3M3YJ

Rna polymerase ii elongation complex c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3m3yJ00
3I4NJ 4S0HB 5IYCJ 3OOUA 2NS8A 1XC5A 1ENHA 4MLOA 2B63J 4A3IJ 5EG0A 1VFCA 1UMQA 2HXIA 3CDLA 3S14J 4NDLA 4B4CA 1GT0C 1WH7A 2LTPA 4M3GA 3PM1A 4JX5A 3CCYA 3S2HJ 2VUMJ 3BQZA 2Y9ZA 2HDDA 4A3JJ 1IDZA 2DN0A 1E3OC 3RKQA 2E2HJ 2OF7A 4MFDA 4IHYA 2JA8J 1IUFA 2R0QC 2O7OA 5FKNA 2TCTA 4IEJA 3NAUA 5HODA 1A5JA 2FJ1A 2MSYA 5EF6A 4UUSA 1XG1A 4FTHA 4EEFG 3PO2J 4XRSA 3JRGA 4MO7A 1DU6A 5J3LA 2HYJA 4M3FA 2Y31A 2R5ZB 2CJJA 1Z77A 2M2EA 3K2AA 3A02A 2JJ7A 2PMZN 1WH5A 1HDDC 2IBDA 3B6CA 3MN2A 3IV5A 4J19A 3HDDA 5C3EJ 4B1RA 1ZTRA 4A3LJ 1R9TJ 1MBKA 5IPAA 1GDTA 5GP9A 4DZJA 3FIWA 5F0FA 1JUPA 2NS7A 9ANTA 1MBGA 1RKWA 2NVXJ 2L7ZA 1MH3A 5EYRA 3OSFA 4AUXA 2HOTA 1U9NA 5J1RA 3Q0UA 3Q0WA 1OCPA 2CQXA 2X9DA 3ZQIA 2K40A 4C3JJ 1CQTA 2LFBA 2JWTA 1BJZA 4UUTA 2XPVA 1DU0A 2DA7A 3DEWA 3GTMJ 3CMYA 3QPLA 5EGOA 3FISA 3ZQLA 3JRCA 3MVPA 3I4MJ 4A3BJ 2K9NA 5FLVA 5EG0B 3GTGJ 3HOZJ 3ZQCA 5FJ8J 3HOYJ 2LP0A 2FD5A 1HF0A 1G2HA 2X6OA 3ZQHA 1H88C 3HOUJ 4BY1J 1FIPA 1I50J 1TC3C 4DZPA 2ECBA 1K61A 2EZHA 1WCMJ 5EZGA 2COBA 1Y1WJ 1IJWC 1MNMC 2D5VA 3BT9A 2ECCA 2DMNA 1I6HJ 2I10A 1FTTA 1VNDA 3S1MJ 4A3CJ 1BW5A 1ETWA 2Y2ZA 2NOGA 4UUSB 2NVTJ 2R7ZJ 3GTQJ 1F36A 2DA1A 1APLC 5IP7J 1MSFC 3LSGA 2DMUA 2DA4A 2E2IJ 3BR3A 5GPCA 4JX6A 3JRBA 4A3MJ 1QVTA 2NVYJ 1JKRC 5F0CA 1TWGJ 2YU9J 3HOWJ 4G12A 4XICA 2R5YA 3IH2A 4GFBA 3QPSA 2WAQN 3JRDA 4XIDA 1ZQ3P 1UG2A 4M3DA 2LY9A 1H89C 1IC8A 3S15J 2E1OA 3TP3A 1RR7A 2ELKA 1ETQA 1RESA 1MBHA 3TW7A 5BNGA 2LVSA 2O8KA 2KDZA 1P7JA 1JJ6C 4I76A 1WI3A 2JA7J 3BQYA 1POGA 1OCTC 3CQZJ 3L1PA 3OSGA 1K83J 1YRNA 3B6AA 2YS9A 1MH4A 3HKZN 2Y0SN 5EGOB 1JTYA 2DMTA 4D7NA 3LSPA 4XRMA 3O8GA 3TW6A 5M5WJ 1EF4A 1WGXA 3BG9A 2QF7A 3G1LA 4C2MJ 3FKIJ 1ZK8A 5M3FJ 5IOZA 2NVQJ 1ITYA 2DA3A 1FEXA 5FKMA 3S17J 2JK3A 1ETOA 3BTLA 5C44J 2GLOA 2L7MP 4CYCA 3Q3SA 5FLMJ 1TWAJ 2FQ4A 1BL0A 3A03A 3SFIA 1HLVA 1O4XA 1IGNA 3K7AJ 1W0TA 2AHQA 1VI0A 5F27A 5JLXA 3WHBA 2GM4A 4A3GJ 4A3FJ 1B72A 5F1JA 3LNQA 5IYDJ 2ZB9A 3S1NJ 1MBFA 3Q0VA 2K9SA 1F43A 5IP6A 2DA5A 5FKLA 3BR0A 3HBLA 3TP0A 2JA5J 4L5EA 3WHCA 4ABZA 2CQQA 2EBIA 2QCOA 4XK4A 4C3HJ 3D1NI 4D7MA 2E19A 2JMWA 2R5YB 1T56A 5E3NA 1BW6A 2CUEA 5GPAA 2M34A 1IG7A 5F08A 4D5FA 2HOAA 2L9RA 4M3BA 4A3DJ 1A6IA 1WPKA 3O8HA 5C4JJ 2JN6A 1ZR2A 3PO3J 1JT0A 2LD5A 4A3KJ 1NK2P 2G0EA 3HGGA 4Y52J 1UHSA 1X58A 4I6ZA 4A93J 2EZLA 2MGQA 1B8IA 3BTCA 1LFBA 5J1YA 1ZR4A 1YRNB 1P7IA 1ETYA 1ZKGA 5E3LA 3C2BA 3BR5A 2Y30A 5IOYA 1MBJA 2H1KA 2XB5A 5FKOA 2LK2A 2DA6A 2WV1A 4DYCA 4CYCB 1GVDA 2GBYA 3LSRA 1W0UA 5E3MA 2H8RA 1U8BA 1PUFA 1JKQC 3SJMA 4BBSJ 2ME0A 1HDPA 3BTJA 5F0HA 2R93J 3NARA 1FIAA 2R92J 1NTCA 1U78A 2EZKA 1JTXA 1HCRA 1ETXA 1B72B 1OJLA 4BY7J 2KT0A 3HOXJ 1Y1VJ 3IH3A 5JLWA 2LR8A 4JP0A 3GTOJ 1JT6A 3S2DJ 3GBGA 2HQ5A 2ID3A 4AC0A 1JGGA 2LKXA 2XRLA 4HNVA 1GV5A 2LLKA 4RBOA 3G1MA 4A3EJ 3SDGA 1SANA 2WB1N 4D5CA 3DCFA 2L7FP 1X2NA 1JUMA 2XPUA 1MSEC 2JA6J 1D5YA 2CRGA 4M6VA 4QSHA 1LE8A 3ZQGA 1GUUA 4DYQA 1IRZA 4X1EA 5EEAA 5M3MJ 2M8GX 2HXOA 3BTIA 5M5YJ 3HOVJ 3RZOJ 1RPWA 2HI3A 1X2MA 2DTZA 2EZIA 4Y7NJ 3JRAA 1QVUA 3JRIA 1B8IB 1FJLA 2VKEA 3LSJA 2K9QA 2MW8A 2DA2A 2IAIA 1RETA 3H0GJ 2EH3A 5DTDA 5E3OA 3H3VK 2O9LA 1FTZA 3HGYA 4BBRJ 3A01A 1RKTA 2VPRA 2N8GA 2X48A 2CUFA 4IHVA 3HEFA 2DJNA 2OPTA 3HB9A 1ZGWA 1AKHA 4AYBN 2ME6A 3BR2A 3GTLJ 4DYRA 4W1UA 1VF9A 1T33A 4QTRA 1PUFB 1JUSA 1JJ8C 1TWHJ 2XB0X 4FCYA 3BR6A 3JRFA 3ZOBA 2MG4A 3BR1A 5IP9J 3M3YJ 1ORKA 5K7HA 4V2FA 3RZDJ 3GTKJ 5C4XJ 3S1RJ 4JYKA 1QRYA 1ETVA 4BKXA 4QIWN 5EDNA 3F0CA 2XGCA 1NK3P 5F04A 4JX4A 2XGEA 4DW6A 2VI6A 2P81A 3BG5A 5M5XJ 4X6AJ 3JRHA 1U9OA 2L0KA 2FX0A 1I3QJ 2Y9YA 4MIMA 4A69C 4B3AA 3JREA 4FISA 3FK7A 4FE7A 1TWCJ 4V2GA 5EZHA 2E2JJ 3LOCA 1LE8B 1XS9A 3G1OA 5DS9A 3E7LA 3TEDA 2W48A 3QQAA 2HOSA 4IHXA 3JR9A 2XSDC 1BA5A 2XPWA 2DMQA 4MFEA 4LOCA 1GV2A 4W97A 1IDYA 3MKLA 2XGDA 3ZQFA 5K7FA 2R5ZA 5IYBJ 2EQRA 1MBEA 2TRTA 3M4OJ 2IEKA 1TWFJ 5FKKA 1Z0XA 3UKGA 3OIOA 1OFCX 1SFOJ 3A01B 1IV6A 1ETKA 1S7EA 2YUSA 4BXXJ 1AKHB 3FK6A 1AHDP 5K7ZA 4IHWA 2M0CA 1AU7A 2CU7A 1JKPC 2ID6A 1Q1VA 4M3EA 4C3IJ 3S16J 3W6VA 1LFUP 3BG3A 3GTJJ 1JKOC 2RAEA 4FE4A 4RDUA 2M9HA 2DMPA 1QPIA 2VKVA 5J1UA 4XRSG 3GTPJ 3S1QJ 3IH4A 3VPRA 2AO9A 3RQIA 1H8AC 1HOMA 3HM5A
chains in the Genus database with same CATH superfamily
1YQAA 4L0YB 3OOUA 2BGCA 1HW1A 3BROA 4Y17A 4UV9A 1YS7A 4I09A 5KNLA 2X85A 5IY5H 1G3WA 2EFQA 4LG0B 2VBZA 3MWMA 4YRVA 3E3VA 4OOIA 1GT0C 3W2VA 2LTPA 2Y75A 4HAMA 3PM1A 3VFZA 3CCYA 1JXSA 3BQZA 3MD2A 3R0AA 4YG2F 1O3QA 2RV8A 1D0YA 2HDDA 2EV5A 2PMHA 5AIQA 5L3CA 1IDZA 2K27A 4M9ZA 2QYOA 4LJZF 4IRHA 2O7OA 4N0BA 3ZMDA 1UJ8A 1LQ1A 4M71A 2CH0A 4AIJA 1TQPA 5HODA 3S32A 3ZRGA 4AWXB 1A5JA 2QENA 4R8HA 1XGNA 5HLTA 3TQNA 4Q47A 4EEFG 5CLSA 3F21A 3JRGA 1ON2A 5HNHA 3IWFA 4DOZA 4YIRX 4EGYA 2HFHA 1Z3YA 1Z77A 5E79C 2PFBA 2JSPA 4RA2A 2IS2A 3B6CA 3MN2A 1G59A 2FNPA 4DGWB 3F9KA 4XM3A 4GDFA 3IAM2 4B1RA 4M73A 4F7ZA 4Q4ZF 5BQTA 3LSMA 4A3LJ 1XTAA 3DTIA 4UNOA 1VZ0A 1TZLA 3GYHX 3D5SC 4HDVA 2VJ5A 2NS7A 3DU5A 5DYMA 4L18B 4D0PA 1MD0A 2WV0A 1FSHA 3OSFA 4XL9A 2CGPA 2VQGA 2V6CA 4A0XA 2GOXB 5K5RA 3Q0UA 2BE5F 4HG2A 3D5LA 4L9NA 1CQTA 3C18A 4IJAA 2ZSHB 4DQ2A 2NVUB 4UUTA 1J59A 2FEZA 3FM5A 2DDAA 2DA7A 3GTMJ 3OYFA 2E35A 3FISA 2F6CA 1VQ8I 2BY2A 2JRTA 5D8LB 3HOZJ 5FJ8J 2X1EA 4IQJA 5J40A 1T38A 1SAUA 3ZMZA 1HF0A 1G2HA 3CCJI 3KLNA 1H88C 3GZ5A 4BY1J 1A36A 3VYSB 1XDSA 2HTJA 1TC3C 2LY1A 3I3LA 1YIOA 4LGWA 2K85A 1CGPA 1XMXA 1WCMJ 3NQOA 1O7FA 2JA2A 5FROA 4G9YA 1MNMC 4GXOA 5TRDA 1QGPA 1UB9A 3K70D 4YIIA 1IRFA 2I10A 3T1BA 2E1NA 1E3HA 3QWLA 3BY6A 1UHWA 4UUSB 3U1DA 2CV0A 3GTQJ 2VT3A 2CW0F 2HZTA 2OQRA 2P6TA 3FXQA 2K9LA 5IP7J 3LSGA 1I1SA 3K70C 4JX6A 4A3MJ 4MQ9F 1FYLA 3MAJA 2DFFA 2W84A 1XDUA 1QPMA 2HDWA 1VTNC 4GFBA 2DK5A 2WAQN 1S6LA 1ZQ3P 3ABMH 1IV8A 3OR2C 1MNEA 4IF4A 3HHHA 3TP3A 1OCCH 1R1TA 1SC7A 3TBIA 1ETQA 1LDJA 4HA8A 1RESA 3A0BC 4QWQA 5BNGA 2LVSA 1ZLKA 4WXCA 1P7JA 1JJ6C 4I76A 2HYGD 1EH8A 3AFHA 1POGA 2UXNA 3FXKA 5F64A 4B3XA 1YO5C 2KMUA 3PFIA 4MQVA 3LQRA 3GW2A 4CO8A 1QBJA 5LLQA 1OMIA 3B6AA 2YS9A 3HKZN 5HLIA 1JTYA 1S7OA 4HX7A 1BM9A 3O8GA 1EF4A 2HQAA 2QF7A 3W3CA 4A6EA 2HVSA 4KISA 1YW8A 1K78A 1R6RA 1SFEA 3L2UA 3BTLA 3QU3A 1K4SA 2EPFA 3RKYA 1UAAA 1R22A 3JAMK 2F5VA 3SFIA 2XRNA 1D0XA 3C3WA 1IGNA 1U2WA 1OCZH 2MC3A 3VYUB 3GMEA 2P0WA 5BS6A 2VOOA 2HDCA 2P8TA 2ZMEA 3WHBA 1LNWA 1Z7LA 4XQFA 3E6DA 3KEQA 2FSWA 2VJIA 1Z05A 2UV1A 5F1JA 1XGMA 3S1NJ 3Q0VA 2Y0MA 2RNGA 1N78A 2DA5A 3I0TA 2F5EA 3BR0A 3HBLA 5KCMA 1QO0D 4LLLA 3ONQA 3WU1B 4I0AA 4XN0A 4RGXA 6PAXA 4C3HJ 2IGMA 1WQ2A 2Z5UA 4D7MA 2A68F 4Y15A 5H6RA 2R5YB 3OIPA 2R4GA 2CUEA 2XAHA 2CWEA 3DWLE 5E1ZB 5GAGJ 1NHAA 2VJJA 4D5FA 2HOAA 2L9RA 4M3BA 3TL4X 4OAZA 4BU2A 1WPKA 4XRFA 1YTYA 2Z33A 3BPXA 2W85A 5J8FA 3IP4B 1XPXA 3HSRA 2F4MB 1FBQA 2VXDA 1NK2P 1BIAA 2G0EA 3DPLC 2KRFA 1I27A 4I6ZA 2R7WA 3BTCA 2QM3A 3CC4I 4IOCF 4KA4A 1EA3A 1FMWA 5H20A 3JAMZ 3QPHA 1YIJI 1D0ZA 3DKYA 3TO9A 4HZFA 1ON1A 2V9KA 3ABLH 2A5YB 2M5WA 4NQWA 2DW4A 3BR5A 1DGRM 2Y30A 2OUMA 3V7CA 1MBJA 5BMZA 2H1KA 5K1YA 4XKWA 3GVAA 2LK2A 5A2QK 1ZGJA 2Q1ZB 3SYTA 4DYCA 4HOBA 4HBLA 4CYCB 1GVDA 2W4SA 4RLFA 3LSRA 2W1OA 2LOOA 2VASA 1U8BA 1HA8A 1PUFA 3M8EA 1IN4A 3M1CA 3BTJA 3GZNB 2PMUA 4E7SA 3LQQA 5D6FA 2JUCA 3FXRA 3NARA 4JOMA 4RS8A 3L2WA 1YHQI 3CCQI 3CO7C 5JHUA 1HCRA 2PJRB 1KA8A 4BY7J 1OCOH 5JFRA 1KQ0A 2QBYA 2YX7A 2QKLB 4M6YA 2JVHA 4KIBA 3HOXJ 3IH3A 2EWNA 2LDUA 4EVIA 4MTDA 1SVOA 1JT6A 2M7BA 4EMSA 1VQKI 2Q8KA 3S2DJ 1FBSA 1UELB 4IPAA 3CUQB 3ERMA 1LJ9A 3S8PA 4AC0A 3OYEA 1JGGA 4HF1A 5B1AH 1STZA 5D6EA 3RYPA 2LKXA 2XRLA 2K5CA 5D4SA 4KIGA 3G1MA 4A3EJ 1BJAA 2WB1N 5LGUA 1V3FA 3DCFA 4CCOA 1E0EA 1SEUA 1JUMA 5CVUA 2NOJB 3ASOH 2W82A 4BXUA 1SFXA 2DT7B 4AYBA 2DPDA 5LGNA 4M6VA 4QSHA 3LA3A 4ANJA 4OWRB 4DYQA 4P1WA 5EEAA 1PP7U 5LRRA 1GXQA 4MGRA 3BTIA 3WE3A 4FQGA 1W36D 2DK8A 2HI3A 5LRSA 3BJOA 2HQNA 4Y7NJ 2VKEA 2UXXA 4ZYHA 1W7PB 5A2QZ 2K9QA 2CV1A 3SHFA 1IRGA 4L9VA 2QQ9A 3ESWB 2V79A 4BJ5C 3H3VK 1XCBA 2O9LA 5ICGA 4DNCA 1R00A 1B4AA 2IS1A 1ZELA 2JSCA 2VPRA 2N8GA 2X48A 5ICCA 4IHVA 1W36C 2L02A 4NB5A 2ME6A 2AQEA 2JPBA 5F1RA 5HDNA 3GLLA 3GTLJ 2R7RA 1MKMA 3GF2A 1V5GA 1B1BA 1CF7B 4W1UA 5GAEJ 2HKXA 5DM6F 1T33A 3V8KA 2NS0A 1S8NA 4QTRA 3VSLA 2KQRA 4S04A 2QSFX 1YITI 3K69A 1JJ8C 4AM3A 3Q9VA 2MABA 3R60A 2ZJ2A 4BHCA 3JRFA 2EIMH 3RDIA 2NXNB 1DP7P 1ORKA 2HVRA 5ED4A 1ZGAA 2DQRA 3S1RJ 2NRAC 4ASNA 4UHTA 1ZH5A 2KLOA 3PNVA 4BYYA 5EDNA 3F0CA 2XGCA 4OU0A 3WG7H 1SD6A 4A0ZA 2IW5A 4EJOA 5F04A 1JE8A 2O03A 2KL4A 2ZFWA 3BG5A 4LG0A 4BJ6C 1L3LA 4AU7A 2LF7A 3K6GA 2L0KA 1M1EB 1R5GA 1E17A 3FXLA 1DPRA 4LIVA 2VT2A 4EGZA 4MIMA 2CS3A 2EFNA 3BPVA 3FK7A 3KE2A 3LOCA 2V6EA 2EV6A 5DD4A 1X19A 3VB2A 1WFXA 3G1OA 3QQAA 2XSDC 3BWGA 1FZPB 1WSUA 1FP2A 1RNLA 5JHFA 2XPWA 2DMQA 2X4HA 2D1VA 4U88A 1BOAA 2BVMA 1W1WE 1N25A 2IT0A 5IT9Z 4F92B 2EQRA 2RQQA 1IXSB 2DOAA 4U87A 1T0FA 5FKKA 1S9HA 3UKGA 3GWZA 3K1PA 1IV6A 3LA7A 2WAQA 4C9YA 1ETKA 2EB7A 3ZP5A 4L5JA 4BXXJ 1JHHA 5CQGA 3MKZA 2X6XA 2RN7A 1AKHB 1AHDP 3CCVI 4E7LA 2M0CA 3R4KA 1XSDA 5K5OA 2D1HA 1WJCA 1JKPC 2WAEA 1IN5A 4C3IJ 3S16J 2EV0A 4HF2A 3H92A 4HEA2 3W6VA 2E36A 3K4NA 1K7AA 3EUAA 1BR4A 2O5RA 1PVEA 3K4BA 3GLXA 4AVPA 3OIQA 2YU3A 1WJBA 1QPIA 3HRUA 2VKVA 3S1QJ 4BQOA 2VC1A 3HKZA 2ESNA 3VPRA 1WGXA 3F22A 3QOEA 5L3GA 2HQRA 1Y39A 1W5CC 3ISPA 3CCUI 1UFMA 2HYFA 1XC5A 3RQ4A 1ENHA 3KYDB 4P55A 3FMQA 3RPUD 3L7WA 4WK8F 2ZXIA 4MLOA 3ABTA 3DPTA 3G73A 4A3IJ 3VEPA 4XN3A 2E60A 1VFCA 1UMQA 3BC8A 3KIOA 4O3MA 3O6BB 3OR1C 4RAZA 2MA3A 3I56I 1WRJA 4F55A 4JX5A 3W2AA 2K4BA 2P5VA 3N4MA 1R71A 2WC2A 4I98B 2M0MA 4KJZA 4LK0F 1IUFA 3QU6A 4ITVA 1U0JA 3ABUA 4MTEA 4ZC3A 2M87A 2BYVE 3DQVC 3AAFA 2AXLA 4UUSA 3OL3A 4FTHA 2ZBKA 2VN2A 2HR3A 4XRSA 3PO2J 1DU6A 1TW3A 1Z6RA 3M8FA 3OYCA 5D8KB 2BXYA 1WKMA 3F6VA 3TMOA 2JTVA 5J4YA 2R5ZB 1O3RA 3K2AA 1D5VA 2KKOA 2PMZN 1WH5A 1HKQA 2BY0A 2IBDA 4F3QA 3REOA 3GX4X 1VQOI 1HDDC 4JK1X 1DDNA 2R7XA 3HDDA 2LNBA 2H6CA 4AVZA 4WWCA 2K9MA 2LG4A 3F3XA 3ZMVA 2FOKA 1ZTRA 3N05A 1MBKA 1BC8C 5IPAA 4UVCA 4DZJA 5DCMB 5F0FA 1YX3A 3OYIA 3A2KA 4MEYF 1JUPA 3P9IA 4PK4A 2ZXWH 2PN6A 3MQ0A 2L7ZA 1MH3A 1MMNA 4ZYEA 3S3NA 2HOTA 3CDIA 5J1RA 3E0JB 2X9DA 3P7NA 1WJAA 4CZCA 2M4KA 2KRHA 2LFBA 2PI0A 1TW2A 3DEWA 3CMYA 1F9NA 3X2QH 4P96A 3MVPA 1NG6A 2K9NA 4XLEA 1EJ9A 5EG0B 1W5TA 4RB1A 3ULQB 3HHGA 2IS4A 1FSEA 4IO9F 2O6GE 2FD5A 4X0GA 4E70A 2PQ8A 3JW4A 4AIHA 3JTGA 4DZPA 1VQ9I 2ECBA 4PSWA 3DEUA 4CA0A 2YSRA 3M7GA 4KNYA 3K4LA 4M6XA 1Y1WJ 2KJCA 2F5FA 3CCEI 2L9NA 3BT9A 1YI2I 1OYYA 3DTKA 4IZZA 1K79A 3OYHA 2GIVA 3DEEA 2NOGA 4IHTA 5ERIA 2NVTJ 2R7ZJ 2R7UA 4ESFA 1TLHB 1RUNA 1SMYF 3F8MA 3H5AA 2VJ4A 1MSFC 4HF0A 2ZCWA 2VB6A 3QODA 2MD5A 2V1XA 2D2WA 3QRFF 2YU9J 2R5YA 4E7JA 2Z9OA 3IH2A 5K5QA 1DPUA 4ZJZA 2CFXA 3JRDA 3U9GA 5CVIA 1V55H 3H5RA 4M3DA 1IC8A 2XAQA 3G2BA 4ENKA 2E1OA 4G8XA 1YW9A 1FP1D 4TV7A 4NC7A 3K4JA 3E6CC 1Z3XA 5E1WA 1ODDA 1P2FA 2KDZA 4RAFA 2XAFA 3K9TA 2ZSIB 4B09A 3OSGA 3AG2H 4EJTA 2QGUA 1TQMA 2B7EA 5GTHC 4M74A 1K83J 1AWCA 3KP7A 5EGOB 3LSPA 3CF5F 3MMYB 3TW6A 1ITYA 5M3FJ 1ZK8A 1FEXA 3BDDA 5FKMA 3J7ZI 3F72A 4CYCA 4M9XA 3K0LA 2IGOA 5FLMJ 1TWAJ 5D4RA 1AOYA 3E5QA 3BJAA 2A3SA 2OCCH 3PIOF 1A35A 1Y6IA 4OIPF 5F27A 5LHIA 5FD5A 1D1BA 3ZQ7A 2HS5A 3TO7A 2DOFA 4A3GJ 2PJRA 1KU3A 4N4NB 4RB0A 1K6YA 3T8TA 4B8XA 2JRMA 1TT5B 3H9JA 5HS9A 5IYDJ 1X3WB 1MBFA 4AD9A 5JVGF 1F43A 2CSOA 5IP6A 4XOTA 1OPCA 3BG7A 3CUQA 2PLYA 2A69F 5DUKA 2CQQA 2QCOA 2VE8A 3BCBA 2BEOA 1F1ZA 4QLCU 2M8EA 2RNJA 5E3NA 1O57A 1OKRA 5GPAA 1IG7A 5LEJA 1XCVA 2K4JA 3A1YA 3P9CA 5F08A 1XGOA 1SD7A 1VQ6I 4IQ4A 1Y0UA 1C0WA 2HNHA 4A3DJ 1V5FA 3F8NA 5BPIA 3ZQQA 4EV0A 3HPGA 3H9QA 3PO3J 4I01A 2EIKH 1E3PA 4Y52J 2DFEA 2EINH 3BJ6A 5DUIA 3CCMI 1W7PA 5J1YA 4E4HA 2FQ3A 2GOMA 2X1CA 4D9JA 1YS6A 1BI0A 4II3A 3OYGA 5KK1A 2XKOA 4CCLA 4XLAA 4BDYA 2GWRA 2XHKA 1R36A 1WHUA 4GGGA 3CUQC 3MEXA 3CC2I 3HG9A 4NUBA 5D5VB 3T5XA 3S3OA 3L09A 2DA6A 2WV1A 1CF7A 3F8FA 1IZ1A 3KZZA 3SXYA 3TO6A 2GBYA 3BZ6A 5J47A 3A4CA 4U0VA 2ME0A 1W7PD 1WJ5A 1X3ZB 4LG3A 3FBIB 2HTSA 2LRDA 2P5LC 1U6GA 3D5RC 1FIAA 1KQ9A 3PFYA 1RC9A 1JTXA 1K4TA 1ETXA 4UVAA 1XN7A 5BPDA 2JPCA 2M7AA 1Y1VJ 3HXLA 5JLWA 2VE9A 1KU9A 2LR8A 4JP0A 5CVJA 5KHDA 3GTOJ 3GBGA 1B59A 1D1CA 1IN8A 1FX7A 4IVNA 2ID3A 1T8IA 3VWBA 3WTWC 3DLLF 3FDYA 4G7ZF 3HOSA 3SDGA 1SANA 3QYBA 3AG3H 4QPQA 1R5HA 2VPLA 3PNTA 2H8WA 2Y69H 1V54H 2RKHA 2QQBA 2ZNYA 5M3MJ 1G3TA 2HXOA 1J2XA 5M5YJ 2H6BA 3HOVJ 1X2MA 2EZIA 2WADA 1FJLA 4RGSA 2QZ8A 3LFUA 3IC7A 2IAIA 1RETA 2MYSA 3GEZA 3H0GJ 4NNJA 5DTDA 5F6FA 3JTHA 2FNAA 3MZHA 2KIUA 4BBRJ 4LB6B 1RKTA 2V1NA 2XIGA 1P4XA 3HEFA 1AKHA 2BV6A 3KPHA 5D5XB 1EH7A 1OQYA 3BR2A 2QKMB 2VONA 3J81K 2NAZA 3GO5A 2FBIA 2V9PA 1KU7A 5KAFC 3WTTC 4ESJA 1VF9A 1B9NA 3HPHA 3LSIA 5FLXK 2KP6A 2XASA 4BQNA 2AS5F 1JUSA 2VODA 2L4MA 1TWHJ 3CUOA 5IT3A 4ENJA 1HSTA 1LUJB 2K3FA 5ILSA 2ISYA 1QNTA 3ZOBA 5HVQC 3HYIA 3VOEA 3BR1A 1USSA 1GLNA 2R7DA 2OQGA 5K7HA 4HSRA 4PJLA 1QU3A 5C4XJ 2HOEA 2J5OA 2IA2A 2ZXHA 3Q9SA 3L9FA 2BY3A 1ETVA 3HJEA 5HDGA 1R4NB 2IGKA 2PG4A 2W00A 3OS0A 1U5TC 4UB8C 4X6AJ 2P81A 3CJNA 3F6OA 2VQLA 3E6BA 2A5WA 4OMZA 1U9OA 3ML6A 4BE0A 1F5TA 2CFOA 2XF6A 2Q2EB 3DKXA 2OZUA 3F8BA 5E8IA 2HZDA 1MGTA 4O5VA 1HQCA 4B3AA 5DD8A 2DDBA 4V2GA 2E2JJ 5EZHA 5B1BH 4A2UA 4UB6C 3ZMTA 1J09A 3C1DA 3M9AA 5DS9A 3TEDA 5FRMA 3TDZC 3LSKA 4FT8A 5FB2A 4S05A 1W4MA 1MZBA 4PUSA 4IL6C 4MFEA 3EUKL 3J81Z 2GAUA 4FETA 4Q5SF 5K7FA 2CO5A 2R5ZA 2WA0A 3M4OJ 1UG0A 2TRTA 5FLXZ 2KZVA 3OYMA 3OIOA 1IXRC 1OFCX 2HPMA 1TQIA 3A01B 4PFOA 2DAOA 5CKTA 3EUHA 1OLTA 4IHWA 4BNCA 2F5DA 1AU7A 5ICEA 3M1EA 2RQPA 5E18F 4LD5A 3V8JA 3ECHA 3EDPA 3RKWA 1X4OA 3W2WA 1HC8A 1SFUA 5J8CA 3DPUA 3NEUA 5FFZA 5DCMA 3EYYA 3CESA 2MC4A 4BHPA 4G6DA 1LFUP 1MJAA 4Y33A 1BIBA 1IAWA 2RAEA 1YG2A 4KUMA 5J1UA 4LMYA 4XRSG 1ZAOA 3GTPJ 2V9VA 3RQIA 1XB4A 4XKCA 3CTAA 4LIUA 4XSXF 4UV8A 5IYCJ 2EA2A 2FU4A 3C7JA 4BDZA 2A6EF 2ADUA 3LAPA 4Y4RA 4C2TA 2B63J 2WAFA 5EG0A 4HSTA 1WJEA 2HXIA 3FXMA 3OS2A 3S14J 4NDLA 2L9SA 1HSJA 1YOVB 4UXNA 1J5YA 2ZJQF 1Y8QB 4JBAA 4M3GA 4ZTFA 2UUZA 3I4PA 2E5NA 3EUHC 3OY9A 4J01A 2I8DA 3S2HJ 1FT9A 4XKBA 2XSJC 2Y9ZA 1QZZA 1D1AA 4A3JJ 2CUJA 4F91B 4BQAA 1W5SA 3RYRA 2E2HJ 4IHYA 2JA8J 2R0QC 4FHTA 1EKEA 1IXCA 1RUOA 1XSVA 2IS6A 3O2PE 2FJ1A 5EF6A 3KZYA 2A07F 4MO7A 5JVTA 1LFPA 2ELHA 5HOOA 4M3FA 2Y31A 5TISC 2FOWA 4OMYA 3FBNB 3M8JA 4PDKA 3MZ8A 1BBYA 3A02A 4ENNA 5LHGA 5E20A 1I5ZA 1MJBA 3E97A 3FM3A 2EK5A 5C3EJ 2VIXA 4KMUX 1USTA 3LMMA 3J80K 1R9TJ 5H2FC 5GP9A 1Y56A 1IW7F 3IUOA 3HC7A 3FIWA 1YJWI 1ZLJA 3SZTA 4BQQA 1Z6TA 1MBGA 4RM3A 2L3DA 3I54A 4BH9A 1P92A 1RKWA 4OINF 2NVXJ 2KHMA 3QYFA 5EYRA 3RI4A 1IO2A 4KT5C 2CQ7A 1U9NA 3LL7A 3OYJA 2CQXA 4RAGA 3ZQIA 2X6WA 1MDMB 1ZYRF 1T6SA 3CMAI 3NRVA 2JWTA 1BJZA 2XPVA 1DU0A 4IHSA 5FRNA 3CF2A 3QPLA 5EGOA 1HW2A 3I4MJ 2EILH 3FWEA 4CCKA 1UHMA 2LP0A 3I55I 1HBXG 3E5XA 3J7AY 1BR2A 2TDXA 2X6OA 2LC2A 2E7XA 2K7LA 3HOUJ 1FIPA 3FXOA 2OJED 1I50J 2F4OB 5HLGA 1U5TB 4IKFA 2R7SA 1K61A 2EZHA 2F5CA 5EZGA 2COBA 1IJWC 2XGXA 2D5VA 1QHGA 1Y0NA 3SFZA 4J00A 3V7SA 4Y13A 4G94A 1FTTA 2VL8A 3RPUA 1VNDA 4PCQA 1R58A 3S1MJ 1BN5A 1BW5A 2Y2ZA 2MLKA 2C6YA 4ZDPA 2L2OA 4CXFA 1F36A 3J80Z 3H1CA 5JR3A 4RB2C 2BHZA 3CCSI 2QEXI 4CDGA 2DYSH 2ETHA 3COAC 2MLGA 2E2IJ 2LYCA 4AIKA 5GPCA 2O8XA 2R7OA 3JRBA 4PZJA 1IN7A 1J9IA 1HW5A 2O0YA 1TT0A 3PNYA 3OYKA 4XICA 2BOLA 4BACA 2R7VA 5HS8A 2DFIA 3WG9A 4XIDA 3WTVC 4FASD 3PIPF 2FMLA 2LY9A 1MMSA 4XNFA 2E34A 3CJTB 3PUFA 5H6QA 1J75A 2K86A 1X1AA 2JUGA 2WBMA 1X1BA 3TW7A 2O8KA 3IAS2 4HQMA 1MMAA 1QZYA 2XF5A 2RC4A 1WI3A 2RDPA 2XDVA 3S2WA 2QSGX 2JA7J 3K1NA 3FF5A 2A05A 4U0YA 1Z7UA 3L1PA 1SVLA 4MEXF 1HKSA 2FRHA 5JI6A 1MH4A 1GVJA 2Y0SN 2RVCA 1YLFA 4D7NA 1LVAA 4XRMA 4GYGA 4WXHA 1KU2A 2STWA 3G1LA 2IP2A 4C2MJ 3FKIJ 2NVQJ 2LKPA 2DA3A 1P9QC 4ZYAA 2OU2A 2PX9A 2JK3A 1ETOA 3H35A 1SFKA 2GLOA 3I71A 3WGGA 4OIOF 2L7MP 2P7VB 1DUXC 3T8RA 3KYLA 4RMNA 4ZDLA 1A31A 4F93B 2DPUA 3Q3SA 3CDHA 2FQ4A 4E7IA 2L7KA 3DV8A 1O4XA 2DOEA 1ZRFA 5J6XA 4A5MA 3OOPA 3P5JA 4CHUA 5CJ9A 2JVGA 4XLHA 1VI0A 3ELKA 2ISZA 2RGVA 2HVQA 4IXAA 4I99C 1HKTA 2GM4A 1H9TA 4RGRA 5EEHA 2J5PA 2Z99A 2ZB9A 4LB5A 3H3ZA 2VKDA 4XLNF 4LLGF 4BXFA 4PJNA 3TP0A 2JA5J 3FMRA 4PSXA 1YFHA 3CLOA 1LB2A 3VODA 2EBIA 2P4WA 3ZGKA 4XK4A 2QQAA 2DT6A 4D1QA 3WTUC 3HOTA 3D1NI 4ZZLA 3WGHA 4WX9A 4EM0B 1S3JA 2BZTA 2MFZA 4M72A 1N75A 1D3YA 3OL4A 3U2RA 5CVRA 1MMDA 3JSPA 4HX4A 4RB3C 3K4CA 2VBWA 4A6DA 2M1BA 5HLHA 2L54A 2CUZA 5AIPA 5C4JJ 2FBKA 1R1VA 4K2EA 1JT0A 3L00A 2LD5A 4A3KJ 3HGGA 1XGSA 1UHSA 2XVCA 1X58A 2ELJA 2MGQA 3DP7A 4RGUA 3F8CA 4ZYDA 1LFBA 2EIJH 2GIZA 5B3SH 3CD6I 2IJLA 2QSHX 3U1KA 2DT5A 1YRNB 4I7HA 2JQ7A 4MNUA 3WTXC 1P7IA 2CMPA 4IX7A 1RIOH 4BJTA 1ETYA 3OMYA 1BOBA 1BI1A 2QUFA 4LITA 4XLPF 3FZVA 3IL2A 2M3AA 2XB5A 5FKOA 1H0MA 4YFXF 1JHFA 1W0UA 3DFGA 2A6HF 2EFPA 4G7OF 1SVMA 1VQ7I 4BBSJ 1HDPA 2E5ZA 2WB1A 4CICA 1Z1DA 1A04A 1NTCA 2MBFA 3OYDA 1ACIA 1B72B 1OJLA 2E7WA 2GXBA 4HNTA 2Z16A 1F4KA 1TNSA 3JCUC 3CMEI 3EPZA 3H36A 3IHUA 2PEXA 3G71I 1PYVA 3H9GA 2LSOA 2R7FA 4DIQA 1L0OC 1Z67A 3HUGB 1IUYA 2FA5A 2L01A 3J7AO 2BBYA 4DBQA 1T2KA 2XKPA 3DLAA 4HNVA 4GRIA 1GV5A 2LLKA 5CVVA 3TOBA 1OISA 5HNFA 2Q2EA 4L9TA 4E7KA 4LFUA 4D5CA 1ZHFA 3HSFA 1MSEC 3MCZA 4RAYA 1I6XA 1X1PA 2CRGA 1D5YA 3BOQA 3ZQGA 1GUUA 2FMYA 2DQLA 3KEYA 3BP8A 3J7YJ 4X1EA 3VYRB 2FE3A 2AXTC 3BLYA 2DTZA 4HV5A 4Z2YA 1B8IB 2W57A 3LSJA 3VDXA 2MW8A 2ZNZA 3JSOA 1VQ5I 1YW7A 2DA2A 2Y48A 4G6TB 1ZG5A 1QQIA 1O3TA 5FGMA 2HGCA 2EH3A 3GFJA 1RI7A 5E3OA 2NNNA 2DLLA 1FTZA 3A01A 2X0LA 2FF4A 1S7AA 2FUG2 4ZZDA 2CUFA 3CJQB 4JQFA 1ZGWA 1GHCA 2HPIA 4AYBN 5GTIC 3DKWA 4HX8A 4WF2A 3CP2A 2FBHA 2OD5A 2M45A 4OAYA 3A0HC 2E1CA 4DYRA 3LSHA 1S29A 3ABKH 2B0LA 4LLNA 1Z21A 4XBFA 4IOAF 2XB0X 4FCYA 3HL2A 3VSKA 2KZGA 2MG4A 4XORA 5IP9J 4EQQA 3ROUA 4KIFA 4HLYA 3RZDJ 5E8GA 2VLAA 1FYKA 2ZXJA 2XROA 3GUDA 4JYKA 1ZG1A 2ZJRF 3HSEA 1OYIA 1QRYA 4RLQA 4G7HF 4QIWN 4IRGA 5FFXA 1G3YA 4L5IA 1LEAA 4Y3OA 4PJMA 1NK3P 3OS1A 1J0RA 2XGEA 2P5KA 1R5ID 3JRHA 2P6SA 2QLZA 1LEBA 4R1HA 3B02A 4ENMA 2YX4A 1I3QJ 3H3UA 4A69C 3JREA 3MKYB 3TGNA 4FE7A 1TWCJ 1BC7C 3LSTA 4HYEA 2L4AA 2QQ8A 2STTA 1LE8B 1IRXA 2VQHA 1XS9A 2I5UA 5FO5A 3VYTB 1D8KA 2HOSA 3RIRA 1R1UA 4GYIA 1LPQA 4UVBA 1KONA 4HRIA 1KGSA 4LOCA 1GV2A 3L2CA 2XGDA 3ZQFA 3G3ZA 2IPQX 2PBIA 2V7FA 2DFHA 3RSNA 1Z0XA 3EQLF 3DF8A 3H5NA 1SFOJ 5L3DA 2KFDA 1S7EA 2YUSA 2KISA 5K7ZA 4BL0B 2BW3B 4G6QA 4BE1A 1RR8C 2KIQA 4II2A 5HS7A 3WTSC 1O3SA 1D8JA 2ID6A 2O61A 3V4GA 4EJVA 3KP6A 1REPC 4WXDA 1KZHA 3BG3A 5B66C 4EJUA 1T95A 4FE4A 4RDUA 1TTYA 1SD5A 2WY7Q 4I02A 2IA0A 3TDUC 2Y0SA 3IH4A 1JGSA 2AO9A 1MDMA 2VKHA 1H8AC 2GQQA 1TNTA 3HM5A 1HOMA 3I4NJ 4S0HB 1UZCA 2MH2A 2GA1A 2NS8A 3C2HA 3OYNA 2R3SA 1B6AA 3QPTA 3KYCB 1N77A 1K6OA 2XV4S 4RM2A 3PSFA 2W24A 4ZH4F 4Q48A 3CDLA 1ERDA 2CW8A 1MJ9A 2X6YA 4B4CA 1XX5A 2FXAA 4HNUA 1WH7A 1G6NA 5ILUA 1R23A 1TBXA 4YIFA 4C30A 3WTYC 3KP3A 3HTSB 2PMZA 4XONA 2VUMJ 4KT6A 2EFWA 4PGGA 3V7RA 4QPOA 4IRIA 3QOPA 1U5TA 1YJNI 2DN0A 4H4KC 1E3OC 3R6SA 3RKQA 2OF7A 3D0SA 3DBLB 4MFDA 3I59B 3GZ6A 5FKNA 1PDNC 2LBFB 2TCTA 4IEJA 3NAUA 2MH9A 4ON0A 4ZYGA 4KICA 1LDKB 2LREA 2MSYA 2DU9A 1XG1A 2BVLA 3P9KA 5J3LA 2HYJA 3ZCOA 2UZKA 2CJJA 3FHNA 2M2EA 1ULYA 1YJ9I 4AIDA 2GXAA 5J4VA 3ZMUA 2Z3YA 3HRSA 2JJ7A 2M4GA 1V4RA 3ZPLA 3IV5A 4DJAA 3GXOA 4J19A 2V4JC 4KN7X 2L5QA 1R4MB 1GDTA 2Z1DA 4NBQA 4KYWA 3MZYA 4HLXA 4CCNA 3OV8A 3R61A 4CCJA 1FOXA 9ANTA 3HZJA 1FPQA 1FMVA 4XMYA 1WZ2A 4BEHB 1VQPI 3E5UA 3IRQA 3DXJF 4AUXA 4UUVA 3LFKA 2LH9A 3Q0WA 1OCPA 5AONA 1LDDA 2NNYA 2GA2A 2K40A 2KIFA 1BR1A 4C3JJ 2WWYA 4BE2A 3WU0A 1FBUA 3GFIA 3EYIA 1X1DA 2DI3A 2JT1A 4XLFA 3ZQLA 3WTZA 4CYDA 2GXGA 3JRCA 3I5UA 1PP8F 5FLVA 4A3BJ 3ZXSA 3GTGJ 1ZG3A 2KDOA 3K10A 3KZIC 3ZQCA 4CH7A 3HOYJ 3FHZA 1WJFA 2DCEA 4R79A 3WODF 3BCAA 4UY8I 1LVKA 4ZTJA 1DQUA 4KFCA 3ZQHA 2ZC2A 1T08B 2ZMEC 4HV6A 3SZPA 4N4OB 1S72I 2F2EA 2OAZA 1X4PA 1Y8RB 2F4IA 4KITB 2X1DA 4CSWA 2ACJA 2W7NA 2ECCA 2DMNA 2B9SA 1I6HJ 4OIQF 3KP2A 4B47A 1LKXA 1YE9A 4E7HA 1XD7A 2OCEA 4MHGA 4A3CJ 3CLQA 1ETWA 3B73A 4GO1A 2V26A 3HIFA 3CCLI 2E1MC 2E71A 3K4KA 3AKZA 2D45A 2IVMA 3S93A 2DA1A 4XR6A 5LHHA 2YPRA 1APLC 2DMUA 2DA4A 4ESBA 3BR3A 1QVTA 2NVYJ 3FKJA 4A5NA 1JKRC 2H94A 5F0CA 1TWGJ 1XMKA 2OBPA 2R7QA 2VBXA 3CMMA 3HOWJ 4G12A 1A6QA 2DJIA 2V1UA 3IKVA 3QP6A 3ZMSA 5LGTA 3Q5FA 4PJ0C 2L9VA 3QPSA 1NH3A 1FLIA 1OYWA 1UG2A 2XAUA 1H89C 3M07A 4CGZA 2BY1A 4P9UA 3S15J 3FXJA 1RR7A 4YFKF 2ELKA 1MBHA 3GFMA 3QYEA 3WGIA 2ZKZA 3BQYA 1OCTC 3CQZJ 2KIMA 2ZO4A 1ONVA 2Z2SB 1I3AA 4HW0A 1YX5A 3L2VA 4L0ZB 2DTRA 3IWZA 2O3FA 1YRNA 3I58A 2DMTA 3DU6A 5KVRA 2CYYA 3NWTA 5M5WJ 1WVRA 2OC6A 3BG9A 4EM2A 4DBRA 5IOZA 1YYVA 1VQMI 4P9FA 2ZJPF 1MMGA 3KP5A 3SDBA 3HRMA 3PSIA 3S17J 2A61A 2QWWA 5C44J 3ZR8X 1XMAA 3AL0C 1TP4A 5TGTA 4I2OA 1BI3A 3GCMA 1BL0A 3A03A 1HLVA 3T0YA 1KQ8A 3I53A 3LWFA 3K7AJ 1W0TA 1TL8A 2Q0OA 2AHQA 1FY7A 3G6EI 4N9IA 1EV7A 5JLXA 2QVOA 4A3FJ 2AQFA 5LEKA 4OIRF 3S3MA 5ICFA 1B72A 1SD4A 1ZN2A 3N97A 2XAJA 2OTJI 5EJCA 3LNQA 4O6JA 3IRRA 5IT9K 1KYWA 2HU9A 2K9SA 3CCRI 3LA2A 2CV2A 4H0EA 5FKLA 2H1LA 4YFNF 3HUGA 2IRFG 4L5EA 4U7BA 1ZREA 2K02A 2VC0A 2A6TA 3WHCA 4ABZA 3PJRA 1FYMA 4F52A 3ECOA 2JZYA 3I9V2 3DBHB 1P6RA 4M9SA 2EJRA 2E19A 2JMWA 2R7TA 1T56A 1BW6A 5EEGA 3WE2A 2M34A 2M30A 2HKOA 1J7KA 5DV5A 1T39A 1FOWA 2EA4A 1A6IA 3ASNH 3O8HA 4KMFA 2JN6A 2HWVA 1ZR2A 2ICWG 3LAJA 2CQNA 3W6KB 2XC7A 2X51A 2CW7A 2DO7A 4A93J 2EZLA 4PGHA 3DBRB 1B8IA 1SAXA 2OTLI 3K4MA 5LD2C 1RRJA 1B9MA 1DGWY 1ZR4A 2WTEA 1ZRDA 4V19K 3ERED 3TKYA 3L2QA 4LK1F 5GAHJ 4E7ZA 4EM1A 1ZKGA 1ZARA 2G7HA 2IGNA 3KLOA 2VQCA 3C2BA 5E3LA 4EJWA 3FXUA 4ETSA 4P5OA 5IOYA 1O7LA 3KP4A 5GADJ 3IKTA 1K78B 2DBBA 2EFOA 3E1SA 2H09A 3R0JA 5DEQA 4HPQA 1FNNA 4C2UA 3SQNA 5DDGA 1T98A 2GZWA 2OZ6A 3BG6A 4NC8A 3F23A 1XSXA 3KX2A 5E3MA 5KAIC 5E1XA 2H8RA 3MKWB 2CQKA 3ZN0A 3BZKA 1JKQC 2COMA 3SJMA 3CO6C 3U21A 5F0HA 2LF8A 1P4WA 2R93J 3ZN1A 3CJRB 3KFWX 3AG4H 3DTEA 3SEQA 2R92J 4U0WA 1U78A 2EZKA 2ZMEB 1MW7A 2G7UA 4KDPA 2KT0A 5FD6A 3KEOA 1G8XA 1EH6A 1DP3A 4WCGA 2QA4I 2HQ5A 1WWXA 2IXSA 2DYRH 1ZRCA 3V42A 1WJDA 3C2GA 4BAYA 4E6KG 1U8RA 4NHJA 4HDUA 2VXZA 4RBOA 5CPRB 2E1MB 4I0BA 1QA6A 2H27A 3MFKA 1FOYA 1VQ4I 2L7FP 5ILVA 1AA7A 1X2NA 2XPUA 3RCOA 2F48A 4KN4X 2JA6J 1LE8A 1I1GA 4CUGA 1IRZA 5DCFA 3EETA 4FX0A 1MIJA 1G3SA 2M8GX 1VQNI 4YELA 1T0FC 4CZZA 3RZOJ 3OYLA 1RPWA 1GXPA 4GCVA 3JRAA 1MNDA 1QVUA 3JRIA 1V5EA 2K3PA 1R49A 4BHBA 1UCRA 1IF1A 1X3UA 2VBYA 4A0YA 1KYZA 2XAGA 3HGYA 2KJBA 1X1CA 1HXDA 5TJJA 3SEZA 3GFLA 2DJNA 2OPTA 3CP8A 3HB9A 4NQWB 4XOPA 2KRCA 3QAHA 5B5EC 1FWZA 4XLCA 2BW3A 1Z91A 5E17F 1Q1HA 3PUBA 3QP5A 3FMSA 3AG1H 5L3EA 5CQEA 4EATA 1WI9A 1PUFB 1QZEA 3BR6A 4ZDOA 1OR7A 1R7JA 3CC7I 4PJJA 3M3YJ 4N9HA 3AL0B 3PL8A 3WU2C 3HTUA 1IN6A 1E2XA 2MD0A 4V2FA 3GTKJ 3RTRA 1S5LC 2QBYB 3PQJA 3KCCA 2UWMA 1SMTA 2XF7A 4BS9A 4B44A 4BKXA 2XUBA 2BXZA 4BGDA 3K2ZA 5CYVA 3V8LA 2KPMA 4BUPA 4JX4A 1NG7A 2OV7A 3UR3C 4DW6A 2VI6A 5M5XJ 2BHYA 5L3BA 2WY8Q 2ZFUA 3I64A 1PUEE 2LKSA 2NYXA 1RZ4A 1FC3A 2FX0A 4YEJA 2Y9YA 2IA1A 4FISA 5DM7F 2DXIA 5D5WB 1I39A 3NWSA 3I59A 1QHHD 2LBFA 3E7LA 2W48A 1U3EM 4IHXA 3CZ6A 3JR9A 4A12A 1BA5A 3RPQA 1OR7C 4HQEA 2CG4A 1JI8A 4W97A 3OWTA 1FOKA 1IDYA 3H0DA 3MKLA 4FX4A 2ESHA 5IYBJ 1P4AA 4B43A 1MBEA 1OCRH 1PJRA 4XSZF 2IEKA 5HDKA 1TWFJ 2PJPA 1Z9CA 3RJPA 2LY2A 1H9GA 3E6MA 4CCMA 4NC6A 4XKVA 3OYBA 3W6JB 3FK6A 4B48A 1G4DA 2CU7A 3FX3A 2YR2A 3O3KA 4L9JA 3G4SI 2P7CB 1BI2A 1Q1VA 4M3EA 4Z6YA 2OA4A 1VQLI 3PQKA 5LBQA 2V1DA 2RREA 5L3FA 5BOXA 2VOPA 4U7DA 3TOAA 5D5UB 2W25A 5LFAA 3GTJJ 4PFPA 1JKOC 3KETA 3RKXA 4BEHA 2HEOA 2M9HA 3UNGC 2DMPA 2DODA 3BZCA 3K1MA 3SZGA 2LMDA 3L2RA 3OYAA 3HRTA 2G9WA
chains in the Genus database with same CATH topology
3I4NJ 4S0HB 5IYCJ 3OOUA 2NS8A 1XC5A 1ENHA 4MLOA 2B63J 4A3IJ 5EG0A 1VFCA 1UMQA 2HXIA 3CDLA 3S14J 4NDLA 4B4CA 1GT0C 1WH7A 2LTPA 4M3GA 3PM1A 4JX5A 3CCYA 3S2HJ 2VUMJ 3BQZA 2Y9ZA 2HDDA 4A3JJ 1IDZA 2DN0A 1E3OC 3RKQA 2E2HJ 2OF7A 4MFDA 4IHYA 2JA8J 1IUFA 2R0QC 2O7OA 5FKNA 2TCTA 4IEJA 3NAUA 5HODA 1A5JA 2FJ1A 2MSYA 5EF6A 4UUSA 1XG1A 4FTHA 4EEFG 3PO2J 4XRSA 3JRGA 4MO7A 1DU6A 5J3LA 2HYJA 4M3FA 2Y31A 2R5ZB 2CJJA 1Z77A 2M2EA 3K2AA 3A02A 2JJ7A 2PMZN 1WH5A 1HDDC 2IBDA 3B6CA 3MN2A 3IV5A 4J19A 3HDDA 5C3EJ 4B1RA 1ZTRA 4A3LJ 1R9TJ 1MBKA 5IPAA 1GDTA 5GP9A 4DZJA 3FIWA 5F0FA 1JUPA 2NS7A 9ANTA 1MBGA 1RKWA 2NVXJ 2L7ZA 1MH3A 5EYRA 3OSFA 4AUXA 2HOTA 1U9NA 5J1RA 3Q0UA 3Q0WA 1OCPA 2CQXA 2X9DA 3ZQIA 2K40A 4C3JJ 1CQTA 2LFBA 2JWTA 1BJZA 4UUTA 2XPVA 1DU0A 2DA7A 3DEWA 3GTMJ 3CMYA 3QPLA 5EGOA 3FISA 3ZQLA 3JRCA 3MVPA 3I4MJ 4A3BJ 2K9NA 5FLVA 5EG0B 3GTGJ 3HOZJ 3ZQCA 5FJ8J 3HOYJ 2LP0A 2FD5A 1HF0A 1G2HA 2X6OA 3ZQHA 1H88C 3HOUJ 4BY1J 1FIPA 1I50J 1TC3C 4DZPA 2ECBA 1K61A 2EZHA 1WCMJ 5EZGA 2COBA 1Y1WJ 1IJWC 1MNMC 2D5VA 3BT9A 2ECCA 2DMNA 1I6HJ 2I10A 1FTTA 1VNDA 3S1MJ 4A3CJ 1BW5A 1ETWA 2Y2ZA 2NOGA 4UUSB 2NVTJ 2R7ZJ 3GTQJ 1F36A 2DA1A 1APLC 5IP7J 1MSFC 3LSGA 2DMUA 2DA4A 2E2IJ 3BR3A 5GPCA 4JX6A 3JRBA 4A3MJ 1QVTA 2NVYJ 1JKRC 5F0CA 1TWGJ 2YU9J 3HOWJ 4G12A 4XICA 2R5YA 3IH2A 4GFBA 3QPSA 2WAQN 3JRDA 4XIDA 1ZQ3P 1UG2A 4M3DA 2LY9A 1H89C 1IC8A 3S15J 2E1OA 3TP3A 1RR7A 2ELKA 1ETQA 1RESA 1MBHA 3TW7A 5BNGA 2LVSA 2O8KA 2KDZA 1P7JA 1JJ6C 4I76A 1WI3A 2JA7J 3BQYA 1POGA 1OCTC 3CQZJ 3L1PA 3OSGA 1K83J 1YRNA 3B6AA 2YS9A 1MH4A 3HKZN 2Y0SN 5EGOB 1JTYA 2DMTA 4D7NA 3LSPA 4XRMA 3O8GA 3TW6A 5M5WJ 1EF4A 1WGXA 3BG9A 2QF7A 3G1LA 4C2MJ 3FKIJ 1ZK8A 5M3FJ 5IOZA 2NVQJ 1ITYA 2DA3A 1FEXA 5FKMA 3S17J 2JK3A 1ETOA 3BTLA 5C44J 2GLOA 2L7MP 4CYCA 3Q3SA 5FLMJ 1TWAJ 2FQ4A 1BL0A 3A03A 3SFIA 1HLVA 1O4XA 1IGNA 3K7AJ 1W0TA 2AHQA 1VI0A 5F27A 5JLXA 3WHBA 2GM4A 4A3GJ 4A3FJ 1B72A 5F1JA 3LNQA 5IYDJ 2ZB9A 3S1NJ 1MBFA 3Q0VA 2K9SA 1F43A 5IP6A 2DA5A 5FKLA 3BR0A 3HBLA 3TP0A 2JA5J 4L5EA 3WHCA 4ABZA 2CQQA 2EBIA 2QCOA 4XK4A 4C3HJ 3D1NI 4D7MA 2E19A 2JMWA 2R5YB 1T56A 5E3NA 1BW6A 2CUEA 5GPAA 2M34A 1IG7A 5F08A 4D5FA 2HOAA 2L9RA 4M3BA 4A3DJ 1A6IA 1WPKA 3O8HA 5C4JJ 2JN6A 1ZR2A 3PO3J 1JT0A 2LD5A 4A3KJ 1NK2P 2G0EA 3HGGA 4Y52J 1UHSA 1X58A 4I6ZA 4A93J 2EZLA 2MGQA 1B8IA 3BTCA 1LFBA 5J1YA 1ZR4A 1YRNB 1P7IA 1ETYA 1ZKGA 5E3LA 3C2BA 3BR5A 2Y30A 5IOYA 1MBJA 2H1KA 2XB5A 5FKOA 2LK2A 2DA6A 2WV1A 4DYCA 4CYCB 1GVDA 2GBYA 3LSRA 1W0UA 5E3MA 2H8RA 1U8BA 1PUFA 1JKQC 3SJMA 4BBSJ 2ME0A 1HDPA 3BTJA 5F0HA 2R93J 3NARA 1FIAA 2R92J 1NTCA 1U78A 2EZKA 1JTXA 1HCRA 1ETXA 1B72B 1OJLA 4BY7J 2KT0A 3HOXJ 1Y1VJ 3IH3A 5JLWA 2LR8A 4JP0A 3GTOJ 1JT6A 3S2DJ 3GBGA 2HQ5A 2ID3A 4AC0A 1JGGA 2LKXA 2XRLA 4HNVA 1GV5A 2LLKA 4RBOA 3G1MA 4A3EJ 3SDGA 1SANA 2WB1N 4D5CA 3DCFA 2L7FP 1X2NA 1JUMA 2XPUA 1MSEC 2JA6J 1D5YA 2CRGA 4M6VA 4QSHA 1LE8A 3ZQGA 1GUUA 4DYQA 1IRZA 4X1EA 5EEAA 5M3MJ 2M8GX 2HXOA 3BTIA 5M5YJ 3HOVJ 3RZOJ 1RPWA 2HI3A 1X2MA 2DTZA 2EZIA 4Y7NJ 3JRAA 1QVUA 3JRIA 1B8IB 1FJLA 2VKEA 3LSJA 2K9QA 2MW8A 2DA2A 2IAIA 1RETA 3H0GJ 2EH3A 5DTDA 5E3OA 3H3VK 2O9LA 1FTZA 3HGYA 4BBRJ 3A01A 1RKTA 2VPRA 2N8GA 2X48A 2CUFA 4IHVA 3HEFA 2DJNA 2OPTA 3HB9A 1ZGWA 1AKHA 4AYBN 2ME6A 3BR2A 3GTLJ 4DYRA 4W1UA 1VF9A 1T33A 4QTRA 1PUFB 1JUSA 1JJ8C 1TWHJ 2XB0X 4FCYA 3BR6A 3JRFA 3ZOBA 2MG4A 3BR1A 5IP9J 3M3YJ 1ORKA 5K7HA 4V2FA 3RZDJ 3GTKJ 5C4XJ 3S1RJ 4JYKA 1QRYA 1ETVA 4BKXA 4QIWN 5EDNA 3F0CA 2XGCA 1NK3P 5F04A 4JX4A 2XGEA 4DW6A 2VI6A 2P81A 3BG5A 5M5XJ 4X6AJ 3JRHA 1U9OA 2L0KA 2FX0A 1I3QJ 2Y9YA 4MIMA 4A69C 4B3AA 3JREA 4FISA 3FK7A 4FE7A 1TWCJ 4V2GA 5EZHA 2E2JJ 3LOCA 1LE8B 1XS9A 3G1OA 5DS9A 3E7LA 3TEDA 2W48A 3QQAA 2HOSA 4IHXA 3JR9A 2XSDC 1BA5A 2XPWA 2DMQA 4MFEA 4LOCA 1GV2A 4W97A 1IDYA 3MKLA 2XGDA 3ZQFA 5K7FA 2R5ZA 5IYBJ 2EQRA 1MBEA 2TRTA 3M4OJ 2IEKA 1TWFJ 5FKKA 1Z0XA 3UKGA 3OIOA 1OFCX 1SFOJ 3A01B 1IV6A 1ETKA 1S7EA 2YUSA 4BXXJ 1AKHB 3FK6A 1AHDP 5K7ZA 4IHWA 2M0CA 1AU7A 2CU7A 1JKPC 2ID6A 1Q1VA 4M3EA 4C3IJ 3S16J 3W6VA 1LFUP 3BG3A 3GTJJ 1JKOC 2RAEA 4FE4A 4RDUA 2M9HA 2DMPA 1QPIA 2VKVA 5J1UA 4XRSG 3GTPJ 3S1QJ 3IH4A 3VPRA 2AO9A 3RQIA 1H8AC 1HOMA 3HM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N J;  4S0H B;  5IYC J;  3OOU A;  2NS8 A;  1XC5 A;  1ENH A;  4MLO A;  2B63 J;  4A3I J;  5EG0 A;  1VFC A;  1UMQ A;  2HXI A;  3CDL A;  3S14 J;  4NDL A;  4B4C A;  1GT0 C;  1WH7 A;  2LTP A;  4M3G A;  3PM1 A;  4JX5 A;  3CCY A;  3S2H J;  2VUM J;  3BQZ A;  2Y9Z A;  2HDD A;  4A3J J;  1IDZ A;  2DN0 A;  1E3O C;  3RKQ A;  2E2H J;  2OF7 A;  4MFD A;  4IHY A;  2JA8 J;  1IUF A;  2R0Q C;  2O7O A;  5FKN A;  2TCT A;  4IEJ A;  3NAU A;  5HOD A;  1A5J A;  2FJ1 A;  2MSY A;  5EF6 A;  4UUS A;  1XG1 A;  4FTH A;  4EEF G;  3PO2 J;  4XRS A;  3JRG A;  4MO7 A;  1DU6 A;  5J3L A;  2HYJ A;  4M3F A;  2Y31 A;  2R5Z B;  2CJJ A;  1Z77 A;  2M2E A;  3K2A A;  3A02 A;  2JJ7 A;  2PMZ N;  1WH5 A;  1HDD C;  2IBD A;  3B6C A;  3MN2 A;  3IV5 A;  4J19 A;  3HDD A;  5C3E J;  4B1R A;  1ZTR A;  4A3L J;  1R9T J;  1MBK A;  5IPA A;  1GDT A;  5GP9 A;  4DZJ A;  3FIW A;  5F0F A;  1JUP A;  2NS7 A;  9ANT A;  1MBG A;  1RKW A;  2NVX J;  2L7Z A;  1MH3 A;  5EYR A;  3OSF A;  4AUX A;  2HOT A;  1U9N A;  5J1R A;  3Q0U A;  3Q0W A;  1OCP A;  2CQX A;  2X9D A;  3ZQI A;  2K40 A;  4C3J J;  1CQT A;  2LFB A;  2JWT A;  1BJZ A;  4UUT A;  2XPV A;  1DU0 A;  2DA7 A;  3DEW A;  3GTM J;  3CMY A;  3QPL A;  5EGO A;  3FIS A;  3ZQL A;  3JRC A;  3MVP A;  3I4M J;  4A3B J;  2K9N A;  5FLV A;  5EG0 B;  3GTG J;  3HOZ J;  3ZQC A;  5FJ8 J;  3HOY J;  2LP0 A;  2FD5 A;  1HF0 A;  1G2H A;  2X6O A;  3ZQH A;  1H88 C;  3HOU J;  4BY1 J;  1FIP A;  1I50 J;  1TC3 C;  4DZP A;  2ECB A;  1K61 A;  2EZH A;  1WCM J;  5EZG A;  2COB A;  1Y1W J;  1IJW C;  1MNM C;  2D5V A;  3BT9 A;  2ECC A;  2DMN A;  1I6H J;  2I10 A;  1FTT A;  1VND A;  3S1M J;  4A3C J;  1BW5 A;  1ETW A;  2Y2Z A;  2NOG A;  4UUS B;  2NVT J;  2R7Z J;  3GTQ J;  1F36 A;  2DA1 A;  1APL C;  5IP7 J;  1MSF C;  3LSG A;  2DMU A;  2DA4 A;  2E2I J;  3BR3 A;  5GPC A;  4JX6 A;  3JRB A;  4A3M J;  1QVT A;  2NVY J;  1JKR C;  5F0C A;  1TWG J;  2YU9 J;  3HOW J;  4G12 A;  4XIC A;  2R5Y A;  3IH2 A;  4GFB A;  3QPS A;  2WAQ N;  3JRD A;  4XID A;  1ZQ3 P;  1UG2 A;  4M3D A;  2LY9 A;  1H89 C;  1IC8 A;  3S15 J;  2E1O A;  3TP3 A;  1RR7 A;  2ELK A;  1ETQ A;  1RES A;  1MBH A;  3TW7 A;  5BNG A;  2LVS A;  2O8K A;  2KDZ A;  1P7J A;  1JJ6 C;  4I76 A;  1WI3 A;  2JA7 J;  3BQY A;  1POG A;  1OCT C;  3CQZ J;  3L1P A;  3OSG A;  1K83 J;  1YRN A;  3B6A A;  2YS9 A;  1MH4 A;  3HKZ N;  2Y0S N;  5EGO B;  1JTY A;  2DMT A;  4D7N A;  3LSP A;  4XRM A;  3O8G A;  3TW6 A;  5M5W J;  1EF4 A;  1WGX A;  3BG9 A;  2QF7 A;  3G1L A;  4C2M J;  3FKI J;  1ZK8 A;  5M3F J;  5IOZ A;  2NVQ J;  1ITY A;  2DA3 A;  1FEX A;  5FKM A;  3S17 J;  2JK3 A;  1ETO A;  3BTL A;  5C44 J;  2GLO A;  2L7M P;  4CYC A;  3Q3S A;  5FLM J;  1TWA J;  2FQ4 A;  1BL0 A;  3A03 A;  3SFI A;  1HLV A;  1O4X A;  1IGN A;  3K7A J;  1W0T A;  2AHQ A;  1VI0 A;  5F27 A;  5JLX A;  3WHB A;  2GM4 A;  4A3G J;  4A3F J;  1B72 A;  5F1J A;  3LNQ A;  5IYD J;  2ZB9 A;  3S1N J;  1MBF A;  3Q0V A;  2K9S A;  1F43 A;  5IP6 A;  2DA5 A;  5FKL A;  3BR0 A;  3HBL A;  3TP0 A;  2JA5 J;  4L5E A;  3WHC A;  4ABZ A;  2CQQ A;  2EBI A;  2QCO A;  4XK4 A;  4C3H J;  3D1N I;  4D7M A;  2E19 A;  2JMW A;  2R5Y B;  1T56 A;  5E3N A;  1BW6 A;  2CUE A;  5GPA A;  2M34 A;  1IG7 A;  5F08 A;  4D5F A;  2HOA A;  2L9R A;  4M3B A;  4A3D J;  1A6I A;  1WPK A;  3O8H A;  5C4J J;  2JN6 A;  1ZR2 A;  3PO3 J;  1JT0 A;  2LD5 A;  4A3K J;  1NK2 P;  2G0E A;  3HGG A;  4Y52 J;  1UHS A;  1X58 A;  4I6Z A;  4A93 J;  2EZL A;  2MGQ A;  1B8I A;  3BTC A;  1LFB A;  5J1Y A;  1ZR4 A;  1YRN B;  1P7I A;  1ETY A;  1ZKG A;  5E3L A;  3C2B A;  3BR5 A;  2Y30 A;  5IOY A;  1MBJ A;  2H1K A;  2XB5 A;  5FKO A;  2LK2 A;  2DA6 A;  2WV1 A;  4DYC A;  4CYC B;  1GVD A;  2GBY A;  3LSR A;  1W0U A;  5E3M A;  2H8R A;  1U8B A;  1PUF A;  1JKQ C;  3SJM A;  4BBS J;  2ME0 A;  1HDP A;  3BTJ A;  5F0H A;  2R93 J;  3NAR A;  1FIA A;  2R92 J;  1NTC A;  1U78 A;  2EZK A;  1JTX A;  1HCR A;  1ETX A;  1B72 B;  1OJL A;  4BY7 J;  2KT0 A;  3HOX J;  1Y1V J;  3IH3 A;  5JLW A;  2LR8 A;  4JP0 A;  3GTO J;  1JT6 A;  3S2D J;  3GBG A;  2HQ5 A;  2ID3 A;  4AC0 A;  1JGG A;  2LKX A;  2XRL A;  4HNV A;  1GV5 A;  2LLK A;  4RBO A;  3G1M A;  4A3E J;  3SDG A;  1SAN A;  2WB1 N;  4D5C A;  3DCF A;  2L7F P;  1X2N A;  1JUM A;  2XPU A;  1MSE C;  2JA6 J;  1D5Y A;  2CRG A;  4M6V A;  4QSH A;  1LE8 A;  3ZQG A;  1GUU A;  4DYQ A;  1IRZ A;  4X1E A;  5EEA A;  5M3M J;  2M8G X;  2HXO A;  3BTI A;  5M5Y J;  3HOV J;  3RZO J;  1RPW A;  2HI3 A;  1X2M A;  2DTZ A;  2EZI A;  4Y7N J;  3JRA A;  1QVU A;  3JRI A;  1B8I B;  1FJL A;  2VKE A;  3LSJ A;  2K9Q A;  2MW8 A;  2DA2 A;  2IAI A;  1RET A;  3H0G J;  2EH3 A;  5DTD A;  5E3O A;  3H3V K;  2O9L A;  1FTZ A;  3HGY A;  4BBR J;  3A01 A;  1RKT A;  2VPR A;  2N8G A;  2X48 A;  2CUF A;  4IHV A;  3HEF A;  2DJN A;  2OPT A;  3HB9 A;  1ZGW A;  1AKH A;  4AYB N;  2ME6 A;  3BR2 A;  3GTL J;  4DYR A;  4W1U A;  1VF9 A;  1T33 A;  4QTR A;  1PUF B;  1JUS A;  1JJ8 C;  1TWH J;  2XB0 X;  4FCY A;  3BR6 A;  3JRF A;  3ZOB A;  2MG4 A;  3BR1 A;  5IP9 J;  3M3Y J;  1ORK A;  5K7H A;  4V2F A;  3RZD J;  3GTK J;  5C4X J;  3S1R J;  4JYK A;  1QRY A;  1ETV A;  4BKX A;  4QIW N;  5EDN A;  3F0C A;  2XGC A;  1NK3 P;  5F04 A;  4JX4 A;  2XGE A;  4DW6 A;  2VI6 A;  2P81 A;  3BG5 A;  5M5X J;  4X6A J;  3JRH A;  1U9O A;  2L0K A;  2FX0 A;  1I3Q J;  2Y9Y A;  4MIM A;  4A69 C;  4B3A A;  3JRE A;  4FIS A;  3FK7 A;  4FE7 A;  1TWC J;  4V2G A;  5EZH A;  2E2J J;  3LOC A;  1LE8 B;  1XS9 A;  3G1O A;  5DS9 A;  3E7L A;  3TED A;  2W48 A;  3QQA A;  2HOS A;  4IHX A;  3JR9 A;  2XSD C;  1BA5 A;  2XPW A;  2DMQ A;  4MFE A;  4LOC A;  1GV2 A;  4W97 A;  1IDY A;  3MKL A;  2XGD A;  3ZQF A;  5K7F A;  2R5Z A;  5IYB J;  2EQR A;  1MBE A;  2TRT A;  3M4O J;  2IEK A;  1TWF J;  5FKK A;  1Z0X A;  3UKG A;  3OIO A;  1OFC X;  1SFO J;  3A01 B;  1IV6 A;  1ETK A;  1S7E A;  2YUS A;  4BXX J;  1AKH B;  3FK6 A;  1AHD P;  5K7Z A;  4IHW A;  2M0C A;  1AU7 A;  2CU7 A;  1JKP C;  2ID6 A;  1Q1V A;  4M3E A;  4C3I J;  3S16 J;  3W6V A;  1LFU P;  3BG3 A;  3GTJ J;  1JKO C;  2RAE A;  4FE4 A;  4RDU A;  2M9H A;  2DMP A;  1QPI A;  2VKV A;  5J1U A;  4XRS G;  3GTP J;  3S1Q J;  3IH4 A;  3VPR A;  2AO9 A;  3RQI A;  1H8A C;  1HOM A;  3HM5 A; 
#chains in the Genus database with same CATH topology
 1YQA A;  4L0Y B;  3OOU A;  2BGC A;  1HW1 A;  3BRO A;  4Y17 A;  4UV9 A;  1YS7 A;  4I09 A;  5KNL A;  2X85 A;  5IY5 H;  1G3W A;  2EFQ A;  4LG0 B;  2VBZ A;  3MWM A;  4YRV A;  3E3V A;  4OOI A;  1GT0 C;  3W2V A;  2LTP A;  2Y75 A;  4HAM A;  3PM1 A;  3VFZ A;  3CCY A;  1JXS A;  3BQZ A;  3MD2 A;  3R0A A;  4YG2 F;  1O3Q A;  2RV8 A;  1D0Y A;  2HDD A;  2EV5 A;  2PMH A;  5AIQ A;  5L3C A;  1IDZ A;  2K27 A;  4M9Z A;  2QYO A;  4LJZ F;  4IRH A;  2O7O A;  4N0B A;  3ZMD A;  1UJ8 A;  1LQ1 A;  4M71 A;  2CH0 A;  4AIJ A;  1TQP A;  5HOD A;  3S32 A;  3ZRG A;  4AWX B;  1A5J A;  2QEN A;  4R8H A;  1XGN A;  5HLT A;  3TQN A;  4Q47 A;  4EEF G;  5CLS A;  3F21 A;  3JRG A;  1ON2 A;  5HNH A;  3IWF A;  4DOZ A;  4YIR X;  4EGY A;  2HFH A;  1Z3Y A;  1Z77 A;  5E79 C;  2PFB A;  2JSP A;  4RA2 A;  2IS2 A;  3B6C A;  3MN2 A;  1G59 A;  2FNP A;  4DGW B;  3F9K A;  4XM3 A;  4GDF A;  3IAM 2;  4B1R A;  4M73 A;  4F7Z A;  4Q4Z F;  5BQT A;  3LSM A;  4A3L J;  1XTA A;  3DTI A;  4UNO A;  1VZ0 A;  1TZL A;  3GYH X;  3D5S C;  4HDV A;  2VJ5 A;  2NS7 A;  3DU5 A;  5DYM A;  4L18 B;  4D0P A;  1MD0 A;  2WV0 A;  1FSH A;  3OSF A;  4XL9 A;  2CGP A;  2VQG A;  2V6C A;  4A0X A;  2GOX B;  5K5R A;  3Q0U A;  2BE5 F;  4HG2 A;  3D5L A;  4L9N A;  1CQT A;  3C18 A;  4IJA A;  2ZSH B;  4DQ2 A;  2NVU B;  4UUT A;  1J59 A;  2FEZ A;  3FM5 A;  2DDA A;  2DA7 A;  3GTM J;  3OYF A;  2E35 A;  3FIS A;  2F6C A;  1VQ8 I;  2BY2 A;  2JRT A;  5D8L B;  3HOZ J;  5FJ8 J;  2X1E A;  4IQJ A;  5J40 A;  1T38 A;  1SAU A;  3ZMZ A;  1HF0 A;  1G2H A;  3CCJ I;  3KLN A;  1H88 C;  3GZ5 A;  4BY1 J;  1A36 A;  3VYS B;  1XDS A;  2HTJ A;  1TC3 C;  2LY1 A;  3I3L A;  1YIO A;  4LGW A;  2K85 A;  1CGP A;  1XMX A;  1WCM J;  3NQO A;  1O7F A;  2JA2 A;  5FRO A;  4G9Y A;  1MNM C;  4GXO A;  5TRD A;  1QGP A;  1UB9 A;  3K70 D;  4YII A;  1IRF A;  2I10 A;  3T1B A;  2E1N A;  1E3H A;  3QWL A;  3BY6 A;  1UHW A;  4UUS B;  3U1D A;  2CV0 A;  3GTQ J;  2VT3 A;  2CW0 F;  2HZT A;  2OQR A;  2P6T A;  3FXQ A;  2K9L A;  5IP7 J;  3LSG A;  1I1S A;  3K70 C;  4JX6 A;  4A3M J;  4MQ9 F;  1FYL A;  3MAJ A;  2DFF A;  2W84 A;  1XDU A;  1QPM A;  2HDW A;  1VTN C;  4GFB A;  2DK5 A;  2WAQ N;  1S6L A;  1ZQ3 P;  3ABM H;  1IV8 A;  3OR2 C;  1MNE A;  4IF4 A;  3HHH A;  3TP3 A;  1OCC H;  1R1T A;  1SC7 A;  3TBI A;  1ETQ A;  1LDJ A;  4HA8 A;  1RES A;  3A0B C;  4QWQ A;  5BNG A;  2LVS A;  1ZLK A;  4WXC A;  1P7J A;  1JJ6 C;  4I76 A;  2HYG D;  1EH8 A;  3AFH A;  1POG A;  2UXN A;  3FXK A;  5F64 A;  4B3X A;  1YO5 C;  2KMU A;  3PFI A;  4MQV A;  3LQR A;  3GW2 A;  4CO8 A;  1QBJ A;  5LLQ A;  1OMI A;  3B6A A;  2YS9 A;  3HKZ N;  5HLI A;  1JTY A;  1S7O A;  4HX7 A;  1BM9 A;  3O8G A;  1EF4 A;  2HQA A;  2QF7 A;  3W3C A;  4A6E A;  2HVS A;  4KIS A;  1YW8 A;  1K78 A;  1R6R A;  1SFE A;  3L2U A;  3BTL A;  3QU3 A;  1K4S A;  2EPF A;  3RKY A;  1UAA A;  1R22 A;  3JAM K;  2F5V A;  3SFI A;  2XRN A;  1D0X A;  3C3W A;  1IGN A;  1U2W A;  1OCZ H;  2MC3 A;  3VYU B;  3GME A;  2P0W A;  5BS6 A;  2VOO A;  2HDC A;  2P8T A;  2ZME A;  3WHB A;  1LNW A;  1Z7L A;  4XQF A;  3E6D A;  3KEQ A;  2FSW A;  2VJI A;  1Z05 A;  2UV1 A;  5F1J A;  1XGM A;  3S1N J;  3Q0V A;  2Y0M A;  2RNG A;  1N78 A;  2DA5 A;  3I0T A;  2F5E A;  3BR0 A;  3HBL A;  5KCM A;  1QO0 D;  4LLL A;  3ONQ A;  3WU1 B;  4I0A A;  4XN0 A;  4RGX A;  6PAX A;  4C3H J;  2IGM A;  1WQ2 A;  2Z5U A;  4D7M A;  2A68 F;  4Y15 A;  5H6R A;  2R5Y B;  3OIP A;  2R4G A;  2CUE A;  2XAH A;  2CWE A;  3DWL E;  5E1Z B;  5GAG J;  1NHA A;  2VJJ A;  4D5F A;  2HOA A;  2L9R A;  4M3B A;  3TL4 X;  4OAZ A;  4BU2 A;  1WPK A;  4XRF A;  1YTY A;  2Z33 A;  3BPX A;  2W85 A;  5J8F A;  3IP4 B;  1XPX A;  3HSR A;  2F4M B;  1FBQ A;  2VXD A;  1NK2 P;  1BIA A;  2G0E A;  3DPL C;  2KRF A;  1I27 A;  4I6Z A;  2R7W A;  3BTC A;  2QM3 A;  3CC4 I;  4IOC F;  4KA4 A;  1EA3 A;  1FMW A;  5H20 A;  3JAM Z;  3QPH A;  1YIJ I;  1D0Z A;  3DKY A;  3TO9 A;  4HZF A;  1ON1 A;  2V9K A;  3ABL H;  2A5Y B;  2M5W A;  4NQW A;  2DW4 A;  3BR5 A;  1DGR M;  2Y30 A;  2OUM A;  3V7C A;  1MBJ A;  5BMZ A;  2H1K A;  5K1Y A;  4XKW A;  3GVA A;  2LK2 A;  5A2Q K;  1ZGJ A;  2Q1Z B;  3SYT A;  4DYC A;  4HOB A;  4HBL A;  4CYC B;  1GVD A;  2W4S A;  4RLF A;  3LSR A;  2W1O A;  2LOO A;  2VAS A;  1U8B A;  1HA8 A;  1PUF A;  3M8E A;  1IN4 A;  3M1C A;  3BTJ A;  3GZN B;  2PMU A;  4E7S A;  3LQQ A;  5D6F A;  2JUC A;  3FXR A;  3NAR A;  4JOM A;  4RS8 A;  3L2W A;  1YHQ I;  3CCQ I;  3CO7 C;  5JHU A;  1HCR A;  2PJR B;  1KA8 A;  4BY7 J;  1OCO H;  5JFR A;  1KQ0 A;  2QBY A;  2YX7 A;  2QKL B;  4M6Y A;  2JVH A;  4KIB A;  3HOX J;  3IH3 A;  2EWN A;  2LDU A;  4EVI A;  4MTD A;  1SVO A;  1JT6 A;  2M7B A;  4EMS A;  1VQK I;  2Q8K A;  3S2D J;  1FBS A;  1UEL B;  4IPA A;  3CUQ B;  3ERM A;  1LJ9 A;  3S8P A;  4AC0 A;  3OYE A;  1JGG A;  4HF1 A;  5B1A H;  1STZ A;  5D6E A;  3RYP A;  2LKX A;  2XRL A;  2K5C A;  5D4S A;  4KIG A;  3G1M A;  4A3E J;  1BJA A;  2WB1 N;  5LGU A;  1V3F A;  3DCF A;  4CCO A;  1E0E A;  1SEU A;  1JUM A;  5CVU A;  2NOJ B;  3ASO H;  2W82 A;  4BXU A;  1SFX A;  2DT7 B;  4AYB A;  2DPD A;  5LGN A;  4M6V A;  4QSH A;  3LA3 A;  4ANJ A;  4OWR B;  4DYQ A;  4P1W A;  5EEA A;  1PP7 U;  5LRR A;  1GXQ A;  4MGR A;  3BTI A;  3WE3 A;  4FQG A;  1W36 D;  2DK8 A;  2HI3 A;  5LRS A;  3BJO A;  2HQN A;  4Y7N J;  2VKE A;  2UXX A;  4ZYH A;  1W7P B;  5A2Q Z;  2K9Q A;  2CV1 A;  3SHF A;  1IRG A;  4L9V A;  2QQ9 A;  3ESW B;  2V79 A;  4BJ5 C;  3H3V K;  1XCB A;  2O9L A;  5ICG A;  4DNC A;  1R00 A;  1B4A A;  2IS1 A;  1ZEL A;  2JSC A;  2VPR A;  2N8G A;  2X48 A;  5ICC A;  4IHV A;  1W36 C;  2L02 A;  4NB5 A;  2ME6 A;  2AQE A;  2JPB A;  5F1R A;  5HDN A;  3GLL A;  3GTL J;  2R7R A;  1MKM A;  3GF2 A;  1V5G A;  1B1B A;  1CF7 B;  4W1U A;  5GAE J;  2HKX A;  5DM6 F;  1T33 A;  3V8K A;  2NS0 A;  1S8N A;  4QTR A;  3VSL A;  2KQR A;  4S04 A;  2QSF X;  1YIT I;  3K69 A;  1JJ8 C;  4AM3 A;  3Q9V A;  2MAB A;  3R60 A;  2ZJ2 A;  4BHC A;  3JRF A;  2EIM H;  3RDI A;  2NXN B;  1DP7 P;  1ORK A;  2HVR A;  5ED4 A;  1ZGA A;  2DQR A;  3S1R J;  2NRA C;  4ASN A;  4UHT A;  1ZH5 A;  2KLO A;  3PNV A;  4BYY A;  5EDN A;  3F0C A;  2XGC A;  4OU0 A;  3WG7 H;  1SD6 A;  4A0Z A;  2IW5 A;  4EJO A;  5F04 A;  1JE8 A;  2O03 A;  2KL4 A;  2ZFW A;  3BG5 A;  4LG0 A;  4BJ6 C;  1L3L A;  4AU7 A;  2LF7 A;  3K6G A;  2L0K A;  1M1E B;  1R5G A;  1E17 A;  3FXL A;  1DPR A;  4LIV A;  2VT2 A;  4EGZ A;  4MIM A;  2CS3 A;  2EFN A;  3BPV A;  3FK7 A;  3KE2 A;  3LOC A;  2V6E A;  2EV6 A;  5DD4 A;  1X19 A;  3VB2 A;  1WFX A;  3G1O A;  3QQA A;  2XSD C;  3BWG A;  1FZP B;  1WSU A;  1FP2 A;  1RNL A;  5JHF A;  2XPW A;  2DMQ A;  2X4H A;  2D1V A;  4U88 A;  1BOA A;  2BVM A;  1W1W E;  1N25 A;  2IT0 A;  5IT9 Z;  4F92 B;  2EQR A;  2RQQ A;  1IXS B;  2DOA A;  4U87 A;  1T0F A;  5FKK A;  1S9H A;  3UKG A;  3GWZ A;  3K1P A;  1IV6 A;  3LA7 A;  2WAQ A;  4C9Y A;  1ETK A;  2EB7 A;  3ZP5 A;  4L5J A;  4BXX J;  1JHH A;  5CQG A;  3MKZ A;  2X6X A;  2RN7 A;  1AKH B;  1AHD P;  3CCV I;  4E7L A;  2M0C A;  3R4K A;  1XSD A;  5K5O A;  2D1H A;  1WJC A;  1JKP C;  2WAE A;  1IN5 A;  4C3I J;  3S16 J;  2EV0 A;  4HF2 A;  3H92 A;  4HEA 2;  3W6V A;  2E36 A;  3K4N A;  1K7A A;  3EUA A;  1BR4 A;  2O5R A;  1PVE A;  3K4B A;  3GLX A;  4AVP A;  3OIQ A;  2YU3 A;  1WJB A;  1QPI A;  3HRU A;  2VKV A;  3S1Q J;  4BQO A;  2VC1 A;  3HKZ A;  2ESN A;  3VPR A;  1WGX A;  3F22 A;  3QOE A;  5L3G A;  2HQR A;  1Y39 A;  1W5C C;  3ISP A;  3CCU I;  1UFM A;  2HYF A;  1XC5 A;  3RQ4 A;  1ENH A;  3KYD B;  4P55 A;  3FMQ A;  3RPU D;  3L7W A;  4WK8 F;  2ZXI A;  4MLO A;  3ABT A;  3DPT A;  3G73 A;  4A3I J;  3VEP A;  4XN3 A;  2E60 A;  1VFC A;  1UMQ A;  3BC8 A;  3KIO A;  4O3M A;  3O6B B;  3OR1 C;  4RAZ A;  2MA3 A;  3I56 I;  1WRJ A;  4F55 A;  4JX5 A;  3W2A A;  2K4B A;  2P5V A;  3N4M A;  1R71 A;  2WC2 A;  4I98 B;  2M0M A;  4KJZ A;  4LK0 F;  1IUF A;  3QU6 A;  4ITV A;  1U0J A;  3ABU A;  4MTE A;  4ZC3 A;  2M87 A;  2BYV E;  3DQV C;  3AAF A;  2AXL A;  4UUS A;  3OL3 A;  4FTH A;  2ZBK A;  2VN2 A;  2HR3 A;  4XRS A;  3PO2 J;  1DU6 A;  1TW3 A;  1Z6R A;  3M8F A;  3OYC A;  5D8K B;  2BXY A;  1WKM A;  3F6V A;  3TMO A;  2JTV A;  5J4Y A;  2R5Z B;  1O3R A;  3K2A A;  1D5V A;  2KKO A;  2PMZ N;  1WH5 A;  1HKQ A;  2BY0 A;  2IBD A;  4F3Q A;  3REO A;  3GX4 X;  1VQO I;  1HDD C;  4JK1 X;  1DDN A;  2R7X A;  3HDD A;  2LNB A;  2H6C A;  4AVZ A;  4WWC A;  2K9M A;  2LG4 A;  3F3X A;  3ZMV A;  2FOK A;  1ZTR A;  3N05 A;  1MBK A;  1BC8 C;  5IPA A;  4UVC A;  4DZJ A;  5DCM B;  5F0F A;  1YX3 A;  3OYI A;  3A2K A;  4MEY F;  1JUP A;  3P9I A;  4PK4 A;  2ZXW H;  2PN6 A;  3MQ0 A;  2L7Z A;  1MH3 A;  1MMN A;  4ZYE A;  3S3N A;  2HOT A;  3CDI A;  5J1R A;  3E0J B;  2X9D A;  3P7N A;  1WJA A;  4CZC A;  2M4K A;  2KRH A;  2LFB A;  2PI0 A;  1TW2 A;  3DEW A;  3CMY A;  1F9N A;  3X2Q H;  4P96 A;  3MVP A;  1NG6 A;  2K9N A;  4XLE A;  1EJ9 A;  5EG0 B;  1W5T A;  4RB1 A;  3ULQ B;  3HHG A;  2IS4 A;  1FSE A;  4IO9 F;  2O6G E;  2FD5 A;  4X0G A;  4E70 A;  2PQ8 A;  3JW4 A;  4AIH A;  3JTG A;  4DZP A;  1VQ9 I;  2ECB A;  4PSW A;  3DEU A;  4CA0 A;  2YSR A;  3M7G A;  4KNY A;  3K4L A;  4M6X A;  1Y1W J;  2KJC A;  2F5F A;  3CCE I;  2L9N A;  3BT9 A;  1YI2 I;  1OYY A;  3DTK A;  4IZZ A;  1K79 A;  3OYH A;  2GIV A;  3DEE A;  2NOG A;  4IHT A;  5ERI A;  2NVT J;  2R7Z J;  2R7U A;  4ESF A;  1TLH B;  1RUN A;  1SMY F;  3F8M A;  3H5A A;  2VJ4 A;  1MSF C;  4HF0 A;  2ZCW A;  2VB6 A;  3QOD A;  2MD5 A;  2V1X A;  2D2W A;  3QRF F;  2YU9 J;  2R5Y A;  4E7J A;  2Z9O A;  3IH2 A;  5K5Q A;  1DPU A;  4ZJZ A;  2CFX A;  3JRD A;  3U9G A;  5CVI A;  1V55 H;  3H5R A;  4M3D A;  1IC8 A;  2XAQ A;  3G2B A;  4ENK A;  2E1O A;  4G8X A;  1YW9 A;  1FP1 D;  4TV7 A;  4NC7 A;  3K4J A;  3E6C C;  1Z3X A;  5E1W A;  1ODD A;  1P2F A;  2KDZ A;  4RAF A;  2XAF A;  3K9T A;  2ZSI B;  4B09 A;  3OSG A;  3AG2 H;  4EJT A;  2QGU A;  1TQM A;  2B7E A;  5GTH C;  4M74 A;  1K83 J;  1AWC A;  3KP7 A;  5EGO B;  3LSP A;  3CF5 F;  3MMY B;  3TW6 A;  1ITY A;  5M3F J;  1ZK8 A;  1FEX A;  3BDD A;  5FKM A;  3J7Z I;  3F72 A;  4CYC A;  4M9X A;  3K0L A;  2IGO A;  5FLM J;  1TWA J;  5D4R A;  1AOY A;  3E5Q A;  3BJA A;  2A3S A;  2OCC H;  3PIO F;  1A35 A;  1Y6I A;  4OIP F;  5F27 A;  5LHI A;  5FD5 A;  1D1B A;  3ZQ7 A;  2HS5 A;  3TO7 A;  2DOF A;  4A3G J;  2PJR A;  1KU3 A;  4N4N B;  4RB0 A;  1K6Y A;  3T8T A;  4B8X A;  2JRM A;  1TT5 B;  3H9J A;  5HS9 A;  5IYD J;  1X3W B;  1MBF A;  4AD9 A;  5JVG F;  1F43 A;  2CSO A;  5IP6 A;  4XOT A;  1OPC A;  3BG7 A;  3CUQ A;  2PLY A;  2A69 F;  5DUK A;  2CQQ A;  2QCO A;  2VE8 A;  3BCB A;  2BEO A;  1F1Z A;  4QLC U;  2M8E A;  2RNJ A;  5E3N A;  1O57 A;  1OKR A;  5GPA A;  1IG7 A;  5LEJ A;  1XCV A;  2K4J A;  3A1Y A;  3P9C A;  5F08 A;  1XGO A;  1SD7 A;  1VQ6 I;  4IQ4 A;  1Y0U A;  1C0W A;  2HNH A;  4A3D J;  1V5F A;  3F8N A;  5BPI A;  3ZQQ A;  4EV0 A;  3HPG A;  3H9Q A;  3PO3 J;  4I01 A;  2EIK H;  1E3P A;  4Y52 J;  2DFE A;  2EIN H;  3BJ6 A;  5DUI A;  3CCM I;  1W7P A;  5J1Y A;  4E4H A;  2FQ3 A;  2GOM A;  2X1C A;  4D9J A;  1YS6 A;  1BI0 A;  4II3 A;  3OYG A;  5KK1 A;  2XKO A;  4CCL A;  4XLA A;  4BDY A;  2GWR A;  2XHK A;  1R36 A;  1WHU A;  4GGG A;  3CUQ C;  3MEX A;  3CC2 I;  3HG9 A;  4NUB A;  5D5V B;  3T5X A;  3S3O A;  3L09 A;  2DA6 A;  2WV1 A;  1CF7 A;  3F8F A;  1IZ1 A;  3KZZ A;  3SXY A;  3TO6 A;  2GBY A;  3BZ6 A;  5J47 A;  3A4C A;  4U0V A;  2ME0 A;  1W7P D;  1WJ5 A;  1X3Z B;  4LG3 A;  3FBI B;  2HTS A;  2LRD A;  2P5L C;  1U6G A;  3D5R C;  1FIA A;  1KQ9 A;  3PFY A;  1RC9 A;  1JTX A;  1K4T A;  1ETX A;  4UVA A;  1XN7 A;  5BPD A;  2JPC A;  2M7A A;  1Y1V J;  3HXL A;  5JLW A;  2VE9 A;  1KU9 A;  2LR8 A;  4JP0 A;  5CVJ A;  5KHD A;  3GTO J;  3GBG A;  1B59 A;  1D1C A;  1IN8 A;  1FX7 A;  4IVN A;  2ID3 A;  1T8I A;  3VWB A;  3WTW C;  3DLL F;  3FDY A;  4G7Z F;  3HOS A;  3SDG A;  1SAN A;  3QYB A;  3AG3 H;  4QPQ A;  1R5H A;  2VPL A;  3PNT A;  2H8W A;  2Y69 H;  1V54 H;  2RKH A;  2QQB A;  2ZNY A;  5M3M J;  1G3T A;  2HXO A;  1J2X A;  5M5Y J;  2H6B A;  3HOV J;  1X2M A;  2EZI A;  2WAD A;  1FJL A;  4RGS A;  2QZ8 A;  3LFU A;  3IC7 A;  2IAI A;  1RET A;  2MYS A;  3GEZ A;  3H0G J;  4NNJ A;  5DTD A;  5F6F A;  3JTH A;  2FNA A;  3MZH A;  2KIU A;  4BBR J;  4LB6 B;  1RKT A;  2V1N A;  2XIG A;  1P4X A;  3HEF A;  1AKH A;  2BV6 A;  3KPH A;  5D5X B;  1EH7 A;  1OQY A;  3BR2 A;  2QKM B;  2VON A;  3J81 K;  2NAZ A;  3GO5 A;  2FBI A;  2V9P A;  1KU7 A;  5KAF C;  3WTT C;  4ESJ A;  1VF9 A;  1B9N A;  3HPH A;  3LSI A;  5FLX K;  2KP6 A;  2XAS A;  4BQN A;  2AS5 F;  1JUS A;  2VOD A;  2L4M A;  1TWH J;  3CUO A;  5IT3 A;  4ENJ A;  1HST A;  1LUJ B;  2K3F A;  5ILS A;  2ISY A;  1QNT A;  3ZOB A;  5HVQ C;  3HYI A;  3VOE A;  3BR1 A;  1USS A;  1GLN A;  2R7D A;  2OQG A;  5K7H A;  4HSR A;  4PJL A;  1QU3 A;  5C4X J;  2HOE A;  2J5O A;  2IA2 A;  2ZXH A;  3Q9S A;  3L9F A;  2BY3 A;  1ETV A;  3HJE A;  5HDG A;  1R4N B;  2IGK A;  2PG4 A;  2W00 A;  3OS0 A;  1U5T C;  4UB8 C;  4X6A J;  2P81 A;  3CJN A;  3F6O A;  2VQL A;  3E6B A;  2A5W A;  4OMZ A;  1U9O A;  3ML6 A;  4BE0 A;  1F5T A;  2CFO A;  2XF6 A;  2Q2E B;  3DKX A;  2OZU A;  3F8B A;  5E8I A;  2HZD A;  1MGT A;  4O5V A;  1HQC A;  4B3A A;  5DD8 A;  2DDB A;  4V2G A;  2E2J J;  5EZH A;  5B1B H;  4A2U A;  4UB6 C;  3ZMT A;  1J09 A;  3C1D A;  3M9A A;  5DS9 A;  3TED A;  5FRM A;  3TDZ C;  3LSK A;  4FT8 A;  5FB2 A;  4S05 A;  1W4M A;  1MZB A;  4PUS A;  4IL6 C;  4MFE A;  3EUK L;  3J81 Z;  2GAU A;  4FET A;  4Q5S F;  5K7F A;  2CO5 A;  2R5Z A;  2WA0 A;  3M4O J;  1UG0 A;  2TRT A;  5FLX Z;  2KZV A;  3OYM A;  3OIO A;  1IXR C;  1OFC X;  2HPM A;  1TQI A;  3A01 B;  4PFO A;  2DAO A;  5CKT A;  3EUH A;  1OLT A;  4IHW A;  4BNC A;  2F5D A;  1AU7 A;  5ICE A;  3M1E A;  2RQP A;  5E18 F;  4LD5 A;  3V8J A;  3ECH A;  3EDP A;  3RKW A;  1X4O A;  3W2W A;  1HC8 A;  1SFU A;  5J8C A;  3DPU A;  3NEU A;  5FFZ A;  5DCM A;  3EYY A;  3CES A;  2MC4 A;  4BHP A;  4G6D A;  1LFU P;  1MJA A;  4Y33 A;  1BIB A;  1IAW A;  2RAE A;  1YG2 A;  4KUM A;  5J1U A;  4LMY A;  4XRS G;  1ZAO A;  3GTP J;  2V9V A;  3RQI A;  1XB4 A;  4XKC A;  3CTA A;  4LIU A;  4XSX F;  4UV8 A;  5IYC J;  2EA2 A;  2FU4 A;  3C7J A;  4BDZ A;  2A6E F;  2ADU A;  3LAP A;  4Y4R A;  4C2T A;  2B63 J;  2WAF A;  5EG0 A;  4HST A;  1WJE A;  2HXI A;  3FXM A;  3OS2 A;  3S14 J;  4NDL A;  2L9S A;  1HSJ A;  1YOV B;  4UXN A;  1J5Y A;  2ZJQ F;  1Y8Q B;  4JBA A;  4M3G A;  4ZTF A;  2UUZ A;  3I4P A;  2E5N A;  3EUH C;  3OY9 A;  4J01 A;  2I8D A;  3S2H J;  1FT9 A;  4XKB A;  2XSJ C;  2Y9Z A;  1QZZ A;  1D1A A;  4A3J J;  2CUJ A;  4F91 B;  4BQA A;  1W5S A;  3RYR A;  2E2H J;  4IHY A;  2JA8 J;  2R0Q C;  4FHT A;  1EKE A;  1IXC A;  1RUO A;  1XSV A;  2IS6 A;  3O2P E;  2FJ1 A;  5EF6 A;  3KZY A;  2A07 F;  4MO7 A;  5JVT A;  1LFP A;  2ELH A;  5HOO A;  4M3F A;  2Y31 A;  5TIS C;  2FOW A;  4OMY A;  3FBN B;  3M8J A;  4PDK A;  3MZ8 A;  1BBY A;  3A02 A;  4ENN A;  5LHG A;  5E20 A;  1I5Z A;  1MJB A;  3E97 A;  3FM3 A;  2EK5 A;  5C3E J;  2VIX A;  4KMU X;  1UST A;  3LMM A;  3J80 K;  1R9T J;  5H2F C;  5GP9 A;  1Y56 A;  1IW7 F;  3IUO A;  3HC7 A;  3FIW A;  1YJW I;  1ZLJ A;  3SZT A;  4BQQ A;  1Z6T A;  1MBG A;  4RM3 A;  2L3D A;  3I54 A;  4BH9 A;  1P92 A;  1RKW A;  4OIN F;  2NVX J;  2KHM A;  3QYF A;  5EYR A;  3RI4 A;  1IO2 A;  4KT5 C;  2CQ7 A;  1U9N A;  3LL7 A;  3OYJ A;  2CQX A;  4RAG A;  3ZQI A;  2X6W A;  1MDM B;  1ZYR F;  1T6S A;  3CMA I;  3NRV A;  2JWT A;  1BJZ A;  2XPV A;  1DU0 A;  4IHS A;  5FRN A;  3CF2 A;  3QPL A;  5EGO A;  1HW2 A;  3I4M J;  2EIL H;  3FWE A;  4CCK A;  1UHM A;  2LP0 A;  3I55 I;  1HBX G;  3E5X A;  3J7A Y;  1BR2 A;  2TDX A;  2X6O A;  2LC2 A;  2E7X A;  2K7L A;  3HOU J;  1FIP A;  3FXO A;  2OJE D;  1I50 J;  2F4O B;  5HLG A;  1U5T B;  4IKF A;  2R7S A;  1K61 A;  2EZH A;  2F5C A;  5EZG A;  2COB A;  1IJW C;  2XGX A;  2D5V A;  1QHG A;  1Y0N A;  3SFZ A;  4J00 A;  3V7S A;  4Y13 A;  4G94 A;  1FTT A;  2VL8 A;  3RPU A;  1VND A;  4PCQ A;  1R58 A;  3S1M J;  1BN5 A;  1BW5 A;  2Y2Z A;  2MLK A;  2C6Y A;  4ZDP A;  2L2O A;  4CXF A;  1F36 A;  3J80 Z;  3H1C A;  5JR3 A;  4RB2 C;  2BHZ A;  3CCS I;  2QEX I;  4CDG A;  2DYS H;  2ETH A;  3COA C;  2MLG A;  2E2I J;  2LYC A;  4AIK A;  5GPC A;  2O8X A;  2R7O A;  3JRB A;  4PZJ A;  1IN7 A;  1J9I A;  1HW5 A;  2O0Y A;  1TT0 A;  3PNY A;  3OYK A;  4XIC A;  2BOL A;  4BAC A;  2R7V A;  5HS8 A;  2DFI A;  3WG9 A;  4XID A;  3WTV C;  4FAS D;  3PIP F;  2FML A;  2LY9 A;  1MMS A;  4XNF A;  2E34 A;  3CJT B;  3PUF A;  5H6Q A;  1J75 A;  2K86 A;  1X1A A;  2JUG A;  2WBM A;  1X1B A;  3TW7 A;  2O8K A;  3IAS 2;  4HQM A;  1MMA A;  1QZY A;  2XF5 A;  2RC4 A;  1WI3 A;  2RDP A;  2XDV A;  3S2W A;  2QSG X;  2JA7 J;  3K1N A;  3FF5 A;  2A05 A;  4U0Y A;  1Z7U A;  3L1P A;  1SVL A;  4MEX F;  1HKS A;  2FRH A;  5JI6 A;  1MH4 A;  1GVJ A;  2Y0S N;  2RVC A;  1YLF A;  4D7N A;  1LVA A;  4XRM A;  4GYG A;  4WXH A;  1KU2 A;  2STW A;  3G1L A;  2IP2 A;  4C2M J;  3FKI J;  2NVQ J;  2LKP A;  2DA3 A;  1P9Q C;  4ZYA A;  2OU2 A;  2PX9 A;  2JK3 A;  1ETO A;  3H35 A;  1SFK A;  2GLO A;  3I71 A;  3WGG A;  4OIO F;  2L7M P;  2P7V B;  1DUX C;  3T8R A;  3KYL A;  4RMN A;  4ZDL A;  1A31 A;  4F93 B;  2DPU A;  3Q3S A;  3CDH A;  2FQ4 A;  4E7I A;  2L7K A;  3DV8 A;  1O4X A;  2DOE A;  1ZRF A;  5J6X A;  4A5M A;  3OOP A;  3P5J A;  4CHU A;  5CJ9 A;  2JVG A;  4XLH A;  1VI0 A;  3ELK A;  2ISZ A;  2RGV A;  2HVQ A;  4IXA A;  4I99 C;  1HKT A;  2GM4 A;  1H9T A;  4RGR A;  5EEH A;  2J5P A;  2Z99 A;  2ZB9 A;  4LB5 A;  3H3Z A;  2VKD A;  4XLN F;  4LLG F;  4BXF A;  4PJN A;  3TP0 A;  2JA5 J;  3FMR A;  4PSX A;  1YFH A;  3CLO A;  1LB2 A;  3VOD A;  2EBI A;  2P4W A;  3ZGK A;  4XK4 A;  2QQA A;  2DT6 A;  4D1Q A;  3WTU C;  3HOT A;  3D1N I;  4ZZL A;  3WGH A;  4WX9 A;  4EM0 B;  1S3J A;  2BZT A;  2MFZ A;  4M72 A;  1N75 A;  1D3Y A;  3OL4 A;  3U2R A;  5CVR A;  1MMD A;  3JSP A;  4HX4 A;  4RB3 C;  3K4C A;  2VBW A;  4A6D A;  2M1B A;  5HLH A;  2L54 A;  2CUZ A;  5AIP A;  5C4J J;  2FBK A;  1R1V A;  4K2E A;  1JT0 A;  3L00 A;  2LD5 A;  4A3K J;  3HGG A;  1XGS A;  1UHS A;  2XVC A;  1X58 A;  2ELJ A;  2MGQ A;  3DP7 A;  4RGU A;  3F8C A;  4ZYD A;  1LFB A;  2EIJ H;  2GIZ A;  5B3S H;  3CD6 I;  2IJL A;  2QSH X;  3U1K A;  2DT5 A;  1YRN B;  4I7H A;  2JQ7 A;  4MNU A;  3WTX C;  1P7I A;  2CMP A;  4IX7 A;  1RIO H;  4BJT A;  1ETY A;  3OMY A;  1BOB A;  1BI1 A;  2QUF A;  4LIT A;  4XLP F;  3FZV A;  3IL2 A;  2M3A A;  2XB5 A;  5FKO A;  1H0M A;  4YFX F;  1JHF A;  1W0U A;  3DFG A;  2A6H F;  2EFP A;  4G7O F;  1SVM A;  1VQ7 I;  4BBS J;  1HDP A;  2E5Z A;  2WB1 A;  4CIC A;  1Z1D A;  1A04 A;  1NTC A;  2MBF A;  3OYD A;  1ACI A;  1B72 B;  1OJL A;  2E7W A;  2GXB A;  4HNT A;  2Z16 A;  1F4K A;  1TNS A;  3JCU C;  3CME I;  3EPZ A;  3H36 A;  3IHU A;  2PEX A;  3G71 I;  1PYV A;  3H9G A;  2LSO A;  2R7F A;  4DIQ A;  1L0O C;  1Z67 A;  3HUG B;  1IUY A;  2FA5 A;  2L01 A;  3J7A O;  2BBY A;  4DBQ A;  1T2K A;  2XKP A;  3DLA A;  4HNV A;  4GRI A;  1GV5 A;  2LLK A;  5CVV A;  3TOB A;  1OIS A;  5HNF A;  2Q2E A;  4L9T A;  4E7K A;  4LFU A;  4D5C A;  1ZHF A;  3HSF A;  1MSE C;  3MCZ A;  4RAY A;  1I6X A;  1X1P A;  2CRG A;  1D5Y A;  3BOQ A;  3ZQG A;  1GUU A;  2FMY A;  2DQL A;  3KEY A;  3BP8 A;  3J7Y J;  4X1E A;  3VYR B;  2FE3 A;  2AXT C;  3BLY A;  2DTZ A;  4HV5 A;  4Z2Y A;  1B8I B;  2W57 A;  3LSJ A;  3VDX A;  2MW8 A;  2ZNZ A;  3JSO A;  1VQ5 I;  1YW7 A;  2DA2 A;  2Y48 A;  4G6T B;  1ZG5 A;  1QQI A;  1O3T A;  5FGM A;  2HGC A;  2EH3 A;  3GFJ A;  1RI7 A;  5E3O A;  2NNN A;  2DLL A;  1FTZ A;  3A01 A;  2X0L A;  2FF4 A;  1S7A A;  2FUG 2;  4ZZD A;  2CUF A;  3CJQ B;  4JQF A;  1ZGW A;  1GHC A;  2HPI A;  4AYB N;  5GTI C;  3DKW A;  4HX8 A;  4WF2 A;  3CP2 A;  2FBH A;  2OD5 A;  2M45 A;  4OAY A;  3A0H C;  2E1C A;  4DYR A;  3LSH A;  1S29 A;  3ABK H;  2B0L A;  4LLN A;  1Z21 A;  4XBF A;  4IOA F;  2XB0 X;  4FCY A;  3HL2 A;  3VSK A;  2KZG A;  2MG4 A;  4XOR A;  5IP9 J;  4EQQ A;  3ROU A;  4KIF A;  4HLY A;  3RZD J;  5E8G A;  2VLA A;  1FYK A;  2ZXJ A;  2XRO A;  3GUD A;  4JYK A;  1ZG1 A;  2ZJR F;  3HSE A;  1OYI A;  1QRY A;  4RLQ A;  4G7H F;  4QIW N;  4IRG A;  5FFX A;  1G3Y A;  4L5I A;  1LEA A;  4Y3O A;  4PJM A;  1NK3 P;  3OS1 A;  1J0R A;  2XGE A;  2P5K A;  1R5I D;  3JRH A;  2P6S A;  2QLZ A;  1LEB A;  4R1H A;  3B02 A;  4ENM A;  2YX4 A;  1I3Q J;  3H3U A;  4A69 C;  3JRE A;  3MKY B;  3TGN A;  4FE7 A;  1TWC J;  1BC7 C;  3LST A;  4HYE A;  2L4A A;  2QQ8 A;  2STT A;  1LE8 B;  1IRX A;  2VQH A;  1XS9 A;  2I5U A;  5FO5 A;  3VYT B;  1D8K A;  2HOS A;  3RIR A;  1R1U A;  4GYI A;  1LPQ A;  4UVB A;  1KON A;  4HRI A;  1KGS A;  4LOC A;  1GV2 A;  3L2C A;  2XGD A;  3ZQF A;  3G3Z A;  2IPQ X;  2PBI A;  2V7F A;  2DFH A;  3RSN A;  1Z0X A;  3EQL F;  3DF8 A;  3H5N A;  1SFO J;  5L3D A;  2KFD A;  1S7E A;  2YUS A;  2KIS A;  5K7Z A;  4BL0 B;  2BW3 B;  4G6Q A;  4BE1 A;  1RR8 C;  2KIQ A;  4II2 A;  5HS7 A;  3WTS C;  1O3S A;  1D8J A;  2ID6 A;  2O61 A;  3V4G A;  4EJV A;  3KP6 A;  1REP C;  4WXD A;  1KZH A;  3BG3 A;  5B66 C;  4EJU A;  1T95 A;  4FE4 A;  4RDU A;  1TTY A;  1SD5 A;  2WY7 Q;  4I02 A;  2IA0 A;  3TDU C;  2Y0S A;  3IH4 A;  1JGS A;  2AO9 A;  1MDM A;  2VKH A;  1H8A C;  2GQQ A;  1TNT A;  3HM5 A;  1HOM A;  3I4N J;  4S0H B;  1UZC A;  2MH2 A;  2GA1 A;  2NS8 A;  3C2H A;  3OYN A;  2R3S A;  1B6A A;  3QPT A;  3KYC B;  1N77 A;  1K6O A;  2XV4 S;  4RM2 A;  3PSF A;  2W24 A;  4ZH4 F;  4Q48 A;  3CDL A;  1ERD A;  2CW8 A;  1MJ9 A;  2X6Y A;  4B4C A;  1XX5 A;  2FXA A;  4HNU A;  1WH7 A;  1G6N A;  5ILU A;  1R23 A;  1TBX A;  4YIF A;  4C30 A;  3WTY C;  3KP3 A;  3HTS B;  2PMZ A;  4XON A;  2VUM J;  4KT6 A;  2EFW A;  4PGG A;  3V7R A;  4QPO A;  4IRI A;  3QOP A;  1U5T A;  1YJN I;  2DN0 A;  4H4K C;  1E3O C;  3R6S A;  3RKQ A;  2OF7 A;  3D0S A;  3DBL B;  4MFD A;  3I59 B;  3GZ6 A;  5FKN A;  1PDN C;  2LBF B;  2TCT A;  4IEJ A;  3NAU A;  2MH9 A;  4ON0 A;  4ZYG A;  4KIC A;  1LDK B;  2LRE A;  2MSY A;  2DU9 A;  1XG1 A;  2BVL A;  3P9K A;  5J3L A;  2HYJ A;  3ZCO A;  2UZK A;  2CJJ A;  3FHN A;  2M2E A;  1ULY A;  1YJ9 I;  4AID A;  2GXA A;  5J4V A;  3ZMU A;  2Z3Y A;  3HRS A;  2JJ7 A;  2M4G A;  1V4R A;  3ZPL A;  3IV5 A;  4DJA A;  3GXO A;  4J19 A;  2V4J C;  4KN7 X;  2L5Q A;  1R4M B;  1GDT A;  2Z1D A;  4NBQ A;  4KYW A;  3MZY A;  4HLX A;  4CCN A;  3OV8 A;  3R61 A;  4CCJ A;  1FOX A;  9ANT A;  3HZJ A;  1FPQ A;  1FMV A;  4XMY A;  1WZ2 A;  4BEH B;  1VQP I;  3E5U A;  3IRQ A;  3DXJ F;  4AUX A;  4UUV A;  3LFK A;  2LH9 A;  3Q0W A;  1OCP A;  5AON A;  1LDD A;  2NNY A;  2GA2 A;  2K40 A;  2KIF A;  1BR1 A;  4C3J J;  2WWY A;  4BE2 A;  3WU0 A;  1FBU A;  3GFI A;  3EYI A;  1X1D A;  2DI3 A;  2JT1 A;  4XLF A;  3ZQL A;  3WTZ A;  4CYD A;  2GXG A;  3JRC A;  3I5U A;  1PP8 F;  5FLV A;  4A3B J;  3ZXS A;  3GTG J;  1ZG3 A;  2KDO A;  3K10 A;  3KZI C;  3ZQC A;  4CH7 A;  3HOY J;  3FHZ A;  1WJF A;  2DCE A;  4R79 A;  3WOD F;  3BCA A;  4UY8 I;  1LVK A;  4ZTJ A;  1DQU A;  4KFC A;  3ZQH A;  2ZC2 A;  1T08 B;  2ZME C;  4HV6 A;  3SZP A;  4N4O B;  1S72 I;  2F2E A;  2OAZ A;  1X4P A;  1Y8R B;  2F4I A;  4KIT B;  2X1D A;  4CSW A;  2ACJ A;  2W7N A;  2ECC A;  2DMN A;  2B9S A;  1I6H J;  4OIQ F;  3KP2 A;  4B47 A;  1LKX A;  1YE9 A;  4E7H A;  1XD7 A;  2OCE A;  4MHG A;  4A3C J;  3CLQ A;  1ETW A;  3B73 A;  4GO1 A;  2V26 A;  3HIF A;  3CCL I;  2E1M C;  2E71 A;  3K4K A;  3AKZ A;  2D45 A;  2IVM A;  3S93 A;  2DA1 A;  4XR6 A;  5LHH A;  2YPR A;  1APL C;  2DMU A;  2DA4 A;  4ESB A;  3BR3 A;  1QVT A;  2NVY J;  3FKJ A;  4A5N A;  1JKR C;  2H94 A;  5F0C A;  1TWG J;  1XMK A;  2OBP A;  2R7Q A;  2VBX A;  3CMM A;  3HOW J;  4G12 A;  1A6Q A;  2DJI A;  2V1U A;  3IKV A;  3QP6 A;  3ZMS A;  5LGT A;  3Q5F A;  4PJ0 C;  2L9V A;  3QPS A;  1NH3 A;  1FLI A;  1OYW A;  1UG2 A;  2XAU A;  1H89 C;  3M07 A;  4CGZ A;  2BY1 A;  4P9U A;  3S15 J;  3FXJ A;  1RR7 A;  4YFK F;  2ELK A;  1MBH A;  3GFM A;  3QYE A;  3WGI A;  2ZKZ A;  3BQY A;  1OCT C;  3CQZ J;  2KIM A;  2ZO4 A;  1ONV A;  2Z2S B;  1I3A A;  4HW0 A;  1YX5 A;  3L2V A;  4L0Z B;  2DTR A;  3IWZ A;  2O3F A;  1YRN A;  3I58 A;  2DMT A;  3DU6 A;  5KVR A;  2CYY A;  3NWT A;  5M5W J;  1WVR A;  2OC6 A;  3BG9 A;  4EM2 A;  4DBR A;  5IOZ A;  1YYV A;  1VQM I;  4P9F A;  2ZJP F;  1MMG A;  3KP5 A;  3SDB A;  3HRM A;  3PSI A;  3S17 J;  2A61 A;  2QWW A;  5C44 J;  3ZR8 X;  1XMA A;  3AL0 C;  1TP4 A;  5TGT A;  4I2O A;  1BI3 A;  3GCM A;  1BL0 A;  3A03 A;  1HLV A;  3T0Y A;  1KQ8 A;  3I53 A;  3LWF A;  3K7A J;  1W0T A;  1TL8 A;  2Q0O A;  2AHQ A;  1FY7 A;  3G6E I;  4N9I A;  1EV7 A;  5JLX A;  2QVO A;  4A3F J;  2AQF A;  5LEK A;  4OIR F;  3S3M A;  5ICF A;  1B72 A;  1SD4 A;  1ZN2 A;  3N97 A;  2XAJ A;  2OTJ I;  5EJC A;  3LNQ A;  4O6J A;  3IRR A;  5IT9 K;  1KYW A;  2HU9 A;  2K9S A;  3CCR I;  3LA2 A;  2CV2 A;  4H0E A;  5FKL A;  2H1L A;  4YFN F;  3HUG A;  2IRF G;  4L5E A;  4U7B A;  1ZRE A;  2K02 A;  2VC0 A;  2A6T A;  3WHC A;  4ABZ A;  3PJR A;  1FYM A;  4F52 A;  3ECO A;  2JZY A;  3I9V 2;  3DBH B;  1P6R A;  4M9S A;  2EJR A;  2E19 A;  2JMW A;  2R7T A;  1T56 A;  1BW6 A;  5EEG A;  3WE2 A;  2M34 A;  2M30 A;  2HKO A;  1J7K A;  5DV5 A;  1T39 A;  1FOW A;  2EA4 A;  1A6I A;  3ASN H;  3O8H A;  4KMF A;  2JN6 A;  2HWV A;  1ZR2 A;  2ICW G;  3LAJ A;  2CQN A;  3W6K B;  2XC7 A;  2X51 A;  2CW7 A;  2DO7 A;  4A93 J;  2EZL A;  4PGH A;  3DBR B;  1B8I A;  1SAX A;  2OTL I;  3K4M A;  5LD2 C;  1RRJ A;  1B9M A;  1DGW Y;  1ZR4 A;  2WTE A;  1ZRD A;  4V19 K;  3ERE D;  3TKY A;  3L2Q A;  4LK1 F;  5GAH J;  4E7Z A;  4EM1 A;  1ZKG A;  1ZAR A;  2G7H A;  2IGN A;  3KLO A;  2VQC A;  3C2B A;  5E3L A;  4EJW A;  3FXU A;  4ETS A;  4P5O A;  5IOY A;  1O7L A;  3KP4 A;  5GAD J;  3IKT A;  1K78 B;  2DBB A;  2EFO A;  3E1S A;  2H09 A;  3R0J A;  5DEQ A;  4HPQ A;  1FNN A;  4C2U A;  3SQN A;  5DDG A;  1T98 A;  2GZW A;  2OZ6 A;  3BG6 A;  4NC8 A;  3F23 A;  1XSX A;  3KX2 A;  5E3M A;  5KAI C;  5E1X A;  2H8R A;  3MKW B;  2CQK A;  3ZN0 A;  3BZK A;  1JKQ C;  2COM A;  3SJM A;  3CO6 C;  3U21 A;  5F0H A;  2LF8 A;  1P4W A;  2R93 J;  3ZN1 A;  3CJR B;  3KFW X;  3AG4 H;  3DTE A;  3SEQ A;  2R92 J;  4U0W A;  1U78 A;  2EZK A;  2ZME B;  1MW7 A;  2G7U A;  4KDP A;  2KT0 A;  5FD6 A;  3KEO A;  1G8X A;  1EH6 A;  1DP3 A;  4WCG A;  2QA4 I;  2HQ5 A;  1WWX A;  2IXS A;  2DYR H;  1ZRC A;  3V42 A;  1WJD A;  3C2G A;  4BAY A;  4E6K G;  1U8R A;  4NHJ A;  4HDU A;  2VXZ A;  4RBO A;  5CPR B;  2E1M B;  4I0B A;  1QA6 A;  2H27 A;  3MFK A;  1FOY A;  1VQ4 I;  2L7F P;  5ILV A;  1AA7 A;  1X2N A;  2XPU A;  3RCO A;  2F48 A;  4KN4 X;  2JA6 J;  1LE8 A;  1I1G A;  4CUG A;  1IRZ A;  5DCF A;  3EET A;  4FX0 A;  1MIJ A;  1G3S A;  2M8G X;  1VQN I;  4YEL A;  1T0F C;  4CZZ A;  3RZO J;  3OYL A;  1RPW A;  1GXP A;  4GCV A;  3JRA A;  1MND A;  1QVU A;  3JRI A;  1V5E A;  2K3P A;  1R49 A;  4BHB A;  1UCR A;  1IF1 A;  1X3U A;  2VBY A;  4A0Y A;  1KYZ A;  2XAG A;  3HGY A;  2KJB A;  1X1C A;  1HXD A;  5TJJ A;  3SEZ A;  3GFL A;  2DJN A;  2OPT A;  3CP8 A;  3HB9 A;  4NQW B;  4XOP A;  2KRC A;  3QAH A;  5B5E C;  1FWZ A;  4XLC A;  2BW3 A;  1Z91 A;  5E17 F;  1Q1H A;  3PUB A;  3QP5 A;  3FMS A;  3AG1 H;  5L3E A;  5CQE A;  4EAT A;  1WI9 A;  1PUF B;  1QZE A;  3BR6 A;  4ZDO A;  1OR7 A;  1R7J A;  3CC7 I;  4PJJ A;  3M3Y J;  4N9H A;  3AL0 B;  3PL8 A;  3WU2 C;  3HTU A;  1IN6 A;  1E2X A;  2MD0 A;  4V2F A;  3GTK J;  3RTR A;  1S5L C;  2QBY B;  3PQJ A;  3KCC A;  2UWM A;  1SMT A;  2XF7 A;  4BS9 A;  4B44 A;  4BKX A;  2XUB A;  2BXZ A;  4BGD A;  3K2Z A;  5CYV A;  3V8L A;  2KPM A;  4BUP A;  4JX4 A;  1NG7 A;  2OV7 A;  3UR3 C;  4DW6 A;  2VI6 A;  5M5X J;  2BHY A;  5L3B A;  2WY8 Q;  2ZFU A;  3I64 A;  1PUE E;  2LKS A;  2NYX A;  1RZ4 A;  1FC3 A;  2FX0 A;  4YEJ A;  2Y9Y A;  2IA1 A;  4FIS A;  5DM7 F;  2DXI A;  5D5W B;  1I39 A;  3NWS A;  3I59 A;  1QHH D;  2LBF A;  3E7L A;  2W48 A;  1U3E M;  4IHX A;  3CZ6 A;  3JR9 A;  4A12 A;  1BA5 A;  3RPQ A;  1OR7 C;  4HQE A;  2CG4 A;  1JI8 A;  4W97 A;  3OWT A;  1FOK A;  1IDY A;  3H0D A;  3MKL A;  4FX4 A;  2ESH A;  5IYB J;  1P4A A;  4B43 A;  1MBE A;  1OCR H;  1PJR A;  4XSZ F;  2IEK A;  5HDK A;  1TWF J;  2PJP A;  1Z9C A;  3RJP A;  2LY2 A;  1H9G A;  3E6M A;  4CCM A;  4NC6 A;  4XKV A;  3OYB A;  3W6J B;  3FK6 A;  4B48 A;  1G4D A;  2CU7 A;  3FX3 A;  2YR2 A;  3O3K A;  4L9J A;  3G4S I;  2P7C B;  1BI2 A;  1Q1V A;  4M3E A;  4Z6Y A;  2OA4 A;  1VQL I;  3PQK A;  5LBQ A;  2V1D A;  2RRE A;  5L3F A;  5BOX A;  2VOP A;  4U7D A;  3TOA A;  5D5U B;  2W25 A;  5LFA A;  3GTJ J;  4PFP A;  1JKO C;  3KET A;  3RKX A;  4BEH A;  2HEO A;  2M9H A;  3UNG C;  2DMP A;  2DOD A;  3BZC A;  3K1M A;  3SZG A;  2LMD A;  3L2R A;  3OYA A;  3HRT A;  2G9W A; 
#chains in the Genus database with same CATH homology
 3I4N J;  4S0H B;  5IYC J;  3OOU A;  2NS8 A;  1XC5 A;  1ENH A;  4MLO A;  2B63 J;  4A3I J;  5EG0 A;  1VFC A;  1UMQ A;  2HXI A;  3CDL A;  3S14 J;  4NDL A;  4B4C A;  1GT0 C;  1WH7 A;  2LTP A;  4M3G A;  3PM1 A;  4JX5 A;  3CCY A;  3S2H J;  2VUM J;  3BQZ A;  2Y9Z A;  2HDD A;  4A3J J;  1IDZ A;  2DN0 A;  1E3O C;  3RKQ A;  2E2H J;  2OF7 A;  4MFD A;  4IHY A;  2JA8 J;  1IUF A;  2R0Q C;  2O7O A;  5FKN A;  2TCT A;  4IEJ A;  3NAU A;  5HOD A;  1A5J A;  2FJ1 A;  2MSY A;  5EF6 A;  4UUS A;  1XG1 A;  4FTH A;  4EEF G;  3PO2 J;  4XRS A;  3JRG A;  4MO7 A;  1DU6 A;  5J3L A;  2HYJ A;  4M3F A;  2Y31 A;  2R5Z B;  2CJJ A;  1Z77 A;  2M2E A;  3K2A A;  3A02 A;  2JJ7 A;  2PMZ N;  1WH5 A;  1HDD C;  2IBD A;  3B6C A;  3MN2 A;  3IV5 A;  4J19 A;  3HDD A;  5C3E J;  4B1R A;  1ZTR A;  4A3L J;  1R9T J;  1MBK A;  5IPA A;  1GDT A;  5GP9 A;  4DZJ A;  3FIW A;  5F0F A;  1JUP A;  2NS7 A;  9ANT A;  1MBG A;  1RKW A;  2NVX J;  2L7Z A;  1MH3 A;  5EYR A;  3OSF A;  4AUX A;  2HOT A;  1U9N A;  5J1R A;  3Q0U A;  3Q0W A;  1OCP A;  2CQX A;  2X9D A;  3ZQI A;  2K40 A;  4C3J J;  1CQT A;  2LFB A;  2JWT A;  1BJZ A;  4UUT A;  2XPV A;  1DU0 A;  2DA7 A;  3DEW A;  3GTM J;  3CMY A;  3QPL A;  5EGO A;  3FIS A;  3ZQL A;  3JRC A;  3MVP A;  3I4M J;  4A3B J;  2K9N A;  5FLV A;  5EG0 B;  3GTG J;  3HOZ J;  3ZQC A;  5FJ8 J;  3HOY J;  2LP0 A;  2FD5 A;  1HF0 A;  1G2H A;  2X6O A;  3ZQH A;  1H88 C;  3HOU J;  4BY1 J;  1FIP A;  1I50 J;  1TC3 C;  4DZP A;  2ECB A;  1K61 A;  2EZH A;  1WCM J;  5EZG A;  2COB A;  1Y1W J;  1IJW C;  1MNM C;  2D5V A;  3BT9 A;  2ECC A;  2DMN A;  1I6H J;  2I10 A;  1FTT A;  1VND A;  3S1M J;  4A3C J;  1BW5 A;  1ETW A;  2Y2Z A;  2NOG A;  4UUS B;  2NVT J;  2R7Z J;  3GTQ J;  1F36 A;  2DA1 A;  1APL C;  5IP7 J;  1MSF C;  3LSG A;  2DMU A;  2DA4 A;  2E2I J;  3BR3 A;  5GPC A;  4JX6 A;  3JRB A;  4A3M J;  1QVT A;  2NVY J;  1JKR C;  5F0C A;  1TWG J;  2YU9 J;  3HOW J;  4G12 A;  4XIC A;  2R5Y A;  3IH2 A;  4GFB A;  3QPS A;  2WAQ N;  3JRD A;  4XID A;  1ZQ3 P;  1UG2 A;  4M3D A;  2LY9 A;  1H89 C;  1IC8 A;  3S15 J;  2E1O A;  3TP3 A;  1RR7 A;  2ELK A;  1ETQ A;  1RES A;  1MBH A;  3TW7 A;  5BNG A;  2LVS A;  2O8K A;  2KDZ A;  1P7J A;  1JJ6 C;  4I76 A;  1WI3 A;  2JA7 J;  3BQY A;  1POG A;  1OCT C;  3CQZ J;  3L1P A;  3OSG A;  1K83 J;  1YRN A;  3B6A A;  2YS9 A;  1MH4 A;  3HKZ N;  2Y0S N;  5EGO B;  1JTY A;  2DMT A;  4D7N A;  3LSP A;  4XRM A;  3O8G A;  3TW6 A;  5M5W J;  1EF4 A;  1WGX A;  3BG9 A;  2QF7 A;  3G1L A;  4C2M J;  3FKI J;  1ZK8 A;  5M3F J;  5IOZ A;  2NVQ J;  1ITY A;  2DA3 A;  1FEX A;  5FKM A;  3S17 J;  2JK3 A;  1ETO A;  3BTL A;  5C44 J;  2GLO A;  2L7M P;  4CYC A;  3Q3S A;  5FLM J;  1TWA J;  2FQ4 A;  1BL0 A;  3A03 A;  3SFI A;  1HLV A;  1O4X A;  1IGN A;  3K7A J;  1W0T A;  2AHQ A;  1VI0 A;  5F27 A;  5JLX A;  3WHB A;  2GM4 A;  4A3G J;  4A3F J;  1B72 A;  5F1J A;  3LNQ A;  5IYD J;  2ZB9 A;  3S1N J;  1MBF A;  3Q0V A;  2K9S A;  1F43 A;  5IP6 A;  2DA5 A;  5FKL A;  3BR0 A;  3HBL A;  3TP0 A;  2JA5 J;  4L5E A;  3WHC A;  4ABZ A;  2CQQ A;  2EBI A;  2QCO A;  4XK4 A;  4C3H J;  3D1N I;  4D7M A;  2E19 A;  2JMW A;  2R5Y B;  1T56 A;  5E3N A;  1BW6 A;  2CUE A;  5GPA A;  2M34 A;  1IG7 A;  5F08 A;  4D5F A;  2HOA A;  2L9R A;  4M3B A;  4A3D J;  1A6I A;  1WPK A;  3O8H A;  5C4J J;  2JN6 A;  1ZR2 A;  3PO3 J;  1JT0 A;  2LD5 A;  4A3K J;  1NK2 P;  2G0E A;  3HGG A;  4Y52 J;  1UHS A;  1X58 A;  4I6Z A;  4A93 J;  2EZL A;  2MGQ A;  1B8I A;  3BTC A;  1LFB A;  5J1Y A;  1ZR4 A;  1YRN B;  1P7I A;  1ETY A;  1ZKG A;  5E3L A;  3C2B A;  3BR5 A;  2Y30 A;  5IOY A;  1MBJ A;  2H1K A;  2XB5 A;  5FKO A;  2LK2 A;  2DA6 A;  2WV1 A;  4DYC A;  4CYC B;  1GVD A;  2GBY A;  3LSR A;  1W0U A;  5E3M A;  2H8R A;  1U8B A;  1PUF A;  1JKQ C;  3SJM A;  4BBS J;  2ME0 A;  1HDP A;  3BTJ A;  5F0H A;  2R93 J;  3NAR A;  1FIA A;  2R92 J;  1NTC A;  1U78 A;  2EZK A;  1JTX A;  1HCR A;  1ETX A;  1B72 B;  1OJL A;  4BY7 J;  2KT0 A;  3HOX J;  1Y1V J;  3IH3 A;  5JLW A;  2LR8 A;  4JP0 A;  3GTO J;  1JT6 A;  3S2D J;  3GBG A;  2HQ5 A;  2ID3 A;  4AC0 A;  1JGG A;  2LKX A;  2XRL A;  4HNV A;  1GV5 A;  2LLK A;  4RBO A;  3G1M A;  4A3E J;  3SDG A;  1SAN A;  2WB1 N;  4D5C A;  3DCF A;  2L7F P;  1X2N A;  1JUM A;  2XPU A;  1MSE C;  2JA6 J;  1D5Y A;  2CRG A;  4M6V A;  4QSH A;  1LE8 A;  3ZQG A;  1GUU A;  4DYQ A;  1IRZ A;  4X1E A;  5EEA A;  5M3M J;  2M8G X;  2HXO A;  3BTI A;  5M5Y J;  3HOV J;  3RZO J;  1RPW A;  2HI3 A;  1X2M A;  2DTZ A;  2EZI A;  4Y7N J;  3JRA A;  1QVU A;  3JRI A;  1B8I B;  1FJL A;  2VKE A;  3LSJ A;  2K9Q A;  2MW8 A;  2DA2 A;  2IAI A;  1RET A;  3H0G J;  2EH3 A;  5DTD A;  5E3O A;  3H3V K;  2O9L A;  1FTZ A;  3HGY A;  4BBR J;  3A01 A;  1RKT A;  2VPR A;  2N8G A;  2X48 A;  2CUF A;  4IHV A;  3HEF A;  2DJN A;  2OPT A;  3HB9 A;  1ZGW A;  1AKH A;  4AYB N;  2ME6 A;  3BR2 A;  3GTL J;  4DYR A;  4W1U A;  1VF9 A;  1T33 A;  4QTR A;  1PUF B;  1JUS A;  1JJ8 C;  1TWH J;  2XB0 X;  4FCY A;  3BR6 A;  3JRF A;  3ZOB A;  2MG4 A;  3BR1 A;  5IP9 J;  3M3Y J;  1ORK A;  5K7H A;  4V2F A;  3RZD J;  3GTK J;  5C4X J;  3S1R J;  4JYK A;  1QRY A;  1ETV A;  4BKX A;  4QIW N;  5EDN A;  3F0C A;  2XGC A;  1NK3 P;  5F04 A;  4JX4 A;  2XGE A;  4DW6 A;  2VI6 A;  2P81 A;  3BG5 A;  5M5X J;  4X6A J;  3JRH A;  1U9O A;  2L0K A;  2FX0 A;  1I3Q J;  2Y9Y A;  4MIM A;  4A69 C;  4B3A A;  3JRE A;  4FIS A;  3FK7 A;  4FE7 A;  1TWC J;  4V2G A;  5EZH A;  2E2J J;  3LOC A;  1LE8 B;  1XS9 A;  3G1O A;  5DS9 A;  3E7L A;  3TED A;  2W48 A;  3QQA A;  2HOS A;  4IHX A;  3JR9 A;  2XSD C;  1BA5 A;  2XPW A;  2DMQ A;  4MFE A;  4LOC A;  1GV2 A;  4W97 A;  1IDY A;  3MKL A;  2XGD A;  3ZQF A;  5K7F A;  2R5Z A;  5IYB J;  2EQR A;  1MBE A;  2TRT A;  3M4O J;  2IEK A;  1TWF J;  5FKK A;  1Z0X A;  3UKG A;  3OIO A;  1OFC X;  1SFO J;  3A01 B;  1IV6 A;  1ETK A;  1S7E A;  2YUS A;  4BXX J;  1AKH B;  3FK6 A;  1AHD P;  5K7Z A;  4IHW A;  2M0C A;  1AU7 A;  2CU7 A;  1JKP C;  2ID6 A;  1Q1V A;  4M3E A;  4C3I J;  3S16 J;  3W6V A;  1LFU P;  3BG3 A;  3GTJ J;  1JKO C;  2RAE A;  4FE4 A;  4RDU A;  2M9H A;  2DMP A;  1QPI A;  2VKV A;  5J1U A;  4XRS G;  3GTP J;  3S1Q J;  3IH4 A;  3VPR A;  2AO9 A;  3RQI A;  1H8A C;  1HOM A;  3HM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...