1I50 J;  2E19 A;  4RGX A;  3CME I;  4DYC A;  1QNT A;  4FTH A;  3C2G A;  3KP3 A;  3QQA A;  1Y6I A;  3HB9 A;  4HAM A;  3LMM A;  3WTU C;  2NYX A;  1FNN A;  1DDN A;  2I8D A;  3ZN0 A;  2VKV A;  4EM1 A;  4BXU A;  4V2F A;  3QYB A;  1A6Q A;  5EG0 A;  3F21 A;  1DU6 A;  4ZJZ A;  1APL C;  4OMY A;  5FGM A;  1FIA A;  4LLG F;  5J47 A;  2DA5 A;  2XDV A;  4MTE A;  3PM1 A;  5IOZ A;  4PSX A;  1TWG J;  2RNG A;  3HXL A;  2L3D A;  2OZ6 A;  4AID A;  3AL0 C;  2GOM A;  5GPC A;  1TQI A;  2TCT A;  2F4O B;  2P5K A;  4ZYE A;  3WTV C;  2A07 F;  2Z9O A;  4A6E A;  2RC4 A;  1U8R A;  2HVQ A;  3OOP A;  4DZP A;  5M3M J;  3TW7 A;  4ON0 A;  3KYL A;  5E3O A;  3J7Z I;  5B1A H;  2KPM A;  4KJZ A;  5IT9 Z;  3JCU C;  4OMZ A;  4L0Y B;  3ZGK A;  3OS2 A;  3LSJ A;  3EYY A;  3OYH A;  4DYQ A;  3I4M J;  2GIZ A;  5AON A;  2D45 A;  2X1C A;  2X6X A;  2VAS A;  1IG7 A;  3P9C A;  2VC1 A;  4BBS J;  3ZMT A;  2OUM A;  4IRI A;  4M6Y A;  3HUG A;  2K27 A;  3MCZ A;  4B3A A;  2G7H A;  3U2R A;  1FBU A;  4BE2 A;  4UHT A;  4PJL A;  2VKE A;  1GXP A;  1ZGJ A;  2DFI A;  3ISP A;  2DJI A;  4S04 A;  1U9O A;  2HU9 A;  1U3E M;  2JWT A;  4W1U A;  3F6V A;  3KP4 A;  2CO5 A;  5CKT A;  5B1B H;  3PIP F;  3WTW C;  3JRA A;  2QZ8 A;  4ZH4 F;  1ITY A;  2VON A;  1JUP A;  4P9U A;  2JA6 J;  1W5C C;  4IL6 C;  2XRO A;  4BXF A;  1I6H J;  5AIQ A;  4LK0 F;  2VBY A;  1P4W A;  1FOY A;  4M6V A;  1G3T A;  3O8H A;  2E7X A;  5CLS A;  1D1B A;  1G4D A;  5LRS A;  2R7O A;  1FMW A;  1F36 A;  3FXJ A;  3WHB A;  1MH4 A;  1R71 A;  2HPI A;  3H9G A;  3FMQ A;  1UEL B;  2BY2 A;  2PFB A;  2DDB A;  5F6F A;  2Q8K A;  1SD7 A;  2ETH A;  1WKM A;  1R9T J;  1RIO H;  3PJR A;  2CUZ A;  2K4B A;  5E8I A;  4KDP A;  4KNY A;  2JRM A;  1X1P A;  1SFE A;  1H9T A;  3FIS A;  2MLK A;  3TED A;  4IKF A;  4LG3 A;  1AKH B;  2QKM B;  2VOO A;  2O9L A;  2HI3 A;  2LRD A;  2F5F A;  4UUS A;  2QWW A;  1FP1 D;  2H27 A;  2H6B A;  3CJN A;  4R79 A;  1FMV A;  2XAF A;  5E3M A;  2XKO A;  2DU9 A;  4N9I A;  1R4M B;  2IS6 A;  1FWZ A;  3O2P E;  2HQA A;  4XN0 A;  3TL4 X;  2VOP A;  2R7F A;  3AFH A;  3QPT A;  4HBL A;  1MJA A;  3ZR8 X;  3E5X A;  1WQ2 A;  4OIO F;  1A35 A;  3FZV A;  4ITV A;  4Y13 A;  4EEF G;  5ILU A;  3MKY B;  2J5P A;  3V8L A;  1ETK A;  2L4M A;  3BG7 A;  1T8I A;  1X2M A;  5D4R A;  3K70 C;  2ZNZ A;  3M8F A;  4IHW A;  5J40 A;  1DPU A;  2CGP A;  2LG4 A;  3H92 A;  4IX7 A;  4RGS A;  1OLT A;  4E7S A;  3WTX C;  3KEQ A;  4L9V A;  4D0P A;  2VPL A;  3WTT C;  4KUM A;  4IHY A;  4CO8 A;  3M3Y J;  3E7L A;  3E5Q A;  1BBY A;  1OCZ H;  2H1L A;  5DV5 A;  2WWY A;  2Z33 A;  1P9Q C;  3S93 A;  3TDU C;  1FZP B;  2VE8 A;  1ACI A;  3PSF A;  2L9N A;  4UB6 C;  3LQR A;  4B3X A;  4M9S A;  3WGH A;  2ICW G;  2IS4 A;  2RQP A;  3LWF A;  2WAQ A;  4XL9 A;  4XIC A;  2GA1 A;  4BQO A;  2ELK A;  3FX3 A;  2DW4 A;  3H36 A;  4RM3 A;  1H9G A;  1T2K A;  3HTU A;  2LY9 A;  4RB2 C;  5F27 A;  5EDN A;  4ZYA A;  3H35 A;  1G3S A;  3HOS A;  1OKR A;  2OBP A;  3RIR A;  1YIT I;  4HF1 A;  2DA6 A;  4LIU A;  2VPR A;  3HC7 A;  2PMZ N;  3S1Q J;  2YX4 A;  3ABK H;  2OZU A;  3DBH B;  3Q0W A;  4AIJ A;  1MW7 A;  3K10 A;  4R1H A;  2JA2 A;  3ZQL A;  5L3D A;  1LFB A;  2AQE A;  2FD5 A;  3S3M A;  1XCV A;  4W97 A;  5HS7 A;  3IRQ A;  1EJ9 A;  2IGO A;  3IHU A;  4F52 A;  2W00 A;  1IC8 A;  3ZRG A;  4A3C J;  2QYO A;  1X1A A;  5ICG A;  3CD6 I;  4OIQ F;  4KN4 X;  2HTS A;  3OIQ A;  4BS9 A;  3X2Q H;  5ICF A;  1ONV A;  2DOA A;  3LA2 A;  2WA0 A;  4LLL A;  1CGP A;  2ZXW H;  3GXO A;  5D8L B;  1G6N A;  2BHZ A;  2W82 A;  2VT2 A;  1UST A;  3JAM Z;  3KYC B;  3RYP A;  3P5J A;  4UB8 C;  5DM7 F;  3BR3 A;  2QLZ A;  1L0O C;  1ZR4 A;  3MMY B;  1V3F A;  4XLP F;  2HZD A;  1JKP C;  1OMI A;  2A6H F;  4EJV A;  2HWV A;  4AIK A;  3PO2 J;  1IF1 A;  4HLY A;  1UZC A;  4HV6 A;  3EUH C;  2HXO A;  1X19 A;  3CJR B;  4BBR J;  3CJT B;  3GVA A;  3C3W A;  5EZG A;  2DXI A;  2JSP A;  2E2I J;  3M9A A;  2IGN A;  1W5T A;  1FJL A;  1YOV B;  3GTO J;  1GVD A;  1D0Z A;  1SMT A;  3F9K A;  4LGW A;  4CCN A;  4F3Q A;  2HEO A;  3IH3 A;  3GUD A;  5FKN A;  3GTL J;  5DUI A;  3E1S A;  1BI3 A;  1KU2 A;  3CTA A;  3DPT A;  3HOX J;  2QBY B;  4MNU A;  3H5N A;  4XLC A;  4FE7 A;  1EH8 A;  1RI7 A;  1NG7 A;  1DGW Y;  2XAG A;  4RGU A;  4C30 A;  4LB6 B;  2JQ7 A;  4ZDP A;  1B72 B;  4A3J J;  2ID6 A;  2CW8 A;  2K9S A;  2UV1 A;  1Q1H A;  3KPH A;  4Y33 A;  1OR7 C;  5JLX A;  3TO6 A;  4EAT A;  1I1G A;  1Z7L A;  2BW3 A;  4ZDL A;  3T0Y A;  4XID A;  3QRF F;  3MN2 A;  1F9N A;  3IL2 A;  3MWM A;  2VQL A;  3ULQ B;  2LYC A;  5J4Y A;  1XCB A;  2BXZ A;  3ONQ A;  5KK1 A;  1RKT A;  4M3F A;  2H8W A;  1YJ9 I;  3FXR A;  2R7D A;  3P7N A;  1X2N A;  1X1C A;  1MSE C;  4NBQ A;  3WG7 H;  4KMU X;  2KLO A;  3WU1 B;  3CCJ I;  2OTL I;  2R7U A;  4NC8 A;  2VKD A;  2RN7 A;  4CCO A;  4EJU A;  3DKY A;  3BRO A;  2ACJ A;  3QAH A;  3H1C A;  3H3U A;  2V6C A;  3RPQ A;  3CC7 I;  3W6J B;  1HBX G;  1JKO C;  2D1V A;  1S7E A;  3OYJ A;  4E7H A;  1ZGA A;  4B1R A;  1W0T A;  3HOY J;  3TP0 A;  1TT0 A;  5GAG J;  2VBX A;  2CJJ A;  4H0E A;  2PI0 A;  2QCO A;  2GAU A;  3M7G A;  1RUO A;  2KZV A;  4HX7 A;  4BJ5 C;  2HYG D;  3HSE A;  2CUE A;  4KIT B;  4B4C A;  5E3N A;  3K1M A;  5D4S A;  3CP2 A;  3CCY A;  1A04 A;  3QYE A;  3R0J A;  2M0C A;  3V7S A;  2CQK A;  3CCV I;  2M30 A;  4JOM A;  1FBS A;  5HNH A;  2IGM A;  1YIO A;  4C3I J;  3ESW B;  2OQG A;  4MFE A;  3F0C A;  2ZSI B;  3HIF A;  4D5C A;  4YIF A;  5LHI A;  1IN7 A;  5HLI A;  3ZQF A;  1U9N A;  3ZXS A;  2IS1 A;  1YYV A;  2LH9 A;  2ZB9 A;  1GUU A;  3ABL H;  3COA C;  3FM3 A;  3IV5 A;  4XQF A;  1XGM A;  1UCR A;  3KCC A;  1OCP A;  4ZDO A;  5FJ8 J;  1BC7 C;  3KLN A;  1V5G A;  1F43 A;  3R61 A;  4XLE A;  1F5T A;  1O3T A;  2CG4 A;  2YU3 A;  3S17 J;  3D5L A;  3G1L A;  2IGK A;  4HEA 2;  4O3M A;  2DN0 A;  4MLO A;  4A6D A;  3MZH A;  5CVI A;  1KON A;  5E3L A;  3GTP J;  3HSF A;  4I02 A;  1FSE A;  3OYL A;  3PNV A;  1YI2 I;  4I98 B;  5F1R A;  4BE0 A;  1ZHF A;  3DTI A;  2PMZ A;  1Z21 A;  3LFU A;  5HS8 A;  1S7A A;  2P0W A;  3BJ6 A;  4MTD A;  4YII A;  5CVJ A;  2E2H J;  2OPT A;  3CCL I;  2HYJ A;  1YW7 A;  2XPW A;  3HRS A;  1BL0 A;  2LKP A;  4G6D A;  4BAY A;  3HYI A;  3SXY A;  1VQL I;  4UUV A;  2HOS A;  1UFM A;  4RM2 A;  1RKW A;  4MEY F;  2Y2Z A;  1VF9 A;  3BR1 A;  2W7N A;  1QU3 A;  2L2O A;  4S05 A;  1BI1 A;  4HRI A;  5JLW A;  1HF0 A;  1UMQ A;  1W1W E;  2DFE A;  4ZZD A;  3GTG J;  3WE3 A;  4G6Q A;  3QP6 A;  4DJA A;  2LR8 A;  4F93 B;  2ZJR F;  3JRE A;  4GYI A;  1SVM A;  2FF4 A;  1QPM A;  3R0A A;  2L02 A;  1YLF A;  2W57 A;  3HOT A;  1DQU A;  4A0Y A;  3N97 A;  5IOY A;  4Y3O A;  3VOD A;  4YFK F;  1HOM A;  4NDL A;  2XAH A;  3GW2 A;  3MKL A;  2LTP A;  2H6C A;  2ZSH B;  3KYD B;  3N4M A;  5LEK A;  1GHC A;  1PUE E;  3H5A A;  4BHB A;  2FXA A;  2ECB A;  1HKT A;  1CF7 B;  3GEZ A;  1B8I B;  4R8H A;  3HTS B;  3SDB A;  1QZE A;  2DJN A;  1XX5 A;  4DQ2 A;  1OIS A;  2E36 A;  4WCG A;  3E6M A;  2RKH A;  2EPF A;  3DLA A;  2DYR H;  4IF4 A;  2CYY A;  3OL4 A;  2Y69 H;  2ZME A;  3BTL A;  4RAY A;  4YEJ A;  4G6T B;  3GBG A;  2JSC A;  1YG2 A;  3F3X A;  3GF2 A;  2AQF A;  3OR1 C;  3SYT A;  4II2 A;  3JRB A;  1MMN A;  2QEX I;  1DPR A;  1TP4 A;  3A1Y A;  1YJN I;  2ADU A;  4M6X A;  4TV7 A;  1XGN A;  5DD8 A;  5KHD A;  3F8N A;  4YRV A;  2PEX A;  2EIM H;  2YPR A;  3CCM I;  4BJT A;  3OY9 A;  3W3C A;  1LVK A;  2QKL B;  5FLV A;  2FOW A;  1KQ0 A;  5H20 A;  4C3J J;  1XN7 A;  2FU4 A;  2AXT C;  3G1M A;  2Y0M A;  3S2W A;  2PX9 A;  2R93 J;  3ZMZ A;  3D1N I;  4IQJ A;  3FXL A;  2YS9 A;  3OYF A;  2HNH A;  3ASN H;  1PDN C;  2K5C A;  3NQO A;  1YRN A;  2VUM J;  3JRF A;  3EUH A;  4GGG A;  4HG2 A;  1U6G A;  1YRN B;  1ZYR F;  5M5X J;  2CQN A;  2HTJ A;  2LFB A;  5E79 C;  3K4K A;  5CPR B;  3GZ5 A;  4FIS A;  5FFX A;  1ZLK A;  4A3D J;  2HYF A;  3BPX A;  1B9N A;  1XG1 A;  4M3E A;  3JRD A;  1POG A;  5CVV A;  4RDU A;  1S7O A;  5HLH A;  3H9J A;  1LNW A;  1TW2 A;  1X58 A;  4S0H B;  4XNF A;  2ZJQ F;  1IN4 A;  1OFC X;  4BY7 J;  2GOX B;  1TWH J;  2JUG A;  5A2Q K;  3LA7 A;  3WU0 A;  1HC8 A;  2HOA A;  4XKW A;  4XK4 A;  1STZ A;  2MW8 A;  3DU6 A;  2NNY A;  3BCB A;  3BR0 A;  3KP2 A;  3Q0V A;  5H2F C;  4EJO A;  5ICE A;  3DBL B;  1MMA A;  4G7H F;  2DMN A;  2A69 F;  4BDY A;  5TRD A;  2L7K A;  1U8B A;  1RUN A;  2MC4 A;  5KAI C;  1TBX A;  4U0Y A;  2VLA A;  4EGY A;  2W4S A;  4RB1 A;  2EV0 A;  4MIM A;  1VQM I;  2ISY A;  1BW6 A;  4BQN A;  1BR2 A;  5E1Z B;  3GTJ J;  3W6V A;  3QWL A;  1DP7 P;  2OV7 A;  3PSI A;  4Z2Y A;  1Z1D A;  2WAQ N;  2B0L A;  1HDD C;  3HGG A;  3V7C A;  5E8G A;  2R4G A;  2P4W A;  1KZH A;  2RRE A;  2V1X A;  3OYK A;  1HLV A;  1EA3 A;  2BZT A;  1W36 D;  5C44 J;  3RJP A;  2DOF A;  3CMA I;  2IT0 A;  1P4A A;  3KEY A;  1R00 A;  2IXS A;  4LLN A;  4I09 A;  5CVU A;  1JTX A;  2IA1 A;  2GXB A;  5LEJ A;  1U5T C;  3QOD A;  3T8R A;  3ZOB A;  3VWB A;  4MQV A;  2VT3 A;  2EFO A;  1X4P A;  4XLN F;  5CVR A;  4I6Z A;  2RGV A;  2DK8 A;  6PAX A;  1BN5 A;  4HOB A;  3OYM A;  1A6I A;  2HQN A;  3FBI B;  2BY3 A;  5DYM A;  3UNG C;  1P7I A;  3J81 Z;  1IRZ A;  2XGC A;  1QA6 A;  1HCR A;  2LSO A;  1D5V A;  5HDK A;  4JK1 X;  3GTQ J;  2Q1Z B;  4GRI A;  4ABZ A;  3WGI A;  4IQ4 A;  3S3O A;  1XPX A;  1EH7 A;  4FCY A;  4XM3 A;  2QQ8 A;  4FT8 A;  5K5O A;  4RA2 A;  1J09 A;  1JUM A;  1B72 A;  2VE9 A;  2VIX A;  2EB7 A;  4B47 A;  2GM4 A;  3SQN A;  1AHD P;  3B6A A;  2HDD A;  3S32 A;  4L5J A;  5J8F A;  1AOY A;  3JTG A;  4U0V A;  3MZ8 A;  4JX6 A;  2VXD A;  1WCM J;  4EQQ A;  4GFB A;  1IV8 A;  2Y30 A;  5H6R A;  2D2W A;  1LFP A;  3HRM A;  3F6O A;  3KET A;  1ZQ3 P;  2MSY A;  2H09 A;  1BJA A;  2XUB A;  3S1N J;  2LY1 A;  2QA4 I;  1ENH A;  4AVZ A;  2L9S A;  5B5E C;  5IT9 K;  4YFN F;  2PJR A;  4F91 B;  3K69 A;  1XMK A;  4E7J A;  3B6C A;  1J59 A;  4UXN A;  3RQI A;  2V9P A;  4CCK A;  3F8C A;  2WAF A;  4DGW B;  5C4X J;  4LB5 A;  1QZZ A;  3BY6 A;  4LFU A;  2QM3 A;  1WJD A;  3REO A;  2O5R A;  1VQ4 I;  2P5V A;  5FFZ A;  2EV5 A;  4D5F A;  1WJC A;  1LDK B;  4P1W A;  1HST A;  2HFH A;  2FEZ A;  3Q9V A;  1ZLJ A;  2TDX A;  2EFP A;  4M74 A;  1T39 A;  1WJ5 A;  2XIG A;  3OV8 A;  2IJL A;  3KZI C;  4ETS A;  2M5W A;  4L9N A;  1MMS A;  4PDK A;  1NH3 A;  4OOI A;  3S1M J;  5M5Y J;  3J7A Y;  3I59 B;  3PNT A;  3WE2 A;  2K3F A;  3K4L A;  5EYR A;  3BTJ A;  3WHC A;  1MBG A;  2DFH A;  4A5N A;  4CYC A;  1MMG A;  3ASO H;  3D0S A;  3ROU A;  2BE5 F;  1PJR A;  4A2U A;  4ESF A;  5J1Y A;  3BOQ A;  1MSF C;  4CHU A;  3S2H J;  2Z3Y A;  2FRH A;  4Y17 A;  2XAJ A;  2HPM A;  4C2T A;  4CCL A;  4KMF A;  3K7A J;  2P81 A;  3L7W A;  2KZG A;  2MGQ A;  3IRR A;  1A5J A;  1IXC A;  4PGH A;  3L09 A;  1UG0 A;  2X6O A;  4Y52 J;  2PJR B;  4D7M A;  4EM0 B;  4RAZ A;  1FBQ A;  3H0G J;  4QPQ A;  5DCM B;  2EH3 A;  3TBI A;  1W4M A;  2WB1 N;  1DU0 A;  5ICC A;  4XSZ F;  4LG0 B;  1X1B A;  2ZO4 A;  5E18 F;  4JYK A;  1FYK A;  1JI8 A;  2P8T A;  3W2W A;  3MFK A;  1Y8Q B;  2VI6 A;  3KZY A;  1K78 A;  3RCO A;  2OCE A;  3TO9 A;  2NVT J;  1WJB A;  3HKZ N;  5IYB J;  1QVT A;  2IA2 A;  3TP3 A;  4WX9 A;  1R5G A;  2LLK A;  2FQ3 A;  2K9L A;  3BG6 A;  3AG1 H;  3I0T A;  3OYC A;  1JHF A;  2PJP A;  3JSO A;  3HRT A;  2ZKZ A;  5D5W B;  4IRH A;  5D6E A;  1HW1 A;  5BPI A;  3IUO A;  1IUY A;  3K4B A;  4G8X A;  3JSP A;  3NAU A;  2WAD A;  3GWZ A;  2V4J C;  1R1V A;  3VYS B;  1I3Q J;  4BEH A;  4D1Q A;  4G94 A;  2M3A A;  3U1D A;  1LVA A;  4MO7 A;  5DD4 A;  2IS2 A;  3KE2 A;  4Q4Z F;  1DGR M;  1XMX A;  2IBD A;  1FIP A;  2A5W A;  2I5U A;  2QSF X;  3FBN B;  5GAE J;  2BHY A;  2P6S A;  1WVR A;  2LF7 A;  1X3W B;  4YIR X;  4KT5 C;  2NOJ B;  1BIB A;  1S72 I;  3E97 A;  1QHH D;  1NG6 A;  4F55 A;  3ZQ7 A;  3LAJ A;  4HNT A;  4Y15 A;  1H0M A;  3HG9 A;  1UHS A;  2K7L A;  3Q5F A;  3FK7 A;  2ECC A;  2VQC A;  3SFI A;  1LKX A;  2O8X A;  1UJ8 A;  2IW5 A;  2EWN A;  3G6E I;  3RKW A;  2HOT A;  2M8G X;  3NAR A;  3E3V A;  5E20 A;  1U0J A;  4A3M J;  1ZAR A;  2VJ5 A;  3D5R C;  1MBF A;  4BU2 A;  2ZJ2 A;  1HW2 A;  3GME A;  4Q48 A;  1WPK A;  1MMD A;  1S5L C;  3Q3S A;  1IUF A;  3F23 A;  2OTJ I;  2BV6 A;  4NHJ A;  3QYF A;  2K85 A;  3I4N J;  3I56 I;  3K9T A;  2YUS A;  1D0Y A;  3HEF A;  1B8I A;  2DDA A;  3DQV C;  2K40 A;  2LKS A;  2KRF A;  2A05 A;  2V6E A;  4FHT A;  2LBF B;  2BY1 A;  5FKK A;  1MJ9 A;  3TO7 A;  2XC7 A;  3G73 A;  3L1P A;  1Z7U A;  1FTT A;  2YR2 A;  2MH9 A;  4Z6Y A;  4PJM A;  2JA8 J;  1SVO A;  2KIQ A;  4ZYH A;  2M4K A;  4UY8 I;  3KLO A;  5GTH C;  5M3F J;  1V5E A;  2L54 A;  4HSR A;  3SZP A;  1SAN A;  2CV2 A;  2DA7 A;  1N78 A;  1KGS A;  1MGT A;  2NNN A;  1QHG A;  1TWC J;  2K9N A;  1QVU A;  3C1D A;  2KL4 A;  5J3L A;  5DTD A;  1O57 A;  4ZTF A;  3A0H C;  3ZCO A;  3HOU J;  1JKR C;  3QPL A;  3DTK A;  3L00 A;  4YFX F;  3G2B A;  1AKH A;  3S2D J;  1KU9 A;  4WXD A;  4RAF A;  2F5V A;  2TRT A; 
#chains in the Genus database with same CATH homology
 2WC2 A;  3PQJ A;  3B73 A;  4IVN A;  1R1U A;  4KFC A;  2MBF A;  2V9V A;  1T98 A;  5LGU A;  2K86 A;  4G9Y A;  4EJT A;  3DV8 A;  3TKY A;  2MA3 A;  1WSU A;  4NQW A;  1XDU A;  2PLY A;  4CZZ A;  2ZXJ A;  5ED4 A;  3ML6 A;  2EJR A;  2L4A A;  4IXA A;  3GFM A;  5FLX K;  1P6R A;  2IRF G;  2QEN A;  3E6D A;  1JXS A;  2Z5U A;  3LFK A;  2PMH A;  5CJ9 A;  3VOE A;  1R36 A;  4PZJ A;  4F7Z A;  3CUQ B;  2MH2 A;  3QP5 A;  1O3S A;  3HHH A;  4LK1 F;  1Z05 A;  4O6J A;  5BQT A;  4UVA A;  1IRG A;  3IKT A;  1XD7 A;  1FT9 A;  2R3S A;  2HZT A;  4OIN F;  1K78 B;  5ERI A;  2FNP A;  2VC0 A;  2JRT A;  2EA2 A;  1P92 A;  4HX8 A;  4ESB A;  2W25 A;  1XSX A;  1YFH A;  3I4P A;  4I01 A;  5AIP A;  2HDC A;  2G9W A;  2PQ8 A;  3KP5 A;  3PQK A;  3TOB A;  1J7K A;  1OR7 A;  1XMA A;  1KYZ A;  1ZRD A;  3SFZ A;  1R1T A;  4M72 A;  2FOK A;  2VOD A;  4L18 B;  5FD5 A;  4L9T A;  2Y48 A;  2M87 A;  2ZCW A;  3KZZ A;  4P55 A;  4GXO A;  2EFW A;  2KKO A;  4IHT A;  1LEA A;  1GVJ A;  2EK5 A;  1LDJ A;  2P7V B;  1TQM A;  3WOD F;  1YW9 A;  4MGR A;  2P5L C;  4GCV A;  4QWQ A;  5E1X A;  2QQA A;  5DCF A;  1IAW A;  3K2Z A;  4JQF A;  5H6Q A;  1S29 A;  1SFU A;  3FF5 A;  1W7P D;  2O61 A;  4RS8 A;  3ERE D;  3TQN A;  2ELH A;  1JHH A;  3HHG A;  5KVR A;  5D5X B;  3W6K B;  4B8X A;  5L3F A;  4EGZ A;  2E1C A;  1T6S A;  1O7F A;  4A0X A;  1X3U A;  2BYV E;  5D5U B;  2CSO A;  2RVC A;  2V1U A;  1UHM A;  2F2E A;  1O3R A;  3WGG A;  2AXL A;  1F4K A;  3RPU A;  2HS5 A;  2DO7 A;  4AD9 A;  1K79 A;  2E1N A;  4HX4 A;  4P9F A;  4HZF A;  1U78 A;  3RI4 A;  3GLX A;  2WV0 A;  2IPQ X;  5HLG A;  5E1W A;  1LEB A;  2HQR A;  2GA2 A;  3LST A;  2D1H A;  1IZ1 A;  3IC7 A;  5DUK A;  3FMS A;  5DDG A;  1WI9 A;  3DP7 A;  3NEU A;  5L3C A;  1XGO A;  3J80 Z;  4DNC A;  1KU7 A;  2F5E A;  3ZMU A;  1Z91 A;  4PGG A;  3RKX A;  1Z6T A;  5HOO A;  2FBK A;  4M9X A;  3MQ0 A;  5K5R A;  2O0Y A;  2W85 A;  4HF0 A;  4NB5 A;  4U7D A;  1RZ4 A;  2LDU A;  1W7P B;  3I71 A;  4EMS A;  1O7L A;  4ASN A;  4BHC A;  1OPC A;  3JTH A;  1IN6 A;  1ZRE A;  5BPD A;  4GYG A;  1ZRC A;  4E70 A;  2FA5 A;  4G7O F;  5BOX A;  2A68 F;  2XVC A;  3J7A O;  3VFZ A;  1LJ9 A;  4I0A A;  1OYY A;  4WWC A;  2W84 A;  2JTV A;  5LRR A;  2XGX A;  4BHP A;  2UXN A;  3ABT A;  3CO7 C;  3BJO A;  1ZAO A;  4KIF A;  3FM5 A;  1VTN C;  2XAS A;  1JGS A;  3BPV A;  1E17 A;  2XRN A;  2Z99 A;  1KA8 A;  3R6S A;  3DXJ F;  1REP C;  1YS7 A;  2VBZ A;  2ZNY A;  3O3K A;  2DQL A;  1B59 A;  1CF7 A;  2PG4 A;  1YTY A;  1IXS B;  1KQ8 A;  3DF8 A;  1ON2 A;  5IT3 A;  4Q5S F;  3GZ6 A;  1NHA A;  1R58 A;  1XB4 A;  3ELK A;  2A6E F;  1WRJ A;  4EVI A;  3J80 K;  2HKX A;  5A2Q Z;  1USS A;  4LJZ F;  3IWF A;  1OYI A;  4P5O A;  1I1S A;  1FX7 A;  4QLC U;  2IA0 A;  1S6L A;  2JPC A;  1TW3 A;  2FE3 A;  1FSH A;  1R5H A;  1TLH B;  2ZFW A;  3P9K A;  1B6A A;  1L3L A;  1S8N A;  1HKS A;  3M1E A;  3EQL F;  5FD6 A;  3GFL A;  3GX4 X;  1KYW A;  4KIB A;  2KJB A;  2XV4 S;  2ISZ A;  1MZB A;  1C0W A;  4M73 A;  5FO5 A;  2KIM A;  3O6B B;  1WWX A;  4O5V A;  2YX7 A;  5F64 A;  3K1P A;  4KA4 A;  3F8F A;  2DBB A;  3QU3 A;  2Q2E A;  4RB0 A;  1EH6 A;  2BEO A;  2DAO A;  2FBI A;  4L9J A;  1I5Z A;  3RKY A;  1J5Y A;  4I7H A;  3QPH A;  3GO5 A;  2DLL A;  3NRV A;  1LQ1 A;  3FWE A;  4EM2 A;  5JI6 A;  5L3E A;  2IP2 A;  4HLX A;  1FC3 A;  3RYR A;  4MHG A;  2M1B A;  4M71 A;  2O3F A;  3ZN1 A;  3DPL C;  1J75 A;  3MZY A;  2H94 A;  5CYV A;  5LBQ A;  3ZMS A;  3C18 A;  4LMY A;  4B09 A;  4XBF A;  5D8K B;  1ULY A;  4IPA A;  2DQR A;  3CUO A;  4RB3 C;  3P9I A;  3SZT A;  4A5M A;  1XSD A;  3HSR A;  1MKM A;  5DEQ A;  3GFJ A;  2CFX A;  4WK8 F;  5D6F A;  1W5S A;  1P4X A;  4WF2 A;  3I5U A;  1LDD A;  3ZPL A;  1U2W A;  4IHS A;  4FX4 A;  2GXG A;  3I53 A;  1IW7 F;  1FPQ A;  3EET A;  1SFX A;  1ZG5 A;  3ZMD A;  4BH9 A;  2DK5 A;  4ENN A;  2F5C A;  4I0B A;  5LHH A;  3R60 A;  3K1N A;  2C6Y A;  1FYM A;  1ZRF A;  3QOP A;  2UZK A;  2O03 A;  5LGT A;  2M45 A;  5JR3 A;  3TGN A;  2KJC A;  4UVC A;  1HW5 A;  1R23 A;  1QO0 D;  2FMY A;  5L3B A;  4UNO A;  1D8K A;  2G7U A;  1FP2 A;  3G3Z A;  3ZMV A;  1XSV A;  1JE8 A;  3F8M A;  1MD0 A;  2A3S A;  2GWR A;  3V7R A;  3ABU A;  5J8C A;  4AVP A;  3GFI A;  2VXZ A;  3R4K A;  1XDS A;  3WTZ A;  2IVM A;  4HDU A;  1I27 A;  2DT5 A;  5TJJ A;  1BIA A;  2EFQ A;  3LAP A;  4HDV A;  1K6O A;  3IWZ A;  1E2X A;  3RDI A;  2J5O A;  2UXX A;  2LNB A;  4ZYD A;  5HS9 A;  2ZBK A;  4K2E A;  3TDZ C;  3ECH A;  1ZH5 A;  4JBA A;  3BJA A;  2V1D A;  1FY7 A;  1HXD A;  1TTY A;  4OIR F;  4CIC A;  1TNS A;  2PBI A;  4LD5 A;  2HR3 A;  1BI0 A;  3CUQ C;  1J9I A;  2GZW A;  3ZP5 A;  5JFR A;  3IKV A;  3F22 A;  2XHK A;  2JT1 A;  1SAX A;  4UV9 A;  5E17 F;  3V8J A;  4L5I A;  3MEX A;  2OQR A;  1V4R A;  3KFW X;  2DI3 A;  2DTR A;  3T1B A;  3EYI A;  2GQQ A;  2OU2 A;  4U7B A;  2FSW A;  2K4J A;  2VN2 A;  4HW0 A;  1LB2 A;  1HKQ A;  2BGC A;  1YW8 A;  4BYY A;  1B1B A;  3TOA A;  4ENJ A;  2QQ9 A;  1MJB A;  1PP7 U;  3K0L A;  1U5T B;  2ESH A;  1ZG3 A;  1FOK A;  3KP7 A;  3T8T A;  3JW4 A;  4N9H A;  1SMY F;  2K02 A;  1SD5 A;  5J6X A;  1D8J A;  1UB9 A;  1FYL A;  2RDP A;  3I59 A;  5BMZ A;  3DFG A;  2EA4 A;  1Z6R A;  4XRF A;  5FB2 A;  2P7C B;  4MQ9 F;  4UV8 A;  2X4H A;  4OIP F;  4RGR A;  4GO1 A;  2PMU A;  3WTS C;  4ZZL A;  1D3Y A;  2A5Y B;  4A0Z A;  4BNC A;  2MLG A;  1ON1 A;  1TQP A;  1IN8 A;  2ZME B;  3WTY C;  3BZ6 A;  3RTR A;  4KIC A;  1F1Z A;  1GXQ A;  4WXC A;  4CDG A;  2HOE A;  2KIF A;  1IN5 A;  5JVT A;  4MEX F;  1IXR C;  1G3W A;  1P2F A;  2QQB A;  5DCM A;  5JHU A;  1T0F A;  4LG0 A;  2F5D A;  4CYD A;  3BWG A;  4HQE A;  3LQQ A;  4AIH A;  3DKW A;  3BP8 A;  2XKP A;  1ODD A;  2CWE A;  1QQI A;  2L01 A;  4AWX B;  1SD6 A;  4U88 A;  4Q47 A;  3KP6 A;  1TNT A;  3VEP A;  3E5U A;  4PCQ A;  3KEO A;  4ZYG A;  1J0R A;  3V4G A;  2DPD A;  1B9M A;  1Z9C A;  2HKO A;  2O6G E;  5EEG A;  3FXU A;  2EFN A;  2W24 A;  2QUF A;  1KU3 A;  1SD4 A;  4N0B A;  3MAJ A;  2OD5 A;  5L3G A;  1O3Q A;  3I58 A;  1BC8 C;  2YSR A;  3SHF A;  1R7J A;  1YQA A;  2Q0O A;  1HQC A;  5ILV A;  2QVO A;  5EEH A;  3AAF A;  1BM9 A;  2JPB A;  3I54 A;  2OA4 A;  2UWM A;  5ILS A;  2FBH A;  3I64 A;  4BQA A;  1I6X A;  4KYW A;  2LF8 A;  3F72 A;  3J81 K;  2AS5 F;  2Y75 A;  4CGZ A;  4ENM A;  3LA3 A;  2COM A;  3T5X A;  4IJA A;  1OYW A;  1IRF A;  2OAZ A;  1BI2 A;  4ENK A;  3JAM K;  2STW A;  2V79 A;  1S3J A;  5D5V B;  3CLO A;  4XSX F;  5FLX Z;  4KN7 X;  3EDP A;  3VB2 A;  3V8K A;  2PN6 A;  1B4A A;  1KQ9 A;  4IRG A;  2NRA C;  4ESJ A;  1XGS A;  4FX0 A;  3FXQ A;  2E7W A;  3HRU A;  5LLQ A;  5HDN A;  2EV6 A;  1J2X A;  2QBY A;  2MD5 A;  2JZY A;  1FLI A;  1G3Y A;  3GYH X;  4UVB A;  4HQM A;  2FML A;  1AWC A;  1RNL A;  2NS0 A;  1QGP A;  3FHZ A;  2CW0 F;  5BS6 A;  3E6C C;  5LHG A;  3CUQ A;  4YG2 F;  1QZY A;  4A12 A;  1Y0U A;  4I2O A;  2RV8 A;  3F8B A;  4KIG A;  1EV7 A;  5K1Y A;  2A61 A;  5K5Q A;  4EJW A;  2XAQ A;  1MDM B;  4P96 A;  4WXH A;  2ESN A;  2M8E A;  3M8E A;  2MC3 A;  1T38 A;  2HGC A;  3PFI A;  2P6T A;  1YS6 A;  4L0Z B;  4OU0 A;  3ECO A;  2RNJ A;  3CDH A;  1QBJ A;  4G7Z F;  1ZN2 A;  3BDD A;  5LGN A;  3QU6 A;  2VBW A;  3U9G A;  2KIU A;  2WTE A;  3CO6 C;  1W7P A;  1R22 A;  2BBY A;  1YO5 C;  5HDG A;  5HVQ C;  4M9Z A;  3H3Z A;  2DPU A;  1MDM A;  4CXF A;  4HYE A;  3WG9 A;  4HA8 A;  2X0L A;  4HV5 A;  1BOA A;  4HF2 A;  1HSJ A;  3Q9S A;  2STT A;  3E6B A;  2FNA A;  3FMR A;  1U5T A;  3C7J A;  3L2C A;  4EV0 A;  1UHW A;  2GIV A;  3B02 A;  1K7A A;  2NAZ A;  4U0W A;  1ZG1 A;  1PP8 F;  3DEU A;  3L9F A;  1DUX C;  4RGX A;  1QNT A;  3KP3 A;  4HAM A;  3WTU C;  2NYX A;  1FNN A;  1DDN A;  3ZN0 A;  4EM1 A;  4BXU A;  3F21 A;  4OMY A;  5FGM A;  4LLG F;  4MTE A;  2L3D A;  2OZ6 A;  1TQI A;  2P5K A;  4ZYE A;  3WTV C;  2A07 F;  2Z9O A;  4A6E A;  2RC4 A;  1U8R A;  3OOP A;  4ON0 A;  5IT9 Z;  4OMZ A;  4L0Y B;  3EYY A;  5AON A;  2D45 A;  3P9C A;  2VC1 A;  3ZMT A;  4IRI A;  4M6Y A;  3HUG A;  2K27 A;  3MCZ A;  2G7H A;  3U2R A;  1FBU A;  4UHT A;  1GXP A;  1ZGJ A;  2DFI A;  3ISP A;  4S04 A;  1U3E M;  3F6V A;  3KP4 A;  2CO5 A;  3WTW C;  2QZ8 A;  4ZH4 F;  2VON A;  4P9U A;  2XRO A;  5AIQ A;  4LK0 F;  2VBY A;  1P4W A;  1G3T A;  2E7X A;  5CLS A;  1G4D A;  5LRS A;  3FMQ A;  2PFB A;  5F6F A;  2Q8K A;  1SD7 A;  2ETH A;  1WKM A;  1RIO H;  2K4B A;  5E8I A;  4KDP A;  4KNY A;  1SFE A;  1H9T A;  2MLK A;  2VOO A;  2F5F A;  2QWW A;  1FP1 D;  2H27 A;  2H6B A;  3CJN A;  4R79 A;  2XAF A;  2XKO A;  2DU9 A;  4N9I A;  1FWZ A;  3O2P E;  2VOP A;  2R7F A;  3QPT A;  4HBL A;  1MJA A;  3E5X A;  1WQ2 A;  4OIO F;  3FZV A;  4Y13 A;  5ILU A;  2J5P A;  3V8L A;  2L4M A;  5D4R A;  2ZNZ A;  3M8F A;  1DPU A;  2CGP A;  3H92 A;  4RGS A;  3WTX C;  3KEQ A;  4L9V A;  4D0P A;  3WTT C;  4KUM A;  4CO8 A;  3E5Q A;  1BBY A;  2WWY A;  5DV5 A;  2Z33 A;  3TDU C;  1FZP B;  2VE8 A;  3LQR A;  4M9S A;  3WGH A;  2RQP A;  3LWF A;  2GA1 A;  3FX3 A;  2DW4 A;  1H9G A;  1T2K A;  3HTU A;  4RB2 C;  1G3S A;  3HOS A;  1OKR A;  2OBP A;  3RIR A;  4HF1 A;  2YX4 A;  2OZU A;  4AIJ A;  4R1H A;  5L3D A;  1XCV A;  5HS7 A;  3IRQ A;  3IHU A;  2QYO A;  5ICG A;  4OIQ F;  4KN4 X;  2HTS A;  5ICF A;  1ONV A;  3LA2 A;  4LLL A;  1CGP A;  3GXO A;  5D8L B;  1G6N A;  2VT2 A;  1UST A;  3JAM Z;  3RYP A;  2QLZ A;  1L0O C;  1V3F A;  4XLP F;  1OMI A;  2A6H F;  4EJV A;  2HWV A;  4AIK A;  1IF1 A;  4HLY A;  4HV6 A;  3GVA A;  3C3W A;  3M9A A;  1W5T A;  1SMT A;  4LGW A;  2HEO A;  3GUD A;  5DUI A;  1BI3 A;  1KU2 A;  3CTA A;  3DPT A;  2QBY B;  4MNU A;  1EH8 A;  1RI7 A;  2XAG A;  4RGU A;  4LB6 B;  1Q1H A;  3TO6 A;  1I1G A;  3T0Y A;  3QRF F;  1F9N A;  3IL2 A;  3MWM A;  3ULQ B;  1XCB A;  5KK1 A;  3FXR A;  2R7D A;  3P7N A;  4KMU X;  3WU1 B;  2RN7 A;  4EJU A;  3BRO A;  2ACJ A;  3QAH A;  3H3U A;  2V6C A;  3RPQ A;  3W6J B;  1HBX G;  2D1V A;  1ZGA A;  2VBX A;  4H0E A;  2PI0 A;  2GAU A;  3M7G A;  1RUO A;  4HX7 A;  2HYG D;  3HSE A;  3K1M A;  5D4S A;  1A04 A;  3V7S A;  3R0J A;  2CQK A;  2M30 A;  1FBS A;  1YIO A;  2OQG A;  3HIF A;  4YIF A;  5LHI A;  1IN7 A;  5HLI A;  1YYV A;  3COA C;  3FM3 A;  1XGM A;  1UCR A;  3KCC A;  1BC7 C;  3KLN A;  3R61 A;  1F5T A;  1O3T A;  2CG4 A;  2YU3 A;  3D5L A;  4O3M A;  4A6D A;  3MZH A;  5CVI A;  3HSF A;  4I02 A;  1FSE A;  4I98 B;  5F1R A;  1ZHF A;  5HS8 A;  1S7A A;  3BJ6 A;  4MTD A;  4YII A;  5CVJ A;  1YW7 A;  3HRS A;  2LKP A;  4G6D A;  4BAY A;  3HYI A;  3SXY A;  4UUV A;  1UFM A;  4MEY F;  4S05 A;  1BI1 A;  4ZZD A;  3WE3 A;  4G6Q A;  3QP6 A;  4GYI A;  2FF4 A;  1QPM A;  3R0A A;  2L02 A;  1YLF A;  2W57 A;  3HOT A;  4A0Y A;  3N97 A;  3VOD A;  4YFK F;  2XAH A;  3GW2 A;  2H6C A;  3N4M A;  5LEK A;  1GHC A;  1PUE E;  4BHB A;  2FXA A;  1HKT A;  1CF7 B;  3GEZ A;  4R8H A;  3HTS B;  4DQ2 A;  4WCG A;  3E6M A;  2RKH A;  4IF4 A;  2CYY A;  2ZME A;  4RAY A;  2JSC A;  1YG2 A;  3F3X A;  3GF2 A;  1DPR A;  2ADU A;  4M6X A;  4TV7 A;  1XGN A;  5DD8 A;  3F8N A;  2PEX A;  2YPR A;  1KQ0 A;  5H20 A;  1XN7 A;  2FU4 A;  2Y0M A;  3S2W A;  3ZMZ A;  1PDN C;  3NQO A;  3EUH A;  4GGG A;  1U6G A;  1ZYR F;  2HTJ A;  3GZ5 A;  5FFX A;  1ZLK A;  2HYF A;  3BPX A;  1B9N A;  5CVV A;  1S7O A;  5HLH A;  1LNW A;  1TW2 A;  1IN4 A;  5A2Q K;  3LA7 A;  3WU0 A;  1STZ A;  2NNY A;  3KP2 A;  5ICE A;  4EJO A;  4G7H F;  2A69 F;  5TRD A;  1RUN A;  4U0Y A;  1TBX A;  4EGY A;  4RB1 A;  2EV0 A;  2ISY A;  5E1Z B;  1DP7 P;  4Z2Y A;  1Z1D A;  2B0L A;  3V7C A;  5E8G A;  2P4W A;  2V1X A;  3RJP A;  2IT0 A;  1P4A A;  1R00 A;  4LLN A;  4I09 A;  5CVU A;  2IA1 A;  2GXB A;  5LEJ A;  1U5T C;  3T8R A;  4MQV A;  2VT3 A;  2EFO A;  4XLN F;  5CVR A;  2RGV A;  2DK8 A;  6PAX A;  1BN5 A;  4HOB A;  2HQN A;  5DYM A;  3J81 Z;  2LSO A;  1D5V A;  5HDK A;  4JK1 X;  3WGI A;  1EH7 A;  4FT8 A;  5K5O A;  2VE9 A;  2EB7 A;  3SQN A;  1AOY A;  4L5J A;  5J8F A;  3JTG A;  4U0V A;  4EQQ A;  5H6R A;  2D2W A;  3HRM A;  3F6O A;  3KET A;  2H09 A;  1BJA A;  2XUB A;  5IT9 K;  4YFN F;  3K69 A;  1XMK A;  1J59 A;  4UXN A;  3F8C A;  4LB5 A;  1QZZ A;  3BY6 A;  4LFU A;  2QM3 A;  3REO A;  2P5V A;  5FFZ A;  2EV5 A;  1LDK B;  1HST A;  2HFH A;  2FEZ A;  3Q9V A;  1ZLJ A;  2TDX A;  2EFP A;  1T39 A;  4M74 A;  2XIG A;  3OV8 A;  2IJL A;  4ETS A;  2M5W A;  4L9N A;  4PDK A;  4OOI A;  3I59 B;  3WE2 A;  4A5N A;  3D0S A;  3ROU A;  2BE5 F;  4A2U A;  4CHU A;  4ESF A;  3BOQ A;  2Z3Y A;  2FRH A;  4Y17 A;  2XAJ A;  4KMF A;  3L7W A;  3IRR A;  1IXC A;  4PGH A;  3L09 A;  4EM0 B;  4RAZ A;  1FBQ A;  5DCM B;  1W4M A;  5ICC A;  4XSZ F;  4LG0 B;  2ZO4 A;  5E18 F;  1FYK A;  2P8T A;  3MFK A;  3KZY A;  1K78 A;  3TO9 A;  2IA2 A;  4WX9 A;  1R5G A;  2FQ3 A;  3I0T A;  1JHF A;  2PJP A;  3JSO A;  3HRT A;  5D5W B;  2ZKZ A;  4IRH A;  5D6E A;  1HW1 A;  5BPI A;  1IUY A;  4G8X A;  3JSP A;  3GWZ A;  1R1V A;  4G94 A;  3U1D A;  1LVA A;  5DD4 A;  3KE2 A;  4Q4Z F;  2P6S A;  2LF7 A;  4KT5 C;  1BIB A;  3E97 A;  3ZQ7 A;  3LAJ A;  4Y15 A;  1H0M A;  2K7L A;  3Q5F A;  2O8X A;  2IW5 A;  2EWN A;  3RKW A;  3E3V A;  5E20 A;  1ZAR A;  2ZJ2 A;  1HW2 A;  4Q48 A;  3F23 A;  2BV6 A;  4NHJ A;  3K9T A;  3DQV C;  2KRF A;  4FHT A;  1MJ9 A;  3TO7 A;  3G73 A;  1Z7U A;  2YR2 A;  2MH9 A;  4ZYH A;  3KLO A;  2L54 A;  3SZP A;  1KGS A;  1MGT A;  2NNN A;  3C1D A;  1O57 A;  3L00 A;  4YFX F;  1KU9 A;  4WXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...