3M3YJ

Rna polymerase ii elongation complex c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3m3yJ00
1VI0A 4A3MJ 4XRMA 3BG3A 1IDZA 3BR6A 4Y7NJ 4A93J 1R9TJ 2R5ZB 1MBEA 3DCFA 1TWCJ 1G2HA 4BBSJ 1UG2A 5FKLA 3F0CA 2M0CA 3S16J 3RZOJ 3GTPJ 3HBLA 3QPLA 5EGOA 2IBDA 1QVUA 3ZQLA 2L9RA 5JLXA 4GFBA 1IG7A 1WGXA 3MKLA 3G1MA 3BQZA 1QPIA 1NK3P 1RETA 3TW6A 1FIAA 4JX4A 1LFBA 5EF6A 1LFUP 1RR7A 4BXXJ 1BW5A 4FE4A 4JYKA 2K9QA 2VI6A 4B1RA 5C44J 2DA5A 2JWTA 4AUXA 2AO9A 1U8BA 3I4MJ 1ETKA 2MG4A 1JUPA 2JA8J 2N8GA 2O9LA 4A3CJ 4QTRA 2MW8A 5E3OA 3QPSA 4EEFG 3G1LA 3HGYA 1XC5A 1FJLA 2LTPA 1GV5A 2VKEA 1RKTA 4W97A 3B6AA 2CQXA 3O8HA 1MSFC 2JA7J 3HOYJ 5IP6A 1AKHB 2D5VA 4DYRA 3GTLJ 3Q0WA 1IUFA 4MFDA 4M3EA 1K83J 2DA7A 5C3EJ 1JUSA 2EZHA 2P81A 2XSDC 3SJMA 5E3MA 4L5EA 2OF7A 3LNQA 3FKIJ 2ECBA 2EH3A 5C4XJ 4MFEA 5M5YJ 4A3JJ 5K7HA 5EZHA 1E3OC 1JTXA 2G0EA 4DZJA 1ETVA 1IV6A 2EBIA 2XGCA 5M3MJ 1AKHA 1X2NA 2R5YA 2DMNA 5GP9A 2IEKA 3A01A 5FKOA 2L7ZA 1F36A 2VUMJ 2ID3A 4JP0A 1FTZA 2YUSA 2Y30A 3PM1A 3M3YJ 2DJNA 5EZGA 3JRAA 1W0UA 3M4OJ 4UUSA 3HDDA 3OOUA 2NOGA 4V2FA 2M34A 1X2MA 5FKKA 4IEJA 2AHQA 1TWAJ 4JX6A 1HCRA 1B72B 1B8IB 3S1MJ 4J19A 3GTOJ 4ABZA 4A3BJ 5EG0A 2DA3A 1O4XA 4G12A 1BJZA 4AYBN 4FTHA 2DA2A 2FQ4A 5IPAA 1IGNA 2X9DA 3HOVJ 5HODA 2R7ZJ 1MH4A 2Y31A 3D1NI 3K2AA 3C2BA 2EZIA 2HOAA 1ZKGA 1B8IA 3OIOA 1MBJA 2HYJA 3BTJA 2YU9J 1Y1VJ 3S1NJ 2X6OA 1WPKA 2Y9YA 2OPTA 4XRSA 2R93J 2XPVA 1GT0C 2I10A 5GPAA 3IV5A 3HOWJ 3HKZN 1YRNA 3LSJA 3K7AJ 4QSHA 1EF4A 5F0HA 3UKGA 1JKPC 1OCTC 3JRHA 2JMWA 2DA6A 3H3VK 1RESA 2FJ1A 3FK7A 3HEFA 1IDYA 2NS7A 2R5YB 1IC8A 1GDTA 4FISA 4BKXA 3GTJJ 4DZPA 1TWGJ 3BTIA 1HLVA 1JJ8C 1BA5A 2R5ZA 5J1RA 4DYCA 3HM5A 9ANTA 1U9NA 2VKVA 4CYCB 1QVTA 3RKQA 2DA4A 3BR3A 4CYCA 2NVYJ 3S1QJ 2XPUA 4MLOA 5IYBJ 3ZOBA 1JJ6C 3TEDA 4A3DJ 4M6VA 2ELKA 3LOCA 1SANA 1FTTA 1BW6A 4MIMA 1VFCA 3S15J 2HXOA 4A3KJ 1IRZA 3CCYA 2COBA 2M9HA 3HB9A 2M2EA 4JX5A 1ETOA 1BL0A 2NS8A 1JTYA 2MGQA 2X48A 4XICA 3ZQIA 1RPWA 3QQAA 1FEXA 1I6HJ 3Q3SA 1GV2A 5EYRA 3W6VA 5FKMA 3RZDJ 3H0GJ 3Q0VA 4XIDA 3L1PA 4D7NA 1H89C 2KDZA 2CQQA 5IYCJ 4UUTA 2JK3A 4FCYA 1Z77A 2VPRA 1MBHA 2GM4A 2XB0X 3HOUJ 2EZLA 1ZTRA 1MBKA 2NVQJ 5F04A 4QIWN 1WH7A 2Y0SN 1D5YA 4M3DA 3BR1A 2JA6J 1POGA 2K9SA 3HGGA 5BNGA 3TP3A 3FISA 2CJJA 3LSGA 1Y1WJ 2HXIA 3BR2A 3FIWA 4M3FA 2R92J 3NAUA 1HOMA 1OFCX 2CU7A 1U78A 3JRIA 1GVDA 1MBFA 4XK4A 2L7MP 3BTCA 2O7OA 5K7FA 3JRBA 1WI3A 2CRGA 3JR9A 3I4NJ 1T33A 2DMUA 3WHBA 3IH2A 3LSRA 5EDNA 3JRCA 1JKQC 4A3FJ 4C3JJ 2LKXA 2ID6A 1DU0A 1CQTA 1H8AC 3Q0UA 2H8RA 1T56A 2JN6A 1S7EA 5F08A 2LD5A 2E2HJ 2ME0A 1ENHA 1I3QJ 1VNDA 1HF0A 5J1YA 4A3EJ 1TC3C 3ZQFA 2K40A 2HOTA 1GUUA 1K61A 2CUEA 1ZR2A 1JKOC 1TWFJ 2HOSA 5M3FJ 1JT6A 4RBOA 3OSGA 4IHYA 1ZK8A 1OCPA 1MSEC 4D7MA 1A5JA 5IOZA 2WAQN 3PO3J 1LE8A 2DA1A 1ZQ3P 2LP0A 2WV1A 4B3AA 2LR8A 4M3BA 3B6CA 1F43A 5J3LA 3BQYA 4RDUA 4IHWA 2YS9A 3GBGA 4D5FA 1MH3A 3JRFA 3GTMJ 1UMQA 1UHSA 3WHCA 3A02A 4B4CA 1YRNB 2HQ5A 2DN0A 3S14J 5EG0B 1JGGA 3A03A 4Y52J 1P7JA 4A3IJ 2LVSA 2FX0A 4X1EA 1IJWC 3VPRA 2LY9A 3ZQHA 4BY7J 1ORKA 2PMZN 3BG5A 1TWHJ 4HNVA 4A3GJ 1APLC 1NTCA 2FD5A 5FKNA 5IP7J 3RQIA 3S1RJ 1P7IA 4C3IJ 5F27A 3S17J 2CUFA 4A3LJ 5IP9J 2IAIA 5EGOB 3BTLA 1LE8B 3CQZJ 4I76A 1OJLA 3HOZJ 3G1OA 1WCMJ 4FE7A 2K9NA 3NARA 3S2DJ 3OSFA 2DMQA 2QF7A 4DW6A 1MBGA 1W0TA 1DU6A 5F0FA 5M5XJ 1ETWA 1XS9A 1PUFA 4MO7A 4X6AJ 2MSYA 1ITYA 2E19A 2E2IJ 1ETXA 2Y9ZA 2TCTA 3TP0A 2H1KA 1Z0XA 1AHDP 3FK6A 3BT9A 2KT0A 2WB1N 1ZR4A 3GTQJ 3BG9A 4D5CA 1A6IA 2ZB9A 5F0CA 2ME6A 1HDDC 4IHVA 1X58A 2XB5A 3E7LA 3JRDA 1H88C 1HDPA 2JA5J 5FLVA 1MNMC 4AC0A 5E3LA 4C3HJ 1RKWA 3MVPA 1ETQA 1JUMA 2O8KA 4S0HB 3BR5A 1I50J 2E2JJ 2RAEA 4V2GA 4IHXA 4UUSB 3LSPA 2L0KA 2DMPA 3CMYA 2XRLA 5M5WJ 1SFOJ 3O8GA 4BBRJ 3DEWA 2QCOA 2E1OA 2Y2ZA 2TRTA 2HDDA 4A69C 1JT0A 1JKRC 3SDGA 2LLKA 2XPWA 2LFBA 4M3GA 2GBYA 1Q1VA 4XRSG 2DMTA 5E3NA 3MN2A 2NVXJ 5EEAA 3JREA 5F1JA 2HI3A 3SFIA 5K7ZA 2L7FP 3JRGA 3GTKJ 5DS9A 4NDLA 3ZQGA 4W1UA 1ETYA 5GPCA 5FLMJ 1FIPA 3GTGJ 3IH4A 1U9OA 1VF9A 2ECCA 2LK2A 2XGDA 1AU7A 4DYQA 4C2MJ 3IH3A 2R0QC 5JLWA 3ZQCA 1QRYA 1XG1A 5IOYA 5J1UA 1NK2P 2XGEA 2JJ7A 4LOCA 2EQRA 1WH5A 2M8GX 4I6ZA 3S2HJ 4BY1J 3A01B 3PO2J 5C4JJ 3HOXJ 3CDLA 3TW7A 5DTDA 5FJ8J 2W48A 2DTZA 3BR0A 1ZGWA 1B72A 2B63J 5IYDJ 2NVTJ 1PUFB 2EZKA 2GLOA
chains in the Genus database with same CATH superfamily
3L9FA 2W7NA 2GIVA 2O61A 1RI7A 3KP5A 4A93J 4BJ6C 3DP7A 1MBEA 3W2AA 1TWCJ 2E1MB 4D9JA 1G2HA 1UG2A 4RGRA 3L2QA 1PJRA 5FKLA 3GTPJ 3B02A 3B73A 3BY6A 3DTIA 2FRHA 3QPLA 2HVSA 2CQNA 3DQVC 3ECHA 3UNGC 3ZQLA 5JLXA 5D5WB 3VSLA 1YW9A 2O8XA 2E36A 2EFWA 1WGXA 1TP4A 3G1MA 3J81K 3FXKA 1VQ7I 1QPIA 1LUJB 4BACA 4BXXJ 2BXYA 1SMTA 2VJ4A 2OQRA 3M8JA 3FXUA 2HTJA 2K9QA 2OD5A 3OL4A 5C44J 2DA5A 2IS4A 2Q2EA 5AIQA 2AO9A 3M9AA 3OYEA 4HBLA 1S8NA 2F5EA 2QBYA 3BDDA 5ICCA 2E7WA 2V79A 2CV1A 2MA3A 3G1LA 5D8LB 4BEHA 3V8KA 3FDYA 3HGYA 1RNLA 5BQTA 2ZMEB 3H0DA 4KUMA 2F5CA 2YPRA 1WJCA 1JI8A 3CCUI 1BI3A 3H36A 3E5UA 1XTAA 2WWYA 4RAGA 3E6BA 3PNYA 1MSFC 3E5XA 1E2XA 4X0GA 2YSRA 3GTLJ 4XR6A 3V7CA 4P96A 3HSFA 3JSPA 4XKCA 1JUSA 4XRFA 2FE3A 4R1HA 4KMFA 4L5EA 2L7KA 2E34A 2MFZA 2OF7A 3OV8A 4RAFA 1IRFA 2ECBA 4E7ZA 1W36D 1EH7A 2O6GE 4C9YA 2XGCA 4TV7A 4HNTA 2DDAA 2BZTA 3MD2A 3AKZA 2R5YA 3DPUA 2DMNA 1Z21A 5GP9A 2XF7A 5ICFA 4HF2A 3BZ6A 5F1RA 4KFCA 2H1LA 1U8RA 3C3WA 1SEUA 1J9IA 4MTEA 2VUMJ 1B9MA 3DLLF 3MKYB 4JP0A 1FTZA 2A6TA 3PM1A 3F72A 4FT8A 2XASA 3M4OJ 3OS1A 4EQQA 4UUSA 1X2MA 2GOXB 3TOAA 2VQGA 1QGPA 4LK0F 5DD4A 5FKKA 4IEJA 2AHQA 1TWAJ 4CH7A 1AOYA 1YYVA 2QUFA 5H6RA 1B72B 1B8IB 3S1MJ 1Z67A 4A3BJ 1TTYA 1XDUA 5EG0A 3ZR8X 3K1NA 1Z6RA 3L2WA 5ED4A 3ABTA 3HHHA 3FXOA 3VSKA 1MDMA 2YX7A 2OZUA 4WX9A 1IGNA 1YW7A 3OWTA 3SZPA 5HODA 3KPHA 2DOEA 2IVMA 1ZLKA 1MH4A 2R7ZJ 1TQIA 1XCVA 2X51A 2QQAA 5DEQA 1QQIA 1XMAA 1UELB 3C2BA 3IC7A 1FY7A 3MZHA 1PUEE 1ZKGA 3RKWA 2HYJA 4ZDLA 5B1AH 4XRSA 3ZMTA 3M1EA 4HV6A 4BHCA 3P9KA 3EUKL 2OJED 1DP3A 3T5XA 3CCEI 3I71A 4B8XA 1LB2A 3BPXA 2VOPA 3LSJA 3FXLA 2EINH 1FOYA 2OBPA 5B5EC 1JKPC 2GXBA 1OCTC 1DGRM 3E97A 1LDJA 4IOAF 3GFIA 2IGNA 2CV2A 4DZPA 5LRSA 2JA2A 2GWRA 2ZMEC 3KP2A 2VKVA 4ENNA 3S3MA 1YX5A 2F6CA 4CYCB 5E8GA 3KEYA 3TO7A 1WRJA 2DA4A 3VFZA 3D5LA 3IUOA 3ZOBA 4Y4RA 1JJ6C 1EJ9A 3TEDA 4A3DJ 4V19K 1SD4A 1N75A 3LOCA 1LQ1A 2LKSA 4OOIA 4AVZA 3C1DA 4ESBA 1FTTA 3K4LA 3OIPA 3J7AO 1XN7A 2CV0A 2CUJA 3HB9A 3LL7A 4M6XA 1ETOA 2HFHA 2EV6A 2R7TA 2NS8A 2MGQA 2IT0A 1MJ9A 4XQFA 2VJJA 1XGSA 2G9WA 2VN2A 2DCEA 4XKWA 3Q3SA 1GV2A 3I58A 3H0GJ 2UZKA 4IF4A 4HSTA 2AXLA 2L4MA 4L9TA 2OAZA 1G3TA 2V6CA 2KDZA 1MMDA 2CQQA 3DKXA 4UUTA 5LGTA 2VQCA 3HTSB 5L3CA 2GM4A 4PJMA 4O5VA 4XOTA 2XB0X 2L9SA 3TOBA 3HOUJ 1ZTRA 2VJIA 3HKZA 3WTWC 4HSRA 1P9QC 1LFPA 1T08B 3D0SA 2BHZA 2EK5A 1TT5B 2FU4A 5D6EA 3AG1H 2K9SA 4BAYA 3HRSA 3HGGA 3QU3A 4XBFA 1RRJA 2GXAA 4N4NB 3BR2A 4ZTJA 2MC3A 2D45A 2KISA 2R92J 4IOCF 1FWZA 2HGCA 4Y33A 4RAYA 1FZPB 4L0ZB 1WI3A 1K4TA 3JR9A 3J7ZI 3LSRA 3NEUA 3QAHA 1UCRA 5EDNA 2PQ8A 1BOAA 4CO8A 4C3JJ 4WWCA 4HF0A 1N77A 4LIUA 3DLAA 1DU0A 2H94A 1BC8C 2HR3A 1GLNA 1T56A 5F08A 1S7EA 2LD5A 2E2HJ 2ME0A 2BV6A 4UB6C 2XKOA 2YU3A 1U0JA 4PJJA 5J1YA 4A3EJ 2HOTA 2QGUA 1XSVA 3KP4A 3U1KA 2L9VA 1TWFJ 3FWEA 2XF5A 4ESJA 4HAMA 1R5HA 3OSGA 5FB2A 1LEAA 2UUZA 4AVPA 4NHJA 2P7VB 1EH8A 4D7MA 1DUXC 1V5GA 3PO3J 3CLQA 4HRIA 4PK4A 3V8JA 2H6CA 4M3BA 3BZCA 3MQ0A 2VOOA 1F43A 1SAUA 4RDUA 4IHWA 1ULYA 3FKJA 2E1CA 4HNUA 2MH2A 1VZ0A 1IXSB 3HOSA 3OYNA 5CVUA 2KKOA 4M73A 2OCCH 5BPIA 3P9IA 2CW0F 3K4BA 2CUZA 1P7JA 3HUGA 4N4OB 1PVEA 4RGXA 3JCUC 4XONA 2A05A 3CUQA 5LEKA 4EJTA 1V54H 1T0FC 1OLTA 3EYYA 5JHUA 2PI0A 3HSEA 3QYFA 3WTTC 4PJLA 2V6EA 4RM2A 4G7HF 1NTCA 4E7LA 2HOEA 5IP7J 1GXPA 1D3YA 3RQIA 2K4BA 3NRVA 5BOXA 4LB5A 1ON2A 4LGWA 1IN8A 4B3XA 2IP2A 3V8LA 5ICGA 1G59A 5IP9J 1T0FA 4UNOA 5D8KB 3BG6A 2RGVA 2X1DA 1YJWI 1E3HA 1IN5A 4XLAA 4R79A 3IHUA 4BE0A 1OJLA 3F21A 2HQAA 3GLXA 3WGGA 2LF8A 3S2DJ 2DMQA 4NC8A 3KYDB 4R8HA 4YG2F 1TLHB 1DU6A 4RA2A 4YIIA 1D8KA 2VIXA 5J4VA 5M5XJ 5DV5A 2O0YA 1Y6IA 4MO7A 4UUVA 1O7FA 5HLGA 1LKXA 2FNPA 1Y39A 2PG4A 2ADUA 3GWZA 3TP0A 3M07A 3LA3A 4PSWA 1R4NB 2H6BA 3I59B 4EJWA 1AHDP 2NVXJ 3FK6A 2ACJA 3ONQA 2K9LA 2W82A 3KYCB 5LGNA 3WTYC 2VODA 1B9NA 2DI3A 2ICWG 3E7LA 1EH6A 3JRDA 1HDPA 2CO5A 3OYBA 4GRIA 3FZVA 3OYHA 1W7PB 4IJAA 3V4GA 2JRMA 4FHTA 4HLXA 3S8PA 1D1CA 3CF2A 1XGOA 3BPVA 2JZYA 4UUSB 4NNJA 3S3NA 1SFOJ 1NHAA 2P5VA 2QZ8A 2ZJ2A 4BBRJ 3DEWA 2PJRA 3BJOA 1B6AA 2Y2ZA 3SFZA 2TRTA 2BVMA 4YIFA 3DBHB 1K79A 4UV8A 1TW2A 1IXRC 3FXMA 2LY1A 1JKRC 1H9TA 2XPWA 5HS9A 5GAHJ 1WJAA 2K27A 2Q0OA 1D1AA 1FOWA 4M72A 2MD0A 5F1JA 4YIRX 1OR7A 2HI3A 3PUBA 2L7FP 2FNAA 3TMOA 5TJJA 1RZ4A 4HG2A 4LITA 5DS9A 3CF5F 4ZZLA 2H8WA 4NDLA 3ZQGA 2XAUA 5GPCA 1A6QA 2ECCA 1VF9A 2CH0A 4OIRF 5E8IA 1AU7A 4DYQA 3IH3A 5DM7F 3ZQCA 3D5SC 2XF6A 2A68F 1VQOI 3IRQA 1FBQA 1QA6A 3DEEA 2JJ7A 3S2HJ 2EQRA 2PFBA 4OAZA 4I6ZA 4BY1J 4WXDA 4XN3A 1D5VA 1AA7A 3HOXJ 3A2KA 1KU2A 3TW7A 3RDIA 2W48A 4L9JA 1HKSA 2XROA 2EV5A 2Z16A 2HEOA 3ZMUA 5TISC 3I4PA 2EZKA 4PCQA 3OYLA 1VI0A 4A3MJ 4C2UA 1IW7F 5KVRA 2JUGA 1E0EA 2ISZA 3BG3A 1IDZA 4Y7NJ 3AG2H 3KP6A 2H27A 4P9UA 3GZ5A 3K6GA 5HDNA 2EFPA 3F0CA 4L18B 3RZOJ 2DPDA 1ZG1A 1O3SA 3F22A 3PNTA 2IBDA 5EGOA 3OYAA 4O3MA 3JTHA 2RVCA 4NQWA 2KRHA 5FGMA 5JHFA 4KJZA 1SVMA 1XMXA 1OQYA 4P55A 1LDDA 3SQNA 1NK3P 4OWRB 5J6XA 3C2HA 1FIAA 3L2RA 1Q1HA 1F9NA 4BEHB 2V1UA 3W2WA 1WJDA 5E1WA 1K4SA 2IS1A 4JYKA 2VXDA 3LFKA 2VI6A 1E17A 4B1RA 4WF2A 2DO7A 3BLYA 2MD5A 4HEA2 3F6OA 4L9VA 1JUPA 4XLFA 3ECOA 2PMUA 1X1DA 2JA8J 1X3WB 2A61A 2KP6A 2M30A 3WG7H 4CHUA 2MH9A 2K86A 2MW8A 2NXNB 5E3OA 3SHFA 4L5IA 2A3SA 4YEJA 4NUBA 1MIJA 5LRRA 1J59A 4LB6B 3TGNA 5D5XB 1RKTA 3UR3C 5D6FA 1FMVA 1YJ9I 3CTAA 3HOYJ 5IP6A 2D5VA 1N25A 4UVBA 2PMHA 1IUFA 4M3EA 2DA7A 1HA8A 2P81A 2XSDC 3SJMA 2V4JC 3RKXA 3CCSI 2E5NA 1BIBA 3REOA 1S9HA 4GXOA 2Q1ZB 2EH3A 2F5VA 3GCMA 4ON0A 2M7BA 2DQRA 3M8FA 5K7HA 5DUIA 4A3JJ 1E3OC 2G0EA 1HSTA 1DPRA 1ETVA 2DYRH 4MNUA 4DZJA 1KQ0A 4ZYHA 1IV6A 2V9KA 1DDNA 5M3MJ 2RNJA 4ZYAA 3JAMK 1KYWA 3QYBA 2ZSIB 3EUAA 2KFDA 2Y75A 5FKOA 1VQ6I 2L7ZA 5HS8A 4HDUA 1MJAA 3DWLE 3RIRA 1TQMA 2QKMB 2Y30A 3KP3A 3R6SA 3M3YJ 1EKEA 3CJTB 3JRAA 3KYLA 2DT5A 5L3FA 4ZTFA 3FXRA 1X19A 2NOGA 4V2FA 3WU0A 2PJPA 2EFQA 4B48A 1ZRDA 3K2ZA 2XAQA 1WJEA 4XLNF 2UWMA 4UVCA 1WSUA 1B1BA 1IV8A 4J19A 2KJCA 3DFGA 4ABZA 3PJRA 5J47A 3CZ6A 5K5RA 2CFXA 1OPCA 4Y15A 3H92A 4DGWB 2R7SA 2D1HA 2DFHA 4PJ0C 2ZFUA 2Y31A 5EEHA 2IJLA 1MMGA 2FMYA 1GXQA 5L3GA 3WE3A 2HYGD 2LNBA 6PAXA 1R58A 1TT0A 3OIOA 1MBJA 3LMMA 3WTVC 2EJRA 3DV8A 3S1NJ 2Y9YA 2UV1A 2QEXI 2A6EF 2MBFA 4DJAA 5D5VB 1GT0C 2LOOA 3CD6I 2KRCA 3R0AA 2L54A 1IO2A 3MCZA 4PSXA 3P5JA 3FMSA 4C2TA 3HKZN 1I6XA 4ENJA 4E7SA 1YRNA 4HQMA 3K7AJ 4QSHA 5F0HA 3M1CA 2QQBA 3K0LA 3JRHA 5ILUA 4HDVA 3HEFA 2FQ3A 2AS5F 4A0ZA 5FROA 3QWLA 3OYJA 3J80Z 2RNGA 4EJVA 4BKXA 3GTJJ 1YO5C 3CC2I 1BA5A 3GXOA 1FC3A 4Q47A 3F6VA 3LA2A 4XNFA 5LHIA 2CW8A 4B44A 1SFEA 3C2GA 3AL0C 1SFUA 3IKVA 3RPUA 2BOLA 4KT6A 4CYCA 2I5UA 1QBJA 1ZGAA 2M4KA 1ZN2A 4OMZA 5IYBJ 4FQGA 4MLOA 4BXUA 2GZWA 4CUGA 2ZXWH 2HDCA 2AQEA 3QPHA 1VFCA 3IAS2 3CCMI 3PFIA 1IRZA 3WTXC 3CCYA 2COBA 4F3QA 4JX5A 3WTZA 4BQOA 3GFJA 1JTYA 2X48A 4XKVA 2VJ5A 2ISYA 3ASNH 3CCVI 2UXXA 4F7ZA 1R22A 3GZ6A 1I6HJ 2FUG2 3L2CA 3U1DA 3AAFA 4IL6C 4IHTA 3KCCA 3IP4B 3CMEI 1H89C 3PQJA 2FOWA 4L5JA 4A0XA 4U88A 4DBQA 1WI9A 4FASD 3A4CA 4BXFA 2KIMA 2P5LC 5BPDA 1ERDA 3HG9A 5IT9K 3BJ6A 2K02A 4U87A 2NOJB 4QIWN 2NS0A 2OV7A 4EJOA 5HVQC 1S29A 3MZYA 2QA4I 1BI2A 2KDOA 2X85A 2Z5UA 3T1BA 3TP3A 1B4AA 3FISA 1FYLA 3LSGA 1F5TA 2HXIA 2LRDA 2LH9A 2RDPA 4HPQA 4EGZA 1OKRA 3CO6C 5HNHA 4KITB 2C6YA 2L02A 3I53A 1HOMA 2JSPA 2ZC2A 3JRIA 1IF1A 1QU3A 1GVDA 1SD7A 1A35A 1W7PA 2O7OA 1LVKA 5K7FA 3CC4I 1KU7A 2JPCA 2CRGA 3KLNA 1R1VA 3KETA 2W00A 4LLNA 3JRCA 1FP1D 4OINF 3DKYA 1ZAOA 3QU6A 2Y0MA 5FRNA 4M74A 2E1NA 1JHFA 1VQLI 4HX8A 1VQNI 3I56I 1YHQI 1H8AC 2HQRA 1UHMA 1Y0NA 2WADA 2JN6A 1LDKB 2OU2A 1D8JA 1SAXA 1BOBA 1VNDA 2BBYA 3G4SI 1ZGJA 2FXAA 1GUUA 2QBYB 4BYYA 1JKOC 2L2OA 5M3FJ 2J5OA 1X3UA 2HOSA 1G6NA 3TDUC 4IHYA 1ZK8A 2Q2EB 4XL9A 2KMUA 1MSEC 3EUHA 5IOZA 2XAJA 1FNNA 2WAQN 3CJNA 5DDGA 2WV1A 3SZGA 1BN5A 3BG7A 3B6CA 1FPQA 2F5DA 2IXSA 3QPTA 4CCNA 4F91B 4YELA 1QPMA 2YS9A 1T39A 3A0BC 3DPLC 3ZP5A 1UHSA 3A02A 4H4KC 1YRNB 2VC0A 2HQ5A 2DN0A 4FX0A 5DUKA 4LJZF 3S14J 1VQ5I 1JGGA 2P6SA 2EB7A 2LC2A 2VKDA 4A3IJ 3EYIA 3N4MA 3H5NA 5KAFC 3PUFA 4X1EA 3K4CA 4KT5C 4CCLA 5FD5A 4IHSA 1J0RA 2OTJI 1OMIA 1LPQA 3LSIA 2F48A 4UV9A 1FP2A 4ZH4F 1A31A 4ETSA 1ZYRF 2MLKA 4HNVA 4A3GJ 1APLC 4RB2C 5FKNA 3OOPA 2VXZA 2RV8A 3NQOA 5F27A 1PP7U 2CUFA 3E6MA 2DDBA 2K3FA 1Z91A 2O5RA 2IAIA 5L3BA 4BU2A 5HS7A 3VDXA 1LE8B 4I76A 4EM2A 4G7OF 3L2UA 4MGRA 2R7WA 5BMZA 1WCMJ 4FE7A 1UAAA 4LIVA 3CP2A 1G3SA 3PSIA 3CO7C 2J5PA 1YOVB 3ZMVA 1W0TA 4CSWA 5F0FA 3IWFA 5CKTA 4HOBA 2TDXA 2WAQA 2CYYA 2MABA 5B3SH 2XRNA 4LG0A 1HC8A 3OIQA 2HKOA 1ETXA 2NYXA 2Y9ZA 2BGCA 1HSJA 2XIGA 3G3ZA 3FBNB 3GVAA 5ERIA 1M1EB 4BJTA 1T38A 2X0LA 4Q48A 3IRRA 2KT0A 1FLIA 5LGUA 1AWCA 2QLZA 3LSKA 2ZXIA 1N78A 4IHVA 2VONA 2XB5A 4A5MA 3KX2A 2LY2A 3FMQA 5FLVA 3IWZA 3RYRA 4RLQA 4CCJA 4AC0A 4OAYA 5E3LA 4ESFA 3MVPA 1ETQA 2ZXHA 3O2PE 3U2RA 1JUMA 3HPHA 3RKYA 2O8KA 1W5TA 2P4WA 2WAFA 4ASNA 2XKPA 4S0HB 2VBWA 4A2UA 1S3JA 4C30A 5IT9Z 1L0OC 2L0KA 2DMPA 2OTLI 4IRGA 1H9GA 2IPQX 1UZCA 3IAM2 3MWMA 1PP8F 4A69C 1JT0A 4L0YB 4G6DA 2XVCA 4CCOA 3OYKA 2LFBA 3H9GA 3L09A 1HW2A 3MN2A 2ESNA 3MFKA 3SFIA 5K7ZA 1F4KA 4KNYA 1J75A 5FFZA 4IZZA 3GUDA 3NWTA 1ONVA 4EMSA 2MYSA 1KGSA 3CCQI 5DD8A 3KLOA 4EJUA 2XC7A 1FIPA 4XM3A 3X2QH 5JLWA 3OYCA 4HV5A 3WODF 2XGEA 2OA4A 4IVNA 3COAC 3A01B 5FFXA 5C4JJ 1QZZA 3CDLA 5DTDA 4NBQA 1W7PD 4JK1X 3J80K 2QQ8A 3EDPA 3HIFA 4ZYEA 3J81Z 3BR0A 2A6HF 5E17F 5CLSA 2FOKA 2GQQA 1PUFB 2Z1DA 2GLOA 1I5ZA 2HZDA 1F1ZA 3H9JA 2E1MC 2BW3A 4IQJA 3OYFA 1NG6A 1DPUA 4BE2A 1X3ZB 3BR6A 5KCMA 2R5ZB 1UFMA 2F4OB 4NB5A 2V9PA 2K85A 4RB0A 1ZARA 2LBFB 1VQMI 2M0CA 1QZYA 1ZHFA 3VYTB 5KK1A 2QQ9A 1LEBA 3M7GA 4F92B 1QHGA 1QVUA 4UHTA 3BP8A 1T95A 2QENA 3BQZA 1I3AA 5EJCA 1YIJI 4LG3A 1RETA 2Z99A 3EQLF 4JX4A 3SDBA 3HZJA 1BW5A 4RGUA 2BY2A 2R7RA 2L01A 4MQVA 4FE4A 4XLCA 3KFWX 3GX4X 4XKBA 1L3LA 2KRFA 1ETKA 4D1QA 1R7JA 3PL8A 2N8GA 4A3CJ 4QTRA 2R4GA 2IGMA 3OL3A 4EEFG 2VQHA 1BR4A 4KIGA 3R60A 1EV7A 2QWWA 5JR3A 4IRIA 4IXAA 4LMYA 2LTPA 4AD9A 1QO0D 1HBXG 3LWFA 3B6AA 3GO5A 1MDMB 2CQXA 3BJAA 3GEZA 2D2WA 1RC9A 3WGHA 3EPZA 4EATA 1KQ9A 2WV0A 3Q0WA 2FA5A 4HYEA 4XOPA 1K83J 2EIMH 5C3EJ 4AIKA 1FX7A 2EZHA 2DK5A 5E3MA 4I98B 5DM6F 1DP7P 2WB1A 1YG2A 1HKQA 5C4XJ 3PNVA 1JTXA 3WE2A 2XAFA 3RJPA 3CDIA 1SVOA 1Y56A 3OMYA 4LLLA 3CCJI 5IT3A 1S72I 2IEKA 3A01A 4MEYF 4KA4A 1USTA 1F36A 3OR1C 3LAPA 4KIBA 3DPTA 1XX5A 2ID3A 2XUBA 2YUSA 5LFAA 1JHHA 2K4JA 4CA0A 1Z7LA 5EZGA 5LEJA 2F5FA 4IX7A 1ZG3A 5ICEA 2M34A 3GF2A 3ZPLA 3KZIC 3H1CA 3LFUA 4O6JA 3ROUA 4QWQA 4JX6A 5H6QA 3CMMA 1HCRA 2RQQA 1WZ2A 4E6KG 2FMLA 3GFMA 2F2EA 3EUHC 4G12A 3QOEA 3ZQQA 4AYBN 4II3A 2DA2A 2FQ4A 4BHBA 4GDFA 4UY8I 1P4XA 2X9DA 2YX4A 2A5YB 5HLHA 1T8IA 1U3EM 4M9ZA 3V7SA 1REPC 3I64A 3CP8A 3ULQB 3D1NI 2ZMEA 1W5SA 2BY0A 2HOAA 5DCMB 2QYOA 3PQKA 4BS9A 4IO9F 3BTJA 3K70D 2R7VA 2L5QA 2X6OA 2CW7A 2OPTA 4PGHA 2XPVA 1FSHA 5HDGA 2IS6A 3MMYB 1FBSA 5GTHC 3W6JB 2I10A 5GPAA 5B66C 1T98A 2CG4A 2VE8A 4F55A 3ESWB 3IV5A 3HOWJ 3FXQA 1MMNA 1XB4A 3Q5FA 4G94A 3K10A 1EF4A 1Z05A 2LDUA 3UKGA 3VYRB 2JMWA 2DA6A 1R49A 4BQQA 2R7OA 3S3OA 2NS7A 2VQLA 2DQLA 3FM5A 3RPUD 1IC8A 1OYIA 5CVIA 5HLTA 4PJNA 1GDTA 4FISA 4B47A 3ABKH 3OYIA 1TWGJ 3DU6A 4E70A 5L3EA 2BVLA 2KJBA 2P0WA 4DYCA 5J1RA 3HM5A 9ANTA 1TNSA 3C7JA 1U9NA 1BI0A 5F64A 2E71A 1QVTA 3LSTA 3PFYA 3RKQA 3BR3A 3VYUB 1SMYF 4E7HA 1PYVA 2XPUA 2KZVA 2ZNYA 1Z9CA 1X1BA 2ELKA 3CMAI 3E6CC 2NNNA 1MNEA 4CYDA 4M6YA 3F8FA 3R61A 5FLXZ 5ILSA 4MTDA 3N97A 4AYBA 2NAZA 3S15J 2OZ6A 2HXOA 4A3KJ 1R23A 2WBMA 2M9HA 1E3PA 2M2EA 3E3VA 1BL0A 4U7DA 4BDZA 3OYGA 1RPWA 2DJIA 2FSWA 3VB2A 1FEXA 3H5AA 5LLQA 2W24A 4XLEA 3HRTA 2KPMA 4HX7A 1FT9A 1R5ID 1Z3YA 2BY1A 3ZXSA 2R7DA 5IYCJ 1XMKA 1YS7A 3CUOA 1BR2A 2JRTA 3K1MA 4PUSA 4E7JA 2VPRA 2PBIA 1LNWA 1P2FA 4WCGA 1MBKA 1FSEA 2B7EA 4JBAA 1VQ9I 5F04A 2Y0SN 4PGGA 4M3DA 3I9V2 3W2VA 2IGKA 3OYDA 2VL8A 1XCBA 2DPUA 2JA6J 3NWSA 1ZRFA 4RLFA 2LKPA 3JW4A 2ELHA 4KMUX 2CJJA 3IL2A 3MZ8A 1Y1WJ 5E79C 3BROA 4I01A 4QPOA 4M3FA 4S04A 1YE9A 3VODA 3M8EA 3NAUA 4ZC3A 1H0MA 2EILH 3H3UA 3LAJA 2CU7A 4XK4A 4UB8C 1G8XA 2VBXA 2L7MP 2BW3B 1MZBA 3JRBA 2V26A 1T33A 1W5CC 3WHBA 3IH2A 2F4MB 2HU9A 2VB6A 2FF4A 3DTEA 5B1BH 2LKXA 3FX3A 1FBUA 1OCRH 2ID6A 2DW4A 5CVVA 1J09A 2EFNA 1DGWY 1WVRA 4ITVA 4IKFA 2DFIA 4ANJA 1RIOH 3KZZA 4GCVA 3E6DA 3FM3A 3GMEA 4AWXB 1TC3C 3AG3H 2K40A 4QPQA 4Z6YA 1K61A 3KIOA 1HKTA 1ZR2A 1R00A 3QODA 2IRFG 1OISA 1W36C 3QOPA 4DOZA 3FHNA 4RBOA 1A5JA 4WXHA 2E35A 2DT6A 2G7HA 3ERMA 1MW7A 2DA1A 4G6QA 2LP0A 3DBLB 2LR8A 3QP5A 4BQNA 4RB3C 1XPXA 2R3SA 1D0ZA 3JRFA 4RS8A 3GTMJ 3WG9A 2HKXA 2DT7B 1UMQA 5E20A 4B4CA 3LQQA 1R4MB 3G2BA 2V7FA 5EG0B 2HWVA 1UG0A 2A5WA 3FXJA 2JTVA 2RQPA 1K7AA 3I54A 2LVSA 3OYMA 2FX0A 1IJWC 3CDHA 2KIFA 1K78B 3VPRA 1KU9A 3VOEA 5AONA 3ZQHA 3ZMSA 1ORKA 1ZLJA 1TWHJ 3BZKA 2FD5A 1P4WA 1FMWA 2H09A 2CQ7A 2IW5A 1Y0UA 2QVOA 3TDZC 4C3IJ 3S1RJ 4KN7X 2HPIA 4YFXF 1P4AA 3BTLA 1X1PA 2P8TA 1R71A 3CQZJ 5ILVA 3QYEA 4JOMA 3O6BB 2LBFA 3HOZJ 2L3DA 2EIJH 1DQUA 1C0WA 3SXYA 2WTEA 3P7NA 1A04A 1MJBA 2LG4A 2VT3A 3CJQB 2QF7A 4N9IA 4DW6A 1MBGA 1X4OA 4LLGF 4UXNA 1RUOA 2DODA 3T0YA 5D5UB 3ELKA 1XSDA 3DF8A 4GYGA 2A07F 4PFPA 4RAZA 1XS9A 2VBZA 3K70C 3HL2A 3TBIA 3CC7I 2E19A 3TO6A 2E2IJ 2H1KA 2JPBA 2W84A 2B9SA 3ZMDA 1K6OA 3FF5A 1ZR4A 1WQ2A 2XV4S 3BCAA 1XGNA 3BG9A 2M5WA 4XSZF 2WA0A 1B59A 2ME6A 1HDDC 2M8EA 3P9CA 4MEXF 4HLYA 1MD0A 1KU3A 3VEPA 3CUQB 1IZ1A 4C3HJ 1I1SA 1HW1A 2GA2A 1KA8A 2W1OA 4MQ9F 1S5LC 1IN6A 3RYPA 3F23A 3BR5A 1I50J 1CF7A 2Z3YA 2RAEA 4FETA 3T8TA 2CMPA 2PMZA 3LSPA 1MKMA 1OYWA 3CMYA 3DXJF 2QM3A 2OCEA 2DYSH 2DAOA 3WU1B 1LJ9A 3IKTA 1HQCA 5J4YA 2LLKA 1XDSA 2HTSA 4M3GA 4NQWB 2GBYA 1Q1VA 2DTRA 5E1ZB 4DNCA 4RB1A 1R1UA 4KN4X 3TL4X 5E3NA 3JREA 1O3RA 1ACIA 1QHHD 3HYIA 3G71I 4ZYDA 1SC7A 2EV0A 2XSJC 1KONA 3JRGA 3ZRGA 1V4RA 2CWEA 5BS6A 4U7BA 2Y69H 1J7KA 5FD6A 4F52A 3AG4H 3F8BA 2ZNZA 3GTGJ 1KQ8A 1U9OA 2M1BA 3SEZA 1UJ8A 4C2MJ 1QRYA 1XG1A 3HHGA 5IOYA 3TQNA 4LK1F 2M8GX 3PO2J 2PEXA 3L00A 4KISA 5FJ8J 1UHWA 4Q5SF 3MKWB 3L7WA 2W57A 1LVAA 3D5RC 4CXFA 1G4DA 5CVRA 3HJEA 2W4SA 3I55I 1FYKA 4CCKA 5LHGA 2M7AA 4XRMA 3V42A 2E60A 1P92A 1R9TJ 1O3TA 2O3FA 1A36A 3DCFA 1ODDA 2ETHA 3RQ4A 3CLOA 4BBSJ 4IPAA 2X4HA 2BHYA 2K3PA 3PIOF 5JFRA 2HPMA 3S16J 3H3ZA 3HBLA 3H9QA 4EVIA 3HRMA 2HNHA 2L9RA 5H20A 1TQPA 1WHUA 4GFBA 3U9GA 2LYCA 2WY7Q 1IG7A 3MKLA 5H2FC 4Y13A 5J40A 2LMDA 4BE1A 3ISPA 4A12A 5GTIC 2V1XA 1BI1A 3TW6A 4DBRA 1VQKI 1LFBA 2HQNA 5EF6A 1RR7A 1LFUP 4I2OA 3JSOA 1WWXA 1U2WA 2QKLB 5GADJ 1T6SA 4U0YA 3ZCOA 3FHZA 2JWTA 4AUXA 3RTRA 2NVUB 2L9NA 1U8BA 3I4MJ 2W85A 2MG4A 5TRDA 2X6WA 3OR2C 4BH9A 2O9LA 3I3LA 2EWNA 3K4MA 1QZEA 3QPSA 1XGMA 3HTUA 1IUYA 1STZA 4WXCA 4B43A 4KDPA 2PN6A 3JAMZ 1XC5A 1FJLA 1HW5A 3K4NA 4U0WA 2FEZA 1GV5A 3RI4A 2VKEA 4W97A 1Z1DA 1O57A 1MMSA 3GYHX 3O8HA 1WKMA 2JA7J 1R5GA 2DBBA 2VLAA 1AKHB 5J8CA 5KHDA 1U5TB 4DYRA 1YITI 3TO9A 1P6RA 2Z9OA 5D4SA 2GOMA 3DEUA 4MFDA 4RM3A 5HOOA 3LNQA 3FKIJ 4MFEA 1BJAA 1JXSA 3ERED 5M5YJ 3MKZA 5EZHA 4OIQF 3R4KA 2LREA 4I7HA 4GO1A 1RR8C 2EBIA 4S05A 1AKHA 3SZTA 1X2NA 2R7QA 2OUMA 4PZJA 1ZH5A 4BUPA 1NH3A 1I1GA 5K5OA 4K2EA 3V7RA 2O03A 1KZHA 2KIUA 1SFXA 4EM1A 2DJNA 3ML6A 1W0UA 4RGSA 2VBYA 3OOUA 4OU0A 4B09A 2HZTA 3HDDA 4AIHA 3S32A 5GAEJ 2BY3A 1S7AA 2M87A 4CDGA 2E5ZA 4D0PA 1O3QA 4NC6A 5AIPA 1ZREA 1W4MA 2HVQA 2KHMA 3E0JB 3E5QA 1FOXA 3VYSB 2LSOA 3GTOJ 3HUGB 4BDYA 2DA3A 4XORA 3L2VA 1O4XA 1BJZA 2HS5A 4FTHA 5IPAA 1OYYA 2GAUA 2JUCA 3LQRA 3HOVJ 2X6XA 2F4IA 2RREA 5JVTA 1V5EA 2OQGA 3BCBA 1MGTA 4CZZA 2GIZA 3K2AA 2D1VA 2HYFA 1O7LA 3OS2A 2PLYA 2EZIA 2BXZA 5DCFA 2Z2SB 1B8IA 4A6DA 2YU9J 1Y1VJ 1Y8RB 1WPKA 4M9XA 2STWA 2R93J 2VKHA 2PX9A 3ZGKA 2P6TA 1FYMA 2STTA 2GXGA 2OC6A 2QSFX 2EFOA 2WAEA 5CQGA 2CS3A 1CGPA 1TBXA 4M9SA 5FO5A 3RPQA 1IRXA 2RN7A 3CUQC 4YFNF 1D0XA 1S6LA 3K4KA 3S93A 1IN4A 5CJ9A 1V55H 4AIDA 3H3VK 1RESA 2FJ1A 3FK7A 3I59A 1IDYA 2R5YB 1USSA 1WFXA 3PSFA 3K1PA 4UVAA 1XD7A 1Y8QB 2FBIA 3BTIA 4LG0B 1HLVA 1JJ8C 4BL0B 2R5ZA 3A0HC 4AM3A 3W3CA 4U0VA 2VASA 3HPGA 5CYVA 3S2WA 3HSRA 2X1CA 2NRAC 1IXCA 4ENKA 2NVYJ 3S1QJ 2V9VA 3GW2A 3I5UA 3R0JA 3AL0B 1R1TA 4N0BA 3OY9A 1Z6TA 4M6VA 1YTYA 3WU2C 1SANA 3HC7A 2QSGX 4YRVA 1BW6A 3H35A 4MIMA 2KIQA 2XAHA 1X4PA 4EGYA 4AIJA 2M45A 1ON1A 2DOAA 5F6FA 4I99C 2EA2A 4HA8A 5E1XA 4XICA 5CQEA 3ZQIA 4A6EA 4II2A 3QQAA 5E18F 3RCOA 5EYRA 5A2QZ 5A2QK 2Z33A 3W6VA 5FKMA 3RZDJ 3Q0VA 4XIDA 3L1PA 3KEOA 4G6TB 1BR1A 4D7NA 1D1BA 4EV0A 2ZKZA 3TKYA 3A1YA 2ZBKA 4IRHA 4GYIA 3GFLA 2JK3A 2NNYA 4FCYA 2HDWA 1Z77A 1MBHA 2ZO4A 5D4RA 2M0MA 1YFHA 1IRGA 2EPFA 3PIPF 2EZLA 2V1DA 5DCMA 1Z7UA 1V5FA 2KZGA 1JE8A 2ZFWA 3C18A 4KYWA 2NVQJ 5CVJA 5HLIA 5JI6A 2VE9A 2KLOA 4PDKA 4P5OA 1WH7A 1D5YA 1U6GA 3ZN1A 1W1WE 2ZXJA 4BJ5C 3BR1A 2BEOA 2YR2A 5IY5H 4OMYA 5K1YA 4CGZA 1POGA 4ZDOA 3LSHA 2CQKA 3JTGA 5HNFA 4PFOA 5BNGA 4H0EA 1CF7B 3FIWA 2EIKH 1Z3XA 1I39A 3GZNB 4YFKF 1IAWA 2LF7A 1SVLA 1OFCX 1OCOH 4FX4A 5LHHA 2M3AA 1BC7C 1VTNC 1U78A 1XSXA 1MBFA 2MC4A 1I27A 3BTCA 5K5QA 4OIOF 4CCMA 1UB9A 3LA7A 4G9YA 3I4NJ 2DMUA 2EA4A 1JKQC 2IGOA 5DYMA 4A3FJ 4NC7A 1ZG5A 4I0BA 2Q8KA 3N05A 2Y48A 2CFOA 1CQTA 3F8NA 1X1AA 3Q0UA 5J8FA 3CCLI 2H8RA 1ZRCA 4OIPF 3VWBA 2M4GA 4LD5A 1ENHA 1I3QJ 1YW8A 4J01A 3ABLH 1HF0A 4DQ2A 4ZYGA 1G3YA 2IA1A 2VT2A 3ZQFA 4A5NA 2UXNA 2CUEA 2KL4A 2ZCWA 5L3DA 3U21A 1T2KA 4I09A 3QRFF 1K78A 4N9HA 2P5KA 1JT6A 1YQAA 2X6YA 3K69A 4KICA 3WGIA 1VQ4I 2RC4A 1VQPI 1OCPA 2CGPA 4MHGA 2JSCA 2R7UA 1TW3A 1LE8A 1ZQ3P 5KNLA 4Z2YA 2W25A 4B3AA 3BC8A 5HDKA 3OS0A 2CSOA 2WC2A 2VPLA 1U5TC 3KP7A 3T8RA 5J3LA 3BQYA 4QLCU 4WK8F 3GBGA 4D5FA 1MH3A 1TZLA 4Y3OA 3K4JA 2FBHA 3F8CA 3WHCA 2R7XA 2KQRA 3HOTA 3RSNA 3G6EI 1OCCH 4XMYA 3A03A 2PJRB 2R7FA 4Y52J 3W6KB 2DU9A 5FRMA 2MLGA 1OCZH 2BYVE 4KIFA 4J00A 2AQFA 4HW0A 1J2XA 2XHKA 2WY8Q 1BIAA 2ZJQF 4P1WA 3CCRI 2LY9A 1WJ5A 4BHPA 4E7KA 4I0AA 4A0YA 4BY7J 3HRUA 2PMZN 3BG5A 3E1SA 1V3FA 5LBQA 2ELJA 2DLLA 2ZJRF 1P7IA 4XSXF 3LSMA 3K9TA 4CICA 3CESA 3S17J 2V1NA 4G7ZF 4XLHA 2G7UA 5KAIC 4A3LJ 1SD5A 3GLLA 2BE5F 3ZMZA 2JQ7A 5EGOB 3FMRA 4RMNA 1RUNA 3Q9VA 3ASOH 1GHCA 3G1OA 2ESHA 5TGTA 2K9NA 1SFKA 3O3KA 3NARA 2DFFA 3DU5A 2E7XA 3MAJA 3OSFA 1BM9A 5GAGJ 1ZELA 1YJNI 3J7AY 3J7YJ 2FBKA 1IN7A 2L4AA 2QSHX 1PDNC 1BBYA 1OR7C 1ETWA 1QNTA 2JT1A 1K6YA 2HVRA 4E7IA 1PUFA 5FLXK 4X6AJ 3ZQ7A 2MSYA 1ITYA 4ZJZA 1TNTA 2TCTA 1Z0XA 1TL8A 3AFHA 2X1EA 3BT9A 1EA3A 1NG7A 4GGGA 1KYZA 2WB1N 3GTQJ 1YX3A 3I0TA 4D5CA 1A6IA 4XN0A 3F3XA 2IS2A 2K9MA 2ZB9A 1YI2I 5F0CA 1YLFA 1MMAA 4HZFA 3H5RA 1X58A 1J5YA 1MNDA 4Q4ZF 1H88C 2K7LA 2DFEA 3F8MA 2RKHA 2VC1A 5CPRB 3SEQA 3ZN0A 2JA5J 2IA0A 1S7OA 2Y0SA 4ZDPA 4ZZDA 1MNMC 4I02A 1RKWA 4HQEA 3SYTA 4BQAA 3FBIB 2A69F 2E2JJ 4V2GA 2XDVA 4IHXA 1U5TA 1WJBA 3QP6A 3ABMH 3MEXA 2DK8A 2AXTC 2XRLA 5M5WJ 3O8GA 3EETA 3ABUA 2QCOA 3KE2A 1WJFA 2E1OA 4BGDA 3DTKA 3KEQA 4BNCA 4AU7A 4E4HA 2HDDA 1VQ8I 4DIQA 2DOFA 3DKWA 3SDGA 5JVGF 2P7CB 3BWGA 1R36A 4XRSG 4EM0B 2DMTA 4L9NA 5EEAA 4JQFA 1YIOA 4P9FA 5EEGA 2XAGA 3GTKJ 4XLPF 2JVGA 4F93B 4HF1A 2GA1A 2ZJPF 2I8DA 4M71A 4W1UA 1ETYA 5FLMJ 1X1CA 3IH4A 2LK2A 4ENMA 2XGDA 4LFUA 2ZSHB 2K5CA 3G73A 2B0LA 4G8XA 1D0YA 3Q9SA 4Y17A 3WTSC 3WTUC 2COMA 2R0QC 5LD2C 5J1UA 4HX4A 1NK2P 3F9KA 3BOQA 4LOCA 1WH5A 1GVJA 3KZYA 4IQ4A 1JGSA 1YS6A 2DTZA 1HXDA 1FOKA 1SD6A 3CJRB 1ZGWA 1B72A 2B63J 5IYDJ 3HXLA 2NVTJ 1G3WA 3DBRB 4CZCA 2DXIA 2XGXA 1R6RA 2JVHA 2IA2A
chains in the Genus database with same CATH topology
1VI0A 4A3MJ 4XRMA 3BG3A 1IDZA 3BR6A 4Y7NJ 4A93J 1R9TJ 2R5ZB 1MBEA 3DCFA 1TWCJ 1G2HA 4BBSJ 1UG2A 5FKLA 3F0CA 2M0CA 3S16J 3RZOJ 3GTPJ 3HBLA 3QPLA 5EGOA 2IBDA 1QVUA 3ZQLA 2L9RA 5JLXA 4GFBA 1IG7A 1WGXA 3MKLA 3G1MA 3BQZA 1QPIA 1NK3P 1RETA 3TW6A 1FIAA 4JX4A 1LFBA 5EF6A 1LFUP 1RR7A 4BXXJ 1BW5A 4FE4A 4JYKA 2K9QA 2VI6A 4B1RA 5C44J 2DA5A 2JWTA 4AUXA 2AO9A 1U8BA 3I4MJ 1ETKA 2MG4A 1JUPA 2JA8J 2N8GA 2O9LA 4A3CJ 4QTRA 2MW8A 5E3OA 3QPSA 4EEFG 3G1LA 3HGYA 1XC5A 1FJLA 2LTPA 1GV5A 2VKEA 1RKTA 4W97A 3B6AA 2CQXA 3O8HA 1MSFC 2JA7J 3HOYJ 5IP6A 1AKHB 2D5VA 4DYRA 3GTLJ 3Q0WA 1IUFA 4MFDA 4M3EA 1K83J 2DA7A 5C3EJ 1JUSA 2EZHA 2P81A 2XSDC 3SJMA 5E3MA 4L5EA 2OF7A 3LNQA 3FKIJ 2ECBA 2EH3A 5C4XJ 4MFEA 5M5YJ 4A3JJ 5K7HA 5EZHA 1E3OC 1JTXA 2G0EA 4DZJA 1ETVA 1IV6A 2EBIA 2XGCA 5M3MJ 1AKHA 1X2NA 2R5YA 2DMNA 5GP9A 2IEKA 3A01A 5FKOA 2L7ZA 1F36A 2VUMJ 2ID3A 4JP0A 1FTZA 2YUSA 2Y30A 3PM1A 3M3YJ 2DJNA 5EZGA 3JRAA 1W0UA 3M4OJ 4UUSA 3HDDA 3OOUA 2NOGA 4V2FA 2M34A 1X2MA 5FKKA 4IEJA 2AHQA 1TWAJ 4JX6A 1HCRA 1B72B 1B8IB 3S1MJ 4J19A 3GTOJ 4ABZA 4A3BJ 5EG0A 2DA3A 1O4XA 4G12A 1BJZA 4AYBN 4FTHA 2DA2A 2FQ4A 5IPAA 1IGNA 2X9DA 3HOVJ 5HODA 2R7ZJ 1MH4A 2Y31A 3D1NI 3K2AA 3C2BA 2EZIA 2HOAA 1ZKGA 1B8IA 3OIOA 1MBJA 2HYJA 3BTJA 2YU9J 1Y1VJ 3S1NJ 2X6OA 1WPKA 2Y9YA 2OPTA 4XRSA 2R93J 2XPVA 1GT0C 2I10A 5GPAA 3IV5A 3HOWJ 3HKZN 1YRNA 3LSJA 3K7AJ 4QSHA 1EF4A 5F0HA 3UKGA 1JKPC 1OCTC 3JRHA 2JMWA 2DA6A 3H3VK 1RESA 2FJ1A 3FK7A 3HEFA 1IDYA 2NS7A 2R5YB 1IC8A 1GDTA 4FISA 4BKXA 3GTJJ 4DZPA 1TWGJ 3BTIA 1HLVA 1JJ8C 1BA5A 2R5ZA 5J1RA 4DYCA 3HM5A 9ANTA 1U9NA 2VKVA 4CYCB 1QVTA 3RKQA 2DA4A 3BR3A 4CYCA 2NVYJ 3S1QJ 2XPUA 4MLOA 5IYBJ 3ZOBA 1JJ6C 3TEDA 4A3DJ 4M6VA 2ELKA 3LOCA 1SANA 1FTTA 1BW6A 4MIMA 1VFCA 3S15J 2HXOA 4A3KJ 1IRZA 3CCYA 2COBA 2M9HA 3HB9A 2M2EA 4JX5A 1ETOA 1BL0A 2NS8A 1JTYA 2MGQA 2X48A 4XICA 3ZQIA 1RPWA 3QQAA 1FEXA 1I6HJ 3Q3SA 1GV2A 5EYRA 3W6VA 5FKMA 3RZDJ 3H0GJ 3Q0VA 4XIDA 3L1PA 4D7NA 1H89C 2KDZA 2CQQA 5IYCJ 4UUTA 2JK3A 4FCYA 1Z77A 2VPRA 1MBHA 2GM4A 2XB0X 3HOUJ 2EZLA 1ZTRA 1MBKA 2NVQJ 5F04A 4QIWN 1WH7A 2Y0SN 1D5YA 4M3DA 3BR1A 2JA6J 1POGA 2K9SA 3HGGA 5BNGA 3TP3A 3FISA 2CJJA 3LSGA 1Y1WJ 2HXIA 3BR2A 3FIWA 4M3FA 2R92J 3NAUA 1HOMA 1OFCX 2CU7A 1U78A 3JRIA 1GVDA 1MBFA 4XK4A 2L7MP 3BTCA 2O7OA 5K7FA 3JRBA 1WI3A 2CRGA 3JR9A 3I4NJ 1T33A 2DMUA 3WHBA 3IH2A 3LSRA 5EDNA 3JRCA 1JKQC 4A3FJ 4C3JJ 2LKXA 2ID6A 1DU0A 1CQTA 1H8AC 3Q0UA 2H8RA 1T56A 2JN6A 1S7EA 5F08A 2LD5A 2E2HJ 2ME0A 1ENHA 1I3QJ 1VNDA 1HF0A 5J1YA 4A3EJ 1TC3C 3ZQFA 2K40A 2HOTA 1GUUA 1K61A 2CUEA 1ZR2A 1JKOC 1TWFJ 2HOSA 5M3FJ 1JT6A 4RBOA 3OSGA 4IHYA 1ZK8A 1OCPA 1MSEC 4D7MA 1A5JA 5IOZA 2WAQN 3PO3J 1LE8A 2DA1A 1ZQ3P 2LP0A 2WV1A 4B3AA 2LR8A 4M3BA 3B6CA 1F43A 5J3LA 3BQYA 4RDUA 4IHWA 2YS9A 3GBGA 4D5FA 1MH3A 3JRFA 3GTMJ 1UMQA 1UHSA 3WHCA 3A02A 4B4CA 1YRNB 2HQ5A 2DN0A 3S14J 5EG0B 1JGGA 3A03A 4Y52J 1P7JA 4A3IJ 2LVSA 2FX0A 4X1EA 1IJWC 3VPRA 2LY9A 3ZQHA 4BY7J 1ORKA 2PMZN 3BG5A 1TWHJ 4HNVA 4A3GJ 1APLC 1NTCA 2FD5A 5FKNA 5IP7J 3RQIA 3S1RJ 1P7IA 4C3IJ 5F27A 3S17J 2CUFA 4A3LJ 5IP9J 2IAIA 5EGOB 3BTLA 1LE8B 3CQZJ 4I76A 1OJLA 3HOZJ 3G1OA 1WCMJ 4FE7A 2K9NA 3NARA 3S2DJ 3OSFA 2DMQA 2QF7A 4DW6A 1MBGA 1W0TA 1DU6A 5F0FA 5M5XJ 1ETWA 1XS9A 1PUFA 4MO7A 4X6AJ 2MSYA 1ITYA 2E19A 2E2IJ 1ETXA 2Y9ZA 2TCTA 3TP0A 2H1KA 1Z0XA 1AHDP 3FK6A 3BT9A 2KT0A 2WB1N 1ZR4A 3GTQJ 3BG9A 4D5CA 1A6IA 2ZB9A 5F0CA 2ME6A 1HDDC 4IHVA 1X58A 2XB5A 3E7LA 3JRDA 1H88C 1HDPA 2JA5J 5FLVA 1MNMC 4AC0A 5E3LA 4C3HJ 1RKWA 3MVPA 1ETQA 1JUMA 2O8KA 4S0HB 3BR5A 1I50J 2E2JJ 2RAEA 4V2GA 4IHXA 4UUSB 3LSPA 2L0KA 2DMPA 3CMYA 2XRLA 5M5WJ 1SFOJ 3O8GA 4BBRJ 3DEWA 2QCOA 2E1OA 2Y2ZA 2TRTA 2HDDA 4A69C 1JT0A 1JKRC 3SDGA 2LLKA 2XPWA 2LFBA 4M3GA 2GBYA 1Q1VA 4XRSG 2DMTA 5E3NA 3MN2A 2NVXJ 5EEAA 3JREA 5F1JA 2HI3A 3SFIA 5K7ZA 2L7FP 3JRGA 3GTKJ 5DS9A 4NDLA 3ZQGA 4W1UA 1ETYA 5GPCA 5FLMJ 1FIPA 3GTGJ 3IH4A 1U9OA 1VF9A 2ECCA 2LK2A 2XGDA 1AU7A 4DYQA 4C2MJ 3IH3A 2R0QC 5JLWA 3ZQCA 1QRYA 1XG1A 5IOYA 5J1UA 1NK2P 2XGEA 2JJ7A 4LOCA 2EQRA 1WH5A 2M8GX 4I6ZA 3S2HJ 4BY1J 3A01B 3PO2J 5C4JJ 3HOXJ 3CDLA 3TW7A 5DTDA 5FJ8J 2W48A 2DTZA 3BR0A 1ZGWA 1B72A 2B63J 5IYDJ 2NVTJ 1PUFB 2EZKA 2GLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI0 A;  4A3M J;  4XRM A;  3BG3 A;  1IDZ A;  3BR6 A;  4Y7N J;  4A93 J;  1R9T J;  2R5Z B;  1MBE A;  3DCF A;  1TWC J;  1G2H A;  4BBS J;  1UG2 A;  5FKL A;  3F0C A;  2M0C A;  3S16 J;  3RZO J;  3GTP J;  3HBL A;  3QPL A;  5EGO A;  2IBD A;  1QVU A;  3ZQL A;  2L9R A;  5JLX A;  4GFB A;  1IG7 A;  1WGX A;  3MKL A;  3G1M A;  3BQZ A;  1QPI A;  1NK3 P;  1RET A;  3TW6 A;  1FIA A;  4JX4 A;  1LFB A;  5EF6 A;  1LFU P;  1RR7 A;  4BXX J;  1BW5 A;  4FE4 A;  4JYK A;  2K9Q A;  2VI6 A;  4B1R A;  5C44 J;  2DA5 A;  2JWT A;  4AUX A;  2AO9 A;  1U8B A;  3I4M J;  1ETK A;  2MG4 A;  1JUP A;  2JA8 J;  2N8G A;  2O9L A;  4A3C J;  4QTR A;  2MW8 A;  5E3O A;  3QPS A;  4EEF G;  3G1L A;  3HGY A;  1XC5 A;  1FJL A;  2LTP A;  1GV5 A;  2VKE A;  1RKT A;  4W97 A;  3B6A A;  2CQX A;  3O8H A;  1MSF C;  2JA7 J;  3HOY J;  5IP6 A;  1AKH B;  2D5V A;  4DYR A;  3GTL J;  3Q0W A;  1IUF A;  4MFD A;  4M3E A;  1K83 J;  2DA7 A;  5C3E J;  1JUS A;  2EZH A;  2P81 A;  2XSD C;  3SJM A;  5E3M A;  4L5E A;  2OF7 A;  3LNQ A;  3FKI J;  2ECB A;  2EH3 A;  5C4X J;  4MFE A;  5M5Y J;  4A3J J;  5K7H A;  5EZH A;  1E3O C;  1JTX A;  2G0E A;  4DZJ A;  1ETV A;  1IV6 A;  2EBI A;  2XGC A;  5M3M J;  1AKH A;  1X2N A;  2R5Y A;  2DMN A;  5GP9 A;  2IEK A;  3A01 A;  5FKO A;  2L7Z A;  1F36 A;  2VUM J;  2ID3 A;  4JP0 A;  1FTZ A;  2YUS A;  2Y30 A;  3PM1 A;  3M3Y J;  2DJN A;  5EZG A;  3JRA A;  1W0U A;  3M4O J;  4UUS A;  3HDD A;  3OOU A;  2NOG A;  4V2F A;  2M34 A;  1X2M A;  5FKK A;  4IEJ A;  2AHQ A;  1TWA J;  4JX6 A;  1HCR A;  1B72 B;  1B8I B;  3S1M J;  4J19 A;  3GTO J;  4ABZ A;  4A3B J;  5EG0 A;  2DA3 A;  1O4X A;  4G12 A;  1BJZ A;  4AYB N;  4FTH A;  2DA2 A;  2FQ4 A;  5IPA A;  1IGN A;  2X9D A;  3HOV J;  5HOD A;  2R7Z J;  1MH4 A;  2Y31 A;  3D1N I;  3K2A A;  3C2B A;  2EZI A;  2HOA A;  1ZKG A;  1B8I A;  3OIO A;  1MBJ A;  2HYJ A;  3BTJ A;  2YU9 J;  1Y1V J;  3S1N J;  2X6O A;  1WPK A;  2Y9Y A;  2OPT A;  4XRS A;  2R93 J;  2XPV A;  1GT0 C;  2I10 A;  5GPA A;  3IV5 A;  3HOW J;  3HKZ N;  1YRN A;  3LSJ A;  3K7A J;  4QSH A;  1EF4 A;  5F0H A;  3UKG A;  1JKP C;  1OCT C;  3JRH A;  2JMW A;  2DA6 A;  3H3V K;  1RES A;  2FJ1 A;  3FK7 A;  3HEF A;  1IDY A;  2NS7 A;  2R5Y B;  1IC8 A;  1GDT A;  4FIS A;  4BKX A;  3GTJ J;  4DZP A;  1TWG J;  3BTI A;  1HLV A;  1JJ8 C;  1BA5 A;  2R5Z A;  5J1R A;  4DYC A;  3HM5 A;  9ANT A;  1U9N A;  2VKV A;  4CYC B;  1QVT A;  3RKQ A;  2DA4 A;  3BR3 A;  4CYC A;  2NVY J;  3S1Q J;  2XPU A;  4MLO A;  5IYB J;  3ZOB A;  1JJ6 C;  3TED A;  4A3D J;  4M6V A;  2ELK A;  3LOC A;  1SAN A;  1FTT A;  1BW6 A;  4MIM A;  1VFC A;  3S15 J;  2HXO A;  4A3K J;  1IRZ A;  3CCY A;  2COB A;  2M9H A;  3HB9 A;  2M2E A;  4JX5 A;  1ETO A;  1BL0 A;  2NS8 A;  1JTY A;  2MGQ A;  2X48 A;  4XIC A;  3ZQI A;  1RPW A;  3QQA A;  1FEX A;  1I6H J;  3Q3S A;  1GV2 A;  5EYR A;  3W6V A;  5FKM A;  3RZD J;  3H0G J;  3Q0V A;  4XID A;  3L1P A;  4D7N A;  1H89 C;  2KDZ A;  2CQQ A;  5IYC J;  4UUT A;  2JK3 A;  4FCY A;  1Z77 A;  2VPR A;  1MBH A;  2GM4 A;  2XB0 X;  3HOU J;  2EZL A;  1ZTR A;  1MBK A;  2NVQ J;  5F04 A;  4QIW N;  1WH7 A;  2Y0S N;  1D5Y A;  4M3D A;  3BR1 A;  2JA6 J;  1POG A;  2K9S A;  3HGG A;  5BNG A;  3TP3 A;  3FIS A;  2CJJ A;  3LSG A;  1Y1W J;  2HXI A;  3BR2 A;  3FIW A;  4M3F A;  2R92 J;  3NAU A;  1HOM A;  1OFC X;  2CU7 A;  1U78 A;  3JRI A;  1GVD A;  1MBF A;  4XK4 A;  2L7M P;  3BTC A;  2O7O A;  5K7F A;  3JRB A;  1WI3 A;  2CRG A;  3JR9 A;  3I4N J;  1T33 A;  2DMU A;  3WHB A;  3IH2 A;  3LSR A;  5EDN A;  3JRC A;  1JKQ C;  4A3F J;  4C3J J;  2LKX A;  2ID6 A;  1DU0 A;  1CQT A;  1H8A C;  3Q0U A;  2H8R A;  1T56 A;  2JN6 A;  1S7E A;  5F08 A;  2LD5 A;  2E2H J;  2ME0 A;  1ENH A;  1I3Q J;  1VND A;  1HF0 A;  5J1Y A;  4A3E J;  1TC3 C;  3ZQF A;  2K40 A;  2HOT A;  1GUU A;  1K61 A;  2CUE A;  1ZR2 A;  1JKO C;  1TWF J;  2HOS A;  5M3F J;  1JT6 A;  4RBO A;  3OSG A;  4IHY A;  1ZK8 A;  1OCP A;  1MSE C;  4D7M A;  1A5J A;  5IOZ A;  2WAQ N;  3PO3 J;  1LE8 A;  2DA1 A;  1ZQ3 P;  2LP0 A;  2WV1 A;  4B3A A;  2LR8 A;  4M3B A;  3B6C A;  1F43 A;  5J3L A;  3BQY A;  4RDU A;  4IHW A;  2YS9 A;  3GBG A;  4D5F A;  1MH3 A;  3JRF A;  3GTM J;  1UMQ A;  1UHS A;  3WHC A;  3A02 A;  4B4C A;  1YRN B;  2HQ5 A;  2DN0 A;  3S14 J;  5EG0 B;  1JGG A;  3A03 A;  4Y52 J;  1P7J A;  4A3I J;  2LVS A;  2FX0 A;  4X1E A;  1IJW C;  3VPR A;  2LY9 A;  3ZQH A;  4BY7 J;  1ORK A;  2PMZ N;  3BG5 A;  1TWH J;  4HNV A;  4A3G J;  1APL C;  1NTC A;  2FD5 A;  5FKN A;  5IP7 J;  3RQI A;  3S1R J;  1P7I A;  4C3I J;  5F27 A;  3S17 J;  2CUF A;  4A3L J;  5IP9 J;  2IAI A;  5EGO B;  3BTL A;  1LE8 B;  3CQZ J;  4I76 A;  1OJL A;  3HOZ J;  3G1O A;  1WCM J;  4FE7 A;  2K9N A;  3NAR A;  3S2D J;  3OSF A;  2DMQ A;  2QF7 A;  4DW6 A;  1MBG A;  1W0T A;  1DU6 A;  5F0F A;  5M5X J;  1ETW A;  1XS9 A;  1PUF A;  4MO7 A;  4X6A J;  2MSY A;  1ITY A;  2E19 A;  2E2I J;  1ETX A;  2Y9Z A;  2TCT A;  3TP0 A;  2H1K A;  1Z0X A;  1AHD P;  3FK6 A;  3BT9 A;  2KT0 A;  2WB1 N;  1ZR4 A;  3GTQ J;  3BG9 A;  4D5C A;  1A6I A;  2ZB9 A;  5F0C A;  2ME6 A;  1HDD C;  4IHV A;  1X58 A;  2XB5 A;  3E7L A;  3JRD A;  1H88 C;  1HDP A;  2JA5 J;  5FLV A;  1MNM C;  4AC0 A;  5E3L A;  4C3H J;  1RKW A;  3MVP A;  1ETQ A;  1JUM A;  2O8K A;  4S0H B;  3BR5 A;  1I50 J;  2E2J J;  2RAE A;  4V2G A;  4IHX A;  4UUS B;  3LSP A;  2L0K A;  2DMP A;  3CMY A;  2XRL A;  5M5W J;  1SFO J;  3O8G A;  4BBR J;  3DEW A;  2QCO A;  2E1O A;  2Y2Z A;  2TRT A;  2HDD A;  4A69 C;  1JT0 A;  1JKR C;  3SDG A;  2LLK A;  2XPW A;  2LFB A;  4M3G A;  2GBY A;  1Q1V A;  4XRS G;  2DMT A;  5E3N A;  3MN2 A;  2NVX J;  5EEA A;  3JRE A;  5F1J A;  2HI3 A;  3SFI A;  5K7Z A;  2L7F P;  3JRG A;  3GTK J;  5DS9 A;  4NDL A;  3ZQG A;  4W1U A;  1ETY A;  5GPC A;  5FLM J;  1FIP A;  3GTG J;  3IH4 A;  1U9O A;  1VF9 A;  2ECC A;  2LK2 A;  2XGD A;  1AU7 A;  4DYQ A;  4C2M J;  3IH3 A;  2R0Q C;  5JLW A;  3ZQC A;  1QRY A;  1XG1 A;  5IOY A;  5J1U A;  1NK2 P;  2XGE A;  2JJ7 A;  4LOC A;  2EQR A;  1WH5 A;  2M8G X;  4I6Z A;  3S2H J;  4BY1 J;  3A01 B;  3PO2 J;  5C4J J;  3HOX J;  3CDL A;  3TW7 A;  5DTD A;  5FJ8 J;  2W48 A;  2DTZ A;  3BR0 A;  1ZGW A;  1B72 A;  2B63 J;  5IYD J;  2NVT J;  1PUF B;  2EZK A;  2GLO A; 
#chains in the Genus database with same CATH topology
 3L9F A;  2W7N A;  2GIV A;  2O61 A;  1RI7 A;  3KP5 A;  4A93 J;  4BJ6 C;  3DP7 A;  1MBE A;  3W2A A;  1TWC J;  2E1M B;  4D9J A;  1G2H A;  1UG2 A;  4RGR A;  3L2Q A;  1PJR A;  5FKL A;  3GTP J;  3B02 A;  3B73 A;  3BY6 A;  3DTI A;  2FRH A;  3QPL A;  2HVS A;  2CQN A;  3DQV C;  3ECH A;  3UNG C;  3ZQL A;  5JLX A;  5D5W B;  3VSL A;  1YW9 A;  2O8X A;  2E36 A;  2EFW A;  1WGX A;  1TP4 A;  3G1M A;  3J81 K;  3FXK A;  1VQ7 I;  1QPI A;  1LUJ B;  4BAC A;  4BXX J;  2BXY A;  1SMT A;  2VJ4 A;  2OQR A;  3M8J A;  3FXU A;  2HTJ A;  2K9Q A;  2OD5 A;  3OL4 A;  5C44 J;  2DA5 A;  2IS4 A;  2Q2E A;  5AIQ A;  2AO9 A;  3M9A A;  3OYE A;  4HBL A;  1S8N A;  2F5E A;  2QBY A;  3BDD A;  5ICC A;  2E7W A;  2V79 A;  2CV1 A;  2MA3 A;  3G1L A;  5D8L B;  4BEH A;  3V8K A;  3FDY A;  3HGY A;  1RNL A;  5BQT A;  2ZME B;  3H0D A;  4KUM A;  2F5C A;  2YPR A;  1WJC A;  1JI8 A;  3CCU I;  1BI3 A;  3H36 A;  3E5U A;  1XTA A;  2WWY A;  4RAG A;  3E6B A;  3PNY A;  1MSF C;  3E5X A;  1E2X A;  4X0G A;  2YSR A;  3GTL J;  4XR6 A;  3V7C A;  4P96 A;  3HSF A;  3JSP A;  4XKC A;  1JUS A;  4XRF A;  2FE3 A;  4R1H A;  4KMF A;  4L5E A;  2L7K A;  2E34 A;  2MFZ A;  2OF7 A;  3OV8 A;  4RAF A;  1IRF A;  2ECB A;  4E7Z A;  1W36 D;  1EH7 A;  2O6G E;  4C9Y A;  2XGC A;  4TV7 A;  4HNT A;  2DDA A;  2BZT A;  3MD2 A;  3AKZ A;  2R5Y A;  3DPU A;  2DMN A;  1Z21 A;  5GP9 A;  2XF7 A;  5ICF A;  4HF2 A;  3BZ6 A;  5F1R A;  4KFC A;  2H1L A;  1U8R A;  3C3W A;  1SEU A;  1J9I A;  4MTE A;  2VUM J;  1B9M A;  3DLL F;  3MKY B;  4JP0 A;  1FTZ A;  2A6T A;  3PM1 A;  3F72 A;  4FT8 A;  2XAS A;  3M4O J;  3OS1 A;  4EQQ A;  4UUS A;  1X2M A;  2GOX B;  3TOA A;  2VQG A;  1QGP A;  4LK0 F;  5DD4 A;  5FKK A;  4IEJ A;  2AHQ A;  1TWA J;  4CH7 A;  1AOY A;  1YYV A;  2QUF A;  5H6R A;  1B72 B;  1B8I B;  3S1M J;  1Z67 A;  4A3B J;  1TTY A;  1XDU A;  5EG0 A;  3ZR8 X;  3K1N A;  1Z6R A;  3L2W A;  5ED4 A;  3ABT A;  3HHH A;  3FXO A;  3VSK A;  1MDM A;  2YX7 A;  2OZU A;  4WX9 A;  1IGN A;  1YW7 A;  3OWT A;  3SZP A;  5HOD A;  3KPH A;  2DOE A;  2IVM A;  1ZLK A;  1MH4 A;  2R7Z J;  1TQI A;  1XCV A;  2X51 A;  2QQA A;  5DEQ A;  1QQI A;  1XMA A;  1UEL B;  3C2B A;  3IC7 A;  1FY7 A;  3MZH A;  1PUE E;  1ZKG A;  3RKW A;  2HYJ A;  4ZDL A;  5B1A H;  4XRS A;  3ZMT A;  3M1E A;  4HV6 A;  4BHC A;  3P9K A;  3EUK L;  2OJE D;  1DP3 A;  3T5X A;  3CCE I;  3I71 A;  4B8X A;  1LB2 A;  3BPX A;  2VOP A;  3LSJ A;  3FXL A;  2EIN H;  1FOY A;  2OBP A;  5B5E C;  1JKP C;  2GXB A;  1OCT C;  1DGR M;  3E97 A;  1LDJ A;  4IOA F;  3GFI A;  2IGN A;  2CV2 A;  4DZP A;  5LRS A;  2JA2 A;  2GWR A;  2ZME C;  3KP2 A;  2VKV A;  4ENN A;  3S3M A;  1YX5 A;  2F6C A;  4CYC B;  5E8G A;  3KEY A;  3TO7 A;  1WRJ A;  2DA4 A;  3VFZ A;  3D5L A;  3IUO A;  3ZOB A;  4Y4R A;  1JJ6 C;  1EJ9 A;  3TED A;  4A3D J;  4V19 K;  1SD4 A;  1N75 A;  3LOC A;  1LQ1 A;  2LKS A;  4OOI A;  4AVZ A;  3C1D A;  4ESB A;  1FTT A;  3K4L A;  3OIP A;  3J7A O;  1XN7 A;  2CV0 A;  2CUJ A;  3HB9 A;  3LL7 A;  4M6X A;  1ETO A;  2HFH A;  2EV6 A;  2R7T A;  2NS8 A;  2MGQ A;  2IT0 A;  1MJ9 A;  4XQF A;  2VJJ A;  1XGS A;  2G9W A;  2VN2 A;  2DCE A;  4XKW A;  3Q3S A;  1GV2 A;  3I58 A;  3H0G J;  2UZK A;  4IF4 A;  4HST A;  2AXL A;  2L4M A;  4L9T A;  2OAZ A;  1G3T A;  2V6C A;  2KDZ A;  1MMD A;  2CQQ A;  3DKX A;  4UUT A;  5LGT A;  2VQC A;  3HTS B;  5L3C A;  2GM4 A;  4PJM A;  4O5V A;  4XOT A;  2XB0 X;  2L9S A;  3TOB A;  3HOU J;  1ZTR A;  2VJI A;  3HKZ A;  3WTW C;  4HSR A;  1P9Q C;  1LFP A;  1T08 B;  3D0S A;  2BHZ A;  2EK5 A;  1TT5 B;  2FU4 A;  5D6E A;  3AG1 H;  2K9S A;  4BAY A;  3HRS A;  3HGG A;  3QU3 A;  4XBF A;  1RRJ A;  2GXA A;  4N4N B;  3BR2 A;  4ZTJ A;  2MC3 A;  2D45 A;  2KIS A;  2R92 J;  4IOC F;  1FWZ A;  2HGC A;  4Y33 A;  4RAY A;  1FZP B;  4L0Z B;  1WI3 A;  1K4T A;  3JR9 A;  3J7Z I;  3LSR A;  3NEU A;  3QAH A;  1UCR A;  5EDN A;  2PQ8 A;  1BOA A;  4CO8 A;  4C3J J;  4WWC A;  4HF0 A;  1N77 A;  4LIU A;  3DLA A;  1DU0 A;  2H94 A;  1BC8 C;  2HR3 A;  1GLN A;  1T56 A;  5F08 A;  1S7E A;  2LD5 A;  2E2H J;  2ME0 A;  2BV6 A;  4UB6 C;  2XKO A;  2YU3 A;  1U0J A;  4PJJ A;  5J1Y A;  4A3E J;  2HOT A;  2QGU A;  1XSV A;  3KP4 A;  3U1K A;  2L9V A;  1TWF J;  3FWE A;  2XF5 A;  4ESJ A;  4HAM A;  1R5H A;  3OSG A;  5FB2 A;  1LEA A;  2UUZ A;  4AVP A;  4NHJ A;  2P7V B;  1EH8 A;  4D7M A;  1DUX C;  1V5G A;  3PO3 J;  3CLQ A;  4HRI A;  4PK4 A;  3V8J A;  2H6C A;  4M3B A;  3BZC A;  3MQ0 A;  2VOO A;  1F43 A;  1SAU A;  4RDU A;  4IHW A;  1ULY A;  3FKJ A;  2E1C A;  4HNU A;  2MH2 A;  1VZ0 A;  1IXS B;  3HOS A;  3OYN A;  5CVU A;  2KKO A;  4M73 A;  2OCC H;  5BPI A;  3P9I A;  2CW0 F;  3K4B A;  2CUZ A;  1P7J A;  3HUG A;  4N4O B;  1PVE A;  4RGX A;  3JCU C;  4XON A;  2A05 A;  3CUQ A;  5LEK A;  4EJT A;  1V54 H;  1T0F C;  1OLT A;  3EYY A;  5JHU A;  2PI0 A;  3HSE A;  3QYF A;  3WTT C;  4PJL A;  2V6E A;  4RM2 A;  4G7H F;  1NTC A;  4E7L A;  2HOE A;  5IP7 J;  1GXP A;  1D3Y A;  3RQI A;  2K4B A;  3NRV A;  5BOX A;  4LB5 A;  1ON2 A;  4LGW A;  1IN8 A;  4B3X A;  2IP2 A;  3V8L A;  5ICG A;  1G59 A;  5IP9 J;  1T0F A;  4UNO A;  5D8K B;  3BG6 A;  2RGV A;  2X1D A;  1YJW I;  1E3H A;  1IN5 A;  4XLA A;  4R79 A;  3IHU A;  4BE0 A;  1OJL A;  3F21 A;  2HQA A;  3GLX A;  3WGG A;  2LF8 A;  3S2D J;  2DMQ A;  4NC8 A;  3KYD B;  4R8H A;  4YG2 F;  1TLH B;  1DU6 A;  4RA2 A;  4YII A;  1D8K A;  2VIX A;  5J4V A;  5M5X J;  5DV5 A;  2O0Y A;  1Y6I A;  4MO7 A;  4UUV A;  1O7F A;  5HLG A;  1LKX A;  2FNP A;  1Y39 A;  2PG4 A;  2ADU A;  3GWZ A;  3TP0 A;  3M07 A;  3LA3 A;  4PSW A;  1R4N B;  2H6B A;  3I59 B;  4EJW A;  1AHD P;  2NVX J;  3FK6 A;  2ACJ A;  3ONQ A;  2K9L A;  2W82 A;  3KYC B;  5LGN A;  3WTY C;  2VOD A;  1B9N A;  2DI3 A;  2ICW G;  3E7L A;  1EH6 A;  3JRD A;  1HDP A;  2CO5 A;  3OYB A;  4GRI A;  3FZV A;  3OYH A;  1W7P B;  4IJA A;  3V4G A;  2JRM A;  4FHT A;  4HLX A;  3S8P A;  1D1C A;  3CF2 A;  1XGO A;  3BPV A;  2JZY A;  4UUS B;  4NNJ A;  3S3N A;  1SFO J;  1NHA A;  2P5V A;  2QZ8 A;  2ZJ2 A;  4BBR J;  3DEW A;  2PJR A;  3BJO A;  1B6A A;  2Y2Z A;  3SFZ A;  2TRT A;  2BVM A;  4YIF A;  3DBH B;  1K79 A;  4UV8 A;  1TW2 A;  1IXR C;  3FXM A;  2LY1 A;  1JKR C;  1H9T A;  2XPW A;  5HS9 A;  5GAH J;  1WJA A;  2K27 A;  2Q0O A;  1D1A A;  1FOW A;  4M72 A;  2MD0 A;  5F1J A;  4YIR X;  1OR7 A;  2HI3 A;  3PUB A;  2L7F P;  2FNA A;  3TMO A;  5TJJ A;  1RZ4 A;  4HG2 A;  4LIT A;  5DS9 A;  3CF5 F;  4ZZL A;  2H8W A;  4NDL A;  3ZQG A;  2XAU A;  5GPC A;  1A6Q A;  2ECC A;  1VF9 A;  2CH0 A;  4OIR F;  5E8I A;  1AU7 A;  4DYQ A;  3IH3 A;  5DM7 F;  3ZQC A;  3D5S C;  2XF6 A;  2A68 F;  1VQO I;  3IRQ A;  1FBQ A;  1QA6 A;  3DEE A;  2JJ7 A;  3S2H J;  2EQR A;  2PFB A;  4OAZ A;  4I6Z A;  4BY1 J;  4WXD A;  4XN3 A;  1D5V A;  1AA7 A;  3HOX J;  3A2K A;  1KU2 A;  3TW7 A;  3RDI A;  2W48 A;  4L9J A;  1HKS A;  2XRO A;  2EV5 A;  2Z16 A;  2HEO A;  3ZMU A;  5TIS C;  3I4P A;  2EZK A;  4PCQ A;  3OYL A;  1VI0 A;  4A3M J;  4C2U A;  1IW7 F;  5KVR A;  2JUG A;  1E0E A;  2ISZ A;  3BG3 A;  1IDZ A;  4Y7N J;  3AG2 H;  3KP6 A;  2H27 A;  4P9U A;  3GZ5 A;  3K6G A;  5HDN A;  2EFP A;  3F0C A;  4L18 B;  3RZO J;  2DPD A;  1ZG1 A;  1O3S A;  3F22 A;  3PNT A;  2IBD A;  5EGO A;  3OYA A;  4O3M A;  3JTH A;  2RVC A;  4NQW A;  2KRH A;  5FGM A;  5JHF A;  4KJZ A;  1SVM A;  1XMX A;  1OQY A;  4P55 A;  1LDD A;  3SQN A;  1NK3 P;  4OWR B;  5J6X A;  3C2H A;  1FIA A;  3L2R A;  1Q1H A;  1F9N A;  4BEH B;  2V1U A;  3W2W A;  1WJD A;  5E1W A;  1K4S A;  2IS1 A;  4JYK A;  2VXD A;  3LFK A;  2VI6 A;  1E17 A;  4B1R A;  4WF2 A;  2DO7 A;  3BLY A;  2MD5 A;  4HEA 2;  3F6O A;  4L9V A;  1JUP A;  4XLF A;  3ECO A;  2PMU A;  1X1D A;  2JA8 J;  1X3W B;  2A61 A;  2KP6 A;  2M30 A;  3WG7 H;  4CHU A;  2MH9 A;  2K86 A;  2MW8 A;  2NXN B;  5E3O A;  3SHF A;  4L5I A;  2A3S A;  4YEJ A;  4NUB A;  1MIJ A;  5LRR A;  1J59 A;  4LB6 B;  3TGN A;  5D5X B;  1RKT A;  3UR3 C;  5D6F A;  1FMV A;  1YJ9 I;  3CTA A;  3HOY J;  5IP6 A;  2D5V A;  1N25 A;  4UVB A;  2PMH A;  1IUF A;  4M3E A;  2DA7 A;  1HA8 A;  2P81 A;  2XSD C;  3SJM A;  2V4J C;  3RKX A;  3CCS I;  2E5N A;  1BIB A;  3REO A;  1S9H A;  4GXO A;  2Q1Z B;  2EH3 A;  2F5V A;  3GCM A;  4ON0 A;  2M7B A;  2DQR A;  3M8F A;  5K7H A;  5DUI A;  4A3J J;  1E3O C;  2G0E A;  1HST A;  1DPR A;  1ETV A;  2DYR H;  4MNU A;  4DZJ A;  1KQ0 A;  4ZYH A;  1IV6 A;  2V9K A;  1DDN A;  5M3M J;  2RNJ A;  4ZYA A;  3JAM K;  1KYW A;  3QYB A;  2ZSI B;  3EUA A;  2KFD A;  2Y75 A;  5FKO A;  1VQ6 I;  2L7Z A;  5HS8 A;  4HDU A;  1MJA A;  3DWL E;  3RIR A;  1TQM A;  2QKM B;  2Y30 A;  3KP3 A;  3R6S A;  3M3Y J;  1EKE A;  3CJT B;  3JRA A;  3KYL A;  2DT5 A;  5L3F A;  4ZTF A;  3FXR A;  1X19 A;  2NOG A;  4V2F A;  3WU0 A;  2PJP A;  2EFQ A;  4B48 A;  1ZRD A;  3K2Z A;  2XAQ A;  1WJE A;  4XLN F;  2UWM A;  4UVC A;  1WSU A;  1B1B A;  1IV8 A;  4J19 A;  2KJC A;  3DFG A;  4ABZ A;  3PJR A;  5J47 A;  3CZ6 A;  5K5R A;  2CFX A;  1OPC A;  4Y15 A;  3H92 A;  4DGW B;  2R7S A;  2D1H A;  2DFH A;  4PJ0 C;  2ZFU A;  2Y31 A;  5EEH A;  2IJL A;  1MMG A;  2FMY A;  1GXQ A;  5L3G A;  3WE3 A;  2HYG D;  2LNB A;  6PAX A;  1R58 A;  1TT0 A;  3OIO A;  1MBJ A;  3LMM A;  3WTV C;  2EJR A;  3DV8 A;  3S1N J;  2Y9Y A;  2UV1 A;  2QEX I;  2A6E F;  2MBF A;  4DJA A;  5D5V B;  1GT0 C;  2LOO A;  3CD6 I;  2KRC A;  3R0A A;  2L54 A;  1IO2 A;  3MCZ A;  4PSX A;  3P5J A;  3FMS A;  4C2T A;  3HKZ N;  1I6X A;  4ENJ A;  4E7S A;  1YRN A;  4HQM A;  3K7A J;  4QSH A;  5F0H A;  3M1C A;  2QQB A;  3K0L A;  3JRH A;  5ILU A;  4HDV A;  3HEF A;  2FQ3 A;  2AS5 F;  4A0Z A;  5FRO A;  3QWL A;  3OYJ A;  3J80 Z;  2RNG A;  4EJV A;  4BKX A;  3GTJ J;  1YO5 C;  3CC2 I;  1BA5 A;  3GXO A;  1FC3 A;  4Q47 A;  3F6V A;  3LA2 A;  4XNF A;  5LHI A;  2CW8 A;  4B44 A;  1SFE A;  3C2G A;  3AL0 C;  1SFU A;  3IKV A;  3RPU A;  2BOL A;  4KT6 A;  4CYC A;  2I5U A;  1QBJ A;  1ZGA A;  2M4K A;  1ZN2 A;  4OMZ A;  5IYB J;  4FQG A;  4MLO A;  4BXU A;  2GZW A;  4CUG A;  2ZXW H;  2HDC A;  2AQE A;  3QPH A;  1VFC A;  3IAS 2;  3CCM I;  3PFI A;  1IRZ A;  3WTX C;  3CCY A;  2COB A;  4F3Q A;  4JX5 A;  3WTZ A;  4BQO A;  3GFJ A;  1JTY A;  2X48 A;  4XKV A;  2VJ5 A;  2ISY A;  3ASN H;  3CCV I;  2UXX A;  4F7Z A;  1R22 A;  3GZ6 A;  1I6H J;  2FUG 2;  3L2C A;  3U1D A;  3AAF A;  4IL6 C;  4IHT A;  3KCC A;  3IP4 B;  3CME I;  1H89 C;  3PQJ A;  2FOW A;  4L5J A;  4A0X A;  4U88 A;  4DBQ A;  1WI9 A;  4FAS D;  3A4C A;  4BXF A;  2KIM A;  2P5L C;  5BPD A;  1ERD A;  3HG9 A;  5IT9 K;  3BJ6 A;  2K02 A;  4U87 A;  2NOJ B;  4QIW N;  2NS0 A;  2OV7 A;  4EJO A;  5HVQ C;  1S29 A;  3MZY A;  2QA4 I;  1BI2 A;  2KDO A;  2X85 A;  2Z5U A;  3T1B A;  3TP3 A;  1B4A A;  3FIS A;  1FYL A;  3LSG A;  1F5T A;  2HXI A;  2LRD A;  2LH9 A;  2RDP A;  4HPQ A;  4EGZ A;  1OKR A;  3CO6 C;  5HNH A;  4KIT B;  2C6Y A;  2L02 A;  3I53 A;  1HOM A;  2JSP A;  2ZC2 A;  3JRI A;  1IF1 A;  1QU3 A;  1GVD A;  1SD7 A;  1A35 A;  1W7P A;  2O7O A;  1LVK A;  5K7F A;  3CC4 I;  1KU7 A;  2JPC A;  2CRG A;  3KLN A;  1R1V A;  3KET A;  2W00 A;  4LLN A;  3JRC A;  1FP1 D;  4OIN F;  3DKY A;  1ZAO A;  3QU6 A;  2Y0M A;  5FRN A;  4M74 A;  2E1N A;  1JHF A;  1VQL I;  4HX8 A;  1VQN I;  3I56 I;  1YHQ I;  1H8A C;  2HQR A;  1UHM A;  1Y0N A;  2WAD A;  2JN6 A;  1LDK B;  2OU2 A;  1D8J A;  1SAX A;  1BOB A;  1VND A;  2BBY A;  3G4S I;  1ZGJ A;  2FXA A;  1GUU A;  2QBY B;  4BYY A;  1JKO C;  2L2O A;  5M3F J;  2J5O A;  1X3U A;  2HOS A;  1G6N A;  3TDU C;  4IHY A;  1ZK8 A;  2Q2E B;  4XL9 A;  2KMU A;  1MSE C;  3EUH A;  5IOZ A;  2XAJ A;  1FNN A;  2WAQ N;  3CJN A;  5DDG A;  2WV1 A;  3SZG A;  1BN5 A;  3BG7 A;  3B6C A;  1FPQ A;  2F5D A;  2IXS A;  3QPT A;  4CCN A;  4F91 B;  4YEL A;  1QPM A;  2YS9 A;  1T39 A;  3A0B C;  3DPL C;  3ZP5 A;  1UHS A;  3A02 A;  4H4K C;  1YRN B;  2VC0 A;  2HQ5 A;  2DN0 A;  4FX0 A;  5DUK A;  4LJZ F;  3S14 J;  1VQ5 I;  1JGG A;  2P6S A;  2EB7 A;  2LC2 A;  2VKD A;  4A3I J;  3EYI A;  3N4M A;  3H5N A;  5KAF C;  3PUF A;  4X1E A;  3K4C A;  4KT5 C;  4CCL A;  5FD5 A;  4IHS A;  1J0R A;  2OTJ I;  1OMI A;  1LPQ A;  3LSI A;  2F48 A;  4UV9 A;  1FP2 A;  4ZH4 F;  1A31 A;  4ETS A;  1ZYR F;  2MLK A;  4HNV A;  4A3G J;  1APL C;  4RB2 C;  5FKN A;  3OOP A;  2VXZ A;  2RV8 A;  3NQO A;  5F27 A;  1PP7 U;  2CUF A;  3E6M A;  2DDB A;  2K3F A;  1Z91 A;  2O5R A;  2IAI A;  5L3B A;  4BU2 A;  5HS7 A;  3VDX A;  1LE8 B;  4I76 A;  4EM2 A;  4G7O F;  3L2U A;  4MGR A;  2R7W A;  5BMZ A;  1WCM J;  4FE7 A;  1UAA A;  4LIV A;  3CP2 A;  1G3S A;  3PSI A;  3CO7 C;  2J5P A;  1YOV B;  3ZMV A;  1W0T A;  4CSW A;  5F0F A;  3IWF A;  5CKT A;  4HOB A;  2TDX A;  2WAQ A;  2CYY A;  2MAB A;  5B3S H;  2XRN A;  4LG0 A;  1HC8 A;  3OIQ A;  2HKO A;  1ETX A;  2NYX A;  2Y9Z A;  2BGC A;  1HSJ A;  2XIG A;  3G3Z A;  3FBN B;  3GVA A;  5ERI A;  1M1E B;  4BJT A;  1T38 A;  2X0L A;  4Q48 A;  3IRR A;  2KT0 A;  1FLI A;  5LGU A;  1AWC A;  2QLZ A;  3LSK A;  2ZXI A;  1N78 A;  4IHV A;  2VON A;  2XB5 A;  4A5M A;  3KX2 A;  2LY2 A;  3FMQ A;  5FLV A;  3IWZ A;  3RYR A;  4RLQ A;  4CCJ A;  4AC0 A;  4OAY A;  5E3L A;  4ESF A;  3MVP A;  1ETQ A;  2ZXH A;  3O2P E;  3U2R A;  1JUM A;  3HPH A;  3RKY A;  2O8K A;  1W5T A;  2P4W A;  2WAF A;  4ASN A;  2XKP A;  4S0H B;  2VBW A;  4A2U A;  1S3J A;  4C30 A;  5IT9 Z;  1L0O C;  2L0K A;  2DMP A;  2OTL I;  4IRG A;  1H9G A;  2IPQ X;  1UZC A;  3IAM 2;  3MWM A;  1PP8 F;  4A69 C;  1JT0 A;  4L0Y B;  4G6D A;  2XVC A;  4CCO A;  3OYK A;  2LFB A;  3H9G A;  3L09 A;  1HW2 A;  3MN2 A;  2ESN A;  3MFK A;  3SFI A;  5K7Z A;  1F4K A;  4KNY A;  1J75 A;  5FFZ A;  4IZZ A;  3GUD A;  3NWT A;  1ONV A;  4EMS A;  2MYS A;  1KGS A;  3CCQ I;  5DD8 A;  3KLO A;  4EJU A;  2XC7 A;  1FIP A;  4XM3 A;  3X2Q H;  5JLW A;  3OYC A;  4HV5 A;  3WOD F;  2XGE A;  2OA4 A;  4IVN A;  3COA C;  3A01 B;  5FFX A;  5C4J J;  1QZZ A;  3CDL A;  5DTD A;  4NBQ A;  1W7P D;  4JK1 X;  3J80 K;  2QQ8 A;  3EDP A;  3HIF A;  4ZYE A;  3J81 Z;  3BR0 A;  2A6H F;  5E17 F;  5CLS A;  2FOK A;  2GQQ A;  1PUF B;  2Z1D A;  2GLO A;  1I5Z A;  2HZD A;  1F1Z A;  3H9J A;  2E1M C;  2BW3 A;  4IQJ A;  3OYF A;  1NG6 A;  1DPU A;  4BE2 A;  1X3Z B;  3BR6 A;  5KCM A;  2R5Z B;  1UFM A;  2F4O B;  4NB5 A;  2V9P A;  2K85 A;  4RB0 A;  1ZAR A;  2LBF B;  1VQM I;  2M0C A;  1QZY A;  1ZHF A;  3VYT B;  5KK1 A;  2QQ9 A;  1LEB A;  3M7G A;  4F92 B;  1QHG A;  1QVU A;  4UHT A;  3BP8 A;  1T95 A;  2QEN A;  3BQZ A;  1I3A A;  5EJC A;  1YIJ I;  4LG3 A;  1RET A;  2Z99 A;  3EQL F;  4JX4 A;  3SDB A;  3HZJ A;  1BW5 A;  4RGU A;  2BY2 A;  2R7R A;  2L01 A;  4MQV A;  4FE4 A;  4XLC A;  3KFW X;  3GX4 X;  4XKB A;  1L3L A;  2KRF A;  1ETK A;  4D1Q A;  1R7J A;  3PL8 A;  2N8G A;  4A3C J;  4QTR A;  2R4G A;  2IGM A;  3OL3 A;  4EEF G;  2VQH A;  1BR4 A;  4KIG A;  3R60 A;  1EV7 A;  2QWW A;  5JR3 A;  4IRI A;  4IXA A;  4LMY A;  2LTP A;  4AD9 A;  1QO0 D;  1HBX G;  3LWF A;  3B6A A;  3GO5 A;  1MDM B;  2CQX A;  3BJA A;  3GEZ A;  2D2W A;  1RC9 A;  3WGH A;  3EPZ A;  4EAT A;  1KQ9 A;  2WV0 A;  3Q0W A;  2FA5 A;  4HYE A;  4XOP A;  1K83 J;  2EIM H;  5C3E J;  4AIK A;  1FX7 A;  2EZH A;  2DK5 A;  5E3M A;  4I98 B;  5DM6 F;  1DP7 P;  2WB1 A;  1YG2 A;  1HKQ A;  5C4X J;  3PNV A;  1JTX A;  3WE2 A;  2XAF A;  3RJP A;  3CDI A;  1SVO A;  1Y56 A;  3OMY A;  4LLL A;  3CCJ I;  5IT3 A;  1S72 I;  2IEK A;  3A01 A;  4MEY F;  4KA4 A;  1UST A;  1F36 A;  3OR1 C;  3LAP A;  4KIB A;  3DPT A;  1XX5 A;  2ID3 A;  2XUB A;  2YUS A;  5LFA A;  1JHH A;  2K4J A;  4CA0 A;  1Z7L A;  5EZG A;  5LEJ A;  2F5F A;  4IX7 A;  1ZG3 A;  5ICE A;  2M34 A;  3GF2 A;  3ZPL A;  3KZI C;  3H1C A;  3LFU A;  4O6J A;  3ROU A;  4QWQ A;  4JX6 A;  5H6Q A;  3CMM A;  1HCR A;  2RQQ A;  1WZ2 A;  4E6K G;  2FML A;  3GFM A;  2F2E A;  3EUH C;  4G12 A;  3QOE A;  3ZQQ A;  4AYB N;  4II3 A;  2DA2 A;  2FQ4 A;  4BHB A;  4GDF A;  4UY8 I;  1P4X A;  2X9D A;  2YX4 A;  2A5Y B;  5HLH A;  1T8I A;  1U3E M;  4M9Z A;  3V7S A;  1REP C;  3I64 A;  3CP8 A;  3ULQ B;  3D1N I;  2ZME A;  1W5S A;  2BY0 A;  2HOA A;  5DCM B;  2QYO A;  3PQK A;  4BS9 A;  4IO9 F;  3BTJ A;  3K70 D;  2R7V A;  2L5Q A;  2X6O A;  2CW7 A;  2OPT A;  4PGH A;  2XPV A;  1FSH A;  5HDG A;  2IS6 A;  3MMY B;  1FBS A;  5GTH C;  3W6J B;  2I10 A;  5GPA A;  5B66 C;  1T98 A;  2CG4 A;  2VE8 A;  4F55 A;  3ESW B;  3IV5 A;  3HOW J;  3FXQ A;  1MMN A;  1XB4 A;  3Q5F A;  4G94 A;  3K10 A;  1EF4 A;  1Z05 A;  2LDU A;  3UKG A;  3VYR B;  2JMW A;  2DA6 A;  1R49 A;  4BQQ A;  2R7O A;  3S3O A;  2NS7 A;  2VQL A;  2DQL A;  3FM5 A;  3RPU D;  1IC8 A;  1OYI A;  5CVI A;  5HLT A;  4PJN A;  1GDT A;  4FIS A;  4B47 A;  3ABK H;  3OYI A;  1TWG J;  3DU6 A;  4E70 A;  5L3E A;  2BVL A;  2KJB A;  2P0W A;  4DYC A;  5J1R A;  3HM5 A;  9ANT A;  1TNS A;  3C7J A;  1U9N A;  1BI0 A;  5F64 A;  2E71 A;  1QVT A;  3LST A;  3PFY A;  3RKQ A;  3BR3 A;  3VYU B;  1SMY F;  4E7H A;  1PYV A;  2XPU A;  2KZV A;  2ZNY A;  1Z9C A;  1X1B A;  2ELK A;  3CMA I;  3E6C C;  2NNN A;  1MNE A;  4CYD A;  4M6Y A;  3F8F A;  3R61 A;  5FLX Z;  5ILS A;  4MTD A;  3N97 A;  4AYB A;  2NAZ A;  3S15 J;  2OZ6 A;  2HXO A;  4A3K J;  1R23 A;  2WBM A;  2M9H A;  1E3P A;  2M2E A;  3E3V A;  1BL0 A;  4U7D A;  4BDZ A;  3OYG A;  1RPW A;  2DJI A;  2FSW A;  3VB2 A;  1FEX A;  3H5A A;  5LLQ A;  2W24 A;  4XLE A;  3HRT A;  2KPM A;  4HX7 A;  1FT9 A;  1R5I D;  1Z3Y A;  2BY1 A;  3ZXS A;  2R7D A;  5IYC J;  1XMK A;  1YS7 A;  3CUO A;  1BR2 A;  2JRT A;  3K1M A;  4PUS A;  4E7J A;  2VPR A;  2PBI A;  1LNW A;  1P2F A;  4WCG A;  1MBK A;  1FSE A;  2B7E A;  4JBA A;  1VQ9 I;  5F04 A;  2Y0S N;  4PGG A;  4M3D A;  3I9V 2;  3W2V A;  2IGK A;  3OYD A;  2VL8 A;  1XCB A;  2DPU A;  2JA6 J;  3NWS A;  1ZRF A;  4RLF A;  2LKP A;  3JW4 A;  2ELH A;  4KMU X;  2CJJ A;  3IL2 A;  3MZ8 A;  1Y1W J;  5E79 C;  3BRO A;  4I01 A;  4QPO A;  4M3F A;  4S04 A;  1YE9 A;  3VOD A;  3M8E A;  3NAU A;  4ZC3 A;  1H0M A;  2EIL H;  3H3U A;  3LAJ A;  2CU7 A;  4XK4 A;  4UB8 C;  1G8X A;  2VBX A;  2L7M P;  2BW3 B;  1MZB A;  3JRB A;  2V26 A;  1T33 A;  1W5C C;  3WHB A;  3IH2 A;  2F4M B;  2HU9 A;  2VB6 A;  2FF4 A;  3DTE A;  5B1B H;  2LKX A;  3FX3 A;  1FBU A;  1OCR H;  2ID6 A;  2DW4 A;  5CVV A;  1J09 A;  2EFN A;  1DGW Y;  1WVR A;  4ITV A;  4IKF A;  2DFI A;  4ANJ A;  1RIO H;  3KZZ A;  4GCV A;  3E6D A;  3FM3 A;  3GME A;  4AWX B;  1TC3 C;  3AG3 H;  2K40 A;  4QPQ A;  4Z6Y A;  1K61 A;  3KIO A;  1HKT A;  1ZR2 A;  1R00 A;  3QOD A;  2IRF G;  1OIS A;  1W36 C;  3QOP A;  4DOZ A;  3FHN A;  4RBO A;  1A5J A;  4WXH A;  2E35 A;  2DT6 A;  2G7H A;  3ERM A;  1MW7 A;  2DA1 A;  4G6Q A;  2LP0 A;  3DBL B;  2LR8 A;  3QP5 A;  4BQN A;  4RB3 C;  1XPX A;  2R3S A;  1D0Z A;  3JRF A;  4RS8 A;  3GTM J;  3WG9 A;  2HKX A;  2DT7 B;  1UMQ A;  5E20 A;  4B4C A;  3LQQ A;  1R4M B;  3G2B A;  2V7F A;  5EG0 B;  2HWV A;  1UG0 A;  2A5W A;  3FXJ A;  2JTV A;  2RQP A;  1K7A A;  3I54 A;  2LVS A;  3OYM A;  2FX0 A;  1IJW C;  3CDH A;  2KIF A;  1K78 B;  3VPR A;  1KU9 A;  3VOE A;  5AON A;  3ZQH A;  3ZMS A;  1ORK A;  1ZLJ A;  1TWH J;  3BZK A;  2FD5 A;  1P4W A;  1FMW A;  2H09 A;  2CQ7 A;  2IW5 A;  1Y0U A;  2QVO A;  3TDZ C;  4C3I J;  3S1R J;  4KN7 X;  2HPI A;  4YFX F;  1P4A A;  3BTL A;  1X1P A;  2P8T A;  1R71 A;  3CQZ J;  5ILV A;  3QYE A;  4JOM A;  3O6B B;  2LBF A;  3HOZ J;  2L3D A;  2EIJ H;  1DQU A;  1C0W A;  3SXY A;  2WTE A;  3P7N A;  1A04 A;  1MJB A;  2LG4 A;  2VT3 A;  3CJQ B;  2QF7 A;  4N9I A;  4DW6 A;  1MBG A;  1X4O A;  4LLG F;  4UXN A;  1RUO A;  2DOD A;  3T0Y A;  5D5U B;  3ELK A;  1XSD A;  3DF8 A;  4GYG A;  2A07 F;  4PFP A;  4RAZ A;  1XS9 A;  2VBZ A;  3K70 C;  3HL2 A;  3TBI A;  3CC7 I;  2E19 A;  3TO6 A;  2E2I J;  2H1K A;  2JPB A;  2W84 A;  2B9S A;  3ZMD A;  1K6O A;  3FF5 A;  1ZR4 A;  1WQ2 A;  2XV4 S;  3BCA A;  1XGN A;  3BG9 A;  2M5W A;  4XSZ F;  2WA0 A;  1B59 A;  2ME6 A;  1HDD C;  2M8E A;  3P9C A;  4MEX F;  4HLY A;  1MD0 A;  1KU3 A;  3VEP A;  3CUQ B;  1IZ1 A;  4C3H J;  1I1S A;  1HW1 A;  2GA2 A;  1KA8 A;  2W1O A;  4MQ9 F;  1S5L C;  1IN6 A;  3RYP A;  3F23 A;  3BR5 A;  1I50 J;  1CF7 A;  2Z3Y A;  2RAE A;  4FET A;  3T8T A;  2CMP A;  2PMZ A;  3LSP A;  1MKM A;  1OYW A;  3CMY A;  3DXJ F;  2QM3 A;  2OCE A;  2DYS H;  2DAO A;  3WU1 B;  1LJ9 A;  3IKT A;  1HQC A;  5J4Y A;  2LLK A;  1XDS A;  2HTS A;  4M3G A;  4NQW B;  2GBY A;  1Q1V A;  2DTR A;  5E1Z B;  4DNC A;  4RB1 A;  1R1U A;  4KN4 X;  3TL4 X;  5E3N A;  3JRE A;  1O3R A;  1ACI A;  1QHH D;  3HYI A;  3G71 I;  4ZYD A;  1SC7 A;  2EV0 A;  2XSJ C;  1KON A;  3JRG A;  3ZRG A;  1V4R A;  2CWE A;  5BS6 A;  4U7B A;  2Y69 H;  1J7K A;  5FD6 A;  4F52 A;  3AG4 H;  3F8B A;  2ZNZ A;  3GTG J;  1KQ8 A;  1U9O A;  2M1B A;  3SEZ A;  1UJ8 A;  4C2M J;  1QRY A;  1XG1 A;  3HHG A;  5IOY A;  3TQN A;  4LK1 F;  2M8G X;  3PO2 J;  2PEX A;  3L00 A;  4KIS A;  5FJ8 J;  1UHW A;  4Q5S F;  3MKW B;  3L7W A;  2W57 A;  1LVA A;  3D5R C;  4CXF A;  1G4D A;  5CVR A;  3HJE A;  2W4S A;  3I55 I;  1FYK A;  4CCK A;  5LHG A;  2M7A A;  4XRM A;  3V42 A;  2E60 A;  1P92 A;  1R9T J;  1O3T A;  2O3F A;  1A36 A;  3DCF A;  1ODD A;  2ETH A;  3RQ4 A;  3CLO A;  4BBS J;  4IPA A;  2X4H A;  2BHY A;  2K3P A;  3PIO F;  5JFR A;  2HPM A;  3S16 J;  3H3Z A;  3HBL A;  3H9Q A;  4EVI A;  3HRM A;  2HNH A;  2L9R A;  5H20 A;  1TQP A;  1WHU A;  4GFB A;  3U9G A;  2LYC A;  2WY7 Q;  1IG7 A;  3MKL A;  5H2F C;  4Y13 A;  5J40 A;  2LMD A;  4BE1 A;  3ISP A;  4A12 A;  5GTI C;  2V1X A;  1BI1 A;  3TW6 A;  4DBR A;  1VQK I;  1LFB A;  2HQN A;  5EF6 A;  1RR7 A;  1LFU P;  4I2O A;  3JSO A;  1WWX A;  1U2W A;  2QKL B;  5GAD J;  1T6S A;  4U0Y A;  3ZCO A;  3FHZ A;  2JWT A;  4AUX A;  3RTR A;  2NVU B;  2L9N A;  1U8B A;  3I4M J;  2W85 A;  2MG4 A;  5TRD A;  2X6W A;  3OR2 C;  4BH9 A;  2O9L A;  3I3L A;  2EWN A;  3K4M A;  1QZE A;  3QPS A;  1XGM A;  3HTU A;  1IUY A;  1STZ A;  4WXC A;  4B43 A;  4KDP A;  2PN6 A;  3JAM Z;  1XC5 A;  1FJL A;  1HW5 A;  3K4N A;  4U0W A;  2FEZ A;  1GV5 A;  3RI4 A;  2VKE A;  4W97 A;  1Z1D A;  1O57 A;  1MMS A;  3GYH X;  3O8H A;  1WKM A;  2JA7 J;  1R5G A;  2DBB A;  2VLA A;  1AKH B;  5J8C A;  5KHD A;  1U5T B;  4DYR A;  1YIT I;  3TO9 A;  1P6R A;  2Z9O A;  5D4S A;  2GOM A;  3DEU A;  4MFD A;  4RM3 A;  5HOO A;  3LNQ A;  3FKI J;  4MFE A;  1BJA A;  1JXS A;  3ERE D;  5M5Y J;  3MKZ A;  5EZH A;  4OIQ F;  3R4K A;  2LRE A;  4I7H A;  4GO1 A;  1RR8 C;  2EBI A;  4S05 A;  1AKH A;  3SZT A;  1X2N A;  2R7Q A;  2OUM A;  4PZJ A;  1ZH5 A;  4BUP A;  1NH3 A;  1I1G A;  5K5O A;  4K2E A;  3V7R A;  2O03 A;  1KZH A;  2KIU A;  1SFX A;  4EM1 A;  2DJN A;  3ML6 A;  1W0U A;  4RGS A;  2VBY A;  3OOU A;  4OU0 A;  4B09 A;  2HZT A;  3HDD A;  4AIH A;  3S32 A;  5GAE J;  2BY3 A;  1S7A A;  2M87 A;  4CDG A;  2E5Z A;  4D0P A;  1O3Q A;  4NC6 A;  5AIP A;  1ZRE A;  1W4M A;  2HVQ A;  2KHM A;  3E0J B;  3E5Q A;  1FOX A;  3VYS B;  2LSO A;  3GTO J;  3HUG B;  4BDY A;  2DA3 A;  4XOR A;  3L2V A;  1O4X A;  1BJZ A;  2HS5 A;  4FTH A;  5IPA A;  1OYY A;  2GAU A;  2JUC A;  3LQR A;  3HOV J;  2X6X A;  2F4I A;  2RRE A;  5JVT A;  1V5E A;  2OQG A;  3BCB A;  1MGT A;  4CZZ A;  2GIZ A;  3K2A A;  2D1V A;  2HYF A;  1O7L A;  3OS2 A;  2PLY A;  2EZI A;  2BXZ A;  5DCF A;  2Z2S B;  1B8I A;  4A6D A;  2YU9 J;  1Y1V J;  1Y8R B;  1WPK A;  4M9X A;  2STW A;  2R93 J;  2VKH A;  2PX9 A;  3ZGK A;  2P6T A;  1FYM A;  2STT A;  2GXG A;  2OC6 A;  2QSF X;  2EFO A;  2WAE A;  5CQG A;  2CS3 A;  1CGP A;  1TBX A;  4M9S A;  5FO5 A;  3RPQ A;  1IRX A;  2RN7 A;  3CUQ C;  4YFN F;  1D0X A;  1S6L A;  3K4K A;  3S93 A;  1IN4 A;  5CJ9 A;  1V55 H;  4AID A;  3H3V K;  1RES A;  2FJ1 A;  3FK7 A;  3I59 A;  1IDY A;  2R5Y B;  1USS A;  1WFX A;  3PSF A;  3K1P A;  4UVA A;  1XD7 A;  1Y8Q B;  2FBI A;  3BTI A;  4LG0 B;  1HLV A;  1JJ8 C;  4BL0 B;  2R5Z A;  3A0H C;  4AM3 A;  3W3C A;  4U0V A;  2VAS A;  3HPG A;  5CYV A;  3S2W A;  3HSR A;  2X1C A;  2NRA C;  1IXC A;  4ENK A;  2NVY J;  3S1Q J;  2V9V A;  3GW2 A;  3I5U A;  3R0J A;  3AL0 B;  1R1T A;  4N0B A;  3OY9 A;  1Z6T A;  4M6V A;  1YTY A;  3WU2 C;  1SAN A;  3HC7 A;  2QSG X;  4YRV A;  1BW6 A;  3H35 A;  4MIM A;  2KIQ A;  2XAH A;  1X4P A;  4EGY A;  4AIJ A;  2M45 A;  1ON1 A;  2DOA A;  5F6F A;  4I99 C;  2EA2 A;  4HA8 A;  5E1X A;  4XIC A;  5CQE A;  3ZQI A;  4A6E A;  4II2 A;  3QQA A;  5E18 F;  3RCO A;  5EYR A;  5A2Q Z;  5A2Q K;  2Z33 A;  3W6V A;  5FKM A;  3RZD J;  3Q0V A;  4XID A;  3L1P A;  3KEO A;  4G6T B;  1BR1 A;  4D7N A;  1D1B A;  4EV0 A;  2ZKZ A;  3TKY A;  3A1Y A;  2ZBK A;  4IRH A;  4GYI A;  3GFL A;  2JK3 A;  2NNY A;  4FCY A;  2HDW A;  1Z77 A;  1MBH A;  2ZO4 A;  5D4R A;  2M0M A;  1YFH A;  1IRG A;  2EPF A;  3PIP F;  2EZL A;  2V1D A;  5DCM A;  1Z7U A;  1V5F A;  2KZG A;  1JE8 A;  2ZFW A;  3C18 A;  4KYW A;  2NVQ J;  5CVJ A;  5HLI A;  5JI6 A;  2VE9 A;  2KLO A;  4PDK A;  4P5O A;  1WH7 A;  1D5Y A;  1U6G A;  3ZN1 A;  1W1W E;  2ZXJ A;  4BJ5 C;  3BR1 A;  2BEO A;  2YR2 A;  5IY5 H;  4OMY A;  5K1Y A;  4CGZ A;  1POG A;  4ZDO A;  3LSH A;  2CQK A;  3JTG A;  5HNF A;  4PFO A;  5BNG A;  4H0E A;  1CF7 B;  3FIW A;  2EIK H;  1Z3X A;  1I39 A;  3GZN B;  4YFK F;  1IAW A;  2LF7 A;  1SVL A;  1OFC X;  1OCO H;  4FX4 A;  5LHH A;  2M3A A;  1BC7 C;  1VTN C;  1U78 A;  1XSX A;  1MBF A;  2MC4 A;  1I27 A;  3BTC A;  5K5Q A;  4OIO F;  4CCM A;  1UB9 A;  3LA7 A;  4G9Y A;  3I4N J;  2DMU A;  2EA4 A;  1JKQ C;  2IGO A;  5DYM A;  4A3F J;  4NC7 A;  1ZG5 A;  4I0B A;  2Q8K A;  3N05 A;  2Y48 A;  2CFO A;  1CQT A;  3F8N A;  1X1A A;  3Q0U A;  5J8F A;  3CCL I;  2H8R A;  1ZRC A;  4OIP F;  3VWB A;  2M4G A;  4LD5 A;  1ENH A;  1I3Q J;  1YW8 A;  4J01 A;  3ABL H;  1HF0 A;  4DQ2 A;  4ZYG A;  1G3Y A;  2IA1 A;  2VT2 A;  3ZQF A;  4A5N A;  2UXN A;  2CUE A;  2KL4 A;  2ZCW A;  5L3D A;  3U21 A;  1T2K A;  4I09 A;  3QRF F;  1K78 A;  4N9H A;  2P5K A;  1JT6 A;  1YQA A;  2X6Y A;  3K69 A;  4KIC A;  3WGI A;  1VQ4 I;  2RC4 A;  1VQP I;  1OCP A;  2CGP A;  4MHG A;  2JSC A;  2R7U A;  1TW3 A;  1LE8 A;  1ZQ3 P;  5KNL A;  4Z2Y A;  2W25 A;  4B3A A;  3BC8 A;  5HDK A;  3OS0 A;  2CSO A;  2WC2 A;  2VPL A;  1U5T C;  3KP7 A;  3T8R A;  5J3L A;  3BQY A;  4QLC U;  4WK8 F;  3GBG A;  4D5F A;  1MH3 A;  1TZL A;  4Y3O A;  3K4J A;  2FBH A;  3F8C A;  3WHC A;  2R7X A;  2KQR A;  3HOT A;  3RSN A;  3G6E I;  1OCC H;  4XMY A;  3A03 A;  2PJR B;  2R7F A;  4Y52 J;  3W6K B;  2DU9 A;  5FRM A;  2MLG A;  1OCZ H;  2BYV E;  4KIF A;  4J00 A;  2AQF A;  4HW0 A;  1J2X A;  2XHK A;  2WY8 Q;  1BIA A;  2ZJQ F;  4P1W A;  3CCR I;  2LY9 A;  1WJ5 A;  4BHP A;  4E7K A;  4I0A A;  4A0Y A;  4BY7 J;  3HRU A;  2PMZ N;  3BG5 A;  3E1S A;  1V3F A;  5LBQ A;  2ELJ A;  2DLL A;  2ZJR F;  1P7I A;  4XSX F;  3LSM A;  3K9T A;  4CIC A;  3CES A;  3S17 J;  2V1N A;  4G7Z F;  4XLH A;  2G7U A;  5KAI C;  4A3L J;  1SD5 A;  3GLL A;  2BE5 F;  3ZMZ A;  2JQ7 A;  5EGO B;  3FMR A;  4RMN A;  1RUN A;  3Q9V A;  3ASO H;  1GHC A;  3G1O A;  2ESH A;  5TGT A;  2K9N A;  1SFK A;  3O3K A;  3NAR A;  2DFF A;  3DU5 A;  2E7X A;  3MAJ A;  3OSF A;  1BM9 A;  5GAG J;  1ZEL A;  1YJN I;  3J7A Y;  3J7Y J;  2FBK A;  1IN7 A;  2L4A A;  2QSH X;  1PDN C;  1BBY A;  1OR7 C;  1ETW A;  1QNT A;  2JT1 A;  1K6Y A;  2HVR A;  4E7I A;  1PUF A;  5FLX K;  4X6A J;  3ZQ7 A;  2MSY A;  1ITY A;  4ZJZ A;  1TNT A;  2TCT A;  1Z0X A;  1TL8 A;  3AFH A;  2X1E A;  3BT9 A;  1EA3 A;  1NG7 A;  4GGG A;  1KYZ A;  2WB1 N;  3GTQ J;  1YX3 A;  3I0T A;  4D5C A;  1A6I A;  4XN0 A;  3F3X A;  2IS2 A;  2K9M A;  2ZB9 A;  1YI2 I;  5F0C A;  1YLF A;  1MMA A;  4HZF A;  3H5R A;  1X58 A;  1J5Y A;  1MND A;  4Q4Z F;  1H88 C;  2K7L A;  2DFE A;  3F8M A;  2RKH A;  2VC1 A;  5CPR B;  3SEQ A;  3ZN0 A;  2JA5 J;  2IA0 A;  1S7O A;  2Y0S A;  4ZDP A;  4ZZD A;  1MNM C;  4I02 A;  1RKW A;  4HQE A;  3SYT A;  4BQA A;  3FBI B;  2A69 F;  2E2J J;  4V2G A;  2XDV A;  4IHX A;  1U5T A;  1WJB A;  3QP6 A;  3ABM H;  3MEX A;  2DK8 A;  2AXT C;  2XRL A;  5M5W J;  3O8G A;  3EET A;  3ABU A;  2QCO A;  3KE2 A;  1WJF A;  2E1O A;  4BGD A;  3DTK A;  3KEQ A;  4BNC A;  4AU7 A;  4E4H A;  2HDD A;  1VQ8 I;  4DIQ A;  2DOF A;  3DKW A;  3SDG A;  5JVG F;  2P7C B;  3BWG A;  1R36 A;  4XRS G;  4EM0 B;  2DMT A;  4L9N A;  5EEA A;  4JQF A;  1YIO A;  4P9F A;  5EEG A;  2XAG A;  3GTK J;  4XLP F;  2JVG A;  4F93 B;  4HF1 A;  2GA1 A;  2ZJP F;  2I8D A;  4M71 A;  4W1U A;  1ETY A;  5FLM J;  1X1C A;  3IH4 A;  2LK2 A;  4ENM A;  2XGD A;  4LFU A;  2ZSH B;  2K5C A;  3G73 A;  2B0L A;  4G8X A;  1D0Y A;  3Q9S A;  4Y17 A;  3WTS C;  3WTU C;  2COM A;  2R0Q C;  5LD2 C;  5J1U A;  4HX4 A;  1NK2 P;  3F9K A;  3BOQ A;  4LOC A;  1WH5 A;  1GVJ A;  3KZY A;  4IQ4 A;  1JGS A;  1YS6 A;  2DTZ A;  1HXD A;  1FOK A;  1SD6 A;  3CJR B;  1ZGW A;  1B72 A;  2B63 J;  5IYD J;  3HXL A;  2NVT J;  1G3W A;  3DBR B;  4CZC A;  2DXI A;  2XGX A;  1R6R A;  2JVH A;  2IA2 A; 
#chains in the Genus database with same CATH homology
 1VI0 A;  4A3M J;  4XRM A;  3BG3 A;  1IDZ A;  3BR6 A;  4Y7N J;  4A93 J;  1R9T J;  2R5Z B;  1MBE A;  3DCF A;  1TWC J;  1G2H A;  4BBS J;  1UG2 A;  5FKL A;  3F0C A;  2M0C A;  3S16 J;  3RZO J;  3GTP J;  3HBL A;  3QPL A;  5EGO A;  2IBD A;  1QVU A;  3ZQL A;  2L9R A;  5JLX A;  4GFB A;  1IG7 A;  1WGX A;  3MKL A;  3G1M A;  3BQZ A;  1QPI A;  1NK3 P;  1RET A;  3TW6 A;  1FIA A;  4JX4 A;  1LFB A;  5EF6 A;  1LFU P;  1RR7 A;  4BXX J;  1BW5 A;  4FE4 A;  4JYK A;  2K9Q A;  2VI6 A;  4B1R A;  5C44 J;  2DA5 A;  2JWT A;  4AUX A;  2AO9 A;  1U8B A;  3I4M J;  1ETK A;  2MG4 A;  1JUP A;  2JA8 J;  2N8G A;  2O9L A;  4A3C J;  4QTR A;  2MW8 A;  5E3O A;  3QPS A;  4EEF G;  3G1L A;  3HGY A;  1XC5 A;  1FJL A;  2LTP A;  1GV5 A;  2VKE A;  1RKT A;  4W97 A;  3B6A A;  2CQX A;  3O8H A;  1MSF C;  2JA7 J;  3HOY J;  5IP6 A;  1AKH B;  2D5V A;  4DYR A;  3GTL J;  3Q0W A;  1IUF A;  4MFD A;  4M3E A;  1K83 J;  2DA7 A;  5C3E J;  1JUS A;  2EZH A;  2P81 A;  2XSD C;  3SJM A;  5E3M A;  4L5E A;  2OF7 A;  3LNQ A;  3FKI J;  2ECB A;  2EH3 A;  5C4X J;  4MFE A;  5M5Y J;  4A3J J;  5K7H A;  5EZH A;  1E3O C;  1JTX A;  2G0E A;  4DZJ A;  1ETV A;  1IV6 A;  2EBI A;  2XGC A;  5M3M J;  1AKH A;  1X2N A;  2R5Y A;  2DMN A;  5GP9 A;  2IEK A;  3A01 A;  5FKO A;  2L7Z A;  1F36 A;  2VUM J;  2ID3 A;  4JP0 A;  1FTZ A;  2YUS A;  2Y30 A;  3PM1 A;  3M3Y J;  2DJN A;  5EZG A;  3JRA A;  1W0U A;  3M4O J;  4UUS A;  3HDD A;  3OOU A;  2NOG A;  4V2F A;  2M34 A;  1X2M A;  5FKK A;  4IEJ A;  2AHQ A;  1TWA J;  4JX6 A;  1HCR A;  1B72 B;  1B8I B;  3S1M J;  4J19 A;  3GTO J;  4ABZ A;  4A3B J;  5EG0 A;  2DA3 A;  1O4X A;  4G12 A;  1BJZ A;  4AYB N;  4FTH A;  2DA2 A;  2FQ4 A;  5IPA A;  1IGN A;  2X9D A;  3HOV J;  5HOD A;  2R7Z J;  1MH4 A;  2Y31 A;  3D1N I;  3K2A A;  3C2B A;  2EZI A;  2HOA A;  1ZKG A;  1B8I A;  3OIO A;  1MBJ A;  2HYJ A;  3BTJ A;  2YU9 J;  1Y1V J;  3S1N J;  2X6O A;  1WPK A;  2Y9Y A;  2OPT A;  4XRS A;  2R93 J;  2XPV A;  1GT0 C;  2I10 A;  5GPA A;  3IV5 A;  3HOW J;  3HKZ N;  1YRN A;  3LSJ A;  3K7A J;  4QSH A;  1EF4 A;  5F0H A;  3UKG A;  1JKP C;  1OCT C;  3JRH A;  2JMW A;  2DA6 A;  3H3V K;  1RES A;  2FJ1 A;  3FK7 A;  3HEF A;  1IDY A;  2NS7 A;  2R5Y B;  1IC8 A;  1GDT A;  4FIS A;  4BKX A;  3GTJ J;  4DZP A;  1TWG J;  3BTI A;  1HLV A;  1JJ8 C;  1BA5 A;  2R5Z A;  5J1R A;  4DYC A;  3HM5 A;  9ANT A;  1U9N A;  2VKV A;  4CYC B;  1QVT A;  3RKQ A;  2DA4 A;  3BR3 A;  4CYC A;  2NVY J;  3S1Q J;  2XPU A;  4MLO A;  5IYB J;  3ZOB A;  1JJ6 C;  3TED A;  4A3D J;  4M6V A;  2ELK A;  3LOC A;  1SAN A;  1FTT A;  1BW6 A;  4MIM A;  1VFC A;  3S15 J;  2HXO A;  4A3K J;  1IRZ A;  3CCY A;  2COB A;  2M9H A;  3HB9 A;  2M2E A;  4JX5 A;  1ETO A;  1BL0 A;  2NS8 A;  1JTY A;  2MGQ A;  2X48 A;  4XIC A;  3ZQI A;  1RPW A;  3QQA A;  1FEX A;  1I6H J;  3Q3S A;  1GV2 A;  5EYR A;  3W6V A;  5FKM A;  3RZD J;  3H0G J;  3Q0V A;  4XID A;  3L1P A;  4D7N A;  1H89 C;  2KDZ A;  2CQQ A;  5IYC J;  4UUT A;  2JK3 A;  4FCY A;  1Z77 A;  2VPR A;  1MBH A;  2GM4 A;  2XB0 X;  3HOU J;  2EZL A;  1ZTR A;  1MBK A;  2NVQ J;  5F04 A;  4QIW N;  1WH7 A;  2Y0S N;  1D5Y A;  4M3D A;  3BR1 A;  2JA6 J;  1POG A;  2K9S A;  3HGG A;  5BNG A;  3TP3 A;  3FIS A;  2CJJ A;  3LSG A;  1Y1W J;  2HXI A;  3BR2 A;  3FIW A;  4M3F A;  2R92 J;  3NAU A;  1HOM A;  1OFC X;  2CU7 A;  1U78 A;  3JRI A;  1GVD A;  1MBF A;  4XK4 A;  2L7M P;  3BTC A;  2O7O A;  5K7F A;  3JRB A;  1WI3 A;  2CRG A;  3JR9 A;  3I4N J;  1T33 A;  2DMU A;  3WHB A;  3IH2 A;  3LSR A;  5EDN A;  3JRC A;  1JKQ C;  4A3F J;  4C3J J;  2LKX A;  2ID6 A;  1DU0 A;  1CQT A;  1H8A C;  3Q0U A;  2H8R A;  1T56 A;  2JN6 A;  1S7E A;  5F08 A;  2LD5 A;  2E2H J;  2ME0 A;  1ENH A;  1I3Q J;  1VND A;  1HF0 A;  5J1Y A;  4A3E J;  1TC3 C;  3ZQF A;  2K40 A;  2HOT A;  1GUU A;  1K61 A;  2CUE A;  1ZR2 A;  1JKO C;  1TWF J;  2HOS A;  5M3F J;  1JT6 A;  4RBO A;  3OSG A;  4IHY A;  1ZK8 A;  1OCP A;  1MSE C;  4D7M A;  1A5J A;  5IOZ A;  2WAQ N;  3PO3 J;  1LE8 A;  2DA1 A;  1ZQ3 P;  2LP0 A;  2WV1 A;  4B3A A;  2LR8 A;  4M3B A;  3B6C A;  1F43 A;  5J3L A;  3BQY A;  4RDU A;  4IHW A;  2YS9 A;  3GBG A;  4D5F A;  1MH3 A;  3JRF A;  3GTM J;  1UMQ A;  1UHS A;  3WHC A;  3A02 A;  4B4C A;  1YRN B;  2HQ5 A;  2DN0 A;  3S14 J;  5EG0 B;  1JGG A;  3A03 A;  4Y52 J;  1P7J A;  4A3I J;  2LVS A;  2FX0 A;  4X1E A;  1IJW C;  3VPR A;  2LY9 A;  3ZQH A;  4BY7 J;  1ORK A;  2PMZ N;  3BG5 A;  1TWH J;  4HNV A;  4A3G J;  1APL C;  1NTC A;  2FD5 A;  5FKN A;  5IP7 J;  3RQI A;  3S1R J;  1P7I A;  4C3I J;  5F27 A;  3S17 J;  2CUF A;  4A3L J;  5IP9 J;  2IAI A;  5EGO B;  3BTL A;  1LE8 B;  3CQZ J;  4I76 A;  1OJL A;  3HOZ J;  3G1O A;  1WCM J;  4FE7 A;  2K9N A;  3NAR A;  3S2D J;  3OSF A;  2DMQ A;  2QF7 A;  4DW6 A;  1MBG A;  1W0T A;  1DU6 A;  5F0F A;  5M5X J;  1ETW A;  1XS9 A;  1PUF A;  4MO7 A;  4X6A J;  2MSY A;  1ITY A;  2E19 A;  2E2I J;  1ETX A;  2Y9Z A;  2TCT A;  3TP0 A;  2H1K A;  1Z0X A;  1AHD P;  3FK6 A;  3BT9 A;  2KT0 A;  2WB1 N;  1ZR4 A;  3GTQ J;  3BG9 A;  4D5C A;  1A6I A;  2ZB9 A;  5F0C A;  2ME6 A;  1HDD C;  4IHV A;  1X58 A;  2XB5 A;  3E7L A;  3JRD A;  1H88 C;  1HDP A;  2JA5 J;  5FLV A;  1MNM C;  4AC0 A;  5E3L A;  4C3H J;  1RKW A;  3MVP A;  1ETQ A;  1JUM A;  2O8K A;  4S0H B;  3BR5 A;  1I50 J;  2E2J J;  2RAE A;  4V2G A;  4IHX A;  4UUS B;  3LSP A;  2L0K A;  2DMP A;  3CMY A;  2XRL A;  5M5W J;  1SFO J;  3O8G A;  4BBR J;  3DEW A;  2QCO A;  2E1O A;  2Y2Z A;  2TRT A;  2HDD A;  4A69 C;  1JT0 A;  1JKR C;  3SDG A;  2LLK A;  2XPW A;  2LFB A;  4M3G A;  2GBY A;  1Q1V A;  4XRS G;  2DMT A;  5E3N A;  3MN2 A;  2NVX J;  5EEA A;  3JRE A;  5F1J A;  2HI3 A;  3SFI A;  5K7Z A;  2L7F P;  3JRG A;  3GTK J;  5DS9 A;  4NDL A;  3ZQG A;  4W1U A;  1ETY A;  5GPC A;  5FLM J;  1FIP A;  3GTG J;  3IH4 A;  1U9O A;  1VF9 A;  2ECC A;  2LK2 A;  2XGD A;  1AU7 A;  4DYQ A;  4C2M J;  3IH3 A;  2R0Q C;  5JLW A;  3ZQC A;  1QRY A;  1XG1 A;  5IOY A;  5J1U A;  1NK2 P;  2XGE A;  2JJ7 A;  4LOC A;  2EQR A;  1WH5 A;  2M8G X;  4I6Z A;  3S2H J;  4BY1 J;  3A01 B;  3PO2 J;  5C4J J;  3HOX J;  3CDL A;  3TW7 A;  5DTD A;  5FJ8 J;  2W48 A;  2DTZ A;  3BR0 A;  1ZGW A;  1B72 A;  2B63 J;  5IYD J;  2NVT J;  1PUF B;  2EZK A;  2GLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...