3M3YJ

Rna polymerase ii elongation complex c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3m3yJ00
5E3LA 2WB1N 3JRCA 1B72A 2E1OA 2HYJA 3JRHA 3ZOBA 3OSGA 1RKWA 2FJ1A 5IOYA 1BW6A 1MBHA 2Y30A 3RKQA 4A3FJ 2ZB9A 1JUSA 2ME0A 3JRIA 2O8KA 5EGOB 3S17J 5EYRA 2VUMJ 1HOMA 1IDYA 1QVTA 2DMNA 2XB5A 3O8GA 1X58A 2M8GX 4C2MJ 2R92J 1G2HA 3WHBA 1A6IA 3CCYA 5GPAA 2XPVA 3IH2A 5E3OA 1MBFA 1IUFA 4FE4A 2NOGA 2JA8J 3S15J 1AHDP 3GTPJ 2AHQA 3IV5A 9ANTA 1YRNB 4AC0A 1DU0A 5FKKA 4XRSA 2R5YB 3Q0UA 5IOZA 4CYCB 3S1QJ 1OJLA 1QVUA 1P7IA 4A93J 1FJLA 5F0HA 2WV1A 4BY1J 4DZJA 5EDNA 4W97A 5JLXA 2KDZA 2R5ZA 1WPKA 2XGEA 1PUFB 3GTGJ 2DA2A 1Z0XA 3BT9A 1TWGJ 3MKLA 4MIMA 3S16J 3I4NJ 1ETQA 1K83J 3ZQGA 5F04A 3LSJA 4DYRA 1FTTA 1B72B 1Z77A 2NS8A 2YU9J 2NVQJ 3PO3J 4JX4A 4M3DA 3NAUA 4Y7NJ 2ECBA 3LNQA 3LSGA 1JJ8C 1QPIA 2P81A 3A01B 4RDUA 4FTHA 1ETWA 2COBA 2CUFA 2XGCA 5C4JJ 1BA5A 1WH7A 1POGA 2NVXJ 5FJ8J 1Q1VA 1RKTA 4FISA 1RETA 4BY7J 4D7MA 4M3FA 4QSHA 2LLKA 1JUMA 2TCTA 3HOUJ 2VKVA 3O8HA 2AO9A 3BQYA 4FE7A 3ZQCA 4A69C 4UUSA 2NVYJ 1NK3P 5IYCJ 1W0TA 2CUEA 2E19A 2Y0SN 5EEAA 3Q0VA 1I3QJ 1X2MA 4MFEA 4A3EJ 2LFBA 3HOYJ 2L9RA 4D5FA 3HEFA 1XS9A 2HXOA 2HOTA 3DEWA 1CQTA 2DMUA 1ENHA 4A3CJ 3CQZJ 1U8BA 5FLMJ 1VI0A 4DYCA 2MSYA 4QTRA 1MSFC 3FIWA 5F0FA 1W0UA 5IP9J 2VPRA 4EEFG 3JR9A 1IJWC 3K2AA 1ORKA 3HDDA 3A02A 3BR5A 4W1UA 1U9OA 3S2HJ 3SDGA 1GV5A 2ID3A 3VPRA 2LD5A 3JRBA 2VKEA 4IEJA 4JX6A 1IV6A 4XRSG 2EZIA 2W48A 3BTIA 3TEDA 4XK4A 4BBRJ 3S2DJ 4HNVA 3S14J 1HDDC 2MW8A 2MGQA 4XICA 5F1JA 2R93J 1AKHA 3LSRA 1JTXA 1ZQ3P 3K7AJ 1BW5A 2MG4A 5GP9A 5EG0A 1U9NA 2EQRA 5C4XJ 5J3LA 4JYKA 1JT0A 5M3MJ 5J1YA 2LK2A 2M2EA 4BBSJ 3M4OJ 2X9DA 3LOCA 3HOVJ 5IP6A 1S7EA 1TWCJ 3BTCA 1X2NA 5M5YJ 1JT6A 1VF9A 1JKQC 4DW6A 1MNMC 3TW6A 4A3IJ 3D1NI 1NTCA 2JA6J 1U78A 1HDPA 2DTZA 3BG5A 1MBGA 1JKOC 3GTLJ 3IH3A 4AUXA 3I4MJ 2EZHA 2X48A 1FEXA 4V2GA 3HGYA 1JKRC 1EF4A 1LFUP 1SFOJ 2B63J 4BKXA 3JREA 3IH4A 1OCTC 3ZQHA 2HOSA 1ETYA 1JJ6C 2LTPA 1OCPA 2I10A 1JKPC 1TWAJ 5IPAA 1GVDA 2E2JJ 1IRZA 2IBDA 3SJMA 3FISA 4B1RA 3ZQIA 1ZR4A 4FCYA 3BR3A 1F43A 1TC3C 5EZGA 1K61A 4XIDA 2JK3A 1HF0A 4A3BJ 2M34A 3MVPA 2L7ZA 3HOZJ 4BXXJ 1AKHB 2CJJA 1OFCX 5EZHA 2G0EA 1H89C 5E3MA 1MSEC 3MN2A 1ZTRA 2JMWA 4C3IJ 3BTLA 4DZPA 2K9SA 2DA4A 3S1RJ 2LP0A 2DA5A 4JP0A 2EH3A 5FLVA 4DYQA 2LVSA 3CDLA 2GBYA 2HQ5A 3G1LA 4Y52J 2CRGA 1WI3A 5FKNA 2KT0A 2L0KA 2ID6A 3H0GJ 3E7LA 2EBIA 2RAEA 5M3FJ 2Y9ZA 3F0CA 2YUSA 3BR6A 2CQXA 3QQAA 4L5EA 1HCRA 4G12A 4C3JJ 2K9QA 5F08A 2ME6A 3BR0A 4RBOA 3HM5A 2L7MP 4MLOA 2R5ZB 5K7FA 2LY9A 1APLC 2GM4A 4AYBN 2DMPA 2IAIA 3C2BA 5F0CA 2JWTA 4UUTA 1ETXA 2Y31A 2OPTA 1B8IA 2R0QC 2H8RA 4MO7A 5F27A 1UG2A 1YRNA 1TWFJ 3HGGA 2XPUA 2D5VA 3ZQFA 3TP3A 2JJ7A 4CYCA 2K9NA 2CU7A 4D5CA 3ZQLA 4V2FA 2DA6A 3TW7A 2OF7A 3OOUA 2WAQN 3GTQJ 3FK6A 4A3JJ 3NARA 2DN0A 3B6AA 1GUUA 3HBLA 5M5WJ 3WHCA 1GDTA 2E2IJ 2XPWA 1AU7A 1JTYA 4JX5A 1O4XA 2JN6A 4A3LJ 1BL0A 1ETKA 2JA7J 1QRYA 2DA3A 1MH4A 5HODA 5DS9A 2M0CA 1XC5A 1WCMJ 1E3OC 2ECCA 4IHXA 2XB0X 3HB9A 2ELKA 1ITYA 4QIWN 1ETVA 3A03A 3M3YJ 3PO2J 2FX0A 2TRTA 1ETOA 2QF7A 3PM1A 3FK7A 4GFBA 3GTOJ 1MBJA 2K40A 2LR8A 3JRGA 3JRFA 1T56A 5BNGA 1IDZA 3HOWJ 4NDLA 3SFIA 4J19A 4UUSB 2HI3A 4B4CA 3H3VK 2EZKA 4A3GJ 4IHVA 2QCOA 1ZR2A 1LE8A 3GTKJ 3A01A 1IC8A 2NS7A 2L7FP 3GTMJ 3OIOA 1H8AC 4C3HJ 2EZLA 4M3BA 3JRDA 3BTJA 5J1UA 5IYBJ 2HOAA 1RESA 1WGXA 3HOXJ 1VFCA 1D5YA 2Y2ZA 2PMZN 3OSFA 4X1EA 4M3GA 3JRAA 1B8IB 2HXIA 4A3KJ 1H88C 2CQQA 3UKGA 2R7ZJ 5IP7J 5K7HA 2JA5J 2XGDA 4MFDA 1GT0C 5DTDA 3FKIJ 2LKXA 3HKZN 1LFBA 2XSDC 2DMTA 3GTJJ 2HDDA 3S1MJ 5C3EJ 3Q3SA 1ZGWA 4M3EA 1MBKA 1UHSA 3BG3A 4LOCA 1RPWA 3TP0A 1I50J 2DA1A 4I6ZA 5E3NA 4ABZA 1FIAA 1NK2P 1FTZA 2GLOA 1FIPA 3QPLA 3DCFA 2N8GA 1BJZA 4XRMA 3RQIA 1Y1VJ 5EG0B 4M6VA 3BR2A 1R9TJ 4B3AA 3BG9A 4X6AJ 5EF6A 5IYDJ 1ZKGA 2H1KA 5M5XJ 3RZDJ 3L1PA 1LE8B 5K7ZA 1UMQA 5EGOA 2IEKA 3S1NJ 2YS9A 2DA7A 1I6HJ 1P7JA 1JUPA 4D7NA 3G1OA 1HLVA 1WH5A 3BQZA 1ZK8A 1TWHJ 1XG1A 3GBGA 2DJNA 3RZOJ 4I76A 3W6VA 2O9LA 2XRLA 1SANA 1F36A 1RR7A 2NVTJ 2DMQA 1Y1WJ 5FKOA 5FKLA 5J1RA 1T33A 1IG7A 2R5YA 3Q0WA 4S0HB 1A5JA 1GV2A 1JGGA 3G1MA 2FD5A 2M9HA 2Y9YA 4IHYA 1MBEA 4IHWA 5GPCA 1VNDA 5FKMA 3CMYA 5JLWA 4A3DJ 2FQ4A 2O7OA 5C44J 1PUFA 2E2HJ 1MH3A 2X6OA 2VI6A 3B6CA 3LSPA 1DU6A 4A3MJ 1IGNA 3QPSA 3BR1A
chains in the Genus database with same CATH superfamily
2KRFA 3ZMDA 4OU0A 2E1OA 1P4XA 3ZMZA 2XC7A 1MMGA 3ZOBA 5K5QA 3W2WA 2JVHA 1PDNC 4BNCA 2LRDA 2DK8A 3OSGA 1BW6A 3RKQA 4A3FJ 4XKWA 1Y0UA 2HYFA 3S17J 3JTGA 1FYMA 1HKTA 3GZ5A 1GVJA 1T0FC 2R7OA 1MZBA 1IO2A 2DLLA 1QVTA 1KQ8A 1WJFA 2ZFUA 3QU3A 4C2MJ 5JR3A 1G2HA 4HZFA 4B3XA 2O6GE 3KEYA 1SC7A 1G3WA 1LPQA 1ZGAA 2CWEA 3H5RA 2PJRB 1OCZH 4I99C 5H6QA 4FE4A 1T2KA 1FLIA 2NOGA 4U0WA 3I5UA 3GTPJ 5E8GA 1MDMA 4D0PA 2CYYA 3ZP5A 3ROUA 3KPHA 2IRFG 1NHAA 3CMMA 5CVRA 1U2WA 2EJRA 2R5YB 5IOZA 5DV5A 1HXDA 3MQ0A 4HSRA 1HQCA 1QVUA 1IXCA 2H94A 2Y0SA 4EGYA 2IA0A 1FJLA 2QKMB 2WV1A 2R7UA 4DZJA 3EETA 2L54A 2OZUA 1LEBA 3M1EA 3BY6A 2R5ZA 3L2QA 2RC4A 5GADJ 1WPKA 1HBXG 4B48A 4EMSA 3GTGJ 1PUFB 3TL4X 1Z7LA 5D5VB 3MKLA 4MIMA 5ED4A 3S16J 3LSJA 3H5AA 5FGMA 4DYRA 3K4NA 2YPRA 4BYYA 1YI2I 3KIOA 2YU9J 3DXJF 3I9V2 4MQVA 3OOPA 4AU7A 2WB1A 2DYRH 4M3DA 1A31A 3B02A 5FRNA 2P6SA 3P9KA 2AXTC 4U7BA 3HJEA 3FMQA 2F5VA 4BACA 2MFZA 3W2VA 3RKXA 4CCMA 3I71A 3GMEA 4EJWA 3DPUA 3DF8A 3CUQC 4RDUA 3OYNA 2CUFA 4HBLA 1G3SA 2IA2A 4YFKF 3KZZA 5H2FC 1POGA 2L01A 4BQNA 1M1EB 1XD7A 4FX4A 1FZPB 4IHSA 2JPCA 1ODDA 5HS8A 4C2UA 1FSEA 2R7WA 4GCVA 4AVZA 1Z05A 3DBHB 3MZYA 5IY5H 2E34A 4GYGA 4KT6A 1W1WE 4B44A 3QYBA 4PK4A 2ZCWA 3HOUJ 1V55H 2ZBKA 1BC8C 4NQWA 4OINF 4H4KC 3HL2A 5D4SA 4UUSA 4NNJA 3AAFA 4IRGA 1AOYA 2Y69H 2HGCA 3VYTB 3LWFA 4LLGF 3SQNA 1YIOA 1YS7A 3HEFA 3ISPA 1B9MA 4CSWA 3DEWA 1XSXA 2FBIA 1KYZA 2BY0A 2H8WA 3QP6A 2RN7A 3TOAA 2L7KA 2O03A 1T98A 2QM3A 1O7FA 1W0UA 3K2AA 2ZNZA 3S2HJ 3SDGA 4AD9A 3E5UA 3KP7A 1U5TB 2VBWA 3PL8A 4GXOA 4BXFA 4E7ZA 2LD5A 6PAXA 3HHGA 2DT6A 1BI3A 3KP6A 4RMNA 4K2EA 5CPRB 3JRBA 4JX6A 4C2TA 4FT8A 5IT3A 1IV6A 1SMYF 2R7DA 2VBXA 2VJIA 3QYEA 1PJRA 4XK4A 2DQLA 3S14J 2ZJRF 1HDDC 3S2DJ 2EFWA 2MBFA 2MW8A 1JI8A 1UFMA 2VQCA 1JTXA 2CW0F 1MW7A 4LB5A 1S9HA 4AIHA 2OCEA 4CCKA 1U0JA 3S3OA 1UELB 1BBYA 2E60A 1HSJA 2ZMEA 4TV7A 1R00A 4JYKA 4Q47A 3WGGA 2CW7A 5M3MJ 1A04A 1XPXA 4BDZA 3OYEA 2MC3A 2X9DA 4BBSJ 4NBQA 1R71A 1FPQA 2M4GA 1X2NA 1YW9A 2QYOA 3IAM2 1JT6A 1JKQC 3K69A 4DW6A 3TKYA 2HKXA 2Q2EA 2VOOA 4EJOA 1QU3A 3PSFA 3D1NI 1V5GA 1NTCA 3BZKA 4BHCA 2R7QA 3QYFA 3V7RA 2MH9A 2F4MB 2JT1A 4NC6A 4AIJA 3BG5A 5KAIC 1K4TA 3CD6I 1IN5A 4HDUA 4AUXA 4X0GA 3J7YJ 2EZHA 4XL9A 4AIKA 2FMLA 3KZIC 2LKSA 4G6DA 4NUBA 1LFUP 1JKRC 3GW2A 1SFOJ 1KQ0A 2LDUA 3RSNA 1I1GA 2GOXB 1LDDA 3HPHA 4WX9A 3ZQHA 2CFXA 2WAQA 1YTYA 2OC6A 1W7PA 1JJ6C 2LTPA 4XKBA 2I10A 4P5OA 1JKPC 1GVDA 1V3FA 1R22A 3VYSB 2PMHA 4F3QA 4B1RA 1XGSA 2WAFA 2JRTA 3JCUC 3ZQIA 3BR3A 3S32A 4BE1A 1GXPA 4IHTA 4BE0A 4IX7A 2A6EF 2L7ZA 2VXZA 3V8JA 1IN4A 5BOXA 1Z1DA 1ZTRA 1MNEA 2XSJC 3BTLA 4DZPA 1FYLA 5FLVA 2LP0A 4JP0A 3G4SI 1JHFA 4DYQA 1WJCA 2LVSA 2XVCA 2QQ9A 2QKLB 2W4SA 2WADA 3OIPA 1MDMB 4CXFA 4Y52J 1WI3A 2FOKA 5LFAA 5HDGA 2COMA 3PIOF 4ESJA 2GQQA 2JSPA 2HPIA 2P8TA 2EBIA 2V1NA 2V4JC 3OYIA 4ZYDA 3E1SA 4ZYGA 4IJAA 4LMYA 4IZZA 4L5EA 2GIZA 3R4KA 3HOTA 4C3JJ 2F5FA 2K9QA 1S6LA 1YITI 2R5ZB 3QPTA 5CKTA 3RJPA 3UR3C 3WODF 2JUGA 3I59B 1VQPI 5F0CA 2GXBA 3I58A 3CMAI 3KLNA 1B8IA 4MGRA 4MO7A 2KIMA 4L9VA 3RPQA 3HGGA 3OYHA 4C9YA 3PQKA 2QUFA 4BU2A 1VQNI 4CYCA 2K3PA 2K9NA 3COAC 4D5CA 1DGRM 1OR7C 3ML6A 4V2FA 3TW7A 5H20A 3DBLB 4CZZA 1SVLA 5AIPA 3MKYB 2XUBA 3S93A 3NARA 4PJMA 5B3SH 4MNUA 5FO5A 2PN6A 4E7HA 4FHTA 2E2IJ 1IAWA 1AU7A 4M9ZA 2W85A 3ZCOA 5D8KB 3F8CA 4D1QA 4E70A 3E5QA 1O4XA 2JN6A 1TQIA 3LSTA 3K4JA 3HXLA 3GLLA 5HODA 1T0FA 2QQAA 3G2BA 2ECCA 1A36A 2XB0X 1K7AA 4PJJA 4E7LA 2IT0A 1ETVA 3A03A 3M3YJ 3PO2J 2DCEA 4A0YA 4EGZA 2QGUA 4RA2A 3C1DA 2ZC2A 3KEOA 4ZZLA 4N4OB 2MA3A 4UV9A 2WWYA 5BNGA 4NQWB 3W6JB 1FX7A 3SFIA 2DAOA 4UUSB 3OWTA 3H3VK 5B66C 3HRSA 1ONVA 2CG4A 4QLCU 1ZR2A 3A01A 2FF4A 3HSRA 4L9TA 1H8AC 2QZ8A 4C3HJ 5BS6A 1CF7B 1HC8A 1VQ4I 1XGOA 3DPLC 2OTLI 3BTJA 3BZCA 3F9KA 3PFYA 4KDPA 3CC2I 1RESA 3K70D 4OIOF 1VFCA 4IRHA 3RCOA 2ESHA 2PMZN 2L02A 5D8LB 3A0BC 2XAQA 3D5SC 2OJED 4A3KJ 1W5SA 1H88C 3EQLF 2R7ZJ 4RGUA 1PVEA 2UWMA 2XGDA 3PFIA 5L3BA 4UHTA 4E6KG 2GA2A 4HV6A 3TO6A 2WY7Q 3L00A 4I0BA 1L3LA 3FKIJ 4PCQA 3DLLF 4BUPA 2LKXA 1LFBA 4Y33A 2EV6A 3GTJJ 2HDDA 5C3EJ 2FRHA 1UHSA 1RC9A 1YW8A 3OL3A 2X6YA 2WC2A 4R79A 1RPWA 2X1CA 3TP0A 1A35A 1UJ8A 2MD5A 3BJ6A 3DEUA 4RLFA 5E3NA 2UV1A 3LQQA 4ZDPA 1FTZA 3HC7A 4OIRF 4KA4A 5LEJA 3F22A 3HZJA 4I02A 2EINH 3OYMA 1SMTA 3OS1A 2KDOA 1BJZA 1S3JA 5TISC 3U2RA 1Z6TA 2LMDA 2V9KA 2Z33A 2JQ7A 1ZG3A 4L0YB 1FOXA 3LA3A 3LQRA 4BH9A 4B3AA 5J4VA 2QSGX 2ZMEB 5IYDJ 1S72I 4Q48A 2H1KA 3OV8A 5M5XJ 1R1VA 2DFHA 5DEQA 4XLPF 3BDDA 1UMQA 3MMYB 3PJRA 1UHMA 1VQMI 2I5UA 2QWWA 1FWZA 2BEOA 4J01A 2Q2EB 4RB0A 2VE9A 3G1OA 4XRFA 4WK8F 1ZK8A 1XG1A 2CQ7A 1LQ1A 3U21A 4B47A 3RZOJ 3VWBA 3TDUC 2PBIA 1SVMA 3WTVC 1F36A 4HDVA 3VB2A 1QGPA 2G7HA 2IPQX 2VJ4A 1IG7A 2R5YA 2YX4A 3WU1B 2VKDA 3Q0WA 1ACIA 3WU2C 2K7LA 4B43A 1A5JA 1ZARA 3DFGA 1LJ9A 2WAEA 4YELA 3A2KA 1MMDA 1UZCA 1DP7P 5HLHA 3OS2A 4BDYA 2BVMA 3E3VA 2BW3A 4RAYA 1NG6A 2O7OA 1PUFA 4ZYEA 4HV5A 2HZTA 1MH3A 2X6OA 3B6CA 4HF1A 2Q1ZB 3NQOA 1ZG1A 4DIQA 4L9NA 3LSPA 5CQEA 5CVIA 4A3MJ 1N77A 1MMAA 2E35A 4PJLA 3GCMA 4CCOA 4PSWA 4UV8A 3CJTB 1RNLA 3JRHA 2X85A 1ZLJA 3FXOA 3KYLA 2Y30A 1REPC 4IQJA 2ZB9A 2B7EA 1QNTA 3ZMSA 5EGOB 5BQTA 3ZXSA 3L2RA 2OQRA 1HOMA 1IDYA 2DMNA 1R1TA 2V6CA 5DM7F 1X58A 3JW4A 3Q9VA 2EFPA 4U0YA 1U8RA 5GPAA 2EV5A 4YEJA 2VPLA 3REOA 4M9XA 2K4JA 4UVCA 1SD6A 9ANTA 3ZRGA 1B9NA 2OV7A 5LHIA 3S1QJ 1K6YA 4CYCB 3LA7A 4FETA 1W36C 2M8EA 3F8MA 2DT5A 3MAJA 1FMVA 5EJCA 5LBQA 5HS7A 4PZJA 1YG2A 2DOEA 4M71A 3O3KA 2BV6A 2RKHA 1TZLA 5EDNA 3RQ4A 4W97A 4I7HA 2HTSA 3HRMA 1SD7A 1W4MA 3I55I 2XIGA 1FBQA 3BT9A 2KZGA 1TWGJ 5JFRA 2HVSA 2OA4A 4HQEA 3I4NJ 1EJ9A 3DTIA 3T8RA 1OISA 1IRXA 3KP4A 2NS8A 3P9IA 3P9CA 4CCNA 3I56I 4LLLA 2ZSIB 1U5TA 4Y7NJ 2VJ5A 3F72A 2W1OA 1S7OA 4BE2A 5CVVA 1ERDA 2UXNA 1QPIA 2RREA 3A01B 2FMYA 4HF2A 2CMPA 2XGCA 4PJNA 1WH7A 2K86A 3BZ6A 2L3DA 4PGGA 1D0YA 1WJDA 4XLAA 2Y48A 2DFEA 2E1MC 1A6QA 3V8KA 2BY1A 2ZXJA 4HOBA 2XAUA 4ZJZA 2LLKA 2BXYA 4PUSA 1WFXA 4DJAA 1IRGA 2VKVA 3H36A 1XSDA 4BQQA 2VXDA 1B4AA 1WRJA 2AO9A 3BQYA 2O0YA 2EILH 1N25A 3RPUA 1KQ9A 2R7TA 1T95A 1W0TA 3ZN0A 2E19A 5EEAA 2OTJI 1I3QJ 2G7UA 3DLAA 3ZMTA 3Q5FA 1X2MA 3N4MA 4A3EJ 2DT7B 2PFBA 1OR7A 2LFBA 2Q8KA 2L9RA 3S3MA 3HOYJ 1OYWA 4IKFA 1DP3A 2HXOA 5K5OA 2HOTA 4CH7A 4UXNA 4BL0B 1CQTA 1ENHA 1YOVB 3CQZJ 2ZXIA 3HTSB 3L2VA 4G9YA 5CLSA 2LNBA 3F8FA 2W82A 1VI0A 5FLMJ 3PNTA 2DW4A 3OY9A 3LL7A 3CUQB 4KIFA 3F6OA 1R4NB 3G73A 2R7RA 1IJWC 1QO0D 2Z3YA 3TQNA 3A02A 3BR5A 3RKYA 2A69F 2BY3A 3B73A 4NB5A 2HPMA 2HEOA 3VPRA 1P6RA 3BROA 5HNFA 2EFNA 3BLYA 1QZYA 1G3YA 2NYXA 4L9JA 2XASA 3MKWB 2KPMA 2P0WA 3QWLA 4XRSG 4F7ZA 4RGRA 3BTIA 2KP6A 4EATA 4HNVA 4FX0A 4GO1A 3I64A 1WZ2A 2MGQA 1LDJA 2R93J 2Y0MA 3LSRA 1TTYA 2G9WA 3DQVC 1ULYA 3H5NA 1BW5A 4HX8A 5ILVA 3HSFA 4G6QA 5KHDA 1U9NA 2EQRA 1F9NA 2DOFA 3M9AA 3CZ6A 2X0LA 5L3EA 3BWGA 4EM0B 1EA3A 4KUMA 2LK2A 2M2EA 2L4AA 3PQJA 5M5YJ 2MH2A 3OYDA 2QQ8A 2BY2A 1H9TA 1LDKB 2BW3B 3I59A 1YFHA 3OYAA 2BVLA 2ELJA 5LLQA 3AFHA 4I01A 1HDPA 2L4MA 4KN4X 2V9VA 2GXGA 2OAZA 3RDIA 4CDGA 3OYGA 1E3HA 1JKOC 3GTLJ 3IH3A 3WGIA 2X48A 2CO5A 3M8FA 5FD5A 4RB2C 3FXMA 1MNDA 5HLTA 4U7DA 1SFUA 1JE8A 2VONA 2K85A 2B63J 2OCCH 3JREA 4WXDA 2IGOA 1BOAA 4BAYA 2KLOA 5BMZA 1H0MA 2LG4A 4UY8I 2CFOA 2KRCA 1WQ2A 3GYHX 2YSRA 4YFXF 3NRVA 1OPCA 3M8JA 2R7XA 1TBXA 1MJ9A 5FROA 5J8FA 1BN5A 1ZR4A 4HSTA 1F43A 4WF2A 3X2QH 5EZGA 2DPUA 3AG2H 2JK3A 3DWLE 3M1CA 3K1MA 1AKHB 2CJJA 2P5VA 2VBZA 1VQOI 1H89C 2ESNA 1ZH5A 3MN2A 3NEUA 3HG9A 3K0LA 1TLHB 2DA5A 2EH3A 3CDLA 2GBYA 5LGNA 2FE3A 3G1LA 2ZXHA 4NHJA 3BG7A 4O3MA 2ID6A 3E0JB 2EV0A 2VODA 3F0CA 1HSTA 1FSHA 1XDSA 2CQXA 1KONA 1HCRA 3S3NA 4G12A 3MFKA 1CF7A 3FM5A 1XGMA 1OMIA 3HM5A 2EIMH 1UAAA 5K7FA 2BBYA 4UB8C 2LY9A 1APLC 2GM4A 1IF1A 4AYBN 2PMZA 3C2BA 1I6XA 3DEEA 1ETXA 1Z3YA 3L7WA 3F23A 3HYIA 4EV0A 3HIFA 1D8JA 2R0QC 1N75A 5F27A 1YRNA 2D5VA 1TWFJ 4C30A 2HVRA 4CHUA 2VC1A 4KYWA 3K10A 3DKXA 2OF7A 1HA8A 2BZTA 2EFOA 2W7NA 4A3JJ 4XOPA 3HBLA 3B6AA 1GUUA 2GA1A 4XSXF 4ASNA 3J80K 3KETA 2X6WA 4HPQA 2XPWA 3ERED 1X1CA 2ZO4A 1H9GA 3R60A 4N4NB 3GVAA 4JX5A 4A3LJ 2JA7J 4O5VA 3FMSA 1MH4A 4OMZA 4JK1X 1E3OC 1S7AA 2E7XA 4IHXA 3ZMVA 5KK1A 3GFMA 2DDAA 2KZVA 2J5PA 4QIWN 1C0WA 3LAPA 2WY8Q 5KAFC 2PLYA 5D4RA 3TO9A 2O3FA 1IDZA 3EPZA 2HI3A 1Y6IA 4F92B 3H3ZA 4RB1A 2X6XA 2KISA 3KP5A 2H09A 3RPUD 3WG9A 5FFZA 4G94A 2KFDA 2K5CA 5E79C 2EZLA 3CDHA 5FFXA 3JRDA 5D5WB 3K1NA 1FOWA 2HOAA 3J7AO 1Y39A 2F5EA 2LKPA 3HOXJ 4JBAA 5B5EC 4HG2A 2Y2ZA 3DKYA 4A6DA 5LHGA 3OSFA 3FDYA 4F52A 3IRRA 1TQPA 2XV4S 4XN0A 3T0YA 3VSKA 2HXIA 4Q5SF 1IRFA 3UKGA 5ICGA 5K7HA 2JA5J 2CV0A 2ICWG 4HA8A 4KMUX 2M5WA 2GZWA 1GT0C 5J40A 5DTDA 1LKXA 1TT5B 4RM2A 4Y15A 1LUJB 5ERIA 2HKOA 4XOTA 3ASNH 2XSDC 1TT0A 2DMTA 4Y3OA 3RTRA 3RYPA 1FP2A 2E7WA 3C18A 2M1BA 4LOCA 2KIFA 2L9NA 4XMYA 2WA0A 2MYSA 4ABZA 1V5FA 1VQ9I 2GLOA 2QSFX 3HUGA 1N78A 3H35A 3H9JA 4IOCF 1EH7A 4BEHB 5DCMA 4XRMA 3RQIA 3LSKA 3Q9SA 3MWMA 2M3AA 1Y8RB 3BG9A 2F4IA 4M72A 4BQOA 2R7FA 1ZKGA 3LSHA 1B59A 2HU9A 1X1DA 1YIJI 3L1PA 3MCZA 4DBRA 3OR1C 3D0SA 4P9UA 5EGOA 2IEKA 3L9FA 4NC7A 3S1NJ 3QP5A 3FHZA 4EJTA 1KYWA 4LG3A 3T1BA 1I6HJ 2JRMA 3GWZA 4EJVA 1ZRFA 4D7NA 4IVNA 4HYEA 3AL0B 4JOMA 1TWHJ 2DJNA 2ZFWA 3QODA 3RKWA 4I76A 2VQHA 2V1UA 1X3WB 4U88A 3FXJA 4I98B 2O9LA 2XRLA 1JHHA 1SANA 1RR7A 3E5XA 4N9HA 1Z21A 1E3PA 1Y1WJ 5FKOA 5HLIA 3CCQI 4BHBA 3QRFF 2P7CB 1Z3XA 1T33A 2KIQA 1QZZA 4S0HB 4D9JA 5HLGA 4XR6A 4ZDOA 1YYVA 2ZXWH 4LITA 5BPDA 2FD5A 2FXAA 2M9HA 2Y9YA 2DFFA 2NOJB 4XLEA 3A0HC 4LLNA 1Z6RA 2NAZA 1KGSA 3DPTA 5FKMA 1I3AA 3CMYA 4A3DJ 3MZ8A 5C44J 1P4WA 4OMYA 3HSEA 1HKSA 2FQ3A 1DU6A 3ONQA 1IGNA 3BR1A 2WB1N 2LBFA 3IP4B 2MABA 2HYJA 1KU9A 4MQ9F 4XLFA 3T8TA 3VFZA 3CESA 4KISA 2ISZA 4ETSA 1RKWA 1SD5A 1MBHA 1T6SA 2X1EA 2VC0A 2IS1A 4O6JA 3JRIA 3GLXA 3EUHC 2GIVA 2O8KA 1W5CC 1S8NA 3CO6C 3C7JA 1SAXA 2DQRA 2VUMJ 3CCMI 3KYDB 3OYJA 2XB5A 3K9TA 3S8PA 3GFIA 2AXLA 3GF2A 2M8GX 3WTWC 2R92J 4UB6C 3WHBA 4L18B 2EWNA 3CCYA 5E20A 4EM2A 3DTKA 5E3OA 1MBFA 3KP3A 3E6BA 1IUFA 2HQRA 3S15J 1AHDP 2F2EA 2EIKH 1D8KA 2AHQA 3BPXA 4LFUA 4A5MA 2EB7A 3G3ZA 1DU0A 1YRNB 5FKKA 5LHHA 4XRSA 3JAMK 3BPVA 3S2WA 5F6FA 1EV7A 2DJIA 4BJ6C 4A93J 5F0HA 4BY1J 3U1KA 3VOEA 4LJZF 3OS0A 2VT2A 2RQQA 2E1CA 3IWFA 2HNHA 2CUJA 5DD4A 2DI3A 2M87A 2VL8A 3WTSC 2FU4A 1Z0XA 2BHZA 4QWQA 2EK5A 3CUQA 1OLTA 1ETQA 4RAGA 2ACJA 1K83J 3FWEA 1W5TA 3GZ6A 1B72B 2L2OA 1Z77A 3AKZA 1O7LA 5DYMA 3KCCA 4JX4A 4YIIA 1GXQA 2I8DA 3NAUA 5J8CA 3CO7C 2NS0A 2ECBA 3LSGA 3QOPA 3ZPLA 2FNAA 5CQGA 3GO5A 2A61A 4H0EA 4OOIA 4RLQA 5E18F 3IRQA 3OYLA 4HLYA 4B8XA 5KVRA 1BA5A 4IXAA 2JVGA 3M7GA 2NVXJ 4S05A 4G7OF 5FJ8J 2HDCA 3K4KA 1W36D 1T38A 1CGPA 2Z16A 1Q1VA 1JGSA 1RETA 4BY7J 3QOEA 4ZTJA 3UNGC 4QSHA 3CLOA 4E7JA 4QPQA 3A4CA 1JUMA 1IXSB 1LNWA 3O8HA 1OYIA 3JSPA 2RVCA 3CC4I 4U87A 2XROA 4A69C 3WE3A 4EQQA 2NVYJ 2X4HA 4ESFA 1NK3P 2F4OB 1HW5A 2NNNA 4XN3A 1YE9A 3Q0VA 1USTA 4MFEA 4D5FA 2DPDA 1RZ4A 3K4MA 4Y17A 4MEXF 3ASOH 3TDZC 4A3CJ 2FUG2 2UXXA 3MD2A 5HVQC 1U8BA 1WSUA 1R4MB 1X3ZB 2IA1A 4DYCA 2XDVA 3GEZA 4QTRA 2LSOA 3FIWA 1U3EM 3VSLA 2XHKA 5F0FA 3HUGB 4EEFG 3JR9A 2WTEA 2PJPA 1LVAA 1ORKA 3K6GA 5DCMB 2E1MB 2OUMA 4RAFA 2O5RA 3U1DA 4W1UA 1U9OA 2FSWA 5B1BH 5JVTA 2PEXA 1SFEA 1TW3A 1EKEA 4DOZA 1D0ZA 3VDXA 2CQKA 3LSMA 1Z91A 3EUAA 3I53A 4UVAA 1ZG5A 2K27A 1PYVA 1BR2A 3SEQA 3VEPA 4MHGA 1L0OC 4BBRJ 3FHNA 1S29A 4ZYAA 4II3A 4F55A 4F91B 4XQFA 3A1YA 1SAUA 3P5JA 2MLKA 1X1PA 5F1JA 1FC3A 3JSOA 4G7ZF 1AKHA 2X1DA 3BG6A 5GAHJ 1VQ6I 1P2FA 3HRUA 1OYYA 3J80Z 4ENJA 1XGNA 1D5VA 3BJOA 3FXRA 3IL2A 3J7ZI 3ZN1A 3JTHA 2P5LC 5C4XJ 4XLCA 2IW5A 2L5QA 4XKVA 2QBYB 2LYCA 2BGCA 3FF5A 3M4OJ 3LOCA 1J7KA 5IT9K 5IP6A 1TWCJ 3BTCA 3I54A 4OWRB 1WWXA 2KRHA 4R1HA 1BJAA 1VF9A 1XMKA 2XGXA 1YHQI 1MNMC 4MEYF 2V26A 4M6YA 1DPUA 1E2XA 3CP2A 3R61A 4AYBA 3CJRB 2Q0OA 2JA6J 5TRDA 1UHWA 2HYGD 2DTZA 1BIAA 4V2GA 2A6TA 2RNGA 1OKRA 1T39A 4HX4A 2LBFB 5A2QK 1NG7A 1S5LC 1OCTC 2PG4A 2XRNA 4XNFA 2VBYA 4S04A 1WJBA 1QZEA 5DD8A 2VE8A 3TOBA 1BR4A 2E2JJ 5IPAA 1ZLKA 2DTRA 1ZGJA 3PUFA 2IBDA 3SJMA 2M45A 4ZDLA 2V1XA 2JUCA 2P4WA 1G4DA 2HDWA 1YJ9I 4XLNF 1UB9A 4FCYA 1TC3C 4CGZA 3CCUI 4A3BJ 5EZHA 1OFCX 1O3RA 2G0EA 5E3MA 2CH0A 1MSEC 2JMWA 4C3IJ 2K9SA 1D1BA 2DA4A 4F93B 4II2A 3WTZA 2HQ5A 2CRGA 5FKNA 5ICFA 3OYKA 5CVJA 2RAEA 2GXAA 2JTVA 1R6RA 2A5YB 1MMSA 1P9QC 1QHHD 3K4CA 4CICA 2Y9ZA 2YUSA 3SZTA 3QQAA 2HZDA 1FMWA 1Z67A 5DCFA 2ZNYA 1PP8F 1WJEA 2L7MP 3BCAA 2KIUA 2K02A 2OQGA 1XMXA 2HWVA 4OIPF 2IAIA 1B1BA 2Y31A 2OPTA 3U9GA 2HR3A 3L2UA 4UUVA 5JI6A 2R3SA 3IUOA 3TP3A 4AIDA 4PDKA 4YIFA 1ZHFA 2LREA 5HDKA 5K1YA 1F5TA 2CU7A 2FA5A 3GX4X 2DA6A 2KKOA 3F8NA 4RGXA 4NC8A 1VQ8I 1QHGA 1ZAOA 2F5CA 2DN0A 1K4SA 5M5WJ 2ELHA 3WHCA 3CF5F 1FNNA 2VQGA 3IHUA 1GDTA 2A6HF 3SZPA 4ENKA 1RUOA 3DTEA 3NWSA 3WGHA 1ETKA 2DA3A 4KICA 1MKMA 2M0CA 1XC5A 1WCMJ 1DGWY 1DPRA 2A68F 3CDIA 4HNUA 1O3TA 3IKTA 1ITYA 1VQLI 2W25A 5E1ZB 4BEHA 1ETOA 1SFXA 2LY1A 4J00A 2K40A 2LR8A 2W57A 3CCRI 2Z9OA 3JRGA 2WV0A 3JRFA 4Z6YA 1T56A 4IL6C 3ABTA 5FB2A 1ZRDA 3HOWJ 5ILUA 2DOAA 4M9SA 1ZN2A 2EZKA 2ZJPF 4IHVA 2QCOA 3GTKJ 1IC8A 2NS7A 3OIOA 5JHUA 2WBMA 2LF7A 3CMEI 1Y8QB 5J1UA 3DP7A 3HPGA 1VQ7I 3SEZA 1WGXA 2L9VA 1D1AA 1D5YA 4LG0A 3BOQA 4DNCA 4X1EA 4M3GA 2AQEA 2CW8A 3KE2A 5CVUA 2PMUA 2CQQA 1ZREA 3V8LA 2CGPA 4CCLA 4ZH4F 1OCCH 2E71A 4XBFA 2NNYA 3G6EI 3I0TA 1LB2A 1SEUA 1R23A 1BOBA 1GHCA 2OBPA 3HKZN 1J59A 4UNOA 2LC2A 4CO8A 2RV8A 4YFNF 3Q3SA 1ZGWA 4M3EA 1OQYA 1R1UA 1FBSA 1KZHA 1IN8A 2DA1A 2FEZA 4I6ZA 4E7KA 3E97A 3CF2A 2NRAC 3LFUA 1IV8A 1O57A 3IC7A 3ZQ7A 3JAMZ 1LEAA 3W2AA 3BC8A 1FIPA 2DODA 1YX3A 3P7NA 2KL4A 3DCFA 2XF6A 4I0AA 2N8GA 4XORA 3CCSI 3LFKA 1FP1D 3CCJI 1Y1VJ 3IWZA 5FRMA 4ON0A 3N97A 4QPOA 1R9TJ 1I5ZA 4X6AJ 4GDFA 5EF6A 3ESWB 2O8XA 2DYSH 4BGDA 4L0ZB 1R36A 3IAS2 1LE8B 3F8BA 5F64A 4HRIA 1TP4A 2PI0A 1R5ID 2DU9A 2E5NA 4WCGA 5BPIA 2YS9A 2DA7A 1MJBA 3ZMUA 2F6CA 3WTUC 2CV2A 1YJNI 4RB3C 1STZA 1IUYA 1TW2A 1HLVA 5HOOA 1ZELA 1WH5A 1I39A 3ELKA 3SFZA 3DU5A 4KN7X 5HS9A 2XAHA 1TQMA 2K4BA 4BS9A 1DDNA 5L3GA 2VOPA 5ICCA 3WU0A 1MGTA 2R4GA 3WG7H 2RDPA 1ZRCA 2E1NA 2QLZA 4KMFA 2DMQA 4AWXB 2IGNA 5GAGJ 2L9SA 2FNPA 1E17A 3H9GA 4OAZA 1IN6A 4M74A 3QU6A 1JGGA 4EM1A 2IXSA 4IHYA 2O61A 5GAEJ 4LGWA 3KLOA 3CP8A 1QA6A 1VNDA 4PJ0C 5GTHC 2HTJA 4FQGA 3OIQA 3L09A 4HNTA 3FMRA 3TMOA 2ADUA 4G6TB 4YRVA 1J0RA 2VASA 3WTXC 2VI6A 3ZGKA 3KP2A 4BXUA 4CYDA 3LA2A 4AVPA 4ANJA 2MLGA 2STWA 3HOSA 1OCOH 5E3LA 3JRCA 1B72A 3SHFA 2DFIA 1HW2A 1FBUA 1QPMA 2MC4A 3CUOA 3H9QA 4IQ4A 1DUXC 3J81K 2DXIA 2FJ1A 4DGWB 5IOYA 5AONA 4U0VA 2HQAA 1JUSA 2ME0A 3KYCB 4IOAF 3OYFA 2NXNB 5EYRA 1JXSA 2ZKZA 1YJWI 2QQBA 2H1LA 2V7FA 3O8GA 3FBIB 2VQLA 2R7VA 4KITB 1IW7F 1A6IA 2PQ8A 2Y75A 1K78A 2H27A 4ZZDA 2XPVA 3IH2A 2EPFA 3FX3A 3ECHA 4IPAA 2JA8J 2DBBA 2QA4I 4I09A 4YIRX 3W6KB 3IV5A 4AC0A 1Q1HA 2CQNA 2HS5A 3FKJA 3Q0UA 4MTDA 1OJLA 2OZ6A 5E17F 1P7IA 3FXLA 5DM6F 2QVOA 1R5HA 4L5JA 1Y56A 2M30A 5FLXK 4MTEA 3PIPF 2JPBA 4Z2YA 1HKQA 2JSCA 5JLXA 2KDZA 1G6NA 1IN7A 3KEQA 1GLNA 4AM3A 2XGEA 3K4BA 3GZNB 2DA2A 3K1PA 2M0MA 5LRRA 1R58A 1USSA 2B9SA 1IZ1A 2V9PA 1IXRC 4A12A 1FYKA 4LB6B 5IT9Z 3ZQGA 3K2ZA 3GFJA 1MJAA 5F04A 1XN7A 1FTTA 1YO5C 1J9IA 4WXCA 1YX5A 4PSXA 2NVQJ 3PO3J 2X51A 3VODA 5AIQA 1K79A 2DK5A 3DKWA 4A6EA 2UUZA 3LNQA 4BQAA 1JJ8C 3EYIA 5CJ9A 3BCBA 3DBRB 1X4PA 2P81A 1XX5A 2QSHX 2ISYA 4FTHA 1PUEE 1ETWA 3O2PE 2COBA 3QAHA 5C4JJ 2YU3A 2FBKA 3VYUB 4FASD 4Q4ZF 5LRSA 1ZYRF 3TGNA 5A2QZ 3L2CA 1RKTA 2ZJQF 2VKHA 4FISA 2KQRA 4D7MA 4M3FA 4LG0B 2K3FA 1RIOH 1U5TC 4HQMA 2LH9A 3I3LA 4A0XA 4IF4A 2TCTA 1TNSA 1X3UA 3E6MA 3ECOA 4FE7A 3ZQCA 1Z9CA 4PGHA 2IS2A 5IYCJ 2UZKA 2CUEA 2Y0SN 2GOMA 5H6RA 4ENMA 2QBYA 4XONA 1I27A 1ON2A 3QPHA 2EFQA 1XS9A 3M8EA 3T5XA 1VQ5I 5LD2C 4M6XA 1T08B 2DMUA 3OL4A 2IS4A 1X4OA 1T8IA 1WVRA 3GUDA 3KZYA 2P5KA 2K9MA 1FT9A 2MSYA 2XKOA 1MSFC 4GGGA 5L3DA 5IP9J 2VPRA 2VN2A 3F6VA 4GYIA 3C2HA 3HDDA 2F5DA 3BJAA 5HNHA 4KT5C 1SD4A 2E5ZA 1GV5A 1X1BA 3R0JA 1X19A 3SXYA 2ID3A 2BE5F 3OR2C 4PFOA 1BI1A 4P55A 2VKEA 4KIBA 4IEJA 1BM9A 2TDXA 3ULQB 4CZCA 4ZC3A 3ABMH 5J47A 3DU6A 4OAYA 2EZIA 4LIVA 2VLAA 2W48A 3TEDA 5KCMA 3SZGA 4HAMA 4G8XA 5LEKA 4M73A 1FY7A 4EVIA 3CJNA 1MMNA 4XICA 2V1DA 3EUKL 1ZQ3P 2IGMA 2HFHA 1UCRA 4HF0A 3K7AJ 4Y13A 2MG4A 5GP9A 5EG0A 1OCRH 4BJ5C 3CCVI 3AG3H 2LY2A 1WJ5A 1R5GA 5E1WA 1BR1A 4N9IA 3NWTA 5J3LA 1G3TA 2BYVE 4IRIA 4A2UA 2LOOA 1JT0A 5J1YA 2M4KA 5K5RA 3HOVJ 2Z99A 2EIJH 2STTA 1RI7A 1S7EA 5JHFA 2MD0A 3GFLA 1BIBA 1J75A 3N05A 5E8IA 3HRTA 1QBJA 2BXZA 1G59A 3TW6A 4A3IJ 2AS5F 4ITVA 2H6CA 1U78A 4ZTFA 3I4PA 4RGSA 1LVKA 1MBGA 4V19K 1D3YA 3I4MJ 1FEXA 3D5RC 1SVOA 1D0XA 1YLFA 3HGYA 1EF4A 2ETHA 5DUKA 4KIGA 3MKZA 3SYTA 1FOYA 4KJZA 1RRJA 2KMUA 3SDBA 4BKXA 3IH4A 4EJUA 2HOSA 2CSOA 1XMAA 4A0ZA 3AL0C 1ETYA 3FM3A 3GXOA 1BC7C 1OCPA 3PNVA 5JVGF 2VIXA 1TWAJ 2BHYA 2Z2SB 3KX2A 1VTNC 2B0LA 1IRZA 3FISA 5D6EA 4P1WA 4R8HA 2KHMA 1EH6A 3KFWX 1TNTA 3WTYC 4XIDA 1K61A 1HF0A 2M34A 3DV8A 3MVPA 3HOZJ 1KA8A 1RR8C 3CTAA 4BXXJ 1X1AA 1K78B 1MD0A 3S1RJ 5E1XA 1EH8A 4G7HF 2JA2A 3CCLI 1XCBA 5CYVA 5D6FA 2KT0A 2L0KA 2LF8A 3H0GJ 3E7LA 3FXUA 1Z7UA 5FD6A 3R6SA 5M3FJ 5TGTA 1SFKA 3MZHA 1V5EA 1XSVA 5B1AH 3BR6A 4JQFA 2OD5A 2Z5UA 1K6OA 5F08A 2ME6A 3BR0A 4RBOA 4MLOA 1WI9A 2A3SA 1DQUA 3H1CA 2DMPA 2PJRA 3J7AY 2JWTA 1U6GA 4UUTA 2HVQA 1XCVA 3H0DA 2H8RA 2KJBA 2GAUA 5ILSA 4BJTA 1UG2A 4ESBA 2XPUA 4BHPA 3ZQFA 3H92A 1O3QA 2JJ7A 2EA4A 2V79A 3LSIA 3PSIA 1V54H 3ZQLA 1O3SA 3K70C 3OOUA 2XF5A 2WAQN 3HKZA 4XKCA 3GTQJ 3FK6A 3AG4H 1W7PB 4KNYA 3RYRA 2M7AA 2XF7A 1WKMA 4XM3A 1WJAA 1W7PD 5D5XB 2CS3A 3ABLH 4E7IA 2GWRA 2E36A 4LK0F 1JTYA 1BL0A 1TL8A 1QRYA 4ENNA 2P6TA 1P92A 2IJLA 5DS9A 4OIQF 4WXHA 3HB9A 2ELKA 1YS6A 2QENA 3RIRA 4A5NA 1VQKI 4I2OA 2RQPA 2FX0A 2TRTA 2QF7A 3PM1A 4GFBA 3FK7A 2A5WA 3GTOJ 1MBJA 3TO7A 5EEHA 2RNJA 1NH3A 5LGTA 4RAZA 1KU3A 3D5LA 2XKPA 2J5OA 4HEA2 3LAJA 2A07F 5KNLA 2DDBA 3CJQB 4NDLA 4J19A 5DDGA 4YG2F 4B4CA 5DUIA 4IO9F 3ABUA 1B6AA 4E4HA 4LIUA 4A3GJ 3CCEI 3FXQA 1LE8A 1VZ0A 2R7SA 2L7FP 3GTMJ 2NVUB 1KU7A 2W84A 5F1RA 3BP8A 2M7BA 2W24A 4M3BA 4DQ2A 4HLXA 1J09A 1HW1A 5IYBJ 4CUGA 3F3XA 4LD5A 3OMYA 5EEGA 2JZYA 3HTUA 3R0AA 4N0BA 4RM3A 2PX9A 3MEXA 3C3WA 2Z1DA 1XTAA 4XLHA 3OYBA 2XAGA 5ICEA 2BOLA 2ZMEC 3J81Z 3JRAA 1B8IB 2D1HA 1YQAA 1YW7A 5HDNA 5IP7J 1RUNA 1KU2A 3ABKH 3PNYA 2QEXI 4MFDA 5TJJA 2CUZA 1ON1A 3E6CC 2ZSHB 1R7JA 3EYYA 4PFPA 5D5UB 5J4YA 3S1MJ 1J2XA 1MBKA 1LFPA 4HX7A 2V6EA 2VJJA 1V4RA 4CCJA 3ZR8X 3BG3A 3CLQA 1BI0A 2D45A 1I50J 2VB6A 3E6DA 1QQIA 3ZQQA 3V7SA 3WE2A 4CA0A 1FIAA 3ERMA 3V4GA 3L2WA 1NK2P 2D2WA 2ZJ2A 4XSZF 3G71I 2IGKA 2AQFA 2KJCA 3QPLA 2IVMA 2VT3A 4ZYHA 5L3FA 4E7SA 5FLXZ 2OU2A 5EG0B 4M6VA 4WWCA 3BR2A 1AWCA 4DBQA 3W3CA 1AA7A 2D1VA 4RS8A 3RZDJ 5K7ZA 1BI2A 1MIJA 1Y0NA 4GRIA 4L5IA 2EA2A 2C6YA 1D1CA 2F48A 4HW0A 2HQNA 3H3UA 2RGVA 1P7JA 3TBIA 3RI4A 2W00A 1JUPA 1F4KA 2YR2A 1F1ZA 3PUBA 3BQZA 1J5YA 3GBGA 1WHUA 3FBNB 2CV1A 3V7CA 3OYCA 2K9LA 2FOWA 3W6VA 2A05A 4UVBA 3EDPA 3V42A 3AG1H 2NVTJ 3C2GA 3FZVA 2IS6A 3VYRB 3LMMA 4P96A 5FKLA 5J1RA 1XB4A 2DO7A 2HOEA 5LGUA 2H6BA 2IP2A 1I1SA 3CC7I 1FOKA 4P9FA 1GV2A 2FBHA 2P7VB 4B09A 3K4LA 3G1MA 3IKVA 1UG0A 1E0EA 1P4AA 3O6BB 3HHHA 1MBEA 3F21A 4IHWA 5GPCA 3M07A 4Y4RA 2XAFA 4LK1F 5GTIC 5L3CA 1G8XA 1XDUA 5JLWA 2FQ4A 2E2HJ 3FXKA 3EUHA 1R49A 1PP7U 2XAJA 2YX7A 3WTTC 4KFCA 5J6XA 3QPSA
chains in the Genus database with same CATH topology
5E3LA 2WB1N 3JRCA 1B72A 2E1OA 2HYJA 3JRHA 3ZOBA 3OSGA 1RKWA 2FJ1A 5IOYA 1BW6A 1MBHA 2Y30A 3RKQA 4A3FJ 2ZB9A 1JUSA 2ME0A 3JRIA 2O8KA 5EGOB 3S17J 5EYRA 2VUMJ 1HOMA 1IDYA 1QVTA 2DMNA 2XB5A 3O8GA 1X58A 2M8GX 4C2MJ 2R92J 1G2HA 3WHBA 1A6IA 3CCYA 5GPAA 2XPVA 3IH2A 5E3OA 1MBFA 1IUFA 4FE4A 2NOGA 2JA8J 3S15J 1AHDP 3GTPJ 2AHQA 3IV5A 9ANTA 1YRNB 4AC0A 1DU0A 5FKKA 4XRSA 2R5YB 3Q0UA 5IOZA 4CYCB 3S1QJ 1OJLA 1QVUA 1P7IA 4A93J 1FJLA 5F0HA 2WV1A 4BY1J 4DZJA 5EDNA 4W97A 5JLXA 2KDZA 2R5ZA 1WPKA 2XGEA 1PUFB 3GTGJ 2DA2A 1Z0XA 3BT9A 1TWGJ 3MKLA 4MIMA 3S16J 3I4NJ 1ETQA 1K83J 3ZQGA 5F04A 3LSJA 4DYRA 1FTTA 1B72B 1Z77A 2NS8A 2YU9J 2NVQJ 3PO3J 4JX4A 4M3DA 3NAUA 4Y7NJ 2ECBA 3LNQA 3LSGA 1JJ8C 1QPIA 2P81A 3A01B 4RDUA 4FTHA 1ETWA 2COBA 2CUFA 2XGCA 5C4JJ 1BA5A 1WH7A 1POGA 2NVXJ 5FJ8J 1Q1VA 1RKTA 4FISA 1RETA 4BY7J 4D7MA 4M3FA 4QSHA 2LLKA 1JUMA 2TCTA 3HOUJ 2VKVA 3O8HA 2AO9A 3BQYA 4FE7A 3ZQCA 4A69C 4UUSA 2NVYJ 1NK3P 5IYCJ 1W0TA 2CUEA 2E19A 2Y0SN 5EEAA 3Q0VA 1I3QJ 1X2MA 4MFEA 4A3EJ 2LFBA 3HOYJ 2L9RA 4D5FA 3HEFA 1XS9A 2HXOA 2HOTA 3DEWA 1CQTA 2DMUA 1ENHA 4A3CJ 3CQZJ 1U8BA 5FLMJ 1VI0A 4DYCA 2MSYA 4QTRA 1MSFC 3FIWA 5F0FA 1W0UA 5IP9J 2VPRA 4EEFG 3JR9A 1IJWC 3K2AA 1ORKA 3HDDA 3A02A 3BR5A 4W1UA 1U9OA 3S2HJ 3SDGA 1GV5A 2ID3A 3VPRA 2LD5A 3JRBA 2VKEA 4IEJA 4JX6A 1IV6A 4XRSG 2EZIA 2W48A 3BTIA 3TEDA 4XK4A 4BBRJ 3S2DJ 4HNVA 3S14J 1HDDC 2MW8A 2MGQA 4XICA 5F1JA 2R93J 1AKHA 3LSRA 1JTXA 1ZQ3P 3K7AJ 1BW5A 2MG4A 5GP9A 5EG0A 1U9NA 2EQRA 5C4XJ 5J3LA 4JYKA 1JT0A 5M3MJ 5J1YA 2LK2A 2M2EA 4BBSJ 3M4OJ 2X9DA 3LOCA 3HOVJ 5IP6A 1S7EA 1TWCJ 3BTCA 1X2NA 5M5YJ 1JT6A 1VF9A 1JKQC 4DW6A 1MNMC 3TW6A 4A3IJ 3D1NI 1NTCA 2JA6J 1U78A 1HDPA 2DTZA 3BG5A 1MBGA 1JKOC 3GTLJ 3IH3A 4AUXA 3I4MJ 2EZHA 2X48A 1FEXA 4V2GA 3HGYA 1JKRC 1EF4A 1LFUP 1SFOJ 2B63J 4BKXA 3JREA 3IH4A 1OCTC 3ZQHA 2HOSA 1ETYA 1JJ6C 2LTPA 1OCPA 2I10A 1JKPC 1TWAJ 5IPAA 1GVDA 2E2JJ 1IRZA 2IBDA 3SJMA 3FISA 4B1RA 3ZQIA 1ZR4A 4FCYA 3BR3A 1F43A 1TC3C 5EZGA 1K61A 4XIDA 2JK3A 1HF0A 4A3BJ 2M34A 3MVPA 2L7ZA 3HOZJ 4BXXJ 1AKHB 2CJJA 1OFCX 5EZHA 2G0EA 1H89C 5E3MA 1MSEC 3MN2A 1ZTRA 2JMWA 4C3IJ 3BTLA 4DZPA 2K9SA 2DA4A 3S1RJ 2LP0A 2DA5A 4JP0A 2EH3A 5FLVA 4DYQA 2LVSA 3CDLA 2GBYA 2HQ5A 3G1LA 4Y52J 2CRGA 1WI3A 5FKNA 2KT0A 2L0KA 2ID6A 3H0GJ 3E7LA 2EBIA 2RAEA 5M3FJ 2Y9ZA 3F0CA 2YUSA 3BR6A 2CQXA 3QQAA 4L5EA 1HCRA 4G12A 4C3JJ 2K9QA 5F08A 2ME6A 3BR0A 4RBOA 3HM5A 2L7MP 4MLOA 2R5ZB 5K7FA 2LY9A 1APLC 2GM4A 4AYBN 2DMPA 2IAIA 3C2BA 5F0CA 2JWTA 4UUTA 1ETXA 2Y31A 2OPTA 1B8IA 2R0QC 2H8RA 4MO7A 5F27A 1UG2A 1YRNA 1TWFJ 3HGGA 2XPUA 2D5VA 3ZQFA 3TP3A 2JJ7A 4CYCA 2K9NA 2CU7A 4D5CA 3ZQLA 4V2FA 2DA6A 3TW7A 2OF7A 3OOUA 2WAQN 3GTQJ 3FK6A 4A3JJ 3NARA 2DN0A 3B6AA 1GUUA 3HBLA 5M5WJ 3WHCA 1GDTA 2E2IJ 2XPWA 1AU7A 1JTYA 4JX5A 1O4XA 2JN6A 4A3LJ 1BL0A 1ETKA 2JA7J 1QRYA 2DA3A 1MH4A 5HODA 5DS9A 2M0CA 1XC5A 1WCMJ 1E3OC 2ECCA 4IHXA 2XB0X 3HB9A 2ELKA 1ITYA 4QIWN 1ETVA 3A03A 3M3YJ 3PO2J 2FX0A 2TRTA 1ETOA 2QF7A 3PM1A 3FK7A 4GFBA 3GTOJ 1MBJA 2K40A 2LR8A 3JRGA 3JRFA 1T56A 5BNGA 1IDZA 3HOWJ 4NDLA 3SFIA 4J19A 4UUSB 2HI3A 4B4CA 3H3VK 2EZKA 4A3GJ 4IHVA 2QCOA 1ZR2A 1LE8A 3GTKJ 3A01A 1IC8A 2NS7A 2L7FP 3GTMJ 3OIOA 1H8AC 4C3HJ 2EZLA 4M3BA 3JRDA 3BTJA 5J1UA 5IYBJ 2HOAA 1RESA 1WGXA 3HOXJ 1VFCA 1D5YA 2Y2ZA 2PMZN 3OSFA 4X1EA 4M3GA 3JRAA 1B8IB 2HXIA 4A3KJ 1H88C 2CQQA 3UKGA 2R7ZJ 5IP7J 5K7HA 2JA5J 2XGDA 4MFDA 1GT0C 5DTDA 3FKIJ 2LKXA 3HKZN 1LFBA 2XSDC 2DMTA 3GTJJ 2HDDA 3S1MJ 5C3EJ 3Q3SA 1ZGWA 4M3EA 1MBKA 1UHSA 3BG3A 4LOCA 1RPWA 3TP0A 1I50J 2DA1A 4I6ZA 5E3NA 4ABZA 1FIAA 1NK2P 1FTZA 2GLOA 1FIPA 3QPLA 3DCFA 2N8GA 1BJZA 4XRMA 3RQIA 1Y1VJ 5EG0B 4M6VA 3BR2A 1R9TJ 4B3AA 3BG9A 4X6AJ 5EF6A 5IYDJ 1ZKGA 2H1KA 5M5XJ 3RZDJ 3L1PA 1LE8B 5K7ZA 1UMQA 5EGOA 2IEKA 3S1NJ 2YS9A 2DA7A 1I6HJ 1P7JA 1JUPA 4D7NA 3G1OA 1HLVA 1WH5A 3BQZA 1ZK8A 1TWHJ 1XG1A 3GBGA 2DJNA 3RZOJ 4I76A 3W6VA 2O9LA 2XRLA 1SANA 1F36A 1RR7A 2NVTJ 2DMQA 1Y1WJ 5FKOA 5FKLA 5J1RA 1T33A 1IG7A 2R5YA 3Q0WA 4S0HB 1A5JA 1GV2A 1JGGA 3G1MA 2FD5A 2M9HA 2Y9YA 4IHYA 1MBEA 4IHWA 5GPCA 1VNDA 5FKMA 3CMYA 5JLWA 4A3DJ 2FQ4A 2O7OA 5C44J 1PUFA 2E2HJ 1MH3A 2X6OA 2VI6A 3B6CA 3LSPA 1DU6A 4A3MJ 1IGNA 3QPSA 3BR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3L A;  2WB1 N;  3JRC A;  1B72 A;  2E1O A;  2HYJ A;  3JRH A;  3ZOB A;  3OSG A;  1RKW A;  2FJ1 A;  5IOY A;  1BW6 A;  1MBH A;  2Y30 A;  3RKQ A;  4A3F J;  2ZB9 A;  1JUS A;  2ME0 A;  3JRI A;  2O8K A;  5EGO B;  3S17 J;  5EYR A;  2VUM J;  1HOM A;  1IDY A;  1QVT A;  2DMN A;  2XB5 A;  3O8G A;  1X58 A;  2M8G X;  4C2M J;  2R92 J;  1G2H A;  3WHB A;  1A6I A;  3CCY A;  5GPA A;  2XPV A;  3IH2 A;  5E3O A;  1MBF A;  1IUF A;  4FE4 A;  2NOG A;  2JA8 J;  3S15 J;  1AHD P;  3GTP J;  2AHQ A;  3IV5 A;  9ANT A;  1YRN B;  4AC0 A;  1DU0 A;  5FKK A;  4XRS A;  2R5Y B;  3Q0U A;  5IOZ A;  4CYC B;  3S1Q J;  1OJL A;  1QVU A;  1P7I A;  4A93 J;  1FJL A;  5F0H A;  2WV1 A;  4BY1 J;  4DZJ A;  5EDN A;  4W97 A;  5JLX A;  2KDZ A;  2R5Z A;  1WPK A;  2XGE A;  1PUF B;  3GTG J;  2DA2 A;  1Z0X A;  3BT9 A;  1TWG J;  3MKL A;  4MIM A;  3S16 J;  3I4N J;  1ETQ A;  1K83 J;  3ZQG A;  5F04 A;  3LSJ A;  4DYR A;  1FTT A;  1B72 B;  1Z77 A;  2NS8 A;  2YU9 J;  2NVQ J;  3PO3 J;  4JX4 A;  4M3D A;  3NAU A;  4Y7N J;  2ECB A;  3LNQ A;  3LSG A;  1JJ8 C;  1QPI A;  2P81 A;  3A01 B;  4RDU A;  4FTH A;  1ETW A;  2COB A;  2CUF A;  2XGC A;  5C4J J;  1BA5 A;  1WH7 A;  1POG A;  2NVX J;  5FJ8 J;  1Q1V A;  1RKT A;  4FIS A;  1RET A;  4BY7 J;  4D7M A;  4M3F A;  4QSH A;  2LLK A;  1JUM A;  2TCT A;  3HOU J;  2VKV A;  3O8H A;  2AO9 A;  3BQY A;  4FE7 A;  3ZQC A;  4A69 C;  4UUS A;  2NVY J;  1NK3 P;  5IYC J;  1W0T A;  2CUE A;  2E19 A;  2Y0S N;  5EEA A;  3Q0V A;  1I3Q J;  1X2M A;  4MFE A;  4A3E J;  2LFB A;  3HOY J;  2L9R A;  4D5F A;  3HEF A;  1XS9 A;  2HXO A;  2HOT A;  3DEW A;  1CQT A;  2DMU A;  1ENH A;  4A3C J;  3CQZ J;  1U8B A;  5FLM J;  1VI0 A;  4DYC A;  2MSY A;  4QTR A;  1MSF C;  3FIW A;  5F0F A;  1W0U A;  5IP9 J;  2VPR A;  4EEF G;  3JR9 A;  1IJW C;  3K2A A;  1ORK A;  3HDD A;  3A02 A;  3BR5 A;  4W1U A;  1U9O A;  3S2H J;  3SDG A;  1GV5 A;  2ID3 A;  3VPR A;  2LD5 A;  3JRB A;  2VKE A;  4IEJ A;  4JX6 A;  1IV6 A;  4XRS G;  2EZI A;  2W48 A;  3BTI A;  3TED A;  4XK4 A;  4BBR J;  3S2D J;  4HNV A;  3S14 J;  1HDD C;  2MW8 A;  2MGQ A;  4XIC A;  5F1J A;  2R93 J;  1AKH A;  3LSR A;  1JTX A;  1ZQ3 P;  3K7A J;  1BW5 A;  2MG4 A;  5GP9 A;  5EG0 A;  1U9N A;  2EQR A;  5C4X J;  5J3L A;  4JYK A;  1JT0 A;  5M3M J;  5J1Y A;  2LK2 A;  2M2E A;  4BBS J;  3M4O J;  2X9D A;  3LOC A;  3HOV J;  5IP6 A;  1S7E A;  1TWC J;  3BTC A;  1X2N A;  5M5Y J;  1JT6 A;  1VF9 A;  1JKQ C;  4DW6 A;  1MNM C;  3TW6 A;  4A3I J;  3D1N I;  1NTC A;  2JA6 J;  1U78 A;  1HDP A;  2DTZ A;  3BG5 A;  1MBG A;  1JKO C;  3GTL J;  3IH3 A;  4AUX A;  3I4M J;  2EZH A;  2X48 A;  1FEX A;  4V2G A;  3HGY A;  1JKR C;  1EF4 A;  1LFU P;  1SFO J;  2B63 J;  4BKX A;  3JRE A;  3IH4 A;  1OCT C;  3ZQH A;  2HOS A;  1ETY A;  1JJ6 C;  2LTP A;  1OCP A;  2I10 A;  1JKP C;  1TWA J;  5IPA A;  1GVD A;  2E2J J;  1IRZ A;  2IBD A;  3SJM A;  3FIS A;  4B1R A;  3ZQI A;  1ZR4 A;  4FCY A;  3BR3 A;  1F43 A;  1TC3 C;  5EZG A;  1K61 A;  4XID A;  2JK3 A;  1HF0 A;  4A3B J;  2M34 A;  3MVP A;  2L7Z A;  3HOZ J;  4BXX J;  1AKH B;  2CJJ A;  1OFC X;  5EZH A;  2G0E A;  1H89 C;  5E3M A;  1MSE C;  3MN2 A;  1ZTR A;  2JMW A;  4C3I J;  3BTL A;  4DZP A;  2K9S A;  2DA4 A;  3S1R J;  2LP0 A;  2DA5 A;  4JP0 A;  2EH3 A;  5FLV A;  4DYQ A;  2LVS A;  3CDL A;  2GBY A;  2HQ5 A;  3G1L A;  4Y52 J;  2CRG A;  1WI3 A;  5FKN A;  2KT0 A;  2L0K A;  2ID6 A;  3H0G J;  3E7L A;  2EBI A;  2RAE A;  5M3F J;  2Y9Z A;  3F0C A;  2YUS A;  3BR6 A;  2CQX A;  3QQA A;  4L5E A;  1HCR A;  4G12 A;  4C3J J;  2K9Q A;  5F08 A;  2ME6 A;  3BR0 A;  4RBO A;  3HM5 A;  2L7M P;  4MLO A;  2R5Z B;  5K7F A;  2LY9 A;  1APL C;  2GM4 A;  4AYB N;  2DMP A;  2IAI A;  3C2B A;  5F0C A;  2JWT A;  4UUT A;  1ETX A;  2Y31 A;  2OPT A;  1B8I A;  2R0Q C;  2H8R A;  4MO7 A;  5F27 A;  1UG2 A;  1YRN A;  1TWF J;  3HGG A;  2XPU A;  2D5V A;  3ZQF A;  3TP3 A;  2JJ7 A;  4CYC A;  2K9N A;  2CU7 A;  4D5C A;  3ZQL A;  4V2F A;  2DA6 A;  3TW7 A;  2OF7 A;  3OOU A;  2WAQ N;  3GTQ J;  3FK6 A;  4A3J J;  3NAR A;  2DN0 A;  3B6A A;  1GUU A;  3HBL A;  5M5W J;  3WHC A;  1GDT A;  2E2I J;  2XPW A;  1AU7 A;  1JTY A;  4JX5 A;  1O4X A;  2JN6 A;  4A3L J;  1BL0 A;  1ETK A;  2JA7 J;  1QRY A;  2DA3 A;  1MH4 A;  5HOD A;  5DS9 A;  2M0C A;  1XC5 A;  1WCM J;  1E3O C;  2ECC A;  4IHX A;  2XB0 X;  3HB9 A;  2ELK A;  1ITY A;  4QIW N;  1ETV A;  3A03 A;  3M3Y J;  3PO2 J;  2FX0 A;  2TRT A;  1ETO A;  2QF7 A;  3PM1 A;  3FK7 A;  4GFB A;  3GTO J;  1MBJ A;  2K40 A;  2LR8 A;  3JRG A;  3JRF A;  1T56 A;  5BNG A;  1IDZ A;  3HOW J;  4NDL A;  3SFI A;  4J19 A;  4UUS B;  2HI3 A;  4B4C A;  3H3V K;  2EZK A;  4A3G J;  4IHV A;  2QCO A;  1ZR2 A;  1LE8 A;  3GTK J;  3A01 A;  1IC8 A;  2NS7 A;  2L7F P;  3GTM J;  3OIO A;  1H8A C;  4C3H J;  2EZL A;  4M3B A;  3JRD A;  3BTJ A;  5J1U A;  5IYB J;  2HOA A;  1RES A;  1WGX A;  3HOX J;  1VFC A;  1D5Y A;  2Y2Z A;  2PMZ N;  3OSF A;  4X1E A;  4M3G A;  3JRA A;  1B8I B;  2HXI A;  4A3K J;  1H88 C;  2CQQ A;  3UKG A;  2R7Z J;  5IP7 J;  5K7H A;  2JA5 J;  2XGD A;  4MFD A;  1GT0 C;  5DTD A;  3FKI J;  2LKX A;  3HKZ N;  1LFB A;  2XSD C;  2DMT A;  3GTJ J;  2HDD A;  3S1M J;  5C3E J;  3Q3S A;  1ZGW A;  4M3E A;  1MBK A;  1UHS A;  3BG3 A;  4LOC A;  1RPW A;  3TP0 A;  1I50 J;  2DA1 A;  4I6Z A;  5E3N A;  4ABZ A;  1FIA A;  1NK2 P;  1FTZ A;  2GLO A;  1FIP A;  3QPL A;  3DCF A;  2N8G A;  1BJZ A;  4XRM A;  3RQI A;  1Y1V J;  5EG0 B;  4M6V A;  3BR2 A;  1R9T J;  4B3A A;  3BG9 A;  4X6A J;  5EF6 A;  5IYD J;  1ZKG A;  2H1K A;  5M5X J;  3RZD J;  3L1P A;  1LE8 B;  5K7Z A;  1UMQ A;  5EGO A;  2IEK A;  3S1N J;  2YS9 A;  2DA7 A;  1I6H J;  1P7J A;  1JUP A;  4D7N A;  3G1O A;  1HLV A;  1WH5 A;  3BQZ A;  1ZK8 A;  1TWH J;  1XG1 A;  3GBG A;  2DJN A;  3RZO J;  4I76 A;  3W6V A;  2O9L A;  2XRL A;  1SAN A;  1F36 A;  1RR7 A;  2NVT J;  2DMQ A;  1Y1W J;  5FKO A;  5FKL A;  5J1R A;  1T33 A;  1IG7 A;  2R5Y A;  3Q0W A;  4S0H B;  1A5J A;  1GV2 A;  1JGG A;  3G1M A;  2FD5 A;  2M9H A;  2Y9Y A;  4IHY A;  1MBE A;  4IHW A;  5GPC A;  1VND A;  5FKM A;  3CMY A;  5JLW A;  4A3D J;  2FQ4 A;  2O7O A;  5C44 J;  1PUF A;  2E2H J;  1MH3 A;  2X6O A;  2VI6 A;  3B6C A;  3LSP A;  1DU6 A;  4A3M J;  1IGN A;  3QPS A;  3BR1 A; 
#chains in the Genus database with same CATH topology
 2KRF A;  3ZMD A;  4OU0 A;  2E1O A;  1P4X A;  3ZMZ A;  2XC7 A;  1MMG A;  3ZOB A;  5K5Q A;  3W2W A;  2JVH A;  1PDN C;  4BNC A;  2LRD A;  2DK8 A;  3OSG A;  1BW6 A;  3RKQ A;  4A3F J;  4XKW A;  1Y0U A;  2HYF A;  3S17 J;  3JTG A;  1FYM A;  1HKT A;  3GZ5 A;  1GVJ A;  1T0F C;  2R7O A;  1MZB A;  1IO2 A;  2DLL A;  1QVT A;  1KQ8 A;  1WJF A;  2ZFU A;  3QU3 A;  4C2M J;  5JR3 A;  1G2H A;  4HZF A;  4B3X A;  2O6G E;  3KEY A;  1SC7 A;  1G3W A;  1LPQ A;  1ZGA A;  2CWE A;  3H5R A;  2PJR B;  1OCZ H;  4I99 C;  5H6Q A;  4FE4 A;  1T2K A;  1FLI A;  2NOG A;  4U0W A;  3I5U A;  3GTP J;  5E8G A;  1MDM A;  4D0P A;  2CYY A;  3ZP5 A;  3ROU A;  3KPH A;  2IRF G;  1NHA A;  3CMM A;  5CVR A;  1U2W A;  2EJR A;  2R5Y B;  5IOZ A;  5DV5 A;  1HXD A;  3MQ0 A;  4HSR A;  1HQC A;  1QVU A;  1IXC A;  2H94 A;  2Y0S A;  4EGY A;  2IA0 A;  1FJL A;  2QKM B;  2WV1 A;  2R7U A;  4DZJ A;  3EET A;  2L54 A;  2OZU A;  1LEB A;  3M1E A;  3BY6 A;  2R5Z A;  3L2Q A;  2RC4 A;  5GAD J;  1WPK A;  1HBX G;  4B48 A;  4EMS A;  3GTG J;  1PUF B;  3TL4 X;  1Z7L A;  5D5V B;  3MKL A;  4MIM A;  5ED4 A;  3S16 J;  3LSJ A;  3H5A A;  5FGM A;  4DYR A;  3K4N A;  2YPR A;  4BYY A;  1YI2 I;  3KIO A;  2YU9 J;  3DXJ F;  3I9V 2;  4MQV A;  3OOP A;  4AU7 A;  2WB1 A;  2DYR H;  4M3D A;  1A31 A;  3B02 A;  5FRN A;  2P6S A;  3P9K A;  2AXT C;  4U7B A;  3HJE A;  3FMQ A;  2F5V A;  4BAC A;  2MFZ A;  3W2V A;  3RKX A;  4CCM A;  3I71 A;  3GME A;  4EJW A;  3DPU A;  3DF8 A;  3CUQ C;  4RDU A;  3OYN A;  2CUF A;  4HBL A;  1G3S A;  2IA2 A;  4YFK F;  3KZZ A;  5H2F C;  1POG A;  2L01 A;  4BQN A;  1M1E B;  1XD7 A;  4FX4 A;  1FZP B;  4IHS A;  2JPC A;  1ODD A;  5HS8 A;  4C2U A;  1FSE A;  2R7W A;  4GCV A;  4AVZ A;  1Z05 A;  3DBH B;  3MZY A;  5IY5 H;  2E34 A;  4GYG A;  4KT6 A;  1W1W E;  4B44 A;  3QYB A;  4PK4 A;  2ZCW A;  3HOU J;  1V55 H;  2ZBK A;  1BC8 C;  4NQW A;  4OIN F;  4H4K C;  3HL2 A;  5D4S A;  4UUS A;  4NNJ A;  3AAF A;  4IRG A;  1AOY A;  2Y69 H;  2HGC A;  3VYT B;  3LWF A;  4LLG F;  3SQN A;  1YIO A;  1YS7 A;  3HEF A;  3ISP A;  1B9M A;  4CSW A;  3DEW A;  1XSX A;  2FBI A;  1KYZ A;  2BY0 A;  2H8W A;  3QP6 A;  2RN7 A;  3TOA A;  2L7K A;  2O03 A;  1T98 A;  2QM3 A;  1O7F A;  1W0U A;  3K2A A;  2ZNZ A;  3S2H J;  3SDG A;  4AD9 A;  3E5U A;  3KP7 A;  1U5T B;  2VBW A;  3PL8 A;  4GXO A;  4BXF A;  4E7Z A;  2LD5 A;  6PAX A;  3HHG A;  2DT6 A;  1BI3 A;  3KP6 A;  4RMN A;  4K2E A;  5CPR B;  3JRB A;  4JX6 A;  4C2T A;  4FT8 A;  5IT3 A;  1IV6 A;  1SMY F;  2R7D A;  2VBX A;  2VJI A;  3QYE A;  1PJR A;  4XK4 A;  2DQL A;  3S14 J;  2ZJR F;  1HDD C;  3S2D J;  2EFW A;  2MBF A;  2MW8 A;  1JI8 A;  1UFM A;  2VQC A;  1JTX A;  2CW0 F;  1MW7 A;  4LB5 A;  1S9H A;  4AIH A;  2OCE A;  4CCK A;  1U0J A;  3S3O A;  1UEL B;  1BBY A;  2E60 A;  1HSJ A;  2ZME A;  4TV7 A;  1R00 A;  4JYK A;  4Q47 A;  3WGG A;  2CW7 A;  5M3M J;  1A04 A;  1XPX A;  4BDZ A;  3OYE A;  2MC3 A;  2X9D A;  4BBS J;  4NBQ A;  1R71 A;  1FPQ A;  2M4G A;  1X2N A;  1YW9 A;  2QYO A;  3IAM 2;  1JT6 A;  1JKQ C;  3K69 A;  4DW6 A;  3TKY A;  2HKX A;  2Q2E A;  2VOO A;  4EJO A;  1QU3 A;  3PSF A;  3D1N I;  1V5G A;  1NTC A;  3BZK A;  4BHC A;  2R7Q A;  3QYF A;  3V7R A;  2MH9 A;  2F4M B;  2JT1 A;  4NC6 A;  4AIJ A;  3BG5 A;  5KAI C;  1K4T A;  3CD6 I;  1IN5 A;  4HDU A;  4AUX A;  4X0G A;  3J7Y J;  2EZH A;  4XL9 A;  4AIK A;  2FML A;  3KZI C;  2LKS A;  4G6D A;  4NUB A;  1LFU P;  1JKR C;  3GW2 A;  1SFO J;  1KQ0 A;  2LDU A;  3RSN A;  1I1G A;  2GOX B;  1LDD A;  3HPH A;  4WX9 A;  3ZQH A;  2CFX A;  2WAQ A;  1YTY A;  2OC6 A;  1W7P A;  1JJ6 C;  2LTP A;  4XKB A;  2I10 A;  4P5O A;  1JKP C;  1GVD A;  1V3F A;  1R22 A;  3VYS B;  2PMH A;  4F3Q A;  4B1R A;  1XGS A;  2WAF A;  2JRT A;  3JCU C;  3ZQI A;  3BR3 A;  3S32 A;  4BE1 A;  1GXP A;  4IHT A;  4BE0 A;  4IX7 A;  2A6E F;  2L7Z A;  2VXZ A;  3V8J A;  1IN4 A;  5BOX A;  1Z1D A;  1ZTR A;  1MNE A;  2XSJ C;  3BTL A;  4DZP A;  1FYL A;  5FLV A;  2LP0 A;  4JP0 A;  3G4S I;  1JHF A;  4DYQ A;  1WJC A;  2LVS A;  2XVC A;  2QQ9 A;  2QKL B;  2W4S A;  2WAD A;  3OIP A;  1MDM B;  4CXF A;  4Y52 J;  1WI3 A;  2FOK A;  5LFA A;  5HDG A;  2COM A;  3PIO F;  4ESJ A;  2GQQ A;  2JSP A;  2HPI A;  2P8T A;  2EBI A;  2V1N A;  2V4J C;  3OYI A;  4ZYD A;  3E1S A;  4ZYG A;  4IJA A;  4LMY A;  4IZZ A;  4L5E A;  2GIZ A;  3R4K A;  3HOT A;  4C3J J;  2F5F A;  2K9Q A;  1S6L A;  1YIT I;  2R5Z B;  3QPT A;  5CKT A;  3RJP A;  3UR3 C;  3WOD F;  2JUG A;  3I59 B;  1VQP I;  5F0C A;  2GXB A;  3I58 A;  3CMA I;  3KLN A;  1B8I A;  4MGR A;  4MO7 A;  2KIM A;  4L9V A;  3RPQ A;  3HGG A;  3OYH A;  4C9Y A;  3PQK A;  2QUF A;  4BU2 A;  1VQN I;  4CYC A;  2K3P A;  2K9N A;  3COA C;  4D5C A;  1DGR M;  1OR7 C;  3ML6 A;  4V2F A;  3TW7 A;  5H20 A;  3DBL B;  4CZZ A;  1SVL A;  5AIP A;  3MKY B;  2XUB A;  3S93 A;  3NAR A;  4PJM A;  5B3S H;  4MNU A;  5FO5 A;  2PN6 A;  4E7H A;  4FHT A;  2E2I J;  1IAW A;  1AU7 A;  4M9Z A;  2W85 A;  3ZCO A;  5D8K B;  3F8C A;  4D1Q A;  4E70 A;  3E5Q A;  1O4X A;  2JN6 A;  1TQI A;  3LST A;  3K4J A;  3HXL A;  3GLL A;  5HOD A;  1T0F A;  2QQA A;  3G2B A;  2ECC A;  1A36 A;  2XB0 X;  1K7A A;  4PJJ A;  4E7L A;  2IT0 A;  1ETV A;  3A03 A;  3M3Y J;  3PO2 J;  2DCE A;  4A0Y A;  4EGZ A;  2QGU A;  4RA2 A;  3C1D A;  2ZC2 A;  3KEO A;  4ZZL A;  4N4O B;  2MA3 A;  4UV9 A;  2WWY A;  5BNG A;  4NQW B;  3W6J B;  1FX7 A;  3SFI A;  2DAO A;  4UUS B;  3OWT A;  3H3V K;  5B66 C;  3HRS A;  1ONV A;  2CG4 A;  4QLC U;  1ZR2 A;  3A01 A;  2FF4 A;  3HSR A;  4L9T A;  1H8A C;  2QZ8 A;  4C3H J;  5BS6 A;  1CF7 B;  1HC8 A;  1VQ4 I;  1XGO A;  3DPL C;  2OTL I;  3BTJ A;  3BZC A;  3F9K A;  3PFY A;  4KDP A;  3CC2 I;  1RES A;  3K70 D;  4OIO F;  1VFC A;  4IRH A;  3RCO A;  2ESH A;  2PMZ N;  2L02 A;  5D8L B;  3A0B C;  2XAQ A;  3D5S C;  2OJE D;  4A3K J;  1W5S A;  1H88 C;  3EQL F;  2R7Z J;  4RGU A;  1PVE A;  2UWM A;  2XGD A;  3PFI A;  5L3B A;  4UHT A;  4E6K G;  2GA2 A;  4HV6 A;  3TO6 A;  2WY7 Q;  3L00 A;  4I0B A;  1L3L A;  3FKI J;  4PCQ A;  3DLL F;  4BUP A;  2LKX A;  1LFB A;  4Y33 A;  2EV6 A;  3GTJ J;  2HDD A;  5C3E J;  2FRH A;  1UHS A;  1RC9 A;  1YW8 A;  3OL3 A;  2X6Y A;  2WC2 A;  4R79 A;  1RPW A;  2X1C A;  3TP0 A;  1A35 A;  1UJ8 A;  2MD5 A;  3BJ6 A;  3DEU A;  4RLF A;  5E3N A;  2UV1 A;  3LQQ A;  4ZDP A;  1FTZ A;  3HC7 A;  4OIR F;  4KA4 A;  5LEJ A;  3F22 A;  3HZJ A;  4I02 A;  2EIN H;  3OYM A;  1SMT A;  3OS1 A;  2KDO A;  1BJZ A;  1S3J A;  5TIS C;  3U2R A;  1Z6T A;  2LMD A;  2V9K A;  2Z33 A;  2JQ7 A;  1ZG3 A;  4L0Y B;  1FOX A;  3LA3 A;  3LQR A;  4BH9 A;  4B3A A;  5J4V A;  2QSG X;  2ZME B;  5IYD J;  1S72 I;  4Q48 A;  2H1K A;  3OV8 A;  5M5X J;  1R1V A;  2DFH A;  5DEQ A;  4XLP F;  3BDD A;  1UMQ A;  3MMY B;  3PJR A;  1UHM A;  1VQM I;  2I5U A;  2QWW A;  1FWZ A;  2BEO A;  4J01 A;  2Q2E B;  4RB0 A;  2VE9 A;  3G1O A;  4XRF A;  4WK8 F;  1ZK8 A;  1XG1 A;  2CQ7 A;  1LQ1 A;  3U21 A;  4B47 A;  3RZO J;  3VWB A;  3TDU C;  2PBI A;  1SVM A;  3WTV C;  1F36 A;  4HDV A;  3VB2 A;  1QGP A;  2G7H A;  2IPQ X;  2VJ4 A;  1IG7 A;  2R5Y A;  2YX4 A;  3WU1 B;  2VKD A;  3Q0W A;  1ACI A;  3WU2 C;  2K7L A;  4B43 A;  1A5J A;  1ZAR A;  3DFG A;  1LJ9 A;  2WAE A;  4YEL A;  3A2K A;  1MMD A;  1UZC A;  1DP7 P;  5HLH A;  3OS2 A;  4BDY A;  2BVM A;  3E3V A;  2BW3 A;  4RAY A;  1NG6 A;  2O7O A;  1PUF A;  4ZYE A;  4HV5 A;  2HZT A;  1MH3 A;  2X6O A;  3B6C A;  4HF1 A;  2Q1Z B;  3NQO A;  1ZG1 A;  4DIQ A;  4L9N A;  3LSP A;  5CQE A;  5CVI A;  4A3M J;  1N77 A;  1MMA A;  2E35 A;  4PJL A;  3GCM A;  4CCO A;  4PSW A;  4UV8 A;  3CJT B;  1RNL A;  3JRH A;  2X85 A;  1ZLJ A;  3FXO A;  3KYL A;  2Y30 A;  1REP C;  4IQJ A;  2ZB9 A;  2B7E A;  1QNT A;  3ZMS A;  5EGO B;  5BQT A;  3ZXS A;  3L2R A;  2OQR A;  1HOM A;  1IDY A;  2DMN A;  1R1T A;  2V6C A;  5DM7 F;  1X58 A;  3JW4 A;  3Q9V A;  2EFP A;  4U0Y A;  1U8R A;  5GPA A;  2EV5 A;  4YEJ A;  2VPL A;  3REO A;  4M9X A;  2K4J A;  4UVC A;  1SD6 A;  9ANT A;  3ZRG A;  1B9N A;  2OV7 A;  5LHI A;  3S1Q J;  1K6Y A;  4CYC B;  3LA7 A;  4FET A;  1W36 C;  2M8E A;  3F8M A;  2DT5 A;  3MAJ A;  1FMV A;  5EJC A;  5LBQ A;  5HS7 A;  4PZJ A;  1YG2 A;  2DOE A;  4M71 A;  3O3K A;  2BV6 A;  2RKH A;  1TZL A;  5EDN A;  3RQ4 A;  4W97 A;  4I7H A;  2HTS A;  3HRM A;  1SD7 A;  1W4M A;  3I55 I;  2XIG A;  1FBQ A;  3BT9 A;  2KZG A;  1TWG J;  5JFR A;  2HVS A;  2OA4 A;  4HQE A;  3I4N J;  1EJ9 A;  3DTI A;  3T8R A;  1OIS A;  1IRX A;  3KP4 A;  2NS8 A;  3P9I A;  3P9C A;  4CCN A;  3I56 I;  4LLL A;  2ZSI B;  1U5T A;  4Y7N J;  2VJ5 A;  3F72 A;  2W1O A;  1S7O A;  4BE2 A;  5CVV A;  1ERD A;  2UXN A;  1QPI A;  2RRE A;  3A01 B;  2FMY A;  4HF2 A;  2CMP A;  2XGC A;  4PJN A;  1WH7 A;  2K86 A;  3BZ6 A;  2L3D A;  4PGG A;  1D0Y A;  1WJD A;  4XLA A;  2Y48 A;  2DFE A;  2E1M C;  1A6Q A;  3V8K A;  2BY1 A;  2ZXJ A;  4HOB A;  2XAU A;  4ZJZ A;  2LLK A;  2BXY A;  4PUS A;  1WFX A;  4DJA A;  1IRG A;  2VKV A;  3H36 A;  1XSD A;  4BQQ A;  2VXD A;  1B4A A;  1WRJ A;  2AO9 A;  3BQY A;  2O0Y A;  2EIL H;  1N25 A;  3RPU A;  1KQ9 A;  2R7T A;  1T95 A;  1W0T A;  3ZN0 A;  2E19 A;  5EEA A;  2OTJ I;  1I3Q J;  2G7U A;  3DLA A;  3ZMT A;  3Q5F A;  1X2M A;  3N4M A;  4A3E J;  2DT7 B;  2PFB A;  1OR7 A;  2LFB A;  2Q8K A;  2L9R A;  3S3M A;  3HOY J;  1OYW A;  4IKF A;  1DP3 A;  2HXO A;  5K5O A;  2HOT A;  4CH7 A;  4UXN A;  4BL0 B;  1CQT A;  1ENH A;  1YOV B;  3CQZ J;  2ZXI A;  3HTS B;  3L2V A;  4G9Y A;  5CLS A;  2LNB A;  3F8F A;  2W82 A;  1VI0 A;  5FLM J;  3PNT A;  2DW4 A;  3OY9 A;  3LL7 A;  3CUQ B;  4KIF A;  3F6O A;  1R4N B;  3G73 A;  2R7R A;  1IJW C;  1QO0 D;  2Z3Y A;  3TQN A;  3A02 A;  3BR5 A;  3RKY A;  2A69 F;  2BY3 A;  3B73 A;  4NB5 A;  2HPM A;  2HEO A;  3VPR A;  1P6R A;  3BRO A;  5HNF A;  2EFN A;  3BLY A;  1QZY A;  1G3Y A;  2NYX A;  4L9J A;  2XAS A;  3MKW B;  2KPM A;  2P0W A;  3QWL A;  4XRS G;  4F7Z A;  4RGR A;  3BTI A;  2KP6 A;  4EAT A;  4HNV A;  4FX0 A;  4GO1 A;  3I64 A;  1WZ2 A;  2MGQ A;  1LDJ A;  2R93 J;  2Y0M A;  3LSR A;  1TTY A;  2G9W A;  3DQV C;  1ULY A;  3H5N A;  1BW5 A;  4HX8 A;  5ILV A;  3HSF A;  4G6Q A;  5KHD A;  1U9N A;  2EQR A;  1F9N A;  2DOF A;  3M9A A;  3CZ6 A;  2X0L A;  5L3E A;  3BWG A;  4EM0 B;  1EA3 A;  4KUM A;  2LK2 A;  2M2E A;  2L4A A;  3PQJ A;  5M5Y J;  2MH2 A;  3OYD A;  2QQ8 A;  2BY2 A;  1H9T A;  1LDK B;  2BW3 B;  3I59 A;  1YFH A;  3OYA A;  2BVL A;  2ELJ A;  5LLQ A;  3AFH A;  4I01 A;  1HDP A;  2L4M A;  4KN4 X;  2V9V A;  2GXG A;  2OAZ A;  3RDI A;  4CDG A;  3OYG A;  1E3H A;  1JKO C;  3GTL J;  3IH3 A;  3WGI A;  2X48 A;  2CO5 A;  3M8F A;  5FD5 A;  4RB2 C;  3FXM A;  1MND A;  5HLT A;  4U7D A;  1SFU A;  1JE8 A;  2VON A;  2K85 A;  2B63 J;  2OCC H;  3JRE A;  4WXD A;  2IGO A;  1BOA A;  4BAY A;  2KLO A;  5BMZ A;  1H0M A;  2LG4 A;  4UY8 I;  2CFO A;  2KRC A;  1WQ2 A;  3GYH X;  2YSR A;  4YFX F;  3NRV A;  1OPC A;  3M8J A;  2R7X A;  1TBX A;  1MJ9 A;  5FRO A;  5J8F A;  1BN5 A;  1ZR4 A;  4HST A;  1F43 A;  4WF2 A;  3X2Q H;  5EZG A;  2DPU A;  3AG2 H;  2JK3 A;  3DWL E;  3M1C A;  3K1M A;  1AKH B;  2CJJ A;  2P5V A;  2VBZ A;  1VQO I;  1H89 C;  2ESN A;  1ZH5 A;  3MN2 A;  3NEU A;  3HG9 A;  3K0L A;  1TLH B;  2DA5 A;  2EH3 A;  3CDL A;  2GBY A;  5LGN A;  2FE3 A;  3G1L A;  2ZXH A;  4NHJ A;  3BG7 A;  4O3M A;  2ID6 A;  3E0J B;  2EV0 A;  2VOD A;  3F0C A;  1HST A;  1FSH A;  1XDS A;  2CQX A;  1KON A;  1HCR A;  3S3N A;  4G12 A;  3MFK A;  1CF7 A;  3FM5 A;  1XGM A;  1OMI A;  3HM5 A;  2EIM H;  1UAA A;  5K7F A;  2BBY A;  4UB8 C;  2LY9 A;  1APL C;  2GM4 A;  1IF1 A;  4AYB N;  2PMZ A;  3C2B A;  1I6X A;  3DEE A;  1ETX A;  1Z3Y A;  3L7W A;  3F23 A;  3HYI A;  4EV0 A;  3HIF A;  1D8J A;  2R0Q C;  1N75 A;  5F27 A;  1YRN A;  2D5V A;  1TWF J;  4C30 A;  2HVR A;  4CHU A;  2VC1 A;  4KYW A;  3K10 A;  3DKX A;  2OF7 A;  1HA8 A;  2BZT A;  2EFO A;  2W7N A;  4A3J J;  4XOP A;  3HBL A;  3B6A A;  1GUU A;  2GA1 A;  4XSX F;  4ASN A;  3J80 K;  3KET A;  2X6W A;  4HPQ A;  2XPW A;  3ERE D;  1X1C A;  2ZO4 A;  1H9G A;  3R60 A;  4N4N B;  3GVA A;  4JX5 A;  4A3L J;  2JA7 J;  4O5V A;  3FMS A;  1MH4 A;  4OMZ A;  4JK1 X;  1E3O C;  1S7A A;  2E7X A;  4IHX A;  3ZMV A;  5KK1 A;  3GFM A;  2DDA A;  2KZV A;  2J5P A;  4QIW N;  1C0W A;  3LAP A;  2WY8 Q;  5KAF C;  2PLY A;  5D4R A;  3TO9 A;  2O3F A;  1IDZ A;  3EPZ A;  2HI3 A;  1Y6I A;  4F92 B;  3H3Z A;  4RB1 A;  2X6X A;  2KIS A;  3KP5 A;  2H09 A;  3RPU D;  3WG9 A;  5FFZ A;  4G94 A;  2KFD A;  2K5C A;  5E79 C;  2EZL A;  3CDH A;  5FFX A;  3JRD A;  5D5W B;  3K1N A;  1FOW A;  2HOA A;  3J7A O;  1Y39 A;  2F5E A;  2LKP A;  3HOX J;  4JBA A;  5B5E C;  4HG2 A;  2Y2Z A;  3DKY A;  4A6D A;  5LHG A;  3OSF A;  3FDY A;  4F52 A;  3IRR A;  1TQP A;  2XV4 S;  4XN0 A;  3T0Y A;  3VSK A;  2HXI A;  4Q5S F;  1IRF A;  3UKG A;  5ICG A;  5K7H A;  2JA5 J;  2CV0 A;  2ICW G;  4HA8 A;  4KMU X;  2M5W A;  2GZW A;  1GT0 C;  5J40 A;  5DTD A;  1LKX A;  1TT5 B;  4RM2 A;  4Y15 A;  1LUJ B;  5ERI A;  2HKO A;  4XOT A;  3ASN H;  2XSD C;  1TT0 A;  2DMT A;  4Y3O A;  3RTR A;  3RYP A;  1FP2 A;  2E7W A;  3C18 A;  2M1B A;  4LOC A;  2KIF A;  2L9N A;  4XMY A;  2WA0 A;  2MYS A;  4ABZ A;  1V5F A;  1VQ9 I;  2GLO A;  2QSF X;  3HUG A;  1N78 A;  3H35 A;  3H9J A;  4IOC F;  1EH7 A;  4BEH B;  5DCM A;  4XRM A;  3RQI A;  3LSK A;  3Q9S A;  3MWM A;  2M3A A;  1Y8R B;  3BG9 A;  2F4I A;  4M72 A;  4BQO A;  2R7F A;  1ZKG A;  3LSH A;  1B59 A;  2HU9 A;  1X1D A;  1YIJ I;  3L1P A;  3MCZ A;  4DBR A;  3OR1 C;  3D0S A;  4P9U A;  5EGO A;  2IEK A;  3L9F A;  4NC7 A;  3S1N J;  3QP5 A;  3FHZ A;  4EJT A;  1KYW A;  4LG3 A;  3T1B A;  1I6H J;  2JRM A;  3GWZ A;  4EJV A;  1ZRF A;  4D7N A;  4IVN A;  4HYE A;  3AL0 B;  4JOM A;  1TWH J;  2DJN A;  2ZFW A;  3QOD A;  3RKW A;  4I76 A;  2VQH A;  2V1U A;  1X3W B;  4U88 A;  3FXJ A;  4I98 B;  2O9L A;  2XRL A;  1JHH A;  1SAN A;  1RR7 A;  3E5X A;  4N9H A;  1Z21 A;  1E3P A;  1Y1W J;  5FKO A;  5HLI A;  3CCQ I;  4BHB A;  3QRF F;  2P7C B;  1Z3X A;  1T33 A;  2KIQ A;  1QZZ A;  4S0H B;  4D9J A;  5HLG A;  4XR6 A;  4ZDO A;  1YYV A;  2ZXW H;  4LIT A;  5BPD A;  2FD5 A;  2FXA A;  2M9H A;  2Y9Y A;  2DFF A;  2NOJ B;  4XLE A;  3A0H C;  4LLN A;  1Z6R A;  2NAZ A;  1KGS A;  3DPT A;  5FKM A;  1I3A A;  3CMY A;  4A3D J;  3MZ8 A;  5C44 J;  1P4W A;  4OMY A;  3HSE A;  1HKS A;  2FQ3 A;  1DU6 A;  3ONQ A;  1IGN A;  3BR1 A;  2WB1 N;  2LBF A;  3IP4 B;  2MAB A;  2HYJ A;  1KU9 A;  4MQ9 F;  4XLF A;  3T8T A;  3VFZ A;  3CES A;  4KIS A;  2ISZ A;  4ETS A;  1RKW A;  1SD5 A;  1MBH A;  1T6S A;  2X1E A;  2VC0 A;  2IS1 A;  4O6J A;  3JRI A;  3GLX A;  3EUH C;  2GIV A;  2O8K A;  1W5C C;  1S8N A;  3CO6 C;  3C7J A;  1SAX A;  2DQR A;  2VUM J;  3CCM I;  3KYD B;  3OYJ A;  2XB5 A;  3K9T A;  3S8P A;  3GFI A;  2AXL A;  3GF2 A;  2M8G X;  3WTW C;  2R92 J;  4UB6 C;  3WHB A;  4L18 B;  2EWN A;  3CCY A;  5E20 A;  4EM2 A;  3DTK A;  5E3O A;  1MBF A;  3KP3 A;  3E6B A;  1IUF A;  2HQR A;  3S15 J;  1AHD P;  2F2E A;  2EIK H;  1D8K A;  2AHQ A;  3BPX A;  4LFU A;  4A5M A;  2EB7 A;  3G3Z A;  1DU0 A;  1YRN B;  5FKK A;  5LHH A;  4XRS A;  3JAM K;  3BPV A;  3S2W A;  5F6F A;  1EV7 A;  2DJI A;  4BJ6 C;  4A93 J;  5F0H A;  4BY1 J;  3U1K A;  3VOE A;  4LJZ F;  3OS0 A;  2VT2 A;  2RQQ A;  2E1C A;  3IWF A;  2HNH A;  2CUJ A;  5DD4 A;  2DI3 A;  2M87 A;  2VL8 A;  3WTS C;  2FU4 A;  1Z0X A;  2BHZ A;  4QWQ A;  2EK5 A;  3CUQ A;  1OLT A;  1ETQ A;  4RAG A;  2ACJ A;  1K83 J;  3FWE A;  1W5T A;  3GZ6 A;  1B72 B;  2L2O A;  1Z77 A;  3AKZ A;  1O7L A;  5DYM A;  3KCC A;  4JX4 A;  4YII A;  1GXQ A;  2I8D A;  3NAU A;  5J8C A;  3CO7 C;  2NS0 A;  2ECB A;  3LSG A;  3QOP A;  3ZPL A;  2FNA A;  5CQG A;  3GO5 A;  2A61 A;  4H0E A;  4OOI A;  4RLQ A;  5E18 F;  3IRQ A;  3OYL A;  4HLY A;  4B8X A;  5KVR A;  1BA5 A;  4IXA A;  2JVG A;  3M7G A;  2NVX J;  4S05 A;  4G7O F;  5FJ8 J;  2HDC A;  3K4K A;  1W36 D;  1T38 A;  1CGP A;  2Z16 A;  1Q1V A;  1JGS A;  1RET A;  4BY7 J;  3QOE A;  4ZTJ A;  3UNG C;  4QSH A;  3CLO A;  4E7J A;  4QPQ A;  3A4C A;  1JUM A;  1IXS B;  1LNW A;  3O8H A;  1OYI A;  3JSP A;  2RVC A;  3CC4 I;  4U87 A;  2XRO A;  4A69 C;  3WE3 A;  4EQQ A;  2NVY J;  2X4H A;  4ESF A;  1NK3 P;  2F4O B;  1HW5 A;  2NNN A;  4XN3 A;  1YE9 A;  3Q0V A;  1UST A;  4MFE A;  4D5F A;  2DPD A;  1RZ4 A;  3K4M A;  4Y17 A;  4MEX F;  3ASO H;  3TDZ C;  4A3C J;  2FUG 2;  2UXX A;  3MD2 A;  5HVQ C;  1U8B A;  1WSU A;  1R4M B;  1X3Z B;  2IA1 A;  4DYC A;  2XDV A;  3GEZ A;  4QTR A;  2LSO A;  3FIW A;  1U3E M;  3VSL A;  2XHK A;  5F0F A;  3HUG B;  4EEF G;  3JR9 A;  2WTE A;  2PJP A;  1LVA A;  1ORK A;  3K6G A;  5DCM B;  2E1M B;  2OUM A;  4RAF A;  2O5R A;  3U1D A;  4W1U A;  1U9O A;  2FSW A;  5B1B H;  5JVT A;  2PEX A;  1SFE A;  1TW3 A;  1EKE A;  4DOZ A;  1D0Z A;  3VDX A;  2CQK A;  3LSM A;  1Z91 A;  3EUA A;  3I53 A;  4UVA A;  1ZG5 A;  2K27 A;  1PYV A;  1BR2 A;  3SEQ A;  3VEP A;  4MHG A;  1L0O C;  4BBR J;  3FHN A;  1S29 A;  4ZYA A;  4II3 A;  4F55 A;  4F91 B;  4XQF A;  3A1Y A;  1SAU A;  3P5J A;  2MLK A;  1X1P A;  5F1J A;  1FC3 A;  3JSO A;  4G7Z F;  1AKH A;  2X1D A;  3BG6 A;  5GAH J;  1VQ6 I;  1P2F A;  3HRU A;  1OYY A;  3J80 Z;  4ENJ A;  1XGN A;  1D5V A;  3BJO A;  3FXR A;  3IL2 A;  3J7Z I;  3ZN1 A;  3JTH A;  2P5L C;  5C4X J;  4XLC A;  2IW5 A;  2L5Q A;  4XKV A;  2QBY B;  2LYC A;  2BGC A;  3FF5 A;  3M4O J;  3LOC A;  1J7K A;  5IT9 K;  5IP6 A;  1TWC J;  3BTC A;  3I54 A;  4OWR B;  1WWX A;  2KRH A;  4R1H A;  1BJA A;  1VF9 A;  1XMK A;  2XGX A;  1YHQ I;  1MNM C;  4MEY F;  2V26 A;  4M6Y A;  1DPU A;  1E2X A;  3CP2 A;  3R61 A;  4AYB A;  3CJR B;  2Q0O A;  2JA6 J;  5TRD A;  1UHW A;  2HYG D;  2DTZ A;  1BIA A;  4V2G A;  2A6T A;  2RNG A;  1OKR A;  1T39 A;  4HX4 A;  2LBF B;  5A2Q K;  1NG7 A;  1S5L C;  1OCT C;  2PG4 A;  2XRN A;  4XNF A;  2VBY A;  4S04 A;  1WJB A;  1QZE A;  5DD8 A;  2VE8 A;  3TOB A;  1BR4 A;  2E2J J;  5IPA A;  1ZLK A;  2DTR A;  1ZGJ A;  3PUF A;  2IBD A;  3SJM A;  2M45 A;  4ZDL A;  2V1X A;  2JUC A;  2P4W A;  1G4D A;  2HDW A;  1YJ9 I;  4XLN F;  1UB9 A;  4FCY A;  1TC3 C;  4CGZ A;  3CCU I;  4A3B J;  5EZH A;  1OFC X;  1O3R A;  2G0E A;  5E3M A;  2CH0 A;  1MSE C;  2JMW A;  4C3I J;  2K9S A;  1D1B A;  2DA4 A;  4F93 B;  4II2 A;  3WTZ A;  2HQ5 A;  2CRG A;  5FKN A;  5ICF A;  3OYK A;  5CVJ A;  2RAE A;  2GXA A;  2JTV A;  1R6R A;  2A5Y B;  1MMS A;  1P9Q C;  1QHH D;  3K4C A;  4CIC A;  2Y9Z A;  2YUS A;  3SZT A;  3QQA A;  2HZD A;  1FMW A;  1Z67 A;  5DCF A;  2ZNY A;  1PP8 F;  1WJE A;  2L7M P;  3BCA A;  2KIU A;  2K02 A;  2OQG A;  1XMX A;  2HWV A;  4OIP F;  2IAI A;  1B1B A;  2Y31 A;  2OPT A;  3U9G A;  2HR3 A;  3L2U A;  4UUV A;  5JI6 A;  2R3S A;  3IUO A;  3TP3 A;  4AID A;  4PDK A;  4YIF A;  1ZHF A;  2LRE A;  5HDK A;  5K1Y A;  1F5T A;  2CU7 A;  2FA5 A;  3GX4 X;  2DA6 A;  2KKO A;  3F8N A;  4RGX A;  4NC8 A;  1VQ8 I;  1QHG A;  1ZAO A;  2F5C A;  2DN0 A;  1K4S A;  5M5W J;  2ELH A;  3WHC A;  3CF5 F;  1FNN A;  2VQG A;  3IHU A;  1GDT A;  2A6H F;  3SZP A;  4ENK A;  1RUO A;  3DTE A;  3NWS A;  3WGH A;  1ETK A;  2DA3 A;  4KIC A;  1MKM A;  2M0C A;  1XC5 A;  1WCM J;  1DGW Y;  1DPR A;  2A68 F;  3CDI A;  4HNU A;  1O3T A;  3IKT A;  1ITY A;  1VQL I;  2W25 A;  5E1Z B;  4BEH A;  1ETO A;  1SFX A;  2LY1 A;  4J00 A;  2K40 A;  2LR8 A;  2W57 A;  3CCR I;  2Z9O A;  3JRG A;  2WV0 A;  3JRF A;  4Z6Y A;  1T56 A;  4IL6 C;  3ABT A;  5FB2 A;  1ZRD A;  3HOW J;  5ILU A;  2DOA A;  4M9S A;  1ZN2 A;  2EZK A;  2ZJP F;  4IHV A;  2QCO A;  3GTK J;  1IC8 A;  2NS7 A;  3OIO A;  5JHU A;  2WBM A;  2LF7 A;  3CME I;  1Y8Q B;  5J1U A;  3DP7 A;  3HPG A;  1VQ7 I;  3SEZ A;  1WGX A;  2L9V A;  1D1A A;  1D5Y A;  4LG0 A;  3BOQ A;  4DNC A;  4X1E A;  4M3G A;  2AQE A;  2CW8 A;  3KE2 A;  5CVU A;  2PMU A;  2CQQ A;  1ZRE A;  3V8L A;  2CGP A;  4CCL A;  4ZH4 F;  1OCC H;  2E71 A;  4XBF A;  2NNY A;  3G6E I;  3I0T A;  1LB2 A;  1SEU A;  1R23 A;  1BOB A;  1GHC A;  2OBP A;  3HKZ N;  1J59 A;  4UNO A;  2LC2 A;  4CO8 A;  2RV8 A;  4YFN F;  3Q3S A;  1ZGW A;  4M3E A;  1OQY A;  1R1U A;  1FBS A;  1KZH A;  1IN8 A;  2DA1 A;  2FEZ A;  4I6Z A;  4E7K A;  3E97 A;  3CF2 A;  2NRA C;  3LFU A;  1IV8 A;  1O57 A;  3IC7 A;  3ZQ7 A;  3JAM Z;  1LEA A;  3W2A A;  3BC8 A;  1FIP A;  2DOD A;  1YX3 A;  3P7N A;  2KL4 A;  3DCF A;  2XF6 A;  4I0A A;  2N8G A;  4XOR A;  3CCS I;  3LFK A;  1FP1 D;  3CCJ I;  1Y1V J;  3IWZ A;  5FRM A;  4ON0 A;  3N97 A;  4QPO A;  1R9T J;  1I5Z A;  4X6A J;  4GDF A;  5EF6 A;  3ESW B;  2O8X A;  2DYS H;  4BGD A;  4L0Z B;  1R36 A;  3IAS 2;  1LE8 B;  3F8B A;  5F64 A;  4HRI A;  1TP4 A;  2PI0 A;  1R5I D;  2DU9 A;  2E5N A;  4WCG A;  5BPI A;  2YS9 A;  2DA7 A;  1MJB A;  3ZMU A;  2F6C A;  3WTU C;  2CV2 A;  1YJN I;  4RB3 C;  1STZ A;  1IUY A;  1TW2 A;  1HLV A;  5HOO A;  1ZEL A;  1WH5 A;  1I39 A;  3ELK A;  3SFZ A;  3DU5 A;  4KN7 X;  5HS9 A;  2XAH A;  1TQM A;  2K4B A;  4BS9 A;  1DDN A;  5L3G A;  2VOP A;  5ICC A;  3WU0 A;  1MGT A;  2R4G A;  3WG7 H;  2RDP A;  1ZRC A;  2E1N A;  2QLZ A;  4KMF A;  2DMQ A;  4AWX B;  2IGN A;  5GAG J;  2L9S A;  2FNP A;  1E17 A;  3H9G A;  4OAZ A;  1IN6 A;  4M74 A;  3QU6 A;  1JGG A;  4EM1 A;  2IXS A;  4IHY A;  2O61 A;  5GAE J;  4LGW A;  3KLO A;  3CP8 A;  1QA6 A;  1VND A;  4PJ0 C;  5GTH C;  2HTJ A;  4FQG A;  3OIQ A;  3L09 A;  4HNT A;  3FMR A;  3TMO A;  2ADU A;  4G6T B;  4YRV A;  1J0R A;  2VAS A;  3WTX C;  2VI6 A;  3ZGK A;  3KP2 A;  4BXU A;  4CYD A;  3LA2 A;  4AVP A;  4ANJ A;  2MLG A;  2STW A;  3HOS A;  1OCO H;  5E3L A;  3JRC A;  1B72 A;  3SHF A;  2DFI A;  1HW2 A;  1FBU A;  1QPM A;  2MC4 A;  3CUO A;  3H9Q A;  4IQ4 A;  1DUX C;  3J81 K;  2DXI A;  2FJ1 A;  4DGW B;  5IOY A;  5AON A;  4U0V A;  2HQA A;  1JUS A;  2ME0 A;  3KYC B;  4IOA F;  3OYF A;  2NXN B;  5EYR A;  1JXS A;  2ZKZ A;  1YJW I;  2QQB A;  2H1L A;  2V7F A;  3O8G A;  3FBI B;  2VQL A;  2R7V A;  4KIT B;  1IW7 F;  1A6I A;  2PQ8 A;  2Y75 A;  1K78 A;  2H27 A;  4ZZD A;  2XPV A;  3IH2 A;  2EPF A;  3FX3 A;  3ECH A;  4IPA A;  2JA8 J;  2DBB A;  2QA4 I;  4I09 A;  4YIR X;  3W6K B;  3IV5 A;  4AC0 A;  1Q1H A;  2CQN A;  2HS5 A;  3FKJ A;  3Q0U A;  4MTD A;  1OJL A;  2OZ6 A;  5E17 F;  1P7I A;  3FXL A;  5DM6 F;  2QVO A;  1R5H A;  4L5J A;  1Y56 A;  2M30 A;  5FLX K;  4MTE A;  3PIP F;  2JPB A;  4Z2Y A;  1HKQ A;  2JSC A;  5JLX A;  2KDZ A;  1G6N A;  1IN7 A;  3KEQ A;  1GLN A;  4AM3 A;  2XGE A;  3K4B A;  3GZN B;  2DA2 A;  3K1P A;  2M0M A;  5LRR A;  1R58 A;  1USS A;  2B9S A;  1IZ1 A;  2V9P A;  1IXR C;  4A12 A;  1FYK A;  4LB6 B;  5IT9 Z;  3ZQG A;  3K2Z A;  3GFJ A;  1MJA A;  5F04 A;  1XN7 A;  1FTT A;  1YO5 C;  1J9I A;  4WXC A;  1YX5 A;  4PSX A;  2NVQ J;  3PO3 J;  2X51 A;  3VOD A;  5AIQ A;  1K79 A;  2DK5 A;  3DKW A;  4A6E A;  2UUZ A;  3LNQ A;  4BQA A;  1JJ8 C;  3EYI A;  5CJ9 A;  3BCB A;  3DBR B;  1X4P A;  2P81 A;  1XX5 A;  2QSH X;  2ISY A;  4FTH A;  1PUE E;  1ETW A;  3O2P E;  2COB A;  3QAH A;  5C4J J;  2YU3 A;  2FBK A;  3VYU B;  4FAS D;  4Q4Z F;  5LRS A;  1ZYR F;  3TGN A;  5A2Q Z;  3L2C A;  1RKT A;  2ZJQ F;  2VKH A;  4FIS A;  2KQR A;  4D7M A;  4M3F A;  4LG0 B;  2K3F A;  1RIO H;  1U5T C;  4HQM A;  2LH9 A;  3I3L A;  4A0X A;  4IF4 A;  2TCT A;  1TNS A;  1X3U A;  3E6M A;  3ECO A;  4FE7 A;  3ZQC A;  1Z9C A;  4PGH A;  2IS2 A;  5IYC J;  2UZK A;  2CUE A;  2Y0S N;  2GOM A;  5H6R A;  4ENM A;  2QBY A;  4XON A;  1I27 A;  1ON2 A;  3QPH A;  2EFQ A;  1XS9 A;  3M8E A;  3T5X A;  1VQ5 I;  5LD2 C;  4M6X A;  1T08 B;  2DMU A;  3OL4 A;  2IS4 A;  1X4O A;  1T8I A;  1WVR A;  3GUD A;  3KZY A;  2P5K A;  2K9M A;  1FT9 A;  2MSY A;  2XKO A;  1MSF C;  4GGG A;  5L3D A;  5IP9 J;  2VPR A;  2VN2 A;  3F6V A;  4GYI A;  3C2H A;  3HDD A;  2F5D A;  3BJA A;  5HNH A;  4KT5 C;  1SD4 A;  2E5Z A;  1GV5 A;  1X1B A;  3R0J A;  1X19 A;  3SXY A;  2ID3 A;  2BE5 F;  3OR2 C;  4PFO A;  1BI1 A;  4P55 A;  2VKE A;  4KIB A;  4IEJ A;  1BM9 A;  2TDX A;  3ULQ B;  4CZC A;  4ZC3 A;  3ABM H;  5J47 A;  3DU6 A;  4OAY A;  2EZI A;  4LIV A;  2VLA A;  2W48 A;  3TED A;  5KCM A;  3SZG A;  4HAM A;  4G8X A;  5LEK A;  4M73 A;  1FY7 A;  4EVI A;  3CJN A;  1MMN A;  4XIC A;  2V1D A;  3EUK L;  1ZQ3 P;  2IGM A;  2HFH A;  1UCR A;  4HF0 A;  3K7A J;  4Y13 A;  2MG4 A;  5GP9 A;  5EG0 A;  1OCR H;  4BJ5 C;  3CCV I;  3AG3 H;  2LY2 A;  1WJ5 A;  1R5G A;  5E1W A;  1BR1 A;  4N9I A;  3NWT A;  5J3L A;  1G3T A;  2BYV E;  4IRI A;  4A2U A;  2LOO A;  1JT0 A;  5J1Y A;  2M4K A;  5K5R A;  3HOV J;  2Z99 A;  2EIJ H;  2STT A;  1RI7 A;  1S7E A;  5JHF A;  2MD0 A;  3GFL A;  1BIB A;  1J75 A;  3N05 A;  5E8I A;  3HRT A;  1QBJ A;  2BXZ A;  1G59 A;  3TW6 A;  4A3I J;  2AS5 F;  4ITV A;  2H6C A;  1U78 A;  4ZTF A;  3I4P A;  4RGS A;  1LVK A;  1MBG A;  4V19 K;  1D3Y A;  3I4M J;  1FEX A;  3D5R C;  1SVO A;  1D0X A;  1YLF A;  3HGY A;  1EF4 A;  2ETH A;  5DUK A;  4KIG A;  3MKZ A;  3SYT A;  1FOY A;  4KJZ A;  1RRJ A;  2KMU A;  3SDB A;  4BKX A;  3IH4 A;  4EJU A;  2HOS A;  2CSO A;  1XMA A;  4A0Z A;  3AL0 C;  1ETY A;  3FM3 A;  3GXO A;  1BC7 C;  1OCP A;  3PNV A;  5JVG F;  2VIX A;  1TWA J;  2BHY A;  2Z2S B;  3KX2 A;  1VTN C;  2B0L A;  1IRZ A;  3FIS A;  5D6E A;  4P1W A;  4R8H A;  2KHM A;  1EH6 A;  3KFW X;  1TNT A;  3WTY C;  4XID A;  1K61 A;  1HF0 A;  2M34 A;  3DV8 A;  3MVP A;  3HOZ J;  1KA8 A;  1RR8 C;  3CTA A;  4BXX J;  1X1A A;  1K78 B;  1MD0 A;  3S1R J;  5E1X A;  1EH8 A;  4G7H F;  2JA2 A;  3CCL I;  1XCB A;  5CYV A;  5D6F A;  2KT0 A;  2L0K A;  2LF8 A;  3H0G J;  3E7L A;  3FXU A;  1Z7U A;  5FD6 A;  3R6S A;  5M3F J;  5TGT A;  1SFK A;  3MZH A;  1V5E A;  1XSV A;  5B1A H;  3BR6 A;  4JQF A;  2OD5 A;  2Z5U A;  1K6O A;  5F08 A;  2ME6 A;  3BR0 A;  4RBO A;  4MLO A;  1WI9 A;  2A3S A;  1DQU A;  3H1C A;  2DMP A;  2PJR A;  3J7A Y;  2JWT A;  1U6G A;  4UUT A;  2HVQ A;  1XCV A;  3H0D A;  2H8R A;  2KJB A;  2GAU A;  5ILS A;  4BJT A;  1UG2 A;  4ESB A;  2XPU A;  4BHP A;  3ZQF A;  3H92 A;  1O3Q A;  2JJ7 A;  2EA4 A;  2V79 A;  3LSI A;  3PSI A;  1V54 H;  3ZQL A;  1O3S A;  3K70 C;  3OOU A;  2XF5 A;  2WAQ N;  3HKZ A;  4XKC A;  3GTQ J;  3FK6 A;  3AG4 H;  1W7P B;  4KNY A;  3RYR A;  2M7A A;  2XF7 A;  1WKM A;  4XM3 A;  1WJA A;  1W7P D;  5D5X B;  2CS3 A;  3ABL H;  4E7I A;  2GWR A;  2E36 A;  4LK0 F;  1JTY A;  1BL0 A;  1TL8 A;  1QRY A;  4ENN A;  2P6T A;  1P92 A;  2IJL A;  5DS9 A;  4OIQ F;  4WXH A;  3HB9 A;  2ELK A;  1YS6 A;  2QEN A;  3RIR A;  4A5N A;  1VQK I;  4I2O A;  2RQP A;  2FX0 A;  2TRT A;  2QF7 A;  3PM1 A;  4GFB A;  3FK7 A;  2A5W A;  3GTO J;  1MBJ A;  3TO7 A;  5EEH A;  2RNJ A;  1NH3 A;  5LGT A;  4RAZ A;  1KU3 A;  3D5L A;  2XKP A;  2J5O A;  4HEA 2;  3LAJ A;  2A07 F;  5KNL A;  2DDB A;  3CJQ B;  4NDL A;  4J19 A;  5DDG A;  4YG2 F;  4B4C A;  5DUI A;  4IO9 F;  3ABU A;  1B6A A;  4E4H A;  4LIU A;  4A3G J;  3CCE I;  3FXQ A;  1LE8 A;  1VZ0 A;  2R7S A;  2L7F P;  3GTM J;  2NVU B;  1KU7 A;  2W84 A;  5F1R A;  3BP8 A;  2M7B A;  2W24 A;  4M3B A;  4DQ2 A;  4HLX A;  1J09 A;  1HW1 A;  5IYB J;  4CUG A;  3F3X A;  4LD5 A;  3OMY A;  5EEG A;  2JZY A;  3HTU A;  3R0A A;  4N0B A;  4RM3 A;  2PX9 A;  3MEX A;  3C3W A;  2Z1D A;  1XTA A;  4XLH A;  3OYB A;  2XAG A;  5ICE A;  2BOL A;  2ZME C;  3J81 Z;  3JRA A;  1B8I B;  2D1H A;  1YQA A;  1YW7 A;  5HDN A;  5IP7 J;  1RUN A;  1KU2 A;  3ABK H;  3PNY A;  2QEX I;  4MFD A;  5TJJ A;  2CUZ A;  1ON1 A;  3E6C C;  2ZSH B;  1R7J A;  3EYY A;  4PFP A;  5D5U B;  5J4Y A;  3S1M J;  1J2X A;  1MBK A;  1LFP A;  4HX7 A;  2V6E A;  2VJJ A;  1V4R A;  4CCJ A;  3ZR8 X;  3BG3 A;  3CLQ A;  1BI0 A;  2D45 A;  1I50 J;  2VB6 A;  3E6D A;  1QQI A;  3ZQQ A;  3V7S A;  3WE2 A;  4CA0 A;  1FIA A;  3ERM A;  3V4G A;  3L2W A;  1NK2 P;  2D2W A;  2ZJ2 A;  4XSZ F;  3G71 I;  2IGK A;  2AQF A;  2KJC A;  3QPL A;  2IVM A;  2VT3 A;  4ZYH A;  5L3F A;  4E7S A;  5FLX Z;  2OU2 A;  5EG0 B;  4M6V A;  4WWC A;  3BR2 A;  1AWC A;  4DBQ A;  3W3C A;  1AA7 A;  2D1V A;  4RS8 A;  3RZD J;  5K7Z A;  1BI2 A;  1MIJ A;  1Y0N A;  4GRI A;  4L5I A;  2EA2 A;  2C6Y A;  1D1C A;  2F48 A;  4HW0 A;  2HQN A;  3H3U A;  2RGV A;  1P7J A;  3TBI A;  3RI4 A;  2W00 A;  1JUP A;  1F4K A;  2YR2 A;  1F1Z A;  3PUB A;  3BQZ A;  1J5Y A;  3GBG A;  1WHU A;  3FBN B;  2CV1 A;  3V7C A;  3OYC A;  2K9L A;  2FOW A;  3W6V A;  2A05 A;  4UVB A;  3EDP A;  3V42 A;  3AG1 H;  2NVT J;  3C2G A;  3FZV A;  2IS6 A;  3VYR B;  3LMM A;  4P96 A;  5FKL A;  5J1R A;  1XB4 A;  2DO7 A;  2HOE A;  5LGU A;  2H6B A;  2IP2 A;  1I1S A;  3CC7 I;  1FOK A;  4P9F A;  1GV2 A;  2FBH A;  2P7V B;  4B09 A;  3K4L A;  3G1M A;  3IKV A;  1UG0 A;  1E0E A;  1P4A A;  3O6B B;  3HHH A;  1MBE A;  3F21 A;  4IHW A;  5GPC A;  3M07 A;  4Y4R A;  2XAF A;  4LK1 F;  5GTI C;  5L3C A;  1G8X A;  1XDU A;  5JLW A;  2FQ4 A;  2E2H J;  3FXK A;  3EUH A;  1R49 A;  1PP7 U;  2XAJ A;  2YX7 A;  3WTT C;  4KFC A;  5J6X A;  3QPS A; 
#chains in the Genus database with same CATH homology
 5E3L A;  2WB1 N;  3JRC A;  1B72 A;  2E1O A;  2HYJ A;  3JRH A;  3ZOB A;  3OSG A;  1RKW A;  2FJ1 A;  5IOY A;  1BW6 A;  1MBH A;  2Y30 A;  3RKQ A;  4A3F J;  2ZB9 A;  1JUS A;  2ME0 A;  3JRI A;  2O8K A;  5EGO B;  3S17 J;  5EYR A;  2VUM J;  1HOM A;  1IDY A;  1QVT A;  2DMN A;  2XB5 A;  3O8G A;  1X58 A;  2M8G X;  4C2M J;  2R92 J;  1G2H A;  3WHB A;  1A6I A;  3CCY A;  5GPA A;  2XPV A;  3IH2 A;  5E3O A;  1MBF A;  1IUF A;  4FE4 A;  2NOG A;  2JA8 J;  3S15 J;  1AHD P;  3GTP J;  2AHQ A;  3IV5 A;  9ANT A;  1YRN B;  4AC0 A;  1DU0 A;  5FKK A;  4XRS A;  2R5Y B;  3Q0U A;  5IOZ A;  4CYC B;  3S1Q J;  1OJL A;  1QVU A;  1P7I A;  4A93 J;  1FJL A;  5F0H A;  2WV1 A;  4BY1 J;  4DZJ A;  5EDN A;  4W97 A;  5JLX A;  2KDZ A;  2R5Z A;  1WPK A;  2XGE A;  1PUF B;  3GTG J;  2DA2 A;  1Z0X A;  3BT9 A;  1TWG J;  3MKL A;  4MIM A;  3S16 J;  3I4N J;  1ETQ A;  1K83 J;  3ZQG A;  5F04 A;  3LSJ A;  4DYR A;  1FTT A;  1B72 B;  1Z77 A;  2NS8 A;  2YU9 J;  2NVQ J;  3PO3 J;  4JX4 A;  4M3D A;  3NAU A;  4Y7N J;  2ECB A;  3LNQ A;  3LSG A;  1JJ8 C;  1QPI A;  2P81 A;  3A01 B;  4RDU A;  4FTH A;  1ETW A;  2COB A;  2CUF A;  2XGC A;  5C4J J;  1BA5 A;  1WH7 A;  1POG A;  2NVX J;  5FJ8 J;  1Q1V A;  1RKT A;  4FIS A;  1RET A;  4BY7 J;  4D7M A;  4M3F A;  4QSH A;  2LLK A;  1JUM A;  2TCT A;  3HOU J;  2VKV A;  3O8H A;  2AO9 A;  3BQY A;  4FE7 A;  3ZQC A;  4A69 C;  4UUS A;  2NVY J;  1NK3 P;  5IYC J;  1W0T A;  2CUE A;  2E19 A;  2Y0S N;  5EEA A;  3Q0V A;  1I3Q J;  1X2M A;  4MFE A;  4A3E J;  2LFB A;  3HOY J;  2L9R A;  4D5F A;  3HEF A;  1XS9 A;  2HXO A;  2HOT A;  3DEW A;  1CQT A;  2DMU A;  1ENH A;  4A3C J;  3CQZ J;  1U8B A;  5FLM J;  1VI0 A;  4DYC A;  2MSY A;  4QTR A;  1MSF C;  3FIW A;  5F0F A;  1W0U A;  5IP9 J;  2VPR A;  4EEF G;  3JR9 A;  1IJW C;  3K2A A;  1ORK A;  3HDD A;  3A02 A;  3BR5 A;  4W1U A;  1U9O A;  3S2H J;  3SDG A;  1GV5 A;  2ID3 A;  3VPR A;  2LD5 A;  3JRB A;  2VKE A;  4IEJ A;  4JX6 A;  1IV6 A;  4XRS G;  2EZI A;  2W48 A;  3BTI A;  3TED A;  4XK4 A;  4BBR J;  3S2D J;  4HNV A;  3S14 J;  1HDD C;  2MW8 A;  2MGQ A;  4XIC A;  5F1J A;  2R93 J;  1AKH A;  3LSR A;  1JTX A;  1ZQ3 P;  3K7A J;  1BW5 A;  2MG4 A;  5GP9 A;  5EG0 A;  1U9N A;  2EQR A;  5C4X J;  5J3L A;  4JYK A;  1JT0 A;  5M3M J;  5J1Y A;  2LK2 A;  2M2E A;  4BBS J;  3M4O J;  2X9D A;  3LOC A;  3HOV J;  5IP6 A;  1S7E A;  1TWC J;  3BTC A;  1X2N A;  5M5Y J;  1JT6 A;  1VF9 A;  1JKQ C;  4DW6 A;  1MNM C;  3TW6 A;  4A3I J;  3D1N I;  1NTC A;  2JA6 J;  1U78 A;  1HDP A;  2DTZ A;  3BG5 A;  1MBG A;  1JKO C;  3GTL J;  3IH3 A;  4AUX A;  3I4M J;  2EZH A;  2X48 A;  1FEX A;  4V2G A;  3HGY A;  1JKR C;  1EF4 A;  1LFU P;  1SFO J;  2B63 J;  4BKX A;  3JRE A;  3IH4 A;  1OCT C;  3ZQH A;  2HOS A;  1ETY A;  1JJ6 C;  2LTP A;  1OCP A;  2I10 A;  1JKP C;  1TWA J;  5IPA A;  1GVD A;  2E2J J;  1IRZ A;  2IBD A;  3SJM A;  3FIS A;  4B1R A;  3ZQI A;  1ZR4 A;  4FCY A;  3BR3 A;  1F43 A;  1TC3 C;  5EZG A;  1K61 A;  4XID A;  2JK3 A;  1HF0 A;  4A3B J;  2M34 A;  3MVP A;  2L7Z A;  3HOZ J;  4BXX J;  1AKH B;  2CJJ A;  1OFC X;  5EZH A;  2G0E A;  1H89 C;  5E3M A;  1MSE C;  3MN2 A;  1ZTR A;  2JMW A;  4C3I J;  3BTL A;  4DZP A;  2K9S A;  2DA4 A;  3S1R J;  2LP0 A;  2DA5 A;  4JP0 A;  2EH3 A;  5FLV A;  4DYQ A;  2LVS A;  3CDL A;  2GBY A;  2HQ5 A;  3G1L A;  4Y52 J;  2CRG A;  1WI3 A;  5FKN A;  2KT0 A;  2L0K A;  2ID6 A;  3H0G J;  3E7L A;  2EBI A;  2RAE A;  5M3F J;  2Y9Z A;  3F0C A;  2YUS A;  3BR6 A;  2CQX A;  3QQA A;  4L5E A;  1HCR A;  4G12 A;  4C3J J;  2K9Q A;  5F08 A;  2ME6 A;  3BR0 A;  4RBO A;  3HM5 A;  2L7M P;  4MLO A;  2R5Z B;  5K7F A;  2LY9 A;  1APL C;  2GM4 A;  4AYB N;  2DMP A;  2IAI A;  3C2B A;  5F0C A;  2JWT A;  4UUT A;  1ETX A;  2Y31 A;  2OPT A;  1B8I A;  2R0Q C;  2H8R A;  4MO7 A;  5F27 A;  1UG2 A;  1YRN A;  1TWF J;  3HGG A;  2XPU A;  2D5V A;  3ZQF A;  3TP3 A;  2JJ7 A;  4CYC A;  2K9N A;  2CU7 A;  4D5C A;  3ZQL A;  4V2F A;  2DA6 A;  3TW7 A;  2OF7 A;  3OOU A;  2WAQ N;  3GTQ J;  3FK6 A;  4A3J J;  3NAR A;  2DN0 A;  3B6A A;  1GUU A;  3HBL A;  5M5W J;  3WHC A;  1GDT A;  2E2I J;  2XPW A;  1AU7 A;  1JTY A;  4JX5 A;  1O4X A;  2JN6 A;  4A3L J;  1BL0 A;  1ETK A;  2JA7 J;  1QRY A;  2DA3 A;  1MH4 A;  5HOD A;  5DS9 A;  2M0C A;  1XC5 A;  1WCM J;  1E3O C;  2ECC A;  4IHX A;  2XB0 X;  3HB9 A;  2ELK A;  1ITY A;  4QIW N;  1ETV A;  3A03 A;  3M3Y J;  3PO2 J;  2FX0 A;  2TRT A;  1ETO A;  2QF7 A;  3PM1 A;  3FK7 A;  4GFB A;  3GTO J;  1MBJ A;  2K40 A;  2LR8 A;  3JRG A;  3JRF A;  1T56 A;  5BNG A;  1IDZ A;  3HOW J;  4NDL A;  3SFI A;  4J19 A;  4UUS B;  2HI3 A;  4B4C A;  3H3V K;  2EZK A;  4A3G J;  4IHV A;  2QCO A;  1ZR2 A;  1LE8 A;  3GTK J;  3A01 A;  1IC8 A;  2NS7 A;  2L7F P;  3GTM J;  3OIO A;  1H8A C;  4C3H J;  2EZL A;  4M3B A;  3JRD A;  3BTJ A;  5J1U A;  5IYB J;  2HOA A;  1RES A;  1WGX A;  3HOX J;  1VFC A;  1D5Y A;  2Y2Z A;  2PMZ N;  3OSF A;  4X1E A;  4M3G A;  3JRA A;  1B8I B;  2HXI A;  4A3K J;  1H88 C;  2CQQ A;  3UKG A;  2R7Z J;  5IP7 J;  5K7H A;  2JA5 J;  2XGD A;  4MFD A;  1GT0 C;  5DTD A;  3FKI J;  2LKX A;  3HKZ N;  1LFB A;  2XSD C;  2DMT A;  3GTJ J;  2HDD A;  3S1M J;  5C3E J;  3Q3S A;  1ZGW A;  4M3E A;  1MBK A;  1UHS A;  3BG3 A;  4LOC A;  1RPW A;  3TP0 A;  1I50 J;  2DA1 A;  4I6Z A;  5E3N A;  4ABZ A;  1FIA A;  1NK2 P;  1FTZ A;  2GLO A;  1FIP A;  3QPL A;  3DCF A;  2N8G A;  1BJZ A;  4XRM A;  3RQI A;  1Y1V J;  5EG0 B;  4M6V A;  3BR2 A;  1R9T J;  4B3A A;  3BG9 A;  4X6A J;  5EF6 A;  5IYD J;  1ZKG A;  2H1K A;  5M5X J;  3RZD J;  3L1P A;  1LE8 B;  5K7Z A;  1UMQ A;  5EGO A;  2IEK A;  3S1N J;  2YS9 A;  2DA7 A;  1I6H J;  1P7J A;  1JUP A;  4D7N A;  3G1O A;  1HLV A;  1WH5 A;  3BQZ A;  1ZK8 A;  1TWH J;  1XG1 A;  3GBG A;  2DJN A;  3RZO J;  4I76 A;  3W6V A;  2O9L A;  2XRL A;  1SAN A;  1F36 A;  1RR7 A;  2NVT J;  2DMQ A;  1Y1W J;  5FKO A;  5FKL A;  5J1R A;  1T33 A;  1IG7 A;  2R5Y A;  3Q0W A;  4S0H B;  1A5J A;  1GV2 A;  1JGG A;  3G1M A;  2FD5 A;  2M9H A;  2Y9Y A;  4IHY A;  1MBE A;  4IHW A;  5GPC A;  1VND A;  5FKM A;  3CMY A;  5JLW A;  4A3D J;  2FQ4 A;  2O7O A;  5C44 J;  1PUF A;  2E2H J;  1MH3 A;  2X6O A;  2VI6 A;  3B6C A;  3LSP A;  1DU6 A;  4A3M J;  1IGN A;  3QPS A;  3BR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...