2K9LA

Structure of the core binding domain of sigma54
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
KETVPYQIPYTPSELEELQQNIKLELEGKEQELALELLNYLNEKGFLSKSVEEISDVLRCSVEELEKVRQKVLRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase sigma factor RpoN
publication title Structure of the RNA polymerase core-binding domain of sigma(54) reveals a likely conformational fracture point
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2008-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1330 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2k9lA00
2K9LA 2K9MA
chains in the Genus database with same CATH superfamily
3PSIA 5IOZA 4P55A 4BE2A 3O3KA 2GIVA 2R7UA 2HPIA 3D5RC 1J7KA 3Q9SA 1W0UA 2XAJA 3QPSA 3OYAA 1AOYA 1RR8C 2NVYJ 2CQXA 1V5EA 4I6ZA 1WH7A 5B3SH 1AKHA 1IN8A 3PJRA 3I54A 3OSGA 3K4LA 3SFIA 1E3HA 1ZRFA 4KN7X 1NHAA 2VBXA 3BC8A 2CW8A 2FOKA 2P6SA 1IN7A 2HI3A 1XDSA 4I76A 2DA4A 2XKOA 3GUDA 4L9TA 4BXFA 3K1MA 5J4YA 4OOIA 5DUIA 3CCUI 1JE8A 1ZGAA 3HSRA 3MZHA 1Z6RA 2LG4A 2Q1ZB 4ON0A 4FETA 2FF4A 3AAFA 2M1BA 1F36A 2D5VA 1O7LA 2A07F 4F93B 5JR3A 4A3FJ 3JSPA 2VLAA 2V6CA 3BDDA 4DJAA 3TGNA 1MW7A 1XD7A 2FBKA 3QRFF 4WWCA 2MG4A 1PP8F 2E19A 2NVTJ 5IYBJ 3A0BC 1FOWA 2VBZA 3S32A 5J4VA 2WB1A 1U9OA 3BLYA 3HHGA 2R5YB 1IW7F 1ZELA 1PJRA 1XGMA 4II2A 4O5VA 1ETWA 1X1BA 2JUGA 2EWNA 3H36A 1KQ9A 2KIQA 3WTYC 2NOGA 3I0TA 3DP7A 2FX0A 2ESHA 1VZ0A 3M8JA 2FJ1A 5L3BA 3O2PE 3BTLA 4NC8A 3S3MA 4HPQA 2H09A 3GLXA 1B8IB 5F1JA 2I5UA 4LLNA 1HOMA 4U88A 2W00A 1QNTA 1SMYF 3QQAA 1LFPA 3VEPA 3DXJF 4OAYA 4UV8A 4MNUA 4LLGF 5IOYA 1S7AA 4IRIA 2F2EA 1DGRM 4O6JA 4XLNF 1VQ5I 4N4NB 4DQ2A 4XIDA 3S1RJ 1JGGA 4DYRA 4PGGA 1NTCA 3ZR8X 4IHYA 2JN6A 1ZG1A 3CCJI 3BJAA 1ZK8A 4B43A 4HZFA 1T56A 3EPZA 3HOVJ 2HYGD 1BL0A 1ZTRA 3PFIA 1QGPA 1R7JA 3I59B 2X1EA 3E97A 3NAUA 4GRIA 4XQFA 3F22A 2H27A 1IZ1A 4V2GA 5E3OA 1HW1A 4ABZA 2FQ3A 2K4JA 2EA4A 3J81K 1WJEA 2IS1A 1OCPA 1B9NA 4OMYA 4LK1F 1GDTA 1DP3A 2DJNA 3KYCB 2EIJH 1X2NA 4BHPA 3CC2I 2CFOA 2OF7A 2PMHA 4G9YA 4E7SA 3CCQI 2W4SA 4M6VA 2ICWG 5F1RA 2LMDA 2CSOA 2HDWA 2GA2A 2LOOA 1IC8A 2ETHA 1KU3A 2VBYA 4NQWA 2K9QA 3HUGA 5CLSA 3IKTA 4X6AJ 1OCOH 4OU0A 3F3XA 1Y0UA 3G3ZA 3LA7A 1Q1VA 2DK5A 3DEUA 4U0VA 1YITI 2UXNA 5F04A 2NXNB 3R4KA 2QQ8A 2E1CA 2Y2ZA 4CCKA 3IC7A 1MDMA 4XICA 3FXKA 3CCYA 3HPHA 3IRQA 2KMUA 1OLTA 4P9UA 2IGNA 2XAGA 3TL4X 2E2IJ 1EA3A 2OU2A 3EETA 3CCLI 5D4RA 4LFUA 2V9PA 2HQ5A 2NNNA 4LLLA 3RPQA 3CUQB 2OPTA 2E71A 3CJRB 4XSXF 1AHDP 2DMQA 2E7XA 4W1UA 2YU9J 3A4CA 2O5RA 4G6DA 4BDYA 3S17J 3HXLA 2G9WA 3PUBA 2WY7Q 3C3WA 1WKMA 3WGHA 4FE7A 2F4MB 4XLHA 5EDNA 3M1EA 3E5UA 2E34A 2F5CA 2P5VA 1FOYA 2EV5A 2KP6A 5CJ9A 2JA5J 1Y1WJ 1RZ4A 1P6RA 1KONA 1TTYA 2V79A 3ZQ7A 4OINF 4KMUX 2RREA 4G94A 3I56I 1FMWA 1B59A 1UG2A 4OIRF 5J3LA 4BH9A 2COBA 3OYBA 1YS6A 3ZCOA 2KKOA 3Q5FA 1BOAA 2DK8A 2XDVA 2DW4A 3AG1H 2EZIA 2Y9YA 1D1BA 2BHZA 3EUKL 4F52A 4QLCU 3BR2A 1JUMA 3BT9A 2YPRA 1RETA 2ECCA 4AIDA 3MMYB 3FX3A 1FTZA 4DYCA 3FBIB 3HRTA 1FWZA 2L4MA 1H89C 3IP4B 3FXOA 2AHQA 4HX8A 5EGOA 4IOAF 2D1HA 3FXQA 1XB4A 5H6RA 1K4SA 3K4MA 1X58A 2CH0A 1JTYA 2RAEA 3UNGC 1K78B 3DEEA 2KIFA 4F7ZA 1QPMA 3F0CA 1Z9CA 1IGNA 5E79C 5CVIA 3K2AA 1BA5A 4EEFG 1T08B 4DW6A 3ZMTA 1IV8A 4R79A 2DTRA 2CU7A 1PP7U 1WWXA 2IA1A 1RUOA 4FX0A 3E0JB 4EM2A 1B72A 2MLKA 1ZAOA 1I50J 2L02A 2X9DA 2OZUA 1E0EA 4PJMA 2CYYA 2ISZA 5BQTA 4AVZA 1MNMC 5LLQA 3AL0C 1ETYA 5B1BH 1A6QA 1L3LA 1IG7A 5FD6A 3IL2A 1KQ0A 2P4WA 1OPCA 2JVHA 5GAHJ 2XF5A 2W24A 3CLQA 5KCMA 3PSFA 3JRDA 1D1AA 4CO8A 4MTEA 1I6HJ 1V55H 3GFJA 4ENJA 4ZZDA 3A01A 5JFRA 5DTDA 1UFMA 1XMKA 2HQNA 1TBXA 1DGWY 2EILH 5E1ZB 5H2FC 2DMNA 1VNDA 2YSRA 4P96A 4RGUA 3TW6A 4HRIA 3WG7H 3QYBA 1K79A 3CTAA 3RQ4A 2HXOA 1W7PA 1OYWA 4MHGA 1AA7A 3PIPF 1RI7A 3GFIA 3TDUC 4XRFA 4RB1A 2F5EA 3BQYA 5HNFA 4J00A 5IT9Z 2LY2A 3RI4A 3G2BA 4IOCF 1G3WA 3OYGA 4BQAA 1MMSA 1MBHA 1OYYA 1P92A 3WHCA 4XLCA 4Y15A 3LSTA 4LB5A 3GZ6A 2EFOA 5M5YJ 3PQJA 2KIUA 2MH2A 1SC7A 1HQCA 4NB5A 2GZWA 5CQGA 4C2UA 2IGKA 1OJLA 3HKZA 1SD6A 1A35A 2XASA 3AFHA 4YEJA 2EV6A 2CG4A 2RDPA 5EJCA 1GVJA 3M07A 1USTA 2B0LA 2KRHA 2EZKA 1VF9A 2H94A 3BY6A 1GT0C 2DDBA 3ZMUA 2CV2A 3CCRI 3KE2A 1F9NA 1FTTA 3BCAA 2LYCA 3FMQA 4XKBA 4RM2A 4BEHA 4XKCA 4DYQA 1A31A 2O0YA 1FOXA 1XCVA 2FEZA 4XK4A 1CQTA 2AXLA 2FNAA 2HFHA 1WQ2A 2BE5F 2CWEA 2EPFA 1YJ9I 3PO2J 3KETA 3CCVI 4M3FA 4HW0A 3KX2A 2O9LA 4LJZF 2EIKH 2VB6A 4Q47A 3DV8A 3GCMA 3TMOA 1XN7A 5DDGA 1YO5C 2X1DA 4XR6A 4BYYA 2L0KA 4LIVA 4ENKA 2DFEA 5K1YA 2CW7A 3K2ZA 3J7ZI 1IF1A 3E3VA 3T5XA 3VPRA 3L2UA 2HGCA 1WCMJ 2XGXA 3QWLA 4NQWB 4CZCA 3S1MJ 1BC7C 3HUGB 1O3SA 3FM3A 1B9MA 1S29A 2P5KA 1QPIA 2PFBA 2DOEA 3ZQLA 2QVOA 5A2QK 3KCCA 2FU4A 3OYNA 1YJWI 2ZKZA 1BM9A 2B9SA 1MDMB 3HRSA 2NS8A 2DT5A 4IHXA 1J5YA 2G7HA 5EG0A 2LY9A 1WZ2A 3VYRB 5D5VB 1FLIA 2JRTA 3CUQC 3F9KA 1ETOA 4UUSB 1QBJA 3JR9A 5M5XJ 1Y8QB 1ZKGA 4NC6A 3ASNH 3ZQIA 3HC7A 3CMYA 1OYIA 5TGTA 4M6XA 1FSHA 2QGUA 1FBSA 3J81Z 2KZGA 4UY8I 2OBPA 3I4PA 1XDUA 5HDKA 3W2VA 3H3VK 2VASA 1IJWC 2EB7A 2I10A 4HF0A 1VQNI 5DYMA 1XGSA 2MW8A 5J40A 2EBIA 1H8AC 2XB5A 3TP0A 5ICFA 3DLAA 1ZGWA 4XRSA 3GFMA 3D5SC 1KYWA 1QVUA 1Y8RB 2VBWA 3ML6A 1B4AA 2DQRA 3E6MA 2Y75A 4FQGA 4ASNA 2NRAC 1OQYA 2QSFX 2XKPA 2DA2A 5KAIC 2DO7A 1ZG5A 3HEFA 1XSVA 2K9MA 5AIQA 2FNPA 4D9JA 1JJ8C 3S15J 2KZVA 2BV6A 2DDAA 5DV5A 5EYRA 4RAYA 3O6BB 1YW7A 4IZZA 4GYGA 2V6EA 4QSHA 3K6GA 3PO3J 2VJIA 2H8WA 5L3GA 3QPLA 4RMNA 2IAIA 4CH7A 3ECOA 4EVIA 1YRNA 1Z91A 5F0FA 3HZJA 3K69A 4S04A 3GYHX 4RA2A 1MH4A 1X3ZB 2W48A 2CRGA 1FNNA 2EIMH 4RBOA 3JRIA 1RIOH 1R49A 2VUMJ 1TZLA 1ON1A 3ABLH 4KIGA 5JLWA 4U87A 4CCLA 4HDVA 1CF7A 4MO7A 1VQOI 4LG3A 4XKVA 2E7WA 4KN4X 3S8PA 4EM0B 4Y13A 2J5OA 1YJNI 2PJRA 4C30A 5CVVA 4PJNA 2RVCA 3R61A 3FHZA 3ABMH 1LKXA 2QBYA 1IRFA 3V8LA 3V42A 1H0MA 2VPLA 1U78A 2IVMA 1LJ9A 3C7JA 1UCRA 4M3GA 3WODF 1STZA 1OKRA 5HDGA 1UHWA 2V4JC 2PI0A 4YRVA 2K4BA 3HRMA 2ZNZA 5KK1A 4IHTA 2JPCA 4EQQA 1JGSA 1WGXA 3QODA 2CFXA 1I1GA 1W5TA 4HG2A 3AG3H 3A01B 2HDDA 3DKXA 1TL8A 2PN6A 2K85A 2DMPA 3E6DA 3JRCA 2N8GA 2R93J 3DEWA 3S93A 3HOTA 2LR8A 3DKWA 3B6CA 3I3LA 2BY2A 1TC3C 1F4KA 2AQEA 3MKZA 3SDBA 1W7PB 1LNWA 4E6KG 3AG2H 1TT5B 2XF7A 4YG2F 4C3IJ 1O4XA 3OR2C 4X1EA 3MWMA 1ZYRF 4MEXF 4IHWA 4P1WA 1MNEA 5J1YA 3CDIA 2ZSHB 4RB0A 2M45A 3OYFA 1R71A 4CICA 4OIQF 2MABA 1B1BA 3BG6A 3IWFA 2ZFUA 3W6VA 4HSTA 9ANTA 1A6IA 2YS9A 3V8KA 1IAWA 4GFBA 2DCEA 2BW3B 1MBJA 4L5JA 3S2HJ 3QOPA 3V7CA 2GXBA 2Z2SB 4JX6A 4NHJA 3P5JA 3QP6A 1WSUA 1Z1DA 2COMA 1KU7A 4BNCA 3LMMA 3TQNA 5IYCJ 1NK2P 1S6LA 3DPTA 3CUQA 4FCYA 3IH4A 2BZTA 4BEHB 3GTQJ 1F1ZA 2OQRA 2EFPA 3JAMZ 1X1DA 1WFXA 3OYHA 1JKOC 1I5ZA 1WJAA 4JOMA 3RIRA 3DU6A 4RAZA 5B5EC 5GP9A 2UZKA 4RGRA 1JXSA 3NWTA 1TLHB 2OJED 3RKWA 2HOEA 3IKVA 1U2WA 3ROUA 3E6CC 2M5WA 4DNCA 3UKGA 4WXHA 3P9CA 4DIQA 3MD2A 2KIMA 2X85A 1HC8A 2X6OA 5E18F 3CCSI 3GTPJ 1PYVA 4AUXA 2ID3A 4ZYEA 1ZN2A 4A3EJ 1W1WE 3SZTA 4L9JA 4DBRA 2MSYA 4E7LA 1MZBA 2RQPA 4XLAA 1REPC 3PL8A 3RSNA 4WXCA 1D5YA 5TJJA 5LHIA 4Z6YA 1T39A 4EJWA 1YX5A 2IGOA 2LFBA 4IKFA 1MMAA 5B1AH 2E5ZA 5EEHA 3GZNB 1BW6A 2NOJB 1RUNA 1MKMA 3LQRA 1U9NA 2ZCWA 5EG0B 1IXRC 1G2HA 1KU9A 2A5YB 4UV9A 1H9GA 3FMSA 5EEGA 1U3EM 1K78A 3M9AA 3QU3A 3WHBA 4I0AA 5BPIA 1O3RA 2XRNA 2DXIA 1V5GA 3MAJA 4OIOF 5L3EA 4ESJA 2E1MC 3EDPA 3R60A 1R5ID 4B1RA 3JRAA 1TQPA 1UG0A 2QKMB 3O8GA 2K27A 4HQMA 4XN0A 1R23A 1X3UA 5FLVA 2W7NA 4IRGA 1JI8A 2DLLA 5B66C 2VC0A 3LA3A 4M9SA 1S5LC 3FXMA 3L7WA 4UB8C 1VQ8I 4JX5A 3AL0B 3RPUD 1CGPA 3FF5A 1JKPC 4IPAA 4ZDLA 5BS6A 4LMYA 3QPTA 4W97A 4LK0F 3H9GA 3OS1A 3R0JA 2HVQA 4RB3C 2MGQA 1Z3XA 5LRSA 5HLGA 2XPWA 3TOBA 4DBQA 5C4JJ 3WTVC 4QTRA 2LKSA 4II3A 4IL6C 1UAAA 4CGZA 2DPDA 2FD5A 1YRNB 1GV5A 1NG6A 3IAS2 4H0EA 5HVQC 4G6TB 1X19A 2ZB9A 4ZH4F 3M4OJ 1I3AA 1ON2A 2LC2A 1JT6A 2ZXJA 3K9TA 1HBXG 2X6YA 1QVTA 2FBHA 3GX4X 4E7IA 2TDXA 1UZCA 1CF7B 3A03A 3DBRB 4MQ9F 3FXLA 3OSFA 3IUOA 4HV5A 4JX4A 3CP2A 2PJRB 1ZREA 2DT7B 1VQKI 1ERDA 2YX4A 1ETXA 4AYBA 1LE8A 2QBYB 4YIFA 2ZJRF 5E8GA 2K9LA 1FEXA 2EV0A 2K5CA 4JP0A 4KUMA 5L3CA 3OYJA 1D1CA 3WE2A 3JTGA 2QYOA 2YX7A 5KHDA 4NDLA 3C2GA 3B73A 3AKZA 2ELHA 2QM3A 4Y52J 1SAXA 4AM3A 4AU7A 4NUBA 3SZPA 1YTYA 1DQUA 4ESBA 2VXDA 2BOLA 5DS9A 3W2AA 1U0JA 3SXYA 5L3FA 3DTKA 1U8RA 3GTGJ 2DYSH 4HX7A 3EQLF 3ONQA 3VFZA 4IX7A 1XSDA 1XTAA 4ENNA 4JQFA 3VYUB 3MZ8A 3KEQA 4IO9F 1HF0A 3OIOA 3F8FA 5HDNA 1WI3A 2AQFA 2GBYA 2HOAA 1J0RA 3PNTA 5FFXA 2DTZA 3HGYA 3NARA 3R0AA 2A6HF 2LY1A 3ERED 4B8XA 1PUFA 3BR3A 4G7OF 4MFEA 2NAZA 2E36A 5D5WB 4ZYDA 2ZJ2A 2XRLA 4RLQA 2MBFA 4HF1A 2KDOA 2HS5A 3L1PA 4XORA 3U9GA 1ETVA 3H0GJ 2M34A 3CD6I 3ECHA 1T33A 2E60A 4BS9A 4UUSA 3CO7C 2QSGX 3OV8A 1ITYA 2X51A 3KZZA 2XB0X 2XAHA 4HSRA 1VQ4I 3K4KA 2DPUA 2GQQA 1R1UA 2GWRA 3KP2A 1FOKA 4AYBN 3KP3A 3LQQA 5K5OA 5D8KB 5FRMA 5BMZA 4RB2C 2MC3A 4A3MJ 4BJTA 5HOOA 1KZHA 4C9YA 3QYFA 3HL2A 1JHHA 2PX9A 3HYIA 2Z9OA 4GCVA 1T38A 2Y0SA 3BP8A 1HW5A 1ORKA 3FWEA 3I4MJ 3HIFA 4PFOA 5FJ8J 2R7SA 1G8XA 3QPHA 4M3BA 3LNQA 3FXUA 5E3LA 4A3DJ 2DFFA 2F5FA 1QO0D 5K7HA 3ZMZA 3DKYA 4N9IA 5K5RA 1HKTA 3RTRA 1EH7A 4C2TA 3I71A 3BTIA 3KZIC 4ESFA 2XSDC 2LSOA 3F6VA 1QHHD 4IHVA 2E1OA 3L00A 1ZG3A 2F48A 4M74A 4KISA 2BXZA 1TW3A 4YIIA 3ZQCA 3DBLB 2H6BA 4GGGA 3FMRA 1HKQA 2FUG2 3GTMJ 1S9HA 2JUCA 4PSWA 2EA2A 5ICCA 4ITVA 4WXDA 3SEQA 4XLPF 5LBQA 2IS4A 3IH2A 5DCFA 2P8TA 5HLIA 2KLOA 5FLXK 1BN5A 2OA4A 4MIMA 3GXOA 5J6XA 1MJAA 2ZFWA 5FRNA 2A5WA 1V3FA 2ELJA 5CYVA 1WHUA 2LREA 1OCRH 4CHUA 4KA4A 2L01A 1IN4A 2KJCA 1X1AA 2KQRA 4BE0A 1T8IA 1ULYA 3H3ZA 3OWTA 4F3QA 1TP4A 3CMMA 1S7OA 3PNYA 5IPAA 2OTLI 3M8EA 4E7KA 1Z7UA 4LITA 1YIJI 2BY1A 2WAEA 2H1LA 5F64A 1POGA 2QF7A 1XC5A 1UMQA 3HOZJ 1H88C 4G12A 3K1NA 5DM7F 3C18A 4I7HA 1ZR2A 2FMYA 3VSLA 5JVGF 1D0XA 3PM1A 1USSA 1QZYA 4ZTFA 3EUHC 3H3UA 5FKMA 3ZQHA 4FTHA 3ZQGA 2Y0SN 3WTXC 1QRYA 4GXOA 2XPUA 3MZYA 4BE1A 1KGSA 3JW4A 1IUFA 4XSZF 4BHCA 2KRFA 4YFKF 1RKTA 4L5EA 5CVRA 1WPKA 2ZXIA 3B02A 3KEOA 2K9SA 1SVOA 3W6KB 1E17A 1WJDA 2B7EA 1XMXA 5BOXA 1J9IA 1MSFC 2ID6A 2WV0A 1IV6A 5J1UA 3PIOF 4XN3A 3ZN1A 1VFCA 4A3CJ 5GTIC 3EYYA 1I39A 2HWVA 4PDKA 3A0HC 5H20A 4Q5SF 3HBLA 2LDUA 4CA0A 1D3YA 3ASOH 1GV2A 3M8FA 3JRGA 3S14J 1FYLA 2JSPA 2LLKA 1Z05A 1TWCJ 4FHTA 2EFWA 2Z99A 2DT6A 4RAGA 2M7AA 1WJ5A 1SFEA 5DUKA 1QHGA 3HGGA 2A61A 1BBYA 4HNVA 5F08A 3BTJA 3K10A 4CDGA 1GUUA 2BW3A 1BR4A 3ZOBA 2XPVA 1QZEA 1Y0NA 2W57A 4L9VA 3LSMA 5E3NA 2BVMA 3F8NA 1LE8B 2K40A 1I3QJ 4L5IA 4XONA 4ANJA 2CS3A 1X4OA 2H8RA 3GTOJ 3J80K 4QPOA 5D6EA 3OIPA 2VKDA 2HU9A 1FY7A 4FASD 1J2XA 2X0LA 2STWA 1W7PD 4E70A 5FO5A 3K4JA 4E4HA 2VIXA 4RM3A 5E8IA 2CQKA 2WWYA 1R58A 1U8BA 2JA7J 2VKHA 2JJ7A 1IXCA 3K4CA 2RC4A 3I64A 2VQGA 3K1PA 1T2KA 3Q0VA 2ADUA 2CUJA 4BJ5C 4YIRX 4C3HJ 1HLVA 2O3FA 2LF7A 3GEZA 3Q0WA 2X6XA 2XIGA 4U0WA 4FE4A 1E2XA 3OYIA 4HBLA 2M4GA 2VT3A 3HTSB 1N75A 3WTTC 3CJNA 4HF2A 2VKEA 1Z0XA 2PMZA 4E7JA 3CCEI 3RDIA 4AWXB 1PUFB 1WVRA 4BAYA 1YFHA 3PFYA 3ZPLA 4Y33A 1O57A 3BCBA 3CCMI 2IS2A 3S3NA 1PVEA 2Z3YA 1YQAA 2D2WA 2HYJA 3MKWB 1IXSB 1ZR4A 1YIOA 2JSCA 4KICA 2STTA 4R1HA 3G1OA 4F55A 3N05A 3BR0A 4MTDA 2FOWA 2MH9A 1ODDA 1W5CC 5IYDJ 2DA7A 5C3EJ 5ILVA 2VC1A 3MCZA 2OQGA 2L3DA 3VOEA 3CC4I 2HDCA 3F72A 3WTUC 1MH3A 2DA6A 3BJ6A 3KEYA 3CLOA 3KZYA 1FJLA 2MLGA 2ESNA 5FKKA 2O6GE 2IXSA 5D5XB 2K02A 2CV0A 3VB2A 3SYTA 2DI3A 3LSRA 3BZKA 1JKQC 2DAOA 4AD9A 2L9RA 4YELA 1MGTA 2E1MB 3L2VA 1Z21A 4CCOA 2R4GA 2QWWA 3DPUA 3OYEA 3RKXA 2CUZA 4XRMA 3TOAA 1SFUA 4MEYF 1RESA 1TQIA 3CUOA 1YS7A 4Y7NJ 3SHFA 1RNLA 3ISPA 3V8JA 2GM4A 3EUHA 3JRHA 4PK4A 5J8FA 1JT0A 2JTVA 2K86A 4I98B 5J1RA 3CC7I 5JVTA 4AIKA 4I2OA 2VL8A 1IUYA 4D0PA 1FSEA 3SQNA 3N4MA 5CQEA 2CO5A 2XAFA 4ZJZA 2WAFA 3HJEA 2MC4A 2PMZN 1EH6A 2IEKA 1FP1D 2OD5A 1F5TA 4IXAA 2CV1A 2DA1A 1LFUP 3IAM2 3U2RA 3HB9A 2M3AA 4D7MA 3FK6A 4ZZLA 4A3KJ 2V1NA 3E5QA 4B09A 1U5TC 3C1DA 1FIPA 3ZGKA 1R1TA 4DZJA 1YG2A 3U1DA 1LB2A 1G59A 4BY1J 2J5PA 5TRDA 3COAC 1R5GA 1A36A 4XKWA 4GYIA 4X0GA 3LSKA 1FC3A 2LRDA 1HDPA 3HPGA 3BPVA 1EF4A 2CQQA 5J47A 2HVSA 1X1CA 4HX4A 2JVGA 4KYWA 4V19K 1IDYA 1X4PA 1FYKA 3TO7A 2PBIA 2PQ8A 4RGXA 4FISA 3ERMA 2JMWA 3MEXA 1BIAA 3NRVA 1K4TA 3LOCA 3ABKH 4YFXF 4Y4RA 4JYKA 2VQLA 3LL7A 3I5UA 3PQKA 4PJLA 2ACJA 1Z67A 4HLYA 2IGMA 2HXIA 1G3TA 1KU2A 2QEXI 1AWCA 3GTKJ 2DYRH 2WADA 1J09A 1R36A 2VE8A 1SD5A 2EJRA 5GAEJ 2X48A 2RN7A 1VQ7I 2CGPA 5FLXZ 3K7AJ 1R00A 2CUFA 4M9ZA 3LAJA 1BIBA 2O7OA 3HOYJ 5GAGJ 1HW2A 3FKIJ 3S3OA 4YFNF 3S1QJ 3HSFA 1R22A 3FK7A 4E7ZA 4BQOA 2Y31A 4ENMA 1DPRA 1LQ1A 4P9FA 2FA5A 1MMGA 3PUFA 1FX7A 2XGEA 4XLFA 4UHTA 2WAQN 5FROA 2KISA 1BJZA 2Y69H 3OYKA 1G3YA 1MD0A 1UJ8A 4ZDPA 1OCTC 1FPQA 4TV7A 3Q9VA 1XSXA 4U7DA 1R1VA 2QQAA 4B44A 4F92B 2VE9A 2A6TA 2MA3A 4OMZA 4A5MA 2LKXA 4C3JJ 3E6BA 2R7VA 4CUGA 3K4BA 3P9IA 3BZCA 3U21A 1SAUA 4CYCA 1SFXA 2A6EF 1XGNA 3OOUA 3SFZA 4EATA 5LGTA 1S8NA 1QU3A 5E1XA 2IJLA 1VQMI 2V1UA 4ZYGA 4L18B 5JHFA 2LBFA 2DN0A 1JHFA 2AO9A 2RNGA 4HA8A 3CDLA 1FBUA 3JRFA 4IHSA 1S7EA 2QUFA 2R3SA 1TWHJ 1YLFA 2Z5UA 2M87A 4C2MJ 4G7ZF 4D7NA 1VQLI 2DOAA 2LK2A 3VSKA 1O3TA 3HM5A 1P2FA 2AXTC 1SMTA 3WU0A 2A3SA 4BDZA 1LFBA 1IN6A 2R7OA 5JI6A 3JRBA 4WX9A 1V4RA 3OYMA 2GA1A 5EZHA 2QLZA 2Z33A 2FBIA 3KP5A 3F8BA 3WU2C 2F5VA 1ZRDA 3DQVC 1R5HA 5FGMA 2JWTA 3Q0UA 5LGUA 2BBYA 4OIPF 4XOTA 1FYMA 4XMYA 4AVPA 3I55I 4B47A 1QQIA 1U6GA 2OC6A 3H35A 4PJJA 2RQQA 5GPAA 4OAZA 3L2CA 4PCQA 3LSGA 3TDZC 4BU2A 5GADJ 2XAQA 1TWGJ 2NS0A 2PMUA 2XVCA 4EJUA 2XAUA 3J80Z 4RDUA 1W5SA 3I53A 1UELB 3T8RA 3BJOA 2R7XA 1QZZA 1RC9A 5HLHA 4EMSA 4KFCA 2HQAA 2WC2A 4BXXJ 4UNOA 1MBKA 3BOQA 3ZRGA 3ZMDA 4M71A 4CSWA 1HSJA 3RKYA 3CJQB 4HYEA 2IS6A 2IW5A 1I27A 1Z7LA 5DD4A 2R7TA 4LG0B 5ILSA 3GWZA 2VKVA 3DFGA 4V2FA 3EYIA 2R7DA 5IT9K 4G8XA 1Z3YA 1GXQA 2K9NA 2Q2EA 3BWGA 3VYTB 2JZYA 5A2QZ 3OYCA 3K4NA 3OL3A 3FXJA 4NNJA 4KMFA 2L7KA 4A0XA 4A5NA 3KP7A 1X1PA 5IP7J 3MQ0A 3TO6A 1BR2A 2YUSA 3VODA 1EV7A 1DPUA 2GOXB 3AG4H 4HNTA 2V9VA 3L09A 1TNSA 4RS8A 1I1SA 2ZSIB 5HS9A 4Y3OA 1T98A 5IP6A 3WTWC 4PJ0C 1HXDA 5LD2C 1X3WB 3FBNB 3DWLE 2KJBA 4QWQA 1P7IA 5DD8A 2BY3A 2DOFA 4IVNA 2NVXJ 4GO1A 1ZARA 2FE3A 1GVDA 3LSPA 1A04A 2D1VA 3HSEA 1VI0A 2QA4I 3L2QA 1HDDC 1Z77A 4I99C 1SEUA 2HEOA 1R4NB 5FKLA 2ZO4A 3RKQA 4E7HA 1HA8A 3TO9A 3QYEA 3TEDA 1BC8C 3D0SA 4UB6C 1BR1A 3CP8A 4HOBA 5LGNA 4S05A 2K7LA 1OCCH 2X4HA 3SZGA 5M3FJ 1Z6TA 2L7MP 4M3EA 4LB6B 2ME6A 3DF8A 5FFZA 3DBHB 5KNLA 4A3IJ 4P5OA 2L2OA 1JKRC 3E5XA 2UXXA 1BOBA 4D5CA 3K70C 1LVKA 2IRFG 4EGYA 2ZBKA 2JT1A 2GOMA 2ZXHA 2HPMA 3KPHA 3G1LA 4G6QA 1YX3A 2HTJA 3W2WA 2O8XA 1AU7A 3CDHA 3CF2A 2M8EA 3V7RA 3P9KA 1ZH5A 2GLOA 4L9NA 4B48A 1B6AA 4XM3A 3BR6A 2XV4S 1XG1A 1WJBA 1KQ8A 1BI3A 1IN5A 5D8LB 3OIQA 1K7AA 4RLFA 2IA0A 4QIWN 2H1KA 3S16J 3RZDJ 1ONVA 4IRHA 2L9VA 2E35A 3A2KA 4WK8F 1G4DA 2OUMA 4BBRJ 1MBEA 2GXAA 2FSWA 2OAZA 5CPRB 1V5FA 2A69F 2QKLB 3L2WA 2XUBA 4MGRA 3L2RA 2BGCA 5F0CA 2MFZA 3H0DA 4D5FA 3KIOA 2YR2A 2D45A 2JA6J 2YU3A 2M30A 2L9NA 2CMPA 3RYRA 3BG3A 1YYVA 1GLNA 2BEOA 3OL4A 3R6SA 1YW9A 2WB1N 1O7FA 3OYLA 3H92A 4Q48A 4NC7A 3JTHA 2E5NA 4LIUA 3QU6A 4HDUA 5F27A 4BXUA 4CYCB 1SFOJ 1LVAA 2K3PA 1KA8A 2EFNA 2CQNA 3N97A 6PAXA 2VPRA 2XF6A 4EJVA 5GTHC 4XLEA 2V7FA 1LUJB 3NEUA 2LBFB 3FIWA 3ULQB 4A6DA 1ENHA 2DMUA 1FT9A 4UVBA 3CESA 3SJMA 2AS5F 3HOWJ 2EK5A 3FXRA 3T8TA 5FB2A 5ERIA 4PGHA 2JQ7A 2V1DA 1FIAA 3SEZA 3SDGA 3G71I 3G6EI 2BHYA 4ZC3A 3ZQFA 2BY0A 5J8CA 2GAUA 2V9KA 1T0FC 2F6CA 2R7ZJ 1LEAA 3NQOA 4BY7J 3V4GA 4EV0A 2G7UA 1GHCA 1MJ9A 2PEXA 2VOPA 2E2JJ 2X6WA 2FRHA 2KDZA 3T1BA 5ICEA 1YI2I 1NH3A 1LDDA 5IT3A 3IH3A 5M5WJ 1RKWA 1GXPA 4BBSJ 2DODA 3GMEA 2VQHA 4A69C 2ZJQF 1W0TA 1YW8A 4FX4A 2QQ9A 2L54A 3HRUA 4M73A 3F23A 1P4AA 4PFPA 2Y48A 2IT0A 1FMVA 1WI9A 2ZMEC 3T0YA 1DP7P 4WF2A 1D8KA 2F4IA 3GVAA 4HAMA 5EZGA 1A5JA 3P7NA 1BI1A 4K2EA 4M6YA 2LP0A 4EJTA 2HOTA 3K0LA 1OCZH 2I8DA 4H4KC 3WTSC 2L9SA 5L3DA 5ICGA 4RGSA 3QP5A 2NYXA 2R5ZA 1XS9A 2EQRA 2HKOA 1TT0A 1C0WA 3WG9A 4BUPA 3E1SA 1S3JA 3U1KA 3LSHA 2L5QA 1U5TB 2HYFA 1MMDA 2O8KA 2HNHA 4A3GJ 1DU0A 3FISA 3TBIA 3BTCA 4CYDA 4U7BA 2ELKA 4KIFA 3L9FA 3JCUC 2E1NA 4PZJA 3OS0A 3GTJJ 3A02A 1JTXA 2R7WA 2XSJC 4B3AA 1AKHB 4IEJA 2VONA 1R4MB 4M9XA 3H9QA 2Q2EB 1TNTA 3TW7A 3ZP5A 5DCMA 4O3MA 4A0YA 4BQNA 2JA2A 3ZXSA 2WV1A 2XGDA 2HVRA 1Y1VJ 3BZ6A 4XOPA 3BROA 3CF5F 3BR1A 2CQ7A 1E3PA 2TCTA 5AIPA 2LD5A 2DFHA 3REOA 3F8MA 1UHSA 1D5VA 2L7FP 2O61A 3LFKA 1F43A 2FXAA 5M3MJ 2A68F 1P4XA 1EJ9A 4IQJA 2P5LC 5AONA 1T95A 5BPDA 2LNBA 2F4OB 2Q0OA 3KYDB 1ZRCA 2OV7A 3HOXJ 4KNYA 1DDNA 2FQ4A 2OCEA 5IY5H 1YE9A 4HQEA 3WE3A 5K7ZA 3H9JA 4LD5A 1OMIA 2R7QA 3OMYA 1RR7A 3JAMK 1D0YA 3GBGA 2ZNYA 4A2UA 1K6YA 4N4OB 4ZDOA 2CW0F 2DJIA 1APLC 2P0WA 1XMAA 4I01A 1LPQA 3JREA 5F0HA 2UWMA 4J19A 1ZLKA 3CJTB 3KP6A 3BR5A 4MFDA 1PDNC 3MKLA 2IA2A 3ELKA 4KITB 3OOPA 2R7FA 2LKPA 2VXZA 1Q1HA 2QSHX 4XL9A 2K3FA 1WRJA 3RYPA 3H5NA 5IP9J 3K70D 1XPXA 3W6JB 1MMNA 2DMTA 1TWAJ 3DTIA 5KVRA 1J75A 4N9HA 4PSXA 4BQQA 2NVQJ 2ISYA 2VJ4A 4N0BA 3OS2A 4WCGA 3JSOA 2KL4A 1W36C 3RJPA 5LHHA 2Z16A 3CQZJ 2R0QC 4HLXA 4XRSG 2W84A 2QENA 4CXFA 3H5RA 4HNUA 4MQVA 1FBQA 5FKNA 2CJJA 2Y0MA 4LOCA 1L0OC 2PJPA 3C2HA 1VTNC 3Q3SA 3CO6C 3F6OA 3J7AO 1OISA 5HLTA 4BGDA 4EM1A 3H5AA 5DM6F 2MD0A 3KFWX 3PNVA 4XBFA 1TQMA 2MD5A 1ZQ3P 2EINH 2GIZA 4MLOA 3J7AY 1T0FA 2V1XA 1JUPA 5TISC 1ZLJA 1SVLA 3LA2A 5E1WA 1EH8A 3VDXA 4CZZA 1SD7A 2JRMA 1I6XA 1KYZA 1Y56A 2HTSA 4Z2YA 2NVUB 2M9HA 3A1YA 1QA6A 2KPMA 4A3LJ 5FLMJ 1FZPB 5CKTA 5FD5A 2HOSA 1FP2A 1R6RA 4OWRB 3WGIA 4B3XA 3H1CA 3LSIA 3ZQQA 2ZMEA 2ECBA 2NS7A 5HODA 2JPBA 3MFKA 2M0MA 3RQIA 2R7RA 1WJFA 3HTUA 1OFCX 1K83J 4A6EA 5BNGA 4FT8A 5E20A 3KYLA 1LEBA 2P6TA 1YHQI 2OCCH 2Z1DA 4KIBA 1OR7C 2WA0A 2IBDA 3OY9A 1MSEC 1LDKB 4LG0A 3HHHA 3X2QH 3BG5A 4AC0A 4IF4A 4R8HA 3WTZA 3HKZN 2VJ5A 2L7ZA 1SVMA 2PG4A 1WJCA 2O03A 3WU1B 4A3JJ 3FZVA 2EFQA 5LFAA 3S1NJ 4D1QA 2VODA 1MJBA 3CZ6A 1YOVB 3VYSB 2WBMA 2LVSA 2M7BA 2EH3A 3BG7A 2M4KA 2ME0A 4UVAA 4M3DA 2ZJPF 3FKJA 3DLLF 3D1NI 1IO2A 2F5DA 2JK3A 5CVUA 3LAPA 1MIJA 5EEAA 2P7VB 2XC7A 2V26A 4LGWA 2UUZA 1N77A 2WAQA 2DA3A 2HR3A 3ESWB 1N78A 1MNDA 4QPQA 2FMLA 1P4WA 2VT2A 3O8HA 5C4XJ 3DCFA 2XGCA 3KP4A 1PUEE 1Y39A 2DFIA 2HZDA 1BJAA 4U0YA 4HV6A 1DU6A 1LDJA 2KRCA 4S0HB 3BQZA 4KT6A 4GDFA 1EKEA 4AIHA 4KJZA 5JHUA 5LHGA 2R5YA 3M3YJ 2VQCA 2R5ZB 4BACA 5F6FA 3E7LA 5GPCA 2UV1A 2ZXWH 2EZLA 3HOSA 4AIJA 4L0ZB 1RRJA 4BJ6C 2RV8A 2W25A 3LFUA 5EGOB 1IRZA 1IDZA 4A93J 2LH9A 1SANA 2M2EA 3GLLA 3IHUA 5FKOA 5KAFC 1D0ZA 1HKSA 4G7HF 4EGZA 4DZPA 4UUVA 2WTEA 4DGWB 3M1CA 4I0BA 5LEJA 1NK3P 1B8IA 3DPLC 4JK1X 2DBBA 3G73A 3TKYA 2XHKA 1W4MA 1HSTA 3BG9A 3DU5A 1ETQA 2TRTA 5K5QA 2DA5A 5DCMB 2OTJI 1BW5A 3GFLA 1B72B 4HEA2 5CVJA 4F91B 3LWFA 3GZ5A 3CMEI 3FHNA 4EJOA 4PUSA 4ZYHA 2B63J 2BXYA 1J59A 2OZ6A 2W85A 1BI0A 3MKYB 2H6CA 1G3SA 3CMAI 4CCNA 4M72A 4KDPA 5D5UB 1M1EB 3D5LA 1D8JA 1UB9A 2WY8Q 2ZC2A 5ED4A 1JUSA 3J7YJ 2C6YA 2R92J 2VOOA 2Y30A 2L4AA 3I59A 4RAFA 1VQ9I 2BYVE 1MBGA 1ETKA 4BL0B 2DU9A 3I9V2 2QCOA 3IWZA 3ABUA 3S2DJ 3RCOA 2HKXA 1O3QA 3GO5A 1TW2A 1SFKA 4I09A 4B4CA 3ZMSA 4CCMA 1TWFJ 2KT0A 2RGVA 2LF8A 1NG7A 3LSJA 2W82A 3TP3A 5ILUA 1XCBA 3GW2A 3G4SI 2VI6A 4UUTA 3I58A 2MYSA 3M7GA 3V7SA 2QZ8A 3G1MA 3RZOJ 5HNHA 1P9QC 1E3OC 5EF6A 1BI2A 4Q4ZF 1Y6IA 2M0CA 1HCRA 1JJ6C 2RKHA 3ZMVA 1X2MA 4ETSA 2XROA 2Q8KA 2E2HJ 4A3BJ 1K6OA 1DUXC 2PLYA 2VN2A 5E3MA 1W36D 2EZHA 4IQ4A 4L0YB 3W3CA 2G0EA 3IV5A 1ACIA 3HOUJ 3MN2A 3WGGA 4ZTJA 4CCJA 1IRXA 4IJAA 4UVCA 3OYDA 2P81A 3GTLJ 4I02A 3OR1C 1P7JA 2KFDA 4JBAA 3B6AA 4UXNA 2VJJA 5D4SA 1S72I 1OR7A 1ZHFA 1XX5A 2W1OA 5HS8A 2IP2A 4DOZA 3HDDA 3ZN0A 1V54H 5H6QA 5JLXA 2IPQX 3FM5A 2QQBA 5HS7A 2RNJA 4ZYAA 5E17F 2CUEA 3KLOA 3GF2A 4BHBA 5LRRA 1MBFA 2A05A 1IRGA 3EUAA 1N25A 4BKXA 3NWSA 2NNYA 1K61A 2JA8J 1XGOA 2HZTA 2KHMA 3DTEA 4NBQA 3FDYA 2BVLA 1SD4A 3UR3C 3F8CA 3QAHA 3BPXA 4Y17A 3ABTA 5K7FA 4A0ZA 1R9TJ 5LEKA 5DEQA 3VWBA 4J01A 3MVPA 1VQ6I 5D6FA 3KLNA 3HG9A 5C44J 1ZGJA 1WH5A 2LTPA 2ZMEB 4KT5C 4XNFA 1T6SA 3I4NJ 2DQLA 3RPUA 2P7CB 4A12A 2HQRA 3IRRA 2Y9ZA 1UHMA 1G6NA 2M8GX 3S2WA 3QOEA 3F21A 2GXGA 2X1CA 1H9TA 1VQPI 3C2BA 1U5TA 1RPWA
chains in the Genus database with same CATH topology
1BR4A 1TZLA 3PSIA 4BE2A 3LSMA 4U87A 2R7UA 2BVMA 2XF6A 4CCLA 2HPIA 3D5RC 4XLEA 4LG3A 3OYAA 4XKVA 2V7FA 4XONA 4ANJA 3S8PA 2LBFB 2PJRA 4C30A 2CS3A 1V5EA 1X4OA 4PJNA 3PJRA 3K4LA 1LKXA 3CESA 2VPLA 3V42A 4QPOA 3BC8A 2VKDA 2HU9A 3OIPA 2CW8A 4FASD 3K4JA 4E4HA 3SEZA 2VIXA 2V4JC 4RM3A 4YRVA 2VKHA 4ZC3A 4BXFA 3K4CA 2VQGA 2V9KA 1T0FC 2F6CA 3QODA 2LG4A 2Q1ZB 2CUJA 4HG2A 4FETA 4BJ5C 3DKXA 4F93B 2X6XA 2VLAA 2X6WA 3S93A 3OYIA 3HOTA 4DJAA 1MW7A 2M4GA 3I3LA 2AQEA 3MKZA 1N75A 3SDBA 2VQHA 3S32A 4E6KG 2PMZA 4E7JA 2WB1A 4PFPA 3BLYA 1FMVA 3PFYA 1ZELA 1PJRA 2XF7A 4Y33A 4II2A 3BCBA 2IS2A 2F4IA 1X1BA 3OR2C 3S3NA 2JUGA 4H4KC 2I8DA 4P1WA 1MNEA 2L9SA 2ZSHB 3MKWB 3OYFA 2MABA 1TT0A 1VZ0A 3M8JA 3BG6A 2ZFUA 4BUPA 3E1SA 4HSTA 4F55A 3LSHA 2L5QA 3N05A 4NC8A 3S3MA 2DCEA 2BW3B 1MMDA 4HPQA 2HNHA 2W00A 1LFPA 2Z2SB 3TBIA 4U7BA 4OAYA 3OS0A 3LMMA 3KEYA 2R7WA 2IXSA 3DPTA 2XSJC 2CV0A 3SYTA 1DGRM 3H9QA 4YELA 3L2VA 2E1MB 4BEHB 1Z21A 2Q2EB 4N4NB 4CCOA 2R4GA 1X1DA 1WFXA 3DPUA 3ZR8X 3OYEA 3OYHA 2CUZA 2JA2A 3ZXSA 1WJAA 4BQNA 4JOMA 2HVRA 4B43A 4XOPA 3DU6A 3EPZA 3NWTA 4XQFA 2X1EA 4GRIA 4IQJA 4PK4A 4DIQA 1T95A 3MD2A 2X85A 1WJEA 1PYVA 2IS1A 2OV7A 2VL8A 1DP3A 5CQEA 1YE9A 4DBRA 4ZJZA 2CFOA 3H9JA 2WAFA 4E7LA 2R7QA 3OMYA 4E7SA 2MC4A 2W4SA 4XLAA 1D0YA 3PL8A 3RSNA 3GBGA 2HDWA 2LOOA 1K6YA 4N4OB 1YX5A 2IGOA 2CV1A 4ZDOA 4IKFA 2DJIA 1MMAA 3IAM2 2P0WA 2E5ZA 2M3AA 2NOJB 2V1NA 2UWMA 3ZGKA 4KITB 1G59A 4CCKA 2VXZA 4XL9A 4XKWA 3H5NA 3HPHA 4X0GA 2KMUA 3LSKA 1OLTA 3K70D 2DXIA 1MMNA 2LRDA 1V5GA 2IGNA 3DTIA 3HPGA 3TL4X 1EA3A 4BQQA 4PSXA 2VJ4A 2E1MC 3OS2A 2KL4A 1W36C 2HVSA 1X1CA 1UG0A 2JVGA 2Z16A 1X4PA 2QKMB 3CJRB 3H5RA 4XN0A 4Y4RA 3A4CA 2O5RA 2VQLA 3LL7A 4PJLA 4HNUA 2W7NA 4BDYA 3HXLA 2IGMA 3PUBA 2WY7Q 2WADA 1J09A 3C2HA 4XLHA 3AL0B 3RPUD 2KP6A 5HLTA 4BGDA 4ZDLA 3H5AA 1KONA 2MD0A 3PNVA 2RREA 3OS1A 3H9GA 1FMWA 2HVQA 4MLOA 3J7AY 1Z3XA 3S3OA 3OYBA 3ZCOA 4BQOA 4DBQA 4E7ZA 2XDVA 4F52A 1JI8A 3EUKL 1MMGA 1D1BA 4XLFA 3VDXA 4II3A 1Y56A 1UAAA 5FROA 3OYKA 3A1YA 2KPMA 3MMYB 1NG6A 3FBIB 3IAS2 5HVQC 4ZDPA 4G6TB 5CKTA 1X19A 3IP4B 1R6RA 2LC2A 4OWRB 4B44A 4F92B 2X6YA 2A6TA 4B3XA 3LSIA 3ZQQA 2M0MA 4E7IA 2R7VA 4CUGA 2R7RA 1WJFA 3K4BA 3K4MA 3U21A 1SAUA 3IUOA 2CH0A 3UNGC 3KYLA 3DEEA 3CP2A 3OOUA 2PJRB 2Z1DA 2DT7B 4EATA 1OR7C 1QU3A 1ERDA 2WA0A 4AYBA 3OY9A 1LDKB 4R79A 2K9LA 2K5CA 3OYJA 5JHFA 2LBFA 1D1CA 3E0JB 2RNGA 2VJ5A 1WJCA 1E0EA 4PJMA 5KHDA 4AVZA 3C2GA 5LFAA 4D1QA 3AKZA 3CZ6A 3AL0C 3VYSB 2WBMA 2M7BA 4AU7A 3BG7A 2M4KA 4NUBA 2DOAA 3VSKA 2JVHA 3FKJA 1DQUA 4BDZA 2VXDA 2BOLA 2XF5A 2R7OA 5KCMA 3PSFA 3W2AA 1D1AA 1U0JA 3OYMA 2XC7A 3DTKA 2V26A 3ONQA 2UUZA 4IX7A 2F5VA 4JQFA 1N77A 3VYUB 3DQVC 2WAQA 1DGWY 1N78A 1MNDA 4QPQA 4HRIA 4XOTA 2AQFA 3QYBA 4XMYA 3RQ4A 2HZDA 4B47A 3PNTA 2OC6A 2KRCA 2LY1A 1AA7A 3H35A 4KT6A 4PJJA 2RQQA 4KJZA 2VQCA 4OAZA 5HNFA 4J00A 4BACA 2LY2A 3LSGA 3G2BA 4BU2A 2UV1A 3OYGA 3HOSA 4RLQA 4XLCA 2XAUA 4BJ6C 2KDOA 3LFUA 1UELB 4XORA 2R7XA 2LH9A 2HQAA 1D0ZA 5CQGA 2E60A 4C2UA 2IGKA 4BS9A 4DGWB 3ZRGA 3M1CA 2X51A 4HSRA 4CSWA 3CJQB 3HKZA 3K4KA 3DPLC 2IS6A 3AFHA 4YEJA 1Z7LA 5FRMA 2R7TA 3DU5A 4BJTA 5HOOA 4C9YA 2KRHA 3QYFA 4HEA2 3HL2A 4F91B 2CV2A 3FHNA 3BCAA 4PUSA 2LYCA 2Y0SA 4XKBA 2R7SA 1Z3YA 4RM2A 4BEHA 4XKCA 4PFOA 3MKYB 1G8XA 4CCNA 3VYTB 3OYCA 3D5LA 2WY8Q 3K4NA 3OL3A 3DKYA 4NNJA 2L7KA 3KX2A 3RTRA 4C2TA 2VB6A 1BR2A 4BL0B 3I9V2 1QHHD 3TMOA 2GOXB 3RCOA 4HNTA 2X1DA 4KISA 4XR6A 2ZSIB 1SFKA 4Y3OA 4LIVA 2CW7A 4CCMA 5LD2C 3L2UA 2FUG2 1NG7A 4NQWB 2W82A 4CZCA 1S9HA 3FBNB 3DWLE 3HUGB 4PSWA 4ITVA 3SEQA 2IS4A 2KLOA 3OYNA 2MYSA 3L2QA 5HNHA 1P9QC 5FRNA 2A5WA 2ELJA 2LREA 1Y6IA 4E7HA 2KQRA 1X1AA 4BE0A 1HA8A 3QYEA 3VYRB 1BR1A 3CP8A 3OWTA 3CMMA 3PNYA 3F9KA 4F3QA 3SZGA 1W36D 4E7KA 4IQ4A 3W3CA 4LITA 3HC7A 4CCJA 1IRXA 4ZTJA 5KNLA 2WAEA 4P5OA 2L2OA 5TGTA 3OYDA 1BOBA 3K70C 1LVKA 3OR1C 2GOMA 2ZXHA 3VSLA 2VJJA 2HPMA 3W2VA 1D0XA 1YX3A 4ZTFA 3EUHC 3W2WA 2VASA 2W1OA 4DOZA 3CF2A 4BE1A 4B48A 4XM3A 3DLAA 1WJBA 2ZXIA 3D5SC 3OIQA 4ZYAA 4RLFA 1WJDA 3EUAA 3NWSA 4XN3A 2KHMA 2K9MA 3A2KA 2OUMA 3DTEA 4D9JA 3FDYA 2BVLA 2KZVA 3UR3C 5CPRB 1V5FA 3L2WA 2QKLB 4CA0A 3L2RA 2MFZA 3H0DA 4IZZA 2V6EA 3VWBA 2JSPA 3K6GA 2VJIA 2L9NA 2CMPA 4J01A 1GLNA 3HG9A 4RMNA 4CH7A 2DT6A 3OL4A 3OYLA 4XNFA 2M7AA 1WJ5A 4NC7A 1QHGA 2E5NA 4LIUA 3QOEA 2X1CA 3K10A 2BW3A 2K3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9L A;  2K9M A; 
#chains in the Genus database with same CATH topology
 3PSI A;  5IOZ A;  4P55 A;  4BE2 A;  3O3K A;  2GIV A;  2R7U A;  2HPI A;  3D5R C;  1J7K A;  3Q9S A;  1W0U A;  2XAJ A;  3QPS A;  3OYA A;  1AOY A;  1RR8 C;  2NVY J;  2CQX A;  1V5E A;  4I6Z A;  1WH7 A;  5B3S H;  1AKH A;  1IN8 A;  3PJR A;  3I54 A;  3OSG A;  3K4L A;  3SFI A;  1E3H A;  1ZRF A;  4KN7 X;  1NHA A;  2VBX A;  3BC8 A;  2CW8 A;  2FOK A;  2P6S A;  1IN7 A;  2HI3 A;  1XDS A;  4I76 A;  2DA4 A;  2XKO A;  3GUD A;  4L9T A;  4BXF A;  3K1M A;  5J4Y A;  4OOI A;  5DUI A;  3CCU I;  1JE8 A;  1ZGA A;  3HSR A;  3MZH A;  1Z6R A;  2LG4 A;  2Q1Z B;  4ON0 A;  4FET A;  2FF4 A;  3AAF A;  2M1B A;  1F36 A;  2D5V A;  1O7L A;  2A07 F;  4F93 B;  5JR3 A;  4A3F J;  3JSP A;  2VLA A;  2V6C A;  3BDD A;  4DJA A;  3TGN A;  1MW7 A;  1XD7 A;  2FBK A;  3QRF F;  4WWC A;  2MG4 A;  1PP8 F;  2E19 A;  2NVT J;  5IYB J;  3A0B C;  1FOW A;  2VBZ A;  3S32 A;  5J4V A;  2WB1 A;  1U9O A;  3BLY A;  3HHG A;  2R5Y B;  1IW7 F;  1ZEL A;  1PJR A;  1XGM A;  4II2 A;  4O5V A;  1ETW A;  1X1B A;  2JUG A;  2EWN A;  3H36 A;  1KQ9 A;  2KIQ A;  3WTY C;  2NOG A;  3I0T A;  3DP7 A;  2FX0 A;  2ESH A;  1VZ0 A;  3M8J A;  2FJ1 A;  5L3B A;  3O2P E;  3BTL A;  4NC8 A;  3S3M A;  4HPQ A;  2H09 A;  3GLX A;  1B8I B;  5F1J A;  2I5U A;  4LLN A;  1HOM A;  4U88 A;  2W00 A;  1QNT A;  1SMY F;  3QQA A;  1LFP A;  3VEP A;  3DXJ F;  4OAY A;  4UV8 A;  4MNU A;  4LLG F;  5IOY A;  1S7A A;  4IRI A;  2F2E A;  1DGR M;  4O6J A;  4XLN F;  1VQ5 I;  4N4N B;  4DQ2 A;  4XID A;  3S1R J;  1JGG A;  4DYR A;  4PGG A;  1NTC A;  3ZR8 X;  4IHY A;  2JN6 A;  1ZG1 A;  3CCJ I;  3BJA A;  1ZK8 A;  4B43 A;  4HZF A;  1T56 A;  3EPZ A;  3HOV J;  2HYG D;  1BL0 A;  1ZTR A;  3PFI A;  1QGP A;  1R7J A;  3I59 B;  2X1E A;  3E97 A;  3NAU A;  4GRI A;  4XQF A;  3F22 A;  2H27 A;  1IZ1 A;  4V2G A;  5E3O A;  1HW1 A;  4ABZ A;  2FQ3 A;  2K4J A;  2EA4 A;  3J81 K;  1WJE A;  2IS1 A;  1OCP A;  1B9N A;  4OMY A;  4LK1 F;  1GDT A;  1DP3 A;  2DJN A;  3KYC B;  2EIJ H;  1X2N A;  4BHP A;  3CC2 I;  2CFO A;  2OF7 A;  2PMH A;  4G9Y A;  4E7S A;  3CCQ I;  2W4S A;  4M6V A;  2ICW G;  5F1R A;  2LMD A;  2CSO A;  2HDW A;  2GA2 A;  2LOO A;  1IC8 A;  2ETH A;  1KU3 A;  2VBY A;  4NQW A;  2K9Q A;  3HUG A;  5CLS A;  3IKT A;  4X6A J;  1OCO H;  4OU0 A;  3F3X A;  1Y0U A;  3G3Z A;  3LA7 A;  1Q1V A;  2DK5 A;  3DEU A;  4U0V A;  1YIT I;  2UXN A;  5F04 A;  2NXN B;  3R4K A;  2QQ8 A;  2E1C A;  2Y2Z A;  4CCK A;  3IC7 A;  1MDM A;  4XIC A;  3FXK A;  3CCY A;  3HPH A;  3IRQ A;  2KMU A;  1OLT A;  4P9U A;  2IGN A;  2XAG A;  3TL4 X;  2E2I J;  1EA3 A;  2OU2 A;  3EET A;  3CCL I;  5D4R A;  4LFU A;  2V9P A;  2HQ5 A;  2NNN A;  4LLL A;  3RPQ A;  3CUQ B;  2OPT A;  2E71 A;  3CJR B;  4XSX F;  1AHD P;  2DMQ A;  2E7X A;  4W1U A;  2YU9 J;  3A4C A;  2O5R A;  4G6D A;  4BDY A;  3S17 J;  3HXL A;  2G9W A;  3PUB A;  2WY7 Q;  3C3W A;  1WKM A;  3WGH A;  4FE7 A;  2F4M B;  4XLH A;  5EDN A;  3M1E A;  3E5U A;  2E34 A;  2F5C A;  2P5V A;  1FOY A;  2EV5 A;  2KP6 A;  5CJ9 A;  2JA5 J;  1Y1W J;  1RZ4 A;  1P6R A;  1KON A;  1TTY A;  2V79 A;  3ZQ7 A;  4OIN F;  4KMU X;  2RRE A;  4G94 A;  3I56 I;  1FMW A;  1B59 A;  1UG2 A;  4OIR F;  5J3L A;  4BH9 A;  2COB A;  3OYB A;  1YS6 A;  3ZCO A;  2KKO A;  3Q5F A;  1BOA A;  2DK8 A;  2XDV A;  2DW4 A;  3AG1 H;  2EZI A;  2Y9Y A;  1D1B A;  2BHZ A;  3EUK L;  4F52 A;  4QLC U;  3BR2 A;  1JUM A;  3BT9 A;  2YPR A;  1RET A;  2ECC A;  4AID A;  3MMY B;  3FX3 A;  1FTZ A;  4DYC A;  3FBI B;  3HRT A;  1FWZ A;  2L4M A;  1H89 C;  3IP4 B;  3FXO A;  2AHQ A;  4HX8 A;  5EGO A;  4IOA F;  2D1H A;  3FXQ A;  1XB4 A;  5H6R A;  1K4S A;  3K4M A;  1X58 A;  2CH0 A;  1JTY A;  2RAE A;  3UNG C;  1K78 B;  3DEE A;  2KIF A;  4F7Z A;  1QPM A;  3F0C A;  1Z9C A;  1IGN A;  5E79 C;  5CVI A;  3K2A A;  1BA5 A;  4EEF G;  1T08 B;  4DW6 A;  3ZMT A;  1IV8 A;  4R79 A;  2DTR A;  2CU7 A;  1PP7 U;  1WWX A;  2IA1 A;  1RUO A;  4FX0 A;  3E0J B;  4EM2 A;  1B72 A;  2MLK A;  1ZAO A;  1I50 J;  2L02 A;  2X9D A;  2OZU A;  1E0E A;  4PJM A;  2CYY A;  2ISZ A;  5BQT A;  4AVZ A;  1MNM C;  5LLQ A;  3AL0 C;  1ETY A;  5B1B H;  1A6Q A;  1L3L A;  1IG7 A;  5FD6 A;  3IL2 A;  1KQ0 A;  2P4W A;  1OPC A;  2JVH A;  5GAH J;  2XF5 A;  2W24 A;  3CLQ A;  5KCM A;  3PSF A;  3JRD A;  1D1A A;  4CO8 A;  4MTE A;  1I6H J;  1V55 H;  3GFJ A;  4ENJ A;  4ZZD A;  3A01 A;  5JFR A;  5DTD A;  1UFM A;  1XMK A;  2HQN A;  1TBX A;  1DGW Y;  2EIL H;  5E1Z B;  5H2F C;  2DMN A;  1VND A;  2YSR A;  4P96 A;  4RGU A;  3TW6 A;  4HRI A;  3WG7 H;  3QYB A;  1K79 A;  3CTA A;  3RQ4 A;  2HXO A;  1W7P A;  1OYW A;  4MHG A;  1AA7 A;  3PIP F;  1RI7 A;  3GFI A;  3TDU C;  4XRF A;  4RB1 A;  2F5E A;  3BQY A;  5HNF A;  4J00 A;  5IT9 Z;  2LY2 A;  3RI4 A;  3G2B A;  4IOC F;  1G3W A;  3OYG A;  4BQA A;  1MMS A;  1MBH A;  1OYY A;  1P92 A;  3WHC A;  4XLC A;  4Y15 A;  3LST A;  4LB5 A;  3GZ6 A;  2EFO A;  5M5Y J;  3PQJ A;  2KIU A;  2MH2 A;  1SC7 A;  1HQC A;  4NB5 A;  2GZW A;  5CQG A;  4C2U A;  2IGK A;  1OJL A;  3HKZ A;  1SD6 A;  1A35 A;  2XAS A;  3AFH A;  4YEJ A;  2EV6 A;  2CG4 A;  2RDP A;  5EJC A;  1GVJ A;  3M07 A;  1UST A;  2B0L A;  2KRH A;  2EZK A;  1VF9 A;  2H94 A;  3BY6 A;  1GT0 C;  2DDB A;  3ZMU A;  2CV2 A;  3CCR I;  3KE2 A;  1F9N A;  1FTT A;  3BCA A;  2LYC A;  3FMQ A;  4XKB A;  4RM2 A;  4BEH A;  4XKC A;  4DYQ A;  1A31 A;  2O0Y A;  1FOX A;  1XCV A;  2FEZ A;  4XK4 A;  1CQT A;  2AXL A;  2FNA A;  2HFH A;  1WQ2 A;  2BE5 F;  2CWE A;  2EPF A;  1YJ9 I;  3PO2 J;  3KET A;  3CCV I;  4M3F A;  4HW0 A;  3KX2 A;  2O9L A;  4LJZ F;  2EIK H;  2VB6 A;  4Q47 A;  3DV8 A;  3GCM A;  3TMO A;  1XN7 A;  5DDG A;  1YO5 C;  2X1D A;  4XR6 A;  4BYY A;  2L0K A;  4LIV A;  4ENK A;  2DFE A;  5K1Y A;  2CW7 A;  3K2Z A;  3J7Z I;  1IF1 A;  3E3V A;  3T5X A;  3VPR A;  3L2U A;  2HGC A;  1WCM J;  2XGX A;  3QWL A;  4NQW B;  4CZC A;  3S1M J;  1BC7 C;  3HUG B;  1O3S A;  3FM3 A;  1B9M A;  1S29 A;  2P5K A;  1QPI A;  2PFB A;  2DOE A;  3ZQL A;  2QVO A;  5A2Q K;  3KCC A;  2FU4 A;  3OYN A;  1YJW I;  2ZKZ A;  1BM9 A;  2B9S A;  1MDM B;  3HRS A;  2NS8 A;  2DT5 A;  4IHX A;  1J5Y A;  2G7H A;  5EG0 A;  2LY9 A;  1WZ2 A;  3VYR B;  5D5V B;  1FLI A;  2JRT A;  3CUQ C;  3F9K A;  1ETO A;  4UUS B;  1QBJ A;  3JR9 A;  5M5X J;  1Y8Q B;  1ZKG A;  4NC6 A;  3ASN H;  3ZQI A;  3HC7 A;  3CMY A;  1OYI A;  5TGT A;  4M6X A;  1FSH A;  2QGU A;  1FBS A;  3J81 Z;  2KZG A;  4UY8 I;  2OBP A;  3I4P A;  1XDU A;  5HDK A;  3W2V A;  3H3V K;  2VAS A;  1IJW C;  2EB7 A;  2I10 A;  4HF0 A;  1VQN I;  5DYM A;  1XGS A;  2MW8 A;  5J40 A;  2EBI A;  1H8A C;  2XB5 A;  3TP0 A;  5ICF A;  3DLA A;  1ZGW A;  4XRS A;  3GFM A;  3D5S C;  1KYW A;  1QVU A;  1Y8R B;  2VBW A;  3ML6 A;  1B4A A;  2DQR A;  3E6M A;  2Y75 A;  4FQG A;  4ASN A;  2NRA C;  1OQY A;  2QSF X;  2XKP A;  2DA2 A;  5KAI C;  2DO7 A;  1ZG5 A;  3HEF A;  1XSV A;  2K9M A;  5AIQ A;  2FNP A;  4D9J A;  1JJ8 C;  3S15 J;  2KZV A;  2BV6 A;  2DDA A;  5DV5 A;  5EYR A;  4RAY A;  3O6B B;  1YW7 A;  4IZZ A;  4GYG A;  2V6E A;  4QSH A;  3K6G A;  3PO3 J;  2VJI A;  2H8W A;  5L3G A;  3QPL A;  4RMN A;  2IAI A;  4CH7 A;  3ECO A;  4EVI A;  1YRN A;  1Z91 A;  5F0F A;  3HZJ A;  3K69 A;  4S04 A;  3GYH X;  4RA2 A;  1MH4 A;  1X3Z B;  2W48 A;  2CRG A;  1FNN A;  2EIM H;  4RBO A;  3JRI A;  1RIO H;  1R49 A;  2VUM J;  1TZL A;  1ON1 A;  3ABL H;  4KIG A;  5JLW A;  4U87 A;  4CCL A;  4HDV A;  1CF7 A;  4MO7 A;  1VQO I;  4LG3 A;  4XKV A;  2E7W A;  4KN4 X;  3S8P A;  4EM0 B;  4Y13 A;  2J5O A;  1YJN I;  2PJR A;  4C30 A;  5CVV A;  4PJN A;  2RVC A;  3R61 A;  3FHZ A;  3ABM H;  1LKX A;  2QBY A;  1IRF A;  3V8L A;  3V42 A;  1H0M A;  2VPL A;  1U78 A;  2IVM A;  1LJ9 A;  3C7J A;  1UCR A;  4M3G A;  3WOD F;  1STZ A;  1OKR A;  5HDG A;  1UHW A;  2V4J C;  2PI0 A;  4YRV A;  2K4B A;  3HRM A;  2ZNZ A;  5KK1 A;  4IHT A;  2JPC A;  4EQQ A;  1JGS A;  1WGX A;  3QOD A;  2CFX A;  1I1G A;  1W5T A;  4HG2 A;  3AG3 H;  3A01 B;  2HDD A;  3DKX A;  1TL8 A;  2PN6 A;  2K85 A;  2DMP A;  3E6D A;  3JRC A;  2N8G A;  2R93 J;  3DEW A;  3S93 A;  3HOT A;  2LR8 A;  3DKW A;  3B6C A;  3I3L A;  2BY2 A;  1TC3 C;  1F4K A;  2AQE A;  3MKZ A;  3SDB A;  1W7P B;  1LNW A;  4E6K G;  3AG2 H;  1TT5 B;  2XF7 A;  4YG2 F;  4C3I J;  1O4X A;  3OR2 C;  4X1E A;  3MWM A;  1ZYR F;  4MEX F;  4IHW A;  4P1W A;  1MNE A;  5J1Y A;  3CDI A;  2ZSH B;  4RB0 A;  2M45 A;  3OYF A;  1R71 A;  4CIC A;  4OIQ F;  2MAB A;  1B1B A;  3BG6 A;  3IWF A;  2ZFU A;  3W6V A;  4HST A;  9ANT A;  1A6I A;  2YS9 A;  3V8K A;  1IAW A;  4GFB A;  2DCE A;  2BW3 B;  1MBJ A;  4L5J A;  3S2H J;  3QOP A;  3V7C A;  2GXB A;  2Z2S B;  4JX6 A;  4NHJ A;  3P5J A;  3QP6 A;  1WSU A;  1Z1D A;  2COM A;  1KU7 A;  4BNC A;  3LMM A;  3TQN A;  5IYC J;  1NK2 P;  1S6L A;  3DPT A;  3CUQ A;  4FCY A;  3IH4 A;  2BZT A;  4BEH B;  3GTQ J;  1F1Z A;  2OQR A;  2EFP A;  3JAM Z;  1X1D A;  1WFX A;  3OYH A;  1JKO C;  1I5Z A;  1WJA A;  4JOM A;  3RIR A;  3DU6 A;  4RAZ A;  5B5E C;  5GP9 A;  2UZK A;  4RGR A;  1JXS A;  3NWT A;  1TLH B;  2OJE D;  3RKW A;  2HOE A;  3IKV A;  1U2W A;  3ROU A;  3E6C C;  2M5W A;  4DNC A;  3UKG A;  4WXH A;  3P9C A;  4DIQ A;  3MD2 A;  2KIM A;  2X85 A;  1HC8 A;  2X6O A;  5E18 F;  3CCS I;  3GTP J;  1PYV A;  4AUX A;  2ID3 A;  4ZYE A;  1ZN2 A;  4A3E J;  1W1W E;  3SZT A;  4L9J A;  4DBR A;  2MSY A;  4E7L A;  1MZB A;  2RQP A;  4XLA A;  1REP C;  3PL8 A;  3RSN A;  4WXC A;  1D5Y A;  5TJJ A;  5LHI A;  4Z6Y A;  1T39 A;  4EJW A;  1YX5 A;  2IGO A;  2LFB A;  4IKF A;  1MMA A;  5B1A H;  2E5Z A;  5EEH A;  3GZN B;  1BW6 A;  2NOJ B;  1RUN A;  1MKM A;  3LQR A;  1U9N A;  2ZCW A;  5EG0 B;  1IXR C;  1G2H A;  1KU9 A;  2A5Y B;  4UV9 A;  1H9G A;  3FMS A;  5EEG A;  1U3E M;  1K78 A;  3M9A A;  3QU3 A;  3WHB A;  4I0A A;  5BPI A;  1O3R A;  2XRN A;  2DXI A;  1V5G A;  3MAJ A;  4OIO F;  5L3E A;  4ESJ A;  2E1M C;  3EDP A;  3R60 A;  1R5I D;  4B1R A;  3JRA A;  1TQP A;  1UG0 A;  2QKM B;  3O8G A;  2K27 A;  4HQM A;  4XN0 A;  1R23 A;  1X3U A;  5FLV A;  2W7N A;  4IRG A;  1JI8 A;  2DLL A;  5B66 C;  2VC0 A;  3LA3 A;  4M9S A;  1S5L C;  3FXM A;  3L7W A;  4UB8 C;  1VQ8 I;  4JX5 A;  3AL0 B;  3RPU D;  1CGP A;  3FF5 A;  1JKP C;  4IPA A;  4ZDL A;  5BS6 A;  4LMY A;  3QPT A;  4W97 A;  4LK0 F;  3H9G A;  3OS1 A;  3R0J A;  2HVQ A;  4RB3 C;  2MGQ A;  1Z3X A;  5LRS A;  5HLG A;  2XPW A;  3TOB A;  4DBQ A;  5C4J J;  3WTV C;  4QTR A;  2LKS A;  4II3 A;  4IL6 C;  1UAA A;  4CGZ A;  2DPD A;  2FD5 A;  1YRN B;  1GV5 A;  1NG6 A;  3IAS 2;  4H0E A;  5HVQ C;  4G6T B;  1X19 A;  2ZB9 A;  4ZH4 F;  3M4O J;  1I3A A;  1ON2 A;  2LC2 A;  1JT6 A;  2ZXJ A;  3K9T A;  1HBX G;  2X6Y A;  1QVT A;  2FBH A;  3GX4 X;  4E7I A;  2TDX A;  1UZC A;  1CF7 B;  3A03 A;  3DBR B;  4MQ9 F;  3FXL A;  3OSF A;  3IUO A;  4HV5 A;  4JX4 A;  3CP2 A;  2PJR B;  1ZRE A;  2DT7 B;  1VQK I;  1ERD A;  2YX4 A;  1ETX A;  4AYB A;  1LE8 A;  2QBY B;  4YIF A;  2ZJR F;  5E8G A;  2K9L A;  1FEX A;  2EV0 A;  2K5C A;  4JP0 A;  4KUM A;  5L3C A;  3OYJ A;  1D1C A;  3WE2 A;  3JTG A;  2QYO A;  2YX7 A;  5KHD A;  4NDL A;  3C2G A;  3B73 A;  3AKZ A;  2ELH A;  2QM3 A;  4Y52 J;  1SAX A;  4AM3 A;  4AU7 A;  4NUB A;  3SZP A;  1YTY A;  1DQU A;  4ESB A;  2VXD A;  2BOL A;  5DS9 A;  3W2A A;  1U0J A;  3SXY A;  5L3F A;  3DTK A;  1U8R A;  3GTG J;  2DYS H;  4HX7 A;  3EQL F;  3ONQ A;  3VFZ A;  4IX7 A;  1XSD A;  1XTA A;  4ENN A;  4JQF A;  3VYU B;  3MZ8 A;  3KEQ A;  4IO9 F;  1HF0 A;  3OIO A;  3F8F A;  5HDN A;  1WI3 A;  2AQF A;  2GBY A;  2HOA A;  1J0R A;  3PNT A;  5FFX A;  2DTZ A;  3HGY A;  3NAR A;  3R0A A;  2A6H F;  2LY1 A;  3ERE D;  4B8X A;  1PUF A;  3BR3 A;  4G7O F;  4MFE A;  2NAZ A;  2E36 A;  5D5W B;  4ZYD A;  2ZJ2 A;  2XRL A;  4RLQ A;  2MBF A;  4HF1 A;  2KDO A;  2HS5 A;  3L1P A;  4XOR A;  3U9G A;  1ETV A;  3H0G J;  2M34 A;  3CD6 I;  3ECH A;  1T33 A;  2E60 A;  4BS9 A;  4UUS A;  3CO7 C;  2QSG X;  3OV8 A;  1ITY A;  2X51 A;  3KZZ A;  2XB0 X;  2XAH A;  4HSR A;  1VQ4 I;  3K4K A;  2DPU A;  2GQQ A;  1R1U A;  2GWR A;  3KP2 A;  1FOK A;  4AYB N;  3KP3 A;  3LQQ A;  5K5O A;  5D8K B;  5FRM A;  5BMZ A;  4RB2 C;  2MC3 A;  4A3M J;  4BJT A;  5HOO A;  1KZH A;  4C9Y A;  3QYF A;  3HL2 A;  1JHH A;  2PX9 A;  3HYI A;  2Z9O A;  4GCV A;  1T38 A;  2Y0S A;  3BP8 A;  1HW5 A;  1ORK A;  3FWE A;  3I4M J;  3HIF A;  4PFO A;  5FJ8 J;  2R7S A;  1G8X A;  3QPH A;  4M3B A;  3LNQ A;  3FXU A;  5E3L A;  4A3D J;  2DFF A;  2F5F A;  1QO0 D;  5K7H A;  3ZMZ A;  3DKY A;  4N9I A;  5K5R A;  1HKT A;  3RTR A;  1EH7 A;  4C2T A;  3I71 A;  3BTI A;  3KZI C;  4ESF A;  2XSD C;  2LSO A;  3F6V A;  1QHH D;  4IHV A;  2E1O A;  3L00 A;  1ZG3 A;  2F48 A;  4M74 A;  4KIS A;  2BXZ A;  1TW3 A;  4YII A;  3ZQC A;  3DBL B;  2H6B A;  4GGG A;  3FMR A;  1HKQ A;  2FUG 2;  3GTM J;  1S9H A;  2JUC A;  4PSW A;  2EA2 A;  5ICC A;  4ITV A;  4WXD A;  3SEQ A;  4XLP F;  5LBQ A;  2IS4 A;  3IH2 A;  5DCF A;  2P8T A;  5HLI A;  2KLO A;  5FLX K;  1BN5 A;  2OA4 A;  4MIM A;  3GXO A;  5J6X A;  1MJA A;  2ZFW A;  5FRN A;  2A5W A;  1V3F A;  2ELJ A;  5CYV A;  1WHU A;  2LRE A;  1OCR H;  4CHU A;  4KA4 A;  2L01 A;  1IN4 A;  2KJC A;  1X1A A;  2KQR A;  4BE0 A;  1T8I A;  1ULY A;  3H3Z A;  3OWT A;  4F3Q A;  1TP4 A;  3CMM A;  1S7O A;  3PNY A;  5IPA A;  2OTL I;  3M8E A;  4E7K A;  1Z7U A;  4LIT A;  1YIJ I;  2BY1 A;  2WAE A;  2H1L A;  5F64 A;  1POG A;  2QF7 A;  1XC5 A;  1UMQ A;  3HOZ J;  1H88 C;  4G12 A;  3K1N A;  5DM7 F;  3C18 A;  4I7H A;  1ZR2 A;  2FMY A;  3VSL A;  5JVG F;  1D0X A;  3PM1 A;  1USS A;  1QZY A;  4ZTF A;  3EUH C;  3H3U A;  5FKM A;  3ZQH A;  4FTH A;  3ZQG A;  2Y0S N;  3WTX C;  1QRY A;  4GXO A;  2XPU A;  3MZY A;  4BE1 A;  1KGS A;  3JW4 A;  1IUF A;  4XSZ F;  4BHC A;  2KRF A;  4YFK F;  1RKT A;  4L5E A;  5CVR A;  1WPK A;  2ZXI A;  3B02 A;  3KEO A;  2K9S A;  1SVO A;  3W6K B;  1E17 A;  1WJD A;  2B7E A;  1XMX A;  5BOX A;  1J9I A;  1MSF C;  2ID6 A;  2WV0 A;  1IV6 A;  5J1U A;  3PIO F;  4XN3 A;  3ZN1 A;  1VFC A;  4A3C J;  5GTI C;  3EYY A;  1I39 A;  2HWV A;  4PDK A;  3A0H C;  5H20 A;  4Q5S F;  3HBL A;  2LDU A;  4CA0 A;  1D3Y A;  3ASO H;  1GV2 A;  3M8F A;  3JRG A;  3S14 J;  1FYL A;  2JSP A;  2LLK A;  1Z05 A;  1TWC J;  4FHT A;  2EFW A;  2Z99 A;  2DT6 A;  4RAG A;  2M7A A;  1WJ5 A;  1SFE A;  5DUK A;  1QHG A;  3HGG A;  2A61 A;  1BBY A;  4HNV A;  5F08 A;  3BTJ A;  3K10 A;  4CDG A;  1GUU A;  2BW3 A;  1BR4 A;  3ZOB A;  2XPV A;  1QZE A;  1Y0N A;  2W57 A;  4L9V A;  3LSM A;  5E3N A;  2BVM A;  3F8N A;  1LE8 B;  2K40 A;  1I3Q J;  4L5I A;  4XON A;  4ANJ A;  2CS3 A;  1X4O A;  2H8R A;  3GTO J;  3J80 K;  4QPO A;  5D6E A;  3OIP A;  2VKD A;  2HU9 A;  1FY7 A;  4FAS D;  1J2X A;  2X0L A;  2STW A;  1W7P D;  4E70 A;  5FO5 A;  3K4J A;  4E4H A;  2VIX A;  4RM3 A;  5E8I A;  2CQK A;  2WWY A;  1R58 A;  1U8B A;  2JA7 J;  2VKH A;  2JJ7 A;  1IXC A;  3K4C A;  2RC4 A;  3I64 A;  2VQG A;  3K1P A;  1T2K A;  3Q0V A;  2ADU A;  2CUJ A;  4BJ5 C;  4YIR X;  4C3H J;  1HLV A;  2O3F A;  2LF7 A;  3GEZ A;  3Q0W A;  2X6X A;  2XIG A;  4U0W A;  4FE4 A;  1E2X A;  3OYI A;  4HBL A;  2M4G A;  2VT3 A;  3HTS B;  1N75 A;  3WTT C;  3CJN A;  4HF2 A;  2VKE A;  1Z0X A;  2PMZ A;  4E7J A;  3CCE I;  3RDI A;  4AWX B;  1PUF B;  1WVR A;  4BAY A;  1YFH A;  3PFY A;  3ZPL A;  4Y33 A;  1O57 A;  3BCB A;  3CCM I;  2IS2 A;  3S3N A;  1PVE A;  2Z3Y A;  1YQA A;  2D2W A;  2HYJ A;  3MKW B;  1IXS B;  1ZR4 A;  1YIO A;  2JSC A;  4KIC A;  2STT A;  4R1H A;  3G1O A;  4F55 A;  3N05 A;  3BR0 A;  4MTD A;  2FOW A;  2MH9 A;  1ODD A;  1W5C C;  5IYD J;  2DA7 A;  5C3E J;  5ILV A;  2VC1 A;  3MCZ A;  2OQG A;  2L3D A;  3VOE A;  3CC4 I;  2HDC A;  3F72 A;  3WTU C;  1MH3 A;  2DA6 A;  3BJ6 A;  3KEY A;  3CLO A;  3KZY A;  1FJL A;  2MLG A;  2ESN A;  5FKK A;  2O6G E;  2IXS A;  5D5X B;  2K02 A;  2CV0 A;  3VB2 A;  3SYT A;  2DI3 A;  3LSR A;  3BZK A;  1JKQ C;  2DAO A;  4AD9 A;  2L9R A;  4YEL A;  1MGT A;  2E1M B;  3L2V A;  1Z21 A;  4CCO A;  2R4G A;  2QWW A;  3DPU A;  3OYE A;  3RKX A;  2CUZ A;  4XRM A;  3TOA A;  1SFU A;  4MEY F;  1RES A;  1TQI A;  3CUO A;  1YS7 A;  4Y7N J;  3SHF A;  1RNL A;  3ISP A;  3V8J A;  2GM4 A;  3EUH A;  3JRH A;  4PK4 A;  5J8F A;  1JT0 A;  2JTV A;  2K86 A;  4I98 B;  5J1R A;  3CC7 I;  5JVT A;  4AIK A;  4I2O A;  2VL8 A;  1IUY A;  4D0P A;  1FSE A;  3SQN A;  3N4M A;  5CQE A;  2CO5 A;  2XAF A;  4ZJZ A;  2WAF A;  3HJE A;  2MC4 A;  2PMZ N;  1EH6 A;  2IEK A;  1FP1 D;  2OD5 A;  1F5T A;  4IXA A;  2CV1 A;  2DA1 A;  1LFU P;  3IAM 2;  3U2R A;  3HB9 A;  2M3A A;  4D7M A;  3FK6 A;  4ZZL A;  4A3K J;  2V1N A;  3E5Q A;  4B09 A;  1U5T C;  3C1D A;  1FIP A;  3ZGK A;  1R1T A;  4DZJ A;  1YG2 A;  3U1D A;  1LB2 A;  1G59 A;  4BY1 J;  2J5P A;  5TRD A;  3COA C;  1R5G A;  1A36 A;  4XKW A;  4GYI A;  4X0G A;  3LSK A;  1FC3 A;  2LRD A;  1HDP A;  3HPG A;  3BPV A;  1EF4 A;  2CQQ A;  5J47 A;  2HVS A;  1X1C A;  4HX4 A;  2JVG A;  4KYW A;  4V19 K;  1IDY A;  1X4P A;  1FYK A;  3TO7 A;  2PBI A;  2PQ8 A;  4RGX A;  4FIS A;  3ERM A;  2JMW A;  3MEX A;  1BIA A;  3NRV A;  1K4T A;  3LOC A;  3ABK H;  4YFX F;  4Y4R A;  4JYK A;  2VQL A;  3LL7 A;  3I5U A;  3PQK A;  4PJL A;  2ACJ A;  1Z67 A;  4HLY A;  2IGM A;  2HXI A;  1G3T A;  1KU2 A;  2QEX I;  1AWC A;  3GTK J;  2DYR H;  2WAD A;  1J09 A;  1R36 A;  2VE8 A;  1SD5 A;  2EJR A;  5GAE J;  2X48 A;  2RN7 A;  1VQ7 I;  2CGP A;  5FLX Z;  3K7A J;  1R00 A;  2CUF A;  4M9Z A;  3LAJ A;  1BIB A;  2O7O A;  3HOY J;  5GAG J;  1HW2 A;  3FKI J;  3S3O A;  4YFN F;  3S1Q J;  3HSF A;  1R22 A;  3FK7 A;  4E7Z A;  4BQO A;  2Y31 A;  4ENM A;  1DPR A;  1LQ1 A;  4P9F A;  2FA5 A;  1MMG A;  3PUF A;  1FX7 A;  2XGE A;  4XLF A;  4UHT A;  2WAQ N;  5FRO A;  2KIS A;  1BJZ A;  2Y69 H;  3OYK A;  1G3Y A;  1MD0 A;  1UJ8 A;  4ZDP A;  1OCT C;  1FPQ A;  4TV7 A;  3Q9V A;  1XSX A;  4U7D A;  1R1V A;  2QQA A;  4B44 A;  4F92 B;  2VE9 A;  2A6T A;  2MA3 A;  4OMZ A;  4A5M A;  2LKX A;  4C3J J;  3E6B A;  2R7V A;  4CUG A;  3K4B A;  3P9I A;  3BZC A;  3U21 A;  1SAU A;  4CYC A;  1SFX A;  2A6E F;  1XGN A;  3OOU A;  3SFZ A;  4EAT A;  5LGT A;  1S8N A;  1QU3 A;  5E1X A;  2IJL A;  1VQM I;  2V1U A;  4ZYG A;  4L18 B;  5JHF A;  2LBF A;  2DN0 A;  1JHF A;  2AO9 A;  2RNG A;  4HA8 A;  3CDL A;  1FBU A;  3JRF A;  4IHS A;  1S7E A;  2QUF A;  2R3S A;  1TWH J;  1YLF A;  2Z5U A;  2M87 A;  4C2M J;  4G7Z F;  4D7N A;  1VQL I;  2DOA A;  2LK2 A;  3VSK A;  1O3T A;  3HM5 A;  1P2F A;  2AXT C;  1SMT A;  3WU0 A;  2A3S A;  4BDZ A;  1LFB A;  1IN6 A;  2R7O A;  5JI6 A;  3JRB A;  4WX9 A;  1V4R A;  3OYM A;  2GA1 A;  5EZH A;  2QLZ A;  2Z33 A;  2FBI A;  3KP5 A;  3F8B A;  3WU2 C;  2F5V A;  1ZRD A;  3DQV C;  1R5H A;  5FGM A;  2JWT A;  3Q0U A;  5LGU A;  2BBY A;  4OIP F;  4XOT A;  1FYM A;  4XMY A;  4AVP A;  3I55 I;  4B47 A;  1QQI A;  1U6G A;  2OC6 A;  3H35 A;  4PJJ A;  2RQQ A;  5GPA A;  4OAZ A;  3L2C A;  4PCQ A;  3LSG A;  3TDZ C;  4BU2 A;  5GAD J;  2XAQ A;  1TWG J;  2NS0 A;  2PMU A;  2XVC A;  4EJU A;  2XAU A;  3J80 Z;  4RDU A;  1W5S A;  3I53 A;  1UEL B;  3T8R A;  3BJO A;  2R7X A;  1QZZ A;  1RC9 A;  5HLH A;  4EMS A;  4KFC A;  2HQA A;  2WC2 A;  4BXX J;  4UNO A;  1MBK A;  3BOQ A;  3ZRG A;  3ZMD A;  4M71 A;  4CSW A;  1HSJ A;  3RKY A;  3CJQ B;  4HYE A;  2IS6 A;  2IW5 A;  1I27 A;  1Z7L A;  5DD4 A;  2R7T A;  4LG0 B;  5ILS A;  3GWZ A;  2VKV A;  3DFG A;  4V2F A;  3EYI A;  2R7D A;  5IT9 K;  4G8X A;  1Z3Y A;  1GXQ A;  2K9N A;  2Q2E A;  3BWG A;  3VYT B;  2JZY A;  5A2Q Z;  3OYC A;  3K4N A;  3OL3 A;  3FXJ A;  4NNJ A;  4KMF A;  2L7K A;  4A0X A;  4A5N A;  3KP7 A;  1X1P A;  5IP7 J;  3MQ0 A;  3TO6 A;  1BR2 A;  2YUS A;  3VOD A;  1EV7 A;  1DPU A;  2GOX B;  3AG4 H;  4HNT A;  2V9V A;  3L09 A;  1TNS A;  4RS8 A;  1I1S A;  2ZSI B;  5HS9 A;  4Y3O A;  1T98 A;  5IP6 A;  3WTW C;  4PJ0 C;  1HXD A;  5LD2 C;  1X3W B;  3FBN B;  3DWL E;  2KJB A;  4QWQ A;  1P7I A;  5DD8 A;  2BY3 A;  2DOF A;  4IVN A;  2NVX J;  4GO1 A;  1ZAR A;  2FE3 A;  1GVD A;  3LSP A;  1A04 A;  2D1V A;  3HSE A;  1VI0 A;  2QA4 I;  3L2Q A;  1HDD C;  1Z77 A;  4I99 C;  1SEU A;  2HEO A;  1R4N B;  5FKL A;  2ZO4 A;  3RKQ A;  4E7H A;  1HA8 A;  3TO9 A;  3QYE A;  3TED A;  1BC8 C;  3D0S A;  4UB6 C;  1BR1 A;  3CP8 A;  4HOB A;  5LGN A;  4S05 A;  2K7L A;  1OCC H;  2X4H A;  3SZG A;  5M3F J;  1Z6T A;  2L7M P;  4M3E A;  4LB6 B;  2ME6 A;  3DF8 A;  5FFZ A;  3DBH B;  5KNL A;  4A3I J;  4P5O A;  2L2O A;  1JKR C;  3E5X A;  2UXX A;  1BOB A;  4D5C A;  3K70 C;  1LVK A;  2IRF G;  4EGY A;  2ZBK A;  2JT1 A;  2GOM A;  2ZXH A;  2HPM A;  3KPH A;  3G1L A;  4G6Q A;  1YX3 A;  2HTJ A;  3W2W A;  2O8X A;  1AU7 A;  3CDH A;  3CF2 A;  2M8E A;  3V7R A;  3P9K A;  1ZH5 A;  2GLO A;  4L9N A;  4B48 A;  1B6A A;  4XM3 A;  3BR6 A;  2XV4 S;  1XG1 A;  1WJB A;  1KQ8 A;  1BI3 A;  1IN5 A;  5D8L B;  3OIQ A;  1K7A A;  4RLF A;  2IA0 A;  4QIW N;  2H1K A;  3S16 J;  3RZD J;  1ONV A;  4IRH A;  2L9V A;  2E35 A;  3A2K A;  4WK8 F;  1G4D A;  2OUM A;  4BBR J;  1MBE A;  2GXA A;  2FSW A;  2OAZ A;  5CPR B;  1V5F A;  2A69 F;  2QKL B;  3L2W A;  2XUB A;  4MGR A;  3L2R A;  2BGC A;  5F0C A;  2MFZ A;  3H0D A;  4D5F A;  3KIO A;  2YR2 A;  2D45 A;  2JA6 J;  2YU3 A;  2M30 A;  2L9N A;  2CMP A;  3RYR A;  3BG3 A;  1YYV A;  1GLN A;  2BEO A;  3OL4 A;  3R6S A;  1YW9 A;  2WB1 N;  1O7F A;  3OYL A;  3H92 A;  4Q48 A;  4NC7 A;  3JTH A;  2E5N A;  4LIU A;  3QU6 A;  4HDU A;  5F27 A;  4BXU A;  4CYC B;  1SFO J;  1LVA A;  2K3P A;  1KA8 A;  2EFN A;  2CQN A;  3N97 A;  6PAX A;  2VPR A;  2XF6 A;  4EJV A;  5GTH C;  4XLE A;  2V7F A;  1LUJ B;  3NEU A;  2LBF B;  3FIW A;  3ULQ B;  4A6D A;  1ENH A;  2DMU A;  1FT9 A;  4UVB A;  3CES A;  3SJM A;  2AS5 F;  3HOW J;  2EK5 A;  3FXR A;  3T8T A;  5FB2 A;  5ERI A;  4PGH A;  2JQ7 A;  2V1D A;  1FIA A;  3SEZ A;  3SDG A;  3G71 I;  3G6E I;  2BHY A;  4ZC3 A;  3ZQF A;  2BY0 A;  5J8C A;  2GAU A;  2V9K A;  1T0F C;  2F6C A;  2R7Z J;  1LEA A;  3NQO A;  4BY7 J;  3V4G A;  4EV0 A;  2G7U A;  1GHC A;  1MJ9 A;  2PEX A;  2VOP A;  2E2J J;  2X6W A;  2FRH A;  2KDZ A;  3T1B A;  5ICE A;  1YI2 I;  1NH3 A;  1LDD A;  5IT3 A;  3IH3 A;  5M5W J;  1RKW A;  1GXP A;  4BBS J;  2DOD A;  3GME A;  2VQH A;  4A69 C;  2ZJQ F;  1W0T A;  1YW8 A;  4FX4 A;  2QQ9 A;  2L54 A;  3HRU A;  4M73 A;  3F23 A;  1P4A A;  4PFP A;  2Y48 A;  2IT0 A;  1FMV A;  1WI9 A;  2ZME C;  3T0Y A;  1DP7 P;  4WF2 A;  1D8K A;  2F4I A;  3GVA A;  4HAM A;  5EZG A;  1A5J A;  3P7N A;  1BI1 A;  4K2E A;  4M6Y A;  2LP0 A;  4EJT A;  2HOT A;  3K0L A;  1OCZ H;  2I8D A;  4H4K C;  3WTS C;  2L9S A;  5L3D A;  5ICG A;  4RGS A;  3QP5 A;  2NYX A;  2R5Z A;  1XS9 A;  2EQR A;  2HKO A;  1TT0 A;  1C0W A;  3WG9 A;  4BUP A;  3E1S A;  1S3J A;  3U1K A;  3LSH A;  2L5Q A;  1U5T B;  2HYF A;  1MMD A;  2O8K A;  2HNH A;  4A3G J;  1DU0 A;  3FIS A;  3TBI A;  3BTC A;  4CYD A;  4U7B A;  2ELK A;  4KIF A;  3L9F A;  3JCU C;  2E1N A;  4PZJ A;  3OS0 A;  3GTJ J;  3A02 A;  1JTX A;  2R7W A;  2XSJ C;  4B3A A;  1AKH B;  4IEJ A;  2VON A;  1R4M B;  4M9X A;  3H9Q A;  2Q2E B;  1TNT A;  3TW7 A;  3ZP5 A;  5DCM A;  4O3M A;  4A0Y A;  4BQN A;  2JA2 A;  3ZXS A;  2WV1 A;  2XGD A;  2HVR A;  1Y1V J;  3BZ6 A;  4XOP A;  3BRO A;  3CF5 F;  3BR1 A;  2CQ7 A;  1E3P A;  2TCT A;  5AIP A;  2LD5 A;  2DFH A;  3REO A;  3F8M A;  1UHS A;  1D5V A;  2L7F P;  2O61 A;  3LFK A;  1F43 A;  2FXA A;  5M3M J;  2A68 F;  1P4X A;  1EJ9 A;  4IQJ A;  2P5L C;  5AON A;  1T95 A;  5BPD A;  2LNB A;  2F4O B;  2Q0O A;  3KYD B;  1ZRC A;  2OV7 A;  3HOX J;  4KNY A;  1DDN A;  2FQ4 A;  2OCE A;  5IY5 H;  1YE9 A;  4HQE A;  3WE3 A;  5K7Z A;  3H9J A;  4LD5 A;  1OMI A;  2R7Q A;  3OMY A;  1RR7 A;  3JAM K;  1D0Y A;  3GBG A;  2ZNY A;  4A2U A;  1K6Y A;  4N4O B;  4ZDO A;  2CW0 F;  2DJI A;  1APL C;  2P0W A;  1XMA A;  4I01 A;  1LPQ A;  3JRE A;  5F0H A;  2UWM A;  4J19 A;  1ZLK A;  3CJT B;  3KP6 A;  3BR5 A;  4MFD A;  1PDN C;  3MKL A;  2IA2 A;  3ELK A;  4KIT B;  3OOP A;  2R7F A;  2LKP A;  2VXZ A;  1Q1H A;  2QSH X;  4XL9 A;  2K3F A;  1WRJ A;  3RYP A;  3H5N A;  5IP9 J;  3K70 D;  1XPX A;  3W6J B;  1MMN A;  2DMT A;  1TWA J;  3DTI A;  5KVR A;  1J75 A;  4N9H A;  4PSX A;  4BQQ A;  2NVQ J;  2ISY A;  2VJ4 A;  4N0B A;  3OS2 A;  4WCG A;  3JSO A;  2KL4 A;  1W36 C;  3RJP A;  5LHH A;  2Z16 A;  3CQZ J;  2R0Q C;  4HLX A;  4XRS G;  2W84 A;  2QEN A;  4CXF A;  3H5R A;  4HNU A;  4MQV A;  1FBQ A;  5FKN A;  2CJJ A;  2Y0M A;  4LOC A;  1L0O C;  2PJP A;  3C2H A;  1VTN C;  3Q3S A;  3CO6 C;  3F6O A;  3J7A O;  1OIS A;  5HLT A;  4BGD A;  4EM1 A;  3H5A A;  5DM6 F;  2MD0 A;  3KFW X;  3PNV A;  4XBF A;  1TQM A;  2MD5 A;  1ZQ3 P;  2EIN H;  2GIZ A;  4MLO A;  3J7A Y;  1T0F A;  2V1X A;  1JUP A;  5TIS C;  1ZLJ A;  1SVL A;  3LA2 A;  5E1W A;  1EH8 A;  3VDX A;  4CZZ A;  1SD7 A;  2JRM A;  1I6X A;  1KYZ A;  1Y56 A;  2HTS A;  4Z2Y A;  2NVU B;  2M9H A;  3A1Y A;  1QA6 A;  2KPM A;  4A3L J;  5FLM J;  1FZP B;  5CKT A;  5FD5 A;  2HOS A;  1FP2 A;  1R6R A;  4OWR B;  3WGI A;  4B3X A;  3H1C A;  3LSI A;  3ZQQ A;  2ZME A;  2ECB A;  2NS7 A;  5HOD A;  2JPB A;  3MFK A;  2M0M A;  3RQI A;  2R7R A;  1WJF A;  3HTU A;  1OFC X;  1K83 J;  4A6E A;  5BNG A;  4FT8 A;  5E20 A;  3KYL A;  1LEB A;  2P6T A;  1YHQ I;  2OCC H;  2Z1D A;  4KIB A;  1OR7 C;  2WA0 A;  2IBD A;  3OY9 A;  1MSE C;  1LDK B;  4LG0 A;  3HHH A;  3X2Q H;  3BG5 A;  4AC0 A;  4IF4 A;  4R8H A;  3WTZ A;  3HKZ N;  2VJ5 A;  2L7Z A;  1SVM A;  2PG4 A;  1WJC A;  2O03 A;  3WU1 B;  4A3J J;  3FZV A;  2EFQ A;  5LFA A;  3S1N J;  4D1Q A;  2VOD A;  1MJB A;  3CZ6 A;  1YOV B;  3VYS B;  2WBM A;  2LVS A;  2M7B A;  2EH3 A;  3BG7 A;  2M4K A;  2ME0 A;  4UVA A;  4M3D A;  2ZJP F;  3FKJ A;  3DLL F;  3D1N I;  1IO2 A;  2F5D A;  2JK3 A;  5CVU A;  3LAP A;  1MIJ A;  5EEA A;  2P7V B;  2XC7 A;  2V26 A;  4LGW A;  2UUZ A;  1N77 A;  2WAQ A;  2DA3 A;  2HR3 A;  3ESW B;  1N78 A;  1MND A;  4QPQ A;  2FML A;  1P4W A;  2VT2 A;  3O8H A;  5C4X J;  3DCF A;  2XGC A;  3KP4 A;  1PUE E;  1Y39 A;  2DFI A;  2HZD A;  1BJA A;  4U0Y A;  4HV6 A;  1DU6 A;  1LDJ A;  2KRC A;  4S0H B;  3BQZ A;  4KT6 A;  4GDF A;  1EKE A;  4AIH A;  4KJZ A;  5JHU A;  5LHG A;  2R5Y A;  3M3Y J;  2VQC A;  2R5Z B;  4BAC A;  5F6F A;  3E7L A;  5GPC A;  2UV1 A;  2ZXW H;  2EZL A;  3HOS A;  4AIJ A;  4L0Z B;  1RRJ A;  4BJ6 C;  2RV8 A;  2W25 A;  3LFU A;  5EGO B;  1IRZ A;  1IDZ A;  4A93 J;  2LH9 A;  1SAN A;  2M2E A;  3GLL A;  3IHU A;  5FKO A;  5KAF C;  1D0Z A;  1HKS A;  4G7H F;  4EGZ A;  4DZP A;  4UUV A;  2WTE A;  4DGW B;  3M1C A;  4I0B A;  5LEJ A;  1NK3 P;  1B8I A;  3DPL C;  4JK1 X;  2DBB A;  3G73 A;  3TKY A;  2XHK A;  1W4M A;  1HST A;  3BG9 A;  3DU5 A;  1ETQ A;  2TRT A;  5K5Q A;  2DA5 A;  5DCM B;  2OTJ I;  1BW5 A;  3GFL A;  1B72 B;  4HEA 2;  5CVJ A;  4F91 B;  3LWF A;  3GZ5 A;  3CME I;  3FHN A;  4EJO A;  4PUS A;  4ZYH A;  2B63 J;  2BXY A;  1J59 A;  2OZ6 A;  2W85 A;  1BI0 A;  3MKY B;  2H6C A;  1G3S A;  3CMA I;  4CCN A;  4M72 A;  4KDP A;  5D5U B;  1M1E B;  3D5L A;  1D8J A;  1UB9 A;  2WY8 Q;  2ZC2 A;  5ED4 A;  1JUS A;  3J7Y J;  2C6Y A;  2R92 J;  2VOO A;  2Y30 A;  2L4A A;  3I59 A;  4RAF A;  1VQ9 I;  2BYV E;  1MBG A;  1ETK A;  4BL0 B;  2DU9 A;  3I9V 2;  2QCO A;  3IWZ A;  3ABU A;  3S2D J;  3RCO A;  2HKX A;  1O3Q A;  3GO5 A;  1TW2 A;  1SFK A;  4I09 A;  4B4C A;  3ZMS A;  4CCM A;  1TWF J;  2KT0 A;  2RGV A;  2LF8 A;  1NG7 A;  3LSJ A;  2W82 A;  3TP3 A;  5ILU A;  1XCB A;  3GW2 A;  3G4S I;  2VI6 A;  4UUT A;  3I58 A;  2MYS A;  3M7G A;  3V7S A;  2QZ8 A;  3G1M A;  3RZO J;  5HNH A;  1P9Q C;  1E3O C;  5EF6 A;  1BI2 A;  4Q4Z F;  1Y6I A;  2M0C A;  1HCR A;  1JJ6 C;  2RKH A;  3ZMV A;  1X2M A;  4ETS A;  2XRO A;  2Q8K A;  2E2H J;  4A3B J;  1K6O A;  1DUX C;  2PLY A;  2VN2 A;  5E3M A;  1W36 D;  2EZH A;  4IQ4 A;  4L0Y B;  3W3C A;  2G0E A;  3IV5 A;  1ACI A;  3HOU J;  3MN2 A;  3WGG A;  4ZTJ A;  4CCJ A;  1IRX A;  4IJA A;  4UVC A;  3OYD A;  2P81 A;  3GTL J;  4I02 A;  3OR1 C;  1P7J A;  2KFD A;  4JBA A;  3B6A A;  4UXN A;  2VJJ A;  5D4S A;  1S72 I;  1OR7 A;  1ZHF A;  1XX5 A;  2W1O A;  5HS8 A;  2IP2 A;  4DOZ A;  3HDD A;  3ZN0 A;  1V54 H;  5H6Q A;  5JLX A;  2IPQ X;  3FM5 A;  2QQB A;  5HS7 A;  2RNJ A;  4ZYA A;  5E17 F;  2CUE A;  3KLO A;  3GF2 A;  4BHB A;  5LRR A;  1MBF A;  2A05 A;  1IRG A;  3EUA A;  1N25 A;  4BKX A;  3NWS A;  2NNY A;  1K61 A;  2JA8 J;  1XGO A;  2HZT A;  2KHM A;  3DTE A;  4NBQ A;  3FDY A;  2BVL A;  1SD4 A;  3UR3 C;  3F8C A;  3QAH A;  3BPX A;  4Y17 A;  3ABT A;  5K7F A;  4A0Z A;  1R9T J;  5LEK A;  5DEQ A;  3VWB A;  4J01 A;  3MVP A;  1VQ6 I;  5D6F A;  3KLN A;  3HG9 A;  5C44 J;  1ZGJ A;  1WH5 A;  2LTP A;  2ZME B;  4KT5 C;  4XNF A;  1T6S A;  3I4N J;  2DQL A;  3RPU A;  2P7C B;  4A12 A;  2HQR A;  3IRR A;  2Y9Z A;  1UHM A;  1G6N A;  2M8G X;  3S2W A;  3QOE A;  3F21 A;  2GXG A;  2X1C A;  1H9T A;  1VQP I;  3C2B A;  1U5T A;  1RPW A; 
#chains in the Genus database with same CATH homology
 1BR4 A;  1TZL A;  3PSI A;  4BE2 A;  3LSM A;  4U87 A;  2R7U A;  2BVM A;  2XF6 A;  4CCL A;  2HPI A;  3D5R C;  4XLE A;  4LG3 A;  3OYA A;  4XKV A;  2V7F A;  4XON A;  4ANJ A;  3S8P A;  2LBF B;  2PJR A;  4C30 A;  2CS3 A;  1V5E A;  1X4O A;  4PJN A;  3PJR A;  3K4L A;  1LKX A;  3CES A;  2VPL A;  3V42 A;  4QPO A;  3BC8 A;  2VKD A;  2HU9 A;  3OIP A;  2CW8 A;  4FAS D;  3K4J A;  4E4H A;  3SEZ A;  2VIX A;  2V4J C;  4RM3 A;  4YRV A;  2VKH A;  4ZC3 A;  4BXF A;  3K4C A;  2VQG A;  2V9K A;  1T0F C;  2F6C A;  3QOD A;  2LG4 A;  2Q1Z B;  2CUJ A;  4HG2 A;  4FET A;  4BJ5 C;  3DKX A;  4F93 B;  2X6X A;  2VLA A;  2X6W A;  3S93 A;  3OYI A;  3HOT A;  4DJA A;  1MW7 A;  2M4G A;  3I3L A;  2AQE A;  3MKZ A;  1N75 A;  3SDB A;  2VQH A;  3S32 A;  4E6K G;  2PMZ A;  4E7J A;  2WB1 A;  4PFP A;  3BLY A;  1FMV A;  3PFY A;  1ZEL A;  1PJR A;  2XF7 A;  4Y33 A;  4II2 A;  3BCB A;  2IS2 A;  2F4I A;  1X1B A;  3OR2 C;  3S3N A;  2JUG A;  4H4K C;  2I8D A;  4P1W A;  1MNE A;  2L9S A;  2ZSH B;  3MKW B;  3OYF A;  2MAB A;  1TT0 A;  1VZ0 A;  3M8J A;  3BG6 A;  2ZFU A;  4BUP A;  3E1S A;  4HST A;  4F55 A;  3LSH A;  2L5Q A;  3N05 A;  4NC8 A;  3S3M A;  2DCE A;  2BW3 B;  1MMD A;  4HPQ A;  2HNH A;  2W00 A;  1LFP A;  2Z2S B;  3TBI A;  4U7B A;  4OAY A;  3OS0 A;  3LMM A;  3KEY A;  2R7W A;  2IXS A;  3DPT A;  2XSJ C;  2CV0 A;  3SYT A;  1DGR M;  3H9Q A;  4YEL A;  3L2V A;  2E1M B;  4BEH B;  1Z21 A;  2Q2E B;  4N4N B;  4CCO A;  2R4G A;  1X1D A;  1WFX A;  3DPU A;  3ZR8 X;  3OYE A;  3OYH A;  2CUZ A;  2JA2 A;  3ZXS A;  1WJA A;  4BQN A;  4JOM A;  2HVR A;  4B43 A;  4XOP A;  3DU6 A;  3EPZ A;  3NWT A;  4XQF A;  2X1E A;  4GRI A;  4IQJ A;  4PK4 A;  4DIQ A;  1T95 A;  3MD2 A;  2X85 A;  1WJE A;  1PYV A;  2IS1 A;  2OV7 A;  2VL8 A;  1DP3 A;  5CQE A;  1YE9 A;  4DBR A;  4ZJZ A;  2CFO A;  3H9J A;  2WAF A;  4E7L A;  2R7Q A;  3OMY A;  4E7S A;  2MC4 A;  2W4S A;  4XLA A;  1D0Y A;  3PL8 A;  3RSN A;  3GBG A;  2HDW A;  2LOO A;  1K6Y A;  4N4O B;  1YX5 A;  2IGO A;  2CV1 A;  4ZDO A;  4IKF A;  2DJI A;  1MMA A;  3IAM 2;  2P0W A;  2E5Z A;  2M3A A;  2NOJ B;  2V1N A;  2UWM A;  3ZGK A;  4KIT B;  1G59 A;  4CCK A;  2VXZ A;  4XL9 A;  4XKW A;  3H5N A;  3HPH A;  4X0G A;  2KMU A;  3LSK A;  1OLT A;  3K70 D;  2DXI A;  1MMN A;  2LRD A;  1V5G A;  2IGN A;  3DTI A;  3HPG A;  3TL4 X;  1EA3 A;  4BQQ A;  4PSX A;  2VJ4 A;  2E1M C;  3OS2 A;  2KL4 A;  1W36 C;  2HVS A;  1X1C A;  1UG0 A;  2JVG A;  2Z16 A;  1X4P A;  2QKM B;  3CJR B;  3H5R A;  4XN0 A;  4Y4R A;  3A4C A;  2O5R A;  2VQL A;  3LL7 A;  4PJL A;  4HNU A;  2W7N A;  4BDY A;  3HXL A;  2IGM A;  3PUB A;  2WY7 Q;  2WAD A;  1J09 A;  3C2H A;  4XLH A;  3AL0 B;  3RPU D;  2KP6 A;  5HLT A;  4BGD A;  4ZDL A;  3H5A A;  1KON A;  2MD0 A;  3PNV A;  2RRE A;  3OS1 A;  3H9G A;  1FMW A;  2HVQ A;  4MLO A;  3J7A Y;  1Z3X A;  3S3O A;  3OYB A;  3ZCO A;  4BQO A;  4DBQ A;  4E7Z A;  2XDV A;  4F52 A;  1JI8 A;  3EUK L;  1MMG A;  1D1B A;  4XLF A;  3VDX A;  4II3 A;  1Y56 A;  1UAA A;  5FRO A;  3OYK A;  3A1Y A;  2KPM A;  3MMY B;  1NG6 A;  3FBI B;  3IAS 2;  5HVQ C;  4ZDP A;  4G6T B;  5CKT A;  1X19 A;  3IP4 B;  1R6R A;  2LC2 A;  4OWR B;  4B44 A;  4F92 B;  2X6Y A;  2A6T A;  4B3X A;  3LSI A;  3ZQQ A;  2M0M A;  4E7I A;  2R7V A;  4CUG A;  2R7R A;  1WJF A;  3K4B A;  3K4M A;  3U21 A;  1SAU A;  3IUO A;  2CH0 A;  3UNG C;  3KYL A;  3DEE A;  3CP2 A;  3OOU A;  2PJR B;  2Z1D A;  2DT7 B;  4EAT A;  1OR7 C;  1QU3 A;  1ERD A;  2WA0 A;  4AYB A;  3OY9 A;  1LDK B;  4R79 A;  2K9L A;  2K5C A;  3OYJ A;  5JHF A;  2LBF A;  1D1C A;  3E0J B;  2RNG A;  2VJ5 A;  1WJC A;  1E0E A;  4PJM A;  5KHD A;  4AVZ A;  3C2G A;  5LFA A;  4D1Q A;  3AKZ A;  3CZ6 A;  3AL0 C;  3VYS B;  2WBM A;  2M7B A;  4AU7 A;  3BG7 A;  2M4K A;  4NUB A;  2DOA A;  3VSK A;  2JVH A;  3FKJ A;  1DQU A;  4BDZ A;  2VXD A;  2BOL A;  2XF5 A;  2R7O A;  5KCM A;  3PSF A;  3W2A A;  1D1A A;  1U0J A;  3OYM A;  2XC7 A;  3DTK A;  2V26 A;  3ONQ A;  2UUZ A;  4IX7 A;  2F5V A;  4JQF A;  1N77 A;  3VYU B;  3DQV C;  2WAQ A;  1DGW Y;  1N78 A;  1MND A;  4QPQ A;  4HRI A;  4XOT A;  2AQF A;  3QYB A;  4XMY A;  3RQ4 A;  2HZD A;  4B47 A;  3PNT A;  2OC6 A;  2KRC A;  2LY1 A;  1AA7 A;  3H35 A;  4KT6 A;  4PJJ A;  2RQQ A;  4KJZ A;  2VQC A;  4OAZ A;  5HNF A;  4J00 A;  4BAC A;  2LY2 A;  3LSG A;  3G2B A;  4BU2 A;  2UV1 A;  3OYG A;  3HOS A;  4RLQ A;  4XLC A;  2XAU A;  4BJ6 C;  2KDO A;  3LFU A;  1UEL B;  4XOR A;  2R7X A;  2LH9 A;  2HQA A;  1D0Z A;  5CQG A;  2E60 A;  4C2U A;  2IGK A;  4BS9 A;  4DGW B;  3ZRG A;  3M1C A;  2X51 A;  4HSR A;  4CSW A;  3CJQ B;  3HKZ A;  3K4K A;  3DPL C;  2IS6 A;  3AFH A;  4YEJ A;  1Z7L A;  5FRM A;  2R7T A;  3DU5 A;  4BJT A;  5HOO A;  4C9Y A;  2KRH A;  3QYF A;  4HEA 2;  3HL2 A;  4F91 B;  2CV2 A;  3FHN A;  3BCA A;  4PUS A;  2LYC A;  2Y0S A;  4XKB A;  2R7S A;  1Z3Y A;  4RM2 A;  4BEH A;  4XKC A;  4PFO A;  3MKY B;  1G8X A;  4CCN A;  3VYT B;  3OYC A;  3D5L A;  2WY8 Q;  3K4N A;  3OL3 A;  3DKY A;  4NNJ A;  2L7K A;  3KX2 A;  3RTR A;  4C2T A;  2VB6 A;  1BR2 A;  4BL0 B;  3I9V 2;  1QHH D;  3TMO A;  2GOX B;  3RCO A;  4HNT A;  2X1D A;  4KIS A;  4XR6 A;  2ZSI B;  1SFK A;  4Y3O A;  4LIV A;  2CW7 A;  4CCM A;  5LD2 C;  3L2U A;  2FUG 2;  1NG7 A;  4NQW B;  2W82 A;  4CZC A;  1S9H A;  3FBN B;  3DWL E;  3HUG B;  4PSW A;  4ITV A;  3SEQ A;  2IS4 A;  2KLO A;  3OYN A;  2MYS A;  3L2Q A;  5HNH A;  1P9Q C;  5FRN A;  2A5W A;  2ELJ A;  2LRE A;  1Y6I A;  4E7H A;  2KQR A;  1X1A A;  4BE0 A;  1HA8 A;  3QYE A;  3VYR B;  1BR1 A;  3CP8 A;  3OWT A;  3CMM A;  3PNY A;  3F9K A;  4F3Q A;  3SZG A;  1W36 D;  4E7K A;  4IQ4 A;  3W3C A;  4LIT A;  3HC7 A;  4CCJ A;  1IRX A;  4ZTJ A;  5KNL A;  2WAE A;  4P5O A;  2L2O A;  5TGT A;  3OYD A;  1BOB A;  3K70 C;  1LVK A;  3OR1 C;  2GOM A;  2ZXH A;  3VSL A;  2VJJ A;  2HPM A;  3W2V A;  1D0X A;  1YX3 A;  4ZTF A;  3EUH C;  3W2W A;  2VAS A;  2W1O A;  4DOZ A;  3CF2 A;  4BE1 A;  4B48 A;  4XM3 A;  3DLA A;  1WJB A;  2ZXI A;  3D5S C;  3OIQ A;  4ZYA A;  4RLF A;  1WJD A;  3EUA A;  3NWS A;  4XN3 A;  2KHM A;  2K9M A;  3A2K A;  2OUM A;  3DTE A;  4D9J A;  3FDY A;  2BVL A;  2KZV A;  3UR3 C;  5CPR B;  1V5F A;  3L2W A;  2QKL B;  4CA0 A;  3L2R A;  2MFZ A;  3H0D A;  4IZZ A;  2V6E A;  3VWB A;  2JSP A;  3K6G A;  2VJI A;  2L9N A;  2CMP A;  4J01 A;  1GLN A;  3HG9 A;  4RMN A;  4CH7 A;  2DT6 A;  3OL4 A;  3OYL A;  4XNF A;  2M7A A;  1WJ5 A;  4NC7 A;  1QHG A;  2E5N A;  4LIU A;  3QOE A;  2X1C A;  3K10 A;  2BW3 A;  2K3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...