4CICA

T. potens iscr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
138
Chain Sequence
GAMGLKVSTKGHYGVQAMFDLAQHFGEGPVSLKSIAERQGLSEPYLEQLIAVLRKAGLVKSVRGAQGGYILAREPRDIKVGDIIRVLEGSLKFDFSVTKSVWEKVKKSIEEVLDSITLADMLKDAEEAQMAQGYMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, BADM/RRF2 FAMILY
publication title The Unique Regulation of Iron-Sulfur Cluster Biogenesis in a Gram-Positive Bacterium.
pubmed doi rcsb
source organism Thermincola potens
molecule tags Transcription
total genus 43
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cicA00
1TW2A 2HZTA 1SD6A 4QLCU 4KMUX 3G3ZA 3R61A 1T98A 3ZMDA 2G9WA 1SAXA 3U9GA 4P96A 2DW4A 4FX0A 2W25A 2F2EA 1OPCA 2XIGA 3QPHA 3R0JA 4KNYA 1ZG3A 4KFCA 5L3EA 1W7PA 2ESNA 3F8NA 2V1UA 1F4KA 1IN6A 5L3FA 2CWEA 3L7WA 3V8KA 4UVBA 1J2XA 3TQNA 3C1DA 4N9HA 3E6MA 4LG0B 1KU7A 5CVVA 4D0PA 2YPRA 1S3JA 4I02A 2K4BA 2EFOA 1CGPA 2Q0OA 1P4AA 3EDPA 5CVRA 3GVAA 2C6YA 4AIKA 1XN7A 2VBYA 3SZTA 2V1DA 1B1BA 1FNNA 4U88A 2QBYB 3G73A 5K1YA 1SMYF 2RV8A 2L4AA 1J75A 4HW0A 4KDPA 1VTNC 2ZMEB 2F5FA 1LDJA 2M45A 4ZYEA 3M1EA 3TOAA 4ZYDA 2X4HA 2OBPA 4M72A 1MJAA 2HTJA 2PJPA 5IT9Z 4OMZA 4A5MA 2CYYA 3TOBA 1XB4A 2Y48A 4G7ZF 3IWZA 2ISYA 2A07F 1ZRDA 1QZYA 3HRMA 4N9IA 5IT9K 3LA7A 3LFKA 3BZ6A 3TDZC 2W24A 1Z1DA 3I58A 2BEOA 4NB5A 4MTDA 1PDNC 3FMSA 1ZREA 3ISPA 4CO8A 1S7OA 5ICEA 1EH6A 3F8BA 5H6RA 3GFIA 2RC4A 3DPTA 3R6SA 1V3FA 1QBJA 3WTVC 3VB2A 4BYYA 1HBXG 1DPUA 5DD4A 4HF1A 1T2KA 3FM5A 2MD5A 1U6GA 4Y13A 2QQAA 4LK1F 1OYWA 1RIOH 2MBFA 2LSOA 3EYIA 3C18A 1MJBA 4A0ZA 3KE2A 3HYIA 3HTSB 3KLOA 5E17F 5D6FA 3CLOA 4MEXF 1HSJA 2XAFA 1XSXA 4UXNA 1QO0D 2EA4A 1YYVA 4MEYF 4RGRA 1Z7UA 4IRHA 2KRFA 1ZGAA 3VFZA 3DPLC 1MD0A 3EUHA 3QPTA 3CDHA 1RZ4A 3FZVA 4IRIA 2HFHA 4P9UA 1WWXA 2A68F 4M9SA 1BIAA 1UB9A 3CUQC 3QOPA 4OOIA 2VBZA 4A2UA 1WSUA 3PFIA 4U7BA 3HRUA 5LHGA 4BNCA 3SFZA 1RUOA 5H6QA 2R7FA 4KUMA 2J5PA 5HOOA 3WTZA 3JW4A 2XASA 2YSRA 5D6EA 5ILSA 2ZXJA 3P9IA 3TGNA 4OIRF 5IT3A 4LJZF 2HS5A 3NQOA 3P9KA 1J9IA 4ZH4F 5LGTA 5AIPA 1HW2A 1BIBA 2OU2A 1RI7A 2ELHA 1LDDA 3E97A 1KQ0A 2O8XA 1FOKA 1X3UA 5E8IA 3HTUA 1O7FA 2WC2A 3W6JB 5BQTA 2MH9A 1R5GA 4LLLA 5BS6A 1K78A 1R7JA 2L3DA 2LDUA 1Z6TA 2XAHA 3CUQA 4RB2C 2NYXA 3OV8A 2J5OA 3BOQA 4UV8A 2H6CA 1FLIA 1O7LA 5FFXA 2AXLA 2DQRA 1ODDA 1FYKA 1KA8A 2NRAC 3N4MA 2CW0F 4G94A 4XSXF 1D3YA 2XV4S 4FX4A 4WXCA 3E5QA 2P8TA 2QLZA 4ZYHA 4EM0B 2RKHA 4HV5A 3GYHX 4ETSA 4L9JA 5LEJA 4L0ZB 4IHSA 3HSRA 1IXRC 1SD4A 4M6YA 3GWZA 1O3RA 5JR3A 2WWYA 1XGOA 3DXJF 2EFPA 2VE8A 2Y75A 4YFKF 5ICCA 2E1CA 2QENA 1OKRA 2EWNA 3K0LA 4G6QA 4A6EA 2P7VB 2V6CA 1Y0UA 4OIOF 2XHKA 4R79A 4CICA 3WODF 5LHIA 1KU2A 3J80Z 3RKYA 2FBKA 3HOSA 2FXAA 4ESBA 2M30A 2D45A 1R58A 2R7DA 4KN4X 4M9XA 2F5CA 1KQ9A 5FD6A 1OYIA 1XCVA 3K9TA 1LNWA 1FBQA 5KK1A 1I27A 2ZCWA 1FBUA 2XRNA 5DCMB 2H94A 5BPDA 3DV8A 1K6OA 5CLSA 3B73A 5FFZA 4M6XA 1IZ1A 3T5XA 2ZFWA 4HX8A 3L00A 5L3BA 2HKXA 2FMLA 4RGUA 1U2WA 3DP7A 1TQPA 3NRVA 3RJPA 1J59A 4EQQA 1CF7B 3WGGA 1F1ZA 1U5TB 1ZH5A 1IN7A 3I0TA 1MZBA 5LLQA 3ZMUA 1O3QA 3M8EA 3BY6A 3MCZA 1OYYA 3QP5A 1TNSA 4KIFA 4AD9A 4RB3C 3LQQA 5E1WA 3E6BA 1BI2A 4G7HF 3SXYA 2A6EF 3ZN1A 4EM2A 2DI3A 1NHAA 1KYZA 2ZJ2A 3VODA 1G3TA 3QP6A 4WWCA 2LKPA 5DYMA 4EVIA 4IF4A 4LD5A 2L02A 5ILUA 2A61A 3M9AA 3GF2A 4KYWA 5D4RA 2FNPA 3GFMA 3ULQB 4A5NA 4WF2A 3ELKA 5E20A 5HLIA 2A5YB 5E8GA 5HLGA 1USSA 3ZMTA 1LVAA 6PAXA 2NNYA 1OR7A 4KT5C 4CZZA 1IRGA 2KIFA 4YFXF 3KP2A 3ZMVA 2JT1A 2A6HF 5DV5A 2OAZA 2FE3A 2MA3A 2DPUA 4IHTA 1DP7P 2P6TA 3QU6A 4I09A 3C7JA 2CSOA 2DFIA 2PEXA 5DDGA 3IRRA 4ENKA 3D0SA 2GXBA 2P7CB 1TTYA 1ZHFA 2V9VA 1J7KA 1RUNA 3F6OA 4MQVA 4ENMA 2MC3A 1JHFA 3E5XA 3FM3A 1U5TC 1HSTA 3TDUC 5D8KB 4ESJA 3WTYC 4HA8A 2K7LA 4UV9A 1KU9A 2DAOA 3FMRA 3LSTA 4JK1X 2UWMA 1K7AA 5DD8A 3MZYA 5DUIA 2RNJA 1LQ1A 3PQKA 1FP1D 2Y0MA 1XGMA 1G3WA 2PMHA 3GZ6A 1PP8F 3F22A 1ZLJA 3RIRA 4GYIA 4OMYA 1GHCA 3GEZA 2VONA 2PFBA 3J81K 1D8JA 2KIMA 2FEZA 4ZZLA 1SFEA 1MJ9A 3Q5FA 4HOBA 4AIJA 1YW8A 4P5OA 3RPQA 5CJ9A 4U7DA 4ZZDA 2XUBA 4EGZA 3BJ6A 4U0WA 5HS7A 1XSVA 3H92A 2JRTA 2VOOA 1GXQA 1JHHA 3ZMSA 2H27A 2HDCA 3IKTA 1Z6RA 1BI0A 1JGSA 3CO6C 4N0BA 2P5VA 5HDGA 4EM1A 4BQAA 1YLFA 3N97A 2QYOA 5CVJA 3WGHA 5E1XA 4ZYGA 1S7AA 3GUDA 2VOPA 5F64A 5J8CA 4KA4A 3T8TA 4IVNA 4Q47A 4RGSA 3BPXA 3ROUA 2BV6A 4M9ZA 4EJTA 3RTRA 1O3SA 2DU9A 1MDMB 3LWFA 1R5HA 4S05A 1WQ2A 1E2XA 1SD7A 1FT9A 3O6BB 3ZPLA 4L5IA 5JVTA 2Z33A 1TBXA 4KIGA 4G7OF 1ON2A 3RYPA 4HF0A 3I4PA 4PGHA 2L54A 4HV6A 3F3XA 4GO1A 3WE3A 3F72A 4EJOA 4HF2A 4Q5SF 4OINF 5F6FA 2HKOA 1QGPA 1F5TA 4LB6B 1TW3A 2M8EA 1J5YA 1ZARA 3TO9A 3WTSC 4LK0F 4EMSA 2CO5A 2A69F 2VT3A 1XMKA 1FSHA 1PP7U 4BAYA 2JSCA 4IXAA 2VODA 3Q9SA 1R36A 2CFXA 3IC7A 2VE9A 3JSPA 2CQKA 4CGZA 3KCCA 2OQGA 3ZMZA 3BWGA 5ERIA 3RI4A 1AOYA 4LFUA 4HQMA 1O3TA 2D2WA 4L18B 3DKWA 3DEUA 3M7GA 3R0AA 2VC1A 4WXDA 4CDGA 3RYRA 3V7CA 5L3CA 2O0YA 5BPIA 2IVMA 1Z05A 3KP6A 3BDDA 2ZNZA 2DBBA 2DT5A 3L09A 1HKQA 1FX7A 2HQRA 4WX9A 4M74A 1T0FA 3W6KB 4FHTA 4NHJA 2PQ8A 1IXCA 4ESFA 2FU4A 3KLNA 2HEOA 2Z99A 2QBYA 1AWCA 2RDPA 4RB0A 3P9CA 1UCRA 1PUEE 2ZMEA 2ACJA 4GXOA 5FO5A 1FC3A 5LRSA 2MLKA 3F8FA 4U0VA 1SMTA 1HW1A 2WTEA 1JE8A 3I59B 4M73A 4AIHA 1W4MA 4YFNF 1XGNA 4EJVA 4S04A 4L9VA 4HX4A 4B8XA 4B09A 3LAPA 1WI9A 1XMAA 4G6DA 4LLNA 2QQBA 5TRDA 2PG4A 1GVJA 2QM3A 4A12A 4PCQA 1TQIA 3IHUA 3ERED 3IRQA 2FQ3A 4BHBA 3D5LA 2UZKA 1J0RA 1YW9A 3J7AO 2Z9OA 3FXQA 1W7PB 2ZNYA 3T1BA 4L9TA 2D1HA 3F21A 5DUKA 1ULYA 3P7NA 3FXUA 2COMA 1BC7C 4RGXA 2ETHA 2DQLA 2L01A 4YIIA 5HDNA 2XAGA 3U1DA 1DPRA 2IT0A 2GIVA 1K79A 5LGNA 4BHCA 4H0EA 3GW2A 4KIBA 5K5OA 1W7PD 2QZ8A 3M8FA 1HW5A 2EFQA 4XSZF 2KKOA 3MEXA 5A2QZ 2ZKZA 1D8KA 3GO5A 4L5JA 4RB1A 1YQAA 5DCFA 4MHGA 1DUXC 3E5UA 3FMQA 2B0LA 1S8NA 4RAYA 4FT8A 5AONA 2HGCA 5F1RA 2NS0A 5CYVA 3O3KA 2HWVA 5A2QK 4HDUA 1SFXA 3BJOA 5LBQA 5AIQA 3GFJA 3WTTC 3ECOA 2CGPA 1EV7A 1FWZA 1T6SA 3K69A 1ZG5A 3CJNA 3WTXC 4A6DA 1FY7A 1LEAA 3JAMZ 5LHHA 2JPBA 4KICA 4O6JA 4LGWA 5H20A 4BXUA 4EJUA 1P2FA 3KP7A 1R1VA 5DEQA 4YIFA 1R1TA 2VBXA 3FWEA 2IP2A 3WTWC 1KQ8A 4JQFA 2FSWA 1UFMA 3HOTA 3JAMK 4F7ZA 1XDUA 2VT2A 3H3ZA 5K5QA 1HXDA 2PBIA 3MQ0A 1RNLA 5LGUA 1U8RA 3Q9VA 1QPMA 1B59A 1YS7A 1HKTA 1QZZA 4ENNA 5L3GA 4HDVA 2UXXA 2OD5A 1E17A 2PMUA 1I5ZA 2G7UA 2FMYA 1BJAA 1KGSA 2EV0A 4HLYA 5E18F 4YG2F 4OU0A 1Z9CA 4QWQA 1BI1A 1FP2A 2KIUA 3GFLA 2HOEA 1B4AA 3QRFF 4BH9A 2ZBKA 3F6VA 4I0AA 4Y15A 1QQIA 1IRFA 1REPC 2YR2A 3JTHA 2IPQX 2O6GE 3BPVA 3KETA 3QAHA 4KN7X 1HKSA 3I64A 2AS5F 4AWXB 1YIOA 3EETA 4RAZA 1TLHB 2QQ9A 3FF5A 1YW7A 3HRTA 4P55A 2RVCA 1UHMA 4DQ2A 4PZJA 1G3YA 2M87A 1MGTA 3FHZA 2GA1A 5BOXA 3KEOA 1EH8A 3JSOA 4MNUA 4L9NA 5E1ZB 1B9MA 3U2RA 5HS9A 1IXSB 3J81Z 3GX4X 2WV0A 2YX7A 3ECHA 2L4MA 2OQRA 4IJAA 4KMFA 1D5VA 5J8FA 4LB5A 3I53A 2Z3YA 2FNAA 2GXGA 4WCGA 2GWRA 3HHGA 2LF8A 2NNNA 2UXNA 1S6LA 5DCMA 1XGSA 4ON0A 2Q2EA 1T39A 3ZQ7A 3I54A 5D4SA 3KZZA 3F23A 1HQCA 2RGVA 3E6DA 4CYDA 2QVOA 1BOAA 2X0LA 4IRGA 4G9YA 1H9TA 2D1VA 5EEGA 2HYFA 5JHUA 3R4KA 1EH7A 1SD5A 1K78B 2YX4A 2H09A 1CF7A 1ZLKA 4XLNF 2DO7A 2GAUA 3CUQB 1U5TA 2RN7A 2VN2A 4I0BA 2W85A 1H0MA 3WU1B 1USTA 1WKMA 2MLGA 2R3SA 3KP5A 2ISZA 3LAJA 1FPQA 1ZGJA 1WRJA 1BM9A 1W5TA 2Z5UA 2EV6A 4ASNA 1L3LA 5ICGA 3TKYA 2P6SA 1Q1HA 1H9GA 2E7WA 3HSEA 1LDKB 5J6XA 1G4DA 2EV5A 2CG4A 2DTRA 4BHPA 1ZN2A 2JZYA 3RPUA 1XCBA 4G8XA 4UVAA 2Q8KA 2OA4A 4HX7A 3L2CA 2M5WA 3DFGA 1TQMA 3GXOA 3RDIA 5FLXZ 1ZRCA 3WU0A 1IN4A 1G6NA 2DK8A 2NAZA 2M1BA 3WGIA 3LA2A 4NQWA 3COAC 2JPCA 1ZG1A 4HQEA 5FLXK 1BN5A 3SHFA 1F9NA 5D5UB 4A0YA 2DLLA 1TNTA 2GA2A 2IJLA 1P6RA 1YTYA 3KP3A 1FZPB 1P92A 1P4XA 5L3DA 3V7SA 1IF1A 1IAWA 2HQNA 3K1PA 1V4RA 3PQJA 3MZHA 5TJJA 3V4GA 4MTEA 4CHUA 1YG2A 5K5RA 4MGRA 1OMIA 3O2PE 2IW5A 2EJRA 3LA3A 1ZYRF 2LF7A 3SQNA 1Z91A 2PI0A 3TO6A 4LG0A 3ZN0A 3GZ5A 2ESHA 2BYVE 1SFUA 1A04A 3FX3A 2EFWA 4K2EA 4Q4ZF 3K1MA 1ZAOA 4HAMA 2XAJA 2EK5A 4EJWA 1B6AA 1YS6A 2O3FA 5CVIA 2P5LC 4EGYA 2LNBA 4M71A 2FBIA 1R00A 1ON1A 2DPDA 5KVRA 3NEUA 4A0XA 5BMZA 3FXRA 3ABUA 3ZP5A 1ONVA 1R22A 2PN6A 4XRFA 2QWWA 2F5DA 1BC8C 2VC0A 1R1UA 1XDSA 4Q48A 3I5UA 1LB2A 2P4WA 3V7RA 3K2ZA 4HLXA 3HHHA 2K86A 1U3EM 2EFNA 2E1NA 3RKWA 5D5XB 4ENJA 1R23A 2BBYA 2A3SA 3IL2A 2GZWA 3EQLF 2VXZA 3KP4A 2BGCA 3WTUC 5FB2A 1O57A 3C3WA 4L0YB 2FA5A 1FYLA 3HUGA 1LJ9A 3TO7A 1YO5C 4IPAA 1DDNA 5FGMA 4Z2YA 2STTA 1FYMA 2FOKA 2XROA 4XLPF 5HVQC 2G7HA 3F8CA 1UHWA 4HZFA 1W5SA 1MKMA 3HSFA 2EA2A 2YU3A 1G3SA 2JTVA 3E3VA 2K27A 1I1GA 4CXFA 1P4WA 4I01A 2IA2A 5JI6A 3F8MA 3V8LA 5HS8A 2HYGD 1QNTA 1MDMA 4OIPF 4EV0A 5ICFA 3IKVA 4UHTA 1BI3A 2V79A 1IUYA 4XBFA 3LQRA 1LEBA 4LMYA 3MFKA 3E6CC 2XAQA 2MH2A 4AVPA 4U0YA 2V1XA 1JXSA 2E7XA 4R8HA 2FBHA 2OZUA 4O5VA 2KJBA 4I7HA 3ABTA 2FF4A 4UVCA 1I1SA 5LRRA 2RQPA 2ADUA 1IN5A 2P5KA 2HR3A 2DK5A 1IW7F 5HDKA 3VOEA 3MWMA 4I98B 3T0YA 2TDXA 2F5EA 3CO7C 3J80K 3H3UA 1FSEA 4PDKA 2W57A 5EEHA 3R60A 2OZ6A 5CVUA 3GLXA 3BJAA 2VBWA 5D8LB 4E70A 3CUOA 5HLHA 3REOA 2KJCA 5D5VB 2O61A 5ILVA 1GXPA 2IRFG 2O03A 4MQ9F 4UUVA 4I2OA 4PGGA 3KFWX 4GCVA 3I71A 2W84A 2GQQA 4Y17A 2XGXA 1STZA 3K1NA 4LLGF 5LEKA 4GGGA 3L9FA 1IN8A 1KYWA 1KU3A 2XKPA 2FRHA 4P9FA 3IWFA 5D5WB 1FBSA 3EYYA 1L0OC 4O3MA 3DF8A 2H6BA 2K4JA 3OOPA 2PLYA 1U78A 3HIFA 3V8JA 1C0WA 4DNCA 4TV7A 3KEQA 3QU3A 2EB7A 2BE5F 3JTGA 2QUFA 1BBYA 3WG9A 3DQVC 2K02A 1T38A 1B9NA 4UNOA 4RS8A 3ML6A 3WE2A 2STWA 4HBLA 2XVCA 3MAJA 2XKOA 4HYEA 4WK8F 2IA0A 4OIQF 1ZRFA 4GYGA 2ZO4A 2HTSA 1XD7A 1XSDA 1YFHA 5FD5A 3BROA 3BP8A 2IA1A 3AAFA 3I59A 5JFRA 3B02A 3CTAA 4R1HA 3VEPA 3SZPA 3S2WA 3RKXA 3T8RA 4WXHA 1S29A 4JBAA 5ED4A 1I6XA 3KZYA 3HRSA
chains in the Genus database with same CATH superfamily
1MMGA 1TW2A 2HZTA 2OUMA 1SAUA 1SD6A 4QLCU 4KMUX 3BTLA 3G3ZA 1X3WB 3BR0A 3S32A 2WV1A 3CD6I 1EJ9A 3R61A 1K6YA 1T98A 3ZMDA 4BQOA 1OJLA 1WJDA 2G9WA 2IGOA 1MBEA 5CQGA 1JTXA 1SAXA 3U9GA 3CDLA 4P96A 3K4JA 2DOEA 2DW4A 1UG2A 4FX0A 2W25A 2F2EA 4XKCA 1OPCA 2XIGA 3M8JA 2XB0X 5F0CA 3CCLI 1ZR4A 2H1KA 4DOZA 3QPHA 3R0JA 3OYGA 2HYJA 5TGTA 4KNYA 1ZG3A 1NG6A 5L3EA 4KFCA 5C4JJ 2E5NA 5GTHC 1W7PA 3EUKL 4A3BJ 2R7RA 2ESNA 1S7EA 2LK2A 3F8NA 3PO2J 2V1UA 1F4KA 1LFUP 5DM6F 1IN6A 5L3FA 2HI3A 3S16J 3CP8A 2CWEA 3L7WA 3V8KA 4UVBA 2HQAA 1J2XA 2ZFUA 2R7WA 3TQNA 1UG0A 2XPVA 1IUFA 1RESA 4LG3A 3C1DA 2LD5A 4N9HA 3E6MA 4J01A 4LG0B 1KU7A 4XKVA 3KYLA 5CVVA 2ME0A 4D0PA 2YPRA 1S3JA 3RZOJ 1UHSA 4I02A 2K4BA 2EFOA 2DDBA 2DA3A 1MBHA 1UZCA 2XF6A 3U21A 2Y9YA 4IQ4A 5KAFC 1CGPA 1IG7A 2R5ZA 2R92J 4X6AJ 2V9KA 2Q0OA 4JX5A 1P4AA 3AKZA 3CCJI 2XDVA 3EDPA 2CV2A 5CVRA 3GZNB 1GV5A 3GVAA 2M4GA 2FUG2 2FX0A 1GT0C 2C6YA 2XGEA 2QSFX 4AIKA 3UKGA 1XN7A 2VBYA 2KT0A 3SZTA 1VQKI 2V1DA 2E1MC 2M8GX 4PFPA 1OCTC 3HDDA 1B1BA 1Z67A 2R7VA 1FNNA 4U88A 2QBYB 3G73A 1S72I 5K1YA 3K6GA 3A4CA 1W36D 1F36A 1SMYF 4BDYA 1Z21A 2RV8A 2L4AA 1J75A 4RA2A 4AIDA 4JX6A 4HW0A 4KDPA 1VTNC 2LC2A 5EJCA 2ZMEB 2F5FA 1LDJA 2LY1A 2M45A 3M07A 4ZYEA 3M1EA 3KEYA 3TOAA 4ZYDA 3JRCA 2JA8J 2IEKA 2X4HA 2OBPA 2Y69H 2CW8A 2JUCA 1H89C 4M72A 1EKEA 4FE7A 5F0HA 1MJAA 2HTJA 3OYAA 2PJPA 5IT9Z 3O8HA 4OMZA 4A5MA 5HNHA 3TW7A 2CYYA 3TOBA 4BS9A 1XB4A 3TBIA 4XRSG 2Y48A 4C30A 4G7ZF 3IWZA 3IUOA 2ISYA 2Z1DA 3G1LA 1JTYA 4CSWA 1D0ZA 2A07F 3CF5F 4HNVA 5F08A 1ZRDA 1QZYA 3HRMA 4I76A 2VJ4A 3SDBA 4N9IA 1OCRH 2MC4A 5FRNA 5IT9K 2K85A 4B3XA 2DT7B 1LKXA 4AU7A 1MMNA 3LA7A 1R6RA 3EUHC 3VYUB 3QQAA 2JJ7A 3LFKA 4DIQA 4BEHA 2VIXA 2HPIA 3BZ6A 3QPLA 4XLCA 3TDZC 2MGQA 2W24A 2ZSHB 1Z1DA 2EZIA 3OL4A 3I58A 3L1PA 2BEOA 4NB5A 2DOFA 2VJJA 1TWFJ 1T33A 2A6TA 4XLAA 4MTDA 2AQEA 2E35A 1PDNC 1QHHD 3W3CA 1KONA 1I6HJ 3FMSA 4B3AA 1ZREA 3A01A 1D1CA 3ISPA 4CO8A 1S7OA 5ICEA 2B7EA 3S3NA 1EH6A 3LSHA 3F8BA 2WBMA 5GPAA 5H6RA 1XS9A 2WAFA 4M3EA 4LIVA 3GFIA 2QA4I 2RC4A 3DPTA 3R6SA 3HGYA 1V3FA 1WH5A 1QBJA 2RAEA 1QPIA 3NWSA 2QKMB 2LKSA 4Y52J 3WTVC 3VB2A 4BYYA 1HBXG 1DPUA 5DD4A 4HF1A 1T2KA 2CQ7A 3FM5A 2CW7A 2MD5A 4BE1A 4A3MJ 3QWLA 1U6GA 4PJMA 4Y13A 2K9NA 1TWGJ 2KMUA 2QQAA 4LK1F 2O5RA 4QPQA 1BR1A 1OYWA 1RIOH 2MBFA 5IYDJ 2X6OA 2DA4A 2LSOA 3EYIA 3C18A 3GTOJ 3B6CA 1HF0A 3S3OA 1XTAA 1R9TJ 1MJBA 1X1PA 4LITA 4A0ZA 3KE2A 4DW6A 2LOOA 1IGNA 9ANTA 1YE9A 3HYIA 3HTSB 1BJZA 3KLOA 5E17F 5D6FA 3CLOA 3S1MJ 2HU9A 4MEXF 1HSJA 1OCOH 4B48A 2XAFA 3PIOF 2R5YB 1XSXA 4UXNA 1QO0D 2CMPA 1YYVA 2EA4A 4MEYF 4RGRA 1Z7UA 2E36A 2KP6A 2LTPA 4IRHA 2QSHX 2QKLB 1WGXA 2KRFA 1ZGAA 5FKMA 3VFZA 3DPLC 1MD0A 4YELA 3EUHA 3ZRGA 3QPTA 3CDHA 1D0YA 1RZ4A 3FZVA 4IRIA 2HFHA 3HC7A 2WAQN 3X2QH 4DYQA 4P9UA 1WWXA 2A68F 4M9SA 1BIAA 1NTCA 1UB9A 3CUQC 3QOPA 5K7FA 2DYRH 5J1RA 5HNFA 4OOIA 2VBZA 3PUBA 4A2UA 3V42A 1N75A 1WSUA 2JMWA 3PFIA 4U7BA 2VUMJ 3KYDB 3OYIA 3HRUA 4DYRA 5LHGA 3OSGA 4BNCA 3CMMA 3SFZA 3PNVA 1RUOA 4B4CA 2OPTA 3BR6A 2DN0A 3B6AA 2KFDA 4MLOA 1T95A 5H6QA 2R7FA 3CC4I 3KYCB 4KUMA 1R49A 2X6XA 2L9VA 1TT0A 2J5PA 5HOOA 2JA6J 3WTZA 3JW4A 2BY2A 2OTLI 2RREA 1MMDA 3HKZA 2XASA 2YSRA 5D6EA 2EIKH 2F4MB 5ILSA 4AVZA 2JA7J 2NVQJ 2ZXJA 3P9IA 3TGNA 1V54H 4OIRF 5IT3A 4Y33A 3RCOA 4LJZF 2ZJQF 2HS5A 3NQOA 3P9KA 4OAZA 1J9IA 4ZH4F 2DA2A 3D1NI 4BJTA 5FKLA 4Z6YA 5AIPA 5LGTA 3L2UA 1H88C 1HW2A 1I3AA 3JRFA 1BIBA 1YRNA 1Y6IA 2XGDA 2NVYJ 2DODA 1RI7A 2OU2A 2HOAA 2ELHA 2EIJH 2XB5A 4YIRX 1LDDA 3E97A 2KL4A 4E7HA 2R7ZJ 1MBGA 1X2MA 4XKWA 1MNEA 1IO2A 1KQ0A 2AHQA 4D7MA 1TC3C 2O8XA 1FOKA 1X3UA 4IOCF 2DCEA 2ZXHA 3JRIA 1JUMA 5E8IA 2AXTC 4GFBA 3HTUA 1O7FA 2WC2A 3W6JB 4UUSA 4UB6C 5BQTA 1G59A 2MH9A 1XG1A 3ERMA 3MKZA 3PNYA 3SEQA 3NWTA 1R5GA 2FOWA 4LLLA 2DA6A 5BS6A 3BCAA 1K78A 1R7JA 2L3DA 2E71A 4E6KG 2LDUA 5EGOA 1Z6TA 2XAHA 1YJNI 3HOYJ 1G8XA 2F48A 3CUQA 5GAGJ 4RB2C 1R4MB 2NYXA 3CJTB 3OV8A 2R7QA 1B8IA 2J5OA 2KZGA 3BOQA 4UV8A 2BOLA 2H6CA 1FLIA 1O7LA 1TT5B 3PL8A 5FFXA 1MSEC 2AXLA 2DQRA 1Z0XA 1U9OA 1ODDA 4BACA 1FYKA 3TP0A 3BG3A 5TISC 1KA8A 2DMQA 5IOYA 3ZCOA 1YI2I 3N4MA 2NRAC 3C2BA 3G2BA 1YHQI 4AYBA 2CW0F 4G94A 4XSXF 2ZJPF 4PSWA 1D3YA 2XV4S 4WXCA 4FX4A 3E5QA 4C2UA 2MG4A 3HBLA 3ABKH 2P8TA 2W00A 2QLZA 4ZYHA 2HOSA 1EA3A 4EM0B 2RKHA 1JUPA 4HV5A 3GYHX 2Y31A 4ETSA 4L9JA 5LEJA 4L0ZB 4IHSA 4IHYA 2BVLA 2ECCA 3HSRA 4PJ0C 1X2NA 3KIOA 1OQYA 5EEAA 1IXRC 1SD4A 1A6IA 4M3BA 3S1QJ 4M6YA 3GWZA 1O3RA 5JR3A 5IP6A 2LP0A 2WWYA 1LE8A 4XMYA 1XGOA 2LY9A 3HJEA 3DXJF 2ME6A 2EFPA 2VE8A 2Y75A 4YFKF 4D1QA 5ICCA 2E1CA 1BA5A 2QENA 3OOUA 1OKRA 2EWNA 3K0LA 3K70D 3MKLA 4G6QA 2DA7A 3HXLA 3FXJA 4A6EA 5CQEA 2P7VB 2V6CA 1Y0UA 4OIOF 2XHKA 3TMOA 4R79A 3W2WA 2VKEA 3CCEI 1JJ8C 1YIJI 4PSXA 5J40A 3WODF 4CICA 2DOAA 4BGDA 5LHIA 4BKXA 1KU2A 3J80Z 2VB6A 3RKYA 2FBKA 3HOSA 2CV1A 3HOVJ 3HM5A 1I3QJ 3ZOBA 2FXAA 3FISA 1ETYA 5J1YA 4ESBA 2GOXB 2M30A 2D45A 1R58A 3HGGA 1R5ID 2R7DA 3FXKA 4KN4X 4M9XA 2F5CA 2WY7Q 2QSGX 1KQ9A 2LMDA 4XRSA 1OYIA 1SVLA 5FD6A 2VJIA 3WHBA 2L7ZA 1XCVA 1P7IA 2R5ZB 3K9TA 3SJMA 1LNWA 4BY1J 1FBQA 5KK1A 1I27A 4LOCA 2ZCWA 1FBUA 1A36A 2XRNA 3HOWJ 5DCMB 2EZKA 5GPCA 5IYCJ 3O8GA 2H94A 5BPDA 1I50J 2Q2EB 3I55I 3DV8A 1K6OA 5CLSA 3AL0B 3B73A 5FFZA 3H5NA 3DBRB 5H2FC 2ZC2A 1Z3XA 4M6XA 1IZ1A 3T5XA 2EH3A 4M3FA 2ZFWA 4HX8A 3L00A 5L3BA 2HKXA 1AKHB 2FMLA 3BR1A 4RGUA 1U2WA 3DP7A 1TQPA 3NRVA 5J1UA 2X9DA 3RJPA 3FKJA 1J59A 4EQQA 3HZJA 4NNJA 2Y9ZA 1AU7A 1CF7B 2DJNA 4B1RA 2Z2SB 1U0JA 3BZCA 3WGGA 3RKQA 1F1ZA 1U5TB 1ZH5A 2XAUA 2Y0SN 1WCMJ 5M5YJ 4JOMA 1IN7A 1X3ZB 1X58A 3LFUA 2XSJC 3I0TA 4E4HA 3IH2A 1MZBA 5LLQA 3ZMUA 1O3QA 3M8EA 3BY6A 3MCZA 1OYYA 2IS4A 2KISA 3QP5A 3ZQQA 1TNSA 2V1NA 2X6WA 4KIFA 4AD9A 5EF6A 4RB3C 3LQQA 5E1WA 4BY7J 2AO9A 2M4KA 4XOPA 3E6BA 3ZGKA 2ELKA 1BI2A 2JSPA 3BC8A 3SXYA 4G7HF 2DMPA 4CUGA 1ETXA 3RQ4A 2A6EF 3ZN1A 4EM2A 4KISA 3HOZJ 2X51A 2DI3A 4A3JJ 1NHAA 1KYZA 1OCZH 3ZQHA 2ZJ2A 3VODA 2B63J 1ETKA 2CV0A 4G6TB 1G3TA 3QP6A 4YEJA 4WWCA 4M6VA 1Z77A 2LKPA 5DYMA 1A35A 4EVIA 4A69C 1ZELA 3K4MA 5B1BH 1FJLA 4IF4A 3A01B 4LD5A 2L02A 3OIPA 1V5GA 2L9RA 4CZCA 1VQNI 3G6EI 5M5WJ 1K83J 1BL0A 5ILUA 2A61A 2W4SA 3M9AA 3GF2A 4KYWA 2WB1N 2FNPA 3CDIA 5D4RA 5IP7J 3GFMA 4HSTA 3ULQB 4II2A 4AC0A 4A5NA 4WF2A 4RAGA 3ELKA 4C3IJ 4PK4A 1RKTA 2W1OA 2FD5A 5E20A 5HLIA 5EG0A 2A5YB 2L7MP 5E8GA 3CCVI 2XSDC 1D1BA 5HLGA 1USSA 4IO9F 3ZMTA 3RPUD 3JRHA 1LVAA 6PAXA 3AG3H 2NNYA 1VQ7I 1OR7A 4KT5C 4CZZA 1DU0A 2KIFA 4NQWB 1IRGA 4YFXF 3FKIJ 3KP2A 5C4XJ 3ZMVA 2JT1A 2EQRA 3CCYA 2A6HF 2V7FA 5DV5A 2OAZA 2FE3A 2QEXI 2MA3A 2DPUA 1JT6A 3AL0C 1QHGA 4IHTA 4NDLA 1DP7P 2P6TA 3QU6A 5GAEJ 2JRMA 4I09A 3C7JA 2CUZA 3TEDA 2CSOA 2DFIA 2PEXA 2DA5A 5DDGA 1PVEA 3OS0A 3IRRA 3IV5A 4ENKA 3D0SA 2GXBA 4J00A 5JLWA 2ICWG 2HDDA 2P7CB 1TTYA 1ZHFA 3WG7H 2V9VA 1J7KA 3DLLF 1RUNA 3BG7A 2M34A 4P1WA 3F6OA 4FTHA 3K4LA 4MQVA 4XONA 4ENMA 2MC3A 4QIWN 1VNDA 1V55H 1JHFA 2R0QC 3E5XA 2KRHA 1U5TC 1HSTA 3FM3A 3TDUC 5D8KB 1E3HA 4ESJA 3WTYC 4HA8A 2L9SA 2EILH 2R93J 2K7LA 3GTMJ 4UV9A 4JYKA 4JP0A 1KU9A 1X1AA 2DAOA 3FMRA 2KIQA 1QZEA 1GV2A 2OV7A 3K4KA 3LSTA 4JK1X 3G4SI 2ID3A 1AHDP 2UWMA 4XQFA 2I10A 2PX9A 3VSKA 3CP2A 1K7AA 5DD8A 3MZYA 1MBJA 5DUIA 1IC8A 1JKPC 4C3JJ 2X1CA 2RNJA 4BDZA 5J4VA 3PQKA 1FP1D 1LQ1A 2Q1ZB 3D5SC 1J09A 1H8AC 3OYLA 2Y0MA 3FXLA 1XGMA 1G3WA 2PMHA 3DEEA 3ZXSA 3GZ6A 3E7LA 1PP8F 2MFZA 1ZLJA 3IP4B 3QODA 3RIRA 3F22A 2O9LA 4GYIA 5B66C 3PUFA 4OMYA 1GHCA 3P5JA 3GEZA 1FEXA 2VONA 2XF5A 2MABA 1VQOI 1YRNB 2VPRA 1X19A 2GLOA 3TL4X 3N05A 2PFBA 3J81K 1D8JA 2KIMA 2FEZA 3GMEA 4QPOA 4RLFA 4ZZLA 1SFEA 1MSFC 4C2TA 1MJ9A 3Q5FA 2PMZN 4HOBA 4AIJA 1YW8A 4P5OA 3LSJA 3W2VA 5KHDA 3CCUI 3RPQA 3MKWB 5CJ9A 3OMYA 4U7DA 2JVGA 4ZZDA 3I3LA 2XUBA 2M2EA 4EGZA 3BJ6A 4U0WA 4LIUA 2OCEA 4KITB 1PUFA 5HS7A 2HZDA 1XSVA 5JVGF 1V5EA 1MBKA 3H92A 3HUGB 2JRTA 1UAAA 2L5QA 2V9PA 2VOOA 1GXQA 1JHHA 4ITVA 3ZMSA 2H27A 1JKOC 2HDCA 3IKTA 3MZ8A 1YJWI 1Z6RA 1BI0A 1JGSA 3CO6C 4N0BA 2P5VA 1HA8A 5HDGA 4EM1A 4BQAA 4A3LJ 1AA7A 2BY0A 1YLFA 3N97A 2QYOA 3ASNH 3K4NA 3IH3A 2MSYA 5CVJA 3WGHA 1HDPA 5E1XA 2LVSA 4ZYGA 1S7AA 4IKFA 3GUDA 5B5EC 2BW3B 1IRZA 4RM3A 2VOPA 3CLQA 3H0GJ 5IP9J 5F64A 3OL3A 2LY2A 5J8CA 4KA4A 1O4XA 3T8TA 4IVNA 5EYRA 4Q47A 3FDYA 5IYBJ 4RGSA 3BPXA 3ROUA 3FK7A 2BV6A 4M9ZA 4EJTA 3RTRA 1O3SA 2DU9A 1JJ6C 1MDMB 1VQ8I 4MFDA 3LWFA 1R5HA 2PJRA 3BG6A 4IQJA 3CJRB 4S05A 4B44A 1WQ2A 1E2XA 1SD7A 1FT9A 3ONQA 3O6BB 1B72B 1W36C 4L5IA 3ZPLA 3JRBA 3DU5A 5JVTA 2CQQA 2M0MA 3DCFA 2Z33A 4AM3A 1TBXA 4KIGA 4G7OF 3OR1C 4E7KA 1ON2A 3RYPA 4OAYA 4HF0A 3I4PA 4PGHA 1WJFA 2L54A 3PSIA 4HV6A 3F3XA 4GO1A 3WE3A 5FKNA 3F72A 1T0FC 1WJEA 3A02A 3PM1A 4EJOA 4HF2A 1YOVB 4Q5SF 3L2WA 4OINF 2ZXIA 5F6FA 3OYDA 2HKOA 3LSRA 2CUJA 2VQCA 1QGPA 1F5TA 1Y1WJ 4LB6B 1TW3A 2ID6A 1RPWA 2M8EA 1J5YA 2X48A 1SFOJ 1ZARA 3H9JA 3TO9A 3WTSC 3K10A 3BTIA 4LK0F 4EMSA 2CO5A 2K9SA 2A69F 2VT3A 1XMKA 1Y56A 2CJJA 1HLVA 1FSHA 3DTKA 1PP7U 4BAYA 2JSCA 4IXAA 2VODA 3Q9SA 3H1CA 2ZMEC 1OFCX 1R36A 2CFXA 3OYCA 2OF7A 3IC7A 3H9GA 4X0GA 2VXDA 2VE9A 2O8KA 1VQ5I 3JSPA 2CQKA 4CGZA 3PJRA 3KCCA 2OQGA 3H36A 3ZMZA 3BWGA 1IV6A 5ERIA 1MBFA 3RI4A 1AOYA 4UY8I 4LFUA 4HQMA 4FISA 1O3TA 2D2WA 2GOMA 4L18B 3DKWA 2HQ5A 2K5CA 2HVSA 3HEFA 3DEUA 2CFOA 3M7GA 3R0AA 1MNDA 5DM7F 2VC1A 4WXDA 4CDGA 1A31A 3RYRA 1HOMA 4XM3A 3V7CA 5L3CA 2TRTA 2O0YA 2KDOA 5BPIA 2K3PA 2LRDA 2IVMA 1Z05A 1WVRA 3KP6A 3TP3A 1V5FA 3BDDA 2ZNZA 3OYNA 2QGUA 2GIZA 2DBBA 3PFYA 3BTCA 2K40A 2DT5A 3L09A 1HKQA 1FX7A 2HQRA 1W1WE 2LYCA 1EF4A 4WX9A 5KNLA 2KPMA 3A03A 4ZDLA 4M74A 1T0FA 3W6KB 4FHTA 4NHJA 4M3DA 2A5WA 1R71A 5HODA 2PQ8A 3J7ZI 1RRJA 1IXCA 4ESFA 4ZYAA 2FU4A 3KLNA 1FTZA 2HEOA 4I99C 1FTTA 3LSMA 1ZQ3P 2Z99A 3BT9A 3HB9A 4CCJA 4XNFA 2KRCA 2QBYA 4EATA 1AWCA 4DBQA 1ORKA 2RDPA 4RB0A 2X1EA 1Q1VA 3P9CA 1UCRA 2JVHA 3OYMA 1PUEE 2FQ4A 3CESA 2ZMEA 4IHXA 2ACJA 4GXOA 5FO5A 1FC3A 4BQQA 3I9V2 3SZGA 2LBFB 3E0JB 4M3GA 4PJNA 4A93J 5LRSA 2MLKA 4CH7A 3PIPF 4DZPA 3DPUA 4E7SA 3L2QA 3F8FA 4U0VA 1OCPA 1SMTA 2XC7A 1HW1A 1QU3A 2DXIA 5C44J 3BG9A 2WTEA 1JE8A 3CC2I 3I59B 3L2VA 4CYCB 4M73A 1XX5A 3ZR8X 4B47A 1VQPI 1FOYA 4AIHA 1K4SA 2N8GA 4HRIA 1W4MA 4YFNF 2R7XA 5F0FA 1Y8RB 1XGNA 4EJVA 4S04A 4L9VA 4HX4A 4PUSA 3OY9A 3G71I 4RM2A 4B8XA 4B09A 3LAPA 1VF9A 1WI9A 4A3IJ 1XMAA 2WB1A 4U87A 1ZR2A 1WJCA 4G6DA 2CUFA 4LLNA 3GTKJ 1M1EB 2QQBA 5TRDA 2F4IA 2PG4A 3KZIC 4W97A 1GVJA 2QM3A 4A12A 3ZQIA 4PCQA 2IS2A 1TQIA 2OC6A 3IHUA 3LSPA 3ERED 2LREA 3SDGA 1SANA 4ZC3A 2P0WA 3DEWA 3IRQA 2FQ3A 3MN2A 4BHBA 1FIAA 1JUSA 3MMYB 2OTJI 4CCKA 3D5LA 2CQXA 2M9HA 4HEA2 2UZKA 3WU2C 1J0RA 1YW9A 3J7AO 2Z9OA 3FXQA 2ZJRF 1W7PB 2ZNYA 3T1BA 1K4TA 5KAIC 4L9TA 4E7JA 2D1HA 3LMMA 3F21A 2W82A 3QYFA 3U1KA 5DUKA 1UJ8A 3P7NA 1MIJA 3FXUA 2COMA 1BC7C 3BQZA 4RGXA 2ETHA 1TWAJ 4HNUA 2DQLA 1Y0NA 2P81A 3OS2A 1MMAA 2L01A 4YIIA 4KJZA 3BG5A 3RZDJ 5HDNA 2XAGA 1PJRA 3U1DA 1DPRA 2H8RA 2IT0A 2GIVA 3DTIA 1K79A 5IY5H 5LGNA 4IZZA 4BHCA 4H0EA 3GW2A 2K9LA 4KIBA 5K5OA 2TCTA 3LSIA 5E3NA 1W7PD 3DBHB 1WJBA 2QZ8A 3M8FA 1HW5A 2EFQA 3JREA 4XSZF 2KKOA 2JQ7A 3OYFA 3MEXA 3OIQA 4ABZA 2R5YA 5A2QZ 2ZKZA 4CCOA 1D8KA 1NK3P 3GO5A 1T56A 3DWLE 4L5JA 4RB1A 1YQAA 2E5ZA 5DCFA 2BHYA 4MHGA 3OS1A 1DUXC 3E5UA 3FMQA 4BXXJ 1T08B 2B0LA 3LSGA 1S8NA 4RAYA 4FT8A 5AONA 2HGCA 3HKZN 2LH9A 5F1RA 4DGWB 5J47A 2WADA 3ZQLA 2NS0A 3OR2C 5CYVA 3O3KA 3GBGA 4V19K 2HWVA 4RBOA 5K7HA 1WJAA 5A2QK 1U9NA 4HDUA 1SFXA 4XLHA 3BJOA 4FE4A 5LBQA 5AIQA 3FK6A 2WA0A 2Y30A 3HOUJ 3GFJA 3WTTC 3ECOA 5B1AH 1BW5A 1ETQA 2CGPA 2YS9A 2KQRA 1EV7A 1IRXA 1FWZA 3FBNB 3GLLA 1RR7A 2E2HJ 1T6SA 3K70C 3K69A 1ZG5A 4BQNA 3CJNA 3OWTA 4A6DA 3WTXC 1FY7A 1ZKGA 1LEAA 1WHUA 2X1DA 2XGCA 3JAMZ 1VZ0A 4V2FA 2W48A 1LPQA 3Q0VA 5LHHA 2JPBA 1Z3YA 1NK2P 4KICA 2KDZA 4O6JA 1TZLA 4LGWA 1VI0A 5H20A 2WAEA 4BXUA 4EJUA 2KHMA 1P2FA 4XR6A 3KP7A 5B3SH 1R1VA 5DEQA 4YIFA 1R1TA 5GAHJ 2VBXA 3CMAI 2UUZA 3FWEA 3HPHA 2IP2A 2RNGA 4F55A 3WTWC 4A3KJ 4JQFA 1KQ8A 2DT6A 4BEHB 2FSWA 1UFMA 2CUEA 3HOTA 2YU9J 3JAMK 4XOTA 2R4GA 4F7ZA 1IDZA 1XDUA 2VT2A 3H3ZA 4V2GA 1JT0A 1S9HA 5K5QA 2NVTJ 1HXDA 2PBIA 3MQ0A 4NC8A 2CQNA 4AUXA 1RNLA 1POGA 4BXFA 5LGUA 1U8RA 4FQGA 3Q9VA 1QPMA 1B59A 2HPMA 2HNHA 1YS7A 1HKTA 2DYSH 3VWBA 3GTLJ 1QZZA 2HVRA 4ENNA 5L3GA 4HDVA 2UXXA 2OD5A 3C2HA 1E17A 2PMUA 1I5ZA 1E3OC 2E1MB 2G7UA 2FMYA 1GDTA 1BJAA 3UR3C 1WJ5A 1KGSA 2EV0A 4HLYA 5E18F 3H35A 1SEUA 1W5CC 3S2DJ 1NG7A 4YG2F 4OU0A 1K61A 1GUUA 1Z9CA 4QWQA 1BI1A 2DFEA 4XL9A 3PSFA 1FP2A 4S0HB 2KIUA 2EINH 3NARA 1SFKA 4XORA 2EBIA 3MD2A 3GFLA 2HOEA 1E0EA 1WZ2A 5E3LA 3H3VK 1B4AA 1YITI 2AQFA 2XPWA 3QRFF 4BH9A 4Y7NJ 2ZBKA 3F6VA 1ETOA 2KZVA 3GTQJ 3DKXA 4I0AA 4Y15A 1QQIA 5M3MJ 1WH7A 1IRFA 1REPC 3CJQB 2YR2A 4GDFA 3A0HC 3CC7I 3JTHA 5J4YA 2IPQX 2WY8Q 2O6GE 1MMSA 3BPVA 3KETA 2HDWA 3QAHA 3LL7A 2OCCH 2FJ1A 4F93B 4MFEA 2DA1A 1GLNA 4KN7X 2IGKA 4IX7A 3Q3SA 1HKSA 1ETVA 5FKKA 3OYJA 3S1NJ 3I64A 2DTZA 3EPZA 2AS5F 3G1OA 4AWXB 2E2IJ 1YIOA 1D0XA 3EETA 2CS3A 3KPHA 4RAZA 1TLHB 2L7FP 2QQ9A 3FF5A 1Z7LA 1YW7A 3S3MA 3BR5A 3HRTA 1DP3A 4P55A 1PYVA 3OYEA 1DGWY 3LSKA 3HOXJ 2RVCA 1UHMA 4BUPA 3ZQGA 4DQ2A 4PZJA 1DGRM 1G3YA 2M87A 2Y2ZA 2V6EA 1MGTA 5CKTA 2XRLA 3FHZA 2GA1A 4BL0B 5BOXA 3KEOA 1EH8A 3JSOA 3FXMA 4MNUA 4L9NA 5E1ZB 4D5CA 1ITYA 5F04A 1IV8A 5K7ZA 2CRGA 4FASD 1B9MA 3U2RA 2WAQA 5HS9A 1IXSB 3J81Z 3GX4X 2WV0A 2VKVA 5FJ8J 1JGGA 1YX5A 3AG1H 2YX7A 2M7BA 2UV1A 3S93A 3ECHA 2L4MA 2OQRA 4IJAA 4KMFA 1D5VA 3DTEA 5J8FA 3I53A 1HCRA 2D5VA 4LB5A 2Z3YA 2FNAA 2GXGA 4WCGA 4D9JA 2GWRA 4NC6A 5JLXA 5EZGA 3CCMI 3HHGA 2LF8A 2NNNA 2UXNA 3S17J 4IHWA 2I5UA 3K7AJ 1S6LA 3E1SA 3A1YA 5DCMA 1XGSA 2BY1A 4ON0A 2Q2EA 4IOAF 1T39A 2VL8A 5KCMA 4E7IA 3QOEA 1E3PA 3ZQ7A 2EZHA 4NBQA 1N77A 2JA2A 3I54A 2NS8A 3KZZA 2E1OA 5D4SA 3F23A 4F92B 3CQZJ 3PO3J 1HQCA 2RGVA 3E6DA 4C9YA 2VPLA 4HPQA 4CYDA 2QVOA 1BOAA 2X0LA 2ZB9A 4IRGA 4G9YA 4RAFA 1AKHA 1H9TA 2D1VA 5EEGA 4UUSB 2HYFA 4EEFG 2ZXWH 3MVPA 5JHUA 2ELJA 3R4KA 2NXNB 2R7SA 1EH7A 1SD5A 5GP9A 1K78B 3AG2H 1HDDC 2YX4A 2H09A 4NC7A 3FHNA 1LFBA 3JRDA 5EGOB 1CF7A 3FXOA 1ZLKA 4XLNF 3SFIA 2DO7A 2GAUA 2QQ8A 2A05A 3CUQB 3CCRI 1U5TA 2RN7A 2VN2A 3Q0WA 1B8IB 4I0BA 4A3DJ 2W85A 2NOJB 1H0MA 3WU1B 2IAIA 4A3EJ 1USTA 1WKMA 2MLGA 2R3SA 3KP5A 2ISZA 5FLVA 3LAJA 1FPQA 1ZGJA 1MH4A 3CF2A 1Y1VJ 1WRJA 1BM9A 4CCNA 1W5TA 2IXSA 3W2AA 3GCMA 2Z5UA 2EV6A 2NOGA 3QYBA 4ASNA 1L3LA 1UMQA 1OISA 5ICGA 2VI6A 3TKYA 2W7NA 2P6SA 1Q1HA 1H9GA 2E7WA 5FROA 3D5RC 5HLTA 3HSEA 4UUTA 1LDKB 1LVKA 2X85A 3SYTA 3FIWA 3QYEA 4Y4RA 5J6XA 1G4DA 2EV5A 5GTIC 2CG4A 2DTRA 4UB8C 4BHPA 1ZN2A 1U8BA 2MYSA 5BNGA 3CMEI 2JZYA 2HXIA 3F9KA 2LKXA 3RPUA 1XCBA 4G8XA 1NH3A 3HL2A 4W1UA 2IS1A 4XIDA 1LE8B 1T8IA 4UVAA 2Q8KA 2OA4A 4F52A 4HX7A 5F1JA 4QSHA 2L0KA 2VKHA 4XK4A 2GXAA 3L2CA 2ZSIB 2M5WA 3CCSI 3DFGA 3M4OJ 1TQMA 3GXOA 2EPFA 2B9SA 3H5AA 1WI3A 3RDIA 3BTJA 3L2RA 3A0BC 2L9NA 3ASOH 3H0DA 2CH0A 3VYRB 5FLXZ 1ZRCA 3IAS2 4ZJZA 3WU0A 1IN4A 1G6NA 1UELB 3HRSA 3S1RJ 2DK8A 4GRIA 2NAZA 4ZDOA 2M1BA 1LFPA 1R4NB 3OYHA 4C2MJ 3WGIA 2JK3A 4G12A 3OSFA 3LA2A 4NQWA 4YRVA 2XPUA 5CPRB 3COAC 2L7KA 2JPCA 1ZG1A 4HQEA 5FLXK 3I4NJ 1BN5A 3F0CA 3SHFA 1F9NA 1XPXA 4L5EA 5D5UB 4A3GJ 3C2GA 5FKOA 4A0YA 4RDUA 4HG2A 2DLLA 1TNTA 3VYTB 2GA2A 2IJLA 3JR9A 1P6RA 1QRYA 1YTYA 3KP3A 1FZPB 2LLKA 3WHCA 1Y39A 1P92A 2H1LA 1P4XA 3H5RA 1OLTA 4PJJA 5L3DA 3V7SA 1MW7A 4BBRJ 1IF1A 1IAWA 2HQNA 2NVUB 1S5LC 1APLC 2LFBA 2VQGA 3K1PA 1ETWA 1VQ4I 3K2AA 1A6QA 1JKQC 1RC9A 1V4RA 4DZJA 3PQJA 4F91B 3MZHA 5TJJA 2E60A 3V4GA 4MTEA 4BU2A 4CHUA 4N4NB 1YG2A 2HVQA 5K5RA 4PFOA 2R7OA 4MGRA 1OCCH 1OMIA 3O2PE 3JCUC 3ZQCA 2IW5A 2EJRA 3LA3A 3DBLB 3AFHA 5LD2C 1ZYRF 2LF7A 3HG9A 3SQNA 1Z91A 2PI0A 1TWCJ 1CQTA 3TO6A 3EUAA 4LG0A 3ZN0A 3GZ5A 4ZTJA 2X6YA 4XN3A 5IPAA 2ESHA 2BYVE 1SFUA 3G1MA 1A04A 1BR4A 3FX3A 2EFWA 3BLYA 4K2EA 4Q4ZF 2LR8A 2F5VA 2F4OB 3K1MA 1ZAOA 4HAMA 2XAJA 2DMTA 2EK5A 4D7NA 4EJWA 3OYBA 4D5FA 4MO7A 1MNMC 1B6AA 1YS6A 2O3FA 2M7AA 4DJAA 1ENHA 5CVIA 2P5LC 4EGYA 2LNBA 4M71A 2FBIA 1R00A 1ON1A 2DPDA 3OIOA 2BVMA 4OWRB 2GM4A 5KVRA 4XKBA 3GTPJ 2YUSA 3BQYA 2BXZA 3NEUA 5EZHA 2DDAA 1P9QC 2Y0SA 3VDXA 4A0XA 2Z16A 5BMZA 3FXRA 2VKDA 3ABUA 3ZP5A 1ONVA 3VSLA 1R22A 2PN6A 4XRFA 3S14J 2BY3A 2F5DA 2QWWA 1BC8C 2VC0A 1RR8C 1MH3A 1R1UA 1XDSA 4Q48A 2COBA 2JN6A 3I5UA 1LB2A 2P4WA 2EZLA 3V7RA 1JKRC 1BOBA 3BCBA 3K2ZA 4HLXA 1QVUA 2VLAA 3HHHA 3S2HJ 2K86A 1U3EM 2EFNA 2E1NA 1YX3A 4X1EA 3RKWA 5D5XB 4ENJA 1R23A 5F27A 4BE2A 2BBYA 2I8DA 2A3SA 2NVXJ 3IL2A 2GZWA 1BR2A 3EQLF 2VXZA 3KP4A 2BGCA 4J19A 3WTUC 2QF7A 5FB2A 1O57A 3C3WA 4L0YB 2FA5A 3KX2A 1FYLA 2HXOA 3HUGA 4E7ZA 1LJ9A 5EG0B 4A3CJ 1W0TA 3TO7A 4DBRA 4CCMA 1YO5C 4IPAA 4A3FJ 1DDNA 5FGMA 2BXYA 3S8PA 4Z2YA 3CMYA 2STTA 1FYMA 2FOKA 2E34A 2XROA 5DTDA 4XICA 4NUBA 1WPKA 4XLPF 3J7YJ 1SC7A 5HVQC 1BW6A 2G7HA 2IBDA 5GADJ 3F8CA 1UHWA 4BJ6C 2JA5J 4JX4A 4HZFA 1W5SA 1MKMA 3HSFA 2EA2A 2YU3A 1N78A 1G3SA 2BW3A 2R7TA 3CZ6A 2JTVA 1IJWC 3GTGJ 1TWHJ 1FOXA 3ESWB 3E3VA 3H9QA 2OJED 1X4OA 2IGNA 2DMUA 2K27A 2G0EA 1I1GA 4CXFA 1P4WA 4I01A 2IA2A 5JI6A 4RMNA 3K4BA 3F8MA 3PNTA 4II3A 3V8LA 1QA6A 5HS8A 2XF7A 1XC5A 3UNGC 2HYGD 1QNTA 2EIMH 3DLAA 1MDMA 4EV0A 4H4KC 4OIPF 4BBSJ 5ICFA 3IKVA 4UHTA 3A2KA 5M3FJ 4N4OB 1BI3A 3JRGA 3TW6A 2V79A 1IUYA 1YJ9I 2JWTA 4XBFA 5DS9A 3LQRA 1LEBA 1Y8QB 4PJLA 4LMYA 3MFKA 3ABLH 3E6CC 4RLQA 2XAQA 1B72A 2MH2A 3HPGA 1A5JA 3LNQA 4AVPA 3BR3A 3OYKA 2MW8A 4U0YA 2V1XA 1JXSA 2BHZA 2E7XA 3ABMH 2QCOA 3AG4H 3BR2A 4R8HA 2FBHA 2OZUA 4O5VA 2DFFA 1KZHA 2GBYA 2KJBA 1SVMA 3IAM2 1D5YA 1RETA 4I7HA 3JRAA 3W6VA 3ABTA 2JUGA 2FF4A 5FLMJ 4UVCA 1I1SA 2K9QA 5LRRA 1ZGWA 3DKYA 1N25A 4QTRA 2RQPA 2ADUA 1IN5A 2P5KA 2V4JC 2HR3A 2DK5A 1IW7F 5HDKA 1DU6A 3VOEA 1TL8A 5LFAA 4E7LA 3MWMA 4I98B 3T0YA 5E79C 2TDXA 2F5EA 3CO7C 2IGMA 2L2OA 3CCQI 4XLEA 2M3AA 2R7UA 4IHVA 3J80K 1VQLI 3H3UA 1FSEA 1FMWA 1ERDA 4PDKA 3J7AY 4KT6A 2W57A 2IS6A 2VQLA 5EEHA 4FCYA 3R60A 4IEJA 3MKYB 2OZ6A 1RKWA 2E19A 5CVUA 1XMXA 4ZTFA 5JHFA 3GLXA 3BJAA 2VBWA 4MIMA 5D8LB 2K9MA 2ECBA 4E70A 3BZKA 3Q0UA 3CUOA 5HLHA 3DU6A 4B43A 3REOA 2KJCA 5D5VB 3VYSB 2O61A 5ILVA 1VFCA 2F6CA 1GXPA 2IRFG 5FRMA 2O03A 2O7OA 4MQ9F 4UUVA 1VQ6I 4I2OA 1TP4A 4PGGA 4Y3OA 3KFWX 4GCVA 3I71A 4CCLA 1PUFB 2W84A 2GQQA 1LUJB 4Y17A 3RQIA 1X4PA 1ZTRA 3IH4A 1I39A 2VASA 2XGXA 1STZA 1WFXA 2E2JJ 3K1NA 4LLGF 5LEKA 5C3EJ 1OR7C 5EDNA 4GGGA 3L9FA 1IN8A 1KYWA 1KU3A 3LOCA 2XKPA 4XLFA 1F43A 3ZQFA 2PMZA 3GTJJ 4ANJA 1FIPA 2FRHA 2VJ5A 4P9FA 1G2HA 3IWFA 5D5WB 1FBSA 1VQ9I 1HC8A 3EYYA 4BE0A 1GVDA 5M5XJ 1L0OC 4O3MA 3DF8A 5E3MA 3M3YJ 4F3QA 2H6BA 3M1CA 2K4JA 3OOPA 4XN0A 1P7JA 1IDYA 2PLYA 1QVTA 1U78A 2V26A 3FBIB 3NAUA 3HIFA 1JI8A 5IOZA 3V8JA 1W0UA 5E3OA 1VQMI 1DQUA 1C0WA 4I6ZA 4DNCA 4TV7A 2M0CA 3K4CA 2MD0A 3KEQA 3QU3A 2EB7A 4AYBN 2BE5F 3JTGA 2QUFA 1FMVA 3I56I 2PJRB 1BBYA 3QPSA 3WG9A 3DQVC 2K02A 1T38A 2NS7A 4IL6C 1B9NA 4UNOA 4RS8A 3ML6A 2LG4A 2KLOA 3WE2A 1X1DA 2STWA 1X1CA 4HBLA 2K3FA 2XVCA 2HOTA 1FOWA 2LBFA 3MAJA 2XKOA 4XRMA 3S15J 4HYEA 4WK8F 3I4MJ 4FETA 4CA0A 2IA0A 2CU7A 1SVOA 4OIQF 1D1AA 1ZRFA 2DFHA 4HNTA 4GYGA 2ZO4A 2HTSA 1XD7A 1XSDA 1YFHA 5FD5A 3VPRA 1X1BA 3BROA 3BP8A 2IA1A 2DJIA 3AAFA 4DYCA 2BZTA 3I59A 4HSRA 2RQQA 4CYCA 5J3LA 1ACIA 1ZK8A 2DMNA 3RSNA 4BJ5C 5JFRA 3B02A 3CTAA 2H8WA 4ZDPA 4C3HJ 4R1HA 2VQHA 3VEPA 3SZPA 3S2WA 3RKXA 3SEZA 3T8RA 4WXHA 1S29A 4JBAA 5ED4A 1I6XA 3KZYA 1ULYA
chains in the Genus database with same CATH topology
1TW2A 2HZTA 1SD6A 4QLCU 4KMUX 3G3ZA 3R61A 1T98A 3ZMDA 2G9WA 1SAXA 3U9GA 4P96A 2DW4A 4FX0A 2W25A 2F2EA 1OPCA 2XIGA 3QPHA 3R0JA 4KNYA 1ZG3A 4KFCA 5L3EA 1W7PA 2ESNA 3F8NA 2V1UA 1F4KA 1IN6A 5L3FA 2CWEA 3L7WA 3V8KA 4UVBA 1J2XA 3TQNA 3C1DA 4N9HA 3E6MA 4LG0B 1KU7A 5CVVA 4D0PA 2YPRA 1S3JA 4I02A 2K4BA 2EFOA 1CGPA 2Q0OA 1P4AA 3EDPA 5CVRA 3GVAA 2C6YA 4AIKA 1XN7A 2VBYA 3SZTA 2V1DA 1B1BA 1FNNA 4U88A 2QBYB 3G73A 5K1YA 1SMYF 2RV8A 2L4AA 1J75A 4HW0A 4KDPA 1VTNC 2ZMEB 2F5FA 1LDJA 2M45A 4ZYEA 3M1EA 3TOAA 4ZYDA 2X4HA 2OBPA 4M72A 1MJAA 2HTJA 2PJPA 5IT9Z 4OMZA 4A5MA 2CYYA 3TOBA 1XB4A 2Y48A 4G7ZF 3IWZA 2ISYA 2A07F 1ZRDA 1QZYA 3HRMA 4N9IA 5IT9K 3LA7A 3LFKA 3BZ6A 3TDZC 2W24A 1Z1DA 3I58A 2BEOA 4NB5A 4MTDA 1PDNC 3FMSA 1ZREA 3ISPA 4CO8A 1S7OA 5ICEA 1EH6A 3F8BA 5H6RA 3GFIA 2RC4A 3DPTA 3R6SA 1V3FA 1QBJA 3WTVC 3VB2A 4BYYA 1HBXG 1DPUA 5DD4A 4HF1A 1T2KA 3FM5A 2MD5A 1U6GA 4Y13A 2QQAA 4LK1F 1OYWA 1RIOH 2MBFA 2LSOA 3EYIA 3C18A 1MJBA 4A0ZA 3KE2A 3HYIA 3HTSB 3KLOA 5E17F 5D6FA 3CLOA 4MEXF 1HSJA 2XAFA 1XSXA 4UXNA 1QO0D 2EA4A 1YYVA 4MEYF 4RGRA 1Z7UA 4IRHA 2KRFA 1ZGAA 3VFZA 3DPLC 1MD0A 3EUHA 3QPTA 3CDHA 1RZ4A 3FZVA 4IRIA 2HFHA 4P9UA 1WWXA 2A68F 4M9SA 1BIAA 1UB9A 3CUQC 3QOPA 4OOIA 2VBZA 4A2UA 1WSUA 3PFIA 4U7BA 3HRUA 5LHGA 4BNCA 3SFZA 1RUOA 5H6QA 2R7FA 4KUMA 2J5PA 5HOOA 3WTZA 3JW4A 2XASA 2YSRA 5D6EA 5ILSA 2ZXJA 3P9IA 3TGNA 4OIRF 5IT3A 4LJZF 2HS5A 3NQOA 3P9KA 1J9IA 4ZH4F 5LGTA 5AIPA 1HW2A 1BIBA 2OU2A 1RI7A 2ELHA 1LDDA 3E97A 1KQ0A 2O8XA 1FOKA 1X3UA 5E8IA 3HTUA 1O7FA 2WC2A 3W6JB 5BQTA 2MH9A 1R5GA 4LLLA 5BS6A 1K78A 1R7JA 2L3DA 2LDUA 1Z6TA 2XAHA 3CUQA 4RB2C 2NYXA 3OV8A 2J5OA 3BOQA 4UV8A 2H6CA 1FLIA 1O7LA 5FFXA 2AXLA 2DQRA 1ODDA 1FYKA 1KA8A 2NRAC 3N4MA 2CW0F 4G94A 4XSXF 1D3YA 2XV4S 4FX4A 4WXCA 3E5QA 2P8TA 2QLZA 4ZYHA 4EM0B 2RKHA 4HV5A 3GYHX 4ETSA 4L9JA 5LEJA 4L0ZB 4IHSA 3HSRA 1IXRC 1SD4A 4M6YA 3GWZA 1O3RA 5JR3A 2WWYA 1XGOA 3DXJF 2EFPA 2VE8A 2Y75A 4YFKF 5ICCA 2E1CA 2QENA 1OKRA 2EWNA 3K0LA 4G6QA 4A6EA 2P7VB 2V6CA 1Y0UA 4OIOF 2XHKA 4R79A 4CICA 3WODF 5LHIA 1KU2A 3J80Z 3RKYA 2FBKA 3HOSA 2FXAA 4ESBA 2M30A 2D45A 1R58A 2R7DA 4KN4X 4M9XA 2F5CA 1KQ9A 5FD6A 1OYIA 1XCVA 3K9TA 1LNWA 1FBQA 5KK1A 1I27A 2ZCWA 1FBUA 2XRNA 5DCMB 2H94A 5BPDA 3DV8A 1K6OA 5CLSA 3B73A 5FFZA 4M6XA 1IZ1A 3T5XA 2ZFWA 4HX8A 3L00A 5L3BA 2HKXA 2FMLA 4RGUA 1U2WA 3DP7A 1TQPA 3NRVA 3RJPA 1J59A 4EQQA 1CF7B 3WGGA 1F1ZA 1U5TB 1ZH5A 1IN7A 3I0TA 1MZBA 5LLQA 3ZMUA 1O3QA 3M8EA 3BY6A 3MCZA 1OYYA 3QP5A 1TNSA 4KIFA 4AD9A 4RB3C 3LQQA 5E1WA 3E6BA 1BI2A 4G7HF 3SXYA 2A6EF 3ZN1A 4EM2A 2DI3A 1NHAA 1KYZA 2ZJ2A 3VODA 1G3TA 3QP6A 4WWCA 2LKPA 5DYMA 4EVIA 4IF4A 4LD5A 2L02A 5ILUA 2A61A 3M9AA 3GF2A 4KYWA 5D4RA 2FNPA 3GFMA 3ULQB 4A5NA 4WF2A 3ELKA 5E20A 5HLIA 2A5YB 5E8GA 5HLGA 1USSA 3ZMTA 1LVAA 6PAXA 2NNYA 1OR7A 4KT5C 4CZZA 1IRGA 2KIFA 4YFXF 3KP2A 3ZMVA 2JT1A 2A6HF 5DV5A 2OAZA 2FE3A 2MA3A 2DPUA 4IHTA 1DP7P 2P6TA 3QU6A 4I09A 3C7JA 2CSOA 2DFIA 2PEXA 5DDGA 3IRRA 4ENKA 3D0SA 2GXBA 2P7CB 1TTYA 1ZHFA 2V9VA 1J7KA 1RUNA 3F6OA 4MQVA 4ENMA 2MC3A 1JHFA 3E5XA 3FM3A 1U5TC 1HSTA 3TDUC 5D8KB 4ESJA 3WTYC 4HA8A 2K7LA 4UV9A 1KU9A 2DAOA 3FMRA 3LSTA 4JK1X 2UWMA 1K7AA 5DD8A 3MZYA 5DUIA 2RNJA 1LQ1A 3PQKA 1FP1D 2Y0MA 1XGMA 1G3WA 2PMHA 3GZ6A 1PP8F 3F22A 1ZLJA 3RIRA 4GYIA 4OMYA 1GHCA 3GEZA 2VONA 2PFBA 3J81K 1D8JA 2KIMA 2FEZA 4ZZLA 1SFEA 1MJ9A 3Q5FA 4HOBA 4AIJA 1YW8A 4P5OA 3RPQA 5CJ9A 4U7DA 4ZZDA 2XUBA 4EGZA 3BJ6A 4U0WA 5HS7A 1XSVA 3H92A 2JRTA 2VOOA 1GXQA 1JHHA 3ZMSA 2H27A 2HDCA 3IKTA 1Z6RA 1BI0A 1JGSA 3CO6C 4N0BA 2P5VA 5HDGA 4EM1A 4BQAA 1YLFA 3N97A 2QYOA 5CVJA 3WGHA 5E1XA 4ZYGA 1S7AA 3GUDA 2VOPA 5F64A 5J8CA 4KA4A 3T8TA 4IVNA 4Q47A 4RGSA 3BPXA 3ROUA 2BV6A 4M9ZA 4EJTA 3RTRA 1O3SA 2DU9A 1MDMB 3LWFA 1R5HA 4S05A 1WQ2A 1E2XA 1SD7A 1FT9A 3O6BB 3ZPLA 4L5IA 5JVTA 2Z33A 1TBXA 4KIGA 4G7OF 1ON2A 3RYPA 4HF0A 3I4PA 4PGHA 2L54A 4HV6A 3F3XA 4GO1A 3WE3A 3F72A 4EJOA 4HF2A 4Q5SF 4OINF 5F6FA 2HKOA 1QGPA 1F5TA 4LB6B 1TW3A 2M8EA 1J5YA 1ZARA 3TO9A 3WTSC 4LK0F 4EMSA 2CO5A 2A69F 2VT3A 1XMKA 1FSHA 1PP7U 4BAYA 2JSCA 4IXAA 2VODA 3Q9SA 1R36A 2CFXA 3IC7A 2VE9A 3JSPA 2CQKA 4CGZA 3KCCA 2OQGA 3ZMZA 3BWGA 5ERIA 3RI4A 1AOYA 4LFUA 4HQMA 1O3TA 2D2WA 4L18B 3DKWA 3DEUA 3M7GA 3R0AA 2VC1A 4WXDA 4CDGA 3RYRA 3V7CA 5L3CA 2O0YA 5BPIA 2IVMA 1Z05A 3KP6A 3BDDA 2ZNZA 2DBBA 2DT5A 3L09A 1HKQA 1FX7A 2HQRA 4WX9A 4M74A 1T0FA 3W6KB 4FHTA 4NHJA 2PQ8A 1IXCA 4ESFA 2FU4A 3KLNA 2HEOA 2Z99A 2QBYA 1AWCA 2RDPA 4RB0A 3P9CA 1UCRA 1PUEE 2ZMEA 2ACJA 4GXOA 5FO5A 1FC3A 5LRSA 2MLKA 3F8FA 4U0VA 1SMTA 1HW1A 2WTEA 1JE8A 3I59B 4M73A 4AIHA 1W4MA 4YFNF 1XGNA 4EJVA 4S04A 4L9VA 4HX4A 4B8XA 4B09A 3LAPA 1WI9A 1XMAA 4G6DA 4LLNA 2QQBA 5TRDA 2PG4A 1GVJA 2QM3A 4A12A 4PCQA 1TQIA 3IHUA 3ERED 3IRQA 2FQ3A 4BHBA 3D5LA 2UZKA 1J0RA 1YW9A 3J7AO 2Z9OA 3FXQA 1W7PB 2ZNYA 3T1BA 4L9TA 2D1HA 3F21A 5DUKA 1ULYA 3P7NA 3FXUA 2COMA 1BC7C 4RGXA 2ETHA 2DQLA 2L01A 4YIIA 5HDNA 2XAGA 3U1DA 1DPRA 2IT0A 2GIVA 1K79A 5LGNA 4BHCA 4H0EA 3GW2A 4KIBA 5K5OA 1W7PD 2QZ8A 3M8FA 1HW5A 2EFQA 4XSZF 2KKOA 3MEXA 5A2QZ 2ZKZA 1D8KA 3GO5A 4L5JA 4RB1A 1YQAA 5DCFA 4MHGA 1DUXC 3E5UA 3FMQA 2B0LA 1S8NA 4RAYA 4FT8A 5AONA 2HGCA 5F1RA 2NS0A 5CYVA 3O3KA 2HWVA 5A2QK 4HDUA 1SFXA 3BJOA 5LBQA 5AIQA 3GFJA 3WTTC 3ECOA 2CGPA 1EV7A 1FWZA 1T6SA 3K69A 1ZG5A 3CJNA 3WTXC 4A6DA 1FY7A 1LEAA 3JAMZ 5LHHA 2JPBA 4KICA 4O6JA 4LGWA 5H20A 4BXUA 4EJUA 1P2FA 3KP7A 1R1VA 5DEQA 4YIFA 1R1TA 2VBXA 3FWEA 2IP2A 3WTWC 1KQ8A 4JQFA 2FSWA 1UFMA 3HOTA 3JAMK 4F7ZA 1XDUA 2VT2A 3H3ZA 5K5QA 1HXDA 2PBIA 3MQ0A 1RNLA 5LGUA 1U8RA 3Q9VA 1QPMA 1B59A 1YS7A 1HKTA 1QZZA 4ENNA 5L3GA 4HDVA 2UXXA 2OD5A 1E17A 2PMUA 1I5ZA 2G7UA 2FMYA 1BJAA 1KGSA 2EV0A 4HLYA 5E18F 4YG2F 4OU0A 1Z9CA 4QWQA 1BI1A 1FP2A 2KIUA 3GFLA 2HOEA 1B4AA 3QRFF 4BH9A 2ZBKA 3F6VA 4I0AA 4Y15A 1QQIA 1IRFA 1REPC 2YR2A 3JTHA 2IPQX 2O6GE 3BPVA 3KETA 3QAHA 4KN7X 1HKSA 3I64A 2AS5F 4AWXB 1YIOA 3EETA 4RAZA 1TLHB 2QQ9A 3FF5A 1YW7A 3HRTA 4P55A 2RVCA 1UHMA 4DQ2A 4PZJA 1G3YA 2M87A 1MGTA 3FHZA 2GA1A 5BOXA 3KEOA 1EH8A 3JSOA 4MNUA 4L9NA 5E1ZB 1B9MA 3U2RA 5HS9A 1IXSB 3J81Z 3GX4X 2WV0A 2YX7A 3ECHA 2L4MA 2OQRA 4IJAA 4KMFA 1D5VA 5J8FA 4LB5A 3I53A 2Z3YA 2FNAA 2GXGA 4WCGA 2GWRA 3HHGA 2LF8A 2NNNA 2UXNA 1S6LA 5DCMA 1XGSA 4ON0A 2Q2EA 1T39A 3ZQ7A 3I54A 5D4SA 3KZZA 3F23A 1HQCA 2RGVA 3E6DA 4CYDA 2QVOA 1BOAA 2X0LA 4IRGA 4G9YA 1H9TA 2D1VA 5EEGA 2HYFA 5JHUA 3R4KA 1EH7A 1SD5A 1K78B 2YX4A 2H09A 1CF7A 1ZLKA 4XLNF 2DO7A 2GAUA 3CUQB 1U5TA 2RN7A 2VN2A 4I0BA 2W85A 1H0MA 3WU1B 1USTA 1WKMA 2MLGA 2R3SA 3KP5A 2ISZA 3LAJA 1FPQA 1ZGJA 1WRJA 1BM9A 1W5TA 2Z5UA 2EV6A 4ASNA 1L3LA 5ICGA 3TKYA 2P6SA 1Q1HA 1H9GA 2E7WA 3HSEA 1LDKB 5J6XA 1G4DA 2EV5A 2CG4A 2DTRA 4BHPA 1ZN2A 2JZYA 3RPUA 1XCBA 4G8XA 4UVAA 2Q8KA 2OA4A 4HX7A 3L2CA 2M5WA 3DFGA 1TQMA 3GXOA 3RDIA 5FLXZ 1ZRCA 3WU0A 1IN4A 1G6NA 2DK8A 2NAZA 2M1BA 3WGIA 3LA2A 4NQWA 3COAC 2JPCA 1ZG1A 4HQEA 5FLXK 1BN5A 3SHFA 1F9NA 5D5UB 4A0YA 2DLLA 1TNTA 2GA2A 2IJLA 1P6RA 1YTYA 3KP3A 1FZPB 1P92A 1P4XA 5L3DA 3V7SA 1IF1A 1IAWA 2HQNA 3K1PA 1V4RA 3PQJA 3MZHA 5TJJA 3V4GA 4MTEA 4CHUA 1YG2A 5K5RA 4MGRA 1OMIA 3O2PE 2IW5A 2EJRA 3LA3A 1ZYRF 2LF7A 3SQNA 1Z91A 2PI0A 3TO6A 4LG0A 3ZN0A 3GZ5A 2ESHA 2BYVE 1SFUA 1A04A 3FX3A 2EFWA 4K2EA 4Q4ZF 3K1MA 1ZAOA 4HAMA 2XAJA 2EK5A 4EJWA 1B6AA 1YS6A 2O3FA 5CVIA 2P5LC 4EGYA 2LNBA 4M71A 2FBIA 1R00A 1ON1A 2DPDA 5KVRA 3NEUA 4A0XA 5BMZA 3FXRA 3ABUA 3ZP5A 1ONVA 1R22A 2PN6A 4XRFA 2QWWA 2F5DA 1BC8C 2VC0A 1R1UA 1XDSA 4Q48A 3I5UA 1LB2A 2P4WA 3V7RA 3K2ZA 4HLXA 3HHHA 2K86A 1U3EM 2EFNA 2E1NA 3RKWA 5D5XB 4ENJA 1R23A 2BBYA 2A3SA 3IL2A 2GZWA 3EQLF 2VXZA 3KP4A 2BGCA 3WTUC 5FB2A 1O57A 3C3WA 4L0YB 2FA5A 1FYLA 3HUGA 1LJ9A 3TO7A 1YO5C 4IPAA 1DDNA 5FGMA 4Z2YA 2STTA 1FYMA 2FOKA 2XROA 4XLPF 5HVQC 2G7HA 3F8CA 1UHWA 4HZFA 1W5SA 1MKMA 3HSFA 2EA2A 2YU3A 1G3SA 2JTVA 3E3VA 2K27A 1I1GA 4CXFA 1P4WA 4I01A 2IA2A 5JI6A 3F8MA 3V8LA 5HS8A 2HYGD 1QNTA 1MDMA 4OIPF 4EV0A 5ICFA 3IKVA 4UHTA 1BI3A 2V79A 1IUYA 4XBFA 3LQRA 1LEBA 4LMYA 3MFKA 3E6CC 2XAQA 2MH2A 4AVPA 4U0YA 2V1XA 1JXSA 2E7XA 4R8HA 2FBHA 2OZUA 4O5VA 2KJBA 4I7HA 3ABTA 2FF4A 4UVCA 1I1SA 5LRRA 2RQPA 2ADUA 1IN5A 2P5KA 2HR3A 2DK5A 1IW7F 5HDKA 3VOEA 3MWMA 4I98B 3T0YA 2TDXA 2F5EA 3CO7C 3J80K 3H3UA 1FSEA 4PDKA 2W57A 5EEHA 3R60A 2OZ6A 5CVUA 3GLXA 3BJAA 2VBWA 5D8LB 4E70A 3CUOA 5HLHA 3REOA 2KJCA 5D5VB 2O61A 5ILVA 1GXPA 2IRFG 2O03A 4MQ9F 4UUVA 4I2OA 4PGGA 3KFWX 4GCVA 3I71A 2W84A 2GQQA 4Y17A 2XGXA 1STZA 3K1NA 4LLGF 5LEKA 4GGGA 3L9FA 1IN8A 1KYWA 1KU3A 2XKPA 2FRHA 4P9FA 3IWFA 5D5WB 1FBSA 3EYYA 1L0OC 4O3MA 3DF8A 2H6BA 2K4JA 3OOPA 2PLYA 1U78A 3HIFA 3V8JA 1C0WA 4DNCA 4TV7A 3KEQA 3QU3A 2EB7A 2BE5F 3JTGA 2QUFA 1BBYA 3WG9A 3DQVC 2K02A 1T38A 1B9NA 4UNOA 4RS8A 3ML6A 3WE2A 2STWA 4HBLA 2XVCA 3MAJA 2XKOA 4HYEA 4WK8F 2IA0A 4OIQF 1ZRFA 4GYGA 2ZO4A 2HTSA 1XD7A 1XSDA 1YFHA 5FD5A 3BROA 3BP8A 2IA1A 3AAFA 3I59A 5JFRA 3B02A 3CTAA 4R1HA 3VEPA 3SZPA 3S2WA 3RKXA 3T8RA 4WXHA 1S29A 4JBAA 5ED4A 1I6XA 3KZYA 3HRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW2 A;  2HZT A;  1SD6 A;  4QLC U;  4KMU X;  3G3Z A;  3R61 A;  1T98 A;  3ZMD A;  2G9W A;  1SAX A;  3U9G A;  4P96 A;  2DW4 A;  4FX0 A;  2W25 A;  2F2E A;  1OPC A;  2XIG A;  3QPH A;  3R0J A;  4KNY A;  1ZG3 A;  4KFC A;  5L3E A;  1W7P A;  2ESN A;  3F8N A;  2V1U A;  1F4K A;  1IN6 A;  5L3F A;  2CWE A;  3L7W A;  3V8K A;  4UVB A;  1J2X A;  3TQN A;  3C1D A;  4N9H A;  3E6M A;  4LG0 B;  1KU7 A;  5CVV A;  4D0P A;  2YPR A;  1S3J A;  4I02 A;  2K4B A;  2EFO A;  1CGP A;  2Q0O A;  1P4A A;  3EDP A;  5CVR A;  3GVA A;  2C6Y A;  4AIK A;  1XN7 A;  2VBY A;  3SZT A;  2V1D A;  1B1B A;  1FNN A;  4U88 A;  2QBY B;  3G73 A;  5K1Y A;  1SMY F;  2RV8 A;  2L4A A;  1J75 A;  4HW0 A;  4KDP A;  1VTN C;  2ZME B;  2F5F A;  1LDJ A;  2M45 A;  4ZYE A;  3M1E A;  3TOA A;  4ZYD A;  2X4H A;  2OBP A;  4M72 A;  1MJA A;  2HTJ A;  2PJP A;  5IT9 Z;  4OMZ A;  4A5M A;  2CYY A;  3TOB A;  1XB4 A;  2Y48 A;  4G7Z F;  3IWZ A;  2ISY A;  2A07 F;  1ZRD A;  1QZY A;  3HRM A;  4N9I A;  5IT9 K;  3LA7 A;  3LFK A;  3BZ6 A;  3TDZ C;  2W24 A;  1Z1D A;  3I58 A;  2BEO A;  4NB5 A;  4MTD A;  1PDN C;  3FMS A;  1ZRE A;  3ISP A;  4CO8 A;  1S7O A;  5ICE A;  1EH6 A;  3F8B A;  5H6R A;  3GFI A;  2RC4 A;  3DPT A;  3R6S A;  1V3F A;  1QBJ A;  3WTV C;  3VB2 A;  4BYY A;  1HBX G;  1DPU A;  5DD4 A;  4HF1 A;  1T2K A;  3FM5 A;  2MD5 A;  1U6G A;  4Y13 A;  2QQA A;  4LK1 F;  1OYW A;  1RIO H;  2MBF A;  2LSO A;  3EYI A;  3C18 A;  1MJB A;  4A0Z A;  3KE2 A;  3HYI A;  3HTS B;  3KLO A;  5E17 F;  5D6F A;  3CLO A;  4MEX F;  1HSJ A;  2XAF A;  1XSX A;  4UXN A;  1QO0 D;  2EA4 A;  1YYV A;  4MEY F;  4RGR A;  1Z7U A;  4IRH A;  2KRF A;  1ZGA A;  3VFZ A;  3DPL C;  1MD0 A;  3EUH A;  3QPT A;  3CDH A;  1RZ4 A;  3FZV A;  4IRI A;  2HFH A;  4P9U A;  1WWX A;  2A68 F;  4M9S A;  1BIA A;  1UB9 A;  3CUQ C;  3QOP A;  4OOI A;  2VBZ A;  4A2U A;  1WSU A;  3PFI A;  4U7B A;  3HRU A;  5LHG A;  4BNC A;  3SFZ A;  1RUO A;  5H6Q A;  2R7F A;  4KUM A;  2J5P A;  5HOO A;  3WTZ A;  3JW4 A;  2XAS A;  2YSR A;  5D6E A;  5ILS A;  2ZXJ A;  3P9I A;  3TGN A;  4OIR F;  5IT3 A;  4LJZ F;  2HS5 A;  3NQO A;  3P9K A;  1J9I A;  4ZH4 F;  5LGT A;  5AIP A;  1HW2 A;  1BIB A;  2OU2 A;  1RI7 A;  2ELH A;  1LDD A;  3E97 A;  1KQ0 A;  2O8X A;  1FOK A;  1X3U A;  5E8I A;  3HTU A;  1O7F A;  2WC2 A;  3W6J B;  5BQT A;  2MH9 A;  1R5G A;  4LLL A;  5BS6 A;  1K78 A;  1R7J A;  2L3D A;  2LDU A;  1Z6T A;  2XAH A;  3CUQ A;  4RB2 C;  2NYX A;  3OV8 A;  2J5O A;  3BOQ A;  4UV8 A;  2H6C A;  1FLI A;  1O7L A;  5FFX A;  2AXL A;  2DQR A;  1ODD A;  1FYK A;  1KA8 A;  2NRA C;  3N4M A;  2CW0 F;  4G94 A;  4XSX F;  1D3Y A;  2XV4 S;  4FX4 A;  4WXC A;  3E5Q A;  2P8T A;  2QLZ A;  4ZYH A;  4EM0 B;  2RKH A;  4HV5 A;  3GYH X;  4ETS A;  4L9J A;  5LEJ A;  4L0Z B;  4IHS A;  3HSR A;  1IXR C;  1SD4 A;  4M6Y A;  3GWZ A;  1O3R A;  5JR3 A;  2WWY A;  1XGO A;  3DXJ F;  2EFP A;  2VE8 A;  2Y75 A;  4YFK F;  5ICC A;  2E1C A;  2QEN A;  1OKR A;  2EWN A;  3K0L A;  4G6Q A;  4A6E A;  2P7V B;  2V6C A;  1Y0U A;  4OIO F;  2XHK A;  4R79 A;  4CIC A;  3WOD F;  5LHI A;  1KU2 A;  3J80 Z;  3RKY A;  2FBK A;  3HOS A;  2FXA A;  4ESB A;  2M30 A;  2D45 A;  1R58 A;  2R7D A;  4KN4 X;  4M9X A;  2F5C A;  1KQ9 A;  5FD6 A;  1OYI A;  1XCV A;  3K9T A;  1LNW A;  1FBQ A;  5KK1 A;  1I27 A;  2ZCW A;  1FBU A;  2XRN A;  5DCM B;  2H94 A;  5BPD A;  3DV8 A;  1K6O A;  5CLS A;  3B73 A;  5FFZ A;  4M6X A;  1IZ1 A;  3T5X A;  2ZFW A;  4HX8 A;  3L00 A;  5L3B A;  2HKX A;  2FML A;  4RGU A;  1U2W A;  3DP7 A;  1TQP A;  3NRV A;  3RJP A;  1J59 A;  4EQQ A;  1CF7 B;  3WGG A;  1F1Z A;  1U5T B;  1ZH5 A;  1IN7 A;  3I0T A;  1MZB A;  5LLQ A;  3ZMU A;  1O3Q A;  3M8E A;  3BY6 A;  3MCZ A;  1OYY A;  3QP5 A;  1TNS A;  4KIF A;  4AD9 A;  4RB3 C;  3LQQ A;  5E1W A;  3E6B A;  1BI2 A;  4G7H F;  3SXY A;  2A6E F;  3ZN1 A;  4EM2 A;  2DI3 A;  1NHA A;  1KYZ A;  2ZJ2 A;  3VOD A;  1G3T A;  3QP6 A;  4WWC A;  2LKP A;  5DYM A;  4EVI A;  4IF4 A;  4LD5 A;  2L02 A;  5ILU A;  2A61 A;  3M9A A;  3GF2 A;  4KYW A;  5D4R A;  2FNP A;  3GFM A;  3ULQ B;  4A5N A;  4WF2 A;  3ELK A;  5E20 A;  5HLI A;  2A5Y B;  5E8G A;  5HLG A;  1USS A;  3ZMT A;  1LVA A;  6PAX A;  2NNY A;  1OR7 A;  4KT5 C;  4CZZ A;  1IRG A;  2KIF A;  4YFX F;  3KP2 A;  3ZMV A;  2JT1 A;  2A6H F;  5DV5 A;  2OAZ A;  2FE3 A;  2MA3 A;  2DPU A;  4IHT A;  1DP7 P;  2P6T A;  3QU6 A;  4I09 A;  3C7J A;  2CSO A;  2DFI A;  2PEX A;  5DDG A;  3IRR A;  4ENK A;  3D0S A;  2GXB A;  2P7C B;  1TTY A;  1ZHF A;  2V9V A;  1J7K A;  1RUN A;  3F6O A;  4MQV A;  4ENM A;  2MC3 A;  1JHF A;  3E5X A;  3FM3 A;  1U5T C;  1HST A;  3TDU C;  5D8K B;  4ESJ A;  3WTY C;  4HA8 A;  2K7L A;  4UV9 A;  1KU9 A;  2DAO A;  3FMR A;  3LST A;  4JK1 X;  2UWM A;  1K7A A;  5DD8 A;  3MZY A;  5DUI A;  2RNJ A;  1LQ1 A;  3PQK A;  1FP1 D;  2Y0M A;  1XGM A;  1G3W A;  2PMH A;  3GZ6 A;  1PP8 F;  3F22 A;  1ZLJ A;  3RIR A;  4GYI A;  4OMY A;  1GHC A;  3GEZ A;  2VON A;  2PFB A;  3J81 K;  1D8J A;  2KIM A;  2FEZ A;  4ZZL A;  1SFE A;  1MJ9 A;  3Q5F A;  4HOB A;  4AIJ A;  1YW8 A;  4P5O A;  3RPQ A;  5CJ9 A;  4U7D A;  4ZZD A;  2XUB A;  4EGZ A;  3BJ6 A;  4U0W A;  5HS7 A;  1XSV A;  3H92 A;  2JRT A;  2VOO A;  1GXQ A;  1JHH A;  3ZMS A;  2H27 A;  2HDC A;  3IKT A;  1Z6R A;  1BI0 A;  1JGS A;  3CO6 C;  4N0B A;  2P5V A;  5HDG A;  4EM1 A;  4BQA A;  1YLF A;  3N97 A;  2QYO A;  5CVJ A;  3WGH A;  5E1X A;  4ZYG A;  1S7A A;  3GUD A;  2VOP A;  5F64 A;  5J8C A;  4KA4 A;  3T8T A;  4IVN A;  4Q47 A;  4RGS A;  3BPX A;  3ROU A;  2BV6 A;  4M9Z A;  4EJT A;  3RTR A;  1O3S A;  2DU9 A;  1MDM B;  3LWF A;  1R5H A;  4S05 A;  1WQ2 A;  1E2X A;  1SD7 A;  1FT9 A;  3O6B B;  3ZPL A;  4L5I A;  5JVT A;  2Z33 A;  1TBX A;  4KIG A;  4G7O F;  1ON2 A;  3RYP A;  4HF0 A;  3I4P A;  4PGH A;  2L54 A;  4HV6 A;  3F3X A;  4GO1 A;  3WE3 A;  3F72 A;  4EJO A;  4HF2 A;  4Q5S F;  4OIN F;  5F6F A;  2HKO A;  1QGP A;  1F5T A;  4LB6 B;  1TW3 A;  2M8E A;  1J5Y A;  1ZAR A;  3TO9 A;  3WTS C;  4LK0 F;  4EMS A;  2CO5 A;  2A69 F;  2VT3 A;  1XMK A;  1FSH A;  1PP7 U;  4BAY A;  2JSC A;  4IXA A;  2VOD A;  3Q9S A;  1R36 A;  2CFX A;  3IC7 A;  2VE9 A;  3JSP A;  2CQK A;  4CGZ A;  3KCC A;  2OQG A;  3ZMZ A;  3BWG A;  5ERI A;  3RI4 A;  1AOY A;  4LFU A;  4HQM A;  1O3T A;  2D2W A;  4L18 B;  3DKW A;  3DEU A;  3M7G A;  3R0A A;  2VC1 A;  4WXD A;  4CDG A;  3RYR A;  3V7C A;  5L3C A;  2O0Y A;  5BPI A;  2IVM A;  1Z05 A;  3KP6 A;  3BDD A;  2ZNZ A;  2DBB A;  2DT5 A;  3L09 A;  1HKQ A;  1FX7 A;  2HQR A;  4WX9 A;  4M74 A;  1T0F A;  3W6K B;  4FHT A;  4NHJ A;  2PQ8 A;  1IXC A;  4ESF A;  2FU4 A;  3KLN A;  2HEO A;  2Z99 A;  2QBY A;  1AWC A;  2RDP A;  4RB0 A;  3P9C A;  1UCR A;  1PUE E;  2ZME A;  2ACJ A;  4GXO A;  5FO5 A;  1FC3 A;  5LRS A;  2MLK A;  3F8F A;  4U0V A;  1SMT A;  1HW1 A;  2WTE A;  1JE8 A;  3I59 B;  4M73 A;  4AIH A;  1W4M A;  4YFN F;  1XGN A;  4EJV A;  4S04 A;  4L9V A;  4HX4 A;  4B8X A;  4B09 A;  3LAP A;  1WI9 A;  1XMA A;  4G6D A;  4LLN A;  2QQB A;  5TRD A;  2PG4 A;  1GVJ A;  2QM3 A;  4A12 A;  4PCQ A;  1TQI A;  3IHU A;  3ERE D;  3IRQ A;  2FQ3 A;  4BHB A;  3D5L A;  2UZK A;  1J0R A;  1YW9 A;  3J7A O;  2Z9O A;  3FXQ A;  1W7P B;  2ZNY A;  3T1B A;  4L9T A;  2D1H A;  3F21 A;  5DUK A;  1ULY A;  3P7N A;  3FXU A;  2COM A;  1BC7 C;  4RGX A;  2ETH A;  2DQL A;  2L01 A;  4YII A;  5HDN A;  2XAG A;  3U1D A;  1DPR A;  2IT0 A;  2GIV A;  1K79 A;  5LGN A;  4BHC A;  4H0E A;  3GW2 A;  4KIB A;  5K5O A;  1W7P D;  2QZ8 A;  3M8F A;  1HW5 A;  2EFQ A;  4XSZ F;  2KKO A;  3MEX A;  5A2Q Z;  2ZKZ A;  1D8K A;  3GO5 A;  4L5J A;  4RB1 A;  1YQA A;  5DCF A;  4MHG A;  1DUX C;  3E5U A;  3FMQ A;  2B0L A;  1S8N A;  4RAY A;  4FT8 A;  5AON A;  2HGC A;  5F1R A;  2NS0 A;  5CYV A;  3O3K A;  2HWV A;  5A2Q K;  4HDU A;  1SFX A;  3BJO A;  5LBQ A;  5AIQ A;  3GFJ A;  3WTT C;  3ECO A;  2CGP A;  1EV7 A;  1FWZ A;  1T6S A;  3K69 A;  1ZG5 A;  3CJN A;  3WTX C;  4A6D A;  1FY7 A;  1LEA A;  3JAM Z;  5LHH A;  2JPB A;  4KIC A;  4O6J A;  4LGW A;  5H20 A;  4BXU A;  4EJU A;  1P2F A;  3KP7 A;  1R1V A;  5DEQ A;  4YIF A;  1R1T A;  2VBX A;  3FWE A;  2IP2 A;  3WTW C;  1KQ8 A;  4JQF A;  2FSW A;  1UFM A;  3HOT A;  3JAM K;  4F7Z A;  1XDU A;  2VT2 A;  3H3Z A;  5K5Q A;  1HXD A;  2PBI A;  3MQ0 A;  1RNL A;  5LGU A;  1U8R A;  3Q9V A;  1QPM A;  1B59 A;  1YS7 A;  1HKT A;  1QZZ A;  4ENN A;  5L3G A;  4HDV A;  2UXX A;  2OD5 A;  1E17 A;  2PMU A;  1I5Z A;  2G7U A;  2FMY A;  1BJA A;  1KGS A;  2EV0 A;  4HLY A;  5E18 F;  4YG2 F;  4OU0 A;  1Z9C A;  4QWQ A;  1BI1 A;  1FP2 A;  2KIU A;  3GFL A;  2HOE A;  1B4A A;  3QRF F;  4BH9 A;  2ZBK A;  3F6V A;  4I0A A;  4Y15 A;  1QQI A;  1IRF A;  1REP C;  2YR2 A;  3JTH A;  2IPQ X;  2O6G E;  3BPV A;  3KET A;  3QAH A;  4KN7 X;  1HKS A;  3I64 A;  2AS5 F;  4AWX B;  1YIO A;  3EET A;  4RAZ A;  1TLH B;  2QQ9 A;  3FF5 A;  1YW7 A;  3HRT A;  4P55 A;  2RVC A;  1UHM A;  4DQ2 A;  4PZJ A;  1G3Y A;  2M87 A;  1MGT A;  3FHZ A;  2GA1 A;  5BOX A;  3KEO A;  1EH8 A;  3JSO A;  4MNU A;  4L9N A;  5E1Z B;  1B9M A;  3U2R A;  5HS9 A;  1IXS B;  3J81 Z;  3GX4 X;  2WV0 A;  2YX7 A;  3ECH A;  2L4M A;  2OQR A;  4IJA A;  4KMF A;  1D5V A;  5J8F A;  4LB5 A;  3I53 A;  2Z3Y A;  2FNA A;  2GXG A;  4WCG A;  2GWR A;  3HHG A;  2LF8 A;  2NNN A;  2UXN A;  1S6L A;  5DCM A;  1XGS A;  4ON0 A;  2Q2E A;  1T39 A;  3ZQ7 A;  3I54 A;  5D4S A;  3KZZ A;  3F23 A;  1HQC A;  2RGV A;  3E6D A;  4CYD A;  2QVO A;  1BOA A;  2X0L A;  4IRG A;  4G9Y A;  1H9T A;  2D1V A;  5EEG A;  2HYF A;  5JHU A;  3R4K A;  1EH7 A;  1SD5 A;  1K78 B;  2YX4 A;  2H09 A;  1CF7 A;  1ZLK A;  4XLN F;  2DO7 A;  2GAU A;  3CUQ B;  1U5T A;  2RN7 A;  2VN2 A;  4I0B A;  2W85 A;  1H0M A;  3WU1 B;  1UST A;  1WKM A;  2MLG A;  2R3S A;  3KP5 A;  2ISZ A;  3LAJ A;  1FPQ A;  1ZGJ A;  1WRJ A;  1BM9 A;  1W5T A;  2Z5U A;  2EV6 A;  4ASN A;  1L3L A;  5ICG A;  3TKY A;  2P6S A;  1Q1H A;  1H9G A;  2E7W A;  3HSE A;  1LDK B;  5J6X A;  1G4D A;  2EV5 A;  2CG4 A;  2DTR A;  4BHP A;  1ZN2 A;  2JZY A;  3RPU A;  1XCB A;  4G8X A;  4UVA A;  2Q8K A;  2OA4 A;  4HX7 A;  3L2C A;  2M5W A;  3DFG A;  1TQM A;  3GXO A;  3RDI A;  5FLX Z;  1ZRC A;  3WU0 A;  1IN4 A;  1G6N A;  2DK8 A;  2NAZ A;  2M1B A;  3WGI A;  3LA2 A;  4NQW A;  3COA C;  2JPC A;  1ZG1 A;  4HQE A;  5FLX K;  1BN5 A;  3SHF A;  1F9N A;  5D5U B;  4A0Y A;  2DLL A;  1TNT A;  2GA2 A;  2IJL A;  1P6R A;  1YTY A;  3KP3 A;  1FZP B;  1P92 A;  1P4X A;  5L3D A;  3V7S A;  1IF1 A;  1IAW A;  2HQN A;  3K1P A;  1V4R A;  3PQJ A;  3MZH A;  5TJJ A;  3V4G A;  4MTE A;  4CHU A;  1YG2 A;  5K5R A;  4MGR A;  1OMI A;  3O2P E;  2IW5 A;  2EJR A;  3LA3 A;  1ZYR F;  2LF7 A;  3SQN A;  1Z91 A;  2PI0 A;  3TO6 A;  4LG0 A;  3ZN0 A;  3GZ5 A;  2ESH A;  2BYV E;  1SFU A;  1A04 A;  3FX3 A;  2EFW A;  4K2E A;  4Q4Z F;  3K1M A;  1ZAO A;  4HAM A;  2XAJ A;  2EK5 A;  4EJW A;  1B6A A;  1YS6 A;  2O3F A;  5CVI A;  2P5L C;  4EGY A;  2LNB A;  4M71 A;  2FBI A;  1R00 A;  1ON1 A;  2DPD A;  5KVR A;  3NEU A;  4A0X A;  5BMZ A;  3FXR A;  3ABU A;  3ZP5 A;  1ONV A;  1R22 A;  2PN6 A;  4XRF A;  2QWW A;  2F5D A;  1BC8 C;  2VC0 A;  1R1U A;  1XDS A;  4Q48 A;  3I5U A;  1LB2 A;  2P4W A;  3V7R A;  3K2Z A;  4HLX A;  3HHH A;  2K86 A;  1U3E M;  2EFN A;  2E1N A;  3RKW A;  5D5X B;  4ENJ A;  1R23 A;  2BBY A;  2A3S A;  3IL2 A;  2GZW A;  3EQL F;  2VXZ A;  3KP4 A;  2BGC A;  3WTU C;  5FB2 A;  1O57 A;  3C3W A;  4L0Y B;  2FA5 A;  1FYL A;  3HUG A;  1LJ9 A;  3TO7 A;  1YO5 C;  4IPA A;  1DDN A;  5FGM A;  4Z2Y A;  2STT A;  1FYM A;  2FOK A;  2XRO A;  4XLP F;  5HVQ C;  2G7H A;  3F8C A;  1UHW A;  4HZF A;  1W5S A;  1MKM A;  3HSF A;  2EA2 A;  2YU3 A;  1G3S A;  2JTV A;  3E3V A;  2K27 A;  1I1G A;  4CXF A;  1P4W A;  4I01 A;  2IA2 A;  5JI6 A;  3F8M A;  3V8L A;  5HS8 A;  2HYG D;  1QNT A;  1MDM A;  4OIP F;  4EV0 A;  5ICF A;  3IKV A;  4UHT A;  1BI3 A;  2V79 A;  1IUY A;  4XBF A;  3LQR A;  1LEB A;  4LMY A;  3MFK A;  3E6C C;  2XAQ A;  2MH2 A;  4AVP A;  4U0Y A;  2V1X A;  1JXS A;  2E7X A;  4R8H A;  2FBH A;  2OZU A;  4O5V A;  2KJB A;  4I7H A;  3ABT A;  2FF4 A;  4UVC A;  1I1S A;  5LRR A;  2RQP A;  2ADU A;  1IN5 A;  2P5K A;  2HR3 A;  2DK5 A;  1IW7 F;  5HDK A;  3VOE A;  3MWM A;  4I98 B;  3T0Y A;  2TDX A;  2F5E A;  3CO7 C;  3J80 K;  3H3U A;  1FSE A;  4PDK A;  2W57 A;  5EEH A;  3R60 A;  2OZ6 A;  5CVU A;  3GLX A;  3BJA A;  2VBW A;  5D8L B;  4E70 A;  3CUO A;  5HLH A;  3REO A;  2KJC A;  5D5V B;  2O61 A;  5ILV A;  1GXP A;  2IRF G;  2O03 A;  4MQ9 F;  4UUV A;  4I2O A;  4PGG A;  3KFW X;  4GCV A;  3I71 A;  2W84 A;  2GQQ A;  4Y17 A;  2XGX A;  1STZ A;  3K1N A;  4LLG F;  5LEK A;  4GGG A;  3L9F A;  1IN8 A;  1KYW A;  1KU3 A;  2XKP A;  2FRH A;  4P9F A;  3IWF A;  5D5W B;  1FBS A;  3EYY A;  1L0O C;  4O3M A;  3DF8 A;  2H6B A;  2K4J A;  3OOP A;  2PLY A;  1U78 A;  3HIF A;  3V8J A;  1C0W A;  4DNC A;  4TV7 A;  3KEQ A;  3QU3 A;  2EB7 A;  2BE5 F;  3JTG A;  2QUF A;  1BBY A;  3WG9 A;  3DQV C;  2K02 A;  1T38 A;  1B9N A;  4UNO A;  4RS8 A;  3ML6 A;  3WE2 A;  2STW A;  4HBL A;  2XVC A;  3MAJ A;  2XKO A;  4HYE A;  4WK8 F;  2IA0 A;  4OIQ F;  1ZRF A;  4GYG A;  2ZO4 A;  2HTS A;  1XD7 A;  1XSD A;  1YFH A;  5FD5 A;  3BRO A;  3BP8 A;  2IA1 A;  3AAF A;  3I59 A;  5JFR A;  3B02 A;  3CTA A;  4R1H A;  3VEP A;  3SZP A;  3S2W A;  3RKX A;  3T8R A;  4WXH A;  1S29 A;  4JBA A;  5ED4 A;  1I6X A;  3KZY A;  3HRS A; 
#chains in the Genus database with same CATH topology
 1MMG A;  1TW2 A;  2HZT A;  2OUM A;  1SAU A;  1SD6 A;  4QLC U;  4KMU X;  3BTL A;  3G3Z A;  1X3W B;  3BR0 A;  3S32 A;  2WV1 A;  3CD6 I;  1EJ9 A;  3R61 A;  1K6Y A;  1T98 A;  3ZMD A;  4BQO A;  1OJL A;  1WJD A;  2G9W A;  2IGO A;  1MBE A;  5CQG A;  1JTX A;  1SAX A;  3U9G A;  3CDL A;  4P96 A;  3K4J A;  2DOE A;  2DW4 A;  1UG2 A;  4FX0 A;  2W25 A;  2F2E A;  4XKC A;  1OPC A;  2XIG A;  3M8J A;  2XB0 X;  5F0C A;  3CCL I;  1ZR4 A;  2H1K A;  4DOZ A;  3QPH A;  3R0J A;  3OYG A;  2HYJ A;  5TGT A;  4KNY A;  1ZG3 A;  1NG6 A;  5L3E A;  4KFC A;  5C4J J;  2E5N A;  5GTH C;  1W7P A;  3EUK L;  4A3B J;  2R7R A;  2ESN A;  1S7E A;  2LK2 A;  3F8N A;  3PO2 J;  2V1U A;  1F4K A;  1LFU P;  5DM6 F;  1IN6 A;  5L3F A;  2HI3 A;  3S16 J;  3CP8 A;  2CWE A;  3L7W A;  3V8K A;  4UVB A;  2HQA A;  1J2X A;  2ZFU A;  2R7W A;  3TQN A;  1UG0 A;  2XPV A;  1IUF A;  1RES A;  4LG3 A;  3C1D A;  2LD5 A;  4N9H A;  3E6M A;  4J01 A;  4LG0 B;  1KU7 A;  4XKV A;  3KYL A;  5CVV A;  2ME0 A;  4D0P A;  2YPR A;  1S3J A;  3RZO J;  1UHS A;  4I02 A;  2K4B A;  2EFO A;  2DDB A;  2DA3 A;  1MBH A;  1UZC A;  2XF6 A;  3U21 A;  2Y9Y A;  4IQ4 A;  5KAF C;  1CGP A;  1IG7 A;  2R5Z A;  2R92 J;  4X6A J;  2V9K A;  2Q0O A;  4JX5 A;  1P4A A;  3AKZ A;  3CCJ I;  2XDV A;  3EDP A;  2CV2 A;  5CVR A;  3GZN B;  1GV5 A;  3GVA A;  2M4G A;  2FUG 2;  2FX0 A;  1GT0 C;  2C6Y A;  2XGE A;  2QSF X;  4AIK A;  3UKG A;  1XN7 A;  2VBY A;  2KT0 A;  3SZT A;  1VQK I;  2V1D A;  2E1M C;  2M8G X;  4PFP A;  1OCT C;  3HDD A;  1B1B A;  1Z67 A;  2R7V A;  1FNN A;  4U88 A;  2QBY B;  3G73 A;  1S72 I;  5K1Y A;  3K6G A;  3A4C A;  1W36 D;  1F36 A;  1SMY F;  4BDY A;  1Z21 A;  2RV8 A;  2L4A A;  1J75 A;  4RA2 A;  4AID A;  4JX6 A;  4HW0 A;  4KDP A;  1VTN C;  2LC2 A;  5EJC A;  2ZME B;  2F5F A;  1LDJ A;  2LY1 A;  2M45 A;  3M07 A;  4ZYE A;  3M1E A;  3KEY A;  3TOA A;  4ZYD A;  3JRC A;  2JA8 J;  2IEK A;  2X4H A;  2OBP A;  2Y69 H;  2CW8 A;  2JUC A;  1H89 C;  4M72 A;  1EKE A;  4FE7 A;  5F0H A;  1MJA A;  2HTJ A;  3OYA A;  2PJP A;  5IT9 Z;  3O8H A;  4OMZ A;  4A5M A;  5HNH A;  3TW7 A;  2CYY A;  3TOB A;  4BS9 A;  1XB4 A;  3TBI A;  4XRS G;  2Y48 A;  4C30 A;  4G7Z F;  3IWZ A;  3IUO A;  2ISY A;  2Z1D A;  3G1L A;  1JTY A;  4CSW A;  1D0Z A;  2A07 F;  3CF5 F;  4HNV A;  5F08 A;  1ZRD A;  1QZY A;  3HRM A;  4I76 A;  2VJ4 A;  3SDB A;  4N9I A;  1OCR H;  2MC4 A;  5FRN A;  5IT9 K;  2K85 A;  4B3X A;  2DT7 B;  1LKX A;  4AU7 A;  1MMN A;  3LA7 A;  1R6R A;  3EUH C;  3VYU B;  3QQA A;  2JJ7 A;  3LFK A;  4DIQ A;  4BEH A;  2VIX A;  2HPI A;  3BZ6 A;  3QPL A;  4XLC A;  3TDZ C;  2MGQ A;  2W24 A;  2ZSH B;  1Z1D A;  2EZI A;  3OL4 A;  3I58 A;  3L1P A;  2BEO A;  4NB5 A;  2DOF A;  2VJJ A;  1TWF J;  1T33 A;  2A6T A;  4XLA A;  4MTD A;  2AQE A;  2E35 A;  1PDN C;  1QHH D;  3W3C A;  1KON A;  1I6H J;  3FMS A;  4B3A A;  1ZRE A;  3A01 A;  1D1C A;  3ISP A;  4CO8 A;  1S7O A;  5ICE A;  2B7E A;  3S3N A;  1EH6 A;  3LSH A;  3F8B A;  2WBM A;  5GPA A;  5H6R A;  1XS9 A;  2WAF A;  4M3E A;  4LIV A;  3GFI A;  2QA4 I;  2RC4 A;  3DPT A;  3R6S A;  3HGY A;  1V3F A;  1WH5 A;  1QBJ A;  2RAE A;  1QPI A;  3NWS A;  2QKM B;  2LKS A;  4Y52 J;  3WTV C;  3VB2 A;  4BYY A;  1HBX G;  1DPU A;  5DD4 A;  4HF1 A;  1T2K A;  2CQ7 A;  3FM5 A;  2CW7 A;  2MD5 A;  4BE1 A;  4A3M J;  3QWL A;  1U6G A;  4PJM A;  4Y13 A;  2K9N A;  1TWG J;  2KMU A;  2QQA A;  4LK1 F;  2O5R A;  4QPQ A;  1BR1 A;  1OYW A;  1RIO H;  2MBF A;  5IYD J;  2X6O A;  2DA4 A;  2LSO A;  3EYI A;  3C18 A;  3GTO J;  3B6C A;  1HF0 A;  3S3O A;  1XTA A;  1R9T J;  1MJB A;  1X1P A;  4LIT A;  4A0Z A;  3KE2 A;  4DW6 A;  2LOO A;  1IGN A;  9ANT A;  1YE9 A;  3HYI A;  3HTS B;  1BJZ A;  3KLO A;  5E17 F;  5D6F A;  3CLO A;  3S1M J;  2HU9 A;  4MEX F;  1HSJ A;  1OCO H;  4B48 A;  2XAF A;  3PIO F;  2R5Y B;  1XSX A;  4UXN A;  1QO0 D;  2CMP A;  1YYV A;  2EA4 A;  4MEY F;  4RGR A;  1Z7U A;  2E36 A;  2KP6 A;  2LTP A;  4IRH A;  2QSH X;  2QKL B;  1WGX A;  2KRF A;  1ZGA A;  5FKM A;  3VFZ A;  3DPL C;  1MD0 A;  4YEL A;  3EUH A;  3ZRG A;  3QPT A;  3CDH A;  1D0Y A;  1RZ4 A;  3FZV A;  4IRI A;  2HFH A;  3HC7 A;  2WAQ N;  3X2Q H;  4DYQ A;  4P9U A;  1WWX A;  2A68 F;  4M9S A;  1BIA A;  1NTC A;  1UB9 A;  3CUQ C;  3QOP A;  5K7F A;  2DYR H;  5J1R A;  5HNF A;  4OOI A;  2VBZ A;  3PUB A;  4A2U A;  3V42 A;  1N75 A;  1WSU A;  2JMW A;  3PFI A;  4U7B A;  2VUM J;  3KYD B;  3OYI A;  3HRU A;  4DYR A;  5LHG A;  3OSG A;  4BNC A;  3CMM A;  3SFZ A;  3PNV A;  1RUO A;  4B4C A;  2OPT A;  3BR6 A;  2DN0 A;  3B6A A;  2KFD A;  4MLO A;  1T95 A;  5H6Q A;  2R7F A;  3CC4 I;  3KYC B;  4KUM A;  1R49 A;  2X6X A;  2L9V A;  1TT0 A;  2J5P A;  5HOO A;  2JA6 J;  3WTZ A;  3JW4 A;  2BY2 A;  2OTL I;  2RRE A;  1MMD A;  3HKZ A;  2XAS A;  2YSR A;  5D6E A;  2EIK H;  2F4M B;  5ILS A;  4AVZ A;  2JA7 J;  2NVQ J;  2ZXJ A;  3P9I A;  3TGN A;  1V54 H;  4OIR F;  5IT3 A;  4Y33 A;  3RCO A;  4LJZ F;  2ZJQ F;  2HS5 A;  3NQO A;  3P9K A;  4OAZ A;  1J9I A;  4ZH4 F;  2DA2 A;  3D1N I;  4BJT A;  5FKL A;  4Z6Y A;  5AIP A;  5LGT A;  3L2U A;  1H88 C;  1HW2 A;  1I3A A;  3JRF A;  1BIB A;  1YRN A;  1Y6I A;  2XGD A;  2NVY J;  2DOD A;  1RI7 A;  2OU2 A;  2HOA A;  2ELH A;  2EIJ H;  2XB5 A;  4YIR X;  1LDD A;  3E97 A;  2KL4 A;  4E7H A;  2R7Z J;  1MBG A;  1X2M A;  4XKW A;  1MNE A;  1IO2 A;  1KQ0 A;  2AHQ A;  4D7M A;  1TC3 C;  2O8X A;  1FOK A;  1X3U A;  4IOC F;  2DCE A;  2ZXH A;  3JRI A;  1JUM A;  5E8I A;  2AXT C;  4GFB A;  3HTU A;  1O7F A;  2WC2 A;  3W6J B;  4UUS A;  4UB6 C;  5BQT A;  1G59 A;  2MH9 A;  1XG1 A;  3ERM A;  3MKZ A;  3PNY A;  3SEQ A;  3NWT A;  1R5G A;  2FOW A;  4LLL A;  2DA6 A;  5BS6 A;  3BCA A;  1K78 A;  1R7J A;  2L3D A;  2E71 A;  4E6K G;  2LDU A;  5EGO A;  1Z6T A;  2XAH A;  1YJN I;  3HOY J;  1G8X A;  2F48 A;  3CUQ A;  5GAG J;  4RB2 C;  1R4M B;  2NYX A;  3CJT B;  3OV8 A;  2R7Q A;  1B8I A;  2J5O A;  2KZG A;  3BOQ A;  4UV8 A;  2BOL A;  2H6C A;  1FLI A;  1O7L A;  1TT5 B;  3PL8 A;  5FFX A;  1MSE C;  2AXL A;  2DQR A;  1Z0X A;  1U9O A;  1ODD A;  4BAC A;  1FYK A;  3TP0 A;  3BG3 A;  5TIS C;  1KA8 A;  2DMQ A;  5IOY A;  3ZCO A;  1YI2 I;  3N4M A;  2NRA C;  3C2B A;  3G2B A;  1YHQ I;  4AYB A;  2CW0 F;  4G94 A;  4XSX F;  2ZJP F;  4PSW A;  1D3Y A;  2XV4 S;  4WXC A;  4FX4 A;  3E5Q A;  4C2U A;  2MG4 A;  3HBL A;  3ABK H;  2P8T A;  2W00 A;  2QLZ A;  4ZYH A;  2HOS A;  1EA3 A;  4EM0 B;  2RKH A;  1JUP A;  4HV5 A;  3GYH X;  2Y31 A;  4ETS A;  4L9J A;  5LEJ A;  4L0Z B;  4IHS A;  4IHY A;  2BVL A;  2ECC A;  3HSR A;  4PJ0 C;  1X2N A;  3KIO A;  1OQY A;  5EEA A;  1IXR C;  1SD4 A;  1A6I A;  4M3B A;  3S1Q J;  4M6Y A;  3GWZ A;  1O3R A;  5JR3 A;  5IP6 A;  2LP0 A;  2WWY A;  1LE8 A;  4XMY A;  1XGO A;  2LY9 A;  3HJE A;  3DXJ F;  2ME6 A;  2EFP A;  2VE8 A;  2Y75 A;  4YFK F;  4D1Q A;  5ICC A;  2E1C A;  1BA5 A;  2QEN A;  3OOU A;  1OKR A;  2EWN A;  3K0L A;  3K70 D;  3MKL A;  4G6Q A;  2DA7 A;  3HXL A;  3FXJ A;  4A6E A;  5CQE A;  2P7V B;  2V6C A;  1Y0U A;  4OIO F;  2XHK A;  3TMO A;  4R79 A;  3W2W A;  2VKE A;  3CCE I;  1JJ8 C;  1YIJ I;  4PSX A;  5J40 A;  3WOD F;  4CIC A;  2DOA A;  4BGD A;  5LHI A;  4BKX A;  1KU2 A;  3J80 Z;  2VB6 A;  3RKY A;  2FBK A;  3HOS A;  2CV1 A;  3HOV J;  3HM5 A;  1I3Q J;  3ZOB A;  2FXA A;  3FIS A;  1ETY A;  5J1Y A;  4ESB A;  2GOX B;  2M30 A;  2D45 A;  1R58 A;  3HGG A;  1R5I D;  2R7D A;  3FXK A;  4KN4 X;  4M9X A;  2F5C A;  2WY7 Q;  2QSG X;  1KQ9 A;  2LMD A;  4XRS A;  1OYI A;  1SVL A;  5FD6 A;  2VJI A;  3WHB A;  2L7Z A;  1XCV A;  1P7I A;  2R5Z B;  3K9T A;  3SJM A;  1LNW A;  4BY1 J;  1FBQ A;  5KK1 A;  1I27 A;  4LOC A;  2ZCW A;  1FBU A;  1A36 A;  2XRN A;  3HOW J;  5DCM B;  2EZK A;  5GPC A;  5IYC J;  3O8G A;  2H94 A;  5BPD A;  1I50 J;  2Q2E B;  3I55 I;  3DV8 A;  1K6O A;  5CLS A;  3AL0 B;  3B73 A;  5FFZ A;  3H5N A;  3DBR B;  5H2F C;  2ZC2 A;  1Z3X A;  4M6X A;  1IZ1 A;  3T5X A;  2EH3 A;  4M3F A;  2ZFW A;  4HX8 A;  3L00 A;  5L3B A;  2HKX A;  1AKH B;  2FML A;  3BR1 A;  4RGU A;  1U2W A;  3DP7 A;  1TQP A;  3NRV A;  5J1U A;  2X9D A;  3RJP A;  3FKJ A;  1J59 A;  4EQQ A;  3HZJ A;  4NNJ A;  2Y9Z A;  1AU7 A;  1CF7 B;  2DJN A;  4B1R A;  2Z2S B;  1U0J A;  3BZC A;  3WGG A;  3RKQ A;  1F1Z A;  1U5T B;  1ZH5 A;  2XAU A;  2Y0S N;  1WCM J;  5M5Y J;  4JOM A;  1IN7 A;  1X3Z B;  1X58 A;  3LFU A;  2XSJ C;  3I0T A;  4E4H A;  3IH2 A;  1MZB A;  5LLQ A;  3ZMU A;  1O3Q A;  3M8E A;  3BY6 A;  3MCZ A;  1OYY A;  2IS4 A;  2KIS A;  3QP5 A;  3ZQQ A;  1TNS A;  2V1N A;  2X6W A;  4KIF A;  4AD9 A;  5EF6 A;  4RB3 C;  3LQQ A;  5E1W A;  4BY7 J;  2AO9 A;  2M4K A;  4XOP A;  3E6B A;  3ZGK A;  2ELK A;  1BI2 A;  2JSP A;  3BC8 A;  3SXY A;  4G7H F;  2DMP A;  4CUG A;  1ETX A;  3RQ4 A;  2A6E F;  3ZN1 A;  4EM2 A;  4KIS A;  3HOZ J;  2X51 A;  2DI3 A;  4A3J J;  1NHA A;  1KYZ A;  1OCZ H;  3ZQH A;  2ZJ2 A;  3VOD A;  2B63 J;  1ETK A;  2CV0 A;  4G6T B;  1G3T A;  3QP6 A;  4YEJ A;  4WWC A;  4M6V A;  1Z77 A;  2LKP A;  5DYM A;  1A35 A;  4EVI A;  4A69 C;  1ZEL A;  3K4M A;  5B1B H;  1FJL A;  4IF4 A;  3A01 B;  4LD5 A;  2L02 A;  3OIP A;  1V5G A;  2L9R A;  4CZC A;  1VQN I;  3G6E I;  5M5W J;  1K83 J;  1BL0 A;  5ILU A;  2A61 A;  2W4S A;  3M9A A;  3GF2 A;  4KYW A;  2WB1 N;  2FNP A;  3CDI A;  5D4R A;  5IP7 J;  3GFM A;  4HST A;  3ULQ B;  4II2 A;  4AC0 A;  4A5N A;  4WF2 A;  4RAG A;  3ELK A;  4C3I J;  4PK4 A;  1RKT A;  2W1O A;  2FD5 A;  5E20 A;  5HLI A;  5EG0 A;  2A5Y B;  2L7M P;  5E8G A;  3CCV I;  2XSD C;  1D1B A;  5HLG A;  1USS A;  4IO9 F;  3ZMT A;  3RPU D;  3JRH A;  1LVA A;  6PAX A;  3AG3 H;  2NNY A;  1VQ7 I;  1OR7 A;  4KT5 C;  4CZZ A;  1DU0 A;  2KIF A;  4NQW B;  1IRG A;  4YFX F;  3FKI J;  3KP2 A;  5C4X J;  3ZMV A;  2JT1 A;  2EQR A;  3CCY A;  2A6H F;  2V7F A;  5DV5 A;  2OAZ A;  2FE3 A;  2QEX I;  2MA3 A;  2DPU A;  1JT6 A;  3AL0 C;  1QHG A;  4IHT A;  4NDL A;  1DP7 P;  2P6T A;  3QU6 A;  5GAE J;  2JRM A;  4I09 A;  3C7J A;  2CUZ A;  3TED A;  2CSO A;  2DFI A;  2PEX A;  2DA5 A;  5DDG A;  1PVE A;  3OS0 A;  3IRR A;  3IV5 A;  4ENK A;  3D0S A;  2GXB A;  4J00 A;  5JLW A;  2ICW G;  2HDD A;  2P7C B;  1TTY A;  1ZHF A;  3WG7 H;  2V9V A;  1J7K A;  3DLL F;  1RUN A;  3BG7 A;  2M34 A;  4P1W A;  3F6O A;  4FTH A;  3K4L A;  4MQV A;  4XON A;  4ENM A;  2MC3 A;  4QIW N;  1VND A;  1V55 H;  1JHF A;  2R0Q C;  3E5X A;  2KRH A;  1U5T C;  1HST A;  3FM3 A;  3TDU C;  5D8K B;  1E3H A;  4ESJ A;  3WTY C;  4HA8 A;  2L9S A;  2EIL H;  2R93 J;  2K7L A;  3GTM J;  4UV9 A;  4JYK A;  4JP0 A;  1KU9 A;  1X1A A;  2DAO A;  3FMR A;  2KIQ A;  1QZE A;  1GV2 A;  2OV7 A;  3K4K A;  3LST A;  4JK1 X;  3G4S I;  2ID3 A;  1AHD P;  2UWM A;  4XQF A;  2I10 A;  2PX9 A;  3VSK A;  3CP2 A;  1K7A A;  5DD8 A;  3MZY A;  1MBJ A;  5DUI A;  1IC8 A;  1JKP C;  4C3J J;  2X1C A;  2RNJ A;  4BDZ A;  5J4V A;  3PQK A;  1FP1 D;  1LQ1 A;  2Q1Z B;  3D5S C;  1J09 A;  1H8A C;  3OYL A;  2Y0M A;  3FXL A;  1XGM A;  1G3W A;  2PMH A;  3DEE A;  3ZXS A;  3GZ6 A;  3E7L A;  1PP8 F;  2MFZ A;  1ZLJ A;  3IP4 B;  3QOD A;  3RIR A;  3F22 A;  2O9L A;  4GYI A;  5B66 C;  3PUF A;  4OMY A;  1GHC A;  3P5J A;  3GEZ A;  1FEX A;  2VON A;  2XF5 A;  2MAB A;  1VQO I;  1YRN B;  2VPR A;  1X19 A;  2GLO A;  3TL4 X;  3N05 A;  2PFB A;  3J81 K;  1D8J A;  2KIM A;  2FEZ A;  3GME A;  4QPO A;  4RLF A;  4ZZL A;  1SFE A;  1MSF C;  4C2T A;  1MJ9 A;  3Q5F A;  2PMZ N;  4HOB A;  4AIJ A;  1YW8 A;  4P5O A;  3LSJ A;  3W2V A;  5KHD A;  3CCU I;  3RPQ A;  3MKW B;  5CJ9 A;  3OMY A;  4U7D A;  2JVG A;  4ZZD A;  3I3L A;  2XUB A;  2M2E A;  4EGZ A;  3BJ6 A;  4U0W A;  4LIU A;  2OCE A;  4KIT B;  1PUF A;  5HS7 A;  2HZD A;  1XSV A;  5JVG F;  1V5E A;  1MBK A;  3H92 A;  3HUG B;  2JRT A;  1UAA A;  2L5Q A;  2V9P A;  2VOO A;  1GXQ A;  1JHH A;  4ITV A;  3ZMS A;  2H27 A;  1JKO C;  2HDC A;  3IKT A;  3MZ8 A;  1YJW I;  1Z6R A;  1BI0 A;  1JGS A;  3CO6 C;  4N0B A;  2P5V A;  1HA8 A;  5HDG A;  4EM1 A;  4BQA A;  4A3L J;  1AA7 A;  2BY0 A;  1YLF A;  3N97 A;  2QYO A;  3ASN H;  3K4N A;  3IH3 A;  2MSY A;  5CVJ A;  3WGH A;  1HDP A;  5E1X A;  2LVS A;  4ZYG A;  1S7A A;  4IKF A;  3GUD A;  5B5E C;  2BW3 B;  1IRZ A;  4RM3 A;  2VOP A;  3CLQ A;  3H0G J;  5IP9 J;  5F64 A;  3OL3 A;  2LY2 A;  5J8C A;  4KA4 A;  1O4X A;  3T8T A;  4IVN A;  5EYR A;  4Q47 A;  3FDY A;  5IYB J;  4RGS A;  3BPX A;  3ROU A;  3FK7 A;  2BV6 A;  4M9Z A;  4EJT A;  3RTR A;  1O3S A;  2DU9 A;  1JJ6 C;  1MDM B;  1VQ8 I;  4MFD A;  3LWF A;  1R5H A;  2PJR A;  3BG6 A;  4IQJ A;  3CJR B;  4S05 A;  4B44 A;  1WQ2 A;  1E2X A;  1SD7 A;  1FT9 A;  3ONQ A;  3O6B B;  1B72 B;  1W36 C;  4L5I A;  3ZPL A;  3JRB A;  3DU5 A;  5JVT A;  2CQQ A;  2M0M A;  3DCF A;  2Z33 A;  4AM3 A;  1TBX A;  4KIG A;  4G7O F;  3OR1 C;  4E7K A;  1ON2 A;  3RYP A;  4OAY A;  4HF0 A;  3I4P A;  4PGH A;  1WJF A;  2L54 A;  3PSI A;  4HV6 A;  3F3X A;  4GO1 A;  3WE3 A;  5FKN A;  3F72 A;  1T0F C;  1WJE A;  3A02 A;  3PM1 A;  4EJO A;  4HF2 A;  1YOV B;  4Q5S F;  3L2W A;  4OIN F;  2ZXI A;  5F6F A;  3OYD A;  2HKO A;  3LSR A;  2CUJ A;  2VQC A;  1QGP A;  1F5T A;  1Y1W J;  4LB6 B;  1TW3 A;  2ID6 A;  1RPW A;  2M8E A;  1J5Y A;  2X48 A;  1SFO J;  1ZAR A;  3H9J A;  3TO9 A;  3WTS C;  3K10 A;  3BTI A;  4LK0 F;  4EMS A;  2CO5 A;  2K9S A;  2A69 F;  2VT3 A;  1XMK A;  1Y56 A;  2CJJ A;  1HLV A;  1FSH A;  3DTK A;  1PP7 U;  4BAY A;  2JSC A;  4IXA A;  2VOD A;  3Q9S A;  3H1C A;  2ZME C;  1OFC X;  1R36 A;  2CFX A;  3OYC A;  2OF7 A;  3IC7 A;  3H9G A;  4X0G A;  2VXD A;  2VE9 A;  2O8K A;  1VQ5 I;  3JSP A;  2CQK A;  4CGZ A;  3PJR A;  3KCC A;  2OQG A;  3H36 A;  3ZMZ A;  3BWG A;  1IV6 A;  5ERI A;  1MBF A;  3RI4 A;  1AOY A;  4UY8 I;  4LFU A;  4HQM A;  4FIS A;  1O3T A;  2D2W A;  2GOM A;  4L18 B;  3DKW A;  2HQ5 A;  2K5C A;  2HVS A;  3HEF A;  3DEU A;  2CFO A;  3M7G A;  3R0A A;  1MND A;  5DM7 F;  2VC1 A;  4WXD A;  4CDG A;  1A31 A;  3RYR A;  1HOM A;  4XM3 A;  3V7C A;  5L3C A;  2TRT A;  2O0Y A;  2KDO A;  5BPI A;  2K3P A;  2LRD A;  2IVM A;  1Z05 A;  1WVR A;  3KP6 A;  3TP3 A;  1V5F A;  3BDD A;  2ZNZ A;  3OYN A;  2QGU A;  2GIZ A;  2DBB A;  3PFY A;  3BTC A;  2K40 A;  2DT5 A;  3L09 A;  1HKQ A;  1FX7 A;  2HQR A;  1W1W E;  2LYC A;  1EF4 A;  4WX9 A;  5KNL A;  2KPM A;  3A03 A;  4ZDL A;  4M74 A;  1T0F A;  3W6K B;  4FHT A;  4NHJ A;  4M3D A;  2A5W A;  1R71 A;  5HOD A;  2PQ8 A;  3J7Z I;  1RRJ A;  1IXC A;  4ESF A;  4ZYA A;  2FU4 A;  3KLN A;  1FTZ A;  2HEO A;  4I99 C;  1FTT A;  3LSM A;  1ZQ3 P;  2Z99 A;  3BT9 A;  3HB9 A;  4CCJ A;  4XNF A;  2KRC A;  2QBY A;  4EAT A;  1AWC A;  4DBQ A;  1ORK A;  2RDP A;  4RB0 A;  2X1E A;  1Q1V A;  3P9C A;  1UCR A;  2JVH A;  3OYM A;  1PUE E;  2FQ4 A;  3CES A;  2ZME A;  4IHX A;  2ACJ A;  4GXO A;  5FO5 A;  1FC3 A;  4BQQ A;  3I9V 2;  3SZG A;  2LBF B;  3E0J B;  4M3G A;  4PJN A;  4A93 J;  5LRS A;  2MLK A;  4CH7 A;  3PIP F;  4DZP A;  3DPU A;  4E7S A;  3L2Q A;  3F8F A;  4U0V A;  1OCP A;  1SMT A;  2XC7 A;  1HW1 A;  1QU3 A;  2DXI A;  5C44 J;  3BG9 A;  2WTE A;  1JE8 A;  3CC2 I;  3I59 B;  3L2V A;  4CYC B;  4M73 A;  1XX5 A;  3ZR8 X;  4B47 A;  1VQP I;  1FOY A;  4AIH A;  1K4S A;  2N8G A;  4HRI A;  1W4M A;  4YFN F;  2R7X A;  5F0F A;  1Y8R B;  1XGN A;  4EJV A;  4S04 A;  4L9V A;  4HX4 A;  4PUS A;  3OY9 A;  3G71 I;  4RM2 A;  4B8X A;  4B09 A;  3LAP A;  1VF9 A;  1WI9 A;  4A3I J;  1XMA A;  2WB1 A;  4U87 A;  1ZR2 A;  1WJC A;  4G6D A;  2CUF A;  4LLN A;  3GTK J;  1M1E B;  2QQB A;  5TRD A;  2F4I A;  2PG4 A;  3KZI C;  4W97 A;  1GVJ A;  2QM3 A;  4A12 A;  3ZQI A;  4PCQ A;  2IS2 A;  1TQI A;  2OC6 A;  3IHU A;  3LSP A;  3ERE D;  2LRE A;  3SDG A;  1SAN A;  4ZC3 A;  2P0W A;  3DEW A;  3IRQ A;  2FQ3 A;  3MN2 A;  4BHB A;  1FIA A;  1JUS A;  3MMY B;  2OTJ I;  4CCK A;  3D5L A;  2CQX A;  2M9H A;  4HEA 2;  2UZK A;  3WU2 C;  1J0R A;  1YW9 A;  3J7A O;  2Z9O A;  3FXQ A;  2ZJR F;  1W7P B;  2ZNY A;  3T1B A;  1K4T A;  5KAI C;  4L9T A;  4E7J A;  2D1H A;  3LMM A;  3F21 A;  2W82 A;  3QYF A;  3U1K A;  5DUK A;  1UJ8 A;  3P7N A;  1MIJ A;  3FXU A;  2COM A;  1BC7 C;  3BQZ A;  4RGX A;  2ETH A;  1TWA J;  4HNU A;  2DQL A;  1Y0N A;  2P81 A;  3OS2 A;  1MMA A;  2L01 A;  4YII A;  4KJZ A;  3BG5 A;  3RZD J;  5HDN A;  2XAG A;  1PJR A;  3U1D A;  1DPR A;  2H8R A;  2IT0 A;  2GIV A;  3DTI A;  1K79 A;  5IY5 H;  5LGN A;  4IZZ A;  4BHC A;  4H0E A;  3GW2 A;  2K9L A;  4KIB A;  5K5O A;  2TCT A;  3LSI A;  5E3N A;  1W7P D;  3DBH B;  1WJB A;  2QZ8 A;  3M8F A;  1HW5 A;  2EFQ A;  3JRE A;  4XSZ F;  2KKO A;  2JQ7 A;  3OYF A;  3MEX A;  3OIQ A;  4ABZ A;  2R5Y A;  5A2Q Z;  2ZKZ A;  4CCO A;  1D8K A;  1NK3 P;  3GO5 A;  1T56 A;  3DWL E;  4L5J A;  4RB1 A;  1YQA A;  2E5Z A;  5DCF A;  2BHY A;  4MHG A;  3OS1 A;  1DUX C;  3E5U A;  3FMQ A;  4BXX J;  1T08 B;  2B0L A;  3LSG A;  1S8N A;  4RAY A;  4FT8 A;  5AON A;  2HGC A;  3HKZ N;  2LH9 A;  5F1R A;  4DGW B;  5J47 A;  2WAD A;  3ZQL A;  2NS0 A;  3OR2 C;  5CYV A;  3O3K A;  3GBG A;  4V19 K;  2HWV A;  4RBO A;  5K7H A;  1WJA A;  5A2Q K;  1U9N A;  4HDU A;  1SFX A;  4XLH A;  3BJO A;  4FE4 A;  5LBQ A;  5AIQ A;  3FK6 A;  2WA0 A;  2Y30 A;  3HOU J;  3GFJ A;  3WTT C;  3ECO A;  5B1A H;  1BW5 A;  1ETQ A;  2CGP A;  2YS9 A;  2KQR A;  1EV7 A;  1IRX A;  1FWZ A;  3FBN B;  3GLL A;  1RR7 A;  2E2H J;  1T6S A;  3K70 C;  3K69 A;  1ZG5 A;  4BQN A;  3CJN A;  3OWT A;  4A6D A;  3WTX C;  1FY7 A;  1ZKG A;  1LEA A;  1WHU A;  2X1D A;  2XGC A;  3JAM Z;  1VZ0 A;  4V2F A;  2W48 A;  1LPQ A;  3Q0V A;  5LHH A;  2JPB A;  1Z3Y A;  1NK2 P;  4KIC A;  2KDZ A;  4O6J A;  1TZL A;  4LGW A;  1VI0 A;  5H20 A;  2WAE A;  4BXU A;  4EJU A;  2KHM A;  1P2F A;  4XR6 A;  3KP7 A;  5B3S H;  1R1V A;  5DEQ A;  4YIF A;  1R1T A;  5GAH J;  2VBX A;  3CMA I;  2UUZ A;  3FWE A;  3HPH A;  2IP2 A;  2RNG A;  4F55 A;  3WTW C;  4A3K J;  4JQF A;  1KQ8 A;  2DT6 A;  4BEH B;  2FSW A;  1UFM A;  2CUE A;  3HOT A;  2YU9 J;  3JAM K;  4XOT A;  2R4G A;  4F7Z A;  1IDZ A;  1XDU A;  2VT2 A;  3H3Z A;  4V2G A;  1JT0 A;  1S9H A;  5K5Q A;  2NVT J;  1HXD A;  2PBI A;  3MQ0 A;  4NC8 A;  2CQN A;  4AUX A;  1RNL A;  1POG A;  4BXF A;  5LGU A;  1U8R A;  4FQG A;  3Q9V A;  1QPM A;  1B59 A;  2HPM A;  2HNH A;  1YS7 A;  1HKT A;  2DYS H;  3VWB A;  3GTL J;  1QZZ A;  2HVR A;  4ENN A;  5L3G A;  4HDV A;  2UXX A;  2OD5 A;  3C2H A;  1E17 A;  2PMU A;  1I5Z A;  1E3O C;  2E1M B;  2G7U A;  2FMY A;  1GDT A;  1BJA A;  3UR3 C;  1WJ5 A;  1KGS A;  2EV0 A;  4HLY A;  5E18 F;  3H35 A;  1SEU A;  1W5C C;  3S2D J;  1NG7 A;  4YG2 F;  4OU0 A;  1K61 A;  1GUU A;  1Z9C A;  4QWQ A;  1BI1 A;  2DFE A;  4XL9 A;  3PSF A;  1FP2 A;  4S0H B;  2KIU A;  2EIN H;  3NAR A;  1SFK A;  4XOR A;  2EBI A;  3MD2 A;  3GFL A;  2HOE A;  1E0E A;  1WZ2 A;  5E3L A;  3H3V K;  1B4A A;  1YIT I;  2AQF A;  2XPW A;  3QRF F;  4BH9 A;  4Y7N J;  2ZBK A;  3F6V A;  1ETO A;  2KZV A;  3GTQ J;  3DKX A;  4I0A A;  4Y15 A;  1QQI A;  5M3M J;  1WH7 A;  1IRF A;  1REP C;  3CJQ B;  2YR2 A;  4GDF A;  3A0H C;  3CC7 I;  3JTH A;  5J4Y A;  2IPQ X;  2WY8 Q;  2O6G E;  1MMS A;  3BPV A;  3KET A;  2HDW A;  3QAH A;  3LL7 A;  2OCC H;  2FJ1 A;  4F93 B;  4MFE A;  2DA1 A;  1GLN A;  4KN7 X;  2IGK A;  4IX7 A;  3Q3S A;  1HKS A;  1ETV A;  5FKK A;  3OYJ A;  3S1N J;  3I64 A;  2DTZ A;  3EPZ A;  2AS5 F;  3G1O A;  4AWX B;  2E2I J;  1YIO A;  1D0X A;  3EET A;  2CS3 A;  3KPH A;  4RAZ A;  1TLH B;  2L7F P;  2QQ9 A;  3FF5 A;  1Z7L A;  1YW7 A;  3S3M A;  3BR5 A;  3HRT A;  1DP3 A;  4P55 A;  1PYV A;  3OYE A;  1DGW Y;  3LSK A;  3HOX J;  2RVC A;  1UHM A;  4BUP A;  3ZQG A;  4DQ2 A;  4PZJ A;  1DGR M;  1G3Y A;  2M87 A;  2Y2Z A;  2V6E A;  1MGT A;  5CKT A;  2XRL A;  3FHZ A;  2GA1 A;  4BL0 B;  5BOX A;  3KEO A;  1EH8 A;  3JSO A;  3FXM A;  4MNU A;  4L9N A;  5E1Z B;  4D5C A;  1ITY A;  5F04 A;  1IV8 A;  5K7Z A;  2CRG A;  4FAS D;  1B9M A;  3U2R A;  2WAQ A;  5HS9 A;  1IXS B;  3J81 Z;  3GX4 X;  2WV0 A;  2VKV A;  5FJ8 J;  1JGG A;  1YX5 A;  3AG1 H;  2YX7 A;  2M7B A;  2UV1 A;  3S93 A;  3ECH A;  2L4M A;  2OQR A;  4IJA A;  4KMF A;  1D5V A;  3DTE A;  5J8F A;  3I53 A;  1HCR A;  2D5V A;  4LB5 A;  2Z3Y A;  2FNA A;  2GXG A;  4WCG A;  4D9J A;  2GWR A;  4NC6 A;  5JLX A;  5EZG A;  3CCM I;  3HHG A;  2LF8 A;  2NNN A;  2UXN A;  3S17 J;  4IHW A;  2I5U A;  3K7A J;  1S6L A;  3E1S A;  3A1Y A;  5DCM A;  1XGS A;  2BY1 A;  4ON0 A;  2Q2E A;  4IOA F;  1T39 A;  2VL8 A;  5KCM A;  4E7I A;  3QOE A;  1E3P A;  3ZQ7 A;  2EZH A;  4NBQ A;  1N77 A;  2JA2 A;  3I54 A;  2NS8 A;  3KZZ A;  2E1O A;  5D4S A;  3F23 A;  4F92 B;  3CQZ J;  3PO3 J;  1HQC A;  2RGV A;  3E6D A;  4C9Y A;  2VPL A;  4HPQ A;  4CYD A;  2QVO A;  1BOA A;  2X0L A;  2ZB9 A;  4IRG A;  4G9Y A;  4RAF A;  1AKH A;  1H9T A;  2D1V A;  5EEG A;  4UUS B;  2HYF A;  4EEF G;  2ZXW H;  3MVP A;  5JHU A;  2ELJ A;  3R4K A;  2NXN B;  2R7S A;  1EH7 A;  1SD5 A;  5GP9 A;  1K78 B;  3AG2 H;  1HDD C;  2YX4 A;  2H09 A;  4NC7 A;  3FHN A;  1LFB A;  3JRD A;  5EGO B;  1CF7 A;  3FXO A;  1ZLK A;  4XLN F;  3SFI A;  2DO7 A;  2GAU A;  2QQ8 A;  2A05 A;  3CUQ B;  3CCR I;  1U5T A;  2RN7 A;  2VN2 A;  3Q0W A;  1B8I B;  4I0B A;  4A3D J;  2W85 A;  2NOJ B;  1H0M A;  3WU1 B;  2IAI A;  4A3E J;  1UST A;  1WKM A;  2MLG A;  2R3S A;  3KP5 A;  2ISZ A;  5FLV A;  3LAJ A;  1FPQ A;  1ZGJ A;  1MH4 A;  3CF2 A;  1Y1V J;  1WRJ A;  1BM9 A;  4CCN A;  1W5T A;  2IXS A;  3W2A A;  3GCM A;  2Z5U A;  2EV6 A;  2NOG A;  3QYB A;  4ASN A;  1L3L A;  1UMQ A;  1OIS A;  5ICG A;  2VI6 A;  3TKY A;  2W7N A;  2P6S A;  1Q1H A;  1H9G A;  2E7W A;  5FRO A;  3D5R C;  5HLT A;  3HSE A;  4UUT A;  1LDK B;  1LVK A;  2X85 A;  3SYT A;  3FIW A;  3QYE A;  4Y4R A;  5J6X A;  1G4D A;  2EV5 A;  5GTI C;  2CG4 A;  2DTR A;  4UB8 C;  4BHP A;  1ZN2 A;  1U8B A;  2MYS A;  5BNG A;  3CME I;  2JZY A;  2HXI A;  3F9K A;  2LKX A;  3RPU A;  1XCB A;  4G8X A;  1NH3 A;  3HL2 A;  4W1U A;  2IS1 A;  4XID A;  1LE8 B;  1T8I A;  4UVA A;  2Q8K A;  2OA4 A;  4F52 A;  4HX7 A;  5F1J A;  4QSH A;  2L0K A;  2VKH A;  4XK4 A;  2GXA A;  3L2C A;  2ZSI B;  2M5W A;  3CCS I;  3DFG A;  3M4O J;  1TQM A;  3GXO A;  2EPF A;  2B9S A;  3H5A A;  1WI3 A;  3RDI A;  3BTJ A;  3L2R A;  3A0B C;  2L9N A;  3ASO H;  3H0D A;  2CH0 A;  3VYR B;  5FLX Z;  1ZRC A;  3IAS 2;  4ZJZ A;  3WU0 A;  1IN4 A;  1G6N A;  1UEL B;  3HRS A;  3S1R J;  2DK8 A;  4GRI A;  2NAZ A;  4ZDO A;  2M1B A;  1LFP A;  1R4N B;  3OYH A;  4C2M J;  3WGI A;  2JK3 A;  4G12 A;  3OSF A;  3LA2 A;  4NQW A;  4YRV A;  2XPU A;  5CPR B;  3COA C;  2L7K A;  2JPC A;  1ZG1 A;  4HQE A;  5FLX K;  3I4N J;  1BN5 A;  3F0C A;  3SHF A;  1F9N A;  1XPX A;  4L5E A;  5D5U B;  4A3G J;  3C2G A;  5FKO A;  4A0Y A;  4RDU A;  4HG2 A;  2DLL A;  1TNT A;  3VYT B;  2GA2 A;  2IJL A;  3JR9 A;  1P6R A;  1QRY A;  1YTY A;  3KP3 A;  1FZP B;  2LLK A;  3WHC A;  1Y39 A;  1P92 A;  2H1L A;  1P4X A;  3H5R A;  1OLT A;  4PJJ A;  5L3D A;  3V7S A;  1MW7 A;  4BBR J;  1IF1 A;  1IAW A;  2HQN A;  2NVU B;  1S5L C;  1APL C;  2LFB A;  2VQG A;  3K1P A;  1ETW A;  1VQ4 I;  3K2A A;  1A6Q A;  1JKQ C;  1RC9 A;  1V4R A;  4DZJ A;  3PQJ A;  4F91 B;  3MZH A;  5TJJ A;  2E60 A;  3V4G A;  4MTE A;  4BU2 A;  4CHU A;  4N4N B;  1YG2 A;  2HVQ A;  5K5R A;  4PFO A;  2R7O A;  4MGR A;  1OCC H;  1OMI A;  3O2P E;  3JCU C;  3ZQC A;  2IW5 A;  2EJR A;  3LA3 A;  3DBL B;  3AFH A;  5LD2 C;  1ZYR F;  2LF7 A;  3HG9 A;  3SQN A;  1Z91 A;  2PI0 A;  1TWC J;  1CQT A;  3TO6 A;  3EUA A;  4LG0 A;  3ZN0 A;  3GZ5 A;  4ZTJ A;  2X6Y A;  4XN3 A;  5IPA A;  2ESH A;  2BYV E;  1SFU A;  3G1M A;  1A04 A;  1BR4 A;  3FX3 A;  2EFW A;  3BLY A;  4K2E A;  4Q4Z F;  2LR8 A;  2F5V A;  2F4O B;  3K1M A;  1ZAO A;  4HAM A;  2XAJ A;  2DMT A;  2EK5 A;  4D7N A;  4EJW A;  3OYB A;  4D5F A;  4MO7 A;  1MNM C;  1B6A A;  1YS6 A;  2O3F A;  2M7A A;  4DJA A;  1ENH A;  5CVI A;  2P5L C;  4EGY A;  2LNB A;  4M71 A;  2FBI A;  1R00 A;  1ON1 A;  2DPD A;  3OIO A;  2BVM A;  4OWR B;  2GM4 A;  5KVR A;  4XKB A;  3GTP J;  2YUS A;  3BQY A;  2BXZ A;  3NEU A;  5EZH A;  2DDA A;  1P9Q C;  2Y0S A;  3VDX A;  4A0X A;  2Z16 A;  5BMZ A;  3FXR A;  2VKD A;  3ABU A;  3ZP5 A;  1ONV A;  3VSL A;  1R22 A;  2PN6 A;  4XRF A;  3S14 J;  2BY3 A;  2F5D A;  2QWW A;  1BC8 C;  2VC0 A;  1RR8 C;  1MH3 A;  1R1U A;  1XDS A;  4Q48 A;  2COB A;  2JN6 A;  3I5U A;  1LB2 A;  2P4W A;  2EZL A;  3V7R A;  1JKR C;  1BOB A;  3BCB A;  3K2Z A;  4HLX A;  1QVU A;  2VLA A;  3HHH A;  3S2H J;  2K86 A;  1U3E M;  2EFN A;  2E1N A;  1YX3 A;  4X1E A;  3RKW A;  5D5X B;  4ENJ A;  1R23 A;  5F27 A;  4BE2 A;  2BBY A;  2I8D A;  2A3S A;  2NVX J;  3IL2 A;  2GZW A;  1BR2 A;  3EQL F;  2VXZ A;  3KP4 A;  2BGC A;  4J19 A;  3WTU C;  2QF7 A;  5FB2 A;  1O57 A;  3C3W A;  4L0Y B;  2FA5 A;  3KX2 A;  1FYL A;  2HXO A;  3HUG A;  4E7Z A;  1LJ9 A;  5EG0 B;  4A3C J;  1W0T A;  3TO7 A;  4DBR A;  4CCM A;  1YO5 C;  4IPA A;  4A3F J;  1DDN A;  5FGM A;  2BXY A;  3S8P A;  4Z2Y A;  3CMY A;  2STT A;  1FYM A;  2FOK A;  2E34 A;  2XRO A;  5DTD A;  4XIC A;  4NUB A;  1WPK A;  4XLP F;  3J7Y J;  1SC7 A;  5HVQ C;  1BW6 A;  2G7H A;  2IBD A;  5GAD J;  3F8C A;  1UHW A;  4BJ6 C;  2JA5 J;  4JX4 A;  4HZF A;  1W5S A;  1MKM A;  3HSF A;  2EA2 A;  2YU3 A;  1N78 A;  1G3S A;  2BW3 A;  2R7T A;  3CZ6 A;  2JTV A;  1IJW C;  3GTG J;  1TWH J;  1FOX A;  3ESW B;  3E3V A;  3H9Q A;  2OJE D;  1X4O A;  2IGN A;  2DMU A;  2K27 A;  2G0E A;  1I1G A;  4CXF A;  1P4W A;  4I01 A;  2IA2 A;  5JI6 A;  4RMN A;  3K4B A;  3F8M A;  3PNT A;  4II3 A;  3V8L A;  1QA6 A;  5HS8 A;  2XF7 A;  1XC5 A;  3UNG C;  2HYG D;  1QNT A;  2EIM H;  3DLA A;  1MDM A;  4EV0 A;  4H4K C;  4OIP F;  4BBS J;  5ICF A;  3IKV A;  4UHT A;  3A2K A;  5M3F J;  4N4O B;  1BI3 A;  3JRG A;  3TW6 A;  2V79 A;  1IUY A;  1YJ9 I;  2JWT A;  4XBF A;  5DS9 A;  3LQR A;  1LEB A;  1Y8Q B;  4PJL A;  4LMY A;  3MFK A;  3ABL H;  3E6C C;  4RLQ A;  2XAQ A;  1B72 A;  2MH2 A;  3HPG A;  1A5J A;  3LNQ A;  4AVP A;  3BR3 A;  3OYK A;  2MW8 A;  4U0Y A;  2V1X A;  1JXS A;  2BHZ A;  2E7X A;  3ABM H;  2QCO A;  3AG4 H;  3BR2 A;  4R8H A;  2FBH A;  2OZU A;  4O5V A;  2DFF A;  1KZH A;  2GBY A;  2KJB A;  1SVM A;  3IAM 2;  1D5Y A;  1RET A;  4I7H A;  3JRA A;  3W6V A;  3ABT A;  2JUG A;  2FF4 A;  5FLM J;  4UVC A;  1I1S A;  2K9Q A;  5LRR A;  1ZGW A;  3DKY A;  1N25 A;  4QTR A;  2RQP A;  2ADU A;  1IN5 A;  2P5K A;  2V4J C;  2HR3 A;  2DK5 A;  1IW7 F;  5HDK A;  1DU6 A;  3VOE A;  1TL8 A;  5LFA A;  4E7L A;  3MWM A;  4I98 B;  3T0Y A;  5E79 C;  2TDX A;  2F5E A;  3CO7 C;  2IGM A;  2L2O A;  3CCQ I;  4XLE A;  2M3A A;  2R7U A;  4IHV A;  3J80 K;  1VQL I;  3H3U A;  1FSE A;  1FMW A;  1ERD A;  4PDK A;  3J7A Y;  4KT6 A;  2W57 A;  2IS6 A;  2VQL A;  5EEH A;  4FCY A;  3R60 A;  4IEJ A;  3MKY B;  2OZ6 A;  1RKW A;  2E19 A;  5CVU A;  1XMX A;  4ZTF A;  5JHF A;  3GLX A;  3BJA A;  2VBW A;  4MIM A;  5D8L B;  2K9M A;  2ECB A;  4E70 A;  3BZK A;  3Q0U A;  3CUO A;  5HLH A;  3DU6 A;  4B43 A;  3REO A;  2KJC A;  5D5V B;  3VYS B;  2O61 A;  5ILV A;  1VFC A;  2F6C A;  1GXP A;  2IRF G;  5FRM A;  2O03 A;  2O7O A;  4MQ9 F;  4UUV A;  1VQ6 I;  4I2O A;  1TP4 A;  4PGG A;  4Y3O A;  3KFW X;  4GCV A;  3I71 A;  4CCL A;  1PUF B;  2W84 A;  2GQQ A;  1LUJ B;  4Y17 A;  3RQI A;  1X4P A;  1ZTR A;  3IH4 A;  1I39 A;  2VAS A;  2XGX A;  1STZ A;  1WFX A;  2E2J J;  3K1N A;  4LLG F;  5LEK A;  5C3E J;  1OR7 C;  5EDN A;  4GGG A;  3L9F A;  1IN8 A;  1KYW A;  1KU3 A;  3LOC A;  2XKP A;  4XLF A;  1F43 A;  3ZQF A;  2PMZ A;  3GTJ J;  4ANJ A;  1FIP A;  2FRH A;  2VJ5 A;  4P9F A;  1G2H A;  3IWF A;  5D5W B;  1FBS A;  1VQ9 I;  1HC8 A;  3EYY A;  4BE0 A;  1GVD A;  5M5X J;  1L0O C;  4O3M A;  3DF8 A;  5E3M A;  3M3Y J;  4F3Q A;  2H6B A;  3M1C A;  2K4J A;  3OOP A;  4XN0 A;  1P7J A;  1IDY A;  2PLY A;  1QVT A;  1U78 A;  2V26 A;  3FBI B;  3NAU A;  3HIF A;  1JI8 A;  5IOZ A;  3V8J A;  1W0U A;  5E3O A;  1VQM I;  1DQU A;  1C0W A;  4I6Z A;  4DNC A;  4TV7 A;  2M0C A;  3K4C A;  2MD0 A;  3KEQ A;  3QU3 A;  2EB7 A;  4AYB N;  2BE5 F;  3JTG A;  2QUF A;  1FMV A;  3I56 I;  2PJR B;  1BBY A;  3QPS A;  3WG9 A;  3DQV C;  2K02 A;  1T38 A;  2NS7 A;  4IL6 C;  1B9N A;  4UNO A;  4RS8 A;  3ML6 A;  2LG4 A;  2KLO A;  3WE2 A;  1X1D A;  2STW A;  1X1C A;  4HBL A;  2K3F A;  2XVC A;  2HOT A;  1FOW A;  2LBF A;  3MAJ A;  2XKO A;  4XRM A;  3S15 J;  4HYE A;  4WK8 F;  3I4M J;  4FET A;  4CA0 A;  2IA0 A;  2CU7 A;  1SVO A;  4OIQ F;  1D1A A;  1ZRF A;  2DFH A;  4HNT A;  4GYG A;  2ZO4 A;  2HTS A;  1XD7 A;  1XSD A;  1YFH A;  5FD5 A;  3VPR A;  1X1B A;  3BRO A;  3BP8 A;  2IA1 A;  2DJI A;  3AAF A;  4DYC A;  2BZT A;  3I59 A;  4HSR A;  2RQQ A;  4CYC A;  5J3L A;  1ACI A;  1ZK8 A;  2DMN A;  3RSN A;  4BJ5 C;  5JFR A;  3B02 A;  3CTA A;  2H8W A;  4ZDP A;  4C3H J;  4R1H A;  2VQH A;  3VEP A;  3SZP A;  3S2W A;  3RKX A;  3SEZ A;  3T8R A;  4WXH A;  1S29 A;  4JBA A;  5ED4 A;  1I6X A;  3KZY A;  1ULY A; 
#chains in the Genus database with same CATH homology
 1TW2 A;  2HZT A;  1SD6 A;  4QLC U;  4KMU X;  3G3Z A;  3R61 A;  1T98 A;  3ZMD A;  2G9W A;  1SAX A;  3U9G A;  4P96 A;  2DW4 A;  4FX0 A;  2W25 A;  2F2E A;  1OPC A;  2XIG A;  3QPH A;  3R0J A;  4KNY A;  1ZG3 A;  4KFC A;  5L3E A;  1W7P A;  2ESN A;  3F8N A;  2V1U A;  1F4K A;  1IN6 A;  5L3F A;  2CWE A;  3L7W A;  3V8K A;  4UVB A;  1J2X A;  3TQN A;  3C1D A;  4N9H A;  3E6M A;  4LG0 B;  1KU7 A;  5CVV A;  4D0P A;  2YPR A;  1S3J A;  4I02 A;  2K4B A;  2EFO A;  1CGP A;  2Q0O A;  1P4A A;  3EDP A;  5CVR A;  3GVA A;  2C6Y A;  4AIK A;  1XN7 A;  2VBY A;  3SZT A;  2V1D A;  1B1B A;  1FNN A;  4U88 A;  2QBY B;  3G73 A;  5K1Y A;  1SMY F;  2RV8 A;  2L4A A;  1J75 A;  4HW0 A;  4KDP A;  1VTN C;  2ZME B;  2F5F A;  1LDJ A;  2M45 A;  4ZYE A;  3M1E A;  3TOA A;  4ZYD A;  2X4H A;  2OBP A;  4M72 A;  1MJA A;  2HTJ A;  2PJP A;  5IT9 Z;  4OMZ A;  4A5M A;  2CYY A;  3TOB A;  1XB4 A;  2Y48 A;  4G7Z F;  3IWZ A;  2ISY A;  2A07 F;  1ZRD A;  1QZY A;  3HRM A;  4N9I A;  5IT9 K;  3LA7 A;  3LFK A;  3BZ6 A;  3TDZ C;  2W24 A;  1Z1D A;  3I58 A;  2BEO A;  4NB5 A;  4MTD A;  1PDN C;  3FMS A;  1ZRE A;  3ISP A;  4CO8 A;  1S7O A;  5ICE A;  1EH6 A;  3F8B A;  5H6R A;  3GFI A;  2RC4 A;  3DPT A;  3R6S A;  1V3F A;  1QBJ A;  3WTV C;  3VB2 A;  4BYY A;  1HBX G;  1DPU A;  5DD4 A;  4HF1 A;  1T2K A;  3FM5 A;  2MD5 A;  1U6G A;  4Y13 A;  2QQA A;  4LK1 F;  1OYW A;  1RIO H;  2MBF A;  2LSO A;  3EYI A;  3C18 A;  1MJB A;  4A0Z A;  3KE2 A;  3HYI A;  3HTS B;  3KLO A;  5E17 F;  5D6F A;  3CLO A;  4MEX F;  1HSJ A;  2XAF A;  1XSX A;  4UXN A;  1QO0 D;  2EA4 A;  1YYV A;  4MEY F;  4RGR A;  1Z7U A;  4IRH A;  2KRF A;  1ZGA A;  3VFZ A;  3DPL C;  1MD0 A;  3EUH A;  3QPT A;  3CDH A;  1RZ4 A;  3FZV A;  4IRI A;  2HFH A;  4P9U A;  1WWX A;  2A68 F;  4M9S A;  1BIA A;  1UB9 A;  3CUQ C;  3QOP A;  4OOI A;  2VBZ A;  4A2U A;  1WSU A;  3PFI A;  4U7B A;  3HRU A;  5LHG A;  4BNC A;  3SFZ A;  1RUO A;  5H6Q A;  2R7F A;  4KUM A;  2J5P A;  5HOO A;  3WTZ A;  3JW4 A;  2XAS A;  2YSR A;  5D6E A;  5ILS A;  2ZXJ A;  3P9I A;  3TGN A;  4OIR F;  5IT3 A;  4LJZ F;  2HS5 A;  3NQO A;  3P9K A;  1J9I A;  4ZH4 F;  5LGT A;  5AIP A;  1HW2 A;  1BIB A;  2OU2 A;  1RI7 A;  2ELH A;  1LDD A;  3E97 A;  1KQ0 A;  2O8X A;  1FOK A;  1X3U A;  5E8I A;  3HTU A;  1O7F A;  2WC2 A;  3W6J B;  5BQT A;  2MH9 A;  1R5G A;  4LLL A;  5BS6 A;  1K78 A;  1R7J A;  2L3D A;  2LDU A;  1Z6T A;  2XAH A;  3CUQ A;  4RB2 C;  2NYX A;  3OV8 A;  2J5O A;  3BOQ A;  4UV8 A;  2H6C A;  1FLI A;  1O7L A;  5FFX A;  2AXL A;  2DQR A;  1ODD A;  1FYK A;  1KA8 A;  2NRA C;  3N4M A;  2CW0 F;  4G94 A;  4XSX F;  1D3Y A;  2XV4 S;  4FX4 A;  4WXC A;  3E5Q A;  2P8T A;  2QLZ A;  4ZYH A;  4EM0 B;  2RKH A;  4HV5 A;  3GYH X;  4ETS A;  4L9J A;  5LEJ A;  4L0Z B;  4IHS A;  3HSR A;  1IXR C;  1SD4 A;  4M6Y A;  3GWZ A;  1O3R A;  5JR3 A;  2WWY A;  1XGO A;  3DXJ F;  2EFP A;  2VE8 A;  2Y75 A;  4YFK F;  5ICC A;  2E1C A;  2QEN A;  1OKR A;  2EWN A;  3K0L A;  4G6Q A;  4A6E A;  2P7V B;  2V6C A;  1Y0U A;  4OIO F;  2XHK A;  4R79 A;  4CIC A;  3WOD F;  5LHI A;  1KU2 A;  3J80 Z;  3RKY A;  2FBK A;  3HOS A;  2FXA A;  4ESB A;  2M30 A;  2D45 A;  1R58 A;  2R7D A;  4KN4 X;  4M9X A;  2F5C A;  1KQ9 A;  5FD6 A;  1OYI A;  1XCV A;  3K9T A;  1LNW A;  1FBQ A;  5KK1 A;  1I27 A;  2ZCW A;  1FBU A;  2XRN A;  5DCM B;  2H94 A;  5BPD A;  3DV8 A;  1K6O A;  5CLS A;  3B73 A;  5FFZ A;  4M6X A;  1IZ1 A;  3T5X A;  2ZFW A;  4HX8 A;  3L00 A;  5L3B A;  2HKX A;  2FML A;  4RGU A;  1U2W A;  3DP7 A;  1TQP A;  3NRV A;  3RJP A;  1J59 A;  4EQQ A;  1CF7 B;  3WGG A;  1F1Z A;  1U5T B;  1ZH5 A;  1IN7 A;  3I0T A;  1MZB A;  5LLQ A;  3ZMU A;  1O3Q A;  3M8E A;  3BY6 A;  3MCZ A;  1OYY A;  3QP5 A;  1TNS A;  4KIF A;  4AD9 A;  4RB3 C;  3LQQ A;  5E1W A;  3E6B A;  1BI2 A;  4G7H F;  3SXY A;  2A6E F;  3ZN1 A;  4EM2 A;  2DI3 A;  1NHA A;  1KYZ A;  2ZJ2 A;  3VOD A;  1G3T A;  3QP6 A;  4WWC A;  2LKP A;  5DYM A;  4EVI A;  4IF4 A;  4LD5 A;  2L02 A;  5ILU A;  2A61 A;  3M9A A;  3GF2 A;  4KYW A;  5D4R A;  2FNP A;  3GFM A;  3ULQ B;  4A5N A;  4WF2 A;  3ELK A;  5E20 A;  5HLI A;  2A5Y B;  5E8G A;  5HLG A;  1USS A;  3ZMT A;  1LVA A;  6PAX A;  2NNY A;  1OR7 A;  4KT5 C;  4CZZ A;  1IRG A;  2KIF A;  4YFX F;  3KP2 A;  3ZMV A;  2JT1 A;  2A6H F;  5DV5 A;  2OAZ A;  2FE3 A;  2MA3 A;  2DPU A;  4IHT A;  1DP7 P;  2P6T A;  3QU6 A;  4I09 A;  3C7J A;  2CSO A;  2DFI A;  2PEX A;  5DDG A;  3IRR A;  4ENK A;  3D0S A;  2GXB A;  2P7C B;  1TTY A;  1ZHF A;  2V9V A;  1J7K A;  1RUN A;  3F6O A;  4MQV A;  4ENM A;  2MC3 A;  1JHF A;  3E5X A;  3FM3 A;  1U5T C;  1HST A;  3TDU C;  5D8K B;  4ESJ A;  3WTY C;  4HA8 A;  2K7L A;  4UV9 A;  1KU9 A;  2DAO A;  3FMR A;  3LST A;  4JK1 X;  2UWM A;  1K7A A;  5DD8 A;  3MZY A;  5DUI A;  2RNJ A;  1LQ1 A;  3PQK A;  1FP1 D;  2Y0M A;  1XGM A;  1G3W A;  2PMH A;  3GZ6 A;  1PP8 F;  3F22 A;  1ZLJ A;  3RIR A;  4GYI A;  4OMY A;  1GHC A;  3GEZ A;  2VON A;  2PFB A;  3J81 K;  1D8J A;  2KIM A;  2FEZ A;  4ZZL A;  1SFE A;  1MJ9 A;  3Q5F A;  4HOB A;  4AIJ A;  1YW8 A;  4P5O A;  3RPQ A;  5CJ9 A;  4U7D A;  4ZZD A;  2XUB A;  4EGZ A;  3BJ6 A;  4U0W A;  5HS7 A;  1XSV A;  3H92 A;  2JRT A;  2VOO A;  1GXQ A;  1JHH A;  3ZMS A;  2H27 A;  2HDC A;  3IKT A;  1Z6R A;  1BI0 A;  1JGS A;  3CO6 C;  4N0B A;  2P5V A;  5HDG A;  4EM1 A;  4BQA A;  1YLF A;  3N97 A;  2QYO A;  5CVJ A;  3WGH A;  5E1X A;  4ZYG A;  1S7A A;  3GUD A;  2VOP A;  5F64 A;  5J8C A;  4KA4 A;  3T8T A;  4IVN A;  4Q47 A;  4RGS A;  3BPX A;  3ROU A;  2BV6 A;  4M9Z A;  4EJT A;  3RTR A;  1O3S A;  2DU9 A;  1MDM B;  3LWF A;  1R5H A;  4S05 A;  1WQ2 A;  1E2X A;  1SD7 A;  1FT9 A;  3O6B B;  3ZPL A;  4L5I A;  5JVT A;  2Z33 A;  1TBX A;  4KIG A;  4G7O F;  1ON2 A;  3RYP A;  4HF0 A;  3I4P A;  4PGH A;  2L54 A;  4HV6 A;  3F3X A;  4GO1 A;  3WE3 A;  3F72 A;  4EJO A;  4HF2 A;  4Q5S F;  4OIN F;  5F6F A;  2HKO A;  1QGP A;  1F5T A;  4LB6 B;  1TW3 A;  2M8E A;  1J5Y A;  1ZAR A;  3TO9 A;  3WTS C;  4LK0 F;  4EMS A;  2CO5 A;  2A69 F;  2VT3 A;  1XMK A;  1FSH A;  1PP7 U;  4BAY A;  2JSC A;  4IXA A;  2VOD A;  3Q9S A;  1R36 A;  2CFX A;  3IC7 A;  2VE9 A;  3JSP A;  2CQK A;  4CGZ A;  3KCC A;  2OQG A;  3ZMZ A;  3BWG A;  5ERI A;  3RI4 A;  1AOY A;  4LFU A;  4HQM A;  1O3T A;  2D2W A;  4L18 B;  3DKW A;  3DEU A;  3M7G A;  3R0A A;  2VC1 A;  4WXD A;  4CDG A;  3RYR A;  3V7C A;  5L3C A;  2O0Y A;  5BPI A;  2IVM A;  1Z05 A;  3KP6 A;  3BDD A;  2ZNZ A;  2DBB A;  2DT5 A;  3L09 A;  1HKQ A;  1FX7 A;  2HQR A;  4WX9 A;  4M74 A;  1T0F A;  3W6K B;  4FHT A;  4NHJ A;  2PQ8 A;  1IXC A;  4ESF A;  2FU4 A;  3KLN A;  2HEO A;  2Z99 A;  2QBY A;  1AWC A;  2RDP A;  4RB0 A;  3P9C A;  1UCR A;  1PUE E;  2ZME A;  2ACJ A;  4GXO A;  5FO5 A;  1FC3 A;  5LRS A;  2MLK A;  3F8F A;  4U0V A;  1SMT A;  1HW1 A;  2WTE A;  1JE8 A;  3I59 B;  4M73 A;  4AIH A;  1W4M A;  4YFN F;  1XGN A;  4EJV A;  4S04 A;  4L9V A;  4HX4 A;  4B8X A;  4B09 A;  3LAP A;  1WI9 A;  1XMA A;  4G6D A;  4LLN A;  2QQB A;  5TRD A;  2PG4 A;  1GVJ A;  2QM3 A;  4A12 A;  4PCQ A;  1TQI A;  3IHU A;  3ERE D;  3IRQ A;  2FQ3 A;  4BHB A;  3D5L A;  2UZK A;  1J0R A;  1YW9 A;  3J7A O;  2Z9O A;  3FXQ A;  1W7P B;  2ZNY A;  3T1B A;  4L9T A;  2D1H A;  3F21 A;  5DUK A;  1ULY A;  3P7N A;  3FXU A;  2COM A;  1BC7 C;  4RGX A;  2ETH A;  2DQL A;  2L01 A;  4YII A;  5HDN A;  2XAG A;  3U1D A;  1DPR A;  2IT0 A;  2GIV A;  1K79 A;  5LGN A;  4BHC A;  4H0E A;  3GW2 A;  4KIB A;  5K5O A;  1W7P D;  2QZ8 A;  3M8F A;  1HW5 A;  2EFQ A;  4XSZ F;  2KKO A;  3MEX A;  5A2Q Z;  2ZKZ A;  1D8K A;  3GO5 A;  4L5J A;  4RB1 A;  1YQA A;  5DCF A;  4MHG A;  1DUX C;  3E5U A;  3FMQ A;  2B0L A;  1S8N A;  4RAY A;  4FT8 A;  5AON A;  2HGC A;  5F1R A;  2NS0 A;  5CYV A;  3O3K A;  2HWV A;  5A2Q K;  4HDU A;  1SFX A;  3BJO A;  5LBQ A;  5AIQ A;  3GFJ A;  3WTT C;  3ECO A;  2CGP A;  1EV7 A;  1FWZ A;  1T6S A;  3K69 A;  1ZG5 A;  3CJN A;  3WTX C;  4A6D A;  1FY7 A;  1LEA A;  3JAM Z;  5LHH A;  2JPB A;  4KIC A;  4O6J A;  4LGW A;  5H20 A;  4BXU A;  4EJU A;  1P2F A;  3KP7 A;  1R1V A;  5DEQ A;  4YIF A;  1R1T A;  2VBX A;  3FWE A;  2IP2 A;  3WTW C;  1KQ8 A;  4JQF A;  2FSW A;  1UFM A;  3HOT A;  3JAM K;  4F7Z A;  1XDU A;  2VT2 A;  3H3Z A;  5K5Q A;  1HXD A;  2PBI A;  3MQ0 A;  1RNL A;  5LGU A;  1U8R A;  3Q9V A;  1QPM A;  1B59 A;  1YS7 A;  1HKT A;  1QZZ A;  4ENN A;  5L3G A;  4HDV A;  2UXX A;  2OD5 A;  1E17 A;  2PMU A;  1I5Z A;  2G7U A;  2FMY A;  1BJA A;  1KGS A;  2EV0 A;  4HLY A;  5E18 F;  4YG2 F;  4OU0 A;  1Z9C A;  4QWQ A;  1BI1 A;  1FP2 A;  2KIU A;  3GFL A;  2HOE A;  1B4A A;  3QRF F;  4BH9 A;  2ZBK A;  3F6V A;  4I0A A;  4Y15 A;  1QQI A;  1IRF A;  1REP C;  2YR2 A;  3JTH A;  2IPQ X;  2O6G E;  3BPV A;  3KET A;  3QAH A;  4KN7 X;  1HKS A;  3I64 A;  2AS5 F;  4AWX B;  1YIO A;  3EET A;  4RAZ A;  1TLH B;  2QQ9 A;  3FF5 A;  1YW7 A;  3HRT A;  4P55 A;  2RVC A;  1UHM A;  4DQ2 A;  4PZJ A;  1G3Y A;  2M87 A;  1MGT A;  3FHZ A;  2GA1 A;  5BOX A;  3KEO A;  1EH8 A;  3JSO A;  4MNU A;  4L9N A;  5E1Z B;  1B9M A;  3U2R A;  5HS9 A;  1IXS B;  3J81 Z;  3GX4 X;  2WV0 A;  2YX7 A;  3ECH A;  2L4M A;  2OQR A;  4IJA A;  4KMF A;  1D5V A;  5J8F A;  4LB5 A;  3I53 A;  2Z3Y A;  2FNA A;  2GXG A;  4WCG A;  2GWR A;  3HHG A;  2LF8 A;  2NNN A;  2UXN A;  1S6L A;  5DCM A;  1XGS A;  4ON0 A;  2Q2E A;  1T39 A;  3ZQ7 A;  3I54 A;  5D4S A;  3KZZ A;  3F23 A;  1HQC A;  2RGV A;  3E6D A;  4CYD A;  2QVO A;  1BOA A;  2X0L A;  4IRG A;  4G9Y A;  1H9T A;  2D1V A;  5EEG A;  2HYF A;  5JHU A;  3R4K A;  1EH7 A;  1SD5 A;  1K78 B;  2YX4 A;  2H09 A;  1CF7 A;  1ZLK A;  4XLN F;  2DO7 A;  2GAU A;  3CUQ B;  1U5T A;  2RN7 A;  2VN2 A;  4I0B A;  2W85 A;  1H0M A;  3WU1 B;  1UST A;  1WKM A;  2MLG A;  2R3S A;  3KP5 A;  2ISZ A;  3LAJ A;  1FPQ A;  1ZGJ A;  1WRJ A;  1BM9 A;  1W5T A;  2Z5U A;  2EV6 A;  4ASN A;  1L3L A;  5ICG A;  3TKY A;  2P6S A;  1Q1H A;  1H9G A;  2E7W A;  3HSE A;  1LDK B;  5J6X A;  1G4D A;  2EV5 A;  2CG4 A;  2DTR A;  4BHP A;  1ZN2 A;  2JZY A;  3RPU A;  1XCB A;  4G8X A;  4UVA A;  2Q8K A;  2OA4 A;  4HX7 A;  3L2C A;  2M5W A;  3DFG A;  1TQM A;  3GXO A;  3RDI A;  5FLX Z;  1ZRC A;  3WU0 A;  1IN4 A;  1G6N A;  2DK8 A;  2NAZ A;  2M1B A;  3WGI A;  3LA2 A;  4NQW A;  3COA C;  2JPC A;  1ZG1 A;  4HQE A;  5FLX K;  1BN5 A;  3SHF A;  1F9N A;  5D5U B;  4A0Y A;  2DLL A;  1TNT A;  2GA2 A;  2IJL A;  1P6R A;  1YTY A;  3KP3 A;  1FZP B;  1P92 A;  1P4X A;  5L3D A;  3V7S A;  1IF1 A;  1IAW A;  2HQN A;  3K1P A;  1V4R A;  3PQJ A;  3MZH A;  5TJJ A;  3V4G A;  4MTE A;  4CHU A;  1YG2 A;  5K5R A;  4MGR A;  1OMI A;  3O2P E;  2IW5 A;  2EJR A;  3LA3 A;  1ZYR F;  2LF7 A;  3SQN A;  1Z91 A;  2PI0 A;  3TO6 A;  4LG0 A;  3ZN0 A;  3GZ5 A;  2ESH A;  2BYV E;  1SFU A;  1A04 A;  3FX3 A;  2EFW A;  4K2E A;  4Q4Z F;  3K1M A;  1ZAO A;  4HAM A;  2XAJ A;  2EK5 A;  4EJW A;  1B6A A;  1YS6 A;  2O3F A;  5CVI A;  2P5L C;  4EGY A;  2LNB A;  4M71 A;  2FBI A;  1R00 A;  1ON1 A;  2DPD A;  5KVR A;  3NEU A;  4A0X A;  5BMZ A;  3FXR A;  3ABU A;  3ZP5 A;  1ONV A;  1R22 A;  2PN6 A;  4XRF A;  2QWW A;  2F5D A;  1BC8 C;  2VC0 A;  1R1U A;  1XDS A;  4Q48 A;  3I5U A;  1LB2 A;  2P4W A;  3V7R A;  3K2Z A;  4HLX A;  3HHH A;  2K86 A;  1U3E M;  2EFN A;  2E1N A;  3RKW A;  5D5X B;  4ENJ A;  1R23 A;  2BBY A;  2A3S A;  3IL2 A;  2GZW A;  3EQL F;  2VXZ A;  3KP4 A;  2BGC A;  3WTU C;  5FB2 A;  1O57 A;  3C3W A;  4L0Y B;  2FA5 A;  1FYL A;  3HUG A;  1LJ9 A;  3TO7 A;  1YO5 C;  4IPA A;  1DDN A;  5FGM A;  4Z2Y A;  2STT A;  1FYM A;  2FOK A;  2XRO A;  4XLP F;  5HVQ C;  2G7H A;  3F8C A;  1UHW A;  4HZF A;  1W5S A;  1MKM A;  3HSF A;  2EA2 A;  2YU3 A;  1G3S A;  2JTV A;  3E3V A;  2K27 A;  1I1G A;  4CXF A;  1P4W A;  4I01 A;  2IA2 A;  5JI6 A;  3F8M A;  3V8L A;  5HS8 A;  2HYG D;  1QNT A;  1MDM A;  4OIP F;  4EV0 A;  5ICF A;  3IKV A;  4UHT A;  1BI3 A;  2V79 A;  1IUY A;  4XBF A;  3LQR A;  1LEB A;  4LMY A;  3MFK A;  3E6C C;  2XAQ A;  2MH2 A;  4AVP A;  4U0Y A;  2V1X A;  1JXS A;  2E7X A;  4R8H A;  2FBH A;  2OZU A;  4O5V A;  2KJB A;  4I7H A;  3ABT A;  2FF4 A;  4UVC A;  1I1S A;  5LRR A;  2RQP A;  2ADU A;  1IN5 A;  2P5K A;  2HR3 A;  2DK5 A;  1IW7 F;  5HDK A;  3VOE A;  3MWM A;  4I98 B;  3T0Y A;  2TDX A;  2F5E A;  3CO7 C;  3J80 K;  3H3U A;  1FSE A;  4PDK A;  2W57 A;  5EEH A;  3R60 A;  2OZ6 A;  5CVU A;  3GLX A;  3BJA A;  2VBW A;  5D8L B;  4E70 A;  3CUO A;  5HLH A;  3REO A;  2KJC A;  5D5V B;  2O61 A;  5ILV A;  1GXP A;  2IRF G;  2O03 A;  4MQ9 F;  4UUV A;  4I2O A;  4PGG A;  3KFW X;  4GCV A;  3I71 A;  2W84 A;  2GQQ A;  4Y17 A;  2XGX A;  1STZ A;  3K1N A;  4LLG F;  5LEK A;  4GGG A;  3L9F A;  1IN8 A;  1KYW A;  1KU3 A;  2XKP A;  2FRH A;  4P9F A;  3IWF A;  5D5W B;  1FBS A;  3EYY A;  1L0O C;  4O3M A;  3DF8 A;  2H6B A;  2K4J A;  3OOP A;  2PLY A;  1U78 A;  3HIF A;  3V8J A;  1C0W A;  4DNC A;  4TV7 A;  3KEQ A;  3QU3 A;  2EB7 A;  2BE5 F;  3JTG A;  2QUF A;  1BBY A;  3WG9 A;  3DQV C;  2K02 A;  1T38 A;  1B9N A;  4UNO A;  4RS8 A;  3ML6 A;  3WE2 A;  2STW A;  4HBL A;  2XVC A;  3MAJ A;  2XKO A;  4HYE A;  4WK8 F;  2IA0 A;  4OIQ F;  1ZRF A;  4GYG A;  2ZO4 A;  2HTS A;  1XD7 A;  1XSD A;  1YFH A;  5FD5 A;  3BRO A;  3BP8 A;  2IA1 A;  3AAF A;  3I59 A;  5JFR A;  3B02 A;  3CTA A;  4R1H A;  3VEP A;  3SZP A;  3S2W A;  3RKX A;  3T8R A;  4WXH A;  1S29 A;  4JBA A;  5ED4 A;  1I6X A;  3KZY A;  3HRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...