2LR8A

Solution nmr structure of casp8-associated protein 2 from homo sapiens, northeast structural genomics consortium (nesg) target hr8150a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
SHMKNVIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASP8-associated protein 2
publication title Solution NMR Structure of CASP8-associated protein 2 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8150A
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 20
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lr8A00
1UMQA 1ETYA 4M3GA 3JREA 2EZKA 2R0QC 5EG0B 3FIWA 2JMWA 1EF4A 1VI0A 4BY1J 3BTLA 3ZQCA 2DA7A 3OIOA 3UKGA 3S2DJ 1A6IA 1FEXA 5EGOB 1U9OA 1MBEA 4A3DJ 5FKKA 1X2NA 1BW6A 1ZKGA 2DMQA 1QVTA 2FQ4A 2N8GA 5C3EJ 2HI3A 3ZOBA 3K2AA 3RQIA 3S2HJ 1B72A 2IAIA 4BXXJ 3IH4A 2YS9A 3Q0UA 2O7OA 4CYCA 3BTIA 2X48A 1VNDA 4RDUA 3S17J 2VUMJ 1ETKA 1HLVA 3M3YJ 5EF6A 1AU7A 3SDGA 4IHWA 3BG3A 1O4XA 1MBGA 2L7ZA 4MO7A 1JT0A 1W0TA 1WH5A 4JX6A 1NK2P 1OJLA 5IOZA 1U78A 2EZHA 3BQZA 3ZQFA 4A3BJ 2VPRA 1I6HJ 1ETOA 1ITYA 2WV1A 1HDPA 2HOSA 1MH3A 3Q0WA 4X1EA 3ZQLA 2ID6A 5IP7J 3BR1A 2DN0A 3CDLA 2O9LA 2OPTA 3TP0A 4XRSA 1RR7A 1JUMA 4QSHA 2JWTA 2EZIA 3CMYA 5E3OA 2WB1N 3PM1A 1IUFA 2H8RA 2DA3A 1XS9A 1TWGJ 1B8IA 1POGA 4FISA 2NS8A 2DA6A 3GTLJ 1K83J 1OCPA 1E3OC 2Y0SN 2H1KA 2HXIA 3GTGJ 3PO3J 3TW6A 1B72B 2DA4A 3CCYA 5DTDA 2NS7A 3HM5A 1IRZA 1TC3C 5EG0A 2XPUA 4M6VA 5IOYA 3K7AJ 1MBKA 1WGXA 1LE8B 2JJ7A 5E3LA 1OCTC 4JX5A 1FTTA 1IV6A 3A03A 1LFUP 4D7NA 2D5VA 2R93J 4XIDA 1GUUA 3O8GA 1JKPC 1OFCX 3RKQA 5DS9A 4W1UA 3HGYA 3BR5A 1SANA 4JP0A 2E2HJ 3WHCA 2ECCA 4RBOA 1A5JA 4D5FA 3HGGA 5FKMA 3JRAA 4AUXA 1Y1WJ 1JT6A 4A3KJ 4BBSJ 4A93J 2OF7A 1NK3P 4LOCA 3BTJA 4JYKA 3JRDA 1B8IB 2LY9A 3CQZJ 1UHSA 2E1OA 4MFDA 2EH3A 2IEKA 2HQ5A 1GVDA 2QF7A 4BBRJ 4M3FA 1GV5A 1JUPA 2VKEA 5FKOA 5F08A 5JLXA 1UG2A 2EBIA 2EQRA 3GTOJ 4G12A 1AHDP 1JJ8C 4MIMA 1FTZA 1U8BA 1WI3A 4A3CJ 4FCYA 4XK4A 1H88C 1Q1VA 1DU6A 3JRHA 2Y9ZA 1FJLA 2FJ1A 1TWCJ 5EZHA 2R92J 1I3QJ 3MN2A 1ZR4A 4C3HJ 2LTPA 5FJ8J 2KT0A 3Q3SA 3GTKJ 4B4CA 3O8HA 1HF0A 4X6AJ 2XGDA 2CUFA 1K61A 1JTXA 4I76A 2AHQA 2HXOA 3H0GJ 2DMTA 2E2IJ 5F1JA 3RZDJ 5C44J 3HB9A 1JJ6C 1T56A 2MGQA 3LSRA 1WPKA 3S1MJ 3LSPA 4M3EA 4MLOA 1IC8A 2DMNA 2I10A 3IH3A 5JLWA 1LE8A 1F43A 4JX4A 5BNGA 5M3FJ 3JRCA 3D1NI 1BA5A 5IYBJ 1BW5A 1R9TJ 1JGGA 4FE7A 1YRNB 2R5ZB 1WCMJ 1H8AC 1GDTA 1JKOC 2GM4A 1ZTRA 2QCOA 3F0CA 5F0CA 3VPRA 4BY7J 1MSFC 4IHVA 4A3MJ 3S1QJ 2EZLA 5M5XJ 1QRYA 2RAEA 2CUEA 2YU9J 2FD5A 5J1RA 3IV5A 3A01B 3G1OA 1TWFJ 2DMPA 2LFBA 2JA7J 4HNVA 4FE4A 3SFIA 2L7MP 1PUFA 1IDYA 1RKTA 3DEWA 1ETVA 2NOGA 5EEAA 3JRFA 4QTRA 1MNMC 3IH2A 1T33A 3OSGA 4M3DA 1D5YA 4DZPA 3GTJJ 5IPAA 1QPIA 2LLKA 1ZR2A 2L7FP 1ZGWA 5IP9J 3S1NJ 3LNQA 2ME6A 2K9SA 2ZB9A 1TWAJ 3QPSA 3HKZN 4UUSB 2MG4A 2JA5J 5EZGA 1ORKA 2AO9A 3JRBA 5GPCA 1P7JA 3MKLA 4B1RA 2TRTA 4DYCA 2XRLA 1HDDC 1ETWA 3S15J 2DA5A 3BR0A 2NVXJ 2B63J 3FISA 4A3EJ 4A69C 2LVSA 1VFCA 3WHBA 1MH4A 5FKNA 3B6AA 3PO2J 3E7LA 2P81A 1JKQC 1RETA 2COBA 3ZQIA 5J3LA 4A3GJ 4L5EA 3HOUJ 2XGCA 3JRGA 5M5WJ 1MSEC 1I50J 1GT0C 1G2HA 4UUTA 5K7FA 3JRIA 2CU7A 5F0HA 1PUFB 1U9NA 2YUSA 3BT9A 1X58A 3TW7A 1YRNA 3OSFA 5EDNA 2R5ZA 5EYRA 5J1UA 2LKXA 1JTYA 2DMUA 1W0UA 9ANTA 3HOXJ 5GP9A 1BJZA 3A01A 4IHYA 2L0KA 4MFEA 4I6ZA 2R5YA 4J19A 1JUSA 2KDZA 3QQAA 3M4OJ 2XPWA 2VI6A 3SJMA 1Z77A 2DJNA 2XB0X 3HOZJ 3S14J 2K40A 2E2JJ 3MVPA 1CQTA 3C2BA 3HDDA 2FX0A 2O8KA 1APLC 4NDLA 2ELKA 2Y31A 2MSYA 3HOWJ 5J1YA 1QVUA 4XRMA 4BKXA 3BG9A 4UUSA 2GBYA 1VF9A 2ME0A 1HCRA 5K7ZA 4GFBA 2DTZA 2LP0A 4QIWN 3TP3A 3TEDA 2GLOA 2LD5A 5F0FA 3NAUA 3H3VK 4C3IJ 2M9HA 3W6VA 2XSDC 2LR8A 5IP6A 2JA6J 1MBFA 5K7HA 4D5CA 1ZQ3P 1AKHB 3BR6A 1NTCA 1S7EA 2K9QA 3FK7A 2W48A 3GTMJ 1Y1VJ 4A3JJ 5GPAA 5M3MJ 5E3MA 2M34A 3ZQHA 2HDDA 3HOVJ 2G0EA 1RPWA 2M2EA 1GV2A 2XPVA 1WH7A 1F36A 1TWHJ 2R5YB 3LSGA 1IGNA 3BTCA 1IJWC 3FKIJ 2L9RA 2TCTA 4IHXA 2NVQJ 4IEJA 3ZQGA 2NVTJ 5M5YJ 1JKRC 2WAQN 1RESA 2ECBA 3BR3A 4V2FA 5IYDJ 4W97A 5F27A 3QPLA 1ETXA 2VKVA 3HOYJ 1LFBA 2XB5A 4D7MA 2E19A 1SFOJ 4AC0A 3FK6A 2JK3A 2CQQA 2DA2A 2XGEA 1ZK8A 2IBDA 3I4MJ 2CJJA 5E3NA 1ETQA 4B3AA 4XICA 2Y2ZA 2HOAA 5C4JJ 4AYBN 2K9NA 2X9DA 3DCFA 4Y7NJ 3L1PA 4A3IJ 2JA8J 2JN6A 3LOCA 3GTQJ 2M0CA 5HODA 4S0HB 3HEFA 2HOTA 4V2GA 4CYCB 2CQXA 2PMZN 1FIPA 5IYCJ 5FLVA 4A3FJ 3RZOJ 3HBLA 4EEFG 3NARA 4DZJA 3I4NJ 2ID3A 3S16J 3BR2A 2NVYJ 4XRSG 1MBJA 3GTPJ 2M8GX 1IDZA 5EGOA 1MBHA 1IG7A 5C4XJ 2X6OA 4DW6A 1BL0A 2Y30A 1FIAA 3S1RJ 3Q0VA 1AKHA 1DU0A 2LK2A 3LSJA 5FLMJ 4C3JJ 2DA1A 4Y52J 5F04A 1HOMA 2R7ZJ 2HYJA 3B6CA 4ABZA 4A3LJ 1H89C 4C2MJ 5FKLA 1XC5A 4DYRA 3BQYA 2MW8A 1ENHA 3BG5A 4DYQA 1Z0XA 2CRGA 1RKWA 3G1MA 1X2MA 3GBGA 4FTHA 3A02A 3JR9A 3G1LA 1P7IA 3OOUA 2Y9YA 1XG1A 4M3BA
chains in the Genus database with same CATH superfamily
1ERDA 4HRIA 3BCBA 4OMYA 2ETHA 1ETYA 3IP4B 4I09A 1ZLJA 3JREA 2EZKA 3D5LA 4R79A 3WGIA 1W36D 1VI0A 2W25A 1G6NA 3WGHA 3M8EA 3B02A 1B1BA 2FBHA 3ZQCA 3OIOA 4ENMA 5DCMB 2WC2A 3DTIA 1A6IA 5FD5A 3HRTA 3WODF 4E7LA 1MBEA 4A3DJ 5F1RA 5J47A 2I8DA 1ZRCA 1QVTA 2FQ4A 2ZC2A 4U87A 1SVLA 3PUBA 5C3EJ 3VEPA 3FDYA 1VQ5I 1FC3A 3OR2C 3LAPA 3S2HJ 2IAIA 2YS9A 3LA2A 3I55I 2RV8A 2O7OA 4CYCA 5D5VB 3RKWA 3S17J 4F91B 4RLQA 1JI8A 1ETKA 3M3YJ 5EF6A 3OYKA 3DWLE 3SDGA 2V26A 1AU7A 3BG3A 4IHWA 5FROA 4ANJA 1K78B 5JR3A 5HLHA 2VT2A 1W0TA 1WH5A 1IRFA 4A0ZA 3CMEI 3BROA 5IOZA 4AIJA 2BY0A 3CF5F 2FMYA 5CQEA 1USTA 3F6VA 4Y33A 1YITI 1I6HJ 3V7RA 2JSCA 2X51A 5LEJA 2M8EA 2WV1A 1Z7LA 3CCSI 1CF7A 3NEUA 2HOSA 4X1EA 2DN0A 3E1SA 2QA4I 2VC0A 3H5NA 3V4GA 4DIQA 2K27A 4M6XA 1Y0NA 4XRSA 4QSHA 2JWTA 4ZYAA 2RQQA 3PM1A 1IUFA 4EJWA 4IRIA 2EA4A 3CUQB 4FISA 3CCLI 4KISA 1IXCA 1K83J 1OCPA 5K5QA 2HKXA 1JE8A 2STWA 2OQGA 1EH7A 1FY7A 2K3FA 2XF7A 3PO3J 3TW6A 4TV7A 4YFXF 2F6CA 1MMGA 2E1MB 5DTDA 1DQUA 3F8CA 1OYIA 4ZZDA 1OCZH 4M6VA 5IOYA 4RGUA 4HZFA 3K7AJ 2QKLB 2VOPA 5BPDA 1EH8A 5H6QA 2L9SA 2OZ6A 1EV7A 3SEQA 2XAGA 1UB9A 1VQLI 4QWQA 1J0RA 1WJFA 3E5QA 2R93J 2HR3A 2PG4A 3HPGA 4ZTJA 4EM2A 1MGTA 1OFCX 2PMZA 3W3CA 1B9NA 4W1UA 2H1LA 2VN2A 3R6SA 2L4AA 1SANA 4MTEA 2NVUB 3WHCA 3C18A 2XIGA 5LHGA 1SVMA 1V3FA 1X3UA 1A5JA 4BL0B 1BM9A 3OS0A 2J5PA 3HGGA 2XAJA 4LFUA 3VYRB 3GLXA 3JTGA 2R7RA 1Y1WJ 2HWVA 3R0AA 2MH9A 2V1UA 2OF7A 1WJEA 3K4JA 4LOCA 3BTJA 1YO5C 2DFEA 2H09A 3CQZJ 5B66C 5BOXA 2IEKA 3KP4A 1R1TA 3RJPA 2DI3A 1JUPA 1D1BA 1JGSA 4KDPA 4OIQF 5A2QK 4HNUA 2L5QA 4LG0B 3LA7A 4BNCA 3MFKA 2DXIA 2WY7Q 3OL3A 3GTOJ 1I39A 2ZMEA 1JJ8C 2KIMA 5GAHJ 1FTZA 3EUHC 1U8BA 1FWZA 1HW1A 1WI3A 4JOMA 3BWGA 3I53A 1I1GA 1R5GA 1EJ9A 5K5OA 3E3VA 1I3QJ 2LTPA 5HNFA 3W2WA 5FJ8J 1X4PA 3Q3SA 2E5ZA 1HF0A 2DYSH 1D5VA 3K1MA 3JAMK 1BOBA 2HTSA 2Z3YA 5ICCA 1K61A 5E79C 2Z16A 2ISYA 1V5EA 1QBJA 1O3SA 3KLNA 4DOZA 3RZDJ 2OA4A 5TISC 1T56A 2MGQA 2RNGA 3S1MJ 2BY3A 2I10A 4EJUA 5E1ZB 5H20A 1E17A 4RAFA 3HIFA 2ELHA 2BVMA 3HHHA 3HRMA 2M4GA 4IVNA 5CVUA 5KCMA 2M4KA 1IV8A 1FLIA 3HSRA 4BQAA 3S93A 3VYTB 1MMAA 3HZJA 2ZFUA 4JQFA 2R7WA 2Z5UA 4KT5C 2MA3A 1YRNB 2R5ZB 1A36A 1H8AC 3BCAA 5KAFC 2CV1A 1ZTRA 1E3HA 5HS7A 4BY7J 4GCVA 1MSFC 4CZZA 4A3MJ 2EFNA 5HLGA 3OYIA 4RLFA 2LMDA 2RAEA 4EGYA 2LG4A 2CUEA 1DDNA 2LH9A 2FD5A 3UNGC 3LL7A 1O3QA 1KU7A 1JXSA 2NAZA 2HPMA 3N05A 1PUFA 1KYZA 1RKTA 3DEWA 3DPLC 5JVGF 3WU1B 3IKTA 3GWZA 3JRFA 4FX4A 1HW5A 4XR6A 3IH2A 3VYSB 3KIOA 1K6YA 4BJTA 2FNPA 4IZZA 2X85A 2ZJ2A 1FSEA 1MDMA 3BC8A 1ZGWA 1ACIA 3U9GA 1A04A 5IP9J 3M1EA 1G3TA 3S1NJ 2Y48A 1LDDA 2Q8KA 3LNQA 5E17F 2KMUA 1R1VA 3S3MA 2IS6A 4RGXA 1WRJA 3QPHA 3RTRA 4A6DA 3IAM2 4B47A 2AO9A 2EB7A 4I02A 1W1WE 2A5YB 1UZCA 2DDAA 2KJCA 5J8FA 3JRBA 2VC1A 5GPCA 2TRTA 2EK5A 2XRLA 1WJ5A 4KICA 3S15J 2DA5A 4LLGF 2NVXJ 2CFXA 4BQOA 1IRGA 4A69C 4XLFA 3FXKA 3TDZC 2XAQA 3C2HA 1BI3A 3E7LA 4M6YA 1BI0A 2XRNA 1SAXA 4AD9A 4ZYDA 3HOUJ 4E7KA 1UCRA 5M5WJ 2HZDA 4WXHA 1WZ2A 2YX7A 3CESA 1OYWA 2CU7A 2MC4A 2YUSA 3BT9A 3MKYB 5CPRB 3M8FA 2E35A 3ABUA 5EDNA 3KZIC 4XMYA 4ZDPA 4BYYA 2DYRH 3HRUA 3FWEA 4G7HF 3CC7I 1JTYA 1W0UA 3MZHA 3HOXJ 2KHMA 2BV6A 2W1OA 4O6JA 1QU3A 3PIPF 2PJPA 1Y8RB 2IA1A 3COAC 1OISA 3P5JA 4IHYA 4BDZA 4I6ZA 4XOPA 4CH7A 3WTSC 5EEGA 1T95A 2VI6A 2R4GA 3F8MA 3SJMA 1Z77A 1W36C 3DV8A 3DU6A 3KPHA 1AWCA 2KJBA 4XL9A 1BR1A 3WTZA 3FZVA 1CQTA 1TQIA 2DO7A 3C1DA 3ZP5A 3HDDA 3HPHA 1W7PD 1YIOA 2KZGA 4NDLA 2ELKA 4OAYA 1DPUA 1H9GA 5J1YA 4G6QA 4M71A 3WTUC 4BKXA 3IWZA 4KN7X 4OIPF 4UUSA 2M87A 1Y39A 1FPQA 1YS6A 4NC8A 5DM7F 4IX7A 2GLOA 2FOWA 4EM0B 3SHFA 1TZLA 4C3IJ 4NQWB 2ZXWH 2EFOA 5IP6A 3RQ4A 3G2BA 1ZRDA 4BXUA 1ZQ3P 1IZ1A 2OBPA 2DU9A 5LRSA 2R7FA 5GADJ 1C0WA 2UV1A 2X6YA 1WJCA 3GF2A 3HOVJ 2G0EA 1G3SA 1RPWA 5TRDA 1IAWA 2R7VA 3ESWB 1F36A 4CSWA 3E6MA 1IGNA 1T38A 2AS5F 4AIHA 1FOXA 3DPUA 3J81Z 2EIMH 1ODDA 1VQ7I 2VQHA 4ZDLA 4DGWB 3I5UA 1XCBA 2MC3A 4EV0A 2ECBA 1U0JA 3BR3A 4D1QA 3A0BC 5K5RA 1J5YA 2QBYA 4Y17A 2XB5A 2CGPA 1SFOJ 4AC0A 1FSHA 3FK6A 5LGUA 3QU3A 3I56I 5D6FA 3CMAI 3I4MJ 4RM2A 5E3NA 4B3AA 4WCGA 1J75A 3VWBA 1W7PB 3AG2H 5C4JJ 4OAZA 4BEHA 3MKZA 2K9NA 2X9DA 4ZJZA 4I7HA 2LKPA 2AQEA 5JHUA 2ESNA 2O5RA 2JN6A 3IRQA 2OC6A 1OCCH 1Z3XA 1AOYA 1KZHA 3I9V2 4HW0A 4Z6YA 4KMUX 2V6EA 3L2VA 3H9JA 5ICFA 1E2XA 2GAUA 1MNDA 1UHWA 1QHGA 3AL0B 3KFWX 3ZMUA 1U8RA 1K4TA 3CJNA 2L2OA 3I4NJ 4RB3C 2ID3A 4Y13A 1D0ZA 4I01A 2LBFB 5DCMA 1KU3A 3GTPJ 1IDZA 4BE1A 1S9HA 1R4NB 1MJAA 2DODA 4CCLA 1IG7A 5C4XJ 1D8KA 1B9MA 2MLGA 4DW6A 1BL0A 2Y30A 1FIAA 5ICGA 1Y6IA 1SC7A 4H0EA 3CD6I 4E7IA 1Y56A 5FLMJ 1XSXA 4BGDA 2HS5A 4C3JJ 3EUKL 1FOKA 3KYCB 2M3AA 5BMZA 4Y52J 5F04A 2GZWA 2OUMA 3DF8A 1K78A 4PDKA 4G7OF 1DPRA 1J2XA 5FKLA 1FOYA 3LSHA 4I0BA 3BQYA 3F9KA 1VTNC 4DYQA 4G9YA 3WTTC 3KZYA 3CJRB 2RDPA 3BZ6A 3JR9A 2OV7A 2DT7B 3DU5A 1R36A 3OOUA 4LIVA 2HPIA 1O7LA 3IC7A 3ECOA 3HYIA 3TOBA 4Q4ZF 3N97A 4M3GA 1OR7C 3TOAA 4XLEA 3FIWA 1G3WA 2A69F 2JMWA 5EG0B 3JSPA 1EF4A 1LVAA 2LF7A 2OZUA 1P9QC 1PDNC 4D9JA 4BY1J 2I5UA 2P5LC 3BTLA 1FYMA 3LSTA 3CUQA 3UKGA 2FXAA 1R1UA 5FKKA 1X2NA 3F72A 1ZKGA 1E0EA 2N8GA 2UWMA 1BJAA 4LB5A 1UJ8A 3K69A 3ZGKA 3IH4A 3R61A 3O2PE 1VNDA 3HHGA 1VZ0A 2VUMJ 3OIPA 3FHZA 1HLVA 3PQKA 5J8CA 3I4PA 1O4XA 3KP6A 1REPC 3FXMA 4BACA 4XKWA 3OV8A 3ZMTA 1DGWY 1NK2P 2V7FA 4MQVA 1U78A 2K4JA 2EZHA 1ZG3A 3HXLA 2J5OA 3D0SA 2NRAC 5CVVA 2VPRA 3FKJA 1ZLKA 2DCEA 1IXRC 1ETOA 3T5XA 4CGZA 4BJ5C 2VASA 4U0WA 4CCKA 1XDUA 3PFIA 1SMTA 3ZQLA 2GA1A 1RI7A 4PGHA 1R7JA 3EDPA 3R0JA 1YFHA 2O9LA 4UVCA 2WADA 2XSJC 1K6OA 1U3EM 1EH6A 2FSWA 1RR7A 1RZ4A 2MD0A 3PSFA 3CMYA 2M7AA 3GZNB 4WXDA 3WGGA 3MCZA 1IN8A 2DA3A 5LGNA 3QP5A 5CKTA 1TWGJ 5D5WB 3OR1C 1TQMA 4I99C 3ZPLA 3JSOA 2DA6A 5FLXZ 1ONVA 3GTLJ 2E60A 4DQ2A 3WG9A 2H1KA 1B72B 4UY8I 1STZA 4BHBA 2OU2A 1SFEA 4KT6A 3K2ZA 3HKZA 1TC3C 1BR4A 2EV0A 2OTLI 1U5TB 3BOQA 4C2UA 5B5EC 2BOLA 1MBKA 1XGMA 2PN6A 2GXBA 3GZ5A 2A3SA 5L3EA 1TNTA 2VQLA 1OCTC 5DV5A 1ZG5A 3R60A 3MMYB 4JX5A 3GMEA 1J9IA 1O7FA 1BI1A 2E71A 3EETA 3ZMVA 3EUAA 2D5VA 3FMQA 2F5FA 2WBMA 3ZQQA 1GUUA 3O8GA 1JKPC 3QWLA 3DP7A 3LWFA 5LEKA 3BR5A 4PFOA 3X2QH 2VLAA 2PBIA 4JP0A 1SD7A 2E2HJ 4XN3A 4YELA 2PJRB 4B3XA 2Y69H 4ZYHA 3P9KA 4D5FA 2VE8A 3CCJI 2VJ4A 5FKMA 4EGZA 2M0MA 4AUXA 2EV6A 1BI2A 1JT6A 2EPFA 5CLSA 2GWRA 2RKHA 1PP8F 5GTIC 4QPOA 1NK3P 2KIFA 1ZGAA 2A6HF 1RUNA 3F23A 3LAJA 1FBSA 1S8NA 4MFDA 2HU9A 1YJ9I 2QF7A 2HQ5A 2XHKA 4II3A 3CCVI 4E7HA 4M3FA 4LLNA 3T0YA 2CV0A 2K02A 3DEEA 5JLXA 2XC7A 1PP7U 1YJWI 1UG2A 2EWNA 1U6GA 4G12A 2E7WA 4MIMA 1R5ID 2A5WA 4UV8A 2QKMB 4A3CJ 4FCYA 4XKBA 2BHZA 3R4KA 4AVZA 2DOFA 3DXJF 2CG4A 2Y9ZA 2FJ1A 3HUGB 5EZHA 3C2GA 4PJMA 4C3HJ 2V1DA 4LK0F 3H5RA 1O57A 1S6LA 3O8HA 2CQ7A 4FQGA 2EIJH 2K4BA 2V1NA 2CUFA 1GLNA 1F4KA 1JTXA 4I76A 2AHQA 4PJNA 3H0GJ 4KA4A 2KDOA 3AL0C 1JJ6C 3ASNH 3ZMDA 2O61A 2E5NA 2BHYA 2HDCA 3RKXA 2EFWA 1LE8A 4ENJA 4PZJA 5BNGA 1K79A 1I3AA 5M3FJ 2WAEA 5IYBJ 3ZMSA 2R7OA 2RC4A 2A05A 2QSHX 2VBXA 1Z67A 4L9NA 3P9CA 4G6DA 1S7OA 4XKCA 2VBWA 4MHGA 3K1NA 4IL6C 2DFFA 5F0CA 3VPRA 3L2CA 1R00A 2VXZA 3V8LA 3S1QJ 2DW4A 3K4KA 2R7SA 3ERED 2A07F 3LA3A 3U2RA 3UR3C 4QLCU 3IUOA 5HOOA 1IUYA 2YU9J 2JPBA 5J1RA 4X0GA 3A01B 1O3RA 3W6KB 2XROA 1TWFJ 1QZYA 2DMPA 3G71I 2LKSA 4ASNA 4FE4A 3QOEA 3EQLF 5B1AH 3GXOA 3CCEI 1J7KA 2VJJA 2DFHA 4WF2A 1T33A 1KQ0A 1WQ2A 1TL8A 3HL2A 5HDKA 4YG2F 3GTJJ 1A35A 3DKXA 5E1WA 1QPIA 1S72I 1ZR2A 1GHCA 2L7FP 2RVCA 4NNJA 2WWYA 1V55H 3BG7A 1USSA 2K9SA 2VKHA 1TWAJ 2GIZA 3QPSA 3HKZN 3CMMA 2MG4A 4E7JA 2IGNA 2WB1A 2RQPA 2JA5J 3B73A 4P5OA 2A6TA 2BW3B 3FHNA 4EJOA 1G8XA 4H4KC 5HS9A 3MKLA 4B1RA 4MNUA 3LFUA 4ENNA 5FFXA 5ICEA 1ETWA 4S05A 2BYVE 3BR0A 3RIRA 4HDVA 3FISA 3QAHA 2FRHA 4NUBA 2LVSA 4M72A 4OMZA 3ABTA 3FF5A 4A0YA 2CQKA 3BZCA 1H0MA 5F6FA 2CW0F 3OOPA 4L9TA 1JKQC 4HQEA 5EJCA 4RB2C 5KK1A 4FT8A 5J3LA 4UXNA 3E6BA 3V8KA 3ZQIA 5GAEJ 4E7ZA 2X6WA 3LSKA 3JRGA 1MSEC 4HSTA 4XLNF 1GT0C 3OIQA 2LNBA 3AFHA 2QENA 2ZO4A 2XV4S 1ZARA 1X58A 5KNLA 3JCUC 3DKYA 1P2FA 3TKYA 3DFGA 3OSFA 4ZDOA 4ENKA 2VJIA 3GEZA 3PIOF 2LKXA 3SZGA 4BE0A 2NYXA 2KIUA 4HA8A 2JQ7A 5E8IA 4HAMA 9ANTA 5HS8A 2F4MB 3FX3A 1LNWA 1BJZA 3S8PA 3CO7C 3L9FA 4MFEA 1JUSA 2UZKA 2XASA 2K86A 4V19K 1FMWA 5FGMA 5HDGA 2XB0X 1UELB 1IW7F 3S14J 2HGCA 1KA8A 2E2JJ 2VIXA 5LRRA 2KL4A 2Q2EA 2D45A 3L2RA 2LDUA 2M1BA 1QGPA 4RAYA 2FX0A 4B48A 5A2QZ 2Y31A 3HRSA 3HOWJ 3CJTB 3K9TA 1U5TC 1LFPA 4XRMA 1VF9A 1D0YA 1HCRA 3LQRA 1W7PA 2FUG2 2PMHA 4QIWN 3L2UA 3TP3A 4BS9A 4RMNA 2HFHA 1Z1DA 3DBRB 2LD5A 5LLQA 2STTA 2CV2A 1Q1HA 3W6VA 1ZGJA 5JFRA 1SFKA 1I27A 5HLIA 2CQNA 4BH9A 5ILUA 4CA0A 2AXTC 1NH3A 3W6JB 4XKVA 2F2EA 2OCCH 1K7AA 1T6SA 1OMIA 2K9QA 3MEXA 3JAMZ 3GTMJ 4HF1A 2QUFA 4XOTA 3J80K 2GIVA 2X4HA 1IN4A 2UXXA 3K10A 1HXDA 3GUDA 3FXQA 2R7UA 1TLHB 2Z99A 1UAAA 1GV2A 3MAJA 3VYUB 1TWHJ 3A1YA 3LSGA 4YFNF 2KQRA 3CCRI 2GXGA 1ZH5A 2TCTA 1CGPA 2NVQJ 3RYPA 2X0LA 3H9GA 3Q5FA 2QZ8A 3GFIA 5GTHC 1RESA 5IYDJ 4V2FA 2W7NA 4GXOA 4W97A 3QPLA 2HTJA 2VKVA 1S7AA 4MQ9F 2QQ8A 1TT0A 3RSNA 4D7MA 2E19A 2VKDA 3RPQA 5DUIA 2GXAA 3D5SC 1VQOI 3DEUA 2CQQA 4NB5A 4CICA 1MZBA 1ZRFA 2PFBA 2F4OB 1NG6A 4GRIA 4M73A 2W85A 1ETQA 3ELKA 1AA7A 1Z3YA 2CUZA 2HOAA 2R7QA 2LYCA 3GFLA 2DFIA 1U2WA 1VQMI 3L1PA 4BU2A 3DTKA 4KNYA 3GTQJ 1P4AA 5HODA 3HEFA 3FM5A 4V2GA 3SFZA 4CYCB 1XDSA 2PMZN 3WTWC 1FIPA 1T0FC 1M1EB 1PVEA 1W5TA 3OYCA 3CP8A 4S04A 2ISZA 2QSGX 4EEFG 2MABA 2G7UA 3S16J 3BR2A 3T8TA 5DCFA 1X1CA 2VL8A 3Q9SA 2M8GX 2XKPA 4LGWA 5AIPA 1QZZA 4UB8C 3S1RJ 1XTAA 4F7ZA 2XDVA 2ZSHB 4U0YA 4IOCF 1AKHA 4Q48A 3LSJA 1DU0A 1X3ZB 1IO2A 3GVAA 1MMSA 1LDKB 1PJRA 3FXRA 3CLQA 2GOXB 5IT3A 3EPZA 3U1KA 3B6CA 2VXDA 4AVPA 1H89C 2KKOA 1XC5A 1YTYA 4Y4RA 2EILH 2MW8A 4U7DA 2FU4A 1ENHA 3AG3H 1Z6RA 1RKWA 1R49A 2KRCA 3GBGA 4BQQA 4P1WA 4PJ0C 3CCMI 2OCEA 2OAZA 2Y9YA 4M3BA 2DOAA 3QPTA 3E5XA 1UMQA 5D8LB 2QSFX 2Z2SB 4O5VA 2KP6A 3TDUC 3FXJA 4MEXF 2IT0A 1T08B 1GXQA 3SYTA 1IF1A 3EUHA 1PYVA 2IGMA 1T39A 2IA2A 4U88A 2E36A 3REOA 3A2KA 2CW8A 4IQJA 1U9OA 2UUZA 3GO5A 2GA2A 2NS0A 3RDIA 3CJQB 2DMQA 2WA0A 4IRGA 4L18B 3ZOBA 2LSOA 3K2AA 3RQIA 2DDBA 1B72A 4U7BA 3ERMA 4NHJA 4WXCA 3F3XA 1SFUA 1MJ9A 1G4DA 1S5LC 2R7TA 4PJJA 4I2OA 2HYFA 1HSJA 2QEXI 4F52A 3C3WA 5JHFA 2JRTA 2L7ZA 4MO7A 1JT0A 5GAGJ 3S3NA 1OJLA 5BS6A 4RAGA 2OTJI 5J4YA 4KIGA 4D0PA 1ZELA 4M9XA 3U21A 2HYGD 1V5GA 3F8FA 3K4MA 3HC7A 3L7WA 1LVKA 5J40A 3F8NA 3RI4A 1N25A 3QRFF 2R7XA 1ITYA 4HF0A 3QYBA 1MH3A 5D4SA 4A6EA 3E5UA 4G6TB 2ZJPF 4HDUA 1JHHA 5FB2A 2DAOA 3IAS2 2OPTA 4KITB 1JUMA 2EZIA 2FNAA 5LBQA 1KU9A 2O8XA 4N9HA 2H8RA 1R4MB 3LQQA 1OCRH 2V1XA 1POGA 1SEUA 2NNYA 1MJBA 1D8JA 1LJ9A 4ZZLA 3AAFA 4RA2A 3TGNA 2BBYA 2HXIA 3GTGJ 5CVIA 3DLAA 3VFZA 4WWCA 4Y3OA 4A5MA 2DA4A 5LGTA 1XSDA 3IRRA 2NS7A 3ABMH 4HX8A 5ERIA 4BXFA 1IRZA 3ZN1A 2P6SA 3GFJA 2XPUA 1A6QA 1HC8A 4FASD 4FETA 1WGXA 4GDFA 1OCOH 2JJ7A 1LPQA 3QOPA 2IJLA 3J7AY 5ED4A 1FTTA 2DOEA 4YIRX 2HVSA 1I5ZA 4D7NA 2O3FA 3RPUA 3K4LA 1I6XA 3GYHX 1WKMA 3OYAA 3RKQA 1WVRA 3E0JB 4IHTA 4HLXA 1XCVA 4N9IA 2M5WA 2F5CA 2K7LA 3ZXSA 3CZ6A 4N4OB 3I59B 1FNNA 4KMFA 3H9QA 4BBSJ 1RNLA 2M30A 4A93J 1Z05A 1YIJI 1B8IB 4JYKA 2KIQA 3JRDA 4JK1X 4LMYA 2DK8A 2EH3A 2V4JC 3DBLB 4BBRJ 4CZCA 1GV5A 5D5XB 1XGSA 2VKEA 1MDMB 3OS2A 2P8TA 5B1BH 1Z91A 3OL4A 5DD4A 3L2QA 2DT5A 5DYMA 2QQ9A 4BHCA 3K6GA 1MKMA 2RREA 1RRJA 2H94A 3OMYA 4XK4A 1H88C 2E1CA 4L9JA 3ISPA 1DU6A 3JRHA 1YW7A 3DLLF 2R92J 1ZR4A 4RB1A 4UB6C 4IF4A 1P6RA 3GTKJ 4B4CA 2IA0A 4X6AJ 1R22A 2XGDA 2ZNZA 2P4WA 4HX7A 2HXOA 4G7ZF 2DBBA 2E2IJ 4MEYF 2Q1ZB 5F1JA 4DBQA 4WX9A 5C44J 3HB9A 2QWWA 3L00A 3LSRA 1WPKA 3LSPA 4M3EA 2MYSA 3CUOA 4MLOA 1IC8A 2DMNA 3BY6A 5KAIC 1BN5A 2XF5A 1N77A 1F43A 4P96A 2BW3A 3CP2A 4BJ6C 2LY1A 2Y75A 3MWMA 4DBRA 1IN7A 3D1NI 3AG1H 1BA5A 4L5JA 3ABKH 1YX3A 1R9TJ 5CJ9A 1WI9A 2ZNYA 4FE7A 3ZCOA 1WCMJ 3SEZA 1GDTA 2DTRA 2GM4A 2IGKA 2Q0OA 2QCOA 1W5CC 2LC2A 2XAFA 5D8KB 2BEOA 2K5CA 2LY2A 1HQCA 5M5XJ 1VQKI 1QRYA 3ASOH 4RGRA 1L3LA 2EINH 2B7EA 3IV5A 4WK8F 3LSMA 1ZG1A 2KFDA 2LFBA 2JZYA 2JA7J 4HNVA 3SFIA 1IDYA 1BC7C 3GW2A 1ETVA 2MD5A 5AONA 2QM3A 3A0HC 5EEAA 2WAQA 4U0VA 4QTRA 1HKSA 2HVQA 3PNYA 1JHFA 3OY9A 1MNMC 3OSGA 4M3DA 1D5YA 1QNTA 1V5FA 4GO1A 2QYOA 1YW9A 3OYEA 4LG0A 3BPXA 4B8XA 2DT6A 3WE3A 2ME6A 1D3YA 2PMUA 3PL8A 5CQGA 4A5NA 4UUSB 1SVOA 3AKZA 1KYWA 5EZGA 1RUOA 5FRNA 3G3ZA 1R71A 1EKEA 2L02A 4HBLA 4P55A 3OWTA 2L01A 2UXNA 2B63J 1DP3A 2CMPA 3F22A 2CO5A 4DJAA 1Z9CA 1YLFA 1MW7A 2CFOA 2D1VA 2G9WA 3WHBA 3L2WA 4IRHA 5FKNA 2LOOA 2JA2A 3B6AA 3PO2J 2HDWA 2P81A 3I0TA 3M8JA 2V9PA 2WV0A 3F6OA 2COBA 5L3DA 2ZBKA 1LDJA 4A3GJ 4L5EA 4E70A 2QVOA 2XGCA 4C9YA 1I50J 1XGNA 3OYGA 4UUTA 5K7FA 3JRIA 1TBXA 5DDGA 2KZVA 3PNTA 2FBKA 3KETA 3RYRA 3ONQA 1YHQI 3BDDA 1YRNA 2R5ZA 2PX9A 1FZPB 2MLKA 3LFKA 2AXLA 2QBYB 2H27A 5J4VA 3CCUI 1T2KA 3J7ZI 5J1UA 2ZMEC 4GYGA 2DMUA 1RR8C 4YRVA 3MZ8A 2HQAA 1HA8A 4XLHA 2F5VA 4J19A 4BEHB 2ZKZA 3KX2A 1KQ8A 2VOOA 4BQNA 2VQGA 1YX5A 2DJNA 4GGGA 4IJAA 4L5IA 3KYLA 2K40A 1QQIA 3MVPA 3ZRGA 4XRFA 2BY1A 3KEYA 3W2AA 2XF6A 2O8KA 1APLC 1ON2A 2P6TA 2KPMA 2BE5F 2A61A 3SZPA 4HX4A 1QVUA 2JT1A 3BG9A 4LLLA 3WU0A 1FT9A 4UVAA 3GX4X 1OR7A 2ME0A 1QA6A 1X1AA 4GFBA 2LP0A 4BE2A 3MKWB 1BR2A 5F0FA 4OINF 3PUFA 1ZHFA 4ZTFA 1LEBA 4UNOA 2P7VB 1X1DA 2PQ8A 4A12A 3K4CA 1MBFA 5K7HA 4D5CA 5FO5A 2KRFA 3BR6A 1S7EA 3Q9VA 5D4RA 2W48A 1Y1VJ 4ZYGA 1WFXA 1MD0A 1QO0D 2HDDA 5FFZA 2JUCA 3BZKA 1FMVA 3WTVC 2IS1A 1XB4A 1BC8C 2XPVA 1WH7A 4CCOA 2ADUA 4Q5SF 2IXSA 2R5YB 4KIFA 4OU0A 3BTCA 1IJWC 3FKIJ 4PUSA 3SDBA 2IGOA 4XSZF 3ZQGA 2NVTJ 5M5YJ 1JKRC 3T1BA 2WAQN 5KHDA 2EFPA 2NNNA 2QLZA 3DKWA 2XAHA 5F27A 4B09A 1Z6TA 1LFBA 3QYEA 3S3OA 3CLOA 2ESHA 1LEAA 2HZTA 5L3CA 2RN7A 2IBDA 1FOWA 1R58A 3VSLA 3ZQ7A 4XICA 4UV9A 4N4NB 3FBIB 3MZYA 2Y2ZA 4Y15A 2V6CA 3E6CC 4PJLA 4XORA 4C30A 4XSXF 1H9TA 1A31A 2ZXJA 3TO6A 3DCFA 4Y7NJ 4A3IJ 2Y0SA 3PQJA 2X1CA 3LOCA 1K4SA 4A2UA 3CCQI 3ZR8X 4S0HB 3BJOA 3BJAA 3G73A 1D1CA 2Z1DA 5IYCJ 5FLVA 3FXLA 4BDYA 1ZAOA 3RZOJ 5DM6F 2R7DA 5BQTA 1N75A 2QGUA 1E3PA 4XRSG 5E1XA 1MBJA 4E6KG 3ZMZA 1B59A 3V8JA 1L0OC 1MBHA 1X4OA 2JTVA 1X19A 2WTEA 2X6OA 4HV6A 4NQWA 4CUGA 3QU6A 2HNHA 2Y0MA 2LK2A 2ZXHA 1VQ9I 1ON1A 2V9KA 3I54A 2IPQX 1G3YA 2GQQA 2DA1A 2IVMA 4HV5A 3KE2A 4MGRA 4JBAA 1HOMA 1WJBA 2R7ZJ 3G6EI 4ABZA 4F55A 3G4SI 2P7CB 4C2MJ 4M9SA 5CVJA 2VBYA 1HW2A 2FMLA 2YSRA 1R23A 3OYLA 2HQNA 3DPTA 3BG5A 3PJRA 4CHUA 3VSKA 4XBFA 3H3UA 4XLCA 3NWSA 3D5RC 4FTHA 1X3WB 1OPCA 3A02A 3DTEA 4Z2YA 4K2EA 2LRDA 1OLTA 3G1LA 2FE3A 4ITVA 1XG1A 3M1CA 1S29A 2Z9OA 5D6EA 4P9UA 2B0LA 1TW2A 4KYWA 2IW5A 2R0QC 3TQNA 2DPUA 1Z7UA 2H6CA 2IS2A 1T98A 4LITA 5DUKA 4IXAA 2BXZA 4ZYEA 2MH2A 4L0ZB 2DA7A 4O3MA 3S2DJ 1FEXA 1DP7P 5EGOB 3S32A 1BW6A 1XMXA 2EV5A 3S2WA 2YX4A 1BIAA 2FEZA 2HI3A 4BXXJ 4HYEA 2K9LA 3KEOA 4HQMA 3Q0UA 2H8WA 3OYMA 3GZ6A 3BTIA 4ZC3A 2X48A 4E7SA 4RDUA 5F64A 2V79A 3RKYA 4LJZF 3F21A 2Z33A 3ML6A 5EEHA 1MBGA 2LBFA 3ULQB 1ULYA 2WY8Q 3WU2C 2KISA 2W82A 4JX6A 4RB0A 1KQ9A 1FBQA 3K1PA 1XN7A 5H6RA 4CYDA 3BQZA 3ZQFA 3TO9A 2FBIA 4A3BJ 4UUVA 2TDXA 5ILVA 1DGRM 1IRXA 3N4MA 2YU3A 2CS3A 4II2A 3HJEA 5CVRA 4EJTA 1MNEA 1HDPA 2O03A 3DQVC 3Q0WA 2MFZA 3TL4X 1IN6A 2ID6A 5IP7J 4LD5A 3BR1A 1VQ8I 1TT5B 3J80Z 4F93B 5LHIA 3CDLA 3OYBA 3DBHB 4HEA2 3I59A 4L9VA 2G7HA 3QYFA 3TP0A 2F5EA 1T8IA 2C6YA 4RAZA 5E8GA 5E3OA 1P4XA 2WB1N 4A0XA 1XS9A 1TP4A 1MMNA 1B8IA 1WJAA 2NS8A 3KEQA 3OYDA 3H3ZA 4LB6B 1E3OC 2IRFG 5TJJA 4OWRB 2Y0SN 3OYJA 4LIUA 1SD4A 2MBFA 4KFCA 2DK5A 2LREA 3CCYA 4G8XA 5L3BA 3HM5A 4FX0A 3VDXA 5EG0A 1X1BA 2EIKH 4EQQA 1LE8B 4IKFA 5E3LA 4RS8A 3IHUA 1F5TA 6PAXA 1B6AA 4NC7A 2W57A 5AIQA 5LFAA 4C2TA 1YG2A 1Y0UA 4PSXA 3K70C 3IL2A 1IV6A 3A03A 4XN0A 1LFUP 1LUJB 3ABLH 1RC9A 1FYLA 4XIDA 3OS1A 2ACJA 4XNFA 3PSIA 5DS9A 2DJIA 3HGYA 2DLLA 4BAYA 4AIKA 2VJ5A 2AQFA 4ZH4F 1CF7B 3H5AA 3M7GA 2L7KA 2HKOA 5D5UB 2ECCA 1UG0A 1BIBA 1XX5A 3CF2A 4RBOA 3HOSA 3PFYA 2HEOA 3A4CA 3JRAA 4XM3A 2VQCA 4EMSA 1J59A 4A3KJ 1VQPI 1UHMA 1WSUA 1D0XA 2VBZA 2V9VA 4P9FA 4KIBA 4PGGA 2LY9A 1MIJA 3JW4A 1UHSA 2E1OA 4N0BA 2VE9A 1YI2I 1GVDA 5B3SH 1XPXA 1QZEA 2M7BA 3I58A 5FKOA 4AM3A 5F08A 1N78A 1O3TA 4M9ZA 5CYVA 3TO7A 4I0AA 3IWFA 2EBIA 1W4MA 2EQRA 1FYKA 1AHDP 2EFQA 2VB6A 5HNHA 4HF2A 1HKTA 2CUJA 3CUQC 2B9SA 1Q1VA 2JPCA 4XONA 5FRMA 1FJLA 1TWCJ 2HVRA 5LD2C 1OYYA 3MN2A 2EA2A 1QHHD 4Q47A 5JI6A 5DD8A 2KT0A 2XVCA 4J01A 2E1MC 3EYYA 4IQ4A 1SMYF 4EJVA 1NHAA 3FM3A 3OYFA 2DMTA 3FXUA 1YS7A 2ICWG 4YEJA 3VODA 3GLLA 1P92A 3BJ6A 4HSRA 1U5TA 3FMSA 3IH3A 1YE9A 4F92B 5JLWA 1WWXA 4AWXB 4JX4A 4J00A 1QPMA 3E6DA 2RNJA 1ZREA 3CTAA 3J81K 1TW3A 4MTDA 3JRCA 2PLYA 2E1NA 1BW5A 2D2WA 2ELJA 3U1DA 1OQYA 1V4RA 4HOBA 4ETSA 1JGGA 2L4MA 4IPAA 3CDHA 4PCQA 2FF4A 2P0WA 1JKOC 1HBXG 3F0CA 3NRVA 4IHVA 2LF8A 2EZLA 3SXYA 2RGVA 2PJRA 2K9MA 2OD5A 2VODA 2ZMEB 1G59A 5L3FA 3G1OA 4M74A 2DPDA 2L7MP 2NOGA 2BGCA 3H0DA 3M07A 4CCJA 3FXOA 2FA5A 1PUEE 3BLYA 1FX7A 2OJED 4IOAF 2Q2EB 4DZPA 4OOIA 2O6GE 1VQ4I 5IPAA 3CC4I 2LLKA 2X1EA 3QP6A 2CW7A 2FQ3A 3O6BB 3AG4H 4RGSA 1ZYRF 3P9IA 3WTXC 2ZB9A 1KGSA 3LSIA 4B44A 3W2VA 3LMMA 4AYBA 2EJRA 1ORKA 4QPQA 5BPIA 3HUGA 2KRHA 2HOEA 2K3PA 2HQRA 1R6RA 4XLPF 3WTYC 5E18F 1P7JA 3KCCA 4DYCA 3HG9A 3I64A 1S3JA 3PNVA 3J7YJ 1KONA 1HDDC 2E7XA 2JSPA 4EVIA 4A3EJ 4CCNA 4UHTA 1VFCA 3RCOA 1MH4A 2A6EF 1IXSB 3V7SA 2YR2A 3H92A 1YJNI 1T0FA 1RETA 3E97A 1MMDA 3IKVA 1YYVA 4OIRF 3ZN0A 4LG3A 2VPLA 2ZSIB 1TQPA 2VONA 3V7CA 5FD6A 1G2HA 1TNSA 3M9AA 2BXYA 3KP3A 5F0HA 1PUFB 1U9NA 3CO6C 3TW7A 2O0YA 4PFPA 3VOEA 5EYRA 3I3LA 4IHSA 4YIFA 1OKRA 3H36A 1V54H 2WAFA 1YW8A 1RIOH 2XGXA 4AIDA 4B43A 1TTYA 3K4BA 5GP9A 1DUXC 1VQ6I 1X1PA 4YFKF 4PSWA 3JTHA 2L0KA 5LHHA 3KLOA 3A01A 3MD2A 3KP5A 2R5YA 5J6XA 4NC6A 2W00A 2KDZA 3QQAA 3M4OJ 4XQFA 1R5HA 2XPWA 2CWEA 3VB2A 5HVQC 3K0LA 3HOZJ 4DNCA 3C2BA 5JVTA 2FOKA 3FBNB 2MSYA 4PK4A 3OYHA 3C7JA 5DEQA 1J09A 2L9NA 2GBYA 1LKXA 5K7ZA 2ZJQF 2DTZA 4ESBA 3TEDA 3HSEA 4XLAA 3MQ0A 4CCMA 3NAUA 4F3QA 1BBYA 3H3VK 2M9HA 1HSTA 2L54A 2L9VA 2PEXA 2XSDC 4ESJA 3HTSB 2LR8A 2JA6J 2ZJRF 2ZFWA 4ESFA 1AKHB 1I1SA 2BVLA 1NTCA 5H2FC 2CH0A 2R3SA 3FK7A 3T8RA 2P5VA 4A3JJ 3K4NA 5GPAA 5M3MJ 5E3MA 2PI0A 4I98B 2JVGA 1ZN2A 2M34A 3ZQHA 2A68F 2K85A 2M2EA 1WJDA 4KN4X 3L09A 4YIIA 3BPVA 3HSFA 2W24A 1HKQA 4EM1A 2L9RA 5K1YA 4BUPA 4ON0A 1YQAA 2OQRA 4IHXA 2W4SA 1XD7A 1Y8QB 5FLXK 4IEJA 1EA3A 1F9NA 5ILSA 1FP2A 4CXFA 4KUMA 5E20A 1ETXA 3TMOA 2DQRA 2H6BA 3HOYJ 1W5SA 1WHUA 4EATA 3J7AO 4RM3A 2JK3A 1FP1D 2CSOA 2DA2A 2VT3A 2IS4A 2XGEA 1ZK8A 5L3GA 3EYIA 2CJJA 3F8BA 2X6XA 2CYYA 2L3DA 4AYBN 3I71A 3BG6A 4KJZA 4R8HA 4HLYA 2P5KA 1BOAA 4G94A 3TBIA 3WG7H 1NG7A 2F4IA 3KP2A 1F1ZA 3ROUA 1GXPA 1SD6A 3ECHA 2JA8J 2X1DA 2XKOA 2BY2A 2M0CA 3GCMA 3KZZA 3V42A 2HOTA 5IY5H 2JRMA 4HG2A 1SD5A 1IN5A 2CQXA 2ZXIA 2BZTA 2F5DA 1Z21A 3NWTA 2D1HA 1SAUA 2NXNB 4A3FJ 4FHTA 3HBLA 4CDGA 3NARA 4DZJA 4CO8A 1SFXA 3RPUD 3K70D 2QQBA 3CDIA 1VQNI 1YOVB 2NVYJ 5IT9K 1GVJA 1B4AA 1XMAA 5EGOA 4L0YB 2NOJB 2XUBA 1D1AA 4HPQA 4LK1F 5HLTA 3HOTA 2M45A 2F48A 2GOMA 3BP8A 3Q0VA 1LQ1A 3CC2I 2JUGA 1P4WA 2ZCWA 3FMRA 3NQOA 1XGOA 3SZTA 4NBQA 2DQLA 4IO9F 2COMA 2IP2A 1FBUA 2E34A 2HYJA 4A3LJ 1XSVA 5HDNA 3KP7A 1UFMA 3SQNA 4GYIA 5IT9Z 3H1CA 2XAUA 1KU2A 4DYRA 3QODA 2JVHA 2YPRA 3O3KA 3WE2A 2KLOA 3GFMA 1Z0XA 2CRGA 4HNTA 3G1MA 3KYDB 1X2MA 4BHPA 4R1HA 4AU7A 3OYNA 5KVRA 2W84A 3H35A 1LB2A 3P7NA 1P7IA 4E4HA 4OIOF 4UVBA 1XMKA 2QQAA 3HTUA 5TGTA
chains in the Genus database with same CATH topology
1UMQA 1ETYA 4M3GA 3JREA 2EZKA 2R0QC 5EG0B 3FIWA 2JMWA 1EF4A 1VI0A 4BY1J 3BTLA 3ZQCA 2DA7A 3OIOA 3UKGA 3S2DJ 1A6IA 1FEXA 5EGOB 1U9OA 1MBEA 4A3DJ 5FKKA 1X2NA 1BW6A 1ZKGA 2DMQA 1QVTA 2FQ4A 2N8GA 5C3EJ 2HI3A 3ZOBA 3K2AA 3RQIA 3S2HJ 1B72A 2IAIA 4BXXJ 3IH4A 2YS9A 3Q0UA 2O7OA 4CYCA 3BTIA 2X48A 1VNDA 4RDUA 3S17J 2VUMJ 1ETKA 1HLVA 3M3YJ 5EF6A 1AU7A 3SDGA 4IHWA 3BG3A 1O4XA 1MBGA 2L7ZA 4MO7A 1JT0A 1W0TA 1WH5A 4JX6A 1NK2P 1OJLA 5IOZA 1U78A 2EZHA 3BQZA 3ZQFA 4A3BJ 2VPRA 1I6HJ 1ETOA 1ITYA 2WV1A 1HDPA 2HOSA 1MH3A 3Q0WA 4X1EA 3ZQLA 2ID6A 5IP7J 3BR1A 2DN0A 3CDLA 2O9LA 2OPTA 3TP0A 4XRSA 1RR7A 1JUMA 4QSHA 2JWTA 2EZIA 3CMYA 5E3OA 2WB1N 3PM1A 1IUFA 2H8RA 2DA3A 1XS9A 1TWGJ 1B8IA 1POGA 4FISA 2NS8A 2DA6A 3GTLJ 1K83J 1OCPA 1E3OC 2Y0SN 2H1KA 2HXIA 3GTGJ 3PO3J 3TW6A 1B72B 2DA4A 3CCYA 5DTDA 2NS7A 3HM5A 1IRZA 1TC3C 5EG0A 2XPUA 4M6VA 5IOYA 3K7AJ 1MBKA 1WGXA 1LE8B 2JJ7A 5E3LA 1OCTC 4JX5A 1FTTA 1IV6A 3A03A 1LFUP 4D7NA 2D5VA 2R93J 4XIDA 1GUUA 3O8GA 1JKPC 1OFCX 3RKQA 5DS9A 4W1UA 3HGYA 3BR5A 1SANA 4JP0A 2E2HJ 3WHCA 2ECCA 4RBOA 1A5JA 4D5FA 3HGGA 5FKMA 3JRAA 4AUXA 1Y1WJ 1JT6A 4A3KJ 4BBSJ 4A93J 2OF7A 1NK3P 4LOCA 3BTJA 4JYKA 3JRDA 1B8IB 2LY9A 3CQZJ 1UHSA 2E1OA 4MFDA 2EH3A 2IEKA 2HQ5A 1GVDA 2QF7A 4BBRJ 4M3FA 1GV5A 1JUPA 2VKEA 5FKOA 5F08A 5JLXA 1UG2A 2EBIA 2EQRA 3GTOJ 4G12A 1AHDP 1JJ8C 4MIMA 1FTZA 1U8BA 1WI3A 4A3CJ 4FCYA 4XK4A 1H88C 1Q1VA 1DU6A 3JRHA 2Y9ZA 1FJLA 2FJ1A 1TWCJ 5EZHA 2R92J 1I3QJ 3MN2A 1ZR4A 4C3HJ 2LTPA 5FJ8J 2KT0A 3Q3SA 3GTKJ 4B4CA 3O8HA 1HF0A 4X6AJ 2XGDA 2CUFA 1K61A 1JTXA 4I76A 2AHQA 2HXOA 3H0GJ 2DMTA 2E2IJ 5F1JA 3RZDJ 5C44J 3HB9A 1JJ6C 1T56A 2MGQA 3LSRA 1WPKA 3S1MJ 3LSPA 4M3EA 4MLOA 1IC8A 2DMNA 2I10A 3IH3A 5JLWA 1LE8A 1F43A 4JX4A 5BNGA 5M3FJ 3JRCA 3D1NI 1BA5A 5IYBJ 1BW5A 1R9TJ 1JGGA 4FE7A 1YRNB 2R5ZB 1WCMJ 1H8AC 1GDTA 1JKOC 2GM4A 1ZTRA 2QCOA 3F0CA 5F0CA 3VPRA 4BY7J 1MSFC 4IHVA 4A3MJ 3S1QJ 2EZLA 5M5XJ 1QRYA 2RAEA 2CUEA 2YU9J 2FD5A 5J1RA 3IV5A 3A01B 3G1OA 1TWFJ 2DMPA 2LFBA 2JA7J 4HNVA 4FE4A 3SFIA 2L7MP 1PUFA 1IDYA 1RKTA 3DEWA 1ETVA 2NOGA 5EEAA 3JRFA 4QTRA 1MNMC 3IH2A 1T33A 3OSGA 4M3DA 1D5YA 4DZPA 3GTJJ 5IPAA 1QPIA 2LLKA 1ZR2A 2L7FP 1ZGWA 5IP9J 3S1NJ 3LNQA 2ME6A 2K9SA 2ZB9A 1TWAJ 3QPSA 3HKZN 4UUSB 2MG4A 2JA5J 5EZGA 1ORKA 2AO9A 3JRBA 5GPCA 1P7JA 3MKLA 4B1RA 2TRTA 4DYCA 2XRLA 1HDDC 1ETWA 3S15J 2DA5A 3BR0A 2NVXJ 2B63J 3FISA 4A3EJ 4A69C 2LVSA 1VFCA 3WHBA 1MH4A 5FKNA 3B6AA 3PO2J 3E7LA 2P81A 1JKQC 1RETA 2COBA 3ZQIA 5J3LA 4A3GJ 4L5EA 3HOUJ 2XGCA 3JRGA 5M5WJ 1MSEC 1I50J 1GT0C 1G2HA 4UUTA 5K7FA 3JRIA 2CU7A 5F0HA 1PUFB 1U9NA 2YUSA 3BT9A 1X58A 3TW7A 1YRNA 3OSFA 5EDNA 2R5ZA 5EYRA 5J1UA 2LKXA 1JTYA 2DMUA 1W0UA 9ANTA 3HOXJ 5GP9A 1BJZA 3A01A 4IHYA 2L0KA 4MFEA 4I6ZA 2R5YA 4J19A 1JUSA 2KDZA 3QQAA 3M4OJ 2XPWA 2VI6A 3SJMA 1Z77A 2DJNA 2XB0X 3HOZJ 3S14J 2K40A 2E2JJ 3MVPA 1CQTA 3C2BA 3HDDA 2FX0A 2O8KA 1APLC 4NDLA 2ELKA 2Y31A 2MSYA 3HOWJ 5J1YA 1QVUA 4XRMA 4BKXA 3BG9A 4UUSA 2GBYA 1VF9A 2ME0A 1HCRA 5K7ZA 4GFBA 2DTZA 2LP0A 4QIWN 3TP3A 3TEDA 2GLOA 2LD5A 5F0FA 3NAUA 3H3VK 4C3IJ 2M9HA 3W6VA 2XSDC 2LR8A 5IP6A 2JA6J 1MBFA 5K7HA 4D5CA 1ZQ3P 1AKHB 3BR6A 1NTCA 1S7EA 2K9QA 3FK7A 2W48A 3GTMJ 1Y1VJ 4A3JJ 5GPAA 5M3MJ 5E3MA 2M34A 3ZQHA 2HDDA 3HOVJ 2G0EA 1RPWA 2M2EA 1GV2A 2XPVA 1WH7A 1F36A 1TWHJ 2R5YB 3LSGA 1IGNA 3BTCA 1IJWC 3FKIJ 2L9RA 2TCTA 4IHXA 2NVQJ 4IEJA 3ZQGA 2NVTJ 5M5YJ 1JKRC 2WAQN 1RESA 2ECBA 3BR3A 4V2FA 5IYDJ 4W97A 5F27A 3QPLA 1ETXA 2VKVA 3HOYJ 1LFBA 2XB5A 4D7MA 2E19A 1SFOJ 4AC0A 3FK6A 2JK3A 2CQQA 2DA2A 2XGEA 1ZK8A 2IBDA 3I4MJ 2CJJA 5E3NA 1ETQA 4B3AA 4XICA 2Y2ZA 2HOAA 5C4JJ 4AYBN 2K9NA 2X9DA 3DCFA 4Y7NJ 3L1PA 4A3IJ 2JA8J 2JN6A 3LOCA 3GTQJ 2M0CA 5HODA 4S0HB 3HEFA 2HOTA 4V2GA 4CYCB 2CQXA 2PMZN 1FIPA 5IYCJ 5FLVA 4A3FJ 3RZOJ 3HBLA 4EEFG 3NARA 4DZJA 3I4NJ 2ID3A 3S16J 3BR2A 2NVYJ 4XRSG 1MBJA 3GTPJ 2M8GX 1IDZA 5EGOA 1MBHA 1IG7A 5C4XJ 2X6OA 4DW6A 1BL0A 2Y30A 1FIAA 3S1RJ 3Q0VA 1AKHA 1DU0A 2LK2A 3LSJA 5FLMJ 4C3JJ 2DA1A 4Y52J 5F04A 1HOMA 2R7ZJ 2HYJA 3B6CA 4ABZA 4A3LJ 1H89C 4C2MJ 5FKLA 1XC5A 4DYRA 3BQYA 2MW8A 1ENHA 3BG5A 4DYQA 1Z0XA 2CRGA 1RKWA 3G1MA 1X2MA 3GBGA 4FTHA 3A02A 3JR9A 3G1LA 1P7IA 3OOUA 2Y9YA 1XG1A 4M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMQ A;  1ETY A;  4M3G A;  3JRE A;  2EZK A;  2R0Q C;  5EG0 B;  3FIW A;  2JMW A;  1EF4 A;  1VI0 A;  4BY1 J;  3BTL A;  3ZQC A;  2DA7 A;  3OIO A;  3UKG A;  3S2D J;  1A6I A;  1FEX A;  5EGO B;  1U9O A;  1MBE A;  4A3D J;  5FKK A;  1X2N A;  1BW6 A;  1ZKG A;  2DMQ A;  1QVT A;  2FQ4 A;  2N8G A;  5C3E J;  2HI3 A;  3ZOB A;  3K2A A;  3RQI A;  3S2H J;  1B72 A;  2IAI A;  4BXX J;  3IH4 A;  2YS9 A;  3Q0U A;  2O7O A;  4CYC A;  3BTI A;  2X48 A;  1VND A;  4RDU A;  3S17 J;  2VUM J;  1ETK A;  1HLV A;  3M3Y J;  5EF6 A;  1AU7 A;  3SDG A;  4IHW A;  3BG3 A;  1O4X A;  1MBG A;  2L7Z A;  4MO7 A;  1JT0 A;  1W0T A;  1WH5 A;  4JX6 A;  1NK2 P;  1OJL A;  5IOZ A;  1U78 A;  2EZH A;  3BQZ A;  3ZQF A;  4A3B J;  2VPR A;  1I6H J;  1ETO A;  1ITY A;  2WV1 A;  1HDP A;  2HOS A;  1MH3 A;  3Q0W A;  4X1E A;  3ZQL A;  2ID6 A;  5IP7 J;  3BR1 A;  2DN0 A;  3CDL A;  2O9L A;  2OPT A;  3TP0 A;  4XRS A;  1RR7 A;  1JUM A;  4QSH A;  2JWT A;  2EZI A;  3CMY A;  5E3O A;  2WB1 N;  3PM1 A;  1IUF A;  2H8R A;  2DA3 A;  1XS9 A;  1TWG J;  1B8I A;  1POG A;  4FIS A;  2NS8 A;  2DA6 A;  3GTL J;  1K83 J;  1OCP A;  1E3O C;  2Y0S N;  2H1K A;  2HXI A;  3GTG J;  3PO3 J;  3TW6 A;  1B72 B;  2DA4 A;  3CCY A;  5DTD A;  2NS7 A;  3HM5 A;  1IRZ A;  1TC3 C;  5EG0 A;  2XPU A;  4M6V A;  5IOY A;  3K7A J;  1MBK A;  1WGX A;  1LE8 B;  2JJ7 A;  5E3L A;  1OCT C;  4JX5 A;  1FTT A;  1IV6 A;  3A03 A;  1LFU P;  4D7N A;  2D5V A;  2R93 J;  4XID A;  1GUU A;  3O8G A;  1JKP C;  1OFC X;  3RKQ A;  5DS9 A;  4W1U A;  3HGY A;  3BR5 A;  1SAN A;  4JP0 A;  2E2H J;  3WHC A;  2ECC A;  4RBO A;  1A5J A;  4D5F A;  3HGG A;  5FKM A;  3JRA A;  4AUX A;  1Y1W J;  1JT6 A;  4A3K J;  4BBS J;  4A93 J;  2OF7 A;  1NK3 P;  4LOC A;  3BTJ A;  4JYK A;  3JRD A;  1B8I B;  2LY9 A;  3CQZ J;  1UHS A;  2E1O A;  4MFD A;  2EH3 A;  2IEK A;  2HQ5 A;  1GVD A;  2QF7 A;  4BBR J;  4M3F A;  1GV5 A;  1JUP A;  2VKE A;  5FKO A;  5F08 A;  5JLX A;  1UG2 A;  2EBI A;  2EQR A;  3GTO J;  4G12 A;  1AHD P;  1JJ8 C;  4MIM A;  1FTZ A;  1U8B A;  1WI3 A;  4A3C J;  4FCY A;  4XK4 A;  1H88 C;  1Q1V A;  1DU6 A;  3JRH A;  2Y9Z A;  1FJL A;  2FJ1 A;  1TWC J;  5EZH A;  2R92 J;  1I3Q J;  3MN2 A;  1ZR4 A;  4C3H J;  2LTP A;  5FJ8 J;  2KT0 A;  3Q3S A;  3GTK J;  4B4C A;  3O8H A;  1HF0 A;  4X6A J;  2XGD A;  2CUF A;  1K61 A;  1JTX A;  4I76 A;  2AHQ A;  2HXO A;  3H0G J;  2DMT A;  2E2I J;  5F1J A;  3RZD J;  5C44 J;  3HB9 A;  1JJ6 C;  1T56 A;  2MGQ A;  3LSR A;  1WPK A;  3S1M J;  3LSP A;  4M3E A;  4MLO A;  1IC8 A;  2DMN A;  2I10 A;  3IH3 A;  5JLW A;  1LE8 A;  1F43 A;  4JX4 A;  5BNG A;  5M3F J;  3JRC A;  3D1N I;  1BA5 A;  5IYB J;  1BW5 A;  1R9T J;  1JGG A;  4FE7 A;  1YRN B;  2R5Z B;  1WCM J;  1H8A C;  1GDT A;  1JKO C;  2GM4 A;  1ZTR A;  2QCO A;  3F0C A;  5F0C A;  3VPR A;  4BY7 J;  1MSF C;  4IHV A;  4A3M J;  3S1Q J;  2EZL A;  5M5X J;  1QRY A;  2RAE A;  2CUE A;  2YU9 J;  2FD5 A;  5J1R A;  3IV5 A;  3A01 B;  3G1O A;  1TWF J;  2DMP A;  2LFB A;  2JA7 J;  4HNV A;  4FE4 A;  3SFI A;  2L7M P;  1PUF A;  1IDY A;  1RKT A;  3DEW A;  1ETV A;  2NOG A;  5EEA A;  3JRF A;  4QTR A;  1MNM C;  3IH2 A;  1T33 A;  3OSG A;  4M3D A;  1D5Y A;  4DZP A;  3GTJ J;  5IPA A;  1QPI A;  2LLK A;  1ZR2 A;  2L7F P;  1ZGW A;  5IP9 J;  3S1N J;  3LNQ A;  2ME6 A;  2K9S A;  2ZB9 A;  1TWA J;  3QPS A;  3HKZ N;  4UUS B;  2MG4 A;  2JA5 J;  5EZG A;  1ORK A;  2AO9 A;  3JRB A;  5GPC A;  1P7J A;  3MKL A;  4B1R A;  2TRT A;  4DYC A;  2XRL A;  1HDD C;  1ETW A;  3S15 J;  2DA5 A;  3BR0 A;  2NVX J;  2B63 J;  3FIS A;  4A3E J;  4A69 C;  2LVS A;  1VFC A;  3WHB A;  1MH4 A;  5FKN A;  3B6A A;  3PO2 J;  3E7L A;  2P81 A;  1JKQ C;  1RET A;  2COB A;  3ZQI A;  5J3L A;  4A3G J;  4L5E A;  3HOU J;  2XGC A;  3JRG A;  5M5W J;  1MSE C;  1I50 J;  1GT0 C;  1G2H A;  4UUT A;  5K7F A;  3JRI A;  2CU7 A;  5F0H A;  1PUF B;  1U9N A;  2YUS A;  3BT9 A;  1X58 A;  3TW7 A;  1YRN A;  3OSF A;  5EDN A;  2R5Z A;  5EYR A;  5J1U A;  2LKX A;  1JTY A;  2DMU A;  1W0U A;  9ANT A;  3HOX J;  5GP9 A;  1BJZ A;  3A01 A;  4IHY A;  2L0K A;  4MFE A;  4I6Z A;  2R5Y A;  4J19 A;  1JUS A;  2KDZ A;  3QQA A;  3M4O J;  2XPW A;  2VI6 A;  3SJM A;  1Z77 A;  2DJN A;  2XB0 X;  3HOZ J;  3S14 J;  2K40 A;  2E2J J;  3MVP A;  1CQT A;  3C2B A;  3HDD A;  2FX0 A;  2O8K A;  1APL C;  4NDL A;  2ELK A;  2Y31 A;  2MSY A;  3HOW J;  5J1Y A;  1QVU A;  4XRM A;  4BKX A;  3BG9 A;  4UUS A;  2GBY A;  1VF9 A;  2ME0 A;  1HCR A;  5K7Z A;  4GFB A;  2DTZ A;  2LP0 A;  4QIW N;  3TP3 A;  3TED A;  2GLO A;  2LD5 A;  5F0F A;  3NAU A;  3H3V K;  4C3I J;  2M9H A;  3W6V A;  2XSD C;  2LR8 A;  5IP6 A;  2JA6 J;  1MBF A;  5K7H A;  4D5C A;  1ZQ3 P;  1AKH B;  3BR6 A;  1NTC A;  1S7E A;  2K9Q A;  3FK7 A;  2W48 A;  3GTM J;  1Y1V J;  4A3J J;  5GPA A;  5M3M J;  5E3M A;  2M34 A;  3ZQH A;  2HDD A;  3HOV J;  2G0E A;  1RPW A;  2M2E A;  1GV2 A;  2XPV A;  1WH7 A;  1F36 A;  1TWH J;  2R5Y B;  3LSG A;  1IGN A;  3BTC A;  1IJW C;  3FKI J;  2L9R A;  2TCT A;  4IHX A;  2NVQ J;  4IEJ A;  3ZQG A;  2NVT J;  5M5Y J;  1JKR C;  2WAQ N;  1RES A;  2ECB A;  3BR3 A;  4V2F A;  5IYD J;  4W97 A;  5F27 A;  3QPL A;  1ETX A;  2VKV A;  3HOY J;  1LFB A;  2XB5 A;  4D7M A;  2E19 A;  1SFO J;  4AC0 A;  3FK6 A;  2JK3 A;  2CQQ A;  2DA2 A;  2XGE A;  1ZK8 A;  2IBD A;  3I4M J;  2CJJ A;  5E3N A;  1ETQ A;  4B3A A;  4XIC A;  2Y2Z A;  2HOA A;  5C4J J;  4AYB N;  2K9N A;  2X9D A;  3DCF A;  4Y7N J;  3L1P A;  4A3I J;  2JA8 J;  2JN6 A;  3LOC A;  3GTQ J;  2M0C A;  5HOD A;  4S0H B;  3HEF A;  2HOT A;  4V2G A;  4CYC B;  2CQX A;  2PMZ N;  1FIP A;  5IYC J;  5FLV A;  4A3F J;  3RZO J;  3HBL A;  4EEF G;  3NAR A;  4DZJ A;  3I4N J;  2ID3 A;  3S16 J;  3BR2 A;  2NVY J;  4XRS G;  1MBJ A;  3GTP J;  2M8G X;  1IDZ A;  5EGO A;  1MBH A;  1IG7 A;  5C4X J;  2X6O A;  4DW6 A;  1BL0 A;  2Y30 A;  1FIA A;  3S1R J;  3Q0V A;  1AKH A;  1DU0 A;  2LK2 A;  3LSJ A;  5FLM J;  4C3J J;  2DA1 A;  4Y52 J;  5F04 A;  1HOM A;  2R7Z J;  2HYJ A;  3B6C A;  4ABZ A;  4A3L J;  1H89 C;  4C2M J;  5FKL A;  1XC5 A;  4DYR A;  3BQY A;  2MW8 A;  1ENH A;  3BG5 A;  4DYQ A;  1Z0X A;  2CRG A;  1RKW A;  3G1M A;  1X2M A;  3GBG A;  4FTH A;  3A02 A;  3JR9 A;  3G1L A;  1P7I A;  3OOU A;  2Y9Y A;  1XG1 A;  4M3B A; 
#chains in the Genus database with same CATH topology
 1ERD A;  4HRI A;  3BCB A;  4OMY A;  2ETH A;  1ETY A;  3IP4 B;  4I09 A;  1ZLJ A;  3JRE A;  2EZK A;  3D5L A;  4R79 A;  3WGI A;  1W36 D;  1VI0 A;  2W25 A;  1G6N A;  3WGH A;  3M8E A;  3B02 A;  1B1B A;  2FBH A;  3ZQC A;  3OIO A;  4ENM A;  5DCM B;  2WC2 A;  3DTI A;  1A6I A;  5FD5 A;  3HRT A;  3WOD F;  4E7L A;  1MBE A;  4A3D J;  5F1R A;  5J47 A;  2I8D A;  1ZRC A;  1QVT A;  2FQ4 A;  2ZC2 A;  4U87 A;  1SVL A;  3PUB A;  5C3E J;  3VEP A;  3FDY A;  1VQ5 I;  1FC3 A;  3OR2 C;  3LAP A;  3S2H J;  2IAI A;  2YS9 A;  3LA2 A;  3I55 I;  2RV8 A;  2O7O A;  4CYC A;  5D5V B;  3RKW A;  3S17 J;  4F91 B;  4RLQ A;  1JI8 A;  1ETK A;  3M3Y J;  5EF6 A;  3OYK A;  3DWL E;  3SDG A;  2V26 A;  1AU7 A;  3BG3 A;  4IHW A;  5FRO A;  4ANJ A;  1K78 B;  5JR3 A;  5HLH A;  2VT2 A;  1W0T A;  1WH5 A;  1IRF A;  4A0Z A;  3CME I;  3BRO A;  5IOZ A;  4AIJ A;  2BY0 A;  3CF5 F;  2FMY A;  5CQE A;  1UST A;  3F6V A;  4Y33 A;  1YIT I;  1I6H J;  3V7R A;  2JSC A;  2X51 A;  5LEJ A;  2M8E A;  2WV1 A;  1Z7L A;  3CCS I;  1CF7 A;  3NEU A;  2HOS A;  4X1E A;  2DN0 A;  3E1S A;  2QA4 I;  2VC0 A;  3H5N A;  3V4G A;  4DIQ A;  2K27 A;  4M6X A;  1Y0N A;  4XRS A;  4QSH A;  2JWT A;  4ZYA A;  2RQQ A;  3PM1 A;  1IUF A;  4EJW A;  4IRI A;  2EA4 A;  3CUQ B;  4FIS A;  3CCL I;  4KIS A;  1IXC A;  1K83 J;  1OCP A;  5K5Q A;  2HKX A;  1JE8 A;  2STW A;  2OQG A;  1EH7 A;  1FY7 A;  2K3F A;  2XF7 A;  3PO3 J;  3TW6 A;  4TV7 A;  4YFX F;  2F6C A;  1MMG A;  2E1M B;  5DTD A;  1DQU A;  3F8C A;  1OYI A;  4ZZD A;  1OCZ H;  4M6V A;  5IOY A;  4RGU A;  4HZF A;  3K7A J;  2QKL B;  2VOP A;  5BPD A;  1EH8 A;  5H6Q A;  2L9S A;  2OZ6 A;  1EV7 A;  3SEQ A;  2XAG A;  1UB9 A;  1VQL I;  4QWQ A;  1J0R A;  1WJF A;  3E5Q A;  2R93 J;  2HR3 A;  2PG4 A;  3HPG A;  4ZTJ A;  4EM2 A;  1MGT A;  1OFC X;  2PMZ A;  3W3C A;  1B9N A;  4W1U A;  2H1L A;  2VN2 A;  3R6S A;  2L4A A;  1SAN A;  4MTE A;  2NVU B;  3WHC A;  3C18 A;  2XIG A;  5LHG A;  1SVM A;  1V3F A;  1X3U A;  1A5J A;  4BL0 B;  1BM9 A;  3OS0 A;  2J5P A;  3HGG A;  2XAJ A;  4LFU A;  3VYR B;  3GLX A;  3JTG A;  2R7R A;  1Y1W J;  2HWV A;  3R0A A;  2MH9 A;  2V1U A;  2OF7 A;  1WJE A;  3K4J A;  4LOC A;  3BTJ A;  1YO5 C;  2DFE A;  2H09 A;  3CQZ J;  5B66 C;  5BOX A;  2IEK A;  3KP4 A;  1R1T A;  3RJP A;  2DI3 A;  1JUP A;  1D1B A;  1JGS A;  4KDP A;  4OIQ F;  5A2Q K;  4HNU A;  2L5Q A;  4LG0 B;  3LA7 A;  4BNC A;  3MFK A;  2DXI A;  2WY7 Q;  3OL3 A;  3GTO J;  1I39 A;  2ZME A;  1JJ8 C;  2KIM A;  5GAH J;  1FTZ A;  3EUH C;  1U8B A;  1FWZ A;  1HW1 A;  1WI3 A;  4JOM A;  3BWG A;  3I53 A;  1I1G A;  1R5G A;  1EJ9 A;  5K5O A;  3E3V A;  1I3Q J;  2LTP A;  5HNF A;  3W2W A;  5FJ8 J;  1X4P A;  3Q3S A;  2E5Z A;  1HF0 A;  2DYS H;  1D5V A;  3K1M A;  3JAM K;  1BOB A;  2HTS A;  2Z3Y A;  5ICC A;  1K61 A;  5E79 C;  2Z16 A;  2ISY A;  1V5E A;  1QBJ A;  1O3S A;  3KLN A;  4DOZ A;  3RZD J;  2OA4 A;  5TIS C;  1T56 A;  2MGQ A;  2RNG A;  3S1M J;  2BY3 A;  2I10 A;  4EJU A;  5E1Z B;  5H20 A;  1E17 A;  4RAF A;  3HIF A;  2ELH A;  2BVM A;  3HHH A;  3HRM A;  2M4G A;  4IVN A;  5CVU A;  5KCM A;  2M4K A;  1IV8 A;  1FLI A;  3HSR A;  4BQA A;  3S93 A;  3VYT B;  1MMA A;  3HZJ A;  2ZFU A;  4JQF A;  2R7W A;  2Z5U A;  4KT5 C;  2MA3 A;  1YRN B;  2R5Z B;  1A36 A;  1H8A C;  3BCA A;  5KAF C;  2CV1 A;  1ZTR A;  1E3H A;  5HS7 A;  4BY7 J;  4GCV A;  1MSF C;  4CZZ A;  4A3M J;  2EFN A;  5HLG A;  3OYI A;  4RLF A;  2LMD A;  2RAE A;  4EGY A;  2LG4 A;  2CUE A;  1DDN A;  2LH9 A;  2FD5 A;  3UNG C;  3LL7 A;  1O3Q A;  1KU7 A;  1JXS A;  2NAZ A;  2HPM A;  3N05 A;  1PUF A;  1KYZ A;  1RKT A;  3DEW A;  3DPL C;  5JVG F;  3WU1 B;  3IKT A;  3GWZ A;  3JRF A;  4FX4 A;  1HW5 A;  4XR6 A;  3IH2 A;  3VYS B;  3KIO A;  1K6Y A;  4BJT A;  2FNP A;  4IZZ A;  2X85 A;  2ZJ2 A;  1FSE A;  1MDM A;  3BC8 A;  1ZGW A;  1ACI A;  3U9G A;  1A04 A;  5IP9 J;  3M1E A;  1G3T A;  3S1N J;  2Y48 A;  1LDD A;  2Q8K A;  3LNQ A;  5E17 F;  2KMU A;  1R1V A;  3S3M A;  2IS6 A;  4RGX A;  1WRJ A;  3QPH A;  3RTR A;  4A6D A;  3IAM 2;  4B47 A;  2AO9 A;  2EB7 A;  4I02 A;  1W1W E;  2A5Y B;  1UZC A;  2DDA A;  2KJC A;  5J8F A;  3JRB A;  2VC1 A;  5GPC A;  2TRT A;  2EK5 A;  2XRL A;  1WJ5 A;  4KIC A;  3S15 J;  2DA5 A;  4LLG F;  2NVX J;  2CFX A;  4BQO A;  1IRG A;  4A69 C;  4XLF A;  3FXK A;  3TDZ C;  2XAQ A;  3C2H A;  1BI3 A;  3E7L A;  4M6Y A;  1BI0 A;  2XRN A;  1SAX A;  4AD9 A;  4ZYD A;  3HOU J;  4E7K A;  1UCR A;  5M5W J;  2HZD A;  4WXH A;  1WZ2 A;  2YX7 A;  3CES A;  1OYW A;  2CU7 A;  2MC4 A;  2YUS A;  3BT9 A;  3MKY B;  5CPR B;  3M8F A;  2E35 A;  3ABU A;  5EDN A;  3KZI C;  4XMY A;  4ZDP A;  4BYY A;  2DYR H;  3HRU A;  3FWE A;  4G7H F;  3CC7 I;  1JTY A;  1W0U A;  3MZH A;  3HOX J;  2KHM A;  2BV6 A;  2W1O A;  4O6J A;  1QU3 A;  3PIP F;  2PJP A;  1Y8R B;  2IA1 A;  3COA C;  1OIS A;  3P5J A;  4IHY A;  4BDZ A;  4I6Z A;  4XOP A;  4CH7 A;  3WTS C;  5EEG A;  1T95 A;  2VI6 A;  2R4G A;  3F8M A;  3SJM A;  1Z77 A;  1W36 C;  3DV8 A;  3DU6 A;  3KPH A;  1AWC A;  2KJB A;  4XL9 A;  1BR1 A;  3WTZ A;  3FZV A;  1CQT A;  1TQI A;  2DO7 A;  3C1D A;  3ZP5 A;  3HDD A;  3HPH A;  1W7P D;  1YIO A;  2KZG A;  4NDL A;  2ELK A;  4OAY A;  1DPU A;  1H9G A;  5J1Y A;  4G6Q A;  4M71 A;  3WTU C;  4BKX A;  3IWZ A;  4KN7 X;  4OIP F;  4UUS A;  2M87 A;  1Y39 A;  1FPQ A;  1YS6 A;  4NC8 A;  5DM7 F;  4IX7 A;  2GLO A;  2FOW A;  4EM0 B;  3SHF A;  1TZL A;  4C3I J;  4NQW B;  2ZXW H;  2EFO A;  5IP6 A;  3RQ4 A;  3G2B A;  1ZRD A;  4BXU A;  1ZQ3 P;  1IZ1 A;  2OBP A;  2DU9 A;  5LRS A;  2R7F A;  5GAD J;  1C0W A;  2UV1 A;  2X6Y A;  1WJC A;  3GF2 A;  3HOV J;  2G0E A;  1G3S A;  1RPW A;  5TRD A;  1IAW A;  2R7V A;  3ESW B;  1F36 A;  4CSW A;  3E6M A;  1IGN A;  1T38 A;  2AS5 F;  4AIH A;  1FOX A;  3DPU A;  3J81 Z;  2EIM H;  1ODD A;  1VQ7 I;  2VQH A;  4ZDL A;  4DGW B;  3I5U A;  1XCB A;  2MC3 A;  4EV0 A;  2ECB A;  1U0J A;  3BR3 A;  4D1Q A;  3A0B C;  5K5R A;  1J5Y A;  2QBY A;  4Y17 A;  2XB5 A;  2CGP A;  1SFO J;  4AC0 A;  1FSH A;  3FK6 A;  5LGU A;  3QU3 A;  3I56 I;  5D6F A;  3CMA I;  3I4M J;  4RM2 A;  5E3N A;  4B3A A;  4WCG A;  1J75 A;  3VWB A;  1W7P B;  3AG2 H;  5C4J J;  4OAZ A;  4BEH A;  3MKZ A;  2K9N A;  2X9D A;  4ZJZ A;  4I7H A;  2LKP A;  2AQE A;  5JHU A;  2ESN A;  2O5R A;  2JN6 A;  3IRQ A;  2OC6 A;  1OCC H;  1Z3X A;  1AOY A;  1KZH A;  3I9V 2;  4HW0 A;  4Z6Y A;  4KMU X;  2V6E A;  3L2V A;  3H9J A;  5ICF A;  1E2X A;  2GAU A;  1MND A;  1UHW A;  1QHG A;  3AL0 B;  3KFW X;  3ZMU A;  1U8R A;  1K4T A;  3CJN A;  2L2O A;  3I4N J;  4RB3 C;  2ID3 A;  4Y13 A;  1D0Z A;  4I01 A;  2LBF B;  5DCM A;  1KU3 A;  3GTP J;  1IDZ A;  4BE1 A;  1S9H A;  1R4N B;  1MJA A;  2DOD A;  4CCL A;  1IG7 A;  5C4X J;  1D8K A;  1B9M A;  2MLG A;  4DW6 A;  1BL0 A;  2Y30 A;  1FIA A;  5ICG A;  1Y6I A;  1SC7 A;  4H0E A;  3CD6 I;  4E7I A;  1Y56 A;  5FLM J;  1XSX A;  4BGD A;  2HS5 A;  4C3J J;  3EUK L;  1FOK A;  3KYC B;  2M3A A;  5BMZ A;  4Y52 J;  5F04 A;  2GZW A;  2OUM A;  3DF8 A;  1K78 A;  4PDK A;  4G7O F;  1DPR A;  1J2X A;  5FKL A;  1FOY A;  3LSH A;  4I0B A;  3BQY A;  3F9K A;  1VTN C;  4DYQ A;  4G9Y A;  3WTT C;  3KZY A;  3CJR B;  2RDP A;  3BZ6 A;  3JR9 A;  2OV7 A;  2DT7 B;  3DU5 A;  1R36 A;  3OOU A;  4LIV A;  2HPI A;  1O7L A;  3IC7 A;  3ECO A;  3HYI A;  3TOB A;  4Q4Z F;  3N97 A;  4M3G A;  1OR7 C;  3TOA A;  4XLE A;  3FIW A;  1G3W A;  2A69 F;  2JMW A;  5EG0 B;  3JSP A;  1EF4 A;  1LVA A;  2LF7 A;  2OZU A;  1P9Q C;  1PDN C;  4D9J A;  4BY1 J;  2I5U A;  2P5L C;  3BTL A;  1FYM A;  3LST A;  3CUQ A;  3UKG A;  2FXA A;  1R1U A;  5FKK A;  1X2N A;  3F72 A;  1ZKG A;  1E0E A;  2N8G A;  2UWM A;  1BJA A;  4LB5 A;  1UJ8 A;  3K69 A;  3ZGK A;  3IH4 A;  3R61 A;  3O2P E;  1VND A;  3HHG A;  1VZ0 A;  2VUM J;  3OIP A;  3FHZ A;  1HLV A;  3PQK A;  5J8C A;  3I4P A;  1O4X A;  3KP6 A;  1REP C;  3FXM A;  4BAC A;  4XKW A;  3OV8 A;  3ZMT A;  1DGW Y;  1NK2 P;  2V7F A;  4MQV A;  1U78 A;  2K4J A;  2EZH A;  1ZG3 A;  3HXL A;  2J5O A;  3D0S A;  2NRA C;  5CVV A;  2VPR A;  3FKJ A;  1ZLK A;  2DCE A;  1IXR C;  1ETO A;  3T5X A;  4CGZ A;  4BJ5 C;  2VAS A;  4U0W A;  4CCK A;  1XDU A;  3PFI A;  1SMT A;  3ZQL A;  2GA1 A;  1RI7 A;  4PGH A;  1R7J A;  3EDP A;  3R0J A;  1YFH A;  2O9L A;  4UVC A;  2WAD A;  2XSJ C;  1K6O A;  1U3E M;  1EH6 A;  2FSW A;  1RR7 A;  1RZ4 A;  2MD0 A;  3PSF A;  3CMY A;  2M7A A;  3GZN B;  4WXD A;  3WGG A;  3MCZ A;  1IN8 A;  2DA3 A;  5LGN A;  3QP5 A;  5CKT A;  1TWG J;  5D5W B;  3OR1 C;  1TQM A;  4I99 C;  3ZPL A;  3JSO A;  2DA6 A;  5FLX Z;  1ONV A;  3GTL J;  2E60 A;  4DQ2 A;  3WG9 A;  2H1K A;  1B72 B;  4UY8 I;  1STZ A;  4BHB A;  2OU2 A;  1SFE A;  4KT6 A;  3K2Z A;  3HKZ A;  1TC3 C;  1BR4 A;  2EV0 A;  2OTL I;  1U5T B;  3BOQ A;  4C2U A;  5B5E C;  2BOL A;  1MBK A;  1XGM A;  2PN6 A;  2GXB A;  3GZ5 A;  2A3S A;  5L3E A;  1TNT A;  2VQL A;  1OCT C;  5DV5 A;  1ZG5 A;  3R60 A;  3MMY B;  4JX5 A;  3GME A;  1J9I A;  1O7F A;  1BI1 A;  2E71 A;  3EET A;  3ZMV A;  3EUA A;  2D5V A;  3FMQ A;  2F5F A;  2WBM A;  3ZQQ A;  1GUU A;  3O8G A;  1JKP C;  3QWL A;  3DP7 A;  3LWF A;  5LEK A;  3BR5 A;  4PFO A;  3X2Q H;  2VLA A;  2PBI A;  4JP0 A;  1SD7 A;  2E2H J;  4XN3 A;  4YEL A;  2PJR B;  4B3X A;  2Y69 H;  4ZYH A;  3P9K A;  4D5F A;  2VE8 A;  3CCJ I;  2VJ4 A;  5FKM A;  4EGZ A;  2M0M A;  4AUX A;  2EV6 A;  1BI2 A;  1JT6 A;  2EPF A;  5CLS A;  2GWR A;  2RKH A;  1PP8 F;  5GTI C;  4QPO A;  1NK3 P;  2KIF A;  1ZGA A;  2A6H F;  1RUN A;  3F23 A;  3LAJ A;  1FBS A;  1S8N A;  4MFD A;  2HU9 A;  1YJ9 I;  2QF7 A;  2HQ5 A;  2XHK A;  4II3 A;  3CCV I;  4E7H A;  4M3F A;  4LLN A;  3T0Y A;  2CV0 A;  2K02 A;  3DEE A;  5JLX A;  2XC7 A;  1PP7 U;  1YJW I;  1UG2 A;  2EWN A;  1U6G A;  4G12 A;  2E7W A;  4MIM A;  1R5I D;  2A5W A;  4UV8 A;  2QKM B;  4A3C J;  4FCY A;  4XKB A;  2BHZ A;  3R4K A;  4AVZ A;  2DOF A;  3DXJ F;  2CG4 A;  2Y9Z A;  2FJ1 A;  3HUG B;  5EZH A;  3C2G A;  4PJM A;  4C3H J;  2V1D A;  4LK0 F;  3H5R A;  1O57 A;  1S6L A;  3O8H A;  2CQ7 A;  4FQG A;  2EIJ H;  2K4B A;  2V1N A;  2CUF A;  1GLN A;  1F4K A;  1JTX A;  4I76 A;  2AHQ A;  4PJN A;  3H0G J;  4KA4 A;  2KDO A;  3AL0 C;  1JJ6 C;  3ASN H;  3ZMD A;  2O61 A;  2E5N A;  2BHY A;  2HDC A;  3RKX A;  2EFW A;  1LE8 A;  4ENJ A;  4PZJ A;  5BNG A;  1K79 A;  1I3A A;  5M3F J;  2WAE A;  5IYB J;  3ZMS A;  2R7O A;  2RC4 A;  2A05 A;  2QSH X;  2VBX A;  1Z67 A;  4L9N A;  3P9C A;  4G6D A;  1S7O A;  4XKC A;  2VBW A;  4MHG A;  3K1N A;  4IL6 C;  2DFF A;  5F0C A;  3VPR A;  3L2C A;  1R00 A;  2VXZ A;  3V8L A;  3S1Q J;  2DW4 A;  3K4K A;  2R7S A;  3ERE D;  2A07 F;  3LA3 A;  3U2R A;  3UR3 C;  4QLC U;  3IUO A;  5HOO A;  1IUY A;  2YU9 J;  2JPB A;  5J1R A;  4X0G A;  3A01 B;  1O3R A;  3W6K B;  2XRO A;  1TWF J;  1QZY A;  2DMP A;  3G71 I;  2LKS A;  4ASN A;  4FE4 A;  3QOE A;  3EQL F;  5B1A H;  3GXO A;  3CCE I;  1J7K A;  2VJJ A;  2DFH A;  4WF2 A;  1T33 A;  1KQ0 A;  1WQ2 A;  1TL8 A;  3HL2 A;  5HDK A;  4YG2 F;  3GTJ J;  1A35 A;  3DKX A;  5E1W A;  1QPI A;  1S72 I;  1ZR2 A;  1GHC A;  2L7F P;  2RVC A;  4NNJ A;  2WWY A;  1V55 H;  3BG7 A;  1USS A;  2K9S A;  2VKH A;  1TWA J;  2GIZ A;  3QPS A;  3HKZ N;  3CMM A;  2MG4 A;  4E7J A;  2IGN A;  2WB1 A;  2RQP A;  2JA5 J;  3B73 A;  4P5O A;  2A6T A;  2BW3 B;  3FHN A;  4EJO A;  1G8X A;  4H4K C;  5HS9 A;  3MKL A;  4B1R A;  4MNU A;  3LFU A;  4ENN A;  5FFX A;  5ICE A;  1ETW A;  4S05 A;  2BYV E;  3BR0 A;  3RIR A;  4HDV A;  3FIS A;  3QAH A;  2FRH A;  4NUB A;  2LVS A;  4M72 A;  4OMZ A;  3ABT A;  3FF5 A;  4A0Y A;  2CQK A;  3BZC A;  1H0M A;  5F6F A;  2CW0 F;  3OOP A;  4L9T A;  1JKQ C;  4HQE A;  5EJC A;  4RB2 C;  5KK1 A;  4FT8 A;  5J3L A;  4UXN A;  3E6B A;  3V8K A;  3ZQI A;  5GAE J;  4E7Z A;  2X6W A;  3LSK A;  3JRG A;  1MSE C;  4HST A;  4XLN F;  1GT0 C;  3OIQ A;  2LNB A;  3AFH A;  2QEN A;  2ZO4 A;  2XV4 S;  1ZAR A;  1X58 A;  5KNL A;  3JCU C;  3DKY A;  1P2F A;  3TKY A;  3DFG A;  3OSF A;  4ZDO A;  4ENK A;  2VJI A;  3GEZ A;  3PIO F;  2LKX A;  3SZG A;  4BE0 A;  2NYX A;  2KIU A;  4HA8 A;  2JQ7 A;  5E8I A;  4HAM A;  9ANT A;  5HS8 A;  2F4M B;  3FX3 A;  1LNW A;  1BJZ A;  3S8P A;  3CO7 C;  3L9F A;  4MFE A;  1JUS A;  2UZK A;  2XAS A;  2K86 A;  4V19 K;  1FMW A;  5FGM A;  5HDG A;  2XB0 X;  1UEL B;  1IW7 F;  3S14 J;  2HGC A;  1KA8 A;  2E2J J;  2VIX A;  5LRR A;  2KL4 A;  2Q2E A;  2D45 A;  3L2R A;  2LDU A;  2M1B A;  1QGP A;  4RAY A;  2FX0 A;  4B48 A;  5A2Q Z;  2Y31 A;  3HRS A;  3HOW J;  3CJT B;  3K9T A;  1U5T C;  1LFP A;  4XRM A;  1VF9 A;  1D0Y A;  1HCR A;  3LQR A;  1W7P A;  2FUG 2;  2PMH A;  4QIW N;  3L2U A;  3TP3 A;  4BS9 A;  4RMN A;  2HFH A;  1Z1D A;  3DBR B;  2LD5 A;  5LLQ A;  2STT A;  2CV2 A;  1Q1H A;  3W6V A;  1ZGJ A;  5JFR A;  1SFK A;  1I27 A;  5HLI A;  2CQN A;  4BH9 A;  5ILU A;  4CA0 A;  2AXT C;  1NH3 A;  3W6J B;  4XKV A;  2F2E A;  2OCC H;  1K7A A;  1T6S A;  1OMI A;  2K9Q A;  3MEX A;  3JAM Z;  3GTM J;  4HF1 A;  2QUF A;  4XOT A;  3J80 K;  2GIV A;  2X4H A;  1IN4 A;  2UXX A;  3K10 A;  1HXD A;  3GUD A;  3FXQ A;  2R7U A;  1TLH B;  2Z99 A;  1UAA A;  1GV2 A;  3MAJ A;  3VYU B;  1TWH J;  3A1Y A;  3LSG A;  4YFN F;  2KQR A;  3CCR I;  2GXG A;  1ZH5 A;  2TCT A;  1CGP A;  2NVQ J;  3RYP A;  2X0L A;  3H9G A;  3Q5F A;  2QZ8 A;  3GFI A;  5GTH C;  1RES A;  5IYD J;  4V2F A;  2W7N A;  4GXO A;  4W97 A;  3QPL A;  2HTJ A;  2VKV A;  1S7A A;  4MQ9 F;  2QQ8 A;  1TT0 A;  3RSN A;  4D7M A;  2E19 A;  2VKD A;  3RPQ A;  5DUI A;  2GXA A;  3D5S C;  1VQO I;  3DEU A;  2CQQ A;  4NB5 A;  4CIC A;  1MZB A;  1ZRF A;  2PFB A;  2F4O B;  1NG6 A;  4GRI A;  4M73 A;  2W85 A;  1ETQ A;  3ELK A;  1AA7 A;  1Z3Y A;  2CUZ A;  2HOA A;  2R7Q A;  2LYC A;  3GFL A;  2DFI A;  1U2W A;  1VQM I;  3L1P A;  4BU2 A;  3DTK A;  4KNY A;  3GTQ J;  1P4A A;  5HOD A;  3HEF A;  3FM5 A;  4V2G A;  3SFZ A;  4CYC B;  1XDS A;  2PMZ N;  3WTW C;  1FIP A;  1T0F C;  1M1E B;  1PVE A;  1W5T A;  3OYC A;  3CP8 A;  4S04 A;  2ISZ A;  2QSG X;  4EEF G;  2MAB A;  2G7U A;  3S16 J;  3BR2 A;  3T8T A;  5DCF A;  1X1C A;  2VL8 A;  3Q9S A;  2M8G X;  2XKP A;  4LGW A;  5AIP A;  1QZZ A;  4UB8 C;  3S1R J;  1XTA A;  4F7Z A;  2XDV A;  2ZSH B;  4U0Y A;  4IOC F;  1AKH A;  4Q48 A;  3LSJ A;  1DU0 A;  1X3Z B;  1IO2 A;  3GVA A;  1MMS A;  1LDK B;  1PJR A;  3FXR A;  3CLQ A;  2GOX B;  5IT3 A;  3EPZ A;  3U1K A;  3B6C A;  2VXD A;  4AVP A;  1H89 C;  2KKO A;  1XC5 A;  1YTY A;  4Y4R A;  2EIL H;  2MW8 A;  4U7D A;  2FU4 A;  1ENH A;  3AG3 H;  1Z6R A;  1RKW A;  1R49 A;  2KRC A;  3GBG A;  4BQQ A;  4P1W A;  4PJ0 C;  3CCM I;  2OCE A;  2OAZ A;  2Y9Y A;  4M3B A;  2DOA A;  3QPT A;  3E5X A;  1UMQ A;  5D8L B;  2QSF X;  2Z2S B;  4O5V A;  2KP6 A;  3TDU C;  3FXJ A;  4MEX F;  2IT0 A;  1T08 B;  1GXQ A;  3SYT A;  1IF1 A;  3EUH A;  1PYV A;  2IGM A;  1T39 A;  2IA2 A;  4U88 A;  2E36 A;  3REO A;  3A2K A;  2CW8 A;  4IQJ A;  1U9O A;  2UUZ A;  3GO5 A;  2GA2 A;  2NS0 A;  3RDI A;  3CJQ B;  2DMQ A;  2WA0 A;  4IRG A;  4L18 B;  3ZOB A;  2LSO A;  3K2A A;  3RQI A;  2DDB A;  1B72 A;  4U7B A;  3ERM A;  4NHJ A;  4WXC A;  3F3X A;  1SFU A;  1MJ9 A;  1G4D A;  1S5L C;  2R7T A;  4PJJ A;  4I2O A;  2HYF A;  1HSJ A;  2QEX I;  4F52 A;  3C3W A;  5JHF A;  2JRT A;  2L7Z A;  4MO7 A;  1JT0 A;  5GAG J;  3S3N A;  1OJL A;  5BS6 A;  4RAG A;  2OTJ I;  5J4Y A;  4KIG A;  4D0P A;  1ZEL A;  4M9X A;  3U21 A;  2HYG D;  1V5G A;  3F8F A;  3K4M A;  3HC7 A;  3L7W A;  1LVK A;  5J40 A;  3F8N A;  3RI4 A;  1N25 A;  3QRF F;  2R7X A;  1ITY A;  4HF0 A;  3QYB A;  1MH3 A;  5D4S A;  4A6E A;  3E5U A;  4G6T B;  2ZJP F;  4HDU A;  1JHH A;  5FB2 A;  2DAO A;  3IAS 2;  2OPT A;  4KIT B;  1JUM A;  2EZI A;  2FNA A;  5LBQ A;  1KU9 A;  2O8X A;  4N9H A;  2H8R A;  1R4M B;  3LQQ A;  1OCR H;  2V1X A;  1POG A;  1SEU A;  2NNY A;  1MJB A;  1D8J A;  1LJ9 A;  4ZZL A;  3AAF A;  4RA2 A;  3TGN A;  2BBY A;  2HXI A;  3GTG J;  5CVI A;  3DLA A;  3VFZ A;  4WWC A;  4Y3O A;  4A5M A;  2DA4 A;  5LGT A;  1XSD A;  3IRR A;  2NS7 A;  3ABM H;  4HX8 A;  5ERI A;  4BXF A;  1IRZ A;  3ZN1 A;  2P6S A;  3GFJ A;  2XPU A;  1A6Q A;  1HC8 A;  4FAS D;  4FET A;  1WGX A;  4GDF A;  1OCO H;  2JJ7 A;  1LPQ A;  3QOP A;  2IJL A;  3J7A Y;  5ED4 A;  1FTT A;  2DOE A;  4YIR X;  2HVS A;  1I5Z A;  4D7N A;  2O3F A;  3RPU A;  3K4L A;  1I6X A;  3GYH X;  1WKM A;  3OYA A;  3RKQ A;  1WVR A;  3E0J B;  4IHT A;  4HLX A;  1XCV A;  4N9I A;  2M5W A;  2F5C A;  2K7L A;  3ZXS A;  3CZ6 A;  4N4O B;  3I59 B;  1FNN A;  4KMF A;  3H9Q A;  4BBS J;  1RNL A;  2M30 A;  4A93 J;  1Z05 A;  1YIJ I;  1B8I B;  4JYK A;  2KIQ A;  3JRD A;  4JK1 X;  4LMY A;  2DK8 A;  2EH3 A;  2V4J C;  3DBL B;  4BBR J;  4CZC A;  1GV5 A;  5D5X B;  1XGS A;  2VKE A;  1MDM B;  3OS2 A;  2P8T A;  5B1B H;  1Z91 A;  3OL4 A;  5DD4 A;  3L2Q A;  2DT5 A;  5DYM A;  2QQ9 A;  4BHC A;  3K6G A;  1MKM A;  2RRE A;  1RRJ A;  2H94 A;  3OMY A;  4XK4 A;  1H88 C;  2E1C A;  4L9J A;  3ISP A;  1DU6 A;  3JRH A;  1YW7 A;  3DLL F;  2R92 J;  1ZR4 A;  4RB1 A;  4UB6 C;  4IF4 A;  1P6R A;  3GTK J;  4B4C A;  2IA0 A;  4X6A J;  1R22 A;  2XGD A;  2ZNZ A;  2P4W A;  4HX7 A;  2HXO A;  4G7Z F;  2DBB A;  2E2I J;  4MEY F;  2Q1Z B;  5F1J A;  4DBQ A;  4WX9 A;  5C44 J;  3HB9 A;  2QWW A;  3L00 A;  3LSR A;  1WPK A;  3LSP A;  4M3E A;  2MYS A;  3CUO A;  4MLO A;  1IC8 A;  2DMN A;  3BY6 A;  5KAI C;  1BN5 A;  2XF5 A;  1N77 A;  1F43 A;  4P96 A;  2BW3 A;  3CP2 A;  4BJ6 C;  2LY1 A;  2Y75 A;  3MWM A;  4DBR A;  1IN7 A;  3D1N I;  3AG1 H;  1BA5 A;  4L5J A;  3ABK H;  1YX3 A;  1R9T J;  5CJ9 A;  1WI9 A;  2ZNY A;  4FE7 A;  3ZCO A;  1WCM J;  3SEZ A;  1GDT A;  2DTR A;  2GM4 A;  2IGK A;  2Q0O A;  2QCO A;  1W5C C;  2LC2 A;  2XAF A;  5D8K B;  2BEO A;  2K5C A;  2LY2 A;  1HQC A;  5M5X J;  1VQK I;  1QRY A;  3ASO H;  4RGR A;  1L3L A;  2EIN H;  2B7E A;  3IV5 A;  4WK8 F;  3LSM A;  1ZG1 A;  2KFD A;  2LFB A;  2JZY A;  2JA7 J;  4HNV A;  3SFI A;  1IDY A;  1BC7 C;  3GW2 A;  1ETV A;  2MD5 A;  5AON A;  2QM3 A;  3A0H C;  5EEA A;  2WAQ A;  4U0V A;  4QTR A;  1HKS A;  2HVQ A;  3PNY A;  1JHF A;  3OY9 A;  1MNM C;  3OSG A;  4M3D A;  1D5Y A;  1QNT A;  1V5F A;  4GO1 A;  2QYO A;  1YW9 A;  3OYE A;  4LG0 A;  3BPX A;  4B8X A;  2DT6 A;  3WE3 A;  2ME6 A;  1D3Y A;  2PMU A;  3PL8 A;  5CQG A;  4A5N A;  4UUS B;  1SVO A;  3AKZ A;  1KYW A;  5EZG A;  1RUO A;  5FRN A;  3G3Z A;  1R71 A;  1EKE A;  2L02 A;  4HBL A;  4P55 A;  3OWT A;  2L01 A;  2UXN A;  2B63 J;  1DP3 A;  2CMP A;  3F22 A;  2CO5 A;  4DJA A;  1Z9C A;  1YLF A;  1MW7 A;  2CFO A;  2D1V A;  2G9W A;  3WHB A;  3L2W A;  4IRH A;  5FKN A;  2LOO A;  2JA2 A;  3B6A A;  3PO2 J;  2HDW A;  2P81 A;  3I0T A;  3M8J A;  2V9P A;  2WV0 A;  3F6O A;  2COB A;  5L3D A;  2ZBK A;  1LDJ A;  4A3G J;  4L5E A;  4E70 A;  2QVO A;  2XGC A;  4C9Y A;  1I50 J;  1XGN A;  3OYG A;  4UUT A;  5K7F A;  3JRI A;  1TBX A;  5DDG A;  2KZV A;  3PNT A;  2FBK A;  3KET A;  3RYR A;  3ONQ A;  1YHQ I;  3BDD A;  1YRN A;  2R5Z A;  2PX9 A;  1FZP B;  2MLK A;  3LFK A;  2AXL A;  2QBY B;  2H27 A;  5J4V A;  3CCU I;  1T2K A;  3J7Z I;  5J1U A;  2ZME C;  4GYG A;  2DMU A;  1RR8 C;  4YRV A;  3MZ8 A;  2HQA A;  1HA8 A;  4XLH A;  2F5V A;  4J19 A;  4BEH B;  2ZKZ A;  3KX2 A;  1KQ8 A;  2VOO A;  4BQN A;  2VQG A;  1YX5 A;  2DJN A;  4GGG A;  4IJA A;  4L5I A;  3KYL A;  2K40 A;  1QQI A;  3MVP A;  3ZRG A;  4XRF A;  2BY1 A;  3KEY A;  3W2A A;  2XF6 A;  2O8K A;  1APL C;  1ON2 A;  2P6T A;  2KPM A;  2BE5 F;  2A61 A;  3SZP A;  4HX4 A;  1QVU A;  2JT1 A;  3BG9 A;  4LLL A;  3WU0 A;  1FT9 A;  4UVA A;  3GX4 X;  1OR7 A;  2ME0 A;  1QA6 A;  1X1A A;  4GFB A;  2LP0 A;  4BE2 A;  3MKW B;  1BR2 A;  5F0F A;  4OIN F;  3PUF A;  1ZHF A;  4ZTF A;  1LEB A;  4UNO A;  2P7V B;  1X1D A;  2PQ8 A;  4A12 A;  3K4C A;  1MBF A;  5K7H A;  4D5C A;  5FO5 A;  2KRF A;  3BR6 A;  1S7E A;  3Q9V A;  5D4R A;  2W48 A;  1Y1V J;  4ZYG A;  1WFX A;  1MD0 A;  1QO0 D;  2HDD A;  5FFZ A;  2JUC A;  3BZK A;  1FMV A;  3WTV C;  2IS1 A;  1XB4 A;  1BC8 C;  2XPV A;  1WH7 A;  4CCO A;  2ADU A;  4Q5S F;  2IXS A;  2R5Y B;  4KIF A;  4OU0 A;  3BTC A;  1IJW C;  3FKI J;  4PUS A;  3SDB A;  2IGO A;  4XSZ F;  3ZQG A;  2NVT J;  5M5Y J;  1JKR C;  3T1B A;  2WAQ N;  5KHD A;  2EFP A;  2NNN A;  2QLZ A;  3DKW A;  2XAH A;  5F27 A;  4B09 A;  1Z6T A;  1LFB A;  3QYE A;  3S3O A;  3CLO A;  2ESH A;  1LEA A;  2HZT A;  5L3C A;  2RN7 A;  2IBD A;  1FOW A;  1R58 A;  3VSL A;  3ZQ7 A;  4XIC A;  4UV9 A;  4N4N B;  3FBI B;  3MZY A;  2Y2Z A;  4Y15 A;  2V6C A;  3E6C C;  4PJL A;  4XOR A;  4C30 A;  4XSX F;  1H9T A;  1A31 A;  2ZXJ A;  3TO6 A;  3DCF A;  4Y7N J;  4A3I J;  2Y0S A;  3PQJ A;  2X1C A;  3LOC A;  1K4S A;  4A2U A;  3CCQ I;  3ZR8 X;  4S0H B;  3BJO A;  3BJA A;  3G73 A;  1D1C A;  2Z1D A;  5IYC J;  5FLV A;  3FXL A;  4BDY A;  1ZAO A;  3RZO J;  5DM6 F;  2R7D A;  5BQT A;  1N75 A;  2QGU A;  1E3P A;  4XRS G;  5E1X A;  1MBJ A;  4E6K G;  3ZMZ A;  1B59 A;  3V8J A;  1L0O C;  1MBH A;  1X4O A;  2JTV A;  1X19 A;  2WTE A;  2X6O A;  4HV6 A;  4NQW A;  4CUG A;  3QU6 A;  2HNH A;  2Y0M A;  2LK2 A;  2ZXH A;  1VQ9 I;  1ON1 A;  2V9K A;  3I54 A;  2IPQ X;  1G3Y A;  2GQQ A;  2DA1 A;  2IVM A;  4HV5 A;  3KE2 A;  4MGR A;  4JBA A;  1HOM A;  1WJB A;  2R7Z J;  3G6E I;  4ABZ A;  4F55 A;  3G4S I;  2P7C B;  4C2M J;  4M9S A;  5CVJ A;  2VBY A;  1HW2 A;  2FML A;  2YSR A;  1R23 A;  3OYL A;  2HQN A;  3DPT A;  3BG5 A;  3PJR A;  4CHU A;  3VSK A;  4XBF A;  3H3U A;  4XLC A;  3NWS A;  3D5R C;  4FTH A;  1X3W B;  1OPC A;  3A02 A;  3DTE A;  4Z2Y A;  4K2E A;  2LRD A;  1OLT A;  3G1L A;  2FE3 A;  4ITV A;  1XG1 A;  3M1C A;  1S29 A;  2Z9O A;  5D6E A;  4P9U A;  2B0L A;  1TW2 A;  4KYW A;  2IW5 A;  2R0Q C;  3TQN A;  2DPU A;  1Z7U A;  2H6C A;  2IS2 A;  1T98 A;  4LIT A;  5DUK A;  4IXA A;  2BXZ A;  4ZYE A;  2MH2 A;  4L0Z B;  2DA7 A;  4O3M A;  3S2D J;  1FEX A;  1DP7 P;  5EGO B;  3S32 A;  1BW6 A;  1XMX A;  2EV5 A;  3S2W A;  2YX4 A;  1BIA A;  2FEZ A;  2HI3 A;  4BXX J;  4HYE A;  2K9L A;  3KEO A;  4HQM A;  3Q0U A;  2H8W A;  3OYM A;  3GZ6 A;  3BTI A;  4ZC3 A;  2X48 A;  4E7S A;  4RDU A;  5F64 A;  2V79 A;  3RKY A;  4LJZ F;  3F21 A;  2Z33 A;  3ML6 A;  5EEH A;  1MBG A;  2LBF A;  3ULQ B;  1ULY A;  2WY8 Q;  3WU2 C;  2KIS A;  2W82 A;  4JX6 A;  4RB0 A;  1KQ9 A;  1FBQ A;  3K1P A;  1XN7 A;  5H6R A;  4CYD A;  3BQZ A;  3ZQF A;  3TO9 A;  2FBI A;  4A3B J;  4UUV A;  2TDX A;  5ILV A;  1DGR M;  1IRX A;  3N4M A;  2YU3 A;  2CS3 A;  4II2 A;  3HJE A;  5CVR A;  4EJT A;  1MNE A;  1HDP A;  2O03 A;  3DQV C;  3Q0W A;  2MFZ A;  3TL4 X;  1IN6 A;  2ID6 A;  5IP7 J;  4LD5 A;  3BR1 A;  1VQ8 I;  1TT5 B;  3J80 Z;  4F93 B;  5LHI A;  3CDL A;  3OYB A;  3DBH B;  4HEA 2;  3I59 A;  4L9V A;  2G7H A;  3QYF A;  3TP0 A;  2F5E A;  1T8I A;  2C6Y A;  4RAZ A;  5E8G A;  5E3O A;  1P4X A;  2WB1 N;  4A0X A;  1XS9 A;  1TP4 A;  1MMN A;  1B8I A;  1WJA A;  2NS8 A;  3KEQ A;  3OYD A;  3H3Z A;  4LB6 B;  1E3O C;  2IRF G;  5TJJ A;  4OWR B;  2Y0S N;  3OYJ A;  4LIU A;  1SD4 A;  2MBF A;  4KFC A;  2DK5 A;  2LRE A;  3CCY A;  4G8X A;  5L3B A;  3HM5 A;  4FX0 A;  3VDX A;  5EG0 A;  1X1B A;  2EIK H;  4EQQ A;  1LE8 B;  4IKF A;  5E3L A;  4RS8 A;  3IHU A;  1F5T A;  6PAX A;  1B6A A;  4NC7 A;  2W57 A;  5AIQ A;  5LFA A;  4C2T A;  1YG2 A;  1Y0U A;  4PSX A;  3K70 C;  3IL2 A;  1IV6 A;  3A03 A;  4XN0 A;  1LFU P;  1LUJ B;  3ABL H;  1RC9 A;  1FYL A;  4XID A;  3OS1 A;  2ACJ A;  4XNF A;  3PSI A;  5DS9 A;  2DJI A;  3HGY A;  2DLL A;  4BAY A;  4AIK A;  2VJ5 A;  2AQF A;  4ZH4 F;  1CF7 B;  3H5A A;  3M7G A;  2L7K A;  2HKO A;  5D5U B;  2ECC A;  1UG0 A;  1BIB A;  1XX5 A;  3CF2 A;  4RBO A;  3HOS A;  3PFY A;  2HEO A;  3A4C A;  3JRA A;  4XM3 A;  2VQC A;  4EMS A;  1J59 A;  4A3K J;  1VQP I;  1UHM A;  1WSU A;  1D0X A;  2VBZ A;  2V9V A;  4P9F A;  4KIB A;  4PGG A;  2LY9 A;  1MIJ A;  3JW4 A;  1UHS A;  2E1O A;  4N0B A;  2VE9 A;  1YI2 I;  1GVD A;  5B3S H;  1XPX A;  1QZE A;  2M7B A;  3I58 A;  5FKO A;  4AM3 A;  5F08 A;  1N78 A;  1O3T A;  4M9Z A;  5CYV A;  3TO7 A;  4I0A A;  3IWF A;  2EBI A;  1W4M A;  2EQR A;  1FYK A;  1AHD P;  2EFQ A;  2VB6 A;  5HNH A;  4HF2 A;  1HKT A;  2CUJ A;  3CUQ C;  2B9S A;  1Q1V A;  2JPC A;  4XON A;  5FRM A;  1FJL A;  1TWC J;  2HVR A;  5LD2 C;  1OYY A;  3MN2 A;  2EA2 A;  1QHH D;  4Q47 A;  5JI6 A;  5DD8 A;  2KT0 A;  2XVC A;  4J01 A;  2E1M C;  3EYY A;  4IQ4 A;  1SMY F;  4EJV A;  1NHA A;  3FM3 A;  3OYF A;  2DMT A;  3FXU A;  1YS7 A;  2ICW G;  4YEJ A;  3VOD A;  3GLL A;  1P92 A;  3BJ6 A;  4HSR A;  1U5T A;  3FMS A;  3IH3 A;  1YE9 A;  4F92 B;  5JLW A;  1WWX A;  4AWX B;  4JX4 A;  4J00 A;  1QPM A;  3E6D A;  2RNJ A;  1ZRE A;  3CTA A;  3J81 K;  1TW3 A;  4MTD A;  3JRC A;  2PLY A;  2E1N A;  1BW5 A;  2D2W A;  2ELJ A;  3U1D A;  1OQY A;  1V4R A;  4HOB A;  4ETS A;  1JGG A;  2L4M A;  4IPA A;  3CDH A;  4PCQ A;  2FF4 A;  2P0W A;  1JKO C;  1HBX G;  3F0C A;  3NRV A;  4IHV A;  2LF8 A;  2EZL A;  3SXY A;  2RGV A;  2PJR A;  2K9M A;  2OD5 A;  2VOD A;  2ZME B;  1G59 A;  5L3F A;  3G1O A;  4M74 A;  2DPD A;  2L7M P;  2NOG A;  2BGC A;  3H0D A;  3M07 A;  4CCJ A;  3FXO A;  2FA5 A;  1PUE E;  3BLY A;  1FX7 A;  2OJE D;  4IOA F;  2Q2E B;  4DZP A;  4OOI A;  2O6G E;  1VQ4 I;  5IPA A;  3CC4 I;  2LLK A;  2X1E A;  3QP6 A;  2CW7 A;  2FQ3 A;  3O6B B;  3AG4 H;  4RGS A;  1ZYR F;  3P9I A;  3WTX C;  2ZB9 A;  1KGS A;  3LSI A;  4B44 A;  3W2V A;  3LMM A;  4AYB A;  2EJR A;  1ORK A;  4QPQ A;  5BPI A;  3HUG A;  2KRH A;  2HOE A;  2K3P A;  2HQR A;  1R6R A;  4XLP F;  3WTY C;  5E18 F;  1P7J A;  3KCC A;  4DYC A;  3HG9 A;  3I64 A;  1S3J A;  3PNV A;  3J7Y J;  1KON A;  1HDD C;  2E7X A;  2JSP A;  4EVI A;  4A3E J;  4CCN A;  4UHT A;  1VFC A;  3RCO A;  1MH4 A;  2A6E F;  1IXS B;  3V7S A;  2YR2 A;  3H92 A;  1YJN I;  1T0F A;  1RET A;  3E97 A;  1MMD A;  3IKV A;  1YYV A;  4OIR F;  3ZN0 A;  4LG3 A;  2VPL A;  2ZSI B;  1TQP A;  2VON A;  3V7C A;  5FD6 A;  1G2H A;  1TNS A;  3M9A A;  2BXY A;  3KP3 A;  5F0H A;  1PUF B;  1U9N A;  3CO6 C;  3TW7 A;  2O0Y A;  4PFP A;  3VOE A;  5EYR A;  3I3L A;  4IHS A;  4YIF A;  1OKR A;  3H36 A;  1V54 H;  2WAF A;  1YW8 A;  1RIO H;  2XGX A;  4AID A;  4B43 A;  1TTY A;  3K4B A;  5GP9 A;  1DUX C;  1VQ6 I;  1X1P A;  4YFK F;  4PSW A;  3JTH A;  2L0K A;  5LHH A;  3KLO A;  3A01 A;  3MD2 A;  3KP5 A;  2R5Y A;  5J6X A;  4NC6 A;  2W00 A;  2KDZ A;  3QQA A;  3M4O J;  4XQF A;  1R5H A;  2XPW A;  2CWE A;  3VB2 A;  5HVQ C;  3K0L A;  3HOZ J;  4DNC A;  3C2B A;  5JVT A;  2FOK A;  3FBN B;  2MSY A;  4PK4 A;  3OYH A;  3C7J A;  5DEQ A;  1J09 A;  2L9N A;  2GBY A;  1LKX A;  5K7Z A;  2ZJQ F;  2DTZ A;  4ESB A;  3TED A;  3HSE A;  4XLA A;  3MQ0 A;  4CCM A;  3NAU A;  4F3Q A;  1BBY A;  3H3V K;  2M9H A;  1HST A;  2L54 A;  2L9V A;  2PEX A;  2XSD C;  4ESJ A;  3HTS B;  2LR8 A;  2JA6 J;  2ZJR F;  2ZFW A;  4ESF A;  1AKH B;  1I1S A;  2BVL A;  1NTC A;  5H2F C;  2CH0 A;  2R3S A;  3FK7 A;  3T8R A;  2P5V A;  4A3J J;  3K4N A;  5GPA A;  5M3M J;  5E3M A;  2PI0 A;  4I98 B;  2JVG A;  1ZN2 A;  2M34 A;  3ZQH A;  2A68 F;  2K85 A;  2M2E A;  1WJD A;  4KN4 X;  3L09 A;  4YII A;  3BPV A;  3HSF A;  2W24 A;  1HKQ A;  4EM1 A;  2L9R A;  5K1Y A;  4BUP A;  4ON0 A;  1YQA A;  2OQR A;  4IHX A;  2W4S A;  1XD7 A;  1Y8Q B;  5FLX K;  4IEJ A;  1EA3 A;  1F9N A;  5ILS A;  1FP2 A;  4CXF A;  4KUM A;  5E20 A;  1ETX A;  3TMO A;  2DQR A;  2H6B A;  3HOY J;  1W5S A;  1WHU A;  4EAT A;  3J7A O;  4RM3 A;  2JK3 A;  1FP1 D;  2CSO A;  2DA2 A;  2VT3 A;  2IS4 A;  2XGE A;  1ZK8 A;  5L3G A;  3EYI A;  2CJJ A;  3F8B A;  2X6X A;  2CYY A;  2L3D A;  4AYB N;  3I71 A;  3BG6 A;  4KJZ A;  4R8H A;  4HLY A;  2P5K A;  1BOA A;  4G94 A;  3TBI A;  3WG7 H;  1NG7 A;  2F4I A;  3KP2 A;  1F1Z A;  3ROU A;  1GXP A;  1SD6 A;  3ECH A;  2JA8 J;  2X1D A;  2XKO A;  2BY2 A;  2M0C A;  3GCM A;  3KZZ A;  3V42 A;  2HOT A;  5IY5 H;  2JRM A;  4HG2 A;  1SD5 A;  1IN5 A;  2CQX A;  2ZXI A;  2BZT A;  2F5D A;  1Z21 A;  3NWT A;  2D1H A;  1SAU A;  2NXN B;  4A3F J;  4FHT A;  3HBL A;  4CDG A;  3NAR A;  4DZJ A;  4CO8 A;  1SFX A;  3RPU D;  3K70 D;  2QQB A;  3CDI A;  1VQN I;  1YOV B;  2NVY J;  5IT9 K;  1GVJ A;  1B4A A;  1XMA A;  5EGO A;  4L0Y B;  2NOJ B;  2XUB A;  1D1A A;  4HPQ A;  4LK1 F;  5HLT A;  3HOT A;  2M45 A;  2F48 A;  2GOM A;  3BP8 A;  3Q0V A;  1LQ1 A;  3CC2 I;  2JUG A;  1P4W A;  2ZCW A;  3FMR A;  3NQO A;  1XGO A;  3SZT A;  4NBQ A;  2DQL A;  4IO9 F;  2COM A;  2IP2 A;  1FBU A;  2E34 A;  2HYJ A;  4A3L J;  1XSV A;  5HDN A;  3KP7 A;  1UFM A;  3SQN A;  4GYI A;  5IT9 Z;  3H1C A;  2XAU A;  1KU2 A;  4DYR A;  3QOD A;  2JVH A;  2YPR A;  3O3K A;  3WE2 A;  2KLO A;  3GFM A;  1Z0X A;  2CRG A;  4HNT A;  3G1M A;  3KYD B;  1X2M A;  4BHP A;  4R1H A;  4AU7 A;  3OYN A;  5KVR A;  2W84 A;  3H35 A;  1LB2 A;  3P7N A;  1P7I A;  4E4H A;  4OIO F;  4UVB A;  1XMK A;  2QQA A;  3HTU A;  5TGT A; 
#chains in the Genus database with same CATH homology
 1UMQ A;  1ETY A;  4M3G A;  3JRE A;  2EZK A;  2R0Q C;  5EG0 B;  3FIW A;  2JMW A;  1EF4 A;  1VI0 A;  4BY1 J;  3BTL A;  3ZQC A;  2DA7 A;  3OIO A;  3UKG A;  3S2D J;  1A6I A;  1FEX A;  5EGO B;  1U9O A;  1MBE A;  4A3D J;  5FKK A;  1X2N A;  1BW6 A;  1ZKG A;  2DMQ A;  1QVT A;  2FQ4 A;  2N8G A;  5C3E J;  2HI3 A;  3ZOB A;  3K2A A;  3RQI A;  3S2H J;  1B72 A;  2IAI A;  4BXX J;  3IH4 A;  2YS9 A;  3Q0U A;  2O7O A;  4CYC A;  3BTI A;  2X48 A;  1VND A;  4RDU A;  3S17 J;  2VUM J;  1ETK A;  1HLV A;  3M3Y J;  5EF6 A;  1AU7 A;  3SDG A;  4IHW A;  3BG3 A;  1O4X A;  1MBG A;  2L7Z A;  4MO7 A;  1JT0 A;  1W0T A;  1WH5 A;  4JX6 A;  1NK2 P;  1OJL A;  5IOZ A;  1U78 A;  2EZH A;  3BQZ A;  3ZQF A;  4A3B J;  2VPR A;  1I6H J;  1ETO A;  1ITY A;  2WV1 A;  1HDP A;  2HOS A;  1MH3 A;  3Q0W A;  4X1E A;  3ZQL A;  2ID6 A;  5IP7 J;  3BR1 A;  2DN0 A;  3CDL A;  2O9L A;  2OPT A;  3TP0 A;  4XRS A;  1RR7 A;  1JUM A;  4QSH A;  2JWT A;  2EZI A;  3CMY A;  5E3O A;  2WB1 N;  3PM1 A;  1IUF A;  2H8R A;  2DA3 A;  1XS9 A;  1TWG J;  1B8I A;  1POG A;  4FIS A;  2NS8 A;  2DA6 A;  3GTL J;  1K83 J;  1OCP A;  1E3O C;  2Y0S N;  2H1K A;  2HXI A;  3GTG J;  3PO3 J;  3TW6 A;  1B72 B;  2DA4 A;  3CCY A;  5DTD A;  2NS7 A;  3HM5 A;  1IRZ A;  1TC3 C;  5EG0 A;  2XPU A;  4M6V A;  5IOY A;  3K7A J;  1MBK A;  1WGX A;  1LE8 B;  2JJ7 A;  5E3L A;  1OCT C;  4JX5 A;  1FTT A;  1IV6 A;  3A03 A;  1LFU P;  4D7N A;  2D5V A;  2R93 J;  4XID A;  1GUU A;  3O8G A;  1JKP C;  1OFC X;  3RKQ A;  5DS9 A;  4W1U A;  3HGY A;  3BR5 A;  1SAN A;  4JP0 A;  2E2H J;  3WHC A;  2ECC A;  4RBO A;  1A5J A;  4D5F A;  3HGG A;  5FKM A;  3JRA A;  4AUX A;  1Y1W J;  1JT6 A;  4A3K J;  4BBS J;  4A93 J;  2OF7 A;  1NK3 P;  4LOC A;  3BTJ A;  4JYK A;  3JRD A;  1B8I B;  2LY9 A;  3CQZ J;  1UHS A;  2E1O A;  4MFD A;  2EH3 A;  2IEK A;  2HQ5 A;  1GVD A;  2QF7 A;  4BBR J;  4M3F A;  1GV5 A;  1JUP A;  2VKE A;  5FKO A;  5F08 A;  5JLX A;  1UG2 A;  2EBI A;  2EQR A;  3GTO J;  4G12 A;  1AHD P;  1JJ8 C;  4MIM A;  1FTZ A;  1U8B A;  1WI3 A;  4A3C J;  4FCY A;  4XK4 A;  1H88 C;  1Q1V A;  1DU6 A;  3JRH A;  2Y9Z A;  1FJL A;  2FJ1 A;  1TWC J;  5EZH A;  2R92 J;  1I3Q J;  3MN2 A;  1ZR4 A;  4C3H J;  2LTP A;  5FJ8 J;  2KT0 A;  3Q3S A;  3GTK J;  4B4C A;  3O8H A;  1HF0 A;  4X6A J;  2XGD A;  2CUF A;  1K61 A;  1JTX A;  4I76 A;  2AHQ A;  2HXO A;  3H0G J;  2DMT A;  2E2I J;  5F1J A;  3RZD J;  5C44 J;  3HB9 A;  1JJ6 C;  1T56 A;  2MGQ A;  3LSR A;  1WPK A;  3S1M J;  3LSP A;  4M3E A;  4MLO A;  1IC8 A;  2DMN A;  2I10 A;  3IH3 A;  5JLW A;  1LE8 A;  1F43 A;  4JX4 A;  5BNG A;  5M3F J;  3JRC A;  3D1N I;  1BA5 A;  5IYB J;  1BW5 A;  1R9T J;  1JGG A;  4FE7 A;  1YRN B;  2R5Z B;  1WCM J;  1H8A C;  1GDT A;  1JKO C;  2GM4 A;  1ZTR A;  2QCO A;  3F0C A;  5F0C A;  3VPR A;  4BY7 J;  1MSF C;  4IHV A;  4A3M J;  3S1Q J;  2EZL A;  5M5X J;  1QRY A;  2RAE A;  2CUE A;  2YU9 J;  2FD5 A;  5J1R A;  3IV5 A;  3A01 B;  3G1O A;  1TWF J;  2DMP A;  2LFB A;  2JA7 J;  4HNV A;  4FE4 A;  3SFI A;  2L7M P;  1PUF A;  1IDY A;  1RKT A;  3DEW A;  1ETV A;  2NOG A;  5EEA A;  3JRF A;  4QTR A;  1MNM C;  3IH2 A;  1T33 A;  3OSG A;  4M3D A;  1D5Y A;  4DZP A;  3GTJ J;  5IPA A;  1QPI A;  2LLK A;  1ZR2 A;  2L7F P;  1ZGW A;  5IP9 J;  3S1N J;  3LNQ A;  2ME6 A;  2K9S A;  2ZB9 A;  1TWA J;  3QPS A;  3HKZ N;  4UUS B;  2MG4 A;  2JA5 J;  5EZG A;  1ORK A;  2AO9 A;  3JRB A;  5GPC A;  1P7J A;  3MKL A;  4B1R A;  2TRT A;  4DYC A;  2XRL A;  1HDD C;  1ETW A;  3S15 J;  2DA5 A;  3BR0 A;  2NVX J;  2B63 J;  3FIS A;  4A3E J;  4A69 C;  2LVS A;  1VFC A;  3WHB A;  1MH4 A;  5FKN A;  3B6A A;  3PO2 J;  3E7L A;  2P81 A;  1JKQ C;  1RET A;  2COB A;  3ZQI A;  5J3L A;  4A3G J;  4L5E A;  3HOU J;  2XGC A;  3JRG A;  5M5W J;  1MSE C;  1I50 J;  1GT0 C;  1G2H A;  4UUT A;  5K7F A;  3JRI A;  2CU7 A;  5F0H A;  1PUF B;  1U9N A;  2YUS A;  3BT9 A;  1X58 A;  3TW7 A;  1YRN A;  3OSF A;  5EDN A;  2R5Z A;  5EYR A;  5J1U A;  2LKX A;  1JTY A;  2DMU A;  1W0U A;  9ANT A;  3HOX J;  5GP9 A;  1BJZ A;  3A01 A;  4IHY A;  2L0K A;  4MFE A;  4I6Z A;  2R5Y A;  4J19 A;  1JUS A;  2KDZ A;  3QQA A;  3M4O J;  2XPW A;  2VI6 A;  3SJM A;  1Z77 A;  2DJN A;  2XB0 X;  3HOZ J;  3S14 J;  2K40 A;  2E2J J;  3MVP A;  1CQT A;  3C2B A;  3HDD A;  2FX0 A;  2O8K A;  1APL C;  4NDL A;  2ELK A;  2Y31 A;  2MSY A;  3HOW J;  5J1Y A;  1QVU A;  4XRM A;  4BKX A;  3BG9 A;  4UUS A;  2GBY A;  1VF9 A;  2ME0 A;  1HCR A;  5K7Z A;  4GFB A;  2DTZ A;  2LP0 A;  4QIW N;  3TP3 A;  3TED A;  2GLO A;  2LD5 A;  5F0F A;  3NAU A;  3H3V K;  4C3I J;  2M9H A;  3W6V A;  2XSD C;  2LR8 A;  5IP6 A;  2JA6 J;  1MBF A;  5K7H A;  4D5C A;  1ZQ3 P;  1AKH B;  3BR6 A;  1NTC A;  1S7E A;  2K9Q A;  3FK7 A;  2W48 A;  3GTM J;  1Y1V J;  4A3J J;  5GPA A;  5M3M J;  5E3M A;  2M34 A;  3ZQH A;  2HDD A;  3HOV J;  2G0E A;  1RPW A;  2M2E A;  1GV2 A;  2XPV A;  1WH7 A;  1F36 A;  1TWH J;  2R5Y B;  3LSG A;  1IGN A;  3BTC A;  1IJW C;  3FKI J;  2L9R A;  2TCT A;  4IHX A;  2NVQ J;  4IEJ A;  3ZQG A;  2NVT J;  5M5Y J;  1JKR C;  2WAQ N;  1RES A;  2ECB A;  3BR3 A;  4V2F A;  5IYD J;  4W97 A;  5F27 A;  3QPL A;  1ETX A;  2VKV A;  3HOY J;  1LFB A;  2XB5 A;  4D7M A;  2E19 A;  1SFO J;  4AC0 A;  3FK6 A;  2JK3 A;  2CQQ A;  2DA2 A;  2XGE A;  1ZK8 A;  2IBD A;  3I4M J;  2CJJ A;  5E3N A;  1ETQ A;  4B3A A;  4XIC A;  2Y2Z A;  2HOA A;  5C4J J;  4AYB N;  2K9N A;  2X9D A;  3DCF A;  4Y7N J;  3L1P A;  4A3I J;  2JA8 J;  2JN6 A;  3LOC A;  3GTQ J;  2M0C A;  5HOD A;  4S0H B;  3HEF A;  2HOT A;  4V2G A;  4CYC B;  2CQX A;  2PMZ N;  1FIP A;  5IYC J;  5FLV A;  4A3F J;  3RZO J;  3HBL A;  4EEF G;  3NAR A;  4DZJ A;  3I4N J;  2ID3 A;  3S16 J;  3BR2 A;  2NVY J;  4XRS G;  1MBJ A;  3GTP J;  2M8G X;  1IDZ A;  5EGO A;  1MBH A;  1IG7 A;  5C4X J;  2X6O A;  4DW6 A;  1BL0 A;  2Y30 A;  1FIA A;  3S1R J;  3Q0V A;  1AKH A;  1DU0 A;  2LK2 A;  3LSJ A;  5FLM J;  4C3J J;  2DA1 A;  4Y52 J;  5F04 A;  1HOM A;  2R7Z J;  2HYJ A;  3B6C A;  4ABZ A;  4A3L J;  1H89 C;  4C2M J;  5FKL A;  1XC5 A;  4DYR A;  3BQY A;  2MW8 A;  1ENH A;  3BG5 A;  4DYQ A;  1Z0X A;  2CRG A;  1RKW A;  3G1M A;  1X2M A;  3GBG A;  4FTH A;  3A02 A;  3JR9 A;  3G1L A;  1P7I A;  3OOU A;  2Y9Y A;  1XG1 A;  4M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...