3ABMH

Bovine heart cytochrome c oxidase at the fully oxidized state (200-s x-ray exposure dataset)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
b'YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3abmH00
3ABKH 5B1AH 2OCCH 3AG3H 2Y69H 3WG7H 2EILH 1OCCH 2DYRH 3AG2H 2EINH 3X2QH 2DYSH 3AG4H 3AG1H 1V55H 1OCZH 2EIMH 5IY5H 3ABLH 3ABMH 3ASOH 5B3SH 2EIKH 2EIJH 1OCRH 2ZXWH 1V54H 5B1BH 1OCOH 3ASNH
chains in the Genus database with same CATH superfamily
1BM9A 2ECBA 1XPXA 1O3RA 1OYWA 2KRCA 2PI0A 2XSDC 1RKWA 2VJ5A 3GFLA 3H5NA 2M0MA 1D5VA 3LSRA 1W7PB 4NDLA 3S2WA 3CCVI 4EGZA 3BG5A 3VSLA 5D8LB 1EF4A 5FLVA 5CKTA 3LQQA 3SQNA 1RUOA 1TWFJ 3HTSB 3OYMA 2A69F 2R5YA 3CMMA 3VODA 4HSRA 4Y4RA 2OJED 4OMZA 2VBZA 1ZARA 1TW3A 3LFUA 1ON1A 1AKHA 3DTKA 4BGDA 4I99C 5ICCA 4XLCA 3ZN0A 4DYQA 3G4SI 2YU9J 1S7AA 3BG6A 4XLFA 1IRXA 2KPMA 2L7ZA 2JA2A 3GTMJ 3E6MA 2P4WA 2QCOA 3H0DA 5A2QZ 3EUHA 4B09A 3OR2C 1VQLI 1ZYRF 1B1BA 4A3DJ 1G2HA 3H36A 2X4HA 2O7OA 2MH9A 4O6JA 3V8KA 5JI6A 3I4NJ 2HVQA 1YIOA 4RGRA 4MNUA 1G3WA 2EV6A 2ZXIA 5FRNA 2Y48A 2VL8A 1BL0A 2NRAC 2VJIA 4XN0A 3CC2I 1H9TA 5M5YJ 2E2IJ 2CFOA 4YEJA 1JKPC 1NG6A 2IS4A 1S8NA 2NS8A 1USSA 4A5MA 4IZZA 2XGCA 4A0YA 1FSEA 1ETVA 2DTRA 4N0BA 3S93A 4JX6A 4FETA 2NVQJ 2CQQA 5F04A 3WODF 2KL4A 2JVGA 1T08B 3KX2A 1T2KA 5LFAA 4ESFA 2DW4A 5DEQA 2E71A 3ZQGA 4BDYA 1Z91A 4WX9A 3CDLA 4B1RA 5F6FA 5ILUA 2D1VA 3CF5F 4PGHA 4XLHA 1KONA 4I98B 1FBUA 2VKHA 3KYCB 1U5TA 2V1XA 4Z2YA 3LAPA 4Y13A 1BN5A 4ZYEA 4Z6YA 4JX5A 2P6SA 1R71A 2F6CA 2OTLI 1B72A 3R6SA 2NVTJ 2F5DA 3W2AA 2DDAA 1ZKGA 2FJ1A 3BP8A 2MABA 5IY5H 1FIPA 2PMZN 3BY6A 3QPTA 2CW8A 3AAFA 4RAFA 1J7KA 1PYVA 2FOKA 2EZKA 1SAXA 3FBNB 1DUXC 2ESHA 1IXCA 3SYTA 5D4SA 3GZ6A 3QYEA 5E79C 1ORKA 3J7YJ 1G3SA 4A3LJ 1WSUA 4KMFA 1OR7A 3PQJA 2IGOA 3QWLA 4XKBA 5E1ZB 1P4XA 1X2NA 2E1MC 1R22A 3OYEA 1SVOA 1IDYA 3SZGA 5DCMA 5KCMA 4QLCU 1FIAA 1XDSA 3MCZA 3F72A 3LQRA 2FXAA 1S6LA 2ISYA 1WJBA 1XMKA 1IJWC 4LIVA 3S2DJ 1W5CC 3OS0A 1J9IA 1Z3YA 3K4KA 3SHFA 1X1CA 2IS1A 3ML6A 1E17A 3I5UA 1IN4A 2ELJA 1V5EA 5LGNA 2VKDA 4JBAA 2DPUA 1QRYA 4KT5C 4DYCA 5LRRA 2IGKA 3K4LA 4DOZA 2OV7A 4RLFA 4PSWA 3VOEA 2R7TA 1MMGA 3FKIJ 2EBIA 3GF2A 1J59A 1RI7A 2QWWA 1ZGJA 1RUNA 1HCRA 2KJCA 4L18B 2ZXJA 1H8AC 1AA7A 1LKXA 4EM1A 4ZC3A 1MDMB 1A04A 4IRIA 3QU6A 1XS9A 4A3EJ 5BMZA 3GCMA 3I59A 3KP7A 2R7ZJ 2VC1A 3FHZA 3E5QA 5IP6A 2ISZA 2E1NA 3HRMA 2ELHA 4B3XA 5BPDA 5D6EA 1HDDC 4II3A 2AS5F 5ICGA 1UCRA 4M3BA 3T8RA 1GVDA 3W6KB 2LVSA 2ZC2A 4MTDA 4UUTA 3NWSA 2B0LA 2WAQN 1Y1WJ 2Q2EB 2NVUB 5FKLA 3GTQJ 2XAHA 5F64A 2GOMA 2HXIA 3NARA 5M5WJ 2W84A 2M4KA 2VOPA 3Q5FA 2H1KA 2V9KA 4NC7A 2HQRA 1XCBA 1TWCJ 1VF9A 4HF0A 3WHBA 1P7IA 4YIRX 3HOTA 3GW2A 1VI0A 1BR1A 4S04A 4MFEA 1MKMA 3BTIA 2WY8Q 4DBQA 1NK3P 4RM3A 1P4WA 3HSRA 3P9CA 2RNJA 1YRNB 1UG2A 2WB1N 4HF2A 2R7UA 3PQKA 3T8TA 2HDCA 4E7IA 3A03A 1IF1A 3PJRA 3FMQA 3H3ZA 2A05A 3HZJA 4GRIA 3AL0C 2DCEA 3CZ6A 3T0YA 2FBKA 1BOAA 2QKMB 2KISA 2ZMEB 3V7SA 1YI2I 3FM3A 4CZCA 1IN8A 1WVRA 3M8EA 4RB3C 1FYMA 2K9MA 1Y0NA 4BKXA 2IEKA 3ESWB 2R4GA 3PFYA 1F36A 3KPHA 2DMUA 1CGPA 3HSFA 2D1HA 5EGOB 1Z05A 3TW7A 4I0BA 2RC4A 1U8RA 4J01A 4H4KC 4M3EA 2QBYB 5F0FA 3GTJJ 1D0XA 2VQGA 2AQEA 4LFUA 1BI0A 3SFZA 2Y0SA 3DEWA 1IG7A 2V7FA 2IGMA 5CYVA 3KYDB 4XLEA 3DBRB 4CUGA 5J1UA 5L3EA 1MJAA 3WTXC 1BJZA 4DZJA 1HBXG 2CYYA 2GBYA 1SVMA 3H9QA 5BS6A 2A5YB 3CO6C 2VXZA 4HX4A 1SD7A 2W85A 1X1BA 5FD6A 1E0EA 5EEAA 3K70D 4J00A 2XF6A 3K4NA 2HVRA 2R3SA 1ZTRA 3VSKA 3RQIA 1N25A 1QVTA 4BE0A 2LP0A 1TTYA 1NHAA 2QEXI 3S1NJ 1B9MA 5K7ZA 3PL8A 1EH8A 1WH7A 3SEQA 3CESA 2OCCH 3G71I 3BT9A 4HDUA 2NVYJ 5IYBJ 3W3CA 1J75A 4A3MJ 2KLOA 1GV2A 2CV1A 5J1RA 4Y33A 1IO2A 1PP7U 3BJ6A 3BJOA 3ERMA 3QQAA 1X19A 3M4OJ 1Z0XA 2E7WA 1Z9CA 1F1ZA 1Y56A 2QGUA 3R4KA 2R5ZB 3ABLH 2X6XA 3F6OA 4HNTA 2R0QC 2R7RA 2RQQA 1XGMA 1I3AA 1RNLA 2XB5A 3W6VA 1ZGAA 3ZN1A 2VN2A 1Z7UA 3EDPA 2FOWA 3KZZA 3TKYA 4RB2C 1B9NA 4FE7A 2HQNA 1ZG5A 1LJ9A 2ACJA 3V8LA 2XVCA 1YLFA 1YS6A 3ERED 5C3EJ 2LBFA 4XSXF 3H3VK 1GHCA 1YJWI 4ZZLA 4V2GA 1X4OA 3CC4I 3QODA 1WI9A 5D5XB 1U8BA 4I02A 2EZIA 3CCYA 1X2MA 2R7QA 2IGNA 2E2HJ 1O7LA 3WGHA 1MGTA 2Z16A 5DUIA 1BC8C 3BR1A 2VC0A 2A61A 3LNQA 2DFIA 4PGGA 4XK4A 1R1TA 2VONA 3UR3C 4KNYA 5IP7J 1YJ9I 4Y17A 3BCAA 3GTOJ 4I01A 3HBLA 4HSTA 4LG0B 2WBMA 3HB9A 2Z5UA 4LLNA 1KYZA 4XICA 5JVTA 2O8XA 3CCQI 2VODA 2DMQA 1R23A 1ETQA 4U87A 3H3UA 3VYUB 5F0CA 1S29A 2RN7A 5K1YA 3NRVA 4P9UA 3KP6A 3CCUI 4BDZA 3HHHA 5B5EC 2OPTA 2JN6A 2HYFA 1MZBA 2V1NA 4ZDPA 3WG7H 4AWXB 1K7AA 3HYIA 3PUFA 2L7KA 1FOXA 3K10A 4HV6A 4U7BA 3DQVC 3WTYC 1OCTC 2E60A 2O0YA 3AG4H 5DDGA 3CJNA 1K4TA 2HS5A 3G73A 1HC8A 2H94A 5EGOA 2VJ4A 3N4MA 3FMRA 1MBFA 3IH3A 1LPQA 3DTIA 1D8JA 1BOBA 5AONA 2MD0A 4WXHA 1AU7A 2OQGA 5DTDA 4LLLA 2P81A 2QKLB 1VQ5I 5D5VB 1U2WA 5DD4A 2NOGA 3A02A 3GBGA 4ETSA 5E18F 1MIJA 5EF6A 1UZCA 2UXXA 1W36D 3E0JB 1Q1VA 4KIFA 3MFKA 2X1EA 3KZYA 4E7KA 4C2TA 1IDZA 3BR5A 1EJ9A 3HJEA 4DNCA 2OC6A 2W4SA 2MA3A 1IRFA 3K69A 2OQRA 4HOBA 2DMTA 2FUG2 1O4XA 2MBFA 5CJ9A 6PAXA 1H0MA 4WK8F 3H5RA 5EG0A 4HQEA 4OOIA 3HTUA 4B43A 4AVPA 3OS1A 2NNNA 3X2QH 2F48A 4Y15A 1UHSA 2FEZA 2R5YB 3FXLA 2VPRA 1XSXA 1Y8RB 2W1OA 2QSGX 3JRAA 3SDGA 1MBJA 1DDNA 1E3OC 4M6YA 4BBRJ 1AKHB 1OYYA 5HS9A 3S3OA 4HDVA 2R5ZA 1HDPA 2IP2A 2LG4A 2FU4A 3HPHA 2DBBA 1KA8A 5DYMA 2VUMJ 3U1KA 1WH5A 5L3FA 2VQLA 3LWFA 2IXSA 3QAHA 1EA3A 2V9PA 3IAS2 3J81K 4A3CJ 4F3QA 3IWZA 5ICEA 3JTHA 5FD5A 1QPMA 1TLHB 4WF2A 3ZQLA 1P7JA 4M71A 3LSGA 5DD8A 4A3BJ 1RRJA 2XAGA 2WAEA 2L9RA 3QU3A 2BEOA 2ZCWA 4RGUA 3CLQA 2X1CA 4C2MJ 3M1CA 2NVXJ 4N9HA 1X58A 2HGCA 2XV4S 2M7BA 1MH3A 4M3FA 4CGZA 2L3DA 4BYYA 1R00A 3IHUA 1TP4A 2BHYA 3MKLA 2LMDA 1ETWA 2XAFA 3FMSA 4XSZF 2DODA 2DT5A 4ABZA 4UB6C 4A12A 3IH4A 2F5CA 2JPCA 2A6HF 2L9SA 4KFCA 2FF4A 3FX3A 2DA5A 1VNDA 3M3YJ 4HYEA 4LG0A 2FSWA 3LSJA 4F92B 4B3AA 4BNCA 3KIOA 4PZJA 1T33A 2MG4A 1NH3A 2JRMA 4RMNA 2X6YA 3RZOJ 3E97A 1UJ8A 2HZDA 2WTEA 2DJNA 2PMUA 3AG3H 2V26A 1V3FA 2MC4A 1B6AA 3B6AA 3EUAA 3JAMZ 3ECOA 1MW7A 2GAUA 2D2WA 1Y0UA 4JYKA 1U78A 1XGOA 3PNYA 2HU9A 4IHYA 2CUZA 2PFBA 3BTLA 4IX7A 2VE9A 5LRSA 1WCMJ 4X0GA 3J7AO 3HXLA 3OOUA 2MGQA 4IQ4A 4RA2A 1TQPA 1ERDA 4FT8A 4BEHB 2DDBA 5HVQC 3KEYA 2PX9A 4IRHA 3L2RA 2E2JJ 5EDNA 2R7FA 2GOXB 3OYGA 4F55A 5HOOA 1VQMI 2DA4A 1IRZA 1DGRM 3CD6I 4X6AJ 1RZ4A 2LF8A 3IP4B 3L09A 1YS7A 1WQ2A 1O57A 3QOEA 1WKMA 2XROA 4EJTA 1FJLA 1R1UA 5M5XJ 2KMUA 3HOUJ 5J4YA 3JR9A 3HUGA 3LA3A 5AIQA 3U9GA 4A0ZA 1HW2A 4NC6A 3ABMH 4BY7J 1XMAA 4YELA 4HX7A 3QYBA 4M6VA 1Z21A 1WJDA 2EV5A 3BTCA 2ZXWH 2ZXHA 2G0EA 3ZMZA 3CCRI 2DOEA 2P5VA 4N9IA 3IUOA 4HW0A 2AQFA 2D45A 5LGTA 4XKWA 4BL0B 3PIOF 2JUGA 2EZHA 5C4XJ 4HV5A 3K4CA 2DT6A 5EYRA 5K7FA 2IAIA 2Q0OA 4UHTA 1REPC 3R61A 1D0ZA 1QPIA 2DI3A 3J7AY 1IRGA 3F8CA 5F1RA 3MKYB 1ZRCA 1X4PA 1W7PD 4ZYHA 2CQ7A 1K4SA 1LB2A 4XLAA 1WI3A 2CUJA 2M8EA 3BLYA 2NS0A 3H1CA 3S14J 4D7MA 3SZPA 3WE3A 5FLXZ 3FK7A 5HS7A 3IRQA 1UAAA 3BROA 3WTUC 2GXBA 5HDGA 2F2EA 5L3CA 4IOAF 1TT5B 3I59B 1YX3A 4HLXA 4UV8A 5KAFC 2CQNA 4ZDLA 3RYRA 4XRSG 4G7ZF 3TGNA 2X0LA 3MKWB 1PP8F 4I09A 2Z1DA 4JP0A 2ID6A 4CXFA 4OIPF 2LC2A 1XGSA 1KU3A 1U9OA 1JGSA 4EJWA 4EATA 4YRVA 4Q4ZF 4LB5A 1X1PA 1ZRFA 4RAYA 2KDZA 1KZHA 4FCYA 1LE8B 4C3HJ 2L7MP 4XLNF 4GXOA 3T1BA 3VPRA 2H27A 4LG3A 3S1QJ 3IKVA 3BTJA 3CCEI 1MBKA 1VFCA 4R1HA 3S3NA 5ICFA 2JT1A 2DQLA 1QBJA 2WC2A 2YUSA 2OCEA 3LOCA 3QYFA 1P2FA 3NEUA 4U0VA 2QSHX 5J8FA 1VQ6I 2RAEA 4BACA 1VQNI 1RIOH 1FYLA 3ABTA 2I8DA 1DU6A 2Z9OA 2PLYA 4BXUA 2M4GA 1F4KA 4IVNA 3IV5A 3CUOA 5FGMA 2KDOA 2YPRA 3N97A 3HHGA 2L54A 2ELKA 2QQBA 1YFHA 2BY1A 2CH0A 4PCQA 2W7NA 1W0TA 3WU0A 1TQIA 5E3OA 2GIVA 2LKSA 2LR8A 2TDXA 2UZKA 3BOQA 3VFZA 4N4OB 3IRRA 3R60A 2CW7A 3PSFA 4BEHA 3L2VA 1ZLKA 1UHWA 4TV7A 5B1BH 3D5SC 5K5RA 3BCBA 1QA6A 4M3DA 3Q0UA 2BYVE 4ZYDA 4L0YB 3K2AA 2WV0A 1DU0A 5LEKA 2HTJA 3F8MA 2OUMA 2YX7A 4MO7A 3BQZA 2L9VA 2R7OA 3BR2A 3J80K 5TRDA 4HNVA 4ANJA 3GFIA 3GYHX 2Y30A 4XRSA 1ZAOA 1LVAA 2LH9A 3I53A 2GIZA 1LEAA 3GUDA 1DQUA 1WJEA 4P96A 1MNDA 1WPKA 5GP9A 2DFHA 3HOYJ 2VLAA 5IPAA 3JW4A 3HOSA 1S3JA 1KQ8A 1ULYA 2M8GX 3P9IA 2CG4A 3HRTA 1IZ1A 4P1WA 3PO3J 3UKGA 4H0EA 3BG3A 1ZG3A 2BY0A 2PEXA 3BQYA 4Y52J 1HSJA 2PG4A 3D5RC 2JSPA 4UVCA 1SFOJ 3RCOA 4BBSJ 4FISA 3Q0VA 2ZNZA 4P5OA 2E1MB 4GYGA 4A3JJ 2EIKH 3FWEA 3LSMA 2VE8A 4XR6A 1HA8A 2HKOA 2M7AA 3GLLA 3I64A 4XL9A 4RM2A 3TDZC 1YE9A 4NUBA 1GXPA 4UNOA 1BI2A 3MQ0A 1ZH5A 3QP5A 4HZFA 1OCCH 2QQAA 2F4OB 2E19A 4JK1X 2OZUA 4L5IA 2NOJB 4V2FA 1TWHJ 3F8BA 3K4MA 2RNGA 4EV0A 2ZSHB 5H6RA 4GYIA 4KIGA 4CYCA 3U21A 4BXXJ 4IRGA 1WJCA 4KN7X 1UG0A 1U6GA 5HS8A 4RB1A 1L3LA 1W1WE 1FMVA 3TOBA 2JMWA 4K2EA 2HNHA 2A6EF 2ZJQF 4PDKA 2IA0A 2NXNB 3FXJA 2V9VA 3CCMI 2LBFB 5IOZA 2O8KA 1LE8A 3H35A 2GA1A 1QO0D 3FXKA 5EZGA 1R6RA 1F9NA 4ENMA 1G59A 2H1LA 2GA2A 5E8IA 5IT9K 4V19K 1MJ9A 5F1JA 1YW8A 2CQXA 1RPWA 3VEPA 2QYOA 1X3ZB 1JT6A 1KU2A 1WHUA 2GLOA 3ZQHA 4DGWB 1N75A 2DA7A 3A01A 3P9KA 3KEQA 3LL7A 2E1CA 2XDVA 3MVPA 4WWCA 1K78A 3RKWA 4KDPA 3GVAA 3OWTA 2YX4A 4QWQA 1X3UA 5B1AH 2DMNA 2F4MB 2KIQA 2IRFG 3F9KA 4AIHA 3E6CC 1ACIA 3C2GA 3K4BA 4LK0F 1YQAA 2QZ8A 3W2VA 2DXIA 2LY9A 1XG1A 3ZMDA 1IV8A 3V8JA 3MZ8A 4U0YA 1JGGA 4BY1J 1BI1A 4HNUA 4R79A 1ZQ3P 4XONA 1APLC 3GZNB 2UUZA 2DFEA 4P55A 4FASD 4L9NA 2R7XA 3RI4A 2GZWA 4HLYA 1OQYA 4FTHA 3S16J 2P8TA 4GCVA 2DQRA 3LAJA 4S0HB 4G7HF 1A35A 1HXDA 2RV8A 2EFNA 2L2OA 5DM6F 2B63J 2XASA 2BY2A 1BW5A 2W25A 2ZNYA 1BIAA 1JTYA 3DXJF 3PNVA 3RTRA 3E1SA 3KP3A 1J09A 2QQ8A 5J4VA 1JKRC 2M87A 1OCPA 4JQFA 4IF4A 1I3QJ 1FP1D 5CLSA 3AL0B 4NC8A 2COBA 2HVSA 3RZDJ 1GDTA 2A68F 5F27A 4E4HA 4E7ZA 2BXYA 5E3LA 4BJ6C 4M72A 4MEXF 3ASNH 1CQTA 5JVGF 5JR3A 4E7HA 3K70C 3PUBA 3OSFA 1FWZA 3BR6A 3TO9A 4L9TA 2EILH 2FBHA 2W24A 1J2XA 3PM1A 1MNEA 4A69C 2BVMA 5GTIC 2XF7A 2ZO4A 2RVCA 1UMQA 5JFRA 2Z33A 1R4MB 1HF0A 4N4NB 2B9SA 1JUSA 3F8FA 2AO9A 1BJAA 3GWZA 1B4AA 3D0SA 3E5UA 2B7EA 4MTEA 4F52A 1V4RA 5IOYA 1XD7A 4II2A 3KP2A 3G1LA 4PJ0C 2L7FP 5DS9A 2H6BA 2CQKA 5D6FA 2RGVA 5EG0B 2F5VA 4IKFA 3QP6A 4LD5A 2Y69H 2V6CA 4AU7A 4G12A 3FHNA 1OKRA 3QOPA 2P5KA 4EGYA 1T95A 2E1OA 4OINF 4HQMA 4CYDA 4Q48A 3J7ZI 2QVOA 1H89C 4I0AA 5BNGA 2W82A 3MZHA 1FC3A 1JKQC 2UXNA 2EIMH 2M1BA 5E3NA 2VIXA 5JLXA 3JRDA 2EQRA 4CCJA 2PBIA 3P7NA 3WHCA 3WTZA 2EK5A 1JTXA 4DW6A 2IPQX 4EM2A 3RKXA 1WZ2A 1QQIA 4MFDA 4A0XA 2TRTA 4E7LA 3JRGA 2Y75A 4QSHA 2R7VA 4Y3OA 2MD5A 2FNPA 2LYCA 4RDUA 3ULQB 2ZBKA 3A1YA 3S2HJ 3TOAA 5LHGA 3L2QA 1SAUA 4R8HA 2K40A 3RDIA 4CSWA 4E7JA 2DAOA 4NQWA 2A6TA 1DP3A 5TISC 2M9HA 1K6YA 1P6RA 1KQ0A 3EYIA 2XUBA 3DP7A 4DIQA 3CJTB 2IS2A 2VBWA 1JXSA 1BC7C 2L5QA 3OSGA 2DJIA 2CU7A 2Z3YA 1BR2A 2BGCA 2K5CA 2X51A 3T5XA 1G3YA 3LA7A 2IA2A 3HKZA 2XIGA 1FTTA 5CQEA 3C2BA 2AXLA 2J5OA 2RREA 3R0AA 1GT0C 5GTHC 4CO8A 4HF1A 5A2QK 3BPXA 3CCSI 1OCRH 2Y0SN 4BUPA 2ADUA 2K9NA 1HSTA 3FK6A 3RYPA 3K1PA 3S1RJ 3W6JB 2STWA 3IAM2 1Z3XA 4ESJA 4JOMA 2K27A 2HYGD 2RDPA 1T39A 1GV5A 2L4AA 2DLLA 3ONQA 1IUFA 4XQFA 4IQJA 3LSKA 1KGSA 2E36A 3ABUA 3LSIA 1ZN2A 1HW5A 2FA5A 4P9FA 3V42A 1MMAA 3OL3A 3HSEA 3FXQA 2KT0A 3OIOA 3G1MA 2CSOA 2HTSA 3K6GA 3ZR8X 3ZQCA 1HKQA 2MLKA 2R7SA 2DK8A 2ME6A 1QHGA 3DBLB 1N77A 4XORA 1I6HJ 1W36C 4MIMA 2VT2A 5J47A 5HDKA 3TQNA 3CJRB 3RPUD 2X85A 3A0HC 2Q8KA 1I1GA 1R7JA 1OLTA 4EJOA 1B8IB 1GXQA 1D1AA 4UV9A 3HGYA 5CVUA 1FBSA 4X1EA 5IYCJ 2OU2A 3M9AA 2XPUA 1MNMC 3HUGB 4UVBA 1K79A 5AIPA 4QTRA 5HLGA 4AYBA 1D1BA 5K5OA 2CV2A 2R93J 4MGRA 2X6WA 4ZH4F 4AVZA 2NNYA 1D3YA 3GTKJ 3K4JA 2C6YA 1ZG1A 4YIIA 3ZQFA 2VJJA 4XM3A 4ASNA 2VQCA 1TWAJ 3QPSA 4ENJA 3ZMTA 4XOPA 1PUFA 1DPRA 4BHPA 2O6GE 4IEJA 3A0BC 3QPHA 2EB7A 1S7EA 3HPGA 1A5JA 1F43A 4E7SA 1JUMA 3DU5A 3K9TA 2JSCA 2KIMA 3OOPA 4A3KJ 5LGUA 2UV1A 4M6XA 1UB9A 3F0CA 3JRBA 3RIRA 2CUEA 3WGIA 2CV0A 1FPQA 3O8HA 2VBXA 2XF5A 3I3LA 5HODA 2K3PA 1RR8C 4Y7NJ 3C3WA 1POGA 3O8GA 4BS9A 4XN3A 3UNGC 1R1VA 1GUUA 2Y2ZA 3F6VA 5M3MJ 1VZ0A 5K5QA 4S05A 1P92A 3GEZA 1X3WB 4I7HA 1SEUA 2DTZA 2GXGA 2ZKZA 3HKZN 4BXFA 4KYWA 1WJFA 3DPLC 3KLOA 1MBGA 1Q1HA 2JRTA 2HOTA 3FXRA 1R5HA 3CJQB 3W2WA 3FXOA 3FISA 2XRNA 2O3FA 1NTCA 2DPDA 1CF7B 1DP7P 1XMXA 1ZELA 3GZ5A 4A3IJ 2I10A 3PO2J 1SMYF 3Q0WA 2KFDA 2BOLA 1ETYA 1SVLA 3ZGKA 1D5YA 5IT3A 5J6XA 1FP2A 3IC7A 3NWTA 3AKZA 4KJZA 5LHHA 4KA4A 2Y31A 3HL2A 2V1UA 3MMYB 2IVMA 2K7LA 1U3EM 3S1MJ 1ZHFA 3WTSC 3CCLI 5H6QA 3EYYA 3L7WA 5FB2A 3L2UA 2FNAA 5L3DA 3SDBA 1S7OA 2FRHA 3H9GA 1X1DA 5FKKA 3EUKL 3EETA 3JRCA 4QPQA 4MQ9F 4DBRA 1G6NA 2L9NA 4FQGA 3ZCOA 3HOZJ 3JCUC 2X48A 5GADJ 3ZMUA 3GTLJ 4IPAA 4AIKA 1EH7A 1UFMA 3I4PA 1EKEA 4G94A 3BG9A 3I55I 1MSFC 2VOOA 1PJRA 2VBYA 5BQTA 4PUSA 1VQ9I 2CWEA 4IO9F 3DLLF 1R5GA 2VPLA 5FLMJ 2LKPA 2OZ6A 2YR2A 2IBDA 4Q47A 3ZOBA 3EQLF 4G9YA 4D1QA 2GQQA 3CMEI 4NHJA 4I2OA 1GVJA 2QLZA 2XPVA 5HLIA 4YIFA 1BR4A 2O9LA 3GXOA 3QPLA 2PJRB 1HW1A 3RKQA 4PSXA 2O03A 1H9GA 4F7ZA 2JZYA 4I76A 1V54H 3I58A 4CCKA 2L4MA 3CLOA 3DU6A 4U7DA 2LFBA 3FDYA 4HG2A 1A31A 4A5NA 5IYDJ 4B47A 2MH2A 2F5FA 4XRMA 3KP4A 2JK3A 4QIWN 3SZTA 2XAQA 2LKXA 1ITYA 1TL8A 2COMA 3BZCA 4NB5A 1B8IA 4OAYA 3H9JA 5ILVA 2BZTA 2QM3A 3DKYA 5HLTA 2G7HA 3D1NI 1XGNA 2DA2A 4G6TB 2JJ7A 1JKOC 2F4IA 2HKXA 1UHMA 4BHCA 3MD2A 2EFPA 3VWBA 4HRIA 1BA5A 1I6XA 5FKNA 3L00A 3BJAA 3H5AA 2GM4A 5F0HA 3WG9A 1WGXA 3CDIA 3WTWC 4UUSA 2KKOA 2K4JA 2HWVA 1YYVA 4KISA 3LMMA 5LLQA 5KAIC 4B8XA 4GGGA 2K85A 5HNHA 3K1NA 5F08A 1MSEC 3CUQA 5DUKA 1HKTA 5TGTA 5D5UB 3OMYA 3DTEA 1MBEA 1Z6RA 4C3IJ 5CVJA 2FQ4A 3V7RA 2DA3A 4RB0A 2W57A 2L02A 3KFWX 2J5PA 1UELB 3BG7A 3BR0A 1W4MA 4WXDA 2LOOA 3HGGA 3M7GA 2M2EA 4FE4A 5LHIA 3O2PE 3H92A 5D4RA 1NK2P 3V4GA 5LBQA 1FOYA 4HX8A 2XC7A 2XHKA 1YO5C 2V79A 3DV8A 4CYCB 3ZRGA 4O3MA 3HRUA 3BWGA 5CVIA 4ZZDA 1AWCA 5L3BA 5FRMA 3QRFF 1LUJB 1I27A 3HOWJ 1QU3A 1FMWA 4OMYA 2LSOA 2VKEA 2LLKA 4C9YA 3K1MA 2CMPA 1WWXA 4BU2A 1CF7A 4XOTA 1VQOI 2P7VB 1V5FA 3SFIA 3FF5A 2TCTA 1KU7A 4AM3A 4E6KG 2VASA 2JA7J 2M34A 2CW0F 2XSJC 1QGPA 1YW9A 2CS3A 3B6CA 3HG9A 2VXDA 3MEXA 4CICA 2M5WA 2E7XA 5HLHA 2KJBA 4ZYAA 1EH6A 2KRHA 3DPUA 3TL4X 1P9QC 4F93B 1FX7A 1V55H 5EZHA 3A01B 2DOFA 2ESNA 2HDWA 4AIJA 3ASOH 1K78B 3E6DA 2E5ZA 1XN7A 2EIJH 2FX0A 2EFQA 3MAJA 1YHQI 1A36A 4OIQF 1TZLA 1Z77A 3DF8A 3LSPA 3CMYA 3GTPJ 3TO6A 2X1DA 1JJ8C 2YSRA 3A2KA 2XKPA 3L9FA 3LA2A 4KT6A 4PJLA 1MJBA 3DCFA 5KHDA 3CO7C 1VQPI 3WTTC 3BR3A 2H6CA 1S5LC 2W00A 4PFOA 4XNFA 5KNLA 1U9NA 3HOVJ 4EMSA 5E17F 1P4AA 3OL4A 5GPCA 3DEUA 3CCJI 5K7HA 2LY1A 3A4CA 2WAFA 3Q9SA 1ZGWA 3CP8A 1J5YA 4DZPA 3HOXJ 2KZVA 2PJRA 3FKJA 4CZZA 2WAQA 1F5TA 2NAZA 4EEFG 1LEBA 1K61A 1SMTA 1TWGJ 4C3JJ 2HZTA 2MYSA 4BJ5C 1E3HA 2I5UA 1OISA 4KN4X 4YFXF 3OR1C 3C1DA 5GAEJ 3M07A 3M1EA 1LVKA 4G8XA 1ZR4A 2UWMA 3TP0A 2H09A 4LGWA 4A2UA 3I56I 4BAYA 1RC9A 5E8GA 2HQ5A 3OYNA 3JREA 4BQAA 2O61A 2HOSA 2KIFA 1ZLJA 2JA8J 4U0WA 3GO5A 1R49A 2FBIA 1JHFA 4M74A 3FBIB 2WB1A 3U2RA 2N8GA 3HM5A 1T0FA 3GFJA 1RETA 5FROA 3JTGA 1IN5A 3ZPLA 3OYAA 4A6EA 2IJLA 4ENNA 3KE2A 3RQ4A 1VQKI 2LD5A 1YW7A 2GWRA 1J0RA 3MN2A 2XKOA 5DCFA 2LY2A 2LTPA 5J8CA 1PVEA 2HOAA 1QHHD 2HPMA 2OF7A 5CVRA 3KZIC 4RGXA 1M1EB 3J81Z 2WA0A 4NNJA 3JRIA 4IHXA 2EA4A 1FYKA 3I9V2 2E5NA 3BZKA 2KP6A 3LFKA 4CCMA 4L9VA 2JQ7A 1Z7LA 1FY7A 1OJLA 3AG2H 1BIBA 4PJJA 1FNNA 2CO5A 2EINH 3ECHA 4CDGA 2EFWA 1O3TA 1RKTA 4KIBA 1W7PA 1I1SA 2EA2A 2HR3A 1ONVA 5D5WB 2M30A 3F23A 5J1YA 1WJ5A 2DU9A 1IN6A 2Y9YA 2XGXA 2BVLA 4LK1F 2P5LC 3KLNA 1XSVA 4UB8C 3G6EI 4RBOA 2ME0A 2NS7A 4ZTFA 4M3GA 4EVIA 1A6IA 2DYRH 1TW2A 1LFUP 1SFKA 2KQRA 1YX5A 1GLNA 1NG7A 4UVAA 4BQQA 4BHBA 4NQWB 5E1WA 1TC3C 3LSHA 4M73A 1OMIA 3F3XA 2KZGA 5CQGA 1IXSB 4XLPF 1T98A 4KUMA 3OYBA 2Q1ZB 5L3GA 1IXRC 1MBHA 1VQ7I 1ENHA 2WY7Q 3ABKH 3OYCA 3C18A 2HXOA 4YFNF 1STZA 3K0LA 5B66C 3AFHA 5HDNA 2ZJPF 2QUFA 4M9XA 4GDFA 4XRFA 1ZR2A 1K6OA 4PJNA 1SD4A 3D5LA 2GXAA 1XX5A 4AC0A 4G7OF 4I6ZA 1FOKA 1XTAA 2CFXA 4L9JA 4UUVA 2ZMEC 4PFPA 5FFXA 4O5VA 1ZREA 4LIUA 1Y39A 1JJ6C 1FT9A 3HRSA 2DT7B 5CPRB 2E35A 3SJMA 2YS9A 4A3FJ 3KP5A 1KYWA 4FHTA 4OIOF 1U0JA 3HC7A 3O6BB 1IN7A 1TNSA 3RJPA 4KMUX 3U1DA 3IWFA 1N78A 1DPUA 1SD5A 2K4BA 3ZMVA 4W97A 3Q9VA 5J40A 2CJJA 2H8WA 3WE2A 4G6DA 3WU2C 4Q5SF 2RQPA 3EPZA 1JI8A 2QA4I 1XB4A 1MD0A 4IL6C 2MLGA 5ERIA 3L1PA 2HFHA 3PIPF 4KICA 3JSOA 2STTA 1S72I 2VT3A 3GTGJ 1I50J 1XDUA 1QNTA 3ELKA 2LK2A 1OYIA 4CCLA 2OBPA 2M3AA 3WTVC 2XGEA 3OY9A 2X6OA 3LSTA 3E5XA 1TT0A 5KVRA 1JE8A 3VDXA 3I4MJ 4L5JA 4D5CA 1W5TA 3TP3A 3R0JA 3BC8A 3GMEA 2IT0A 5IP9J 1W0UA 1Z67A 3FXUA 3CC7I 3JAMK 5M3FJ 1YJNI 1ETXA 2BV6A 4FX4A 3L2WA 2JWTA 2JA5J 5FO5A 5DV5A 2KIUA 3KYLA 2D5VA 4B44A 3PSIA 3GLXA 5FKMA 1PUFB 2W48A 5D8KB 5JLWA 5CVVA 2PJPA 3TW6A 2G7UA 2Z2SB 1D8KA 3B02A 4IHSA 3G1OA 4EQQA 2WV1A 4MEYF 4DQ2A 1LFBA 2DMPA 2JTVA 5KK1A 1SFUA 2A3SA 4BQOA 1O3QA 1EV7A 1I39A 2BHZA 4ESBA 2DYSH 2KHMA 2VB6A 3BZ6A 2IS6A 3M8FA 2A5WA 4XKCA 4LB6B 2L01A 3IL2A 1IUYA 1QVUA 1O3SA 3COAC 3MWMA 4MHGA 1YG2A 2Z99A 5GPAA 2OD5A 2ETHA 3BPVA 3BDDA 3TMOA 1FEXA 1OCOH 1T56A 4ITVA 5FJ8J 3G2BA 3RSNA 2WADA 4F91B 2LF7A 4D5FA 3B73A 1MDMA 2CUFA 2DFFA 1YTYA 3HEFA 2QF7A 2HQAA 2P0WA 4L0ZB 2HYJA 1O7FA 1VQ8I 1QZZA 2QENA 2XAUA 4W1UA 1ZRDA 1BI3A 3PNTA 2EFOA 2G9WA 3VB2A 2FE3A 3IH2A 1BW6A 4RAZA 2MW8A 3KCCA 1ON2A 3GFMA 2YU3A 4C30A 3C7JA 1LQ1A 4ENKA 4IHTA 4AD9A 4E70A 1Z6TA 3ZQQA 1ZK8A 2Q2EA 4A6DA 3MKZA 2AXTC 3FZVA 5GAHJ 1XC5A 3M8JA 4DYRA 3FM5A 2MFZA 5FLXK 5HNFA 1LDJA 2R7WA 1ODDA 3TBIA 2O5RA 4ZJZA 2Y0MA 4PJMA 4D0PA 4EM0B 3KEOA 1Y6IA 4D7NA 5DM7F 5BPIA 5E20A 2XB0X 2XGDA 1RR7A 2PMHA 2EPFA 3Q3SA 3L2CA 2E34A 4C2UA 4BE2A 3OYDA 1B59A 3TEDA 4UY8I 3J80Z 1FLIA 2A07F 2ZFWA 1YRNA 2X9DA 3ISPA 5TJJA 4RAGA 1HKSA 2EJRA 1D0YA 2XPWA 1LDDA 4HEA2 3CDHA 3ZQ7A 3OYJA 1A6QA 2ZB9A 1IGNA 2EWNA 1X1AA 1XSDA 1R9TJ 2LDUA 5BOXA 2ZMEA 2M0CA 2FQ3A 2DOAA 3I54A 1YOVB 2JUCA 4IJAA 4ZDOA 1SD6A 4CCNA 3CUQC 2F5EA 2V4JC 4PK4A 4EJUA 4KITB 2DK5A 3WGGA 2ICWG 4CA0A 1S9HA 1LNWA 1OPCA 2V1DA 3DWLE 2QQ9A 2K3FA 2FMLA 3DKWA 1TQMA 1Y1VJ 2QBYA 4IOCF 2EH3A 2IA1A 4U88A 1IW7F 3I71A 1FBQA 2CRGA 3H0GJ 4A93J 2ZJRF 3JRFA 4UUSB 1E3PA 3S32A 2JA6J 5FKOA 1L0OC 2ZJ2A 2ID3A 1KU9A 2BW3B 3DKXA 4LITA 4IHVA 3ROUA 3CUQB 2HPIA 5J3LA 1Z1DA 4LMYA 4BE1A 3S17J 2HOEA 4D9JA 4DJAA 3OYLA 2K86A 2BXZA 2DO7A 2FMYA 4OU0A 1FOWA 2HDDA 1WFXA 1LFPA 4GFBA 2K9QA 2K9SA 4A3GJ 3TO7A 3N05A 3P5JA 3ZQIA 1LDKB 3DEEA 2BY3A 1K83J 4OWRB 2H8RA 2RKHA 3S8PA 1R36A 5IT9Z 3EUHC 1IV6A 4RLQA 3K2ZA 2P6TA 3PFIA 2VKVA 3OV8A 4HPQA 2K02A 3GX4X 2VQHA 4MQVA 4M9ZA 2DN0A 4YFKF 4ZTJA 3TDUC 3G3ZA 3I0TA 5H2FC 3HIFA 4CCOA 1AOYA 3F21A 1C0WA 4HA8A 2Y9ZA 4HAMA 1SANA 2AHQA 2PN6A 1G4DA 1R58A 1MMDA 4BQNA 2OA4A 4LLGF 3S15J 3O3KA 4UXNA 4EJVA 4XKVA 4IXAA 1D1CA 4B48A 3CP2A 2OTJI 1JHHA 4XIDA 1H88C 1MMSA 4J19A 1E2XA 3DBHB 2QSFX 5C44J 1KQ9A 4XMYA 1Y8QB 2BBYA 4GO1A 3AG1H 5EEGA 5JHFA 2K9LA 9ANTA 1U5TC 3OIPA 1I5ZA 3ZXSA 4XBFA 1VTNC 1SC7A 2EZLA 3DPTA 3SXYA 5GAGJ 4RGSA 3F22A 1WRJA 3VYTB 3CF2A 2P7CB 1MMNA 1G8XA 2OAZA 2MSYA 3OS2A 2DA6A 4HBLA 5E1XA 5H20A 1QZEA 1SFEA 3REOA 5C4JJ 1YITI 1T8IA 1HQCA 4LJZF 1W5SA 1ETKA 2NYXA 4WCGA 1WJAA 3DLAA 3NQOA 4CH7A 4BJTA 2XAJA 2PQ8A 5ILSA 5E3MA 4B4CA 4JX4A 5EEHA 1SFXA 2JVHA 4AYBN 1BBYA 1T38A 3RKYA 1VQ4I 1TNTA 4RS8A 1PDNC 3CQZJ 3MZYA 1U5TB 4G6QA 2HI3A 3OYHA 1HOMA 2L0KA 3IKTA 1JUPA 1T0FC 3KETA 2HEOA 4FX0A 2R7DA 1T6SA 1JT0A 3FIWA 1MH4A 2EV0A 1OR7C 3NAUA 3VYRB 1USTA 3DFGA 3K7AJ 1V5GA 4ZYGA 1B72B 2FD5A 3V7CA 2CGPA 5LD2C 3CMAI 1XCVA 1QZYA 1G3TA 4AUXA 5LEJA 1IC8A 1HLVA 5EJCA 2LRDA 4AIDA 1FSHA 3JSPA 3C2HA 3JRHA 1FTZA 2ZSIB 3E3VA 3OIQA 3VYSB 1R5ID 5B3SH 4WXCA 1IAWA 2IW5A 3OYKA 1OFCX 1R4NB 4OAZA 4BH9A 3RPUA 2VI6A 3S3MA 1YIJI 1TBXA 1RESA 4NBQA 4YG2F 1FZPB 1ETOA 1DGWY 2ZFUA 3E6BA 4CHUA 2M45A 2XRLA 4MLOA 3E7LA 5FFZA 2BE5F 1PUEE 4M9SA 2MC3A 3OYFA 3SEZA 2JPBA 5JHUA 4IHWA 3F8NA 4ON0A 3WU1B 3HDDA 4OIRF 2BW3A 2ECCA 4LOCA 5DCMB 3OYIA 3RPQA 3ZP5A 1OCZH 2WWYA 1AHDP 2DA1A 4L5EA 2KRFA 2LNBA 2PMZA 2V6EA 3ZMSA 3CTAA 4QPOA 5ED4A 2LREA 3FXMA 2R92J
chains in the Genus database with same CATH topology
3ABKH 5B1AH 2OCCH 3AG3H 2Y69H 3WG7H 2EILH 1OCCH 2DYRH 3AG2H 2EINH 3X2QH 2DYSH 3AG4H 3AG1H 1V55H 1OCZH 2EIMH 5IY5H 3ABLH 3ABMH 3ASOH 5B3SH 2EIKH 2EIJH 1OCRH 2ZXWH 1V54H 5B1BH 1OCOH 3ASNH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABK H;  5B1A H;  2OCC H;  3AG3 H;  2Y69 H;  3WG7 H;  2EIL H;  1OCC H;  2DYR H;  3AG2 H;  2EIN H;  3X2Q H;  2DYS H;  3AG4 H;  3AG1 H;  1V55 H;  1OCZ H;  2EIM H;  5IY5 H;  3ABL H;  3ABM H;  3ASO H;  5B3S H;  2EIK H;  2EIJ H;  1OCR H;  2ZXW H;  1V54 H;  5B1B H;  1OCO H;  3ASN H; 
#chains in the Genus database with same CATH topology
 1BM9 A;  2ECB A;  1XPX A;  1O3R A;  1OYW A;  2KRC A;  2PI0 A;  2XSD C;  1RKW A;  2VJ5 A;  3GFL A;  3H5N A;  2M0M A;  1D5V A;  3LSR A;  1W7P B;  4NDL A;  3S2W A;  3CCV I;  4EGZ A;  3BG5 A;  3VSL A;  5D8L B;  1EF4 A;  5FLV A;  5CKT A;  3LQQ A;  3SQN A;  1RUO A;  1TWF J;  3HTS B;  3OYM A;  2A69 F;  2R5Y A;  3CMM A;  3VOD A;  4HSR A;  4Y4R A;  2OJE D;  4OMZ A;  2VBZ A;  1ZAR A;  1TW3 A;  3LFU A;  1ON1 A;  1AKH A;  3DTK A;  4BGD A;  4I99 C;  5ICC A;  4XLC A;  3ZN0 A;  4DYQ A;  3G4S I;  2YU9 J;  1S7A A;  3BG6 A;  4XLF A;  1IRX A;  2KPM A;  2L7Z A;  2JA2 A;  3GTM J;  3E6M A;  2P4W A;  2QCO A;  3H0D A;  5A2Q Z;  3EUH A;  4B09 A;  3OR2 C;  1VQL I;  1ZYR F;  1B1B A;  4A3D J;  1G2H A;  3H36 A;  2X4H A;  2O7O A;  2MH9 A;  4O6J A;  3V8K A;  5JI6 A;  3I4N J;  2HVQ A;  1YIO A;  4RGR A;  4MNU A;  1G3W A;  2EV6 A;  2ZXI A;  5FRN A;  2Y48 A;  2VL8 A;  1BL0 A;  2NRA C;  2VJI A;  4XN0 A;  3CC2 I;  1H9T A;  5M5Y J;  2E2I J;  2CFO A;  4YEJ A;  1JKP C;  1NG6 A;  2IS4 A;  1S8N A;  2NS8 A;  1USS A;  4A5M A;  4IZZ A;  2XGC A;  4A0Y A;  1FSE A;  1ETV A;  2DTR A;  4N0B A;  3S93 A;  4JX6 A;  4FET A;  2NVQ J;  2CQQ A;  5F04 A;  3WOD F;  2KL4 A;  2JVG A;  1T08 B;  3KX2 A;  1T2K A;  5LFA A;  4ESF A;  2DW4 A;  5DEQ A;  2E71 A;  3ZQG A;  4BDY A;  1Z91 A;  4WX9 A;  3CDL A;  4B1R A;  5F6F A;  5ILU A;  2D1V A;  3CF5 F;  4PGH A;  4XLH A;  1KON A;  4I98 B;  1FBU A;  2VKH A;  3KYC B;  1U5T A;  2V1X A;  4Z2Y A;  3LAP A;  4Y13 A;  1BN5 A;  4ZYE A;  4Z6Y A;  4JX5 A;  2P6S A;  1R71 A;  2F6C A;  2OTL I;  1B72 A;  3R6S A;  2NVT J;  2F5D A;  3W2A A;  2DDA A;  1ZKG A;  2FJ1 A;  3BP8 A;  2MAB A;  5IY5 H;  1FIP A;  2PMZ N;  3BY6 A;  3QPT A;  2CW8 A;  3AAF A;  4RAF A;  1J7K A;  1PYV A;  2FOK A;  2EZK A;  1SAX A;  3FBN B;  1DUX C;  2ESH A;  1IXC A;  3SYT A;  5D4S A;  3GZ6 A;  3QYE A;  5E79 C;  1ORK A;  3J7Y J;  1G3S A;  4A3L J;  1WSU A;  4KMF A;  1OR7 A;  3PQJ A;  2IGO A;  3QWL A;  4XKB A;  5E1Z B;  1P4X A;  1X2N A;  2E1M C;  1R22 A;  3OYE A;  1SVO A;  1IDY A;  3SZG A;  5DCM A;  5KCM A;  4QLC U;  1FIA A;  1XDS A;  3MCZ A;  3F72 A;  3LQR A;  2FXA A;  1S6L A;  2ISY A;  1WJB A;  1XMK A;  1IJW C;  4LIV A;  3S2D J;  1W5C C;  3OS0 A;  1J9I A;  1Z3Y A;  3K4K A;  3SHF A;  1X1C A;  2IS1 A;  3ML6 A;  1E17 A;  3I5U A;  1IN4 A;  2ELJ A;  1V5E A;  5LGN A;  2VKD A;  4JBA A;  2DPU A;  1QRY A;  4KT5 C;  4DYC A;  5LRR A;  2IGK A;  3K4L A;  4DOZ A;  2OV7 A;  4RLF A;  4PSW A;  3VOE A;  2R7T A;  1MMG A;  3FKI J;  2EBI A;  3GF2 A;  1J59 A;  1RI7 A;  2QWW A;  1ZGJ A;  1RUN A;  1HCR A;  2KJC A;  4L18 B;  2ZXJ A;  1H8A C;  1AA7 A;  1LKX A;  4EM1 A;  4ZC3 A;  1MDM B;  1A04 A;  4IRI A;  3QU6 A;  1XS9 A;  4A3E J;  5BMZ A;  3GCM A;  3I59 A;  3KP7 A;  2R7Z J;  2VC1 A;  3FHZ A;  3E5Q A;  5IP6 A;  2ISZ A;  2E1N A;  3HRM A;  2ELH A;  4B3X A;  5BPD A;  5D6E A;  1HDD C;  4II3 A;  2AS5 F;  5ICG A;  1UCR A;  4M3B A;  3T8R A;  1GVD A;  3W6K B;  2LVS A;  2ZC2 A;  4MTD A;  4UUT A;  3NWS A;  2B0L A;  2WAQ N;  1Y1W J;  2Q2E B;  2NVU B;  5FKL A;  3GTQ J;  2XAH A;  5F64 A;  2GOM A;  2HXI A;  3NAR A;  5M5W J;  2W84 A;  2M4K A;  2VOP A;  3Q5F A;  2H1K A;  2V9K A;  4NC7 A;  2HQR A;  1XCB A;  1TWC J;  1VF9 A;  4HF0 A;  3WHB A;  1P7I A;  4YIR X;  3HOT A;  3GW2 A;  1VI0 A;  1BR1 A;  4S04 A;  4MFE A;  1MKM A;  3BTI A;  2WY8 Q;  4DBQ A;  1NK3 P;  4RM3 A;  1P4W A;  3HSR A;  3P9C A;  2RNJ A;  1YRN B;  1UG2 A;  2WB1 N;  4HF2 A;  2R7U A;  3PQK A;  3T8T A;  2HDC A;  4E7I A;  3A03 A;  1IF1 A;  3PJR A;  3FMQ A;  3H3Z A;  2A05 A;  3HZJ A;  4GRI A;  3AL0 C;  2DCE A;  3CZ6 A;  3T0Y A;  2FBK A;  1BOA A;  2QKM B;  2KIS A;  2ZME B;  3V7S A;  1YI2 I;  3FM3 A;  4CZC A;  1IN8 A;  1WVR A;  3M8E A;  4RB3 C;  1FYM A;  2K9M A;  1Y0N A;  4BKX A;  2IEK A;  3ESW B;  2R4G A;  3PFY A;  1F36 A;  3KPH A;  2DMU A;  1CGP A;  3HSF A;  2D1H A;  5EGO B;  1Z05 A;  3TW7 A;  4I0B A;  2RC4 A;  1U8R A;  4J01 A;  4H4K C;  4M3E A;  2QBY B;  5F0F A;  3GTJ J;  1D0X A;  2VQG A;  2AQE A;  4LFU A;  1BI0 A;  3SFZ A;  2Y0S A;  3DEW A;  1IG7 A;  2V7F A;  2IGM A;  5CYV A;  3KYD B;  4XLE A;  3DBR B;  4CUG A;  5J1U A;  5L3E A;  1MJA A;  3WTX C;  1BJZ A;  4DZJ A;  1HBX G;  2CYY A;  2GBY A;  1SVM A;  3H9Q A;  5BS6 A;  2A5Y B;  3CO6 C;  2VXZ A;  4HX4 A;  1SD7 A;  2W85 A;  1X1B A;  5FD6 A;  1E0E A;  5EEA A;  3K70 D;  4J00 A;  2XF6 A;  3K4N A;  2HVR A;  2R3S A;  1ZTR A;  3VSK A;  3RQI A;  1N25 A;  1QVT A;  4BE0 A;  2LP0 A;  1TTY A;  1NHA A;  2QEX I;  3S1N J;  1B9M A;  5K7Z A;  3PL8 A;  1EH8 A;  1WH7 A;  3SEQ A;  3CES A;  2OCC H;  3G71 I;  3BT9 A;  4HDU A;  2NVY J;  5IYB J;  3W3C A;  1J75 A;  4A3M J;  2KLO A;  1GV2 A;  2CV1 A;  5J1R A;  4Y33 A;  1IO2 A;  1PP7 U;  3BJ6 A;  3BJO A;  3ERM A;  3QQA A;  1X19 A;  3M4O J;  1Z0X A;  2E7W A;  1Z9C A;  1F1Z A;  1Y56 A;  2QGU A;  3R4K A;  2R5Z B;  3ABL H;  2X6X A;  3F6O A;  4HNT A;  2R0Q C;  2R7R A;  2RQQ A;  1XGM A;  1I3A A;  1RNL A;  2XB5 A;  3W6V A;  1ZGA A;  3ZN1 A;  2VN2 A;  1Z7U A;  3EDP A;  2FOW A;  3KZZ A;  3TKY A;  4RB2 C;  1B9N A;  4FE7 A;  2HQN A;  1ZG5 A;  1LJ9 A;  2ACJ A;  3V8L A;  2XVC A;  1YLF A;  1YS6 A;  3ERE D;  5C3E J;  2LBF A;  4XSX F;  3H3V K;  1GHC A;  1YJW I;  4ZZL A;  4V2G A;  1X4O A;  3CC4 I;  3QOD A;  1WI9 A;  5D5X B;  1U8B A;  4I02 A;  2EZI A;  3CCY A;  1X2M A;  2R7Q A;  2IGN A;  2E2H J;  1O7L A;  3WGH A;  1MGT A;  2Z16 A;  5DUI A;  1BC8 C;  3BR1 A;  2VC0 A;  2A61 A;  3LNQ A;  2DFI A;  4PGG A;  4XK4 A;  1R1T A;  2VON A;  3UR3 C;  4KNY A;  5IP7 J;  1YJ9 I;  4Y17 A;  3BCA A;  3GTO J;  4I01 A;  3HBL A;  4HST A;  4LG0 B;  2WBM A;  3HB9 A;  2Z5U A;  4LLN A;  1KYZ A;  4XIC A;  5JVT A;  2O8X A;  3CCQ I;  2VOD A;  2DMQ A;  1R23 A;  1ETQ A;  4U87 A;  3H3U A;  3VYU B;  5F0C A;  1S29 A;  2RN7 A;  5K1Y A;  3NRV A;  4P9U A;  3KP6 A;  3CCU I;  4BDZ A;  3HHH A;  5B5E C;  2OPT A;  2JN6 A;  2HYF A;  1MZB A;  2V1N A;  4ZDP A;  3WG7 H;  4AWX B;  1K7A A;  3HYI A;  3PUF A;  2L7K A;  1FOX A;  3K10 A;  4HV6 A;  4U7B A;  3DQV C;  3WTY C;  1OCT C;  2E60 A;  2O0Y A;  3AG4 H;  5DDG A;  3CJN A;  1K4T A;  2HS5 A;  3G73 A;  1HC8 A;  2H94 A;  5EGO A;  2VJ4 A;  3N4M A;  3FMR A;  1MBF A;  3IH3 A;  1LPQ A;  3DTI A;  1D8J A;  1BOB A;  5AON A;  2MD0 A;  4WXH A;  1AU7 A;  2OQG A;  5DTD A;  4LLL A;  2P81 A;  2QKL B;  1VQ5 I;  5D5V B;  1U2W A;  5DD4 A;  2NOG A;  3A02 A;  3GBG A;  4ETS A;  5E18 F;  1MIJ A;  5EF6 A;  1UZC A;  2UXX A;  1W36 D;  3E0J B;  1Q1V A;  4KIF A;  3MFK A;  2X1E A;  3KZY A;  4E7K A;  4C2T A;  1IDZ A;  3BR5 A;  1EJ9 A;  3HJE A;  4DNC A;  2OC6 A;  2W4S A;  2MA3 A;  1IRF A;  3K69 A;  2OQR A;  4HOB A;  2DMT A;  2FUG 2;  1O4X A;  2MBF A;  5CJ9 A;  6PAX A;  1H0M A;  4WK8 F;  3H5R A;  5EG0 A;  4HQE A;  4OOI A;  3HTU A;  4B43 A;  4AVP A;  3OS1 A;  2NNN A;  3X2Q H;  2F48 A;  4Y15 A;  1UHS A;  2FEZ A;  2R5Y B;  3FXL A;  2VPR A;  1XSX A;  1Y8R B;  2W1O A;  2QSG X;  3JRA A;  3SDG A;  1MBJ A;  1DDN A;  1E3O C;  4M6Y A;  4BBR J;  1AKH B;  1OYY A;  5HS9 A;  3S3O A;  4HDV A;  2R5Z A;  1HDP A;  2IP2 A;  2LG4 A;  2FU4 A;  3HPH A;  2DBB A;  1KA8 A;  5DYM A;  2VUM J;  3U1K A;  1WH5 A;  5L3F A;  2VQL A;  3LWF A;  2IXS A;  3QAH A;  1EA3 A;  2V9P A;  3IAS 2;  3J81 K;  4A3C J;  4F3Q A;  3IWZ A;  5ICE A;  3JTH A;  5FD5 A;  1QPM A;  1TLH B;  4WF2 A;  3ZQL A;  1P7J A;  4M71 A;  3LSG A;  5DD8 A;  4A3B J;  1RRJ A;  2XAG A;  2WAE A;  2L9R A;  3QU3 A;  2BEO A;  2ZCW A;  4RGU A;  3CLQ A;  2X1C A;  4C2M J;  3M1C A;  2NVX J;  4N9H A;  1X58 A;  2HGC A;  2XV4 S;  2M7B A;  1MH3 A;  4M3F A;  4CGZ A;  2L3D A;  4BYY A;  1R00 A;  3IHU A;  1TP4 A;  2BHY A;  3MKL A;  2LMD A;  1ETW A;  2XAF A;  3FMS A;  4XSZ F;  2DOD A;  2DT5 A;  4ABZ A;  4UB6 C;  4A12 A;  3IH4 A;  2F5C A;  2JPC A;  2A6H F;  2L9S A;  4KFC A;  2FF4 A;  3FX3 A;  2DA5 A;  1VND A;  3M3Y J;  4HYE A;  4LG0 A;  2FSW A;  3LSJ A;  4F92 B;  4B3A A;  4BNC A;  3KIO A;  4PZJ A;  1T33 A;  2MG4 A;  1NH3 A;  2JRM A;  4RMN A;  2X6Y A;  3RZO J;  3E97 A;  1UJ8 A;  2HZD A;  2WTE A;  2DJN A;  2PMU A;  3AG3 H;  2V26 A;  1V3F A;  2MC4 A;  1B6A A;  3B6A A;  3EUA A;  3JAM Z;  3ECO A;  1MW7 A;  2GAU A;  2D2W A;  1Y0U A;  4JYK A;  1U78 A;  1XGO A;  3PNY A;  2HU9 A;  4IHY A;  2CUZ A;  2PFB A;  3BTL A;  4IX7 A;  2VE9 A;  5LRS A;  1WCM J;  4X0G A;  3J7A O;  3HXL A;  3OOU A;  2MGQ A;  4IQ4 A;  4RA2 A;  1TQP A;  1ERD A;  4FT8 A;  4BEH B;  2DDB A;  5HVQ C;  3KEY A;  2PX9 A;  4IRH A;  3L2R A;  2E2J J;  5EDN A;  2R7F A;  2GOX B;  3OYG A;  4F55 A;  5HOO A;  1VQM I;  2DA4 A;  1IRZ A;  1DGR M;  3CD6 I;  4X6A J;  1RZ4 A;  2LF8 A;  3IP4 B;  3L09 A;  1YS7 A;  1WQ2 A;  1O57 A;  3QOE A;  1WKM A;  2XRO A;  4EJT A;  1FJL A;  1R1U A;  5M5X J;  2KMU A;  3HOU J;  5J4Y A;  3JR9 A;  3HUG A;  3LA3 A;  5AIQ A;  3U9G A;  4A0Z A;  1HW2 A;  4NC6 A;  3ABM H;  4BY7 J;  1XMA A;  4YEL A;  4HX7 A;  3QYB A;  4M6V A;  1Z21 A;  1WJD A;  2EV5 A;  3BTC A;  2ZXW H;  2ZXH A;  2G0E A;  3ZMZ A;  3CCR I;  2DOE A;  2P5V A;  4N9I A;  3IUO A;  4HW0 A;  2AQF A;  2D45 A;  5LGT A;  4XKW A;  4BL0 B;  3PIO F;  2JUG A;  2EZH A;  5C4X J;  4HV5 A;  3K4C A;  2DT6 A;  5EYR A;  5K7F A;  2IAI A;  2Q0O A;  4UHT A;  1REP C;  3R61 A;  1D0Z A;  1QPI A;  2DI3 A;  3J7A Y;  1IRG A;  3F8C A;  5F1R A;  3MKY B;  1ZRC A;  1X4P A;  1W7P D;  4ZYH A;  2CQ7 A;  1K4S A;  1LB2 A;  4XLA A;  1WI3 A;  2CUJ A;  2M8E A;  3BLY A;  2NS0 A;  3H1C A;  3S14 J;  4D7M A;  3SZP A;  3WE3 A;  5FLX Z;  3FK7 A;  5HS7 A;  3IRQ A;  1UAA A;  3BRO A;  3WTU C;  2GXB A;  5HDG A;  2F2E A;  5L3C A;  4IOA F;  1TT5 B;  3I59 B;  1YX3 A;  4HLX A;  4UV8 A;  5KAF C;  2CQN A;  4ZDL A;  3RYR A;  4XRS G;  4G7Z F;  3TGN A;  2X0L A;  3MKW B;  1PP8 F;  4I09 A;  2Z1D A;  4JP0 A;  2ID6 A;  4CXF A;  4OIP F;  2LC2 A;  1XGS A;  1KU3 A;  1U9O A;  1JGS A;  4EJW A;  4EAT A;  4YRV A;  4Q4Z F;  4LB5 A;  1X1P A;  1ZRF A;  4RAY A;  2KDZ A;  1KZH A;  4FCY A;  1LE8 B;  4C3H J;  2L7M P;  4XLN F;  4GXO A;  3T1B A;  3VPR A;  2H27 A;  4LG3 A;  3S1Q J;  3IKV A;  3BTJ A;  3CCE I;  1MBK A;  1VFC A;  4R1H A;  3S3N A;  5ICF A;  2JT1 A;  2DQL A;  1QBJ A;  2WC2 A;  2YUS A;  2OCE A;  3LOC A;  3QYF A;  1P2F A;  3NEU A;  4U0V A;  2QSH X;  5J8F A;  1VQ6 I;  2RAE A;  4BAC A;  1VQN I;  1RIO H;  1FYL A;  3ABT A;  2I8D A;  1DU6 A;  2Z9O A;  2PLY A;  4BXU A;  2M4G A;  1F4K A;  4IVN A;  3IV5 A;  3CUO A;  5FGM A;  2KDO A;  2YPR A;  3N97 A;  3HHG A;  2L54 A;  2ELK A;  2QQB A;  1YFH A;  2BY1 A;  2CH0 A;  4PCQ A;  2W7N A;  1W0T A;  3WU0 A;  1TQI A;  5E3O A;  2GIV A;  2LKS A;  2LR8 A;  2TDX A;  2UZK A;  3BOQ A;  3VFZ A;  4N4O B;  3IRR A;  3R60 A;  2CW7 A;  3PSF A;  4BEH A;  3L2V A;  1ZLK A;  1UHW A;  4TV7 A;  5B1B H;  3D5S C;  5K5R A;  3BCB A;  1QA6 A;  4M3D A;  3Q0U A;  2BYV E;  4ZYD A;  4L0Y B;  3K2A A;  2WV0 A;  1DU0 A;  5LEK A;  2HTJ A;  3F8M A;  2OUM A;  2YX7 A;  4MO7 A;  3BQZ A;  2L9V A;  2R7O A;  3BR2 A;  3J80 K;  5TRD A;  4HNV A;  4ANJ A;  3GFI A;  3GYH X;  2Y30 A;  4XRS A;  1ZAO A;  1LVA A;  2LH9 A;  3I53 A;  2GIZ A;  1LEA A;  3GUD A;  1DQU A;  1WJE A;  4P96 A;  1MND A;  1WPK A;  5GP9 A;  2DFH A;  3HOY J;  2VLA A;  5IPA A;  3JW4 A;  3HOS A;  1S3J A;  1KQ8 A;  1ULY A;  2M8G X;  3P9I A;  2CG4 A;  3HRT A;  1IZ1 A;  4P1W A;  3PO3 J;  3UKG A;  4H0E A;  3BG3 A;  1ZG3 A;  2BY0 A;  2PEX A;  3BQY A;  4Y52 J;  1HSJ A;  2PG4 A;  3D5R C;  2JSP A;  4UVC A;  1SFO J;  3RCO A;  4BBS J;  4FIS A;  3Q0V A;  2ZNZ A;  4P5O A;  2E1M B;  4GYG A;  4A3J J;  2EIK H;  3FWE A;  3LSM A;  2VE8 A;  4XR6 A;  1HA8 A;  2HKO A;  2M7A A;  3GLL A;  3I64 A;  4XL9 A;  4RM2 A;  3TDZ C;  1YE9 A;  4NUB A;  1GXP A;  4UNO A;  1BI2 A;  3MQ0 A;  1ZH5 A;  3QP5 A;  4HZF A;  1OCC H;  2QQA A;  2F4O B;  2E19 A;  4JK1 X;  2OZU A;  4L5I A;  2NOJ B;  4V2F A;  1TWH J;  3F8B A;  3K4M A;  2RNG A;  4EV0 A;  2ZSH B;  5H6R A;  4GYI A;  4KIG A;  4CYC A;  3U21 A;  4BXX J;  4IRG A;  1WJC A;  4KN7 X;  1UG0 A;  1U6G A;  5HS8 A;  4RB1 A;  1L3L A;  1W1W E;  1FMV A;  3TOB A;  2JMW A;  4K2E A;  2HNH A;  2A6E F;  2ZJQ F;  4PDK A;  2IA0 A;  2NXN B;  3FXJ A;  2V9V A;  3CCM I;  2LBF B;  5IOZ A;  2O8K A;  1LE8 A;  3H35 A;  2GA1 A;  1QO0 D;  3FXK A;  5EZG A;  1R6R A;  1F9N A;  4ENM A;  1G59 A;  2H1L A;  2GA2 A;  5E8I A;  5IT9 K;  4V19 K;  1MJ9 A;  5F1J A;  1YW8 A;  2CQX A;  1RPW A;  3VEP A;  2QYO A;  1X3Z B;  1JT6 A;  1KU2 A;  1WHU A;  2GLO A;  3ZQH A;  4DGW B;  1N75 A;  2DA7 A;  3A01 A;  3P9K A;  3KEQ A;  3LL7 A;  2E1C A;  2XDV A;  3MVP A;  4WWC A;  1K78 A;  3RKW A;  4KDP A;  3GVA A;  3OWT A;  2YX4 A;  4QWQ A;  1X3U A;  5B1A H;  2DMN A;  2F4M B;  2KIQ A;  2IRF G;  3F9K A;  4AIH A;  3E6C C;  1ACI A;  3C2G A;  3K4B A;  4LK0 F;  1YQA A;  2QZ8 A;  3W2V A;  2DXI A;  2LY9 A;  1XG1 A;  3ZMD A;  1IV8 A;  3V8J A;  3MZ8 A;  4U0Y A;  1JGG A;  4BY1 J;  1BI1 A;  4HNU A;  4R79 A;  1ZQ3 P;  4XON A;  1APL C;  3GZN B;  2UUZ A;  2DFE A;  4P55 A;  4FAS D;  4L9N A;  2R7X A;  3RI4 A;  2GZW A;  4HLY A;  1OQY A;  4FTH A;  3S16 J;  2P8T A;  4GCV A;  2DQR A;  3LAJ A;  4S0H B;  4G7H F;  1A35 A;  1HXD A;  2RV8 A;  2EFN A;  2L2O A;  5DM6 F;  2B63 J;  2XAS A;  2BY2 A;  1BW5 A;  2W25 A;  2ZNY A;  1BIA A;  1JTY A;  3DXJ F;  3PNV A;  3RTR A;  3E1S A;  3KP3 A;  1J09 A;  2QQ8 A;  5J4V A;  1JKR C;  2M87 A;  1OCP A;  4JQF A;  4IF4 A;  1I3Q J;  1FP1 D;  5CLS A;  3AL0 B;  4NC8 A;  2COB A;  2HVS A;  3RZD J;  1GDT A;  2A68 F;  5F27 A;  4E4H A;  4E7Z A;  2BXY A;  5E3L A;  4BJ6 C;  4M72 A;  4MEX F;  3ASN H;  1CQT A;  5JVG F;  5JR3 A;  4E7H A;  3K70 C;  3PUB A;  3OSF A;  1FWZ A;  3BR6 A;  3TO9 A;  4L9T A;  2EIL H;  2FBH A;  2W24 A;  1J2X A;  3PM1 A;  1MNE A;  4A69 C;  2BVM A;  5GTI C;  2XF7 A;  2ZO4 A;  2RVC A;  1UMQ A;  5JFR A;  2Z33 A;  1R4M B;  1HF0 A;  4N4N B;  2B9S A;  1JUS A;  3F8F A;  2AO9 A;  1BJA A;  3GWZ A;  1B4A A;  3D0S A;  3E5U A;  2B7E A;  4MTE A;  4F52 A;  1V4R A;  5IOY A;  1XD7 A;  4II2 A;  3KP2 A;  3G1L A;  4PJ0 C;  2L7F P;  5DS9 A;  2H6B A;  2CQK A;  5D6F A;  2RGV A;  5EG0 B;  2F5V A;  4IKF A;  3QP6 A;  4LD5 A;  2Y69 H;  2V6C A;  4AU7 A;  4G12 A;  3FHN A;  1OKR A;  3QOP A;  2P5K A;  4EGY A;  1T95 A;  2E1O A;  4OIN F;  4HQM A;  4CYD A;  4Q48 A;  3J7Z I;  2QVO A;  1H89 C;  4I0A A;  5BNG A;  2W82 A;  3MZH A;  1FC3 A;  1JKQ C;  2UXN A;  2EIM H;  2M1B A;  5E3N A;  2VIX A;  5JLX A;  3JRD A;  2EQR A;  4CCJ A;  2PBI A;  3P7N A;  3WHC A;  3WTZ A;  2EK5 A;  1JTX A;  4DW6 A;  2IPQ X;  4EM2 A;  3RKX A;  1WZ2 A;  1QQI A;  4MFD A;  4A0X A;  2TRT A;  4E7L A;  3JRG A;  2Y75 A;  4QSH A;  2R7V A;  4Y3O A;  2MD5 A;  2FNP A;  2LYC A;  4RDU A;  3ULQ B;  2ZBK A;  3A1Y A;  3S2H J;  3TOA A;  5LHG A;  3L2Q A;  1SAU A;  4R8H A;  2K40 A;  3RDI A;  4CSW A;  4E7J A;  2DAO A;  4NQW A;  2A6T A;  1DP3 A;  5TIS C;  2M9H A;  1K6Y A;  1P6R A;  1KQ0 A;  3EYI A;  2XUB A;  3DP7 A;  4DIQ A;  3CJT B;  2IS2 A;  2VBW A;  1JXS A;  1BC7 C;  2L5Q A;  3OSG A;  2DJI A;  2CU7 A;  2Z3Y A;  1BR2 A;  2BGC A;  2K5C A;  2X51 A;  3T5X A;  1G3Y A;  3LA7 A;  2IA2 A;  3HKZ A;  2XIG A;  1FTT A;  5CQE A;  3C2B A;  2AXL A;  2J5O A;  2RRE A;  3R0A A;  1GT0 C;  5GTH C;  4CO8 A;  4HF1 A;  5A2Q K;  3BPX A;  3CCS I;  1OCR H;  2Y0S N;  4BUP A;  2ADU A;  2K9N A;  1HST A;  3FK6 A;  3RYP A;  3K1P A;  3S1R J;  3W6J B;  2STW A;  3IAM 2;  1Z3X A;  4ESJ A;  4JOM A;  2K27 A;  2HYG D;  2RDP A;  1T39 A;  1GV5 A;  2L4A A;  2DLL A;  3ONQ A;  1IUF A;  4XQF A;  4IQJ A;  3LSK A;  1KGS A;  2E36 A;  3ABU A;  3LSI A;  1ZN2 A;  1HW5 A;  2FA5 A;  4P9F A;  3V42 A;  1MMA A;  3OL3 A;  3HSE A;  3FXQ A;  2KT0 A;  3OIO A;  3G1M A;  2CSO A;  2HTS A;  3K6G A;  3ZR8 X;  3ZQC A;  1HKQ A;  2MLK A;  2R7S A;  2DK8 A;  2ME6 A;  1QHG A;  3DBL B;  1N77 A;  4XOR A;  1I6H J;  1W36 C;  4MIM A;  2VT2 A;  5J47 A;  5HDK A;  3TQN A;  3CJR B;  3RPU D;  2X85 A;  3A0H C;  2Q8K A;  1I1G A;  1R7J A;  1OLT A;  4EJO A;  1B8I B;  1GXQ A;  1D1A A;  4UV9 A;  3HGY A;  5CVU A;  1FBS A;  4X1E A;  5IYC J;  2OU2 A;  3M9A A;  2XPU A;  1MNM C;  3HUG B;  4UVB A;  1K79 A;  5AIP A;  4QTR A;  5HLG A;  4AYB A;  1D1B A;  5K5O A;  2CV2 A;  2R93 J;  4MGR A;  2X6W A;  4ZH4 F;  4AVZ A;  2NNY A;  1D3Y A;  3GTK J;  3K4J A;  2C6Y A;  1ZG1 A;  4YII A;  3ZQF A;  2VJJ A;  4XM3 A;  4ASN A;  2VQC A;  1TWA J;  3QPS A;  4ENJ A;  3ZMT A;  4XOP A;  1PUF A;  1DPR A;  4BHP A;  2O6G E;  4IEJ A;  3A0B C;  3QPH A;  2EB7 A;  1S7E A;  3HPG A;  1A5J A;  1F43 A;  4E7S A;  1JUM A;  3DU5 A;  3K9T A;  2JSC A;  2KIM A;  3OOP A;  4A3K J;  5LGU A;  2UV1 A;  4M6X A;  1UB9 A;  3F0C A;  3JRB A;  3RIR A;  2CUE A;  3WGI A;  2CV0 A;  1FPQ A;  3O8H A;  2VBX A;  2XF5 A;  3I3L A;  5HOD A;  2K3P A;  1RR8 C;  4Y7N J;  3C3W A;  1POG A;  3O8G A;  4BS9 A;  4XN3 A;  3UNG C;  1R1V A;  1GUU A;  2Y2Z A;  3F6V A;  5M3M J;  1VZ0 A;  5K5Q A;  4S05 A;  1P92 A;  3GEZ A;  1X3W B;  4I7H A;  1SEU A;  2DTZ A;  2GXG A;  2ZKZ A;  3HKZ N;  4BXF A;  4KYW A;  1WJF A;  3DPL C;  3KLO A;  1MBG A;  1Q1H A;  2JRT A;  2HOT A;  3FXR A;  1R5H A;  3CJQ B;  3W2W A;  3FXO A;  3FIS A;  2XRN A;  2O3F A;  1NTC A;  2DPD A;  1CF7 B;  1DP7 P;  1XMX A;  1ZEL A;  3GZ5 A;  4A3I J;  2I10 A;  3PO2 J;  1SMY F;  3Q0W A;  2KFD A;  2BOL A;  1ETY A;  1SVL A;  3ZGK A;  1D5Y A;  5IT3 A;  5J6X A;  1FP2 A;  3IC7 A;  3NWT A;  3AKZ A;  4KJZ A;  5LHH A;  4KA4 A;  2Y31 A;  3HL2 A;  2V1U A;  3MMY B;  2IVM A;  2K7L A;  1U3E M;  3S1M J;  1ZHF A;  3WTS C;  3CCL I;  5H6Q A;  3EYY A;  3L7W A;  5FB2 A;  3L2U A;  2FNA A;  5L3D A;  3SDB A;  1S7O A;  2FRH A;  3H9G A;  1X1D A;  5FKK A;  3EUK L;  3EET A;  3JRC A;  4QPQ A;  4MQ9 F;  4DBR A;  1G6N A;  2L9N A;  4FQG A;  3ZCO A;  3HOZ J;  3JCU C;  2X48 A;  5GAD J;  3ZMU A;  3GTL J;  4IPA A;  4AIK A;  1EH7 A;  1UFM A;  3I4P A;  1EKE A;  4G94 A;  3BG9 A;  3I55 I;  1MSF C;  2VOO A;  1PJR A;  2VBY A;  5BQT A;  4PUS A;  1VQ9 I;  2CWE A;  4IO9 F;  3DLL F;  1R5G A;  2VPL A;  5FLM J;  2LKP A;  2OZ6 A;  2YR2 A;  2IBD A;  4Q47 A;  3ZOB A;  3EQL F;  4G9Y A;  4D1Q A;  2GQQ A;  3CME I;  4NHJ A;  4I2O A;  1GVJ A;  2QLZ A;  2XPV A;  5HLI A;  4YIF A;  1BR4 A;  2O9L A;  3GXO A;  3QPL A;  2PJR B;  1HW1 A;  3RKQ A;  4PSX A;  2O03 A;  1H9G A;  4F7Z A;  2JZY A;  4I76 A;  1V54 H;  3I58 A;  4CCK A;  2L4M A;  3CLO A;  3DU6 A;  4U7D A;  2LFB A;  3FDY A;  4HG2 A;  1A31 A;  4A5N A;  5IYD J;  4B47 A;  2MH2 A;  2F5F A;  4XRM A;  3KP4 A;  2JK3 A;  4QIW N;  3SZT A;  2XAQ A;  2LKX A;  1ITY A;  1TL8 A;  2COM A;  3BZC A;  4NB5 A;  1B8I A;  4OAY A;  3H9J A;  5ILV A;  2BZT A;  2QM3 A;  3DKY A;  5HLT A;  2G7H A;  3D1N I;  1XGN A;  2DA2 A;  4G6T B;  2JJ7 A;  1JKO C;  2F4I A;  2HKX A;  1UHM A;  4BHC A;  3MD2 A;  2EFP A;  3VWB A;  4HRI A;  1BA5 A;  1I6X A;  5FKN A;  3L00 A;  3BJA A;  3H5A A;  2GM4 A;  5F0H A;  3WG9 A;  1WGX A;  3CDI A;  3WTW C;  4UUS A;  2KKO A;  2K4J A;  2HWV A;  1YYV A;  4KIS A;  3LMM A;  5LLQ A;  5KAI C;  4B8X A;  4GGG A;  2K85 A;  5HNH A;  3K1N A;  5F08 A;  1MSE C;  3CUQ A;  5DUK A;  1HKT A;  5TGT A;  5D5U B;  3OMY A;  3DTE A;  1MBE A;  1Z6R A;  4C3I J;  5CVJ A;  2FQ4 A;  3V7R A;  2DA3 A;  4RB0 A;  2W57 A;  2L02 A;  3KFW X;  2J5P A;  1UEL B;  3BG7 A;  3BR0 A;  1W4M A;  4WXD A;  2LOO A;  3HGG A;  3M7G A;  2M2E A;  4FE4 A;  5LHI A;  3O2P E;  3H92 A;  5D4R A;  1NK2 P;  3V4G A;  5LBQ A;  1FOY A;  4HX8 A;  2XC7 A;  2XHK A;  1YO5 C;  2V79 A;  3DV8 A;  4CYC B;  3ZRG A;  4O3M A;  3HRU A;  3BWG A;  5CVI A;  4ZZD A;  1AWC A;  5L3B A;  5FRM A;  3QRF F;  1LUJ B;  1I27 A;  3HOW J;  1QU3 A;  1FMW A;  4OMY A;  2LSO A;  2VKE A;  2LLK A;  4C9Y A;  3K1M A;  2CMP A;  1WWX A;  4BU2 A;  1CF7 A;  4XOT A;  1VQO I;  2P7V B;  1V5F A;  3SFI A;  3FF5 A;  2TCT A;  1KU7 A;  4AM3 A;  4E6K G;  2VAS A;  2JA7 J;  2M34 A;  2CW0 F;  2XSJ C;  1QGP A;  1YW9 A;  2CS3 A;  3B6C A;  3HG9 A;  2VXD A;  3MEX A;  4CIC A;  2M5W A;  2E7X A;  5HLH A;  2KJB A;  4ZYA A;  1EH6 A;  2KRH A;  3DPU A;  3TL4 X;  1P9Q C;  4F93 B;  1FX7 A;  1V55 H;  5EZH A;  3A01 B;  2DOF A;  2ESN A;  2HDW A;  4AIJ A;  3ASO H;  1K78 B;  3E6D A;  2E5Z A;  1XN7 A;  2EIJ H;  2FX0 A;  2EFQ A;  3MAJ A;  1YHQ I;  1A36 A;  4OIQ F;  1TZL A;  1Z77 A;  3DF8 A;  3LSP A;  3CMY A;  3GTP J;  3TO6 A;  2X1D A;  1JJ8 C;  2YSR A;  3A2K A;  2XKP A;  3L9F A;  3LA2 A;  4KT6 A;  4PJL A;  1MJB A;  3DCF A;  5KHD A;  3CO7 C;  1VQP I;  3WTT C;  3BR3 A;  2H6C A;  1S5L C;  2W00 A;  4PFO A;  4XNF A;  5KNL A;  1U9N A;  3HOV J;  4EMS A;  5E17 F;  1P4A A;  3OL4 A;  5GPC A;  3DEU A;  3CCJ I;  5K7H A;  2LY1 A;  3A4C A;  2WAF A;  3Q9S A;  1ZGW A;  3CP8 A;  1J5Y A;  4DZP A;  3HOX J;  2KZV A;  2PJR A;  3FKJ A;  4CZZ A;  2WAQ A;  1F5T A;  2NAZ A;  4EEF G;  1LEB A;  1K61 A;  1SMT A;  1TWG J;  4C3J J;  2HZT A;  2MYS A;  4BJ5 C;  1E3H A;  2I5U A;  1OIS A;  4KN4 X;  4YFX F;  3OR1 C;  3C1D A;  5GAE J;  3M07 A;  3M1E A;  1LVK A;  4G8X A;  1ZR4 A;  2UWM A;  3TP0 A;  2H09 A;  4LGW A;  4A2U A;  3I56 I;  4BAY A;  1RC9 A;  5E8G A;  2HQ5 A;  3OYN A;  3JRE A;  4BQA A;  2O61 A;  2HOS A;  2KIF A;  1ZLJ A;  2JA8 J;  4U0W A;  3GO5 A;  1R49 A;  2FBI A;  1JHF A;  4M74 A;  3FBI B;  2WB1 A;  3U2R A;  2N8G A;  3HM5 A;  1T0F A;  3GFJ A;  1RET A;  5FRO A;  3JTG A;  1IN5 A;  3ZPL A;  3OYA A;  4A6E A;  2IJL A;  4ENN A;  3KE2 A;  3RQ4 A;  1VQK I;  2LD5 A;  1YW7 A;  2GWR A;  1J0R A;  3MN2 A;  2XKO A;  5DCF A;  2LY2 A;  2LTP A;  5J8C A;  1PVE A;  2HOA A;  1QHH D;  2HPM A;  2OF7 A;  5CVR A;  3KZI C;  4RGX A;  1M1E B;  3J81 Z;  2WA0 A;  4NNJ A;  3JRI A;  4IHX A;  2EA4 A;  1FYK A;  3I9V 2;  2E5N A;  3BZK A;  2KP6 A;  3LFK A;  4CCM A;  4L9V A;  2JQ7 A;  1Z7L A;  1FY7 A;  1OJL A;  3AG2 H;  1BIB A;  4PJJ A;  1FNN A;  2CO5 A;  2EIN H;  3ECH A;  4CDG A;  2EFW A;  1O3T A;  1RKT A;  4KIB A;  1W7P A;  1I1S A;  2EA2 A;  2HR3 A;  1ONV A;  5D5W B;  2M30 A;  3F23 A;  5J1Y A;  1WJ5 A;  2DU9 A;  1IN6 A;  2Y9Y A;  2XGX A;  2BVL A;  4LK1 F;  2P5L C;  3KLN A;  1XSV A;  4UB8 C;  3G6E I;  4RBO A;  2ME0 A;  2NS7 A;  4ZTF A;  4M3G A;  4EVI A;  1A6I A;  2DYR H;  1TW2 A;  1LFU P;  1SFK A;  2KQR A;  1YX5 A;  1GLN A;  1NG7 A;  4UVA A;  4BQQ A;  4BHB A;  4NQW B;  5E1W A;  1TC3 C;  3LSH A;  4M73 A;  1OMI A;  3F3X A;  2KZG A;  5CQG A;  1IXS B;  4XLP F;  1T98 A;  4KUM A;  3OYB A;  2Q1Z B;  5L3G A;  1IXR C;  1MBH A;  1VQ7 I;  1ENH A;  2WY7 Q;  3ABK H;  3OYC A;  3C18 A;  2HXO A;  4YFN F;  1STZ A;  3K0L A;  5B66 C;  3AFH A;  5HDN A;  2ZJP F;  2QUF A;  4M9X A;  4GDF A;  4XRF A;  1ZR2 A;  1K6O A;  4PJN A;  1SD4 A;  3D5L A;  2GXA A;  1XX5 A;  4AC0 A;  4G7O F;  4I6Z A;  1FOK A;  1XTA A;  2CFX A;  4L9J A;  4UUV A;  2ZME C;  4PFP A;  5FFX A;  4O5V A;  1ZRE A;  4LIU A;  1Y39 A;  1JJ6 C;  1FT9 A;  3HRS A;  2DT7 B;  5CPR B;  2E35 A;  3SJM A;  2YS9 A;  4A3F J;  3KP5 A;  1KYW A;  4FHT A;  4OIO F;  1U0J A;  3HC7 A;  3O6B B;  1IN7 A;  1TNS A;  3RJP A;  4KMU X;  3U1D A;  3IWF A;  1N78 A;  1DPU A;  1SD5 A;  2K4B A;  3ZMV A;  4W97 A;  3Q9V A;  5J40 A;  2CJJ A;  2H8W A;  3WE2 A;  4G6D A;  3WU2 C;  4Q5S F;  2RQP A;  3EPZ A;  1JI8 A;  2QA4 I;  1XB4 A;  1MD0 A;  4IL6 C;  2MLG A;  5ERI A;  3L1P A;  2HFH A;  3PIP F;  4KIC A;  3JSO A;  2STT A;  1S72 I;  2VT3 A;  3GTG J;  1I50 J;  1XDU A;  1QNT A;  3ELK A;  2LK2 A;  1OYI A;  4CCL A;  2OBP A;  2M3A A;  3WTV C;  2XGE A;  3OY9 A;  2X6O A;  3LST A;  3E5X A;  1TT0 A;  5KVR A;  1JE8 A;  3VDX A;  3I4M J;  4L5J A;  4D5C A;  1W5T A;  3TP3 A;  3R0J A;  3BC8 A;  3GME A;  2IT0 A;  5IP9 J;  1W0U A;  1Z67 A;  3FXU A;  3CC7 I;  3JAM K;  5M3F J;  1YJN I;  1ETX A;  2BV6 A;  4FX4 A;  3L2W A;  2JWT A;  2JA5 J;  5FO5 A;  5DV5 A;  2KIU A;  3KYL A;  2D5V A;  4B44 A;  3PSI A;  3GLX A;  5FKM A;  1PUF B;  2W48 A;  5D8K B;  5JLW A;  5CVV A;  2PJP A;  3TW6 A;  2G7U A;  2Z2S B;  1D8K A;  3B02 A;  4IHS A;  3G1O A;  4EQQ A;  2WV1 A;  4MEY F;  4DQ2 A;  1LFB A;  2DMP A;  2JTV A;  5KK1 A;  1SFU A;  2A3S A;  4BQO A;  1O3Q A;  1EV7 A;  1I39 A;  2BHZ A;  4ESB A;  2DYS H;  2KHM A;  2VB6 A;  3BZ6 A;  2IS6 A;  3M8F A;  2A5W A;  4XKC A;  4LB6 B;  2L01 A;  3IL2 A;  1IUY A;  1QVU A;  1O3S A;  3COA C;  3MWM A;  4MHG A;  1YG2 A;  2Z99 A;  5GPA A;  2OD5 A;  2ETH A;  3BPV A;  3BDD A;  3TMO A;  1FEX A;  1OCO H;  1T56 A;  4ITV A;  5FJ8 J;  3G2B A;  3RSN A;  2WAD A;  4F91 B;  2LF7 A;  4D5F A;  3B73 A;  1MDM A;  2CUF A;  2DFF A;  1YTY A;  3HEF A;  2QF7 A;  2HQA A;  2P0W A;  4L0Z B;  2HYJ A;  1O7F A;  1VQ8 I;  1QZZ A;  2QEN A;  2XAU A;  4W1U A;  1ZRD A;  1BI3 A;  3PNT A;  2EFO A;  2G9W A;  3VB2 A;  2FE3 A;  3IH2 A;  1BW6 A;  4RAZ A;  2MW8 A;  3KCC A;  1ON2 A;  3GFM A;  2YU3 A;  4C30 A;  3C7J A;  1LQ1 A;  4ENK A;  4IHT A;  4AD9 A;  4E70 A;  1Z6T A;  3ZQQ A;  1ZK8 A;  2Q2E A;  4A6D A;  3MKZ A;  2AXT C;  3FZV A;  5GAH J;  1XC5 A;  3M8J A;  4DYR A;  3FM5 A;  2MFZ A;  5FLX K;  5HNF A;  1LDJ A;  2R7W A;  1ODD A;  3TBI A;  2O5R A;  4ZJZ A;  2Y0M A;  4PJM A;  4D0P A;  4EM0 B;  3KEO A;  1Y6I A;  4D7N A;  5DM7 F;  5BPI A;  5E20 A;  2XB0 X;  2XGD A;  1RR7 A;  2PMH A;  2EPF A;  3Q3S A;  3L2C A;  2E34 A;  4C2U A;  4BE2 A;  3OYD A;  1B59 A;  3TED A;  4UY8 I;  3J80 Z;  1FLI A;  2A07 F;  2ZFW A;  1YRN A;  2X9D A;  3ISP A;  5TJJ A;  4RAG A;  1HKS A;  2EJR A;  1D0Y A;  2XPW A;  1LDD A;  4HEA 2;  3CDH A;  3ZQ7 A;  3OYJ A;  1A6Q A;  2ZB9 A;  1IGN A;  2EWN A;  1X1A A;  1XSD A;  1R9T J;  2LDU A;  5BOX A;  2ZME A;  2M0C A;  2FQ3 A;  2DOA A;  3I54 A;  1YOV B;  2JUC A;  4IJA A;  4ZDO A;  1SD6 A;  4CCN A;  3CUQ C;  2F5E A;  2V4J C;  4PK4 A;  4EJU A;  4KIT B;  2DK5 A;  3WGG A;  2ICW G;  4CA0 A;  1S9H A;  1LNW A;  1OPC A;  2V1D A;  3DWL E;  2QQ9 A;  2K3F A;  2FML A;  3DKW A;  1TQM A;  1Y1V J;  2QBY A;  4IOC F;  2EH3 A;  2IA1 A;  4U88 A;  1IW7 F;  3I71 A;  1FBQ A;  2CRG A;  3H0G J;  4A93 J;  2ZJR F;  3JRF A;  4UUS B;  1E3P A;  3S32 A;  2JA6 J;  5FKO A;  1L0O C;  2ZJ2 A;  2ID3 A;  1KU9 A;  2BW3 B;  3DKX A;  4LIT A;  4IHV A;  3ROU A;  3CUQ B;  2HPI A;  5J3L A;  1Z1D A;  4LMY A;  4BE1 A;  3S17 J;  2HOE A;  4D9J A;  4DJA A;  3OYL A;  2K86 A;  2BXZ A;  2DO7 A;  2FMY A;  4OU0 A;  1FOW A;  2HDD A;  1WFX A;  1LFP A;  4GFB A;  2K9Q A;  2K9S A;  4A3G J;  3TO7 A;  3N05 A;  3P5J A;  3ZQI A;  1LDK B;  3DEE A;  2BY3 A;  1K83 J;  4OWR B;  2H8R A;  2RKH A;  3S8P A;  1R36 A;  5IT9 Z;  3EUH C;  1IV6 A;  4RLQ A;  3K2Z A;  2P6T A;  3PFI A;  2VKV A;  3OV8 A;  4HPQ A;  2K02 A;  3GX4 X;  2VQH A;  4MQV A;  4M9Z A;  2DN0 A;  4YFK F;  4ZTJ A;  3TDU C;  3G3Z A;  3I0T A;  5H2F C;  3HIF A;  4CCO A;  1AOY A;  3F21 A;  1C0W A;  4HA8 A;  2Y9Z A;  4HAM A;  1SAN A;  2AHQ A;  2PN6 A;  1G4D A;  1R58 A;  1MMD A;  4BQN A;  2OA4 A;  4LLG F;  3S15 J;  3O3K A;  4UXN A;  4EJV A;  4XKV A;  4IXA A;  1D1C A;  4B48 A;  3CP2 A;  2OTJ I;  1JHH A;  4XID A;  1H88 C;  1MMS A;  4J19 A;  1E2X A;  3DBH B;  2QSF X;  5C44 J;  1KQ9 A;  4XMY A;  1Y8Q B;  2BBY A;  4GO1 A;  3AG1 H;  5EEG A;  5JHF A;  2K9L A;  9ANT A;  1U5T C;  3OIP A;  1I5Z A;  3ZXS A;  4XBF A;  1VTN C;  1SC7 A;  2EZL A;  3DPT A;  3SXY A;  5GAG J;  4RGS A;  3F22 A;  1WRJ A;  3VYT B;  3CF2 A;  2P7C B;  1MMN A;  1G8X A;  2OAZ A;  2MSY A;  3OS2 A;  2DA6 A;  4HBL A;  5E1X A;  5H20 A;  1QZE A;  1SFE A;  3REO A;  5C4J J;  1YIT I;  1T8I A;  1HQC A;  4LJZ F;  1W5S A;  1ETK A;  2NYX A;  4WCG A;  1WJA A;  3DLA A;  3NQO A;  4CH7 A;  4BJT A;  2XAJ A;  2PQ8 A;  5ILS A;  5E3M A;  4B4C A;  4JX4 A;  5EEH A;  1SFX A;  2JVH A;  4AYB N;  1BBY A;  1T38 A;  3RKY A;  1VQ4 I;  1TNT A;  4RS8 A;  1PDN C;  3CQZ J;  3MZY A;  1U5T B;  4G6Q A;  2HI3 A;  3OYH A;  1HOM A;  2L0K A;  3IKT A;  1JUP A;  1T0F C;  3KET A;  2HEO A;  4FX0 A;  2R7D A;  1T6S A;  1JT0 A;  3FIW A;  1MH4 A;  2EV0 A;  1OR7 C;  3NAU A;  3VYR B;  1UST A;  3DFG A;  3K7A J;  1V5G A;  4ZYG A;  1B72 B;  2FD5 A;  3V7C A;  2CGP A;  5LD2 C;  3CMA I;  1XCV A;  1QZY A;  1G3T A;  4AUX A;  5LEJ A;  1IC8 A;  1HLV A;  5EJC A;  2LRD A;  4AID A;  1FSH A;  3JSP A;  3C2H A;  3JRH A;  1FTZ A;  2ZSI B;  3E3V A;  3OIQ A;  3VYS B;  1R5I D;  5B3S H;  4WXC A;  1IAW A;  2IW5 A;  3OYK A;  1OFC X;  1R4N B;  4OAZ A;  4BH9 A;  3RPU A;  2VI6 A;  3S3M A;  1YIJ I;  1TBX A;  1RES A;  4NBQ A;  4YG2 F;  1FZP B;  1ETO A;  1DGW Y;  2ZFU A;  3E6B A;  4CHU A;  2M45 A;  2XRL A;  4MLO A;  3E7L A;  5FFZ A;  2BE5 F;  1PUE E;  4M9S A;  2MC3 A;  3OYF A;  3SEZ A;  2JPB A;  5JHU A;  4IHW A;  3F8N A;  4ON0 A;  3WU1 B;  3HDD A;  4OIR F;  2BW3 A;  2ECC A;  4LOC A;  5DCM B;  3OYI A;  3RPQ A;  3ZP5 A;  1OCZ H;  2WWY A;  1AHD P;  2DA1 A;  4L5E A;  2KRF A;  2LNB A;  2PMZ A;  2V6E A;  3ZMS A;  3CTA A;  4QPO A;  5ED4 A;  2LRE A;  3FXM A;  2R92 J; 
#chains in the Genus database with same CATH homology
 3ABK H;  5B1A H;  2OCC H;  3AG3 H;  2Y69 H;  3WG7 H;  2EIL H;  1OCC H;  2DYR H;  3AG2 H;  2EIN H;  3X2Q H;  2DYS H;  3AG4 H;  3AG1 H;  1V55 H;  1OCZ H;  2EIM H;  5IY5 H;  3ABL H;  3ABM H;  3ASO H;  5B3S H;  2EIK H;  2EIJ H;  1OCR H;  2ZXW H;  1V54 H;  5B1B H;  1OCO H;  3ASN H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...