1Y0NA

Structure of protein of unknown function pa3463 from pseudomonas aeruginosa pao1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
71
Chain Sequence
GHMLIPHDLLEADTLNNLLEDFVTRETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical protein PA3463 from Pseudomonas aeruginosa strain PAO1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0270 protein PA3463
total genus 21
structure length 71
sequence length 78
ec nomenclature
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06794 UPF0270 Uncharacterised protein family (UPF0270)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.610 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A YehU-like 1y0nA00
1Y0NA
chains in the Genus database with same CATH superfamily
1R00A 2M8EA 5EZGA 1EF4A 3IL2A 4HX7A 3EETA 4KFCA 2NVTJ 2GAUA 3ROUA 2XAQA 3SXYA 2AHQA 3CF2A 4M9XA 2HDWA 2HR3A 3OYNA 1VFCA 2GXAA 4Q5SF 4HF1A 4A0ZA 2NVQJ 1B6AA 1IV6A 1B9MA 2ECCA 2XGDA 3KX2A 2O9LA 3K2ZA 4EM2A 3K0LA 3WE2A 2L7ZA 4E7KA 3PO2J 2GOXB 1O7FA 3ZN0A 1G6NA 4XR6A 4CYDA 4E7LA 1MBHA 1VQNI 4MQVA 1JHHA 1UMQA 4BACA 1IN4A 1SVOA 3MKLA 5FRMA 3TQNA 2W85A 2QZ8A 4M3FA 1XMKA 4KITB 1ULYA 2MH2A 2ICWG 4Y17A 1IAWA 1ETYA 1MJ9A 3IH2A 5IYCJ 3I55I 1FC3A 2DT6A 4EMSA 2EJRA 1ZTRA 3HOUJ 1W36D 4AIHA 4IHVA 3HPHA 3FMSA 2QVOA 5M5WJ 3I53A 3CO6C 1X1PA 3K2AA 2VXZA 2XRNA 3MD2A 1YRNB 4BBRJ 1HXDA 1BR1A 2HU9A 4BJTA 2JA2A 2AXTC 3JRGA 3OIOA 4C2MJ 3GTOJ 1BN5A 2ZXJA 2OAZA 2YUSA 3F6VA 3L1PA 2EV5A 4EJOA 2B0LA 2ZKZA 1IXRC 4EM0B 3ZMUA 3Q9VA 4F55A 1Z6RA 3DPLC 1Y1VJ 3QP5A 5E3LA 2JN6A 4ITVA 5EZHA 1LDDA 1IW7F 3CQZJ 1J0RA 1X3WB 5K7ZA 4D1QA 1SFXA 1WJDA 2NVXJ 5KCMA 3WU0A 2JMWA 2F4OB 1QZZA 3PQJA 1TQPA 1HDPA 1PVEA 3BTCA 5F08A 2RV8A 1Y0UA 2JVHA 3S2DJ 3ZXSA 3FZVA 1MMDA 1D8KA 2DTZA 2W82A 3AG2H 1Y6IA 4PFOA 2OU2A 5DV5A 4IRGA 1ZG5A 3WTSC 1IN8A 2P81A 4G7OF 1WH7A 1W5TA 5E1ZB 1YYVA 1XSDA 2XAJA 3LSKA 4IEJA 2NNYA 3DTIA 4DJAA 1W36C 1FYMA 1ODDA 2BHYA 1YW7A 2IVMA 2ZO4A 3T1BA 2IS2A 3KETA 3SJMA 1HC8A 2DQLA 3HKZN 3KP7A 2RNJA 2VQHA 2CQQA 1MNEA 3MZYA 4BQOA 1H0MA 2DA2A 1O57A 2LH9A 2Y0MA 3IKVA 2UV1A 1WHUA 2NOJB 4MFEA 1HOMA 4NUBA 4Y7NJ 3B02A 1BW6A 3A01A 4P9UA 3DEUA 4L5EA 1ETVA 1O7LA 1WFXA 2Y9ZA 3ERMA 3RPUD 4ASNA 4ABZA 4G94A 1YJWI 1MJAA 3H5NA 3OS2A 3I59B 1JJ8C 1ON1A 2FNAA 4D7NA 4OMYA 4BQQA 4QIWN 1EH6A 1IC8A 1G2HA 2LMDA 2L01A 3K4MA 2UWMA 4MQ9F 4F92B 3TO9A 4PCQA 2QM3A 2R7UA 3HRMA 5HVQC 3EUHA 4YIIA 5HLHA 5FO5A 4RLFA 3DTKA 1ZG3A 4CH7A 3RKWA 3HIFA 1ZRFA 2VJ4A 2PJRB 2DPUA 1NK2P 4BS9A 2VC0A 2F5EA 3SZTA 4O6JA 2MGQA 4AUXA 1J2XA 4EGZA 4I09A 1GV5A 3OOUA 3ZR8X 1K7AA 2VOOA 1W1WE 4X1EA 2XAHA 2XV4S 3S2HJ 2CW7A 4LG0B 1JT6A 5TRDA 5B5EC 4DQ2A 1WH5A 3VEPA 2LF7A 3CDLA 4G7ZF 1BR2A 5JVTA 4FCYA 1D5VA 4C2UA 3L7WA 3KZZA 2ZJPF 2CU7A 4LK1F 2NS7A 1FPQA 3ZMTA 1D5YA 3W2AA 2R7ZJ 3ZOBA 4X6AJ 1BC8C 3RKYA 3OR1C 4LIUA 2QWWA 1WJAA 2IW5A 1A04A 1DPUA 4RAYA 4E7JA 4PJLA 2KIMA 4ESBA 2ELJA 1J7KA 2JSCA 2EZIA 1UB9A 5F0FA 4GYIA 4J19A 1FEXA 1ACIA 4KJZA 1UG2A 3FXUA 1RUNA 3ABMH 4XLAA 1I27A 2EH3A 2NAZA 4OAYA 4PSWA 4RM2A 1BR4A 1AWCA 3PO3J 1VQ8I 1TWGJ 3S17J 2RGVA 3IP4B 2DA7A 3H3ZA 2CG4A 3BR6A 3PIOF 4E7IA 3OYHA 5IOYA 3C7JA 5EJCA 2V1NA 1VQ5I 2KISA 3RSNA 4O5VA 2M0CA 5TISC 2BHZA 2CWEA 2E1NA 2JVGA 4GCVA 5JLXA 4ZTJA 1U3EM 2C6YA 3MZHA 4L0ZB 1HDDC 3K4JA 3B73A 1NHAA 1ZGAA 3R4KA 5LD2C 3OR2C 2VQCA 1C0WA 3BLYA 3DKXA 1AA7A 1KZHA 3RIRA 1FSHA 1YG2A 3K70C 2QUFA 4AC0A 2EPFA 1XX5A 3K9TA 2W4SA 3O2PE 2NS8A 3F8FA 3T5XA 3VYUB 1LE8A 2DMNA 4QPOA 3DLAA 2IS6A 1OYYA 2WY8Q 3K6GA 4G7HF 1SD5A 1TW3A 4B1RA 1TWHJ 4UVBA 3JRCA 3DFGA 2WADA 4D5FA 2E71A 2R7WA 4B8XA 2WAFA 1K79A 3W6JB 2M5WA 3HGGA 1P4AA 3IKTA 5E17F 1JUPA 1RKTA 4KIBA 3CJRB 2E2JJ 1FSEA 4ZYAA 4F91B 3BWGA 3K1NA 4QPQA 4LFUA 4XIDA 4M9ZA 3RPQA 2K9NA 3GW2A 3I9V2 3CC2I 3AG4H 3DU5A 4A3IJ 5LLQA 2MD0A 4YRVA 1H89C 3RCOA 5D5UB 4KN4X 1FBSA 2K9SA 3WU2C 3ISPA 3J7YJ 5BNGA 4OU0A 3BG9A 4M9SA 4OIOF 2EV0A 1PUFA 4D7MA 2CMPA 2M30A 3E6BA 3JRDA 1OCOH 3CCMI 2XRLA 1VQ7I 4XN3A 2HYFA 4M72A 2MC3A 2QSGX 2CS3A 3QU6A 2HXIA 2PMZA 3FBIB 1R36A 2VPRA 2VC1A 5ED4A 2DT7B 4PZJA 4DBQA 1BA5A 4R79A 4A3DJ 1LDKB 4YFNF 2KIUA 3CMYA 2Y31A 2HVRA 1YTYA 4IHSA 2NYXA 3WE3A 2GWRA 5DM6F 2CH0A 3HTSB 2VONA 3CTAA 5HLIA 5CJ9A 3F8BA 5FB2A 5L3EA 2O8XA 2LD5A 3E1SA 2O0YA 2DA4A 2M7AA 1I1GA 2XPWA 3DBLB 5GAEJ 3GUDA 2RAEA 3U21A 4MEYF 3DBRB 4S05A 3P5JA 3LSRA 4FASD 2Z3YA 4C2TA 1HSJA 2F2EA 4CYCA 2VKVA 3MWMA 4RGXA 1A5JA 1Y39A 1YITI 1XSXA 1QBJA 1Y56A 2LRDA 1OCZH 2CFXA 1J59A 2ACJA 3H92A 2E5NA 3PNYA 2X9DA 3H5AA 3LSPA 1G3SA 3IWZA 3WTYC 3IV5A 1WJFA 1P92A 3QPHA 4HDVA 1PUFB 2O7OA 4YG2F 3VODA 4CICA 1ZAOA 4BQNA 1O3RA 1T0FA 1USSA 2MABA 2E7XA 3G1LA 5J1YA 2A3SA 2FD5A 1ZK8A 3D5SC 1Y8QB 4C3IJ 4DYRA 2E36A 4PSXA 2RQQA 2OV7A 3LSMA 5ERIA 1JGSA 2ESHA 2DU9A 5EDNA 1AKHB 2R92J 2KQRA 1W7PB 4MTEA 5L3CA 1O4XA 4ESFA 2EFOA 2EZKA 4B4CA 3CJQB 4IPAA 3IRRA 2FOKA 2IGKA 3J81K 2D1VA 4C30A 3CMMA 3OYDA 3BPVA 1UJ8A 2F5CA 2FEZA 3ABUA 4XICA 2ZMEC 3JRAA 1S6LA 4BE2A 1A35A 5LGTA 4BXUA 1Q1HA 3M8FA 2CV2A 2WTEA 3BJ6A 2K86A 4BJ5C 5E8IA 3CF5F 2IA1A 1L3LA 3CCRI 2J5OA 3ABTA 4I02A 2DCEA 5D5XB 2IEKA 3KLOA 3OWTA 2OZ6A 2Y75A 3FWEA 1SVMA 3FXQA 1S72I 3A1YA 2DYRH 4XKVA 5E1WA 3EUKL 2LKPA 1U9OA 2ME0A 4A3BJ 3GFJA 3FM5A 2OA4A 4UUSB 4FQGA 1MKMA 2JRMA 3ECOA 3WHCA 2Y48A 5DCFA 3GTJJ 4PJJA 3QYFA 4MTDA 2MSYA 2R5ZB 1U5TA 3S3MA 5FKLA 4A3CJ 4XOTA 5AONA 1VQ9I 1N25A 3OOPA 2VE9A 4I0AA 2QKLB 1MH3A 4JBAA 2XHKA 2JA6J 1V4RA 2HVQA 1R22A 3BTJA 3E97A 3RPUA 4UY8I 2EBIA 1TNSA 3S16J 4XL9A 3FK6A 3F23A 4BE1A 1TLHB 1P6RA 2KFDA 2VN2A 3L2QA 3DWLE 2O6GE 3LA7A 3BC8A 4HX8A 1B9NA 3BJOA 3LAJA 3ZQFA 2LG4A 5FJ8J 3ZQGA 3EYIA 3V8KA 3IC7A 2EWNA 1J5YA 2IS1A 1H9GA 3K4NA 2HYGD 3HSRA 2R5ZA 3HOTA 2D2WA 1XGOA 1YO5C 1QU3A 2ZFWA 2JK3A 3FKIJ 2PJPA 4UUSA 4YFXF 4PJNA 5F0CA 3Q5FA 1ZN2A 4DZPA 3COAC 1R4NB 3MCZA 3MKWB 2LR8A 5M3MJ 5HLGA 4XNFA 4FX0A 3BR3A 2M8GX 5GADJ 2OCCH 1IF1A 1JUSA 3I59A 3HOZJ 4PGHA 2ETHA 3R6SA 1UCRA 3HKZA 1RKWA 1HW2A 2E2IJ 2VODA 3E5QA 4NNJA 1V55H 1YIJI 4O3MA 2QSHX 3H36A 3BG6A 2V79A 3CESA 4HDUA 2EFNA 3A01B 1X58A 3IAS2 2DN0A 1NH3A 1E3OC 3KZIC 3TKYA 2V9KA 4RS8A 3NWTA 5J3LA 2E19A 2CQNA 5BPIA 2XAUA 3KP4A 4RGRA 4BGDA 3OYFA 2DDAA 2KIQA 2CV0A 2B7EA 4IL6C 4OINF 3SQNA 2X48A 4IF4A 4CXFA 4BAYA 3NARA 4U7DA 1OCRH 2M3AA 2PFBA 2RKHA 4P5OA 3WGHA 3H5RA 2K4BA 3P9CA 1X1CA 2ELKA 2I10A 2W1OA 3Q0UA 4XRSA 2FMYA 2QQBA 3BG5A 2VIXA 4ZYGA 5E8GA 1E3HA 2VJJA 1G3TA 3V8LA 2XB0X 3OYAA 4EGYA 2HEOA 3MFKA 1EA3A 5E20A 3L2UA 1XGMA 2VE8A 3LSHA 4JQFA 2GIZA 3ASNH 2FE3A 4ZYDA 2AXLA 2DXIA 3QQAA 1LFBA 4YEJA 4AIDA 1EKEA 4GRIA 2NOGA 2K7LA 3ZP5A 1R1VA 3QYBA 1G8XA 2IGNA 3VSKA 4JX6A 4F7ZA 3BPXA 4L0YB 2CUEA 5ICGA 1W0UA 1JKRC 3K70D 4ENMA 5IP6A 1T08B 3WTTC 2XKOA 3H3UA 1IN7A 1DP7P 1GVDA 4IQJA 2EINH 2IXSA 2ZSIB 3CUQB 2HI3A 5CKTA 4EJUA 2ZXWH 3A0BC 4L9NA 4OWRB 1S29A 5DTDA 3TO6A 1EH7A 3TOAA 5F1JA 1USTA 5FLXK 4FETA 3JRFA 1XSVA 2LDUA 4I76A 2Z16A 1MMGA 4Q4ZF 2OF7A 1Y1WJ 4ZC3A 2QQAA 1IGNA 3HTUA 4Y13A 3CLOA 3ZMZA 3CO7C 4RGSA 1SD7A 5HDKA 5JLWA 3OS0A 3LFUA 5L3FA 1TW2A 3RZDJ 2KL4A 5J1UA 2JTVA 2LF8A 3MEXA 3S32A 2KT0A 3HRUA 3S3OA 3M4OJ 4Q48A 2ECBA 2LSOA 2ZBKA 2QEXI 2VOPA 4IHWA 3RYPA 1YE9A 3FIWA 3VYTB 2E2HJ 1WZ2A 1IRFA 3GTLJ 2V1XA 1OFCX 3BQZA 4A69C 1R1UA 4BEHB 3HHHA 3G1MA 3U9GA 1J09A 4FISA 2XF7A 2K40A 3V42A 2CUJA 4WXHA 5J8CA 1RUOA 4R1HA 1J9IA 2DO7A 4FE4A 3ZGKA 4EEFG 2Q0OA 5L3DA 2MH9A 2V26A 4IOCF 1UFMA 2L7FP 2CSOA 1IJWC 3NRVA 1I50J 3TGNA 1FLIA 2WC2A 2WY7Q 1N78A 2KRHA 3VYRB 1F5TA 3M3YJ 2A68F 3V7SA 5IP9J 2EA4A 5F64A 4HBLA 1SMTA 1FWZA 1BI2A 3G6EI 3S93A 1S5LC 2E60A 4RAFA 2DW4A 4L5JA 2ZJRF 4J00A 4E7SA 4IRHA 4D0PA 5ICCA 5DCMB 1TT0A 3QP6A 2QA4I 3K10A 3ULQB 2W24A 5DD4A 2CUFA 2OPTA 1X3UA 2W25A 4IQ4A 3PIPF 2TCTA 3F72A 3M07A 4GO1A 4KMUX 3AG3H 4PJMA 3PUFA 1OYWA 3G2BA 2M87A 3ZMVA 4UUTA 5DUKA 3DQVC 3K69A 5CQEA 1OCPA 1H8AC 1F43A 4XSXF 3QRFF 4LB6B 2L5QA 1Z9CA 4V2FA 2JWTA 2PQ8A 4XLHA 2HOEA 1QZEA 3DEEA 5CQGA 3VB2A 2L54A 2H1LA 4KT5C 3QPTA 4AVPA 2DK8A 5B66C 4CCNA 3BT9A 1IUYA 3W6KB 5JR3A 2HYJA 4LD5A 1T8IA 2BZTA 3REOA 2XSDC 4H0EA 2VBZA 3GTGJ 4XLCA 2M34A 5M3FJ 3FMRA 5FFXA 4XLNF 4AYBA 2COBA 5DD8A 1IV8A 1HKTA 3BZ6A 2PMUA 1LEBA 1P2FA 4KUMA 5D6FA 4HNVA 3OYBA 1Z0XA 4IO9F 4EJTA 4I01A 1HLVA 4A3KJ 2GIVA 2VBYA 4BUPA 2KHMA 4RLQA 2Q1ZB 2X85A 2BE5F 1XS9A 3GEZA 4XKCA 1F1ZA 3MZ8A 1K78B 1Z91A 2XGCA 3HPGA 2UZKA 2RQPA 2DQRA 2UUZA 3GX4X 1X19A 3HOYJ 1XGSA 5H6RA 2X6WA 3E5UA 1LKXA 4HLXA 5F1RA 2Y9YA 2R7DA 3H35A 4BJ6C 3J7AO 1Z3XA 3CJNA 3ESWB 1DUXC 1GXQA 1N77A 1JKQC 1HF0A 1WRJA 3SEQA 1QPMA 5FLVA 2WAQN 3KLNA 2W48A 1QZYA 4JP0A 2CV1A 1JT0A 3GO5A 4HAMA 1FOWA 4KN7X 3JSPA 4ZJZA 2BBYA 2CQ7A 2QCOA 2RREA 5IPAA 1RESA 3I0TA 1P7IA 3H0DA 2M7BA 4XRSG 5CVVA 3GMEA 3O6BB 3LMMA 5J40A 2HQ5A 1S7OA 3OL3A 3WG9A 1QVTA 4V2GA 4AD9A 3TMOA 3OYGA 3F8CA 4P9FA 3BZCA 2ESNA 2VKEA 2JA7J 1FJLA 3FXLA 4HQMA 4LOCA 4XBFA 3UR3C 2FU4A 4KDPA 2LY9A 5J6XA 1PDNC 3BG3A 2IGOA 3CDHA 1T39A 4DGWB 1S3JA 1X2MA 4AVZA 4DBRA 3U1DA 1WCMJ 1D0XA 5K7HA 3J7AY 2V9PA 4BL0B 5GPCA 1B59A 5D8LB 1WWXA 3CJTB 4OOIA 1YX3A 1X1AA 1VF9A 2EK5A 3KE2A 2X0LA 1ETKA 2KRCA 3AFHA 1OQYA 1RI7A 2KPMA 3BROA 3MVPA 1OCCH 1YJNI 4LMYA 3K7AJ 1MH4A 2QBYB 2JRTA 2L9VA 2X6OA 4QSHA 5C44J 4RB0A 3HSEA 1Y0NA 5E18F 1IXCA 2LC2A 1FTZA 5EF6A 2MLGA 1MIJA 1WJBA 4DIQA 2BY3A 2KDOA 1TTYA 2AS5F 2XUBA 2W84A 5DYMA 2OTLI 1ORKA 2OUMA 4D9JA 4HV5A 4HEA2 1FIAA 2COMA 2K3PA 3JAMZ 1SFEA 3MMYB 5H2FC 3F22A 1JUMA 2NVYJ 4A0YA 2K5CA 2XASA 3B6CA 4XMYA 2W57A 3PFIA 2ISYA 3CC4I 2ID6A 4KIGA 5LBQA 3FDYA 1U9NA 5H20A 4HV6A 1BOBA 4B48A 1CGPA 1OJLA 4BH9A 3LOCA 3TL4X 2X6YA 1V5GA 3PFYA 5F0HA 3BP8A 1GV2A 1YW9A 2A61A 4PUSA 2BOLA 4UHTA 4W1UA 5FKOA 5J1RA 2EIMH 4AIKA 1QA6A 2HOSA 3NWSA 2PI0A 4LK0F 1T2KA 4IHXA 3F9KA 3BCBA 2P4WA 1W5CC 2EILH 9ANTA 2QENA 1GVJA 2WBMA 1W4MA 2FX0A 3R61A 3Q9SA 1LQ1A 2FJ1A 5TJJA 2B63J 2WV0A 2IS4A 2NNNA 3Q0WA 3U1KA 4HPQA 1FT9A 2N8GA 3GZ5A 1D0YA 1QNTA 3K4LA 3L00A 4UVAA 1R5HA 3ABLH 5B1AH 1F9NA 4CCOA 3GFIA 4HLYA 1XCBA 3CCQI 1ENHA 2PBIA 3HJEA 1XTAA 2P6SA 2XVCA 4L5IA 2D45A 3F8MA 1KGSA 2Z33A 3S14J 4C3JJ 3KYLA 2F5FA 3ZMDA 4CA0A 1KU3A 4F52A 2P7VB 3FBNB 2HOAA 2LBFA 3ERED 5DDGA 1G59A 4JYKA 3KYDB 1FYLA 4BQAA 2DODA 3A02A 3CUQC 2K9QA 2WA0A 1LNWA 3SZGA 3SEZA 2MYSA 2ZJQF 5J4YA 2AO9A 1OR7C 3A4CA 4D5CA 3P9KA 1SC7A 4P55A 1HW1A 1KU7A 3D5RC 2RNGA 4EQQA 2CJJA 1V3FA 3HSFA 3WHBA 5ILUA 2E35A 1PUEE 2VLAA 2QYOA 3IH4A 4ANJA 3S2WA 4GDFA 2RVCA 4HW0A 3WU1B 2BW3A 2PG4A 2ELHA 4IHYA 4LLLA 1PP8F 2LREA 3GZ6A 1MJBA 2DBBA 3JSOA 4A6EA 1TT5B 4AM3A 2G0EA 5FKMA 1ZLKA 1O3SA 3CCSI 5JHUA 1VZ0A 3HDDA 3OIPA 5KAFC 1LB2A 2JZYA 2VXDA 3ELKA 4CZZA 3KP3A 3T0YA 1Z67A 2DJNA 1VQLI 2X51A 1I6HJ 3FXRA 3DLLF 4N9IA 4LLNA 4BXXJ 1YS6A 2LFBA 1LFUP 1IDYA 3IH3A 3IRQA 1IUFA 2F5DA 1XD7A 3AL0B 1MZBA 2R7FA 3DPTA 4YIRX 1PJRA 3CP2A 1MD0A 4HNUA 1X1BA 4XRFA 4ENNA 2OJED 5ILSA 4FE7A 1CF7B 5F27A 1MBGA 2HKOA 5E3OA 1FYKA 1ETWA 4ZDOA 4X0GA 2D5VA 3IAM2 3QU3A 1WVRA 4W97A 5H6QA 2X6XA 1K6YA 2FQ3A 4KT6A 1Z1DA 3WTXC 4ZTFA 5HOOA 3KIOA 4V19K 3S1QJ 2VQLA 4I6ZA 3CMAI 2Z5UA 1B1BA 3HOXJ 2L2OA 5EGOA 4E70A 3WTWC 4BY7J 3JW4A 3PSIA 4H4KC 4HF0A 5GTHC 2RC4A 2DPDA 2O8KA 1DU0A 5IT9K 2PJRA 1XDUA 2KP6A 3JAMK 1JI8A 1U5TB 4IVNA 2X1EA 1TNTA 3BR5A 4QTRA 1ZR4A 2JUCA 2BGCA 2VASA 1W0TA 1O3QA 4RAGA 5C3EJ 2DMTA 1W7PD 2VBXA 3V7CA 3CCLI 3ZQQA 2KMUA 4U0VA 3CDIA 4DZJA 2QKMB 1EH8A 1TL8A 2DFHA 3WGIA 2MA3A 2O5RA 3OS1A 4M3GA 4BYYA 3I4MJ 3L2RA 3LSGA 5AIQA 1FMWA 2PN6A 1WSUA 4CO8A 3FISA 1ETXA 2QF7A 2OC6A 1E2XA 2ADUA 1R6RA 3DV8A 2MLKA 3KFWX 4GFBA 5J47A 4WF2A 3QOPA 4BEHA 3ZCOA 4RB2C 5DEQA 4KISA 1IRGA 2ZC2A 4B44A 2DI3A 3Q3SA 2V4JC 3FHNA 2D1HA 1DDNA 3KEOA 1S8NA 3I5UA 4FX4A 3G3ZA 4XKWA 2BY0A 3J7ZI 5BMZA 2LY1A 3PNTA 1T56A 1XMAA 1P9QC 1LFPA 4RAZA 3DCFA 2R7XA 4M73A 1TP4A 1WJCA 3OMYA 4JX5A 5D5WB 4QWQA 4WX9A 3M7GA 3OYKA 1PYVA 1UHWA 2LBFB 3ML6A 3OYLA 3VOEA 4NBQA 2P7CB 1MBFA 4PDKA 1T33A 1V5EA 2M2EA 4A3GJ 2NVUB 2F5VA 3VPRA 1DU6A 2K3FA 4LITA 3BQYA 4N4OB 5HNHA 5LHIA 1EV7A 3E7LA 4OIQF 5HS9A 4WK8F 5TGTA 4UUVA 2VUMJ 2TRTA 3SFIA 2KKOA 2FMLA 1BIAA 4F93B 4L18B 2WAEA 1SVLA 3QAHA 4BKXA 4NB5A 3CP8A 4G6DA 3RKXA 4P96A 1H88C 4HF2A 3HEFA 1FP2A 1P7JA 3M1EA 2XKPA 3DKWA 1JXSA 5D8KB 3BDDA 4A3EJ 1LVAA 4XK4A 2XB5A 1D1BA 2P6TA 2HZTA 2ZCWA 1VQ4I 1I39A 2QQ8A 2M0MA 1QPIA 4A0XA 1OR7A 3DPUA 4B3AA 4NC7A 5IY5H 1Z21A 2E5ZA 4CYCB 1JTXA 3GF2A 4K2EA 2IJLA 2E1MC 3AG1H 4ZYEA 4E4HA 1F36A 2VJIA 2KZGA 1PP7U 3LA2A 3HG9A 2ID3A 2H27A 2OQGA 2JPCA 5GAHJ 2HTJA 2A6TA 3MN2A 1QRYA 1AKHA 5D5VB 1YRNA 4KIFA 3VDXA 1R5ID 2L9SA 2KJBA 3C2GA 2CYYA 2DMPA 3BOQA 2GQQA 2V1UA 5M5YJ 3EPZA 1SFKA 1FOXA 5K7FA 2L02A 2P0WA 4M6VA 3TP0A 5DUIA 1REPC 3CUQA 3C2BA 1ETQA 4XKBA 1ON2A 3PUBA 1U5TC 3WODF 2YR2A 3E0JB 3FKJA 2H6CA 2J5PA 1YJ9I 4OMZA 3GTKJ 5KVRA 1K4TA 1T0FC 2EIJH 2O03A 3N05A 4WCGA 4I2OA 5E79C 4IOAF 1T6SA 4UV9A 3RQ4A 3LA3A 1MDMB 1MSFC 1P4XA 1JKPC 1MNDA 4U87A 1ZHFA 4G8XA 1O3TA 3ZMSA 2MG4A 2ZXHA 3TEDA 3BCAA 2DYSH 2DDBA 1GHCA 3DU6A 5F04A 3W3CA 3QYEA 1SMYF 1WI3A 3IUOA 2BYVE 1K83J 1MMSA 5FLXZ 1ZG1A 3D5LA 5LEJA 2P5LC 4P1WA 5LRRA 1HQCA 3ZQ7A 3LWFA 2FQ4A 5FRNA 2Y0SA 1NK3P 3FXKA 3X2QH 1K4SA 4NHJA 3GCMA 2G9WA 1QHGA 2BY2A 3C18A 2UXXA 4HX4A 2LNBA 3HUGA 3BTLA 1I6XA 2XAFA 3GTMJ 4XRMA 1R58A 3ZPLA 3HL2A 2VKDA 2VT3A 2FBHA 5K5RA 3LNQA 4G12A 1HW5A 2KRFA 2V9VA 1SAXA 3CC7I 2DFFA 3M9AA 4BHCA 1AHDP 4N4NB 4I98B 3GTQJ 1SANA 2FSWA 1TBXA 2H8RA 2AQEA 2LP0A 5D4SA 1LUJB 2PX9A 2HDDA 4RMNA 4FHTA 3HRSA 2HXOA 2IBDA 4CUGA 4DNCA 3GZNB 3V7RA 1B72A 1EJ9A 1YS7A 3MQ0A 2Q2EB 3I54A 1G3YA 5HS8A 5BQTA 1ITYA 1HBXG 5K1YA 3CCEI 3CCUI 3HYIA 4CHUA 2VKHA 1ONVA 1NTCA 4Q47A 2GXGA 4XQFA 2HQNA 2VI6A 3I56I 3HOWJ 5ICEA 4GGGA 1D8JA 2K27A 1I3QJ 2L4MA 4BXFA 3WG7H 2NS0A 4BY1J 5LGUA 4YIFA 3BG7A 1U2WA 2DK5A 5CVJA 1ERDA 3KP5A 2OBPA 4MNUA 3BZKA 1B8IA 2XROA 4CSWA 1BM9A 2P8TA 1X2NA 3RI4A 1N75A 3TW6A 3VFZA 5HNFA 2HNHA 1X4OA 1WI9A 5GTIC 5EEAA 3I58A 4DYQA 4DOZA 2H94A 3KYCB 1SFUA 1KONA 5LFAA 1FX7A 1TC3C 2FNPA 2ZB9A 3A2KA 2VPLA 2VBWA 4CCLA 3EQLF 1ETOA 1F4KA 1S7EA 1T98A 1Z6TA 2EIKH 2G7UA 3K1MA 1RRJA 5M5XJ 4ZDPA 5JI6A 1K61A 2YSRA 2OQRA 1KYWA 2QQ9A 4MFDA 3CMEI 1YHQI 1W5SA 4BHPA 4NQWB 2R4GA 3UKGA 4WXCA 3G1OA 5IT3A 2ZXIA 2YPRA 2Z2SB 1MMNA 2HTSA 3FM3A 1DQUA 3H1CA 3EUAA 1WPKA 1DGWY 4EV0A 4HOBA 5DM7F 1P4WA 2EFQA 4IRIA 3JR9A 3HRTA 1A6IA 2V6EA 1R1TA 3OSFA 4II2A 2BXYA 3SDGA 1FOKA 2R7QA 3S8PA 2KDZA 3PSFA 2WB1A 4AIJA 2EZLA 3ZQLA 2Q2EA 2A6HF 5B3SH 5LGNA 3I4NJ 4OAZA 5D6EA 1FMVA 2DLLA 4GYGA 3WTZA 2DOFA 2HOTA 2FBIA 3KPHA 4ZH4F 1UHMA 1RNLA 3O8GA 3BJAA 2KLOA 5FD6A 2P5VA 3E6MA 3OL4A 1E17A 2R5YB 2OCEA 4XLPF 2R7TA 5FGMA 3D1NI 3F6OA 3ZQHA 2YU3A 4S0HB 2G7HA 2HQAA 1GLNA 2TDXA 1YLFA 2BXZA 3GVAA 3NQOA 4XORA 5B1BH 3E6CC 1JGGA 1STZA 4BNCA 3E6DA 2PMHA 2ZSHB 4CCJA 3CD6I 2R3SA 3V8JA 3KEQA 3H0GJ 1MBJA 2K02A 4II3A 2X1DA 3GWZA 3GLLA 2KIFA 4BHBA 2R7OA 5DCMA 2IRFG 2LVSA 1HSTA 3KCCA 5F6FA 1VQ6I 1QHHD 3HUGB 3HHGA 1BI0A 1YIOA 2HFHA 3ECHA 4LIVA 2XDVA 2CFOA 3JCUC 1OPCA 4EJVA 1K6OA 4J01A 1BJZA 4DW6A 2O3FA 5LRSA 3OSGA 2CQKA 2X4HA 3P7NA 1VQPI 2LLKA 3RQIA 3C1DA 3L2WA 3VSLA 2IT0A 2E1OA 2MBFA 3SDBA 2OTJI 1HA8A 1ZR2A 3NEUA 1AOYA 3H9GA 3FXJA 1KQ9A 1XG1A 2HPIA 3VWBA 2DJIA 3M8EA 2XPUA 1FOYA 2FF4A 3DKYA 4I7HA 2HPMA 1I5ZA 1RIOH 1B72B 1NG7A 3AL0C 1YX5A 3B6AA 4E7ZA 2WAQA 3CCJI 1IZ1A 2L9RA 2K4JA 2EFPA 1YFHA 4E6KG 3RZOJ 3FF5A 1IXSB 4PGGA 2XF5A 1VI0A 2GA1A 2MFZA 3CCVI 5KNLA 2NXNB 1FBUA 2A5WA 2BY1A 4A3MJ 2GLOA 2WV1A 3DXJF 4LB5A 2JA8J 3CLQA 4ETSA 3GLXA 5D4RA 1BC7C 1IN5A 3ABKH 2HWVA 4RBOA 3PJRA 3S1NJ 1UAAA 2YX7A 5HODA 3G4SI 5CYVA 2Q8KA 1S7AA 1JKOC 3PM1A 2F48A 1YOVB 3ZRGA 3ZQIA 4RB3C 3HOVJ 3F21A 4XN0A 3TO7A 3OYMA 1Q1VA 3H3VK 3RJPA 1BBYA 2JT1A 3M8JA 4A12A 1A36A 1ZRCA 1D0ZA 4N0BA 4WXDA 4A3LJ 2DFEA 5HDNA 4AWXB 1R7JA 3LSJA 2LOOA 2IPQX 3OY9A 2UXNA 1J75A 2VB6A 2LK2A 1LJ9A 2M45A 2RDPA 4G6TB 3N97A 4UNOA 3FK7A 3EUHC 1L0OC 2MW8A 5E3NA 2E34A 2M4KA 4MHGA 1RETA 4QLCU 4YELA 2LKSA 4C9YA 2Z1DA 4MEXF 3FX3A 1H9TA 5C4JJ 3HBLA 2ZMEA 2CW8A 1R4MB 3F3XA 4HZFA 5EEHA 1ZLJA 1GT0C 3O8HA 2M9HA 5GP9A 4KNYA 2JUGA 3HC7A 2AQFA 1VNDA 3GTPJ 4B3XA 1E0EA 3TP3A 1LEAA 2I5UA 2R0QC 4CCKA 2XF6A 1U8BA 2DA1A 1I3AA 5BOXA 3AKZA 4M74A 3E3VA 5JVGF 3EYYA 1UELB 4ZZDA 3R0JA 4KICA 1M1EB 3QPSA 4DYCA 3QOEA 3EDPA 4CDGA 4ENKA 3ZQCA 3O3KA 3JRBA 1SAUA 1JTYA 3S3NA 3U2RA 3KEYA 1LE8B 2IP2A 4A3JJ 1ZQ3P 1QQIA 3QWLA 5IOZA 2BVLA 1Z3YA 1ZH5A 2F6CA 2X1CA 2QGUA 4BBSJ 3K1PA 2E1CA 1RPWA 4NC6A 2L3DA 1SD4A 2Y2ZA 4F3QA 2STWA 3BY6A 4ZZLA 2DOEA 1U78A 5ILVA 2VT2A 4L9VA 1GXPA 2DA5A 6PAXA 2A69F 5CVRA 5EEGA 1XN7A 3L2CA 1G4DA 2EV6A 2W00A 4LG0A 1WJ5A 4A6DA 2ZFUA 3FMQA 4A2UA 4CGZA 2EFWA 5FFZA 1BW5A 3OIQA 3DTEA 4I99C 3HOSA 2W7NA 2H1KA 4UV8A 3FHZA 2STTA 3J81Z 4ESJA 4IJAA 5KAIC 3ONQA 2EB7A 2HZDA 1A31A 1HKQA 2DFIA 2ZJ2A 1D1CA 1IRZA 1XDSA 4IKFA 3TBIA 3I71A 3W2WA 4EM1A 5GAGJ 1X1DA 4M71A 1YW8A 1U8RA 4LGWA 3AAFA 1IO2A 2YX4A 2DTRA 3RKQA 1RR8C 2ME6A 1BI1A 1CQTA 3BR2A 3IWFA 5IYDJ 2Y30A 2H09A 4G6QA 4AU7A 4WWCA 2CRGA 3BTIA 4HYEA 1ZRDA 2V7FA 4C3HJ 2PMZN 1UG0A 1U6GA 2XGEA 3WTUC 5EGOB 1VTNC 4KYWA 2H6BA 1MNMC 1A6QA 3MAJA 1ZARA 4NDLA 1IG7A 3I3LA 3R0AA 5LEKA 3IHUA 1QO0D 5LHHA 2HKXA 4Y3OA 3L09A 2XPVA 3QODA 2F4IA 2JPBA 3F8NA 4A5NA 4A5MA 5L3BA 1CF7A 2VQGA 4MGRA 4Y33A 5L3GA 5AIPA 3GFMA 2FUG2 4FTHA 1UZCA 2HDCA 4NC8A 2GZWA 3LL7A 2K9MA 5BS6A 1MSEC 1E3PA 1BJAA 2HS5A 4IHTA 2A05A 2H8WA 1Z77A 3GFLA 3VYSB 1GUUA 4M3DA 4OIPF 1W7PA 5IT9Z 3W6VA 4N9HA 2XGXA 2GXBA 2HGCA 1SEUA 4Z2YA 3PL8A 1TWAJ 1XCVA 2DT5A 3OYIA 4HSRA 5DS9A 5FLMJ 1D1AA 1KYZA 2M4GA 1MDMA 2BV6A 4BDZA 2F4MB 2R93J 4S04A 4AYBN 3UNGC 2P5KA 4BE0A 1RZ4A 2DA6A 3JTGA 2R7RA 4XOPA 2A07F 2VL8A 4EATA 3K4CA 4PFPA 4HG2A 4IX7A 4RM3A 3C3WA 5E1XA 2BW3B 3OYJA 1S9HA 3N4MA 3SZPA 2O61A 1ZGJA 5KK1A 3I4PA 3OYEA 1QGPA 4M3EA 3PQKA 1KQ8A 5CVIA 1WJEA 3GYHX 2EZHA 2V6CA 3CZ6A 2RN7A 4M3BA 3JREA 1KA8A 1FP1D 4CZCA 2JA5J 2I8DA 3HXLA 2PLYA 2XSJC 3M1CA 1FZPB 2HQRA 1FIPA 3HZJA 1D3YA 4G9YA 5FKKA 2L4AA 1OKRA 2EA2A 4XM3A 4KA4A 2LKXA 1R71A 3SHFA 2FOWA 3JTHA 2EQRA 1TWCJ 2DMUA 1WQ2A 4BDYA 1POGA 1SD6A 1BL0A 1V5FA 3P9IA 3D0SA 1Y8RB 3T8RA 1Z7LA 5HS7A 2IAIA 3K4KA 3ZN1A 1UHSA 5KHDA 5FROA 3K4BA 4RB1A 2CO5A 1BOAA 4PJ0C 2Y69H 1WGXA 2LY2A 1KU2A 1T95A 2IA2A 2R7VA 2B9SA 2E1MB 4L9JA 3CCYA 2FA5A 4U0WA 2ZMEB 5FD5A 3KP2A 4E7HA 1OYIA 4PK4A 3WGGA 1BIBA 4UXNA 3W2VA 2NRAC 3KZYA 4TV7A 1IN6A 3L9FA 2Y0SN 1K78A 1Z7UA 2L9NA 3LSTA 3HM5A 3RYRA 3MKYB 4I0BA 1FNNA 4Y4RA 2DOAA 1DGRM 1TQIA 3G71I 4IXAA 2L0KA 2K9LA 2PEXA 4HNTA 1IDZA 1BI3A 5CVUA 4Z6YA 3DF8A 4XONA 4OIRF 2QLZA 4LJZF 4U0YA 3TDUC 4LG3A 5HDGA 2JSPA 3CUOA 1YQAA 1JJ6C 3RTRA 1MGTA 4IZZA 4ZYHA 1MBKA 1DPRA 3F0CA 2DMQA 4LLGF 1OISA 4U88A 5BPDA 2OZUA 1LPQA 2FBKA 5CPRB 2LTPA 2CQXA 4GXOA 2A6EF 4B43A 4XLFA 3S1MJ 2L7MP 1V54H 2CW0F 1G3WA 1DP3A 3PNVA 3KP6A 4M6XA 3A0HC 2QBYA 2CUZA 2QSFX 2Z9OA 4EVIA 2DA3A 4R8HA 4RGUA 3WTVC 5JHFA 2GA2A 2LYCA 1FBQA 3LQRA 3Q0VA 4UB6C 3JRIA 2ZNZA 2FXAA 1VQMI 2YS9A 2MD5A 2FRHA 2XIGA 2XC7A 2R7SA 1MW7A 1HKSA 3BR0A 1MMAA 4YFKF 4Y15A 5IP7J 5HLTA 2E7WA 3TDZC 2GBYA 1XC5A 3E5XA 2KZVA 1TZLA 1LDJA 1HCRA 5IYBJ 5K5QA 4U7BA 3J80Z 1OLTA 3J80K 4HSTA 1RC9A 3LAPA 3HB9A 1WKMA 5K5OA 1T38A 4FT8A 3FXOA 2IA0A 1JE8A 2OD5A 2BVMA 3R60A 1R9TJ 1XGNA 5A2QK 5A2QZ 3G73A 3DBHB 4ON0A 3DEWA 3S15J 3ASOH 5E3MA 4KMFA 1QVUA 2BEOA 4M6YA 4JOMA 3LFKA 1VQOI 1XPXA 4CCMA 3NAUA 4A3FJ 4B09A 2VJ5A 3FXMA 3A03A 2Z99A 1KQ0A 2XAGA 2KJCA 1LVKA 1TWFJ 5C4XJ 5J4VA 2JJ7A 1FY7A 2R5YA 1IRXA 3HGYA 3LSIA 5EG0A 3QPLA 4MIMA 2V1DA 2M1BA 3S1RJ 2A5YB 3TOBA 5LHGA 1VQKI 3TW7A 3I64A 4HA8A 2IGMA 2L7KA 3LQQA 4ENJA 2HVSA 1B8IB 1X4PA 4UB8C 1GDTA 5FKNA 4BU2A 1XB4A 4B47A 1JHFA 4A93J 1R5GA 1Z05A 1R23A 4L9TA 4RDUA 4JX4A 1RR7A 2ISZA 1R49A 5ICFA 1XMXA 3H9JA 1YI2I 5J8FA 1NG6A 3DP7A 1ZYRF 4ZDLA 1B4AA 2DAOA 5JFRA 1MBEA 1APLC 4XSZF 4EJWA 3MKZA 1OCTC 3H9QA 1X3ZB 4HRIA 3SYTA 1TQMA 2GOMA 3OV8A 4NQWA 1AU7A 1SFOJ 1U0JA 1ZKGA 3OYCA 4RA2A 4MLOA 5GPAA 2WWYA 1ZGWA 4HQEA 2YU9J 2MC4A 3T8TA 3GBGA 3JRHA 4Y52J 3BR1A 4JK1X 1OMIA 1I1SA 3SFZA 1FTTA 3L2VA 4XLEA 4MO7A 1ZREA 2GM4A 2JQ7A 1KU9A 5EG0B 2K85A 5EYRA 3RDIA 3V4GA 3GXOA 2CGPA 3C2HA 4UVCA 2ZNYA 5CLSA 2WB1N 1ZELA
chains in the Genus database with same CATH topology
1Y0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0N A; 
#chains in the Genus database with same CATH topology
 1R00 A;  2M8E A;  5EZG A;  1EF4 A;  3IL2 A;  4HX7 A;  3EET A;  4KFC A;  2NVT J;  2GAU A;  3ROU A;  2XAQ A;  3SXY A;  2AHQ A;  3CF2 A;  4M9X A;  2HDW A;  2HR3 A;  3OYN A;  1VFC A;  2GXA A;  4Q5S F;  4HF1 A;  4A0Z A;  2NVQ J;  1B6A A;  1IV6 A;  1B9M A;  2ECC A;  2XGD A;  3KX2 A;  2O9L A;  3K2Z A;  4EM2 A;  3K0L A;  3WE2 A;  2L7Z A;  4E7K A;  3PO2 J;  2GOX B;  1O7F A;  3ZN0 A;  1G6N A;  4XR6 A;  4CYD A;  4E7L A;  1MBH A;  1VQN I;  4MQV A;  1JHH A;  1UMQ A;  4BAC A;  1IN4 A;  1SVO A;  3MKL A;  5FRM A;  3TQN A;  2W85 A;  2QZ8 A;  4M3F A;  1XMK A;  4KIT B;  1ULY A;  2MH2 A;  2ICW G;  4Y17 A;  1IAW A;  1ETY A;  1MJ9 A;  3IH2 A;  5IYC J;  3I55 I;  1FC3 A;  2DT6 A;  4EMS A;  2EJR A;  1ZTR A;  3HOU J;  1W36 D;  4AIH A;  4IHV A;  3HPH A;  3FMS A;  2QVO A;  5M5W J;  3I53 A;  3CO6 C;  1X1P A;  3K2A A;  2VXZ A;  2XRN A;  3MD2 A;  1YRN B;  4BBR J;  1HXD A;  1BR1 A;  2HU9 A;  4BJT A;  2JA2 A;  2AXT C;  3JRG A;  3OIO A;  4C2M J;  3GTO J;  1BN5 A;  2ZXJ A;  2OAZ A;  2YUS A;  3F6V A;  3L1P A;  2EV5 A;  4EJO A;  2B0L A;  2ZKZ A;  1IXR C;  4EM0 B;  3ZMU A;  3Q9V A;  4F55 A;  1Z6R A;  3DPL C;  1Y1V J;  3QP5 A;  5E3L A;  2JN6 A;  4ITV A;  5EZH A;  1LDD A;  1IW7 F;  3CQZ J;  1J0R A;  1X3W B;  5K7Z A;  4D1Q A;  1SFX A;  1WJD A;  2NVX J;  5KCM A;  3WU0 A;  2JMW A;  2F4O B;  1QZZ A;  3PQJ A;  1TQP A;  1HDP A;  1PVE A;  3BTC A;  5F08 A;  2RV8 A;  1Y0U A;  2JVH A;  3S2D J;  3ZXS A;  3FZV A;  1MMD A;  1D8K A;  2DTZ A;  2W82 A;  3AG2 H;  1Y6I A;  4PFO A;  2OU2 A;  5DV5 A;  4IRG A;  1ZG5 A;  3WTS C;  1IN8 A;  2P81 A;  4G7O F;  1WH7 A;  1W5T A;  5E1Z B;  1YYV A;  1XSD A;  2XAJ A;  3LSK A;  4IEJ A;  2NNY A;  3DTI A;  4DJA A;  1W36 C;  1FYM A;  1ODD A;  2BHY A;  1YW7 A;  2IVM A;  2ZO4 A;  3T1B A;  2IS2 A;  3KET A;  3SJM A;  1HC8 A;  2DQL A;  3HKZ N;  3KP7 A;  2RNJ A;  2VQH A;  2CQQ A;  1MNE A;  3MZY A;  4BQO A;  1H0M A;  2DA2 A;  1O57 A;  2LH9 A;  2Y0M A;  3IKV A;  2UV1 A;  1WHU A;  2NOJ B;  4MFE A;  1HOM A;  4NUB A;  4Y7N J;  3B02 A;  1BW6 A;  3A01 A;  4P9U A;  3DEU A;  4L5E A;  1ETV A;  1O7L A;  1WFX A;  2Y9Z A;  3ERM A;  3RPU D;  4ASN A;  4ABZ A;  4G94 A;  1YJW I;  1MJA A;  3H5N A;  3OS2 A;  3I59 B;  1JJ8 C;  1ON1 A;  2FNA A;  4D7N A;  4OMY A;  4BQQ A;  4QIW N;  1EH6 A;  1IC8 A;  1G2H A;  2LMD A;  2L01 A;  3K4M A;  2UWM A;  4MQ9 F;  4F92 B;  3TO9 A;  4PCQ A;  2QM3 A;  2R7U A;  3HRM A;  5HVQ C;  3EUH A;  4YII A;  5HLH A;  5FO5 A;  4RLF A;  3DTK A;  1ZG3 A;  4CH7 A;  3RKW A;  3HIF A;  1ZRF A;  2VJ4 A;  2PJR B;  2DPU A;  1NK2 P;  4BS9 A;  2VC0 A;  2F5E A;  3SZT A;  4O6J A;  2MGQ A;  4AUX A;  1J2X A;  4EGZ A;  4I09 A;  1GV5 A;  3OOU A;  3ZR8 X;  1K7A A;  2VOO A;  1W1W E;  4X1E A;  2XAH A;  2XV4 S;  3S2H J;  2CW7 A;  4LG0 B;  1JT6 A;  5TRD A;  5B5E C;  4DQ2 A;  1WH5 A;  3VEP A;  2LF7 A;  3CDL A;  4G7Z F;  1BR2 A;  5JVT A;  4FCY A;  1D5V A;  4C2U A;  3L7W A;  3KZZ A;  2ZJP F;  2CU7 A;  4LK1 F;  2NS7 A;  1FPQ A;  3ZMT A;  1D5Y A;  3W2A A;  2R7Z J;  3ZOB A;  4X6A J;  1BC8 C;  3RKY A;  3OR1 C;  4LIU A;  2QWW A;  1WJA A;  2IW5 A;  1A04 A;  1DPU A;  4RAY A;  4E7J A;  4PJL A;  2KIM A;  4ESB A;  2ELJ A;  1J7K A;  2JSC A;  2EZI A;  1UB9 A;  5F0F A;  4GYI A;  4J19 A;  1FEX A;  1ACI A;  4KJZ A;  1UG2 A;  3FXU A;  1RUN A;  3ABM H;  4XLA A;  1I27 A;  2EH3 A;  2NAZ A;  4OAY A;  4PSW A;  4RM2 A;  1BR4 A;  1AWC A;  3PO3 J;  1VQ8 I;  1TWG J;  3S17 J;  2RGV A;  3IP4 B;  2DA7 A;  3H3Z A;  2CG4 A;  3BR6 A;  3PIO F;  4E7I A;  3OYH A;  5IOY A;  3C7J A;  5EJC A;  2V1N A;  1VQ5 I;  2KIS A;  3RSN A;  4O5V A;  2M0C A;  5TIS C;  2BHZ A;  2CWE A;  2E1N A;  2JVG A;  4GCV A;  5JLX A;  4ZTJ A;  1U3E M;  2C6Y A;  3MZH A;  4L0Z B;  1HDD C;  3K4J A;  3B73 A;  1NHA A;  1ZGA A;  3R4K A;  5LD2 C;  3OR2 C;  2VQC A;  1C0W A;  3BLY A;  3DKX A;  1AA7 A;  1KZH A;  3RIR A;  1FSH A;  1YG2 A;  3K70 C;  2QUF A;  4AC0 A;  2EPF A;  1XX5 A;  3K9T A;  2W4S A;  3O2P E;  2NS8 A;  3F8F A;  3T5X A;  3VYU B;  1LE8 A;  2DMN A;  4QPO A;  3DLA A;  2IS6 A;  1OYY A;  2WY8 Q;  3K6G A;  4G7H F;  1SD5 A;  1TW3 A;  4B1R A;  1TWH J;  4UVB A;  3JRC A;  3DFG A;  2WAD A;  4D5F A;  2E71 A;  2R7W A;  4B8X A;  2WAF A;  1K79 A;  3W6J B;  2M5W A;  3HGG A;  1P4A A;  3IKT A;  5E17 F;  1JUP A;  1RKT A;  4KIB A;  3CJR B;  2E2J J;  1FSE A;  4ZYA A;  4F91 B;  3BWG A;  3K1N A;  4QPQ A;  4LFU A;  4XID A;  4M9Z A;  3RPQ A;  2K9N A;  3GW2 A;  3I9V 2;  3CC2 I;  3AG4 H;  3DU5 A;  4A3I J;  5LLQ A;  2MD0 A;  4YRV A;  1H89 C;  3RCO A;  5D5U B;  4KN4 X;  1FBS A;  2K9S A;  3WU2 C;  3ISP A;  3J7Y J;  5BNG A;  4OU0 A;  3BG9 A;  4M9S A;  4OIO F;  2EV0 A;  1PUF A;  4D7M A;  2CMP A;  2M30 A;  3E6B A;  3JRD A;  1OCO H;  3CCM I;  2XRL A;  1VQ7 I;  4XN3 A;  2HYF A;  4M72 A;  2MC3 A;  2QSG X;  2CS3 A;  3QU6 A;  2HXI A;  2PMZ A;  3FBI B;  1R36 A;  2VPR A;  2VC1 A;  5ED4 A;  2DT7 B;  4PZJ A;  4DBQ A;  1BA5 A;  4R79 A;  4A3D J;  1LDK B;  4YFN F;  2KIU A;  3CMY A;  2Y31 A;  2HVR A;  1YTY A;  4IHS A;  2NYX A;  3WE3 A;  2GWR A;  5DM6 F;  2CH0 A;  3HTS B;  2VON A;  3CTA A;  5HLI A;  5CJ9 A;  3F8B A;  5FB2 A;  5L3E A;  2O8X A;  2LD5 A;  3E1S A;  2O0Y A;  2DA4 A;  2M7A A;  1I1G A;  2XPW A;  3DBL B;  5GAE J;  3GUD A;  2RAE A;  3U21 A;  4MEY F;  3DBR B;  4S05 A;  3P5J A;  3LSR A;  4FAS D;  2Z3Y A;  4C2T A;  1HSJ A;  2F2E A;  4CYC A;  2VKV A;  3MWM A;  4RGX A;  1A5J A;  1Y39 A;  1YIT I;  1XSX A;  1QBJ A;  1Y56 A;  2LRD A;  1OCZ H;  2CFX A;  1J59 A;  2ACJ A;  3H92 A;  2E5N A;  3PNY A;  2X9D A;  3H5A A;  3LSP A;  1G3S A;  3IWZ A;  3WTY C;  3IV5 A;  1WJF A;  1P92 A;  3QPH A;  4HDV A;  1PUF B;  2O7O A;  4YG2 F;  3VOD A;  4CIC A;  1ZAO A;  4BQN A;  1O3R A;  1T0F A;  1USS A;  2MAB A;  2E7X A;  3G1L A;  5J1Y A;  2A3S A;  2FD5 A;  1ZK8 A;  3D5S C;  1Y8Q B;  4C3I J;  4DYR A;  2E36 A;  4PSX A;  2RQQ A;  2OV7 A;  3LSM A;  5ERI A;  1JGS A;  2ESH A;  2DU9 A;  5EDN A;  1AKH B;  2R92 J;  2KQR A;  1W7P B;  4MTE A;  5L3C A;  1O4X A;  4ESF A;  2EFO A;  2EZK A;  4B4C A;  3CJQ B;  4IPA A;  3IRR A;  2FOK A;  2IGK A;  3J81 K;  2D1V A;  4C30 A;  3CMM A;  3OYD A;  3BPV A;  1UJ8 A;  2F5C A;  2FEZ A;  3ABU A;  4XIC A;  2ZME C;  3JRA A;  1S6L A;  4BE2 A;  1A35 A;  5LGT A;  4BXU A;  1Q1H A;  3M8F A;  2CV2 A;  2WTE A;  3BJ6 A;  2K86 A;  4BJ5 C;  5E8I A;  3CF5 F;  2IA1 A;  1L3L A;  3CCR I;  2J5O A;  3ABT A;  4I02 A;  2DCE A;  5D5X B;  2IEK A;  3KLO A;  3OWT A;  2OZ6 A;  2Y75 A;  3FWE A;  1SVM A;  3FXQ A;  1S72 I;  3A1Y A;  2DYR H;  4XKV A;  5E1W A;  3EUK L;  2LKP A;  1U9O A;  2ME0 A;  4A3B J;  3GFJ A;  3FM5 A;  2OA4 A;  4UUS B;  4FQG A;  1MKM A;  2JRM A;  3ECO A;  3WHC A;  2Y48 A;  5DCF A;  3GTJ J;  4PJJ A;  3QYF A;  4MTD A;  2MSY A;  2R5Z B;  1U5T A;  3S3M A;  5FKL A;  4A3C J;  4XOT A;  5AON A;  1VQ9 I;  1N25 A;  3OOP A;  2VE9 A;  4I0A A;  2QKL B;  1MH3 A;  4JBA A;  2XHK A;  2JA6 J;  1V4R A;  2HVQ A;  1R22 A;  3BTJ A;  3E97 A;  3RPU A;  4UY8 I;  2EBI A;  1TNS A;  3S16 J;  4XL9 A;  3FK6 A;  3F23 A;  4BE1 A;  1TLH B;  1P6R A;  2KFD A;  2VN2 A;  3L2Q A;  3DWL E;  2O6G E;  3LA7 A;  3BC8 A;  4HX8 A;  1B9N A;  3BJO A;  3LAJ A;  3ZQF A;  2LG4 A;  5FJ8 J;  3ZQG A;  3EYI A;  3V8K A;  3IC7 A;  2EWN A;  1J5Y A;  2IS1 A;  1H9G A;  3K4N A;  2HYG D;  3HSR A;  2R5Z A;  3HOT A;  2D2W A;  1XGO A;  1YO5 C;  1QU3 A;  2ZFW A;  2JK3 A;  3FKI J;  2PJP A;  4UUS A;  4YFX F;  4PJN A;  5F0C A;  3Q5F A;  1ZN2 A;  4DZP A;  3COA C;  1R4N B;  3MCZ A;  3MKW B;  2LR8 A;  5M3M J;  5HLG A;  4XNF A;  4FX0 A;  3BR3 A;  2M8G X;  5GAD J;  2OCC H;  1IF1 A;  1JUS A;  3I59 A;  3HOZ J;  4PGH A;  2ETH A;  3R6S A;  1UCR A;  3HKZ A;  1RKW A;  1HW2 A;  2E2I J;  2VOD A;  3E5Q A;  4NNJ A;  1V55 H;  1YIJ I;  4O3M A;  2QSH X;  3H36 A;  3BG6 A;  2V79 A;  3CES A;  4HDU A;  2EFN A;  3A01 B;  1X58 A;  3IAS 2;  2DN0 A;  1NH3 A;  1E3O C;  3KZI C;  3TKY A;  2V9K A;  4RS8 A;  3NWT A;  5J3L A;  2E19 A;  2CQN A;  5BPI A;  2XAU A;  3KP4 A;  4RGR A;  4BGD A;  3OYF A;  2DDA A;  2KIQ A;  2CV0 A;  2B7E A;  4IL6 C;  4OIN F;  3SQN A;  2X48 A;  4IF4 A;  4CXF A;  4BAY A;  3NAR A;  4U7D A;  1OCR H;  2M3A A;  2PFB A;  2RKH A;  4P5O A;  3WGH A;  3H5R A;  2K4B A;  3P9C A;  1X1C A;  2ELK A;  2I10 A;  2W1O A;  3Q0U A;  4XRS A;  2FMY A;  2QQB A;  3BG5 A;  2VIX A;  4ZYG A;  5E8G A;  1E3H A;  2VJJ A;  1G3T A;  3V8L A;  2XB0 X;  3OYA A;  4EGY A;  2HEO A;  3MFK A;  1EA3 A;  5E20 A;  3L2U A;  1XGM A;  2VE8 A;  3LSH A;  4JQF A;  2GIZ A;  3ASN H;  2FE3 A;  4ZYD A;  2AXL A;  2DXI A;  3QQA A;  1LFB A;  4YEJ A;  4AID A;  1EKE A;  4GRI A;  2NOG A;  2K7L A;  3ZP5 A;  1R1V A;  3QYB A;  1G8X A;  2IGN A;  3VSK A;  4JX6 A;  4F7Z A;  3BPX A;  4L0Y B;  2CUE A;  5ICG A;  1W0U A;  1JKR C;  3K70 D;  4ENM A;  5IP6 A;  1T08 B;  3WTT C;  2XKO A;  3H3U A;  1IN7 A;  1DP7 P;  1GVD A;  4IQJ A;  2EIN H;  2IXS A;  2ZSI B;  3CUQ B;  2HI3 A;  5CKT A;  4EJU A;  2ZXW H;  3A0B C;  4L9N A;  4OWR B;  1S29 A;  5DTD A;  3TO6 A;  1EH7 A;  3TOA A;  5F1J A;  1UST A;  5FLX K;  4FET A;  3JRF A;  1XSV A;  2LDU A;  4I76 A;  2Z16 A;  1MMG A;  4Q4Z F;  2OF7 A;  1Y1W J;  4ZC3 A;  2QQA A;  1IGN A;  3HTU A;  4Y13 A;  3CLO A;  3ZMZ A;  3CO7 C;  4RGS A;  1SD7 A;  5HDK A;  5JLW A;  3OS0 A;  3LFU A;  5L3F A;  1TW2 A;  3RZD J;  2KL4 A;  5J1U A;  2JTV A;  2LF8 A;  3MEX A;  3S32 A;  2KT0 A;  3HRU A;  3S3O A;  3M4O J;  4Q48 A;  2ECB A;  2LSO A;  2ZBK A;  2QEX I;  2VOP A;  4IHW A;  3RYP A;  1YE9 A;  3FIW A;  3VYT B;  2E2H J;  1WZ2 A;  1IRF A;  3GTL J;  2V1X A;  1OFC X;  3BQZ A;  4A69 C;  1R1U A;  4BEH B;  3HHH A;  3G1M A;  3U9G A;  1J09 A;  4FIS A;  2XF7 A;  2K40 A;  3V42 A;  2CUJ A;  4WXH A;  5J8C A;  1RUO A;  4R1H A;  1J9I A;  2DO7 A;  4FE4 A;  3ZGK A;  4EEF G;  2Q0O A;  5L3D A;  2MH9 A;  2V26 A;  4IOC F;  1UFM A;  2L7F P;  2CSO A;  1IJW C;  3NRV A;  1I50 J;  3TGN A;  1FLI A;  2WC2 A;  2WY7 Q;  1N78 A;  2KRH A;  3VYR B;  1F5T A;  3M3Y J;  2A68 F;  3V7S A;  5IP9 J;  2EA4 A;  5F64 A;  4HBL A;  1SMT A;  1FWZ A;  1BI2 A;  3G6E I;  3S93 A;  1S5L C;  2E60 A;  4RAF A;  2DW4 A;  4L5J A;  2ZJR F;  4J00 A;  4E7S A;  4IRH A;  4D0P A;  5ICC A;  5DCM B;  1TT0 A;  3QP6 A;  2QA4 I;  3K10 A;  3ULQ B;  2W24 A;  5DD4 A;  2CUF A;  2OPT A;  1X3U A;  2W25 A;  4IQ4 A;  3PIP F;  2TCT A;  3F72 A;  3M07 A;  4GO1 A;  4KMU X;  3AG3 H;  4PJM A;  3PUF A;  1OYW A;  3G2B A;  2M87 A;  3ZMV A;  4UUT A;  5DUK A;  3DQV C;  3K69 A;  5CQE A;  1OCP A;  1H8A C;  1F43 A;  4XSX F;  3QRF F;  4LB6 B;  2L5Q A;  1Z9C A;  4V2F A;  2JWT A;  2PQ8 A;  4XLH A;  2HOE A;  1QZE A;  3DEE A;  5CQG A;  3VB2 A;  2L54 A;  2H1L A;  4KT5 C;  3QPT A;  4AVP A;  2DK8 A;  5B66 C;  4CCN A;  3BT9 A;  1IUY A;  3W6K B;  5JR3 A;  2HYJ A;  4LD5 A;  1T8I A;  2BZT A;  3REO A;  2XSD C;  4H0E A;  2VBZ A;  3GTG J;  4XLC A;  2M34 A;  5M3F J;  3FMR A;  5FFX A;  4XLN F;  4AYB A;  2COB A;  5DD8 A;  1IV8 A;  1HKT A;  3BZ6 A;  2PMU A;  1LEB A;  1P2F A;  4KUM A;  5D6F A;  4HNV A;  3OYB A;  1Z0X A;  4IO9 F;  4EJT A;  4I01 A;  1HLV A;  4A3K J;  2GIV A;  2VBY A;  4BUP A;  2KHM A;  4RLQ A;  2Q1Z B;  2X85 A;  2BE5 F;  1XS9 A;  3GEZ A;  4XKC A;  1F1Z A;  3MZ8 A;  1K78 B;  1Z91 A;  2XGC A;  3HPG A;  2UZK A;  2RQP A;  2DQR A;  2UUZ A;  3GX4 X;  1X19 A;  3HOY J;  1XGS A;  5H6R A;  2X6W A;  3E5U A;  1LKX A;  4HLX A;  5F1R A;  2Y9Y A;  2R7D A;  3H35 A;  4BJ6 C;  3J7A O;  1Z3X A;  3CJN A;  3ESW B;  1DUX C;  1GXQ A;  1N77 A;  1JKQ C;  1HF0 A;  1WRJ A;  3SEQ A;  1QPM A;  5FLV A;  2WAQ N;  3KLN A;  2W48 A;  1QZY A;  4JP0 A;  2CV1 A;  1JT0 A;  3GO5 A;  4HAM A;  1FOW A;  4KN7 X;  3JSP A;  4ZJZ A;  2BBY A;  2CQ7 A;  2QCO A;  2RRE A;  5IPA A;  1RES A;  3I0T A;  1P7I A;  3H0D A;  2M7B A;  4XRS G;  5CVV A;  3GME A;  3O6B B;  3LMM A;  5J40 A;  2HQ5 A;  1S7O A;  3OL3 A;  3WG9 A;  1QVT A;  4V2G A;  4AD9 A;  3TMO A;  3OYG A;  3F8C A;  4P9F A;  3BZC A;  2ESN A;  2VKE A;  2JA7 J;  1FJL A;  3FXL A;  4HQM A;  4LOC A;  4XBF A;  3UR3 C;  2FU4 A;  4KDP A;  2LY9 A;  5J6X A;  1PDN C;  3BG3 A;  2IGO A;  3CDH A;  1T39 A;  4DGW B;  1S3J A;  1X2M A;  4AVZ A;  4DBR A;  3U1D A;  1WCM J;  1D0X A;  5K7H A;  3J7A Y;  2V9P A;  4BL0 B;  5GPC A;  1B59 A;  5D8L B;  1WWX A;  3CJT B;  4OOI A;  1YX3 A;  1X1A A;  1VF9 A;  2EK5 A;  3KE2 A;  2X0L A;  1ETK A;  2KRC A;  3AFH A;  1OQY A;  1RI7 A;  2KPM A;  3BRO A;  3MVP A;  1OCC H;  1YJN I;  4LMY A;  3K7A J;  1MH4 A;  2QBY B;  2JRT A;  2L9V A;  2X6O A;  4QSH A;  5C44 J;  4RB0 A;  3HSE A;  1Y0N A;  5E18 F;  1IXC A;  2LC2 A;  1FTZ A;  5EF6 A;  2MLG A;  1MIJ A;  1WJB A;  4DIQ A;  2BY3 A;  2KDO A;  1TTY A;  2AS5 F;  2XUB A;  2W84 A;  5DYM A;  2OTL I;  1ORK A;  2OUM A;  4D9J A;  4HV5 A;  4HEA 2;  1FIA A;  2COM A;  2K3P A;  3JAM Z;  1SFE A;  3MMY B;  5H2F C;  3F22 A;  1JUM A;  2NVY J;  4A0Y A;  2K5C A;  2XAS A;  3B6C A;  4XMY A;  2W57 A;  3PFI A;  2ISY A;  3CC4 I;  2ID6 A;  4KIG A;  5LBQ A;  3FDY A;  1U9N A;  5H20 A;  4HV6 A;  1BOB A;  4B48 A;  1CGP A;  1OJL A;  4BH9 A;  3LOC A;  3TL4 X;  2X6Y A;  1V5G A;  3PFY A;  5F0H A;  3BP8 A;  1GV2 A;  1YW9 A;  2A61 A;  4PUS A;  2BOL A;  4UHT A;  4W1U A;  5FKO A;  5J1R A;  2EIM H;  4AIK A;  1QA6 A;  2HOS A;  3NWS A;  2PI0 A;  4LK0 F;  1T2K A;  4IHX A;  3F9K A;  3BCB A;  2P4W A;  1W5C C;  2EIL H;  9ANT A;  2QEN A;  1GVJ A;  2WBM A;  1W4M A;  2FX0 A;  3R61 A;  3Q9S A;  1LQ1 A;  2FJ1 A;  5TJJ A;  2B63 J;  2WV0 A;  2IS4 A;  2NNN A;  3Q0W A;  3U1K A;  4HPQ A;  1FT9 A;  2N8G A;  3GZ5 A;  1D0Y A;  1QNT A;  3K4L A;  3L00 A;  4UVA A;  1R5H A;  3ABL H;  5B1A H;  1F9N A;  4CCO A;  3GFI A;  4HLY A;  1XCB A;  3CCQ I;  1ENH A;  2PBI A;  3HJE A;  1XTA A;  2P6S A;  2XVC A;  4L5I A;  2D45 A;  3F8M A;  1KGS A;  2Z33 A;  3S14 J;  4C3J J;  3KYL A;  2F5F A;  3ZMD A;  4CA0 A;  1KU3 A;  4F52 A;  2P7V B;  3FBN B;  2HOA A;  2LBF A;  3ERE D;  5DDG A;  1G59 A;  4JYK A;  3KYD B;  1FYL A;  4BQA A;  2DOD A;  3A02 A;  3CUQ C;  2K9Q A;  2WA0 A;  1LNW A;  3SZG A;  3SEZ A;  2MYS A;  2ZJQ F;  5J4Y A;  2AO9 A;  1OR7 C;  3A4C A;  4D5C A;  3P9K A;  1SC7 A;  4P55 A;  1HW1 A;  1KU7 A;  3D5R C;  2RNG A;  4EQQ A;  2CJJ A;  1V3F A;  3HSF A;  3WHB A;  5ILU A;  2E35 A;  1PUE E;  2VLA A;  2QYO A;  3IH4 A;  4ANJ A;  3S2W A;  4GDF A;  2RVC A;  4HW0 A;  3WU1 B;  2BW3 A;  2PG4 A;  2ELH A;  4IHY A;  4LLL A;  1PP8 F;  2LRE A;  3GZ6 A;  1MJB A;  2DBB A;  3JSO A;  4A6E A;  1TT5 B;  4AM3 A;  2G0E A;  5FKM A;  1ZLK A;  1O3S A;  3CCS I;  5JHU A;  1VZ0 A;  3HDD A;  3OIP A;  5KAF C;  1LB2 A;  2JZY A;  2VXD A;  3ELK A;  4CZZ A;  3KP3 A;  3T0Y A;  1Z67 A;  2DJN A;  1VQL I;  2X51 A;  1I6H J;  3FXR A;  3DLL F;  4N9I A;  4LLN A;  4BXX J;  1YS6 A;  2LFB A;  1LFU P;  1IDY A;  3IH3 A;  3IRQ A;  1IUF A;  2F5D A;  1XD7 A;  3AL0 B;  1MZB A;  2R7F A;  3DPT A;  4YIR X;  1PJR A;  3CP2 A;  1MD0 A;  4HNU A;  1X1B A;  4XRF A;  4ENN A;  2OJE D;  5ILS A;  4FE7 A;  1CF7 B;  5F27 A;  1MBG A;  2HKO A;  5E3O A;  1FYK A;  1ETW A;  4ZDO A;  4X0G A;  2D5V A;  3IAM 2;  3QU3 A;  1WVR A;  4W97 A;  5H6Q A;  2X6X A;  1K6Y A;  2FQ3 A;  4KT6 A;  1Z1D A;  3WTX C;  4ZTF A;  5HOO A;  3KIO A;  4V19 K;  3S1Q J;  2VQL A;  4I6Z A;  3CMA I;  2Z5U A;  1B1B A;  3HOX J;  2L2O A;  5EGO A;  4E70 A;  3WTW C;  4BY7 J;  3JW4 A;  3PSI A;  4H4K C;  4HF0 A;  5GTH C;  2RC4 A;  2DPD A;  2O8K A;  1DU0 A;  5IT9 K;  2PJR A;  1XDU A;  2KP6 A;  3JAM K;  1JI8 A;  1U5T B;  4IVN A;  2X1E A;  1TNT A;  3BR5 A;  4QTR A;  1ZR4 A;  2JUC A;  2BGC A;  2VAS A;  1W0T A;  1O3Q A;  4RAG A;  5C3E J;  2DMT A;  1W7P D;  2VBX A;  3V7C A;  3CCL I;  3ZQQ A;  2KMU A;  4U0V A;  3CDI A;  4DZJ A;  2QKM B;  1EH8 A;  1TL8 A;  2DFH A;  3WGI A;  2MA3 A;  2O5R A;  3OS1 A;  4M3G A;  4BYY A;  3I4M J;  3L2R A;  3LSG A;  5AIQ A;  1FMW A;  2PN6 A;  1WSU A;  4CO8 A;  3FIS A;  1ETX A;  2QF7 A;  2OC6 A;  1E2X A;  2ADU A;  1R6R A;  3DV8 A;  2MLK A;  3KFW X;  4GFB A;  5J47 A;  4WF2 A;  3QOP A;  4BEH A;  3ZCO A;  4RB2 C;  5DEQ A;  4KIS A;  1IRG A;  2ZC2 A;  4B44 A;  2DI3 A;  3Q3S A;  2V4J C;  3FHN A;  2D1H A;  1DDN A;  3KEO A;  1S8N A;  3I5U A;  4FX4 A;  3G3Z A;  4XKW A;  2BY0 A;  3J7Z I;  5BMZ A;  2LY1 A;  3PNT A;  1T56 A;  1XMA A;  1P9Q C;  1LFP A;  4RAZ A;  3DCF A;  2R7X A;  4M73 A;  1TP4 A;  1WJC A;  3OMY A;  4JX5 A;  5D5W B;  4QWQ A;  4WX9 A;  3M7G A;  3OYK A;  1PYV A;  1UHW A;  2LBF B;  3ML6 A;  3OYL A;  3VOE A;  4NBQ A;  2P7C B;  1MBF A;  4PDK A;  1T33 A;  1V5E A;  2M2E A;  4A3G J;  2NVU B;  2F5V A;  3VPR A;  1DU6 A;  2K3F A;  4LIT A;  3BQY A;  4N4O B;  5HNH A;  5LHI A;  1EV7 A;  3E7L A;  4OIQ F;  5HS9 A;  4WK8 F;  5TGT A;  4UUV A;  2VUM J;  2TRT A;  3SFI A;  2KKO A;  2FML A;  1BIA A;  4F93 B;  4L18 B;  2WAE A;  1SVL A;  3QAH A;  4BKX A;  4NB5 A;  3CP8 A;  4G6D A;  3RKX A;  4P96 A;  1H88 C;  4HF2 A;  3HEF A;  1FP2 A;  1P7J A;  3M1E A;  2XKP A;  3DKW A;  1JXS A;  5D8K B;  3BDD A;  4A3E J;  1LVA A;  4XK4 A;  2XB5 A;  1D1B A;  2P6T A;  2HZT A;  2ZCW A;  1VQ4 I;  1I39 A;  2QQ8 A;  2M0M A;  1QPI A;  4A0X A;  1OR7 A;  3DPU A;  4B3A A;  4NC7 A;  5IY5 H;  1Z21 A;  2E5Z A;  4CYC B;  1JTX A;  3GF2 A;  4K2E A;  2IJL A;  2E1M C;  3AG1 H;  4ZYE A;  4E4H A;  1F36 A;  2VJI A;  2KZG A;  1PP7 U;  3LA2 A;  3HG9 A;  2ID3 A;  2H27 A;  2OQG A;  2JPC A;  5GAH J;  2HTJ A;  2A6T A;  3MN2 A;  1QRY A;  1AKH A;  5D5V B;  1YRN A;  4KIF A;  3VDX A;  1R5I D;  2L9S A;  2KJB A;  3C2G A;  2CYY A;  2DMP A;  3BOQ A;  2GQQ A;  2V1U A;  5M5Y J;  3EPZ A;  1SFK A;  1FOX A;  5K7F A;  2L02 A;  2P0W A;  4M6V A;  3TP0 A;  5DUI A;  1REP C;  3CUQ A;  3C2B A;  1ETQ A;  4XKB A;  1ON2 A;  3PUB A;  1U5T C;  3WOD F;  2YR2 A;  3E0J B;  3FKJ A;  2H6C A;  2J5P A;  1YJ9 I;  4OMZ A;  3GTK J;  5KVR A;  1K4T A;  1T0F C;  2EIJ H;  2O03 A;  3N05 A;  4WCG A;  4I2O A;  5E79 C;  4IOA F;  1T6S A;  4UV9 A;  3RQ4 A;  3LA3 A;  1MDM B;  1MSF C;  1P4X A;  1JKP C;  1MND A;  4U87 A;  1ZHF A;  4G8X A;  1O3T A;  3ZMS A;  2MG4 A;  2ZXH A;  3TED A;  3BCA A;  2DYS H;  2DDB A;  1GHC A;  3DU6 A;  5F04 A;  3W3C A;  3QYE A;  1SMY F;  1WI3 A;  3IUO A;  2BYV E;  1K83 J;  1MMS A;  5FLX Z;  1ZG1 A;  3D5L A;  5LEJ A;  2P5L C;  4P1W A;  5LRR A;  1HQC A;  3ZQ7 A;  3LWF A;  2FQ4 A;  5FRN A;  2Y0S A;  1NK3 P;  3FXK A;  3X2Q H;  1K4S A;  4NHJ A;  3GCM A;  2G9W A;  1QHG A;  2BY2 A;  3C18 A;  2UXX A;  4HX4 A;  2LNB A;  3HUG A;  3BTL A;  1I6X A;  2XAF A;  3GTM J;  4XRM A;  1R58 A;  3ZPL A;  3HL2 A;  2VKD A;  2VT3 A;  2FBH A;  5K5R A;  3LNQ A;  4G12 A;  1HW5 A;  2KRF A;  2V9V A;  1SAX A;  3CC7 I;  2DFF A;  3M9A A;  4BHC A;  1AHD P;  4N4N B;  4I98 B;  3GTQ J;  1SAN A;  2FSW A;  1TBX A;  2H8R A;  2AQE A;  2LP0 A;  5D4S A;  1LUJ B;  2PX9 A;  2HDD A;  4RMN A;  4FHT A;  3HRS A;  2HXO A;  2IBD A;  4CUG A;  4DNC A;  3GZN B;  3V7R A;  1B72 A;  1EJ9 A;  1YS7 A;  3MQ0 A;  2Q2E B;  3I54 A;  1G3Y A;  5HS8 A;  5BQT A;  1ITY A;  1HBX G;  5K1Y A;  3CCE I;  3CCU I;  3HYI A;  4CHU A;  2VKH A;  1ONV A;  1NTC A;  4Q47 A;  2GXG A;  4XQF A;  2HQN A;  2VI6 A;  3I56 I;  3HOW J;  5ICE A;  4GGG A;  1D8J A;  2K27 A;  1I3Q J;  2L4M A;  4BXF A;  3WG7 H;  2NS0 A;  4BY1 J;  5LGU A;  4YIF A;  3BG7 A;  1U2W A;  2DK5 A;  5CVJ A;  1ERD A;  3KP5 A;  2OBP A;  4MNU A;  3BZK A;  1B8I A;  2XRO A;  4CSW A;  1BM9 A;  2P8T A;  1X2N A;  3RI4 A;  1N75 A;  3TW6 A;  3VFZ A;  5HNF A;  2HNH A;  1X4O A;  1WI9 A;  5GTI C;  5EEA A;  3I58 A;  4DYQ A;  4DOZ A;  2H94 A;  3KYC B;  1SFU A;  1KON A;  5LFA A;  1FX7 A;  1TC3 C;  2FNP A;  2ZB9 A;  3A2K A;  2VPL A;  2VBW A;  4CCL A;  3EQL F;  1ETO A;  1F4K A;  1S7E A;  1T98 A;  1Z6T A;  2EIK H;  2G7U A;  3K1M A;  1RRJ A;  5M5X J;  4ZDP A;  5JI6 A;  1K61 A;  2YSR A;  2OQR A;  1KYW A;  2QQ9 A;  4MFD A;  3CME I;  1YHQ I;  1W5S A;  4BHP A;  4NQW B;  2R4G A;  3UKG A;  4WXC A;  3G1O A;  5IT3 A;  2ZXI A;  2YPR A;  2Z2S B;  1MMN A;  2HTS A;  3FM3 A;  1DQU A;  3H1C A;  3EUA A;  1WPK A;  1DGW Y;  4EV0 A;  4HOB A;  5DM7 F;  1P4W A;  2EFQ A;  4IRI A;  3JR9 A;  3HRT A;  1A6I A;  2V6E A;  1R1T A;  3OSF A;  4II2 A;  2BXY A;  3SDG A;  1FOK A;  2R7Q A;  3S8P A;  2KDZ A;  3PSF A;  2WB1 A;  4AIJ A;  2EZL A;  3ZQL A;  2Q2E A;  2A6H F;  5B3S H;  5LGN A;  3I4N J;  4OAZ A;  5D6E A;  1FMV A;  2DLL A;  4GYG A;  3WTZ A;  2DOF A;  2HOT A;  2FBI A;  3KPH A;  4ZH4 F;  1UHM A;  1RNL A;  3O8G A;  3BJA A;  2KLO A;  5FD6 A;  2P5V A;  3E6M A;  3OL4 A;  1E17 A;  2R5Y B;  2OCE A;  4XLP F;  2R7T A;  5FGM A;  3D1N I;  3F6O A;  3ZQH A;  2YU3 A;  4S0H B;  2G7H A;  2HQA A;  1GLN A;  2TDX A;  1YLF A;  2BXZ A;  3GVA A;  3NQO A;  4XOR A;  5B1B H;  3E6C C;  1JGG A;  1STZ A;  4BNC A;  3E6D A;  2PMH A;  2ZSH B;  4CCJ A;  3CD6 I;  2R3S A;  3V8J A;  3KEQ A;  3H0G J;  1MBJ A;  2K02 A;  4II3 A;  2X1D A;  3GWZ A;  3GLL A;  2KIF A;  4BHB A;  2R7O A;  5DCM A;  2IRF G;  2LVS A;  1HST A;  3KCC A;  5F6F A;  1VQ6 I;  1QHH D;  3HUG B;  3HHG A;  1BI0 A;  1YIO A;  2HFH A;  3ECH A;  4LIV A;  2XDV A;  2CFO A;  3JCU C;  1OPC A;  4EJV A;  1K6O A;  4J01 A;  1BJZ A;  4DW6 A;  2O3F A;  5LRS A;  3OSG A;  2CQK A;  2X4H A;  3P7N A;  1VQP I;  2LLK A;  3RQI A;  3C1D A;  3L2W A;  3VSL A;  2IT0 A;  2E1O A;  2MBF A;  3SDB A;  2OTJ I;  1HA8 A;  1ZR2 A;  3NEU A;  1AOY A;  3H9G A;  3FXJ A;  1KQ9 A;  1XG1 A;  2HPI A;  3VWB A;  2DJI A;  3M8E A;  2XPU A;  1FOY A;  2FF4 A;  3DKY A;  4I7H A;  2HPM A;  1I5Z A;  1RIO H;  1B72 B;  1NG7 A;  3AL0 C;  1YX5 A;  3B6A A;  4E7Z A;  2WAQ A;  3CCJ I;  1IZ1 A;  2L9R A;  2K4J A;  2EFP A;  1YFH A;  4E6K G;  3RZO J;  3FF5 A;  1IXS B;  4PGG A;  2XF5 A;  1VI0 A;  2GA1 A;  2MFZ A;  3CCV I;  5KNL A;  2NXN B;  1FBU A;  2A5W A;  2BY1 A;  4A3M J;  2GLO A;  2WV1 A;  3DXJ F;  4LB5 A;  2JA8 J;  3CLQ A;  4ETS A;  3GLX A;  5D4R A;  1BC7 C;  1IN5 A;  3ABK H;  2HWV A;  4RBO A;  3PJR A;  3S1N J;  1UAA A;  2YX7 A;  5HOD A;  3G4S I;  5CYV A;  2Q8K A;  1S7A A;  1JKO C;  3PM1 A;  2F48 A;  1YOV B;  3ZRG A;  3ZQI A;  4RB3 C;  3HOV J;  3F21 A;  4XN0 A;  3TO7 A;  3OYM A;  1Q1V A;  3H3V K;  3RJP A;  1BBY A;  2JT1 A;  3M8J A;  4A12 A;  1A36 A;  1ZRC A;  1D0Z A;  4N0B A;  4WXD A;  4A3L J;  2DFE A;  5HDN A;  4AWX B;  1R7J A;  3LSJ A;  2LOO A;  2IPQ X;  3OY9 A;  2UXN A;  1J75 A;  2VB6 A;  2LK2 A;  1LJ9 A;  2M45 A;  2RDP A;  4G6T B;  3N97 A;  4UNO A;  3FK7 A;  3EUH C;  1L0O C;  2MW8 A;  5E3N A;  2E34 A;  2M4K A;  4MHG A;  1RET A;  4QLC U;  4YEL A;  2LKS A;  4C9Y A;  2Z1D A;  4MEX F;  3FX3 A;  1H9T A;  5C4J J;  3HBL A;  2ZME A;  2CW8 A;  1R4M B;  3F3X A;  4HZF A;  5EEH A;  1ZLJ A;  1GT0 C;  3O8H A;  2M9H A;  5GP9 A;  4KNY A;  2JUG A;  3HC7 A;  2AQF A;  1VND A;  3GTP J;  4B3X A;  1E0E A;  3TP3 A;  1LEA A;  2I5U A;  2R0Q C;  4CCK A;  2XF6 A;  1U8B A;  2DA1 A;  1I3A A;  5BOX A;  3AKZ A;  4M74 A;  3E3V A;  5JVG F;  3EYY A;  1UEL B;  4ZZD A;  3R0J A;  4KIC A;  1M1E B;  3QPS A;  4DYC A;  3QOE A;  3EDP A;  4CDG A;  4ENK A;  3ZQC A;  3O3K A;  3JRB A;  1SAU A;  1JTY A;  3S3N A;  3U2R A;  3KEY A;  1LE8 B;  2IP2 A;  4A3J J;  1ZQ3 P;  1QQI A;  3QWL A;  5IOZ A;  2BVL A;  1Z3Y A;  1ZH5 A;  2F6C A;  2X1C A;  2QGU A;  4BBS J;  3K1P A;  2E1C A;  1RPW A;  4NC6 A;  2L3D A;  1SD4 A;  2Y2Z A;  4F3Q A;  2STW A;  3BY6 A;  4ZZL A;  2DOE A;  1U78 A;  5ILV A;  2VT2 A;  4L9V A;  1GXP A;  2DA5 A;  6PAX A;  2A69 F;  5CVR A;  5EEG A;  1XN7 A;  3L2C A;  1G4D A;  2EV6 A;  2W00 A;  4LG0 A;  1WJ5 A;  4A6D A;  2ZFU A;  3FMQ A;  4A2U A;  4CGZ A;  2EFW A;  5FFZ A;  1BW5 A;  3OIQ A;  3DTE A;  4I99 C;  3HOS A;  2W7N A;  2H1K A;  4UV8 A;  3FHZ A;  2STT A;  3J81 Z;  4ESJ A;  4IJA A;  5KAI C;  3ONQ A;  2EB7 A;  2HZD A;  1A31 A;  1HKQ A;  2DFI A;  2ZJ2 A;  1D1C A;  1IRZ A;  1XDS A;  4IKF A;  3TBI A;  3I71 A;  3W2W A;  4EM1 A;  5GAG J;  1X1D A;  4M71 A;  1YW8 A;  1U8R A;  4LGW A;  3AAF A;  1IO2 A;  2YX4 A;  2DTR A;  3RKQ A;  1RR8 C;  2ME6 A;  1BI1 A;  1CQT A;  3BR2 A;  3IWF A;  5IYD J;  2Y30 A;  2H09 A;  4G6Q A;  4AU7 A;  4WWC A;  2CRG A;  3BTI A;  4HYE A;  1ZRD A;  2V7F A;  4C3H J;  2PMZ N;  1UG0 A;  1U6G A;  2XGE A;  3WTU C;  5EGO B;  1VTN C;  4KYW A;  2H6B A;  1MNM C;  1A6Q A;  3MAJ A;  1ZAR A;  4NDL A;  1IG7 A;  3I3L A;  3R0A A;  5LEK A;  3IHU A;  1QO0 D;  5LHH A;  2HKX A;  4Y3O A;  3L09 A;  2XPV A;  3QOD A;  2F4I A;  2JPB A;  3F8N A;  4A5N A;  4A5M A;  5L3B A;  1CF7 A;  2VQG A;  4MGR A;  4Y33 A;  5L3G A;  5AIP A;  3GFM A;  2FUG 2;  4FTH A;  1UZC A;  2HDC A;  4NC8 A;  2GZW A;  3LL7 A;  2K9M A;  5BS6 A;  1MSE C;  1E3P A;  1BJA A;  2HS5 A;  4IHT A;  2A05 A;  2H8W A;  1Z77 A;  3GFL A;  3VYS B;  1GUU A;  4M3D A;  4OIP F;  1W7P A;  5IT9 Z;  3W6V A;  4N9H A;  2XGX A;  2GXB A;  2HGC A;  1SEU A;  4Z2Y A;  3PL8 A;  1TWA J;  1XCV A;  2DT5 A;  3OYI A;  4HSR A;  5DS9 A;  5FLM J;  1D1A A;  1KYZ A;  2M4G A;  1MDM A;  2BV6 A;  4BDZ A;  2F4M B;  2R93 J;  4S04 A;  4AYB N;  3UNG C;  2P5K A;  4BE0 A;  1RZ4 A;  2DA6 A;  3JTG A;  2R7R A;  4XOP A;  2A07 F;  2VL8 A;  4EAT A;  3K4C A;  4PFP A;  4HG2 A;  4IX7 A;  4RM3 A;  3C3W A;  5E1X A;  2BW3 B;  3OYJ A;  1S9H A;  3N4M A;  3SZP A;  2O61 A;  1ZGJ A;  5KK1 A;  3I4P A;  3OYE A;  1QGP A;  4M3E A;  3PQK A;  1KQ8 A;  5CVI A;  1WJE A;  3GYH X;  2EZH A;  2V6C A;  3CZ6 A;  2RN7 A;  4M3B A;  3JRE A;  1KA8 A;  1FP1 D;  4CZC A;  2JA5 J;  2I8D A;  3HXL A;  2PLY A;  2XSJ C;  3M1C A;  1FZP B;  2HQR A;  1FIP A;  3HZJ A;  1D3Y A;  4G9Y A;  5FKK A;  2L4A A;  1OKR A;  2EA2 A;  4XM3 A;  4KA4 A;  2LKX A;  1R71 A;  3SHF A;  2FOW A;  3JTH A;  2EQR A;  1TWC J;  2DMU A;  1WQ2 A;  4BDY A;  1POG A;  1SD6 A;  1BL0 A;  1V5F A;  3P9I A;  3D0S A;  1Y8R B;  3T8R A;  1Z7L A;  5HS7 A;  2IAI A;  3K4K A;  3ZN1 A;  1UHS A;  5KHD A;  5FRO A;  3K4B A;  4RB1 A;  2CO5 A;  1BOA A;  4PJ0 C;  2Y69 H;  1WGX A;  2LY2 A;  1KU2 A;  1T95 A;  2IA2 A;  2R7V A;  2B9S A;  2E1M B;  4L9J A;  3CCY A;  2FA5 A;  4U0W A;  2ZME B;  5FD5 A;  3KP2 A;  4E7H A;  1OYI A;  4PK4 A;  3WGG A;  1BIB A;  4UXN A;  3W2V A;  2NRA C;  3KZY A;  4TV7 A;  1IN6 A;  3L9F A;  2Y0S N;  1K78 A;  1Z7U A;  2L9N A;  3LST A;  3HM5 A;  3RYR A;  3MKY B;  4I0B A;  1FNN A;  4Y4R A;  2DOA A;  1DGR M;  1TQI A;  3G71 I;  4IXA A;  2L0K A;  2K9L A;  2PEX A;  4HNT A;  1IDZ A;  1BI3 A;  5CVU A;  4Z6Y A;  3DF8 A;  4XON A;  4OIR F;  2QLZ A;  4LJZ F;  4U0Y A;  3TDU C;  4LG3 A;  5HDG A;  2JSP A;  3CUO A;  1YQA A;  1JJ6 C;  3RTR A;  1MGT A;  4IZZ A;  4ZYH A;  1MBK A;  1DPR A;  3F0C A;  2DMQ A;  4LLG F;  1OIS A;  4U88 A;  5BPD A;  2OZU A;  1LPQ A;  2FBK A;  5CPR B;  2LTP A;  2CQX A;  4GXO A;  2A6E F;  4B43 A;  4XLF A;  3S1M J;  2L7M P;  1V54 H;  2CW0 F;  1G3W A;  1DP3 A;  3PNV A;  3KP6 A;  4M6X A;  3A0H C;  2QBY A;  2CUZ A;  2QSF X;  2Z9O A;  4EVI A;  2DA3 A;  4R8H A;  4RGU A;  3WTV C;  5JHF A;  2GA2 A;  2LYC A;  1FBQ A;  3LQR A;  3Q0V A;  4UB6 C;  3JRI A;  2ZNZ A;  2FXA A;  1VQM I;  2YS9 A;  2MD5 A;  2FRH A;  2XIG A;  2XC7 A;  2R7S A;  1MW7 A;  1HKS A;  3BR0 A;  1MMA A;  4YFK F;  4Y15 A;  5IP7 J;  5HLT A;  2E7W A;  3TDZ C;  2GBY A;  1XC5 A;  3E5X A;  2KZV A;  1TZL A;  1LDJ A;  1HCR A;  5IYB J;  5K5Q A;  4U7B A;  3J80 Z;  1OLT A;  3J80 K;  4HST A;  1RC9 A;  3LAP A;  3HB9 A;  1WKM A;  5K5O A;  1T38 A;  4FT8 A;  3FXO A;  2IA0 A;  1JE8 A;  2OD5 A;  2BVM A;  3R60 A;  1R9T J;  1XGN A;  5A2Q K;  5A2Q Z;  3G73 A;  3DBH B;  4ON0 A;  3DEW A;  3S15 J;  3ASO H;  5E3M A;  4KMF A;  1QVU A;  2BEO A;  4M6Y A;  4JOM A;  3LFK A;  1VQO I;  1XPX A;  4CCM A;  3NAU A;  4A3F J;  4B09 A;  2VJ5 A;  3FXM A;  3A03 A;  2Z99 A;  1KQ0 A;  2XAG A;  2KJC A;  1LVK A;  1TWF J;  5C4X J;  5J4V A;  2JJ7 A;  1FY7 A;  2R5Y A;  1IRX A;  3HGY A;  3LSI A;  5EG0 A;  3QPL A;  4MIM A;  2V1D A;  2M1B A;  3S1R J;  2A5Y B;  3TOB A;  5LHG A;  1VQK I;  3TW7 A;  3I64 A;  4HA8 A;  2IGM A;  2L7K A;  3LQQ A;  4ENJ A;  2HVS A;  1B8I B;  1X4P A;  4UB8 C;  1GDT A;  5FKN A;  4BU2 A;  1XB4 A;  4B47 A;  1JHF A;  4A93 J;  1R5G A;  1Z05 A;  1R23 A;  4L9T A;  4RDU A;  4JX4 A;  1RR7 A;  2ISZ A;  1R49 A;  5ICF A;  1XMX A;  3H9J A;  1YI2 I;  5J8F A;  1NG6 A;  3DP7 A;  1ZYR F;  4ZDL A;  1B4A A;  2DAO A;  5JFR A;  1MBE A;  1APL C;  4XSZ F;  4EJW A;  3MKZ A;  1OCT C;  3H9Q A;  1X3Z B;  4HRI A;  3SYT A;  1TQM A;  2GOM A;  3OV8 A;  4NQW A;  1AU7 A;  1SFO J;  1U0J A;  1ZKG A;  3OYC A;  4RA2 A;  4MLO A;  5GPA A;  2WWY A;  1ZGW A;  4HQE A;  2YU9 J;  2MC4 A;  3T8T A;  3GBG A;  3JRH A;  4Y52 J;  3BR1 A;  4JK1 X;  1OMI A;  1I1S A;  3SFZ A;  1FTT A;  3L2V A;  4XLE A;  4MO7 A;  1ZRE A;  2GM4 A;  2JQ7 A;  1KU9 A;  5EG0 B;  2K85 A;  5EYR A;  3RDI A;  3V4G A;  3GXO A;  2CGP A;  3C2H A;  4UVC A;  2ZNY A;  5CLS A;  2WB1 N;  1ZEL A; 
#chains in the Genus database with same CATH homology
 1Y0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...