2K9LA

Structure of the core binding domain of sigma54
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
b'KETVPYQIPYTPSELEELQQNIKLELEGKEQELALELLNYLNEKGFLSKSVEEISDVLRCSVEELEKVRQKVLRLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor RpoN
publication title Structure of the RNA polymerase core-binding domain of sigma(54) reveals a likely conformational fracture point
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2008-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1330 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2k9lA00
2K9LA 2K9MA
chains in the Genus database with same CATH superfamily
2Z2SB 2STTA 1LE8B 3OR1C 1SVMA 2L9NA 2AQFA 1BOAA 2AXTC 3P9CA 4ESFA 2RDPA 5ICCA 3DWLE 4F55A 2KQRA 2X1EA 4HDVA 2XC7A 3SEQA 1CGPA 3K7AJ 4HV6A 2PQ8A 1HDDC 2R93J 2LR8A 2H8WA 3FM3A 2EB7A 3ROUA 3A4CA 3KCCA 5GTIC 4X0GA 3GEZA 3TO9A 2A05A 4EJWA 4J01A 4EJVA 4LLLA 5K7ZA 1GT0C 3SFIA 1REPC 1MH3A 5FD6A 1SD6A 2M7AA 2FBIA 1AKHA 4I7HA 3KIOA 4A0ZA 1G8XA 1OCCH 3BWGA 3EQLF 3HOYJ 2M8GX 1MJAA 2K9MA 2ZC2A 3FWEA 4AIKA 3WGHA 2ISZA 1E3HA 2O8KA 2QF7A 3ELKA 2VBWA 2Q0OA 5HLIA 2HTSA 2CV0A 3JAMZ 4WCGA 1YRNB 2ZCWA 1L0OC 5LRRA 2R7OA 5CYVA 1V54H 3OYJA 1SD5A 1Z9CA 1UFMA 3S2WA 2UV1A 3NRVA 4UUVA 4DJAA 2KDZA 3G6EI 3CCQI 2KRCA 2Y48A 3S1QJ 2VOOA 4EGZA 3LFKA 3EETA 1W7PD 3BT9A 3VFZA 2A3SA 2C6YA 5E18F 2AQEA 4MTEA 5EGOB 4UUSB 3MZHA 2DN0A 2RV8A 3ZMSA 1WJCA 4EV0A 3V4GA 4BBSJ 4EJOA 2EV6A 4BBRJ 2EIKH 2DPUA 4KITB 1KU7A 2KMUA 4S04A 1FIAA 2V6EA 4Y15A 3W6KB 2DO7A 2V1DA 5KNLA 3BZCA 1ZRFA 3D5SC 2PJPA 2CRGA 1R5GA 2BY2A 1Y1VJ 3L2RA 2VPLA 3KP4A 3L2VA 2R7VA 2GLOA 4U88A 3K70C 5HDKA 3RDIA 2F48A 4G12A 2EA2A 2XPWA 3TP3A 1XPXA 3L2QA 3GFLA 5B1BH 1NTCA 2OUMA 1SEUA 4WWCA 1KYZA 2ZMEA 3EDPA 5FKLA 1ZGAA 4M3GA 5JHFA 4RS8A 5EZHA 1AOYA 4A3EJ 5DCMB 1F4KA 4IRGA 5J6XA 4LK0F 1JXSA 2F5CA 1Z6RA 3FMQA 5J40A 1LPQA 2Q8KA 1USTA 3JRCA 5H20A 4ASNA 1K78A 2PMUA 4N4OB 4JQFA 4A12A 2GBYA 3K4NA 2EIJH 5ILVA 3RTRA 3HRSA 3IRQA 1DP3A 3QU3A 2ZXHA 4PJJA 1G6NA 3OY9A 1T0FA 2DT6A 3SZPA 4HX7A 1Y0UA 4UB8C 3VYTB 3GFMA 1IDYA 3LWFA 1BC8C 2IA0A 2CUJA 4JOMA 3DLLF 1GXQA 3TEDA 2CJJA 1WFXA 2P5LC 2XAFA 1AKHB 2EFPA 1HBXG 2PI0A 2DK5A 3C3WA 4E6KG 2M45A 4RM2A 4TV7A 2V7FA 3S1RJ 2P5KA 2H6CA 4I98B 2RNJA 3RQ4A 1FLIA 3H5RA 1DU0A 1PYVA 3PUBA 3OSFA 1ZK8A 2X6XA 5J1YA 1VQNI 3E6DA 1D5VA 3KZIC 2EH3A 4EMSA 3QPHA 1W7PA 1J0RA 4RLQA 2QYOA 4BU2A 4DZPA 1OYYA 4Z6YA 3A01A 3IWFA 1XX5A 1TTYA 4IPAA 2DOEA 3TGNA 3BLYA 4A5MA 4FCYA 2MC3A 5IYDJ 3MCZA 3HOZJ 4BUPA 1H8AC 4LIUA 1P4AA 5EEGA 3BG6A 2ZJQF 1JJ6C 5J1RA 4IRIA 4CYCA 1BOBA 3ZQHA 1ZHFA 4I02A 1UCRA 3HPHA 1VQLI 5E3MA 2IVMA 2DMNA 5DS9A 1WJEA 1LB2A 5E20A 1GVJA 1N78A 4BYYA 1SMTA 5B1AH 1RR7A 2DQLA 1TZLA 1SFUA 2DOFA 3B6CA 1R1VA 2JN6A 1TQPA 4MGRA 1ETOA 3IRRA 4C2TA 1FBUA 2FF4A 4AIDA 3CUQB 2BW3A 2ZMEB 1R58A 3HIFA 1EKEA 2B0LA 1IAWA 4HRIA 1JUPA 4B43A 4J00A 3CDLA 1QQIA 2E1MC 1LFBA 3BR6A 4X1EA 3PQKA 2H1LA 2X4HA 4M6YA 5D5WB 2H6BA 2VQCA 1RZ4A 3KETA 1B8IB 1OISA 2NS0A 4AIHA 2RREA 3OYNA 1AHDP 2QA4I 4HDUA 2VJJA 3OSGA 2R7RA 5CPRB 2W57A 2DA7A 2QENA 1UHWA 5HLTA 2UXNA 4I09A 4O5VA 2KZVA 2LVSA 4DYCA 3O2PE 2LC2A 1J2XA 4DW6A 1K79A 3UKGA 3CP8A 3LL7A 3SDGA 1AU7A 4Q48A 3E5UA 1FPQA 1U5TB 1W5TA 3J81Z 3JCUC 2X9DA 3W2AA 3JRFA 2EILH 3E6MA 4IHSA 1SD7A 2YS9A 1Z7UA 1HSTA 2CQKA 3CJQB 3KE2A 2EFOA 1K4TA 2OF7A 4LG3A 1D1BA 3JREA 4EM2A 4FQGA 3HC7A 3S2HJ 2EFWA 2K02A 4FE4A 3SZGA 1LVKA 2G7HA 2XRNA 1F1ZA 4R8HA 4CH7A 2Y75A 3LOCA 1W36C 1MMNA 2O6GE 2BOLA 3FBNB 2M2EA 4XRSA 3V42A 4DOZA 2K7LA 3A2KA 1W7PB 2M1BA 3U2RA 1D0XA 4HNVA 5ICGA 3PJRA 1V55H 4G8XA 2HVSA 3DTKA 4NC7A 2V4JC 4DBQA 1LQ1A 3BP8A 3H9JA 4KYWA 4XICA 2KPMA 4HQMA 1SAXA 2DFIA 2RGVA 5F1JA 1SFEA 4HQEA 1YOVB 4WX9A 1XMXA 5CKTA 2DU9A 2ETHA 3ASOH 3K4CA 3Q9SA 4B44A 4IVNA 4IQ4A 3WG9A 2EQRA 3KYCB 3RKWA 1WH5A 3ZMTA 3AKZA 1DP7P 2BYVE 4PDKA 3CCSI 3ESWB 3OYFA 4O3MA 3H36A 2DMTA 1O4XA 1R4MB 2UZKA 1ON1A 2KT0A 3L7WA 4KUMA 2PFBA 2ZJPF 2V1NA 5J4YA 4D5CA 2VJ5A 5HDNA 3OYLA 3CJRB 2Y9ZA 1S9HA 1YYVA 1QVTA 3BR3A 4QPQA 4PZJA 4E4HA 2BW3B 3KP3A 2VC0A 3OS0A 2VE9A 3B73A 3DU5A 4XKWA 2DA4A 1FMWA 2JA2A 1O3QA 2JRMA 2XF7A 2MGQA 3JRDA 5JR3A 4OMYA 1X4PA 1XTAA 3QPSA 4M9XA 4YELA 4CDGA 4HF0A 2L54A 4AVZA 3RZDJ 2DCEA 3LQRA 1T6SA 2K40A 1QHGA 3NARA 2LBFA 1K61A 4AC0A 2LP0A 3E3VA 2HGCA 1FT9A 4AIJA 2F4MB 3DU6A 2ZFWA 1K7AA 1SVOA 2FD5A 1RUOA 1R6RA 4CSWA 3ECOA 4HA8A 5EYRA 1XS9A 4I2OA 1HA8A 3KP5A 2K5CA 2HOEA 3MKYB 3GYHX 3R61A 1KU2A 3FIWA 5K5RA 4MLOA 3I64A 4F3QA 1M1EB 4I6ZA 2WTEA 5EEAA 2GA1A 1I6HJ 1WI9A 2VQHA 4OIPF 2NAZA 1P7IA 2BY0A 5IYBJ 1QBJA 2QSFX 3S3OA 2ZXIA 3K10A 3S3MA 5DUKA 3CCVI 2HYJA 3HB9A 1RRJA 4YIIA 3ZCOA 5TGTA 2Z1DA 1ZG5A 1GLNA 3LSKA 3ZQIA 4BQOA 1UELB 2DJNA 1QZYA 3BY6A 2DT7B 1GXPA 3FXLA 3S1NJ 1EH7A 1I3QJ 1X3UA 5BNGA 5BQTA 1OCOH 2LH9A 2W84A 4CZZA 5BPDA 1MMDA 5F0FA 1FP1D 1HW5A 1Q1VA 4E7LA 3VWBA 3FK7A 1KGSA 2V26A 3RSNA 4MNUA 1MIJA 1YTYA 3GTKJ 2E7WA 3S3NA 3CESA 3MKLA 2LKXA 2DODA 3RKXA 1YE9A 4AD9A 5FKKA 1WH7A 3D5RC 1QRYA 4XRFA 5D5XB 1MKMA 2ELHA 1A04A 2O9LA 4A69C 3WTTC 3N97A 4JP0A 2N8GA 3TW6A 3OYKA 2XIGA 2XGXA 1BR1A 3E7LA 1Y1WJ 1DQUA 2VKEA 4ESJA 3IH3A 3ZOBA 1B4AA 3TO6A 4P9UA 4AWXB 5BOXA 3I56I 3GO5A 1FOYA 4RAZA 1YS7A 3HEFA 4RAGA 2MYSA 3HG9A 1H9GA 1O3RA 2IJLA 4ZDLA 3AL0C 3GUDA 5HODA 3BTJA 4A3JJ 1ZYRF 1U9OA 2NRAC 1GHCA 1RIOH 3LA2A 5KCMA 3SXYA 1Z0XA 1ZKGA 3L00A 3OYAA 2PMHA 2DYRH 4IHVA 4WXHA 3QOEA 2L5QA 2NS7A 2VB6A 2ZXJA 3ECHA 4XL9A 4IQJA 4A3DJ 1WJFA 2LBFB 1D0ZA 3P5JA 1WRJA 2O5RA 5EDNA 3WODF 1I5ZA 2M3AA 5LGUA 4P9FA 2GOMA 4G7ZF 4CYDA 3L2UA 2GXBA 3CMYA 3EUHC 4W1UA 3BJAA 1WZ2A 1X2NA 3RI4A 2CH0A 2CW0F 2V9KA 1QPMA 2DAOA 5ICFA 4XLCA 4CHUA 3G1LA 4ETSA 1FEXA 4RM3A 2XF5A 2TDXA 5HS8A 2Z9OA 3MEXA 3VODA 1TWAJ 2X1CA 4NBQA 2L7ZA 3KEYA 1P6RA 2VOPA 1G3WA 2EK5A 2XRLA 2R7FA 3LSMA 2ADUA 3VPRA 1SFOJ 1H88C 3M4OJ 2VIXA 3O8HA 1XSDA 1JKQC 2YPRA 2K4BA 3MZYA 2ME6A 4NB5A 1RKTA 4FHTA 3I71A 3HOUJ 3KYDB 3WG7H 4GFBA 1AA7A 4D7MA 4DYQA 3BR1A 5LLQA 2HDDA 1IUFA 1XC5A 4HEA2 2A6HF 5D8LB 3FDYA 4FT8A 2BVLA 2EFNA 4XMYA 3GFIA 3QYFA 1X3WB 2DK8A 1T8IA 5JLXA 2K9LA 1RESA 2XAQA 4A6EA 2A5YB 3OWTA 3WTYC 4LMYA 3HOSA 1G59A 1QA6A 2ESHA 2PJRA 3TBIA 3I53A 2HFHA 3G4SI 2Z5UA 3FF5A 1FOXA 1SD4A 3QODA 2ICWG 2DA6A 4ZYGA 4BACA 3K4MA 1NG7A 2IW5A 2L4AA 3E5QA 4FETA 3MKWB 4HNUA 2VT3A 1RC9A 4JBAA 3C7JA 2M87A 2NNNA 1HCRA 4XRSG 2MSYA 3WGGA 5J8CA 1TL8A 2MW8A 1FTZA 2BY3A 1FBSA 2X85A 2ECCA 2W82A 5J8FA 2XKOA 2XHKA 3WU2C 2AO9A 3F22A 2W85A 4V2GA 2KRHA 5FLXZ 1DU6A 2B7EA 1DGWY 3F21A 1GDTA 1D8KA 2YX4A 3OR2C 2H94A 1EH8A 2OZUA 3F8MA 3IH4A 1R36A 4YEJA 3CCJI 5FROA 1LNWA 2Y0SA 2AHQA 4C2MJ 5JHUA 3M9AA 2Y2ZA 1YW7A 2LY9A 3WE3A 2R7SA 3FHNA 3OS2A 4UNOA 4EM0B 2M7BA 3NWTA 2IPQX 4XSZF 3CQZJ 4LJZF 1OKRA 1X58A 1TWFJ 4PGGA 1S8NA 3KEQA 1WHUA 5A2QK 1XMKA 2Y31A 4A2UA 1JGSA 2HPIA 2LF8A 3G1MA 1EV7A 2VLAA 3S1MJ 2K85A 3FXKA 5DCFA 2P6SA 3GF2A 5DEQA 3CCUI 1IXRC 5LEKA 2JA5J 2H1KA 2IA2A 1WJ5A 3AG4H 4BHBA 4WF2A 1T33A 2Y0SN 3WTUC 1S7OA 3CC2I 1MMGA 1EF4A 2W4SA 3E97A 5IYCJ 3ZN1A 1NK3P 5HS9A 3TQNA 4YFNF 1B72B 3ZMZA 4JX6A 3FXOA 4M6VA 4M3FA 2LSOA 4A0YA 1X1BA 4DIQA 4CO8A 3IHUA 3ONQA 2JTVA 2EPFA 5HLGA 1FWZA 2COMA 1F9NA 4L0ZB 4GRIA 3GZNB 1N75A 3CJTB 2YR2A 1TBXA 3DPLC 4MQ9F 1WJBA 3S14J 2OCEA 3HOXJ 3JRBA 3SEZA 5FRNA 1OCRH 2XDVA 3EPZA 2MABA 3BOQA 4II3A 4IOAF 1Y8RB 2XB5A 3IL2A 2EIMH 1IF1A 1J5YA 3MWMA 2VASA 3MZ8A 5K5OA 2OAZA 3L2CA 1TWCJ 3PNYA 5ED4A 1ITYA 2VI6A 2HPMA 1R71A 1PP8F 4CCNA 2V9PA 3CF2A 4Q4ZF 1U3EM 5DV5A 3BCBA 3CF5F 3MD2A 2O3FA 5L3DA 2PJRB 4D0PA 4G6DA 3Q5FA 2E5NA 2IAIA 3NWSA 1ZR4A 1HF0A 2WY7Q 2RNGA 2LY2A 1HC8A 2XSJC 3KLOA 4BE0A 2DXIA 1S5LC 2K86A 1BN5A 2HR3A 1KONA 2ZNYA 4C2UA 5EG0B 1F43A 5C44J 4BY7J 2A07F 1MNDA 2E2JJ 5EF6A 1IXCA 1HSJA 3L1PA 3R60A 4LIVA 3M3YJ 1Y56A 4PUSA 1Z77A 3HGGA 2ZBKA 3HHGA 3QWLA 4S05A 1R23A 2Y69H 2R7UA 3DKWA 3PFIA 2G0EA 2EZLA 2W48A 3GTGJ 3U1KA 1YS6A 4ENNA 1YX3A 1QHHD 3A0HC 1BI1A 4XBFA 3W2WA 2NOGA 1FTTA 4M9SA 2OTJI 4IF4A 1VQ7I 1ZELA 2CU7A 3JR9A 3ERMA 4XRMA 2R7WA 4DGWB 3FBIB 3H9QA 3LNQA 1BR4A 1TNTA 2HZTA 3IAS2 1UG2A 3OYHA 3E5XA 5E79C 5JFRA 3ISPA 1R22A 4IHTA 4XLHA 1BA5A 1WVRA 3I4MJ 1IZ1A 2E71A 4WXCA 4LG0A 1EH6A 1CQTA 5H6RA 1HOMA 1G2HA 1FSHA 3FXQA 3CTAA 4GO1A 3GTPJ 4IKFA 1X1PA 2IS6A 1A6IA 4MEXF 2JWTA 1DUXC 1SMYF 2E1NA 1ZAOA 3BTCA 4PCQA 2KLOA 4RGUA 1VQMI 5K1YA 2F5VA 3LSGA 3P7NA 2EZIA 4II2A 1QNTA 4BJTA 3ML6A 1MNMC 2CQQA 2R7DA 1XCVA 2ZNZA 4OWRB 5KAIC 1FJLA 3G3ZA 1KZHA 1RNLA 5LBQA 3E6CC 4KDPA 5DM6F 1XGOA 4BXFA 2CS3A 4A3CJ 1W5SA 4RB1A 1IN5A 2X0LA 2Z3YA 2TRTA 2BXYA 2QQ9A 1XSVA 1ZARA 1KA8A 5LGTA 2ID6A 4XIDA 5F04A 2DYSH 5CVUA 3JW4A 2MH2A 3OIQA 2JA8J 2CYYA 3E6BA 5CQGA 1TP4A 1PVEA 1ZR2A 1MBGA 2JJ7A 5DUIA 5CVRA 2WAQA 3LA7A 1WJDA 3ABMH 2R5ZA 5LHHA 1N77A 1D1CA 4H4KC 3F9KA 2J5PA 1WKMA 2PLYA 1JTYA 4NDLA 3FXMA 4BE2A 1JHFA 2OQRA 5DTDA 4F7ZA 4N4NB 3F8CA 4PK4A 1O7LA 4ZYAA 2NNYA 2DFHA 2MD5A 3SZTA 3MAJA 4ZH4F 1JGGA 2WAQN 2PN6A 3BC8A 1C0WA 3QU6A 1YFHA 3H5AA 4CCLA 4L9JA 4A5NA 2FE3A 2FU4A 3E1SA 3OYDA 1A31A 4I0BA 2IRFG 2JMWA 4HSRA 4L5IA 2R0QC 5LEJA 2NXNB 3IAM2 5J1UA 4FX4A 4KT6A 3OYIA 1YITI 1BL0A 4WK8F 4M6XA 3L2WA 1FBQA 3HTUA 5M5XJ 1A6QA 1LEAA 1BW6A 4HYEA 4PFPA 4BJ6C 5DDGA 4BHCA 5KHDA 2FX0A 4DZJA 3HPGA 1STZA 2KHMA 2BXZA 3GWZA 4NC6A 1EJ9A 4QIWN 3QP6A 3T5XA 2DLLA 2JSCA 4F91B 3F6OA 4A3FJ 3H3ZA 3CUQC 4N9HA 2QEXI 3PNVA 2FOWA 2ZMEC 5LRSA 4WXDA 1OR7C 1V5EA 1K78B 3QOPA 4HAMA 1FSEA 2JZYA 2VPRA 4XNFA 2D2WA 4IZZA 3CMMA 3A0BC 2DTRA 3J80Z 1PUFA 4E7SA 1YW9A 1OYWA 2HKXA 1ETKA 2V1UA 3OYMA 1T2KA 2BBYA 3KP6A 3JTGA 4XSXF 4R1HA 3KZYA 1GVDA 1HKSA 1MBEA 1K83J 2O8XA 4JYKA 4XM3A 1LKXA 4BH9A 3AAFA 1IXSB 1ETXA 3ZQGA 4PJNA 1KQ0A 4HNTA 1V3FA 1U5TC 3VEPA 4KN7X 3CCRI 5L3FA 1R7JA 2GWRA 3K69A 4CA0A 5GAHJ 3S17J 5FB2A 4E7JA 2LNBA 3ABLH 1ZLKA 1ZLJA 5C3EJ 2RQPA 4IHXA 2DDBA 2P7VB 2XGCA 4RB3C 4L5EA 2K4JA 3K4JA 4EM1A 1HLVA 3K4LA 3S8PA 2EBIA 1WGXA 2A69F 5J4VA 2PBIA 2VJIA 3A01B 4XOTA 2QZ8A 2XPUA 4KT5C 5JI6A 3HJEA 3JSPA 2FBKA 1U9NA 1XDSA 1I1SA 1RETA 1H0MA 4OMZA 4G9YA 2UXXA 3DEWA 2L7FP 2R4GA 4XQFA 2WAEA 2HVRA 1Z3XA 4XLPF 4CYCB 3R0AA 4PFOA 1JKOC 2MG4A 2JRTA 4KICA 1UB9A 3LFUA 4LLNA 2CMPA 4HBLA 4U0VA 1P4WA 4B3XA 2LTPA 4HG2A 3I3LA 5ILUA 1MSEC 3KP2A 3HRUA 5FFZA 1MW7A 1ETWA 4B8XA 3ZGKA 3TMOA 4P96A 1H89C 3H3VK 1LUJB 5L3EA 2VONA 2IGKA 2LMDA 2K9QA 1VQ9I 3GW2A 2IXSA 4U87A 2CUEA 4L18B 3QRFF 4IHWA 1I27A 1ZG1A 2JVGA 4RGSA 3CCEI 2GA2A 3JAMK 4RA2A 2DA5A 1R5HA 2NS8A 1LJ9A 3RYRA 1XD7A 5EEHA 3AFHA 1I39A 3CDIA 2HI3A 2X51A 2LDUA 5J3LA 4U7BA 3J7AY 5FKNA 2WBMA 2R7ZJ 2IP2A 2H8RA 2P5VA 4P1WA 4EGYA 4G6TB 1T39A 3HUGA 4ZZLA 1BJAA 2FSWA 3HSRA 4ABZA 5E3LA 3WHCA 1VF9A 2O03A 3L9FA 3CMAI 3K4KA 2XV4S 3FKJA 1KQ8A 3IWZA 2XB0X 3EYIA 2PX9A 2G9WA 1KQ9A 3BR0A 3NQOA 5K7HA 1V4RA 4BDYA 4BXUA 3ZQLA 4HX8A 2LYCA 1DPUA 1S72I 2UUZA 3TDZC 4C3IJ 3CC4I 2EZKA 3Q0WA 1K6OA 4HF2A 2ESNA 3EUHA 4RGXA 3V7CA 4GDFA 2FNPA 4JK1X 2BE5F 4G7HF 2A61A 2HXOA 4HZFA 4Y17A 3UR3C 3JSOA 3IP4B 1B6AA 3LSHA 3PO2J 4G7OF 3H0DA 3RKYA 4NQWA 2Q2EA 4GYGA 3BG7A 2JA6J 1P9QC 1X3ZB 1IDZA 3RYPA 3F8BA 2VC1A 3QPLA 2P81A 5K5QA 2F4OB 2FJ1A 1J75A 1T95A 1I3AA 2FMYA 5E1ZB 1U8BA 2NVQJ 4XKBA 5E1XA 2CQ7A 1ULYA 1O7FA 3W3CA 3HOTA 1APLC 1YIOA 2O0YA 2GIVA 4E7ZA 3N4MA 3ZR8X 1BR2A 1Y6IA 2R92J 1RKWA 4Y33A 3F6VA 3ERED 4AVPA 2XKPA 5K7FA 1NH3A 5GAEJ 1TWHJ 4FX0A 5EZGA 1R1TA 1CF7A 3C2HA 5TJJA 3HSFA 2AXLA 3OS1A 2OC6A 5CQEA 1E3PA 2NVUB 2CUFA 2LRDA 1ODDA 3SDBA 4EJTA 1JHHA 5DM7F 4OIQF 3HZJA 1ON2A 2OV7A 1RPWA 3GVAA 1X19A 5KK1A 4U0WA 3CCMI 2EINH 3PIOF 4U7DA 1U6GA 2FRHA 3DKYA 3I5UA 5D4RA 1K4SA 3H0GJ 4HSTA 2YSRA 2H27A 4OINF 1UHMA 2IEKA 1ZGWA 2KKOA 3WTSC 1QU3A 2L02A 2VUMJ 3NAUA 5AIPA 5BMZA 3CC7I 4XLNF 4P55A 2WC2A 1E2XA 1MNEA 3PFYA 1ONVA 3QYBA 4LGWA 4F92B 1YG2A 1MZBA 2LF7A 3HDDA 4MHGA 3ZN0A 1OCZH 3AL0B 4F52A 2I5UA 3HUGB 3RJPA 5F1RA 4N0BA 1JJ8C 2CQXA 3K0LA 3U9GA 1W4MA 2YU9J 4ITVA 3M1CA 2ECBA 3K6GA 4LFUA 4LK1F 1F5TA 1YLFA 2QM3A 3GLLA 4BL0B 1YJ9I 1Y0NA 2RAEA 4CCKA 5IPAA 2WV0A 3CCYA 4CCJA 3F3XA 1HQCA 3HGYA 3S93A 4A0XA 3KP7A 1IJWC 2L4MA 1FY7A 1NHAA 3K70D 3I9V2 2CW8A 3PSIA 3BR2A 1QZEA 2VJ4A 2L01A 4G94A 3G1OA 4EATA 3LSIA 1IO2A 1Y8QB 2XROA 3MQ0A 3CO7C 2M4KA 4LITA 3DP7A 4PSWA 4M3DA 1MDMA 1YO5C 4BKXA 2OD5A 4KMFA 4K2EA 2KIMA 2F5DA 1ORKA 3LSJA 4YIRX 1FOWA 2LG4A 4CXFA 1S3JA 3K1NA 4L9TA 4AYBA 4XK4A 2IS1A 1U8RA 3PQJA 2E2HJ 2VODA 1U0JA 5IP7J 2DMPA 2Y30A 3ZMUA 2K3FA 4RMNA 1BI3A 4OAYA 2RC4A 2LOOA 2QKLB 1G3TA 1XMAA 1TW3A 2STWA 5M3FJ 2ELKA 3RPUA 4RDUA 2CG4A 2HU9A 5LHGA 2CUZA 2LKSA 3PL8A 5AONA 1IG7A 1BBYA 3M8EA 3HKZA 3G2BA 3J7ZI 3G71I 2HDWA 3F8FA 5E8IA 2K9SA 2NYXA 3LAPA 4KIGA 1LFPA 2QCOA 4DQ2A 1DGRM 3PNTA 2W7NA 2GQQA 1CF7B 3SHFA 1DPRA 3J81K 4IJAA 4AYBN 1L3LA 2E5ZA 3FXJA 2MH9A 4D5FA 1IUYA 1I1GA 1TNSA 3GTJJ 3AG2H 2FMLA 1TQIA 2R3SA 1MMAA 3I4PA 3PIPF 3CUOA 1IN6A 1JTXA 3FHZA 2DA2A 1Z6TA 1OFCX 1FYLA 3G73A 1JT6A 4G6QA 3ZQ7A 1IN8A 5IT9Z 5CLSA 3C2BA 3HKZN 4LD5A 2ZXWH 4EQQA 2A5WA 1TT5B 2HOTA 2MBFA 2MA3A 3CP2A 3T8TA 4ZDPA 2WV1A 5LFAA 2NVXJ 1POGA 1YX5A 5D6FA 2KP6A 2M0MA 2MD0A 2K3PA 1UHSA 1P7JA 1TW2A 5JVTA 4UY8I 3HM5A 1ZG3A 5F0CA 4KJZA 5TISC 5D5VB 1FZPB 4YFKF 1HKQA 5F0HA 4ZDOA 2E36A 2W1OA 2OU2A 2KJCA 2GOXB 3T1BA 3CLOA 4CGZA 1KU3A 5B66C 4ZYDA 5EGOA 3BJ6A 4UUSA 5IOYA 5FKMA 3AG3H 5JVGF 4CCMA 1VQ5I 3BZ6A 4BQAA 3HHHA 1EA3A 1D5YA 3B02A 3KPHA 1G4DA 6PAXA 4YRVA 4RAYA 2OJED 4ZYEA 4CICA 4BAYA 3TO7A 1J9IA 1Z21A 4ZTJA 2BY1A 2R7XA 2JVHA 3GBGA 2I8DA 3O3KA 3OV8A 1NK2P 3F23A 2KRFA 3IUOA 2ELJA 5CVVA 3VYUB 2CWEA 2IGMA 4UHTA 3FZVA 3CDHA 2JPBA 2ZSIB 5H6QA 1BI2A 3Q9VA 1IRZA 4U0YA 1X2MA 4BHPA 1MBKA 4RB2C 2X6YA 1P4XA 1MDMB 2VE8A 3A1YA 5DYMA 1YJWI 3LA3A 3HOWJ 5GP9A 2LD5A 5DCMA 4W97A 1IV8A 4IEJA 4A3MJ 3BDDA 1A5JA 2ZO4A 2JQ7A 2K9NA 4ENJA 1VQKI 1IN7A 3MVPA 4XOPA 1R4NB 9ANTA 2HOAA 1BM9A 4Y4RA 3RCOA 1J59A 1SANA 4CUGA 3M1EA 4UUTA 2BEOA 3DPTA 1TLHB 4ZZDA 5E3NA 4Z2YA 3I59A 2CW7A 3C2GA 3R0JA 1VQOI 2DOAA 4HV5A 1GV5A 4HW0A 3JTHA 2E34A 3Q3SA 2M30A 2FBHA 2CV1A 2CFOA 4FASD 2KIUA 3KZZA 2KIQA 2V1XA 3RIRA 2DBBA 1R1UA 2H09A 1A36A 5E8GA 3DCFA 4ZTFA 1OCTC 3DLAA 1F36A 3P9IA 3RPQA 3KYLA 4M9ZA 3ZQFA 3GX4X 2DT5A 4ZJZA 2P8TA 2L7KA 3DFGA 1W36D 1BW5A 1SFXA 2QBYA 3H1CA 1FOKA 4KIFA 2YU3A 5ILSA 4YG2F 1YJNI 3Q0UA 2A68F 2ID3A 3WTZA 2Z99A 5F27A 1T56A 1UG0A 5J47A 3IC7A 1OYIA 2VT2A 3WTWC 2CQNA 1BJZA 1MBHA 1VZ0A 2XAJA 1R49A 2F5EA 4IHYA 3BPVA 2LREA 5AIQA 2OA4A 3H9GA 1B9NA 1BIAA 3OYBA 4IX7A 2PG4A 2HQRA 4KMUX 2JA7J 1QVUA 3DBLB 4BEHA 3DPUA 4A3GJ 1H9TA 4D1QA 3DTEA 5HVQC 2GZWA 3A02A 2IS2A 2KZGA 1Z3YA 2QQBA 3WHBA 5M5YJ 2QQ8A 3I4NJ 1OLTA 2HZDA 4BE1A 4EVIA 4IRHA 2QKMB 5E1WA 2ZSHB 3WU1B 3C18A 1E0EA 1RUNA 1P92A 4HOBA 2WY8Q 4BQNA 4B47A 4YFXF 3HRTA 1PDNC 1XG1A 4M71A 1D3YA 2QSHX 5IT3A 1Z67A 2D45A 5DD8A 2HYFA 4C3JJ 3LSRA 3V8JA 2LY1A 2VXZA 3BG5A 3COAC 3GTLJ 4ON0A 5CJ9A 1JE8A 2BGCA 2DQRA 4DBRA 5FGMA 5LHIA 3ZMDA 4IL6C 3CUQA 4HPQA 4PJ0C 3HSEA 2EA4A 2LK2A 1OR7A 4XLFA 2FA5A 4MO7A 5FRMA 4UB6C 1D8JA 4I01A 1Z05A 3VSLA 4O6JA 3H92A 4L5JA 3C1DA 2BVMA 4RBOA 2KFDA 2E19A 2M0CA 2QQAA 3LSPA 3TDUC 2P7CB 4D7NA 3S32A 1ZGJA 1XGSA 1B8IA 4MEYF 3BG3A 1D0YA 3O8GA 4DYRA 3S15J 2MLGA 2E1CA 3I54A 2B63J 1BIBA 1JKRC 1LDKB 1X1AA 2EWNA 5BPIA 2QLZA 2JT1A 3I59B 1ETQA 2LFBA 3VSKA 4QWQA 3MN2A 4AM3A 1LEBA 3RQIA 1I50J 1U5TA 2HXIA 1YIJI 1X1DA 3A03A 4M73A 1BC7C 3ULQB 1RI7A 2L7MP 2V6CA 3VYSB 2E60A 1JKPC 2EV0A 2E2IJ 2Z33A 5D4SA 1FIPA 3ZRGA 2XAHA 4IOCF 2KISA 4XKVA 1BI0A 1S6LA 2GXGA 2Y9YA 2M8EA 5LD2C 3EYYA 1TQMA 3QAHA 2X48A 5IP6A 3U1DA 2JPCA 3QPTA 4BNCA 3CJNA 2QBYB 2E7XA 3REOA 4LLGF 1OJLA 3OL4A 4KN4X 4V2FA 5GTHC 4KISA 3R4KA 2DJIA 5C4JJ 5F6FA 2FEZA 1O3SA 4ENKA 3FX3A 1LDJA 4L0YB 1UZCA 1U2WA 2MFZA 1J7KA 2VL8A 2L2OA 1J09A 3PSFA 3D1NI 2HEOA 3LSTA 1S7EA 5IOZA 3F72A 2ZJ2A 1ZRCA 4BEHB 5JLWA 3K2ZA 3LAJA 1FYKA 2DI3A 4ZC3A 3V8LA 5FFXA 3ZQCA 3BQYA 2EV5A 3HL2A 2QWWA 2XSDC 2ZKZA 5M3MJ 4LG0B 2DMQA 5KVRA 4FE7A 4B48A 2FUG2 3DEUA 3CO6C 1V5GA 3WE2A 3WTXC 4HLXA 2K27A 1JI8A 2M5WA 4QLCU 4P5OA 2XAGA 5D8KB 4V19K 3FXUA 1XN7A 2E1MB 2WAFA 3T0YA 1KU9A 4A3BJ 4B1RA 3FKIJ 5GPAA 2DFEA 3GLXA 4RLFA 4KFCA 5IT9K 1OQYA 3B6AA 1S7AA 4GCVA 1GUUA 3J7AO 2DTZA 5IP9J 5FLVA 3K1MA 2GXAA 1W1WE 1P2FA 3GTMJ 5FLXK 1X1CA 3V7SA 5TRDA 4XKCA 2ACJA 3GTQJ 3SFZA 4XORA 1VFCA 4L9NA 3UNGC 1B9MA 2HWVA 5ICEA 2COBA 4XONA 3BJOA 3NEUA 1HXDA 1W0UA 2KJBA 3HRMA 4L9VA 4UVAA 1T0FC 5F08A 2M9HA 2F2EA 2HKOA 1AWCA 4KNYA 2WADA 1IC8A 3IH2A 1PUEE 3HBLA 4M72A 3OYCA 5LGNA 1A35A 3EUKL 4Y3OA 4A93J 2V9VA 3FXRA 4EEFG 2KIFA 1WI3A 1O3TA 3SYTA 3VOEA 2R5ZB 2A6EF 4EJUA 5HNFA 5FKOA 1IRGA 4E7HA 1ETVA 2F5FA 1ACIA 4JX4A 1MD0A 2JSPA 2HQNA 1TT0A 3KEOA 3OIPA 2Y0MA 4BY1J 3BG9A 3IKVA 4JX5A 1W0TA 2VKHA 3LQQA 2XVCA 1Q1HA 4GYIA 3I0TA 1SFKA 1LVAA 2W00A 4M74A 4BGDA 3EUAA 2L3DA 1DDNA 3X2QH 2FQ4A 2FNAA 3JRIA 3R6SA 4KIBA 3KX2A 2IGNA 2ZJRF 1T08B 4OU0A 3OYGA 1O57A 5HS7A 2HTJA 1LDDA 5F64A 4HF1A 1MSFC 1MBFA 3BTIA 3RKQA 4J19A 3GZ5A 5GADJ 2ME0A 1XGNA 3PUFA 1PP7U 2X6WA 2EJRA 2QVOA 3Q0VA 5FO5A 3K9TA 4XLAA 1LFUP 3WTVC 2OTLI 4NUBA 5FLMJ 1D1AA 1NG6A 3QYEA 1ZTRA 2CFXA 1G3SA 4OIRF 4B09A 4CCOA 3HTSB 4X6AJ 4IO9F 4Y13A 5A2QZ 3OIOA 3CLQA 2DA1A 5B5EC 4Q5SF 1HW2A 3H5NA 3BTLA 1MJ9A 5KAFC 5D6EA 3IKTA 4FISA 1MMSA 3HOVJ 4BJ5C 5HLHA 1I6XA 3D5LA 2MC4A 3ABTA 4UV9A 2W25A 4I76A 2BV6A 4GXOA 5HDGA 1IRFA 1FC3A 2R7QA 2XGEA 3JRHA 2DDAA 2BHYA 4NHJA 1ERDA 3TW7A 2HQ5A 1PUFB 4XR6A 5L3CA 3FM5A 3TL4X 4C3HJ 3CZ6A 1N25A 4HLYA 3WU0A 4F93B 1G3YA 3SJMA 1E3OC 4UVCA 2YX7A 5CVIA 4PJLA 2D1HA 2P0WA 2JK3A 2GAUA 5HNHA 3DQVC 3F8NA 4QPOA 2HS5A 1WWXA 4MTDA 1SAUA 2HDCA 4E7IA 2OZ6A 1FYMA 1MGTA 3ZP5A 1W5CC 2XGDA 3OOUA 3DEEA 3VB2A 2I10A 4I0AA 2QSGX 2X1DA 1X4OA 2JUGA 2NOJB 2L9SA 2FOKA 5C4XJ 2VKVA 3DBHB 2DMUA 2VN2A 2VQLA 5HOOA 1Z1DA 4LB5A 5E17F 4B3AA 1VQPI 2VXDA 1VQ6I 3ZMVA 3OYEA 2M34A 3BPXA 1SVLA 2F4IA 2WB1A 1OCPA 3FMSA 5BS6A 2E1OA 2HVQA 3O6BB 2O7OA 3LMMA 3RPUD 3M8JA 3DKXA 4ANJA 4FTHA 3GTOJ 1IV6A 2Q1ZB 4UV8A 1IRXA 2GIZA 3OMYA 2XASA 1XDUA 2J5OA 2HNHA 1QGPA 1T98A 2DW4A 1ZH5A 2IBDA 4XN0A 5DD4A 1WSUA 1OPCA 4NNJA 4Y7NJ 2GM4A 1XCBA 1WCMJ 2TCTA 3VDXA 1FX7A 2X6OA 2B9SA 2HOSA 2OPTA 2W24A 4H0EA 1XB4A 2OBPA 2DFFA 2P4WA 1T38A 2WB1N 2Z16A 2RQQA 5L3BA 5H2FC 5ERIA 2R5YA 3ASNH 1ETYA 4E70A 4BXXJ 3ZPLA 2YUSA 3I55I 1FNNA 2WWYA 3WGIA 1YI2I 3W6VA 1R5ID 3CD6I 3AG1H 2KDOA 3BQZA 1IGNA 2VBYA 3QQAA 2M4GA 1TWGJ 3I58A 3VYRB 3GXOA 5E3OA 2CV2A 1ZRDA 3H35A 4KA4A 1Y39A 1HKTA 2A6TA 3ABKH 4N9IA 4PGHA 3ZQQA 4OIOF 4RAFA 3K2AA 2IGOA 3KFWX 1KYWA 4NC8A 2XUBA 5B3SH 1RR8C 3N05A 4UVBA 2BHZA 4MIMA 2HQAA 3QP5A 1QO0D 1ENHA 3CMEI 3PO3J 1USSA 1IN4A 1JUMA 1YW8A 1HW1A 3S16J 1YHQI 1VNDA 1VQ4I 2RN7A 4S0HB 1JUSA 2ISYA 1HDPA 1UMQA 5L3GA 2RKHA 1QPIA 3F0CA 4QTRA 1FP2A 3OL3A 4XLEA 4Y52J 2D1VA 4R79A 1ZQ3P 3MKZA 4LB6B 1R00A 3DXJF 2NVYJ 2LKPA 4NQWB 1UAAA 2Q2EB 2VBXA 3TKYA 2EFQA 1ZREA 2QUFA 3CCLI 4OAZA 4A3IJ 1WJAA 1Z7LA 1LE8A 2LLKA 3BROA 4C9YA 1MBJA 2FQ3A 1MJBA 4HX4A 2L9VA 2XF6A 4Q47A 2KL4A 4MQVA 4YIFA 1VTNC 2VQGA 3D0SA 4PJMA 1GV2A 4M3EA 4AUXA 1B72A 5CVJA 4AU7A 3K4BA 2R7TA 1YQAA 2HYGD 3J80K 2E35A 4D9JA 4GGGA 3HXLA 3T8RA 4IXAA 2DA3A 2FXAA 4LOCA 5EJCA 3L09A 3GCMA 2F6CA 2CGPA 2V79A 2L9RA 3HYIA 3JRAA 2PMZA 3M8FA 3MFKA 1S29A 5M5WJ 2VBZA 2D5VA 5FJ8J 3W6JB 3BCAA 1V5FA 2P6TA 3P9KA 5GPCA 2WA0A 3FK6A 3K1PA 1TC3C 2ZFUA 1IW7F 3TOAA 4BQQA 2CSOA 4M3BA 2RVCA 1VQ8I 3V8KA 3GZ6A 1ZN2A 2L0KA 3SQNA 2IT0A 1K6YA 4XN3A 2XPVA 4RGRA 1B59A 4OOIA 3GFJA 4PSXA 2CO5A 2VKDA 2QGUA 3DTIA 3BR5A 2R5YB 2PEXA 4C30A 2EZHA 1YRNA 1FMVA 3RZOJ 3ABUA 3W2VA 4A6DA 1XGMA 2UWMA 3MMYB 2PMZN 4B4CA 4ZYHA 3M07A 3FISA 4UXNA 5EG0A 1JT0A 2AS5F 4I99C 1QZZA 3E0JB 2IA1A 2BZTA 1PJRA 2ZB9A 2JUCA 3BZKA 3H3UA 3GMEA 4ESBA 3V7RA 5IY5H 3DBRB 4BS9A 4MFEA 3FMRA 4ENMA 4A3LJ 1MH4A 4RB0A 5D5UB 3S2DJ 1WQ2A 2G7UA 3TP0A 1B1BA 3J7YJ 4MFDA 1OMIA 3U21A 5FD5A 3ZXSA 1Z91A 1U78A 3DV8A 3OOPA 4DNCA 3TOBA 2XAUA 3PM1A 2IS4A 1VI0A 2O61A 3JRGA 3KLNA 2DPDA 1E17A 4BDZA 3M7GA 1UJ8A 3IV5A 1WPKA 4QSHA 5GAGJ 2MLKA 3DF8A 4CZCA 2NVTJ 2OQGA 2OCCH 4E7KA 4A3KJ 1R9TJ 1SC7A 1XSXA
chains in the Genus database with same CATH topology
2Z2SB 3OR1C 5KCMA 3OYAA 1MW7A 2L9NA 3ZGKA 2AQFA 3TMOA 3ZRGA 3DWLE 4XKVA 2IGKA 2KQRA 3QOEA 2X1EA 4F55A 2L5QA 2VB6A 3SEQA 2XC7A 5LD2C 4XL9A 4IQJA 1WJFA 2LBFB 1D0ZA 2IXSA 4U87A 2O5RA 3A4CA 4X0GA 2JVGA 4KISA 2M3AA 3OL4A 4J01A 2DJIA 2GOMA 3L2UA 3EUHC 2M7AA 2CH0A 2MFZA 2V9KA 3AFHA 4XLCA 1G8XA 2VL8A 2X51A 2XF5A 2L2OA 4RM3A 1J09A 3PSFA 4U7BA 2WBMA 3J7AY 2K9MA 2X1CA 4P1WA 4G6TB 3KEYA 4BEHB 3LSMA 2VIXA 4ZC3A 3HL2A 3K4KA 2CV0A 3FKJA 2R7OA 1AA7A 4B48A 4BDYA 3OYJA 2FUG2 1V5GA 4HEA2 2LYCA 3FDYA 2UUZA 1JI8A 2BVLA 2UV1A 4XMYA 4P5OA 3QYFA 4DJAA 2E1MB 2K9LA 2WAFA 2KRCA 3OWTA 4RLFA 3UR3C 2AQEA 3IP4B 3LSHA 3H0DA 3HOSA 1WJCA 3BG7A 1G59A 1P9QC 2PJRA 3TBIA 1X1CA 4KITB 1T95A 2KMUA 4XKCA 2V6EA 4XORA 5KNLA 3QODA 3D5SC 3UNGC 4BACA 4XKBA 3K4MA 1NG7A 4XONA 3L2RA 4FETA 3W3CA 3MKWB 3L2VA 4HNUA 3HOTA 2VPLA 2R7VA 1T0FC 3K70C 4E7ZA 2WADA 3ZR8X 1BR2A 1Y6IA 4Y33A 3OYCA 3EUKL 4Y3OA 3L2QA 2OUMA 2X85A 2W82A 5JHFA 2KRHA 3C2HA 3SYTA 1DGWY 5HNFA 3OS1A 4E7HA 3OR2C 2OC6A 5CQEA 2LRDA 4YEJA 3SDBA 5FROA 2JSPA 2Y0SA 1TT0A 3OIPA 4N4OB 4JQFA 3K4NA 2OV7A 1DP3A 3RTRA 1X19A 2VKHA 2ZXHA 2R7SA 3FHNA 4PJJA 3OS2A 4BGDA 1SFKA 2M7BA 2W00A 3OY9A 3EUAA 2DT6A 3DKYA 3NWTA 4HSTA 3VYTB 3KX2A 2IGNA 2CUJA 1QU3A 4JOMA 3OYGA 2HPIA 1WFXA 2VLAA 1MNEA 3PFYA 4E6KG 3QYBA 4F92B 1WJ5A 4RM2A 3AL0B 2V7FA 4F52A 1MMGA 2W4SA 3HUGB 2X6WA 4DIQA 1X1BA 4ITVA 3RQ4A 3M1CA 3H5RA 3K6GA 1PYVA 3ONQA 4XLAA 4NUBA 3PUBA 1D1AA 1NG6A 3QYEA 4BL0B 4GRIA 4CCOA 1N75A 4CCKA 2X6XA 3DPLC 1WJBA 4CCJA 3S93A 3SEZA 5FRNA 3K70D 2XDVA 3EPZA 2MABA 4II3A 4RLQA 4BU2A 3I9V2 2CW8A 3H5NA 3PSIA 2VJ4A 2VASA 4BJ5C 3BLYA 3D5LA 2MC4A 3LSIA 3PNYA 4BUPA 4EATA 2HPMA 2M4KA 4LITA 4LIUA 4PSWA 2R7QA 4CCNA 3BG6A 3CF2A 1ERDA 3BCBA 1BOBA 3MD2A 4XR6A 3TL4X 2LG4A 2PJRB 2E5NA 4AYBA 3CZ6A 3HPHA 3NWSA 2IS1A 4F93B 2WY7Q 2RNGA 1WJEA 2LY2A 4PJLA 1U0JA 2XSJC 4BE0A 2DXIA 1N78A 1TZLA 2P0WA 4RMNA 5HNHA 1KONA 3DQVC 4OAYA 2LOOA 4QPOA 4C2UA 2QKLB 1SAUA 2HU9A 1MNDA 2CUZA 4C2TA 3PL8A 4E7IA 3HKZA 4LIVA 3G2BA 1Y56A 3OOUA 4PUSA 2BW3A 2HDWA 3DEEA 2R7UA 4HRIA 1LFPA 1DGRM 3PNTA 2W7NA 4B43A 2X1DA 4J00A 1X4OA 2JUGA 2E1MC 2NOJB 2L9SA 2E5ZA 1YX3A 1QHHD 2VQLA 2VQCA 3W2WA 5HOOA 1ZELA 1MMAA 2VXDA 2R7WA 2RREA 3OYNA 4DGWB 3FBIB 3H9QA 3OYEA 2VJJA 1BR4A 2R7RA 5CPRB 3IAS2 5HLTA 3OYHA 2F4IA 2KZVA 2WB1A 2LC2A 2A5WA 2HVQA 4XLHA 3CP8A 3CP2A 3LL7A 3LMMA 3RPUD 3M8JA 4ZDPA 5LFAA 3DKXA 4ANJA 1YX5A 2KP6A 2M0MA 2MD0A 2K3PA 1IRXA 2Q1ZB 3OMYA 4IKFA 2IS6A 3W2AA 2HNHA 4KJZA 4XN0A 3CJQB 4NNJA 4ZDOA 2W1OA 4LG3A 1D1BA 2KLOA 2GOXB 3VDXA 2F5VA 3LSGA 3HC7A 4II2A 4BJTA 4CCMA 3SZGA 1LVKA 1EA3A 2Z16A 2RQQA 4CH7A 1W36C 4OWRB 4YRVA 1MMNA 2BOLA 3FBNB 1Z21A 4ZTJA 2KDOA 3V42A 2CS3A 2JVHA 3GBGA 2I8DA 4BXFA 4DOZA 3A2KA 2R7XA 2M4GA 1D0XA 3IUOA 2ELJA 3PJRA 3VYRB 2HVSA 3VYUB 3DTKA 4NC7A 2CV2A 2V4JC 2IGMA 4DBQA 2ZSIB 3H35A 3H9JA 2KPMA 3OIQA 2A6TA 3ZQQA 5CQGA 2IGOA 4NC8A 3N05A 2X6YA 2HQAA 2WAQA 5CKTA 3A1YA 3K4CA 4B44A 1WJDA 4IQ4A 3AKZA 1N77A 1D1CA 4H4KC 3F9KA 3OYFA 4XOPA 4Y4RA 3RCOA 2V1NA 4BE2A 3OL3A 4CUGA 4XLEA 3DPTA 2VJ5A 4R79A 3OYLA 3CJRB 4N4NB 3MKZA 1S9HA 4PK4A 4ZYAA 4QPQA 2CW7A 3C2GA 4E4HA 2BW3B 2DOAA 3OS0A 3DU5A 4NQWB 4XKWA 1UAAA 2Q2EB 3BC8A 1FMWA 3H5AA 4CCLA 2JA2A 2XF7A 4OAZA 2CV1A 2CFOA 1WJAA 1X4PA 4FASD 3OYDA 3E1SA 4YELA 1Z7LA 4HSRA 4C9YA 4ZTFA 3DLAA 4AVZA 3KYLA 2XF6A 3IAM2 2DCEA 2KL4A 4KT6A 2VQGA 4PJMA 3OYIA 1QHGA 4ZJZA 2LBFA 4AU7A 3L2WA 3K4BA 2L7KA 1W36D 2R7TA 4PFPA 4BJ6C 4D9JA 3HXLA 5KHDA 3HPGA 2F6CA 3DU6A 2KHMA 1UG0A 2PMZA 4F91B 1R6RA 4CSWA 1HA8A 2K5CA 3BCAA 1V5FA 1VZ0A 3MKYB 2WA0A 3PNVA 2LREA 3H9GA 4MLOA 3OYBA 1OR7C 4F3QA 2ZFUA 1V5EA 3VYSB 4BQQA 4IX7A 4XNFA 4BEHA 3DPUA 4IZZA 4D1QA 3CMMA 3DTEA 2VQHA 5HVQC 2IS2A 1Z3YA 1K6YA 4XN3A 4E7SA 1OLTA 2HZDA 4BE1A 4PSXA 2VKDA 3DTIA 3S3OA 2QKMB 2ZSHB 2ZXIA 4C30A 3OYMA 1E0EA 1FMVA 3K10A 3S3MA 2WY8Q 3W2VA 4B47A 4BQNA 2UWMA 3MMYB 3ZCOA 5TGTA 2Z1DA 1GLNA 3LSKA 4BQOA 4XM3A 1LKXA 1UELB 2LY1A 2DT7B 2VXZA 4PJNA 3E0JB 1PJRA 4HNTA 4DBRA 2LH9A 4HPQA 1MMDA 4E7LA 4CA0A 3VWBA 2V26A 3RSNA 4E7JA 4XLFA 5FRMA 4BS9A 3VSLA 3S3NA 2BVMA 3CESA 3K4JA 3S32A 1YE9A 3K4LA 3S8PA 1D0YA 3U21A 3D5RC 2VJIA 3ZXSA 4XOTA 1LDKB 1X1AA 3OYKA 2XAUA 1BR1A 2IS4A 1DQUA 4BDZA 3VSKA 2R4GA 4XQFA 2WAEA 2HVRA 1Z3XA 1X1DA 2MYSA 3HG9A 4PFOA 4CZCA 3LFUA 4E7KA 2CMPA 4ZDLA 4B3XA 3AL0C 4HG2A 3I3LA 2E60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9L A;  2K9M A; 
#chains in the Genus database with same CATH topology
 2Z2S B;  2STT A;  1LE8 B;  3OR1 C;  1SVM A;  2L9N A;  2AQF A;  1BOA A;  2AXT C;  3P9C A;  4ESF A;  2RDP A;  5ICC A;  3DWL E;  4F55 A;  2KQR A;  2X1E A;  4HDV A;  2XC7 A;  3SEQ A;  1CGP A;  3K7A J;  4HV6 A;  2PQ8 A;  1HDD C;  2R93 J;  2LR8 A;  2H8W A;  3FM3 A;  2EB7 A;  3ROU A;  3A4C A;  3KCC A;  5GTI C;  4X0G A;  3GEZ A;  3TO9 A;  2A05 A;  4EJW A;  4J01 A;  4EJV A;  4LLL A;  5K7Z A;  1GT0 C;  3SFI A;  1REP C;  1MH3 A;  5FD6 A;  1SD6 A;  2M7A A;  2FBI A;  1AKH A;  4I7H A;  3KIO A;  4A0Z A;  1G8X A;  1OCC H;  3BWG A;  3EQL F;  3HOY J;  2M8G X;  1MJA A;  2K9M A;  2ZC2 A;  3FWE A;  4AIK A;  3WGH A;  2ISZ A;  1E3H A;  2O8K A;  2QF7 A;  3ELK A;  2VBW A;  2Q0O A;  5HLI A;  2HTS A;  2CV0 A;  3JAM Z;  4WCG A;  1YRN B;  2ZCW A;  1L0O C;  5LRR A;  2R7O A;  5CYV A;  1V54 H;  3OYJ A;  1SD5 A;  1Z9C A;  1UFM A;  3S2W A;  2UV1 A;  3NRV A;  4UUV A;  4DJA A;  2KDZ A;  3G6E I;  3CCQ I;  2KRC A;  2Y48 A;  3S1Q J;  2VOO A;  4EGZ A;  3LFK A;  3EET A;  1W7P D;  3BT9 A;  3VFZ A;  2A3S A;  2C6Y A;  5E18 F;  2AQE A;  4MTE A;  5EGO B;  4UUS B;  3MZH A;  2DN0 A;  2RV8 A;  3ZMS A;  1WJC A;  4EV0 A;  3V4G A;  4BBS J;  4EJO A;  2EV6 A;  4BBR J;  2EIK H;  2DPU A;  4KIT B;  1KU7 A;  2KMU A;  4S04 A;  1FIA A;  2V6E A;  4Y15 A;  3W6K B;  2DO7 A;  2V1D A;  5KNL A;  3BZC A;  1ZRF A;  3D5S C;  2PJP A;  2CRG A;  1R5G A;  2BY2 A;  1Y1V J;  3L2R A;  2VPL A;  3KP4 A;  3L2V A;  2R7V A;  2GLO A;  4U88 A;  3K70 C;  5HDK A;  3RDI A;  2F48 A;  4G12 A;  2EA2 A;  2XPW A;  3TP3 A;  1XPX A;  3L2Q A;  3GFL A;  5B1B H;  1NTC A;  2OUM A;  1SEU A;  4WWC A;  1KYZ A;  2ZME A;  3EDP A;  5FKL A;  1ZGA A;  4M3G A;  5JHF A;  4RS8 A;  5EZH A;  1AOY A;  4A3E J;  5DCM B;  1F4K A;  4IRG A;  5J6X A;  4LK0 F;  1JXS A;  2F5C A;  1Z6R A;  3FMQ A;  5J40 A;  1LPQ A;  2Q8K A;  1UST A;  3JRC A;  5H20 A;  4ASN A;  1K78 A;  2PMU A;  4N4O B;  4JQF A;  4A12 A;  2GBY A;  3K4N A;  2EIJ H;  5ILV A;  3RTR A;  3HRS A;  3IRQ A;  1DP3 A;  3QU3 A;  2ZXH A;  4PJJ A;  1G6N A;  3OY9 A;  1T0F A;  2DT6 A;  3SZP A;  4HX7 A;  1Y0U A;  4UB8 C;  3VYT B;  3GFM A;  1IDY A;  3LWF A;  1BC8 C;  2IA0 A;  2CUJ A;  4JOM A;  3DLL F;  1GXQ A;  3TED A;  2CJJ A;  1WFX A;  2P5L C;  2XAF A;  1AKH B;  2EFP A;  1HBX G;  2PI0 A;  2DK5 A;  3C3W A;  4E6K G;  2M45 A;  4RM2 A;  4TV7 A;  2V7F A;  3S1R J;  2P5K A;  2H6C A;  4I98 B;  2RNJ A;  3RQ4 A;  1FLI A;  3H5R A;  1DU0 A;  1PYV A;  3PUB A;  3OSF A;  1ZK8 A;  2X6X A;  5J1Y A;  1VQN I;  3E6D A;  1D5V A;  3KZI C;  2EH3 A;  4EMS A;  3QPH A;  1W7P A;  1J0R A;  4RLQ A;  2QYO A;  4BU2 A;  4DZP A;  1OYY A;  4Z6Y A;  3A01 A;  3IWF A;  1XX5 A;  1TTY A;  4IPA A;  2DOE A;  3TGN A;  3BLY A;  4A5M A;  4FCY A;  2MC3 A;  5IYD J;  3MCZ A;  3HOZ J;  4BUP A;  1H8A C;  4LIU A;  1P4A A;  5EEG A;  3BG6 A;  2ZJQ F;  1JJ6 C;  5J1R A;  4IRI A;  4CYC A;  1BOB A;  3ZQH A;  1ZHF A;  4I02 A;  1UCR A;  3HPH A;  1VQL I;  5E3M A;  2IVM A;  2DMN A;  5DS9 A;  1WJE A;  1LB2 A;  5E20 A;  1GVJ A;  1N78 A;  4BYY A;  1SMT A;  5B1A H;  1RR7 A;  2DQL A;  1TZL A;  1SFU A;  2DOF A;  3B6C A;  1R1V A;  2JN6 A;  1TQP A;  4MGR A;  1ETO A;  3IRR A;  4C2T A;  1FBU A;  2FF4 A;  4AID A;  3CUQ B;  2BW3 A;  2ZME B;  1R58 A;  3HIF A;  1EKE A;  2B0L A;  1IAW A;  4HRI A;  1JUP A;  4B43 A;  4J00 A;  3CDL A;  1QQI A;  2E1M C;  1LFB A;  3BR6 A;  4X1E A;  3PQK A;  2H1L A;  2X4H A;  4M6Y A;  5D5W B;  2H6B A;  2VQC A;  1RZ4 A;  3KET A;  1B8I B;  1OIS A;  2NS0 A;  4AIH A;  2RRE A;  3OYN A;  1AHD P;  2QA4 I;  4HDU A;  2VJJ A;  3OSG A;  2R7R A;  5CPR B;  2W57 A;  2DA7 A;  2QEN A;  1UHW A;  5HLT A;  2UXN A;  4I09 A;  4O5V A;  2KZV A;  2LVS A;  4DYC A;  3O2P E;  2LC2 A;  1J2X A;  4DW6 A;  1K79 A;  3UKG A;  3CP8 A;  3LL7 A;  3SDG A;  1AU7 A;  4Q48 A;  3E5U A;  1FPQ A;  1U5T B;  1W5T A;  3J81 Z;  3JCU C;  2X9D A;  3W2A A;  3JRF A;  2EIL H;  3E6M A;  4IHS A;  1SD7 A;  2YS9 A;  1Z7U A;  1HST A;  2CQK A;  3CJQ B;  3KE2 A;  2EFO A;  1K4T A;  2OF7 A;  4LG3 A;  1D1B A;  3JRE A;  4EM2 A;  4FQG A;  3HC7 A;  3S2H J;  2EFW A;  2K02 A;  4FE4 A;  3SZG A;  1LVK A;  2G7H A;  2XRN A;  1F1Z A;  4R8H A;  4CH7 A;  2Y75 A;  3LOC A;  1W36 C;  1MMN A;  2O6G E;  2BOL A;  3FBN B;  2M2E A;  4XRS A;  3V42 A;  4DOZ A;  2K7L A;  3A2K A;  1W7P B;  2M1B A;  3U2R A;  1D0X A;  4HNV A;  5ICG A;  3PJR A;  1V55 H;  4G8X A;  2HVS A;  3DTK A;  4NC7 A;  2V4J C;  4DBQ A;  1LQ1 A;  3BP8 A;  3H9J A;  4KYW A;  4XIC A;  2KPM A;  4HQM A;  1SAX A;  2DFI A;  2RGV A;  5F1J A;  1SFE A;  4HQE A;  1YOV B;  4WX9 A;  1XMX A;  5CKT A;  2DU9 A;  2ETH A;  3ASO H;  3K4C A;  3Q9S A;  4B44 A;  4IVN A;  4IQ4 A;  3WG9 A;  2EQR A;  3KYC B;  3RKW A;  1WH5 A;  3ZMT A;  3AKZ A;  1DP7 P;  2BYV E;  4PDK A;  3CCS I;  3ESW B;  3OYF A;  4O3M A;  3H36 A;  2DMT A;  1O4X A;  1R4M B;  2UZK A;  1ON1 A;  2KT0 A;  3L7W A;  4KUM A;  2PFB A;  2ZJP F;  2V1N A;  5J4Y A;  4D5C A;  2VJ5 A;  5HDN A;  3OYL A;  3CJR B;  2Y9Z A;  1S9H A;  1YYV A;  1QVT A;  3BR3 A;  4QPQ A;  4PZJ A;  4E4H A;  2BW3 B;  3KP3 A;  2VC0 A;  3OS0 A;  2VE9 A;  3B73 A;  3DU5 A;  4XKW A;  2DA4 A;  1FMW A;  2JA2 A;  1O3Q A;  2JRM A;  2XF7 A;  2MGQ A;  3JRD A;  5JR3 A;  4OMY A;  1X4P A;  1XTA A;  3QPS A;  4M9X A;  4YEL A;  4CDG A;  4HF0 A;  2L54 A;  4AVZ A;  3RZD J;  2DCE A;  3LQR A;  1T6S A;  2K40 A;  1QHG A;  3NAR A;  2LBF A;  1K61 A;  4AC0 A;  2LP0 A;  3E3V A;  2HGC A;  1FT9 A;  4AIJ A;  2F4M B;  3DU6 A;  2ZFW A;  1K7A A;  1SVO A;  2FD5 A;  1RUO A;  1R6R A;  4CSW A;  3ECO A;  4HA8 A;  5EYR A;  1XS9 A;  4I2O A;  1HA8 A;  3KP5 A;  2K5C A;  2HOE A;  3MKY B;  3GYH X;  3R61 A;  1KU2 A;  3FIW A;  5K5R A;  4MLO A;  3I64 A;  4F3Q A;  1M1E B;  4I6Z A;  2WTE A;  5EEA A;  2GA1 A;  1I6H J;  1WI9 A;  2VQH A;  4OIP F;  2NAZ A;  1P7I A;  2BY0 A;  5IYB J;  1QBJ A;  2QSF X;  3S3O A;  2ZXI A;  3K10 A;  3S3M A;  5DUK A;  3CCV I;  2HYJ A;  3HB9 A;  1RRJ A;  4YII A;  3ZCO A;  5TGT A;  2Z1D A;  1ZG5 A;  1GLN A;  3LSK A;  3ZQI A;  4BQO A;  1UEL B;  2DJN A;  1QZY A;  3BY6 A;  2DT7 B;  1GXP A;  3FXL A;  3S1N J;  1EH7 A;  1I3Q J;  1X3U A;  5BNG A;  5BQT A;  1OCO H;  2LH9 A;  2W84 A;  4CZZ A;  5BPD A;  1MMD A;  5F0F A;  1FP1 D;  1HW5 A;  1Q1V A;  4E7L A;  3VWB A;  3FK7 A;  1KGS A;  2V26 A;  3RSN A;  4MNU A;  1MIJ A;  1YTY A;  3GTK J;  2E7W A;  3S3N A;  3CES A;  3MKL A;  2LKX A;  2DOD A;  3RKX A;  1YE9 A;  4AD9 A;  5FKK A;  1WH7 A;  3D5R C;  1QRY A;  4XRF A;  5D5X B;  1MKM A;  2ELH A;  1A04 A;  2O9L A;  4A69 C;  3WTT C;  3N97 A;  4JP0 A;  2N8G A;  3TW6 A;  3OYK A;  2XIG A;  2XGX A;  1BR1 A;  3E7L A;  1Y1W J;  1DQU A;  2VKE A;  4ESJ A;  3IH3 A;  3ZOB A;  1B4A A;  3TO6 A;  4P9U A;  4AWX B;  5BOX A;  3I56 I;  3GO5 A;  1FOY A;  4RAZ A;  1YS7 A;  3HEF A;  4RAG A;  2MYS A;  3HG9 A;  1H9G A;  1O3R A;  2IJL A;  4ZDL A;  3AL0 C;  3GUD A;  5HOD A;  3BTJ A;  4A3J J;  1ZYR F;  1U9O A;  2NRA C;  1GHC A;  1RIO H;  3LA2 A;  5KCM A;  3SXY A;  1Z0X A;  1ZKG A;  3L00 A;  3OYA A;  2PMH A;  2DYR H;  4IHV A;  4WXH A;  3QOE A;  2L5Q A;  2NS7 A;  2VB6 A;  2ZXJ A;  3ECH A;  4XL9 A;  4IQJ A;  4A3D J;  1WJF A;  2LBF B;  1D0Z A;  3P5J A;  1WRJ A;  2O5R A;  5EDN A;  3WOD F;  1I5Z A;  2M3A A;  5LGU A;  4P9F A;  2GOM A;  4G7Z F;  4CYD A;  3L2U A;  2GXB A;  3CMY A;  3EUH C;  4W1U A;  3BJA A;  1WZ2 A;  1X2N A;  3RI4 A;  2CH0 A;  2CW0 F;  2V9K A;  1QPM A;  2DAO A;  5ICF A;  4XLC A;  4CHU A;  3G1L A;  4ETS A;  1FEX A;  4RM3 A;  2XF5 A;  2TDX A;  5HS8 A;  2Z9O A;  3MEX A;  3VOD A;  1TWA J;  2X1C A;  4NBQ A;  2L7Z A;  3KEY A;  1P6R A;  2VOP A;  1G3W A;  2EK5 A;  2XRL A;  2R7F A;  3LSM A;  2ADU A;  3VPR A;  1SFO J;  1H88 C;  3M4O J;  2VIX A;  3O8H A;  1XSD A;  1JKQ C;  2YPR A;  2K4B A;  3MZY A;  2ME6 A;  4NB5 A;  1RKT A;  4FHT A;  3I71 A;  3HOU J;  3KYD B;  3WG7 H;  4GFB A;  1AA7 A;  4D7M A;  4DYQ A;  3BR1 A;  5LLQ A;  2HDD A;  1IUF A;  1XC5 A;  4HEA 2;  2A6H F;  5D8L B;  3FDY A;  4FT8 A;  2BVL A;  2EFN A;  4XMY A;  3GFI A;  3QYF A;  1X3W B;  2DK8 A;  1T8I A;  5JLX A;  2K9L A;  1RES A;  2XAQ A;  4A6E A;  2A5Y B;  3OWT A;  3WTY C;  4LMY A;  3HOS A;  1G59 A;  1QA6 A;  2ESH A;  2PJR A;  3TBI A;  3I53 A;  2HFH A;  3G4S I;  2Z5U A;  3FF5 A;  1FOX A;  1SD4 A;  3QOD A;  2ICW G;  2DA6 A;  4ZYG A;  4BAC A;  3K4M A;  1NG7 A;  2IW5 A;  2L4A A;  3E5Q A;  4FET A;  3MKW B;  4HNU A;  2VT3 A;  1RC9 A;  4JBA A;  3C7J A;  2M87 A;  2NNN A;  1HCR A;  4XRS G;  2MSY A;  3WGG A;  5J8C A;  1TL8 A;  2MW8 A;  1FTZ A;  2BY3 A;  1FBS A;  2X85 A;  2ECC A;  2W82 A;  5J8F A;  2XKO A;  2XHK A;  3WU2 C;  2AO9 A;  3F22 A;  2W85 A;  4V2G A;  2KRH A;  5FLX Z;  1DU6 A;  2B7E A;  1DGW Y;  3F21 A;  1GDT A;  1D8K A;  2YX4 A;  3OR2 C;  2H94 A;  1EH8 A;  2OZU A;  3F8M A;  3IH4 A;  1R36 A;  4YEJ A;  3CCJ I;  5FRO A;  1LNW A;  2Y0S A;  2AHQ A;  4C2M J;  5JHU A;  3M9A A;  2Y2Z A;  1YW7 A;  2LY9 A;  3WE3 A;  2R7S A;  3FHN A;  3OS2 A;  4UNO A;  4EM0 B;  2M7B A;  3NWT A;  2IPQ X;  4XSZ F;  3CQZ J;  4LJZ F;  1OKR A;  1X58 A;  1TWF J;  4PGG A;  1S8N A;  3KEQ A;  1WHU A;  5A2Q K;  1XMK A;  2Y31 A;  4A2U A;  1JGS A;  2HPI A;  2LF8 A;  3G1M A;  1EV7 A;  2VLA A;  3S1M J;  2K85 A;  3FXK A;  5DCF A;  2P6S A;  3GF2 A;  5DEQ A;  3CCU I;  1IXR C;  5LEK A;  2JA5 J;  2H1K A;  2IA2 A;  1WJ5 A;  3AG4 H;  4BHB A;  4WF2 A;  1T33 A;  2Y0S N;  3WTU C;  1S7O A;  3CC2 I;  1MMG A;  1EF4 A;  2W4S A;  3E97 A;  5IYC J;  3ZN1 A;  1NK3 P;  5HS9 A;  3TQN A;  4YFN F;  1B72 B;  3ZMZ A;  4JX6 A;  3FXO A;  4M6V A;  4M3F A;  2LSO A;  4A0Y A;  1X1B A;  4DIQ A;  4CO8 A;  3IHU A;  3ONQ A;  2JTV A;  2EPF A;  5HLG A;  1FWZ A;  2COM A;  1F9N A;  4L0Z B;  4GRI A;  3GZN B;  1N75 A;  3CJT B;  2YR2 A;  1TBX A;  3DPL C;  4MQ9 F;  1WJB A;  3S14 J;  2OCE A;  3HOX J;  3JRB A;  3SEZ A;  5FRN A;  1OCR H;  2XDV A;  3EPZ A;  2MAB A;  3BOQ A;  4II3 A;  4IOA F;  1Y8R B;  2XB5 A;  3IL2 A;  2EIM H;  1IF1 A;  1J5Y A;  3MWM A;  2VAS A;  3MZ8 A;  5K5O A;  2OAZ A;  3L2C A;  1TWC J;  3PNY A;  5ED4 A;  1ITY A;  2VI6 A;  2HPM A;  1R71 A;  1PP8 F;  4CCN A;  2V9P A;  3CF2 A;  4Q4Z F;  1U3E M;  5DV5 A;  3BCB A;  3CF5 F;  3MD2 A;  2O3F A;  5L3D A;  2PJR B;  4D0P A;  4G6D A;  3Q5F A;  2E5N A;  2IAI A;  3NWS A;  1ZR4 A;  1HF0 A;  2WY7 Q;  2RNG A;  2LY2 A;  1HC8 A;  2XSJ C;  3KLO A;  4BE0 A;  2DXI A;  1S5L C;  2K86 A;  1BN5 A;  2HR3 A;  1KON A;  2ZNY A;  4C2U A;  5EG0 B;  1F43 A;  5C44 J;  4BY7 J;  2A07 F;  1MND A;  2E2J J;  5EF6 A;  1IXC A;  1HSJ A;  3L1P A;  3R60 A;  4LIV A;  3M3Y J;  1Y56 A;  4PUS A;  1Z77 A;  3HGG A;  2ZBK A;  3HHG A;  3QWL A;  4S05 A;  1R23 A;  2Y69 H;  2R7U A;  3DKW A;  3PFI A;  2G0E A;  2EZL A;  2W48 A;  3GTG J;  3U1K A;  1YS6 A;  4ENN A;  1YX3 A;  1QHH D;  3A0H C;  1BI1 A;  4XBF A;  3W2W A;  2NOG A;  1FTT A;  4M9S A;  2OTJ I;  4IF4 A;  1VQ7 I;  1ZEL A;  2CU7 A;  3JR9 A;  3ERM A;  4XRM A;  2R7W A;  4DGW B;  3FBI B;  3H9Q A;  3LNQ A;  1BR4 A;  1TNT A;  2HZT A;  3IAS 2;  1UG2 A;  3OYH A;  3E5X A;  5E79 C;  5JFR A;  3ISP A;  1R22 A;  4IHT A;  4XLH A;  1BA5 A;  1WVR A;  3I4M J;  1IZ1 A;  2E71 A;  4WXC A;  4LG0 A;  1EH6 A;  1CQT A;  5H6R A;  1HOM A;  1G2H A;  1FSH A;  3FXQ A;  3CTA A;  4GO1 A;  3GTP J;  4IKF A;  1X1P A;  2IS6 A;  1A6I A;  4MEX F;  2JWT A;  1DUX C;  1SMY F;  2E1N A;  1ZAO A;  3BTC A;  4PCQ A;  2KLO A;  4RGU A;  1VQM I;  5K1Y A;  2F5V A;  3LSG A;  3P7N A;  2EZI A;  4II2 A;  1QNT A;  4BJT A;  3ML6 A;  1MNM C;  2CQQ A;  2R7D A;  1XCV A;  2ZNZ A;  4OWR B;  5KAI C;  1FJL A;  3G3Z A;  1KZH A;  1RNL A;  5LBQ A;  3E6C C;  4KDP A;  5DM6 F;  1XGO A;  4BXF A;  2CS3 A;  4A3C J;  1W5S A;  4RB1 A;  1IN5 A;  2X0L A;  2Z3Y A;  2TRT A;  2BXY A;  2QQ9 A;  1XSV A;  1ZAR A;  1KA8 A;  5LGT A;  2ID6 A;  4XID A;  5F04 A;  2DYS H;  5CVU A;  3JW4 A;  2MH2 A;  3OIQ A;  2JA8 J;  2CYY A;  3E6B A;  5CQG A;  1TP4 A;  1PVE A;  1ZR2 A;  1MBG A;  2JJ7 A;  5DUI A;  5CVR A;  2WAQ A;  3LA7 A;  1WJD A;  3ABM H;  2R5Z A;  5LHH A;  1N77 A;  1D1C A;  4H4K C;  3F9K A;  2J5P A;  1WKM A;  2PLY A;  1JTY A;  4NDL A;  3FXM A;  4BE2 A;  1JHF A;  2OQR A;  5DTD A;  4F7Z A;  4N4N B;  3F8C A;  4PK4 A;  1O7L A;  4ZYA A;  2NNY A;  2DFH A;  2MD5 A;  3SZT A;  3MAJ A;  4ZH4 F;  1JGG A;  2WAQ N;  2PN6 A;  3BC8 A;  1C0W A;  3QU6 A;  1YFH A;  3H5A A;  4CCL A;  4L9J A;  4A5N A;  2FE3 A;  2FU4 A;  3E1S A;  3OYD A;  1A31 A;  4I0B A;  2IRF G;  2JMW A;  4HSR A;  4L5I A;  2R0Q C;  5LEJ A;  2NXN B;  3IAM 2;  5J1U A;  4FX4 A;  4KT6 A;  3OYI A;  1YIT I;  1BL0 A;  4WK8 F;  4M6X A;  3L2W A;  1FBQ A;  3HTU A;  5M5X J;  1A6Q A;  1LEA A;  1BW6 A;  4HYE A;  4PFP A;  4BJ6 C;  5DDG A;  4BHC A;  5KHD A;  2FX0 A;  4DZJ A;  3HPG A;  1STZ A;  2KHM A;  2BXZ A;  3GWZ A;  4NC6 A;  1EJ9 A;  4QIW N;  3QP6 A;  3T5X A;  2DLL A;  2JSC A;  4F91 B;  3F6O A;  4A3F J;  3H3Z A;  3CUQ C;  4N9H A;  2QEX I;  3PNV A;  2FOW A;  2ZME C;  5LRS A;  4WXD A;  1OR7 C;  1V5E A;  1K78 B;  3QOP A;  4HAM A;  1FSE A;  2JZY A;  2VPR A;  4XNF A;  2D2W A;  4IZZ A;  3CMM A;  3A0B C;  2DTR A;  3J80 Z;  1PUF A;  4E7S A;  1YW9 A;  1OYW A;  2HKX A;  1ETK A;  2V1U A;  3OYM A;  1T2K A;  2BBY A;  3KP6 A;  3JTG A;  4XSX F;  4R1H A;  3KZY A;  1GVD A;  1HKS A;  1MBE A;  1K83 J;  2O8X A;  4JYK A;  4XM3 A;  1LKX A;  4BH9 A;  3AAF A;  1IXS B;  1ETX A;  3ZQG A;  4PJN A;  1KQ0 A;  4HNT A;  1V3F A;  1U5T C;  3VEP A;  4KN7 X;  3CCR I;  5L3F A;  1R7J A;  2GWR A;  3K69 A;  4CA0 A;  5GAH J;  3S17 J;  5FB2 A;  4E7J A;  2LNB A;  3ABL H;  1ZLK A;  1ZLJ A;  5C3E J;  2RQP A;  4IHX A;  2DDB A;  2P7V B;  2XGC A;  4RB3 C;  4L5E A;  2K4J A;  3K4J A;  4EM1 A;  1HLV A;  3K4L A;  3S8P A;  2EBI A;  1WGX A;  2A69 F;  5J4V A;  2PBI A;  2VJI A;  3A01 B;  4XOT A;  2QZ8 A;  2XPU A;  4KT5 C;  5JI6 A;  3HJE A;  3JSP A;  2FBK A;  1U9N A;  1XDS A;  1I1S A;  1RET A;  1H0M A;  4OMZ A;  4G9Y A;  2UXX A;  3DEW A;  2L7F P;  2R4G A;  4XQF A;  2WAE A;  2HVR A;  1Z3X A;  4XLP F;  4CYC B;  3R0A A;  4PFO A;  1JKO C;  2MG4 A;  2JRT A;  4KIC A;  1UB9 A;  3LFU A;  4LLN A;  2CMP A;  4HBL A;  4U0V A;  1P4W A;  4B3X A;  2LTP A;  4HG2 A;  3I3L A;  5ILU A;  1MSE C;  3KP2 A;  3HRU A;  5FFZ A;  1MW7 A;  1ETW A;  4B8X A;  3ZGK A;  3TMO A;  4P96 A;  1H89 C;  3H3V K;  1LUJ B;  5L3E A;  2VON A;  2IGK A;  2LMD A;  2K9Q A;  1VQ9 I;  3GW2 A;  2IXS A;  4U87 A;  2CUE A;  4L18 B;  3QRF F;  4IHW A;  1I27 A;  1ZG1 A;  2JVG A;  4RGS A;  3CCE I;  2GA2 A;  3JAM K;  4RA2 A;  2DA5 A;  1R5H A;  2NS8 A;  1LJ9 A;  3RYR A;  1XD7 A;  5EEH A;  3AFH A;  1I39 A;  3CDI A;  2HI3 A;  2X51 A;  2LDU A;  5J3L A;  4U7B A;  3J7A Y;  5FKN A;  2WBM A;  2R7Z J;  2IP2 A;  2H8R A;  2P5V A;  4P1W A;  4EGY A;  4G6T B;  1T39 A;  3HUG A;  4ZZL A;  1BJA A;  2FSW A;  3HSR A;  4ABZ A;  5E3L A;  3WHC A;  1VF9 A;  2O03 A;  3L9F A;  3CMA I;  3K4K A;  2XV4 S;  3FKJ A;  1KQ8 A;  3IWZ A;  2XB0 X;  3EYI A;  2PX9 A;  2G9W A;  1KQ9 A;  3BR0 A;  3NQO A;  5K7H A;  1V4R A;  4BDY A;  4BXU A;  3ZQL A;  4HX8 A;  2LYC A;  1DPU A;  1S72 I;  2UUZ A;  3TDZ C;  4C3I J;  3CC4 I;  2EZK A;  3Q0W A;  1K6O A;  4HF2 A;  2ESN A;  3EUH A;  4RGX A;  3V7C A;  4GDF A;  2FNP A;  4JK1 X;  2BE5 F;  4G7H F;  2A61 A;  2HXO A;  4HZF A;  4Y17 A;  3UR3 C;  3JSO A;  3IP4 B;  1B6A A;  3LSH A;  3PO2 J;  4G7O F;  3H0D A;  3RKY A;  4NQW A;  2Q2E A;  4GYG A;  3BG7 A;  2JA6 J;  1P9Q C;  1X3Z B;  1IDZ A;  3RYP A;  3F8B A;  2VC1 A;  3QPL A;  2P81 A;  5K5Q A;  2F4O B;  2FJ1 A;  1J75 A;  1T95 A;  1I3A A;  2FMY A;  5E1Z B;  1U8B A;  2NVQ J;  4XKB A;  5E1X A;  2CQ7 A;  1ULY A;  1O7F A;  3W3C A;  3HOT A;  1APL C;  1YIO A;  2O0Y A;  2GIV A;  4E7Z A;  3N4M A;  3ZR8 X;  1BR2 A;  1Y6I A;  2R92 J;  1RKW A;  4Y33 A;  3F6V A;  3ERE D;  4AVP A;  2XKP A;  5K7F A;  1NH3 A;  5GAE J;  1TWH J;  4FX0 A;  5EZG A;  1R1T A;  1CF7 A;  3C2H A;  5TJJ A;  3HSF A;  2AXL A;  3OS1 A;  2OC6 A;  5CQE A;  1E3P A;  2NVU B;  2CUF A;  2LRD A;  1ODD A;  3SDB A;  4EJT A;  1JHH A;  5DM7 F;  4OIQ F;  3HZJ A;  1ON2 A;  2OV7 A;  1RPW A;  3GVA A;  1X19 A;  5KK1 A;  4U0W A;  3CCM I;  2EIN H;  3PIO F;  4U7D A;  1U6G A;  2FRH A;  3DKY A;  3I5U A;  5D4R A;  1K4S A;  3H0G J;  4HST A;  2YSR A;  2H27 A;  4OIN F;  1UHM A;  2IEK A;  1ZGW A;  2KKO A;  3WTS C;  1QU3 A;  2L02 A;  2VUM J;  3NAU A;  5AIP A;  5BMZ A;  3CC7 I;  4XLN F;  4P55 A;  2WC2 A;  1E2X A;  1MNE A;  3PFY A;  1ONV A;  3QYB A;  4LGW A;  4F92 B;  1YG2 A;  1MZB A;  2LF7 A;  3HDD A;  4MHG A;  3ZN0 A;  1OCZ H;  3AL0 B;  4F52 A;  2I5U A;  3HUG B;  3RJP A;  5F1R A;  4N0B A;  1JJ8 C;  2CQX A;  3K0L A;  3U9G A;  1W4M A;  2YU9 J;  4ITV A;  3M1C A;  2ECB A;  3K6G A;  4LFU A;  4LK1 F;  1F5T A;  1YLF A;  2QM3 A;  3GLL A;  4BL0 B;  1YJ9 I;  1Y0N A;  2RAE A;  4CCK A;  5IPA A;  2WV0 A;  3CCY A;  4CCJ A;  3F3X A;  1HQC A;  3HGY A;  3S93 A;  4A0X A;  3KP7 A;  1IJW C;  2L4M A;  1FY7 A;  1NHA A;  3K70 D;  3I9V 2;  2CW8 A;  3PSI A;  3BR2 A;  1QZE A;  2VJ4 A;  2L01 A;  4G94 A;  3G1O A;  4EAT A;  3LSI A;  1IO2 A;  1Y8Q B;  2XRO A;  3MQ0 A;  3CO7 C;  2M4K A;  4LIT A;  3DP7 A;  4PSW A;  4M3D A;  1MDM A;  1YO5 C;  4BKX A;  2OD5 A;  4KMF A;  4K2E A;  2KIM A;  2F5D A;  1ORK A;  3LSJ A;  4YIR X;  1FOW A;  2LG4 A;  4CXF A;  1S3J A;  3K1N A;  4L9T A;  4AYB A;  4XK4 A;  2IS1 A;  1U8R A;  3PQJ A;  2E2H J;  2VOD A;  1U0J A;  5IP7 J;  2DMP A;  2Y30 A;  3ZMU A;  2K3F A;  4RMN A;  1BI3 A;  4OAY A;  2RC4 A;  2LOO A;  2QKL B;  1G3T A;  1XMA A;  1TW3 A;  2STW A;  5M3F J;  2ELK A;  3RPU A;  4RDU A;  2CG4 A;  2HU9 A;  5LHG A;  2CUZ A;  2LKS A;  3PL8 A;  5AON A;  1IG7 A;  1BBY A;  3M8E A;  3HKZ A;  3G2B A;  3J7Z I;  3G71 I;  2HDW A;  3F8F A;  5E8I A;  2K9S A;  2NYX A;  3LAP A;  4KIG A;  1LFP A;  2QCO A;  4DQ2 A;  1DGR M;  3PNT A;  2W7N A;  2GQQ A;  1CF7 B;  3SHF A;  1DPR A;  3J81 K;  4IJA A;  4AYB N;  1L3L A;  2E5Z A;  3FXJ A;  2MH9 A;  4D5F A;  1IUY A;  1I1G A;  1TNS A;  3GTJ J;  3AG2 H;  2FML A;  1TQI A;  2R3S A;  1MMA A;  3I4P A;  3PIP F;  3CUO A;  1IN6 A;  1JTX A;  3FHZ A;  2DA2 A;  1Z6T A;  1OFC X;  1FYL A;  3G73 A;  1JT6 A;  4G6Q A;  3ZQ7 A;  1IN8 A;  5IT9 Z;  5CLS A;  3C2B A;  3HKZ N;  4LD5 A;  2ZXW H;  4EQQ A;  2A5W A;  1TT5 B;  2HOT A;  2MBF A;  2MA3 A;  3CP2 A;  3T8T A;  4ZDP A;  2WV1 A;  5LFA A;  2NVX J;  1POG A;  1YX5 A;  5D6F A;  2KP6 A;  2M0M A;  2MD0 A;  2K3P A;  1UHS A;  1P7J A;  1TW2 A;  5JVT A;  4UY8 I;  3HM5 A;  1ZG3 A;  5F0C A;  4KJZ A;  5TIS C;  5D5V B;  1FZP B;  4YFK F;  1HKQ A;  5F0H A;  4ZDO A;  2E36 A;  2W1O A;  2OU2 A;  2KJC A;  2GOX B;  3T1B A;  3CLO A;  4CGZ A;  1KU3 A;  5B66 C;  4ZYD A;  5EGO A;  3BJ6 A;  4UUS A;  5IOY A;  5FKM A;  3AG3 H;  5JVG F;  4CCM A;  1VQ5 I;  3BZ6 A;  4BQA A;  3HHH A;  1EA3 A;  1D5Y A;  3B02 A;  3KPH A;  1G4D A;  6PAX A;  4YRV A;  4RAY A;  2OJE D;  4ZYE A;  4CIC A;  4BAY A;  3TO7 A;  1J9I A;  1Z21 A;  4ZTJ A;  2BY1 A;  2R7X A;  2JVH A;  3GBG A;  2I8D A;  3O3K A;  3OV8 A;  1NK2 P;  3F23 A;  2KRF A;  3IUO A;  2ELJ A;  5CVV A;  3VYU B;  2CWE A;  2IGM A;  4UHT A;  3FZV A;  3CDH A;  2JPB A;  2ZSI B;  5H6Q A;  1BI2 A;  3Q9V A;  1IRZ A;  4U0Y A;  1X2M A;  4BHP A;  1MBK A;  4RB2 C;  2X6Y A;  1P4X A;  1MDM B;  2VE8 A;  3A1Y A;  5DYM A;  1YJW I;  3LA3 A;  3HOW J;  5GP9 A;  2LD5 A;  5DCM A;  4W97 A;  1IV8 A;  4IEJ A;  4A3M J;  3BDD A;  1A5J A;  2ZO4 A;  2JQ7 A;  2K9N A;  4ENJ A;  1VQK I;  1IN7 A;  3MVP A;  4XOP A;  1R4N B;  9ANT A;  2HOA A;  1BM9 A;  4Y4R A;  3RCO A;  1J59 A;  1SAN A;  4CUG A;  3M1E A;  4UUT A;  2BEO A;  3DPT A;  1TLH B;  4ZZD A;  5E3N A;  4Z2Y A;  3I59 A;  2CW7 A;  3C2G A;  3R0J A;  1VQO I;  2DOA A;  4HV5 A;  1GV5 A;  4HW0 A;  3JTH A;  2E34 A;  3Q3S A;  2M30 A;  2FBH A;  2CV1 A;  2CFO A;  4FAS D;  2KIU A;  3KZZ A;  2KIQ A;  2V1X A;  3RIR A;  2DBB A;  1R1U A;  2H09 A;  1A36 A;  5E8G A;  3DCF A;  4ZTF A;  1OCT C;  3DLA A;  1F36 A;  3P9I A;  3RPQ A;  3KYL A;  4M9Z A;  3ZQF A;  3GX4 X;  2DT5 A;  4ZJZ A;  2P8T A;  2L7K A;  3DFG A;  1W36 D;  1BW5 A;  1SFX A;  2QBY A;  3H1C A;  1FOK A;  4KIF A;  2YU3 A;  5ILS A;  4YG2 F;  1YJN I;  3Q0U A;  2A68 F;  2ID3 A;  3WTZ A;  2Z99 A;  5F27 A;  1T56 A;  1UG0 A;  5J47 A;  3IC7 A;  1OYI A;  2VT2 A;  3WTW C;  2CQN A;  1BJZ A;  1MBH A;  1VZ0 A;  2XAJ A;  1R49 A;  2F5E A;  4IHY A;  3BPV A;  2LRE A;  5AIQ A;  2OA4 A;  3H9G A;  1B9N A;  1BIA A;  3OYB A;  4IX7 A;  2PG4 A;  2HQR A;  4KMU X;  2JA7 J;  1QVU A;  3DBL B;  4BEH A;  3DPU A;  4A3G J;  1H9T A;  4D1Q A;  3DTE A;  5HVQ C;  2GZW A;  3A02 A;  2IS2 A;  2KZG A;  1Z3Y A;  2QQB A;  3WHB A;  5M5Y J;  2QQ8 A;  3I4N J;  1OLT A;  2HZD A;  4BE1 A;  4EVI A;  4IRH A;  2QKM B;  5E1W A;  2ZSH B;  3WU1 B;  3C18 A;  1E0E A;  1RUN A;  1P92 A;  4HOB A;  2WY8 Q;  4BQN A;  4B47 A;  4YFX F;  3HRT A;  1PDN C;  1XG1 A;  4M71 A;  1D3Y A;  2QSH X;  5IT3 A;  1Z67 A;  2D45 A;  5DD8 A;  2HYF A;  4C3J J;  3LSR A;  3V8J A;  2LY1 A;  2VXZ A;  3BG5 A;  3COA C;  3GTL J;  4ON0 A;  5CJ9 A;  1JE8 A;  2BGC A;  2DQR A;  4DBR A;  5FGM A;  5LHI A;  3ZMD A;  4IL6 C;  3CUQ A;  4HPQ A;  4PJ0 C;  3HSE A;  2EA4 A;  2LK2 A;  1OR7 A;  4XLF A;  2FA5 A;  4MO7 A;  5FRM A;  4UB6 C;  1D8J A;  4I01 A;  1Z05 A;  3VSL A;  4O6J A;  3H92 A;  4L5J A;  3C1D A;  2BVM A;  4RBO A;  2KFD A;  2E19 A;  2M0C A;  2QQA A;  3LSP A;  3TDU C;  2P7C B;  4D7N A;  3S32 A;  1ZGJ A;  1XGS A;  1B8I A;  4MEY F;  3BG3 A;  1D0Y A;  3O8G A;  4DYR A;  3S15 J;  2MLG A;  2E1C A;  3I54 A;  2B63 J;  1BIB A;  1JKR C;  1LDK B;  1X1A A;  2EWN A;  5BPI A;  2QLZ A;  2JT1 A;  3I59 B;  1ETQ A;  2LFB A;  3VSK A;  4QWQ A;  3MN2 A;  4AM3 A;  1LEB A;  3RQI A;  1I50 J;  1U5T A;  2HXI A;  1YIJ I;  1X1D A;  3A03 A;  4M73 A;  1BC7 C;  3ULQ B;  1RI7 A;  2L7M P;  2V6C A;  3VYS B;  2E60 A;  1JKP C;  2EV0 A;  2E2I J;  2Z33 A;  5D4S A;  1FIP A;  3ZRG A;  2XAH A;  4IOC F;  2KIS A;  4XKV A;  1BI0 A;  1S6L A;  2GXG A;  2Y9Y A;  2M8E A;  5LD2 C;  3EYY A;  1TQM A;  3QAH A;  2X48 A;  5IP6 A;  3U1D A;  2JPC A;  3QPT A;  4BNC A;  3CJN A;  2QBY B;  2E7X A;  3REO A;  4LLG F;  1OJL A;  3OL4 A;  4KN4 X;  4V2F A;  5GTH C;  4KIS A;  3R4K A;  2DJI A;  5C4J J;  5F6F A;  2FEZ A;  1O3S A;  4ENK A;  3FX3 A;  1LDJ A;  4L0Y B;  1UZC A;  1U2W A;  2MFZ A;  1J7K A;  2VL8 A;  2L2O A;  1J09 A;  3PSF A;  3D1N I;  2HEO A;  3LST A;  1S7E A;  5IOZ A;  3F72 A;  2ZJ2 A;  1ZRC A;  4BEH B;  5JLW A;  3K2Z A;  3LAJ A;  1FYK A;  2DI3 A;  4ZC3 A;  3V8L A;  5FFX A;  3ZQC A;  3BQY A;  2EV5 A;  3HL2 A;  2QWW A;  2XSD C;  2ZKZ A;  5M3M J;  4LG0 B;  2DMQ A;  5KVR A;  4FE7 A;  4B48 A;  2FUG 2;  3DEU A;  3CO6 C;  1V5G A;  3WE2 A;  3WTX C;  4HLX A;  2K27 A;  1JI8 A;  2M5W A;  4QLC U;  4P5O A;  2XAG A;  5D8K B;  4V19 K;  3FXU A;  1XN7 A;  2E1M B;  2WAF A;  3T0Y A;  1KU9 A;  4A3B J;  4B1R A;  3FKI J;  5GPA A;  2DFE A;  3GLX A;  4RLF A;  4KFC A;  5IT9 K;  1OQY A;  3B6A A;  1S7A A;  4GCV A;  1GUU A;  3J7A O;  2DTZ A;  5IP9 J;  5FLV A;  3K1M A;  2GXA A;  1W1W E;  1P2F A;  3GTM J;  5FLX K;  1X1C A;  3V7S A;  5TRD A;  4XKC A;  2ACJ A;  3GTQ J;  3SFZ A;  4XOR A;  1VFC A;  4L9N A;  3UNG C;  1B9M A;  2HWV A;  5ICE A;  2COB A;  4XON A;  3BJO A;  3NEU A;  1HXD A;  1W0U A;  2KJB A;  3HRM A;  4L9V A;  4UVA A;  1T0F C;  5F08 A;  2M9H A;  2F2E A;  2HKO A;  1AWC A;  4KNY A;  2WAD A;  1IC8 A;  3IH2 A;  1PUE E;  3HBL A;  4M72 A;  3OYC A;  5LGN A;  1A35 A;  3EUK L;  4Y3O A;  4A93 J;  2V9V A;  3FXR A;  4EEF G;  2KIF A;  1WI3 A;  1O3T A;  3SYT A;  3VOE A;  2R5Z B;  2A6E F;  4EJU A;  5HNF A;  5FKO A;  1IRG A;  4E7H A;  1ETV A;  2F5F A;  1ACI A;  4JX4 A;  1MD0 A;  2JSP A;  2HQN A;  1TT0 A;  3KEO A;  3OIP A;  2Y0M A;  4BY1 J;  3BG9 A;  3IKV A;  4JX5 A;  1W0T A;  2VKH A;  3LQQ A;  2XVC A;  1Q1H A;  4GYI A;  3I0T A;  1SFK A;  1LVA A;  2W00 A;  4M74 A;  4BGD A;  3EUA A;  2L3D A;  1DDN A;  3X2Q H;  2FQ4 A;  2FNA A;  3JRI A;  3R6S A;  4KIB A;  3KX2 A;  2IGN A;  2ZJR F;  1T08 B;  4OU0 A;  3OYG A;  1O57 A;  5HS7 A;  2HTJ A;  1LDD A;  5F64 A;  4HF1 A;  1MSF C;  1MBF A;  3BTI A;  3RKQ A;  4J19 A;  3GZ5 A;  5GAD J;  2ME0 A;  1XGN A;  3PUF A;  1PP7 U;  2X6W A;  2EJR A;  2QVO A;  3Q0V A;  5FO5 A;  3K9T A;  4XLA A;  1LFU P;  3WTV C;  2OTL I;  4NUB A;  5FLM J;  1D1A A;  1NG6 A;  3QYE A;  1ZTR A;  2CFX A;  1G3S A;  4OIR F;  4B09 A;  4CCO A;  3HTS B;  4X6A J;  4IO9 F;  4Y13 A;  5A2Q Z;  3OIO A;  3CLQ A;  2DA1 A;  5B5E C;  4Q5S F;  1HW2 A;  3H5N A;  3BTL A;  1MJ9 A;  5KAF C;  5D6E A;  3IKT A;  4FIS A;  1MMS A;  3HOV J;  4BJ5 C;  5HLH A;  1I6X A;  3D5L A;  2MC4 A;  3ABT A;  4UV9 A;  2W25 A;  4I76 A;  2BV6 A;  4GXO A;  5HDG A;  1IRF A;  1FC3 A;  2R7Q A;  2XGE A;  3JRH A;  2DDA A;  2BHY A;  4NHJ A;  1ERD A;  3TW7 A;  2HQ5 A;  1PUF B;  4XR6 A;  5L3C A;  3FM5 A;  3TL4 X;  4C3H J;  3CZ6 A;  1N25 A;  4HLY A;  3WU0 A;  4F93 B;  1G3Y A;  3SJM A;  1E3O C;  4UVC A;  2YX7 A;  5CVI A;  4PJL A;  2D1H A;  2P0W A;  2JK3 A;  2GAU A;  5HNH A;  3DQV C;  3F8N A;  4QPO A;  2HS5 A;  1WWX A;  4MTD A;  1SAU A;  2HDC A;  4E7I A;  2OZ6 A;  1FYM A;  1MGT A;  3ZP5 A;  1W5C C;  2XGD A;  3OOU A;  3DEE A;  3VB2 A;  2I10 A;  4I0A A;  2QSG X;  2X1D A;  1X4O A;  2JUG A;  2NOJ B;  2L9S A;  2FOK A;  5C4X J;  2VKV A;  3DBH B;  2DMU A;  2VN2 A;  2VQL A;  5HOO A;  1Z1D A;  4LB5 A;  5E17 F;  4B3A A;  1VQP I;  2VXD A;  1VQ6 I;  3ZMV A;  3OYE A;  2M34 A;  3BPX A;  1SVL A;  2F4I A;  2WB1 A;  1OCP A;  3FMS A;  5BS6 A;  2E1O A;  2HVQ A;  3O6B B;  2O7O A;  3LMM A;  3RPU D;  3M8J A;  3DKX A;  4ANJ A;  4FTH A;  3GTO J;  1IV6 A;  2Q1Z B;  4UV8 A;  1IRX A;  2GIZ A;  3OMY A;  2XAS A;  1XDU A;  2J5O A;  2HNH A;  1QGP A;  1T98 A;  2DW4 A;  1ZH5 A;  2IBD A;  4XN0 A;  5DD4 A;  1WSU A;  1OPC A;  4NNJ A;  4Y7N J;  2GM4 A;  1XCB A;  1WCM J;  2TCT A;  3VDX A;  1FX7 A;  2X6O A;  2B9S A;  2HOS A;  2OPT A;  2W24 A;  4H0E A;  1XB4 A;  2OBP A;  2DFF A;  2P4W A;  1T38 A;  2WB1 N;  2Z16 A;  2RQQ A;  5L3B A;  5H2F C;  5ERI A;  2R5Y A;  3ASN H;  1ETY A;  4E70 A;  4BXX J;  3ZPL A;  2YUS A;  3I55 I;  1FNN A;  2WWY A;  3WGI A;  1YI2 I;  3W6V A;  1R5I D;  3CD6 I;  3AG1 H;  2KDO A;  3BQZ A;  1IGN A;  2VBY A;  3QQA A;  2M4G A;  1TWG J;  3I58 A;  3VYR B;  3GXO A;  5E3O A;  2CV2 A;  1ZRD A;  3H35 A;  4KA4 A;  1Y39 A;  1HKT A;  2A6T A;  3ABK H;  4N9I A;  4PGH A;  3ZQQ A;  4OIO F;  4RAF A;  3K2A A;  2IGO A;  3KFW X;  1KYW A;  4NC8 A;  2XUB A;  5B3S H;  1RR8 C;  3N05 A;  4UVB A;  2BHZ A;  4MIM A;  2HQA A;  3QP5 A;  1QO0 D;  1ENH A;  3CME I;  3PO3 J;  1USS A;  1IN4 A;  1JUM A;  1YW8 A;  1HW1 A;  3S16 J;  1YHQ I;  1VND A;  1VQ4 I;  2RN7 A;  4S0H B;  1JUS A;  2ISY A;  1HDP A;  1UMQ A;  5L3G A;  2RKH A;  1QPI A;  3F0C A;  4QTR A;  1FP2 A;  3OL3 A;  4XLE A;  4Y52 J;  2D1V A;  4R79 A;  1ZQ3 P;  3MKZ A;  4LB6 B;  1R00 A;  3DXJ F;  2NVY J;  2LKP A;  4NQW B;  1UAA A;  2Q2E B;  2VBX A;  3TKY A;  2EFQ A;  1ZRE A;  2QUF A;  3CCL I;  4OAZ A;  4A3I J;  1WJA A;  1Z7L A;  1LE8 A;  2LLK A;  3BRO A;  4C9Y A;  1MBJ A;  2FQ3 A;  1MJB A;  4HX4 A;  2L9V A;  2XF6 A;  4Q47 A;  2KL4 A;  4MQV A;  4YIF A;  1VTN C;  2VQG A;  3D0S A;  4PJM A;  1GV2 A;  4M3E A;  4AUX A;  1B72 A;  5CVJ A;  4AU7 A;  3K4B A;  2R7T A;  1YQA A;  2HYG D;  3J80 K;  2E35 A;  4D9J A;  4GGG A;  3HXL A;  3T8R A;  4IXA A;  2DA3 A;  2FXA A;  4LOC A;  5EJC A;  3L09 A;  3GCM A;  2F6C A;  2CGP A;  2V79 A;  2L9R A;  3HYI A;  3JRA A;  2PMZ A;  3M8F A;  3MFK A;  1S29 A;  5M5W J;  2VBZ A;  2D5V A;  5FJ8 J;  3W6J B;  3BCA A;  1V5F A;  2P6T A;  3P9K A;  5GPC A;  2WA0 A;  3FK6 A;  3K1P A;  1TC3 C;  2ZFU A;  1IW7 F;  3TOA A;  4BQQ A;  2CSO A;  4M3B A;  2RVC A;  1VQ8 I;  3V8K A;  3GZ6 A;  1ZN2 A;  2L0K A;  3SQN A;  2IT0 A;  1K6Y A;  4XN3 A;  2XPV A;  4RGR A;  1B59 A;  4OOI A;  3GFJ A;  4PSX A;  2CO5 A;  2VKD A;  2QGU A;  3DTI A;  3BR5 A;  2R5Y B;  2PEX A;  4C30 A;  2EZH A;  1YRN A;  1FMV A;  3RZO J;  3ABU A;  3W2V A;  4A6D A;  1XGM A;  2UWM A;  3MMY B;  2PMZ N;  4B4C A;  4ZYH A;  3M07 A;  3FIS A;  4UXN A;  5EG0 A;  1JT0 A;  2AS5 F;  4I99 C;  1QZZ A;  3E0J B;  2IA1 A;  2BZT A;  1PJR A;  2ZB9 A;  2JUC A;  3BZK A;  3H3U A;  3GME A;  4ESB A;  3V7R A;  5IY5 H;  3DBR B;  4BS9 A;  4MFE A;  3FMR A;  4ENM A;  4A3L J;  1MH4 A;  4RB0 A;  5D5U B;  3S2D J;  1WQ2 A;  2G7U A;  3TP0 A;  1B1B A;  3J7Y J;  4MFD A;  1OMI A;  3U21 A;  5FD5 A;  3ZXS A;  1Z91 A;  1U78 A;  3DV8 A;  3OOP A;  4DNC A;  3TOB A;  2XAU A;  3PM1 A;  2IS4 A;  1VI0 A;  2O61 A;  3JRG A;  3KLN A;  2DPD A;  1E17 A;  4BDZ A;  3M7G A;  1UJ8 A;  3IV5 A;  1WPK A;  4QSH A;  5GAG J;  2MLK A;  3DF8 A;  4CZC A;  2NVT J;  2OQG A;  2OCC H;  4E7K A;  4A3K J;  1R9T J;  1SC7 A;  1XSX A; 
#chains in the Genus database with same CATH homology
 2Z2S B;  3OR1 C;  5KCM A;  3OYA A;  1MW7 A;  2L9N A;  3ZGK A;  2AQF A;  3TMO A;  3ZRG A;  3DWL E;  4XKV A;  2IGK A;  2KQR A;  3QOE A;  2X1E A;  4F55 A;  2L5Q A;  2VB6 A;  3SEQ A;  2XC7 A;  5LD2 C;  4XL9 A;  4IQJ A;  1WJF A;  2LBF B;  1D0Z A;  2IXS A;  4U87 A;  2O5R A;  3A4C A;  4X0G A;  2JVG A;  4KIS A;  2M3A A;  3OL4 A;  4J01 A;  2DJI A;  2GOM A;  3L2U A;  3EUH C;  2M7A A;  2CH0 A;  2MFZ A;  2V9K A;  3AFH A;  4XLC A;  1G8X A;  2VL8 A;  2X51 A;  2XF5 A;  2L2O A;  4RM3 A;  1J09 A;  3PSF A;  4U7B A;  2WBM A;  3J7A Y;  2K9M A;  2X1C A;  4P1W A;  4G6T B;  3KEY A;  4BEH B;  3LSM A;  2VIX A;  4ZC3 A;  3HL2 A;  3K4K A;  2CV0 A;  3FKJ A;  2R7O A;  1AA7 A;  4B48 A;  4BDY A;  3OYJ A;  2FUG 2;  1V5G A;  4HEA 2;  2LYC A;  3FDY A;  2UUZ A;  1JI8 A;  2BVL A;  2UV1 A;  4XMY A;  4P5O A;  3QYF A;  4DJA A;  2E1M B;  2K9L A;  2WAF A;  2KRC A;  3OWT A;  4RLF A;  3UR3 C;  2AQE A;  3IP4 B;  3LSH A;  3H0D A;  3HOS A;  1WJC A;  3BG7 A;  1G59 A;  1P9Q C;  2PJR A;  3TBI A;  1X1C A;  4KIT B;  1T95 A;  2KMU A;  4XKC A;  2V6E A;  4XOR A;  5KNL A;  3QOD A;  3D5S C;  3UNG C;  4BAC A;  4XKB A;  3K4M A;  1NG7 A;  4XON A;  3L2R A;  4FET A;  3W3C A;  3MKW B;  3L2V A;  4HNU A;  3HOT A;  2VPL A;  2R7V A;  1T0F C;  3K70 C;  4E7Z A;  2WAD A;  3ZR8 X;  1BR2 A;  1Y6I A;  4Y33 A;  3OYC A;  3EUK L;  4Y3O A;  3L2Q A;  2OUM A;  2X85 A;  2W82 A;  5JHF A;  2KRH A;  3C2H A;  3SYT A;  1DGW Y;  5HNF A;  3OS1 A;  4E7H A;  3OR2 C;  2OC6 A;  5CQE A;  2LRD A;  4YEJ A;  3SDB A;  5FRO A;  2JSP A;  2Y0S A;  1TT0 A;  3OIP A;  4N4O B;  4JQF A;  3K4N A;  2OV7 A;  1DP3 A;  3RTR A;  1X19 A;  2VKH A;  2ZXH A;  2R7S A;  3FHN A;  4PJJ A;  3OS2 A;  4BGD A;  1SFK A;  2M7B A;  2W00 A;  3OY9 A;  3EUA A;  2DT6 A;  3DKY A;  3NWT A;  4HST A;  3VYT B;  3KX2 A;  2IGN A;  2CUJ A;  1QU3 A;  4JOM A;  3OYG A;  2HPI A;  1WFX A;  2VLA A;  1MNE A;  3PFY A;  4E6K G;  3QYB A;  4F92 B;  1WJ5 A;  4RM2 A;  3AL0 B;  2V7F A;  4F52 A;  1MMG A;  2W4S A;  3HUG B;  2X6W A;  4DIQ A;  1X1B A;  4ITV A;  3RQ4 A;  3M1C A;  3H5R A;  3K6G A;  1PYV A;  3ONQ A;  4XLA A;  4NUB A;  3PUB A;  1D1A A;  1NG6 A;  3QYE A;  4BL0 B;  4GRI A;  4CCO A;  1N75 A;  4CCK A;  2X6X A;  3DPL C;  1WJB A;  4CCJ A;  3S93 A;  3SEZ A;  5FRN A;  3K70 D;  2XDV A;  3EPZ A;  2MAB A;  4II3 A;  4RLQ A;  4BU2 A;  3I9V 2;  2CW8 A;  3H5N A;  3PSI A;  2VJ4 A;  2VAS A;  4BJ5 C;  3BLY A;  3D5L A;  2MC4 A;  3LSI A;  3PNY A;  4BUP A;  4EAT A;  2HPM A;  2M4K A;  4LIT A;  4LIU A;  4PSW A;  2R7Q A;  4CCN A;  3BG6 A;  3CF2 A;  1ERD A;  3BCB A;  1BOB A;  3MD2 A;  4XR6 A;  3TL4 X;  2LG4 A;  2PJR B;  2E5N A;  4AYB A;  3CZ6 A;  3HPH A;  3NWS A;  2IS1 A;  4F93 B;  2WY7 Q;  2RNG A;  1WJE A;  2LY2 A;  4PJL A;  1U0J A;  2XSJ C;  4BE0 A;  2DXI A;  1N78 A;  1TZL A;  2P0W A;  4RMN A;  5HNH A;  1KON A;  3DQV C;  4OAY A;  2LOO A;  4QPO A;  4C2U A;  2QKL B;  1SAU A;  2HU9 A;  1MND A;  2CUZ A;  4C2T A;  3PL8 A;  4E7I A;  3HKZ A;  4LIV A;  3G2B A;  1Y56 A;  3OOU A;  4PUS A;  2BW3 A;  2HDW A;  3DEE A;  2R7U A;  4HRI A;  1LFP A;  1DGR M;  3PNT A;  2W7N A;  4B43 A;  2X1D A;  4J00 A;  1X4O A;  2JUG A;  2E1M C;  2NOJ B;  2L9S A;  2E5Z A;  1YX3 A;  1QHH D;  2VQL A;  2VQC A;  3W2W A;  5HOO A;  1ZEL A;  1MMA A;  2VXD A;  2R7W A;  2RRE A;  3OYN A;  4DGW B;  3FBI B;  3H9Q A;  3OYE A;  2VJJ A;  1BR4 A;  2R7R A;  5CPR B;  3IAS 2;  5HLT A;  3OYH A;  2F4I A;  2KZV A;  2WB1 A;  2LC2 A;  2A5W A;  2HVQ A;  4XLH A;  3CP8 A;  3CP2 A;  3LL7 A;  3LMM A;  3RPU D;  3M8J A;  4ZDP A;  5LFA A;  3DKX A;  4ANJ A;  1YX5 A;  2KP6 A;  2M0M A;  2MD0 A;  2K3P A;  1IRX A;  2Q1Z B;  3OMY A;  4IKF A;  2IS6 A;  3W2A A;  2HNH A;  4KJZ A;  4XN0 A;  3CJQ B;  4NNJ A;  4ZDO A;  2W1O A;  4LG3 A;  1D1B A;  2KLO A;  2GOX B;  3VDX A;  2F5V A;  3LSG A;  3HC7 A;  4II2 A;  4BJT A;  4CCM A;  3SZG A;  1LVK A;  1EA3 A;  2Z16 A;  2RQQ A;  4CH7 A;  1W36 C;  4OWR B;  4YRV A;  1MMN A;  2BOL A;  3FBN B;  1Z21 A;  4ZTJ A;  2KDO A;  3V42 A;  2CS3 A;  2JVH A;  3GBG A;  2I8D A;  4BXF A;  4DOZ A;  3A2K A;  2R7X A;  2M4G A;  1D0X A;  3IUO A;  2ELJ A;  3PJR A;  3VYR B;  2HVS A;  3VYU B;  3DTK A;  4NC7 A;  2CV2 A;  2V4J C;  2IGM A;  4DBQ A;  2ZSI B;  3H35 A;  3H9J A;  2KPM A;  3OIQ A;  2A6T A;  3ZQQ A;  5CQG A;  2IGO A;  4NC8 A;  3N05 A;  2X6Y A;  2HQA A;  2WAQ A;  5CKT A;  3A1Y A;  3K4C A;  4B44 A;  1WJD A;  4IQ4 A;  3AKZ A;  1N77 A;  1D1C A;  4H4K C;  3F9K A;  3OYF A;  4XOP A;  4Y4R A;  3RCO A;  2V1N A;  4BE2 A;  3OL3 A;  4CUG A;  4XLE A;  3DPT A;  2VJ5 A;  4R79 A;  3OYL A;  3CJR B;  4N4N B;  3MKZ A;  1S9H A;  4PK4 A;  4ZYA A;  4QPQ A;  2CW7 A;  3C2G A;  4E4H A;  2BW3 B;  2DOA A;  3OS0 A;  3DU5 A;  4NQW B;  4XKW A;  1UAA A;  2Q2E B;  3BC8 A;  1FMW A;  3H5A A;  4CCL A;  2JA2 A;  2XF7 A;  4OAZ A;  2CV1 A;  2CFO A;  1WJA A;  1X4P A;  4FAS D;  3OYD A;  3E1S A;  4YEL A;  1Z7L A;  4HSR A;  4C9Y A;  4ZTF A;  3DLA A;  4AVZ A;  3KYL A;  2XF6 A;  3IAM 2;  2DCE A;  2KL4 A;  4KT6 A;  2VQG A;  4PJM A;  3OYI A;  1QHG A;  4ZJZ A;  2LBF A;  4AU7 A;  3L2W A;  3K4B A;  2L7K A;  1W36 D;  2R7T A;  4PFP A;  4BJ6 C;  4D9J A;  3HXL A;  5KHD A;  3HPG A;  2F6C A;  3DU6 A;  2KHM A;  1UG0 A;  2PMZ A;  4F91 B;  1R6R A;  4CSW A;  1HA8 A;  2K5C A;  3BCA A;  1V5F A;  1VZ0 A;  3MKY B;  2WA0 A;  3PNV A;  2LRE A;  3H9G A;  4MLO A;  3OYB A;  1OR7 C;  4F3Q A;  2ZFU A;  1V5E A;  3VYS B;  4BQQ A;  4IX7 A;  4XNF A;  4BEH A;  3DPU A;  4IZZ A;  4D1Q A;  3CMM A;  3DTE A;  2VQH A;  5HVQ C;  2IS2 A;  1Z3Y A;  1K6Y A;  4XN3 A;  4E7S A;  1OLT A;  2HZD A;  4BE1 A;  4PSX A;  2VKD A;  3DTI A;  3S3O A;  2QKM B;  2ZSH B;  2ZXI A;  4C30 A;  3OYM A;  1E0E A;  1FMV A;  3K10 A;  3S3M A;  2WY8 Q;  3W2V A;  4B47 A;  4BQN A;  2UWM A;  3MMY B;  3ZCO A;  5TGT A;  2Z1D A;  1GLN A;  3LSK A;  4BQO A;  4XM3 A;  1LKX A;  1UEL B;  2LY1 A;  2DT7 B;  2VXZ A;  4PJN A;  3E0J B;  1PJR A;  4HNT A;  4DBR A;  2LH9 A;  4HPQ A;  1MMD A;  4E7L A;  4CA0 A;  3VWB A;  2V26 A;  3RSN A;  4E7J A;  4XLF A;  5FRM A;  4BS9 A;  3VSL A;  3S3N A;  2BVM A;  3CES A;  3K4J A;  3S32 A;  1YE9 A;  3K4L A;  3S8P A;  1D0Y A;  3U21 A;  3D5R C;  2VJI A;  3ZXS A;  4XOT A;  1LDK B;  1X1A A;  3OYK A;  2XAU A;  1BR1 A;  2IS4 A;  1DQU A;  4BDZ A;  3VSK A;  2R4G A;  4XQF A;  2WAE A;  2HVR A;  1Z3X A;  1X1D A;  2MYS A;  3HG9 A;  4PFO A;  4CZC A;  3LFU A;  4E7K A;  2CMP A;  4ZDL A;  4B3X A;  3AL0 C;  4HG2 A;  3I3L A;  2E60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...