2LR8A

Solution nmr structure of casp8-associated protein 2 from homo sapiens, northeast structural genomics consortium (nesg) target hr8150a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
SHMKNVIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASP8-associated protein 2
publication title Solution NMR Structure of CASP8-associated protein 2 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8150A
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 20
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lr8A00
9ANTA 2HYJA 1A6IA 2JWTA 2JA6J 4NDLA 5IYCJ 1JKOC 4A3LJ 4L5EA 1MSEC 3B6AA 3LOCA 3Q0WA 5FKOA 2PMZN 1WPKA 3HOWJ 2B63J 3JRBA 1R9TJ 1APLC 3CMYA 3BT9A 3O8HA 5F04A 1B72A 2EBIA 1TWCJ 4DZJA 1HDDC 1JUPA 3Q0VA 4MO7A 1MBHA 1JT6A 5J1RA 5GP9A 1ETYA 4A3IJ 2DA4A 4XICA 5EEAA 3A02A 2ME6A 1WGXA 3HOZJ 5EYRA 3SDGA 3VPRA 3JRIA 3NARA 3HB9A 3CCYA 2L9RA 3PO3J 1XS9A 3ZQLA 3PO2J 2ID3A 1BW6A 5IPAA 3QPLA 5GPAA 1TWGJ 3GBGA 1BW5A 1QVTA 3GTQJ 3HOVJ 3M4OJ 2JJ7A 2HI3A 1JJ6C 2L7ZA 2W48A 1JGGA 1BA5A 1WI3A 4MLOA 4AUXA 1VF9A 4J19A 4V2GA 2ELKA 2TRTA 4ABZA 2ID6A 2VKVA 2DA2A 3K2AA 3OIOA 2JA5J 2DA6A 2CU7A 1H8AC 2WV1A 1PUFB 4B1RA 5F0CA 3A01A 1UMQA 2LFBA 1ENHA 2FD5A 3HOXJ 2YS9A 5FLVA 2HQ5A 5FKNA 3H3VK 2R5ZA 3H0GJ 3UKGA 4A3GJ 1DU6A 4A3MJ 5EF6A 3S15J 2VKEA 1IC8A 1JKQC 2D5VA 5E3NA 4LOCA 4AYBN 2FJ1A 2M0CA 1U9OA 2JMWA 2XGCA 4C3JJ 1MH3A 2N8GA 1GUUA 4QIWN 3E7LA 1AU7A 3W6VA 4D5FA 1JUSA 2G0EA 1MSFC 1P7IA 2QCOA 1JUMA 4BXXJ 1F43A 3BG3A 4DYCA 4A3CJ 4I6ZA 1EF4A 4A3BJ 2QF7A 1RR7A 4D5CA 3K7AJ 5DTDA 4FTHA 4A93J 3JRGA 3JRCA 4CYCA 3ZOBA 1IG7A 2MG4A 5F27A 2DMUA 1FEXA 1MBGA 2HXIA 3SJMA 3TW7A 4JYKA 2L7MP 3BR0A 3S17J 3DCFA 3WHCA 2K40A 1SFOJ 1UHSA 4BY1J 2WAQN 4W97A 4V2FA 3WHBA 3OSGA 1LE8B 3BR6A 2DA1A 3LNQA 1MH4A 4A3EJ 5M5YJ 1VI0A 1MNMC 5K7FA 1U9NA 3HOUJ 4C3IJ 5IYDJ 2YUSA 5FKLA 2DMTA 3GTGJ 3BG9A 4Y52J 3JRFA 2M8GX 2XGEA 3M3YJ 4A69C 4A3DJ 4A3JJ 1HF0A 1NTCA 4X6AJ 3PM1A 1X58A 2O7OA 2LY9A 3LSPA 2AO9A 1MBEA 3O8GA 5IP6A 5M5XJ 5EG0B 3FIWA 2OPTA 1I50J 3MN2A 4MFDA 1K61A 3ZQCA 2JN6A 1GT0C 3BR3A 3BG5A 5FKKA 4A3FJ 3QQAA 2DMPA 2VUMJ 1NK2P 2Y0SN 2HOSA 2WB1N 1IRZA 2XB5A 3JRHA 3BTJA 2X9DA 5M5WJ 3BQYA 2R5YB 2E2IJ 4D7MA 5GPCA 5IP9J 3LSRA 1PUFA 4XRMA 1P7JA 3CDLA 5C3EJ 1ZKGA 1CQTA 2NOGA 1X2NA 1BL0A 1A5JA 1ZK8A 2Y2ZA 1ZTRA 1QPIA 2EQRA 3ZQFA 3OSFA 1ETVA 1Y1WJ 1NK3P 1Q1VA 2LK2A 5FJ8J 1HLVA 4X1EA 1HDPA 2HOAA 3SFIA 5HODA 1LFBA 4QSHA 2NVQJ 2MSYA 3ZQIA 1TC3C 3BTCA 2LLKA 2GBYA 3JREA 1FJLA 1X2MA 1ETWA 2ME0A 1IDYA 1RETA 4QTRA 2P81A 3D1NI 2CQXA 1IV6A 3JR9A 2X48A 2ECBA 1WH7A 4BBRJ 1H88C 4MFEA 4C3HJ 5BNGA 2CRGA 2GM4A 2ECCA 1Z0XA 1OJLA 4W1UA 4RDUA 1BJZA 2IAIA 2MGQA 1E3OC 2M34A 3HBLA 2EZHA 3GTPJ 1I6HJ 1GV2A 1W0TA 1U8BA 3S1NJ 1RPWA 3I4NJ 4FE7A 3MKLA 3QPSA 2M9HA 4AC0A 5DS9A 1OFCX 1OCPA 4DYRA 3NAUA 3S1RJ 2CUEA 3HGGA 2X6OA 1Y1VJ 2RAEA 5C44J 1FIAA 3RQIA 5E3LA 3GTOJ 1LE8A 2E2JJ 2GLOA 3IH4A 2YU9J 5F1JA 1F36A 2EZKA 1GV5A 3LSGA 2DJNA 2K9NA 4DYQA 4GFBA 1S7EA 1JTYA 3S1QJ 4UUSB 2KT0A 5M3MJ 2NVYJ 1AKHB 3CQZJ 2LD5A 1Z77A 5F08A 3RKQA 3S14J 5IOYA 1ZR2A 1OCTC 1ETQA 2COBA 4IEJA 4B3AA 5C4JJ 1YRNB 4DW6A 2FX0A 2IBDA 3LSJA 2XRLA 2VI6A 2TCTA 1O4XA 1B8IB 2NS8A 5EG0A 2Y9YA 4D7NA 1MBFA 1K83J 4EEFG 3HKZN 1ZGWA 2CQQA 5EGOB 5J1YA 1WH5A 1QVUA 2I10A 2LP0A 1WCMJ 1IDZA 2NVXJ 3GTMJ 1ZR4A 4BBSJ 1ETOA 2EH3A 1T33A 5E3MA 3S1MJ 1HCRA 5M3FJ 3GTLJ 2O9LA 4C2MJ 5FKMA 1FTZA 2R5YA 4XK4A 4IHVA 1FIPA 4XRSA 3TEDA 4UUTA 1I3QJ 4JX4A 1ETXA 2MW8A 1TWHJ 3FKIJ 5IOZA 2LTPA 4B4CA 3Q3SA 2OF7A 4M3EA 4IHXA 3ZQGA 3G1OA 2LKXA 5EDNA 2H1KA 2L7FP 3IV5A 3JRAA 4M3BA 4JX5A 2NVTJ 1AHDP 1TWAJ 5EZHA 4HNVA 5JLXA 1IJWC 1B72B 2AHQA 3DEWA 3FK6A 4JP0A 5J1UA 3IH2A 2DTZA 4M3FA 1FTTA 2XPWA 2DA3A 3C2BA 4BKXA 2L0KA 1T56A 4S0HB 3FK7A 2R92J 3HEFA 2HOTA 4M3GA 2JA7J 3GTKJ 3IH3A 2CUFA 5F0FA 2KDZA 1POGA 2CJJA 1ORKA 4FISA 1LFUP 1JTXA 4FE4A 2VPRA 1GVDA 4IHYA 1HOMA 2R93J 2K9SA 2NS7A 1GDTA 2E2HJ 1TWFJ 3TW6A 2R0QC 2LVSA 3F0CA 1QRYA 3FISA 3A03A 3HDDA 1D5YA 2ZB9A 3S16J 4JX6A 3MVPA 4Y7NJ 5JLWA 1JKRC 4XRSG 2IEKA 4I76A 2HDDA 4XIDA 5K7ZA 3G1LA 1VFCA 1IGNA 1U78A 2JA8J 5J3LA 3S2DJ 2DMNA 4RBOA 1RKWA 3JRDA 3RZDJ 1DU0A 3OOUA 2FQ4A 2H8RA 3A01B 1ETKA 3L1PA 2DA7A 2Y9ZA 4UUSA 3G1MA 5IP7J 2E1OA 1AKHA 3RZOJ 5C4XJ 2DMQA 5EZGA 2R5ZB 2O8KA 1W0UA 1YRNA 1ZQ3P 3TP0A 2EZIA 3GTJJ 2XGDA 3B6CA 1JT0A 2DA5A 1B8IA 1MBKA 4M6VA 2XB0X 4BY7J 1G2HA 2DN0A 1RKTA 1XG1A 1XC5A 1JJ8C 1ITYA 1VNDA 1UG2A 3BQZA 4G12A 5K7HA 3Q0UA 5EGOA 1H89C 2M2EA 2Y31A 2JK3A 4MIMA 2EZLA 3HM5A 1RESA 5E3OA 4IHWA 1JKPC 3BR1A 3BR2A 1MBJA 3BR5A 2Y30A 1SANA 4M3DA 2XPVA 2XSDC 5FLMJ 2XPUA 3TP3A 4DZPA 3S2HJ 3BTIA 5F0HA 4A3KJ 3HGYA 3BTLA 3HOYJ 3I4MJ 1IUFA 2HXOA 2K9QA 2LR8A 2E19A 3ZQHA 2R7ZJ 4CYCB 5IYBJ 4FCYA
chains in the Genus database with same CATH superfamily
3BOQA 2JWTA 3SZGA 4ZZLA 5IYCJ 4L5EA 4YRVA 1LJ9A 3IKVA 3LOCA 1SVMA 4PJ0C 3FXMA 1G3SA 4R8HA 3C3WA 4L9TA 2F5CA 2HS5A 5AIPA 2KMUA 5FGMA 2D1VA 3HUGA 1R36A 1A6QA 5F04A 1MJ9A 4HPQA 2EBIA 4DZJA 3Q5FA 1HDDC 1K78A 3GZ6A 3Q0VA 1P4WA 2WTEA 1FMVA 1TL8A 4MO7A 3IRQA 1MBHA 1V55H 2KISA 4Y4RA 5J1RA 2X1DA 5GP9A 1M1EB 1R4NB 5IT9Z 2HGCA 5LHIA 4XL9A 3LFUA 3KPHA 2VT2A 3OYKA 2BE5F 2P6SA 1EJ9A 3R0AA 2HPIA 1XS9A 3DTEA 3ZQLA 3PO2J 3P5JA 2ID3A 2FBKA 3GBGA 1BW5A 1B9MA 1QVTA 3M4OJ 5BPIA 4PDKA 1K4TA 1JJ6C 2W48A 5DUKA 1WJ5A 2HQNA 2Q0OA 1UAAA 1WZ2A 4MLOA 4IZZA 3RSNA 3KP4A 2IS6A 4S04A 3WGGA 1SVLA 3K1PA 4V2GA 1R5GA 2EFOA 3OYGA 3FBNB 5J8FA 2FSWA 2TRTA 3NWSA 2H6CA 3BZ6A 1J9IA 3DBHB 4AM3A 3IUOA 2DU9A 4UB6C 3SDBA 5JR3A 4G7OF 2LBFA 5K5OA 2HKXA 3BG7A 3CUOA 3H3VK 4EATA 1U2WA 4A3GJ 5EF6A 2E7XA 3D5SC 3EUHC 2PMZA 2E5NA 2D5VA 5E3NA 2DFHA 1J2XA 4AYBN 2PFBA 2XSJC 2L4AA 1VQ5I 2PEXA 3RKXA 1LEAA 4MTEA 1ZG1A 4PSXA 2ZXJA 5LGUA 3F22A 1MH3A 1ONVA 2MC3A 3E7LA 2BBYA 1Y56A 4D5FA 1AU7A 1XCBA 2F5DA 2HZDA 2QBYB 4PUSA 1TLHB 1IN4A 1JUMA 4PGHA 4UHTA 1OMIA 4A3CJ 2LMDA 4HX4A 1P6RA 4HEA2 2QF7A 2VXDA 3K4LA 4G6QA 3FXKA 2RN7A 5DTDA 3G6EI 3JRGA 3JRCA 3MKWB 3L9FA 4OAYA 5DDGA 1IG7A 1YLFA 4LJZF 1FEXA 3C2HA 4MHGA 4WWCA 3BZCA 3KEQA 3HSFA 5D5WB 1SFOJ 1G4DA 3I64A 2A69F 2WAQN 4OIOF 1SMTA 1LE8B 5CVIA 3U2RA 4A0YA 5L3BA 1D5VA 1V5EA 1X3WB 5L3EA 3DLLF 1O7LA 2DI3A 1MH4A 1R1VA 4BDZA 5M5YJ 4M71A 4OIPF 4U87A 2KQRA 2R7VA 1UCRA 3LA2A 3DTIA 4Q48A 3HZJA 5L3CA 4Y52J 1TW2A 5HLTA 3JRFA 2M8GX 3L2RA 2ZJRF 1XGOA 2VKHA 4D0PA 4ZZDA 5F6FA 3J7AY 1XTAA 2P7CB 3OV8A 1IV8A 3P9KA 5J6XA 2Q1ZB 5LLQA 1BC7C 1D8KA 2DW4A 4H0EA 3O8GA 1MBEA 2UUZA 4HYEA 4OMZA 3D5LA 3MN2A 1FPQA 2HDCA 2VB6A 2ZJ2A 4QPOA 2JA2A 3WTWC 2EA4A 4A5NA 1QZEA 3ZQ7A 3BR3A 4A3FJ 4L0YB 2O03A 2VIXA 2CQ7A 3OYNA 5ILVA 2PN6A 1ZRFA 2Y0SN 1IN7A 2M4KA 3I71A 3UNGC 3PIPF 3ASOH 2X9DA 3CCEI 1R49A 3RI4A 1WJCA 2E2IJ 2XDVA 1AWCA 2GA1A 5IP9J 3CCQI 2V79A 1WFXA 3K4BA 3H3ZA 1EH8A 1UHWA 3K70D 2MC4A 3GVAA 4X0GA 2NOGA 5HDKA 3CUQA 1BL0A 1ZTRA 2V1XA 4XORA 5DCMB 5CYVA 1QPIA 2CV1A 4G7ZF 3MZ8A 2O6GE 1BBYA 4CCLA 1NK3P 1Q1VA 5FJ8J 3AG2H 3AKZA 3CC2I 3HG9A 4X1EA 2FNAA 2ISYA 2HOAA 4UVAA 3MMYB 2MLGA 3FZVA 4BQQA 1TC3C 3X2QH 3OYBA 2LLKA 1FJLA 4EM2A 2HQAA 4OU0A 2M5WA 3E97A 3LL7A 2NS0A 2L54A 1H88C 4C3HJ 1W7PA 3V7RA 3TMOA 3LQRA 1RRJA 3SZPA 3JW4A 4W1UA 2H27A 2MGQA 1ZRDA 2M34A 4XNFA 1YJNI 2E35A 3TDUC 1F4KA 4Z2YA 5K5QA 2H8WA 1I6HJ 1GV2A 3EDPA 1U8BA 3J7ZI 1RPWA 3SEQA 5DS9A 1FOKA 4UV8A 1BOBA 1U5TB 3NAUA 5E1XA 2WY7Q 1FIAA 2DT6A 2E1MB 4HNUA 3RCOA 4B09A 1G8XA 5BS6A 2LY1A 4HF2A 2EZKA 2WB1A 4EJVA 4ETSA 4KISA 4GFBA 1T38A 1XDUA 1XDSA 2R7QA 4RGUA 5BPDA 1JTYA 1LKXA 4IRIA 1VQMI 4IHSA 1UELB 3DKXA 3CQZJ 2LD5A 5KHDA 4I7HA 1AOYA 3S14J 2DOEA 1ZR2A 3KP7A 4CCJA 3ZMUA 4DNCA 5JVTA 5HS7A 1YRNB 2FX0A 5KAFC 3ZXSA 1PUEE 2NXNB 2CQKA 2BW3A 2VI6A 4IQ4A 4XN0A 5DV5A 2LF8A 1SFXA 3ISPA 4WXHA 1DGWY 3CLOA 5EG0A 2Y9YA 3F8FA 3HKZN 1ZGWA 3TQNA 2EINH 1WH5A 2O0YA 4CH7A 3LSHA 2KRFA 2I10A 1R6RA 2WWYA 2X6XA 2NVXJ 1YI2I 5KAIC 1ETOA 2Z99A 1E17A 2A3SA 2Z2SB 3VSKA 1HCRA 2DPUA 2COMA 4L9NA 1SD7A 3CZ6A 3IAS2 4FETA 4RM3A 2P6TA 4BE1A 2O9LA 1FTZA 4IQJA 3VYUB 1FIPA 3O2PE 3F8NA 1HKSA 1I3QJ 5AONA 2K27A 2MW8A 4AD9A 4Q47A 3ERMA 1L0OC 4MEXF 2WAEA 2DT5A 3QAHA 2A05A 1FX7A 4IHXA 3MKYB 2FOKA 2L7FP 1YITI 4PJMA 3R6SA 5FD6A 3I59A 3OL3A 4LITA 1IF1A 2D2WA 3HUGB 5LRSA 3ZCOA 1T0FC 1ZARA 3DEWA 3FK6A 4UUVA 3I55I 1K78B 2XPWA 3ZMTA 3DLAA 4ZTJA 3ABMH 4MQ9F 2K85A 1X1BA 1P2FA 1MNDA 3OIQA 3GLXA 5JFRA 3ZMDA 3CCMI 3G2BA 1X1DA 2EWNA 3T8TA 5LBQA 3B73A 4IPAA 2VPLA 1ORKA 3Q9VA 2Y69H 3BPVA 2LKPA 3OYIA 1GDTA 4UNOA 1TWFJ 1NHAA 1BR2A 3PUBA 4JOMA 3PFIA 1R71A 3TW6A 3A4CA 3CJNA 2QBYA 1O3SA 2V6EA 4C2TA 5LRRA 3PJRA 3FISA 4YIRX 4P9UA 3T1BA 3HDDA 2ZB9A 1TTYA 5ICCA 2ZFUA 1W7PD 2QYOA 3MVPA 4LG3A 1F5TA 4XRSG 5ILSA 1U5TC 3M9AA 2BY2A 1YIOA 1W4MA 2HYGD 5DCFA 3WODF 4CCOA 1DPUA 2E1MC 1IGNA 1Z3XA 1U78A 2VJ5A 5IT9K 2WY8Q 3LWFA 1TT5B 2CUZA 2XF5A 2GQQA 3RZDJ 2Z16A 3OOUA 1OYYA 4YELA 1A31A 2DFEA 2DA7A 1W1WE 2KKOA 1D1CA 2VBXA 2LBFB 2LKSA 5B3SH 1I39A 3JSOA 5IP7J 1AKHA 3RZOJ 4NQWA 2DMQA 2KPMA 1LUJB 4AIDA 2M8EA 2EV0A 2IGNA 4OOIA 3L7WA 1J7KA 3PSFA 5DD8A 3QPHA 4KICA 3B6CA 2ZXHA 4P96A 1B8IA 3LA3A 4M6VA 5D8KB 1WJAA 1G2HA 5D5XB 1Z9CA 3KP5A 3AG1H 1VNDA 3BQZA 4G12A 4BHCA 1MKMA 3DEUA 2IJLA 1H89C 5ERIA 2BOLA 1KQ0A 2HR3A 3DU5A 3J7AO 2I5UA 5E3OA 3BR1A 1HC8A 2VL8A 3BR5A 2PJPA 3TP3A 4CZCA 3FHZA 2PMUA 4J01A 3M8EA 3F8CA 3TKYA 5TRDA 1LNWA 2A6EF 3EYYA 5IYBJ 3E6BA 4ZDLA 2HYJA 5FROA 2CW8A 5HLHA 4PJJA 1Z6TA 1KYWA 1XSXA 3B6AA 3TDZC 3Q0WA 3TO9A 4XLHA 1WPKA 3BCBA 4NHJA 4HX7A 1UG0A 4E4HA 1APLC 3F9KA 2VJ4A 4EJOA 1HXDA 3U1DA 2BHYA 2JUGA 4IJAA 5EEHA 5B1BH 3I58A 2K4BA 3OS1A 4IRHA 2O5RA 1JI8A 3TO7A 2M0MA 4WK8F 1MIJA 3RKWA 3GFJA 3FXQA 4RGSA 4A3IJ 1BOAA 5EEAA 2ME6A 5BOXA 3SDGA 3JRIA 2MBFA 3JAMZ 2W24A 3W2WA 4BQAA 2IPQX 2XV4S 1X1PA 1G6NA 2IGMA 2UZKA 2VLAA 1DP3A 2ZSIB 3KP3A 3KEOA 1BW6A 3KX2A 3DPLC 4PFPA 5IPAA 2RNGA 3EUAA 2STWA 1TWGJ 4CYDA 4P9FA 2JJ7A 3EQLF 4ENNA 1G3TA 1Z6RA 4F92B 1XCVA 1WI3A 2GXGA 1FSEA 3U21A 4HQMA 2PQ8A 3K70C 5CJ9A 2ISZA 2P7VB 2Z3YA 2X6WA 2XAJA 3NWTA 4LK0F 1S5LC 3HC7A 2FNPA 1SFUA 2W82A 2DA6A 4EGYA 1SD5A 1H8AC 2OCEA 1OQYA 2ICWG 5F0CA 2GWRA 4RGRA 1IUYA 2LFBA 4IXAA 3OR1C 2LYCA 5H6RA 1FY7A 3SXYA 3VYTB 3CUQB 2V26A 2M45A 2RQQA 1XGMA 5FKNA 5FRMA 1KU3A 3H0GJ 4BH9A 1FBUA 4ENKA 1VQKI 3PSIA 4A3MJ 4I09A 3FMSA 1YYVA 3V4GA 1FOXA 2OQRA 2VN2A 2L9VA 1IC8A 5D4RA 3WTXC 1Z91A 2HWVA 4BGDA 3BCAA 4BUPA 3CJRB 2FJ1A 1S7OA 3BZKA 3REOA 4G6TB 3LMMA 1B4AA 2N8GA 2OV7A 1BR1A 4QIWN 1KU7A 1FOWA 4RS8A 3HL2A 3HPGA 4CZZA 5LGTA 1MSFC 2QVOA 5J8CA 1B1BA 1F43A 1W7PB 2HDWA 4I6ZA 3GW2A 4D5CA 4KN7X 1FP2A 1G59A 2C6YA 2MFZA 2JRTA 4FTHA 1OISA 4A93J 1EV7A 1BR4A 1IXSB 2V7FA 3ZOBA 4HV6A 4NBQA 1MDMA 2HZTA 2DMUA 4ESJA 3I5UA 2DK8A 1YE9A 4JYKA 3VYSB 1EA3A 3FMQA 3VYRB 2V9KA 5CLSA 1YJWI 2I8DA 2DO7A 2XGXA 2W1OA 5ILUA 2HKOA 4PK4A 3DTKA 1UHMA 3OL4A 3CLQA 3E3VA 1ZN2A 4M74A 4R79A 3CCSI 2XRNA 2QM3A 4ENMA 5FFZA 1MNMC 1REPC 3PNYA 4GYIA 2GAUA 5F64A 2H6BA 5IYDJ 1FP1D 2YUSA 4RLQA 3GTGJ 2DMTA 3M3YJ 4F55A 4RB0A 1XX5A 2Y75A 4E6KG 3E5QA 3K4KA 2K7LA 1HF0A 1NTCA 3W6KB 2Y0MA 2DBBA 3PM1A 4CDGA 2V6CA 2BW3B 2LY9A 3LSPA 4BJ6C 5LHHA 4LGWA 3MWMA 3HRUA 5M5XJ 5HNFA 2EA2A 2KIMA 1KU2A 5EG0B 2MH2A 3OS0A 4ZC3A 3UR3C 4MFDA 1FWZA 4M9SA 1K61A 2EIKH 5HS8A 1RI7A 2NRAC 2FF4A 4KUMA 5EJCA 3G71I 1RIOH 1GT0C 4KNYA 4PCQA 2VUMJ 2HOSA 4G9YA 1IRZA 4BXFA 2B7EA 3BG6A 4TV7A 3JRHA 3QWLA 3BJAA 2O3FA 1T6SA 5J4VA 2LSOA 3WTUC 2XASA 1R7JA 2CG4A 2L9SA 2JPBA 2XF6A 4M73A 1AA7A 1ACIA 3PQKA 3PUFA 2VC1A 3ZR8X 2NNNA 2CMPA 1HQCA 1ZK8A 2Y2ZA 2W85A 3CUQC 3J80Z 3SZTA 1ZAOA 3ASNH 3CD6I 4ZYHA 3I59B 5HVQC 1T2KA 3NQOA 3OYDA 1HLVA 1HDPA 3M8JA 2UV1A 1LFBA 1WSUA 3ZPLA 2QLZA 1RNLA 3ZQIA 1FSHA 2X85A 3K6GA 4KN4X 4C9YA 2AS5F 1IN5A 1ETWA 5DYMA 2QKLB 2P81A 2AXLA 2X48A 3BC8A 1IO2A 1V3FA 3K4MA 1Z0XA 1OJLA 2QKMB 3CP8A 2JZYA 2ELHA 1E3OC 1X1AA 1IAWA 4D1QA 1MW7A 1TNSA 3AFHA 1D1AA 2EZHA 4XKCA 4MGRA 3ZMVA 3GTPJ 3DKWA 3H0DA 1I1GA 2MD0A 3OYEA 4C2UA 4ZJZA 3S1NJ 4FE7A 3QPSA 2XF7A 4AC0A 3S3MA 3ROUA 1Y39A 3S1RJ 4N9IA 4CCKA 1JHFA 2VT3A 2X6OA 3OIPA 2RAEA 1YHQI 2A6TA 4HW0A 2E2JJ 5JI6A 3COAC 2GLOA 5F1JA 2HPMA 1F36A 1T95A 3LSGA 1X3ZB 3MAJA 4BE2A 3C7JA 1K6YA 1R23A 2LC2A 4OIQF 2ETHA 3RYPA 1J09A 4LIUA 3IKTA 1AKHB 4L0ZB 1LQ1A 3TOAA 2XC7A 4NQWB 1WI9A 2JVGA 4XM3A 4BU2A 4G6DA 1ETQA 2COBA 2V1NA 4AVZA 3BROA 2IBDA 3OS2A 2RDPA 5L3GA 2ESHA 2BY3A 2VC0A 3KYDB 1B8IB 3QPTA 2GIZA 2PG4A 3H9QA 3LSTA 4HOBA 1MBFA 2KJCA 3G4SI 2CQQA 4WXDA 4Y3OA 1QVUA 1GLNA 3TO6A 5HDGA 4KYWA 1WCMJ 4HNTA 1YOVB 3D0SA 5H2FC 3ECOA 1ZR4A 3A0HC 2VE8A 5J40A 3MFKA 3PIOF 2LG4A 3V7CA 3WG7H 5M3FJ 3E5XA 4C2MJ 2BZTA 3BY6A 2EIMH 4K2EA 4BNCA 1P4XA 3GZ5A 4XRSA 3F6VA 2DK5A 1X1CA 1ETXA 2AQFA 3HJEA 3VFZA 5GAGJ 2FBHA 2R7FA 5IOZA 1U6GA 2JSPA 2LTPA 3VEPA 2EV5A 4BXUA 1QHGA 3Q3SA 3AG3H 3K2ZA 2OF7A 4XLNF 5DM6F 2PX9A 4Q5SF 3OWTA 3G1OA 1YX3A 4ZYGA 5EDNA 4XOPA 3OR2C 1UFMA 5FD5A 1U0JA 2G7UA 4P1WA 2NVTJ 2D45A 1AHDP 2OUMA 5BMZA 5D4SA 5K1YA 2VQLA 5JLXA 4EM1A 1J75A 2VBZA 1Z05A 2AHQA 4CA0A 2X6YA 4WXCA 4I0AA 4H4KC 2Z1DA 2DTZA 1S3JA 3HHHA 1PYVA 3MEXA 3SEZA 3HSEA 3C2BA 5JHUA 3KLNA 4BKXA 4XKWA 1R00A 2L0KA 4B48A 1T56A 4HZFA 5EEGA 4P5OA 3V8JA 4XONA 4S0HB 1SMYF 2QUFA 3K1MA 4MQVA 3FK7A 2HOTA 2GOXB 1ZH5A 1I1SA 3KFWX 4M3GA 1GXPA 2EILH 3IH3A 4UVCA 4YFXF 2W4SA 5K5RA 1JTXA 3KZZA 1ZGJA 2O61A 3LQQA 1KQ8A 2R93J 1T98A 2BXZA 2NS7A 4YIIA 2E2HJ 1X4OA 2DPDA 4XLFA 5D5VB 3J7YJ 1G3YA 4U0YA 3K4CA 4I0BA 4BYYA 2R0QC 3BWGA 2LVSA 3KIOA 3F0CA 1N25A 3KYLA 2DT7B 1L3LA 2FOWA 3RYRA 1QRYA 3A03A 2CQNA 4RB1A 2XROA 1D5YA 3HRTA 4KJZA 3L2UA 1QNTA 3VB2A 4UY8I 3IRRA 2L9NA 2R7XA 1TW3A 3ZN1A 4M6YA 1TZLA 2CUJA 4F93B 4I76A 1XPXA 4XIDA 1VFCA 1MMDA 2JA8J 4HF1A 4RB3C 4N4OB 3RIRA 4E7LA 3S2DJ 1RZ4A 2P5KA 3JRDA 4CICA 3GXOA 1Z67A 2L02A 3JAMK 2H8RA 4BQOA 3KCCA 3DKYA 4DGWB 3L1PA 2ZXIA 2Y9ZA 1HW1A 2BYVE 4YFNF 1SEUA 1USTA 4QWQA 3CESA 5C4XJ 4D9JA 3H36A 3T8RA 4UV9A 3WGIA 1SC7A 2M7AA 3GFIA 1ZQ3P 2QSFX 1DP7P 4PSWA 2EZIA 1V5FA 2EV6A 1KA8A 5J47A 3GWZA 1MBKA 4HDUA 2DN0A 1RKTA 1OKRA 1XC5A 2G7HA 4G94A 1JJ8C 3BP8A 2E71A 1QO0D 3S8PA 5EGOA 1W36D 3PL8A 3ABKH 4EM0B 5HOOA 2Y31A 5H20A 3HM5A 3GLLA 1FC3A 4IHTA 4IHWA 2LRDA 1JKPC 3BR2A 1PVEA 4G8XA 3VDXA 4ITVA 1K7AA 2XPUA 3GX4X 2JPCA 1D0YA 5F0HA 4YG2F 4E7KA 1OCZH 2DDAA 3BTLA 3I4MJ 1IUFA 2HXOA 2K9QA 2LR8A 2TDXA 2X0LA 3OY9A 2R7ZJ 3KETA 1D0XA 2LDUA 1SD6A 3MZHA 5ED4A 3HTSB 3P7NA 2R7DA 3IL2A 1MDMB 2XKPA 5CVVA 1T8IA 9ANTA 2JA6J 4DQ2A 1JKOC 1ULYA 2AXTC 3GFMA 1SFKA 4KMUX 4HLXA 5FKOA 2PMZN 3HOWJ 2B63J 2EPFA 2F4MB 2L3DA 2FMYA 3RDIA 2RNJA 3O8HA 1Y8RB 1B72A 2W57A 1QZZA 1TWCJ 3C2GA 1YW8A 3V8KA 2VE9A 2HOEA 3ABLH 1Y0UA 1ETYA 4XSXF 3GUDA 2DDBA 1ZLJA 1VQ7I 2QQ9A 1KQ9A 3A02A 1WGXA 2F6CA 1LPQA 4BAYA 2XAUA 3F72A 2CH0A 3FM5A 3RPUD 3M1CA 3VOEA 2DYSH 3L2CA 3K4NA 1W5CC 5ICEA 2L9RA 3WU1B 1YQAA 4RA2A 3QRFF 4NNJA 4E7HA 1YFHA 1YW7A 2ESNA 1Z1DA 3QPLA 5GPAA 1KONA 3ML6A 3KZIC 3GTQJ 3HOVJ 2X4HA 3RKYA 2HI3A 5LGNA 4EJTA 2L7ZA 3QODA 4HQEA 1JGGA 1BA5A 4GRIA 2JQ7A 2PBIA 4AUXA 1VF9A 4J19A 1Y8QB 4OAZA 4B3XA 3CF2A 3DU6A 1ZELA 1O3TA 3DP7A 4HG2A 1JE8A 1X4PA 4OWRB 1WJBA 1W5SA 4I99C 5TJJA 3CMAI 2L01A 1N77A 4EV0A 2VKVA 2DA2A 3I53A 4M72A 1SAXA 3OIOA 3TBIA 1WKMA 2FEZA 2FU4A 2WV1A 5E8GA 1RUOA 2FQ3A 3FWEA 3A01A 3G73A 1ZG5A 2QQBA 4ESFA 1VQ6I 2M30A 4L9VA 1ENHA 2KZVA 5E79C 2YS9A 1OR7A 4NC6A 5FLVA 5LEKA 1E3PA 2YSRA 4KIGA 2R5ZA 5E17F 3K9TA 2LREA 3MQ0A 3F8MA 3I4PA 4A5MA 3S15J 5A2QK 2OZUA 4LOCA 1U9OA 2XGCA 4BEHA 3WTZA 2L2OA 2MABA 2KRHA 1K6OA 3MD2A 3O6BB 3BDDA 1QQIA 4P55A 2JT1A 4F7ZA 5B1AH 3W6VA 1SD4A 1JUSA 2IGKA 1Y6IA 1O57A 4DJAA 1CGPA 3MKZA 3DF8A 1YS7A 1P92A 4BHBA 1OYIA 5DUIA 3CC4I 2W84A 4GO1A 2ZNZA 1ON1A 4HRIA 1KGSA 3S32A 2B0LA 3J80K 1FBQA 4WX9A 1PP7U 2D1HA 1VQOI 2JTVA 4CYCA 1VQ9I 3FXUA 2MG4A 3LSIA 4QPQA 3VODA 3EETA 5F27A 5L3FA 3HSRA 3V7SA 1SVOA 2MLKA 1DQUA 4XLEA 3BR0A 2AQEA 1O7FA 3S17J 3DCFA 1A35A 3CO6C 1FT9A 4CCMA 5TISC 1HKTA 2K5CA 4AWXB 3WHBA 2DCEA 4M6XA 3WGHA 1T39A 2P5LC 2DQLA 2KL4A 3LNQA 2K9MA 3CCUI 4ZYEA 2ADUA 3DFGA 1LEBA 4A3EJ 1VI0A 3H92A 5K7FA 4ZYAA 2JVHA 3S3OA 3HXLA 3HOUJ 5FO5A 2CWEA 5CPRB 4DBQA 2IA0A 5FKLA 3EYIA 3BG9A 1S6LA 2E34A 2EJRA 2QA4I 1TP4A 1HW2A 3ZRGA 2IP2A 4UVBA 3T5XA 2O7OA 1MJBA 2PMHA 2R4GA 2AO9A 4ZDPA 3EPZA 4IRGA 3WTVC 4LLNA 1S72I 1I50J 3HYIA 5FFXA 3GMEA 4NC8A 1E0EA 4AYBA 2PJRA 2R3SA 3I54A 1K4SA 2OU2A 2K3PA 1WJFA 3ZQCA 1ON2A 5FKKA 1TNTA 2XVCA 2E7WA 3QQAA 2VXZA 3R61A 2DMPA 4HF0A 1NK2P 3QYEA 2WB1N 1QHHD 5IT3A 4LLLA 4KDPA 2XB5A 2ZC2A 5M5WJ 1ZHFA 2KJBA 4XQFA 3FXOA 5GPCA 1MGTA 4BS9A 4FX4A 3LSRA 3F23A 1PUFA 2M4GA 2DQRA 4XRMA 4BJ5C 2OA4A 4ZDOA 3CDLA 5C3EJ 4CO8A 1O3RA 4HDVA 2VASA 3WE3A 1X2NA 2W25A 5HNHA 2V1DA 3O3KA 1A5JA 3HHGA 3CCJI 4AU7A 2DAOA 1WJEA 3L00A 2A07F 1MZBA 3ZMZA 2EQRA 3OSFA 4E7IA 1DDNA 4DBRA 1BI2A 3FKJA 2CS3A 2WAQA 2QEXI 3GFLA 1Z3YA 1BC8C 5HODA 1RC9A 2NNYA 2E60A 2WADA 4QSHA 2MSYA 2RC4A 3M8FA 3BTCA 1X2MA 3RPQA 2ZNYA 2KIUA 3F6OA 1IDYA 1V54H 1IV6A 2CQXA 1MMAA 3JR9A 1XN7A 5D8LB 2BGCA 1WH7A 3E0JB 4MFEA 1VQNI 2DTRA 4CCNA 2GIVA 5BNGA 2HFHA 4WCGA 2Q2EB 1EH6A 2CRGA 1I5ZA 2ECCA 1IRXA 3SFZA 4F3QA 4AIHA 1U3EM 4U7DA 1BJZA 1LDDA 2IAIA 4PZJA 3FXJA 1VQ8I 3A2KA 4YIFA 3HBLA 1D1BA 2OD5A 5E8IA 3B02A 2H09A 3OMYA 3M07A 4L18B 3DWLE 3MKLA 4HLYA 3VSLA 1OFCX 2KIFA 1OCPA 5HDNA 4DYRA 1R5ID 4ZH4F 1E2XA 1T08B 2CUEA 3HGGA 1YIJI 2K4JA 2J5PA 3RQIA 5E3LA 1FMWA 3GTOJ 1SFEA 1MJAA 2F2EA 2HU9A 1GVJA 3LFKA 1OPCA 4B8XA 2IGOA 2F48A 4II2A 1TT0A 1IRFA 4DYQA 2J5OA 3FF5A 2HVQA 2OBPA 3H1CA 4FCYA 3S1QJ 1SAUA 2VBYA 2PLYA 2QQAA 5M3MJ 2NVYJ 2HTSA 2QGUA 1IRGA 5F08A 3RKQA 5IOYA 1W36C 2P8TA 4IEJA 1UB9A 4B3AA 2F5VA 4DW6A 3FX3A 3LSJA 4RMNA 2XRLA 5E20A 1O4XA 1HW5A 1HKQA 1KZHA 1I27A 2M1BA 1K83J 2CO5A 4RAZA 5EGOB 2EFQA 4XKBA 4II3A 4EQQA 4EJWA 2VBWA 3N97A 5GTHC 1IDZA 2RGVA 3GTMJ 1XMKA 2K9LA 4BACA 3ZMSA 1FYMA 3WG9A 4OMYA 3GTLJ 5FKMA 3CO7C 1R5HA 2X1CA 4XMYA 2R5YA 3E6DA 3FM3A 3IP4B 4DOZA 1CF7B 1XB4A 3QOPA 4UUTA 1FOYA 5A2QZ 3FKIJ 4BQNA 3OYHA 3QP6A 2MYSA 3AG4H 2WBMA 1F1ZA 4Y33A 2OC6A 3IV5A 1OLTA 4M3BA 4FT8A 3PNVA 1PP8F 1HBXG 3M1EA 3GZNB 3KZYA 3ABUA 4IF4A 5EZHA 5HS9A 4HNVA 2EFWA 1IJWC 1LVAA 3EUKL 1B72B 4XOTA 1BI3A 3H9JA 4JP0A 1GXQA 5J1UA 2FXAA 3IH2A 2VONA 2WC2A 6PAXA 3ZP5A 2VQCA 4GGGA 5CVJA 2DOAA 2VOPA 2XIGA 2BEOA 3ELKA 4E7JA 1QA6A 1VQPI 2E36A 1JHHA 3M7GA 5GAHJ 4EJUA 2KZGA 2CUFA 4UB8C 5F0FA 2KDZA 1LVKA 2CJJA 1MMSA 1UZCA 2ZO4A 4PJNA 3ZGKA 1IW7F 2VPRA 1GVDA 4IHYA 2RKHA 1JGSA 1PJRA 4E7ZA 4FASD 3CC7I 3E1SA 1OCOH 3BLYA 1VQ4I 3S16J 2VQGA 2A5YB 3L09A 4JX6A 3HKZA 4KA4A 4Y7NJ 3SQNA 4XSZF 2IXSA 1BI1A 2KP6A 2Z5UA 1NH3A 1JKRC 3CP2A 4PFOA 1UJ8A 3IC7A 1W5TA 1VTNC 5K7ZA 3G1LA 3WU2C 4I01A 5J3LA 4IKFA 5CVRA 5GTIC 2FE3A 3KEYA 3AAFA 2DMNA 4XKVA 1RKWA 4A0XA 2BY0A 2WAFA 1DU0A 1WVRA 1YS6A 2FQ4A 3A01B 2CV0A 1ZRCA 2GOMA 5L3DA 1MMNA 2QSGX 4UUSA 3G1MA 1B6AA 3C18A 2E1OA 1TQMA 1X19A 5E1WA 1O3QA 1J59A 5EZGA 4XLCA 2FUG2 1BM9A 2R5ZB 5B66C 2O8KA 2HTJA 2XUBA 2NAZA 2LNBA 3TP0A 2FRHA 4IOCF 2V9PA 2XGDA 2E1CA 2DA5A 3V8LA 2A5WA 4BHPA 4E7SA 2X1EA 1X3UA 2EIJH 2XB0X 3H5AA 4BY7J 1HSTA 4BEHB 4M9XA 4AIJA 2KDOA 2B9SA 4AIKA 2XAHA 4A2UA 3W3CA 1UG2A 2UWMA 1QU3A 4RAYA 3S2WA 3CCLI 2JK3A 4EGZA 1MD0A 4FQGA 3L2WA 2KIQA 3DBRB 5FLXZ 2JRMA 1MBJA 1R4MB 1SANA 3GCMA 5FLMJ 2KRCA 4IVNA 4R1HA 2ZKZA 2LOOA 1ZGAA 3BTIA 3HIFA 4MEYF 3HGYA 5HLIA 2OZ6A 1IZ1A 3OYJA 2YU3A 4CYCB 3QU6A 3E6MA 3CF5F 2IVMA 5ICFA 1NG6A 3CDHA 2EK5A 1B9NA 1A6IA 3L2VA 3VWBA 3FHNA 4NDLA 4A3LJ 1MSEC 3CJQB 2ZMEB 1ZREA 3G3ZA 2A6HF 4IOAF 5E1ZB 2PI0A 3JRBA 1PDNC 3HRMA 1R9TJ 3CMYA 5KVRA 3BT9A 3R4KA 3W6JB 3LSKA 1Z7UA 3WTTC 4I98B 4LLGF 1FYLA 3FXRA 1JUPA 3IHUA 1ZYRF 3BJOA 4HV5A 4HAMA 4KT5C 2NVUB 5DM7F 2F4OB 3S93A 2QENA 2QZ8A 4HA8A 1JT6A 3P9IA 1OCRH 3CCVI 1EH7A 1YJ9I 2DA4A 2XAGA 4XICA 3GYHX 3HOZJ 2VODA 2CW0F 3RPUA 5EYRA 3VPRA 3K1NA 3NARA 5HLGA 3HB9A 3CCYA 4GDFA 2IA2A 1S8NA 3W2AA 1TQIA 2YX4A 3PO3J 4GXOA 4XRFA 3OYCA 3J81Z 4ZTFA 5LHGA 2H1LA 2OTJI 2PJRB 2WV0A 4CXFA 5KK1A 3RTRA 2Q2EA 1YTYA 2IT0A 4L5JA 2ZSHB 2K3FA 4U7BA 3LAJA 1TQPA 2ELKA 2L4MA 4WF2A 4ABZA 4NUBA 2ID6A 3K2AA 2JA5J 4RGXA 2KHMA 4M9ZA 2CU7A 1XSDA 4CUGA 1PUFB 5LD2C 4B1RA 4RAGA 2HEOA 4I2OA 1QPMA 4CSWA 1UMQA 1G3WA 4KIBA 1JXSA 1P9QC 3NRVA 3T0YA 5CKTA 2FD5A 3DBLB 3HOXJ 3QU3A 3KP6A 2F5FA 1FLIA 2HQ5A 4KT6A 1OR7C 2R7RA 2BVLA 3UKGA 3EUHA 1DU6A 3OYFA 1B59A 2W00A 4LG0A 2VKEA 2FA5A 1JKQC 5FB2A 4JQFA 4LFUA 4F91B 2M0CA 2JMWA 3K10A 4C3JJ 4A0ZA 4F52A 1GUUA 2CW7A 3DXJF 5D6FA 2DLLA 2G0EA 2ZCWA 4EVIA 2P5VA 2CGPA 5FRNA 1P7IA 2QCOA 3U1KA 4BXXJ 3BG3A 3H3UA 4DYCA 1WQ2A 1EF4A 4A3BJ 4ENJA 1RR7A 2IS4A 4NB5A 3WU0A 3ESWB 3K7AJ 3H5RA 2OAZA 2K86A 4XN3A 2GXBA 1OYWA 4YFKF 5ICGA 1U8RA 4I02A 2OCCH 4IX7A 2OJED 4RB2C 1MBGA 2HXIA 2CV2A 3SJMA 3WTYC 3ECHA 3TW7A 4RAFA 2L7MP 3L2QA 3WHCA 2K40A 1DUXC 4ANJA 1UHSA 2BV6A 5BQTA 4BY1J 2ZMEC 4W97A 4V2FA 4HX8A 1CF7A 1STZA 3OSGA 1Y0NA 3BR6A 2OQGA 2NOJB 2CYYA 2DA1A 3WTSC 1R58A 2YR2A 4V19K 4ON0A 1LB2A 1I3AA 3K4JA 1U9NA 4KMFA 2LF7A 5CQGA 3OYAA 4XLPF 4C3IJ 1ZLKA 1A36A 1LFPA 4DIQA 2E5ZA 2EFNA 3ERED 2UXNA 2XGEA 4A69C 4A3DJ 2YPRA 4A3JJ 2O8XA 1KU9A 3IWFA 1IN6A 2STTA 4X6AJ 1X58A 4U0VA 4A12A 1F9NA 3K69A 2BY1A 4MNUA 4N4NB 1D0ZA 5IP6A 2Q8KA 1NG7A 4LD5A 3FIWA 2OPTA 3A1YA 2V9VA 5KNLA 4EMSA 4KITB 2DODA 1Q1HA 3JTGA 4GCVA 4BDYA 2HYFA 3F8BA 2JN6A 4BL0B 3BG5A 3E6CC 2GXAA 2LY2A 1IN8A 3A0BC 1MMGA 3OYLA 1KYZA 3D5RC 4LIVA 4B47A 3WE2A 3JCUC 2G9WA 2XHKA 3BTJA 3E5UA 2ZXWH 3BQYA 4B44A 2JUCA 2K02A 4D7MA 2R5YB 4BE0A 1VQLI 2RVCA 4LB6B 2HVSA 2EB7A 1N75A 3FXLA 1P7JA 1ZKGA 5KCMA 3I56I 5AIQA 1CQTA 2DFFA 1WRJA 4LMYA 2ZFWA 3CCRI 3HRSA 2UXXA 1YO5C 4XR6A 3ZQFA 1QGPA 1BN5A 4BJTA 1ETVA 2GZWA 1Y1WJ 1HSJA 5B5EC 2LK2A 3TL4X 3QOEA 1D3YA 3SFIA 3S3NA 1K79A 2NVQJ 3CJTB 1R1TA 4Y17A 3HTUA 3F3XA 2GBYA 3JREA 3Q9SA 2VOOA 2H94A 2L7KA 2F4IA 1HA8A 2ME0A 2P4WA 2R7TA 1RETA 4QTRA 3D1NI 4B43A 1ODDA 1YW9A 1S29A 2CFOA 2ECBA 4BBRJ 3HOSA 1P4AA 4KFCA 4G7HF 3JSPA 4N9HA 1YX5A 2XKOA 2GM4A 3KP2A 4N0BA 2LH9A 4RDUA 5DEQA 2IS1A 4MTDA 5GAEJ 2ZBKA 3RJPA 2RREA 2DFIA 1DGRM 1DPRA 1TBXA 3F21A 1BIAA 1W0TA 3I4NJ 3R60A 4NC7A 2M9HA 5IY5H 4FHTA 2NYXA 3SHFA 3OYMA 1Y1VJ 2RQPA 5C44J 1OCCH 1LE8A 3PFYA 3IH4A 4U0WA 2YU9J 3GO5A 1J0RA 4L5IA 5TGTA 4E70A 1GV5A 2DJNA 5JVGF 2K9NA 4OINF 4IL6C 4JBAA 2WA0A 1S7EA 3V42A 2ZMEA 2ELJA 3H9GA 1V4RA 2KT0A 3LSMA 4UUSB 3I0TA 4PGGA 3QP5A 1XMXA 4RLFA 4A6EA 1Z77A 3TOBA 2QWWA 2QQ8A 3ZQQA 1OCTC 4Y13A 4S05A 5C4JJ 2P0WA 3BPXA 2X51A 3CDIA 2TCTA 1LDJA 2HVRA 2Z9OA 2NS8A 1BI0A 1XGSA 2GA2A 4D7NA 3IWZA 4EEFG 3HOTA 4QLCU 5J1YA 1WHUA 3ONQA 4CGZA 1IXCA 3MZYA 3CMMA 2LP0A 2FBIA 5E18F 3C1DA 4KIFA 4BBSJ 1H9GA 2EFPA 2EH3A 1T33A 3H35A 5E3MA 1MNEA 3S1MJ 5D5UB 1C0WA 3KLOA 2IS2A 1D8JA 2Y48A 2CFXA 4XK4A 4IHVA 3FDYA 3TEDA 3AL0B 4IO9F 3JTHA 4Q4ZF 4JX4A 2KFDA 5F1RA 1TWHJ 2IW5A 2QSHX 4B4CA 3FMRA 4Y15A 1RUNA 1ERDA 4M3EA 1R1UA 3ABTA 3ZQGA 2LKXA 5DCMA 2H1KA 3JRAA 1QZYA 4JX5A 3OOPA 4HSTA 1ZG3A 2R7UA 3N4MA 1TWAJ 1T0FA 1XMAA 2DYRH 2CSOA 2V1UA 3I3LA 4YEJA 4ASNA 3PNTA 5FLXK 1S9HA 1I6XA 3ULQB 5D6EA 3I9V2 4M3FA 1FTTA 1XSVA 2DA3A 3GEZA 4ZYDA 1XGNA 3DV8A 2IRFG 2ACJA 4LK1F 1Z21A 2R7SA 2Z33A 2R92J 2VJJA 3HEFA 1XD7A 2V4JC 3DQVC 5J4YA 1FZPB 2JA7J 3HPHA 3GTKJ 2IA1A 3TGNA 1POGA 2YX7A 2MH9A 2R7OA 4FISA 1LFUP 4CHUA 4FE4A 3ZN0A 4A6DA 1HOMA 4XBFA 2K9SA 3CMEI 1Z7LA 2F5EA 3H5NA 3DPUA 5DD4A 2E1NA 2BHZA 3P9CA 2M87A 4XLAA 4O3MA 1FBSA 1U5TA 1LDKB 4FX0A 5JLWA 3NEUA 5H6QA 5CVUA 1N78A 2IEKA 2FMLA 3QYFA 1USSA 2HDDA 1GHCA 4O5VA 1H9TA 5LEJA 3BJ6A 5CQEA 1RR8C 4RBOA 2R7WA 4HSRA 3GF2A 3QYBA 3LAPA 1S7AA 1ETKA 3KYCB 4LB5A 4RM2A 2DOFA 1A04A 1E3HA 3SYTA 1IXRC 3J81K 2HQRA 3FBIB 4PJLA 4AVPA 1FYKA 2RV8A 2Y0SA 5GADJ 1FNNA 4OIRF 1VZ0A 2L5QA 2BXYA 1W0UA 1YRNA 3MCZA 4HBLA 4U88A 2MA3A 4O6JA 3GTJJ 4LG0B 1BIBA 2VKDA 3W2VA 1JT0A 1V5GA 2KLOA 1H0MA 1XG1A 3K0LA 2MD5A 1ITYA 1WWXA 3LA7A 2HNHA 5JHFA 5K7HA 3Q0UA 4J00A 3KE2A 2DJIA 2XAFA 2M2EA 4JK1X 4MIMA 2EZLA 1J5YA 1RESA 4C30A 4GYGA 4Z6YA 2A61A 3DPTA 4ESBA 5LFAA 1QBJA 3N05A 2OTLI 2Y30A 3IAM2 4M3DA 2XPVA 2XSDC 3R0JA 3S2HJ 4DZPA 1R22A 3DEEA 2BVMA 2M7BA 4A3KJ 4UXNA 2VQHA 3HOYJ 2ZJPF 2A68F 2JSCA 1YG2A 2E19A 3CTAA 4L9JA 3U9GA 3PQJA 3ZQHA 2ZJQF 2DXIA 2VJIA 3AL0C 1BJAA 2M3AA 1WJDA 2W7NA 2XAQA 1EKEA 3RQ4A
chains in the Genus database with same CATH topology
9ANTA 2HYJA 1A6IA 2JWTA 2JA6J 4NDLA 5IYCJ 1JKOC 4A3LJ 4L5EA 1MSEC 3B6AA 3LOCA 3Q0WA 5FKOA 2PMZN 1WPKA 3HOWJ 2B63J 3JRBA 1R9TJ 1APLC 3CMYA 3BT9A 3O8HA 5F04A 1B72A 2EBIA 1TWCJ 4DZJA 1HDDC 1JUPA 3Q0VA 4MO7A 1MBHA 1JT6A 5J1RA 5GP9A 1ETYA 4A3IJ 2DA4A 4XICA 5EEAA 3A02A 2ME6A 1WGXA 3HOZJ 5EYRA 3SDGA 3VPRA 3JRIA 3NARA 3HB9A 3CCYA 2L9RA 3PO3J 1XS9A 3ZQLA 3PO2J 2ID3A 1BW6A 5IPAA 3QPLA 5GPAA 1TWGJ 3GBGA 1BW5A 1QVTA 3GTQJ 3HOVJ 3M4OJ 2JJ7A 2HI3A 1JJ6C 2L7ZA 2W48A 1JGGA 1BA5A 1WI3A 4MLOA 4AUXA 1VF9A 4J19A 4V2GA 2ELKA 2TRTA 4ABZA 2ID6A 2VKVA 2DA2A 3K2AA 3OIOA 2JA5J 2DA6A 2CU7A 1H8AC 2WV1A 1PUFB 4B1RA 5F0CA 3A01A 1UMQA 2LFBA 1ENHA 2FD5A 3HOXJ 2YS9A 5FLVA 2HQ5A 5FKNA 3H3VK 2R5ZA 3H0GJ 3UKGA 4A3GJ 1DU6A 4A3MJ 5EF6A 3S15J 2VKEA 1IC8A 1JKQC 2D5VA 5E3NA 4LOCA 4AYBN 2FJ1A 2M0CA 1U9OA 2JMWA 2XGCA 4C3JJ 1MH3A 2N8GA 1GUUA 4QIWN 3E7LA 1AU7A 3W6VA 4D5FA 1JUSA 2G0EA 1MSFC 1P7IA 2QCOA 1JUMA 4BXXJ 1F43A 3BG3A 4DYCA 4A3CJ 4I6ZA 1EF4A 4A3BJ 2QF7A 1RR7A 4D5CA 3K7AJ 5DTDA 4FTHA 4A93J 3JRGA 3JRCA 4CYCA 3ZOBA 1IG7A 2MG4A 5F27A 2DMUA 1FEXA 1MBGA 2HXIA 3SJMA 3TW7A 4JYKA 2L7MP 3BR0A 3S17J 3DCFA 3WHCA 2K40A 1SFOJ 1UHSA 4BY1J 2WAQN 4W97A 4V2FA 3WHBA 3OSGA 1LE8B 3BR6A 2DA1A 3LNQA 1MH4A 4A3EJ 5M5YJ 1VI0A 1MNMC 5K7FA 1U9NA 3HOUJ 4C3IJ 5IYDJ 2YUSA 5FKLA 2DMTA 3GTGJ 3BG9A 4Y52J 3JRFA 2M8GX 2XGEA 3M3YJ 4A69C 4A3DJ 4A3JJ 1HF0A 1NTCA 4X6AJ 3PM1A 1X58A 2O7OA 2LY9A 3LSPA 2AO9A 1MBEA 3O8GA 5IP6A 5M5XJ 5EG0B 3FIWA 2OPTA 1I50J 3MN2A 4MFDA 1K61A 3ZQCA 2JN6A 1GT0C 3BR3A 3BG5A 5FKKA 4A3FJ 3QQAA 2DMPA 2VUMJ 1NK2P 2Y0SN 2HOSA 2WB1N 1IRZA 2XB5A 3JRHA 3BTJA 2X9DA 5M5WJ 3BQYA 2R5YB 2E2IJ 4D7MA 5GPCA 5IP9J 3LSRA 1PUFA 4XRMA 1P7JA 3CDLA 5C3EJ 1ZKGA 1CQTA 2NOGA 1X2NA 1BL0A 1A5JA 1ZK8A 2Y2ZA 1ZTRA 1QPIA 2EQRA 3ZQFA 3OSFA 1ETVA 1Y1WJ 1NK3P 1Q1VA 2LK2A 5FJ8J 1HLVA 4X1EA 1HDPA 2HOAA 3SFIA 5HODA 1LFBA 4QSHA 2NVQJ 2MSYA 3ZQIA 1TC3C 3BTCA 2LLKA 2GBYA 3JREA 1FJLA 1X2MA 1ETWA 2ME0A 1IDYA 1RETA 4QTRA 2P81A 3D1NI 2CQXA 1IV6A 3JR9A 2X48A 2ECBA 1WH7A 4BBRJ 1H88C 4MFEA 4C3HJ 5BNGA 2CRGA 2GM4A 2ECCA 1Z0XA 1OJLA 4W1UA 4RDUA 1BJZA 2IAIA 2MGQA 1E3OC 2M34A 3HBLA 2EZHA 3GTPJ 1I6HJ 1GV2A 1W0TA 1U8BA 3S1NJ 1RPWA 3I4NJ 4FE7A 3MKLA 3QPSA 2M9HA 4AC0A 5DS9A 1OFCX 1OCPA 4DYRA 3NAUA 3S1RJ 2CUEA 3HGGA 2X6OA 1Y1VJ 2RAEA 5C44J 1FIAA 3RQIA 5E3LA 3GTOJ 1LE8A 2E2JJ 2GLOA 3IH4A 2YU9J 5F1JA 1F36A 2EZKA 1GV5A 3LSGA 2DJNA 2K9NA 4DYQA 4GFBA 1S7EA 1JTYA 3S1QJ 4UUSB 2KT0A 5M3MJ 2NVYJ 1AKHB 3CQZJ 2LD5A 1Z77A 5F08A 3RKQA 3S14J 5IOYA 1ZR2A 1OCTC 1ETQA 2COBA 4IEJA 4B3AA 5C4JJ 1YRNB 4DW6A 2FX0A 2IBDA 3LSJA 2XRLA 2VI6A 2TCTA 1O4XA 1B8IB 2NS8A 5EG0A 2Y9YA 4D7NA 1MBFA 1K83J 4EEFG 3HKZN 1ZGWA 2CQQA 5EGOB 5J1YA 1WH5A 1QVUA 2I10A 2LP0A 1WCMJ 1IDZA 2NVXJ 3GTMJ 1ZR4A 4BBSJ 1ETOA 2EH3A 1T33A 5E3MA 3S1MJ 1HCRA 5M3FJ 3GTLJ 2O9LA 4C2MJ 5FKMA 1FTZA 2R5YA 4XK4A 4IHVA 1FIPA 4XRSA 3TEDA 4UUTA 1I3QJ 4JX4A 1ETXA 2MW8A 1TWHJ 3FKIJ 5IOZA 2LTPA 4B4CA 3Q3SA 2OF7A 4M3EA 4IHXA 3ZQGA 3G1OA 2LKXA 5EDNA 2H1KA 2L7FP 3IV5A 3JRAA 4M3BA 4JX5A 2NVTJ 1AHDP 1TWAJ 5EZHA 4HNVA 5JLXA 1IJWC 1B72B 2AHQA 3DEWA 3FK6A 4JP0A 5J1UA 3IH2A 2DTZA 4M3FA 1FTTA 2XPWA 2DA3A 3C2BA 4BKXA 2L0KA 1T56A 4S0HB 3FK7A 2R92J 3HEFA 2HOTA 4M3GA 2JA7J 3GTKJ 3IH3A 2CUFA 5F0FA 2KDZA 1POGA 2CJJA 1ORKA 4FISA 1LFUP 1JTXA 4FE4A 2VPRA 1GVDA 4IHYA 1HOMA 2R93J 2K9SA 2NS7A 1GDTA 2E2HJ 1TWFJ 3TW6A 2R0QC 2LVSA 3F0CA 1QRYA 3FISA 3A03A 3HDDA 1D5YA 2ZB9A 3S16J 4JX6A 3MVPA 4Y7NJ 5JLWA 1JKRC 4XRSG 2IEKA 4I76A 2HDDA 4XIDA 5K7ZA 3G1LA 1VFCA 1IGNA 1U78A 2JA8J 5J3LA 3S2DJ 2DMNA 4RBOA 1RKWA 3JRDA 3RZDJ 1DU0A 3OOUA 2FQ4A 2H8RA 3A01B 1ETKA 3L1PA 2DA7A 2Y9ZA 4UUSA 3G1MA 5IP7J 2E1OA 1AKHA 3RZOJ 5C4XJ 2DMQA 5EZGA 2R5ZB 2O8KA 1W0UA 1YRNA 1ZQ3P 3TP0A 2EZIA 3GTJJ 2XGDA 3B6CA 1JT0A 2DA5A 1B8IA 1MBKA 4M6VA 2XB0X 4BY7J 1G2HA 2DN0A 1RKTA 1XG1A 1XC5A 1JJ8C 1ITYA 1VNDA 1UG2A 3BQZA 4G12A 5K7HA 3Q0UA 5EGOA 1H89C 2M2EA 2Y31A 2JK3A 4MIMA 2EZLA 3HM5A 1RESA 5E3OA 4IHWA 1JKPC 3BR1A 3BR2A 1MBJA 3BR5A 2Y30A 1SANA 4M3DA 2XPVA 2XSDC 5FLMJ 2XPUA 3TP3A 4DZPA 3S2HJ 3BTIA 5F0HA 4A3KJ 3HGYA 3BTLA 3HOYJ 3I4MJ 1IUFA 2HXOA 2K9QA 2LR8A 2E19A 3ZQHA 2R7ZJ 4CYCB 5IYBJ 4FCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ANT A;  2HYJ A;  1A6I A;  2JWT A;  2JA6 J;  4NDL A;  5IYC J;  1JKO C;  4A3L J;  4L5E A;  1MSE C;  3B6A A;  3LOC A;  3Q0W A;  5FKO A;  2PMZ N;  1WPK A;  3HOW J;  2B63 J;  3JRB A;  1R9T J;  1APL C;  3CMY A;  3BT9 A;  3O8H A;  5F04 A;  1B72 A;  2EBI A;  1TWC J;  4DZJ A;  1HDD C;  1JUP A;  3Q0V A;  4MO7 A;  1MBH A;  1JT6 A;  5J1R A;  5GP9 A;  1ETY A;  4A3I J;  2DA4 A;  4XIC A;  5EEA A;  3A02 A;  2ME6 A;  1WGX A;  3HOZ J;  5EYR A;  3SDG A;  3VPR A;  3JRI A;  3NAR A;  3HB9 A;  3CCY A;  2L9R A;  3PO3 J;  1XS9 A;  3ZQL A;  3PO2 J;  2ID3 A;  1BW6 A;  5IPA A;  3QPL A;  5GPA A;  1TWG J;  3GBG A;  1BW5 A;  1QVT A;  3GTQ J;  3HOV J;  3M4O J;  2JJ7 A;  2HI3 A;  1JJ6 C;  2L7Z A;  2W48 A;  1JGG A;  1BA5 A;  1WI3 A;  4MLO A;  4AUX A;  1VF9 A;  4J19 A;  4V2G A;  2ELK A;  2TRT A;  4ABZ A;  2ID6 A;  2VKV A;  2DA2 A;  3K2A A;  3OIO A;  2JA5 J;  2DA6 A;  2CU7 A;  1H8A C;  2WV1 A;  1PUF B;  4B1R A;  5F0C A;  3A01 A;  1UMQ A;  2LFB A;  1ENH A;  2FD5 A;  3HOX J;  2YS9 A;  5FLV A;  2HQ5 A;  5FKN A;  3H3V K;  2R5Z A;  3H0G J;  3UKG A;  4A3G J;  1DU6 A;  4A3M J;  5EF6 A;  3S15 J;  2VKE A;  1IC8 A;  1JKQ C;  2D5V A;  5E3N A;  4LOC A;  4AYB N;  2FJ1 A;  2M0C A;  1U9O A;  2JMW A;  2XGC A;  4C3J J;  1MH3 A;  2N8G A;  1GUU A;  4QIW N;  3E7L A;  1AU7 A;  3W6V A;  4D5F A;  1JUS A;  2G0E A;  1MSF C;  1P7I A;  2QCO A;  1JUM A;  4BXX J;  1F43 A;  3BG3 A;  4DYC A;  4A3C J;  4I6Z A;  1EF4 A;  4A3B J;  2QF7 A;  1RR7 A;  4D5C A;  3K7A J;  5DTD A;  4FTH A;  4A93 J;  3JRG A;  3JRC A;  4CYC A;  3ZOB A;  1IG7 A;  2MG4 A;  5F27 A;  2DMU A;  1FEX A;  1MBG A;  2HXI A;  3SJM A;  3TW7 A;  4JYK A;  2L7M P;  3BR0 A;  3S17 J;  3DCF A;  3WHC A;  2K40 A;  1SFO J;  1UHS A;  4BY1 J;  2WAQ N;  4W97 A;  4V2F A;  3WHB A;  3OSG A;  1LE8 B;  3BR6 A;  2DA1 A;  3LNQ A;  1MH4 A;  4A3E J;  5M5Y J;  1VI0 A;  1MNM C;  5K7F A;  1U9N A;  3HOU J;  4C3I J;  5IYD J;  2YUS A;  5FKL A;  2DMT A;  3GTG J;  3BG9 A;  4Y52 J;  3JRF A;  2M8G X;  2XGE A;  3M3Y J;  4A69 C;  4A3D J;  4A3J J;  1HF0 A;  1NTC A;  4X6A J;  3PM1 A;  1X58 A;  2O7O A;  2LY9 A;  3LSP A;  2AO9 A;  1MBE A;  3O8G A;  5IP6 A;  5M5X J;  5EG0 B;  3FIW A;  2OPT A;  1I50 J;  3MN2 A;  4MFD A;  1K61 A;  3ZQC A;  2JN6 A;  1GT0 C;  3BR3 A;  3BG5 A;  5FKK A;  4A3F J;  3QQA A;  2DMP A;  2VUM J;  1NK2 P;  2Y0S N;  2HOS A;  2WB1 N;  1IRZ A;  2XB5 A;  3JRH A;  3BTJ A;  2X9D A;  5M5W J;  3BQY A;  2R5Y B;  2E2I J;  4D7M A;  5GPC A;  5IP9 J;  3LSR A;  1PUF A;  4XRM A;  1P7J A;  3CDL A;  5C3E J;  1ZKG A;  1CQT A;  2NOG A;  1X2N A;  1BL0 A;  1A5J A;  1ZK8 A;  2Y2Z A;  1ZTR A;  1QPI A;  2EQR A;  3ZQF A;  3OSF A;  1ETV A;  1Y1W J;  1NK3 P;  1Q1V A;  2LK2 A;  5FJ8 J;  1HLV A;  4X1E A;  1HDP A;  2HOA A;  3SFI A;  5HOD A;  1LFB A;  4QSH A;  2NVQ J;  2MSY A;  3ZQI A;  1TC3 C;  3BTC A;  2LLK A;  2GBY A;  3JRE A;  1FJL A;  1X2M A;  1ETW A;  2ME0 A;  1IDY A;  1RET A;  4QTR A;  2P81 A;  3D1N I;  2CQX A;  1IV6 A;  3JR9 A;  2X48 A;  2ECB A;  1WH7 A;  4BBR J;  1H88 C;  4MFE A;  4C3H J;  5BNG A;  2CRG A;  2GM4 A;  2ECC A;  1Z0X A;  1OJL A;  4W1U A;  4RDU A;  1BJZ A;  2IAI A;  2MGQ A;  1E3O C;  2M34 A;  3HBL A;  2EZH A;  3GTP J;  1I6H J;  1GV2 A;  1W0T A;  1U8B A;  3S1N J;  1RPW A;  3I4N J;  4FE7 A;  3MKL A;  3QPS A;  2M9H A;  4AC0 A;  5DS9 A;  1OFC X;  1OCP A;  4DYR A;  3NAU A;  3S1R J;  2CUE A;  3HGG A;  2X6O A;  1Y1V J;  2RAE A;  5C44 J;  1FIA A;  3RQI A;  5E3L A;  3GTO J;  1LE8 A;  2E2J J;  2GLO A;  3IH4 A;  2YU9 J;  5F1J A;  1F36 A;  2EZK A;  1GV5 A;  3LSG A;  2DJN A;  2K9N A;  4DYQ A;  4GFB A;  1S7E A;  1JTY A;  3S1Q J;  4UUS B;  2KT0 A;  5M3M J;  2NVY J;  1AKH B;  3CQZ J;  2LD5 A;  1Z77 A;  5F08 A;  3RKQ A;  3S14 J;  5IOY A;  1ZR2 A;  1OCT C;  1ETQ A;  2COB A;  4IEJ A;  4B3A A;  5C4J J;  1YRN B;  4DW6 A;  2FX0 A;  2IBD A;  3LSJ A;  2XRL A;  2VI6 A;  2TCT A;  1O4X A;  1B8I B;  2NS8 A;  5EG0 A;  2Y9Y A;  4D7N A;  1MBF A;  1K83 J;  4EEF G;  3HKZ N;  1ZGW A;  2CQQ A;  5EGO B;  5J1Y A;  1WH5 A;  1QVU A;  2I10 A;  2LP0 A;  1WCM J;  1IDZ A;  2NVX J;  3GTM J;  1ZR4 A;  4BBS J;  1ETO A;  2EH3 A;  1T33 A;  5E3M A;  3S1M J;  1HCR A;  5M3F J;  3GTL J;  2O9L A;  4C2M J;  5FKM A;  1FTZ A;  2R5Y A;  4XK4 A;  4IHV A;  1FIP A;  4XRS A;  3TED A;  4UUT A;  1I3Q J;  4JX4 A;  1ETX A;  2MW8 A;  1TWH J;  3FKI J;  5IOZ A;  2LTP A;  4B4C A;  3Q3S A;  2OF7 A;  4M3E A;  4IHX A;  3ZQG A;  3G1O A;  2LKX A;  5EDN A;  2H1K A;  2L7F P;  3IV5 A;  3JRA A;  4M3B A;  4JX5 A;  2NVT J;  1AHD P;  1TWA J;  5EZH A;  4HNV A;  5JLX A;  1IJW C;  1B72 B;  2AHQ A;  3DEW A;  3FK6 A;  4JP0 A;  5J1U A;  3IH2 A;  2DTZ A;  4M3F A;  1FTT A;  2XPW A;  2DA3 A;  3C2B A;  4BKX A;  2L0K A;  1T56 A;  4S0H B;  3FK7 A;  2R92 J;  3HEF A;  2HOT A;  4M3G A;  2JA7 J;  3GTK J;  3IH3 A;  2CUF A;  5F0F A;  2KDZ A;  1POG A;  2CJJ A;  1ORK A;  4FIS A;  1LFU P;  1JTX A;  4FE4 A;  2VPR A;  1GVD A;  4IHY A;  1HOM A;  2R93 J;  2K9S A;  2NS7 A;  1GDT A;  2E2H J;  1TWF J;  3TW6 A;  2R0Q C;  2LVS A;  3F0C A;  1QRY A;  3FIS A;  3A03 A;  3HDD A;  1D5Y A;  2ZB9 A;  3S16 J;  4JX6 A;  3MVP A;  4Y7N J;  5JLW A;  1JKR C;  4XRS G;  2IEK A;  4I76 A;  2HDD A;  4XID A;  5K7Z A;  3G1L A;  1VFC A;  1IGN A;  1U78 A;  2JA8 J;  5J3L A;  3S2D J;  2DMN A;  4RBO A;  1RKW A;  3JRD A;  3RZD J;  1DU0 A;  3OOU A;  2FQ4 A;  2H8R A;  3A01 B;  1ETK A;  3L1P A;  2DA7 A;  2Y9Z A;  4UUS A;  3G1M A;  5IP7 J;  2E1O A;  1AKH A;  3RZO J;  5C4X J;  2DMQ A;  5EZG A;  2R5Z B;  2O8K A;  1W0U A;  1YRN A;  1ZQ3 P;  3TP0 A;  2EZI A;  3GTJ J;  2XGD A;  3B6C A;  1JT0 A;  2DA5 A;  1B8I A;  1MBK A;  4M6V A;  2XB0 X;  4BY7 J;  1G2H A;  2DN0 A;  1RKT A;  1XG1 A;  1XC5 A;  1JJ8 C;  1ITY A;  1VND A;  1UG2 A;  3BQZ A;  4G12 A;  5K7H A;  3Q0U A;  5EGO A;  1H89 C;  2M2E A;  2Y31 A;  2JK3 A;  4MIM A;  2EZL A;  3HM5 A;  1RES A;  5E3O A;  4IHW A;  1JKP C;  3BR1 A;  3BR2 A;  1MBJ A;  3BR5 A;  2Y30 A;  1SAN A;  4M3D A;  2XPV A;  2XSD C;  5FLM J;  2XPU A;  3TP3 A;  4DZP A;  3S2H J;  3BTI A;  5F0H A;  4A3K J;  3HGY A;  3BTL A;  3HOY J;  3I4M J;  1IUF A;  2HXO A;  2K9Q A;  2LR8 A;  2E19 A;  3ZQH A;  2R7Z J;  4CYC B;  5IYB J;  4FCY A; 
#chains in the Genus database with same CATH topology
 3BOQ A;  2JWT A;  3SZG A;  4ZZL A;  5IYC J;  4L5E A;  4YRV A;  1LJ9 A;  3IKV A;  3LOC A;  1SVM A;  4PJ0 C;  3FXM A;  1G3S A;  4R8H A;  3C3W A;  4L9T A;  2F5C A;  2HS5 A;  5AIP A;  2KMU A;  5FGM A;  2D1V A;  3HUG A;  1R36 A;  1A6Q A;  5F04 A;  1MJ9 A;  4HPQ A;  2EBI A;  4DZJ A;  3Q5F A;  1HDD C;  1K78 A;  3GZ6 A;  3Q0V A;  1P4W A;  2WTE A;  1FMV A;  1TL8 A;  4MO7 A;  3IRQ A;  1MBH A;  1V55 H;  2KIS A;  4Y4R A;  5J1R A;  2X1D A;  5GP9 A;  1M1E B;  1R4N B;  5IT9 Z;  2HGC A;  5LHI A;  4XL9 A;  3LFU A;  3KPH A;  2VT2 A;  3OYK A;  2BE5 F;  2P6S A;  1EJ9 A;  3R0A A;  2HPI A;  1XS9 A;  3DTE A;  3ZQL A;  3PO2 J;  3P5J A;  2ID3 A;  2FBK A;  3GBG A;  1BW5 A;  1B9M A;  1QVT A;  3M4O J;  5BPI A;  4PDK A;  1K4T A;  1JJ6 C;  2W48 A;  5DUK A;  1WJ5 A;  2HQN A;  2Q0O A;  1UAA A;  1WZ2 A;  4MLO A;  4IZZ A;  3RSN A;  3KP4 A;  2IS6 A;  4S04 A;  3WGG A;  1SVL A;  3K1P A;  4V2G A;  1R5G A;  2EFO A;  3OYG A;  3FBN B;  5J8F A;  2FSW A;  2TRT A;  3NWS A;  2H6C A;  3BZ6 A;  1J9I A;  3DBH B;  4AM3 A;  3IUO A;  2DU9 A;  4UB6 C;  3SDB A;  5JR3 A;  4G7O F;  2LBF A;  5K5O A;  2HKX A;  3BG7 A;  3CUO A;  3H3V K;  4EAT A;  1U2W A;  4A3G J;  5EF6 A;  2E7X A;  3D5S C;  3EUH C;  2PMZ A;  2E5N A;  2D5V A;  5E3N A;  2DFH A;  1J2X A;  4AYB N;  2PFB A;  2XSJ C;  2L4A A;  1VQ5 I;  2PEX A;  3RKX A;  1LEA A;  4MTE A;  1ZG1 A;  4PSX A;  2ZXJ A;  5LGU A;  3F22 A;  1MH3 A;  1ONV A;  2MC3 A;  3E7L A;  2BBY A;  1Y56 A;  4D5F A;  1AU7 A;  1XCB A;  2F5D A;  2HZD A;  2QBY B;  4PUS A;  1TLH B;  1IN4 A;  1JUM A;  4PGH A;  4UHT A;  1OMI A;  4A3C J;  2LMD A;  4HX4 A;  1P6R A;  4HEA 2;  2QF7 A;  2VXD A;  3K4L A;  4G6Q A;  3FXK A;  2RN7 A;  5DTD A;  3G6E I;  3JRG A;  3JRC A;  3MKW B;  3L9F A;  4OAY A;  5DDG A;  1IG7 A;  1YLF A;  4LJZ F;  1FEX A;  3C2H A;  4MHG A;  4WWC A;  3BZC A;  3KEQ A;  3HSF A;  5D5W B;  1SFO J;  1G4D A;  3I64 A;  2A69 F;  2WAQ N;  4OIO F;  1SMT A;  1LE8 B;  5CVI A;  3U2R A;  4A0Y A;  5L3B A;  1D5V A;  1V5E A;  1X3W B;  5L3E A;  3DLL F;  1O7L A;  2DI3 A;  1MH4 A;  1R1V A;  4BDZ A;  5M5Y J;  4M71 A;  4OIP F;  4U87 A;  2KQR A;  2R7V A;  1UCR A;  3LA2 A;  3DTI A;  4Q48 A;  3HZJ A;  5L3C A;  4Y52 J;  1TW2 A;  5HLT A;  3JRF A;  2M8G X;  3L2R A;  2ZJR F;  1XGO A;  2VKH A;  4D0P A;  4ZZD A;  5F6F A;  3J7A Y;  1XTA A;  2P7C B;  3OV8 A;  1IV8 A;  3P9K A;  5J6X A;  2Q1Z B;  5LLQ A;  1BC7 C;  1D8K A;  2DW4 A;  4H0E A;  3O8G A;  1MBE A;  2UUZ A;  4HYE A;  4OMZ A;  3D5L A;  3MN2 A;  1FPQ A;  2HDC A;  2VB6 A;  2ZJ2 A;  4QPO A;  2JA2 A;  3WTW C;  2EA4 A;  4A5N A;  1QZE A;  3ZQ7 A;  3BR3 A;  4A3F J;  4L0Y B;  2O03 A;  2VIX A;  2CQ7 A;  3OYN A;  5ILV A;  2PN6 A;  1ZRF A;  2Y0S N;  1IN7 A;  2M4K A;  3I71 A;  3UNG C;  3PIP F;  3ASO H;  2X9D A;  3CCE I;  1R49 A;  3RI4 A;  1WJC A;  2E2I J;  2XDV A;  1AWC A;  2GA1 A;  5IP9 J;  3CCQ I;  2V79 A;  1WFX A;  3K4B A;  3H3Z A;  1EH8 A;  1UHW A;  3K70 D;  2MC4 A;  3GVA A;  4X0G A;  2NOG A;  5HDK A;  3CUQ A;  1BL0 A;  1ZTR A;  2V1X A;  4XOR A;  5DCM B;  5CYV A;  1QPI A;  2CV1 A;  4G7Z F;  3MZ8 A;  2O6G E;  1BBY A;  4CCL A;  1NK3 P;  1Q1V A;  5FJ8 J;  3AG2 H;  3AKZ A;  3CC2 I;  3HG9 A;  4X1E A;  2FNA A;  2ISY A;  2HOA A;  4UVA A;  3MMY B;  2MLG A;  3FZV A;  4BQQ A;  1TC3 C;  3X2Q H;  3OYB A;  2LLK A;  1FJL A;  4EM2 A;  2HQA A;  4OU0 A;  2M5W A;  3E97 A;  3LL7 A;  2NS0 A;  2L54 A;  1H88 C;  4C3H J;  1W7P A;  3V7R A;  3TMO A;  3LQR A;  1RRJ A;  3SZP A;  3JW4 A;  4W1U A;  2H27 A;  2MGQ A;  1ZRD A;  2M34 A;  4XNF A;  1YJN I;  2E35 A;  3TDU C;  1F4K A;  4Z2Y A;  5K5Q A;  2H8W A;  1I6H J;  1GV2 A;  3EDP A;  1U8B A;  3J7Z I;  1RPW A;  3SEQ A;  5DS9 A;  1FOK A;  4UV8 A;  1BOB A;  1U5T B;  3NAU A;  5E1X A;  2WY7 Q;  1FIA A;  2DT6 A;  2E1M B;  4HNU A;  3RCO A;  4B09 A;  1G8X A;  5BS6 A;  2LY1 A;  4HF2 A;  2EZK A;  2WB1 A;  4EJV A;  4ETS A;  4KIS A;  4GFB A;  1T38 A;  1XDU A;  1XDS A;  2R7Q A;  4RGU A;  5BPD A;  1JTY A;  1LKX A;  4IRI A;  1VQM I;  4IHS A;  1UEL B;  3DKX A;  3CQZ J;  2LD5 A;  5KHD A;  4I7H A;  1AOY A;  3S14 J;  2DOE A;  1ZR2 A;  3KP7 A;  4CCJ A;  3ZMU A;  4DNC A;  5JVT A;  5HS7 A;  1YRN B;  2FX0 A;  5KAF C;  3ZXS A;  1PUE E;  2NXN B;  2CQK A;  2BW3 A;  2VI6 A;  4IQ4 A;  4XN0 A;  5DV5 A;  2LF8 A;  1SFX A;  3ISP A;  4WXH A;  1DGW Y;  3CLO A;  5EG0 A;  2Y9Y A;  3F8F A;  3HKZ N;  1ZGW A;  3TQN A;  2EIN H;  1WH5 A;  2O0Y A;  4CH7 A;  3LSH A;  2KRF A;  2I10 A;  1R6R A;  2WWY A;  2X6X A;  2NVX J;  1YI2 I;  5KAI C;  1ETO A;  2Z99 A;  1E17 A;  2A3S A;  2Z2S B;  3VSK A;  1HCR A;  2DPU A;  2COM A;  4L9N A;  1SD7 A;  3CZ6 A;  3IAS 2;  4FET A;  4RM3 A;  2P6T A;  4BE1 A;  2O9L A;  1FTZ A;  4IQJ A;  3VYU B;  1FIP A;  3O2P E;  3F8N A;  1HKS A;  1I3Q J;  5AON A;  2K27 A;  2MW8 A;  4AD9 A;  4Q47 A;  3ERM A;  1L0O C;  4MEX F;  2WAE A;  2DT5 A;  3QAH A;  2A05 A;  1FX7 A;  4IHX A;  3MKY B;  2FOK A;  2L7F P;  1YIT I;  4PJM A;  3R6S A;  5FD6 A;  3I59 A;  3OL3 A;  4LIT A;  1IF1 A;  2D2W A;  3HUG B;  5LRS A;  3ZCO A;  1T0F C;  1ZAR A;  3DEW A;  3FK6 A;  4UUV A;  3I55 I;  1K78 B;  2XPW A;  3ZMT A;  3DLA A;  4ZTJ A;  3ABM H;  4MQ9 F;  2K85 A;  1X1B A;  1P2F A;  1MND A;  3OIQ A;  3GLX A;  5JFR A;  3ZMD A;  3CCM I;  3G2B A;  1X1D A;  2EWN A;  3T8T A;  5LBQ A;  3B73 A;  4IPA A;  2VPL A;  1ORK A;  3Q9V A;  2Y69 H;  3BPV A;  2LKP A;  3OYI A;  1GDT A;  4UNO A;  1TWF J;  1NHA A;  1BR2 A;  3PUB A;  4JOM A;  3PFI A;  1R71 A;  3TW6 A;  3A4C A;  3CJN A;  2QBY A;  1O3S A;  2V6E A;  4C2T A;  5LRR A;  3PJR A;  3FIS A;  4YIR X;  4P9U A;  3T1B A;  3HDD A;  2ZB9 A;  1TTY A;  5ICC A;  2ZFU A;  1W7P D;  2QYO A;  3MVP A;  4LG3 A;  1F5T A;  4XRS G;  5ILS A;  1U5T C;  3M9A A;  2BY2 A;  1YIO A;  1W4M A;  2HYG D;  5DCF A;  3WOD F;  4CCO A;  1DPU A;  2E1M C;  1IGN A;  1Z3X A;  1U78 A;  2VJ5 A;  5IT9 K;  2WY8 Q;  3LWF A;  1TT5 B;  2CUZ A;  2XF5 A;  2GQQ A;  3RZD J;  2Z16 A;  3OOU A;  1OYY A;  4YEL A;  1A31 A;  2DFE A;  2DA7 A;  1W1W E;  2KKO A;  1D1C A;  2VBX A;  2LBF B;  2LKS A;  5B3S H;  1I39 A;  3JSO A;  5IP7 J;  1AKH A;  3RZO J;  4NQW A;  2DMQ A;  2KPM A;  1LUJ B;  4AID A;  2M8E A;  2EV0 A;  2IGN A;  4OOI A;  3L7W A;  1J7K A;  3PSF A;  5DD8 A;  3QPH A;  4KIC A;  3B6C A;  2ZXH A;  4P96 A;  1B8I A;  3LA3 A;  4M6V A;  5D8K B;  1WJA A;  1G2H A;  5D5X B;  1Z9C A;  3KP5 A;  3AG1 H;  1VND A;  3BQZ A;  4G12 A;  4BHC A;  1MKM A;  3DEU A;  2IJL A;  1H89 C;  5ERI A;  2BOL A;  1KQ0 A;  2HR3 A;  3DU5 A;  3J7A O;  2I5U A;  5E3O A;  3BR1 A;  1HC8 A;  2VL8 A;  3BR5 A;  2PJP A;  3TP3 A;  4CZC A;  3FHZ A;  2PMU A;  4J01 A;  3M8E A;  3F8C A;  3TKY A;  5TRD A;  1LNW A;  2A6E F;  3EYY A;  5IYB J;  3E6B A;  4ZDL A;  2HYJ A;  5FRO A;  2CW8 A;  5HLH A;  4PJJ A;  1Z6T A;  1KYW A;  1XSX A;  3B6A A;  3TDZ C;  3Q0W A;  3TO9 A;  4XLH A;  1WPK A;  3BCB A;  4NHJ A;  4HX7 A;  1UG0 A;  4E4H A;  1APL C;  3F9K A;  2VJ4 A;  4EJO A;  1HXD A;  3U1D A;  2BHY A;  2JUG A;  4IJA A;  5EEH A;  5B1B H;  3I58 A;  2K4B A;  3OS1 A;  4IRH A;  2O5R A;  1JI8 A;  3TO7 A;  2M0M A;  4WK8 F;  1MIJ A;  3RKW A;  3GFJ A;  3FXQ A;  4RGS A;  4A3I J;  1BOA A;  5EEA A;  2ME6 A;  5BOX A;  3SDG A;  3JRI A;  2MBF A;  3JAM Z;  2W24 A;  3W2W A;  4BQA A;  2IPQ X;  2XV4 S;  1X1P A;  1G6N A;  2IGM A;  2UZK A;  2VLA A;  1DP3 A;  2ZSI B;  3KP3 A;  3KEO A;  1BW6 A;  3KX2 A;  3DPL C;  4PFP A;  5IPA A;  2RNG A;  3EUA A;  2STW A;  1TWG J;  4CYD A;  4P9F A;  2JJ7 A;  3EQL F;  4ENN A;  1G3T A;  1Z6R A;  4F92 B;  1XCV A;  1WI3 A;  2GXG A;  1FSE A;  3U21 A;  4HQM A;  2PQ8 A;  3K70 C;  5CJ9 A;  2ISZ A;  2P7V B;  2Z3Y A;  2X6W A;  2XAJ A;  3NWT A;  4LK0 F;  1S5L C;  3HC7 A;  2FNP A;  1SFU A;  2W82 A;  2DA6 A;  4EGY A;  1SD5 A;  1H8A C;  2OCE A;  1OQY A;  2ICW G;  5F0C A;  2GWR A;  4RGR A;  1IUY A;  2LFB A;  4IXA A;  3OR1 C;  2LYC A;  5H6R A;  1FY7 A;  3SXY A;  3VYT B;  3CUQ B;  2V26 A;  2M45 A;  2RQQ A;  1XGM A;  5FKN A;  5FRM A;  1KU3 A;  3H0G J;  4BH9 A;  1FBU A;  4ENK A;  1VQK I;  3PSI A;  4A3M J;  4I09 A;  3FMS A;  1YYV A;  3V4G A;  1FOX A;  2OQR A;  2VN2 A;  2L9V A;  1IC8 A;  5D4R A;  3WTX C;  1Z91 A;  2HWV A;  4BGD A;  3BCA A;  4BUP A;  3CJR B;  2FJ1 A;  1S7O A;  3BZK A;  3REO A;  4G6T B;  3LMM A;  1B4A A;  2N8G A;  2OV7 A;  1BR1 A;  4QIW N;  1KU7 A;  1FOW A;  4RS8 A;  3HL2 A;  3HPG A;  4CZZ A;  5LGT A;  1MSF C;  2QVO A;  5J8C A;  1B1B A;  1F43 A;  1W7P B;  2HDW A;  4I6Z A;  3GW2 A;  4D5C A;  4KN7 X;  1FP2 A;  1G59 A;  2C6Y A;  2MFZ A;  2JRT A;  4FTH A;  1OIS A;  4A93 J;  1EV7 A;  1BR4 A;  1IXS B;  2V7F A;  3ZOB A;  4HV6 A;  4NBQ A;  1MDM A;  2HZT A;  2DMU A;  4ESJ A;  3I5U A;  2DK8 A;  1YE9 A;  4JYK A;  3VYS B;  1EA3 A;  3FMQ A;  3VYR B;  2V9K A;  5CLS A;  1YJW I;  2I8D A;  2DO7 A;  2XGX A;  2W1O A;  5ILU A;  2HKO A;  4PK4 A;  3DTK A;  1UHM A;  3OL4 A;  3CLQ A;  3E3V A;  1ZN2 A;  4M74 A;  4R79 A;  3CCS I;  2XRN A;  2QM3 A;  4ENM A;  5FFZ A;  1MNM C;  1REP C;  3PNY A;  4GYI A;  2GAU A;  5F64 A;  2H6B A;  5IYD J;  1FP1 D;  2YUS A;  4RLQ A;  3GTG J;  2DMT A;  3M3Y J;  4F55 A;  4RB0 A;  1XX5 A;  2Y75 A;  4E6K G;  3E5Q A;  3K4K A;  2K7L A;  1HF0 A;  1NTC A;  3W6K B;  2Y0M A;  2DBB A;  3PM1 A;  4CDG A;  2V6C A;  2BW3 B;  2LY9 A;  3LSP A;  4BJ6 C;  5LHH A;  4LGW A;  3MWM A;  3HRU A;  5M5X J;  5HNF A;  2EA2 A;  2KIM A;  1KU2 A;  5EG0 B;  2MH2 A;  3OS0 A;  4ZC3 A;  3UR3 C;  4MFD A;  1FWZ A;  4M9S A;  1K61 A;  2EIK H;  5HS8 A;  1RI7 A;  2NRA C;  2FF4 A;  4KUM A;  5EJC A;  3G71 I;  1RIO H;  1GT0 C;  4KNY A;  4PCQ A;  2VUM J;  2HOS A;  4G9Y A;  1IRZ A;  4BXF A;  2B7E A;  3BG6 A;  4TV7 A;  3JRH A;  3QWL A;  3BJA A;  2O3F A;  1T6S A;  5J4V A;  2LSO A;  3WTU C;  2XAS A;  1R7J A;  2CG4 A;  2L9S A;  2JPB A;  2XF6 A;  4M73 A;  1AA7 A;  1ACI A;  3PQK A;  3PUF A;  2VC1 A;  3ZR8 X;  2NNN A;  2CMP A;  1HQC A;  1ZK8 A;  2Y2Z A;  2W85 A;  3CUQ C;  3J80 Z;  3SZT A;  1ZAO A;  3ASN H;  3CD6 I;  4ZYH A;  3I59 B;  5HVQ C;  1T2K A;  3NQO A;  3OYD A;  1HLV A;  1HDP A;  3M8J A;  2UV1 A;  1LFB A;  1WSU A;  3ZPL A;  2QLZ A;  1RNL A;  3ZQI A;  1FSH A;  2X85 A;  3K6G A;  4KN4 X;  4C9Y A;  2AS5 F;  1IN5 A;  1ETW A;  5DYM A;  2QKL B;  2P81 A;  2AXL A;  2X48 A;  3BC8 A;  1IO2 A;  1V3F A;  3K4M A;  1Z0X A;  1OJL A;  2QKM B;  3CP8 A;  2JZY A;  2ELH A;  1E3O C;  1X1A A;  1IAW A;  4D1Q A;  1MW7 A;  1TNS A;  3AFH A;  1D1A A;  2EZH A;  4XKC A;  4MGR A;  3ZMV A;  3GTP J;  3DKW A;  3H0D A;  1I1G A;  2MD0 A;  3OYE A;  4C2U A;  4ZJZ A;  3S1N J;  4FE7 A;  3QPS A;  2XF7 A;  4AC0 A;  3S3M A;  3ROU A;  1Y39 A;  3S1R J;  4N9I A;  4CCK A;  1JHF A;  2VT3 A;  2X6O A;  3OIP A;  2RAE A;  1YHQ I;  2A6T A;  4HW0 A;  2E2J J;  5JI6 A;  3COA C;  2GLO A;  5F1J A;  2HPM A;  1F36 A;  1T95 A;  3LSG A;  1X3Z B;  3MAJ A;  4BE2 A;  3C7J A;  1K6Y A;  1R23 A;  2LC2 A;  4OIQ F;  2ETH A;  3RYP A;  1J09 A;  4LIU A;  3IKT A;  1AKH B;  4L0Z B;  1LQ1 A;  3TOA A;  2XC7 A;  4NQW B;  1WI9 A;  2JVG A;  4XM3 A;  4BU2 A;  4G6D A;  1ETQ A;  2COB A;  2V1N A;  4AVZ A;  3BRO A;  2IBD A;  3OS2 A;  2RDP A;  5L3G A;  2ESH A;  2BY3 A;  2VC0 A;  3KYD B;  1B8I B;  3QPT A;  2GIZ A;  2PG4 A;  3H9Q A;  3LST A;  4HOB A;  1MBF A;  2KJC A;  3G4S I;  2CQQ A;  4WXD A;  4Y3O A;  1QVU A;  1GLN A;  3TO6 A;  5HDG A;  4KYW A;  1WCM J;  4HNT A;  1YOV B;  3D0S A;  5H2F C;  3ECO A;  1ZR4 A;  3A0H C;  2VE8 A;  5J40 A;  3MFK A;  3PIO F;  2LG4 A;  3V7C A;  3WG7 H;  5M3F J;  3E5X A;  4C2M J;  2BZT A;  3BY6 A;  2EIM H;  4K2E A;  4BNC A;  1P4X A;  3GZ5 A;  4XRS A;  3F6V A;  2DK5 A;  1X1C A;  1ETX A;  2AQF A;  3HJE A;  3VFZ A;  5GAG J;  2FBH A;  2R7F A;  5IOZ A;  1U6G A;  2JSP A;  2LTP A;  3VEP A;  2EV5 A;  4BXU A;  1QHG A;  3Q3S A;  3AG3 H;  3K2Z A;  2OF7 A;  4XLN F;  5DM6 F;  2PX9 A;  4Q5S F;  3OWT A;  3G1O A;  1YX3 A;  4ZYG A;  5EDN A;  4XOP A;  3OR2 C;  1UFM A;  5FD5 A;  1U0J A;  2G7U A;  4P1W A;  2NVT J;  2D45 A;  1AHD P;  2OUM A;  5BMZ A;  5D4S A;  5K1Y A;  2VQL A;  5JLX A;  4EM1 A;  1J75 A;  2VBZ A;  1Z05 A;  2AHQ A;  4CA0 A;  2X6Y A;  4WXC A;  4I0A A;  4H4K C;  2Z1D A;  2DTZ A;  1S3J A;  3HHH A;  1PYV A;  3MEX A;  3SEZ A;  3HSE A;  3C2B A;  5JHU A;  3KLN A;  4BKX A;  4XKW A;  1R00 A;  2L0K A;  4B48 A;  1T56 A;  4HZF A;  5EEG A;  4P5O A;  3V8J A;  4XON A;  4S0H B;  1SMY F;  2QUF A;  3K1M A;  4MQV A;  3FK7 A;  2HOT A;  2GOX B;  1ZH5 A;  1I1S A;  3KFW X;  4M3G A;  1GXP A;  2EIL H;  3IH3 A;  4UVC A;  4YFX F;  2W4S A;  5K5R A;  1JTX A;  3KZZ A;  1ZGJ A;  2O61 A;  3LQQ A;  1KQ8 A;  2R93 J;  1T98 A;  2BXZ A;  2NS7 A;  4YII A;  2E2H J;  1X4O A;  2DPD A;  4XLF A;  5D5V B;  3J7Y J;  1G3Y A;  4U0Y A;  3K4C A;  4I0B A;  4BYY A;  2R0Q C;  3BWG A;  2LVS A;  3KIO A;  3F0C A;  1N25 A;  3KYL A;  2DT7 B;  1L3L A;  2FOW A;  3RYR A;  1QRY A;  3A03 A;  2CQN A;  4RB1 A;  2XRO A;  1D5Y A;  3HRT A;  4KJZ A;  3L2U A;  1QNT A;  3VB2 A;  4UY8 I;  3IRR A;  2L9N A;  2R7X A;  1TW3 A;  3ZN1 A;  4M6Y A;  1TZL A;  2CUJ A;  4F93 B;  4I76 A;  1XPX A;  4XID A;  1VFC A;  1MMD A;  2JA8 J;  4HF1 A;  4RB3 C;  4N4O B;  3RIR A;  4E7L A;  3S2D J;  1RZ4 A;  2P5K A;  3JRD A;  4CIC A;  3GXO A;  1Z67 A;  2L02 A;  3JAM K;  2H8R A;  4BQO A;  3KCC A;  3DKY A;  4DGW B;  3L1P A;  2ZXI A;  2Y9Z A;  1HW1 A;  2BYV E;  4YFN F;  1SEU A;  1UST A;  4QWQ A;  3CES A;  5C4X J;  4D9J A;  3H36 A;  3T8R A;  4UV9 A;  3WGI A;  1SC7 A;  2M7A A;  3GFI A;  1ZQ3 P;  2QSF X;  1DP7 P;  4PSW A;  2EZI A;  1V5F A;  2EV6 A;  1KA8 A;  5J47 A;  3GWZ A;  1MBK A;  4HDU A;  2DN0 A;  1RKT A;  1OKR A;  1XC5 A;  2G7H A;  4G94 A;  1JJ8 C;  3BP8 A;  2E71 A;  1QO0 D;  3S8P A;  5EGO A;  1W36 D;  3PL8 A;  3ABK H;  4EM0 B;  5HOO A;  2Y31 A;  5H20 A;  3HM5 A;  3GLL A;  1FC3 A;  4IHT A;  4IHW A;  2LRD A;  1JKP C;  3BR2 A;  1PVE A;  4G8X A;  3VDX A;  4ITV A;  1K7A A;  2XPU A;  3GX4 X;  2JPC A;  1D0Y A;  5F0H A;  4YG2 F;  4E7K A;  1OCZ H;  2DDA A;  3BTL A;  3I4M J;  1IUF A;  2HXO A;  2K9Q A;  2LR8 A;  2TDX A;  2X0L A;  3OY9 A;  2R7Z J;  3KET A;  1D0X A;  2LDU A;  1SD6 A;  3MZH A;  5ED4 A;  3HTS B;  3P7N A;  2R7D A;  3IL2 A;  1MDM B;  2XKP A;  5CVV A;  1T8I A;  9ANT A;  2JA6 J;  4DQ2 A;  1JKO C;  1ULY A;  2AXT C;  3GFM A;  1SFK A;  4KMU X;  4HLX A;  5FKO A;  2PMZ N;  3HOW J;  2B63 J;  2EPF A;  2F4M B;  2L3D A;  2FMY A;  3RDI A;  2RNJ A;  3O8H A;  1Y8R B;  1B72 A;  2W57 A;  1QZZ A;  1TWC J;  3C2G A;  1YW8 A;  3V8K A;  2VE9 A;  2HOE A;  3ABL H;  1Y0U A;  1ETY A;  4XSX F;  3GUD A;  2DDB A;  1ZLJ A;  1VQ7 I;  2QQ9 A;  1KQ9 A;  3A02 A;  1WGX A;  2F6C A;  1LPQ A;  4BAY A;  2XAU A;  3F72 A;  2CH0 A;  3FM5 A;  3RPU D;  3M1C A;  3VOE A;  2DYS H;  3L2C A;  3K4N A;  1W5C C;  5ICE A;  2L9R A;  3WU1 B;  1YQA A;  4RA2 A;  3QRF F;  4NNJ A;  4E7H A;  1YFH A;  1YW7 A;  2ESN A;  1Z1D A;  3QPL A;  5GPA A;  1KON A;  3ML6 A;  3KZI C;  3GTQ J;  3HOV J;  2X4H A;  3RKY A;  2HI3 A;  5LGN A;  4EJT A;  2L7Z A;  3QOD A;  4HQE A;  1JGG A;  1BA5 A;  4GRI A;  2JQ7 A;  2PBI A;  4AUX A;  1VF9 A;  4J19 A;  1Y8Q B;  4OAZ A;  4B3X A;  3CF2 A;  3DU6 A;  1ZEL A;  1O3T A;  3DP7 A;  4HG2 A;  1JE8 A;  1X4P A;  4OWR B;  1WJB A;  1W5S A;  4I99 C;  5TJJ A;  3CMA I;  2L01 A;  1N77 A;  4EV0 A;  2VKV A;  2DA2 A;  3I53 A;  4M72 A;  1SAX A;  3OIO A;  3TBI A;  1WKM A;  2FEZ A;  2FU4 A;  2WV1 A;  5E8G A;  1RUO A;  2FQ3 A;  3FWE A;  3A01 A;  3G73 A;  1ZG5 A;  2QQB A;  4ESF A;  1VQ6 I;  2M30 A;  4L9V A;  1ENH A;  2KZV A;  5E79 C;  2YS9 A;  1OR7 A;  4NC6 A;  5FLV A;  5LEK A;  1E3P A;  2YSR A;  4KIG A;  2R5Z A;  5E17 F;  3K9T A;  2LRE A;  3MQ0 A;  3F8M A;  3I4P A;  4A5M A;  3S15 J;  5A2Q K;  2OZU A;  4LOC A;  1U9O A;  2XGC A;  4BEH A;  3WTZ A;  2L2O A;  2MAB A;  2KRH A;  1K6O A;  3MD2 A;  3O6B B;  3BDD A;  1QQI A;  4P55 A;  2JT1 A;  4F7Z A;  5B1A H;  3W6V A;  1SD4 A;  1JUS A;  2IGK A;  1Y6I A;  1O57 A;  4DJA A;  1CGP A;  3MKZ A;  3DF8 A;  1YS7 A;  1P92 A;  4BHB A;  1OYI A;  5DUI A;  3CC4 I;  2W84 A;  4GO1 A;  2ZNZ A;  1ON1 A;  4HRI A;  1KGS A;  3S32 A;  2B0L A;  3J80 K;  1FBQ A;  4WX9 A;  1PP7 U;  2D1H A;  1VQO I;  2JTV A;  4CYC A;  1VQ9 I;  3FXU A;  2MG4 A;  3LSI A;  4QPQ A;  3VOD A;  3EET A;  5F27 A;  5L3F A;  3HSR A;  3V7S A;  1SVO A;  2MLK A;  1DQU A;  4XLE A;  3BR0 A;  2AQE A;  1O7F A;  3S17 J;  3DCF A;  1A35 A;  3CO6 C;  1FT9 A;  4CCM A;  5TIS C;  1HKT A;  2K5C A;  4AWX B;  3WHB A;  2DCE A;  4M6X A;  3WGH A;  1T39 A;  2P5L C;  2DQL A;  2KL4 A;  3LNQ A;  2K9M A;  3CCU I;  4ZYE A;  2ADU A;  3DFG A;  1LEB A;  4A3E J;  1VI0 A;  3H92 A;  5K7F A;  4ZYA A;  2JVH A;  3S3O A;  3HXL A;  3HOU J;  5FO5 A;  2CWE A;  5CPR B;  4DBQ A;  2IA0 A;  5FKL A;  3EYI A;  3BG9 A;  1S6L A;  2E34 A;  2EJR A;  2QA4 I;  1TP4 A;  1HW2 A;  3ZRG A;  2IP2 A;  4UVB A;  3T5X A;  2O7O A;  1MJB A;  2PMH A;  2R4G A;  2AO9 A;  4ZDP A;  3EPZ A;  4IRG A;  3WTV C;  4LLN A;  1S72 I;  1I50 J;  3HYI A;  5FFX A;  3GME A;  4NC8 A;  1E0E A;  4AYB A;  2PJR A;  2R3S A;  3I54 A;  1K4S A;  2OU2 A;  2K3P A;  1WJF A;  3ZQC A;  1ON2 A;  5FKK A;  1TNT A;  2XVC A;  2E7W A;  3QQA A;  2VXZ A;  3R61 A;  2DMP A;  4HF0 A;  1NK2 P;  3QYE A;  2WB1 N;  1QHH D;  5IT3 A;  4LLL A;  4KDP A;  2XB5 A;  2ZC2 A;  5M5W J;  1ZHF A;  2KJB A;  4XQF A;  3FXO A;  5GPC A;  1MGT A;  4BS9 A;  4FX4 A;  3LSR A;  3F23 A;  1PUF A;  2M4G A;  2DQR A;  4XRM A;  4BJ5 C;  2OA4 A;  4ZDO A;  3CDL A;  5C3E J;  4CO8 A;  1O3R A;  4HDV A;  2VAS A;  3WE3 A;  1X2N A;  2W25 A;  5HNH A;  2V1D A;  3O3K A;  1A5J A;  3HHG A;  3CCJ I;  4AU7 A;  2DAO A;  1WJE A;  3L00 A;  2A07 F;  1MZB A;  3ZMZ A;  2EQR A;  3OSF A;  4E7I A;  1DDN A;  4DBR A;  1BI2 A;  3FKJ A;  2CS3 A;  2WAQ A;  2QEX I;  3GFL A;  1Z3Y A;  1BC8 C;  5HOD A;  1RC9 A;  2NNY A;  2E60 A;  2WAD A;  4QSH A;  2MSY A;  2RC4 A;  3M8F A;  3BTC A;  1X2M A;  3RPQ A;  2ZNY A;  2KIU A;  3F6O A;  1IDY A;  1V54 H;  1IV6 A;  2CQX A;  1MMA A;  3JR9 A;  1XN7 A;  5D8L B;  2BGC A;  1WH7 A;  3E0J B;  4MFE A;  1VQN I;  2DTR A;  4CCN A;  2GIV A;  5BNG A;  2HFH A;  4WCG A;  2Q2E B;  1EH6 A;  2CRG A;  1I5Z A;  2ECC A;  1IRX A;  3SFZ A;  4F3Q A;  4AIH A;  1U3E M;  4U7D A;  1BJZ A;  1LDD A;  2IAI A;  4PZJ A;  3FXJ A;  1VQ8 I;  3A2K A;  4YIF A;  3HBL A;  1D1B A;  2OD5 A;  5E8I A;  3B02 A;  2H09 A;  3OMY A;  3M07 A;  4L18 B;  3DWL E;  3MKL A;  4HLY A;  3VSL A;  1OFC X;  2KIF A;  1OCP A;  5HDN A;  4DYR A;  1R5I D;  4ZH4 F;  1E2X A;  1T08 B;  2CUE A;  3HGG A;  1YIJ I;  2K4J A;  2J5P A;  3RQI A;  5E3L A;  1FMW A;  3GTO J;  1SFE A;  1MJA A;  2F2E A;  2HU9 A;  1GVJ A;  3LFK A;  1OPC A;  4B8X A;  2IGO A;  2F48 A;  4II2 A;  1TT0 A;  1IRF A;  4DYQ A;  2J5O A;  3FF5 A;  2HVQ A;  2OBP A;  3H1C A;  4FCY A;  3S1Q J;  1SAU A;  2VBY A;  2PLY A;  2QQA A;  5M3M J;  2NVY J;  2HTS A;  2QGU A;  1IRG A;  5F08 A;  3RKQ A;  5IOY A;  1W36 C;  2P8T A;  4IEJ A;  1UB9 A;  4B3A A;  2F5V A;  4DW6 A;  3FX3 A;  3LSJ A;  4RMN A;  2XRL A;  5E20 A;  1O4X A;  1HW5 A;  1HKQ A;  1KZH A;  1I27 A;  2M1B A;  1K83 J;  2CO5 A;  4RAZ A;  5EGO B;  2EFQ A;  4XKB A;  4II3 A;  4EQQ A;  4EJW A;  2VBW A;  3N97 A;  5GTH C;  1IDZ A;  2RGV A;  3GTM J;  1XMK A;  2K9L A;  4BAC A;  3ZMS A;  1FYM A;  3WG9 A;  4OMY A;  3GTL J;  5FKM A;  3CO7 C;  1R5H A;  2X1C A;  4XMY A;  2R5Y A;  3E6D A;  3FM3 A;  3IP4 B;  4DOZ A;  1CF7 B;  1XB4 A;  3QOP A;  4UUT A;  1FOY A;  5A2Q Z;  3FKI J;  4BQN A;  3OYH A;  3QP6 A;  2MYS A;  3AG4 H;  2WBM A;  1F1Z A;  4Y33 A;  2OC6 A;  3IV5 A;  1OLT A;  4M3B A;  4FT8 A;  3PNV A;  1PP8 F;  1HBX G;  3M1E A;  3GZN B;  3KZY A;  3ABU A;  4IF4 A;  5EZH A;  5HS9 A;  4HNV A;  2EFW A;  1IJW C;  1LVA A;  3EUK L;  1B72 B;  4XOT A;  1BI3 A;  3H9J A;  4JP0 A;  1GXQ A;  5J1U A;  2FXA A;  3IH2 A;  2VON A;  2WC2 A;  6PAX A;  3ZP5 A;  2VQC A;  4GGG A;  5CVJ A;  2DOA A;  2VOP A;  2XIG A;  2BEO A;  3ELK A;  4E7J A;  1QA6 A;  1VQP I;  2E36 A;  1JHH A;  3M7G A;  5GAH J;  4EJU A;  2KZG A;  2CUF A;  4UB8 C;  5F0F A;  2KDZ A;  1LVK A;  2CJJ A;  1MMS A;  1UZC A;  2ZO4 A;  4PJN A;  3ZGK A;  1IW7 F;  2VPR A;  1GVD A;  4IHY A;  2RKH A;  1JGS A;  1PJR A;  4E7Z A;  4FAS D;  3CC7 I;  3E1S A;  1OCO H;  3BLY A;  1VQ4 I;  3S16 J;  2VQG A;  2A5Y B;  3L09 A;  4JX6 A;  3HKZ A;  4KA4 A;  4Y7N J;  3SQN A;  4XSZ F;  2IXS A;  1BI1 A;  2KP6 A;  2Z5U A;  1NH3 A;  1JKR C;  3CP2 A;  4PFO A;  1UJ8 A;  3IC7 A;  1W5T A;  1VTN C;  5K7Z A;  3G1L A;  3WU2 C;  4I01 A;  5J3L A;  4IKF A;  5CVR A;  5GTI C;  2FE3 A;  3KEY A;  3AAF A;  2DMN A;  4XKV A;  1RKW A;  4A0X A;  2BY0 A;  2WAF A;  1DU0 A;  1WVR A;  1YS6 A;  2FQ4 A;  3A01 B;  2CV0 A;  1ZRC A;  2GOM A;  5L3D A;  1MMN A;  2QSG X;  4UUS A;  3G1M A;  1B6A A;  3C18 A;  2E1O A;  1TQM A;  1X19 A;  5E1W A;  1O3Q A;  1J59 A;  5EZG A;  4XLC A;  2FUG 2;  1BM9 A;  2R5Z B;  5B66 C;  2O8K A;  2HTJ A;  2XUB A;  2NAZ A;  2LNB A;  3TP0 A;  2FRH A;  4IOC F;  2V9P A;  2XGD A;  2E1C A;  2DA5 A;  3V8L A;  2A5W A;  4BHP A;  4E7S A;  2X1E A;  1X3U A;  2EIJ H;  2XB0 X;  3H5A A;  4BY7 J;  1HST A;  4BEH B;  4M9X A;  4AIJ A;  2KDO A;  2B9S A;  4AIK A;  2XAH A;  4A2U A;  3W3C A;  1UG2 A;  2UWM A;  1QU3 A;  4RAY A;  3S2W A;  3CCL I;  2JK3 A;  4EGZ A;  1MD0 A;  4FQG A;  3L2W A;  2KIQ A;  3DBR B;  5FLX Z;  2JRM A;  1MBJ A;  1R4M B;  1SAN A;  3GCM A;  5FLM J;  2KRC A;  4IVN A;  4R1H A;  2ZKZ A;  2LOO A;  1ZGA A;  3BTI A;  3HIF A;  4MEY F;  3HGY A;  5HLI A;  2OZ6 A;  1IZ1 A;  3OYJ A;  2YU3 A;  4CYC B;  3QU6 A;  3E6M A;  3CF5 F;  2IVM A;  5ICF A;  1NG6 A;  3CDH A;  2EK5 A;  1B9N A;  1A6I A;  3L2V A;  3VWB A;  3FHN A;  4NDL A;  4A3L J;  1MSE C;  3CJQ B;  2ZME B;  1ZRE A;  3G3Z A;  2A6H F;  4IOA F;  5E1Z B;  2PI0 A;  3JRB A;  1PDN C;  3HRM A;  1R9T J;  3CMY A;  5KVR A;  3BT9 A;  3R4K A;  3W6J B;  3LSK A;  1Z7U A;  3WTT C;  4I98 B;  4LLG F;  1FYL A;  3FXR A;  1JUP A;  3IHU A;  1ZYR F;  3BJO A;  4HV5 A;  4HAM A;  4KT5 C;  2NVU B;  5DM7 F;  2F4O B;  3S93 A;  2QEN A;  2QZ8 A;  4HA8 A;  1JT6 A;  3P9I A;  1OCR H;  3CCV I;  1EH7 A;  1YJ9 I;  2DA4 A;  2XAG A;  4XIC A;  3GYH X;  3HOZ J;  2VOD A;  2CW0 F;  3RPU A;  5EYR A;  3VPR A;  3K1N A;  3NAR A;  5HLG A;  3HB9 A;  3CCY A;  4GDF A;  2IA2 A;  1S8N A;  3W2A A;  1TQI A;  2YX4 A;  3PO3 J;  4GXO A;  4XRF A;  3OYC A;  3J81 Z;  4ZTF A;  5LHG A;  2H1L A;  2OTJ I;  2PJR B;  2WV0 A;  4CXF A;  5KK1 A;  3RTR A;  2Q2E A;  1YTY A;  2IT0 A;  4L5J A;  2ZSH B;  2K3F A;  4U7B A;  3LAJ A;  1TQP A;  2ELK A;  2L4M A;  4WF2 A;  4ABZ A;  4NUB A;  2ID6 A;  3K2A A;  2JA5 J;  4RGX A;  2KHM A;  4M9Z A;  2CU7 A;  1XSD A;  4CUG A;  1PUF B;  5LD2 C;  4B1R A;  4RAG A;  2HEO A;  4I2O A;  1QPM A;  4CSW A;  1UMQ A;  1G3W A;  4KIB A;  1JXS A;  1P9Q C;  3NRV A;  3T0Y A;  5CKT A;  2FD5 A;  3DBL B;  3HOX J;  3QU3 A;  3KP6 A;  2F5F A;  1FLI A;  2HQ5 A;  4KT6 A;  1OR7 C;  2R7R A;  2BVL A;  3UKG A;  3EUH A;  1DU6 A;  3OYF A;  1B59 A;  2W00 A;  4LG0 A;  2VKE A;  2FA5 A;  1JKQ C;  5FB2 A;  4JQF A;  4LFU A;  4F91 B;  2M0C A;  2JMW A;  3K10 A;  4C3J J;  4A0Z A;  4F52 A;  1GUU A;  2CW7 A;  3DXJ F;  5D6F A;  2DLL A;  2G0E A;  2ZCW A;  4EVI A;  2P5V A;  2CGP A;  5FRN A;  1P7I A;  2QCO A;  3U1K A;  4BXX J;  3BG3 A;  3H3U A;  4DYC A;  1WQ2 A;  1EF4 A;  4A3B J;  4ENJ A;  1RR7 A;  2IS4 A;  4NB5 A;  3WU0 A;  3ESW B;  3K7A J;  3H5R A;  2OAZ A;  2K86 A;  4XN3 A;  2GXB A;  1OYW A;  4YFK F;  5ICG A;  1U8R A;  4I02 A;  2OCC H;  4IX7 A;  2OJE D;  4RB2 C;  1MBG A;  2HXI A;  2CV2 A;  3SJM A;  3WTY C;  3ECH A;  3TW7 A;  4RAF A;  2L7M P;  3L2Q A;  3WHC A;  2K40 A;  1DUX C;  4ANJ A;  1UHS A;  2BV6 A;  5BQT A;  4BY1 J;  2ZME C;  4W97 A;  4V2F A;  4HX8 A;  1CF7 A;  1STZ A;  3OSG A;  1Y0N A;  3BR6 A;  2OQG A;  2NOJ B;  2CYY A;  2DA1 A;  3WTS C;  1R58 A;  2YR2 A;  4V19 K;  4ON0 A;  1LB2 A;  1I3A A;  3K4J A;  1U9N A;  4KMF A;  2LF7 A;  5CQG A;  3OYA A;  4XLP F;  4C3I J;  1ZLK A;  1A36 A;  1LFP A;  4DIQ A;  2E5Z A;  2EFN A;  3ERE D;  2UXN A;  2XGE A;  4A69 C;  4A3D J;  2YPR A;  4A3J J;  2O8X A;  1KU9 A;  3IWF A;  1IN6 A;  2STT A;  4X6A J;  1X58 A;  4U0V A;  4A12 A;  1F9N A;  3K69 A;  2BY1 A;  4MNU A;  4N4N B;  1D0Z A;  5IP6 A;  2Q8K A;  1NG7 A;  4LD5 A;  3FIW A;  2OPT A;  3A1Y A;  2V9V A;  5KNL A;  4EMS A;  4KIT B;  2DOD A;  1Q1H A;  3JTG A;  4GCV A;  4BDY A;  2HYF A;  3F8B A;  2JN6 A;  4BL0 B;  3BG5 A;  3E6C C;  2GXA A;  2LY2 A;  1IN8 A;  3A0B C;  1MMG A;  3OYL A;  1KYZ A;  3D5R C;  4LIV A;  4B47 A;  3WE2 A;  3JCU C;  2G9W A;  2XHK A;  3BTJ A;  3E5U A;  2ZXW H;  3BQY A;  4B44 A;  2JUC A;  2K02 A;  4D7M A;  2R5Y B;  4BE0 A;  1VQL I;  2RVC A;  4LB6 B;  2HVS A;  2EB7 A;  1N75 A;  3FXL A;  1P7J A;  1ZKG A;  5KCM A;  3I56 I;  5AIQ A;  1CQT A;  2DFF A;  1WRJ A;  4LMY A;  2ZFW A;  3CCR I;  3HRS A;  2UXX A;  1YO5 C;  4XR6 A;  3ZQF A;  1QGP A;  1BN5 A;  4BJT A;  1ETV A;  2GZW A;  1Y1W J;  1HSJ A;  5B5E C;  2LK2 A;  3TL4 X;  3QOE A;  1D3Y A;  3SFI A;  3S3N A;  1K79 A;  2NVQ J;  3CJT B;  1R1T A;  4Y17 A;  3HTU A;  3F3X A;  2GBY A;  3JRE A;  3Q9S A;  2VOO A;  2H94 A;  2L7K A;  2F4I A;  1HA8 A;  2ME0 A;  2P4W A;  2R7T A;  1RET A;  4QTR A;  3D1N I;  4B43 A;  1ODD A;  1YW9 A;  1S29 A;  2CFO A;  2ECB A;  4BBR J;  3HOS A;  1P4A A;  4KFC A;  4G7H F;  3JSP A;  4N9H A;  1YX5 A;  2XKO A;  2GM4 A;  3KP2 A;  4N0B A;  2LH9 A;  4RDU A;  5DEQ A;  2IS1 A;  4MTD A;  5GAE J;  2ZBK A;  3RJP A;  2RRE A;  2DFI A;  1DGR M;  1DPR A;  1TBX A;  3F21 A;  1BIA A;  1W0T A;  3I4N J;  3R60 A;  4NC7 A;  2M9H A;  5IY5 H;  4FHT A;  2NYX A;  3SHF A;  3OYM A;  1Y1V J;  2RQP A;  5C44 J;  1OCC H;  1LE8 A;  3PFY A;  3IH4 A;  4U0W A;  2YU9 J;  3GO5 A;  1J0R A;  4L5I A;  5TGT A;  4E70 A;  1GV5 A;  2DJN A;  5JVG F;  2K9N A;  4OIN F;  4IL6 C;  4JBA A;  2WA0 A;  1S7E A;  3V42 A;  2ZME A;  2ELJ A;  3H9G A;  1V4R A;  2KT0 A;  3LSM A;  4UUS B;  3I0T A;  4PGG A;  3QP5 A;  1XMX A;  4RLF A;  4A6E A;  1Z77 A;  3TOB A;  2QWW A;  2QQ8 A;  3ZQQ A;  1OCT C;  4Y13 A;  4S05 A;  5C4J J;  2P0W A;  3BPX A;  2X51 A;  3CDI A;  2TCT A;  1LDJ A;  2HVR A;  2Z9O A;  2NS8 A;  1BI0 A;  1XGS A;  2GA2 A;  4D7N A;  3IWZ A;  4EEF G;  3HOT A;  4QLC U;  5J1Y A;  1WHU A;  3ONQ A;  4CGZ A;  1IXC A;  3MZY A;  3CMM A;  2LP0 A;  2FBI A;  5E18 F;  3C1D A;  4KIF A;  4BBS J;  1H9G A;  2EFP A;  2EH3 A;  1T33 A;  3H35 A;  5E3M A;  1MNE A;  3S1M J;  5D5U B;  1C0W A;  3KLO A;  2IS2 A;  1D8J A;  2Y48 A;  2CFX A;  4XK4 A;  4IHV A;  3FDY A;  3TED A;  3AL0 B;  4IO9 F;  3JTH A;  4Q4Z F;  4JX4 A;  2KFD A;  5F1R A;  1TWH J;  2IW5 A;  2QSH X;  4B4C A;  3FMR A;  4Y15 A;  1RUN A;  1ERD A;  4M3E A;  1R1U A;  3ABT A;  3ZQG A;  2LKX A;  5DCM A;  2H1K A;  3JRA A;  1QZY A;  4JX5 A;  3OOP A;  4HST A;  1ZG3 A;  2R7U A;  3N4M A;  1TWA J;  1T0F A;  1XMA A;  2DYR H;  2CSO A;  2V1U A;  3I3L A;  4YEJ A;  4ASN A;  3PNT A;  5FLX K;  1S9H A;  1I6X A;  3ULQ B;  5D6E A;  3I9V 2;  4M3F A;  1FTT A;  1XSV A;  2DA3 A;  3GEZ A;  4ZYD A;  1XGN A;  3DV8 A;  2IRF G;  2ACJ A;  4LK1 F;  1Z21 A;  2R7S A;  2Z33 A;  2R92 J;  2VJJ A;  3HEF A;  1XD7 A;  2V4J C;  3DQV C;  5J4Y A;  1FZP B;  2JA7 J;  3HPH A;  3GTK J;  2IA1 A;  3TGN A;  1POG A;  2YX7 A;  2MH9 A;  2R7O A;  4FIS A;  1LFU P;  4CHU A;  4FE4 A;  3ZN0 A;  4A6D A;  1HOM A;  4XBF A;  2K9S A;  3CME I;  1Z7L A;  2F5E A;  3H5N A;  3DPU A;  5DD4 A;  2E1N A;  2BHZ A;  3P9C A;  2M87 A;  4XLA A;  4O3M A;  1FBS A;  1U5T A;  1LDK B;  4FX0 A;  5JLW A;  3NEU A;  5H6Q A;  5CVU A;  1N78 A;  2IEK A;  2FML A;  3QYF A;  1USS A;  2HDD A;  1GHC A;  4O5V A;  1H9T A;  5LEJ A;  3BJ6 A;  5CQE A;  1RR8 C;  4RBO A;  2R7W A;  4HSR A;  3GF2 A;  3QYB A;  3LAP A;  1S7A A;  1ETK A;  3KYC B;  4LB5 A;  4RM2 A;  2DOF A;  1A04 A;  1E3H A;  3SYT A;  1IXR C;  3J81 K;  2HQR A;  3FBI B;  4PJL A;  4AVP A;  1FYK A;  2RV8 A;  2Y0S A;  5GAD J;  1FNN A;  4OIR F;  1VZ0 A;  2L5Q A;  2BXY A;  1W0U A;  1YRN A;  3MCZ A;  4HBL A;  4U88 A;  2MA3 A;  4O6J A;  3GTJ J;  4LG0 B;  1BIB A;  2VKD A;  3W2V A;  1JT0 A;  1V5G A;  2KLO A;  1H0M A;  1XG1 A;  3K0L A;  2MD5 A;  1ITY A;  1WWX A;  3LA7 A;  2HNH A;  5JHF A;  5K7H A;  3Q0U A;  4J00 A;  3KE2 A;  2DJI A;  2XAF A;  2M2E A;  4JK1 X;  4MIM A;  2EZL A;  1J5Y A;  1RES A;  4C30 A;  4GYG A;  4Z6Y A;  2A61 A;  3DPT A;  4ESB A;  5LFA A;  1QBJ A;  3N05 A;  2OTL I;  2Y30 A;  3IAM 2;  4M3D A;  2XPV A;  2XSD C;  3R0J A;  3S2H J;  4DZP A;  1R22 A;  3DEE A;  2BVM A;  2M7B A;  4A3K J;  4UXN A;  2VQH A;  3HOY J;  2ZJP F;  2A68 F;  2JSC A;  1YG2 A;  2E19 A;  3CTA A;  4L9J A;  3U9G A;  3PQJ A;  3ZQH A;  2ZJQ F;  2DXI A;  2VJI A;  3AL0 C;  1BJA A;  2M3A A;  1WJD A;  2W7N A;  2XAQ A;  1EKE A;  3RQ4 A; 
#chains in the Genus database with same CATH homology
 9ANT A;  2HYJ A;  1A6I A;  2JWT A;  2JA6 J;  4NDL A;  5IYC J;  1JKO C;  4A3L J;  4L5E A;  1MSE C;  3B6A A;  3LOC A;  3Q0W A;  5FKO A;  2PMZ N;  1WPK A;  3HOW J;  2B63 J;  3JRB A;  1R9T J;  1APL C;  3CMY A;  3BT9 A;  3O8H A;  5F04 A;  1B72 A;  2EBI A;  1TWC J;  4DZJ A;  1HDD C;  1JUP A;  3Q0V A;  4MO7 A;  1MBH A;  1JT6 A;  5J1R A;  5GP9 A;  1ETY A;  4A3I J;  2DA4 A;  4XIC A;  5EEA A;  3A02 A;  2ME6 A;  1WGX A;  3HOZ J;  5EYR A;  3SDG A;  3VPR A;  3JRI A;  3NAR A;  3HB9 A;  3CCY A;  2L9R A;  3PO3 J;  1XS9 A;  3ZQL A;  3PO2 J;  2ID3 A;  1BW6 A;  5IPA A;  3QPL A;  5GPA A;  1TWG J;  3GBG A;  1BW5 A;  1QVT A;  3GTQ J;  3HOV J;  3M4O J;  2JJ7 A;  2HI3 A;  1JJ6 C;  2L7Z A;  2W48 A;  1JGG A;  1BA5 A;  1WI3 A;  4MLO A;  4AUX A;  1VF9 A;  4J19 A;  4V2G A;  2ELK A;  2TRT A;  4ABZ A;  2ID6 A;  2VKV A;  2DA2 A;  3K2A A;  3OIO A;  2JA5 J;  2DA6 A;  2CU7 A;  1H8A C;  2WV1 A;  1PUF B;  4B1R A;  5F0C A;  3A01 A;  1UMQ A;  2LFB A;  1ENH A;  2FD5 A;  3HOX J;  2YS9 A;  5FLV A;  2HQ5 A;  5FKN A;  3H3V K;  2R5Z A;  3H0G J;  3UKG A;  4A3G J;  1DU6 A;  4A3M J;  5EF6 A;  3S15 J;  2VKE A;  1IC8 A;  1JKQ C;  2D5V A;  5E3N A;  4LOC A;  4AYB N;  2FJ1 A;  2M0C A;  1U9O A;  2JMW A;  2XGC A;  4C3J J;  1MH3 A;  2N8G A;  1GUU A;  4QIW N;  3E7L A;  1AU7 A;  3W6V A;  4D5F A;  1JUS A;  2G0E A;  1MSF C;  1P7I A;  2QCO A;  1JUM A;  4BXX J;  1F43 A;  3BG3 A;  4DYC A;  4A3C J;  4I6Z A;  1EF4 A;  4A3B J;  2QF7 A;  1RR7 A;  4D5C A;  3K7A J;  5DTD A;  4FTH A;  4A93 J;  3JRG A;  3JRC A;  4CYC A;  3ZOB A;  1IG7 A;  2MG4 A;  5F27 A;  2DMU A;  1FEX A;  1MBG A;  2HXI A;  3SJM A;  3TW7 A;  4JYK A;  2L7M P;  3BR0 A;  3S17 J;  3DCF A;  3WHC A;  2K40 A;  1SFO J;  1UHS A;  4BY1 J;  2WAQ N;  4W97 A;  4V2F A;  3WHB A;  3OSG A;  1LE8 B;  3BR6 A;  2DA1 A;  3LNQ A;  1MH4 A;  4A3E J;  5M5Y J;  1VI0 A;  1MNM C;  5K7F A;  1U9N A;  3HOU J;  4C3I J;  5IYD J;  2YUS A;  5FKL A;  2DMT A;  3GTG J;  3BG9 A;  4Y52 J;  3JRF A;  2M8G X;  2XGE A;  3M3Y J;  4A69 C;  4A3D J;  4A3J J;  1HF0 A;  1NTC A;  4X6A J;  3PM1 A;  1X58 A;  2O7O A;  2LY9 A;  3LSP A;  2AO9 A;  1MBE A;  3O8G A;  5IP6 A;  5M5X J;  5EG0 B;  3FIW A;  2OPT A;  1I50 J;  3MN2 A;  4MFD A;  1K61 A;  3ZQC A;  2JN6 A;  1GT0 C;  3BR3 A;  3BG5 A;  5FKK A;  4A3F J;  3QQA A;  2DMP A;  2VUM J;  1NK2 P;  2Y0S N;  2HOS A;  2WB1 N;  1IRZ A;  2XB5 A;  3JRH A;  3BTJ A;  2X9D A;  5M5W J;  3BQY A;  2R5Y B;  2E2I J;  4D7M A;  5GPC A;  5IP9 J;  3LSR A;  1PUF A;  4XRM A;  1P7J A;  3CDL A;  5C3E J;  1ZKG A;  1CQT A;  2NOG A;  1X2N A;  1BL0 A;  1A5J A;  1ZK8 A;  2Y2Z A;  1ZTR A;  1QPI A;  2EQR A;  3ZQF A;  3OSF A;  1ETV A;  1Y1W J;  1NK3 P;  1Q1V A;  2LK2 A;  5FJ8 J;  1HLV A;  4X1E A;  1HDP A;  2HOA A;  3SFI A;  5HOD A;  1LFB A;  4QSH A;  2NVQ J;  2MSY A;  3ZQI A;  1TC3 C;  3BTC A;  2LLK A;  2GBY A;  3JRE A;  1FJL A;  1X2M A;  1ETW A;  2ME0 A;  1IDY A;  1RET A;  4QTR A;  2P81 A;  3D1N I;  2CQX A;  1IV6 A;  3JR9 A;  2X48 A;  2ECB A;  1WH7 A;  4BBR J;  1H88 C;  4MFE A;  4C3H J;  5BNG A;  2CRG A;  2GM4 A;  2ECC A;  1Z0X A;  1OJL A;  4W1U A;  4RDU A;  1BJZ A;  2IAI A;  2MGQ A;  1E3O C;  2M34 A;  3HBL A;  2EZH A;  3GTP J;  1I6H J;  1GV2 A;  1W0T A;  1U8B A;  3S1N J;  1RPW A;  3I4N J;  4FE7 A;  3MKL A;  3QPS A;  2M9H A;  4AC0 A;  5DS9 A;  1OFC X;  1OCP A;  4DYR A;  3NAU A;  3S1R J;  2CUE A;  3HGG A;  2X6O A;  1Y1V J;  2RAE A;  5C44 J;  1FIA A;  3RQI A;  5E3L A;  3GTO J;  1LE8 A;  2E2J J;  2GLO A;  3IH4 A;  2YU9 J;  5F1J A;  1F36 A;  2EZK A;  1GV5 A;  3LSG A;  2DJN A;  2K9N A;  4DYQ A;  4GFB A;  1S7E A;  1JTY A;  3S1Q J;  4UUS B;  2KT0 A;  5M3M J;  2NVY J;  1AKH B;  3CQZ J;  2LD5 A;  1Z77 A;  5F08 A;  3RKQ A;  3S14 J;  5IOY A;  1ZR2 A;  1OCT C;  1ETQ A;  2COB A;  4IEJ A;  4B3A A;  5C4J J;  1YRN B;  4DW6 A;  2FX0 A;  2IBD A;  3LSJ A;  2XRL A;  2VI6 A;  2TCT A;  1O4X A;  1B8I B;  2NS8 A;  5EG0 A;  2Y9Y A;  4D7N A;  1MBF A;  1K83 J;  4EEF G;  3HKZ N;  1ZGW A;  2CQQ A;  5EGO B;  5J1Y A;  1WH5 A;  1QVU A;  2I10 A;  2LP0 A;  1WCM J;  1IDZ A;  2NVX J;  3GTM J;  1ZR4 A;  4BBS J;  1ETO A;  2EH3 A;  1T33 A;  5E3M A;  3S1M J;  1HCR A;  5M3F J;  3GTL J;  2O9L A;  4C2M J;  5FKM A;  1FTZ A;  2R5Y A;  4XK4 A;  4IHV A;  1FIP A;  4XRS A;  3TED A;  4UUT A;  1I3Q J;  4JX4 A;  1ETX A;  2MW8 A;  1TWH J;  3FKI J;  5IOZ A;  2LTP A;  4B4C A;  3Q3S A;  2OF7 A;  4M3E A;  4IHX A;  3ZQG A;  3G1O A;  2LKX A;  5EDN A;  2H1K A;  2L7F P;  3IV5 A;  3JRA A;  4M3B A;  4JX5 A;  2NVT J;  1AHD P;  1TWA J;  5EZH A;  4HNV A;  5JLX A;  1IJW C;  1B72 B;  2AHQ A;  3DEW A;  3FK6 A;  4JP0 A;  5J1U A;  3IH2 A;  2DTZ A;  4M3F A;  1FTT A;  2XPW A;  2DA3 A;  3C2B A;  4BKX A;  2L0K A;  1T56 A;  4S0H B;  3FK7 A;  2R92 J;  3HEF A;  2HOT A;  4M3G A;  2JA7 J;  3GTK J;  3IH3 A;  2CUF A;  5F0F A;  2KDZ A;  1POG A;  2CJJ A;  1ORK A;  4FIS A;  1LFU P;  1JTX A;  4FE4 A;  2VPR A;  1GVD A;  4IHY A;  1HOM A;  2R93 J;  2K9S A;  2NS7 A;  1GDT A;  2E2H J;  1TWF J;  3TW6 A;  2R0Q C;  2LVS A;  3F0C A;  1QRY A;  3FIS A;  3A03 A;  3HDD A;  1D5Y A;  2ZB9 A;  3S16 J;  4JX6 A;  3MVP A;  4Y7N J;  5JLW A;  1JKR C;  4XRS G;  2IEK A;  4I76 A;  2HDD A;  4XID A;  5K7Z A;  3G1L A;  1VFC A;  1IGN A;  1U78 A;  2JA8 J;  5J3L A;  3S2D J;  2DMN A;  4RBO A;  1RKW A;  3JRD A;  3RZD J;  1DU0 A;  3OOU A;  2FQ4 A;  2H8R A;  3A01 B;  1ETK A;  3L1P A;  2DA7 A;  2Y9Z A;  4UUS A;  3G1M A;  5IP7 J;  2E1O A;  1AKH A;  3RZO J;  5C4X J;  2DMQ A;  5EZG A;  2R5Z B;  2O8K A;  1W0U A;  1YRN A;  1ZQ3 P;  3TP0 A;  2EZI A;  3GTJ J;  2XGD A;  3B6C A;  1JT0 A;  2DA5 A;  1B8I A;  1MBK A;  4M6V A;  2XB0 X;  4BY7 J;  1G2H A;  2DN0 A;  1RKT A;  1XG1 A;  1XC5 A;  1JJ8 C;  1ITY A;  1VND A;  1UG2 A;  3BQZ A;  4G12 A;  5K7H A;  3Q0U A;  5EGO A;  1H89 C;  2M2E A;  2Y31 A;  2JK3 A;  4MIM A;  2EZL A;  3HM5 A;  1RES A;  5E3O A;  4IHW A;  1JKP C;  3BR1 A;  3BR2 A;  1MBJ A;  3BR5 A;  2Y30 A;  1SAN A;  4M3D A;  2XPV A;  2XSD C;  5FLM J;  2XPU A;  3TP3 A;  4DZP A;  3S2H J;  3BTI A;  5F0H A;  4A3K J;  3HGY A;  3BTL A;  3HOY J;  3I4M J;  1IUF A;  2HXO A;  2K9Q A;  2LR8 A;  2E19 A;  3ZQH A;  2R7Z J;  4CYC B;  5IYB J;  4FCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...