3ABMH

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 26
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3abmH00
1OCCH 1OCRH 2EIKH 3WG7H 5B3SH 2ZXWH 5B1BH 2DYRH 2EIJH 1V54H 3AG3H 3AG1H 2EIMH 3AG2H 1OCOH 3ABMH 3AG4H 2EILH 3X2QH 2OCCH 3ASOH 2Y69H 5IY5H 3ASNH 1OCZH 2DYSH 3ABKH 5B1AH 3ABLH 1V55H 2EINH
chains in the Genus database with same CATH superfamily
2BY3A 3I0TA 2W7NA 2IGKA 4ON0A 5D4RA 1IJWC 2M4GA 2CUFA 4E7KA 4M3FA 1A6IA 5HLGA 2VPLA 4DBQA 1DGRM 3BP8A 3HYIA 4P5OA 1W0UA 4IHYA 3VWBA 2O7OA 1PP8F 2M1BA 2C6YA 2OA4A 3T8RA 2KHMA 2IS1A 4ABZA 4OIOF 2WAQA 2FX0A 4QPQA 3IRRA 2X85A 3I53A 1IUFA 3E6CC 4LGWA 4LIUA 5LGNA 2VOOA 4FT8A 1STZA 3FXLA 1U5TB 3S3OA 1BL0A 3P9CA 4XLHA 5GAHJ 3LOCA 4D9JA 1VQ9I 4XQFA 4EV0A 1MNMC 1I3QJ 2OBPA 4LLLA 1H88C 2YU3A 5M3MJ 5TISC 3I71A 1D5YA 4I0BA 2XKPA 1K83J 2QYOA 2Q8KA 1LEAA 3SEZA 3CF5F 1B1BA 1UZCA 2JA6J 3PNTA 1Z21A 1OCTC 2JZYA 1X4PA 2V7FA 3P7NA 2F4IA 3I59A 4A12A 1WJBA 2E19A 3ZN1A 1AKHB 2R5YA 4AIJA 1AHDP 3AL0B 2LVSA 2FD5A 3BG5A 2CQ7A 3HGYA 1R58A 3KEYA 4PSWA 2VODA 3HSRA 2DYRH 1LPQA 1R36A 6PAXA 1SVOA 3AG1H 4Q5SF 2D5VA 2ZJQF 1FIPA 3M4OJ 4RA2A 2DDAA 4ZYGA 1CGPA 1SVLA 2E71A 5FRNA 3DQVC 1G59A 2X1CA 4UV9A 4H4KC 4BXFA 3L7WA 2A3SA 3BPVA 5GAGJ 1WKMA 1VQLI 4ZJZA 5J3LA 4RGXA 5GPCA 2MLKA 4QWQA 3S1NJ 3DKWA 3L2WA 4XN3A 3CO6C 2UUZA 2ZKZA 1V54H 1O7LA 2FQ3A 2LF8A 2FOKA 1BC8C 1CF7B 5KAIC 2LF7A 3E6DA 1MD0A 1HKQA 4AIDA 4B3XA 3BLYA 1HLVA 5K5RA 1F9NA 1S7AA 5BPDA 4UV8A 3CC7I 5E18F 1ETYA 2O0YA 4XRFA 3U1KA 4F55A 2GZWA 2LMDA 4BHPA 2L7MP 3T5XA 1M1EB 2EBIA 3BJOA 3KIOA 4P9UA 4MEXF 4IX7A 1ZH5A 2Y31A 1JT0A 1MGTA 3FXMA 4OIPF 1HF0A 3VSKA 1U3EM 2QENA 1KU2A 1K79A 4IQ4A 1IW7F 1BI0A 2JN6A 2DQRA 4OIRF 2G0EA 2IVMA 4EJVA 1IF1A 1J7KA 1X2MA 2KJCA 4RS8A 4RBOA 1MMSA 1NH3A 2ZO4A 1IG7A 5TGTA 3BTLA 3WGGA 5JHFA 1P6RA 1MMNA 3E0JB 1DUXC 3C2BA 2EZKA 3KLNA 5J4VA 3A01B 5DM6F 1Y1WJ 2P6TA 2E36A 5FKOA 2NNYA 4S0HB 2PN6A 2ZMEB 3CMYA 2HEOA 3HXLA 2JT1A 2ELHA 2JTVA 1HKTA 2OV7A 2AXLA 2LC2A 1IRFA 4WWCA 2F2EA 3BR6A 3DXJF 2XRNA 5C4JJ 2I10A 2YU9J 1XDUA 1YITI 1VQ5I 4JQFA 2KQRA 3CO7C 2L7FP 2V26A 3HG9A 2LSOA 4HOBA 2ZMEA 2ECBA 4GO1A 3OYGA 5AIPA 1QO0D 2LBFA 3FHZA 1R1VA 2ESHA 4L5EA 2FNPA 2RREA 4M3EA 3PNYA 4QTRA 1HW2A 4XKVA 1TWHJ 5M5WJ 3K4LA 1XSDA 1X1CA 1WI3A 3I5UA 5IT9K 2F5VA 2OZ6A 1RR8C 4YEJA 2JMWA 4LITA 5BPIA 1FZPB 5D8LB 2J5OA 2W25A 3MZ8A 3NWTA 1AU7A 2M7AA 2CS3A 3W6VA 2DFIA 1G6NA 2EV5A 2LYCA 5EJCA 1BW5A 4C2TA 2HKOA 3WHBA 3CCYA 3OOUA 2VC1A 2FBIA 3GVAA 4U7BA 2BY0A 1H89C 4BXXJ 5JR3A 1XN7A 1ZGAA 1Y0NA 2H09A 2ZXJA 2R7OA 3HUGA 4IVNA 3P9KA 5K7FA 4A6DA 1SANA 1UHMA 2H27A 5IP7J 2FMLA 2NVXJ 4OAYA 5HLIA 1P9QC 1Z3YA 1QZZA 2Z2SB 1NK3P 4DQ2A 5ILUA 2GXBA 5EZGA 1MZBA 1UB9A 5CKTA 3WTSC 4HV6A 4L5IA 5DYMA 5GAEJ 1WQ2A 3ML6A 2B0LA 3NAUA 1MMAA 4HLYA 2IS6A 2X6YA 3O8GA 1LDJA 3QAHA 4XK4A 2HFHA 2DMNA 3FZVA 4FHTA 2R7TA 2VT2A 2DPUA 3DTEA 1HCRA 1WI9A 1RUOA 4LLGF 4KISA 4JOMA 2FJ1A 4BE2A 2PG4A 1YOVB 2PJRA 4A3JJ 4A0XA 3I58A 1WJEA 2RV8A 4G7HF 2P0WA 2ZFWA 1SC7A 4HF0A 3VYUB 3BC8A 3RQIA 3DCFA 1YJWI 2QQBA 1XCVA 4UVCA 2FSWA 2LTPA 4FE7A 3A0HC 4NC6A 3WHCA 2QF7A 1MBFA 1ENHA 3A1YA 4E7HA 1B72B 5CQGA 2JUCA 5DCMA 4RGSA 4I98B 1BR2A 3P5JA 3IC7A 2K5CA 2PLYA 4DJAA 4AIHA 3SDBA 1FBUA 2HQNA 3OY9A 2HNHA 2FRHA 4RAGA 3RZOJ 2F4OB 2TCTA 1RKWA 4XIDA 2VKEA 1FLIA 2NXNB 1MIJA 4FISA 3SFZA 3RZDJ 3HDDA 2DK5A 5HDKA 1MDMB 2P5LC 4BY1J 3X2QH 3R6SA 3HOTA 3TP3A 2MH9A 4RM3A 3S3MA 1JGSA 1HQCA 1IRGA 3ABLH 3F8CA 3T8TA 4CCOA 1YX3A 2UXXA 4MTDA 1F5TA 2STWA 2RNJA 5J1YA 3JRIA 4Y17A 4KMFA 4BE1A 2CW7A 4R1HA 4HX8A 4E7ZA 2O61A 3V7RA 2IXSA 2K86A 3RKWA 4L0YB 3AG3H 2Y9ZA 2EA4A 4I02A 1FMVA 4G94A 2CW0F 4II2A 1ZK8A 1Y8RB 4IRHA 1JXSA 2MGQA 5BNGA 4Y15A 3HTUA 3TOAA 3OYFA 1TWFJ 4LJZF 4CO8A 1FPQA 4KIFA 2E60A 3D1NI 5FB2A 2RQPA 1BN5A 3K4CA 1D0YA 4MHGA 2UV1A 2WADA 1QHHD 3GTQJ 3HOUJ 2JSPA 4A3BJ 1ACIA 4CCKA 2ISYA 2VJ5A 4DGWB 5L3DA 1Z7LA 2BE5F 4EGYA 1FP2A 1ZKGA 4D0PA 1W7PA 3H92A 2HXOA 2G7UA 5E8GA 1ZLKA 3I54A 4FASD 2JQ7A 1SFXA 4AIKA 2DA6A 1I6HJ 2Y75A 4XSXF 3KFWX 2OQRA 4GXOA 5A2QK 2DJIA 4JK1X 1S3JA 1HA8A 3QWLA 4KIBA 2F5FA 4ESJA 3RI4A 2R7DA 2PJRB 1D1CA 4KJZA 2L5QA 1K6OA 4MQVA 4WXDA 4B09A 2OZUA 1T98A 2H6BA 4B48A 3CCVI 1EA3A 5GP9A 5IYBJ 5DD4A 3D0SA 2DTZA 1Y0UA 3JSOA 1T2KA 1QU3A 2RQQA 1JJ6C 3SFIA 1PJRA 4KYWA 2YUSA 3NARA 4AUXA 3CLQA 1G3WA 5D5WB 2M34A 3OL3A 5B66C 3A4CA 4QLCU 2JPBA 2K4JA 1VQOI 2VE8A 1OISA 2ZMEC 5LHIA 4BHBA 1Q1VA 4BYYA 5EGOB 2K3PA 2Y0SA 2VBWA 3CC4I 2VXZA 4Y3OA 3WU1B 3QPSA 3ZMSA 1FYMA 4G6TB 3H1CA 2LKPA 2GBYA 5EG0B 1HDPA 1ZYRF 2NS8A 4TV7A 5CJ9A 4HG2A 3RIRA 3SZTA 1IRXA 3CCLI 4QIWN 2V1UA 1W0TA 1V5EA 4U0WA 4FX0A 1J5YA 3DPTA 3PUFA 4EATA 4KNYA 3N97A 3LSKA 4LMYA 5E8IA 1XMKA 1TQMA 5L3FA 3FMSA 2K27A 2W00A 1TQPA 1TNSA 1IDYA 2WAQN 3Q3SA 2P7CB 1ZG1A 1EH7A 1OMIA 3M8FA 2R5YB 3S1MJ 3TGNA 5E3MA 4AYBN 1IV6A 3CJRB 1K4TA 4GDFA 2R7VA 1ON1A 3L2VA 2TDXA 4UNOA 1ZREA 3FKJA 1OCPA 1J0RA 3OYNA 4FX4A 4Q48A 3GEZA 4KT6A 5GTHC 1VQ8I 3H36A 2GOXB 1KZHA 2PBIA 3LQQA 3JAMK 1PUFA 4RGUA 3S14J 2O03A 1R7JA 2E7WA 2QQ8A 2FMYA 4M6VA 5JFRA 2A5WA 3DKYA 2KZGA 3TDUC 1UMQA 2CFXA 2M0MA 2ZBKA 5H6RA 3Q9VA 2EZLA 3OYDA 3JRBA 4LLNA 3CUQB 1MMGA 3F8BA 3F8FA 4CH7A 3A02A 3DBRB 2XUBA 3V7SA 3JRGA 2WBMA 1H0MA 3CCEI 1V55H 2RGVA 3BQZA 1E2XA 2BGCA 5F64A 4HF1A 1WCMJ 2ELJA 1FY7A 3LA7A 3CP8A 1Z67A 2GM4A 1I27A 4U88A 1YW8A 1FX7A 1BI1A 5DCMB 1TL8A 1VQMI 1X1DA 1BR4A 5FLXZ 2QKMB 2M8EA 1N78A 2KRCA 2ZSHB 2DT7B 2CFOA 4HPQA 3FM5A 3TW6A 2QWWA 3OYBA 4ZZLA 4MO7A 3QYEA 4B3AA 3WGHA 2LD5A 3BCBA 3NWSA 3S17J 4BQQA 4E4HA 1JKRC 1SMTA 3QPLA 4ENNA 1ON2A 1ZARA 4HNTA 3QPHA 4NC7A 3BG7A 3MMYB 3HHGA 2VE9A 3PFIA 1J2XA 3Q9SA 4CDGA 2RN7A 4A6EA 3MKYB 1OJLA 2FE3A 3M8JA 4C9YA 2EFWA 3HEFA 4GCVA 2LY2A 1FTTA 3SDGA 5IYCJ 1YJ9I 5LFAA 1FWZA 2VJIA 5J4YA 4IKFA 3TKYA 2BY1A 1FBSA 1Z7UA 4Z6YA 2L7ZA 2UZKA 2X9DA 1WH7A 4ZYEA 3E6MA 1J9IA 1REPC 3FXUA 5FLVA 4XLEA 5K7ZA 1LDKB 5M5YJ 5LGUA 5F6FA 2VQHA 5JVGF 3JRHA 4LG3A 1XPXA 4BHCA 4N0BA 3ERMA 3AG2H 4HBLA 4CZZA 4YIRX 2AHQA 4UY8I 4I01A 2WWYA 1WH5A 2BHZA 2F6CA 3ASOH 1LE8B 1W7PB 3G71I 4BGDA 2A07F 1I1SA 2OJED 4MFEA 4A3GJ 2NS0A 3RPQA 1XDSA 3HRSA 4M6YA 2CW8A 3TMOA 2M7BA 3KYDB 2Z99A 2VB6A 3B02A 3MCZA 3IWFA 1XGMA 5F0CA 1LB2A 1FMWA 2DJNA 2ZSIB 2PX9A 5BQTA 3JRDA 3LSGA 4NB5A 1X19A 3BR0A 1OR7A 2V9KA 3DU5A 3BJ6A 1ZRCA 2R5ZB 3HKZN 3F23A 1BOBA 3DTIA 4NQWA 4UVBA 4WXCA 1B9NA 2D1VA 2VT3A 4BEHA 3ONQA 3J7AO 2LRDA 3GO5A 4H0EA 3CD6I 3MFKA 4W97A 2CV0A 1MBKA 3ZXSA 5J1RA 2LLKA 4FE4A 4XORA 2NOJB 2FF4A 2XF5A 3F8NA 3RKQA 1G8XA 1TT5B 2DA5A 3OYHA 3HOSA 1X1AA 3QU6A 3GW2A 4RB1A 2E1CA 1FNNA 4IHSA 5JVTA 5DUIA 3CQZJ 1POGA 3CJTB 1Y1VJ 2LP0A 3G3ZA 5J6XA 4YFNF 2Y69H 2R7QA 3BTJA 3VODA 2JJ7A 3TL4X 4A0ZA 4G7OF 3CCQI 5C3EJ 2XC7A 1Z1DA 3GTKJ 2GA1A 3HPHA 3J7ZI 3F72A 1PUFB 1T39A 3COAC 1UHSA 1OFCX 3A0BC 3BOQA 4E7LA 1S29A 3EUHA 3HBLA 3D5SC 4IRIA 2HOSA 5EYRA 2AXTC 1VF9A 4ESBA 3ECHA 5HLHA 2Q2EB 4HV5A 1IXCA 1D8JA 2DO7A 2DN0A 4KN7X 3DLLF 1W36C 2EQRA 1EF4A 3ZQLA 1ZGWA 2ETHA 4IHWA 1YYVA 2K7LA 3PSIA 1C0WA 2ICWG 3CLOA 3S2HJ 1APLC 1UFMA 2P7VB 1K78A 1SD7A 1D0XA 1X3UA 3ROUA 4CCMA 3V8KA 4IO9F 2XPVA 1E17A 2PEXA 3G73A 1MBGA 4KDPA 3E97A 2R7ZJ 3QOEA 1FSEA 3BG3A 4IJAA 2GOMA 2ZJRF 4CGZA 1JHHA 2HU9A 1FEXA 3AKZA 1EV7A 3U21A 1N77A 3U9GA 2XAHA 2Y48A 4R79A 1IN4A 2VQLA 3J7AY 3CUOA 4WX9A 1MSFC 1S8NA 2GIVA 3DWLE 5EDNA 1R49A 5H2FC 2OU2A 1XX5A 1T0FA 2I5UA 2FQ4A 2O8XA 3OOPA 5LEJA 2CGPA 2VKHA 3W6JB 3R4KA 1TP4A 2B9SA 5ICCA 2DMTA 3RPUD 1R5ID 1BM9A 2HPMA 1KU3A 1D5VA 2XSJC 1AKHA 3G1LA 1QPMA 1TT0A 3WODF 4WCGA 1O3SA 2ECCA 2XPUA 4XKWA 3HSFA 1ONVA 1ZR2A 3G4SI 3K2AA 2ELKA 2ZNZA 3GYHX 4PGHA 3FXKA 3EDPA 1B8IA 2L4MA 2XIGA 2BBYA 1QRYA 2DW4A 1X3WB 1V3FA 3I4MJ 2BY2A 3IH4A 4EGZA 2HTJA 4LIVA 1ZGJA 2LY1A 4V19K 1I5ZA 4KICA 1J75A 3VYRB 5ICEA 2HYJA 3W2WA 1T6SA 3MQ0A 2M0CA 5CLSA 3RPUA 5HOOA 3RCOA 1V5FA 2PI0A 3RKXA 1P4AA 2E1MB 3KZYA 5GADJ 2M5WA 2CQXA 2VJ4A 4MFDA 1Q1HA 2K9SA 1D3YA 1R9TJ 3H3VK 2OUMA 1RETA 3G2BA 4XONA 3V4GA 5KAFC 3LNQA 3HTSB 2GXAA 2OTJI 3N05A 5HNFA 4M71A 3R61A 5LLQA 3ABKH 2H94A 3E5QA 2NVUB 3OS1A 3JCUC 3JSPA 3OYMA 3ULQB 5CVRA 5J8FA 3TW7A 3S15J 1E0EA 1R4MB 4A5MA 1G4DA 4HSRA 1L0OC 2DOAA 1IAWA 3SXYA 2KIUA 1DQUA 1E3OC 4MNUA 5JI6A 1HSJA 2ZB9A 5J40A 4DNCA 3F6VA 3JRFA 2Z1DA 3S1RJ 4M3DA 1P2FA 2H1KA 4HRIA 5E20A 2H6CA 3DPLC 1MSEC 3HOXJ 2IPQX 4K2EA 4UUVA 1T56A 1LEBA 1YHQI 1IXSB 4ESFA 4MQ9F 3L9FA 5EZHA 3WU0A 2CO5A 1BIBA 1V5GA 1R5GA 3K2ZA 2E1MC 1LJ9A 5LRRA 1K7AA 1PYVA 1ZN2A 3H5RA 2UXNA 5IYDJ 1TLHB 2E2HJ 3KP5A 2EV6A 3TO9A 2JVGA 3CMEI 3J81Z 2JA2A 5IT3A 4RM2A 1JKOC 4M9SA 5JLXA 4EJOA 1KU7A 1VI0A 2DOFA 1RC9A 3CMMA 3GTLJ 3TDZC 1A35A 5LRSA 3SHFA 3SJMA 1B9MA 2R7SA 1E3HA 4PJ0C 3J80K 5LHGA 4HX7A 2VLAA 1I3AA 3QODA 3GFJA 4V2FA 3FXJA 2XGCA 1U9NA 2K3FA 1EKEA 1IN8A 4DZPA 2HDCA 4I2OA 5L3GA 5GPAA 3WTTC 4PJNA 3VYTB 3ZCOA 4ENMA 1D1AA 5HNHA 1ZTRA 2VXDA 3HIFA 2X4HA 3C2GA 3HOZJ 2HPIA 4XMYA 2WB1N 1QNTA 4A3IJ 3B6AA 4DYCA 4Y4RA 3RDIA 2AQEA 4HQEA 3TP0A 3K70C 1N75A 5EEAA 2XKOA 4ZH4F 4E7SA 3V8JA 4A3FJ 2KKOA 4BDYA 4A5NA 3L2CA 1BC7C 2KL4A 1EH8A 2HR3A 3ABMH 5KCMA 3BY6A 3LA2A 4I99C 1TWCJ 2QSGX 1VFCA 2JPCA 3M1EA 1MBJA 3FHNA 5FROA 1S5LC 3KEQA 1IDZA 3Q0VA 2ZNYA 3OYIA 3K0LA 1WHUA 3BG9A 2PFBA 2XROA 2HI3A 2E1OA 1AA7A 1FP1D 2K9MA 2O9LA 4MIMA 2J5PA 2MSYA 5CYVA 5F04A 4KFCA 1A36A 3LWFA 4FETA 3PL8A 2MLGA 2PMUA 1I39A 2LNBA 4A3EJ 2VN2A 1R6RA 4XR6A 2DMPA 4NDLA 3WE2A 2NAZA 2GQQA 1FC3A 2B63J 3FK7A 2HQ5A 4IOAF 2NNNA 2VL8A 3CCSI 1KYZA 2JWTA 2X51A 1O3TA 2F4MB 2HOAA 3CP2A 4KA4A 1MBHA 1T95A 2M8GX 3H0DA 1SD6A 4A3LJ 5FO5A 1FIAA 3KEOA 3I4NJ 3M8EA 2PQ8A 2A68F 1VQNI 2A6TA 3PUBA 4BS9A 2CSOA 3GXOA 3L2QA 4FTHA 3ASNH 3M7GA 4LOCA 1KQ0A 1YW9A 2MG4A 3TOBA 3GCMA 4YIFA 4V2GA 1TQIA 2OF7A 2OTLI 3HGGA 1QPIA 3KZZA 3AFHA 2M45A 5DDGA 3TO6A 1IUYA 2JA8J 4Y52J 1FSHA 3J80Z 3BR3A 1QHGA 5TJJA 3KYLA 1UG2A 3OYKA 2W84A 3ZPLA 1XGOA 2LY9A 4YFKF 2E5NA 5D4SA 1LFPA 2OC6A 3DP7A 1MJAA 1WVRA 2OCCH 1XGNA 3CCMI 4G8XA 2BW3B 2K4BA 3L00A 3CCJI 2IS2A 4C2MJ 4YRVA 2KPMA 1FOKA 5HDNA 5M3FJ 4CYCA 3D5RC 3QYFA 3WTVC 1WJAA 2R3SA 3BROA 3F6OA 5LBQA 4IXAA 3V7CA 2R92J 3BG6A 5B1BH 4L0ZB 2NOGA 2NYXA 3M1CA 5H20A 2Z5UA 1XD7A 3EUKL 3ZR8X 1JI8A 2IGOA 2QQ9A 1TZLA 1USTA 2P81A 1OCOH 3KZIC 1P7IA 1RR7A 3K4JA 3KX2A 3JR9A 4UUSA 2H1LA 2VKVA 2F5DA 1GXPA 3OSFA 1YX5A 2R7FA 3OS2A 5EEHA 4HEA2 1ETWA 4J00A 3CZ6A 5IP9J 3P9IA 4IEJA 2VBXA 4U0YA 1A6QA 1S6LA 4BXUA 1I50J 1R1UA 2XF6A 1ERDA 3S2DJ 2X6OA 1U6GA 3VDXA 2FXAA 4Y7NJ 3TO7A 1RI7A 4NBQA 5EEGA 3W2AA 3VFZA 1T08B 1SAXA 2HDDA 2L4AA 4BJ6C 4G6DA 1YI2I 1DP7P 1Z6RA 4D1QA 2ZXHA 3OIOA 2LREA 2R93J 3OMYA 2KISA 2LFBA 2MFZA 3PO3J 3GWZA 3K70D 1HBXG 4L9TA 3JTHA 3G1OA 4AD9A 3C18A 3MZYA 4BH9A 3PQKA 1O3RA 5ICFA 3HSEA 3BT9A 2LDUA 1UCRA 2QQAA 4G12A 4M6XA 2HOEA 2YSRA 2HTSA 2Y9YA 3I59B 3QU3A 4PCQA 2MD0A 5C44J 3VEPA 1ORKA 2EZIA 4EM2A 2L54A 3ELKA 2ZJ2A 4GFBA 2LBFB 1U0JA 1ETXA 2DYSH 1MNDA 3LSIA 3CUQA 3DV8A 3KCCA 1HKSA 3KP2A 1D1BA 4D7MA 5JLWA 3UKGA 2Z9OA 1QZYA 3H9GA 5DTDA 3HOYJ 1OKRA 2EIKH 2UWMA 2M87A 2MA3A 2OCEA 4XKBA 1LVAA 1GVJA 4NQWB 1R1TA 5LHHA 2QLZA 4RLQA 5HDGA 4BE0A 2DAOA 5LGTA 1AOYA 2KIFA 2Z16A 5H6QA 2A5YB 2MH2A 3ZN0A 2VQGA 4EMSA 4F3QA 1LQ1A 2EFNA 1ZELA 2Y0MA 1I6XA 3EETA 1OCCH 2ZJPF 1PP7U 4RB2C 2WY8Q 4JP0A 4ZTJA 2VUMJ 1IRZA 3RKYA 4CCJA 1AWCA 4XRMA 4OOIA 2Y2ZA 3WU2C 2QCOA 3RTRA 3H35A 2W48A 4KT5C 3ZQIA 3K1NA 2HYFA 3C1DA 3QP6A 3L2RA 4IQJA 2DFEA 1EJ9A 3FBIB 3AG4H 2KT0A 4A3CJ 5J1UA 2JRMA 3GFMA 1VQ6I 4P9FA 4ZDPA 3GTGJ 3IV5A 1ZG3A 3BZ6A 1K6YA 5GTIC 1MJ9A 2XVCA 1QBJA 2DXIA 1B6AA 1U8BA 3NEUA 3HOVJ 2V1NA 1GT0C 1FYKA 1LNWA 3OWTA 1SFUA 1JUPA 4XRSG 5F1RA 2V9PA 1TW3A 5E3NA 2LKSA 4HAMA 3GUDA 1O7FA 4CUGA 5EGOA 1FOWA 1GV2A 1OYWA 2COBA 3GTJJ 2LOOA 2BV6A 3IH2A 3IAM2 1LFBA 1YFHA 3H9QA 4RGRA 4CCNA 1MKMA 4II3A 2CWEA 2GWRA 2VOPA 4HQMA 1FOXA 5FKMA 1ETKA 3U2RA 2E34A 4PSXA 3DU6A 1KGSA 2D2WA 4XL9A 4C2UA 2X1EA 1D0ZA 2K9QA 5FD5A 5A2QZ 4CYCB 2Q1ZB 2JSCA 3IRQA 1K78B 1YRNB 3HJEA 4HLXA 4N4OB 4LK1F 2HVQA 2FEZA 3G6EI 4PJLA 1SFKA 2BXZA 4GRIA 4Y13A 2HVRA 4PFPA 1J59A 2Z33A 1O3QA 4BU2A 5FKKA 1HXDA 3DBLB 3BR2A 1KQ9A 3A03A 3K69A 4XNFA 2DPDA 4AWXB 4Q47A 3L09A 2VIXA 1F1ZA 3BDDA 2HKXA 3OIPA 2ME6A 4JBAA 1YIJI 3HL2A 3LA3A 1NHAA 2CMPA 3MKWB 1A31A 2XB5A 3BR5A 4N9HA 1MH3A 4G7ZF 1ZRFA 5KVRA 5BS6A 5JHUA 2DQLA 1XG1A 3ZRGA 2HVSA 1BW6A 3QP5A 2VC0A 2ZXIA 5K1YA 2CQNA 3KETA 4C3IJ 4UHTA 3FIWA 3KE2A 4XOPA 4MEYF 3CDIA 1RNLA 2DMQA 4BUPA 3TBIA 2W82A 4ENKA 3FISA 5ILSA 1FJLA 1BIAA 1OYYA 2EFOA 4PZJA 3TEDA 3GLXA 2VJJA 5CVIA 4B1RA 3JRCA 1H9TA 2X0LA 4HNUA 4HF2A 4F52A 3J7YJ 5DUKA 1B59A 3DBHB 1WJFA 4DW6A 3DTKA 1GLNA 2BOLA 2K02A 2W24A 3RQ4A 2QM3A 3QYBA 1S7EA 3GZ6A 1BA5A 3FKIJ 5C4XJ 3GTOJ 3SYTA 3PNVA 1QVTA 1JUSA 2XAQA 2IRFG 4Y33A 2FU4A 1SD5A 2G7HA 3M9AA 4YIIA 3HC7A 4WXHA 3KP6A 1MNEA 4A3DJ 1JTYA 3T1BA 4Q4ZF 1B8IB 3GZNB 1OQYA 1MDMA 4AVPA 2O8KA 4HZFA 2GLOA 3E3VA 2WV1A 2N8GA 4HDUA 3C3WA 2CQQA 2E7XA 5DV5A 4M72A 5BOXA 2CUZA 4ZDOA 1WWXA 1W5TA 4IZZA 1TNTA 4XKCA 4BQAA 5FFXA 5DD8A 1W4MA 4B44A 5B5EC 2CG4A 4LK0F 4D5CA 2Y0SN 5FKNA 4UUTA 2O3FA 3K9TA 5HS7A 4UUSB 3VSLA 2EINH 1RRJA 1G3TA 4NUBA 4D5FA 1OCRH 2IT0A 2QBYA 1F43A 2IA0A 3GBGA 3S2WA 2W4SA 3RJPA 2E2IJ 4EM1A 1VZ0A 3FXQA 4PK4A 1LFUP 1X1BA 1TTYA 2EIJH 1UG0A 2X48A 3K1MA 4KUMA 4JX5A 2HZTA 1Z91A 3KP7A 4RAYA 4M9XA 1VQ7I 4LD5A 1W7PD 3O6BB 5F1JA 3PM1A 5KNLA 2QGUA 1ITYA 2DU9A 4DZJA 3MN2A 1GVDA 1OLTA 2PMHA 1NK2P 1S9HA 3ZMTA 1SMYF 2W57A 3ZQCA 2VQCA 3CCUI 4LB6B 2WTEA 1IXRC 3U1DA 3JAMZ 1RIOH 3BWGA 5E3LA 2WV0A 2Y30A 1DGWY 4HYEA 3DEUA 4KN4X 2R7RA 1FT9A 1WJDA 3VOEA 2IS4A 1BJAA 4EQQA 4PDKA 1XSXA 2V6EA 3L2UA 1GHCA 1UELB 2YX4A 4MLOA 1J09A 2ZC2A 3FK6A 2DA2A 2EILH 3WGIA 1QA6A 1R5HA 4O6JA 4ZDLA 1KQ8A 2BVMA 1ZRDA 2NS7A 4KMUX 2QZ8A 1TC3C 2L9VA 4X0GA 3JRAA 3ZGKA 4AYBA 1XCBA 1DPUA 5D5UB 3BR1A 3E5XA 3CJNA 4IHXA 3GTPJ 1DDNA 4RB0A 4XLPF 2DK8A 3IKVA 3ZQ7A 3ZQQA 2DI3A 2JA5J 1YW7A 4C30A 4A93J 2HGCA 1FTZA 3B73A 1IN5A 2F48A 4A0YA 2IJLA 2X1DA 2KRHA 1R4NB 4UXNA 2L7KA 5DM7F 4IOCF 1GDTA 4A3KJ 3DKXA 2CYYA 2EZHA 5HS9A 3GF2A 4HW0A 1XGSA 1FBQA 2AO9A 2OAZA 3LL7A 4BNCA 1KONA 1P4XA 1F4KA 2NVYJ 3O2PE 4NNJA 2BVLA 2K9LA 3LSRA 3EUHC 3CMAI 4BBRJ 2VASA 5E79C 2ISZA 4PJJA 2LR8A 4E7JA 1RPWA 2CUEA 4XICA 2H8WA 1E3PA 3IHUA 3K6GA 4HNVA 2KP6A 2RDPA 4ETSA 4C3JJ 1FOYA 1PDNC 4OU0A 2M4KA 4PUSA 4P55A 3H9JA 3ZMDA 5AIQA 4B47A 3LMMA 2ZXWH 3LSHA 1T8IA 3DFGA 4EM0B 2WAFA 2D1HA 1LE8A 4J19A 5J8CA 2OQGA 1P4WA 2KIMA 2L2OA 4L18B 5CVVA 1JT6A 1G3YA 2EH3A 4PJMA 2F5CA 3EUAA 3RSNA 2RVCA 2DT5A 4EJTA 1Z6TA 2IA1A 3Q0UA 1BOAA 2JUGA 2CH0A 2VI6A 5HS8A 2L02A 4C3HJ 3ERED 1H9GA 2KFDA 4EJUA 4X1EA 3W6KB 1W36D 2MC3A 2XAUA 4BQNA 4N9IA 3RYRA 4F93B 1WGXA 1NG7A 2D45A 1YE9A 5E1ZB 1NG6A 3DEEA 1X2NA 1HC8A 2R7XA 1IGNA 1Y39A 3CDLA 3HRTA 3S32A 4PFOA 1SFOJ 1IO2A 1VQPI 2QKLB 1UHWA 2A05A 3EQLF 5IOZA 3ZQGA 5LEKA 3OYJA 4CICA 2ID3A 3OV8A 3FBNB 1OCZH 2DA1A 3F0CA 2L9SA 3HRMA 2HDWA 2V9VA 1NTCA 1N25A 5E3OA 3E1SA 2NRAC 2FUG2 1U9OA 1USSA 3I4PA 2V79A 3B6CA 3ABTA 1ZAOA 4I76A 1DP3A 4S05A 2MBFA 4RB3C 2XV4S 2CQKA 3KLOA 3MD2A 4GYIA 5L3EA 4DYRA 1Z3XA 5ILVA 3LAPA 2FNAA 1YS6A 4CCLA 1Y6IA 2JA7J 4AVZA 2E35A 2XAGA 2DCEA 2IBDA 2DLLA 3SZGA 3BCAA 1SFEA 1O57A 4A3MJ 1S72I 2YX7A 4G6QA 3T0YA 3I3LA 3F9KA 1R23A 3S93A 1WJCA 2EV0A 1YS7A 4I09A 4L9VA 3H5AA 3W2VA 5FLMJ 3A01A 1QGPA 4XRSA 2XAFA 2AS5F 3KP3A 2R7UA 3LSTA 4BAYA 1BR1A 1WSUA 3S8PA 3HM5A 3IH3A 2QSFX 3QPTA 1X4OA 2M3AA 3BZKA 2QUFA 1R71A 5D6EA 1U2WA 2YR2A 3O3KA 1U78A 4RAFA 1A04A 4XBFA 3ZMUA 1ETQA 4CA0A 1PUEE 2ZCWA 4BL0B 2DA3A 2JRTA 3WG7H 3WTZA 3F21A 2ADUA 4ANJA 2BHYA 4BACA 2ME0A 1IN7A 1Z77A 3K4KA 3QOPA 1GXQA 4KIGA 4XM3A 2MC4A 3IP4B 2KDZA 4I6ZA 1ZLJA 1DPRA 3IAS2 2IEKA 4IF4A 4RAZA 4HDVA 5FLXK 2A61A 5HVQC 3GMEA 3QQAA 2WAEA 2KZVA 2P5KA 1YRNA 3H3ZA 4R8HA 2HOTA 1BI3A 4B4CA 5CQEA 2NVTJ 1X58A 1LDDA 4M73A 5B3SH 3ZMZA 1YTYA 3FF5A 1ETOA 3WTXC 1S7OA 2M30A 4P1WA 4CZCA 3OS0A 1WPKA 5EG0A 1TWGJ 2LH9A 3OYCA 2EJRA 3BZCA 3GLLA 3K4BA 2R4GA 3HRUA 1MW7A 4F91B 1ZR4A 2F5EA 3WTUC 3I9V2 1G2HA 2XPWA 2ID6A 4M74A 3OR2C 2QA4I 4BKXA 4QSHA 4P96A 4U0VA 3EYYA 4I0AA 2LG4A 3R0AA 1XS9A 1V4RA 3FMRA 3K1PA 4JYKA 2I8DA 4A2UA 3ZMVA 3PFYA 3OL4A 4EVIA 3WTWC 1WJ5A 3MKZA 3OYEA 2XASA 1QQIA 3CESA 4BDZA 3F8MA 3AL0C 3MAJA 3ABUA 4IHVA 2L01A 2RAEA 5CPRB 2M2EA 3J81K 5D5VB 1OYIA 4RMNA 1HW5A 5D8KB 1Z0XA 1MJBA 2PJPA 3REOA 3F22A 4OMYA 1IN6A 3ISPA 3CDHA 2E1NA 5HODA 2KDOA 3H5NA 4WF2A 1B4AA 1JGGA 4O3MA 2P8TA 4BY7J 5J47A 3IL2A 5L3CA 3S16J 3FM3A 3GZ5A 1Y8QB 4CYDA 5CVUA 2DODA 3PJRA 5M5XJ 2BYVE 3V8LA 3HUGB 3HOWJ 4AM3A 2XHKA 2W1OA 2VKDA 2YPRA 3LQRA 3IWZA 3FDYA 1G3SA 5K5QA 3CJQB 4NHJA 2DBBA 3R60A 2VPRA 1LUJB 5IOYA 3AAFA 3S1QJ 1YQAA 3WE3A 3K4MA 5B1AH 2EFQA 3SEQA 4IHTA 9ANTA 3ZQFA 2NVQJ 2P5VA 2FOWA 4G9YA 2R0QC 2HS5A 2ESNA 3LSJA 1BJZA 1JUMA 1ZHFA 1A5JA 2O6GE 3BQYA 2P4WA 3N4MA 2H8RA 2EK5A 2XRLA 4XLAA 4F7ZA 2L9RA 3OR1C 3MKLA 5LD2C 1WZ2A 5E1XA 4HSTA 1WRJA 1ULYA 5FJ8J 1MMDA 1ODDA 2CV1A 2CJJA 2OPTA 4HA8A 3BTIA 3GFIA 3PSFA 4U7DA 1L3LA 1CF7A 1CQTA 3DEWA 3HB9A 2GAUA 2DOEA 2KMUA 3HKZA 4EEFG 2PMZA 1KYWA 1JHFA 5DEQA 3LSPA 1IC8A 3ECOA 3ZQHA 3EYIA 4NC8A 2GA2A 2M9HA 1UAAA 4I7HA 2EIMH 3O8HA 2DT6A 2EWNA 4AC0A 1ZG5A 4D7NA 1KA8A 3CTAA 4UB6C 3EPZA 4LG0B 2TRTA 5DCFA 2R7WA 4CXFA 3E5UA 3PO2J 1P7JA 1GUUA 3FWEA 2V4JC 4M3GA 1VTNC 5IT9Z 1XSVA 3ZOBA 3VYSB 4M3BA 4J01A 1YO5C 3A2KA 4MTEA 3R0JA 2HQRA 1HOMA 3MVPA 5F0HA 2BZTA 1K61A 4N4NB 1XC5A 1TW2A 2FBKA 2K40A 4S04A 1JTXA 4IRGA 3GTMJ 2E5ZA 1OR7C 2OD5A 2QVOA 4OWRB 1ZQ3P 2XSDC 2LKXA 4XOTA 3GFLA 1DU6A 3F3XA 2CU7A 1JE8A 2G9WA 4HX4A 1IV8A 4WK8F 1Y56A 4E70A 2VBZA 4ASNA 4F92B 2EPFA 4DIQA 1XMXA 1SVMA 3GX4X 2DFHA 2XGDA 4LFUA 3L1PA 1D8KA 5L3BA 2KJBA 1W5SA 1UJ8A 4UVAA 4OIQF 3I56I 1QZEA 4ZC3A 1OPCA 5KK1A 3FX3A 2VBYA 4UB8C 4ZYHA 2JVHA 2XF7A 3LFKA 2YS9A 1T38A 2MD5A 1KU9A 4DYQA 2HQAA 1YIOA 2MABA 2QEXI 3OSGA 1RKTA 2EB7A 5EF6A 5F08A 2RC4A 4RLFA 5FKLA 4XLFA 4DBRA 2ACJA 5E17F 4W1UA 2STTA 5DS9A 4BQOA 5E1WA 5KHDA 2EFPA 2CUJA 3DLAA 3KYCB 2HWVA 4GYGA 4CSWA 3OYLA 2KLOA 2B7EA 1JJ8C 1XTAA 4IPAA 3M3YJ 4X6AJ 1I1GA 2RKHA 5HLTA 4YELA 1ETVA 4IL6C 4KITB 3ZP5A 1TWAJ 1XMAA 2FBHA 1W5CC 2AQFA 1SAUA 2KRFA 4YG2F 1IZ1A 4O5VA 1LKXA 2MW8A 2L3DA 3MEXA 4MGRA 2EA2A 3HHHA 4A69C 1U5TC 1RUNA 2MYSA 3JREA 3BTCA 2IA2A 4ZYDA 2COMA 4JX4A 3Q5FA 3E6BA 5IP6A 5ERIA 4GGGA 4XN0A 4BEHB 4EJWA 3HZJA 4YFXF 2R5ZA 1U5TA 3D5LA 1WFXA 4ENJA 2VONA 1VNDA 5FFZA 3E7LA 1U8RA 4RDUA 3C2HA 5K5OA 2WY7Q 5FGMA 2ZFUA 1PVEA 4XSZF 2WA0A 2KIQA 5IY5H 3HPGA 1JKQC 2DFFA 2CV2A 2JK3A 2A6HF 1B72A 2GIZA 3PIOF 3H3UA 3CCRI 3KP4A 3I55I 2XGEA 3Q0WA 3WG9A 2HZDA 5ED4A 3H0GJ 4L9JA 5D5XB 2P6SA 2QSHX 1GV5A 3IKTA 3OIQA 1BBYA 3PQJA 2A6EF 4ZZDA 4OAZA 1RESA 1HDDC 2W85A 2IAIA 4BJ5C 4PGGA 2PMZN 1R00A 4BJTA 2BW3A 3K4NA 3MWMA 3K10A 3SZPA 2O5RA 4QPOA 2A69F 2LK2A 5F27A 3QRFF 4JX6A 3NQOA 1HSTA 1Z9CA 2Q0OA 4ZYAA 4XLNF 1X1PA 1FYLA 2DA4A 2V1DA 3BPXA 3KPHA 3M07A 1Z05A 3I64A 3MZHA 1H8AC 2DDBA 3K7AJ 2DA7A 4AU7A 3DPUA 3C7JA 2DTRA 3FMQA 2IP2A 3TQNA 3ESWB 4Z2YA 5BMZA 4ITVA 2E2JJ 2IGNA 5ICGA 2XDVA 3DF8A 1W1WE 3LAJA 3V42A 4E7IA 5TRDA 3CC2I 1LVKA 3FXRA 5IPAA 5FD6A 1VQKI 5AONA 2L0KA 1T33A 2XAJA 3PIPF 2XB0X 3JW4A 3CF2A 5D6FA 1HW1A 1XB4A 1SD4A 4B43A 3WTYC 3JTGA 4ZTFA 1O4XA 2WB1A 4FQGA 5K7HA 1JKPC 4CHUA 2X6WA 2CRGA 1T0FC 1X3ZB 2FA5A 2QBYB 2Z3YA 1VQ4I 4OINF 4L9NA 1BI2A 5FRMA 5CVJA 2Q2EA 2IW5A 2WC2A 4U87A 3SQNA 1F36A 1K4SA 3LSMA 2XGXA 4LB5A 2HXIA 3UR3C 4DOZA 4L5JA 1SEUA 2DMUA 1P92A 4E6KG 1TBXA 3RYPA 4B8XA 4FCYA 3OYAA 3S3NA 1EH6A 2V1XA 2BXYA 4M9ZA 3VPRA 5F0FA 4BBSJ 3IUOA 2RNGA 1QVUA 2V6CA 4OMZA 4LG0A 3UNGC 2K85A 2BEOA 1YJNI 2GXGA 1MBEA 1MH4A 4XLCA 3NRVA 3VB2A 1RZ4A 2IGMA 2L9NA 1R22A 2K9NA 1YG2A 3G1MA 3CUQC 2HYGD 2X6XA 3LFUA 3FXOA 1YLFA 3BJAA 3W3CA 1DU0A
chains in the Genus database with same CATH topology
1OCCH 1OCRH 2EIKH 3WG7H 5B3SH 2ZXWH 5B1BH 2DYRH 2EIJH 1V54H 3AG3H 3AG1H 2EIMH 3AG2H 1OCOH 3ABMH 3AG4H 2EILH 3X2QH 2OCCH 3ASOH 2Y69H 5IY5H 3ASNH 1OCZH 2DYSH 3ABKH 5B1AH 3ABLH 1V55H 2EINH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC H;  1OCR H;  2EIK H;  3WG7 H;  5B3S H;  2ZXW H;  5B1B H;  2DYR H;  2EIJ H;  1V54 H;  3AG3 H;  3AG1 H;  2EIM H;  3AG2 H;  1OCO H;  3ABM H;  3AG4 H;  2EIL H;  3X2Q H;  2OCC H;  3ASO H;  2Y69 H;  5IY5 H;  3ASN H;  1OCZ H;  2DYS H;  3ABK H;  5B1A H;  3ABL H;  1V55 H;  2EIN H; 
#chains in the Genus database with same CATH topology
 2BY3 A;  3I0T A;  2W7N A;  2IGK A;  4ON0 A;  5D4R A;  1IJW C;  2M4G A;  2CUF A;  4E7K A;  4M3F A;  1A6I A;  5HLG A;  2VPL A;  4DBQ A;  1DGR M;  3BP8 A;  3HYI A;  4P5O A;  1W0U A;  4IHY A;  3VWB A;  2O7O A;  1PP8 F;  2M1B A;  2C6Y A;  2OA4 A;  3T8R A;  2KHM A;  2IS1 A;  4ABZ A;  4OIO F;  2WAQ A;  2FX0 A;  4QPQ A;  3IRR A;  2X85 A;  3I53 A;  1IUF A;  3E6C C;  4LGW A;  4LIU A;  5LGN A;  2VOO A;  4FT8 A;  1STZ A;  3FXL A;  1U5T B;  3S3O A;  1BL0 A;  3P9C A;  4XLH A;  5GAH J;  3LOC A;  4D9J A;  1VQ9 I;  4XQF A;  4EV0 A;  1MNM C;  1I3Q J;  2OBP A;  4LLL A;  1H88 C;  2YU3 A;  5M3M J;  5TIS C;  3I71 A;  1D5Y A;  4I0B A;  2XKP A;  1K83 J;  2QYO A;  2Q8K A;  1LEA A;  3SEZ A;  3CF5 F;  1B1B A;  1UZC A;  2JA6 J;  3PNT A;  1Z21 A;  1OCT C;  2JZY A;  1X4P A;  2V7F A;  3P7N A;  2F4I A;  3I59 A;  4A12 A;  1WJB A;  2E19 A;  3ZN1 A;  1AKH B;  2R5Y A;  4AIJ A;  1AHD P;  3AL0 B;  2LVS A;  2FD5 A;  3BG5 A;  2CQ7 A;  3HGY A;  1R58 A;  3KEY A;  4PSW A;  2VOD A;  3HSR A;  2DYR H;  1LPQ A;  1R36 A;  6PAX A;  1SVO A;  3AG1 H;  4Q5S F;  2D5V A;  2ZJQ F;  1FIP A;  3M4O J;  4RA2 A;  2DDA A;  4ZYG A;  1CGP A;  1SVL A;  2E71 A;  5FRN A;  3DQV C;  1G59 A;  2X1C A;  4UV9 A;  4H4K C;  4BXF A;  3L7W A;  2A3S A;  3BPV A;  5GAG J;  1WKM A;  1VQL I;  4ZJZ A;  5J3L A;  4RGX A;  5GPC A;  2MLK A;  4QWQ A;  3S1N J;  3DKW A;  3L2W A;  4XN3 A;  3CO6 C;  2UUZ A;  2ZKZ A;  1V54 H;  1O7L A;  2FQ3 A;  2LF8 A;  2FOK A;  1BC8 C;  1CF7 B;  5KAI C;  2LF7 A;  3E6D A;  1MD0 A;  1HKQ A;  4AID A;  4B3X A;  3BLY A;  1HLV A;  5K5R A;  1F9N A;  1S7A A;  5BPD A;  4UV8 A;  3CC7 I;  5E18 F;  1ETY A;  2O0Y A;  4XRF A;  3U1K A;  4F55 A;  2GZW A;  2LMD A;  4BHP A;  2L7M P;  3T5X A;  1M1E B;  2EBI A;  3BJO A;  3KIO A;  4P9U A;  4MEX F;  4IX7 A;  1ZH5 A;  2Y31 A;  1JT0 A;  1MGT A;  3FXM A;  4OIP F;  1HF0 A;  3VSK A;  1U3E M;  2QEN A;  1KU2 A;  1K79 A;  4IQ4 A;  1IW7 F;  1BI0 A;  2JN6 A;  2DQR A;  4OIR F;  2G0E A;  2IVM A;  4EJV A;  1IF1 A;  1J7K A;  1X2M A;  2KJC A;  4RS8 A;  4RBO A;  1MMS A;  1NH3 A;  2ZO4 A;  1IG7 A;  5TGT A;  3BTL A;  3WGG A;  5JHF A;  1P6R A;  1MMN A;  3E0J B;  1DUX C;  3C2B A;  2EZK A;  3KLN A;  5J4V A;  3A01 B;  5DM6 F;  1Y1W J;  2P6T A;  2E36 A;  5FKO A;  2NNY A;  4S0H B;  2PN6 A;  2ZME B;  3CMY A;  2HEO A;  3HXL A;  2JT1 A;  2ELH A;  2JTV A;  1HKT A;  2OV7 A;  2AXL A;  2LC2 A;  1IRF A;  4WWC A;  2F2E A;  3BR6 A;  3DXJ F;  2XRN A;  5C4J J;  2I10 A;  2YU9 J;  1XDU A;  1YIT I;  1VQ5 I;  4JQF A;  2KQR A;  3CO7 C;  2L7F P;  2V26 A;  3HG9 A;  2LSO A;  4HOB A;  2ZME A;  2ECB A;  4GO1 A;  3OYG A;  5AIP A;  1QO0 D;  2LBF A;  3FHZ A;  1R1V A;  2ESH A;  4L5E A;  2FNP A;  2RRE A;  4M3E A;  3PNY A;  4QTR A;  1HW2 A;  4XKV A;  1TWH J;  5M5W J;  3K4L A;  1XSD A;  1X1C A;  1WI3 A;  3I5U A;  5IT9 K;  2F5V A;  2OZ6 A;  1RR8 C;  4YEJ A;  2JMW A;  4LIT A;  5BPI A;  1FZP B;  5D8L B;  2J5O A;  2W25 A;  3MZ8 A;  3NWT A;  1AU7 A;  2M7A A;  2CS3 A;  3W6V A;  2DFI A;  1G6N A;  2EV5 A;  2LYC A;  5EJC A;  1BW5 A;  4C2T A;  2HKO A;  3WHB A;  3CCY A;  3OOU A;  2VC1 A;  2FBI A;  3GVA A;  4U7B A;  2BY0 A;  1H89 C;  4BXX J;  5JR3 A;  1XN7 A;  1ZGA A;  1Y0N A;  2H09 A;  2ZXJ A;  2R7O A;  3HUG A;  4IVN A;  3P9K A;  5K7F A;  4A6D A;  1SAN A;  1UHM A;  2H27 A;  5IP7 J;  2FML A;  2NVX J;  4OAY A;  5HLI A;  1P9Q C;  1Z3Y A;  1QZZ A;  2Z2S B;  1NK3 P;  4DQ2 A;  5ILU A;  2GXB A;  5EZG A;  1MZB A;  1UB9 A;  5CKT A;  3WTS C;  4HV6 A;  4L5I A;  5DYM A;  5GAE J;  1WQ2 A;  3ML6 A;  2B0L A;  3NAU A;  1MMA A;  4HLY A;  2IS6 A;  2X6Y A;  3O8G A;  1LDJ A;  3QAH A;  4XK4 A;  2HFH A;  2DMN A;  3FZV A;  4FHT A;  2R7T A;  2VT2 A;  2DPU A;  3DTE A;  1HCR A;  1WI9 A;  1RUO A;  4LLG F;  4KIS A;  4JOM A;  2FJ1 A;  4BE2 A;  2PG4 A;  1YOV B;  2PJR A;  4A3J J;  4A0X A;  3I58 A;  1WJE A;  2RV8 A;  4G7H F;  2P0W A;  2ZFW A;  1SC7 A;  4HF0 A;  3VYU B;  3BC8 A;  3RQI A;  3DCF A;  1YJW I;  2QQB A;  1XCV A;  4UVC A;  2FSW A;  2LTP A;  4FE7 A;  3A0H C;  4NC6 A;  3WHC A;  2QF7 A;  1MBF A;  1ENH A;  3A1Y A;  4E7H A;  1B72 B;  5CQG A;  2JUC A;  5DCM A;  4RGS A;  4I98 B;  1BR2 A;  3P5J A;  3IC7 A;  2K5C A;  2PLY A;  4DJA A;  4AIH A;  3SDB A;  1FBU A;  2HQN A;  3OY9 A;  2HNH A;  2FRH A;  4RAG A;  3RZO J;  2F4O B;  2TCT A;  1RKW A;  4XID A;  2VKE A;  1FLI A;  2NXN B;  1MIJ A;  4FIS A;  3SFZ A;  3RZD J;  3HDD A;  2DK5 A;  5HDK A;  1MDM B;  2P5L C;  4BY1 J;  3X2Q H;  3R6S A;  3HOT A;  3TP3 A;  2MH9 A;  4RM3 A;  3S3M A;  1JGS A;  1HQC A;  1IRG A;  3ABL H;  3F8C A;  3T8T A;  4CCO A;  1YX3 A;  2UXX A;  4MTD A;  1F5T A;  2STW A;  2RNJ A;  5J1Y A;  3JRI A;  4Y17 A;  4KMF A;  4BE1 A;  2CW7 A;  4R1H A;  4HX8 A;  4E7Z A;  2O61 A;  3V7R A;  2IXS A;  2K86 A;  3RKW A;  4L0Y B;  3AG3 H;  2Y9Z A;  2EA4 A;  4I02 A;  1FMV A;  4G94 A;  2CW0 F;  4II2 A;  1ZK8 A;  1Y8R B;  4IRH A;  1JXS A;  2MGQ A;  5BNG A;  4Y15 A;  3HTU A;  3TOA A;  3OYF A;  1TWF J;  4LJZ F;  4CO8 A;  1FPQ A;  4KIF A;  2E60 A;  3D1N I;  5FB2 A;  2RQP A;  1BN5 A;  3K4C A;  1D0Y A;  4MHG A;  2UV1 A;  2WAD A;  1QHH D;  3GTQ J;  3HOU J;  2JSP A;  4A3B J;  1ACI A;  4CCK A;  2ISY A;  2VJ5 A;  4DGW B;  5L3D A;  1Z7L A;  2BE5 F;  4EGY A;  1FP2 A;  1ZKG A;  4D0P A;  1W7P A;  3H92 A;  2HXO A;  2G7U A;  5E8G A;  1ZLK A;  3I54 A;  4FAS D;  2JQ7 A;  1SFX A;  4AIK A;  2DA6 A;  1I6H J;  2Y75 A;  4XSX F;  3KFW X;  2OQR A;  4GXO A;  5A2Q K;  2DJI A;  4JK1 X;  1S3J A;  1HA8 A;  3QWL A;  4KIB A;  2F5F A;  4ESJ A;  3RI4 A;  2R7D A;  2PJR B;  1D1C A;  4KJZ A;  2L5Q A;  1K6O A;  4MQV A;  4WXD A;  4B09 A;  2OZU A;  1T98 A;  2H6B A;  4B48 A;  3CCV I;  1EA3 A;  5GP9 A;  5IYB J;  5DD4 A;  3D0S A;  2DTZ A;  1Y0U A;  3JSO A;  1T2K A;  1QU3 A;  2RQQ A;  1JJ6 C;  3SFI A;  1PJR A;  4KYW A;  2YUS A;  3NAR A;  4AUX A;  3CLQ A;  1G3W A;  5D5W B;  2M34 A;  3OL3 A;  5B66 C;  3A4C A;  4QLC U;  2JPB A;  2K4J A;  1VQO I;  2VE8 A;  1OIS A;  2ZME C;  5LHI A;  4BHB A;  1Q1V A;  4BYY A;  5EGO B;  2K3P A;  2Y0S A;  2VBW A;  3CC4 I;  2VXZ A;  4Y3O A;  3WU1 B;  3QPS A;  3ZMS A;  1FYM A;  4G6T B;  3H1C A;  2LKP A;  2GBY A;  5EG0 B;  1HDP A;  1ZYR F;  2NS8 A;  4TV7 A;  5CJ9 A;  4HG2 A;  3RIR A;  3SZT A;  1IRX A;  3CCL I;  4QIW N;  2V1U A;  1W0T A;  1V5E A;  4U0W A;  4FX0 A;  1J5Y A;  3DPT A;  3PUF A;  4EAT A;  4KNY A;  3N97 A;  3LSK A;  4LMY A;  5E8I A;  1XMK A;  1TQM A;  5L3F A;  3FMS A;  2K27 A;  2W00 A;  1TQP A;  1TNS A;  1IDY A;  2WAQ N;  3Q3S A;  2P7C B;  1ZG1 A;  1EH7 A;  1OMI A;  3M8F A;  2R5Y B;  3S1M J;  3TGN A;  5E3M A;  4AYB N;  1IV6 A;  3CJR B;  1K4T A;  4GDF A;  2R7V A;  1ON1 A;  3L2V A;  2TDX A;  4UNO A;  1ZRE A;  3FKJ A;  1OCP A;  1J0R A;  3OYN A;  4FX4 A;  4Q48 A;  3GEZ A;  4KT6 A;  5GTH C;  1VQ8 I;  3H36 A;  2GOX B;  1KZH A;  2PBI A;  3LQQ A;  3JAM K;  1PUF A;  4RGU A;  3S14 J;  2O03 A;  1R7J A;  2E7W A;  2QQ8 A;  2FMY A;  4M6V A;  5JFR A;  2A5W A;  3DKY A;  2KZG A;  3TDU C;  1UMQ A;  2CFX A;  2M0M A;  2ZBK A;  5H6R A;  3Q9V A;  2EZL A;  3OYD A;  3JRB A;  4LLN A;  3CUQ B;  1MMG A;  3F8B A;  3F8F A;  4CH7 A;  3A02 A;  3DBR B;  2XUB A;  3V7S A;  3JRG A;  2WBM A;  1H0M A;  3CCE I;  1V55 H;  2RGV A;  3BQZ A;  1E2X A;  2BGC A;  5F64 A;  4HF1 A;  1WCM J;  2ELJ A;  1FY7 A;  3LA7 A;  3CP8 A;  1Z67 A;  2GM4 A;  1I27 A;  4U88 A;  1YW8 A;  1FX7 A;  1BI1 A;  5DCM B;  1TL8 A;  1VQM I;  1X1D A;  1BR4 A;  5FLX Z;  2QKM B;  2M8E A;  1N78 A;  2KRC A;  2ZSH B;  2DT7 B;  2CFO A;  4HPQ A;  3FM5 A;  3TW6 A;  2QWW A;  3OYB A;  4ZZL A;  4MO7 A;  3QYE A;  4B3A A;  3WGH A;  2LD5 A;  3BCB A;  3NWS A;  3S17 J;  4BQQ A;  4E4H A;  1JKR C;  1SMT A;  3QPL A;  4ENN A;  1ON2 A;  1ZAR A;  4HNT A;  3QPH A;  4NC7 A;  3BG7 A;  3MMY B;  3HHG A;  2VE9 A;  3PFI A;  1J2X A;  3Q9S A;  4CDG A;  2RN7 A;  4A6E A;  3MKY B;  1OJL A;  2FE3 A;  3M8J A;  4C9Y A;  2EFW A;  3HEF A;  4GCV A;  2LY2 A;  1FTT A;  3SDG A;  5IYC J;  1YJ9 I;  5LFA A;  1FWZ A;  2VJI A;  5J4Y A;  4IKF A;  3TKY A;  2BY1 A;  1FBS A;  1Z7U A;  4Z6Y A;  2L7Z A;  2UZK A;  2X9D A;  1WH7 A;  4ZYE A;  3E6M A;  1J9I A;  1REP C;  3FXU A;  5FLV A;  4XLE A;  5K7Z A;  1LDK B;  5M5Y J;  5LGU A;  5F6F A;  2VQH A;  5JVG F;  3JRH A;  4LG3 A;  1XPX A;  4BHC A;  4N0B A;  3ERM A;  3AG2 H;  4HBL A;  4CZZ A;  4YIR X;  2AHQ A;  4UY8 I;  4I01 A;  2WWY A;  1WH5 A;  2BHZ A;  2F6C A;  3ASO H;  1LE8 B;  1W7P B;  3G71 I;  4BGD A;  2A07 F;  1I1S A;  2OJE D;  4MFE A;  4A3G J;  2NS0 A;  3RPQ A;  1XDS A;  3HRS A;  4M6Y A;  2CW8 A;  3TMO A;  2M7B A;  3KYD B;  2Z99 A;  2VB6 A;  3B02 A;  3MCZ A;  3IWF A;  1XGM A;  5F0C A;  1LB2 A;  1FMW A;  2DJN A;  2ZSI B;  2PX9 A;  5BQT A;  3JRD A;  3LSG A;  4NB5 A;  1X19 A;  3BR0 A;  1OR7 A;  2V9K A;  3DU5 A;  3BJ6 A;  1ZRC A;  2R5Z B;  3HKZ N;  3F23 A;  1BOB A;  3DTI A;  4NQW A;  4UVB A;  4WXC A;  1B9N A;  2D1V A;  2VT3 A;  4BEH A;  3ONQ A;  3J7A O;  2LRD A;  3GO5 A;  4H0E A;  3CD6 I;  3MFK A;  4W97 A;  2CV0 A;  1MBK A;  3ZXS A;  5J1R A;  2LLK A;  4FE4 A;  4XOR A;  2NOJ B;  2FF4 A;  2XF5 A;  3F8N A;  3RKQ A;  1G8X A;  1TT5 B;  2DA5 A;  3OYH A;  3HOS A;  1X1A A;  3QU6 A;  3GW2 A;  4RB1 A;  2E1C A;  1FNN A;  4IHS A;  5JVT A;  5DUI A;  3CQZ J;  1POG A;  3CJT B;  1Y1V J;  2LP0 A;  3G3Z A;  5J6X A;  4YFN F;  2Y69 H;  2R7Q A;  3BTJ A;  3VOD A;  2JJ7 A;  3TL4 X;  4A0Z A;  4G7O F;  3CCQ I;  5C3E J;  2XC7 A;  1Z1D A;  3GTK J;  2GA1 A;  3HPH A;  3J7Z I;  3F72 A;  1PUF B;  1T39 A;  3COA C;  1UHS A;  1OFC X;  3A0B C;  3BOQ A;  4E7L A;  1S29 A;  3EUH A;  3HBL A;  3D5S C;  4IRI A;  2HOS A;  5EYR A;  2AXT C;  1VF9 A;  4ESB A;  3ECH A;  5HLH A;  2Q2E B;  4HV5 A;  1IXC A;  1D8J A;  2DO7 A;  2DN0 A;  4KN7 X;  3DLL F;  1W36 C;  2EQR A;  1EF4 A;  3ZQL A;  1ZGW A;  2ETH A;  4IHW A;  1YYV A;  2K7L A;  3PSI A;  1C0W A;  2ICW G;  3CLO A;  3S2H J;  1APL C;  1UFM A;  2P7V B;  1K78 A;  1SD7 A;  1D0X A;  1X3U A;  3ROU A;  4CCM A;  3V8K A;  4IO9 F;  2XPV A;  1E17 A;  2PEX A;  3G73 A;  1MBG A;  4KDP A;  3E97 A;  2R7Z J;  3QOE A;  1FSE A;  3BG3 A;  4IJA A;  2GOM A;  2ZJR F;  4CGZ A;  1JHH A;  2HU9 A;  1FEX A;  3AKZ A;  1EV7 A;  3U21 A;  1N77 A;  3U9G A;  2XAH A;  2Y48 A;  4R79 A;  1IN4 A;  2VQL A;  3J7A Y;  3CUO A;  4WX9 A;  1MSF C;  1S8N A;  2GIV A;  3DWL E;  5EDN A;  1R49 A;  5H2F C;  2OU2 A;  1XX5 A;  1T0F A;  2I5U A;  2FQ4 A;  2O8X A;  3OOP A;  5LEJ A;  2CGP A;  2VKH A;  3W6J B;  3R4K A;  1TP4 A;  2B9S A;  5ICC A;  2DMT A;  3RPU D;  1R5I D;  1BM9 A;  2HPM A;  1KU3 A;  1D5V A;  2XSJ C;  1AKH A;  3G1L A;  1QPM A;  1TT0 A;  3WOD F;  4WCG A;  1O3S A;  2ECC A;  2XPU A;  4XKW A;  3HSF A;  1ONV A;  1ZR2 A;  3G4S I;  3K2A A;  2ELK A;  2ZNZ A;  3GYH X;  4PGH A;  3FXK A;  3EDP A;  1B8I A;  2L4M A;  2XIG A;  2BBY A;  1QRY A;  2DW4 A;  1X3W B;  1V3F A;  3I4M J;  2BY2 A;  3IH4 A;  4EGZ A;  2HTJ A;  4LIV A;  1ZGJ A;  2LY1 A;  4V19 K;  1I5Z A;  4KIC A;  1J75 A;  3VYR B;  5ICE A;  2HYJ A;  3W2W A;  1T6S A;  3MQ0 A;  2M0C A;  5CLS A;  3RPU A;  5HOO A;  3RCO A;  1V5F A;  2PI0 A;  3RKX A;  1P4A A;  2E1M B;  3KZY A;  5GAD J;  2M5W A;  2CQX A;  2VJ4 A;  4MFD A;  1Q1H A;  2K9S A;  1D3Y A;  1R9T J;  3H3V K;  2OUM A;  1RET A;  3G2B A;  4XON A;  3V4G A;  5KAF C;  3LNQ A;  3HTS B;  2GXA A;  2OTJ I;  3N05 A;  5HNF A;  4M71 A;  3R61 A;  5LLQ A;  3ABK H;  2H94 A;  3E5Q A;  2NVU B;  3OS1 A;  3JCU C;  3JSP A;  3OYM A;  3ULQ B;  5CVR A;  5J8F A;  3TW7 A;  3S15 J;  1E0E A;  1R4M B;  4A5M A;  1G4D A;  4HSR A;  1L0O C;  2DOA A;  1IAW A;  3SXY A;  2KIU A;  1DQU A;  1E3O C;  4MNU A;  5JI6 A;  1HSJ A;  2ZB9 A;  5J40 A;  4DNC A;  3F6V A;  3JRF A;  2Z1D A;  3S1R J;  4M3D A;  1P2F A;  2H1K A;  4HRI A;  5E20 A;  2H6C A;  3DPL C;  1MSE C;  3HOX J;  2IPQ X;  4K2E A;  4UUV A;  1T56 A;  1LEB A;  1YHQ I;  1IXS B;  4ESF A;  4MQ9 F;  3L9F A;  5EZH A;  3WU0 A;  2CO5 A;  1BIB A;  1V5G A;  1R5G A;  3K2Z A;  2E1M C;  1LJ9 A;  5LRR A;  1K7A A;  1PYV A;  1ZN2 A;  3H5R A;  2UXN A;  5IYD J;  1TLH B;  2E2H J;  3KP5 A;  2EV6 A;  3TO9 A;  2JVG A;  3CME I;  3J81 Z;  2JA2 A;  5IT3 A;  4RM2 A;  1JKO C;  4M9S A;  5JLX A;  4EJO A;  1KU7 A;  1VI0 A;  2DOF A;  1RC9 A;  3CMM A;  3GTL J;  3TDZ C;  1A35 A;  5LRS A;  3SHF A;  3SJM A;  1B9M A;  2R7S A;  1E3H A;  4PJ0 C;  3J80 K;  5LHG A;  4HX7 A;  2VLA A;  1I3A A;  3QOD A;  3GFJ A;  4V2F A;  3FXJ A;  2XGC A;  1U9N A;  2K3F A;  1EKE A;  1IN8 A;  4DZP A;  2HDC A;  4I2O A;  5L3G A;  5GPA A;  3WTT C;  4PJN A;  3VYT B;  3ZCO A;  4ENM A;  1D1A A;  5HNH A;  1ZTR A;  2VXD A;  3HIF A;  2X4H A;  3C2G A;  3HOZ J;  2HPI A;  4XMY A;  2WB1 N;  1QNT A;  4A3I J;  3B6A A;  4DYC A;  4Y4R A;  3RDI A;  2AQE A;  4HQE A;  3TP0 A;  3K70 C;  1N75 A;  5EEA A;  2XKO A;  4ZH4 F;  4E7S A;  3V8J A;  4A3F J;  2KKO A;  4BDY A;  4A5N A;  3L2C A;  1BC7 C;  2KL4 A;  1EH8 A;  2HR3 A;  3ABM H;  5KCM A;  3BY6 A;  3LA2 A;  4I99 C;  1TWC J;  2QSG X;  1VFC A;  2JPC A;  3M1E A;  1MBJ A;  3FHN A;  5FRO A;  1S5L C;  3KEQ A;  1IDZ A;  3Q0V A;  2ZNY A;  3OYI A;  3K0L A;  1WHU A;  3BG9 A;  2PFB A;  2XRO A;  2HI3 A;  2E1O A;  1AA7 A;  1FP1 D;  2K9M A;  2O9L A;  4MIM A;  2J5P A;  2MSY A;  5CYV A;  5F04 A;  4KFC A;  1A36 A;  3LWF A;  4FET A;  3PL8 A;  2MLG A;  2PMU A;  1I39 A;  2LNB A;  4A3E J;  2VN2 A;  1R6R A;  4XR6 A;  2DMP A;  4NDL A;  3WE2 A;  2NAZ A;  2GQQ A;  1FC3 A;  2B63 J;  3FK7 A;  2HQ5 A;  4IOA F;  2NNN A;  2VL8 A;  3CCS I;  1KYZ A;  2JWT A;  2X51 A;  1O3T A;  2F4M B;  2HOA A;  3CP2 A;  4KA4 A;  1MBH A;  1T95 A;  2M8G X;  3H0D A;  1SD6 A;  4A3L J;  5FO5 A;  1FIA A;  3KEO A;  3I4N J;  3M8E A;  2PQ8 A;  2A68 F;  1VQN I;  2A6T A;  3PUB A;  4BS9 A;  2CSO A;  3GXO A;  3L2Q A;  4FTH A;  3ASN H;  3M7G A;  4LOC A;  1KQ0 A;  1YW9 A;  2MG4 A;  3TOB A;  3GCM A;  4YIF A;  4V2G A;  1TQI A;  2OF7 A;  2OTL I;  3HGG A;  1QPI A;  3KZZ A;  3AFH A;  2M45 A;  5DDG A;  3TO6 A;  1IUY A;  2JA8 J;  4Y52 J;  1FSH A;  3J80 Z;  3BR3 A;  1QHG A;  5TJJ A;  3KYL A;  1UG2 A;  3OYK A;  2W84 A;  3ZPL A;  1XGO A;  2LY9 A;  4YFK F;  2E5N A;  5D4S A;  1LFP A;  2OC6 A;  3DP7 A;  1MJA A;  1WVR A;  2OCC H;  1XGN A;  3CCM I;  4G8X A;  2BW3 B;  2K4B A;  3L00 A;  3CCJ I;  2IS2 A;  4C2M J;  4YRV A;  2KPM A;  1FOK A;  5HDN A;  5M3F J;  4CYC A;  3D5R C;  3QYF A;  3WTV C;  1WJA A;  2R3S A;  3BRO A;  3F6O A;  5LBQ A;  4IXA A;  3V7C A;  2R92 J;  3BG6 A;  5B1B H;  4L0Z B;  2NOG A;  2NYX A;  3M1C A;  5H20 A;  2Z5U A;  1XD7 A;  3EUK L;  3ZR8 X;  1JI8 A;  2IGO A;  2QQ9 A;  1TZL A;  1UST A;  2P81 A;  1OCO H;  3KZI C;  1P7I A;  1RR7 A;  3K4J A;  3KX2 A;  3JR9 A;  4UUS A;  2H1L A;  2VKV A;  2F5D A;  1GXP A;  3OSF A;  1YX5 A;  2R7F A;  3OS2 A;  5EEH A;  4HEA 2;  1ETW A;  4J00 A;  3CZ6 A;  5IP9 J;  3P9I A;  4IEJ A;  2VBX A;  4U0Y A;  1A6Q A;  1S6L A;  4BXU A;  1I50 J;  1R1U A;  2XF6 A;  1ERD A;  3S2D J;  2X6O A;  1U6G A;  3VDX A;  2FXA A;  4Y7N J;  3TO7 A;  1RI7 A;  4NBQ A;  5EEG A;  3W2A A;  3VFZ A;  1T08 B;  1SAX A;  2HDD A;  2L4A A;  4BJ6 C;  4G6D A;  1YI2 I;  1DP7 P;  1Z6R A;  4D1Q A;  2ZXH A;  3OIO A;  2LRE A;  2R93 J;  3OMY A;  2KIS A;  2LFB A;  2MFZ A;  3PO3 J;  3GWZ A;  3K70 D;  1HBX G;  4L9T A;  3JTH A;  3G1O A;  4AD9 A;  3C18 A;  3MZY A;  4BH9 A;  3PQK A;  1O3R A;  5ICF A;  3HSE A;  3BT9 A;  2LDU A;  1UCR A;  2QQA A;  4G12 A;  4M6X A;  2HOE A;  2YSR A;  2HTS A;  2Y9Y A;  3I59 B;  3QU3 A;  4PCQ A;  2MD0 A;  5C44 J;  3VEP A;  1ORK A;  2EZI A;  4EM2 A;  2L54 A;  3ELK A;  2ZJ2 A;  4GFB A;  2LBF B;  1U0J A;  1ETX A;  2DYS H;  1MND A;  3LSI A;  3CUQ A;  3DV8 A;  3KCC A;  1HKS A;  3KP2 A;  1D1B A;  4D7M A;  5JLW A;  3UKG A;  2Z9O A;  1QZY A;  3H9G A;  5DTD A;  3HOY J;  1OKR A;  2EIK H;  2UWM A;  2M87 A;  2MA3 A;  2OCE A;  4XKB A;  1LVA A;  1GVJ A;  4NQW B;  1R1T A;  5LHH A;  2QLZ A;  4RLQ A;  5HDG A;  4BE0 A;  2DAO A;  5LGT A;  1AOY A;  2KIF A;  2Z16 A;  5H6Q A;  2A5Y B;  2MH2 A;  3ZN0 A;  2VQG A;  4EMS A;  4F3Q A;  1LQ1 A;  2EFN A;  1ZEL A;  2Y0M A;  1I6X A;  3EET A;  1OCC H;  2ZJP F;  1PP7 U;  4RB2 C;  2WY8 Q;  4JP0 A;  4ZTJ A;  2VUM J;  1IRZ A;  3RKY A;  4CCJ A;  1AWC A;  4XRM A;  4OOI A;  2Y2Z A;  3WU2 C;  2QCO A;  3RTR A;  3H35 A;  2W48 A;  4KT5 C;  3ZQI A;  3K1N A;  2HYF A;  3C1D A;  3QP6 A;  3L2R A;  4IQJ A;  2DFE A;  1EJ9 A;  3FBI B;  3AG4 H;  2KT0 A;  4A3C J;  5J1U A;  2JRM A;  3GFM A;  1VQ6 I;  4P9F A;  4ZDP A;  3GTG J;  3IV5 A;  1ZG3 A;  3BZ6 A;  1K6Y A;  5GTI C;  1MJ9 A;  2XVC A;  1QBJ A;  2DXI A;  1B6A A;  1U8B A;  3NEU A;  3HOV J;  2V1N A;  1GT0 C;  1FYK A;  1LNW A;  3OWT A;  1SFU A;  1JUP A;  4XRS G;  5F1R A;  2V9P A;  1TW3 A;  5E3N A;  2LKS A;  4HAM A;  3GUD A;  1O7F A;  4CUG A;  5EGO A;  1FOW A;  1GV2 A;  1OYW A;  2COB A;  3GTJ J;  2LOO A;  2BV6 A;  3IH2 A;  3IAM 2;  1LFB A;  1YFH A;  3H9Q A;  4RGR A;  4CCN A;  1MKM A;  4II3 A;  2CWE A;  2GWR A;  2VOP A;  4HQM A;  1FOX A;  5FKM A;  1ETK A;  3U2R A;  2E34 A;  4PSX A;  3DU6 A;  1KGS A;  2D2W A;  4XL9 A;  4C2U A;  2X1E A;  1D0Z A;  2K9Q A;  5FD5 A;  5A2Q Z;  4CYC B;  2Q1Z B;  2JSC A;  3IRQ A;  1K78 B;  1YRN B;  3HJE A;  4HLX A;  4N4O B;  4LK1 F;  2HVQ A;  2FEZ A;  3G6E I;  4PJL A;  1SFK A;  2BXZ A;  4GRI A;  4Y13 A;  2HVR A;  4PFP A;  1J59 A;  2Z33 A;  1O3Q A;  4BU2 A;  5FKK A;  1HXD A;  3DBL B;  3BR2 A;  1KQ9 A;  3A03 A;  3K69 A;  4XNF A;  2DPD A;  4AWX B;  4Q47 A;  3L09 A;  2VIX A;  1F1Z A;  3BDD A;  2HKX A;  3OIP A;  2ME6 A;  4JBA A;  1YIJ I;  3HL2 A;  3LA3 A;  1NHA A;  2CMP A;  3MKW B;  1A31 A;  2XB5 A;  3BR5 A;  4N9H A;  1MH3 A;  4G7Z F;  1ZRF A;  5KVR A;  5BS6 A;  5JHU A;  2DQL A;  1XG1 A;  3ZRG A;  2HVS A;  1BW6 A;  3QP5 A;  2VC0 A;  2ZXI A;  5K1Y A;  2CQN A;  3KET A;  4C3I J;  4UHT A;  3FIW A;  3KE2 A;  4XOP A;  4MEY F;  3CDI A;  1RNL A;  2DMQ A;  4BUP A;  3TBI A;  2W82 A;  4ENK A;  3FIS A;  5ILS A;  1FJL A;  1BIA A;  1OYY A;  2EFO A;  4PZJ A;  3TED A;  3GLX A;  2VJJ A;  5CVI A;  4B1R A;  3JRC A;  1H9T A;  2X0L A;  4HNU A;  4HF2 A;  4F52 A;  3J7Y J;  5DUK A;  1B59 A;  3DBH B;  1WJF A;  4DW6 A;  3DTK A;  1GLN A;  2BOL A;  2K02 A;  2W24 A;  3RQ4 A;  2QM3 A;  3QYB A;  1S7E A;  3GZ6 A;  1BA5 A;  3FKI J;  5C4X J;  3GTO J;  3SYT A;  3PNV A;  1QVT A;  1JUS A;  2XAQ A;  2IRF G;  4Y33 A;  2FU4 A;  1SD5 A;  2G7H A;  3M9A A;  4YII A;  3HC7 A;  4WXH A;  3KP6 A;  1MNE A;  4A3D J;  1JTY A;  3T1B A;  4Q4Z F;  1B8I B;  3GZN B;  1OQY A;  1MDM A;  4AVP A;  2O8K A;  4HZF A;  2GLO A;  3E3V A;  2WV1 A;  2N8G A;  4HDU A;  3C3W A;  2CQQ A;  2E7X A;  5DV5 A;  4M72 A;  5BOX A;  2CUZ A;  4ZDO A;  1WWX A;  1W5T A;  4IZZ A;  1TNT A;  4XKC A;  4BQA A;  5FFX A;  5DD8 A;  1W4M A;  4B44 A;  5B5E C;  2CG4 A;  4LK0 F;  4D5C A;  2Y0S N;  5FKN A;  4UUT A;  2O3F A;  3K9T A;  5HS7 A;  4UUS B;  3VSL A;  2EIN H;  1RRJ A;  1G3T A;  4NUB A;  4D5F A;  1OCR H;  2IT0 A;  2QBY A;  1F43 A;  2IA0 A;  3GBG A;  3S2W A;  2W4S A;  3RJP A;  2E2I J;  4EM1 A;  1VZ0 A;  3FXQ A;  4PK4 A;  1LFU P;  1X1B A;  1TTY A;  2EIJ H;  1UG0 A;  2X48 A;  3K1M A;  4KUM A;  4JX5 A;  2HZT A;  1Z91 A;  3KP7 A;  4RAY A;  4M9X A;  1VQ7 I;  4LD5 A;  1W7P D;  3O6B B;  5F1J A;  3PM1 A;  5KNL A;  2QGU A;  1ITY A;  2DU9 A;  4DZJ A;  3MN2 A;  1GVD A;  1OLT A;  2PMH A;  1NK2 P;  1S9H A;  3ZMT A;  1SMY F;  2W57 A;  3ZQC A;  2VQC A;  3CCU I;  4LB6 B;  2WTE A;  1IXR C;  3U1D A;  3JAM Z;  1RIO H;  3BWG A;  5E3L A;  2WV0 A;  2Y30 A;  1DGW Y;  4HYE A;  3DEU A;  4KN4 X;  2R7R A;  1FT9 A;  1WJD A;  3VOE A;  2IS4 A;  1BJA A;  4EQQ A;  4PDK A;  1XSX A;  2V6E A;  3L2U A;  1GHC A;  1UEL B;  2YX4 A;  4MLO A;  1J09 A;  2ZC2 A;  3FK6 A;  2DA2 A;  2EIL H;  3WGI A;  1QA6 A;  1R5H A;  4O6J A;  4ZDL A;  1KQ8 A;  2BVM A;  1ZRD A;  2NS7 A;  4KMU X;  2QZ8 A;  1TC3 C;  2L9V A;  4X0G A;  3JRA A;  3ZGK A;  4AYB A;  1XCB A;  1DPU A;  5D5U B;  3BR1 A;  3E5X A;  3CJN A;  4IHX A;  3GTP J;  1DDN A;  4RB0 A;  4XLP F;  2DK8 A;  3IKV A;  3ZQ7 A;  3ZQQ A;  2DI3 A;  2JA5 J;  1YW7 A;  4C30 A;  4A93 J;  2HGC A;  1FTZ A;  3B73 A;  1IN5 A;  2F48 A;  4A0Y A;  2IJL A;  2X1D A;  2KRH A;  1R4N B;  4UXN A;  2L7K A;  5DM7 F;  4IOC F;  1GDT A;  4A3K J;  3DKX A;  2CYY A;  2EZH A;  5HS9 A;  3GF2 A;  4HW0 A;  1XGS A;  1FBQ A;  2AO9 A;  2OAZ A;  3LL7 A;  4BNC A;  1KON A;  1P4X A;  1F4K A;  2NVY J;  3O2P E;  4NNJ A;  2BVL A;  2K9L A;  3LSR A;  3EUH C;  3CMA I;  4BBR J;  2VAS A;  5E79 C;  2ISZ A;  4PJJ A;  2LR8 A;  4E7J A;  1RPW A;  2CUE A;  4XIC A;  2H8W A;  1E3P A;  3IHU A;  3K6G A;  4HNV A;  2KP6 A;  2RDP A;  4ETS A;  4C3J J;  1FOY A;  1PDN C;  4OU0 A;  2M4K A;  4PUS A;  4P55 A;  3H9J A;  3ZMD A;  5AIQ A;  4B47 A;  3LMM A;  2ZXW H;  3LSH A;  1T8I A;  3DFG A;  4EM0 B;  2WAF A;  2D1H A;  1LE8 A;  4J19 A;  5J8C A;  2OQG A;  1P4W A;  2KIM A;  2L2O A;  4L18 B;  5CVV A;  1JT6 A;  1G3Y A;  2EH3 A;  4PJM A;  2F5C A;  3EUA A;  3RSN A;  2RVC A;  2DT5 A;  4EJT A;  1Z6T A;  2IA1 A;  3Q0U A;  1BOA A;  2JUG A;  2CH0 A;  2VI6 A;  5HS8 A;  2L02 A;  4C3H J;  3ERE D;  1H9G A;  2KFD A;  4EJU A;  4X1E A;  3W6K B;  1W36 D;  2MC3 A;  2XAU A;  4BQN A;  4N9I A;  3RYR A;  4F93 B;  1WGX A;  1NG7 A;  2D45 A;  1YE9 A;  5E1Z B;  1NG6 A;  3DEE A;  1X2N A;  1HC8 A;  2R7X A;  1IGN A;  1Y39 A;  3CDL A;  3HRT A;  3S32 A;  4PFO A;  1SFO J;  1IO2 A;  1VQP I;  2QKL B;  1UHW A;  2A05 A;  3EQL F;  5IOZ A;  3ZQG A;  5LEK A;  3OYJ A;  4CIC A;  2ID3 A;  3OV8 A;  3FBN B;  1OCZ H;  2DA1 A;  3F0C A;  2L9S A;  3HRM A;  2HDW A;  2V9V A;  1NTC A;  1N25 A;  5E3O A;  3E1S A;  2NRA C;  2FUG 2;  1U9O A;  1USS A;  3I4P A;  2V79 A;  3B6C A;  3ABT A;  1ZAO A;  4I76 A;  1DP3 A;  4S05 A;  2MBF A;  4RB3 C;  2XV4 S;  2CQK A;  3KLO A;  3MD2 A;  4GYI A;  5L3E A;  4DYR A;  1Z3X A;  5ILV A;  3LAP A;  2FNA A;  1YS6 A;  4CCL A;  1Y6I A;  2JA7 J;  4AVZ A;  2E35 A;  2XAG A;  2DCE A;  2IBD A;  2DLL A;  3SZG A;  3BCA A;  1SFE A;  1O57 A;  4A3M J;  1S72 I;  2YX7 A;  4G6Q A;  3T0Y A;  3I3L A;  3F9K A;  1R23 A;  3S93 A;  1WJC A;  2EV0 A;  1YS7 A;  4I09 A;  4L9V A;  3H5A A;  3W2V A;  5FLM J;  3A01 A;  1QGP A;  4XRS A;  2XAF A;  2AS5 F;  3KP3 A;  2R7U A;  3LST A;  4BAY A;  1BR1 A;  1WSU A;  3S8P A;  3HM5 A;  3IH3 A;  2QSF X;  3QPT A;  1X4O A;  2M3A A;  3BZK A;  2QUF A;  1R71 A;  5D6E A;  1U2W A;  2YR2 A;  3O3K A;  1U78 A;  4RAF A;  1A04 A;  4XBF A;  3ZMU A;  1ETQ A;  4CA0 A;  1PUE E;  2ZCW A;  4BL0 B;  2DA3 A;  2JRT A;  3WG7 H;  3WTZ A;  3F21 A;  2ADU A;  4ANJ A;  2BHY A;  4BAC A;  2ME0 A;  1IN7 A;  1Z77 A;  3K4K A;  3QOP A;  1GXQ A;  4KIG A;  4XM3 A;  2MC4 A;  3IP4 B;  2KDZ A;  4I6Z A;  1ZLJ A;  1DPR A;  3IAS 2;  2IEK A;  4IF4 A;  4RAZ A;  4HDV A;  5FLX K;  2A61 A;  5HVQ C;  3GME A;  3QQA A;  2WAE A;  2KZV A;  2P5K A;  1YRN A;  3H3Z A;  4R8H A;  2HOT A;  1BI3 A;  4B4C A;  5CQE A;  2NVT J;  1X58 A;  1LDD A;  4M73 A;  5B3S H;  3ZMZ A;  1YTY A;  3FF5 A;  1ETO A;  3WTX C;  1S7O A;  2M30 A;  4P1W A;  4CZC A;  3OS0 A;  1WPK A;  5EG0 A;  1TWG J;  2LH9 A;  3OYC A;  2EJR A;  3BZC A;  3GLL A;  3K4B A;  2R4G A;  3HRU A;  1MW7 A;  4F91 B;  1ZR4 A;  2F5E A;  3WTU C;  3I9V 2;  1G2H A;  2XPW A;  2ID6 A;  4M74 A;  3OR2 C;  2QA4 I;  4BKX A;  4QSH A;  4P96 A;  4U0V A;  3EYY A;  4I0A A;  2LG4 A;  3R0A A;  1XS9 A;  1V4R A;  3FMR A;  3K1P A;  4JYK A;  2I8D A;  4A2U A;  3ZMV A;  3PFY A;  3OL4 A;  4EVI A;  3WTW C;  1WJ5 A;  3MKZ A;  3OYE A;  2XAS A;  1QQI A;  3CES A;  4BDZ A;  3F8M A;  3AL0 C;  3MAJ A;  3ABU A;  4IHV A;  2L01 A;  2RAE A;  5CPR B;  2M2E A;  3J81 K;  5D5V B;  1OYI A;  4RMN A;  1HW5 A;  5D8K B;  1Z0X A;  1MJB A;  2PJP A;  3REO A;  3F22 A;  4OMY A;  1IN6 A;  3ISP A;  3CDH A;  2E1N A;  5HOD A;  2KDO A;  3H5N A;  4WF2 A;  1B4A A;  1JGG A;  4O3M A;  2P8T A;  4BY7 J;  5J47 A;  3IL2 A;  5L3C A;  3S16 J;  3FM3 A;  3GZ5 A;  1Y8Q B;  4CYD A;  5CVU A;  2DOD A;  3PJR A;  5M5X J;  2BYV E;  3V8L A;  3HUG B;  3HOW J;  4AM3 A;  2XHK A;  2W1O A;  2VKD A;  2YPR A;  3LQR A;  3IWZ A;  3FDY A;  1G3S A;  5K5Q A;  3CJQ B;  4NHJ A;  2DBB A;  3R60 A;  2VPR A;  1LUJ B;  5IOY A;  3AAF A;  3S1Q J;  1YQA A;  3WE3 A;  3K4M A;  5B1A H;  2EFQ A;  3SEQ A;  4IHT A;  9ANT A;  3ZQF A;  2NVQ J;  2P5V A;  2FOW A;  4G9Y A;  2R0Q C;  2HS5 A;  2ESN A;  3LSJ A;  1BJZ A;  1JUM A;  1ZHF A;  1A5J A;  2O6G E;  3BQY A;  2P4W A;  3N4M A;  2H8R A;  2EK5 A;  2XRL A;  4XLA A;  4F7Z A;  2L9R A;  3OR1 C;  3MKL A;  5LD2 C;  1WZ2 A;  5E1X A;  4HST A;  1WRJ A;  1ULY A;  5FJ8 J;  1MMD A;  1ODD A;  2CV1 A;  2CJJ A;  2OPT A;  4HA8 A;  3BTI A;  3GFI A;  3PSF A;  4U7D A;  1L3L A;  1CF7 A;  1CQT A;  3DEW A;  3HB9 A;  2GAU A;  2DOE A;  2KMU A;  3HKZ A;  4EEF G;  2PMZ A;  1KYW A;  1JHF A;  5DEQ A;  3LSP A;  1IC8 A;  3ECO A;  3ZQH A;  3EYI A;  4NC8 A;  2GA2 A;  2M9H A;  1UAA A;  4I7H A;  2EIM H;  3O8H A;  2DT6 A;  2EWN A;  4AC0 A;  1ZG5 A;  4D7N A;  1KA8 A;  3CTA A;  4UB6 C;  3EPZ A;  4LG0 B;  2TRT A;  5DCF A;  2R7W A;  4CXF A;  3E5U A;  3PO2 J;  1P7J A;  1GUU A;  3FWE A;  2V4J C;  4M3G A;  1VTN C;  5IT9 Z;  1XSV A;  3ZOB A;  3VYS B;  4M3B A;  4J01 A;  1YO5 C;  3A2K A;  4MTE A;  3R0J A;  2HQR A;  1HOM A;  3MVP A;  5F0H A;  2BZT A;  1K61 A;  4N4N B;  1XC5 A;  1TW2 A;  2FBK A;  2K40 A;  4S04 A;  1JTX A;  4IRG A;  3GTM J;  2E5Z A;  1OR7 C;  2OD5 A;  2QVO A;  4OWR B;  1ZQ3 P;  2XSD C;  2LKX A;  4XOT A;  3GFL A;  1DU6 A;  3F3X A;  2CU7 A;  1JE8 A;  2G9W A;  4HX4 A;  1IV8 A;  4WK8 F;  1Y56 A;  4E70 A;  2VBZ A;  4ASN A;  4F92 B;  2EPF A;  4DIQ A;  1XMX A;  1SVM A;  3GX4 X;  2DFH A;  2XGD A;  4LFU A;  3L1P A;  1D8K A;  5L3B A;  2KJB A;  1W5S A;  1UJ8 A;  4UVA A;  4OIQ F;  3I56 I;  1QZE A;  4ZC3 A;  1OPC A;  5KK1 A;  3FX3 A;  2VBY A;  4UB8 C;  4ZYH A;  2JVH A;  2XF7 A;  3LFK A;  2YS9 A;  1T38 A;  2MD5 A;  1KU9 A;  4DYQ A;  2HQA A;  1YIO A;  2MAB A;  2QEX I;  3OSG A;  1RKT A;  2EB7 A;  5EF6 A;  5F08 A;  2RC4 A;  4RLF A;  5FKL A;  4XLF A;  4DBR A;  2ACJ A;  5E17 F;  4W1U A;  2STT A;  5DS9 A;  4BQO A;  5E1W A;  5KHD A;  2EFP A;  2CUJ A;  3DLA A;  3KYC B;  2HWV A;  4GYG A;  4CSW A;  3OYL A;  2KLO A;  2B7E A;  1JJ8 C;  1XTA A;  4IPA A;  3M3Y J;  4X6A J;  1I1G A;  2RKH A;  5HLT A;  4YEL A;  1ETV A;  4IL6 C;  4KIT B;  3ZP5 A;  1TWA J;  1XMA A;  2FBH A;  1W5C C;  2AQF A;  1SAU A;  2KRF A;  4YG2 F;  1IZ1 A;  4O5V A;  1LKX A;  2MW8 A;  2L3D A;  3MEX A;  4MGR A;  2EA2 A;  3HHH A;  4A69 C;  1U5T C;  1RUN A;  2MYS A;  3JRE A;  3BTC A;  2IA2 A;  4ZYD A;  2COM A;  4JX4 A;  3Q5F A;  3E6B A;  5IP6 A;  5ERI A;  4GGG A;  4XN0 A;  4BEH B;  4EJW A;  3HZJ A;  4YFX F;  2R5Z A;  1U5T A;  3D5L A;  1WFX A;  4ENJ A;  2VON A;  1VND A;  5FFZ A;  3E7L A;  1U8R A;  4RDU A;  3C2H A;  5K5O A;  2WY7 Q;  5FGM A;  2ZFU A;  1PVE A;  4XSZ F;  2WA0 A;  2KIQ A;  5IY5 H;  3HPG A;  1JKQ C;  2DFF A;  2CV2 A;  2JK3 A;  2A6H F;  1B72 A;  2GIZ A;  3PIO F;  3H3U A;  3CCR I;  3KP4 A;  3I55 I;  2XGE A;  3Q0W A;  3WG9 A;  2HZD A;  5ED4 A;  3H0G J;  4L9J A;  5D5X B;  2P6S A;  2QSH X;  1GV5 A;  3IKT A;  3OIQ A;  1BBY A;  3PQJ A;  2A6E F;  4ZZD A;  4OAZ A;  1RES A;  1HDD C;  2W85 A;  2IAI A;  4BJ5 C;  4PGG A;  2PMZ N;  1R00 A;  4BJT A;  2BW3 A;  3K4N A;  3MWM A;  3K10 A;  3SZP A;  2O5R A;  4QPO A;  2A69 F;  2LK2 A;  5F27 A;  3QRF F;  4JX6 A;  3NQO A;  1HST A;  1Z9C A;  2Q0O A;  4ZYA A;  4XLN F;  1X1P A;  1FYL A;  2DA4 A;  2V1D A;  3BPX A;  3KPH A;  3M07 A;  1Z05 A;  3I64 A;  3MZH A;  1H8A C;  2DDB A;  3K7A J;  2DA7 A;  4AU7 A;  3DPU A;  3C7J A;  2DTR A;  3FMQ A;  2IP2 A;  3TQN A;  3ESW B;  4Z2Y A;  5BMZ A;  4ITV A;  2E2J J;  2IGN A;  5ICG A;  2XDV A;  3DF8 A;  1W1W E;  3LAJ A;  3V42 A;  4E7I A;  5TRD A;  3CC2 I;  1LVK A;  3FXR A;  5IPA A;  5FD6 A;  1VQK I;  5AON A;  2L0K A;  1T33 A;  2XAJ A;  3PIP F;  2XB0 X;  3JW4 A;  3CF2 A;  5D6F A;  1HW1 A;  1XB4 A;  1SD4 A;  4B43 A;  3WTY C;  3JTG A;  4ZTF A;  1O4X A;  2WB1 A;  4FQG A;  5K7H A;  1JKP C;  4CHU A;  2X6W A;  2CRG A;  1T0F C;  1X3Z B;  2FA5 A;  2QBY B;  2Z3Y A;  1VQ4 I;  4OIN F;  4L9N A;  1BI2 A;  5FRM A;  5CVJ A;  2Q2E A;  2IW5 A;  2WC2 A;  4U87 A;  3SQN A;  1F36 A;  1K4S A;  3LSM A;  2XGX A;  4LB5 A;  2HXI A;  3UR3 C;  4DOZ A;  4L5J A;  1SEU A;  2DMU A;  1P92 A;  4E6K G;  1TBX A;  3RYP A;  4B8X A;  4FCY A;  3OYA A;  3S3N A;  1EH6 A;  2V1X A;  2BXY A;  4M9Z A;  3VPR A;  5F0F A;  4BBS J;  3IUO A;  2RNG A;  1QVU A;  2V6C A;  4OMZ A;  4LG0 A;  3UNG C;  2K85 A;  2BEO A;  1YJN I;  2GXG A;  1MBE A;  1MH4 A;  4XLC A;  3NRV A;  3VB2 A;  1RZ4 A;  2IGM A;  2L9N A;  1R22 A;  2K9N A;  1YG2 A;  3G1M A;  3CUQ C;  2HYG D;  2X6X A;  3LFU A;  3FXO A;  1YLF A;  3BJA A;  3W3C A;  1DU0 A; 
#chains in the Genus database with same CATH homology
 1OCC H;  1OCR H;  2EIK H;  3WG7 H;  5B3S H;  2ZXW H;  5B1B H;  2DYR H;  2EIJ H;  1V54 H;  3AG3 H;  3AG1 H;  2EIM H;  3AG2 H;  1OCO H;  3ABM H;  3AG4 H;  2EIL H;  3X2Q H;  2OCC H;  3ASO H;  2Y69 H;  5IY5 H;  3ASN H;  1OCZ H;  2DYS H;  3ABK H;  5B1A H;  3ABL H;  1V55 H;  2EIN H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...