2LR8A

Solution nmr structure of casp8-associated protein 2 from homo sapiens, northeast structural genomics consortium (nesg) target hr8150a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
SHMKNVIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords CASP8-associated protein 2
publication title Solution NMR Structure of CASP8-associated protein 2 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8150A
rcsb
source organism Homo sapiens
total genus 20
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lr8A00
5GPAA 1ETWA 1IC8A 3CMYA 3QQAA 1IJWC 2DTZA 3WHCA 1OJLA 5C4XJ 2FX0A 3ZQGA 4D5FA 3ZQCA 4X6AJ 2R0QC 4Y7NJ 2GLOA 3PO3J 1FTTA 4V2GA 3HKZN 5F0HA 2NVQJ 1HDDC 2XPWA 2KDZA 2MW8A 1K61A 5F0FA 1PUFB 1BW6A 3HGYA 2LTPA 2HDDA 1K83J 5DS9A 3IH3A 1ENHA 2Y9YA 2HI3A 2ID3A 1MH4A 2OF7A 2N8GA 3GTJJ 2H1KA 2O8KA 4JYKA 5EGOB 1APLC 2R92J 3TW6A 1B72A 3RZOJ 4A3MJ 3HOYJ 3OIOA 5JLWA 1I6HJ 4MFEA 3JRDA 4A3GJ 1G2HA 2Y0SN 5FKOA 5IYDJ 5K7HA 1QVUA 4FCYA 4M3EA 2JA5J 1MSFC 3BTCA 2M8GX 5FKKA 2TRTA 1VNDA 3RZDJ 1TWGJ 2JA6J 3VPRA 1D5YA 1JJ8C 1HCRA 2NVTJ 2M9HA 3OSGA 1MBHA 1RPWA 3GBGA 5F0CA 1F43A 3JREA 5J1UA 4EEFG 2R93J 4B3AA 4DZJA 5F27A 4V2FA 3GTPJ 4DW6A 3O8GA 4B1RA 1LE8B 5HODA 1GUUA 2XPVA 3BG3A 5E3MA 2HXIA 1Q1VA 9ANTA 3Q0VA 1BL0A 3E7LA 1JJ6C 3LSJA 1TC3C 2VUMJ 2COBA 3ZQHA 4C2MJ 2R5ZB 4A3LJ 1GV5A 2YU9J 2IEKA 2LFBA 2R5YB 2RAEA 1LFUP 1T56A 2VKEA 1U8BA 4RDUA 3TEDA 2VPRA 3D1NI 1NK2P 2EZLA 1ZTRA 4BY7J 1JKOC 5J3LA 2XGCA 1CQTA 1RKWA 2X6OA 1YRNA 4IHYA 4JX5A 1JUPA 4DYRA 3WHBA 1JT6A 3IH2A 3H0GJ 3L1PA 3I4MJ 4QTRA 3I4NJ 4A3JJ 2E2JJ 1OFCX 2QCOA 1JKRC 3S16J 4CYCB 3IV5A 1BW5A 4D5CA 5JLXA 1MSEC 1QPIA 2LR8A 3C2BA 1LFBA 1ETXA 2ECBA 1HDPA 3MKLA 3JRHA 3GTQJ 3S1NJ 4FTHA 5F08A 1MBEA 3BG9A 1JKPC 4DYQA 2WB1N 3BR3A 3GTKJ 4FE4A 1XC5A 2DMTA 5F1JA 1ETQA 1GT0C 2AO9A 4NDLA 2NS8A 2IAIA 2JA8J 2XPUA 1SFOJ 2LKXA 1A5JA 2DMNA 2GBYA 1GDTA 4QSHA 2HOTA 1Y1WJ 2Y2ZA 1HLVA 5FKNA 5FKLA 3G1MA 4S0HB 4D7MA 1DU6A 2E2IJ 5F04A 1EF4A 1BA5A 4J19A 1NK3P 1MNMC 4ABZA 2KT0A 3JRBA 5M5XJ 4A3FJ 3HOVJ 2WV1A 1S7EA 1Y1VJ 2Y30A 3G1LA 2ZB9A 1WGXA 1JT0A 2YUSA 4QIWN 5IOZA 3SFIA 2PMZN 1AKHB 2M2EA 5E3NA 3S1QJ 1WPKA 2LVSA 3FK6A 4M3BA 1WCMJ 5K7FA 2L9RA 3QPSA 2DN0A 5DTDA 4M3DA 3LSPA 1VF9A 2VI6A 4Y52J 3S14J 1UG2A 3G1OA 2DA4A 2HOAA 4XRSG 3SJMA 1E3OC 2K9SA 1MH3A 3O8HA 5FKMA 3PM1A 2QF7A 3LNQA 3BTLA 5M5WJ 2M0CA 2E19A 2DJNA 5IPAA 3S1RJ 3F0CA 3OOUA 1ZR4A 4DZPA 5EEAA 2X9DA 1JTYA 5M3MJ 3BR0A 5C44J 5EG0B 5EYRA 1BJZA 2X48A 5C3EJ 2EZHA 1OCTC 2EQRA 2MSYA 4MFDA 2W48A 1IRZA 3K7AJ 3NARA 3S15J 5IP9J 3BR2A 1P7IA 1B8IA 2GM4A 3TP3A 2P81A 2E2HJ 2OPTA 4XRMA 1FEXA 1AU7A 3HOZJ 2Y31A 1RETA 1UMQA 1ETOA 1ETYA 1ZKGA 4C3HJ 3K2AA 2LY9A 2K9QA 2HQ5A 3LSGA 4I6ZA 5M3FJ 2LP0A 1AHDP 4I76A 2CRGA 3CQZJ 3HOUJ 1VFCA 5EZGA 1B72B 5EZHA 4A3DJ 2E1OA 2K9NA 2G0EA 2ELKA 1U78A 4XRSA 1WH7A 2DA6A 2I10A 3BQYA 1IGNA 2EZIA 1GV2A 3Q3SA 4BKXA 4XIDA 3FISA 4XICA 1MBFA 5M5YJ 1QRYA 1U9NA 4C3IJ 1TWAJ 5BNGA 1TWFJ 1XS9A 4GFBA 4AYBN 2DMPA 4HNVA 2HYJA 4MLOA 3JRAA 1W0UA 4JX6A 2R7ZJ 1RKTA 4DYCA 5E3LA 4UUSB 3JR9A 3DCFA 5GPCA 2LD5A 1I3QJ 4JP0A 1FTZA 2EH3A 2NVXJ 1PUFA 3BR1A 3A01B 3Q0UA 2ME0A 2TCTA 1X2NA 1ETKA 3UKGA 3S2DJ 4W97A 5EGOA 1TWHJ 5J1RA 2XRLA 2DMQA 1I50J 4BY1J 3M4OJ 1JGGA 4IHWA 1WI3A 4BBSJ 3HBLA 2NS7A 3PO2J 1X58A 2DMUA 4JX4A 4A3KJ 2D5VA 4A93J 3SDGA 1F36A 1IG7A 3FIWA 5C4JJ 1ETVA 2LK2A 5FLVA 3BTJA 1Z0XA 1H89C 2L0KA 1YRNB 2DA2A 4M3FA 1MBKA 1SANA 3GTLJ 4G12A 2CUEA 1W0TA 2MGQA 1GVDA 4IHVA 5FLMJ 5FJ8J 1HF0A 2JJ7A 3MN2A 2JA7J 1MBGA 2CUFA 3GTOJ 3S17J 2YS9A 3JRIA 3BR5A 1LE8A 5IP6A 4AC0A 2DA5A 2JK3A 3JRGA 2LLKA 1OCPA 1NTCA 5K7ZA 2L7ZA 1JUSA 1IV6A 3BR6A 1ITYA 2R5ZA 2ID6A 5EF6A 2R5YA 3B6CA 3H3VK 1DU0A 4A3IJ 4X1EA 5J1YA 1FJLA 3JRFA 1MBJA 4C3JJ 2ME6A 1R9TJ 3RQIA 1VI0A 4W1UA 4D7NA 5EDNA 1ZK8A 2DA7A 1IDYA 5IOYA 4BXXJ 3TW7A 5IP7J 2JMWA 1UHSA 1RESA 4FE7A 4CYCA 3S1MJ 2FJ1A 3W6VA 3GTGJ 1JTXA 3HEFA 1U9OA 2CQQA 3HDDA 3BG5A 3QPLA 3ZOBA 1X2MA 4A3BJ 2K40A 2NVYJ 3GTMJ 4UUSA 1ZQ3P 2XGDA 1Z77A 1RR7A 1ZR2A 4BBRJ 3HOWJ 2JWTA 4XK4A 1T33A 2VKVA 4FISA 3A01A 2JN6A 2FD5A 2M34A 3BT9A 1ZGWA 3HM5A 5GP9A 2CQXA 2IBDA 2EZKA 2H8RA 4IHXA 2XGEA 2NOGA 3FKIJ 4M3GA 4MO7A 2B63J 3HB9A 3DEWA 3RKQA 1P7JA 3BQZA 3A03A 3B6AA 4A3CJ 2HOSA 1O4XA 2L7FP 3NAUA 4M6VA 2DA1A 1A6IA 1HOMA 1POGA 1WH5A 4RBOA 4AUXA 2AHQA 1FIPA 4IEJA 1B8IB 2HXOA 1TWCJ 4A69C 2FQ4A 4MIMA 3JRCA 1IUFA 3FK7A 5IYBJ 2XSDC 3M3YJ 3S2HJ 3CDLA 3ZQFA 3LSRA 2CJJA 2CU7A 1AKHA 4LOCA 1JUMA 2DA3A 2O9LA 1H88C 2EBIA 1QVTA 1ORKA 1H8AC 3Q0WA 2O7OA 2WAQN 2MG4A 3IH4A 4A3EJ 3BTIA 1IDZA 1JKQC 3HGGA 5E3OA 2XB5A 4UUTA 1FIAA 2Y9ZA 3MVPA 1XG1A 3TP0A 3ZQIA 2L7MP 2XB0X 3HOXJ 5IYCJ 3A02A 2ECCA 3LOCA 4L5EA 3ZQLA 4B4CA 3CCYA 3OSFA 5EG0A
chains in the Genus database with same CATH superfamily
2AS5F 4EJUA 1MDMA 1IJWC 2JSCA 3WODF 1FT9A 2OAZA 1WRJA 1WQ2A 4LIUA 4CZCA 4X6AJ 1V54H 2GZWA 4RLFA 2R0QC 3DP7A 3SYTA 2YSRA 2CH0A 3CJRB 1HKTA 5F0HA 2NVQJ 2XPWA 2VPLA 1ULYA 1X4OA 1ZARA 4ENJA 5F0FA 2BW3B 2C6YA 1Y0UA 3HGYA 3F6VA 3QRFF 2XV4S 1T8IA 3GMEA 3GTJJ 2OF7A 2MLGA 1O7FA 5GAHJ 5ICFA 2H1KA 2O8KA 5EGOB 1K7AA 4L9NA 1QQIA 1ZG3A 1T38A 2HPMA 1R71A 2QM3A 2JRTA 3DTKA 3RZOJ 3HOYJ 5JLWA 1I6HJ 1KU9A 1OCCH 1UG0A 4A3GJ 1ZN2A 3H5RA 1YIJI 1SAXA 4GYIA 2M1BA 1UAAA 1ZG1A 5K7HA 4BEHB 3ZR8X 4EJOA 4M3EA 3BTCA 1G3SA 2TRTA 3Q9VA 1VNDA 3QYEA 4G7ZF 3ABLH 4BQQA 2F5CA 3BPXA 4PGHA 1TQPA 2A6EF 2R7TA 5FD5A 5FO5A 2EFPA 1VQ5I 3HHGA 5FD6A 1Y56A 5H6RA 2VQCA 1G3TA 3PSFA 5F0CA 4Z2YA 3W3CA 3G73A 1K6YA 2BEOA 5DUKA 1BC7C 1BN5A 5HODA 2O6GE 1GUUA 1IRGA 3BG3A 2LYCA 2HXIA 2GQQA 3Q0VA 3E7LA 1BL0A 3LSJA 2L4AA 2VT2A 2DYRH 1W7PB 2DT5A 3CO7C 4A3LJ 5D8LB 4CZZA 1LKXA 2YU9J 3BP8A 3MQ0A 2DU9A 2VKEA 1MKMA 3N05A 3KZZA 3SHFA 4RDUA 4A5NA 3VSKA 2NOJB 3ABKH 3RDIA 3KP4A 1OCZH 2E7WA 1QO0D 1ZTRA 2X85A 1MMAA 1LVKA 1MMNA 2PFBA 3ZMVA 3A0HC 2QGUA 4HX4A 1RKWA 4BXUA 2KLOA 3CUQC 4XKCA 4IHYA 1X1PA 1YOVB 1ZAOA 4L5IA 3CCRI 3L1PA 3H0GJ 2R7OA 5ICCA 1O57A 1F4KA 1BW5A 1JKRC 3CJNA 5JLXA 4O5VA 2Q2EA 3EUKL 2L9SA 1FBUA 2CUJA 3TL4X 3K70D 3HYIA 2ECBA 5DYMA 1I3AA 3MFKA 1VQ8I 1J0RA 3ABMH 3G3ZA 5E79C 1IZ1A 2PEXA 5F08A 5CVRA 4DYQA 3I5UA 3GTKJ 3RKXA 3IWZA 1H9TA 4CUGA 1GT0C 4NDLA 2XAFA 2NS8A 4A5MA 1SFOJ 2XASA 5AONA 2P7CB 2XDVA 4XKBA 5L3DA 4RLQA 1GDTA 4QSHA 2WADA 1SAUA 3S3MA 3ESWB 4N9IA 2RQQA 4CYDA 1U8RA 4YIFA 2ETHA 2BV6A 3BJ6A 1YITI 5FKLA 2XAJA 3GZNB 2R7FA 1R4NB 1BA5A 4HQEA 4B09A 4PJ0C 4DQ2A 3HOVJ 3E6DA 2ZMEB 2PN6A 1V5GA 3IUOA 1X19A 5KVRA 2QSHX 1DGWY 2CW0F 3SFIA 1XPXA 2HU9A 2QBYA 3S1QJ 1ZG5A 3E97A 3FK6A 2K3FA 1WCMJ 4IJAA 2L9RA 2JT1A 2KQRA 2X51A 3VDXA 5LGTA 2EILH 2L2OA 3HPGA 3PQKA 5BS6A 4XLPF 1UG2A 1XDSA 2Y75A 4IVNA 2X4HA 5CVUA 1JHFA 2DBBA 2KIQA 3SJMA 3C7JA 1NHAA 1MH3A 3I71A 1P2FA 4UNOA 4PFOA 4XR6A 3PM1A 1X1CA 2QF7A 3K4MA 3BTLA 1W7PA 4NNJA 1FWZA 1XTAA 2E19A 2MLKA 4XBFA 3SZGA 2ZFUA 3RYRA 1D1AA 4DZPA 1YS6A 1JTYA 2OC6A 3BR0A 4YG2F 2FQ3A 2WTEA 4LD5A 5C3EJ 2AXLA 3MMYB 5HNFA 2XRNA 1IRZA 3K7AJ 1FC3A 3HC7A 4U87A 4LITA 2ZXHA 2GM4A 1V55H 2WY7Q 2Z3YA 3C2GA 4IF4A 3U2RA 5DM7F 2RGVA 5HOOA 1ETOA 2QQAA 2E5NA 4C3HJ 2ISYA 2LY9A 1CGPA 5M3FJ 2LP0A 1AHDP 2CV2A 4I76A 3ZN1A 4ZH4F 4RB3C 5ICGA 3LSIA 1Z3YA 2WV0A 3M9AA 5B66C 1U3EM 1B72B 2DFIA 2H1LA 5ERIA 2IS4A 2XUBA 1IXRC 1RIOH 2ELKA 2VASA 4P5OA 1BR4A 2EZIA 1GV2A 2E1CA 1SVLA 4OIPF 3TQNA 3OYDA 3K2ZA 3TMOA 1I1GA 5M5YJ 4HEA2 2DXIA 4B47A 1TWAJ 1TWFJ 2EINH 2OCCH 3AKZA 2BVLA 4NB5A 2FA5A 3K70C 1JE8A 3JRAA 1W0UA 2CW7A 4ZYEA 3DKXA 2UXNA 3JR9A 3DCFA 2KRCA 1S7AA 2OCEA 1TT0A 1X1DA 4I98B 1HC8A 1DQUA 1XMKA 2EH3A 3R60A 3SFZA 3BR1A 3KP6A 2BZTA 2ZMEA 1G59A 3BZ6A 2RC4A 1PJRA 4BXFA 5BMZA 3GX4X 2LBFA 5HVQC 3S2DJ 1TWHJ 5J1RA 2WWYA 2H94A 4I7HA 3ULQB 1VQ4I 2KHMA 5FFZA 3LA3A 2EV5A 3PO2J 4M9ZA 4JX4A 2KJBA 3CMEI 1V5FA 1HSTA 2ZMEC 1IG7A 1BOBA 2LK2A 5FLVA 3WTXC 3BTJA 1B59A 1X3UA 3HTUA 1AA7A 4KIGA 2L0KA 1H89C 1YRNB 2DA2A 2V6CA 2VJIA 1E17A 5IT9K 3E6MA 2KDOA 4D0PA 2F5FA 3DBLB 2HZDA 3OYJA 3GTLJ 1IXSB 4G12A 3DXJF 4FASD 4G9YA 1W0TA 4LGWA 1XDUA 3ASNH 1GVDA 5FLMJ 2YPRA 3RPQA 5J6XA 4HSTA 4ENNA 1SMTA 2W00A 6PAXA 2ELJA 4IRGA 2ICWG 1MBGA 5DD4A 4ZDLA 4KDPA 5J4VA 1YX3A 3RPUA 2YS9A 4PUSA 4HF2A 4QPQA 5IP6A 1YO5C 2BE5F 1I1SA 4MQVA 1OR7A 2DJIA 1FYLA 2L7ZA 2V1NA 1IV6A 1ITYA 2E71A 4BYYA 1D8KA 2FBKA 2LF8A 1VQPI 1RNLA 2R5YA 3A4CA 1WI9A 5KHDA 4RAGA 4A3IJ 1W4MA 5CPRB 3VYTB 4BE1A 1W5TA 1P92A 1XX5A 2FNPA 4L9TA 4XM3A 2Z16A 4UB6C 5HS9A 3OYMA 2EV6A 1A36A 4LB6B 3I3LA 2K86A 1XGSA 1SFEA 2DA7A 4R8HA 3T1BA 4AM3A 1S3JA 3ZXSA 3GF2A 4KYWA 1RESA 4FE7A 2QVOA 3EPZA 4KT5C 1O3RA 3RSNA 1BBYA 3KYDB 5E17F 1U9OA 1TTYA 3RCOA 1X1BA 5H6QA 1G4DA 1YHQI 5D5XB 1J59A 2LH9A 5K5OA 1X2MA 2CS3A 4A3BJ 4M73A 2FSWA 2K40A 2KIMA 2RN7A 2GOXB 4E7LA 3CCMI 2ESHA 1ZQ3P 3DBRB 1Z77A 3DF8A 3V7CA 1ZR2A 3EDPA 4BBRJ 3C18A 2A6HF 2XF5A 3CD6I 2JWTA 5LRSA 3MKYB 2JUCA 2VKVA 2HGCA 1CF7B 2PJPA 4E7SA 1I5ZA 2M34A 1R22A 1R36A 4R1HA 2M7AA 4IO9F 4LK0F 4HW0A 1XCBA 1BJAA 2FF4A 4FETA 4M3GA 4P55A 3VSLA 4IHXA 5L3EA 3HB9A 4KA4A 2Y69H 3DTEA 4HOBA 3BQZA 2X0LA 4BL0B 1D8JA 2X6WA 1LUJB 3ECHA 3BPVA 4M6VA 1OYIA 2P5KA 2ZCWA 3I59A 4RM3A 3FXRA 3KP5A 4AUXA 4AU7A 1FIPA 2DK5A 2XKOA 1FMWA 2QKLB 1PP7U 1FBQA 3H3UA 1TWCJ 3HHHA 1O3SA 4BNCA 4D1QA 2MD5A 3JRCA 2A5WA 2VXZA 3VOEA 4KITB 2CQ7A 2LNBA 4LIVA 3W6JB 3IRRA 3CF5F 3M3YJ 2JPCA 2PBIA 4CDGA 1W5CC 3CJTB 2VIXA 1K6OA 4HBLA 1OYWA 2LREA 4ETSA 4U7DA 1YIOA 5L3FA 1E2XA 2BGCA 1BI0A 4UV9A 2EBIA 4XLAA 5E1ZB 2R7UA 1QVTA 2Q8KA 3Q0WA 1PVEA 4OOIA 1ZGAA 4Y4RA 3L2QA 2LG4A 4WWCA 3IH4A 4AVZA 4A3EJ 1DP3A 2A3SA 2NNNA 3HGGA 2XB5A 4H4KC 3CC7I 2IPQX 1FIAA 1QZZA 2Y9ZA 1Q1HA 2M7BA 1PDNC 4P9UA 2OU2A 2L7MP 2XB0X 5D6FA 2HPIA 5B1AH 3DBHB 2NVUB 1OKRA 1RZ4A 1BI1A 1QA6A 2LDUA 2JPBA 2V4JC 1TBXA 1Y39A 2F5EA 3F8MA 1DDNA 5EG0A 3FM5A 1IC8A 4B43A 3T0YA 4ZTFA 1R1UA 2IT0A 4RB2C 2Q1ZB 2FX0A 3ZQCA 4BACA 5D5UB 1FOYA 5TGTA 4V2GA 3G4SI 1IN6A 3GVAA 4XLFA 4UHTA 2KDZA 3EUAA 1K61A 5ILVA 1G3YA 4XRFA 4GYGA 1BW6A 4MQ9F 2LTPA 2O8XA 4UVBA 2FMLA 3E5QA 1ENHA 2OD5A 3ZQQA 4JYKA 4CHUA 4N4OB 1IRXA 5JVGF 3OYNA 2GA2A 2GXGA 4BH9A 3JSPA 2DFHA 1J9IA 2FMYA 3JRDA 2LSOA 4BJ6C 3BG6A 2OZ6A 1G2HA 3DEEA 2B9SA 4BU2A 1QPMA 4FCYA 3DLAA 2OZUA 2X1CA 1WJAA 2H6CA 3BC8A 4AIKA 1KA8A 1KGSA 3AFHA 4JBAA 3LSTA 2STTA 4I02A 5FKKA 1MD0A 2LY1A 3GZ6A 2V9KA 2CV1A 1D5YA 2JA6J 1JJ8C 4RA2A 1ZHFA 3C3WA 4XLEA 2QQ9A 3NWSA 3FX3A 3M7GA 1GHCA 1MBHA 3QP5A 1FOWA 1O7LA 3ASOH 4HYEA 4EEFG 1TNSA 3F23A 4B3AA 4DZJA 3WTYC 1XCVA 4V2FA 2V9PA 3O8GA 3KP3A 1LE8B 1PUEE 1VQKI 5E3MA 3J80Z 1TC3C 1JJ6C 4HV5A 2COBA 2P6SA 2HYGD 3CF2A 1TLHB 4C2MJ 3CCQI 2DAOA 2PJRA 4YFNF 5A2QZ 5LHIA 3O6BB 2KKOA 3VB2A 2K02A 1LFUP 1T56A 2E1MB 2GAUA 2NS0A 4F3QA 4UVCA 4UV8A 2W7NA 2VN2A 1XGMA 5CJ9A 4KIFA 4ZZLA 5BOXA 1NK2P 3U21A 4FT8A 1BR2A 1OLTA 4ASNA 1D0YA 3LSMA 4C9YA 4F91B 1K78B 3WTVC 4JX5A 1FX7A 1I27A 2QLZA 2QSGX 3WHBA 3IH2A 4CICA 2O5RA 4QTRA 2B0LA 3E6BA 1OFCX 3IV5A 3FHZA 1WKMA 5H2FC 4KICA 1MSEC 4P96A 4E7ZA 1MZBA 1MJ9A 1SVMA 3C2BA 4Y3OA 3HIFA 2M8EA 3LWFA 4NC6A 2F2EA 2V79A 3JRHA 3GEZA 3H1CA 4HX8A 1ODDA 4FTHA 2UUZA 4PGGA 3CCEI 1W36C 2MABA 2XAQA 5E18F 3BR3A 1MNEA 4FE4A 5K1YA 3VWBA 2QQ8A 3CLOA 4OWRB 5E1XA 2XPUA 5J40A 4M72A 1A5JA 5KK1A 1JHHA 4OIRF 1XB4A 4NQWB 1Y1WJ 2VOOA 2JUGA 2XVCA 5J4YA 2IA0A 3DPLC 5CQGA 2ZJPF 1TNTA 2MC4A 1Z05A 1WJFA 3K4JA 3OR1C 3BCBA 5FLXZ 4B8XA 2XAUA 4M71A 4A2UA 3K4BA 2KT0A 4ABZA 3CO6C 2WV1A 1EV7A 1Y1VJ 5KNLA 2V26A 3KFWX 4PZJA 1FP2A 2YUSA 4EJWA 2M4GA 3T8RA 1RI7A 2DW4A 4QIWN 1JT0A 3G71I 1AKHB 1WPKA 1LDKB 3LA7A 5DTDA 1R5HA 1VF9A 4CO8A 3CCSI 1QHHD 2VE8A 3IC7A 1SFKA 4MTEA 4XRSG 1E3OC 2K9SA 2VJ5A 3O8HA 2BY2A 5FKMA 3OYFA 3HOSA 3LSKA 2EIMH 2ZSHB 4F55A 1VZ0A 4PJNA 2CWEA 3RYPA 1J2XA 1YJ9I 3GFMA 5EEAA 4GDFA 2FE3A 2MH2A 2HVQA 5C44J 1V4RA 5CKTA 5EYRA 2ZNYA 4ZYAA 2FBHA 1YFHA 1V3FA 3NQOA 5FFXA 3VODA 2IS6A 2V7FA 1E0EA 2B7EA 3EUHC 1JI8A 2P7VB 5IP9J 1FYMA 3BR2A 1B8IA 3AG4H 4L18B 3OYHA 3BZKA 2RNGA 5HLTA 1UELB 1A35A 2EIJH 4HLXA 3MZYA 1YQAA 1YS7A 3GFIA 1VTNC 4XRMA 1HW1A 2E1MC 3HOZJ 4ZDPA 3NRVA 2HVSA 4DBQA 1MJAA 1UMQA 5F64A 3K2AA 3M8FA 1DGRM 1D1CA 2A69F 4HNUA 4KMFA 2HQ5A 3Q5FA 4I6ZA 2DDAA 3GXOA 3CUQA 3OV8A 4LG0A 3CCUI 3CQZJ 3HOUJ 2VB6A 3FMRA 1KU2A 3OYEA 2DODA 3PL8A 4A3DJ 2E1OA 3SXYA 4HLYA 2R7WA 2VKDA 2EWNA 3E5XA 3L09A 3HSRA 2Z33A 3QU3A 4RM2A 3TDZC 2UXXA 4XIDA 3FZVA 1HBXG 3FISA 4XICA 2EV0A 2YX4A 4C3IJ 3KP2A 5BNGA 4N4NB 4NHJA 4DOZA 1A31A 3AG3H 2M4KA 4HNVA 2HYJA 1JXSA 2HTJA 2HTSA 2ZXWH 2ZXIA 1QHGA 4JX6A 2R7ZJ 5DM6F 5E3LA 1ZRFA 1LDDA 2HQRA 2NYXA 3L2UA 1OYYA 5IY5H 4JP0A 3ZRGA 2ZXJA 2NVXJ 2W24A 3OYIA 3WE2A 1Z67A 1SFXA 2BW3A 3A01B 1G8XA 4RGXA 3ZMZA 5TJJA 3WTWC 4WK8F 2HDWA 4J01A 4W97A 5EGOA 1Z3XA 3OS2A 1R5GA 2AQEA 1I50J 4BY1J 4BJ5C 3BZCA 3V7RA 2E35A 4BBSJ 1ACIA 1X58A 3SDGA 2CQKA 3BROA 1F36A 2IRFG 3REOA 2IS1A 4BEHA 4XL9A 3FXQA 3QAHA 1Z0XA 4G8XA 2HYFA 2BOLA 3K1PA 1GXPA 1MBKA 3JCUC 3ELKA 5CVJA 2VBWA 3GWZA 3U1DA 1R6RA 1I6XA 2MGQA 1HF0A 1LEBA 5HS8A 3SZTA 4YFXF 1KONA 2D1HA 2L9NA 1VQ9I 2LMDA 3WTZA 2PMUA 1QZYA 2DCEA 1WJDA 4FQGA 1YJWI 3QOPA 4AC0A 2HKOA 2JK3A 4E70A 1OCPA 3CMAI 5K7ZA 2LC2A 2K9LA 2EPFA 3SEQA 4XOPA 4CCKA 2KRHA 4OIOF 3GO5A 1YJNI 4OINF 1A6QA 1JGSA 3K69A 3TBIA 5E8GA 3I56I 2IXSA 3JRFA 3BWGA 1T98A 1XMXA 1USTA 2DPDA 5K5QA 4PSWA 4C3JJ 3M07A 4ENMA 4I99C 2QA4I 1IAWA 1DP7P 4L0YB 2PQ8A 1VI0A 4W1UA 2IW5A 4EM1A 2JVHA 1P4AA 2L3DA 3PUBA 2R4GA 1ZK8A 3EYYA 1IDYA 5DD8A 5IOYA 5B5EC 4B48A 2JTVA 1OPCA 3LMMA 5EEGA 2FEZA 4MEYF 3FKJA 3HEFA 2CQQA 4EGZA 1BM9A 2P6TA 3TKYA 1HW2A 4EJTA 5FGMA 3HOTA 2QWWA 1EH8A 5LHHA 3OYCA 3I53A 1UCRA 2F48A 3FXOA 2W4SA 2ZSIB 4XLCA 3R4KA 2UZKA 4JQFA 1RR7A 2QEXI 2OA4A 3WG9A 3DU5A 3IKVA 3CC4I 3H9QA 4XMYA 1P9QC 4XK4A 4FISA 3A01A 3PSIA 3BT9A 4A12A 3QWLA 3JAMZ 2CQXA 2ZFWA 2IBDA 3KPHA 4AWXB 4YELA 4E7JA 1X3ZB 3HSEA 4Y15A 5TRDA 3PIOF 3DEWA 3RKQA 4BUPA 2OQGA 1FOKA 1EH6A 2W57A 3A03A 3B6AA 3L2RA 2HQNA 4A3CJ 4WXDA 2DA1A 1A6IA 5CVIA 1POGA 3IKTA 1GLNA 3SDBA 2AHQA 2HXOA 1IRFA 2EA2A 2FQ4A 3DFGA 3J7ZI 3ZMTA 4WXCA 3J7AO 1IUFA 5IYBJ 1ZLKA 2GOMA 2XSDC 3PNTA 3S2HJ 4DGWB 5D5VB 3WU1B 3ZQFA 2Y0MA 3SZPA 4O3MA 1JUMA 3F8FA 3FXMA 3J7YJ 1FSEA 3OMYA 3JSOA 1O3QA 2O9LA 1BIAA 1H88C 1IUYA 3S32A 2XIGA 3J81Z 1ONVA 1ORKA 3E0JB 4BJTA 1XSXA 2WAQN 2AQFA 2XSJC 3BTIA 1JKQC 2ZBKA 2IGNA 3MVPA 3P7NA 3TP0A 3ZQIA 1RC9A 2HVRA 5IYCJ 2EFWA 1TQIA 1B4AA 4IOAF 1WJCA 4Y13A 2EFOA 3I4PA 2ECCA 4E6KG 4B4CA 3CCYA 2F5DA 2X1DA 4L5JA 1ZRDA 4NC8A 1SD6A 5KAFC 3I64A 4GO1A 2L7KA 4XQFA 3CMYA 3QQAA 2WAQA 5HLGA 2DTZA 1Z9CA 2HFHA 1SC7A 1OJLA 2ZO4A 4KJZA 2XHKA 4AIDA 5GAEJ 2OTLI 3PO3J 4IHTA 3SEZA 3WGHA 4AIHA 4PCQA 4CSWA 1HDDC 3HRMA 1UB9A 2D2WA 2MW8A 4GXOA 3OS0A 3H92A 2MH9A 1PUFB 1SEUA 1K83J 5DS9A 3IH3A 2RDPA 3BCAA 4EGYA 2Y9YA 2JA2A 2HI3A 2ID3A 4HPQA 5LFAA 3FXKA 5HDGA 1RRJA 3HRSA 2GIVA 1B9NA 4E7IA 2F5VA 3GUDA 1WJEA 1B72A 3RKYA 4ANJA 2BY3A 1D0XA 3FBNB 4MFEA 1D5VA 2R3SA 2XAGA 4KFCA 3DPTA 2L01A 3GLXA 4KN4X 4I09A 4G7HF 5IYDJ 1QVUA 1VQ6I 3CESA 3K4KA 2X6XA 2JA5J 1XN7A 1FLIA 4B44A 3D5SC 2M8GX 1BI2A 1HSJA 2KFDA 2EIKH 3RZDJ 1U5TB 1TWGJ 5AIQA 4Q5SF 1IV8A 2Q0OA 4BAYA 2ELHA 2NVTJ 2RVCA 3K1MA 1STZA 2KIFA 1RPWA 2H09A 3GBGA 4F7ZA 4RGUA 5LGUA 5JFRA 1F43A 4YEJA 5J1UA 2R93J 3DTIA 4IX7A 4PFPA 1S8NA 1FOXA 3F3XA 4XNFA 2OV7A 3QODA 5HS7A 4S04A 2Z9OA 3RQ4A 3GTPJ 4LFUA 2XROA 1V5EA 1XGNA 2XPVA 3BDDA 1G6NA 3FMSA 4DBRA 1Q1VA 2Z5UA 9ANTA 2RKHA 3P9CA 3AL0B 3AAFA 2KISA 2R5ZB 4U0WA 2LFBA 2RAEA 3HL2A 3N97A 1KQ8A 3QYBA 1KYZA 3G2BA 2LKSA 2E1NA 2VJJA 3D1NI 5B3SH 2EZLA 4XLNF 1WWXA 4BY7J 1JKOC 5J3LA 2A5YB 5LLQA 2X6OA 3LQRA 1YRNA 2VBXA 3T8TA 3LSHA 4DYRA 2QYOA 5JHFA 2FBIA 1JT6A 5D5WB 1MMDA 1P4WA 4YIRX 4A3JJ 4F52A 2ZJQF 1H0MA 4CYCB 3S3NA 1QPIA 4KISA 1S7OA 5HDNA 2WA0A 1R5ID 2CV0A 1LFBA 5AIPA 1Z6RA 3MKLA 2V1UA 3OIQA 1KQ9A 1MBEA 2CW8A 5CVVA 4OAZA 1ON1A 4DIQA 1XC5A 2DMTA 4NBQA 3TOAA 4BQAA 2PX9A 1ETQA 2K3PA 5FRMA 1N78A 2GXBA 2IAIA 4ON0A 2JA8J 2LKXA 3UR3C 1MMGA 1M1EB 3MCZA 2DMNA 3G6EI 2ISZA 1NG6A 4BE0A 4ZJZA 1HQCA 4QWQA 4M74A 2OJED 3CCJI 3K1NA 2KJCA 1HLVA 1F5TA 5FKNA 4L0ZB 3ECOA 3CLQA 2JZYA 3G1MA 5K5RA 4D7MA 4GGGA 1DU6A 2E2IJ 5F04A 2DI3A 2MC3A 3OL3A 2L54A 5E1WA 1NK3P 2PI0A 3IP4B 1FMVA 5M5XJ 4A3FJ 1T08B 1Z91A 2HDCA 3P5JA 2Y30A 5FROA 3G1LA 1C0WA 2NAZA 1K79A 1B6AA 1WGXA 2QENA 3ZCOA 3W2AA 4A0XA 2PMZN 1IN7A 2M2EA 5JHUA 2H27A 3F72A 1T0FC 3CTAA 3I55I 2DN0A 4M3DA 1UJ8A 3KEQA 4HQMA 2CUZA 3LSPA 2VI6A 3S14J 3F9KA 2CMPA 4XLHA 3G1OA 5LEJA 1L3LA 4BE2A 2KIUA 1WHUA 1CF7A 2K5CA 2EJRA 1BC8C 4HNTA 2DYSH 4I0BA 2P5LC 1UHWA 2RREA 3GW2A 3LNQA 2M0CA 1HXDA 4FHTA 2IA2A 2DJNA 5IPAA 3IL2A 3QYFA 2PMZA 2BY0A 3F0CA 2BXYA 3UNGC 1W5SA 1ZR4A 3ONQA 2H6BA 4EQQA 2FXAA 3CDHA 2R7DA 4HV6A 5M3MJ 3OWTA 4HF0A 2X48A 3H35A 5CLSA 1OCTC 4EM0B 1MDMB 2DFEA 2EQRA 2MSYA 3ZQ7A 1KQ0A 4MFDA 1XGOA 2W48A 5DV5A 2M3AA 3ZN0A 4CCNA 3AL0C 5E8IA 3S15J 1S5LC 3WE3A 4EJVA 2P81A 5DEQA 3LAPA 3QP6A 1FEXA 2YR2A 2EFQA 1AU7A 2HNHA 2Y31A 1RETA 4HDVA 3ROUA 4O6JA 2F4MB 3R61A 3HSFA 4UVAA 2K9QA 3LSGA 3COAC 4G6QA 3QPHA 3OR2C 2CRGA 2VONA 2Z1DA 2VC1A 3I0TA 5EZGA 3CCLI 1USSA 4DJAA 1AWCA 2BBYA 1XSDA 3W2WA 4IL6C 4RB1A 2UWMA 3I54A 2VBYA 4BQNA 2CO5A 4XRSA 2MFZA 4UB8C 5JVTA 2DA6A 3BQYA 2DOAA 3Q3SA 4BKXA 1Z21A 2K4BA 3CJQB 2I8DA 1MBFA 2F6CA 4PSXA 3BG7A 3C2HA 4ZYHA 1QRYA 1U9NA 3RIRA 1R1TA 4AYBN 1D3YA 2WAEA 5GTIC 2DMPA 3IWFA 1FNNA 4RGSA 1J5YA 4MLOA 4PJMA 5ICEA 2R7VA 3FHNA 1RKTA 4UUSB 1KYWA 3WTUC 5L3CA 5GPCA 2LD5A 1I3QJ 5KAIC 4U0VA 2IP2A 5TISC 2RNJA 4LJZF 4LB5A 3TDUC 3LA2A 3Q0UA 4QLCU 4KNYA 2DQRA 4AYBA 3J80K 1X2NA 1ETKA 2R7SA 1J09A 3DQVC 3MKWB 3M8EA 2A68F 4U88A 4EV0A 2J5OA 1LB2A 3M4OJ 5A2QK 4IHWA 3BJAA 1WI3A 1FPQA 2NS7A 2DMUA 4A3KJ 2D5VA 4A93J 2W84A 2DQLA 4WX9A 4IRIA 3S8PA 5BQTA 3V7SA 5CYVA 3PNVA 2UV1A 2LF7A 4HZFA 4M3FA 4P9FA 5J47A 3HJEA 3ZGKA 2K7LA 3JTHA 4A0YA 4ZYGA 1IN4A 3FBIB 4IHVA 3E1SA 2D45A 2JJ7A 3MN2A 3CP8A 1FYKA 1Z7UA 2EA4A 2KPMA 1TT5B 2Q2EB 3TO6A 2JA7J 2E7XA 4C2UA 3IAM2 4L9JA 1R7JA 2CUFA 2GXAA 3GTOJ 4BHCA 3S17J 2QKMB 1KZHA 3R6SA 2R7RA 2CGPA 1LE8A 3FXJA 1GVJA 3L9FA 4OMYA 2DOFA 2ESNA 1BI3A 2Y48A 1VQ7I 3AG1H 4P1WA 2V1XA 3EUHA 3JRGA 1NTCA 3VEPA 1XMAA 1JUSA 3BR6A 2VQGA 1MW7A 3ZPLA 3CZ6A 2QZ8A 1N25A 2LRDA 3B6CA 4WXHA 3E3VA 3FMQA 1ZRCA 4MTDA 2COMA 1N75A 4HA8A 1A04A 1RUOA 4TV7A 3K4NA 3HG9A 3F8BA 2I5UA 3OYGA 1OISA 1DPUA 3PFYA 3NEUA 1R23A 1PP8F 2K85A 5LHGA 2ME6A 3X2QH 3RQIA 4D7NA 2X6YA 5EDNA 4G6TB 1K78A 4Y33A 3TW7A 5FLXK 2QSFX 2JMWA 1UHSA 5JR3A 3OYLA 3KX2A 3EYIA 3LAJA 2FJ1A 3W6VA 2O61A 3GTGJ 1MIJA 2XKPA 4S05A 1BOAA 1R58A 1VQNI 1F9NA 2QBYB 3BG5A 4XN0A 3ZOBA 4II3A 3KP7A 2V9VA 3D0SA 1W7PD 1FP1D 1BIBA 2NVYJ 3L00A 3TO7A 1XSVA 4EVIA 4UUSA 3GTMJ 2VC0A 2L4MA 3HRTA 4BQOA 3FXLA 1VQLI 2JN6A 1HA8A 2FD5A 3VYUB 5LBQA 1ZGWA 1T39A 3FXUA 3KEOA 2BHYA 4WF2A 1YE9A 4JK1X 3HZJA 2G7UA 2H8RA 5FRNA 2DOEA 2XGEA 2NOGA 2P0WA 4LLGF 1IW7F 3K0LA 3V8KA 1ERDA 1P7JA 4NQWA 2ZKZA 3KZIC 3U9GA 2IA1A 4AIJA 1S29A 1B1BA 4FX4A 4Z6YA 3WTTC 3WGGA 3KEYA 4RBOA 2VQHA 3VYRB 4M9XA 1DUXC 1NH3A 4Q48A 3M1CA 3KLNA 4G6DA 1ZREA 1LJ9A 3V4GA 2HEOA 4BDZA 3B73A 3F8NA 2IGKA 1FY7A 1Y6IA 1ZGJA 2CJJA 1LQ1A 1AKHA 2D1VA 3M8JA 5LD2C 3FF5A 4BHBA 4GRIA 4NC7A 1Y8RB 2GA1A 2BXZA 3HUGB 3LL7A 2LY2A 2O7OA 5L3GA 2LOOA 1HW5A 1IDZA 2CYYA 1EA3A 4II2A 4C30A 1WJBA 2CQNA 2ZC2A 3KZYA 5EEHA 2XGXA 3O3KA 1K4SA 3K10A 4XSXF 3Q9SA 1H9GA 3GFLA 4PK4A 4ESFA 3OL4A 2OQRA 3B02A 3L7WA 3LOCA 4L5EA 2WY8Q 3I9V2 3ZQLA 2MD0A 3OSFA 1GXQA 1U0JA 4A6EA 5GPAA 3QU6A 1ETWA 3E5UA 1LNWA 3L2WA 4XORA 1EJ9A 1O3TA 3D5LA 3PNYA 2FRHA 4KN7X 3WHCA 3ZQGA 4D5FA 5C4XJ 2Z2SB 3LQQA 1MGTA 1SVOA 2VL8A 4HX7A 3F6OA 2HS5A 4Y7NJ 2GLOA 4A0ZA 1FTTA 3ISPA 3HKZN 1PYVA 3MWMA 2HDDA 3V8LA 4XKVA 1U6GA 1LPQA 3TGNA 1MMSA 2XF7A 4L9VA 2LBFB 1MH4A 2CSOA 2N8GA 4IRHA 5LRRA 3QPTA 1Y0NA 1APLC 2MA3A 2R92J 3TW6A 1TW3A 3ERMA 1YX5A 4LLLA 2PMHA 4A3MJ 2O03A 3OIOA 2XC7A 4I01A 3HKZA 3NWTA 3LFUA 2Y0SN 5FKOA 5JI6A 2L02A 1WJ5A 1SMYF 1TQMA 4WCGA 4IZZA 1YW9A 3C1DA 1MSFC 2EFNA 3RPUD 4N9HA 3A2KA 4F93B 4KUMA 3VPRA 2L9VA 1HCRA 4CA0A 2P8TA 2L5QA 3R0JA 4IHSA 2M9HA 3OSGA 2VOPA 3KLOA 4YRVA 2P5VA 2W1OA 2Y0SA 3D5RC 3JREA 3J7AY 1J75A 2VT3A 2DFFA 5F27A 3KCCA 1XD7A 3I58A 4DW6A 4B1RA 4NUBA 4ZC3A 4CCLA 4HRIA 1E3PA 3JW4A 2JSPA 3M1EA 3H5NA 1TL8A 2IGMA 2W25A 2FOWA 4MGRA 2VUMJ 2AXTC 4R79A 3JTGA 3ZQHA 1GV5A 3FWEA 1KU7A 2IEKA 2A07F 2R5YB 1WVRA 2E36A 5D6EA 3CCVI 1U8BA 5GTHC 3HUGA 3TEDA 2VXDA 2W82A 2K9MA 2VPRA 2M5WA 2KZGA 1ZH5A 3DKYA 4J00A 1HKSA 2JVGA 4KT6A 5L3BA 2TDXA 5IT9Z 1WZ2A 3DU6A 2XGCA 3DLLF 5DCFA 1CQTA 4EMSA 1JUPA 1ZLJA 3I4MJ 3F22A 4PDKA 5F6FA 3I4NJ 1WFXA 1RR8C 2STWA 2E2JJ 2QCOA 3S16J 4D5CA 4JOMA 2LR8A 2IVMA 3ML6A 3WU2C 5BPIA 1ETXA 4U0YA 1HDPA 4FX0A 4GCVA 4KMUX 2DK8A 1N77A 3GTQJ 1LEAA 5J8FA 3S1NJ 4RAFA 1QGPA 3BG9A 1JKPC 3MZ8A 2WB1N 3IRQA 4IXAA 5F1JA 2M0MA 1IXCA 1OMIA 2AO9A 4LG3A 3PIPF 2RV8A 2DLLA 2HQAA 3MKZA 4EATA 4E7HA 4B3XA 3H3ZA 3JAMK 3H36A 4MHGA 2DO7A 1J7KA 2GBYA 2OTJI 4BS9A 2HZTA 4MNUA 3V8JA 2HOTA 2Y2ZA 5D4RA 2OUMA 2FU4A 2WB1A 3R0AA 2J5PA 2WC2A 3I59B 4S0HB 2NRAC 4UUVA 3V42A 3EETA 4BHPA 1EF4A 5B1BH 3CC2I 4J19A 1MNMC 3JRBA 2KMUA 1T6SA 3DEUA 4KIBA 1S7EA 5D8KB 3H0DA 3K4LA 3A1YA 2ZB9A 5IOZA 5D4SA 2DT6A 1FZPB 2KRFA 5E3NA 1P4XA 1KU3A 2LVSA 2K27A 4M3BA 4BGDA 5K7FA 4G7OF 2E34A 3QPSA 4LK1F 3HRUA 3ZMSA 2HR3A 4CXFA 4Y52J 2VKHA 5GADJ 1TZLA 4HAMA 5GAGJ 1ZYRF 2DA4A 2HOAA 3J81K 2WAFA 3CDIA 1EH7A 4E4HA 3TO9A 5M5WJ 2A61A 5HNHA 2KL4A 2OBPA 3W2VA 3E6CC 4Q4ZF 3S1RJ 1SD5A 3OOUA 1NG7A 1L0OC 2X9DA 3KE2A 3H9GA 2QUFA 3P9KA 1WSUA 5F1RA 5EG0B 1BJZA 3ZMUA 2EZHA 3IAS2 1R00A 1YI2I 3NARA 4YFKF 1OR7C 5FB2A 4IOCF 1P7IA 2VE9A 3QOEA 1UFMA 2JQ7A 3TP3A 2IJLA 1YTYA 4YIIA 1P6RA 2HWVA 3H5AA 2E2HJ 2OPTA 2ZNZA 3BY6A 3OS1A 4I0AA 2K4JA 3PFIA 3TOBA 2DT7B 2PLYA 4ENKA 1ETYA 1ZKGA 4A6DA 4OIQF 1TW2A 2HKXA 2EB7A 2O3FA 1UZCA 2JRMA 3ZMDA 1X4PA 3BLYA 2G9WA 4ZDOA 3O2PE 1VFCA 3MEXA 1YYVA 3FM3A 5EZHA 4AVPA 4ESBA 2K9NA 3S93A 5J8CA 1D1BA 1MNDA 2VODA 2G0EA 1TP4A 4M9SA 2V6EA 4V19K 2VLAA 1U78A 4XSZF 2RQPA 1WH7A 2I10A 1DPRA 1EKEA 1IGNA 4CGZA 1E3HA 1R1VA 4CCOA 3U1KA 3K4CA 2X1EA 4ZYDA 5CQEA 1X3WB 2M87A 3F21A 1XS9A 1YG2A 4GFBA 1HKQA 3RTRA 3OYAA 1F1ZA 4E7KA 3H9JA 3DV8A 5ILSA 3N4MA 3OYBA 4DYCA 3MZHA 5DCMB 3W6KB 2XF6A 1Y8QB 2HOEA 5IT3A 3L2VA 3ABUA 2KP6A 1ZELA 2CFOA 4CCJA 1FTZA 3KYLA 3BOQA 1PUFA 2W85A 2M30A 2IS2A 1QBJA 1UHMA 2ME0A 2Z99A 2TCTA 3IHUA 1SFUA 3PJRA 3UKGA 4I2OA 1RUNA 4AD9A 2PJRB 4QPOA 2O0YA 2XRLA 2DMQA 4CCMA 1QZEA 1JGGA 1S9HA 3ERED 3HBLA 1G3WA 1X1AA 3OYKA 1W36D 1FBSA 3KYCB 3FIWA 5C4JJ 1ETVA 2YX7A 1T0FA 3CUOA 4G94A 3S3OA 4HDUA 1QNTA 2DDBA 3BJOA 2VQLA 4M6XA 4LLNA 1R49A 4U7BA 1LVAA 1SANA 2CUEA 2P4WA 2NNYA 1U5TA 5KCMA 3OOPA 4F92B 5FJ8J 1T95A 5E20A 1BR1A 2G7HA 3AG2H 3KIOA 1VQMI 1S6LA 1I39A 2YU3A 3VYSB 4D9JA 5ED4A 4HF1A 3JRIA 3BR5A 1R4MB 2F4OB 1OQYA 3CMMA 1YLFA 1U5TC 2H8WA 1QU3A 1SD7A 4DNCA 2DA5A 2CFXA 2FUG2 2LLKA 4OU0A 4XOTA 5LGNA 1VQOI 4M6YA 2R5ZA 2ID6A 5EF6A 3LFKA 3ZP5A 2BY1A 4RB0A 3H3VK 1DU0A 4RS8A 1S72I 4X1EA 4C2TA 5H20A 5J1YA 1SD4A 1FJLA 1MBJA 2CG4A 4IQ4A 2BVMA 2DTRA 3HXLA 4K2EA 4X0GA 3OIPA 3PQJA 1R9TJ 2WBMA 3FDYA 4MEXF 1W1WE 1ON2A 4UXNA 4PJJA 4IKFA 4BXXJ 4XONA 5IP7J 4ZTJA 5HLHA 2KZVA 3DKWA 4HG2A 4CH7A 2ZJ2A 4CYCA 3S1MJ 1OCRH 1JTXA 4XN3A 4UY8I 3HDDA 3HTSB 4ZZDA 3GCMA 3A0BC 2BHZA 3QPLA 4Q47A 3K6GA 2MBFA 1FSHA 4XKWA 2LKPA 1Z6TA 1LDJA 2R7QA 5BPDA 2BYVE 5DCMA 2FNAA 2XGDA 4OMZA 2VJ4A 4HSRA 2VBZA 4RAZA 3RKWA 3S2WA 3HOWJ 3MAJA 1T2KA 4Y17A 1T33A 5ILUA 5LEKA 2QQBA 3K9TA 3HM5A 3F8CA 5GP9A 1YW8A 2EZKA 2M45A 3FKIJ 4MO7A 2B63J 2EK5A 3MD2A 2XAHA 3DWLE 3SQNA 2R7XA 1IN8A 2F4IA 1O4XA 2L7FP 2HOSA 2E60A 3NAUA 1YW7A 1D0ZA 4N0BA 4PJLA 3L2CA 4ESJA 1B9MA 1WH5A 1HOMA 2IGOA 2MYSA 4BDYA 4ITVA 2GWRA 1B8IB 4IEJA 2GIZA 3KETA 1IN5A 4RAYA 1IO2A 3T5XA 4A69C 2ACJA 4MIMA 5EJCA 3GZ5A 5HLIA 1OCOH 1Z7LA 1IF1A 1K4TA 3FK7A 1LFPA 4IQJA 2DPUA 3RJPA 5HDKA 3DPUA 3OY9A 1U2WA 3CDLA 3GLLA 5DUIA 3WGIA 2NXNB 5DDGA 3LSRA 3WTSC 2E5ZA 2CU7A 3GFJA 1MJBA 3CUQB 4LOCA 4LG0B 4LMYA 4RGRA 2FOKA 2V1DA 2DA3A 3PUFA 4RMNA 1AOYA 1H8AC 2A6TA 4OAYA 1REPC 2MG4A 3ABTA 4H0EA 3HPHA 5E3OA 4UUTA 3WG7H 3P9IA 1XG1A 3WU0A 2PG4A 3HOXJ 4IPAA 3RI4A 2ZJRF 3GYHX 2ADUA 3A02A 3VFZA 1Z1DA 4EM2A 3EQLF 2A05A 3CP2A
chains in the Genus database with same CATH topology
5GPAA 1ETWA 1IC8A 3CMYA 3QQAA 1IJWC 2DTZA 3WHCA 1OJLA 5C4XJ 2FX0A 3ZQGA 4D5FA 3ZQCA 4X6AJ 2R0QC 4Y7NJ 2GLOA 3PO3J 1FTTA 4V2GA 3HKZN 5F0HA 2NVQJ 1HDDC 2XPWA 2KDZA 2MW8A 1K61A 5F0FA 1PUFB 1BW6A 3HGYA 2LTPA 2HDDA 1K83J 5DS9A 3IH3A 1ENHA 2Y9YA 2HI3A 2ID3A 1MH4A 2OF7A 2N8GA 3GTJJ 2H1KA 2O8KA 4JYKA 5EGOB 1APLC 2R92J 3TW6A 1B72A 3RZOJ 4A3MJ 3HOYJ 3OIOA 5JLWA 1I6HJ 4MFEA 3JRDA 4A3GJ 1G2HA 2Y0SN 5FKOA 5IYDJ 5K7HA 1QVUA 4FCYA 4M3EA 2JA5J 1MSFC 3BTCA 2M8GX 5FKKA 2TRTA 1VNDA 3RZDJ 1TWGJ 2JA6J 3VPRA 1D5YA 1JJ8C 1HCRA 2NVTJ 2M9HA 3OSGA 1MBHA 1RPWA 3GBGA 5F0CA 1F43A 3JREA 5J1UA 4EEFG 2R93J 4B3AA 4DZJA 5F27A 4V2FA 3GTPJ 4DW6A 3O8GA 4B1RA 1LE8B 5HODA 1GUUA 2XPVA 3BG3A 5E3MA 2HXIA 1Q1VA 9ANTA 3Q0VA 1BL0A 3E7LA 1JJ6C 3LSJA 1TC3C 2VUMJ 2COBA 3ZQHA 4C2MJ 2R5ZB 4A3LJ 1GV5A 2YU9J 2IEKA 2LFBA 2R5YB 2RAEA 1LFUP 1T56A 2VKEA 1U8BA 4RDUA 3TEDA 2VPRA 3D1NI 1NK2P 2EZLA 1ZTRA 4BY7J 1JKOC 5J3LA 2XGCA 1CQTA 1RKWA 2X6OA 1YRNA 4IHYA 4JX5A 1JUPA 4DYRA 3WHBA 1JT6A 3IH2A 3H0GJ 3L1PA 3I4MJ 4QTRA 3I4NJ 4A3JJ 2E2JJ 1OFCX 2QCOA 1JKRC 3S16J 4CYCB 3IV5A 1BW5A 4D5CA 5JLXA 1MSEC 1QPIA 2LR8A 3C2BA 1LFBA 1ETXA 2ECBA 1HDPA 3MKLA 3JRHA 3GTQJ 3S1NJ 4FTHA 5F08A 1MBEA 3BG9A 1JKPC 4DYQA 2WB1N 3BR3A 3GTKJ 4FE4A 1XC5A 2DMTA 5F1JA 1ETQA 1GT0C 2AO9A 4NDLA 2NS8A 2IAIA 2JA8J 2XPUA 1SFOJ 2LKXA 1A5JA 2DMNA 2GBYA 1GDTA 4QSHA 2HOTA 1Y1WJ 2Y2ZA 1HLVA 5FKNA 5FKLA 3G1MA 4S0HB 4D7MA 1DU6A 2E2IJ 5F04A 1EF4A 1BA5A 4J19A 1NK3P 1MNMC 4ABZA 2KT0A 3JRBA 5M5XJ 4A3FJ 3HOVJ 2WV1A 1S7EA 1Y1VJ 2Y30A 3G1LA 2ZB9A 1WGXA 1JT0A 2YUSA 4QIWN 5IOZA 3SFIA 2PMZN 1AKHB 2M2EA 5E3NA 3S1QJ 1WPKA 2LVSA 3FK6A 4M3BA 1WCMJ 5K7FA 2L9RA 3QPSA 2DN0A 5DTDA 4M3DA 3LSPA 1VF9A 2VI6A 4Y52J 3S14J 1UG2A 3G1OA 2DA4A 2HOAA 4XRSG 3SJMA 1E3OC 2K9SA 1MH3A 3O8HA 5FKMA 3PM1A 2QF7A 3LNQA 3BTLA 5M5WJ 2M0CA 2E19A 2DJNA 5IPAA 3S1RJ 3F0CA 3OOUA 1ZR4A 4DZPA 5EEAA 2X9DA 1JTYA 5M3MJ 3BR0A 5C44J 5EG0B 5EYRA 1BJZA 2X48A 5C3EJ 2EZHA 1OCTC 2EQRA 2MSYA 4MFDA 2W48A 1IRZA 3K7AJ 3NARA 3S15J 5IP9J 3BR2A 1P7IA 1B8IA 2GM4A 3TP3A 2P81A 2E2HJ 2OPTA 4XRMA 1FEXA 1AU7A 3HOZJ 2Y31A 1RETA 1UMQA 1ETOA 1ETYA 1ZKGA 4C3HJ 3K2AA 2LY9A 2K9QA 2HQ5A 3LSGA 4I6ZA 5M3FJ 2LP0A 1AHDP 4I76A 2CRGA 3CQZJ 3HOUJ 1VFCA 5EZGA 1B72B 5EZHA 4A3DJ 2E1OA 2K9NA 2G0EA 2ELKA 1U78A 4XRSA 1WH7A 2DA6A 2I10A 3BQYA 1IGNA 2EZIA 1GV2A 3Q3SA 4BKXA 4XIDA 3FISA 4XICA 1MBFA 5M5YJ 1QRYA 1U9NA 4C3IJ 1TWAJ 5BNGA 1TWFJ 1XS9A 4GFBA 4AYBN 2DMPA 4HNVA 2HYJA 4MLOA 3JRAA 1W0UA 4JX6A 2R7ZJ 1RKTA 4DYCA 5E3LA 4UUSB 3JR9A 3DCFA 5GPCA 2LD5A 1I3QJ 4JP0A 1FTZA 2EH3A 2NVXJ 1PUFA 3BR1A 3A01B 3Q0UA 2ME0A 2TCTA 1X2NA 1ETKA 3UKGA 3S2DJ 4W97A 5EGOA 1TWHJ 5J1RA 2XRLA 2DMQA 1I50J 4BY1J 3M4OJ 1JGGA 4IHWA 1WI3A 4BBSJ 3HBLA 2NS7A 3PO2J 1X58A 2DMUA 4JX4A 4A3KJ 2D5VA 4A93J 3SDGA 1F36A 1IG7A 3FIWA 5C4JJ 1ETVA 2LK2A 5FLVA 3BTJA 1Z0XA 1H89C 2L0KA 1YRNB 2DA2A 4M3FA 1MBKA 1SANA 3GTLJ 4G12A 2CUEA 1W0TA 2MGQA 1GVDA 4IHVA 5FLMJ 5FJ8J 1HF0A 2JJ7A 3MN2A 2JA7J 1MBGA 2CUFA 3GTOJ 3S17J 2YS9A 3JRIA 3BR5A 1LE8A 5IP6A 4AC0A 2DA5A 2JK3A 3JRGA 2LLKA 1OCPA 1NTCA 5K7ZA 2L7ZA 1JUSA 1IV6A 3BR6A 1ITYA 2R5ZA 2ID6A 5EF6A 2R5YA 3B6CA 3H3VK 1DU0A 4A3IJ 4X1EA 5J1YA 1FJLA 3JRFA 1MBJA 4C3JJ 2ME6A 1R9TJ 3RQIA 1VI0A 4W1UA 4D7NA 5EDNA 1ZK8A 2DA7A 1IDYA 5IOYA 4BXXJ 3TW7A 5IP7J 2JMWA 1UHSA 1RESA 4FE7A 4CYCA 3S1MJ 2FJ1A 3W6VA 3GTGJ 1JTXA 3HEFA 1U9OA 2CQQA 3HDDA 3BG5A 3QPLA 3ZOBA 1X2MA 4A3BJ 2K40A 2NVYJ 3GTMJ 4UUSA 1ZQ3P 2XGDA 1Z77A 1RR7A 1ZR2A 4BBRJ 3HOWJ 2JWTA 4XK4A 1T33A 2VKVA 4FISA 3A01A 2JN6A 2FD5A 2M34A 3BT9A 1ZGWA 3HM5A 5GP9A 2CQXA 2IBDA 2EZKA 2H8RA 4IHXA 2XGEA 2NOGA 3FKIJ 4M3GA 4MO7A 2B63J 3HB9A 3DEWA 3RKQA 1P7JA 3BQZA 3A03A 3B6AA 4A3CJ 2HOSA 1O4XA 2L7FP 3NAUA 4M6VA 2DA1A 1A6IA 1HOMA 1POGA 1WH5A 4RBOA 4AUXA 2AHQA 1FIPA 4IEJA 1B8IB 2HXOA 1TWCJ 4A69C 2FQ4A 4MIMA 3JRCA 1IUFA 3FK7A 5IYBJ 2XSDC 3M3YJ 3S2HJ 3CDLA 3ZQFA 3LSRA 2CJJA 2CU7A 1AKHA 4LOCA 1JUMA 2DA3A 2O9LA 1H88C 2EBIA 1QVTA 1ORKA 1H8AC 3Q0WA 2O7OA 2WAQN 2MG4A 3IH4A 4A3EJ 3BTIA 1IDZA 1JKQC 3HGGA 5E3OA 2XB5A 4UUTA 1FIAA 2Y9ZA 3MVPA 1XG1A 3TP0A 3ZQIA 2L7MP 2XB0X 3HOXJ 5IYCJ 3A02A 2ECCA 3LOCA 4L5EA 3ZQLA 4B4CA 3CCYA 3OSFA 5EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GPA A;  1ETW A;  1IC8 A;  3CMY A;  3QQA A;  1IJW C;  2DTZ A;  3WHC A;  1OJL A;  5C4X J;  2FX0 A;  3ZQG A;  4D5F A;  3ZQC A;  4X6A J;  2R0Q C;  4Y7N J;  2GLO A;  3PO3 J;  1FTT A;  4V2G A;  3HKZ N;  5F0H A;  2NVQ J;  1HDD C;  2XPW A;  2KDZ A;  2MW8 A;  1K61 A;  5F0F A;  1PUF B;  1BW6 A;  3HGY A;  2LTP A;  2HDD A;  1K83 J;  5DS9 A;  3IH3 A;  1ENH A;  2Y9Y A;  2HI3 A;  2ID3 A;  1MH4 A;  2OF7 A;  2N8G A;  3GTJ J;  2H1K A;  2O8K A;  4JYK A;  5EGO B;  1APL C;  2R92 J;  3TW6 A;  1B72 A;  3RZO J;  4A3M J;  3HOY J;  3OIO A;  5JLW A;  1I6H J;  4MFE A;  3JRD A;  4A3G J;  1G2H A;  2Y0S N;  5FKO A;  5IYD J;  5K7H A;  1QVU A;  4FCY A;  4M3E A;  2JA5 J;  1MSF C;  3BTC A;  2M8G X;  5FKK A;  2TRT A;  1VND A;  3RZD J;  1TWG J;  2JA6 J;  3VPR A;  1D5Y A;  1JJ8 C;  1HCR A;  2NVT J;  2M9H A;  3OSG A;  1MBH A;  1RPW A;  3GBG A;  5F0C A;  1F43 A;  3JRE A;  5J1U A;  4EEF G;  2R93 J;  4B3A A;  4DZJ A;  5F27 A;  4V2F A;  3GTP J;  4DW6 A;  3O8G A;  4B1R A;  1LE8 B;  5HOD A;  1GUU A;  2XPV A;  3BG3 A;  5E3M A;  2HXI A;  1Q1V A;  9ANT A;  3Q0V A;  1BL0 A;  3E7L A;  1JJ6 C;  3LSJ A;  1TC3 C;  2VUM J;  2COB A;  3ZQH A;  4C2M J;  2R5Z B;  4A3L J;  1GV5 A;  2YU9 J;  2IEK A;  2LFB A;  2R5Y B;  2RAE A;  1LFU P;  1T56 A;  2VKE A;  1U8B A;  4RDU A;  3TED A;  2VPR A;  3D1N I;  1NK2 P;  2EZL A;  1ZTR A;  4BY7 J;  1JKO C;  5J3L A;  2XGC A;  1CQT A;  1RKW A;  2X6O A;  1YRN A;  4IHY A;  4JX5 A;  1JUP A;  4DYR A;  3WHB A;  1JT6 A;  3IH2 A;  3H0G J;  3L1P A;  3I4M J;  4QTR A;  3I4N J;  4A3J J;  2E2J J;  1OFC X;  2QCO A;  1JKR C;  3S16 J;  4CYC B;  3IV5 A;  1BW5 A;  4D5C A;  5JLX A;  1MSE C;  1QPI A;  2LR8 A;  3C2B A;  1LFB A;  1ETX A;  2ECB A;  1HDP A;  3MKL A;  3JRH A;  3GTQ J;  3S1N J;  4FTH A;  5F08 A;  1MBE A;  3BG9 A;  1JKP C;  4DYQ A;  2WB1 N;  3BR3 A;  3GTK J;  4FE4 A;  1XC5 A;  2DMT A;  5F1J A;  1ETQ A;  1GT0 C;  2AO9 A;  4NDL A;  2NS8 A;  2IAI A;  2JA8 J;  2XPU A;  1SFO J;  2LKX A;  1A5J A;  2DMN A;  2GBY A;  1GDT A;  4QSH A;  2HOT A;  1Y1W J;  2Y2Z A;  1HLV A;  5FKN A;  5FKL A;  3G1M A;  4S0H B;  4D7M A;  1DU6 A;  2E2I J;  5F04 A;  1EF4 A;  1BA5 A;  4J19 A;  1NK3 P;  1MNM C;  4ABZ A;  2KT0 A;  3JRB A;  5M5X J;  4A3F J;  3HOV J;  2WV1 A;  1S7E A;  1Y1V J;  2Y30 A;  3G1L A;  2ZB9 A;  1WGX A;  1JT0 A;  2YUS A;  4QIW N;  5IOZ A;  3SFI A;  2PMZ N;  1AKH B;  2M2E A;  5E3N A;  3S1Q J;  1WPK A;  2LVS A;  3FK6 A;  4M3B A;  1WCM J;  5K7F A;  2L9R A;  3QPS A;  2DN0 A;  5DTD A;  4M3D A;  3LSP A;  1VF9 A;  2VI6 A;  4Y52 J;  3S14 J;  1UG2 A;  3G1O A;  2DA4 A;  2HOA A;  4XRS G;  3SJM A;  1E3O C;  2K9S A;  1MH3 A;  3O8H A;  5FKM A;  3PM1 A;  2QF7 A;  3LNQ A;  3BTL A;  5M5W J;  2M0C A;  2E19 A;  2DJN A;  5IPA A;  3S1R J;  3F0C A;  3OOU A;  1ZR4 A;  4DZP A;  5EEA A;  2X9D A;  1JTY A;  5M3M J;  3BR0 A;  5C44 J;  5EG0 B;  5EYR A;  1BJZ A;  2X48 A;  5C3E J;  2EZH A;  1OCT C;  2EQR A;  2MSY A;  4MFD A;  2W48 A;  1IRZ A;  3K7A J;  3NAR A;  3S15 J;  5IP9 J;  3BR2 A;  1P7I A;  1B8I A;  2GM4 A;  3TP3 A;  2P81 A;  2E2H J;  2OPT A;  4XRM A;  1FEX A;  1AU7 A;  3HOZ J;  2Y31 A;  1RET A;  1UMQ A;  1ETO A;  1ETY A;  1ZKG A;  4C3H J;  3K2A A;  2LY9 A;  2K9Q A;  2HQ5 A;  3LSG A;  4I6Z A;  5M3F J;  2LP0 A;  1AHD P;  4I76 A;  2CRG A;  3CQZ J;  3HOU J;  1VFC A;  5EZG A;  1B72 B;  5EZH A;  4A3D J;  2E1O A;  2K9N A;  2G0E A;  2ELK A;  1U78 A;  4XRS A;  1WH7 A;  2DA6 A;  2I10 A;  3BQY A;  1IGN A;  2EZI A;  1GV2 A;  3Q3S A;  4BKX A;  4XID A;  3FIS A;  4XIC A;  1MBF A;  5M5Y J;  1QRY A;  1U9N A;  4C3I J;  1TWA J;  5BNG A;  1TWF J;  1XS9 A;  4GFB A;  4AYB N;  2DMP A;  4HNV A;  2HYJ A;  4MLO A;  3JRA A;  1W0U A;  4JX6 A;  2R7Z J;  1RKT A;  4DYC A;  5E3L A;  4UUS B;  3JR9 A;  3DCF A;  5GPC A;  2LD5 A;  1I3Q J;  4JP0 A;  1FTZ A;  2EH3 A;  2NVX J;  1PUF A;  3BR1 A;  3A01 B;  3Q0U A;  2ME0 A;  2TCT A;  1X2N A;  1ETK A;  3UKG A;  3S2D J;  4W97 A;  5EGO A;  1TWH J;  5J1R A;  2XRL A;  2DMQ A;  1I50 J;  4BY1 J;  3M4O J;  1JGG A;  4IHW A;  1WI3 A;  4BBS J;  3HBL A;  2NS7 A;  3PO2 J;  1X58 A;  2DMU A;  4JX4 A;  4A3K J;  2D5V A;  4A93 J;  3SDG A;  1F36 A;  1IG7 A;  3FIW A;  5C4J J;  1ETV A;  2LK2 A;  5FLV A;  3BTJ A;  1Z0X A;  1H89 C;  2L0K A;  1YRN B;  2DA2 A;  4M3F A;  1MBK A;  1SAN A;  3GTL J;  4G12 A;  2CUE A;  1W0T A;  2MGQ A;  1GVD A;  4IHV A;  5FLM J;  5FJ8 J;  1HF0 A;  2JJ7 A;  3MN2 A;  2JA7 J;  1MBG A;  2CUF A;  3GTO J;  3S17 J;  2YS9 A;  3JRI A;  3BR5 A;  1LE8 A;  5IP6 A;  4AC0 A;  2DA5 A;  2JK3 A;  3JRG A;  2LLK A;  1OCP A;  1NTC A;  5K7Z A;  2L7Z A;  1JUS A;  1IV6 A;  3BR6 A;  1ITY A;  2R5Z A;  2ID6 A;  5EF6 A;  2R5Y A;  3B6C A;  3H3V K;  1DU0 A;  4A3I J;  4X1E A;  5J1Y A;  1FJL A;  3JRF A;  1MBJ A;  4C3J J;  2ME6 A;  1R9T J;  3RQI A;  1VI0 A;  4W1U A;  4D7N A;  5EDN A;  1ZK8 A;  2DA7 A;  1IDY A;  5IOY A;  4BXX J;  3TW7 A;  5IP7 J;  2JMW A;  1UHS A;  1RES A;  4FE7 A;  4CYC A;  3S1M J;  2FJ1 A;  3W6V A;  3GTG J;  1JTX A;  3HEF A;  1U9O A;  2CQQ A;  3HDD A;  3BG5 A;  3QPL A;  3ZOB A;  1X2M A;  4A3B J;  2K40 A;  2NVY J;  3GTM J;  4UUS A;  1ZQ3 P;  2XGD A;  1Z77 A;  1RR7 A;  1ZR2 A;  4BBR J;  3HOW J;  2JWT A;  4XK4 A;  1T33 A;  2VKV A;  4FIS A;  3A01 A;  2JN6 A;  2FD5 A;  2M34 A;  3BT9 A;  1ZGW A;  3HM5 A;  5GP9 A;  2CQX A;  2IBD A;  2EZK A;  2H8R A;  4IHX A;  2XGE A;  2NOG A;  3FKI J;  4M3G A;  4MO7 A;  2B63 J;  3HB9 A;  3DEW A;  3RKQ A;  1P7J A;  3BQZ A;  3A03 A;  3B6A A;  4A3C J;  2HOS A;  1O4X A;  2L7F P;  3NAU A;  4M6V A;  2DA1 A;  1A6I A;  1HOM A;  1POG A;  1WH5 A;  4RBO A;  4AUX A;  2AHQ A;  1FIP A;  4IEJ A;  1B8I B;  2HXO A;  1TWC J;  4A69 C;  2FQ4 A;  4MIM A;  3JRC A;  1IUF A;  3FK7 A;  5IYB J;  2XSD C;  3M3Y J;  3S2H J;  3CDL A;  3ZQF A;  3LSR A;  2CJJ A;  2CU7 A;  1AKH A;  4LOC A;  1JUM A;  2DA3 A;  2O9L A;  1H88 C;  2EBI A;  1QVT A;  1ORK A;  1H8A C;  3Q0W A;  2O7O A;  2WAQ N;  2MG4 A;  3IH4 A;  4A3E J;  3BTI A;  1IDZ A;  1JKQ C;  3HGG A;  5E3O A;  2XB5 A;  4UUT A;  1FIA A;  2Y9Z A;  3MVP A;  1XG1 A;  3TP0 A;  3ZQI A;  2L7M P;  2XB0 X;  3HOX J;  5IYC J;  3A02 A;  2ECC A;  3LOC A;  4L5E A;  3ZQL A;  4B4C A;  3CCY A;  3OSF A;  5EG0 A; 
#chains in the Genus database with same CATH topology
 2AS5 F;  4EJU A;  1MDM A;  1IJW C;  2JSC A;  3WOD F;  1FT9 A;  2OAZ A;  1WRJ A;  1WQ2 A;  4LIU A;  4CZC A;  4X6A J;  1V54 H;  2GZW A;  4RLF A;  2R0Q C;  3DP7 A;  3SYT A;  2YSR A;  2CH0 A;  3CJR B;  1HKT A;  5F0H A;  2NVQ J;  2XPW A;  2VPL A;  1ULY A;  1X4O A;  1ZAR A;  4ENJ A;  5F0F A;  2BW3 B;  2C6Y A;  1Y0U A;  3HGY A;  3F6V A;  3QRF F;  2XV4 S;  1T8I A;  3GME A;  3GTJ J;  2OF7 A;  2MLG A;  1O7F A;  5GAH J;  5ICF A;  2H1K A;  2O8K A;  5EGO B;  1K7A A;  4L9N A;  1QQI A;  1ZG3 A;  1T38 A;  2HPM A;  1R71 A;  2QM3 A;  2JRT A;  3DTK A;  3RZO J;  3HOY J;  5JLW A;  1I6H J;  1KU9 A;  1OCC H;  1UG0 A;  4A3G J;  1ZN2 A;  3H5R A;  1YIJ I;  1SAX A;  4GYI A;  2M1B A;  1UAA A;  1ZG1 A;  5K7H A;  4BEH B;  3ZR8 X;  4EJO A;  4M3E A;  3BTC A;  1G3S A;  2TRT A;  3Q9V A;  1VND A;  3QYE A;  4G7Z F;  3ABL H;  4BQQ A;  2F5C A;  3BPX A;  4PGH A;  1TQP A;  2A6E F;  2R7T A;  5FD5 A;  5FO5 A;  2EFP A;  1VQ5 I;  3HHG A;  5FD6 A;  1Y56 A;  5H6R A;  2VQC A;  1G3T A;  3PSF A;  5F0C A;  4Z2Y A;  3W3C A;  3G73 A;  1K6Y A;  2BEO A;  5DUK A;  1BC7 C;  1BN5 A;  5HOD A;  2O6G E;  1GUU A;  1IRG A;  3BG3 A;  2LYC A;  2HXI A;  2GQQ A;  3Q0V A;  3E7L A;  1BL0 A;  3LSJ A;  2L4A A;  2VT2 A;  2DYR H;  1W7P B;  2DT5 A;  3CO7 C;  4A3L J;  5D8L B;  4CZZ A;  1LKX A;  2YU9 J;  3BP8 A;  3MQ0 A;  2DU9 A;  2VKE A;  1MKM A;  3N05 A;  3KZZ A;  3SHF A;  4RDU A;  4A5N A;  3VSK A;  2NOJ B;  3ABK H;  3RDI A;  3KP4 A;  1OCZ H;  2E7W A;  1QO0 D;  1ZTR A;  2X85 A;  1MMA A;  1LVK A;  1MMN A;  2PFB A;  3ZMV A;  3A0H C;  2QGU A;  4HX4 A;  1RKW A;  4BXU A;  2KLO A;  3CUQ C;  4XKC A;  4IHY A;  1X1P A;  1YOV B;  1ZAO A;  4L5I A;  3CCR I;  3L1P A;  3H0G J;  2R7O A;  5ICC A;  1O57 A;  1F4K A;  1BW5 A;  1JKR C;  3CJN A;  5JLX A;  4O5V A;  2Q2E A;  3EUK L;  2L9S A;  1FBU A;  2CUJ A;  3TL4 X;  3K70 D;  3HYI A;  2ECB A;  5DYM A;  1I3A A;  3MFK A;  1VQ8 I;  1J0R A;  3ABM H;  3G3Z A;  5E79 C;  1IZ1 A;  2PEX A;  5F08 A;  5CVR A;  4DYQ A;  3I5U A;  3GTK J;  3RKX A;  3IWZ A;  1H9T A;  4CUG A;  1GT0 C;  4NDL A;  2XAF A;  2NS8 A;  4A5M A;  1SFO J;  2XAS A;  5AON A;  2P7C B;  2XDV A;  4XKB A;  5L3D A;  4RLQ A;  1GDT A;  4QSH A;  2WAD A;  1SAU A;  3S3M A;  3ESW B;  4N9I A;  2RQQ A;  4CYD A;  1U8R A;  4YIF A;  2ETH A;  2BV6 A;  3BJ6 A;  1YIT I;  5FKL A;  2XAJ A;  3GZN B;  2R7F A;  1R4N B;  1BA5 A;  4HQE A;  4B09 A;  4PJ0 C;  4DQ2 A;  3HOV J;  3E6D A;  2ZME B;  2PN6 A;  1V5G A;  3IUO A;  1X19 A;  5KVR A;  2QSH X;  1DGW Y;  2CW0 F;  3SFI A;  1XPX A;  2HU9 A;  2QBY A;  3S1Q J;  1ZG5 A;  3E97 A;  3FK6 A;  2K3F A;  1WCM J;  4IJA A;  2L9R A;  2JT1 A;  2KQR A;  2X51 A;  3VDX A;  5LGT A;  2EIL H;  2L2O A;  3HPG A;  3PQK A;  5BS6 A;  4XLP F;  1UG2 A;  1XDS A;  2Y75 A;  4IVN A;  2X4H A;  5CVU A;  1JHF A;  2DBB A;  2KIQ A;  3SJM A;  3C7J A;  1NHA A;  1MH3 A;  3I71 A;  1P2F A;  4UNO A;  4PFO A;  4XR6 A;  3PM1 A;  1X1C A;  2QF7 A;  3K4M A;  3BTL A;  1W7P A;  4NNJ A;  1FWZ A;  1XTA A;  2E19 A;  2MLK A;  4XBF A;  3SZG A;  2ZFU A;  3RYR A;  1D1A A;  4DZP A;  1YS6 A;  1JTY A;  2OC6 A;  3BR0 A;  4YG2 F;  2FQ3 A;  2WTE A;  4LD5 A;  5C3E J;  2AXL A;  3MMY B;  5HNF A;  2XRN A;  1IRZ A;  3K7A J;  1FC3 A;  3HC7 A;  4U87 A;  4LIT A;  2ZXH A;  2GM4 A;  1V55 H;  2WY7 Q;  2Z3Y A;  3C2G A;  4IF4 A;  3U2R A;  5DM7 F;  2RGV A;  5HOO A;  1ETO A;  2QQA A;  2E5N A;  4C3H J;  2ISY A;  2LY9 A;  1CGP A;  5M3F J;  2LP0 A;  1AHD P;  2CV2 A;  4I76 A;  3ZN1 A;  4ZH4 F;  4RB3 C;  5ICG A;  3LSI A;  1Z3Y A;  2WV0 A;  3M9A A;  5B66 C;  1U3E M;  1B72 B;  2DFI A;  2H1L A;  5ERI A;  2IS4 A;  2XUB A;  1IXR C;  1RIO H;  2ELK A;  2VAS A;  4P5O A;  1BR4 A;  2EZI A;  1GV2 A;  2E1C A;  1SVL A;  4OIP F;  3TQN A;  3OYD A;  3K2Z A;  3TMO A;  1I1G A;  5M5Y J;  4HEA 2;  2DXI A;  4B47 A;  1TWA J;  1TWF J;  2EIN H;  2OCC H;  3AKZ A;  2BVL A;  4NB5 A;  2FA5 A;  3K70 C;  1JE8 A;  3JRA A;  1W0U A;  2CW7 A;  4ZYE A;  3DKX A;  2UXN A;  3JR9 A;  3DCF A;  2KRC A;  1S7A A;  2OCE A;  1TT0 A;  1X1D A;  4I98 B;  1HC8 A;  1DQU A;  1XMK A;  2EH3 A;  3R60 A;  3SFZ A;  3BR1 A;  3KP6 A;  2BZT A;  2ZME A;  1G59 A;  3BZ6 A;  2RC4 A;  1PJR A;  4BXF A;  5BMZ A;  3GX4 X;  2LBF A;  5HVQ C;  3S2D J;  1TWH J;  5J1R A;  2WWY A;  2H94 A;  4I7H A;  3ULQ B;  1VQ4 I;  2KHM A;  5FFZ A;  3LA3 A;  2EV5 A;  3PO2 J;  4M9Z A;  4JX4 A;  2KJB A;  3CME I;  1V5F A;  1HST A;  2ZME C;  1IG7 A;  1BOB A;  2LK2 A;  5FLV A;  3WTX C;  3BTJ A;  1B59 A;  1X3U A;  3HTU A;  1AA7 A;  4KIG A;  2L0K A;  1H89 C;  1YRN B;  2DA2 A;  2V6C A;  2VJI A;  1E17 A;  5IT9 K;  3E6M A;  2KDO A;  4D0P A;  2F5F A;  3DBL B;  2HZD A;  3OYJ A;  3GTL J;  1IXS B;  4G12 A;  3DXJ F;  4FAS D;  4G9Y A;  1W0T A;  4LGW A;  1XDU A;  3ASN H;  1GVD A;  5FLM J;  2YPR A;  3RPQ A;  5J6X A;  4HST A;  4ENN A;  1SMT A;  2W00 A;  6PAX A;  2ELJ A;  4IRG A;  2ICW G;  1MBG A;  5DD4 A;  4ZDL A;  4KDP A;  5J4V A;  1YX3 A;  3RPU A;  2YS9 A;  4PUS A;  4HF2 A;  4QPQ A;  5IP6 A;  1YO5 C;  2BE5 F;  1I1S A;  4MQV A;  1OR7 A;  2DJI A;  1FYL A;  2L7Z A;  2V1N A;  1IV6 A;  1ITY A;  2E71 A;  4BYY A;  1D8K A;  2FBK A;  2LF8 A;  1VQP I;  1RNL A;  2R5Y A;  3A4C A;  1WI9 A;  5KHD A;  4RAG A;  4A3I J;  1W4M A;  5CPR B;  3VYT B;  4BE1 A;  1W5T A;  1P92 A;  1XX5 A;  2FNP A;  4L9T A;  4XM3 A;  2Z16 A;  4UB6 C;  5HS9 A;  3OYM A;  2EV6 A;  1A36 A;  4LB6 B;  3I3L A;  2K86 A;  1XGS A;  1SFE A;  2DA7 A;  4R8H A;  3T1B A;  4AM3 A;  1S3J A;  3ZXS A;  3GF2 A;  4KYW A;  1RES A;  4FE7 A;  2QVO A;  3EPZ A;  4KT5 C;  1O3R A;  3RSN A;  1BBY A;  3KYD B;  5E17 F;  1U9O A;  1TTY A;  3RCO A;  1X1B A;  5H6Q A;  1G4D A;  1YHQ I;  5D5X B;  1J59 A;  2LH9 A;  5K5O A;  1X2M A;  2CS3 A;  4A3B J;  4M73 A;  2FSW A;  2K40 A;  2KIM A;  2RN7 A;  2GOX B;  4E7L A;  3CCM I;  2ESH A;  1ZQ3 P;  3DBR B;  1Z77 A;  3DF8 A;  3V7C A;  1ZR2 A;  3EDP A;  4BBR J;  3C18 A;  2A6H F;  2XF5 A;  3CD6 I;  2JWT A;  5LRS A;  3MKY B;  2JUC A;  2VKV A;  2HGC A;  1CF7 B;  2PJP A;  4E7S A;  1I5Z A;  2M34 A;  1R22 A;  1R36 A;  4R1H A;  2M7A A;  4IO9 F;  4LK0 F;  4HW0 A;  1XCB A;  1BJA A;  2FF4 A;  4FET A;  4M3G A;  4P55 A;  3VSL A;  4IHX A;  5L3E A;  3HB9 A;  4KA4 A;  2Y69 H;  3DTE A;  4HOB A;  3BQZ A;  2X0L A;  4BL0 B;  1D8J A;  2X6W A;  1LUJ B;  3ECH A;  3BPV A;  4M6V A;  1OYI A;  2P5K A;  2ZCW A;  3I59 A;  4RM3 A;  3FXR A;  3KP5 A;  4AUX A;  4AU7 A;  1FIP A;  2DK5 A;  2XKO A;  1FMW A;  2QKL B;  1PP7 U;  1FBQ A;  3H3U A;  1TWC J;  3HHH A;  1O3S A;  4BNC A;  4D1Q A;  2MD5 A;  3JRC A;  2A5W A;  2VXZ A;  3VOE A;  4KIT B;  2CQ7 A;  2LNB A;  4LIV A;  3W6J B;  3IRR A;  3CF5 F;  3M3Y J;  2JPC A;  2PBI A;  4CDG A;  1W5C C;  3CJT B;  2VIX A;  1K6O A;  4HBL A;  1OYW A;  2LRE A;  4ETS A;  4U7D A;  1YIO A;  5L3F A;  1E2X A;  2BGC A;  1BI0 A;  4UV9 A;  2EBI A;  4XLA A;  5E1Z B;  2R7U A;  1QVT A;  2Q8K A;  3Q0W A;  1PVE A;  4OOI A;  1ZGA A;  4Y4R A;  3L2Q A;  2LG4 A;  4WWC A;  3IH4 A;  4AVZ A;  4A3E J;  1DP3 A;  2A3S A;  2NNN A;  3HGG A;  2XB5 A;  4H4K C;  3CC7 I;  2IPQ X;  1FIA A;  1QZZ A;  2Y9Z A;  1Q1H A;  2M7B A;  1PDN C;  4P9U A;  2OU2 A;  2L7M P;  2XB0 X;  5D6F A;  2HPI A;  5B1A H;  3DBH B;  2NVU B;  1OKR A;  1RZ4 A;  1BI1 A;  1QA6 A;  2LDU A;  2JPB A;  2V4J C;  1TBX A;  1Y39 A;  2F5E A;  3F8M A;  1DDN A;  5EG0 A;  3FM5 A;  1IC8 A;  4B43 A;  3T0Y A;  4ZTF A;  1R1U A;  2IT0 A;  4RB2 C;  2Q1Z B;  2FX0 A;  3ZQC A;  4BAC A;  5D5U B;  1FOY A;  5TGT A;  4V2G A;  3G4S I;  1IN6 A;  3GVA A;  4XLF A;  4UHT A;  2KDZ A;  3EUA A;  1K61 A;  5ILV A;  1G3Y A;  4XRF A;  4GYG A;  1BW6 A;  4MQ9 F;  2LTP A;  2O8X A;  4UVB A;  2FML A;  3E5Q A;  1ENH A;  2OD5 A;  3ZQQ A;  4JYK A;  4CHU A;  4N4O B;  1IRX A;  5JVG F;  3OYN A;  2GA2 A;  2GXG A;  4BH9 A;  3JSP A;  2DFH A;  1J9I A;  2FMY A;  3JRD A;  2LSO A;  4BJ6 C;  3BG6 A;  2OZ6 A;  1G2H A;  3DEE A;  2B9S A;  4BU2 A;  1QPM A;  4FCY A;  3DLA A;  2OZU A;  2X1C A;  1WJA A;  2H6C A;  3BC8 A;  4AIK A;  1KA8 A;  1KGS A;  3AFH A;  4JBA A;  3LST A;  2STT A;  4I02 A;  5FKK A;  1MD0 A;  2LY1 A;  3GZ6 A;  2V9K A;  2CV1 A;  1D5Y A;  2JA6 J;  1JJ8 C;  4RA2 A;  1ZHF A;  3C3W A;  4XLE A;  2QQ9 A;  3NWS A;  3FX3 A;  3M7G A;  1GHC A;  1MBH A;  3QP5 A;  1FOW A;  1O7L A;  3ASO H;  4HYE A;  4EEF G;  1TNS A;  3F23 A;  4B3A A;  4DZJ A;  3WTY C;  1XCV A;  4V2F A;  2V9P A;  3O8G A;  3KP3 A;  1LE8 B;  1PUE E;  1VQK I;  5E3M A;  3J80 Z;  1TC3 C;  1JJ6 C;  4HV5 A;  2COB A;  2P6S A;  2HYG D;  3CF2 A;  1TLH B;  4C2M J;  3CCQ I;  2DAO A;  2PJR A;  4YFN F;  5A2Q Z;  5LHI A;  3O6B B;  2KKO A;  3VB2 A;  2K02 A;  1LFU P;  1T56 A;  2E1M B;  2GAU A;  2NS0 A;  4F3Q A;  4UVC A;  4UV8 A;  2W7N A;  2VN2 A;  1XGM A;  5CJ9 A;  4KIF A;  4ZZL A;  5BOX A;  1NK2 P;  3U21 A;  4FT8 A;  1BR2 A;  1OLT A;  4ASN A;  1D0Y A;  3LSM A;  4C9Y A;  4F91 B;  1K78 B;  3WTV C;  4JX5 A;  1FX7 A;  1I27 A;  2QLZ A;  2QSG X;  3WHB A;  3IH2 A;  4CIC A;  2O5R A;  4QTR A;  2B0L A;  3E6B A;  1OFC X;  3IV5 A;  3FHZ A;  1WKM A;  5H2F C;  4KIC A;  1MSE C;  4P96 A;  4E7Z A;  1MZB A;  1MJ9 A;  1SVM A;  3C2B A;  4Y3O A;  3HIF A;  2M8E A;  3LWF A;  4NC6 A;  2F2E A;  2V79 A;  3JRH A;  3GEZ A;  3H1C A;  4HX8 A;  1ODD A;  4FTH A;  2UUZ A;  4PGG A;  3CCE I;  1W36 C;  2MAB A;  2XAQ A;  5E18 F;  3BR3 A;  1MNE A;  4FE4 A;  5K1Y A;  3VWB A;  2QQ8 A;  3CLO A;  4OWR B;  5E1X A;  2XPU A;  5J40 A;  4M72 A;  1A5J A;  5KK1 A;  1JHH A;  4OIR F;  1XB4 A;  4NQW B;  1Y1W J;  2VOO A;  2JUG A;  2XVC A;  5J4Y A;  2IA0 A;  3DPL C;  5CQG A;  2ZJP F;  1TNT A;  2MC4 A;  1Z05 A;  1WJF A;  3K4J A;  3OR1 C;  3BCB A;  5FLX Z;  4B8X A;  2XAU A;  4M71 A;  4A2U A;  3K4B A;  2KT0 A;  4ABZ A;  3CO6 C;  2WV1 A;  1EV7 A;  1Y1V J;  5KNL A;  2V26 A;  3KFW X;  4PZJ A;  1FP2 A;  2YUS A;  4EJW A;  2M4G A;  3T8R A;  1RI7 A;  2DW4 A;  4QIW N;  1JT0 A;  3G71 I;  1AKH B;  1WPK A;  1LDK B;  3LA7 A;  5DTD A;  1R5H A;  1VF9 A;  4CO8 A;  3CCS I;  1QHH D;  2VE8 A;  3IC7 A;  1SFK A;  4MTE A;  4XRS G;  1E3O C;  2K9S A;  2VJ5 A;  3O8H A;  2BY2 A;  5FKM A;  3OYF A;  3HOS A;  3LSK A;  2EIM H;  2ZSH B;  4F55 A;  1VZ0 A;  4PJN A;  2CWE A;  3RYP A;  1J2X A;  1YJ9 I;  3GFM A;  5EEA A;  4GDF A;  2FE3 A;  2MH2 A;  2HVQ A;  5C44 J;  1V4R A;  5CKT A;  5EYR A;  2ZNY A;  4ZYA A;  2FBH A;  1YFH A;  1V3F A;  3NQO A;  5FFX A;  3VOD A;  2IS6 A;  2V7F A;  1E0E A;  2B7E A;  3EUH C;  1JI8 A;  2P7V B;  5IP9 J;  1FYM A;  3BR2 A;  1B8I A;  3AG4 H;  4L18 B;  3OYH A;  3BZK A;  2RNG A;  5HLT A;  1UEL B;  1A35 A;  2EIJ H;  4HLX A;  3MZY A;  1YQA A;  1YS7 A;  3GFI A;  1VTN C;  4XRM A;  1HW1 A;  2E1M C;  3HOZ J;  4ZDP A;  3NRV A;  2HVS A;  4DBQ A;  1MJA A;  1UMQ A;  5F64 A;  3K2A A;  3M8F A;  1DGR M;  1D1C A;  2A69 F;  4HNU A;  4KMF A;  2HQ5 A;  3Q5F A;  4I6Z A;  2DDA A;  3GXO A;  3CUQ A;  3OV8 A;  4LG0 A;  3CCU I;  3CQZ J;  3HOU J;  2VB6 A;  3FMR A;  1KU2 A;  3OYE A;  2DOD A;  3PL8 A;  4A3D J;  2E1O A;  3SXY A;  4HLY A;  2R7W A;  2VKD A;  2EWN A;  3E5X A;  3L09 A;  3HSR A;  2Z33 A;  3QU3 A;  4RM2 A;  3TDZ C;  2UXX A;  4XID A;  3FZV A;  1HBX G;  3FIS A;  4XIC A;  2EV0 A;  2YX4 A;  4C3I J;  3KP2 A;  5BNG A;  4N4N B;  4NHJ A;  4DOZ A;  1A31 A;  3AG3 H;  2M4K A;  4HNV A;  2HYJ A;  1JXS A;  2HTJ A;  2HTS A;  2ZXW H;  2ZXI A;  1QHG A;  4JX6 A;  2R7Z J;  5DM6 F;  5E3L A;  1ZRF A;  1LDD A;  2HQR A;  2NYX A;  3L2U A;  1OYY A;  5IY5 H;  4JP0 A;  3ZRG A;  2ZXJ A;  2NVX J;  2W24 A;  3OYI A;  3WE2 A;  1Z67 A;  1SFX A;  2BW3 A;  3A01 B;  1G8X A;  4RGX A;  3ZMZ A;  5TJJ A;  3WTW C;  4WK8 F;  2HDW A;  4J01 A;  4W97 A;  5EGO A;  1Z3X A;  3OS2 A;  1R5G A;  2AQE A;  1I50 J;  4BY1 J;  4BJ5 C;  3BZC A;  3V7R A;  2E35 A;  4BBS J;  1ACI A;  1X58 A;  3SDG A;  2CQK A;  3BRO A;  1F36 A;  2IRF G;  3REO A;  2IS1 A;  4BEH A;  4XL9 A;  3FXQ A;  3QAH A;  1Z0X A;  4G8X A;  2HYF A;  2BOL A;  3K1P A;  1GXP A;  1MBK A;  3JCU C;  3ELK A;  5CVJ A;  2VBW A;  3GWZ A;  3U1D A;  1R6R A;  1I6X A;  2MGQ A;  1HF0 A;  1LEB A;  5HS8 A;  3SZT A;  4YFX F;  1KON A;  2D1H A;  2L9N A;  1VQ9 I;  2LMD A;  3WTZ A;  2PMU A;  1QZY A;  2DCE A;  1WJD A;  4FQG A;  1YJW I;  3QOP A;  4AC0 A;  2HKO A;  2JK3 A;  4E70 A;  1OCP A;  3CMA I;  5K7Z A;  2LC2 A;  2K9L A;  2EPF A;  3SEQ A;  4XOP A;  4CCK A;  2KRH A;  4OIO F;  3GO5 A;  1YJN I;  4OIN F;  1A6Q A;  1JGS A;  3K69 A;  3TBI A;  5E8G A;  3I56 I;  2IXS A;  3JRF A;  3BWG A;  1T98 A;  1XMX A;  1UST A;  2DPD A;  5K5Q A;  4PSW A;  4C3J J;  3M07 A;  4ENM A;  4I99 C;  2QA4 I;  1IAW A;  1DP7 P;  4L0Y B;  2PQ8 A;  1VI0 A;  4W1U A;  2IW5 A;  4EM1 A;  2JVH A;  1P4A A;  2L3D A;  3PUB A;  2R4G A;  1ZK8 A;  3EYY A;  1IDY A;  5DD8 A;  5IOY A;  5B5E C;  4B48 A;  2JTV A;  1OPC A;  3LMM A;  5EEG A;  2FEZ A;  4MEY F;  3FKJ A;  3HEF A;  2CQQ A;  4EGZ A;  1BM9 A;  2P6T A;  3TKY A;  1HW2 A;  4EJT A;  5FGM A;  3HOT A;  2QWW A;  1EH8 A;  5LHH A;  3OYC A;  3I53 A;  1UCR A;  2F48 A;  3FXO A;  2W4S A;  2ZSI B;  4XLC A;  3R4K A;  2UZK A;  4JQF A;  1RR7 A;  2QEX I;  2OA4 A;  3WG9 A;  3DU5 A;  3IKV A;  3CC4 I;  3H9Q A;  4XMY A;  1P9Q C;  4XK4 A;  4FIS A;  3A01 A;  3PSI A;  3BT9 A;  4A12 A;  3QWL A;  3JAM Z;  2CQX A;  2ZFW A;  2IBD A;  3KPH A;  4AWX B;  4YEL A;  4E7J A;  1X3Z B;  3HSE A;  4Y15 A;  5TRD A;  3PIO F;  3DEW A;  3RKQ A;  4BUP A;  2OQG A;  1FOK A;  1EH6 A;  2W57 A;  3A03 A;  3B6A A;  3L2R A;  2HQN A;  4A3C J;  4WXD A;  2DA1 A;  1A6I A;  5CVI A;  1POG A;  3IKT A;  1GLN A;  3SDB A;  2AHQ A;  2HXO A;  1IRF A;  2EA2 A;  2FQ4 A;  3DFG A;  3J7Z I;  3ZMT A;  4WXC A;  3J7A O;  1IUF A;  5IYB J;  1ZLK A;  2GOM A;  2XSD C;  3PNT A;  3S2H J;  4DGW B;  5D5V B;  3WU1 B;  3ZQF A;  2Y0M A;  3SZP A;  4O3M A;  1JUM A;  3F8F A;  3FXM A;  3J7Y J;  1FSE A;  3OMY A;  3JSO A;  1O3Q A;  2O9L A;  1BIA A;  1H88 C;  1IUY A;  3S32 A;  2XIG A;  3J81 Z;  1ONV A;  1ORK A;  3E0J B;  4BJT A;  1XSX A;  2WAQ N;  2AQF A;  2XSJ C;  3BTI A;  1JKQ C;  2ZBK A;  2IGN A;  3MVP A;  3P7N A;  3TP0 A;  3ZQI A;  1RC9 A;  2HVR A;  5IYC J;  2EFW A;  1TQI A;  1B4A A;  4IOA F;  1WJC A;  4Y13 A;  2EFO A;  3I4P A;  2ECC A;  4E6K G;  4B4C A;  3CCY A;  2F5D A;  2X1D A;  4L5J A;  1ZRD A;  4NC8 A;  1SD6 A;  5KAF C;  3I64 A;  4GO1 A;  2L7K A;  4XQF A;  3CMY A;  3QQA A;  2WAQ A;  5HLG A;  2DTZ A;  1Z9C A;  2HFH A;  1SC7 A;  1OJL A;  2ZO4 A;  4KJZ A;  2XHK A;  4AID A;  5GAE J;  2OTL I;  3PO3 J;  4IHT A;  3SEZ A;  3WGH A;  4AIH A;  4PCQ A;  4CSW A;  1HDD C;  3HRM A;  1UB9 A;  2D2W A;  2MW8 A;  4GXO A;  3OS0 A;  3H92 A;  2MH9 A;  1PUF B;  1SEU A;  1K83 J;  5DS9 A;  3IH3 A;  2RDP A;  3BCA A;  4EGY A;  2Y9Y A;  2JA2 A;  2HI3 A;  2ID3 A;  4HPQ A;  5LFA A;  3FXK A;  5HDG A;  1RRJ A;  3HRS A;  2GIV A;  1B9N A;  4E7I A;  2F5V A;  3GUD A;  1WJE A;  1B72 A;  3RKY A;  4ANJ A;  2BY3 A;  1D0X A;  3FBN B;  4MFE A;  1D5V A;  2R3S A;  2XAG A;  4KFC A;  3DPT A;  2L01 A;  3GLX A;  4KN4 X;  4I09 A;  4G7H F;  5IYD J;  1QVU A;  1VQ6 I;  3CES A;  3K4K A;  2X6X A;  2JA5 J;  1XN7 A;  1FLI A;  4B44 A;  3D5S C;  2M8G X;  1BI2 A;  1HSJ A;  2KFD A;  2EIK H;  3RZD J;  1U5T B;  1TWG J;  5AIQ A;  4Q5S F;  1IV8 A;  2Q0O A;  4BAY A;  2ELH A;  2NVT J;  2RVC A;  3K1M A;  1STZ A;  2KIF A;  1RPW A;  2H09 A;  3GBG A;  4F7Z A;  4RGU A;  5LGU A;  5JFR A;  1F43 A;  4YEJ A;  5J1U A;  2R93 J;  3DTI A;  4IX7 A;  4PFP A;  1S8N A;  1FOX A;  3F3X A;  4XNF A;  2OV7 A;  3QOD A;  5HS7 A;  4S04 A;  2Z9O A;  3RQ4 A;  3GTP J;  4LFU A;  2XRO A;  1V5E A;  1XGN A;  2XPV A;  3BDD A;  1G6N A;  3FMS A;  4DBR A;  1Q1V A;  2Z5U A;  9ANT A;  2RKH A;  3P9C A;  3AL0 B;  3AAF A;  2KIS A;  2R5Z B;  4U0W A;  2LFB A;  2RAE A;  3HL2 A;  3N97 A;  1KQ8 A;  3QYB A;  1KYZ A;  3G2B A;  2LKS A;  2E1N A;  2VJJ A;  3D1N I;  5B3S H;  2EZL A;  4XLN F;  1WWX A;  4BY7 J;  1JKO C;  5J3L A;  2A5Y B;  5LLQ A;  2X6O A;  3LQR A;  1YRN A;  2VBX A;  3T8T A;  3LSH A;  4DYR A;  2QYO A;  5JHF A;  2FBI A;  1JT6 A;  5D5W B;  1MMD A;  1P4W A;  4YIR X;  4A3J J;  4F52 A;  2ZJQ F;  1H0M A;  4CYC B;  3S3N A;  1QPI A;  4KIS A;  1S7O A;  5HDN A;  2WA0 A;  1R5I D;  2CV0 A;  1LFB A;  5AIP A;  1Z6R A;  3MKL A;  2V1U A;  3OIQ A;  1KQ9 A;  1MBE A;  2CW8 A;  5CVV A;  4OAZ A;  1ON1 A;  4DIQ A;  1XC5 A;  2DMT A;  4NBQ A;  3TOA A;  4BQA A;  2PX9 A;  1ETQ A;  2K3P A;  5FRM A;  1N78 A;  2GXB A;  2IAI A;  4ON0 A;  2JA8 J;  2LKX A;  3UR3 C;  1MMG A;  1M1E B;  3MCZ A;  2DMN A;  3G6E I;  2ISZ A;  1NG6 A;  4BE0 A;  4ZJZ A;  1HQC A;  4QWQ A;  4M74 A;  2OJE D;  3CCJ I;  3K1N A;  2KJC A;  1HLV A;  1F5T A;  5FKN A;  4L0Z B;  3ECO A;  3CLQ A;  2JZY A;  3G1M A;  5K5R A;  4D7M A;  4GGG A;  1DU6 A;  2E2I J;  5F04 A;  2DI3 A;  2MC3 A;  3OL3 A;  2L54 A;  5E1W A;  1NK3 P;  2PI0 A;  3IP4 B;  1FMV A;  5M5X J;  4A3F J;  1T08 B;  1Z91 A;  2HDC A;  3P5J A;  2Y30 A;  5FRO A;  3G1L A;  1C0W A;  2NAZ A;  1K79 A;  1B6A A;  1WGX A;  2QEN A;  3ZCO A;  3W2A A;  4A0X A;  2PMZ N;  1IN7 A;  2M2E A;  5JHU A;  2H27 A;  3F72 A;  1T0F C;  3CTA A;  3I55 I;  2DN0 A;  4M3D A;  1UJ8 A;  3KEQ A;  4HQM A;  2CUZ A;  3LSP A;  2VI6 A;  3S14 J;  3F9K A;  2CMP A;  4XLH A;  3G1O A;  5LEJ A;  1L3L A;  4BE2 A;  2KIU A;  1WHU A;  1CF7 A;  2K5C A;  2EJR A;  1BC8 C;  4HNT A;  2DYS H;  4I0B A;  2P5L C;  1UHW A;  2RRE A;  3GW2 A;  3LNQ A;  2M0C A;  1HXD A;  4FHT A;  2IA2 A;  2DJN A;  5IPA A;  3IL2 A;  3QYF A;  2PMZ A;  2BY0 A;  3F0C A;  2BXY A;  3UNG C;  1W5S A;  1ZR4 A;  3ONQ A;  2H6B A;  4EQQ A;  2FXA A;  3CDH A;  2R7D A;  4HV6 A;  5M3M J;  3OWT A;  4HF0 A;  2X48 A;  3H35 A;  5CLS A;  1OCT C;  4EM0 B;  1MDM B;  2DFE A;  2EQR A;  2MSY A;  3ZQ7 A;  1KQ0 A;  4MFD A;  1XGO A;  2W48 A;  5DV5 A;  2M3A A;  3ZN0 A;  4CCN A;  3AL0 C;  5E8I A;  3S15 J;  1S5L C;  3WE3 A;  4EJV A;  2P81 A;  5DEQ A;  3LAP A;  3QP6 A;  1FEX A;  2YR2 A;  2EFQ A;  1AU7 A;  2HNH A;  2Y31 A;  1RET A;  4HDV A;  3ROU A;  4O6J A;  2F4M B;  3R61 A;  3HSF A;  4UVA A;  2K9Q A;  3LSG A;  3COA C;  4G6Q A;  3QPH A;  3OR2 C;  2CRG A;  2VON A;  2Z1D A;  2VC1 A;  3I0T A;  5EZG A;  3CCL I;  1USS A;  4DJA A;  1AWC A;  2BBY A;  1XSD A;  3W2W A;  4IL6 C;  4RB1 A;  2UWM A;  3I54 A;  2VBY A;  4BQN A;  2CO5 A;  4XRS A;  2MFZ A;  4UB8 C;  5JVT A;  2DA6 A;  3BQY A;  2DOA A;  3Q3S A;  4BKX A;  1Z21 A;  2K4B A;  3CJQ B;  2I8D A;  1MBF A;  2F6C A;  4PSX A;  3BG7 A;  3C2H A;  4ZYH A;  1QRY A;  1U9N A;  3RIR A;  1R1T A;  4AYB N;  1D3Y A;  2WAE A;  5GTI C;  2DMP A;  3IWF A;  1FNN A;  4RGS A;  1J5Y A;  4MLO A;  4PJM A;  5ICE A;  2R7V A;  3FHN A;  1RKT A;  4UUS B;  1KYW A;  3WTU C;  5L3C A;  5GPC A;  2LD5 A;  1I3Q J;  5KAI C;  4U0V A;  2IP2 A;  5TIS C;  2RNJ A;  4LJZ F;  4LB5 A;  3TDU C;  3LA2 A;  3Q0U A;  4QLC U;  4KNY A;  2DQR A;  4AYB A;  3J80 K;  1X2N A;  1ETK A;  2R7S A;  1J09 A;  3DQV C;  3MKW B;  3M8E A;  2A68 F;  4U88 A;  4EV0 A;  2J5O A;  1LB2 A;  3M4O J;  5A2Q K;  4IHW A;  3BJA A;  1WI3 A;  1FPQ A;  2NS7 A;  2DMU A;  4A3K J;  2D5V A;  4A93 J;  2W84 A;  2DQL A;  4WX9 A;  4IRI A;  3S8P A;  5BQT A;  3V7S A;  5CYV A;  3PNV A;  2UV1 A;  2LF7 A;  4HZF A;  4M3F A;  4P9F A;  5J47 A;  3HJE A;  3ZGK A;  2K7L A;  3JTH A;  4A0Y A;  4ZYG A;  1IN4 A;  3FBI B;  4IHV A;  3E1S A;  2D45 A;  2JJ7 A;  3MN2 A;  3CP8 A;  1FYK A;  1Z7U A;  2EA4 A;  2KPM A;  1TT5 B;  2Q2E B;  3TO6 A;  2JA7 J;  2E7X A;  4C2U A;  3IAM 2;  4L9J A;  1R7J A;  2CUF A;  2GXA A;  3GTO J;  4BHC A;  3S17 J;  2QKM B;  1KZH A;  3R6S A;  2R7R A;  2CGP A;  1LE8 A;  3FXJ A;  1GVJ A;  3L9F A;  4OMY A;  2DOF A;  2ESN A;  1BI3 A;  2Y48 A;  1VQ7 I;  3AG1 H;  4P1W A;  2V1X A;  3EUH A;  3JRG A;  1NTC A;  3VEP A;  1XMA A;  1JUS A;  3BR6 A;  2VQG A;  1MW7 A;  3ZPL A;  3CZ6 A;  2QZ8 A;  1N25 A;  2LRD A;  3B6C A;  4WXH A;  3E3V A;  3FMQ A;  1ZRC A;  4MTD A;  2COM A;  1N75 A;  4HA8 A;  1A04 A;  1RUO A;  4TV7 A;  3K4N A;  3HG9 A;  3F8B A;  2I5U A;  3OYG A;  1OIS A;  1DPU A;  3PFY A;  3NEU A;  1R23 A;  1PP8 F;  2K85 A;  5LHG A;  2ME6 A;  3X2Q H;  3RQI A;  4D7N A;  2X6Y A;  5EDN A;  4G6T B;  1K78 A;  4Y33 A;  3TW7 A;  5FLX K;  2QSF X;  2JMW A;  1UHS A;  5JR3 A;  3OYL A;  3KX2 A;  3EYI A;  3LAJ A;  2FJ1 A;  3W6V A;  2O61 A;  3GTG J;  1MIJ A;  2XKP A;  4S05 A;  1BOA A;  1R58 A;  1VQN I;  1F9N A;  2QBY B;  3BG5 A;  4XN0 A;  3ZOB A;  4II3 A;  3KP7 A;  2V9V A;  3D0S A;  1W7P D;  1FP1 D;  1BIB A;  2NVY J;  3L00 A;  3TO7 A;  1XSV A;  4EVI A;  4UUS A;  3GTM J;  2VC0 A;  2L4M A;  3HRT A;  4BQO A;  3FXL A;  1VQL I;  2JN6 A;  1HA8 A;  2FD5 A;  3VYU B;  5LBQ A;  1ZGW A;  1T39 A;  3FXU A;  3KEO A;  2BHY A;  4WF2 A;  1YE9 A;  4JK1 X;  3HZJ A;  2G7U A;  2H8R A;  5FRN A;  2DOE A;  2XGE A;  2NOG A;  2P0W A;  4LLG F;  1IW7 F;  3K0L A;  3V8K A;  1ERD A;  1P7J A;  4NQW A;  2ZKZ A;  3KZI C;  3U9G A;  2IA1 A;  4AIJ A;  1S29 A;  1B1B A;  4FX4 A;  4Z6Y A;  3WTT C;  3WGG A;  3KEY A;  4RBO A;  2VQH A;  3VYR B;  4M9X A;  1DUX C;  1NH3 A;  4Q48 A;  3M1C A;  3KLN A;  4G6D A;  1ZRE A;  1LJ9 A;  3V4G A;  2HEO A;  4BDZ A;  3B73 A;  3F8N A;  2IGK A;  1FY7 A;  1Y6I A;  1ZGJ A;  2CJJ A;  1LQ1 A;  1AKH A;  2D1V A;  3M8J A;  5LD2 C;  3FF5 A;  4BHB A;  4GRI A;  4NC7 A;  1Y8R B;  2GA1 A;  2BXZ A;  3HUG B;  3LL7 A;  2LY2 A;  2O7O A;  5L3G A;  2LOO A;  1HW5 A;  1IDZ A;  2CYY A;  1EA3 A;  4II2 A;  4C30 A;  1WJB A;  2CQN A;  2ZC2 A;  3KZY A;  5EEH A;  2XGX A;  3O3K A;  1K4S A;  3K10 A;  4XSX F;  3Q9S A;  1H9G A;  3GFL A;  4PK4 A;  4ESF A;  3OL4 A;  2OQR A;  3B02 A;  3L7W A;  3LOC A;  4L5E A;  2WY8 Q;  3I9V 2;  3ZQL A;  2MD0 A;  3OSF A;  1GXQ A;  1U0J A;  4A6E A;  5GPA A;  3QU6 A;  1ETW A;  3E5U A;  1LNW A;  3L2W A;  4XOR A;  1EJ9 A;  1O3T A;  3D5L A;  3PNY A;  2FRH A;  4KN7 X;  3WHC A;  3ZQG A;  4D5F A;  5C4X J;  2Z2S B;  3LQQ A;  1MGT A;  1SVO A;  2VL8 A;  4HX7 A;  3F6O A;  2HS5 A;  4Y7N J;  2GLO A;  4A0Z A;  1FTT A;  3ISP A;  3HKZ N;  1PYV A;  3MWM A;  2HDD A;  3V8L A;  4XKV A;  1U6G A;  1LPQ A;  3TGN A;  1MMS A;  2XF7 A;  4L9V A;  2LBF B;  1MH4 A;  2CSO A;  2N8G A;  4IRH A;  5LRR A;  3QPT A;  1Y0N A;  1APL C;  2MA3 A;  2R92 J;  3TW6 A;  1TW3 A;  3ERM A;  1YX5 A;  4LLL A;  2PMH A;  4A3M J;  2O03 A;  3OIO A;  2XC7 A;  4I01 A;  3HKZ A;  3NWT A;  3LFU A;  2Y0S N;  5FKO A;  5JI6 A;  2L02 A;  1WJ5 A;  1SMY F;  1TQM A;  4WCG A;  4IZZ A;  1YW9 A;  3C1D A;  1MSF C;  2EFN A;  3RPU D;  4N9H A;  3A2K A;  4F93 B;  4KUM A;  3VPR A;  2L9V A;  1HCR A;  4CA0 A;  2P8T A;  2L5Q A;  3R0J A;  4IHS A;  2M9H A;  3OSG A;  2VOP A;  3KLO A;  4YRV A;  2P5V A;  2W1O A;  2Y0S A;  3D5R C;  3JRE A;  3J7A Y;  1J75 A;  2VT3 A;  2DFF A;  5F27 A;  3KCC A;  1XD7 A;  3I58 A;  4DW6 A;  4B1R A;  4NUB A;  4ZC3 A;  4CCL A;  4HRI A;  1E3P A;  3JW4 A;  2JSP A;  3M1E A;  3H5N A;  1TL8 A;  2IGM A;  2W25 A;  2FOW A;  4MGR A;  2VUM J;  2AXT C;  4R79 A;  3JTG A;  3ZQH A;  1GV5 A;  3FWE A;  1KU7 A;  2IEK A;  2A07 F;  2R5Y B;  1WVR A;  2E36 A;  5D6E A;  3CCV I;  1U8B A;  5GTH C;  3HUG A;  3TED A;  2VXD A;  2W82 A;  2K9M A;  2VPR A;  2M5W A;  2KZG A;  1ZH5 A;  3DKY A;  4J00 A;  1HKS A;  2JVG A;  4KT6 A;  5L3B A;  2TDX A;  5IT9 Z;  1WZ2 A;  3DU6 A;  2XGC A;  3DLL F;  5DCF A;  1CQT A;  4EMS A;  1JUP A;  1ZLJ A;  3I4M J;  3F22 A;  4PDK A;  5F6F A;  3I4N J;  1WFX A;  1RR8 C;  2STW A;  2E2J J;  2QCO A;  3S16 J;  4D5C A;  4JOM A;  2LR8 A;  2IVM A;  3ML6 A;  3WU2 C;  5BPI A;  1ETX A;  4U0Y A;  1HDP A;  4FX0 A;  4GCV A;  4KMU X;  2DK8 A;  1N77 A;  3GTQ J;  1LEA A;  5J8F A;  3S1N J;  4RAF A;  1QGP A;  3BG9 A;  1JKP C;  3MZ8 A;  2WB1 N;  3IRQ A;  4IXA A;  5F1J A;  2M0M A;  1IXC A;  1OMI A;  2AO9 A;  4LG3 A;  3PIP F;  2RV8 A;  2DLL A;  2HQA A;  3MKZ A;  4EAT A;  4E7H A;  4B3X A;  3H3Z A;  3JAM K;  3H36 A;  4MHG A;  2DO7 A;  1J7K A;  2GBY A;  2OTJ I;  4BS9 A;  2HZT A;  4MNU A;  3V8J A;  2HOT A;  2Y2Z A;  5D4R A;  2OUM A;  2FU4 A;  2WB1 A;  3R0A A;  2J5P A;  2WC2 A;  3I59 B;  4S0H B;  2NRA C;  4UUV A;  3V42 A;  3EET A;  4BHP A;  1EF4 A;  5B1B H;  3CC2 I;  4J19 A;  1MNM C;  3JRB A;  2KMU A;  1T6S A;  3DEU A;  4KIB A;  1S7E A;  5D8K B;  3H0D A;  3K4L A;  3A1Y A;  2ZB9 A;  5IOZ A;  5D4S A;  2DT6 A;  1FZP B;  2KRF A;  5E3N A;  1P4X A;  1KU3 A;  2LVS A;  2K27 A;  4M3B A;  4BGD A;  5K7F A;  4G7O F;  2E34 A;  3QPS A;  4LK1 F;  3HRU A;  3ZMS A;  2HR3 A;  4CXF A;  4Y52 J;  2VKH A;  5GAD J;  1TZL A;  4HAM A;  5GAG J;  1ZYR F;  2DA4 A;  2HOA A;  3J81 K;  2WAF A;  3CDI A;  1EH7 A;  4E4H A;  3TO9 A;  5M5W J;  2A61 A;  5HNH A;  2KL4 A;  2OBP A;  3W2V A;  3E6C C;  4Q4Z F;  3S1R J;  1SD5 A;  3OOU A;  1NG7 A;  1L0O C;  2X9D A;  3KE2 A;  3H9G A;  2QUF A;  3P9K A;  1WSU A;  5F1R A;  5EG0 B;  1BJZ A;  3ZMU A;  2EZH A;  3IAS 2;  1R00 A;  1YI2 I;  3NAR A;  4YFK F;  1OR7 C;  5FB2 A;  4IOC F;  1P7I A;  2VE9 A;  3QOE A;  1UFM A;  2JQ7 A;  3TP3 A;  2IJL A;  1YTY A;  4YII A;  1P6R A;  2HWV A;  3H5A A;  2E2H J;  2OPT A;  2ZNZ A;  3BY6 A;  3OS1 A;  4I0A A;  2K4J A;  3PFI A;  3TOB A;  2DT7 B;  2PLY A;  4ENK A;  1ETY A;  1ZKG A;  4A6D A;  4OIQ F;  1TW2 A;  2HKX A;  2EB7 A;  2O3F A;  1UZC A;  2JRM A;  3ZMD A;  1X4P A;  3BLY A;  2G9W A;  4ZDO A;  3O2P E;  1VFC A;  3MEX A;  1YYV A;  3FM3 A;  5EZH A;  4AVP A;  4ESB A;  2K9N A;  3S93 A;  5J8C A;  1D1B A;  1MND A;  2VOD A;  2G0E A;  1TP4 A;  4M9S A;  2V6E A;  4V19 K;  2VLA A;  1U78 A;  4XSZ F;  2RQP A;  1WH7 A;  2I10 A;  1DPR A;  1EKE A;  1IGN A;  4CGZ A;  1E3H A;  1R1V A;  4CCO A;  3U1K A;  3K4C A;  2X1E A;  4ZYD A;  5CQE A;  1X3W B;  2M87 A;  3F21 A;  1XS9 A;  1YG2 A;  4GFB A;  1HKQ A;  3RTR A;  3OYA A;  1F1Z A;  4E7K A;  3H9J A;  3DV8 A;  5ILS A;  3N4M A;  3OYB A;  4DYC A;  3MZH A;  5DCM B;  3W6K B;  2XF6 A;  1Y8Q B;  2HOE A;  5IT3 A;  3L2V A;  3ABU A;  2KP6 A;  1ZEL A;  2CFO A;  4CCJ A;  1FTZ A;  3KYL A;  3BOQ A;  1PUF A;  2W85 A;  2M30 A;  2IS2 A;  1QBJ A;  1UHM A;  2ME0 A;  2Z99 A;  2TCT A;  3IHU A;  1SFU A;  3PJR A;  3UKG A;  4I2O A;  1RUN A;  4AD9 A;  2PJR B;  4QPO A;  2O0Y A;  2XRL A;  2DMQ A;  4CCM A;  1QZE A;  1JGG A;  1S9H A;  3ERE D;  3HBL A;  1G3W A;  1X1A A;  3OYK A;  1W36 D;  1FBS A;  3KYC B;  3FIW A;  5C4J J;  1ETV A;  2YX7 A;  1T0F A;  3CUO A;  4G94 A;  3S3O A;  4HDU A;  1QNT A;  2DDB A;  3BJO A;  2VQL A;  4M6X A;  4LLN A;  1R49 A;  4U7B A;  1LVA A;  1SAN A;  2CUE A;  2P4W A;  2NNY A;  1U5T A;  5KCM A;  3OOP A;  4F92 B;  5FJ8 J;  1T95 A;  5E20 A;  1BR1 A;  2G7H A;  3AG2 H;  3KIO A;  1VQM I;  1S6L A;  1I39 A;  2YU3 A;  3VYS B;  4D9J A;  5ED4 A;  4HF1 A;  3JRI A;  3BR5 A;  1R4M B;  2F4O B;  1OQY A;  3CMM A;  1YLF A;  1U5T C;  2H8W A;  1QU3 A;  1SD7 A;  4DNC A;  2DA5 A;  2CFX A;  2FUG 2;  2LLK A;  4OU0 A;  4XOT A;  5LGN A;  1VQO I;  4M6Y A;  2R5Z A;  2ID6 A;  5EF6 A;  3LFK A;  3ZP5 A;  2BY1 A;  4RB0 A;  3H3V K;  1DU0 A;  4RS8 A;  1S72 I;  4X1E A;  4C2T A;  5H20 A;  5J1Y A;  1SD4 A;  1FJL A;  1MBJ A;  2CG4 A;  4IQ4 A;  2BVM A;  2DTR A;  3HXL A;  4K2E A;  4X0G A;  3OIP A;  3PQJ A;  1R9T J;  2WBM A;  3FDY A;  4MEX F;  1W1W E;  1ON2 A;  4UXN A;  4PJJ A;  4IKF A;  4BXX J;  4XON A;  5IP7 J;  4ZTJ A;  5HLH A;  2KZV A;  3DKW A;  4HG2 A;  4CH7 A;  2ZJ2 A;  4CYC A;  3S1M J;  1OCR H;  1JTX A;  4XN3 A;  4UY8 I;  3HDD A;  3HTS B;  4ZZD A;  3GCM A;  3A0B C;  2BHZ A;  3QPL A;  4Q47 A;  3K6G A;  2MBF A;  1FSH A;  4XKW A;  2LKP A;  1Z6T A;  1LDJ A;  2R7Q A;  5BPD A;  2BYV E;  5DCM A;  2FNA A;  2XGD A;  4OMZ A;  2VJ4 A;  4HSR A;  2VBZ A;  4RAZ A;  3RKW A;  3S2W A;  3HOW J;  3MAJ A;  1T2K A;  4Y17 A;  1T33 A;  5ILU A;  5LEK A;  2QQB A;  3K9T A;  3HM5 A;  3F8C A;  5GP9 A;  1YW8 A;  2EZK A;  2M45 A;  3FKI J;  4MO7 A;  2B63 J;  2EK5 A;  3MD2 A;  2XAH A;  3DWL E;  3SQN A;  2R7X A;  1IN8 A;  2F4I A;  1O4X A;  2L7F P;  2HOS A;  2E60 A;  3NAU A;  1YW7 A;  1D0Z A;  4N0B A;  4PJL A;  3L2C A;  4ESJ A;  1B9M A;  1WH5 A;  1HOM A;  2IGO A;  2MYS A;  4BDY A;  4ITV A;  2GWR A;  1B8I B;  4IEJ A;  2GIZ A;  3KET A;  1IN5 A;  4RAY A;  1IO2 A;  3T5X A;  4A69 C;  2ACJ A;  4MIM A;  5EJC A;  3GZ5 A;  5HLI A;  1OCO H;  1Z7L A;  1IF1 A;  1K4T A;  3FK7 A;  1LFP A;  4IQJ A;  2DPU A;  3RJP A;  5HDK A;  3DPU A;  3OY9 A;  1U2W A;  3CDL A;  3GLL A;  5DUI A;  3WGI A;  2NXN B;  5DDG A;  3LSR A;  3WTS C;  2E5Z A;  2CU7 A;  3GFJ A;  1MJB A;  3CUQ B;  4LOC A;  4LG0 B;  4LMY A;  4RGR A;  2FOK A;  2V1D A;  2DA3 A;  3PUF A;  4RMN A;  1AOY A;  1H8A C;  2A6T A;  4OAY A;  1REP C;  2MG4 A;  3ABT A;  4H0E A;  3HPH A;  5E3O A;  4UUT A;  3WG7 H;  3P9I A;  1XG1 A;  3WU0 A;  2PG4 A;  3HOX J;  4IPA A;  3RI4 A;  2ZJR F;  3GYH X;  2ADU A;  3A02 A;  3VFZ A;  1Z1D A;  4EM2 A;  3EQL F;  2A05 A;  3CP2 A; 
#chains in the Genus database with same CATH homology
 5GPA A;  1ETW A;  1IC8 A;  3CMY A;  3QQA A;  1IJW C;  2DTZ A;  3WHC A;  1OJL A;  5C4X J;  2FX0 A;  3ZQG A;  4D5F A;  3ZQC A;  4X6A J;  2R0Q C;  4Y7N J;  2GLO A;  3PO3 J;  1FTT A;  4V2G A;  3HKZ N;  5F0H A;  2NVQ J;  1HDD C;  2XPW A;  2KDZ A;  2MW8 A;  1K61 A;  5F0F A;  1PUF B;  1BW6 A;  3HGY A;  2LTP A;  2HDD A;  1K83 J;  5DS9 A;  3IH3 A;  1ENH A;  2Y9Y A;  2HI3 A;  2ID3 A;  1MH4 A;  2OF7 A;  2N8G A;  3GTJ J;  2H1K A;  2O8K A;  4JYK A;  5EGO B;  1APL C;  2R92 J;  3TW6 A;  1B72 A;  3RZO J;  4A3M J;  3HOY J;  3OIO A;  5JLW A;  1I6H J;  4MFE A;  3JRD A;  4A3G J;  1G2H A;  2Y0S N;  5FKO A;  5IYD J;  5K7H A;  1QVU A;  4FCY A;  4M3E A;  2JA5 J;  1MSF C;  3BTC A;  2M8G X;  5FKK A;  2TRT A;  1VND A;  3RZD J;  1TWG J;  2JA6 J;  3VPR A;  1D5Y A;  1JJ8 C;  1HCR A;  2NVT J;  2M9H A;  3OSG A;  1MBH A;  1RPW A;  3GBG A;  5F0C A;  1F43 A;  3JRE A;  5J1U A;  4EEF G;  2R93 J;  4B3A A;  4DZJ A;  5F27 A;  4V2F A;  3GTP J;  4DW6 A;  3O8G A;  4B1R A;  1LE8 B;  5HOD A;  1GUU A;  2XPV A;  3BG3 A;  5E3M A;  2HXI A;  1Q1V A;  9ANT A;  3Q0V A;  1BL0 A;  3E7L A;  1JJ6 C;  3LSJ A;  1TC3 C;  2VUM J;  2COB A;  3ZQH A;  4C2M J;  2R5Z B;  4A3L J;  1GV5 A;  2YU9 J;  2IEK A;  2LFB A;  2R5Y B;  2RAE A;  1LFU P;  1T56 A;  2VKE A;  1U8B A;  4RDU A;  3TED A;  2VPR A;  3D1N I;  1NK2 P;  2EZL A;  1ZTR A;  4BY7 J;  1JKO C;  5J3L A;  2XGC A;  1CQT A;  1RKW A;  2X6O A;  1YRN A;  4IHY A;  4JX5 A;  1JUP A;  4DYR A;  3WHB A;  1JT6 A;  3IH2 A;  3H0G J;  3L1P A;  3I4M J;  4QTR A;  3I4N J;  4A3J J;  2E2J J;  1OFC X;  2QCO A;  1JKR C;  3S16 J;  4CYC B;  3IV5 A;  1BW5 A;  4D5C A;  5JLX A;  1MSE C;  1QPI A;  2LR8 A;  3C2B A;  1LFB A;  1ETX A;  2ECB A;  1HDP A;  3MKL A;  3JRH A;  3GTQ J;  3S1N J;  4FTH A;  5F08 A;  1MBE A;  3BG9 A;  1JKP C;  4DYQ A;  2WB1 N;  3BR3 A;  3GTK J;  4FE4 A;  1XC5 A;  2DMT A;  5F1J A;  1ETQ A;  1GT0 C;  2AO9 A;  4NDL A;  2NS8 A;  2IAI A;  2JA8 J;  2XPU A;  1SFO J;  2LKX A;  1A5J A;  2DMN A;  2GBY A;  1GDT A;  4QSH A;  2HOT A;  1Y1W J;  2Y2Z A;  1HLV A;  5FKN A;  5FKL A;  3G1M A;  4S0H B;  4D7M A;  1DU6 A;  2E2I J;  5F04 A;  1EF4 A;  1BA5 A;  4J19 A;  1NK3 P;  1MNM C;  4ABZ A;  2KT0 A;  3JRB A;  5M5X J;  4A3F J;  3HOV J;  2WV1 A;  1S7E A;  1Y1V J;  2Y30 A;  3G1L A;  2ZB9 A;  1WGX A;  1JT0 A;  2YUS A;  4QIW N;  5IOZ A;  3SFI A;  2PMZ N;  1AKH B;  2M2E A;  5E3N A;  3S1Q J;  1WPK A;  2LVS A;  3FK6 A;  4M3B A;  1WCM J;  5K7F A;  2L9R A;  3QPS A;  2DN0 A;  5DTD A;  4M3D A;  3LSP A;  1VF9 A;  2VI6 A;  4Y52 J;  3S14 J;  1UG2 A;  3G1O A;  2DA4 A;  2HOA A;  4XRS G;  3SJM A;  1E3O C;  2K9S A;  1MH3 A;  3O8H A;  5FKM A;  3PM1 A;  2QF7 A;  3LNQ A;  3BTL A;  5M5W J;  2M0C A;  2E19 A;  2DJN A;  5IPA A;  3S1R J;  3F0C A;  3OOU A;  1ZR4 A;  4DZP A;  5EEA A;  2X9D A;  1JTY A;  5M3M J;  3BR0 A;  5C44 J;  5EG0 B;  5EYR A;  1BJZ A;  2X48 A;  5C3E J;  2EZH A;  1OCT C;  2EQR A;  2MSY A;  4MFD A;  2W48 A;  1IRZ A;  3K7A J;  3NAR A;  3S15 J;  5IP9 J;  3BR2 A;  1P7I A;  1B8I A;  2GM4 A;  3TP3 A;  2P81 A;  2E2H J;  2OPT A;  4XRM A;  1FEX A;  1AU7 A;  3HOZ J;  2Y31 A;  1RET A;  1UMQ A;  1ETO A;  1ETY A;  1ZKG A;  4C3H J;  3K2A A;  2LY9 A;  2K9Q A;  2HQ5 A;  3LSG A;  4I6Z A;  5M3F J;  2LP0 A;  1AHD P;  4I76 A;  2CRG A;  3CQZ J;  3HOU J;  1VFC A;  5EZG A;  1B72 B;  5EZH A;  4A3D J;  2E1O A;  2K9N A;  2G0E A;  2ELK A;  1U78 A;  4XRS A;  1WH7 A;  2DA6 A;  2I10 A;  3BQY A;  1IGN A;  2EZI A;  1GV2 A;  3Q3S A;  4BKX A;  4XID A;  3FIS A;  4XIC A;  1MBF A;  5M5Y J;  1QRY A;  1U9N A;  4C3I J;  1TWA J;  5BNG A;  1TWF J;  1XS9 A;  4GFB A;  4AYB N;  2DMP A;  4HNV A;  2HYJ A;  4MLO A;  3JRA A;  1W0U A;  4JX6 A;  2R7Z J;  1RKT A;  4DYC A;  5E3L A;  4UUS B;  3JR9 A;  3DCF A;  5GPC A;  2LD5 A;  1I3Q J;  4JP0 A;  1FTZ A;  2EH3 A;  2NVX J;  1PUF A;  3BR1 A;  3A01 B;  3Q0U A;  2ME0 A;  2TCT A;  1X2N A;  1ETK A;  3UKG A;  3S2D J;  4W97 A;  5EGO A;  1TWH J;  5J1R A;  2XRL A;  2DMQ A;  1I50 J;  4BY1 J;  3M4O J;  1JGG A;  4IHW A;  1WI3 A;  4BBS J;  3HBL A;  2NS7 A;  3PO2 J;  1X58 A;  2DMU A;  4JX4 A;  4A3K J;  2D5V A;  4A93 J;  3SDG A;  1F36 A;  1IG7 A;  3FIW A;  5C4J J;  1ETV A;  2LK2 A;  5FLV A;  3BTJ A;  1Z0X A;  1H89 C;  2L0K A;  1YRN B;  2DA2 A;  4M3F A;  1MBK A;  1SAN A;  3GTL J;  4G12 A;  2CUE A;  1W0T A;  2MGQ A;  1GVD A;  4IHV A;  5FLM J;  5FJ8 J;  1HF0 A;  2JJ7 A;  3MN2 A;  2JA7 J;  1MBG A;  2CUF A;  3GTO J;  3S17 J;  2YS9 A;  3JRI A;  3BR5 A;  1LE8 A;  5IP6 A;  4AC0 A;  2DA5 A;  2JK3 A;  3JRG A;  2LLK A;  1OCP A;  1NTC A;  5K7Z A;  2L7Z A;  1JUS A;  1IV6 A;  3BR6 A;  1ITY A;  2R5Z A;  2ID6 A;  5EF6 A;  2R5Y A;  3B6C A;  3H3V K;  1DU0 A;  4A3I J;  4X1E A;  5J1Y A;  1FJL A;  3JRF A;  1MBJ A;  4C3J J;  2ME6 A;  1R9T J;  3RQI A;  1VI0 A;  4W1U A;  4D7N A;  5EDN A;  1ZK8 A;  2DA7 A;  1IDY A;  5IOY A;  4BXX J;  3TW7 A;  5IP7 J;  2JMW A;  1UHS A;  1RES A;  4FE7 A;  4CYC A;  3S1M J;  2FJ1 A;  3W6V A;  3GTG J;  1JTX A;  3HEF A;  1U9O A;  2CQQ A;  3HDD A;  3BG5 A;  3QPL A;  3ZOB A;  1X2M A;  4A3B J;  2K40 A;  2NVY J;  3GTM J;  4UUS A;  1ZQ3 P;  2XGD A;  1Z77 A;  1RR7 A;  1ZR2 A;  4BBR J;  3HOW J;  2JWT A;  4XK4 A;  1T33 A;  2VKV A;  4FIS A;  3A01 A;  2JN6 A;  2FD5 A;  2M34 A;  3BT9 A;  1ZGW A;  3HM5 A;  5GP9 A;  2CQX A;  2IBD A;  2EZK A;  2H8R A;  4IHX A;  2XGE A;  2NOG A;  3FKI J;  4M3G A;  4MO7 A;  2B63 J;  3HB9 A;  3DEW A;  3RKQ A;  1P7J A;  3BQZ A;  3A03 A;  3B6A A;  4A3C J;  2HOS A;  1O4X A;  2L7F P;  3NAU A;  4M6V A;  2DA1 A;  1A6I A;  1HOM A;  1POG A;  1WH5 A;  4RBO A;  4AUX A;  2AHQ A;  1FIP A;  4IEJ A;  1B8I B;  2HXO A;  1TWC J;  4A69 C;  2FQ4 A;  4MIM A;  3JRC A;  1IUF A;  3FK7 A;  5IYB J;  2XSD C;  3M3Y J;  3S2H J;  3CDL A;  3ZQF A;  3LSR A;  2CJJ A;  2CU7 A;  1AKH A;  4LOC A;  1JUM A;  2DA3 A;  2O9L A;  1H88 C;  2EBI A;  1QVT A;  1ORK A;  1H8A C;  3Q0W A;  2O7O A;  2WAQ N;  2MG4 A;  3IH4 A;  4A3E J;  3BTI A;  1IDZ A;  1JKQ C;  3HGG A;  5E3O A;  2XB5 A;  4UUT A;  1FIA A;  2Y9Z A;  3MVP A;  1XG1 A;  3TP0 A;  3ZQI A;  2L7M P;  2XB0 X;  3HOX J;  5IYC J;  3A02 A;  2ECC A;  3LOC A;  4L5E A;  3ZQL A;  4B4C A;  3CCY A;  3OSF A;  5EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...