4CICA

T. potens iscr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
138
Chain Sequence
GAMGLKVSTKGHYGVQAMFDLAQHFGEGPVSLKSIAERQGLSEPYLEQLIAVLRKAGLVKSVRGAQGGYILAREPRDIKVGDIIRVLEGSLKFDFSVTKSVWEKVKKSIEEVLDSITLADMLKDAEEAQMAQGYMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, BADM/RRF2 FAMILY
publication title The Unique Regulation of Iron-Sulfur Cluster Biogenesis in a Gram-Positive Bacterium.
pubmed doi rcsb
source organism Thermincola potens
total genus 43
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cicA00
2KRFA 4ZH4F 2V9VA 5D4SA 3R61A 3SHFA 1D8JA 1ZLJA 3PQKA 3ZMSA 5D5UB 1U5TA 5EEGA 5E1WA 2XAQA 2RNJA 5JFRA 3ROUA 3C7JA 2WWYA 4KFCA 2EFWA 4L0YB 2QYOA 2XROA 3ZN1A 1XD7A 3RYRA 3KE2A 3CDHA 5FB2A 5L3EA 2K02A 1KU2A 5KK1A 1XSVA 1RI7A 4CHUA 3DXJF 2Y75A 3FM5A 1R1VA 1Z7UA 4R1HA 4I2OA 3F23A 3HSEA 1DP7P 3Q9SA 2HS5A 2M87A 2A07F 4KN7X 3SFZA 2P6SA 4HF1A 2UXNA 5HLGA 5DEQA 2O6GE 2PBIA 2HKXA 4F7ZA 4IJAA 5H6RA 5DUKA 3BP8A 3MFKA 1EH8A 1XDSA 3EYYA 4ZZDA 3EQLF 2X0LA 4ZYDA 4FX4A 4BYYA 4NQWA 5ICFA 3V7CA 3KFWX 4HBLA 3U2RA 2EA4A 5J8FA 4ENNA 2J5OA 2ZMEA 2ACJA 5IT9K 3F8BA 4A6EA 1HW2A 1BJAA 3V8KA 3E6CC 1YLFA 5J8CA 3CO6C 2CFXA 1ONVA 4LK1F 1JGSA 2FXAA 2K4BA 4EM2A 4L9JA 1HKTA 5LGTA 2R7FA 4KMFA 3P7NA 2A6EF 2ISZA 1U78A 1IAWA 4JQFA 1B4AA 3CLOA 2EV6A 3RTRA 1ZN2A 2QENA 3LWFA 4CICA 1KU3A 2PJPA 3LSTA 2ELHA 2EFPA 2OZ6A 4CYDA 4N9HA 2Q8KA 4IHSA 2LDUA 3B73A 4IPAA 1RUOA 3IRRA 3PFIA 4D0PA 1WWXA 1R00A 4BHCA 4P5OA 1Z1DA 1P4XA 4L0ZB 3TQNA 2H6CA 2MH2A 3I4PA 5CVVA 4HX8A 2PN6A 2ESHA 5HS8A 4HDUA 1CF7B 1IN4A 2RVCA 4EM1A 3ZMVA 5BMZA 2O3FA 4XLPF 2LNBA 5HDKA 3TO9A 5LHGA 2OQRA 3Q9VA 2BEOA 2MH9A 2H27A 1XDUA 4U7DA 2XIGA 3DP7A 1KQ9A 4LMYA 1UHMA 3I59B 2GIVA 4LG0A 4P9UA 3ULQB 4Y17A 2JPCA 1XMKA 3RPQA 3LA3A 4AD9A 4HQEA 4EJWA 4EGYA 3MAJA 4I0AA 2ADUA 2DQLA 1PDNC 2O03A 5ICGA 4UVBA 2YR2A 5F1RA 4PGHA 1J75A 2UXXA 2STTA 1LJ9A 3IWFA 5TRDA 2M1BA 1BI0A 1P4WA 3GFLA 4Q4ZF 2W84A 3ERED 1WSUA 2EV0A 2PG4A 1S8NA 2QBYB 5FFZA 4I01A 1UCRA 1VTNC 5JI6A 5FLXZ 2FBIA 2GA1A 1R5GA 1G4DA 3JTHA 2YX4A 4HDVA 2P6TA 3WTWC 2Q2EA 2CYYA 2W57A 2CWEA 2DQRA 4A12A 4AIKA 1ZHFA 1FP1D 3V8JA 4HF0A 4HYEA 2RDPA 3P9KA 2IW5A 1RNLA 3SQNA 1XGMA 2VOOA 2DI3A 2EA2A 1D8KA 2KKOA 2A68F 2HFHA 3E3VA 3JAMK 2F2EA 4M6YA 1U5TB 4WX9A 1IF1A 3TO6A 2F5CA 3IC7A 3D0SA 3V4GA 4B09A 4YIFA 1YW8A 1TLHB 2MD5A 2GXGA 3EUHA 4OIPF 1FZPB 2G7UA 3SZTA 2FE3A 3HRUA 3C18A 1SFUA 2MLKA 4CZZA 4EV0A 4Q5SF 3FXUA 2NRAC 4YFNF 4UXNA 4M9XA 3J80Z 1CGPA 4IXAA 5LEJA 1SMTA 2G9WA 4CO8A 1V3FA 2QWWA 2VBXA 3W6JB 4R8HA 2DW4A 2OZUA 3TDUC 3I58A 1QGPA 4UVAA 1KGSA 4A0ZA 2FRHA 2H6BA 1F4KA 1BI3A 2FOKA 1USTA 2GZWA 4PDKA 1LEBA 2QQBA 3WTUC 3CUQA 1XN7A 1SMYF 5AIQA 3H3ZA 2OQGA 3F8MA 3WTVC 2DTRA 1J5YA 2ZMEB 2QZ8A 4DQ2A 1KQ8A 4BHPA 3T1BA 1R1TA 2VN2A 2RQPA 5FO5A 3ISPA 3GLXA 4EGZA 4A0XA 2OD5A 1BC8C 2HYGD 1R7JA 4M74A 1TBXA 2AS5F 3EDPA 4A0YA 2V1XA 1AOYA 4NB5A 1Z6RA 3W6KB 3GF2A 1U8RA 2L3DA 3EETA 2FMYA 3ECOA 3FXRA 3KEQA 3VODA 5ICEA 1LNWA 3I0TA 5LBQA 1BC7C 3MEXA 2KJCA 5D4RA 1U2WA 5HLHA 4WXDA 1A04A 2K7LA 2Z9OA 4I09A 2YSRA 3GXOA 4XBFA 3CUOA 3F3XA 4L5IA 1Q1HA 1F9NA 1R58A 2WV0A 2LF8A 2IP2A 2P8TA 2QUFA 3CTAA 5H20A 2EJRA 5BPDA 3ZP5A 2OBPA 3O2PE 1WKMA 4U0VA 2A3SA 5D5WB 1KYWA 1LQ1A 2FF4A 2NAZA 5L3BA 2E7XA 1QO0D 2DO7A 5DYMA 3T8TA 2IPQX 4EVIA 5L3CA 3BPVA 5BQTA 4ENMA 1KU7A 2D2WA 2PEXA 3F6VA 4LG0B 2NNYA 4XSXF 5K5RA 4HLXA 4MHGA 3FX3A 3HTSB 4UNOA 1L3LA 4RB2C 3V7RA 1FSHA 3TKYA 4KT5C 3FHZA 3IHUA 1W7PA 1W5TA 3J81Z 2XAJA 2ZCWA 3C1DA 3DV8A 4HW0A 1DPUA 1YFHA 4KIBA 4FHTA 1XGSA 3PQJA 2HTSA 2IA2A 4EM0B 3LQQA 3OOPA 2J5PA 4EJOA 1G3WA 1ZARA 1YW9A 3GUDA 2OAZA 3WGIA 4OMZA 3E5QA 2HOEA 1JHFA 3KZYA 2CO5A 1ZRFA 3WU0A 2FA5A 2XAGA 1W5SA 5KVRA 5HS9A 3QPTA 1X3UA 3HUGA 4MTDA 2Y0MA 2E7WA 5CVJA 2AXLA 4O6JA 2X4HA 5DDGA 3LAJA 3KP7A 1LDKB 2IA1A 3HRTA 2F5DA 3KCCA 4FX0A 2HR3A 1XGOA 3GYHX 2L4AA 4M9SA 3KP4A 2CG4A 1RUNA 5L3GA 2V6CA 1Z6TA 5L3DA 4M9ZA 4FT8A 5IT3A 5K5OA 5ILVA 3QP5A 1T38A 4RB1A 4G7HF 3ZPLA 3M7GA 5A2QZ 1IXSB 2FBKA 4BH9A 3P9IA 1R36A 3OV8A 3HRSA 5CVIA 2FMLA 3VOEA 5D5VB 3E5UA 4LJZF 5LRSA 3KEOA 3I64A 4ZYGA 1QZZA 3WTZA 2KIMA 1HSJA 1TQIA 3IL2A 4IVNA 4P96A 1MZBA 2JZYA 3N97A 3I71A 1XMAA 1V4RA 4RGRA 3LA7A 1XB4A 1QPMA 5L3FA 3KLNA 3FM3A 3CUQB 3ZMUA 2DK8A 5E8IA 3REOA 2VONA 5DCMA 3KP6A 4YFXF 1H0MA 1STZA 1MKMA 5HS7A 4I0BA 1FP2A 2IT0A 2FNPA 3C3WA 3QAHA 4YIIA 3JSOA 4O5VA 4AVPA 1I1GA 4KICA 4Y13A 1UHWA 1O7FA 4XRFA 3U1DA 2P4WA 4UVCA 2RN7A 5LEKA 4UV9A 4G7OF 2Z3YA 2H94A 3FMQA 3E6DA 4EQQA 2JSCA 2XKOA 3M9AA 3F21A 2JRTA 2IRFG 1E17A 3FWEA 2HYFA 2A69F 2MLGA 3DKWA 3VEPA 1IW7F 4U0YA 4Q48A 1J0RA 3WODF 4GCVA 1S7OA 3VFZA 1DPRA 1MDMA 1O3RA 2VOPA 1XGNA 5JR3A 5HDNA 1ZRDA 5JHUA 2NS0A 1KA8A 4Y15A 4XSZF 2LF7A 1K7AA 1HQCA 4HQMA 3KLOA 1H9GA 2D1VA 4P9FA 2BGCA 1Z9CA 2VBZA 1D3YA 1ZG1A 3K1NA 3N4MA 4M72A 3L2CA 3WTTC 3HOTA 1HXDA 4WWCA 1HSTA 4HLYA 1MJAA 5E1ZB 1ZLKA 5H6QA 3IKTA 2ZXJA 2JT1A 4KIGA 2VBWA 1K79A 2M8EA 4CXFA 2ZNZA 1G3SA 3GWZA 3FMRA 4JK1X 4ZZLA 1OYIA 3L7WA 1PP7U 3BDDA 4E70A 1P2FA 1ULYA 3ZMDA 5FD5A 4LB5A 3DQVC 2LSOA 2W85A 5HOOA 1W7PB 3BJ6A 1TNSA 2Z5UA 2MA3A 1KQ0A 1BN5A 2DK5A 4PGGA 4L9NA 5LGNA 4HX7A 3ZQ7A 2ISYA 4GO1A 1IXRC 1U5TC 4OU0A 2IVMA 3M8EA 3R6SA 2GWRA 4HAMA 1ZYRF 1T98A 3H92A 1MGTA 5IT9Z 4ZYEA 1F5TA 1UB9A 1TQPA 3QOPA 1YW7A 5CVUA 4JBAA 2DT5A 1P4AA 3JSPA 1IN8A 4AIJA 3WE3A 2JPBA 1ZAOA 3G3ZA 1FT9A 2DLLA 4U0WA 2XAFA 1WRJA 3K1PA 2RKHA 3R0AA 1Z05A 3BWGA 2P7VB 4G8XA 4GYIA 3FMSA 4K2EA 3E97A 4BQAA 1SD6A 4KMUX 1O3QA 4BNCA 3WU1B 2V79A 2L02A 1FBQA 2P5KA 2PMUA 5E1XA 3F72A 2QQAA 2P5VA 2NNNA 3GZ6A 3RKXA 2RGVA 4IRGA 4L18B 1XCVA 1AWCA 1TW3A 1B1BA 2DPUA 1XSDA 1OKRA 2VODA 1ODDA 2EFNA 2HQNA 5ILSA 1GXPA 2GA2A 2HTJA 1FYMA 2R3SA 1YIOA 3COAC 2PLYA 1IN7A 3GX4X 4O3MA 3ZMZA 3I53A 3F6OA 3GW2A 4OOIA 3QPHA 2EFQA 1HW1A 2L01A 2HGCA 4B8XA 1T0FA 5BPIA 1XSXA 2MC3A 5DCMB 4CDGA 3L9FA 3NQOA 3T5XA 1H9TA 3IRQA 3SZPA 1JHHA 1SD5A 5EEHA 2ESNA 4AIHA 5DD8A 5FD6A 3H3UA 1FY7A 1QBJA 3L00A 2STWA 4A5NA 2A5YB 1QNTA 3WTSC 2FBHA 1UFMA 1OR7A 4PZJA 4MQVA 3K1MA 5E17F 2C6YA 1L0OC 3RYPA 2QLZA 5E18F 2XGXA 1F1ZA 4ZYHA 2DBBA 3LFKA 1EH6A 1SFXA 2GAUA 1XCBA 2PQ8A 2PI0A 2CSOA 2OA4A 4LK0F 2V1UA 3TDZC 1MJBA 1S29A 1P6RA 3HTUA 2ZBKA 4WCGA 1MDMB 3E6BA 5E8GA 1OPCA 3MZYA 4N0BA 1IRGA 1BM9A 2HWVA 1WQ2A 2HEOA 3AAFA 2L4MA 3KP3A 3JAMZ 1JE8A 1T2KA 2LKPA 1QZYA 3NEUA 4EJTA 2IA0A 2VC0A 3Q5FA 1NHAA 2VT3A 2O61A 1RZ4A 4ETSA 4MQ9F 3GFJA 1YG2A 3IWZA 3F22A 3G73A 3TO7A 3B02A 3BJOA 1GHCA 2F5FA 2ZNYA 1FC3A 1YQAA 1G6NA 3M1EA 3O3KA 1LVAA 4G6DA 5ICCA 1FBUA 1BIBA 1R1UA 4L5JA 3HYIA 3BOQA 4RAYA 5CYVA 2CGPA 2MBFA 4YG2F 5AONA 3RDIA 4OIQF 2FSWA 4Z2YA 1OYYA 2CQKA 4U7BA 5BOXA 3HSFA 4GYGA 1I1SA 2IJLA 1I5ZA 2XASA 2GQQA 1K78A 4UV8A 1TQMA 4HOBA 3V8LA 3WGHA 2W24A 5DCFA 3D5LA 5FLXK 4G6QA 1BI1A 4DNCA 2PFBA 2UZKA 1IN5A 2DU9A 1OYWA 4WK8F 4A6DA 3QU6A 3RI4A 2M30A 3MWMA 3BZ6A 4LLGF 3ABTA 4YFKF 1B9NA 4H0EA 4OIOF 3QU3A 2F5EA 2COMA 4LFUA 3T0YA 3DPLC 3K69A 1K6OA 3M8FA 2E1NA 1YTYA 1I27A 2DFIA 5LHHA 3RJPA 4EJVA 1ON1A 3RIRA 3GEZA 4A2UA 1RIOH 1C0WA 4HV5A 2FQ3A 3ZN0A 4GGGA 2W25A 6PAXA 5J6XA 4A5MA 1TNTA 2EK5A 4IF4A 4IRIA 2VE9A 1JXSA 2D45A 4P55A 4IRHA 1DDNA 3K0LA 2WC2A 3BPXA 4I7HA 3NRVA 3CJNA 1SD4A 3WTYC 1ZG5A 1YO5C 1ZG3A 3J80K 4IHTA 3TOAA 3CUQC 5CLSA 2EFOA 4EJUA 2ZFWA 1QQIA 2DPDA 2QQ9A 3GFMA 4RAZA 1E2XA 2P7CB 1J59A 3QP6A 1GXQA 1B6AA 5DV5A 3JW4A 3ELKA 2BBYA 1ON2A 3L09A 1FPQA 4KIFA 5E20A 5F64A 5HLIA 4LB6B 5D6FA 4G9YA 3BY6A 1WI9A 2JTVA 4L9TA 5ERIA 3JTGA 2TDXA 3V7SA 4KA4A 1R5HA 2VT2A 2M45A 4BHBA 3RKYA 2XV4S 1U3EM 3LAPA 2B0LA 1SFEA 2UWMA 2XKPA 3TOBA 2YX7A 5CVRA 2EWNA 4RGSA 2XRNA 3I54A 4OIRF 3ECHA 3K2ZA 2EB7A 4HV6A 4G7ZF 2XVCA 3I5UA 2BYVE 3HRMA 3U9GA 1BI2A 2OU2A 2QM3A 4R79A 1ZGJA 4HA8A 2FNAA 2WTEA 3RKWA 3IKVA 3MZHA 1USSA 2K4JA 3BJAA 1G3TA 2P5LC 4ON0A 1IRFA 1FBSA 5FFXA 2A6HF 1I6XA 4ESJA 1J9IA 3O6BB 4WXCA 2O8XA 2VXZA 3F8CA 4MTEA 2M5WA 1PP8F 4NHJA 3HOSA 3HHGA 4WXHA 3R0JA 1DUXC 3DPTA 4I98B 2K86A 3CO7C 1T39A 5LLQA 4RB3C 3LA2A 4U88A 2BV6A 2A61A 4G94A 1FNNA 3ABUA 2NYXA 1KU9A 1FOKA 4XLNF 5JVTA 1LEAA 2G7HA 2GXBA 4KN4X 2ZO4A 5LHIA 3DEUA 3FXQA 1FSEA 1Y0UA 1B59A 5CJ9A 2KIUA 1J7KA 3RPUA 1O57A 1EH7A 3TGNA 4RB0A 1OMIA 2HKOA 4LLNA 4UUVA 2ZKZA 4M71A 4S05A 1S6LA 2FU4A 3GVAA 4HF2A 4CGZA 1O3TA 3HIFA 1R23A 3E5XA 1LDDA 1BIAA 1MJ9A 3J81K 1IXCA 4TV7A 5D6EA 2CW0F 1PUEE 2ETHA 1S7AA 3WG9A 2RV8A 4KUMA 2KIFA 1FWZA 2PMHA 4ENJA 1FX7A 3GZ5A 4S04A 4KNYA 4M6XA 4MGRA 1BBYA 2HDCA 1K78B 4AWXB 2O0YA 5LRRA 2Y48A 2D1HA 1W7PD 5DUIA 1ZREA 1W4MA 2HQRA 1HKSA 1B9MA 4I02A 5HDGA 1G3YA 3R60A 3KP2A 4HZFA 3S2WA 4L9VA 1Z91A 3VB2A 1YS7A 3MQ0A 3HHHA 3ZMTA 1P92A 1LDJA 3ML6A 4GXOA 2K27A 1FYLA 5D8KB 1YS6A 1EV7A 3SXYA 1GVJA 1HKQA 5ED4A 1HBXG 1REPC 1KYZA 4WF2A 2QVOA 2HZTA 5TJJA 4PCQA 2XUBA 2YU3A 4OINF 1IZ1A 3LQRA 5DD4A 3F8NA 4KDPA 3QRFF 2RC4A 5D8LB 5K1YA 1R22A 2DAOA 3R4KA 2V1DA 1ZGAA 4OMYA 1HW5A 3WE2A 1TW2A 4ASNA 3E6MA 1MD0A 1O3SA 1BOAA 3T8RA 5A2QK 1FYKA 2Q0OA 2VBYA 1FLIA 3P9CA 3GO5A 5AIPA 4BXUA 2KJBA 4HX4A 1TTYA 2YPRA 4RGUA 1CF7A 3DFGA 2R7DA 1D5VA 3GFIA 4MEXF 3K9TA 4EMSA 5LGUA 3EYIA 3KETA 3WGGA 5FGMA 4ESFA 2H09A 5F6FA 1J2XA 2FEZA 1ZH5A 3I59A 1IN6A 4N9IA 4UHTA 4MNUA 1YYVA 2Z99A 4BAYA 4RGXA 1LB2A 1SAXA 1IUYA 5BS6A 5K5QA 4LGWA 1ZRCA 4LD5A 3FZVA 2XHKA 4QWQA 3J7AO 4KYWA 2VC1A 1S3JA 4QLCU 2BE5F 3BROA 3WTXC 2E1CA 2Z33A 4ENKA 3MCZA 1SD7A 3KZZA 3KP5A 2QBYA 1O7LA 2L54A 4RS8A 3FF5A 2XAHA 5D5XB 4ESBA 5ILUA 4LLLA 1U6GA 3HSRA 4Q47A 3F8FA 1T6SA 2ZJ2A 3DF8A 4M73A 4MEYF 2EV5A 2VE8A 5HVQC
chains in the Genus database with same CATH superfamily
2KRFA 4ZH4F 1ERDA 2V9VA 5D4SA 1JKQC 2JRMA 3VWBA 3R61A 3SHFA 1D8JA 1ZLJA 2LY2A 2QCOA 3PQKA 1VQ9I 3ZMSA 5D5UB 3CF5F 2QQ8A 3JRAA 2MD0A 1U5TA 2CS3A 5EEGA 5E1WA 1YITI 2XAQA 3S32A 5K7FA 3S14J 2RNJA 1RC9A 5JFRA 3ROUA 4XKWA 3C7JA 4J19A 2WWYA 4F92B 4KFCA 3F0CA 2VKEA 2EFWA 5M3FJ 1LUJB 4L0YB 2QYOA 2XROA 3ZN1A 1XD7A 2QA4I 3RYRA 3KE2A 3CDHA 2ME0A 3OYNA 5KNLA 2G0EA 5IYCJ 2PMZA 5L3EA 5FB2A 2E1MB 2K02A 1KU2A 1OLTA 2ZSHB 2DMPA 5KK1A 1XSVA 3J7AY 1RI7A 2O7OA 3DXJF 4CHUA 2Y75A 3FM5A 2HQ5A 1R1VA 1Z7UA 3OOUA 4R1HA 3DTEA 2L9SA 4I2OA 2RNGA 5FJ8J 3F23A 4D7MA 3HSEA 1DP7P 2XAUA 2V9PA 3S3NA 2KFDA 2DXIA 3Q9SA 2HS5A 2M87A 2OPTA 2A07F 3K2AA 4KN7X 2BOLA 3QYFA 1JKPC 2X1CA 2DA7A 2P6SA 4ZYAA 1T33A 3SFZA 3ZQHA 4HF1A 2DMUA 4B43A 1YRNB 3A0BC 4PJLA 4QIWN 1NH3A 3OIQA 3MKLA 3VYSB 2UXNA 5HLGA 4HNUA 5DEQA 2O6GE 2PBIA 4B4CA 2HKXA 4F7ZA 4E7HA 4RLQA 3CP2A 5HNFA 4XNFA 4IJAA 4NNJA 5H6RA 1IUFA 3ABMH 5DUKA 3BP8A 3BR6A 3MFKA 2R5ZB 1V5GA 1EH8A 1XDSA 3EYYA 3AL0C 4ZZDA 1SFOJ 3EQLF 2X0LA 2HOSA 4ZYDA 3QQAA 4BYYA 4FX4A 4NQWA 5ICFA 3V7CA 3KFWX 1LPQA 2HDWA 4HBLA 3U2RA 2EA4A 5J8FA 4ZC3A 4X1EA 4ENNA 1K83J 2J5OA 2ZMEA 1EKEA 2ME6A 3MVPA 2LY1A 2ACJA 4U87A 4LIUA 5IT9K 2X6YA 3E1SA 2D5VA 3F8BA 4A6EA 1PUFA 1HW2A 3I56I 3JREA 1BJAA 3V8KA 3CJRB 3E6CC 1YLFA 1UZCA 5J8CA 2ZJRF 2KIQA 3CO6C 5IOYA 1BR1A 3CZ6A 1W36C 4M3FA 2CFXA 1JUPA 1ONVA 4OWRB 2GOMA 2M7BA 3OYDA 1MSEC 5C44J 4LK1F 3CMEI 1JGSA 3IAS2 3LSPA 3HOXJ 2FXAA 4DYQA 2K4BA 3FXMA 4L9JA 4EM2A 2EINH 1HKTA 5LGTA 5K7HA 1E3HA 1FJLA 2R7FA 1Z7LA 5GADJ 4KMFA 3BC8A 4EATA 1FMVA 1V5FA 1F36A 2A6EF 3P7NA 4JX5A 3I4MJ 2BW3B 3K70D 3PSIA 2ISZA 1U78A 5LD2C 1IAWA 4JQFA 2WB1N 5EZGA 2HVQA 2GXAA 1B4AA 4M3DA 4MLOA 3CLOA 4II2A 1R71A 1I50J 2EV6A 4Y7NJ 3RTRA 1VQPI 1HOMA 1ZN2A 1WJAA 2QENA 2NOJB 3U21A 2WBMA 3LSIA 3LWFA 1JTXA 4CICA 1KU3A 3NWTA 2PJPA 3LSTA 4KT6A 2ELHA 5B5EC 2EFPA 3JRIA 2OZ6A 4QPOA 1VF9A 4N9HA 4CYDA 4FCYA 1BJZA 2Q8KA 2LDUA 4IHSA 2LREA 3B73A 3GBGA 3Q0VA 2HDDA 4IPAA 1RUOA 1VI0A 1WFXA 1TZLA 3IRRA 3PFIA 4D0PA 1WWXA 1RKWA 2LBFA 1R00A 3H9GA 2WAFA 4BHCA 2B63J 4P5OA 1Z1DA 1P4XA 4L0ZB 3JRCA 3TQNA 2H6CA 1E3OC 2MH2A 3I4PA 5CVVA 2CU7A 4HX8A 2PN6A 2ESHA 2DN0A 5HS8A 1MMAA 4HDUA 1CF7B 1YX5A 3G1OA 1IN4A 2RVCA 1RETA 4BQQA 4RAGA 4EM1A 1T0FC 3ZMVA 3IH3A 5BMZA 2O3FA 4IX7A 4IKFA 4XLPF 2LNBA 5GPAA 2KRHA 2NS8A 3TO9A 5HDKA 5FRNA 5LHGA 2E36A 1HC8A 2OQRA 3Q9VA 2BEOA 2MH9A 4A69C 2VQCA 2H27A 1XDUA 4U7DA 1GUUA 2XIGA 3DP7A 1KQ9A 3WU2C 4LMYA 2B9SA 1UHMA 1OISA 3I59B 2GIVA 2DMTA 4LG0A 3VYRB 4P9UA 3S3MA 2AO9A 3ULQB 1JT0A 3S3OA 4Y17A 2VKHA 4BACA 4UUSA 3HDDA 2XPWA 3ZCOA 3KZIC 2LTPA 2X6XA 4CCJA 2LMDA 2JPCA 4Y3OA 1XMKA 5IPAA 2R7TA 3MKZA 3A1YA 3RPQA 1FIPA 3LA3A 4AD9A 3CCUI 3CCEI 1K6YA 1OR7C 3SEZA 4HQEA 2B7EA 3A01B 1QVTA 2DFHA 2I8DA 4II3A 4EJWA 2HOTA 4EGYA 3MAJA 1E0EA 4I0AA 2ADUA 2DQLA 1K61A 1PDNC 4DYCA 2O03A 5ICGA 4BE2A 4UVBA 2YR2A 5F1RA 4PGHA 1J75A 3GTPJ 2UXXA 1SC7A 2STTA 4F52A 1LJ9A 3IWFA 1ACIA 4HNTA 1I39A 5LFAA 4XLCA 5TRDA 2M1BA 1X3WB 1BI0A 1P4WA 2VL8A 4HRIA 3GFLA 5C3EJ 1P7IA 3H1CA 4Q4ZF 2W84A 3ERED 1WSUA 2GOXB 1Y1VJ 4RMNA 2EV0A 1Y1WJ 2PG4A 3K4NA 1S8NA 2HXIA 1B8IB 2QBYB 2HXOA 5FFZA 4I01A 4BL0B 1UCRA 1VTNC 4IHYA 5JI6A 2MYSA 5FLXZ 5HLTA 3AG1H 4C9YA 2FBIA 2GA1A 4E7IA 2DA6A 4X6AJ 2M2EA 4IHWA 1R5GA 2OJED 1VQMI 3JTHA 1G4DA 4F93B 1MMSA 2YX4A 1WZ2A 1Z77A 3HEFA 4E7SA 4HDVA 2P6TA 3WTWC 2JQ7A 3ZQQA 2V26A 2Q2EA 2CYYA 2W57A 2CWEA 2DQRA 4A12A 4AIKA 3PJRA 1ZHFA 3PNTA 1FP1D 3V8JA 3ZGKA 4HF0A 4HYEA 4LITA 2DFFA 2RDPA 3P9KA 2K9NA 2IW5A 1RNLA 3SQNA 3UNGC 1Z21A 5KAIC 1XGMA 2LVSA 2GBYA 2QKLB 3OL4A 4CYCB 1MH3A 2VOOA 2DI3A 1OCZH 2EA2A 4XRMA 1D8KA 3O8HA 4BDYA 3PUBA 2QSFX 2KKOA 2Z16A 4PFOA 3BG6A 2R7QA 3LMMA 2A68F 3S16J 4PJJA 2HFHA 3E3VA 1W1WE 2LRDA 3JAMK 2F2EA 4M6YA 5F0HA 3JRFA 2HNHA 1QVUA 4NC8A 5GAHJ 1MBJA 1U5TB 2RREA 2K9LA 1J09A 4WX9A 1IF1A 2FD5A 3TO6A 2F5CA 2LG4A 3IC7A 3UKGA 3D0SA 3V4GA 4B09A 4YIFA 1YW8A 1D0ZA 1TLHB 1AKHA 4RDUA 2KDZA 1JGGA 2CQXA 3GTKJ 2VKVA 3BR3A 2MD5A 3HM5A 2GXGA 3EUHA 4OIPF 1FZPB 2G7UA 5HNHA 3SZTA 3A0HC 3OYKA 2FE3A 3HRUA 4C3IJ 2I5UA 3C18A 3VSKA 1SFUA 4A3DJ 2MLKA 4CZZA 4EV0A 4Q5SF 3FXUA 2NRAC 4YFNF 4E7KA 2DOEA 5IP6A 4UXNA 4M9XA 3J80Z 1CGPA 4IXAA 5LEJA 1SMTA 2G9WA 4JYKA 4CO8A 1V3FA 2QWWA 1NTCA 2VBXA 3W6JB 2A05A 4R8HA 2BVLA 2AQEA 2DW4A 3SDBA 3U1KA 3PIPF 2DT7B 2YUSA 2OZUA 3TDUC 3I58A 1RKTA 1QGPA 4D1QA 2XC7A 1M1EB 4UVAA 1KGSA 4A0ZA 2FRHA 2M3AA 4IOAF 2H6BA 4G6TB 1IG7A 4A3MJ 1F4KA 1BI3A 2FOKA 2EIKH 2BHZA 2TCTA 1USTA 2GZWA 4PDKA 2CQQA 2IGNA 5DS9A 4OAZA 2QQBA 3WTUC 3CUQA 1LEBA 1XN7A 2V4JC 1SMYF 3QWLA 1TC3C 4BEHA 4IZZA 5AIQA 3H3ZA 2JJ7A 4NQWB 4YIRX 2L7ZA 5CPRB 4S0HB 4BGDA 2OQGA 1XTAA 3F8MA 3OYAA 4Y33A 1R6RA 2DTRA 3WTVC 1MW7A 5IY5H 3M3YJ 1J5YA 2ZMEB 2QZ8A 4DQ2A 4C30A 1Z67A 1KQ8A 1WH7A 1VQKI 4BQNA 2PMZN 4BHPA 2EBIA 1TWHJ 1R1TA 2VN2A 2RQPA 5FO5A 3T1BA 3ISPA 3GLXA 2OD5A 4A0XA 2LKSA 4EGZA 1PUFB 2E5NA 1BC8C 2HYGD 4MO7A 1R7JA 2JA8J 4G12A 4M74A 1BR2A 1MNDA 4NBQA 1TBXA 2AS5F 2VASA 3MZ8A 4V2GA 1MH4A 4HNVA 1EA3A 2E1OA 3K4CA 2KP6A 3EDPA 3MD2A 4RAFA 4A0YA 2V1XA 5EJCA 1MBGA 1AOYA 4NB5A 2Y30A 3OR1C 1Z6RA 4PJMA 1QHGA 1WJBA 3W6KB 3GF2A 1U8RA 2L3DA 1JUSA 3I9V2 3EETA 1OCPA 1SFKA 1RESA 2FMYA 2ZXIA 4DW6A 3ECOA 4C3HJ 4DZJA 5GAGJ 3FXRA 3BG7A 3KEQA 3VODA 1P9QC 4CCMA 1G2HA 5ICEA 4MFDA 2CV2A 1LNWA 3I0TA 5LBQA 1BC7C 2VQGA 3MEXA 3QOEA 3SDGA 3K4BA 2ZXWH 2KJCA 5D4RA 3S2DJ 1U2WA 5HLHA 4WXDA 1A04A 2K7LA 1N75A 3RQIA 1XS9A 2Z9OA 3PSFA 4I09A 3KYLA 2R0QC 4D5FA 2YSRA 3GXOA 4XBFA 2JA2A 3CUOA 4DBRA 3F3XA 3D1NI 2VQHA 2XGCA 4L5IA 3OS1A 1Q1HA 5IOZA 3HB9A 1F9NA 1R58A 1RPWA 3M1CA 2KRCA 5GP9A 2WV0A 4Y52J 2LF8A 4XONA 2DMNA 2IP2A 2P8TA 4IHVA 2QUFA 1KONA 3CTAA 1FTTA 2VIXA 3O8GA 5H20A 5KAFC 2EJRA 5BPDA 2R7WA 3ZP5A 2OBPA 3PO3J 2LBFB 2CQNA 3ZXSA 3HBLA 3ZQFA 3BTJA 1GDTA 2R7UA 3OIPA 1Y8RB 3O2PE 1YIJI 1UJ8A 1WKMA 4U0VA 1YI2I 2A3SA 1I3AA 5D5WB 1KYWA 4BS9A 3CCVI 3F9KA 2CH0A 4UB8C 1LQ1A 2FF4A 2NAZA 5L3BA 2E7XA 3FHNA 1QO0D 2DO7A 5DYMA 3T8TA 2OC6A 3WHCA 1MSFC 1A6QA 2IPQX 4EVIA 5L3CA 4JP0A 3BPVA 5BQTA 5DM6F 3L2RA 4ENMA 3L2WA 4CH7A 1KU7A 2D2WA 3HG9A 5M5YJ 3BZCA 3WG7H 2PEXA 3F6VA 3W2WA 2QEXI 4LG0B 2NNYA 1VQNI 4XSXF 3GTOJ 4UUSB 5K5RA 4HLXA 4MHGA 2JUCA 3CF2A 3FX3A 2QSHX 3HTSB 1ETQA 2K9QA 4B48A 4UNOA 3LFUA 4DJAA 3L1PA 1L3LA 4RB2C 3V7RA 4V2FA 4B3XA 1FSHA 3TKYA 2Y2ZA 4AVZA 3B6AA 4KT5C 5FLVA 3FHZA 3IHUA 1W7PA 1UELB 1W5TA 3J81Z 2XAJA 2ZCWA 3C1DA 4PK4A 1WJ5A 3DV8A 3H9QA 4HW0A 3RQ4A 1DPUA 2MSYA 3TP0A 2DA2A 4KIBA 4FHTA 1YFHA 3BZKA 1XGSA 1QU3A 3PNYA 1FOYA 3PQJA 2HTSA 2IA2A 4EM0B 3CC4I 5FKMA 3LQQA 4BXXJ 2IEKA 5TISC 2M0MA 2E2HJ 3OOPA 3JCUC 3DBRB 2J5PA 2CMPA 4EJOA 5KHDA 1G3WA 2I10A 1ZARA 3GMEA 1YW9A 2KPMA 2ZJQF 4PSWA 1LVKA 3GUDA 2OAZA 3HOVJ 3WGIA 1ETKA 1XG1A 4YRVA 2LC2A 3LSMA 4OMZA 3E5QA 1U8BA 3Q0UA 2DDBA 2HOEA 2BY0A 2E1MC 1JHFA 4A3LJ 2X85A 1IJWC 3OYCA 3W3CA 3KZYA 1MBKA 2CO5A 4ITVA 3VDXA 1ZRFA 3WU0A 2FA5A 2XAGA 4XKVA 2KL4A 1W5SA 2H1KA 4A3GJ 5KVRA 2Q2EB 3QPTA 5HS9A 4BJ6C 1X3UA 3IV5A 2EIJH 3HUGA 4QTRA 4MTDA 2DJNA 2R7SA 2Y0MA 3KPHA 2E7WA 2EPFA 5CVJA 1TT0A 2AXLA 2EZLA 4C3JJ 1ETYA 4O6JA 3DCFA 2X4HA 5DDGA 3KYDB 4DOZA 3CP8A 3LAJA 3KP7A 1LDKB 2WAQA 2IA1A 3HRTA 2F5DA 1UG2A 2KZGA 3K4JA 3KCCA 4FX0A 2DA3A 2MG4A 4XK4A 2DA4A 3JRBA 2QSGX 2HR3A 1XGOA 1X1CA 1Y6IA 3GTJJ 3GYHX 2NVUB 2L4AA 3GZNB 3OS2A 4M9SA 3KP4A 2VB6A 5J1RA 3IH4A 1FIAA 3G4SI 2CG4A 2DCEA 4BXFA 4A3FJ 1RUNA 1X19A 5L3GA 4M3GA 3IH2A 2V6CA 1Z6TA 5L3DA 4M9ZA 4FT8A 2HPMA 4RM3A 5IT3A 1AKHB 2TRTA 5K5OA 5ILVA 1XC5A 5J47A 3QP5A 1T38A 4RB1A 1TWFJ 1WVRA 1X2MA 4IO9F 4G7HF 2CV1A 3ZPLA 3M7GA 5A2QZ 1IXSB 2FBKA 4BH9A 5GTIC 4J01A 3P9IA 2IGKA 2O9LA 1IDZA 2W82A 3CDIA 2GM4A 1R36A 4N4NB 3AKZA 1T95A 1IRZA 3OV8A 3HRSA 5CVIA 3M4OJ 2NOGA 4ZTJA 2FMLA 3VOEA 5D5VB 1D1AA 3E5UA 4LJZF 3KEOA 5LRSA 4XKBA 2DA5A 3I64A 4ZYGA 1QZZA 1NG7A 3C2GA 2COBA 1WJDA 3WTZA 2KIMA 1HSJA 1TQIA 2MGQA 4IVNA 3IL2A 1OFCX 4P96A 2F6CA 1MZBA 1QA6A 2JZYA 5DM7F 3HOUJ 3N97A 3I71A 1XMAA 1V4RA 4QSHA 4RGRA 3LA7A 1VQ5I 1XB4A 2WY7Q 1QPMA 4LG3A 5L3FA 3CESA 3KLNA 3ZQGA 3FM3A 3FDYA 2X48A 3CUQB 3DBLB 3ZMUA 4BEHB 2DK8A 5E8IA 2K85A 3REOA 3HKZA 2EZIA 2VONA 5HODA 4UY8I 3KEYA 5DCMA 2M8GX 5TGTA 3AG3H 1PVEA 4DZPA 2VJJA 3KP6A 5EGOA 4YFXF 3L2QA 1H0MA 2HZDA 1STZA 2ZSIB 3IAM2 1MIJA 1YJNI 1MKMA 5HS7A 1OCOH 1AU7A 4I0BA 1FP2A 2IT0A 2FNPA 3C3WA 4IQJA 1IRXA 1W36D 1VFCA 3QAHA 4YIIA 1ITYA 3JSOA 4O5VA 5BNGA 4AVPA 5CQEA 2HI3A 5J1YA 1KZHA 1I1GA 1XMXA 4KICA 4Y13A 3G6EI 2HU9A 4XICA 4IOCF 3JRHA 3BTIA 2Z1DA 2XF5A 1UHWA 1O7FA 4XRFA 4XIDA 3U1DA 2P4WA 2LOOA 2IGOA 4UVCA 2RN7A 5LEKA 4UV9A 3TL4X 4A3IJ 4G7OF 5EG0A 3ZRGA 1DU6A 2Z3YA 2WV1A 4XMYA 2H94A 5J4VA 3DU6A 1ZR2A 3FMQA 1JI8A 3RSNA 3E6DA 1X4PA 1LE8A 4EQQA 2JSCA 2XKOA 3H0GJ 1ETWA 3M9AA 3F21A 2JRTA 3BR1A 1LFUP 2IRFG 1N78A 1E17A 3FWEA 2HYFA 3C2HA 3RKQA 5E3OA 1X3ZB 2A69F 2MLGA 3DKWA 3VEPA 2IS2A 1IW7F 3HZJA 2CUZA 4U0YA 4Q48A 4JX4A 1J0RA 1Z3YA 3WODF 4GCVA 3TMOA 1S7OA 3VFZA 2JMWA 1DPRA 1MDMA 4XM3A 1O3RA 2VOPA 1XGNA 5JR3A 5HDNA 4LOCA 1ZRDA 3WHBA 3CCJI 5JHUA 5IP9J 2NS0A 1KA8A 4Y15A 4XSZF 2W4SA 3S1QJ 4BUPA 2LF7A 1K7AA 3OYGA 1HDPA 1HQCA 4HQMA 3KLOA 2AXTC 3LSKA 1H9GA 3FXJA 2D1VA 1SANA 1YJWI 4P9FA 3PO2J 2BGCA 2W48A 1Z9CA 1MMDA 1NG6A 1IGNA 2VBZA 1YJ9I 5FLMJ 2OCCH 1T56A 1D3YA 4A3EJ 1ZG1A 1UMQA 1Y56A 3K1NA 2OTLI 1RR8C 3N4MA 2O8KA 4GDFA 3K4KA 4M72A 3L2CA 3WTTC 5EDNA 4FASD 3CCYA 2KQRA 3HOTA 9ANTA 5FROA 1HXDA 2BXZA 2M34A 4WWCA 1HSTA 4HLYA 2MABA 3JR9A 1MJAA 2KHMA 5E1ZB 1POGA 1ZLKA 2W7NA 5H6QA 3IKTA 2L0KA 4N4OB 2H8WA 2ZXJA 2VPRA 3MKYB 2JT1A 4W97A 4KIGA 3V42A 3CQZJ 2GLOA 2VBWA 1K79A 4BDZA 1BOBA 4IEJA 3BQYA 2M8EA 3RZOJ 2CW7A 2VUMJ 4CXFA 2ZNZA 1G3SA 3GWZA 3FMRA 4JK1X 4ZZLA 1OYIA 4RA2A 1PYVA 3DTIA 3L7WA 2WADA 2E2IJ 1BA5A 2L9VA 1PP7U 3BG5A 3BDDA 1WJCA 2QGUA 4E70A 1P2FA 2X6OA 1ULYA 2XPVA 3BR0A 2YS9A 1BW6A 3ZMDA 4HEA2 5FD5A 1OCCH 3H0DA 1SVLA 1V54H 1W0TA 2JA6J 1F43A 4LB5A 3DQVC 2LSOA 2W85A 5HOOA 4AUXA 1W7PB 3BJ6A 1TNSA 3FK6A 2Z5UA 2MA3A 1KQ0A 1BN5A 2DK5A 4LIVA 4BY1J 1GVDA 4PGGA 3HOZJ 3I4NJ 3K10A 5K7ZA 4L9NA 5GTHC 5LGNA 4HX7A 4UUTA 3ZQ7A 2ISYA 3ABKH 3H5RA 4GO1A 1IXRC 1U5TC 2XRLA 4OU0A 2IVMA 3TBIA 2R7ZJ 3M8EA 3LSRA 2ID3A 2Y69H 4CZCA 3R6SA 2GWRA 2E5ZA 3BTLA 4HAMA 1ZYRF 4I99C 3SFIA 1T98A 3H92A 4XORA 1MGTA 1TL8A 2JUGA 2EH3A 1A31A 5IT9Z 1DP3A 4ZYEA 1F5TA 1UB9A 1TQPA 3QOPA 4B44A 5F1JA 1YW7A 4QPQA 3SEQA 2R5ZA 4V19K 2P0WA 2K3FA 3BT9A 4F55A 1X2NA 5CVUA 4JBAA 2DT5A 3DBHB 3VPRA 1P4AA 2IAIA 2AHQA 3JSPA 1IN8A 4XLFA 4AIJA 4CCOA 3WE3A 3QPSA 2JPBA 5H2FC 1WCMJ 1ZAOA 2Q1ZB 3G3ZA 1FT9A 3HUGB 2ELJA 2DLLA 3QODA 3SZGA 2H1LA 5FKOA 4U0WA 2XAFA 1WRJA 3VSLA 2XB5A 3K1PA 1OCRH 2RKHA 3R0AA 4PJ0C 1FOXA 2XGEA 2DA1A 2E35A 4FQGA 1Z05A 3BWGA 1D0XA 3DLAA 2W00A 2P7VB 4FTHA 4G8XA 4GYIA 3FMSA 3CDLA 4K2EA 3E97A 4BQAA 1SD6A 4GRIA 2X51A 4KMUX 5E3NA 1AA7A 1O3QA 1MBHA 4BNCA 5IP7J 3WU1B 3OYJA 2V79A 1JKRC 2L02A 2R5YA 2DJIA 2NVYJ 1FBQA 3PL8A 2P5KA 4XN3A 2PMUA 5E1XA 1MBEA 1U9OA 2Y0SA 3F72A 2M4GA 2QQAA 1ETOA 2OV7A 3OYEA 2FQ4A 2NNNA 2P5VA 4XOTA 1NK2P 2R7XA 3GZ6A 3RKXA 2RGVA 4Y4RA 4IRGA 4B1RA 1OJLA 4L18B 2ZMEC 3CCQI 2KT0A 2X6WA 3AG2H 2BVMA 3LL7A 1XCVA 3H5AA 1AWCA 1TW3A 1B1BA 2E60A 2DPUA 1XSDA 3HXLA 1D0YA 4ZDPA 1OKRA 1X1AA 2HVRA 2VODA 2BHYA 3S8PA 3HC7A 1ODDA 2EFNA 1UG0A 2HQNA 5ILSA 4E6KG 2GA2A 2HTJA 3OYFA 1GXPA 1FYMA 1APLC 2R3SA 1VQOI 1YIOA 3COAC 2DDAA 2PLYA 1IN7A 3GX4X 3ONQA 4O3MA 1X1DA 3GCMA 3HGYA 3DKYA 3IUOA 1I6HJ 2WAQN 1TT5B 3ZMZA 3I53A 3F6OA 1IDYA 4W1UA 3CCSI 2DTZA 3CJTB 3GW2A 4OOIA 1I3QJ 1S5LC 3QPHA 2EFQA 2LLKA 1HW1A 4AYBA 4BBRJ 2L01A 2BZTA 3RZDJ 2CW8A 2M4KA 2HGCA 4B8XA 1T0FA 1JTYA 4E4HA 1P7JA 5BPIA 1XSXA 2MC3A 5F08A 4I6ZA 5DCMB 2LY9A 3B6CA 2NVTJ 3ERMA 4CDGA 5EGOB 3L9FA 3NQOA 3OY9A 1HDDC 3T5XA 1Y39A 2DOFA 1H9TA 4BBSJ 4C2MJ 2W1OA 3CMMA 3LNQA 2OUMA 3IRQA 3SZPA 1JHHA 3TEDA 1SD5A 5EEHA 2ESNA 4AIHA 2DT6A 5DD8A 5FD6A 3H3UA 3G71I 1FY7A 1QBJA 3L00A 2STWA 5B1AH 2Y31A 4A5NA 2A5YB 1QNTA 3WTSC 4IHXA 1LFPA 1JT6A 2FBHA 3EPZA 1UFMA 4A3KJ 1OR7A 2CUJA 2XSJC 4PZJA 4MQVA 2LP0A 5EG0B 3K1MA 3RCOA 4DGWB 5E17F 2C6YA 3AFHA 1L0OC 3RYPA 2QLZA 5E18F 4DYRA 2XGXA 3DLLF 1F1ZA 2DBBA 4XRSG 3KIOA 3LFKA 4ZYHA 1EH6A 1SFXA 2GAUA 1MNEA 4MFEA 1LE8B 4BJTA 2VJ4A 2IGMA 1XCBA 2NS7A 4XLEA 1O4XA 2PQ8A 3A02A 2PI0A 1WH5A 2CSOA 2OA4A 4LK0F 1MBFA 2JN6A 2V1UA 3TDZC 1JUMA 1MJBA 1ZK8A 1S29A 2ICWG 2VJIA 3ASNH 1A36A 1W5CC 4BQOA 1P6RA 3OL3A 4M6VA 1YHQI 3HTUA 2MW8A 2V7FA 2MFZA 2L5QA 3EUAA 2ZBKA 4PSXA 4WCGA 2F4OB 4NC6A 1MDMB 3E6BA 4CSWA 2F5VA 5E8GA 1PJRA 1OPCA 5GAEJ 3MZYA 3MN2A 4N0BA 1IRGA 2EZHA 1BM9A 2HWVA 3QYEA 1WQ2A 1SVMA 2HEOA 3MMYB 2KMUA 3AAFA 1EJ9A 2L4MA 1EF4A 2BY2A 1RR7A 3KP3A 3JAMZ 2DMQA 1JE8A 1T2KA 3M8JA 2L9NA 2LKPA 1HF0A 3DKXA 1DQUA 1QZYA 3NEUA 3FKIJ 4DIQA 4EJTA 3W6VA 2IA0A 2VC0A 3Q5FA 1NHAA 2VT3A 3DEEA 2O61A 1RZ4A 4YELA 4ETSA 4MQ9F 3GFJA 3L2UA 1BR4A 1YG2A 3IWZA 3F22A 3G73A 3TO7A 3B02A 3BJOA 1GHCA 2F5FA 2ZNYA 4B47A 2HOAA 3OYMA 3CC7I 3CC2I 5IYBJ 1FC3A 1YQAA 3BQZA 1VQ7I 1G6NA 3M1EA 3O3KA 1LVAA 4G6DA 5ICCA 1NK3P 3HOWJ 1FBUA 1BIBA 1ETVA 1R1UA 1X58A 2KZVA 1R4NB 4L5JA 5M5WJ 2PJRA 3HYIA 3BOQA 4RAYA 1SAUA 5CYVA 2CGPA 3L2VA 1E3PA 2MBFA 1GV5A 4YG2F 3S1NJ 5AONA 3MKWB 2R4GA 1R5ID 3RDIA 4OIQF 2FSWA 4Z2YA 4RM2A 1OYYA 2CQKA 4ZDLA 3PFYA 3HSFA 4U7BA 1G8XA 4GYGA 5BOXA 3GTLJ 1I1SA 2IJLA 3FBNB 1I5ZA 2XASA 1WHUA 2GQQA 1X4OA 1QZEA 1K78A 2E19A 4ZDOA 4UV8A 3J7ZI 1TQMA 4HOBA 3V8LA 3HPHA 3WGHA 2L7FP 2W24A 2FUG2 5DCFA 3D5LA 3CLQA 2CUFA 3FXLA 1G59A 4G6QA 1BI1A 4DNCA 2PFBA 5FLXK 2UZKA 5IYDJ 1IN5A 1LFBA 4X0GA 4HSTA 3OYLA 2DU9A 1OYWA 2LYCA 4F91B 2HYJA 2R7RA 4WK8F 1TWCJ 4A6DA 3QU6A 4UB6C 2N8GA 2M30A 3RI4A 3MWMA 3A03A 3BZ6A 4BKXA 4LLGF 3ABTA 4PUSA 2EIMH 4YFKF 1WGXA 1B9NA 2E71A 2EQRA 3OYBA 4D5CA 4H0EA 5J4YA 4J00A 4OIOF 5M5XJ 3QU3A 1ZQ3P 4C2UA 2F5EA 1B72A 3S17J 1H89C 5F0FA 3GTMJ 2COMA 4LFUA 3T0YA 1T08B 3DPLC 3K69A 1JJ6C 3FXKA 1K6OA 3OIOA 3M8FA 3AL0B 2E1NA 4L5EA 3PM1A 1YTYA 1VQ4I 1I27A 2DFIA 5LHHA 3RJPA 3H3VK 2MC4A 4EJVA 1ON1A 3RIRA 1UAAA 3RPUD 2ZXHA 3GEZA 1H88C 4A2UA 1ZKGA 4IQ4A 3EUHC 1RIOH 1C0WA 2WAEA 4HSRA 2CRGA 4HV5A 2FQ3A 3ZN0A 4GGGA 2W25A 6PAXA 4PJNA 3K70C 2AQFA 5FKNA 5J6XA 1DGWY 4A5MA 5C4XJ 3G1LA 1TNTA 2EK5A 1IC8A 3E0JB 2UUZA 4IF4A 4IRIA 2VE9A 1JXSA 2D45A 2YU9J 4P55A 2JA5J 1QHHD 1S7EA 3QPLA 4XQFA 2FX0A 4IRHA 1DDNA 4Z6YA 3K0LA 1R49A 1TWAJ 3FXOA 3Q3SA 2WC2A 3BPXA 4I7HA 4P1WA 1ZTRA 3NRVA 3CJNA 3BCBA 1SD4A 4KJZA 3WTYC 1WJEA 2ZFUA 4BU2A 3BCAA 1ZG5A 1YO5C 4XKCA 1ZG3A 3J80K 3P5JA 4IHTA 3TOAA 3FBIB 1IO2A 4KISA 1MMGA 3OS0A 2BY1A 2JK3A 5F04A 5KCMA 2R5YB 3DTKA 3CUQC 5JVGF 3PIOF 2JSPA 5CLSA 2EFOA 4EJUA 2ZFWA 4A3JJ 1QQIA 2DPDA 2QQ9A 4A3CJ 3GFMA 4RAZA 1E2XA 1ZR4A 3H35A 3GTGJ 1FOWA 2P7CB 1J59A 3QP6A 1GXQA 5FRMA 1B6AA 1TWGJ 1VNDA 5DV5A 3JW4A 3OYHA 2XPUA 3TW6A 3ELKA 2BBYA 1ON2A 3L09A 1YOVB 3A4CA 1FPQA 1TP4A 1Z3XA 2XDVA 4KIFA 5E20A 5F64A 5HLIA 4LB6B 2VJ5A 5D6FA 4EEFG 3ZR8X 4G9YA 1MNMC 1SEUA 4E7ZA 3BY6A 4A93J 3E7LA 1WI9A 2ECBA 2JTVA 3ZQCA 4HG2A 4L9TA 5ERIA 2IXSA 4FE7A 4BY7J 3JTGA 2TDXA 4FETA 3V7SA 4KA4A 1R5HA 2VT2A 2M45A 4BE0A 5F27A 4BHBA 3K6GA 4XRSA 2ZB9A 2K40A 3RKYA 2XV4S 4NUBA 2NVXJ 2R92J 1U3EM 4MIMA 3DWLE 5B3SH 3LAPA 1JKOC 2K3PA 2B0LA 1SFEA 1WI3A 2UWMA 2XKPA 4A3BJ 1OCTC 4F3QA 2VQLA 3TOBA 2YX7A 2DYSH 5CVRA 3M07A 2V1NA 2EWNA 4RGSA 3CCMI 2F48A 2XRNA 3DEWA 3I54A 4XLHA 4OIRF 4AIDA 2JVGA 5FKLA 1W0UA 3ECHA 3OWTA 3PNVA 2EILH 3K2ZA 2Y0SN 1GT0C 1MMNA 2EB7A 1Z0XA 3GLLA 3JRDA 4HV6A 2UV1A 3OR2C 2IS6A 1WJFA 1IV6A 4G7ZF 2XVCA 3I5UA 2A5WA 2BYVE 4RBOA 3HRMA 3U9GA 1BI2A 2OU2A 2VXDA 2QM3A 4R79A 1ZGJA 4PFPA 4HA8A 3NWSA 2HQAA 4ZJZA 2FNAA 2WTEA 2DODA 3RKWA 3IKVA 3MZHA 5E3MA 2DYRH 2R93J 1USSA 3OSFA 2X1DA 2K4JA 2M7AA 3BJAA 3N05A 5E3LA 2H8RA 1D1CA 4JX6A 4ZTFA 3EUKL 1G3TA 3BLYA 3HJEA 4XR6A 5FKKA 1ORKA 2P5LC 4ON0A 1IRFA 1FBSA 5FFXA 3OSGA 3S93A 3K7AJ 3BTCA 3J7YJ 2A6HF 1I6XA 1V5EA 3ASOH 2OCEA 4ESJA 2A6TA 1J9IA 3FKJA 3O6BB 4WXCA 2O8XA 5EYRA 2VXZA 3F8CA 3BG9A 1N77A 2WA0A 4MTEA 2M5WA 1PP8F 4NHJA 3HOSA 2X9DA 3HHGA 4AYBN 4AM3A 2LK2A 3R0JA 4WXHA 1LKXA 2XSDC 1XX5A 2K5CA 3UR3C 3QYBA 2VLAA 2Y9YA 4CA0A 2XF7A 2KLOA 4JOMA 1DUXC 3DPTA 4I98B 4ANJA 2K86A 2DOAA 3CO7C 1T39A 4XLAA 4XOPA 3BR5A 5LLQA 4RB3C 3LA2A 2XB0X 4U88A 2BV6A 1YX3A 2LH9A 2L7MP 2A61A 1X1BA 4G94A 1FNNA 3HL2A 3ABUA 2NYXA 1KU9A 1HLVA 2VPLA 1FOKA 4XLNF 5JVTA 1LEAA 2G7HA 3SYTA 4NC7A 3JRGA 2GXBA 4KN4X 2NVQJ 2ZO4A 3ZQIA 5LHIA 3DEUA 3FXQA 1FSEA 1Y0UA 1A5JA 2R7VA 1B59A 5CJ9A 2KIUA 2VI6A 1J7KA 2F4IA 5CKTA 3RPUA 4E7JA 3HGGA 2E2JJ 1O57A 5JLXA 1EH7A 3TGNA 3LSJA 4RB0A 1OMIA 2HKOA 1YRNA 4AU7A 4LLNA 2Z2SB 4UUVA 2ZKZA 4M71A 4S05A 2L7KA 1S6LA 2FU4A 3GVAA 3Q0WA 3FK7A 4HF2A 3OYIA 1DGRM 1VQ8I 4CGZA 4DBQA 2IS4A 1O3TA 3HIFA 1R23A 1U0JA 3ZQLA 3E5XA 1LDDA 3W2VA 4ABZA 4NDLA 2M9HA 3CCLI 4BE1A 2JA7J 1BIAA 3IP4B 1MJ9A 1XPXA 1JJ8C 3J81K 1YE9A 2WB1A 2JWTA 2PJRB 1GLNA 1IXCA 3G1MA 4TV7A 2RAEA 5D6EA 1VZ0A 1X1PA 1FTZA 2CW0F 1PUEE 2ETHA 1S7AA 1A35A 3W2AA 1OQYA 3WG9A 2RV8A 3ESWB 4C2TA 5GPCA 4KUMA 2KIFA 1FWZA 3LSGA 3K4LA 2PMHA 5F0CA 5EZHA 5DTDA 1FX7A 4ENJA 1BW5A 3GZ5A 4S04A 3S2HJ 4KNYA 4M6XA 4OAYA 4MGRA 1BBYA 2HDCA 1K78B 4AWXB 2O0YA 3S1RJ 5LRRA 2Y48A 3H36A 2D1HA 1W7PD 5DUIA 1S72I 1WPKA 5EF6A 1ZREA 3NAUA 2BY3A 1W4MA 2IS1A 5J3LA 2L2OA 2HQRA 1HKSA 1UHSA 4IL6C 1B9MA 4I02A 1Q1VA 3FIWA 5HDGA 1G3YA 1HCRA 3R60A 1GV2A 3KP2A 4HZFA 3S2WA 4L9VA 4KITB 1VQ6I 3ZOBA 2CQ7A 1Z91A 3VB2A 1YS7A 3MQ0A 3HHHA 3ZMTA 1P92A 5B66C 1LDJA 3ML6A 4GXOA 1B72B 2K27A 1DU0A 4E7LA 1FYLA 5D8KB 1YS6A 1EV7A 3SXYA 3A2KA 1IV8A 1GVJA 3D5RC 3VYUB 1HKQA 3NARA 5ED4A 1HBXG 2BW3A 4AC0A 3GTQJ 1REPC 1KYZA 4WF2A 2QVOA 1H8AC 4B3AA 2HZTA 5TJJA 3S15J 3AG4H 4PCQA 2CJJA 2KISA 2P81A 1ETXA 4FE4A 2XUBA 2YU3A 3DPUA 1N25A 4OINF 2E34A 4CUGA 3LSHA 1IZ1A 1S9HA 3FISA 3LQRA 2R7OA 5DD4A 4CCNA 1K4SA 1Y8QB 3F8NA 2LR8A 4KDPA 3H5NA 2OTJI 3QRFF 2RC4A 5D8LB 3CCRI 5K1YA 1BL0A 2M0CA 1R22A 2DAOA 3R4KA 2V1DA 2NXNB 1RRJA 1ZGAA 2XGDA 4FISA 4OMYA 1HW5A 3WE2A 2CUEA 1TW2A 4ASNA 1T8IA 3E6MA 1MD0A 3TW7A 2ELKA 1O3SA 1BOAA 3BG3A 3T8RA 5A2QK 2PX9A 3X2QH 1FYKA 3CJQB 2Q0OA 2VBYA 4RLFA 1FLIA 3P9CA 3GO5A 3KX2A 5AIPA 2XF6A 3G2BA 3CMYA 2LFBA 4BXUA 2KJBA 4HX4A 4D9JA 1A6IA 1FMWA 2VKDA 1TTYA 2YPRA 5JLWA 4RGUA 3S1MJ 5CQGA 4H4KC 1CF7A 3DFGA 2R7DA 3LOCA 1K4TA 3HPGA 5E79C 1D5VA 1V55H 3GFIA 4CCLA 2FOWA 4YEJA 2OF7A 4MEXF 4D7NA 1D1BA 3D5SC 3K9TA 5M3MJ 4EMSA 2Y9ZA 2CV0A 5LGUA 5B1BH 3EYIA 2L9RA 3KETA 3WGGA 1HA8A 5FGMA 4ESFA 2H09A 4GFBA 5F6FA 1J2XA 2FEZA 1R9TJ 3PUFA 1ZH5A 3I59A 2LD5A 2ZC2A 1IN6A 4N9IA 5EEAA 1D5YA 3TP3A 2FJ1A 1SVOA 4UHTA 3ABLH 1AHDP 3DU5A 1ZELA 4MNUA 5J1UA 2DFEA 1YYVA 3I55I 2Z99A 2JVHA 3CD6I 4BAYA 4RGXA 4BJ5C 1LB2A 1ENHA 2X1EA 2F4MB 1CQTA 3H9JA 3A01A 2QF7A 3OMYA 1SAXA 1IUYA 2ECCA 3I3LA 5BS6A 5K5QA 2EZKA 4LGWA 1ZRCA 5JHFA 4LD5A 3K4MA 2BXYA 2K9SA 3HOYJ 2GIZA 3FZVA 2XHKA 2K9MA 4QWQA 3J7AO 2KDOA 3CMAI 2RQQA 1QRYA 4KYWA 2VC1A 1S3JA 4QLCU 4M3EA 2BE5F 3BROA 3KYCB 3HKZN 3WTXC 2HVSA 4CCKA 2Z33A 2E1CA 4ENKA 2HPIA 1SD7A 3MCZA 5C4JJ 1B8IA 3KZZA 3SJMA 3KP5A 2QBYA 1O7LA 1R4MB 3BR2A 2L54A 4RS8A 3FF5A 2XAHA 5D5XB 1VQLI 4ESBA 5ILUA 2ID6A 4LLLA 4I76A 1FEXA 5J40A 1U6GA 2V6EA 3HSRA 2CFOA 4Q47A 2IBDA 3F8FA 1T6SA 2ZJ2A 2QKMB 3C2BA 1ZGWA 1U9NA 2WY8Q 3DF8A 2V9KA 4M73A 4MEYF 1QPIA 2EV5A 3VYTB 1Y0NA 4HPQA 2ZJPF 2O5RA 4XL9A 4XN0A 4M3BA 4CYCA 2LKXA 2VE8A 5HVQC
chains in the Genus database with same CATH topology
2KRFA 4ZH4F 2V9VA 5D4SA 3R61A 3SHFA 1D8JA 1ZLJA 3PQKA 3ZMSA 5D5UB 1U5TA 5EEGA 5E1WA 2XAQA 2RNJA 5JFRA 3ROUA 3C7JA 2WWYA 4KFCA 2EFWA 4L0YB 2QYOA 2XROA 3ZN1A 1XD7A 3RYRA 3KE2A 3CDHA 5FB2A 5L3EA 2K02A 1KU2A 5KK1A 1XSVA 1RI7A 4CHUA 3DXJF 2Y75A 3FM5A 1R1VA 1Z7UA 4R1HA 4I2OA 3F23A 3HSEA 1DP7P 3Q9SA 2HS5A 2M87A 2A07F 4KN7X 3SFZA 2P6SA 4HF1A 2UXNA 5HLGA 5DEQA 2O6GE 2PBIA 2HKXA 4F7ZA 4IJAA 5H6RA 5DUKA 3BP8A 3MFKA 1EH8A 1XDSA 3EYYA 4ZZDA 3EQLF 2X0LA 4ZYDA 4FX4A 4BYYA 4NQWA 5ICFA 3V7CA 3KFWX 4HBLA 3U2RA 2EA4A 5J8FA 4ENNA 2J5OA 2ZMEA 2ACJA 5IT9K 3F8BA 4A6EA 1HW2A 1BJAA 3V8KA 3E6CC 1YLFA 5J8CA 3CO6C 2CFXA 1ONVA 4LK1F 1JGSA 2FXAA 2K4BA 4EM2A 4L9JA 1HKTA 5LGTA 2R7FA 4KMFA 3P7NA 2A6EF 2ISZA 1U78A 1IAWA 4JQFA 1B4AA 3CLOA 2EV6A 3RTRA 1ZN2A 2QENA 3LWFA 4CICA 1KU3A 2PJPA 3LSTA 2ELHA 2EFPA 2OZ6A 4CYDA 4N9HA 2Q8KA 4IHSA 2LDUA 3B73A 4IPAA 1RUOA 3IRRA 3PFIA 4D0PA 1WWXA 1R00A 4BHCA 4P5OA 1Z1DA 1P4XA 4L0ZB 3TQNA 2H6CA 2MH2A 3I4PA 5CVVA 4HX8A 2PN6A 2ESHA 5HS8A 4HDUA 1CF7B 1IN4A 2RVCA 4EM1A 3ZMVA 5BMZA 2O3FA 4XLPF 2LNBA 5HDKA 3TO9A 5LHGA 2OQRA 3Q9VA 2BEOA 2MH9A 2H27A 1XDUA 4U7DA 2XIGA 3DP7A 1KQ9A 4LMYA 1UHMA 3I59B 2GIVA 4LG0A 4P9UA 3ULQB 4Y17A 2JPCA 1XMKA 3RPQA 3LA3A 4AD9A 4HQEA 4EJWA 4EGYA 3MAJA 4I0AA 2ADUA 2DQLA 1PDNC 2O03A 5ICGA 4UVBA 2YR2A 5F1RA 4PGHA 1J75A 2UXXA 2STTA 1LJ9A 3IWFA 5TRDA 2M1BA 1BI0A 1P4WA 3GFLA 4Q4ZF 2W84A 3ERED 1WSUA 2EV0A 2PG4A 1S8NA 2QBYB 5FFZA 4I01A 1UCRA 1VTNC 5JI6A 5FLXZ 2FBIA 2GA1A 1R5GA 1G4DA 3JTHA 2YX4A 4HDVA 2P6TA 3WTWC 2Q2EA 2CYYA 2W57A 2CWEA 2DQRA 4A12A 4AIKA 1ZHFA 1FP1D 3V8JA 4HF0A 4HYEA 2RDPA 3P9KA 2IW5A 1RNLA 3SQNA 1XGMA 2VOOA 2DI3A 2EA2A 1D8KA 2KKOA 2A68F 2HFHA 3E3VA 3JAMK 2F2EA 4M6YA 1U5TB 4WX9A 1IF1A 3TO6A 2F5CA 3IC7A 3D0SA 3V4GA 4B09A 4YIFA 1YW8A 1TLHB 2MD5A 2GXGA 3EUHA 4OIPF 1FZPB 2G7UA 3SZTA 2FE3A 3HRUA 3C18A 1SFUA 2MLKA 4CZZA 4EV0A 4Q5SF 3FXUA 2NRAC 4YFNF 4UXNA 4M9XA 3J80Z 1CGPA 4IXAA 5LEJA 1SMTA 2G9WA 4CO8A 1V3FA 2QWWA 2VBXA 3W6JB 4R8HA 2DW4A 2OZUA 3TDUC 3I58A 1QGPA 4UVAA 1KGSA 4A0ZA 2FRHA 2H6BA 1F4KA 1BI3A 2FOKA 1USTA 2GZWA 4PDKA 1LEBA 2QQBA 3WTUC 3CUQA 1XN7A 1SMYF 5AIQA 3H3ZA 2OQGA 3F8MA 3WTVC 2DTRA 1J5YA 2ZMEB 2QZ8A 4DQ2A 1KQ8A 4BHPA 3T1BA 1R1TA 2VN2A 2RQPA 5FO5A 3ISPA 3GLXA 4EGZA 4A0XA 2OD5A 1BC8C 2HYGD 1R7JA 4M74A 1TBXA 2AS5F 3EDPA 4A0YA 2V1XA 1AOYA 4NB5A 1Z6RA 3W6KB 3GF2A 1U8RA 2L3DA 3EETA 2FMYA 3ECOA 3FXRA 3KEQA 3VODA 5ICEA 1LNWA 3I0TA 5LBQA 1BC7C 3MEXA 2KJCA 5D4RA 1U2WA 5HLHA 4WXDA 1A04A 2K7LA 2Z9OA 4I09A 2YSRA 3GXOA 4XBFA 3CUOA 3F3XA 4L5IA 1Q1HA 1F9NA 1R58A 2WV0A 2LF8A 2IP2A 2P8TA 2QUFA 3CTAA 5H20A 2EJRA 5BPDA 3ZP5A 2OBPA 3O2PE 1WKMA 4U0VA 2A3SA 5D5WB 1KYWA 1LQ1A 2FF4A 2NAZA 5L3BA 2E7XA 1QO0D 2DO7A 5DYMA 3T8TA 2IPQX 4EVIA 5L3CA 3BPVA 5BQTA 4ENMA 1KU7A 2D2WA 2PEXA 3F6VA 4LG0B 2NNYA 4XSXF 5K5RA 4HLXA 4MHGA 3FX3A 3HTSB 4UNOA 1L3LA 4RB2C 3V7RA 1FSHA 3TKYA 4KT5C 3FHZA 3IHUA 1W7PA 1W5TA 3J81Z 2XAJA 2ZCWA 3C1DA 3DV8A 4HW0A 1DPUA 1YFHA 4KIBA 4FHTA 1XGSA 3PQJA 2HTSA 2IA2A 4EM0B 3LQQA 3OOPA 2J5PA 4EJOA 1G3WA 1ZARA 1YW9A 3GUDA 2OAZA 3WGIA 4OMZA 3E5QA 2HOEA 1JHFA 3KZYA 2CO5A 1ZRFA 3WU0A 2FA5A 2XAGA 1W5SA 5KVRA 5HS9A 3QPTA 1X3UA 3HUGA 4MTDA 2Y0MA 2E7WA 5CVJA 2AXLA 4O6JA 2X4HA 5DDGA 3LAJA 3KP7A 1LDKB 2IA1A 3HRTA 2F5DA 3KCCA 4FX0A 2HR3A 1XGOA 3GYHX 2L4AA 4M9SA 3KP4A 2CG4A 1RUNA 5L3GA 2V6CA 1Z6TA 5L3DA 4M9ZA 4FT8A 5IT3A 5K5OA 5ILVA 3QP5A 1T38A 4RB1A 4G7HF 3ZPLA 3M7GA 5A2QZ 1IXSB 2FBKA 4BH9A 3P9IA 1R36A 3OV8A 3HRSA 5CVIA 2FMLA 3VOEA 5D5VB 3E5UA 4LJZF 5LRSA 3KEOA 3I64A 4ZYGA 1QZZA 3WTZA 2KIMA 1HSJA 1TQIA 3IL2A 4IVNA 4P96A 1MZBA 2JZYA 3N97A 3I71A 1XMAA 1V4RA 4RGRA 3LA7A 1XB4A 1QPMA 5L3FA 3KLNA 3FM3A 3CUQB 3ZMUA 2DK8A 5E8IA 3REOA 2VONA 5DCMA 3KP6A 4YFXF 1H0MA 1STZA 1MKMA 5HS7A 4I0BA 1FP2A 2IT0A 2FNPA 3C3WA 3QAHA 4YIIA 3JSOA 4O5VA 4AVPA 1I1GA 4KICA 4Y13A 1UHWA 1O7FA 4XRFA 3U1DA 2P4WA 4UVCA 2RN7A 5LEKA 4UV9A 4G7OF 2Z3YA 2H94A 3FMQA 3E6DA 4EQQA 2JSCA 2XKOA 3M9AA 3F21A 2JRTA 2IRFG 1E17A 3FWEA 2HYFA 2A69F 2MLGA 3DKWA 3VEPA 1IW7F 4U0YA 4Q48A 1J0RA 3WODF 4GCVA 1S7OA 3VFZA 1DPRA 1MDMA 1O3RA 2VOPA 1XGNA 5JR3A 5HDNA 1ZRDA 5JHUA 2NS0A 1KA8A 4Y15A 4XSZF 2LF7A 1K7AA 1HQCA 4HQMA 3KLOA 1H9GA 2D1VA 4P9FA 2BGCA 1Z9CA 2VBZA 1D3YA 1ZG1A 3K1NA 3N4MA 4M72A 3L2CA 3WTTC 3HOTA 1HXDA 4WWCA 1HSTA 4HLYA 1MJAA 5E1ZB 1ZLKA 5H6QA 3IKTA 2ZXJA 2JT1A 4KIGA 2VBWA 1K79A 2M8EA 4CXFA 2ZNZA 1G3SA 3GWZA 3FMRA 4JK1X 4ZZLA 1OYIA 3L7WA 1PP7U 3BDDA 4E70A 1P2FA 1ULYA 3ZMDA 5FD5A 4LB5A 3DQVC 2LSOA 2W85A 5HOOA 1W7PB 3BJ6A 1TNSA 2Z5UA 2MA3A 1KQ0A 1BN5A 2DK5A 4PGGA 4L9NA 5LGNA 4HX7A 3ZQ7A 2ISYA 4GO1A 1IXRC 1U5TC 4OU0A 2IVMA 3M8EA 3R6SA 2GWRA 4HAMA 1ZYRF 1T98A 3H92A 1MGTA 5IT9Z 4ZYEA 1F5TA 1UB9A 1TQPA 3QOPA 1YW7A 5CVUA 4JBAA 2DT5A 1P4AA 3JSPA 1IN8A 4AIJA 3WE3A 2JPBA 1ZAOA 3G3ZA 1FT9A 2DLLA 4U0WA 2XAFA 1WRJA 3K1PA 2RKHA 3R0AA 1Z05A 3BWGA 2P7VB 4G8XA 4GYIA 3FMSA 4K2EA 3E97A 4BQAA 1SD6A 4KMUX 1O3QA 4BNCA 3WU1B 2V79A 2L02A 1FBQA 2P5KA 2PMUA 5E1XA 3F72A 2QQAA 2P5VA 2NNNA 3GZ6A 3RKXA 2RGVA 4IRGA 4L18B 1XCVA 1AWCA 1TW3A 1B1BA 2DPUA 1XSDA 1OKRA 2VODA 1ODDA 2EFNA 2HQNA 5ILSA 1GXPA 2GA2A 2HTJA 1FYMA 2R3SA 1YIOA 3COAC 2PLYA 1IN7A 3GX4X 4O3MA 3ZMZA 3I53A 3F6OA 3GW2A 4OOIA 3QPHA 2EFQA 1HW1A 2L01A 2HGCA 4B8XA 1T0FA 5BPIA 1XSXA 2MC3A 5DCMB 4CDGA 3L9FA 3NQOA 3T5XA 1H9TA 3IRQA 3SZPA 1JHHA 1SD5A 5EEHA 2ESNA 4AIHA 5DD8A 5FD6A 3H3UA 1FY7A 1QBJA 3L00A 2STWA 4A5NA 2A5YB 1QNTA 3WTSC 2FBHA 1UFMA 1OR7A 4PZJA 4MQVA 3K1MA 5E17F 2C6YA 1L0OC 3RYPA 2QLZA 5E18F 2XGXA 1F1ZA 4ZYHA 2DBBA 3LFKA 1EH6A 1SFXA 2GAUA 1XCBA 2PQ8A 2PI0A 2CSOA 2OA4A 4LK0F 2V1UA 3TDZC 1MJBA 1S29A 1P6RA 3HTUA 2ZBKA 4WCGA 1MDMB 3E6BA 5E8GA 1OPCA 3MZYA 4N0BA 1IRGA 1BM9A 2HWVA 1WQ2A 2HEOA 3AAFA 2L4MA 3KP3A 3JAMZ 1JE8A 1T2KA 2LKPA 1QZYA 3NEUA 4EJTA 2IA0A 2VC0A 3Q5FA 1NHAA 2VT3A 2O61A 1RZ4A 4ETSA 4MQ9F 3GFJA 1YG2A 3IWZA 3F22A 3G73A 3TO7A 3B02A 3BJOA 1GHCA 2F5FA 2ZNYA 1FC3A 1YQAA 1G6NA 3M1EA 3O3KA 1LVAA 4G6DA 5ICCA 1FBUA 1BIBA 1R1UA 4L5JA 3HYIA 3BOQA 4RAYA 5CYVA 2CGPA 2MBFA 4YG2F 5AONA 3RDIA 4OIQF 2FSWA 4Z2YA 1OYYA 2CQKA 4U7BA 5BOXA 3HSFA 4GYGA 1I1SA 2IJLA 1I5ZA 2XASA 2GQQA 1K78A 4UV8A 1TQMA 4HOBA 3V8LA 3WGHA 2W24A 5DCFA 3D5LA 5FLXK 4G6QA 1BI1A 4DNCA 2PFBA 2UZKA 1IN5A 2DU9A 1OYWA 4WK8F 4A6DA 3QU6A 3RI4A 2M30A 3MWMA 3BZ6A 4LLGF 3ABTA 4YFKF 1B9NA 4H0EA 4OIOF 3QU3A 2F5EA 2COMA 4LFUA 3T0YA 3DPLC 3K69A 1K6OA 3M8FA 2E1NA 1YTYA 1I27A 2DFIA 5LHHA 3RJPA 4EJVA 1ON1A 3RIRA 3GEZA 4A2UA 1RIOH 1C0WA 4HV5A 2FQ3A 3ZN0A 4GGGA 2W25A 6PAXA 5J6XA 4A5MA 1TNTA 2EK5A 4IF4A 4IRIA 2VE9A 1JXSA 2D45A 4P55A 4IRHA 1DDNA 3K0LA 2WC2A 3BPXA 4I7HA 3NRVA 3CJNA 1SD4A 3WTYC 1ZG5A 1YO5C 1ZG3A 3J80K 4IHTA 3TOAA 3CUQC 5CLSA 2EFOA 4EJUA 2ZFWA 1QQIA 2DPDA 2QQ9A 3GFMA 4RAZA 1E2XA 2P7CB 1J59A 3QP6A 1GXQA 1B6AA 5DV5A 3JW4A 3ELKA 2BBYA 1ON2A 3L09A 1FPQA 4KIFA 5E20A 5F64A 5HLIA 4LB6B 5D6FA 4G9YA 3BY6A 1WI9A 2JTVA 4L9TA 5ERIA 3JTGA 2TDXA 3V7SA 4KA4A 1R5HA 2VT2A 2M45A 4BHBA 3RKYA 2XV4S 1U3EM 3LAPA 2B0LA 1SFEA 2UWMA 2XKPA 3TOBA 2YX7A 5CVRA 2EWNA 4RGSA 2XRNA 3I54A 4OIRF 3ECHA 3K2ZA 2EB7A 4HV6A 4G7ZF 2XVCA 3I5UA 2BYVE 3HRMA 3U9GA 1BI2A 2OU2A 2QM3A 4R79A 1ZGJA 4HA8A 2FNAA 2WTEA 3RKWA 3IKVA 3MZHA 1USSA 2K4JA 3BJAA 1G3TA 2P5LC 4ON0A 1IRFA 1FBSA 5FFXA 2A6HF 1I6XA 4ESJA 1J9IA 3O6BB 4WXCA 2O8XA 2VXZA 3F8CA 4MTEA 2M5WA 1PP8F 4NHJA 3HOSA 3HHGA 4WXHA 3R0JA 1DUXC 3DPTA 4I98B 2K86A 3CO7C 1T39A 5LLQA 4RB3C 3LA2A 4U88A 2BV6A 2A61A 4G94A 1FNNA 3ABUA 2NYXA 1KU9A 1FOKA 4XLNF 5JVTA 1LEAA 2G7HA 2GXBA 4KN4X 2ZO4A 5LHIA 3DEUA 3FXQA 1FSEA 1Y0UA 1B59A 5CJ9A 2KIUA 1J7KA 3RPUA 1O57A 1EH7A 3TGNA 4RB0A 1OMIA 2HKOA 4LLNA 4UUVA 2ZKZA 4M71A 4S05A 1S6LA 2FU4A 3GVAA 4HF2A 4CGZA 1O3TA 3HIFA 1R23A 3E5XA 1LDDA 1BIAA 1MJ9A 3J81K 1IXCA 4TV7A 5D6EA 2CW0F 1PUEE 2ETHA 1S7AA 3WG9A 2RV8A 4KUMA 2KIFA 1FWZA 2PMHA 4ENJA 1FX7A 3GZ5A 4S04A 4KNYA 4M6XA 4MGRA 1BBYA 2HDCA 1K78B 4AWXB 2O0YA 5LRRA 2Y48A 2D1HA 1W7PD 5DUIA 1ZREA 1W4MA 2HQRA 1HKSA 1B9MA 4I02A 5HDGA 1G3YA 3R60A 3KP2A 4HZFA 3S2WA 4L9VA 1Z91A 3VB2A 1YS7A 3MQ0A 3HHHA 3ZMTA 1P92A 1LDJA 3ML6A 4GXOA 2K27A 1FYLA 5D8KB 1YS6A 1EV7A 3SXYA 1GVJA 1HKQA 5ED4A 1HBXG 1REPC 1KYZA 4WF2A 2QVOA 2HZTA 5TJJA 4PCQA 2XUBA 2YU3A 4OINF 1IZ1A 3LQRA 5DD4A 3F8NA 4KDPA 3QRFF 2RC4A 5D8LB 5K1YA 1R22A 2DAOA 3R4KA 2V1DA 1ZGAA 4OMYA 1HW5A 3WE2A 1TW2A 4ASNA 3E6MA 1MD0A 1O3SA 1BOAA 3T8RA 5A2QK 1FYKA 2Q0OA 2VBYA 1FLIA 3P9CA 3GO5A 5AIPA 4BXUA 2KJBA 4HX4A 1TTYA 2YPRA 4RGUA 1CF7A 3DFGA 2R7DA 1D5VA 3GFIA 4MEXF 3K9TA 4EMSA 5LGUA 3EYIA 3KETA 3WGGA 5FGMA 4ESFA 2H09A 5F6FA 1J2XA 2FEZA 1ZH5A 3I59A 1IN6A 4N9IA 4UHTA 4MNUA 1YYVA 2Z99A 4BAYA 4RGXA 1LB2A 1SAXA 1IUYA 5BS6A 5K5QA 4LGWA 1ZRCA 4LD5A 3FZVA 2XHKA 4QWQA 3J7AO 4KYWA 2VC1A 1S3JA 4QLCU 2BE5F 3BROA 3WTXC 2E1CA 2Z33A 4ENKA 3MCZA 1SD7A 3KZZA 3KP5A 2QBYA 1O7LA 2L54A 4RS8A 3FF5A 2XAHA 5D5XB 4ESBA 5ILUA 4LLLA 1U6GA 3HSRA 4Q47A 3F8FA 1T6SA 2ZJ2A 3DF8A 4M73A 4MEYF 2EV5A 2VE8A 5HVQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRF A;  4ZH4 F;  2V9V A;  5D4S A;  3R61 A;  3SHF A;  1D8J A;  1ZLJ A;  3PQK A;  3ZMS A;  5D5U B;  1U5T A;  5EEG A;  5E1W A;  2XAQ A;  2RNJ A;  5JFR A;  3ROU A;  3C7J A;  2WWY A;  4KFC A;  2EFW A;  4L0Y B;  2QYO A;  2XRO A;  3ZN1 A;  1XD7 A;  3RYR A;  3KE2 A;  3CDH A;  5FB2 A;  5L3E A;  2K02 A;  1KU2 A;  5KK1 A;  1XSV A;  1RI7 A;  4CHU A;  3DXJ F;  2Y75 A;  3FM5 A;  1R1V A;  1Z7U A;  4R1H A;  4I2O A;  3F23 A;  3HSE A;  1DP7 P;  3Q9S A;  2HS5 A;  2M87 A;  2A07 F;  4KN7 X;  3SFZ A;  2P6S A;  4HF1 A;  2UXN A;  5HLG A;  5DEQ A;  2O6G E;  2PBI A;  2HKX A;  4F7Z A;  4IJA A;  5H6R A;  5DUK A;  3BP8 A;  3MFK A;  1EH8 A;  1XDS A;  3EYY A;  4ZZD A;  3EQL F;  2X0L A;  4ZYD A;  4FX4 A;  4BYY A;  4NQW A;  5ICF A;  3V7C A;  3KFW X;  4HBL A;  3U2R A;  2EA4 A;  5J8F A;  4ENN A;  2J5O A;  2ZME A;  2ACJ A;  5IT9 K;  3F8B A;  4A6E A;  1HW2 A;  1BJA A;  3V8K A;  3E6C C;  1YLF A;  5J8C A;  3CO6 C;  2CFX A;  1ONV A;  4LK1 F;  1JGS A;  2FXA A;  2K4B A;  4EM2 A;  4L9J A;  1HKT A;  5LGT A;  2R7F A;  4KMF A;  3P7N A;  2A6E F;  2ISZ A;  1U78 A;  1IAW A;  4JQF A;  1B4A A;  3CLO A;  2EV6 A;  3RTR A;  1ZN2 A;  2QEN A;  3LWF A;  4CIC A;  1KU3 A;  2PJP A;  3LST A;  2ELH A;  2EFP A;  2OZ6 A;  4CYD A;  4N9H A;  2Q8K A;  4IHS A;  2LDU A;  3B73 A;  4IPA A;  1RUO A;  3IRR A;  3PFI A;  4D0P A;  1WWX A;  1R00 A;  4BHC A;  4P5O A;  1Z1D A;  1P4X A;  4L0Z B;  3TQN A;  2H6C A;  2MH2 A;  3I4P A;  5CVV A;  4HX8 A;  2PN6 A;  2ESH A;  5HS8 A;  4HDU A;  1CF7 B;  1IN4 A;  2RVC A;  4EM1 A;  3ZMV A;  5BMZ A;  2O3F A;  4XLP F;  2LNB A;  5HDK A;  3TO9 A;  5LHG A;  2OQR A;  3Q9V A;  2BEO A;  2MH9 A;  2H27 A;  1XDU A;  4U7D A;  2XIG A;  3DP7 A;  1KQ9 A;  4LMY A;  1UHM A;  3I59 B;  2GIV A;  4LG0 A;  4P9U A;  3ULQ B;  4Y17 A;  2JPC A;  1XMK A;  3RPQ A;  3LA3 A;  4AD9 A;  4HQE A;  4EJW A;  4EGY A;  3MAJ A;  4I0A A;  2ADU A;  2DQL A;  1PDN C;  2O03 A;  5ICG A;  4UVB A;  2YR2 A;  5F1R A;  4PGH A;  1J75 A;  2UXX A;  2STT A;  1LJ9 A;  3IWF A;  5TRD A;  2M1B A;  1BI0 A;  1P4W A;  3GFL A;  4Q4Z F;  2W84 A;  3ERE D;  1WSU A;  2EV0 A;  2PG4 A;  1S8N A;  2QBY B;  5FFZ A;  4I01 A;  1UCR A;  1VTN C;  5JI6 A;  5FLX Z;  2FBI A;  2GA1 A;  1R5G A;  1G4D A;  3JTH A;  2YX4 A;  4HDV A;  2P6T A;  3WTW C;  2Q2E A;  2CYY A;  2W57 A;  2CWE A;  2DQR A;  4A12 A;  4AIK A;  1ZHF A;  1FP1 D;  3V8J A;  4HF0 A;  4HYE A;  2RDP A;  3P9K A;  2IW5 A;  1RNL A;  3SQN A;  1XGM A;  2VOO A;  2DI3 A;  2EA2 A;  1D8K A;  2KKO A;  2A68 F;  2HFH A;  3E3V A;  3JAM K;  2F2E A;  4M6Y A;  1U5T B;  4WX9 A;  1IF1 A;  3TO6 A;  2F5C A;  3IC7 A;  3D0S A;  3V4G A;  4B09 A;  4YIF A;  1YW8 A;  1TLH B;  2MD5 A;  2GXG A;  3EUH A;  4OIP F;  1FZP B;  2G7U A;  3SZT A;  2FE3 A;  3HRU A;  3C18 A;  1SFU A;  2MLK A;  4CZZ A;  4EV0 A;  4Q5S F;  3FXU A;  2NRA C;  4YFN F;  4UXN A;  4M9X A;  3J80 Z;  1CGP A;  4IXA A;  5LEJ A;  1SMT A;  2G9W A;  4CO8 A;  1V3F A;  2QWW A;  2VBX A;  3W6J B;  4R8H A;  2DW4 A;  2OZU A;  3TDU C;  3I58 A;  1QGP A;  4UVA A;  1KGS A;  4A0Z A;  2FRH A;  2H6B A;  1F4K A;  1BI3 A;  2FOK A;  1UST A;  2GZW A;  4PDK A;  1LEB A;  2QQB A;  3WTU C;  3CUQ A;  1XN7 A;  1SMY F;  5AIQ A;  3H3Z A;  2OQG A;  3F8M A;  3WTV C;  2DTR A;  1J5Y A;  2ZME B;  2QZ8 A;  4DQ2 A;  1KQ8 A;  4BHP A;  3T1B A;  1R1T A;  2VN2 A;  2RQP A;  5FO5 A;  3ISP A;  3GLX A;  4EGZ A;  4A0X A;  2OD5 A;  1BC8 C;  2HYG D;  1R7J A;  4M74 A;  1TBX A;  2AS5 F;  3EDP A;  4A0Y A;  2V1X A;  1AOY A;  4NB5 A;  1Z6R A;  3W6K B;  3GF2 A;  1U8R A;  2L3D A;  3EET A;  2FMY A;  3ECO A;  3FXR A;  3KEQ A;  3VOD A;  5ICE A;  1LNW A;  3I0T A;  5LBQ A;  1BC7 C;  3MEX A;  2KJC A;  5D4R A;  1U2W A;  5HLH A;  4WXD A;  1A04 A;  2K7L A;  2Z9O A;  4I09 A;  2YSR A;  3GXO A;  4XBF A;  3CUO A;  3F3X A;  4L5I A;  1Q1H A;  1F9N A;  1R58 A;  2WV0 A;  2LF8 A;  2IP2 A;  2P8T A;  2QUF A;  3CTA A;  5H20 A;  2EJR A;  5BPD A;  3ZP5 A;  2OBP A;  3O2P E;  1WKM A;  4U0V A;  2A3S A;  5D5W B;  1KYW A;  1LQ1 A;  2FF4 A;  2NAZ A;  5L3B A;  2E7X A;  1QO0 D;  2DO7 A;  5DYM A;  3T8T A;  2IPQ X;  4EVI A;  5L3C A;  3BPV A;  5BQT A;  4ENM A;  1KU7 A;  2D2W A;  2PEX A;  3F6V A;  4LG0 B;  2NNY A;  4XSX F;  5K5R A;  4HLX A;  4MHG A;  3FX3 A;  3HTS B;  4UNO A;  1L3L A;  4RB2 C;  3V7R A;  1FSH A;  3TKY A;  4KT5 C;  3FHZ A;  3IHU A;  1W7P A;  1W5T A;  3J81 Z;  2XAJ A;  2ZCW A;  3C1D A;  3DV8 A;  4HW0 A;  1DPU A;  1YFH A;  4KIB A;  4FHT A;  1XGS A;  3PQJ A;  2HTS A;  2IA2 A;  4EM0 B;  3LQQ A;  3OOP A;  2J5P A;  4EJO A;  1G3W A;  1ZAR A;  1YW9 A;  3GUD A;  2OAZ A;  3WGI A;  4OMZ A;  3E5Q A;  2HOE A;  1JHF A;  3KZY A;  2CO5 A;  1ZRF A;  3WU0 A;  2FA5 A;  2XAG A;  1W5S A;  5KVR A;  5HS9 A;  3QPT A;  1X3U A;  3HUG A;  4MTD A;  2Y0M A;  2E7W A;  5CVJ A;  2AXL A;  4O6J A;  2X4H A;  5DDG A;  3LAJ A;  3KP7 A;  1LDK B;  2IA1 A;  3HRT A;  2F5D A;  3KCC A;  4FX0 A;  2HR3 A;  1XGO A;  3GYH X;  2L4A A;  4M9S A;  3KP4 A;  2CG4 A;  1RUN A;  5L3G A;  2V6C A;  1Z6T A;  5L3D A;  4M9Z A;  4FT8 A;  5IT3 A;  5K5O A;  5ILV A;  3QP5 A;  1T38 A;  4RB1 A;  4G7H F;  3ZPL A;  3M7G A;  5A2Q Z;  1IXS B;  2FBK A;  4BH9 A;  3P9I A;  1R36 A;  3OV8 A;  3HRS A;  5CVI A;  2FML A;  3VOE A;  5D5V B;  3E5U A;  4LJZ F;  5LRS A;  3KEO A;  3I64 A;  4ZYG A;  1QZZ A;  3WTZ A;  2KIM A;  1HSJ A;  1TQI A;  3IL2 A;  4IVN A;  4P96 A;  1MZB A;  2JZY A;  3N97 A;  3I71 A;  1XMA A;  1V4R A;  4RGR A;  3LA7 A;  1XB4 A;  1QPM A;  5L3F A;  3KLN A;  3FM3 A;  3CUQ B;  3ZMU A;  2DK8 A;  5E8I A;  3REO A;  2VON A;  5DCM A;  3KP6 A;  4YFX F;  1H0M A;  1STZ A;  1MKM A;  5HS7 A;  4I0B A;  1FP2 A;  2IT0 A;  2FNP A;  3C3W A;  3QAH A;  4YII A;  3JSO A;  4O5V A;  4AVP A;  1I1G A;  4KIC A;  4Y13 A;  1UHW A;  1O7F A;  4XRF A;  3U1D A;  2P4W A;  4UVC A;  2RN7 A;  5LEK A;  4UV9 A;  4G7O F;  2Z3Y A;  2H94 A;  3FMQ A;  3E6D A;  4EQQ A;  2JSC A;  2XKO A;  3M9A A;  3F21 A;  2JRT A;  2IRF G;  1E17 A;  3FWE A;  2HYF A;  2A69 F;  2MLG A;  3DKW A;  3VEP A;  1IW7 F;  4U0Y A;  4Q48 A;  1J0R A;  3WOD F;  4GCV A;  1S7O A;  3VFZ A;  1DPR A;  1MDM A;  1O3R A;  2VOP A;  1XGN A;  5JR3 A;  5HDN A;  1ZRD A;  5JHU A;  2NS0 A;  1KA8 A;  4Y15 A;  4XSZ F;  2LF7 A;  1K7A A;  1HQC A;  4HQM A;  3KLO A;  1H9G A;  2D1V A;  4P9F A;  2BGC A;  1Z9C A;  2VBZ A;  1D3Y A;  1ZG1 A;  3K1N A;  3N4M A;  4M72 A;  3L2C A;  3WTT C;  3HOT A;  1HXD A;  4WWC A;  1HST A;  4HLY A;  1MJA A;  5E1Z B;  1ZLK A;  5H6Q A;  3IKT A;  2ZXJ A;  2JT1 A;  4KIG A;  2VBW A;  1K79 A;  2M8E A;  4CXF A;  2ZNZ A;  1G3S A;  3GWZ A;  3FMR A;  4JK1 X;  4ZZL A;  1OYI A;  3L7W A;  1PP7 U;  3BDD A;  4E70 A;  1P2F A;  1ULY A;  3ZMD A;  5FD5 A;  4LB5 A;  3DQV C;  2LSO A;  2W85 A;  5HOO A;  1W7P B;  3BJ6 A;  1TNS A;  2Z5U A;  2MA3 A;  1KQ0 A;  1BN5 A;  2DK5 A;  4PGG A;  4L9N A;  5LGN A;  4HX7 A;  3ZQ7 A;  2ISY A;  4GO1 A;  1IXR C;  1U5T C;  4OU0 A;  2IVM A;  3M8E A;  3R6S A;  2GWR A;  4HAM A;  1ZYR F;  1T98 A;  3H92 A;  1MGT A;  5IT9 Z;  4ZYE A;  1F5T A;  1UB9 A;  1TQP A;  3QOP A;  1YW7 A;  5CVU A;  4JBA A;  2DT5 A;  1P4A A;  3JSP A;  1IN8 A;  4AIJ A;  3WE3 A;  2JPB A;  1ZAO A;  3G3Z A;  1FT9 A;  2DLL A;  4U0W A;  2XAF A;  1WRJ A;  3K1P A;  2RKH A;  3R0A A;  1Z05 A;  3BWG A;  2P7V B;  4G8X A;  4GYI A;  3FMS A;  4K2E A;  3E97 A;  4BQA A;  1SD6 A;  4KMU X;  1O3Q A;  4BNC A;  3WU1 B;  2V79 A;  2L02 A;  1FBQ A;  2P5K A;  2PMU A;  5E1X A;  3F72 A;  2QQA A;  2P5V A;  2NNN A;  3GZ6 A;  3RKX A;  2RGV A;  4IRG A;  4L18 B;  1XCV A;  1AWC A;  1TW3 A;  1B1B A;  2DPU A;  1XSD A;  1OKR A;  2VOD A;  1ODD A;  2EFN A;  2HQN A;  5ILS A;  1GXP A;  2GA2 A;  2HTJ A;  1FYM A;  2R3S A;  1YIO A;  3COA C;  2PLY A;  1IN7 A;  3GX4 X;  4O3M A;  3ZMZ A;  3I53 A;  3F6O A;  3GW2 A;  4OOI A;  3QPH A;  2EFQ A;  1HW1 A;  2L01 A;  2HGC A;  4B8X A;  1T0F A;  5BPI A;  1XSX A;  2MC3 A;  5DCM B;  4CDG A;  3L9F A;  3NQO A;  3T5X A;  1H9T A;  3IRQ A;  3SZP A;  1JHH A;  1SD5 A;  5EEH A;  2ESN A;  4AIH A;  5DD8 A;  5FD6 A;  3H3U A;  1FY7 A;  1QBJ A;  3L00 A;  2STW A;  4A5N A;  2A5Y B;  1QNT A;  3WTS C;  2FBH A;  1UFM A;  1OR7 A;  4PZJ A;  4MQV A;  3K1M A;  5E17 F;  2C6Y A;  1L0O C;  3RYP A;  2QLZ A;  5E18 F;  2XGX A;  1F1Z A;  4ZYH A;  2DBB A;  3LFK A;  1EH6 A;  1SFX A;  2GAU A;  1XCB A;  2PQ8 A;  2PI0 A;  2CSO A;  2OA4 A;  4LK0 F;  2V1U A;  3TDZ C;  1MJB A;  1S29 A;  1P6R A;  3HTU A;  2ZBK A;  4WCG A;  1MDM B;  3E6B A;  5E8G A;  1OPC A;  3MZY A;  4N0B A;  1IRG A;  1BM9 A;  2HWV A;  1WQ2 A;  2HEO A;  3AAF A;  2L4M A;  3KP3 A;  3JAM Z;  1JE8 A;  1T2K A;  2LKP A;  1QZY A;  3NEU A;  4EJT A;  2IA0 A;  2VC0 A;  3Q5F A;  1NHA A;  2VT3 A;  2O61 A;  1RZ4 A;  4ETS A;  4MQ9 F;  3GFJ A;  1YG2 A;  3IWZ A;  3F22 A;  3G73 A;  3TO7 A;  3B02 A;  3BJO A;  1GHC A;  2F5F A;  2ZNY A;  1FC3 A;  1YQA A;  1G6N A;  3M1E A;  3O3K A;  1LVA A;  4G6D A;  5ICC A;  1FBU A;  1BIB A;  1R1U A;  4L5J A;  3HYI A;  3BOQ A;  4RAY A;  5CYV A;  2CGP A;  2MBF A;  4YG2 F;  5AON A;  3RDI A;  4OIQ F;  2FSW A;  4Z2Y A;  1OYY A;  2CQK A;  4U7B A;  5BOX A;  3HSF A;  4GYG A;  1I1S A;  2IJL A;  1I5Z A;  2XAS A;  2GQQ A;  1K78 A;  4UV8 A;  1TQM A;  4HOB A;  3V8L A;  3WGH A;  2W24 A;  5DCF A;  3D5L A;  5FLX K;  4G6Q A;  1BI1 A;  4DNC A;  2PFB A;  2UZK A;  1IN5 A;  2DU9 A;  1OYW A;  4WK8 F;  4A6D A;  3QU6 A;  3RI4 A;  2M30 A;  3MWM A;  3BZ6 A;  4LLG F;  3ABT A;  4YFK F;  1B9N A;  4H0E A;  4OIO F;  3QU3 A;  2F5E A;  2COM A;  4LFU A;  3T0Y A;  3DPL C;  3K69 A;  1K6O A;  3M8F A;  2E1N A;  1YTY A;  1I27 A;  2DFI A;  5LHH A;  3RJP A;  4EJV A;  1ON1 A;  3RIR A;  3GEZ A;  4A2U A;  1RIO H;  1C0W A;  4HV5 A;  2FQ3 A;  3ZN0 A;  4GGG A;  2W25 A;  6PAX A;  5J6X A;  4A5M A;  1TNT A;  2EK5 A;  4IF4 A;  4IRI A;  2VE9 A;  1JXS A;  2D45 A;  4P55 A;  4IRH A;  1DDN A;  3K0L A;  2WC2 A;  3BPX A;  4I7H A;  3NRV A;  3CJN A;  1SD4 A;  3WTY C;  1ZG5 A;  1YO5 C;  1ZG3 A;  3J80 K;  4IHT A;  3TOA A;  3CUQ C;  5CLS A;  2EFO A;  4EJU A;  2ZFW A;  1QQI A;  2DPD A;  2QQ9 A;  3GFM A;  4RAZ A;  1E2X A;  2P7C B;  1J59 A;  3QP6 A;  1GXQ A;  1B6A A;  5DV5 A;  3JW4 A;  3ELK A;  2BBY A;  1ON2 A;  3L09 A;  1FPQ A;  4KIF A;  5E20 A;  5F64 A;  5HLI A;  4LB6 B;  5D6F A;  4G9Y A;  3BY6 A;  1WI9 A;  2JTV A;  4L9T A;  5ERI A;  3JTG A;  2TDX A;  3V7S A;  4KA4 A;  1R5H A;  2VT2 A;  2M45 A;  4BHB A;  3RKY A;  2XV4 S;  1U3E M;  3LAP A;  2B0L A;  1SFE A;  2UWM A;  2XKP A;  3TOB A;  2YX7 A;  5CVR A;  2EWN A;  4RGS A;  2XRN A;  3I54 A;  4OIR F;  3ECH A;  3K2Z A;  2EB7 A;  4HV6 A;  4G7Z F;  2XVC A;  3I5U A;  2BYV E;  3HRM A;  3U9G A;  1BI2 A;  2OU2 A;  2QM3 A;  4R79 A;  1ZGJ A;  4HA8 A;  2FNA A;  2WTE A;  3RKW A;  3IKV A;  3MZH A;  1USS A;  2K4J A;  3BJA A;  1G3T A;  2P5L C;  4ON0 A;  1IRF A;  1FBS A;  5FFX A;  2A6H F;  1I6X A;  4ESJ A;  1J9I A;  3O6B B;  4WXC A;  2O8X A;  2VXZ A;  3F8C A;  4MTE A;  2M5W A;  1PP8 F;  4NHJ A;  3HOS A;  3HHG A;  4WXH A;  3R0J A;  1DUX C;  3DPT A;  4I98 B;  2K86 A;  3CO7 C;  1T39 A;  5LLQ A;  4RB3 C;  3LA2 A;  4U88 A;  2BV6 A;  2A61 A;  4G94 A;  1FNN A;  3ABU A;  2NYX A;  1KU9 A;  1FOK A;  4XLN F;  5JVT A;  1LEA A;  2G7H A;  2GXB A;  4KN4 X;  2ZO4 A;  5LHI A;  3DEU A;  3FXQ A;  1FSE A;  1Y0U A;  1B59 A;  5CJ9 A;  2KIU A;  1J7K A;  3RPU A;  1O57 A;  1EH7 A;  3TGN A;  4RB0 A;  1OMI A;  2HKO A;  4LLN A;  4UUV A;  2ZKZ A;  4M71 A;  4S05 A;  1S6L A;  2FU4 A;  3GVA A;  4HF2 A;  4CGZ A;  1O3T A;  3HIF A;  1R23 A;  3E5X A;  1LDD A;  1BIA A;  1MJ9 A;  3J81 K;  1IXC A;  4TV7 A;  5D6E A;  2CW0 F;  1PUE E;  2ETH A;  1S7A A;  3WG9 A;  2RV8 A;  4KUM A;  2KIF A;  1FWZ A;  2PMH A;  4ENJ A;  1FX7 A;  3GZ5 A;  4S04 A;  4KNY A;  4M6X A;  4MGR A;  1BBY A;  2HDC A;  1K78 B;  4AWX B;  2O0Y A;  5LRR A;  2Y48 A;  2D1H A;  1W7P D;  5DUI A;  1ZRE A;  1W4M A;  2HQR A;  1HKS A;  1B9M A;  4I02 A;  5HDG A;  1G3Y A;  3R60 A;  3KP2 A;  4HZF A;  3S2W A;  4L9V A;  1Z91 A;  3VB2 A;  1YS7 A;  3MQ0 A;  3HHH A;  3ZMT A;  1P92 A;  1LDJ A;  3ML6 A;  4GXO A;  2K27 A;  1FYL A;  5D8K B;  1YS6 A;  1EV7 A;  3SXY A;  1GVJ A;  1HKQ A;  5ED4 A;  1HBX G;  1REP C;  1KYZ A;  4WF2 A;  2QVO A;  2HZT A;  5TJJ A;  4PCQ A;  2XUB A;  2YU3 A;  4OIN F;  1IZ1 A;  3LQR A;  5DD4 A;  3F8N A;  4KDP A;  3QRF F;  2RC4 A;  5D8L B;  5K1Y A;  1R22 A;  2DAO A;  3R4K A;  2V1D A;  1ZGA A;  4OMY A;  1HW5 A;  3WE2 A;  1TW2 A;  4ASN A;  3E6M A;  1MD0 A;  1O3S A;  1BOA A;  3T8R A;  5A2Q K;  1FYK A;  2Q0O A;  2VBY A;  1FLI A;  3P9C A;  3GO5 A;  5AIP A;  4BXU A;  2KJB A;  4HX4 A;  1TTY A;  2YPR A;  4RGU A;  1CF7 A;  3DFG A;  2R7D A;  1D5V A;  3GFI A;  4MEX F;  3K9T A;  4EMS A;  5LGU A;  3EYI A;  3KET A;  3WGG A;  5FGM A;  4ESF A;  2H09 A;  5F6F A;  1J2X A;  2FEZ A;  1ZH5 A;  3I59 A;  1IN6 A;  4N9I A;  4UHT A;  4MNU A;  1YYV A;  2Z99 A;  4BAY A;  4RGX A;  1LB2 A;  1SAX A;  1IUY A;  5BS6 A;  5K5Q A;  4LGW A;  1ZRC A;  4LD5 A;  3FZV A;  2XHK A;  4QWQ A;  3J7A O;  4KYW A;  2VC1 A;  1S3J A;  4QLC U;  2BE5 F;  3BRO A;  3WTX C;  2E1C A;  2Z33 A;  4ENK A;  3MCZ A;  1SD7 A;  3KZZ A;  3KP5 A;  2QBY A;  1O7L A;  2L54 A;  4RS8 A;  3FF5 A;  2XAH A;  5D5X B;  4ESB A;  5ILU A;  4LLL A;  1U6G A;  3HSR A;  4Q47 A;  3F8F A;  1T6S A;  2ZJ2 A;  3DF8 A;  4M73 A;  4MEY F;  2EV5 A;  2VE8 A;  5HVQ C; 
#chains in the Genus database with same CATH topology
 2KRF A;  4ZH4 F;  1ERD A;  2V9V A;  5D4S A;  1JKQ C;  2JRM A;  3VWB A;  3R61 A;  3SHF A;  1D8J A;  1ZLJ A;  2LY2 A;  2QCO A;  3PQK A;  1VQ9 I;  3ZMS A;  5D5U B;  3CF5 F;  2QQ8 A;  3JRA A;  2MD0 A;  1U5T A;  2CS3 A;  5EEG A;  5E1W A;  1YIT I;  2XAQ A;  3S32 A;  5K7F A;  3S14 J;  2RNJ A;  1RC9 A;  5JFR A;  3ROU A;  4XKW A;  3C7J A;  4J19 A;  2WWY A;  4F92 B;  4KFC A;  3F0C A;  2VKE A;  2EFW A;  5M3F J;  1LUJ B;  4L0Y B;  2QYO A;  2XRO A;  3ZN1 A;  1XD7 A;  2QA4 I;  3RYR A;  3KE2 A;  3CDH A;  2ME0 A;  3OYN A;  5KNL A;  2G0E A;  5IYC J;  2PMZ A;  5L3E A;  5FB2 A;  2E1M B;  2K02 A;  1KU2 A;  1OLT A;  2ZSH B;  2DMP A;  5KK1 A;  1XSV A;  3J7A Y;  1RI7 A;  2O7O A;  3DXJ F;  4CHU A;  2Y75 A;  3FM5 A;  2HQ5 A;  1R1V A;  1Z7U A;  3OOU A;  4R1H A;  3DTE A;  2L9S A;  4I2O A;  2RNG A;  5FJ8 J;  3F23 A;  4D7M A;  3HSE A;  1DP7 P;  2XAU A;  2V9P A;  3S3N A;  2KFD A;  2DXI A;  3Q9S A;  2HS5 A;  2M87 A;  2OPT A;  2A07 F;  3K2A A;  4KN7 X;  2BOL A;  3QYF A;  1JKP C;  2X1C A;  2DA7 A;  2P6S A;  4ZYA A;  1T33 A;  3SFZ A;  3ZQH A;  4HF1 A;  2DMU A;  4B43 A;  1YRN B;  3A0B C;  4PJL A;  4QIW N;  1NH3 A;  3OIQ A;  3MKL A;  3VYS B;  2UXN A;  5HLG A;  4HNU A;  5DEQ A;  2O6G E;  2PBI A;  4B4C A;  2HKX A;  4F7Z A;  4E7H A;  4RLQ A;  3CP2 A;  5HNF A;  4XNF A;  4IJA A;  4NNJ A;  5H6R A;  1IUF A;  3ABM H;  5DUK A;  3BP8 A;  3BR6 A;  3MFK A;  2R5Z B;  1V5G A;  1EH8 A;  1XDS A;  3EYY A;  3AL0 C;  4ZZD A;  1SFO J;  3EQL F;  2X0L A;  2HOS A;  4ZYD A;  3QQA A;  4BYY A;  4FX4 A;  4NQW A;  5ICF A;  3V7C A;  3KFW X;  1LPQ A;  2HDW A;  4HBL A;  3U2R A;  2EA4 A;  5J8F A;  4ZC3 A;  4X1E A;  4ENN A;  1K83 J;  2J5O A;  2ZME A;  1EKE A;  2ME6 A;  3MVP A;  2LY1 A;  2ACJ A;  4U87 A;  4LIU A;  5IT9 K;  2X6Y A;  3E1S A;  2D5V A;  3F8B A;  4A6E A;  1PUF A;  1HW2 A;  3I56 I;  3JRE A;  1BJA A;  3V8K A;  3CJR B;  3E6C C;  1YLF A;  1UZC A;  5J8C A;  2ZJR F;  2KIQ A;  3CO6 C;  5IOY A;  1BR1 A;  3CZ6 A;  1W36 C;  4M3F A;  2CFX A;  1JUP A;  1ONV A;  4OWR B;  2GOM A;  2M7B A;  3OYD A;  1MSE C;  5C44 J;  4LK1 F;  3CME I;  1JGS A;  3IAS 2;  3LSP A;  3HOX J;  2FXA A;  4DYQ A;  2K4B A;  3FXM A;  4L9J A;  4EM2 A;  2EIN H;  1HKT A;  5LGT A;  5K7H A;  1E3H A;  1FJL A;  2R7F A;  1Z7L A;  5GAD J;  4KMF A;  3BC8 A;  4EAT A;  1FMV A;  1V5F A;  1F36 A;  2A6E F;  3P7N A;  4JX5 A;  3I4M J;  2BW3 B;  3K70 D;  3PSI A;  2ISZ A;  1U78 A;  5LD2 C;  1IAW A;  4JQF A;  2WB1 N;  5EZG A;  2HVQ A;  2GXA A;  1B4A A;  4M3D A;  4MLO A;  3CLO A;  4II2 A;  1R71 A;  1I50 J;  2EV6 A;  4Y7N J;  3RTR A;  1VQP I;  1HOM A;  1ZN2 A;  1WJA A;  2QEN A;  2NOJ B;  3U21 A;  2WBM A;  3LSI A;  3LWF A;  1JTX A;  4CIC A;  1KU3 A;  3NWT A;  2PJP A;  3LST A;  4KT6 A;  2ELH A;  5B5E C;  2EFP A;  3JRI A;  2OZ6 A;  4QPO A;  1VF9 A;  4N9H A;  4CYD A;  4FCY A;  1BJZ A;  2Q8K A;  2LDU A;  4IHS A;  2LRE A;  3B73 A;  3GBG A;  3Q0V A;  2HDD A;  4IPA A;  1RUO A;  1VI0 A;  1WFX A;  1TZL A;  3IRR A;  3PFI A;  4D0P A;  1WWX A;  1RKW A;  2LBF A;  1R00 A;  3H9G A;  2WAF A;  4BHC A;  2B63 J;  4P5O A;  1Z1D A;  1P4X A;  4L0Z B;  3JRC A;  3TQN A;  2H6C A;  1E3O C;  2MH2 A;  3I4P A;  5CVV A;  2CU7 A;  4HX8 A;  2PN6 A;  2ESH A;  2DN0 A;  5HS8 A;  1MMA A;  4HDU A;  1CF7 B;  1YX5 A;  3G1O A;  1IN4 A;  2RVC A;  1RET A;  4BQQ A;  4RAG A;  4EM1 A;  1T0F C;  3ZMV A;  3IH3 A;  5BMZ A;  2O3F A;  4IX7 A;  4IKF A;  4XLP F;  2LNB A;  5GPA A;  2KRH A;  2NS8 A;  3TO9 A;  5HDK A;  5FRN A;  5LHG A;  2E36 A;  1HC8 A;  2OQR A;  3Q9V A;  2BEO A;  2MH9 A;  4A69 C;  2VQC A;  2H27 A;  1XDU A;  4U7D A;  1GUU A;  2XIG A;  3DP7 A;  1KQ9 A;  3WU2 C;  4LMY A;  2B9S A;  1UHM A;  1OIS A;  3I59 B;  2GIV A;  2DMT A;  4LG0 A;  3VYR B;  4P9U A;  3S3M A;  2AO9 A;  3ULQ B;  1JT0 A;  3S3O A;  4Y17 A;  2VKH A;  4BAC A;  4UUS A;  3HDD A;  2XPW A;  3ZCO A;  3KZI C;  2LTP A;  2X6X A;  4CCJ A;  2LMD A;  2JPC A;  4Y3O A;  1XMK A;  5IPA A;  2R7T A;  3MKZ A;  3A1Y A;  3RPQ A;  1FIP A;  3LA3 A;  4AD9 A;  3CCU I;  3CCE I;  1K6Y A;  1OR7 C;  3SEZ A;  4HQE A;  2B7E A;  3A01 B;  1QVT A;  2DFH A;  2I8D A;  4II3 A;  4EJW A;  2HOT A;  4EGY A;  3MAJ A;  1E0E A;  4I0A A;  2ADU A;  2DQL A;  1K61 A;  1PDN C;  4DYC A;  2O03 A;  5ICG A;  4BE2 A;  4UVB A;  2YR2 A;  5F1R A;  4PGH A;  1J75 A;  3GTP J;  2UXX A;  1SC7 A;  2STT A;  4F52 A;  1LJ9 A;  3IWF A;  1ACI A;  4HNT A;  1I39 A;  5LFA A;  4XLC A;  5TRD A;  2M1B A;  1X3W B;  1BI0 A;  1P4W A;  2VL8 A;  4HRI A;  3GFL A;  5C3E J;  1P7I A;  3H1C A;  4Q4Z F;  2W84 A;  3ERE D;  1WSU A;  2GOX B;  1Y1V J;  4RMN A;  2EV0 A;  1Y1W J;  2PG4 A;  3K4N A;  1S8N A;  2HXI A;  1B8I B;  2QBY B;  2HXO A;  5FFZ A;  4I01 A;  4BL0 B;  1UCR A;  1VTN C;  4IHY A;  5JI6 A;  2MYS A;  5FLX Z;  5HLT A;  3AG1 H;  4C9Y A;  2FBI A;  2GA1 A;  4E7I A;  2DA6 A;  4X6A J;  2M2E A;  4IHW A;  1R5G A;  2OJE D;  1VQM I;  3JTH A;  1G4D A;  4F93 B;  1MMS A;  2YX4 A;  1WZ2 A;  1Z77 A;  3HEF A;  4E7S A;  4HDV A;  2P6T A;  3WTW C;  2JQ7 A;  3ZQQ A;  2V26 A;  2Q2E A;  2CYY A;  2W57 A;  2CWE A;  2DQR A;  4A12 A;  4AIK A;  3PJR A;  1ZHF A;  3PNT A;  1FP1 D;  3V8J A;  3ZGK A;  4HF0 A;  4HYE A;  4LIT A;  2DFF A;  2RDP A;  3P9K A;  2K9N A;  2IW5 A;  1RNL A;  3SQN A;  3UNG C;  1Z21 A;  5KAI C;  1XGM A;  2LVS A;  2GBY A;  2QKL B;  3OL4 A;  4CYC B;  1MH3 A;  2VOO A;  2DI3 A;  1OCZ H;  2EA2 A;  4XRM A;  1D8K A;  3O8H A;  4BDY A;  3PUB A;  2QSF X;  2KKO A;  2Z16 A;  4PFO A;  3BG6 A;  2R7Q A;  3LMM A;  2A68 F;  3S16 J;  4PJJ A;  2HFH A;  3E3V A;  1W1W E;  2LRD A;  3JAM K;  2F2E A;  4M6Y A;  5F0H A;  3JRF A;  2HNH A;  1QVU A;  4NC8 A;  5GAH J;  1MBJ A;  1U5T B;  2RRE A;  2K9L A;  1J09 A;  4WX9 A;  1IF1 A;  2FD5 A;  3TO6 A;  2F5C A;  2LG4 A;  3IC7 A;  3UKG A;  3D0S A;  3V4G A;  4B09 A;  4YIF A;  1YW8 A;  1D0Z A;  1TLH B;  1AKH A;  4RDU A;  2KDZ A;  1JGG A;  2CQX A;  3GTK J;  2VKV A;  3BR3 A;  2MD5 A;  3HM5 A;  2GXG A;  3EUH A;  4OIP F;  1FZP B;  2G7U A;  5HNH A;  3SZT A;  3A0H C;  3OYK A;  2FE3 A;  3HRU A;  4C3I J;  2I5U A;  3C18 A;  3VSK A;  1SFU A;  4A3D J;  2MLK A;  4CZZ A;  4EV0 A;  4Q5S F;  3FXU A;  2NRA C;  4YFN F;  4E7K A;  2DOE A;  5IP6 A;  4UXN A;  4M9X A;  3J80 Z;  1CGP A;  4IXA A;  5LEJ A;  1SMT A;  2G9W A;  4JYK A;  4CO8 A;  1V3F A;  2QWW A;  1NTC A;  2VBX A;  3W6J B;  2A05 A;  4R8H A;  2BVL A;  2AQE A;  2DW4 A;  3SDB A;  3U1K A;  3PIP F;  2DT7 B;  2YUS A;  2OZU A;  3TDU C;  3I58 A;  1RKT A;  1QGP A;  4D1Q A;  2XC7 A;  1M1E B;  4UVA A;  1KGS A;  4A0Z A;  2FRH A;  2M3A A;  4IOA F;  2H6B A;  4G6T B;  1IG7 A;  4A3M J;  1F4K A;  1BI3 A;  2FOK A;  2EIK H;  2BHZ A;  2TCT A;  1UST A;  2GZW A;  4PDK A;  2CQQ A;  2IGN A;  5DS9 A;  4OAZ A;  2QQB A;  3WTU C;  3CUQ A;  1LEB A;  1XN7 A;  2V4J C;  1SMY F;  3QWL A;  1TC3 C;  4BEH A;  4IZZ A;  5AIQ A;  3H3Z A;  2JJ7 A;  4NQW B;  4YIR X;  2L7Z A;  5CPR B;  4S0H B;  4BGD A;  2OQG A;  1XTA A;  3F8M A;  3OYA A;  4Y33 A;  1R6R A;  2DTR A;  3WTV C;  1MW7 A;  5IY5 H;  3M3Y J;  1J5Y A;  2ZME B;  2QZ8 A;  4DQ2 A;  4C30 A;  1Z67 A;  1KQ8 A;  1WH7 A;  1VQK I;  4BQN A;  2PMZ N;  4BHP A;  2EBI A;  1TWH J;  1R1T A;  2VN2 A;  2RQP A;  5FO5 A;  3T1B A;  3ISP A;  3GLX A;  2OD5 A;  4A0X A;  2LKS A;  4EGZ A;  1PUF B;  2E5N A;  1BC8 C;  2HYG D;  4MO7 A;  1R7J A;  2JA8 J;  4G12 A;  4M74 A;  1BR2 A;  1MND A;  4NBQ A;  1TBX A;  2AS5 F;  2VAS A;  3MZ8 A;  4V2G A;  1MH4 A;  4HNV A;  1EA3 A;  2E1O A;  3K4C A;  2KP6 A;  3EDP A;  3MD2 A;  4RAF A;  4A0Y A;  2V1X A;  5EJC A;  1MBG A;  1AOY A;  4NB5 A;  2Y30 A;  3OR1 C;  1Z6R A;  4PJM A;  1QHG A;  1WJB A;  3W6K B;  3GF2 A;  1U8R A;  2L3D A;  1JUS A;  3I9V 2;  3EET A;  1OCP A;  1SFK A;  1RES A;  2FMY A;  2ZXI A;  4DW6 A;  3ECO A;  4C3H J;  4DZJ A;  5GAG J;  3FXR A;  3BG7 A;  3KEQ A;  3VOD A;  1P9Q C;  4CCM A;  1G2H A;  5ICE A;  4MFD A;  2CV2 A;  1LNW A;  3I0T A;  5LBQ A;  1BC7 C;  2VQG A;  3MEX A;  3QOE A;  3SDG A;  3K4B A;  2ZXW H;  2KJC A;  5D4R A;  3S2D J;  1U2W A;  5HLH A;  4WXD A;  1A04 A;  2K7L A;  1N75 A;  3RQI A;  1XS9 A;  2Z9O A;  3PSF A;  4I09 A;  3KYL A;  2R0Q C;  4D5F A;  2YSR A;  3GXO A;  4XBF A;  2JA2 A;  3CUO A;  4DBR A;  3F3X A;  3D1N I;  2VQH A;  2XGC A;  4L5I A;  3OS1 A;  1Q1H A;  5IOZ A;  3HB9 A;  1F9N A;  1R58 A;  1RPW A;  3M1C A;  2KRC A;  5GP9 A;  2WV0 A;  4Y52 J;  2LF8 A;  4XON A;  2DMN A;  2IP2 A;  2P8T A;  4IHV A;  2QUF A;  1KON A;  3CTA A;  1FTT A;  2VIX A;  3O8G A;  5H20 A;  5KAF C;  2EJR A;  5BPD A;  2R7W A;  3ZP5 A;  2OBP A;  3PO3 J;  2LBF B;  2CQN A;  3ZXS A;  3HBL A;  3ZQF A;  3BTJ A;  1GDT A;  2R7U A;  3OIP A;  1Y8R B;  3O2P E;  1YIJ I;  1UJ8 A;  1WKM A;  4U0V A;  1YI2 I;  2A3S A;  1I3A A;  5D5W B;  1KYW A;  4BS9 A;  3CCV I;  3F9K A;  2CH0 A;  4UB8 C;  1LQ1 A;  2FF4 A;  2NAZ A;  5L3B A;  2E7X A;  3FHN A;  1QO0 D;  2DO7 A;  5DYM A;  3T8T A;  2OC6 A;  3WHC A;  1MSF C;  1A6Q A;  2IPQ X;  4EVI A;  5L3C A;  4JP0 A;  3BPV A;  5BQT A;  5DM6 F;  3L2R A;  4ENM A;  3L2W A;  4CH7 A;  1KU7 A;  2D2W A;  3HG9 A;  5M5Y J;  3BZC A;  3WG7 H;  2PEX A;  3F6V A;  3W2W A;  2QEX I;  4LG0 B;  2NNY A;  1VQN I;  4XSX F;  3GTO J;  4UUS B;  5K5R A;  4HLX A;  4MHG A;  2JUC A;  3CF2 A;  3FX3 A;  2QSH X;  3HTS B;  1ETQ A;  2K9Q A;  4B48 A;  4UNO A;  3LFU A;  4DJA A;  3L1P A;  1L3L A;  4RB2 C;  3V7R A;  4V2F A;  4B3X A;  1FSH A;  3TKY A;  2Y2Z A;  4AVZ A;  3B6A A;  4KT5 C;  5FLV A;  3FHZ A;  3IHU A;  1W7P A;  1UEL B;  1W5T A;  3J81 Z;  2XAJ A;  2ZCW A;  3C1D A;  4PK4 A;  1WJ5 A;  3DV8 A;  3H9Q A;  4HW0 A;  3RQ4 A;  1DPU A;  2MSY A;  3TP0 A;  2DA2 A;  4KIB A;  4FHT A;  1YFH A;  3BZK A;  1XGS A;  1QU3 A;  3PNY A;  1FOY A;  3PQJ A;  2HTS A;  2IA2 A;  4EM0 B;  3CC4 I;  5FKM A;  3LQQ A;  4BXX J;  2IEK A;  5TIS C;  2M0M A;  2E2H J;  3OOP A;  3JCU C;  3DBR B;  2J5P A;  2CMP A;  4EJO A;  5KHD A;  1G3W A;  2I10 A;  1ZAR A;  3GME A;  1YW9 A;  2KPM A;  2ZJQ F;  4PSW A;  1LVK A;  3GUD A;  2OAZ A;  3HOV J;  3WGI A;  1ETK A;  1XG1 A;  4YRV A;  2LC2 A;  3LSM A;  4OMZ A;  3E5Q A;  1U8B A;  3Q0U A;  2DDB A;  2HOE A;  2BY0 A;  2E1M C;  1JHF A;  4A3L J;  2X85 A;  1IJW C;  3OYC A;  3W3C A;  3KZY A;  1MBK A;  2CO5 A;  4ITV A;  3VDX A;  1ZRF A;  3WU0 A;  2FA5 A;  2XAG A;  4XKV A;  2KL4 A;  1W5S A;  2H1K A;  4A3G J;  5KVR A;  2Q2E B;  3QPT A;  5HS9 A;  4BJ6 C;  1X3U A;  3IV5 A;  2EIJ H;  3HUG A;  4QTR A;  4MTD A;  2DJN A;  2R7S A;  2Y0M A;  3KPH A;  2E7W A;  2EPF A;  5CVJ A;  1TT0 A;  2AXL A;  2EZL A;  4C3J J;  1ETY A;  4O6J A;  3DCF A;  2X4H A;  5DDG A;  3KYD B;  4DOZ A;  3CP8 A;  3LAJ A;  3KP7 A;  1LDK B;  2WAQ A;  2IA1 A;  3HRT A;  2F5D A;  1UG2 A;  2KZG A;  3K4J A;  3KCC A;  4FX0 A;  2DA3 A;  2MG4 A;  4XK4 A;  2DA4 A;  3JRB A;  2QSG X;  2HR3 A;  1XGO A;  1X1C A;  1Y6I A;  3GTJ J;  3GYH X;  2NVU B;  2L4A A;  3GZN B;  3OS2 A;  4M9S A;  3KP4 A;  2VB6 A;  5J1R A;  3IH4 A;  1FIA A;  3G4S I;  2CG4 A;  2DCE A;  4BXF A;  4A3F J;  1RUN A;  1X19 A;  5L3G A;  4M3G A;  3IH2 A;  2V6C A;  1Z6T A;  5L3D A;  4M9Z A;  4FT8 A;  2HPM A;  4RM3 A;  5IT3 A;  1AKH B;  2TRT A;  5K5O A;  5ILV A;  1XC5 A;  5J47 A;  3QP5 A;  1T38 A;  4RB1 A;  1TWF J;  1WVR A;  1X2M A;  4IO9 F;  4G7H F;  2CV1 A;  3ZPL A;  3M7G A;  5A2Q Z;  1IXS B;  2FBK A;  4BH9 A;  5GTI C;  4J01 A;  3P9I A;  2IGK A;  2O9L A;  1IDZ A;  2W82 A;  3CDI A;  2GM4 A;  1R36 A;  4N4N B;  3AKZ A;  1T95 A;  1IRZ A;  3OV8 A;  3HRS A;  5CVI A;  3M4O J;  2NOG A;  4ZTJ A;  2FML A;  3VOE A;  5D5V B;  1D1A A;  3E5U A;  4LJZ F;  3KEO A;  5LRS A;  4XKB A;  2DA5 A;  3I64 A;  4ZYG A;  1QZZ A;  1NG7 A;  3C2G A;  2COB A;  1WJD A;  3WTZ A;  2KIM A;  1HSJ A;  1TQI A;  2MGQ A;  4IVN A;  3IL2 A;  1OFC X;  4P96 A;  2F6C A;  1MZB A;  1QA6 A;  2JZY A;  5DM7 F;  3HOU J;  3N97 A;  3I71 A;  1XMA A;  1V4R A;  4QSH A;  4RGR A;  3LA7 A;  1VQ5 I;  1XB4 A;  2WY7 Q;  1QPM A;  4LG3 A;  5L3F A;  3CES A;  3KLN A;  3ZQG A;  3FM3 A;  3FDY A;  2X48 A;  3CUQ B;  3DBL B;  3ZMU A;  4BEH B;  2DK8 A;  5E8I A;  2K85 A;  3REO A;  3HKZ A;  2EZI A;  2VON A;  5HOD A;  4UY8 I;  3KEY A;  5DCM A;  2M8G X;  5TGT A;  3AG3 H;  1PVE A;  4DZP A;  2VJJ A;  3KP6 A;  5EGO A;  4YFX F;  3L2Q A;  1H0M A;  2HZD A;  1STZ A;  2ZSI B;  3IAM 2;  1MIJ A;  1YJN I;  1MKM A;  5HS7 A;  1OCO H;  1AU7 A;  4I0B A;  1FP2 A;  2IT0 A;  2FNP A;  3C3W A;  4IQJ A;  1IRX A;  1W36 D;  1VFC A;  3QAH A;  4YII A;  1ITY A;  3JSO A;  4O5V A;  5BNG A;  4AVP A;  5CQE A;  2HI3 A;  5J1Y A;  1KZH A;  1I1G A;  1XMX A;  4KIC A;  4Y13 A;  3G6E I;  2HU9 A;  4XIC A;  4IOC F;  3JRH A;  3BTI A;  2Z1D A;  2XF5 A;  1UHW A;  1O7F A;  4XRF A;  4XID A;  3U1D A;  2P4W A;  2LOO A;  2IGO A;  4UVC A;  2RN7 A;  5LEK A;  4UV9 A;  3TL4 X;  4A3I J;  4G7O F;  5EG0 A;  3ZRG A;  1DU6 A;  2Z3Y A;  2WV1 A;  4XMY A;  2H94 A;  5J4V A;  3DU6 A;  1ZR2 A;  3FMQ A;  1JI8 A;  3RSN A;  3E6D A;  1X4P A;  1LE8 A;  4EQQ A;  2JSC A;  2XKO A;  3H0G J;  1ETW A;  3M9A A;  3F21 A;  2JRT A;  3BR1 A;  1LFU P;  2IRF G;  1N78 A;  1E17 A;  3FWE A;  2HYF A;  3C2H A;  3RKQ A;  5E3O A;  1X3Z B;  2A69 F;  2MLG A;  3DKW A;  3VEP A;  2IS2 A;  1IW7 F;  3HZJ A;  2CUZ A;  4U0Y A;  4Q48 A;  4JX4 A;  1J0R A;  1Z3Y A;  3WOD F;  4GCV A;  3TMO A;  1S7O A;  3VFZ A;  2JMW A;  1DPR A;  1MDM A;  4XM3 A;  1O3R A;  2VOP A;  1XGN A;  5JR3 A;  5HDN A;  4LOC A;  1ZRD A;  3WHB A;  3CCJ I;  5JHU A;  5IP9 J;  2NS0 A;  1KA8 A;  4Y15 A;  4XSZ F;  2W4S A;  3S1Q J;  4BUP A;  2LF7 A;  1K7A A;  3OYG A;  1HDP A;  1HQC A;  4HQM A;  3KLO A;  2AXT C;  3LSK A;  1H9G A;  3FXJ A;  2D1V A;  1SAN A;  1YJW I;  4P9F A;  3PO2 J;  2BGC A;  2W48 A;  1Z9C A;  1MMD A;  1NG6 A;  1IGN A;  2VBZ A;  1YJ9 I;  5FLM J;  2OCC H;  1T56 A;  1D3Y A;  4A3E J;  1ZG1 A;  1UMQ A;  1Y56 A;  3K1N A;  2OTL I;  1RR8 C;  3N4M A;  2O8K A;  4GDF A;  3K4K A;  4M72 A;  3L2C A;  3WTT C;  5EDN A;  4FAS D;  3CCY A;  2KQR A;  3HOT A;  9ANT A;  5FRO A;  1HXD A;  2BXZ A;  2M34 A;  4WWC A;  1HST A;  4HLY A;  2MAB A;  3JR9 A;  1MJA A;  2KHM A;  5E1Z B;  1POG A;  1ZLK A;  2W7N A;  5H6Q A;  3IKT A;  2L0K A;  4N4O B;  2H8W A;  2ZXJ A;  2VPR A;  3MKY B;  2JT1 A;  4W97 A;  4KIG A;  3V42 A;  3CQZ J;  2GLO A;  2VBW A;  1K79 A;  4BDZ A;  1BOB A;  4IEJ A;  3BQY A;  2M8E A;  3RZO J;  2CW7 A;  2VUM J;  4CXF A;  2ZNZ A;  1G3S A;  3GWZ A;  3FMR A;  4JK1 X;  4ZZL A;  1OYI A;  4RA2 A;  1PYV A;  3DTI A;  3L7W A;  2WAD A;  2E2I J;  1BA5 A;  2L9V A;  1PP7 U;  3BG5 A;  3BDD A;  1WJC A;  2QGU A;  4E70 A;  1P2F A;  2X6O A;  1ULY A;  2XPV A;  3BR0 A;  2YS9 A;  1BW6 A;  3ZMD A;  4HEA 2;  5FD5 A;  1OCC H;  3H0D A;  1SVL A;  1V54 H;  1W0T A;  2JA6 J;  1F43 A;  4LB5 A;  3DQV C;  2LSO A;  2W85 A;  5HOO A;  4AUX A;  1W7P B;  3BJ6 A;  1TNS A;  3FK6 A;  2Z5U A;  2MA3 A;  1KQ0 A;  1BN5 A;  2DK5 A;  4LIV A;  4BY1 J;  1GVD A;  4PGG A;  3HOZ J;  3I4N J;  3K10 A;  5K7Z A;  4L9N A;  5GTH C;  5LGN A;  4HX7 A;  4UUT A;  3ZQ7 A;  2ISY A;  3ABK H;  3H5R A;  4GO1 A;  1IXR C;  1U5T C;  2XRL A;  4OU0 A;  2IVM A;  3TBI A;  2R7Z J;  3M8E A;  3LSR A;  2ID3 A;  2Y69 H;  4CZC A;  3R6S A;  2GWR A;  2E5Z A;  3BTL A;  4HAM A;  1ZYR F;  4I99 C;  3SFI A;  1T98 A;  3H92 A;  4XOR A;  1MGT A;  1TL8 A;  2JUG A;  2EH3 A;  1A31 A;  5IT9 Z;  1DP3 A;  4ZYE A;  1F5T A;  1UB9 A;  1TQP A;  3QOP A;  4B44 A;  5F1J A;  1YW7 A;  4QPQ A;  3SEQ A;  2R5Z A;  4V19 K;  2P0W A;  2K3F A;  3BT9 A;  4F55 A;  1X2N A;  5CVU A;  4JBA A;  2DT5 A;  3DBH B;  3VPR A;  1P4A A;  2IAI A;  2AHQ A;  3JSP A;  1IN8 A;  4XLF A;  4AIJ A;  4CCO A;  3WE3 A;  3QPS A;  2JPB A;  5H2F C;  1WCM J;  1ZAO A;  2Q1Z B;  3G3Z A;  1FT9 A;  3HUG B;  2ELJ A;  2DLL A;  3QOD A;  3SZG A;  2H1L A;  5FKO A;  4U0W A;  2XAF A;  1WRJ A;  3VSL A;  2XB5 A;  3K1P A;  1OCR H;  2RKH A;  3R0A A;  4PJ0 C;  1FOX A;  2XGE A;  2DA1 A;  2E35 A;  4FQG A;  1Z05 A;  3BWG A;  1D0X A;  3DLA A;  2W00 A;  2P7V B;  4FTH A;  4G8X A;  4GYI A;  3FMS A;  3CDL A;  4K2E A;  3E97 A;  4BQA A;  1SD6 A;  4GRI A;  2X51 A;  4KMU X;  5E3N A;  1AA7 A;  1O3Q A;  1MBH A;  4BNC A;  5IP7 J;  3WU1 B;  3OYJ A;  2V79 A;  1JKR C;  2L02 A;  2R5Y A;  2DJI A;  2NVY J;  1FBQ A;  3PL8 A;  2P5K A;  4XN3 A;  2PMU A;  5E1X A;  1MBE A;  1U9O A;  2Y0S A;  3F72 A;  2M4G A;  2QQA A;  1ETO A;  2OV7 A;  3OYE A;  2FQ4 A;  2NNN A;  2P5V A;  4XOT A;  1NK2 P;  2R7X A;  3GZ6 A;  3RKX A;  2RGV A;  4Y4R A;  4IRG A;  4B1R A;  1OJL A;  4L18 B;  2ZME C;  3CCQ I;  2KT0 A;  2X6W A;  3AG2 H;  2BVM A;  3LL7 A;  1XCV A;  3H5A A;  1AWC A;  1TW3 A;  1B1B A;  2E60 A;  2DPU A;  1XSD A;  3HXL A;  1D0Y A;  4ZDP A;  1OKR A;  1X1A A;  2HVR A;  2VOD A;  2BHY A;  3S8P A;  3HC7 A;  1ODD A;  2EFN A;  1UG0 A;  2HQN A;  5ILS A;  4E6K G;  2GA2 A;  2HTJ A;  3OYF A;  1GXP A;  1FYM A;  1APL C;  2R3S A;  1VQO I;  1YIO A;  3COA C;  2DDA A;  2PLY A;  1IN7 A;  3GX4 X;  3ONQ A;  4O3M A;  1X1D A;  3GCM A;  3HGY A;  3DKY A;  3IUO A;  1I6H J;  2WAQ N;  1TT5 B;  3ZMZ A;  3I53 A;  3F6O A;  1IDY A;  4W1U A;  3CCS I;  2DTZ A;  3CJT B;  3GW2 A;  4OOI A;  1I3Q J;  1S5L C;  3QPH A;  2EFQ A;  2LLK A;  1HW1 A;  4AYB A;  4BBR J;  2L01 A;  2BZT A;  3RZD J;  2CW8 A;  2M4K A;  2HGC A;  4B8X A;  1T0F A;  1JTY A;  4E4H A;  1P7J A;  5BPI A;  1XSX A;  2MC3 A;  5F08 A;  4I6Z A;  5DCM B;  2LY9 A;  3B6C A;  2NVT J;  3ERM A;  4CDG A;  5EGO B;  3L9F A;  3NQO A;  3OY9 A;  1HDD C;  3T5X A;  1Y39 A;  2DOF A;  1H9T A;  4BBS J;  4C2M J;  2W1O A;  3CMM A;  3LNQ A;  2OUM A;  3IRQ A;  3SZP A;  1JHH A;  3TED A;  1SD5 A;  5EEH A;  2ESN A;  4AIH A;  2DT6 A;  5DD8 A;  5FD6 A;  3H3U A;  3G71 I;  1FY7 A;  1QBJ A;  3L00 A;  2STW A;  5B1A H;  2Y31 A;  4A5N A;  2A5Y B;  1QNT A;  3WTS C;  4IHX A;  1LFP A;  1JT6 A;  2FBH A;  3EPZ A;  1UFM A;  4A3K J;  1OR7 A;  2CUJ A;  2XSJ C;  4PZJ A;  4MQV A;  2LP0 A;  5EG0 B;  3K1M A;  3RCO A;  4DGW B;  5E17 F;  2C6Y A;  3AFH A;  1L0O C;  3RYP A;  2QLZ A;  5E18 F;  4DYR A;  2XGX A;  3DLL F;  1F1Z A;  2DBB A;  4XRS G;  3KIO A;  3LFK A;  4ZYH A;  1EH6 A;  1SFX A;  2GAU A;  1MNE A;  4MFE A;  1LE8 B;  4BJT A;  2VJ4 A;  2IGM A;  1XCB A;  2NS7 A;  4XLE A;  1O4X A;  2PQ8 A;  3A02 A;  2PI0 A;  1WH5 A;  2CSO A;  2OA4 A;  4LK0 F;  1MBF A;  2JN6 A;  2V1U A;  3TDZ C;  1JUM A;  1MJB A;  1ZK8 A;  1S29 A;  2ICW G;  2VJI A;  3ASN H;  1A36 A;  1W5C C;  4BQO A;  1P6R A;  3OL3 A;  4M6V A;  1YHQ I;  3HTU A;  2MW8 A;  2V7F A;  2MFZ A;  2L5Q A;  3EUA A;  2ZBK A;  4PSX A;  4WCG A;  2F4O B;  4NC6 A;  1MDM B;  3E6B A;  4CSW A;  2F5V A;  5E8G A;  1PJR A;  1OPC A;  5GAE J;  3MZY A;  3MN2 A;  4N0B A;  1IRG A;  2EZH A;  1BM9 A;  2HWV A;  3QYE A;  1WQ2 A;  1SVM A;  2HEO A;  3MMY B;  2KMU A;  3AAF A;  1EJ9 A;  2L4M A;  1EF4 A;  2BY2 A;  1RR7 A;  3KP3 A;  3JAM Z;  2DMQ A;  1JE8 A;  1T2K A;  3M8J A;  2L9N A;  2LKP A;  1HF0 A;  3DKX A;  1DQU A;  1QZY A;  3NEU A;  3FKI J;  4DIQ A;  4EJT A;  3W6V A;  2IA0 A;  2VC0 A;  3Q5F A;  1NHA A;  2VT3 A;  3DEE A;  2O61 A;  1RZ4 A;  4YEL A;  4ETS A;  4MQ9 F;  3GFJ A;  3L2U A;  1BR4 A;  1YG2 A;  3IWZ A;  3F22 A;  3G73 A;  3TO7 A;  3B02 A;  3BJO A;  1GHC A;  2F5F A;  2ZNY A;  4B47 A;  2HOA A;  3OYM A;  3CC7 I;  3CC2 I;  5IYB J;  1FC3 A;  1YQA A;  3BQZ A;  1VQ7 I;  1G6N A;  3M1E A;  3O3K A;  1LVA A;  4G6D A;  5ICC A;  1NK3 P;  3HOW J;  1FBU A;  1BIB A;  1ETV A;  1R1U A;  1X58 A;  2KZV A;  1R4N B;  4L5J A;  5M5W J;  2PJR A;  3HYI A;  3BOQ A;  4RAY A;  1SAU A;  5CYV A;  2CGP A;  3L2V A;  1E3P A;  2MBF A;  1GV5 A;  4YG2 F;  3S1N J;  5AON A;  3MKW B;  2R4G A;  1R5I D;  3RDI A;  4OIQ F;  2FSW A;  4Z2Y A;  4RM2 A;  1OYY A;  2CQK A;  4ZDL A;  3PFY A;  3HSF A;  4U7B A;  1G8X A;  4GYG A;  5BOX A;  3GTL J;  1I1S A;  2IJL A;  3FBN B;  1I5Z A;  2XAS A;  1WHU A;  2GQQ A;  1X4O A;  1QZE A;  1K78 A;  2E19 A;  4ZDO A;  4UV8 A;  3J7Z I;  1TQM A;  4HOB A;  3V8L A;  3HPH A;  3WGH A;  2L7F P;  2W24 A;  2FUG 2;  5DCF A;  3D5L A;  3CLQ A;  2CUF A;  3FXL A;  1G59 A;  4G6Q A;  1BI1 A;  4DNC A;  2PFB A;  5FLX K;  2UZK A;  5IYD J;  1IN5 A;  1LFB A;  4X0G A;  4HST A;  3OYL A;  2DU9 A;  1OYW A;  2LYC A;  4F91 B;  2HYJ A;  2R7R A;  4WK8 F;  1TWC J;  4A6D A;  3QU6 A;  4UB6 C;  2N8G A;  2M30 A;  3RI4 A;  3MWM A;  3A03 A;  3BZ6 A;  4BKX A;  4LLG F;  3ABT A;  4PUS A;  2EIM H;  4YFK F;  1WGX A;  1B9N A;  2E71 A;  2EQR A;  3OYB A;  4D5C A;  4H0E A;  5J4Y A;  4J00 A;  4OIO F;  5M5X J;  3QU3 A;  1ZQ3 P;  4C2U A;  2F5E A;  1B72 A;  3S17 J;  1H89 C;  5F0F A;  3GTM J;  2COM A;  4LFU A;  3T0Y A;  1T08 B;  3DPL C;  3K69 A;  1JJ6 C;  3FXK A;  1K6O A;  3OIO A;  3M8F A;  3AL0 B;  2E1N A;  4L5E A;  3PM1 A;  1YTY A;  1VQ4 I;  1I27 A;  2DFI A;  5LHH A;  3RJP A;  3H3V K;  2MC4 A;  4EJV A;  1ON1 A;  3RIR A;  1UAA A;  3RPU D;  2ZXH A;  3GEZ A;  1H88 C;  4A2U A;  1ZKG A;  4IQ4 A;  3EUH C;  1RIO H;  1C0W A;  2WAE A;  4HSR A;  2CRG A;  4HV5 A;  2FQ3 A;  3ZN0 A;  4GGG A;  2W25 A;  6PAX A;  4PJN A;  3K70 C;  2AQF A;  5FKN A;  5J6X A;  1DGW Y;  4A5M A;  5C4X J;  3G1L A;  1TNT A;  2EK5 A;  1IC8 A;  3E0J B;  2UUZ A;  4IF4 A;  4IRI A;  2VE9 A;  1JXS A;  2D45 A;  2YU9 J;  4P55 A;  2JA5 J;  1QHH D;  1S7E A;  3QPL A;  4XQF A;  2FX0 A;  4IRH A;  1DDN A;  4Z6Y A;  3K0L A;  1R49 A;  1TWA J;  3FXO A;  3Q3S A;  2WC2 A;  3BPX A;  4I7H A;  4P1W A;  1ZTR A;  3NRV A;  3CJN A;  3BCB A;  1SD4 A;  4KJZ A;  3WTY C;  1WJE A;  2ZFU A;  4BU2 A;  3BCA A;  1ZG5 A;  1YO5 C;  4XKC A;  1ZG3 A;  3J80 K;  3P5J A;  4IHT A;  3TOA A;  3FBI B;  1IO2 A;  4KIS A;  1MMG A;  3OS0 A;  2BY1 A;  2JK3 A;  5F04 A;  5KCM A;  2R5Y B;  3DTK A;  3CUQ C;  5JVG F;  3PIO F;  2JSP A;  5CLS A;  2EFO A;  4EJU A;  2ZFW A;  4A3J J;  1QQI A;  2DPD A;  2QQ9 A;  4A3C J;  3GFM A;  4RAZ A;  1E2X A;  1ZR4 A;  3H35 A;  3GTG J;  1FOW A;  2P7C B;  1J59 A;  3QP6 A;  1GXQ A;  5FRM A;  1B6A A;  1TWG J;  1VND A;  5DV5 A;  3JW4 A;  3OYH A;  2XPU A;  3TW6 A;  3ELK A;  2BBY A;  1ON2 A;  3L09 A;  1YOV B;  3A4C A;  1FPQ A;  1TP4 A;  1Z3X A;  2XDV A;  4KIF A;  5E20 A;  5F64 A;  5HLI A;  4LB6 B;  2VJ5 A;  5D6F A;  4EEF G;  3ZR8 X;  4G9Y A;  1MNM C;  1SEU A;  4E7Z A;  3BY6 A;  4A93 J;  3E7L A;  1WI9 A;  2ECB A;  2JTV A;  3ZQC A;  4HG2 A;  4L9T A;  5ERI A;  2IXS A;  4FE7 A;  4BY7 J;  3JTG A;  2TDX A;  4FET A;  3V7S A;  4KA4 A;  1R5H A;  2VT2 A;  2M45 A;  4BE0 A;  5F27 A;  4BHB A;  3K6G A;  4XRS A;  2ZB9 A;  2K40 A;  3RKY A;  2XV4 S;  4NUB A;  2NVX J;  2R92 J;  1U3E M;  4MIM A;  3DWL E;  5B3S H;  3LAP A;  1JKO C;  2K3P A;  2B0L A;  1SFE A;  1WI3 A;  2UWM A;  2XKP A;  4A3B J;  1OCT C;  4F3Q A;  2VQL A;  3TOB A;  2YX7 A;  2DYS H;  5CVR A;  3M07 A;  2V1N A;  2EWN A;  4RGS A;  3CCM I;  2F48 A;  2XRN A;  3DEW A;  3I54 A;  4XLH A;  4OIR F;  4AID A;  2JVG A;  5FKL A;  1W0U A;  3ECH A;  3OWT A;  3PNV A;  2EIL H;  3K2Z A;  2Y0S N;  1GT0 C;  1MMN A;  2EB7 A;  1Z0X A;  3GLL A;  3JRD A;  4HV6 A;  2UV1 A;  3OR2 C;  2IS6 A;  1WJF A;  1IV6 A;  4G7Z F;  2XVC A;  3I5U A;  2A5W A;  2BYV E;  4RBO A;  3HRM A;  3U9G A;  1BI2 A;  2OU2 A;  2VXD A;  2QM3 A;  4R79 A;  1ZGJ A;  4PFP A;  4HA8 A;  3NWS A;  2HQA A;  4ZJZ A;  2FNA A;  2WTE A;  2DOD A;  3RKW A;  3IKV A;  3MZH A;  5E3M A;  2DYR H;  2R93 J;  1USS A;  3OSF A;  2X1D A;  2K4J A;  2M7A A;  3BJA A;  3N05 A;  5E3L A;  2H8R A;  1D1C A;  4JX6 A;  4ZTF A;  3EUK L;  1G3T A;  3BLY A;  3HJE A;  4XR6 A;  5FKK A;  1ORK A;  2P5L C;  4ON0 A;  1IRF A;  1FBS A;  5FFX A;  3OSG A;  3S93 A;  3K7A J;  3BTC A;  3J7Y J;  2A6H F;  1I6X A;  1V5E A;  3ASO H;  2OCE A;  4ESJ A;  2A6T A;  1J9I A;  3FKJ A;  3O6B B;  4WXC A;  2O8X A;  5EYR A;  2VXZ A;  3F8C A;  3BG9 A;  1N77 A;  2WA0 A;  4MTE A;  2M5W A;  1PP8 F;  4NHJ A;  3HOS A;  2X9D A;  3HHG A;  4AYB N;  4AM3 A;  2LK2 A;  3R0J A;  4WXH A;  1LKX A;  2XSD C;  1XX5 A;  2K5C A;  3UR3 C;  3QYB A;  2VLA A;  2Y9Y A;  4CA0 A;  2XF7 A;  2KLO A;  4JOM A;  1DUX C;  3DPT A;  4I98 B;  4ANJ A;  2K86 A;  2DOA A;  3CO7 C;  1T39 A;  4XLA A;  4XOP A;  3BR5 A;  5LLQ A;  4RB3 C;  3LA2 A;  2XB0 X;  4U88 A;  2BV6 A;  1YX3 A;  2LH9 A;  2L7M P;  2A61 A;  1X1B A;  4G94 A;  1FNN A;  3HL2 A;  3ABU A;  2NYX A;  1KU9 A;  1HLV A;  2VPL A;  1FOK A;  4XLN F;  5JVT A;  1LEA A;  2G7H A;  3SYT A;  4NC7 A;  3JRG A;  2GXB A;  4KN4 X;  2NVQ J;  2ZO4 A;  3ZQI A;  5LHI A;  3DEU A;  3FXQ A;  1FSE A;  1Y0U A;  1A5J A;  2R7V A;  1B59 A;  5CJ9 A;  2KIU A;  2VI6 A;  1J7K A;  2F4I A;  5CKT A;  3RPU A;  4E7J A;  3HGG A;  2E2J J;  1O57 A;  5JLX A;  1EH7 A;  3TGN A;  3LSJ A;  4RB0 A;  1OMI A;  2HKO A;  1YRN A;  4AU7 A;  4LLN A;  2Z2S B;  4UUV A;  2ZKZ A;  4M71 A;  4S05 A;  2L7K A;  1S6L A;  2FU4 A;  3GVA A;  3Q0W A;  3FK7 A;  4HF2 A;  3OYI A;  1DGR M;  1VQ8 I;  4CGZ A;  4DBQ A;  2IS4 A;  1O3T A;  3HIF A;  1R23 A;  1U0J A;  3ZQL A;  3E5X A;  1LDD A;  3W2V A;  4ABZ A;  4NDL A;  2M9H A;  3CCL I;  4BE1 A;  2JA7 J;  1BIA A;  3IP4 B;  1MJ9 A;  1XPX A;  1JJ8 C;  3J81 K;  1YE9 A;  2WB1 A;  2JWT A;  2PJR B;  1GLN A;  1IXC A;  3G1M A;  4TV7 A;  2RAE A;  5D6E A;  1VZ0 A;  1X1P A;  1FTZ A;  2CW0 F;  1PUE E;  2ETH A;  1S7A A;  1A35 A;  3W2A A;  1OQY A;  3WG9 A;  2RV8 A;  3ESW B;  4C2T A;  5GPC A;  4KUM A;  2KIF A;  1FWZ A;  3LSG A;  3K4L A;  2PMH A;  5F0C A;  5EZH A;  5DTD A;  1FX7 A;  4ENJ A;  1BW5 A;  3GZ5 A;  4S04 A;  3S2H J;  4KNY A;  4M6X A;  4OAY A;  4MGR A;  1BBY A;  2HDC A;  1K78 B;  4AWX B;  2O0Y A;  3S1R J;  5LRR A;  2Y48 A;  3H36 A;  2D1H A;  1W7P D;  5DUI A;  1S72 I;  1WPK A;  5EF6 A;  1ZRE A;  3NAU A;  2BY3 A;  1W4M A;  2IS1 A;  5J3L A;  2L2O A;  2HQR A;  1HKS A;  1UHS A;  4IL6 C;  1B9M A;  4I02 A;  1Q1V A;  3FIW A;  5HDG A;  1G3Y A;  1HCR A;  3R60 A;  1GV2 A;  3KP2 A;  4HZF A;  3S2W A;  4L9V A;  4KIT B;  1VQ6 I;  3ZOB A;  2CQ7 A;  1Z91 A;  3VB2 A;  1YS7 A;  3MQ0 A;  3HHH A;  3ZMT A;  1P92 A;  5B66 C;  1LDJ A;  3ML6 A;  4GXO A;  1B72 B;  2K27 A;  1DU0 A;  4E7L A;  1FYL A;  5D8K B;  1YS6 A;  1EV7 A;  3SXY A;  3A2K A;  1IV8 A;  1GVJ A;  3D5R C;  3VYU B;  1HKQ A;  3NAR A;  5ED4 A;  1HBX G;  2BW3 A;  4AC0 A;  3GTQ J;  1REP C;  1KYZ A;  4WF2 A;  2QVO A;  1H8A C;  4B3A A;  2HZT A;  5TJJ A;  3S15 J;  3AG4 H;  4PCQ A;  2CJJ A;  2KIS A;  2P81 A;  1ETX A;  4FE4 A;  2XUB A;  2YU3 A;  3DPU A;  1N25 A;  4OIN F;  2E34 A;  4CUG A;  3LSH A;  1IZ1 A;  1S9H A;  3FIS A;  3LQR A;  2R7O A;  5DD4 A;  4CCN A;  1K4S A;  1Y8Q B;  3F8N A;  2LR8 A;  4KDP A;  3H5N A;  2OTJ I;  3QRF F;  2RC4 A;  5D8L B;  3CCR I;  5K1Y A;  1BL0 A;  2M0C A;  1R22 A;  2DAO A;  3R4K A;  2V1D A;  2NXN B;  1RRJ A;  1ZGA A;  2XGD A;  4FIS A;  4OMY A;  1HW5 A;  3WE2 A;  2CUE A;  1TW2 A;  4ASN A;  1T8I A;  3E6M A;  1MD0 A;  3TW7 A;  2ELK A;  1O3S A;  1BOA A;  3BG3 A;  3T8R A;  5A2Q K;  2PX9 A;  3X2Q H;  1FYK A;  3CJQ B;  2Q0O A;  2VBY A;  4RLF A;  1FLI A;  3P9C A;  3GO5 A;  3KX2 A;  5AIP A;  2XF6 A;  3G2B A;  3CMY A;  2LFB A;  4BXU A;  2KJB A;  4HX4 A;  4D9J A;  1A6I A;  1FMW A;  2VKD A;  1TTY A;  2YPR A;  5JLW A;  4RGU A;  3S1M J;  5CQG A;  4H4K C;  1CF7 A;  3DFG A;  2R7D A;  3LOC A;  1K4T A;  3HPG A;  5E79 C;  1D5V A;  1V55 H;  3GFI A;  4CCL A;  2FOW A;  4YEJ A;  2OF7 A;  4MEX F;  4D7N A;  1D1B A;  3D5S C;  3K9T A;  5M3M J;  4EMS A;  2Y9Z A;  2CV0 A;  5LGU A;  5B1B H;  3EYI A;  2L9R A;  3KET A;  3WGG A;  1HA8 A;  5FGM A;  4ESF A;  2H09 A;  4GFB A;  5F6F A;  1J2X A;  2FEZ A;  1R9T J;  3PUF A;  1ZH5 A;  3I59 A;  2LD5 A;  2ZC2 A;  1IN6 A;  4N9I A;  5EEA A;  1D5Y A;  3TP3 A;  2FJ1 A;  1SVO A;  4UHT A;  3ABL H;  1AHD P;  3DU5 A;  1ZEL A;  4MNU A;  5J1U A;  2DFE A;  1YYV A;  3I55 I;  2Z99 A;  2JVH A;  3CD6 I;  4BAY A;  4RGX A;  4BJ5 C;  1LB2 A;  1ENH A;  2X1E A;  2F4M B;  1CQT A;  3H9J A;  3A01 A;  2QF7 A;  3OMY A;  1SAX A;  1IUY A;  2ECC A;  3I3L A;  5BS6 A;  5K5Q A;  2EZK A;  4LGW A;  1ZRC A;  5JHF A;  4LD5 A;  3K4M A;  2BXY A;  2K9S A;  3HOY J;  2GIZ A;  3FZV A;  2XHK A;  2K9M A;  4QWQ A;  3J7A O;  2KDO A;  3CMA I;  2RQQ A;  1QRY A;  4KYW A;  2VC1 A;  1S3J A;  4QLC U;  4M3E A;  2BE5 F;  3BRO A;  3KYC B;  3HKZ N;  3WTX C;  2HVS A;  4CCK A;  2Z33 A;  2E1C A;  4ENK A;  2HPI A;  1SD7 A;  3MCZ A;  5C4J J;  1B8I A;  3KZZ A;  3SJM A;  3KP5 A;  2QBY A;  1O7L A;  1R4M B;  3BR2 A;  2L54 A;  4RS8 A;  3FF5 A;  2XAH A;  5D5X B;  1VQL I;  4ESB A;  5ILU A;  2ID6 A;  4LLL A;  4I76 A;  1FEX A;  5J40 A;  1U6G A;  2V6E A;  3HSR A;  2CFO A;  4Q47 A;  2IBD A;  3F8F A;  1T6S A;  2ZJ2 A;  2QKM B;  3C2B A;  1ZGW A;  1U9N A;  2WY8 Q;  3DF8 A;  2V9K A;  4M73 A;  4MEY F;  1QPI A;  2EV5 A;  3VYT B;  1Y0N A;  4HPQ A;  2ZJP F;  2O5R A;  4XL9 A;  4XN0 A;  4M3B A;  4CYC A;  2LKX A;  2VE8 A;  5HVQ C; 
#chains in the Genus database with same CATH homology
 2KRF A;  4ZH4 F;  2V9V A;  5D4S A;  3R61 A;  3SHF A;  1D8J A;  1ZLJ A;  3PQK A;  3ZMS A;  5D5U B;  1U5T A;  5EEG A;  5E1W A;  2XAQ A;  2RNJ A;  5JFR A;  3ROU A;  3C7J A;  2WWY A;  4KFC A;  2EFW A;  4L0Y B;  2QYO A;  2XRO A;  3ZN1 A;  1XD7 A;  3RYR A;  3KE2 A;  3CDH A;  5FB2 A;  5L3E A;  2K02 A;  1KU2 A;  5KK1 A;  1XSV A;  1RI7 A;  4CHU A;  3DXJ F;  2Y75 A;  3FM5 A;  1R1V A;  1Z7U A;  4R1H A;  4I2O A;  3F23 A;  3HSE A;  1DP7 P;  3Q9S A;  2HS5 A;  2M87 A;  2A07 F;  4KN7 X;  3SFZ A;  2P6S A;  4HF1 A;  2UXN A;  5HLG A;  5DEQ A;  2O6G E;  2PBI A;  2HKX A;  4F7Z A;  4IJA A;  5H6R A;  5DUK A;  3BP8 A;  3MFK A;  1EH8 A;  1XDS A;  3EYY A;  4ZZD A;  3EQL F;  2X0L A;  4ZYD A;  4FX4 A;  4BYY A;  4NQW A;  5ICF A;  3V7C A;  3KFW X;  4HBL A;  3U2R A;  2EA4 A;  5J8F A;  4ENN A;  2J5O A;  2ZME A;  2ACJ A;  5IT9 K;  3F8B A;  4A6E A;  1HW2 A;  1BJA A;  3V8K A;  3E6C C;  1YLF A;  5J8C A;  3CO6 C;  2CFX A;  1ONV A;  4LK1 F;  1JGS A;  2FXA A;  2K4B A;  4EM2 A;  4L9J A;  1HKT A;  5LGT A;  2R7F A;  4KMF A;  3P7N A;  2A6E F;  2ISZ A;  1U78 A;  1IAW A;  4JQF A;  1B4A A;  3CLO A;  2EV6 A;  3RTR A;  1ZN2 A;  2QEN A;  3LWF A;  4CIC A;  1KU3 A;  2PJP A;  3LST A;  2ELH A;  2EFP A;  2OZ6 A;  4CYD A;  4N9H A;  2Q8K A;  4IHS A;  2LDU A;  3B73 A;  4IPA A;  1RUO A;  3IRR A;  3PFI A;  4D0P A;  1WWX A;  1R00 A;  4BHC A;  4P5O A;  1Z1D A;  1P4X A;  4L0Z B;  3TQN A;  2H6C A;  2MH2 A;  3I4P A;  5CVV A;  4HX8 A;  2PN6 A;  2ESH A;  5HS8 A;  4HDU A;  1CF7 B;  1IN4 A;  2RVC A;  4EM1 A;  3ZMV A;  5BMZ A;  2O3F A;  4XLP F;  2LNB A;  5HDK A;  3TO9 A;  5LHG A;  2OQR A;  3Q9V A;  2BEO A;  2MH9 A;  2H27 A;  1XDU A;  4U7D A;  2XIG A;  3DP7 A;  1KQ9 A;  4LMY A;  1UHM A;  3I59 B;  2GIV A;  4LG0 A;  4P9U A;  3ULQ B;  4Y17 A;  2JPC A;  1XMK A;  3RPQ A;  3LA3 A;  4AD9 A;  4HQE A;  4EJW A;  4EGY A;  3MAJ A;  4I0A A;  2ADU A;  2DQL A;  1PDN C;  2O03 A;  5ICG A;  4UVB A;  2YR2 A;  5F1R A;  4PGH A;  1J75 A;  2UXX A;  2STT A;  1LJ9 A;  3IWF A;  5TRD A;  2M1B A;  1BI0 A;  1P4W A;  3GFL A;  4Q4Z F;  2W84 A;  3ERE D;  1WSU A;  2EV0 A;  2PG4 A;  1S8N A;  2QBY B;  5FFZ A;  4I01 A;  1UCR A;  1VTN C;  5JI6 A;  5FLX Z;  2FBI A;  2GA1 A;  1R5G A;  1G4D A;  3JTH A;  2YX4 A;  4HDV A;  2P6T A;  3WTW C;  2Q2E A;  2CYY A;  2W57 A;  2CWE A;  2DQR A;  4A12 A;  4AIK A;  1ZHF A;  1FP1 D;  3V8J A;  4HF0 A;  4HYE A;  2RDP A;  3P9K A;  2IW5 A;  1RNL A;  3SQN A;  1XGM A;  2VOO A;  2DI3 A;  2EA2 A;  1D8K A;  2KKO A;  2A68 F;  2HFH A;  3E3V A;  3JAM K;  2F2E A;  4M6Y A;  1U5T B;  4WX9 A;  1IF1 A;  3TO6 A;  2F5C A;  3IC7 A;  3D0S A;  3V4G A;  4B09 A;  4YIF A;  1YW8 A;  1TLH B;  2MD5 A;  2GXG A;  3EUH A;  4OIP F;  1FZP B;  2G7U A;  3SZT A;  2FE3 A;  3HRU A;  3C18 A;  1SFU A;  2MLK A;  4CZZ A;  4EV0 A;  4Q5S F;  3FXU A;  2NRA C;  4YFN F;  4UXN A;  4M9X A;  3J80 Z;  1CGP A;  4IXA A;  5LEJ A;  1SMT A;  2G9W A;  4CO8 A;  1V3F A;  2QWW A;  2VBX A;  3W6J B;  4R8H A;  2DW4 A;  2OZU A;  3TDU C;  3I58 A;  1QGP A;  4UVA A;  1KGS A;  4A0Z A;  2FRH A;  2H6B A;  1F4K A;  1BI3 A;  2FOK A;  1UST A;  2GZW A;  4PDK A;  1LEB A;  2QQB A;  3WTU C;  3CUQ A;  1XN7 A;  1SMY F;  5AIQ A;  3H3Z A;  2OQG A;  3F8M A;  3WTV C;  2DTR A;  1J5Y A;  2ZME B;  2QZ8 A;  4DQ2 A;  1KQ8 A;  4BHP A;  3T1B A;  1R1T A;  2VN2 A;  2RQP A;  5FO5 A;  3ISP A;  3GLX A;  4EGZ A;  4A0X A;  2OD5 A;  1BC8 C;  2HYG D;  1R7J A;  4M74 A;  1TBX A;  2AS5 F;  3EDP A;  4A0Y A;  2V1X A;  1AOY A;  4NB5 A;  1Z6R A;  3W6K B;  3GF2 A;  1U8R A;  2L3D A;  3EET A;  2FMY A;  3ECO A;  3FXR A;  3KEQ A;  3VOD A;  5ICE A;  1LNW A;  3I0T A;  5LBQ A;  1BC7 C;  3MEX A;  2KJC A;  5D4R A;  1U2W A;  5HLH A;  4WXD A;  1A04 A;  2K7L A;  2Z9O A;  4I09 A;  2YSR A;  3GXO A;  4XBF A;  3CUO A;  3F3X A;  4L5I A;  1Q1H A;  1F9N A;  1R58 A;  2WV0 A;  2LF8 A;  2IP2 A;  2P8T A;  2QUF A;  3CTA A;  5H20 A;  2EJR A;  5BPD A;  3ZP5 A;  2OBP A;  3O2P E;  1WKM A;  4U0V A;  2A3S A;  5D5W B;  1KYW A;  1LQ1 A;  2FF4 A;  2NAZ A;  5L3B A;  2E7X A;  1QO0 D;  2DO7 A;  5DYM A;  3T8T A;  2IPQ X;  4EVI A;  5L3C A;  3BPV A;  5BQT A;  4ENM A;  1KU7 A;  2D2W A;  2PEX A;  3F6V A;  4LG0 B;  2NNY A;  4XSX F;  5K5R A;  4HLX A;  4MHG A;  3FX3 A;  3HTS B;  4UNO A;  1L3L A;  4RB2 C;  3V7R A;  1FSH A;  3TKY A;  4KT5 C;  3FHZ A;  3IHU A;  1W7P A;  1W5T A;  3J81 Z;  2XAJ A;  2ZCW A;  3C1D A;  3DV8 A;  4HW0 A;  1DPU A;  1YFH A;  4KIB A;  4FHT A;  1XGS A;  3PQJ A;  2HTS A;  2IA2 A;  4EM0 B;  3LQQ A;  3OOP A;  2J5P A;  4EJO A;  1G3W A;  1ZAR A;  1YW9 A;  3GUD A;  2OAZ A;  3WGI A;  4OMZ A;  3E5Q A;  2HOE A;  1JHF A;  3KZY A;  2CO5 A;  1ZRF A;  3WU0 A;  2FA5 A;  2XAG A;  1W5S A;  5KVR A;  5HS9 A;  3QPT A;  1X3U A;  3HUG A;  4MTD A;  2Y0M A;  2E7W A;  5CVJ A;  2AXL A;  4O6J A;  2X4H A;  5DDG A;  3LAJ A;  3KP7 A;  1LDK B;  2IA1 A;  3HRT A;  2F5D A;  3KCC A;  4FX0 A;  2HR3 A;  1XGO A;  3GYH X;  2L4A A;  4M9S A;  3KP4 A;  2CG4 A;  1RUN A;  5L3G A;  2V6C A;  1Z6T A;  5L3D A;  4M9Z A;  4FT8 A;  5IT3 A;  5K5O A;  5ILV A;  3QP5 A;  1T38 A;  4RB1 A;  4G7H F;  3ZPL A;  3M7G A;  5A2Q Z;  1IXS B;  2FBK A;  4BH9 A;  3P9I A;  1R36 A;  3OV8 A;  3HRS A;  5CVI A;  2FML A;  3VOE A;  5D5V B;  3E5U A;  4LJZ F;  5LRS A;  3KEO A;  3I64 A;  4ZYG A;  1QZZ A;  3WTZ A;  2KIM A;  1HSJ A;  1TQI A;  3IL2 A;  4IVN A;  4P96 A;  1MZB A;  2JZY A;  3N97 A;  3I71 A;  1XMA A;  1V4R A;  4RGR A;  3LA7 A;  1XB4 A;  1QPM A;  5L3F A;  3KLN A;  3FM3 A;  3CUQ B;  3ZMU A;  2DK8 A;  5E8I A;  3REO A;  2VON A;  5DCM A;  3KP6 A;  4YFX F;  1H0M A;  1STZ A;  1MKM A;  5HS7 A;  4I0B A;  1FP2 A;  2IT0 A;  2FNP A;  3C3W A;  3QAH A;  4YII A;  3JSO A;  4O5V A;  4AVP A;  1I1G A;  4KIC A;  4Y13 A;  1UHW A;  1O7F A;  4XRF A;  3U1D A;  2P4W A;  4UVC A;  2RN7 A;  5LEK A;  4UV9 A;  4G7O F;  2Z3Y A;  2H94 A;  3FMQ A;  3E6D A;  4EQQ A;  2JSC A;  2XKO A;  3M9A A;  3F21 A;  2JRT A;  2IRF G;  1E17 A;  3FWE A;  2HYF A;  2A69 F;  2MLG A;  3DKW A;  3VEP A;  1IW7 F;  4U0Y A;  4Q48 A;  1J0R A;  3WOD F;  4GCV A;  1S7O A;  3VFZ A;  1DPR A;  1MDM A;  1O3R A;  2VOP A;  1XGN A;  5JR3 A;  5HDN A;  1ZRD A;  5JHU A;  2NS0 A;  1KA8 A;  4Y15 A;  4XSZ F;  2LF7 A;  1K7A A;  1HQC A;  4HQM A;  3KLO A;  1H9G A;  2D1V A;  4P9F A;  2BGC A;  1Z9C A;  2VBZ A;  1D3Y A;  1ZG1 A;  3K1N A;  3N4M A;  4M72 A;  3L2C A;  3WTT C;  3HOT A;  1HXD A;  4WWC A;  1HST A;  4HLY A;  1MJA A;  5E1Z B;  1ZLK A;  5H6Q A;  3IKT A;  2ZXJ A;  2JT1 A;  4KIG A;  2VBW A;  1K79 A;  2M8E A;  4CXF A;  2ZNZ A;  1G3S A;  3GWZ A;  3FMR A;  4JK1 X;  4ZZL A;  1OYI A;  3L7W A;  1PP7 U;  3BDD A;  4E70 A;  1P2F A;  1ULY A;  3ZMD A;  5FD5 A;  4LB5 A;  3DQV C;  2LSO A;  2W85 A;  5HOO A;  1W7P B;  3BJ6 A;  1TNS A;  2Z5U A;  2MA3 A;  1KQ0 A;  1BN5 A;  2DK5 A;  4PGG A;  4L9N A;  5LGN A;  4HX7 A;  3ZQ7 A;  2ISY A;  4GO1 A;  1IXR C;  1U5T C;  4OU0 A;  2IVM A;  3M8E A;  3R6S A;  2GWR A;  4HAM A;  1ZYR F;  1T98 A;  3H92 A;  1MGT A;  5IT9 Z;  4ZYE A;  1F5T A;  1UB9 A;  1TQP A;  3QOP A;  1YW7 A;  5CVU A;  4JBA A;  2DT5 A;  1P4A A;  3JSP A;  1IN8 A;  4AIJ A;  3WE3 A;  2JPB A;  1ZAO A;  3G3Z A;  1FT9 A;  2DLL A;  4U0W A;  2XAF A;  1WRJ A;  3K1P A;  2RKH A;  3R0A A;  1Z05 A;  3BWG A;  2P7V B;  4G8X A;  4GYI A;  3FMS A;  4K2E A;  3E97 A;  4BQA A;  1SD6 A;  4KMU X;  1O3Q A;  4BNC A;  3WU1 B;  2V79 A;  2L02 A;  1FBQ A;  2P5K A;  2PMU A;  5E1X A;  3F72 A;  2QQA A;  2P5V A;  2NNN A;  3GZ6 A;  3RKX A;  2RGV A;  4IRG A;  4L18 B;  1XCV A;  1AWC A;  1TW3 A;  1B1B A;  2DPU A;  1XSD A;  1OKR A;  2VOD A;  1ODD A;  2EFN A;  2HQN A;  5ILS A;  1GXP A;  2GA2 A;  2HTJ A;  1FYM A;  2R3S A;  1YIO A;  3COA C;  2PLY A;  1IN7 A;  3GX4 X;  4O3M A;  3ZMZ A;  3I53 A;  3F6O A;  3GW2 A;  4OOI A;  3QPH A;  2EFQ A;  1HW1 A;  2L01 A;  2HGC A;  4B8X A;  1T0F A;  5BPI A;  1XSX A;  2MC3 A;  5DCM B;  4CDG A;  3L9F A;  3NQO A;  3T5X A;  1H9T A;  3IRQ A;  3SZP A;  1JHH A;  1SD5 A;  5EEH A;  2ESN A;  4AIH A;  5DD8 A;  5FD6 A;  3H3U A;  1FY7 A;  1QBJ A;  3L00 A;  2STW A;  4A5N A;  2A5Y B;  1QNT A;  3WTS C;  2FBH A;  1UFM A;  1OR7 A;  4PZJ A;  4MQV A;  3K1M A;  5E17 F;  2C6Y A;  1L0O C;  3RYP A;  2QLZ A;  5E18 F;  2XGX A;  1F1Z A;  4ZYH A;  2DBB A;  3LFK A;  1EH6 A;  1SFX A;  2GAU A;  1XCB A;  2PQ8 A;  2PI0 A;  2CSO A;  2OA4 A;  4LK0 F;  2V1U A;  3TDZ C;  1MJB A;  1S29 A;  1P6R A;  3HTU A;  2ZBK A;  4WCG A;  1MDM B;  3E6B A;  5E8G A;  1OPC A;  3MZY A;  4N0B A;  1IRG A;  1BM9 A;  2HWV A;  1WQ2 A;  2HEO A;  3AAF A;  2L4M A;  3KP3 A;  3JAM Z;  1JE8 A;  1T2K A;  2LKP A;  1QZY A;  3NEU A;  4EJT A;  2IA0 A;  2VC0 A;  3Q5F A;  1NHA A;  2VT3 A;  2O61 A;  1RZ4 A;  4ETS A;  4MQ9 F;  3GFJ A;  1YG2 A;  3IWZ A;  3F22 A;  3G73 A;  3TO7 A;  3B02 A;  3BJO A;  1GHC A;  2F5F A;  2ZNY A;  1FC3 A;  1YQA A;  1G6N A;  3M1E A;  3O3K A;  1LVA A;  4G6D A;  5ICC A;  1FBU A;  1BIB A;  1R1U A;  4L5J A;  3HYI A;  3BOQ A;  4RAY A;  5CYV A;  2CGP A;  2MBF A;  4YG2 F;  5AON A;  3RDI A;  4OIQ F;  2FSW A;  4Z2Y A;  1OYY A;  2CQK A;  4U7B A;  5BOX A;  3HSF A;  4GYG A;  1I1S A;  2IJL A;  1I5Z A;  2XAS A;  2GQQ A;  1K78 A;  4UV8 A;  1TQM A;  4HOB A;  3V8L A;  3WGH A;  2W24 A;  5DCF A;  3D5L A;  5FLX K;  4G6Q A;  1BI1 A;  4DNC A;  2PFB A;  2UZK A;  1IN5 A;  2DU9 A;  1OYW A;  4WK8 F;  4A6D A;  3QU6 A;  3RI4 A;  2M30 A;  3MWM A;  3BZ6 A;  4LLG F;  3ABT A;  4YFK F;  1B9N A;  4H0E A;  4OIO F;  3QU3 A;  2F5E A;  2COM A;  4LFU A;  3T0Y A;  3DPL C;  3K69 A;  1K6O A;  3M8F A;  2E1N A;  1YTY A;  1I27 A;  2DFI A;  5LHH A;  3RJP A;  4EJV A;  1ON1 A;  3RIR A;  3GEZ A;  4A2U A;  1RIO H;  1C0W A;  4HV5 A;  2FQ3 A;  3ZN0 A;  4GGG A;  2W25 A;  6PAX A;  5J6X A;  4A5M A;  1TNT A;  2EK5 A;  4IF4 A;  4IRI A;  2VE9 A;  1JXS A;  2D45 A;  4P55 A;  4IRH A;  1DDN A;  3K0L A;  2WC2 A;  3BPX A;  4I7H A;  3NRV A;  3CJN A;  1SD4 A;  3WTY C;  1ZG5 A;  1YO5 C;  1ZG3 A;  3J80 K;  4IHT A;  3TOA A;  3CUQ C;  5CLS A;  2EFO A;  4EJU A;  2ZFW A;  1QQI A;  2DPD A;  2QQ9 A;  3GFM A;  4RAZ A;  1E2X A;  2P7C B;  1J59 A;  3QP6 A;  1GXQ A;  1B6A A;  5DV5 A;  3JW4 A;  3ELK A;  2BBY A;  1ON2 A;  3L09 A;  1FPQ A;  4KIF A;  5E20 A;  5F64 A;  5HLI A;  4LB6 B;  5D6F A;  4G9Y A;  3BY6 A;  1WI9 A;  2JTV A;  4L9T A;  5ERI A;  3JTG A;  2TDX A;  3V7S A;  4KA4 A;  1R5H A;  2VT2 A;  2M45 A;  4BHB A;  3RKY A;  2XV4 S;  1U3E M;  3LAP A;  2B0L A;  1SFE A;  2UWM A;  2XKP A;  3TOB A;  2YX7 A;  5CVR A;  2EWN A;  4RGS A;  2XRN A;  3I54 A;  4OIR F;  3ECH A;  3K2Z A;  2EB7 A;  4HV6 A;  4G7Z F;  2XVC A;  3I5U A;  2BYV E;  3HRM A;  3U9G A;  1BI2 A;  2OU2 A;  2QM3 A;  4R79 A;  1ZGJ A;  4HA8 A;  2FNA A;  2WTE A;  3RKW A;  3IKV A;  3MZH A;  1USS A;  2K4J A;  3BJA A;  1G3T A;  2P5L C;  4ON0 A;  1IRF A;  1FBS A;  5FFX A;  2A6H F;  1I6X A;  4ESJ A;  1J9I A;  3O6B B;  4WXC A;  2O8X A;  2VXZ A;  3F8C A;  4MTE A;  2M5W A;  1PP8 F;  4NHJ A;  3HOS A;  3HHG A;  4WXH A;  3R0J A;  1DUX C;  3DPT A;  4I98 B;  2K86 A;  3CO7 C;  1T39 A;  5LLQ A;  4RB3 C;  3LA2 A;  4U88 A;  2BV6 A;  2A61 A;  4G94 A;  1FNN A;  3ABU A;  2NYX A;  1KU9 A;  1FOK A;  4XLN F;  5JVT A;  1LEA A;  2G7H A;  2GXB A;  4KN4 X;  2ZO4 A;  5LHI A;  3DEU A;  3FXQ A;  1FSE A;  1Y0U A;  1B59 A;  5CJ9 A;  2KIU A;  1J7K A;  3RPU A;  1O57 A;  1EH7 A;  3TGN A;  4RB0 A;  1OMI A;  2HKO A;  4LLN A;  4UUV A;  2ZKZ A;  4M71 A;  4S05 A;  1S6L A;  2FU4 A;  3GVA A;  4HF2 A;  4CGZ A;  1O3T A;  3HIF A;  1R23 A;  3E5X A;  1LDD A;  1BIA A;  1MJ9 A;  3J81 K;  1IXC A;  4TV7 A;  5D6E A;  2CW0 F;  1PUE E;  2ETH A;  1S7A A;  3WG9 A;  2RV8 A;  4KUM A;  2KIF A;  1FWZ A;  2PMH A;  4ENJ A;  1FX7 A;  3GZ5 A;  4S04 A;  4KNY A;  4M6X A;  4MGR A;  1BBY A;  2HDC A;  1K78 B;  4AWX B;  2O0Y A;  5LRR A;  2Y48 A;  2D1H A;  1W7P D;  5DUI A;  1ZRE A;  1W4M A;  2HQR A;  1HKS A;  1B9M A;  4I02 A;  5HDG A;  1G3Y A;  3R60 A;  3KP2 A;  4HZF A;  3S2W A;  4L9V A;  1Z91 A;  3VB2 A;  1YS7 A;  3MQ0 A;  3HHH A;  3ZMT A;  1P92 A;  1LDJ A;  3ML6 A;  4GXO A;  2K27 A;  1FYL A;  5D8K B;  1YS6 A;  1EV7 A;  3SXY A;  1GVJ A;  1HKQ A;  5ED4 A;  1HBX G;  1REP C;  1KYZ A;  4WF2 A;  2QVO A;  2HZT A;  5TJJ A;  4PCQ A;  2XUB A;  2YU3 A;  4OIN F;  1IZ1 A;  3LQR A;  5DD4 A;  3F8N A;  4KDP A;  3QRF F;  2RC4 A;  5D8L B;  5K1Y A;  1R22 A;  2DAO A;  3R4K A;  2V1D A;  1ZGA A;  4OMY A;  1HW5 A;  3WE2 A;  1TW2 A;  4ASN A;  3E6M A;  1MD0 A;  1O3S A;  1BOA A;  3T8R A;  5A2Q K;  1FYK A;  2Q0O A;  2VBY A;  1FLI A;  3P9C A;  3GO5 A;  5AIP A;  4BXU A;  2KJB A;  4HX4 A;  1TTY A;  2YPR A;  4RGU A;  1CF7 A;  3DFG A;  2R7D A;  1D5V A;  3GFI A;  4MEX F;  3K9T A;  4EMS A;  5LGU A;  3EYI A;  3KET A;  3WGG A;  5FGM A;  4ESF A;  2H09 A;  5F6F A;  1J2X A;  2FEZ A;  1ZH5 A;  3I59 A;  1IN6 A;  4N9I A;  4UHT A;  4MNU A;  1YYV A;  2Z99 A;  4BAY A;  4RGX A;  1LB2 A;  1SAX A;  1IUY A;  5BS6 A;  5K5Q A;  4LGW A;  1ZRC A;  4LD5 A;  3FZV A;  2XHK A;  4QWQ A;  3J7A O;  4KYW A;  2VC1 A;  1S3J A;  4QLC U;  2BE5 F;  3BRO A;  3WTX C;  2E1C A;  2Z33 A;  4ENK A;  3MCZ A;  1SD7 A;  3KZZ A;  3KP5 A;  2QBY A;  1O7L A;  2L54 A;  4RS8 A;  3FF5 A;  2XAH A;  5D5X B;  4ESB A;  5ILU A;  4LLL A;  1U6G A;  3HSR A;  4Q47 A;  3F8F A;  1T6S A;  2ZJ2 A;  3DF8 A;  4M73 A;  4MEY F;  2EV5 A;  2VE8 A;  5HVQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...