3ABMH

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3abmH00
3ABLH 3ABMH 3AG2H 3AG1H 3ABKH 1OCZH 2EIMH 5B1AH 1OCRH 3X2QH 3ASNH 1V55H 3AG3H 1OCCH 2EIJH 2EIKH 2EINH 3AG4H 3WG7H 2DYRH 2OCCH 1OCOH 3ASOH 5IY5H 2Y69H 5B1BH 5B3SH 2ZXWH 2DYSH 2EILH 1V54H
chains in the Genus database with same CATH superfamily
3FBIB 5L3DA 3S93A 1TBXA 5CLSA 3H1CA 2XDVA 2EA4A 2PG4A 3TP3A 4GDFA 2CFXA 2DMQA 1ZK8A 1VQOI 1T38A 2QBYA 5E18F 3W2AA 1IN5A 1VFCA 1UB9A 2LY2A 1WI9A 5FD5A 2XSDC 1SC7A 1X2NA 2CJJA 3LQRA 4II3A 3MKLA 4FX4A 2VJ4A 4IHVA 6PAXA 3LWFA 3P9IA 4I0AA 2ADUA 5L3EA 3HOSA 1K6YA 1W0TA 2HOTA 3FKJA 2V1DA 5J40A 3BT9A 4XRSA 3H5RA 3U21A 1A31A 1HSTA 4XLEA 3TW7A 2OQGA 3TOBA 1ON1A 3GZ6A 1TWHJ 1YX5A 4R79A 5ILVA 1TC3C 3MZ8A 2O61A 3BZCA 2R7WA 2BE5F 4ZDPA 3QODA 4KISA 1YW8A 2ZCWA 4DZJA 2HDDA 2Y2ZA 2IS1A 2KJBA 2L2OA 4OINF 3L9FA 1I5ZA 1LNWA 2P5KA 5M3MJ 4HLYA 3FXKA 4MQVA 4R1HA 1SD4A 1WRJA 2HOAA 1O7LA 1OISA 3ZPLA 3VB2A 1RIOH 3DPTA 2K86A 4M6YA 2Z33A 3F22A 2GZWA 4RAFA 5JR3A 2K3PA 2AXTC 1IXSB 2TDXA 2K4JA 4ZYAA 4D9JA 2Q1ZB 1QBJA 1MSEC 4L9NA 4ANJA 2GBYA 2EBIA 1JKQC 3BR5A 4XLHA 1VF9A 2RAEA 1IN8A 1VQPI 1I6HJ 3IP4B 2EJRA 5C3EJ 3PIPF 2NS0A 4J01A 2JRTA 2VASA 3LSMA 2DN0A 2XAHA 3BOQA 2PJRA 1V5EA 4HF0A 2JMWA 3ABKH 2LKXA 1HDPA 2EIMH 2R7SA 1JTYA 1LFBA 3I9V2 4BS9A 1I27A 1WH7A 4XRMA 2RKHA 4CDGA 2R7TA 2HR3A 2UUZA 4RAYA 3I4MJ 2LNBA 5KK1A 2K27A 5EEGA 4FCYA 1JKPC 1GV5A 2M34A 3E97A 3TDUC 4CZZA 4L5EA 3LL7A 4BBSJ 3ZRGA 5D6FA 1USSA 3SZGA 3DU6A 2G7UA 3QPLA 2BY2A 2EWNA 2ISYA 2Y9ZA 1U8RA 1M1EB 2MH9A 5FKKA 1A35A 3K2AA 3KETA 4F55A 1W7PA 1R23A 4C3JJ 2FSWA 4Q4ZF 4XOPA 2F5FA 3ECOA 4NB5A 2NVTJ 2NAZA 5E8GA 1MBJA 3IHUA 3VPRA 3BPVA 3JTHA 2JUGA 4BE0A 2VOPA 4ZDOA 3KP7A 2EILH 1XDSA 3ZN0A 2OPTA 3WTTC 1X3WB 4A0ZA 2CRGA 2L7MP 3MMYB 1RKTA 2E1MB 2QQ9A 2CW7A 2H8RA 1B8IA 2DFEA 2OC6A 3S16J 1R4MB 4A3FJ 1Y8QB 4AVPA 2OUMA 4MHGA 4EJVA 1EF4A 2JK3A 2VKHA 2GOMA 1MMSA 1QVUA 2RNJA 1LKXA 4C30A 4G7OF 4HX8A 3SYTA 1STZA 5M3FJ 4G12A 5LEKA 1MD0A 4ENKA 3R6SA 3A02A 2LK2A 1T39A 1Z21A 1P2FA 3COAC 4B47A 3HUGB 3JRAA 3BLYA 4XL9A 3BG3A 3BTCA 1A04A 1JJ6C 2ID6A 2ELHA 5L3CA 4PJJA 2PN6A 1WJ5A 5D5WB 3EETA 2EFWA 4RBOA 1XGMA 5LEJA 2JSCA 3J81K 4NDLA 2QSGX 3GTPJ 1FX7A 1A36A 4LFUA 1R1UA 3KP5A 2XF6A 1P6RA 2CG4A 3H9GA 2ZJPF 5DDGA 1E2XA 2FOKA 5H6QA 5C4XJ 1MJBA 3BG5A 5E79C 3D1NI 1QZEA 5E1XA 3FIWA 3PO2J 1UJ8A 2R5ZB 2BYVE 2GXAA 4F91B 3FMQA 2FMLA 3PQJA 1MNMC 3HRSA 5IOZA 1X4PA 5FO5A 2ETHA 1ZG3A 4E7IA 4G94A 1NK2P 5HS8A 2IEKA 3RJPA 3DPUA 5ED4A 1OCPA 1WVRA 3CJNA 5CPRB 4BE1A 2XASA 3F8MA 2CQXA 3KE2A 4WWCA 2HVSA 4KA4A 1XPXA 4X6AJ 1U9NA 1S8NA 4Z2YA 2E19A 2QSFX 5EGOA 1Z7UA 3WU1B 2K5CA 3R0JA 1Y39A 2JN6A 4OIOF 1O3QA 2HZDA 3QPSA 5FROA 1Z67A 1YHQI 5M5YJ 5L3FA 2YS9A 2OAZA 5IT9K 5JLXA 2L9VA 2HGCA 3R61A 2I10A 5TGTA 3WTVC 3I4NJ 4RLFA 1YW7A 4HLXA 3P9KA 2WAEA 2LY1A 2W48A 3CZ6A 4FQGA 5J1RA 3CMYA 1TL8A 3EUHC 4PJMA 1DQUA 4M9XA 3E0JB 2FA5A 4Q5SF 3L7WA 5CVIA 4E4HA 2VBWA 4ESBA 2FOWA 1H8AC 2VL8A 2EZLA 2KFDA 4JX6A 1L3LA 4A0XA 3GTKJ 5C4JJ 2X1DA 2DFHA 1FMWA 1IDYA 2MC4A 3ZQ7A 1A6IA 4YIRX 3OS0A 1H9TA 3QRFF 1GHCA 2H8WA 3CUQA 4LIUA 2QBYB 3VSLA 2ZJRF 3HPHA 2XROA 1VQNI 3FXUA 1RPWA 5F1JA 2HYJA 3M1CA 1JGSA 2NS7A 2X4HA 4UHTA 3KEYA 3FKIJ 4ENJA 1IN6A 2FNPA 4RGRA 4HRIA 1LB2A 5FLXZ 3DFGA 3G71I 4KIGA 4HNVA 1K4TA 2K9MA 4MTEA 2ZJQF 2VN2A 2HQAA 4BAYA 2LD5A 4HYEA 4OMZA 3RPQA 1YTYA 2F5CA 3S8PA 3L2UA 4AM3A 1Z91A 1XDUA 5DYMA 4DYRA 3WTWC 1S9HA 3CP8A 2ELKA 4OAZA 1XCBA 2Z1DA 4HNTA 1P7IA 4CCNA 3TBIA 1HXDA 1XX5A 2M0CA 4Y4RA 2W84A 3BC8A 5IT3A 3RPUA 3D5LA 3MZHA 1FYKA 2D1HA 2R93J 2HKXA 4E7HA 3OYEA 3FHNA 4XSZF 2X9DA 4D5CA 4PJNA 1IGNA 1JE8A 1HKTA 3CP2A 5CQGA 1ZQ3P 3OS1A 2NNNA 3FXMA 3V7CA 1HCRA 1SFOJ 3HXLA 3HGYA 1X3ZB 3CESA 4LK0F 3BZ6A 3ZQGA 2V6EA 2A5WA 1WKMA 4A3MJ 4ZC3A 1JKRC 1B72A 1V5FA 4IQJA 4P96A 2L9NA 1FOWA 4BJTA 3IAM2 4OIQF 2DK8A 1MGTA 3KLOA 1X3UA 1QNTA 1XCVA 3OY9A 2XC7A 4XLCA 4IOAF 3S2DJ 2VE8A 4BHBA 1BM9A 1XSXA 2BZTA 1USTA 3M1EA 2LREA 3KCCA 4RA2A 3MVPA 3HKZN 4PGHA 3LA7A 4BQQA 3HGGA 4XN3A 4LLNA 3K4LA 1SVLA 2P0WA 4IHTA 4XLFA 3BR0A 1GVDA 3LSGA 4AWXB 5LFAA 4YFXF 3G73A 1EJ9A 4MNUA 1EKEA 2LOOA 3OIOA 1MIJA 3TOAA 3VYUB 1T0FC 2LVSA 3CCYA 1TT5B 2DBBA 3RYRA 5IY5H 5JHFA 1UMQA 1ZKGA 2CUEA 3WTYC 4D0PA 4L9JA 1W7PB 2ZNZA 1PUEE 4H0EA 1BC8C 1WCMJ 3I71A 2F5EA 2DA2A 2DU9A 2LC2A 3WHBA 2GOXB 1OYIA 1R49A 2O6GE 1IXRC 1B9MA 3GFIA 4HEA2 2CUFA 2K9SA 5D4RA 1U78A 3BTLA 3CJQB 4E6KG 3FM3A 2L7KA 2XAUA 5DUIA 3QPHA 2LSOA 4HX4A 1Z05A 2KRCA 2KQRA 2X0LA 3BDDA 4BEHA 2G0EA 3HOUJ 2CUJA 2M5WA 3PFIA 4DJAA 3CCUI 1SAUA 2WAQN 3S3NA 4XM3A 1TW3A 3RQ4A 2DT5A 4G6QA 2JUCA 5BMZA 2JVHA 4IKFA 4RM3A 2P5VA 3OMYA 3ASNH 4B43A 1ITYA 3W2VA 2HEOA 2B63J 2QF7A 3S1NJ 3K70D 3M07A 3QP5A 3TW6A 3HTSB 1PP8F 1HKQA 3JRIA 2MABA 1D0XA 2KRFA 3O3KA 2QZ8A 1QGPA 4V2GA 2JTVA 5CYVA 3SJMA 2HVQA 3WODF 4JX5A 4IQ4A 4B4CA 3DBRB 3IL2A 2DYSH 2J5PA 2E5NA 1OYWA 1ZELA 4HSRA 1MMAA 1HW1A 4HV5A 4W97A 1K61A 2YPRA 1FY7A 4CA0A 1OYYA 3GFLA 3K4BA 2Z3YA 2MSYA 5HDKA 1HBXG 2AXLA 4EATA 3WTSC 1V5GA 2A3SA 2GA1A 1ETQA 2BHZA 2QQ8A 1XN7A 4U87A 5E20A 1XB4A 3BROA 2IGNA 3LAPA 1MZBA 4Y15A 1TWGJ 1JTXA 1R22A 4YIFA 5BQTA 2WV1A 3ZMDA 5KHDA 2I5UA 3BJ6A 3DLAA 1V54H 2XV4S 4XIDA 2IA0A 2GXBA 3F8NA 3VEPA 2R7DA 2JA2A 4A2UA 1UG2A 1YIOA 3EPZA 5DCMB 1XMKA 4FE4A 2EPFA 4EJUA 1JXSA 2CU7A 1ZRFA 1OCRH 2NYXA 3BY6A 3DF8A 3CDHA 2ELJA 4M72A 4EM0B 1MBFA 4ZYHA 3LA2A 1IRXA 5LHHA 4KUMA 4A3JJ 1MMDA 3QP6A 4S04A 3JAMK 3D5RC 3K7AJ 1LVKA 3NARA 3KYCB 4ESFA 3WGIA 1HDDC 1LVAA 2VBXA 1U5TC 4BJ6C 5D8LB 5JVTA 4M6VA 3GLXA 3FXOA 1VQ8I 1FTTA 1I50J 3KP3A 1ENHA 4A3BJ 5CVJA 2Q2EA 1DDNA 2ZXHA 3GO5A 4XNFA 2FJ1A 1J09A 5BNGA 4P5OA 1OFCX 2WY8Q 2YUSA 1IV8A 1GLNA 2X6WA 2HWVA 4LK1F 3U2RA 3B02A 3GTOJ 1P4AA 2MD0A 1ETWA 5IPAA 1ZGJA 2DA5A 4XK4A 5J4YA 1WHUA 4J19A 2PJPA 3PL8A 1I6XA 3MFKA 4IRGA 4DYQA 3MKYB 1PVEA 3P5JA 2L5QA 2DOEA 2VKVA 3HYIA 2FNAA 2BVMA 3CF2A 3K4NA 2IA2A 3V4GA 3GLLA 2CUZA 3SQNA 1LFPA 1WJCA 3A1YA 2R3SA 1KZHA 4O3MA 3WG7H 1I1SA 4L0YB 4I2OA 1WZ2A 3E6CC 3GBGA 2FBHA 3ECHA 4BU2A 4L0ZB 3CD6I 4NHJA 2W82A 1P9QC 3VDXA 5LD2C 2O8KA 3K4MA 2M4KA 2ESNA 3DQVC 2IP2A 5HODA 5BPDA 2HTJA 3HPGA 2EV6A 4G8XA 3CDLA 2LR8A 5EZGA 2AHQA 5CVUA 4XN0A 3FWEA 1MDMA 3AL0B 3JAMZ 2DA1A 2FEZA 2G7HA 1BIAA 3BZKA 1ZHFA 3DEEA 3TO7A 1D1AA 4PFOA 2DFFA 2VPLA 2XRLA 3H35A 2Z5UA 3CTAA 5ERIA 1S3JA 1B72B 1FWZA 3P9CA 3S14J 4A3DJ 3CO7C 5BOXA 2STWA 4XSXF 1J2XA 2V9PA 3EUHA 4UUSA 2IGMA 3J7YJ 2HKOA 3T8TA 3RKQA 1ZLJA 4C2MJ 2JT1A 3ZGKA 4D7MA 2OTLI 1IXCA 5IP6A 3S3OA 1FSEA 5GAEJ 4C3IJ 3LSKA 3PFYA 4IJAA 3DKYA 3OSFA 1HF0A 1JUPA 3I56I 2NNYA 3M3YJ 4L5JA 3SZTA 2ZXIA 2WWYA 3HHGA 2J5OA 1I3AA 5CJ9A 4KNYA 1MBEA 1N78A 1FSHA 3C3WA 4DBQA 3HJEA 4NQWA 3ELKA 3K4CA 4AUXA 2FX0A 4MFEA 3OL4A 5AIQA 2ZBKA 1FIAA 3HZJA 3IUOA 4FT8A 1OKRA 1LEBA 4CXFA 4FISA 5H20A 4EEFG 5LHIA 2DO7A 2WBMA 3GYHX 3ZQIA 5FRMA 1YS6A 5FRNA 5LRRA 5BS6A 3ZR8X 3N05A 1GV2A 4XKVA 4EM1A 4IVNA 4CO8A 5J1UA 3L2WA 3C18A 2VI6A 1Y1WJ 4EJTA 4YFKF 1ON2A 3I59B 4PJLA 4UNOA 5JI6A 2V1XA 3REOA 3CLQA 1DGRM 3K2ZA 2DA6A 2IXSA 2W00A 2A69F 1YITI 1IUYA 2KP6A 3HRMA 3ZCOA 2L7FP 2F4OB 1T98A 4XONA 2MGQA 4IO9F 4U0VA 3DTEA 2CV0A 1RNLA 2ISZA 3I0TA 5IYDJ 4XLAA 1BC7C 1LEAA 4OOIA 4J00A 2HTSA 4BEHB 1YJWI 3CCSI 1WSUA 2QCOA 2DOFA 3IH2A 2Z2SB 2DMNA 2ME6A 2HXIA 2BY1A 2GXGA 4B8XA 2VUMJ 5F08A 2P6TA 1S29A 3DEWA 3L09A 3H3UA 2O0YA 4CICA 3ZOBA 2R7ZJ 1PJRA 2HYFA 3IC7A 1S7EA 3DEUA 2HXOA 1TQPA 2KIMA 2QM3A 3SFZA 1WI3A 1W5TA 2KT0A 4HA8A 4CCKA 4I0BA 2Q0OA 2L9SA 1WPKA 2IVMA 1FC3A 2XIGA 3DKWA 3FISA 2OCEA 1QVTA 2M45A 3FBNB 2IBDA 5HLGA 3I54A 1JI8A 4E7SA 1T0FA 1ZTRA 3SEZA 4UVAA 3F8FA 3EYIA 3ZXSA 3ISPA 3CCVI 4Y13A 4ZH4F 4KICA 1Z6RA 4DQ2A 1FJLA 2JWTA 3QOEA 2E7WA 2KKOA 3OOUA 3TL4X 2IS2A 5LHGA 1BA5A 3IWZA 5LBQA 3ZP5A 1RR7A 2XAQA 3R60A 4RAZA 1MBGA 2KIQA 1QQIA 5HDGA 4KITB 1R6RA 4A5NA 4HNUA 5D5VB 4JP0A 3J80K 4D7NA 4OU0A 4MLOA 1ETXA 1MMNA 1YW9A 4JQFA 2AS5F 3GEZA 2CQNA 3EUAA 2ECBA 5ILSA 1KU3A 1S7AA 3F6OA 1ZLKA 4AIJA 1N75A 1ZGAA 1OQYA 1D5VA 4V2FA 1MNEA 4IRIA 4JYKA 3DP7A 4IXAA 4HQMA 3VFZA 4KT5C 3NRVA 2EFNA 3QU3A 1YS7A 3BCAA 5FKLA 1R36A 2A5YB 2Q8KA 4DW6A 3HC7A 3KEQA 3ULQB 1RRJA 2M9HA 1KU7A 2A68F 1V55H 3FMRA 2W1OA 1XSDA 4CHUA 2EIJH 4WK8F 1DUXC 2IS6A 5TISC 4G6TB 2HI3A 2JJ7A 1TWFJ 3MZYA 3IKTA 2KZGA 2L01A 1T33A 4GGGA 3T8RA 4QTRA 2YU3A 2QWWA 1Z9CA 2DOAA 4ZTFA 3SHFA 1W1WE 1Y0UA 4I7HA 2DA3A 4I09A 3S32A 5L3GA 4XICA 3IRQA 5CKTA 3CCRI 2BHYA 1K79A 3G2BA 2ZKZA 4PJ0C 5K7FA 5E3MA 4FASD 4BXUA 3J7AO 3L2QA 5F64A 1PDNC 2OTJI 2ZSHB 3BQYA 2A07F 4A12A 2YSRA 3E6DA 3MKWB 2NVYJ 2WA0A 4HF1A 3PSIA 1O3TA 3LA3A 1KYWA 2OCCH 2IT0A 1Z1DA 1ZYRF 4BXFA 4L5IA 1K7AA 1HA8A 3TMOA 3F23A 2E1MC 2DDAA 1IAWA 2W85A 5ICFA 2LDUA 5FLXK 5JVGF 4ZYGA 4PSXA 3J80Z 2DQRA 1ETVA 2FUG2 2R7OA 4RMNA 4MEXF 4YIIA 3CF5F 1RETA 1KQ0A 4CCJA 2XPUA 2V4JC 4EMSA 4U7BA 3OL3A 4I6ZA 2E5ZA 3PQKA 1ZRDA 2WV0A 3FF5A 2P6SA 2M2EA 4A6EA 5LGUA 1QPIA 4M3GA 2DDBA 2B0LA 1CF7A 4OAYA 1G2HA 2XGXA 4ZDLA 3V8JA 5LLQA 1OCTC 2P81A 4WXCA 3E6MA 4L9VA 4V19K 2ECCA 1SD6A 2K9QA 1H0MA 1B6AA 4N4OB 1ERDA 3BQZA 1ULYA 1SFUA 4K2EA 1KA8A 1F4KA 1WJFA 4LG0A 3G6EI 4E7LA 2OD5A 4P9FA 2LLKA 1YRNA 2HVRA 2VQHA 2IS4A 5FFXA 3WE2A 2R7UA 4YFNF 3BG7A 3H9JA 1WJAA 3JCUC 3VWBA 2VQGA 2Y0SA 1G3WA 2HZTA 4MFDA 1RR8C 4AVZA 1G3TA 4ZZLA 3ROUA 4CH7A 5EG0A 3DTKA 4PK4A 1V3FA 4DBRA 5K7ZA 3BG6A 2EB7A 2GIVA 2XGEA 3J7ZI 3LSIA 4Q47A 2UWMA 4NQWB 2VBYA 1Y0NA 1FP2A 2MD5A 5HDNA 1WFXA 1YQAA 5FGMA 1X1AA 1SAXA 2BOLA 4JX4A 4A3IJ 1GDTA 2VBZA 4U88A 3ZMZA 2EIKH 3B6CA 4HSTA 4N9IA 4C2TA 1IUFA 5GTHC 2MLKA 2MG4A 2MLGA 4L9TA 2R7XA 4LB5A 3E7LA 3F21A 1ZG1A 1XGSA 3W3CA 1JGGA 1VQ9I 3WTXC 2HU9A 1X1DA 2HOEA 4I01A 2X6OA 3FM5A 3OR1C 4WX9A 2KDOA 2RGVA 3B6AA 1ZRCA 1BR2A 1W7PD 4DGWB 3LQQA 2XGCA 2DFIA 3ML6A 1FTZA 2UXNA 1O7FA 4QIWN 3F72A 4HPQA 5FB2A 1S7OA 4OWRB 3IH4A 4DIQA 1N25A 1SD7A 2EFQA 2ZMEA 2CYYA 1JJ8C 1O57A 3QQAA 2DMUA 2RN7A 3RSNA 2KHMA 3OS2A 3A03A 2DT7B 1K4SA 5FKOA 1ZH5A 3ABMH 2O7OA 1WJDA 5LRSA 1Z6TA 1TT0A 1VZ0A 3GTLJ 2NOJB 3ZMSA 3KIOA 2XAGA 1T56A 2AQEA 1BJZA 3A01A 1IN4A 3Q3SA 4B1RA 1TWCJ 1IDZA 2ZJ2A 1SANA 1G8XA 1OLTA 2V9KA 1BW5A 5J8CA 2ZC2A 1OCOH 1O3RA 4AYBA 3ASOH 2EFOA 3LSHA 4LOCA 4D1QA 5BPIA 1QPMA 1E3OC 2H6BA 3K1PA 2M7AA 4NC7A 1MKMA 1WWXA 2PJRB 4HOBA 2K02A 2NOGA 2Z9OA 5GAGJ 1FLIA 1UCRA 2GA2A 1FIPA 2VC0A 1ZARA 4U0WA 2XPWA 3CCLI 3CC7I 2QUFA 2Y30A 2WC2A 2QQAA 4EJOA 2Y48A 2EZKA 2GLOA 1FZPB 3L2CA 3SZPA 3G1OA 1KU2A 4A3GJ 3RZDJ 4LIVA 1D8KA 1ZG5A 1Y1VJ 2E34A 4F93B 1F5TA 1NK3P 2WTEA 2N8GA 3NAUA 1BJAA 5DV5A 3M8JA 2LBFA 3HM5A 3BWGA 1UG0A 2A6EF 4G6DA 4EM2A 2K85A 1UAAA 1ETKA 1AKHA 1D5YA 4XKCA 2ZO4A 4ASNA 2LMDA 3DWLE 3GZNB 3L00A 4XR6A 2GIZA 5AONA 3JSOA 2GM4A 3GUDA 3UKGA 1PUFA 2KIFA 2W24A 3T0YA 4A3LJ 5KNLA 3CCEI 4IHYA 2R7VA 3FXQA 3CC2I 2CSOA 4ZTJA 3HRUA 4CSWA 2IPQX 3BR6A 1ONVA 2VT2A 1KU9A 4FHTA 3HOTA 2M87A 1D1BA 3LMMA 1YJNI 1I39A 3S1MJ 1P4WA 5DEQA 3OYNA 3NEUA 2HQRA 2Y0SN 1D0ZA 4XRFA 4BQAA 1B8IB 3R4KA 4HBLA 4IEJA 5GAHJ 1OPCA 2CWEA 1I3QJ 4IL6C 3VYRB 3IWFA 2PMZA 4LITA 4TV7A 1SVMA 2HQNA 4RB0A 5DS9A 2V79A 5IYCJ 1QHHD 3P7NA 4Y52J 2B7EA 2DTZA 1ZN2A 2NS8A 1H89C 3CLOA 2LY9A 3HG9A 4RM2A 3VYSB 1Z77A 1R5ID 2VKEA 3QOPA 5E8IA 4MO7A 1J59A 2O5RA 2XAFA 3IV5A 3NQOA 3KLNA 3HSFA 3ZQHA 1MNDA 1J75A 3HOVJ 4QPQA 3GTMJ 3GCMA 2OU2A 4KJZA 2EFPA 3G3ZA 3S15J 1KQ9A 5CQEA 2ZXJA 4Y7NJ 3MKZA 4PSWA 2M1BA 1HSJA 2VOOA 2H1KA 1HW2A 4M9SA 2DODA 3QAHA 3PJRA 1LE8A 4BY7J 1PP7U 1SFXA 4EVIA 1FYLA 2A05A 2EQRA 2XAJA 3H0GJ 3K4JA 3OR2C 5JLWA 1AU7A 4XMYA 3RKWA 3RZOJ 1Q1VA 4BBRJ 4QSHA 3C7JA 3TP0A 3M4OJ 2A6HF 1BI0A 2KMUA 3KZYA 2RDPA 1NG7A 2GQQA 3X2QH 2XGDA 3WGGA 4MGRA 2BEOA 3TGNA 3CCMI 3O6BB 3C2BA 4A3EJ 4AD9A 1P92A 4P1WA 4CZCA 3BJOA 5IP9J 2DYRH 4HDUA 4UVCA 4Y33A 5F0FA 1G4DA 4A93J 2PX9A 1Z7LA 2VB6A 5EGOB 1TNTA 1DU6A 1WQ2A 2V1NA 3L1PA 2LRDA 1LFUP 2JA7J 3B73A 2CMPA 3FHZA 1EV7A 1EH7A 1RZ4A 3H3ZA 3OYIA 1W36D 3PNVA 3F8BA 1K6OA 3BP8A 1V4RA 1EH6A 4LG0B 4YRVA 4CGZA 5LGNA 5B1AH 1YRNB 4BNCA 1MMGA 2XB5A 5JHUA 1DP3A 2VJIA 3KP4A 3OWTA 3VYTB 3CC4I 3AAFA 1FT9A 1R71A 5F1RA 4FETA 2OV7A 2DA4A 2FD5A 2ZFUA 4C9YA 1GT0C 4M71A 2DCEA 3CMEI 4QLCU 1F36A 2CS3A 2KIUA 1HKSA 1TP4A 3HSEA 2UXXA 1R9TJ 1VQ6I 4XBFA 1L0OC 3CUQB 4O5VA 1K78A 4I98B 1IZ1A 1I1GA 2MBFA 4JK1X 2BXYA 3CDIA 3Q0VA 2YR2A 4PUSA 1OMIA 4GRIA 2E60A 3AG3H 5AIPA 1J0RA 2VKDA 4LD5A 5HS9A 4BDYA 1W0UA 4JBAA 4W1UA 1LUJB 2L3DA 3K70C 1X1PA 2F5VA 4XKBA 4CCOA 4Z6YA 1S6LA 1S5LC 5GTIC 2Y0MA 3SDBA 3MAJA 1MSFC 2QEXI 2COMA 2FE3A 2DJNA 4B44A 2OQRA 4BUPA 1HW5A 1IRZA 3ZMVA 2DK5A 5KAFC 1B59A 1Y6IA 1VQKI 1LJ9A 5M5XJ 1D8JA 3HEFA 3SDGA 1C0WA 1IRGA 1SVOA 2BGCA 1YLFA 2QKLB 4GYIA 5F27A 1E3HA 4YEJA 3WU0A 1NG6A 5HLTA 2ZMEB 3AFHA 4AU7A 1OJLA 3H5AA 5HNHA 2B9SA 1YOVB 2M4GA 1T6SA 2QA4I 2GWRA 3G1LA 4FE7A 2V7FA 3V8LA 4IZZA 3S2WA 1D1CA 2H09A 1FP1D 3I3LA 1IG7A 3DKXA 3OYLA 2IRFG 2PMZN 1SMTA 2UZKA 4M3FA 3A01B 3EUKL 3W6JB 4CCLA 3CMMA 2A6TA 5K1YA 2XVCA 4A3KJ 4CUGA 1U9OA 2KZVA 2EZIA 4R8HA 2LFBA 2MW8A 1FOYA 2HYGD 4B48A 9ANTA 1E17A 3K6GA 5M5WJ 2DAOA 2A61A 2DXIA 4BKXA 1KYZA 4GO1A 1YO5C 4JOMA 5HLHA 5F0CA 4BY1J 3AL0C 4E7KA 2EK5A 3HRTA 2LYCA 4Y3OA 2QGUA 1W36C 4I76A 2R92J 2JPBA 1VI0A 3KZIC 5IYBJ 2ACJA 1ZR4A 2X1CA 4X1EA 4CYCA 3BR3A 1RUNA 1FOKA 1X19A 2AQFA 2VQCA 4M74A 4BGDA 5E3OA 2JZYA 5CVRA 1YIJI 1Y8RB 5EEAA 3S1RJ 2JA5J 1P7JA 1RI7A 2ID3A 3BPXA 1T2KA 5J8FA 4ZYEA 1QRYA 3TO6A 3JRGA 1APLC 3V8KA 3K1NA 3LFKA 4N0BA 2QKMB 2LBFB 2KRHA 3PNTA 3RQIA 5KCMA 4DOZA 3ERMA 1AKHB 4L18B 2AO9A 3ZMTA 1VQ5I 2NXNB 3H3VK 2NVQJ 3HTUA 1NH3A 3AKZA 5EEHA 5TJJA 2WB1A 1OR7C 4U0YA 3GTJJ 5ILUA 2EV0A 1PUFB 3DV8A 1TZLA 3CJTB 3K69A 4BACA 2Z99A 2FU4A 1U2WA 1GXQA 1G3SA 1IO2A 5B1BH 3M9AA 3H9QA 1Z3XA 1D3YA 1YI2I 3JRFA 2TRTA 3GW2A 3PM1A 3SEQA 3F3XA 5K7HA 3MN2A 1SD5A 4KT6A 1Y56A 3A0BC 1F9NA 4M3DA 4D5FA 1UZCA 1AOYA 3Q0WA 3EYYA 2EV5A 4HV6A 1Z0XA 1OCZH 4BL0B 4KFCA 1GVJA 1FNNA 3OYBA 3W2WA 2ICWG 5J47A 2L9RA 1VTNC 5EYRA 3L2RA 3GX4X 4OMYA 1R1TA 3ABUA 3R0AA 2P8TA 4GXOA 3CO6C 3J7AY 4OIPF 1UELB 5FFZA 2CGPA 1VQ7I 1T08B 3QPTA 2RV8A 2RNGA 4ENMA 3FXRA 4KIFA 5K5RA 4N9HA 3BG9A 3JTGA 4YG2F 1POGA 2VE9A 2L4AA 2E1OA 3C1DA 1GUUA 3F0CA 3Q9SA 3IRRA 4MEYF 2HOSA 3I64A 4P9UA 5J4VA 3LAJA 3LSTA 2O03A 3K10A 2V6CA 4M3BA 3Q0UA 2PMUA 3H92A 1ZREA 1LDJA 2LTPA 3G4SI 3AG4H 1QO0D 3RCOA 4XRSG 1R1VA 3OOPA 1IRFA 1LE8B 1LDKB 2PQ8A 2P7VB 1HOMA 1P4XA 2NVUB 1U6GA 3RKYA 2CV1A 4II2A 2R5YA 2VIXA 1A5JA 3TQNA 2CW0F 2H6CA 4XKWA 1SFEA 1QHGA 3A4CA 3FMSA 1N77A 2NVXJ 2STTA 5EJCA 3OYGA 3KEOA 1IN7A 4FX0A 2KL4A 3ZMUA 4IHSA 2E71A 3E1SA 4ENNA 1X4OA 2YX4A 3LSPA 1F1ZA 1HLVA 2E2JJ 3HSRA 4BHCA 2E2IJ 2LF8A 3PO3J 1FBUA 2QSHX 2Q2EB 2X48A 4HF2A 1R7JA 2YU9J 5KVRA 4IX7A 3BTJA 2P7CB 2HPMA 5ICCA 3FXJA 4KMUX 4QPOA 4KN4X 2PBIA 2MC3A 1MH4A 4WF2A 3ZQFA 2LP0A 1SMYF 1AWCA 3VODA 3T1BA 4PZJA 1DPRA 2R7RA 5B66C 3HOZJ 3A0HC 4G7ZF 1K78B 4NUBA 3LSRA 4P55A 3DTIA 2VJ5A 1DP7P 3AG2H 3JW4A 2XF5A 3GXOA 2PLYA 2X6YA 2Z16A 4A69C 2D5VA 1RESA 4XLNF 2RC4A 2FRHA 4G9YA 3IH3A 5FD6A 2CW8A 4BE2A 1T8IA 3L2VA 5EDNA 2JPCA 2E7XA 3RYPA 3U1DA 4BYYA 3EDPA 5F0HA 2BY0A 3LNQA 3CUOA 2Y9YA 2WB1N 3I53A 2KPMA 5TRDA 3I4PA 4ON0A 4NBQA 1A6QA 1MJAA 1AHDP 5F6FA 2H27A 2JA8J 2CQQA 1MH3A 1YYVA 3OYHA 1RC9A 1BI3A 1MW7A 1Q1HA 3RTRA 3U9GA 3FDYA 1RKWA 2O8XA 4Q48A 2FBKA 2V26A 3HKZA 5K5OA 1MDMB 1G59A 3V7RA 4DYCA 2M3AA 3RKXA 1ZAOA 4HQEA 1U5TA 1X2MA 3ZQLA 4RB2C 4XORA 2HFHA 3RIRA 2CV2A 3JRBA 2OBPA 2R0QC 3F8CA 5D5XB 2XB0X 5DM6F 2BV6A 3ZQQA 2HS5A 2ZB9A 3OIPA 1HQCA 3PSFA 2XUBA 1Z3YA 1G6NA 4UUSB 3OV8A 5IOYA 4MIMA 5GPCA 3F9KA 2XKPA 1FBQA 1X1BA 1YG2A 2F5DA 4XQFA 1J9IA 3DU5A 3F6VA 2OZ6A 2XF7A 5DCMA 2DA7A 3GMEA 3NWTA 2IGOA 1WGXA 5F04A 2O9LA 4EGYA 1VQLI 3OYMA 5DM7F 3GTGJ 3OYFA 1DU0A 1YX3A 3PUBA 3HBLA 4AIHA 5E1WA 2LH9A 4M73A 2HQ5A 4ABZA 2CQ7A 3OYKA 2WADA 1UHMA 4NNJA 2VT3A 4M3EA 1LQ1A 4CYCB 4ESJA 1TNSA 3WG9A 1WJEA 1BIBA 2MYSA 2RREA 5D8KB 4M6XA 1ACIA 3N97A 2DW4A 3CMAI 2XRNA 4B3XA 2JA6J 5HVQC 4NC8A 5D5UB 2WAQA 5K5QA 3DXJF 4S05A 1SFKA 2IA1A 1BOAA 4G7HF 5ICEA 2ZXWH 1S72I 4BJ5C 3M7GA 2F48A 4GFBA 1YE9A 2K4BA 5C44J 1UHWA 3PIOF 4F92B 1H88C 3EQLF 5FKNA 3WE3A 2ME0A 4WXHA 1R58A 3SXYA 4RDUA 1W4MA 3K4KA 4HZFA 1XG1A 1JT0A 4GCVA 3LOCA 2HNHA 3IAS2 4LJZF 4UB6C 1KGSA 3J81Z 2VXDA 2K40A 3HOWJ 1UHSA 4UB8C 3NWSA 3K9TA 5DCFA 2D2WA 2FQ3A 1SEUA 2QQBA 4HG2A 2E1NA 1VNDA 5IP7J 1BI2A 2CO5A 2OZUA 2VODA 4LG3A 2JVGA 3N4MA 1NTCA 4NC6A 3ZN1A 4RB1A 5B5EC 4M9ZA 5H6RA 3RI4A 1FMVA 3HOXJ 1ETOA 2VXZA 5D6EA 2W4SA 3ZQCA 2C6YA 2XKOA 1B1BA 3QYBA 3VSKA 2PI0A 3CCJI 2BBYA 2LKPA 1X58A 3JRDA 4N4NB 3K1MA 2IW5A 3OSGA 3Q5FA 3G1MA 5HLIA 1BN5A 2E36A 2EINH 4U7DA 3OYDA 3TO9A 3WGHA 3CJRB 2IGKA 4LLLA 3DBHB 3OYJA 1HC8A 3KYDB 4KDPA 1MBHA 5J6XA 1T95A 2DMTA 1VQMI 5FLVA 2QENA 1IJWC 3TKYA 5IT9Z 3ESWB 5GADJ 5JFRA 2P4WA 4RGXA 2VPRA 3KZZA 3JRCA 1XC5A 3GFJA 3I5UA 1B9NA 1TWAJ 1TTYA 4LLGF 2F4IA 1BR1A 3WTUC 4PFPA 3FK6A 2ESHA 2V9VA 3CCQI 3ONQA 3HIFA 1JKOC 2LKSA 5FLMJ 3OYCA 1WJBA 2DJIA 1J7KA 3QWLA 5J3LA 3E3VA 2BW3A 2K9NA 3QYEA 4BH9A 1XD7A 4HAMA 5FKMA 5E3LA 2DLLA 1GXPA 2R5YB 2WY7Q 4MTDA 1FPQA 3TDZC 1OR7A 4KIBA 1E0EA 1IW7F 2F2EA 3MEXA 2F6CA 3E6BA 2K9LA 4E7ZA 4LGWA 3T5XA 3W6KB 3S2HJ 2L7ZA 3GFMA 2E2HJ 1FOXA 3KP6A 1K83J 2M0MA 1E3PA 1JT6A 5DD4A 1DPUA 1LPQA 2M7BA 3WTZA 3LFUA 1IC8A 1ETYA 1TQMA 2K7LA 2X85A 3M8EA 3H0DA 3S17J 3DCFA 1U0JA 2M30A 3PUFA 2PMHA 3V42A 3S3MA 2IAIA 4O6JA 2IJLA 1XMAA 1REPC 1BI1A 4A3CJ 3UR3C 3KFWX 4DNCA 4PGGA 4IHWA 4UY8I 2UV1A 3GVAA 3I59A 4FTHA 2X51A 1H9GA 5GPAA 4OIRF 3KX2A 3OYAA 1EH8A 2YX7A 3D5SC 4RLQA 4S0HB 2OA4A 1IV6A 3MWMA 3DLLF 2KDZA 2E35A 5EF6A 1BL0A 2CH0A 3HB9A 3FK7A 1XMXA 3FXLA 2D45A 5DD8A 1XGNA 3FZVA 3V7SA 4MQ9F 3QYFA 2PFBA 2LF7A 4RGSA 4UUVA 4KYWA 2XSJC 4ZJZA 2L02A 3ABTA 2MFZA 4X0GA 2DT6A 1QZZA 2KISA 2VJJA 1XTAA 2JRMA 3O8HA 5GP9A 1JUSA 3DBLB 4A5MA 1IF1A 1BW6A 4HDVA 5KAIC 3IKVA 1TLHB 2XPVA 4UV8A 5HS7A 2JSPA 2MH2A 1TW2A 2ZFWA 4B09A 2DI3A 2KLOA 3W6VA 4KMFA 2R7QA 4UVBA 1R00A 3C2GA 4AC0A 3H5NA 2K3FA 1PYVA 2R7FA 3AG1H 3TEDA 3KPHA 2FF4A 4DZPA 2DQLA 3WHCA 3O2PE 2EA2A 4IRHA 1U5TB 4Y17A 3QU6A 2FMYA 3HOYJ 4ZYDA 1XGOA 2FQ4A 1CF7B 2FBIA 1D0YA 4BQNA 4RB3C 4GYGA 3CQZJ 1VQ4I 1KQ8A 4ZZDA 2QVOA 1W5SA 2R4GA 2L54A 3ERED 3RPUD 2RQPA 2P5LC 1FYMA 4WCGA 2DTRA 4F3QA 1R4NB 2Y75A 3GZ5A 2BVLA 2RVCA 3JREA 1DGWY 4CCMA 2QLZA 4AYBN 2QYOA 4UUTA 1QA6A 4HX7A 2E1CA 2EZHA 1J5YA 5L3BA 1O4XA 1F43A 2VONA 4XLPF 5A2QK 1W5CC 3E5UA 2M8EA 3U1KA 5EG0B 3Q9VA 4E7JA 2CQKA 3M8FA 1JUMA 1AA7A 3MD2A 4BDZA 3FX3A 3K0LA 1CGPA 5EZHA 1R5GA 1EA3A 3VOEA 2DPUA 1KONA 1WH5A 2MA3A 2W57A 2HDCA 4IHXA 1BBYA 3S1QJ 3JRHA 3I55I 3GTQJ 4AIDA 4C2UA 3MQ0A 1FEXA 4PDKA 4QWQA 4IF4A 1XSVA 4I02A 4IPAA 4CYDA 4F7ZA 3JR9A 1CQTA 4B3AA 3KYLA 3LSJA 2ZSIB 5B3SH 3A2KA 4XOTA 4RS8A 2X1EA 4BHPA 3OIQA 5D4SA 5LGTA 2GAUA 2VQLA 3ABLH 3I58A 4A0YA 4H4KC 2DPDA 3E5QA 2KJCA 2M8GX 2EH3A 2DMPA 3HL2A 3SFIA 2W7NA 1G3YA 2FXAA 2D1VA 3HUGA 4EQQA 3RDIA 1X1CA 4LB6B 5HNFA 1QZYA 1JHHA 3CUQC 1RUOA 2ZNYA 3BTIA 3C2HA 2OJED 5CVVA 4BQOA 3HDDA 2W25A 3UNGC 4UXNA 1JHFA 5E17F 1YFHA 1ZGWA 1ORKA 3BJAA 3PNYA 1LDDA 3JSPA 1ZR2A 3GWZA 1FBSA 1O3SA 4EGZA 4E70A 2G9WA 2BXZA 1R5HA 2X6XA 1MJ9A 3HHHA 2R5ZA 4RAGA 1U8BA 3H36A 4WXDA 1B4AA 4IOCF 3O8GA 2L4MA 4UV9A 1BOBA 2O3FA 5A2QZ 5E1ZB 2H1LA 1YJ9I 2COBA 2CFOA 4I99C 2PEXA 2XHKA 4AIKA 2VC1A 3WU2C 4LMYA 5HOOA 2HPIA 5J1YA 3KP2A 4BXXJ 2RQQA 5ICGA 4EJWA 4YELA 4KN7X 2ZMEC 1XS9A 1ODDA 5FJ8J 2HDWA 2TCTA 3BR2A 3MCZA 3BCBA 2V1UA 3E5XA 1UFMA 3D0SA 2WAFA 2OF7A 2L0KA 4F52A 4ETSA 5H2FC 2BY3A 1NHAA 1OCCH 1U3EM 1QU3A 4RGUA 1TQIA 4EV0A 5E3NA 2NRAC 1MBKA 2I8DA 2LG4A 4A6DA 2H94A 2BW3B 4PCQA 2VLAA 5DTDA 3BR1A 4ITVA 3DPLC 2Y69H 4HW0A 2Y31A 4C3HJ 2JQ7A 1BR4A 3GF2A 2F4MB 5DUKA
chains in the Genus database with same CATH topology
3ABLH 3ABMH 3AG2H 3AG1H 3ABKH 1OCZH 2EIMH 5B1AH 1OCRH 3X2QH 3ASNH 1V55H 3AG3H 1OCCH 2EIJH 2EIKH 2EINH 3AG4H 3WG7H 2DYRH 2OCCH 1OCOH 3ASOH 5IY5H 2Y69H 5B1BH 5B3SH 2ZXWH 2DYSH 2EILH 1V54H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL H;  3ABM H;  3AG2 H;  3AG1 H;  3ABK H;  1OCZ H;  2EIM H;  5B1A H;  1OCR H;  3X2Q H;  3ASN H;  1V55 H;  3AG3 H;  1OCC H;  2EIJ H;  2EIK H;  2EIN H;  3AG4 H;  3WG7 H;  2DYR H;  2OCC H;  1OCO H;  3ASO H;  5IY5 H;  2Y69 H;  5B1B H;  5B3S H;  2ZXW H;  2DYS H;  2EIL H;  1V54 H; 
#chains in the Genus database with same CATH topology
 3FBI B;  5L3D A;  3S93 A;  1TBX A;  5CLS A;  3H1C A;  2XDV A;  2EA4 A;  2PG4 A;  3TP3 A;  4GDF A;  2CFX A;  2DMQ A;  1ZK8 A;  1VQO I;  1T38 A;  2QBY A;  5E18 F;  3W2A A;  1IN5 A;  1VFC A;  1UB9 A;  2LY2 A;  1WI9 A;  5FD5 A;  2XSD C;  1SC7 A;  1X2N A;  2CJJ A;  3LQR A;  4II3 A;  3MKL A;  4FX4 A;  2VJ4 A;  4IHV A;  6PAX A;  3LWF A;  3P9I A;  4I0A A;  2ADU A;  5L3E A;  3HOS A;  1K6Y A;  1W0T A;  2HOT A;  3FKJ A;  2V1D A;  5J40 A;  3BT9 A;  4XRS A;  3H5R A;  3U21 A;  1A31 A;  1HST A;  4XLE A;  3TW7 A;  2OQG A;  3TOB A;  1ON1 A;  3GZ6 A;  1TWH J;  1YX5 A;  4R79 A;  5ILV A;  1TC3 C;  3MZ8 A;  2O61 A;  3BZC A;  2R7W A;  2BE5 F;  4ZDP A;  3QOD A;  4KIS A;  1YW8 A;  2ZCW A;  4DZJ A;  2HDD A;  2Y2Z A;  2IS1 A;  2KJB A;  2L2O A;  4OIN F;  3L9F A;  1I5Z A;  1LNW A;  2P5K A;  5M3M J;  4HLY A;  3FXK A;  4MQV A;  4R1H A;  1SD4 A;  1WRJ A;  2HOA A;  1O7L A;  1OIS A;  3ZPL A;  3VB2 A;  1RIO H;  3DPT A;  2K86 A;  4M6Y A;  2Z33 A;  3F22 A;  2GZW A;  4RAF A;  5JR3 A;  2K3P A;  2AXT C;  1IXS B;  2TDX A;  2K4J A;  4ZYA A;  4D9J A;  2Q1Z B;  1QBJ A;  1MSE C;  4L9N A;  4ANJ A;  2GBY A;  2EBI A;  1JKQ C;  3BR5 A;  4XLH A;  1VF9 A;  2RAE A;  1IN8 A;  1VQP I;  1I6H J;  3IP4 B;  2EJR A;  5C3E J;  3PIP F;  2NS0 A;  4J01 A;  2JRT A;  2VAS A;  3LSM A;  2DN0 A;  2XAH A;  3BOQ A;  2PJR A;  1V5E A;  4HF0 A;  2JMW A;  3ABK H;  2LKX A;  1HDP A;  2EIM H;  2R7S A;  1JTY A;  1LFB A;  3I9V 2;  4BS9 A;  1I27 A;  1WH7 A;  4XRM A;  2RKH A;  4CDG A;  2R7T A;  2HR3 A;  2UUZ A;  4RAY A;  3I4M J;  2LNB A;  5KK1 A;  2K27 A;  5EEG A;  4FCY A;  1JKP C;  1GV5 A;  2M34 A;  3E97 A;  3TDU C;  4CZZ A;  4L5E A;  3LL7 A;  4BBS J;  3ZRG A;  5D6F A;  1USS A;  3SZG A;  3DU6 A;  2G7U A;  3QPL A;  2BY2 A;  2EWN A;  2ISY A;  2Y9Z A;  1U8R A;  1M1E B;  2MH9 A;  5FKK A;  1A35 A;  3K2A A;  3KET A;  4F55 A;  1W7P A;  1R23 A;  4C3J J;  2FSW A;  4Q4Z F;  4XOP A;  2F5F A;  3ECO A;  4NB5 A;  2NVT J;  2NAZ A;  5E8G A;  1MBJ A;  3IHU A;  3VPR A;  3BPV A;  3JTH A;  2JUG A;  4BE0 A;  2VOP A;  4ZDO A;  3KP7 A;  2EIL H;  1XDS A;  3ZN0 A;  2OPT A;  3WTT C;  1X3W B;  4A0Z A;  2CRG A;  2L7M P;  3MMY B;  1RKT A;  2E1M B;  2QQ9 A;  2CW7 A;  2H8R A;  1B8I A;  2DFE A;  2OC6 A;  3S16 J;  1R4M B;  4A3F J;  1Y8Q B;  4AVP A;  2OUM A;  4MHG A;  4EJV A;  1EF4 A;  2JK3 A;  2VKH A;  2GOM A;  1MMS A;  1QVU A;  2RNJ A;  1LKX A;  4C30 A;  4G7O F;  4HX8 A;  3SYT A;  1STZ A;  5M3F J;  4G12 A;  5LEK A;  1MD0 A;  4ENK A;  3R6S A;  3A02 A;  2LK2 A;  1T39 A;  1Z21 A;  1P2F A;  3COA C;  4B47 A;  3HUG B;  3JRA A;  3BLY A;  4XL9 A;  3BG3 A;  3BTC A;  1A04 A;  1JJ6 C;  2ID6 A;  2ELH A;  5L3C A;  4PJJ A;  2PN6 A;  1WJ5 A;  5D5W B;  3EET A;  2EFW A;  4RBO A;  1XGM A;  5LEJ A;  2JSC A;  3J81 K;  4NDL A;  2QSG X;  3GTP J;  1FX7 A;  1A36 A;  4LFU A;  1R1U A;  3KP5 A;  2XF6 A;  1P6R A;  2CG4 A;  3H9G A;  2ZJP F;  5DDG A;  1E2X A;  2FOK A;  5H6Q A;  5C4X J;  1MJB A;  3BG5 A;  5E79 C;  3D1N I;  1QZE A;  5E1X A;  3FIW A;  3PO2 J;  1UJ8 A;  2R5Z B;  2BYV E;  2GXA A;  4F91 B;  3FMQ A;  2FML A;  3PQJ A;  1MNM C;  3HRS A;  5IOZ A;  1X4P A;  5FO5 A;  2ETH A;  1ZG3 A;  4E7I A;  4G94 A;  1NK2 P;  5HS8 A;  2IEK A;  3RJP A;  3DPU A;  5ED4 A;  1OCP A;  1WVR A;  3CJN A;  5CPR B;  4BE1 A;  2XAS A;  3F8M A;  2CQX A;  3KE2 A;  4WWC A;  2HVS A;  4KA4 A;  1XPX A;  4X6A J;  1U9N A;  1S8N A;  4Z2Y A;  2E19 A;  2QSF X;  5EGO A;  1Z7U A;  3WU1 B;  2K5C A;  3R0J A;  1Y39 A;  2JN6 A;  4OIO F;  1O3Q A;  2HZD A;  3QPS A;  5FRO A;  1Z67 A;  1YHQ I;  5M5Y J;  5L3F A;  2YS9 A;  2OAZ A;  5IT9 K;  5JLX A;  2L9V A;  2HGC A;  3R61 A;  2I10 A;  5TGT A;  3WTV C;  3I4N J;  4RLF A;  1YW7 A;  4HLX A;  3P9K A;  2WAE A;  2LY1 A;  2W48 A;  3CZ6 A;  4FQG A;  5J1R A;  3CMY A;  1TL8 A;  3EUH C;  4PJM A;  1DQU A;  4M9X A;  3E0J B;  2FA5 A;  4Q5S F;  3L7W A;  5CVI A;  4E4H A;  2VBW A;  4ESB A;  2FOW A;  1H8A C;  2VL8 A;  2EZL A;  2KFD A;  4JX6 A;  1L3L A;  4A0X A;  3GTK J;  5C4J J;  2X1D A;  2DFH A;  1FMW A;  1IDY A;  2MC4 A;  3ZQ7 A;  1A6I A;  4YIR X;  3OS0 A;  1H9T A;  3QRF F;  1GHC A;  2H8W A;  3CUQ A;  4LIU A;  2QBY B;  3VSL A;  2ZJR F;  3HPH A;  2XRO A;  1VQN I;  3FXU A;  1RPW A;  5F1J A;  2HYJ A;  3M1C A;  1JGS A;  2NS7 A;  2X4H A;  4UHT A;  3KEY A;  3FKI J;  4ENJ A;  1IN6 A;  2FNP A;  4RGR A;  4HRI A;  1LB2 A;  5FLX Z;  3DFG A;  3G71 I;  4KIG A;  4HNV A;  1K4T A;  2K9M A;  4MTE A;  2ZJQ F;  2VN2 A;  2HQA A;  4BAY A;  2LD5 A;  4HYE A;  4OMZ A;  3RPQ A;  1YTY A;  2F5C A;  3S8P A;  3L2U A;  4AM3 A;  1Z91 A;  1XDU A;  5DYM A;  4DYR A;  3WTW C;  1S9H A;  3CP8 A;  2ELK A;  4OAZ A;  1XCB A;  2Z1D A;  4HNT A;  1P7I A;  4CCN A;  3TBI A;  1HXD A;  1XX5 A;  2M0C A;  4Y4R A;  2W84 A;  3BC8 A;  5IT3 A;  3RPU A;  3D5L A;  3MZH A;  1FYK A;  2D1H A;  2R93 J;  2HKX A;  4E7H A;  3OYE A;  3FHN A;  4XSZ F;  2X9D A;  4D5C A;  4PJN A;  1IGN A;  1JE8 A;  1HKT A;  3CP2 A;  5CQG A;  1ZQ3 P;  3OS1 A;  2NNN A;  3FXM A;  3V7C A;  1HCR A;  1SFO J;  3HXL A;  3HGY A;  1X3Z B;  3CES A;  4LK0 F;  3BZ6 A;  3ZQG A;  2V6E A;  2A5W A;  1WKM A;  4A3M J;  4ZC3 A;  1JKR C;  1B72 A;  1V5F A;  4IQJ A;  4P96 A;  2L9N A;  1FOW A;  4BJT A;  3IAM 2;  4OIQ F;  2DK8 A;  1MGT A;  3KLO A;  1X3U A;  1QNT A;  1XCV A;  3OY9 A;  2XC7 A;  4XLC A;  4IOA F;  3S2D J;  2VE8 A;  4BHB A;  1BM9 A;  1XSX A;  2BZT A;  1UST A;  3M1E A;  2LRE A;  3KCC A;  4RA2 A;  3MVP A;  3HKZ N;  4PGH A;  3LA7 A;  4BQQ A;  3HGG A;  4XN3 A;  4LLN A;  3K4L A;  1SVL A;  2P0W A;  4IHT A;  4XLF A;  3BR0 A;  1GVD A;  3LSG A;  4AWX B;  5LFA A;  4YFX F;  3G73 A;  1EJ9 A;  4MNU A;  1EKE A;  2LOO A;  3OIO A;  1MIJ A;  3TOA A;  3VYU B;  1T0F C;  2LVS A;  3CCY A;  1TT5 B;  2DBB A;  3RYR A;  5IY5 H;  5JHF A;  1UMQ A;  1ZKG A;  2CUE A;  3WTY C;  4D0P A;  4L9J A;  1W7P B;  2ZNZ A;  1PUE E;  4H0E A;  1BC8 C;  1WCM J;  3I71 A;  2F5E A;  2DA2 A;  2DU9 A;  2LC2 A;  3WHB A;  2GOX B;  1OYI A;  1R49 A;  2O6G E;  1IXR C;  1B9M A;  3GFI A;  4HEA 2;  2CUF A;  2K9S A;  5D4R A;  1U78 A;  3BTL A;  3CJQ B;  4E6K G;  3FM3 A;  2L7K A;  2XAU A;  5DUI A;  3QPH A;  2LSO A;  4HX4 A;  1Z05 A;  2KRC A;  2KQR A;  2X0L A;  3BDD A;  4BEH A;  2G0E A;  3HOU J;  2CUJ A;  2M5W A;  3PFI A;  4DJA A;  3CCU I;  1SAU A;  2WAQ N;  3S3N A;  4XM3 A;  1TW3 A;  3RQ4 A;  2DT5 A;  4G6Q A;  2JUC A;  5BMZ A;  2JVH A;  4IKF A;  4RM3 A;  2P5V A;  3OMY A;  3ASN H;  4B43 A;  1ITY A;  3W2V A;  2HEO A;  2B63 J;  2QF7 A;  3S1N J;  3K70 D;  3M07 A;  3QP5 A;  3TW6 A;  3HTS B;  1PP8 F;  1HKQ A;  3JRI A;  2MAB A;  1D0X A;  2KRF A;  3O3K A;  2QZ8 A;  1QGP A;  4V2G A;  2JTV A;  5CYV A;  3SJM A;  2HVQ A;  3WOD F;  4JX5 A;  4IQ4 A;  4B4C A;  3DBR B;  3IL2 A;  2DYS H;  2J5P A;  2E5N A;  1OYW A;  1ZEL A;  4HSR A;  1MMA A;  1HW1 A;  4HV5 A;  4W97 A;  1K61 A;  2YPR A;  1FY7 A;  4CA0 A;  1OYY A;  3GFL A;  3K4B A;  2Z3Y A;  2MSY A;  5HDK A;  1HBX G;  2AXL A;  4EAT A;  3WTS C;  1V5G A;  2A3S A;  2GA1 A;  1ETQ A;  2BHZ A;  2QQ8 A;  1XN7 A;  4U87 A;  5E20 A;  1XB4 A;  3BRO A;  2IGN A;  3LAP A;  1MZB A;  4Y15 A;  1TWG J;  1JTX A;  1R22 A;  4YIF A;  5BQT A;  2WV1 A;  3ZMD A;  5KHD A;  2I5U A;  3BJ6 A;  3DLA A;  1V54 H;  2XV4 S;  4XID A;  2IA0 A;  2GXB A;  3F8N A;  3VEP A;  2R7D A;  2JA2 A;  4A2U A;  1UG2 A;  1YIO A;  3EPZ A;  5DCM B;  1XMK A;  4FE4 A;  2EPF A;  4EJU A;  1JXS A;  2CU7 A;  1ZRF A;  1OCR H;  2NYX A;  3BY6 A;  3DF8 A;  3CDH A;  2ELJ A;  4M72 A;  4EM0 B;  1MBF A;  4ZYH A;  3LA2 A;  1IRX A;  5LHH A;  4KUM A;  4A3J J;  1MMD A;  3QP6 A;  4S04 A;  3JAM K;  3D5R C;  3K7A J;  1LVK A;  3NAR A;  3KYC B;  4ESF A;  3WGI A;  1HDD C;  1LVA A;  2VBX A;  1U5T C;  4BJ6 C;  5D8L B;  5JVT A;  4M6V A;  3GLX A;  3FXO A;  1VQ8 I;  1FTT A;  1I50 J;  3KP3 A;  1ENH A;  4A3B J;  5CVJ A;  2Q2E A;  1DDN A;  2ZXH A;  3GO5 A;  4XNF A;  2FJ1 A;  1J09 A;  5BNG A;  4P5O A;  1OFC X;  2WY8 Q;  2YUS A;  1IV8 A;  1GLN A;  2X6W A;  2HWV A;  4LK1 F;  3U2R A;  3B02 A;  3GTO J;  1P4A A;  2MD0 A;  1ETW A;  5IPA A;  1ZGJ A;  2DA5 A;  4XK4 A;  5J4Y A;  1WHU A;  4J19 A;  2PJP A;  3PL8 A;  1I6X A;  3MFK A;  4IRG A;  4DYQ A;  3MKY B;  1PVE A;  3P5J A;  2L5Q A;  2DOE A;  2VKV A;  3HYI A;  2FNA A;  2BVM A;  3CF2 A;  3K4N A;  2IA2 A;  3V4G A;  3GLL A;  2CUZ A;  3SQN A;  1LFP A;  1WJC A;  3A1Y A;  2R3S A;  1KZH A;  4O3M A;  3WG7 H;  1I1S A;  4L0Y B;  4I2O A;  1WZ2 A;  3E6C C;  3GBG A;  2FBH A;  3ECH A;  4BU2 A;  4L0Z B;  3CD6 I;  4NHJ A;  2W82 A;  1P9Q C;  3VDX A;  5LD2 C;  2O8K A;  3K4M A;  2M4K A;  2ESN A;  3DQV C;  2IP2 A;  5HOD A;  5BPD A;  2HTJ A;  3HPG A;  2EV6 A;  4G8X A;  3CDL A;  2LR8 A;  5EZG A;  2AHQ A;  5CVU A;  4XN0 A;  3FWE A;  1MDM A;  3AL0 B;  3JAM Z;  2DA1 A;  2FEZ A;  2G7H A;  1BIA A;  3BZK A;  1ZHF A;  3DEE A;  3TO7 A;  1D1A A;  4PFO A;  2DFF A;  2VPL A;  2XRL A;  3H35 A;  2Z5U A;  3CTA A;  5ERI A;  1S3J A;  1B72 B;  1FWZ A;  3P9C A;  3S14 J;  4A3D J;  3CO7 C;  5BOX A;  2STW A;  4XSX F;  1J2X A;  2V9P A;  3EUH A;  4UUS A;  2IGM A;  3J7Y J;  2HKO A;  3T8T A;  3RKQ A;  1ZLJ A;  4C2M J;  2JT1 A;  3ZGK A;  4D7M A;  2OTL I;  1IXC A;  5IP6 A;  3S3O A;  1FSE A;  5GAE J;  4C3I J;  3LSK A;  3PFY A;  4IJA A;  3DKY A;  3OSF A;  1HF0 A;  1JUP A;  3I56 I;  2NNY A;  3M3Y J;  4L5J A;  3SZT A;  2ZXI A;  2WWY A;  3HHG A;  2J5O A;  1I3A A;  5CJ9 A;  4KNY A;  1MBE A;  1N78 A;  1FSH A;  3C3W A;  4DBQ A;  3HJE A;  4NQW A;  3ELK A;  3K4C A;  4AUX A;  2FX0 A;  4MFE A;  3OL4 A;  5AIQ A;  2ZBK A;  1FIA A;  3HZJ A;  3IUO A;  4FT8 A;  1OKR A;  1LEB A;  4CXF A;  4FIS A;  5H20 A;  4EEF G;  5LHI A;  2DO7 A;  2WBM A;  3GYH X;  3ZQI A;  5FRM A;  1YS6 A;  5FRN A;  5LRR A;  5BS6 A;  3ZR8 X;  3N05 A;  1GV2 A;  4XKV A;  4EM1 A;  4IVN A;  4CO8 A;  5J1U A;  3L2W A;  3C18 A;  2VI6 A;  1Y1W J;  4EJT A;  4YFK F;  1ON2 A;  3I59 B;  4PJL A;  4UNO A;  5JI6 A;  2V1X A;  3REO A;  3CLQ A;  1DGR M;  3K2Z A;  2DA6 A;  2IXS A;  2W00 A;  2A69 F;  1YIT I;  1IUY A;  2KP6 A;  3HRM A;  3ZCO A;  2L7F P;  2F4O B;  1T98 A;  4XON A;  2MGQ A;  4IO9 F;  4U0V A;  3DTE A;  2CV0 A;  1RNL A;  2ISZ A;  3I0T A;  5IYD J;  4XLA A;  1BC7 C;  1LEA A;  4OOI A;  4J00 A;  2HTS A;  4BEH B;  1YJW I;  3CCS I;  1WSU A;  2QCO A;  2DOF A;  3IH2 A;  2Z2S B;  2DMN A;  2ME6 A;  2HXI A;  2BY1 A;  2GXG A;  4B8X A;  2VUM J;  5F08 A;  2P6T A;  1S29 A;  3DEW A;  3L09 A;  3H3U A;  2O0Y A;  4CIC A;  3ZOB A;  2R7Z J;  1PJR A;  2HYF A;  3IC7 A;  1S7E A;  3DEU A;  2HXO A;  1TQP A;  2KIM A;  2QM3 A;  3SFZ A;  1WI3 A;  1W5T A;  2KT0 A;  4HA8 A;  4CCK A;  4I0B A;  2Q0O A;  2L9S A;  1WPK A;  2IVM A;  1FC3 A;  2XIG A;  3DKW A;  3FIS A;  2OCE A;  1QVT A;  2M45 A;  3FBN B;  2IBD A;  5HLG A;  3I54 A;  1JI8 A;  4E7S A;  1T0F A;  1ZTR A;  3SEZ A;  4UVA A;  3F8F A;  3EYI A;  3ZXS A;  3ISP A;  3CCV I;  4Y13 A;  4ZH4 F;  4KIC A;  1Z6R A;  4DQ2 A;  1FJL A;  2JWT A;  3QOE A;  2E7W A;  2KKO A;  3OOU A;  3TL4 X;  2IS2 A;  5LHG A;  1BA5 A;  3IWZ A;  5LBQ A;  3ZP5 A;  1RR7 A;  2XAQ A;  3R60 A;  4RAZ A;  1MBG A;  2KIQ A;  1QQI A;  5HDG A;  4KIT B;  1R6R A;  4A5N A;  4HNU A;  5D5V B;  4JP0 A;  3J80 K;  4D7N A;  4OU0 A;  4MLO A;  1ETX A;  1MMN A;  1YW9 A;  4JQF A;  2AS5 F;  3GEZ A;  2CQN A;  3EUA A;  2ECB A;  5ILS A;  1KU3 A;  1S7A A;  3F6O A;  1ZLK A;  4AIJ A;  1N75 A;  1ZGA A;  1OQY A;  1D5V A;  4V2F A;  1MNE A;  4IRI A;  4JYK A;  3DP7 A;  4IXA A;  4HQM A;  3VFZ A;  4KT5 C;  3NRV A;  2EFN A;  3QU3 A;  1YS7 A;  3BCA A;  5FKL A;  1R36 A;  2A5Y B;  2Q8K A;  4DW6 A;  3HC7 A;  3KEQ A;  3ULQ B;  1RRJ A;  2M9H A;  1KU7 A;  2A68 F;  1V55 H;  3FMR A;  2W1O A;  1XSD A;  4CHU A;  2EIJ H;  4WK8 F;  1DUX C;  2IS6 A;  5TIS C;  4G6T B;  2HI3 A;  2JJ7 A;  1TWF J;  3MZY A;  3IKT A;  2KZG A;  2L01 A;  1T33 A;  4GGG A;  3T8R A;  4QTR A;  2YU3 A;  2QWW A;  1Z9C A;  2DOA A;  4ZTF A;  3SHF A;  1W1W E;  1Y0U A;  4I7H A;  2DA3 A;  4I09 A;  3S32 A;  5L3G A;  4XIC A;  3IRQ A;  5CKT A;  3CCR I;  2BHY A;  1K79 A;  3G2B A;  2ZKZ A;  4PJ0 C;  5K7F A;  5E3M A;  4FAS D;  4BXU A;  3J7A O;  3L2Q A;  5F64 A;  1PDN C;  2OTJ I;  2ZSH B;  3BQY A;  2A07 F;  4A12 A;  2YSR A;  3E6D A;  3MKW B;  2NVY J;  2WA0 A;  4HF1 A;  3PSI A;  1O3T A;  3LA3 A;  1KYW A;  2OCC H;  2IT0 A;  1Z1D A;  1ZYR F;  4BXF A;  4L5I A;  1K7A A;  1HA8 A;  3TMO A;  3F23 A;  2E1M C;  2DDA A;  1IAW A;  2W85 A;  5ICF A;  2LDU A;  5FLX K;  5JVG F;  4ZYG A;  4PSX A;  3J80 Z;  2DQR A;  1ETV A;  2FUG 2;  2R7O A;  4RMN A;  4MEX F;  4YII A;  3CF5 F;  1RET A;  1KQ0 A;  4CCJ A;  2XPU A;  2V4J C;  4EMS A;  4U7B A;  3OL3 A;  4I6Z A;  2E5Z A;  3PQK A;  1ZRD A;  2WV0 A;  3FF5 A;  2P6S A;  2M2E A;  4A6E A;  5LGU A;  1QPI A;  4M3G A;  2DDB A;  2B0L A;  1CF7 A;  4OAY A;  1G2H A;  2XGX A;  4ZDL A;  3V8J A;  5LLQ A;  1OCT C;  2P81 A;  4WXC A;  3E6M A;  4L9V A;  4V19 K;  2ECC A;  1SD6 A;  2K9Q A;  1H0M A;  1B6A A;  4N4O B;  1ERD A;  3BQZ A;  1ULY A;  1SFU A;  4K2E A;  1KA8 A;  1F4K A;  1WJF A;  4LG0 A;  3G6E I;  4E7L A;  2OD5 A;  4P9F A;  2LLK A;  1YRN A;  2HVR A;  2VQH A;  2IS4 A;  5FFX A;  3WE2 A;  2R7U A;  4YFN F;  3BG7 A;  3H9J A;  1WJA A;  3JCU C;  3VWB A;  2VQG A;  2Y0S A;  1G3W A;  2HZT A;  4MFD A;  1RR8 C;  4AVZ A;  1G3T A;  4ZZL A;  3ROU A;  4CH7 A;  5EG0 A;  3DTK A;  4PK4 A;  1V3F A;  4DBR A;  5K7Z A;  3BG6 A;  2EB7 A;  2GIV A;  2XGE A;  3J7Z I;  3LSI A;  4Q47 A;  2UWM A;  4NQW B;  2VBY A;  1Y0N A;  1FP2 A;  2MD5 A;  5HDN A;  1WFX A;  1YQA A;  5FGM A;  1X1A A;  1SAX A;  2BOL A;  4JX4 A;  4A3I J;  1GDT A;  2VBZ A;  4U88 A;  3ZMZ A;  2EIK H;  3B6C A;  4HST A;  4N9I A;  4C2T A;  1IUF A;  5GTH C;  2MLK A;  2MG4 A;  2MLG A;  4L9T A;  2R7X A;  4LB5 A;  3E7L A;  3F21 A;  1ZG1 A;  1XGS A;  3W3C A;  1JGG A;  1VQ9 I;  3WTX C;  2HU9 A;  1X1D A;  2HOE A;  4I01 A;  2X6O A;  3FM5 A;  3OR1 C;  4WX9 A;  2KDO A;  2RGV A;  3B6A A;  1ZRC A;  1BR2 A;  1W7P D;  4DGW B;  3LQQ A;  2XGC A;  2DFI A;  3ML6 A;  1FTZ A;  2UXN A;  1O7F A;  4QIW N;  3F72 A;  4HPQ A;  5FB2 A;  1S7O A;  4OWR B;  3IH4 A;  4DIQ A;  1N25 A;  1SD7 A;  2EFQ A;  2ZME A;  2CYY A;  1JJ8 C;  1O57 A;  3QQA A;  2DMU A;  2RN7 A;  3RSN A;  2KHM A;  3OS2 A;  3A03 A;  2DT7 B;  1K4S A;  5FKO A;  1ZH5 A;  3ABM H;  2O7O A;  1WJD A;  5LRS A;  1Z6T A;  1TT0 A;  1VZ0 A;  3GTL J;  2NOJ B;  3ZMS A;  3KIO A;  2XAG A;  1T56 A;  2AQE A;  1BJZ A;  3A01 A;  1IN4 A;  3Q3S A;  4B1R A;  1TWC J;  1IDZ A;  2ZJ2 A;  1SAN A;  1G8X A;  1OLT A;  2V9K A;  1BW5 A;  5J8C A;  2ZC2 A;  1OCO H;  1O3R A;  4AYB A;  3ASO H;  2EFO A;  3LSH A;  4LOC A;  4D1Q A;  5BPI A;  1QPM A;  1E3O C;  2H6B A;  3K1P A;  2M7A A;  4NC7 A;  1MKM A;  1WWX A;  2PJR B;  4HOB A;  2K02 A;  2NOG A;  2Z9O A;  5GAG J;  1FLI A;  1UCR A;  2GA2 A;  1FIP A;  2VC0 A;  1ZAR A;  4U0W A;  2XPW A;  3CCL I;  3CC7 I;  2QUF A;  2Y30 A;  2WC2 A;  2QQA A;  4EJO A;  2Y48 A;  2EZK A;  2GLO A;  1FZP B;  3L2C A;  3SZP A;  3G1O A;  1KU2 A;  4A3G J;  3RZD J;  4LIV A;  1D8K A;  1ZG5 A;  1Y1V J;  2E34 A;  4F93 B;  1F5T A;  1NK3 P;  2WTE A;  2N8G A;  3NAU A;  1BJA A;  5DV5 A;  3M8J A;  2LBF A;  3HM5 A;  3BWG A;  1UG0 A;  2A6E F;  4G6D A;  4EM2 A;  2K85 A;  1UAA A;  1ETK A;  1AKH A;  1D5Y A;  4XKC A;  2ZO4 A;  4ASN A;  2LMD A;  3DWL E;  3GZN B;  3L00 A;  4XR6 A;  2GIZ A;  5AON A;  3JSO A;  2GM4 A;  3GUD A;  3UKG A;  1PUF A;  2KIF A;  2W24 A;  3T0Y A;  4A3L J;  5KNL A;  3CCE I;  4IHY A;  2R7V A;  3FXQ A;  3CC2 I;  2CSO A;  4ZTJ A;  3HRU A;  4CSW A;  2IPQ X;  3BR6 A;  1ONV A;  2VT2 A;  1KU9 A;  4FHT A;  3HOT A;  2M87 A;  1D1B A;  3LMM A;  1YJN I;  1I39 A;  3S1M J;  1P4W A;  5DEQ A;  3OYN A;  3NEU A;  2HQR A;  2Y0S N;  1D0Z A;  4XRF A;  4BQA A;  1B8I B;  3R4K A;  4HBL A;  4IEJ A;  5GAH J;  1OPC A;  2CWE A;  1I3Q J;  4IL6 C;  3VYR B;  3IWF A;  2PMZ A;  4LIT A;  4TV7 A;  1SVM A;  2HQN A;  4RB0 A;  5DS9 A;  2V79 A;  5IYC J;  1QHH D;  3P7N A;  4Y52 J;  2B7E A;  2DTZ A;  1ZN2 A;  2NS8 A;  1H89 C;  3CLO A;  2LY9 A;  3HG9 A;  4RM2 A;  3VYS B;  1Z77 A;  1R5I D;  2VKE A;  3QOP A;  5E8I A;  4MO7 A;  1J59 A;  2O5R A;  2XAF A;  3IV5 A;  3NQO A;  3KLN A;  3HSF A;  3ZQH A;  1MND A;  1J75 A;  3HOV J;  4QPQ A;  3GTM J;  3GCM A;  2OU2 A;  4KJZ A;  2EFP A;  3G3Z A;  3S15 J;  1KQ9 A;  5CQE A;  2ZXJ A;  4Y7N J;  3MKZ A;  4PSW A;  2M1B A;  1HSJ A;  2VOO A;  2H1K A;  1HW2 A;  4M9S A;  2DOD A;  3QAH A;  3PJR A;  1LE8 A;  4BY7 J;  1PP7 U;  1SFX A;  4EVI A;  1FYL A;  2A05 A;  2EQR A;  2XAJ A;  3H0G J;  3K4J A;  3OR2 C;  5JLW A;  1AU7 A;  4XMY A;  3RKW A;  3RZO J;  1Q1V A;  4BBR J;  4QSH A;  3C7J A;  3TP0 A;  3M4O J;  2A6H F;  1BI0 A;  2KMU A;  3KZY A;  2RDP A;  1NG7 A;  2GQQ A;  3X2Q H;  2XGD A;  3WGG A;  4MGR A;  2BEO A;  3TGN A;  3CCM I;  3O6B B;  3C2B A;  4A3E J;  4AD9 A;  1P92 A;  4P1W A;  4CZC A;  3BJO A;  5IP9 J;  2DYR H;  4HDU A;  4UVC A;  4Y33 A;  5F0F A;  1G4D A;  4A93 J;  2PX9 A;  1Z7L A;  2VB6 A;  5EGO B;  1TNT A;  1DU6 A;  1WQ2 A;  2V1N A;  3L1P A;  2LRD A;  1LFU P;  2JA7 J;  3B73 A;  2CMP A;  3FHZ A;  1EV7 A;  1EH7 A;  1RZ4 A;  3H3Z A;  3OYI A;  1W36 D;  3PNV A;  3F8B A;  1K6O A;  3BP8 A;  1V4R A;  1EH6 A;  4LG0 B;  4YRV A;  4CGZ A;  5LGN A;  5B1A H;  1YRN B;  4BNC A;  1MMG A;  2XB5 A;  5JHU A;  1DP3 A;  2VJI A;  3KP4 A;  3OWT A;  3VYT B;  3CC4 I;  3AAF A;  1FT9 A;  1R71 A;  5F1R A;  4FET A;  2OV7 A;  2DA4 A;  2FD5 A;  2ZFU A;  4C9Y A;  1GT0 C;  4M71 A;  2DCE A;  3CME I;  4QLC U;  1F36 A;  2CS3 A;  2KIU A;  1HKS A;  1TP4 A;  3HSE A;  2UXX A;  1R9T J;  1VQ6 I;  4XBF A;  1L0O C;  3CUQ B;  4O5V A;  1K78 A;  4I98 B;  1IZ1 A;  1I1G A;  2MBF A;  4JK1 X;  2BXY A;  3CDI A;  3Q0V A;  2YR2 A;  4PUS A;  1OMI A;  4GRI A;  2E60 A;  3AG3 H;  5AIP A;  1J0R A;  2VKD A;  4LD5 A;  5HS9 A;  4BDY A;  1W0U A;  4JBA A;  4W1U A;  1LUJ B;  2L3D A;  3K70 C;  1X1P A;  2F5V A;  4XKB A;  4CCO A;  4Z6Y A;  1S6L A;  1S5L C;  5GTI C;  2Y0M A;  3SDB A;  3MAJ A;  1MSF C;  2QEX I;  2COM A;  2FE3 A;  2DJN A;  4B44 A;  2OQR A;  4BUP A;  1HW5 A;  1IRZ A;  3ZMV A;  2DK5 A;  5KAF C;  1B59 A;  1Y6I A;  1VQK I;  1LJ9 A;  5M5X J;  1D8J A;  3HEF A;  3SDG A;  1C0W A;  1IRG A;  1SVO A;  2BGC A;  1YLF A;  2QKL B;  4GYI A;  5F27 A;  1E3H A;  4YEJ A;  3WU0 A;  1NG6 A;  5HLT A;  2ZME B;  3AFH A;  4AU7 A;  1OJL A;  3H5A A;  5HNH A;  2B9S A;  1YOV B;  2M4G A;  1T6S A;  2QA4 I;  2GWR A;  3G1L A;  4FE7 A;  2V7F A;  3V8L A;  4IZZ A;  3S2W A;  1D1C A;  2H09 A;  1FP1 D;  3I3L A;  1IG7 A;  3DKX A;  3OYL A;  2IRF G;  2PMZ N;  1SMT A;  2UZK A;  4M3F A;  3A01 B;  3EUK L;  3W6J B;  4CCL A;  3CMM A;  2A6T A;  5K1Y A;  2XVC A;  4A3K J;  4CUG A;  1U9O A;  2KZV A;  2EZI A;  4R8H A;  2LFB A;  2MW8 A;  1FOY A;  2HYG D;  4B48 A;  9ANT A;  1E17 A;  3K6G A;  5M5W J;  2DAO A;  2A61 A;  2DXI A;  4BKX A;  1KYZ A;  4GO1 A;  1YO5 C;  4JOM A;  5HLH A;  5F0C A;  4BY1 J;  3AL0 C;  4E7K A;  2EK5 A;  3HRT A;  2LYC A;  4Y3O A;  2QGU A;  1W36 C;  4I76 A;  2R92 J;  2JPB A;  1VI0 A;  3KZI C;  5IYB J;  2ACJ A;  1ZR4 A;  2X1C A;  4X1E A;  4CYC A;  3BR3 A;  1RUN A;  1FOK A;  1X19 A;  2AQF A;  2VQC A;  4M74 A;  4BGD A;  5E3O A;  2JZY A;  5CVR A;  1YIJ I;  1Y8R B;  5EEA A;  3S1R J;  2JA5 J;  1P7J A;  1RI7 A;  2ID3 A;  3BPX A;  1T2K A;  5J8F A;  4ZYE A;  1QRY A;  3TO6 A;  3JRG A;  1APL C;  3V8K A;  3K1N A;  3LFK A;  4N0B A;  2QKM B;  2LBF B;  2KRH A;  3PNT A;  3RQI A;  5KCM A;  4DOZ A;  3ERM A;  1AKH B;  4L18 B;  2AO9 A;  3ZMT A;  1VQ5 I;  2NXN B;  3H3V K;  2NVQ J;  3HTU A;  1NH3 A;  3AKZ A;  5EEH A;  5TJJ A;  2WB1 A;  1OR7 C;  4U0Y A;  3GTJ J;  5ILU A;  2EV0 A;  1PUF B;  3DV8 A;  1TZL A;  3CJT B;  3K69 A;  4BAC A;  2Z99 A;  2FU4 A;  1U2W A;  1GXQ A;  1G3S A;  1IO2 A;  5B1B H;  3M9A A;  3H9Q A;  1Z3X A;  1D3Y A;  1YI2 I;  3JRF A;  2TRT A;  3GW2 A;  3PM1 A;  3SEQ A;  3F3X A;  5K7H A;  3MN2 A;  1SD5 A;  4KT6 A;  1Y56 A;  3A0B C;  1F9N A;  4M3D A;  4D5F A;  1UZC A;  1AOY A;  3Q0W A;  3EYY A;  2EV5 A;  4HV6 A;  1Z0X A;  1OCZ H;  4BL0 B;  4KFC A;  1GVJ A;  1FNN A;  3OYB A;  3W2W A;  2ICW G;  5J47 A;  2L9R A;  1VTN C;  5EYR A;  3L2R A;  3GX4 X;  4OMY A;  1R1T A;  3ABU A;  3R0A A;  2P8T A;  4GXO A;  3CO6 C;  3J7A Y;  4OIP F;  1UEL B;  5FFZ A;  2CGP A;  1VQ7 I;  1T08 B;  3QPT A;  2RV8 A;  2RNG A;  4ENM A;  3FXR A;  4KIF A;  5K5R A;  4N9H A;  3BG9 A;  3JTG A;  4YG2 F;  1POG A;  2VE9 A;  2L4A A;  2E1O A;  3C1D A;  1GUU A;  3F0C A;  3Q9S A;  3IRR A;  4MEY F;  2HOS A;  3I64 A;  4P9U A;  5J4V A;  3LAJ A;  3LST A;  2O03 A;  3K10 A;  2V6C A;  4M3B A;  3Q0U A;  2PMU A;  3H92 A;  1ZRE A;  1LDJ A;  2LTP A;  3G4S I;  3AG4 H;  1QO0 D;  3RCO A;  4XRS G;  1R1V A;  3OOP A;  1IRF A;  1LE8 B;  1LDK B;  2PQ8 A;  2P7V B;  1HOM A;  1P4X A;  2NVU B;  1U6G A;  3RKY A;  2CV1 A;  4II2 A;  2R5Y A;  2VIX A;  1A5J A;  3TQN A;  2CW0 F;  2H6C A;  4XKW A;  1SFE A;  1QHG A;  3A4C A;  3FMS A;  1N77 A;  2NVX J;  2STT A;  5EJC A;  3OYG A;  3KEO A;  1IN7 A;  4FX0 A;  2KL4 A;  3ZMU A;  4IHS A;  2E71 A;  3E1S A;  4ENN A;  1X4O A;  2YX4 A;  3LSP A;  1F1Z A;  1HLV A;  2E2J J;  3HSR A;  4BHC A;  2E2I J;  2LF8 A;  3PO3 J;  1FBU A;  2QSH X;  2Q2E B;  2X48 A;  4HF2 A;  1R7J A;  2YU9 J;  5KVR A;  4IX7 A;  3BTJ A;  2P7C B;  2HPM A;  5ICC A;  3FXJ A;  4KMU X;  4QPO A;  4KN4 X;  2PBI A;  2MC3 A;  1MH4 A;  4WF2 A;  3ZQF A;  2LP0 A;  1SMY F;  1AWC A;  3VOD A;  3T1B A;  4PZJ A;  1DPR A;  2R7R A;  5B66 C;  3HOZ J;  3A0H C;  4G7Z F;  1K78 B;  4NUB A;  3LSR A;  4P55 A;  3DTI A;  2VJ5 A;  1DP7 P;  3AG2 H;  3JW4 A;  2XF5 A;  3GXO A;  2PLY A;  2X6Y A;  2Z16 A;  4A69 C;  2D5V A;  1RES A;  4XLN F;  2RC4 A;  2FRH A;  4G9Y A;  3IH3 A;  5FD6 A;  2CW8 A;  4BE2 A;  1T8I A;  3L2V A;  5EDN A;  2JPC A;  2E7X A;  3RYP A;  3U1D A;  4BYY A;  3EDP A;  5F0H A;  2BY0 A;  3LNQ A;  3CUO A;  2Y9Y A;  2WB1 N;  3I53 A;  2KPM A;  5TRD A;  3I4P A;  4ON0 A;  4NBQ A;  1A6Q A;  1MJA A;  1AHD P;  5F6F A;  2H27 A;  2JA8 J;  2CQQ A;  1MH3 A;  1YYV A;  3OYH A;  1RC9 A;  1BI3 A;  1MW7 A;  1Q1H A;  3RTR A;  3U9G A;  3FDY A;  1RKW A;  2O8X A;  4Q48 A;  2FBK A;  2V26 A;  3HKZ A;  5K5O A;  1MDM B;  1G59 A;  3V7R A;  4DYC A;  2M3A A;  3RKX A;  1ZAO A;  4HQE A;  1U5T A;  1X2M A;  3ZQL A;  4RB2 C;  4XOR A;  2HFH A;  3RIR A;  2CV2 A;  3JRB A;  2OBP A;  2R0Q C;  3F8C A;  5D5X B;  2XB0 X;  5DM6 F;  2BV6 A;  3ZQQ A;  2HS5 A;  2ZB9 A;  3OIP A;  1HQC A;  3PSF A;  2XUB A;  1Z3Y A;  1G6N A;  4UUS B;  3OV8 A;  5IOY A;  4MIM A;  5GPC A;  3F9K A;  2XKP A;  1FBQ A;  1X1B A;  1YG2 A;  2F5D A;  4XQF A;  1J9I A;  3DU5 A;  3F6V A;  2OZ6 A;  2XF7 A;  5DCM A;  2DA7 A;  3GME A;  3NWT A;  2IGO A;  1WGX A;  5F04 A;  2O9L A;  4EGY A;  1VQL I;  3OYM A;  5DM7 F;  3GTG J;  3OYF A;  1DU0 A;  1YX3 A;  3PUB A;  3HBL A;  4AIH A;  5E1W A;  2LH9 A;  4M73 A;  2HQ5 A;  4ABZ A;  2CQ7 A;  3OYK A;  2WAD A;  1UHM A;  4NNJ A;  2VT3 A;  4M3E A;  1LQ1 A;  4CYC B;  4ESJ A;  1TNS A;  3WG9 A;  1WJE A;  1BIB A;  2MYS A;  2RRE A;  5D8K B;  4M6X A;  1ACI A;  3N97 A;  2DW4 A;  3CMA I;  2XRN A;  4B3X A;  2JA6 J;  5HVQ C;  4NC8 A;  5D5U B;  2WAQ A;  5K5Q A;  3DXJ F;  4S05 A;  1SFK A;  2IA1 A;  1BOA A;  4G7H F;  5ICE A;  2ZXW H;  1S72 I;  4BJ5 C;  3M7G A;  2F48 A;  4GFB A;  1YE9 A;  2K4B A;  5C44 J;  1UHW A;  3PIO F;  4F92 B;  1H88 C;  3EQL F;  5FKN A;  3WE3 A;  2ME0 A;  4WXH A;  1R58 A;  3SXY A;  4RDU A;  1W4M A;  3K4K A;  4HZF A;  1XG1 A;  1JT0 A;  4GCV A;  3LOC A;  2HNH A;  3IAS 2;  4LJZ F;  4UB6 C;  1KGS A;  3J81 Z;  2VXD A;  2K40 A;  3HOW J;  1UHS A;  4UB8 C;  3NWS A;  3K9T A;  5DCF A;  2D2W A;  2FQ3 A;  1SEU A;  2QQB A;  4HG2 A;  2E1N A;  1VND A;  5IP7 J;  1BI2 A;  2CO5 A;  2OZU A;  2VOD A;  4LG3 A;  2JVG A;  3N4M A;  1NTC A;  4NC6 A;  3ZN1 A;  4RB1 A;  5B5E C;  4M9Z A;  5H6R A;  3RI4 A;  1FMV A;  3HOX J;  1ETO A;  2VXZ A;  5D6E A;  2W4S A;  3ZQC A;  2C6Y A;  2XKO A;  1B1B A;  3QYB A;  3VSK A;  2PI0 A;  3CCJ I;  2BBY A;  2LKP A;  1X58 A;  3JRD A;  4N4N B;  3K1M A;  2IW5 A;  3OSG A;  3Q5F A;  3G1M A;  5HLI A;  1BN5 A;  2E36 A;  2EIN H;  4U7D A;  3OYD A;  3TO9 A;  3WGH A;  3CJR B;  2IGK A;  4LLL A;  3DBH B;  3OYJ A;  1HC8 A;  3KYD B;  4KDP A;  1MBH A;  5J6X A;  1T95 A;  2DMT A;  1VQM I;  5FLV A;  2QEN A;  1IJW C;  3TKY A;  5IT9 Z;  3ESW B;  5GAD J;  5JFR A;  2P4W A;  4RGX A;  2VPR A;  3KZZ A;  3JRC A;  1XC5 A;  3GFJ A;  3I5U A;  1B9N A;  1TWA J;  1TTY A;  4LLG F;  2F4I A;  1BR1 A;  3WTU C;  4PFP A;  3FK6 A;  2ESH A;  2V9V A;  3CCQ I;  3ONQ A;  3HIF A;  1JKO C;  2LKS A;  5FLM J;  3OYC A;  1WJB A;  2DJI A;  1J7K A;  3QWL A;  5J3L A;  3E3V A;  2BW3 A;  2K9N A;  3QYE A;  4BH9 A;  1XD7 A;  4HAM A;  5FKM A;  5E3L A;  2DLL A;  1GXP A;  2R5Y B;  2WY7 Q;  4MTD A;  1FPQ A;  3TDZ C;  1OR7 A;  4KIB A;  1E0E A;  1IW7 F;  2F2E A;  3MEX A;  2F6C A;  3E6B A;  2K9L A;  4E7Z A;  4LGW A;  3T5X A;  3W6K B;  3S2H J;  2L7Z A;  3GFM A;  2E2H J;  1FOX A;  3KP6 A;  1K83 J;  2M0M A;  1E3P A;  1JT6 A;  5DD4 A;  1DPU A;  1LPQ A;  2M7B A;  3WTZ A;  3LFU A;  1IC8 A;  1ETY A;  1TQM A;  2K7L A;  2X85 A;  3M8E A;  3H0D A;  3S17 J;  3DCF A;  1U0J A;  2M30 A;  3PUF A;  2PMH A;  3V42 A;  3S3M A;  2IAI A;  4O6J A;  2IJL A;  1XMA A;  1REP C;  1BI1 A;  4A3C J;  3UR3 C;  3KFW X;  4DNC A;  4PGG A;  4IHW A;  4UY8 I;  2UV1 A;  3GVA A;  3I59 A;  4FTH A;  2X51 A;  1H9G A;  5GPA A;  4OIR F;  3KX2 A;  3OYA A;  1EH8 A;  2YX7 A;  3D5S C;  4RLQ A;  4S0H B;  2OA4 A;  1IV6 A;  3MWM A;  3DLL F;  2KDZ A;  2E35 A;  5EF6 A;  1BL0 A;  2CH0 A;  3HB9 A;  3FK7 A;  1XMX A;  3FXL A;  2D45 A;  5DD8 A;  1XGN A;  3FZV A;  3V7S A;  4MQ9 F;  3QYF A;  2PFB A;  2LF7 A;  4RGS A;  4UUV A;  4KYW A;  2XSJ C;  4ZJZ A;  2L02 A;  3ABT A;  2MFZ A;  4X0G A;  2DT6 A;  1QZZ A;  2KIS A;  2VJJ A;  1XTA A;  2JRM A;  3O8H A;  5GP9 A;  1JUS A;  3DBL B;  4A5M A;  1IF1 A;  1BW6 A;  4HDV A;  5KAI C;  3IKV A;  1TLH B;  2XPV A;  4UV8 A;  5HS7 A;  2JSP A;  2MH2 A;  1TW2 A;  2ZFW A;  4B09 A;  2DI3 A;  2KLO A;  3W6V A;  4KMF A;  2R7Q A;  4UVB A;  1R00 A;  3C2G A;  4AC0 A;  3H5N A;  2K3F A;  1PYV A;  2R7F A;  3AG1 H;  3TED A;  3KPH A;  2FF4 A;  4DZP A;  2DQL A;  3WHC A;  3O2P E;  2EA2 A;  4IRH A;  1U5T B;  4Y17 A;  3QU6 A;  2FMY A;  3HOY J;  4ZYD A;  1XGO A;  2FQ4 A;  1CF7 B;  2FBI A;  1D0Y A;  4BQN A;  4RB3 C;  4GYG A;  3CQZ J;  1VQ4 I;  1KQ8 A;  4ZZD A;  2QVO A;  1W5S A;  2R4G A;  2L54 A;  3ERE D;  3RPU D;  2RQP A;  2P5L C;  1FYM A;  4WCG A;  2DTR A;  4F3Q A;  1R4N B;  2Y75 A;  3GZ5 A;  2BVL A;  2RVC A;  3JRE A;  1DGW Y;  4CCM A;  2QLZ A;  4AYB N;  2QYO A;  4UUT A;  1QA6 A;  4HX7 A;  2E1C A;  2EZH A;  1J5Y A;  5L3B A;  1O4X A;  1F43 A;  2VON A;  4XLP F;  5A2Q K;  1W5C C;  3E5U A;  2M8E A;  3U1K A;  5EG0 B;  3Q9V A;  4E7J A;  2CQK A;  3M8F A;  1JUM A;  1AA7 A;  3MD2 A;  4BDZ A;  3FX3 A;  3K0L A;  1CGP A;  5EZH A;  1R5G A;  1EA3 A;  3VOE A;  2DPU A;  1KON A;  1WH5 A;  2MA3 A;  2W57 A;  2HDC A;  4IHX A;  1BBY A;  3S1Q J;  3JRH A;  3I55 I;  3GTQ J;  4AID A;  4C2U A;  3MQ0 A;  1FEX A;  4PDK A;  4QWQ A;  4IF4 A;  1XSV A;  4I02 A;  4IPA A;  4CYD A;  4F7Z A;  3JR9 A;  1CQT A;  4B3A A;  3KYL A;  3LSJ A;  2ZSI B;  5B3S H;  3A2K A;  4XOT A;  4RS8 A;  2X1E A;  4BHP A;  3OIQ A;  5D4S A;  5LGT A;  2GAU A;  2VQL A;  3ABL H;  3I58 A;  4A0Y A;  4H4K C;  2DPD A;  3E5Q A;  2KJC A;  2M8G X;  2EH3 A;  2DMP A;  3HL2 A;  3SFI A;  2W7N A;  1G3Y A;  2FXA A;  2D1V A;  3HUG A;  4EQQ A;  3RDI A;  1X1C A;  4LB6 B;  5HNF A;  1QZY A;  1JHH A;  3CUQ C;  1RUO A;  2ZNY A;  3BTI A;  3C2H A;  2OJE D;  5CVV A;  4BQO A;  3HDD A;  2W25 A;  3UNG C;  4UXN A;  1JHF A;  5E17 F;  1YFH A;  1ZGW A;  1ORK A;  3BJA A;  3PNY A;  1LDD A;  3JSP A;  1ZR2 A;  3GWZ A;  1FBS A;  1O3S A;  4EGZ A;  4E70 A;  2G9W A;  2BXZ A;  1R5H A;  2X6X A;  1MJ9 A;  3HHH A;  2R5Z A;  4RAG A;  1U8B A;  3H36 A;  4WXD A;  1B4A A;  4IOC F;  3O8G A;  2L4M A;  4UV9 A;  1BOB A;  2O3F A;  5A2Q Z;  5E1Z B;  2H1L A;  1YJ9 I;  2COB A;  2CFO A;  4I99 C;  2PEX A;  2XHK A;  4AIK A;  2VC1 A;  3WU2 C;  4LMY A;  5HOO A;  2HPI A;  5J1Y A;  3KP2 A;  4BXX J;  2RQQ A;  5ICG A;  4EJW A;  4YEL A;  4KN7 X;  2ZME C;  1XS9 A;  1ODD A;  5FJ8 J;  2HDW A;  2TCT A;  3BR2 A;  3MCZ A;  3BCB A;  2V1U A;  3E5X A;  1UFM A;  3D0S A;  2WAF A;  2OF7 A;  2L0K A;  4F52 A;  4ETS A;  5H2F C;  2BY3 A;  1NHA A;  1OCC H;  1U3E M;  1QU3 A;  4RGU A;  1TQI A;  4EV0 A;  5E3N A;  2NRA C;  1MBK A;  2I8D A;  2LG4 A;  4A6D A;  2H94 A;  2BW3 B;  4PCQ A;  2VLA A;  5DTD A;  3BR1 A;  4ITV A;  3DPL C;  2Y69 H;  4HW0 A;  2Y31 A;  4C3H J;  2JQ7 A;  1BR4 A;  3GF2 A;  2F4M B;  5DUK A; 
#chains in the Genus database with same CATH homology
 3ABL H;  3ABM H;  3AG2 H;  3AG1 H;  3ABK H;  1OCZ H;  2EIM H;  5B1A H;  1OCR H;  3X2Q H;  3ASN H;  1V55 H;  3AG3 H;  1OCC H;  2EIJ H;  2EIK H;  2EIN H;  3AG4 H;  3WG7 H;  2DYR H;  2OCC H;  1OCO H;  3ASO H;  5IY5 H;  2Y69 H;  5B1B H;  5B3S H;  2ZXW H;  2DYS H;  2EIL H;  1V54 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...