1X3WB

Structure of a peptide:n-glycanase-rad23 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
GSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide:N-glycanase
publication title Structure of a peptide:N-glycanase-Rad23 complex: insight into the deglycosylation for denatured glycoproteins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1x3wB01
1QZEA 4YIRX 2QSFX 1X3WB 3ESWB 1OQYA 1PVEA 2F4MB 2QSHX 2F4OB 1X3ZB 2QSGX 1TP4A
chains in the Genus database with same CATH superfamily
5E79C 1TW2A 5BOXA 1MBKA 4AM3A 1SEUA 1T08B 2VC0A 4HLXA 2L9RA 4B8XA 4RB1A 2L02A 3UR3C 3C7JA 2NVXJ 2HOTA 3KP3A 4MLOA 3GBGA 1YW7A 2KQRA 1K6YA 4C9YA 1VZ0A 2LYCA 3RKWA 1G3SA 2WAEA 1JUMA 3K1NA 2KMUA 4UUSB 1W4MA 5GPCA 4MTDA 3LSMA 3RYPA 3H0GJ 4DOZA 4BDYA 3KIOA 1A6QA 4UUTA 3DTKA 1YJNI 2O3FA 3TBIA 2E1MB 4RBOA 1ZG5A 3ZQ7A 5FLMJ 3GTQJ 2K9QA 3DKYA 1FIAA 1L3LA 3G3ZA 1AKHA 1OR7A 1Y0NA 3MWMA 1LEAA 4ITVA 3KP4A 4L9TA 2WB1A 3H5AA 2DPDA 1D3YA 3C2BA 1UZCA 2EIKH 3RPUA 4FX0A 2V4JC 3D5LA 3GLLA 3R61A 4DZPA 2K3FA 3I55I 4IZZA 4A3JJ 3S32A 1OCZH 4AVPA 4Y52J 3HZJA 2DPUA 2BW3B 1T98A 3I9V2 4IEJA 3G71I 1OCPA 1R6RA 2XAQA 3WGIA 2PG4A 4P5OA 2GXBA 4EM2A 5FLXK 2EH3A 2NNNA 5LHGA 4C30A 2FQ4A 4A69C 4ENJA 4JYKA 4IPAA 3AG3H 1W7PA 2W25A 1O3RA 1V55H 4IHYA 2RNJA 3OY9A 3VODA 2IXSA 3HIFA 2X0LA 1OYYA 3WGGA 3BR2A 5F0CA 1U78A 3J80Z 3BCBA 5ILVA 4PSXA 1ZGWA 3BG7A 1BI1A 4G7HF 1MBHA 5GAHJ 4M9SA 4ZTJA 3JTHA 3U21A 2KRHA 3N97A 1LQ1A 4AYBA 3OSGA 5DM7F 3HRUA 2KZGA 2LH9A 3MVPA 1O4XA 2XGEA 1BOAA 4KMUX 3BG9A 2E2IJ 1WSUA 5K7ZA 2ZNYA 4L9NA 2KL4A 2VE9A 1Z6RA 2EZLA 3VYRB 3DF8A 2RQPA 1U5TB 2CSOA 5K5QA 3P5JA 3L2UA 2IS6A 1ETKA 1QHGA 3BZKA 3HRTA 3HBLA 4JX4A 5JLXA 4HNTA 4NC8A 2CWEA 2CW8A 3LOCA 2M4GA 3G73A 4A3LJ 2NOGA 4EVIA 2VASA 4LITA 5DS9A 3P9KA 5EDNA 3A1YA 4P9FA 3RKXA 1JHHA 4I99C 2ETHA 5LGUA 4XN3A 3JAMZ 2PJPA 2ZMEB 2L7ZA 2N8GA 3BCAA 3TQNA 1DPRA 2DBBA 2FRHA 1DGWY 3KP5A 2VUMJ 1G3TA 2VJJA 3CC4I 2EFNA 1NTCA 2K9MA 2K4JA 2HQ5A 3B73A 2VPRA 2M87A 3OIOA 5IP7J 1EH8A 1FPQA 4GXOA 4ENKA 4M3GA 4U0VA 5ICGA 2LMDA 3WTTC 1USSA 3C1DA 3MMYB 3OYHA 4K2EA 4N4NB 2OA4A 2XDVA 2MA3A 1T38A 4YIIA 2E5ZA 3FIWA 2LK2A 4BHPA 3H5RA 4AUXA 2LREA 2XRLA 2Z99A 1B9NA 1I6HJ 1F36A 3QU6A 1G59A 1GDTA 1WVRA 2HR3A 1MD0A 2PMUA 4FE4A 1EKEA 4UUSA 3M8EA 4RDUA 5LEKA 5A2QZ 4RAYA 4XL9A 3BTIA 4PJLA 3QQAA 1YJWI 2HZDA 2WY8Q 4JX5A 2L7KA 3FDYA 4L0ZB 4I7HA 1PP7U 5L3GA 1XC5A 3OYCA 2V1XA 3OV8A 2DOAA 3OSFA 3CMMA 4OMYA 1MBFA 1SFEA 1MNMC 4G6QA 3PIPF 4S04A 4CCJA 1Y39A 4AWXB 5FFXA 1MMGA 1S72I 2F5VA 2DQRA 4BQAA 3AG1H 4DJAA 5C4JJ 2LSOA 4D5FA 5K7HA 5D6FA 3L2VA 3Q3SA 5IP6A 3CTAA 2DN0A 2I10A 1ZLKA 5CJ9A 1V5GA 1SD6A 2GA1A 3C18A 1KONA 1IXCA 2ZJ2A 4KIBA 1X19A 1VQ5I 4A3BJ 2JA8J 4BBSJ 3HHGA 4KT5C 1O3TA 4IHSA 3DTIA 4HX7A 4RB0A 2LY9A 1G3WA 2A05A 1RRJA 1KYZA 4B4CA 5ILSA 4C3JJ 1QZYA 2CV0A 2E7WA 2K9LA 3DBRB 5DUIA 4EGYA 3MKZA 1HA8A 5K5RA 4A5MA 3K7AJ 3ZMDA 5D4RA 4LLGF 1J59A 2E2HJ 5HLIA 3NEUA 2EFQA 4QIWN 2EFPA 2BY3A 4EJVA 4MO7A 1HW1A 1XGSA 2UXNA 1LVKA 3GFIA 2G0EA 3I58A 1I5ZA 2F5EA 2F48A 3I53A 4PSWA 2Q2EB 2Q8KA 4ZYGA 4BE1A 1JJ8C 1J75A 3K1MA 3M1CA 1OPCA 2V1NA 2ACJA 4GFBA 1U5TA 4LLNA 2ECBA 1VQNI 1S8NA 4UVCA 5DCFA 4BL0B 4DYCA 2Z5UA 2GOMA 2W57A 4D7NA 3QOEA 4OAZA 2RREA 3SYTA 1PVEA 3CO6C 1BOBA 2QKLB 3FKIJ 5HDKA 2IW5A 1XMXA 3ONQA 1H0MA 2WY7Q 2XUBA 3CESA 3KCCA 5FLXZ 5CVVA 1YQAA 1UMQA 5M3MJ 3JR9A 5HLTA 2ZMEA 3MKWB 3CMEI 1IG7A 4KIFA 3F8FA 2Y30A 2D45A 4RAFA 5LRSA 5GTIC 1R4NB 2W4SA 4G8XA 1ZH5A 4Y4RA 4GO1A 2CQ7A 2O8KA 3HKZN 2MC3A 4E7LA 3IV5A 4M9ZA 4KN4X 3GO5A 1SAUA 4FHTA 2PLYA 4KYWA 5DV5A 1SD4A 2NXNB 2Y9YA 2E34A 1R36A 4HSRA 3O8GA 2FD5A 1ERDA 5FJ8J 2Z33A 2A6HF 3GCMA 1ENHA 4DZJA 1AOYA 3ZQHA 3WTXC 2O03A 1J09A 4U0WA 1X1DA 3TP3A 4YRVA 1ETVA 1X1AA 4BXFA 2AQEA 2EQRA 2X1EA 5J8CA 2RGVA 4BJTA 1RIOH 1I1GA 3S3OA 2R7FA 2OTLI 2L2OA 1KZHA 1IZ1A 3K69A 5JHFA 4XRMA 1LEBA 3QAHA 1LPQA 2QBYA 4KJZA 1F43A 3KFWX 1FYLA 3ABMH 2O9LA 4GDFA 2HWVA 4RGUA 5GP9A 4AIDA 4F93B 1JGGA 3D0SA 5K7FA 3E3VA 5FO5A 4IRHA 2BE5F 2BY1A 2EB7A 1IGNA 1ETWA 1UG0A 1UCRA 2JK3A 5D5UB 1Z21A 2NS7A 2LFBA 2JRTA 3TP0A 3SDBA 4EM0B 2VKHA 1YLFA 2YS9A 3BT9A 1A6IA 1X4PA 4X6AJ 1QPMA 2GZWA 2NVYJ 2VT2A 4GGGA 4EATA 2W84A 1TWGJ 1K78A 1IXRC 1BIBA 3LSTA 3NAUA 2GM4A 2ZJPF 4R1HA 4U87A 1SMTA 2IS1A 3ERMA 4HBLA 5TRDA 3JREA 2GLOA 4BYYA 4I02A 1S9HA 2XB5A 4XMYA 4JOMA 1LDDA 3BR6A 3OYJA 2D1HA 3O2PE 5CVUA 3DBLB 3WU0A 4RM3A 3TMOA 1FYKA 2GAUA 2LNBA 3DEWA 1ETYA 1T8IA 4L18B 4HQMA 2LD5A 3OYGA 3MZHA 4BU2A 2ZFUA 1S3JA 1REPC 3LWFA 3NWTA 5B3SH 3CF5F 1Z3YA 2P81A 2M0MA 5M5YJ 2HDCA 4G6TB 2CV2A 2I5UA 2X6XA 2MFZA 2VJ4A 2ZCWA 1ZQ3P 2Q2EA 3TO9A 4XRSA 3LMMA 5J1RA 1BN5A 3CJRB 2EK5A 1XGNA 1KU2A 3K1PA 1T56A 2F4MB 3P9CA 1BJZA 1U9OA 2EA2A 3FXUA 5J47A 2BYVE 4M74A 3TL4X 4G7ZF 1WH5A 1TLHB 3PUBA 4HYEA 2DFFA 1MMSA 4Y7NJ 3R0JA 2XKOA 4CDGA 3PQKA 1D8KA 1LKXA 1KU7A 1P4XA 1U0JA 3KYDB 2V9VA 3IP4B 3DXJF 1OMIA 4N9HA 3OYDA 2PMHA 2LF7A 3HSFA 3OR1C 2W82A 1L0OC 2EFWA 3DKXA 4XN0A 1P7JA 2P6TA 4ZH4F 4QPOA 5IOYA 2CQQA 2XPVA 2BZTA 2R7VA 2IGOA 3RKYA 1MJAA 4IKFA 2VQHA 1X3UA 1SAXA 3SZGA 1I1SA 2VBXA 2H94A 1FTZA 2NVTJ 2QM3A 3S93A 2MH2A 1ON2A 1SMYF 2ZFWA 4OAYA 3PNTA 3K4BA 2LDUA 3VSLA 2X51A 2FMLA 1Q1HA 2ZO4A 4N9IA 1XPXA 1WQ2A 1NHAA 1Y56A 3I54A 3P9IA 2CUEA 4PUSA 3VOEA 1AWCA 1CF7B 5H6RA 3O3KA 3DWLE 2MD0A 2UUZA 2IJLA 1ZAOA 1LE8B 1ULYA 1JXSA 2R5YB 1CQTA 2VOOA 1XB4A 4YEJA 4BS9A 1ZR2A 4FCYA 5EEHA 3OOPA 3W2VA 2O5RA 2Y75A 2X85A 2W85A 2VJIA 5HNHA 3CQZJ 1Z77A 4XLNF 1P9QC 1O7FA 2V9PA 2CH0A 5DCMB 4IVNA 4CZZA 2DA2A 3HUGB 1UHMA 3VYUB 1LJ9A 1FIPA 2A6TA 1Z0XA 4WCGA 3EQLF 4NC7A 4XKWA 2KLOA 1DU0A 2BVMA 1X1BA 4ZZDA 5KVRA 2E2JJ 4HAMA 4FX4A 1O7LA 5BS6A 5FKNA 2QEXI 1K4SA 2JSPA 3F9KA 2GXAA 3ZN0A 2DAOA 3CJQB 3ELKA 3KE2A 3OIQA 1I27A 3E5UA 3WGHA 3ZCOA 2X9DA 3CDLA 3JRDA 1BI2A 4YG2F 4ZTFA 1YX3A 4ESFA 1LFBA 2MLGA 2R3SA 4X0GA 5TGTA 2CV1A 3AG4H 4UXNA 1JHFA 3CLQA 1R9TJ 1W0UA 3JSOA 2R5ZB 3I5UA 4XLPF 1USTA 2KHMA 5J4YA 2RV8A 5EYRA 3KZIC 4E7ZA 3BC8A 2OCCH 4DYQA 2LC2A 1Y1VJ 1HDPA 4IX7A 2DW4A 5FROA 2UWMA 3OL3A 2FUG2 1ZLJA 5JVGF 3CUQC 4IQJA 5FGMA 2Y48A 4CICA 5C4XJ 4KDPA 5D4SA 3A0BC 3A03A 4HRIA 3JRCA 4YELA 5LFAA 2B0LA 2F5FA 3F72A 1T0FC 2K40A 3H1CA 4CCMA 4JQFA 1WH7A 2B9SA 2TDXA 1RR7A 2DA4A 2H8RA 3FX3A 1T95A 1W5TA 4XORA 3WTVC 5FKKA 2FOKA 4BNCA 1V3FA 3S3MA 1FY7A 3CZ6A 3UKGA 3E6BA 2XVCA 2QQAA 4XKBA 5M3FJ 1ON1A 2L9SA 1IRZA 2E60A 2VPLA 1ZTRA 1J2XA 1MGTA 1IN5A 2EA4A 3RPUD 3OYEA 1V4RA 4R8HA 4HX8A 3LSJA 4A2UA 3ZMZA 1DGRM 2DYSH 4M3EA 2DDAA 3V8KA 3LAJA 1VQ4I 2DJNA 3F8MA 2AS5F 5LGTA 2FE3A 1IDYA 2OPTA 3H92A 1R22A 3JRFA 2R7XA 2Q0OA 4EJOA 4A3EJ 2P7VB 3ISPA 2A61A 1SFOJ 3HPGA 4OU0A 2Z3YA 3TDUC 3H9GA 4O3MA 3RJPA 1ITYA 2ID6A 4OWRB 3WU2C 2E1CA 4JK1X 5EEGA 3HDDA 1WCMJ 1FSHA 1CF7A 3BJOA 1JT6A 3RIRA 1LE8A 3X2QH 2R5YA 2QF7A 2Y0SA 2COBA 4RAZA 1HKTA 2DT6A 3HTSB 1WZ2A 1IO2A 3WG7H 4OIQF 2E36A 3BQZA 2WV0A 5E1XA 1JKQC 3B6CA 1IV8A 3LQRA 3GTOJ 2WTEA 3OYMA 1R00A 2RVCA 2GQQA 3CDHA 1U3EM 3K6GA 1XN7A 2IS4A 4HPQA 4NNJA 5DCMA 3CDIA 3EUHA 1DDNA 2OCEA 3HUGA 3CF2A 3BTCA 2WB1N 2DO7A 2BHZA 4AC0A 4XICA 4PFPA 3LSHA 1MSFC 4AD9A 4W97A 1O3SA 1OYWA 2FX0A 3ZQCA 4F3QA 3F6OA 3OS2A 2XC7A 5HDGA 1S5LC 4IHXA 3QODA 1MJ9A 1IUYA 4ASNA 1RETA 2XGDA 4M3DA 3FM5A 4QLCU 5JFRA 2WC2A 1XCVA 3L7WA 2XPWA 3CMAI 2OQRA 1GVJA 2VT3A 1P4AA 3V8JA 1YW9A 4LG0B 2DCEA 3M07A 1HC8A 1FP1D 3K10A 3TW6A 1POGA 1QO0D 4Q48A 1RC9A 3PNVA 3HG9A 3CCYA 2DMQA 2QUFA 3I4PA 4PCQA 4XKCA 5IY5H 1FOWA 4ZYEA 1R49A 2WA0A 4LB5A 2XAJA 3JW4A 1XGOA 2LY1A 4Y3OA 2DYRH 4ETSA 2R5ZA 1R5ID 3I4MJ 1RUNA 3Q9SA 2X6OA 2F5CA 4AYBN 4AIJA 3DFGA 1TTYA 4XSZF 2BEOA 4KFCA 5F64A 4XQFA 3EDPA 4UVAA 3F0CA 3BROA 4XK4A 5IT9K 5KCMA 3M1EA 1X3WB 1QPIA 5J40A 2G7HA 2VBYA 4XSXF 3ZQGA 5IPAA 4XOPA 3K4MA 3MZYA 5EZGA 5B66C 2YU9J 1E0EA 3V42A 2WBMA 1HQCA 2HXIA 5LEJA 4I0AA 2AHQA 3F8NA 4ESJA 2M7AA 1PJRA 3CLOA 5E8GA 1MNDA 1WPKA 3WU1B 1X2NA 3A01B 3G4SI 4FISA 3N05A 2QLZA 4CGZA 2JA7J 1SFUA 3E1SA 1PYVA 4RB2C 2CFOA 2M1BA 1H89C 1WJ5A 3DP7A 2X1CA 1OR7C 2FBIA 3KLNA 5ERIA 2DK5A 1YO5C 3CUOA 5B1AH 5CQEA 3K2ZA 3UNGC 3F23A 2MABA 1D1AA 3ZQIA 4BKXA 1Z6TA 1IN4A 2J5OA 1X1PA 2LKSA 3MKLA 3RSNA 3NQOA 2UZKA 3ZPLA 4LGWA 2HI3A 1S6LA 2CUZA 4A12A 5LRRA 4E7HA 1BC8C 1YX5A 2JPCA 1XSXA 4CSWA 2ISZA 2NRAC 4MEYF 2W1OA 2R0QC 3E5QA 4MHGA 1FMVA 1UJ8A 2EINH 2F5DA 2IGMA 2NOJB 2M45A 3HB9A 3K2AA 3K9TA 4PJJA 4UB8C 2UV1A 4E4HA 2OC6A 2Q1ZB 2L7FP 1OISA 1TZLA 1I39A 2CO5A 5J3LA 4YFKF 1SFKA 4PJNA 2H27A 4E7SA 1KU3A 3U9GA 3V4GA 1U6GA 4BEHB 4IRIA 2R93J 4B48A 2W7NA 1B59A 5KK1A 1F9NA 4XRSG 3VB2A 2JMWA 4OMZA 3RKQA 3T8RA 4A6EA 2QCOA 5F1RA 3ULQB 2IT0A 3F6VA 1KYWA 4I6ZA 2HOEA 2MGQA 3DBHB 1FT9A 3KX2A 3J7ZI 4PGGA 2HXOA 2EV0A 2L5QA 1RKWA 1WWXA 3FXOA 4JX6A 1DP3A 3PUFA 2HKXA 2K02A 4V2FA 3FWEA 5E3OA 1F5TA 4G12A 4P1WA 3HM5A 4P96A 4MFDA 1W0TA 3PFIA 3RCOA 3LSPA 1FP2A 5EG0B 4DYRA 5E18F 3R60A 4AIKA 1CGPA 3GZ5A 4L5IA 4B1RA 1QRYA 2OAZA 2R7QA 4E70A 1QNTA 4Y15A 1C0WA 1MDMB 4MIMA 3WHBA 2JVGA 4ZDPA 4WXCA 4DQ2A 2XF7A 4YIRX 2K4BA 3K0LA 3KEOA 2XRNA 1B6AA 4BY7J 3KETA 2IPQX 2E71A 4GYGA 1Y8QB 4D9JA 1TL8A 3T0YA 2KZVA 4M73A 2HDDA 2DMUA 1BA5A 4I98B 1TT5B 2HQNA 3CP8A 5HODA 2BW3A 2PN6A 2EILH 4BUPA 4KISA 2YX7A 3EYIA 4UV8A 3A4CA 4B3AA 2QA4I 1ODDA 2L9NA 5CPRB 3PNYA 3B6AA 3KP2A 3COAC 3HXLA 4RB3C 4G7OF 4GCVA 2M8GX 2XF6A 3TOAA 1A36A 3LAPA 2V26A 1K61A 3U2RA 3ABUA 1UAAA 1BI3A 3H0DA 3GFJA 2HEOA 4A0ZA 3CO7C 2VOPA 1VI0A 1RI7A 4NB5A 3OMYA 2PI0A 3DLLF 5CVJA 2Y31A 3A01A 2E1MC 3FF5A 1R1VA 5AONA 2QQ9A 3ABTA 2Y0MA 3H35A 5KAFC 2H1LA 2RKHA 1TT0A 4AVZA 2DODA 3GVAA 1IJWC 3I59B 2STWA 2KDZA 1IDZA 3K4CA 1TWFJ 2GBYA 3HTUA 4BE2A 1BW6A 3Q0VA 4V19K 5DYMA 3BTJA 1Z7LA 2EZHA 2JJ7A 3GW2A 3EETA 4TV7A 1I3QJ 3WE2A 2L0KA 3D1NI 2O61A 1EH6A 2A68F 2M4KA 3TOBA 2DFEA 3PO2J 1GT0C 4XBFA 2EBIA 2XIGA 2IGKA 2EWNA 3K70D 1OCOH 3ABLH 3BPXA 5DD8A 1FC3A 4PGHA 3GTKJ 4LOCA 3S1QJ 1P4WA 2P5KA 3S1RJ 1Z91A 2A3SA 2OBPA 3CCJI 3TGNA 2GA2A 1D5YA 4ABZA 4Q5SF 2XAFA 2ZKZA 3FISA 4FE7A 3I56I 4PDKA 1IW7F 3OIPA 3ERED 2JQ7A 4LK0F 3RI4A 1FTTA 4BEHA 1IUFA 1HSJA 3L9FA 3O8HA 3GTGJ 5HNFA 1EF4A 1T6SA 3BPVA 2AXTC 3KPHA 4PJ0C 1OCTC 4JP0A 1GVDA 2ESNA 2EV6A 4FQGA 3W6JB 3BR3A 1I50J 3AL0B 2QYOA 2BVLA 4BXUA 4II2A 4KUMA 2DOFA 1YJ9I 4BQOA 2ZXHA 2ZXWH 4MNUA 2DA5A 2KRFA 4XOTA 1SVLA 4ZYAA 4C3IJ 1U5TC 2LOOA 1D0XA 5BPDA 2G9WA 2FF4A 2O0YA 4A3CJ 4RLQA 2C6YA 3I3LA 4CCOA 1JTYA 3E6DA 1NG6A 5KAIC 1XCBA 2R4GA 4RGXA 5LLQA 3M3YJ 1WFXA 2JN6A 4A3DJ 4A3GJ 1E2XA 1BBYA 4IL6C 5K5OA 2HTJA 4KN7X 2FMYA 3LSRA 2ZMEC 4OOIA 3GXOA 1XS9A 2FQ3A 2ISYA 5CVRA 2NS0A 5ILUA 1K4TA 1D8JA 3BDDA 4KNYA 5IYBJ 1S7EA 1FMWA 3Q0UA 2V9KA 3M8FA 4V2GA 3NRVA 3E7LA 3HRSA 1DPUA 3BY6A 3IRRA 2JTVA 4XM3A 1AHDP 3G1MA 4NUBA 4RM2A 3PSFA 3QRFF 5IYDJ 3MAJA 1DP7P 3GLXA 4ZDOA 1WGXA 1M1EB 3HC7A 2QQBA 3CCQI 2EZKA 2PFBA 1TBXA 3IRQA 2IRFG 2STTA 1BJAA 4EV0A 2HPMA 1WJBA 2LKPA 2MSYA 3SZTA 4BE0A 1MZBA 3VSKA 5F1JA 2OZ6A 5CVIA 1QQIA 2H6BA 3ZMSA 1TQMA 3PIOF 2CFXA 2ZNZA 4E7KA 2ELJA 2DDBA 3J7AY 4IRGA 3TW7A 2VB6A 3J81K 5E17F 1JKOC 2A07F 4I01A 1UHSA 1WHUA 1HOMA 2Z9OA 1SD5A 4ENMA 4BXXJ 3A0HC 3K4NA 2R92J 2ICWG 4JBAA 1A04A 2VKVA 4XLEA 2NVUB 1ZGAA 4EEFG 3HOZJ 3DPLC 1XD7A 2PMZA 1D0ZA 2MH9A 3AG2H 2R7RA 1HXDA 4KITB 3BR5A 3GF2A 1H8AC 2PEXA 4M6VA 4NDLA 3CC7I 4M6XA 1J0RA 2GIVA 4D0PA 2VBZA 3BWGA 5IT3A 4HG2A 1R4MB 2VL8A 2FSWA 1B4AA 2V6CA 5D6EA 3K70C 6PAXA 4HZFA 1R7JA 3QPHA 4J01A 1RR8C 1MMNA 2HQRA 2OF7A 2FEZA 4CO8A 4KT6A 2DA7A 3L1PA 1QZZA 1U9NA 2HZTA 2JUCA 2JA6J 3RQIA 4HF2A 5ICCA 1RPWA 3GFMA 1R23A 4XKVA 3VWBA 3GTMJ 1BM9A 1YHQI 2P4WA 3KEYA 1I6XA 3LA2A 4RLFA 1VQ8I 2R7ZJ 2MD5A 3KZYA 5JVTA 1VQKI 2VKEA 3S2HJ 5F08A 1IN7A 1Y1WJ 3C2HA 2OZUA 4A6DA 3M9AA 3VEPA 1WJEA 5K1YA 3GEZA 5FRMA 3T8TA 5EF6A 2P5VA 2V7FA 3H5NA 1U8BA 5ICEA 1FLIA 1OFCX 9ANTA 3RYRA 2YR2A 2L54A 4BACA 1YOVB 3M4OJ 4B09A 4E6KG 5F0HA 4LLLA 1QU3A 4HNVA 4XRFA 2IBDA 1UB9A 4EM1A 2YPRA 1YTYA 5JR3A 2CRGA 2RNGA 5L3FA 3D5RC 2BXZA 3HOTA 3DEUA 1LUJB 4A0XA 3G1LA 3KP6A 2LKXA 2COMA 2KRCA 4I09A 4G9YA 4BGDA 1W36D 1E3OC 1MH4A 4BH9A 3SHFA 3MZ8A 2K9SA 2WAQA 1MH3A 1T2KA 1K83J 1UHWA 1KGSA 3DPUA 1FZPB 1Y6IA 5DEQA 2QWWA 2DJIA 5EEAA 1A31A 3MCZA 1K79A 2YX4A 3F8BA 1LFUP 2IA0A 3V8LA 2DQLA 3BTLA 3GFLA 2GIZA 3ZMTA 5E8IA 1MBGA 2E7XA 4CH7A 4ZZLA 4CXFA 4RGRA 3ASNH 3IH2A 1VF9A 2DMTA 4EJTA 1ETXA 1R58A 4OIOF 3H36A 4LFUA 5HVQC 4XNFA 3WTYC 2KJCA 1J9IA 3B02A 3TO6A 3E6CC 4HOBA 3SEZA 1FOKA 3IKTA 1R71A 1KA8A 4XLCA 1LVAA 4E7JA 1MKMA 1LDJA 1TQPA 2ECCA 2WAFA 4HV6A 3BR0A 4Y13A 2NS8A 4LMYA 2BV6A 2CW0F 3F8CA 3JRHA 3H3UA 2HYGD 5D8KB 2JUGA 2HPIA 1QHHD 1TNSA 2CS3A 3ZP5A 5DD4A 2L9VA 2NNYA 1XMKA 3PQJA 1MW7A 3MD2A 2A69F 1R1TA 3QPLA 2HYJA 1WI3A 3FBIB 4A93J 4MGRA 3ECHA 2QQ8A 2DI3A 5EJCA 2QSFX 3MQ0A 3E0JB 1K7AA 2Y0SN 4M71A 2HDWA 4MQ9F 2RAEA 1B9MA 1WJFA 1IAWA 4RGSA 2MLKA 5FB2A 2R7DA 3R6SA 4AU7A 5TISC 5GTHC 2A6EF 5C3EJ 1W7PB 3S14J 1EV7A 3FK7A 2CJJA 2XSDC 1IN8A 5E20A 2MC4A 3I0TA 5KNLA 4S05A 1T33A 4DNCA 1TWHJ 3BG3A 3HPHA 1RUOA 1O3QA 2R7OA 4U88A 3V7RA 3VYTB 3QPSA 3J81Z 1VQ6I 5HOOA 2OU2A 4WXDA 1OLTA 2CQKA 1IF1A 4B3XA 2BY2A 3HSEA 5FFZA 3JSPA 2NYXA 3L2CA 3BG6A 5E3LA 2KISA 4ANJA 3ML6A 4BJ5C 4AIHA 2IEKA 1GUUA 4L9VA 3U1KA 2X1DA 1N78A 4HX4A 4I76A 4A3IJ 2K5CA 2P5LC 1S29A 3I71A 2W00A 2K9NA 1XG1A 5BPIA 3CJNA 5AIQA 3OYBA 2H1KA 5J8FA 2R7WA 4Y33A 2XGCA 2PJRB 1JGSA 3HSRA 3OS0A 3LL7A 2HTSA 1LFPA 4FTHA 5HLGA 2VKDA 5CLSA 1P6RA 1JKPC 1STZA 1HLVA 2KIQA 2DT5A 3DU5A 3REOA 4Q4ZF 1HBXG 3BOQA 2M8EA 2BGCA 3E6MA 2X6YA 5HLHA 1FBSA 3ASOH 1E3PA 1W36C 4Z6YA 2O8XA 4F7ZA 1EJ9A 1ZARA 4UV9A 4ZDLA 2CUJA 2TRTA 4CZCA 1X58A 1XX5A 1LNWA 2Y2ZA 1D5VA 3PSIA 4QTRA 5JI6A 4XR6A 3WTSC 3ZRGA 3JRAA 3W6KB 4OINF 1FOXA 3MFKA 3FKJA 2OD5A 3Q9VA 2JA5J 1OYIA 3M8JA 3CJTB 2DA6A 3N4MA 1TP4A 1H88C 5FKOA 4C2TA 4QWQA 1WRJA 4P9UA 3G1OA 1MNEA 1SD7A 3GX4X 3VYSB 3Q5FA 2DFHA 4U7BA 3ZMVA 3EUHC 2HQAA 3ECOA 3AKZA 3L2RA 3IHUA 1BL0A 1Y0UA 3FXJA 4HF0A 1U2WA 2HU9A 4LK1F 2HVSA 1XTAA 2TCTA 2EIJH 5TJJA 5DTDA 3JRIA 1T39A 5HS8A 3IAS2 3QYEA 5B1BH 1FOYA 3S1MJ 1QA6A 3CCLI 4A3MJ 3S16J 4R79A 1MBJA 2LY2A 3ZN1A 4B43A 1O57A 4HV5A 2ZJRF 1ZK8A 1Y8RB 3ZQLA 4LD5A 2IAIA 3WTWC 2ESHA 5L3EA 2M9HA 1X3ZB 2R7TA 4M3BA 1PP8F 5EZHA 5H20A 1QGPA 1W5SA 3HOXJ 4BDZA 2ZBKA 3LA7A 5KHDA 4PFOA 3GZ6A 1ZR4A 3OR2C 4WWCA 3F22A 3OYAA 1OCCH 2HOAA 2JVHA 2VN2A 5LBQA 3LFUA 2FBKA 1RESA 3GTLJ 4UY8I 4G6DA 1IN6A 2G7UA 3O6BB 1V5EA 5E1WA 4PK4A 3ZMUA 5D5XB 5JLWA 4PZJA 1LDKB 2OJED 2DLLA 1XSVA 5LHIA 3IC7A 4HA8A 1JTXA 1NG7A 4HW0A 1TC3C 2VONA 5BNGA 1BW5A 2D1VA 3OOUA 1N25A 1QVTA 4XONA 4BQQA 2Y9ZA 3CC2I 2F4OB 4GYIA 3SFIA 4IF4A 1I3AA 4UUVA 5GAEJ 3FBNB 2JZYA 5E3NA 3PJRA 2AQFA 3KEQA 4UB6C 1V54H 2JSCA 3FXQA 2PX9A 2L3DA 4LB6B 5EGOB 1KU9A 2ME6A 4UVBA 2Z16A 2PJRA 3RZDJ 4CA0A 3H9JA 3GYHX 1YS6A 2LLKA 2JT1A 3BJAA 4CCKA 3G6EI 1B72B 1MJBA 3BG5A 1S7OA 3CCRI 3ABKH 1J7KA 1JUSA 1VNDA 1QZEA 2WADA 3H3ZA 4B47A 4CCLA 5H2FC 3HJEA 4Q47A 4DBQA 2CMPA 2UXXA 2V79A 2D2WA 4DBRA 3M7GA 4HLYA 1WJDA 3S17J 5E1ZB 1TWAJ 2FU4A 1GV5A 1KQ0A 2QVOA 2EIMH 4LG0A 3FXLA 2L7MP 2Z1DA 1G2HA 3G2BA 1HW2A 1LB2A 2IA1A 5F0FA 3TO7A 3PL8A 2V6EA 4ON0A 3DV8A 2K3PA 5HDNA 5H6QA 1U8RA 2D5VA 2ZC2A 5ICFA 2XKPA 4U7DA 3OWTA 4O5VA 3DLAA 1GLNA 2RN7A 2O6GE 3RZOJ 3KZZA 2M34A 3BJ6A 1Z05A 3ESWB 3FZVA 2OQGA 4XIDA 5CYVA 1MBEA 3AAFA 4BY1J 2HVQA 4KMFA 3A2KA 2KKOA 1FBUA 2YUSA 2QBYB 1S7AA 2H6CA 2QZ8A 3SZPA 4WXHA 1NH3A 1GHCA 3GUDA 1D1CA 1HF0A 2R7SA 2PBIA 4I2OA 3FM3A 2B63J 4UHTA 2HS5A 2AXLA 2VI6A 2BXYA 5L3BA 2HKOA 4ZYDA 2RC4A 2QSHX 1VFCA 1YIJI 1ZKGA 2ELKA 2K85A 4L9JA 2VBWA 1BIAA 1GV2A 2ZJQF 4RS8A 1TWCJ 3DPTA 2DTZA 1A5JA 1W1WE 2VQLA 1K78B 3V7CA 1NK2P 1HKQA 1JJ6C 1WKMA 3PFYA 5CKTA 3U1DA 2HGCA 3HYIA 3E97A 2CG4A 4MEXF 2E1NA 2MG4A 4BAYA 1QBJA 1VQMI 2CW7A 3WG9A 2P7CB 1QVUA 1JKRC 3T5XA 2VQCA 1YITI 1FWZA 3EYYA 1UELB 2XB0X 3HGYA 2K86A 3K4JA 3P7NA 5C44J 3IWZA 4DGWB 2ELHA 2DOEA 1ZREA 3JCUC 1YYVA 1HSTA 4KIGA 4CUGA 1APLC 1X1CA 4HDUA 1SC7A 4XLFA 3BLYA 1RZ4A 2XROA 2M7BA 5IT9Z 3FMSA 2HOSA 2KIUA 2LTPA 3QOPA 1FBQA 2HNHA 1MMDA 3KYCB 3IL2A 5J4VA 1HW5A 2GXGA 5BQTA 2X4HA 1F1ZA 1YI2I 2QENA 1ZRCA 2CGPA 3DKWA 4RMNA 5M5WJ 3OYNA 1VQ9I 4KICA 1G3YA 4IO9F 4QSHA 1MMAA 3NARA 5EGOA 1D1BA 3IH3A 3SJMA 1KQ9A 2XAGA 3VDXA 1X2MA 3TEDA 2K7LA 2LR8A 2KFDA 1FX7A 3SXYA 1P7IA 3HOUJ 3QP5A 1B72A 4EMSA 3HHHA 3DCFA 4M72A 3L00A 1YFHA 1VQLI 4CYDA 2WWYA 1BR1A 4D7MA 2VC1A 2XAUA 3BZCA 4IXAA 5IP9J 3L2QA 2W24A 5IYCJ 3MEXA 4EQQA 5FKMA 1ZGJA 2PQ8A 1MSEC 2ZSHB 2X48A 1FYMA 3RTRA 2GOXB 3RQ4A 3J7AO 4CYCB 3GMEA 5EG0A 2EFOA 2LBFB 2CQXA 4NHJA 1AU7A 1BR2A 4L0YB 1YS7A 3EUAA 3ROUA 4GRIA 4P55A 5CQGA 1KQ8A 2CU7A 1MDMA 4IOAF 1IRFA 1FSEA 3F3XA 3IUOA 4II3A 5GADJ 2H8WA 1ZYRF 3W6VA 2XGXA 3DEEA 1JT0A 3PM1A 5F04A 2KT0A 1VTNC 2A5YB 3CP2A 3RDIA 2X6WA 4IHWA 4N4OB 3EPZA 3DQVC 1ETQA 1B1BA 2M3AA 1DU6A 3HOSA 2ADUA 2NVQJ 4O6JA 5L3DA 2DA3A 2BOLA 2PMZN 4F52A 4C2MJ 3DTEA 2B7EA 1ZRFA 2I8DA 1XSDA 5DM6F 3HKZA 2MBFA 4W1UA 3KLOA 1A35A 3OS1A 1YE9A 3GTJJ 2V1UA 3LSKA 1P92A 5LHHA 5DUKA 2KP6A 2M2EA 2NAZA 3CUQB 1PUFB 5FRNA 3S1NJ 2JWTA 4LIUA 3SEQA 2H09A 3JTGA 3HOVJ 2LF8A 1R1UA 1R5HA 2KIFA 2M30A 2FXAA 2EPFA 2IVMA 1EH7A 1TQIA 4HEA2 4MTEA 2XPUA 1SFXA 3VFZA 2QSGX 3LNQA 1SVMA 3BQYA 4FASD 2DMNA 4D1QA 4CCNA 3WE3A 4B44A 3CMYA 2BHYA 2EV5A 1YW8A 2V1DA 2IA2A 4N0BA 4WF2A 3I59A 4H4KC 1RKTA 4EJWA 2FBHA 4NBQA 4X1EA 4J19A 4ESBA 1W5CC 3ZGKA 1BC7C 1JUPA 3W3CA 4F92B 2A5WA 2R7UA 5J1YA 1WJAA 5JHUA 2ID3A 1TW3A 3Q0WA 2P8TA 4RAGA 1NK3P 5LGNA 1XMAA 2CUFA 2FA5A 3QWLA 1HKSA 2DT7B 4MFEA 3S2WA 5ED4A 2DXIA 2VXDA 1ZG1A 3I4NJ 1PUEE 4BHCA 3FXRA 1VQ7I 1OKRA 4ZJZA 4BBRJ 2F4IA 1WI9A 2VE8A 1Z1DA 5E3MA 4HDVA 4HF1A 4XLAA 2M5WA 4NC6A 2F2EA 2LG4A 2KDOA 2ME0A 3LSGA 2MW8A 4EGZA 1OJLA 2OTJI 1GXQA 2F6CA 2FNPA 1YG2A 2EZIA 3C3WA 3ZXSA 2ZB9A 2ZSIB 4DIQA 5HS9A 5FD5A 2VODA 1Z67A 1G6NA 3K4KA 3S2DJ 3OL4A 1ZG3A 1Q1VA 2WAQN 5M5XJ 4MQVA 3TKYA 3OYLA 2VXZA 3ZR8X 4PJMA 4LG3A 2GWRA 5J1UA 2XSJC 2AO9A 3HOWJ 2Y69H 4CYCA 2DU9A 1F4KA 1SANA 2E35A 1N77A 2XV4S 5IOZA 2LBFA 5B5EC 3CCUI 1VQPI 3VPRA 1V5FA 4YIFA 3CCVI 3HOYJ 2E5NA 5FD6A 1XDUA 1X4OA 4LIVA 3ZOBA 3QYBA 2KPMA 2M0CA 1Z9CA 2YU3A 3LSIA 2BY0A 1BR4A 3LA3A 4HQEA 3WODF 4HNUA 1YIOA 1Z7UA 1ZELA 3BR1A 3BP8A 2VJ5A 3HL2A 1WJCA 1B8IB 5DDGA 1FJLA 3FXKA 2JPBA 5L3CA 4NQWB 1YRNA 3K4LA 2CQNA 3D5SC 1VQOI 1MIJA 3FMQA 3AL0C 3WTUC 2LRDA 4HSTA 1ONVA 3OYIA 1FNNA 4EJUA 2HYFA 4I0BA 5GAGJ 3IWFA 2VQGA 2YSRA 3S8PA 2DFIA 3H9QA 4DW6A 1PUFA 3CUQA 2OV7A 3QYFA 2W48A 1XDSA 3EUKL 4FT8A 3TDZC 3ZQQA 1T0FA 3SQNA 1G4DA 2MYSA 2RDPA 4IQ4A 2DK8A 4H0EA 1DUXC 4OIPF 1ZN2A 3FHZA 3J80K 5J6XA 4UNOA 4BQNA 3FMRA 3GZNB 1N75A 4L5JA 4J00A 4F91B 4XLHA 2XF5A 3WTZA 4G94A 3HRMA 1ZRDA 1K6OA 2HFHA 3R4KA 2WV1A 4QPQA 4BJ6C 1UFMA 4F55A 3LQQA 4WX9A 3MN2A 2P0WA 1OQYA 4M3FA 1RNLA 1J5YA 3LFKA 1FEXA 2OUMA 1AKHB 2KIMA 2E19A 4LJZF 1IV6A 3R0AA 3HEFA 3E5XA 2ZXJA 3H3VK 3SDGA 5F6FA 1ACIA 1IXSB 3CCEI 4M6YA 2DA1A 1JE8A 3I64A 3KP7A 5AIPA 2E1OA 2K27A 3J7YJ 3CCSI 1E3HA 3IH4A 1ETOA 3IKVA 3T1BA 2L4MA 3DU6A 4BHBA 3SFZA 4D5CA 3FXMA 1P2FA 2JA2A 1TNTA 1ZHFA 3JAMK 2DTRA 3W2WA 3GTPJ 1E17A 3QU3A 1HCRA 1JI8A 5HS7A 3NWSA 2EJRA 4IJAA 4CHUA 2LP0A 5FLVA 1AA7A 5FKLA 2HVRA 3S3NA 2VIXA 2JRMA 1Z3XA 3A02A 3IAM2 5GPAA 4E7IA 3MKYB 1GXPA 4ENNA 3W2AA 1UG2A 3QP6A 2DMPA 2Z2SB 1PDNC 1IC8A 5D5WB 4Z2YA 4A0YA 1XGMA 3FK6A 1IRXA 2J5PA 1EA3A 3JRBA 4IHTA 4RA2A 2RQQA 2VLAA 3RPQA 2P6SA 2XASA 4WK8F 4YFXF 1H9GA 2FNAA 2FJ1A 2IS2A 2FOWA 3WHCA 3S15J 4L5EA 3CD6I 1G8XA 1HDDC 2QKMB 4M9XA 2IGNA 4OIRF 1H9TA 3HGGA 3V7SA 5A2QK 2BBYA 4IHVA 2CYYA 2KJBA 1W7PD 2ZXIA 1D0YA 4KA4A 1R5GA 5LD2C 3AFHA 4ZC3A 2XAHA 3ZQFA 5D8LB 4YFNF 4C2UA 1OCRH 4U0YA 3PO3J 1DQUA 1YRNB 4FETA 3QPTA 5D5VB 3C2GA 3CCMI 1SVOA 3OYKA 4ZYHA 3KYLA 2IP2A 3OYFA 1B8IA 4A3FJ 2L4AA 3BZ6A 4C3HJ 2L01A 3GWZA 4NQWA 4A3KJ 5BMZA 3L2WA 2QGUA 3L09A 4A5NA 5F27A 2O7OA 3F21A 4IOCF 1IRGA 2XHKA 1BI0A 2LVSA 4Y17A 4S0HB 3FHNA 1ORKA 3JRGA
chains in the Genus database with same CATH topology
1QZEA 4YIRX 2QSFX 1X3WB 3ESWB 1OQYA 1PVEA 2F4MB 2QSHX 2F4OB 1X3ZB 2QSGX 1TP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZE A;  4YIR X;  2QSF X;  1X3W B;  3ESW B;  1OQY A;  1PVE A;  2F4M B;  2QSH X;  2F4O B;  1X3Z B;  2QSG X;  1TP4 A; 
#chains in the Genus database with same CATH topology
 5E79 C;  1TW2 A;  5BOX A;  1MBK A;  4AM3 A;  1SEU A;  1T08 B;  2VC0 A;  4HLX A;  2L9R A;  4B8X A;  4RB1 A;  2L02 A;  3UR3 C;  3C7J A;  2NVX J;  2HOT A;  3KP3 A;  4MLO A;  3GBG A;  1YW7 A;  2KQR A;  1K6Y A;  4C9Y A;  1VZ0 A;  2LYC A;  3RKW A;  1G3S A;  2WAE A;  1JUM A;  3K1N A;  2KMU A;  4UUS B;  1W4M A;  5GPC A;  4MTD A;  3LSM A;  3RYP A;  3H0G J;  4DOZ A;  4BDY A;  3KIO A;  1A6Q A;  4UUT A;  3DTK A;  1YJN I;  2O3F A;  3TBI A;  2E1M B;  4RBO A;  1ZG5 A;  3ZQ7 A;  5FLM J;  3GTQ J;  2K9Q A;  3DKY A;  1FIA A;  1L3L A;  3G3Z A;  1AKH A;  1OR7 A;  1Y0N A;  3MWM A;  1LEA A;  4ITV A;  3KP4 A;  4L9T A;  2WB1 A;  3H5A A;  2DPD A;  1D3Y A;  3C2B A;  1UZC A;  2EIK H;  3RPU A;  4FX0 A;  2V4J C;  3D5L A;  3GLL A;  3R61 A;  4DZP A;  2K3F A;  3I55 I;  4IZZ A;  4A3J J;  3S32 A;  1OCZ H;  4AVP A;  4Y52 J;  3HZJ A;  2DPU A;  2BW3 B;  1T98 A;  3I9V 2;  4IEJ A;  3G71 I;  1OCP A;  1R6R A;  2XAQ A;  3WGI A;  2PG4 A;  4P5O A;  2GXB A;  4EM2 A;  5FLX K;  2EH3 A;  2NNN A;  5LHG A;  4C30 A;  2FQ4 A;  4A69 C;  4ENJ A;  4JYK A;  4IPA A;  3AG3 H;  1W7P A;  2W25 A;  1O3R A;  1V55 H;  4IHY A;  2RNJ A;  3OY9 A;  3VOD A;  2IXS A;  3HIF A;  2X0L A;  1OYY A;  3WGG A;  3BR2 A;  5F0C A;  1U78 A;  3J80 Z;  3BCB A;  5ILV A;  4PSX A;  1ZGW A;  3BG7 A;  1BI1 A;  4G7H F;  1MBH A;  5GAH J;  4M9S A;  4ZTJ A;  3JTH A;  3U21 A;  2KRH A;  3N97 A;  1LQ1 A;  4AYB A;  3OSG A;  5DM7 F;  3HRU A;  2KZG A;  2LH9 A;  3MVP A;  1O4X A;  2XGE A;  1BOA A;  4KMU X;  3BG9 A;  2E2I J;  1WSU A;  5K7Z A;  2ZNY A;  4L9N A;  2KL4 A;  2VE9 A;  1Z6R A;  2EZL A;  3VYR B;  3DF8 A;  2RQP A;  1U5T B;  2CSO A;  5K5Q A;  3P5J A;  3L2U A;  2IS6 A;  1ETK A;  1QHG A;  3BZK A;  3HRT A;  3HBL A;  4JX4 A;  5JLX A;  4HNT A;  4NC8 A;  2CWE A;  2CW8 A;  3LOC A;  2M4G A;  3G73 A;  4A3L J;  2NOG A;  4EVI A;  2VAS A;  4LIT A;  5DS9 A;  3P9K A;  5EDN A;  3A1Y A;  4P9F A;  3RKX A;  1JHH A;  4I99 C;  2ETH A;  5LGU A;  4XN3 A;  3JAM Z;  2PJP A;  2ZME B;  2L7Z A;  2N8G A;  3BCA A;  3TQN A;  1DPR A;  2DBB A;  2FRH A;  1DGW Y;  3KP5 A;  2VUM J;  1G3T A;  2VJJ A;  3CC4 I;  2EFN A;  1NTC A;  2K9M A;  2K4J A;  2HQ5 A;  3B73 A;  2VPR A;  2M87 A;  3OIO A;  5IP7 J;  1EH8 A;  1FPQ A;  4GXO A;  4ENK A;  4M3G A;  4U0V A;  5ICG A;  2LMD A;  3WTT C;  1USS A;  3C1D A;  3MMY B;  3OYH A;  4K2E A;  4N4N B;  2OA4 A;  2XDV A;  2MA3 A;  1T38 A;  4YII A;  2E5Z A;  3FIW A;  2LK2 A;  4BHP A;  3H5R A;  4AUX A;  2LRE A;  2XRL A;  2Z99 A;  1B9N A;  1I6H J;  1F36 A;  3QU6 A;  1G59 A;  1GDT A;  1WVR A;  2HR3 A;  1MD0 A;  2PMU A;  4FE4 A;  1EKE A;  4UUS A;  3M8E A;  4RDU A;  5LEK A;  5A2Q Z;  4RAY A;  4XL9 A;  3BTI A;  4PJL A;  3QQA A;  1YJW I;  2HZD A;  2WY8 Q;  4JX5 A;  2L7K A;  3FDY A;  4L0Z B;  4I7H A;  1PP7 U;  5L3G A;  1XC5 A;  3OYC A;  2V1X A;  3OV8 A;  2DOA A;  3OSF A;  3CMM A;  4OMY A;  1MBF A;  1SFE A;  1MNM C;  4G6Q A;  3PIP F;  4S04 A;  4CCJ A;  1Y39 A;  4AWX B;  5FFX A;  1MMG A;  1S72 I;  2F5V A;  2DQR A;  4BQA A;  3AG1 H;  4DJA A;  5C4J J;  2LSO A;  4D5F A;  5K7H A;  5D6F A;  3L2V A;  3Q3S A;  5IP6 A;  3CTA A;  2DN0 A;  2I10 A;  1ZLK A;  5CJ9 A;  1V5G A;  1SD6 A;  2GA1 A;  3C18 A;  1KON A;  1IXC A;  2ZJ2 A;  4KIB A;  1X19 A;  1VQ5 I;  4A3B J;  2JA8 J;  4BBS J;  3HHG A;  4KT5 C;  1O3T A;  4IHS A;  3DTI A;  4HX7 A;  4RB0 A;  2LY9 A;  1G3W A;  2A05 A;  1RRJ A;  1KYZ A;  4B4C A;  5ILS A;  4C3J J;  1QZY A;  2CV0 A;  2E7W A;  2K9L A;  3DBR B;  5DUI A;  4EGY A;  3MKZ A;  1HA8 A;  5K5R A;  4A5M A;  3K7A J;  3ZMD A;  5D4R A;  4LLG F;  1J59 A;  2E2H J;  5HLI A;  3NEU A;  2EFQ A;  4QIW N;  2EFP A;  2BY3 A;  4EJV A;  4MO7 A;  1HW1 A;  1XGS A;  2UXN A;  1LVK A;  3GFI A;  2G0E A;  3I58 A;  1I5Z A;  2F5E A;  2F48 A;  3I53 A;  4PSW A;  2Q2E B;  2Q8K A;  4ZYG A;  4BE1 A;  1JJ8 C;  1J75 A;  3K1M A;  3M1C A;  1OPC A;  2V1N A;  2ACJ A;  4GFB A;  1U5T A;  4LLN A;  2ECB A;  1VQN I;  1S8N A;  4UVC A;  5DCF A;  4BL0 B;  4DYC A;  2Z5U A;  2GOM A;  2W57 A;  4D7N A;  3QOE A;  4OAZ A;  2RRE A;  3SYT A;  1PVE A;  3CO6 C;  1BOB A;  2QKL B;  3FKI J;  5HDK A;  2IW5 A;  1XMX A;  3ONQ A;  1H0M A;  2WY7 Q;  2XUB A;  3CES A;  3KCC A;  5FLX Z;  5CVV A;  1YQA A;  1UMQ A;  5M3M J;  3JR9 A;  5HLT A;  2ZME A;  3MKW B;  3CME I;  1IG7 A;  4KIF A;  3F8F A;  2Y30 A;  2D45 A;  4RAF A;  5LRS A;  5GTI C;  1R4N B;  2W4S A;  4G8X A;  1ZH5 A;  4Y4R A;  4GO1 A;  2CQ7 A;  2O8K A;  3HKZ N;  2MC3 A;  4E7L A;  3IV5 A;  4M9Z A;  4KN4 X;  3GO5 A;  1SAU A;  4FHT A;  2PLY A;  4KYW A;  5DV5 A;  1SD4 A;  2NXN B;  2Y9Y A;  2E34 A;  1R36 A;  4HSR A;  3O8G A;  2FD5 A;  1ERD A;  5FJ8 J;  2Z33 A;  2A6H F;  3GCM A;  1ENH A;  4DZJ A;  1AOY A;  3ZQH A;  3WTX C;  2O03 A;  1J09 A;  4U0W A;  1X1D A;  3TP3 A;  4YRV A;  1ETV A;  1X1A A;  4BXF A;  2AQE A;  2EQR A;  2X1E A;  5J8C A;  2RGV A;  4BJT A;  1RIO H;  1I1G A;  3S3O A;  2R7F A;  2OTL I;  2L2O A;  1KZH A;  1IZ1 A;  3K69 A;  5JHF A;  4XRM A;  1LEB A;  3QAH A;  1LPQ A;  2QBY A;  4KJZ A;  1F43 A;  3KFW X;  1FYL A;  3ABM H;  2O9L A;  4GDF A;  2HWV A;  4RGU A;  5GP9 A;  4AID A;  4F93 B;  1JGG A;  3D0S A;  5K7F A;  3E3V A;  5FO5 A;  4IRH A;  2BE5 F;  2BY1 A;  2EB7 A;  1IGN A;  1ETW A;  1UG0 A;  1UCR A;  2JK3 A;  5D5U B;  1Z21 A;  2NS7 A;  2LFB A;  2JRT A;  3TP0 A;  3SDB A;  4EM0 B;  2VKH A;  1YLF A;  2YS9 A;  3BT9 A;  1A6I A;  1X4P A;  4X6A J;  1QPM A;  2GZW A;  2NVY J;  2VT2 A;  4GGG A;  4EAT A;  2W84 A;  1TWG J;  1K78 A;  1IXR C;  1BIB A;  3LST A;  3NAU A;  2GM4 A;  2ZJP F;  4R1H A;  4U87 A;  1SMT A;  2IS1 A;  3ERM A;  4HBL A;  5TRD A;  3JRE A;  2GLO A;  4BYY A;  4I02 A;  1S9H A;  2XB5 A;  4XMY A;  4JOM A;  1LDD A;  3BR6 A;  3OYJ A;  2D1H A;  3O2P E;  5CVU A;  3DBL B;  3WU0 A;  4RM3 A;  3TMO A;  1FYK A;  2GAU A;  2LNB A;  3DEW A;  1ETY A;  1T8I A;  4L18 B;  4HQM A;  2LD5 A;  3OYG A;  3MZH A;  4BU2 A;  2ZFU A;  1S3J A;  1REP C;  3LWF A;  3NWT A;  5B3S H;  3CF5 F;  1Z3Y A;  2P81 A;  2M0M A;  5M5Y J;  2HDC A;  4G6T B;  2CV2 A;  2I5U A;  2X6X A;  2MFZ A;  2VJ4 A;  2ZCW A;  1ZQ3 P;  2Q2E A;  3TO9 A;  4XRS A;  3LMM A;  5J1R A;  1BN5 A;  3CJR B;  2EK5 A;  1XGN A;  1KU2 A;  3K1P A;  1T56 A;  2F4M B;  3P9C A;  1BJZ A;  1U9O A;  2EA2 A;  3FXU A;  5J47 A;  2BYV E;  4M74 A;  3TL4 X;  4G7Z F;  1WH5 A;  1TLH B;  3PUB A;  4HYE A;  2DFF A;  1MMS A;  4Y7N J;  3R0J A;  2XKO A;  4CDG A;  3PQK A;  1D8K A;  1LKX A;  1KU7 A;  1P4X A;  1U0J A;  3KYD B;  2V9V A;  3IP4 B;  3DXJ F;  1OMI A;  4N9H A;  3OYD A;  2PMH A;  2LF7 A;  3HSF A;  3OR1 C;  2W82 A;  1L0O C;  2EFW A;  3DKX A;  4XN0 A;  1P7J A;  2P6T A;  4ZH4 F;  4QPO A;  5IOY A;  2CQQ A;  2XPV A;  2BZT A;  2R7V A;  2IGO A;  3RKY A;  1MJA A;  4IKF A;  2VQH A;  1X3U A;  1SAX A;  3SZG A;  1I1S A;  2VBX A;  2H94 A;  1FTZ A;  2NVT J;  2QM3 A;  3S93 A;  2MH2 A;  1ON2 A;  1SMY F;  2ZFW A;  4OAY A;  3PNT A;  3K4B A;  2LDU A;  3VSL A;  2X51 A;  2FML A;  1Q1H A;  2ZO4 A;  4N9I A;  1XPX A;  1WQ2 A;  1NHA A;  1Y56 A;  3I54 A;  3P9I A;  2CUE A;  4PUS A;  3VOE A;  1AWC A;  1CF7 B;  5H6R A;  3O3K A;  3DWL E;  2MD0 A;  2UUZ A;  2IJL A;  1ZAO A;  1LE8 B;  1ULY A;  1JXS A;  2R5Y B;  1CQT A;  2VOO A;  1XB4 A;  4YEJ A;  4BS9 A;  1ZR2 A;  4FCY A;  5EEH A;  3OOP A;  3W2V A;  2O5R A;  2Y75 A;  2X85 A;  2W85 A;  2VJI A;  5HNH A;  3CQZ J;  1Z77 A;  4XLN F;  1P9Q C;  1O7F A;  2V9P A;  2CH0 A;  5DCM B;  4IVN A;  4CZZ A;  2DA2 A;  3HUG B;  1UHM A;  3VYU B;  1LJ9 A;  1FIP A;  2A6T A;  1Z0X A;  4WCG A;  3EQL F;  4NC7 A;  4XKW A;  2KLO A;  1DU0 A;  2BVM A;  1X1B A;  4ZZD A;  5KVR A;  2E2J J;  4HAM A;  4FX4 A;  1O7L A;  5BS6 A;  5FKN A;  2QEX I;  1K4S A;  2JSP A;  3F9K A;  2GXA A;  3ZN0 A;  2DAO A;  3CJQ B;  3ELK A;  3KE2 A;  3OIQ A;  1I27 A;  3E5U A;  3WGH A;  3ZCO A;  2X9D A;  3CDL A;  3JRD A;  1BI2 A;  4YG2 F;  4ZTF A;  1YX3 A;  4ESF A;  1LFB A;  2MLG A;  2R3S A;  4X0G A;  5TGT A;  2CV1 A;  3AG4 H;  4UXN A;  1JHF A;  3CLQ A;  1R9T J;  1W0U A;  3JSO A;  2R5Z B;  3I5U A;  4XLP F;  1UST A;  2KHM A;  5J4Y A;  2RV8 A;  5EYR A;  3KZI C;  4E7Z A;  3BC8 A;  2OCC H;  4DYQ A;  2LC2 A;  1Y1V J;  1HDP A;  4IX7 A;  2DW4 A;  5FRO A;  2UWM A;  3OL3 A;  2FUG 2;  1ZLJ A;  5JVG F;  3CUQ C;  4IQJ A;  5FGM A;  2Y48 A;  4CIC A;  5C4X J;  4KDP A;  5D4S A;  3A0B C;  3A03 A;  4HRI A;  3JRC A;  4YEL A;  5LFA A;  2B0L A;  2F5F A;  3F72 A;  1T0F C;  2K40 A;  3H1C A;  4CCM A;  4JQF A;  1WH7 A;  2B9S A;  2TDX A;  1RR7 A;  2DA4 A;  2H8R A;  3FX3 A;  1T95 A;  1W5T A;  4XOR A;  3WTV C;  5FKK A;  2FOK A;  4BNC A;  1V3F A;  3S3M A;  1FY7 A;  3CZ6 A;  3UKG A;  3E6B A;  2XVC A;  2QQA A;  4XKB A;  5M3F J;  1ON1 A;  2L9S A;  1IRZ A;  2E60 A;  2VPL A;  1ZTR A;  1J2X A;  1MGT A;  1IN5 A;  2EA4 A;  3RPU D;  3OYE A;  1V4R A;  4R8H A;  4HX8 A;  3LSJ A;  4A2U A;  3ZMZ A;  1DGR M;  2DYS H;  4M3E A;  2DDA A;  3V8K A;  3LAJ A;  1VQ4 I;  2DJN A;  3F8M A;  2AS5 F;  5LGT A;  2FE3 A;  1IDY A;  2OPT A;  3H92 A;  1R22 A;  3JRF A;  2R7X A;  2Q0O A;  4EJO A;  4A3E J;  2P7V B;  3ISP A;  2A61 A;  1SFO J;  3HPG A;  4OU0 A;  2Z3Y A;  3TDU C;  3H9G A;  4O3M A;  3RJP A;  1ITY A;  2ID6 A;  4OWR B;  3WU2 C;  2E1C A;  4JK1 X;  5EEG A;  3HDD A;  1WCM J;  1FSH A;  1CF7 A;  3BJO A;  1JT6 A;  3RIR A;  1LE8 A;  3X2Q H;  2R5Y A;  2QF7 A;  2Y0S A;  2COB A;  4RAZ A;  1HKT A;  2DT6 A;  3HTS B;  1WZ2 A;  1IO2 A;  3WG7 H;  4OIQ F;  2E36 A;  3BQZ A;  2WV0 A;  5E1X A;  1JKQ C;  3B6C A;  1IV8 A;  3LQR A;  3GTO J;  2WTE A;  3OYM A;  1R00 A;  2RVC A;  2GQQ A;  3CDH A;  1U3E M;  3K6G A;  1XN7 A;  2IS4 A;  4HPQ A;  4NNJ A;  5DCM A;  3CDI A;  3EUH A;  1DDN A;  2OCE A;  3HUG A;  3CF2 A;  3BTC A;  2WB1 N;  2DO7 A;  2BHZ A;  4AC0 A;  4XIC A;  4PFP A;  3LSH A;  1MSF C;  4AD9 A;  4W97 A;  1O3S A;  1OYW A;  2FX0 A;  3ZQC A;  4F3Q A;  3F6O A;  3OS2 A;  2XC7 A;  5HDG A;  1S5L C;  4IHX A;  3QOD A;  1MJ9 A;  1IUY A;  4ASN A;  1RET A;  2XGD A;  4M3D A;  3FM5 A;  4QLC U;  5JFR A;  2WC2 A;  1XCV A;  3L7W A;  2XPW A;  3CMA I;  2OQR A;  1GVJ A;  2VT3 A;  1P4A A;  3V8J A;  1YW9 A;  4LG0 B;  2DCE A;  3M07 A;  1HC8 A;  1FP1 D;  3K10 A;  3TW6 A;  1POG A;  1QO0 D;  4Q48 A;  1RC9 A;  3PNV A;  3HG9 A;  3CCY A;  2DMQ A;  2QUF A;  3I4P A;  4PCQ A;  4XKC A;  5IY5 H;  1FOW A;  4ZYE A;  1R49 A;  2WA0 A;  4LB5 A;  2XAJ A;  3JW4 A;  1XGO A;  2LY1 A;  4Y3O A;  2DYR H;  4ETS A;  2R5Z A;  1R5I D;  3I4M J;  1RUN A;  3Q9S A;  2X6O A;  2F5C A;  4AYB N;  4AIJ A;  3DFG A;  1TTY A;  4XSZ F;  2BEO A;  4KFC A;  5F64 A;  4XQF A;  3EDP A;  4UVA A;  3F0C A;  3BRO A;  4XK4 A;  5IT9 K;  5KCM A;  3M1E A;  1X3W B;  1QPI A;  5J40 A;  2G7H A;  2VBY A;  4XSX F;  3ZQG A;  5IPA A;  4XOP A;  3K4M A;  3MZY A;  5EZG A;  5B66 C;  2YU9 J;  1E0E A;  3V42 A;  2WBM A;  1HQC A;  2HXI A;  5LEJ A;  4I0A A;  2AHQ A;  3F8N A;  4ESJ A;  2M7A A;  1PJR A;  3CLO A;  5E8G A;  1MND A;  1WPK A;  3WU1 B;  1X2N A;  3A01 B;  3G4S I;  4FIS A;  3N05 A;  2QLZ A;  4CGZ A;  2JA7 J;  1SFU A;  3E1S A;  1PYV A;  4RB2 C;  2CFO A;  2M1B A;  1H89 C;  1WJ5 A;  3DP7 A;  2X1C A;  1OR7 C;  2FBI A;  3KLN A;  5ERI A;  2DK5 A;  1YO5 C;  3CUO A;  5B1A H;  5CQE A;  3K2Z A;  3UNG C;  3F23 A;  2MAB A;  1D1A A;  3ZQI A;  4BKX A;  1Z6T A;  1IN4 A;  2J5O A;  1X1P A;  2LKS A;  3MKL A;  3RSN A;  3NQO A;  2UZK A;  3ZPL A;  4LGW A;  2HI3 A;  1S6L A;  2CUZ A;  4A12 A;  5LRR A;  4E7H A;  1BC8 C;  1YX5 A;  2JPC A;  1XSX A;  4CSW A;  2ISZ A;  2NRA C;  4MEY F;  2W1O A;  2R0Q C;  3E5Q A;  4MHG A;  1FMV A;  1UJ8 A;  2EIN H;  2F5D A;  2IGM A;  2NOJ B;  2M45 A;  3HB9 A;  3K2A A;  3K9T A;  4PJJ A;  4UB8 C;  2UV1 A;  4E4H A;  2OC6 A;  2Q1Z B;  2L7F P;  1OIS A;  1TZL A;  1I39 A;  2CO5 A;  5J3L A;  4YFK F;  1SFK A;  4PJN A;  2H27 A;  4E7S A;  1KU3 A;  3U9G A;  3V4G A;  1U6G A;  4BEH B;  4IRI A;  2R93 J;  4B48 A;  2W7N A;  1B59 A;  5KK1 A;  1F9N A;  4XRS G;  3VB2 A;  2JMW A;  4OMZ A;  3RKQ A;  3T8R A;  4A6E A;  2QCO A;  5F1R A;  3ULQ B;  2IT0 A;  3F6V A;  1KYW A;  4I6Z A;  2HOE A;  2MGQ A;  3DBH B;  1FT9 A;  3KX2 A;  3J7Z I;  4PGG A;  2HXO A;  2EV0 A;  2L5Q A;  1RKW A;  1WWX A;  3FXO A;  4JX6 A;  1DP3 A;  3PUF A;  2HKX A;  2K02 A;  4V2F A;  3FWE A;  5E3O A;  1F5T A;  4G12 A;  4P1W A;  3HM5 A;  4P96 A;  4MFD A;  1W0T A;  3PFI A;  3RCO A;  3LSP A;  1FP2 A;  5EG0 B;  4DYR A;  5E18 F;  3R60 A;  4AIK A;  1CGP A;  3GZ5 A;  4L5I A;  4B1R A;  1QRY A;  2OAZ A;  2R7Q A;  4E70 A;  1QNT A;  4Y15 A;  1C0W A;  1MDM B;  4MIM A;  3WHB A;  2JVG A;  4ZDP A;  4WXC A;  4DQ2 A;  2XF7 A;  4YIR X;  2K4B A;  3K0L A;  3KEO A;  2XRN A;  1B6A A;  4BY7 J;  3KET A;  2IPQ X;  2E71 A;  4GYG A;  1Y8Q B;  4D9J A;  1TL8 A;  3T0Y A;  2KZV A;  4M73 A;  2HDD A;  2DMU A;  1BA5 A;  4I98 B;  1TT5 B;  2HQN A;  3CP8 A;  5HOD A;  2BW3 A;  2PN6 A;  2EIL H;  4BUP A;  4KIS A;  2YX7 A;  3EYI A;  4UV8 A;  3A4C A;  4B3A A;  2QA4 I;  1ODD A;  2L9N A;  5CPR B;  3PNY A;  3B6A A;  3KP2 A;  3COA C;  3HXL A;  4RB3 C;  4G7O F;  4GCV A;  2M8G X;  2XF6 A;  3TOA A;  1A36 A;  3LAP A;  2V26 A;  1K61 A;  3U2R A;  3ABU A;  1UAA A;  1BI3 A;  3H0D A;  3GFJ A;  2HEO A;  4A0Z A;  3CO7 C;  2VOP A;  1VI0 A;  1RI7 A;  4NB5 A;  3OMY A;  2PI0 A;  3DLL F;  5CVJ A;  2Y31 A;  3A01 A;  2E1M C;  3FF5 A;  1R1V A;  5AON A;  2QQ9 A;  3ABT A;  2Y0M A;  3H35 A;  5KAF C;  2H1L A;  2RKH A;  1TT0 A;  4AVZ A;  2DOD A;  3GVA A;  1IJW C;  3I59 B;  2STW A;  2KDZ A;  1IDZ A;  3K4C A;  1TWF J;  2GBY A;  3HTU A;  4BE2 A;  1BW6 A;  3Q0V A;  4V19 K;  5DYM A;  3BTJ A;  1Z7L A;  2EZH A;  2JJ7 A;  3GW2 A;  3EET A;  4TV7 A;  1I3Q J;  3WE2 A;  2L0K A;  3D1N I;  2O61 A;  1EH6 A;  2A68 F;  2M4K A;  3TOB A;  2DFE A;  3PO2 J;  1GT0 C;  4XBF A;  2EBI A;  2XIG A;  2IGK A;  2EWN A;  3K70 D;  1OCO H;  3ABL H;  3BPX A;  5DD8 A;  1FC3 A;  4PGH A;  3GTK J;  4LOC A;  3S1Q J;  1P4W A;  2P5K A;  3S1R J;  1Z91 A;  2A3S A;  2OBP A;  3CCJ I;  3TGN A;  2GA2 A;  1D5Y A;  4ABZ A;  4Q5S F;  2XAF A;  2ZKZ A;  3FIS A;  4FE7 A;  3I56 I;  4PDK A;  1IW7 F;  3OIP A;  3ERE D;  2JQ7 A;  4LK0 F;  3RI4 A;  1FTT A;  4BEH A;  1IUF A;  1HSJ A;  3L9F A;  3O8H A;  3GTG J;  5HNF A;  1EF4 A;  1T6S A;  3BPV A;  2AXT C;  3KPH A;  4PJ0 C;  1OCT C;  4JP0 A;  1GVD A;  2ESN A;  2EV6 A;  4FQG A;  3W6J B;  3BR3 A;  1I50 J;  3AL0 B;  2QYO A;  2BVL A;  4BXU A;  4II2 A;  4KUM A;  2DOF A;  1YJ9 I;  4BQO A;  2ZXH A;  2ZXW H;  4MNU A;  2DA5 A;  2KRF A;  4XOT A;  1SVL A;  4ZYA A;  4C3I J;  1U5T C;  2LOO A;  1D0X A;  5BPD A;  2G9W A;  2FF4 A;  2O0Y A;  4A3C J;  4RLQ A;  2C6Y A;  3I3L A;  4CCO A;  1JTY A;  3E6D A;  1NG6 A;  5KAI C;  1XCB A;  2R4G A;  4RGX A;  5LLQ A;  3M3Y J;  1WFX A;  2JN6 A;  4A3D J;  4A3G J;  1E2X A;  1BBY A;  4IL6 C;  5K5O A;  2HTJ A;  4KN7 X;  2FMY A;  3LSR A;  2ZME C;  4OOI A;  3GXO A;  1XS9 A;  2FQ3 A;  2ISY A;  5CVR A;  2NS0 A;  5ILU A;  1K4T A;  1D8J A;  3BDD A;  4KNY A;  5IYB J;  1S7E A;  1FMW A;  3Q0U A;  2V9K A;  3M8F A;  4V2G A;  3NRV A;  3E7L A;  3HRS A;  1DPU A;  3BY6 A;  3IRR A;  2JTV A;  4XM3 A;  1AHD P;  3G1M A;  4NUB A;  4RM2 A;  3PSF A;  3QRF F;  5IYD J;  3MAJ A;  1DP7 P;  3GLX A;  4ZDO A;  1WGX A;  1M1E B;  3HC7 A;  2QQB A;  3CCQ I;  2EZK A;  2PFB A;  1TBX A;  3IRQ A;  2IRF G;  2STT A;  1BJA A;  4EV0 A;  2HPM A;  1WJB A;  2LKP A;  2MSY A;  3SZT A;  4BE0 A;  1MZB A;  3VSK A;  5F1J A;  2OZ6 A;  5CVI A;  1QQI A;  2H6B A;  3ZMS A;  1TQM A;  3PIO F;  2CFX A;  2ZNZ A;  4E7K A;  2ELJ A;  2DDB A;  3J7A Y;  4IRG A;  3TW7 A;  2VB6 A;  3J81 K;  5E17 F;  1JKO C;  2A07 F;  4I01 A;  1UHS A;  1WHU A;  1HOM A;  2Z9O A;  1SD5 A;  4ENM A;  4BXX J;  3A0H C;  3K4N A;  2R92 J;  2ICW G;  4JBA A;  1A04 A;  2VKV A;  4XLE A;  2NVU B;  1ZGA A;  4EEF G;  3HOZ J;  3DPL C;  1XD7 A;  2PMZ A;  1D0Z A;  2MH9 A;  3AG2 H;  2R7R A;  1HXD A;  4KIT B;  3BR5 A;  3GF2 A;  1H8A C;  2PEX A;  4M6V A;  4NDL A;  3CC7 I;  4M6X A;  1J0R A;  2GIV A;  4D0P A;  2VBZ A;  3BWG A;  5IT3 A;  4HG2 A;  1R4M B;  2VL8 A;  2FSW A;  1B4A A;  2V6C A;  5D6E A;  3K70 C;  6PAX A;  4HZF A;  1R7J A;  3QPH A;  4J01 A;  1RR8 C;  1MMN A;  2HQR A;  2OF7 A;  2FEZ A;  4CO8 A;  4KT6 A;  2DA7 A;  3L1P A;  1QZZ A;  1U9N A;  2HZT A;  2JUC A;  2JA6 J;  3RQI A;  4HF2 A;  5ICC A;  1RPW A;  3GFM A;  1R23 A;  4XKV A;  3VWB A;  3GTM J;  1BM9 A;  1YHQ I;  2P4W A;  3KEY A;  1I6X A;  3LA2 A;  4RLF A;  1VQ8 I;  2R7Z J;  2MD5 A;  3KZY A;  5JVT A;  1VQK I;  2VKE A;  3S2H J;  5F08 A;  1IN7 A;  1Y1W J;  3C2H A;  2OZU A;  4A6D A;  3M9A A;  3VEP A;  1WJE A;  5K1Y A;  3GEZ A;  5FRM A;  3T8T A;  5EF6 A;  2P5V A;  2V7F A;  3H5N A;  1U8B A;  5ICE A;  1FLI A;  1OFC X;  9ANT A;  3RYR A;  2YR2 A;  2L54 A;  4BAC A;  1YOV B;  3M4O J;  4B09 A;  4E6K G;  5F0H A;  4LLL A;  1QU3 A;  4HNV A;  4XRF A;  2IBD A;  1UB9 A;  4EM1 A;  2YPR A;  1YTY A;  5JR3 A;  2CRG A;  2RNG A;  5L3F A;  3D5R C;  2BXZ A;  3HOT A;  3DEU A;  1LUJ B;  4A0X A;  3G1L A;  3KP6 A;  2LKX A;  2COM A;  2KRC A;  4I09 A;  4G9Y A;  4BGD A;  1W36 D;  1E3O C;  1MH4 A;  4BH9 A;  3SHF A;  3MZ8 A;  2K9S A;  2WAQ A;  1MH3 A;  1T2K A;  1K83 J;  1UHW A;  1KGS A;  3DPU A;  1FZP B;  1Y6I A;  5DEQ A;  2QWW A;  2DJI A;  5EEA A;  1A31 A;  3MCZ A;  1K79 A;  2YX4 A;  3F8B A;  1LFU P;  2IA0 A;  3V8L A;  2DQL A;  3BTL A;  3GFL A;  2GIZ A;  3ZMT A;  5E8I A;  1MBG A;  2E7X A;  4CH7 A;  4ZZL A;  4CXF A;  4RGR A;  3ASN H;  3IH2 A;  1VF9 A;  2DMT A;  4EJT A;  1ETX A;  1R58 A;  4OIO F;  3H36 A;  4LFU A;  5HVQ C;  4XNF A;  3WTY C;  2KJC A;  1J9I A;  3B02 A;  3TO6 A;  3E6C C;  4HOB A;  3SEZ A;  1FOK A;  3IKT A;  1R71 A;  1KA8 A;  4XLC A;  1LVA A;  4E7J A;  1MKM A;  1LDJ A;  1TQP A;  2ECC A;  2WAF A;  4HV6 A;  3BR0 A;  4Y13 A;  2NS8 A;  4LMY A;  2BV6 A;  2CW0 F;  3F8C A;  3JRH A;  3H3U A;  2HYG D;  5D8K B;  2JUG A;  2HPI A;  1QHH D;  1TNS A;  2CS3 A;  3ZP5 A;  5DD4 A;  2L9V A;  2NNY A;  1XMK A;  3PQJ A;  1MW7 A;  3MD2 A;  2A69 F;  1R1T A;  3QPL A;  2HYJ A;  1WI3 A;  3FBI B;  4A93 J;  4MGR A;  3ECH A;  2QQ8 A;  2DI3 A;  5EJC A;  2QSF X;  3MQ0 A;  3E0J B;  1K7A A;  2Y0S N;  4M71 A;  2HDW A;  4MQ9 F;  2RAE A;  1B9M A;  1WJF A;  1IAW A;  4RGS A;  2MLK A;  5FB2 A;  2R7D A;  3R6S A;  4AU7 A;  5TIS C;  5GTH C;  2A6E F;  5C3E J;  1W7P B;  3S14 J;  1EV7 A;  3FK7 A;  2CJJ A;  2XSD C;  1IN8 A;  5E20 A;  2MC4 A;  3I0T A;  5KNL A;  4S05 A;  1T33 A;  4DNC A;  1TWH J;  3BG3 A;  3HPH A;  1RUO A;  1O3Q A;  2R7O A;  4U88 A;  3V7R A;  3VYT B;  3QPS A;  3J81 Z;  1VQ6 I;  5HOO A;  2OU2 A;  4WXD A;  1OLT A;  2CQK A;  1IF1 A;  4B3X A;  2BY2 A;  3HSE A;  5FFZ A;  3JSP A;  2NYX A;  3L2C A;  3BG6 A;  5E3L A;  2KIS A;  4ANJ A;  3ML6 A;  4BJ5 C;  4AIH A;  2IEK A;  1GUU A;  4L9V A;  3U1K A;  2X1D A;  1N78 A;  4HX4 A;  4I76 A;  4A3I J;  2K5C A;  2P5L C;  1S29 A;  3I71 A;  2W00 A;  2K9N A;  1XG1 A;  5BPI A;  3CJN A;  5AIQ A;  3OYB A;  2H1K A;  5J8F A;  2R7W A;  4Y33 A;  2XGC A;  2PJR B;  1JGS A;  3HSR A;  3OS0 A;  3LL7 A;  2HTS A;  1LFP A;  4FTH A;  5HLG A;  2VKD A;  5CLS A;  1P6R A;  1JKP C;  1STZ A;  1HLV A;  2KIQ A;  2DT5 A;  3DU5 A;  3REO A;  4Q4Z F;  1HBX G;  3BOQ A;  2M8E A;  2BGC A;  3E6M A;  2X6Y A;  5HLH A;  1FBS A;  3ASO H;  1E3P A;  1W36 C;  4Z6Y A;  2O8X A;  4F7Z A;  1EJ9 A;  1ZAR A;  4UV9 A;  4ZDL A;  2CUJ A;  2TRT A;  4CZC A;  1X58 A;  1XX5 A;  1LNW A;  2Y2Z A;  1D5V A;  3PSI A;  4QTR A;  5JI6 A;  4XR6 A;  3WTS C;  3ZRG A;  3JRA A;  3W6K B;  4OIN F;  1FOX A;  3MFK A;  3FKJ A;  2OD5 A;  3Q9V A;  2JA5 J;  1OYI A;  3M8J A;  3CJT B;  2DA6 A;  3N4M A;  1TP4 A;  1H88 C;  5FKO A;  4C2T A;  4QWQ A;  1WRJ A;  4P9U A;  3G1O A;  1MNE A;  1SD7 A;  3GX4 X;  3VYS B;  3Q5F A;  2DFH A;  4U7B A;  3ZMV A;  3EUH C;  2HQA A;  3ECO A;  3AKZ A;  3L2R A;  3IHU A;  1BL0 A;  1Y0U A;  3FXJ A;  4HF0 A;  1U2W A;  2HU9 A;  4LK1 F;  2HVS A;  1XTA A;  2TCT A;  2EIJ H;  5TJJ A;  5DTD A;  3JRI A;  1T39 A;  5HS8 A;  3IAS 2;  3QYE A;  5B1B H;  1FOY A;  3S1M J;  1QA6 A;  3CCL I;  4A3M J;  3S16 J;  4R79 A;  1MBJ A;  2LY2 A;  3ZN1 A;  4B43 A;  1O57 A;  4HV5 A;  2ZJR F;  1ZK8 A;  1Y8R B;  3ZQL A;  4LD5 A;  2IAI A;  3WTW C;  2ESH A;  5L3E A;  2M9H A;  1X3Z B;  2R7T A;  4M3B A;  1PP8 F;  5EZH A;  5H20 A;  1QGP A;  1W5S A;  3HOX J;  4BDZ A;  2ZBK A;  3LA7 A;  5KHD A;  4PFO A;  3GZ6 A;  1ZR4 A;  3OR2 C;  4WWC A;  3F22 A;  3OYA A;  1OCC H;  2HOA A;  2JVH A;  2VN2 A;  5LBQ A;  3LFU A;  2FBK A;  1RES A;  3GTL J;  4UY8 I;  4G6D A;  1IN6 A;  2G7U A;  3O6B B;  1V5E A;  5E1W A;  4PK4 A;  3ZMU A;  5D5X B;  5JLW A;  4PZJ A;  1LDK B;  2OJE D;  2DLL A;  1XSV A;  5LHI A;  3IC7 A;  4HA8 A;  1JTX A;  1NG7 A;  4HW0 A;  1TC3 C;  2VON A;  5BNG A;  1BW5 A;  2D1V A;  3OOU A;  1N25 A;  1QVT A;  4XON A;  4BQQ A;  2Y9Z A;  3CC2 I;  2F4O B;  4GYI A;  3SFI A;  4IF4 A;  1I3A A;  4UUV A;  5GAE J;  3FBN B;  2JZY A;  5E3N A;  3PJR A;  2AQF A;  3KEQ A;  4UB6 C;  1V54 H;  2JSC A;  3FXQ A;  2PX9 A;  2L3D A;  4LB6 B;  5EGO B;  1KU9 A;  2ME6 A;  4UVB A;  2Z16 A;  2PJR A;  3RZD J;  4CA0 A;  3H9J A;  3GYH X;  1YS6 A;  2LLK A;  2JT1 A;  3BJA A;  4CCK A;  3G6E I;  1B72 B;  1MJB A;  3BG5 A;  1S7O A;  3CCR I;  3ABK H;  1J7K A;  1JUS A;  1VND A;  1QZE A;  2WAD A;  3H3Z A;  4B47 A;  4CCL A;  5H2F C;  3HJE A;  4Q47 A;  4DBQ A;  2CMP A;  2UXX A;  2V79 A;  2D2W A;  4DBR A;  3M7G A;  4HLY A;  1WJD A;  3S17 J;  5E1Z B;  1TWA J;  2FU4 A;  1GV5 A;  1KQ0 A;  2QVO A;  2EIM H;  4LG0 A;  3FXL A;  2L7M P;  2Z1D A;  1G2H A;  3G2B A;  1HW2 A;  1LB2 A;  2IA1 A;  5F0F A;  3TO7 A;  3PL8 A;  2V6E A;  4ON0 A;  3DV8 A;  2K3P A;  5HDN A;  5H6Q A;  1U8R A;  2D5V A;  2ZC2 A;  5ICF A;  2XKP A;  4U7D A;  3OWT A;  4O5V A;  3DLA A;  1GLN A;  2RN7 A;  2O6G E;  3RZO J;  3KZZ A;  2M34 A;  3BJ6 A;  1Z05 A;  3ESW B;  3FZV A;  2OQG A;  4XID A;  5CYV A;  1MBE A;  3AAF A;  4BY1 J;  2HVQ A;  4KMF A;  3A2K A;  2KKO A;  1FBU A;  2YUS A;  2QBY B;  1S7A A;  2H6C A;  2QZ8 A;  3SZP A;  4WXH A;  1NH3 A;  1GHC A;  3GUD A;  1D1C A;  1HF0 A;  2R7S A;  2PBI A;  4I2O A;  3FM3 A;  2B63 J;  4UHT A;  2HS5 A;  2AXL A;  2VI6 A;  2BXY A;  5L3B A;  2HKO A;  4ZYD A;  2RC4 A;  2QSH X;  1VFC A;  1YIJ I;  1ZKG A;  2ELK A;  2K85 A;  4L9J A;  2VBW A;  1BIA A;  1GV2 A;  2ZJQ F;  4RS8 A;  1TWC J;  3DPT A;  2DTZ A;  1A5J A;  1W1W E;  2VQL A;  1K78 B;  3V7C A;  1NK2 P;  1HKQ A;  1JJ6 C;  1WKM A;  3PFY A;  5CKT A;  3U1D A;  2HGC A;  3HYI A;  3E97 A;  2CG4 A;  4MEX F;  2E1N A;  2MG4 A;  4BAY A;  1QBJ A;  1VQM I;  2CW7 A;  3WG9 A;  2P7C B;  1QVU A;  1JKR C;  3T5X A;  2VQC A;  1YIT I;  1FWZ A;  3EYY A;  1UEL B;  2XB0 X;  3HGY A;  2K86 A;  3K4J A;  3P7N A;  5C44 J;  3IWZ A;  4DGW B;  2ELH A;  2DOE A;  1ZRE A;  3JCU C;  1YYV A;  1HST A;  4KIG A;  4CUG A;  1APL C;  1X1C A;  4HDU A;  1SC7 A;  4XLF A;  3BLY A;  1RZ4 A;  2XRO A;  2M7B A;  5IT9 Z;  3FMS A;  2HOS A;  2KIU A;  2LTP A;  3QOP A;  1FBQ A;  2HNH A;  1MMD A;  3KYC B;  3IL2 A;  5J4V A;  1HW5 A;  2GXG A;  5BQT A;  2X4H A;  1F1Z A;  1YI2 I;  2QEN A;  1ZRC A;  2CGP A;  3DKW A;  4RMN A;  5M5W J;  3OYN A;  1VQ9 I;  4KIC A;  1G3Y A;  4IO9 F;  4QSH A;  1MMA A;  3NAR A;  5EGO A;  1D1B A;  3IH3 A;  3SJM A;  1KQ9 A;  2XAG A;  3VDX A;  1X2M A;  3TED A;  2K7L A;  2LR8 A;  2KFD A;  1FX7 A;  3SXY A;  1P7I A;  3HOU J;  3QP5 A;  1B72 A;  4EMS A;  3HHH A;  3DCF A;  4M72 A;  3L00 A;  1YFH A;  1VQL I;  4CYD A;  2WWY A;  1BR1 A;  4D7M A;  2VC1 A;  2XAU A;  3BZC A;  4IXA A;  5IP9 J;  3L2Q A;  2W24 A;  5IYC J;  3MEX A;  4EQQ A;  5FKM A;  1ZGJ A;  2PQ8 A;  1MSE C;  2ZSH B;  2X48 A;  1FYM A;  3RTR A;  2GOX B;  3RQ4 A;  3J7A O;  4CYC B;  3GME A;  5EG0 A;  2EFO A;  2LBF B;  2CQX A;  4NHJ A;  1AU7 A;  1BR2 A;  4L0Y B;  1YS7 A;  3EUA A;  3ROU A;  4GRI A;  4P55 A;  5CQG A;  1KQ8 A;  2CU7 A;  1MDM A;  4IOA F;  1IRF A;  1FSE A;  3F3X A;  3IUO A;  4II3 A;  5GAD J;  2H8W A;  1ZYR F;  3W6V A;  2XGX A;  3DEE A;  1JT0 A;  3PM1 A;  5F04 A;  2KT0 A;  1VTN C;  2A5Y B;  3CP2 A;  3RDI A;  2X6W A;  4IHW A;  4N4O B;  3EPZ A;  3DQV C;  1ETQ A;  1B1B A;  2M3A A;  1DU6 A;  3HOS A;  2ADU A;  2NVQ J;  4O6J A;  5L3D A;  2DA3 A;  2BOL A;  2PMZ N;  4F52 A;  4C2M J;  3DTE A;  2B7E A;  1ZRF A;  2I8D A;  1XSD A;  5DM6 F;  3HKZ A;  2MBF A;  4W1U A;  3KLO A;  1A35 A;  3OS1 A;  1YE9 A;  3GTJ J;  2V1U A;  3LSK A;  1P92 A;  5LHH A;  5DUK A;  2KP6 A;  2M2E A;  2NAZ A;  3CUQ B;  1PUF B;  5FRN A;  3S1N J;  2JWT A;  4LIU A;  3SEQ A;  2H09 A;  3JTG A;  3HOV J;  2LF8 A;  1R1U A;  1R5H A;  2KIF A;  2M30 A;  2FXA A;  2EPF A;  2IVM A;  1EH7 A;  1TQI A;  4HEA 2;  4MTE A;  2XPU A;  1SFX A;  3VFZ A;  2QSG X;  3LNQ A;  1SVM A;  3BQY A;  4FAS D;  2DMN A;  4D1Q A;  4CCN A;  3WE3 A;  4B44 A;  3CMY A;  2BHY A;  2EV5 A;  1YW8 A;  2V1D A;  2IA2 A;  4N0B A;  4WF2 A;  3I59 A;  4H4K C;  1RKT A;  4EJW A;  2FBH A;  4NBQ A;  4X1E A;  4J19 A;  4ESB A;  1W5C C;  3ZGK A;  1BC7 C;  1JUP A;  3W3C A;  4F92 B;  2A5W A;  2R7U A;  5J1Y A;  1WJA A;  5JHU A;  2ID3 A;  1TW3 A;  3Q0W A;  2P8T A;  4RAG A;  1NK3 P;  5LGN A;  1XMA A;  2CUF A;  2FA5 A;  3QWL A;  1HKS A;  2DT7 B;  4MFE A;  3S2W A;  5ED4 A;  2DXI A;  2VXD A;  1ZG1 A;  3I4N J;  1PUE E;  4BHC A;  3FXR A;  1VQ7 I;  1OKR A;  4ZJZ A;  4BBR J;  2F4I A;  1WI9 A;  2VE8 A;  1Z1D A;  5E3M A;  4HDV A;  4HF1 A;  4XLA A;  2M5W A;  4NC6 A;  2F2E A;  2LG4 A;  2KDO A;  2ME0 A;  3LSG A;  2MW8 A;  4EGZ A;  1OJL A;  2OTJ I;  1GXQ A;  2F6C A;  2FNP A;  1YG2 A;  2EZI A;  3C3W A;  3ZXS A;  2ZB9 A;  2ZSI B;  4DIQ A;  5HS9 A;  5FD5 A;  2VOD A;  1Z67 A;  1G6N A;  3K4K A;  3S2D J;  3OL4 A;  1ZG3 A;  1Q1V A;  2WAQ N;  5M5X J;  4MQV A;  3TKY A;  3OYL A;  2VXZ A;  3ZR8 X;  4PJM A;  4LG3 A;  2GWR A;  5J1U A;  2XSJ C;  2AO9 A;  3HOW J;  2Y69 H;  4CYC A;  2DU9 A;  1F4K A;  1SAN A;  2E35 A;  1N77 A;  2XV4 S;  5IOZ A;  2LBF A;  5B5E C;  3CCU I;  1VQP I;  3VPR A;  1V5F A;  4YIF A;  3CCV I;  3HOY J;  2E5N A;  5FD6 A;  1XDU A;  1X4O A;  4LIV A;  3ZOB A;  3QYB A;  2KPM A;  2M0C A;  1Z9C A;  2YU3 A;  3LSI A;  2BY0 A;  1BR4 A;  3LA3 A;  4HQE A;  3WOD F;  4HNU A;  1YIO A;  1Z7U A;  1ZEL A;  3BR1 A;  3BP8 A;  2VJ5 A;  3HL2 A;  1WJC A;  1B8I B;  5DDG A;  1FJL A;  3FXK A;  2JPB A;  5L3C A;  4NQW B;  1YRN A;  3K4L A;  2CQN A;  3D5S C;  1VQO I;  1MIJ A;  3FMQ A;  3AL0 C;  3WTU C;  2LRD A;  4HST A;  1ONV A;  3OYI A;  1FNN A;  4EJU A;  2HYF A;  4I0B A;  5GAG J;  3IWF A;  2VQG A;  2YSR A;  3S8P A;  2DFI A;  3H9Q A;  4DW6 A;  1PUF A;  3CUQ A;  2OV7 A;  3QYF A;  2W48 A;  1XDS A;  3EUK L;  4FT8 A;  3TDZ C;  3ZQQ A;  1T0F A;  3SQN A;  1G4D A;  2MYS A;  2RDP A;  4IQ4 A;  2DK8 A;  4H0E A;  1DUX C;  4OIP F;  1ZN2 A;  3FHZ A;  3J80 K;  5J6X A;  4UNO A;  4BQN A;  3FMR A;  3GZN B;  1N75 A;  4L5J A;  4J00 A;  4F91 B;  4XLH A;  2XF5 A;  3WTZ A;  4G94 A;  3HRM A;  1ZRD A;  1K6O A;  2HFH A;  3R4K A;  2WV1 A;  4QPQ A;  4BJ6 C;  1UFM A;  4F55 A;  3LQQ A;  4WX9 A;  3MN2 A;  2P0W A;  1OQY A;  4M3F A;  1RNL A;  1J5Y A;  3LFK A;  1FEX A;  2OUM A;  1AKH B;  2KIM A;  2E19 A;  4LJZ F;  1IV6 A;  3R0A A;  3HEF A;  3E5X A;  2ZXJ A;  3H3V K;  3SDG A;  5F6F A;  1ACI A;  1IXS B;  3CCE I;  4M6Y A;  2DA1 A;  1JE8 A;  3I64 A;  3KP7 A;  5AIP A;  2E1O A;  2K27 A;  3J7Y J;  3CCS I;  1E3H A;  3IH4 A;  1ETO A;  3IKV A;  3T1B A;  2L4M A;  3DU6 A;  4BHB A;  3SFZ A;  4D5C A;  3FXM A;  1P2F A;  2JA2 A;  1TNT A;  1ZHF A;  3JAM K;  2DTR A;  3W2W A;  3GTP J;  1E17 A;  3QU3 A;  1HCR A;  1JI8 A;  5HS7 A;  3NWS A;  2EJR A;  4IJA A;  4CHU A;  2LP0 A;  5FLV A;  1AA7 A;  5FKL A;  2HVR A;  3S3N A;  2VIX A;  2JRM A;  1Z3X A;  3A02 A;  3IAM 2;  5GPA A;  4E7I A;  3MKY B;  1GXP A;  4ENN A;  3W2A A;  1UG2 A;  3QP6 A;  2DMP A;  2Z2S B;  1PDN C;  1IC8 A;  5D5W B;  4Z2Y A;  4A0Y A;  1XGM A;  3FK6 A;  1IRX A;  2J5P A;  1EA3 A;  3JRB A;  4IHT A;  4RA2 A;  2RQQ A;  2VLA A;  3RPQ A;  2P6S A;  2XAS A;  4WK8 F;  4YFX F;  1H9G A;  2FNA A;  2FJ1 A;  2IS2 A;  2FOW A;  3WHC A;  3S15 J;  4L5E A;  3CD6 I;  1G8X A;  1HDD C;  2QKM B;  4M9X A;  2IGN A;  4OIR F;  1H9T A;  3HGG A;  3V7S A;  5A2Q K;  2BBY A;  4IHV A;  2CYY A;  2KJB A;  1W7P D;  2ZXI A;  1D0Y A;  4KA4 A;  1R5G A;  5LD2 C;  3AFH A;  4ZC3 A;  2XAH A;  3ZQF A;  5D8L B;  4YFN F;  4C2U A;  1OCR H;  4U0Y A;  3PO3 J;  1DQU A;  1YRN B;  4FET A;  3QPT A;  5D5V B;  3C2G A;  3CCM I;  1SVO A;  3OYK A;  4ZYH A;  3KYL A;  2IP2 A;  3OYF A;  1B8I A;  4A3F J;  2L4A A;  3BZ6 A;  4C3H J;  2L01 A;  3GWZ A;  4NQW A;  4A3K J;  5BMZ A;  3L2W A;  2QGU A;  3L09 A;  4A5N A;  5F27 A;  2O7O A;  3F21 A;  4IOC F;  1IRG A;  2XHK A;  1BI0 A;  2LVS A;  4Y17 A;  4S0H B;  3FHN A;  1ORK A;  3JRG A; 
#chains in the Genus database with same CATH homology
 1QZE A;  4YIR X;  2QSF X;  1X3W B;  3ESW B;  1OQY A;  1PVE A;  2F4M B;  2QSH X;  2F4O B;  1X3Z B;  2QSG X;  1TP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...