3ABMH

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
total genus 26
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3abmH00
2EIJH 5IY5H 1OCZH 2DYRH 2EIMH 3ABLH 1OCCH 2DYSH 3ASOH 5B1AH 3AG4H 5B3SH 3X2QH 1V55H 5B1BH 3AG1H 2OCCH 3WG7H 2ZXWH 1V54H 3ABKH 2Y69H 1OCRH 2EINH 2EIKH 2EILH 1OCOH 3AG2H 3ABMH 3ASNH 3AG3H
chains in the Genus database with same CATH superfamily
4A93J 4XR6A 1A31A 3CCVI 3DTEA 1F4KA 3H9QA 1WWXA 1RPWA 1KQ0A 5HNHA 2O6GE 2QSGX 3O3KA 1Q1HA 1Y0NA 3BQYA 3IH4A 2DA3A 1G4DA 1D1CA 2UWMA 1X1DA 3CUQA 3FISA 1PYVA 1TL8A 3MKYB 3ZQIA 3CCYA 5GPAA 2GIVA 4LK0F 1MJBA 4R1HA 3JREA 4A3GJ 1FOWA 5HNFA 2DYRH 2OQRA 1KU2A 2LG4A 2HOTA 1WKMA 4ITVA 5KVRA 1D8JA 2LKXA 1TLHB 3DBHB 1APLC 1H9TA 2P4WA 3WTWC 3MEXA 1A35A 3ZP5A 4HV5A 2MC4A 3DQVC 3FIWA 4AVPA 1FBQA 3WU0A 3HGYA 2CJJA 2LR8A 3E7LA 4ZDLA 3TDZC 2I5UA 4L18B 1ACIA 3K4BA 1UHSA 3ZQHA 4L0ZB 4PDKA 2CUZA 3AG2H 1AHDP 4PJJA 5CQEA 1XG1A 2M1BA 2Y31A 4LB6B 3OS0A 2O8KA 3CJRB 1K7AA 1AKHA 3A01A 2ECCA 2ZFWA 1MBJA 2GOXB 3CO7C 3GTKJ 4B48A 4UUTA 4KISA 2P81A 2VPRA 3SEZA 5FRNA 3CCRI 2F4IA 4YIRX 3RYRA 3I9V2 4KYWA 1JHFA 2KISA 2CW8A 4BAYA 1VNDA 3S1RJ 2IGMA 3W2VA 4N9IA 4ETSA 4RAGA 4U0YA 4HDUA 2FQ4A 2M0CA 3IH2A 2M34A 1UJ8A 4RLQA 1HDDC 2JJ7A 5IPAA 3JRDA 5EEHA 1LPQA 4D5CA 4YFNF 1MZBA 1X4OA 3MN2A 3EPZA 2R3SA 5FKMA 4B3XA 2ELHA 1R1VA 5E18F 4HX7A 4HG2A 4BU2A 5LGTA 5BMZA 1XPXA 2VC1A 4A3IJ 4XOTA 4UNOA 5JHUA 2D1VA 3A4CA 3G6EI 1H89C 3VFZA 2KL4A 3ABMH 3FK7A 3VWBA 2EWNA 2A3SA 4HX4A 5BOXA 4F55A 1EA3A 1X3WB 3U2RA 1B9NA 2IPQX 1CF7B 1ITYA 2M4GA 2YX7A 5F6FA 2XASA 3DKYA 3PSIA 4PFOA 3BZKA 3ZMVA 2L7KA 1VTNC 2QF7A 3RKXA 3ZQGA 3KZIC 1FTZA 3HUGB 1FBUA 4CICA 3TW7A 4II2A 1USSA 1O3TA 1IDZA 2W84A 3DU5A 2NS8A 2Y2ZA 2MABA 4EMSA 4RB3C 3BJAA 1FMWA 3JTGA 1S5LC 1JUPA 3I71A 3D5RC 4C9YA 1MNDA 4EATA 1T6SA 3HKZA 4DOZA 2E1OA 1K4SA 2E7XA 2XGDA 1XDUA 1IUFA 2IGOA 2Y75A 3TDUC 1L0OC 3FXUA 2P8TA 4RB1A 1QPMA 2FJ1A 1U0JA 4UY8I 1YHQI 3PUBA 4RM3A 1XX5A 2EFWA 3CMYA 2O7OA 2Y69H 2CH0A 1OCPA 2GBYA 1NK2P 2V6CA 5E1ZB 5IYDJ 1MMAA 2BVMA 3HRSA 2XSDC 3RSNA 5HLIA 2DMNA 4CYCB 2P6TA 2CW0F 4M74A 2IXSA 2QKLB 2BY0A 1GXQA 4E7KA 1U9NA 3ZOBA 2QENA 4A69C 3I59B 1TQIA 3DKXA 4Y15A 3PFYA 1ZREA 5HODA 3PNVA 2UXXA 1J5YA 2Q1ZB 4PGGA 1TQMA 3KE2A 4MLOA 3LFUA 3N05A 2YX4A 3K1MA 4MTEA 1POGA 3ZQLA 4KFCA 1MJAA 2VONA 4UXNA 1GHCA 1HKSA 3HSRA 4PUSA 4UV8A 5F0FA 3FX3A 2ZJRF 3ZMDA 3DPLC 4IHTA 3Q0WA 4HF2A 4GFBA 4HA8A 5ED4A 1D3YA 1Z7UA 3S1NJ 3V7CA 3WGHA 1W5CC 5BS6A 1E2XA 1HKQA 3JW4A 3DU6A 1P92A 2DPDA 5H6QA 1W7PB 4AYBA 2PJRA 1XC5A 1HW2A 4CZCA 2H6CA 3I56I 1YW7A 2EK5A 2K9SA 4EGYA 2P7CB 1I1GA 2EV0A 3EUAA 1U6GA 4H4KC 5A2QK 2E1NA 2V1NA 4N4OB 4RGRA 1MMNA 3HL2A 2H8WA 3IRQA 2GQQA 3F8FA 2V9KA 4MFDA 3WTUC 5D5UB 5DS9A 1TT5B 2M7BA 1ZK8A 4QWQA 5HOOA 4TV7A 1E3HA 1FPQA 3D1NI 2DODA 1Y1WJ 2OD5A 1ZAOA 2J5PA 2M0MA 3QQAA 3OL4A 3I3LA 3QPSA 2LH9A 2A5WA 5L3GA 4BBRJ 4UUSB 1FYLA 1X2NA 2JSPA 4RDUA 3E5XA 2P5VA 1B9MA 4MGRA 2XAUA 2RREA 3LFKA 1W7PD 4E7JA 3GTGJ 2EIKH 1G3TA 3F8NA 1J9IA 3SYTA 1Z9CA 2FSWA 3O8HA 4KIFA 3MAJA 2KMUA 2R7WA 3GFIA 3WTSC 1QHHD 4DYCA 3E6MA 4LD5A 4BXFA 3ABLH 3K4LA 2L3DA 1XCVA 3PM1A 3BG5A 1RI7A 2VPLA 3DWLE 2WBMA 3CDLA 5LLQA 3WODF 4RS8A 1HBXG 5CYVA 4HQEA 1YX5A 1O7LA 5FGMA 4G9YA 3C1DA 3BG9A 2OU2A 3CCUI 2QUFA 3CQZJ 5J8FA 1TW2A 2PFBA 2XRNA 3C2GA 2A07F 4S05A 4IXAA 4OMZA 2NNNA 3CZ6A 2FBHA 5GPCA 2QZ8A 5DCMB 4EJUA 1BC8C 1XN7A 3NWTA 1J75A 2DOEA 4IRHA 1MNEA 4RAYA 1REPC 1UELB 2VOPA 3F23A 4LLGF 3GTMJ 2C6YA 2NVQJ 2DN0A 1IRXA 3BR5A 3D0SA 2XV4S 3KFWX 4XLEA 4Y17A 5A2QZ 1ON2A 5JVGF 1JE8A 2HYFA 2A05A 2V9VA 4ENMA 3WGIA 4E6KG 1H88C 3OIQA 2L9VA 1PP8F 4OAYA 1SFOJ 1J09A 2XIGA 4BE0A 2R7FA 2X85A 2VQGA 1Z7LA 3H3UA 1ZH5A 2JA7J 4A0XA 1XDSA 1IV6A 1Z67A 2DOFA 2KJCA 3HEFA 4MO7A 1GV5A 3GZ6A 3LNQA 4HZFA 4XBFA 5K5OA 2CGPA 5M5WJ 2XGCA 3U9GA 2HKXA 3WU2C 1T39A 3TW6A 2K5CA 4F92B 4MIMA 1VQ9I 2M7AA 3ELKA 3AG1H 1U9OA 4XIDA 1PUEE 3WG7H 2OZUA 3HPGA 3I4NJ 3S2DJ 4QLCU 2XF6A 4D1QA 1CF7A 5DM7F 2VN2A 1TBXA 4I01A 2CQKA 2K4BA 5EJCA 4DZJA 2ISYA 3G4SI 3S1QJ 3SZGA 2WB1A 2IW5A 3ISPA 3DBLB 3F0CA 2W85A 3WE2A 1FY7A 3FMQA 1X1BA 3OOPA 3CMEI 3HUGA 2RKHA 2ZNZA 3WTVC 2K4JA 1UZCA 2EV5A 2F5VA 2HDDA 1TZLA 1O3RA 4AIKA 2EPFA 3OYMA 1R58A 2JVGA 2JMWA 3P9KA 2DDBA 4HSRA 4WXHA 1R71A 4FHTA 3R60A 4NHJA 2JVHA 4I99C 3BR2A 3T8RA 4CCNA 1KU7A 4NC7A 4OIRF 3EDPA 1MKMA 3W2AA 1VF9A 2G7UA 1I6HJ 3OIOA 4FISA 2GAUA 3CCJI 3OS1A 2IVMA 2LREA 1VZ0A 1YYVA 1P6RA 4M9XA 3HRUA 5TISC 1DPUA 4CYCA 4UV9A 5F0HA 2M8GX 4JYKA 4ESFA 3KIOA 4NNJA 2EFQA 1MMGA 1SFKA 3RPQA 3I59A 3S17J 3BWGA 3BTLA 2D5VA 3G2BA 5LRRA 2M2EA 2XPUA 3S3MA 5HS7A 4I0BA 4CDGA 1K61A 3FZVA 4MQ9F 1KONA 3GCMA 1QVUA 5LEJA 2IA2A 2NAZA 3P5JA 2MLKA 3HHGA 3DP7A 2UV1A 3OMYA 3C3WA 3F9KA 1MBGA 4L9VA 3LA2A 3AG4H 2LMDA 5E3MA 3FXOA 4GXOA 1WZ2A 3LSMA 4KIBA 1WGXA 4C30A 1T0FA 3IWFA 2ZO4A 4CCJA 3Q0UA 1X58A 1PUFB 2UZKA 3IWZA 3BTCA 3K70C 3BJOA 3M7GA 1W7PA 1KQ8A 5GTHC 2W24A 5HS8A 3K2ZA 2G9WA 4U0VA 1TTYA 3AG3H 3CO6C 3PQKA 2ME0A 1GUUA 2M4KA 2QQAA 3FMRA 5H20A 3K7AJ 2QKMB 2ZXJA 3VEPA 2OTLI 3E6DA 1R49A 1GLNA 4XICA 4KN4X 2TRTA 3SZPA 2DQLA 3LAJA 3FXJA 3I55I 2DPUA 1V3FA 2DOAA 2MBFA 1T98A 3IKVA 3TKYA 2WAQA 4JOMA 3J7AY 2HGCA 3EUHC 2RN7A 4M6XA 2XROA 4EEFG 3I4MJ 1FLIA 2RGVA 4HNUA 4UUSA 2R5YB 2KIUA 3HOYJ 2FOKA 2HVSA 4YIIA 5CKTA 4I6ZA 4ZH4F 3ASOH 2P5KA 4M71A 5D6EA 2OA4A 3NRVA 2HU9A 3VODA 2M3AA 2XGEA 3G71I 1Y0UA 3C2BA 3F8BA 4PK4A 1WQ2A 5IOYA 2DMTA 2XPVA 4E4HA 2VUMJ 1ZLJA 5LFAA 3CD6I 1K83J 4BQQA 4IX7A 4P55A 4BE2A 2BBYA 2W57A 5HLTA 2FQ3A 3V7SA 3OYAA 3CP8A 4PSXA 3OR2C 2ZXHA 4A3FJ 2CWEA 1XMAA 5E79C 2HQRA 5AONA 2ELJA 1QA6A 1B6AA 3KLNA 4XSXF 1P4AA 1D1BA 4N0BA 5CVIA 4V19K 1VQNI 2WY7Q 5DCMA 3JR9A 5E8GA 2EZHA 5E1WA 2IEKA 1O57A 2P6SA 5E8IA 3BG3A 2OJED 3L2VA 1U8RA 2JT1A 3TQNA 3GTPJ 3PO2J 3ASNH 4WXDA 1IV8A 1Z0XA 3F72A 1IRZA 2V1DA 2FRHA 3GLLA 1RC9A 1I50J 4UB6C 5FB2A 2VJIA 3G1MA 5IYCJ 1IXRC 2EFOA 5DYMA 2PI0A 4M6YA 4PFPA 2G7HA 2DFFA 2Q2EB 2R7OA 4XN0A 1A36A 2IA0A 4XLCA 3CMMA 5IP7J 2CFOA 2R5ZB 3KP4A 2E7WA 5E1XA 5L3DA 1QZEA 1LDDA 2CFXA 2ZBKA 1TNTA 1S7OA 2XHKA 4I7HA 3P7NA 1RETA 2V1UA 5ERIA 3IAM2 2L4MA 5J6XA 1QHGA 5DD8A 3QP5A 5FO5A 4L5JA 2DT5A 2FU4A 2DA1A 3TMOA 2GXBA 1ZG3A 4GGGA 2FA5A 1TWHJ 3CC7I 3H92A 2X48A 5IOZA 1IXSB 2WWYA 4LLNA 3KEYA 1MBFA 1PVEA 1U8BA 3GMEA 1O4XA 3MFKA 3H35A 1IGNA 2KRFA 3O2PE 4G6TB 5EGOB 1T56A 2HOEA 2MW8A 4S0HB 3OYJA 4RAFA 3WG9A 3OYCA 4RGXA 1JT6A 5JFRA 2PJPA 1OR7A 4B8XA 1EJ9A 4P9FA 3ERMA 2BXZA 4M72A 4R8HA 1TP4A 4FX4A 5JHFA 2HDCA 2PEXA 3FXQA 2XPWA 3QOPA 4LK1F 4BY1J 2KIQA 3QRFF 1W36C 5D8LB 1H8AC 5D5WB 5LHIA 3L2QA 3TL4X 3BLYA 3C7JA 5E17F 4IOAF 2L54A 2DLLA 2HFHA 2CYYA 1UB9A 4IVNA 4LIUA 2O61A 2RV8A 4P9UA 1OQYA 4O3MA 2KP6A 1FOYA 2XAGA 1BR4A 1YQAA 1W1WE 1M1EB 1EKEA 4HAMA 3QYFA 2KHMA 2YS9A 3A0HC 1YE9A 3KYLA 1B8IB 3JTHA 4FE4A 4OMYA 4ZDOA 4E7SA 1ZGAA 2LF8A 1UHMA 4IF4A 2O9LA 1V4RA 2QQBA 3FXRA 1LQ1A 2OCCH 1SMYF 4FQGA 5FFZA 2EZKA 2X4HA 2IRFG 2QCOA 2FOWA 3ULQB 4A12A 3ZCOA 5JLWA 3HOXJ 1JUSA 3FHNA 2YR2A 3FM5A 2Z99A 3GFJA 3AL0C 4IQJA 2V7FA 5J1UA 4KA4A 2DI3A 1VQ4I 4XK4A 2HOAA 1JKQC 2COMA 1D1AA 1PUFA 1SFXA 2PN6A 1YTYA 4CCLA 4B47A 3WTTC 1FP2A 3MVPA 4RA2A 2K9QA 4ZYGA 2WC2A 4JX5A 1SAXA 1MGTA 1TWCJ 3Q0VA 3C18A 3K4JA 4BJ6C 4MEYF 2BW3B 1EV7A 5HDNA 2DMQA 3I64A 5FLVA 3TO9A 1EH6A 1TWAJ 2COBA 5DUIA 1N25A 3HOUJ 1X1PA 2A6EF 1TWFJ 2F4OB 3ZMZA 3IKTA 1UG2A 1KU9A 2A6TA 1JKPC 4WK8F 4M9SA 3MKWB 2UXNA 2EIMH 5F64A 5FKNA 4A0YA 3BP8A 1UCRA 1WI3A 4G6QA 2E60A 3KEQA 3L9FA 1LE8B 2R5YA 2Q0OA 1TT0A 1S7AA 2YU3A 3UR3C 5M5XJ 3QPLA 5B66C 1KZHA 1ZHFA 2WA0A 3QU3A 1F43A 3GEZA 2FE3A 2XKPA 2KIFA 2VQHA 2Y0MA 4QPQA 4BKXA 3JRFA 2CSOA 5K5RA 1YIJI 2EFNA 4XL9A 4LLLA 1DQUA 2Y9ZA 2E1MC 2FEZA 1K6YA 1P9QC 3MMYB 2Y0SA 2WTEA 4DYRA 5BPDA 5GTIC 2CMPA 1G3SA 2VT2A 1SEUA 3GTLJ 2M9HA 2FXAA 5F04A 1SVMA 1V54H 2B63J 1UMQA 3RZOJ 5AIPA 2DK5A 1RR8C 1FSEA 2EILH 2HWVA 2DA2A 2QQ8A 1GXPA 1Z05A 3OV8A 3CJNA 4M6VA 1LVKA 4HF0A 1IDYA 4MEXF 2E34A 2LYCA 3BG7A 2D45A 2X51A 2Z1DA 1ZARA 3EQLF 2GIZA 4LFUA 2FF4A 1IN6A 2KDZA 2BGCA 3GTOJ 1N77A 3TOAA 2EA2A 3HJEA 2E5NA 4AU7A 1IW7F 3JSPA 1TNSA 5D4SA 1O3QA 5LHHA 2XB5A 2JK3A 4RGSA 3R61A 3T5XA 1HKTA 3S3NA 2ZSIB 2PLYA 1XGNA 2D2WA 2LP0A 2Q2EA 1RNLA 2RQPA 2BEOA 1RIOH 2CQ7A 1BM9A 4B3AA 3WTXC 3OYLA 4HV6A 3SZTA 2R5ZA 4ZJZA 3HIFA 3DBRB 3PIOF 1YX3A 1N78A 5FRMA 4CSWA 4HF1A 4L0YB 4A3EJ 2A5YB 3HSEA 4Y33A 4ESBA 4ZYEA 1B59A 2IAIA 2L2OA 5KAIC 4FASD 1I3AA 4PGHA 5FKLA 2LY2A 1KGSA 1O7FA 3CDIA 3ZMTA 1KU3A 3B6AA 1RESA 3HXLA 4N9HA 4Y13A 3M1CA 3J7YJ 1TW3A 2BHYA 2DDAA 2FBKA 1ERDA 3DLAA 4LOCA 2ZXWH 2B7EA 4OIOF 4KUMA 2X6OA 2FMYA 3LSTA 1FIPA 5LRSA 1OCOH 4G7HF 3MKZA 3G3ZA 1XS9A 1IC8A 3CC4I 1FIAA 2Y0SN 5C3EJ 2P5LC 4BQAA 1Y1VJ 2K9MA 5ILSA 5EGOA 2WAEA 2OC6A 3MZ8A 3TO7A 3I5UA 1HCRA 2E2JJ 1WJCA 2XF7A 2O0YA 1R22A 5L3BA 1JTYA 4A3BJ 3IHUA 3LQQA 2E2IJ 3BY6A 4U7DA 3LSKA 4IPAA 4ENKA 5EYRA 5IP6A 2IP2A 3GO5A 1I1SA 1P7JA 3ROUA 1YIOA 2FNAA 2OF7A 3LSRA 2TCTA 4IHWA 2Y9YA 1ZTRA 4KJZA 3AAFA 4WXCA 2LY9A 5E3LA 1Z3XA 4B09A 5E3NA 4GDFA 4AIDA 2CUFA 3E6CC 3S2HJ 3KCCA 4YIFA 2R7DA 3TGNA 5DEQA 1QRYA 5F0CA 3DCFA 2F5CA 4I2OA 2XF5A 3LA3A 4YFKF 2DYSH 1ORKA 1HC8A 5HDGA 2O8XA 5LBQA 2BE5F 5F08A 4B4CA 4IRIA 1K78B 2GWRA 4Q5SF 2HKOA 2QSHX 5J40A 5GADJ 1YFHA 1ENHA 2XAHA 1B8IA 3U1KA 3OYBA 4KMUX 3F8CA 3CCSI 4IHVA 3RI4A 2JA2A 2BOLA 3E6BA 4A3LJ 4XSZF 1JUMA 5LGNA 2VE9A 2XAQA 5FLMJ 1BW6A 3EYYA 3QYBA 2E5ZA 1SFEA 3E5UA 3S15J 2A69F 3U21A 3ZQFA 4U0WA 4A0ZA 3FM3A 4JK1X 4F52A 2NRAC 3K1NA 1G8XA 5HLGA 4EM0B 1IN8A 5D4RA 4DGWB 4HEA2 5GAGJ 3PIPF 3GXOA 4OOIA 4HX8A 3A02A 3CJQB 1X4PA 3MQ0A 1IAWA 4P5OA 1WJEA 2A61A 5D8KB 1LDKB 4ESJA 2NVUB 3BC8A 1OCZH 4DYQA 2BW3A 2BHZA 1ZG1A 3L7WA 2DJIA 4I98B 3W3CA 4ZYHA 2W25A 3WTZA 1A5JA 4LMYA 4I09A 4YEJA 3K70D 1HA8A 5DUKA 2ZCWA 1DP7P 4BXXJ 1O3SA 1EH8A 2VKDA 1MBEA 2OTJI 2GOMA 3OYNA 3L00A 4BYYA 6PAXA 2K9NA 2V4JC 2JZYA 2YPRA 3M8EA 1LE8A 1BI2A 3DEEA 3ESWB 2L5QA 1DDNA 2R92J 2Y30A 2CV0A 3GZ5A 3JRGA 3E97A 5H6RA 4IL6C 5DD4A 1Y56A 2F5EA 4AC0A 3QYEA 3LA7A 1VQ6I 5KNLA 1LUJB 1U2WA 2HXIA 3RPUD 3KP3A 3RCOA 4BY7J 1JT0A 1S29A 2EINH 2BVLA 4W1UA 3CDHA 4XKCA 4RMNA 1AA7A 2IGKA 2JN6A 3JRAA 1R36A 2OZ6A 2NS7A 2MD0A 5M3FJ 4M3GA 4DBRA 4I02A 3OYKA 3DKWA 4M3DA 2NVXJ 2CQXA 3W6JB 2R0QC 4RM2A 2KRCA 2Z16A 1LJ9A 1ULYA 2DMPA 3T0YA 3L2UA 1HSJA 3HTSB 3FF5A 3K2AA 4XRMA 2VQLA 2STWA 1WSUA 2QSFX 5K1YA 4BQNA 5F1RA 1XSVA 4IKFA 1ZYRF 4PJMA 1ETVA 3KP7A 3P9IA 4A5MA 3OIPA 5ILUA 3LAPA 2IS1A 1B4AA 1WPKA 4CCKA 2XGXA 1QVTA 3W6VA 2IS2A 3OL3A 1NG6A 5FD5A 3SEQA 3B73A 1FX7A 4QPOA 4QIWN 3CCEI 4PJNA 1D5YA 1JJ6C 3H5NA 2VQCA 1X19A 2DAOA 1P2FA 4XRSG 4CCMA 3AKZA 5CVRA 4OINF 4CH7A 9ANTA 5E20A 4K2EA 4C2TA 2GM4A 1Y39A 3RKWA 4L5EA 1GVDA 2LK2A 2L9SA 3KP5A 4YFXF 4D7MA 2N8GA 4LJZF 3J81K 2VBXA 4IEJA 1R5HA 3DTIA 1RUOA 1MSFC 1BIBA 3JSOA 1WJDA 1MMDA 4E7LA 1U5TC 3TBIA 1KQ9A 1X3ZB 2CQQA 2HYGD 3BZ6A 3RJPA 4D7NA 5HLHA 4EJVA 2E1CA 3WGGA 3RTRA 3MZHA 5C4XJ 3QPHA 2DFEA 3L2RA 3BT9A 4X0GA 3GYHX 3SDGA 3S1MJ 3GFLA 4XLNF 2JA8J 3K10A 2PX9A 2E19A 1ETWA 3K4CA 2M30A 3LL7A 3OS2A 1VQMI 1A6QA 2ZC2A 3HB9A 4Q47A 2IS6A 3NEUA 3WU1B 2X6XA 5KHDA 4XNFA 2QBYB 2W1OA 1SD5A 3IAS2 4A3JJ 3DPUA 3EUKL 1YS6A 4JQFA 4ZYAA 4EQQA 1NHAA 3EYIA 4RAZA 2DCEA 2BY3A 4O6JA 3LSIA 1D5VA 2Z3YA 4MNUA 1BN5A 3DFGA 3V8JA 3BPXA 4JBAA 2PG4A 3JRIA 1FSHA 2ISZA 1JKRC 4XLHA 3MZYA 1D8KA 2E36A 2R7TA 5KAFC 3R0AA 1IRGA 1BC7C 3SDBA 1IN5A 1OPCA 2RQQA 1R23A 3IL2A 5EZHA 1NTCA 4M3FA 4ZTFA 3HOWJ 1A6IA 3N97A 3BTIA 4F3QA 2LBFB 2Z33A 2R7UA 1MBKA 3CF5F 2ZSHB 1SD7A 1K78A 1W36D 2H09A 4A3DJ 5LEKA 3E3VA 3DEWA 3AL0B 3M1EA 5KCMA 3FHZA 3ZN0A 2OV7A 4HNVA 2KJBA 1UAAA 1ZG5A 3HDDA 2KZGA 3DV8A 2V9PA 4EV0A 3J81Z 3NARA 4C3JJ 3KLOA 1I39A 4AIJA 2ID3A 4BE1A 1MMSA 3SHFA 1QBJA 5JVTA 2YU9J 2LVSA 5J1RA 1DGWY 2XSJC 3HSFA 4M9ZA 2DTZA 2QVOA 1JTXA 3MWMA 2NXNB 1YLFA 2QGUA 1S72I 4KITB 5DDGA 1JKOC 3KETA 2Q8KA 1SAUA 2GXAA 4V2GA 3A1YA 3Q9SA 1F5TA 2A68F 3O6BB 5D6FA 4RGUA 2DA4A 4ASNA 3OYFA 1DPRA 2HTJA 1YJWI 2MSYA 2DFHA 2O03A 4JP0A 3EUHA 2W7NA 5BQTA 2LTPA 2CS3A 4OAZA 2AHQA 4PSWA 2CW7A 1T38A 4LIVA 1LFPA 5IT3A 1PP7U 4E70A 3F8MA 4Z6YA 4D9JA 4KMFA 2XB0X 1ZGWA 2KQRA 2VE8A 4U88A 3L2CA 1LVAA 2KLOA 3FMSA 1SVLA 1HF0A 1Z91A 1KYZA 1TC3C 2X0LA 1FTTA 1FJLA 2ZMEC 2E1MB 2DA5A 4XONA 3WE3A 3VPRA 3S93A 4DJAA 5FKKA 2JRTA 1WJBA 2F5FA 1DP3A 4QTRA 3EETA 3D5LA 4ZZDA 2K3PA 3KYCB 4FETA 2HVRA 1Z6RA 5GP9A 4DNCA 4DIQA 3CTAA 4BGDA 3MD2A 4WWCA 1VQ8I 2VBWA 3RZDJ 3VYRB 2EBIA 4BHPA 2MC3A 1SFUA 4XN3A 1ETKA 4G7OF 4G12A 3V42A 3IH3A 2KKOA 3K4MA 4CXFA 4HNTA 4BDYA 3E1SA 5CLSA 2ZJQF 4HPQA 1GVJA 5FD6A 4A2UA 3FKJA 1WJAA 3FXLA 1FYMA 2HXOA 2W48A 1IUYA 3F21A 1WJFA 4RBOA 1U78A 4PJLA 3FXMA 2X1EA 2F2EA 3M4OJ 4XORA 2ZFUA 2MFZA 1FT9A 2M5WA 2AS5F 4NBQA 5BPIA 3CMAI 4H0EA 1IN7A 3G73A 3H1CA 2JQ7A 2OAZA 1RKTA 3RKQA 5ICGA 3U1DA 3ML6A 4G8XA 2WAFA 4XMYA 3HM5A 3J7ZI 3HOZJ 1QNTA 2K9LA 1VQLI 3CLQA 2JUGA 2DO7A 2PBIA 2L01A 3F6OA 5J3LA 5M3MJ 4Y7NJ 1FMVA 2X1DA 3GWZA 3ERED 4P96A 3QAHA 2TDXA 4WF2A 2EH3A 2DFIA 2VKHA 3BG6A 3VYTB 5IYBJ 2O3FA 1I27A 1STZA 4A3KJ 1WFXA 2K86A 3JRHA 4EJWA 1FC3A 1MDMB 4C2MJ 2KFDA 3CF2A 3ZR8X 1IRFA 3PUFA 4MHGA 2NYXA 3K9TA 1NG7A 2L9NA 4HLXA 3HZJA 4ZYDA 4OU0A 3BR6A 3V7RA 2H94A 1E0EA 3RYPA 2QA4I 5CQGA 3HOVJ 5EZGA 1R6RA 4ENJA 4IJAA 1YRNB 4OIPF 1X3UA 3QWLA 4XKVA 2L4AA 1V5FA 1IN4A 2VJ5A 1BR2A 4BBSJ 3B02A 1TWGJ 2QBYA 1ONVA 3UKGA 5K7ZA 1Q1VA 4FX0A 5F27A 3L2WA 1OFCX 4EJOA 4IHXA 4ZZLA 4LG3A 2KZVA 1YJNI 2QEXI 1BBYA 2DBBA 3OOUA 2G0EA 1DU0A 4UVAA 5EG0B 1FYKA 1G6NA 3CCMI 5D5XB 4CYDA 1LB2A 1ZRDA 4M73A 1I6XA 3JCUC 3CUQC 2OBPA 2VKEA 1D0YA 4HW0A 1X2MA 2VB6A 2QYOA 2VC0A 2CO5A 1D0XA 2NS0A 3BTJA 4UHTA 2LBFA 4OWRB 3KEOA 2VBZA 5FLXK 3OR1C 1WRJA 5BNGA 5B3SH 4KDPA 2W4SA 1VQPI 5TRDA 2DMUA 3HRMA 4KIGA 2M8EA 3GF2A 3H3ZA 3PSFA 2YSRA 3AFHA 1K79A 5LHGA 4BUPA 4CZZA 4B44A 3KZYA 1QZZA 1LDJA 2HS5A 3H5AA 5C4JJ 3RKYA 2ZJPF 1Z77A 2V6EA 2WV0A 1LFBA 3H0DA 1FBSA 1KYWA 4UVCA 1V5GA 5J8CA 3VSLA 3O8GA 2HVQA 2VXZA 3GTQJ 2EQRA 1XGSA 1ZRFA 1MW7A 3DTKA 3K69A 3OYIA 2JPCA 3OY9A 4XRFA 1Y6IA 2LKSA 4KT6A 2DW4A 1FP1D 3K0LA 2L7MP 3NQOA 2DU9A 3QU6A 2DT7B 2H8RA 4PZJA 2VASA 4A3CJ 3NAUA 1OJLA 4HDVA 2GZWA 3DXJF 1JXSA 4E7HA 2AXLA 4LG0B 4RB2C 1T33A 4S04A 4OIQF 1D0ZA 3JRCA 2QM3A 2L0KA 4NUBA 2E2HJ 4YG2F 3M9AA 5L3FA 3HBLA 2K40A 4BDZA 3K6GA 1F36A 3PJRA 2J5OA 5TGTA 5D5VB 5GAHJ 1VQ7I 2ME6A 5CPRB 2LY1A 2V1XA 5FROA 5FLXZ 1IJWC 3R4KA 2MG4A 4MFEA 5FFXA 2KPMA 4IHSA 4EVIA 1R9TJ 2XDVA 1JHHA 2L02A 4B1RA 3E0JB 4J00A 3I0TA 3F3XA 1ETQA 2E35A 3KX2A 5ICCA 3OYGA 3K4KA 3DEUA 2HI3A 2ELKA 1YW9A 1BL0A 4GCVA 1WHUA 2IS4A 2EZLA 2VL8A 1CQTA 1ZQ3P 1IF1A 4IOCF 1G59A 2K02A 5E3OA 1SD4A 1OISA 1R5ID 1Z6TA 2RC4A 4IO9F 3M3YJ 3TP3A 3SFZA 4KT5C 1OLTA 1ETYA 2IA1A 3K1PA 3CESA 3CCLI 3SFIA 1OYYA 2CU7A 1R1UA 1OYIA 3HHHA 3PL8A 1XTAA 2K3FA 3C2HA 5TJJA 2HDWA 4GYGA 2LKPA 4ZTJA 4KN7X 2JPBA 3H36A 4Q4ZF 4PJ0C 1B72B 4W97A 1W0TA 1TQPA 3WHBA 5EDNA 2ESNA 1ETXA 1W5TA 3HGGA 3PNYA 4R79A 1U5TB 4ABZA 2LNBA 3L1PA 3PO3J 5CVJA 5CJ9A 3W6KB 2HTSA 5F1JA 2DK8A 1HLVA 3CUOA 2NOJB 2I8DA 1R1TA 2KT0A 3H5RA 4L9NA 5EEGA 3R6SA 5GAEJ 1S8NA 4U7BA 1HXDA 1MDMA 3HRTA 3BR3A 5J4YA 3VDXA 4A3MJ 4J01A 3JAMK 3OYHA 3ABTA 3HTUA 1W5SA 2BY2A 5CVVA 1SC7A 1JJ8C 5JR3A 1GT0C 3I53A 3ECHA 2DJNA 3VYUB 4G7ZF 3QODA 4HSTA 1P4WA 4HBLA 2DA7A 2MA3A 2M45A 1YRNA 1YO5C 3TEDA 5K7HA 1XMKA 1GV2A 5DCFA 3H9JA 1K6OA 3T1BA 1CGPA 1LNWA 1A04A 3BR0A 4N4NB 4Y4RA 4GRIA 3MCZA 2XRLA 3HG9A 3ZN1A 1W4MA 1G3YA 1AWCA 4BHBA 4CGZA 5J4VA 2H1KA 2R7VA 3ZPLA 4Y3OA 3I54A 1DUXC 3G1OA 4L9TA 4XKWA 4Z2YA 5EG0A 4B43A 2CG4A 3S2WA 3LQRA 1MH4A 5ICFA 2R7ZJ 5B1BH 2ECBA 4ON0A 4BNCA 2MD5A 1R00A 2JWTA 5H2FC 4J19A 3A2KA 2PMUA 4WX9A 1G3WA 2FX0A 3DF8A 1H9GA 1WVRA 2GA1A 1T8IA 4XLFA 4EM1A 3HKZN 3G1LA 3NWSA 4V2FA 2CV1A 3V8KA 2GA2A 2AQEA 1MD0A 1IO2A 1SMTA 3KP2A 2NOGA 3FK6A 1Z3YA 2EZIA 5ICEA 3VB2A 3S14J 3B6CA 3BOQA 1BOAA 2Z5UA 5KK1A 3COAC 3IC7A 3FDYA 1QQIA 2STTA 3Q9VA 3QPTA 2CV2A 3J80K 1NK3P 3HYIA 2ETHA 2HZDA 4JX6A 1FOKA 4BQOA 4G94A 3JAMZ 3LSHA 3Q3SA 2KDOA 3BCAA 1IXCA 4M3BA 3VYSB 1JI8A 3KZZA 1H0MA 5IP9J 4AVZA 4CA0A 3SQNA 4O5VA 4I76A 1XGOA 3FBIB 1Z21A 2IBDA 2XAJA 1WI9A 5L3EA 2MYSA 2D1HA 1DGRM 1VQKI 2AXTC 2R7RA 2ZNYA 4CHUA 4FT8A 3M07A 2LRDA 1U3EM 5B5EC 1S3JA 4NC8A 1HW5A 4RLFA 2X9DA 4U87A 2VBYA 1RUNA 1XD7A 2ZMEB 2ACJA 3OSFA 5JLXA 2R7XA 2X1CA 2DT6A 2VI6A 3RDIA 5IT9K 4AUXA 2H1LA 1ZELA 2F5DA 2X6WA 1MIJA 1FWZA 3VSKA 3SXYA 2FNPA 4LG0A 3R0JA 2CUEA 2XKOA 3PQJA 3ZQQA 3S16J 1BI3A 2OPTA 4AYBN 3DPTA 3HC7A 1QPIA 1OCCH 2HQNA 4UB8C 4EGZA 1WCMJ 4X6AJ 2V79A 4BACA 2JA5J 2AQFA 1HDPA 1PJRA 1Y8QB 3LWFA 4X1EA 4F91B 3HOTA 1HQCA 3RIRA 5LGUA 4HYEA 2H27A 1S6LA 3OYDA 4P1WA 3WHCA 1T2KA 4E7ZA 3M8JA 2ID6A 2K27A 2IJLA 3LMMA 4DQ2A 4BH9A 1WH5A 2ZB9A 4DBQA 2KRHA 2LOOA 4C3IJ 4FCYA 2UUZA 3GW2A 1BI1A 3GX4X 3N4MA 2VODA 1OMIA 1YG2A 4LITA 5LD2C 1ZRCA 3TO6A 4Y52J 3J80Z 3LOCA 2KIMA 4IRGA 1ZGJA 3FKIJ 5FKOA 2JRMA 4NQWB 1BI0A 1BW5A 4ZDPA 1R7JA 2HPIA 3FXKA 3BPVA 4E7IA 5DM6F 1BOBA 2NVTJ 2JUCA 2QWWA 3BZCA 1R4MB 5M5YJ 4BEHB 2RAEA 2FMLA 1HOMA 3I4PA 2W00A 1X1AA 4CUGA 4XRSA 5IY5H 2LC2A 1RR7A 4JX4A 3QP6A 4D5FA 3GBGA 2VT3A 3IP4B 1B72A 2EFPA 1I3QJ 3DLLF 1U5TA 4A6EA 5IT9Z 2I10A 1LKXA 2IGNA 2DTRA 2VJJA 4WCGA 1E3PA 3P9CA 1MH3A 3I58A 3LSPA 2HR3A 4XLAA 5C44J 3TP0A 2VIXA 4CCOA 2LD5A 4BJ5C 5K5QA 1IG7A 4BHCA 3GFMA 1JGSA 1MSEC 4M3EA 3A03A 4XKBA 4XLPF 3V4GA 2P7VB 2QQ9A 4IZZA 2IT0A 2E71A 1V5EA 2F4MB 4DZPA 1E17A 2RNGA 4RB0A 3ECOA 4L5IA 1ZN2A 1ODDA 3ZQ7A 1X1CA 4LGWA 2QLZA 2WADA 1NH3A 3VOEA 4FTHA 3K4NA 4YELA 2HQ5A 3M8FA 1T0FC 2F48A 3S32A 4IQ4A 4G6DA 3CP2A 1BR1A 1T08B 5DTDA 1J2XA 4A6DA 1LEAA 2EB7A 2CUJA 3ZMUA 3CUQB 2OUMA 2K85A 3FWEA 1N75A 1BA5A 5ILVA 1J7KA 3RQIA 1UFMA 3X2QH 2CQNA 5K7FA 5HS9A 3GZNB 2XAFA 1HW1A 2ZJ2A 4EM2A 1C0WA 4I0AA 3T8TA 1JGGA 2K7LA 4HQMA 1W0UA 2WB1N 5FJ8J 1BJZA 3ONQA 2ESHA 1LFUP 1R4NB 2V26A 3L09A 4BL0B 4C3HJ 3IV5A 3CCQI 1J0RA 2NNYA 4AD9A 2JSCA 2GLOA 3BCBA 4GO1A 2EIJH 3GVAA 2L7FP 2OCEA 4D0PA 4DW6A 1ZKGA 2YUSA 4HLYA 1E3OC 3REOA 5B1AH 4F93B 2A6HF 2MLGA 4NC6A 3A0BC 2PMHA 1ZR2A 2LLKA 2VOOA 2EA4A 2LDUA 4A5NA 3JRBA 1XGMA 3H0GJ 1VQ5I 1PDNC 1QGPA 4AM3A 3KP6A 1QO0D 2RDPA 4XM3A 2HNHA 3RPUA 4MTDA 4MQVA 2HPMA 2BYVE 1AKHB 1XCBA 2B0LA 1I5ZA 1OKRA 2O5RA 3A01B 2LF7A 3OWTA 2DQRA 1FNNA 1S7EA 1YJ9I 1IZ1A 3TOBA 3W2WA 3D5SC 2EJRA 1YI2I 2NVYJ 2MH2A 4C2UA 2ZKZA 5HVQC 1ON1A 1BJAA 1XB4A 2Y48A 4II3A 2JTVA 2L9RA 1VFCA 1V55H 2VLAA 4IHYA 4UUVA 1RRJA 2BZTA 4KICA 1XSDA 1EF4A 1AOYA 1SVOA 4YRVA 1XSXA 2XVCA 4HOBA 5HDKA 3J7AO 1AU7A 2OQGA 1F9NA 3H3VK 1QZYA 1GDTA 4ZC3A 3RQ4A 3F22A 3GLXA 4NDLA 2ZMEA 3BROA 4PCQA 1USTA 1Z1DA 1MJ9A 4LB5A 3BQZA 1OYWA 1XMXA 1K4TA 1BIAA 3HPHA 3WTYC 4BS9A 2Z2SB 4ENNA 4QSHA 1OCTC 5EEAA 1SANA 3V8LA 2HYJA 1FEXA 2PQ8A 1ZR4A 2LSOA 1FOXA 5J47A 1VQOI 2R7QA 4GYIA 3SJMA 2R4GA 2FUG2 1P7IA 1DU6A 1F1ZA 2AO9A 1RZ4A 1YW8A 2MGQA 4AWXB 3OSGA 2L7ZA 2LFBA 1FZPB 3CC2I 1LEBA 2VXDA 3GTJJ 4EJTA 2ICWG 4Q48A 3ZQCA 2FBIA 4XQFA 3ZXSA 3IRRA 3Q5FA 2PMZA 2WV1A 4AIHA 2P0WA 3ZGKA 4CO8A 1MBHA 1G2HA 2WAQN 4HRIA 3BDDA 2GXGA 2RNJA 1YITI 4UVBA 1RKWA 1T95A 4ANJA 3PNTA 1Y8RB 2HZTA 3BR1A 3QOEA 1WJ5A 5J1YA 4NQWA 3OYEA 3FBNB 2WY8Q 2X6YA 2B9SA 3F6VA 1MNMC 2R93J 2RVCA 1KA8A 3E5QA 3S8PA 3KYDB 1QU3A 4FE7A 1OR7C 2XC7A 1S9HA 2VJ4A 4BEHA 1P4XA 1L3LA 3ZRGA 4BJTA 3GUDA 2M87A 3MKLA 1WH7A 1HSTA 2HQAA 3ABKH 1UG0A 2DXIA 1R5GA 1OCRH 3BJ6A 1ETOA 4F7ZA 5JI6A 1EH7A 2H6BA 4L9JA 2HOSA 1J59A 3H9GA 1YS7A 3LSGA 2BY1A 2HEOA 4BXUA 3KPHA 3HOSA 2ADUA 3PFIA 2R7SA 2MH9A 3S3OA 5DV5A 2VKVA 1UHWA 2JA6J 3IUOA 3ABUA 2XUBA 5L3CA 3CJTB 2DA6A 1YOVB 5CVUA 2F6CA 2EV6A 2BXYA 4KNYA 2Z9OA 1B1BA 4NB5A 2BV6A 2ZXIA 2FD5A 2W82A 1SD6A 3ZMSA 5AIQA 4XOPA 3UNGC 1VI0A 1ZLKA 2PJRB 2CRGA 3CLOA 3LSJA 5EF6A 2PMZN
chains in the Genus database with same CATH topology
2EIJH 5IY5H 1OCZH 2DYRH 2EIMH 3ABLH 1OCCH 2DYSH 3ASOH 5B1AH 3AG4H 5B3SH 3X2QH 1V55H 5B1BH 3AG1H 2OCCH 3WG7H 2ZXWH 1V54H 3ABKH 2Y69H 1OCRH 2EINH 2EIKH 2EILH 1OCOH 3AG2H 3ABMH 3ASNH 3AG3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIJ H;  5IY5 H;  1OCZ H;  2DYR H;  2EIM H;  3ABL H;  1OCC H;  2DYS H;  3ASO H;  5B1A H;  3AG4 H;  5B3S H;  3X2Q H;  1V55 H;  5B1B H;  3AG1 H;  2OCC H;  3WG7 H;  2ZXW H;  1V54 H;  3ABK H;  2Y69 H;  1OCR H;  2EIN H;  2EIK H;  2EIL H;  1OCO H;  3AG2 H;  3ABM H;  3ASN H;  3AG3 H; 
#chains in the Genus database with same CATH topology
 4A93 J;  4XR6 A;  1A31 A;  3CCV I;  3DTE A;  1F4K A;  3H9Q A;  1WWX A;  1RPW A;  1KQ0 A;  5HNH A;  2O6G E;  2QSG X;  3O3K A;  1Q1H A;  1Y0N A;  3BQY A;  3IH4 A;  2DA3 A;  1G4D A;  1D1C A;  2UWM A;  1X1D A;  3CUQ A;  3FIS A;  1PYV A;  1TL8 A;  3MKY B;  3ZQI A;  3CCY A;  5GPA A;  2GIV A;  4LK0 F;  1MJB A;  4R1H A;  3JRE A;  4A3G J;  1FOW A;  5HNF A;  2DYR H;  2OQR A;  1KU2 A;  2LG4 A;  2HOT A;  1WKM A;  4ITV A;  5KVR A;  1D8J A;  2LKX A;  1TLH B;  3DBH B;  1APL C;  1H9T A;  2P4W A;  3WTW C;  3MEX A;  1A35 A;  3ZP5 A;  4HV5 A;  2MC4 A;  3DQV C;  3FIW A;  4AVP A;  1FBQ A;  3WU0 A;  3HGY A;  2CJJ A;  2LR8 A;  3E7L A;  4ZDL A;  3TDZ C;  2I5U A;  4L18 B;  1ACI A;  3K4B A;  1UHS A;  3ZQH A;  4L0Z B;  4PDK A;  2CUZ A;  3AG2 H;  1AHD P;  4PJJ A;  5CQE A;  1XG1 A;  2M1B A;  2Y31 A;  4LB6 B;  3OS0 A;  2O8K A;  3CJR B;  1K7A A;  1AKH A;  3A01 A;  2ECC A;  2ZFW A;  1MBJ A;  2GOX B;  3CO7 C;  3GTK J;  4B48 A;  4UUT A;  4KIS A;  2P81 A;  2VPR A;  3SEZ A;  5FRN A;  3CCR I;  2F4I A;  4YIR X;  3RYR A;  3I9V 2;  4KYW A;  1JHF A;  2KIS A;  2CW8 A;  4BAY A;  1VND A;  3S1R J;  2IGM A;  3W2V A;  4N9I A;  4ETS A;  4RAG A;  4U0Y A;  4HDU A;  2FQ4 A;  2M0C A;  3IH2 A;  2M34 A;  1UJ8 A;  4RLQ A;  1HDD C;  2JJ7 A;  5IPA A;  3JRD A;  5EEH A;  1LPQ A;  4D5C A;  4YFN F;  1MZB A;  1X4O A;  3MN2 A;  3EPZ A;  2R3S A;  5FKM A;  4B3X A;  2ELH A;  1R1V A;  5E18 F;  4HX7 A;  4HG2 A;  4BU2 A;  5LGT A;  5BMZ A;  1XPX A;  2VC1 A;  4A3I J;  4XOT A;  4UNO A;  5JHU A;  2D1V A;  3A4C A;  3G6E I;  1H89 C;  3VFZ A;  2KL4 A;  3ABM H;  3FK7 A;  3VWB A;  2EWN A;  2A3S A;  4HX4 A;  5BOX A;  4F55 A;  1EA3 A;  1X3W B;  3U2R A;  1B9N A;  2IPQ X;  1CF7 B;  1ITY A;  2M4G A;  2YX7 A;  5F6F A;  2XAS A;  3DKY A;  3PSI A;  4PFO A;  3BZK A;  3ZMV A;  2L7K A;  1VTN C;  2QF7 A;  3RKX A;  3ZQG A;  3KZI C;  1FTZ A;  3HUG B;  1FBU A;  4CIC A;  3TW7 A;  4II2 A;  1USS A;  1O3T A;  1IDZ A;  2W84 A;  3DU5 A;  2NS8 A;  2Y2Z A;  2MAB A;  4EMS A;  4RB3 C;  3BJA A;  1FMW A;  3JTG A;  1S5L C;  1JUP A;  3I71 A;  3D5R C;  4C9Y A;  1MND A;  4EAT A;  1T6S A;  3HKZ A;  4DOZ A;  2E1O A;  1K4S A;  2E7X A;  2XGD A;  1XDU A;  1IUF A;  2IGO A;  2Y75 A;  3TDU C;  1L0O C;  3FXU A;  2P8T A;  4RB1 A;  1QPM A;  2FJ1 A;  1U0J A;  4UY8 I;  1YHQ I;  3PUB A;  4RM3 A;  1XX5 A;  2EFW A;  3CMY A;  2O7O A;  2Y69 H;  2CH0 A;  1OCP A;  2GBY A;  1NK2 P;  2V6C A;  5E1Z B;  5IYD J;  1MMA A;  2BVM A;  3HRS A;  2XSD C;  3RSN A;  5HLI A;  2DMN A;  4CYC B;  2P6T A;  2CW0 F;  4M74 A;  2IXS A;  2QKL B;  2BY0 A;  1GXQ A;  4E7K A;  1U9N A;  3ZOB A;  2QEN A;  4A69 C;  3I59 B;  1TQI A;  3DKX A;  4Y15 A;  3PFY A;  1ZRE A;  5HOD A;  3PNV A;  2UXX A;  1J5Y A;  2Q1Z B;  4PGG A;  1TQM A;  3KE2 A;  4MLO A;  3LFU A;  3N05 A;  2YX4 A;  3K1M A;  4MTE A;  1POG A;  3ZQL A;  4KFC A;  1MJA A;  2VON A;  4UXN A;  1GHC A;  1HKS A;  3HSR A;  4PUS A;  4UV8 A;  5F0F A;  3FX3 A;  2ZJR F;  3ZMD A;  3DPL C;  4IHT A;  3Q0W A;  4HF2 A;  4GFB A;  4HA8 A;  5ED4 A;  1D3Y A;  1Z7U A;  3S1N J;  3V7C A;  3WGH A;  1W5C C;  5BS6 A;  1E2X A;  1HKQ A;  3JW4 A;  3DU6 A;  1P92 A;  2DPD A;  5H6Q A;  1W7P B;  4AYB A;  2PJR A;  1XC5 A;  1HW2 A;  4CZC A;  2H6C A;  3I56 I;  1YW7 A;  2EK5 A;  2K9S A;  4EGY A;  2P7C B;  1I1G A;  2EV0 A;  3EUA A;  1U6G A;  4H4K C;  5A2Q K;  2E1N A;  2V1N A;  4N4O B;  4RGR A;  1MMN A;  3HL2 A;  2H8W A;  3IRQ A;  2GQQ A;  3F8F A;  2V9K A;  4MFD A;  3WTU C;  5D5U B;  5DS9 A;  1TT5 B;  2M7B A;  1ZK8 A;  4QWQ A;  5HOO A;  4TV7 A;  1E3H A;  1FPQ A;  3D1N I;  2DOD A;  1Y1W J;  2OD5 A;  1ZAO A;  2J5P A;  2M0M A;  3QQA A;  3OL4 A;  3I3L A;  3QPS A;  2LH9 A;  2A5W A;  5L3G A;  4BBR J;  4UUS B;  1FYL A;  1X2N A;  2JSP A;  4RDU A;  3E5X A;  2P5V A;  1B9M A;  4MGR A;  2XAU A;  2RRE A;  3LFK A;  1W7P D;  4E7J A;  3GTG J;  2EIK H;  1G3T A;  3F8N A;  1J9I A;  3SYT A;  1Z9C A;  2FSW A;  3O8H A;  4KIF A;  3MAJ A;  2KMU A;  2R7W A;  3GFI A;  3WTS C;  1QHH D;  4DYC A;  3E6M A;  4LD5 A;  4BXF A;  3ABL H;  3K4L A;  2L3D A;  1XCV A;  3PM1 A;  3BG5 A;  1RI7 A;  2VPL A;  3DWL E;  2WBM A;  3CDL A;  5LLQ A;  3WOD F;  4RS8 A;  1HBX G;  5CYV A;  4HQE A;  1YX5 A;  1O7L A;  5FGM A;  4G9Y A;  3C1D A;  3BG9 A;  2OU2 A;  3CCU I;  2QUF A;  3CQZ J;  5J8F A;  1TW2 A;  2PFB A;  2XRN A;  3C2G A;  2A07 F;  4S05 A;  4IXA A;  4OMZ A;  2NNN A;  3CZ6 A;  2FBH A;  5GPC A;  2QZ8 A;  5DCM B;  4EJU A;  1BC8 C;  1XN7 A;  3NWT A;  1J75 A;  2DOE A;  4IRH A;  1MNE A;  4RAY A;  1REP C;  1UEL B;  2VOP A;  3F23 A;  4LLG F;  3GTM J;  2C6Y A;  2NVQ J;  2DN0 A;  1IRX A;  3BR5 A;  3D0S A;  2XV4 S;  3KFW X;  4XLE A;  4Y17 A;  5A2Q Z;  1ON2 A;  5JVG F;  1JE8 A;  2HYF A;  2A05 A;  2V9V A;  4ENM A;  3WGI A;  4E6K G;  1H88 C;  3OIQ A;  2L9V A;  1PP8 F;  4OAY A;  1SFO J;  1J09 A;  2XIG A;  4BE0 A;  2R7F A;  2X85 A;  2VQG A;  1Z7L A;  3H3U A;  1ZH5 A;  2JA7 J;  4A0X A;  1XDS A;  1IV6 A;  1Z67 A;  2DOF A;  2KJC A;  3HEF A;  4MO7 A;  1GV5 A;  3GZ6 A;  3LNQ A;  4HZF A;  4XBF A;  5K5O A;  2CGP A;  5M5W J;  2XGC A;  3U9G A;  2HKX A;  3WU2 C;  1T39 A;  3TW6 A;  2K5C A;  4F92 B;  4MIM A;  1VQ9 I;  2M7A A;  3ELK A;  3AG1 H;  1U9O A;  4XID A;  1PUE E;  3WG7 H;  2OZU A;  3HPG A;  3I4N J;  3S2D J;  4QLC U;  2XF6 A;  4D1Q A;  1CF7 A;  5DM7 F;  2VN2 A;  1TBX A;  4I01 A;  2CQK A;  2K4B A;  5EJC A;  4DZJ A;  2ISY A;  3G4S I;  3S1Q J;  3SZG A;  2WB1 A;  2IW5 A;  3ISP A;  3DBL B;  3F0C A;  2W85 A;  3WE2 A;  1FY7 A;  3FMQ A;  1X1B A;  3OOP A;  3CME I;  3HUG A;  2RKH A;  2ZNZ A;  3WTV C;  2K4J A;  1UZC A;  2EV5 A;  2F5V A;  2HDD A;  1TZL A;  1O3R A;  4AIK A;  2EPF A;  3OYM A;  1R58 A;  2JVG A;  2JMW A;  3P9K A;  2DDB A;  4HSR A;  4WXH A;  1R71 A;  4FHT A;  3R60 A;  4NHJ A;  2JVH A;  4I99 C;  3BR2 A;  3T8R A;  4CCN A;  1KU7 A;  4NC7 A;  4OIR F;  3EDP A;  1MKM A;  3W2A A;  1VF9 A;  2G7U A;  1I6H J;  3OIO A;  4FIS A;  2GAU A;  3CCJ I;  3OS1 A;  2IVM A;  2LRE A;  1VZ0 A;  1YYV A;  1P6R A;  4M9X A;  3HRU A;  5TIS C;  1DPU A;  4CYC A;  4UV9 A;  5F0H A;  2M8G X;  4JYK A;  4ESF A;  3KIO A;  4NNJ A;  2EFQ A;  1MMG A;  1SFK A;  3RPQ A;  3I59 A;  3S17 J;  3BWG A;  3BTL A;  2D5V A;  3G2B A;  5LRR A;  2M2E A;  2XPU A;  3S3M A;  5HS7 A;  4I0B A;  4CDG A;  1K61 A;  3FZV A;  4MQ9 F;  1KON A;  3GCM A;  1QVU A;  5LEJ A;  2IA2 A;  2NAZ A;  3P5J A;  2MLK A;  3HHG A;  3DP7 A;  2UV1 A;  3OMY A;  3C3W A;  3F9K A;  1MBG A;  4L9V A;  3LA2 A;  3AG4 H;  2LMD A;  5E3M A;  3FXO A;  4GXO A;  1WZ2 A;  3LSM A;  4KIB A;  1WGX A;  4C30 A;  1T0F A;  3IWF A;  2ZO4 A;  4CCJ A;  3Q0U A;  1X58 A;  1PUF B;  2UZK A;  3IWZ A;  3BTC A;  3K70 C;  3BJO A;  3M7G A;  1W7P A;  1KQ8 A;  5GTH C;  2W24 A;  5HS8 A;  3K2Z A;  2G9W A;  4U0V A;  1TTY A;  3AG3 H;  3CO6 C;  3PQK A;  2ME0 A;  1GUU A;  2M4K A;  2QQA A;  3FMR A;  5H20 A;  3K7A J;  2QKM B;  2ZXJ A;  3VEP A;  2OTL I;  3E6D A;  1R49 A;  1GLN A;  4XIC A;  4KN4 X;  2TRT A;  3SZP A;  2DQL A;  3LAJ A;  3FXJ A;  3I55 I;  2DPU A;  1V3F A;  2DOA A;  2MBF A;  1T98 A;  3IKV A;  3TKY A;  2WAQ A;  4JOM A;  3J7A Y;  2HGC A;  3EUH C;  2RN7 A;  4M6X A;  2XRO A;  4EEF G;  3I4M J;  1FLI A;  2RGV A;  4HNU A;  4UUS A;  2R5Y B;  2KIU A;  3HOY J;  2FOK A;  2HVS A;  4YII A;  5CKT A;  4I6Z A;  4ZH4 F;  3ASO H;  2P5K A;  4M71 A;  5D6E A;  2OA4 A;  3NRV A;  2HU9 A;  3VOD A;  2M3A A;  2XGE A;  3G71 I;  1Y0U A;  3C2B A;  3F8B A;  4PK4 A;  1WQ2 A;  5IOY A;  2DMT A;  2XPV A;  4E4H A;  2VUM J;  1ZLJ A;  5LFA A;  3CD6 I;  1K83 J;  4BQQ A;  4IX7 A;  4P55 A;  4BE2 A;  2BBY A;  2W57 A;  5HLT A;  2FQ3 A;  3V7S A;  3OYA A;  3CP8 A;  4PSX A;  3OR2 C;  2ZXH A;  4A3F J;  2CWE A;  1XMA A;  5E79 C;  2HQR A;  5AON A;  2ELJ A;  1QA6 A;  1B6A A;  3KLN A;  4XSX F;  1P4A A;  1D1B A;  4N0B A;  5CVI A;  4V19 K;  1VQN I;  2WY7 Q;  5DCM A;  3JR9 A;  5E8G A;  2EZH A;  5E1W A;  2IEK A;  1O57 A;  2P6S A;  5E8I A;  3BG3 A;  2OJE D;  3L2V A;  1U8R A;  2JT1 A;  3TQN A;  3GTP J;  3PO2 J;  3ASN H;  4WXD A;  1IV8 A;  1Z0X A;  3F72 A;  1IRZ A;  2V1D A;  2FRH A;  3GLL A;  1RC9 A;  1I50 J;  4UB6 C;  5FB2 A;  2VJI A;  3G1M A;  5IYC J;  1IXR C;  2EFO A;  5DYM A;  2PI0 A;  4M6Y A;  4PFP A;  2G7H A;  2DFF A;  2Q2E B;  2R7O A;  4XN0 A;  1A36 A;  2IA0 A;  4XLC A;  3CMM A;  5IP7 J;  2CFO A;  2R5Z B;  3KP4 A;  2E7W A;  5E1X A;  5L3D A;  1QZE A;  1LDD A;  2CFX A;  2ZBK A;  1TNT A;  1S7O A;  2XHK A;  4I7H A;  3P7N A;  1RET A;  2V1U A;  5ERI A;  3IAM 2;  2L4M A;  5J6X A;  1QHG A;  5DD8 A;  3QP5 A;  5FO5 A;  4L5J A;  2DT5 A;  2FU4 A;  2DA1 A;  3TMO A;  2GXB A;  1ZG3 A;  4GGG A;  2FA5 A;  1TWH J;  3CC7 I;  3H92 A;  2X48 A;  5IOZ A;  1IXS B;  2WWY A;  4LLN A;  3KEY A;  1MBF A;  1PVE A;  1U8B A;  3GME A;  1O4X A;  3MFK A;  3H35 A;  1IGN A;  2KRF A;  3O2P E;  4G6T B;  5EGO B;  1T56 A;  2HOE A;  2MW8 A;  4S0H B;  3OYJ A;  4RAF A;  3WG9 A;  3OYC A;  4RGX A;  1JT6 A;  5JFR A;  2PJP A;  1OR7 A;  4B8X A;  1EJ9 A;  4P9F A;  3ERM A;  2BXZ A;  4M72 A;  4R8H A;  1TP4 A;  4FX4 A;  5JHF A;  2HDC A;  2PEX A;  3FXQ A;  2XPW A;  3QOP A;  4LK1 F;  4BY1 J;  2KIQ A;  3QRF F;  1W36 C;  5D8L B;  1H8A C;  5D5W B;  5LHI A;  3L2Q A;  3TL4 X;  3BLY A;  3C7J A;  5E17 F;  4IOA F;  2L54 A;  2DLL A;  2HFH A;  2CYY A;  1UB9 A;  4IVN A;  4LIU A;  2O61 A;  2RV8 A;  4P9U A;  1OQY A;  4O3M A;  2KP6 A;  1FOY A;  2XAG A;  1BR4 A;  1YQA A;  1W1W E;  1M1E B;  1EKE A;  4HAM A;  3QYF A;  2KHM A;  2YS9 A;  3A0H C;  1YE9 A;  3KYL A;  1B8I B;  3JTH A;  4FE4 A;  4OMY A;  4ZDO A;  4E7S A;  1ZGA A;  2LF8 A;  1UHM A;  4IF4 A;  2O9L A;  1V4R A;  2QQB A;  3FXR A;  1LQ1 A;  2OCC H;  1SMY F;  4FQG A;  5FFZ A;  2EZK A;  2X4H A;  2IRF G;  2QCO A;  2FOW A;  3ULQ B;  4A12 A;  3ZCO A;  5JLW A;  3HOX J;  1JUS A;  3FHN A;  2YR2 A;  3FM5 A;  2Z99 A;  3GFJ A;  3AL0 C;  4IQJ A;  2V7F A;  5J1U A;  4KA4 A;  2DI3 A;  1VQ4 I;  4XK4 A;  2HOA A;  1JKQ C;  2COM A;  1D1A A;  1PUF A;  1SFX A;  2PN6 A;  1YTY A;  4CCL A;  4B47 A;  3WTT C;  1FP2 A;  3MVP A;  4RA2 A;  2K9Q A;  4ZYG A;  2WC2 A;  4JX5 A;  1SAX A;  1MGT A;  1TWC J;  3Q0V A;  3C18 A;  3K4J A;  4BJ6 C;  4MEY F;  2BW3 B;  1EV7 A;  5HDN A;  2DMQ A;  3I64 A;  5FLV A;  3TO9 A;  1EH6 A;  1TWA J;  2COB A;  5DUI A;  1N25 A;  3HOU J;  1X1P A;  2A6E F;  1TWF J;  2F4O B;  3ZMZ A;  3IKT A;  1UG2 A;  1KU9 A;  2A6T A;  1JKP C;  4WK8 F;  4M9S A;  3MKW B;  2UXN A;  2EIM H;  5F64 A;  5FKN A;  4A0Y A;  3BP8 A;  1UCR A;  1WI3 A;  4G6Q A;  2E60 A;  3KEQ A;  3L9F A;  1LE8 B;  2R5Y A;  2Q0O A;  1TT0 A;  1S7A A;  2YU3 A;  3UR3 C;  5M5X J;  3QPL A;  5B66 C;  1KZH A;  1ZHF A;  2WA0 A;  3QU3 A;  1F43 A;  3GEZ A;  2FE3 A;  2XKP A;  2KIF A;  2VQH A;  2Y0M A;  4QPQ A;  4BKX A;  3JRF A;  2CSO A;  5K5R A;  1YIJ I;  2EFN A;  4XL9 A;  4LLL A;  1DQU A;  2Y9Z A;  2E1M C;  2FEZ A;  1K6Y A;  1P9Q C;  3MMY B;  2Y0S A;  2WTE A;  4DYR A;  5BPD A;  5GTI C;  2CMP A;  1G3S A;  2VT2 A;  1SEU A;  3GTL J;  2M9H A;  2FXA A;  5F04 A;  1SVM A;  1V54 H;  2B63 J;  1UMQ A;  3RZO J;  5AIP A;  2DK5 A;  1RR8 C;  1FSE A;  2EIL H;  2HWV A;  2DA2 A;  2QQ8 A;  1GXP A;  1Z05 A;  3OV8 A;  3CJN A;  4M6V A;  1LVK A;  4HF0 A;  1IDY A;  4MEX F;  2E34 A;  2LYC A;  3BG7 A;  2D45 A;  2X51 A;  2Z1D A;  1ZAR A;  3EQL F;  2GIZ A;  4LFU A;  2FF4 A;  1IN6 A;  2KDZ A;  2BGC A;  3GTO J;  1N77 A;  3TOA A;  2EA2 A;  3HJE A;  2E5N A;  4AU7 A;  1IW7 F;  3JSP A;  1TNS A;  5D4S A;  1O3Q A;  5LHH A;  2XB5 A;  2JK3 A;  4RGS A;  3R61 A;  3T5X A;  1HKT A;  3S3N A;  2ZSI B;  2PLY A;  1XGN A;  2D2W A;  2LP0 A;  2Q2E A;  1RNL A;  2RQP A;  2BEO A;  1RIO H;  2CQ7 A;  1BM9 A;  4B3A A;  3WTX C;  3OYL A;  4HV6 A;  3SZT A;  2R5Z A;  4ZJZ A;  3HIF A;  3DBR B;  3PIO F;  1YX3 A;  1N78 A;  5FRM A;  4CSW A;  4HF1 A;  4L0Y B;  4A3E J;  2A5Y B;  3HSE A;  4Y33 A;  4ESB A;  4ZYE A;  1B59 A;  2IAI A;  2L2O A;  5KAI C;  4FAS D;  1I3A A;  4PGH A;  5FKL A;  2LY2 A;  1KGS A;  1O7F A;  3CDI A;  3ZMT A;  1KU3 A;  3B6A A;  1RES A;  3HXL A;  4N9H A;  4Y13 A;  3M1C A;  3J7Y J;  1TW3 A;  2BHY A;  2DDA A;  2FBK A;  1ERD A;  3DLA A;  4LOC A;  2ZXW H;  2B7E A;  4OIO F;  4KUM A;  2X6O A;  2FMY A;  3LST A;  1FIP A;  5LRS A;  1OCO H;  4G7H F;  3MKZ A;  3G3Z A;  1XS9 A;  1IC8 A;  3CC4 I;  1FIA A;  2Y0S N;  5C3E J;  2P5L C;  4BQA A;  1Y1V J;  2K9M A;  5ILS A;  5EGO A;  2WAE A;  2OC6 A;  3MZ8 A;  3TO7 A;  3I5U A;  1HCR A;  2E2J J;  1WJC A;  2XF7 A;  2O0Y A;  1R22 A;  5L3B A;  1JTY A;  4A3B J;  3IHU A;  3LQQ A;  2E2I J;  3BY6 A;  4U7D A;  3LSK A;  4IPA A;  4ENK A;  5EYR A;  5IP6 A;  2IP2 A;  3GO5 A;  1I1S A;  1P7J A;  3ROU A;  1YIO A;  2FNA A;  2OF7 A;  3LSR A;  2TCT A;  4IHW A;  2Y9Y A;  1ZTR A;  4KJZ A;  3AAF A;  4WXC A;  2LY9 A;  5E3L A;  1Z3X A;  4B09 A;  5E3N A;  4GDF A;  4AID A;  2CUF A;  3E6C C;  3S2H J;  3KCC A;  4YIF A;  2R7D A;  3TGN A;  5DEQ A;  1QRY A;  5F0C A;  3DCF A;  2F5C A;  4I2O A;  2XF5 A;  3LA3 A;  4YFK F;  2DYS H;  1ORK A;  1HC8 A;  5HDG A;  2O8X A;  5LBQ A;  2BE5 F;  5F08 A;  4B4C A;  4IRI A;  1K78 B;  2GWR A;  4Q5S F;  2HKO A;  2QSH X;  5J40 A;  5GAD J;  1YFH A;  1ENH A;  2XAH A;  1B8I A;  3U1K A;  3OYB A;  4KMU X;  3F8C A;  3CCS I;  4IHV A;  3RI4 A;  2JA2 A;  2BOL A;  3E6B A;  4A3L J;  4XSZ F;  1JUM A;  5LGN A;  2VE9 A;  2XAQ A;  5FLM J;  1BW6 A;  3EYY A;  3QYB A;  2E5Z A;  1SFE A;  3E5U A;  3S15 J;  2A69 F;  3U21 A;  3ZQF A;  4U0W A;  4A0Z A;  3FM3 A;  4JK1 X;  4F52 A;  2NRA C;  3K1N A;  1G8X A;  5HLG A;  4EM0 B;  1IN8 A;  5D4R A;  4DGW B;  4HEA 2;  5GAG J;  3PIP F;  3GXO A;  4OOI A;  4HX8 A;  3A02 A;  3CJQ B;  1X4P A;  3MQ0 A;  1IAW A;  4P5O A;  1WJE A;  2A61 A;  5D8K B;  1LDK B;  4ESJ A;  2NVU B;  3BC8 A;  1OCZ H;  4DYQ A;  2BW3 A;  2BHZ A;  1ZG1 A;  3L7W A;  2DJI A;  4I98 B;  3W3C A;  4ZYH A;  2W25 A;  3WTZ A;  1A5J A;  4LMY A;  4I09 A;  4YEJ A;  3K70 D;  1HA8 A;  5DUK A;  2ZCW A;  1DP7 P;  4BXX J;  1O3S A;  1EH8 A;  2VKD A;  1MBE A;  2OTJ I;  2GOM A;  3OYN A;  3L00 A;  4BYY A;  6PAX A;  2K9N A;  2V4J C;  2JZY A;  2YPR A;  3M8E A;  1LE8 A;  1BI2 A;  3DEE A;  3ESW B;  2L5Q A;  1DDN A;  2R92 J;  2Y30 A;  2CV0 A;  3GZ5 A;  3JRG A;  3E97 A;  5H6R A;  4IL6 C;  5DD4 A;  1Y56 A;  2F5E A;  4AC0 A;  3QYE A;  3LA7 A;  1VQ6 I;  5KNL A;  1LUJ B;  1U2W A;  2HXI A;  3RPU D;  3KP3 A;  3RCO A;  4BY7 J;  1JT0 A;  1S29 A;  2EIN H;  2BVL A;  4W1U A;  3CDH A;  4XKC A;  4RMN A;  1AA7 A;  2IGK A;  2JN6 A;  3JRA A;  1R36 A;  2OZ6 A;  2NS7 A;  2MD0 A;  5M3F J;  4M3G A;  4DBR A;  4I02 A;  3OYK A;  3DKW A;  4M3D A;  2NVX J;  2CQX A;  3W6J B;  2R0Q C;  4RM2 A;  2KRC A;  2Z16 A;  1LJ9 A;  1ULY A;  2DMP A;  3T0Y A;  3L2U A;  1HSJ A;  3HTS B;  3FF5 A;  3K2A A;  4XRM A;  2VQL A;  2STW A;  1WSU A;  2QSF X;  5K1Y A;  4BQN A;  5F1R A;  1XSV A;  4IKF A;  1ZYR F;  4PJM A;  1ETV A;  3KP7 A;  3P9I A;  4A5M A;  3OIP A;  5ILU A;  3LAP A;  2IS1 A;  1B4A A;  1WPK A;  4CCK A;  2XGX A;  1QVT A;  3W6V A;  2IS2 A;  3OL3 A;  1NG6 A;  5FD5 A;  3SEQ A;  3B73 A;  1FX7 A;  4QPO A;  4QIW N;  3CCE I;  4PJN A;  1D5Y A;  1JJ6 C;  3H5N A;  2VQC A;  1X19 A;  2DAO A;  1P2F A;  4XRS G;  4CCM A;  3AKZ A;  5CVR A;  4OIN F;  4CH7 A;  9ANT A;  5E20 A;  4K2E A;  4C2T A;  2GM4 A;  1Y39 A;  3RKW A;  4L5E A;  1GVD A;  2LK2 A;  2L9S A;  3KP5 A;  4YFX F;  4D7M A;  2N8G A;  4LJZ F;  3J81 K;  2VBX A;  4IEJ A;  1R5H A;  3DTI A;  1RUO A;  1MSF C;  1BIB A;  3JSO A;  1WJD A;  1MMD A;  4E7L A;  1U5T C;  3TBI A;  1KQ9 A;  1X3Z B;  2CQQ A;  2HYG D;  3BZ6 A;  3RJP A;  4D7N A;  5HLH A;  4EJV A;  2E1C A;  3WGG A;  3RTR A;  3MZH A;  5C4X J;  3QPH A;  2DFE A;  3L2R A;  3BT9 A;  4X0G A;  3GYH X;  3SDG A;  3S1M J;  3GFL A;  4XLN F;  2JA8 J;  3K10 A;  2PX9 A;  2E19 A;  1ETW A;  3K4C A;  2M30 A;  3LL7 A;  3OS2 A;  1VQM I;  1A6Q A;  2ZC2 A;  3HB9 A;  4Q47 A;  2IS6 A;  3NEU A;  3WU1 B;  2X6X A;  5KHD A;  4XNF A;  2QBY B;  2W1O A;  1SD5 A;  3IAS 2;  4A3J J;  3DPU A;  3EUK L;  1YS6 A;  4JQF A;  4ZYA A;  4EQQ A;  1NHA A;  3EYI A;  4RAZ A;  2DCE A;  2BY3 A;  4O6J A;  3LSI A;  1D5V A;  2Z3Y A;  4MNU A;  1BN5 A;  3DFG A;  3V8J A;  3BPX A;  4JBA A;  2PG4 A;  3JRI A;  1FSH A;  2ISZ A;  1JKR C;  4XLH A;  3MZY A;  1D8K A;  2E36 A;  2R7T A;  5KAF C;  3R0A A;  1IRG A;  1BC7 C;  3SDB A;  1IN5 A;  1OPC A;  2RQQ A;  1R23 A;  3IL2 A;  5EZH A;  1NTC A;  4M3F A;  4ZTF A;  3HOW J;  1A6I A;  3N97 A;  3BTI A;  4F3Q A;  2LBF B;  2Z33 A;  2R7U A;  1MBK A;  3CF5 F;  2ZSH B;  1SD7 A;  1K78 A;  1W36 D;  2H09 A;  4A3D J;  5LEK A;  3E3V A;  3DEW A;  3AL0 B;  3M1E A;  5KCM A;  3FHZ A;  3ZN0 A;  2OV7 A;  4HNV A;  2KJB A;  1UAA A;  1ZG5 A;  3HDD A;  2KZG A;  3DV8 A;  2V9P A;  4EV0 A;  3J81 Z;  3NAR A;  4C3J J;  3KLO A;  1I39 A;  4AIJ A;  2ID3 A;  4BE1 A;  1MMS A;  3SHF A;  1QBJ A;  5JVT A;  2YU9 J;  2LVS A;  5J1R A;  1DGW Y;  2XSJ C;  3HSF A;  4M9Z A;  2DTZ A;  2QVO A;  1JTX A;  3MWM A;  2NXN B;  1YLF A;  2QGU A;  1S72 I;  4KIT B;  5DDG A;  1JKO C;  3KET A;  2Q8K A;  1SAU A;  2GXA A;  4V2G A;  3A1Y A;  3Q9S A;  1F5T A;  2A68 F;  3O6B B;  5D6F A;  4RGU A;  2DA4 A;  4ASN A;  3OYF A;  1DPR A;  2HTJ A;  1YJW I;  2MSY A;  2DFH A;  2O03 A;  4JP0 A;  3EUH A;  2W7N A;  5BQT A;  2LTP A;  2CS3 A;  4OAZ A;  2AHQ A;  4PSW A;  2CW7 A;  1T38 A;  4LIV A;  1LFP A;  5IT3 A;  1PP7 U;  4E70 A;  3F8M A;  4Z6Y A;  4D9J A;  4KMF A;  2XB0 X;  1ZGW A;  2KQR A;  2VE8 A;  4U88 A;  3L2C A;  1LVA A;  2KLO A;  3FMS A;  1SVL A;  1HF0 A;  1Z91 A;  1KYZ A;  1TC3 C;  2X0L A;  1FTT A;  1FJL A;  2ZME C;  2E1M B;  2DA5 A;  4XON A;  3WE3 A;  3VPR A;  3S93 A;  4DJA A;  5FKK A;  2JRT A;  1WJB A;  2F5F A;  1DP3 A;  4QTR A;  3EET A;  3D5L A;  4ZZD A;  2K3P A;  3KYC B;  4FET A;  2HVR A;  1Z6R A;  5GP9 A;  4DNC A;  4DIQ A;  3CTA A;  4BGD A;  3MD2 A;  4WWC A;  1VQ8 I;  2VBW A;  3RZD J;  3VYR B;  2EBI A;  4BHP A;  2MC3 A;  1SFU A;  4XN3 A;  1ETK A;  4G7O F;  4G12 A;  3V42 A;  3IH3 A;  2KKO A;  3K4M A;  4CXF A;  4HNT A;  4BDY A;  3E1S A;  5CLS A;  2ZJQ F;  4HPQ A;  1GVJ A;  5FD6 A;  4A2U A;  3FKJ A;  1WJA A;  3FXL A;  1FYM A;  2HXO A;  2W48 A;  1IUY A;  3F21 A;  1WJF A;  4RBO A;  1U78 A;  4PJL A;  3FXM A;  2X1E A;  2F2E A;  3M4O J;  4XOR A;  2ZFU A;  2MFZ A;  1FT9 A;  2M5W A;  2AS5 F;  4NBQ A;  5BPI A;  3CMA I;  4H0E A;  1IN7 A;  3G73 A;  3H1C A;  2JQ7 A;  2OAZ A;  1RKT A;  3RKQ A;  5ICG A;  3U1D A;  3ML6 A;  4G8X A;  2WAF A;  4XMY A;  3HM5 A;  3J7Z I;  3HOZ J;  1QNT A;  2K9L A;  1VQL I;  3CLQ A;  2JUG A;  2DO7 A;  2PBI A;  2L01 A;  3F6O A;  5J3L A;  5M3M J;  4Y7N J;  1FMV A;  2X1D A;  3GWZ A;  3ERE D;  4P96 A;  3QAH A;  2TDX A;  4WF2 A;  2EH3 A;  2DFI A;  2VKH A;  3BG6 A;  3VYT B;  5IYB J;  2O3F A;  1I27 A;  1STZ A;  4A3K J;  1WFX A;  2K86 A;  3JRH A;  4EJW A;  1FC3 A;  1MDM B;  4C2M J;  2KFD A;  3CF2 A;  3ZR8 X;  1IRF A;  3PUF A;  4MHG A;  2NYX A;  3K9T A;  1NG7 A;  2L9N A;  4HLX A;  3HZJ A;  4ZYD A;  4OU0 A;  3BR6 A;  3V7R A;  2H94 A;  1E0E A;  3RYP A;  2QA4 I;  5CQG A;  3HOV J;  5EZG A;  1R6R A;  4ENJ A;  4IJA A;  1YRN B;  4OIP F;  1X3U A;  3QWL A;  4XKV A;  2L4A A;  1V5F A;  1IN4 A;  2VJ5 A;  1BR2 A;  4BBS J;  3B02 A;  1TWG J;  2QBY A;  1ONV A;  3UKG A;  5K7Z A;  1Q1V A;  4FX0 A;  5F27 A;  3L2W A;  1OFC X;  4EJO A;  4IHX A;  4ZZL A;  4LG3 A;  2KZV A;  1YJN I;  2QEX I;  1BBY A;  2DBB A;  3OOU A;  2G0E A;  1DU0 A;  4UVA A;  5EG0 B;  1FYK A;  1G6N A;  3CCM I;  5D5X B;  4CYD A;  1LB2 A;  1ZRD A;  4M73 A;  1I6X A;  3JCU C;  3CUQ C;  2OBP A;  2VKE A;  1D0Y A;  4HW0 A;  1X2M A;  2VB6 A;  2QYO A;  2VC0 A;  2CO5 A;  1D0X A;  2NS0 A;  3BTJ A;  4UHT A;  2LBF A;  4OWR B;  3KEO A;  2VBZ A;  5FLX K;  3OR1 C;  1WRJ A;  5BNG A;  5B3S H;  4KDP A;  2W4S A;  1VQP I;  5TRD A;  2DMU A;  3HRM A;  4KIG A;  2M8E A;  3GF2 A;  3H3Z A;  3PSF A;  2YSR A;  3AFH A;  1K79 A;  5LHG A;  4BUP A;  4CZZ A;  4B44 A;  3KZY A;  1QZZ A;  1LDJ A;  2HS5 A;  3H5A A;  5C4J J;  3RKY A;  2ZJP F;  1Z77 A;  2V6E A;  2WV0 A;  1LFB A;  3H0D A;  1FBS A;  1KYW A;  4UVC A;  1V5G A;  5J8C A;  3VSL A;  3O8G A;  2HVQ A;  2VXZ A;  3GTQ J;  2EQR A;  1XGS A;  1ZRF A;  1MW7 A;  3DTK A;  3K69 A;  3OYI A;  2JPC A;  3OY9 A;  4XRF A;  1Y6I A;  2LKS A;  4KT6 A;  2DW4 A;  1FP1 D;  3K0L A;  2L7M P;  3NQO A;  2DU9 A;  3QU6 A;  2DT7 B;  2H8R A;  4PZJ A;  2VAS A;  4A3C J;  3NAU A;  1OJL A;  4HDV A;  2GZW A;  3DXJ F;  1JXS A;  4E7H A;  2AXL A;  4LG0 B;  4RB2 C;  1T33 A;  4S04 A;  4OIQ F;  1D0Z A;  3JRC A;  2QM3 A;  2L0K A;  4NUB A;  2E2H J;  4YG2 F;  3M9A A;  5L3F A;  3HBL A;  2K40 A;  4BDZ A;  3K6G A;  1F36 A;  3PJR A;  2J5O A;  5TGT A;  5D5V B;  5GAH J;  1VQ7 I;  2ME6 A;  5CPR B;  2LY1 A;  2V1X A;  5FRO A;  5FLX Z;  1IJW C;  3R4K A;  2MG4 A;  4MFE A;  5FFX A;  2KPM A;  4IHS A;  4EVI A;  1R9T J;  2XDV A;  1JHH A;  2L02 A;  4B1R A;  3E0J B;  4J00 A;  3I0T A;  3F3X A;  1ETQ A;  2E35 A;  3KX2 A;  5ICC A;  3OYG A;  3K4K A;  3DEU A;  2HI3 A;  2ELK A;  1YW9 A;  1BL0 A;  4GCV A;  1WHU A;  2IS4 A;  2EZL A;  2VL8 A;  1CQT A;  1ZQ3 P;  1IF1 A;  4IOC F;  1G59 A;  2K02 A;  5E3O A;  1SD4 A;  1OIS A;  1R5I D;  1Z6T A;  2RC4 A;  4IO9 F;  3M3Y J;  3TP3 A;  3SFZ A;  4KT5 C;  1OLT A;  1ETY A;  2IA1 A;  3K1P A;  3CES A;  3CCL I;  3SFI A;  1OYY A;  2CU7 A;  1R1U A;  1OYI A;  3HHH A;  3PL8 A;  1XTA A;  2K3F A;  3C2H A;  5TJJ A;  2HDW A;  4GYG A;  2LKP A;  4ZTJ A;  4KN7 X;  2JPB A;  3H36 A;  4Q4Z F;  4PJ0 C;  1B72 B;  4W97 A;  1W0T A;  1TQP A;  3WHB A;  5EDN A;  2ESN A;  1ETX A;  1W5T A;  3HGG A;  3PNY A;  4R79 A;  1U5T B;  4ABZ A;  2LNB A;  3L1P A;  3PO3 J;  5CVJ A;  5CJ9 A;  3W6K B;  2HTS A;  5F1J A;  2DK8 A;  1HLV A;  3CUO A;  2NOJ B;  2I8D A;  1R1T A;  2KT0 A;  3H5R A;  4L9N A;  5EEG A;  3R6S A;  5GAE J;  1S8N A;  4U7B A;  1HXD A;  1MDM A;  3HRT A;  3BR3 A;  5J4Y A;  3VDX A;  4A3M J;  4J01 A;  3JAM K;  3OYH A;  3ABT A;  3HTU A;  1W5S A;  2BY2 A;  5CVV A;  1SC7 A;  1JJ8 C;  5JR3 A;  1GT0 C;  3I53 A;  3ECH A;  2DJN A;  3VYU B;  4G7Z F;  3QOD A;  4HST A;  1P4W A;  4HBL A;  2DA7 A;  2MA3 A;  2M45 A;  1YRN A;  1YO5 C;  3TED A;  5K7H A;  1XMK A;  1GV2 A;  5DCF A;  3H9J A;  1K6O A;  3T1B A;  1CGP A;  1LNW A;  1A04 A;  3BR0 A;  4N4N B;  4Y4R A;  4GRI A;  3MCZ A;  2XRL A;  3HG9 A;  3ZN1 A;  1W4M A;  1G3Y A;  1AWC A;  4BHB A;  4CGZ A;  5J4V A;  2H1K A;  2R7V A;  3ZPL A;  4Y3O A;  3I54 A;  1DUX C;  3G1O A;  4L9T A;  4XKW A;  4Z2Y A;  5EG0 A;  4B43 A;  2CG4 A;  3S2W A;  3LQR A;  1MH4 A;  5ICF A;  2R7Z J;  5B1B H;  2ECB A;  4ON0 A;  4BNC A;  2MD5 A;  1R00 A;  2JWT A;  5H2F C;  4J19 A;  3A2K A;  2PMU A;  4WX9 A;  1G3W A;  2FX0 A;  3DF8 A;  1H9G A;  1WVR A;  2GA1 A;  1T8I A;  4XLF A;  4EM1 A;  3HKZ N;  3G1L A;  3NWS A;  4V2F A;  2CV1 A;  3V8K A;  2GA2 A;  2AQE A;  1MD0 A;  1IO2 A;  1SMT A;  3KP2 A;  2NOG A;  3FK6 A;  1Z3Y A;  2EZI A;  5ICE A;  3VB2 A;  3S14 J;  3B6C A;  3BOQ A;  1BOA A;  2Z5U A;  5KK1 A;  3COA C;  3IC7 A;  3FDY A;  1QQI A;  2STT A;  3Q9V A;  3QPT A;  2CV2 A;  3J80 K;  1NK3 P;  3HYI A;  2ETH A;  2HZD A;  4JX6 A;  1FOK A;  4BQO A;  4G94 A;  3JAM Z;  3LSH A;  3Q3S A;  2KDO A;  3BCA A;  1IXC A;  4M3B A;  3VYS B;  1JI8 A;  3KZZ A;  1H0M A;  5IP9 J;  4AVZ A;  4CA0 A;  3SQN A;  4O5V A;  4I76 A;  1XGO A;  3FBI B;  1Z21 A;  2IBD A;  2XAJ A;  1WI9 A;  5L3E A;  2MYS A;  2D1H A;  1DGR M;  1VQK I;  2AXT C;  2R7R A;  2ZNY A;  4CHU A;  4FT8 A;  3M07 A;  2LRD A;  1U3E M;  5B5E C;  1S3J A;  4NC8 A;  1HW5 A;  4RLF A;  2X9D A;  4U87 A;  2VBY A;  1RUN A;  1XD7 A;  2ZME B;  2ACJ A;  3OSF A;  5JLX A;  2R7X A;  2X1C A;  2DT6 A;  2VI6 A;  3RDI A;  5IT9 K;  4AUX A;  2H1L A;  1ZEL A;  2F5D A;  2X6W A;  1MIJ A;  1FWZ A;  3VSK A;  3SXY A;  2FNP A;  4LG0 A;  3R0J A;  2CUE A;  2XKO A;  3PQJ A;  3ZQQ A;  3S16 J;  1BI3 A;  2OPT A;  4AYB N;  3DPT A;  3HC7 A;  1QPI A;  1OCC H;  2HQN A;  4UB8 C;  4EGZ A;  1WCM J;  4X6A J;  2V79 A;  4BAC A;  2JA5 J;  2AQF A;  1HDP A;  1PJR A;  1Y8Q B;  3LWF A;  4X1E A;  4F91 B;  3HOT A;  1HQC A;  3RIR A;  5LGU A;  4HYE A;  2H27 A;  1S6L A;  3OYD A;  4P1W A;  3WHC A;  1T2K A;  4E7Z A;  3M8J A;  2ID6 A;  2K27 A;  2IJL A;  3LMM A;  4DQ2 A;  4BH9 A;  1WH5 A;  2ZB9 A;  4DBQ A;  2KRH A;  2LOO A;  4C3I J;  4FCY A;  2UUZ A;  3GW2 A;  1BI1 A;  3GX4 X;  3N4M A;  2VOD A;  1OMI A;  1YG2 A;  4LIT A;  5LD2 C;  1ZRC A;  3TO6 A;  4Y52 J;  3J80 Z;  3LOC A;  2KIM A;  4IRG A;  1ZGJ A;  3FKI J;  5FKO A;  2JRM A;  4NQW B;  1BI0 A;  1BW5 A;  4ZDP A;  1R7J A;  2HPI A;  3FXK A;  3BPV A;  4E7I A;  5DM6 F;  1BOB A;  2NVT J;  2JUC A;  2QWW A;  3BZC A;  1R4M B;  5M5Y J;  4BEH B;  2RAE A;  2FML A;  1HOM A;  3I4P A;  2W00 A;  1X1A A;  4CUG A;  4XRS A;  5IY5 H;  2LC2 A;  1RR7 A;  4JX4 A;  3QP6 A;  4D5F A;  3GBG A;  2VT3 A;  3IP4 B;  1B72 A;  2EFP A;  1I3Q J;  3DLL F;  1U5T A;  4A6E A;  5IT9 Z;  2I10 A;  1LKX A;  2IGN A;  2DTR A;  2VJJ A;  4WCG A;  1E3P A;  3P9C A;  1MH3 A;  3I58 A;  3LSP A;  2HR3 A;  4XLA A;  5C44 J;  3TP0 A;  2VIX A;  4CCO A;  2LD5 A;  4BJ5 C;  5K5Q A;  1IG7 A;  4BHC A;  3GFM A;  1JGS A;  1MSE C;  4M3E A;  3A03 A;  4XKB A;  4XLP F;  3V4G A;  2P7V B;  2QQ9 A;  4IZZ A;  2IT0 A;  2E71 A;  1V5E A;  2F4M B;  4DZP A;  1E17 A;  2RNG A;  4RB0 A;  3ECO A;  4L5I A;  1ZN2 A;  1ODD A;  3ZQ7 A;  1X1C A;  4LGW A;  2QLZ A;  2WAD A;  1NH3 A;  3VOE A;  4FTH A;  3K4N A;  4YEL A;  2HQ5 A;  3M8F A;  1T0F C;  2F48 A;  3S32 A;  4IQ4 A;  4G6D A;  3CP2 A;  1BR1 A;  1T08 B;  5DTD A;  1J2X A;  4A6D A;  1LEA A;  2EB7 A;  2CUJ A;  3ZMU A;  3CUQ B;  2OUM A;  2K85 A;  3FWE A;  1N75 A;  1BA5 A;  5ILV A;  1J7K A;  3RQI A;  1UFM A;  3X2Q H;  2CQN A;  5K7F A;  5HS9 A;  3GZN B;  2XAF A;  1HW1 A;  2ZJ2 A;  4EM2 A;  1C0W A;  4I0A A;  3T8T A;  1JGG A;  2K7L A;  4HQM A;  1W0U A;  2WB1 N;  5FJ8 J;  1BJZ A;  3ONQ A;  2ESH A;  1LFU P;  1R4N B;  2V26 A;  3L09 A;  4BL0 B;  4C3H J;  3IV5 A;  3CCQ I;  1J0R A;  2NNY A;  4AD9 A;  2JSC A;  2GLO A;  3BCB A;  4GO1 A;  2EIJ H;  3GVA A;  2L7F P;  2OCE A;  4D0P A;  4DW6 A;  1ZKG A;  2YUS A;  4HLY A;  1E3O C;  3REO A;  5B1A H;  4F93 B;  2A6H F;  2MLG A;  4NC6 A;  3A0B C;  2PMH A;  1ZR2 A;  2LLK A;  2VOO A;  2EA4 A;  2LDU A;  4A5N A;  3JRB A;  1XGM A;  3H0G J;  1VQ5 I;  1PDN C;  1QGP A;  4AM3 A;  3KP6 A;  1QO0 D;  2RDP A;  4XM3 A;  2HNH A;  3RPU A;  4MTD A;  4MQV A;  2HPM A;  2BYV E;  1AKH B;  1XCB A;  2B0L A;  1I5Z A;  1OKR A;  2O5R A;  3A01 B;  2LF7 A;  3OWT A;  2DQR A;  1FNN A;  1S7E A;  1YJ9 I;  1IZ1 A;  3TOB A;  3W2W A;  3D5S C;  2EJR A;  1YI2 I;  2NVY J;  2MH2 A;  4C2U A;  2ZKZ A;  5HVQ C;  1ON1 A;  1BJA A;  1XB4 A;  2Y48 A;  4II3 A;  2JTV A;  2L9R A;  1VFC A;  1V55 H;  2VLA A;  4IHY A;  4UUV A;  1RRJ A;  2BZT A;  4KIC A;  1XSD A;  1EF4 A;  1AOY A;  1SVO A;  4YRV A;  1XSX A;  2XVC A;  4HOB A;  5HDK A;  3J7A O;  1AU7 A;  2OQG A;  1F9N A;  3H3V K;  1QZY A;  1GDT A;  4ZC3 A;  3RQ4 A;  3F22 A;  3GLX A;  4NDL A;  2ZME A;  3BRO A;  4PCQ A;  1UST A;  1Z1D A;  1MJ9 A;  4LB5 A;  3BQZ A;  1OYW A;  1XMX A;  1K4T A;  1BIA A;  3HPH A;  3WTY C;  4BS9 A;  2Z2S B;  4ENN A;  4QSH A;  1OCT C;  5EEA A;  1SAN A;  3V8L A;  2HYJ A;  1FEX A;  2PQ8 A;  1ZR4 A;  2LSO A;  1FOX A;  5J47 A;  1VQO I;  2R7Q A;  4GYI A;  3SJM A;  2R4G A;  2FUG 2;  1P7I A;  1DU6 A;  1F1Z A;  2AO9 A;  1RZ4 A;  1YW8 A;  2MGQ A;  4AWX B;  3OSG A;  2L7Z A;  2LFB A;  1FZP B;  3CC2 I;  1LEB A;  2VXD A;  3GTJ J;  4EJT A;  2ICW G;  4Q48 A;  3ZQC A;  2FBI A;  4XQF A;  3ZXS A;  3IRR A;  3Q5F A;  2PMZ A;  2WV1 A;  4AIH A;  2P0W A;  3ZGK A;  4CO8 A;  1MBH A;  1G2H A;  2WAQ N;  4HRI A;  3BDD A;  2GXG A;  2RNJ A;  1YIT I;  4UVB A;  1RKW A;  1T95 A;  4ANJ A;  3PNT A;  1Y8R B;  2HZT A;  3BR1 A;  3QOE A;  1WJ5 A;  5J1Y A;  4NQW A;  3OYE A;  3FBN B;  2WY8 Q;  2X6Y A;  2B9S A;  3F6V A;  1MNM C;  2R93 J;  2RVC A;  1KA8 A;  3E5Q A;  3S8P A;  3KYD B;  1QU3 A;  4FE7 A;  1OR7 C;  2XC7 A;  1S9H A;  2VJ4 A;  4BEH A;  1P4X A;  1L3L A;  3ZRG A;  4BJT A;  3GUD A;  2M87 A;  3MKL A;  1WH7 A;  1HST A;  2HQA A;  3ABK H;  1UG0 A;  2DXI A;  1R5G A;  1OCR H;  3BJ6 A;  1ETO A;  4F7Z A;  5JI6 A;  1EH7 A;  2H6B A;  4L9J A;  2HOS A;  1J59 A;  3H9G A;  1YS7 A;  3LSG A;  2BY1 A;  2HEO A;  4BXU A;  3KPH A;  3HOS A;  2ADU A;  3PFI A;  2R7S A;  2MH9 A;  3S3O A;  5DV5 A;  2VKV A;  1UHW A;  2JA6 J;  3IUO A;  3ABU A;  2XUB A;  5L3C A;  3CJT B;  2DA6 A;  1YOV B;  5CVU A;  2F6C A;  2EV6 A;  2BXY A;  4KNY A;  2Z9O A;  1B1B A;  4NB5 A;  2BV6 A;  2ZXI A;  2FD5 A;  2W82 A;  1SD6 A;  3ZMS A;  5AIQ A;  4XOP A;  3UNG C;  1VI0 A;  1ZLK A;  2PJR B;  2CRG A;  3CLO A;  3LSJ A;  5EF6 A;  2PMZ N; 
#chains in the Genus database with same CATH homology
 2EIJ H;  5IY5 H;  1OCZ H;  2DYR H;  2EIM H;  3ABL H;  1OCC H;  2DYS H;  3ASO H;  5B1A H;  3AG4 H;  5B3S H;  3X2Q H;  1V55 H;  5B1B H;  3AG1 H;  2OCC H;  3WG7 H;  2ZXW H;  1V54 H;  3ABK H;  2Y69 H;  1OCR H;  2EIN H;  2EIK H;  2EIL H;  1OCO H;  3AG2 H;  3ABM H;  3ASN H;  3AG3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...