1Y0NA

Structure of protein of unknown function pa3463 from pseudomonas aeruginosa pao1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
71
Chain Sequence
b'GHMLIPHDLLEADTLNNLLEDFVTRETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0270 protein PA3463
publication title Hypothetical protein PA3463 from Pseudomonas aeruginosa strain PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 21
structure length 71
sequence length 78
ec nomenclature
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06794 UPF0270 Uncharacterised protein family (UPF0270)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A YehU-like 1y0nA00
1Y0NA
chains in the Genus database with same CATH superfamily
5EGOA 2QCOA 2LK2A 2EA4A 3Q3SA 5E8GA 3B6CA 1FC3A 1W5SA 2GOXB 4IOCF 2Z9OA 3VYRB 4L5EA 5HNFA 1T6SA 3LA2A 2EIKH 2HOTA 3K2AA 2D45A 5E1WA 3BG6A 3Q0UA 2KZGA 2W82A 1HQCA 3GMEA 1TNTA 4B44A 2JT1A 1TQMA 2JPBA 2VOPA 1BW5A 3R0AA 3BG7A 2RDPA 5IP6A 3DKYA 1U0JA 1W0TA 3PNTA 3K70D 3HOUJ 2H6BA 4M72A 2V1UA 3DV8A 4BHBA 2WADA 2M7AA 5DDGA 3AL0B 3M07A 2HDWA 3HGYA 1GT0C 2E2HJ 3G1MA 5H20A 1PP7U 2O7OA 4H4KC 1YFHA 3BT9A 1X1DA 2PG4A 1UB9A 3VWBA 1FIPA 1SD6A 3RQIA 1Y1VJ 1BC8C 2XVCA 1U8BA 1FPQA 4L9JA 1GVDA 3NWSA 3OYIA 4RAGA 4F93B 5ILVA 1FIAA 4D0PA 2N8GA 2W1OA 5M3MJ 1UZCA 3OIPA 2VBYA 1J0RA 4ABZA 3G1LA 1OCRH 2H1KA 4XLFA 1FZPB 1ON2A 2BHYA 2EZLA 2E1OA 5FROA 4XQFA 4XN3A 3CO6C 4U87A 4FX4A 3JRDA 1DP7P 3QOPA 3LMMA 1YOVB 4LK0F 2Z2SB 3FHNA 3SXYA 2DLLA 4NC6A 1D5YA 3AL0C 1PJRA 4H0EA 2IS1A 2IGKA 1FTZA 3C7JA 4EM1A 2JN6A 2DAOA 1E3OC 3IRQA 4CYCB 1L3LA 2LSOA 1IGNA 1NHAA 4CA0A 3CUQB 4MHGA 4M9SA 3FIWA 3WGHA 3Q9SA 5DCMA 1RPWA 4HLYA 2HYJA 4PJ0C 2NAZA 2JA7J 2VB6A 4RLFA 3K4BA 1XGNA 2EZHA 4UB6C 1T56A 2CUEA 3ZQIA 2BZTA 4ZJZA 1ON1A 4WXCA 2RKHA 2FU4A 1TT5B 3K4NA 5AIQA 2KQRA 4J19A 4WK8F 3DXJF 2QLZA 1ETQA 3HXLA 4XM3A 1MW7A 4AC0A 2IXSA 5GADJ 3S15J 3CF5F 4GCVA 1UFMA 3L2WA 2IEKA 1B1BA 3SEQA 3GFLA 2JUCA 3HL2A 2Q1ZB 5FD6A 2CW0F 3LSTA 1PUFB 2HVSA 1VQ4I 3RYRA 2K85A 5E3NA 1YIJI 2XC7A 4MQVA 2ZJRF 2BEOA 2LDUA 4AVZA 2DDBA 1QHHD 2DFFA 3SFIA 1FYMA 3GBGA 3A2KA 3D0SA 1QNTA 3FZVA 1SANA 3OYNA 1ZYRF 4EJTA 1FBUA 2EIMH 4M6XA 2HQRA 3DPTA 3OIOA 4L9NA 3BCAA 2E7XA 1LEBA 4ZTFA 1R4NB 2IGOA 3OYBA 3HKZA 4IF4A 2TRTA 3R60A 3I0TA 3ABUA 4UUSB 3C2HA 2C6YA 4KIFA 2R93J 2NVXJ 4E7SA 3V8LA 3LAPA 2L0KA 3H0GJ 2JUGA 3N97A 1XDSA 4D7NA 1MD0A 1JE8A 3K69A 4AM3A 1G3YA 4I76A 2I10A 3HPGA 5DM6F 2HPIA 1HSTA 1H9TA 3PO3J 4XKCA 4AIHA 4HNUA 3IH3A 3BC8A 5ICGA 3HOTA 5IT9K 4UY8I 4RGUA 3WTSC 3E7LA 4PJJA 4DW6A 1UELB 2PQ8A 4PFOA 2COMA 3V42A 1LPQA 1FWZA 4KA4A 5B66C 1QZZA 3BR5A 4KN7X 2HOSA 3RCOA 4DJAA 1Z0XA 2QF7A 4KISA 1BR2A 2VJ4A 3EQLF 2NOGA 3KFWX 3WODF 2HQAA 3A0BC 2VONA 2CS3A 2DA7A 3CCMI 1RUOA 3FXUA 4RS8A 2FSWA 2JPCA 2QWWA 2A69F 2FNPA 4RA2A 3VYSB 4UV8A 3F8FA 1T95A 2O6GE 3FK7A 3QPTA 5H6RA 3WE3A 3JRCA 4HV6A 2VJIA 2IS2A 2AXLA 3PO2J 1D0ZA 3FXOA 4IHXA 3HZJA 2M8GX 2VBWA 2M4KA 4D9JA 3SJMA 4FTHA 5F64A 2CQKA 3ASNH 3T8RA 3C2GA 3CCUI 1V5GA 4M9ZA 1IV6A 1F4KA 1VF9A 1S3JA 4KMUX 1MH4A 5LFAA 3KEQA 4ENNA 3E6CC 2W4SA 4ENJA 1ULYA 2EV5A 2V9PA 2IT0A 1XPXA 3EUAA 2DT6A 1R4MB 1S6LA 2COBA 4KDPA 2KMUA 2XAQA 3BR1A 2LYCA 4BAYA 3CCVI 2XIGA 2BBYA 1HXDA 3R0JA 3BJOA 4KIGA 4MTEA 1B72B 1MMSA 3ZQFA 3CC2I 3LQQA 1R7JA 4XIDA 4JBAA 3WGIA 1TW3A 1U3EM 3LWFA 2K4JA 2P0WA 2HNHA 2E1MB 4OU0A 4PGGA 1WKMA 4UV9A 1Z91A 3P7NA 1STZA 1FT9A 1J7KA 2DW4A 4N9IA 3TBIA 1QPMA 2QQBA 3DQVC 4LG0A 2Y0MA 4XLPF 4BE2A 2LC2A 4HSRA 4A3EJ 5ED4A 3CUOA 2PFBA 1PUEE 2F5DA 1TP4A 3KZIC 4HNTA 3E5XA 3H3VK 2FX0A 3TQNA 4P9UA 2VL8A 3DKXA 4LOCA 2JSPA 4C2UA 4IJAA 2R7TA 3K4CA 3CJRB 4OIPF 5HS8A 5EJCA 3MMYB 1AWCA 4RGRA 3F72A 1JI8A 1UJ8A 3T5XA 1FOKA 2EJRA 4BE1A 2M34A 1I50J 3AG4H 1Z1DA 3TDZC 1K7AA 2Y48A 2GOMA 3HHGA 4HQEA 3SDGA 1YJ9I 1PVEA 4Q48A 3CLOA 2E1MC 4A69C 1JKOC 1BI3A 3S2HJ 1FMVA 1RZ4A 2AS5F 5E3MA 3JR9A 2ZMEB 1XGOA 1RETA 2L7FP 4A3KJ 5ILSA 2XGEA 1RUNA 2QQ9A 2L7ZA 3G4SI 3KP7A 3OL4A 1MSFC 4EGZA 1JXSA 1MZBA 2Z3YA 3F3XA 2VQHA 4LLGF 4AU7A 4KIBA 5EZGA 2DMNA 2K9MA 5GAEJ 2FOKA 2OD5A 1TBXA 5M5YJ 2EQRA 3WG7H 1KQ8A 2RREA 1U8RA 2TCTA 4XRMA 2YS9A 1LDDA 3A02A 4EV0A 3QU3A 2QZ8A 3EUKL 3H9GA 5EYRA 3S14J 1XMKA 2HVQA 4DQ2A 3WU1B 1MH3A 1NG6A 2KJBA 3REOA 1ZG5A 4D5CA 2XB5A 2A61A 3G6EI 3TP3A 2KDZA 1BR1A 3K1MA 5HDKA 2DFHA 1XC5A 2KPMA 4IHYA 1EKEA 5JLWA 3GF2A 2OQRA 2L4MA 2K9QA 5JHUA 5FB2A 3S2DJ 3H35A 3K9TA 4F91B 5LGNA 5M3FJ 4Y13A 4BGDA 1XTAA 4MIMA 4MO7A 4XLHA 2DA2A 1T2KA 1BC7C 2ZMEC 3S2WA 2F5EA 3EYIA 5B1AH 4V2FA 3HUGA 3MAJA 2A68F 4P96A 3O2PE 5F1RA 5BOXA 1BA5A 3GFMA 3FWEA 1I5ZA 1O7FA 2OF7A 2E1NA 1ZN2A 2M0MA 2CMPA 2YU3A 4FX0A 3OOUA 2ZXIA 4XRSG 3QPSA 4I0AA 4EVIA 3PNYA 3LAJA 1JKRC 2EWNA 4XKVA 2HU9A 5EEGA 1E17A 4A6DA 2MYSA 4UHTA 1WRJA 2LOOA 2LRDA 1QRYA 5F1JA 1MJAA 3QQAA 5FRMA 2ID6A 4CGZA 2NS7A 5EG0B 2BY2A 4JOMA 3FM3A 3B73A 3OYEA 3JSOA 3RIRA 2VQCA 3GYHX 4J01A 2I8DA 2L02A 3LOCA 4HSTA 3R4KA 3HKZN 3KP2A 3IHUA 5J6XA 1YS7A 5J1UA 4M73A 2GIVA 4S0HB 2HKXA 3I64A 4AIDA 4X1EA 3H5NA 1G4DA 1SMTA 4ASNA 3R61A 4LB6B 4E6KG 1HW5A 4ANJA 2X9DA 4JX6A 1FJLA 2O0YA 2V4JC 5L3CA 1I6XA 4RAFA 4YELA 1ZR2A 3DTIA 4XLCA 1SD7A 4ZYGA 2VE8A 3K1NA 3CP8A 3S3OA 4LIVA 4KT5C 2MLGA 4ZDLA 4GRIA 3OYFA 2Y9YA 4L5IA 3GZ6A 3F8BA 4RGSA 2MC3A 2PEXA 4R1HA 2HEOA 3E3VA 5EZHA 2ELKA 2MD5A 4OIRF 2A5WA 1IN7A 2F5FA 3BQZA 3HOVJ 1ZTRA 1R1UA 3JW4A 2MW8A 3LSKA 1XMXA 4X0GA 2CQ7A 2HS5A 2IA0A 3VYUB 2BHZA 4HF0A 3HRSA 5E20A 4BXUA 3V8JA 1B4AA 4KN4X 4ON0A 1MBHA 3CCSI 1WSUA 3EDPA 3HDDA 3PUBA 3FM5A 2BV6A 3KLOA 3I54A 1S5LC 3BY6A 3NAUA 2GBYA 2RNJA 1Y8QB 2FOWA 3GFJA 2JRMA 5L3DA 1LQ1A 2IVMA 2CRGA 3I71A 4XK4A 4X6AJ 2A6TA 4EEFG 1LNWA 1IF1A 2JJ7A 5HODA 1HOMA 1XSVA 1O3TA 2EK5A 1R1VA 1BI1A 1B8IA 5B1BH 1LDKB 2L54A 5HS9A 1TWFJ 2CV1A 4YFXF 4GXOA 3CDHA 2XPWA 2V1NA 5IYBJ 5FJ8J 1H8AC 3BQYA 2GWRA 4LITA 3FISA 3ASOH 4OMZA 1MBEA 3DU5A 1USTA 2HQNA 4LG0B 4G9YA 4M3BA 1P7JA 5F04A 3WU0A 3SYTA 1Q1VA 3BTIA 3H3ZA 2KP6A 1MBFA 5E1XA 1FYKA 1H0MA 1KU7A 2LF7A 1F5TA 2VC1A 4ZDPA 3WTWC 2R7OA 4DYQA 5EEHA 2HYGD 5J8CA 4BQAA 2G7HA 2JMWA 1PYVA 4JX4A 2EIJH 2W84A 4RLQA 2R5YA 1QO0D 3W2WA 2BY1A 3BWGA 4QSHA 3BP8A 4W1UA 3OR2C 2WTEA 4BHCA 3J7AO 5HS7A 4MEYF 1P6RA 3MD2A 4GO1A 4HX4A 4UUSA 1R22A 3DTEA 4V2GA 2UWMA 2R92J 2K40A 4WXHA 5LBQA 3M8JA 4F55A 3K6GA 5K7ZA 1MMDA 2MBFA 3ZMUA 4IXAA 5ICFA 3RTRA 1S7EA 2AXTC 4AD9A 3S3MA 2PX9A 3ZQGA 5DD4A 1QZYA 3DPLC 5D6FA 3FXJA 1S29A 2Y0SA 4A3LJ 1K83J 1KA8A 2VIXA 5LEKA 4A0ZA 2IS6A 1WJCA 3OS2A 2L01A 2V26A 2HDCA 2NRAC 2R7XA 3KP4A 3EPZA 1SMYF 5FD5A 2O03A 2ZNYA 2ICWG 2QQAA 2ZXWH 4HDUA 2LBFB 2PJPA 4F7ZA 2GZWA 4O5VA 2NVQJ 1SFEA 2NVUB 2LR8A 1B59A 2A5YB 3V7CA 3IKVA 3COAC 1KGSA 2X0LA 1VQKI 4AVPA 3ECOA 1TZLA 4LIUA 3F9KA 4A3MJ 1RR8C 2P7CB 2WC2A 4FT8A 1IN8A 3ZN1A 4A3JJ 3S1MJ 3I59A 2QQ8A 2CQNA 2XDVA 3ZMVA 2K9NA 2Y31A 1E0EA 3F8CA 2P5VA 1IW7F 1XN7A 2ZJ2A 2ESNA 5GAGJ 3CF2A 1A6IA 3LSIA 1B9MA 1DGWY 1Y8RB 4BL0B 2X6XA 4HQMA 1QGPA 4PJNA 3I58A 2BW3A 2DMQA 3BZ6A 1MMNA 3HUGB 1ZKGA 4LMYA 3VFZA 2Y75A 2ZJPF 1DPUA 3PL8A 4DYRA 3ZMTA 3V7SA 4BHPA 4RM2A 1OMIA 1Z3YA 1I39A 2B7EA 2G9WA 3RZDJ 1J59A 3DBHB 1EH7A 3FXKA 4L5JA 1G8XA 4B3AA 4B43A 3BLYA 1B72A 5CVUA 2J5OA 2V1XA 3L00A 1XX5A 1U5TB 4LD5A 4BBRJ 2R4GA 3MVPA 4HEA2 4CZZA 4IEJA 1LE8A 3F6VA 3S1QJ 1HKSA 3OYCA 5K5QA 3W2AA 1RKWA 5F08A 5FKLA 1E3HA 4XL9A 4A3FJ 3HEFA 3IWZA 2LMDA 3ABMH 3DF8A 3WTZA 2DMTA 3RJPA 3BG3A 2PBIA 2EINH 2EZIA 3DEUA 4CCMA 3GXOA 2ZO4A 3BR3A 2R7VA 3GLXA 3WTUC 2CH0A 1T0FC 4HZFA 1EH8A 1VQ5I 1ODDA 3BG9A 2ZXJA 2FJ1A 1P4WA 1MGTA 1LVKA 2QUFA 2LNBA 3K4KA 4IVNA 2FQ3A 3K10A 1SC7A 4ZC3A 4DZPA 3ZQ7A 4L9VA 3A01A 4M3FA 1QVTA 2CFXA 2KIUA 3LA3A 1HKQA 4M3EA 1IN6A 1D8JA 1U5TC 1UG2A 3HYIA 4YIRX 5GTIC 2XGDA 4DYCA 3BCBA 3GTOJ 4FASD 3LFKA 4NUBA 3RKXA 3SQNA 4UVBA 2X51A 4BQOA 3A1YA 2ZSIB 3A4CA 3PQJA 4XSZF 3NEUA 3I4MJ 1EV7A 4FE4A 1EJ9A 4NBQA 4CYDA 1U9OA 2ZMEA 4BS9A 2KHMA 1FNNA 2GA2A 1X19A 3P9CA 1FSHA 4KUMA 2A3SA 4MLOA 1YI2I 2WAFA 1SEUA 2ID3A 2E36A 2RQPA 1N25A 2IW5A 2W24A 1FMWA 4HX7A 3DBLB 1GDTA 3M4OJ 1OFCX 5J1YA 4F3QA 2P5LC 5JVGF 3FKJA 3OSFA 5LD2C 5LEJA 5LRSA 1IAWA 2HTJA 4S05A 3MZYA 5EEAA 1WWXA 4ZYHA 2BVMA 3ZQHA 1ZR4A 3PM1A 3HGGA 3ZQLA 4G6DA 5KK1A 1CGPA 4KITB 3GUDA 1B8IB 1JT6A 2CW8A 3LL7A 4M3GA 4XMYA 1O3RA 2ESHA 3M1EA 4WX9A 2R7UA 3H5AA 2HI3A 3CCJI 1XSDA 2DMPA 2KIFA 2PLYA 3GTGJ 3MKZA 3QYEA 4AWXB 2JTVA 2QVOA 2MSYA 2FBKA 4EMSA 1ETVA 1T39A 3TO6A 5FLXK 4G7ZF 2NNNA 4UUVA 3PSIA 4M9XA 3F8NA 2HDDA 5LLQA 2KL4A 1KU3A 1TWCJ 4G6QA 2VQGA 4AYBN 3GEZA 1BBYA 2R5YB 3GW2A 1NK3P 3SDBA 5CQEA 2IAIA 4CDGA 3MFKA 4A3IJ 1IRFA 2V1DA 4C3JJ 2DA1A 2V6EA 3E6MA 3IH2A 4KJZA 1HDDC 3GCMA 1B6AA 4EJWA 2E35A 4UXNA 3W6KB 5F0HA 3KZZA 3O8GA 1FP1D 4XSXF 4OWRB 5FLVA 5HLHA 3KLNA 4AIJA 2BXYA 2EBIA 5EG0A 4BJTA 3A0HC 1LFUP 1MDMB 4MGRA 4NQWB 1TLHB 3IKTA 4ETSA 5FLXZ 1KU2A 2WBMA 5DM7F 1V55H 3ZMSA 4V19K 2L3DA 4CCJA 3WTYC 1U2WA 3JAMK 1GXPA 4BEHA 4JK1X 5TJJA 1WJAA 4BJ6C 2GAUA 2R5ZA 2XPUA 1YLFA 2K4BA 2XAUA 2EFOA 4B1RA 3TDUC 1H89C 3GTPJ 5BNGA 1VQ7I 2ZFUA 4CH7A 4D7MA 2EV0A 3I3LA 2Y0SN 3CMYA 1J5YA 2D1VA 4HAMA 3QRFF 3I59B 4BBSJ 1SFKA 3H5RA 3CDLA 2I5UA 3TGNA 2ZXHA 4DZJA 2WB1A 1G59A 2NVYJ 5IT9Z 5DEQA 3ZMDA 1YYVA 2F2EA 3OL3A 3VB2A 1Y56A 3HSFA 1WFXA 2D2WA 4RMNA 4HDVA 4HF1A 4M71A 4EM2A 3O6BB 1S9HA 1ZG1A 2BW3B 3H1CA 2R7QA 1J09A 1DP3A 2VE9A 1G3WA 4G7HF 1K61A 2GXBA 2DA6A 5LHHA 2VPLA 4UVAA 2FBHA 1YX3A 1JT0A 5AIPA 4YIIA 4LG3A 1YS6A 2H27A 1ZRCA 1Y6IA 2DA3A 5IOYA 3BOQA 4IHWA 1WJDA 3GO5A 3FDYA 4NDLA 5J47A 2M30A 3FF5A 3BR2A 3HBLA 4E70A 3L1PA 1LE8B 2O9LA 3S17J 3ABTA 1X1BA 2L5QA 1HCRA 3GFIA 4U0VA 3M9AA 2O3FA 4E4HA 5LHIA 2JVHA 4XRSA 1O7LA 4I6ZA 6PAXA 2F48A 2LFBA 3TKYA 4M6VA 5F0FA 1ETOA 4XONA 4P1WA 1D0XA 4OIOF 1MMAA 2G7UA 2W00A 5H6QA 1KYZA 1D1BA 2DODA 3K7AJ 4JX5A 1P4XA 2FNAA 2HYFA 1ZHFA 5CLSA 1FTTA 1R49A 3HOZJ 2G0EA 4CHUA 4ZTJA 2OCCH 2A6EF 1WH5A 3OSGA 2R3SA 4KT6A 3ZQCA 1UCRA 4LGWA 5CVRA 3DLAA 5ERIA 1RIOH 3DCFA 2BYVE 5E3LA 5CPRB 3MN2A 3CMEI 2QKMB 1K4SA 2Y2ZA 4HF2A 3S16J 3ZMZA 2DOFA 3VPRA 2PJRB 4B4CA 1MJ9A 1WGXA 3A01B 4LLNA 5JVTA 2VLAA 4A12A 1HA8A 3EYYA 2OTLI 4Z6YA 2DFEA 4CCLA 2P7VB 4MFEA 3E6BA 1IV8A 1K78B 4OAYA 2DCEA 1FP2A 3FBNB 3MKLA 1JKPC 4WWCA 3OS0A 2KIMA 2H09A 3HIFA 2X4HA 4ITVA 1WPKA 1AU7A 1BJZA 5D5XB 4EGYA 3OYKA 5BPIA 3IAM2 2B9SA 2LD5A 4A2UA 3KETA 3IL2A 2XKOA 2ZC2A 5HLTA 2B0LA 3EETA 4A3CJ 5KHDA 3K4LA 3KEOA 2QBYA 3HM5A 4CUGA 1WCMJ 2VI6A 4U7DA 2VJJA 4YRVA 4RM3A 1EA3A 3HRUA 5TGTA 1SVLA 3CP2A 3G2BA 2LBFA 2ZNZA 3SZTA 3JRHA 1O57A 1RRJA 3OYLA 4EATA 3CJQB 1QBJA 1O4XA 4PSWA 5GTHC 5L3GA 4L0YB 5EF6A 2XAGA 5FKNA 4BNCA 2MABA 3OV8A 3E5UA 4QWQA 1SAXA 2MC4A 3MKYB 3FX3A 5FLMJ 1H9GA 4AIKA 1MBGA 4C30A 4ZYEA 1K6OA 2PMZA 2E1CA 1ZGAA 1Y1WJ 3BROA 4BDZA 2F6CA 3LSGA 4CSWA 4YIFA 2LVSA 1EF4A 2GXGA 3VODA 4WCGA 2EZKA 3DWLE 4KNYA 3GTLJ 1OCPA 2M9HA 3L9FA 3OMYA 2EA2A 4FQGA 2P6SA 3DU6A 2E71A 3I4PA 4C3HJ 5IY5H 2AO9A 2F5CA 1T0FA 1ZREA 2VXDA 4XLNF 3F21A 1T33A 4KFCA 1QVUA 3J7AY 2QM3A 3E5QA 1JJ6C 5FRNA 3U1KA 4I2OA 3PFIA 2HPMA 5CYVA 1A35A 2IA2A 2M1BA 4BJ5C 3FMRA 5FKOA 1V5FA 2ZCWA 4U0WA 1OQYA 1DGRM 4IRIA 1U5TA 3SHFA 3OY9A 3CQZJ 5HDGA 4Y17A 4Y52J 3S8PA 2E34A 1YRNB 3CC7I 2F4IA 2VBZA 1IJWC 2F5VA 1XDUA 1X3UA 3TW7A 1Z67A 4CICA 3BTLA 2JZYA 3U21A 3BZKA 4QIWN 2CFOA 2Q8KA 2ECCA 1IG7A 3GWZA 2FQ4A 1N75A 3RKQA 2KT0A 4KYWA 1N77A 2GXAA 4IX7A 3JTHA 5CKTA 4HPQA 4IHVA 3VYTB 4IQ4A 2DT7B 4NHJA 1HBXG 3WE2A 2A6HF 4BEHB 2VKEA 1IXRC 1E3PA 4A5MA 1RC9A 4BE0A 2ME6A 2R5ZB 3HTSB 2XAHA 5DD8A 4AUXA 2CYYA 2DTRA 5J1RA 4Y3OA 1MBKA 2EH3A 1N78A 3L2UA 4XR6A 3ULQB 1P7IA 2DBBA 3MCZA 2HR3A 1D0YA 1V4RA 2XUBA 3RSNA 2AHQA 1GV2A 1WJ5A 4XORA 3HOSA 3ROUA 3V4GA 1HLVA 5FFXA 3BTJA 1BOBA 4HNVA 2VXZA 3PNVA 3S1NJ 1BIAA 5CVJA 3L2RA 2MG4A 3U2RA 1HDPA 1UG0A 3TOAA 1IXCA 3CLQA 1UHMA 3O8HA 1FSEA 5BS6A 2V9VA 3ERED 2W57A 1LEAA 1WVRA 2CUFA 2QGUA 3E1SA 5LGUA 4O6JA 1JTYA 3TO9A 2MFZA 1TWAJ 2OA4A 4W97A 5TISC 1A31A 2DOEA 4BH9A 3A03A 2Y9ZA 4A93J 2KKOA 4XBFA 1J9IA 3LSMA 3S32A 3H92A 2DTZA 2VBXA 2XAFA 2Q0OA 3WTXC 1VQLI 1R5ID 3TW6A 3KE2A 5GAHJ 3Q9VA 1EH6A 2H6CA 3HB9A 4Y15A 3DFGA 1G3TA 2CW7A 2WB1N 5C4XJ 2EB7A 1I6HJ 1FEXA 4Q47A 3L2QA 4U7BA 4HA8A 3HOXJ 4E7IA 4ESJA 3L2VA 2RV8A 4GYGA 3M8EA 5F6FA 3F22A 3U9GA 3MWMA 3HTUA 2M3AA 2ZSHB 3G71I 1TWHJ 1SD4A 4CCNA 1OCTC 3JRAA 1OKRA 2CGPA 2UXXA 1A04A 4HOBA 1WZ2A 2YSRA 4RBOA 5KVRA 2OC6A 1AKHB 3U1DA 1ZELA 1MNMC 3F6OA 1DU6A 2TDXA 2K3FA 1IZ1A 5DCFA 1VQ6I 2MA3A 3TO7A 3J80K 1YO5C 3C1DA 2CV0A 3B02A 1HW2A 1T38A 3QYBA 1ZH5A 3BG5A 4QLCU 3F0CA 2WAQA 5BMZA 1W5CC 2M4GA 3LNQA 1K6YA 4ENMA 2H8RA 1SVMA 4DIQA 3FMSA 1Z05A 4XICA 2ACJA 2K02A 3IRRA 1K4TA 1R00A 1XSXA 3RPQA 3GTKJ 2VUMJ 3BTCA 1TNSA 3VOEA 4M6YA 1NTCA 1ZK8A 2XHKA 2AQEA 5DUKA 4BQQA 4JYKA 2OU2A 3HJEA 4IRHA 4BUPA 2RVCA 5D8KB 1VI0A 3M8FA 4G7OF 3ESWB 5L3FA 3GTJJ 2PMUA 3BJ6A 2W7NA 1YW9A 2XGXA 1ZRFA 2O8KA 2X1EA 2HXOA 2LLKA 4K2EA 1IUYA 3IV5A 1MDMA 3QP5A 3QPLA 4NQWA 2KLOA 3BJAA 2ADUA 1Z7UA 3HG9A 1K79A 1NK2P 2XPVA 3ONQA 1NG7A 2K86A 1R5HA 3LQRA 3M7GA 3PQKA 1G6NA 4XOTA 4IPAA 4L0ZB 1P92A 1U9NA 2QBYB 4CZCA 3NRVA 2M8EA 2OUMA 3MQ0A 1R71A 5FKKA 2E19A 2L2OA 5K5RA 2NYXA 1T08B 2VN2A 3GTQJ 1SAUA 3RPUD 2E2JJ 2OZUA 2HKOA 5DUIA 1R58A 2D5VA 2IJLA 2P5KA 5CJ9A 4RAYA 2HGCA 3D5SC 4MFDA 4RAZA 2VJ5A 2VOOA 5FO5A 1X58A 3ELKA 2QENA 3RPUA 2DXIA 2GM4A 2DOAA 2UXNA 1V3FA 9ANTA 1R36A 3LSRA 5C4JJ 1R23A 1ACIA 2CUZA 3VSKA 3ZPLA 2VODA 5GP9A 2X48A 1I27A 1VQ8I 2HZDA 1XCVA 3CMAI 1A6QA 2R7FA 5BQTA 1OJLA 2FMYA 1YJWI 3S1RJ 2VKDA 5GPCA 3DLLF 5M5WJ 1TW2A 2ME0A 3AG1H 2KISA 2DDAA 1M1EB 2DT5A 1ZRDA 1B9NA 3RYPA 1FLIA 5LGTA 2IGNA 2Q2EB 2MH9A 1NH3A 1OYYA 3UNGC 2CJJA 3CO7C 3CCEI 1DQUA 2PMZN 2R7RA 4G8XA 2VASA 3H36A 3AKZA 4N4OB 4E7ZA 1KQ0A 1VQNI 1ETKA 1JUPA 1FOWA 1TT0A 3FHZA 3OIQA 5ICCA 1JKQC 4LLLA 2QSFX 2XSJC 4B48A 3KEYA 2E5NA 4HRIA 5IP7J 4OAZA 2KRFA 5E3OA 4Y33A 3TMOA 1X2NA 2WV1A 4Y7NJ 4WF2A 2DPUA 2BVLA 2UUZA 4CO8A 3PIPF 1U6GA 1DDNA 2DN0A 4N0BA 2FXAA 4U0YA 1PP8F 1Z6TA 4C3IJ 4UVCA 1C0WA 2M7BA 1SFUA 1MJBA 1F36A 3OYMA 3IUOA 1V54H 1ZLJA 2XAJA 2WAEA 1FBSA 5CVVA 2ELHA 3S93A 5AONA 2YX4A 1MIJA 3TOBA 2CQQA 2HTSA 3GLLA 1GUUA 5HLIA 1RR7A 2LF8A 3DEWA 1BM9A 2GQQA 2V7FA 2W25A 2PJRA 2BGCA 4DOZA 1YQAA 4Y4RA 1FBQA 4RGXA 1IDZA 2HFHA 3H3UA 3DEEA 4A3DJ 3CC4I 3BDDA 4OMYA 2XKPA 1K78A 1IXSB 2EV6A 3CJNA 3JRBA 4EJOA 3GX4X 1BN5A 4PZJA 4EM0B 4DNCA 5ICEA 1OYIA 1YG2A 1YX5A 3CESA 4Q5SF 2A05A 2OJED 1V5EA 2EFWA 1LKXA 3K2ZA 2QSHX 2JRTA 1XMAA 5HNHA 3H9JA 1UAAA 3SFZA 2YX7A 4BDYA 1XD7A 1A5JA 3QODA 3JSPA 1Y39A 2CSOA 2EFQA 1WJBA 2KRHA 2EILH 4KICA 1RESA 3PIOF 1W0UA 1APLC 2CQXA 3ABKH 1LFPA 2OZ6A 2R7ZJ 3NARA 3SEZA 2H94A 5L3EA 1TWGJ 2QEXI 1JTXA 2JVGA 5C3EJ 3KCCA 3E6DA 2RQQA 2JA6J 3ML6A 3VDXA 1UHSA 5HOOA 4I09A 2P81A 3ZOBA 3WTTC 3QYFA 1AHDP 5D6EA 4XN0A 4FISA 2CUJA 1IC8A 1REPC 2KFDA 3I5UA 1I3AA 1RKTA 3K0LA 5E18F 2HZTA 3JREA 2DYRH 2CWEA 1IDYA 4BXFA 3ERMA 2Z33A 5D5WB 2LY9A 1ETXA 4I99C 4WXDA 3DP7A 4IO9F 1H88C 1D1AA 2OCEA 2PI0A 1BR4A 4UNOA 3V7RA 2QYOA 2DJNA 5D8LB 4B8XA 2K9SA 4PJMA 2RN7A 4BY7J 2X6YA 3H0DA 1VQOI 3JRGA 3IP4B 2KZVA 2L7KA 3FXLA 4II3A 3FXMA 1W7PB 1W36C 1ITYA 3Q5FA 4PK4A 1O3QA 2DMUA 1WI3A 4FCYA 4HG2A 5B3SH 1JJ8C 4IKFA 2E5ZA 3CUQC 1LFBA 2A07F 1R9TJ 1ORKA 5C44J 2DPDA 1DPRA 4XLEA 2ZBKA 1YRNA 2VT3A 4OIQF 1LVAA 2WAQN 3F8MA 4I0BA 2JA8J 3Q0VA 3C3WA 3K4JA 1JGGA 1U78A 3VEPA 4C2TA 1J2XA 1X4OA 2OQGA 1FX7A 3DBRB 3VSLA 3HOWJ 3AG2H 1XS9A 2IS4A 4EJVA 2L9VA 3QAHA 3ZRGA 5ILUA 2LKXA 4F52A 3PUFA 3TEDA 2V9KA 3KYDB 3FXRA 2FEZA 2VPRA 2WWYA 1MMGA 3WG9A 3BR0A 3W6VA 5J4VA 5CQGA 1RI7A 2LY2A 3OYHA 3KZYA 2F4MB 3HRMA 3KP3A 2LH9A 1VNDA 4ZH4F 5LHGA 5J40A 4ESBA 2M45A 4PDKA 4B47A 3CTAA 1GLNA 3HSEA 3IAS2 1R6RA 5A2QK 2IGMA 1SFXA 1XGMA 2OBPA 3K1PA 2MH2A 2IP2A 2RAEA 3QWLA 3IH4A 1XB4A 4A0XA 1TQPA 2BY3A 2FMLA 2IRFG 1IRZA 2STWA 2NS0A 2XF5A 3GZ5A 4NC7A 4RDUA 3OS1A 4PUSA 5IOZA 3AFHA 3JCUC 1OPCA 1W4MA 1SFOJ 2RC4A 5GPAA 2YUSA 4UB8C 3HHHA 4RB0A 3BR6A 1P9QC 2KDOA 1SD5A 2FD5A 2ISYA 3JAMZ 1IRGA 4CCKA 4B3XA 4PCQA 1S8NA 1DU0A 4BACA 5IYCJ 2BOLA 1IO2A 3RKWA 1VQ9I 5IYDJ 5EGOB 4Q4ZF 2XROA 2KRCA 4XNFA 1P2FA 4JQFA 1ZGJA 1ONVA 2LTPA 2V6CA 3W3CA 1XCBA 1VFCA 1HF0A 3CCYA 5A2QZ 4HV5A 1S72I 4OOIA 2OV7A 3PSFA 1OR7C 2DK8A 3S3NA 1WJFA 2J5PA 3EUHC 4C9YA 1CF7A 2CG4A 3RDIA 1LJ9A 1X4PA 3L7WA 2P4WA 1QQIA 1LB2A 5D4SA 4RB3C 3LSPA 2OPTA 4I98B 5DS9A 3GVAA 1AKHA 3B6AA 3N4MA 2E7WA 2HOAA 4EQQA 1KONA 5JR3A 1BI2A 3JRFA 1QZEA 1TC3C 5TRDA 4KMFA 3OYGA 2CV2A 4P55A 3ZN0A 5D4RA 2X1CA 3BPVA 4BXXJ 1HC8A 2R7SA 2FE3A 2D1HA 2ISZA 4S04A 4I7HA 3FBIB 2HQ5A 1ETWA 1HSJA 3MEXA 4LB5A 1YW7A 3JRIA 2R7WA 2VQLA 1OISA 5K5OA 3PFYA 3CZ6A 3T1BA 3ZGKA 3FK6A 3OWTA 1VTNC 3GZNB 3G3ZA 4G12A 4FETA 4QPOA 3ZR8X 1T98A 4ZZLA 2FA5A 4J00A 1A36A 2QKLB 5K1YA 1F43A 1JUSA 2VT2A 5EDNA 2X1DA 2OTJI 5JFRA 1MKMA 3O3KA 2L7MP 1KYWA 1AOYA 1OCOH 4QPQA 3QPHA 2FF4A 3D5RC 5FGMA 5DYMA 4CXFA 1IUFA 4MTDA 2GA1A 2XF6A 2XB0X 4HBLA 1MNDA 2W85A 4ENKA 2PN6A 4LFUA 3K70C 5E1ZB 3L2CA 1I1SA 4IOAF 2MLKA 3CDIA 2LG4A 2ECBA 4LJZF 4DBQA 1OYWA 4YG2F 3CCLI 1YE9A 2PMHA 2DA4A 3FXQA 2DA5A 5CVIA 3IWFA 4TV7A 3ZCOA 4IZZA 3MZHA 1Z77A 3N05A 5JI6A 2F4OB 2L9RA 4PGHA 2VC0A 2IBDA 2Y69H 4RB1A 2DFIA 3L09A 4BU2A 4E7HA 4IQJA 3DKWA 5DCMB 5IP9J 1GVJA 3WTVC 3R6SA 3V8KA 3X2QH 1BIBA 4R8HA 1CQTA 1Z3XA 2L9NA 4BKXA 1MSEC 5B5EC 2W48A 1LUJB 1ZLKA 1ZGWA 2X85A 2O8XA 2LKSA 2NXNB 3F23A 3J7ZI 4QTRA 1OCZH 2UV1A 4JP0A 3RQ4A 5HVQC 1IN4A 3HSRA 3WHCA 4O3MA 2EPFA 2RGVA 5F27A 1BJAA 2KJCA 4II2A 3KYLA 4YEJA 3J7YJ 4IRGA 2WA0A 4PSXA 2Q2EA 3CCQI 1FYLA 4Z2YA 5M5XJ 1MBJA 3HRTA 4YFNF 4FHTA 4E7KA 1OCCH 1Z9CA 1DUXC 4ZDOA 1PDNC 4IL6C 2HOEA 2V79A 3ABLH 4NB5A 3CD6I 2DQRA 1ERDA 1W5TA 2H1LA 5JLXA 2X6WA 5HDNA 2AQFA 3K4MA 4MNUA 4XKBA 4R79A 2XRNA 1P4AA 1D5VA 5D5UB 3J81K 2K9LA 2DO7A 4EJUA 1X3WB 1L0OC 4M3DA 3Q0WA 3T0YA 1Q1HA 2XV4S 1G3SA 2ZB9A 2YPRA 3SZGA 3KP5A 4DGWB 2HWVA 1HW1A 1R1TA 3FMQA 3CMMA 3HOYJ 1Y0NA 5J8FA 4I02A 2OAZA 4L9TA 3RKYA 1JHFA 1ENHA 3KYCB 4CCOA 4ZYAA 1I1GA 1W1WE 4OINF 3DTKA 2L4AA 1WH7A 3D1NI 1BOAA 3IC7A 4D5FA 4RB2C 2LKPA 3I53A 4XOPA 3LSHA 1X1CA 2P6TA 1KZHA 4N9HA 4GFBA 4N4NB 5E79C 4P5OA 3OYJA 2GLOA 5KNLA 2Y30A 3I56I 1S7OA 3LSJA 2JA2A 3G73A 4GDFA 3GTMJ 1GV5A 2JK3A 2VKVA 2M5WA 1YJNI 3J81Z 2ZFWA 1Z6RA 1X3ZB 4E7LA 1QA6A 5DV5A 2M87A 3W6JB 2DU9A 2Z16A 4D1QA 2WV0A 2O61A 3ISPA 3JTGA 1XGSA 4XRFA 2DQLA 4BQNA 4A0YA 1KQ9A 3P5JA 3OYAA 1QHGA 3PJRA 1G2HA 5KAFC 4MEXF 1YITI 3LA7A 3KPHA 1VQMI 1AA7A 1W36D 1BW6A 1D3YA 1X2MA 2IA1A 2B63J 2VKHA 3BZCA 3ECHA 2NS8A 4NC8A 4B09A 3KP6A 4CYCA 5LRRA 1UMQA 2STTA 4BY1J 4UUTA 2X6OA 2ZKZA 2LY1A 3DPUA 1ZQ3P 2R7DA 1TL8A 3CUQA 2HVRA 2KIQA 5K7HA 2ETHA 2BE5F 2FBIA 5D5VB 1WJEA 2FUG2 3NQOA 1CF7B 4DBRA 3HPHA 3LFUA 5F0CA 2CO5A 3W2VA 1X1PA 2ELJA 1QU3A 2EFPA 2NOJB 4XKWA 1YHQI 3KX2A 2EFNA 2QA4I 4A3GJ 2MGQA 3D5LA 1F9NA 2LP0A 3I4NJ 2LREA 3C2BA 3C18A 4YFKF 2R0QC 1O3SA 5FFZA 2E2IJ 1MNEA 3ZQQA 1KU9A 1QPIA 3CJTB 4HLXA 4HX8A 1GHCA 4HYEA 2DJIA 3RI4A 1JUMA 4ZZDA 1POGA 3P9IA 4IHTA 4AYBA 4G94A 1JGSA 5KAIC 4ZYDA 1D8KA 1W7PD 4L18B 1BI0A 5J3LA 1GXQA 5FKMA 1BL0A 1USSA 3TL4X 2Z5UA 4E7JA 1UHWA 1PUFA 3OR1C 5BPDA 3WGGA 1HKTA 1W7PA 2CU7A 2Z1DA 1F1ZA 3UR3C 1SVOA 4A5NA 4P9FA 2Z99A 3I55I 3KIOA 4U88A 1YIOA 4F92B 2ZJQF 3ZP5A 3SZPA 1I3QJ 2BXZA 1WQ2A 2MD0A 3TP0A 3P9KA 1RNLA 2YR2A 3RZOJ 1IN5A 3I9V2 3UKGA 5E8IA 3AAFA 1E2XA 2YU9J 1LDJA 1WI9A 2JA5J 5H2FC 4I01A 1XG1A 4GYIA 4FE7A 3J80Z 4GGGA 4BYYA 1ZAOA 3CCRI 2WY8Q 5J4YA 1OLTA 2FRHA 2IPQX 4ESFA 4M74A 4G6TB 2WY7Q 1FOXA 2RNGA 3NWTA 3BPXA 3FKIJ 2O5RA 1TTYA 2XGCA 1D1CA 2DYSH 2NNYA 2QSGX 2L9SA 2XSDC 4A3BJ 5E17F 2NVTJ 4HW0A 3AG3H 3G1OA 2M0CA 5IT3A 3OYDA 2JQ7A 1WHUA 3OOPA 2K3PA 2E60A 2XASA 1VZ0A 2K27A 1YTYA 1OR7A 1ZG3A 1ZARA 3EUHA 1J75A 1JHHA 2XRLA 1ETYA 3ZXSA 4IHSA 3HC7A 4LK1F 3T8TA 3MKWB 1IRXA 3WHBA 1Z21A 2BY0A 5KCMA 3QU6A 3QP6A 1S7AA 3WU2C 2JWTA 5HLGA 3QOEA 1T8IA 2M2EA 1YW8A 1FOYA 3H9QA 1VQPI 4PJLA 1TQIA 2P8TA 2K5CA 2K7LA 3M3YJ 4A6EA 5K7FA 2HXIA 4NNJA 5L3BA 3E97A 1FY7A 4PFPA 1Z7LA 2DI3A 2UZKA 5JHFA 5IPAA 1Y0UA 5DTDA 3E0JB 3MZ8A 4XLAA 2GIZA 1X1AA 1R5GA 4MQ9F 2JSCA 2XF7A 2H8WA 3M1CA 2DK5A 4C2MJ
chains in the Genus database with same CATH topology
1Y0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0N A; 
#chains in the Genus database with same CATH topology
 5EGO A;  2QCO A;  2LK2 A;  2EA4 A;  3Q3S A;  5E8G A;  3B6C A;  1FC3 A;  1W5S A;  2GOX B;  4IOC F;  2Z9O A;  3VYR B;  4L5E A;  5HNF A;  1T6S A;  3LA2 A;  2EIK H;  2HOT A;  3K2A A;  2D45 A;  5E1W A;  3BG6 A;  3Q0U A;  2KZG A;  2W82 A;  1HQC A;  3GME A;  1TNT A;  4B44 A;  2JT1 A;  1TQM A;  2JPB A;  2VOP A;  1BW5 A;  3R0A A;  3BG7 A;  2RDP A;  5IP6 A;  3DKY A;  1U0J A;  1W0T A;  3PNT A;  3K70 D;  3HOU J;  2H6B A;  4M72 A;  2V1U A;  3DV8 A;  4BHB A;  2WAD A;  2M7A A;  5DDG A;  3AL0 B;  3M07 A;  2HDW A;  3HGY A;  1GT0 C;  2E2H J;  3G1M A;  5H20 A;  1PP7 U;  2O7O A;  4H4K C;  1YFH A;  3BT9 A;  1X1D A;  2PG4 A;  1UB9 A;  3VWB A;  1FIP A;  1SD6 A;  3RQI A;  1Y1V J;  1BC8 C;  2XVC A;  1U8B A;  1FPQ A;  4L9J A;  1GVD A;  3NWS A;  3OYI A;  4RAG A;  4F93 B;  5ILV A;  1FIA A;  4D0P A;  2N8G A;  2W1O A;  5M3M J;  1UZC A;  3OIP A;  2VBY A;  1J0R A;  4ABZ A;  3G1L A;  1OCR H;  2H1K A;  4XLF A;  1FZP B;  1ON2 A;  2BHY A;  2EZL A;  2E1O A;  5FRO A;  4XQF A;  4XN3 A;  3CO6 C;  4U87 A;  4FX4 A;  3JRD A;  1DP7 P;  3QOP A;  3LMM A;  1YOV B;  4LK0 F;  2Z2S B;  3FHN A;  3SXY A;  2DLL A;  4NC6 A;  1D5Y A;  3AL0 C;  1PJR A;  4H0E A;  2IS1 A;  2IGK A;  1FTZ A;  3C7J A;  4EM1 A;  2JN6 A;  2DAO A;  1E3O C;  3IRQ A;  4CYC B;  1L3L A;  2LSO A;  1IGN A;  1NHA A;  4CA0 A;  3CUQ B;  4MHG A;  4M9S A;  3FIW A;  3WGH A;  3Q9S A;  5DCM A;  1RPW A;  4HLY A;  2HYJ A;  4PJ0 C;  2NAZ A;  2JA7 J;  2VB6 A;  4RLF A;  3K4B A;  1XGN A;  2EZH A;  4UB6 C;  1T56 A;  2CUE A;  3ZQI A;  2BZT A;  4ZJZ A;  1ON1 A;  4WXC A;  2RKH A;  2FU4 A;  1TT5 B;  3K4N A;  5AIQ A;  2KQR A;  4J19 A;  4WK8 F;  3DXJ F;  2QLZ A;  1ETQ A;  3HXL A;  4XM3 A;  1MW7 A;  4AC0 A;  2IXS A;  5GAD J;  3S15 J;  3CF5 F;  4GCV A;  1UFM A;  3L2W A;  2IEK A;  1B1B A;  3SEQ A;  3GFL A;  2JUC A;  3HL2 A;  2Q1Z B;  5FD6 A;  2CW0 F;  3LST A;  1PUF B;  2HVS A;  1VQ4 I;  3RYR A;  2K85 A;  5E3N A;  1YIJ I;  2XC7 A;  4MQV A;  2ZJR F;  2BEO A;  2LDU A;  4AVZ A;  2DDB A;  1QHH D;  2DFF A;  3SFI A;  1FYM A;  3GBG A;  3A2K A;  3D0S A;  1QNT A;  3FZV A;  1SAN A;  3OYN A;  1ZYR F;  4EJT A;  1FBU A;  2EIM H;  4M6X A;  2HQR A;  3DPT A;  3OIO A;  4L9N A;  3BCA A;  2E7X A;  1LEB A;  4ZTF A;  1R4N B;  2IGO A;  3OYB A;  3HKZ A;  4IF4 A;  2TRT A;  3R60 A;  3I0T A;  3ABU A;  4UUS B;  3C2H A;  2C6Y A;  4KIF A;  2R93 J;  2NVX J;  4E7S A;  3V8L A;  3LAP A;  2L0K A;  3H0G J;  2JUG A;  3N97 A;  1XDS A;  4D7N A;  1MD0 A;  1JE8 A;  3K69 A;  4AM3 A;  1G3Y A;  4I76 A;  2I10 A;  3HPG A;  5DM6 F;  2HPI A;  1HST A;  1H9T A;  3PO3 J;  4XKC A;  4AIH A;  4HNU A;  3IH3 A;  3BC8 A;  5ICG A;  3HOT A;  5IT9 K;  4UY8 I;  4RGU A;  3WTS C;  3E7L A;  4PJJ A;  4DW6 A;  1UEL B;  2PQ8 A;  4PFO A;  2COM A;  3V42 A;  1LPQ A;  1FWZ A;  4KA4 A;  5B66 C;  1QZZ A;  3BR5 A;  4KN7 X;  2HOS A;  3RCO A;  4DJA A;  1Z0X A;  2QF7 A;  4KIS A;  1BR2 A;  2VJ4 A;  3EQL F;  2NOG A;  3KFW X;  3WOD F;  2HQA A;  3A0B C;  2VON A;  2CS3 A;  2DA7 A;  3CCM I;  1RUO A;  3FXU A;  4RS8 A;  2FSW A;  2JPC A;  2QWW A;  2A69 F;  2FNP A;  4RA2 A;  3VYS B;  4UV8 A;  3F8F A;  1T95 A;  2O6G E;  3FK7 A;  3QPT A;  5H6R A;  3WE3 A;  3JRC A;  4HV6 A;  2VJI A;  2IS2 A;  2AXL A;  3PO2 J;  1D0Z A;  3FXO A;  4IHX A;  3HZJ A;  2M8G X;  2VBW A;  2M4K A;  4D9J A;  3SJM A;  4FTH A;  5F64 A;  2CQK A;  3ASN H;  3T8R A;  3C2G A;  3CCU I;  1V5G A;  4M9Z A;  1IV6 A;  1F4K A;  1VF9 A;  1S3J A;  4KMU X;  1MH4 A;  5LFA A;  3KEQ A;  4ENN A;  3E6C C;  2W4S A;  4ENJ A;  1ULY A;  2EV5 A;  2V9P A;  2IT0 A;  1XPX A;  3EUA A;  2DT6 A;  1R4M B;  1S6L A;  2COB A;  4KDP A;  2KMU A;  2XAQ A;  3BR1 A;  2LYC A;  4BAY A;  3CCV I;  2XIG A;  2BBY A;  1HXD A;  3R0J A;  3BJO A;  4KIG A;  4MTE A;  1B72 B;  1MMS A;  3ZQF A;  3CC2 I;  3LQQ A;  1R7J A;  4XID A;  4JBA A;  3WGI A;  1TW3 A;  1U3E M;  3LWF A;  2K4J A;  2P0W A;  2HNH A;  2E1M B;  4OU0 A;  4PGG A;  1WKM A;  4UV9 A;  1Z91 A;  3P7N A;  1STZ A;  1FT9 A;  1J7K A;  2DW4 A;  4N9I A;  3TBI A;  1QPM A;  2QQB A;  3DQV C;  4LG0 A;  2Y0M A;  4XLP F;  4BE2 A;  2LC2 A;  4HSR A;  4A3E J;  5ED4 A;  3CUO A;  2PFB A;  1PUE E;  2F5D A;  1TP4 A;  3KZI C;  4HNT A;  3E5X A;  3H3V K;  2FX0 A;  3TQN A;  4P9U A;  2VL8 A;  3DKX A;  4LOC A;  2JSP A;  4C2U A;  4IJA A;  2R7T A;  3K4C A;  3CJR B;  4OIP F;  5HS8 A;  5EJC A;  3MMY B;  1AWC A;  4RGR A;  3F72 A;  1JI8 A;  1UJ8 A;  3T5X A;  1FOK A;  2EJR A;  4BE1 A;  2M34 A;  1I50 J;  3AG4 H;  1Z1D A;  3TDZ C;  1K7A A;  2Y48 A;  2GOM A;  3HHG A;  4HQE A;  3SDG A;  1YJ9 I;  1PVE A;  4Q48 A;  3CLO A;  2E1M C;  4A69 C;  1JKO C;  1BI3 A;  3S2H J;  1FMV A;  1RZ4 A;  2AS5 F;  5E3M A;  3JR9 A;  2ZME B;  1XGO A;  1RET A;  2L7F P;  4A3K J;  5ILS A;  2XGE A;  1RUN A;  2QQ9 A;  2L7Z A;  3G4S I;  3KP7 A;  3OL4 A;  1MSF C;  4EGZ A;  1JXS A;  1MZB A;  2Z3Y A;  3F3X A;  2VQH A;  4LLG F;  4AU7 A;  4KIB A;  5EZG A;  2DMN A;  2K9M A;  5GAE J;  2FOK A;  2OD5 A;  1TBX A;  5M5Y J;  2EQR A;  3WG7 H;  1KQ8 A;  2RRE A;  1U8R A;  2TCT A;  4XRM A;  2YS9 A;  1LDD A;  3A02 A;  4EV0 A;  3QU3 A;  2QZ8 A;  3EUK L;  3H9G A;  5EYR A;  3S14 J;  1XMK A;  2HVQ A;  4DQ2 A;  3WU1 B;  1MH3 A;  1NG6 A;  2KJB A;  3REO A;  1ZG5 A;  4D5C A;  2XB5 A;  2A61 A;  3G6E I;  3TP3 A;  2KDZ A;  1BR1 A;  3K1M A;  5HDK A;  2DFH A;  1XC5 A;  2KPM A;  4IHY A;  1EKE A;  5JLW A;  3GF2 A;  2OQR A;  2L4M A;  2K9Q A;  5JHU A;  5FB2 A;  3S2D J;  3H35 A;  3K9T A;  4F91 B;  5LGN A;  5M3F J;  4Y13 A;  4BGD A;  1XTA A;  4MIM A;  4MO7 A;  4XLH A;  2DA2 A;  1T2K A;  1BC7 C;  2ZME C;  3S2W A;  2F5E A;  3EYI A;  5B1A H;  4V2F A;  3HUG A;  3MAJ A;  2A68 F;  4P96 A;  3O2P E;  5F1R A;  5BOX A;  1BA5 A;  3GFM A;  3FWE A;  1I5Z A;  1O7F A;  2OF7 A;  2E1N A;  1ZN2 A;  2M0M A;  2CMP A;  2YU3 A;  4FX0 A;  3OOU A;  2ZXI A;  4XRS G;  3QPS A;  4I0A A;  4EVI A;  3PNY A;  3LAJ A;  1JKR C;  2EWN A;  4XKV A;  2HU9 A;  5EEG A;  1E17 A;  4A6D A;  2MYS A;  4UHT A;  1WRJ A;  2LOO A;  2LRD A;  1QRY A;  5F1J A;  1MJA A;  3QQA A;  5FRM A;  2ID6 A;  4CGZ A;  2NS7 A;  5EG0 B;  2BY2 A;  4JOM A;  3FM3 A;  3B73 A;  3OYE A;  3JSO A;  3RIR A;  2VQC A;  3GYH X;  4J01 A;  2I8D A;  2L02 A;  3LOC A;  4HST A;  3R4K A;  3HKZ N;  3KP2 A;  3IHU A;  5J6X A;  1YS7 A;  5J1U A;  4M73 A;  2GIV A;  4S0H B;  2HKX A;  3I64 A;  4AID A;  4X1E A;  3H5N A;  1G4D A;  1SMT A;  4ASN A;  3R61 A;  4LB6 B;  4E6K G;  1HW5 A;  4ANJ A;  2X9D A;  4JX6 A;  1FJL A;  2O0Y A;  2V4J C;  5L3C A;  1I6X A;  4RAF A;  4YEL A;  1ZR2 A;  3DTI A;  4XLC A;  1SD7 A;  4ZYG A;  2VE8 A;  3K1N A;  3CP8 A;  3S3O A;  4LIV A;  4KT5 C;  2MLG A;  4ZDL A;  4GRI A;  3OYF A;  2Y9Y A;  4L5I A;  3GZ6 A;  3F8B A;  4RGS A;  2MC3 A;  2PEX A;  4R1H A;  2HEO A;  3E3V A;  5EZH A;  2ELK A;  2MD5 A;  4OIR F;  2A5W A;  1IN7 A;  2F5F A;  3BQZ A;  3HOV J;  1ZTR A;  1R1U A;  3JW4 A;  2MW8 A;  3LSK A;  1XMX A;  4X0G A;  2CQ7 A;  2HS5 A;  2IA0 A;  3VYU B;  2BHZ A;  4HF0 A;  3HRS A;  5E20 A;  4BXU A;  3V8J A;  1B4A A;  4KN4 X;  4ON0 A;  1MBH A;  3CCS I;  1WSU A;  3EDP A;  3HDD A;  3PUB A;  3FM5 A;  2BV6 A;  3KLO A;  3I54 A;  1S5L C;  3BY6 A;  3NAU A;  2GBY A;  2RNJ A;  1Y8Q B;  2FOW A;  3GFJ A;  2JRM A;  5L3D A;  1LQ1 A;  2IVM A;  2CRG A;  3I71 A;  4XK4 A;  4X6A J;  2A6T A;  4EEF G;  1LNW A;  1IF1 A;  2JJ7 A;  5HOD A;  1HOM A;  1XSV A;  1O3T A;  2EK5 A;  1R1V A;  1BI1 A;  1B8I A;  5B1B H;  1LDK B;  2L54 A;  5HS9 A;  1TWF J;  2CV1 A;  4YFX F;  4GXO A;  3CDH A;  2XPW A;  2V1N A;  5IYB J;  5FJ8 J;  1H8A C;  3BQY A;  2GWR A;  4LIT A;  3FIS A;  3ASO H;  4OMZ A;  1MBE A;  3DU5 A;  1UST A;  2HQN A;  4LG0 B;  4G9Y A;  4M3B A;  1P7J A;  5F04 A;  3WU0 A;  3SYT A;  1Q1V A;  3BTI A;  3H3Z A;  2KP6 A;  1MBF A;  5E1X A;  1FYK A;  1H0M A;  1KU7 A;  2LF7 A;  1F5T A;  2VC1 A;  4ZDP A;  3WTW C;  2R7O A;  4DYQ A;  5EEH A;  2HYG D;  5J8C A;  4BQA A;  2G7H A;  2JMW A;  1PYV A;  4JX4 A;  2EIJ H;  2W84 A;  4RLQ A;  2R5Y A;  1QO0 D;  3W2W A;  2BY1 A;  3BWG A;  4QSH A;  3BP8 A;  4W1U A;  3OR2 C;  2WTE A;  4BHC A;  3J7A O;  5HS7 A;  4MEY F;  1P6R A;  3MD2 A;  4GO1 A;  4HX4 A;  4UUS A;  1R22 A;  3DTE A;  4V2G A;  2UWM A;  2R92 J;  2K40 A;  4WXH A;  5LBQ A;  3M8J A;  4F55 A;  3K6G A;  5K7Z A;  1MMD A;  2MBF A;  3ZMU A;  4IXA A;  5ICF A;  3RTR A;  1S7E A;  2AXT C;  4AD9 A;  3S3M A;  2PX9 A;  3ZQG A;  5DD4 A;  1QZY A;  3DPL C;  5D6F A;  3FXJ A;  1S29 A;  2Y0S A;  4A3L J;  1K83 J;  1KA8 A;  2VIX A;  5LEK A;  4A0Z A;  2IS6 A;  1WJC A;  3OS2 A;  2L01 A;  2V26 A;  2HDC A;  2NRA C;  2R7X A;  3KP4 A;  3EPZ A;  1SMY F;  5FD5 A;  2O03 A;  2ZNY A;  2ICW G;  2QQA A;  2ZXW H;  4HDU A;  2LBF B;  2PJP A;  4F7Z A;  2GZW A;  4O5V A;  2NVQ J;  1SFE A;  2NVU B;  2LR8 A;  1B59 A;  2A5Y B;  3V7C A;  3IKV A;  3COA C;  1KGS A;  2X0L A;  1VQK I;  4AVP A;  3ECO A;  1TZL A;  4LIU A;  3F9K A;  4A3M J;  1RR8 C;  2P7C B;  2WC2 A;  4FT8 A;  1IN8 A;  3ZN1 A;  4A3J J;  3S1M J;  3I59 A;  2QQ8 A;  2CQN A;  2XDV A;  3ZMV A;  2K9N A;  2Y31 A;  1E0E A;  3F8C A;  2P5V A;  1IW7 F;  1XN7 A;  2ZJ2 A;  2ESN A;  5GAG J;  3CF2 A;  1A6I A;  3LSI A;  1B9M A;  1DGW Y;  1Y8R B;  4BL0 B;  2X6X A;  4HQM A;  1QGP A;  4PJN A;  3I58 A;  2BW3 A;  2DMQ A;  3BZ6 A;  1MMN A;  3HUG B;  1ZKG A;  4LMY A;  3VFZ A;  2Y75 A;  2ZJP F;  1DPU A;  3PL8 A;  4DYR A;  3ZMT A;  3V7S A;  4BHP A;  4RM2 A;  1OMI A;  1Z3Y A;  1I39 A;  2B7E A;  2G9W A;  3RZD J;  1J59 A;  3DBH B;  1EH7 A;  3FXK A;  4L5J A;  1G8X A;  4B3A A;  4B43 A;  3BLY A;  1B72 A;  5CVU A;  2J5O A;  2V1X A;  3L00 A;  1XX5 A;  1U5T B;  4LD5 A;  4BBR J;  2R4G A;  3MVP A;  4HEA 2;  4CZZ A;  4IEJ A;  1LE8 A;  3F6V A;  3S1Q J;  1HKS A;  3OYC A;  5K5Q A;  3W2A A;  1RKW A;  5F08 A;  5FKL A;  1E3H A;  4XL9 A;  4A3F J;  3HEF A;  3IWZ A;  2LMD A;  3ABM H;  3DF8 A;  3WTZ A;  2DMT A;  3RJP A;  3BG3 A;  2PBI A;  2EIN H;  2EZI A;  3DEU A;  4CCM A;  3GXO A;  2ZO4 A;  3BR3 A;  2R7V A;  3GLX A;  3WTU C;  2CH0 A;  1T0F C;  4HZF A;  1EH8 A;  1VQ5 I;  1ODD A;  3BG9 A;  2ZXJ A;  2FJ1 A;  1P4W A;  1MGT A;  1LVK A;  2QUF A;  2LNB A;  3K4K A;  4IVN A;  2FQ3 A;  3K10 A;  1SC7 A;  4ZC3 A;  4DZP A;  3ZQ7 A;  4L9V A;  3A01 A;  4M3F A;  1QVT A;  2CFX A;  2KIU A;  3LA3 A;  1HKQ A;  4M3E A;  1IN6 A;  1D8J A;  1U5T C;  1UG2 A;  3HYI A;  4YIR X;  5GTI C;  2XGD A;  4DYC A;  3BCB A;  3GTO J;  4FAS D;  3LFK A;  4NUB A;  3RKX A;  3SQN A;  4UVB A;  2X51 A;  4BQO A;  3A1Y A;  2ZSI B;  3A4C A;  3PQJ A;  4XSZ F;  3NEU A;  3I4M J;  1EV7 A;  4FE4 A;  1EJ9 A;  4NBQ A;  4CYD A;  1U9O A;  2ZME A;  4BS9 A;  2KHM A;  1FNN A;  2GA2 A;  1X19 A;  3P9C A;  1FSH A;  4KUM A;  2A3S A;  4MLO A;  1YI2 I;  2WAF A;  1SEU A;  2ID3 A;  2E36 A;  2RQP A;  1N25 A;  2IW5 A;  2W24 A;  1FMW A;  4HX7 A;  3DBL B;  1GDT A;  3M4O J;  1OFC X;  5J1Y A;  4F3Q A;  2P5L C;  5JVG F;  3FKJ A;  3OSF A;  5LD2 C;  5LEJ A;  5LRS A;  1IAW A;  2HTJ A;  4S05 A;  3MZY A;  5EEA A;  1WWX A;  4ZYH A;  2BVM A;  3ZQH A;  1ZR4 A;  3PM1 A;  3HGG A;  3ZQL A;  4G6D A;  5KK1 A;  1CGP A;  4KIT B;  3GUD A;  1B8I B;  1JT6 A;  2CW8 A;  3LL7 A;  4M3G A;  4XMY A;  1O3R A;  2ESH A;  3M1E A;  4WX9 A;  2R7U A;  3H5A A;  2HI3 A;  3CCJ I;  1XSD A;  2DMP A;  2KIF A;  2PLY A;  3GTG J;  3MKZ A;  3QYE A;  4AWX B;  2JTV A;  2QVO A;  2MSY A;  2FBK A;  4EMS A;  1ETV A;  1T39 A;  3TO6 A;  5FLX K;  4G7Z F;  2NNN A;  4UUV A;  3PSI A;  4M9X A;  3F8N A;  2HDD A;  5LLQ A;  2KL4 A;  1KU3 A;  1TWC J;  4G6Q A;  2VQG A;  4AYB N;  3GEZ A;  1BBY A;  2R5Y B;  3GW2 A;  1NK3 P;  3SDB A;  5CQE A;  2IAI A;  4CDG A;  3MFK A;  4A3I J;  1IRF A;  2V1D A;  4C3J J;  2DA1 A;  2V6E A;  3E6M A;  3IH2 A;  4KJZ A;  1HDD C;  3GCM A;  1B6A A;  4EJW A;  2E35 A;  4UXN A;  3W6K B;  5F0H A;  3KZZ A;  3O8G A;  1FP1 D;  4XSX F;  4OWR B;  5FLV A;  5HLH A;  3KLN A;  4AIJ A;  2BXY A;  2EBI A;  5EG0 A;  4BJT A;  3A0H C;  1LFU P;  1MDM B;  4MGR A;  4NQW B;  1TLH B;  3IKT A;  4ETS A;  5FLX Z;  1KU2 A;  2WBM A;  5DM7 F;  1V55 H;  3ZMS A;  4V19 K;  2L3D A;  4CCJ A;  3WTY C;  1U2W A;  3JAM K;  1GXP A;  4BEH A;  4JK1 X;  5TJJ A;  1WJA A;  4BJ6 C;  2GAU A;  2R5Z A;  2XPU A;  1YLF A;  2K4B A;  2XAU A;  2EFO A;  4B1R A;  3TDU C;  1H89 C;  3GTP J;  5BNG A;  1VQ7 I;  2ZFU A;  4CH7 A;  4D7M A;  2EV0 A;  3I3L A;  2Y0S N;  3CMY A;  1J5Y A;  2D1V A;  4HAM A;  3QRF F;  3I59 B;  4BBS J;  1SFK A;  3H5R A;  3CDL A;  2I5U A;  3TGN A;  2ZXH A;  4DZJ A;  2WB1 A;  1G59 A;  2NVY J;  5IT9 Z;  5DEQ A;  3ZMD A;  1YYV A;  2F2E A;  3OL3 A;  3VB2 A;  1Y56 A;  3HSF A;  1WFX A;  2D2W A;  4RMN A;  4HDV A;  4HF1 A;  4M71 A;  4EM2 A;  3O6B B;  1S9H A;  1ZG1 A;  2BW3 B;  3H1C A;  2R7Q A;  1J09 A;  1DP3 A;  2VE9 A;  1G3W A;  4G7H F;  1K61 A;  2GXB A;  2DA6 A;  5LHH A;  2VPL A;  4UVA A;  2FBH A;  1YX3 A;  1JT0 A;  5AIP A;  4YII A;  4LG3 A;  1YS6 A;  2H27 A;  1ZRC A;  1Y6I A;  2DA3 A;  5IOY A;  3BOQ A;  4IHW A;  1WJD A;  3GO5 A;  3FDY A;  4NDL A;  5J47 A;  2M30 A;  3FF5 A;  3BR2 A;  3HBL A;  4E70 A;  3L1P A;  1LE8 B;  2O9L A;  3S17 J;  3ABT A;  1X1B A;  2L5Q A;  1HCR A;  3GFI A;  4U0V A;  3M9A A;  2O3F A;  4E4H A;  5LHI A;  2JVH A;  4XRS A;  1O7L A;  4I6Z A;  6PAX A;  2F48 A;  2LFB A;  3TKY A;  4M6V A;  5F0F A;  1ETO A;  4XON A;  4P1W A;  1D0X A;  4OIO F;  1MMA A;  2G7U A;  2W00 A;  5H6Q A;  1KYZ A;  1D1B A;  2DOD A;  3K7A J;  4JX5 A;  1P4X A;  2FNA A;  2HYF A;  1ZHF A;  5CLS A;  1FTT A;  1R49 A;  3HOZ J;  2G0E A;  4CHU A;  4ZTJ A;  2OCC H;  2A6E F;  1WH5 A;  3OSG A;  2R3S A;  4KT6 A;  3ZQC A;  1UCR A;  4LGW A;  5CVR A;  3DLA A;  5ERI A;  1RIO H;  3DCF A;  2BYV E;  5E3L A;  5CPR B;  3MN2 A;  3CME I;  2QKM B;  1K4S A;  2Y2Z A;  4HF2 A;  3S16 J;  3ZMZ A;  2DOF A;  3VPR A;  2PJR B;  4B4C A;  1MJ9 A;  1WGX A;  3A01 B;  4LLN A;  5JVT A;  2VLA A;  4A12 A;  1HA8 A;  3EYY A;  2OTL I;  4Z6Y A;  2DFE A;  4CCL A;  2P7V B;  4MFE A;  3E6B A;  1IV8 A;  1K78 B;  4OAY A;  2DCE A;  1FP2 A;  3FBN B;  3MKL A;  1JKP C;  4WWC A;  3OS0 A;  2KIM A;  2H09 A;  3HIF A;  2X4H A;  4ITV A;  1WPK A;  1AU7 A;  1BJZ A;  5D5X B;  4EGY A;  3OYK A;  5BPI A;  3IAM 2;  2B9S A;  2LD5 A;  4A2U A;  3KET A;  3IL2 A;  2XKO A;  2ZC2 A;  5HLT A;  2B0L A;  3EET A;  4A3C J;  5KHD A;  3K4L A;  3KEO A;  2QBY A;  3HM5 A;  4CUG A;  1WCM J;  2VI6 A;  4U7D A;  2VJJ A;  4YRV A;  4RM3 A;  1EA3 A;  3HRU A;  5TGT A;  1SVL A;  3CP2 A;  3G2B A;  2LBF A;  2ZNZ A;  3SZT A;  3JRH A;  1O57 A;  1RRJ A;  3OYL A;  4EAT A;  3CJQ B;  1QBJ A;  1O4X A;  4PSW A;  5GTH C;  5L3G A;  4L0Y B;  5EF6 A;  2XAG A;  5FKN A;  4BNC A;  2MAB A;  3OV8 A;  3E5U A;  4QWQ A;  1SAX A;  2MC4 A;  3MKY B;  3FX3 A;  5FLM J;  1H9G A;  4AIK A;  1MBG A;  4C30 A;  4ZYE A;  1K6O A;  2PMZ A;  2E1C A;  1ZGA A;  1Y1W J;  3BRO A;  4BDZ A;  2F6C A;  3LSG A;  4CSW A;  4YIF A;  2LVS A;  1EF4 A;  2GXG A;  3VOD A;  4WCG A;  2EZK A;  3DWL E;  4KNY A;  3GTL J;  1OCP A;  2M9H A;  3L9F A;  3OMY A;  2EA2 A;  4FQG A;  2P6S A;  3DU6 A;  2E71 A;  3I4P A;  4C3H J;  5IY5 H;  2AO9 A;  2F5C A;  1T0F A;  1ZRE A;  2VXD A;  4XLN F;  3F21 A;  1T33 A;  4KFC A;  1QVU A;  3J7A Y;  2QM3 A;  3E5Q A;  1JJ6 C;  5FRN A;  3U1K A;  4I2O A;  3PFI A;  2HPM A;  5CYV A;  1A35 A;  2IA2 A;  2M1B A;  4BJ5 C;  3FMR A;  5FKO A;  1V5F A;  2ZCW A;  4U0W A;  1OQY A;  1DGR M;  4IRI A;  1U5T A;  3SHF A;  3OY9 A;  3CQZ J;  5HDG A;  4Y17 A;  4Y52 J;  3S8P A;  2E34 A;  1YRN B;  3CC7 I;  2F4I A;  2VBZ A;  1IJW C;  2F5V A;  1XDU A;  1X3U A;  3TW7 A;  1Z67 A;  4CIC A;  3BTL A;  2JZY A;  3U21 A;  3BZK A;  4QIW N;  2CFO A;  2Q8K A;  2ECC A;  1IG7 A;  3GWZ A;  2FQ4 A;  1N75 A;  3RKQ A;  2KT0 A;  4KYW A;  1N77 A;  2GXA A;  4IX7 A;  3JTH A;  5CKT A;  4HPQ A;  4IHV A;  3VYT B;  4IQ4 A;  2DT7 B;  4NHJ A;  1HBX G;  3WE2 A;  2A6H F;  4BEH B;  2VKE A;  1IXR C;  1E3P A;  4A5M A;  1RC9 A;  4BE0 A;  2ME6 A;  2R5Z B;  3HTS B;  2XAH A;  5DD8 A;  4AUX A;  2CYY A;  2DTR A;  5J1R A;  4Y3O A;  1MBK A;  2EH3 A;  1N78 A;  3L2U A;  4XR6 A;  3ULQ B;  1P7I A;  2DBB A;  3MCZ A;  2HR3 A;  1D0Y A;  1V4R A;  2XUB A;  3RSN A;  2AHQ A;  1GV2 A;  1WJ5 A;  4XOR A;  3HOS A;  3ROU A;  3V4G A;  1HLV A;  5FFX A;  3BTJ A;  1BOB A;  4HNV A;  2VXZ A;  3PNV A;  3S1N J;  1BIA A;  5CVJ A;  3L2R A;  2MG4 A;  3U2R A;  1HDP A;  1UG0 A;  3TOA A;  1IXC A;  3CLQ A;  1UHM A;  3O8H A;  1FSE A;  5BS6 A;  2V9V A;  3ERE D;  2W57 A;  1LEA A;  1WVR A;  2CUF A;  2QGU A;  3E1S A;  5LGU A;  4O6J A;  1JTY A;  3TO9 A;  2MFZ A;  1TWA J;  2OA4 A;  4W97 A;  5TIS C;  1A31 A;  2DOE A;  4BH9 A;  3A03 A;  2Y9Z A;  4A93 J;  2KKO A;  4XBF A;  1J9I A;  3LSM A;  3S32 A;  3H92 A;  2DTZ A;  2VBX A;  2XAF A;  2Q0O A;  3WTX C;  1VQL I;  1R5I D;  3TW6 A;  3KE2 A;  5GAH J;  3Q9V A;  1EH6 A;  2H6C A;  3HB9 A;  4Y15 A;  3DFG A;  1G3T A;  2CW7 A;  2WB1 N;  5C4X J;  2EB7 A;  1I6H J;  1FEX A;  4Q47 A;  3L2Q A;  4U7B A;  4HA8 A;  3HOX J;  4E7I A;  4ESJ A;  3L2V A;  2RV8 A;  4GYG A;  3M8E A;  5F6F A;  3F22 A;  3U9G A;  3MWM A;  3HTU A;  2M3A A;  2ZSH B;  3G71 I;  1TWH J;  1SD4 A;  4CCN A;  1OCT C;  3JRA A;  1OKR A;  2CGP A;  2UXX A;  1A04 A;  4HOB A;  1WZ2 A;  2YSR A;  4RBO A;  5KVR A;  2OC6 A;  1AKH B;  3U1D A;  1ZEL A;  1MNM C;  3F6O A;  1DU6 A;  2TDX A;  2K3F A;  1IZ1 A;  5DCF A;  1VQ6 I;  2MA3 A;  3TO7 A;  3J80 K;  1YO5 C;  3C1D A;  2CV0 A;  3B02 A;  1HW2 A;  1T38 A;  3QYB A;  1ZH5 A;  3BG5 A;  4QLC U;  3F0C A;  2WAQ A;  5BMZ A;  1W5C C;  2M4G A;  3LNQ A;  1K6Y A;  4ENM A;  2H8R A;  1SVM A;  4DIQ A;  3FMS A;  1Z05 A;  4XIC A;  2ACJ A;  2K02 A;  3IRR A;  1K4T A;  1R00 A;  1XSX A;  3RPQ A;  3GTK J;  2VUM J;  3BTC A;  1TNS A;  3VOE A;  4M6Y A;  1NTC A;  1ZK8 A;  2XHK A;  2AQE A;  5DUK A;  4BQQ A;  4JYK A;  2OU2 A;  3HJE A;  4IRH A;  4BUP A;  2RVC A;  5D8K B;  1VI0 A;  3M8F A;  4G7O F;  3ESW B;  5L3F A;  3GTJ J;  2PMU A;  3BJ6 A;  2W7N A;  1YW9 A;  2XGX A;  1ZRF A;  2O8K A;  2X1E A;  2HXO A;  2LLK A;  4K2E A;  1IUY A;  3IV5 A;  1MDM A;  3QP5 A;  3QPL A;  4NQW A;  2KLO A;  3BJA A;  2ADU A;  1Z7U A;  3HG9 A;  1K79 A;  1NK2 P;  2XPV A;  3ONQ A;  1NG7 A;  2K86 A;  1R5H A;  3LQR A;  3M7G A;  3PQK A;  1G6N A;  4XOT A;  4IPA A;  4L0Z B;  1P92 A;  1U9N A;  2QBY B;  4CZC A;  3NRV A;  2M8E A;  2OUM A;  3MQ0 A;  1R71 A;  5FKK A;  2E19 A;  2L2O A;  5K5R A;  2NYX A;  1T08 B;  2VN2 A;  3GTQ J;  1SAU A;  3RPU D;  2E2J J;  2OZU A;  2HKO A;  5DUI A;  1R58 A;  2D5V A;  2IJL A;  2P5K A;  5CJ9 A;  4RAY A;  2HGC A;  3D5S C;  4MFD A;  4RAZ A;  2VJ5 A;  2VOO A;  5FO5 A;  1X58 A;  3ELK A;  2QEN A;  3RPU A;  2DXI A;  2GM4 A;  2DOA A;  2UXN A;  1V3F A;  9ANT A;  1R36 A;  3LSR A;  5C4J J;  1R23 A;  1ACI A;  2CUZ A;  3VSK A;  3ZPL A;  2VOD A;  5GP9 A;  2X48 A;  1I27 A;  1VQ8 I;  2HZD A;  1XCV A;  3CMA I;  1A6Q A;  2R7F A;  5BQT A;  1OJL A;  2FMY A;  1YJW I;  3S1R J;  2VKD A;  5GPC A;  3DLL F;  5M5W J;  1TW2 A;  2ME0 A;  3AG1 H;  2KIS A;  2DDA A;  1M1E B;  2DT5 A;  1ZRD A;  1B9N A;  3RYP A;  1FLI A;  5LGT A;  2IGN A;  2Q2E B;  2MH9 A;  1NH3 A;  1OYY A;  3UNG C;  2CJJ A;  3CO7 C;  3CCE I;  1DQU A;  2PMZ N;  2R7R A;  4G8X A;  2VAS A;  3H36 A;  3AKZ A;  4N4O B;  4E7Z A;  1KQ0 A;  1VQN I;  1ETK A;  1JUP A;  1FOW A;  1TT0 A;  3FHZ A;  3OIQ A;  5ICC A;  1JKQ C;  4LLL A;  2QSF X;  2XSJ C;  4B48 A;  3KEY A;  2E5N A;  4HRI A;  5IP7 J;  4OAZ A;  2KRF A;  5E3O A;  4Y33 A;  3TMO A;  1X2N A;  2WV1 A;  4Y7N J;  4WF2 A;  2DPU A;  2BVL A;  2UUZ A;  4CO8 A;  3PIP F;  1U6G A;  1DDN A;  2DN0 A;  4N0B A;  2FXA A;  4U0Y A;  1PP8 F;  1Z6T A;  4C3I J;  4UVC A;  1C0W A;  2M7B A;  1SFU A;  1MJB A;  1F36 A;  3OYM A;  3IUO A;  1V54 H;  1ZLJ A;  2XAJ A;  2WAE A;  1FBS A;  5CVV A;  2ELH A;  3S93 A;  5AON A;  2YX4 A;  1MIJ A;  3TOB A;  2CQQ A;  2HTS A;  3GLL A;  1GUU A;  5HLI A;  1RR7 A;  2LF8 A;  3DEW A;  1BM9 A;  2GQQ A;  2V7F A;  2W25 A;  2PJR A;  2BGC A;  4DOZ A;  1YQA A;  4Y4R A;  1FBQ A;  4RGX A;  1IDZ A;  2HFH A;  3H3U A;  3DEE A;  4A3D J;  3CC4 I;  3BDD A;  4OMY A;  2XKP A;  1K78 A;  1IXS B;  2EV6 A;  3CJN A;  3JRB A;  4EJO A;  3GX4 X;  1BN5 A;  4PZJ A;  4EM0 B;  4DNC A;  5ICE A;  1OYI A;  1YG2 A;  1YX5 A;  3CES A;  4Q5S F;  2A05 A;  2OJE D;  1V5E A;  2EFW A;  1LKX A;  3K2Z A;  2QSH X;  2JRT A;  1XMA A;  5HNH A;  3H9J A;  1UAA A;  3SFZ A;  2YX7 A;  4BDY A;  1XD7 A;  1A5J A;  3QOD A;  3JSP A;  1Y39 A;  2CSO A;  2EFQ A;  1WJB A;  2KRH A;  2EIL H;  4KIC A;  1RES A;  3PIO F;  1W0U A;  1APL C;  2CQX A;  3ABK H;  1LFP A;  2OZ6 A;  2R7Z J;  3NAR A;  3SEZ A;  2H94 A;  5L3E A;  1TWG J;  2QEX I;  1JTX A;  2JVG A;  5C3E J;  3KCC A;  3E6D A;  2RQQ A;  2JA6 J;  3ML6 A;  3VDX A;  1UHS A;  5HOO A;  4I09 A;  2P81 A;  3ZOB A;  3WTT C;  3QYF A;  1AHD P;  5D6E A;  4XN0 A;  4FIS A;  2CUJ A;  1IC8 A;  1REP C;  2KFD A;  3I5U A;  1I3A A;  1RKT A;  3K0L A;  5E18 F;  2HZT A;  3JRE A;  2DYR H;  2CWE A;  1IDY A;  4BXF A;  3ERM A;  2Z33 A;  5D5W B;  2LY9 A;  1ETX A;  4I99 C;  4WXD A;  3DP7 A;  4IO9 F;  1H88 C;  1D1A A;  2OCE A;  2PI0 A;  1BR4 A;  4UNO A;  3V7R A;  2QYO A;  2DJN A;  5D8L B;  4B8X A;  2K9S A;  4PJM A;  2RN7 A;  4BY7 J;  2X6Y A;  3H0D A;  1VQO I;  3JRG A;  3IP4 B;  2KZV A;  2L7K A;  3FXL A;  4II3 A;  3FXM A;  1W7P B;  1W36 C;  1ITY A;  3Q5F A;  4PK4 A;  1O3Q A;  2DMU A;  1WI3 A;  4FCY A;  4HG2 A;  5B3S H;  1JJ8 C;  4IKF A;  2E5Z A;  3CUQ C;  1LFB A;  2A07 F;  1R9T J;  1ORK A;  5C44 J;  2DPD A;  1DPR A;  4XLE A;  2ZBK A;  1YRN A;  2VT3 A;  4OIQ F;  1LVA A;  2WAQ N;  3F8M A;  4I0B A;  2JA8 J;  3Q0V A;  3C3W A;  3K4J A;  1JGG A;  1U78 A;  3VEP A;  4C2T A;  1J2X A;  1X4O A;  2OQG A;  1FX7 A;  3DBR B;  3VSL A;  3HOW J;  3AG2 H;  1XS9 A;  2IS4 A;  4EJV A;  2L9V A;  3QAH A;  3ZRG A;  5ILU A;  2LKX A;  4F52 A;  3PUF A;  3TED A;  2V9K A;  3KYD B;  3FXR A;  2FEZ A;  2VPR A;  2WWY A;  1MMG A;  3WG9 A;  3BR0 A;  3W6V A;  5J4V A;  5CQG A;  1RI7 A;  2LY2 A;  3OYH A;  3KZY A;  2F4M B;  3HRM A;  3KP3 A;  2LH9 A;  1VND A;  4ZH4 F;  5LHG A;  5J40 A;  4ESB A;  2M45 A;  4PDK A;  4B47 A;  3CTA A;  1GLN A;  3HSE A;  3IAS 2;  1R6R A;  5A2Q K;  2IGM A;  1SFX A;  1XGM A;  2OBP A;  3K1P A;  2MH2 A;  2IP2 A;  2RAE A;  3QWL A;  3IH4 A;  1XB4 A;  4A0X A;  1TQP A;  2BY3 A;  2FML A;  2IRF G;  1IRZ A;  2STW A;  2NS0 A;  2XF5 A;  3GZ5 A;  4NC7 A;  4RDU A;  3OS1 A;  4PUS A;  5IOZ A;  3AFH A;  3JCU C;  1OPC A;  1W4M A;  1SFO J;  2RC4 A;  5GPA A;  2YUS A;  4UB8 C;  3HHH A;  4RB0 A;  3BR6 A;  1P9Q C;  2KDO A;  1SD5 A;  2FD5 A;  2ISY A;  3JAM Z;  1IRG A;  4CCK A;  4B3X A;  4PCQ A;  1S8N A;  1DU0 A;  4BAC A;  5IYC J;  2BOL A;  1IO2 A;  3RKW A;  1VQ9 I;  5IYD J;  5EGO B;  4Q4Z F;  2XRO A;  2KRC A;  4XNF A;  1P2F A;  4JQF A;  1ZGJ A;  1ONV A;  2LTP A;  2V6C A;  3W3C A;  1XCB A;  1VFC A;  1HF0 A;  3CCY A;  5A2Q Z;  4HV5 A;  1S72 I;  4OOI A;  2OV7 A;  3PSF A;  1OR7 C;  2DK8 A;  3S3N A;  1WJF A;  2J5P A;  3EUH C;  4C9Y A;  1CF7 A;  2CG4 A;  3RDI A;  1LJ9 A;  1X4P A;  3L7W A;  2P4W A;  1QQI A;  1LB2 A;  5D4S A;  4RB3 C;  3LSP A;  2OPT A;  4I98 B;  5DS9 A;  3GVA A;  1AKH A;  3B6A A;  3N4M A;  2E7W A;  2HOA A;  4EQQ A;  1KON A;  5JR3 A;  1BI2 A;  3JRF A;  1QZE A;  1TC3 C;  5TRD A;  4KMF A;  3OYG A;  2CV2 A;  4P55 A;  3ZN0 A;  5D4R A;  2X1C A;  3BPV A;  4BXX J;  1HC8 A;  2R7S A;  2FE3 A;  2D1H A;  2ISZ A;  4S04 A;  4I7H A;  3FBI B;  2HQ5 A;  1ETW A;  1HSJ A;  3MEX A;  4LB5 A;  1YW7 A;  3JRI A;  2R7W A;  2VQL A;  1OIS A;  5K5O A;  3PFY A;  3CZ6 A;  3T1B A;  3ZGK A;  3FK6 A;  3OWT A;  1VTN C;  3GZN B;  3G3Z A;  4G12 A;  4FET A;  4QPO A;  3ZR8 X;  1T98 A;  4ZZL A;  2FA5 A;  4J00 A;  1A36 A;  2QKL B;  5K1Y A;  1F43 A;  1JUS A;  2VT2 A;  5EDN A;  2X1D A;  2OTJ I;  5JFR A;  1MKM A;  3O3K A;  2L7M P;  1KYW A;  1AOY A;  1OCO H;  4QPQ A;  3QPH A;  2FF4 A;  3D5R C;  5FGM A;  5DYM A;  4CXF A;  1IUF A;  4MTD A;  2GA1 A;  2XF6 A;  2XB0 X;  4HBL A;  1MND A;  2W85 A;  4ENK A;  2PN6 A;  4LFU A;  3K70 C;  5E1Z B;  3L2C A;  1I1S A;  4IOA F;  2MLK A;  3CDI A;  2LG4 A;  2ECB A;  4LJZ F;  4DBQ A;  1OYW A;  4YG2 F;  3CCL I;  1YE9 A;  2PMH A;  2DA4 A;  3FXQ A;  2DA5 A;  5CVI A;  3IWF A;  4TV7 A;  3ZCO A;  4IZZ A;  3MZH A;  1Z77 A;  3N05 A;  5JI6 A;  2F4O B;  2L9R A;  4PGH A;  2VC0 A;  2IBD A;  2Y69 H;  4RB1 A;  2DFI A;  3L09 A;  4BU2 A;  4E7H A;  4IQJ A;  3DKW A;  5DCM B;  5IP9 J;  1GVJ A;  3WTV C;  3R6S A;  3V8K A;  3X2Q H;  1BIB A;  4R8H A;  1CQT A;  1Z3X A;  2L9N A;  4BKX A;  1MSE C;  5B5E C;  2W48 A;  1LUJ B;  1ZLK A;  1ZGW A;  2X85 A;  2O8X A;  2LKS A;  2NXN B;  3F23 A;  3J7Z I;  4QTR A;  1OCZ H;  2UV1 A;  4JP0 A;  3RQ4 A;  5HVQ C;  1IN4 A;  3HSR A;  3WHC A;  4O3M A;  2EPF A;  2RGV A;  5F27 A;  1BJA A;  2KJC A;  4II2 A;  3KYL A;  4YEJ A;  3J7Y J;  4IRG A;  2WA0 A;  4PSX A;  2Q2E A;  3CCQ I;  1FYL A;  4Z2Y A;  5M5X J;  1MBJ A;  3HRT A;  4YFN F;  4FHT A;  4E7K A;  1OCC H;  1Z9C A;  1DUX C;  4ZDO A;  1PDN C;  4IL6 C;  2HOE A;  2V79 A;  3ABL H;  4NB5 A;  3CD6 I;  2DQR A;  1ERD A;  1W5T A;  2H1L A;  5JLX A;  2X6W A;  5HDN A;  2AQF A;  3K4M A;  4MNU A;  4XKB A;  4R79 A;  2XRN A;  1P4A A;  1D5V A;  5D5U B;  3J81 K;  2K9L A;  2DO7 A;  4EJU A;  1X3W B;  1L0O C;  4M3D A;  3Q0W A;  3T0Y A;  1Q1H A;  2XV4 S;  1G3S A;  2ZB9 A;  2YPR A;  3SZG A;  3KP5 A;  4DGW B;  2HWV A;  1HW1 A;  1R1T A;  3FMQ A;  3CMM A;  3HOY J;  1Y0N A;  5J8F A;  4I02 A;  2OAZ A;  4L9T A;  3RKY A;  1JHF A;  1ENH A;  3KYC B;  4CCO A;  4ZYA A;  1I1G A;  1W1W E;  4OIN F;  3DTK A;  2L4A A;  1WH7 A;  3D1N I;  1BOA A;  3IC7 A;  4D5F A;  4RB2 C;  2LKP A;  3I53 A;  4XOP A;  3LSH A;  1X1C A;  2P6T A;  1KZH A;  4N9H A;  4GFB A;  4N4N B;  5E79 C;  4P5O A;  3OYJ A;  2GLO A;  5KNL A;  2Y30 A;  3I56 I;  1S7O A;  3LSJ A;  2JA2 A;  3G73 A;  4GDF A;  3GTM J;  1GV5 A;  2JK3 A;  2VKV A;  2M5W A;  1YJN I;  3J81 Z;  2ZFW A;  1Z6R A;  1X3Z B;  4E7L A;  1QA6 A;  5DV5 A;  2M87 A;  3W6J B;  2DU9 A;  2Z16 A;  4D1Q A;  2WV0 A;  2O61 A;  3ISP A;  3JTG A;  1XGS A;  4XRF A;  2DQL A;  4BQN A;  4A0Y A;  1KQ9 A;  3P5J A;  3OYA A;  1QHG A;  3PJR A;  1G2H A;  5KAF C;  4MEX F;  1YIT I;  3LA7 A;  3KPH A;  1VQM I;  1AA7 A;  1W36 D;  1BW6 A;  1D3Y A;  1X2M A;  2IA1 A;  2B63 J;  2VKH A;  3BZC A;  3ECH A;  2NS8 A;  4NC8 A;  4B09 A;  3KP6 A;  4CYC A;  5LRR A;  1UMQ A;  2STT A;  4BY1 J;  4UUT A;  2X6O A;  2ZKZ A;  2LY1 A;  3DPU A;  1ZQ3 P;  2R7D A;  1TL8 A;  3CUQ A;  2HVR A;  2KIQ A;  5K7H A;  2ETH A;  2BE5 F;  2FBI A;  5D5V B;  1WJE A;  2FUG 2;  3NQO A;  1CF7 B;  4DBR A;  3HPH A;  3LFU A;  5F0C A;  2CO5 A;  3W2V A;  1X1P A;  2ELJ A;  1QU3 A;  2EFP A;  2NOJ B;  4XKW A;  1YHQ I;  3KX2 A;  2EFN A;  2QA4 I;  4A3G J;  2MGQ A;  3D5L A;  1F9N A;  2LP0 A;  3I4N J;  2LRE A;  3C2B A;  3C18 A;  4YFK F;  2R0Q C;  1O3S A;  5FFZ A;  2E2I J;  1MNE A;  3ZQQ A;  1KU9 A;  1QPI A;  3CJT B;  4HLX A;  4HX8 A;  1GHC A;  4HYE A;  2DJI A;  3RI4 A;  1JUM A;  4ZZD A;  1POG A;  3P9I A;  4IHT A;  4AYB A;  4G94 A;  1JGS A;  5KAI C;  4ZYD A;  1D8K A;  1W7P D;  4L18 B;  1BI0 A;  5J3L A;  1GXQ A;  5FKM A;  1BL0 A;  1USS A;  3TL4 X;  2Z5U A;  4E7J A;  1UHW A;  1PUF A;  3OR1 C;  5BPD A;  3WGG A;  1HKT A;  1W7P A;  2CU7 A;  2Z1D A;  1F1Z A;  3UR3 C;  1SVO A;  4A5N A;  4P9F A;  2Z99 A;  3I55 I;  3KIO A;  4U88 A;  1YIO A;  4F92 B;  2ZJQ F;  3ZP5 A;  3SZP A;  1I3Q J;  2BXZ A;  1WQ2 A;  2MD0 A;  3TP0 A;  3P9K A;  1RNL A;  2YR2 A;  3RZO J;  1IN5 A;  3I9V 2;  3UKG A;  5E8I A;  3AAF A;  1E2X A;  2YU9 J;  1LDJ A;  1WI9 A;  2JA5 J;  5H2F C;  4I01 A;  1XG1 A;  4GYI A;  4FE7 A;  3J80 Z;  4GGG A;  4BYY A;  1ZAO A;  3CCR I;  2WY8 Q;  5J4Y A;  1OLT A;  2FRH A;  2IPQ X;  4ESF A;  4M74 A;  4G6T B;  2WY7 Q;  1FOX A;  2RNG A;  3NWT A;  3BPX A;  3FKI J;  2O5R A;  1TTY A;  2XGC A;  1D1C A;  2DYS H;  2NNY A;  2QSG X;  2L9S A;  2XSD C;  4A3B J;  5E17 F;  2NVT J;  4HW0 A;  3AG3 H;  3G1O A;  2M0C A;  5IT3 A;  3OYD A;  2JQ7 A;  1WHU A;  3OOP A;  2K3P A;  2E60 A;  2XAS A;  1VZ0 A;  2K27 A;  1YTY A;  1OR7 A;  1ZG3 A;  1ZAR A;  3EUH A;  1J75 A;  1JHH A;  2XRL A;  1ETY A;  3ZXS A;  4IHS A;  3HC7 A;  4LK1 F;  3T8T A;  3MKW B;  1IRX A;  3WHB A;  1Z21 A;  2BY0 A;  5KCM A;  3QU6 A;  3QP6 A;  1S7A A;  3WU2 C;  2JWT A;  5HLG A;  3QOE A;  1T8I A;  2M2E A;  1YW8 A;  1FOY A;  3H9Q A;  1VQP I;  4PJL A;  1TQI A;  2P8T A;  2K5C A;  2K7L A;  3M3Y J;  4A6E A;  5K7F A;  2HXI A;  4NNJ A;  5L3B A;  3E97 A;  1FY7 A;  4PFP A;  1Z7L A;  2DI3 A;  2UZK A;  5JHF A;  5IPA A;  1Y0U A;  5DTD A;  3E0J B;  3MZ8 A;  4XLA A;  2GIZ A;  1X1A A;  1R5G A;  4MQ9 F;  2JSC A;  2XF7 A;  2H8W A;  3M1C A;  2DK5 A;  4C2M J; 
#chains in the Genus database with same CATH homology
 1Y0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...