2VPLA

The structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
137
structure length
137
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 50S RIBOSOMAL PROTEIN L1
publication title Domain II of Thermus thermophilus ribosomal protein L1 hinders recognition of its mRNA.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 30
structure length 137
sequence length 137
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2630 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vplA01
2VPLA 2OV7A 2OUMA
chains in the Genus database with same CATH superfamily
5F08A 4ITVA 1SVOA 3TO6A 4LOCA 4EJUA 1IUFA 3A0BC 4A5MA 4AIDA 4XR6A 2X1DA 4C2MJ 3F8BA 2IBDA 1NK3P 1Z77A 1Z67A 3HSRA 4O5VA 2K9SA 2EINH 2CU7A 1G8XA 4MO7A 3DU5A 3F3XA 4ZZDA 1FX7A 3I3LA 3WTWC 1SFOJ 2HQRA 4XSZF 2H8RA 3ABMH 4PSWA 4XORA 5FD5A 4YRVA 1SAXA 4FE7A 3HIFA 3ROUA 3L7WA 2VC0A 2XAGA 4E7ZA 2RC4A 3R0AA 2KIMA 3PFYA 1VQ9I 2KKOA 3RYPA 2Y0MA 3VFZA 2P81A 3T1BA 3GYHX 1FT9A 1TNSA 2LOOA 1RUNA 3RSNA 5B3SH 5DV5A 2E7WA 4Y52J 2DJNA 2V1DA 3WGGA 3MKLA 2AXTC 3TGNA 4Q5SF 1U8RA 1I27A 4JQFA 3U2RA 3H9GA 1K78A 3P9IA 3CLOA 1FP1D 2NOGA 2QQBA 3RZOJ 2XGXA 5ICEA 4A0ZA 4KFCA 4PUSA 2JSCA 5IT9Z 2V26A 1T08B 4XLNF 4XONA 1E17A 2VL8A 1ZAOA 2VB6A 3CCRI 3BR2A 3HUGB 1F5TA 4N4NB 3RPUD 3BP8A 1YRNB 2Y2ZA 3WU2C 2WV1A 2R5ZB 3U1KA 2PBIA 3O8GA 4KMUX 1ZREA 5BOXA 1MJBA 3TKYA 1F36A 3KYDB 2BY0A 3H3ZA 1ENHA 4XOTA 4EM0B 2HOTA 3WU0A 3W6KB 1I3QJ 3OYKA 1GV5A 2XKPA 2PJRA 3L00A 4M9XA 3V7RA 2XGEA 3L9FA 4ZYHA 3RI4A 3W2AA 2G0EA 2R93J 3OIOA 1E2XA 5F64A 2M4GA 2BY1A 2CYYA 3G6EI 1LB2A 3BG7A 4BXUA 2WWYA 1YX3A 2QKLB 3W3CA 4E70A 5LGTA 2CJJA 2MA3A 4XSXF 3UNGC 4XLEA 1OCOH 2DN0A 4G7ZF 2Y0SN 2Y75A 1HDDC 1X3UA 4JX4A 4I01A 2JA8J 3P9KA 1MJ9A 2V9KA 3S8PA 3A02A 2EIJH 1W36D 4UUTA 3KYLA 2R0QC 2VBYA 2CSOA 4MGRA 2Y0SA 1QRYA 2M9HA 3Q3SA 4HV6A 2UUZA 2KL4A 2X85A 3FXRA 5DUIA 4KDPA 4XIDA 1H9GA 3CF2A 2WAFA 2DDAA 1WVRA 2KIUA 3ZMSA 2COMA 1XDUA 2EPFA 2VKEA 3HJEA 3L2CA 2VKDA 1AU7A 2AQFA 4E7JA 1Q1HA 2KIQA 3JW4A 5IP6A 3M3YJ 2BGCA 3CCLI 1FLIA 4BEHB 2HXOA 1ETWA 1UHWA 2ZCWA 4I6ZA 3QOPA 3S2DJ 1VQ5I 1WJFA 3OYCA 2IT0A 1IRXA 2LREA 3CZ6A 2K9LA 4WXHA 4XBFA 3V8LA 1JKOC 3IHUA 3DP7A 2IPQX 3CJNA 1A6IA 1ZGJA 2HTSA 3E6CC 5AONA 5F1JA 4WF2A 2CQ7A 2XPWA 3MKZA 1FZPB 1RR7A 5D5UB 2YX4A 2ZNZA 3QP6A 2DMPA 2E1MB 5DM7F 5A2QK 3M07A 3R60A 3IH2A 2ZJ2A 2NYXA 4AVPA 1YHQI 3FIWA 4GCVA 1D3YA 2W4SA 2VQLA 3I55I 2WY7Q 4NC7A 4D7NA 2GIZA 2VN2A 5LBQA 2EZIA 1L3LA 4LIVA 1XMXA 1B9MA 1XG1A 1R7JA 5KHDA 1J5YA 3J7ZI 3CO6C 3BZ6A 3EPZA 1J0RA 2QLZA 4I09A 4C3IJ 2DTRA 4N0BA 3C2GA 2DA1A 5CVVA 1KYWA 4LMYA 4IO9F 4A6DA 1QVUA 2ZB9A 3VYUB 4CO8A 3ULQB 3PUBA 2M3AA 1FBSA 1SD4A 4RB2C 2X6OA 1MIJA 1IXSB 1VNDA 3DF8A 3BT9A 4NDLA 5EG0A 3S1RJ 1IV6A 3PQJA 4QTRA 2MSYA 4KICA 3F6VA 1YFHA 3X2QH 1KU7A 3E3VA 2Y9ZA 2KDZA 2R7DA 5J1YA 1KU9A 2ISYA 2HYFA 1PUFA 2W00A 3O6BB 1O3RA 2WB1N 1MJAA 3ERMA 4BS9A 2H94A 2HKXA 3I64A 2MYSA 2PJRB 2JPCA 3OYBA 3L2RA 2JWTA 3T8RA 2IA2A 2X6XA 1T95A 1OCRH 2MFZA 3HOWJ 5KAIC 5GTIC 3HL2A 3DBRB 3CDLA 3GTQJ 3D5RC 3FWEA 2L7KA 4FHTA 2WC2A 2HTJA 2KP6A 5D8LB 1ZKGA 4M73A 1KQ0A 3LFKA 4FISA 4HRIA 3PFIA 4RB3C 1Z91A 5KNLA 1HW5A 5JLWA 5IT9K 3ZGKA 3E6BA 4EM2A 1I3AA 1X1BA 4RLFA 3J7AY 4L9TA 2L02A 5CKTA 4UUVA 3ASNH 1VTNC 4MEXF 1I6HJ 1VZ0A 3HOYJ 2OV7A 4ZTFA 5FKOA 1RKWA 3BTLA 3KP2A 1JHHA 4J01A 2IGOA 1FBQA 3GBGA 4N4OB 1ZGWA 3K4NA 3DPTA 2HQ5A 2O8XA 4CH7A 2IS2A 1R6RA 2KMUA 5DD8A 2P0WA 3FMQA 4UVCA 1OPCA 1LFBA 5J8FA 4DIQA 2UV1A 3OYLA 2IP2A 3JRBA 3CCEI 1IJWC 2GA2A 4ENJA 3TQNA 4IRHA 3M1CA 2WA0A 4OINF 2HYGD 3KX2A 1ETKA 4C30A 4M3DA 3GFJA 4N9IA 2GWRA 4XL9A 1S72I 3VB2A 2ZXIA 5F1RA 2O9LA 2ZC2A 2R7TA 2FSWA 5E1XA 1FSEA 4RAYA 3RTRA 1S7EA 1SAUA 3M4OJ 1R71A 2HNHA 2XAUA 1TQMA 4CDGA 5M5WJ 1Z6RA 3QPSA 2M1BA 2CV2A 1VF9A 1XMKA 1EH8A 2F4OB 1MZBA 1YQAA 3CP2A 2JRMA 3F8MA 3LA7A 2XKOA 5ERIA 3I59A 1BR2A 1R1TA 4A3FJ 3JREA 4P9FA 1PJRA 3JSOA 1N25A 4E7KA 2K02A 3B02A 4HNVA 1A31A 4A3LJ 5BS6A 2EWNA 5HNFA 4A3EJ 2A3SA 1ERDA 3ZR8X 2VT3A 4HF2A 1DGWY 2EV5A 2EQRA 2FBIA 3FF5A 1Z0XA 1QA6A 2QVOA 2GLOA 2A05A 1W7PA 4RMNA 5GAEJ 1HW2A 4DBRA 2LC2A 1IW7F 3BG9A 2JN6A 5DS9A 3QYFA 5EG0B 1Y6IA 3OMYA 1AWCA 1XS9A 4D1QA 5DEQA 1Y39A 2XDVA 1JJ8C 2Y9YA 1D8JA 2E7XA 1D8KA 3HGYA 1Z9CA 4OMYA 1PUFB 5ICGA 4EVIA 2DI3A 2GXGA 3HEFA 1MBKA 2Z5UA 3L1PA 3S3NA 3GFLA 3DEUA 1IN8A 3J81Z 2LKPA 3LQQA 5M3FJ 3SXYA 2RQQA 4IHVA 2Z2SB 3VOEA 4A3JJ 1XCBA 4YEJA 1MDMB 3AG1H 2X0LA 3M1EA 3JRFA 1YOVB 2K40A 2BBYA 4KNYA 1R36A 4HPQA 4UV8A 1NG6A 1Z1DA 1XCVA 2ID6A 1TZLA 4CA0A 5ED4A 1N78A 3MEXA 4PFOA 4HV5A 1ZG1A 3GTKJ 1S29A 5EEHA 1O7FA 3KETA 4AU7A 2P5LC 4H4KC 2ECCA 1HA8A 4X0GA 5J1RA 3WTYC 3AG4H 5K7FA 2K9NA 4XLCA 2XPUA 4YIFA 2FBKA 3OR1C 3LSRA 3KP7A 2ZXJA 5EF6A 1WHUA 2ZBKA 1OYWA 3L2VA 5IOYA 2XAJA 4MEYF 1JGSA 4XRFA 3I53A 3KEYA 4Y15A 2K85A 1OISA 2IJLA 1ZRDA 1YW9A 1J75A 5EJCA 3RKXA 3WTTC 2D45A 3RCOA 2L9NA 3FHNA 4XNFA 3PNYA 2L9SA 2LY2A 4S0HB 2VPRA 1USTA 3CJQB 1HQCA 2HQNA 3E97A 2E71A 3S3OA 5IY5H 3L2WA 1FPQA 4HQMA 1DU0A 1YJ9I 2P7CB 5HLTA 4FCYA 1FYKA 3LFUA 3ERED 2Y31A 3H36A 1FEXA 1MGTA 4IOCF 2QUFA 4ZYEA 2JTVA 5F0FA 1T0FC 2X51A 1ODDA 2VUMJ 1ON1A 2BV6A 2LF8A 3WGHA 2W24A 4KT6A 4PGHA 1PUEE 5EYRA 5HDNA 5D8KB 2NAZA 2ETHA 3BTJA 3I4MJ 1ZQ3P 4LFUA 3EUHA 3IKTA 2ZNYA 3ABTA 2CO5A 4XKVA 4ESBA 1A6QA 2G7UA 2DA4A 1MH4A 2QWWA 2QENA 3JRCA 2QQ9A 3CC7I 1I50J 1NG7A 2K7LA 2XIGA 3LSMA 5FKNA 1SD7A 2VBXA 4I99C 4PCQA 3G1LA 3GCMA 1YJNI 1J7KA 2V9VA 2ZJPF 4U7DA 3KZIC 1RPWA 3IAM2 5AIQA 2E36A 3ZMTA 2GOXB 4UY8I 4BJ5C 3U9GA 1HC8A 4RB0A 2DT7B 2STWA 3OSGA 3ZN1A 1MBEA 2VODA 1RR8C 5E3LA 3QQAA 2X6WA 1WCMJ 4BQOA 2VQHA 3CCVI 1MBGA 5KK1A 2O5RA 2DAOA 3H92A 5J40A 4F55A 2E1OA 3V8KA 2P6SA 2PFBA 4KA4A 4CXFA 2VKHA 3HPHA 4QPOA 3Q0VA 1UFMA 1CQTA 4UVAA 3NARA 1E3OC 4AYBN 1YTYA 2E2IJ 2PJPA 1X1DA 4DQ2A 3N05A 1FBUA 1WSUA 1FY7A 2OQGA 4UB8C 5DCFA 5LRRA 1XB4A 2KRHA 1T8IA 4KITB 4BKXA 4AIJA 5CLSA 4BJTA 1HBXG 1RUOA 1SMYF 1BR4A 1W36C 1U3EM 4UHTA 2NS7A 2EA4A 3C1DA 3Q9VA 3CDIA 1WJCA 2F5DA 4AWXB 4A3IJ 1R4NB 2FA5A 3Q0WA 3M7GA 4BGDA 5B66C 2A5YB 2LF7A 3D5SC 1ZG5A 2DFIA 1GLNA 3D1NI 2GIVA 4D7MA 2NXNB 4XKWA 5CVIA 2OAZA 2XROA 2L0KA 3EUAA 2DT5A 3HSEA 3LNQA 1ON2A 1ZK8A 2EZKA 5LGUA 1OCZH 2DDBA 3DXJF 3EUKL 2XAFA 2W1OA 4HF0A 4P9UA 4EEFG 3HKZA 3OOUA 1VQOI 2JUGA 3DLLF 1MSEC 3J81K 2EZHA 2ZXHA 1YW7A 3RQIA 3A2KA 3BR6A 2MLKA 2MW8A 2AQEA 4B8XA 3I56I 1AOYA 3A03A 2BHYA 4N9HA 4U88A 4IEJA 1I5ZA 2VBWA 5DCMA 3T5XA 4ESFA 2WADA 2HS5A 1OYYA 4W97A 1U9OA 1LDJA 5A2QZ 4L18B 2NVUB 1S9HA 3ML6A 5ICCA 3LSJA 2FNAA 4M3FA 1OR7C 3BLYA 4GYIA 2H27A 2F4MB 3ZMVA 5CQEA 4UNOA 2GZWA 3B6CA 2NS8A 4G6TB 3R61A 1WI9A 5K7HA 2R7WA 1ZLKA 4RM3A 2E2HJ 3PL8A 4BE1A 1DDNA 4MTDA 3BCBA 3TO9A 1LVKA 4HG2A 2KT0A 1H9TA 3VWBA 2ELJA 1IN6A 3OR2C 2DT6A 2K27A 4BYYA 3HOTA 2M45A 3K4KA 4BH9A 4XRSG 1B1BA 5D5VB 4B44A 4CZZA 4PJ0C 1SC7A 4C2TA 4RM2A 2R92J 5L3DA 1X2MA 4WK8F 4LG0B 3H0DA 3MMYB 1BC8C 3ZQ7A 2DCEA 1MNEA 2FU4A 2HI3A 2K5CA 2QF7A 3F6OA 3S2HJ 1Q1VA 4BDZA 2HXIA 4A3MJ 2MH9A 4ETSA 2L7ZA 1U2WA 4JP0A 1YIJI 2FE3A 1W0UA 4Y17A 1P6RA 2PMHA 5FFZA 1BJAA 4DYRA 1UAAA 2EA2A 1E0EA 2NVYJ 5L3BA 4L9VA 1R5ID 4QLCU 2DYSH 2H6CA 4I0BA 3KFWX 4PJMA 2FQ3A 2QBYA 1ZYRF 2CWEA 3B73A 5GTHC 1BW6A 4S05A 2KPMA 2HGCA 2P7VB 2L9RA 5JHFA 2XSJC 1ETXA 1RRJA 4XMYA 2ZSHB 3VDXA 4F93B 2LYCA 3F8CA 1XX5A 4OMZA 3KP6A 3H1CA 1MSFC 4IVNA 1XPXA 2BHZA 4B47A 2V1XA 3WE2A 1T6SA 1OCCH 1JKQC 5KVRA 5TRDA 3KEQA 4NQWA 4Q47A 4D9JA 4ESJA 3GTJJ 3RZDJ 3CUQC 5M5YJ 1Z05A 4C2UA 5L3EA 3SFZA 3BPVA 4II2A 4H0EA 2BY3A 4AIHA 2OC6A 5HDKA 4LG3A 4V19K 2VE9A 1IO2A 3DV8A 3CF5F 3LSHA 5J6XA 1OLTA 3SZPA 4ANJA 3BQYA 3LWFA 4HOBA 5HLHA 1K4SA 4L0ZB 2E5ZA 3TOBA 1K6YA 2K86A 2QZ8A 3DFGA 4HQEA 1G3YA 3K6GA 1POGA 3ZCOA 3ZPLA 3QP5A 4ZZLA 3RKQA 2BW3A 3F21A 2RREA 2R7UA 1JUPA 1LKXA 2LTPA 1G4DA 4IXAA 1B4AA 2LD5A 3MQ0A 3I4NJ 1JUMA 1AKHA 1KU2A 1WJAA 5JI6A 2WAQN 2DA5A 3E5UA 4GXOA 5DCMB 4AD9A 3G2BA 4BAYA 3PIOF 4M3GA 2Y48A 4WX9A 2ADUA 2RAEA 1BOBA 4CCKA 3A4CA 4Q48A 1RIOH 1B8IB 2UWMA 1GUUA 4A69C 5CQGA 2HFHA 3GUDA 3AL0B 2WAQA 1AA7A 4YELA 4GRIA 2EFNA 1ZRFA 2CV0A 2KQRA 2QQ8A 2NOJB 1DP3A 1B72A 4II3A 1IRFA 5E79C 2KFDA 3LAJA 5FLMJ 2ZMEC 3OSFA 2DOFA 2W57A 1TW3A 3SEZA 3F8FA 3IAS2 2MG4A 4HNUA 1R5HA 1BOAA 5HS7A 2H09A 1IZ1A 1MMDA 2V9PA 3REOA 3WTZA 1U78A 6PAXA 4GO1A 4B48A 4FX0A 5DM6F 3GEZA 5HS8A 2M7AA 3C18A 4GDFA 4NC6A 2V1UA 3HM5A 5C3EJ 1T39A 2EK5A 2IA0A 1HW1A 1BW5A 1SD6A 3ONQA 4RGSA 1FWZA 3PNVA 3AKZA 5H6RA 2OD5A 3K70D 2IGNA 4PJJA 4BDYA 3HDDA 3RQ4A 5E17F 2EFOA 1EF4A 1ZTRA 2DA3A 1KZHA 2B9SA 1WJBA 2ZSIB 3OYJA 1MBFA 5K5QA 5FROA 1VQNI 3KYCB 2K3PA 5TGTA 1ZARA 5M5XJ 2O8KA 2DK5A 4E7SA 4MFEA 4IL6C 5EEAA 3E6DA 4EJOA 1KQ9A 2FXAA 2IGMA 1QVTA 4B3AA 3KCCA 5F6FA 1DP7P 3ISPA 4CYDA 5J1UA 3G73A 5C44J 2QBYB 3N4MA 2LR8A 3IRQA 3H3VK 1K78B 5LRSA 1RI7A 1YO5C 2VIXA 3NAUA 2CH0A 2A6HF 2EFPA 1IDZA 1XSVA 2DA6A 2NVQJ 2YX7A 1WQ2A 1IGNA 3O3KA 3GZNB 3I5UA 3F72A 2VONA 3CC4I 1UMQA 1LEBA 5CVUA 4MHGA 2CUJA 4XK4A 4E4HA 3OY9A 5FRNA 1U8BA 2PG4A 3K0LA 4MIMA 5E1WA 4S04A 4V2FA 5HLGA 1V5FA 1XTAA 2UXXA 1TW2A 2JA5J 1K79A 4YG2F 1IXCA 2YU3A 4EGYA 3BJAA 5LGNA 4J00A 1MBHA 1WJ5A 1WPKA 3LQRA 3S32A 3FXJA 3KZYA 1FJLA 2QSGX 2HZDA 2DFEA 2DXIA 1HKSA 1V55H 3T8TA 2RDPA 5DTDA 3IV5A 2L9VA 2TRTA 2LDUA 2VC1A 4XLFA 2XRNA 3W6VA 3S16J 2LP0A 1UZCA 2MBFA 4KUMA 3JSPA 2HQAA 3UKGA 2EZLA 3OL3A 2ZKZA 5FB2A 4KMFA 3DCFA 5EGOA 4DJAA 1P7JA 2WB1A 2MC4A 3DPLC 1Z7UA 3CCYA 3SEQA 1JKRC 4FASD 1GT0C 2JK3A 2EIMH 3OIQA 4IHTA 2UZKA 2V4JC 3OYFA 3CLQA 2BW3B 1LFPA 2V6EA 2ZJRF 4PZJA 4DZPA 3BPXA 3CO7C 3PO2J 1JT6A 1YE9A 2WTEA 1T2KA 5HNHA 3D0SA 2R3SA 1N77A 3ECOA 2QSHX 4CCLA 5LHIA 2O03A 1ZN2A 3HBLA 2CW7A 5D4SA 3CCJI 2GM4A 1SEUA 3EDPA 1PP8F 3S1QJ 1P2FA 4Y3OA 1H89C 3IH4A 1TC3C 5HS9A 3BJOA 1MNMC 1DPUA 3TMOA 4UB6C 5H20A 2OTLI 2M8EA 1B72B 2D1VA 1P7IA 4MQVA 1ACIA 1X1PA 1WKMA 3FXQA 5JHUA 4A3KJ 1U5TC 3HYIA 2K3FA 3KLOA 1R9TJ 1D0XA 1LE8A 2IS4A 3K4JA 3IRRA 2R7SA 2NNNA 3OV8A 1T33A 3I71A 1TWHJ 2VXZA 3W2WA 4PJLA 5F0CA 2XHKA 2BVMA 2B63J 4RA2A 3GZ6A 2CQQA 1ZRCA 2W85A 4XQFA 1X2NA 5GAGJ 5LEKA 5B1AH 3BTCA 5DYMA 4M6VA 1YLFA 3FXKA 4I98B 1X19A 2ACJA 2HEOA 5HOOA 4XN3A 4ZDPA 3W6JB 1BI3A 1YX5A 4KJZA 1FSHA 1FC3A 2A69F 1QQIA 3P7NA 4P5OA 3DBLB 2VXDA 1WZ2A 4HZFA 1M1EB 3GMEA 2DJIA 3G1OA 2O6GE 3J7YJ 1T98A 3C7JA 1ZLJA 4M9ZA 5HVQC 5DDGA 3ABKH 5FKLA 1YITI 1HXDA 2JT1A 2FD5A 3OYHA 1R58A 4PK4A 2F5CA 5DUKA 4OAYA 2F5FA 1O4XA 3QODA 4I76A 5LLQA 5IT3A 1O3QA 2YUSA 1SD5A 4ON0A 4K2EA 4M74A 3OYAA 1G3SA 4OU0A 3QYBA 3FXMA 2KISA 4D0PA 4AIKA 1KYZA 4B1RA 4OOIA 3OYEA 1IDYA 1LUJB 3RPQA 3M9AA 3BZCA 4HLXA 5L3CA 3I54A 3VODA 1XSXA 2EIKH 4BACA 3IP4B 3Q0UA 5F27A 3BG5A 1YS7A 2LKSA 4DGWB 2ECBA 2AXLA 2X1CA 4JYKA 2NS0A 2HYJA 2D1HA 3IUOA 1LPQA 2EFWA 3K4LA 4NHJA 2FEZA 2R7XA 1BM9A 1FOWA 2HOAA 2Y30A 3ZN0A 1JT0A 3O2PE 1VFCA 1X1CA 2CFXA 4BHPA 2IW5A 5EGOB 3DWLE 1IAWA 4LGWA 4DOZA 4FE4A 2JA6J 3QU6A 3E7LA 1HOMA 3OWTA 1S5LC 3CESA 2KZVA 2DFHA 2DYRH 2OTJI 3V7SA 4B3XA 4EATA 5DD4A 4YFXF 4BXFA 3BOQA 3ABUA 1JE8A 5B5EC 3QU3A 3COAC 5FGMA 4HAMA 3VEPA 5IPAA 3SJMA 1B59A 3K69A 4Y4RA 3OYGA 4IQJA 1YI2I 5LHHA 3ZQCA 1ZH5A 5FLVA 1PP7U 4G94A 1QZZA 2Z16A 5EZGA 1G59A 1XD7A 1ONVA 4LK1F 1LQ1A 3C2BA 1D5YA 4RB1A 2YS9A 2L3DA 4G6QA 5JVTA 1U9NA 4JX5A 1LE8B 5J3LA 3E5QA 5D5WB 3WE3A 3QAHA 2COBA 3CDHA 1Z3XA 4AC0A 3GZ5A 1UELB 1LNWA 5E3MA 1TWCJ 4X6AJ 1YG2A 3HTUA 3WG7H 4OWRB 4IKFA 3DTEA 2I10A 2C6YA 2L7MP 1R00A 1NK2P 2Q8KA 3MVPA 3IL2A 2VJ4A 1FNNA 4IOAF 2BEOA 4MNUA 3WU1B 1BR1A 4YFKF 3C2HA 4OIQF 2DMTA 1I1SA 2N8GA 1S7OA 1JKPC 2ID3A 3H9QA 1ETYA 2ZO4A 1WI3A 4XRMA 3FISA 3HOXJ 3SHFA 3O8HA 3TP3A 4OIOF 3GTGJ 1FTZA 2E35A 2Z3YA 3I59B 2NRAC 3BY6A 4GGGA 4C3JJ 3WHBA 4ZDOA 5JLXA 3HRUA 4CUGA 3CCSI 4LB5A 2E34A 2RQPA 2HU9A 1UHSA 1ZHFA 1DUXC 4U0VA 1OJLA 4R79A 4L0YB 2NVTJ 1ZELA 2OA4A 3K4MA 3FBIB 3PJRA 1J9IA 3AL0C 3L2QA 1QHHD 2H6BA 3D5LA 3RDIA 2DPDA 2CG4A 1W7PB 2EFQA 5ICFA 1MD0A 4CCMA 1BL0A 4KISA 4P1WA 3S15J 2HR3A 1QPMA 2VBZA 1MW7A 2OPTA 3JCUC 3IC7A 2VOOA 1FYLA 1D5VA 3GTPJ 4ZTJA 3E1SA 4IPAA 3DLAA 2FF4A 3K7AJ 2GA1A 1LVAA 2UXNA 3CMEI 4CCNA 3S14J 4BE0A 4I0AA 2LH9A 2I8DA 1W0TA 1R1VA 3C3WA 5BNGA 3HRSA 3K1NA 1XGNA 4R1HA 2HVRA 2HOSA 2CFOA 4UV9A 4U0YA 1IRZA 4IJAA 3F22A 2LY1A 4CCJA 4CSWA 2E1MC 4ZYAA 2CV1A 3ZMZA 1GHCA 3K2AA 3W2VA 3DEEA 4AYBA 2V7FA 4HLYA 2LRDA 2QEXI 1SVMA 3DQVC 1MNDA 4CYCA 1TWGJ 3AG3H 3I58A 3B6AA 4BQNA 5D4RA 3ZMDA 1PYVA 1DU6A 5KCMA 1MH3A 5J47A 1WJEA 3MFKA 4LLNA 3ZQFA 3S17J 2KDOA 5JVGF 3BDDA 4LITA 3BG3A 3BTIA 1TLHB 5IYDJ 3DU6A 2IS6A 2ICWG 3ZQQA 1A36A 3V7CA 4KIFA 3GWZA 3PNTA 2Z33A 3VPRA 2QQAA 2KLOA 1DGRM 1V3FA 1TNTA 1JTYA 4HX8A 1QZEA 3Q5FA 1Y0UA 1WH5A 3M8JA 3CCQI 2PMZN 2AHQA 2PQ8A 1W4MA 5LHGA 2W84A 2IA1A 5E8GA 3L2UA 3RJPA 3BZKA 3A0HC 4ZJZA 3ZP5A 2I5UA 5IP7J 1YRNA 1BN5A 2DK8A 4PJNA 5K1YA 3OS0A 1NH3A 5IYCJ 3HZJA 3S1NJ 4G12A 2B7EA 2RVCA 3QPHA 4BU2A 2Y69H 2K9MA 2A6TA 1P4XA 3G71I 1RNLA 2WAEA 2MC3A 3H5RA 2VJ5A 2YSRA 4M6XA 4OAZA 3K70C 4EJWA 2X4HA 3V8JA 4BUPA 1T0FA 2E19A 2QM3A 4F3QA 1BC7C 3BR5A 5FRMA 3CUOA 4F7ZA 2BYVE 4O3MA 5BPDA 2DTZA 1NTCA 2FNPA 1FP2A 2Z1DA 1FOXA 3EETA 1WH7A 2CUFA 3J80Z 3OS1A 3FM3A 3GTLJ 3FK6A 4XICA 2R7VA 1HLVA 2CGPA 2GOMA 2P4WA 3M8FA 1YS6A 2KRCA 4KN7X 2HDDA 1UJ8A 5BQTA 4KN4X 1TWAJ 2Z99A 3FMRA 2YU9J 1OKRA 3E5XA 3TDUC 1ZR2A 1ETOA 1P4AA 1TWFJ 3KZZA 2HOEA 1XMAA 2QSFX 2WY8Q 3QYEA 3N97A 4Z6YA 3RPUA 2JZYA 4IHWA 2DOEA 4MFDA 3JRAA 1GVJA 3HOUJ 4RGXA 1MMAA 2IVMA 3K4CA 5EDNA 2KHMA 4NNJA 3WG9A 1UG0A 3OYNA 1KU3A 3QPLA 4HW0A 2WV0A 2BOLA 1VQ6I 1Z3YA 4BEHA 4JK1X 2XASA 3ZQHA 4RAZA 3NEUA 2M0CA 4ZYGA 2XSDC 1GVDA 3AFHA 1YIOA 3ABLH 1HCRA 3CC2I 5LD2C 1EJ9A 2BZTA 2DA7A 1H88C 3JRHA 5FKKA 3IH3A 4ABZA 2F4IA 4BQAA 3MCZA 1C0WA 4GFBA 3BR0A 3CJTB 4CHUA 1A04A 4F91B 1D0YA 2P5KA 3U1DA 1OQYA 5FJ8J 4BY7J 1YW8A 3GLLA 4KYWA 2RKHA 2OF7A 1TBXA 3LA2A 1GXPA 3ZXSA 3CMAI 4EM1A 5JFRA 4A0YA 4V2GA 1VQKI 1V54H 1HKTA 3LSPA 4L5IA 3WHCA 4CYCB 2F48A 3FK7A 1ZG3A 3CTAA 4RAGA 2M30A 3MD2A 2ISZA 2L4MA 2MD0A 2ELKA 2QYOA 4EQQA 2RGVA 3MZHA 3ZRGA 2X6YA 4KIGA 5H6QA 3S2WA 4G7OF 3OIPA 4XLAA 2XRLA 1O7LA 3VSKA 2DODA 4RGRA 1WFXA 4BBSJ 1U0JA 4BHCA 4A2UA 3K10A 3KPHA 3H3UA 2Q0OA 1HF0A 2A5WA 1L0OC 1P4WA 4C3HJ 2WBMA 1RKTA 3DEWA 3LA3A 4JOMA 5JR3A 3GF2A 2BXZA 3K1MA 3LSIA 3MKWB 1Z7LA 3KP4A 5ILSA 2F2EA 1IRGA 4LIUA 3HHHA 4FETA 1KA8A 4YIIA 4EGZA 1W5CC 1USSA 2K9QA 3DBHB 2ME6A 5GAHJ 3JTGA 1I1GA 2QGUA 3LL7A 1K83J 5FO5A 4BL0B 2XAHA 3E6MA 1BIAA 2EILH 4O6JA 1ZR4A 1TQPA 2R7RA 1OR7A 1P92A 1TT5B 1N75A 2XF7A 1JTXA 4PSXA 4LLLA 3F0CA 4HX7A 1QO0D 4ZH4F 4M71A 3K9TA 1BIBA 3CMMA 5HODA 1E3HA 1V4RA 3HOSA 2VKVA 1F9NA 1VQ7I 5GPCA 3TO7A 5L3GA 4Q4ZF 4LJZF 3LAPA 3FKIJ 2XF6A 1LEAA 2H1KA 3EYIA 2R4GA 4UXNA 3GVAA 5CPRB 1MBJA 1O57A 5TISC 5AIPA 2DMNA 1IXRC 4ZDLA 4G8XA 2DBBA 4A5NA 2STTA 1RZ4A 1B6AA 1ULYA 1X3ZB 3ZMUA 1K4TA 1FIPA 2DQRA 2HKOA 1I39A 3QRFF 5FFXA 1X3WB 3BR1A 1R23A 3PUFA 4BJ6C 2O0YA 1T38A 2IS1A 2KIFA 2R5YA 5J4YA 2R7QA 2KRFA 2ME0A 3FKJA 2OUMA 1K61A 3SZGA 2VJIA 2EH3A 3MZYA 2FMLA 2J5PA 2Z9OA 3NRVA 5C4XJ 2E1CA 3EQLF 5IP9J 4IRGA 3T0YA 1JJ6C 2P6TA 3I4PA 3G4SI 2D2WA 2A61A 4TV7A 1VQLI 4MTEA 2VJJA 3F8NA 4MLOA 1W1WE 1D1AA 4Z2YA 2GQQA 1BI0A 1IN5A 3J80K 4RLQA 3OYMA 4QWQA 1D0ZA 1QGPA 5HLIA 4BHBA 5LEJA 4F52A 5GPAA 1Z21A 3TL4X 2L5QA 4IQ4A 5CJ9A 1HDPA 1WWXA 4M9SA 1BBYA 1A5JA 1DPRA 2EBIA 4ENMA 2VT2A 2VASA 2G7HA 1FOYA 3SFIA 3GW2A 1TP4A 2DW4A 2A6EF 3SZTA 2XGCA 3KE2A 1UCRA 2NVXJ 4U87A 1ITYA 3ELKA 2P8TA 1D1BA 3BROA 3SDBA 2FOKA 3PM1A 2IAIA 2L4AA 2V6CA 4L5JA 1XSDA 2M7BA 5E8IA 1F1ZA 2JPBA 2HVSA 3CUQA 3JAMZ 3E0JB 3FDYA 1OMIA 4DYQA 4NQWB 4G7HF 1IV8A 4M3BA 2EB7A 2YR2A 2OCCH 3H5AA 2LBFA 2TCTA 2DMQA 3GTMJ 1S7AA 1GV2A 2XVCA 2PLYA 2JUCA 2OBPA 4B4CA 5LFAA 1QNTA 2FQ4A 3H5NA 1BJZA 2ZJQF 2M0MA 1TL8A 3IWFA 2HWVA 3BC8A 3RKYA 3PQKA 4WXDA 4OIRF 1MKMA 2LK2A 3MKYB 4ENKA 2R7FA 1STZA 4NUBA 1CF7A 1EH6A 3HHGA 2OQRA 4W1UA 1G2HA 4CICA 4DYCA 3CQZJ 1AKHB 4PFPA 1HSJA 3TOAA 4X1EA 4D5FA 4XRSA 4EMSA 3AG2H 3CMYA 2FBHA 3TW7A 2QKMB 2M2EA 4Y7NJ 1MDMA 1MMNA 2W25A 2VLAA 4D5CA 3DTIA 5E20A 2ZMEA 1F4KA 1RC9A 1DQUA 1MMGA 2OZUA 2HDWA 5C4JJ 1UG2A 4M72A 2CQNA 2X48A 4I02A 3FM5A 4QSHA 1NHAA 4B43A 1EH7A 2KJCA 1WGXA 3IKVA 2F6CA 4HNTA 1GDTA 4AM3A 5J4VA 2LLKA 2O61A 1J59A 2LY9A 3R0JA 1OFCX 2R5YB 4XM3A 1B9NA 1HKQA 4ENNA 2J5OA 1E3PA 2DOAA 4WCGA 2Q2EA 1IUYA 1SFEA 4CZCA 3CCMI 1XC5A 3TP0A 4E7HA 3SYTA 1KONA 5FD6A 2K4JA 1GXQA 2LKXA 4A0XA 4L9JA 2MH2A 1JGGA 1QBJA 2DQLA 5KAFC 3FHZA 4IHSA 3GTOJ 2E1NA 3RKWA 2IXSA 5E3NA 4B09A 1RESA 4NC8A 5D6FA 3HOVJ 4AUXA 1OYIA 2DO7A 3KEOA 1REPC 3KLNA 4A3GJ 3BG6A 4I7HA 3V42A 2OJED 2IEKA 3PSIA 1SFKA 1A35A 1X58A 3ZOBA 4M6YA 2F5EA 4CCOA 1PDNC 2JVGA 5FLXZ 1Y8RB 4FTHA 2ZFWA 3K1PA 5FKMA 2GBYA 2XGDA 5B1BH 1CGPA 2DU9A 2IRFG 2ESHA 2DFFA 3H9JA 2H8WA 4KIBA 3OS2A 1G3WA 3GFIA 1SFUA 3EUHC 4L9NA 3VYRB 1O3TA 2JQ7A 1JI8A 4YFNF 2JVHA 3CUQB 4L5EA 2CUEA 2F5VA 2BVLA 4E6KG 4J19A 2VPLA 2MGQA 2RN7A 3MZ8A 1IN7A 4NBQA 1TTYA 3LSGA 3R6SA 3H35A 5M3MJ 2CS3A 3HGGA 5E3OA 3FX3A 2DPUA 2MLGA 3HRMA 3I9V2 2LBFB 3S93A 2W48A 2PMUA 3BCAA 1XN7A 2M8GX 4BBRJ 3U21A 2IGKA 1WRJA 2A68F 2K4BA 2HVQA 2LFBA 1SVLA 4BE2A 3WTVC 1IG7A 1YYVA 4P55A 2FJ1A 4IHYA 4JBAA 3FXUA 4G9YA 3G3ZA 4LLGF 4RAFA 3S1MJ 1V5GA 1BI1A 2CW8A 4YIRX 1IF1A 3H0GJ 2VQGA 4FT8A 4IX7A 4QPQA 4MQ9F 4EJTA 1CF7B 5F04A 4HSTA 2X1EA 2FMYA 2XPVA 1K6OA 4DZJA 1R49A 2NNYA 1S3JA 4JX6A 1IN4A 2MD5A 4M3EA 5ILUA 1FYMA 2FRHA 3HTSB 3Q9SA 1EKEA 5D5XB 4HDVA 3R4KA 2LSOA 3JAMK 4GYGA 3K4BA 3VYSB 1R1UA 2BY2A 2QA4I 2R7ZJ 3M8EA 1LDKB 2XB5A 1SANA 1U5TA 3GFMA 2ZMEB 3JRIA 1XGOA 2O7OA 3HXLA 1VQMI 3FBNB 2PX9A 1LDDA 1HSTA 4A3DJ 2EV0A 1VI0A 5J8CA 4DW6A 1V5EA 3GXOA 4ASNA 2O3FA 4E7LA 2LVSA 2AS5F 5ILVA 3FXOA 2JRTA 2E60A 2CQKA 4U0WA 2FX0A 3I0TA 2M4KA 5HDGA 3L09A 1W7PD 2DA2A 4UVBA 1S6LA 4A93J 4LK0F 3UR3C 3NWTA 4BY1J 3QOEA 4Y33A 3P9CA 5CYVA 4FQGA 2PI0A 2HPMA 4Y13A 4WWCA 3ZQGA 2W7NA 1W5TA 2GXBA 1R22A 1G3TA 3HSFA 4HEA2 2Q2EB 2EJRA 2OZ6A 1D1CA 1JHFA 2RNGA 3HB9A 3GLXA 3A01A 2BE5F 1ORKA 2W82A 3MAJA 1Y1WJ 1VQ4I 3LSTA 1SMTA 5EEGA 3LMMA 9ANTA 3DKYA 4NB5A 4HF1A 3NWSA 4A6EA 2L7FP 3TW6A 1EV7A 1J09A 2E5NA 3WODF 1IC8A 3WTXC 5K5OA 4RGUA 3V4GA 5IYBJ 3VSLA 5TJJA 3OYDA 2HPIA 3HC7A 1QPIA 1RETA 3J7AO 2L01A 3RIRA 4XLPF 3CJRB 1G6NA 1U6GA 3ZQIA 2JA7J 3JRGA 2XB0X 4P96A 4A12A 3JTHA 4HBLA 2D5VA 2GAUA 3DTKA 2L54A 4HA8A 3PSFA 4IF4A 1ETQA 1XGSA 3G1MA 4QIWN 3EYYA 4UUSA 1K7AA 1H8AC 1FIAA 3AAFA 2VQCA 3WGIA 3P5JA 1Y1VJ 2OU2A 4XKBA 1LFUP 1JXSA 2XF5A 4IRIA 4XN0A 2KJBA 2VI6A 4RBOA 2CMPA 2CUZA 1S8NA 3TEDA 3LSKA 4E7IA 1QU3A 1MMSA 4EV0A 1VQ8I 2EV6A 3K2ZA 4HYEA 5BMZA 1X4PA 2DMUA 1Y8QB 1R4MB 2TDXA 2VOPA 3ECHA 4LG0A 1Y56A 1JUSA 2ZXWH 3CP8A 4XLHA 4U7BA 5E18F 2M87A 3GO5A 3DPUA 4ZC3A 3SQNA 3RYRA 1X4OA 2CRGA 4PGGA 1O3SA 2DLLA 2V79A 2FUG2 4EJVA 4RDUA 4IHXA 2JA2A 3KP3A 2XC7A 1FOKA 2M5WA 2RV8A 3BQZA 3GX4X 1W5SA 3FMSA 4FX4A 1WJDA 2FOWA 5IOZA 3PO3J 4HDUA 4DBQA 1H0MA 4A3CJ 3FXLA 3NQOA 1FTTA 2AO9A 1R5GA 3MWMA 5FLXK 4DNCA 3F23A 2PEXA 2YPRA 1I6XA 1KGSA 2P5VA 4IZZA 2HDCA 3JR9A 2CQXA 1TT0A 1EA3A 3BWGA 3SDGA 4C9YA 1T56A 2XAQA 3HG9A 3DKXA 1XDSA 1QHGA 5E1ZB 2V1NA 1OCTC 2JSPA 2QCOA 1FMWA 3OL4A 2KZGA 1U5TB 1BA5A 2JJ7A 3HUGA 2H1LA 3MN2A 2JMWA 2GXAA 3ASOH 4CGZA 2ESNA 3ZQLA 3DKWA 2R5ZA 3TBIA 4PDKA 2L2OA 1QZYA 4F92B 1YJWI 2XV4S 1UHMA 3JRDA 2PMZA 1F43A 2XUBA 4ZYDA 4OIPF 3HOZJ 3FZVA 2PN6A 2RNJA 3IWZA 3HKZN 2E2JJ 2LMDA 3TDZC 4XOPA 1VQPI 1J2XA 4LD5A 3WTSC 2B0LA 5D6EA 3HPGA 5EZHA 5GP9A 1UB9A 5H2FC 1FMVA 2BXYA 4KT5C 5F0HA 1SFXA 1KQ8A 1XGMA 4BXXJ 4HSRA 2ELHA 3BR3A 2LG4A 3PIPF 2R7OA 3A01B 4G6DA 4XKCA 3QWLA 1Y0NA 2Q1ZB 5BPIA 4BNCA 1AHDP 4R8HA 2VE8A 4A3BJ 2MABA 1X1AA 1ETVA 3LOCA 2A07F 5K5RA 3WTUC 1BI2A 5L3FA 2HZTA 2M34A 5GADJ 3S3MA 2LNBA 3CCUI 3HRTA 1TQIA 1PVEA 3QPTA 3OOPA 3OYIA 3F9KA 1B8IA 4RS8A 3CD6I 5CVRA 5K7ZA 3A1YA 2X9DA 4WXCA 1LJ9A 1P9QC 4I2OA 4AVZA 1OCPA 1ZGAA 2OCEA 4LB6B 3BJ6A 2CW0F 3KP5A 4UUSB 1APLC 3ESWB 3VYTB 2ZFUA 3KIOA 4HX4A 2G9WA 1Z6TA 4BQQA 5CVJA
chains in the Genus database with same CATH topology
4ITVA 2VJJA 4MLOA 1D1AA 1NG7A 3LSMA 4XR6A 4RLQA 3OYMA 5HVQC 1D0ZA 2X1DA 4F52A 3OYHA 1Z21A 4PK4A 3TL4X 2L5QA 4IQ4A 4OAYA 1G8XA 3DU5A 3IAM2 3QODA 3I3LA 2GOXB 4BJ5C 2VASA 3OYAA 2DT7B 4PSWA 3QYBA 4XORA 4YRVA 3OYEA 2X6WA 4U87A 4BQOA 4E7ZA 1D1BA 2VQHA 3SDBA 3PFYA 2O5RA 2M7BA 4F55A 2HVSA 4BACA 2LOOA 3RSNA 3IP4B 2VKHA 3HPHA 3E0JB 4QPOA 3FDYA 4DGWB 4NQWB 2X1CA 3IUOA 3H5AA 4JQFA 2LBFA 3H9GA 3K4LA 2R7XA 1X1DA 3N05A 4PUSA 5LFAA 1X1CA 2V26A 2KRHA 3H5NA 4XONA 2VL8A 4KITB 3DWLE 2M0MA 2VB6A 4BJTA 4DOZA 3BC8A 1BR4A 1W36C 3HUGB 3OWTA 3CESA 4N4NB 3RPUD 2KZVA 1WJCA 4B3XA 4EATA 3MKYB 4BGDA 4BXFA 3D5SC 1GLNA 4NUBA 4XKWA 4XOTA 4PFPA 3EUAA 3OYKA 2PJRA 4Y4RA 3OYGA 4IQJA 3W2AA 2QKMB 2Z16A 3EUKL 1G59A 2W1OA 1MMNA 2VLAA 2M4GA 3HKZA 3OOUA 3DTIA 2JUGA 3BG7A 1YX3A 2QKLB 3W3CA 1DQUA 1MMGA 2ZXHA 3A2KA 3UNGC 4XLEA 2HDWA 1Z3XA 2AQEA 3S8PA 2V9KA 4B43A 1W36D 3KYLA 2F6CA 1UELB 4HNTA 2WADA 2Y0SA 2UUZA 2KL4A 2X85A 4OWRB 4XM3A 1S9HA 4IKFA 3DTEA 3CF2A 2WAFA 1OR7C 3BLYA 2VJ4A 2DOAA 5CQEA 1BR1A 2VKDA 4G6TB 3C2HA 4CZCA 2AQFA 4E7JA 4E7HA 3SYTA 1KONA 3H9QA 2R7WA 4RM3A 3PL8A 4BE1A 4BEHB 3BCBA 1WJFA 1LVKA 4HG2A 3OYCA 1IRXA 2LREA 3VWBA 2ELJA 4ZDOA 3CZ6A 2K9LA 2IXSA 3OR2C 2DT6A 4CUGA 4NC8A 2HU9A 3HOTA 3BG6A 3K4KA 3V42A 4R79A 4B44A 3MKZA 4C2TA 4RM2A 1ZELA 3K4MA 3PSIA 1SFKA 3FBIB 3H0DA 3PJRA 2E1MB 3MMYB 3AL0C 2DCEA 1MNEA 3L2QA 1QHHD 2K5CA 3D5LA 4CCOA 4BDZA 2JVGA 4CCMA 4KISA 4P1WA 3H9JA 1MW7A 3OS2A 2W4SA 2VQLA 3EUHC 3VYRB 2WY7Q 1JI8A 4NC7A 2JVHA 2F5VA 4E6KG 2BVLA 3E1SA 4ZTJA 1UAAA 2VPLA 1E0EA 3DLAA 4LIVA 3LSGA 3H35A 5KHDA 2CS3A 4CCNA 4BE0A 2LH9A 2I8DA 3EPZA 3I9V2 2LBFB 3S93A 3BCAA 4PJMA 3C2GA 2HVRA 2CFOA 2KPMA 3U21A 2IGKA 3VYUB 2HVQA 2LY1A 4CCJA 4CSWA 5JHFA 4BE2A 3PUBA 2M3AA 2XSJC 2E1MC 4ZYAA 4XMYA 2ZSHB 3VDXA 4F93B 2CV1A 2LYCA 3W2VA 3DEEA 4AYBA 1V5GA 2V7FA 2LRDA 4B47A 2CW8A 3DQVC 1MNDA 2VQGA 4BQNA 1PYVA 4IX7A 4QPQA 5KCMA 1WJEA 4D9JA 2KDOA 4HSTA 4LITA 2W00A 2X1EA 3DU6A 4BS9A 4C2UA 2IS6A 4II2A 2MYSA 3ZQQA 2OC6A 3OYBA 4LG3A 3L2RA 3PNTA 2PJRB 2KLOA 1DGRM 2X6XA 1T95A 2MFZA 3LSHA 1OLTA 3K4BA 3HL2A 3VYSB 4ANJA 3M8JA 1LDKB 3D5RC 2L7KA 2E5ZA 3L2UA 1K6YA 2KP6A 4ZJZA 3HXLA 3FBNB 3K6GA 3ZCOA 4HRIA 4PJNA 3OS0A 2BW3A 5KNLA 2RREA 1V5EA 2R7UA 1LKXA 3ZGKA 4BU2A 2K9MA 2A6TA 4E7LA 1X1BA 2E60A 4RLFA 2WAEA 3H5RA 3J7AY 2VJ5A 1WJAA 2M4KA 5CKTA 4OAZA 3K70C 3G2BA 3UR3C 3NWTA 4BUPA 1VZ0A 2OV7A 4ZTFA 4F3QA 3QOEA 4J01A 4Y33A 1BOBA 2IGOA 3GBGA 3A4CA 4N4OB 4CCKA 2HPMA 5FRMA 2UWMA 3K4NA 2W7NA 3DPTA 5CQGA 3AL0B 2WAQA 4HEA2 1AA7A 2Q2EB 4GRIA 4YELA 4CH7A 2CV0A 2KQRA 2Z1DA 2NOJB 2IS2A 1R6RA 2KMUA 1DP3A 2P0WA 1D1CA 2RNGA 4II3A 3OS1A 2W82A 4DIQA 2UV1A 3OYLA 2R7VA 3LMMA 2GOMA 2KRCA 3DKYA 3M1CA 2WA0A 3NWSA 3KX2A 3IAS2 3SEZA 4C30A 4HNUA 1J09A 2E5NA 1MMDA 3VSLA 3OYDA 2HPIA 3HC7A 4XL9A 4B48A 2WY8Q 3QYEA 2ZXIA 3CJRB 2R7TA 2M7AA 3RTRA 1SAUA 1MMAA 3DTKA 3K4CA 3ONQA 3PNVA 3AKZA 2KHMA 4NNJA 2HNHA 3PSFA 3K70D 2IGNA 2XAUA 4PJJA 1UG0A 4BDYA 3OYNA 3RQ4A 2CV2A 2BOLA 2VQCA 1Z3YA 4BEHA 3CP2A 1WJBA 2ZSIB 4XKBA 3OYJA 2XF5A 4XN0A 5FROA 1BR2A 2K3PA 2CMPA 2CUZA 5TGTA 3LSKA 4E7IA 3AFHA 4E7SA 1QU3A 5LD2C 1PJRA 2IGMA 4E7KA 1X4PA 5HNFA 2F4IA 1Y56A 3CP8A 4XLHA 4U7BA 1ERDA 3ZR8X 1D0YA 4F91B 1DGWY 3DPUA 4ZC3A 2VIXA 1X4OA 2CH0A 4RMNA 3ZXSA 2FUG2 2JA2A 2LC2A 3QYFA 2XC7A 1Y6IA 3OMYA 2CUJA 4E4HA 4D1QA 3OY9A 2XDVA 5FRNA 1WJDA 4DBQA 3MD2A 1V5FA 2MD0A 4J00A 1WJ5A 4IZZA 3ZRGA 3S32A 2X6YA 1TT0A 1EA3A 2HZDA 3OIPA 3S3NA 2DXIA 4XLAA 4C9YA 3VSKA 1WFXA 3HG9A 4XLFA 1U0JA 3DKXA 3K10A 1QHGA 2HQAA 2RQQA 2A5WA 2V1NA 3OL3A 2JSPA 2Z2SB 1FMWA 3OL4A 4YEJA 4DJAA 2WB1A 2WBMA 4JOMA 2MC4A 3DPLC 3SEQA 4FASD 3LSIA 3MKWB 1Z7LA 3OIQA 2V4JC 4HPQA 3OYFA 1NG6A 2BW3B 4LIUA 1LFPA 2V6EA 4FETA 1TZLA 4CA0A 1N78A 3TBIA 2L2OA 4PFOA 4F92B 2PMZA 1YE9A 4AU7A 4H4KC 3LL7A 4XOPA 5HNHA 4BL0B 1HA8A 4X0GA 1N77A 3HPGA 4CCLA 2R7RA 1FMVA 1N75A 2XF7A 4PSXA 2CW7A 4XLCA 4Y3OA 3OR1C 4HSRA 3CMMA 3TMOA 2LG4A 3HOSA 3L2VA 2R7OA 3KEYA 4XKCA 2Q1ZB 1D0XA 2XF6A 2IS4A 3K4JA 2MABA 2R7SA 2R4GA 5CPRB 1X1AA 3RCOA 2L9NA 3FHNA 4XNFA 4ZDLA 2VXZA 2L9SA 2LY2A 3PNYA 3W2WA 4PJLA 2BVMA 3S3MA 3CJQB 3S3OA 3L2WA 4XQFA 4BJ6C 5HLTA 3OYIA 2IS1A 3F9KA 3LFUA 2R7QA 3FKJA 3A1YA 1T0FC 2OUMA 2X51A 1P9QC 1X19A 3SZGA 2VJIA 4AVZA 5HOOA 4XN3A 4ZDPA 4KT6A 1YX5A 4KJZA 4P5OA 2VXDA 3VYTB 2ZFUA 2DJIA 4XKVA 4BQQA 4DBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPL A;  2OV7 A;  2OUM A; 
#chains in the Genus database with same CATH topology
 5F08 A;  4ITV A;  1SVO A;  3TO6 A;  4LOC A;  4EJU A;  1IUF A;  3A0B C;  4A5M A;  4AID A;  4XR6 A;  2X1D A;  4C2M J;  3F8B A;  2IBD A;  1NK3 P;  1Z77 A;  1Z67 A;  3HSR A;  4O5V A;  2K9S A;  2EIN H;  2CU7 A;  1G8X A;  4MO7 A;  3DU5 A;  3F3X A;  4ZZD A;  1FX7 A;  3I3L A;  3WTW C;  1SFO J;  2HQR A;  4XSZ F;  2H8R A;  3ABM H;  4PSW A;  4XOR A;  5FD5 A;  4YRV A;  1SAX A;  4FE7 A;  3HIF A;  3ROU A;  3L7W A;  2VC0 A;  2XAG A;  4E7Z A;  2RC4 A;  3R0A A;  2KIM A;  3PFY A;  1VQ9 I;  2KKO A;  3RYP A;  2Y0M A;  3VFZ A;  2P81 A;  3T1B A;  3GYH X;  1FT9 A;  1TNS A;  2LOO A;  1RUN A;  3RSN A;  5B3S H;  5DV5 A;  2E7W A;  4Y52 J;  2DJN A;  2V1D A;  3WGG A;  3MKL A;  2AXT C;  3TGN A;  4Q5S F;  1U8R A;  1I27 A;  4JQF A;  3U2R A;  3H9G A;  1K78 A;  3P9I A;  3CLO A;  1FP1 D;  2NOG A;  2QQB A;  3RZO J;  2XGX A;  5ICE A;  4A0Z A;  4KFC A;  4PUS A;  2JSC A;  5IT9 Z;  2V26 A;  1T08 B;  4XLN F;  4XON A;  1E17 A;  2VL8 A;  1ZAO A;  2VB6 A;  3CCR I;  3BR2 A;  3HUG B;  1F5T A;  4N4N B;  3RPU D;  3BP8 A;  1YRN B;  2Y2Z A;  3WU2 C;  2WV1 A;  2R5Z B;  3U1K A;  2PBI A;  3O8G A;  4KMU X;  1ZRE A;  5BOX A;  1MJB A;  3TKY A;  1F36 A;  3KYD B;  2BY0 A;  3H3Z A;  1ENH A;  4XOT A;  4EM0 B;  2HOT A;  3WU0 A;  3W6K B;  1I3Q J;  3OYK A;  1GV5 A;  2XKP A;  2PJR A;  3L00 A;  4M9X A;  3V7R A;  2XGE A;  3L9F A;  4ZYH A;  3RI4 A;  3W2A A;  2G0E A;  2R93 J;  3OIO A;  1E2X A;  5F64 A;  2M4G A;  2BY1 A;  2CYY A;  3G6E I;  1LB2 A;  3BG7 A;  4BXU A;  2WWY A;  1YX3 A;  2QKL B;  3W3C A;  4E70 A;  5LGT A;  2CJJ A;  2MA3 A;  4XSX F;  3UNG C;  4XLE A;  1OCO H;  2DN0 A;  4G7Z F;  2Y0S N;  2Y75 A;  1HDD C;  1X3U A;  4JX4 A;  4I01 A;  2JA8 J;  3P9K A;  1MJ9 A;  2V9K A;  3S8P A;  3A02 A;  2EIJ H;  1W36 D;  4UUT A;  3KYL A;  2R0Q C;  2VBY A;  2CSO A;  4MGR A;  2Y0S A;  1QRY A;  2M9H A;  3Q3S A;  4HV6 A;  2UUZ A;  2KL4 A;  2X85 A;  3FXR A;  5DUI A;  4KDP A;  4XID A;  1H9G A;  3CF2 A;  2WAF A;  2DDA A;  1WVR A;  2KIU A;  3ZMS A;  2COM A;  1XDU A;  2EPF A;  2VKE A;  3HJE A;  3L2C A;  2VKD A;  1AU7 A;  2AQF A;  4E7J A;  1Q1H A;  2KIQ A;  3JW4 A;  5IP6 A;  3M3Y J;  2BGC A;  3CCL I;  1FLI A;  4BEH B;  2HXO A;  1ETW A;  1UHW A;  2ZCW A;  4I6Z A;  3QOP A;  3S2D J;  1VQ5 I;  1WJF A;  3OYC A;  2IT0 A;  1IRX A;  2LRE A;  3CZ6 A;  2K9L A;  4WXH A;  4XBF A;  3V8L A;  1JKO C;  3IHU A;  3DP7 A;  2IPQ X;  3CJN A;  1A6I A;  1ZGJ A;  2HTS A;  3E6C C;  5AON A;  5F1J A;  4WF2 A;  2CQ7 A;  2XPW A;  3MKZ A;  1FZP B;  1RR7 A;  5D5U B;  2YX4 A;  2ZNZ A;  3QP6 A;  2DMP A;  2E1M B;  5DM7 F;  5A2Q K;  3M07 A;  3R60 A;  3IH2 A;  2ZJ2 A;  2NYX A;  4AVP A;  1YHQ I;  3FIW A;  4GCV A;  1D3Y A;  2W4S A;  2VQL A;  3I55 I;  2WY7 Q;  4NC7 A;  4D7N A;  2GIZ A;  2VN2 A;  5LBQ A;  2EZI A;  1L3L A;  4LIV A;  1XMX A;  1B9M A;  1XG1 A;  1R7J A;  5KHD A;  1J5Y A;  3J7Z I;  3CO6 C;  3BZ6 A;  3EPZ A;  1J0R A;  2QLZ A;  4I09 A;  4C3I J;  2DTR A;  4N0B A;  3C2G A;  2DA1 A;  5CVV A;  1KYW A;  4LMY A;  4IO9 F;  4A6D A;  1QVU A;  2ZB9 A;  3VYU B;  4CO8 A;  3ULQ B;  3PUB A;  2M3A A;  1FBS A;  1SD4 A;  4RB2 C;  2X6O A;  1MIJ A;  1IXS B;  1VND A;  3DF8 A;  3BT9 A;  4NDL A;  5EG0 A;  3S1R J;  1IV6 A;  3PQJ A;  4QTR A;  2MSY A;  4KIC A;  3F6V A;  1YFH A;  3X2Q H;  1KU7 A;  3E3V A;  2Y9Z A;  2KDZ A;  2R7D A;  5J1Y A;  1KU9 A;  2ISY A;  2HYF A;  1PUF A;  2W00 A;  3O6B B;  1O3R A;  2WB1 N;  1MJA A;  3ERM A;  4BS9 A;  2H94 A;  2HKX A;  3I64 A;  2MYS A;  2PJR B;  2JPC A;  3OYB A;  3L2R A;  2JWT A;  3T8R A;  2IA2 A;  2X6X A;  1T95 A;  1OCR H;  2MFZ A;  3HOW J;  5KAI C;  5GTI C;  3HL2 A;  3DBR B;  3CDL A;  3GTQ J;  3D5R C;  3FWE A;  2L7K A;  4FHT A;  2WC2 A;  2HTJ A;  2KP6 A;  5D8L B;  1ZKG A;  4M73 A;  1KQ0 A;  3LFK A;  4FIS A;  4HRI A;  3PFI A;  4RB3 C;  1Z91 A;  5KNL A;  1HW5 A;  5JLW A;  5IT9 K;  3ZGK A;  3E6B A;  4EM2 A;  1I3A A;  1X1B A;  4RLF A;  3J7A Y;  4L9T A;  2L02 A;  5CKT A;  4UUV A;  3ASN H;  1VTN C;  4MEX F;  1I6H J;  1VZ0 A;  3HOY J;  2OV7 A;  4ZTF A;  5FKO A;  1RKW A;  3BTL A;  3KP2 A;  1JHH A;  4J01 A;  2IGO A;  1FBQ A;  3GBG A;  4N4O B;  1ZGW A;  3K4N A;  3DPT A;  2HQ5 A;  2O8X A;  4CH7 A;  2IS2 A;  1R6R A;  2KMU A;  5DD8 A;  2P0W A;  3FMQ A;  4UVC A;  1OPC A;  1LFB A;  5J8F A;  4DIQ A;  2UV1 A;  3OYL A;  2IP2 A;  3JRB A;  3CCE I;  1IJW C;  2GA2 A;  4ENJ A;  3TQN A;  4IRH A;  3M1C A;  2WA0 A;  4OIN F;  2HYG D;  3KX2 A;  1ETK A;  4C30 A;  4M3D A;  3GFJ A;  4N9I A;  2GWR A;  4XL9 A;  1S72 I;  3VB2 A;  2ZXI A;  5F1R A;  2O9L A;  2ZC2 A;  2R7T A;  2FSW A;  5E1X A;  1FSE A;  4RAY A;  3RTR A;  1S7E A;  1SAU A;  3M4O J;  1R71 A;  2HNH A;  2XAU A;  1TQM A;  4CDG A;  5M5W J;  1Z6R A;  3QPS A;  2M1B A;  2CV2 A;  1VF9 A;  1XMK A;  1EH8 A;  2F4O B;  1MZB A;  1YQA A;  3CP2 A;  2JRM A;  3F8M A;  3LA7 A;  2XKO A;  5ERI A;  3I59 A;  1BR2 A;  1R1T A;  4A3F J;  3JRE A;  4P9F A;  1PJR A;  3JSO A;  1N25 A;  4E7K A;  2K02 A;  3B02 A;  4HNV A;  1A31 A;  4A3L J;  5BS6 A;  2EWN A;  5HNF A;  4A3E J;  2A3S A;  1ERD A;  3ZR8 X;  2VT3 A;  4HF2 A;  1DGW Y;  2EV5 A;  2EQR A;  2FBI A;  3FF5 A;  1Z0X A;  1QA6 A;  2QVO A;  2GLO A;  2A05 A;  1W7P A;  4RMN A;  5GAE J;  1HW2 A;  4DBR A;  2LC2 A;  1IW7 F;  3BG9 A;  2JN6 A;  5DS9 A;  3QYF A;  5EG0 B;  1Y6I A;  3OMY A;  1AWC A;  1XS9 A;  4D1Q A;  5DEQ A;  1Y39 A;  2XDV A;  1JJ8 C;  2Y9Y A;  1D8J A;  2E7X A;  1D8K A;  3HGY A;  1Z9C A;  4OMY A;  1PUF B;  5ICG A;  4EVI A;  2DI3 A;  2GXG A;  3HEF A;  1MBK A;  2Z5U A;  3L1P A;  3S3N A;  3GFL A;  3DEU A;  1IN8 A;  3J81 Z;  2LKP A;  3LQQ A;  5M3F J;  3SXY A;  2RQQ A;  4IHV A;  2Z2S B;  3VOE A;  4A3J J;  1XCB A;  4YEJ A;  1MDM B;  3AG1 H;  2X0L A;  3M1E A;  3JRF A;  1YOV B;  2K40 A;  2BBY A;  4KNY A;  1R36 A;  4HPQ A;  4UV8 A;  1NG6 A;  1Z1D A;  1XCV A;  2ID6 A;  1TZL A;  4CA0 A;  5ED4 A;  1N78 A;  3MEX A;  4PFO A;  4HV5 A;  1ZG1 A;  3GTK J;  1S29 A;  5EEH A;  1O7F A;  3KET A;  4AU7 A;  2P5L C;  4H4K C;  2ECC A;  1HA8 A;  4X0G A;  5J1R A;  3WTY C;  3AG4 H;  5K7F A;  2K9N A;  4XLC A;  2XPU A;  4YIF A;  2FBK A;  3OR1 C;  3LSR A;  3KP7 A;  2ZXJ A;  5EF6 A;  1WHU A;  2ZBK A;  1OYW A;  3L2V A;  5IOY A;  2XAJ A;  4MEY F;  1JGS A;  4XRF A;  3I53 A;  3KEY A;  4Y15 A;  2K85 A;  1OIS A;  2IJL A;  1ZRD A;  1YW9 A;  1J75 A;  5EJC A;  3RKX A;  3WTT C;  2D45 A;  3RCO A;  2L9N A;  3FHN A;  4XNF A;  3PNY A;  2L9S A;  2LY2 A;  4S0H B;  2VPR A;  1UST A;  3CJQ B;  1HQC A;  2HQN A;  3E97 A;  2E71 A;  3S3O A;  5IY5 H;  3L2W A;  1FPQ A;  4HQM A;  1DU0 A;  1YJ9 I;  2P7C B;  5HLT A;  4FCY A;  1FYK A;  3LFU A;  3ERE D;  2Y31 A;  3H36 A;  1FEX A;  1MGT A;  4IOC F;  2QUF A;  4ZYE A;  2JTV A;  5F0F A;  1T0F C;  2X51 A;  1ODD A;  2VUM J;  1ON1 A;  2BV6 A;  2LF8 A;  3WGH A;  2W24 A;  4KT6 A;  4PGH A;  1PUE E;  5EYR A;  5HDN A;  5D8K B;  2NAZ A;  2ETH A;  3BTJ A;  3I4M J;  1ZQ3 P;  4LFU A;  3EUH A;  3IKT A;  2ZNY A;  3ABT A;  2CO5 A;  4XKV A;  4ESB A;  1A6Q A;  2G7U A;  2DA4 A;  1MH4 A;  2QWW A;  2QEN A;  3JRC A;  2QQ9 A;  3CC7 I;  1I50 J;  1NG7 A;  2K7L A;  2XIG A;  3LSM A;  5FKN A;  1SD7 A;  2VBX A;  4I99 C;  4PCQ A;  3G1L A;  3GCM A;  1YJN I;  1J7K A;  2V9V A;  2ZJP F;  4U7D A;  3KZI C;  1RPW A;  3IAM 2;  5AIQ A;  2E36 A;  3ZMT A;  2GOX B;  4UY8 I;  4BJ5 C;  3U9G A;  1HC8 A;  4RB0 A;  2DT7 B;  2STW A;  3OSG A;  3ZN1 A;  1MBE A;  2VOD A;  1RR8 C;  5E3L A;  3QQA A;  2X6W A;  1WCM J;  4BQO A;  2VQH A;  3CCV I;  1MBG A;  5KK1 A;  2O5R A;  2DAO A;  3H92 A;  5J40 A;  4F55 A;  2E1O A;  3V8K A;  2P6S A;  2PFB A;  4KA4 A;  4CXF A;  2VKH A;  3HPH A;  4QPO A;  3Q0V A;  1UFM A;  1CQT A;  4UVA A;  3NAR A;  1E3O C;  4AYB N;  1YTY A;  2E2I J;  2PJP A;  1X1D A;  4DQ2 A;  3N05 A;  1FBU A;  1WSU A;  1FY7 A;  2OQG A;  4UB8 C;  5DCF A;  5LRR A;  1XB4 A;  2KRH A;  1T8I A;  4KIT B;  4BKX A;  4AIJ A;  5CLS A;  4BJT A;  1HBX G;  1RUO A;  1SMY F;  1BR4 A;  1W36 C;  1U3E M;  4UHT A;  2NS7 A;  2EA4 A;  3C1D A;  3Q9V A;  3CDI A;  1WJC A;  2F5D A;  4AWX B;  4A3I J;  1R4N B;  2FA5 A;  3Q0W A;  3M7G A;  4BGD A;  5B66 C;  2A5Y B;  2LF7 A;  3D5S C;  1ZG5 A;  2DFI A;  1GLN A;  3D1N I;  2GIV A;  4D7M A;  2NXN B;  4XKW A;  5CVI A;  2OAZ A;  2XRO A;  2L0K A;  3EUA A;  2DT5 A;  3HSE A;  3LNQ A;  1ON2 A;  1ZK8 A;  2EZK A;  5LGU A;  1OCZ H;  2DDB A;  3DXJ F;  3EUK L;  2XAF A;  2W1O A;  4HF0 A;  4P9U A;  4EEF G;  3HKZ A;  3OOU A;  1VQO I;  2JUG A;  3DLL F;  1MSE C;  3J81 K;  2EZH A;  2ZXH A;  1YW7 A;  3RQI A;  3A2K A;  3BR6 A;  2MLK A;  2MW8 A;  2AQE A;  4B8X A;  3I56 I;  1AOY A;  3A03 A;  2BHY A;  4N9H A;  4U88 A;  4IEJ A;  1I5Z A;  2VBW A;  5DCM A;  3T5X A;  4ESF A;  2WAD A;  2HS5 A;  1OYY A;  4W97 A;  1U9O A;  1LDJ A;  5A2Q Z;  4L18 B;  2NVU B;  1S9H A;  3ML6 A;  5ICC A;  3LSJ A;  2FNA A;  4M3F A;  1OR7 C;  3BLY A;  4GYI A;  2H27 A;  2F4M B;  3ZMV A;  5CQE A;  4UNO A;  2GZW A;  3B6C A;  2NS8 A;  4G6T B;  3R61 A;  1WI9 A;  5K7H A;  2R7W A;  1ZLK A;  4RM3 A;  2E2H J;  3PL8 A;  4BE1 A;  1DDN A;  4MTD A;  3BCB A;  3TO9 A;  1LVK A;  4HG2 A;  2KT0 A;  1H9T A;  3VWB A;  2ELJ A;  1IN6 A;  3OR2 C;  2DT6 A;  2K27 A;  4BYY A;  3HOT A;  2M45 A;  3K4K A;  4BH9 A;  4XRS G;  1B1B A;  5D5V B;  4B44 A;  4CZZ A;  4PJ0 C;  1SC7 A;  4C2T A;  4RM2 A;  2R92 J;  5L3D A;  1X2M A;  4WK8 F;  4LG0 B;  3H0D A;  3MMY B;  1BC8 C;  3ZQ7 A;  2DCE A;  1MNE A;  2FU4 A;  2HI3 A;  2K5C A;  2QF7 A;  3F6O A;  3S2H J;  1Q1V A;  4BDZ A;  2HXI A;  4A3M J;  2MH9 A;  4ETS A;  2L7Z A;  1U2W A;  4JP0 A;  1YIJ I;  2FE3 A;  1W0U A;  4Y17 A;  1P6R A;  2PMH A;  5FFZ A;  1BJA A;  4DYR A;  1UAA A;  2EA2 A;  1E0E A;  2NVY J;  5L3B A;  4L9V A;  1R5I D;  4QLC U;  2DYS H;  2H6C A;  4I0B A;  3KFW X;  4PJM A;  2FQ3 A;  2QBY A;  1ZYR F;  2CWE A;  3B73 A;  5GTH C;  1BW6 A;  4S05 A;  2KPM A;  2HGC A;  2P7V B;  2L9R A;  5JHF A;  2XSJ C;  1ETX A;  1RRJ A;  4XMY A;  2ZSH B;  3VDX A;  4F93 B;  2LYC A;  3F8C A;  1XX5 A;  4OMZ A;  3KP6 A;  3H1C A;  1MSF C;  4IVN A;  1XPX A;  2BHZ A;  4B47 A;  2V1X A;  3WE2 A;  1T6S A;  1OCC H;  1JKQ C;  5KVR A;  5TRD A;  3KEQ A;  4NQW A;  4Q47 A;  4D9J A;  4ESJ A;  3GTJ J;  3RZD J;  3CUQ C;  5M5Y J;  1Z05 A;  4C2U A;  5L3E A;  3SFZ A;  3BPV A;  4II2 A;  4H0E A;  2BY3 A;  4AIH A;  2OC6 A;  5HDK A;  4LG3 A;  4V19 K;  2VE9 A;  1IO2 A;  3DV8 A;  3CF5 F;  3LSH A;  5J6X A;  1OLT A;  3SZP A;  4ANJ A;  3BQY A;  3LWF A;  4HOB A;  5HLH A;  1K4S A;  4L0Z B;  2E5Z A;  3TOB A;  1K6Y A;  2K86 A;  2QZ8 A;  3DFG A;  4HQE A;  1G3Y A;  3K6G A;  1POG A;  3ZCO A;  3ZPL A;  3QP5 A;  4ZZL A;  3RKQ A;  2BW3 A;  3F21 A;  2RRE A;  2R7U A;  1JUP A;  1LKX A;  2LTP A;  1G4D A;  4IXA A;  1B4A A;  2LD5 A;  3MQ0 A;  3I4N J;  1JUM A;  1AKH A;  1KU2 A;  1WJA A;  5JI6 A;  2WAQ N;  2DA5 A;  3E5U A;  4GXO A;  5DCM B;  4AD9 A;  3G2B A;  4BAY A;  3PIO F;  4M3G A;  2Y48 A;  4WX9 A;  2ADU A;  2RAE A;  1BOB A;  4CCK A;  3A4C A;  4Q48 A;  1RIO H;  1B8I B;  2UWM A;  1GUU A;  4A69 C;  5CQG A;  2HFH A;  3GUD A;  3AL0 B;  2WAQ A;  1AA7 A;  4YEL A;  4GRI A;  2EFN A;  1ZRF A;  2CV0 A;  2KQR A;  2QQ8 A;  2NOJ B;  1DP3 A;  1B72 A;  4II3 A;  1IRF A;  5E79 C;  2KFD A;  3LAJ A;  5FLM J;  2ZME C;  3OSF A;  2DOF A;  2W57 A;  1TW3 A;  3SEZ A;  3F8F A;  3IAS 2;  2MG4 A;  4HNU A;  1R5H A;  1BOA A;  5HS7 A;  2H09 A;  1IZ1 A;  1MMD A;  2V9P A;  3REO A;  3WTZ A;  1U78 A;  6PAX A;  4GO1 A;  4B48 A;  4FX0 A;  5DM6 F;  3GEZ A;  5HS8 A;  2M7A A;  3C18 A;  4GDF A;  4NC6 A;  2V1U A;  3HM5 A;  5C3E J;  1T39 A;  2EK5 A;  2IA0 A;  1HW1 A;  1BW5 A;  1SD6 A;  3ONQ A;  4RGS A;  1FWZ A;  3PNV A;  3AKZ A;  5H6R A;  2OD5 A;  3K70 D;  2IGN A;  4PJJ A;  4BDY A;  3HDD A;  3RQ4 A;  5E17 F;  2EFO A;  1EF4 A;  1ZTR A;  2DA3 A;  1KZH A;  2B9S A;  1WJB A;  2ZSI B;  3OYJ A;  1MBF A;  5K5Q A;  5FRO A;  1VQN I;  3KYC B;  2K3P A;  5TGT A;  1ZAR A;  5M5X J;  2O8K A;  2DK5 A;  4E7S A;  4MFE A;  4IL6 C;  5EEA A;  3E6D A;  4EJO A;  1KQ9 A;  2FXA A;  2IGM A;  1QVT A;  4B3A A;  3KCC A;  5F6F A;  1DP7 P;  3ISP A;  4CYD A;  5J1U A;  3G73 A;  5C44 J;  2QBY B;  3N4M A;  2LR8 A;  3IRQ A;  3H3V K;  1K78 B;  5LRS A;  1RI7 A;  1YO5 C;  2VIX A;  3NAU A;  2CH0 A;  2A6H F;  2EFP A;  1IDZ A;  1XSV A;  2DA6 A;  2NVQ J;  2YX7 A;  1WQ2 A;  1IGN A;  3O3K A;  3GZN B;  3I5U A;  3F72 A;  2VON A;  3CC4 I;  1UMQ A;  1LEB A;  5CVU A;  4MHG A;  2CUJ A;  4XK4 A;  4E4H A;  3OY9 A;  5FRN A;  1U8B A;  2PG4 A;  3K0L A;  4MIM A;  5E1W A;  4S04 A;  4V2F A;  5HLG A;  1V5F A;  1XTA A;  2UXX A;  1TW2 A;  2JA5 J;  1K79 A;  4YG2 F;  1IXC A;  2YU3 A;  4EGY A;  3BJA A;  5LGN A;  4J00 A;  1MBH A;  1WJ5 A;  1WPK A;  3LQR A;  3S32 A;  3FXJ A;  3KZY A;  1FJL A;  2QSG X;  2HZD A;  2DFE A;  2DXI A;  1HKS A;  1V55 H;  3T8T A;  2RDP A;  5DTD A;  3IV5 A;  2L9V A;  2TRT A;  2LDU A;  2VC1 A;  4XLF A;  2XRN A;  3W6V A;  3S16 J;  2LP0 A;  1UZC A;  2MBF A;  4KUM A;  3JSP A;  2HQA A;  3UKG A;  2EZL A;  3OL3 A;  2ZKZ A;  5FB2 A;  4KMF A;  3DCF A;  5EGO A;  4DJA A;  1P7J A;  2WB1 A;  2MC4 A;  3DPL C;  1Z7U A;  3CCY A;  3SEQ A;  1JKR C;  4FAS D;  1GT0 C;  2JK3 A;  2EIM H;  3OIQ A;  4IHT A;  2UZK A;  2V4J C;  3OYF A;  3CLQ A;  2BW3 B;  1LFP A;  2V6E A;  2ZJR F;  4PZJ A;  4DZP A;  3BPX A;  3CO7 C;  3PO2 J;  1JT6 A;  1YE9 A;  2WTE A;  1T2K A;  5HNH A;  3D0S A;  2R3S A;  1N77 A;  3ECO A;  2QSH X;  4CCL A;  5LHI A;  2O03 A;  1ZN2 A;  3HBL A;  2CW7 A;  5D4S A;  3CCJ I;  2GM4 A;  1SEU A;  3EDP A;  1PP8 F;  3S1Q J;  1P2F A;  4Y3O A;  1H89 C;  3IH4 A;  1TC3 C;  5HS9 A;  3BJO A;  1MNM C;  1DPU A;  3TMO A;  4UB6 C;  5H20 A;  2OTL I;  2M8E A;  1B72 B;  2D1V A;  1P7I A;  4MQV A;  1ACI A;  1X1P A;  1WKM A;  3FXQ A;  5JHU A;  4A3K J;  1U5T C;  3HYI A;  2K3F A;  3KLO A;  1R9T J;  1D0X A;  1LE8 A;  2IS4 A;  3K4J A;  3IRR A;  2R7S A;  2NNN A;  3OV8 A;  1T33 A;  3I71 A;  1TWH J;  2VXZ A;  3W2W A;  4PJL A;  5F0C A;  2XHK A;  2BVM A;  2B63 J;  4RA2 A;  3GZ6 A;  2CQQ A;  1ZRC A;  2W85 A;  4XQF A;  1X2N A;  5GAG J;  5LEK A;  5B1A H;  3BTC A;  5DYM A;  4M6V A;  1YLF A;  3FXK A;  4I98 B;  1X19 A;  2ACJ A;  2HEO A;  5HOO A;  4XN3 A;  4ZDP A;  3W6J B;  1BI3 A;  1YX5 A;  4KJZ A;  1FSH A;  1FC3 A;  2A69 F;  1QQI A;  3P7N A;  4P5O A;  3DBL B;  2VXD A;  1WZ2 A;  4HZF A;  1M1E B;  3GME A;  2DJI A;  3G1O A;  2O6G E;  3J7Y J;  1T98 A;  3C7J A;  1ZLJ A;  4M9Z A;  5HVQ C;  5DDG A;  3ABK H;  5FKL A;  1YIT I;  1HXD A;  2JT1 A;  2FD5 A;  3OYH A;  1R58 A;  4PK4 A;  2F5C A;  5DUK A;  4OAY A;  2F5F A;  1O4X A;  3QOD A;  4I76 A;  5LLQ A;  5IT3 A;  1O3Q A;  2YUS A;  1SD5 A;  4ON0 A;  4K2E A;  4M74 A;  3OYA A;  1G3S A;  4OU0 A;  3QYB A;  3FXM A;  2KIS A;  4D0P A;  4AIK A;  1KYZ A;  4B1R A;  4OOI A;  3OYE A;  1IDY A;  1LUJ B;  3RPQ A;  3M9A A;  3BZC A;  4HLX A;  5L3C A;  3I54 A;  3VOD A;  1XSX A;  2EIK H;  4BAC A;  3IP4 B;  3Q0U A;  5F27 A;  3BG5 A;  1YS7 A;  2LKS A;  4DGW B;  2ECB A;  2AXL A;  2X1C A;  4JYK A;  2NS0 A;  2HYJ A;  2D1H A;  3IUO A;  1LPQ A;  2EFW A;  3K4L A;  4NHJ A;  2FEZ A;  2R7X A;  1BM9 A;  1FOW A;  2HOA A;  2Y30 A;  3ZN0 A;  1JT0 A;  3O2P E;  1VFC A;  1X1C A;  2CFX A;  4BHP A;  2IW5 A;  5EGO B;  3DWL E;  1IAW A;  4LGW A;  4DOZ A;  4FE4 A;  2JA6 J;  3QU6 A;  3E7L A;  1HOM A;  3OWT A;  1S5L C;  3CES A;  2KZV A;  2DFH A;  2DYR H;  2OTJ I;  3V7S A;  4B3X A;  4EAT A;  5DD4 A;  4YFX F;  4BXF A;  3BOQ A;  3ABU A;  1JE8 A;  5B5E C;  3QU3 A;  3COA C;  5FGM A;  4HAM A;  3VEP A;  5IPA A;  3SJM A;  1B59 A;  3K69 A;  4Y4R A;  3OYG A;  4IQJ A;  1YI2 I;  5LHH A;  3ZQC A;  1ZH5 A;  5FLV A;  1PP7 U;  4G94 A;  1QZZ A;  2Z16 A;  5EZG A;  1G59 A;  1XD7 A;  1ONV A;  4LK1 F;  1LQ1 A;  3C2B A;  1D5Y A;  4RB1 A;  2YS9 A;  2L3D A;  4G6Q A;  5JVT A;  1U9N A;  4JX5 A;  1LE8 B;  5J3L A;  3E5Q A;  5D5W B;  3WE3 A;  3QAH A;  2COB A;  3CDH A;  1Z3X A;  4AC0 A;  3GZ5 A;  1UEL B;  1LNW A;  5E3M A;  1TWC J;  4X6A J;  1YG2 A;  3HTU A;  3WG7 H;  4OWR B;  4IKF A;  3DTE A;  2I10 A;  2C6Y A;  2L7M P;  1R00 A;  1NK2 P;  2Q8K A;  3MVP A;  3IL2 A;  2VJ4 A;  1FNN A;  4IOA F;  2BEO A;  4MNU A;  3WU1 B;  1BR1 A;  4YFK F;  3C2H A;  4OIQ F;  2DMT A;  1I1S A;  2N8G A;  1S7O A;  1JKP C;  2ID3 A;  3H9Q A;  1ETY A;  2ZO4 A;  1WI3 A;  4XRM A;  3FIS A;  3HOX J;  3SHF A;  3O8H A;  3TP3 A;  4OIO F;  3GTG J;  1FTZ A;  2E35 A;  2Z3Y A;  3I59 B;  2NRA C;  3BY6 A;  4GGG A;  4C3J J;  3WHB A;  4ZDO A;  5JLX A;  3HRU A;  4CUG A;  3CCS I;  4LB5 A;  2E34 A;  2RQP A;  2HU9 A;  1UHS A;  1ZHF A;  1DUX C;  4U0V A;  1OJL A;  4R79 A;  4L0Y B;  2NVT J;  1ZEL A;  2OA4 A;  3K4M A;  3FBI B;  3PJR A;  1J9I A;  3AL0 C;  3L2Q A;  1QHH D;  2H6B A;  3D5L A;  3RDI A;  2DPD A;  2CG4 A;  1W7P B;  2EFQ A;  5ICF A;  1MD0 A;  4CCM A;  1BL0 A;  4KIS A;  4P1W A;  3S15 J;  2HR3 A;  1QPM A;  2VBZ A;  1MW7 A;  2OPT A;  3JCU C;  3IC7 A;  2VOO A;  1FYL A;  1D5V A;  3GTP J;  4ZTJ A;  3E1S A;  4IPA A;  3DLA A;  2FF4 A;  3K7A J;  2GA1 A;  1LVA A;  2UXN A;  3CME I;  4CCN A;  3S14 J;  4BE0 A;  4I0A A;  2LH9 A;  2I8D A;  1W0T A;  1R1V A;  3C3W A;  5BNG A;  3HRS A;  3K1N A;  1XGN A;  4R1H A;  2HVR A;  2HOS A;  2CFO A;  4UV9 A;  4U0Y A;  1IRZ A;  4IJA A;  3F22 A;  2LY1 A;  4CCJ A;  4CSW A;  2E1M C;  4ZYA A;  2CV1 A;  3ZMZ A;  1GHC A;  3K2A A;  3W2V A;  3DEE A;  4AYB A;  2V7F A;  4HLY A;  2LRD A;  2QEX I;  1SVM A;  3DQV C;  1MND A;  4CYC A;  1TWG J;  3AG3 H;  3I58 A;  3B6A A;  4BQN A;  5D4R A;  3ZMD A;  1PYV A;  1DU6 A;  5KCM A;  1MH3 A;  5J47 A;  1WJE A;  3MFK A;  4LLN A;  3ZQF A;  3S17 J;  2KDO A;  5JVG F;  3BDD A;  4LIT A;  3BG3 A;  3BTI A;  1TLH B;  5IYD J;  3DU6 A;  2IS6 A;  2ICW G;  3ZQQ A;  1A36 A;  3V7C A;  4KIF A;  3GWZ A;  3PNT A;  2Z33 A;  3VPR A;  2QQA A;  2KLO A;  1DGR M;  1V3F A;  1TNT A;  1JTY A;  4HX8 A;  1QZE A;  3Q5F A;  1Y0U A;  1WH5 A;  3M8J A;  3CCQ I;  2PMZ N;  2AHQ A;  2PQ8 A;  1W4M A;  5LHG A;  2W84 A;  2IA1 A;  5E8G A;  3L2U A;  3RJP A;  3BZK A;  3A0H C;  4ZJZ A;  3ZP5 A;  2I5U A;  5IP7 J;  1YRN A;  1BN5 A;  2DK8 A;  4PJN A;  5K1Y A;  3OS0 A;  1NH3 A;  5IYC J;  3HZJ A;  3S1N J;  4G12 A;  2B7E A;  2RVC A;  3QPH A;  4BU2 A;  2Y69 H;  2K9M A;  2A6T A;  1P4X A;  3G71 I;  1RNL A;  2WAE A;  2MC3 A;  3H5R A;  2VJ5 A;  2YSR A;  4M6X A;  4OAZ A;  3K70 C;  4EJW A;  2X4H A;  3V8J A;  4BUP A;  1T0F A;  2E19 A;  2QM3 A;  4F3Q A;  1BC7 C;  3BR5 A;  5FRM A;  3CUO A;  4F7Z A;  2BYV E;  4O3M A;  5BPD A;  2DTZ A;  1NTC A;  2FNP A;  1FP2 A;  2Z1D A;  1FOX A;  3EET A;  1WH7 A;  2CUF A;  3J80 Z;  3OS1 A;  3FM3 A;  3GTL J;  3FK6 A;  4XIC A;  2R7V A;  1HLV A;  2CGP A;  2GOM A;  2P4W A;  3M8F A;  1YS6 A;  2KRC A;  4KN7 X;  2HDD A;  1UJ8 A;  5BQT A;  4KN4 X;  1TWA J;  2Z99 A;  3FMR A;  2YU9 J;  1OKR A;  3E5X A;  3TDU C;  1ZR2 A;  1ETO A;  1P4A A;  1TWF J;  3KZZ A;  2HOE A;  1XMA A;  2QSF X;  2WY8 Q;  3QYE A;  3N97 A;  4Z6Y A;  3RPU A;  2JZY A;  4IHW A;  2DOE A;  4MFD A;  3JRA A;  1GVJ A;  3HOU J;  4RGX A;  1MMA A;  2IVM A;  3K4C A;  5EDN A;  2KHM A;  4NNJ A;  3WG9 A;  1UG0 A;  3OYN A;  1KU3 A;  3QPL A;  4HW0 A;  2WV0 A;  2BOL A;  1VQ6 I;  1Z3Y A;  4BEH A;  4JK1 X;  2XAS A;  3ZQH A;  4RAZ A;  3NEU A;  2M0C A;  4ZYG A;  2XSD C;  1GVD A;  3AFH A;  1YIO A;  3ABL H;  1HCR A;  3CC2 I;  5LD2 C;  1EJ9 A;  2BZT A;  2DA7 A;  1H88 C;  3JRH A;  5FKK A;  3IH3 A;  4ABZ A;  2F4I A;  4BQA A;  3MCZ A;  1C0W A;  4GFB A;  3BR0 A;  3CJT B;  4CHU A;  1A04 A;  4F91 B;  1D0Y A;  2P5K A;  3U1D A;  1OQY A;  5FJ8 J;  4BY7 J;  1YW8 A;  3GLL A;  4KYW A;  2RKH A;  2OF7 A;  1TBX A;  3LA2 A;  1GXP A;  3ZXS A;  3CMA I;  4EM1 A;  5JFR A;  4A0Y A;  4V2G A;  1VQK I;  1V54 H;  1HKT A;  3LSP A;  4L5I A;  3WHC A;  4CYC B;  2F48 A;  3FK7 A;  1ZG3 A;  3CTA A;  4RAG A;  2M30 A;  3MD2 A;  2ISZ A;  2L4M A;  2MD0 A;  2ELK A;  2QYO A;  4EQQ A;  2RGV A;  3MZH A;  3ZRG A;  2X6Y A;  4KIG A;  5H6Q A;  3S2W A;  4G7O F;  3OIP A;  4XLA A;  2XRL A;  1O7L A;  3VSK A;  2DOD A;  4RGR A;  1WFX A;  4BBS J;  1U0J A;  4BHC A;  4A2U A;  3K10 A;  3KPH A;  3H3U A;  2Q0O A;  1HF0 A;  2A5W A;  1L0O C;  1P4W A;  4C3H J;  2WBM A;  1RKT A;  3DEW A;  3LA3 A;  4JOM A;  5JR3 A;  3GF2 A;  2BXZ A;  3K1M A;  3LSI A;  3MKW B;  1Z7L A;  3KP4 A;  5ILS A;  2F2E A;  1IRG A;  4LIU A;  3HHH A;  4FET A;  1KA8 A;  4YII A;  4EGZ A;  1W5C C;  1USS A;  2K9Q A;  3DBH B;  2ME6 A;  5GAH J;  3JTG A;  1I1G A;  2QGU A;  3LL7 A;  1K83 J;  5FO5 A;  4BL0 B;  2XAH A;  3E6M A;  1BIA A;  2EIL H;  4O6J A;  1ZR4 A;  1TQP A;  2R7R A;  1OR7 A;  1P92 A;  1TT5 B;  1N75 A;  2XF7 A;  1JTX A;  4PSX A;  4LLL A;  3F0C A;  4HX7 A;  1QO0 D;  4ZH4 F;  4M71 A;  3K9T A;  1BIB A;  3CMM A;  5HOD A;  1E3H A;  1V4R A;  3HOS A;  2VKV A;  1F9N A;  1VQ7 I;  5GPC A;  3TO7 A;  5L3G A;  4Q4Z F;  4LJZ F;  3LAP A;  3FKI J;  2XF6 A;  1LEA A;  2H1K A;  3EYI A;  2R4G A;  4UXN A;  3GVA A;  5CPR B;  1MBJ A;  1O57 A;  5TIS C;  5AIP A;  2DMN A;  1IXR C;  4ZDL A;  4G8X A;  2DBB A;  4A5N A;  2STT A;  1RZ4 A;  1B6A A;  1ULY A;  1X3Z B;  3ZMU A;  1K4T A;  1FIP A;  2DQR A;  2HKO A;  1I39 A;  3QRF F;  5FFX A;  1X3W B;  3BR1 A;  1R23 A;  3PUF A;  4BJ6 C;  2O0Y A;  1T38 A;  2IS1 A;  2KIF A;  2R5Y A;  5J4Y A;  2R7Q A;  2KRF A;  2ME0 A;  3FKJ A;  2OUM A;  1K61 A;  3SZG A;  2VJI A;  2EH3 A;  3MZY A;  2FML A;  2J5P A;  2Z9O A;  3NRV A;  5C4X J;  2E1C A;  3EQL F;  5IP9 J;  4IRG A;  3T0Y A;  1JJ6 C;  2P6T A;  3I4P A;  3G4S I;  2D2W A;  2A61 A;  4TV7 A;  1VQL I;  4MTE A;  2VJJ A;  3F8N A;  4MLO A;  1W1W E;  1D1A A;  4Z2Y A;  2GQQ A;  1BI0 A;  1IN5 A;  3J80 K;  4RLQ A;  3OYM A;  4QWQ A;  1D0Z A;  1QGP A;  5HLI A;  4BHB A;  5LEJ A;  4F52 A;  5GPA A;  1Z21 A;  3TL4 X;  2L5Q A;  4IQ4 A;  5CJ9 A;  1HDP A;  1WWX A;  4M9S A;  1BBY A;  1A5J A;  1DPR A;  2EBI A;  4ENM A;  2VT2 A;  2VAS A;  2G7H A;  1FOY A;  3SFI A;  3GW2 A;  1TP4 A;  2DW4 A;  2A6E F;  3SZT A;  2XGC A;  3KE2 A;  1UCR A;  2NVX J;  4U87 A;  1ITY A;  3ELK A;  2P8T A;  1D1B A;  3BRO A;  3SDB A;  2FOK A;  3PM1 A;  2IAI A;  2L4A A;  2V6C A;  4L5J A;  1XSD A;  2M7B A;  5E8I A;  1F1Z A;  2JPB A;  2HVS A;  3CUQ A;  3JAM Z;  3E0J B;  3FDY A;  1OMI A;  4DYQ A;  4NQW B;  4G7H F;  1IV8 A;  4M3B A;  2EB7 A;  2YR2 A;  2OCC H;  3H5A A;  2LBF A;  2TCT A;  2DMQ A;  3GTM J;  1S7A A;  1GV2 A;  2XVC A;  2PLY A;  2JUC A;  2OBP A;  4B4C A;  5LFA A;  1QNT A;  2FQ4 A;  3H5N A;  1BJZ A;  2ZJQ F;  2M0M A;  1TL8 A;  3IWF A;  2HWV A;  3BC8 A;  3RKY A;  3PQK A;  4WXD A;  4OIR F;  1MKM A;  2LK2 A;  3MKY B;  4ENK A;  2R7F A;  1STZ A;  4NUB A;  1CF7 A;  1EH6 A;  3HHG A;  2OQR A;  4W1U A;  1G2H A;  4CIC A;  4DYC A;  3CQZ J;  1AKH B;  4PFP A;  1HSJ A;  3TOA A;  4X1E A;  4D5F A;  4XRS A;  4EMS A;  3AG2 H;  3CMY A;  2FBH A;  3TW7 A;  2QKM B;  2M2E A;  4Y7N J;  1MDM A;  1MMN A;  2W25 A;  2VLA A;  4D5C A;  3DTI A;  5E20 A;  2ZME A;  1F4K A;  1RC9 A;  1DQU A;  1MMG A;  2OZU A;  2HDW A;  5C4J J;  1UG2 A;  4M72 A;  2CQN A;  2X48 A;  4I02 A;  3FM5 A;  4QSH A;  1NHA A;  4B43 A;  1EH7 A;  2KJC A;  1WGX A;  3IKV A;  2F6C A;  4HNT A;  1GDT A;  4AM3 A;  5J4V A;  2LLK A;  2O61 A;  1J59 A;  2LY9 A;  3R0J A;  1OFC X;  2R5Y B;  4XM3 A;  1B9N A;  1HKQ A;  4ENN A;  2J5O A;  1E3P A;  2DOA A;  4WCG A;  2Q2E A;  1IUY A;  1SFE A;  4CZC A;  3CCM I;  1XC5 A;  3TP0 A;  4E7H A;  3SYT A;  1KON A;  5FD6 A;  2K4J A;  1GXQ A;  2LKX A;  4A0X A;  4L9J A;  2MH2 A;  1JGG A;  1QBJ A;  2DQL A;  5KAF C;  3FHZ A;  4IHS A;  3GTO J;  2E1N A;  3RKW A;  2IXS A;  5E3N A;  4B09 A;  1RES A;  4NC8 A;  5D6F A;  3HOV J;  4AUX A;  1OYI A;  2DO7 A;  3KEO A;  1REP C;  3KLN A;  4A3G J;  3BG6 A;  4I7H A;  3V42 A;  2OJE D;  2IEK A;  3PSI A;  1SFK A;  1A35 A;  1X58 A;  3ZOB A;  4M6Y A;  2F5E A;  4CCO A;  1PDN C;  2JVG A;  5FLX Z;  1Y8R B;  4FTH A;  2ZFW A;  3K1P A;  5FKM A;  2GBY A;  2XGD A;  5B1B H;  1CGP A;  2DU9 A;  2IRF G;  2ESH A;  2DFF A;  3H9J A;  2H8W A;  4KIB A;  3OS2 A;  1G3W A;  3GFI A;  1SFU A;  3EUH C;  4L9N A;  3VYR B;  1O3T A;  2JQ7 A;  1JI8 A;  4YFN F;  2JVH A;  3CUQ B;  4L5E A;  2CUE A;  2F5V A;  2BVL A;  4E6K G;  4J19 A;  2VPL A;  2MGQ A;  2RN7 A;  3MZ8 A;  1IN7 A;  4NBQ A;  1TTY A;  3LSG A;  3R6S A;  3H35 A;  5M3M J;  2CS3 A;  3HGG A;  5E3O A;  3FX3 A;  2DPU A;  2MLG A;  3HRM A;  3I9V 2;  2LBF B;  3S93 A;  2W48 A;  2PMU A;  3BCA A;  1XN7 A;  2M8G X;  4BBR J;  3U21 A;  2IGK A;  1WRJ A;  2A68 F;  2K4B A;  2HVQ A;  2LFB A;  1SVL A;  4BE2 A;  3WTV C;  1IG7 A;  1YYV A;  4P55 A;  2FJ1 A;  4IHY A;  4JBA A;  3FXU A;  4G9Y A;  3G3Z A;  4LLG F;  4RAF A;  3S1M J;  1V5G A;  1BI1 A;  2CW8 A;  4YIR X;  1IF1 A;  3H0G J;  2VQG A;  4FT8 A;  4IX7 A;  4QPQ A;  4MQ9 F;  4EJT A;  1CF7 B;  5F04 A;  4HST A;  2X1E A;  2FMY A;  2XPV A;  1K6O A;  4DZJ A;  1R49 A;  2NNY A;  1S3J A;  4JX6 A;  1IN4 A;  2MD5 A;  4M3E A;  5ILU A;  1FYM A;  2FRH A;  3HTS B;  3Q9S A;  1EKE A;  5D5X B;  4HDV A;  3R4K A;  2LSO A;  3JAM K;  4GYG A;  3K4B A;  3VYS B;  1R1U A;  2BY2 A;  2QA4 I;  2R7Z J;  3M8E A;  1LDK B;  2XB5 A;  1SAN A;  1U5T A;  3GFM A;  2ZME B;  3JRI A;  1XGO A;  2O7O A;  3HXL A;  1VQM I;  3FBN B;  2PX9 A;  1LDD A;  1HST A;  4A3D J;  2EV0 A;  1VI0 A;  5J8C A;  4DW6 A;  1V5E A;  3GXO A;  4ASN A;  2O3F A;  4E7L A;  2LVS A;  2AS5 F;  5ILV A;  3FXO A;  2JRT A;  2E60 A;  2CQK A;  4U0W A;  2FX0 A;  3I0T A;  2M4K A;  5HDG A;  3L09 A;  1W7P D;  2DA2 A;  4UVB A;  1S6L A;  4A93 J;  4LK0 F;  3UR3 C;  3NWT A;  4BY1 J;  3QOE A;  4Y33 A;  3P9C A;  5CYV A;  4FQG A;  2PI0 A;  2HPM A;  4Y13 A;  4WWC A;  3ZQG A;  2W7N A;  1W5T A;  2GXB A;  1R22 A;  1G3T A;  3HSF A;  4HEA 2;  2Q2E B;  2EJR A;  2OZ6 A;  1D1C A;  1JHF A;  2RNG A;  3HB9 A;  3GLX A;  3A01 A;  2BE5 F;  1ORK A;  2W82 A;  3MAJ A;  1Y1W J;  1VQ4 I;  3LST A;  1SMT A;  5EEG A;  3LMM A;  9ANT A;  3DKY A;  4NB5 A;  4HF1 A;  3NWS A;  4A6E A;  2L7F P;  3TW6 A;  1EV7 A;  1J09 A;  2E5N A;  3WOD F;  1IC8 A;  3WTX C;  5K5O A;  4RGU A;  3V4G A;  5IYB J;  3VSL A;  5TJJ A;  3OYD A;  2HPI A;  3HC7 A;  1QPI A;  1RET A;  3J7A O;  2L01 A;  3RIR A;  4XLP F;  3CJR B;  1G6N A;  1U6G A;  3ZQI A;  2JA7 J;  3JRG A;  2XB0 X;  4P96 A;  4A12 A;  3JTH A;  4HBL A;  2D5V A;  2GAU A;  3DTK A;  2L54 A;  4HA8 A;  3PSF A;  4IF4 A;  1ETQ A;  1XGS A;  3G1M A;  4QIW N;  3EYY A;  4UUS A;  1K7A A;  1H8A C;  1FIA A;  3AAF A;  2VQC A;  3WGI A;  3P5J A;  1Y1V J;  2OU2 A;  4XKB A;  1LFU P;  1JXS A;  2XF5 A;  4IRI A;  4XN0 A;  2KJB A;  2VI6 A;  4RBO A;  2CMP A;  2CUZ A;  1S8N A;  3TED A;  3LSK A;  4E7I A;  1QU3 A;  1MMS A;  4EV0 A;  1VQ8 I;  2EV6 A;  3K2Z A;  4HYE A;  5BMZ A;  1X4P A;  2DMU A;  1Y8Q B;  1R4M B;  2TDX A;  2VOP A;  3ECH A;  4LG0 A;  1Y56 A;  1JUS A;  2ZXW H;  3CP8 A;  4XLH A;  4U7B A;  5E18 F;  2M87 A;  3GO5 A;  3DPU A;  4ZC3 A;  3SQN A;  3RYR A;  1X4O A;  2CRG A;  4PGG A;  1O3S A;  2DLL A;  2V79 A;  2FUG 2;  4EJV A;  4RDU A;  4IHX A;  2JA2 A;  3KP3 A;  2XC7 A;  1FOK A;  2M5W A;  2RV8 A;  3BQZ A;  3GX4 X;  1W5S A;  3FMS A;  4FX4 A;  1WJD A;  2FOW A;  5IOZ A;  3PO3 J;  4HDU A;  4DBQ A;  1H0M A;  4A3C J;  3FXL A;  3NQO A;  1FTT A;  2AO9 A;  1R5G A;  3MWM A;  5FLX K;  4DNC A;  3F23 A;  2PEX A;  2YPR A;  1I6X A;  1KGS A;  2P5V A;  4IZZ A;  2HDC A;  3JR9 A;  2CQX A;  1TT0 A;  1EA3 A;  3BWG A;  3SDG A;  4C9Y A;  1T56 A;  2XAQ A;  3HG9 A;  3DKX A;  1XDS A;  1QHG A;  5E1Z B;  2V1N A;  1OCT C;  2JSP A;  2QCO A;  1FMW A;  3OL4 A;  2KZG A;  1U5T B;  1BA5 A;  2JJ7 A;  3HUG A;  2H1L A;  3MN2 A;  2JMW A;  2GXA A;  3ASO H;  4CGZ A;  2ESN A;  3ZQL A;  3DKW A;  2R5Z A;  3TBI A;  4PDK A;  2L2O A;  1QZY A;  4F92 B;  1YJW I;  2XV4 S;  1UHM A;  3JRD A;  2PMZ A;  1F43 A;  2XUB A;  4ZYD A;  4OIP F;  3HOZ J;  3FZV A;  2PN6 A;  2RNJ A;  3IWZ A;  3HKZ N;  2E2J J;  2LMD A;  3TDZ C;  4XOP A;  1VQP I;  1J2X A;  4LD5 A;  3WTS C;  2B0L A;  5D6E A;  3HPG A;  5EZH A;  5GP9 A;  1UB9 A;  5H2F C;  1FMV A;  2BXY A;  4KT5 C;  5F0H A;  1SFX A;  1KQ8 A;  1XGM A;  4BXX J;  4HSR A;  2ELH A;  3BR3 A;  2LG4 A;  3PIP F;  2R7O A;  3A01 B;  4G6D A;  4XKC A;  3QWL A;  1Y0N A;  2Q1Z B;  5BPI A;  4BNC A;  1AHD P;  4R8H A;  2VE8 A;  4A3B J;  2MAB A;  1X1A A;  1ETV A;  3LOC A;  2A07 F;  5K5R A;  3WTU C;  1BI2 A;  5L3F A;  2HZT A;  2M34 A;  5GAD J;  3S3M A;  2LNB A;  3CCU I;  3HRT A;  1TQI A;  1PVE A;  3QPT A;  3OOP A;  3OYI A;  3F9K A;  1B8I A;  4RS8 A;  3CD6 I;  5CVR A;  5K7Z A;  3A1Y A;  2X9D A;  4WXC A;  1LJ9 A;  1P9Q C;  4I2O A;  4AVZ A;  1OCP A;  1ZGA A;  2OCE A;  4LB6 B;  3BJ6 A;  2CW0 F;  3KP5 A;  4UUS B;  1APL C;  3ESW B;  3VYT B;  2ZFU A;  3KIO A;  4HX4 A;  2G9W A;  1Z6T A;  4BQQ A;  5CVJ A; 
#chains in the Genus database with same CATH homology
 4ITV A;  2VJJ A;  4MLO A;  1D1A A;  1NG7 A;  3LSM A;  4XR6 A;  4RLQ A;  3OYM A;  5HVQ C;  1D0Z A;  2X1D A;  4F52 A;  3OYH A;  1Z21 A;  4PK4 A;  3TL4 X;  2L5Q A;  4IQ4 A;  4OAY A;  1G8X A;  3DU5 A;  3IAM 2;  3QOD A;  3I3L A;  2GOX B;  4BJ5 C;  2VAS A;  3OYA A;  2DT7 B;  4PSW A;  3QYB A;  4XOR A;  4YRV A;  3OYE A;  2X6W A;  4U87 A;  4BQO A;  4E7Z A;  1D1B A;  2VQH A;  3SDB A;  3PFY A;  2O5R A;  2M7B A;  4F55 A;  2HVS A;  4BAC A;  2LOO A;  3RSN A;  3IP4 B;  2VKH A;  3HPH A;  3E0J B;  4QPO A;  3FDY A;  4DGW B;  4NQW B;  2X1C A;  3IUO A;  3H5A A;  4JQF A;  2LBF A;  3H9G A;  3K4L A;  2R7X A;  1X1D A;  3N05 A;  4PUS A;  5LFA A;  1X1C A;  2V26 A;  2KRH A;  3H5N A;  4XON A;  2VL8 A;  4KIT B;  3DWL E;  2M0M A;  2VB6 A;  4BJT A;  4DOZ A;  3BC8 A;  1BR4 A;  1W36 C;  3HUG B;  3OWT A;  3CES A;  4N4N B;  3RPU D;  2KZV A;  1WJC A;  4B3X A;  4EAT A;  3MKY B;  4BGD A;  4BXF A;  3D5S C;  1GLN A;  4NUB A;  4XKW A;  4XOT A;  4PFP A;  3EUA A;  3OYK A;  2PJR A;  4Y4R A;  3OYG A;  4IQJ A;  3W2A A;  2QKM B;  2Z16 A;  3EUK L;  1G59 A;  2W1O A;  1MMN A;  2VLA A;  2M4G A;  3HKZ A;  3OOU A;  3DTI A;  2JUG A;  3BG7 A;  1YX3 A;  2QKL B;  3W3C A;  1DQU A;  1MMG A;  2ZXH A;  3A2K A;  3UNG C;  4XLE A;  2HDW A;  1Z3X A;  2AQE A;  3S8P A;  2V9K A;  4B43 A;  1W36 D;  3KYL A;  2F6C A;  1UEL B;  4HNT A;  2WAD A;  2Y0S A;  2UUZ A;  2KL4 A;  2X85 A;  4OWR B;  4XM3 A;  1S9H A;  4IKF A;  3DTE A;  3CF2 A;  2WAF A;  1OR7 C;  3BLY A;  2VJ4 A;  2DOA A;  5CQE A;  1BR1 A;  2VKD A;  4G6T B;  3C2H A;  4CZC A;  2AQF A;  4E7J A;  4E7H A;  3SYT A;  1KON A;  3H9Q A;  2R7W A;  4RM3 A;  3PL8 A;  4BE1 A;  4BEH B;  3BCB A;  1WJF A;  1LVK A;  4HG2 A;  3OYC A;  1IRX A;  2LRE A;  3VWB A;  2ELJ A;  4ZDO A;  3CZ6 A;  2K9L A;  2IXS A;  3OR2 C;  2DT6 A;  4CUG A;  4NC8 A;  2HU9 A;  3HOT A;  3BG6 A;  3K4K A;  3V42 A;  4R79 A;  4B44 A;  3MKZ A;  4C2T A;  4RM2 A;  1ZEL A;  3K4M A;  3PSI A;  1SFK A;  3FBI B;  3H0D A;  3PJR A;  2E1M B;  3MMY B;  3AL0 C;  2DCE A;  1MNE A;  3L2Q A;  1QHH D;  2K5C A;  3D5L A;  4CCO A;  4BDZ A;  2JVG A;  4CCM A;  4KIS A;  4P1W A;  3H9J A;  1MW7 A;  3OS2 A;  2W4S A;  2VQL A;  3EUH C;  3VYR B;  2WY7 Q;  1JI8 A;  4NC7 A;  2JVH A;  2F5V A;  4E6K G;  2BVL A;  3E1S A;  4ZTJ A;  1UAA A;  2VPL A;  1E0E A;  3DLA A;  4LIV A;  3LSG A;  3H35 A;  5KHD A;  2CS3 A;  4CCN A;  4BE0 A;  2LH9 A;  2I8D A;  3EPZ A;  3I9V 2;  2LBF B;  3S93 A;  3BCA A;  4PJM A;  3C2G A;  2HVR A;  2CFO A;  2KPM A;  3U21 A;  2IGK A;  3VYU B;  2HVQ A;  2LY1 A;  4CCJ A;  4CSW A;  5JHF A;  4BE2 A;  3PUB A;  2M3A A;  2XSJ C;  2E1M C;  4ZYA A;  4XMY A;  2ZSH B;  3VDX A;  4F93 B;  2CV1 A;  2LYC A;  3W2V A;  3DEE A;  4AYB A;  1V5G A;  2V7F A;  2LRD A;  4B47 A;  2CW8 A;  3DQV C;  1MND A;  2VQG A;  4BQN A;  1PYV A;  4IX7 A;  4QPQ A;  5KCM A;  1WJE A;  4D9J A;  2KDO A;  4HST A;  4LIT A;  2W00 A;  2X1E A;  3DU6 A;  4BS9 A;  4C2U A;  2IS6 A;  4II2 A;  2MYS A;  3ZQQ A;  2OC6 A;  3OYB A;  4LG3 A;  3L2R A;  3PNT A;  2PJR B;  2KLO A;  1DGR M;  2X6X A;  1T95 A;  2MFZ A;  3LSH A;  1OLT A;  3K4B A;  3HL2 A;  3VYS B;  4ANJ A;  3M8J A;  1LDK B;  3D5R C;  2L7K A;  2E5Z A;  3L2U A;  1K6Y A;  2KP6 A;  4ZJZ A;  3HXL A;  3FBN B;  3K6G A;  3ZCO A;  4HRI A;  4PJN A;  3OS0 A;  2BW3 A;  5KNL A;  2RRE A;  1V5E A;  2R7U A;  1LKX A;  3ZGK A;  4BU2 A;  2K9M A;  2A6T A;  4E7L A;  1X1B A;  2E60 A;  4RLF A;  2WAE A;  3H5R A;  3J7A Y;  2VJ5 A;  1WJA A;  2M4K A;  5CKT A;  4OAZ A;  3K70 C;  3G2B A;  3UR3 C;  3NWT A;  4BUP A;  1VZ0 A;  2OV7 A;  4ZTF A;  4F3Q A;  3QOE A;  4J01 A;  4Y33 A;  1BOB A;  2IGO A;  3GBG A;  3A4C A;  4N4O B;  4CCK A;  2HPM A;  5FRM A;  2UWM A;  3K4N A;  2W7N A;  3DPT A;  5CQG A;  3AL0 B;  2WAQ A;  4HEA 2;  1AA7 A;  2Q2E B;  4GRI A;  4YEL A;  4CH7 A;  2CV0 A;  2KQR A;  2Z1D A;  2NOJ B;  2IS2 A;  1R6R A;  2KMU A;  1DP3 A;  2P0W A;  1D1C A;  2RNG A;  4II3 A;  3OS1 A;  2W82 A;  4DIQ A;  2UV1 A;  3OYL A;  2R7V A;  3LMM A;  2GOM A;  2KRC A;  3DKY A;  3M1C A;  2WA0 A;  3NWS A;  3KX2 A;  3IAS 2;  3SEZ A;  4C30 A;  4HNU A;  1J09 A;  2E5N A;  1MMD A;  3VSL A;  3OYD A;  2HPI A;  3HC7 A;  4XL9 A;  4B48 A;  2WY8 Q;  3QYE A;  2ZXI A;  3CJR B;  2R7T A;  2M7A A;  3RTR A;  1SAU A;  1MMA A;  3DTK A;  3K4C A;  3ONQ A;  3PNV A;  3AKZ A;  2KHM A;  4NNJ A;  2HNH A;  3PSF A;  3K70 D;  2IGN A;  2XAU A;  4PJJ A;  1UG0 A;  4BDY A;  3OYN A;  3RQ4 A;  2CV2 A;  2BOL A;  2VQC A;  1Z3Y A;  4BEH A;  3CP2 A;  1WJB A;  2ZSI B;  4XKB A;  3OYJ A;  2XF5 A;  4XN0 A;  5FRO A;  1BR2 A;  2K3P A;  2CMP A;  2CUZ A;  5TGT A;  3LSK A;  4E7I A;  3AFH A;  4E7S A;  1QU3 A;  5LD2 C;  1PJR A;  2IGM A;  4E7K A;  1X4P A;  5HNF A;  2F4I A;  1Y56 A;  3CP8 A;  4XLH A;  4U7B A;  1ERD A;  3ZR8 X;  1D0Y A;  4F91 B;  1DGW Y;  3DPU A;  4ZC3 A;  2VIX A;  1X4O A;  2CH0 A;  4RMN A;  3ZXS A;  2FUG 2;  2JA2 A;  2LC2 A;  3QYF A;  2XC7 A;  1Y6I A;  3OMY A;  2CUJ A;  4E4H A;  4D1Q A;  3OY9 A;  2XDV A;  5FRN A;  1WJD A;  4DBQ A;  3MD2 A;  1V5F A;  2MD0 A;  4J00 A;  1WJ5 A;  4IZZ A;  3ZRG A;  3S32 A;  2X6Y A;  1TT0 A;  1EA3 A;  2HZD A;  3OIP A;  3S3N A;  2DXI A;  4XLA A;  4C9Y A;  3VSK A;  1WFX A;  3HG9 A;  4XLF A;  1U0J A;  3DKX A;  3K10 A;  1QHG A;  2HQA A;  2RQQ A;  2A5W A;  2V1N A;  3OL3 A;  2JSP A;  2Z2S B;  1FMW A;  3OL4 A;  4YEJ A;  4DJA A;  2WB1 A;  2WBM A;  4JOM A;  2MC4 A;  3DPL C;  3SEQ A;  4FAS D;  3LSI A;  3MKW B;  1Z7L A;  3OIQ A;  2V4J C;  4HPQ A;  3OYF A;  1NG6 A;  2BW3 B;  4LIU A;  1LFP A;  2V6E A;  4FET A;  1TZL A;  4CA0 A;  1N78 A;  3TBI A;  2L2O A;  4PFO A;  4F92 B;  2PMZ A;  1YE9 A;  4AU7 A;  4H4K C;  3LL7 A;  4XOP A;  5HNH A;  4BL0 B;  1HA8 A;  4X0G A;  1N77 A;  3HPG A;  4CCL A;  2R7R A;  1FMV A;  1N75 A;  2XF7 A;  4PSX A;  2CW7 A;  4XLC A;  4Y3O A;  3OR1 C;  4HSR A;  3CMM A;  3TMO A;  2LG4 A;  3HOS A;  3L2V A;  2R7O A;  3KEY A;  4XKC A;  2Q1Z B;  1D0X A;  2XF6 A;  2IS4 A;  3K4J A;  2MAB A;  2R7S A;  2R4G A;  5CPR B;  1X1A A;  3RCO A;  2L9N A;  3FHN A;  4XNF A;  4ZDL A;  2VXZ A;  2L9S A;  2LY2 A;  3PNY A;  3W2W A;  4PJL A;  2BVM A;  3S3M A;  3CJQ B;  3S3O A;  3L2W A;  4XQF A;  4BJ6 C;  5HLT A;  3OYI A;  2IS1 A;  3F9K A;  3LFU A;  2R7Q A;  3FKJ A;  3A1Y A;  1T0F C;  2OUM A;  2X51 A;  1P9Q C;  1X19 A;  3SZG A;  2VJI A;  4AVZ A;  5HOO A;  4XN3 A;  4ZDP A;  4KT6 A;  1YX5 A;  4KJZ A;  4P5O A;  2VXD A;  3VYT B;  2ZFU A;  2DJI A;  4XKV A;  4BQQ A;  4DBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...