1X3WB

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
GSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords peptide:N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1x3wB01
2QSGX 1TP4A 3ESWB 2F4MB 1X3WB 2QSHX 2F4OB 1OQYA 1PVEA 4YIRX 1X3ZB 2QSFX 1QZEA
chains in the Genus database with same CATH superfamily
3J7AO 1PUFB 5CJ9A 1JJ6C 2HPMA 5A2QZ 5IOYA 3DTIA 1ZARA 1ZH5A 4BXUA 1OMIA 3F8NA 3N05A 3K69A 4FETA 4HYEA 5E17F 2R4GA 4L5JA 2M87A 4YFXF 1TT0A 3HOXJ 1LKXA 1J2XA 1T56A 1X2NA 5J3LA 2QM3A 1SMTA 4DBQA 5EGOA 5M3FJ 2DMUA 4GCVA 2CGPA 2OQGA 1MBFA 1ZLKA 3ZQGA 1GUUA 1BN5A 1M1EB 3K4CA 1NK2P 3TO9A 3BTIA 3K2ZA 1FNNA 1FX7A 2UXNA 1YRNA 4NHJA 2HQRA 4E7SA 3FDYA 3I4MJ 3LA2A 5TJJA 1BR4A 3S1NJ 2V9KA 3AKZA 1MJBA 4ON0A 3L2CA 3GW2A 3D1NI 4MEYF 1T38A 2MABA 2XGXA 1GXPA 2X1EA 1E3HA 3NAUA 2A68F 2EIKH 4XONA 4ZYAA 1ACIA 2LVSA 3BJ6A 3KZYA 4BJ6C 5IT9Z 4BHBA 3RPUA 3TBIA 4CUGA 3V7CA 1JI8A 3R0JA 2M8EA 4X1EA 3J80Z 1B8IB 4A0XA 3W3CA 4B1RA 5BOXA 1P92A 1USSA 2HNHA 2PG4A 2JQ7A 1SFEA 2VQGA 3Q0UA 4C3JJ 1U9OA 3U1DA 2BVMA 1VNDA 2CG4A 3WU0A 1HBXG 2DPDA 3R6SA 1IXRC 3D5RC 5E1ZB 1O3SA 1FJLA 1QQIA 5EJCA 3S2HJ 3BY6A 5DUKA 1YYVA 2XF7A 2DODA 4HDVA 1O4XA 4HSTA 1HCRA 5JLWA 4Q48A 4WX9A 1IJWC 3S1MJ 1XPXA 1AWCA 3CLOA 3LL7A 2CV1A 1H8AC 4WXHA 3GTGJ 1FBSA 4GDFA 4HX8A 2JN6A 2VJIA 2E1CA 2AS5F 1W7PA 2PMZA 4XQFA 1A04A 5K1YA 5EG0A 4DW6A 3BROA 1OJLA 1XDUA 1LEBA 2L7MP 2Z2SB 5E3OA 4PFOA 3WGHA 1NH3A 2JA6J 2K5CA 2DT7B 4S04A 3WTYC 2ME6A 4BHPA 3JRFA 2HWVA 3REOA 1SEUA 4O3MA 1SAUA 4IOCF 1HKSA 3LQQA 3PUBA 3BWGA 2MFZA 3KLNA 3UNGC 1ETOA 4AC0A 5LHGA 4X0GA 2ZCWA 5F04A 2EPFA 2DA6A 2P6SA 5EZHA 3G1LA 2DA5A 3AL0B 3GFIA 1G3TA 2X9DA 4OAZA 1A36A 2IGKA 3PNVA 4ESJA 3DU6A 2M9HA 3H5NA 2ID3A 2OV7A 2DK8A 1AOYA 1W1WE 3V7SA 2FOWA 1EH6A 3W6JB 4C2TA 5FKLA 2L54A 1Z3YA 3JTGA 2IGOA 1G2HA 3ZN1A 3JAMK 2STWA 3KEQA 4IHYA 2BXYA 2K9QA 3CC4I 1KQ0A 2R3SA 3TO6A 2ZMEA 2GBYA 3HHGA 3F8FA 4F7ZA 2XPUA 2ME0A 1TNSA 1O3TA 2DW4A 3BQYA 4PZJA 3VEPA 2VT3A 1R7JA 4DQ2A 5F1RA 3WG7H 4KICA 5EEGA 4ZYDA 1D0ZA 2IGNA 4E7JA 1YS7A 3ESWB 4OOIA 4DBRA 3HHHA 3CUQC 3EUHC 4EGZA 1U8BA 2O5RA 3QPLA 2LNBA 3HEFA 2DPUA 3DLLF 2IP2A 1JTXA 3K9TA 2IT0A 3VYUB 2AXTC 5AIPA 9ANTA 3LSGA 1YIOA 3U9GA 3ASNH 3SYTA 2XROA 2EFQA 1MDMB 4PJJA 2LSOA 3TEDA 5EYRA 4M3GA 2Y48A 4KISA 2KHMA 1S72I 3HM5A 3CESA 1UHSA 5ILUA 2FEZA 1FYKA 4RLQA 2J5PA 3K4NA 4XOPA 4Q4ZF 2IA1A 5LRSA 1FMVA 4XK4A 1JUPA 3DKXA 3LOCA 3NQOA 4UHTA 5E1XA 1JJ8C 1IF1A 3FISA 1HC8A 1IRZA 2IXSA 2QUFA 3HGYA 2V26A 2L9SA 4HPQA 1OYYA 2LR8A 3L1PA 2E2HJ 1JUSA 3CC7I 1MMAA 2HGCA 3OSGA 2ZXWH 3DTKA 2HQ5A 2HYGD 3KP6A 1XSDA 5FGMA 1Q1HA 3DV8A 1RNLA 1KQ8A 3HGGA 1O3QA 3K4LA 4XRSA 1KU7A 1ETVA 3RYPA 1HW5A 3F0CA 4I09A 1JXSA 3D5SC 3FKJA 3HRUA 3E97A 4E7IA 2XKOA 2CQNA 2IBDA 2WAEA 3ZXSA 4NNJA 1GDTA 3RKYA 4OIQF 2PMZN 4ENMA 4TV7A 2TDXA 4E7KA 4ENNA 2L9NA 2I10A 3QPTA 4IPAA 4WXCA 2A61A 5DDGA 2P5LC 4LLNA 3BTJA 4OMYA 3T8TA 5DCMA 1GVDA 3PFIA 4CZZA 4Z6YA 3BCAA 1ZQ3P 2VONA 2DA3A 4BY1J 5JFRA 2A6EF 1X1DA 5E3MA 2H27A 4YIRX 4W97A 2BYVE 1UZCA 3DPTA 2Z16A 2W85A 3CCYA 4KIFA 4E4HA 3AAFA 2HZTA 2M5WA 3SZGA 5CQGA 3DKYA 4C2UA 3DU5A 3M7GA 1TWHJ 3M8EA 3BPXA 4M71A 1F43A 4EMSA 4LG3A 1RC9A 1U5TB 5KAFC 4G94A 3L00A 1BA5A 4KITB 2RC4A 1NK3P 3ABUA 1HLVA 2ZSIB 3E0JB 3BC8A 5D4SA 3LSRA 5DCFA 4MO7A 4OIRF 4HA8A 4R1HA 4V2GA 2LLKA 1PVEA 2HQAA 1PP8F 1WJFA 1OR7C 4BDYA 2D2WA 4EM0B 4RB2C 1WGXA 5FKNA 3MKLA 1S8NA 5F08A 3JSPA 3I4PA 2PI0A 1QPMA 2ZC2A 5B5EC 4IX7A 2YX4A 1Z7UA 4I02A 1QZZA 3S1QJ 3L2VA 5CLSA 1FOWA 2MYSA 5LGNA 5C4XJ 4UVBA 5DD4A 4P9UA 1BIAA 5HLTA 1IN7A 5H6RA 3HRMA 4B43A 2ISZA 1NTCA 2IW5A 2FE3A 3RDIA 5J1RA 2DMQA 3C7JA 3HPHA 5IYCJ 2JK3A 2FJ1A 4GFBA 2Q2EA 4OINF 4LG0A 4BUPA 4HLXA 2EIJH 1XC5A 1UELB 3DTEA 1FIPA 4FISA 1ZGWA 1D1BA 3J80K 4HRIA 1IN8A 2AQEA 1HF0A 2A07F 5D8KB 3WTSC 2KIUA 4EGYA 3ZMZA 4BQQA 4A6DA 3JRDA 5KK1A 3HOVJ 2VBZA 3IH4A 1P7JA 2NVXJ 3MMYB 3S32A 1G3YA 2LG4A 3KP7A 4CO8A 2DU9A 3B6CA 1VQOI 4DZPA 5D6FA 3QP5A 2H1LA 1A6QA 2OA4A 4U87A 3VDXA 3ZCOA 3EUAA 4OIPF 2PX9A 3MWMA 3F8CA 5BPDA 1VI0A 1FTZA 4R79A 1LB2A 4HF1A 1MBEA 4OAYA 4ZYGA 1OCRH 3Q0VA 3RZDJ 3EQLF 1Z6TA 4LK1F 1YJNI 4AU7A 3MZ8A 5KAIC 4BH9A 4FHTA 4C3HJ 1MZBA 1E2XA 2XAJA 1KONA 5M5XJ 3G1OA 1DQUA 5EDNA 1S29A 2QSGX 2MBFA 2LF8A 4I98B 1HW1A 4BJTA 2G7HA 1SD4A 1XGOA 2LREA 4F91B 1W5TA 2F5EA 3K6GA 2LD5A 3CUQA 3EUHA 2LKPA 1P9QC 2PJRA 1ODDA 1LE8B 3ZQLA 2O8XA 5BNGA 1UJ8A 4N4NB 5GPAA 2WY8Q 3GFJA 2Y75A 4RMNA 2O03A 3PNTA 5FO5A 4JX4A 3GTKJ 2K4BA 1X3UA 2GXBA 3VSKA 1X1CA 3TDZC 3I58A 1V3FA 3OYBA 2Q8KA 3JCUC 1FYMA 3P9CA 5EF6A 1YW7A 1F1ZA 2GA2A 3WTTC 2JA5J 5LGTA 1DPUA 1B6AA 2K3FA 3EYIA 4MEXF 3A2KA 3BZCA 4C9YA 2DCEA 2ELKA 5DEQA 4KJZA 3QWLA 3FMQA 2HDWA 2DQRA 3IHUA 2NNYA 2ESNA 3J81K 1O7LA 3LMMA 3CQZJ 5J1YA 1MNMC 3P5JA 1T98A 2QSFX 3TOBA 5HDGA 3NRVA 1MW7A 1UCRA 2P5KA 1AHDP 2LY9A 4LIUA 3I71A 4ZDLA 3VYTB 1ULYA 1VQPI 1E3OC 3GFMA 4FCYA 4XL9A 4G12A 4BDZA 3MQ0A 3OOUA 2NNNA 4Q5SF 4EATA 1MJAA 2L4MA 3FF5A 2XGEA 2WV1A 3CF5F 2VPRA 3OV8A 2GAUA 3KYCB 1SFKA 5IP9J 1K4TA 1SAXA 3ABMH 5FD6A 2PMHA 4MQVA 5J47A 4R8HA 3MZYA 4UUSA 1Z91A 5HOOA 3S16J 2QBYB 3PL8A 2DDAA 2OAZA 3RPUD 1XGSA 3GWZA 1FLIA 2VIXA 3FHNA 5C4JJ 2CV2A 2VBYA 3CCQI 2JA7J 2Y69H 3CJQB 3DXJF 5TRDA 1WRJA 1V5GA 1YW8A 3BP8A 3ULQB 3PQKA 1RESA 3O3KA 2IAIA 3LFKA 1RIOH 2E2IJ 2QQ8A 5HS8A 1KA8A 1X4OA 2DJIA 4E6KG 4M73A 3W2VA 1DU6A 2F4IA 3QPHA 2ZJPF 4G6TB 2A05A 5E3LA 1SFXA 3E5UA 5CVJA 4II3A 4RS8A 1W7PD 3S3NA 4ZYHA 1JE8A 2R5ZB 4Y3OA 2ACJA 2F5FA 1PJRA 2DA2A 3OL3A 2D45A 1RI7A 2R5YA 1FSHA 2I8DA 2LFBA 1IGNA 1W5CC 2DN0A 4HNVA 3OS2A 1XSXA 4ESFA 1RRJA 2FXAA 2O7OA 2OC6A 1I3AA 1Q1VA 3LWFA 2P8TA 5LLQA 5LBQA 3QYFA 2PJPA 1ZREA 4E70A 1MNEA 4XLNF 3I59B 1TQMA 2VBWA 2LC2A 4BL0B 5GTHC 4MTDA 2BW3A 3VYSB 4K2EA 2TCTA 2E1OA 2XPVA 4XMYA 4BJ5C 3FIWA 4BY7J 3H5RA 1FP2A 5DYMA 1VZ0A 4U88A 3SDGA 2BGCA 4I99C 2M7BA 2VKEA 2CQKA 1MJ9A 1UG0A 5GAGJ 5B66C 4LLLA 4AWXB 4BS9A 4U7DA 2VXZA 2VL8A 1ZG5A 4C30A 1MSEC 2BY2A 2XSDC 1JT0A 4ZJZA 2L3DA 1CGPA 3CD6I 2OPTA 1IRXA 3GMEA 3M3YJ 2O0YA 2GIVA 3CTAA 3WE3A 4CCOA 3CCSI 1T33A 4LJZF 4Q47A 2Q1ZB 3W6KB 2NOJB 3FHZA 3E6BA 4XRSG 5EEAA 3KP3A 5BPIA 1QBJA 5J8CA 1TC3C 1LDKB 3CMYA 2UWMA 4DNCA 2ZNZA 4M3FA 2WB1A 1TWFJ 1P4XA 1XN7A 1I50J 3C18A 5FFXA 1ZR2A 1YITI 2ELHA 3V8LA 2X85A 1B72A 3S14J 1QHGA 1X3ZB 2JPBA 2V1UA 5JVGF 3LA3A 3RJPA 2WADA 5J6XA 4J01A 4M9SA 2DA7A 1WWXA 1Y1VJ 3ELKA 4U0YA 2DYRH 4BQNA 1SFUA 2KL4A 1ETWA 2RV8A 1FYLA 3RKXA 2JVHA 3QYEA 2B0LA 2F5CA 5HDNA 1U3EM 3MN2A 1U0JA 1UFMA 2LH9A 4EJVA 5CQEA 3MEXA 2YR2A 4H4KC 1IW7F 1Z3XA 2MGQA 5E8IA 4A3KJ 2OUMA 2A6HF 3SJMA 2RNJA 4XLHA 1ZRFA 3M8FA 3KPHA 1F9NA 1QVTA 4GYGA 1HDDC 2FA5A 2E1MC 2COMA 4RM2A 4ZDPA 4N0BA 4P96A 1CF7B 1V4RA 2DI3A 1YLFA 3K4JA 3MCZA 2NRAC 1G3WA 3FM3A 4UNOA 2WC2A 3HYIA 4A3JJ 1EF4A 3NWSA 2RREA 3V7RA 5JHFA 2X51A 3H3UA 2X6WA 2E35A 3V42A 3H3VK 4JX5A 5DM6F 2F4OB 2LBFA 1JTYA 2M30A 2A3SA 3GXOA 3HRTA 5GAEJ 1K7AA 2BV6A 1TT5B 1I1GA 1MBGA 2MA3A 1R1UA 2KQRA 3HRSA 2EILH 4D0PA 4M3DA 1V5FA 3MZHA 4Y17A 5JHUA 3KZZA 3CMAI 2FBKA 1LQ1A 4IHXA 4CYCB 3LAPA 1WKMA 1MBJA 2HXIA 2CYYA 2DDBA 2VKVA 5DM7F 2DJNA 2VOOA 1KQ9A 2X48A 1W5SA 1VQLI 2LP0A 3PJRA 4WWCA 4EJWA 3GFLA 2DO7A 1QA6A 2DMPA 2L01A 3PSFA 5ILSA 4J19A 1I3QJ 1ZG3A 1RPWA 3A0HC 3GF2A 1BOAA 4CCMA 3ZMUA 3CC2I 2H6BA 3BPVA 4HF2A 3HBLA 4GXOA 3HOYJ 3OR1C 5B1BH 3T0YA 1ON1A 3WHCA 3C2GA 4KN4X 4LMYA 4P1WA 1FSEA 4CGZA 5ICGA 2KIFA 2OJED 3J7YJ 3IKVA 3CJRB 2HR3A 4B3AA 1VQNI 3L2QA 5EGOB 2UUZA 1NHAA 5E1WA 4ENKA 1A6IA 1R71A 4LK0F 2H6CA 4YIFA 3HOUJ 2XASA 3GBGA 1TP4A 3CCEI 2IVMA 1YRNB 5F0FA 2OTLI 4A3LJ 4UB6C 2HDDA 5KNLA 4RDUA 4NUBA 5L3EA 2M2EA 2VQHA 1MBKA 1USTA 3QYBA 2JRMA 4G7OF 3FMRA 3SXYA 4A2UA 2AHQA 2EZLA 3QODA 4UB8C 1V55H 3ZMDA 4RBOA 1WJCA 3RQ4A 1D8JA 1FPQA 2E19A 2CMPA 4FT8A 3ZMSA 1IXSB 3JW4A 1VTNC 1RZ4A 4PCQA 1YE9A 2HYFA 2QF7A 4WF2A 4BQAA 1MKMA 1UG2A 2JUGA 2KRHA 4N9IA 1K6OA 3DPLC 3RSNA 5ED4A 1AU7A 2V1NA 3F6VA 1R5GA 2WA0A 4HX7A 1ORKA 4EJUA 2K02A 3OYAA 2WB1N 4DZJA 3LSKA 3RKWA 3G6EI 2DAOA 4RAGA 1ETXA 3FXLA 1BM9A 1IN6A 1OLTA 4A69C 3JRCA 2F4MB 5FLXK 3CZ6A 3GX4X 4A3EJ 2K86A 4MIMA 4J00A 1IV6A 2M3AA 4MQ9F 3CJTB 1R5HA 1ZTRA 4QSHA 3F21A 1U9NA 3H9QA 5L3FA 3I0TA 1W7PB 1WVRA 4KIGA 2K9MA 1R00A 2HKOA 5AONA 5EG0B 1OKRA 3K1PA 3PSIA 2W25A 3K70C 1K78A 3FXKA 3CCVI 2RQQA 5IYDJ 3KP2A 4XLAA 4PGHA 5FJ8J 1O7FA 1OCZH 1G3SA 3M1EA 3ZOBA 2V1DA 2GA1A 2R7SA 3K70D 4MFDA 3U21A 1XD7A 3QRFF 1IDZA 3ERED 1J7KA 4M74A 1OYIA 3KFWX 3J81Z 5DD8A 3BG9A 1WH7A 2P81A 1UHMA 4EVIA 3K0LA 2CW7A 3KZIC 4ZH4F 1WH5A 2FSWA 3QU6A 5HVQC 2KDZA 3WTWC 3I56I 1E17A 2R7DA 2QQ9A 4B48A 3I54A 5K7HA 2G0EA 4KT6A 4FASD 2VOPA 2K9NA 1BOBA 1LVAA 4M6YA 3K2AA 3KP5A 4I0AA 4NBQA 5ICFA 5DS9A 4V19K 3VODA 4EV0A 2IGMA 3I9V2 1A31A 2KISA 3I5UA 1D1CA 3OWTA 1TBXA 1ZK8A 2BXZA 3QOPA 3SEZA 3O8GA 2VASA 3LSIA 3HOZJ 1S3JA 1DPRA 4OWRB 3DBLB 3GCMA 4RA2A 2X6OA 5IP7J 5J4VA 3HDDA 1U6GA 2FNAA 3BG3A 4XLPF 5LRRA 3CCMI 3MAJA 5J1UA 5H2FC 3U2RA 1V5EA 4LITA 4BU2A 3IUOA 3H92A 2ZMEB 3AG4H 4JK1X 2HOAA 1YTYA 3K7AJ 5M3MJ 3K4BA 4MHGA 3E7LA 3OOPA 2D1VA 1T2KA 3WG9A 1YX3A 1XG1A 1POGA 3GTQJ 3OYLA 4BE1A 3OIOA 1VQ5I 3GTMJ 5FLVA 2XAGA 2CUJA 3S15J 1HSJA 1TWGJ 3S93A 2O8KA 2Y2ZA 2JA2A 4IOAF 3O8HA 3RZOJ 4EQQA 3ECHA 1B9MA 4BE2A 3HKZA 3ZQIA 2HEOA 4YIIA 4YEJA 2JTVA 3BR1A 5HNFA 4CCLA 4DIQA 4EJTA 3VPRA 2H8RA 1VQ6I 3ML6A 1FP1D 3E5QA 1Z77A 3GTOJ 2YS9A 2CU7A 3A02A 2Y0SA 1ON2A 1WQ2A 3FBIB 2XVCA 4NC8A 5ICEA 1I6HJ 2A5YB 1TWAJ 4NB5A 4D7MA 2D5VA 1XTAA 3I55I 1GV5A 5CVVA 2XF5A 1DU0A 2LTPA 1B1BA 1E3PA 4DJAA 1Z7LA 1MMNA 3QPSA 3GYHX 4AIJA 4NC7A 3ZR8X 3WGIA 2IA0A 4A3IJ 4BACA 2L7FP 2EB7A 1WCMJ 5HNHA 3H36A 2A69F 3LFUA 3CO7C 1J0RA 2OF7A 2P4WA 3TMOA 3EYYA 3TDUC 4XOTA 5F0CA 2M0CA 2MW8A 4F3QA 1YJWI 3C2BA 1JT6A 1YG2A 2NS8A 2CW0F 1IN4A 4M3BA 3FK6A 2KFDA 5GADJ 3GEZA 2M8GX 1N75A 2OBPA 3FXUA 3BZKA 2NVUB 4XKWA 2L02A 5B3SH 4QTRA 2E5ZA 1ZYRF 1WZ2A 1LDDA 3ZQCA 4M72A 2GOMA 3GTPJ 4EM2A 2V7FA 3OYIA 2EFOA 5JLXA 3OMYA 1HKQA 2G9WA 2JMWA 2CFOA 3PQJA 4PSWA 2E34A 3ZQHA 3G73A 2QEXI 2R7XA 2VE9A 2GQQA 4A12A 1RR8C 3R0AA 3OY9A 3TW7A 2K40A 2X1CA 3BLYA 3F3XA 3JRGA 4IKFA 5TGTA 1W0TA 3CP8A 3QU3A 4C3IJ 2LRDA 1MIJA 1WJAA 3KE2A 2DFIA 2NAZA 4XIDA 5DCMB 2H09A 1FOXA 4MTEA 3SZPA 2YPRA 5AIQA 3PO2J 4BQOA 1OCPA 1QNTA 2EA2A 1JGSA 1QPIA 3E5XA 3VYRB 5K5OA 3DEWA 3DBHB 2PEXA 2RNGA 4FE7A 2LYCA 5B1AH 1MH3A 3G4SI 2BHZA 5E8GA 2ADUA 1S7OA 4RAYA 1I39A 1ZELA 2X6YA 3H3ZA 2AXLA 3ZPLA 1MSFC 2LKSA 4RGXA 3ZMVA 4BBRJ 4ZZDA 5GTIC 1Z9CA 1YI2I 3PM1A 3ABKH 3P7NA 4NC6A 1EV7A 1LFBA 2V6CA 4IVNA 3MFKA 3F22A 5D6EA 3LA7A 2DOEA 1W4MA 4IHWA 2K7LA 2PMUA 3W6VA 4HAMA 5KHDA 1O3RA 2A5WA 1R6RA 3FXOA 4AYBA 3LSPA 2RDPA 4LGWA 3GTJJ 2NYXA 1HA8A 1XCVA 3ROUA 1WFXA 2MLKA 2R92J 3HSRA 2IJLA 3TOAA 2R7RA 3VWBA 3OYFA 2DTRA 3LQRA 1T39A 1C0WA 1EH8A 2Q2EB 3L09A 1TQIA 4LG0B 3JTHA 3QOEA 2VODA 3A4CA 3F72A 2HTJA 2GZWA 5CVIA 3H1CA 1G8XA 1RKTA 5ERIA 2VLAA 3FM5A 1XMXA 2EFPA 1ZGJA 1Y8QB 3E3VA 4XLEA 3Q5FA 1O57A 2VJ4A 2WAQA 2EH3A 2ZXJA 2LMDA 4JX6A 3QQAA 1PDNC 5FB2A 2WV0A 4W1UA 2DA4A 3LSJA 3F9KA 3M9AA 1J75A 4KT5C 4Y33A 5FFZA 3PIPF 2CJJA 4XR6A 4CSWA 3N97A 2K85A 3FKIJ 4WCGA 4YELA 2VXDA 5K7ZA 1S7EA 3RTRA 4PUSA 2FX0A 3IP4B 2CS3A 3V8JA 1GT0C 4KNYA 3FWEA 2Y0SN 3MVPA 1G4DA 4A5NA 5IP6A 2FD5A 1LJ9A 3GVAA 2K9LA 1L3LA 4HW0A 3K4KA 2RN7A 4GGGA 2L2OA 1FT9A 4MLOA 4CDGA 5EEHA 3OYKA 1MH4A 2KMUA 3QAHA 3TO7A 3WGGA 3C3WA 1OCTC 1KYZA 2W84A 2MLGA 3RI4A 2R7ZJ 1X1BA 1P4WA 4D5FA 3CUQB 1J09A 1IRGA 2F5DA 4KN7X 1XB4A 2PJRB 2VI6A 1WSUA 5CPRB 2E71A 2F6CA 4RM3A 4L0YB 2HXOA 2FBIA 1A35A 3HOSA 5FKKA 1T95A 2QSHX 1BI2A 2MD5A 3BR0A 1P4AA 1X1PA 5CVRA 3EETA 2EBIA 1X2MA 3BTLA 3HZJA 3F8MA 4D5CA 2JSCA 1K61A 5LEKA 3OYNA 3ZP5A 1ETKA 5FLXZ 2UXXA 4PGGA 3D0SA 2ZXHA 1B59A 1Z1DA 4Y7NJ 2R7QA 3BR5A 1EA3A 3CF2A 4AM3A 1YFHA 1KZHA 5GP9A 4Y13A 1K4SA 1REPC 2NVYJ 3K1MA 2Q0OA 1D1AA 1F5TA 2ZKZA 4JQFA 4Z2YA 4G9YA 3TW6A 5F0HA 1J5YA 1D3YA 2M1BA 4UV8A 2GXGA 4BBSJ 3B73A 2F48A 2PFBA 4XLCA 2BVLA 3BJAA 2JRTA 1JKQC 2ZSHB 2DYSH 2DBBA 3CP2A 5F1JA 4ZDOA 1XX5A 1I5ZA 4ETSA 3IH2A 5IPAA 2Z5UA 2QYOA 4HQMA 1GV2A 2RKHA 4ZTJA 1QHHD 1WI9A 4A3MJ 3AL0C 4AIKA 1ZLJA 1RUOA 4UUSB 3H9JA 3A01A 2ETHA 3IH3A 4II2A 5FRNA 2PQ8A 2W00A 4KUMA 4AYBN 1LPQA 1GVJA 5J8FA 5L3BA 2O6GE 4C2MJ 2EWNA 3BDDA 2XB0X 3S3MA 2W24A 2ZJQF 3OYGA 5C44J 2W4SA 2LKXA 5ICCA 4UVCA 2W82A 3KIOA 4AIHA 3BT9A 2EK5A 2CQXA 1WJEA 4RGSA 3ISPA 4D7NA 3MKYB 1YS6A 2ZBKA 1T6SA 3C1DA 3WHBA 4LD5A 2UV1A 3HUGA 2EINH 2MD0A 5K5RA 5D4RA 2A6TA 3JSOA 3G2BA 4LB5A 2BZTA 1S5LC 2XSJC 2NS0A 3OYEA 3CO6C 1QVUA 2L5QA 3JRBA 3MKWB 2QKLB 3PUFA 5K5QA 1HSTA 3ABTA 1ETQA 4I7HA 2VB6A 2EZIA 2R5YB 5DV5A 1H89C 2VN2A 2HOSA 1QU3A 1BI1A 3KYDB 4BGDA 3ABLH 3VB2A 4A3DJ 2J5OA 3L7WA 2ZXIA 4S0HB 4GO1A 1U2WA 3GLXA 2BW3B 4KDPA 1XMKA 3PNYA 4NQWA 2CO5A 5BMZA 3NWTA 2EA4A 2Y9YA 3DP7A 5BQTA 2KJBA 1R1TA 4PJ0C 2FMYA 2XIGA 4HSRA 3X2QH 3Q9SA 2GM4A 2V79A 3B02A 2PBIA 2BY3A 3BG6A 4HBLA 4L9NA 2WAFA 1AKHA 4BEHA 4M6XA 1BW6A 2EFNA 4HNUA 2VBXA 2QKMB 4L9TA 3LSMA 3OS1A 1EKEA 1DGWY 1ZGAA 4CHUA 1PUFA 3WU1B 1T8IA 4HEA2 3CCRI 5LD2C 4L18B 1HOMA 2RVCA 4XN0A 3WU2C 5KVRA 3HXLA 1IZ1A 3BCBA 1SVOA 4EM1A 2XDVA 4LIVA 3LNQA 2Y9ZA 4NDLA 2XRLA 5D5VB 1IUFA 1B72B 1FZPB 5FLMJ 1OCCH 4JYKA 4F92B 2QA4I 3Q0WA 1QZYA 2P5VA 3HIFA 1VFCA 3CCUI 1X4PA 1STZA 1FEXA 1JUMA 2R93J 4FTHA 4A0ZA 4ITVA 1R4NB 6PAXA 1F36A 2VJ5A 2W48A 1K6YA 2CRGA 1IDYA 1BBYA 5H6QA 1IO2A 4IO9F 2CUEA 4CCNA 2R7FA 2AO9A 2COBA 2KP6A 1J59A 4G6QA 1DP7P 2XV4S 2VJJA 5FRMA 2XAHA 2DQLA 3BJOA 2NS7A 1T0FC 3BG7A 3S3OA 2G7UA 2B63J 5IYBJ 3GTLJ 1Y56A 1FC3A 4KFCA 3HB9A 2KPMA 1VQ9I 4UV9A 3IRRA 1B8IA 3TQNA 2KJCA 3OSFA 5KCMA 1ZRCA 4B8XA 4QPOA 4B3XA 4QLCU 4MNUA 1B9NA 3BZ6A 2V4JC 5HODA 2VE8A 2MC3A 1WJ5A 1QO0D 4GYIA 3TKYA 3MD2A 3DF8A 2XF6A 2HKXA 3GUDA 3ECOA 4I76A 4A6EA 4CICA 4XKVA 2E7WA 2HTSA 4A3FJ 1D8KA 3GZ5A 5JR3A 4IHVA 4EEFG 1U5TC 4JOMA 2LBFB 2R7VA 1H0MA 4KYWA 2O9LA 1FOYA 1FTTA 4OIOF 1G6NA 3G3ZA 3HJEA 5DUIA 3UKGA 5CKTA 3DCFA 1X58A 2DLLA 1HDPA 4BAYA 1K79A 2KDOA 2FMLA 1HKTA 5CVUA 1F4KA 2EV6A 1S9HA 1TZLA 2FUG2 1Y39A 3IL2A 2WWYA 1ZAOA 4RLFA 3OYCA 3H5AA 2FNPA 4P5OA 4HDUA 1Z21A 4N4OB 3IKTA 5D8LB 3SEQA 1DGRM 3PFYA 1QRYA 2X0LA 1TNTA 1R5ID 1R36A 1W36C 3BR3A 2P6TA 1YJ9I 4B09A 3ZQFA 2VT2A 4U0VA 3FX3A 1J9IA 4IHTA 4MGRA 2BY0A 2EIMH 2HVSA 1W36D 3F8BA 1YOVB 2GWRA 2XAFA 2L9VA 2LOOA 4V2FA 3RIRA 4XSXF 4OU0A 2ZFWA 1R22A 3BG5A 1WHUA 1H88C 5HLIA 2OD5A 2MG4A 4FE4A 2XHKA 1YX5A 3S8PA 3ZGKA 1ERDA 4D9JA 3CMMA 4E7ZA 3IWZA 3HG9A 4XRMA 3HL2A 3SFZA 4I6ZA 4FX0A 2GOXB 1LVKA 2DK5A 4KMUX 2WTEA 2HS5A 3CDHA 2JZYA 1BC8C 1D5YA 2IA2A 3M8JA 4ASNA 4G7HF 3TP0A 3V8KA 3LSTA 2W1OA 2HOTA 4YRVA 4O6JA 2MC4A 1OPCA 4AIDA 4AVPA 5D5WB 5FKMA 2KZVA 3G1MA 3I3LA 4EJOA 2BY1A 4PDKA 2E1NA 2KT0A 3A1YA 1FBQA 2JVGA 2QWWA 3O6BB 3BR6A 1YHQI 2MSYA 3E6MA 1L0OC 4DYCA 1S7AA 2JUCA 1WI3A 2DXIA 4UY8I 2YX7A 2CUZA 5HS7A 3ZN0A 1Y8RB 3G71I 4ESBA 3E1SA 2YSRA 3L2WA 2OTJI 4IQJA 1ZR4A 1BC7C 2JSPA 2HVQA 1MDMA 3H0GJ 2JA8J 1XGMA 1TW3A 1Z05A 2H1KA 2DOFA 5F27A 1K78B 4M9ZA 2R0QC 1BJZA 2Y0MA 4B47A 3PO3J 3DFGA 3FMSA 1SD7A 3BR2A 4QWQA 3DKWA 5HLGA 3VOEA 4HLYA 5HDKA 5TISC 3I64A 2JPCA 2PLYA 4YFKF 3OYJA 2DMNA 2QQAA 1VQ7I 4PJLA 3WE2A 4M3EA 3AG3H 4PFPA 3OIPA 4B4CA 4IHSA 4BXFA 3OYHA 1SC7A 3FXMA 2LK2A 2JWTA 3IWFA 2IS2A 2X6XA 4XORA 1YIJI 1Y6IA 4ENJA 1KU3A 1ITYA 1P7IA 5K7FA 2GLOA 1OQYA 1N77A 3Q3SA 1JKRC 5ILVA 4UXNA 1B4AA 3KEOA 3SFIA 3W2WA 2E7XA 1H9TA 2NXNB 2QENA 4WXDA 4HV5A 1CQTA 2N8GA 1TTYA 2DTZA 4JBAA 2NOGA 2O3FA 3M1CA 4AUXA 4U0WA 1T0FA 1MMSA 2CV0A 2X1DA 1I27A 4A3BJ 3SQNA 3DPUA 3HOTA 1FIAA 3GLLA 4IXAA 3CDLA 1A5JA 2V1XA 3CCLI 2XGDA 2RAEA 2E1MB 2DOAA 3IAS2 3T8RA 1YQAA 1NG7A 2HZDA 1PUEE 1ZKGA 2XB5A 3I4NJ 4QIWN 1VQMI 3CCJI 1EJ9A 1MD0A 5LHHA 2NVQJ 3M4OJ 4XN3A 1TLHB 2OCCH 2DA1A 2K27A 1BW5A 4BHCA 1FWZA 5J4YA 3F23A 3J7ZI 2W7NA 2VKHA 2P7CB 1ZN2A 4DYQA 1U5TA 2H8WA 2XGCA 1KYWA 2ID6A 1FMWA 4F93B 1GXQA 3IV5A 4Y52J 3BOQA 2F2EA 1FOKA 2YUSA 2V9VA 5DTDA 5HLHA 3ERMA 3GZ6A 5F6FA 3NARA 2Z33A 5E20A 1OCOH 2ELJA 1I1SA 4I0BA 2C6YA 1D0XA 1BL0A 2P7VB 4QPQA 3KCCA 3BTCA 1HW2A 1D0YA 1S6LA 3FXJA 4ZC3A 2B7EA 3AG2H 2BE5F 4F55A 3S17J 5L3GA 4IRHA 4FX4A 3CLQA 3P9IA 2LDUA 4RGRA 3JREA 2VC0A 1FBUA 2MH9A 3RKQA 3CUOA 1XCBA 4A3GJ 4S05A 4LOCA 1NG6A 2JT1A 3A0BC 1YO5C 4CZCA 4YG2F 1ENHA 2HQNA 2OZUA 3AFHA 4CH7A 4YFNF 2MH2A 3SZTA 2CUFA 3D5LA 2IRFG 3TP3A 5A2QK 1TW2A 3JR9A 4XKBA 4B44A 1SANA 3WTXC 4KA4A 2XAQA 4U7BA 3OL4A 4RAFA 2CQQA 3F6OA 4HG2A 4HQEA 3KLOA 3C2HA 4IRGA 1XSVA 3UR3C 3WTVC 1SFOJ 2STTA 2CW8A 2O61A 1XDSA 2Y30A 5C3EJ 2KRFA 1Z6RA 2KZGA 4IF4A 4ABZA 2E60A 4L9JA 4FQGA 5HS9A 3KX2A 3FK7A 5FROA 4ZTFA 3EUKL 3VSLA 4O5VA 2EV0A 5FKOA 3COAC 2V6EA 2EZHA 2DT5A 4I2OA 1BR1A 1DP3A 1Z0XA 3W2AA 4HX4A 3KYLA 1W0UA 5D5XB 2UZKA 1LFPA 5IT9K 5L3DA 4CYDA 1TL8A 1RUNA 1R4MB 3ASOH 5H20A 2YU9J 1IRFA 3T5XA 3V4GA 4HNTA 1Y0NA 2ZJ2A 2ESHA 4AD9A 4CXFA 4HOBA 1VQ8I 3P9KA 2IS1A 4XRFA 1UAAA 1N25A 3R60A 2R7WA 4G6DA 1MGTA 1ONVA 3NEUA 3S1RJ 1APLC 2ZNYA 4IZZA 2E2JJ 2VUMJ 2EZKA 1LE8A 4M9XA 3FZVA 4CCJA 2W57A 1XS9A 5M5YJ 2K4JA 1OISA 3FBNB 1BI3A 2FU4A 3BQZA 4PJNA 1ZG1A 2IS4A 1RR7A 5E3NA 2LY1A 3R61A 1V54H 2Z99A 1T08B 1SMYF 4D1QA 3IC7A 1GHCA 2WBMA 4N9HA 1I6XA 3HKZN 3EDPA 1HQCA 3FXRA 1ZHFA 3RCOA 5IT3A 1IUYA 1P6RA 2I5UA 1JGGA 3KEYA 5IY5H 2QLZA 2B9SA 4IJAA 2XAUA 4L5EA 5L3CA 1PP7U 2LY2A 2HYJA 4ANJA 1R23A 1UHWA 1E0EA 4XICA 1LNWA 1ZRDA 4P55A 2D1HA 1IV8A 4XM3A 2GIZA 5EZGA 5M5WJ 4XSZF 2ZB9A 2E36A 5FD5A 3H35A 1IN5A 3KETA 1VQ4I 1U8RA 2XPWA 1KU2A 4AVZA 4L9VA 1MNDA 2V9PA 2Z3YA 4A93J 4RAZA 4XNFA 2P0WA 3EPZA 1BJAA 4A3CJ 2PN6A 4A0YA 2E5NA 1WJBA 1SVLA 2KKOA 3K1NA 4PK4A 4BXXJ 3DLAA 2Z9OA 2OZ6A 2VQCA 2EV5A 1G59A 2QBYA 4E7HA 5D5UB 4DOZA 2YU3A 2DFHA 2L9RA 1H9GA 2KRCA 4X6AJ 1WPKA 2KLOA 4WK8F 4H0EA 4GRIA 2HVRA 3U1KA 4F52A 4L0ZB 1LEAA 2NVTJ 2CSOA 3L2UA 1AA7A 1Z67A 5JI6A 1BR2A 1R58A 2L7KA 3I53A 3DQVC 4L5IA 1MMGA 4ZYEA 5CYVA 2H94A 1BI0A 2XUBA 2CH0A 3WTUC 3SHFA 1U78A 1XGNA 2IEKA 3KP4A 5E18F 5LHIA 1ETYA 3B6AA 2DFFA 1UMQA 2FQ4A 1KGSA 3DEUA 2FF4A 4HZFA 2BEOA 3HC7A 4XLFA 4KMFA 1IXCA 2R5ZA 1HXDA 4IL6C 5GPCA 2VQLA 3RYRA 4I01A 1RKWA 2CQ7A 1N78A 1K83J 2CWEA 1KU9A 2L0KA 3CJNA 3J7AY 2JJ7A 3QP6A 2QVOA 5JVTA 3MKZA 2BBYA 3O2PE 1DDNA 2VPLA 3IRQA 1VQKI 3ZRGA 3L9FA 3RPQA 2EJRA 3I59A 3M07A 2DFEA 2L4AA 2HDCA 2BOLA 3OIQA 3GZNB 4BE0A 1IG7A 4XBFA 1RETA 3JAMZ 2FBHA 4P9FA 1JHFA 2XC7A 2OCEA 2HOEA 4CA0A 5LFAA 4MFEA 2FQ3A 2OQRA 1YW9A 3VFZA 4RB3C 4KIBA 3T1BA 3FXQA 2M34A 2F5VA 3PIOF 5LGUA 1GLNA 2KIMA 2HI3A 1R9TJ 2QQBA 2XRNA 3HPGA 3Q9VA 3TGNA 3OYMA 5E79C 4BKXA 4DGWB 2R7UA 4OMZA 3JRHA 2KIQA 2L7ZA 1OR7A 3S2DJ 2M4KA 3K10A 2BHYA 3HTSB 2CFXA 1MMDA 1LFUP 4ZZLA 2ICWG 4M6VA 3HTUA 1FY7A 1Y1WJ 2LF7A 2HFHA 2HPIA 1LUJB 2ZJRF 1SD5A 4IEJA 2ECCA 3H0DA 4DYRA 5LEJA 2FRHA 2RGVA 3HSFA 3A01B 4IRIA 4JP0A 1MBHA 1R49A 4G8XA 3CMEI 2WAQN 4IQ4A 3K4MA 1IC8A 1JKPC 1UB9A 4RB0A 1JKOC 3SDBA 4A5MA 2EFWA 3LAJA 2ECBA 3A03A 4PJMA 3RQIA 3DEEA 3ZQ7A 1SD6A 2ZO4A 4Y15A 2GXAA 4E7LA 5BS6A 2DMTA 1SVMA 1R1VA 4LFUA 5F64A 2M0MA 2VC1A 4RGUA 1D5VA 1Y0UA 2QCOA 2IPQX 4LLGF 1LDJA 1OYWA 3HUGB 1DUXC 4BNCA 2ZMEC 2XKPA 2M45A 2M4GA 1WJDA 3R4KA 3E6DA 3ZMTA 4HF0A 3WTZA 1CF7A 1VF9A 4UUTA 2WY7Q 1IAWA 3OR2C 2OU2A 3GO5A 1BIBA 2HU9A 1P2FA 3ZQQA 2TRTA 5IOZA 2IS6A 1X3WB 3OS0A 3JRIA 4HV6A 3HSEA 3LSHA 2ZFUA 4UVAA 3OYDA 3E6CC 1PYVA 3DWLE 5J40A 1TQPA 2K3PA 4RB1A 3HOWJ 4BYYA 4UUVA 1QZEA 3AG1H 3H9GA 3L2RA 3N4MA 2R7TA 1X19A 1XMAA 2FOKA 3IAM2 4Y4RA 1QGPA 2AQFA 4NQWB 3S2WA 1X1AA 1JHHA 4PSXA 2ISYA 2M7AA 4G7ZF 2K9SA 3ONQA 4CYCA 3JRAA 2Z1DA 1EH7A 2EQRA 1AKHB 3WODF 2X4HA 2R7OA 4BEHB 3TL4X 2VKDA 3CDIA 4LB6B 2Y31A 4CCKA 3DBRB 2QZ8A 5GAHJ 2DT6A 2QGUA 2RQPA 4XKCA 1TWCJ 1OFCX
chains in the Genus database with same CATH topology
2QSGX 1TP4A 3ESWB 2F4MB 1X3WB 2QSHX 2F4OB 1OQYA 1PVEA 4YIRX 1X3ZB 2QSFX 1QZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSG X;  1TP4 A;  3ESW B;  2F4M B;  1X3W B;  2QSH X;  2F4O B;  1OQY A;  1PVE A;  4YIR X;  1X3Z B;  2QSF X;  1QZE A; 
#chains in the Genus database with same CATH topology
 3J7A O;  1PUF B;  5CJ9 A;  1JJ6 C;  2HPM A;  5A2Q Z;  5IOY A;  3DTI A;  1ZAR A;  1ZH5 A;  4BXU A;  1OMI A;  3F8N A;  3N05 A;  3K69 A;  4FET A;  4HYE A;  5E17 F;  2R4G A;  4L5J A;  2M87 A;  4YFX F;  1TT0 A;  3HOX J;  1LKX A;  1J2X A;  1T56 A;  1X2N A;  5J3L A;  2QM3 A;  1SMT A;  4DBQ A;  5EGO A;  5M3F J;  2DMU A;  4GCV A;  2CGP A;  2OQG A;  1MBF A;  1ZLK A;  3ZQG A;  1GUU A;  1BN5 A;  1M1E B;  3K4C A;  1NK2 P;  3TO9 A;  3BTI A;  3K2Z A;  1FNN A;  1FX7 A;  2UXN A;  1YRN A;  4NHJ A;  2HQR A;  4E7S A;  3FDY A;  3I4M J;  3LA2 A;  5TJJ A;  1BR4 A;  3S1N J;  2V9K A;  3AKZ A;  1MJB A;  4ON0 A;  3L2C A;  3GW2 A;  3D1N I;  4MEY F;  1T38 A;  2MAB A;  2XGX A;  1GXP A;  2X1E A;  1E3H A;  3NAU A;  2A68 F;  2EIK H;  4XON A;  4ZYA A;  1ACI A;  2LVS A;  3BJ6 A;  3KZY A;  4BJ6 C;  5IT9 Z;  4BHB A;  3RPU A;  3TBI A;  4CUG A;  3V7C A;  1JI8 A;  3R0J A;  2M8E A;  4X1E A;  3J80 Z;  1B8I B;  4A0X A;  3W3C A;  4B1R A;  5BOX A;  1P92 A;  1USS A;  2HNH A;  2PG4 A;  2JQ7 A;  1SFE A;  2VQG A;  3Q0U A;  4C3J J;  1U9O A;  3U1D A;  2BVM A;  1VND A;  2CG4 A;  3WU0 A;  1HBX G;  2DPD A;  3R6S A;  1IXR C;  3D5R C;  5E1Z B;  1O3S A;  1FJL A;  1QQI A;  5EJC A;  3S2H J;  3BY6 A;  5DUK A;  1YYV A;  2XF7 A;  2DOD A;  4HDV A;  1O4X A;  4HST A;  1HCR A;  5JLW A;  4Q48 A;  4WX9 A;  1IJW C;  3S1M J;  1XPX A;  1AWC A;  3CLO A;  3LL7 A;  2CV1 A;  1H8A C;  4WXH A;  3GTG J;  1FBS A;  4GDF A;  4HX8 A;  2JN6 A;  2VJI A;  2E1C A;  2AS5 F;  1W7P A;  2PMZ A;  4XQF A;  1A04 A;  5K1Y A;  5EG0 A;  4DW6 A;  3BRO A;  1OJL A;  1XDU A;  1LEB A;  2L7M P;  2Z2S B;  5E3O A;  4PFO A;  3WGH A;  1NH3 A;  2JA6 J;  2K5C A;  2DT7 B;  4S04 A;  3WTY C;  2ME6 A;  4BHP A;  3JRF A;  2HWV A;  3REO A;  1SEU A;  4O3M A;  1SAU A;  4IOC F;  1HKS A;  3LQQ A;  3PUB A;  3BWG A;  2MFZ A;  3KLN A;  3UNG C;  1ETO A;  4AC0 A;  5LHG A;  4X0G A;  2ZCW A;  5F04 A;  2EPF A;  2DA6 A;  2P6S A;  5EZH A;  3G1L A;  2DA5 A;  3AL0 B;  3GFI A;  1G3T A;  2X9D A;  4OAZ A;  1A36 A;  2IGK A;  3PNV A;  4ESJ A;  3DU6 A;  2M9H A;  3H5N A;  2ID3 A;  2OV7 A;  2DK8 A;  1AOY A;  1W1W E;  3V7S A;  2FOW A;  1EH6 A;  3W6J B;  4C2T A;  5FKL A;  2L54 A;  1Z3Y A;  3JTG A;  2IGO A;  1G2H A;  3ZN1 A;  3JAM K;  2STW A;  3KEQ A;  4IHY A;  2BXY A;  2K9Q A;  3CC4 I;  1KQ0 A;  2R3S A;  3TO6 A;  2ZME A;  2GBY A;  3HHG A;  3F8F A;  4F7Z A;  2XPU A;  2ME0 A;  1TNS A;  1O3T A;  2DW4 A;  3BQY A;  4PZJ A;  3VEP A;  2VT3 A;  1R7J A;  4DQ2 A;  5F1R A;  3WG7 H;  4KIC A;  5EEG A;  4ZYD A;  1D0Z A;  2IGN A;  4E7J A;  1YS7 A;  3ESW B;  4OOI A;  4DBR A;  3HHH A;  3CUQ C;  3EUH C;  4EGZ A;  1U8B A;  2O5R A;  3QPL A;  2LNB A;  3HEF A;  2DPU A;  3DLL F;  2IP2 A;  1JTX A;  3K9T A;  2IT0 A;  3VYU B;  2AXT C;  5AIP A;  9ANT A;  3LSG A;  1YIO A;  3U9G A;  3ASN H;  3SYT A;  2XRO A;  2EFQ A;  1MDM B;  4PJJ A;  2LSO A;  3TED A;  5EYR A;  4M3G A;  2Y48 A;  4KIS A;  2KHM A;  1S72 I;  3HM5 A;  3CES A;  1UHS A;  5ILU A;  2FEZ A;  1FYK A;  4RLQ A;  2J5P A;  3K4N A;  4XOP A;  4Q4Z F;  2IA1 A;  5LRS A;  1FMV A;  4XK4 A;  1JUP A;  3DKX A;  3LOC A;  3NQO A;  4UHT A;  5E1X A;  1JJ8 C;  1IF1 A;  3FIS A;  1HC8 A;  1IRZ A;  2IXS A;  2QUF A;  3HGY A;  2V26 A;  2L9S A;  4HPQ A;  1OYY A;  2LR8 A;  3L1P A;  2E2H J;  1JUS A;  3CC7 I;  1MMA A;  2HGC A;  3OSG A;  2ZXW H;  3DTK A;  2HQ5 A;  2HYG D;  3KP6 A;  1XSD A;  5FGM A;  1Q1H A;  3DV8 A;  1RNL A;  1KQ8 A;  3HGG A;  1O3Q A;  3K4L A;  4XRS A;  1KU7 A;  1ETV A;  3RYP A;  1HW5 A;  3F0C A;  4I09 A;  1JXS A;  3D5S C;  3FKJ A;  3HRU A;  3E97 A;  4E7I A;  2XKO A;  2CQN A;  2IBD A;  2WAE A;  3ZXS A;  4NNJ A;  1GDT A;  3RKY A;  4OIQ F;  2PMZ N;  4ENM A;  4TV7 A;  2TDX A;  4E7K A;  4ENN A;  2L9N A;  2I10 A;  3QPT A;  4IPA A;  4WXC A;  2A61 A;  5DDG A;  2P5L C;  4LLN A;  3BTJ A;  4OMY A;  3T8T A;  5DCM A;  1GVD A;  3PFI A;  4CZZ A;  4Z6Y A;  3BCA A;  1ZQ3 P;  2VON A;  2DA3 A;  4BY1 J;  5JFR A;  2A6E F;  1X1D A;  5E3M A;  2H27 A;  4YIR X;  4W97 A;  2BYV E;  1UZC A;  3DPT A;  2Z16 A;  2W85 A;  3CCY A;  4KIF A;  4E4H A;  3AAF A;  2HZT A;  2M5W A;  3SZG A;  5CQG A;  3DKY A;  4C2U A;  3DU5 A;  3M7G A;  1TWH J;  3M8E A;  3BPX A;  4M71 A;  1F43 A;  4EMS A;  4LG3 A;  1RC9 A;  1U5T B;  5KAF C;  4G94 A;  3L00 A;  1BA5 A;  4KIT B;  2RC4 A;  1NK3 P;  3ABU A;  1HLV A;  2ZSI B;  3E0J B;  3BC8 A;  5D4S A;  3LSR A;  5DCF A;  4MO7 A;  4OIR F;  4HA8 A;  4R1H A;  4V2G A;  2LLK A;  1PVE A;  2HQA A;  1PP8 F;  1WJF A;  1OR7 C;  4BDY A;  2D2W A;  4EM0 B;  4RB2 C;  1WGX A;  5FKN A;  3MKL A;  1S8N A;  5F08 A;  3JSP A;  3I4P A;  2PI0 A;  1QPM A;  2ZC2 A;  5B5E C;  4IX7 A;  2YX4 A;  1Z7U A;  4I02 A;  1QZZ A;  3S1Q J;  3L2V A;  5CLS A;  1FOW A;  2MYS A;  5LGN A;  5C4X J;  4UVB A;  5DD4 A;  4P9U A;  1BIA A;  5HLT A;  1IN7 A;  5H6R A;  3HRM A;  4B43 A;  2ISZ A;  1NTC A;  2IW5 A;  2FE3 A;  3RDI A;  5J1R A;  2DMQ A;  3C7J A;  3HPH A;  5IYC J;  2JK3 A;  2FJ1 A;  4GFB A;  2Q2E A;  4OIN F;  4LG0 A;  4BUP A;  4HLX A;  2EIJ H;  1XC5 A;  1UEL B;  3DTE A;  1FIP A;  4FIS A;  1ZGW A;  1D1B A;  3J80 K;  4HRI A;  1IN8 A;  2AQE A;  1HF0 A;  2A07 F;  5D8K B;  3WTS C;  2KIU A;  4EGY A;  3ZMZ A;  4BQQ A;  4A6D A;  3JRD A;  5KK1 A;  3HOV J;  2VBZ A;  3IH4 A;  1P7J A;  2NVX J;  3MMY B;  3S32 A;  1G3Y A;  2LG4 A;  3KP7 A;  4CO8 A;  2DU9 A;  3B6C A;  1VQO I;  4DZP A;  5D6F A;  3QP5 A;  2H1L A;  1A6Q A;  2OA4 A;  4U87 A;  3VDX A;  3ZCO A;  3EUA A;  4OIP F;  2PX9 A;  3MWM A;  3F8C A;  5BPD A;  1VI0 A;  1FTZ A;  4R79 A;  1LB2 A;  4HF1 A;  1MBE A;  4OAY A;  4ZYG A;  1OCR H;  3Q0V A;  3RZD J;  3EQL F;  1Z6T A;  4LK1 F;  1YJN I;  4AU7 A;  3MZ8 A;  5KAI C;  4BH9 A;  4FHT A;  4C3H J;  1MZB A;  1E2X A;  2XAJ A;  1KON A;  5M5X J;  3G1O A;  1DQU A;  5EDN A;  1S29 A;  2QSG X;  2MBF A;  2LF8 A;  4I98 B;  1HW1 A;  4BJT A;  2G7H A;  1SD4 A;  1XGO A;  2LRE A;  4F91 B;  1W5T A;  2F5E A;  3K6G A;  2LD5 A;  3CUQ A;  3EUH A;  2LKP A;  1P9Q C;  2PJR A;  1ODD A;  1LE8 B;  3ZQL A;  2O8X A;  5BNG A;  1UJ8 A;  4N4N B;  5GPA A;  2WY8 Q;  3GFJ A;  2Y75 A;  4RMN A;  2O03 A;  3PNT A;  5FO5 A;  4JX4 A;  3GTK J;  2K4B A;  1X3U A;  2GXB A;  3VSK A;  1X1C A;  3TDZ C;  3I58 A;  1V3F A;  3OYB A;  2Q8K A;  3JCU C;  1FYM A;  3P9C A;  5EF6 A;  1YW7 A;  1F1Z A;  2GA2 A;  3WTT C;  2JA5 J;  5LGT A;  1DPU A;  1B6A A;  2K3F A;  3EYI A;  4MEX F;  3A2K A;  3BZC A;  4C9Y A;  2DCE A;  2ELK A;  5DEQ A;  4KJZ A;  3QWL A;  3FMQ A;  2HDW A;  2DQR A;  3IHU A;  2NNY A;  2ESN A;  3J81 K;  1O7L A;  3LMM A;  3CQZ J;  5J1Y A;  1MNM C;  3P5J A;  1T98 A;  2QSF X;  3TOB A;  5HDG A;  3NRV A;  1MW7 A;  1UCR A;  2P5K A;  1AHD P;  2LY9 A;  4LIU A;  3I71 A;  4ZDL A;  3VYT B;  1ULY A;  1VQP I;  1E3O C;  3GFM A;  4FCY A;  4XL9 A;  4G12 A;  4BDZ A;  3MQ0 A;  3OOU A;  2NNN A;  4Q5S F;  4EAT A;  1MJA A;  2L4M A;  3FF5 A;  2XGE A;  2WV1 A;  3CF5 F;  2VPR A;  3OV8 A;  2GAU A;  3KYC B;  1SFK A;  5IP9 J;  1K4T A;  1SAX A;  3ABM H;  5FD6 A;  2PMH A;  4MQV A;  5J47 A;  4R8H A;  3MZY A;  4UUS A;  1Z91 A;  5HOO A;  3S16 J;  2QBY B;  3PL8 A;  2DDA A;  2OAZ A;  3RPU D;  1XGS A;  3GWZ A;  1FLI A;  2VIX A;  3FHN A;  5C4J J;  2CV2 A;  2VBY A;  3CCQ I;  2JA7 J;  2Y69 H;  3CJQ B;  3DXJ F;  5TRD A;  1WRJ A;  1V5G A;  1YW8 A;  3BP8 A;  3ULQ B;  3PQK A;  1RES A;  3O3K A;  2IAI A;  3LFK A;  1RIO H;  2E2I J;  2QQ8 A;  5HS8 A;  1KA8 A;  1X4O A;  2DJI A;  4E6K G;  4M73 A;  3W2V A;  1DU6 A;  2F4I A;  3QPH A;  2ZJP F;  4G6T B;  2A05 A;  5E3L A;  1SFX A;  3E5U A;  5CVJ A;  4II3 A;  4RS8 A;  1W7P D;  3S3N A;  4ZYH A;  1JE8 A;  2R5Z B;  4Y3O A;  2ACJ A;  2F5F A;  1PJR A;  2DA2 A;  3OL3 A;  2D45 A;  1RI7 A;  2R5Y A;  1FSH A;  2I8D A;  2LFB A;  1IGN A;  1W5C C;  2DN0 A;  4HNV A;  3OS2 A;  1XSX A;  4ESF A;  1RRJ A;  2FXA A;  2O7O A;  2OC6 A;  1I3A A;  1Q1V A;  3LWF A;  2P8T A;  5LLQ A;  5LBQ A;  3QYF A;  2PJP A;  1ZRE A;  4E70 A;  1MNE A;  4XLN F;  3I59 B;  1TQM A;  2VBW A;  2LC2 A;  4BL0 B;  5GTH C;  4MTD A;  2BW3 A;  3VYS B;  4K2E A;  2TCT A;  2E1O A;  2XPV A;  4XMY A;  4BJ5 C;  3FIW A;  4BY7 J;  3H5R A;  1FP2 A;  5DYM A;  1VZ0 A;  4U88 A;  3SDG A;  2BGC A;  4I99 C;  2M7B A;  2VKE A;  2CQK A;  1MJ9 A;  1UG0 A;  5GAG J;  5B66 C;  4LLL A;  4AWX B;  4BS9 A;  4U7D A;  2VXZ A;  2VL8 A;  1ZG5 A;  4C30 A;  1MSE C;  2BY2 A;  2XSD C;  1JT0 A;  4ZJZ A;  2L3D A;  1CGP A;  3CD6 I;  2OPT A;  1IRX A;  3GME A;  3M3Y J;  2O0Y A;  2GIV A;  3CTA A;  3WE3 A;  4CCO A;  3CCS I;  1T33 A;  4LJZ F;  4Q47 A;  2Q1Z B;  3W6K B;  2NOJ B;  3FHZ A;  3E6B A;  4XRS G;  5EEA A;  3KP3 A;  5BPI A;  1QBJ A;  5J8C A;  1TC3 C;  1LDK B;  3CMY A;  2UWM A;  4DNC A;  2ZNZ A;  4M3F A;  2WB1 A;  1TWF J;  1P4X A;  1XN7 A;  1I50 J;  3C18 A;  5FFX A;  1ZR2 A;  1YIT I;  2ELH A;  3V8L A;  2X85 A;  1B72 A;  3S14 J;  1QHG A;  1X3Z B;  2JPB A;  2V1U A;  5JVG F;  3LA3 A;  3RJP A;  2WAD A;  5J6X A;  4J01 A;  4M9S A;  2DA7 A;  1WWX A;  1Y1V J;  3ELK A;  4U0Y A;  2DYR H;  4BQN A;  1SFU A;  2KL4 A;  1ETW A;  2RV8 A;  1FYL A;  3RKX A;  2JVH A;  3QYE A;  2B0L A;  2F5C A;  5HDN A;  1U3E M;  3MN2 A;  1U0J A;  1UFM A;  2LH9 A;  4EJV A;  5CQE A;  3MEX A;  2YR2 A;  4H4K C;  1IW7 F;  1Z3X A;  2MGQ A;  5E8I A;  4A3K J;  2OUM A;  2A6H F;  3SJM A;  2RNJ A;  4XLH A;  1ZRF A;  3M8F A;  3KPH A;  1F9N A;  1QVT A;  4GYG A;  1HDD C;  2FA5 A;  2E1M C;  2COM A;  4RM2 A;  4ZDP A;  4N0B A;  4P96 A;  1CF7 B;  1V4R A;  2DI3 A;  1YLF A;  3K4J A;  3MCZ A;  2NRA C;  1G3W A;  3FM3 A;  4UNO A;  2WC2 A;  3HYI A;  4A3J J;  1EF4 A;  3NWS A;  2RRE A;  3V7R A;  5JHF A;  2X51 A;  3H3U A;  2X6W A;  2E35 A;  3V42 A;  3H3V K;  4JX5 A;  5DM6 F;  2F4O B;  2LBF A;  1JTY A;  2M30 A;  2A3S A;  3GXO A;  3HRT A;  5GAE J;  1K7A A;  2BV6 A;  1TT5 B;  1I1G A;  1MBG A;  2MA3 A;  1R1U A;  2KQR A;  3HRS A;  2EIL H;  4D0P A;  4M3D A;  1V5F A;  3MZH A;  4Y17 A;  5JHU A;  3KZZ A;  3CMA I;  2FBK A;  1LQ1 A;  4IHX A;  4CYC B;  3LAP A;  1WKM A;  1MBJ A;  2HXI A;  2CYY A;  2DDB A;  2VKV A;  5DM7 F;  2DJN A;  2VOO A;  1KQ9 A;  2X48 A;  1W5S A;  1VQL I;  2LP0 A;  3PJR A;  4WWC A;  4EJW A;  3GFL A;  2DO7 A;  1QA6 A;  2DMP A;  2L01 A;  3PSF A;  5ILS A;  4J19 A;  1I3Q J;  1ZG3 A;  1RPW A;  3A0H C;  3GF2 A;  1BOA A;  4CCM A;  3ZMU A;  3CC2 I;  2H6B A;  3BPV A;  4HF2 A;  3HBL A;  4GXO A;  3HOY J;  3OR1 C;  5B1B H;  3T0Y A;  1ON1 A;  3WHC A;  3C2G A;  4KN4 X;  4LMY A;  4P1W A;  1FSE A;  4CGZ A;  5ICG A;  2KIF A;  2OJE D;  3J7Y J;  3IKV A;  3CJR B;  2HR3 A;  4B3A A;  1VQN I;  3L2Q A;  5EGO B;  2UUZ A;  1NHA A;  5E1W A;  4ENK A;  1A6I A;  1R71 A;  4LK0 F;  2H6C A;  4YIF A;  3HOU J;  2XAS A;  3GBG A;  1TP4 A;  3CCE I;  2IVM A;  1YRN B;  5F0F A;  2OTL I;  4A3L J;  4UB6 C;  2HDD A;  5KNL A;  4RDU A;  4NUB A;  5L3E A;  2M2E A;  2VQH A;  1MBK A;  1UST A;  3QYB A;  2JRM A;  4G7O F;  3FMR A;  3SXY A;  4A2U A;  2AHQ A;  2EZL A;  3QOD A;  4UB8 C;  1V55 H;  3ZMD A;  4RBO A;  1WJC A;  3RQ4 A;  1D8J A;  1FPQ A;  2E19 A;  2CMP A;  4FT8 A;  3ZMS A;  1IXS B;  3JW4 A;  1VTN C;  1RZ4 A;  4PCQ A;  1YE9 A;  2HYF A;  2QF7 A;  4WF2 A;  4BQA A;  1MKM A;  1UG2 A;  2JUG A;  2KRH A;  4N9I A;  1K6O A;  3DPL C;  3RSN A;  5ED4 A;  1AU7 A;  2V1N A;  3F6V A;  1R5G A;  2WA0 A;  4HX7 A;  1ORK A;  4EJU A;  2K02 A;  3OYA A;  2WB1 N;  4DZJ A;  3LSK A;  3RKW A;  3G6E I;  2DAO A;  4RAG A;  1ETX A;  3FXL A;  1BM9 A;  1IN6 A;  1OLT A;  4A69 C;  3JRC A;  2F4M B;  5FLX K;  3CZ6 A;  3GX4 X;  4A3E J;  2K86 A;  4MIM A;  4J00 A;  1IV6 A;  2M3A A;  4MQ9 F;  3CJT B;  1R5H A;  1ZTR A;  4QSH A;  3F21 A;  1U9N A;  3H9Q A;  5L3F A;  3I0T A;  1W7P B;  1WVR A;  4KIG A;  2K9M A;  1R00 A;  2HKO A;  5AON A;  5EG0 B;  1OKR A;  3K1P A;  3PSI A;  2W25 A;  3K70 C;  1K78 A;  3FXK A;  3CCV I;  2RQQ A;  5IYD J;  3KP2 A;  4XLA A;  4PGH A;  5FJ8 J;  1O7F A;  1OCZ H;  1G3S A;  3M1E A;  3ZOB A;  2V1D A;  2GA1 A;  2R7S A;  3K70 D;  4MFD A;  3U21 A;  1XD7 A;  3QRF F;  1IDZ A;  3ERE D;  1J7K A;  4M74 A;  1OYI A;  3KFW X;  3J81 Z;  5DD8 A;  3BG9 A;  1WH7 A;  2P81 A;  1UHM A;  4EVI A;  3K0L A;  2CW7 A;  3KZI C;  4ZH4 F;  1WH5 A;  2FSW A;  3QU6 A;  5HVQ C;  2KDZ A;  3WTW C;  3I56 I;  1E17 A;  2R7D A;  2QQ9 A;  4B48 A;  3I54 A;  5K7H A;  2G0E A;  4KT6 A;  4FAS D;  2VOP A;  2K9N A;  1BOB A;  1LVA A;  4M6Y A;  3K2A A;  3KP5 A;  4I0A A;  4NBQ A;  5ICF A;  5DS9 A;  4V19 K;  3VOD A;  4EV0 A;  2IGM A;  3I9V 2;  1A31 A;  2KIS A;  3I5U A;  1D1C A;  3OWT A;  1TBX A;  1ZK8 A;  2BXZ A;  3QOP A;  3SEZ A;  3O8G A;  2VAS A;  3LSI A;  3HOZ J;  1S3J A;  1DPR A;  4OWR B;  3DBL B;  3GCM A;  4RA2 A;  2X6O A;  5IP7 J;  5J4V A;  3HDD A;  1U6G A;  2FNA A;  3BG3 A;  4XLP F;  5LRR A;  3CCM I;  3MAJ A;  5J1U A;  5H2F C;  3U2R A;  1V5E A;  4LIT A;  4BU2 A;  3IUO A;  3H92 A;  2ZME B;  3AG4 H;  4JK1 X;  2HOA A;  1YTY A;  3K7A J;  5M3M J;  3K4B A;  4MHG A;  3E7L A;  3OOP A;  2D1V A;  1T2K A;  3WG9 A;  1YX3 A;  1XG1 A;  1POG A;  3GTQ J;  3OYL A;  4BE1 A;  3OIO A;  1VQ5 I;  3GTM J;  5FLV A;  2XAG A;  2CUJ A;  3S15 J;  1HSJ A;  1TWG J;  3S93 A;  2O8K A;  2Y2Z A;  2JA2 A;  4IOA F;  3O8H A;  3RZO J;  4EQQ A;  3ECH A;  1B9M A;  4BE2 A;  3HKZ A;  3ZQI A;  2HEO A;  4YII A;  4YEJ A;  2JTV A;  3BR1 A;  5HNF A;  4CCL A;  4DIQ A;  4EJT A;  3VPR A;  2H8R A;  1VQ6 I;  3ML6 A;  1FP1 D;  3E5Q A;  1Z77 A;  3GTO J;  2YS9 A;  2CU7 A;  3A02 A;  2Y0S A;  1ON2 A;  1WQ2 A;  3FBI B;  2XVC A;  4NC8 A;  5ICE A;  1I6H J;  2A5Y B;  1TWA J;  4NB5 A;  4D7M A;  2D5V A;  1XTA A;  3I55 I;  1GV5 A;  5CVV A;  2XF5 A;  1DU0 A;  2LTP A;  1B1B A;  1E3P A;  4DJA A;  1Z7L A;  1MMN A;  3QPS A;  3GYH X;  4AIJ A;  4NC7 A;  3ZR8 X;  3WGI A;  2IA0 A;  4A3I J;  4BAC A;  2L7F P;  2EB7 A;  1WCM J;  5HNH A;  3H36 A;  2A69 F;  3LFU A;  3CO7 C;  1J0R A;  2OF7 A;  2P4W A;  3TMO A;  3EYY A;  3TDU C;  4XOT A;  5F0C A;  2M0C A;  2MW8 A;  4F3Q A;  1YJW I;  3C2B A;  1JT6 A;  1YG2 A;  2NS8 A;  2CW0 F;  1IN4 A;  4M3B A;  3FK6 A;  2KFD A;  5GAD J;  3GEZ A;  2M8G X;  1N75 A;  2OBP A;  3FXU A;  3BZK A;  2NVU B;  4XKW A;  2L02 A;  5B3S H;  4QTR A;  2E5Z A;  1ZYR F;  1WZ2 A;  1LDD A;  3ZQC A;  4M72 A;  2GOM A;  3GTP J;  4EM2 A;  2V7F A;  3OYI A;  2EFO A;  5JLX A;  3OMY A;  1HKQ A;  2G9W A;  2JMW A;  2CFO A;  3PQJ A;  4PSW A;  2E34 A;  3ZQH A;  3G73 A;  2QEX I;  2R7X A;  2VE9 A;  2GQQ A;  4A12 A;  1RR8 C;  3R0A A;  3OY9 A;  3TW7 A;  2K40 A;  2X1C A;  3BLY A;  3F3X A;  3JRG A;  4IKF A;  5TGT A;  1W0T A;  3CP8 A;  3QU3 A;  4C3I J;  2LRD A;  1MIJ A;  1WJA A;  3KE2 A;  2DFI A;  2NAZ A;  4XID A;  5DCM B;  2H09 A;  1FOX A;  4MTE A;  3SZP A;  2YPR A;  5AIQ A;  3PO2 J;  4BQO A;  1OCP A;  1QNT A;  2EA2 A;  1JGS A;  1QPI A;  3E5X A;  3VYR B;  5K5O A;  3DEW A;  3DBH B;  2PEX A;  2RNG A;  4FE7 A;  2LYC A;  5B1A H;  1MH3 A;  3G4S I;  2BHZ A;  5E8G A;  2ADU A;  1S7O A;  4RAY A;  1I39 A;  1ZEL A;  2X6Y A;  3H3Z A;  2AXL A;  3ZPL A;  1MSF C;  2LKS A;  4RGX A;  3ZMV A;  4BBR J;  4ZZD A;  5GTI C;  1Z9C A;  1YI2 I;  3PM1 A;  3ABK H;  3P7N A;  4NC6 A;  1EV7 A;  1LFB A;  2V6C A;  4IVN A;  3MFK A;  3F22 A;  5D6E A;  3LA7 A;  2DOE A;  1W4M A;  4IHW A;  2K7L A;  2PMU A;  3W6V A;  4HAM A;  5KHD A;  1O3R A;  2A5W A;  1R6R A;  3FXO A;  4AYB A;  3LSP A;  2RDP A;  4LGW A;  3GTJ J;  2NYX A;  1HA8 A;  1XCV A;  3ROU A;  1WFX A;  2MLK A;  2R92 J;  3HSR A;  2IJL A;  3TOA A;  2R7R A;  3VWB A;  3OYF A;  2DTR A;  3LQR A;  1T39 A;  1C0W A;  1EH8 A;  2Q2E B;  3L09 A;  1TQI A;  4LG0 B;  3JTH A;  3QOE A;  2VOD A;  3A4C A;  3F72 A;  2HTJ A;  2GZW A;  5CVI A;  3H1C A;  1G8X A;  1RKT A;  5ERI A;  2VLA A;  3FM5 A;  1XMX A;  2EFP A;  1ZGJ A;  1Y8Q B;  3E3V A;  4XLE A;  3Q5F A;  1O57 A;  2VJ4 A;  2WAQ A;  2EH3 A;  2ZXJ A;  2LMD A;  4JX6 A;  3QQA A;  1PDN C;  5FB2 A;  2WV0 A;  4W1U A;  2DA4 A;  3LSJ A;  3F9K A;  3M9A A;  1J75 A;  4KT5 C;  4Y33 A;  5FFZ A;  3PIP F;  2CJJ A;  4XR6 A;  4CSW A;  3N97 A;  2K85 A;  3FKI J;  4WCG A;  4YEL A;  2VXD A;  5K7Z A;  1S7E A;  3RTR A;  4PUS A;  2FX0 A;  3IP4 B;  2CS3 A;  3V8J A;  1GT0 C;  4KNY A;  3FWE A;  2Y0S N;  3MVP A;  1G4D A;  4A5N A;  5IP6 A;  2FD5 A;  1LJ9 A;  3GVA A;  2K9L A;  1L3L A;  4HW0 A;  3K4K A;  2RN7 A;  4GGG A;  2L2O A;  1FT9 A;  4MLO A;  4CDG A;  5EEH A;  3OYK A;  1MH4 A;  2KMU A;  3QAH A;  3TO7 A;  3WGG A;  3C3W A;  1OCT C;  1KYZ A;  2W84 A;  2MLG A;  3RI4 A;  2R7Z J;  1X1B A;  1P4W A;  4D5F A;  3CUQ B;  1J09 A;  1IRG A;  2F5D A;  4KN7 X;  1XB4 A;  2PJR B;  2VI6 A;  1WSU A;  5CPR B;  2E71 A;  2F6C A;  4RM3 A;  4L0Y B;  2HXO A;  2FBI A;  1A35 A;  3HOS A;  5FKK A;  1T95 A;  2QSH X;  1BI2 A;  2MD5 A;  3BR0 A;  1P4A A;  1X1P A;  5CVR A;  3EET A;  2EBI A;  1X2M A;  3BTL A;  3HZJ A;  3F8M A;  4D5C A;  2JSC A;  1K61 A;  5LEK A;  3OYN A;  3ZP5 A;  1ETK A;  5FLX Z;  2UXX A;  4PGG A;  3D0S A;  2ZXH A;  1B59 A;  1Z1D A;  4Y7N J;  2R7Q A;  3BR5 A;  1EA3 A;  3CF2 A;  4AM3 A;  1YFH A;  1KZH A;  5GP9 A;  4Y13 A;  1K4S A;  1REP C;  2NVY J;  3K1M A;  2Q0O A;  1D1A A;  1F5T A;  2ZKZ A;  4JQF A;  4Z2Y A;  4G9Y A;  3TW6 A;  5F0H A;  1J5Y A;  1D3Y A;  2M1B A;  4UV8 A;  2GXG A;  4BBS J;  3B73 A;  2F48 A;  2PFB A;  4XLC A;  2BVL A;  3BJA A;  2JRT A;  1JKQ C;  2ZSH B;  2DYS H;  2DBB A;  3CP2 A;  5F1J A;  4ZDO A;  1XX5 A;  1I5Z A;  4ETS A;  3IH2 A;  5IPA A;  2Z5U A;  2QYO A;  4HQM A;  1GV2 A;  2RKH A;  4ZTJ A;  1QHH D;  1WI9 A;  4A3M J;  3AL0 C;  4AIK A;  1ZLJ A;  1RUO A;  4UUS B;  3H9J A;  3A01 A;  2ETH A;  3IH3 A;  4II2 A;  5FRN A;  2PQ8 A;  2W00 A;  4KUM A;  4AYB N;  1LPQ A;  1GVJ A;  5J8F A;  5L3B A;  2O6G E;  4C2M J;  2EWN A;  3BDD A;  2XB0 X;  3S3M A;  2W24 A;  2ZJQ F;  3OYG A;  5C44 J;  2W4S A;  2LKX A;  5ICC A;  4UVC A;  2W82 A;  3KIO A;  4AIH A;  3BT9 A;  2EK5 A;  2CQX A;  1WJE A;  4RGS A;  3ISP A;  4D7N A;  3MKY B;  1YS6 A;  2ZBK A;  1T6S A;  3C1D A;  3WHB A;  4LD5 A;  2UV1 A;  3HUG A;  2EIN H;  2MD0 A;  5K5R A;  5D4R A;  2A6T A;  3JSO A;  3G2B A;  4LB5 A;  2BZT A;  1S5L C;  2XSJ C;  2NS0 A;  3OYE A;  3CO6 C;  1QVU A;  2L5Q A;  3JRB A;  3MKW B;  2QKL B;  3PUF A;  5K5Q A;  1HST A;  3ABT A;  1ETQ A;  4I7H A;  2VB6 A;  2EZI A;  2R5Y B;  5DV5 A;  1H89 C;  2VN2 A;  2HOS A;  1QU3 A;  1BI1 A;  3KYD B;  4BGD A;  3ABL H;  3VB2 A;  4A3D J;  2J5O A;  3L7W A;  2ZXI A;  4S0H B;  4GO1 A;  1U2W A;  3GLX A;  2BW3 B;  4KDP A;  1XMK A;  3PNY A;  4NQW A;  2CO5 A;  5BMZ A;  3NWT A;  2EA4 A;  2Y9Y A;  3DP7 A;  5BQT A;  2KJB A;  1R1T A;  4PJ0 C;  2FMY A;  2XIG A;  4HSR A;  3X2Q H;  3Q9S A;  2GM4 A;  2V79 A;  3B02 A;  2PBI A;  2BY3 A;  3BG6 A;  4HBL A;  4L9N A;  2WAF A;  1AKH A;  4BEH A;  4M6X A;  1BW6 A;  2EFN A;  4HNU A;  2VBX A;  2QKM B;  4L9T A;  3LSM A;  3OS1 A;  1EKE A;  1DGW Y;  1ZGA A;  4CHU A;  1PUF A;  3WU1 B;  1T8I A;  4HEA 2;  3CCR I;  5LD2 C;  4L18 B;  1HOM A;  2RVC A;  4XN0 A;  3WU2 C;  5KVR A;  3HXL A;  1IZ1 A;  3BCB A;  1SVO A;  4EM1 A;  2XDV A;  4LIV A;  3LNQ A;  2Y9Z A;  4NDL A;  2XRL A;  5D5V B;  1IUF A;  1B72 B;  1FZP B;  5FLM J;  1OCC H;  4JYK A;  4F92 B;  2QA4 I;  3Q0W A;  1QZY A;  2P5V A;  3HIF A;  1VFC A;  3CCU I;  1X4P A;  1STZ A;  1FEX A;  1JUM A;  2R93 J;  4FTH A;  4A0Z A;  4ITV A;  1R4N B;  6PAX A;  1F36 A;  2VJ5 A;  2W48 A;  1K6Y A;  2CRG A;  1IDY A;  1BBY A;  5H6Q A;  1IO2 A;  4IO9 F;  2CUE A;  4CCN A;  2R7F A;  2AO9 A;  2COB A;  2KP6 A;  1J59 A;  4G6Q A;  1DP7 P;  2XV4 S;  2VJJ A;  5FRM A;  2XAH A;  2DQL A;  3BJO A;  2NS7 A;  1T0F C;  3BG7 A;  3S3O A;  2G7U A;  2B63 J;  5IYB J;  3GTL J;  1Y56 A;  1FC3 A;  4KFC A;  3HB9 A;  2KPM A;  1VQ9 I;  4UV9 A;  3IRR A;  1B8I A;  3TQN A;  2KJC A;  3OSF A;  5KCM A;  1ZRC A;  4B8X A;  4QPO A;  4B3X A;  4QLC U;  4MNU A;  1B9N A;  3BZ6 A;  2V4J C;  5HOD A;  2VE8 A;  2MC3 A;  1WJ5 A;  1QO0 D;  4GYI A;  3TKY A;  3MD2 A;  3DF8 A;  2XF6 A;  2HKX A;  3GUD A;  3ECO A;  4I76 A;  4A6E A;  4CIC A;  4XKV A;  2E7W A;  2HTS A;  4A3F J;  1D8K A;  3GZ5 A;  5JR3 A;  4IHV A;  4EEF G;  1U5T C;  4JOM A;  2LBF B;  2R7V A;  1H0M A;  4KYW A;  2O9L A;  1FOY A;  1FTT A;  4OIO F;  1G6N A;  3G3Z A;  3HJE A;  5DUI A;  3UKG A;  5CKT A;  3DCF A;  1X58 A;  2DLL A;  1HDP A;  4BAY A;  1K79 A;  2KDO A;  2FML A;  1HKT A;  5CVU A;  1F4K A;  2EV6 A;  1S9H A;  1TZL A;  2FUG 2;  1Y39 A;  3IL2 A;  2WWY A;  1ZAO A;  4RLF A;  3OYC A;  3H5A A;  2FNP A;  4P5O A;  4HDU A;  1Z21 A;  4N4O B;  3IKT A;  5D8L B;  3SEQ A;  1DGR M;  3PFY A;  1QRY A;  2X0L A;  1TNT A;  1R5I D;  1R36 A;  1W36 C;  3BR3 A;  2P6T A;  1YJ9 I;  4B09 A;  3ZQF A;  2VT2 A;  4U0V A;  3FX3 A;  1J9I A;  4IHT A;  4MGR A;  2BY0 A;  2EIM H;  2HVS A;  1W36 D;  3F8B A;  1YOV B;  2GWR A;  2XAF A;  2L9V A;  2LOO A;  4V2F A;  3RIR A;  4XSX F;  4OU0 A;  2ZFW A;  1R22 A;  3BG5 A;  1WHU A;  1H88 C;  5HLI A;  2OD5 A;  2MG4 A;  4FE4 A;  2XHK A;  1YX5 A;  3S8P A;  3ZGK A;  1ERD A;  4D9J A;  3CMM A;  4E7Z A;  3IWZ A;  3HG9 A;  4XRM A;  3HL2 A;  3SFZ A;  4I6Z A;  4FX0 A;  2GOX B;  1LVK A;  2DK5 A;  4KMU X;  2WTE A;  2HS5 A;  3CDH A;  2JZY A;  1BC8 C;  1D5Y A;  2IA2 A;  3M8J A;  4ASN A;  4G7H F;  3TP0 A;  3V8K A;  3LST A;  2W1O A;  2HOT A;  4YRV A;  4O6J A;  2MC4 A;  1OPC A;  4AID A;  4AVP A;  5D5W B;  5FKM A;  2KZV A;  3G1M A;  3I3L A;  4EJO A;  2BY1 A;  4PDK A;  2E1N A;  2KT0 A;  3A1Y A;  1FBQ A;  2JVG A;  2QWW A;  3O6B B;  3BR6 A;  1YHQ I;  2MSY A;  3E6M A;  1L0O C;  4DYC A;  1S7A A;  2JUC A;  1WI3 A;  2DXI A;  4UY8 I;  2YX7 A;  2CUZ A;  5HS7 A;  3ZN0 A;  1Y8R B;  3G71 I;  4ESB A;  3E1S A;  2YSR A;  3L2W A;  2OTJ I;  4IQJ A;  1ZR4 A;  1BC7 C;  2JSP A;  2HVQ A;  1MDM A;  3H0G J;  2JA8 J;  1XGM A;  1TW3 A;  1Z05 A;  2H1K A;  2DOF A;  5F27 A;  1K78 B;  4M9Z A;  2R0Q C;  1BJZ A;  2Y0M A;  4B47 A;  3PO3 J;  3DFG A;  3FMS A;  1SD7 A;  3BR2 A;  4QWQ A;  3DKW A;  5HLG A;  3VOE A;  4HLY A;  5HDK A;  5TIS C;  3I64 A;  2JPC A;  2PLY A;  4YFK F;  3OYJ A;  2DMN A;  2QQA A;  1VQ7 I;  4PJL A;  3WE2 A;  4M3E A;  3AG3 H;  4PFP A;  3OIP A;  4B4C A;  4IHS A;  4BXF A;  3OYH A;  1SC7 A;  3FXM A;  2LK2 A;  2JWT A;  3IWF A;  2IS2 A;  2X6X A;  4XOR A;  1YIJ I;  1Y6I A;  4ENJ A;  1KU3 A;  1ITY A;  1P7I A;  5K7F A;  2GLO A;  1OQY A;  1N77 A;  3Q3S A;  1JKR C;  5ILV A;  4UXN A;  1B4A A;  3KEO A;  3SFI A;  3W2W A;  2E7X A;  1H9T A;  2NXN B;  2QEN A;  4WXD A;  4HV5 A;  1CQT A;  2N8G A;  1TTY A;  2DTZ A;  4JBA A;  2NOG A;  2O3F A;  3M1C A;  4AUX A;  4U0W A;  1T0F A;  1MMS A;  2CV0 A;  2X1D A;  1I27 A;  4A3B J;  3SQN A;  3DPU A;  3HOT A;  1FIA A;  3GLL A;  4IXA A;  3CDL A;  1A5J A;  2V1X A;  3CCL I;  2XGD A;  2RAE A;  2E1M B;  2DOA A;  3IAS 2;  3T8R A;  1YQA A;  1NG7 A;  2HZD A;  1PUE E;  1ZKG A;  2XB5 A;  3I4N J;  4QIW N;  1VQM I;  3CCJ I;  1EJ9 A;  1MD0 A;  5LHH A;  2NVQ J;  3M4O J;  4XN3 A;  1TLH B;  2OCC H;  2DA1 A;  2K27 A;  1BW5 A;  4BHC A;  1FWZ A;  5J4Y A;  3F23 A;  3J7Z I;  2W7N A;  2VKH A;  2P7C B;  1ZN2 A;  4DYQ A;  1U5T A;  2H8W A;  2XGC A;  1KYW A;  2ID6 A;  1FMW A;  4F93 B;  1GXQ A;  3IV5 A;  4Y52 J;  3BOQ A;  2F2E A;  1FOK A;  2YUS A;  2V9V A;  5DTD A;  5HLH A;  3ERM A;  3GZ6 A;  5F6F A;  3NAR A;  2Z33 A;  5E20 A;  1OCO H;  2ELJ A;  1I1S A;  4I0B A;  2C6Y A;  1D0X A;  1BL0 A;  2P7V B;  4QPQ A;  3KCC A;  3BTC A;  1HW2 A;  1D0Y A;  1S6L A;  3FXJ A;  4ZC3 A;  2B7E A;  3AG2 H;  2BE5 F;  4F55 A;  3S17 J;  5L3G A;  4IRH A;  4FX4 A;  3CLQ A;  3P9I A;  2LDU A;  4RGR A;  3JRE A;  2VC0 A;  1FBU A;  2MH9 A;  3RKQ A;  3CUO A;  1XCB A;  4A3G J;  4S05 A;  4LOC A;  1NG6 A;  2JT1 A;  3A0B C;  1YO5 C;  4CZC A;  4YG2 F;  1ENH A;  2HQN A;  2OZU A;  3AFH A;  4CH7 A;  4YFN F;  2MH2 A;  3SZT A;  2CUF A;  3D5L A;  2IRF G;  3TP3 A;  5A2Q K;  1TW2 A;  3JR9 A;  4XKB A;  4B44 A;  1SAN A;  3WTX C;  4KA4 A;  2XAQ A;  4U7B A;  3OL4 A;  4RAF A;  2CQQ A;  3F6O A;  4HG2 A;  4HQE A;  3KLO A;  3C2H A;  4IRG A;  1XSV A;  3UR3 C;  3WTV C;  1SFO J;  2STT A;  2CW8 A;  2O61 A;  1XDS A;  2Y30 A;  5C3E J;  2KRF A;  1Z6R A;  2KZG A;  4IF4 A;  4ABZ A;  2E60 A;  4L9J A;  4FQG A;  5HS9 A;  3KX2 A;  3FK7 A;  5FRO A;  4ZTF A;  3EUK L;  3VSL A;  4O5V A;  2EV0 A;  5FKO A;  3COA C;  2V6E A;  2EZH A;  2DT5 A;  4I2O A;  1BR1 A;  1DP3 A;  1Z0X A;  3W2A A;  4HX4 A;  3KYL A;  1W0U A;  5D5X B;  2UZK A;  1LFP A;  5IT9 K;  5L3D A;  4CYD A;  1TL8 A;  1RUN A;  1R4M B;  3ASO H;  5H20 A;  2YU9 J;  1IRF A;  3T5X A;  3V4G A;  4HNT A;  1Y0N A;  2ZJ2 A;  2ESH A;  4AD9 A;  4CXF A;  4HOB A;  1VQ8 I;  3P9K A;  2IS1 A;  4XRF A;  1UAA A;  1N25 A;  3R60 A;  2R7W A;  4G6D A;  1MGT A;  1ONV A;  3NEU A;  3S1R J;  1APL C;  2ZNY A;  4IZZ A;  2E2J J;  2VUM J;  2EZK A;  1LE8 A;  4M9X A;  3FZV A;  4CCJ A;  2W57 A;  1XS9 A;  5M5Y J;  2K4J A;  1OIS A;  3FBN B;  1BI3 A;  2FU4 A;  3BQZ A;  4PJN A;  1ZG1 A;  2IS4 A;  1RR7 A;  5E3N A;  2LY1 A;  3R61 A;  1V54 H;  2Z99 A;  1T08 B;  1SMY F;  4D1Q A;  3IC7 A;  1GHC A;  2WBM A;  4N9H A;  1I6X A;  3HKZ N;  3EDP A;  1HQC A;  3FXR A;  1ZHF A;  3RCO A;  5IT3 A;  1IUY A;  1P6R A;  2I5U A;  1JGG A;  3KEY A;  5IY5 H;  2QLZ A;  2B9S A;  4IJA A;  2XAU A;  4L5E A;  5L3C A;  1PP7 U;  2LY2 A;  2HYJ A;  4ANJ A;  1R23 A;  1UHW A;  1E0E A;  4XIC A;  1LNW A;  1ZRD A;  4P55 A;  2D1H A;  1IV8 A;  4XM3 A;  2GIZ A;  5EZG A;  5M5W J;  4XSZ F;  2ZB9 A;  2E36 A;  5FD5 A;  3H35 A;  1IN5 A;  3KET A;  1VQ4 I;  1U8R A;  2XPW A;  1KU2 A;  4AVZ A;  4L9V A;  1MND A;  2V9P A;  2Z3Y A;  4A93 J;  4RAZ A;  4XNF A;  2P0W A;  3EPZ A;  1BJA A;  4A3C J;  2PN6 A;  4A0Y A;  2E5N A;  1WJB A;  1SVL A;  2KKO A;  3K1N A;  4PK4 A;  4BXX J;  3DLA A;  2Z9O A;  2OZ6 A;  2VQC A;  2EV5 A;  1G59 A;  2QBY A;  4E7H A;  5D5U B;  4DOZ A;  2YU3 A;  2DFH A;  2L9R A;  1H9G A;  2KRC A;  4X6A J;  1WPK A;  2KLO A;  4WK8 F;  4H0E A;  4GRI A;  2HVR A;  3U1K A;  4F52 A;  4L0Z B;  1LEA A;  2NVT J;  2CSO A;  3L2U A;  1AA7 A;  1Z67 A;  5JI6 A;  1BR2 A;  1R58 A;  2L7K A;  3I53 A;  3DQV C;  4L5I A;  1MMG A;  4ZYE A;  5CYV A;  2H94 A;  1BI0 A;  2XUB A;  2CH0 A;  3WTU C;  3SHF A;  1U78 A;  1XGN A;  2IEK A;  3KP4 A;  5E18 F;  5LHI A;  1ETY A;  3B6A A;  2DFF A;  1UMQ A;  2FQ4 A;  1KGS A;  3DEU A;  2FF4 A;  4HZF A;  2BEO A;  3HC7 A;  4XLF A;  4KMF A;  1IXC A;  2R5Z A;  1HXD A;  4IL6 C;  5GPC A;  2VQL A;  3RYR A;  4I01 A;  1RKW A;  2CQ7 A;  1N78 A;  1K83 J;  2CWE A;  1KU9 A;  2L0K A;  3CJN A;  3J7A Y;  2JJ7 A;  3QP6 A;  2QVO A;  5JVT A;  3MKZ A;  2BBY A;  3O2P E;  1DDN A;  2VPL A;  3IRQ A;  1VQK I;  3ZRG A;  3L9F A;  3RPQ A;  2EJR A;  3I59 A;  3M07 A;  2DFE A;  2L4A A;  2HDC A;  2BOL A;  3OIQ A;  3GZN B;  4BE0 A;  1IG7 A;  4XBF A;  1RET A;  3JAM Z;  2FBH A;  4P9F A;  1JHF A;  2XC7 A;  2OCE A;  2HOE A;  4CA0 A;  5LFA A;  4MFE A;  2FQ3 A;  2OQR A;  1YW9 A;  3VFZ A;  4RB3 C;  4KIB A;  3T1B A;  3FXQ A;  2M34 A;  2F5V A;  3PIO F;  5LGU A;  1GLN A;  2KIM A;  2HI3 A;  1R9T J;  2QQB A;  2XRN A;  3HPG A;  3Q9V A;  3TGN A;  3OYM A;  5E79 C;  4BKX A;  4DGW B;  2R7U A;  4OMZ A;  3JRH A;  2KIQ A;  2L7Z A;  1OR7 A;  3S2D J;  2M4K A;  3K10 A;  2BHY A;  3HTS B;  2CFX A;  1MMD A;  1LFU P;  4ZZL A;  2ICW G;  4M6V A;  3HTU A;  1FY7 A;  1Y1W J;  2LF7 A;  2HFH A;  2HPI A;  1LUJ B;  2ZJR F;  1SD5 A;  4IEJ A;  2ECC A;  3H0D A;  4DYR A;  5LEJ A;  2FRH A;  2RGV A;  3HSF A;  3A01 B;  4IRI A;  4JP0 A;  1MBH A;  1R49 A;  4G8X A;  3CME I;  2WAQ N;  4IQ4 A;  3K4M A;  1IC8 A;  1JKP C;  1UB9 A;  4RB0 A;  1JKO C;  3SDB A;  4A5M A;  2EFW A;  3LAJ A;  2ECB A;  3A03 A;  4PJM A;  3RQI A;  3DEE A;  3ZQ7 A;  1SD6 A;  2ZO4 A;  4Y15 A;  2GXA A;  4E7L A;  5BS6 A;  2DMT A;  1SVM A;  1R1V A;  4LFU A;  5F64 A;  2M0M A;  2VC1 A;  4RGU A;  1D5V A;  1Y0U A;  2QCO A;  2IPQ X;  4LLG F;  1LDJ A;  1OYW A;  3HUG B;  1DUX C;  4BNC A;  2ZME C;  2XKP A;  2M45 A;  2M4G A;  1WJD A;  3R4K A;  3E6D A;  3ZMT A;  4HF0 A;  3WTZ A;  1CF7 A;  1VF9 A;  4UUT A;  2WY7 Q;  1IAW A;  3OR2 C;  2OU2 A;  3GO5 A;  1BIB A;  2HU9 A;  1P2F A;  3ZQQ A;  2TRT A;  5IOZ A;  2IS6 A;  1X3W B;  3OS0 A;  3JRI A;  4HV6 A;  3HSE A;  3LSH A;  2ZFU A;  4UVA A;  3OYD A;  3E6C C;  1PYV A;  3DWL E;  5J40 A;  1TQP A;  2K3P A;  4RB1 A;  3HOW J;  4BYY A;  4UUV A;  1QZE A;  3AG1 H;  3H9G A;  3L2R A;  3N4M A;  2R7T A;  1X19 A;  1XMA A;  2FOK A;  3IAM 2;  4Y4R A;  1QGP A;  2AQF A;  4NQW B;  3S2W A;  1X1A A;  1JHH A;  4PSX A;  2ISY A;  2M7A A;  4G7Z F;  2K9S A;  3ONQ A;  4CYC A;  3JRA A;  2Z1D A;  1EH7 A;  2EQR A;  1AKH B;  3WOD F;  2X4H A;  2R7O A;  4BEH B;  3TL4 X;  2VKD A;  3CDI A;  4LB6 B;  2Y31 A;  4CCK A;  3DBR B;  2QZ8 A;  5GAH J;  2DT6 A;  2QGU A;  2RQP A;  4XKC A;  1TWC J;  1OFC X; 
#chains in the Genus database with same CATH homology
 2QSG X;  1TP4 A;  3ESW B;  2F4M B;  1X3W B;  2QSH X;  2F4O B;  1OQY A;  1PVE A;  4YIR X;  1X3Z B;  2QSF X;  1QZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...