3ABMH

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3abmH00
3ASOH 3ABLH 2ZXWH 2EINH 5B3SH 1OCCH 3AG3H 3WG7H 3ABMH 5B1AH 3AG1H 3AG4H 5IY5H 3X2QH 2EIKH 2EILH 1OCRH 2DYRH 2EIMH 2Y69H 1V55H 2OCCH 2EIJH 1V54H 3ABKH 1OCOH 2DYSH 5B1BH 3ASNH 3AG2H 1OCZH
chains in the Genus database with same CATH superfamily
1HSTA 4CA0A 4UUVA 2L9VA 4ENKA 1WJCA 3O8GA 4BJ6C 2EFQA 2V6CA 5DCMA 3OYBA 1WJAA 4M73A 3CMMA 1S8NA 4BY1J 1X2NA 4D1QA 1TWCJ 3BJOA 1QO0D 1BW6A 2ZSIB 4I76A 3QP5A 4RGRA 5IT3A 5D4RA 2OV7A 4EVIA 4U0VA 2XF6A 2CQNA 1D8KA 3IKVA 2V4JC 3I64A 3TP0A 3GWZA 5FRMA 2HZDA 1X4OA 3JRCA 5IOYA 5FLVA 2QF7A 3VYUB 2MLKA 2VBXA 2OQGA 5EEGA 2CUEA 3U9GA 2VBYA 3GF2A 1N25A 4PJLA 3DEEA 3MCZA 3S2DJ 2XIGA 4M74A 2LH9A 1AWCA 4PJJA 4L9NA 1D1CA 4F92B 2FBKA 4AU7A 5KHDA 2L7MP 1HKTA 3PFIA 1MBEA 2KT0A 2Q2EB 4CUGA 3RJPA 5CVRA 4HF2A 3R4KA 4RA2A 3W2WA 4BJTA 1WSUA 3N4MA 1Y1WJ 3QP6A 5IYDJ 5LGTA 3U1DA 3EDPA 4HNUA 1Z9CA 1EKEA 2P4WA 4JBAA 1KYWA 3R60A 3TO7A 3MZ8A 2MLGA 1I3QJ 1SAXA 3A03A 1V5EA 2VODA 2ELHA 1Z6TA 4DOZA 3CCUI 4IQJA 4RM3A 3ASNH 1IF1A 3QU3A 1ACIA 3MZYA 1OPCA 2FUG2 4RLFA 2Z9OA 4ITVA 3GLXA 1EH7A 5H20A 5D5VB 2CQQA 2FJ1A 3TMOA 4MEXF 2MG4A 1RNLA 2HQRA 1R00A 2O5RA 1W5TA 1E17A 3DBHB 1WFXA 3G1LA 4M3BA 1O3TA 3GTOJ 1W7PD 3RTRA 2Q1ZB 5K5OA 1OR7C 5EEHA 3QWLA 3ZQHA 2DYSH 4D9JA 1O3RA 1OCZH 2QBYB 2RGVA 2R7QA 2DMNA 2UV1A 1T0FA 5FGMA 1RKTA 1FP2A 2R5YB 2HXIA 4MQVA 5D5WB 4XK4A 1O3QA 1XSXA 3BR6A 3RPUD 2QSGX 2YSRA 2ECBA 5IYCJ 1ZRFA 4QWQA 2Y31A 4NQWB 3WG9A 4A3LJ 1SMYF 4RGSA 4B47A 4RB3C 1I6HJ 2LY1A 2ID6A 4L5IA 4IHVA 1BI3A 3ZPLA 3H3VK 2WY8Q 1HC8A 3KYCB 2I10A 3OS0A 3EETA 4A3BJ 2FXAA 2H27A 1P4XA 3DKYA 3PUFA 4RB0A 4ZDPA 1KU7A 3ZMTA 1P7IA 2D1VA 4A5MA 4EGYA 3P5JA 2VC1A 4OWRB 2KLOA 5H2FC 3CC2I 1MH3A 1YIJI 4LOCA 1JUSA 1O57A 4K2EA 4D5CA 2D5VA 3MKWB 2IPQX 2WAQN 2HEOA 2Y0SA 5EDNA 1BOAA 4Z2YA 3GEZA 1PP7U 2ZC2A 3CUQC 1ZLJA 2A6EF 2Z2SB 1EA3A 2PEXA 3REOA 1X1DA 3JAMZ 3QRFF 4NHJA 2OQRA 4FHTA 2FA5A 1L3LA 4HYEA 4KIFA 1UZCA 2KP6A 4HZFA 2LKSA 1P4WA 5B1AH 2ZKZA 3SDGA 1EF4A 1Z21A 2DO7A 3BQYA 1ETXA 3CC7I 3WTZA 1V4RA 5KK1A 1EH8A 2ELJA 2H94A 1UCRA 4U0YA 1BI0A 1XGOA 4IRHA 4XIDA 2PG4A 3BQZA 1XDSA 2CW7A 3P9IA 1ITYA 3TBIA 3TQNA 2BY0A 5M5YJ 2QKLB 3LSMA 2OA4A 3KP6A 3F8MA 2N8GA 1IDYA 3Q5FA 4EMSA 2ZSHB 1ODDA 2VC0A 2XRNA 2O8XA 3H5AA 4CH7A 4BS9A 4IHSA 4ZDOA 1ERDA 4P9UA 4AYBN 3JSPA 4BXUA 3LSTA 5GPAA 1H0MA 1IV6A 4A3KJ 3GTJJ 3FKIJ 4B43A 4LLLA 3CF5F 3I5UA 2VJIA 3U21A 1IDZA 1AHDP 1HKSA 3TDUC 2QQBA 5LRRA 2YU3A 3CJRB 2DA4A 3MD2A 2KQRA 3ZQQA 4WF2A 3OWTA 2K85A 1YLFA 1FSEA 4ANJA 4LD5A 4E7KA 2LF8A 4A3GJ 3M8EA 2Q8KA 1J2XA 2EZKA 1T6SA 3I58A 3P7NA 3ELKA 4U0WA 4CZZA 3IAM2 3J7ZI 2M5WA 1PDNC 3KETA 4PZJA 3BZ6A 3U1KA 3AG1H 5ICEA 1B4AA 1MKMA 2VQGA 1F43A 4LIVA 1X1BA 3VSLA 3R61A 3K69A 3CLOA 3LFUA 4IHXA 1JT0A 3MKLA 4L5EA 3H0DA 2I8DA 1WH7A 4MIMA 4KT5C 2W48A 1JHFA 3FISA 3BTIA 3E3VA 4JYKA 2ZJRF 2DPUA 2O0YA 2HYJA 5JHUA 1OCCH 1FBSA 3WG7H 5LHGA 4NB5A 1GXQA 1JE8A 3HM5A 1VNDA 4BHCA 1N78A 3M9AA 4IXAA 2RREA 5J40A 1R4NB 2NS0A 2NXNB 2K02A 5AONA 5BNGA 4XOTA 2UXNA 3C2BA 3F6VA 3B6AA 1RI7A 3EUKL 3TW6A 1FC3A 2JRTA 3J80Z 4UUTA 2XAHA 4OAYA 2HOTA 3JAMK 4QPQA 1VQ5I 2W4SA 2ZO4A 2DMUA 2G9WA 4KISA 3K1PA 3PUBA 1I39A 3VSKA 1BJAA 4CYCB 3VYSB 2HTSA 1ZREA 3L2CA 3K1NA 3LSIA 1VQMI 2O7OA 3CJTB 3G6EI 2BVMA 2M4GA 4M9SA 2RN7A 1X58A 4FQGA 2LVSA 3ZN1A 5HLGA 1KQ0A 2KDOA 2VASA 5FD5A 2EZHA 4KJZA 4G8XA 2QA4I 4XKBA 3CMAI 2F4OB 1JXSA 4KA4A 2HKOA 1BR4A 1QHHD 2ZNYA 2EPFA 3W2VA 5C44J 5LHHA 2UUZA 2JWTA 5J1YA 3ECHA 2C6YA 2Z3YA 4XN0A 1ETOA 4R79A 3S3MA 2R7XA 1A6IA 2R3SA 3OSFA 5H6QA 1F9NA 4XKWA 3AG4H 1GT0C 2KL4A 3WHCA 3G4SI 4IOAF 3KFWX 2XAUA 4ESBA 3GTPJ 2E1NA 4I01A 4OOIA 4PSXA 1E3PA 2GXAA 1LDJA 3C7JA 2F5EA 1D8JA 4MQ9F 1S6LA 2KIUA 2BOLA 1D3YA 3ECOA 1IGNA 2JRMA 2M0MA 4WXDA 4ETSA 4PCQA 1J75A 1N75A 1YTYA 4ASNA 4FE4A 5KCMA 2VKEA 1RKWA 4QLCU 3M8FA 3AAFA 5FKNA 3Q0VA 2PMUA 4JX6A 3RPQA 3S32A 1YW8A 4BY7J 5F0HA 3ESWB 2VE9A 3OOUA 4ZYEA 5K1YA 2CV2A 2B9SA 2OTJI 4V2FA 5K5RA 2VKDA 2QSHX 1F36A 3K4CA 1F4KA 4M6YA 1PUEE 2GOXB 3MMYB 2HVSA 1S3JA 3BY6A 1X2MA 2XVCA 5J4VA 1USSA 2WA0A 2ZXWH 1BL0A 3JRHA 5ERIA 3JSOA 2M7BA 1J59A 1YYVA 3PQKA 2F4MB 1GDTA 4LG0A 3DTEA 2CSOA 1QBJA 2GQQA 5M3FJ 2JA6J 3BPVA 4C2MJ 4C2TA 1AKHB 3CD6I 2DA3A 2QENA 4A3MJ 1U5TA 2DFIA 2ZXHA 3ZMVA 1S72I 1W0UA 4BQAA 1JJ6C 3IC7A 4IHYA 2KISA 2AQFA 3E6CC 3G71I 3EUHA 1NK2P 4I98B 3ROUA 5LEJA 3FBNB 4A3IJ 2FBIA 2D2WA 1XC5A 4B3XA 2NVQJ 3AG2H 3ZMDA 1P4AA 4DZJA 2M34A 3HIFA 2GA2A 1G59A 2Y0MA 3KEQA 2F4IA 1GXPA 2F5CA 2K9NA 3H92A 5EF6A 1MBFA 4XBFA 4WXCA 1X19A 4OMZA 3HKZA 2E35A 1H9TA 1S7AA 1UB9A 3D5SC 3FXKA 2VL8A 2LP0A 4Y15A 4M3EA 1U2WA 1Y1VJ 2DAOA 3AKZA 4LJZF 3HOXJ 1SFOJ 4Y4RA 3ABKH 2YU9J 4YRVA 4ZTJA 4OIQF 1KYZA 2R7WA 2QUFA 1K7AA 4Y52J 3BROA 4W97A 5JR3A 3ABLH 2YX4A 4HPQA 1JKRC 4KIBA 3VB2A 3LFKA 3IWFA 3CCQI 4YIFA 2R7SA 1XMAA 2BBYA 2MABA 4J00A 4XNFA 4II2A 2YX7A 5CJ9A 4RB2C 4LK0F 4AC0A 2MYSA 1OCRH 3RCOA 5HODA 2HR3A 3HGYA 1XN7A 2PMZA 2K7LA 4BH9A 1PUFA 3C18A 3DPLC 1TP4A 2L7KA 4FT8A 1MD0A 2DK8A 4LG3A 2ME0A 2W82A 5EG0B 5L3GA 1MSFC 2EWNA 1AOYA 4RGUA 4C3JJ 2IBDA 1KA8A 5LGNA 4U87A 1OYYA 1Z7UA 2KZVA 4MO7A 3H5RA 3LAJA 1HXDA 3S1RJ 3FMSA 4TV7A 5FFXA 5HOOA 4I7HA 3KLOA 2Q2EA 1BJZA 3L00A 4XM3A 4EM0B 4RB1A 2LBFB 4AD9A 4M3DA 4IZZA 3SDBA 4BQNA 2GM4A 4UHTA 3RPUA 3CDLA 3I0TA 3RYPA 2L3DA 2VI6A 4AWXB 3HTSB 2DMTA 4AVZA 2DXIA 2STWA 4P1WA 3OYIA 2LD5A 2TRTA 1LKXA 2L7ZA 4D7NA 2HNHA 2O8KA 5FKOA 5B66C 4C3HJ 1YITI 2COMA 4ZZDA 4F7ZA 3S1QJ 2F5FA 1JGSA 1S7OA 4X1EA 5JI6A 2BZTA 1YO5C 2X1EA 4ENMA 5GADJ 2DQRA 3GTLJ 3R0JA 3LL7A 2QQAA 3I54A 1KU9A 4H4KC 4CCOA 2XAJA 3SEQA 1MJ9A 2IJLA 1XX5A 2EV0A 2NNYA 1K83J 2OAZA 4LIUA 2WTEA 1EJ9A 3CP2A 1R1TA 3HXLA 1JKQC 4XLAA 4IEJA 4BACA 2QWWA 4MGRA 3SZPA 4DBQA 2FE3A 2M3AA 3VYTB 2LR8A 2MGQA 2VBWA 3D5RC 4OIOF 2IP2A 2VBZA 4EQQA 2CFXA 2ESNA 1A36A 1R5HA 4XKVA 3TOAA 3LOCA 1LQ1A 3GFLA 2CQKA 3QPTA 2M1BA 3RKYA 4EJUA 2GIVA 3E5QA 3F8NA 3S14J 4NDLA 3JTGA 3FKJA 4Y33A 1T56A 2IGNA 2EQRA 3WU0A 1DGWY 1VTNC 1X3ZB 4NQWA 2X9DA 1YW9A 4LG0B 2FF4A 2JSCA 1D0YA 1GV2A 3FDYA 3WTXC 3HL2A 1R71A 2CGPA 1H89C 1G6NA 4QTRA 2XSDC 1XB4A 2XF5A 1U5TB 3WODF 2PMHA 1OCOH 2VOPA 4H0EA 2ICWG 1TNSA 1T38A 4IHTA 3CC4I 3KP4A 3HOZJ 2E19A 3LAPA 2V1NA 2P81A 2K3PA 2VPRA 1NK3P 3J7YJ 2ACJA 4RBOA 4ZYAA 1YJ9I 3ISPA 4LK1F 1W5SA 3V8JA 4DYCA 1XGMA 2K9SA 4HAMA 5FKKA 2E5ZA 4ZH4F 3UNGC 3OIPA 3V42A 3FBIB 3PIOF 1ZKGA 5C4XJ 1UAAA 3WTVC 4HBLA 2EIMH 5M5XJ 2IT0A 1SAUA 2Z5UA 2LTPA 5JLXA 4E7ZA 2VOOA 2Z1DA 1JHHA 1R1UA 2IRFG 3CMYA 3B02A 2M2EA 1IN6A 2M0CA 5FKMA 4CYDA 1T08B 4HG2A 1Z05A 1OYIA 1ZG1A 2DFEA 1PVEA 2DW4A 1ZAOA 1MJBA 2XC7A 2R5ZB 2DDAA 4IHWA 4XQFA 3KE2A 1JI8A 4YG2F 3GTMJ 3F8CA 5L3EA 4B3AA 4NBQA 4M3FA 1ZQ3P 1GVDA 1IO2A 1WPKA 1G4DA 4Y17A 2EB7A 4W1UA 4WK8F 4XR6A 3K9TA 3CCSI 3ZQ7A 1FBUA 3GZ5A 3A02A 2MW8A 3ZR8X 5LGUA 2Z16A 2IS2A 5HS9A 3M1EA 1BR1A 3ZP5A 1QHGA 1X3WB 1TQPA 4M9XA 1A35A 1PUFB 1KU2A 3FXLA 3SQNA 2OTLI 4FASD 4OIPF 2DI3A 2DBBA 3TO6A 2R7RA 3OS2A 3HTUA 3FM3A 3GYHX 3QU6A 1YS6A 4I2OA 2XSJC 3GZNB 2A05A 2J5PA 5J47A 1TZLA 1W7PB 2O6GE 2QM3A 2WADA 2LKPA 3DCFA 5FLXZ 4RDUA 1YJWI 2CV1A 1ZR2A 4BKXA 2QCOA 4X0GA 3OYCA 3I53A 1R9TJ 1EH6A 4RAZA 1R4MB 2NVYJ 3FXQA 1WZ2A 1XMKA 2F5DA 1OLTA 1S7EA 4D5FA 4RMNA 2DU9A 2X6YA 3OS1A 4KN4X 3PNYA 4EGZA 2Y9YA 1XD7A 1VQLI 1FT9A 3DU6A 2DA2A 5DEQA 5BMZA 1ETQA 2LKXA 5D5UB 2H6CA 4RAGA 2ZMEB 1XSVA 1U9OA 1T0FC 2DFHA 3DF8A 4OIRF 1JUPA 2GA1A 1ORKA 1XGNA 3BG7A 3JRDA 2FD5A 4FETA 3T5XA 3HSRA 1QZZA 5F64A 1WJFA 2R7FA 3HSFA 3WTWC 2A6TA 2V1DA 1FLIA 2KRHA 2E2IJ 4XSXF 3TEDA 4O3MA 4D7MA 4UVBA 3RZOJ 4GGGA 2IGMA 1IN8A 1E3OC 3R0AA 4II3A 4ESFA 2WWYA 3I4MJ 1B72B 5GTIC 3HOUJ 1ZARA 1MGTA 3WU1B 1WJEA 3D5LA 4OU0A 4I6ZA 4FX4A 3MKYB 4G9YA 3EPZA 1K78A 4M6VA 3K4KA 2JK3A 3H1CA 2A5YB 5AIQA 5LD2C 2LOOA 2JT1A 3BG6A 1MMNA 1NHAA 3BR5A 4N4OB 2XPWA 2JTVA 4KN7X 4CYCA 2FX0A 2LYCA 2K86A 5CVVA 3HOSA 3AL0B 3ZGKA 2EFWA 3I4PA 2GWRA 3NARA 4HLXA 5KAIC 4ABZA 3PNTA 1AU7A 3HUGA 4RM2A 1BC7C 3VYRB 2ZJPF 1IV8A 1M1EB 1HF0A 2IXSA 3BLYA 1JUMA 3G1OA 1SMTA 4A3FJ 1J7KA 2BYVE 3GX4X 2W24A 1ETWA 2HYFA 3HPGA 2VJJA 2I5UA 1VQ6I 1MBJA 4UVCA 1LUJB 3VEPA 1LE8A 4C2UA 3J81Z 3H3ZA 1IXSB 4BL0B 3OV8A 1MBHA 3BTCA 1XTAA 5E3NA 2BV6A 2XROA 3L2WA 3WU2C 1R6RA 2CUFA 3KEOA 3DLLF 3DU5A 2XDVA 1XGSA 1I1GA 2CUJA 2HVQA 3QPLA 1D0ZA 2DJNA 4M72A 2K9LA 2EJRA 5ICFA 1PYVA 5EEAA 1E3HA 3LMMA 4BGDA 1SC7A 4LMYA 1FOYA 1YIOA 5GTHC 5FLXK 2EFOA 3BZCA 3V7CA 4UV8A 3C2GA 3ML6A 4N9IA 2WBMA 2X51A 3PL8A 1WKMA 3VDXA 4UB8C 3H36A 5GAHJ 1MNMC 3CLQA 2G7UA 2A6HF 1G3WA 3FF5A 3MQ0A 1RR7A 5JHFA 1QZEA 1R7JA 1YW7A 5LRSA 1HW5A 2QLZA 1IUYA 4EJWA 2L7FP 4KMFA 1ZYRF 4IPAA 2STTA 1S5LC 1DU6A 1BN5A 4DBRA 3JRBA 4MHGA 4CO8A 4A5NA 4YFXF 2E1OA 4ZYDA 3W2AA 3P9CA 1HKQA 5FB2A 1KQ8A 4G7OF 4C9YA 3HOVJ 3C1DA 1JTYA 1Z6RA 5F1JA 1RUOA 2MC4A 4A3CJ 3LSGA 3OYNA 2A07F 3CDHA 2VUMJ 1AKHA 1F1ZA 3V4GA 1U6GA 3MAJA 4FTHA 5HLTA 4GFBA 1S9HA 2P5LC 1REPC 1R58A 2PX9A 4XKCA 5E79C 3E6BA 2OCCH 1LVKA 3K2ZA 3H5NA 1Y0NA 3BJ6A 4B1RA 3Q9SA 3O6BB 3FZVA 3OL4A 2E60A 1X3UA 2PBIA 1BM9A 3QPHA 2HPMA 3ZQGA 3OYJA 1MBKA 1Z3XA 3BTJA 1W36D 2JUGA 2EFNA 3IUOA 4EV0A 5BPDA 4IOCF 3KZZA 4R8HA 2QEXI 1YHQI 2W57A 3TL4X 2AXLA 5H6RA 2E71A 2JZYA 2RVCA 4LB5A 1SVOA 2TDXA 3HKZN 4HLYA 1QVTA 4CICA 2M45A 5D6EA 3J81K 2E7XA 5IP9J 5ED4A 4I02A 2LFBA 4P5OA 1FIAA 2P8TA 3OSGA 4L0ZB 1KONA 2J5OA 4B4CA 1NG7A 4ZJZA 2FEZA 2E34A 1IG7A 3QOEA 5B3SH 2X1CA 5ILVA 3W6KB 3CCYA 2K4JA 3U2RA 5M5WJ 1QU3A 1WQ2A 3O2PE 1HDPA 2ZNZA 4JX4A 4IO9F 2CMPA 3EYYA 2L9NA 2IGOA 4G7HF 2L9SA 2IAIA 3F0CA 2LMDA 1DUXC 2LRDA 2HQNA 4XLFA 3KP7A 2Q0OA 5J8CA 1MZBA 3M4OJ 3TDZC 5B5EC 4U7DA 5IPAA 3KX2A 4UXNA 1D1BA 1WH5A 2PMZN 5HNHA 1K78B 2JQ7A 2V9VA 3L1PA 2E2JJ 1ZR4A 3IH3A 1DQUA 1LVAA 1WCMJ 3QOPA 3WTYC 3I71A 2UZKA 2JJ7A 4E7IA 3SFZA 4X6AJ 4I99C 4J19A 5EG0A 2TCTA 3FMRA 5BS6A 3K70C 2KIFA 2EZIA 2MBFA 2NRAC 5GAGJ 3N05A 5E3OA 4KDPA 2MH2A 3HUGB 3ZQLA 4F52A 2P7CB 1YQAA 2LY2A 1QA6A 1Q1VA 4Q48A 3TP3A 3FWEA 2Y30A 1WI3A 1U0JA 3ZMUA 2KRCA 1YG2A 2LBFA 4IL6C 1TL8A 4FE7A 3K7AJ 1LE8B 3K4LA 3BPXA 3IRQA 2QQ8A 1ZK8A 1X1PA 1RPWA 4HEA2 2W00A 1Y8RB 4QIWN 1BI2A 2LDUA 3GW2A 1KQ9A 1SVLA 3CJNA 4XORA 4GO1A 4WWCA 3I9V2 5IY5H 2Y75A 1APLC 2HZTA 3VPRA 3Q0UA 2NVTJ 3CCRI 3IP4B 3SFIA 3HOYJ 5C3EJ 3SXYA 3HYIA 3IL2A 3W6VA 5IP7J 2KDZA 3R6SA 4PUSA 3RZDJ 4EJVA 1U5TC 3COAC 2HPIA 3QYFA 1ENHA 3SJMA 3CCLI 4IVNA 2CU7A 3HRSA 2DPDA 3WGGA 3EUHC 3DKWA 3E6DA 3KP3A 4LLNA 3K0LA 1P92A 4XLHA 1QVUA 1HDDC 2OJED 2RQQA 3JTHA 5DD8A 2ZBKA 2FRHA 1W1WE 3PO2J 4KITB 1QNTA 1JGGA 3JRGA 3HRMA 4LFUA 4ZYGA 3WGIA 2ZFWA 2DK5A 2P5KA 2QVOA 3L7WA 4EEFG 1VQPI 5DM6F 3RKXA 2HYGD 1USTA 3GMEA 4ENNA 4BHBA 5JFRA 1UG2A 3ASOH 1TT0A 4F3QA 5JVTA 3JRAA 4CCMA 1WGXA 2HKXA 3DXJF 3GO5A 3S8PA 1FNNA 3BOQA 2FU4A 3LSJA 1ZRDA 1ZH5A 3HRTA 1QZYA 2DJIA 2NVUB 1R5ID 1VF9A 2K27A 3A1YA 3M8JA 1S29A 2Y69H 3G3ZA 2PN6A 5HS8A 2EA2A 2NOJB 2NYXA 3LQRA 3J80K 1D1AA 5KAFC 3BG3A 2R7VA 3PQJA 2HWVA 2DA1A 2DCEA 4A0ZA 1IRXA 2NAZA 5C4JJ 1K4SA 1BC8C 2FOWA 3ZQCA 2IS4A 2JA5J 3F8BA 2HDDA 2WC2A 1FTTA 1TQIA 4XOPA 2WAFA 3ZN0A 4NNJA 3A0BC 2QKMB 4PFPA 5ILSA 1Q1HA 4BXXJ 2O9LA 1UG0A 1FY7A 1VQNI 3CUQB 3KP2A 3O3KA 1C0WA 3WTSC 1B9NA 4EJTA 5LLQA 1WVRA 1Z77A 3VODA 1WJDA 3WHBA 3LNQA 5J3LA 1HW2A 2R92J 4A3JJ 4BE0A 4G6TB 4ZDLA 1FWZA 2O03A 2M30A 2ZB9A 4RAFA 1MMSA 4F91B 3LSRA 2HS5A 2VB6A 3A4CA 1ZN2A 3GFJA 2CG4A 2R5ZA 4ZZLA 3FXRA 4GYIA 1T8IA 1IN5A 4Q5SF 4CCNA 3CESA 4DQ2A 1RETA 3JCUC 4KT6A 1IC8A 1T2KA 2JMWA 3F22A 1FOXA 2M8EA 1ZHFA 3OOPA 2E1CA 4HF1A 1Y0UA 1UFMA 2L4MA 2F6CA 3MN2A 5K7HA 1XSDA 2QQ9A 1A31A 5J8FA 4E7JA 3GBGA 3ULQB 1ZGJA 1R49A 1FP1D 3TOBA 4WCGA 3ZQIA 4C30A 1V5GA 2IA2A 4HNTA 1RC9A 2L01A 4E6KG 2W7NA 1ZRCA 4BXFA 2XF7A 3V8LA 4DNCA 1OMIA 4F55A 1IW7F 2VQHA 3PIPF 3F23A 3DBRB 4UV9A 2OBPA 1YS7A 3GXOA 1N77A 2GBYA 2L4AA 3DFGA 3QODA 1LFPA 3L9FA 1IXCA 2M9HA 5EJCA 1Z1DA 3GTQJ 4AIKA 4IQ4A 4YIIA 1W7PA 4KIGA 1W0TA 1UELB 2KMUA 2E5NA 3I59B 4WX9A 1LFUP 2ZFUA 4G6QA 4WXHA 2FOKA 5F04A 3IH4A 4U7BA 2RAEA 4EJOA 2NVXJ 3KIOA 4CSWA 4B09A 5E18F 3K2AA 1SD6A 3KEYA 3KZIC 3E5XA 2DOAA 3F8FA 2VPLA 2HOEA 2IA1A 2X48A 1YJNI 4DIQA 2K9MA 2HFHA 3OMYA 1UHSA 3AL0C 4Q4ZF 3K4NA 2XPVA 2ZMEA 4ZTFA 1ULYA 2BXYA 1KZHA 5E1ZB 1XCVA 2K40A 4IJAA 2L54A 3ZQFA 1G3SA 1H88C 1MIJA 4PJMA 1FTZA 1OQYA 2P5VA 3TO9A 1U8RA 1FPQA 2HTJA 2DTRA 2E7WA 2ESHA 2WAEA 4NC7A 2IS1A 1MH4A 3F21A 2A68F 2MFZA 2V26A 3M07A 1J09A 2HOAA 4MLOA 1YX3A 5CVJA 4XRFA 4EM1A 3IV5A 4I0AA 1B72A 4N0BA 3OYEA 3ERED 2RC4A 4M71A 4P55A 3CDIA 4A6DA 2IW5A 2G7HA 3KYLA 3I4NJ 5E17F 2X6XA 1FMVA 1KU3A 4BEHB 4L9VA 1CF7B 3NEUA 3PSIA 5DCFA 3IAS2 4S05A 2KZGA 3CJQB 2ISZA 3S1MJ 4Q47A 1WHUA 5TJJA 3VFZA 4HSTA 2CUZA 5HDGA 5DV5A 1VQ4I 3G2BA 1QPIA 1TWGJ 5IP6A 1D5YA 3I55I 3F72A 2DOEA 3RDIA 3DPTA 2A69F 2LC2A 3S15J 2Y9ZA 2DA6A 4GCVA 3H35A 1IRFA 2LY9A 2CFOA 5KNLA 2OF7A 1RIOH 2DT7B 1PJRA 1L0OC 5E3MA 2JPBA 3BG9A 4BE1A 5TRDA 4IKFA 2EFPA 2OCEA 4MEYF 5TISC 3H3UA 4P96A 3H9QA 3KZYA 1K6OA 1R36A 4CDGA 3RQIA 1SFEA 2CRGA 2JA2A 2WY7Q 2L0KA 3ZOBA 1RUNA 5D8LB 3CCVI 3MWMA 4D0PA 4YFNF 2HXOA 5DTDA 2BY1A 1YFHA 4JX5A 4E70A 3IH2A 5FLMJ 1YOVB 4ZC3A 2LF7A 1SEUA 3HZJA 2ZXJA 5K7ZA 3T8TA 2FNAA 2XGCA 4N4NB 2KJCA 3WE2A 2EIKH 2KRFA 2PI0A 2R93J 1WWXA 5EYRA 3KCCA 2BEOA 3LA2A 3K10A 3FM5A 5JLWA 1DPUA 2Y0SN 2DA5A 2X6WA 1G3TA 2KPMA 3PJRA 1BBYA 2V1UA 1HQCA 4UY8I 5F08A 4LGWA 1DPRA 3S17J 1VQ8I 1Z91A 3PSFA 2X6OA 4CZCA 4IRIA 4BU2A 1LDDA 2M8GX 1ZGAA 2OC6A 1E0EA 4C3IJ 1QPMA 1B8IA 3CQZJ 3ZMZA 1K6YA 2VKVA 1U8BA 1K79A 3B6CA 1SANA 4E7HA 4PJNA 1IRGA 5AIPA 1HBXG 2LG4A 2OZ6A 1BI1A 4JQFA 3J7AO 2UWMA 5CKTA 3ZCOA 1IAWA 1FOKA 4L9TA 3BZKA 1VFCA 1T98A 2E1MB 3FXUA 2A61A 1LB2A 1F5TA 3A2KA 3VOEA 4HF0A 1GUUA 2V79A 3BC8A 3TKYA 2XGXA 2ZJ2A 1V3FA 2OD5A 4N9HA 5EZGA 1HA8A 3EUAA 4KUMA 4E4HA 1R22A 5FKLA 1MNDA 4IF4A 1I6XA 3K6GA 2PJPA 1HW1A 2DMQA 2AQEA 4M9ZA 5E8GA 3QAHA 4HDUA 4QSHA 3S93A 1Z3YA 3T0YA 1JTXA 1Z67A 1RR8C 5FD6A 3C2HA 2RNJA 1U9NA 2XGDA 3I3LA 3G1MA 3MZHA 4HW0A 2WB1A 3WTUC 2CS3A 1GHCA 4V19K 3DP7A 2O61A 2RQPA 5EZHA 4E7LA 1KGSA 2X4HA 2CH0A 5TGTA 1SD4A 2O3FA 4JK1X 2GIZA 2XAQA 2XASA 1E2XA 3HPHA 2ME6A 1MSEC 1ETKA 4OMYA 2EA4A 4ZYHA 1NH3A 1I27A 2V9KA 1TW3A 2ADUA 3HC7A 1VZ0A 3JW4A 5GPCA 5FO5A 4UVAA 3O8HA 1J0RA 1SD7A 4RGXA 4IRGA 2EV5A 3HG9A 4BBSJ 1HOMA 1XG1A 1FIPA 2XAGA 3OYKA 1P6RA 1ZG5A 4XONA 3RKWA 2DA7A 2LSOA 5LHIA 3BCBA 1I5ZA 5CPRB 3V7SA 3SZGA 4BYYA 2JUCA 2KIQA 5CQGA 4GYGA 3S3NA 3SEZA 4XSZF 5J6XA 1FYKA 2L2OA 2H09A 2IEKA 4B8XA 1IRZA 5J1RA 5HDKA 1BOBA 4A93J 1GVJA 2A3SA 4B48A 5E3LA 1XMXA 1B6AA 3I56I 2XUBA 3B73A 4XRSA 4BDYA 1O7FA 1V5FA 5D4SA 1IZ1A 2XAFA 2AO9A 2M4KA 1Z7LA 2H1LA 4CCJA 4HRIA 1LEAA 3V7RA 1MMDA 1SFXA 3HHHA 3M7GA 4HDVA 5IOZA 3QYBA 2VJ5A 5ICCA 1GLNA 1I50J 2OU2A 3DEWA 3LA3A 4A3EJ 2K9QA 2CO5A 4PJ0C 2IGKA 4L0YB 2AXTC 5DM7F 1TT5B 1WI9A 3FXJA 3GCMA 5F0FA 2G0EA 3LQQA 4AVPA 2VKHA 5F1RA 2VE8A 2XV4S 1G8XA 3L2RA 4DZPA 3RI4A 5ICGA 5D6FA 3GFMA 9ANTA 4HQMA 3X2QH 1IN7A 2BHZA 2MD5A 5HLIA 3EYIA 4PK4A 3SZTA 1MBGA 2BW3B 3HOTA 1MDMA 1YRNA 5IT9Z 1A04A 2R7TA 2HVRA 3MVPA 2P7VB 1OYWA 5IYBJ 1FJLA 2NS8A 1XDUA 3FIWA 4XRSG 2ETHA 3HDDA 4B44A 4HX7A 3BR1A 2Z33A 4DGWB 1FEXA 2ISYA 3K4BA 3EQLF 3BR0A 4OAZA 3DLAA 4P9FA 3RSNA 1OR7A 1R23A 2DN0A 3PNVA 1B59A 2XPUA 4M6XA 3RYRA 3Q3SA 1BIAA 3DKXA 2KKOA 1DU0A 2DDBA 1OCPA 3GVAA 1EV7A 1V55H 1Y8QB 2P6TA 3NQOA 2VLAA 1B8IB 1FSHA 3OIQA 4CHUA 1I1SA 4QPOA 3KP5A 3QQAA 1J9IA 2BVLA 3DV8A 3JRIA 1JT6A 3CMEI 2BY2A 2H6BA 4L18B 4ON0A 3OYGA 1DP7P 1RESA 2W25A 4L5JA 4A2UA 1TWHJ 1TWFJ 2EH3A 2GZWA 2MD0A 4XRMA 1OCTC 2BY3A 1YX5A 2WV1A 4I0BA 3D0SA 1DDNA 2GLOA 5GAEJ 1X1CA 3QYEA 4DJAA 5DCMB 5J4YA 1TQMA 3OYAA 3GTKJ 4MFEA 5E1XA 4Y13A 2FMYA 4HSRA 5LEKA 5F6FA 3BR3A 4NC8A 3C3WA 3BWGA 3PFYA 4I09A 2IVMA 4YELA 4G7ZF 1ON1A 1LFBA 2MA3A 4PGGA 4V2GA 3GZ6A 2E2HJ 4AM3A 2DQLA 2XKPA 1AA7A 2DOFA 3CUQA 1QRYA 5DS9A 2LNBA 4BQOA 5FROA 3F9KA 1SVMA 2YUSA 4CXFA 1OJLA 1CGPA 4BDZA 2X1DA 1UJ8A 4A0YA 2ZCWA 1XS9A 3F3XA 2V6EA 1ZG3A 3KYDB 3MEXA 4BBRJ 1WJBA 2R7UA 4HV6A 1OKRA 1ZLKA 3WE3A 3LSHA 2VQLA 3RQ4A 2B63J 3DWLE 5K7FA 1OFCX 3HBLA 1ZTRA 5D8KB 5BPIA 2ID3A 2X0LA 1P9QC 3CCEI 1FMWA 1H9GA 1TW2A 5DDGA 4A12A 3V8KA 5IT9K 1B1BA 3NRVA 2ELKA 2UXXA 4RAYA 2CYYA 3CCMI 2NNNA 2MC3A 2JVHA 2R0QC 2KJBA 1U78A 3H9GA 4XLCA 4Y3OA 1JKPC 2YS9A 2DFFA 5HDNA 3HRUA 1FBQA 4G6DA 1IJWC 2HQ5A 2XGEA 1FYMA 3SYTA 2GXBA 3IRRA 4G94A 1YI2I 3F6OA 3I59A 1O4XA 1TLHB 3DPUA 4EM2A 3K4JA 1O7LA 5CQEA 4MFDA 1TTYA 3BDDA 1STZA 1H8AC 1HCRA 1BA5A 3BP8A 2HDCA 2ZXIA 3GTGJ 1Z0XA 2K3FA 3L2UA 3G73A 3HSEA 2R7ZJ 3HGGA 4AUXA 2OPTA 4YIRX 2OZUA 2BE5F 3LSPA 2VT3A 2VJ4A 3IWZA 2FQ4A 1SFUA 5HNFA 2CJJA 4BJ5C 4S04A 5FRNA 4KICA 5CVIA 3ZRGA 3T1BA 1LPQA 4HV5A 4CCKA 2PFBA 1MDMB 1YRNB 1MNEA 5A2QZ 2DTZA 1VQ9I 1X1AA 4JP0A 3TW7A 5F27A 5HVQC 2EBIA 2HGCA 2HDWA 4FX0A 5L3BA 2H8WA 5E20A 4A6EA 5HLHA 3M1CA 3OR2C 5LFAA 1ETVA 3E0JB 3FX3A 4BEHA 2FBHA 5J1UA 3CP8A 1CF7A 1TBXA 2F48A 1T39A 1D5VA 4DW6A 4LB6B 2RV8A 2WAQA 2EILH 5BQTA 3HEFA 1R5GA 3CUOA 3K1MA 4LLGF 3CO7C 3HOWJ 1MJAA 2QYOA 5E8IA 2FMLA 1D0XA 2AS5F 3OIOA 1ON2A 3CO6C 3PM1A 2XB5A 2CQXA 3ABUA 2EINH 1BIBA 2KIMA 2R7OA 3DEUA 3SHFA 3UR3C 1R1VA 3FK6A 5HS7A 2HU9A 3E6MA 4NC6A 4UUSA 2LLKA 1VQ7I 1IN4A 1WRJA 2DODA 2RDPA 2YR2A 1VQOI 3P9KA 3DTIA 1JKOC 1TNTA 1G3YA 4A69C 3CCJI 2JA8J 5L3FA 3J7AY 2PJRA 1SD5A 1TC3C 4DYRA 1T33A 4GDFA 4AYBA 2VQCA 4XLNF 4KYWA 3NAUA 2W84A 4ESJA 4KFCA 2NS7A 2COBA 4AIJA 4LITA 1FYLA 3E97A 1Y6IA 5DYMA 2E1MC 2PQ8A 2K5CA 5EGOA 1LEBA 1UMQA 3OYHA 5FFZA 2PLYA 4L9JA 2DYRH 3GUDA 4IX7A 3VWBA 1HLVA 4F93B 1ZGWA 3CZ6A 3E1SA 3H9JA 4GXOA 2CW8A 2Y2ZA 2GXGA 3BT9A 5FJ8J 1XCBA 3BTLA 3FK7A 3KPHA 2HOSA 2MH9A 2HQAA 1W5CC 4EATA 1A6QA 3PO3J 2BXZA 3TGNA 3W3CA 4HX4A 3K4MA 4KNYA 2W85A 2JA7J 3E7LA 2XB0X 3H0GJ 4YFKF 4Z6YA 3OYFA 3A01A 2V1XA 1IXRC 5DUIA 1UHMA 2A5WA 2Y48A 4BHPA 1PP8F 2KHMA 2X85A 1Y56A 3N97A 2DT5A 1JJ8C 5A2QK 2XKOA 2WV0A 4U88A 2EV6A 2FNPA 2JVGA 2ZMEC 3LA7A 2GAUA 2KFDA 1G2HA 1T95A 3E5UA 4FISA 3S3OA 4E7SA 1U3EM 3CTAA 4BE2A 2D1HA 1QGPA 2R4GA 3OL3A 1DGRM 2M87A 4PDKA 4HQEA 1RZ4A 1XPXA 2LK2A 1CQTA 2OUMA 3QPSA 3HB9A 2CQ7A 2EIJH 4UB6C 3T8RA 2P0WA 3S1NJ 4BNCA 2BHYA 3MFKA 2L9RA 3FHZA 3OYLA 2VN2A 4RS8A 4FCYA 1K61A 2DMPA 5F0CA 1UHWA 3BCAA 4HA8A 3FHNA 2ZJQF 4Y7NJ 3OY9A 2H1KA 3OR1C 3ABMH 1J5YA 4JOMA 3S16J 5CYVA 5LBQA 2WB1N 1BR2A 2EZLA 2QSFX 2R7DA 5D5XB 2VIXA 2BGCA 3BJAA 3JR9A 2E36A 3DQVC 2VXZA 4XN3A 3JRFA 4MNUA 5K5QA 3OYDA 4CGZA 2IS6A 1V54H 3LSKA 2YPRA 2L5QA 5DD4A 4A0XA 4HNVA 3WTTC 3NWSA 1O3SA 3IHUA 1NTCA 2EK5A 3KLNA 3BR2A 1MW7A 1RRJA 4XICA 5ILUA 3DTKA 2D45A 4MTEA 3CF2A 5GP9A 3ZXSA 4AIDA 5L3CA 2AHQA 1ONVA 2P6SA 4GRIA 1X4PA 4YEJA 3Q0WA 2V7FA 2M7AA 2RNGA 5CLSA 3L2VA 3HJEA 2VONA 1I3AA 2JPCA 3ONQA 4CCLA 5B1BH 1YE9A 4HOBA 3IKTA 2L02A 3L09A 3RIRA 4HX8A 4MTDA 3W6JB 4O5VA 3AFHA 3AG3H 1WJ5A 2QGUA 1P2FA 5M3MJ 3BG5A 1B9MA 3DBLB 3D1NI 1W36C 1IUFA 1TWAJ 2CV0A 4XLPF 1VQKI 5L3DA 2CW0F 5DUKA 1Y39A 3FXMA 1FX7A 2B7EA 3FXOA 3LWFA 4UUSB 5CVUA 3HHGA 2FSWA 3S2HJ 3GLLA 3MKZA 1LDKB 2W1OA 3UKGA 3NWTA 1MMGA 2GOMA 3FMQA 4XMYA 1MMAA 1QQIA 2QBYA 1A5JA 2XHKA 1GV5A 4XLEA 4G12A 2F2EA 5E1WA 2R5YA 1NG6A 4J01A 1K4TA 4ENJA 4BUPA 4KMUX 2H8RA 3A0HC 2HI3A 2VXDA 2PJRB 1P7JA 1HSJA 2F5VA 6PAXA 5JVGF 2VT2A 4S0HB 4DYQA 2JSPA 3WGHA 1W4MA 1LJ9A 2BW3A 2LREA 2DLLA 2V9PA 1FZPB 3M3YJ 5EGOB 3RKQA 1SFKA 4PGHA 4PSWA 2CWEA 4RLQA 2B0LA 4BQQA 4UNOA 1DP3A 2IA0A 4NUBA 3Q9VA 2Z99A 4BAYA 3K70D 2MSYA 3GFIA 3L2QA 4A3DJ 2K4BA 2QZ8A 5BOXA 3ERMA 3ABTA 3S2WA 4AIHA 4XL9A 4R1HA 3OYMA 1ETYA 1ZELA 1OISA 4O6JA 3JREA 2ECCA 4OINF 3ZMSA 1POGA 2NOGA 2RKHA 2XRLA 3A01B 2JN6A 1FOWA 2FQ3A 4M3GA 4PFOA 1BW5A 2DT6A 1LNWA 1VI0A 5KVRA
chains in the Genus database with same CATH topology
3ASOH 3ABLH 2ZXWH 2EINH 5B3SH 1OCCH 3AG3H 3WG7H 3ABMH 5B1AH 3AG1H 3AG4H 5IY5H 3X2QH 2EIKH 2EILH 1OCRH 2DYRH 2EIMH 2Y69H 1V55H 2OCCH 2EIJH 1V54H 3ABKH 1OCOH 2DYSH 5B1BH 3ASNH 3AG2H 1OCZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO H;  3ABL H;  2ZXW H;  2EIN H;  5B3S H;  1OCC H;  3AG3 H;  3WG7 H;  3ABM H;  5B1A H;  3AG1 H;  3AG4 H;  5IY5 H;  3X2Q H;  2EIK H;  2EIL H;  1OCR H;  2DYR H;  2EIM H;  2Y69 H;  1V55 H;  2OCC H;  2EIJ H;  1V54 H;  3ABK H;  1OCO H;  2DYS H;  5B1B H;  3ASN H;  3AG2 H;  1OCZ H; 
#chains in the Genus database with same CATH topology
 1HST A;  4CA0 A;  4UUV A;  2L9V A;  4ENK A;  1WJC A;  3O8G A;  4BJ6 C;  2EFQ A;  2V6C A;  5DCM A;  3OYB A;  1WJA A;  4M73 A;  3CMM A;  1S8N A;  4BY1 J;  1X2N A;  4D1Q A;  1TWC J;  3BJO A;  1QO0 D;  1BW6 A;  2ZSI B;  4I76 A;  3QP5 A;  4RGR A;  5IT3 A;  5D4R A;  2OV7 A;  4EVI A;  4U0V A;  2XF6 A;  2CQN A;  1D8K A;  3IKV A;  2V4J C;  3I64 A;  3TP0 A;  3GWZ A;  5FRM A;  2HZD A;  1X4O A;  3JRC A;  5IOY A;  5FLV A;  2QF7 A;  3VYU B;  2MLK A;  2VBX A;  2OQG A;  5EEG A;  2CUE A;  3U9G A;  2VBY A;  3GF2 A;  1N25 A;  4PJL A;  3DEE A;  3MCZ A;  3S2D J;  2XIG A;  4M74 A;  2LH9 A;  1AWC A;  4PJJ A;  4L9N A;  1D1C A;  4F92 B;  2FBK A;  4AU7 A;  5KHD A;  2L7M P;  1HKT A;  3PFI A;  1MBE A;  2KT0 A;  2Q2E B;  4CUG A;  3RJP A;  5CVR A;  4HF2 A;  3R4K A;  4RA2 A;  3W2W A;  4BJT A;  1WSU A;  3N4M A;  1Y1W J;  3QP6 A;  5IYD J;  5LGT A;  3U1D A;  3EDP A;  4HNU A;  1Z9C A;  1EKE A;  2P4W A;  4JBA A;  1KYW A;  3R60 A;  3TO7 A;  3MZ8 A;  2MLG A;  1I3Q J;  1SAX A;  3A03 A;  1V5E A;  2VOD A;  2ELH A;  1Z6T A;  4DOZ A;  3CCU I;  4IQJ A;  4RM3 A;  3ASN H;  1IF1 A;  3QU3 A;  1ACI A;  3MZY A;  1OPC A;  2FUG 2;  4RLF A;  2Z9O A;  4ITV A;  3GLX A;  1EH7 A;  5H20 A;  5D5V B;  2CQQ A;  2FJ1 A;  3TMO A;  4MEX F;  2MG4 A;  1RNL A;  2HQR A;  1R00 A;  2O5R A;  1W5T A;  1E17 A;  3DBH B;  1WFX A;  3G1L A;  4M3B A;  1O3T A;  3GTO J;  1W7P D;  3RTR A;  2Q1Z B;  5K5O A;  1OR7 C;  5EEH A;  3QWL A;  3ZQH A;  2DYS H;  4D9J A;  1O3R A;  1OCZ H;  2QBY B;  2RGV A;  2R7Q A;  2DMN A;  2UV1 A;  1T0F A;  5FGM A;  1RKT A;  1FP2 A;  2R5Y B;  2HXI A;  4MQV A;  5D5W B;  4XK4 A;  1O3Q A;  1XSX A;  3BR6 A;  3RPU D;  2QSG X;  2YSR A;  2ECB A;  5IYC J;  1ZRF A;  4QWQ A;  2Y31 A;  4NQW B;  3WG9 A;  4A3L J;  1SMY F;  4RGS A;  4B47 A;  4RB3 C;  1I6H J;  2LY1 A;  2ID6 A;  4L5I A;  4IHV A;  1BI3 A;  3ZPL A;  3H3V K;  2WY8 Q;  1HC8 A;  3KYC B;  2I10 A;  3OS0 A;  3EET A;  4A3B J;  2FXA A;  2H27 A;  1P4X A;  3DKY A;  3PUF A;  4RB0 A;  4ZDP A;  1KU7 A;  3ZMT A;  1P7I A;  2D1V A;  4A5M A;  4EGY A;  3P5J A;  2VC1 A;  4OWR B;  2KLO A;  5H2F C;  3CC2 I;  1MH3 A;  1YIJ I;  4LOC A;  1JUS A;  1O57 A;  4K2E A;  4D5C A;  2D5V A;  3MKW B;  2IPQ X;  2WAQ N;  2HEO A;  2Y0S A;  5EDN A;  1BOA A;  4Z2Y A;  3GEZ A;  1PP7 U;  2ZC2 A;  3CUQ C;  1ZLJ A;  2A6E F;  2Z2S B;  1EA3 A;  2PEX A;  3REO A;  1X1D A;  3JAM Z;  3QRF F;  4NHJ A;  2OQR A;  4FHT A;  2FA5 A;  1L3L A;  4HYE A;  4KIF A;  1UZC A;  2KP6 A;  4HZF A;  2LKS A;  1P4W A;  5B1A H;  2ZKZ A;  3SDG A;  1EF4 A;  1Z21 A;  2DO7 A;  3BQY A;  1ETX A;  3CC7 I;  3WTZ A;  1V4R A;  5KK1 A;  1EH8 A;  2ELJ A;  2H94 A;  1UCR A;  4U0Y A;  1BI0 A;  1XGO A;  4IRH A;  4XID A;  2PG4 A;  3BQZ A;  1XDS A;  2CW7 A;  3P9I A;  1ITY A;  3TBI A;  3TQN A;  2BY0 A;  5M5Y J;  2QKL B;  3LSM A;  2OA4 A;  3KP6 A;  3F8M A;  2N8G A;  1IDY A;  3Q5F A;  4EMS A;  2ZSH B;  1ODD A;  2VC0 A;  2XRN A;  2O8X A;  3H5A A;  4CH7 A;  4BS9 A;  4IHS A;  4ZDO A;  1ERD A;  4P9U A;  4AYB N;  3JSP A;  4BXU A;  3LST A;  5GPA A;  1H0M A;  1IV6 A;  4A3K J;  3GTJ J;  3FKI J;  4B43 A;  4LLL A;  3CF5 F;  3I5U A;  2VJI A;  3U21 A;  1IDZ A;  1AHD P;  1HKS A;  3TDU C;  2QQB A;  5LRR A;  2YU3 A;  3CJR B;  2DA4 A;  3MD2 A;  2KQR A;  3ZQQ A;  4WF2 A;  3OWT A;  2K85 A;  1YLF A;  1FSE A;  4ANJ A;  4LD5 A;  4E7K A;  2LF8 A;  4A3G J;  3M8E A;  2Q8K A;  1J2X A;  2EZK A;  1T6S A;  3I58 A;  3P7N A;  3ELK A;  4U0W A;  4CZZ A;  3IAM 2;  3J7Z I;  2M5W A;  1PDN C;  3KET A;  4PZJ A;  3BZ6 A;  3U1K A;  3AG1 H;  5ICE A;  1B4A A;  1MKM A;  2VQG A;  1F43 A;  4LIV A;  1X1B A;  3VSL A;  3R61 A;  3K69 A;  3CLO A;  3LFU A;  4IHX A;  1JT0 A;  3MKL A;  4L5E A;  3H0D A;  2I8D A;  1WH7 A;  4MIM A;  4KT5 C;  2W48 A;  1JHF A;  3FIS A;  3BTI A;  3E3V A;  4JYK A;  2ZJR F;  2DPU A;  2O0Y A;  2HYJ A;  5JHU A;  1OCC H;  1FBS A;  3WG7 H;  5LHG A;  4NB5 A;  1GXQ A;  1JE8 A;  3HM5 A;  1VND A;  4BHC A;  1N78 A;  3M9A A;  4IXA A;  2RRE A;  5J40 A;  1R4N B;  2NS0 A;  2NXN B;  2K02 A;  5AON A;  5BNG A;  4XOT A;  2UXN A;  3C2B A;  3F6V A;  3B6A A;  1RI7 A;  3EUK L;  3TW6 A;  1FC3 A;  2JRT A;  3J80 Z;  4UUT A;  2XAH A;  4OAY A;  2HOT A;  3JAM K;  4QPQ A;  1VQ5 I;  2W4S A;  2ZO4 A;  2DMU A;  2G9W A;  4KIS A;  3K1P A;  3PUB A;  1I39 A;  3VSK A;  1BJA A;  4CYC B;  3VYS B;  2HTS A;  1ZRE A;  3L2C A;  3K1N A;  3LSI A;  1VQM I;  2O7O A;  3CJT B;  3G6E I;  2BVM A;  2M4G A;  4M9S A;  2RN7 A;  1X58 A;  4FQG A;  2LVS A;  3ZN1 A;  5HLG A;  1KQ0 A;  2KDO A;  2VAS A;  5FD5 A;  2EZH A;  4KJZ A;  4G8X A;  2QA4 I;  4XKB A;  3CMA I;  2F4O B;  1JXS A;  4KA4 A;  2HKO A;  1BR4 A;  1QHH D;  2ZNY A;  2EPF A;  3W2V A;  5C44 J;  5LHH A;  2UUZ A;  2JWT A;  5J1Y A;  3ECH A;  2C6Y A;  2Z3Y A;  4XN0 A;  1ETO A;  4R79 A;  3S3M A;  2R7X A;  1A6I A;  2R3S A;  3OSF A;  5H6Q A;  1F9N A;  4XKW A;  3AG4 H;  1GT0 C;  2KL4 A;  3WHC A;  3G4S I;  4IOA F;  3KFW X;  2XAU A;  4ESB A;  3GTP J;  2E1N A;  4I01 A;  4OOI A;  4PSX A;  1E3P A;  2GXA A;  1LDJ A;  3C7J A;  2F5E A;  1D8J A;  4MQ9 F;  1S6L A;  2KIU A;  2BOL A;  1D3Y A;  3ECO A;  1IGN A;  2JRM A;  2M0M A;  4WXD A;  4ETS A;  4PCQ A;  1J75 A;  1N75 A;  1YTY A;  4ASN A;  4FE4 A;  5KCM A;  2VKE A;  1RKW A;  4QLC U;  3M8F A;  3AAF A;  5FKN A;  3Q0V A;  2PMU A;  4JX6 A;  3RPQ A;  3S32 A;  1YW8 A;  4BY7 J;  5F0H A;  3ESW B;  2VE9 A;  3OOU A;  4ZYE A;  5K1Y A;  2CV2 A;  2B9S A;  2OTJ I;  4V2F A;  5K5R A;  2VKD A;  2QSH X;  1F36 A;  3K4C A;  1F4K A;  4M6Y A;  1PUE E;  2GOX B;  3MMY B;  2HVS A;  1S3J A;  3BY6 A;  1X2M A;  2XVC A;  5J4V A;  1USS A;  2WA0 A;  2ZXW H;  1BL0 A;  3JRH A;  5ERI A;  3JSO A;  2M7B A;  1J59 A;  1YYV A;  3PQK A;  2F4M B;  1GDT A;  4LG0 A;  3DTE A;  2CSO A;  1QBJ A;  2GQQ A;  5M3F J;  2JA6 J;  3BPV A;  4C2M J;  4C2T A;  1AKH B;  3CD6 I;  2DA3 A;  2QEN A;  4A3M J;  1U5T A;  2DFI A;  2ZXH A;  3ZMV A;  1S72 I;  1W0U A;  4BQA A;  1JJ6 C;  3IC7 A;  4IHY A;  2KIS A;  2AQF A;  3E6C C;  3G71 I;  3EUH A;  1NK2 P;  4I98 B;  3ROU A;  5LEJ A;  3FBN B;  4A3I J;  2FBI A;  2D2W A;  1XC5 A;  4B3X A;  2NVQ J;  3AG2 H;  3ZMD A;  1P4A A;  4DZJ A;  2M34 A;  3HIF A;  2GA2 A;  1G59 A;  2Y0M A;  3KEQ A;  2F4I A;  1GXP A;  2F5C A;  2K9N A;  3H92 A;  5EF6 A;  1MBF A;  4XBF A;  4WXC A;  1X19 A;  4OMZ A;  3HKZ A;  2E35 A;  1H9T A;  1S7A A;  1UB9 A;  3D5S C;  3FXK A;  2VL8 A;  2LP0 A;  4Y15 A;  4M3E A;  1U2W A;  1Y1V J;  2DAO A;  3AKZ A;  4LJZ F;  3HOX J;  1SFO J;  4Y4R A;  3ABK H;  2YU9 J;  4YRV A;  4ZTJ A;  4OIQ F;  1KYZ A;  2R7W A;  2QUF A;  1K7A A;  4Y52 J;  3BRO A;  4W97 A;  5JR3 A;  3ABL H;  2YX4 A;  4HPQ A;  1JKR C;  4KIB A;  3VB2 A;  3LFK A;  3IWF A;  3CCQ I;  4YIF A;  2R7S A;  1XMA A;  2BBY A;  2MAB A;  4J00 A;  4XNF A;  4II2 A;  2YX7 A;  5CJ9 A;  4RB2 C;  4LK0 F;  4AC0 A;  2MYS A;  1OCR H;  3RCO A;  5HOD A;  2HR3 A;  3HGY A;  1XN7 A;  2PMZ A;  2K7L A;  4BH9 A;  1PUF A;  3C18 A;  3DPL C;  1TP4 A;  2L7K A;  4FT8 A;  1MD0 A;  2DK8 A;  4LG3 A;  2ME0 A;  2W82 A;  5EG0 B;  5L3G A;  1MSF C;  2EWN A;  1AOY A;  4RGU A;  4C3J J;  2IBD A;  1KA8 A;  5LGN A;  4U87 A;  1OYY A;  1Z7U A;  2KZV A;  4MO7 A;  3H5R A;  3LAJ A;  1HXD A;  3S1R J;  3FMS A;  4TV7 A;  5FFX A;  5HOO A;  4I7H A;  3KLO A;  2Q2E A;  1BJZ A;  3L00 A;  4XM3 A;  4EM0 B;  4RB1 A;  2LBF B;  4AD9 A;  4M3D A;  4IZZ A;  3SDB A;  4BQN A;  2GM4 A;  4UHT A;  3RPU A;  3CDL A;  3I0T A;  3RYP A;  2L3D A;  2VI6 A;  4AWX B;  3HTS B;  2DMT A;  4AVZ A;  2DXI A;  2STW A;  4P1W A;  3OYI A;  2LD5 A;  2TRT A;  1LKX A;  2L7Z A;  4D7N A;  2HNH A;  2O8K A;  5FKO A;  5B66 C;  4C3H J;  1YIT I;  2COM A;  4ZZD A;  4F7Z A;  3S1Q J;  2F5F A;  1JGS A;  1S7O A;  4X1E A;  5JI6 A;  2BZT A;  1YO5 C;  2X1E A;  4ENM A;  5GAD J;  2DQR A;  3GTL J;  3R0J A;  3LL7 A;  2QQA A;  3I54 A;  1KU9 A;  4H4K C;  4CCO A;  2XAJ A;  3SEQ A;  1MJ9 A;  2IJL A;  1XX5 A;  2EV0 A;  2NNY A;  1K83 J;  2OAZ A;  4LIU A;  2WTE A;  1EJ9 A;  3CP2 A;  1R1T A;  3HXL A;  1JKQ C;  4XLA A;  4IEJ A;  4BAC A;  2QWW A;  4MGR A;  3SZP A;  4DBQ A;  2FE3 A;  2M3A A;  3VYT B;  2LR8 A;  2MGQ A;  2VBW A;  3D5R C;  4OIO F;  2IP2 A;  2VBZ A;  4EQQ A;  2CFX A;  2ESN A;  1A36 A;  1R5H A;  4XKV A;  3TOA A;  3LOC A;  1LQ1 A;  3GFL A;  2CQK A;  3QPT A;  2M1B A;  3RKY A;  4EJU A;  2GIV A;  3E5Q A;  3F8N A;  3S14 J;  4NDL A;  3JTG A;  3FKJ A;  4Y33 A;  1T56 A;  2IGN A;  2EQR A;  3WU0 A;  1DGW Y;  1VTN C;  1X3Z B;  4NQW A;  2X9D A;  1YW9 A;  4LG0 B;  2FF4 A;  2JSC A;  1D0Y A;  1GV2 A;  3FDY A;  3WTX C;  3HL2 A;  1R71 A;  2CGP A;  1H89 C;  1G6N A;  4QTR A;  2XSD C;  1XB4 A;  2XF5 A;  1U5T B;  3WOD F;  2PMH A;  1OCO H;  2VOP A;  4H0E A;  2ICW G;  1TNS A;  1T38 A;  4IHT A;  3CC4 I;  3KP4 A;  3HOZ J;  2E19 A;  3LAP A;  2V1N A;  2P81 A;  2K3P A;  2VPR A;  1NK3 P;  3J7Y J;  2ACJ A;  4RBO A;  4ZYA A;  1YJ9 I;  3ISP A;  4LK1 F;  1W5S A;  3V8J A;  4DYC A;  1XGM A;  2K9S A;  4HAM A;  5FKK A;  2E5Z A;  4ZH4 F;  3UNG C;  3OIP A;  3V42 A;  3FBI B;  3PIO F;  1ZKG A;  5C4X J;  1UAA A;  3WTV C;  4HBL A;  2EIM H;  5M5X J;  2IT0 A;  1SAU A;  2Z5U A;  2LTP A;  5JLX A;  4E7Z A;  2VOO A;  2Z1D A;  1JHH A;  1R1U A;  2IRF G;  3CMY A;  3B02 A;  2M2E A;  1IN6 A;  2M0C A;  5FKM A;  4CYD A;  1T08 B;  4HG2 A;  1Z05 A;  1OYI A;  1ZG1 A;  2DFE A;  1PVE A;  2DW4 A;  1ZAO A;  1MJB A;  2XC7 A;  2R5Z B;  2DDA A;  4IHW A;  4XQF A;  3KE2 A;  1JI8 A;  4YG2 F;  3GTM J;  3F8C A;  5L3E A;  4B3A A;  4NBQ A;  4M3F A;  1ZQ3 P;  1GVD A;  1IO2 A;  1WPK A;  1G4D A;  4Y17 A;  2EB7 A;  4W1U A;  4WK8 F;  4XR6 A;  3K9T A;  3CCS I;  3ZQ7 A;  1FBU A;  3GZ5 A;  3A02 A;  2MW8 A;  3ZR8 X;  5LGU A;  2Z16 A;  2IS2 A;  5HS9 A;  3M1E A;  1BR1 A;  3ZP5 A;  1QHG A;  1X3W B;  1TQP A;  4M9X A;  1A35 A;  1PUF B;  1KU2 A;  3FXL A;  3SQN A;  2OTL I;  4FAS D;  4OIP F;  2DI3 A;  2DBB A;  3TO6 A;  2R7R A;  3OS2 A;  3HTU A;  3FM3 A;  3GYH X;  3QU6 A;  1YS6 A;  4I2O A;  2XSJ C;  3GZN B;  2A05 A;  2J5P A;  5J47 A;  1TZL A;  1W7P B;  2O6G E;  2QM3 A;  2WAD A;  2LKP A;  3DCF A;  5FLX Z;  4RDU A;  1YJW I;  2CV1 A;  1ZR2 A;  4BKX A;  2QCO A;  4X0G A;  3OYC A;  3I53 A;  1R9T J;  1EH6 A;  4RAZ A;  1R4M B;  2NVY J;  3FXQ A;  1WZ2 A;  1XMK A;  2F5D A;  1OLT A;  1S7E A;  4D5F A;  4RMN A;  2DU9 A;  2X6Y A;  3OS1 A;  4KN4 X;  3PNY A;  4EGZ A;  2Y9Y A;  1XD7 A;  1VQL I;  1FT9 A;  3DU6 A;  2DA2 A;  5DEQ A;  5BMZ A;  1ETQ A;  2LKX A;  5D5U B;  2H6C A;  4RAG A;  2ZME B;  1XSV A;  1U9O A;  1T0F C;  2DFH A;  3DF8 A;  4OIR F;  1JUP A;  2GA1 A;  1ORK A;  1XGN A;  3BG7 A;  3JRD A;  2FD5 A;  4FET A;  3T5X A;  3HSR A;  1QZZ A;  5F64 A;  1WJF A;  2R7F A;  3HSF A;  3WTW C;  2A6T A;  2V1D A;  1FLI A;  2KRH A;  2E2I J;  4XSX F;  3TED A;  4O3M A;  4D7M A;  4UVB A;  3RZO J;  4GGG A;  2IGM A;  1IN8 A;  1E3O C;  3R0A A;  4II3 A;  4ESF A;  2WWY A;  3I4M J;  1B72 B;  5GTI C;  3HOU J;  1ZAR A;  1MGT A;  3WU1 B;  1WJE A;  3D5L A;  4OU0 A;  4I6Z A;  4FX4 A;  3MKY B;  4G9Y A;  3EPZ A;  1K78 A;  4M6V A;  3K4K A;  2JK3 A;  3H1C A;  2A5Y B;  5AIQ A;  5LD2 C;  2LOO A;  2JT1 A;  3BG6 A;  1MMN A;  1NHA A;  3BR5 A;  4N4O B;  2XPW A;  2JTV A;  4KN7 X;  4CYC A;  2FX0 A;  2LYC A;  2K86 A;  5CVV A;  3HOS A;  3AL0 B;  3ZGK A;  2EFW A;  3I4P A;  2GWR A;  3NAR A;  4HLX A;  5KAI C;  4ABZ A;  3PNT A;  1AU7 A;  3HUG A;  4RM2 A;  1BC7 C;  3VYR B;  2ZJP F;  1IV8 A;  1M1E B;  1HF0 A;  2IXS A;  3BLY A;  1JUM A;  3G1O A;  1SMT A;  4A3F J;  1J7K A;  2BYV E;  3GX4 X;  2W24 A;  1ETW A;  2HYF A;  3HPG A;  2VJJ A;  2I5U A;  1VQ6 I;  1MBJ A;  4UVC A;  1LUJ B;  3VEP A;  1LE8 A;  4C2U A;  3J81 Z;  3H3Z A;  1IXS B;  4BL0 B;  3OV8 A;  1MBH A;  3BTC A;  1XTA A;  5E3N A;  2BV6 A;  2XRO A;  3L2W A;  3WU2 C;  1R6R A;  2CUF A;  3KEO A;  3DLL F;  3DU5 A;  2XDV A;  1XGS A;  1I1G A;  2CUJ A;  2HVQ A;  3QPL A;  1D0Z A;  2DJN A;  4M72 A;  2K9L A;  2EJR A;  5ICF A;  1PYV A;  5EEA A;  1E3H A;  3LMM A;  4BGD A;  1SC7 A;  4LMY A;  1FOY A;  1YIO A;  5GTH C;  5FLX K;  2EFO A;  3BZC A;  3V7C A;  4UV8 A;  3C2G A;  3ML6 A;  4N9I A;  2WBM A;  2X51 A;  3PL8 A;  1WKM A;  3VDX A;  4UB8 C;  3H36 A;  5GAH J;  1MNM C;  3CLQ A;  2G7U A;  2A6H F;  1G3W A;  3FF5 A;  3MQ0 A;  1RR7 A;  5JHF A;  1QZE A;  1R7J A;  1YW7 A;  5LRS A;  1HW5 A;  2QLZ A;  1IUY A;  4EJW A;  2L7F P;  4KMF A;  1ZYR F;  4IPA A;  2STT A;  1S5L C;  1DU6 A;  1BN5 A;  4DBR A;  3JRB A;  4MHG A;  4CO8 A;  4A5N A;  4YFX F;  2E1O A;  4ZYD A;  3W2A A;  3P9C A;  1HKQ A;  5FB2 A;  1KQ8 A;  4G7O F;  4C9Y A;  3HOV J;  3C1D A;  1JTY A;  1Z6R A;  5F1J A;  1RUO A;  2MC4 A;  4A3C J;  3LSG A;  3OYN A;  2A07 F;  3CDH A;  2VUM J;  1AKH A;  1F1Z A;  3V4G A;  1U6G A;  3MAJ A;  4FTH A;  5HLT A;  4GFB A;  1S9H A;  2P5L C;  1REP C;  1R58 A;  2PX9 A;  4XKC A;  5E79 C;  3E6B A;  2OCC H;  1LVK A;  3K2Z A;  3H5N A;  1Y0N A;  3BJ6 A;  4B1R A;  3Q9S A;  3O6B B;  3FZV A;  3OL4 A;  2E60 A;  1X3U A;  2PBI A;  1BM9 A;  3QPH A;  2HPM A;  3ZQG A;  3OYJ A;  1MBK A;  1Z3X A;  3BTJ A;  1W36 D;  2JUG A;  2EFN A;  3IUO A;  4EV0 A;  5BPD A;  4IOC F;  3KZZ A;  4R8H A;  2QEX I;  1YHQ I;  2W57 A;  3TL4 X;  2AXL A;  5H6R A;  2E71 A;  2JZY A;  2RVC A;  4LB5 A;  1SVO A;  2TDX A;  3HKZ N;  4HLY A;  1QVT A;  4CIC A;  2M45 A;  5D6E A;  3J81 K;  2E7X A;  5IP9 J;  5ED4 A;  4I02 A;  2LFB A;  4P5O A;  1FIA A;  2P8T A;  3OSG A;  4L0Z B;  1KON A;  2J5O A;  4B4C A;  1NG7 A;  4ZJZ A;  2FEZ A;  2E34 A;  1IG7 A;  3QOE A;  5B3S H;  2X1C A;  5ILV A;  3W6K B;  3CCY A;  2K4J A;  3U2R A;  5M5W J;  1QU3 A;  1WQ2 A;  3O2P E;  1HDP A;  2ZNZ A;  4JX4 A;  4IO9 F;  2CMP A;  3EYY A;  2L9N A;  2IGO A;  4G7H F;  2L9S A;  2IAI A;  3F0C A;  2LMD A;  1DUX C;  2LRD A;  2HQN A;  4XLF A;  3KP7 A;  2Q0O A;  5J8C A;  1MZB A;  3M4O J;  3TDZ C;  5B5E C;  4U7D A;  5IPA A;  3KX2 A;  4UXN A;  1D1B A;  1WH5 A;  2PMZ N;  5HNH A;  1K78 B;  2JQ7 A;  2V9V A;  3L1P A;  2E2J J;  1ZR4 A;  3IH3 A;  1DQU A;  1LVA A;  1WCM J;  3QOP A;  3WTY C;  3I71 A;  2UZK A;  2JJ7 A;  4E7I A;  3SFZ A;  4X6A J;  4I99 C;  4J19 A;  5EG0 A;  2TCT A;  3FMR A;  5BS6 A;  3K70 C;  2KIF A;  2EZI A;  2MBF A;  2NRA C;  5GAG J;  3N05 A;  5E3O A;  4KDP A;  2MH2 A;  3HUG B;  3ZQL A;  4F52 A;  2P7C B;  1YQA A;  2LY2 A;  1QA6 A;  1Q1V A;  4Q48 A;  3TP3 A;  3FWE A;  2Y30 A;  1WI3 A;  1U0J A;  3ZMU A;  2KRC A;  1YG2 A;  2LBF A;  4IL6 C;  1TL8 A;  4FE7 A;  3K7A J;  1LE8 B;  3K4L A;  3BPX A;  3IRQ A;  2QQ8 A;  1ZK8 A;  1X1P A;  1RPW A;  4HEA 2;  2W00 A;  1Y8R B;  4QIW N;  1BI2 A;  2LDU A;  3GW2 A;  1KQ9 A;  1SVL A;  3CJN A;  4XOR A;  4GO1 A;  4WWC A;  3I9V 2;  5IY5 H;  2Y75 A;  1APL C;  2HZT A;  3VPR A;  3Q0U A;  2NVT J;  3CCR I;  3IP4 B;  3SFI A;  3HOY J;  5C3E J;  3SXY A;  3HYI A;  3IL2 A;  3W6V A;  5IP7 J;  2KDZ A;  3R6S A;  4PUS A;  3RZD J;  4EJV A;  1U5T C;  3COA C;  2HPI A;  3QYF A;  1ENH A;  3SJM A;  3CCL I;  4IVN A;  2CU7 A;  3HRS A;  2DPD A;  3WGG A;  3EUH C;  3DKW A;  3E6D A;  3KP3 A;  4LLN A;  3K0L A;  1P92 A;  4XLH A;  1QVU A;  1HDD C;  2OJE D;  2RQQ A;  3JTH A;  5DD8 A;  2ZBK A;  2FRH A;  1W1W E;  3PO2 J;  4KIT B;  1QNT A;  1JGG A;  3JRG A;  3HRM A;  4LFU A;  4ZYG A;  3WGI A;  2ZFW A;  2DK5 A;  2P5K A;  2QVO A;  3L7W A;  4EEF G;  1VQP I;  5DM6 F;  3RKX A;  2HYG D;  1UST A;  3GME A;  4ENN A;  4BHB A;  5JFR A;  1UG2 A;  3ASO H;  1TT0 A;  4F3Q A;  5JVT A;  3JRA A;  4CCM A;  1WGX A;  2HKX A;  3DXJ F;  3GO5 A;  3S8P A;  1FNN A;  3BOQ A;  2FU4 A;  3LSJ A;  1ZRD A;  1ZH5 A;  3HRT A;  1QZY A;  2DJI A;  2NVU B;  1R5I D;  1VF9 A;  2K27 A;  3A1Y A;  3M8J A;  1S29 A;  2Y69 H;  3G3Z A;  2PN6 A;  5HS8 A;  2EA2 A;  2NOJ B;  2NYX A;  3LQR A;  3J80 K;  1D1A A;  5KAF C;  3BG3 A;  2R7V A;  3PQJ A;  2HWV A;  2DA1 A;  2DCE A;  4A0Z A;  1IRX A;  2NAZ A;  5C4J J;  1K4S A;  1BC8 C;  2FOW A;  3ZQC A;  2IS4 A;  2JA5 J;  3F8B A;  2HDD A;  2WC2 A;  1FTT A;  1TQI A;  4XOP A;  2WAF A;  3ZN0 A;  4NNJ A;  3A0B C;  2QKM B;  4PFP A;  5ILS A;  1Q1H A;  4BXX J;  2O9L A;  1UG0 A;  1FY7 A;  1VQN I;  3CUQ B;  3KP2 A;  3O3K A;  1C0W A;  3WTS C;  1B9N A;  4EJT A;  5LLQ A;  1WVR A;  1Z77 A;  3VOD A;  1WJD A;  3WHB A;  3LNQ A;  5J3L A;  1HW2 A;  2R92 J;  4A3J J;  4BE0 A;  4G6T B;  4ZDL A;  1FWZ A;  2O03 A;  2M30 A;  2ZB9 A;  4RAF A;  1MMS A;  4F91 B;  3LSR A;  2HS5 A;  2VB6 A;  3A4C A;  1ZN2 A;  3GFJ A;  2CG4 A;  2R5Z A;  4ZZL A;  3FXR A;  4GYI A;  1T8I A;  1IN5 A;  4Q5S F;  4CCN A;  3CES A;  4DQ2 A;  1RET A;  3JCU C;  4KT6 A;  1IC8 A;  1T2K A;  2JMW A;  3F22 A;  1FOX A;  2M8E A;  1ZHF A;  3OOP A;  2E1C A;  4HF1 A;  1Y0U A;  1UFM A;  2L4M A;  2F6C A;  3MN2 A;  5K7H A;  1XSD A;  2QQ9 A;  1A31 A;  5J8F A;  4E7J A;  3GBG A;  3ULQ B;  1ZGJ A;  1R49 A;  1FP1 D;  3TOB A;  4WCG A;  3ZQI A;  4C30 A;  1V5G A;  2IA2 A;  4HNT A;  1RC9 A;  2L01 A;  4E6K G;  2W7N A;  1ZRC A;  4BXF A;  2XF7 A;  3V8L A;  4DNC A;  1OMI A;  4F55 A;  1IW7 F;  2VQH A;  3PIP F;  3F23 A;  3DBR B;  4UV9 A;  2OBP A;  1YS7 A;  3GXO A;  1N77 A;  2GBY A;  2L4A A;  3DFG A;  3QOD A;  1LFP A;  3L9F A;  1IXC A;  2M9H A;  5EJC A;  1Z1D A;  3GTQ J;  4AIK A;  4IQ4 A;  4YII A;  1W7P A;  4KIG A;  1W0T A;  1UEL B;  2KMU A;  2E5N A;  3I59 B;  4WX9 A;  1LFU P;  2ZFU A;  4G6Q A;  4WXH A;  2FOK A;  5F04 A;  3IH4 A;  4U7B A;  2RAE A;  4EJO A;  2NVX J;  3KIO A;  4CSW A;  4B09 A;  5E18 F;  3K2A A;  1SD6 A;  3KEY A;  3KZI C;  3E5X A;  2DOA A;  3F8F A;  2VPL A;  2HOE A;  2IA1 A;  2X48 A;  1YJN I;  4DIQ A;  2K9M A;  2HFH A;  3OMY A;  1UHS A;  3AL0 C;  4Q4Z F;  3K4N A;  2XPV A;  2ZME A;  4ZTF A;  1ULY A;  2BXY A;  1KZH A;  5E1Z B;  1XCV A;  2K40 A;  4IJA A;  2L54 A;  3ZQF A;  1G3S A;  1H88 C;  1MIJ A;  4PJM A;  1FTZ A;  1OQY A;  2P5V A;  3TO9 A;  1U8R A;  1FPQ A;  2HTJ A;  2DTR A;  2E7W A;  2ESH A;  2WAE A;  4NC7 A;  2IS1 A;  1MH4 A;  3F21 A;  2A68 F;  2MFZ A;  2V26 A;  3M07 A;  1J09 A;  2HOA A;  4MLO A;  1YX3 A;  5CVJ A;  4XRF A;  4EM1 A;  3IV5 A;  4I0A A;  1B72 A;  4N0B A;  3OYE A;  3ERE D;  2RC4 A;  4M71 A;  4P55 A;  3CDI A;  4A6D A;  2IW5 A;  2G7H A;  3KYL A;  3I4N J;  5E17 F;  2X6X A;  1FMV A;  1KU3 A;  4BEH B;  4L9V A;  1CF7 B;  3NEU A;  3PSI A;  5DCF A;  3IAS 2;  4S05 A;  2KZG A;  3CJQ B;  2ISZ A;  3S1M J;  4Q47 A;  1WHU A;  5TJJ A;  3VFZ A;  4HST A;  2CUZ A;  5HDG A;  5DV5 A;  1VQ4 I;  3G2B A;  1QPI A;  1TWG J;  5IP6 A;  1D5Y A;  3I55 I;  3F72 A;  2DOE A;  3RDI A;  3DPT A;  2A69 F;  2LC2 A;  3S15 J;  2Y9Z A;  2DA6 A;  4GCV A;  3H35 A;  1IRF A;  2LY9 A;  2CFO A;  5KNL A;  2OF7 A;  1RIO H;  2DT7 B;  1PJR A;  1L0O C;  5E3M A;  2JPB A;  3BG9 A;  4BE1 A;  5TRD A;  4IKF A;  2EFP A;  2OCE A;  4MEY F;  5TIS C;  3H3U A;  4P96 A;  3H9Q A;  3KZY A;  1K6O A;  1R36 A;  4CDG A;  3RQI A;  1SFE A;  2CRG A;  2JA2 A;  2WY7 Q;  2L0K A;  3ZOB A;  1RUN A;  5D8L B;  3CCV I;  3MWM A;  4D0P A;  4YFN F;  2HXO A;  5DTD A;  2BY1 A;  1YFH A;  4JX5 A;  4E70 A;  3IH2 A;  5FLM J;  1YOV B;  4ZC3 A;  2LF7 A;  1SEU A;  3HZJ A;  2ZXJ A;  5K7Z A;  3T8T A;  2FNA A;  2XGC A;  4N4N B;  2KJC A;  3WE2 A;  2EIK H;  2KRF A;  2PI0 A;  2R93 J;  1WWX A;  5EYR A;  3KCC A;  2BEO A;  3LA2 A;  3K10 A;  3FM5 A;  5JLW A;  1DPU A;  2Y0S N;  2DA5 A;  2X6W A;  1G3T A;  2KPM A;  3PJR A;  1BBY A;  2V1U A;  1HQC A;  4UY8 I;  5F08 A;  4LGW A;  1DPR A;  3S17 J;  1VQ8 I;  1Z91 A;  3PSF A;  2X6O A;  4CZC A;  4IRI A;  4BU2 A;  1LDD A;  2M8G X;  1ZGA A;  2OC6 A;  1E0E A;  4C3I J;  1QPM A;  1B8I A;  3CQZ J;  3ZMZ A;  1K6Y A;  2VKV A;  1U8B A;  1K79 A;  3B6C A;  1SAN A;  4E7H A;  4PJN A;  1IRG A;  5AIP A;  1HBX G;  2LG4 A;  2OZ6 A;  1BI1 A;  4JQF A;  3J7A O;  2UWM A;  5CKT A;  3ZCO A;  1IAW A;  1FOK A;  4L9T A;  3BZK A;  1VFC A;  1T98 A;  2E1M B;  3FXU A;  2A61 A;  1LB2 A;  1F5T A;  3A2K A;  3VOE A;  4HF0 A;  1GUU A;  2V79 A;  3BC8 A;  3TKY A;  2XGX A;  2ZJ2 A;  1V3F A;  2OD5 A;  4N9H A;  5EZG A;  1HA8 A;  3EUA A;  4KUM A;  4E4H A;  1R22 A;  5FKL A;  1MND A;  4IF4 A;  1I6X A;  3K6G A;  2PJP A;  1HW1 A;  2DMQ A;  2AQE A;  4M9Z A;  5E8G A;  3QAH A;  4HDU A;  4QSH A;  3S93 A;  1Z3Y A;  3T0Y A;  1JTX A;  1Z67 A;  1RR8 C;  5FD6 A;  3C2H A;  2RNJ A;  1U9N A;  2XGD A;  3I3L A;  3G1M A;  3MZH A;  4HW0 A;  2WB1 A;  3WTU C;  2CS3 A;  1GHC A;  4V19 K;  3DP7 A;  2O61 A;  2RQP A;  5EZH A;  4E7L A;  1KGS A;  2X4H A;  2CH0 A;  5TGT A;  1SD4 A;  2O3F A;  4JK1 X;  2GIZ A;  2XAQ A;  2XAS A;  1E2X A;  3HPH A;  2ME6 A;  1MSE C;  1ETK A;  4OMY A;  2EA4 A;  4ZYH A;  1NH3 A;  1I27 A;  2V9K A;  1TW3 A;  2ADU A;  3HC7 A;  1VZ0 A;  3JW4 A;  5GPC A;  5FO5 A;  4UVA A;  3O8H A;  1J0R A;  1SD7 A;  4RGX A;  4IRG A;  2EV5 A;  3HG9 A;  4BBS J;  1HOM A;  1XG1 A;  1FIP A;  2XAG A;  3OYK A;  1P6R A;  1ZG5 A;  4XON A;  3RKW A;  2DA7 A;  2LSO A;  5LHI A;  3BCB A;  1I5Z A;  5CPR B;  3V7S A;  3SZG A;  4BYY A;  2JUC A;  2KIQ A;  5CQG A;  4GYG A;  3S3N A;  3SEZ A;  4XSZ F;  5J6X A;  1FYK A;  2L2O A;  2H09 A;  2IEK A;  4B8X A;  1IRZ A;  5J1R A;  5HDK A;  1BOB A;  4A93 J;  1GVJ A;  2A3S A;  4B48 A;  5E3L A;  1XMX A;  1B6A A;  3I56 I;  2XUB A;  3B73 A;  4XRS A;  4BDY A;  1O7F A;  1V5F A;  5D4S A;  1IZ1 A;  2XAF A;  2AO9 A;  2M4K A;  1Z7L A;  2H1L A;  4CCJ A;  4HRI A;  1LEA A;  3V7R A;  1MMD A;  1SFX A;  3HHH A;  3M7G A;  4HDV A;  5IOZ A;  3QYB A;  2VJ5 A;  5ICC A;  1GLN A;  1I50 J;  2OU2 A;  3DEW A;  3LA3 A;  4A3E J;  2K9Q A;  2CO5 A;  4PJ0 C;  2IGK A;  4L0Y B;  2AXT C;  5DM7 F;  1TT5 B;  1WI9 A;  3FXJ A;  3GCM A;  5F0F A;  2G0E A;  3LQQ A;  4AVP A;  2VKH A;  5F1R A;  2VE8 A;  2XV4 S;  1G8X A;  3L2R A;  4DZP A;  3RI4 A;  5ICG A;  5D6F A;  3GFM A;  9ANT A;  4HQM A;  3X2Q H;  1IN7 A;  2BHZ A;  2MD5 A;  5HLI A;  3EYI A;  4PK4 A;  3SZT A;  1MBG A;  2BW3 B;  3HOT A;  1MDM A;  1YRN A;  5IT9 Z;  1A04 A;  2R7T A;  2HVR A;  3MVP A;  2P7V B;  1OYW A;  5IYB J;  1FJL A;  2NS8 A;  1XDU A;  3FIW A;  4XRS G;  2ETH A;  3HDD A;  4B44 A;  4HX7 A;  3BR1 A;  2Z33 A;  4DGW B;  1FEX A;  2ISY A;  3K4B A;  3EQL F;  3BR0 A;  4OAZ A;  3DLA A;  4P9F A;  3RSN A;  1OR7 A;  1R23 A;  2DN0 A;  3PNV A;  1B59 A;  2XPU A;  4M6X A;  3RYR A;  3Q3S A;  1BIA A;  3DKX A;  2KKO A;  1DU0 A;  2DDB A;  1OCP A;  3GVA A;  1EV7 A;  1V55 H;  1Y8Q B;  2P6T A;  3NQO A;  2VLA A;  1B8I B;  1FSH A;  3OIQ A;  4CHU A;  1I1S A;  4QPO A;  3KP5 A;  3QQA A;  1J9I A;  2BVL A;  3DV8 A;  3JRI A;  1JT6 A;  3CME I;  2BY2 A;  2H6B A;  4L18 B;  4ON0 A;  3OYG A;  1DP7 P;  1RES A;  2W25 A;  4L5J A;  4A2U A;  1TWH J;  1TWF J;  2EH3 A;  2GZW A;  2MD0 A;  4XRM A;  1OCT C;  2BY3 A;  1YX5 A;  2WV1 A;  4I0B A;  3D0S A;  1DDN A;  2GLO A;  5GAE J;  1X1C A;  3QYE A;  4DJA A;  5DCM B;  5J4Y A;  1TQM A;  3OYA A;  3GTK J;  4MFE A;  5E1X A;  4Y13 A;  2FMY A;  4HSR A;  5LEK A;  5F6F A;  3BR3 A;  4NC8 A;  3C3W A;  3BWG A;  3PFY A;  4I09 A;  2IVM A;  4YEL A;  4G7Z F;  1ON1 A;  1LFB A;  2MA3 A;  4PGG A;  4V2G A;  3GZ6 A;  2E2H J;  4AM3 A;  2DQL A;  2XKP A;  1AA7 A;  2DOF A;  3CUQ A;  1QRY A;  5DS9 A;  2LNB A;  4BQO A;  5FRO A;  3F9K A;  1SVM A;  2YUS A;  4CXF A;  1OJL A;  1CGP A;  4BDZ A;  2X1D A;  1UJ8 A;  4A0Y A;  2ZCW A;  1XS9 A;  3F3X A;  2V6E A;  1ZG3 A;  3KYD B;  3MEX A;  4BBR J;  1WJB A;  2R7U A;  4HV6 A;  1OKR A;  1ZLK A;  3WE3 A;  3LSH A;  2VQL A;  3RQ4 A;  2B63 J;  3DWL E;  5K7F A;  1OFC X;  3HBL A;  1ZTR A;  5D8K B;  5BPI A;  2ID3 A;  2X0L A;  1P9Q C;  3CCE I;  1FMW A;  1H9G A;  1TW2 A;  5DDG A;  4A12 A;  3V8K A;  5IT9 K;  1B1B A;  3NRV A;  2ELK A;  2UXX A;  4RAY A;  2CYY A;  3CCM I;  2NNN A;  2MC3 A;  2JVH A;  2R0Q C;  2KJB A;  1U78 A;  3H9G A;  4XLC A;  4Y3O A;  1JKP C;  2YS9 A;  2DFF A;  5HDN A;  3HRU A;  1FBQ A;  4G6D A;  1IJW C;  2HQ5 A;  2XGE A;  1FYM A;  3SYT A;  2GXB A;  3IRR A;  4G94 A;  1YI2 I;  3F6O A;  3I59 A;  1O4X A;  1TLH B;  3DPU A;  4EM2 A;  3K4J A;  1O7L A;  5CQE A;  4MFD A;  1TTY A;  3BDD A;  1STZ A;  1H8A C;  1HCR A;  1BA5 A;  3BP8 A;  2HDC A;  2ZXI A;  3GTG J;  1Z0X A;  2K3F A;  3L2U A;  3G73 A;  3HSE A;  2R7Z J;  3HGG A;  4AUX A;  2OPT A;  4YIR X;  2OZU A;  2BE5 F;  3LSP A;  2VT3 A;  2VJ4 A;  3IWZ A;  2FQ4 A;  1SFU A;  5HNF A;  2CJJ A;  4BJ5 C;  4S04 A;  5FRN A;  4KIC A;  5CVI A;  3ZRG A;  3T1B A;  1LPQ A;  4HV5 A;  4CCK A;  2PFB A;  1MDM B;  1YRN B;  1MNE A;  5A2Q Z;  2DTZ A;  1VQ9 I;  1X1A A;  4JP0 A;  3TW7 A;  5F27 A;  5HVQ C;  2EBI A;  2HGC A;  2HDW A;  4FX0 A;  5L3B A;  2H8W A;  5E20 A;  4A6E A;  5HLH A;  3M1C A;  3OR2 C;  5LFA A;  1ETV A;  3E0J B;  3FX3 A;  4BEH A;  2FBH A;  5J1U A;  3CP8 A;  1CF7 A;  1TBX A;  2F48 A;  1T39 A;  1D5V A;  4DW6 A;  4LB6 B;  2RV8 A;  2WAQ A;  2EIL H;  5BQT A;  3HEF A;  1R5G A;  3CUO A;  3K1M A;  4LLG F;  3CO7 C;  3HOW J;  1MJA A;  2QYO A;  5E8I A;  2FML A;  1D0X A;  2AS5 F;  3OIO A;  1ON2 A;  3CO6 C;  3PM1 A;  2XB5 A;  2CQX A;  3ABU A;  2EIN H;  1BIB A;  2KIM A;  2R7O A;  3DEU A;  3SHF A;  3UR3 C;  1R1V A;  3FK6 A;  5HS7 A;  2HU9 A;  3E6M A;  4NC6 A;  4UUS A;  2LLK A;  1VQ7 I;  1IN4 A;  1WRJ A;  2DOD A;  2RDP A;  2YR2 A;  1VQO I;  3P9K A;  3DTI A;  1JKO C;  1TNT A;  1G3Y A;  4A69 C;  3CCJ I;  2JA8 J;  5L3F A;  3J7A Y;  2PJR A;  1SD5 A;  1TC3 C;  4DYR A;  1T33 A;  4GDF A;  4AYB A;  2VQC A;  4XLN F;  4KYW A;  3NAU A;  2W84 A;  4ESJ A;  4KFC A;  2NS7 A;  2COB A;  4AIJ A;  4LIT A;  1FYL A;  3E97 A;  1Y6I A;  5DYM A;  2E1M C;  2PQ8 A;  2K5C A;  5EGO A;  1LEB A;  1UMQ A;  3OYH A;  5FFZ A;  2PLY A;  4L9J A;  2DYR H;  3GUD A;  4IX7 A;  3VWB A;  1HLV A;  4F93 B;  1ZGW A;  3CZ6 A;  3E1S A;  3H9J A;  4GXO A;  2CW8 A;  2Y2Z A;  2GXG A;  3BT9 A;  5FJ8 J;  1XCB A;  3BTL A;  3FK7 A;  3KPH A;  2HOS A;  2MH9 A;  2HQA A;  1W5C C;  4EAT A;  1A6Q A;  3PO3 J;  2BXZ A;  3TGN A;  3W3C A;  4HX4 A;  3K4M A;  4KNY A;  2W85 A;  2JA7 J;  3E7L A;  2XB0 X;  3H0G J;  4YFK F;  4Z6Y A;  3OYF A;  3A01 A;  2V1X A;  1IXR C;  5DUI A;  1UHM A;  2A5W A;  2Y48 A;  4BHP A;  1PP8 F;  2KHM A;  2X85 A;  1Y56 A;  3N97 A;  2DT5 A;  1JJ8 C;  5A2Q K;  2XKO A;  2WV0 A;  4U88 A;  2EV6 A;  2FNP A;  2JVG A;  2ZME C;  3LA7 A;  2GAU A;  2KFD A;  1G2H A;  1T95 A;  3E5U A;  4FIS A;  3S3O A;  4E7S A;  1U3E M;  3CTA A;  4BE2 A;  2D1H A;  1QGP A;  2R4G A;  3OL3 A;  1DGR M;  2M87 A;  4PDK A;  4HQE A;  1RZ4 A;  1XPX A;  2LK2 A;  1CQT A;  2OUM A;  3QPS A;  3HB9 A;  2CQ7 A;  2EIJ H;  4UB6 C;  3T8R A;  2P0W A;  3S1N J;  4BNC A;  2BHY A;  3MFK A;  2L9R A;  3FHZ A;  3OYL A;  2VN2 A;  4RS8 A;  4FCY A;  1K61 A;  2DMP A;  5F0C A;  1UHW A;  3BCA A;  4HA8 A;  3FHN A;  2ZJQ F;  4Y7N J;  3OY9 A;  2H1K A;  3OR1 C;  3ABM H;  1J5Y A;  4JOM A;  3S16 J;  5CYV A;  5LBQ A;  2WB1 N;  1BR2 A;  2EZL A;  2QSF X;  2R7D A;  5D5X B;  2VIX A;  2BGC A;  3BJA A;  3JR9 A;  2E36 A;  3DQV C;  2VXZ A;  4XN3 A;  3JRF A;  4MNU A;  5K5Q A;  3OYD A;  4CGZ A;  2IS6 A;  1V54 H;  3LSK A;  2YPR A;  2L5Q A;  5DD4 A;  4A0X A;  4HNV A;  3WTT C;  3NWS A;  1O3S A;  3IHU A;  1NTC A;  2EK5 A;  3KLN A;  3BR2 A;  1MW7 A;  1RRJ A;  4XIC A;  5ILU A;  3DTK A;  2D45 A;  4MTE A;  3CF2 A;  5GP9 A;  3ZXS A;  4AID A;  5L3C A;  2AHQ A;  1ONV A;  2P6S A;  4GRI A;  1X4P A;  4YEJ A;  3Q0W A;  2V7F A;  2M7A A;  2RNG A;  5CLS A;  3L2V A;  3HJE A;  2VON A;  1I3A A;  2JPC A;  3ONQ A;  4CCL A;  5B1B H;  1YE9 A;  4HOB A;  3IKT A;  2L02 A;  3L09 A;  3RIR A;  4HX8 A;  4MTD A;  3W6J B;  4O5V A;  3AFH A;  3AG3 H;  1WJ5 A;  2QGU A;  1P2F A;  5M3M J;  3BG5 A;  1B9M A;  3DBL B;  3D1N I;  1W36 C;  1IUF A;  1TWA J;  2CV0 A;  4XLP F;  1VQK I;  5L3D A;  2CW0 F;  5DUK A;  1Y39 A;  3FXM A;  1FX7 A;  2B7E A;  3FXO A;  3LWF A;  4UUS B;  5CVU A;  3HHG A;  2FSW A;  3S2H J;  3GLL A;  3MKZ A;  1LDK B;  2W1O A;  3UKG A;  3NWT A;  1MMG A;  2GOM A;  3FMQ A;  4XMY A;  1MMA A;  1QQI A;  2QBY A;  1A5J A;  2XHK A;  1GV5 A;  4XLE A;  4G12 A;  2F2E A;  5E1W A;  2R5Y A;  1NG6 A;  4J01 A;  1K4T A;  4ENJ A;  4BUP A;  4KMU X;  2H8R A;  3A0H C;  2HI3 A;  2VXD A;  2PJR B;  1P7J A;  1HSJ A;  2F5V A;  6PAX A;  5JVG F;  2VT2 A;  4S0H B;  4DYQ A;  2JSP A;  3WGH A;  1W4M A;  1LJ9 A;  2BW3 A;  2LRE A;  2DLL A;  2V9P A;  1FZP B;  3M3Y J;  5EGO B;  3RKQ A;  1SFK A;  4PGH A;  4PSW A;  2CWE A;  4RLQ A;  2B0L A;  4BQQ A;  4UNO A;  1DP3 A;  2IA0 A;  4NUB A;  3Q9V A;  2Z99 A;  4BAY A;  3K70 D;  2MSY A;  3GFI A;  3L2Q A;  4A3D J;  2K4B A;  2QZ8 A;  5BOX A;  3ERM A;  3ABT A;  3S2W A;  4AIH A;  4XL9 A;  4R1H A;  3OYM A;  1ETY A;  1ZEL A;  1OIS A;  4O6J A;  3JRE A;  2ECC A;  4OIN F;  3ZMS A;  1POG A;  2NOG A;  2RKH A;  2XRL A;  3A01 B;  2JN6 A;  1FOW A;  2FQ3 A;  4M3G A;  4PFO A;  1BW5 A;  2DT6 A;  1LNW A;  1VI0 A;  5KVR A; 
#chains in the Genus database with same CATH homology
 3ASO H;  3ABL H;  2ZXW H;  2EIN H;  5B3S H;  1OCC H;  3AG3 H;  3WG7 H;  3ABM H;  5B1A H;  3AG1 H;  3AG4 H;  5IY5 H;  3X2Q H;  2EIK H;  2EIL H;  1OCR H;  2DYR H;  2EIM H;  2Y69 H;  1V55 H;  2OCC H;  2EIJ H;  1V54 H;  3ABK H;  1OCO H;  2DYS H;  5B1B H;  3ASN H;  3AG2 H;  1OCZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...