1R00A

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-homocysteine (sah)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r00A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r00A03
3TRKA 3R6SA 4M9XA 4RTQA 3J80Z 3WTVC 3QOXA 5HIIA 1JG3A 1X3UA 5DD4A 1Z6RA 5DT2A 4F85A 1ZG5A 1QAMA 4KMUX 3C3YA 2ONZA 1R18A 1T38A 3N97A 1H9TA 4HF2A 1XDZA 5EHGA 2NYXA 4I01A 6PAXA 2O3FA 3P71T 1O54A 3T8TA 3CTAA 1ULYA 3NTVA 3E23A 1IRGA 2PVCA 3J81K 3JSPA 1F4KA 4L9NA 3KP6A 4AZSA 4M71A 5LQCA 5IT9Z 1DUXC 1JGSA 4HLXA 1U3EM 2QY6A 5K5OA 2QE6A 4RVHA 2D45A 3LCVB 1F3LA 5F64A 5ICEA 2CMGA 2PN6A 2JT1A 1X1BA 2WWYA 3PLAE 3JWHA 4BYYA 5M5BA 2OZVA 2XBMA 2VT2A 3V8JA 4HLYA 2CGPA 1Q1HA 2OBPA 2EK5A 2ELHA 5GWXA 1NW6A 3B7PA 1P4AA 3I4PA 1RI3A 1MDMB 2PFBA 1UCRA 1S7AA 2YU3A 2P8JA 2MD5A 4LG0B 3P9IA 1EH8A 4X60A 3SR4A 4OA5A 3ABUA 1O3TA 3QPHA 5HDNA 1RI2A 2PSSA 3THSA 3WTTC 2ZWAA 4EGZA 3GNLA 4DKJA 3HA7A 3R9XB 4GYIA 3ME5A 1VTNC 4RAYA 5EZSA 2O6GE 2P1DA 1VE3A 4Y13A 3P9CA 4E2WA 2P5VA 3GRRA 1ON2A 1PRYA 1TQPA 1HKTA 4RTJA 2EV0A 1UFKA 3L7WA 1ZGAA 2XYRA 3UZUA 3BDDA 3G3ZA 4XUCA 4DCGA 2ZMEA 1KP9A 1ZG3A 5H6RA 1HW1A 3HCBA 2G8NA 2A69F 5HDKA 5D1HA 2IRFG 3IKTA 4PIPA 2C7PA 2LD4A 2GAUA 1Z3CA 5BS6A 3ER8A 4RB0A 4G7OF 2AN4A 4V0RA 3DMGA 1IRFA 4LB5A 5IT9K 3F6VA 2E7XA 3ZP5A 5C0OE 3NJRA 2IH5A 2WC2A 3NWEA 2FOKA 3GF2A 3K69A 3KP4A 4AIKA 3NMUF 2JHPA 1OYYA 1YF3A 3A7DA 2ACJA 1B9MA 4U0YA 4G6QA 1FBNA 3ZMDA 4E2ZA 4PZJA 2EV5A 3ORHA 5F6FA 2Q8KA 3EVCA 2HFHA 2DULA 2PX5A 2YX4A 4PGGA 5IH3A 3F6OA 4EM1A 3IV6A 5HS7A 2Z6QA 4NQWA 2HDCA 5C9ZA 4HYEA 1ZARA 1DP7P 5FUBA 3E6CC 2IPQX 3KKZA 3GRVA 4B17A 1UWVA 4LK1F 2UYQA 1XDUA 5EKXA 5CUQA 1UFMA 3R6TA 2I9KA 3NW9A 2A6EF 2YXEA 1P6RA 4GOMD 3KPYA 4HZFA 3R61A 5DCFA 1IAWA 3I58A 3HVJA 1SVUA 4UHTA 5KVAA 3CCFA 2FU4A 4M6YA 1EH6A 2H94A 4FSXA 4NECA 1N7JA 3ABTA 3G8AA 1R00A 2KKOA 5LEKA 1XN7A 4HX4A 1B1BA 3P9KA 5DD8A 3VOEA 4FT4A 3OU2A 3ERCA 2AVDA 2BGCA 2XASA 3HRUA 3RKYA 4GUAA 2HS5A 2IBTA 4AZWA 2VBXA 1RJDA 3F3XA 3Q9VA 3L8DA 2YPRA 2M87A 4ZYGA 4A0ZA 4E31A 3BKWA 1BHJA 4P7GA 4RB1A 1K78A 5E1MA 3E7PA 1F1ZA 3F8FA 3UJAA 4C4AA 4ETSA 1RNLA 1ONVA 1JTEA 2JHCA 5H20A 4YG2F 5ICCA 3FPFA 1XB4A 1Y0UA 1T0FA 1DDNA 3HVHA 4RS8A 3M70A 2QQ9A 2WA2A 1MJFA 2K02A 3BPXA 4OMZA 4XSXF 1N2XA 2ZO4A 4LB6B 3PB3A 1D2HA 5T64A 3FHZA 3M6XA 4PYLA 2PX4A 2I6GA 1R7JA 1BOAA 4L5IA 3LAPA 1X1CA 3EGIA 4O3MA 3HVKA 4R6XA 5E17F 5LQJA 5DX0A 2QRVB 3SSOA 4G8XA 4PCQA 3F72A 3WU1B 3ZMZA 2VDUE 5LQUA 2IDJA 3SXYA 1QBJA 2I7CA 1HQCA 4BAYA 5K0FA 5FA5A 4EQQA 4JK1X 5LGNA 2JJQA 4CYDA 1EQAA 1NV8A 3WTXC 1LVAA 3B73A 5E1WA 3TO9A 4R05A 3KP3A 1FT9A 3FPJA 5EMMA 4L0YB 5D5XB 5AIQA 3JAMZ 1MDMA 4HBLA 3F21A 1JG4A 4HA8A 3TO7A 2J5OA 3T0YA 2PKWA 3CC8A 3WGIA 4BHBA 3G2MA 1QNTA 3ZN0A 2KIMA 5KS2A 1LDDA 3NEUA 3S68A 4E70A 3SGLA 3ANXA 1G3YA 2GA2A 1UIRA 2JSCA 3DR5A 3K9TA 3MAGA 3FUWA 3CLOA 3QU3A 4EJTA 3P7NA 3ECOA 3AXTA 2FRHA 4HW0A 5KYGA 3EYIA 3FMQA 4P7FA 2VBYA 4JQFA 2ZIFA 3QV2A 1NV9A 1LDKB 3K1PA 4KW7A 3V7SA 4PONA 5GINE 3E5UA 4FP9A 2PXAA 1A04A 2JZYA 3I54A 3HHHA 5JR3A 4PYQA 3P97A 2ESHA 2PLWA 1R74A 3FPGA 3KQMA 5D5WB 3BOQA 4CDGA 5GP1A 2CYYA 1SAXA 3PS9A 1L1EA 2UYHA 4U0VA 5DRTA 5CJ9A 3VEPA 1O9GA 3K1MA 2XHKA 2QQAA 4UUVA 4HF0A 3NVMB 1USTA 1PP8F 3P2KA 3LDFA 4HGZA 2VP3A 1HKSA 5E1BA 4WWCA 1MJAA 5LGUA 1W7PA 5FD6A 1U2ZA 2XVMA 3RW9A 1TLHB 1F9NA 3E8SA 4IKPA 1P1BA 4LJZF 5CVRA 4KWCA 2X4HA 3HIFA 2XKPA 2IIPA 5B1SA 5LSAA 1O3RA 3MQ2A 4RTMA 3HCEA 5EKUA 1KHHA 2EA4A 3L9FA 1K7AA 3A4TA 1TW3A 5D6EA 5D1NA 3C0KA 2DO7A 3IC7A 2CSOA 2DPUA 4Y2HA 5HOQA 2PMHA 1VBFA 2G70A 3LBYA 4IV0A 5DXAA 4P96A 2VBZA 3GVAA 5DXJA 4MQVA 3E97A 1XCBA 4EJWA 4Q48A 1IUYA 4HC4A 3TGNA 2FSWA 3JWJA 4OQDA 3RDIA 1GXQA 3GJYA 2D2WA 4KA4A 2MA3A 3SHFA 3EVEA 3MCZA 3FUTA 3U81A 5E8IA 4CWAA 1SFEA 1H1DA 3BT7A 3C6KA 4OIQF 1BI1A 4KICA 4RVFA 2KRFA 3FZVA 4PYMA 3GRZA 4KIFA 1UHWA 5FO5A 5E9JA 1BM9A 2G9WA 2FBHA 1K78B 4N0BA 5DX8A 2ZULA 1YO5C 4G56A 2G7UA 4I02A 4OX9Y 1YW8A 3G2PA 3IHUA 4ENMA 5K1YA 2PT9A 4BLVA 1YFLA 4BH9A 4BNCA 3EMBA 2WK1A 4RTNA 3LSTA 1MHTA 3KQVA 1IXCA 5EHIA 3BY6A 2P41A 2LSOA 1KQ8A 1FY7A 4P5OA 4A6DA 4ZYDA 4PCLA 2HQRA 4CGZA 3OU6A 2A6HF 5CVUA 3BZ6A 4A5NA 2C6YA 2D1HA 2Z33A 5K0CA 1ZLJA 2A3SA 1Z7UA 3GX4X 1XDSA 5DTQA 5ILVA 3UJCA 3KLNA 3PQKA 2X0LA 1HXDA 1O3SA 1FSEA 1OMIA 2VOPA 2EWNA 4CTJA 3JWGA 1YG2A 3I5UA 3ELYA 2RC4A 2HKOA 1FP2A 3SQNA 2M8EA 4K2EA 1MJ9A 4OIRF 1YB2A 1TQIA 2B3TA 3BGVA 2V1UA 5J6XA 3ZQ7A 3PFIA 3WTZA 4I2OA 2V79A 4MNUA 4O6JA 1R23A 4HV6A 2AXLA 3CO6C 5EVJA 2ZFWA 1XVAA 2BEOA 2C7RA 2PY6A 2GB4A 3QOWA 1OR7A 5BOXA 5LHGA 2EB7A 2DT5A 3HHGA 5LQAA 2VONA 4G6DA 3O3KA 2FQ3A 4BLWA 1O57A 5GM1A 3LPMA 4U7TB 2H6CA 1ZH5A 3I9FA 3AWIA 5GIPE 3UJ8A 3ER9A 4ZH4F 4WF2A 4I09A 5FLXZ 4QTUB 5H6QA 3WTSC 2IH2A 1WI9A 3FMRA 3QP5A 2F5CA 5DYMA 4QLCU 4A2UA 4X1OA 4C07A 2EFQA 3U9GA 5LQRA 3M4XA 5AIPA 3LBFA 2ERCA 1U8RA 4F84A 1R1TA 1RJEA 3HRSA 4ER0A 2HKXA 3RI4A 1QQIA 2RNJA 3JW4A 2PV0A 2GPYA 3R4KA 4MEYF 1JXSA 8MHTA 4KFCA 2AOWA 3GW2A 1Z1DA 1I5ZA 4CZZA 3UJ7A 3O6BB 4LECA 4GCVA 2R3SA 3BGIA 1M6EX 1FX7A 1ZRFA 4A0XA 3BWMA 1TW2A 2ZBRA 2OA4A 2GIVA 4LWOA 4WXHA 2IFTA 2Y1XA 4BLUA 1QANA 3Q7EA 3V7RA 4HG2A 3ZN1A 4CKBA 5HOOA 2D1VA 1IW7F 4WXCA 3WGGA 2QZ8A 3CJNA 1R8YA 2G1PA 1JQEA 1ON1A 3WU0A 2IH4A 2O07A 2XAHA 2HNKA 4F86A 4HV5A 4K6MA 5L3BA 1JHHA 3LQRA 1XSDA 1SD6A 4PCAA 3EVBA 3DULA 5FCDA 2UZKA 2F5EA 3KQYA 3ELDA 1RJFA 4U0WA 2OYRA 1BI2A 3LKZA 1G4DA 2ZMEB 4L9JA 1E17A 4IJAA 2FXAA 3A25A 2K27A 3CDHA 1FYMA 1SUSA 1Z91A 3G2OA 1FP1D 2P7VB 3OU7A 4IRIA 3SMQA 4M36A 3NDJA 2OB2A 3UJ9A 3SFZA 5EIWA 4G7ZF 3U1DA 5FULA 4UXNA 1ZLKA 4L5JA 2ISYA 2HTJA 1FLIA 3UJBA 4MGRA 3KZYA 1BC8C 3PFGA 1XJ5A 2UWMA 2PT6A 3LDGA 3HSRA 4GOLD 2ZBPA 1B9NA 2UYOA 2V1DA 1KU7A 4EKGA 3KQQA 3CJQA 2DK5A 3TLJA 1U5TB 4N9HA 2NXJA 1G6NA 1R8XA 3G88A 2P3OA 1IZ1A 3BKXA 1WXWA 1MKMA 3EVFA 4YFKF 3CUQC 4PNEA 3EEYA 1KXZA 3LA7A 3IKVA 1P39A 1NHAA 4XCXA 2OB1A 4IRGA 5LHIA 3J7AO 5DSTA 2DFIA 2Z3YA 5EGSA 1AV6A 3U2RA 3LAJA 2XVCA 1IN6A 3J80K 3HOSA 5L3GA 5E8RA 1WY7A 5E18F 3QP6A 1DPUA 3SVZA 3KPWA 5J8FA 2DLLA 4HGYA 2VC0A 4LFUA 1RUOA 3ROUA 2CKDA 1W5SA 3OPNA 4V0QA 5HILA 1EJ0A 4ENNA 2HTSA 4GO1A 1NW3A 3LCCA 2DAOA 4P58A 1SD4A 3HSEA 1J2XA 5HLIA 4FX4A 2YR0A 4DMGA 2MBFA 3M6UA 3EVDA 3LGAA 1H0MA 3A7EA 2YUIA 5ERGB 3SM3A 2OZUA 1TNSA 1ZGJA 5K05A 3EVZA 3F22A 2IP2A 3M33A 2PX2A 4Q47A 2P3QA 5CIYA 4PIMA 1GHCA 1M6YA 4LD5A 2ZJ2A 1OR8A 3VC2A 4WXDA 1SG9A 1D2GA 3NVKI 2L4AA 3CUQB 2XYVA 3PT9A 2BM8A 2O0YA 4PYIA 2FMLA 4HQMA 2VOOA 2P4WA 2MC3A 1W7PB 4KIGA 1AQIA 3ML6A 3DF8A 3MEXA 9MHTA 4ESBA 3KP7A 3E05A 3UJDA 3KZZA 4MQ4A 4GOOD 5E9WA 4A6EA 3W6JB 4R79A 1IM8A 5T6BA 2ZWVA 3F8CA 2FF4A 2FBKA 4R8HA 1FC3A 4QTTB 4QDKA 5LR6A 3NQOA 1JR4A 2HR1A 4B8XA 4CXFA 2IDKA 1U2WA 2ADMA 1VPTA 2W57A 3KQTA 1MGTA 4I0BA 3FTCA 5EMJA 2GZWA 1YZHA 2PJDA 2K4JA 4EJUA 1ZQ9A 4EK9A 3SZPA 1HNNA 4YV0A 5LBQA 3KPVA 3I71A 4MTLA 3C18A 1Z9CA 3OZRA 1U78A 2RVCA 3H92A 3DH0A 4YFNF 1BC7C 1S6LA 3WG9A 1RI1A 2H09A 1N7IA 4ER5A 3V8LA 3ZMUA 3SXJA 3SSNA 2K4BA 5K8VA 1S7OA 3E5QA 2PLYA 2V74B 4OU0A 1FNNA 4YUXA 3F23A 1TQMA 2OAZA 1CF7B 1ORHA 4MWZA 4PGHA 5ERIA 1CGPA 4LG1A 1ZKDA 2PEXA 1QGPA 4R1HA 4QDJA 5JFRA 1VP9A 4MEXF 3CO7C 3F8BA 2J5PA 2VBWA 4Y30A 5ILUA 2W24A 3RIRA 5BW4A 4IF4A 4IV8A 3SZTA 4HDVA 1QYRA 5GIOE 1YFJA 1YW9A 2H6BA 2UZ4A 4XBFA 3FYDA 1ZHFA 3G73A 5EEGA 4FS8A 1U5TC 1NBHA 4H0EA 1XXLA 2ZW9A 4RTKA 3NWBA 2ZIEA 2XV4S 3K0BA 5CVJA 1W7PD 4DNCA 1W4MA 4AUKA 2QQBA 3DEUA 5HDGA 1C0WA 3KR9A 5EZQA 4BP1A 2XIGA 2IJLA 2ZZKA 2ESRA 4S04A 3E6MA 5DM4A 4Y17A 2PX8A 3KU1A 1I1GA 3F4KA 3KEOA 2CW0F 1U5TA 1H9GA 4KMFA 3FXQA 3P2IA 4PINA 4BXUA 1EJ6A 5D8LB 4L0ZB 2PWPA 2Z6AA 3T7TA 3MHTA 2P7HA 3I0TA 4KT5C 2HYFA 3HYIA 4DA4A 3AJDA 2Y1WA 3G5TA 1QO0D 2DW4A 5F2OA 3DXJF 1L3CA 3GXOA 4U88A 1L3IA 1PP7U 2VE9A 1SUIA 3TFWA 2B78A 3B3GA 2OPBA 4LG0A 4RYLA 1ZRCA 2GA1A 2FPOA 1D8KA 5FA8A 5E1OA 2DTRA 5FFZA 4L7VA 2EFNA 4M9ZA 2QM3A 5DX1A 3HP7A 5FLXK 1O9HA 5E1XA 10MHA 1I9GA 3KPUA 2YTZA 4U7BA 2O0LA 2ONYA 4XSZF 4HOBA 4MQ9F 4EJOA 3M8EA 1NW5A 5K5QA 2MH9A 3HTUA 4E2YA 4WX9A 2STTA 1XMKA 3D5LA 3B02A 3ELKA 4RX1A 1RUNA 4XLPF 3I64A 4ZZLA 2O03A 3MZYA 2YXDA 3FUUA 4PWYA 5DPMA 2UXNA 3RYRA 4OBWA 5HZMA 1DCTA 5FTWA 1LEAA 1IXSB 3EETA 3DTNA 1KA8A 2IA2A 4ISCA 3MERA 1JE8A 3OFKA 5HIKA 1PJZA 3ID6C 1YLFA 3DQVC 3G2QA 2OBFA 4M37A 2V7EA 4HX7A 5FHQA 5IT3A 1IN5A 3K0LA 3DV8A 5K03A 3T1BA 2ADUA 5FQOA 2WV0A 4PYNA 2EFOA 2XGXA 4ER6A 1HBXG 5EQJB 4HSGA 5CLSA 2EFPA 1JSXA 3D0SA 1RIOH 2BR4A 3JTHA 5CCXA 4RTOA 4ZYHA 5K01A 3LDUA 5H02A 2CG4A 3GFMA 2P8TA 2MLGA 4QVKA 5CVDA 2ZZMA 3ELWA 2E7WA 5DTRA 1EIZA 4YIFA 2RV8A 3CJTA 2Q0OA 2ORED 3EMDA 4ZTBA 2PBIA 5HS8A 3QOPA 3GWZA 2P3LA 3UJ6A 2W84A 3R24A 3E5XA 4IHSA 1J0RA 2PBFA 1BKYA 5P8WA 1KQ0A 4L18B 1T2KA 3CUOA 3FYCA 2FK8A 4RB3C 5D8KB 2HV9A 3OE4A 2COMA 4QPPA 3BXOA 3T7SA 2EJUA 1HKQA 2QBYA 5BXYA 1VQ1A 5D5VB 1O3QA 4BQAA 1NW8A 4YUVA 3L09A 1VLMA 5L3DA 2GA9A 4LLLA 4RGUA 1ZN2A 3V7CA 3TKAA 5GM2A 2L3DA 3DP7A 2XAFA 1T43A 4HF1A 1YW7A 2M30A 4HTFA 4CHUA 4NHJA 2OO3A 1P2FA 3MCTA 2ZCWA 5E8GA 3GEZA 4E32A 3QPTA 4ON0A 3OE5A 4EKIA 1OYIA 2L4MA 2B25A 3BZBA 2ZVJA 3E6BA 3LHDA 3K1NA 1G60A 2XKOA 1GXPA 5K0GA 3HRMA 2M5WA 3IRRA 1VL5A 2PGXA 2ZBQA 3CVOA 3P2EA 4HTFB 3DXYA 2YX7A 4IVNA 2EA2A 3ELUA 1YTYA 5EG5A 1NBIA 3DXXA 3C3WA 2A07F 2PQ8A 3F8MA 3DPTA 1BBYA 1K79A 2N47A 4QQKA 4GGGA 1XSVA 3R60A 5E1ZB 1INLA 2VE8A 1XSXA 2Z9OA 3LX6A 2K86A 5GOZA 4PYKA 1IY9A 2NXNA 5LQKA 3Q9SA 1J5YA 3I53A 1XGMA 1KYZA 3GDHA 3MTEA 4AVPA 1JQDA 2B2CA 4AZVA 5K0LA 2K7LA 4IPAA 1BJAA 3HNRA 1P4XA 4YV1A 2NP6A 3LWFA 3KPJA 5DRYA 3H2BA 2DI3A 1TNTA 3ZPLA 2BZGA 1BI3A 3HM2A 1WWXA 1S29A 4U7DA 4RTRA 1ZYRF 2WTEA 3EPPA 1QZYA 3UA3A 2TDXA 1OKRA 2QBYB 5DM2A 3TM5A 2P5LC 1T6SA 3GRYA 2L02A 2E1CA 5CVIA 1FOKA 3G8BA 4YMHA 3JAMK 1FWZA 3LA3A 1EG2A 3CKKA 3DLCA 2PXCA 2BM9A 2RQPA 3WE2A 2A61A 3HTSB 5EMKA 2VS1A 2VDVE 3GFIA 4RSRA 1T39A 3WODF 3M1EA 4M9SA 2JG3A 3MFKA 3J81Z 3MZHA 4RV9A 5ILSA 1WG8A 1MJBA 4RAZA 2Z6UA 3VFZA 2KIUA 3G7UA 4Q5SF 2QYOA 4IHTA 2EFJA 3Q87B 3M7GA 4CKEA 4BHPA 3OFJA 4P9FA 2EJTA 5F1RA 1SMYF 4N9IA 1U6GA 3BWGA 1YYVA 2XAJA 2HEOA 5A2QK 1BOOA 4FGZA 3A26A 2CL5A 4I7HA 1LEBA 2P6TA 3GFJA 5K0NA 5FGMA 4XUEA 1XMAA 2OU2A 3HSFA 5LRRA 4EM0B 3V8KA 4RWZA 2MH2A 5EOVA 2M45A 3K2ZA 3KR0A 1JQ3A 3KHKA 2O8XA 4NB5A 2ZTHA 3FUVA 4R8SA 1R22A 3KEQA 1O7FA 1SD5A 3CUQA 3AY0A 4JXJA 3DXZA 1RI4A 3GFLA 3REOA 1KIAA 2EV6A 3I59B 1IN7A 4KDPA 3H3ZA 4OOIA 1L3BA 2F5FA 2RN7A 3EUHA 5LEJA 3QU6A 1XD7A 5E20A 4RGXA 5FHRA 1Z05A 1WRJA 2B0LA 1KPGA 4OINF 4AIHA 5A2QZ 5LQNA 1ORIA 2NS0A 2GS9A 2VXZA 5HLGA 2OZ6A 2NXCA 4KN4X 1UHMA 4RTLA 3KCCA 2ZSUA 3V4GA 3VB2A 3O2PE 1KQ9A 3TR6A 2VODA 3MAJA 5KQRA 1PUEE 3S2WA 1KPIA 4WCGA 4ENJA 1F5TA 1WS6A 1W5TA 3UWPA 5JI6A 3G89A 3V8VA 3EEOA 1FZPB 1AF7A 5EIFA 5K0JA 2QVOA 1D5VA 1E2XA 4Q4ZF 4FSDA 2NXEA 2FNAA 3C1DA 4LLGF 5BPIA 5FADA 2VC1A 2F2EA 1IN8A 4RGSA 3RIEA 3OZTA 2ZXJA 1I1NA 2LF8A 3WSTA 3HA5A 1Z6TA 4OA8A 3UA4A 1XCVA 4CO8A 3B5IA 2DPMA 3BGDA 3KETA 3FRIA 1LNWA 4C03A 5FB2A 1KYWA 2L01A 1QZZA 1LDJA 2ZZNA 2Y0MA 1D3YA 1G38A 3C7JA 3RODA 2ZBKA 2AOUB 4GC5A 2IA1A 3WTUC 1YQAA 2EG5A 3UFBA 2YQZA 2GXBA 4IXAA 4LK0F 2XYQA 4MTEA 4CICA 2OY0A 3SX0A 3VC1A 2A14A 3TOBA 4KUMA 5G02A 1G8SA 4ASNA 4LWPA 2Y48A 3FPHA 3R3HA 4M6XA 2YSRA 3GGDA 1G55A 3FTEA 2FHPA 2DBBA 3C6MA 3P8ZA 5E1DA 3KP2A 2R6ZA 5DLYA 3DLIA 1FYLA 5F2KA 4OMYA 2DU9A 5DCMA 4OIPF 1XGOA 5LLQA 3EDPA 5ICGA 2XVAA 3FRHA 4ATNA 5BQTA 2HR3A 4F7ZA 4YV2A 2C7OA 2GWRA 4HX8A 3MB5A 4AZTA 5EMLA 2JPBA 4X41A 3TPZA 4HAMA 5BP7A 5IKMA 1QPMA 3E6DA 1OYWA 4A0YA 3BUSA 1B4AA 1XGSA 4L9TA 5TJJA 2OQGA 4DZRA 2QENA 2QLZA 5CM2Z 4X63A 3OCJA 3ULQB 2AOTB 1TTYA 1J7KA 4DQ0A 3FPEA 5EEHA 4WK8F 3HRTA 2LKPA 3DPLC 5CVVA 3IYLW 3UBTA 1DL5A 1SMTA 3LCUA 4HQEA 1BIAA 1R6AA 3FXRA 3FTFA 2VT3A 2QUFA 2W25A 3IL2A 5K5RA 2NNNA 2HQNA 2CWWA 5D5UB 2HMYB 1DUSA 1AOYA 4EJVA 2HZTA 4G94A 3C3PA 3R0AA 1FSHA 4XLNF 3VODA 1TBXA 3HVIA 2EJRA 3R0QA 2L54A 2FMYA 2P6SA 3MGGA 2R7FA 5FQNA 3FM3A 4PYJA 1R1UA 1DPRA 3IWZA 4GQBA 5DV5A 3KE2A 3E3VA 2BR5A 4FX0A 3GZ6A 4EGYA 2V9VA 2NP7A 3JSOA 1F38A 2DQLA 5DCMB 4KRGA 2FA5A 2LDUA 1R5HA 1LB2A 1T98A 1L9KA 2YXLA 2KW5A 2G72A 2PI0A 4GBED 2ESNA 4M38A 1KU3A 3RJPA 3CGGA 4AX8A 3GIWA 2F8LA 4UVCA 4Z2YA 3P9NA 2AS0A 3WGHA 3GO5A 1AQJA 5LHHA 4A12A 2WA1A 4G9YA 1SQFA 3PTAA 1Q0TA 2ISZA 3BWYA 5DSXA 5E2AA 2LNBA 4O5VA 2O61A 3FZGA 4AD9A 3IHTA 2BYVE 4KDRA 5DEQA 3N4MA 2GXGA 2P7CB 2Q2EA 2V1XA 2UYCA 2DQRA 1X19A 1WXXA 4E2XA 2YVLA 1KR5A 2Z5UA 2HWVA 3B3JA 5TRDA 3WTWC 2V6CA 1JG2A 3L2CA 4FR0A 2RGVA 2GLUA 5J8CA 3MWMA 3FXUA 3B89A 3SSMA 4MTDA 4POOA 4RB2C 2NNYA 3T5XA 3K6RA 2IW5A 2B9EA 5T67A 4I0AA 1FPQA 5JVTA 1YIOA 3CBGA 4MHGA 3HUGA 3COAC 3T8RA 1JG1A 3GZ5A 4R6WA 4QWQA 4U7PB 2CWEA 1G3WA 5K09A 3IWFA 2XRNA 2JHAA 2A5YB 3BJAA 3OZSA 3M6WA 5BW5A 1XCJA 3ECHA 2VN2A 1IN4A 2IT0A 3PX3A 4HH4A 1R5GA 1GVJA 1XCLA 2EFWA 1HW5A 3DFGA 3DOUA 3WE3A 2PWYA 3BP8A 1L0OC 5HS9A 4ZZDA 4UVAA 1ZG1A 2BR3A 5HIJA 5K0EA 3KQSA 2IBSA 3KLOA 4CXMA 4DQ2A 1L3LA 2AS5F 4A5MA 1ZAOA 4HDUA 5DWQA 4IRHA 1HW2A 5E2BA 4OIOF 7MHTA 1V4RA 3O31A 3HCFA 3A27A 2H00A 5LRSA 2ZCJA 1Y8CA 1NT2A 5K0BA 3LKDA 1P91A 1FBQA 3FF5A 2AN3A 3PFHA 3RYPA 4ZYEA 4IWNA 3TOAA 4RVDA 1J9IA 4KN7X 1R1VA 5HLHA 4D0PA 5AONA 2ZIGA 1HSJA 1VP3A 1KU2A 2HTEA 2ZNZA 3THRA 4GF5A 2AOTA 2R7DA 1NKVA 5DUKA 1D8JA 1NE2A 1BN5A 1M0EA 4FT8A 3GRUA 4GC9A 5HVQC 1EV7A 5ED4A 4YFXF 1I1SA 3LECA 1X1AA 1FJXA 1I27A 2MLKA 2H11A 2GQQA 4EQZA 2HGCA 2K4MA 4DM3A 3T7RA 4CTKA 4E33A 4GXOA 3TM4A 3EVGA 3RPQA 5L3EA 1D2CA 4LGWA 5DUIA 2KJBA 3RPUA 3JWIA 2ETHA 1KPHA 2OXTA 4M72A 1FYKA 5BMZA 4ESFA 3RTRA 2I62A 4GOND 4YUYA 4RTPA 3NRVA 1XTPA 2CFXA 4EV0A 1IF1A 3V97A 4GEKA 5E8JA 3AXSA 3HEMA 3KQOA 2AOUA 4DCMA 1IXRC 2FYTA 1KGSA 4RVGA 2JH9A 3LL7A 5F2NA 2RKHA 3GLXA 4M74A 2CQKA 3TQNA 1P1CA 3KQWA 3FX3A 3O4FA 3PVCA 5HIMA 3DKWA 1UB9A 3BPVA 3GYHX 1ZREA 1JHFA 3ZMTA 4LLNA 1WZNA 4KYWA 4AIJA 3GU3A 3KP5A 4KNYA 2OD5A 2YX1A 2BH2A 1MZBA 1S3JA 3JTGA 5CVEA 5E9QA 1BC5A 3FTDA 2NAZA 3HCDA 3DMHA 4ESJA 3LFKA 1K6OA 3TQSA 1BIBA 4M73A 3D2LA 3PX2A 4GYGA 5FWDA 1QAOA 4RTSA 1I6XA 1NW7A 5FD5A 1G3SA 2IVMA 1X1DA 2O57A 1B6AA 3EQLF 1R36A 2AOVA 1YZ3A 2PMUA 4O29A 3GUDA 3HOTA 5D6FA 2Z99A 5FFXA 3MTIA 3NDIA 1I4WA 4YIIA 3IEIA 5ICFA 2PJPA 4UVBA 2O06A 5FWAA 3OV8A 3AAFA 2UXXA 3R0JA 2LF7A 4JBAA 2M1BA 4M7RA 3FMSA 4KIBA 2XROA 1YUBA 1FBUA 2DPDA 4E30A 2KJCA 4C04A 4OQEA 3HA3A 3LA2A 2CO5A 1YS6A 1OPCA 3HCAA 3BWCA 3T0IA 1WKMA 2JH8A 5KQSA 3TOSA 2VZ9A 1RI5A 2AVNA 2AR0A 4WVLA 3M6VA 4YMGA 2CMHA 1SQGA 4RGRA 2BE5F 3ZMVA 4BY9E 3DUWA 2STWA 2XAGA 2P40A 1WQ2A 2E1NA 5HFJA 4EMSA 3BWBA 2F5DA 2AN5A 3TKYA 3QAHA 4YUWA 3MQ0A 4H0NA 5JUWA 1BI0A 4TV7A 3BJOA 2GAFA 2O05A 2NYUA 3EVAA 3GO4A 4BP3A 1EH7A 4ENKA 3F8NA 3FUXA 4PYOA 5DM1A 2Y75A 3L00A 2AOXA 2H27A 2IGTA 2BV6A 1IXKA 3KQPA 2OQRA 1VIDA 3G5LA 4QQNA 4AWXB 2ZNYA 5L3CA 2IA0A 4ER7A 3KR2A 4C08A 2DK8A 2G71A 4FHTA 2FK7A 2FNPA 4HRAA 4LMYA 1LQ1A 3GCZA 1JTFA 1AWCA 1FBSA 1XGNA 3WTYC 2KIFA 4QVGA 1G6Q1 1HSTA 1JSZA 5D4RA 2ZKZA 3EGEA 2P7IA 1CF7A 2XUBA 1RJGA 2ZFUA 1HMYA 5DM0A 3HTXA 2H1RA 2AZTA 3FWEA 1STZA 2C7QA 1V3FA 2QRVA 5JHUA 2FCAA 4KDCA 5MHTA 4G7HF 4P9UA 4Y15A 4BHCA 5CCBA 3ISPA 3BROA 2E5WA 4UOEA 3TO6A 1S8NA 3EYYA 1P92A 3VSEA 4P7JA 3CJRA 3PQJA 1PDNC 1ZRDA 2QWWA 3LQQA 1TPYA 5LGTA 4DF3A 5U4XA 1V39A 1Q0SA 2A68F 1EAMA 1LJ9A 3BJ6A 4EM2A 2FE3A 4CKCA 2BBYA 2FBIA 2FRXA 2OKCA 2PXXA 4FZVA 4B09A 3ERED 4P55A 3TDZC 4UV8A 5HEKA 2HOEA 4XRFA 1RZ4A 4EVIA 4P7KA 2PG4A 3ZMSA 1J75A 3HCCA 3H3UA 2YR2A 1WSUA 3FM5A 2JRTA 2JTVA 5EC8A 2Q41A 3O7WA 3VYWA 2W85A 1YS7A 2ZLBA 1REPC 3W6KB 2P35A 4I98B 2EX4A 2RDPA 1YFHA 1G8AA 1O7LA 3RKXA 3EGVA 5DDGA 5L3FA 5EPEA 3B3FA 1USSA 1RI7A 3KFWX 4C06A 3KR1A 1SFUA 1G3TA 4R8RA 2FEZA 4KVZA 4FT2A 1MD0A 4MIKA 1SKMA 5CD1A 4X61A 1P4WA 3RKWA 2HWKA 2XAQA 3TDUC 4UNOA 4S05A 4QPNA 3OOPA 5D4SA 5DTMA 4L9VA 3IRQA 1SD7A 3X0DA 2P5KA 4C05A 4MHTA 1SFXA 2IPXA 3I59A 5KK1A 4OBXA 2G7HA 5BPDA 3M8FA 2GH1A 2NRAC 3TMAA 1QAQA 1R58A 5C1IA 2JPCA 4ER3A 1KU9A 1B42A 4XUDA 4PDKA 1J59A 2NNWB 5CYVA 2VDWA 3QRFF 2HYGD 4YUZA 4UV9A 3Q5FA 1B59A 1ODDA 3M9AA 3DMFA 5KVRA
chains in the Genus database with same CATH superfamily
4ZXPA 2HA2A 1CTQA 1T8PA 2HZDA 2OBYA 3JYLA 4KIJA 4F8YA 4JNKA 3I01M 4UCXA 4M0FA 5F2EA 5I7OA 2V7PA 4WLOA 5BWBA 1GZSA 1KGDA 1Q22A 2WJJA 3GT7A 4W1QA 3TZCA 3PHLA 4JX9A 4BFYA 3J80Z 2IKQA 4G4GA 1MEJA 3TQQA 4BNNA 2HIGA 4HNHA 3SDZA 1C9KA 1XRPA 5CDFE 4XX1A 4QJ3A 1JG3A 1X3UA 2IOFA 3U4QA 4RYDA 5KMGB 121PA 1C8LA 3H75A 3A4IA 2JJMA 1ECGA 2HA3A 2P0EA 3HXPA 1Y80A 3NHLA 2O8FB 3C3YA 1JG7A 2P6NA 1C3OB 4PAMA 4AFNA 1YR6A 1R18A 7REQA 1UPTA 5FPYA 1QS0A 3N97A 4PICA 1H9TA 1UPAA 4R9RA 2AZ4A 4E5VA 3RWMB 4ZC8A 3V9PA 2HY7A 1UADA 1ULSA 2MSDB 4I2VA 1CZRA 2KRHA 1PSZA 1V8FA 1ZUNB 1UDAA 1GA6A 5IKEA 4CN9A 1FX0A 1ZYUA 2O3FA 3QELA 4PBSA 4U02A 3RV4A 1N25A 4CM8A 1IBKB 4NCBA 4Z1MD 3P71T 1JDTA 3D02A 4XKVA 2D1QA 3T8TA 2XSZD 3ENNA 1BMTA 2APJA 3N0XA 1C2TA 1SELA 4RF3A 4M0UA 1T2UA 3TRIA 4ASUA 1A76A 1U9OA 1IRGA 2OE2A 5JOQA 1II9A 5TPZA 3J81K 3BWEA 3UXMA 5LKAA 4B4CA 4JSTA 5GZ3A 1LLUA 2ZU0C 2VH1A 4B83A 1H6DA 1VB5A 2ICWG 4GZLA 1W5CC 4AZSA 2G9VA 4RMGA 3ZCOA 4NH0A 4WN9A 5G0WA 3HCNA 4GZ3A 2FP4B 1PUIA 4IHAA 3PX7A 3WK5A 4CEJB 5IT9Z 2XMDA 2ZIWB 2CBXA 3OOYA 5HA5A 5LMCA 2B20A 3ND5A 5CXXA 2KPOA 4IIEA 1FFBA 4KUGA 4YMIA 3DLHA 5FBRB 3NBKA 3LYHA 1ZK2A 1KDVA 3UAZA 1EINA 1X7DA 2NO0A 2VXOA 7GPBA 4WD3A 5IF9A 2BFPA 4RPKA 3PZRA 1I2MA 3KOMA 1F3LA 5JDIA 3GQBA 2VASA 2P9EA 4G5SA 1X1BA 2JFBA 5CLGA 2W8BB 4RIIA 4E7LA 3JWHA 3QWAA 2MSLA 5A3SA 3PLAE 4Q9DA 1SUPA 2XBMA 4GMXA 2VT2A 3V8JA 1IG0A 1UFRA 1UBGA 2VPPA 2CDRA 2CGPA 1BFDA 3ONDA 4L16A 4QG7A 1V5EA 3GTOJ 1WW8A 2J30A 2YZ7A 3HY4A 4U2KA 4OJKA 1FL9A 1OJLA 3IVRA 3GAZA 4GM1A 1DAMA 4ZOLF 1HXHA 3F7TA 1NW6A 5GWXA 1IHDA 3O3MB 2KLHA 3D5TA 1JBEA 3VFDA 3W5BA 3PV0A 3LC7O 3FGPA 4BC0A 4RHCA 1MDMB 3TLYA 3UG7A 1P1KA 2PFBA 4DCNA 3QX3A 1OZGA 5M3FJ 1Z4LA 3OWOA 1GCGA 2MSCB 2BLNA 4UASA 2P8JA 4QEKA 2I1VB 3I30X 4ZWNA 3UTCA 1S4MA 2NS8A 3K5HA 4X1IA 4R2KA 3V4SA 1PNTA 1SO8A 1YRQA 4BFZA 2WSSD 5JO0A 1AO0A 1FJGB 2FFQA 4A3LJ 1S8FA 1RJ9B 3PIPF 2YCBA 4OA5A 3UPUA 2JBHA 1LW6E 3HFGA 4EFMA 3GEGA 5HDNA 1RI2A 1P4JA 4RIGA 3LRXA 3SZUA 2DA1A 3WI7A 4U9IS 1STOA 1TGYA 2C4HA 2XI4A 2ZWAA 4G2TA 5CA0B 4GYIA 3TNLA 2X0KA 3FWYA 1P5HA 3QI2A 3WWZA 1HK7A 2IGMA 2O6GE 1YZNA 4Q5IA 3VOAA 3P27A 1PU2A 3RVKA 4H3SA 2PH3A 1Z2AA 3P9CA 1FX1A 2PZLA 2R5ZB 1KO7A 3BF8A 3GRRA 4ZVTA 1PRYA 2CEAA 2QF7A 5F23A 5EESA 2EV0A 2Q5HA 3EAFA 3DWEX 5KBYA 4RTJA 4WY8A 3A4CA 5J1YA 1NDUA 1NVDA 3ZW7A 3G3ZA 3I6BA 4XUCA 5K3DA 2PGIA 2HYJA 1SVMA 3L46A 5FAKA 3U37A 2FDXA 1GEEA 4KQGA 3CTMA 3RS4A 3ZV7A 3CZ6A 1KSJA 3RG8A 4BO3A 4REMA 3DQPA 4EPXA 3ED5A 1UDBA 4CDMA 4R8LA 4FKBA 4TZ6A 4JGBA 2B69A 1M8KA 1THZA 3CX7A 3KZKA 4M4SA 1W1IA 2X7HA 2GAUA 3E3OA 4W99A 1YAJA 2FWPA 4HJXA 4PZZA 4UU8A 4G7OF 1M74A 1PJQA 5FLEX 2GK4A 5EZ6B 2AN4A 3TP3A 1IRFA 3HUUA 3OYLA 5IT9K 4JEMA 3DPSA 1SOUA 4EPRA 2X8JA 2RMKA 4E4HA 1TIPA 1OUMA 1QG0A 1FTZA 2M9MA 3OCWA 4HDRB 1W581 4YJFA 1R3DA 2WAEA 5ALTA 3KT0A 5JNWA 5FBWB 5M29A 5I7AA 3NWEA 2FG5A 3AR6A 1XF9A 3K2QA 3UXHA 3L3BA 3M1AA 3TFQA 4NEHB 2O23A 4PQRA 1MNAA 2L5QA 3PJDA 3NMUF 2JHPA 2O2YA 3BICA 4G0ZA 3CF5F 3HMQA 3A7DA 2OM2A 2Z83A 5U9CA 1ZD4A 1FBNA 4Y6LA 4KPUB 3P7MA 1AIPA 3GLQA 4E2ZA 5BR1A 2B5OA 5HKOA 3N8NA 2M8GX 4CUZA 5FBHA 2XITA 2XQGA 5F6FA 2PG3A 3EVCA 4AIIA 4HXEB 2P4HX 5T3UA 4WKOA 4I6JA 1N5JA 2QVBA 3S7ZA 2XF5A 5CQGA 2QSFX 1FFXA 2YRWA 3A28A 4JKIA 3ROQA 3H0EA 3IESA 4Q24A 4LGVA 1CP2A 4PJMA 3UKGA 2NSJA 5HS7A 1WKBA 1OBHA 3VYTB 3IV6A 3EZ2A 3VR6D 1IRXA 1JSCA 4DM4A 5EJGA 3WV5A 4XYEA 4YP5A 1YRAA 1DP7P 1B1AA 1YJXA 3NKVA 3TZLA 1KEEA 3T3OA 1L5OA 1TLLA 4WL0A 1TWFJ 4JQZA 1YNSA 4I50F 1MOZA 2AJTA 3K9HA 1OB5A 4XM0A 1T4DA 2B7EA 3PFCA 4KQMA 3CS3A 4EUSA 3V42A 4KQ1A 3GEDA 5BVHA 1RYBA 2NPOA 1J9GA 1UFMA 3C7AA 3R6TA 4N6OA 3OSZA 1QYDA 3NW9A 1ZD5A 5FV7A 5TX7A 1LPNA 2I9KA 1E8MA 1B8NA 2AR7A 2IP4A 1J9ZA 4LZOA 3LSPA 1KTVA 2HPVA 2ZSKA 3L1JA 2RNGA 4FOLA 4JDUA 4LZNA 1IAWA 5AW1A 3HVJA 4P4TA 1GPUA 1Y8RA 1J5EB 2QN1A 3ZHCA 4J3FA 4BVEA 3LNCA 3OVMA 1LH0A 4FSXA 3IIMA 3LUPA 1Q0LA 5JXWA 5DS9A 2RHBA 3ZWCA 1UZCA 2JGLA 3GQBB 4GKBA 5KAPA 4FLEA 1R00A 2KISA 3LH5A 2ZRNA 2RKOA 4JC0A 5CFPA 4Q3DA 4IILA 5JATA 4BUCA 3H0DA 5KINB 4JJ6A 5B58T 1GL6A 1KYQA 4EVQA 4POAA 4U6NA 1C7RA 2XASA 2R5ZA 1PVOA 4WTOA 4XJXA 4RETA 2IBTA 2HS5A 4HB4A 4EX7A 2NADA 1RIIA 4AZWA 3P5SA 1SHTX 1KK2A 4ZAVA 3FBTA 2CMKA 4R1UA 3F3XA 5FTKA 3TBKA 5C18A 2P62A 2LTPA 4N5LA 1K6YA 1NN3A 2ORVA 3WK6A 4KRFA 4YP1A 1RYEA 1W85A 2VQ6A 1NM5A 5IAJA 4EWLA 2E49A 1IWPB 1JHRA 3BKWA 2O59A 1PZEA 3OYGA 1U94A 2P90A 3VSLA 1BJKA 3EOBI 3F8FA 3CYFA 4LBYA 5D8DA 5GZ6A 3UJAA 2GTIA 4KUEA 5G3ZA 2CJXA 1ONVA 3RFCA 4F8EA 4HAYA 2JHCA 5H20A 5ICCA 3B3AA 1PFGA 3GJXC 4EG8A 1JB9A 3EDQA 2I1QA 4WY5A 1DDNA 1DQPA 1FTSA 2CDNA 1CT9A 1MFPA 3AQIA 3HVHA 3FOWA 4MS3A 2EP5A 1ZOOA 2NQ2C 5EXEA 3AKEA 3M70A 5JS2A 1PK8A 3DT8A 5YASA 1SWWA 4IY1A 4X1KA 2A86A 3D6TB 4CDNA 3BPXA 4GXQA 4MULA 3L49A 4IMJB 4XSXF 2ZO4A 4BLRA 2R7AA 2PGLA 1Y0BA 5T64A 4C89A 1II8A 3SOZA 3PE3A 2O2IA 3KWJA 2IUYA 1CQWA 3M6XA 4Q0MA 4BE9A 3H1EA 2Q3LA 4BQRA 3NGMA 1TM3E 3LVRE 1R7JA 1BOAA 4L5IA 1BS1A 1X1CA 1TF7A 3EGIA 3M4YA 4HRXA 1RXVA 3KYBA 4QOIA 3VTFA 5E17F 3ZPXA 1O89A 3WGLA 3KIPA 1M7GA 1WXEA 1IQUA 2HLDA 4RW0A 5BR4A 5EJ6A 3F72A 3T52A 4LW8A 3CX6A 3QF4B 1M34B 4R2WA 4OFBA 3D3WA 2PUWA 3ZMZA 3FVRA 3V00A 2A9PA 1DKLA 2EC5A 4E13A 3EODA 1WBJB 1OQAA 2LVSA 5K0SA 3BAZA 2Q3DA 4MYTA 2GM3A 1YL6A 2QVYX 4AYWA 1XX6A 5K0FA 1FZTA 1G19A 1XZBA 1ZJ6A 1P9NA 5LGNA 2JJQA 1QRTA 1EQAA 3FSJX 3D7SA 4DNXA 1SVKA 4QL3A 3A4MA 4QUIA 4C3VA 3KUKA 4F86A 3MCWA 5E1WA 1TZLA 2FPPA 3F49S 3IDAA 2IZ0A 5AM4A 4DUZB 3TLGA 1KA9H 4RY8A 1DAFA 3WL7A 1YQ9A 4Q9IA 5K7HA 5IJ0B 2ADOA 4PANA 5IW8A 4CU5A 4CLEA 5AIQA 3HXLA 3D0OA 2IOYA 4HNUA 3E7WA 3H9UA 3IP6A 3JTEA 4ERXA 2PUAA 4QUBA 4BCDA 4C7MA 4NEQA 3ROTA 3M07A 4NFSA 4TTPA 4OP2A 4RCZA 4CLRB 4YCJA 4IWYA 2R1VA 5CG2A 3TW8A 3DBVO 5JAQA 3T0YA 1YULA 1JUMA 3K96A 4NH4A 4ZO7A 3FPSA 3IALA 2G5CA 5CB4B 1C8BA 3CC8A 4F55A 1R0RE 2LKSA 2ZRCA 3G2MA 4FS3A 5FRDA 3ZN0A 4P3XA 5KS2A 4ZZ2A 2XMPA 1CR2A 2ZQYA 3NEUA 3HKEB 5DISB 4BWFB 1A9RA 4E70A 2GZAA 5ALEA 3SGLA 2FUG2 3A6DA 3OG9A 1LC0A 1TJ4A 2QY9A 1UIRA 1V48A 2JSCA 2MMCA 4JL5A 4OOEA 3LBIA 4ESEA 4BKQA 2OV2A 4ML3A 2B35A 4CL3A 1FIAA 3CLOA 5BWMA 1K7SN 1PR3A 1U2TA 4Q3AA 4M49A 1LNSA 3KJEA 2JG3A 4P98A 4HW0A 2GUGA 2ID6A 2FZKA 4JQFA 4CMHA 1O97C 4NBTA 3LSKA 5IDQA 3OT1A 1UP4A 3UXYA 1Z4MA 1NVFA 2D5IA 1T8YA 3WBFA 2V97A 1SD1A 2K7ZA 4O08A 4DMFA 3K1TA 1YJBA 2TMGA 5JPDA 3U31A 4RQTA 5HNKA 3HEBA 2CXHA 2Y05A 4MRMA 5K3AA 2HSZA 3F6SA 1GPH1 4HQOA 3W4IA 2XAUA 3I2FA 3GLFA 3HHHA 2XTZA 3OYAA 4PYQA 4TTTS 2JRMA 3BIOA 1H66A 1R74A 2H0RA 2GHQA 2VFAA 5D5WB 1NNLA 3M34A 2H06A 2FJUA 2VTBA 5J2UB 2CYYA 2R87A 4HEJA 2JGFA 1EUDB 1HDIA 5AUQA 4P35A 1X2EA 4B7UA 2LMDA 3PM1A 4M1KA 4RO0A 2C3UA 2OCXA 3TP0A 2XNDD 2JQ7A 5DRTA 3VEPA 3K1MA 3L6EA 1SH7A 4IM7A 4OO3A 5TS2A 3FHTA 3D9QX 2YN0A 4UUVA 3GGSA 3W1EA 1UF9A 1O77A 1E58A 1KY5A 4HF0A 2I34A 3OBIA 1GN9A 2HK6A 1USTA 4F60A 1DJQA 3B13B 1OWMA 4DGQA 5K3BA 4WWCA 2QLBA 2X5JO 3R7WB 1PSWA 2XVMA 1W7PA 5FD6A 1LDGA 1U2ZA 3PEUA 4U7PB 3G1LA 2WD8A 2TMDA 4UE6A 3WL3A 1WLYA 5C5EA 1G0OA 1KMNA 1NXPA 1P1BA 5B6IA 5CVRA 1ZAYA 3OWTA 2ECOA 2PH5A 2IKSA 3K2AA 4Z5XA 1FXSA 4Z54A 4DR5B 1XTBA 1NKTA 2IIPA 2ZB3A 3G6WA 3BH7A 3IHWA 1OA1A 3SICE 3VO1A 4F4HA 2DBVO 2F3QA 1O3RA 3H11B 3QLUA 5DZSA 3UT0A 5ES4B 5K45A 4CR7A 1JDBC 2R1TB 1OISA 2X0NA 2YDXA 3L7OA 3L84A 1QO9A 1N0VC 1CG6A 3LIIA 3ONFA 2LE0A 2ZYAA 3HOZJ 1Z5WA 1A96A 1QHGA 1TW3A 2ZDGA 3CP8A 3FHNA 5A6SA 1P7CA 3QXHA 2VAPA 1FTQA 2C1XA 4K9NA 4M21A 3JARB 4FDVA 4LHYA 1U6IA 5D1NA 4EKEA 1O58A 2DO7A 1CRPA 1NC3A 3BTVA 5T8KC 3LE8A 2CJWA 3RVMA 1CV2A 4BNTA 1N5DA 5HYVA 1Y7IA 2EZTA 4NKRA 4EY8A 1Z4KA 2YOGA 2Z58A 5B3JC 1UMBB 3LCRA 3RSFA 2FN4A 4JR1A 1L2TA 2JAPA 2OFFA 3LBYA 3SJZA 4ZOLA 4UUSB 5CDHA 4FTHA 3HXMA 2PS0A 2XVZA 4R68A 5AM1A 3OSGA 3FVVA 4QGAA 2ZI7A 4S12A 4TUYB 1XNGA 1SVNA 4P83A 2ZAMA 5KNDH 2QVXX 2GPTA 5EN4A 1IOZA 4C4XA 4HATA 2DFPA 3TTXA 2C2MA 3LBAA 1RC1A 4BNFA 4CIBA 1H5QA 2E36A 4NV1A 4KSYA 1VI6A 3MCZA 3FUTA 3LPLA 5REQA 1R4MA 4QT4A 1RPAA 1LE8B 4OAOA 3Q15C 4CWAA 1SFEA 1H1DA 2LDBA 3PDIB 3C6KA 4K6GA 4CCWA 3LAWA 3NIFB 1PLLA 5AKXA 3V4PB 2HRDA 3LQYA 5EJEA 4OIQF 1BI1A 2Y67A 1QCDA 4E1BA 3OIUA 5KOHB 2KRFA 4OMUA 4WXEA 3P0FA 1D4FA 4MA4A 4KIFA 1QUEA 4XA8A 3E9RA 2VHZA 3CC2I 1VPEA 5E9JA 2YYAA 1AQUA 2A9KA 4ZQEA 1O4VA 4FMDB 5ESDA 1KH1A 2B4TO 3CTPA 2OV4A 4BFCA 1C0EA 1XZJA 2W22A 4TS1A 3VDMA 5HQ3A 3FOEC 4DB2A 5NULA 1JIVA 3USES 2Y0SA 4I02A 1PD1A 3UOGA 5FJJA 1YW8A 1MABA 5TNXA 1GSIA 1J90A 2PT9A 2PWAA 1JR3E 3DE4X 3L82B 4AP6A 1FIUA 4I99A 1V8DA 2WK1A 4DLRA 3FIWA 1VJGA 5KWVA 1OFCX 5IZCA 5J1SB 1UWKA 3UAYA 2EJCA 1NIJA 2GZ1A 2IYOA 1WH7A 1RZUA 2F9LA 3W34A 1E64A 2WJ3A 3GBPA 5EHIA 3WP1B 3NHPA 4C29A 4F4CA 5KCMA 2IU0A 5EE9A 5DYGA 2IHUA 1KDPA 2QMOA 1FMWA 3SMVA 1PUFB 4EHAA 3LA8A 1KY2A 1K3UB 4PCLA 1PD0A 2HDDA 3H6KA 5AKGA 1USVA 2HUPA 2O6HA 4LTNA 1KI7A 4AY3A 5CVUA 3R09A 4PPFA 3UWSA 4QLAA 5KYWB 2E4ZA 1ZLJA 2HD4A 1XDSA 3GX4X 3GVXA 4TT3D 4UM5A 4OUKX 5ILVA 4JFRA 1VQ9I 3PZBA 2EFCB 3ZCUA 4ENPA 1BHSA 1IUOA 3BRWA 3IBTA 1U9JA 1CJMA 3NJ4A 1KY3A 4R1SA 2PNJA 4YCBA 2JFFA 2EYQA 1HXDA 1VG0B 1YS9A 2V6FA 4WBSA 4C0SA 3M5WA 2EWNA 3JWGA 2Q5IA 3QJGA 1BYIA 2AJLI 3DDWA 3L92A 4L5YA 1JHOA 3DEKA 1W4RA 3MQFA 4X93A 1LQTA 1RYMA 4FISA 2V03A 3R0XA 4DZJA 4Y2PA 1H89C 4QXRA 4HB2A 1SXGA 1MJ9A 4OIRF 2GRAA 3OLQA 4S1PA 1I3AA 2QZSA 4G65A 3ETNA 5AWFC 1YB2A 5JROA 2AG5A 4HAXA 5IJXA 2V1UA 4M55A 5GJBA 1ZY2A 3ZQ7A 3SIRA 3PFIA 2ECBA 1VGRA 2F59A 3PDCA 2V79A 1SPBS 1T5DX 2XVYA 3AFHA 3HKCB 5DBEX 5JSZA 5E79C 4GYKA 4ZDWA 4HV6A 2WOOA 3V48A 2MC4A 3ZR8X 1HH4A 5E4JA 2ZFWA 3RBXA 2BEOA 3VC7A 2A05A 3U56A 5BSUA 2NUPB 2SCUA 3QOWA 1EK2A 2XZOA 3S0JA 2PFKA 1EBUA 1WHTB 4PR0A 5BPFA 2VHXA 3FG9A 4B81A 4BWGA 2KM1A 3K16A 1M2VA 3O4RA 2GEBA 1N6PA 2KLBA 4NP6A 2ECKA 5JSHA 3GLIE 3DEEA 2P77A 1DIAA 1E3MA 2GXQA 4Y2TA 1R0KA 3JX9A 3ZKAA 3MS2A 3WWEA 4LOCA 2QN3A 5AVOA 4ZZ1A 3AM5A 4FFBA 2H6CA 3CLSD 4UTZA 1RAFA 4G07A 3I9FA 1J8MF 1UG0A 3ET4A 4RV5A 2OR3A 4NUBA 4HF7A 1OI3A 2RHRA 3TRDA 4ZH4F 1Z35A 3ER9A 1I1HA 2J3IA 3FXAA 4LE1A 4EW3A 5KSZA 4FM9A 4HWOA 2X6TA 4MHSA 2GF0A 3H5AA 5H6QA 1O8BA 3BK1A 5AVZA 1DX6A 3C7DB 5JNUA 4GKJB 1WI9A 1SRRA 3L01A 4JI3B 3QP5A 3F3MA 3WFZA 2HU9A 4IOCF 1QE3A 1LBSA 2PL3A 4PAWA 2H07A 5BORA 1EXNA 1XG5A 1NMYA 2FN9A 3DTVB 4NPCA 1K4YA 1TQDA 1XGKA 1ZD9A 1XLVA 5ALGA 2ISCA 3HI6A 3CMMA 4EKYA 3M4XA 5I7FA 3N2IA 1EBBA 1T24A 4G0VA 3IOCA 3L7YA 3H97A 2ERCA 1DEKA 2G88A 1KO4A 3DS8A 4PXAA 1U8RA 1PWZA 3JVUA 3RTDA 5JLJA 1N6HA 4XPIA 3N2YA 3S29A 5EWJB 3FK6A 1UKYA 2GBCA 3UMMA 1ESZA 4MW2A 1IUFA 3MXTA 2BGTA 4OM8A 4ER0A 4YRAA 5K20A 4BZWA 1KQOA 3LUJA 1B3BA 3W5IA 4QUDA 3JW4A 3U4MA 4KXUA 3N58A 1E0JA 3ILSA 3CF0A 5D7NA 3UMJA 8MHTA 5EDNA 4CQLA 4YS6A 2GJSA 5GAHJ 4KFCA 3SU8A 2AOWA 4V02A 1Y1KE 4CDRA 4DIEA 3A14A 4YRPA 4JSYA 3GW2A 2XOKA 1PYGA 4UMDA 4CZZA 4Y9SA 1N2BA 2R1VB 3ANTA 5A3VA 3G3EA 3HLYA 3RVDA 4EPWA 4JEUA 1VQ5I 2O7NA 4EFLA 3THWB 2SECE 3CNBA 4GKKB 3EQ6A 4UD6A 2HBRA 1MAHA 1ZRFA 1FXWA 1O94D 3NAMA 4WA8A 3BWMA 3AF6A 1EXMA 3U44A 4DBLE 2OA4A 3B6KA 2GIVA 2KWIA 4MWBA 2FG7C 3WLOA 1X7YA 4BLUA 2XXAA 1QANA 1JF8A 1VYVA 2ZYIA 4KN8A 5D6NA 3V7RA 3PP8A 3M8KA 1E1QA 3NXKA 1O5OA 1NONA 3TD6A 3WV4A 4EY3A 3ROZA 5HOOA 2CV1A 3DZHA 3E3MA 1QQTA 3FHCB 2DFNA 4WXCA 3WGGA 2QKYA 3QNUA 4ZARA 3VR6A 1JQEA 1NG6A 2RJOA 2V5AA 5DYTA 2BM1A 2I76A 1NLUA 3VHLB 1P2UA 1S8OA 4R0MA 2XAHA 3SXUA 1RADA 5BXQC 1N3IA 1Z15A 4J7AA 4HDRA 3PGKA 1F48A 3ND7A 3KXPA 3AJEA 4LRXA 3WHLA 4ZGBA 2RAPA 3WGYA 5B3SH 1JHHA 3LQRA 5FUXA 3VR4H 3LC2O 3PD1A 1JKQC 2BMDA 5CBPB 6PFKA 1FSZA 2ZBUA 3C48A 3PTLA 3DDCA 2G4LA 4JU8A 1BU5A 1UIMA 1E2LA 4MKGA 1Q2UA 3RRNA 3DDZX 1NURA 3NQ41 2BFNA 2HSJA 4M1WA 4MUIA 5KAFC 4K6CA 1ZISA 3W5CA 1HC8A 2OYRA 3LKZA 4WCDA 4IMRA 4PHHA 1I4TD 1G4DA 1C1DB 2E4WA 4RMNA 1EE9A 1Z12A 2EKPA 3B9RA 2ATCA 3EQ2A 5C4JJ 4L9JA 1I36A 1RAGA 1FXWF 2Q6KA 2QV0A 1Q11A 2WYHA 3IIKA 2FXAA 4LWZA 3A25A 1B73A 1RYYA 3QYFA 1IFXA 3W6VA 2IXTA 5C4MA 1LX6A 3TDKA 1OXVA 3IAHA 3WJ2A 3PEFA 2PU7A 4JWKA 4WXMA 4RJKA 1U2GC 4NNJA 2C2YA 1NPTO 4X6XA 1E32A 3NDJA 3ASUA 3BJRA 1GPMA 4IOKA 1RXCA 3R3ZA 2HIMA 2FFHA 2XNJA 3SFZA 1QTIA 3RJ5A 1KMQA 5C46F 3SEQA 3PE6A 1T5TA 2R11A 5FULA 4TM8A 2EIXA 2ISYA 3SK0A 1FXUA 4YH1A 4ETNA 1W2HA 1G3QA 1GR0A 1PHRA 3ERMA 1XJ5A 4KAJA 3VTZA 4QQ8A 1A5SB 3UG6A 3RK4A 1UJCA 4IQ8A 4OF4A 4TN5A 1Y1SA 4RABA 3HSRA 3ZOKA 4J2HA 3VPGA 4HPXB 4LRWA 1B9NA 4LY9A 1VI0A 2X9LA 2UYOA 4YCAA 4P54A 1DS6A 1U5TB 1TVCA 1RXEA 5CNMA 5GPAA 1N2IA 1A9XB 13PKA 3A0HC 1J2JA 4H17A 4U3JA 4V0KA 1VHDA 3UGKA 4UNIA 5ERXA 1K8QA 1G21B 1LSJA 3BKXA 4S0HB 1YI2I 1F12A 1KO1A 3PFYA 5JVGF 4KYVA 1WXWA 4Z3DA 3T6KA 3UOAB 4BVFA 3VYRB 3AU8A 4C14A 3CCQI 4W7IA 1KXZA 1A97A 2CLLB 3DZ8A 5IEJA 5IDVA 3LA7A 1NPDA 3WISA 1U02A 2PKXA 3L6CA 2VP5A 2II6A 2ZRBA 1UOQA 3R9KA 5FWNA 5BVHB 5B2EA 2GK6A 1ZMTA 2OSVA 1UJ5A 1OFGA 1PZGA 3VDXA 2MSWA 4J9VA 4QYXA 4QFCA 1EWRA 2SBTA 3LF1A 3L07A 4U87A 2I3ZA 3PC2A 3ZHTA 2DFIA 2K9MA 2C99A 2DFDA 1JJIA 2JLBA 3ESDA 2XVCA 5AKHA 5ALPA 5HDBB 2M34A 2JEOA 4JBIA 5T4EA 5L3GA 1UQUA 4O8CA 3ER6A 3BD6A 1BWSA 1QRYA 1DKQA 1IOVA 4LTDA 2OUMA 1KK3A 3DWFA 3KPWA 3MJHA 2FD5A 5J8FA 3U61B 4MV0A 1GDTA 2A1TR 2QL5A 3IR7A 1VPLA 4D8VA 3AVXA 4HQ6A 2VC0A 4NYIR 2Q3FA 3A9VA 1UEJA 4M3DA 4LFUA 3VYSB 1WJGA 1MTOA 2PMCA 3K0CA 3EFHA 4HAVA 1RUOA 3ROUA 2CKDA 1W5SA 3DVLA 3QVVA 4MW9A 4N5HX 4PG4A 4V0QA 4Y52J 3LCCA 5IK2A 4GO1A 4BE4A 4OGWA 4UCWA 4XFJA 2R8OA 1J2XA 5HLIA 4TL7A 2MBFA 2PH1A 3I6MA 1P7YA 3IMGA 3L0IB 4QNRA 2QWXA 4YACA 1H0MA 1LDEA 3A7EA 4EYGA 4H1UA 4JOSA 3SM3A 1ZNYA 3R3WA 3SYMA 4F5YA 3ONQA 3BILA 3T5CA 3QELB 2XXAB 3UUWA 3F22A 3M33A 5TVGA 3SYNA 2GPBA 1FYEA 1XWWA 2YYYA 2V6MA 3CLRC 1TL8A 2HQAA 4KYUA 4PFOA 1KQNA 4FCWA 1JAXA 1M6YA 5B57C 2M7BA 4LD5A 1AM4D 5PGMA 1LVUA 3EJ6A 4D9FA 2DT8A 4C4SA 1Z5UA 4ZQIA 3TCXB 1SXJB 1ZHOA 2H9IA 4MW1A 2D4AA 1KEZA 3CUQB 4QU9A 1Z28A 4DYRA 2XYVA 3NONA 3PWKA 4ZXFA 1VFNA 2PSJA 5JJ5A 1BXGB 3G59A 1BR1A 3N76A 3ZDYB 2Q5JA 5I5GA 2WICA 1POGA 2EZLA 2P4WA 3CZMA 2IHYA 4GPTA 1EVLA 3QKRA 1AUVA 4H4CA 5DCWA 3U3KA 4BCCA 4LZPA 3ML6A 1K61A 1TB4A 1VMKA 1II8B 2WIKA 1TTHA 2WYOA 1MJ5A 2ZCUA 3E4CA 3LWNA 3PVSA 3DMPA 1MXHA 2B99A 4I8IA 4MKIA 4KBGA 4RESA 2A6TA 1WDLA 2D7JA 3TX2A 4B4WA 1T9DA 1BE1A 2HWUA 5E9WA 3GPIA 4A6EA 1KEEB 4DZPA 1W44A 1E1CB 1SA0B 4XIDA 4HX5A 4MWOA 1CULC 4LNAA 3UWOA 7ADHA 3OLWA 3MMNA 5T6BA 1JJ8C 5KTNA 3NM5A 4Q3BA 2FBKA 4R8HA 1SJ9A 1FDIA 1P81A 2FWIA 2IY8A 2CMFA 3IP1A 3NQOA 3LT5A 4QOFA 5E7IA 5C35A 5JI2E 2A67A 2CK3D 3DDNA 5I9BA 2JC3A 5ITSA 1FW6A 2ADMA 5AOBA 2ZWMA 2W57A 3S1RJ 3KQTA 3QRWA 1MGTA 4I0BA 2ZTLA 2NO6A 4PHCA 3R7BA 3UEOA 5BV8A 4PGAA 2X1MA 4JNCA 2H31A 3EIXA 3JQ9A 1U81A 4LOHA 3FDZB 1J7JA 2X8BA 3PR1A 2PUGA 2K4JA 1HM5A 2CBZA 5G1PA 1ELOA 1HNNA 5LBQA 3UK7A 4EEKA 3AL0B 3HEAA 3UMCA 1ISRA 2V9CA 1EIWA 4HP8A 1U98A 5J2UF 3M1YA 4ANJA 2JUGA 2WJZB 1D9ZA 1GZ5A 4XEUA 5SZKB 4CGYA 2BFFA 5LDHA 3EEIA 3U1KA 4D5CA 1U78A 1SK8A 2RVCA 1WMFA 2ZJQF 1N5MA 1JJVA 2BLLA 5IKOA 1FUEA 4P4GA 3C2QA 5EYRA 5DGTA 1C7ZA 1H5NA 1N7IA 2JGAA 2OWDA 4A8PA 4D1YA 2RHWA 3R75A 4KMSA 1RJWA 3RUAA 3R3JA 2WLTA 4AY2A 5KIAA 3UQZA 2CYAA 2CS3A 1SCJA 2QTHA 2V74B 3LZ6A 1DC3A 3PRHA 1SEUA 1P2TA 2KX7A 3F23A 4GKAA 2ZXUA 1LUJB 3DCIA 4UUMA 3KO8A 3K6SA 3GRAA 2D1YA 2BTEA 1CF7B 1UMKA 3RAGA 4PGHA 3G2KA 4ZA2A 3SC3A 1KQFA 1V16A 5DK4A 5BQ5A 3PIIA 2PEXA 2FUKA 2VYND 2XWBF 2Y2ZA 2VC2B 5JFRA 1U4OA 2YS6A 3CZRA 2Q62A 3FB1A 1VPDA 3GD5A 2CB0A 2CLSA 3MMXA 3O2QB 4N0QA 1SIUA 2VBWA 3DMYA 1Z0IA 1SHKA 3B6EA 3G0CA 4MUYA 2D2XA 2QGFA 4P92A 4YASA 5TISC 1L5KA 3OCXA 1F0NA 2IPNA 1S2GA 3LLMA 2B63J 3CRNA 2XT6A 3I5XA 4UBIA 5EUBA 4YXFA 1NA5A 5CP8A 2QN6A 1YQXA 4FD3A 3OESA 1YW9A 2OK7A 4M0LA 5DGXA 5KAMA 4BNYA 1S8AA 3VI3B 4XBFA 3P9YA 3GI1A 2VHUA 2ZUWA 3TLMA 3FYDA 1FUIA 1Z4JA 4TX1A 4N0EA 3TMOA 1JFFA 4FS8A 4ED9A 3T9EA 2X48A 4UCFA 2IF0A 3N39C 1Z5GA 1SQ6A 5HRUA 2UXDB 2CHGA 3DDHA 4WV3A 2Q1TA 3TW6A 2PO7A 4Y2SA 4BRZA 3S8EA 5IP7J 4TSFA 5CVJA 3W79A 3WVNA 1W7PD 1L4HA 5LFAA 1ZUNA 2FSGA 3B6IA 4OIMA 1UKEA 1DZIA 2WUEA 5DHUA 2YUSA 4JX6A 3VPFA 2ZIXA 3E70C 2QQBA 1LV8A 1VLZA 3DEUA 5HDGA 1IY1A 1E4YA 1VL2A 1X7GA 2AC7A 3BJEA 4Q7JB 4A0QA 2XIGA 2BRUA 4RQBA 421PA 4FJ2A 4G5QA 3ADCA 2IJLA 5H3HA 3VKFA 4AN1A 2ZZKA 2IRWA 4LSMA 3E6MA 5CX1B 4D8TA 3NC4A 4WVFA 2WEKA 2BGKA 2IU4A 3FNBA 3LXRA 4P82A 4CR8A 4HRVA 2N8GA 5J1RA 3W2VA 2BN4A 3D6JA 4XIJA 3HO1A 1SC1A 2H8GA 2P75A 2VWPA 2ZE7A 4LXQA 4HPWA 4IHQA 1AMUA 4W1RA 3KEOA 4PLWA 2GDZA 2COEA 1RMQA 3RADC 3E1GA 2A0KA 4WLEA 3ROEA 4NL4H 3QLVA 4KPGA 4BXUA 2RIPA 4KQIA 4FOPA 3KKEA 3KEGA 3WFIA 3L2QA 3I0TA 1RQPA 4BMXA 4V1CA 1KO8A 4C0AC 2Y1WA 4IXDA 2QTVB 3DSRA 4HEQA 2DW4A 3GK3A 2QM8A 4ZDJA 5JNTA 3A6FA 1Y5RA 4W8HA 3BCAA 3LSJA 5AVVA 2R5FA 4QRDA 2XX3A 4IZZA 1YDMA 1V4BA 3ZUGA 4WKGA 4ZIRB 3GXOA 3K0EA 1ODJA 3IPRA 1L3IA 4R9SA 5EINA 1JHPA 4ABYA 1PP7U 2D5VA 3K2EA 1LI4A 1QK5A 1K75A 2DX7A 4GDMA 1MX9A 4CMBA 2IQ5A 4B73A 3NWSA 3RSCA 4HFNA 2ZREA 3F8SA 3GUZA 1XPUA 1K9SA 4C7XA 2FPOA 4Q05A 4UW9A 2IZOA 4OSEA 4Z9YA 4N3GA 5E1OA 1RHRA 3E9QA 5JE8A 4CNQA 3WL8A 2D6FA 4JYCA 5FFZA 2X5KO 2IYTA 4DA0A 3CLUC 2X86A 4PGMA 3L8GA 4XI9A 5FLXK 3H4TA 4L07A 3WMFA 1UKCA 1J6UA 3EHDA 4AUMA 5MGBA 3K5WA 3KPUA 2YTZA 2AO9A 3AOGA 4P53A 4UVGA 4W1PA 3TLZA 3PO2J 5FKMA 1FTGA 2J5QA 1D0XA 2A7XA 4HOBA 4MQ9F 3NFYA 4I55A 4ZC1A 3SFVA 3M8EA 1NW5A 5K5QA 1T9HA 2BMVA 2XUHA 2NVXJ 4IJ5A 4QBHA 1T15A 4WX9A 1XMKA 2VI5A 4ODIA 4W1UA 2QL9A 2XC7A 2XCOA 3IEPA 1N3LA 2I6SA 3O2JA 4J43A 4MUGA 2NVYJ 5AVUA 4RJTA 1L8AA 2W2QA 3LPCA 3J7TA 4XICA 4BY7J 2Y1EA 5AJVB 4DIUA 3ODGA 2NWQA 3MJRA 4OQNA 2UXNA 2NUBA 4OBWA 4OI4A 1XA0A 3DLTA 2MCFA 1LEAA 3OZAA 4N47A 5KYTA 4JUFA 3EETA 1KA8A 3GLGE 3EAGA 4PQGA 2YZKA 3IEVA 2EGUA 3C3AA 4Z3OA 4F45A 1JI8A 4W5TA 2PKRA 3DQVC 2PYIA 2OBFA 2HA5A 4HX7A 1TCBA 2D59A 2YDYA 4MKHA 1XA4A 1IN5A 1QHHA 2C82A 2R7MA 2PLFA 2RJ3A 3T1BA 5FWAA 1BMFA 2F3RA 4R5MA 1NJ1A 2YBDA 4AUXA 1E2IA 1IE3A 2HMVA 1JEAA 3IEXA 1F4VA 4O33A 5F4BA 4XQ9A 4IDBA 4OXNA 1Y37A 4P4LA 4UHBA 1B8PA 1CRZA 3UO8B 4DR2B 4H0CA 3LO8A 5EQJB 1IO2A 2D5CA 5FUQA 3H1PA 2JIZA 4R1MA 1PT9A 5AT1A 1YVPA 1OZFA 4LHXA 1JSXA 2BR4A 4HLCA 3U2QA 2AJDA 3IXMA 3P9SA 4LHZA 4ZYHA 2RG1A 4DV1B 3LDUA 1SANA 4LZZA 4RZSA 1OOEA 4I6EA 2ZJ7A 4M83A 5CA0F 5JJCA 2QTAA 2Z0MA 3CUYA 3W8EA 4FQGA 1DC6A 3GG2A 1QRAA 2WFZA 3MBOA 4YCLA 1NAHA 2E7WA 4FFBB 1DFIA 5DTRA 2NU8A 4YIFA 3Q3GE 3NCHA 3H5OA 4INAA 4G0OA 1UMCB 3EMDA 3EY4A 1DP3A 1WQ3A 3FCAA 3KL2A 4ZTBA 2PBIA 4B0PA 4H1WA 1X3LA 4INPA 2VWQA 3CQ9A 3Q7IA 1KL7A 2VDOB 4O2RA 5TPWA 4IHSA 3KZXA 3OHSX 1D0IA 5DYIA 1BKYA 2XUAA 5P8WA 3RZDJ 1GPBA 2HADA 1FTYA 4QFDA 1T2KA 2YJ3A 4QWMA 4EI9A 3WA7A 2YV3A 2R8PA 1VF9A 5CAEA 4LY3A 2A3NA 1QFYA 4N3CA 4QJBA 1Z0KA 5F5NA 2GCIA 3ZX5A 3VR3D 5D8KB 1GQYA 2P9QA 2COMA 1YQTA 2QX7A 3GMSA 2OD9A 3R40A 5CX1A 5TRTA 4F6CA 1WBBA 3T7SA 2X7JA 2CDBA 4RLHA 1HKQA 3WB2A 3I05A 1PJ2A 4M0DA 5C31A 2IGKA 1U0NA 2GUWA 4ECAA 5ECGC 3OM1A 1SBZA 1RLIA 1VYHA 1WPRA 3PC7A 4AI6A 2VRWA 2M2IA 3HY6A 5DYNA 1ECLA 1FZQA 1P62B 3WICA 1B23P 2LRHA 4RGUA 1MG0A 4OYRA 4W9MC 3V7CA 4GLOA 1ES9A 2WFMA 2L3DA 1IL0A 3TKAA 4BE7B 1N33B 4ZO8A 5A0VA 2XAFA 1OXSC 4ZT5A 4JASB 4DOMA 5HS4A 4ZQHA 4HF1A 3Q41A 1YNOA 1PNQA 1YW7A 3D6AA 4HTFA 4CHUA 5KKAA 4EHBA 2YRFA 2H52A 2OO3A 2HWXA 2PZGA 3LRPA 3MCTA 3NAGA 4EGCB 2ZJOA 3SBDA 3ZH9B 3FXMA 2AQ8A 3EUFA 3TG8A 1YOVA 3ZVRA 4ON0A 2DHRA 2Y1FA 3AU9A 2JIPA 5A4AA 2FH5B 3NYRA 4H1HA 3SHTA 2DYRH 5IYZA 3VH3A 4EARA 1OH6A 1MBFA 3T54A 1KEVA 3Q3VA 2WU4A 4HH1A 4J1QA 1OTYA 4JIMA 4LKOA 5JECA 4E14A 2PGXA 5FPKA 1GG5A 2V26A 1MVLA 2QX4A 3O95A 4YFVA 1ZPDA 4BX3A 4D81A 4B4DA 4AMYA 3DXYA 4F9FA 3OZFA 3UKDA 2H3HA 4I76A 4CRWB 2YXNA 1VMDA 2WWXA 3K1JA 2C9MA 1CVIA 5JQGF 4QPQA 1CNMA 1NBIA 1DC5A 1N1MA 3C3WA 3L41A 4X8HA 1CUXA 1KARA 2XSDC 1L8LA 2GPNA 2KZVA 3DEFA 4BUPA 3DPTA 3NBUA 3TN7A 1BBYA 4RPGA 4YAKA 4I1PA 3O03A 1WMEA 2QQGA 3OJFA 2DFEA 2OLJA 1FLNA 3TZKA 4KAXA 3I04A 2QAIA 1G4HA 1XSVA 2WU8A 1I5OA 4AL4A 4B45A 4M0MA 4C43A 3HG7A 1O8CA 2BHTA 2Z2SB 3K05A 2VDLB 3JRXA 2GHTA 2PRJA 5ALFA 1QJCA 4PG7A 2OJED 4B87A 2VE8A 1XSXA 4FE4A 4U2GA 3ETJA 1BEEA 1CZNA 2K86A 1CJSA 1JKJA 1I24A 1ZOSA 3KQUA 1H8ED 1E3LA 2GBGA 3WQRA 3PNLA 4IQGA 4ZPXA 6YASA 2YWCA 4E7KA 5LQKA 4PXYA 3Q9SA 1VE7A 2M0CA 1V1MB 1F8GA 1J5YA 3I53A 3PA6A 3GQVA 4NENB 1GPYA 1Q7BA 1XUOA 1JQDA 3GDHA 2B2CA 4PNHA 1V37A 2YHBA 2VL8A 3BCBA 1G63A 1UAYA 4AZVA 1AX9A 2UYGA 3IKLA 4CMEC 1I1QB 2K7LA 1YS2X 2X0DA 1KOJA 1Z29A 3PCRB 4IPAA 4URZR 3INYA 2E2HJ 2DKNA 1BJAA 2WSSA 3KHSA 3N8DA 1BH6A 1QK3A 2G25A 1ZESA 2I2AA 1VHTA 4NEGA 5G41A 3SX4A 4D80A 4DRXA 1UINA 2NP6A 3KPJA 4QHTA 3FNFA 2V7VA 2DI3A 4TV9F 2J4DA 2BZGA 2C20A 1L4GA 5CIQA 4E88A 1XSEA 2ONCA 3HM2A 1WWXA 1EMDA 4C0LA 4GI3A 3RJZA 2ZR9A 3ZDFA 4XN3A 2CW5A 4O2AA 3QA3E 1IH8A 2P9YA 4L0QA 1F4PA 3MLEA 3CCVI 2AMYA 5L8VA 2P69A 3H9CA 2PGAA 4IV5A 1H3NA 2FUEA 5DHPA 2XUZA 4EECA 2ZU6A 4A73A 1OX4B 1WW3A 4Q4DA 3DE7X 3ZLJA 2C92A 1U8TA 3ZK7A 1IQRA 2OV7A 4FETA 2L02A 1GPKA 3DM5A 3EY9A 2E1CA 1DMSA 3GRYA 1FOKA 4RCVA 4AZ3B 3JQPA 3G8BA 4M7WA 1APBA 3BZCA 3JAMK 1FPMA 3OX1A 4HJRA 4JWTA 2X22A 1SOVA 1FWZA 3LA3A 1Y8QB 1PL8A 1EG2A 2CLMB 1T95A 1L5ZA 2UZ1B 3DLCA 3H04A 2VJCA 4ALLA 5IUJC 3D5EA 1DEAA 2A61A 3BR1A 1FEXA 4WOKA 3SLKA 3V8MA 3QEBZ 3GYBA 4XJSA 4EFKA 2VS1A 3NRCA 3GFIA 2ZB9A 3CR3C 1JILA 4QDXA 4W7HA 1EQ2A 1QRSA 1Y1RA 1RBMA 1SQSA 3JVIA 3M6AA 5C8YA 5I9IA 4RV9A 3TSWA 5ADWA 2CCJA 4RAZA 5C3EJ 2DT6A 4B7AA 4II3A 5H8WA 4QO7A 5F7XA 1FP4A 2CXXA 4KV9A 4GGMX 1KDRA 2F3PA 3PPXA 4XQEA 4Y0AA 5DM60 1EXWA 4O63O 3WOVA 3Q87B 4CKEA 4BHPA 1WO8A 3B3QA 5TSDA 3LXMA 3OFJA 3AJRA 1IRZA 5L6LB 1UKVY 2BZSA 2EJTA 5C7LO 5F1RA 2ZI9A 3BQMB 3IUMA 5AJXA 1K6MA 1U6GA 1WJEA 5M34A 3W6UA 4AJ9A 4HWTA 3ROGA 1M1NA 1HLDA 4M1TA 3RHSA 3ZS9A 4CLOB 1YYVA 2EEPA 2RHLA 3ZGKA 3MWKA 1HOXA 2HEOA 3OKCA 3NYWA 4PPGA 3UC5A 5A2QK 2FR8C 3WK9A 2G7ZA 5FWXB 3QE0A 5C5IA 2LYCA 4C7OB 5AM5A 3GFJA 1R8QA 1BA2A 1N5LA 1GRNA 1YACA 2PQ0A 3PHJA 1MH4A 4MHOA 5CPRB 4D9IA 4EB8A 5FGMA 2KT0A 5FLMJ 1XMAA 4MP8A 3HSFA 1LRKA 2OVBA 4I1VA 4XUEA 2YV4A 5BNTA 2WYVA 2XKJE 3IMEA 1ESCA 2R7LA 2XZTA 2FPIA 1NQWA 1SHJA 2O2SA 1XDBA 3WDKA 4RKFA 4OI0A 5A4IS 3K2ZA 1B6RA 1E66A 1WQ1R 3KR0A 3W2AA 1YMQA 3C97A 3I32A 3A1EA 1J0DA 2ZTHA 3KEYA 4KXNA 4WCFA 2WI8A 4MGKR 2R6GA 2VKDA 1GZHB 1DBPA 3MD2A 3C8DA 4YJ2F 3RD5A 2VJJA 4YO8A 4W4TA 1QA6A 3A6JA 2MHCA 3H2IA 3IIIA 3ZVNA 3G85A 2C9YA 4QHYA 2HRCA 2WWIA 5A9SB 5BSFA 5F9HA 3CUQA 1VLQA 2WE8A 3AY0A 1CS0A 2CN1A 3FLEA 3L8ZA 4JXJA 2HXSA 4M86A 4R41A 1ZKGA 3DXZA 3HS3A 4L0CA 1ZLYA 4DRYA 4L9AA 1QDUA 3OL4A 1HYQA 3ENQA 4HSEA 3UMBA 2DTDA 5DBHX 1Y6ZA 3LNQA 1L3BA 2FMXA 4JR2A 1L4LA 2GCNA 3UWDA 3WO1A 2I91A 3MRSA 4PO1A 1H1TA 3F67A 3W7AA 2B1IA 4ZHQB 1Z5VA 3TPFA 5BR8B 1XD7A 1AF4A 1NMEA 4UBNA 1XNRB 1AC5A 1BKDR 1JBKA 1MPTA 1VJDA 1ZLXA 3N1UA 3P2MA 2EARA 1J1UA 3EGDB 4MINA 3C3MA 1CLUA 1MQSA 4LF6B 2X2OA 2DQKA 2A6PA 3BMOA 4OINF 4AIHA 2PJRB 4FKZA 5A2QZ 2P2YA 3PDJA 1K98A 1YBFA 2JGIA 3F4LA 4MO9A 4OUDA 2GS9A 3TXXA 3L2VA 5JY6A 3UAGA 3I92A 5DMXA 3QWLA 1FP7A 4BB9A 1UHMA 1B0ZA 2QMQA 4CG2A 3QUQA 3BHMA 5DX0A 3FZQA 3HOWJ 3RU7A 5EXPA 1QZXA 2ZR0A 1KQ9A 1VCMA 1XXHB 4P3NA 3TR6A 3TZQA 3CUTA 1TKAA 4EPVA 5D7BA 3B82A 3RYHB 4FPXA 4EGJA 4DHWA 2IYYA 4PN3A 1PUEE 2NVQJ 1ODLA 4JQOA 3TOCA 1F5TA 2GESA 1TI7A 2CZQA 2W6NA 4UFOA 5BQPA 1WS6A 1RXSA 3S1SA 3UWPA 2NU7B 4JP2A 3GFRA 3G89A 1DC4A 4LS3A 3H3VK 1NASA 5IPAA 2AXEA 2PYDA 3K2IA 3PDHA 1FZPB 4LZWA 4ZO6A 5FYDA 1D5VA 1FYWA 2C5FA 1KORA 2VJAA 2HVQA 2W2TA 1E2XA 2Q2OA 3F78A 4K40A 1GA4A 4Q4ZF 4A3JJ 1DJPA 1JI0A 1M76A 2DWQA 3DUFA 4K9RA 1DCMA 3TLXA 3E3NA 3GX1A 3HB1A 2NXEA 1AV7A 3I9V1 3L0ZA 4I5EA 5BPIA 3AF3A 4QDTA 2VC1A 4ROTA 5FFNA 4G2NA 5TPWB 3TQIA 4B85A 1K5GA 1PFUA 1WPQA 2GTHA 1I1NA 1Q1AA 3BE6A 3DDUA 3WWPA 2H1OA 1VI5A 2WG2A 2C2ZA 2FWNA 3OIGA 3I2HA 2K9NA 1BFUA 3UA4A 4CO8A 1U3VA 3G9ZA 2OTJI 1B41A 4NONA 4R1TA 4R98A 2E2IJ 1PEYA 4D56A 1DGRM 3SEZA 1X38A 4EZEA 3DKKA 4UOZA 1PNRA 2DQSA 1R66A 4V3CA 1LNWA 4FB4A 5FRMA 4MLPA 5KTSA 1M2GA 5AH0A 4ZEOA 4EATA 2DMUA 1NSYA 4C03A 1QZZA 3QVXA 3H7AA 3NWPA 4RL6A 4EELA 2OL4A 4R1QA 2ZRKA 3TLGB 3W7BA 5BWOA 2VOJA 3AHFA 2M9HA 2Y0MA 4C5CA 5C37A 1YJWI 1OW3B 1YS4A 1GIAA 3KWMA 4GYYA 4LPKA 1HDCA 2AOUB 2L19A 3LHKA 2IA1A 2Z30A 1MEEA 2QT9A 4OHZA 4CTMA 4WGFA 5ADHA 2BONA 4JITA 4IKOA 4XVHA 3BZUA 2VXDA 1V9CA 1YQAA 3D4BA 1JI3A 4TVBA 1TC2A 4FNAA 1ZI6A 4XLEA 1Y4UA 1QF9A 4IXAA 3JRFA 1F1BA 4LK0F 3E0JB 2JIBA 2RHJA 2WC1A 3HL2A 1NN5A 4MKXA 5IMBA 4DIBA 3HI4A 3AUAA 3M49A 4GMFA 2BGIA 1V11A 2QZJA 3ZHUA 4QUHA 2AHRA 2XYHA 4LDZA 2A14A 3EC2A 3QYBA 4MR7A 3IE1A 4BBAA 1W96A 4XTCS 4ZTJA 3OOUA 3W2WA 4NCIA 3OYFA 1PL0A 4K1LA 3OUZA 4TMVA 2YFQA 5AR1A 5IFLA 5F78A 5JNSA 5I48A 4FQ8A 4D99A 3KNZA 1CVLA 1ZRSA 2Z4RA 4A4DA 3I2JA 1UJNA 1DXYA 3R3HA 4RGYA 5TQVA 2YSRA 3HPQA 3OTGA 4CL0A 2FHPA 3CY6A 1C1HA 3T7JA 2AFHA 5AW6A 4UBLA 5FUWA 3WAJA<