1Y0NA

Structure of protein of unknown function pa3463 from pseudomonas aeruginosa pao1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
71
Chain Sequence
GHMLIPHDLLEADTLNNLLEDFVTRETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0270 protein PA3463
publication title Hypothetical protein PA3463 from Pseudomonas aeruginosa strain PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 21
structure length 71
sequence length 78
ec nomenclature
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06794 UPF0270 Uncharacterised protein family (UPF0270)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A YehU-like 1y0nA00
1Y0NA
chains in the Genus database with same CATH superfamily
1RI7A 2L2OA 3ML6A 1UG0A 5F64A 2LY2A 1XSVA 3G1LA 1JJ8C 2R4GA 5EG0B 1Z05A 4MO7A 5CVJA 4IRIA 3REOA 1MBHA 4I02A 4U0VA 4ETSA 1QZZA 4LITA 3I54A 2HPMA 2XF6A 4A2UA 3I4NJ 2N8GA 3CCVI 4FASD 3F0CA 2X6XA 3ZQGA 4IHVA 1BN5A 3HDDA 1YFHA 1O7FA 3EDPA 3MVPA 4F7ZA 3VOEA 2EZLA 3TW6A 4BYYA 4HW0A 5D5VB 4PZJA 3FHNA 2A6HF 1QPMA 2L0KA 1FSHA 2I5UA 3J7YJ 2DPDA 3RKXA 1I39A 4ZZDA 1JKRC 2M87A 5L3DA 4DQ2A 4KIBA 4XOTA 5TGTA 3VB2A 5DYMA 3W2WA 2JA8J 1IRGA 1Z7LA 2UXNA 3T8TA 5D5XB 1UG2A 3RPQA 1J5YA 4V2GA 3PQKA 2MFZA 1RPWA 3ABTA 4M71A 2QSHX 2KRHA 2E7XA 4HLXA 1L3LA 2LH9A 2VN2A 2E34A 3V8KA 3BJ6A 1NG6A 4HQMA 1ACIA 2V6CA 1BI2A 2M8EA 5FFXA 2HGCA 4UV8A 4XLNF 1FYMA 5IY5H 4BE2A 4XKVA 2ZBKA 5LD2C 4DBQA 5EJCA 3H3ZA 1QO0D 1AKHB 1S8NA 4OAZA 3RKYA 3CCQI 5IT3A 3UKGA 3LL7A 3BJOA 2BHZA 3ZOBA 5F08A 2ZMEA 3AG3H 4XN3A 2H1KA 5KVRA 1FZPB 3V7SA 2VE9A 2ADUA 4FX0A 3ZN0A 3WGIA 3K1PA 4XLFA 3ZQQA 2IJLA 3I53A 4KMFA 2BV6A 2PQ8A 2DMPA 4IXAA 3TQNA 3FK6A 3K70C 4OU0A 4BEHA 2GZWA 2VBYA 1HKQA 1MGTA 4BL0B 3CCMI 2A05A 2W1OA 5J4YA 3GYHX 3JRBA 1IDYA 4ZZLA 4ENJA 5TRDA 1U5TC 3FM5A 3OYBA 4IHXA 2JA2A 3SHFA 2L02A 2LP0A 1LFPA 2R5YA 4IHTA 4DNCA 3FMSA 1W0TA 3K4NA 2OTLI 2YX4A 2QLZA 2QQ9A 3OIOA 4Q47A 3BZCA 1LEAA 3OYAA 1JHFA 4WWCA 1ON1A 3PFIA 3UR3C 2XV4S 4ESFA 1JE8A 1NG7A 3KYCB 2M0CA 4PSXA 4B3AA 2TDXA 2WAFA 5AIPA 4C3JJ 1SFXA 1Z1DA 2PLYA 4CCKA 3EUHC 5K7ZA 2DMNA 1FYLA 2XGCA 1AWCA 3K69A 4A5MA 3CLQA 3OS2A 4HLYA 5D4RA 3E1SA 2JVGA 5K7FA 5DD4A 2VL8A 5F0CA 4EQQA 2YU9J 1R4NB 4A5NA 2D2WA 2CU7A 2HYFA 2BXZA 2RNGA 5EZHA 4D0PA 4HF2A 2FJ1A 1SVMA 1FIAA 1K6YA 3RKWA 3BPXA 3M1CA 1ZRCA 1SMTA 3GMEA 2NVXJ 5E18F 3W6VA 4P9FA 5CVVA 4A3FJ 1IN7A 3D1NI 4EGYA 2F5EA 1R7JA 2OPTA 1FT9A 1U0JA 1EH7A 2XAGA 3DQVC 5HS9A 3WTXC 2DT7B 4M3GA 1AA7A 2LMDA 3BR6A 4L9VA 3MEXA 5F04A 2R7FA 4D1QA 2EIMH 1A6QA 5D4SA 5FLVA 1R23A 1PP7U 3KE2A 3CUOA 2QKLB 4EGZA 4XMYA 1TNSA 3FISA 2Q2EA 1OCPA 2R7WA 3QWLA 2GAUA 3ZQFA 2M7AA 4QLCU 3S3MA 3JRDA 2ZO4A 2Y30A 5H2FC 2X6OA 3GTGJ 1U8BA 4P55A 2KISA 1V5GA 2XDVA 3O6BB 4IHWA 2WTEA 3CLOA 2DT6A 3ISPA 2E7WA 3F8BA 3FHZA 4IHYA 3BJAA 5IP6A 3E3VA 1H9TA 5HDKA 2G7HA 2BE5F 1TW2A 5CVUA 2WWYA 4XRSA 4KN7X 1AOYA 3BDDA 3KETA 2RQPA 4MIMA 2OU2A 3FBIB 4RB3C 3FXUA 3WGHA 1OCCH 2XHKA 5IYDJ 3BWGA 2DMTA 3IHUA 4JX4A 5DM7F 3H5NA 4BH9A 3R0AA 4BQQA 4CCNA 2HQRA 4GYGA 1E2XA 2K9NA 2V9KA 3ZGKA 3E0JB 2CG4A 4DGWB 4AD9A 4IF4A 4O6JA 1FMVA 2E1MB 4HBLA 1E0EA 4CYDA 3G3ZA 3ABMH 2ZNYA 4BHBA 2V1DA 2DA6A 2KQRA 1GVDA 5IPAA 1E3OC 1NK3P 2GA2A 2FUG2 2K86A 3VPRA 4KN4X 3E6CC 2VJ5A 3MZ8A 5LFAA 3W6KB 1TQIA 2KKOA 9ANTA 1D1AA 4C2TA 4ABZA 1Z91A 5ILVA 2MD5A 1HF0A 1P2FA 3RKQA 3CC7I 5DV5A 4NDLA 1Y8RB 4BXFA 4MQ9F 3K4CA 3M8EA 5HDGA 3F22A 5ERIA 4HX4A 1EH6A 4EM1A 1EF4A 4HAMA 2WA0A 4BQOA 4WK8F 1U8RA 1G3YA 2WC2A 1TT0A 3ZMVA 2V9PA 1SFOJ 4E7IA 3DP7A 5CPRB 2CSOA 3W6JB 2F48A 1MZBA 4W1UA 5E3LA 3BP8A 1FOYA 1W5TA 1SAXA 3NEUA 1SEUA 2MGQA 3GX4X 2FSWA 1P9QC 1F4KA 1ZG1A 1MSEC 4PJMA 2NXNB 3DTIA 2HQAA 2NOGA 4PJ0C 4YIIA 1T38A 3ZXSA 3I59A 4F91B 2QQ8A 2W82A 3TGNA 4IVNA 2EV6A 3BLYA 3AKZA 4J00A 1NHAA 2IS2A 2VKHA 1T6SA 4CCJA 2JTVA 1A31A 4U0YA 1KZHA 2W25A 4S04A 4M74A 3E7LA 4P1WA 4PJJA 1ETOA 1X1PA 2X0LA 3P9IA 3AFHA 3OYFA 1SFKA 2NNNA 3BC8A 3FIWA 2QQBA 4RLQA 4E7LA 4I76A 3H5AA 3KX2A 4IO9F 1HKSA 2R7ZJ 4F93B 2QKMB 3KYDB 3M1EA 3V7CA 2CV2A 2XKOA 1MKMA 3KZYA 1D5VA 2RDPA 2LVSA 3CUQC 5JLWA 2XGDA 2W7NA 2FD5A 1MMAA 1XDSA 2LRDA 2NOJB 2JPBA 4RGRA 3BQZA 1XCVA 2XC7A 2VJIA 3E5XA 3RPUA 2VLAA 2DQLA 3AAFA 2YSRA 1P92A 3CMYA 3BG5A 5FRNA 1R5GA 1A36A 5J3LA 4BNCA 3NWTA 1G3TA 4CH7A 4U88A 3CMMA 4NC7A 1Q1VA 4RGSA 1MDMB 4FT8A 2CV0A 2HDDA 1R4MB 3CJNA 1Y56A 3K2AA 4CSWA 4H0EA 4W97A 3COAC 4PSWA 4D7MA 3JAMZ 2EB7A 4MEYF 4X0GA 2VQCA 3M8FA 2IGNA 4RAZA 3FF5A 1XMAA 5BPIA 1FOKA 4KA4A 2OJED 4BGDA 4E7ZA 1RETA 1USTA 4IPAA 3VODA 4E7HA 3CJQB 4EM2A 1DU6A 3TP0A 2Y0SN 3LSMA 1ZLKA 1P7JA 2X6WA 4LMYA 2W24A 2JA7J 3HRSA 1SD4A 5D6EA 1IUYA 1QU3A 4MGRA 2KZVA 3CESA 4YIRX 2P5KA 4WXHA 1R36A 4M9ZA 1XN7A 3JAMK 1JXSA 1QNTA 1WJAA 4EJOA 4EEFG 1HW5A 3M4OJ 3HB9A 3QPTA 3OOUA 4CDGA 1R22A 2KJCA 4WX9A 1Z3XA 4CGZA 2LFBA 3R0JA 1IUFA 1DQUA 1TT5B 2HXIA 4TV7A 5IP7J 4X1EA 2WB1N 2I10A 3C3WA 2MA3A 2XAJA 5FKKA 3OYCA 2KZGA 2Y69H 4CCOA 1YO5C 1UFMA 3D5LA 5FGMA 3U21A 3WTYC 1VFCA 2M4KA 1U3EM 3S32A 4AVZA 2XAUA 1T33A 2H6BA 4DJAA 2HTSA 3CDIA 2FXAA 4GDFA 1DPUA 4DYRA 2Y0SA 1Z6RA 2F2EA 1Z9CA 1K4TA 4I98B 1KQ9A 1B72A 2WAEA 4BY7J 5E3OA 3HYIA 2AXTC 3IAS2 1T08B 3CP2A 2B9SA 3OV8A 3ZMTA 1OLTA 2V1UA 4P96A 3QAHA 1OR7C 3HUGB 4G94A 3JTGA 3ECHA 3Q3SA 3OYIA 4CXFA 1MNDA 2AHQA 1J9IA 3GO5A 2XGEA 1RIOH 1X58A 2IS4A 2LD5A 4BY1J 1XGNA 3C2BA 5F1JA 1IXCA 5B1AH 3PNYA 3JRGA 1G6NA 4P5OA 3I64A 3DPUA 4HQEA 4AC0A 3JR9A 1TC3C 3BQYA 2TCTA 2V26A 5J6XA 4YG2F 4IEJA 1JJ6C 1GT0C 1KQ8A 1FLIA 5CLSA 1HSTA 1M1EB 4HF0A 3LFKA 1FY7A 2RKHA 1REPC 2VKVA 1ZRDA 1ZREA 4V19K 2DOEA 2Z1DA 4FQGA 2J5OA 3SEQA 4B09A 2E2IJ 2DCEA 4ZYAA 1OJLA 1IW7F 3K1NA 3B6CA 4OIOF 1J75A 3JRAA 4ENKA 1SC7A 4E7JA 4PDKA 1YIJI 2PMUA 1Z21A 3BCAA 4F3QA 5KK1A 3ZQCA 1MJBA 1Z0XA 3EPZA 4ENMA 3CC2I 4DZPA 4G7ZF 5J4VA 3TP3A 5HNFA 2P6SA 3DXJF 3KCCA 4MNUA 4PJLA 2HDWA 3QPLA 3H36A 3VWBA 3IUOA 1P6RA 1DUXC 2EFWA 4QPOA 3A0BC 2UWMA 1TP4A 3IAM2 3MQ0A 1ITYA 2ME0A 4I2OA 1QQIA 4CUGA 1KU3A 4G6DA 3HUGA 4A6EA 4M73A 4S0HB 5FFZA 1ETXA 2MBFA 1L0OC 3CMAI 2X1EA 1TQMA 1VQ4I 2Z5UA 1SD6A 2VI6A 4UVAA 2M30A 2LF8A 1LJ9A 5L3CA 2D5VA 3L2UA 3K9TA 3BR1A 3PSFA 4M6YA 1ORKA 3OYDA 2AQEA 3HHHA 4RB1A 1YRNB 2BW3B 2L01A 3GTJJ 4A12A 2P4WA 1K78B 2CYYA 5AIQA 1P7IA 4PJNA 2DFIA 4QWQA 2EILH 4BBRJ 4CCMA 3BY6A 3OSGA 3L09A 2IXSA 1D8KA 1Y1VJ 1ZELA 2NRAC 1XB4A 2DO7A 2JSPA 5M3FJ 1CQTA 2HDCA 5GPCA 2M34A 1WWXA 3HTUA 2DODA 1O3SA 2ESNA 1TL8A 2EFQA 1IXSB 3QQAA 3PNTA 4ZDOA 3BZKA 3TEDA 2K7LA 2CQKA 4I0AA 2PJRA 4S05A 1IDZA 1ZG3A 5HVQC 1DP7P 2EFOA 1TQPA 5B66C 4EVIA 3L00A 3DU5A 5H6QA 2ID6A 3A1YA 1FMWA 2VT3A 2ICWG 2IS6A 3TL4X 2L5QA 1FP1D 1Y1WJ 2M9HA 2V9VA 2XRNA 3WTUC 3L2VA 2IW5A 3OYNA 2YU3A 4NC8A 3Q0UA 4O5VA 4RGUA 4NUBA 3SJMA 1ETKA 3NWSA 1WJEA 2P5LC 1GV2A 1U9OA 3FXKA 3PL8A 4HSTA 3OYHA 1TTYA 2IEKA 1R1TA 2KIMA 3CD6I 3H3UA 2BOLA 2O8XA 2VOPA 3DBHB 2ZKZA 5DCFA 2GBYA 2X48A 2CGPA 3RYPA 4IRHA 4XSZF 2A07F 3LFUA 1KQ0A 3RZOJ 3PO2J 4GRIA 3CCYA 1XDUA 4ZTJA 5JVGF 3VYUB 1I5ZA 4ZTFA 4GFBA 3IC7A 3M07A 2BVMA 4A0YA 4HX7A 1LVAA 2K9QA 4XRMA 3PUBA 2BY3A 1TZLA 1FBQA 3SZGA 2ZMEB 2FU4A 2XPUA 3WU1B 1W0UA 2E35A 1MMGA 3QU6A 1BR4A 1QVUA 5C4XJ 5FD5A 4BQNA 4NC6A 4B44A 4A3LJ 2R7OA 2R0QC 4BBSJ 4AIHA 3Q9VA 4RBOA 3CTAA 5A2QZ 2TRTA 4L9JA 3FKJA 3LAJA 4AYBA 4XR6A 4BEHB 3JW4A 1FWZA 3IRQA 1X1BA 2CO5A 2IA2A 3SZTA 1JHHA 1XPXA 2L3DA 2M2EA 2XKPA 3EUKL 1ZR4A 2XUBA 2OCEA 3V8JA 3IH4A 3WTZA 1YE9A 3BG6A 2MG4A 4BHCA 1XSXA 3S1NJ 2XRLA 2XAFA 4WCGA 1GXPA 1JGSA 1X1DA 1V3FA 2R5YB 1DGWY 2OTJI 1JUMA 3VDXA 2R5ZA 4MHGA 3WE2A 2Y9ZA 5HLIA 1SVLA 1KYZA 2EIJH 4XKBA 2MSYA 4U7DA 5L3BA 1PP8F 2RN7A 2GIZA 4RA2A 3ZMDA 1XGOA 4HRIA 3O3KA 3A01B 1T56A 2RV8A 5FJ8J 2DA4A 3DWLE 3PUFA 2L4MA 5IP9J 4Y52J 4RB2C 1S5LC 4M9SA 2DOFA 1V5FA 4UXNA 2GXBA 2QVOA 2VT2A 2Z16A 3BTJA 4A3BJ 2DMQA 3RDIA 4LG3A 3J7AO 4OWRB 4BHPA 3F23A 2KDOA 4ZDLA 5B5EC 2E36A 1MH3A 2O7OA 3X2QH 3LSRA 1FC3A 3ABLH 2EPFA 5HNHA 2BY2A 4L5EA 1UCRA 2EWNA 2XPVA 1PVEA 4LFUA 1E3PA 2IA1A 3EUAA 1WH5A 4BACA 4IOAF 4N9HA 3QOPA 4HA8A 2E1OA 3VEPA 2A6EF 2K9MA 4BE0A 3ECOA 4Y15A 5BS6A 3FXJA 1Y8QB 1MBEA 1BOBA 2DA2A 4H4KC 3BTCA 3IKTA 4I01A 2V7FA 1OCOH 1QBJA 4ASNA 1MBKA 4FTHA 1R9TJ 1GVJA 2EZKA 2BXYA 3JRIA 1KU2A 2AO9A 3R4KA 3SDGA 2ZJQF 1MH4A 1S7EA 3KLNA 2OAZA 2Y2ZA 1OYWA 4XLPF 2Q2EB 3JREA 2QM3A 2F6CA 1VTNC 3CCJI 1YYVA 1Z6TA 1BL0A 2HZTA 4ITVA 4AM3A 2G0EA 3HG9A 3LA3A 1MNMC 2HKXA 3A01A 3QODA 1YJ9I 3BTIA 1B8IA 1UMQA 4PUSA 5EEGA 1KONA 3SDBA 1B4AA 1BI3A 4II2A 4E4HA 4E70A 4X6AJ 4XK4A 2E19A 5CJ9A 2LC2A 4R8HA 2JSCA 3K4BA 2QEXI 3HPHA 3N97A 2KIUA 1D0ZA 3UNGC 2XF5A 2JRTA 4A0ZA 1JKQC 2CQQA 1X3WB 2PMHA 2VJJA 5FLXZ 3ASNH 3BZ6A 1D5YA 2JA5J 4LK1F 3OR1C 4Y4RA 3F6VA 4Z2YA 3KP3A 1ZR2A 3H9QA 3OS1A 1YW7A 1KA8A 1J7KA 2FRHA 3RTRA 2DPUA 5HODA 1B59A 3O2PE 1K4SA 1G59A 1TWGJ 1HBXG 1MJAA 3HBLA 3TDUC 3BT9A 3WG7H 1DGRM 2L54A 2M4GA 1IGNA 1MSFC 3I9V2 2HS5A 5EZGA 5GP9A 3N4MA 3HKZN 1TBXA 4LIVA 2ZJ2A 5CVRA 2DDAA 1JT6A 3HOYJ 4A6DA 1SANA 1U5TA 5FLXK 2DA5A 1Y0NA 2HI3A 1A5JA 3CO7C 3I56I 2BY0A 2Y31A 5HLHA 1OMIA 5E3MA 3A03A 2EIKH 4K2EA 2IGKA 3VSLA 5E17F 2YUSA 1QA6A 1ON2A 2LG4A 4XKWA 3QP6A 5JR3A 2ZB9A 5FKNA 1A04A 3EUHA 2Z9OA 1HSJA 2UV1A 3TBIA 3CO6C 2VOOA 3LSGA 5M5XJ 1XS9A 4BDZA 4NBQA 2PI0A 1MW7A 3P7NA 3S1RJ 1DU0A 2EA4A 1G4DA 2K40A 3P5JA 2V1NA 1N25A 4QTRA 3GBGA 3NARA 4RM3A 4UUVA 3S1QJ 3S1MJ 1S29A 4XONA 2GM4A 3RJPA 4CCLA 2JJ7A 4UV9A 3LAPA 1RUOA 1P4WA 3E6DA 2RQQA 3LQRA 3SEZA 2Z3YA 3BCBA 4NQWA 3TW7A 1YITI 2H8RA 2VJ4A 2MC3A 3I59B 5LGTA 3ROUA 3L2WA 3HKZA 2MH2A 2OF7A 1QVTA 4PK4A 1MIJA 4UVCA 3WTVC 4HZFA 1E3HA 3S14J 4WF2A 5K1YA 3C7JA 2LYCA 4N0BA 1ZHFA 1VQOI 4AU7A 4Y13A 1PUFA 2VKDA 1HXDA 2Y9YA 3GTQJ 3ERMA 1YQAA 2DOAA 1IRXA 2ELJA 2QBYA 3SYTA 1YJWI 1RUNA 1POGA 4G6QA 2X4HA 1IXRC 3ZMUA 3GTPJ 2EFPA 1OYIA 2W57A 2FF4A 2LBFA 2E1MC 2ME6A 2QZ8A 5EYRA 2B7EA 2M5WA 3U1KA 3VYSB 2WADA 1WI9A 2PMZN 3DEUA 4DYQA 4XRFA 2IGMA 5J47A 1K7AA 5L3FA 4QSHA 2Q1ZB 1SAUA 2IA0A 2A6TA 3JRHA 2EZHA 1W7PA 1S72I 4B47A 1VZ0A 1UZCA 3FZVA 1T98A 3WTWC 2R7XA 1F43A 5GAHJ 2MW8A 4OMZA 3PO3J 4XLEA 3C2HA 5E1XA 4D5FA 3OR2C 3E97A 1FOWA 2JQ7A 3IV5A 3CDLA 2XAQA 1XMKA 1VQ6I 1ODDA 2ELKA 5FO5A 2H09A 3GFIA 2WV0A 2CS3A 2VB6A 4Q4ZF 4F52A 3TOAA 4I7HA 4HDUA 4F55A 3RIRA 2FOWA 1W5CC 3HSFA 4XN0A 4L18B 3ESWB 1I3AA 2BYVE 3RI4A 4AIDA 4LD5A 2MH9A 1VQKI 4OIPF 1W4MA 1VQLI 4PFOA 3QYBA 1XC5A 3DLAA 1IO2A 3DEWA 4LIUA 2ZFWA 2XASA 2DLLA 3BG7A 2ESHA 3V4GA 4M6XA 2CWEA 2YPRA 1WJBA 1SD7A 2PMZA 2VASA 2XVCA 2DA7A 2Q0OA 2QSGX 1S3JA 1ZK8A 2OQRA 1OCTC 4RAGA 2JUGA 3OIQA 1RC9A 2HNHA 4ANJA 1FNNA 2KIFA 4Y33A 2NAZA 3SFZA 3I4PA 4UUTA 1LB2A 4G8XA 2CUJA 1IN5A 1BJZA 2JRMA 4KT5C 4JYKA 1YTYA 3PJRA 1MJ9A 5ILSA 3RSNA 1EH8A 4XRSG 1MBGA 1QZEA 3K4KA 3KIOA 1ETQA 2KRCA 1LE8A 1O4XA 2K4BA 2R7SA 2VC1A 1FJLA 1XTAA 4IL6C 5DEQA 5CKTA 3SFIA 2XF7A 1D3YA 3F3XA 3W3CA 1HLVA 5AONA 5EEAA 4XM3A 3VYRB 4GYIA 2GLOA 3LMMA 3GVAA 3K7AJ 5LGNA 3IKVA 3VYTB 2HOEA 1B72B 2B0LA 3BTLA 2QENA 5HS7A 3EYIA 1PDNC 2FMYA 2V6EA 4KNYA 1LEBA 3FBNB 2PFBA 1DP3A 2P6TA 1A35A 1BJAA 4C3IJ 4CZZA 3L2RA 1WSUA 1R1UA 5C44J 2R7UA 4M72A 1IN4A 2CFOA 2OBPA 1B6AA 3QYEA 4N4OB 3ZQHA 1HC8A 1VQ7I 1T2KA 1IG7A 5IOZA 1WRJA 1LQ1A 2FQ3A 2HVSA 2BVLA 3C2GA 1F1ZA 4XICA 3MKZA 3R6SA 2YX7A 3CUQA 4B8XA 3H1CA 1JTYA 2DFFA 3LA2A 2HR3A 1ZLJA 4UHTA 3DKXA 2HTJA 1R00A 2JN6A 5M3MJ 1LFUP 3CJTB 3I71A 2QQAA 3AG1H 3G1MA 5GTIC 2QUFA 1ZYRF 2JVHA 5FKLA 3U9GA 2KDZA 2L7ZA 4B3XA 2L9RA 2FOKA 1WPKA 4KDPA 2OUMA 3BPVA 2CUFA 2F4OB 2FBHA 5FD6A 2W84A 2GQQA 1R49A 2LK2A 3FWEA 1G8XA 2M1BA 3RQ4A 4BJTA 3JCUC 2IGOA 5GAEJ 2HZDA 3TO7A 3OL3A 3DV8A 4A0XA 5DUIA 2LF7A 2NS7A 5J1YA 5LEKA 3OS0A 2YR2A 3MKYB 2VPRA 3QPSA 1EV7A 3WU0A 3OL4A 4ZYEA 3GW2A 1MD0A 3WGGA 2XB0X 3PFYA 2IVMA 5L3GA 3TO9A 2DI3A 3BR2A 3HHGA 5B1BH 3F8MA 3FK7A 1ZARA 4JK1X 2ZCWA 4A3KJ 4LG0A 4IHSA 2RNJA 2NVTJ 5IOYA 4LK0F 4FE4A 3IRRA 3I3LA 4XSXF 3RPUD 2NS8A 4AIKA 2ZC2A 5D8LB 5GPAA 1ZG5A 2E2JJ 2KHMA 1Y6IA 1OKRA 4KUMA 1O7LA 1R1VA 5J8FA 3G6EI 3HZJA 2Z99A 2DJIA 2E71A 3OIPA 1Z77A 3KEYA 3GFLA 4P9UA 4D7NA 4HNVA 3HL2A 4J01A 4LGWA 3T8RA 3M7GA 1YI2I 4ZYDA 1XSDA 1RR8C 1O3RA 3L7WA 5GAGJ 1WZ2A 4L5JA 5D6FA 3K4LA 4E6KG 4RLFA 2EBIA 3A02A 1BIAA 4KMUX 2JA6J 2W48A 1X1CA 2DTRA 4ZJZA 1JGGA 3LA7A 1IN6A 2M45A 1CF7A 2A69F 3K1MA 1BBYA 3ZCOA 4ZDPA 5KNLA 3B73A 1UJ8A 2CFXA 4EJVA 2GXAA 2FE3A 5IYCJ 2P81A 5ICFA 1D1BA 3ZQIA 3JSPA 1LUJB 1R5HA 4Q5SF 1LNWA 2PJRB 2NVUB 3ASOH 3HXLA 5F6FA 2RC4A 1YG2A 4A3EJ 1FTTA 3TO6A 2L7MP 2ZXJA 4ZYHA 5ICCA 1B1BA 2VXDA 3ZMSA 2HQNA 3CMEI 1WVRA 4OMYA 4Y7NJ 2ZJPF 1I27A 3F6OA 3RZDJ 5FLMJ 1OR7A 4LB6B 3LWFA 2DA1A 1T0FC 2HVQA 3VSKA 4LLLA 5DUKA 2PG4A 2FBIA 3B6AA 1X4PA 5BNGA 1IJWC 4HOBA 3S8PA 5FKMA 2OD5A 4BXUA 2LREA 3TDZC 2OCCH 2EQRA 4HG2A 5LGUA 2OA4A 3J81Z 5J1UA 5C3EJ 3JRCA 4NHJA 1BW5A 1V54H 5DM6F 1VQ9I 5F0HA 3FDYA 2HOTA 3KLOA 2A5WA 2JT1A 2X1DA 2ZXHA 2EH3A 3ZQLA 4PGHA 1W5SA 2VXZA 1QHHD 3HOTA 3F8NA 1MBFA 3QP5A 1Y0UA 5K7HA 3K4MA 1TWCJ 4XLCA 3IH3A 3R61A 2BBYA 1TWHJ 2CJJA 3DTKA 2COMA 4M3FA 1V5EA 3GLLA 3M3YJ 4EJTA 2E5NA 1VQPI 1BR2A 2DYSH 2LKSA 5F1RA 1BC8C 3BR3A 4L5IA 4IKFA 2M8GX 3HOWJ 1QHGA 3WU2C 3H0GJ 3J81K 3ZMZA 5H6RA 2LLKA 2EINH 2X1CA 1ZGJA 3H3VK 3JSOA 4ZH4F 1I6XA 5CVIA 3RQIA 3AL0B 3FXMA 4KISA 1Z7UA 4FETA 3A4CA 2DMUA 3S15J 2O03A 4DBRA 3HRTA 2NYXA 2JUCA 2H27A 4AYBN 2LY1A 3GFJA 3DTEA 1ONVA 1F5TA 1W36D 1AHDP 3DFGA 4M6VA 4LB5A 4IX7A 1BM9A 2R5ZB 2L9SA 3ONQA 2HWVA 1AU7A 2DT5A 2EFNA 5E8GA 2QGUA 1MMNA 1ULYA 4CO8A 3ZPLA 1SVOA 2HU9A 1UHMA 3LNQA 2R93J 3RCOA 5D5WB 4CA0A 4RMNA 2WV1A 1ETWA 1LVKA 2EJRA 4XNFA 3KFWX 3KP5A 2PEXA 5ICGA 2E1CA 2GOMA 2DFHA 1XGSA 4MFDA 4OOIA 2STTA 2K5CA 4A3GJ 3L2QA 4A3JJ 2VIXA 1YX5A 1JUPA 1K6OA 1ENHA 2KP6A 5JVTA 1JKPC 3R60A 4CZCA 4HV5A 1HW1A 2ZXWH 1K83J 4EJWA 3DPLC 2R3SA 4YIFA 2PJPA 4PFPA 1GLNA 2CRGA 2JMWA 3FXOA 2P5VA 3ZQ7A 2X6YA 4G12A 1X4OA 3CCUI 4M9XA 1MMDA 3J7ZI 1P4AA 1FSEA 3EETA 2JZYA 1GXQA 2ZMEC 2BZTA 2IRFG 4IJAA 4WXCA 3CF2A 3NQOA 1FPQA 5HLGA 1HOMA 2DTZA 4XORA 1ZGWA 1JKOC 4XL9A 4BDYA 1HDDC 1F9NA 3CZ6A 3JRFA 4YFKF 1ZGAA 2F5VA 3F8FA 3CF5F 2LTPA 2DJNA 4PCQA 4HYEA 4U0WA 2R92J 1I1GA 2EZIA 1KGSA 2ISZA 3Q5FA 1LDKB 5LHGA 1OYYA 1G2HA 2RGVA 2NVYJ 1WGXA 5A2QK 3GZ5A 4F92B 5DD8A 1X3UA 2QF7A 4YRVA 1B8IB 1D1CA 1SD5A 2HEOA 1UHSA 2KT0A 2VQGA 3G73A 3M8JA 1VNDA 1EA3A 1R5ID 5E1ZB 2PX9A 3WHBA 5ED4A 3OYLA 1GUUA 2COBA 3H9JA 3Q0VA 2XIGA 4MTEA 4L0ZB 3S3OA 3HC7A 3MWMA 1IRZA 1U2WA 1BI1A 3HEFA 3GZ6A 3H35A 4Y3OA 2F5FA 3S2HJ 2DU9A 2EV0A 1ZQ3P 4EM0B 4LOCA 4B1RA 5LLQA 2C6YA 2A61A 4GXOA 1YJNI 1U78A 3J80Z 3S2DJ 2O61A 1RR7A 3A0HC 4IZZA 2I8DA 4KYWA 2A5YB 1H88C 2O8KA 4AIJA 3BG3A 1MNEA 5TISC 2VE8A 2D1HA 1D0YA 5EG0A 2CUZA 2ETHA 4FHTA 1FIPA 3GTOJ 2Y48A 2VODA 2KRFA 1R71A 3H5RA 3IWFA 3MMYB 3T1BA 3ZN1A 4Q48A 5K5OA 3MZYA 1U5TB 2M7BA 1IV8A 3SXYA 3BR5A 4N9IA 1P4XA 3OYEA 3J80K 3F8CA 2DA3A 1XMXA 3CP8A 4IRGA 3LSKA 4B48A 3M9AA 1IN8A 3DF8A 3LSHA 3BG9A 4UUSB 3FXQA 2ACJA 2UXXA 1OQYA 1S7OA 2CW8A 3HM5A 4L9NA 4L0YB 3PIPF 1S6LA 5BMZA 1NH3A 3HTSB 1VI0A 1KYWA 3D5RC 3GFMA 1TWAJ 2K3PA 3OYJA 1H0MA 1VQNI 5LHHA 1PJRA 1USSA 3KEOA 3QU3A 1YX3A 5DTDA 3HOXJ 1YW8A 3Q0WA 4NQWB 1H89C 3E5QA 4YFNF 1I3QJ 2F5DA 2MLGA 2ZSHB 3FMRA 3IP4B 2HXOA 4C30A 1BOAA 1AKHA 2MC4A 1RESA 4M3EA 4FCYA 2CW7A 3V42A 1XGMA 2H1LA 2E1NA 3OMYA 4XQFA 1PUFB 2X85A 3LQQA 4ESJA 2ZFUA 3Q9SA 2CUEA 3W2VA 5J40A 1MMSA 2D1VA 3KP4A 2QBYB 4LLGF 1T39A 3F21A 1X2MA 2XB5A 1QGPA 2ZJRF 2VPLA 1YLFA 3D5SC 1VF9A 5DDGA 4A3MJ 2LBFB 2W85A 3HOUJ 3BROA 1LDJA 4FISA 4I6ZA 2IPQX 3O8HA 4I99C 2KL4A 3MCZA 2R7DA 1W7PB 3DCFA 2X9DA 4UUSA 5E1WA 1RKTA 1YS7A 1UB9A 2M0MA 4OAYA 4EATA 3EYYA 2MABA 1ZKGA 3HGYA 3A2KA 1UHWA 2Z2SB 4BJ6C 2OZ6A 5LHIA 1OISA 2BEOA 1APLC 4A3DJ 2PBIA 3IWZA 4MFEA 3P9CA 1G3SA 2ZXIA 2IP2A 3DBLB 2DW4A 3L2CA 2PN6A 2CH0A 3CCRI 3GWZA 1BW6A 2XAHA 3S3NA 2L9VA 1J0RA 2KMUA 1Z3YA 5EGOB 2JPCA 2GWRA 3D0SA 5GTHC 3K2ZA 2STWA 2EA2A 4DYCA 3PIOF 3DKYA 5BQTA 1LDDA 1MBJA 2BY1A 2NS0A 4XBFA 3U2RA 1SMYF 2QYOA 5M5WJ 4LLNA 2VKEA 2H6CA 1N78A 1WCMJ 2LDUA 3V7RA 5BOXA 3G4SI 3MKWB 2HPIA 3I55I 3KPHA 4D9JA 3CCSI 5JFRA 3K10A 2KIQA 3AG4H 3GUDA 5F0FA 2OV7A 1X1AA 5IYBJ 3DBRB 5HDNA 3CCEI 1IRFA 2MYSA 4R1HA 4I0BA 3TMOA 4KITB 2P7VB 2K9SA 3U1DA 1C0WA 2QCOA 4HNTA 2DK5A 4I09A 1WHUA 1GDTA 2WBMA 1KU7A 3MKLA 1JT0A 2RREA 2MD0A 3HRUA 4JP0A 3GTMJ 4KIGA 5E79C 1LE8B 3GTKJ 1WQ2A 3ERED 2L9NA 2GIVA 1SFEA 1S9HA 2CQNA 4KFCA 3OYKA 3HOVJ 3FMQA 2VC0A 2E2HJ 4C2UA 1TLHB 1N75A 2EK5A 2D45A 2K27A 3CJRB 3J7AY 1K61A 5EGOA 3K70D 3ELKA 2VBWA 3F72A 4YFXF 4FE7A 1QPIA 4G9YA 2P8TA 2RVCA 4G7HF 3OSFA 2K02A 4GCVA 2B63J 3KZZA 4CICA 1PYVA 2VUMJ 2J5PA 3LOCA 5HLTA 2DBBA 2CV1A 4O3MA 2Q8KA 2FEZA 2L7FP 3MN2A 3I58A 3C18A 1ETVA 3SZPA 4A3CJ 1O3TA 5EEHA 1U6GA 4N4NB 1TW3A 2VQHA 1YOVB 2UUZA 2FQ4A 1KU9A 2KJBA 5ICEA 1YW9A 4ZC3A 5D5UB 4RGXA 2WAQN 5LBQA 1IC8A 2LKXA 3LSJA 4RS8A 4EJUA 4IOCF 4CYCB 1ERDA 4ESBA 3FX3A 3IL2A 3GCMA 2V1XA 3CUQB 4KIFA 1E17A 2ELHA 1EKEA 2W00A 2ID3A 5E8IA 4ZYGA 2IT0A 4HPQA 4YEJA 2K9LA 2HYJA 4QPQA 1S7AA 4DZJA 3L1PA 2O3FA 2GOXB 2OZUA 1FX7A 1TNTA 4U7BA 3S93A 2GA1A 4NB5A 4BKXA 4JOMA 2KPMA 2G7UA 4YELA 2DFEA 1RNLA 1J2XA 4KT6A 5LRSA 2DYRH 3O8GA 1GV5A 4HDVA 3CC4I 4L9TA 1ZAOA 1ZTRA 5JHFA 4AVPA 1WJDA 4C3HJ 3KYLA 1I1SA 1HW2A 1GHCA 4RDUA 2DXIA 2V4JC 2AQFA 3KP7A 3JTHA 4HSRA 1EJ9A 3I0TA 4ENNA 2ECCA 1QZYA 5FROA 4A3IJ 2IS1A 2DQRA 5EDNA 2MLKA 3MD2A 3WODF 5LEJA 2NNYA 4JBAA 3DPTA 1X19A 3GXOA 2IBDA 2ECBA 2XPWA 4BAYA 3WTTC 1HCRA 4XIDA 2WAQA 4OIRF 2AS5F 3T0YA 1I50J 2CQXA 5JHUA 1WH7A 1I6HJ 5FKOA 3I5UA 5JI6A 4LG0B 2LR8A 1B9NA 2K3FA 3T5XA 1W7PD 3FM3A 4ON0A 4C2MJ 2LY9A 3MFKA 3S16J 2R7VA 3ABKH 5B3SH 3EQLF 5CYVA 4E7KA 5HS8A 4CYCA 1A6IA 3NAUA 1ZRFA 2H94A 2O6GE 2BGCA 3G2BA 1WJFA 2X51A 3QOEA 3HPGA 2WY7Q 5JLXA 2R7TA 5KAIC 3C1DA 3SQNA 4BJ5C 3S2WA 5J1RA 4IQ4A 1K79A 2Z33A 2XSDC 2JK3A 4UB8C 2QSFX 5E20A 2K4JA 5FB2A 1W36C 1WJ5A 2IAIA 2YS9A 4HF1A 1BI0A 1BC7C 2HYGD 1XX5A 1CF7B 3TKYA 3ULQB 4OIQF 2VBZA 5ILUA 4EMSA 1FOXA 2FNPA 3FXRA 2XROA 3ABUA 2CQ7A 2W4SA 4HNUA 1RKWA 1O3QA 3HOZJ 2A68F 3GZNB 4PGGA 3N05A 1LKXA 2R7RA 3GF2A 5GADJ 1MDMA 2LKPA 4U87A 3WTSC 1FYKA 3OY9A 1OCRH 4II3A 1J59A 2F4IA 1X3ZB 4OINF 1BA5A 5C4JJ 1FBUA 3DKWA 3AG2H 1WFXA 2E60A 4AUXA 3W2AA 1X2NA 3LSIA 5DCMB 3WHCA 2GXGA 2ZSIB 4IQJA 1JI8A 1FTZA 1BIBA 4A93J 1Q1HA 3G1OA 4XLAA 1WI3A 4EV0A 4HEA2 4R79A 2H8WA 1Y39A 3H9GA 3G71I 1PUEE 2L7KA 3HJEA 2DAOA 3F9KA 4BU2A 1WJCA 3LSPA 2O5RA 1LFBA 3DLLF 4DIQA 3H0DA 4M3BA 3E6MA 3CCLI 3MAJA 2L4AA 4E7SA 4MTDA 4UVBA 1V4RA 2CW0F 1U9NA 5D8KB 2P0WA 1Z67A 3HOSA 1XCBA 4J19A 3NRVA 1OFCX 1CGPA 1VQMI 2KFDA 2KLOA 4RAYA 1UAAA 3GLXA 2FMLA 3E5UA 5TJJA 2HFHA 4JX5A 2WB1A 2O0YA 3IH2A 1IZ1A 5KAFC 2A3SA 4XLHA 1FBSA 3FKIJ 1B9MA 2V79A 2HQ5A 5KCMA 2FA5A 4MQVA 2RAEA 4HX8A 2CMPA 4V2FA 3GTLJ 5DS9A 1QRYA 1XD7A 2Y75A 3HRMA 3HSRA 3KZIC 5L3EA 4XOPA 3E6BA 2XSJC 2LSOA 4QIWN 1VQ5I 5DCMA 5M5YJ 1R6RA 2M3AA 1W1WE 2QWWA 4UNOA 2F4MB 5HOOA 4B4CA 3CDHA 3PSIA 4DOZA 4RB0A 3HGGA 1JUSA 3QYFA 1HA8A 1DPRA 3CQZJ 1OPCA 2DDBA 3OWTA 3PM1A 4JX6A 1G3WA 3OYGA 2DN0A 3KP2A 1ZH5A 4CHUA 1HQCA 4WXDA 4JQFA 2G9WA 1SFUA 3KP6A 4G7OF 3HSEA 2HVRA 4AWXB 2O9LA 5E3NA 4BUPA 4LJZF 1R58A 3WE3A 2BHYA 1LPQA 4XKCA 1J09A 2XGXA 3GEZA 3K4JA 5IT9Z 5LRRA 1RRJA 1IAWA 5K5RA 3DEEA 2K85A 3BOQA 3OOPA 4KICA 2LNBA 1WKMA 5J8CA 4GGGA 4RAFA 4BQAA 5K5QA 4MEXF 3MZHA 3V8LA 2HKOA 3H92A 3HIFA 3LSTA 2OQGA 2OC6A 1VQ8I 3WG9A 4BS9A 1HDPA 5F27A 3RYRA 4G6TB 1N77A 4DW6A 5KHDA 1F36A 1FP2A 1UELB 1ZN2A 5FRMA 3QPHA 3K6GA 2HOSA 2LOOA 2FNAA 1YS6A 4GO1A 2AXLA 2WY8Q 4A69C 1O57A 3S17J 2VQLA 1D0XA 5H20A 1RZ4A 1TWFJ 5IT9K 1IV6A 1T0FA 4KJZA 3OYMA 4RM2A 4BE1A 1V55H 4Y17A 5CQEA 5EF6A 1JTXA 1BR1A 4UY8I 4HV6A 3FXLA 3AL0C 1T95A 2E5ZA 2ZNZA 3KEQA 4MLOA 4Z6YA 2NVQJ 5CQGA 4NNJA 2P7CB 1ETYA 2FX0A 1IF1A 1OCZH 3TOBA 1H9GA 2DK8A 3PNVA 4D5CA 1YHQI 3BR0A 4UB6C 2Y0MA 3ZP5A 3DU6A 2R7QA 1YIOA 2ISYA 1H8AC 4BXXJ 6PAXA 2JWTA 3P9KA 1D8JA 2VBXA 1DDNA 2FBKA 1T8IA 3VFZA 4M3DA 3PQJA 5BPDA 3K0LA 3ZRGA 2BW3A 1YRNA 1NTCA 2VONA 1XG1A 1STZA 1K78A 4FX4A 1NK2P 3L9FA 3B02A 1FEXA 1HKTA 2UZKA 2HOAA 3QRFF 2F5CA 2EV5A 4C9YA 2QA4I 3ZR8X 3I4MJ 4B43A
chains in the Genus database with same CATH topology
1Y0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0N A; 
#chains in the Genus database with same CATH topology
 1RI7 A;  2L2O A;  3ML6 A;  1UG0 A;  5F64 A;  2LY2 A;  1XSV A;  3G1L A;  1JJ8 C;  2R4G A;  5EG0 B;  1Z05 A;  4MO7 A;  5CVJ A;  4IRI A;  3REO A;  1MBH A;  4I02 A;  4U0V A;  4ETS A;  1QZZ A;  4LIT A;  3I54 A;  2HPM A;  2XF6 A;  4A2U A;  3I4N J;  2N8G A;  3CCV I;  4FAS D;  3F0C A;  2X6X A;  3ZQG A;  4IHV A;  1BN5 A;  3HDD A;  1YFH A;  1O7F A;  3EDP A;  3MVP A;  4F7Z A;  3VOE A;  2EZL A;  3TW6 A;  4BYY A;  4HW0 A;  5D5V B;  4PZJ A;  3FHN A;  2A6H F;  1QPM A;  2L0K A;  1FSH A;  2I5U A;  3J7Y J;  2DPD A;  3RKX A;  1I39 A;  4ZZD A;  1JKR C;  2M87 A;  5L3D A;  4DQ2 A;  4KIB A;  4XOT A;  5TGT A;  3VB2 A;  5DYM A;  3W2W A;  2JA8 J;  1IRG A;  1Z7L A;  2UXN A;  3T8T A;  5D5X B;  1UG2 A;  3RPQ A;  1J5Y A;  4V2G A;  3PQK A;  2MFZ A;  1RPW A;  3ABT A;  4M71 A;  2QSH X;  2KRH A;  2E7X A;  4HLX A;  1L3L A;  2LH9 A;  2VN2 A;  2E34 A;  3V8K A;  3BJ6 A;  1NG6 A;  4HQM A;  1ACI A;  2V6C A;  1BI2 A;  2M8E A;  5FFX A;  2HGC A;  4UV8 A;  4XLN F;  1FYM A;  5IY5 H;  4BE2 A;  4XKV A;  2ZBK A;  5LD2 C;  4DBQ A;  5EJC A;  3H3Z A;  1QO0 D;  1AKH B;  1S8N A;  4OAZ A;  3RKY A;  3CCQ I;  5IT3 A;  3UKG A;  3LL7 A;  3BJO A;  2BHZ A;  3ZOB A;  5F08 A;  2ZME A;  3AG3 H;  4XN3 A;  2H1K A;  5KVR A;  1FZP B;  3V7S A;  2VE9 A;  2ADU A;  4FX0 A;  3ZN0 A;  3WGI A;  3K1P A;  4XLF A;  3ZQQ A;  2IJL A;  3I53 A;  4KMF A;  2BV6 A;  2PQ8 A;  2DMP A;  4IXA A;  3TQN A;  3FK6 A;  3K70 C;  4OU0 A;  4BEH A;  2GZW A;  2VBY A;  1HKQ A;  1MGT A;  4BL0 B;  3CCM I;  2A05 A;  2W1O A;  5J4Y A;  3GYH X;  3JRB A;  1IDY A;  4ZZL A;  4ENJ A;  5TRD A;  1U5T C;  3FM5 A;  3OYB A;  4IHX A;  2JA2 A;  3SHF A;  2L02 A;  2LP0 A;  1LFP A;  2R5Y A;  4IHT A;  4DNC A;  3FMS A;  1W0T A;  3K4N A;  2OTL I;  2YX4 A;  2QLZ A;  2QQ9 A;  3OIO A;  4Q47 A;  3BZC A;  1LEA A;  3OYA A;  1JHF A;  4WWC A;  1ON1 A;  3PFI A;  3UR3 C;  2XV4 S;  4ESF A;  1JE8 A;  1NG7 A;  3KYC B;  2M0C A;  4PSX A;  4B3A A;  2TDX A;  2WAF A;  5AIP A;  4C3J J;  1SFX A;  1Z1D A;  2PLY A;  4CCK A;  3EUH C;  5K7Z A;  2DMN A;  1FYL A;  2XGC A;  1AWC A;  3K69 A;  4A5M A;  3CLQ A;  3OS2 A;  4HLY A;  5D4R A;  3E1S A;  2JVG A;  5K7F A;  5DD4 A;  2VL8 A;  5F0C A;  4EQQ A;  2YU9 J;  1R4N B;  4A5N A;  2D2W A;  2CU7 A;  2HYF A;  2BXZ A;  2RNG A;  5EZH A;  4D0P A;  4HF2 A;  2FJ1 A;  1SVM A;  1FIA A;  1K6Y A;  3RKW A;  3BPX A;  3M1C A;  1ZRC A;  1SMT A;  3GME A;  2NVX J;  5E18 F;  3W6V A;  4P9F A;  5CVV A;  4A3F J;  1IN7 A;  3D1N I;  4EGY A;  2F5E A;  1R7J A;  2OPT A;  1FT9 A;  1U0J A;  1EH7 A;  2XAG A;  3DQV C;  5HS9 A;  3WTX C;  2DT7 B;  4M3G A;  1AA7 A;  2LMD A;  3BR6 A;  4L9V A;  3MEX A;  5F04 A;  2R7F A;  4D1Q A;  2EIM H;  1A6Q A;  5D4S A;  5FLV A;  1R23 A;  1PP7 U;  3KE2 A;  3CUO A;  2QKL B;  4EGZ A;  4XMY A;  1TNS A;  3FIS A;  2Q2E A;  1OCP A;  2R7W A;  3QWL A;  2GAU A;  3ZQF A;  2M7A A;  4QLC U;  3S3M A;  3JRD A;  2ZO4 A;  2Y30 A;  5H2F C;  2X6O A;  3GTG J;  1U8B A;  4P55 A;  2KIS A;  1V5G A;  2XDV A;  3O6B B;  4IHW A;  2WTE A;  3CLO A;  2DT6 A;  3ISP A;  2E7W A;  3F8B A;  3FHZ A;  4IHY A;  3BJA A;  5IP6 A;  3E3V A;  1H9T A;  5HDK A;  2G7H A;  2BE5 F;  1TW2 A;  5CVU A;  2WWY A;  4XRS A;  4KN7 X;  1AOY A;  3BDD A;  3KET A;  2RQP A;  4MIM A;  2OU2 A;  3FBI B;  4RB3 C;  3FXU A;  3WGH A;  1OCC H;  2XHK A;  5IYD J;  3BWG A;  2DMT A;  3IHU A;  4JX4 A;  5DM7 F;  3H5N A;  4BH9 A;  3R0A A;  4BQQ A;  4CCN A;  2HQR A;  4GYG A;  1E2X A;  2K9N A;  2V9K A;  3ZGK A;  3E0J B;  2CG4 A;  4DGW B;  4AD9 A;  4IF4 A;  4O6J A;  1FMV A;  2E1M B;  4HBL A;  1E0E A;  4CYD A;  3G3Z A;  3ABM H;  2ZNY A;  4BHB A;  2V1D A;  2DA6 A;  2KQR A;  1GVD A;  5IPA A;  1E3O C;  1NK3 P;  2GA2 A;  2FUG 2;  2K86 A;  3VPR A;  4KN4 X;  3E6C C;  2VJ5 A;  3MZ8 A;  5LFA A;  3W6K B;  1TQI A;  2KKO A;  9ANT A;  1D1A A;  4C2T A;  4ABZ A;  1Z91 A;  5ILV A;  2MD5 A;  1HF0 A;  1P2F A;  3RKQ A;  3CC7 I;  5DV5 A;  4NDL A;  1Y8R B;  4BXF A;  4MQ9 F;  3K4C A;  3M8E A;  5HDG A;  3F22 A;  5ERI A;  4HX4 A;  1EH6 A;  4EM1 A;  1EF4 A;  4HAM A;  2WA0 A;  4BQO A;  4WK8 F;  1U8R A;  1G3Y A;  2WC2 A;  1TT0 A;  3ZMV A;  2V9P A;  1SFO J;  4E7I A;  3DP7 A;  5CPR B;  2CSO A;  3W6J B;  2F48 A;  1MZB A;  4W1U A;  5E3L A;  3BP8 A;  1FOY A;  1W5T A;  1SAX A;  3NEU A;  1SEU A;  2MGQ A;  3GX4 X;  2FSW A;  1P9Q C;  1F4K A;  1ZG1 A;  1MSE C;  4PJM A;  2NXN B;  3DTI A;  2HQA A;  2NOG A;  4PJ0 C;  4YII A;  1T38 A;  3ZXS A;  3I59 A;  4F91 B;  2QQ8 A;  2W82 A;  3TGN A;  4IVN A;  2EV6 A;  3BLY A;  3AKZ A;  4J00 A;  1NHA A;  2IS2 A;  2VKH A;  1T6S A;  4CCJ A;  2JTV A;  1A31 A;  4U0Y A;  1KZH A;  2W25 A;  4S04 A;  4M74 A;  3E7L A;  4P1W A;  4PJJ A;  1ETO A;  1X1P A;  2X0L A;  3P9I A;  3AFH A;  3OYF A;  1SFK A;  2NNN A;  3BC8 A;  3FIW A;  2QQB A;  4RLQ A;  4E7L A;  4I76 A;  3H5A A;  3KX2 A;  4IO9 F;  1HKS A;  2R7Z J;  4F93 B;  2QKM B;  3KYD B;  3M1E A;  3V7C A;  2CV2 A;  2XKO A;  1MKM A;  3KZY A;  1D5V A;  2RDP A;  2LVS A;  3CUQ C;  5JLW A;  2XGD A;  2W7N A;  2FD5 A;  1MMA A;  1XDS A;  2LRD A;  2NOJ B;  2JPB A;  4RGR A;  3BQZ A;  1XCV A;  2XC7 A;  2VJI A;  3E5X A;  3RPU A;  2VLA A;  2DQL A;  3AAF A;  2YSR A;  1P92 A;  3CMY A;  3BG5 A;  5FRN A;  1R5G A;  1A36 A;  5J3L A;  4BNC A;  3NWT A;  1G3T A;  4CH7 A;  4U88 A;  3CMM A;  4NC7 A;  1Q1V A;  4RGS A;  1MDM B;  4FT8 A;  2CV0 A;  2HDD A;  1R4M B;  3CJN A;  1Y56 A;  3K2A A;  4CSW A;  4H0E A;  4W97 A;  3COA C;  4PSW A;  4D7M A;  3JAM Z;  2EB7 A;  4MEY F;  4X0G A;  2VQC A;  3M8F A;  2IGN A;  4RAZ A;  3FF5 A;  1XMA A;  5BPI A;  1FOK A;  4KA4 A;  2OJE D;  4BGD A;  4E7Z A;  1RET A;  1UST A;  4IPA A;  3VOD A;  4E7H A;  3CJQ B;  4EM2 A;  1DU6 A;  3TP0 A;  2Y0S N;  3LSM A;  1ZLK A;  1P7J A;  2X6W A;  4LMY A;  2W24 A;  2JA7 J;  3HRS A;  1SD4 A;  5D6E A;  1IUY A;  1QU3 A;  4MGR A;  2KZV A;  3CES A;  4YIR X;  2P5K A;  4WXH A;  1R36 A;  4M9Z A;  1XN7 A;  3JAM K;  1JXS A;  1QNT A;  1WJA A;  4EJO A;  4EEF G;  1HW5 A;  3M4O J;  3HB9 A;  3QPT A;  3OOU A;  4CDG A;  1R22 A;  2KJC A;  4WX9 A;  1Z3X A;  4CGZ A;  2LFB A;  3R0J A;  1IUF A;  1DQU A;  1TT5 B;  2HXI A;  4TV7 A;  5IP7 J;  4X1E A;  2WB1 N;  2I10 A;  3C3W A;  2MA3 A;  2XAJ A;  5FKK A;  3OYC A;  2KZG A;  2Y69 H;  4CCO A;  1YO5 C;  1UFM A;  3D5L A;  5FGM A;  3U21 A;  3WTY C;  1VFC A;  2M4K A;  1U3E M;  3S32 A;  4AVZ A;  2XAU A;  1T33 A;  2H6B A;  4DJA A;  2HTS A;  3CDI A;  2FXA A;  4GDF A;  1DPU A;  4DYR A;  2Y0S A;  1Z6R A;  2F2E A;  1Z9C A;  1K4T A;  4I98 B;  1KQ9 A;  1B72 A;  2WAE A;  4BY7 J;  5E3O A;  3HYI A;  2AXT C;  3IAS 2;  1T08 B;  3CP2 A;  2B9S A;  3OV8 A;  3ZMT A;  1OLT A;  2V1U A;  4P96 A;  3QAH A;  1OR7 C;  3HUG B;  4G94 A;  3JTG A;  3ECH A;  3Q3S A;  3OYI A;  4CXF A;  1MND A;  2AHQ A;  1J9I A;  3GO5 A;  2XGE A;  1RIO H;  1X58 A;  2IS4 A;  2LD5 A;  4BY1 J;  1XGN A;  3C2B A;  5F1J A;  1IXC A;  5B1A H;  3PNY A;  3JRG A;  1G6N A;  4P5O A;  3I64 A;  3DPU A;  4HQE A;  4AC0 A;  3JR9 A;  1TC3 C;  3BQY A;  2TCT A;  2V26 A;  5J6X A;  4YG2 F;  4IEJ A;  1JJ6 C;  1GT0 C;  1KQ8 A;  1FLI A;  5CLS A;  1HST A;  1M1E B;  4HF0 A;  3LFK A;  1FY7 A;  2RKH A;  1REP C;  2VKV A;  1ZRD A;  1ZRE A;  4V19 K;  2DOE A;  2Z1D A;  4FQG A;  2J5O A;  3SEQ A;  4B09 A;  2E2I J;  2DCE A;  4ZYA A;  1OJL A;  1IW7 F;  3K1N A;  3B6C A;  4OIO F;  1J75 A;  3JRA A;  4ENK A;  1SC7 A;  4E7J A;  4PDK A;  1YIJ I;  2PMU A;  1Z21 A;  3BCA A;  4F3Q A;  5KK1 A;  3ZQC A;  1MJB A;  1Z0X A;  3EPZ A;  4ENM A;  3CC2 I;  4DZP A;  4G7Z F;  5J4V A;  3TP3 A;  5HNF A;  2P6S A;  3DXJ F;  3KCC A;  4MNU A;  4PJL A;  2HDW A;  3QPL A;  3H36 A;  3VWB A;  3IUO A;  1P6R A;  1DUX C;  2EFW A;  4QPO A;  3A0B C;  2UWM A;  1TP4 A;  3IAM 2;  3MQ0 A;  1ITY A;  2ME0 A;  4I2O A;  1QQI A;  4CUG A;  1KU3 A;  4G6D A;  3HUG A;  4A6E A;  4M73 A;  4S0H B;  5FFZ A;  1ETX A;  2MBF A;  1L0O C;  3CMA I;  2X1E A;  1TQM A;  1VQ4 I;  2Z5U A;  1SD6 A;  2VI6 A;  4UVA A;  2M30 A;  2LF8 A;  1LJ9 A;  5L3C A;  2D5V A;  3L2U A;  3K9T A;  3BR1 A;  3PSF A;  4M6Y A;  1ORK A;  3OYD A;  2AQE A;  3HHH A;  4RB1 A;  1YRN B;  2BW3 B;  2L01 A;  3GTJ J;  4A12 A;  2P4W A;  1K78 B;  2CYY A;  5AIQ A;  1P7I A;  4PJN A;  2DFI A;  4QWQ A;  2EIL H;  4BBR J;  4CCM A;  3BY6 A;  3OSG A;  3L09 A;  2IXS A;  1D8K A;  1Y1V J;  1ZEL A;  2NRA C;  1XB4 A;  2DO7 A;  2JSP A;  5M3F J;  1CQT A;  2HDC A;  5GPC A;  2M34 A;  1WWX A;  3HTU A;  2DOD A;  1O3S A;  2ESN A;  1TL8 A;  2EFQ A;  1IXS B;  3QQA A;  3PNT A;  4ZDO A;  3BZK A;  3TED A;  2K7L A;  2CQK A;  4I0A A;  2PJR A;  4S05 A;  1IDZ A;  1ZG3 A;  5HVQ C;  1DP7 P;  2EFO A;  1TQP A;  5B66 C;  4EVI A;  3L00 A;  3DU5 A;  5H6Q A;  2ID6 A;  3A1Y A;  1FMW A;  2VT3 A;  2ICW G;  2IS6 A;  3TL4 X;  2L5Q A;  1FP1 D;  1Y1W J;  2M9H A;  2V9V A;  2XRN A;  3WTU C;  3L2V A;  2IW5 A;  3OYN A;  2YU3 A;  4NC8 A;  3Q0U A;  4O5V A;  4RGU A;  4NUB A;  3SJM A;  1ETK A;  3NWS A;  1WJE A;  2P5L C;  1GV2 A;  1U9O A;  3FXK A;  3PL8 A;  4HST A;  3OYH A;  1TTY A;  2IEK A;  1R1T A;  2KIM A;  3CD6 I;  3H3U A;  2BOL A;  2O8X A;  2VOP A;  3DBH B;  2ZKZ A;  5DCF A;  2GBY A;  2X48 A;  2CGP A;  3RYP A;  4IRH A;  4XSZ F;  2A07 F;  3LFU A;  1KQ0 A;  3RZO J;  3PO2 J;  4GRI A;  3CCY A;  1XDU A;  4ZTJ A;  5JVG F;  3VYU B;  1I5Z A;  4ZTF A;  4GFB A;  3IC7 A;  3M07 A;  2BVM A;  4A0Y A;  4HX7 A;  1LVA A;  2K9Q A;  4XRM A;  3PUB A;  2BY3 A;  1TZL A;  1FBQ A;  3SZG A;  2ZME B;  2FU4 A;  2XPU A;  3WU1 B;  1W0U A;  2E35 A;  1MMG A;  3QU6 A;  1BR4 A;  1QVU A;  5C4X J;  5FD5 A;  4BQN A;  4NC6 A;  4B44 A;  4A3L J;  2R7O A;  2R0Q C;  4BBS J;  4AIH A;  3Q9V A;  4RBO A;  3CTA A;  5A2Q Z;  2TRT A;  4L9J A;  3FKJ A;  3LAJ A;  4AYB A;  4XR6 A;  4BEH B;  3JW4 A;  1FWZ A;  3IRQ A;  1X1B A;  2CO5 A;  2IA2 A;  3SZT A;  1JHH A;  1XPX A;  2L3D A;  2M2E A;  2XKP A;  3EUK L;  1ZR4 A;  2XUB A;  2OCE A;  3V8J A;  3IH4 A;  3WTZ A;  1YE9 A;  3BG6 A;  2MG4 A;  4BHC A;  1XSX A;  3S1N J;  2XRL A;  2XAF A;  4WCG A;  1GXP A;  1JGS A;  1X1D A;  1V3F A;  2R5Y B;  1DGW Y;  2OTJ I;  1JUM A;  3VDX A;  2R5Z A;  4MHG A;  3WE2 A;  2Y9Z A;  5HLI A;  1SVL A;  1KYZ A;  2EIJ H;  4XKB A;  2MSY A;  4U7D A;  5L3B A;  1PP8 F;  2RN7 A;  2GIZ A;  4RA2 A;  3ZMD A;  1XGO A;  4HRI A;  3O3K A;  3A01 B;  1T56 A;  2RV8 A;  5FJ8 J;  2DA4 A;  3DWL E;  3PUF A;  2L4M A;  5IP9 J;  4Y52 J;  4RB2 C;  1S5L C;  4M9S A;  2DOF A;  1V5F A;  4UXN A;  2GXB A;  2QVO A;  2VT2 A;  2Z16 A;  3BTJ A;  4A3B J;  2DMQ A;  3RDI A;  4LG3 A;  3J7A O;  4OWR B;  4BHP A;  3F23 A;  2KDO A;  4ZDL A;  5B5E C;  2E36 A;  1MH3 A;  2O7O A;  3X2Q H;  3LSR A;  1FC3 A;  3ABL H;  2EPF A;  5HNH A;  2BY2 A;  4L5E A;  1UCR A;  2EWN A;  2XPV A;  1PVE A;  4LFU A;  1E3P A;  2IA1 A;  3EUA A;  1WH5 A;  4BAC A;  4IOA F;  4N9H A;  3QOP A;  4HA8 A;  2E1O A;  3VEP A;  2A6E F;  2K9M A;  4BE0 A;  3ECO A;  4Y15 A;  5BS6 A;  3FXJ A;  1Y8Q B;  1MBE A;  1BOB A;  2DA2 A;  4H4K C;  3BTC A;  3IKT A;  4I01 A;  2V7F A;  1OCO H;  1QBJ A;  4ASN A;  1MBK A;  4FTH A;  1R9T J;  1GVJ A;  2EZK A;  2BXY A;  3JRI A;  1KU2 A;  2AO9 A;  3R4K A;  3SDG A;  2ZJQ F;  1MH4 A;  1S7E A;  3KLN A;  2OAZ A;  2Y2Z A;  1OYW A;  4XLP F;  2Q2E B;  3JRE A;  2QM3 A;  2F6C A;  1VTN C;  3CCJ I;  1YYV A;  1Z6T A;  1BL0 A;  2HZT A;  4ITV A;  4AM3 A;  2G0E A;  3HG9 A;  3LA3 A;  1MNM C;  2HKX A;  3A01 A;  3QOD A;  1YJ9 I;  3BTI A;  1B8I A;  1UMQ A;  4PUS A;  5EEG A;  1KON A;  3SDB A;  1B4A A;  1BI3 A;  4II2 A;  4E4H A;  4E70 A;  4X6A J;  4XK4 A;  2E19 A;  5CJ9 A;  2LC2 A;  4R8H A;  2JSC A;  3K4B A;  2QEX I;  3HPH A;  3N97 A;  2KIU A;  1D0Z A;  3UNG C;  2XF5 A;  2JRT A;  4A0Z A;  1JKQ C;  2CQQ A;  1X3W B;  2PMH A;  2VJJ A;  5FLX Z;  3ASN H;  3BZ6 A;  1D5Y A;  2JA5 J;  4LK1 F;  3OR1 C;  4Y4R A;  3F6V A;  4Z2Y A;  3KP3 A;  1ZR2 A;  3H9Q A;  3OS1 A;  1YW7 A;  1KA8 A;  1J7K A;  2FRH A;  3RTR A;  2DPU A;  5HOD A;  1B59 A;  3O2P E;  1K4S A;  1G59 A;  1TWG J;  1HBX G;  1MJA A;  3HBL A;  3TDU C;  3BT9 A;  3WG7 H;  1DGR M;  2L54 A;  2M4G A;  1IGN A;  1MSF C;  3I9V 2;  2HS5 A;  5EZG A;  5GP9 A;  3N4M A;  3HKZ N;  1TBX A;  4LIV A;  2ZJ2 A;  5CVR A;  2DDA A;  1JT6 A;  3HOY J;  4A6D A;  1SAN A;  1U5T A;  5FLX K;  2DA5 A;  1Y0N A;  2HI3 A;  1A5J A;  3CO7 C;  3I56 I;  2BY0 A;  2Y31 A;  5HLH A;  1OMI A;  5E3M A;  3A03 A;  2EIK H;  4K2E A;  2IGK A;  3VSL A;  5E17 F;  2YUS A;  1QA6 A;  1ON2 A;  2LG4 A;  4XKW A;  3QP6 A;  5JR3 A;  2ZB9 A;  5FKN A;  1A04 A;  3EUH A;  2Z9O A;  1HSJ A;  2UV1 A;  3TBI A;  3CO6 C;  2VOO A;  3LSG A;  5M5X J;  1XS9 A;  4BDZ A;  4NBQ A;  2PI0 A;  1MW7 A;  3P7N A;  3S1R J;  1DU0 A;  2EA4 A;  1G4D A;  2K40 A;  3P5J A;  2V1N A;  1N25 A;  4QTR A;  3GBG A;  3NAR A;  4RM3 A;  4UUV A;  3S1Q J;  3S1M J;  1S29 A;  4XON A;  2GM4 A;  3RJP A;  4CCL A;  2JJ7 A;  4UV9 A;  3LAP A;  1RUO A;  1P4W A;  3E6D A;  2RQQ A;  3LQR A;  3SEZ A;  2Z3Y A;  3BCB A;  4NQW A;  3TW7 A;  1YIT I;  2H8R A;  2VJ4 A;  2MC3 A;  3I59 B;  5LGT A;  3ROU A;  3L2W A;  3HKZ A;  2MH2 A;  2OF7 A;  1QVT A;  4PK4 A;  1MIJ A;  4UVC A;  3WTV C;  4HZF A;  1E3H A;  3S14 J;  4WF2 A;  5K1Y A;  3C7J A;  2LYC A;  4N0B A;  1ZHF A;  1VQO I;  4AU7 A;  4Y13 A;  1PUF A;  2VKD A;  1HXD A;  2Y9Y A;  3GTQ J;  3ERM A;  1YQA A;  2DOA A;  1IRX A;  2ELJ A;  2QBY A;  3SYT A;  1YJW I;  1RUN A;  1POG A;  4G6Q A;  2X4H A;  1IXR C;  3ZMU A;  3GTP J;  2EFP A;  1OYI A;  2W57 A;  2FF4 A;  2LBF A;  2E1M C;  2ME6 A;  2QZ8 A;  5EYR A;  2B7E A;  2M5W A;  3U1K A;  3VYS B;  2WAD A;  1WI9 A;  2PMZ N;  3DEU A;  4DYQ A;  4XRF A;  2IGM A;  5J47 A;  1K7A A;  5L3F A;  4QSH A;  2Q1Z B;  1SAU A;  2IA0 A;  2A6T A;  3JRH A;  2EZH A;  1W7P A;  1S72 I;  4B47 A;  1VZ0 A;  1UZC A;  3FZV A;  1T98 A;  3WTW C;  2R7X A;  1F43 A;  5GAH J;  2MW8 A;  4OMZ A;  3PO3 J;  4XLE A;  3C2H A;  5E1X A;  4D5F A;  3OR2 C;  3E97 A;  1FOW A;  2JQ7 A;  3IV5 A;  3CDL A;  2XAQ A;  1XMK A;  1VQ6 I;  1ODD A;  2ELK A;  5FO5 A;  2H09 A;  3GFI A;  2WV0 A;  2CS3 A;  2VB6 A;  4Q4Z F;  4F52 A;  3TOA A;  4I7H A;  4HDU A;  4F55 A;  3RIR A;  2FOW A;  1W5C C;  3HSF A;  4XN0 A;  4L18 B;  3ESW B;  1I3A A;  2BYV E;  3RI4 A;  4AID A;  4LD5 A;  2MH9 A;  1VQK I;  4OIP F;  1W4M A;  1VQL I;  4PFO A;  3QYB A;  1XC5 A;  3DLA A;  1IO2 A;  3DEW A;  4LIU A;  2ZFW A;  2XAS A;  2DLL A;  3BG7 A;  2ESH A;  3V4G A;  4M6X A;  2CWE A;  2YPR A;  1WJB A;  1SD7 A;  2PMZ A;  2VAS A;  2XVC A;  2DA7 A;  2Q0O A;  2QSG X;  1S3J A;  1ZK8 A;  2OQR A;  1OCT C;  4RAG A;  2JUG A;  3OIQ A;  1RC9 A;  2HNH A;  4ANJ A;  1FNN A;  2KIF A;  4Y33 A;  2NAZ A;  3SFZ A;  3I4P A;  4UUT A;  1LB2 A;  4G8X A;  2CUJ A;  1IN5 A;  1BJZ A;  2JRM A;  4KT5 C;  4JYK A;  1YTY A;  3PJR A;  1MJ9 A;  5ILS A;  3RSN A;  1EH8 A;  4XRS G;  1MBG A;  1QZE A;  3K4K A;  3KIO A;  1ETQ A;  2KRC A;  1LE8 A;  1O4X A;  2K4B A;  2R7S A;  2VC1 A;  1FJL A;  1XTA A;  4IL6 C;  5DEQ A;  5CKT A;  3SFI A;  2XF7 A;  1D3Y A;  3F3X A;  3W3C A;  1HLV A;  5AON A;  5EEA A;  4XM3 A;  3VYR B;  4GYI A;  2GLO A;  3LMM A;  3GVA A;  3K7A J;  5LGN A;  3IKV A;  3VYT B;  2HOE A;  1B72 B;  2B0L A;  3BTL A;  2QEN A;  5HS7 A;  3EYI A;  1PDN C;  2FMY A;  2V6E A;  4KNY A;  1LEB A;  3FBN B;  2PFB A;  1DP3 A;  2P6T A;  1A35 A;  1BJA A;  4C3I J;  4CZZ A;  3L2R A;  1WSU A;  1R1U A;  5C44 J;  2R7U A;  4M72 A;  1IN4 A;  2CFO A;  2OBP A;  1B6A A;  3QYE A;  4N4O B;  3ZQH A;  1HC8 A;  1VQ7 I;  1T2K A;  1IG7 A;  5IOZ A;  1WRJ A;  1LQ1 A;  2FQ3 A;  2HVS A;  2BVL A;  3C2G A;  1F1Z A;  4XIC A;  3MKZ A;  3R6S A;  2YX7 A;  3CUQ A;  4B8X A;  3H1C A;  1JTY A;  2DFF A;  3LA2 A;  2HR3 A;  1ZLJ A;  4UHT A;  3DKX A;  2HTJ A;  1R00 A;  2JN6 A;  5M3M J;  1LFU P;  3CJT B;  3I71 A;  2QQA A;  3AG1 H;  3G1M A;  5GTI C;  2QUF A;  1ZYR F;  2JVH A;  5FKL A;  3U9G A;  2KDZ A;  2L7Z A;  4B3X A;  2L9R A;  2FOK A;  1WPK A;  4KDP A;  2OUM A;  3BPV A;  2CUF A;  2F4O B;  2FBH A;  5FD6 A;  2W84 A;  2GQQ A;  1R49 A;  2LK2 A;  3FWE A;  1G8X A;  2M1B A;  3RQ4 A;  4BJT A;  3JCU C;  2IGO A;  5GAE J;  2HZD A;  3TO7 A;  3OL3 A;  3DV8 A;  4A0X A;  5DUI A;  2LF7 A;  2NS7 A;  5J1Y A;  5LEK A;  3OS0 A;  2YR2 A;  3MKY B;  2VPR A;  3QPS A;  1EV7 A;  3WU0 A;  3OL4 A;  4ZYE A;  3GW2 A;  1MD0 A;  3WGG A;  2XB0 X;  3PFY A;  2IVM A;  5L3G A;  3TO9 A;  2DI3 A;  3BR2 A;  3HHG A;  5B1B H;  3F8M A;  3FK7 A;  1ZAR A;  4JK1 X;  2ZCW A;  4A3K J;  4LG0 A;  4IHS A;  2RNJ A;  2NVT J;  5IOY A;  4LK0 F;  4FE4 A;  3IRR A;  3I3L A;  4XSX F;  3RPU D;  2NS8 A;  4AIK A;  2ZC2 A;  5D8L B;  5GPA A;  1ZG5 A;  2E2J J;  2KHM A;  1Y6I A;  1OKR A;  4KUM A;  1O7L A;  1R1V A;  5J8F A;  3G6E I;  3HZJ A;  2Z99 A;  2DJI A;  2E71 A;  3OIP A;  1Z77 A;  3KEY A;  3GFL A;  4P9U A;  4D7N A;  4HNV A;  3HL2 A;  4J01 A;  4LGW A;  3T8R A;  3M7G A;  1YI2 I;  4ZYD A;  1XSD A;  1RR8 C;  1O3R A;  3L7W A;  5GAG J;  1WZ2 A;  4L5J A;  5D6F A;  3K4L A;  4E6K G;  4RLF A;  2EBI A;  3A02 A;  1BIA A;  4KMU X;  2JA6 J;  2W48 A;  1X1C A;  2DTR A;  4ZJZ A;  1JGG A;  3LA7 A;  1IN6 A;  2M45 A;  1CF7 A;  2A69 F;  3K1M A;  1BBY A;  3ZCO A;  4ZDP A;  5KNL A;  3B73 A;  1UJ8 A;  2CFX A;  4EJV A;  2GXA A;  2FE3 A;  5IYC J;  2P81 A;  5ICF A;  1D1B A;  3ZQI A;  3JSP A;  1LUJ B;  1R5H A;  4Q5S F;  1LNW A;  2PJR B;  2NVU B;  3ASO H;  3HXL A;  5F6F A;  2RC4 A;  1YG2 A;  4A3E J;  1FTT A;  3TO6 A;  2L7M P;  2ZXJ A;  4ZYH A;  5ICC A;  1B1B A;  2VXD A;  3ZMS A;  2HQN A;  3CME I;  1WVR A;  4OMY A;  4Y7N J;  2ZJP F;  1I27 A;  3F6O A;  3RZD J;  5FLM J;  1OR7 A;  4LB6 B;  3LWF A;  2DA1 A;  1T0F C;  2HVQ A;  3VSK A;  4LLL A;  5DUK A;  2PG4 A;  2FBI A;  3B6A A;  1X4P A;  5BNG A;  1IJW C;  4HOB A;  3S8P A;  5FKM A;  2OD5 A;  4BXU A;  2LRE A;  3TDZ C;  2OCC H;  2EQR A;  4HG2 A;  5LGU A;  2OA4 A;  3J81 Z;  5J1U A;  5C3E J;  3JRC A;  4NHJ A;  1BW5 A;  1V54 H;  5DM6 F;  1VQ9 I;  5F0H A;  3FDY A;  2HOT A;  3KLO A;  2A5W A;  2JT1 A;  2X1D A;  2ZXH A;  2EH3 A;  3ZQL A;  4PGH A;  1W5S A;  2VXZ A;  1QHH D;  3HOT A;  3F8N A;  1MBF A;  3QP5 A;  1Y0U A;  5K7H A;  3K4M A;  1TWC J;  4XLC A;  3IH3 A;  3R61 A;  2BBY A;  1TWH J;  2CJJ A;  3DTK A;  2COM A;  4M3F A;  1V5E A;  3GLL A;  3M3Y J;  4EJT A;  2E5N A;  1VQP I;  1BR2 A;  2DYS H;  2LKS A;  5F1R A;  1BC8 C;  3BR3 A;  4L5I A;  4IKF A;  2M8G X;  3HOW J;  1QHG A;  3WU2 C;  3H0G J;  3J81 K;  3ZMZ A;  5H6R A;  2LLK A;  2EIN H;  2X1C A;  1ZGJ A;  3H3V K;  3JSO A;  4ZH4 F;  1I6X A;  5CVI A;  3RQI A;  3AL0 B;  3FXM A;  4KIS A;  1Z7U A;  4FET A;  3A4C A;  2DMU A;  3S15 J;  2O03 A;  4DBR A;  3HRT A;  2NYX A;  2JUC A;  2H27 A;  4AYB N;  2LY1 A;  3GFJ A;  3DTE A;  1ONV A;  1F5T A;  1W36 D;  1AHD P;  3DFG A;  4M6V A;  4LB5 A;  4IX7 A;  1BM9 A;  2R5Z B;  2L9S A;  3ONQ A;  2HWV A;  1AU7 A;  2DT5 A;  2EFN A;  5E8G A;  2QGU A;  1MMN A;  1ULY A;  4CO8 A;  3ZPL A;  1SVO A;  2HU9 A;  1UHM A;  3LNQ A;  2R93 J;  3RCO A;  5D5W B;  4CA0 A;  4RMN A;  2WV1 A;  1ETW A;  1LVK A;  2EJR A;  4XNF A;  3KFW X;  3KP5 A;  2PEX A;  5ICG A;  2E1C A;  2GOM A;  2DFH A;  1XGS A;  4MFD A;  4OOI A;  2STT A;  2K5C A;  4A3G J;  3L2Q A;  4A3J J;  2VIX A;  1YX5 A;  1JUP A;  1K6O A;  1ENH A;  2KP6 A;  5JVT A;  1JKP C;  3R60 A;  4CZC A;  4HV5 A;  1HW1 A;  2ZXW H;  1K83 J;  4EJW A;  3DPL C;  2R3S A;  4YIF A;  2PJP A;  4PFP A;  1GLN A;  2CRG A;  2JMW A;  3FXO A;  2P5V A;  3ZQ7 A;  2X6Y A;  4G12 A;  1X4O A;  3CCU I;  4M9X A;  1MMD A;  3J7Z I;  1P4A A;  1FSE A;  3EET A;  2JZY A;  1GXQ A;  2ZME C;  2BZT A;  2IRF G;  4IJA A;  4WXC A;  3CF2 A;  3NQO A;  1FPQ A;  5HLG A;  1HOM A;  2DTZ A;  4XOR A;  1ZGW A;  1JKO C;  4XL9 A;  4BDY A;  1HDD C;  1F9N A;  3CZ6 A;  3JRF A;  4YFK F;  1ZGA A;  2F5V A;  3F8F A;  3CF5 F;  2LTP A;  2DJN A;  4PCQ A;  4HYE A;  4U0W A;  2R92 J;  1I1G A;  2EZI A;  1KGS A;  2ISZ A;  3Q5F A;  1LDK B;  5LHG A;  1OYY A;  1G2H A;  2RGV A;  2NVY J;  1WGX A;  5A2Q K;  3GZ5 A;  4F92 B;  5DD8 A;  1X3U A;  2QF7 A;  4YRV A;  1B8I B;  1D1C A;  1SD5 A;  2HEO A;  1UHS A;  2KT0 A;  2VQG A;  3G73 A;  3M8J A;  1VND A;  1EA3 A;  1R5I D;  5E1Z B;  2PX9 A;  3WHB A;  5ED4 A;  3OYL A;  1GUU A;  2COB A;  3H9J A;  3Q0V A;  2XIG A;  4MTE A;  4L0Z B;  3S3O A;  3HC7 A;  3MWM A;  1IRZ A;  1U2W A;  1BI1 A;  3HEF A;  3GZ6 A;  3H35 A;  4Y3O A;  2F5F A;  3S2H J;  2DU9 A;  2EV0 A;  1ZQ3 P;  4EM0 B;  4LOC A;  4B1R A;  5LLQ A;  2C6Y A;  2A61 A;  4GXO A;  1YJN I;  1U78 A;  3J80 Z;  3S2D J;  2O61 A;  1RR7 A;  3A0H C;  4IZZ A;  2I8D A;  4KYW A;  2A5Y B;  1H88 C;  2O8K A;  4AIJ A;  3BG3 A;  1MNE A;  5TIS C;  2VE8 A;  2D1H A;  1D0Y A;  5EG0 A;  2CUZ A;  2ETH A;  4FHT A;  1FIP A;  3GTO J;  2Y48 A;  2VOD A;  2KRF A;  1R71 A;  3H5R A;  3IWF A;  3MMY B;  3T1B A;  3ZN1 A;  4Q48 A;  5K5O A;  3MZY A;  1U5T B;  2M7B A;  1IV8 A;  3SXY A;  3BR5 A;  4N9I A;  1P4X A;  3OYE A;  3J80 K;  3F8C A;  2DA3 A;  1XMX A;  3CP8 A;  4IRG A;  3LSK A;  4B48 A;  3M9A A;  1IN8 A;  3DF8 A;  3LSH A;  3BG9 A;  4UUS B;  3FXQ A;  2ACJ A;  2UXX A;  1OQY A;  1S7O A;  2CW8 A;  3HM5 A;  4L9N A;  4L0Y B;  3PIP F;  1S6L A;  5BMZ A;  1NH3 A;  3HTS B;  1VI0 A;  1KYW A;  3D5R C;  3GFM A;  1TWA J;  2K3P A;  3OYJ A;  1H0M A;  1VQN I;  5LHH A;  1PJR A;  1USS A;  3KEO A;  3QU3 A;  1YX3 A;  5DTD A;  3HOX J;  1YW8 A;  3Q0W A;  4NQW B;  1H89 C;  3E5Q A;  4YFN F;  1I3Q J;  2F5D A;  2MLG A;  2ZSH B;  3FMR A;  3IP4 B;  2HXO A;  4C30 A;  1BOA A;  1AKH A;  2MC4 A;  1RES A;  4M3E A;  4FCY A;  2CW7 A;  3V42 A;  1XGM A;  2H1L A;  2E1N A;  3OMY A;  4XQF A;  1PUF B;  2X85 A;  3LQQ A;  4ESJ A;  2ZFU A;  3Q9S A;  2CUE A;  3W2V A;  5J40 A;  1MMS A;  2D1V A;  3KP4 A;  2QBY B;  4LLG F;  1T39 A;  3F21 A;  1X2M A;  2XB5 A;  1QGP A;  2ZJR F;  2VPL A;  1YLF A;  3D5S C;  1VF9 A;  5DDG A;  4A3M J;  2LBF B;  2W85 A;  3HOU J;  3BRO A;  1LDJ A;  4FIS A;  4I6Z A;  2IPQ X;  3O8H A;  4I99 C;  2KL4 A;  3MCZ A;  2R7D A;  1W7P B;  3DCF A;  2X9D A;  4UUS A;  5E1W A;  1RKT A;  1YS7 A;  1UB9 A;  2M0M A;  4OAY A;  4EAT A;  3EYY A;  2MAB A;  1ZKG A;  3HGY A;  3A2K A;  1UHW A;  2Z2S B;  4BJ6 C;  2OZ6 A;  5LHI A;  1OIS A;  2BEO A;  1APL C;  4A3D J;  2PBI A;  3IWZ A;  4MFE A;  3P9C A;  1G3S A;  2ZXI A;  2IP2 A;  3DBL B;  2DW4 A;  3L2C A;  2PN6 A;  2CH0 A;  3CCR I;  3GWZ A;  1BW6 A;  2XAH A;  3S3N A;  2L9V A;  1J0R A;  2KMU A;  1Z3Y A;  5EGO B;  2JPC A;  2GWR A;  3D0S A;  5GTH C;  3K2Z A;  2STW A;  2EA2 A;  4DYC A;  3PIO F;  3DKY A;  5BQT A;  1LDD A;  1MBJ A;  2BY1 A;  2NS0 A;  4XBF A;  3U2R A;  1SMY F;  2QYO A;  5M5W J;  4LLN A;  2VKE A;  2H6C A;  1N78 A;  1WCM J;  2LDU A;  3V7R A;  5BOX A;  3G4S I;  3MKW B;  2HPI A;  3I55 I;  3KPH A;  4D9J A;  3CCS I;  5JFR A;  3K10 A;  2KIQ A;  3AG4 H;  3GUD A;  5F0F A;  2OV7 A;  1X1A A;  5IYB J;  3DBR B;  5HDN A;  3CCE I;  1IRF A;  2MYS A;  4R1H A;  4I0B A;  3TMO A;  4KIT B;  2P7V B;  2K9S A;  3U1D A;  1C0W A;  2QCO A;  4HNT A;  2DK5 A;  4I09 A;  1WHU A;  1GDT A;  2WBM A;  1KU7 A;  3MKL A;  1JT0 A;  2RRE A;  2MD0 A;  3HRU A;  4JP0 A;  3GTM J;  4KIG A;  5E79 C;  1LE8 B;  3GTK J;  1WQ2 A;  3ERE D;  2L9N A;  2GIV A;  1SFE A;  1S9H A;  2CQN A;  4KFC A;  3OYK A;  3HOV J;  3FMQ A;  2VC0 A;  2E2H J;  4C2U A;  1TLH B;  1N75 A;  2EK5 A;  2D45 A;  2K27 A;  3CJR B;  3J7A Y;  1K61 A;  5EGO A;  3K70 D;  3ELK A;  2VBW A;  3F72 A;  4YFX F;  4FE7 A;  1QPI A;  4G9Y A;  2P8T A;  2RVC A;  4G7H F;  3OSF A;  2K02 A;  4GCV A;  2B63 J;  3KZZ A;  4CIC A;  1PYV A;  2VUM J;  2J5P A;  3LOC A;  5HLT A;  2DBB A;  2CV1 A;  4O3M A;  2Q8K A;  2FEZ A;  2L7F P;  3MN2 A;  3I58 A;  3C18 A;  1ETV A;  3SZP A;  4A3C J;  1O3T A;  5EEH A;  1U6G A;  4N4N B;  1TW3 A;  2VQH A;  1YOV B;  2UUZ A;  2FQ4 A;  1KU9 A;  2KJB A;  5ICE A;  1YW9 A;  4ZC3 A;  5D5U B;  4RGX A;  2WAQ N;  5LBQ A;  1IC8 A;  2LKX A;  3LSJ A;  4RS8 A;  4EJU A;  4IOC F;  4CYC B;  1ERD A;  4ESB A;  3FX3 A;  3IL2 A;  3GCM A;  2V1X A;  3CUQ B;  4KIF A;  1E17 A;  2ELH A;  1EKE A;  2W00 A;  2ID3 A;  5E8I A;  4ZYG A;  2IT0 A;  4HPQ A;  4YEJ A;  2K9L A;  2HYJ A;  4QPQ A;  1S7A A;  4DZJ A;  3L1P A;  2O3F A;  2GOX B;  2OZU A;  1FX7 A;  1TNT A;  4U7B A;  3S93 A;  2GA1 A;  4NB5 A;  4BKX A;  4JOM A;  2KPM A;  2G7U A;  4YEL A;  2DFE A;  1RNL A;  1J2X A;  4KT6 A;  5LRS A;  2DYR H;  3O8G A;  1GV5 A;  4HDV A;  3CC4 I;  4L9T A;  1ZAO A;  1ZTR A;  5JHF A;  4AVP A;  1WJD A;  4C3H J;  3KYL A;  1I1S A;  1HW2 A;  1GHC A;  4RDU A;  2DXI A;  2V4J C;  2AQF A;  3KP7 A;  3JTH A;  4HSR A;  1EJ9 A;  3I0T A;  4ENN A;  2ECC A;  1QZY A;  5FRO A;  4A3I J;  2IS1 A;  2DQR A;  5EDN A;  2MLK A;  3MD2 A;  3WOD F;  5LEJ A;  2NNY A;  4JBA A;  3DPT A;  1X19 A;  3GXO A;  2IBD A;  2ECB A;  2XPW A;  4BAY A;  3WTT C;  1HCR A;  4XID A;  2WAQ A;  4OIR F;  2AS5 F;  3T0Y A;  1I50 J;  2CQX A;  5JHU A;  1WH7 A;  1I6H J;  5FKO A;  3I5U A;  5JI6 A;  4LG0 B;  2LR8 A;  1B9N A;  2K3F A;  3T5X A;  1W7P D;  3FM3 A;  4ON0 A;  4C2M J;  2LY9 A;  3MFK A;  3S16 J;  2R7V A;  3ABK H;  5B3S H;  3EQL F;  5CYV A;  4E7K A;  5HS8 A;  4CYC A;  1A6I A;  3NAU A;  1ZRF A;  2H94 A;  2O6G E;  2BGC A;  3G2B A;  1WJF A;  2X51 A;  3QOE A;  3HPG A;  2WY7 Q;  5JLX A;  2R7T A;  5KAI C;  3C1D A;  3SQN A;  4BJ5 C;  3S2W A;  5J1R A;  4IQ4 A;  1K79 A;  2Z33 A;  2XSD C;  2JK3 A;  4UB8 C;  2QSF X;  5E20 A;  2K4J A;  5FB2 A;  1W36 C;  1WJ5 A;  2IAI A;  2YS9 A;  4HF1 A;  1BI0 A;  1BC7 C;  2HYG D;  1XX5 A;  1CF7 B;  3TKY A;  3ULQ B;  4OIQ F;  2VBZ A;  5ILU A;  4EMS A;  1FOX A;  2FNP A;  3FXR A;  2XRO A;  3ABU A;  2CQ7 A;  2W4S A;  4HNU A;  1RKW A;  1O3Q A;  3HOZ J;  2A68 F;  3GZN B;  4PGG A;  3N05 A;  1LKX A;  2R7R A;  3GF2 A;  5GAD J;  1MDM A;  2LKP A;  4U87 A;  3WTS C;  1FYK A;  3OY9 A;  1OCR H;  4II3 A;  1J59 A;  2F4I A;  1X3Z B;  4OIN F;  1BA5 A;  5C4J J;  1FBU A;  3DKW A;  3AG2 H;  1WFX A;  2E60 A;  4AUX A;  3W2A A;  1X2N A;  3LSI A;  5DCM B;  3WHC A;  2GXG A;  2ZSI B;  4IQJ A;  1JI8 A;  1FTZ A;  1BIB A;  4A93 J;  1Q1H A;  3G1O A;  4XLA A;  1WI3 A;  4EV0 A;  4HEA 2;  4R79 A;  2H8W A;  1Y39 A;  3H9G A;  3G71 I;  1PUE E;  2L7K A;  3HJE A;  2DAO A;  3F9K A;  4BU2 A;  1WJC A;  3LSP A;  2O5R A;  1LFB A;  3DLL F;  4DIQ A;  3H0D A;  4M3B A;  3E6M A;  3CCL I;  3MAJ A;  2L4A A;  4E7S A;  4MTD A;  4UVB A;  1V4R A;  2CW0 F;  1U9N A;  5D8K B;  2P0W A;  1Z67 A;  3HOS A;  1XCB A;  4J19 A;  3NRV A;  1OFC X;  1CGP A;  1VQM I;  2KFD A;  2KLO A;  4RAY A;  1UAA A;  3GLX A;  2FML A;  3E5U A;  5TJJ A;  2HFH A;  4JX5 A;  2WB1 A;  2O0Y A;  3IH2 A;  1IZ1 A;  5KAF C;  2A3S A;  4XLH A;  1FBS A;  3FKI J;  1B9M A;  2V79 A;  2HQ5 A;  5KCM A;  2FA5 A;  4MQV A;  2RAE A;  4HX8 A;  2CMP A;  4V2F A;  3GTL J;  5DS9 A;  1QRY A;  1XD7 A;  2Y75 A;  3HRM A;  3HSR A;  3KZI C;  5L3E A;  4XOP A;  3E6B A;  2XSJ C;  2LSO A;  4QIW N;  1VQ5 I;  5DCM A;  5M5Y J;  1R6R A;  2M3A A;  1W1W E;  2QWW A;  4UNO A;  2F4M B;  5HOO A;  4B4C A;  3CDH A;  3PSI A;  4DOZ A;  4RB0 A;  3HGG A;  1JUS A;  3QYF A;  1HA8 A;  1DPR A;  3CQZ J;  1OPC A;  2DDB A;  3OWT A;  3PM1 A;  4JX6 A;  1G3W A;  3OYG A;  2DN0 A;  3KP2 A;  1ZH5 A;  4CHU A;  1HQC A;  4WXD A;  4JQF A;  2G9W A;  1SFU A;  3KP6 A;  4G7O F;  3HSE A;  2HVR A;  4AWX B;  2O9L A;  5E3N A;  4BUP A;  4LJZ F;  1R58 A;  3WE3 A;  2BHY A;  1LPQ A;  4XKC A;  1J09 A;  2XGX A;  3GEZ A;  3K4J A;  5IT9 Z;  5LRR A;  1RRJ A;  1IAW A;  5K5R A;  3DEE A;  2K85 A;  3BOQ A;  3OOP A;  4KIC A;  2LNB A;  1WKM A;  5J8C A;  4GGG A;  4RAF A;  4BQA A;  5K5Q A;  4MEX F;  3MZH A;  3V8L A;  2HKO A;  3H92 A;  3HIF A;  3LST A;  2OQG A;  2OC6 A;  1VQ8 I;  3WG9 A;  4BS9 A;  1HDP A;  5F27 A;  3RYR A;  4G6T B;  1N77 A;  4DW6 A;  5KHD A;  1F36 A;  1FP2 A;  1UEL B;  1ZN2 A;  5FRM A;  3QPH A;  3K6G A;  2HOS A;  2LOO A;  2FNA A;  1YS6 A;  4GO1 A;  2AXL A;  2WY8 Q;  4A69 C;  1O57 A;  3S17 J;  2VQL A;  1D0X A;  5H20 A;  1RZ4 A;  1TWF J;  5IT9 K;  1IV6 A;  1T0F A;  4KJZ A;  3OYM A;  4RM2 A;  4BE1 A;  1V55 H;  4Y17 A;  5CQE A;  5EF6 A;  1JTX A;  1BR1 A;  4UY8 I;  4HV6 A;  3FXL A;  3AL0 C;  1T95 A;  2E5Z A;  2ZNZ A;  3KEQ A;  4MLO A;  4Z6Y A;  2NVQ J;  5CQG A;  4NNJ A;  2P7C B;  1ETY A;  2FX0 A;  1IF1 A;  1OCZ H;  3TOB A;  1H9G A;  2DK8 A;  3PNV A;  4D5C A;  1YHQ I;  3BR0 A;  4UB6 C;  2Y0M A;  3ZP5 A;  3DU6 A;  2R7Q A;  1YIO A;  2ISY A;  1H8A C;  4BXX J;  6PAX A;  2JWT A;  3P9K A;  1D8J A;  2VBX A;  1DDN A;  2FBK A;  1T8I A;  3VFZ A;  4M3D A;  3PQJ A;  5BPD A;  3K0L A;  3ZRG A;  2BW3 A;  1YRN A;  1NTC A;  2VON A;  1XG1 A;  1STZ A;  1K78 A;  4FX4 A;  1NK2 P;  3L9F A;  3B02 A;  1FEX A;  1HKT A;  2UZK A;  2HOA A;  3QRF F;  2F5C A;  2EV5 A;  4C9Y A;  2QA4 I;  3ZR8 X;  3I4M J;  4B43 A; 
#chains in the Genus database with same CATH homology
 1Y0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...