4CICA

T. potens iscr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
138
Chain Sequence
GAMGLKVSTKGHYGVQAMFDLAQHFGEGPVSLKSIAERQGLSEPYLEQLIAVLRKAGLVKSVRGAQGGYILAREPRDIKVGDIIRVLEGSLKFDFSVTKSVWEKVKKSIEEVLDSITLADMLKDAEEAQMAQGYMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Unique Regulation of Iron-Sulfur Cluster Biogenesis in a Gram-Positive Bacterium.
pubmed doi rcsb
source organism Thermincola potens
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, BADM/RRF2 FAMILY
total genus 43
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cicA00
3JAMZ 3L9FA 4DQ2A 3WTVC 4LLGF 3IKVA 3F72A 1LEBA 2LKPA 3ZMSA 3CO6C 2CO5A 4UV8A 4XBFA 4EV0A 5L3BA 4AVPA 5HS9A 2P7VB 2DTRA 5H6RA 4KICA 2IJLA 3WTWC 5BS6A 3JSPA 4ZYGA 1ZRDA 3L09A 5TRDA 1ZAOA 1DPRA 3SXYA 4XLPF 4UHTA 2V1DA 3WTYC 2NS0A 5CVIA 1R5HA 2CW0F 1R1VA 1J9IA 5L3GA 1UHWA 4KIBA 1Z6RA 1FYMA 3FMRA 3VFZA 1TQMA 2G9WA 4Q4ZF 5CLSA 4IXAA 4G6DA 2XIGA 1R7JA 1SFUA 2DAOA 4Y15A 5ICFA 1SFXA 2RV8A 3K1NA 2V6CA 2K27A 3GX4X 3W6JB 4RGSA 4F7ZA 1XN7A 4KNYA 2XRNA 3F21A 2JTVA 4D0PA 1UFMA 1E17A 3IWFA 4K2EA 1HKTA 5A2QZ 5D5XB 4G8XA 1RZ4A 3GO5A 1BI3A 2JSCA 4U0WA 3F3XA 2Q2EA 5CJ9A 2HWVA 5ILSA 3ZMDA 1Z91A 1LNWA 1EV7A 2P5LC 3FXUA 4Q48A 3VODA 4BNCA 3M9AA 3TDZC 5JVTA 1FC3A 2FXAA 2C6YA 2STWA 3W6KB 3K2ZA 3BOQA 1I27A 1D5VA 5AIPA 3BPXA 3SQNA 3T8RA 3GFIA 5LGNA 4GCVA 1F9NA 3K0LA 3VEPA 4MEYF 1TTYA 2W57A 3FHZA 2L4AA 1YW9A 2E1NA 2HTSA 5JR3A 1D3YA 5LHHA 2Y48A 3IHUA 1J5YA 1IZ1A 3OOPA 1K7AA 4OMZA 2W84A 1SAXA 4EM2A 3HOSA 4ZYDA 5D6EA 1R5GA 2ZMEB 4DNCA 2ADUA 4LK1F 3LAJA 4RS8A 2L01A 1W5SA 3DXJF 4M73A 3V7RA 3RDIA 2DPDA 3I58A 2ACJA 2XAHA 2PI0A 4LLNA 1FYLA 2OQRA 5HDNA 5HDGA 2VE8A 3DF8A 3GYHX 1F1ZA 2Z99A 2KJCA 4LMYA 3BJOA 1U3EM 4AIKA 1U5TA 4LGWA 2H27A 3LAPA 4RB0A 3HSRA 1USTA 1J7KA 1W5TA 1TW2A 2XASA 5H20A 4CO8A 4LG0A 3ZPLA 5E18F 4I0AA 3O3KA 1SD7A 3MWMA 1FBSA 2FBKA 1FBUA 1J0RA 4AIJA 3JAMK 2MH9A 3S2WA 1D8KA 2XKOA 1BC8C 2XGXA 3O2PE 1U5TB 1FY7A 3J81K 2VOOA 2EFPA 5BQTA 1BIAA 1DP7P 2D45A 2GIVA 2KJBA 2IA1A 4P9FA 2YU3A 1R23A 1B9MA 2QM3A 4EMSA 2IA2A 3TOBA 1V3FA 4OIRF 3R60A 1SD6A 2M45A 4ENJA 1CF7A 3I64A 1R58A 2P5KA 4HDUA 4RGRA 4YFNF 1BN5A 3I4PA 4G6QA 4IRGA 1DDNA 3E6CC 1GVJA 4UV9A 4R79A 3N4MA 2B0LA 1FBQA 4KIGA 2VC0A 2VN2A 4GXOA 4MHGA 4O6JA 1MJ9A 3ERED 1F5TA 5IT9Z 5D4SA 4CDGA 3GZ5A 4ASNA 1Z6TA 1ZARA 4OIQF 3MZHA 3L7WA 4KMUX 3WTZA 4WXCA 2DW4A 2YPRA 4HZFA 4TV7A 1QPMA 4P55A 3EYIA 3GVAA 2IW5A 4EGZA 4RB3C 5IT3A 4L5JA 2W85A 4RGUA 4CYDA 3WTTC 1WSUA 4Y17A 1RIOH 5ICGA 4EJTA 2LF7A 4KFCA 1U8RA 2E7XA 3HIFA 4GYGA 5IT9K 5BPIA 2BGCA 3TDUC 3GXOA 1KYZA 4Q5SF 4YIIA 4Y13A 1LJ9A 2FEZA 3RI4A 4HDVA 2GA1A 4IJAA 2GWRA 2V1XA 2K02A 3KP3A 1BJAA 2ZNZA 5JHUA 3JTHA 1W7PA 2XROA 3GWZA 3KLNA 1JHHA 1HW5A 3TGNA 4ON0A 2P7CB 3F8CA 2DK8A 3I59A 4MQVA 2HZTA 2PMHA 5CVRA 3RKYA 4G7HF 2EV6A 2H6CA 5LGTA 4L18B 5HS8A 4ESJA 1WKMA 4A0YA 5DUIA 2EFWA 2MA3A 2VE9A 3C18A 5H6QA 4JQFA 1MD0A 3E3VA 4UUVA 1FYKA 3F8BA 1P6RA 1AWCA 4LJZF 4EJVA 3MAJA 1OKRA 5KVRA 3DP7A 5L3DA 4M9SA 3N97A 1UB9A 3KLOA 5J8CA 2MD5A 4MTDA 1IN4A 1G3YA 1R1TA 1QO0D 2DLLA 1FX7A 2IA0A 1R36A 1JE8A 2F5EA 3F8FA 3T8TA 1BBYA 4OU0A 4L0ZB 2JPCA 1O57A 4ENKA 4UVAA 4BQAA 2YSRA 4JK1X 5DUKA 2STTA 3LSTA 1J75A 4I02A 3ECHA 1BM9A 3IL2A 3MEXA 1IN5A 3E6MA 2K4JA 2AXLA 1G3SA 2K4BA 2XAFA 1NHAA 5BOXA 2XAQA 2MBFA 3O6BB 2DK5A 4IRHA 3OV8A 3CLOA 3B02A 2CSOA 2RKHA 3Q9VA 2VBZA 4EJUA 2K86A 5CVJA 3P9IA 1ZHFA 3LWFA 4HV6A 1ODDA 3QP6A 2UXNA 2RC4A 5HOOA 2P8TA 1KQ9A 2FBIA 5D8LB 4KDPA 4M6YA 2EV0A 3WU1B 4EJWA 4G94A 4HX4A 2P6TA 5DCMA 3HHHA 4AD9A 5J6XA 1HSJA 2AS5F 1YW7A 3LQRA 5EEHA 1ZG1A 3HTSB 2QVOA 4M6XA 1ZN2A 4QWQA 5K5RA 1MJAA 1D8JA 5A2QK 4I09A 3JSOA 4IHTA 1S6LA 3DV8A 1LDKB 3KP2A 3M8EA 4GGGA 2F5CA 4PCQA 1XCVA 1XGMA 5D8KB 3J7AO 4XLNF 1K79A 4MNUA 3KEQA 1G6NA 1YW8A 2XKPA 2P6SA 1HKQA 3ABUA 3CUQB 3DEUA 1IXRC 1H9TA 2KIUA 2DO7A 4PGGA 4JBAA 2HYFA 1IAWA 3BJ6A 3FM5A 2V1UA 4YFXF 1IN8A 2ZNYA 2JZYA 3CUOA 2PMUA 3HRUA 2KKOA 5L3CA 1CGPA 3R0AA 4LD5A 1FP1D 3KP4A 3MCZA 2BYVE 2A6HF 3F8MA 1O3SA 3F6VA 2NNNA 2IVMA 3TO9A 1IXCA 2D1HA 3QOPA 4XSXF 4HX7A 5DEQA 3K1MA 4A5MA 1FT9A 3E5XA 1XGSA 2HKOA 2W24A 3GEZA 1OR7A 3GF2A 3G3ZA 1U2WA 2CWEA 3T0YA 1GHCA 3WTXC 3R6SA 3BROA 1W7PB 1TLHB 3WGIA 2CG4A 2FNPA 2FNAA 3QU3A 1XGOA 4HQMA 1W4MA 1O3QA 4IF4A 3HUGA 2EJRA 4I2OA 3KZZA 4HLXA 4N9IA 3ISPA 2CFXA 1TNTA 2A69F 3V4GA 5BPDA 3VOEA 3NRVA 3EYYA 2HR3A 1FPQA 2L02A 1QGPA 4WX9A 1ZREA 1G3TA 3ECOA 3LQQA 2P4WA 3I54A 3KP7A 2R7FA 4EVIA 1B59A 1T38A 5FLXZ 2OU2A 5FO5A 1H9GA 1I1GA 1BIBA 1BOAA 4ENNA 3RTRA 1OYIA 3ZQ7A 1FP2A 5L3FA 5ICEA 1XSVA 4R1HA 1P4XA 3WTSC 1ON2A 4A6DA 5DYMA 4NB5A 4OMYA 1K78A 2RVCA 2OZUA 2F2EA 4MGRA 3EUHA 5E20A 5AONA 4EM1A 4BHCA 1ZLKA 3PFIA 2L3DA 2BV6A 3ZN0A 3ZMUA 3Q5FA 2BE5F 1MDMB 4S05A 3ABTA 1ZRCA 5FD6A 1PP8F 3RYPA 4BYYA 1ZGJA 5LRSA 1YS6A 2GXBA 4YIFA 4ZYHA 2YX7A 2FOKA 3NEUA 1B9NA 5L3EA 2E1CA 3WGHA 1I5ZA 5E1ZB 2TDXA 4NHJA 4MEXF 2EFNA 1F4KA 4A0ZA 2GAUA 2FQ3A 1HBXG 3B73A 1G4DA 5LBQA 4ZZLA 1TQIA 4P5OA 4HF1A 5FD5A 3HOTA 2PQ8A 2KIFA 4M9ZA 1Z9CA 4YFKF 1KQ8A 1BI0A 1YS7A 2MH2A 2A6EF 2DQLA 4U0VA 1J59A 2BEOA 5CVUA 2G7HA 3GLXA 4IVNA 1MJBA 1P4AA 4WF2A 1YLFA 1YQAA 2QQAA 3DPTA 4WCGA 4PDKA 2OAZA 4OIOF 1XGNA 4EGYA 2V79A 4LLLA 1I6XA 2FU4A 2ZFWA 1R1UA 1XMAA 1T0FA 3P7NA 4IRIA 4WWCA 2GA2A 4XRFA 3GZ6A 3BWGA 3ELKA 2ZO4A 3JW4A 4B8XA 2GZWA 2VT3A 2ZBKA 2IP2A 3KZYA 1UCRA 4S04A 1HW2A 1REPC 3AAFA 4RB2C 3COAC 2WTEA 4ETSA 3Q9SA 2H94A 3HRMA 1Z7UA 5AIQA 3MFKA 3IRRA 1ZYRF 2EB7A 4HA8A 3HHGA 4ZH4F 2W25A 3SHFA 2EK5A 2V9VA 1KYWA 4GO1A 1KQ0A 3LA7A 1ON1A 1PP7U 1JXSA 2DBBA 2X0LA 2VC1A 3TO6A 4I7HA 3BDDA 2M87A 4OINF 4P9UA 5JFRA 4WXDA 3HRSA 1P2FA 4N0BA 3SZTA 1K78B 1SFEA 4KN7X 3HSFA 1WWXA 2LF8A 2DI3A 1IXSB 1EH7A 2Z5UA 1SMTA 3BPVA 3T1BA 2WV0A 1X3UA 3FXQA 2OBPA 3CDHA 4KUMA 2O6GE 1MZBA 3T5XA 1W7PD 5HLIA 5DD8A 3CO7C 3C3WA 5HS7A 3WE3A 2CYYA 1L3LA 1O7LA 2HTJA 1WI9A 3MZYA 3ZP5A 1XMKA 1USSA 2XHKA 1IN7A 3BJAA 1ZLJA 4WXHA 1YTYA 2XVCA 2MLGA 3L2CA 2MLKA 5LEKA 1B4AA 2FMYA 1STZA 2PLYA 3KFWX 5HDKA 2HFHA 3KCCA 3V7CA 5K5QA 1YIOA 2O61A 1KA8A 4HBLA 1KU3A 5ED4A 1U6GA 1TW3A 3K69A 2J5OA 1S3JA 2NAZA 3U2RA 2M1BA 2JT1A 4U88A 2KRFA 1O3TA 3WODF 2A68F 3FF5A 4P96A 2QENA 5E1WA 5HVQC 1RUNA 4CGZA 1KGSA 5LLQA 5LRRA 3D5LA 4FHTA 4R8HA 1ZH5A 3TO7A 1Y0UA 3I0TA 1XB4A 1RUOA 5E1XA 3ZMZA 2FMLA 5FB2A 3E6BA 5BMZA 3HTUA 2O03A 3FMSA 2UWMA 4HF2A 2O3FA 2GXGA 3U1DA 2A61A 5K1YA 2ISYA 2DFIA 2QQ9A 2HOEA 1U5TC 3M8FA 3KEOA 1I1SA 4L9VA 5F1RA 1PDNC 2J5PA 3RYRA 4O3MA 3J80K 1YG2A 5D6FA 2M5WA 1IN6A 2MC3A 4L5IA 4HLYA 5DDGA 1CF7B 3C7JA 4L9JA 3WG9A 2ISZA 2D1VA 4A2UA 3QU6A 3LA2A 2O0YA 2VODA 1FWZA 2UXXA 2DPUA 4UVCA 4AWXB 2HS5A 4BHBA 1V4RA 3ML6A 4PGHA 5D5WB 4MTEA 1ZG5A 5D4RA 3RJPA 2IT0A 2OA4A 1U78A 3I59B 1TNSA 2ETHA 3EQLF 2ZMEA 3I53A 3R61A 3KETA 2D2WA 3WU0A 2QUFA 4RAZA 4HOBA 1ULYA 3TOAA 4M74A 1YFHA 4G7OF 3DPLC 4QLCU 4A12A 2Y0MA 4ESFA 4ZYEA 3K1PA 1T2KA 2Z9OA 5LGUA 1XCBA 3RPUA 3MQ0A 4XSZF 1XD7A 5DV5A 4CXFA 2H6BA 4A0XA 2R7DA 2P5VA 3I71A 4N9HA 1SMYF 4LFUA 1TBXA 3CUQC 1XSXA 1DUXC 1Z1DA 3ZMTA 4FX0A 5ILVA 2L54A 3IWZA 4GYIA 1RNLA 3IKTA 2QBYA 2FA5A 4ZZDA 2M30A 4KMFA 3RPQA 2ELHA 2HDCA 1OMIA 3I5UA 3SZPA 2ESHA 3V8LA 1YYVA 4BH9A 2DU9A 1OYWA 2OQGA 2YX4A 1UHMA 2A5YB 2WWYA 4UNOA 4EM0B 3QRFF 6PAXA 5D5UB 2XV4S 2QBYB 1QZYA 3F6OA 3R0JA 5E8GA 4Z2YA 2F5FA 4OOIA 2GQQA 3DQVC 5DD4A 1H0MA 3F22A 5JI6A 1ZG3A 3WE2A 1Z05A 3SFZA 2VBYA 2HQNA 5TJJA 1HSTA 4UXNA 3L00A 3NQOA 4KA4A 4EQQA 2RN7A 3WTUC 2WC2A 2EFOA 4LG0B 2CQKA 2VBXA 3CJNA 4LK0F 5DCFA 1BI1A 3H92A 2Z3YA 3RKXA 1KU9A 4A6EA 3F8NA 3IC7A 1MKMA 4HX8A 3V8JA 4HF0A 1S29A 3GFLA 1HKSA 3CUQA 3LFKA 4FT8A 3KP6A 1R00A 5EEGA 2PBIA 3HYIA 1O7FA 5E8IA 2HQRA 4HQEA 4L9NA 2PEXA 4EJOA 1FNNA 2O8XA 2HGCA 1QBJA 4U0YA 2RDPA 2VXZA 3EETA 2XAGA 4G9YA 1KU7A 3VB2A 2K7LA 1LDDA 1T6SA 2EA2A 4M71A 4HAMA 2UZKA 1HQCA 2F5DA 3FWEA 2NYXA 5J8FA 2PN6A 4O5VA 1BI2A 2VBWA 2HKXA 1B6AA 2QWWA 1A04A 3RIRA 2FE3A 2EWNA 3QPHA 1GXQA 4M9XA 2VOPA 4LB6B 1EH8A 1C0WA 1DPUA 1ZGAA 4BAYA 1SD4A 2JPBA 4Q47A 4IPAA 2PJPA 4I01A 3BP8A 5KK1A 1OYYA 4U7BA 4FX4A 5ERIA 3GFMA 3KP5A 4M72A 4H0EA 5FGMA 2YR2A 3PQJA 2BBYA 4G7ZF 2FF4A 5HLHA 3FMQA 1YO5C 2PG4A 1MDMA 3ZMVA 3FM3A 1QNTA 3KE2A 3GFJA 2M8EA 4YG2F 3G73A 4CHUA 2ESNA 1OPCA 4HV5A 5ILUA 3DKWA 5LHIA 2ZCWA 2KIMA 4E70A 3BY6A 2EV5A 5ICCA 3QPTA 1O3RA 2G7UA 4RB1A 2ZXJA 2FBHA 2CGPA 2E7WA 1XSDA 1HW1A 1QQIA 1L0OC 2DQRA 5LEJA 4ENMA 2XAJA 1R22A 2HEOA 2OD5A 2ZKZA 5F64A 4HW0A 1LB2A 5HLGA 4HYEA 3V8KA 2A3SA 2LSOA 2QQBA 1IUYA 1SD5A 3H3UA 3DFGA 2EFQA 3RKWA 2COMA 3QAHA 3HRTA 4KN4X 1XDSA 3D0SA 3C1DA 5CVVA 1PUEE 2X4HA 2IRFG 3ZN1A 4IHSA 3BZ6A 3LA3A 1LDJA 5D5VB 2QLZA 5E17F 1LQ1A 2Y75A 1EH6A 4ESBA 4A5NA 1E2XA 3IRQA 1GXPA 1FOKA 1T39A 4L0YB 3REOA 3WGGA 3V7SA 3TQNA 2RQPA 4BXUA 2Q0OA 1VTNC 3FZVA 4LB5A 5LHGA 4I0BA 3TKYA 1FSHA 4KT5C 3E5UA 4AIHA 1K6OA 4KIFA 1G3WA 1AOYA 3M7GA 1S7OA 1B1BA 2L4MA 3JTGA 1S7AA 4B09A 1LEAA 2DT5A 5K5OA 3R4KA 2Q8KA 3U9GA 1WRJA 2R3SA 3M1EA 2LNBA 4I98B 4UVBA 1P92A 4PZJA 4OIPF 3K9TA 1JHFA 2VONA 1P4WA 3ULQB 1JGSA 1XDUA 4MQ9F 4WK8F 3CTAA 3ROUA 2NNYA 4BHPA 5F6FA 4L9TA 2NRAC 2LDUA 1LVAA 2Z33A 5CYVA 3HSEA 2PFBA 1FLIA 3F23A 3P9KA 3GW2A 2IPQX 1HXDA 1ZRFA 1IRGA 3E97A 3J80Z 2RGVA 4KYWA 2OZ6A 1Q1HA 2XUBA 3EDPA 2JRTA 1IRFA 4CICA 1RI7A 4CZZA 1IF1A 1TQPA 1WQ2A 2QZ8A 4RAYA 3QP5A 2EA4A 3PQKA 3FX3A 2HYGD 1ONVA 2A07F 2FRHA 1IW7F 2RNJA 2ZJ2A 5FFXA 2H09A 3E5QA 1FZPB 1KU2A 4NQWA 1QZZA 3P9CA 3E6DA 5FLXK 4RGXA 4U7DA 3FXRA 2VT2A 3GUDA 5FFZA 1J2XA 2QYOA 1MGTA 3H3ZA 3J81Z 1FSEA 5DCMB 1BC7C 1T98A 1S8NA 2FSWA
chains in the Genus database with same CATH superfamily
3HKZA 3JAMZ 3L9FA 1RC9A 4DQ2A 2CQNA 2UV1A 2W48A 2OTLI 2EILH 2OF7A 3WTVC 4LLGF 3DTKA 3DKYA 3ZQCA 3IKVA 1U9NA 2AHQA 3F72A 1LEBA 4A69C 2LKPA 4PK4A 2E5ZA 2EINH 4BGDA 3ZMSA 2EQRA 1D1BA 2JN6A 4NQWB 3CO6C 2ECBA 2CO5A 4XORA 4ABZA 3K70C 1X4OA 2OV7A 3QODA 4IHXA 1K4TA 4UV8A 3BQZA 4RAFA 1JT6A 4XBFA 2YS9A 2X9DA 4EV0A 1ORKA 2QCOA 5L3BA 1D5YA 4Z6YA 2WA0A 3M8JA 2M7BA 5F1JA 4PFPA 3DBLB 2ICWG 2JWTA 2QKMB 4AVPA 1MNDA 5HS9A 3HPHA 2P7VB 5IYCJ 2DTRA 5H6RA 1Y0NA 2IJLA 1Y6IA 4KICA 2X51A 5BS6A 3WTWC 3JSPA 3BR2A 4ZYGA 3L09A 5TRDA 1ZRDA 1ZAOA 1DPRA 3SXYA 4MO7A 1TWHJ 3H35A 2E5NA 1FOXA 4XLPF 4UHTA 2V1DA 3WTYC 2DXIA 2NS0A 4C2UA 2R7XA 5CVIA 1R5HA 2CW0F 1R1VA 2HYJA 4B47A 2E2JJ 3QPSA 5M3MJ 5K7ZA 1J9IA 5L3GA 4BBSJ 1UHWA 1B8IA 2AXTC 3HOYJ 4KIBA 1UELB 2VJIA 2YUSA 1MBKA 1SFKA 1Z6RA 1FYMA 3FMRA 3VFZA 3LSKA 4IHVA 1TQMA 3F0CA 2G9WA 2K9LA 2IGMA 3K4NA 5K7FA 4Q4ZF 2R7QA 4IL6C 5CLSA 2FUG2 2CUEA 3AG2H 2WY8Q 4E7IA 4CSWA 4IXAA 4G6DA 2XIGA 1R7JA 2BY2A 1SFUA 2DAOA 4Y15A 1T08B 5ICFA 1SFXA 2XF6A 1SAUA 2RV8A 2R92J 3K1NA 4XMYA 1UHSA 2V6CA 5B66C 2K27A 3GX4X 3PM1A 2XGCA 3W6JB 3TW6A 4RGSA 4S0HB 4F7ZA 1XN7A 4KNYA 2DA7A 2DOFA 2N8GA 2NVQJ 2XRNA 1ACIA 3ABLH 2K9QA 3F21A 5J4VA 3A01B 2JTVA 4A3CJ 4D0PA 1UFMA 2HVSA 2VKHA 1E17A 3IWFA 4K2EA 4A3BJ 1YJ9I 1HKTA 1VQ4I 3LMMA 5D5XB 5A2QZ 1V55H 4G8XA 4CYCB 3S17J 1RZ4A 1OISA 2RREA 2QKLB 3GO5A 4J19A 5M5XJ 2EIJH 1BA5A 4C30A 1BI3A 2ELJA 2JSCA 4RM3A 3BTLA 3FKIJ 4U0WA 3F3XA 2Q2EA 5CJ9A 1P9QC 2HWVA 1V5FA 5ILSA 3ZMDA 2CV2A 1Z91A 2CRGA 1Z77A 1LNWA 3H9GA 1EV7A 2P5LC 3FXUA 4Q48A 2BY3A 3VODA 4BNCA 2DYSH 3M9AA 3DTEA 4G6TB 3TDZC 2XB0X 1FC3A 2VI6A 5JVTA 3SDGA 2FXAA 4L5EA 4FQGA 1Z3YA 2C6YA 2STWA 3W6KB 3K2ZA 3BOQA 1I27A 1D5VA 5AIPA 3BPXA 3SQNA 2KRCA 3T8RA 3E1SA 3EPZA 3GFIA 5LGNA 4BL0B 2EPFA 4GCVA 4HSRA 3MMYB 1ETYA 3J7AY 1F9NA 3K0LA 4BE0A 3VEPA 1NG7A 4MEYF 2XRLA 1TTYA 2W57A 3FHZA 2L4AA 3RKQA 2WV1A 4UY8I 2M2EA 1YW9A 2EZHA 2DCEA 2E1NA 3TBIA 2HTSA 5JR3A 1D3YA 5LHHA 2Y48A 3IHUA 1J5YA 1IZ1A 3OOPA 2ZXIA 3L2QA 1K7AA 4GFBA 1WPKA 4OMZA 4FISA 2W84A 1SAXA 3I4MJ 2EIMH 5E3OA 4EM2A 1ZR2A 3HOSA 4C2TA 4ZYDA 5D6EA 3AFHA 5EDNA 1MMSA 1R5GA 2ZMEB 2ADUA 4LK1F 5F08A 4DNCA 3LAJA 1Z0XA 4RS8A 2QF7A 3M3YJ 2KISA 2B9SA 2L01A 1UG0A 3W3CA 3OS2A 2GIZA 1W5SA 3PFYA 3CCUI 3DXJF 1X1AA 2Y9YA 2DODA 3OSGA 1T56A 4M73A 3V7RA 3RDIA 1HCRA 1GV5A 2DPDA 3LSPA 3I58A 2ACJA 4F91B 1S7EA 2XAHA 2PI0A 4Y3OA 5DS9A 4LLNA 1FYLA 2OQRA 1QHHD 1PYVA 3SFIA 5HDNA 5HDGA 2LFBA 1ZKGA 2VE8A 2QSHX 5C4XJ 5JLWA 3DF8A 3VYTB 3GYHX 1F1ZA 2Z99A 2KJCA 3G4SI 3B6AA 4LMYA 4B4CA 4XL9A 3DWLE 3BJOA 4UUSB 2FOWA 3ASOH 1U3EM 1LFPA 1ERDA 4AIKA 4XKBA 1U5TA 3OMYA 1XTAA 4LGWA 2H27A 3LAPA 1MBHA 4RB0A 3HSRA 2MFZA 4PJMA 1USTA 2BHYA 2DA1A 1J7KA 1AA7A 1W5TA 3CC7I 1TW2A 2XASA 3OL4A 5H20A 3D5RC 4JX6A 4CO8A 4AIDA 4LG0A 3BQYA 1QA6A 3ZPLA 3OS1A 1X19A 3JR9A 4CCOA 4DYCA 2KHMA 3DEEA 1WJ5A 4I0AA 5E18F 3NARA 4C3JJ 1IDZA 3O3KA 1EJ9A 2XF7A 1SD7A 3MWMA 3OR2C 3HGYA 1FBSA 1IRZA 2FBKA 1FBUA 1DGWY 3UR3C 1J0RA 4AIJA 2JVHA 2LVSA 3H5NA 2MH9A 3S2WA 3JAMK 1YHQI 1D8KA 2XKOA 4XRSA 2XGXA 2L5QA 1BC8C 2ZMEC 3O2PE 1U5TB 3DBHB 1FY7A 2B63J 2M4KA 3ZQHA 1ZR4A 4UUTA 3J81K 2JSPA 2VOOA 2EFPA 5BQTA 1YX3A 4AYBN 1BIAA 3HJEA 1T33A 3ESWB 3QWLA 4NC7A 1DP7P 2D45A 2GIVA 3KPHA 2KJBA 3BZKA 3TEDA 2IA1A 4P9FA 2YU3A 1R23A 3OY9A 1MSFC 2HOTA 1B9MA 4XR6A 2QM3A 4EMSA 1WJCA 2ZJPF 1D1CA 2ECCA 1TZLA 2DMUA 2IA2A 2JK3A 3TOBA 1V3FA 4XLAA 4OIRF 5HNFA 3R60A 1SD6A 2M45A 4ENJA 5KNLA 1CF7A 2WB1A 2HVQA 3I64A 3S1MJ 1R58A 2P5KA 1V54H 4HDUA 3BR6A 4RGRA 4B3XA 4YFNF 1BN5A 3E7LA 2LOOA 3OSFA 3CJTB 5J1RA 4IKFA 3I4PA 4N4NB 2KIQA 2ZSIB 4G6QA 3PSFA 2WADA 4IRGA 1DDNA 3E6CC 3AKZA 1APLC 1A31A 2R7UA 1GVJA 4UV9A 4R79A 1N77A 2BW3A 3N4MA 2B0LA 2GM4A 1FBQA 4KIGA 4B1RA 2VC0A 2CH0A 3WHCA 1TT5B 2VN2A 3JCUC 4U87A 4GXOA 2ZJQF 4MHGA 1HC8A 3FKJA 4O6JA 1MJ9A 3ERED 1F5TA 5IT9Z 5D4SA 3I4NJ 2Z16A 2KLOA 1S72I 3CMAI 2CUZA 2KZGA 4CDGA 4QPQA 2V6EA 3GZ5A 4ASNA 2CMPA 1LE8B 1BR4A 1OJLA 4A3MJ 1Z6TA 3BC8A 1RKTA 2MW8A 2E71A 2VPRA 4FASD 2XGEA 1ZARA 4UB6C 4OIQF 1MIJA 1DU6A 3MZHA 1FTZA 3L7WA 2GOXB 1FIPA 2IGNA 4KMUX 4WXCA 3WTZA 2DW4A 2YPRA 4HZFA 4TV7A 3VSLA 1HLVA 3S2HJ 1QPMA 4P55A 4BQQA 3CDIA 3I56I 3GVAA 2IW5A 4EGZA 3EYIA 4XLEA 4CA0A 2KT0A 3ZOBA 3PSIA 4RB3C 1VQ8I 5IT3A 4L5JA 2W85A 4OWRB 4RGUA 4CYDA 3WTTC 1WSUA 4Y17A 1RIOH 5ICGA 4EJTA 4B48A 2LF7A 4KFCA 3K4JA 1U8RA 1HF0A 2E7XA 5F0HA 3S8PA 1ZK8A 3HIFA 3GTQJ 4GYGA 5IT9K 3OYBA 4E4HA 5BPIA 2H8RA 2BGCA 3TDUC 3GXOA 1KYZA 3IH2A 3K4CA 1R4MB 4Q5SF 3ZQQA 4CYCA 4Y4RA 3CCMI 4J01A 2BZTA 4YIIA 4Y13A 1LJ9A 1YI2I 2LH9A 5HLTA 2FEZA 3FXKA 3RI4A 4X1EA 2GA1A 4HDVA 4IJAA 4D5FA 5C4JJ 3Q3SA 2GWRA 1VQKI 2V1XA 2ID6A 2K02A 2LLKA 3KP3A 1BJAA 2ZNZA 5JHUA 1RESA 3JTHA 5IOZA 2HQ5A 1N75A 1W7PA 2XROA 3GWZA 4W97A 3KLNA 1YJWI 1JHHA 1HW5A 2QEXI 2LKSA 2Y69H 4ON0A 3TGNA 3TW7A 4ZTJA 2P7CB 3F8CA 5GTHC 1ETOA 3Q0VA 2DK8A 3I59A 3BR1A 4MQVA 2HZTA 4W1UA 5EYRA 1R71A 3H1CA 1TWAJ 1BOBA 2PMHA 5CVRA 3RKYA 4MIMA 2PX9A 4NUBA 4G7HF 1PUFA 3IH4A 3S2DJ 2EV6A 3HGGA 1R9TJ 2H6CA 5LGTA 1U9OA 2Y0SN 4L18B 1ETWA 5HS8A 5HNHA 1Y1VJ 4ESJA 2FJ1A 1WKMA 4A0YA 4XK4A 5DUIA 4IHWA 1JUSA 3D5SC 3SEZA 2EFWA 2MA3A 1WGXA 2WBMA 4V2FA 4Y7NJ 4X0GA 1PVEA 2VE9A 4JX4A 3C18A 3GTKJ 1RKWA 2MC4A 2CW7A 3LSHA 3G1OA 2KP6A 5H6QA 2IS1A 4II3A 4JQFA 3FBNB 1TWGJ 2RQQA 1MD0A 3E3VA 4UUVA 2VQCA 2EIKH 4ZYAA 1WHUA 3W2WA 4A93J 5F0CA 3ZQIA 1BW5A 3TMOA 2MABA 1FYKA 3F8BA 1P6RA 1TL8A 1AWCA 3CMEI 4XLFA 4LJZF 1E3OC 4EJVA 3MAJA 2OTJI 1OKRA 5KVRA 3DP7A 5L3DA 4M9SA 3N97A 1UB9A 3KLOA 5J8CA 4CZCA 3JRAA 2MD5A 3DU6A 4MTDA 1J09A 4ZTFA 1IN4A 1G3YA 1JJ6C 1R1TA 1QO0D 1YX5A 3PO2J 2DLLA 1FX7A 2K5CA 3VPRA 3S3OA 2IA0A 1R36A 1JE8A 1E0EA 2F5EA 3F8FA 3T8TA 1BBYA 4OU0A 4L0ZB 4FX4A 1D0YA 1OR7C 2JPCA 1YOVB 1O57A 3BCBA 3H0DA 4ENKA 4UVAA 4F55A 4BQAA 3HOWJ 2YSRA 3G2BA 3K10A 4JK1X 3JRGA 1GLNA 3H5AA 5DUKA 2V9KA 3LSTA 2STTA 1J75A 4I02A 3ECHA 1BM9A 3IL2A 4BEHA 1K61A 3MEXA 1FEXA 4JX5A 1IN5A 3E6MA 2K4JA 2AXLA 1G3SA 1VI0A 2K4BA 2XAFA 2XF5A 1NHAA 4IOCF 5BOXA 3JRFA 1NK2P 2XAQA 2HPMA 2MBFA 4ITVA 3O6BB 2R7WA 2DK5A 4IRHA 3OV8A 4OAYA 3CLOA 3B02A 4HPQA 3ZCOA 5CKTA 2R5ZA 3DBRB 1VQPI 2CSOA 2WAFA 2RKHA 3K70D 3HOZJ 3HOUJ 1K4SA 2PJRB 3Q9VA 2JUGA 4C3IJ 2VBZA 4EJUA 2K86A 5CVJA 3P9IA 3CCJI 5BNGA 3ZQGA 1BR2A 1ZHFA 3LWFA 4HV6A 1EKEA 1ODDA 3QP6A 2UXNA 3X2QH 1PUFB 1EF4A 3OIQA 1G59A 1OCCH 2RC4A 5HOOA 2P8TA 4AC0A 1KQ9A 2FBIA 5B1BH 3VYRB 5D8LB 4KDPA 3OS0A 4M6YA 1O4XA 3A02A 2EV0A 4DIQA 3WU1B 4EJWA 3CP8A 4G94A 4HX4A 2P6TA 1KZHA 5IP7J 5DCMA 3NWTA 3HHHA 4AD9A 4AVZA 5J6XA 1HSJA 2AS5F 1BW6A 1YW7A 1IV8A 2EZKA 3K2AA 4LIUA 2L9VA 3LQRA 3S32A 1OFCX 5EEHA 1ZG1A 2VKVA 3HTSB 2QVOA 4M6XA 4B44A 5FKOA 4QPOA 1ZN2A 4QWQA 5K5RA 3A03A 1MJAA 1D8JA 5A2QK 4I09A 3OYEA 1HOMA 3HUGB 3JSOA 1ETVA 4IHTA 3ZR8X 2COBA 5EG0B 1S6LA 1VFCA 3DV8A 1LDKB 3KP2A 3M8EA 2XAUA 3AG3H 5DM7F 4GGGA 2F5CA 4PCQA 1XCVA 4FE4A 1XGMA 5D8KB 3MVPA 3J7AO 4XLNF 1K79A 4MNUA 1LPQA 3KEQA 2LY1A 1G6NA 1YW8A 2XKPA 4D9JA 1W0UA 3VYUB 2M7AA 2P6SA 4DJAA 2IAIA 1HKQA 2FQ4A 3ABUA 4GDFA 3HEFA 2DJNA 3CUQB 3DEUA 1IXRC 4BXXJ 1H9TA 2KIUA 1LFBA 2DO7A 4PGGA 4JBAA 2HYFA 1WJFA 2X1DA 3OYCA 1QPIA 3GTMJ 1SEUA 5FLVA 4KISA 3MD2A 3QYFA 1VQMI 2VQLA 1LE8A 3C2BA 2F5VA 3BJ6A 1IAWA 3FM5A 3BTCA 1Z3XA 1VQLI 5IOYA 1FMWA 2V1UA 4YFXF 2I8DA 3FHNA 1IN8A 2VL8A 2LKXA 2ZNYA 3CUOA 1WVRA 2JZYA 2PMUA 3G1MA 3HRUA 2KKOA 2LMDA 2XPWA 5L3CA 1CGPA 2CUJA 3ZQLA 3R0AA 4LD5A 1FP1D 3KP4A 4AU7A 2V9PA 3RPUD 1KONA 3CDLA 1R5ID 2IEKA 2I10A 2DOEA 3MCZA 1JI8A 2BYVE 3TP3A 2OCEA 2A6HF 2Y0SA 4HNUA 4RMNA 1JKOC 3F8MA 1O3SA 3A4CA 3F6VA 2NNNA 1IG7A 2QA4I 2QSFX 4EATA 2IVMA 3TO9A 1IUFA 2LG4A 4DZJA 2JA7J 1IXCA 2D1HA 4ZC3A 1Q1VA 3QOPA 4XSXF 1GT0C 3A1YA 4XLHA 2O5RA 4HX7A 2R5YB 5DEQA 5FRNA 3K1MA 4RLQA 1LKXA 5JHFA 4A5MA 3A01A 1FT9A 3UKGA 3E5XA 1XGSA 2HKOA 2W24A 3GEZA 1OR7A 3GF2A 4BS9A 2GXAA 3G3ZA 1D0XA 1A5JA 1U2WA 2CWEA 3T0YA 1GHCA 3WTXC 3R6SA 2HI3A 3BROA 1W7PB 1XS9A 1TLHB 3WGIA 1RPWA 2CG4A 2HNHA 1T0FC 3HB9A 2FNPA 2FNAA 3QU3A 1OCTC 3KEYA 1XGOA 4HQMA 2K40A 2X6XA 4MLOA 1R49A 1W4MA 4ZDOA 2HVRA 3S93A 4NDLA 4JOMA 1O3QA 4IF4A 3HUGA 3W6VA 2EJRA 3PUBA 3OIPA 5J3LA 3CCEI 1M1EB 1PJRA 4I2OA 3KZZA 4HLXA 1MBJA 4J00A 4N9IA 3ISPA 3AG1H 5CPRB 2CFXA 4C2MJ 1TNTA 2A69F 3V4GA 5BPDA 2QGUA 1YITI 3VOEA 3NRVA 3EYYA 1T95A 3DPUA 4RAGA 2HR3A 4BE1A 1FPQA 2DA3A 1QGPA 2L02A 4WX9A 1ZREA 1G3TA 3ECOA 2NVXJ 3LQQA 2P4WA 3I54A 5J1UA 3KP7A 3IAM2 5DM6F 2R7FA 1MSEC 4EVIA 3MN2A 1B59A 2E36A 2F4IA 1D1AA 1T38A 4M3BA 1WH7A 5FLXZ 2OU2A 5FO5A 2HQAA 1H9GA 2ME0A 1I1GA 2M34A 1BIBA 1BOAA 4ENNA 2DOAA 3RTRA 3CESA 1OYIA 1U8BA 3Q0WA 2VJ4A 3ZQ7A 3OYIA 1FP2A 4XIDA 5L3FA 3S1RJ 5ICEA 4EEFG 1XSVA 4R1HA 2WY7Q 1P4XA 3WTSC 1ON2A 4BDZA 1E3PA 1IV6A 4A6DA 5DYMA 5E3NA 2H1KA 1MNEA 4NB5A 4OMYA 5DTDA 3W2AA 1K78A 3VDXA 2RVCA 2OZUA 2F2EA 2W7NA 4MGRA 2E1MB 3EUHA 4M3DA 5E20A 3L2RA 5AONA 4EM1A 4IQJA 4BHCA 2ZFUA 1WI3A 1ZLKA 2VUMJ 4BJTA 2R7ZJ 2DT7B 3PFIA 2L3DA 2BV6A 2Y31A 3ZN0A 4XM3A 1SC7A 5CQGA 4A3FJ 3ZMUA 3Q5FA 2BE5F 1MDMB 1Y56A 3N05A 4S05A 4DBRA 2MGQA 3ABTA 3OR1C 1ZRCA 5FD6A 1PP8F 3S1NJ 3RYPA 4CCMA 3OYAA 2EBIA 4BYYA 3ABKH 4NC8A 3SYTA 1ZGJA 1UZCA 1YS6A 5LRSA 2GXBA 4B43A 2LREA 4GRIA 3CCYA 2ZC2A 4YIFA 4ZYHA 3HZJA 2YX7A 1FIAA 2FOKA 3B6CA 3NEUA 1B9NA 3DLLF 5L3EA 3S3NA 1YRNB 2E1CA 3WGHA 3SJMA 1I5ZA 2PMZA 2R7OA 1MMDA 2XPVA 3ZQFA 5E1ZB 1Z7LA 2TDXA 3EUHC 2DMPA 2OC6A 3BT9A 5GAHJ 2L2OA 5FROA 5H2FC 4NHJA 4MEXF 1NH3A 2EFNA 1N25A 1F4KA 4M6VA 4A0ZA 2GAUA 2XDVA 2Y9ZA 2FQ3A 5EZHA 3PO3J 1HBXG 1W5CC 4XQFA 4E6KG 1E3HA 4JP0A 3B73A 4F93B 1IRXA 5KAFC 5GPAA 1H8AC 1G4DA 5LBQA 4HNTA 3S3MA 1VF9A 4ZZLA 1TQIA 4P5OA 4HF1A 5FD5A 3LSJA 3QYBA 3HOTA 2PQ8A 4BJ5C 1A35A 4BQOA 2DA4A 1XMXA 2KIFA 4CCJA 1ETKA 4M9ZA 2X85A 1Z9CA 4YFKF 1KQ8A 1BI0A 1F43A 1XX5A 1YS7A 2MH2A 2A6EF 2DQLA 4XLCA 4U0VA 1J59A 2BY1A 2BEOA 2XPUA 5CVUA 4YRVA 2G7HA 3GLXA 4IVNA 3KYDB 3JRCA 3I9V2 1MJBA 1P4AA 4WF2A 4M3GA 3K4KA 1YLFA 1YQAA 4XKVA 1FOYA 1T8IA 2QQAA 3DPTA 4G12A 4WCGA 4PDKA 2JRMA 2OAZA 1NK3P 2LY2A 4OIOF 4II2A 1X58A 1XGNA 2P0WA 2ZXHA 4EGYA 3CJRB 3OOUA 2V79A 2BVLA 2TRTA 1I6XA 4LLLA 5HODA 2FU4A 2ZFWA 1G2HA 1R1UA 1XMAA 1T0FA 2VLAA 3P7NA 4NNJA 2KDOA 4IRIA 4WWCA 2GA2A 1WJEA 3BG3A 4XRFA 3GZ6A 4CCKA 3BWGA 3ELKA 2ZO4A 1W0TA 3NAUA 3JW4A 4B8XA 2OPTA 5EGOB 2VJJA 2GZWA 5J47A 2JA2A 2VT3A 2ZBKA 2IP2A 1P7IA 3KZYA 3V42A 1UCRA 3WG7H 2HDWA 4S04A 1HW2A 2BXZA 1VQOI 1REPC 3UNGC 1ITYA 3AAFA 3LSIA 4RB2C 3COAC 2WTEA 5GP9A 4ETSA 3Q9SA 2H94A 5E3LA 3HRMA 1Z7UA 5AIQA 3CC4I 3MFKA 4BJ6C 1NG6A 3IRRA 1DP3A 1ZYRF 2EB7A 4HA8A 4E7LA 3P5JA 2F4OB 1OLTA 3HHGA 4ZH4F 3DU5A 2Q2EB 2W25A 3GZNB 2E35A 5FKMA 3SHFA 2EK5A 2V9VA 3OYKA 4V2GA 1Y8QB 1KYWA 4GO1A 1W36C 2VPLA 4UB8C 3KZIC 2NVUB 3VSKA 1KQ0A 3LA7A 5IP9J 2V1NA 1ON1A 3L2VA 1PP7U 1JXSA 2DBBA 2X0LA 2VC1A 1S9HA 3TO6A 5FKLA 4X6AJ 4BACA 4I7HA 3BDDA 2M87A 2A05A 4OINF 4P9UA 5JFRA 3BG6A 4WXDA 3HRSA 1SVOA 1P2FA 4N0BA 3SZTA 1K78B 3I3LA 3CCVI 1SFEA 4KN7X 2IBDA 3HSFA 1WWXA 2R7SA 4D5CA 4KJZA 1K6YA 2LF8A 3PIOF 1UG2A 4IX7A 2HU9A 2DI3A 1IXSB 1EH7A 2BHZA 2DFHA 2CV0A 2BXYA 2Z5UA 4A3KJ 1IC8A 1SMTA 3LSGA 3BPVA 3T1BA 1OCOH 1TWCJ 4HNVA 2WV0A 1X3UA 3FXQA 1UMQA 5IYDJ 2OBPA 1U0JA 3CDHA 2F48A 5JLXA 4KUMA 2O6GE 2E19A 3L1PA 2W00A 2L9SA 1FJLA 3U1KA 4KT6A 3GTOJ 2O8KA 1MZBA 3OYNA 1X1CA 5F27A 3BZCA 3T5XA 1W7PD 5HLIA 4IQ4A 3C3WA 5DD8A 3FISA 3M07A 5HS7A 1V5GA 2CYYA 3WE3A 3CO7C 5M5WJ 1L3LA 1AKHB 4A3EJ 1O7LA 4DGWB 3AL0C 3LNQA 2HTJA 3EUKL 4XRMA 3BR0A 1HA8A 1WI9A 3G1LA 3MZYA 2E2IJ 3C2HA 4I99C 3MKYB 3ZP5A 1GVDA 4MFDA 1NTCA 1XMKA 1B72B 3J7YJ 1USSA 2XHKA 1IN7A 1H88C 3BJAA 1ZLJA 2HPIA 4WXHA 1YTYA 2XVCA 2MLGA 3L2CA 2HOAA 2MLKA 5LEKA 1W36D 1B4AA 2FMYA 1STZA 3HL2A 2DYRH 3CQZJ 3ZGKA 2PLYA 1IJWC 3KFWX 2IXSA 2DDAA 2G0EA 5HDKA 5J1YA 3HC7A 2OJED 2HFHA 3CLQA 3KCCA 2Z1DA 3V7CA 1YIOA 2GOMA 2JMWA 5K5QA 1I6HJ 2O61A 1KA8A 4HBLA 1KU3A 1X4PA 3KX2A 4XONA 4E7HA 1TWFJ 5ED4A 1U6GA 1TW3A 3K69A 2R7VA 2J5OA 1S3JA 2NAZA 2P81A 3U2RA 3O8HA 2XC7A 2M1BA 2DA2A 2LD5A 2JT1A 4M3EA 2JQ7A 4U88A 2KRFA 1O3TA 3S14J 3WODF 1VQ5I 2A68F 2E60A 3FF5A 4P96A 2QENA 5E1WA 2ID3A 2DJIA 5HVQC 1RUNA 4CGZA 2FD5A 1KGSA 2HXIA 5LRRA 5LLQA 1MBFA 3D5LA 4FHTA 3JRIA 2IS4A 3MZ8A 4R8HA 3RCOA 1DQUA 1VQNI 2O7OA 2QQ8A 1ZH5A 3FDYA 5FKNA 4XOTA 2XB5A 2R0QC 3TO7A 1Y0UA 5C3EJ 3I0TA 1XB4A 1RUOA 4YEJA 5E1XA 2CFOA 3ZMZA 2FMLA 5FB2A 9ANTA 2DTZA 3E6BA 5BMZA 1JJ8C 3OYFA 1F36A 3HTUA 2O03A 3FMSA 5M3FJ 2UWMA 4HF2A 2O3FA 4E7JA 4XICA 2GXGA 2VIXA 2VQHA 1QVUA 3U1DA 2A61A 5K1YA 4I76A 3MKWB 1JKRC 1YRNA 2XSDC 1JUMA 2CUFA 2JJ7A 2ISYA 5B3SH 2DFIA 2QQ9A 2HOEA 1ENHA 1U5TC 3L2WA 5LD2C 2BVMA 3M8FA 3KEOA 1A6IA 1I1SA 2DMQA 1IDYA 3A0BC 4L9VA 5F1RA 1PDNC 2J5PA 4RBOA 3RYRA 4O3MA 3J80K 5EGOA 3QOEA 2NS7A 1YG2A 3DCFA 5D6FA 2M5WA 1IN6A 2MC3A 4L5IA 5E3MA 3H3VK 4HLYA 5DDGA 1CF7B 2R7RA 3FXLA 3C7JA 3OYJA 3LSRA 4L9JA 3WG9A 3CJQB 3H0GJ 3BTIA 2KZVA 2D1VA 2ISZA 3DEWA 3D1NI 4A2UA 3QU6A 5IYBJ 3LA2A 2O0YA 2Q1ZB 2MSYA 2DMNA 2VODA 1FWZA 4XN3A 4A3GJ 2UXXA 1BL0A 2DPUA 4UVCA 4AWXB 2ELKA 2HS5A 4BHBA 2BW3B 2M8GX 1V4RA 2VASA 3ML6A 4PGHA 3NWSA 2CQ7A 5D5WB 4MTEA 1ZG5A 3CCSI 1RRJA 2B7EA 5D4RA 2MG4A 1QZEA 2A6TA 1OCZH 1R4NB 3RJPA 4PJNA 2IT0A 2OA4A 1U78A 3I59B 1OQYA 1TNSA 3CCLI 2ETHA 3EQLF 4XKCA 2ZMEA 3I53A 3R61A 3KETA 2D2WA 1P7JA 1ZTRA 3WU0A 2QUFA 4RAZA 3K4MA 2DA6A 3CZ6A 3K6GA 4HOBA 5KAIC 1ULYA 2M0CA 1YIJI 3TOAA 1N78A 4M74A 3SDBA 1LUJB 1YFHA 1TT0A 2Y30A 1W1WE 3AG4H 4G7OF 2E34A 2EZLA 4A3LJ 4FCYA 5K7HA 2WAQA 3DPLC 4QLCU 4A12A 2Y0MA 2AQEA 4ESFA 3LL7A 4ZYEA 3CMYA 3K1PA 1T2KA 1VNDA 2HDDA 2Z9OA 5LGUA 2DN0A 1XCBA 3BR3A 3RPUA 2XGDA 3MQ0A 4XSZF 3IH3A 1FOWA 2L7ZA 1B8IB 5IY5H 4E7KA 1XD7A 2KFDA 4A3DJ 5DV5A 3PUFA 3K4BA 4CXFA 2H6BA 4A0XA 2M9HA 2R7DA 2P5VA 3I71A 4N9HA 1SMYF 4LFUA 5FRMA 2JUCA 1TBXA 3CUQC 1TC3C 1CQTA 2NVTJ 2FX0A 4OAZA 2PMZN 1XSXA 1DUXC 1Z1DA 3RZOJ 3K4LA 3ZMTA 4FX0A 5ILVA 2K9NA 1WFXA 3ZXSA 2L54A 3IWZA 4GYIA 1Y1WJ 1RNLA 4D7MA 1JTYA 2VXDA 3F9KA 3IKTA 5CQEA 5B5EC 4A3IJ 3LFUA 4H4KC 3S16J 1SANA 3K7AJ 5FJ8J 1ETXA 3BCAA 2QBYA 1MH4A 2FA5A 4ZZDA 2M30A 4KMFA 3RPQA 2DFEA 4Y52J 4AYBA 4PJJA 2ELHA 2HDCA 1BR1A 1OMIA 4LG3A 4F92B 3I5UA 3SZPA 1WJBA 1FTTA 2ESHA 3V8LA 1YYVA 3H9JA 4BH9A 4IHYA 2DU9A 2AQFA 2YX4A 1OYWA 2DT6A 2OQGA 4Y33A 2X48A 1TP4A 3MKLA 4B3AA 1UHMA 2A5YB 2WWYA 1AU7A 4UNOA 4EM0B 4BY7J 3QRFF 4F52A 1X1DA 6PAXA 4BDYA 1I3QJ 5D5UB 2WAEA 2XV4S 4E7ZA 1ETQA 2QBYB 1SVLA 3ERMA 2LC2A 1QZYA 3PL8A 3F6OA 3R0JA 5E8GA 2D5VA 4Z2YA 1ZELA 2PJRA 2X6OA 3HOVJ 5TGTA 2F5FA 4OOIA 2OUMA 2GQQA 3DQVC 2NOJB 5DD4A 3Q0UA 1H0MA 5JI6A 3F22A 3S1QJ 1ZG3A 3WE2A 5B1AH 4PFOA 1Z05A 5EF6A 2WAQN 1WZ2A 1POGA 4AM3A 2CS3A 3FK7A 3WHBA 4CCLA 3SFZA 2VBYA 2HQNA 5TJJA 4D7NA 1HSTA 1OCRH 2WB1N 4BKXA 2VJ5A 4UXNA 3L00A 5JVGF 3NQOA 1JUPA 4KA4A 1B72A 3PIPF 3HXLA 4EQQA 2RN7A 4BY1J 4ZJZA 2MD0A 3WTUC 1LFUP 2WC2A 2EFOA 2V7FA 3ZRGA 4LG0B 4NC6A 4ZDLA 2CQKA 2VBXA 1WCMJ 2V26A 2LTPA 4IZZA 4F3QA 3G71I 2NOGA 2LR8A 2M0MA 2H1LA 1MMGA 3CJNA 4LK0F 5DCFA 1X1BA 5F04A 3RSNA 1BI1A 3FIWA 3H92A 2Z3YA 1VQ9I 5F0FA 3RKXA 1JKQC 3OL3A 5GTIC 2JVGA 2CU7A 1KU9A 2Z2SB 4A6EA 2K85A 3PNYA 3F8NA 3H36A 3CF5F 2JA5J 3IC7A 1MKMA 4HX8A 4DBQA 4YIRX 3CMMA 1VQ7I 2IS2A 4CH7A 4FTHA 1X3WB 1VZ0A 3V8JA 4HF0A 1S29A 3GFLA 3O8GA 2ZJRF 1HKSA 2F4MB 3CUQA 3LFKA 3PNTA 4FT8A 4QTRA 2MYSA 2K3FA 3CCQI 3KP6A 1R00A 3CC2I 5EEGA 2PBIA 2LRDA 3GCMA 3SZGA 3JRBA 3DLAA 4IO9F 2RNGA 3HYIA 1O7FA 5E8IA 3HPGA 2HQRA 3CD6I 1JGGA 4HQEA 4L9NA 3J7ZI 2PEXA 4EJOA 1Y8RB 2XSJC 3IUOA 2KDZA 3IP4B 2O8XA 1FNNA 3I55I 2CV1A 5KHDA 2HGCA 4XRSG 1QRYA 1QBJA 2L0KA 4U0YA 2RDPA 2VXZA 3BR5A 3EETA 2XAGA 4G9YA 1KU7A 4FETA 3VB2A 1S5LC 2K7LA 5TISC 1LDDA 1T6SA 2L7MP 2EA2A 4IEJA 4M71A 4HAMA 4PJLA 2UZKA 1HQCA 3FWEA 2F5DA 3BLYA 2NYXA 1XG1A 5J8FA 2PN6A 4O5VA 1BI2A 3GTPJ 1UJ8A 2VBWA 2HKXA 1B6AA 2VB6A 2QWWA 1H89C 1A04A 2E2HJ 2W4SA 3RIRA 2FE3A 2IGKA 2EWNA 4LITA 3QPHA 1GXQA 3SEQA 4M9XA 1GDTA 2VOPA 5J40A 3FBIB 2HZDA 4LB6B 1EH8A 4BEHB 1D0ZA 1C0WA 1DPUA 1FMVA 1ZGAA 4D1QA 4BAYA 1K83J 1SD4A 4DYQA 2JPBA 3PJRA 4Q47A 4IPAA 3TL4X 4V19K 2LK2A 1Z67A 2PJPA 2UUZA 4I01A 1I50J 4JYKA 3U21A 3BP8A 2DFFA 1OYYA 5KK1A 1SVMA 3H9QA 2R4GA 3FK6A 5ERIA 3GFMA 4U7BA 3KP5A 4M72A 5FGMA 3HOXJ 3C2GA 4H0EA 1RR8C 4HRIA 3IV5A 3GTLJ 3ONQA 4QSHA 2YR2A 3PQJA 2BBYA 3GBGA 2JA8J 3ASNH 4G7ZF 2FF4A 3OYMA 1XPXA 3M1CA 1LVKA 5HLHA 1BJZA 3FMQA 4M3FA 2CJJA 1YO5C 1MMAA 2PG4A 1SFOJ 1MDMA 3ZMVA 3FM3A 2L9RA 4LIVA 2L7KA 3A0HC 1QNTA 2DMTA 2K9MA 3ABMH 3KE2A 2HXOA 1QVTA 1WJDA 3GFJA 3KYCB 4P1WA 2K3PA 5EJCA 4DZPA 2ZSHB 2M8EA 2ZXWH 4RM2A 3EUAA 4YG2F 2E1MC 3L2UA 3G73A 3BG7A 4CHUA 4BU2A 3OYDA 4XKWA 2ESNA 2DDBA 1OPCA 3GTGJ 2I5UA 2DA5A 4HV5A 5ILUA 1JKPC 1JTXA 3DKWA 5LHIA 2ZCWA 2KIMA 3BTJA 4E70A 3RQ4A 3BY6A 1RETA 1YE9A 2OCCH 2EV5A 2VQGA 4KITB 4A3JJ 5ICCA 1HDPA 2RAEA 3CP2A 3QPTA 1O3RA 1DGRM 2G7UA 4RB1A 2ZXJA 2FBHA 3HBLA 2L7FP 2CGPA 2E7WA 2IS6A 1XSDA 3HKZN 1HW1A 2H8WA 1IO2A 4XOPA 1QQIA 4PSXA 5EG0A 2HOSA 1L0OC 2DQRA 5IP6A 3KIOA 2EZIA 4XN0A 5LEJA 1YJNI 4ENMA 4HEA2 3RQIA 3M4OJ 2XAJA 1V5EA 1R22A 4FE7A 3OYGA 2HEOA 2OD5A 2ZKZA 2CW8A 2ME6A 5F64A 4HW0A 4LOCA 1X3ZB 2X1EA 1WH5A 1LB2A 5HLGA 4HYEA 1X2MA 3V8KA 1GUUA 2A3SA 4C9YA 2LSOA 1WJAA 3GTJJ 1ZQ3P 3HM5A 2QQBA 1IUYA 1SD5A 3H3UA 1EA3A 4DOZA 2JA6J 3DFGA 2EFQA 3RKWA 3CF2A 2COMA 3H5RA 2BY0A 4IOAF 2GBYA 3QAHA 3HRTA 3AL0B 4YELA 2EH3A 4KN4X 1XDSA 5GADJ 3D0SA 3G6EI 2TCTA 3C1DA 5CVVA 1PUEE 2X4HA 2IRFG 3E0JB 3ZN1A 4IHSA 3BZ6A 3OYHA 3QPLA 2K9SA 1LDJA 3LA3A 5D5VB 2Y2ZA 2QLZA 5E17F 3OYLA 1LQ1A 2Y75A 1EH6A 1X1PA 4PJ0C 4ESBA 2LP0A 4A5NA 3CCRI 5E79C 1E2XA 3IRQA 3KYLA 1GXPA 1FOKA 5GAEJ 4PSWA 1I39A 1AHDP 1T39A 4L0YB 2KPMA 4RA2A 2R93J 3REOA 3QYEA 2GLOA 2NS8A 3A2KA 1A36A 3OIOA 1MBGA 3WGGA 2KRHA 3V7SA 2W1OA 3FXOA 1RR7A 3TQNA 2RQPA 3HDDA 3JREA 4BXFA 1QU3A 3MKZA 4RDUA 3S15J 4BXUA 2Q0OA 3RZDJ 1VTNC 3FZVA 4LB5A 5LHGA 1MNMC 1JT0A 5C44J 4I0BA 3TKYA 1FSHA 1MBEA 1MW7A 2KQRA 4KT5C 5J4YA 3E5UA 4AIHA 4I6ZA 5EEAA 1K6OA 4KIFA 1G3WA 1AOYA 3WU2C 2V4JC 3PNVA 2R5ZB 1IGNA 4HG2A 3M7GA 1GV2A 3JRHA 1S7OA 1B1BA 2L4MA 3JTGA 1S7AA 2M3AA 4B09A 1LEAA 2DT5A 2VKDA 4CCNA 1MMNA 5LFAA 5K5OA 1I3AA 3R4KA 2Q8KA 4C3HJ 3U9GA 2E1OA 5KCMA 1WRJA 4DYRA 2ZB9A 3TP0A 4NBQA 1G8XA 5FKKA 2R3SA 3GLLA 3M1EA 2LNBA 4I98B 5GAGJ 4UVBA 1P92A 4PZJA 4OIPF 3K9TA 1JHFA 3VYSB 2VONA 1P4WA 4BQNA 2KMUA 3HG9A 2X6WA 4BUPA 3ULQB 2O9LA 1JGSA 1XDUA 4MQ9F 4WK8F 1Z21A 1X2NA 3CTAA 4ZDPA 3ROUA 2NNYA 4BHPA 1Y39A 5F6FA 3W2VA 3VWBA 4L9TA 2NRAC 2LDUA 1LVAA 4XNFA 3IAS2 4QIWN 2Z33A 2VKEA 5CYVA 3HSEA 5IPAA 2PFBA 1HDDC 2KL4A 1FLIA 3BG5A 3F23A 3P9KA 2LY9A 3GW2A 2IPQX 1HXDA 1ZGWA 3GMEA 2X6YA 1ZRFA 1IRGA 3E97A 3J80Z 2A5WA 2RGVA 4KYWA 1XC5A 1Q1HA 2OZ6A 2XUBA 5M5YJ 2R5YA 5FLMJ 3EDPA 2JRTA 1IRFA 2IGOA 5EZGA 4CICA 4HSTA 3FXMA 1RI7A 4UUSA 1AKHA 2QSGX 2BOLA 2LBFB 4CZZA 1IF1A 4N4OB 1TQPA 1WQ2A 2QZ8A 2CQXA 2M4GA 4RAYA 1QHGA 3QP5A 2EA4A 3PQKA 2L9NA 3FX3A 4CUGA 4E7SA 3DTIA 4BBRJ 3LSMA 2AO9A 2HYGD 1ONVA 5GPCA 2A07F 4PUSA 3JRDA 1MH3A 2FRHA 1IW7F 2RNJA 3DKXA 2F6CA 2ZJ2A 1UAAA 2X1CA 2H09A 3FXJA 3E5QA 5FFXA 2YU9J 1DU0A 4RLFA 1FZPB 1KU2A 4NQWA 1QZZA 4BE2A 3P9CA 4DW6A 1OCPA 3E6DA 5FLXK 2NVYJ 2LYCA 4RGXA 4U7DA 3FXRA 4MFEA 3BG9A 2VT2A 2W82A 3GUDA 4AUXA 2R7TA 5FFZA 4ANJA 1J2XA 3LOCA 2QYOA 2LBFA 1MGTA 3H3ZA 2CQQA 3QQAA 1VQ6I 3OWTA 3J81Z 1FSEA 1R6RA 5DCMB 1BC7C 1T98A 1S8NA 2NXNB 2FSWA 1A6QA
chains in the Genus database with same CATH topology
3JAMZ 3L9FA 4DQ2A 3WTVC 4LLGF 3IKVA 3F72A 1LEBA 2LKPA 3ZMSA 3CO6C 2CO5A 4UV8A 4XBFA 4EV0A 5L3BA 4AVPA 5HS9A 2P7VB 2DTRA 5H6RA 4KICA 2IJLA 3WTWC 5BS6A 3JSPA 4ZYGA 1ZRDA 3L09A 5TRDA 1ZAOA 1DPRA 3SXYA 4XLPF 4UHTA 2V1DA 3WTYC 2NS0A 5CVIA 1R5HA 2CW0F 1R1VA 1J9IA 5L3GA 1UHWA 4KIBA 1Z6RA 1FYMA 3FMRA 3VFZA 1TQMA 2G9WA 4Q4ZF 5CLSA 4IXAA 4G6DA 2XIGA 1R7JA 1SFUA 2DAOA 4Y15A 5ICFA 1SFXA 2RV8A 3K1NA 2V6CA 2K27A 3GX4X 3W6JB 4RGSA 4F7ZA 1XN7A 4KNYA 2XRNA 3F21A 2JTVA 4D0PA 1UFMA 1E17A 3IWFA 4K2EA 1HKTA 5A2QZ 5D5XB 4G8XA 1RZ4A 3GO5A 1BI3A 2JSCA 4U0WA 3F3XA 2Q2EA 5CJ9A 2HWVA 5ILSA 3ZMDA 1Z91A 1LNWA 1EV7A 2P5LC 3FXUA 4Q48A 3VODA 4BNCA 3M9AA 3TDZC 5JVTA 1FC3A 2FXAA 2C6YA 2STWA 3W6KB 3K2ZA 3BOQA 1I27A 1D5VA 5AIPA 3BPXA 3SQNA 3T8RA 3GFIA 5LGNA 4GCVA 1F9NA 3K0LA 3VEPA 4MEYF 1TTYA 2W57A 3FHZA 2L4AA 1YW9A 2E1NA 2HTSA 5JR3A 1D3YA 5LHHA 2Y48A 3IHUA 1J5YA 1IZ1A 3OOPA 1K7AA 4OMZA 2W84A 1SAXA 4EM2A 3HOSA 4ZYDA 5D6EA 1R5GA 2ZMEB 4DNCA 2ADUA 4LK1F 3LAJA 4RS8A 2L01A 1W5SA 3DXJF 4M73A 3V7RA 3RDIA 2DPDA 3I58A 2ACJA 2XAHA 2PI0A 4LLNA 1FYLA 2OQRA 5HDNA 5HDGA 2VE8A 3DF8A 3GYHX 1F1ZA 2Z99A 2KJCA 4LMYA 3BJOA 1U3EM 4AIKA 1U5TA 4LGWA 2H27A 3LAPA 4RB0A 3HSRA 1USTA 1J7KA 1W5TA 1TW2A 2XASA 5H20A 4CO8A 4LG0A 3ZPLA 5E18F 4I0AA 3O3KA 1SD7A 3MWMA 1FBSA 2FBKA 1FBUA 1J0RA 4AIJA 3JAMK 2MH9A 3S2WA 1D8KA 2XKOA 1BC8C 2XGXA 3O2PE 1U5TB 1FY7A 3J81K 2VOOA 2EFPA 5BQTA 1BIAA 1DP7P 2D45A 2GIVA 2KJBA 2IA1A 4P9FA 2YU3A 1R23A 1B9MA 2QM3A 4EMSA 2IA2A 3TOBA 1V3FA 4OIRF 3R60A 1SD6A 2M45A 4ENJA 1CF7A 3I64A 1R58A 2P5KA 4HDUA 4RGRA 4YFNF 1BN5A 3I4PA 4G6QA 4IRGA 1DDNA 3E6CC 1GVJA 4UV9A 4R79A 3N4MA 2B0LA 1FBQA 4KIGA 2VC0A 2VN2A 4GXOA 4MHGA 4O6JA 1MJ9A 3ERED 1F5TA 5IT9Z 5D4SA 4CDGA 3GZ5A 4ASNA 1Z6TA 1ZARA 4OIQF 3MZHA 3L7WA 4KMUX 3WTZA 4WXCA 2DW4A 2YPRA 4HZFA 4TV7A 1QPMA 4P55A 3EYIA 3GVAA 2IW5A 4EGZA 4RB3C 5IT3A 4L5JA 2W85A 4RGUA 4CYDA 3WTTC 1WSUA 4Y17A 1RIOH 5ICGA 4EJTA 2LF7A 4KFCA 1U8RA 2E7XA 3HIFA 4GYGA 5IT9K 5BPIA 2BGCA 3TDUC 3GXOA 1KYZA 4Q5SF 4YIIA 4Y13A 1LJ9A 2FEZA 3RI4A 4HDVA 2GA1A 4IJAA 2GWRA 2V1XA 2K02A 3KP3A 1BJAA 2ZNZA 5JHUA 3JTHA 1W7PA 2XROA 3GWZA 3KLNA 1JHHA 1HW5A 3TGNA 4ON0A 2P7CB 3F8CA 2DK8A 3I59A 4MQVA 2HZTA 2PMHA 5CVRA 3RKYA 4G7HF 2EV6A 2H6CA 5LGTA 4L18B 5HS8A 4ESJA 1WKMA 4A0YA 5DUIA 2EFWA 2MA3A 2VE9A 3C18A 5H6QA 4JQFA 1MD0A 3E3VA 4UUVA 1FYKA 3F8BA 1P6RA 1AWCA 4LJZF 4EJVA 3MAJA 1OKRA 5KVRA 3DP7A 5L3DA 4M9SA 3N97A 1UB9A 3KLOA 5J8CA 2MD5A 4MTDA 1IN4A 1G3YA 1R1TA 1QO0D 2DLLA 1FX7A 2IA0A 1R36A 1JE8A 2F5EA 3F8FA 3T8TA 1BBYA 4OU0A 4L0ZB 2JPCA 1O57A 4ENKA 4UVAA 4BQAA 2YSRA 4JK1X 5DUKA 2STTA 3LSTA 1J75A 4I02A 3ECHA 1BM9A 3IL2A 3MEXA 1IN5A 3E6MA 2K4JA 2AXLA 1G3SA 2K4BA 2XAFA 1NHAA 5BOXA 2XAQA 2MBFA 3O6BB 2DK5A 4IRHA 3OV8A 3CLOA 3B02A 2CSOA 2RKHA 3Q9VA 2VBZA 4EJUA 2K86A 5CVJA 3P9IA 1ZHFA 3LWFA 4HV6A 1ODDA 3QP6A 2UXNA 2RC4A 5HOOA 2P8TA 1KQ9A 2FBIA 5D8LB 4KDPA 4M6YA 2EV0A 3WU1B 4EJWA 4G94A 4HX4A 2P6TA 5DCMA 3HHHA 4AD9A 5J6XA 1HSJA 2AS5F 1YW7A 3LQRA 5EEHA 1ZG1A 3HTSB 2QVOA 4M6XA 1ZN2A 4QWQA 5K5RA 1MJAA 1D8JA 5A2QK 4I09A 3JSOA 4IHTA 1S6LA 3DV8A 1LDKB 3KP2A 3M8EA 4GGGA 2F5CA 4PCQA 1XCVA 1XGMA 5D8KB 3J7AO 4XLNF 1K79A 4MNUA 3KEQA 1G6NA 1YW8A 2XKPA 2P6SA 1HKQA 3ABUA 3CUQB 3DEUA 1IXRC 1H9TA 2KIUA 2DO7A 4PGGA 4JBAA 2HYFA 1IAWA 3BJ6A 3FM5A 2V1UA 4YFXF 1IN8A 2ZNYA 2JZYA 3CUOA 2PMUA 3HRUA 2KKOA 5L3CA 1CGPA 3R0AA 4LD5A 1FP1D 3KP4A 3MCZA 2BYVE 2A6HF 3F8MA 1O3SA 3F6VA 2NNNA 2IVMA 3TO9A 1IXCA 2D1HA 3QOPA 4XSXF 4HX7A 5DEQA 3K1MA 4A5MA 1FT9A 3E5XA 1XGSA 2HKOA 2W24A 3GEZA 1OR7A 3GF2A 3G3ZA 1U2WA 2CWEA 3T0YA 1GHCA 3WTXC 3R6SA 3BROA 1W7PB 1TLHB 3WGIA 2CG4A 2FNPA 2FNAA 3QU3A 1XGOA 4HQMA 1W4MA 1O3QA 4IF4A 3HUGA 2EJRA 4I2OA 3KZZA 4HLXA 4N9IA 3ISPA 2CFXA 1TNTA 2A69F 3V4GA 5BPDA 3VOEA 3NRVA 3EYYA 2HR3A 1FPQA 2L02A 1QGPA 4WX9A 1ZREA 1G3TA 3ECOA 3LQQA 2P4WA 3I54A 3KP7A 2R7FA 4EVIA 1B59A 1T38A 5FLXZ 2OU2A 5FO5A 1H9GA 1I1GA 1BIBA 1BOAA 4ENNA 3RTRA 1OYIA 3ZQ7A 1FP2A 5L3FA 5ICEA 1XSVA 4R1HA 1P4XA 3WTSC 1ON2A 4A6DA 5DYMA 4NB5A 4OMYA 1K78A 2RVCA 2OZUA 2F2EA 4MGRA 3EUHA 5E20A 5AONA 4EM1A 4BHCA 1ZLKA 3PFIA 2L3DA 2BV6A 3ZN0A 3ZMUA 3Q5FA 2BE5F 1MDMB 4S05A 3ABTA 1ZRCA 5FD6A 1PP8F 3RYPA 4BYYA 1ZGJA 5LRSA 1YS6A 2GXBA 4YIFA 4ZYHA 2YX7A 2FOKA 3NEUA 1B9NA 5L3EA 2E1CA 3WGHA 1I5ZA 5E1ZB 2TDXA 4NHJA 4MEXF 2EFNA 1F4KA 4A0ZA 2GAUA 2FQ3A 1HBXG 3B73A 1G4DA 5LBQA 4ZZLA 1TQIA 4P5OA 4HF1A 5FD5A 3HOTA 2PQ8A 2KIFA 4M9ZA 1Z9CA 4YFKF 1KQ8A 1BI0A 1YS7A 2MH2A 2A6EF 2DQLA 4U0VA 1J59A 2BEOA 5CVUA 2G7HA 3GLXA 4IVNA 1MJBA 1P4AA 4WF2A 1YLFA 1YQAA 2QQAA 3DPTA 4WCGA 4PDKA 2OAZA 4OIOF 1XGNA 4EGYA 2V79A 4LLLA 1I6XA 2FU4A 2ZFWA 1R1UA 1XMAA 1T0FA 3P7NA 4IRIA 4WWCA 2GA2A 4XRFA 3GZ6A 3BWGA 3ELKA 2ZO4A 3JW4A 4B8XA 2GZWA 2VT3A 2ZBKA 2IP2A 3KZYA 1UCRA 4S04A 1HW2A 1REPC 3AAFA 4RB2C 3COAC 2WTEA 4ETSA 3Q9SA 2H94A 3HRMA 1Z7UA 5AIQA 3MFKA 3IRRA 1ZYRF 2EB7A 4HA8A 3HHGA 4ZH4F 2W25A 3SHFA 2EK5A 2V9VA 1KYWA 4GO1A 1KQ0A 3LA7A 1ON1A 1PP7U 1JXSA 2DBBA 2X0LA 2VC1A 3TO6A 4I7HA 3BDDA 2M87A 4OINF 4P9UA 5JFRA 4WXDA 3HRSA 1P2FA 4N0BA 3SZTA 1K78B 1SFEA 4KN7X 3HSFA 1WWXA 2LF8A 2DI3A 1IXSB 1EH7A 2Z5UA 1SMTA 3BPVA 3T1BA 2WV0A 1X3UA 3FXQA 2OBPA 3CDHA 4KUMA 2O6GE 1MZBA 3T5XA 1W7PD 5HLIA 5DD8A 3CO7C 3C3WA 5HS7A 3WE3A 2CYYA 1L3LA 1O7LA 2HTJA 1WI9A 3MZYA 3ZP5A 1XMKA 1USSA 2XHKA 1IN7A 3BJAA 1ZLJA 4WXHA 1YTYA 2XVCA 2MLGA 3L2CA 2MLKA 5LEKA 1B4AA 2FMYA 1STZA 2PLYA 3KFWX 5HDKA 2HFHA 3KCCA 3V7CA 5K5QA 1YIOA 2O61A 1KA8A 4HBLA 1KU3A 5ED4A 1U6GA 1TW3A 3K69A 2J5OA 1S3JA 2NAZA 3U2RA 2M1BA 2JT1A 4U88A 2KRFA 1O3TA 3WODF 2A68F 3FF5A 4P96A 2QENA 5E1WA 5HVQC 1RUNA 4CGZA 1KGSA 5LLQA 5LRRA 3D5LA 4FHTA 4R8HA 1ZH5A 3TO7A 1Y0UA 3I0TA 1XB4A 1RUOA 5E1XA 3ZMZA 2FMLA 5FB2A 3E6BA 5BMZA 3HTUA 2O03A 3FMSA 2UWMA 4HF2A 2O3FA 2GXGA 3U1DA 2A61A 5K1YA 2ISYA 2DFIA 2QQ9A 2HOEA 1U5TC 3M8FA 3KEOA 1I1SA 4L9VA 5F1RA 1PDNC 2J5PA 3RYRA 4O3MA 3J80K 1YG2A 5D6FA 2M5WA 1IN6A 2MC3A 4L5IA 4HLYA 5DDGA 1CF7B 3C7JA 4L9JA 3WG9A 2ISZA 2D1VA 4A2UA 3QU6A 3LA2A 2O0YA 2VODA 1FWZA 2UXXA 2DPUA 4UVCA 4AWXB 2HS5A 4BHBA 1V4RA 3ML6A 4PGHA 5D5WB 4MTEA 1ZG5A 5D4RA 3RJPA 2IT0A 2OA4A 1U78A 3I59B 1TNSA 2ETHA 3EQLF 2ZMEA 3I53A 3R61A 3KETA 2D2WA 3WU0A 2QUFA 4RAZA 4HOBA 1ULYA 3TOAA 4M74A 1YFHA 4G7OF 3DPLC 4QLCU 4A12A 2Y0MA 4ESFA 4ZYEA 3K1PA 1T2KA 2Z9OA 5LGUA 1XCBA 3RPUA 3MQ0A 4XSZF 1XD7A 5DV5A 4CXFA 2H6BA 4A0XA 2R7DA 2P5VA 3I71A 4N9HA 1SMYF 4LFUA 1TBXA 3CUQC 1XSXA 1DUXC 1Z1DA 3ZMTA 4FX0A 5ILVA 2L54A 3IWZA 4GYIA 1RNLA 3IKTA 2QBYA 2FA5A 4ZZDA 2M30A 4KMFA 3RPQA 2ELHA 2HDCA 1OMIA 3I5UA 3SZPA 2ESHA 3V8LA 1YYVA 4BH9A 2DU9A 1OYWA 2OQGA 2YX4A 1UHMA 2A5YB 2WWYA 4UNOA 4EM0B 3QRFF 6PAXA 5D5UB 2XV4S 2QBYB 1QZYA 3F6OA 3R0JA 5E8GA 4Z2YA 2F5FA 4OOIA 2GQQA 3DQVC 5DD4A 1H0MA 3F22A 5JI6A 1ZG3A 3WE2A 1Z05A 3SFZA 2VBYA 2HQNA 5TJJA 1HSTA 4UXNA 3L00A 3NQOA 4KA4A 4EQQA 2RN7A 3WTUC 2WC2A 2EFOA 4LG0B 2CQKA 2VBXA 3CJNA 4LK0F 5DCFA 1BI1A 3H92A 2Z3YA 3RKXA 1KU9A 4A6EA 3F8NA 3IC7A 1MKMA 4HX8A 3V8JA 4HF0A 1S29A 3GFLA 1HKSA 3CUQA 3LFKA 4FT8A 3KP6A 1R00A 5EEGA 2PBIA 3HYIA 1O7FA 5E8IA 2HQRA 4HQEA 4L9NA 2PEXA 4EJOA 1FNNA 2O8XA 2HGCA 1QBJA 4U0YA 2RDPA 2VXZA 3EETA 2XAGA 4G9YA 1KU7A 3VB2A 2K7LA 1LDDA 1T6SA 2EA2A 4M71A 4HAMA 2UZKA 1HQCA 2F5DA 3FWEA 2NYXA 5J8FA 2PN6A 4O5VA 1BI2A 2VBWA 2HKXA 1B6AA 2QWWA 1A04A 3RIRA 2FE3A 2EWNA 3QPHA 1GXQA 4M9XA 2VOPA 4LB6B 1EH8A 1C0WA 1DPUA 1ZGAA 4BAYA 1SD4A 2JPBA 4Q47A 4IPAA 2PJPA 4I01A 3BP8A 5KK1A 1OYYA 4U7BA 4FX4A 5ERIA 3GFMA 3KP5A 4M72A 4H0EA 5FGMA 2YR2A 3PQJA 2BBYA 4G7ZF 2FF4A 5HLHA 3FMQA 1YO5C 2PG4A 1MDMA 3ZMVA 3FM3A 1QNTA 3KE2A 3GFJA 2M8EA 4YG2F 3G73A 4CHUA 2ESNA 1OPCA 4HV5A 5ILUA 3DKWA 5LHIA 2ZCWA 2KIMA 4E70A 3BY6A 2EV5A 5ICCA 3QPTA 1O3RA 2G7UA 4RB1A 2ZXJA 2FBHA 2CGPA 2E7WA 1XSDA 1HW1A 1QQIA 1L0OC 2DQRA 5LEJA 4ENMA 2XAJA 1R22A 2HEOA 2OD5A 2ZKZA 5F64A 4HW0A 1LB2A 5HLGA 4HYEA 3V8KA 2A3SA 2LSOA 2QQBA 1IUYA 1SD5A 3H3UA 3DFGA 2EFQA 3RKWA 2COMA 3QAHA 3HRTA 4KN4X 1XDSA 3D0SA 3C1DA 5CVVA 1PUEE 2X4HA 2IRFG 3ZN1A 4IHSA 3BZ6A 3LA3A 1LDJA 5D5VB 2QLZA 5E17F 1LQ1A 2Y75A 1EH6A 4ESBA 4A5NA 1E2XA 3IRQA 1GXPA 1FOKA 1T39A 4L0YB 3REOA 3WGGA 3V7SA 3TQNA 2RQPA 4BXUA 2Q0OA 1VTNC 3FZVA 4LB5A 5LHGA 4I0BA 3TKYA 1FSHA 4KT5C 3E5UA 4AIHA 1K6OA 4KIFA 1G3WA 1AOYA 3M7GA 1S7OA 1B1BA 2L4MA 3JTGA 1S7AA 4B09A 1LEAA 2DT5A 5K5OA 3R4KA 2Q8KA 3U9GA 1WRJA 2R3SA 3M1EA 2LNBA 4I98B 4UVBA 1P92A 4PZJA 4OIPF 3K9TA 1JHFA 2VONA 1P4WA 3ULQB 1JGSA 1XDUA 4MQ9F 4WK8F 3CTAA 3ROUA 2NNYA 4BHPA 5F6FA 4L9TA 2NRAC 2LDUA 1LVAA 2Z33A 5CYVA 3HSEA 2PFBA 1FLIA 3F23A 3P9KA 3GW2A 2IPQX 1HXDA 1ZRFA 1IRGA 3E97A 3J80Z 2RGVA 4KYWA 2OZ6A 1Q1HA 2XUBA 3EDPA 2JRTA 1IRFA 4CICA 1RI7A 4CZZA 1IF1A 1TQPA 1WQ2A 2QZ8A 4RAYA 3QP5A 2EA4A 3PQKA 3FX3A 2HYGD 1ONVA 2A07F 2FRHA 1IW7F 2RNJA 2ZJ2A 5FFXA 2H09A 3E5QA 1FZPB 1KU2A 4NQWA 1QZZA 3P9CA 3E6DA 5FLXK 4RGXA 4U7DA 3FXRA 2VT2A 3GUDA 5FFZA 1J2XA 2QYOA 1MGTA 3H3ZA 3J81Z 1FSEA 5DCMB 1BC7C 1T98A 1S8NA 2FSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM Z;  3L9F A;  4DQ2 A;  3WTV C;  4LLG F;  3IKV A;  3F72 A;  1LEB A;  2LKP A;  3ZMS A;  3CO6 C;  2CO5 A;  4UV8 A;  4XBF A;  4EV0 A;  5L3B A;  4AVP A;  5HS9 A;  2P7V B;  2DTR A;  5H6R A;  4KIC A;  2IJL A;  3WTW C;  5BS6 A;  3JSP A;  4ZYG A;  1ZRD A;  3L09 A;  5TRD A;  1ZAO A;  1DPR A;  3SXY A;  4XLP F;  4UHT A;  2V1D A;  3WTY C;  2NS0 A;  5CVI A;  1R5H A;  2CW0 F;  1R1V A;  1J9I A;  5L3G A;  1UHW A;  4KIB A;  1Z6R A;  1FYM A;  3FMR A;  3VFZ A;  1TQM A;  2G9W A;  4Q4Z F;  5CLS A;  4IXA A;  4G6D A;  2XIG A;  1R7J A;  1SFU A;  2DAO A;  4Y15 A;  5ICF A;  1SFX A;  2RV8 A;  3K1N A;  2V6C A;  2K27 A;  3GX4 X;  3W6J B;  4RGS A;  4F7Z A;  1XN7 A;  4KNY A;  2XRN A;  3F21 A;  2JTV A;  4D0P A;  1UFM A;  1E17 A;  3IWF A;  4K2E A;  1HKT A;  5A2Q Z;  5D5X B;  4G8X A;  1RZ4 A;  3GO5 A;  1BI3 A;  2JSC A;  4U0W A;  3F3X A;  2Q2E A;  5CJ9 A;  2HWV A;  5ILS A;  3ZMD A;  1Z91 A;  1LNW A;  1EV7 A;  2P5L C;  3FXU A;  4Q48 A;  3VOD A;  4BNC A;  3M9A A;  3TDZ C;  5JVT A;  1FC3 A;  2FXA A;  2C6Y A;  2STW A;  3W6K B;  3K2Z A;  3BOQ A;  1I27 A;  1D5V A;  5AIP A;  3BPX A;  3SQN A;  3T8R A;  3GFI A;  5LGN A;  4GCV A;  1F9N A;  3K0L A;  3VEP A;  4MEY F;  1TTY A;  2W57 A;  3FHZ A;  2L4A A;  1YW9 A;  2E1N A;  2HTS A;  5JR3 A;  1D3Y A;  5LHH A;  2Y48 A;  3IHU A;  1J5Y A;  1IZ1 A;  3OOP A;  1K7A A;  4OMZ A;  2W84 A;  1SAX A;  4EM2 A;  3HOS A;  4ZYD A;  5D6E A;  1R5G A;  2ZME B;  4DNC A;  2ADU A;  4LK1 F;  3LAJ A;  4RS8 A;  2L01 A;  1W5S A;  3DXJ F;  4M73 A;  3V7R A;  3RDI A;  2DPD A;  3I58 A;  2ACJ A;  2XAH A;  2PI0 A;  4LLN A;  1FYL A;  2OQR A;  5HDN A;  5HDG A;  2VE8 A;  3DF8 A;  3GYH X;  1F1Z A;  2Z99 A;  2KJC A;  4LMY A;  3BJO A;  1U3E M;  4AIK A;  1U5T A;  4LGW A;  2H27 A;  3LAP A;  4RB0 A;  3HSR A;  1UST A;  1J7K A;  1W5T A;  1TW2 A;  2XAS A;  5H20 A;  4CO8 A;  4LG0 A;  3ZPL A;  5E18 F;  4I0A A;  3O3K A;  1SD7 A;  3MWM A;  1FBS A;  2FBK A;  1FBU A;  1J0R A;  4AIJ A;  3JAM K;  2MH9 A;  3S2W A;  1D8K A;  2XKO A;  1BC8 C;  2XGX A;  3O2P E;  1U5T B;  1FY7 A;  3J81 K;  2VOO A;  2EFP A;  5BQT A;  1BIA A;  1DP7 P;  2D45 A;  2GIV A;  2KJB A;  2IA1 A;  4P9F A;  2YU3 A;  1R23 A;  1B9M A;  2QM3 A;  4EMS A;  2IA2 A;  3TOB A;  1V3F A;  4OIR F;  3R60 A;  1SD6 A;  2M45 A;  4ENJ A;  1CF7 A;  3I64 A;  1R58 A;  2P5K A;  4HDU A;  4RGR A;  4YFN F;  1BN5 A;  3I4P A;  4G6Q A;  4IRG A;  1DDN A;  3E6C C;  1GVJ A;  4UV9 A;  4R79 A;  3N4M A;  2B0L A;  1FBQ A;  4KIG A;  2VC0 A;  2VN2 A;  4GXO A;  4MHG A;  4O6J A;  1MJ9 A;  3ERE D;  1F5T A;  5IT9 Z;  5D4S A;  4CDG A;  3GZ5 A;  4ASN A;  1Z6T A;  1ZAR A;  4OIQ F;  3MZH A;  3L7W A;  4KMU X;  3WTZ A;  4WXC A;  2DW4 A;  2YPR A;  4HZF A;  4TV7 A;  1QPM A;  4P55 A;  3EYI A;  3GVA A;  2IW5 A;  4EGZ A;  4RB3 C;  5IT3 A;  4L5J A;  2W85 A;  4RGU A;  4CYD A;  3WTT C;  1WSU A;  4Y17 A;  1RIO H;  5ICG A;  4EJT A;  2LF7 A;  4KFC A;  1U8R A;  2E7X A;  3HIF A;  4GYG A;  5IT9 K;  5BPI A;  2BGC A;  3TDU C;  3GXO A;  1KYZ A;  4Q5S F;  4YII A;  4Y13 A;  1LJ9 A;  2FEZ A;  3RI4 A;  4HDV A;  2GA1 A;  4IJA A;  2GWR A;  2V1X A;  2K02 A;  3KP3 A;  1BJA A;  2ZNZ A;  5JHU A;  3JTH A;  1W7P A;  2XRO A;  3GWZ A;  3KLN A;  1JHH A;  1HW5 A;  3TGN A;  4ON0 A;  2P7C B;  3F8C A;  2DK8 A;  3I59 A;  4MQV A;  2HZT A;  2PMH A;  5CVR A;  3RKY A;  4G7H F;  2EV6 A;  2H6C A;  5LGT A;  4L18 B;  5HS8 A;  4ESJ A;  1WKM A;  4A0Y A;  5DUI A;  2EFW A;  2MA3 A;  2VE9 A;  3C18 A;  5H6Q A;  4JQF A;  1MD0 A;  3E3V A;  4UUV A;  1FYK A;  3F8B A;  1P6R A;  1AWC A;  4LJZ F;  4EJV A;  3MAJ A;  1OKR A;  5KVR A;  3DP7 A;  5L3D A;  4M9S A;  3N97 A;  1UB9 A;  3KLO A;  5J8C A;  2MD5 A;  4MTD A;  1IN4 A;  1G3Y A;  1R1T A;  1QO0 D;  2DLL A;  1FX7 A;  2IA0 A;  1R36 A;  1JE8 A;  2F5E A;  3F8F A;  3T8T A;  1BBY A;  4OU0 A;  4L0Z B;  2JPC A;  1O57 A;  4ENK A;  4UVA A;  4BQA A;  2YSR A;  4JK1 X;  5DUK A;  2STT A;  3LST A;  1J75 A;  4I02 A;  3ECH A;  1BM9 A;  3IL2 A;  3MEX A;  1IN5 A;  3E6M A;  2K4J A;  2AXL A;  1G3S A;  2K4B A;  2XAF A;  1NHA A;  5BOX A;  2XAQ A;  2MBF A;  3O6B B;  2DK5 A;  4IRH A;  3OV8 A;  3CLO A;  3B02 A;  2CSO A;  2RKH A;  3Q9V A;  2VBZ A;  4EJU A;  2K86 A;  5CVJ A;  3P9I A;  1ZHF A;  3LWF A;  4HV6 A;  1ODD A;  3QP6 A;  2UXN A;  2RC4 A;  5HOO A;  2P8T A;  1KQ9 A;  2FBI A;  5D8L B;  4KDP A;  4M6Y A;  2EV0 A;  3WU1 B;  4EJW A;  4G94 A;  4HX4 A;  2P6T A;  5DCM A;  3HHH A;  4AD9 A;  5J6X A;  1HSJ A;  2AS5 F;  1YW7 A;  3LQR A;  5EEH A;  1ZG1 A;  3HTS B;  2QVO A;  4M6X A;  1ZN2 A;  4QWQ A;  5K5R A;  1MJA A;  1D8J A;  5A2Q K;  4I09 A;  3JSO A;  4IHT A;  1S6L A;  3DV8 A;  1LDK B;  3KP2 A;  3M8E A;  4GGG A;  2F5C A;  4PCQ A;  1XCV A;  1XGM A;  5D8K B;  3J7A O;  4XLN F;  1K79 A;  4MNU A;  3KEQ A;  1G6N A;  1YW8 A;  2XKP A;  2P6S A;  1HKQ A;  3ABU A;  3CUQ B;  3DEU A;  1IXR C;  1H9T A;  2KIU A;  2DO7 A;  4PGG A;  4JBA A;  2HYF A;  1IAW A;  3BJ6 A;  3FM5 A;  2V1U A;  4YFX F;  1IN8 A;  2ZNY A;  2JZY A;  3CUO A;  2PMU A;  3HRU A;  2KKO A;  5L3C A;  1CGP A;  3R0A A;  4LD5 A;  1FP1 D;  3KP4 A;  3MCZ A;  2BYV E;  2A6H F;  3F8M A;  1O3S A;  3F6V A;  2NNN A;  2IVM A;  3TO9 A;  1IXC A;  2D1H A;  3QOP A;  4XSX F;  4HX7 A;  5DEQ A;  3K1M A;  4A5M A;  1FT9 A;  3E5X A;  1XGS A;  2HKO A;  2W24 A;  3GEZ A;  1OR7 A;  3GF2 A;  3G3Z A;  1U2W A;  2CWE A;  3T0Y A;  1GHC A;  3WTX C;  3R6S A;  3BRO A;  1W7P B;  1TLH B;  3WGI A;  2CG4 A;  2FNP A;  2FNA A;  3QU3 A;  1XGO A;  4HQM A;  1W4M A;  1O3Q A;  4IF4 A;  3HUG A;  2EJR A;  4I2O A;  3KZZ A;  4HLX A;  4N9I A;  3ISP A;  2CFX A;  1TNT A;  2A69 F;  3V4G A;  5BPD A;  3VOE A;  3NRV A;  3EYY A;  2HR3 A;  1FPQ A;  2L02 A;  1QGP A;  4WX9 A;  1ZRE A;  1G3T A;  3ECO A;  3LQQ A;  2P4W A;  3I54 A;  3KP7 A;  2R7F A;  4EVI A;  1B59 A;  1T38 A;  5FLX Z;  2OU2 A;  5FO5 A;  1H9G A;  1I1G A;  1BIB A;  1BOA A;  4ENN A;  3RTR A;  1OYI A;  3ZQ7 A;  1FP2 A;  5L3F A;  5ICE A;  1XSV A;  4R1H A;  1P4X A;  3WTS C;  1ON2 A;  4A6D A;  5DYM A;  4NB5 A;  4OMY A;  1K78 A;  2RVC A;  2OZU A;  2F2E A;  4MGR A;  3EUH A;  5E20 A;  5AON A;  4EM1 A;  4BHC A;  1ZLK A;  3PFI A;  2L3D A;  2BV6 A;  3ZN0 A;  3ZMU A;  3Q5F A;  2BE5 F;  1MDM B;  4S05 A;  3ABT A;  1ZRC A;  5FD6 A;  1PP8 F;  3RYP A;  4BYY A;  1ZGJ A;  5LRS A;  1YS6 A;  2GXB A;  4YIF A;  4ZYH A;  2YX7 A;  2FOK A;  3NEU A;  1B9N A;  5L3E A;  2E1C A;  3WGH A;  1I5Z A;  5E1Z B;  2TDX A;  4NHJ A;  4MEX F;  2EFN A;  1F4K A;  4A0Z A;  2GAU A;  2FQ3 A;  1HBX G;  3B73 A;  1G4D A;  5LBQ A;  4ZZL A;  1TQI A;  4P5O A;  4HF1 A;  5FD5 A;  3HOT A;  2PQ8 A;  2KIF A;  4M9Z A;  1Z9C A;  4YFK F;  1KQ8 A;  1BI0 A;  1YS7 A;  2MH2 A;  2A6E F;  2DQL A;  4U0V A;  1J59 A;  2BEO A;  5CVU A;  2G7H A;  3GLX A;  4IVN A;  1MJB A;  1P4A A;  4WF2 A;  1YLF A;  1YQA A;  2QQA A;  3DPT A;  4WCG A;  4PDK A;  2OAZ A;  4OIO F;  1XGN A;  4EGY A;  2V79 A;  4LLL A;  1I6X A;  2FU4 A;  2ZFW A;  1R1U A;  1XMA A;  1T0F A;  3P7N A;  4IRI A;  4WWC A;  2GA2 A;  4XRF A;  3GZ6 A;  3BWG A;  3ELK A;  2ZO4 A;  3JW4 A;  4B8X A;  2GZW A;  2VT3 A;  2ZBK A;  2IP2 A;  3KZY A;  1UCR A;  4S04 A;  1HW2 A;  1REP C;  3AAF A;  4RB2 C;  3COA C;  2WTE A;  4ETS A;  3Q9S A;  2H94 A;  3HRM A;  1Z7U A;  5AIQ A;  3MFK A;  3IRR A;  1ZYR F;  2EB7 A;  4HA8 A;  3HHG A;  4ZH4 F;  2W25 A;  3SHF A;  2EK5 A;  2V9V A;  1KYW A;  4GO1 A;  1KQ0 A;  3LA7 A;  1ON1 A;  1PP7 U;  1JXS A;  2DBB A;  2X0L A;  2VC1 A;  3TO6 A;  4I7H A;  3BDD A;  2M87 A;  4OIN F;  4P9U A;  5JFR A;  4WXD A;  3HRS A;  1P2F A;  4N0B A;  3SZT A;  1K78 B;  1SFE A;  4KN7 X;  3HSF A;  1WWX A;  2LF8 A;  2DI3 A;  1IXS B;  1EH7 A;  2Z5U A;  1SMT A;  3BPV A;  3T1B A;  2WV0 A;  1X3U A;  3FXQ A;  2OBP A;  3CDH A;  4KUM A;  2O6G E;  1MZB A;  3T5X A;  1W7P D;  5HLI A;  5DD8 A;  3CO7 C;  3C3W A;  5HS7 A;  3WE3 A;  2CYY A;  1L3L A;  1O7L A;  2HTJ A;  1WI9 A;  3MZY A;  3ZP5 A;  1XMK A;  1USS A;  2XHK A;  1IN7 A;  3BJA A;  1ZLJ A;  4WXH A;  1YTY A;  2XVC A;  2MLG A;  3L2C A;  2MLK A;  5LEK A;  1B4A A;  2FMY A;  1STZ A;  2PLY A;  3KFW X;  5HDK A;  2HFH A;  3KCC A;  3V7C A;  5K5Q A;  1YIO A;  2O61 A;  1KA8 A;  4HBL A;  1KU3 A;  5ED4 A;  1U6G A;  1TW3 A;  3K69 A;  2J5O A;  1S3J A;  2NAZ A;  3U2R A;  2M1B A;  2JT1 A;  4U88 A;  2KRF A;  1O3T A;  3WOD F;  2A68 F;  3FF5 A;  4P96 A;  2QEN A;  5E1W A;  5HVQ C;  1RUN A;  4CGZ A;  1KGS A;  5LLQ A;  5LRR A;  3D5L A;  4FHT A;  4R8H A;  1ZH5 A;  3TO7 A;  1Y0U A;  3I0T A;  1XB4 A;  1RUO A;  5E1X A;  3ZMZ A;  2FML A;  5FB2 A;  3E6B A;  5BMZ A;  3HTU A;  2O03 A;  3FMS A;  2UWM A;  4HF2 A;  2O3F A;  2GXG A;  3U1D A;  2A61 A;  5K1Y A;  2ISY A;  2DFI A;  2QQ9 A;  2HOE A;  1U5T C;  3M8F A;  3KEO A;  1I1S A;  4L9V A;  5F1R A;  1PDN C;  2J5P A;  3RYR A;  4O3M A;  3J80 K;  1YG2 A;  5D6F A;  2M5W A;  1IN6 A;  2MC3 A;  4L5I A;  4HLY A;  5DDG A;  1CF7 B;  3C7J A;  4L9J A;  3WG9 A;  2ISZ A;  2D1V A;  4A2U A;  3QU6 A;  3LA2 A;  2O0Y A;  2VOD A;  1FWZ A;  2UXX A;  2DPU A;  4UVC A;  4AWX B;  2HS5 A;  4BHB A;  1V4R A;  3ML6 A;  4PGH A;  5D5W B;  4MTE A;  1ZG5 A;  5D4R A;  3RJP A;  2IT0 A;  2OA4 A;  1U78 A;  3I59 B;  1TNS A;  2ETH A;  3EQL F;  2ZME A;  3I53 A;  3R61 A;  3KET A;  2D2W A;  3WU0 A;  2QUF A;  4RAZ A;  4HOB A;  1ULY A;  3TOA A;  4M74 A;  1YFH A;  4G7O F;  3DPL C;  4QLC U;  4A12 A;  2Y0M A;  4ESF A;  4ZYE A;  3K1P A;  1T2K A;  2Z9O A;  5LGU A;  1XCB A;  3RPU A;  3MQ0 A;  4XSZ F;  1XD7 A;  5DV5 A;  4CXF A;  2H6B A;  4A0X A;  2R7D A;  2P5V A;  3I71 A;  4N9H A;  1SMY F;  4LFU A;  1TBX A;  3CUQ C;  1XSX A;  1DUX C;  1Z1D A;  3ZMT A;  4FX0 A;  5ILV A;  2L54 A;  3IWZ A;  4GYI A;  1RNL A;  3IKT A;  2QBY A;  2FA5 A;  4ZZD A;  2M30 A;  4KMF A;  3RPQ A;  2ELH A;  2HDC A;  1OMI A;  3I5U A;  3SZP A;  2ESH A;  3V8L A;  1YYV A;  4BH9 A;  2DU9 A;  1OYW A;  2OQG A;  2YX4 A;  1UHM A;  2A5Y B;  2WWY A;  4UNO A;  4EM0 B;  3QRF F;  6PAX A;  5D5U B;  2XV4 S;  2QBY B;  1QZY A;  3F6O A;  3R0J A;  5E8G A;  4Z2Y A;  2F5F A;  4OOI A;  2GQQ A;  3DQV C;  5DD4 A;  1H0M A;  3F22 A;  5JI6 A;  1ZG3 A;  3WE2 A;  1Z05 A;  3SFZ A;  2VBY A;  2HQN A;  5TJJ A;  1HST A;  4UXN A;  3L00 A;  3NQO A;  4KA4 A;  4EQQ A;  2RN7 A;  3WTU C;  2WC2 A;  2EFO A;  4LG0 B;  2CQK A;  2VBX A;  3CJN A;  4LK0 F;  5DCF A;  1BI1 A;  3H92 A;  2Z3Y A;  3RKX A;  1KU9 A;  4A6E A;  3F8N A;  3IC7 A;  1MKM A;  4HX8 A;  3V8J A;  4HF0 A;  1S29 A;  3GFL A;  1HKS A;  3CUQ A;  3LFK A;  4FT8 A;  3KP6 A;  1R00 A;  5EEG A;  2PBI A;  3HYI A;  1O7F A;  5E8I A;  2HQR A;  4HQE A;  4L9N A;  2PEX A;  4EJO A;  1FNN A;  2O8X A;  2HGC A;  1QBJ A;  4U0Y A;  2RDP A;  2VXZ A;  3EET A;  2XAG A;  4G9Y A;  1KU7 A;  3VB2 A;  2K7L A;  1LDD A;  1T6S A;  2EA2 A;  4M71 A;  4HAM A;  2UZK A;  1HQC A;  2F5D A;  3FWE A;  2NYX A;  5J8F A;  2PN6 A;  4O5V A;  1BI2 A;  2VBW A;  2HKX A;  1B6A A;  2QWW A;  1A04 A;  3RIR A;  2FE3 A;  2EWN A;  3QPH A;  1GXQ A;  4M9X A;  2VOP A;  4LB6 B;  1EH8 A;  1C0W A;  1DPU A;  1ZGA A;  4BAY A;  1SD4 A;  2JPB A;  4Q47 A;  4IPA A;  2PJP A;  4I01 A;  3BP8 A;  5KK1 A;  1OYY A;  4U7B A;  4FX4 A;  5ERI A;  3GFM A;  3KP5 A;  4M72 A;  4H0E A;  5FGM A;  2YR2 A;  3PQJ A;  2BBY A;  4G7Z F;  2FF4 A;  5HLH A;  3FMQ A;  1YO5 C;  2PG4 A;  1MDM A;  3ZMV A;  3FM3 A;  1QNT A;  3KE2 A;  3GFJ A;  2M8E A;  4YG2 F;  3G73 A;  4CHU A;  2ESN A;  1OPC A;  4HV5 A;  5ILU A;  3DKW A;  5LHI A;  2ZCW A;  2KIM A;  4E70 A;  3BY6 A;  2EV5 A;  5ICC A;  3QPT A;  1O3R A;  2G7U A;  4RB1 A;  2ZXJ A;  2FBH A;  2CGP A;  2E7W A;  1XSD A;  1HW1 A;  1QQI A;  1L0O C;  2DQR A;  5LEJ A;  4ENM A;  2XAJ A;  1R22 A;  2HEO A;  2OD5 A;  2ZKZ A;  5F64 A;  4HW0 A;  1LB2 A;  5HLG A;  4HYE A;  3V8K A;  2A3S A;  2LSO A;  2QQB A;  1IUY A;  1SD5 A;  3H3U A;  3DFG A;  2EFQ A;  3RKW A;  2COM A;  3QAH A;  3HRT A;  4KN4 X;  1XDS A;  3D0S A;  3C1D A;  5CVV A;  1PUE E;  2X4H A;  2IRF G;  3ZN1 A;  4IHS A;  3BZ6 A;  3LA3 A;  1LDJ A;  5D5V B;  2QLZ A;  5E17 F;  1LQ1 A;  2Y75 A;  1EH6 A;  4ESB A;  4A5N A;  1E2X A;  3IRQ A;  1GXP A;  1FOK A;  1T39 A;  4L0Y B;  3REO A;  3WGG A;  3V7S A;  3TQN A;  2RQP A;  4BXU A;  2Q0O A;  1VTN C;  3FZV A;  4LB5 A;  5LHG A;  4I0B A;  3TKY A;  1FSH A;  4KT5 C;  3E5U A;  4AIH A;  1K6O A;  4KIF A;  1G3W A;  1AOY A;  3M7G A;  1S7O A;  1B1B A;  2L4M A;  3JTG A;  1S7A A;  4B09 A;  1LEA A;  2DT5 A;  5K5O A;  3R4K A;  2Q8K A;  3U9G A;  1WRJ A;  2R3S A;  3M1E A;  2LNB A;  4I98 B;  4UVB A;  1P92 A;  4PZJ A;  4OIP F;  3K9T A;  1JHF A;  2VON A;  1P4W A;  3ULQ B;  1JGS A;  1XDU A;  4MQ9 F;  4WK8 F;  3CTA A;  3ROU A;  2NNY A;  4BHP A;  5F6F A;  4L9T A;  2NRA C;  2LDU A;  1LVA A;  2Z33 A;  5CYV A;  3HSE A;  2PFB A;  1FLI A;  3F23 A;  3P9K A;  3GW2 A;  2IPQ X;  1HXD A;  1ZRF A;  1IRG A;  3E97 A;  3J80 Z;  2RGV A;  4KYW A;  2OZ6 A;  1Q1H A;  2XUB A;  3EDP A;  2JRT A;  1IRF A;  4CIC A;  1RI7 A;  4CZZ A;  1IF1 A;  1TQP A;  1WQ2 A;  2QZ8 A;  4RAY A;  3QP5 A;  2EA4 A;  3PQK A;  3FX3 A;  2HYG D;  1ONV A;  2A07 F;  2FRH A;  1IW7 F;  2RNJ A;  2ZJ2 A;  5FFX A;  2H09 A;  3E5Q A;  1FZP B;  1KU2 A;  4NQW A;  1QZZ A;  3P9C A;  3E6D A;  5FLX K;  4RGX A;  4U7D A;  3FXR A;  2VT2 A;  3GUD A;  5FFZ A;  1J2X A;  2QYO A;  1MGT A;  3H3Z A;  3J81 Z;  1FSE A;  5DCM B;  1BC7 C;  1T98 A;  1S8N A;  2FSW A; 
#chains in the Genus database with same CATH topology
 3HKZ A;  3JAM Z;  3L9F A;  1RC9 A;  4DQ2 A;  2CQN A;  2UV1 A;  2W48 A;  2OTL I;  2EIL H;  2OF7 A;  3WTV C;  4LLG F;  3DTK A;  3DKY A;  3ZQC A;  3IKV A;  1U9N A;  2AHQ A;  3F72 A;  1LEB A;  4A69 C;  2LKP A;  4PK4 A;  2E5Z A;  2EIN H;  4BGD A;  3ZMS A;  2EQR A;  1D1B A;  2JN6 A;  4NQW B;  3CO6 C;  2ECB A;  2CO5 A;  4XOR A;  4ABZ A;  3K70 C;  1X4O A;  2OV7 A;  3QOD A;  4IHX A;  1K4T A;  4UV8 A;  3BQZ A;  4RAF A;  1JT6 A;  4XBF A;  2YS9 A;  2X9D A;  4EV0 A;  1ORK A;  2QCO A;  5L3B A;  1D5Y A;  4Z6Y A;  2WA0 A;  3M8J A;  2M7B A;  5F1J A;  4PFP A;  3DBL B;  2ICW G;  2JWT A;  2QKM B;  4AVP A;  1MND A;  5HS9 A;  3HPH A;  2P7V B;  5IYC J;  2DTR A;  5H6R A;  1Y0N A;  2IJL A;  1Y6I A;  4KIC A;  2X51 A;  5BS6 A;  3WTW C;  3JSP A;  3BR2 A;  4ZYG A;  3L09 A;  5TRD A;  1ZRD A;  1ZAO A;  1DPR A;  3SXY A;  4MO7 A;  1TWH J;  3H35 A;  2E5N A;  1FOX A;  4XLP F;  4UHT A;  2V1D A;  3WTY C;  2DXI A;  2NS0 A;  4C2U A;  2R7X A;  5CVI A;  1R5H A;  2CW0 F;  1R1V A;  2HYJ A;  4B47 A;  2E2J J;  3QPS A;  5M3M J;  5K7Z A;  1J9I A;  5L3G A;  4BBS J;  1UHW A;  1B8I A;  2AXT C;  3HOY J;  4KIB A;  1UEL B;  2VJI A;  2YUS A;  1MBK A;  1SFK A;  1Z6R A;  1FYM A;  3FMR A;  3VFZ A;  3LSK A;  4IHV A;  1TQM A;  3F0C A;  2G9W A;  2K9L A;  2IGM A;  3K4N A;  5K7F A;  4Q4Z F;  2R7Q A;  4IL6 C;  5CLS A;  2FUG 2;  2CUE A;  3AG2 H;  2WY8 Q;  4E7I A;  4CSW A;  4IXA A;  4G6D A;  2XIG A;  1R7J A;  2BY2 A;  1SFU A;  2DAO A;  4Y15 A;  1T08 B;  5ICF A;  1SFX A;  2XF6 A;  1SAU A;  2RV8 A;  2R92 J;  3K1N A;  4XMY A;  1UHS A;  2V6C A;  5B66 C;  2K27 A;  3GX4 X;  3PM1 A;  2XGC A;  3W6J B;  3TW6 A;  4RGS A;  4S0H B;  4F7Z A;  1XN7 A;  4KNY A;  2DA7 A;  2DOF A;  2N8G A;  2NVQ J;  2XRN A;  1ACI A;  3ABL H;  2K9Q A;  3F21 A;  5J4V A;  3A01 B;  2JTV A;  4A3C J;  4D0P A;  1UFM A;  2HVS A;  2VKH A;  1E17 A;  3IWF A;  4K2E A;  4A3B J;  1YJ9 I;  1HKT A;  1VQ4 I;  3LMM A;  5D5X B;  5A2Q Z;  1V55 H;  4G8X A;  4CYC B;  3S17 J;  1RZ4 A;  1OIS A;  2RRE A;  2QKL B;  3GO5 A;  4J19 A;  5M5X J;  2EIJ H;  1BA5 A;  4C30 A;  1BI3 A;  2ELJ A;  2JSC A;  4RM3 A;  3BTL A;  3FKI J;  4U0W A;  3F3X A;  2Q2E A;  5CJ9 A;  1P9Q C;  2HWV A;  1V5F A;  5ILS A;  3ZMD A;  2CV2 A;  1Z91 A;  2CRG A;  1Z77 A;  1LNW A;  3H9G A;  1EV7 A;  2P5L C;  3FXU A;  4Q48 A;  2BY3 A;  3VOD A;  4BNC A;  2DYS H;  3M9A A;  3DTE A;  4G6T B;  3TDZ C;  2XB0 X;  1FC3 A;  2VI6 A;  5JVT A;  3SDG A;  2FXA A;  4L5E A;  4FQG A;  1Z3Y A;  2C6Y A;  2STW A;  3W6K B;  3K2Z A;  3BOQ A;  1I27 A;  1D5V A;  5AIP A;  3BPX A;  3SQN A;  2KRC A;  3T8R A;  3E1S A;  3EPZ A;  3GFI A;  5LGN A;  4BL0 B;  2EPF A;  4GCV A;  4HSR A;  3MMY B;  1ETY A;  3J7A Y;  1F9N A;  3K0L A;  4BE0 A;  3VEP A;  1NG7 A;  4MEY F;  2XRL A;  1TTY A;  2W57 A;  3FHZ A;  2L4A A;  3RKQ A;  2WV1 A;  4UY8 I;  2M2E A;  1YW9 A;  2EZH A;  2DCE A;  2E1N A;  3TBI A;  2HTS A;  5JR3 A;  1D3Y A;  5LHH A;  2Y48 A;  3IHU A;  1J5Y A;  1IZ1 A;  3OOP A;  2ZXI A;  3L2Q A;  1K7A A;  4GFB A;  1WPK A;  4OMZ A;  4FIS A;  2W84 A;  1SAX A;  3I4M J;  2EIM H;  5E3O A;  4EM2 A;  1ZR2 A;  3HOS A;  4C2T A;  4ZYD A;  5D6E A;  3AFH A;  5EDN A;  1MMS A;  1R5G A;  2ZME B;  2ADU A;  4LK1 F;  5F08 A;  4DNC A;  3LAJ A;  1Z0X A;  4RS8 A;  2QF7 A;  3M3Y J;  2KIS A;  2B9S A;  2L01 A;  1UG0 A;  3W3C A;  3OS2 A;  2GIZ A;  1W5S A;  3PFY A;  3CCU I;  3DXJ F;  1X1A A;  2Y9Y A;  2DOD A;  3OSG A;  1T56 A;  4M73 A;  3V7R A;  3RDI A;  1HCR A;  1GV5 A;  2DPD A;  3LSP A;  3I58 A;  2ACJ A;  4F91 B;  1S7E A;  2XAH A;  2PI0 A;  4Y3O A;  5DS9 A;  4LLN A;  1FYL A;  2OQR A;  1QHH D;  1PYV A;  3SFI A;  5HDN A;  5HDG A;  2LFB A;  1ZKG A;  2VE8 A;  2QSH X;  5C4X J;  5JLW A;  3DF8 A;  3VYT B;  3GYH X;  1F1Z A;  2Z99 A;  2KJC A;  3G4S I;  3B6A A;  4LMY A;  4B4C A;  4XL9 A;  3DWL E;  3BJO A;  4UUS B;  2FOW A;  3ASO H;  1U3E M;  1LFP A;  1ERD A;  4AIK A;  4XKB A;  1U5T A;  3OMY A;  1XTA A;  4LGW A;  2H27 A;  3LAP A;  1MBH A;  4RB0 A;  3HSR A;  2MFZ A;  4PJM A;  1UST A;  2BHY A;  2DA1 A;  1J7K A;  1AA7 A;  1W5T A;  3CC7 I;  1TW2 A;  2XAS A;  3OL4 A;  5H20 A;  3D5R C;  4JX6 A;  4CO8 A;  4AID A;  4LG0 A;  3BQY A;  1QA6 A;  3ZPL A;  3OS1 A;  1X19 A;  3JR9 A;  4CCO A;  4DYC A;  2KHM A;  3DEE A;  1WJ5 A;  4I0A A;  5E18 F;  3NAR A;  4C3J J;  1IDZ A;  3O3K A;  1EJ9 A;  2XF7 A;  1SD7 A;  3MWM A;  3OR2 C;  3HGY A;  1FBS A;  1IRZ A;  2FBK A;  1FBU A;  1DGW Y;  3UR3 C;  1J0R A;  4AIJ A;  2JVH A;  2LVS A;  3H5N A;  2MH9 A;  3S2W A;  3JAM K;  1YHQ I;  1D8K A;  2XKO A;  4XRS A;  2XGX A;  2L5Q A;  1BC8 C;  2ZME C;  3O2P E;  1U5T B;  3DBH B;  1FY7 A;  2B63 J;  2M4K A;  3ZQH A;  1ZR4 A;  4UUT A;  3J81 K;  2JSP A;  2VOO A;  2EFP A;  5BQT A;  1YX3 A;  4AYB N;  1BIA A;  3HJE A;  1T33 A;  3ESW B;  3QWL A;  4NC7 A;  1DP7 P;  2D45 A;  2GIV A;  3KPH A;  2KJB A;  3BZK A;  3TED A;  2IA1 A;  4P9F A;  2YU3 A;  1R23 A;  3OY9 A;  1MSF C;  2HOT A;  1B9M A;  4XR6 A;  2QM3 A;  4EMS A;  1WJC A;  2ZJP F;  1D1C A;  2ECC A;  1TZL A;  2DMU A;  2IA2 A;  2JK3 A;  3TOB A;  1V3F A;  4XLA A;  4OIR F;  5HNF A;  3R60 A;  1SD6 A;  2M45 A;  4ENJ A;  5KNL A;  1CF7 A;  2WB1 A;  2HVQ A;  3I64 A;  3S1M J;  1R58 A;  2P5K A;  1V54 H;  4HDU A;  3BR6 A;  4RGR A;  4B3X A;  4YFN F;  1BN5 A;  3E7L A;  2LOO A;  3OSF A;  3CJT B;  5J1R A;  4IKF A;  3I4P A;  4N4N B;  2KIQ A;  2ZSI B;  4G6Q A;  3PSF A;  2WAD A;  4IRG A;  1DDN A;  3E6C C;  3AKZ A;  1APL C;  1A31 A;  2R7U A;  1GVJ A;  4UV9 A;  4R79 A;  1N77 A;  2BW3 A;  3N4M A;  2B0L A;  2GM4 A;  1FBQ A;  4KIG A;  4B1R A;  2VC0 A;  2CH0 A;  3WHC A;  1TT5 B;  2VN2 A;  3JCU C;  4U87 A;  4GXO A;  2ZJQ F;  4MHG A;  1HC8 A;  3FKJ A;  4O6J A;  1MJ9 A;  3ERE D;  1F5T A;  5IT9 Z;  5D4S A;  3I4N J;  2Z16 A;  2KLO A;  1S72 I;  3CMA I;  2CUZ A;  2KZG A;  4CDG A;  4QPQ A;  2V6E A;  3GZ5 A;  4ASN A;  2CMP A;  1LE8 B;  1BR4 A;  1OJL A;  4A3M J;  1Z6T A;  3BC8 A;  1RKT A;  2MW8 A;  2E71 A;  2VPR A;  4FAS D;  2XGE A;  1ZAR A;  4UB6 C;  4OIQ F;  1MIJ A;  1DU6 A;  3MZH A;  1FTZ A;  3L7W A;  2GOX B;  1FIP A;  2IGN A;  4KMU X;  4WXC A;  3WTZ A;  2DW4 A;  2YPR A;  4HZF A;  4TV7 A;  3VSL A;  1HLV A;  3S2H J;  1QPM A;  4P55 A;  4BQQ A;  3CDI A;  3I56 I;  3GVA A;  2IW5 A;  4EGZ A;  3EYI A;  4XLE A;  4CA0 A;  2KT0 A;  3ZOB A;  3PSI A;  4RB3 C;  1VQ8 I;  5IT3 A;  4L5J A;  2W85 A;  4OWR B;  4RGU A;  4CYD A;  3WTT C;  1WSU A;  4Y17 A;  1RIO H;  5ICG A;  4EJT A;  4B48 A;  2LF7 A;  4KFC A;  3K4J A;  1U8R A;  1HF0 A;  2E7X A;  5F0H A;  3S8P A;  1ZK8 A;  3HIF A;  3GTQ J;  4GYG A;  5IT9 K;  3OYB A;  4E4H A;  5BPI A;  2H8R A;  2BGC A;  3TDU C;  3GXO A;  1KYZ A;  3IH2 A;  3K4C A;  1R4M B;  4Q5S F;  3ZQQ A;  4CYC A;  4Y4R A;  3CCM I;  4J01 A;  2BZT A;  4YII A;  4Y13 A;  1LJ9 A;  1YI2 I;  2LH9 A;  5HLT A;  2FEZ A;  3FXK A;  3RI4 A;  4X1E A;  2GA1 A;  4HDV A;  4IJA A;  4D5F A;  5C4J J;  3Q3S A;  2GWR A;  1VQK I;  2V1X A;  2ID6 A;  2K02 A;  2LLK A;  3KP3 A;  1BJA A;  2ZNZ A;  5JHU A;  1RES A;  3JTH A;  5IOZ A;  2HQ5 A;  1N75 A;  1W7P A;  2XRO A;  3GWZ A;  4W97 A;  3KLN A;  1YJW I;  1JHH A;  1HW5 A;  2QEX I;  2LKS A;  2Y69 H;  4ON0 A;  3TGN A;  3TW7 A;  4ZTJ A;  2P7C B;  3F8C A;  5GTH C;  1ETO A;  3Q0V A;  2DK8 A;  3I59 A;  3BR1 A;  4MQV A;  2HZT A;  4W1U A;  5EYR A;  1R71 A;  3H1C A;  1TWA J;  1BOB A;  2PMH A;  5CVR A;  3RKY A;  4MIM A;  2PX9 A;  4NUB A;  4G7H F;  1PUF A;  3IH4 A;  3S2D J;  2EV6 A;  3HGG A;  1R9T J;  2H6C A;  5LGT A;  1U9O A;  2Y0S N;  4L18 B;  1ETW A;  5HS8 A;  5HNH A;  1Y1V J;  4ESJ A;  2FJ1 A;  1WKM A;  4A0Y A;  4XK4 A;  5DUI A;  4IHW A;  1JUS A;  3D5S C;  3SEZ A;  2EFW A;  2MA3 A;  1WGX A;  2WBM A;  4V2F A;  4Y7N J;  4X0G A;  1PVE A;  2VE9 A;  4JX4 A;  3C18 A;  3GTK J;  1RKW A;  2MC4 A;  2CW7 A;  3LSH A;  3G1O A;  2KP6 A;  5H6Q A;  2IS1 A;  4II3 A;  4JQF A;  3FBN B;  1TWG J;  2RQQ A;  1MD0 A;  3E3V A;  4UUV A;  2VQC A;  2EIK H;  4ZYA A;  1WHU A;  3W2W A;  4A93 J;  5F0C A;  3ZQI A;  1BW5 A;  3TMO A;  2MAB A;  1FYK A;  3F8B A;  1P6R A;  1TL8 A;  1AWC A;  3CME I;  4XLF A;  4LJZ F;  1E3O C;  4EJV A;  3MAJ A;  2OTJ I;  1OKR A;  5KVR A;  3DP7 A;  5L3D A;  4M9S A;  3N97 A;  1UB9 A;  3KLO A;  5J8C A;  4CZC A;  3JRA A;  2MD5 A;  3DU6 A;  4MTD A;  1J09 A;  4ZTF A;  1IN4 A;  1G3Y A;  1JJ6 C;  1R1T A;  1QO0 D;  1YX5 A;  3PO2 J;  2DLL A;  1FX7 A;  2K5C A;  3VPR A;  3S3O A;  2IA0 A;  1R36 A;  1JE8 A;  1E0E A;  2F5E A;  3F8F A;  3T8T A;  1BBY A;  4OU0 A;  4L0Z B;  4FX4 A;  1D0Y A;  1OR7 C;  2JPC A;  1YOV B;  1O57 A;  3BCB A;  3H0D A;  4ENK A;  4UVA A;  4F55 A;  4BQA A;  3HOW J;  2YSR A;  3G2B A;  3K10 A;  4JK1 X;  3JRG A;  1GLN A;  3H5A A;  5DUK A;  2V9K A;  3LST A;  2STT A;  1J75 A;  4I02 A;  3ECH A;  1BM9 A;  3IL2 A;  4BEH A;  1K61 A;  3MEX A;  1FEX A;  4JX5 A;  1IN5 A;  3E6M A;  2K4J A;  2AXL A;  1G3S A;  1VI0 A;  2K4B A;  2XAF A;  2XF5 A;  1NHA A;  4IOC F;  5BOX A;  3JRF A;  1NK2 P;  2XAQ A;  2HPM A;  2MBF A;  4ITV A;  3O6B B;  2R7W A;  2DK5 A;  4IRH A;  3OV8 A;  4OAY A;  3CLO A;  3B02 A;  4HPQ A;  3ZCO A;  5CKT A;  2R5Z A;  3DBR B;  1VQP I;  2CSO A;  2WAF A;  2RKH A;  3K70 D;  3HOZ J;  3HOU J;  1K4S A;  2PJR B;  3Q9V A;  2JUG A;  4C3I J;  2VBZ A;  4EJU A;  2K86 A;  5CVJ A;  3P9I A;  3CCJ I;  5BNG A;  3ZQG A;  1BR2 A;  1ZHF A;  3LWF A;  4HV6 A;  1EKE A;  1ODD A;  3QP6 A;  2UXN A;  3X2Q H;  1PUF B;  1EF4 A;  3OIQ A;  1G59 A;  1OCC H;  2RC4 A;  5HOO A;  2P8T A;  4AC0 A;  1KQ9 A;  2FBI A;  5B1B H;  3VYR B;  5D8L B;  4KDP A;  3OS0 A;  4M6Y A;  1O4X A;  3A02 A;  2EV0 A;  4DIQ A;  3WU1 B;  4EJW A;  3CP8 A;  4G94 A;  4HX4 A;  2P6T A;  1KZH A;  5IP7 J;  5DCM A;  3NWT A;  3HHH A;  4AD9 A;  4AVZ A;  5J6X A;  1HSJ A;  2AS5 F;  1BW6 A;  1YW7 A;  1IV8 A;  2EZK A;  3K2A A;  4LIU A;  2L9V A;  3LQR A;  3S32 A;  1OFC X;  5EEH A;  1ZG1 A;  2VKV A;  3HTS B;  2QVO A;  4M6X A;  4B44 A;  5FKO A;  4QPO A;  1ZN2 A;  4QWQ A;  5K5R A;  3A03 A;  1MJA A;  1D8J A;  5A2Q K;  4I09 A;  3OYE A;  1HOM A;  3HUG B;  3JSO A;  1ETV A;  4IHT A;  3ZR8 X;  2COB A;  5EG0 B;  1S6L A;  1VFC A;  3DV8 A;  1LDK B;  3KP2 A;  3M8E A;  2XAU A;  3AG3 H;  5DM7 F;  4GGG A;  2F5C A;  4PCQ A;  1XCV A;  4FE4 A;  1XGM A;  5D8K B;  3MVP A;  3J7A O;  4XLN F;  1K79 A;  4MNU A;  1LPQ A;  3KEQ A;  2LY1 A;  1G6N A;  1YW8 A;  2XKP A;  4D9J A;  1W0U A;  3VYU B;  2M7A A;  2P6S A;  4DJA A;  2IAI A;  1HKQ A;  2FQ4 A;  3ABU A;  4GDF A;  3HEF A;  2DJN A;  3CUQ B;  3DEU A;  1IXR C;  4BXX J;  1H9T A;  2KIU A;  1LFB A;  2DO7 A;  4PGG A;  4JBA A;  2HYF A;  1WJF A;  2X1D A;  3OYC A;  1QPI A;  3GTM J;  1SEU A;  5FLV A;  4KIS A;  3MD2 A;  3QYF A;  1VQM I;  2VQL A;  1LE8 A;  3C2B A;  2F5V A;  3BJ6 A;  1IAW A;  3FM5 A;  3BTC A;  1Z3X A;  1VQL I;  5IOY A;  1FMW A;  2V1U A;  4YFX F;  2I8D A;  3FHN A;  1IN8 A;  2VL8 A;  2LKX A;  2ZNY A;  3CUO A;  1WVR A;  2JZY A;  2PMU A;  3G1M A;  3HRU A;  2KKO A;  2LMD A;  2XPW A;  5L3C A;  1CGP A;  2CUJ A;  3ZQL A;  3R0A A;  4LD5 A;  1FP1 D;  3KP4 A;  4AU7 A;  2V9P A;  3RPU D;  1KON A;  3CDL A;  1R5I D;  2IEK A;  2I10 A;  2DOE A;  3MCZ A;  1JI8 A;  2BYV E;  3TP3 A;  2OCE A;  2A6H F;  2Y0S A;  4HNU A;  4RMN A;  1JKO C;  3F8M A;  1O3S A;  3A4C A;  3F6V A;  2NNN A;  1IG7 A;  2QA4 I;  2QSF X;  4EAT A;  2IVM A;  3TO9 A;  1IUF A;  2LG4 A;  4DZJ A;  2JA7 J;  1IXC A;  2D1H A;  4ZC3 A;  1Q1V A;  3QOP A;  4XSX F;  1GT0 C;  3A1Y A;  4XLH A;  2O5R A;  4HX7 A;  2R5Y B;  5DEQ A;  5FRN A;  3K1M A;  4RLQ A;  1LKX A;  5JHF A;  4A5M A;  3A01 A;  1FT9 A;  3UKG A;  3E5X A;  1XGS A;  2HKO A;  2W24 A;  3GEZ A;  1OR7 A;  3GF2 A;  4BS9 A;  2GXA A;  3G3Z A;  1D0X A;  1A5J A;  1U2W A;  2CWE A;  3T0Y A;  1GHC A;  3WTX C;  3R6S A;  2HI3 A;  3BRO A;  1W7P B;  1XS9 A;  1TLH B;  3WGI A;  1RPW A;  2CG4 A;  2HNH A;  1T0F C;  3HB9 A;  2FNP A;  2FNA A;  3QU3 A;  1OCT C;  3KEY A;  1XGO A;  4HQM A;  2K40 A;  2X6X A;  4MLO A;  1R49 A;  1W4M A;  4ZDO A;  2HVR A;  3S93 A;  4NDL A;  4JOM A;  1O3Q A;  4IF4 A;  3HUG A;  3W6V A;  2EJR A;  3PUB A;  3OIP A;  5J3L A;  3CCE I;  1M1E B;  1PJR A;  4I2O A;  3KZZ A;  4HLX A;  1MBJ A;  4J00 A;  4N9I A;  3ISP A;  3AG1 H;  5CPR B;  2CFX A;  4C2M J;  1TNT A;  2A69 F;  3V4G A;  5BPD A;  2QGU A;  1YIT I;  3VOE A;  3NRV A;  3EYY A;  1T95 A;  3DPU A;  4RAG A;  2HR3 A;  4BE1 A;  1FPQ A;  2DA3 A;  1QGP A;  2L02 A;  4WX9 A;  1ZRE A;  1G3T A;  3ECO A;  2NVX J;  3LQQ A;  2P4W A;  3I54 A;  5J1U A;  3KP7 A;  3IAM 2;  5DM6 F;  2R7F A;  1MSE C;  4EVI A;  3MN2 A;  1B59 A;  2E36 A;  2F4I A;  1D1A A;  1T38 A;  4M3B A;  1WH7 A;  5FLX Z;  2OU2 A;  5FO5 A;  2HQA A;  1H9G A;  2ME0 A;  1I1G A;  2M34 A;  1BIB A;  1BOA A;  4ENN A;  2DOA A;  3RTR A;  3CES A;  1OYI A;  1U8B A;  3Q0W A;  2VJ4 A;  3ZQ7 A;  3OYI A;  1FP2 A;  4XID A;  5L3F A;  3S1R J;  5ICE A;  4EEF G;  1XSV A;  4R1H A;  2WY7 Q;  1P4X A;  3WTS C;  1ON2 A;  4BDZ A;  1E3P A;  1IV6 A;  4A6D A;  5DYM A;  5E3N A;  2H1K A;  1MNE A;  4NB5 A;  4OMY A;  5DTD A;  3W2A A;  1K78 A;  3VDX A;  2RVC A;  2OZU A;  2F2E A;  2W7N A;  4MGR A;  2E1M B;  3EUH A;  4M3D A;  5E20 A;  3L2R A;  5AON A;  4EM1 A;  4IQJ A;  4BHC A;  2ZFU A;  1WI3 A;  1ZLK A;  2VUM J;  4BJT A;  2R7Z J;  2DT7 B;  3PFI A;  2L3D A;  2BV6 A;  2Y31 A;  3ZN0 A;  4XM3 A;  1SC7 A;  5CQG A;  4A3F J;  3ZMU A;  3Q5F A;  2BE5 F;  1MDM B;  1Y56 A;  3N05 A;  4S05 A;  4DBR A;  2MGQ A;  3ABT A;  3OR1 C;  1ZRC A;  5FD6 A;  1PP8 F;  3S1N J;  3RYP A;  4CCM A;  3OYA A;  2EBI A;  4BYY A;  3ABK H;  4NC8 A;  3SYT A;  1ZGJ A;  1UZC A;  1YS6 A;  5LRS A;  2GXB A;  4B43 A;  2LRE A;  4GRI A;  3CCY A;  2ZC2 A;  4YIF A;  4ZYH A;  3HZJ A;  2YX7 A;  1FIA A;  2FOK A;  3B6C A;  3NEU A;  1B9N A;  3DLL F;  5L3E A;  3S3N A;  1YRN B;  2E1C A;  3WGH A;  3SJM A;  1I5Z A;  2PMZ A;  2R7O A;  1MMD A;  2XPV A;  3ZQF A;  5E1Z B;  1Z7L A;  2TDX A;  3EUH C;  2DMP A;  2OC6 A;  3BT9 A;  5GAH J;  2L2O A;  5FRO A;  5H2F C;  4NHJ A;  4MEX F;  1NH3 A;  2EFN A;  1N25 A;  1F4K A;  4M6V A;  4A0Z A;  2GAU A;  2XDV A;  2Y9Z A;  2FQ3 A;  5EZH A;  3PO3 J;  1HBX G;  1W5C C;  4XQF A;  4E6K G;  1E3H A;  4JP0 A;  3B73 A;  4F93 B;  1IRX A;  5KAF C;  5GPA A;  1H8A C;  1G4D A;  5LBQ A;  4HNT A;  3S3M A;  1VF9 A;  4ZZL A;  1TQI A;  4P5O A;  4HF1 A;  5FD5 A;  3LSJ A;  3QYB A;  3HOT A;  2PQ8 A;  4BJ5 C;  1A35 A;  4BQO A;  2DA4 A;  1XMX A;  2KIF A;  4CCJ A;  1ETK A;  4M9Z A;  2X85 A;  1Z9C A;  4YFK F;  1KQ8 A;  1BI0 A;  1F43 A;  1XX5 A;  1YS7 A;  2MH2 A;  2A6E F;  2DQL A;  4XLC A;  4U0V A;  1J59 A;  2BY1 A;  2BEO A;  2XPU A;  5CVU A;  4YRV A;  2G7H A;  3GLX A;  4IVN A;  3KYD B;  3JRC A;  3I9V 2;  1MJB A;  1P4A A;  4WF2 A;  4M3G A;  3K4K A;  1YLF A;  1YQA A;  4XKV A;  1FOY A;  1T8I A;  2QQA A;  3DPT A;  4G12 A;  4WCG A;  4PDK A;  2JRM A;  2OAZ A;  1NK3 P;  2LY2 A;  4OIO F;  4II2 A;  1X58 A;  1XGN A;  2P0W A;  2ZXH A;  4EGY A;  3CJR B;  3OOU A;  2V79 A;  2BVL A;  2TRT A;  1I6X A;  4LLL A;  5HOD A;  2FU4 A;  2ZFW A;  1G2H A;  1R1U A;  1XMA A;  1T0F A;  2VLA A;  3P7N A;  4NNJ A;  2KDO A;  4IRI A;  4WWC A;  2GA2 A;  1WJE A;  3BG3 A;  4XRF A;  3GZ6 A;  4CCK A;  3BWG A;  3ELK A;  2ZO4 A;  1W0T A;  3NAU A;  3JW4 A;  4B8X A;  2OPT A;  5EGO B;  2VJJ A;  2GZW A;  5J47 A;  2JA2 A;  2VT3 A;  2ZBK A;  2IP2 A;  1P7I A;  3KZY A;  3V42 A;  1UCR A;  3WG7 H;  2HDW A;  4S04 A;  1HW2 A;  2BXZ A;  1VQO I;  1REP C;  3UNG C;  1ITY A;  3AAF A;  3LSI A;  4RB2 C;  3COA C;  2WTE A;  5GP9 A;  4ETS A;  3Q9S A;  2H94 A;  5E3L A;  3HRM A;  1Z7U A;  5AIQ A;  3CC4 I;  3MFK A;  4BJ6 C;  1NG6 A;  3IRR A;  1DP3 A;  1ZYR F;  2EB7 A;  4HA8 A;  4E7L A;  3P5J A;  2F4O B;  1OLT A;  3HHG A;  4ZH4 F;  3DU5 A;  2Q2E B;  2W25 A;  3GZN B;  2E35 A;  5FKM A;  3SHF A;  2EK5 A;  2V9V A;  3OYK A;  4V2G A;  1Y8Q B;  1KYW A;  4GO1 A;  1W36 C;  2VPL A;  4UB8 C;  3KZI C;  2NVU B;  3VSK A;  1KQ0 A;  3LA7 A;  5IP9 J;  2V1N A;  1ON1 A;  3L2V A;  1PP7 U;  1JXS A;  2DBB A;  2X0L A;  2VC1 A;  1S9H A;  3TO6 A;  5FKL A;  4X6A J;  4BAC A;  4I7H A;  3BDD A;  2M87 A;  2A05 A;  4OIN F;  4P9U A;  5JFR A;  3BG6 A;  4WXD A;  3HRS A;  1SVO A;  1P2F A;  4N0B A;  3SZT A;  1K78 B;  3I3L A;  3CCV I;  1SFE A;  4KN7 X;  2IBD A;  3HSF A;  1WWX A;  2R7S A;  4D5C A;  4KJZ A;  1K6Y A;  2LF8 A;  3PIO F;  1UG2 A;  4IX7 A;  2HU9 A;  2DI3 A;  1IXS B;  1EH7 A;  2BHZ A;  2DFH A;  2CV0 A;  2BXY A;  2Z5U A;  4A3K J;  1IC8 A;  1SMT A;  3LSG A;  3BPV A;  3T1B A;  1OCO H;  1TWC J;  4HNV A;  2WV0 A;  1X3U A;  3FXQ A;  1UMQ A;  5IYD J;  2OBP A;  1U0J A;  3CDH A;  2F48 A;  5JLX A;  4KUM A;  2O6G E;  2E19 A;  3L1P A;  2W00 A;  2L9S A;  1FJL A;  3U1K A;  4KT6 A;  3GTO J;  2O8K A;  1MZB A;  3OYN A;  1X1C A;  5F27 A;  3BZC A;  3T5X A;  1W7P D;  5HLI A;  4IQ4 A;  3C3W A;  5DD8 A;  3FIS A;  3M07 A;  5HS7 A;  1V5G A;  2CYY A;  3WE3 A;  3CO7 C;  5M5W J;  1L3L A;  1AKH B;  4A3E J;  1O7L A;  4DGW B;  3AL0 C;  3LNQ A;  2HTJ A;  3EUK L;  4XRM A;  3BR0 A;  1HA8 A;  1WI9 A;  3G1L A;  3MZY A;  2E2I J;  3C2H A;  4I99 C;  3MKY B;  3ZP5 A;  1GVD A;  4MFD A;  1NTC A;  1XMK A;  1B72 B;  3J7Y J;  1USS A;  2XHK A;  1IN7 A;  1H88 C;  3BJA A;  1ZLJ A;  2HPI A;  4WXH A;  1YTY A;  2XVC A;  2MLG A;  3L2C A;  2HOA A;  2MLK A;  5LEK A;  1W36 D;  1B4A A;  2FMY A;  1STZ A;  3HL2 A;  2DYR H;  3CQZ J;  3ZGK A;  2PLY A;  1IJW C;  3KFW X;  2IXS A;  2DDA A;  2G0E A;  5HDK A;  5J1Y A;  3HC7 A;  2OJE D;  2HFH A;  3CLQ A;  3KCC A;  2Z1D A;  3V7C A;  1YIO A;  2GOM A;  2JMW A;  5K5Q A;  1I6H J;  2O61 A;  1KA8 A;  4HBL A;  1KU3 A;  1X4P A;  3KX2 A;  4XON A;  4E7H A;  1TWF J;  5ED4 A;  1U6G A;  1TW3 A;  3K69 A;  2R7V A;  2J5O A;  1S3J A;  2NAZ A;  2P81 A;  3U2R A;  3O8H A;  2XC7 A;  2M1B A;  2DA2 A;  2LD5 A;  2JT1 A;  4M3E A;  2JQ7 A;  4U88 A;  2KRF A;  1O3T A;  3S14 J;  3WOD F;  1VQ5 I;  2A68 F;  2E60 A;  3FF5 A;  4P96 A;  2QEN A;  5E1W A;  2ID3 A;  2DJI A;  5HVQ C;  1RUN A;  4CGZ A;  2FD5 A;  1KGS A;  2HXI A;  5LRR A;  5LLQ A;  1MBF A;  3D5L A;  4FHT A;  3JRI A;  2IS4 A;  3MZ8 A;  4R8H A;  3RCO A;  1DQU A;  1VQN I;  2O7O A;  2QQ8 A;  1ZH5 A;  3FDY A;  5FKN A;  4XOT A;  2XB5 A;  2R0Q C;  3TO7 A;  1Y0U A;  5C3E J;  3I0T A;  1XB4 A;  1RUO A;  4YEJ A;  5E1X A;  2CFO A;  3ZMZ A;  2FML A;  5FB2 A;  9ANT A;  2DTZ A;  3E6B A;  5BMZ A;  1JJ8 C;  3OYF A;  1F36 A;  3HTU A;  2O03 A;  3FMS A;  5M3F J;  2UWM A;  4HF2 A;  2O3F A;  4E7J A;  4XIC A;  2GXG A;  2VIX A;  2VQH A;  1QVU A;  3U1D A;  2A61 A;  5K1Y A;  4I76 A;  3MKW B;  1JKR C;  1YRN A;  2XSD C;  1JUM A;  2CUF A;  2JJ7 A;  2ISY A;  5B3S H;  2DFI A;  2QQ9 A;  2HOE A;  1ENH A;  1U5T C;  3L2W A;  5LD2 C;  2BVM A;  3M8F A;  3KEO A;  1A6I A;  1I1S A;  2DMQ A;  1IDY A;  3A0B C;  4L9V A;  5F1R A;  1PDN C;  2J5P A;  4RBO A;  3RYR A;  4O3M A;  3J80 K;  5EGO A;  3QOE A;  2NS7 A;  1YG2 A;  3DCF A;  5D6F A;  2M5W A;  1IN6 A;  2MC3 A;  4L5I A;  5E3M A;  3H3V K;  4HLY A;  5DDG A;  1CF7 B;  2R7R A;  3FXL A;  3C7J A;  3OYJ A;  3LSR A;  4L9J A;  3WG9 A;  3CJQ B;  3H0G J;  3BTI A;  2KZV A;  2D1V A;  2ISZ A;  3DEW A;  3D1N I;  4A2U A;  3QU6 A;  5IYB J;  3LA2 A;  2O0Y A;  2Q1Z B;  2MSY A;  2DMN A;  2VOD A;  1FWZ A;  4XN3 A;  4A3G J;  2UXX A;  1BL0 A;  2DPU A;  4UVC A;  4AWX B;  2ELK A;  2HS5 A;  4BHB A;  2BW3 B;  2M8G X;  1V4R A;  2VAS A;  3ML6 A;  4PGH A;  3NWS A;  2CQ7 A;  5D5W B;  4MTE A;  1ZG5 A;  3CCS I;  1RRJ A;  2B7E A;  5D4R A;  2MG4 A;  1QZE A;  2A6T A;  1OCZ H;  1R4N B;  3RJP A;  4PJN A;  2IT0 A;  2OA4 A;  1U78 A;  3I59 B;  1OQY A;  1TNS A;  3CCL I;  2ETH A;  3EQL F;  4XKC A;  2ZME A;  3I53 A;  3R61 A;  3KET A;  2D2W A;  1P7J A;  1ZTR A;  3WU0 A;  2QUF A;  4RAZ A;  3K4M A;  2DA6 A;  3CZ6 A;  3K6G A;  4HOB A;  5KAI C;  1ULY A;  2M0C A;  1YIJ I;  3TOA A;  1N78 A;  4M74 A;  3SDB A;  1LUJ B;  1YFH A;  1TT0 A;  2Y30 A;  1W1W E;  3AG4 H;  4G7O F;  2E34 A;  2EZL A;  4A3L J;  4FCY A;  5K7H A;  2WAQ A;  3DPL C;  4QLC U;  4A12 A;  2Y0M A;  2AQE A;  4ESF A;  3LL7 A;  4ZYE A;  3CMY A;  3K1P A;  1T2K A;  1VND A;  2HDD A;  2Z9O A;  5LGU A;  2DN0 A;  1XCB A;  3BR3 A;  3RPU A;  2XGD A;  3MQ0 A;  4XSZ F;  3IH3 A;  1FOW A;  2L7Z A;  1B8I B;  5IY5 H;  4E7K A;  1XD7 A;  2KFD A;  4A3D J;  5DV5 A;  3PUF A;  3K4B A;  4CXF A;  2H6B A;  4A0X A;  2M9H A;  2R7D A;  2P5V A;  3I71 A;  4N9H A;  1SMY F;  4LFU A;  5FRM A;  2JUC A;  1TBX A;  3CUQ C;  1TC3 C;  1CQT A;  2NVT J;  2FX0 A;  4OAZ A;  2PMZ N;  1XSX A;  1DUX C;  1Z1D A;  3RZO J;  3K4L A;  3ZMT A;  4FX0 A;  5ILV A;  2K9N A;  1WFX A;  3ZXS A;  2L54 A;  3IWZ A;  4GYI A;  1Y1W J;  1RNL A;  4D7M A;  1JTY A;  2VXD A;  3F9K A;  3IKT A;  5CQE A;  5B5E C;  4A3I J;  3LFU A;  4H4K C;  3S16 J;  1SAN A;  3K7A J;  5FJ8 J;  1ETX A;  3BCA A;  2QBY A;  1MH4 A;  2FA5 A;  4ZZD A;  2M30 A;  4KMF A;  3RPQ A;  2DFE A;  4Y52 J;  4AYB A;  4PJJ A;  2ELH A;  2HDC A;  1BR1 A;  1OMI A;  4LG3 A;  4F92 B;  3I5U A;  3SZP A;  1WJB A;  1FTT A;  2ESH A;  3V8L A;  1YYV A;  3H9J A;  4BH9 A;  4IHY A;  2DU9 A;  2AQF A;  2YX4 A;  1OYW A;  2DT6 A;  2OQG A;  4Y33 A;  2X48 A;  1TP4 A;  3MKL A;  4B3A A;  1UHM A;  2A5Y B;  2WWY A;  1AU7 A;  4UNO A;  4EM0 B;  4BY7 J;  3QRF F;  4F52 A;  1X1D A;  6PAX A;  4BDY A;  1I3Q J;  5D5U B;  2WAE A;  2XV4 S;  4E7Z A;  1ETQ A;  2QBY B;  1SVL A;  3ERM A;  2LC2 A;  1QZY A;  3PL8 A;  3F6O A;  3R0J A;  5E8G A;  2D5V A;  4Z2Y A;  1ZEL A;  2PJR A;  2X6O A;  3HOV J;  5TGT A;  2F5F A;  4OOI A;  2OUM A;  2GQQ A;  3DQV C;  2NOJ B;  5DD4 A;  3Q0U A;  1H0M A;  5JI6 A;  3F22 A;  3S1Q J;  1ZG3 A;  3WE2 A;  5B1A H;  4PFO A;  1Z05 A;  5EF6 A;  2WAQ N;  1WZ2 A;  1POG A;  4AM3 A;  2CS3 A;  3FK7 A;  3WHB A;  4CCL A;  3SFZ A;  2VBY A;  2HQN A;  5TJJ A;  4D7N A;  1HST A;  1OCR H;  2WB1 N;  4BKX A;  2VJ5 A;  4UXN A;  3L00 A;  5JVG F;  3NQO A;  1JUP A;  4KA4 A;  1B72 A;  3PIP F;  3HXL A;  4EQQ A;  2RN7 A;  4BY1 J;  4ZJZ A;  2MD0 A;  3WTU C;  1LFU P;  2WC2 A;  2EFO A;  2V7F A;  3ZRG A;  4LG0 B;  4NC6 A;  4ZDL A;  2CQK A;  2VBX A;  1WCM J;  2V26 A;  2LTP A;  4IZZ A;  4F3Q A;  3G71 I;  2NOG A;  2LR8 A;  2M0M A;  2H1L A;  1MMG A;  3CJN A;  4LK0 F;  5DCF A;  1X1B A;  5F04 A;  3RSN A;  1BI1 A;  3FIW A;  3H92 A;  2Z3Y A;  1VQ9 I;  5F0F A;  3RKX A;  1JKQ C;  3OL3 A;  5GTI C;  2JVG A;  2CU7 A;  1KU9 A;  2Z2S B;  4A6E A;  2K85 A;  3PNY A;  3F8N A;  3H36 A;  3CF5 F;  2JA5 J;  3IC7 A;  1MKM A;  4HX8 A;  4DBQ A;  4YIR X;  3CMM A;  1VQ7 I;  2IS2 A;  4CH7 A;  4FTH A;  1X3W B;  1VZ0 A;  3V8J A;  4HF0 A;  1S29 A;  3GFL A;  3O8G A;  2ZJR F;  1HKS A;  2F4M B;  3CUQ A;  3LFK A;  3PNT A;  4FT8 A;  4QTR A;  2MYS A;  2K3F A;  3CCQ I;  3KP6 A;  1R00 A;  3CC2 I;  5EEG A;  2PBI A;  2LRD A;  3GCM A;  3SZG A;  3JRB A;  3DLA A;  4IO9 F;  2RNG A;  3HYI A;  1O7F A;  5E8I A;  3HPG A;  2HQR A;  3CD6 I;  1JGG A;  4HQE A;  4L9N A;  3J7Z I;  2PEX A;  4EJO A;  1Y8R B;  2XSJ C;  3IUO A;  2KDZ A;  3IP4 B;  2O8X A;  1FNN A;  3I55 I;  2CV1 A;  5KHD A;  2HGC A;  4XRS G;  1QRY A;  1QBJ A;  2L0K A;  4U0Y A;  2RDP A;  2VXZ A;  3BR5 A;  3EET A;  2XAG A;  4G9Y A;  1KU7 A;  4FET A;  3VB2 A;  1S5L C;  2K7L A;  5TIS C;  1LDD A;  1T6S A;  2L7M P;  2EA2 A;  4IEJ A;  4M71 A;  4HAM A;  4PJL A;  2UZK A;  1HQC A;  3FWE A;  2F5D A;  3BLY A;  2NYX A;  1XG1 A;  5J8F A;  2PN6 A;  4O5V A;  1BI2 A;  3GTP J;  1UJ8 A;  2VBW A;  2HKX A;  1B6A A;  2VB6 A;  2QWW A;  1H89 C;  1A04 A;  2E2H J;  2W4S A;  3RIR A;  2FE3 A;  2IGK A;  2EWN A;  4LIT A;  3QPH A;  1GXQ A;  3SEQ A;  4M9X A;  1GDT A;  2VOP A;  5J40 A;  3FBI B;  2HZD A;  4LB6 B;  1EH8 A;  4BEH B;  1D0Z A;  1C0W A;  1DPU A;  1FMV A;  1ZGA A;  4D1Q A;  4BAY A;  1K83 J;  1SD4 A;  4DYQ A;  2JPB A;  3PJR A;  4Q47 A;  4IPA A;  3TL4 X;  4V19 K;  2LK2 A;  1Z67 A;  2PJP A;  2UUZ A;  4I01 A;  1I50 J;  4JYK A;  3U21 A;  3BP8 A;  2DFF A;  1OYY A;  5KK1 A;  1SVM A;  3H9Q A;  2R4G A;  3FK6 A;  5ERI A;  3GFM A;  4U7B A;  3KP5 A;  4M72 A;  5FGM A;  3HOX J;  3C2G A;  4H0E A;  1RR8 C;  4HRI A;  3IV5 A;  3GTL J;  3ONQ A;  4QSH A;  2YR2 A;  3PQJ A;  2BBY A;  3GBG A;  2JA8 J;  3ASN H;  4G7Z F;  2FF4 A;  3OYM A;  1XPX A;  3M1C A;  1LVK A;  5HLH A;  1BJZ A;  3FMQ A;  4M3F A;  2CJJ A;  1YO5 C;  1MMA A;  2PG4 A;  1SFO J;  1MDM A;  3ZMV A;  3FM3 A;  2L9R A;  4LIV A;  2L7K A;  3A0H C;  1QNT A;  2DMT A;  2K9M A;  3ABM H;  3KE2 A;  2HXO A;  1QVT A;  1WJD A;  3GFJ A;  3KYC B;  4P1W A;  2K3P A;  5EJC A;  4DZP A;  2ZSH B;  2M8E A;  2ZXW H;  4RM2 A;  3EUA A;  4YG2 F;  2E1M C;  3L2U A;  3G73 A;  3BG7 A;  4CHU A;  4BU2 A;  3OYD A;  4XKW A;  2ESN A;  2DDB A;  1OPC A;  3GTG J;  2I5U A;  2DA5 A;  4HV5 A;  5ILU A;  1JKP C;  1JTX A;  3DKW A;  5LHI A;  2ZCW A;  2KIM A;  3BTJ A;  4E70 A;  3RQ4 A;  3BY6 A;  1RET A;  1YE9 A;  2OCC H;  2EV5 A;  2VQG A;  4KIT B;  4A3J J;  5ICC A;  1HDP A;  2RAE A;  3CP2 A;  3QPT A;  1O3R A;  1DGR M;  2G7U A;  4RB1 A;  2ZXJ A;  2FBH A;  3HBL A;  2L7F P;  2CGP A;  2E7W A;  2IS6 A;  1XSD A;  3HKZ N;  1HW1 A;  2H8W A;  1IO2 A;  4XOP A;  1QQI A;  4PSX A;  5EG0 A;  2HOS A;  1L0O C;  2DQR A;  5IP6 A;  3KIO A;  2EZI A;  4XN0 A;  5LEJ A;  1YJN I;  4ENM A;  4HEA 2;  3RQI A;  3M4O J;  2XAJ A;  1V5E A;  1R22 A;  4FE7 A;  3OYG A;  2HEO A;  2OD5 A;  2ZKZ A;  2CW8 A;  2ME6 A;  5F64 A;  4HW0 A;  4LOC A;  1X3Z B;  2X1E A;  1WH5 A;  1LB2 A;  5HLG A;  4HYE A;  1X2M A;  3V8K A;  1GUU A;  2A3S A;  4C9Y A;  2LSO A;  1WJA A;  3GTJ J;  1ZQ3 P;  3HM5 A;  2QQB A;  1IUY A;  1SD5 A;  3H3U A;  1EA3 A;  4DOZ A;  2JA6 J;  3DFG A;  2EFQ A;  3RKW A;  3CF2 A;  2COM A;  3H5R A;  2BY0 A;  4IOA F;  2GBY A;  3QAH A;  3HRT A;  3AL0 B;  4YEL A;  2EH3 A;  4KN4 X;  1XDS A;  5GAD J;  3D0S A;  3G6E I;  2TCT A;  3C1D A;  5CVV A;  1PUE E;  2X4H A;  2IRF G;  3E0J B;  3ZN1 A;  4IHS A;  3BZ6 A;  3OYH A;  3QPL A;  2K9S A;  1LDJ A;  3LA3 A;  5D5V B;  2Y2Z A;  2QLZ A;  5E17 F;  3OYL A;  1LQ1 A;  2Y75 A;  1EH6 A;  1X1P A;  4PJ0 C;  4ESB A;  2LP0 A;  4A5N A;  3CCR I;  5E79 C;  1E2X A;  3IRQ A;  3KYL A;  1GXP A;  1FOK A;  5GAE J;  4PSW A;  1I39 A;  1AHD P;  1T39 A;  4L0Y B;  2KPM A;  4RA2 A;  2R93 J;  3REO A;  3QYE A;  2GLO A;  2NS8 A;  3A2K A;  1A36 A;  3OIO A;  1MBG A;  3WGG A;  2KRH A;  3V7S A;  2W1O A;  3FXO A;  1RR7 A;  3TQN A;  2RQP A;  3HDD A;  3JRE A;  4BXF A;  1QU3 A;  3MKZ A;  4RDU A;  3S15 J;  4BXU A;  2Q0O A;  3RZD J;  1VTN C;  3FZV A;  4LB5 A;  5LHG A;  1MNM C;  1JT0 A;  5C44 J;  4I0B A;  3TKY A;  1FSH A;  1MBE A;  1MW7 A;  2KQR A;  4KT5 C;  5J4Y A;  3E5U A;  4AIH A;  4I6Z A;  5EEA A;  1K6O A;  4KIF A;  1G3W A;  1AOY A;  3WU2 C;  2V4J C;  3PNV A;  2R5Z B;  1IGN A;  4HG2 A;  3M7G A;  1GV2 A;  3JRH A;  1S7O A;  1B1B A;  2L4M A;  3JTG A;  1S7A A;  2M3A A;  4B09 A;  1LEA A;  2DT5 A;  2VKD A;  4CCN A;  1MMN A;  5LFA A;  5K5O A;  1I3A A;  3R4K A;  2Q8K A;  4C3H J;  3U9G A;  2E1O A;  5KCM A;  1WRJ A;  4DYR A;  2ZB9 A;  3TP0 A;  4NBQ A;  1G8X A;  5FKK A;  2R3S A;  3GLL A;  3M1E A;  2LNB A;  4I98 B;  5GAG J;  4UVB A;  1P92 A;  4PZJ A;  4OIP F;  3K9T A;  1JHF A;  3VYS B;  2VON A;  1P4W A;  4BQN A;  2KMU A;  3HG9 A;  2X6W A;  4BUP A;  3ULQ B;  2O9L A;  1JGS A;  1XDU A;  4MQ9 F;  4WK8 F;  1Z21 A;  1X2N A;  3CTA A;  4ZDP A;  3ROU A;  2NNY A;  4BHP A;  1Y39 A;  5F6F A;  3W2V A;  3VWB A;  4L9T A;  2NRA C;  2LDU A;  1LVA A;  4XNF A;  3IAS 2;  4QIW N;  2Z33 A;  2VKE A;  5CYV A;  3HSE A;  5IPA A;  2PFB A;  1HDD C;  2KL4 A;  1FLI A;  3BG5 A;  3F23 A;  3P9K A;  2LY9 A;  3GW2 A;  2IPQ X;  1HXD A;  1ZGW A;  3GME A;  2X6Y A;  1ZRF A;  1IRG A;  3E97 A;  3J80 Z;  2A5W A;  2RGV A;  4KYW A;  1XC5 A;  1Q1H A;  2OZ6 A;  2XUB A;  5M5Y J;  2R5Y A;  5FLM J;  3EDP A;  2JRT A;  1IRF A;  2IGO A;  5EZG A;  4CIC A;  4HST A;  3FXM A;  1RI7 A;  4UUS A;  1AKH A;  2QSG X;  2BOL A;  2LBF B;  4CZZ A;  1IF1 A;  4N4O B;  1TQP A;  1WQ2 A;  2QZ8 A;  2CQX A;  2M4G A;  4RAY A;  1QHG A;  3QP5 A;  2EA4 A;  3PQK A;  2L9N A;  3FX3 A;  4CUG A;  4E7S A;  3DTI A;  4BBR J;  3LSM A;  2AO9 A;  2HYG D;  1ONV A;  5GPC A;  2A07 F;  4PUS A;  3JRD A;  1MH3 A;  2FRH A;  1IW7 F;  2RNJ A;  3DKX A;  2F6C A;  2ZJ2 A;  1UAA A;  2X1C A;  2H09 A;  3FXJ A;  3E5Q A;  5FFX A;  2YU9 J;  1DU0 A;  4RLF A;  1FZP B;  1KU2 A;  4NQW A;  1QZZ A;  4BE2 A;  3P9C A;  4DW6 A;  1OCP A;  3E6D A;  5FLX K;  2NVY J;  2LYC A;  4RGX A;  4U7D A;  3FXR A;  4MFE A;  3BG9 A;  2VT2 A;  2W82 A;  3GUD A;  4AUX A;  2R7T A;  5FFZ A;  4ANJ A;  1J2X A;  3LOC A;  2QYO A;  2LBF A;  1MGT A;  3H3Z A;  2CQQ A;  3QQA A;  1VQ6 I;  3OWT A;  3J81 Z;  1FSE A;  1R6R A;  5DCM B;  1BC7 C;  1T98 A;  1S8N A;  2NXN B;  2FSW A;  1A6Q A; 
#chains in the Genus database with same CATH homology
 3JAM Z;  3L9F A;  4DQ2 A;  3WTV C;  4LLG F;  3IKV A;  3F72 A;  1LEB A;  2LKP A;  3ZMS A;  3CO6 C;  2CO5 A;  4UV8 A;  4XBF A;  4EV0 A;  5L3B A;  4AVP A;  5HS9 A;  2P7V B;  2DTR A;  5H6R A;  4KIC A;  2IJL A;  3WTW C;  5BS6 A;  3JSP A;  4ZYG A;  1ZRD A;  3L09 A;  5TRD A;  1ZAO A;  1DPR A;  3SXY A;  4XLP F;  4UHT A;  2V1D A;  3WTY C;  2NS0 A;  5CVI A;  1R5H A;  2CW0 F;  1R1V A;  1J9I A;  5L3G A;  1UHW A;  4KIB A;  1Z6R A;  1FYM A;  3FMR A;  3VFZ A;  1TQM A;  2G9W A;  4Q4Z F;  5CLS A;  4IXA A;  4G6D A;  2XIG A;  1R7J A;  1SFU A;  2DAO A;  4Y15 A;  5ICF A;  1SFX A;  2RV8 A;  3K1N A;  2V6C A;  2K27 A;  3GX4 X;  3W6J B;  4RGS A;  4F7Z A;  1XN7 A;  4KNY A;  2XRN A;  3F21 A;  2JTV A;  4D0P A;  1UFM A;  1E17 A;  3IWF A;  4K2E A;  1HKT A;  5A2Q Z;  5D5X B;  4G8X A;  1RZ4 A;  3GO5 A;  1BI3 A;  2JSC A;  4U0W A;  3F3X A;  2Q2E A;  5CJ9 A;  2HWV A;  5ILS A;  3ZMD A;  1Z91 A;  1LNW A;  1EV7 A;  2P5L C;  3FXU A;  4Q48 A;  3VOD A;  4BNC A;  3M9A A;  3TDZ C;  5JVT A;  1FC3 A;  2FXA A;  2C6Y A;  2STW A;  3W6K B;  3K2Z A;  3BOQ A;  1I27 A;  1D5V A;  5AIP A;  3BPX A;  3SQN A;  3T8R A;  3GFI A;  5LGN A;  4GCV A;  1F9N A;  3K0L A;  3VEP A;  4MEY F;  1TTY A;  2W57 A;  3FHZ A;  2L4A A;  1YW9 A;  2E1N A;  2HTS A;  5JR3 A;  1D3Y A;  5LHH A;  2Y48 A;  3IHU A;  1J5Y A;  1IZ1 A;  3OOP A;  1K7A A;  4OMZ A;  2W84 A;  1SAX A;  4EM2 A;  3HOS A;  4ZYD A;  5D6E A;  1R5G A;  2ZME B;  4DNC A;  2ADU A;  4LK1 F;  3LAJ A;  4RS8 A;  2L01 A;  1W5S A;  3DXJ F;  4M73 A;  3V7R A;  3RDI A;  2DPD A;  3I58 A;  2ACJ A;  2XAH A;  2PI0 A;  4LLN A;  1FYL A;  2OQR A;  5HDN A;  5HDG A;  2VE8 A;  3DF8 A;  3GYH X;  1F1Z A;  2Z99 A;  2KJC A;  4LMY A;  3BJO A;  1U3E M;  4AIK A;  1U5T A;  4LGW A;  2H27 A;  3LAP A;  4RB0 A;  3HSR A;  1UST A;  1J7K A;  1W5T A;  1TW2 A;  2XAS A;  5H20 A;  4CO8 A;  4LG0 A;  3ZPL A;  5E18 F;  4I0A A;  3O3K A;  1SD7 A;  3MWM A;  1FBS A;  2FBK A;  1FBU A;  1J0R A;  4AIJ A;  3JAM K;  2MH9 A;  3S2W A;  1D8K A;  2XKO A;  1BC8 C;  2XGX A;  3O2P E;  1U5T B;  1FY7 A;  3J81 K;  2VOO A;  2EFP A;  5BQT A;  1BIA A;  1DP7 P;  2D45 A;  2GIV A;  2KJB A;  2IA1 A;  4P9F A;  2YU3 A;  1R23 A;  1B9M A;  2QM3 A;  4EMS A;  2IA2 A;  3TOB A;  1V3F A;  4OIR F;  3R60 A;  1SD6 A;  2M45 A;  4ENJ A;  1CF7 A;  3I64 A;  1R58 A;  2P5K A;  4HDU A;  4RGR A;  4YFN F;  1BN5 A;  3I4P A;  4G6Q A;  4IRG A;  1DDN A;  3E6C C;  1GVJ A;  4UV9 A;  4R79 A;  3N4M A;  2B0L A;  1FBQ A;  4KIG A;  2VC0 A;  2VN2 A;  4GXO A;  4MHG A;  4O6J A;  1MJ9 A;  3ERE D;  1F5T A;  5IT9 Z;  5D4S A;  4CDG A;  3GZ5 A;  4ASN A;  1Z6T A;  1ZAR A;  4OIQ F;  3MZH A;  3L7W A;  4KMU X;  3WTZ A;  4WXC A;  2DW4 A;  2YPR A;  4HZF A;  4TV7 A;  1QPM A;  4P55 A;  3EYI A;  3GVA A;  2IW5 A;  4EGZ A;  4RB3 C;  5IT3 A;  4L5J A;  2W85 A;  4RGU A;  4CYD A;  3WTT C;  1WSU A;  4Y17 A;  1RIO H;  5ICG A;  4EJT A;  2LF7 A;  4KFC A;  1U8R A;  2E7X A;  3HIF A;  4GYG A;  5IT9 K;  5BPI A;  2BGC A;  3TDU C;  3GXO A;  1KYZ A;  4Q5S F;  4YII A;  4Y13 A;  1LJ9 A;  2FEZ A;  3RI4 A;  4HDV A;  2GA1 A;  4IJA A;  2GWR A;  2V1X A;  2K02 A;  3KP3 A;  1BJA A;  2ZNZ A;  5JHU A;  3JTH A;  1W7P A;  2XRO A;  3GWZ A;  3KLN A;  1JHH A;  1HW5 A;  3TGN A;  4ON0 A;  2P7C B;  3F8C A;  2DK8 A;  3I59 A;  4MQV A;  2HZT A;  2PMH A;  5CVR A;  3RKY A;  4G7H F;  2EV6 A;  2H6C A;  5LGT A;  4L18 B;  5HS8 A;  4ESJ A;  1WKM A;  4A0Y A;  5DUI A;  2EFW A;  2MA3 A;  2VE9 A;  3C18 A;  5H6Q A;  4JQF A;  1MD0 A;  3E3V A;  4UUV A;  1FYK A;  3F8B A;  1P6R A;  1AWC A;  4LJZ F;  4EJV A;  3MAJ A;  1OKR A;  5KVR A;  3DP7 A;  5L3D A;  4M9S A;  3N97 A;  1UB9 A;  3KLO A;  5J8C A;  2MD5 A;  4MTD A;  1IN4 A;  1G3Y A;  1R1T A;  1QO0 D;  2DLL A;  1FX7 A;  2IA0 A;  1R36 A;  1JE8 A;  2F5E A;  3F8F A;  3T8T A;  1BBY A;  4OU0 A;  4L0Z B;  2JPC A;  1O57 A;  4ENK A;  4UVA A;  4BQA A;  2YSR A;  4JK1 X;  5DUK A;  2STT A;  3LST A;  1J75 A;  4I02 A;  3ECH A;  1BM9 A;  3IL2 A;  3MEX A;  1IN5 A;  3E6M A;  2K4J A;  2AXL A;  1G3S A;  2K4B A;  2XAF A;  1NHA A;  5BOX A;  2XAQ A;  2MBF A;  3O6B B;  2DK5 A;  4IRH A;  3OV8 A;  3CLO A;  3B02 A;  2CSO A;  2RKH A;  3Q9V A;  2VBZ A;  4EJU A;  2K86 A;  5CVJ A;  3P9I A;  1ZHF A;  3LWF A;  4HV6 A;  1ODD A;  3QP6 A;  2UXN A;  2RC4 A;  5HOO A;  2P8T A;  1KQ9 A;  2FBI A;  5D8L B;  4KDP A;  4M6Y A;  2EV0 A;  3WU1 B;  4EJW A;  4G94 A;  4HX4 A;  2P6T A;  5DCM A;  3HHH A;  4AD9 A;  5J6X A;  1HSJ A;  2AS5 F;  1YW7 A;  3LQR A;  5EEH A;  1ZG1 A;  3HTS B;  2QVO A;  4M6X A;  1ZN2 A;  4QWQ A;  5K5R A;  1MJA A;  1D8J A;  5A2Q K;  4I09 A;  3JSO A;  4IHT A;  1S6L A;  3DV8 A;  1LDK B;  3KP2 A;  3M8E A;  4GGG A;  2F5C A;  4PCQ A;  1XCV A;  1XGM A;  5D8K B;  3J7A O;  4XLN F;  1K79 A;  4MNU A;  3KEQ A;  1G6N A;  1YW8 A;  2XKP A;  2P6S A;  1HKQ A;  3ABU A;  3CUQ B;  3DEU A;  1IXR C;  1H9T A;  2KIU A;  2DO7 A;  4PGG A;  4JBA A;  2HYF A;  1IAW A;  3BJ6 A;  3FM5 A;  2V1U A;  4YFX F;  1IN8 A;  2ZNY A;  2JZY A;  3CUO A;  2PMU A;  3HRU A;  2KKO A;  5L3C A;  1CGP A;  3R0A A;  4LD5 A;  1FP1 D;  3KP4 A;  3MCZ A;  2BYV E;  2A6H F;  3F8M A;  1O3S A;  3F6V A;  2NNN A;  2IVM A;  3TO9 A;  1IXC A;  2D1H A;  3QOP A;  4XSX F;  4HX7 A;  5DEQ A;  3K1M A;  4A5M A;  1FT9 A;  3E5X A;  1XGS A;  2HKO A;  2W24 A;  3GEZ A;  1OR7 A;  3GF2 A;  3G3Z A;  1U2W A;  2CWE A;  3T0Y A;  1GHC A;  3WTX C;  3R6S A;  3BRO A;  1W7P B;  1TLH B;  3WGI A;  2CG4 A;  2FNP A;  2FNA A;  3QU3 A;  1XGO A;  4HQM A;  1W4M A;  1O3Q A;  4IF4 A;  3HUG A;  2EJR A;  4I2O A;  3KZZ A;  4HLX A;  4N9I A;  3ISP A;  2CFX A;  1TNT A;  2A69 F;  3V4G A;  5BPD A;  3VOE A;  3NRV A;  3EYY A;  2HR3 A;  1FPQ A;  2L02 A;  1QGP A;  4WX9 A;  1ZRE A;  1G3T A;  3ECO A;  3LQQ A;  2P4W A;  3I54 A;  3KP7 A;  2R7F A;  4EVI A;  1B59 A;  1T38 A;  5FLX Z;  2OU2 A;  5FO5 A;  1H9G A;  1I1G A;  1BIB A;  1BOA A;  4ENN A;  3RTR A;  1OYI A;  3ZQ7 A;  1FP2 A;  5L3F A;  5ICE A;  1XSV A;  4R1H A;  1P4X A;  3WTS C;  1ON2 A;  4A6D A;  5DYM A;  4NB5 A;  4OMY A;  1K78 A;  2RVC A;  2OZU A;  2F2E A;  4MGR A;  3EUH A;  5E20 A;  5AON A;  4EM1 A;  4BHC A;  1ZLK A;  3PFI A;  2L3D A;  2BV6 A;  3ZN0 A;  3ZMU A;  3Q5F A;  2BE5 F;  1MDM B;  4S05 A;  3ABT A;  1ZRC A;  5FD6 A;  1PP8 F;  3RYP A;  4BYY A;  1ZGJ A;  5LRS A;  1YS6 A;  2GXB A;  4YIF A;  4ZYH A;  2YX7 A;  2FOK A;  3NEU A;  1B9N A;  5L3E A;  2E1C A;  3WGH A;  1I5Z A;  5E1Z B;  2TDX A;  4NHJ A;  4MEX F;  2EFN A;  1F4K A;  4A0Z A;  2GAU A;  2FQ3 A;  1HBX G;  3B73 A;  1G4D A;  5LBQ A;  4ZZL A;  1TQI A;  4P5O A;  4HF1 A;  5FD5 A;  3HOT A;  2PQ8 A;  2KIF A;  4M9Z A;  1Z9C A;  4YFK F;  1KQ8 A;  1BI0 A;  1YS7 A;  2MH2 A;  2A6E F;  2DQL A;  4U0V A;  1J59 A;  2BEO A;  5CVU A;  2G7H A;  3GLX A;  4IVN A;  1MJB A;  1P4A A;  4WF2 A;  1YLF A;  1YQA A;  2QQA A;  3DPT A;  4WCG A;  4PDK A;  2OAZ A;  4OIO F;  1XGN A;  4EGY A;  2V79 A;  4LLL A;  1I6X A;  2FU4 A;  2ZFW A;  1R1U A;  1XMA A;  1T0F A;  3P7N A;  4IRI A;  4WWC A;  2GA2 A;  4XRF A;  3GZ6 A;  3BWG A;  3ELK A;  2ZO4 A;  3JW4 A;  4B8X A;  2GZW A;  2VT3 A;  2ZBK A;  2IP2 A;  3KZY A;  1UCR A;  4S04 A;  1HW2 A;  1REP C;  3AAF A;  4RB2 C;  3COA C;  2WTE A;  4ETS A;  3Q9S A;  2H94 A;  3HRM A;  1Z7U A;  5AIQ A;  3MFK A;  3IRR A;  1ZYR F;  2EB7 A;  4HA8 A;  3HHG A;  4ZH4 F;  2W25 A;  3SHF A;  2EK5 A;  2V9V A;  1KYW A;  4GO1 A;  1KQ0 A;  3LA7 A;  1ON1 A;  1PP7 U;  1JXS A;  2DBB A;  2X0L A;  2VC1 A;  3TO6 A;  4I7H A;  3BDD A;  2M87 A;  4OIN F;  4P9U A;  5JFR A;  4WXD A;  3HRS A;  1P2F A;  4N0B A;  3SZT A;  1K78 B;  1SFE A;  4KN7 X;  3HSF A;  1WWX A;  2LF8 A;  2DI3 A;  1IXS B;  1EH7 A;  2Z5U A;  1SMT A;  3BPV A;  3T1B A;  2WV0 A;  1X3U A;  3FXQ A;  2OBP A;  3CDH A;  4KUM A;  2O6G E;  1MZB A;  3T5X A;  1W7P D;  5HLI A;  5DD8 A;  3CO7 C;  3C3W A;  5HS7 A;  3WE3 A;  2CYY A;  1L3L A;  1O7L A;  2HTJ A;  1WI9 A;  3MZY A;  3ZP5 A;  1XMK A;  1USS A;  2XHK A;  1IN7 A;  3BJA A;  1ZLJ A;  4WXH A;  1YTY A;  2XVC A;  2MLG A;  3L2C A;  2MLK A;  5LEK A;  1B4A A;  2FMY A;  1STZ A;  2PLY A;  3KFW X;  5HDK A;  2HFH A;  3KCC A;  3V7C A;  5K5Q A;  1YIO A;  2O61 A;  1KA8 A;  4HBL A;  1KU3 A;  5ED4 A;  1U6G A;  1TW3 A;  3K69 A;  2J5O A;  1S3J A;  2NAZ A;  3U2R A;  2M1B A;  2JT1 A;  4U88 A;  2KRF A;  1O3T A;  3WOD F;  2A68 F;  3FF5 A;  4P96 A;  2QEN A;  5E1W A;  5HVQ C;  1RUN A;  4CGZ A;  1KGS A;  5LLQ A;  5LRR A;  3D5L A;  4FHT A;  4R8H A;  1ZH5 A;  3TO7 A;  1Y0U A;  3I0T A;  1XB4 A;  1RUO A;  5E1X A;  3ZMZ A;  2FML A;  5FB2 A;  3E6B A;  5BMZ A;  3HTU A;  2O03 A;  3FMS A;  2UWM A;  4HF2 A;  2O3F A;  2GXG A;  3U1D A;  2A61 A;  5K1Y A;  2ISY A;  2DFI A;  2QQ9 A;  2HOE A;  1U5T C;  3M8F A;  3KEO A;  1I1S A;  4L9V A;  5F1R A;  1PDN C;  2J5P A;  3RYR A;  4O3M A;  3J80 K;  1YG2 A;  5D6F A;  2M5W A;  1IN6 A;  2MC3 A;  4L5I A;  4HLY A;  5DDG A;  1CF7 B;  3C7J A;  4L9J A;  3WG9 A;  2ISZ A;  2D1V A;  4A2U A;  3QU6 A;  3LA2 A;  2O0Y A;  2VOD A;  1FWZ A;  2UXX A;  2DPU A;  4UVC A;  4AWX B;  2HS5 A;  4BHB A;  1V4R A;  3ML6 A;  4PGH A;  5D5W B;  4MTE A;  1ZG5 A;  5D4R A;  3RJP A;  2IT0 A;  2OA4 A;  1U78 A;  3I59 B;  1TNS A;  2ETH A;  3EQL F;  2ZME A;  3I53 A;  3R61 A;  3KET A;  2D2W A;  3WU0 A;  2QUF A;  4RAZ A;  4HOB A;  1ULY A;  3TOA A;  4M74 A;  1YFH A;  4G7O F;  3DPL C;  4QLC U;  4A12 A;  2Y0M A;  4ESF A;  4ZYE A;  3K1P A;  1T2K A;  2Z9O A;  5LGU A;  1XCB A;  3RPU A;  3MQ0 A;  4XSZ F;  1XD7 A;  5DV5 A;  4CXF A;  2H6B A;  4A0X A;  2R7D A;  2P5V A;  3I71 A;  4N9H A;  1SMY F;  4LFU A;  1TBX A;  3CUQ C;  1XSX A;  1DUX C;  1Z1D A;  3ZMT A;  4FX0 A;  5ILV A;  2L54 A;  3IWZ A;  4GYI A;  1RNL A;  3IKT A;  2QBY A;  2FA5 A;  4ZZD A;  2M30 A;  4KMF A;  3RPQ A;  2ELH A;  2HDC A;  1OMI A;  3I5U A;  3SZP A;  2ESH A;  3V8L A;  1YYV A;  4BH9 A;  2DU9 A;  1OYW A;  2OQG A;  2YX4 A;  1UHM A;  2A5Y B;  2WWY A;  4UNO A;  4EM0 B;  3QRF F;  6PAX A;  5D5U B;  2XV4 S;  2QBY B;  1QZY A;  3F6O A;  3R0J A;  5E8G A;  4Z2Y A;  2F5F A;  4OOI A;  2GQQ A;  3DQV C;  5DD4 A;  1H0M A;  3F22 A;  5JI6 A;  1ZG3 A;  3WE2 A;  1Z05 A;  3SFZ A;  2VBY A;  2HQN A;  5TJJ A;  1HST A;  4UXN A;  3L00 A;  3NQO A;  4KA4 A;  4EQQ A;  2RN7 A;  3WTU C;  2WC2 A;  2EFO A;  4LG0 B;  2CQK A;  2VBX A;  3CJN A;  4LK0 F;  5DCF A;  1BI1 A;  3H92 A;  2Z3Y A;  3RKX A;  1KU9 A;  4A6E A;  3F8N A;  3IC7 A;  1MKM A;  4HX8 A;  3V8J A;  4HF0 A;  1S29 A;  3GFL A;  1HKS A;  3CUQ A;  3LFK A;  4FT8 A;  3KP6 A;  1R00 A;  5EEG A;  2PBI A;  3HYI A;  1O7F A;  5E8I A;  2HQR A;  4HQE A;  4L9N A;  2PEX A;  4EJO A;  1FNN A;  2O8X A;  2HGC A;  1QBJ A;  4U0Y A;  2RDP A;  2VXZ A;  3EET A;  2XAG A;  4G9Y A;  1KU7 A;  3VB2 A;  2K7L A;  1LDD A;  1T6S A;  2EA2 A;  4M71 A;  4HAM A;  2UZK A;  1HQC A;  2F5D A;  3FWE A;  2NYX A;  5J8F A;  2PN6 A;  4O5V A;  1BI2 A;  2VBW A;  2HKX A;  1B6A A;  2QWW A;  1A04 A;  3RIR A;  2FE3 A;  2EWN A;  3QPH A;  1GXQ A;  4M9X A;  2VOP A;  4LB6 B;  1EH8 A;  1C0W A;  1DPU A;  1ZGA A;  4BAY A;  1SD4 A;  2JPB A;  4Q47 A;  4IPA A;  2PJP A;  4I01 A;  3BP8 A;  5KK1 A;  1OYY A;  4U7B A;  4FX4 A;  5ERI A;  3GFM A;  3KP5 A;  4M72 A;  4H0E A;  5FGM A;  2YR2 A;  3PQJ A;  2BBY A;  4G7Z F;  2FF4 A;  5HLH A;  3FMQ A;  1YO5 C;  2PG4 A;  1MDM A;  3ZMV A;  3FM3 A;  1QNT A;  3KE2 A;  3GFJ A;  2M8E A;  4YG2 F;  3G73 A;  4CHU A;  2ESN A;  1OPC A;  4HV5 A;  5ILU A;  3DKW A;  5LHI A;  2ZCW A;  2KIM A;  4E70 A;  3BY6 A;  2EV5 A;  5ICC A;  3QPT A;  1O3R A;  2G7U A;  4RB1 A;  2ZXJ A;  2FBH A;  2CGP A;  2E7W A;  1XSD A;  1HW1 A;  1QQI A;  1L0O C;  2DQR A;  5LEJ A;  4ENM A;  2XAJ A;  1R22 A;  2HEO A;  2OD5 A;  2ZKZ A;  5F64 A;  4HW0 A;  1LB2 A;  5HLG A;  4HYE A;  3V8K A;  2A3S A;  2LSO A;  2QQB A;  1IUY A;  1SD5 A;  3H3U A;  3DFG A;  2EFQ A;  3RKW A;  2COM A;  3QAH A;  3HRT A;  4KN4 X;  1XDS A;  3D0S A;  3C1D A;  5CVV A;  1PUE E;  2X4H A;  2IRF G;  3ZN1 A;  4IHS A;  3BZ6 A;  3LA3 A;  1LDJ A;  5D5V B;  2QLZ A;  5E17 F;  1LQ1 A;  2Y75 A;  1EH6 A;  4ESB A;  4A5N A;  1E2X A;  3IRQ A;  1GXP A;  1FOK A;  1T39 A;  4L0Y B;  3REO A;  3WGG A;  3V7S A;  3TQN A;  2RQP A;  4BXU A;  2Q0O A;  1VTN C;  3FZV A;  4LB5 A;  5LHG A;  4I0B A;  3TKY A;  1FSH A;  4KT5 C;  3E5U A;  4AIH A;  1K6O A;  4KIF A;  1G3W A;  1AOY A;  3M7G A;  1S7O A;  1B1B A;  2L4M A;  3JTG A;  1S7A A;  4B09 A;  1LEA A;  2DT5 A;  5K5O A;  3R4K A;  2Q8K A;  3U9G A;  1WRJ A;  2R3S A;  3M1E A;  2LNB A;  4I98 B;  4UVB A;  1P92 A;  4PZJ A;  4OIP F;  3K9T A;  1JHF A;  2VON A;  1P4W A;  3ULQ B;  1JGS A;  1XDU A;  4MQ9 F;  4WK8 F;  3CTA A;  3ROU A;  2NNY A;  4BHP A;  5F6F A;  4L9T A;  2NRA C;  2LDU A;  1LVA A;  2Z33 A;  5CYV A;  3HSE A;  2PFB A;  1FLI A;  3F23 A;  3P9K A;  3GW2 A;  2IPQ X;  1HXD A;  1ZRF A;  1IRG A;  3E97 A;  3J80 Z;  2RGV A;  4KYW A;  2OZ6 A;  1Q1H A;  2XUB A;  3EDP A;  2JRT A;  1IRF A;  4CIC A;  1RI7 A;  4CZZ A;  1IF1 A;  1TQP A;  1WQ2 A;  2QZ8 A;  4RAY A;  3QP5 A;  2EA4 A;  3PQK A;  3FX3 A;  2HYG D;  1ONV A;  2A07 F;  2FRH A;  1IW7 F;  2RNJ A;  2ZJ2 A;  5FFX A;  2H09 A;  3E5Q A;  1FZP B;  1KU2 A;  4NQW A;  1QZZ A;  3P9C A;  3E6D A;  5FLX K;  4RGX A;  4U7D A;  3FXR A;  2VT2 A;  3GUD A;  5FFZ A;  1J2X A;  2QYO A;  1MGT A;  3H3Z A;  3J81 Z;  1FSE A;  5DCM B;  1BC7 C;  1T98 A;  1S8N A;  2FSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...