3M3YJ

Rna polymerase ii elongation complex c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3m3yJ00
2HYJA 5JLWA 1GV5A 2QF7A 4ABZA 5EG0B 2CQXA 1GUUA 2ELKA 3SJMA 1QPIA 1RKTA 3S14J 3A02A 2EQRA 2R7ZJ 2IBDA 3H3VK 1P7IA 2NOGA 4Y7NJ 4RBOA 2LVSA 2DMUA 3ZQFA 4JX5A 2JMWA 2MSYA 3L1PA 4A3KJ 3A01B 3JRHA 5GP9A 1CQTA 1PUFA 2DMNA 2M8GX 2L0KA 3GTOJ 2HOSA 4UUSA 1JUPA 2DA6A 2NVYJ 2LLKA 2E19A 1Y1VJ 1ORKA 2L7FP 5E3MA 2NVXJ 4AC0A 1ETVA 2GM4A 3CQZJ 3TW7A 4B3AA 1Q1VA 2EZKA 3LSRA 1JJ6C 2R5YB 2NVTJ 2L7ZA 3GTKJ 5BNGA 4XRSG 2O7OA 2AO9A 3Q0UA 3JRAA 3JRCA 1U9OA 4XK4A 3JRDA 1GT0C 1ITYA 1YRNA 3FIWA 4FISA 4IEJA 2H8RA 5M3MJ 2MGQA 2LKXA 2LK2A 3ZQHA 1U9NA 3TP3A 1HOMA 3HEFA 2K9SA 2R93J 2Y31A 2XRLA 2KT0A 4QTRA 4D5FA 3NARA 2GLOA 3HDDA 3BR0A 1ETYA 2JK3A 3DEWA 3BG5A 4BXXJ 4JP0A 1FIAA 1ETQA 1GDTA 5EGOA 4NDLA 1FEXA 3HB9A 1MBHA 2XPUA 3O8GA 1W0UA 1BL0A 1DU6A 2HXOA 2DMPA 1JUMA 5E3NA 4V2FA 3I4NJ 2DN0A 1TWCJ 3E7LA 5HODA 5C4XJ 1G2HA 2P81A 5IYCJ 4XRMA 5IP9J 1ENHA 5K7FA 2XPVA 1RESA 3A03A 1IG7A 1BA5A 3BQYA 5IYDJ 2HDDA 1VFCA 4XICA 3BG3A 3B6CA 2HOAA 1MH3A 1XC5A 3Q0VA 3ZQLA 5J1YA 4W1UA 3W6VA 3S16J 1GVDA 2DA7A 1P7JA 3F0CA 3BQZA 1OCPA 4I6ZA 4IHYA 1TWHJ 2WB1N 1AKHB 1UMQA 3PM1A 4MFEA 4X6AJ 2XGDA 1HDDC 3G1LA 5DTDA 2Y9ZA 1ZK8A 4A3LJ 1IDZA 4IHWA 3BR1A 1IUFA 3M4OJ 1JKPC 4JX6A 4MLOA 2R5ZA 2R92J 3BTCA 3QPSA 1BJZA 1MBKA 3HOZJ 4DZPA 3GTJJ 1A6IA 2W48A 1MBGA 1ZTRA 2M0CA 3CMYA 3S17J 4C2MJ 4A3BJ 2HXIA 4JX4A 3LSGA 1U78A 3PO2J 4W97A 3HKZN 4C3IJ 4I76A 3LNQA 2XGEA 1JT0A 1B72A 1LE8B 3S1MJ 1JT6A 2MW8A 2H1KA 2M34A 4GFBA 1UG2A 5EGOB 1B8IA 1RETA 3NAUA 3WHCA 1VI0A 4A3DJ 2FD5A 3S2DJ 3GTGJ 2D5VA 2WV1A 4DYRA 4JYKA 4DW6A 2EH3A 2LR8A 2K9NA 2Y30A 1HF0A 4BBSJ 3OSGA 2HQ5A 3M3YJ 1I6HJ 2ME0A 4EEFG 4A3EJ 5JLXA 1IRZA 4HNVA 2JA5J 1ZR4A 4C3JJ 3IH3A 1E3OC 3FKIJ 4UUTA 3BR6A 5IP7J 1XS9A 4DZJA 2COBA 1WCMJ 1Z0XA 1XG1A 1NK3P 4CYCA 2JA8J 1K61A 3IV5A 3O8HA 1H8AC 1MBJA 1IDYA 5F04A 1RKWA 3HGYA 3IH4A 4L5EA 1AHDP 2JN6A 1JTXA 1TWGJ 2ECCA 3BTIA 4MFDA 4B1RA 5M5XJ 1BW5A 5J1UA 5EYRA 1IGNA 1MNMC 5K7HA 2NS8A 2X6OA 3GTMJ 4AYBN 2NS7A 2HOTA 5EZHA 1FTTA 5EG0A 2XSDC 2NVQJ 3HOUJ 1QVTA 5EZGA 4QIWN 5F27A 5FLVA 3BG9A 5FKMA 2JJ7A 3B6AA 1GV2A 5EEAA 1FJLA 2IAIA 2JA6J 4BY1J 1K83J 4MO7A 3JRGA 2OF7A 2CUEA 1NK2P 3RZDJ 3TW6A 3D1NI 2DMQA 4FTHA 2LP0A 1NTCA 3JR9A 1QVUA 5M5WJ 1Y1WJ 5IOZA 3S1QJ 2ID6A 1EF4A 1PUFB 1MSFC 4M3DA 3OSFA 2OPTA 3CDLA 1H88C 1ETXA 1POGA 2LTPA 3I4MJ 4UUSB 4X1EA 2LD5A 1DU0A 4IHXA 5GPAA 2O8KA 1ETOA 1HLVA 1T33A 4FCYA 1MBFA 3RQIA 2R5YA 1RPWA 2VKEA 5FKOA 3HGGA 1JKOC 4A93J 2VPRA 4A3MJ 1RR7A 1H89C 2TCTA 2XPWA 2YS9A 2XGCA 3QQAA 1OJLA 3JRFA 1D5YA 4BY7J 1MSEC 4D5CA 5FKNA 1YRNB 3ZQCA 4A3JJ 1F36A 2X9DA 1ZKGA 4CYCB 4D7MA 4M3GA 2XB5A 4M3BA 3SFIA 3MN2A 5GPCA 5C4JJ 1IC8A 5J3LA 5M3FJ 4IHVA 3QPLA 5J1RA 1Z77A 3JREA 3BR5A 1O4XA 2FQ4A 3WHBA 3MKLA 1VF9A 3G1MA 2VKVA 3HOXJ 4D7NA 4A3IJ 2EZIA 3S2HJ 4A69C 3S15J 2QCOA 2XB0X 2AHQA 2GBYA 4M3FA 1ETWA 2M2EA 5FJ8J 5F0CA 1APLC 2CUFA 3OOUA 2K40A 2EBIA 3BTLA 4BBRJ 4QSHA 4C3HJ 3BR3A 1U8BA 3RZOJ 3HOYJ 3CCYA 1OFCX 1T56A 1WH5A 1QRYA 2LFBA 1A5JA 3Q3SA 3LOCA 1SFOJ 3G1OA 3K2AA 2E2IJ 3Q0WA 1MH4A 3GTQJ 2DA2A 2DJNA 2EZHA 1TC3C 4XIDA 2ZB9A 1W0TA 2I10A 2TRTA 2Y2ZA 5K7ZA 3JRBA 2MG4A 4S0HB 1TWAJ 2DA5A 5FKLA 4BKXA 2ME6A 2Y0SN 2M9HA 3PO3J 1HCRA 2FX0A 1I3QJ 2RAEA 1SANA 3SDGA 3HM5A 2L7MP 4AUXA 5FLMJ 4DYCA 4FE7A 2B63J 2YU9J 2CRGA 4RDUA 3TEDA 3GTPJ 4Y52J 5E3LA 2JWTA 1X58A 1AKHA 2E2HJ 2IEKA 3HOVJ 3LSPA 3UKGA 2E1OA 3K7AJ 1WGXA 4XRSA 1JKQC 1MBEA 2PMZN 4A3FJ 1ZQ3P 1JKRC 3FK6A 3OIOA 3VPRA 5IOYA 2VUMJ 4G12A 2X48A 1WH7A 1LFBA 5F0FA 4DYQA 2R5ZB 4MIMA 3TP0A 1HDPA 2ID3A 3MVPA 5F1JA 2CJJA 3BTJA 9ANTA 1FTZA 1ZGWA 2VI6A 2Y9YA 4FE4A 3ZQIA 5EDNA 2N8GA 1X2NA 1WPKA 2E2JJ 1VNDA 2LY9A 2KDZA 1F43A 3A01A 2CQQA 1WI3A 1LE8A 3BR2A 5C3EJ 5DS9A 3HOWJ 3S1NJ 3C2BA 1I50J 1B72B 2DA3A 2DMTA 1S7EA 3ZOBA 5IYBJ 4V2GA 1B8IB 2EZLA 2G0EA 1ZR2A 3FK7A 3ZQGA 1IJWC 2O9LA 1JUSA 3DCFA 4B4CA 1X2MA 3JRIA 4A3GJ 5M5YJ 3IH2A 2YUSA 5IP6A 1JJ8C 5E3OA 2FJ1A 1ETKA 1TWFJ 2DA1A 1AU7A 5F0HA 1FIPA 2CU7A 1BW6A 5F08A 3H0GJ 3FISA 1OCTC 2R0QC 1JGGA 3S1RJ 4J19A 3GTLJ 2ECBA 1JTYA 3HBLA 2DTZA 2K9QA 5IPAA 1R9TJ 1LFUP 3GBGA 2WAQN 4M3EA 5EF6A 3BT9A 2L9RA 3LSJA 5FKKA 4M6VA 4LOCA 1UHSA 3RKQA 2HI3A 1IV6A 4A3CJ 2JA7J 2DA4A 5C44J
chains in the Genus database with same CATH superfamily
1USTA 2ACJA 2OZUA 2HYJA 3IUOA 3BOQA 1D8KA 2RNGA 1ZG3A 4EJUA 1IRGA 3F9KA 1GUUA 4IXAA 2ELKA 2KJBA 4NBQA 1F9NA 1SVMA 1P7IA 2K9MA 3LSTA 2KQRA 3LSKA 4RBOA 2DMUA 1VQLI 3ZQFA 4JX5A 2JMWA 3L1PA 4A3KJ 1KYZA 1TZLA 4I99C 1YS6A 1LEAA 2RV8A 3KETA 2NOJB 5E1WA 3KIOA 3OR2C 4Z6YA 1A31A 3OY9A 1W5SA 2LC2A 3HRTA 1JUPA 2QM3A 2XHKA 2E19A 1ZN2A 3RYPA 2L7FP 2HR3A 1SVLA 2OD5A 4AC0A 1LNWA 3RSNA 3QODA 5CQEA 5JHFA 2EIJH 1ZG1A 1FNNA 5J8FA 3BJ6A 4WK8F 2GXAA 2HTSA 2R5YB 1ZH5A 2MFZA 2L7ZA 5DM6F 1QHGA 4XRSG 3VOEA 2V6CA 2O7OA 1IN8A 3V8JA 4B47A 1GT0C 1PP8F 4HPQA 3FMRA 5CPRB 2LYCA 2OCEA 3OYHA 5E79C 3FF5A 5FFXA 4ZH4F 4FISA 4BHBA 1YG2A 3H9QA 1J5YA 4UY8I 2STWA 2HYGD 3P9IA 1U9NA 1F1ZA 1ZLKA 1USSA 2ZNZA 2R93J 2HEOA 1XSDA 3T8RA 1FBQA 1XDSA 4M9ZA 2MH2A 3BP8A 3NARA 3HDDA 1BR4A 3BR0A 1ETYA 2NAZA 4GYGA 2JK3A 3O6BB 4LK1F 3BG5A 2MA3A 4FHTA 3U1KA 3HUGA 3SDBA 4BXXJ 1GDTA 4J00A 5EGOA 3JCUC 3TOBA 1ERDA 3K1MA 3I0TA 2KMUA 2XPUA 2IA0A 2YX4A 3BWGA 3QRFF 1W0UA 3GEZA 1DU6A 2DMPA 3N4MA 2Z1DA 3CJTB 2R7UA 2GA2A 2KRFA 2V9PA 3GX4X 1SFXA 4CICA 3VYRB 3B73A 2DN0A 3OS0A 5C4XJ 3K4JA 3MD2A 4XONA 2P81A 1U3EM 5ILVA 1ENHA 1O7LA 3DEUA 2QWWA 2XIGA 1KQ8A 1BR1A 1WQ2A 1IG7A 2PG4A 2FNPA 1BA5A 3BQYA 5IYDJ 1FP2A 3BG3A 3V7RA 3B6CA 4M73A 2HOAA 2HGCA 3ZQLA 4LLGF 2D2WA 2XAJA 5J1YA 1ZREA 2RKHA 3TOAA 2VE9A 1Z3YA 2BZTA 2DA7A 1P7JA 3F0CA 1LUJB 2ETHA 4G6QA 4J01A 2WB1N 4GRIA 1DQUA 4DGWB 1LDJA 3GWZA 3G1LA 1N75A 2XROA 3F3XA 4ENJA 3CCLI 4QPOA 2DDAA 4LG0A 4P55A 2ELJA 2R7FA 4HW0A 3BR1A 5CVUA 2VLAA 1IUFA 3OYJA 1HW2A 5FRMA 2DOEA 3J7AO 2DT6A 3LA3A 4ZDPA 2P5KA 1S7AA 1BJZA 3H1CA 3QU3A 2OTJI 1ZAOA 2CS3A 2HYFA 4S05A 1MBGA 1WJ5A 2M0CA 3CMYA 1EH8A 1A04A 2GZWA 3S17J 5HLGA 3PO2J 3Q5FA 3HKZN 4C3IJ 3J81K 1YHQI 4I76A 2ZMEB 3BG7A 4Q5SF 2CV2A 1JT0A 1ZHFA 2WAQA 2BVMA 1X3UA 2DI3A 2LF7A 3OL3A 1B8IA 1RETA 1G59A 2DW4A 2Q2EB 3ZXSA 1VI0A 3L9FA 4FX0A 1PJRA 5DV5A 2DPDA 2FEZA 3KP7A 4ZZDA 3G71I 2WV1A 1QBJA 1TQPA 2ZXWH 2M30A 4KN7X 1IN5A 4RLQA 4N9IA 3PQKA 2EINH 1P9QC 1IRZA 3PIPF 4HNVA 3HC7A 3SXYA 4M74A 3KEYA 3AFHA 4U88A 3ERMA 3CCJI 3CUOA 4KJZA 4UUTA 5HLTA 2LNBA 2PFBA 4G8XA 3BR6A 4DZJA 5FRNA 2COBA 1WCMJ 1X4OA 3W6KB 3PFYA 4XORA 2BY0A 1NK3P 5HLIA 4KIGA 3IV5A 3KFWX 4ITVA 2P0WA 5F04A 3IH4A 4M6XA 3IL2A 2BE5F 2CQKA 2HWVA 2ZFWA 3LAPA 5K5RA 3BTIA 4MFDA 4ZTJA 4N0BA 3OYMA 3H3UA 3MZ8A 1WFXA 4PGGA 1U5TA 2FOKA 2ISZA 2KP6A 1UHMA 5EYRA 2XKOA 2X6OA 5EG0A 2XSDC 1OCCH 2VKHA 2NRAC 4HX7A 4WF2A 4BYYA 3HZJA 2KIQA 4BNCA 5FLVA 1W7PA 4KUMA 5FKMA 4Y33A 4ESFA 2BVLA 3B02A 2G7HA 1ON2A 3QP6A 2HQNA 4H0EA 3P7NA 1X4PA 1HW5A 3OYLA 3D1NI 1YITI 1NTCA 3BZKA 3L7WA 2DAOA 4BXUA 2R7VA 2B7EA 4WXHA 3BPXA 2QBYA 1PUFB 3C7JA 3REOA 3IKTA 1U5TC 3BCBA 3E97A 2BYVE 3EUKL 4DNCA 4UUSB 2HOEA 3M8EA 4KMUX 4BQNA 4U0VA 1ETOA 1D1BA 2OUMA 5HDKA 1MIJA 4R79A 4HLXA 5FKOA 1KU7A 5CLSA 5BPDA 4XM3A 4A93J 1RR7A 3EUHA 1JI8A 2R3SA 3JTHA 1YW7A 3AL0C 2XGCA 3PSFA 1FZPB 1OCOH 2OCCH 3CUQB 1V3FA 1FOKA 3SHFA 3ZQQA 2CQNA 3VSLA 4Q4ZF 4IOCF 1F36A 2X9DA 1ZKGA 2FMYA 4UNOA 4D7MA 2A07F 2F5FA 5EEHA 2X51A 1ODDA 4M3BA 5DCMA 5J3LA 4L18B 2VODA 3QPLA 1GXPA 1U2WA 1Z77A 2W84A 4RAGA 3LA2A 3MKLA 1K4TA 1I6XA 4D0PA 3G1MA 1XMKA 4A3IJ 3RTRA 3VFZA 1RIOH 2EZIA 4RAFA 2PI0A 4JOMA 2VONA 3S15J 2QCOA 3GZ5A 3W3CA 4XLPF 1JHHA 1ZGAA 5FJ8J 4E70A 2CUFA 4AM3A 2KZVA 2K40A 2PQ8A 2EBIA 2A6TA 3OL4A 3FMSA 3BR3A 3HOYJ 2IS1A 3WU0A 2W7NA 3EUHC 2NNYA 2MH9A 1T56A 1WH5A 2EJRA 3ZN0A 2QQAA 1QRYA 3HG9A 4YFNF 2W25A 3WTYC 2KDOA 1MH4A 4E4HA 4ON0A 1MKMA 1UJ8A 2DA2A 4QWQA 1TC3C 1TW2A 2ZB9A 2I10A 3NRVA 1SEUA 1KU2A 3GLXA 5K7ZA 2P5LC 4L0YB 2XAFA 2VKDA 4S0HB 4YRVA 1TWAJ 5GAEJ 2K85A 3ECOA 3J7ZI 4OOIA 1R6RA 1W4MA 5JFRA 4LB6B 2V1DA 3PL8A 1HCRA 1BI0A 1I5ZA 2QSHX 3GFJA 3K70C 1IRXA 2JUCA 2G9WA 1SANA 3F8MA 2JPBA 2L7MP 4RM3A 3SDGA 1ULYA 2Z2SB 4AUXA 2M7AA 3EDPA 3TEDA 1TTYA 2JWTA 1D5VA 5D5UB 4Y15A 1Z7UA 1YX3A 1AKHA 2E2HJ 2IEKA 3F72A 1BI3A 2Z3YA 4EJOA 3UKGA 3E6BA 3HTSB 3EETA 1QPMA 3R61A 5LRRA 2PMZN 4U87A 3I9V2 2EILH 5HNHA 1D1AA 4A3FJ 1ZQ3P 4L0ZB 1VQKI 2L02A 3ABTA 4RB3C 1R49A 1T95A 2E34A 3OYKA 3RPUD 2IGMA 4BDZA 3L2QA 3MVPA 9ANTA 3KZYA 4A6DA 1ZGWA 1IUYA 3IRQA 4FE4A 5EDNA 4AIJA 1T0FA 3IRRA 2R4GA 3ZMUA 3A01A 1WI3A 2P4WA 4HG2A 4XKCA 5ED4A 4PJMA 3DXJF 3S1NJ 3EUAA 3C2BA 4D9JA 4AWXB 3ZOBA 3HHGA 4L9VA 4ENNA 3T5XA 1XX5A 3E5XA 3FK7A 1Z6TA 5D4SA 2EK5A 4PZJA 4JBAA 2R7XA 3N05A 3U1DA 3ABLH 3DCFA 3HRUA 3A1YA 2HKXA 2H6BA 3IH2A 4HNTA 4YIFA 2UV1A 1FYLA 5EEGA 2P7CB 2CH0A 5IP6A 3CLQA 4F52A 4LLNA 2BHYA 5E3OA 3LA7A 2FJ1A 1TWFJ 2RGVA 2V4JC 2VC1A 2LDUA 2DA1A 4II3A 3CC2I 1BW6A 2JTVA 4CSWA 1MMAA 5ILUA 1OCTC 2UZKA 2R0QC 2GOXB 2ZJQF 2M3AA 1JGGA 1TT5B 4J19A 3DBHB 1LDKB 1EH7A 4KIFA 3D0SA 4F92B 1WZ2A 2JQ7A 2K7LA 3OS1A 3AKZA 5IT9Z 3SYTA 2DYRH 1G3SA 3HYIA 3OIQA 4A6EA 2E1MB 3CP8A 1Z1DA 4LGWA 4CZZA 2HI3A 4B8XA 1IN4A 2HDCA 2DA4A 2NYXA 5C44J 4F3QA 2UWMA 1Y6IA 3CLOA 1RC9A 2VJIA 3I59A 4B3XA 4XNFA 2M0MA 2ZSHB 3SJMA 3MAJA 1QPIA 2WY8Q 3MWMA 5CQGA 5A2QK 3A02A 2EQRA 2DU9A 2ZXJA 4U0YA 3G2BA 1YI2I 3SZGA 1X1AA 1BC8C 1YQAA 2VQGA 2ZCWA 3FHNA 3H5NA 4ETSA 2OZ6A 3JRHA 1I1SA 1LDDA 4XN3A 4KDPA 2M8GX 2LRDA 2HDWA 2L0KA 3U9GA 3GTOJ 4BUPA 1S8NA 2HOSA 1MDMA 2GOMA 4S04A 2A5WA 2DA6A 5DDGA 4PFPA 4N4NB 4RB0A 1KU9A 1V4RA 1DGRM 5E3MA 1R1TA 2VBWA 2NVXJ 4MEYF 4A2UA 2DFFA 2L4MA 3CQZJ 4B3AA 1Q1VA 2LOOA 2HQRA 1MZBA 3PNVA 2DODA 2JSPA 3GTKJ 5BNGA 3QYBA 1HXDA 5LD2C 3V42A 1FWZA 3JRAA 3JRCA 2QEXI 1U9OA 4XK4A 2E71A 1ITYA 3FBNB 4BHPA 5JHUA 3CF2A 1YRNA 3HSEA 1MD0A 2HQAA 4XLAA 1O3RA 5M3MJ 2Y0SA 2LK2A 1J09A 3KE2A 5LGUA 5GAHJ 1X3ZB 1NHAA 2M1BA 1EA3A 1UELB 3HEFA 4Y17A 4G9YA 4ESBA 2VJJA 5JI6A 3GFMA 2JVHA 3J7AY 2X85A 2ZBKA 4QTRA 4AVZA 2QLZA 4PJLA 2GLOA 3ZQ7A 3BROA 4FETA 4NC7A 3E1SA 4NQWB 4XLNF 2ISYA 1O57A 2ZJRF 1PYVA 2VE8A 3ZP5A 4XSZF 4Y13A 2GWRA 1VZ0A 4NDLA 4XBFA 1XGOA 3GYHX 4G7HF 5JVTA 1GVJA 1BL0A 2HXOA 1XCVA 3I55I 4M71A 1D0XA 1XSVA 1Y8QB 3ASNH 1JHFA 3CP2A 3GLLA 3CCVI 3FXOA 5LEKA 2V1NA 3I4NJ 4IZZA 1TWCJ 2WAFA 5HODA 2YR2A 4BDYA 1G2HA 4RLFA 2X6WA 4UVCA 3SEZA 1FY7A 3F21A 2AS5F 3BC8A 2V9KA 5IP9J 1SFKA 1XTAA 5K7FA 2XPVA 2K4BA 2FRHA 3W2AA 3MZHA 4EM0B 2IT0A 1IN7A 1Y56A 2FMLA 2OJED 4HV6A 3VYTB 4MTDA 1MH3A 3Q0VA 1S3JA 4O6JA 4PUSA 4IF4A 2DFEA 3RKYA 2LBFA 3S16J 1FLIA 2AXLA 1X1PA 3BPVA 2QA4I 1WSUA 1VQ5I 5KVRA 3DKWA 1ZRFA 1Y39A 3KYLA 2OBPA 3R0AA 5BOXA 3HOSA 1R71A 4U7BA 4X6AJ 2XGDA 2QKLB 3L2VA 3E6CC 1HDDC 4BE1A 2X0LA 2Y9ZA 1H9GA 2EV5A 2XAHA 3CCQI 4PJNA 1IDZA 4XLEA 3H35A 4L9JA 4NB5A 3ZGKA 5K1YA 1FOWA 3I64A 4IHWA 3AAFA 4Q48A 2QZ8A 1X1DA 4MLOA 4E7SA 1FP1D 4D1QA 2P6SA 3V8KA 3BLYA 3PQJA 2VIXA 1U8RA 4EVIA 3KEOA 5L3GA 2W48A 1TT0A 3MKZA 5H6QA 1E0EA 2F5VA 1N78A 4GXOA 2IS4A 2HXIA 4JX4A 1E2XA 5TISC 2CUJA 1SFEA 1MNDA 3LNQA 3R60A 1I3AA 5FGMA 1LE8B 3E3VA 4IX7A 1E3PA 1WJCA 2H1KA 3V8LA 1UAAA 1KQ0A 5EGOB 4TV7A 3FXQA 1OPCA 4JK1X 3CCSI 2FD5A 4HX8A 4QPQA 2ADUA 3GTGJ 3QWLA 1W36C 2D5VA 2VXZA 4RB1A 1BM9A 4JYKA 4DYRA 2K9NA 1HF0A 4UB8C 2HQ5A 3M3YJ 1B6AA 4XSXF 1R5GA 2EPFA 2OAZA 3VB2A 2HS5A 3FM3A 5ILSA 1X3WB 2V9VA 2JA5J 1ON1A 2CG4A 3D5SC 3GO5A 3F8BA 4C3JJ 4BGDA 2V1XA 2KL4A 2DOFA 3PUBA 1OYYA 4RM2A 4LIVA 2EFQA 1S5LC 2BY2A 3C1DA 5IP7J 5LHIA 3GF2A 3MFKA 2IVMA 4I02A 4FX4A 4B43A 5DCFA 3TO7A 5E17F 4CYCA 2JA8J 4ZYDA 2E36A 1O3SA 1MBJA 2ZFUA 1IDYA 2Q0OA 2DK5A 1X19A 2O03A 1AHDP 4HDUA 3J7YJ 2XAQA 2A05A 1MJ9A 2OV7A 4BEHA 2RDPA 4HLYA 4IHSA 1CF7A 3WGIA 4UXNA 3D5RC 5M5XJ 3PNTA 3OYIA 3E5QA 5J1UA 5HS9A 3X2QH 5H20A 3PJRA 3PUFA 3BZ6A 5K7HA 4IO9F 2HOTA 4BL0B 4DIQA 2X6XA 2XKPA 5DEQA 1BC7C 4LG3A 3S93A 5EZGA 2V1UA 5F27A 2EFWA 4XOTA 4AIHA 5D8LB 4ASNA 1G4DA 2CMPA 2JJ7A 5GTIC 1GV2A 5EEAA 2COMA 2F4OB 3VEPA 2JA6J 3OOPA 5J40A 2CGPA 2KISA 4CCMA 3H0DA 2GQQA 2VASA 2LP0A 4R8HA 1Y1WJ 3JAMZ 5IOZA 5KK1A 2TDXA 3RJPA 4CHUA 3CO7C 1MSFC 1E17A 1HSTA 1EF4A 4M3DA 5CKTA 3VYUB 3OSFA 2OPTA 4CUGA 3J80K 1RR8C 1R5HA 3K4KA 3WU2C 4X1EA 3CDIA 2EFPA 2LD5A 3WE3A 3OYDA 1DU0A 5D4RA 2GIVA 4IHXA 1IZ1A 2BV6A 1T33A 2JZYA 4FCYA 4XLCA 1MBFA 2R5YA 3S32A 3FM5A 3HGGA 1HQCA 2Y75A 2VPRA 1B1BA 2QYOA 2WTEA 1YO5C 2MC4A 3QAHA 2YS9A 3PFIA 5B66C 1BBYA 1OJLA 3JRFA 4BY7J 2MC3A 4D5CA 3ZQCA 4A3JJ 4N9HA 4KN4X 1HKQA 4M3GA 1ZYRF 4I0BA 4KA4A 5M3FJ 4G6DA 4HQMA 3H92A 4AU7A 1M1EB 2AQFA 3JREA 2PX9A 3BR5A 1QZYA 2VOPA 2FQ4A 1SMTA 3BJAA 3CZ6A 1H0MA 2BY3A 1BI2A 2VKVA 3LQRA 1UB9A 3S2HJ 3MKWB 1UZCA 1RNLA 2AQEA 2L9NA 3CESA 2F5DA 2WB1A 4XLHA 2VOOA 2XAUA 4QSHA 3ERED 2DQLA 5FD6A 2A3SA 1RUOA 4IRHA 3AG1H 1XD7A 4MQVA 2CFOA 1LJ9A 4F55A 1A5JA 3S2WA 2P8TA 1TLHB 3K2AA 2E2IJ 2XAGA 5H2FC 3AL0B 3GTQJ 1FMWA 1Y8RB 3IHUA 1W7PD 2DPUA 3BDDA 2LY1A 1S6LA 3BG6A 1D8JA 3WTWC 3K9TA 4B48A 4CYDA 3JRBA 3K0LA 4HAMA 2D45A 1R00A 1H9TA 4BKXA 4HZFA 2QSFX 3HTUA 2M9HA 3EYYA 3PO3J 4BE0A 3WG9A 3HKZA 5IT3A 2P5VA 3COAC 1I3QJ 2I5UA 2D1VA 4FQGA 3ESWB 3EQLF 4RDUA 3T1BA 2IJLA 4F7ZA 2BBYA 3QYEA 4OMYA 1HKTA 3DKYA 4E7KA 1WJFA 1IW7F 3EPZA 1AA7A 3IAS2 1LQ1A 1FT9A 3HRMA 3FHZA 3AG4H 3HOVJ 1P2FA 4RGSA 3LSPA 4H4KC 1K79A 4OMZA 1XPXA 4MGRA 4BQQA 2OTLI 2L5QA 3KCCA 1LEBA 3K7AJ 2FBKA 3TGNA 1WGXA 1V54H 5CVJA 1TBXA 5CYVA 3V7CA 2IA1A 1FC3A 1WI9A 1SD7A 3L2RA 2PJRA 5CJ9A 3IP4B 2ZC2A 4ZTFA 1TQIA 1JKRC 2FA5A 1BI1A 3VPRA 3LFUA 1S29A 1WWXA 3CDHA 4HA8A 2QSGX 2X48A 2XF6A 1JXSA 5F0FA 5HS8A 1FX7A 4IJAA 2O61A 1MW7A 2R5ZB 4RMNA 4MIMA 2ID3A 4CCJA 3TDUC 5D6EA 5F1JA 4HF0A 3HHHA 5E8GA 1FTZA 1D1CA 5L3DA 1JGSA 2Z16A 2ZNYA 2ZMEA 1OYIA 2GXGA 2LY9A 2KDZA 3GFLA 1AOYA 4LK0F 1R36A 3HOWJ 4LITA 2XC7A 1B72B 1QA6A 3K70D 4C2TA 2DA3A 1S7EA 2Q2EA 1VQMI 3KP4A 1L0OC 1MJBA 5TJJA 1OCZH 2Y48A 3RDIA 1ZR2A 3DF8A 3K69A 3TQNA 3HOTA 1KU3A 3NWSA 1PDNC 1EH6A 2RC4A 3WTTC 1X2MA 3JRIA 3OYNA 3GZ6A 5M5YJ 2YUSA 2X1EA 4AIKA 3CJQB 2XGXA 4M72A 3JSPA 1LVKA 2WWYA 1YIOA 2OC6A 1AU7A 3OYBA 2MD0A 3IWZA 2ZMEC 3EYIA 3H0GJ 3PIOF 2A68F 3LFKA 3S3MA 3DPUA 1YLFA 5DUIA 2DO7A 3HPHA 3S1RJ 3V7SA 2RQQA 3BZCA 3GTLJ 2ECBA 3ROUA 2K9QA 3OIPA 3LSIA 3QOEA 1X1CA 2L9SA 3BJOA 1SD6A 3LSJA 1Y0NA 1KYWA 4M6VA 4Y3OA 2VBXA 2PEXA 1OKRA 4PSWA 1UHSA 5E8IA 3TMOA 4HF2A 4PGHA 3HJEA 3W2WA 1DGWY 2NS0A 1IV6A 5LRSA 3CMAI 1QGPA 1FYKA 2OQRA 1DP7P 5FFZA 5JLWA 2QF7A 4ABZA 2WADA 4A12A 4P96A 2CQXA 2K02A 2D1HA 5FLXK 3KYDB 3I56I 3S14J 4YELA 5LEJA 5BPIA 2RQPA 2IP2A 3OYAA 3H3VK 2QENA 6PAXA 2NOGA 4HQEA 3I5UA 5IY5H 2KIMA 1OQYA 2X4HA 2V7FA 3ZMDA 2V26A 3A01B 1R5ID 5GP9A 3I71A 1CQTA 1PUFA 5ICFA 2DMNA 1YIJI 3LSMA 1Z91A 3QOPA 2EWNA 2H8WA 4UUSA 2O3FA 2NVYJ 3TO6A 1Z3XA 4OIOF 3MCZA 1K78B 4YEJA 1ETVA 2GM4A 3ZMVA 4DBQA 2XUBA 3TW7A 1WRJA 5HDGA 2EB7A 3LSRA 1JJ6C 2VJ5A 4HF1A 3H5AA 3DTEA 3FXMA 1C0WA 2VC0A 3VSKA 1WJAA 2IGOA 3ZCOA 2HTJA 4WXDA 1J59A 4XLFA 2R7TA 3I3LA 2HVQA 1G3YA 1ZRDA 4EMSA 1V5FA 3IC7A 4KISA 3ZQHA 4Y4RA 3ABKH 3W6JB 5B5EC 1TW3A 2K9SA 2BW3B 4E7LA 2Y31A 1R4NB 3L09A 3WE2A 2XRLA 2KPMA 2KT0A 2KLOA 3H9GA 4D5FA 3DEWA 1XGSA 4GCVA 1VQPI 2JRTA 4FASD 1FIAA 1ETQA 1OISA 3VYSB 1FEXA 4EM2A 3LL7A 5K5OA 3DBRB 3RYRA 3KLNA 4LLLA 1WJEA 2PMZA 4RA2A 5H6RA 3K4MA 2OU2A 1PP7U 5E3NA 2PMUA 3HRSA 2CV1A 1MMNA 2F6CA 2KKOA 4WCGA 1WKMA 3E7LA 1QZZA 2STTA 5IYCJ 2B0LA 4RAYA 4XRMA 2I8DA 4PSXA 3A4CA 3A03A 1A35A 3WGHA 1VFCA 4XICA 1R1VA 5DYMA 3DKXA 4I0AA 2XF7A 1XC5A 1T0FC 2CFXA 3GW2A 4LD5A 1YJNI 1PVEA 3DU6A 3K4NA 2VPLA 3GCMA 4I01A 3G3ZA 2FOWA 2HPIA 1TWHJ 4BJ6C 5D8KB 2K9LA 3IKVA 2RNJA 4ENMA 3PM1A 3FXKA 4HSRA 4GYIA 4KYWA 2K27A 3LSHA 1OR7A 1Y0UA 1MMGA 1P6RA 4A3LJ 1ZK8A 2M8EA 2O0YA 1FSHA 4YIIA 3RPUA 5BS6A 2E35A 1D0YA 4ZJZA 3M4OJ 3MMYB 1XGNA 2R92J 1SFUA 3KP3A 1SMYF 3BTCA 2MLGA 1Z67A 4E7HA 3GTJJ 1A6IA 1FOXA 4HBLA 4C9YA 1FSEA 1YE9A 3ELKA 1IAWA 1ZTRA 4KT6A 4C2MJ 2W24A 2CO5A 4A3BJ 2DYSH 1U78A 3MQ0A 4W97A 1SC7A 3TL4X 3L2WA 2W4SA 1V5GA 2DBBA 4RS8A 1UHWA 1JT6A 2QUFA 3RIRA 3A2KA 2KZGA 2CW8A 4GFBA 1NG6A 1UG2A 5K5QA 2M45A 1OR7C 3E0JB 3RCOA 2EH3A 3K4LA 3J81Z 2R7WA 2Y30A 1VTNC 4LB5A 3OSGA 4A0ZA 3E6MA 3NQOA 1MJAA 4EEFG 2JPCA 1YX5A 5JLXA 4CCOA 4A3EJ 2CWEA 1P4XA 2M5WA 4UV8A 4XN0A 1B9MA 4ENKA 4PJ0C 1XN7A 4LFUA 1SAUA 5L3EA 2KRHA 2HKOA 1Z0XA 2QQBA 4XR6A 2O5RA 2Q8KA 4OIRF 1XG1A 3AG2H 1K61A 3OYCA 4L5IA 3KP6A 1H8AC 1RKWA 3HGYA 1U0JA 1OMIA 2JN6A 3R6SA 3DPTA 5B1AH 3KEQA 2K4JA 4EM1A 4ZC3A 3K6GA 1YW8A 3F6VA 4B1RA 1BW5A 1Z7LA 3QU6A 4RAZA 2G7UA 4BQAA 2NS8A 2FXAA 4AYBN 2R7QA 2NS7A 1W36D 2A6HF 5EZHA 3U21A 2IA2A 2IRFG 3DU5A 2NVQJ 1QVTA 1IXSB 2XRNA 4QIWN 4KFCA 3T8TA 1EKEA 2VBYA 1BN5A 3ZPLA 2GIZA 5L3CA 3B6AA 2IAIA 4XL9A 1A6QA 4MO7A 2CUEA 2NXNB 2VXDA 4EGYA 1D3YA 4RGUA 4KICA 5KAIC 1R7JA 5DM7F 3TW6A 1XSXA 3F8FA 1P4WA 1W1WE 3HPGA 2R7DA 3S1QJ 2ID6A 3QPHA 2FU4A 3CMMA 2F4IA 1H88C 3K2ZA 2E1MC 2IPQX 4UHTA 1POGA 3AG3H 4KIBA 3K10A 2L2OA 1LPQA 1L3LA 2RN7A 5GPAA 1HLVA 2V6EA 3ZMZA 3WTZA 3CC4I 4BACA 2FUG2 3GXOA 5HDNA 1RPWA 1K7AA 1QQIA 2CQ7A 2E7XA 2FNAA 4A3MJ 1H89C 2TCTA 4IKFA 4GDFA 1WHUA 2P7VB 2DK8A 1DP3A 1BOBA 1HC8A 3BCAA 5FKNA 3ZMTA 1S9HA 3FWEA 2QQ8A 3CCEI 4NC8A 2BY1A 2XF5A 4CYCB 3DLLF 3OWTA 4MNUA 3SFIA 3MN2A 5GPCA 1TNSA 4IHVA 3H9JA 4BAYA 4EV0A 3KX2A 5AONA 2E1CA 4II2A 4P9FA 3WHBA 5HNFA 2X1CA 1TQMA 1VF9A 2MABA 4NQWA 3LWFA 1G3WA 4PCQA 1S7OA 4A69C 4U0WA 4IVNA 1J9IA 1VQ4I 2XB0X 2AHQA 2M2EA 4GO1A 3HUGB 1APLC 3OOUA 4BBRJ 3E5UA 1VQ8I 3OYEA 1U8BA 3RZOJ 2CW0F 3WGGA 2EA4A 3CCRI 3CCYA 2VN2A 4G7ZF 1OFCX 2GXBA 3QP5A 2DOAA 3Q3SA 3WG7H 3RPQA 3G1OA 4PDKA 3Q0WA 3MKYB 1Z21A 4CCKA 2EZHA 2DJNA 3SZTA 3VWBA 3WODF 1LKXA 5J4YA 4UVBA 1J2XA 4BS9A 2Y2ZA 2OQGA 5BMZA 1XB4A 4MHGA 5FROA 2B9SA 2DTRA 1GXQA 5L3BA 1QHHD 2L54A 3M07A 4I98B 4F93B 2ME6A 5FLXZ 3WU1B 1BIAA 4UB6C 2CUZA 2MYSA 3KPHA 4UUVA 3HSFA 1RUNA 2RAEA 2FX0A 3FXRA 3KZZA 3HM5A 3H5RA 5FLMJ 2M4KA 4DYCA 2B63J 3W2VA 4WX9A 1LVAA 3GVAA 3Q9VA 3VODA 3GTPJ 5F1RA 4Y52J 1IRFA 5D5VB 1Z05A 4ZZLA 2P6TA 2JUGA 2AXTC 1R23A 4UVAA 2E1OA 2VL8A 4NC6A 2VBZA 1JKQC 1K6OA 3ABMH 2M7BA 3UR3C 4HEA2 1FBUA 5B1BH 1HW1A 2H09A 1NG7A 3OIOA 4LG0B 3KP2A 2VUMJ 2VT3A 2A5YB 2XVCA 2LSOA 1LFBA 2WV0A 4CH7A 2O8XA 1HDPA 2PBIA 3TP0A 5JR3A 4DOZA 4RGRA 2JA2A 3V4GA 2CW7A 3FBIB 4L5JA 1DPRA 5ICGA 2LH9A 2Y9YA 4IL6C 2Z9OA 2DFIA 3ZQIA 1X2NA 1IXRC 1I39A 2Y69H 2E2JJ 5E1XA 3HSRA 1EV7A 1LE8A 3FDYA 5C3EJ 2H6CA 5LLQA 1OYWA 2DMTA 1AWCA 3L2UA 1GHCA 5IYBJ 2O6GE 5GADJ 1B8IB 4L9NA 2W1OA 2E7WA 4L9TA 3G73A 1WJBA 1LFPA 2M4GA 3PNYA 2XASA 2DXIA 2A69F 5KAFC 1HA8A 2IXSA 4A3GJ 4EJWA 1D0ZA 2DQRA 2E1NA 3DBLB 4QLCU 1JJ8C 4M6YA 3BY6A 3CO6C 3DPLC 5TRDA 2HZTA 3G6EI 5F0HA 1FIPA 2CU7A 2EFNA 5IT9K 4LIUA 1ZG5A 3JTGA 4HV5A 5J4VA 1REPC 2KJCA 2K3FA 3HBLA 1JTYA 5HVQC 2YX7A 1X1BA 5IPAA 1R9TJ 1B9NA 2NNNA 2WAQN 4M3EA 3BT9A 2L9RA 1SAXA 5FKKA 1IV8A 3HL2A 4CZCA 3OR1C 2MBFA 4IRIA 4I2OA 1U5TB 2E5ZA 3RKQA 4BXFA 2PJRB 3P9CA 5HLHA 2IGKA 1YTYA 1FYMA 3CC7I 2JA7J 3RKXA 1BJAA 4YIRX 3S3NA 3OV8A 1GV5A 3HIFA 5EG0B 2QQ9A 1HKSA 1DPUA 2QGUA 2XSJC 3O2PE 3DV8A 1RKTA 1W7PB 2R7ZJ 2IBDA 2ZSIB 3O3KA 5DUKA 3OYFA 4Y7NJ 5J47A 2LVSA 4NUBA 2LY2A 2K5CA 4YFXF 2MSYA 4CCNA 1U6GA 3ASOH 2HZDA 5LBQA 1W5TA 5A2QZ 3K4BA 2QBYB 4E7IA 5CVIA 4ZYGA 2LLKA 1Y1VJ 1TL8A 1ORKA 3K1PA 3SEQA 4ZYHA 2BEOA 3E6DA 4PJJA 4HNUA 2CYYA 3KP5A 2EZKA 2NVTJ 4BE2A 3LAJA 3FX3A 3DFGA 4DJAA 3Q0UA 2AO9A 2FF4A 4KNYA 1BIBA 3JRDA 1O3TA 2R7OA 3OYGA 3M7GA 3FIWA 2JT1A 3CF5F 2DJIA 3KLOA 4IEJA 3JW4A 1YOVB 1ZGJA 2H8RA 3CJNA 2XDVA 2MGQA 3WTUC 2LKXA 4N4OB 2EV0A 5BQTA 1J7KA 4AD9A 3TP3A 1HOMA 4G7OF 2WY7Q 5DCMB 4ZDOA 1R58A 2WA0A 2K86A 2H1LA 3S8PA 1ACIA 2IW5A 2UXNA 4PK4A 4EJVA 5JVGF 3SZPA 4XKWA 4JP0A 5LGTA 3MZYA 3F6OA 4G94A 5KHDA 3HB9A 1MBHA 1O3QA 1G3TA 3O8GA 2DLLA 1ZELA 4P1WA 2DFHA 1T39A 2W85A 1JUMA 4KT5C 2HFHA 1IO2A 3A0BC 2LF8A 4V2FA 3F22A 4XRFA 2KHMA 3RQ4A 2PLYA 3Q9SA 1T2KA 4BQOA 1RESA 1T98A 2R7SA 5TGTA 4FT8A 2YU3A 4LMYA 2FSWA 2HDDA 4IHTA 1TNTA 2H94A 2UXXA 1VQOI 1QU3A 2F5CA 2ZXIA 4OAYA 2JVGA 3WTSC 3VDXA 4W1UA 3W6VA 3DP7A 1XDUA 3IWFA 1GVDA 1DDNA 2Y0MA 3L00A 3BQZA 1OCPA 4I6ZA 4IHYA 2FE3A 1AKHB 4HSTA 1UMQA 4MFEA 5F64A 2WBMA 4EGZA 4X0GA 2KIFA 4E7JA 1RI7A 5DTDA 3LQQA 4ZDLA 1Z6RA 2PMHA 3F8CA 3ZN1A 1JE8A 5LGNA 3C3WA 1JKPC 4JX6A 4CO8A 2R5ZA 5ERIA 2Z5UA 2LREA 3QPSA 3I53A 1MBKA 3HOZJ 4DZPA 2A6EF 4CGZA 5E20A 3ZMSA 1YJ9I 2L4AA 1F4KA 2Z33A 4PFOA 1RRJA 4NHJA 5HS7A 1FBSA 2L3DA 3LSGA 4O3MA 4KITB 1FOYA 5L3FA 2Q1ZB 2XGEA 2LG4A 1B59A 4P9UA 2W82A 1B72A 3FXUA 3S1MJ 2RREA 2MW8A 2M34A 3MEXA 4I7HA 1K6YA 5AIPA 3NAUA 3WHCA 4A3DJ 1SD4A 3CCUI 3S2DJ 1XMAA 5ICEA 1KGSA 3C18A 5AIQA 4DW6A 2LR8A 4BBSJ 3HXLA 1Z9CA 1I6HJ 5LFAA 2ME0A 4IQJA 2HVRA 3K1NA 2ICWG 2VJ4A 3N97A 1T08B 4BHCA 1ZR4A 1A36A 3A0HC 3IH3A 2J5PA 1E3OC 3FKIJ 2MD5A 3CUQA 3S3OA 3DWLE 1ZLJA 4HX4A 1XS9A 1EJ9A 4HRIA 3DEEA 4V19K 2CSOA 3OMYA 1QNTA 2W57A 2WAEA 4HYEA 3O8HA 2HVSA 5FB2A 5ICCA 2IS2A 4L5EA 4B44A 1KZHA 2EFOA 1JTXA 3C2GA 2ZJPF 1TWGJ 2W00A 1UFMA 4M9XA 3SQNA 2ECCA 3KZIC 4O5VA 2EIMH 4MEXF 2F5EA 2ELHA 2ESHA 1V55H 2FBHA 2CV0A 1R4MB 1IGNA 5DD8A 1OLTA 1MNMC 3GTMJ 4OWRB 4DBRA 4LJZF 3SFZA 1FTTA 4IRGA 3HOUJ 3I59B 3JAMK 4A5NA 2PN6A 3DQVC 3GZNB 4OINF 1PUEE 3RI4A 3CMEI 3BG9A 3CUQC 3ABUA 3C2HA 5D5XB 3ZR8X 3QPTA 5J8CA 1VQNI 1FJLA 2FQ3A 4BY1J 1K83J 3JRGA 2OF7A 1NK2P 3FMQA 2VQHA 1MMDA 3UNGC 3GFIA 2ZO4A 1OCRH 3RZDJ 4C30A 1F5TA 4OIPF 2DMQA 3PSIA 4FTHA 3ML6A 3JR9A 4OU0A 5LHHA 1QVUA 2LMDA 5M5WJ 2BOLA 4AVPA 3CTAA 3I58A 4WWCA 3R4KA 3P9KA 4RB2C 4XQFA 2HU9A 3CDLA 3G4SI 1YJWI 1ETXA 1RZ4A 2LTPA 1MDMB 3I4MJ 5KNLA 1K78A 1MMSA 5B3SH 1FMVA 2M87A 2KFDA 2O8KA 1HBXG 3RQIA 1I27A 2VKEA 2QVOA 1QZEA 4OAZA 4A0XA 1JKOC 4K2EA 1UCRA 1LB2A 2L9VA 3J80Z 2ZXHA 2XPWA 5KCMA 2BHZA 3LMMA 3OS2A 2R7RA 4NNJA 3QQAA 1B4AA 3F8NA 1D5YA 1KA8A 3ISPA 1MSEC 1YRNB 2DCEA 1N25A 4Z2YA 4B09A 4JQFA 4HDVA 3U2RA 1YS7A 4IPAA 2LKPA 3T0YA 2MLKA 1O7FA 1ONVA 2XB5A 2BW3A 1IC8A 5C4JJ 3M1EA 3P5JA 5J1RA 4E7ZA 4ESJA 1O4XA 3JSOA 3D5LA 5J6XA 3L2CA 4C2UA 4HOBA 1T38A 2BXZA 3HOXJ 2DT5A 4D7NA 3M9AA 2EIKH 3GMEA 4XKVA 3H3ZA 2E60A 4P5OA 3NWTA 3ECHA 2GBYA 1ETWA 4M3FA 1YYVA 4AIDA 1R1UA 2RVCA 4F91B 5F0CA 1IN6A 2GA1A 3BTLA 4C3HJ 3CD6I 2QKMB 4XKBA 2DDBA 1HSJA 5D6FA 1XGMA 5E1ZB 1G8XA 1KQ9A 2LFBA 3KYCB 1J0RA 3LOCA 1SD5A 1SFOJ 2DT7B 5HOOA 1T8IA 4XIDA 1W0TA 2A61A 3DLAA 3WTVC 1MGTA 2TRTA 2ZJ2A 1TP4A 2FBIA 2MG4A 4MTEA 1XCBA 4DQ2A 2JRMA 2DA5A 5FKLA 1MNEA 3IAM2 1P4AA 4MQ9F 2Y0SN 2VT2A 2X1DA 2VQCA 4M9SA 3WTXC 2F2EA 1CGPA 1GLNA 2H27A 2WC2A 1S72I 1W5CC 3GUDA 4FE7A 1Q1HA 4BH9A 2YU9J 4XOPA 2CRGA 2E5NA 4R1HA 4CXFA 1ZRCA 4I09A 1T6SA 2LBFB 2F4MB 5E3LA 4BJTA 1BR2A 3FKJA 1X58A 2EV6A 5CVVA 2NVUB 4CDGA 1P92A 4OIQF 2F48A 1VQ7I 5GTHC 1G6NA 3QYFA 4A0YA 3CCMI 3M8FA 4YFKF 4XRSA 1MBEA 3DTKA 2J5OA 2L7KA 2X6YA 1E3HA 2IS6A 4ANJA 2HNHA 4IOAF 3FK6A 2JSCA 4G6TB 5IOYA 4G12A 3RKWA 3ZRGA 3K4CA 3CJRB 1VQ9I 2GAUA 2KIUA 1WH7A 1BOAA 4DYQA 4EATA 5CVRA 4BU2A 2VQLA 1KONA 2IGNA 3FXJA 3I54A 1UG0A 4ZYAA 4YG2F 2BGCA 2CJJA 3BTJA 2C6YA 2VI6A 2N8GA 5LHGA 1WPKA 1XMXA 4UV9A 5FO5A 3ULQB 1VNDA 1V5EA 1F43A 1STZA 2CQQA 3BR2A 5F6FA 5DS9A 2LKSA 4EQQA 1I50J 4RGXA 4KMFA 5E18F 1QO0D 1R22A 4V2GA 2EZLA 3ONQA 2G0EA 4CCLA 1K4SA 3ZQGA 2L01A 1IJWC 2OA4A 3DTIA 2O9LA 1YW9A 4ZYEA 1JUSA 5FD5A 4AYBA 4BJ5C 1J75A 4B4CA 3I4PA 4IQ4A 4Q47A 4GGGA 2K3PA 1WJDA 2YSRA 2XV4S 3H36A 1IF1A 1VQ6I 3FZVA 3TKYA 1ETKA 3NEUA 1WVRA 2KRCA 2EA2A 2V79A 4E6KG 3TO9A 1I1GA 4WXCA 5F08A 1ZARA 3FISA 4XMYA 3FXLA 3TBIA 3M8JA 1NH3A 2DTZA 1SVOA 2UUZA 2ESNA 1LFUP 3GBGA 2BXYA 2Z99A 5EF6A 1YFHA 1IXCA 2HPMA 3R0JA 3M1CA 2PJPA 2ZKZA 3F23A 4A5MA 4LOCA 5DD4A 4BEHB 5D5WB 1CF7B 1FPQA 4CA0A 1N77A 2VB6A 3TDZC 4EJTA 5GAGJ 4A3CJ 4U7DA 1DUXC 5EJCA 2YPRA
chains in the Genus database with same CATH topology
2HYJA 5JLWA 1GV5A 2QF7A 4ABZA 5EG0B 2CQXA 1GUUA 2ELKA 3SJMA 1QPIA 1RKTA 3S14J 3A02A 2EQRA 2R7ZJ 2IBDA 3H3VK 1P7IA 2NOGA 4Y7NJ 4RBOA 2LVSA 2DMUA 3ZQFA 4JX5A 2JMWA 2MSYA 3L1PA 4A3KJ 3A01B 3JRHA 5GP9A 1CQTA 1PUFA 2DMNA 2M8GX 2L0KA 3GTOJ 2HOSA 4UUSA 1JUPA 2DA6A 2NVYJ 2LLKA 2E19A 1Y1VJ 1ORKA 2L7FP 5E3MA 2NVXJ 4AC0A 1ETVA 2GM4A 3CQZJ 3TW7A 4B3AA 1Q1VA 2EZKA 3LSRA 1JJ6C 2R5YB 2NVTJ 2L7ZA 3GTKJ 5BNGA 4XRSG 2O7OA 2AO9A 3Q0UA 3JRAA 3JRCA 1U9OA 4XK4A 3JRDA 1GT0C 1ITYA 1YRNA 3FIWA 4FISA 4IEJA 2H8RA 5M3MJ 2MGQA 2LKXA 2LK2A 3ZQHA 1U9NA 3TP3A 1HOMA 3HEFA 2K9SA 2R93J 2Y31A 2XRLA 2KT0A 4QTRA 4D5FA 3NARA 2GLOA 3HDDA 3BR0A 1ETYA 2JK3A 3DEWA 3BG5A 4BXXJ 4JP0A 1FIAA 1ETQA 1GDTA 5EGOA 4NDLA 1FEXA 3HB9A 1MBHA 2XPUA 3O8GA 1W0UA 1BL0A 1DU6A 2HXOA 2DMPA 1JUMA 5E3NA 4V2FA 3I4NJ 2DN0A 1TWCJ 3E7LA 5HODA 5C4XJ 1G2HA 2P81A 5IYCJ 4XRMA 5IP9J 1ENHA 5K7FA 2XPVA 1RESA 3A03A 1IG7A 1BA5A 3BQYA 5IYDJ 2HDDA 1VFCA 4XICA 3BG3A 3B6CA 2HOAA 1MH3A 1XC5A 3Q0VA 3ZQLA 5J1YA 4W1UA 3W6VA 3S16J 1GVDA 2DA7A 1P7JA 3F0CA 3BQZA 1OCPA 4I6ZA 4IHYA 1TWHJ 2WB1N 1AKHB 1UMQA 3PM1A 4MFEA 4X6AJ 2XGDA 1HDDC 3G1LA 5DTDA 2Y9ZA 1ZK8A 4A3LJ 1IDZA 4IHWA 3BR1A 1IUFA 3M4OJ 1JKPC 4JX6A 4MLOA 2R5ZA 2R92J 3BTCA 3QPSA 1BJZA 1MBKA 3HOZJ 4DZPA 3GTJJ 1A6IA 2W48A 1MBGA 1ZTRA 2M0CA 3CMYA 3S17J 4C2MJ 4A3BJ 2HXIA 4JX4A 3LSGA 1U78A 3PO2J 4W97A 3HKZN 4C3IJ 4I76A 3LNQA 2XGEA 1JT0A 1B72A 1LE8B 3S1MJ 1JT6A 2MW8A 2H1KA 2M34A 4GFBA 1UG2A 5EGOB 1B8IA 1RETA 3NAUA 3WHCA 1VI0A 4A3DJ 2FD5A 3S2DJ 3GTGJ 2D5VA 2WV1A 4DYRA 4JYKA 4DW6A 2EH3A 2LR8A 2K9NA 2Y30A 1HF0A 4BBSJ 3OSGA 2HQ5A 3M3YJ 1I6HJ 2ME0A 4EEFG 4A3EJ 5JLXA 1IRZA 4HNVA 2JA5J 1ZR4A 4C3JJ 3IH3A 1E3OC 3FKIJ 4UUTA 3BR6A 5IP7J 1XS9A 4DZJA 2COBA 1WCMJ 1Z0XA 1XG1A 1NK3P 4CYCA 2JA8J 1K61A 3IV5A 3O8HA 1H8AC 1MBJA 1IDYA 5F04A 1RKWA 3HGYA 3IH4A 4L5EA 1AHDP 2JN6A 1JTXA 1TWGJ 2ECCA 3BTIA 4MFDA 4B1RA 5M5XJ 1BW5A 5J1UA 5EYRA 1IGNA 1MNMC 5K7HA 2NS8A 2X6OA 3GTMJ 4AYBN 2NS7A 2HOTA 5EZHA 1FTTA 5EG0A 2XSDC 2NVQJ 3HOUJ 1QVTA 5EZGA 4QIWN 5F27A 5FLVA 3BG9A 5FKMA 2JJ7A 3B6AA 1GV2A 5EEAA 1FJLA 2IAIA 2JA6J 4BY1J 1K83J 4MO7A 3JRGA 2OF7A 2CUEA 1NK2P 3RZDJ 3TW6A 3D1NI 2DMQA 4FTHA 2LP0A 1NTCA 3JR9A 1QVUA 5M5WJ 1Y1WJ 5IOZA 3S1QJ 2ID6A 1EF4A 1PUFB 1MSFC 4M3DA 3OSFA 2OPTA 3CDLA 1H88C 1ETXA 1POGA 2LTPA 3I4MJ 4UUSB 4X1EA 2LD5A 1DU0A 4IHXA 5GPAA 2O8KA 1ETOA 1HLVA 1T33A 4FCYA 1MBFA 3RQIA 2R5YA 1RPWA 2VKEA 5FKOA 3HGGA 1JKOC 4A93J 2VPRA 4A3MJ 1RR7A 1H89C 2TCTA 2XPWA 2YS9A 2XGCA 3QQAA 1OJLA 3JRFA 1D5YA 4BY7J 1MSEC 4D5CA 5FKNA 1YRNB 3ZQCA 4A3JJ 1F36A 2X9DA 1ZKGA 4CYCB 4D7MA 4M3GA 2XB5A 4M3BA 3SFIA 3MN2A 5GPCA 5C4JJ 1IC8A 5J3LA 5M3FJ 4IHVA 3QPLA 5J1RA 1Z77A 3JREA 3BR5A 1O4XA 2FQ4A 3WHBA 3MKLA 1VF9A 3G1MA 2VKVA 3HOXJ 4D7NA 4A3IJ 2EZIA 3S2HJ 4A69C 3S15J 2QCOA 2XB0X 2AHQA 2GBYA 4M3FA 1ETWA 2M2EA 5FJ8J 5F0CA 1APLC 2CUFA 3OOUA 2K40A 2EBIA 3BTLA 4BBRJ 4QSHA 4C3HJ 3BR3A 1U8BA 3RZOJ 3HOYJ 3CCYA 1OFCX 1T56A 1WH5A 1QRYA 2LFBA 1A5JA 3Q3SA 3LOCA 1SFOJ 3G1OA 3K2AA 2E2IJ 3Q0WA 1MH4A 3GTQJ 2DA2A 2DJNA 2EZHA 1TC3C 4XIDA 2ZB9A 1W0TA 2I10A 2TRTA 2Y2ZA 5K7ZA 3JRBA 2MG4A 4S0HB 1TWAJ 2DA5A 5FKLA 4BKXA 2ME6A 2Y0SN 2M9HA 3PO3J 1HCRA 2FX0A 1I3QJ 2RAEA 1SANA 3SDGA 3HM5A 2L7MP 4AUXA 5FLMJ 4DYCA 4FE7A 2B63J 2YU9J 2CRGA 4RDUA 3TEDA 3GTPJ 4Y52J 5E3LA 2JWTA 1X58A 1AKHA 2E2HJ 2IEKA 3HOVJ 3LSPA 3UKGA 2E1OA 3K7AJ 1WGXA 4XRSA 1JKQC 1MBEA 2PMZN 4A3FJ 1ZQ3P 1JKRC 3FK6A 3OIOA 3VPRA 5IOYA 2VUMJ 4G12A 2X48A 1WH7A 1LFBA 5F0FA 4DYQA 2R5ZB 4MIMA 3TP0A 1HDPA 2ID3A 3MVPA 5F1JA 2CJJA 3BTJA 9ANTA 1FTZA 1ZGWA 2VI6A 2Y9YA 4FE4A 3ZQIA 5EDNA 2N8GA 1X2NA 1WPKA 2E2JJ 1VNDA 2LY9A 2KDZA 1F43A 3A01A 2CQQA 1WI3A 1LE8A 3BR2A 5C3EJ 5DS9A 3HOWJ 3S1NJ 3C2BA 1I50J 1B72B 2DA3A 2DMTA 1S7EA 3ZOBA 5IYBJ 4V2GA 1B8IB 2EZLA 2G0EA 1ZR2A 3FK7A 3ZQGA 1IJWC 2O9LA 1JUSA 3DCFA 4B4CA 1X2MA 3JRIA 4A3GJ 5M5YJ 3IH2A 2YUSA 5IP6A 1JJ8C 5E3OA 2FJ1A 1ETKA 1TWFJ 2DA1A 1AU7A 5F0HA 1FIPA 2CU7A 1BW6A 5F08A 3H0GJ 3FISA 1OCTC 2R0QC 1JGGA 3S1RJ 4J19A 3GTLJ 2ECBA 1JTYA 3HBLA 2DTZA 2K9QA 5IPAA 1R9TJ 1LFUP 3GBGA 2WAQN 4M3EA 5EF6A 3BT9A 2L9RA 3LSJA 5FKKA 4M6VA 4LOCA 1UHSA 3RKQA 2HI3A 1IV6A 4A3CJ 2JA7J 2DA4A 5C44J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYJ A;  5JLW A;  1GV5 A;  2QF7 A;  4ABZ A;  5EG0 B;  2CQX A;  1GUU A;  2ELK A;  3SJM A;  1QPI A;  1RKT A;  3S14 J;  3A02 A;  2EQR A;  2R7Z J;  2IBD A;  3H3V K;  1P7I A;  2NOG A;  4Y7N J;  4RBO A;  2LVS A;  2DMU A;  3ZQF A;  4JX5 A;  2JMW A;  2MSY A;  3L1P A;  4A3K J;  3A01 B;  3JRH A;  5GP9 A;  1CQT A;  1PUF A;  2DMN A;  2M8G X;  2L0K A;  3GTO J;  2HOS A;  4UUS A;  1JUP A;  2DA6 A;  2NVY J;  2LLK A;  2E19 A;  1Y1V J;  1ORK A;  2L7F P;  5E3M A;  2NVX J;  4AC0 A;  1ETV A;  2GM4 A;  3CQZ J;  3TW7 A;  4B3A A;  1Q1V A;  2EZK A;  3LSR A;  1JJ6 C;  2R5Y B;  2NVT J;  2L7Z A;  3GTK J;  5BNG A;  4XRS G;  2O7O A;  2AO9 A;  3Q0U A;  3JRA A;  3JRC A;  1U9O A;  4XK4 A;  3JRD A;  1GT0 C;  1ITY A;  1YRN A;  3FIW A;  4FIS A;  4IEJ A;  2H8R A;  5M3M J;  2MGQ A;  2LKX A;  2LK2 A;  3ZQH A;  1U9N A;  3TP3 A;  1HOM A;  3HEF A;  2K9S A;  2R93 J;  2Y31 A;  2XRL A;  2KT0 A;  4QTR A;  4D5F A;  3NAR A;  2GLO A;  3HDD A;  3BR0 A;  1ETY A;  2JK3 A;  3DEW A;  3BG5 A;  4BXX J;  4JP0 A;  1FIA A;  1ETQ A;  1GDT A;  5EGO A;  4NDL A;  1FEX A;  3HB9 A;  1MBH A;  2XPU A;  3O8G A;  1W0U A;  1BL0 A;  1DU6 A;  2HXO A;  2DMP A;  1JUM A;  5E3N A;  4V2F A;  3I4N J;  2DN0 A;  1TWC J;  3E7L A;  5HOD A;  5C4X J;  1G2H A;  2P81 A;  5IYC J;  4XRM A;  5IP9 J;  1ENH A;  5K7F A;  2XPV A;  1RES A;  3A03 A;  1IG7 A;  1BA5 A;  3BQY A;  5IYD J;  2HDD A;  1VFC A;  4XIC A;  3BG3 A;  3B6C A;  2HOA A;  1MH3 A;  1XC5 A;  3Q0V A;  3ZQL A;  5J1Y A;  4W1U A;  3W6V A;  3S16 J;  1GVD A;  2DA7 A;  1P7J A;  3F0C A;  3BQZ A;  1OCP A;  4I6Z A;  4IHY A;  1TWH J;  2WB1 N;  1AKH B;  1UMQ A;  3PM1 A;  4MFE A;  4X6A J;  2XGD A;  1HDD C;  3G1L A;  5DTD A;  2Y9Z A;  1ZK8 A;  4A3L J;  1IDZ A;  4IHW A;  3BR1 A;  1IUF A;  3M4O J;  1JKP C;  4JX6 A;  4MLO A;  2R5Z A;  2R92 J;  3BTC A;  3QPS A;  1BJZ A;  1MBK A;  3HOZ J;  4DZP A;  3GTJ J;  1A6I A;  2W48 A;  1MBG A;  1ZTR A;  2M0C A;  3CMY A;  3S17 J;  4C2M J;  4A3B J;  2HXI A;  4JX4 A;  3LSG A;  1U78 A;  3PO2 J;  4W97 A;  3HKZ N;  4C3I J;  4I76 A;  3LNQ A;  2XGE A;  1JT0 A;  1B72 A;  1LE8 B;  3S1M J;  1JT6 A;  2MW8 A;  2H1K A;  2M34 A;  4GFB A;  1UG2 A;  5EGO B;  1B8I A;  1RET A;  3NAU A;  3WHC A;  1VI0 A;  4A3D J;  2FD5 A;  3S2D J;  3GTG J;  2D5V A;  2WV1 A;  4DYR A;  4JYK A;  4DW6 A;  2EH3 A;  2LR8 A;  2K9N A;  2Y30 A;  1HF0 A;  4BBS J;  3OSG A;  2HQ5 A;  3M3Y J;  1I6H J;  2ME0 A;  4EEF G;  4A3E J;  5JLX A;  1IRZ A;  4HNV A;  2JA5 J;  1ZR4 A;  4C3J J;  3IH3 A;  1E3O C;  3FKI J;  4UUT A;  3BR6 A;  5IP7 J;  1XS9 A;  4DZJ A;  2COB A;  1WCM J;  1Z0X A;  1XG1 A;  1NK3 P;  4CYC A;  2JA8 J;  1K61 A;  3IV5 A;  3O8H A;  1H8A C;  1MBJ A;  1IDY A;  5F04 A;  1RKW A;  3HGY A;  3IH4 A;  4L5E A;  1AHD P;  2JN6 A;  1JTX A;  1TWG J;  2ECC A;  3BTI A;  4MFD A;  4B1R A;  5M5X J;  1BW5 A;  5J1U A;  5EYR A;  1IGN A;  1MNM C;  5K7H A;  2NS8 A;  2X6O A;  3GTM J;  4AYB N;  2NS7 A;  2HOT A;  5EZH A;  1FTT A;  5EG0 A;  2XSD C;  2NVQ J;  3HOU J;  1QVT A;  5EZG A;  4QIW N;  5F27 A;  5FLV A;  3BG9 A;  5FKM A;  2JJ7 A;  3B6A A;  1GV2 A;  5EEA A;  1FJL A;  2IAI A;  2JA6 J;  4BY1 J;  1K83 J;  4MO7 A;  3JRG A;  2OF7 A;  2CUE A;  1NK2 P;  3RZD J;  3TW6 A;  3D1N I;  2DMQ A;  4FTH A;  2LP0 A;  1NTC A;  3JR9 A;  1QVU A;  5M5W J;  1Y1W J;  5IOZ A;  3S1Q J;  2ID6 A;  1EF4 A;  1PUF B;  1MSF C;  4M3D A;  3OSF A;  2OPT A;  3CDL A;  1H88 C;  1ETX A;  1POG A;  2LTP A;  3I4M J;  4UUS B;  4X1E A;  2LD5 A;  1DU0 A;  4IHX A;  5GPA A;  2O8K A;  1ETO A;  1HLV A;  1T33 A;  4FCY A;  1MBF A;  3RQI A;  2R5Y A;  1RPW A;  2VKE A;  5FKO A;  3HGG A;  1JKO C;  4A93 J;  2VPR A;  4A3M J;  1RR7 A;  1H89 C;  2TCT A;  2XPW A;  2YS9 A;  2XGC A;  3QQA A;  1OJL A;  3JRF A;  1D5Y A;  4BY7 J;  1MSE C;  4D5C A;  5FKN A;  1YRN B;  3ZQC A;  4A3J J;  1F36 A;  2X9D A;  1ZKG A;  4CYC B;  4D7M A;  4M3G A;  2XB5 A;  4M3B A;  3SFI A;  3MN2 A;  5GPC A;  5C4J J;  1IC8 A;  5J3L A;  5M3F J;  4IHV A;  3QPL A;  5J1R A;  1Z77 A;  3JRE A;  3BR5 A;  1O4X A;  2FQ4 A;  3WHB A;  3MKL A;  1VF9 A;  3G1M A;  2VKV A;  3HOX J;  4D7N A;  4A3I J;  2EZI A;  3S2H J;  4A69 C;  3S15 J;  2QCO A;  2XB0 X;  2AHQ A;  2GBY A;  4M3F A;  1ETW A;  2M2E A;  5FJ8 J;  5F0C A;  1APL C;  2CUF A;  3OOU A;  2K40 A;  2EBI A;  3BTL A;  4BBR J;  4QSH A;  4C3H J;  3BR3 A;  1U8B A;  3RZO J;  3HOY J;  3CCY A;  1OFC X;  1T56 A;  1WH5 A;  1QRY A;  2LFB A;  1A5J A;  3Q3S A;  3LOC A;  1SFO J;  3G1O A;  3K2A A;  2E2I J;  3Q0W A;  1MH4 A;  3GTQ J;  2DA2 A;  2DJN A;  2EZH A;  1TC3 C;  4XID A;  2ZB9 A;  1W0T A;  2I10 A;  2TRT A;  2Y2Z A;  5K7Z A;  3JRB A;  2MG4 A;  4S0H B;  1TWA J;  2DA5 A;  5FKL A;  4BKX A;  2ME6 A;  2Y0S N;  2M9H A;  3PO3 J;  1HCR A;  2FX0 A;  1I3Q J;  2RAE A;  1SAN A;  3SDG A;  3HM5 A;  2L7M P;  4AUX A;  5FLM J;  4DYC A;  4FE7 A;  2B63 J;  2YU9 J;  2CRG A;  4RDU A;  3TED A;  3GTP J;  4Y52 J;  5E3L A;  2JWT A;  1X58 A;  1AKH A;  2E2H J;  2IEK A;  3HOV J;  3LSP A;  3UKG A;  2E1O A;  3K7A J;  1WGX A;  4XRS A;  1JKQ C;  1MBE A;  2PMZ N;  4A3F J;  1ZQ3 P;  1JKR C;  3FK6 A;  3OIO A;  3VPR A;  5IOY A;  2VUM J;  4G12 A;  2X48 A;  1WH7 A;  1LFB A;  5F0F A;  4DYQ A;  2R5Z B;  4MIM A;  3TP0 A;  1HDP A;  2ID3 A;  3MVP A;  5F1J A;  2CJJ A;  3BTJ A;  9ANT A;  1FTZ A;  1ZGW A;  2VI6 A;  2Y9Y A;  4FE4 A;  3ZQI A;  5EDN A;  2N8G A;  1X2N A;  1WPK A;  2E2J J;  1VND A;  2LY9 A;  2KDZ A;  1F43 A;  3A01 A;  2CQQ A;  1WI3 A;  1LE8 A;  3BR2 A;  5C3E J;  5DS9 A;  3HOW J;  3S1N J;  3C2B A;  1I50 J;  1B72 B;  2DA3 A;  2DMT A;  1S7E A;  3ZOB A;  5IYB J;  4V2G A;  1B8I B;  2EZL A;  2G0E A;  1ZR2 A;  3FK7 A;  3ZQG A;  1IJW C;  2O9L A;  1JUS A;  3DCF A;  4B4C A;  1X2M A;  3JRI A;  4A3G J;  5M5Y J;  3IH2 A;  2YUS A;  5IP6 A;  1JJ8 C;  5E3O A;  2FJ1 A;  1ETK A;  1TWF J;  2DA1 A;  1AU7 A;  5F0H A;  1FIP A;  2CU7 A;  1BW6 A;  5F08 A;  3H0G J;  3FIS A;  1OCT C;  2R0Q C;  1JGG A;  3S1R J;  4J19 A;  3GTL J;  2ECB A;  1JTY A;  3HBL A;  2DTZ A;  2K9Q A;  5IPA A;  1R9T J;  1LFU P;  3GBG A;  2WAQ N;  4M3E A;  5EF6 A;  3BT9 A;  2L9R A;  3LSJ A;  5FKK A;  4M6V A;  4LOC A;  1UHS A;  3RKQ A;  2HI3 A;  1IV6 A;  4A3C J;  2JA7 J;  2DA4 A;  5C44 J; 
#chains in the Genus database with same CATH topology
 1UST A;  2ACJ A;  2OZU A;  2HYJ A;  3IUO A;  3BOQ A;  1D8K A;  2RNG A;  1ZG3 A;  4EJU A;  1IRG A;  3F9K A;  1GUU A;  4IXA A;  2ELK A;  2KJB A;  4NBQ A;  1F9N A;  1SVM A;  1P7I A;  2K9M A;  3LST A;  2KQR A;  3LSK A;  4RBO A;  2DMU A;  1VQL I;  3ZQF A;  4JX5 A;  2JMW A;  3L1P A;  4A3K J;  1KYZ A;  1TZL A;  4I99 C;  1YS6 A;  1LEA A;  2RV8 A;  3KET A;  2NOJ B;  5E1W A;  3KIO A;  3OR2 C;  4Z6Y A;  1A31 A;  3OY9 A;  1W5S A;  2LC2 A;  3HRT A;  1JUP A;  2QM3 A;  2XHK A;  2E19 A;  1ZN2 A;  3RYP A;  2L7F P;  2HR3 A;  1SVL A;  2OD5 A;  4AC0 A;  1LNW A;  3RSN A;  3QOD A;  5CQE A;  5JHF A;  2EIJ H;  1ZG1 A;  1FNN A;  5J8F A;  3BJ6 A;  4WK8 F;  2GXA A;  2HTS A;  2R5Y B;  1ZH5 A;  2MFZ A;  2L7Z A;  5DM6 F;  1QHG A;  4XRS G;  3VOE A;  2V6C A;  2O7O A;  1IN8 A;  3V8J A;  4B47 A;  1GT0 C;  1PP8 F;  4HPQ A;  3FMR A;  5CPR B;  2LYC A;  2OCE A;  3OYH A;  5E79 C;  3FF5 A;  5FFX A;  4ZH4 F;  4FIS A;  4BHB A;  1YG2 A;  3H9Q A;  1J5Y A;  4UY8 I;  2STW A;  2HYG D;  3P9I A;  1U9N A;  1F1Z A;  1ZLK A;  1USS A;  2ZNZ A;  2R93 J;  2HEO A;  1XSD A;  3T8R A;  1FBQ A;  1XDS A;  4M9Z A;  2MH2 A;  3BP8 A;  3NAR A;  3HDD A;  1BR4 A;  3BR0 A;  1ETY A;  2NAZ A;  4GYG A;  2JK3 A;  3O6B B;  4LK1 F;  3BG5 A;  2MA3 A;  4FHT A;  3U1K A;  3HUG A;  3SDB A;  4BXX J;  1GDT A;  4J00 A;  5EGO A;  3JCU C;  3TOB A;  1ERD A;  3K1M A;  3I0T A;  2KMU A;  2XPU A;  2IA0 A;  2YX4 A;  3BWG A;  3QRF F;  1W0U A;  3GEZ A;  1DU6 A;  2DMP A;  3N4M A;  2Z1D A;  3CJT B;  2R7U A;  2GA2 A;  2KRF A;  2V9P A;  3GX4 X;  1SFX A;  4CIC A;  3VYR B;  3B73 A;  2DN0 A;  3OS0 A;  5C4X J;  3K4J A;  3MD2 A;  4XON A;  2P81 A;  1U3E M;  5ILV A;  1ENH A;  1O7L A;  3DEU A;  2QWW A;  2XIG A;  1KQ8 A;  1BR1 A;  1WQ2 A;  1IG7 A;  2PG4 A;  2FNP A;  1BA5 A;  3BQY A;  5IYD J;  1FP2 A;  3BG3 A;  3V7R A;  3B6C A;  4M73 A;  2HOA A;  2HGC A;  3ZQL A;  4LLG F;  2D2W A;  2XAJ A;  5J1Y A;  1ZRE A;  2RKH A;  3TOA A;  2VE9 A;  1Z3Y A;  2BZT A;  2DA7 A;  1P7J A;  3F0C A;  1LUJ B;  2ETH A;  4G6Q A;  4J01 A;  2WB1 N;  4GRI A;  1DQU A;  4DGW B;  1LDJ A;  3GWZ A;  3G1L A;  1N75 A;  2XRO A;  3F3X A;  4ENJ A;  3CCL I;  4QPO A;  2DDA A;  4LG0 A;  4P55 A;  2ELJ A;  2R7F A;  4HW0 A;  3BR1 A;  5CVU A;  2VLA A;  1IUF A;  3OYJ A;  1HW2 A;  5FRM A;  2DOE A;  3J7A O;  2DT6 A;  3LA3 A;  4ZDP A;  2P5K A;  1S7A A;  1BJZ A;  3H1C A;  3QU3 A;  2OTJ I;  1ZAO A;  2CS3 A;  2HYF A;  4S05 A;  1MBG A;  1WJ5 A;  2M0C A;  3CMY A;  1EH8 A;  1A04 A;  2GZW A;  3S17 J;  5HLG A;  3PO2 J;  3Q5F A;  3HKZ N;  4C3I J;  3J81 K;  1YHQ I;  4I76 A;  2ZME B;  3BG7 A;  4Q5S F;  2CV2 A;  1JT0 A;  1ZHF A;  2WAQ A;  2BVM A;  1X3U A;  2DI3 A;  2LF7 A;  3OL3 A;  1B8I A;  1RET A;  1G59 A;  2DW4 A;  2Q2E B;  3ZXS A;  1VI0 A;  3L9F A;  4FX0 A;  1PJR A;  5DV5 A;  2DPD A;  2FEZ A;  3KP7 A;  4ZZD A;  3G71 I;  2WV1 A;  1QBJ A;  1TQP A;  2ZXW H;  2M30 A;  4KN7 X;  1IN5 A;  4RLQ A;  4N9I A;  3PQK A;  2EIN H;  1P9Q C;  1IRZ A;  3PIP F;  4HNV A;  3HC7 A;  3SXY A;  4M74 A;  3KEY A;  3AFH A;  4U88 A;  3ERM A;  3CCJ I;  3CUO A;  4KJZ A;  4UUT A;  5HLT A;  2LNB A;  2PFB A;  4G8X A;  3BR6 A;  4DZJ A;  5FRN A;  2COB A;  1WCM J;  1X4O A;  3W6K B;  3PFY A;  4XOR A;  2BY0 A;  1NK3 P;  5HLI A;  4KIG A;  3IV5 A;  3KFW X;  4ITV A;  2P0W A;  5F04 A;  3IH4 A;  4M6X A;  3IL2 A;  2BE5 F;  2CQK A;  2HWV A;  2ZFW A;  3LAP A;  5K5R A;  3BTI A;  4MFD A;  4ZTJ A;  4N0B A;  3OYM A;  3H3U A;  3MZ8 A;  1WFX A;  4PGG A;  1U5T A;  2FOK A;  2ISZ A;  2KP6 A;  1UHM A;  5EYR A;  2XKO A;  2X6O A;  5EG0 A;  2XSD C;  1OCC H;  2VKH A;  2NRA C;  4HX7 A;  4WF2 A;  4BYY A;  3HZJ A;  2KIQ A;  4BNC A;  5FLV A;  1W7P A;  4KUM A;  5FKM A;  4Y33 A;  4ESF A;  2BVL A;  3B02 A;  2G7H A;  1ON2 A;  3QP6 A;  2HQN A;  4H0E A;  3P7N A;  1X4P A;  1HW5 A;  3OYL A;  3D1N I;  1YIT I;  1NTC A;  3BZK A;  3L7W A;  2DAO A;  4BXU A;  2R7V A;  2B7E A;  4WXH A;  3BPX A;  2QBY A;  1PUF B;  3C7J A;  3REO A;  3IKT A;  1U5T C;  3BCB A;  3E97 A;  2BYV E;  3EUK L;  4DNC A;  4UUS B;  2HOE A;  3M8E A;  4KMU X;  4BQN A;  4U0V A;  1ETO A;  1D1B A;  2OUM A;  5HDK A;  1MIJ A;  4R79 A;  4HLX A;  5FKO A;  1KU7 A;  5CLS A;  5BPD A;  4XM3 A;  4A93 J;  1RR7 A;  3EUH A;  1JI8 A;  2R3S A;  3JTH A;  1YW7 A;  3AL0 C;  2XGC A;  3PSF A;  1FZP B;  1OCO H;  2OCC H;  3CUQ B;  1V3F A;  1FOK A;  3SHF A;  3ZQQ A;  2CQN A;  3VSL A;  4Q4Z F;  4IOC F;  1F36 A;  2X9D A;  1ZKG A;  2FMY A;  4UNO A;  4D7M A;  2A07 F;  2F5F A;  5EEH A;  2X51 A;  1ODD A;  4M3B A;  5DCM A;  5J3L A;  4L18 B;  2VOD A;  3QPL A;  1GXP A;  1U2W A;  1Z77 A;  2W84 A;  4RAG A;  3LA2 A;  3MKL A;  1K4T A;  1I6X A;  4D0P A;  3G1M A;  1XMK A;  4A3I J;  3RTR A;  3VFZ A;  1RIO H;  2EZI A;  4RAF A;  2PI0 A;  4JOM A;  2VON A;  3S15 J;  2QCO A;  3GZ5 A;  3W3C A;  4XLP F;  1JHH A;  1ZGA A;  5FJ8 J;  4E70 A;  2CUF A;  4AM3 A;  2KZV A;  2K40 A;  2PQ8 A;  2EBI A;  2A6T A;  3OL4 A;  3FMS A;  3BR3 A;  3HOY J;  2IS1 A;  3WU0 A;  2W7N A;  3EUH C;  2NNY A;  2MH9 A;  1T56 A;  1WH5 A;  2EJR A;  3ZN0 A;  2QQA A;  1QRY A;  3HG9 A;  4YFN F;  2W25 A;  3WTY C;  2KDO A;  1MH4 A;  4E4H A;  4ON0 A;  1MKM A;  1UJ8 A;  2DA2 A;  4QWQ A;  1TC3 C;  1TW2 A;  2ZB9 A;  2I10 A;  3NRV A;  1SEU A;  1KU2 A;  3GLX A;  5K7Z A;  2P5L C;  4L0Y B;  2XAF A;  2VKD A;  4S0H B;  4YRV A;  1TWA J;  5GAE J;  2K85 A;  3ECO A;  3J7Z I;  4OOI A;  1R6R A;  1W4M A;  5JFR A;  4LB6 B;  2V1D A;  3PL8 A;  1HCR A;  1BI0 A;  1I5Z A;  2QSH X;  3GFJ A;  3K70 C;  1IRX A;  2JUC A;  2G9W A;  1SAN A;  3F8M A;  2JPB A;  2L7M P;  4RM3 A;  3SDG A;  1ULY A;  2Z2S B;  4AUX A;  2M7A A;  3EDP A;  3TED A;  1TTY A;  2JWT A;  1D5V A;  5D5U B;  4Y15 A;  1Z7U A;  1YX3 A;  1AKH A;  2E2H J;  2IEK A;  3F72 A;  1BI3 A;  2Z3Y A;  4EJO A;  3UKG A;  3E6B A;  3HTS B;  3EET A;  1QPM A;  3R61 A;  5LRR A;  2PMZ N;  4U87 A;  3I9V 2;  2EIL H;  5HNH A;  1D1A A;  4A3F J;  1ZQ3 P;  4L0Z B;  1VQK I;  2L02 A;  3ABT A;  4RB3 C;  1R49 A;  1T95 A;  2E34 A;  3OYK A;  3RPU D;  2IGM A;  4BDZ A;  3L2Q A;  3MVP A;  9ANT A;  3KZY A;  4A6D A;  1ZGW A;  1IUY A;  3IRQ A;  4FE4 A;  5EDN A;  4AIJ A;  1T0F A;  3IRR A;  2R4G A;  3ZMU A;  3A01 A;  1WI3 A;  2P4W A;  4HG2 A;  4XKC A;  5ED4 A;  4PJM A;  3DXJ F;  3S1N J;  3EUA A;  3C2B A;  4D9J A;  4AWX B;  3ZOB A;  3HHG A;  4L9V A;  4ENN A;  3T5X A;  1XX5 A;  3E5X A;  3FK7 A;  1Z6T A;  5D4S A;  2EK5 A;  4PZJ A;  4JBA A;  2R7X A;  3N05 A;  3U1D A;  3ABL H;  3DCF A;  3HRU A;  3A1Y A;  2HKX A;  2H6B A;  3IH2 A;  4HNT A;  4YIF A;  2UV1 A;  1FYL A;  5EEG A;  2P7C B;  2CH0 A;  5IP6 A;  3CLQ A;  4F52 A;  4LLN A;  2BHY A;  5E3O A;  3LA7 A;  2FJ1 A;  1TWF J;  2RGV A;  2V4J C;  2VC1 A;  2LDU A;  2DA1 A;  4II3 A;  3CC2 I;  1BW6 A;  2JTV A;  4CSW A;  1MMA A;  5ILU A;  1OCT C;  2UZK A;  2R0Q C;  2GOX B;  2ZJQ F;  2M3A A;  1JGG A;  1TT5 B;  4J19 A;  3DBH B;  1LDK B;  1EH7 A;  4KIF A;  3D0S A;  4F92 B;  1WZ2 A;  2JQ7 A;  2K7L A;  3OS1 A;  3AKZ A;  5IT9 Z;  3SYT A;  2DYR H;  1G3S A;  3HYI A;  3OIQ A;  4A6E A;  2E1M B;  3CP8 A;  1Z1D A;  4LGW A;  4CZZ A;  2HI3 A;  4B8X A;  1IN4 A;  2HDC A;  2DA4 A;  2NYX A;  5C44 J;  4F3Q A;  2UWM A;  1Y6I A;  3CLO A;  1RC9 A;  2VJI A;  3I59 A;  4B3X A;  4XNF A;  2M0M A;  2ZSH B;  3SJM A;  3MAJ A;  1QPI A;  2WY8 Q;  3MWM A;  5CQG A;  5A2Q K;  3A02 A;  2EQR A;  2DU9 A;  2ZXJ A;  4U0Y A;  3G2B A;  1YI2 I;  3SZG A;  1X1A A;  1BC8 C;  1YQA A;  2VQG A;  2ZCW A;  3FHN A;  3H5N A;  4ETS A;  2OZ6 A;  3JRH A;  1I1S A;  1LDD A;  4XN3 A;  4KDP A;  2M8G X;  2LRD A;  2HDW A;  2L0K A;  3U9G A;  3GTO J;  4BUP A;  1S8N A;  2HOS A;  1MDM A;  2GOM A;  4S04 A;  2A5W A;  2DA6 A;  5DDG A;  4PFP A;  4N4N B;  4RB0 A;  1KU9 A;  1V4R A;  1DGR M;  5E3M A;  1R1T A;  2VBW A;  2NVX J;  4MEY F;  4A2U A;  2DFF A;  2L4M A;  3CQZ J;  4B3A A;  1Q1V A;  2LOO A;  2HQR A;  1MZB A;  3PNV A;  2DOD A;  2JSP A;  3GTK J;  5BNG A;  3QYB A;  1HXD A;  5LD2 C;  3V42 A;  1FWZ A;  3JRA A;  3JRC A;  2QEX I;  1U9O A;  4XK4 A;  2E71 A;  1ITY A;  3FBN B;  4BHP A;  5JHU A;  3CF2 A;  1YRN A;  3HSE A;  1MD0 A;  2HQA A;  4XLA A;  1O3R A;  5M3M J;  2Y0S A;  2LK2 A;  1J09 A;  3KE2 A;  5LGU A;  5GAH J;  1X3Z B;  1NHA A;  2M1B A;  1EA3 A;  1UEL B;  3HEF A;  4Y17 A;  4G9Y A;  4ESB A;  2VJJ A;  5JI6 A;  3GFM A;  2JVH A;  3J7A Y;  2X85 A;  2ZBK A;  4QTR A;  4AVZ A;  2QLZ A;  4PJL A;  2GLO A;  3ZQ7 A;  3BRO A;  4FET A;  4NC7 A;  3E1S A;  4NQW B;  4XLN F;  2ISY A;  1O57 A;  2ZJR F;  1PYV A;  2VE8 A;  3ZP5 A;  4XSZ F;  4Y13 A;  2GWR A;  1VZ0 A;  4NDL A;  4XBF A;  1XGO A;  3GYH X;  4G7H F;  5JVT A;  1GVJ A;  1BL0 A;  2HXO A;  1XCV A;  3I55 I;  4M71 A;  1D0X A;  1XSV A;  1Y8Q B;  3ASN H;  1JHF A;  3CP2 A;  3GLL A;  3CCV I;  3FXO A;  5LEK A;  2V1N A;  3I4N J;  4IZZ A;  1TWC J;  2WAF A;  5HOD A;  2YR2 A;  4BDY A;  1G2H A;  4RLF A;  2X6W A;  4UVC A;  3SEZ A;  1FY7 A;  3F21 A;  2AS5 F;  3BC8 A;  2V9K A;  5IP9 J;  1SFK A;  1XTA A;  5K7F A;  2XPV A;  2K4B A;  2FRH A;  3W2A A;  3MZH A;  4EM0 B;  2IT0 A;  1IN7 A;  1Y56 A;  2FML A;  2OJE D;  4HV6 A;  3VYT B;  4MTD A;  1MH3 A;  3Q0V A;  1S3J A;  4O6J A;  4PUS A;  4IF4 A;  2DFE A;  3RKY A;  2LBF A;  3S16 J;  1FLI A;  2AXL A;  1X1P A;  3BPV A;  2QA4 I;  1WSU A;  1VQ5 I;  5KVR A;  3DKW A;  1ZRF A;  1Y39 A;  3KYL A;  2OBP A;  3R0A A;  5BOX A;  3HOS A;  1R71 A;  4U7B A;  4X6A J;  2XGD A;  2QKL B;  3L2V A;  3E6C C;  1HDD C;  4BE1 A;  2X0L A;  2Y9Z A;  1H9G A;  2EV5 A;  2XAH A;  3CCQ I;  4PJN A;  1IDZ A;  4XLE A;  3H35 A;  4L9J A;  4NB5 A;  3ZGK A;  5K1Y A;  1FOW A;  3I64 A;  4IHW A;  3AAF A;  4Q48 A;  2QZ8 A;  1X1D A;  4MLO A;  4E7S A;  1FP1 D;  4D1Q A;  2P6S A;  3V8K A;  3BLY A;  3PQJ A;  2VIX A;  1U8R A;  4EVI A;  3KEO A;  5L3G A;  2W48 A;  1TT0 A;  3MKZ A;  5H6Q A;  1E0E A;  2F5V A;  1N78 A;  4GXO A;  2IS4 A;  2HXI A;  4JX4 A;  1E2X A;  5TIS C;  2CUJ A;  1SFE A;  1MND A;  3LNQ A;  3R60 A;  1I3A A;  5FGM A;  1LE8 B;  3E3V A;  4IX7 A;  1E3P A;  1WJC A;  2H1K A;  3V8L A;  1UAA A;  1KQ0 A;  5EGO B;  4TV7 A;  3FXQ A;  1OPC A;  4JK1 X;  3CCS I;  2FD5 A;  4HX8 A;  4QPQ A;  2ADU A;  3GTG J;  3QWL A;  1W36 C;  2D5V A;  2VXZ A;  4RB1 A;  1BM9 A;  4JYK A;  4DYR A;  2K9N A;  1HF0 A;  4UB8 C;  2HQ5 A;  3M3Y J;  1B6A A;  4XSX F;  1R5G A;  2EPF A;  2OAZ A;  3VB2 A;  2HS5 A;  3FM3 A;  5ILS A;  1X3W B;  2V9V A;  2JA5 J;  1ON1 A;  2CG4 A;  3D5S C;  3GO5 A;  3F8B A;  4C3J J;  4BGD A;  2V1X A;  2KL4 A;  2DOF A;  3PUB A;  1OYY A;  4RM2 A;  4LIV A;  2EFQ A;  1S5L C;  2BY2 A;  3C1D A;  5IP7 J;  5LHI A;  3GF2 A;  3MFK A;  2IVM A;  4I02 A;  4FX4 A;  4B43 A;  5DCF A;  3TO7 A;  5E17 F;  4CYC A;  2JA8 J;  4ZYD A;  2E36 A;  1O3S A;  1MBJ A;  2ZFU A;  1IDY A;  2Q0O A;  2DK5 A;  1X19 A;  2O03 A;  1AHD P;  4HDU A;  3J7Y J;  2XAQ A;  2A05 A;  1MJ9 A;  2OV7 A;  4BEH A;  2RDP A;  4HLY A;  4IHS A;  1CF7 A;  3WGI A;  4UXN A;  3D5R C;  5M5X J;  3PNT A;  3OYI A;  3E5Q A;  5J1U A;  5HS9 A;  3X2Q H;  5H20 A;  3PJR A;  3PUF A;  3BZ6 A;  5K7H A;  4IO9 F;  2HOT A;  4BL0 B;  4DIQ A;  2X6X A;  2XKP A;  5DEQ A;  1BC7 C;  4LG3 A;  3S93 A;  5EZG A;  2V1U A;  5F27 A;  2EFW A;  4XOT A;  4AIH A;  5D8L B;  4ASN A;  1G4D A;  2CMP A;  2JJ7 A;  5GTI C;  1GV2 A;  5EEA A;  2COM A;  2F4O B;  3VEP A;  2JA6 J;  3OOP A;  5J40 A;  2CGP A;  2KIS A;  4CCM A;  3H0D A;  2GQQ A;  2VAS A;  2LP0 A;  4R8H A;  1Y1W J;  3JAM Z;  5IOZ A;  5KK1 A;  2TDX A;  3RJP A;  4CHU A;  3CO7 C;  1MSF C;  1E17 A;  1HST A;  1EF4 A;  4M3D A;  5CKT A;  3VYU B;  3OSF A;  2OPT A;  4CUG A;  3J80 K;  1RR8 C;  1R5H A;  3K4K A;  3WU2 C;  4X1E A;  3CDI A;  2EFP A;  2LD5 A;  3WE3 A;  3OYD A;  1DU0 A;  5D4R A;  2GIV A;  4IHX A;  1IZ1 A;  2BV6 A;  1T33 A;  2JZY A;  4FCY A;  4XLC A;  1MBF A;  2R5Y A;  3S32 A;  3FM5 A;  3HGG A;  1HQC A;  2Y75 A;  2VPR A;  1B1B A;  2QYO A;  2WTE A;  1YO5 C;  2MC4 A;  3QAH A;  2YS9 A;  3PFI A;  5B66 C;  1BBY A;  1OJL A;  3JRF A;  4BY7 J;  2MC3 A;  4D5C A;  3ZQC A;  4A3J J;  4N9H A;  4KN4 X;  1HKQ A;  4M3G A;  1ZYR F;  4I0B A;  4KA4 A;  5M3F J;  4G6D A;  4HQM A;  3H92 A;  4AU7 A;  1M1E B;  2AQF A;  3JRE A;  2PX9 A;  3BR5 A;  1QZY A;  2VOP A;  2FQ4 A;  1SMT A;  3BJA A;  3CZ6 A;  1H0M A;  2BY3 A;  1BI2 A;  2VKV A;  3LQR A;  1UB9 A;  3S2H J;  3MKW B;  1UZC A;  1RNL A;  2AQE A;  2L9N A;  3CES A;  2F5D A;  2WB1 A;  4XLH A;  2VOO A;  2XAU A;  4QSH A;  3ERE D;  2DQL A;  5FD6 A;  2A3S A;  1RUO A;  4IRH A;  3AG1 H;  1XD7 A;  4MQV A;  2CFO A;  1LJ9 A;  4F55 A;  1A5J A;  3S2W A;  2P8T A;  1TLH B;  3K2A A;  2E2I J;  2XAG A;  5H2F C;  3AL0 B;  3GTQ J;  1FMW A;  1Y8R B;  3IHU A;  1W7P D;  2DPU A;  3BDD A;  2LY1 A;  1S6L A;  3BG6 A;  1D8J A;  3WTW C;  3K9T A;  4B48 A;  4CYD A;  3JRB A;  3K0L A;  4HAM A;  2D45 A;  1R00 A;  1H9T A;  4BKX A;  4HZF A;  2QSF X;  3HTU A;  2M9H A;  3EYY A;  3PO3 J;  4BE0 A;  3WG9 A;  3HKZ A;  5IT3 A;  2P5V A;  3COA C;  1I3Q J;  2I5U A;  2D1V A;  4FQG A;  3ESW B;  3EQL F;  4RDU A;  3T1B A;  2IJL A;  4F7Z A;  2BBY A;  3QYE A;  4OMY A;  1HKT A;  3DKY A;  4E7K A;  1WJF A;  1IW7 F;  3EPZ A;  1AA7 A;  3IAS 2;  1LQ1 A;  1FT9 A;  3HRM A;  3FHZ A;  3AG4 H;  3HOV J;  1P2F A;  4RGS A;  3LSP A;  4H4K C;  1K79 A;  4OMZ A;  1XPX A;  4MGR A;  4BQQ A;  2OTL I;  2L5Q A;  3KCC A;  1LEB A;  3K7A J;  2FBK A;  3TGN A;  1WGX A;  1V54 H;  5CVJ A;  1TBX A;  5CYV A;  3V7C A;  2IA1 A;  1FC3 A;  1WI9 A;  1SD7 A;  3L2R A;  2PJR A;  5CJ9 A;  3IP4 B;  2ZC2 A;  4ZTF A;  1TQI A;  1JKR C;  2FA5 A;  1BI1 A;  3VPR A;  3LFU A;  1S29 A;  1WWX A;  3CDH A;  4HA8 A;  2QSG X;  2X48 A;  2XF6 A;  1JXS A;  5F0F A;  5HS8 A;  1FX7 A;  4IJA A;  2O61 A;  1MW7 A;  2R5Z B;  4RMN A;  4MIM A;  2ID3 A;  4CCJ A;  3TDU C;  5D6E A;  5F1J A;  4HF0 A;  3HHH A;  5E8G A;  1FTZ A;  1D1C A;  5L3D A;  1JGS A;  2Z16 A;  2ZNY A;  2ZME A;  1OYI A;  2GXG A;  2LY9 A;  2KDZ A;  3GFL A;  1AOY A;  4LK0 F;  1R36 A;  3HOW J;  4LIT A;  2XC7 A;  1B72 B;  1QA6 A;  3K70 D;  4C2T A;  2DA3 A;  1S7E A;  2Q2E A;  1VQM I;  3KP4 A;  1L0O C;  1MJB A;  5TJJ A;  1OCZ H;  2Y48 A;  3RDI A;  1ZR2 A;  3DF8 A;  3K69 A;  3TQN A;  3HOT A;  1KU3 A;  3NWS A;  1PDN C;  1EH6 A;  2RC4 A;  3WTT C;  1X2M A;  3JRI A;  3OYN A;  3GZ6 A;  5M5Y J;  2YUS A;  2X1E A;  4AIK A;  3CJQ B;  2XGX A;  4M72 A;  3JSP A;  1LVK A;  2WWY A;  1YIO A;  2OC6 A;  1AU7 A;  3OYB A;  2MD0 A;  3IWZ A;  2ZME C;  3EYI A;  3H0G J;  3PIO F;  2A68 F;  3LFK A;  3S3M A;  3DPU A;  1YLF A;  5DUI A;  2DO7 A;  3HPH A;  3S1R J;  3V7S A;  2RQQ A;  3BZC A;  3GTL J;  2ECB A;  3ROU A;  2K9Q A;  3OIP A;  3LSI A;  3QOE A;  1X1C A;  2L9S A;  3BJO A;  1SD6 A;  3LSJ A;  1Y0N A;  1KYW A;  4M6V A;  4Y3O A;  2VBX A;  2PEX A;  1OKR A;  4PSW A;  1UHS A;  5E8I A;  3TMO A;  4HF2 A;  4PGH A;  3HJE A;  3W2W A;  1DGW Y;  2NS0 A;  1IV6 A;  5LRS A;  3CMA I;  1QGP A;  1FYK A;  2OQR A;  1DP7 P;  5FFZ A;  5JLW A;  2QF7 A;  4ABZ A;  2WAD A;  4A12 A;  4P96 A;  2CQX A;  2K02 A;  2D1H A;  5FLX K;  3KYD B;  3I56 I;  3S14 J;  4YEL A;  5LEJ A;  5BPI A;  2RQP A;  2IP2 A;  3OYA A;  3H3V K;  2QEN A;  6PAX A;  2NOG A;  4HQE A;  3I5U A;  5IY5 H;  2KIM A;  1OQY A;  2X4H A;  2V7F A;  3ZMD A;  2V26 A;  3A01 B;  1R5I D;  5GP9 A;  3I71 A;  1CQT A;  1PUF A;  5ICF A;  2DMN A;  1YIJ I;  3LSM A;  1Z91 A;  3QOP A;  2EWN A;  2H8W A;  4UUS A;  2O3F A;  2NVY J;  3TO6 A;  1Z3X A;  4OIO F;  3MCZ A;  1K78 B;  4YEJ A;  1ETV A;  2GM4 A;  3ZMV A;  4DBQ A;  2XUB A;  3TW7 A;  1WRJ A;  5HDG A;  2EB7 A;  3LSR A;  1JJ6 C;  2VJ5 A;  4HF1 A;  3H5A A;  3DTE A;  3FXM A;  1C0W A;  2VC0 A;  3VSK A;  1WJA A;  2IGO A;  3ZCO A;  2HTJ A;  4WXD A;  1J59 A;  4XLF A;  2R7T A;  3I3L A;  2HVQ A;  1G3Y A;  1ZRD A;  4EMS A;  1V5F A;  3IC7 A;  4KIS A;  3ZQH A;  4Y4R A;  3ABK H;  3W6J B;  5B5E C;  1TW3 A;  2K9S A;  2BW3 B;  4E7L A;  2Y31 A;  1R4N B;  3L09 A;  3WE2 A;  2XRL A;  2KPM A;  2KT0 A;  2KLO A;  3H9G A;  4D5F A;  3DEW A;  1XGS A;  4GCV A;  1VQP I;  2JRT A;  4FAS D;  1FIA A;  1ETQ A;  1OIS A;  3VYS B;  1FEX A;  4EM2 A;  3LL7 A;  5K5O A;  3DBR B;  3RYR A;  3KLN A;  4LLL A;  1WJE A;  2PMZ A;  4RA2 A;  5H6R A;  3K4M A;  2OU2 A;  1PP7 U;  5E3N A;  2PMU A;  3HRS A;  2CV1 A;  1MMN A;  2F6C A;  2KKO A;  4WCG A;  1WKM A;  3E7L A;  1QZZ A;  2STT A;  5IYC J;  2B0L A;  4RAY A;  4XRM A;  2I8D A;  4PSX A;  3A4C A;  3A03 A;  1A35 A;  3WGH A;  1VFC A;  4XIC A;  1R1V A;  5DYM A;  3DKX A;  4I0A A;  2XF7 A;  1XC5 A;  1T0F C;  2CFX A;  3GW2 A;  4LD5 A;  1YJN I;  1PVE A;  3DU6 A;  3K4N A;  2VPL A;  3GCM A;  4I01 A;  3G3Z A;  2FOW A;  2HPI A;  1TWH J;  4BJ6 C;  5D8K B;  2K9L A;  3IKV A;  2RNJ A;  4ENM A;  3PM1 A;  3FXK A;  4HSR A;  4GYI A;  4KYW A;  2K27 A;  3LSH A;  1OR7 A;  1Y0U A;  1MMG A;  1P6R A;  4A3L J;  1ZK8 A;  2M8E A;  2O0Y A;  1FSH A;  4YII A;  3RPU A;  5BS6 A;  2E35 A;  1D0Y A;  4ZJZ A;  3M4O J;  3MMY B;  1XGN A;  2R92 J;  1SFU A;  3KP3 A;  1SMY F;  3BTC A;  2MLG A;  1Z67 A;  4E7H A;  3GTJ J;  1A6I A;  1FOX A;  4HBL A;  4C9Y A;  1FSE A;  1YE9 A;  3ELK A;  1IAW A;  1ZTR A;  4KT6 A;  4C2M J;  2W24 A;  2CO5 A;  4A3B J;  2DYS H;  1U78 A;  3MQ0 A;  4W97 A;  1SC7 A;  3TL4 X;  3L2W A;  2W4S A;  1V5G A;  2DBB A;  4RS8 A;  1UHW A;  1JT6 A;  2QUF A;  3RIR A;  3A2K A;  2KZG A;  2CW8 A;  4GFB A;  1NG6 A;  1UG2 A;  5K5Q A;  2M45 A;  1OR7 C;  3E0J B;  3RCO A;  2EH3 A;  3K4L A;  3J81 Z;  2R7W A;  2Y30 A;  1VTN C;  4LB5 A;  3OSG A;  4A0Z A;  3E6M A;  3NQO A;  1MJA A;  4EEF G;  2JPC A;  1YX5 A;  5JLX A;  4CCO A;  4A3E J;  2CWE A;  1P4X A;  2M5W A;  4UV8 A;  4XN0 A;  1B9M A;  4ENK A;  4PJ0 C;  1XN7 A;  4LFU A;  1SAU A;  5L3E A;  2KRH A;  2HKO A;  1Z0X A;  2QQB A;  4XR6 A;  2O5R A;  2Q8K A;  4OIR F;  1XG1 A;  3AG2 H;  1K61 A;  3OYC A;  4L5I A;  3KP6 A;  1H8A C;  1RKW A;  3HGY A;  1U0J A;  1OMI A;  2JN6 A;  3R6S A;  3DPT A;  5B1A H;  3KEQ A;  2K4J A;  4EM1 A;  4ZC3 A;  3K6G A;  1YW8 A;  3F6V A;  4B1R A;  1BW5 A;  1Z7L A;  3QU6 A;  4RAZ A;  2G7U A;  4BQA A;  2NS8 A;  2FXA A;  4AYB N;  2R7Q A;  2NS7 A;  1W36 D;  2A6H F;  5EZH A;  3U21 A;  2IA2 A;  2IRF G;  3DU5 A;  2NVQ J;  1QVT A;  1IXS B;  2XRN A;  4QIW N;  4KFC A;  3T8T A;  1EKE A;  2VBY A;  1BN5 A;  3ZPL A;  2GIZ A;  5L3C A;  3B6A A;  2IAI A;  4XL9 A;  1A6Q A;  4MO7 A;  2CUE A;  2NXN B;  2VXD A;  4EGY A;  1D3Y A;  4RGU A;  4KIC A;  5KAI C;  1R7J A;  5DM7 F;  3TW6 A;  1XSX A;  3F8F A;  1P4W A;  1W1W E;  3HPG A;  2R7D A;  3S1Q J;  2ID6 A;  3QPH A;  2FU4 A;  3CMM A;  2F4I A;  1H88 C;  3K2Z A;  2E1M C;  2IPQ X;  4UHT A;  1POG A;  3AG3 H;  4KIB A;  3K10 A;  2L2O A;  1LPQ A;  1L3L A;  2RN7 A;  5GPA A;  1HLV A;  2V6E A;  3ZMZ A;  3WTZ A;  3CC4 I;  4BAC A;  2FUG 2;  3GXO A;  5HDN A;  1RPW A;  1K7A A;  1QQI A;  2CQ7 A;  2E7X A;  2FNA A;  4A3M J;  1H89 C;  2TCT A;  4IKF A;  4GDF A;  1WHU A;  2P7V B;  2DK8 A;  1DP3 A;  1BOB A;  1HC8 A;  3BCA A;  5FKN A;  3ZMT A;  1S9H A;  3FWE A;  2QQ8 A;  3CCE I;  4NC8 A;  2BY1 A;  2XF5 A;  4CYC B;  3DLL F;  3OWT A;  4MNU A;  3SFI A;  3MN2 A;  5GPC A;  1TNS A;  4IHV A;  3H9J A;  4BAY A;  4EV0 A;  3KX2 A;  5AON A;  2E1C A;  4II2 A;  4P9F A;  3WHB A;  5HNF A;  2X1C A;  1TQM A;  1VF9 A;  2MAB A;  4NQW A;  3LWF A;  1G3W A;  4PCQ A;  1S7O A;  4A69 C;  4U0W A;  4IVN A;  1J9I A;  1VQ4 I;  2XB0 X;  2AHQ A;  2M2E A;  4GO1 A;  3HUG B;  1APL C;  3OOU A;  4BBR J;  3E5U A;  1VQ8 I;  3OYE A;  1U8B A;  3RZO J;  2CW0 F;  3WGG A;  2EA4 A;  3CCR I;  3CCY A;  2VN2 A;  4G7Z F;  1OFC X;  2GXB A;  3QP5 A;  2DOA A;  3Q3S A;  3WG7 H;  3RPQ A;  3G1O A;  4PDK A;  3Q0W A;  3MKY B;  1Z21 A;  4CCK A;  2EZH A;  2DJN A;  3SZT A;  3VWB A;  3WOD F;  1LKX A;  5J4Y A;  4UVB A;  1J2X A;  4BS9 A;  2Y2Z A;  2OQG A;  5BMZ A;  1XB4 A;  4MHG A;  5FRO A;  2B9S A;  2DTR A;  1GXQ A;  5L3B A;  1QHH D;  2L54 A;  3M07 A;  4I98 B;  4F93 B;  2ME6 A;  5FLX Z;  3WU1 B;  1BIA A;  4UB6 C;  2CUZ A;  2MYS A;  3KPH A;  4UUV A;  3HSF A;  1RUN A;  2RAE A;  2FX0 A;  3FXR A;  3KZZ A;  3HM5 A;  3H5R A;  5FLM J;  2M4K A;  4DYC A;  2B63 J;  3W2V A;  4WX9 A;  1LVA A;  3GVA A;  3Q9V A;  3VOD A;  3GTP J;  5F1R A;  4Y52 J;  1IRF A;  5D5V B;  1Z05 A;  4ZZL A;  2P6T A;  2JUG A;  2AXT C;  1R23 A;  4UVA A;  2E1O A;  2VL8 A;  4NC6 A;  2VBZ A;  1JKQ C;  1K6O A;  3ABM H;  2M7B A;  3UR3 C;  4HEA 2;  1FBU A;  5B1B H;  1HW1 A;  2H09 A;  1NG7 A;  3OIO A;  4LG0 B;  3KP2 A;  2VUM J;  2VT3 A;  2A5Y B;  2XVC A;  2LSO A;  1LFB A;  2WV0 A;  4CH7 A;  2O8X A;  1HDP A;  2PBI A;  3TP0 A;  5JR3 A;  4DOZ A;  4RGR A;  2JA2 A;  3V4G A;  2CW7 A;  3FBI B;  4L5J A;  1DPR A;  5ICG A;  2LH9 A;  2Y9Y A;  4IL6 C;  2Z9O A;  2DFI A;  3ZQI A;  1X2N A;  1IXR C;  1I39 A;  2Y69 H;  2E2J J;  5E1X A;  3HSR A;  1EV7 A;  1LE8 A;  3FDY A;  5C3E J;  2H6C A;  5LLQ A;  1OYW A;  2DMT A;  1AWC A;  3L2U A;  1GHC A;  5IYB J;  2O6G E;  5GAD J;  1B8I B;  4L9N A;  2W1O A;  2E7W A;  4L9T A;  3G73 A;  1WJB A;  1LFP A;  2M4G A;  3PNY A;  2XAS A;  2DXI A;  2A69 F;  5KAF C;  1HA8 A;  2IXS A;  4A3G J;  4EJW A;  1D0Z A;  2DQR A;  2E1N A;  3DBL B;  4QLC U;  1JJ8 C;  4M6Y A;  3BY6 A;  3CO6 C;  3DPL C;  5TRD A;  2HZT A;  3G6E I;  5F0H A;  1FIP A;  2CU7 A;  2EFN A;  5IT9 K;  4LIU A;  1ZG5 A;  3JTG A;  4HV5 A;  5J4V A;  1REP C;  2KJC A;  2K3F A;  3HBL A;  1JTY A;  5HVQ C;  2YX7 A;  1X1B A;  5IPA A;  1R9T J;  1B9N A;  2NNN A;  2WAQ N;  4M3E A;  3BT9 A;  2L9R A;  1SAX A;  5FKK A;  1IV8 A;  3HL2 A;  4CZC A;  3OR1 C;  2MBF A;  4IRI A;  4I2O A;  1U5T B;  2E5Z A;  3RKQ A;  4BXF A;  2PJR B;  3P9C A;  5HLH A;  2IGK A;  1YTY A;  1FYM A;  3CC7 I;  2JA7 J;  3RKX A;  1BJA A;  4YIR X;  3S3N A;  3OV8 A;  1GV5 A;  3HIF A;  5EG0 B;  2QQ9 A;  1HKS A;  1DPU A;  2QGU A;  2XSJ C;  3O2P E;  3DV8 A;  1RKT A;  1W7P B;  2R7Z J;  2IBD A;  2ZSI B;  3O3K A;  5DUK A;  3OYF A;  4Y7N J;  5J47 A;  2LVS A;  4NUB A;  2LY2 A;  2K5C A;  4YFX F;  2MSY A;  4CCN A;  1U6G A;  3ASO H;  2HZD A;  5LBQ A;  1W5T A;  5A2Q Z;  3K4B A;  2QBY B;  4E7I A;  5CVI A;  4ZYG A;  2LLK A;  1Y1V J;  1TL8 A;  1ORK A;  3K1P A;  3SEQ A;  4ZYH A;  2BEO A;  3E6D A;  4PJJ A;  4HNU A;  2CYY A;  3KP5 A;  2EZK A;  2NVT J;  4BE2 A;  3LAJ A;  3FX3 A;  3DFG A;  4DJA A;  3Q0U A;  2AO9 A;  2FF4 A;  4KNY A;  1BIB A;  3JRD A;  1O3T A;  2R7O A;  3OYG A;  3M7G A;  3FIW A;  2JT1 A;  3CF5 F;  2DJI A;  3KLO A;  4IEJ A;  3JW4 A;  1YOV B;  1ZGJ A;  2H8R A;  3CJN A;  2XDV A;  2MGQ A;  3WTU C;  2LKX A;  4N4O B;  2EV0 A;  5BQT A;  1J7K A;  4AD9 A;  3TP3 A;  1HOM A;  4G7O F;  2WY7 Q;  5DCM B;  4ZDO A;  1R58 A;  2WA0 A;  2K86 A;  2H1L A;  3S8P A;  1ACI A;  2IW5 A;  2UXN A;  4PK4 A;  4EJV A;  5JVG F;  3SZP A;  4XKW A;  4JP0 A;  5LGT A;  3MZY A;  3F6O A;  4G94 A;  5KHD A;  3HB9 A;  1MBH A;  1O3Q A;  1G3T A;  3O8G A;  2DLL A;  1ZEL A;  4P1W A;  2DFH A;  1T39 A;  2W85 A;  1JUM A;  4KT5 C;  2HFH A;  1IO2 A;  3A0B C;  2LF8 A;  4V2F A;  3F22 A;  4XRF A;  2KHM A;  3RQ4 A;  2PLY A;  3Q9S A;  1T2K A;  4BQO A;  1RES A;  1T98 A;  2R7S A;  5TGT A;  4FT8 A;  2YU3 A;  4LMY A;  2FSW A;  2HDD A;  4IHT A;  1TNT A;  2H94 A;  2UXX A;  1VQO I;  1QU3 A;  2F5C A;  2ZXI A;  4OAY A;  2JVG A;  3WTS C;  3VDX A;  4W1U A;  3W6V A;  3DP7 A;  1XDU A;  3IWF A;  1GVD A;  1DDN A;  2Y0M A;  3L00 A;  3BQZ A;  1OCP A;  4I6Z A;  4IHY A;  2FE3 A;  1AKH B;  4HST A;  1UMQ A;  4MFE A;  5F64 A;  2WBM A;  4EGZ A;  4X0G A;  2KIF A;  4E7J A;  1RI7 A;  5DTD A;  3LQQ A;  4ZDL A;  1Z6R A;  2PMH A;  3F8C A;  3ZN1 A;  1JE8 A;  5LGN A;  3C3W A;  1JKP C;  4JX6 A;  4CO8 A;  2R5Z A;  5ERI A;  2Z5U A;  2LRE A;  3QPS A;  3I53 A;  1MBK A;  3HOZ J;  4DZP A;  2A6E F;  4CGZ A;  5E20 A;  3ZMS A;  1YJ9 I;  2L4A A;  1F4K A;  2Z33 A;  4PFO A;  1RRJ A;  4NHJ A;  5HS7 A;  1FBS A;  2L3D A;  3LSG A;  4O3M A;  4KIT B;  1FOY A;  5L3F A;  2Q1Z B;  2XGE A;  2LG4 A;  1B59 A;  4P9U A;  2W82 A;  1B72 A;  3FXU A;  3S1M J;  2RRE A;  2MW8 A;  2M34 A;  3MEX A;  4I7H A;  1K6Y A;  5AIP A;  3NAU A;  3WHC A;  4A3D J;  1SD4 A;  3CCU I;  3S2D J;  1XMA A;  5ICE A;  1KGS A;  3C18 A;  5AIQ A;  4DW6 A;  2LR8 A;  4BBS J;  3HXL A;  1Z9C A;  1I6H J;  5LFA A;  2ME0 A;  4IQJ A;  2HVR A;  3K1N A;  2ICW G;  2VJ4 A;  3N97 A;  1T08 B;  4BHC A;  1ZR4 A;  1A36 A;  3A0H C;  3IH3 A;  2J5P A;  1E3O C;  3FKI J;  2MD5 A;  3CUQ A;  3S3O A;  3DWL E;  1ZLJ A;  4HX4 A;  1XS9 A;  1EJ9 A;  4HRI A;  3DEE A;  4V19 K;  2CSO A;  3OMY A;  1QNT A;  2W57 A;  2WAE A;  4HYE A;  3O8H A;  2HVS A;  5FB2 A;  5ICC A;  2IS2 A;  4L5E A;  4B44 A;  1KZH A;  2EFO A;  1JTX A;  3C2G A;  2ZJP F;  1TWG J;  2W00 A;  1UFM A;  4M9X A;  3SQN A;  2ECC A;  3KZI C;  4O5V A;  2EIM H;  4MEX F;  2F5E A;  2ELH A;  2ESH A;  1V55 H;  2FBH A;  2CV0 A;  1R4M B;  1IGN A;  5DD8 A;  1OLT A;  1MNM C;  3GTM J;  4OWR B;  4DBR A;  4LJZ F;  3SFZ A;  1FTT A;  4IRG A;  3HOU J;  3I59 B;  3JAM K;  4A5N A;  2PN6 A;  3DQV C;  3GZN B;  4OIN F;  1PUE E;  3RI4 A;  3CME I;  3BG9 A;  3CUQ C;  3ABU A;  3C2H A;  5D5X B;  3ZR8 X;  3QPT A;  5J8C A;  1VQN I;  1FJL A;  2FQ3 A;  4BY1 J;  1K83 J;  3JRG A;  2OF7 A;  1NK2 P;  3FMQ A;  2VQH A;  1MMD A;  3UNG C;  3GFI A;  2ZO4 A;  1OCR H;  3RZD J;  4C30 A;  1F5T A;  4OIP F;  2DMQ A;  3PSI A;  4FTH A;  3ML6 A;  3JR9 A;  4OU0 A;  5LHH A;  1QVU A;  2LMD A;  5M5W J;  2BOL A;  4AVP A;  3CTA A;  3I58 A;  4WWC A;  3R4K A;  3P9K A;  4RB2 C;  4XQF A;  2HU9 A;  3CDL A;  3G4S I;  1YJW I;  1ETX A;  1RZ4 A;  2LTP A;  1MDM B;  3I4M J;  5KNL A;  1K78 A;  1MMS A;  5B3S H;  1FMV A;  2M87 A;  2KFD A;  2O8K A;  1HBX G;  3RQI A;  1I27 A;  2VKE A;  2QVO A;  1QZE A;  4OAZ A;  4A0X A;  1JKO C;  4K2E A;  1UCR A;  1LB2 A;  2L9V A;  3J80 Z;  2ZXH A;  2XPW A;  5KCM A;  2BHZ A;  3LMM A;  3OS2 A;  2R7R A;  4NNJ A;  3QQA A;  1B4A A;  3F8N A;  1D5Y A;  1KA8 A;  3ISP A;  1MSE C;  1YRN B;  2DCE A;  1N25 A;  4Z2Y A;  4B09 A;  4JQF A;  4HDV A;  3U2R A;  1YS7 A;  4IPA A;  2LKP A;  3T0Y A;  2MLK A;  1O7F A;  1ONV A;  2XB5 A;  2BW3 A;  1IC8 A;  5C4J J;  3M1E A;  3P5J A;  5J1R A;  4E7Z A;  4ESJ A;  1O4X A;  3JSO A;  3D5L A;  5J6X A;  3L2C A;  4C2U A;  4HOB A;  1T38 A;  2BXZ A;  3HOX J;  2DT5 A;  4D7N A;  3M9A A;  2EIK H;  3GME A;  4XKV A;  3H3Z A;  2E60 A;  4P5O A;  3NWT A;  3ECH A;  2GBY A;  1ETW A;  4M3F A;  1YYV A;  4AID A;  1R1U A;  2RVC A;  4F91 B;  5F0C A;  1IN6 A;  2GA1 A;  3BTL A;  4C3H J;  3CD6 I;  2QKM B;  4XKB A;  2DDB A;  1HSJ A;  5D6F A;  1XGM A;  5E1Z B;  1G8X A;  1KQ9 A;  2LFB A;  3KYC B;  1J0R A;  3LOC A;  1SD5 A;  1SFO J;  2DT7 B;  5HOO A;  1T8I A;  4XID A;  1W0T A;  2A61 A;  3DLA A;  3WTV C;  1MGT A;  2TRT A;  2ZJ2 A;  1TP4 A;  2FBI A;  2MG4 A;  4MTE A;  1XCB A;  4DQ2 A;  2JRM A;  2DA5 A;  5FKL A;  1MNE A;  3IAM 2;  1P4A A;  4MQ9 F;  2Y0S N;  2VT2 A;  2X1D A;  2VQC A;  4M9S A;  3WTX C;  2F2E A;  1CGP A;  1GLN A;  2H27 A;  2WC2 A;  1S72 I;  1W5C C;  3GUD A;  4FE7 A;  1Q1H A;  4BH9 A;  2YU9 J;  4XOP A;  2CRG A;  2E5N A;  4R1H A;  4CXF A;  1ZRC A;  4I09 A;  1T6S A;  2LBF B;  2F4M B;  5E3L A;  4BJT A;  1BR2 A;  3FKJ A;  1X58 A;  2EV6 A;  5CVV A;  2NVU B;  4CDG A;  1P92 A;  4OIQ F;  2F48 A;  1VQ7 I;  5GTH C;  1G6N A;  3QYF A;  4A0Y A;  3CCM I;  3M8F A;  4YFK F;  4XRS A;  1MBE A;  3DTK A;  2J5O A;  2L7K A;  2X6Y A;  1E3H A;  2IS6 A;  4ANJ A;  2HNH A;  4IOA F;  3FK6 A;  2JSC A;  4G6T B;  5IOY A;  4G12 A;  3RKW A;  3ZRG A;  3K4C A;  3CJR B;  1VQ9 I;  2GAU A;  2KIU A;  1WH7 A;  1BOA A;  4DYQ A;  4EAT A;  5CVR A;  4BU2 A;  2VQL A;  1KON A;  2IGN A;  3FXJ A;  3I54 A;  1UG0 A;  4ZYA A;  4YG2 F;  2BGC A;  2CJJ A;  3BTJ A;  2C6Y A;  2VI6 A;  2N8G A;  5LHG A;  1WPK A;  1XMX A;  4UV9 A;  5FO5 A;  3ULQ B;  1VND A;  1V5E A;  1F43 A;  1STZ A;  2CQQ A;  3BR2 A;  5F6F A;  5DS9 A;  2LKS A;  4EQQ A;  1I50 J;  4RGX A;  4KMF A;  5E18 F;  1QO0 D;  1R22 A;  4V2G A;  2EZL A;  3ONQ A;  2G0E A;  4CCL A;  1K4S A;  3ZQG A;  2L01 A;  1IJW C;  2OA4 A;  3DTI A;  2O9L A;  1YW9 A;  4ZYE A;  1JUS A;  5FD5 A;  4AYB A;  4BJ5 C;  1J75 A;  4B4C A;  3I4P A;  4IQ4 A;  4Q47 A;  4GGG A;  2K3P A;  1WJD A;  2YSR A;  2XV4 S;  3H36 A;  1IF1 A;  1VQ6 I;  3FZV A;  3TKY A;  1ETK A;  3NEU A;  1WVR A;  2KRC A;  2EA2 A;  2V79 A;  4E6K G;  3TO9 A;  1I1G A;  4WXC A;  5F08 A;  1ZAR A;  3FIS A;  4XMY A;  3FXL A;  3TBI A;  3M8J A;  1NH3 A;  2DTZ A;  1SVO A;  2UUZ A;  2ESN A;  1LFU P;  3GBG A;  2BXY A;  2Z99 A;  5EF6 A;  1YFH A;  1IXC A;  2HPM A;  3R0J A;  3M1C A;  2PJP A;  2ZKZ A;  3F23 A;  4A5M A;  4LOC A;  5DD4 A;  4BEH B;  5D5W B;  1CF7 B;  1FPQ A;  4CA0 A;  1N77 A;  2VB6 A;  3TDZ C;  4EJT A;  5GAG J;  4A3C J;  4U7D A;  1DUX C;  5EJC A;  2YPR A; 
#chains in the Genus database with same CATH homology
 2HYJ A;  5JLW A;  1GV5 A;  2QF7 A;  4ABZ A;  5EG0 B;  2CQX A;  1GUU A;  2ELK A;  3SJM A;  1QPI A;  1RKT A;  3S14 J;  3A02 A;  2EQR A;  2R7Z J;  2IBD A;  3H3V K;  1P7I A;  2NOG A;  4Y7N J;  4RBO A;  2LVS A;  2DMU A;  3ZQF A;  4JX5 A;  2JMW A;  2MSY A;  3L1P A;  4A3K J;  3A01 B;  3JRH A;  5GP9 A;  1CQT A;  1PUF A;  2DMN A;  2M8G X;  2L0K A;  3GTO J;  2HOS A;  4UUS A;  1JUP A;  2DA6 A;  2NVY J;  2LLK A;  2E19 A;  1Y1V J;  1ORK A;  2L7F P;  5E3M A;  2NVX J;  4AC0 A;  1ETV A;  2GM4 A;  3CQZ J;  3TW7 A;  4B3A A;  1Q1V A;  2EZK A;  3LSR A;  1JJ6 C;  2R5Y B;  2NVT J;  2L7Z A;  3GTK J;  5BNG A;  4XRS G;  2O7O A;  2AO9 A;  3Q0U A;  3JRA A;  3JRC A;  1U9O A;  4XK4 A;  3JRD A;  1GT0 C;  1ITY A;  1YRN A;  3FIW A;  4FIS A;  4IEJ A;  2H8R A;  5M3M J;  2MGQ A;  2LKX A;  2LK2 A;  3ZQH A;  1U9N A;  3TP3 A;  1HOM A;  3HEF A;  2K9S A;  2R93 J;  2Y31 A;  2XRL A;  2KT0 A;  4QTR A;  4D5F A;  3NAR A;  2GLO A;  3HDD A;  3BR0 A;  1ETY A;  2JK3 A;  3DEW A;  3BG5 A;  4BXX J;  4JP0 A;  1FIA A;  1ETQ A;  1GDT A;  5EGO A;  4NDL A;  1FEX A;  3HB9 A;  1MBH A;  2XPU A;  3O8G A;  1W0U A;  1BL0 A;  1DU6 A;  2HXO A;  2DMP A;  1JUM A;  5E3N A;  4V2F A;  3I4N J;  2DN0 A;  1TWC J;  3E7L A;  5HOD A;  5C4X J;  1G2H A;  2P81 A;  5IYC J;  4XRM A;  5IP9 J;  1ENH A;  5K7F A;  2XPV A;  1RES A;  3A03 A;  1IG7 A;  1BA5 A;  3BQY A;  5IYD J;  2HDD A;  1VFC A;  4XIC A;  3BG3 A;  3B6C A;  2HOA A;  1MH3 A;  1XC5 A;  3Q0V A;  3ZQL A;  5J1Y A;  4W1U A;  3W6V A;  3S16 J;  1GVD A;  2DA7 A;  1P7J A;  3F0C A;  3BQZ A;  1OCP A;  4I6Z A;  4IHY A;  1TWH J;  2WB1 N;  1AKH B;  1UMQ A;  3PM1 A;  4MFE A;  4X6A J;  2XGD A;  1HDD C;  3G1L A;  5DTD A;  2Y9Z A;  1ZK8 A;  4A3L J;  1IDZ A;  4IHW A;  3BR1 A;  1IUF A;  3M4O J;  1JKP C;  4JX6 A;  4MLO A;  2R5Z A;  2R92 J;  3BTC A;  3QPS A;  1BJZ A;  1MBK A;  3HOZ J;  4DZP A;  3GTJ J;  1A6I A;  2W48 A;  1MBG A;  1ZTR A;  2M0C A;  3CMY A;  3S17 J;  4C2M J;  4A3B J;  2HXI A;  4JX4 A;  3LSG A;  1U78 A;  3PO2 J;  4W97 A;  3HKZ N;  4C3I J;  4I76 A;  3LNQ A;  2XGE A;  1JT0 A;  1B72 A;  1LE8 B;  3S1M J;  1JT6 A;  2MW8 A;  2H1K A;  2M34 A;  4GFB A;  1UG2 A;  5EGO B;  1B8I A;  1RET A;  3NAU A;  3WHC A;  1VI0 A;  4A3D J;  2FD5 A;  3S2D J;  3GTG J;  2D5V A;  2WV1 A;  4DYR A;  4JYK A;  4DW6 A;  2EH3 A;  2LR8 A;  2K9N A;  2Y30 A;  1HF0 A;  4BBS J;  3OSG A;  2HQ5 A;  3M3Y J;  1I6H J;  2ME0 A;  4EEF G;  4A3E J;  5JLX A;  1IRZ A;  4HNV A;  2JA5 J;  1ZR4 A;  4C3J J;  3IH3 A;  1E3O C;  3FKI J;  4UUT A;  3BR6 A;  5IP7 J;  1XS9 A;  4DZJ A;  2COB A;  1WCM J;  1Z0X A;  1XG1 A;  1NK3 P;  4CYC A;  2JA8 J;  1K61 A;  3IV5 A;  3O8H A;  1H8A C;  1MBJ A;  1IDY A;  5F04 A;  1RKW A;  3HGY A;  3IH4 A;  4L5E A;  1AHD P;  2JN6 A;  1JTX A;  1TWG J;  2ECC A;  3BTI A;  4MFD A;  4B1R A;  5M5X J;  1BW5 A;  5J1U A;  5EYR A;  1IGN A;  1MNM C;  5K7H A;  2NS8 A;  2X6O A;  3GTM J;  4AYB N;  2NS7 A;  2HOT A;  5EZH A;  1FTT A;  5EG0 A;  2XSD C;  2NVQ J;  3HOU J;  1QVT A;  5EZG A;  4QIW N;  5F27 A;  5FLV A;  3BG9 A;  5FKM A;  2JJ7 A;  3B6A A;  1GV2 A;  5EEA A;  1FJL A;  2IAI A;  2JA6 J;  4BY1 J;  1K83 J;  4MO7 A;  3JRG A;  2OF7 A;  2CUE A;  1NK2 P;  3RZD J;  3TW6 A;  3D1N I;  2DMQ A;  4FTH A;  2LP0 A;  1NTC A;  3JR9 A;  1QVU A;  5M5W J;  1Y1W J;  5IOZ A;  3S1Q J;  2ID6 A;  1EF4 A;  1PUF B;  1MSF C;  4M3D A;  3OSF A;  2OPT A;  3CDL A;  1H88 C;  1ETX A;  1POG A;  2LTP A;  3I4M J;  4UUS B;  4X1E A;  2LD5 A;  1DU0 A;  4IHX A;  5GPA A;  2O8K A;  1ETO A;  1HLV A;  1T33 A;  4FCY A;  1MBF A;  3RQI A;  2R5Y A;  1RPW A;  2VKE A;  5FKO A;  3HGG A;  1JKO C;  4A93 J;  2VPR A;  4A3M J;  1RR7 A;  1H89 C;  2TCT A;  2XPW A;  2YS9 A;  2XGC A;  3QQA A;  1OJL A;  3JRF A;  1D5Y A;  4BY7 J;  1MSE C;  4D5C A;  5FKN A;  1YRN B;  3ZQC A;  4A3J J;  1F36 A;  2X9D A;  1ZKG A;  4CYC B;  4D7M A;  4M3G A;  2XB5 A;  4M3B A;  3SFI A;  3MN2 A;  5GPC A;  5C4J J;  1IC8 A;  5J3L A;  5M3F J;  4IHV A;  3QPL A;  5J1R A;  1Z77 A;  3JRE A;  3BR5 A;  1O4X A;  2FQ4 A;  3WHB A;  3MKL A;  1VF9 A;  3G1M A;  2VKV A;  3HOX J;  4D7N A;  4A3I J;  2EZI A;  3S2H J;  4A69 C;  3S15 J;  2QCO A;  2XB0 X;  2AHQ A;  2GBY A;  4M3F A;  1ETW A;  2M2E A;  5FJ8 J;  5F0C A;  1APL C;  2CUF A;  3OOU A;  2K40 A;  2EBI A;  3BTL A;  4BBR J;  4QSH A;  4C3H J;  3BR3 A;  1U8B A;  3RZO J;  3HOY J;  3CCY A;  1OFC X;  1T56 A;  1WH5 A;  1QRY A;  2LFB A;  1A5J A;  3Q3S A;  3LOC A;  1SFO J;  3G1O A;  3K2A A;  2E2I J;  3Q0W A;  1MH4 A;  3GTQ J;  2DA2 A;  2DJN A;  2EZH A;  1TC3 C;  4XID A;  2ZB9 A;  1W0T A;  2I10 A;  2TRT A;  2Y2Z A;  5K7Z A;  3JRB A;  2MG4 A;  4S0H B;  1TWA J;  2DA5 A;  5FKL A;  4BKX A;  2ME6 A;  2Y0S N;  2M9H A;  3PO3 J;  1HCR A;  2FX0 A;  1I3Q J;  2RAE A;  1SAN A;  3SDG A;  3HM5 A;  2L7M P;  4AUX A;  5FLM J;  4DYC A;  4FE7 A;  2B63 J;  2YU9 J;  2CRG A;  4RDU A;  3TED A;  3GTP J;  4Y52 J;  5E3L A;  2JWT A;  1X58 A;  1AKH A;  2E2H J;  2IEK A;  3HOV J;  3LSP A;  3UKG A;  2E1O A;  3K7A J;  1WGX A;  4XRS A;  1JKQ C;  1MBE A;  2PMZ N;  4A3F J;  1ZQ3 P;  1JKR C;  3FK6 A;  3OIO A;  3VPR A;  5IOY A;  2VUM J;  4G12 A;  2X48 A;  1WH7 A;  1LFB A;  5F0F A;  4DYQ A;  2R5Z B;  4MIM A;  3TP0 A;  1HDP A;  2ID3 A;  3MVP A;  5F1J A;  2CJJ A;  3BTJ A;  9ANT A;  1FTZ A;  1ZGW A;  2VI6 A;  2Y9Y A;  4FE4 A;  3ZQI A;  5EDN A;  2N8G A;  1X2N A;  1WPK A;  2E2J J;  1VND A;  2LY9 A;  2KDZ A;  1F43 A;  3A01 A;  2CQQ A;  1WI3 A;  1LE8 A;  3BR2 A;  5C3E J;  5DS9 A;  3HOW J;  3S1N J;  3C2B A;  1I50 J;  1B72 B;  2DA3 A;  2DMT A;  1S7E A;  3ZOB A;  5IYB J;  4V2G A;  1B8I B;  2EZL A;  2G0E A;  1ZR2 A;  3FK7 A;  3ZQG A;  1IJW C;  2O9L A;  1JUS A;  3DCF A;  4B4C A;  1X2M A;  3JRI A;  4A3G J;  5M5Y J;  3IH2 A;  2YUS A;  5IP6 A;  1JJ8 C;  5E3O A;  2FJ1 A;  1ETK A;  1TWF J;  2DA1 A;  1AU7 A;  5F0H A;  1FIP A;  2CU7 A;  1BW6 A;  5F08 A;  3H0G J;  3FIS A;  1OCT C;  2R0Q C;  1JGG A;  3S1R J;  4J19 A;  3GTL J;  2ECB A;  1JTY A;  3HBL A;  2DTZ A;  2K9Q A;  5IPA A;  1R9T J;  1LFU P;  3GBG A;  2WAQ N;  4M3E A;  5EF6 A;  3BT9 A;  2L9R A;  3LSJ A;  5FKK A;  4M6V A;  4LOC A;  1UHS A;  3RKQ A;  2HI3 A;  1IV6 A;  4A3C J;  2JA7 J;  2DA4 A;  5C44 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...