1Y0NA

Structure of protein of unknown function pa3463 from pseudomonas aeruginosa pao1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
71
Chain Sequence
GHMLIPHDLLEADTLNNLLEDFVTRETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0270 protein PA3463
publication title Hypothetical protein PA3463 from Pseudomonas aeruginosa strain PAO1
rcsb
source organism Pseudomonas aeruginosa
total genus 21
structure length 71
sequence length 78
ec nomenclature
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06794 UPF0270 Uncharacterised protein family (UPF0270)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A YehU-like 1y0nA00
1Y0NA
chains in the Genus database with same CATH superfamily
2KISA 3KYLA 3BZ6A 2ZO4A 2A6EF 3BLYA 4LK0F 1BC7C 3HUGA 3DTIA 4RLQA 4W97A 3S8PA 5IY5H 3CCQI 1J0RA 3IH3A 3T1BA 5TISC 4KMFA 3CCLI 1QGPA 4LOCA 2VBXA 3MZYA 4CICA 2GA1A 1ZRFA 1JXSA 1IN8A 2E1OA 2VXZA 2QUFA 1FNNA 5FKOA 1TQIA 3L1PA 4P1WA 2ZMEC 1UHMA 1AOYA 3CDHA 1ZLKA 2LFBA 4RAFA 1IUYA 2BW3B 2M4KA 3DPLC 3E7LA 5K1YA 1BBYA 2NVQJ 3VYUB 2OA4A 2OZ6A 4BQOA 3CC2I 4BQQA 4MQ9F 3C1DA 3EDPA 1D0ZA 2Q1ZB 2JPBA 3ZN1A 3HTUA 4KN4X 4D9JA 5K5QA 3KP4A 5D6EA 4XLHA 2CU7A 2VN2A 2BXZA 5BPDA 1ZH5A 4RLFA 2CUJA 1AA7A 5H6QA 4G7ZF 1LDDA 1FC3A 2X6YA 5HLGA 3O3KA 2VI6A 1QBJA 4CYDA 1LVKA 2W84A 3U21A 4A5MA 3D0SA 4MTEA 4C3IJ 2IGOA 2NAZA 3JSOA 2UXXA 4ANJA 1ZGWA 4JP0A 3WTTC 2XPWA 1ZRCA 2LKPA 4ZJZA 4DNCA 4LLNA 1NG6A 1Q1VA 2IGKA 2XRNA 1MNMC 1SANA 2DAOA 2K3PA 1BW5A 1Z7LA 4XIDA 5EF6A 1ZYRF 1W7PD 2HWVA 3RKQA 4IL6C 5FKNA 4P9UA 2PBIA 3IP4B 3ABMH 2HR3A 5J4VA 4ENMA 3CO7C 4BBSJ 2OJED 1FY7A 4WXDA 2OZUA 1TTYA 2W7NA 3GTOJ 2UXNA 5E3LA 1SD4A 1O3QA 2FNAA 1I3QJ 3EPZA 1CGPA 4MO7A 2KJBA 3G1OA 4O6JA 3M7GA 4B43A 2F5DA 2MC3A 4DOZA 3PUBA 3PM1A 5IT3A 2DOAA 2DA3A 3DV8A 1JKQC 4PJ0C 4ZYEA 2FA5A 3SYTA 1R23A 1D5VA 2V1NA 4EJOA 4A3GJ 3JRCA 1K4SA 2CH0A 1SD5A 3BR3A 3QP5A 2MD0A 3JTGA 4IVNA 1M1EB 3BPVA 2OPTA 1WI9A 2A68F 2CRGA 3HG9A 4EQQA 3AAFA 4HF0A 4AWXB 2XGDA 4CHUA 5CVJA 1SVLA 3NWSA 3I9V2 1E3PA 2FUG2 3NRVA 4IPAA 5D5VB 2DK5A 1BR2A 3BZKA 1WHUA 3S3NA 2YSRA 1DGWY 3CLOA 2H6CA 5J40A 4A0XA 3OYEA 3O6BB 4P9FA 4JOMA 3W2AA 1GUUA 3HRUA 1Z91A 1EH6A 2OTLI 1JGSA 2RNGA 3AFHA 2L7MP 1A5JA 3OSFA 1V55H 3BG9A 2E35A 4N4OB 2BZTA 3GLLA 2LY1A 5KK1A 3U2RA 1YLFA 1RRJA 2DOEA 3QYEA 1J5YA 3ZQIA 3T0YA 5HDNA 2BHZA 4HX8A 2M0MA 3H3VK 3KETA 2COMA 2X1CA 4LLLA 1U5TA 2DO7A 2JRTA 3J7YJ 2WY8Q 1B1BA 3I56I 1W4MA 2ICWG 1HQCA 5J3LA 5DCMB 3KZZA 3GVAA 4XN3A 4Y17A 1R5ID 2KRFA 4PUSA 4UUTA 1B6AA 2JQ7A 2KZVA 2I5UA 4HOBA 1H89C 1XCVA 1TT5B 3SFIA 1C0WA 4EM0B 3BQYA 2KL4A 4F7ZA 2JN6A 3HZJA 5BNGA 1F5TA 2VKDA 4B1RA 2BYVE 5KCMA 3HGYA 2R7DA 2DT6A 1ODDA 3FHNA 5CKTA 4KICA 4XKWA 1GDTA 1FSEA 1WVRA 1B8IB 1STZA 2X6WA 3FMSA 1P4XA 4XLPF 4HZFA 2KIMA 1F36A 1D1CA 1JTXA 3M8JA 3VODA 2VE9A 2G0EA 2F5FA 1ZGJA 3F8NA 2VIXA 1JTYA 4GGGA 5K5RA 1RI7A 1HKSA 5J8FA 3J7ZI 2QQ8A 5TRDA 4I0AA 4U7DA 3G71I 3ERMA 4BUPA 3L7WA 1JGGA 1FX7A 4CDGA 3BOQA 3CDLA 1WJ5A 2E60A 2M7BA 3BR1A 2PLYA 1VFCA 2IS4A 4EEFG 2BVMA 2QYOA 2V6CA 1OQYA 4PK4A 2VPLA 1MBHA 2F2EA 1QZZA 4E7JA 4Y4RA 2PMZN 2M8GX 3F6OA 3D1NI 3RDIA 4UB6C 5AONA 1N75A 2ZJRF 2DMQA 3QU6A 5J6XA 1Q1HA 1WGXA 2P6SA 1MSFC 3D5SC 2RV8A 4KITB 3IRQA 1VF9A 1DPUA 3WODF 3EETA 3LA7A 5E8GA 1MNEA 3HKZN 3TDUC 3ZQHA 2GWRA 1UAAA 2HFHA 3K1PA 2W48A 1YITI 3FKIJ 4OMZA 1YG2A 5ICCA 2EIMH 5FD5A 1O57A 2ZJ2A 2K85A 3BDDA 4M3BA 2IS6A 4N9IA 3ZMVA 2DPUA 1QU3A 1D0YA 3FKJA 4G12A 2A07F 3CUQC 3C2BA 1I3AA 1X4OA 2ZMEA 3E5UA 4E4HA 1VI0A 1S5LC 1I6XA 4E70A 3WTVC 3CDIA 5DCFA 1G3TA 4KT6A 4NNJA 5M5WJ 5EGOA 3CMAI 2HOAA 2OQGA 4YG2F 2CV1A 2XAGA 2DXIA 2DJNA 4BDYA 4K2EA 2DMPA 1R58A 4AIDA 3IRRA 4M9ZA 1H0MA 2RQQA 4XLAA 4S0HB 2VKVA 1RR7A 3DEUA 1BI3A 2HKXA 1KYZA 2LREA 4AU7A 3ASNH 2R3SA 2ZSHB 3M1CA 1IZ1A 3OYLA 4AIKA 4GO1A 2HDCA 1EF4A 3IAS2 2DMTA 2L2OA 1UB9A 2L54A 3M9AA 1T8IA 1FMWA 3DEWA 1WWXA 1OJLA 3TQNA 5JLXA 2DT5A 2VQGA 3KP7A 4L5EA 3HUGB 3NWTA 5JHUA 1W36D 1JI8A 4DGWB 3LSPA 4MFEA 2HEOA 2MBFA 2JVHA 3CF5F 5LEKA 1K6YA 3ECHA 1RESA 3LA3A 1WJEA 4P55A 1LNWA 1OCPA 2EV6A 4I0BA 3DCFA 1HA8A 4UVAA 3P9IA 5F0CA 2Y2ZA 3ISPA 3KEYA 1PUEE 1KU3A 2GLOA 1P7IA 2OU2A 1SFUA 1TWHJ 4UVBA 1WJBA 1PP8F 4KA4A 3IUOA 2E34A 4BDZA 3A03A 5IPAA 3S15J 4R8HA 2ECBA 3WE3A 2ZNZA 3E5XA 2O8XA 4G8XA 3WTXC 2XGEA 1RPWA 2XHKA 4UV8A 5AIQA 3QWLA 3QYFA 4I2OA 2A5WA 2AHQA 3KYDB 4MEYF 5H6RA 2Y0SN 2K86A 4A0ZA 4ZTFA 1U8BA 1K4TA 4YFKF 1MMAA 2HOTA 3HDDA 4IHSA 4A6DA 5EDNA 4A3LJ 1Y8RB 4I6ZA 1QA6A 3A4CA 2NVTJ 1JHFA 1HLVA 2L7KA 2BY1A 4GDFA 1IDYA 2QSFX 4HX4A 2QF7A 4KDPA 1S9HA 3I5UA 4HSTA 4IKFA 3S16J 3OL3A 2PEXA 4IHXA 3HOYJ 1R49A 1KU9A 3U1DA 1POGA 4CCJA 3LSRA 4CUGA 2IXSA 2G7HA 1DU6A 4BJ5C 3AKZA 2F4IA 2K4JA 3OIOA 9ANTA 4FE7A 4ENKA 2BV6A 4OWRB 3KP5A 3JSPA 3CUOA 1FOXA 2DMNA 3CP2A 1JT6A 2FX0A 1J7KA 2QSGX 3HRTA 3PO2J 3VSKA 3H36A 5IP9J 5FB2A 2HOSA 5DTDA 1XMAA 3PL8A 4F55A 4WX9A 3SZTA 4HNVA 2PI0A 2HZDA 2JWTA 2R7TA 3LQRA 4BU2A 4Z6YA 3S3OA 3SXYA 1AWCA 1SMYF 2K9QA 1RC9A 2L4MA 4NQWA 4Y15A 1OPCA 1GLNA 2QLZA 3REOA 3L2WA 3K4MA 1HBXG 4CA0A 4DW6A 3H3UA 2M2EA 1J09A 3P9CA 1HCRA 2O03A 4NC7A 2NS0A 3GEZA 2GOMA 3I3LA 4CGZA 2JK3A 2DA7A 4G94A 1I1GA 1Y1VJ 5D5XB 5BQTA 3S17J 2K3FA 2KZGA 2L3DA 2AO9A 1DP3A 4XOTA 2HGCA 2HU9A 3DKYA 2LY2A 3O8GA 5FKKA 1VQNI 2E2HJ 4EJTA 3BY6A 2GXGA 3E6BA 4FTHA 3QPHA 4XKCA 1XPXA 1T2KA 1YOVB 3QRFF 5E18F 3I64A 4IOCF 1Y8QB 2H94A 3CCSI 1SFOJ 3RQIA 1FZPB 1SMTA 3MKYB 1OLTA 5LRRA 1P7JA 3QPSA 1WJDA 1LFUP 3CJNA 2R93J 5FFXA 2EV5A 3FMQA 3L2VA 5J47A 4ESFA 2ZXHA 3NEUA 1HW5A 2K4BA 2O6GE 1HSJA 5DCMA 2GIZA 3G1MA 4L18B 3RKXA 2R7ZJ 3AL0C 3DKXA 3KFWX 3HJEA 3S93A 3CC4I 3N97A 5DD4A 2CQXA 1V5EA 2DFFA 1XGNA 2WBMA 2IJLA 5GPAA 1OYIA 4NUBA 4LK1F 1U5TB 4HF2A 2AQEA 4IO9F 2HDDA 1IDZA 2X0LA 3KEQA 3A0BC 3RYPA 2JT1A 3GFIA 2QKLB 3DBRB 3K70D 1N77A 1GXPA 1B8IA 3R0AA 1PVEA 2KPMA 2H6BA 4N0BA 2OQRA 1EA3A 2EFWA 1BOBA 2K9LA 2E5NA 4FX4A 1RR8C 5L3EA 3IH4A 1XG1A 4LJZF 2CQNA 3Q0WA 2HYGD 2IS2A 2O3FA 4XLFA 4MIMA 1DU0A 2O8KA 3JRGA 4XKVA 3IH2A 3DP7A 3BC8A 4RGRA 2V6EA 1T98A 5HDKA 4BY7J 2VJJA 1RETA 2WB1A 2CQ7A 3EUHC 3I54A 1FBSA 4IQ4A 4JQFA 1A04A 2VJIA 3FBIB 4BE0A 1IRXA 3CJQB 2PJRA 4UB8C 2RGVA 3CUQA 3G3ZA 2R5ZA 2DK8A 3HEFA 3RSNA 5D5WB 3J7AY 3T5XA 3M07A 3VFZA 3OWTA 4KN7X 3TOAA 3SEZA 3K4NA 4F92B 4HV5A 2Q2EA 4EMSA 1MH4A 4AM3A 2EZLA 2BGCA 3FMRA 1XC5A 5HNHA 3FM3A 2WAFA 3MKWB 5J1YA 1WSUA 1D1AA 3IHUA 2IPQX 2YPRA 4DBQA 3BTLA 2L9VA 1K7AA 3WTYC 4ENJA 1H9GA 5E79C 3WG9A 1AKHB 1YW7A 1MMSA 5D4RA 2GOXB 2HZTA 2HPIA 2XV4S 2GXBA 3K0LA 1SC7A 1MJBA 3KIOA 3PUFA 4ITVA 4AD9A 1UHWA 2WADA 2VC1A 2B0LA 1ZRDA 1FOWA 3LAPA 4HA8A 1TQPA 1I27A 2DQLA 4BNCA 2QWWA 3Q9SA 2TRTA 2Z33A 4EJWA 5ILUA 1MKMA 1WJAA 1NH3A 1S7AA 3L09A 2HVQA 5DUIA 3DFGA 3K7AJ 3SDBA 1U78A 1FTTA 2A6TA 3P5JA 1W5CC 3ZQQA 3IKVA 4EM1A 1BI1A 2Q8KA 3QP6A 4CO8A 2ZMEB 3ZMZA 4C30A 2XASA 3G1LA 4HV6A 1OMIA 3H5RA 4II2A 4BACA 5FFZA 3S1NJ 2LDUA 5ICFA 2XKOA 3TMOA 3OIPA 1WH7A 5TGTA 5LGUA 5EGOB 2HQRA 4MEXF 3LSJA 4UXNA 2CUZA 5AIPA 1K83J 5E8IA 2DYSH 4HDVA 4RBOA 3MFKA 4G6TB 2ZXIA 1UJ8A 1LUJB 5GP9A 4B3AA 2G9WA 2L7ZA 2VQCA 3PQJA 5DM7F 2JUGA 2FQ3A 3VSLA 2RREA 3MQ0A 1QRYA 3K4LA 1OKRA 4A0YA 4L5JA 2ECCA 1X2MA 4B8XA 4X0GA 2LC2A 3DLLF 4V19K 4QWQA 1HKQA 2P0WA 1QZYA 3TP0A 5M3FJ 4HNUA 3S14J 4M9SA 1QZEA 3RKYA 5KNLA 3FBNB 5GAGJ 4I02A 3WGGA 3SJMA 4G7HF 1MBGA 4MTDA 3VWBA 1FOYA 1PJRA 3WU1B 3SFZA 1D5YA 2GA2A 1WKMA 1UFMA 4XICA 1J9IA 2O5RA 2X1DA 2CFXA 4JX5A 1BR4A 1B4AA 2JUCA 3FXKA 5CVUA 2YS9A 5IYCJ 3M8FA 2V9PA 2NYXA 1CQTA 2JPCA 1DUXC 2P7CB 4D7NA 2MYSA 2Z5UA 2MLGA 3VOEA 1VQ7I 1XGSA 2CO5A 2EB7A 2VODA 1Z9CA 4HRIA 5L3BA 1Z21A 1VQ5I 4U88A 3F72A 4WWCA 1BN5A 3GTKJ 4B09A 1KGSA 1EH7A 1LFBA 5JVGF 4DYRA 3S2HJ 3HHGA 4M71A 1KQ9A 2BY2A 2X6XA 4A3BJ 2E1MC 2HXIA 3BG5A 2YUSA 2IS1A 3TGNA 3ULQB 1TC3C 4RGXA 4RB1A 2E7WA 3SHFA 1XSVA 4MNUA 2NXNB 1VQ4I 2JJ7A 3PSIA 4HEA2 2O7OA 3RPUA 2F5CA 3H3ZA 2NOGA 3R4KA 5F1JA 5LEJA 3ZPLA 4B47A 2JZYA 4PJJA 1T38A 1TLHB 1IN7A 2Y31A 1FPQA 4RS8A 3WU2C 1OISA 4ZH4F 4F93B 2FXAA 2L9NA 2FOWA 2X51A 4XSZF 1ETOA 4NDLA 1LQ1A 3I55I 4I98B 4LB6B 1WQ2A 4C3JJ 3FF5A 3MCZA 3N05A 3MD2A 1D1BA 2VJ5A 3KP6A 4BS9A 3MKZA 2DQRA 5BPIA 1XB4A 4XSXF 3IL2A 2R5YA 2R7XA 2ELJA 2V26A 3I59A 3KE2A 3H5AA 1G3SA 3GZNB 3GFMA 1A6QA 2W85A 3LNQA 2M87A 1YW8A 3ZR8X 3GTGJ 1REPC 4NQWB 1MJAA 3K4CA 4AUXA 3HSRA 1YIJI 2KIQA 4Y33A 4KYWA 1DGRM 2R92J 3LWFA 1P4WA 3W3CA 4D7MA 1FP1D 4QSHA 2VE8A 3M8EA 3WHBA 1Z3YA 3V7SA 1S29A 3GF2A 2DDBA 2GAUA 5LGNA 2J5PA 2EINH 1I5ZA 3CLQA 5JI6A 1HC8A 5LD2C 4PJMA 1OYYA 5JLWA 1K78B 3ZRGA 2KRHA 3IAM2 4FCYA 2O9LA 4ZYDA 1S6LA 4GXOA 5L3DA 1OFCX 1N25A 1BOAA 1R5HA 1U6GA 3BG7A 1R71A 2HOEA 1HXDA 2A6HF 5FKLA 2ZJQF 1U8RA 5HVQC 2CUFA 2FOKA 5E1ZB 3GTPJ 4MLOA 1W5SA 4XKBA 3ZQCA 2VBWA 2LH9A 3O2PE 4CCMA 2Y48A 2XIGA 4CSWA 2VBYA 4A93J 2LR8A 1ZQ3P 1AHDP 4F91B 1KA8A 2M0CA 1YRNA 1ETVA 2Y0MA 2E19A 2XAFA 4S04A 5EZHA 4KMUX 4M3DA 2CWEA 4L0ZB 1IG7A 2KQRA 3HL2A 4ZYAA 5DDGA 2V9KA 4WF2A 4BEHB 1MGTA 1E2XA 2MG4A 2IA1A 2X85A 2EH3A 3KLNA 2CV0A 2V79A 5HOOA 2ID3A 3H0GJ 1RZ4A 2DN0A 3GTJJ 3ZQ7A 1OCCH 5DYMA 3LSKA 2KLOA 4UNOA 2O61A 1ITYA 1E3HA 3VEPA 2R7SA 1ZG1A 2FMLA 3NARA 1YHQI 1MDMB 5FLXK 5FLVA 2DTZA 3Q3SA 2Z2SB 4XORA 3DPTA 1EV7A 3B6CA 5A2QK 4H4KC 1Z6RA 5KAFC 3LOCA 2XC7A 5CLSA 3HM5A 4B44A 4UVCA 2QSHX 4FHTA 5LHHA 2JA7J 1I1SA 3SDGA 1YFHA 4X1EA 5K7ZA 2PJRB 5F04A 3CUQB 3ZN0A 1ZKGA 2R5ZB 1XS9A 1LE8B 1T56A 3K4JA 5JHFA 3AG4H 2PFBA 1AKHA 3B6AA 3KZIC 3CJRB 5ERIA 2K40A 1FWZA 1V3FA 2EILH 5B1BH 4CCOA 2KP6A 1HDDC 1KQ8A 1O7LA 1K61A 2Q2EB 2L7FP 1JJ8C 4RB0A 2WY7Q 4Y13A 3CO6C 5IOYA 2K02A 3C7JA 1T95A 3MVPA 4P96A 4RMNA 4Z2YA 4H0EA 4EVIA 1NK2P 3M1EA 1YX3A 3CP8A 4AVZA 2X9DA 4PDKA 1A31A 4PSXA 3UR3C 3I4PA 2C6YA 1MBFA 3E6DA 3E97A 3ZCOA 4HYEA 1X1PA 3CCEI 4PGGA 1ZG5A 2BBYA 1UHSA 3MN2A 4GCVA 4O5VA 4KJZA 2ID6A 3ECOA 3BG6A 2A69F 3V8KA 1N78A 3ROUA 1XTAA 2FBIA 3WTZA 4RDUA 1VNDA 1RKWA 2FF4A 4YIFA 3WTUC 1NK3P 4S05A 2OC6A 4RAZA 3BJ6A 2P6TA 3AG3H 4M3FA 2F4OB 2X48A 1SAUA 1LJ9A 2P81A 5FRNA 1XX5A 4WXHA 2ESHA 1L3LA 1JKOC 2YX4A 3KPHA 3TO7A 1BA5A 2OCEA 4DYQA 3ABLH 2STTA 2FBKA 2AXTC 3F8CA 4R79A 2BVLA 3OYMA 4PFPA 2MSYA 2FD5A 2KFDA 3CF2A 3BZCA 2QQAA 1G8XA 4IHYA 2FNPA 3GTLJ 1LVAA 2QA4I 5DEQA 3PIPF 3DKWA 2XVCA 4D0PA 3V42A 1PUFA 3GFJA 3GO5A 1X1CA 1TWCJ 2IA2A 5TJJA 2GM4A 5HS9A 3DTKA 1Z7UA 3LMMA 5LGTA 1YS6A 1H8AC 1D8KA 2VT2A 1OCZH 5E1XA 1R1VA 1TZLA 5CJ9A 3FK7A 1LDJA 5FJ8J 3GYHX 1VQKI 1FYKA 5J8CA 4KT5C 1ZHFA 2MGQA 5E3NA 3H92A 3R0JA 1Y39A 1QQIA 3VYTB 4M74A 1YI2I 1NG7A 4OIRF 1I50J 2HYJA 1B59A 1YJWI 1S72I 3QQAA 4BHPA 2EA2A 4LG0A 2OBPA 3R6SA 3HOXJ 5FLXZ 2EIJH 1IXCA 3J7AO 1JKRC 1HSTA 5M5XJ 2KKOA 3HOTA 3TP3A 5IYDJ 2NNNA 4A69C 1F43A 2NOJB 5CPRB 4JYKA 4DQ2A 3LSMA 1HW1A 1LB2A 3Q5FA 3A0HC 4HQMA 4C3HJ 1TW2A 3OSGA 1FBUA 2WWYA 2IBDA 2VPRA 2DFHA 2K7LA 4GFBA 4XONA 4RAGA 2X4HA 2AXLA 1DP7P 4ZDPA 4M3GA 3H9GA 5K5OA 3HBLA 4BHBA 4ETSA 1VQMI 3HRSA 5E17F 3VDXA 3WGIA 2Z3YA 3GMEA 3RJPA 4U87A 3LSGA 1IF1A 3KZYA 4BHCA 2CG4A 2XUBA 1Z77A 2E5ZA 2VBZA 3OYJA 3ZQLA 1GVDA 3A01A 5IP6A 1P4AA 1UG0A 2VB6A 1D0XA 5J4YA 3HGGA 3FM5A 2DDAA 3A1YA 3MEXA 4ZC3A 5IOZA 1P2FA 1G2HA 1OCRH 3P7NA 2WB1N 5KVRA 4DJAA 3AG2H 3BJAA 3E1SA 3S3MA 2W25A 4OINF 3KLOA 2VKEA 2M3AA 2KDOA 1KQ0A 2M34A 3H0DA 4XK4A 3RCOA 2J5OA 4ASNA 4XRMA 1EJ9A 2XF7A 3HRMA 2H27A 3QPLA 4E7ZA 3W6VA 1LPQA 3Q0VA 4L9JA 2RDPA 2R7FA 3TO9A 1R4NB 2DFEA 3I58A 4LGWA 3OYNA 2Z9OA 2I8DA 3MWMA 2LYCA 3AG1H 5K7HA 5LLQA 3S2DJ 1HW2A 2HPMA 2DU9A 2R7OA 3S2WA 1T33A 4YEJA 1LFPA 1FYLA 2DODA 1WJFA 2W1OA 2R5YB 3HTSB 2EZKA 3I59B 3FXRA 4JBAA 4CH7A 2EFOA 3WGHA 3WG7H 2FJ1A 1Y6IA 3IWZA 3LSHA 4R1HA 4B48A 2CQKA 3AL0B 2KJCA 1X3UA 1R5GA 5F64A 2D2WA 3OR1C 1K78A 2XGCA 1JUSA 1Z1DA 2LMDA 2EZIA 3CJTB 1TWFJ 1ACIA 3BCAA 2JA8J 3L2QA 5HDGA 6PAXA 4BGDA 2V1DA 4GRIA 5F27A 4XRSA 1UG2A 4M3EA 2OV7A 2IAIA 3OYDA 1V5FA 5GTIC 1AU7A 5FLMJ 5EG0A 1VTNC 5FKMA 1NTCA 3BR5A 2CUEA 3CESA 1LEAA 2BY3A 2E71A 5F0HA 1PP7U 1P92A 3L2CA 2OAZA 3E3VA 4EJUA 2HNHA 1BI0A 2R7QA 5CQGA 2XAHA 4IOAF 1IN6A 1Y1WJ 3V8LA 3QPTA 5BMZA 2YU9J 4B3XA 3ZOBA 2B9SA 4CXFA 2OF7A 2JSPA 1FIAA 3DQVC 2Z1DA 1JKPC 2D5VA 2YU3A 2L02A 3K69A 1O3SA 4OMYA 1H88C 4BEHA 4UY8I 3F22A 4Y3OA 3HOWJ 1X1AA 2LY9A 1MH3A 1YIOA 2IP2A 2VL8A 3FXLA 2LD5A 1BW6A 4UUSA 2W82A 4XRFA 4HW0A 1MIJA 2M1BA 4Q5SF 1R4MB 1YRNB 2XKPA 3QOPA 1HF0A 4IRGA 3ZXSA 1MDMA 2MABA 2PMUA 3MMYB 4ABZA 4IHVA 3JRDA 3WU0A 4M73A 3FXJA 2V1XA 1IO2A 3I4NJ 2QCOA 3QODA 4F3QA 5E3OA 3LFKA 1B72A 1ZN2A 3GBGA 3G6EI 3CTAA 4HPQA 4DBRA 1IN4A 4KUMA 1FEXA 3ZMTA 1YJ9I 5FRMA 2XPUA 1SVMA 1R36A 1LE8A 3PNYA 2W4SA 1LEBA 1ETKA 4IXAA 1FYMA 4C2TA 5L3GA 2WA0A 3CQZJ 3H5NA 2GXAA 4D5CA 2EPFA 4ESBA 2EIKH 3KYCB 4M6XA 3W2WA 1NHAA 1IXSB 2X6OA 4HG2A 2R7WA 3ZMSA 2UV1A 4PJNA 3HXLA 1X1DA 4I7HA 3KEOA 3TW6A 3PNTA 5HNFA 1FSHA 2VASA 3J80K 2Y30A 4PFOA 1XSDA 2RAEA 2X1EA 4XL9A 2P5KA 4GYIA 3SZGA 1UZCA 3S1RJ 1IV6A 3BP8A 2KDZA 1VQ6I 4DIQA 1U0JA 4HLYA 3R60A 3EUAA 2TCTA 5EZGA 1S7OA 3TDZC 1XN7A 1SAXA 1R22A 3D5LA 5GTHC 5EYRA 1WH5A 4BAYA 4L0YB 2GIVA 1TWGJ 3HIFA 3UNGC 3DTEA 1WFXA 2ME0A 1HOMA 2CQQA 3EYIA 2DCEA 1S7EA 1QPIA 3B73A 2P8TA 3X2QH 4Q4ZF 2E1CA 3M3YJ 3T8RA 2LBFA 2K9MA 3HSFA 5GPCA 5GAEJ 2ZXJA 3I53A 2QBYA 5DV5A 3GTMJ 1RUOA 3KCCA 4EJVA 1MJ9A 4PSWA 3LAJA 4PJLA 3RPQA 2MD5A 3JRAA 4BXUA 1IN5A 4I99C 3FHZA 4M6VA 4RM2A 2MH2A 3I0TA 2CV2A 4WCGA 4I09A 3COAC 1VQOI 5EEHA 3FX3A 5LHIA 3HPHA 2QENA 2DA1A 2ESNA 3BG3A 3E0JB 3SZPA 3G4SI 5IP7J 3ELKA 3QAHA 2JVGA 4RA2A 3N4MA 3ONQA 5CVVA 5CVIA 4G6QA 2N8GA 5H20A 4CCNA 4NBQA 3CCMI 4XLCA 1X1BA 4QPOA 4G9YA 1PUFB 2ZB9A 4GYGA 3RZOJ 1WPKA 3MZ8A 1JT0A 4OU0A 1G6NA 1W36C 1TP4A 2QM3A 2IGNA 2EJRA 4X6AJ 3L9FA 5C4XJ 1YS7A 3I4MJ 5D8LB 1TNTA 4LG3A 1W7PA 4C9YA 3RIRA 4HF1A 4AC0A 1IAWA 1V5GA 4BE2A 5GAHJ 2DLLA 4BE1A 4YELA 4E7SA 4A5NA 5HLHA 2HQ5A 5FO5A 2E1MB 2QZ8A 4IRHA 1CF7A 2F48A 2HVSA 2E2IJ 2UWMA 1ETYA 2RVCA 1V4RA 1DQUA 2W24A 2TDXA 4YFXF 1RKTA 4RB3C 3HYIA 4MQVA 2QKMB 4LG0B 4WK8F 3C2GA 4E6KG 1IRGA 1FLIA 3K10A 4KIFA 2R7UA 2H09A 2PX9A 2A61A 1KYWA 1ENHA 2CS3A 3GCMA 3JCUC 3O8HA 3RKWA 5ICGA 3WHCA 3BTIA 4CYCA 2ACJA 2MLKA 1MD0A 3K1NA 1E3OC 3M4OJ 1Z3XA 1BJAA 4N4NB 5B1AH 2JTVA 3JR9A 2WAQA 2GZWA 1TT0A 1USTA 5E1WA 3J80Z 1IRFA 2EK5A 1G3WA 1XGMA 1JUPA 4J00A 4OIQF 3GTQJ 1ZGAA 4EV0A 1E17A 3BR0A 1U3EM 4F52A 4BY1J 4M72A 4YRVA 1ZREA 2VJ4A 4XOPA 1F4KA 3T8TA 3VB2A 4CCLA 4A12A 2ISZA 2M4GA 3OS2A 5HODA 1X58A 1Y0UA 4XM3A 4BJ6C 2GBYA 4MFDA 3BQZA 4Q48A 2VONA 1B9NA 4A6EA 5IT9K 2JA5J 3PJRA 3A01B 3H1CA 4RM3A 4OIPF 4RGUA 2HTSA 2P5LC 1T08B 1SD6A 3PSFA 5EEGA 4DZJA 2ELKA 2V9VA 3OL4A 4KFCA 1T0FC 1YTYA 3CMYA 5F1RA 3R61A 5B66C 1XMKA 3MKLA 3L2UA 3JRBA 2CW0F 1ZG3A 3F8MA 4AVPA 2QEXI 3NQOA 3C3WA 4UUVA 4A3IJ 3OYCA 2NVYJ 1TL8A 3NAUA 2DBBA 2XB5A 1XCBA 3BROA 4XR6A 5JVTA 3ERED 1R6RA 4LFUA 4LIVA 3JRHA 2H8RA 3BR6A 3D5RC 3PIOF 1PYVA 4FE4A 1IC8A 2EFNA 2VQLA 3I71A 4LITA 1KU2A 2DOFA 2RNJA 1R1UA 4V2FA 4IJAA 1FOKA 4EATA 2XRLA 3IC7A 2IGMA 2LVSA 3F8FA 2NS8A 1W5TA 1ZELA 1SD7A 3CC7I 4DYCA 4HX7A 2P7VB 1X19A 1TW3A 1BL0A 4WXCA 3J81K 4BXXJ 5FD6A 2XAJA 2K27A 1K6OA 3HB9A 4ZZDA 1I39A 3HOZJ 2Y9ZA 2FMYA 4ZDLA 1BR1A 3F0CA 2LLKA 4RGSA 3QU3A 2ZC2A 3OOPA 4LIUA 4IQJA 3RPUD 4A3CJ 2DT7B 4MHGA 3HC7A 3LA2A 2M7AA 3CCYA 3ZGKA 2M30A 4E7HA 3TKYA 1MMGA 3BCBA 2P4WA 4ESJA 4I76A 4A3FJ 1ORKA 2QVOA 3EUHA 4ZDOA 1RNLA 1U9NA 3GXOA 2F5VA 1BI2A 3DU6A 5EG0B 2DA5A 1TWAJ 4XMYA 1VQLI 3MZHA 2VKHA 4TV7A 5EJCA 1ETWA 2NS7A 2KIFA 3QOEA 3FXOA 3PNVA 3IKTA 3OS1A 4II3A 3OYAA 3JRFA 4RAYA 2I10A 3JAMK 3EUKL 2CGPA 4NC8A 1JJ6C 3GZ5A 3H9QA 3S1MJ 2BXYA 1K79A 3DU5A 2FE3A 3K70C 2O0YA 1MSEC 4IHWA 4IZZA 2WC2A 2JRMA 3C18A 3K9TA 3TL4X 4XBFA 4XQFA 3KP2A 1ULYA 2XAQA 1IXRC 5E20A 3OYIA 2AQFA 5D6FA 4Y52J 2LTPA 5CQEA 5IT9Z 1ON1A 3SEQA 2OUMA 4UUSB 1UMQA 2DA6A 2YR2A 4G7OF 5GADJ 1LDKB 2LRDA 3GFLA 2PN6A 3BTCA 3RTRA 5D8KB 2IT0A 2K9SA 2G7UA 3GLXA 1G4DA 3DF8A 3V8JA 3A2KA 4XLEA 4QPQA 3OYGA 2E2JJ 2BOLA 2Z16A 1BM9A 5CVRA 2VT3A 2ZJPF 2PQ8A 2M8EA 3U9GA 2HYFA 2VQHA 4AYBN 2ZCWA 1Z67A 2M9HA 2IRFG 2WV1A 1O4XA 1OR7C 1W0UA 1B72B 2D1HA 4J01A 1GVJA 2MA3A 1YW9A 3BT9A 3SQNA 3RI4A 1HKTA 3W2VA 5ILVA 2CMPA 1MBJA 2CW7A 3OIQA 4OIOF 2B63J 1ZARA 4LLGF 5B5EC 4A3EJ 4ZTJA 1YJNI 1U2WA 2STWA 3LSIA 4IHTA 2YX7A 2KT0A 2RC4A 1EH8A 2KRCA 1U9OA 3H9JA 2CYYA 1WZ2A 3DPUA 4MGRA 1O3TA 4PGHA 3BJOA 3OYFA 2DA4A 3JRIA 1IGNA 1BIBA 4A3JJ 4JK1X 3J81Z 1X2NA 1FT9A 1KONA 1ETXA 4YFNF 2L01A 1MNDA 1GV5A 1E0EA 5J1UA 2V4JC 2COBA 1J59A 3U1KA 2AS5F 2LKXA 2CFOA 2DA2A 2HQNA 3RYRA 1GT0C 5C3EJ 1J2XA 2DMUA 1BJZA 2L4AA 4I01A 5F0FA 1XMXA 2ZFWA 2R4GA 5ED4A 2CW8A 1FTZA 2E1NA 2Q0OA 3HHHA 3WTWC 3KP3A 4P5OA 4O3MA 4L5IA 4HLXA 1G3YA 4CZZA 1G59A 1Z05A 5CYVA 2LBFB 4A3DJ 1X4PA 4OAZA 2QBYB 3K4KA 2HQAA 1RIOH 5DUKA 4U7BA 3F23A 1FMVA 3W6JB 3OR2C 4JX6A 3JREA 5B3SH 1ONVA 2HKOA 3K2AA 1SVOA 2JA2A 3FZVA 4L9TA 4UV9A 3JAMZ 4PZJA 1XSXA 1QO0D 5L3CA 1R7JA 4ZYHA 1Y56A 1SFKA 1TBXA 1W1WE 2UZKA 3V4GA 2ADUA 2XROA 4BH9A 1YQAA 1FIPA 3B02A 3PO3J 1QNTA 2EV0A 2UUZA 3HOUJ 1IRZA 3CCRI 4A3MJ 5JFRA 1B9MA 1ZK8A 1Y0NA 2BY0A 3OMYA 5IYBJ 2FU4A 5HLTA 2E7XA 4IF4A 3ML6A 4FETA 2MC4A 1EKEA 3FK6A 2VOOA 3DBLB 4M6YA 2OD5A 1P9QC 2BE5F 4C2UA 4KISA 3TO6A 4HBLA 1Z6TA 3LFUA 2H8WA 2BW3A 1S8NA 1W7PB 5A2QZ 2ZSIB 4QLCU 2HVRA 2VXDA 1IJWC 2HS5A 4HDUA 1D3YA 3ZP5A 4D1QA 1JHHA 1SFEA 3BTJA 4BYYA 4J19A 1CF7B 2L0KA 1T0FA 4QTRA 3RQ4A 2QQ9A 5DD8A 3BR2A 4NHJA 2KMUA 3ZQGA 4IEJA 4AYBA 2XSJC 2LNBA 4A2UA 5F08A 3OYHA 1MW7A 4FX0A 4CYCB 1HDPA 4B4CA 1V54H 2ZKZA 5BS6A 4L9VA 5LRSA 3QYBA 1A36A 1S3JA 2EA4A 2M5WA 3BWGA 4U0YA 1Z0XA 4U0VA 1WCMJ 4KIGA 4W1UA 4ZYGA 2FEZA 5DS9A 3K4BA 1IV8A 4EM2A 3CCUI 3CZ6A 3LQQA 2KHMA 3TW7A 4D5FA 2QGUA 1DPRA 1USSA 3Q9VA 1ZAOA 4BKXA 1TQMA 4HNTA 2DPDA 1OYWA 2XF6A 4UHTA 1ZTRA 1VQ9I 1ZR4A 2Z99A 4OAYA 1TNSA 4CCKA 5ICEA 2PMZA 2R7VA 2ZNYA 2JSCA 2CJJA 3F3XA 1FBQA 3G2BA 2FQ4A 3EYYA 1ERDA 5C44J 4XRSG 3S1QJ 3HKZA 5DM6F 2LOOA 3A02A 2R7RA 4RB2C 2OTJI 1UCRA 3E6MA 2A5YB 3HSEA 3ABTA 1FJLA 1PDNC 3PQKA 2L9SA 3C2HA 2HTJA 1X3ZB 2ME6A 3FXMA 3Q0UA 1GV2A 1WRJA 2LSOA 3GZ6A 2VUMJ 3ZMDA 5D4SA 2XB0X 5D5UB 3CCVI 2F6CA 5HS8A 3DEEA 3E6CC 5EEAA 1VZ0A 2JMWA 3PFIA 2A3SA 4U0WA 3LL7A 1OCOH 1DDNA 3OYKA 4A3KJ 5BOXA 2DTRA 1OCTC 1QHGA 2OCCH 3HPGA 5M3MJ 4DZPA 1KU7A 2NVUB 1QPMA 1QVTA 5F6FA 2RQPA 3H35A 1APLC 3DBHB 5KAIC 2PMHA 2NNYA 2D45A 4FT8A 1MMDA 2V7FA 3ESWB 1W0TA 1XDUA 1QHHD 2Y9YA 4BL0B 1KZHA 2A05A 3P9KA 3TBIA 1IW7F 3EQLF 2B7EA 4BBRJ 2LK2A 3CD6I 1MBEA 2NVXJ 2PJPA 2VLAA 4OOIA 1T39A 3ABKH 2IA0A 3L2RA 1MZBA 2R0QC 1UELB 1XD7A 4BXFA 1QVUA 2IVMA 2VOPA 2W57A 5FGMA 2DW4A 4QIWN 1ZR2A 3F6VA 3WTSC 3E5QA 2PG4A 5E3MA 2IW5A 3ZQFA 5LFAA 2H1KA 2FBHA 1X3WB 2K9NA 1YX5A 2ZFUA 2H1LA 2MH9A 4EGYA 4CZCA 4G6DA 3K2ZA 2GQQA 2EZHA 3LSTA 3OS0A 1OR7A 2BEOA 2XPVA 1YO5C 3TOBA 3GWZA 2RKHA 3PFYA 3MAJA 4FQGA 4BQNA 3HOVJ 3W6KB 4ZZLA 1R00A 1O7FA 2QQBA 4Y7NJ 2EFQA 2WV0A 1T6SA 3FIWA 2E36A 5ILSA 3K1MA 4ENNA 3ASOH 2MFZA 3S32A 3BPXA 4LMYA 1F9NA 1GHCA 2F4MB 2DI3A 4M9XA 1I6HJ 1FP2A 5H2FC 3V7CA 3VPRA 2Y75A 5LHGA 2Y0SA 1ON2A 4KIBA 4NC6A 1JUMA 1A35A 2V1UA 3CMMA 2FSWA 3RZDJ 1ZLJA 1L0OC 2ZXWH 4N9HA 3OY9A 4YIIA 1RUNA 1D8JA 2HXOA 2FRHA 3GUDA 2HDWA 4IX7A 2WTEA 2F5EA 3VYRB 3UKGA 2W00A 3V7RA 2XAUA 2M45A 3GW2A 2XDVA 2IEKA 2WAQN 4EGZA 2WAEA 3K6GA 3L00A 1LKXA 3CCJI 1GXQA 4KNYA 2BHYA 1U5TC 3G73A 5JR3A 2P5VA 3JTHA 4NB5A 2VC0A 5M5YJ 4AIHA 4JX4A 4Q47A 3HOSA 2ISYA 2RN7A 1J75A 1ETQA 4FASD 4E7LA 3IWFA 2D1VA 1VQ8I 3F8BA 4LB5A 3KX2A 2XF5A 5L3FA 3FXQA 1SFXA 3FXUA 1BC8C 4XNFA 5LBQA 3VYSB 1R9TJ 2MW8A 3DWLE 4E7IA 5K7FA 3CMEI 3OYBA 1YE9A 2KIUA 3DXJF 4C2MJ 1IUFA 1R1TA 2DJIA 2DYRH 1A6IA 2XGXA 2EBIA 2ZBKA 3F21A 5J1RA 2LKSA 1VQPI 2L9RA 2JA6J 3WE2A 4BQAA 4AIJA 5HS7A 5C4JJ 4LD5A 2NRAC 1XGOA 4HQEA 2ETHA 2EFPA 3FDYA 3ABUA 2K5CA 3DLAA 1MBKA 4FISA 3JW4A 4L9NA 1MMNA 2L5QA 3OV8A 2CSOA 2XSDC 4HSRA 4ON0A 2EWNA 3F9KA 4YIRX 4XN0A 2DFIA 2LG4A 5HLIA 1WI3A 4V2GA 5KHDA 2LP0A 4E7KA 3OOUA 1O3RA 2ELHA 4HAMA 3IV5A 2HI3A 1JE8A 4XLNF 1WJCA 1F1ZA 1BIAA 3FWEA 5FROA 2LF7A 1XDSA 4PCQA 3FISA 3TEDA 1H9TA 3GX4X 2EQRA 3ZMUA 1YYVA 2Y69H 1P6RA 2LF8A 1SEUA 4IRIA 4BJTA
chains in the Genus database with same CATH topology
1Y0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0N A; 
#chains in the Genus database with same CATH topology
 2KIS A;  3KYL A;  3BZ6 A;  2ZO4 A;  2A6E F;  3BLY A;  4LK0 F;  1BC7 C;  3HUG A;  3DTI A;  4RLQ A;  4W97 A;  3S8P A;  5IY5 H;  3CCQ I;  1J0R A;  3IH3 A;  3T1B A;  5TIS C;  4KMF A;  3CCL I;  1QGP A;  4LOC A;  2VBX A;  3MZY A;  4CIC A;  2GA1 A;  1ZRF A;  1JXS A;  1IN8 A;  2E1O A;  2VXZ A;  2QUF A;  1FNN A;  5FKO A;  1TQI A;  3L1P A;  4P1W A;  2ZME C;  1UHM A;  1AOY A;  3CDH A;  1ZLK A;  2LFB A;  4RAF A;  1IUY A;  2BW3 B;  2M4K A;  3DPL C;  3E7L A;  5K1Y A;  1BBY A;  2NVQ J;  3VYU B;  2OA4 A;  2OZ6 A;  4BQO A;  3CC2 I;  4BQQ A;  4MQ9 F;  3C1D A;  3EDP A;  1D0Z A;  2Q1Z B;  2JPB A;  3ZN1 A;  3HTU A;  4KN4 X;  4D9J A;  5K5Q A;  3KP4 A;  5D6E A;  4XLH A;  2CU7 A;  2VN2 A;  2BXZ A;  5BPD A;  1ZH5 A;  4RLF A;  2CUJ A;  1AA7 A;  5H6Q A;  4G7Z F;  1LDD A;  1FC3 A;  2X6Y A;  5HLG A;  3O3K A;  2VI6 A;  1QBJ A;  4CYD A;  1LVK A;  2W84 A;  3U21 A;  4A5M A;  3D0S A;  4MTE A;  4C3I J;  2IGO A;  2NAZ A;  3JSO A;  2UXX A;  4ANJ A;  1ZGW A;  4JP0 A;  3WTT C;  2XPW A;  1ZRC A;  2LKP A;  4ZJZ A;  4DNC A;  4LLN A;  1NG6 A;  1Q1V A;  2IGK A;  2XRN A;  1MNM C;  1SAN A;  2DAO A;  2K3P A;  1BW5 A;  1Z7L A;  4XID A;  5EF6 A;  1ZYR F;  1W7P D;  2HWV A;  3RKQ A;  4IL6 C;  5FKN A;  4P9U A;  2PBI A;  3IP4 B;  3ABM H;  2HR3 A;  5J4V A;  4ENM A;  3CO7 C;  4BBS J;  2OJE D;  1FY7 A;  4WXD A;  2OZU A;  1TTY A;  2W7N A;  3GTO J;  2UXN A;  5E3L A;  1SD4 A;  1O3Q A;  2FNA A;  1I3Q J;  3EPZ A;  1CGP A;  4MO7 A;  2KJB A;  3G1O A;  4O6J A;  3M7G A;  4B43 A;  2F5D A;  2MC3 A;  4DOZ A;  3PUB A;  3PM1 A;  5IT3 A;  2DOA A;  2DA3 A;  3DV8 A;  1JKQ C;  4PJ0 C;  4ZYE A;  2FA5 A;  3SYT A;  1R23 A;  1D5V A;  2V1N A;  4EJO A;  4A3G J;  3JRC A;  1K4S A;  2CH0 A;  1SD5 A;  3BR3 A;  3QP5 A;  2MD0 A;  3JTG A;  4IVN A;  1M1E B;  3BPV A;  2OPT A;  1WI9 A;  2A68 F;  2CRG A;  3HG9 A;  4EQQ A;  3AAF A;  4HF0 A;  4AWX B;  2XGD A;  4CHU A;  5CVJ A;  1SVL A;  3NWS A;  3I9V 2;  1E3P A;  2FUG 2;  3NRV A;  4IPA A;  5D5V B;  2DK5 A;  1BR2 A;  3BZK A;  1WHU A;  3S3N A;  2YSR A;  1DGW Y;  3CLO A;  2H6C A;  5J40 A;  4A0X A;  3OYE A;  3O6B B;  4P9F A;  4JOM A;  3W2A A;  1GUU A;  3HRU A;  1Z91 A;  1EH6 A;  2OTL I;  1JGS A;  2RNG A;  3AFH A;  2L7M P;  1A5J A;  3OSF A;  1V55 H;  3BG9 A;  2E35 A;  4N4O B;  2BZT A;  3GLL A;  2LY1 A;  5KK1 A;  3U2R A;  1YLF A;  1RRJ A;  2DOE A;  3QYE A;  1J5Y A;  3ZQI A;  3T0Y A;  5HDN A;  2BHZ A;  4HX8 A;  2M0M A;  3H3V K;  3KET A;  2COM A;  2X1C A;  4LLL A;  1U5T A;  2DO7 A;  2JRT A;  3J7Y J;  2WY8 Q;  1B1B A;  3I56 I;  1W4M A;  2ICW G;  1HQC A;  5J3L A;  5DCM B;  3KZZ A;  3GVA A;  4XN3 A;  4Y17 A;  1R5I D;  2KRF A;  4PUS A;  4UUT A;  1B6A A;  2JQ7 A;  2KZV A;  2I5U A;  4HOB A;  1H89 C;  1XCV A;  1TT5 B;  3SFI A;  1C0W A;  4EM0 B;  3BQY A;  2KL4 A;  4F7Z A;  2JN6 A;  3HZJ A;  5BNG A;  1F5T A;  2VKD A;  4B1R A;  2BYV E;  5KCM A;  3HGY A;  2R7D A;  2DT6 A;  1ODD A;  3FHN A;  5CKT A;  4KIC A;  4XKW A;  1GDT A;  1FSE A;  1WVR A;  1B8I B;  1STZ A;  2X6W A;  3FMS A;  1P4X A;  4XLP F;  4HZF A;  2KIM A;  1F36 A;  1D1C A;  1JTX A;  3M8J A;  3VOD A;  2VE9 A;  2G0E A;  2F5F A;  1ZGJ A;  3F8N A;  2VIX A;  1JTY A;  4GGG A;  5K5R A;  1RI7 A;  1HKS A;  5J8F A;  3J7Z I;  2QQ8 A;  5TRD A;  4I0A A;  4U7D A;  3G71 I;  3ERM A;  4BUP A;  3L7W A;  1JGG A;  1FX7 A;  4CDG A;  3BOQ A;  3CDL A;  1WJ5 A;  2E60 A;  2M7B A;  3BR1 A;  2PLY A;  1VFC A;  2IS4 A;  4EEF G;  2BVM A;  2QYO A;  2V6C A;  1OQY A;  4PK4 A;  2VPL A;  1MBH A;  2F2E A;  1QZZ A;  4E7J A;  4Y4R A;  2PMZ N;  2M8G X;  3F6O A;  3D1N I;  3RDI A;  4UB6 C;  5AON A;  1N75 A;  2ZJR F;  2DMQ A;  3QU6 A;  5J6X A;  1Q1H A;  1WGX A;  2P6S A;  1MSF C;  3D5S C;  2RV8 A;  4KIT B;  3IRQ A;  1VF9 A;  1DPU A;  3WOD F;  3EET A;  3LA7 A;  5E8G A;  1MNE A;  3HKZ N;  3TDU C;  3ZQH A;  2GWR A;  1UAA A;  2HFH A;  3K1P A;  2W48 A;  1YIT I;  3FKI J;  4OMZ A;  1YG2 A;  5ICC A;  2EIM H;  5FD5 A;  1O57 A;  2ZJ2 A;  2K85 A;  3BDD A;  4M3B A;  2IS6 A;  4N9I A;  3ZMV A;  2DPU A;  1QU3 A;  1D0Y A;  3FKJ A;  4G12 A;  2A07 F;  3CUQ C;  3C2B A;  1I3A A;  1X4O A;  2ZME A;  3E5U A;  4E4H A;  1VI0 A;  1S5L C;  1I6X A;  4E70 A;  3WTV C;  3CDI A;  5DCF A;  1G3T A;  4KT6 A;  4NNJ A;  5M5W J;  5EGO A;  3CMA I;  2HOA A;  2OQG A;  4YG2 F;  2CV1 A;  2XAG A;  2DXI A;  2DJN A;  4BDY A;  4K2E A;  2DMP A;  1R58 A;  4AID A;  3IRR A;  4M9Z A;  1H0M A;  2RQQ A;  4XLA A;  4S0H B;  2VKV A;  1RR7 A;  3DEU A;  1BI3 A;  2HKX A;  1KYZ A;  2LRE A;  4AU7 A;  3ASN H;  2R3S A;  2ZSH B;  3M1C A;  1IZ1 A;  3OYL A;  4AIK A;  4GO1 A;  2HDC A;  1EF4 A;  3IAS 2;  2DMT A;  2L2O A;  1UB9 A;  2L54 A;  3M9A A;  1T8I A;  1FMW A;  3DEW A;  1WWX A;  1OJL A;  3TQN A;  5JLX A;  2DT5 A;  2VQG A;  3KP7 A;  4L5E A;  3HUG B;  3NWT A;  5JHU A;  1W36 D;  1JI8 A;  4DGW B;  3LSP A;  4MFE A;  2HEO A;  2MBF A;  2JVH A;  3CF5 F;  5LEK A;  1K6Y A;  3ECH A;  1RES A;  3LA3 A;  1WJE A;  4P55 A;  1LNW A;  1OCP A;  2EV6 A;  4I0B A;  3DCF A;  1HA8 A;  4UVA A;  3P9I A;  5F0C A;  2Y2Z A;  3ISP A;  3KEY A;  1PUE E;  1KU3 A;  2GLO A;  1P7I A;  2OU2 A;  1SFU A;  1TWH J;  4UVB A;  1WJB A;  1PP8 F;  4KA4 A;  3IUO A;  2E34 A;  4BDZ A;  3A03 A;  5IPA A;  3S15 J;  4R8H A;  2ECB A;  3WE3 A;  2ZNZ A;  3E5X A;  2O8X A;  4G8X A;  3WTX C;  2XGE A;  1RPW A;  2XHK A;  4UV8 A;  5AIQ A;  3QWL A;  3QYF A;  4I2O A;  2A5W A;  2AHQ A;  3KYD B;  4MEY F;  5H6R A;  2Y0S N;  2K86 A;  4A0Z A;  4ZTF A;  1U8B A;  1K4T A;  4YFK F;  1MMA A;  2HOT A;  3HDD A;  4IHS A;  4A6D A;  5EDN A;  4A3L J;  1Y8R B;  4I6Z A;  1QA6 A;  3A4C A;  2NVT J;  1JHF A;  1HLV A;  2L7K A;  2BY1 A;  4GDF A;  1IDY A;  2QSF X;  4HX4 A;  2QF7 A;  4KDP A;  1S9H A;  3I5U A;  4HST A;  4IKF A;  3S16 J;  3OL3 A;  2PEX A;  4IHX A;  3HOY J;  1R49 A;  1KU9 A;  3U1D A;  1POG A;  4CCJ A;  3LSR A;  4CUG A;  2IXS A;  2G7H A;  1DU6 A;  4BJ5 C;  3AKZ A;  2F4I A;  2K4J A;  3OIO A;  9ANT A;  4FE7 A;  4ENK A;  2BV6 A;  4OWR B;  3KP5 A;  3JSP A;  3CUO A;  1FOX A;  2DMN A;  3CP2 A;  1JT6 A;  2FX0 A;  1J7K A;  2QSG X;  3HRT A;  3PO2 J;  3VSK A;  3H36 A;  5IP9 J;  5FB2 A;  2HOS A;  5DTD A;  1XMA A;  3PL8 A;  4F55 A;  4WX9 A;  3SZT A;  4HNV A;  2PI0 A;  2HZD A;  2JWT A;  2R7T A;  3LQR A;  4BU2 A;  4Z6Y A;  3S3O A;  3SXY A;  1AWC A;  1SMY F;  2K9Q A;  1RC9 A;  2L4M A;  4NQW A;  4Y15 A;  1OPC A;  1GLN A;  2QLZ A;  3REO A;  3L2W A;  3K4M A;  1HBX G;  4CA0 A;  4DW6 A;  3H3U A;  2M2E A;  1J09 A;  3P9C A;  1HCR A;  2O03 A;  4NC7 A;  2NS0 A;  3GEZ A;  2GOM A;  3I3L A;  4CGZ A;  2JK3 A;  2DA7 A;  4G94 A;  1I1G A;  1Y1V J;  5D5X B;  5BQT A;  3S17 J;  2K3F A;  2KZG A;  2L3D A;  2AO9 A;  1DP3 A;  4XOT A;  2HGC A;  2HU9 A;  3DKY A;  2LY2 A;  3O8G A;  5FKK A;  1VQN I;  2E2H J;  4EJT A;  3BY6 A;  2GXG A;  3E6B A;  4FTH A;  3QPH A;  4XKC A;  1XPX A;  1T2K A;  1YOV B;  3QRF F;  5E18 F;  3I64 A;  4IOC F;  1Y8Q B;  2H94 A;  3CCS I;  1SFO J;  3RQI A;  1FZP B;  1SMT A;  3MKY B;  1OLT A;  5LRR A;  1P7J A;  3QPS A;  1WJD A;  1LFU P;  3CJN A;  2R93 J;  5FFX A;  2EV5 A;  3FMQ A;  3L2V A;  5J47 A;  4ESF A;  2ZXH A;  3NEU A;  1HW5 A;  2K4B A;  2O6G E;  1HSJ A;  5DCM A;  2GIZ A;  3G1M A;  4L18 B;  3RKX A;  2R7Z J;  3AL0 C;  3DKX A;  3KFW X;  3HJE A;  3S93 A;  3CC4 I;  3N97 A;  5DD4 A;  2CQX A;  1V5E A;  2DFF A;  1XGN A;  2WBM A;  2IJL A;  5GPA A;  1OYI A;  4NUB A;  4LK1 F;  1U5T B;  4HF2 A;  2AQE A;  4IO9 F;  2HDD A;  1IDZ A;  2X0L A;  3KEQ A;  3A0B C;  3RYP A;  2JT1 A;  3GFI A;  2QKL B;  3DBR B;  3K70 D;  1N77 A;  1GXP A;  1B8I A;  3R0A A;  1PVE A;  2KPM A;  2H6B A;  4N0B A;  2OQR A;  1EA3 A;  2EFW A;  1BOB A;  2K9L A;  2E5N A;  4FX4 A;  1RR8 C;  5L3E A;  3IH4 A;  1XG1 A;  4LJZ F;  2CQN A;  3Q0W A;  2HYG D;  2IS2 A;  2O3F A;  4XLF A;  4MIM A;  1DU0 A;  2O8K A;  3JRG A;  4XKV A;  3IH2 A;  3DP7 A;  3BC8 A;  4RGR A;  2V6E A;  1T98 A;  5HDK A;  4BY7 J;  2VJJ A;  1RET A;  2WB1 A;  2CQ7 A;  3EUH C;  3I54 A;  1FBS A;  4IQ4 A;  4JQF A;  1A04 A;  2VJI A;  3FBI B;  4BE0 A;  1IRX A;  3CJQ B;  2PJR A;  4UB8 C;  2RGV A;  3CUQ A;  3G3Z A;  2R5Z A;  2DK8 A;  3HEF A;  3RSN A;  5D5W B;  3J7A Y;  3T5X A;  3M07 A;  3VFZ A;  3OWT A;  4KN7 X;  3TOA A;  3SEZ A;  3K4N A;  4F92 B;  4HV5 A;  2Q2E A;  4EMS A;  1MH4 A;  4AM3 A;  2EZL A;  2BGC A;  3FMR A;  1XC5 A;  5HNH A;  3FM3 A;  2WAF A;  3MKW B;  5J1Y A;  1WSU A;  1D1A A;  3IHU A;  2IPQ X;  2YPR A;  4DBQ A;  3BTL A;  2L9V A;  1K7A A;  3WTY C;  4ENJ A;  1H9G A;  5E79 C;  3WG9 A;  1AKH B;  1YW7 A;  1MMS A;  5D4R A;  2GOX B;  2HZT A;  2HPI A;  2XV4 S;  2GXB A;  3K0L A;  1SC7 A;  1MJB A;  3KIO A;  3PUF A;  4ITV A;  4AD9 A;  1UHW A;  2WAD A;  2VC1 A;  2B0L A;  1ZRD A;  1FOW A;  3LAP A;  4HA8 A;  1TQP A;  1I27 A;  2DQL A;  4BNC A;  2QWW A;  3Q9S A;  2TRT A;  2Z33 A;  4EJW A;  5ILU A;  1MKM A;  1WJA A;  1NH3 A;  1S7A A;  3L09 A;  2HVQ A;  5DUI A;  3DFG A;  3K7A J;  3SDB A;  1U78 A;  1FTT A;  2A6T A;  3P5J A;  1W5C C;  3ZQQ A;  3IKV A;  4EM1 A;  1BI1 A;  2Q8K A;  3QP6 A;  4CO8 A;  2ZME B;  3ZMZ A;  4C30 A;  2XAS A;  3G1L A;  4HV6 A;  1OMI A;  3H5R A;  4II2 A;  4BAC A;  5FFZ A;  3S1N J;  2LDU A;  5ICF A;  2XKO A;  3TMO A;  3OIP A;  1WH7 A;  5TGT A;  5LGU A;  5EGO B;  2HQR A;  4MEX F;  3LSJ A;  4UXN A;  2CUZ A;  5AIP A;  1K83 J;  5E8I A;  2DYS H;  4HDV A;  4RBO A;  3MFK A;  4G6T B;  2ZXI A;  1UJ8 A;  1LUJ B;  5GP9 A;  4B3A A;  2G9W A;  2L7Z A;  2VQC A;  3PQJ A;  5DM7 F;  2JUG A;  2FQ3 A;  3VSL A;  2RRE A;  3MQ0 A;  1QRY A;  3K4L A;  1OKR A;  4A0Y A;  4L5J A;  2ECC A;  1X2M A;  4B8X A;  4X0G A;  2LC2 A;  3DLL F;  4V19 K;  4QWQ A;  1HKQ A;  2P0W A;  1QZY A;  3TP0 A;  5M3F J;  4HNU A;  3S14 J;  4M9S A;  1QZE A;  3RKY A;  5KNL A;  3FBN B;  5GAG J;  4I02 A;  3WGG A;  3SJM A;  4G7H F;  1MBG A;  4MTD A;  3VWB A;  1FOY A;  1PJR A;  3WU1 B;  3SFZ A;  1D5Y A;  2GA2 A;  1WKM A;  1UFM A;  4XIC A;  1J9I A;  2O5R A;  2X1D A;  2CFX A;  4JX5 A;  1BR4 A;  1B4A A;  2JUC A;  3FXK A;  5CVU A;  2YS9 A;  5IYC J;  3M8F A;  2V9P A;  2NYX A;  1CQT A;  2JPC A;  1DUX C;  2P7C B;  4D7N A;  2MYS A;  2Z5U A;  2MLG A;  3VOE A;  1VQ7 I;  1XGS A;  2CO5 A;  2EB7 A;  2VOD A;  1Z9C A;  4HRI A;  5L3B A;  1Z21 A;  1VQ5 I;  4U88 A;  3F72 A;  4WWC A;  1BN5 A;  3GTK J;  4B09 A;  1KGS A;  1EH7 A;  1LFB A;  5JVG F;  4DYR A;  3S2H J;  3HHG A;  4M71 A;  1KQ9 A;  2BY2 A;  2X6X A;  4A3B J;  2E1M C;  2HXI A;  3BG5 A;  2YUS A;  2IS1 A;  3TGN A;  3ULQ B;  1TC3 C;  4RGX A;  4RB1 A;  2E7W A;  3SHF A;  1XSV A;  4MNU A;  2NXN B;  1VQ4 I;  2JJ7 A;  3PSI A;  4HEA 2;  2O7O A;  3RPU A;  2F5C A;  3H3Z A;  2NOG A;  3R4K A;  5F1J A;  5LEJ A;  3ZPL A;  4B47 A;  2JZY A;  4PJJ A;  1T38 A;  1TLH B;  1IN7 A;  2Y31 A;  1FPQ A;  4RS8 A;  3WU2 C;  1OIS A;  4ZH4 F;  4F93 B;  2FXA A;  2L9N A;  2FOW A;  2X51 A;  4XSZ F;  1ETO A;  4NDL A;  1LQ1 A;  3I55 I;  4I98 B;  4LB6 B;  1WQ2 A;  4C3J J;  3FF5 A;  3MCZ A;  3N05 A;  3MD2 A;  1D1B A;  2VJ5 A;  3KP6 A;  4BS9 A;  3MKZ A;  2DQR A;  5BPI A;  1XB4 A;  4XSX F;  3IL2 A;  2R5Y A;  2R7X A;  2ELJ A;  2V26 A;  3I59 A;  3KE2 A;  3H5A A;  1G3S A;  3GZN B;  3GFM A;  1A6Q A;  2W85 A;  3LNQ A;  2M87 A;  1YW8 A;  3ZR8 X;  3GTG J;  1REP C;  4NQW B;  1MJA A;  3K4C A;  4AUX A;  3HSR A;  1YIJ I;  2KIQ A;  4Y33 A;  4KYW A;  1DGR M;  2R92 J;  3LWF A;  1P4W A;  3W3C A;  4D7M A;  1FP1 D;  4QSH A;  2VE8 A;  3M8E A;  3WHB A;  1Z3Y A;  3V7S A;  1S29 A;  3GF2 A;  2DDB A;  2GAU A;  5LGN A;  2J5P A;  2EIN H;  1I5Z A;  3CLQ A;  5JI6 A;  1HC8 A;  5LD2 C;  4PJM A;  1OYY A;  5JLW A;  1K78 B;  3ZRG A;  2KRH A;  3IAM 2;  4FCY A;  2O9L A;  4ZYD A;  1S6L A;  4GXO A;  5L3D A;  1OFC X;  1N25 A;  1BOA A;  1R5H A;  1U6G A;  3BG7 A;  1R71 A;  2HOE A;  1HXD A;  2A6H F;  5FKL A;  2ZJQ F;  1U8R A;  5HVQ C;  2CUF A;  2FOK A;  5E1Z B;  3GTP J;  4MLO A;  1W5S A;  4XKB A;  3ZQC A;  2VBW A;  2LH9 A;  3O2P E;  4CCM A;  2Y48 A;  2XIG A;  4CSW A;  2VBY A;  4A93 J;  2LR8 A;  1ZQ3 P;  1AHD P;  4F91 B;  1KA8 A;  2M0C A;  1YRN A;  1ETV A;  2Y0M A;  2E19 A;  2XAF A;  4S04 A;  5EZH A;  4KMU X;  4M3D A;  2CWE A;  4L0Z B;  1IG7 A;  2KQR A;  3HL2 A;  4ZYA A;  5DDG A;  2V9K A;  4WF2 A;  4BEH B;  1MGT A;  1E2X A;  2MG4 A;  2IA1 A;  2X85 A;  2EH3 A;  3KLN A;  2CV0 A;  2V79 A;  5HOO A;  2ID3 A;  3H0G J;  1RZ4 A;  2DN0 A;  3GTJ J;  3ZQ7 A;  1OCC H;  5DYM A;  3LSK A;  2KLO A;  4UNO A;  2O61 A;  1ITY A;  1E3H A;  3VEP A;  2R7S A;  1ZG1 A;  2FML A;  3NAR A;  1YHQ I;  1MDM B;  5FLX K;  5FLV A;  2DTZ A;  3Q3S A;  2Z2S B;  4XOR A;  3DPT A;  1EV7 A;  3B6C A;  5A2Q K;  4H4K C;  1Z6R A;  5KAF C;  3LOC A;  2XC7 A;  5CLS A;  3HM5 A;  4B44 A;  4UVC A;  2QSH X;  4FHT A;  5LHH A;  2JA7 J;  1I1S A;  3SDG A;  1YFH A;  4X1E A;  5K7Z A;  2PJR B;  5F04 A;  3CUQ B;  3ZN0 A;  1ZKG A;  2R5Z B;  1XS9 A;  1LE8 B;  1T56 A;  3K4J A;  5JHF A;  3AG4 H;  2PFB A;  1AKH A;  3B6A A;  3KZI C;  3CJR B;  5ERI A;  2K40 A;  1FWZ A;  1V3F A;  2EIL H;  5B1B H;  4CCO A;  2KP6 A;  1HDD C;  1KQ8 A;  1O7L A;  1K61 A;  2Q2E B;  2L7F P;  1JJ8 C;  4RB0 A;  2WY7 Q;  4Y13 A;  3CO6 C;  5IOY A;  2K02 A;  3C7J A;  1T95 A;  3MVP A;  4P96 A;  4RMN A;  4Z2Y A;  4H0E A;  4EVI A;  1NK2 P;  3M1E A;  1YX3 A;  3CP8 A;  4AVZ A;  2X9D A;  4PDK A;  1A31 A;  4PSX A;  3UR3 C;  3I4P A;  2C6Y A;  1MBF A;  3E6D A;  3E97 A;  3ZCO A;  4HYE A;  1X1P A;  3CCE I;  4PGG A;  1ZG5 A;  2BBY A;  1UHS A;  3MN2 A;  4GCV A;  4O5V A;  4KJZ A;  2ID6 A;  3ECO A;  3BG6 A;  2A69 F;  3V8K A;  1N78 A;  3ROU A;  1XTA A;  2FBI A;  3WTZ A;  4RDU A;  1VND A;  1RKW A;  2FF4 A;  4YIF A;  3WTU C;  1NK3 P;  4S05 A;  2OC6 A;  4RAZ A;  3BJ6 A;  2P6T A;  3AG3 H;  4M3F A;  2F4O B;  2X48 A;  1SAU A;  1LJ9 A;  2P81 A;  5FRN A;  1XX5 A;  4WXH A;  2ESH A;  1L3L A;  1JKO C;  2YX4 A;  3KPH A;  3TO7 A;  1BA5 A;  2OCE A;  4DYQ A;  3ABL H;  2STT A;  2FBK A;  2AXT C;  3F8C A;  4R79 A;  2BVL A;  3OYM A;  4PFP A;  2MSY A;  2FD5 A;  2KFD A;  3CF2 A;  3BZC A;  2QQA A;  1G8X A;  4IHY A;  2FNP A;  3GTL J;  1LVA A;  2QA4 I;  5DEQ A;  3PIP F;  3DKW A;  2XVC A;  4D0P A;  3V42 A;  1PUF A;  3GFJ A;  3GO5 A;  1X1C A;  1TWC J;  2IA2 A;  5TJJ A;  2GM4 A;  5HS9 A;  3DTK A;  1Z7U A;  3LMM A;  5LGT A;  1YS6 A;  1H8A C;  1D8K A;  2VT2 A;  1OCZ H;  5E1X A;  1R1V A;  1TZL A;  5CJ9 A;  3FK7 A;  1LDJ A;  5FJ8 J;  3GYH X;  1VQK I;  1FYK A;  5J8C A;  4KT5 C;  1ZHF A;  2MGQ A;  5E3N A;  3H92 A;  3R0J A;  1Y39 A;  1QQI A;  3VYT B;  4M74 A;  1YI2 I;  1NG7 A;  4OIR F;  1I50 J;  2HYJ A;  1B59 A;  1YJW I;  1S72 I;  3QQA A;  4BHP A;  2EA2 A;  4LG0 A;  2OBP A;  3R6S A;  3HOX J;  5FLX Z;  2EIJ H;  1IXC A;  3J7A O;  1JKR C;  1HST A;  5M5X J;  2KKO A;  3HOT A;  3TP3 A;  5IYD J;  2NNN A;  4A69 C;  1F43 A;  2NOJ B;  5CPR B;  4JYK A;  4DQ2 A;  3LSM A;  1HW1 A;  1LB2 A;  3Q5F A;  3A0H C;  4HQM A;  4C3H J;  1TW2 A;  3OSG A;  1FBU A;  2WWY A;  2IBD A;  2VPR A;  2DFH A;  2K7L A;  4GFB A;  4XON A;  4RAG A;  2X4H A;  2AXL A;  1DP7 P;  4ZDP A;  4M3G A;  3H9G A;  5K5O A;  3HBL A;  4BHB A;  4ETS A;  1VQM I;  3HRS A;  5E17 F;  3VDX A;  3WGI A;  2Z3Y A;  3GME A;  3RJP A;  4U87 A;  3LSG A;  1IF1 A;  3KZY A;  4BHC A;  2CG4 A;  2XUB A;  1Z77 A;  2E5Z A;  2VBZ A;  3OYJ A;  3ZQL A;  1GVD A;  3A01 A;  5IP6 A;  1P4A A;  1UG0 A;  2VB6 A;  1D0X A;  5J4Y A;  3HGG A;  3FM5 A;  2DDA A;  3A1Y A;  3MEX A;  4ZC3 A;  5IOZ A;  1P2F A;  1G2H A;  1OCR H;  3P7N A;  2WB1 N;  5KVR A;  4DJA A;  3AG2 H;  3BJA A;  3E1S A;  3S3M A;  2W25 A;  4OIN F;  3KLO A;  2VKE A;  2M3A A;  2KDO A;  1KQ0 A;  2M34 A;  3H0D A;  4XK4 A;  3RCO A;  2J5O A;  4ASN A;  4XRM A;  1EJ9 A;  2XF7 A;  3HRM A;  2H27 A;  3QPL A;  4E7Z A;  3W6V A;  1LPQ A;  3Q0V A;  4L9J A;  2RDP A;  2R7F A;  3TO9 A;  1R4N B;  2DFE A;  3I58 A;  4LGW A;  3OYN A;  2Z9O A;  2I8D A;  3MWM A;  2LYC A;  3AG1 H;  5K7H A;  5LLQ A;  3S2D J;  1HW2 A;  2HPM A;  2DU9 A;  2R7O A;  3S2W A;  1T33 A;  4YEJ A;  1LFP A;  1FYL A;  2DOD A;  1WJF A;  2W1O A;  2R5Y B;  3HTS B;  2EZK A;  3I59 B;  3FXR A;  4JBA A;  4CH7 A;  2EFO A;  3WGH A;  3WG7 H;  2FJ1 A;  1Y6I A;  3IWZ A;  3LSH A;  4R1H A;  4B48 A;  2CQK A;  3AL0 B;  2KJC A;  1X3U A;  1R5G A;  5F64 A;  2D2W A;  3OR1 C;  1K78 A;  2XGC A;  1JUS A;  1Z1D A;  2LMD A;  2EZI A;  3CJT B;  1TWF J;  1ACI A;  3BCA A;  2JA8 J;  3L2Q A;  5HDG A;  6PAX A;  4BGD A;  2V1D A;  4GRI A;  5F27 A;  4XRS A;  1UG2 A;  4M3E A;  2OV7 A;  2IAI A;  3OYD A;  1V5F A;  5GTI C;  1AU7 A;  5FLM J;  5EG0 A;  1VTN C;  5FKM A;  1NTC A;  3BR5 A;  2CUE A;  3CES A;  1LEA A;  2BY3 A;  2E71 A;  5F0H A;  1PP7 U;  1P92 A;  3L2C A;  2OAZ A;  3E3V A;  4EJU A;  2HNH A;  1BI0 A;  2R7Q A;  5CQG A;  2XAH A;  4IOA F;  1IN6 A;  1Y1W J;  3V8L A;  3QPT A;  5BMZ A;  2YU9 J;  4B3X A;  3ZOB A;  2B9S A;  4CXF A;  2OF7 A;  2JSP A;  1FIA A;  3DQV C;  2Z1D A;  1JKP C;  2D5V A;  2YU3 A;  2L02 A;  3K69 A;  1O3S A;  4OMY A;  1H88 C;  4BEH A;  4UY8 I;  3F22 A;  4Y3O A;  3HOW J;  1X1A A;  2LY9 A;  1MH3 A;  1YIO A;  2IP2 A;  2VL8 A;  3FXL A;  2LD5 A;  1BW6 A;  4UUS A;  2W82 A;  4XRF A;  4HW0 A;  1MIJ A;  2M1B A;  4Q5S F;  1R4M B;  1YRN B;  2XKP A;  3QOP A;  1HF0 A;  4IRG A;  3ZXS A;  1MDM A;  2MAB A;  2PMU A;  3MMY B;  4ABZ A;  4IHV A;  3JRD A;  3WU0 A;  4M73 A;  3FXJ A;  2V1X A;  1IO2 A;  3I4N J;  2QCO A;  3QOD A;  4F3Q A;  5E3O A;  3LFK A;  1B72 A;  1ZN2 A;  3GBG A;  3G6E I;  3CTA A;  4HPQ A;  4DBR A;  1IN4 A;  4KUM A;  1FEX A;  3ZMT A;  1YJ9 I;  5FRM A;  2XPU A;  1SVM A;  1R36 A;  1LE8 A;  3PNY A;  2W4S A;  1LEB A;  1ETK A;  4IXA A;  1FYM A;  4C2T A;  5L3G A;  2WA0 A;  3CQZ J;  3H5N A;  2GXA A;  4D5C A;  2EPF A;  4ESB A;  2EIK H;  3KYC B;  4M6X A;  3W2W A;  1NHA A;  1IXS B;  2X6O A;  4HG2 A;  2R7W A;  3ZMS A;  2UV1 A;  4PJN A;  3HXL A;  1X1D A;  4I7H A;  3KEO A;  3TW6 A;  3PNT A;  5HNF A;  1FSH A;  2VAS A;  3J80 K;  2Y30 A;  4PFO A;  1XSD A;  2RAE A;  2X1E A;  4XL9 A;  2P5K A;  4GYI A;  3SZG A;  1UZC A;  3S1R J;  1IV6 A;  3BP8 A;  2KDZ A;  1VQ6 I;  4DIQ A;  1U0J A;  4HLY A;  3R60 A;  3EUA A;  2TCT A;  5EZG A;  1S7O A;  3TDZ C;  1XN7 A;  1SAX A;  1R22 A;  3D5L A;  5GTH C;  5EYR A;  1WH5 A;  4BAY A;  4L0Y B;  2GIV A;  1TWG J;  3HIF A;  3UNG C;  3DTE A;  1WFX A;  2ME0 A;  1HOM A;  2CQQ A;  3EYI A;  2DCE A;  1S7E A;  1QPI A;  3B73 A;  2P8T A;  3X2Q H;  4Q4Z F;  2E1C A;  3M3Y J;  3T8R A;  2LBF A;  2K9M A;  3HSF A;  5GPC A;  5GAE J;  2ZXJ A;  3I53 A;  2QBY A;  5DV5 A;  3GTM J;  1RUO A;  3KCC A;  4EJV A;  1MJ9 A;  4PSW A;  3LAJ A;  4PJL A;  3RPQ A;  2MD5 A;  3JRA A;  4BXU A;  1IN5 A;  4I99 C;  3FHZ A;  4M6V A;  4RM2 A;  2MH2 A;  3I0T A;  2CV2 A;  4WCG A;  4I09 A;  3COA C;  1VQO I;  5EEH A;  3FX3 A;  5LHI A;  3HPH A;  2QEN A;  2DA1 A;  2ESN A;  3BG3 A;  3E0J B;  3SZP A;  3G4S I;  5IP7 J;  3ELK A;  3QAH A;  2JVG A;  4RA2 A;  3N4M A;  3ONQ A;  5CVV A;  5CVI A;  4G6Q A;  2N8G A;  5H20 A;  4CCN A;  4NBQ A;  3CCM I;  4XLC A;  1X1B A;  4QPO A;  4G9Y A;  1PUF B;  2ZB9 A;  4GYG A;  3RZO J;  1WPK A;  3MZ8 A;  1JT0 A;  4OU0 A;  1G6N A;  1W36 C;  1TP4 A;  2QM3 A;  2IGN A;  2EJR A;  4X6A J;  3L9F A;  5C4X J;  1YS7 A;  3I4M J;  5D8L B;  1TNT A;  4LG3 A;  1W7P A;  4C9Y A;  3RIR A;  4HF1 A;  4AC0 A;  1IAW A;  1V5G A;  4BE2 A;  5GAH J;  2DLL A;  4BE1 A;  4YEL A;  4E7S A;  4A5N A;  5HLH A;  2HQ5 A;  5FO5 A;  2E1M B;  2QZ8 A;  4IRH A;  1CF7 A;  2F48 A;  2HVS A;  2E2I J;  2UWM A;  1ETY A;  2RVC A;  1V4R A;  1DQU A;  2W24 A;  2TDX A;  4YFX F;  1RKT A;  4RB3 C;  3HYI A;  4MQV A;  2QKM B;  4LG0 B;  4WK8 F;  3C2G A;  4E6K G;  1IRG A;  1FLI A;  3K10 A;  4KIF A;  2R7U A;  2H09 A;  2PX9 A;  2A61 A;  1KYW A;  1ENH A;  2CS3 A;  3GCM A;  3JCU C;  3O8H A;  3RKW A;  5ICG A;  3WHC A;  3BTI A;  4CYC A;  2ACJ A;  2MLK A;  1MD0 A;  3K1N A;  1E3O C;  3M4O J;  1Z3X A;  1BJA A;  4N4N B;  5B1A H;  2JTV A;  3JR9 A;  2WAQ A;  2GZW A;  1TT0 A;  1UST A;  5E1W A;  3J80 Z;  1IRF A;  2EK5 A;  1G3W A;  1XGM A;  1JUP A;  4J00 A;  4OIQ F;  3GTQ J;  1ZGA A;  4EV0 A;  1E17 A;  3BR0 A;  1U3E M;  4F52 A;  4BY1 J;  4M72 A;  4YRV A;  1ZRE A;  2VJ4 A;  4XOP A;  1F4K A;  3T8T A;  3VB2 A;  4CCL A;  4A12 A;  2ISZ A;  2M4G A;  3OS2 A;  5HOD A;  1X58 A;  1Y0U A;  4XM3 A;  4BJ6 C;  2GBY A;  4MFD A;  3BQZ A;  4Q48 A;  2VON A;  1B9N A;  4A6E A;  5IT9 K;  2JA5 J;  3PJR A;  3A01 B;  3H1C A;  4RM3 A;  4OIP F;  4RGU A;  2HTS A;  2P5L C;  1T08 B;  1SD6 A;  3PSF A;  5EEG A;  4DZJ A;  2ELK A;  2V9V A;  3OL4 A;  4KFC A;  1T0F C;  1YTY A;  3CMY A;  5F1R A;  3R61 A;  5B66 C;  1XMK A;  3MKL A;  3L2U A;  3JRB A;  2CW0 F;  1ZG3 A;  3F8M A;  4AVP A;  2QEX I;  3NQO A;  3C3W A;  4UUV A;  4A3I J;  3OYC A;  2NVY J;  1TL8 A;  3NAU A;  2DBB A;  2XB5 A;  1XCB A;  3BRO A;  4XR6 A;  5JVT A;  3ERE D;  1R6R A;  4LFU A;  4LIV A;  3JRH A;  2H8R A;  3BR6 A;  3D5R C;  3PIO F;  1PYV A;  4FE4 A;  1IC8 A;  2EFN A;  2VQL A;  3I71 A;  4LIT A;  1KU2 A;  2DOF A;  2RNJ A;  1R1U A;  4V2F A;  4IJA A;  1FOK A;  4EAT A;  2XRL A;  3IC7 A;  2IGM A;  2LVS A;  3F8F A;  2NS8 A;  1W5T A;  1ZEL A;  1SD7 A;  3CC7 I;  4DYC A;  4HX7 A;  2P7V B;  1X19 A;  1TW3 A;  1BL0 A;  4WXC A;  3J81 K;  4BXX J;  5FD6 A;  2XAJ A;  2K27 A;  1K6O A;  3HB9 A;  4ZZD A;  1I39 A;  3HOZ J;  2Y9Z A;  2FMY A;  4ZDL A;  1BR1 A;  3F0C A;  2LLK A;  4RGS A;  3QU3 A;  2ZC2 A;  3OOP A;  4LIU A;  4IQJ A;  3RPU D;  4A3C J;  2DT7 B;  4MHG A;  3HC7 A;  3LA2 A;  2M7A A;  3CCY A;  3ZGK A;  2M30 A;  4E7H A;  3TKY A;  1MMG A;  3BCB A;  2P4W A;  4ESJ A;  4I76 A;  4A3F J;  1ORK A;  2QVO A;  3EUH A;  4ZDO A;  1RNL A;  1U9N A;  3GXO A;  2F5V A;  1BI2 A;  3DU6 A;  5EG0 B;  2DA5 A;  1TWA J;  4XMY A;  1VQL I;  3MZH A;  2VKH A;  4TV7 A;  5EJC A;  1ETW A;  2NS7 A;  2KIF A;  3QOE A;  3FXO A;  3PNV A;  3IKT A;  3OS1 A;  4II3 A;  3OYA A;  3JRF A;  4RAY A;  2I10 A;  3JAM K;  3EUK L;  2CGP A;  4NC8 A;  1JJ6 C;  3GZ5 A;  3H9Q A;  3S1M J;  2BXY A;  1K79 A;  3DU5 A;  2FE3 A;  3K70 C;  2O0Y A;  1MSE C;  4IHW A;  4IZZ A;  2WC2 A;  2JRM A;  3C18 A;  3K9T A;  3TL4 X;  4XBF A;  4XQF A;  3KP2 A;  1ULY A;  2XAQ A;  1IXR C;  5E20 A;  3OYI A;  2AQF A;  5D6F A;  4Y52 J;  2LTP A;  5CQE A;  5IT9 Z;  1ON1 A;  3SEQ A;  2OUM A;  4UUS B;  1UMQ A;  2DA6 A;  2YR2 A;  4G7O F;  5GAD J;  1LDK B;  2LRD A;  3GFL A;  2PN6 A;  3BTC A;  3RTR A;  5D8K B;  2IT0 A;  2K9S A;  2G7U A;  3GLX A;  1G4D A;  3DF8 A;  3V8J A;  3A2K A;  4XLE A;  4QPQ A;  3OYG A;  2E2J J;  2BOL A;  2Z16 A;  1BM9 A;  5CVR A;  2VT3 A;  2ZJP F;  2PQ8 A;  2M8E A;  3U9G A;  2HYF A;  2VQH A;  4AYB N;  2ZCW A;  1Z67 A;  2M9H A;  2IRF G;  2WV1 A;  1O4X A;  1OR7 C;  1W0U A;  1B72 B;  2D1H A;  4J01 A;  1GVJ A;  2MA3 A;  1YW9 A;  3BT9 A;  3SQN A;  3RI4 A;  1HKT A;  3W2V A;  5ILV A;  2CMP A;  1MBJ A;  2CW7 A;  3OIQ A;  4OIO F;  2B63 J;  1ZAR A;  4LLG F;  5B5E C;  4A3E J;  4ZTJ A;  1YJN I;  1U2W A;  2STW A;  3LSI A;  4IHT A;  2YX7 A;  2KT0 A;  2RC4 A;  1EH8 A;  2KRC A;  1U9O A;  3H9J A;  2CYY A;  1WZ2 A;  3DPU A;  4MGR A;  1O3T A;  4PGH A;  3BJO A;  3OYF A;  2DA4 A;  3JRI A;  1IGN A;  1BIB A;  4A3J J;  4JK1 X;  3J81 Z;  1X2N A;  1FT9 A;  1KON A;  1ETX A;  4YFN F;  2L01 A;  1MND A;  1GV5 A;  1E0E A;  5J1U A;  2V4J C;  2COB A;  1J59 A;  3U1K A;  2AS5 F;  2LKX A;  2CFO A;  2DA2 A;  2HQN A;  3RYR A;  1GT0 C;  5C3E J;  1J2X A;  2DMU A;  1BJZ A;  2L4A A;  4I01 A;  5F0F A;  1XMX A;  2ZFW A;  2R4G A;  5ED4 A;  2CW8 A;  1FTZ A;  2E1N A;  2Q0O A;  3HHH A;  3WTW C;  3KP3 A;  4P5O A;  4O3M A;  4L5I A;  4HLX A;  1G3Y A;  4CZZ A;  1G59 A;  1Z05 A;  5CYV A;  2LBF B;  4A3D J;  1X4P A;  4OAZ A;  2QBY B;  3K4K A;  2HQA A;  1RIO H;  5DUK A;  4U7B A;  3F23 A;  1FMV A;  3W6J B;  3OR2 C;  4JX6 A;  3JRE A;  5B3S H;  1ONV A;  2HKO A;  3K2A A;  1SVO A;  2JA2 A;  3FZV A;  4L9T A;  4UV9 A;  3JAM Z;  4PZJ A;  1XSX A;  1QO0 D;  5L3C A;  1R7J A;  4ZYH A;  1Y56 A;  1SFK A;  1TBX A;  1W1W E;  2UZK A;  3V4G A;  2ADU A;  2XRO A;  4BH9 A;  1YQA A;  1FIP A;  3B02 A;  3PO3 J;  1QNT A;  2EV0 A;  2UUZ A;  3HOU J;  1IRZ A;  3CCR I;  4A3M J;  5JFR A;  1B9M A;  1ZK8 A;  1Y0N A;  2BY0 A;  3OMY A;  5IYB J;  2FU4 A;  5HLT A;  2E7X A;  4IF4 A;  3ML6 A;  4FET A;  2MC4 A;  1EKE A;  3FK6 A;  2VOO A;  3DBL B;  4M6Y A;  2OD5 A;  1P9Q C;  2BE5 F;  4C2U A;  4KIS A;  3TO6 A;  4HBL A;  1Z6T A;  3LFU A;  2H8W A;  2BW3 A;  1S8N A;  1W7P B;  5A2Q Z;  2ZSI B;  4QLC U;  2HVR A;  2VXD A;  1IJW C;  2HS5 A;  4HDU A;  1D3Y A;  3ZP5 A;  4D1Q A;  1JHH A;  1SFE A;  3BTJ A;  4BYY A;  4J19 A;  1CF7 B;  2L0K A;  1T0F A;  4QTR A;  3RQ4 A;  2QQ9 A;  5DD8 A;  3BR2 A;  4NHJ A;  2KMU A;  3ZQG A;  4IEJ A;  4AYB A;  2XSJ C;  2LNB A;  4A2U A;  5F08 A;  3OYH A;  1MW7 A;  4FX0 A;  4CYC B;  1HDP A;  4B4C A;  1V54 H;  2ZKZ A;  5BS6 A;  4L9V A;  5LRS A;  3QYB A;  1A36 A;  1S3J A;  2EA4 A;  2M5W A;  3BWG A;  4U0Y A;  1Z0X A;  4U0V A;  1WCM J;  4KIG A;  4W1U A;  4ZYG A;  2FEZ A;  5DS9 A;  3K4B A;  1IV8 A;  4EM2 A;  3CCU I;  3CZ6 A;  3LQQ A;  2KHM A;  3TW7 A;  4D5F A;  2QGU A;  1DPR A;  1USS A;  3Q9V A;  1ZAO A;  4BKX A;  1TQM A;  4HNT A;  2DPD A;  1OYW A;  2XF6 A;  4UHT A;  1ZTR A;  1VQ9 I;  1ZR4 A;  2Z99 A;  4OAY A;  1TNS A;  4CCK A;  5ICE A;  2PMZ A;  2R7V A;  2ZNY A;  2JSC A;  2CJJ A;  3F3X A;  1FBQ A;  3G2B A;  2FQ4 A;  3EYY A;  1ERD A;  5C44 J;  4XRS G;  3S1Q J;  3HKZ A;  5DM6 F;  2LOO A;  3A02 A;  2R7R A;  4RB2 C;  2OTJ I;  1UCR A;  3E6M A;  2A5Y B;  3HSE A;  3ABT A;  1FJL A;  1PDN C;  3PQK A;  2L9S A;  3C2H A;  2HTJ A;  1X3Z B;  2ME6 A;  3FXM A;  3Q0U A;  1GV2 A;  1WRJ A;  2LSO A;  3GZ6 A;  2VUM J;  3ZMD A;  5D4S A;  2XB0 X;  5D5U B;  3CCV I;  2F6C A;  5HS8 A;  3DEE A;  3E6C C;  5EEA A;  1VZ0 A;  2JMW A;  3PFI A;  2A3S A;  4U0W A;  3LL7 A;  1OCO H;  1DDN A;  3OYK A;  4A3K J;  5BOX A;  2DTR A;  1OCT C;  1QHG A;  2OCC H;  3HPG A;  5M3M J;  4DZP A;  1KU7 A;  2NVU B;  1QPM A;  1QVT A;  5F6F A;  2RQP A;  3H35 A;  1APL C;  3DBH B;  5KAI C;  2PMH A;  2NNY A;  2D45 A;  4FT8 A;  1MMD A;  2V7F A;  3ESW B;  1W0T A;  1XDU A;  1QHH D;  2Y9Y A;  4BL0 B;  1KZH A;  2A05 A;  3P9K A;  3TBI A;  1IW7 F;  3EQL F;  2B7E A;  4BBR J;  2LK2 A;  3CD6 I;  1MBE A;  2NVX J;  2PJP A;  2VLA A;  4OOI A;  1T39 A;  3ABK H;  2IA0 A;  3L2R A;  1MZB A;  2R0Q C;  1UEL B;  1XD7 A;  4BXF A;  1QVU A;  2IVM A;  2VOP A;  2W57 A;  5FGM A;  2DW4 A;  4QIW N;  1ZR2 A;  3F6V A;  3WTS C;  3E5Q A;  2PG4 A;  5E3M A;  2IW5 A;  3ZQF A;  5LFA A;  2H1K A;  2FBH A;  1X3W B;  2K9N A;  1YX5 A;  2ZFU A;  2H1L A;  2MH9 A;  4EGY A;  4CZC A;  4G6D A;  3K2Z A;  2GQQ A;  2EZH A;  3LST A;  3OS0 A;  1OR7 A;  2BEO A;  2XPV A;  1YO5 C;  3TOB A;  3GWZ A;  2RKH A;  3PFY A;  3MAJ A;  4FQG A;  4BQN A;  3HOV J;  3W6K B;  4ZZL A;  1R00 A;  1O7F A;  2QQB A;  4Y7N J;  2EFQ A;  2WV0 A;  1T6S A;  3FIW A;  2E36 A;  5ILS A;  3K1M A;  4ENN A;  3ASO H;  2MFZ A;  3S32 A;  3BPX A;  4LMY A;  1F9N A;  1GHC A;  2F4M B;  2DI3 A;  4M9X A;  1I6H J;  1FP2 A;  5H2F C;  3V7C A;  3VPR A;  2Y75 A;  5LHG A;  2Y0S A;  1ON2 A;  4KIB A;  4NC6 A;  1JUM A;  1A35 A;  2V1U A;  3CMM A;  2FSW A;  3RZD J;  1ZLJ A;  1L0O C;  2ZXW H;  4N9H A;  3OY9 A;  4YII A;  1RUN A;  1D8J A;  2HXO A;  2FRH A;  3GUD A;  2HDW A;  4IX7 A;  2WTE A;  2F5E A;  3VYR B;  3UKG A;  2W00 A;  3V7R A;  2XAU A;  2M45 A;  3GW2 A;  2XDV A;  2IEK A;  2WAQ N;  4EGZ A;  2WAE A;  3K6G A;  3L00 A;  1LKX A;  3CCJ I;  1GXQ A;  4KNY A;  2BHY A;  1U5T C;  3G73 A;  5JR3 A;  2P5V A;  3JTH A;  4NB5 A;  2VC0 A;  5M5Y J;  4AIH A;  4JX4 A;  4Q47 A;  3HOS A;  2ISY A;  2RN7 A;  1J75 A;  1ETQ A;  4FAS D;  4E7L A;  3IWF A;  2D1V A;  1VQ8 I;  3F8B A;  4LB5 A;  3KX2 A;  2XF5 A;  5L3F A;  3FXQ A;  1SFX A;  3FXU A;  1BC8 C;  4XNF A;  5LBQ A;  3VYS B;  1R9T J;  2MW8 A;  3DWL E;  4E7I A;  5K7F A;  3CME I;  3OYB A;  1YE9 A;  2KIU A;  3DXJ F;  4C2M J;  1IUF A;  1R1T A;  2DJI A;  2DYR H;  1A6I A;  2XGX A;  2EBI A;  2ZBK A;  3F21 A;  5J1R A;  2LKS A;  1VQP I;  2L9R A;  2JA6 J;  3WE2 A;  4BQA A;  4AIJ A;  5HS7 A;  5C4J J;  4LD5 A;  2NRA C;  1XGO A;  4HQE A;  2ETH A;  2EFP A;  3FDY A;  3ABU A;  2K5C A;  3DLA A;  1MBK A;  4FIS A;  3JW4 A;  4L9N A;  1MMN A;  2L5Q A;  3OV8 A;  2CSO A;  2XSD C;  4HSR A;  4ON0 A;  2EWN A;  3F9K A;  4YIR X;  4XN0 A;  2DFI A;  2LG4 A;  5HLI A;  1WI3 A;  4V2G A;  5KHD A;  2LP0 A;  4E7K A;  3OOU A;  1O3R A;  2ELH A;  4HAM A;  3IV5 A;  2HI3 A;  1JE8 A;  4XLN F;  1WJC A;  1F1Z A;  1BIA A;  3FWE A;  5FRO A;  2LF7 A;  1XDS A;  4PCQ A;  3FIS A;  3TED A;  1H9T A;  3GX4 X;  2EQR A;  3ZMU A;  1YYV A;  2Y69 H;  1P6R A;  2LF8 A;  1SEU A;  4IRI A;  4BJT A; 
#chains in the Genus database with same CATH homology
 1Y0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...