1R00A

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-homocysteine (sah)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r00A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r00A03
3KQWA 3THSA 2GPYA 1G4DA 3ABTA 4EGZA 1BN5A 2V6CA 3P9KA 3I9FA 4XUCA 1G3YA 4M37A 4AUKA 2G7HA 2HWVA 5EZQA 1NE2A 4BLVA 4Q48A 3FYCA 5LQRA 2GB4A 3OFKA 8MHTA 3PFGA 4RB3C 1G60A 2GZWA 2PJPA 3ELDA 1IF1A 1SMTA 1KQ9A 4L18B 2PG4A 4G7OF 2OA4A 5DCMB 4I0BA 4PGGA 4OA5A 5JI6A 4RX1A 1FYKA 4IHTA 3WTZA 4LG0A 2YPRA 2P8JA 4X61A 3FUTA 1VP9A 4OIRF 4ZYHA 5FHRA 1V4RA 4QQKA 1SFEA 3GUDA 4XSXF 3RYRA 1XTPA 3AXTA 2DPDA 1XGNA 4FGZA 1MHTA 1B59A 4U7PB 4R8SA 1S7AA 2W57A 4E32A 3K9TA 2P3OA 2MC3A 5FA5A 2IH2A 4OX9Y 3RTRA 3PLAE 2FHPA 1ZRCA 2I7CA 1I1NA 2ELHA 1HW2A 3HSRA 2ORED 5G02A 5C9ZA 1GXQA 3G2PA 5GWXA 2IH4A 3GJYA 3B3JA 4L7VA 1AQIA 3HCCA 1H0MA 4BP3A 1HKQA 3HSFA 1KPGA 1VP3A 4HV5A 2P7IA 2P41A 4M36A 4ENNA 3J7AO 1IXRC 3HEMA 1YIOA 1QGPA 1G3WA 2PT6A 2XYRA 1DP7P 4YG2F 2AVNA 2R7DA 4ENKA 1FPQA 3OU2A 2VOOA 3KR9A 2EV5A 1ZG1A 2LDUA 1IAWA 4EQZA 4IRGA 3E05A 3L09A 5HILA 1IN5A 3N4MA 3FTCA 2RVCA 4CKBA 5EMLA 5BPDA 2ACJA 1SFUA 3IWZA 3T7SA 2ZIFA 4OA8A 2LD4A 4E2YA 5K0CA 1XCLA 4UOEA 5DRTA 4ENMA 3UBTA 3EVEA 4MTDA 4K6MA 2XHKA 2JT1A 3PS9A 3PQJA 2PXCA 1XJ5A 3MTIA 2A07F 5IH3A 3FRHA 1TBXA 2L3DA 2ONYA 3Q87B 4P58A 3UJAA 3IRQA 1U78A 5FUBA 4I02A 1J0RA 2BBYA 2KW5A 4DCMA 1MJAA 2G70A 1BJAA 1WS6A 3ANXA 3C6MA 2L02A 3B89A 5E1XA 1GXPA 2ZXJA 1JSXA 1D3YA 3ECOA 2NP7A 2Z9OA 1WG8A 2MH9A 5EMKA 3HCAA 5HIJA 2F5DA 3V7RA 3G2MA 2FF4A 1J2XA 5KYGA 2K7LA 3KE2A 1PDNC 3G89A 2B25A 5T6BA 5J6XA 5ILVA 3OPNA 2CW0F 4JK1X 1SKMA 5LGUA 2JSCA 3EVAA 1BI1A 2I9KA 5F2NA 3E6CC 4RYLA 3SX0A 3NRVA 3KQYA 1MD0A 2ZBKA 5ILUA 1IUYA 4Y30A 5EMMA 3LA2A 1ZN2A 2EV0A 1KU7A 3EGEA 4KW7A 1P4XA 4M9XA 4EJUA 5DX0A 4HA8A 3V8LA 3EVZA 5HIMA 2NXNA 2IFTA 1M6YA 3MGGA 5BPIA 3DLCA 5K5RA 1D2GA 4LFUA 3OOPA 2NXEA 5T64A 2KIMA 5CVJA 2NP6A 1UFMA 3FPEA 1KYWA 5A2QK 3V97A 3L2CA 1KQ8A 4R8HA 1DPUA 3I71A 1QAQA 3K6RA 4ENJA 3F8BA 5FLXK 3TOAA 3FPFA 1RJFA 3G73A 2Y48A 4Z2YA 3A7DA 5JHUA 1J5YA 3TDZC 5GP1A 5DD8A 5FA8A 2FK8A 3SVZA 1DCTA 1J9IA 3LHDA 2ZFWA 1R7JA 1AOYA 2COMA 1F3LA 2VE8A 1B4AA 1L3CA 2RN7A 1RJEA 2FU4A 3FPGA 3RIEA 2H27A 3SHFA 1Z7UA 3HA7A 3I5UA 2PQ8A 3OV8A 1T2KA 2VE9A 4DCGA 3M7GA 1R1VA 4BXUA 5LLQA 2AXLA 3EETA 3I59B 1MDMB 5LGNA 2UYHA 1YYVA 4R6WA 3SMQA 2IRFG 1S7OA 3JSOA 4A2UA 3JWHA 3GO4A 2UXXA 4CKCA 4CWAA 2FBIA 3OZTA 4UNOA 1YLFA 4KIGA 4Y13A 4B17A 2OBPA 3IKVA 2IBSA 2RC4A 2JG3A 1L0OC 4XRFA 5FD6A 3I64A 1VLMA 4HC4A 2IW5A 2ISZA 1EJ6A 1KPHA 2ZULA 5DPMA 2XYVA 2Q8KA 1IRGA 4A6DA 5K09A 4IJAA 1NBHA 1I4WA 1YW9A 2O07A 2ETHA 5GM1A 1ZLJA 2EFWA 1G3TA 1RI4A 2VDVE 2EFPA 3HHHA 4IF4A 1D8KA 3GLXA 3OFJA 5DT2A 2H11A 2IJLA 2B78A 5LGTA 1QZYA 4LG1A 3BDDA 2IPXA 2XVCA 4ZYEA 3MHTA 1F5TA 1ZHFA 3ISPA 1JG4A 3CUQB 4FSDA 2DFIA 3TRKA 4HDVA 1LQ1A 1U5TB 3VC2A 2DTRA 1BC8C 1KA8A 4Y2HA 1SMYF 4GOMD 1NHAA 4K2EA 4HW0A 2AOXA 3DMFA 4PWYA 2UZ4A 2FSWA 2PT9A 3EVFA 5K1YA 3S68A 2VZ9A 3R6SA 4UVAA 4CGZA 1MJFA 2PJDA 2P7VB 4XLNF 1PUEE 1ZAOA 1UFKA 4CTKA 3M8FA 3KR2A 3WGGA 3M33A 5D5WB 2HEOA 2DW4A 1U5TC 5ERIA 3M9AA 5KVRA 3FMQA 3HRMA 3SXYA 3RKWA 3BKXA 3R60A 1QBJA 5IT9K 3CBGA 3TO9A 3KU1A 2CQKA 1ZARA 1MZBA 3M8EA 4R79A 2L01A 1RI1A 1STZA 5KK1A 2XVAA 1IRFA 1YZHA 2C7QA 1XMAA 1SQFA 3GRRA 1MDMA 3SR4A 3KLOA 3PQKA 4A0ZA 1EH7A 3TM4A 3OCJA 4OOIA 3FUXA 2E5WA 2NAZA 1RI3A 4XUDA 3T7RA 1J75A 4FS8A 2Q0OA 3DULA 2LF8A 2BM8A 3ORHA 2EK5A 4HDUA 2XBMA 3LPMA 3R3HA 2QYOA 4WXHA 4HRAA 4P5OA 1L3BA 2HMYB 4OU0A 1P1CA 2JHPA 1SD5A 3HOSA 3ZPLA 2PSSA 2AOUB 3LECA 3J80Z 1F1ZA 2FBHA 2HQNA 2HDCA 3G2QA 4UV9A 2FRXA 3CVOA 1ZRFA 3LSTA 4BLUA 4HF1A 1M6EX 2NRAC 2YX4A 4AZWA 4C06A 3OU6A 3EMDA 1O3SA 1XGOA 2PLWA 3CGGA 5BP7A 3EQLF 3ME5A 3HHGA 2ESHA 5EC8A 2BE5F 3T1BA 4BLWA 5E20A 2VT3A 3FHZA 4Y17A 5FFXA 3QP5A 1IXKA 3NMUF 2ZWAA 3THRA 1EH6A 1U5TA 2FOKA 3WGHA 1A04A 2ZZNA 4P9FA 2HZTA 3EYIA 5FHQA 1GHCA 1H9GA 3O7WA 3BGDA 1W5SA 3GU3A 3HUGA 3U81A 3BZ6A 3PT9A 3GZ6A 1OR8A 3M6UA 2GS9A 3FTFA 5H02A 1XSVA 1HQCA 5FGMA 3WTSC 2P7HA 5FCDA 3W6JB 1U8RA 3TOBA 2KIUA 5DXAA 3LCUA 1X3UA 1HKSA 3C7JA 2K86A 4KNYA 1OPCA 1P6RA 3F8CA 2PLYA 1BHJA 5FWDA 3F3XA 3H3UA 3P7NA 5CVIA 5CYVA 2H94A 3VSEA 3F8NA 5K0EA 1R8XA 3SM3A 4LGWA 4Y15A 5LHGA 3B3FA 4LECA 4P7GA 4ESJA 5C0OE 4RTNA 2LKPA 2H6BA 1QAMA 2DPUA 2A61A 4RTPA 3KQQA 2CYYA 2M30A 1ZRDA 2AS5F 2CKDA 4IV8A 4KDPA 2AOUA 3FMRA 4FSXA 3GNLA 1FJXA 4PCLA 5D4RA 5FB2A 1P39A 4DM3A 1VIDA 2FE3A 2ADUA 5D5UB 2O6GE 1G8AA 5CCXA 3P9CA 3GIWA 5J8FA 1HXDA 5ED4A 2X4HA 3R9XB 3CDHA 2ESNA 4RVDA 4YUYA 3HCFA 5EQJB 1LEBA 5BW5A 2ZBRA 2OAZA 3TGNA 1BIBA 4DA4A 2AR0A 3A7EA 1NW7A 3KP5A 5DM0A 4XUEA 2JHCA 4WK8F 3HM2A 3LDFA 4OIOF 1JG1A 1IXSB 2ZVJA 1G38A 2VBWA 1BC7C 4BQAA 2GA1A 3CLOA 3IWFA 3G7UA 3B02A 5K5QA 3E97A 4YUWA 1W4MA 5FULA 5HFJA 4HQMA 3E7PA 2W84A 2YR0A 3ELYA 3R61A 3DPLC 2B0LA 2ZIGA 2C7PA 2JTVA 4BHBA 1T98A 2ZSUA 1KQ0A 1CGPA 1NV9A 4UHTA 5CM2Z 1SD4A 2IPQX 1I1SA 2IDJA 4HTFB 4WCGA 5HLGA 2HWKA 3IEIA 3LX6A 1HSTA 1G55A 2BV6A 2Z6UA 4EJTA 4M7RA 1ZLKA 5DSTA 2GA9A 4HQEA 1NW8A 3R0QA 3EDPA 2DQLA 3K1MA 2G9WA 3LCVB 4U7BA 2HR1A 1G6NA 2ZZMA 4M73A 5EHIA 3ID6C 3X0DA 5CVUA 5HEKA 2FQ3A 4YUZA 3FM5A 4HGYA 1QAOA 1JQEA 4PGHA 2RKHA 3BZBA 3K1PA 3I53A 3PB3A 3TFWA 4CXFA 5K01A 5L3DA 2ISYA 1ON2A 4E70A 5LHHA 3R6TA 3TPZA 2XAGA 5DYMA 5ICFA 4EJOA 1KYZA 3FPJA 5CUQA 2HKXA 4M38A 3UJCA 3PFIA 2CGPA 1O54A 4WX9A 1KGSA 3VODA 3D0SA 2P3LA 2OU2A 2FPOA 1PP8F 4RTLA 2XGXA 2PEXA 2H6CA 3BXOA 4FT8A 5DV5A 4EJVA 4M9SA 2PVCA 3VOEA 2ZW9A 1ZGJA 4I7HA 4NECA 1VE3A 5CJ9A 2DBBA 1XDZA 3LKZA 4ER6A 4FP9A 3GRUA 3RODA 4CZZA 2L54A 2O06A 5ICGA 3FXQA 1OYYA 5CVRA 4RS8A 1SAXA 1XCBA 2A5YB 1YTYA 4HF0A 5FQOA 3U1DA 1W7PB 4KYWA 2HQRA 3NWBA 3HRUA 1U2WA 4MTEA 2LSOA 1O3RA 4LB6B 2O03A 4GC5A 5CVEA 3HVJA 2AOWA 1X1BA 3GFLA 2A6HF 3BGIA 4EJWA 2PMHA 3F21A 3PTAA 1OMIA 5HLIA 3UWPA 4MHGA 3ERED 1AV6A 3FMSA 1TQPA 1OYIA 3G2OA 5M5BA 3Q9VA 2QVOA 1O9GA 2TDXA 1Z6TA 1JHFA 4HBLA 4U0YA 2CWWA 1BIAA 1EG2A 4M71A 1XGMA 2HR3A 2O0LA 2M1BA 1KHHA 4IWNA 5BW4A 2Z3YA 3AY0A 1LVAA 5HS7A 2O57A 2ZJ2A 5DXJA 3LDUA 3MAJA 1WQ2A 4HTFA 3UA3A 1WY7A 3HTXA 4QPPA 2ZCJA 2KKOA 3MEXA 4HF2A 1ZH5A 3GFJA 2D1VA 4KA4A 5EKXA 1IW7F 3DEUA 3SFZA 4B09A 4Q47A 3FUUA 4M6YA 4LD5A 2VODA 3F6OA 4E2WA 2PX2A 3ABUA 4HYEA 1VL5A 3NTVA 3O3KA 1YB2A 1D2HA 3HOTA 3I0TA 5ICEA 4RB0A 3HCDA 4IRHA 2BZGA 4LLNA 1HSJA 1U2ZA 1FP1D 2MD5A 3RIRA 2OKCA 4EM0B 3WSTA 4RAZA 3WTWC 1FX7A 2PV0A 4UXNA 4WWCA 2KJCA 3HIFA 4RTSA 2KRFA 1FBNA 3DV8A 2AN3A 2OO3A 1Z6RA 1DUXC 2E7XA 5AIPA 5DM2A 2D1HA 1R00A 1J7KA 4IV0A 5TRDA 1YFHA 3V7CA 2Y1XA 3C3YA 5FADA 1X1CA 1EAMA 3DMGA 1NW3A 1OYWA 5HDNA 4X63A 4U7DA 2Q2EA 5GIOE 4NQWA 2A69F 3OZSA 5L3EA 3GF2A 1W7PA 2E7WA 4WF2A 4ISCA 2XAQA 3TMAA 1USTA 4POOA 1SD6A 2D45A 2CL5A 2NS0A 4A5NA 3DKWA 4ZZLA 3KR1A 2PXAA 3BUSA 1R23A 4R1HA 3Q7EA 2VXZA 3RDIA 1XVAA 2IT0A 4PYKA 4N9HA 1CF7B 2O0YA 2QWWA 5A2QZ 3KPVA 1Q1HA 4CKEA 5IT3A 1Z1DA 3HCEA 1RI5A 3FZGA 5K5OA 5L3BA 3EVBA 5FLXZ 3P9IA 4RTRA 4RGUA 3SGLA 2QQ9A 1UCRA 2PX8A 1DDNA 3WTUC 1C0WA 2DK5A 3D5LA 3SSNA 5HS9A 2M45A 2O05A 3O6BB 3G5TA 4PCAA 1YZ3A 5L3FA 1JHHA 3CJTA 1QPMA 3C0KA 3DP7A 4DZRA 5FD5A 6PAXA 2W25A 4BHCA 3GZ5A 3ELUA 4PZJA 2AS0A 4TV7A 2NNNA 2O61A 4X41A 4QTTB 1UIRA 4CYDA 3BWMA 3M70A 1Z9CA 4BY9E 5DCFA 1FSHA 4AZTA 3HNRA 4EV0A 1FY7A 1IN8A 2YUIA 5DX8A 4YMHA 3CJNA 3V8KA 1B6AA 3E5XA 4JXJA 4PDKA 4HX7A 4M9ZA 4YUVA 4DQ0A 4QDJA 3QPHA 5KS2A 1RUNA 3KQSA 5KQSA 4CO8A 4S04A 2ZLBA 4GUAA 1WXXA 4U7TB 1R1TA 2P7CB 5DTMA 2QUFA 4OMYA 3VB2A 3KEQA 1L1EA 5F64A 3SXJA 4RGSA 4KRGA 2K27A 4G6QA 5AONA 4GC9A 2PXXA 3I4PA 2Y75A 3T7TA 2GXGA 4ER0A 4IXAA 3EGIA 3QV2A 3IKTA 3HTSB 2NYUA 3DH0A 1ODDA 2AZTA 2F5EA 5LR6A 2DI3A 3BWBA 4PNEA 4F86A 3GFIA 3F8MA 4OMZA 1BOOA 3C18A 3K69A 3RPQA 5K0NA 1O3QA 4RB1A 4EQQA 2EA4A 2CO5A 2DQRA 1L3LA 2FYTA 2AOVA 5EZSA 2WV0A 1CF7A 2XKOA 1F9NA 2F5FA 1G8SA 4OIQF 5EG5A 4RSRA 3RW9A 4ZYGA 3CJQA 4BH9A 4EMSA 1I9GA 2MA3A 3P2EA 4RWZA 5HIKA 5HLHA 4M6XA 1XD7A 2HNKA 2VBYA 4ER5A 3I58A 4PYOA 2EFJA 2OB1A 1OR7A 4G9YA 3MERA 3VFZA 2OQRA 2EX4A 3LFKA 2HFHA 1TNSA 1QQIA 1REPC 4EM2A 4Q5SF 1ZGAA 3VC1A 3FUVA 3J81K 2EG5A 1JXSA 1TTYA 3FTDA 3JWGA 2VP3A 5F1RA 2JRTA 2IVMA 4L0YB 1XSXA 2P8TA 3RI4A 3U9GA 4PYQA 1FOKA 3UJ7A 4KMFA 5HS8A 4ESBA 1U3EM 2ZNYA 1B1BA 3IC7A 1N7IA 4C03A 2V1UA 2CG4A 3A4TA 2B3TA 1FWZA 2ZMEB 2XIGA 1FT9A 3P71T 3ZN0A 3V7SA 1G3SA 2LNBA 4P7JA 3KZZA 3FZVA 3L00A 5LRRA 2Z33A 5E8IA 5CVDA 4A12A 4EKGA 2VOPA 3ELWA 2HYGD 1JTEA 1J59A 5D8LB 3V8VA 2XKPA 4UUVA 1JQ3A 2WA2A 1JSZA 1F38A 1JE8A 3BOQA 2PX4A 4LWOA 3ZMUA 1BI2A 1FP2A 1TLHB 3GEZA 3IHUA 3CJRA 3BWGA 2HKOA 5EMJA 2V74B 1O3TA 2EWNA 4MTLA 3MWMA 3KCCA 3BT7A 3HVIA 3LAPA 3U2RA 3CC8A 2BR3A 5MHTA 4O6JA 2HTSA 3EEYA 5GIPE 3WE3A 2ERCA 1XCJA 4PYJA 1G6Q1 1WRJA 2IBTA 4IKPA 4UV8A 2B2CA 4KT5C 1R8YA 5DM1A 1YUBA 1U6GA 4O29A 2GAUA 2MH2A 5B1SA 4U0WA 1N2XA 1S6LA 3JAMZ 4WVLA 4BAYA 1LEAA 4G7ZF 4GOOD 2RNJA 2BM9A 2XAFA 3QPTA 4P7FA 2CSOA 1I1GA 4A5MA 5D6EA 1ZQ9A 4CXMA 4AX8A 5DTRA 3KZYA 3HA5A 4FR0A 3LA3A 4GO1A 2K4JA 5LHIA 3EVDA 5IKMA 2K4BA 1RIOH 1MJ9A 3ZMVA 3HA3A 3JWIA 3C6KA 2A68F 2GA2A 1FLIA 2G72A 1B9NA 3DOUA 2FMLA 2YQZA 3LBFA 3VEPA 2IIPA 4HLYA 1WWXA 3KQOA 2N47A 2PBFA 4C05A 3ZMSA 4V0QA 5FTWA 2QQBA 2VBXA 5E1OA 2V79A 5K0LA 1QZZA 1AF7A 4NHJA 2VC1A 3EYYA 4WXDA 5F2KA 3LBYA 2G8NA 3UJ9A 1IN6A 3FX3A 1ULYA 3JTGA 1X1AA 5F6FA 4PIPA 4OINF 2ZMEA 4MHTA 4R05A 1LJ9A 2M87A 1R18A 1YS6A 4QPNA 3BP8A 2JPBA 3BY6A 3MCZA 1RI7A 1EH8A 2QBYA 1WSUA 1P91A 2WA1A 2YU3A 2PGXA 4X1OA 3SZPA 4F7ZA 3PVCA 3NDJA 5LQCA 2EFNA 4P7KA 1TQMA 2WWYA 2QY6A 2QENA 3RKYA 1JQDA 2XVMA 3TOSA 2GLUA 4V0RA 4RVHA 3BROA 3S2WA 5BQTA 1H1DA 3K1NA 3MAGA 1JGSA 3FXUA 3TKYA 5F2OA 2MLKA 1EIZA 3DR5A 3EVCA 3KPYA 5CVVA 4HX4A 3A25A 1O7LA 5D5XB 1JG3A 5E1BA 4IRIA 1EV7A 3C1DA 1YO5C 2V9VA 3KKZA 4KDRA 5GOZA 4I0AA 2PN6A 5DUKA 4DF3A 5BMZA 3GXOA 2OXTA 5LQAA 5EPEA 2HV9A 3QOXA 3GDHA 4O5VA 3NVMB 2ESRA 3Q5FA 3F23A 5HOQA 3SZTA 3NVKI 4YIIA 4L9TA 3T5XA 4WXCA 2P1DA 3PX2A 5CIYA 4Q4ZF 5K0JA 4GOLD 2Z6AA 3T0YA 3BJAA 1D2CA 10MHA 5LEKA 2F5CA 5FQNA 4HSGA 1T43A 4F84A 4HAMA 4M72A 4MIKA 3DXYA 3E3VA 2A6EF 3CTAA 1L9KA 3QRFF 2YXEA 5EEHA 2PWYA 4OQEA 5AIQA 1VTNC 1IXCA 3M6WA 2EB7A 4ETSA 1LB2A 1K79A 1O9HA 2BEOA 2VDWA 3REOA 1YFJA 5DD4A 4H0EA 3F6VA 4I01A 1KU3A 2F2EA 5DDGA 1D5VA 4A6EA 1SG9A 1TW2A 1UB9A 2P6TA 4MEXF 3Q9SA 2FK7A 2QLZA 1QNTA 1ZG5A 5EKUA 4ON0A 3UJ6A 4N9IA 3NDIA 4HH4A 5E1WA 3NQOA 4QLCU 2PFBA 4PYMA 2P5VA 2ZBQA 3E6BA 9MHTA 3WTYC 2Q41A 1R58A 4C04A 2XAJA 5E9QA 4PONA 1V3FA 1O57A 4JBAA 3WTVC 1HW5A 3K0LA 2OYRA 5BS6A 4LLGF 5GINE 4QDKA 4KIBA 3COAC 2OD5A 3T8RA 1QYRA 3KETA 2QQAA 3HRSA 5D1NA 3GX4X 3TQNA 5LSAA 2EA2A 2AN4A 3MQ0A 4DQ2A 3KP3A 3KEOA 2STWA 4CDGA 4MQVA 2JZYA 3L9FA 2F8LA 1HKTA 1UWVA 2IP2A 2JJQA 5DRYA 2KIFA 3LWFA 3DLIA 4AD9A 2RGVA 1DL5A 3GFMA 3G5LA 1FNNA 1VBFA 5D6FA 4KDCA 4EK9A 3AAFA 2A14A 1KR5A 2ZWVA 2IA0A 3A26A 4BNCA 3ZMDA 4KVZA 3E23A 3W6KB 2AN5A 2GWRA 2OZVA 1EQAA 5D1HA 2G71A 5E1MA 5JVTA 1E2XA 3G88A 4RVGA 5HVQC 3P97A 4R6XA 3T0IA 3F72A 2EFOA 4E33A 4KMUX 4QWQA 3P2IA 2DK8A 4AWXB 4L0ZB 3N97A 2PY6A 4YMGA 4P55A 5GM2A 1XSDA 3DFGA 4AVPA 1Z3CA 4YFKF 2GIVA 2VDUE 1IZ1A 2G7UA 2YTZA 4ZZDA 1MGTA 4ER7A 3EVGA 3NWEA 4MNUA 1BI3A 4LK1F 2BR5A 1BBYA 2AVDA 5TJJA 5U4XA 2L4MA 4RTOA 3E5QA 3EPPA 2OBFA 3KHKA 3NW9A 1HBXG 4YIFA 1Z05A 3F8FA 4YV1A 4YUXA 2OY0A 4I98B 1I6XA 2X0LA 4L5JA 1E17A 2XASA 5LRSA 2VONA 1N7JA 1ONVA 3OU7A 1KU9A 2RDPA 2STTA 3QU6A 1USSA 1S29A 1R6AA 4ATNA 3LQQA 2DLLA 2OB2A 2P6SA 5K0GA 3BPVA 1P4WA 3M4XA 1UHMA 4LLLA 4QVKA 3LA7A 2M5WA 4L9JA 2L4AA 2V7EA 3EMBA 4AIJA 1JG2A 4E2ZA 5EEGA 3QOWA 1Q0SA 1SUSA 2FEZA 4G8XA 2DU9A 3ELKA 4YFNF 2Z6QA 2M8EA 2ONZA 3O31A 1T38A 1YW7A 5KQRA 4F85A 2BR4A 1KU2A 2ZO4A 3D2LA 1B42A 3KP6A 4MGRA 3IL2A 2QM3A 5E9WA 1T6SA 1FSEA 2XAHA 4UVCA 3LCCA 2CFXA 2HTEA 5HOOA 2GXBA 4OBXA 1JR4A 3MZYA 5DUIA 1YS7A 4HG2A 4PCQA 4G56A 4PYIA 4FX4A 4LMYA 5LBQA 4PYNA 1P4AA 4N0BA 2NXCA 2G1PA 3OE4A 2Y0MA 2K4MA 1ZG3A 3LDGA 3BJ6A 4A0XA 4AZVA 3RYPA 2ZBPA 5DCMA 2ZTHA 1RUOA 1K7AA 3BJOA 4KN7X 3E6MA 3AWIA 3MB5A 1BC5A 3GVAA 2C7OA 1UHWA 5DM4A 1X19A 2FBKA 1FYMA 1XXLA 3JW4A 1R36A 2NXJA 2YVLA 3DXZA 1Q0TA 2DAOA 3KP7A 5LQKA 1W5TA 3FTEA 2EFQA 2KJBA 4L5IA 1PJZA 2YXLA 4E2XA 2ADMA 3G8BA 1AWCA 2H00A 5P8WA 5FWAA 1R5HA 2VBZA 1NW5A 1BOAA 1L3IA 3KQTA 5EGSA 4OQDA 3M1EA 2NNWB 1IN4A 2BYVE 3TKAA 5E2BA 2FMYA 2UWMA 3LQRA 4GYGA 1FYLA 3JWJA 3GWZA 3WU1B 2H09A 2D2WA 1R22A 5JR3A 3FUWA 1I27A 5EOVA 5T67A 1S8NA 2P4WA 4R8RA 3NJRA 2W24A 2BH2A 1R74A 1TQIA 4P9UA 1ORIA 4L9NA 1EJ0A 3CUOA 3UFBA 1V39A 3BWCA 2UYQA 2IA2A 3DXXA 2YSRA 3ZMZA 4XLPF 2ZFUA 5HZMA 4RTMA 3FWEA 1IN7A 4JQFA 5DX1A 4ZYDA 2UYOA 5HDGA 4BP1A 1B9MA 1BI0A 1K6OA 5ERGB 5EIWA 4BYYA 4CICA 1BM9A 5E8GA 4U0VA 2E1NA 3T8TA 3V8JA 3L8DA 4EGYA 2P5KA 5CD1A 3E5UA 2JPCA 2XYQA 1MKMA 3TO7A 4RTKA 4KUMA 1JTFA 4MQ4A 1XCVA 3GYHX 1YG2A 1KXZA 4AIKA 4RTJA 1O7FA 4OBWA 1K78B 2FNPA 5ICCA 3ULQB 4EVIA 4ER3A 3G3ZA 1TPYA 1WI9A 4QVGA 2HYFA 3F4KA 4FT2A 3FRIA 3TDUC 1R1UA 1HMYA 3E8SA 4GCVA 4C4AA 4E31A 2CMGA 2MBFA 1DUSA 1Z91A 2QRVB 3AJDA 3B3GA 4L9VA 5D5VB 4YV2A 2J5PA 3IV6A 1D8JA 2GH1A 1SFXA 3L7WA 3K0BA 2OQGA 3IRRA 1S3JA 2FCAA 1P92A 1IY9A 7MHTA 4KIFA 2IH5A 2Y1WA 5LQUA 3B7PA 4G94A 4AIHA 2C7RA 2RV8A 1FC3A 1YF3A 2GQQA 4ASNA 3ZQ7A 2PX5A 3QAHA 3EGVA 3KPJA 1M0EA 4EM1A 2DO7A 2O8XA 2EV6A 1LDDA 2QE6A 2I62A 2CWEA 2VT2A 2AOTB 1YFLA 5L3CA 3UJ8A 1TNTA 5J8CA 4RGRA 1FZPB 3C3WA 2YXDA 1OKRA 4RB2C 4MWZA 3NEUA 1RI2A 3DQVC 3FYDA 2FRHA 3WODF 3DUWA 3OZRA 3KP2A 3J81Z 4C07A 2HGCA 4HZFA 2LF7A 5IT9Z 3I54A 5H20A 2IGTA 3R4KA 3CUQC 4QQNA 5HIIA 3PX3A 5E2AA 2K02A 3MQ2A 2HOEA 3GGDA 2H1RA 4HLXA 4ZH4F 3KPUA 4S05A 3HTUA 3GRYA 5DTQA 4LJZF 1XMKA 2IDKA 3CCFA 3EEOA 5LQJA 3LAJA 1PP7U 2XROA 4RGXA 3IYLW 2NNYA 4G7HF 1ZREA 4ESFA 3ZP5A 3WTXC 2QBYB 2V1DA 3I59A 2XUBA 3ML6A 3HVHA 3KQPA 4HOBA 4H0NA 3KPWA 5LEJA 1K78A 3H3ZA 5BOXA 3UA4A 1NKVA 5CCBA 1KIAA 1H9TA 4E30A 4X60A 5K8VA 1NV8A 2XV4S 5E8JA 2NYXA 3GO5A 5FFZA 3SSOA 4PIMA 4FT4A 4RV9A 5L3GA 4BHPA 3QU3A 4I2OA 4ZTBA 4KICA 4RVFA 3J80K 2QRVA 3LL7A 3FF5A 2ZCWA 2UZKA 1RJDA 3R24A 3P9NA 2V1XA 4B8XA 3MTEA 1LNWA 5KVAA 2Z99A 4GQBA 3UJBA 2Z5UA 3O2PE 3JSPA 3H2BA 4PINA 2A3SA 3O4FA 2HS5A 4MQ9F 5K0FA 1YW8A 4CHUA 4OIPF 3KQMA 2VC0A 1QO0D 3V4GA 3UJDA 5DLYA 4HV6A 3HRTA 5D4SA 1T0FA 3JTHA 2PMUA 3CUQA 4M74A 3ZMTA 1XDUA 2E1CA 2J5OA 3KP4A 1LDKB 3KR0A 5K0BA 2P5LC 5H6QA 4FZVA 3FXRA 4A0YA 3AXSA 3JAMK 3DF8A 3H92A 2W85A 2EJTA 3RPUA 2AOTA 3DPTA 2R6ZA 4DKJA 1I5ZA 2PBIA 3RKXA 4CTJA 4HX8A 2CMHA 3SSMA 2WK1A 5CLSA 5DEQA 3ER9A 4GYIA 4IHSA 1FBQA 4DMGA 1AQJA 3C3PA 1NT2A 1INLA 3RJPA 2VN2A 2JH9A 4LK0F 4GXOA 1KPIA 1FBSA 3HYIA 4FX0A 3HCBA 2IA1A 4UVBA 2I6GA 4PYLA 1FBUA 3DXJF 2OZ6A 3CKKA 1WKMA 3TO6A 2C6YA 2DULA 3ERCA 5EHGA 1ZYRF 2DT5A 3R0AA 1W7PD 1P1BA 3CO6C 3GCZA 5ILSA 3ZN1A 5FO5A 4HGZA 2OZUA 2UXNA 4XCXA 5K03A 2XRNA 5LQNA 4O3MA 3E6DA 1HNNA 4GEKA 4P96A 5E1ZB 4GF5A 4U88A 4RAYA 2R3SA 3VYWA 4FHTA 1RZ4A 3QOPA 1DPRA 1GVJA 5C1IA 5BXYA 5E9JA 2P3QA 4KN4X 3OE5A 1WZNA 1VPTA 4GGGA 3GRZA 5DWQA 4GOND 3M6XA 3TM5A 2BGCA 3IHTA 2FA5A 1Y0UA 2JHAA 5E17F 4NB5A 2OPBA 2GAFA 2P40A 3ECHA 2JH8A 4I09A 3BKWA 4MEYF 3LKDA 2PKWA 3TQSA 3WG9A 2ZIEA 2R7FA 3WGIA 2ZZKA 1R5GA 1RNLA 3G8AA 2DPMA 3KLNA 5HDKA 1ON1A 4RTQA 3KFWX 1XN7A 4D0PA 2B9EA 1SVUA 3A27A 2YR2A 5JFRA 5K05A 4LG0B 1WXWA 2O3FA 4XBFA 3R0JA 2EJUA 4G6DA 3MCTA 3BPXA 3KQVA 1BKYA 3WTTC 3WU0A 3WE2A 5H6RA 2FXAA 1YQAA 1HW1A 3K2ZA 3QP6A 1NW6A 4LWPA 4LB5A 2MLGA 1P2FA 2WC2A 3MFKA 2FNAA 1ORHA 1F4KA 2WTEA 3ER8A 5D8KB 2UYCA 4YFXF 4YV0A 4DNCA 2ZNZA 4AZSA 4EKIA 3LGAA 5JUWA 1XB4A 1VQ1A 2YX1A 1LDJA 1Y8CA 2VS1A 3EUHA 1SQGA 1TW3A 3SQNA 2PWPA 3TR6A 1MJBA 5DSXA 3CO7C 5E8RA 5EIFA 4XSZF 3F22A 4QTUB 1RJGA 1X1DA 4IPAA 3DMHA 5E18F 4KWCA 3FM3A 3ROUA 4IVNA 2PI0A 1ZKDA 3HP7A 3HVKA 3P8ZA 5E1DA 3TLJA 2YX7A 1XDSA 5EVJA 1XGSA 3GRVA 3FPHA 1QANA 2EJRA 3PFHA 3MZHA 2HTJA 3BGVA 4GBED 3B5IA 3BWYA 3UZUA 2QZ8A 1SD7A 3M6VA 1SUIA 2RQPA 4KFCA 1PRYA 3HSEA 3B73A 4C08A 3GW2A 1IM8A 2P35A 1T39A 3P2KA 1KP9A 3DTNA 2ZKZA 1NBIA
chains in the Genus database with same CATH superfamily
5FUQA 1WCV1 4N76A 1BN5A 3P9KA 3WGLA 4X9XA 1I0LA 4Q0MA 4DG9A 5IXYA 3MMYB 2GB4A 3JZFA 3C3XA 3K35A 2GZWA 1DOZA 5EIXA 3FCOA 4NZMA 4DW8A 5GPAA 4V0NA 4ZC1A 4DUPA 2H1SA 4N3GA 4H27A 1EQ2A 1S3IA 3IDQA 1EHCA 4QQKA 3DFFA 2R751 2OAQ1 5KTKA 3L0OA 4U8HA 1OX6A 1VPDA 2CHVA 3OG9A 2VDPB 3GFQA 3E22B 2G9RA 2YMQA 3S2YA 2FHPA 2DH6A 3VDMA 2NXNB 2RHGB 4WKBA 4TTTS 1X14A 1QLJA 4ZPXA 2AFIA 4L7VA 4BXFA 2JHGA 1T0HB 1D6NA 2PRYA 5G40A 1YIOA 1QGPA 1QGYA 1UKAA 3WWOA 4H59A 3OBIA 4WK0B 4Q1AA 1FPQA 2VOOA 5J1UA 4RHCA 4EQZA 1JEQB 3L09A 1O2DA 3WRXA 4CKBA 2YOHA 1J5XA 3Q5EA 2X5NA 4EHBA 1QIEA 1VPEA 2WHQA 2LIVA 3R9IA 2PSJA 1CJVC 4YO7A 3PQJA 2FW1A 4NIMA 3MTIA 2W22A 4TZKA 5HNFA 1C0LA 4QBTA 3CF6R 5E4FA 2Z4SA 1ML3A 4JUDX 3RVBA 3EISA 5F1YA 2V6JA 2DOAA 4I1VA 4P33A 4RW0A 5A4MS 1H42A 4ZI5A 3VSLA 3VNQA 5GJBA 1P60A 3RK4A 1X0XA 2W37A 3OF3A 2AZXA 1U0JA 3KE2A 3G89A 5TGZA 1VJ0A 5LGUA 2JSCA 3CM0A 3NUZA 3NRVA 3SKYA 5ILUA 1V26A 3E15A 4Y30A 1MFPA 3UXYA 3KT6A 2I4NA 2IP1A 3JQGB 3QOFA 4F9FA 4JIMA 2QL5A 3KUUA 1TD9A 3ZDDA 4TKLA 3RVJA 5L9AA 3HDTA 4BGEA 1EGAA 4MINA 1RQ2A 1XZAA 2Q9AA 1WAMA 3OS1A 1KQ8A 4S1TA 3WK5A 2FPXA 2RKWA 4Y6GB 4Z9XA 4KBGA 4FW9A 3QE3A 3A1YA 5CW2A 1ORWA 1J5YA 1N2IA 1R7JA 4D81A 1U7DA 2WB4A 4K05A 3I61A 1Y1PA 2IHNA 1IONA 1FYDA 3M7GA 2ZWPA 4BXUA 2JIDA 1T8WA 3RFVA 1CRZA 1RP1A 5CEJA 4FJ0A 2X1HA 5TJ9A 4I9NA 3VDRA 1XO1A 3I12A 3PA6A 2X2EA 4HC4A 3ZYCA 2ISZA 2PD6A 4JN6B 2Q62A 4YJGB 1LNQA 2JARA 1HG0A 2RH5A 4MB6A 3NFYA 2RGEA 4BNZA 4V1CI 5AIAA 1YE3A 3OKAA 4OEHA 3L05A 2AXQA 4GOMD 4MPTA 1XRQA 4RKYA 1NHAA 4BBRJ 5AM2A 4JLPA 1NN1A 3GXBA 1W0KD 4QSMA 3AU9A 5JNSA 1GAJA 3AI2A 1IMOA 2M6KA 4N7JA 1T33A 1A2BA 4PSUA 4U0KA 5AM5A 1AKEA 4B4VA 3T41A 1ID8A 3V1NA 3TLEA 5EG0B 3U7QB 1CY1A 1E7RA 3LUFA 4ZV7A 1STZA 1Q0RA 3UR3C 2PQMA 3GRRA 5K6AC 1F8GA 1NBOA 1CETA 3CCBA 3BGOS 4RVUA 3T7RA 4QXRA 1TMYA 2XBMA 4G6ZA 4A3SA 3AUJB 4WXHA 4PN7A 3V6MA 2YY7A 3ZPLA 3KVYA 2OK7A 4IVQA 4UV9A 1XMJA 4DLTA 2JFWA 3KB2A 2TYSB 2WFZA 2VF8A 2JLCA 2W6QA 2HYIC 3BICA 1FDVA 2BE5F 1L4NA 3C3KA 2JQ7A 3FTQA 3WO0A 2CHUA 3QA3E 4V2GA 4BEJA 3GTGJ 2IJGX 1R4ZA 4GOXA 1TA0A 3K0EA 3GU3A 1N2EA 4G5QA 3U81A 3K4NA 4UHCA 3HXPA 4UUSB 2HVRA 2Z2IA 3PWKA 1M2EA 5TQ2B 2CHGA 4E6KG 1ETWA 5CIQA 2WJ4A 2VZEA 2P2GA 3I5AA 2C77A 4YRRA 1YVDA 2X8LA 3NRBA 1HKSA 1FUYB 4D3FA 5DNUA 1DMSA 1OPCA 3T1TA 1MX5A 3MMXA 1YOBA 5M29A 1EWKA 3IAM2 1QQAA 2I3BA 2JIQA 4YMSA 1Z4LA 4LXQA 2QLFA 4C3IJ 2H6BA 3LIIA 4D3SA 1X7DA 4UXIA 2ZRMA 2QIOA 4NP6A 3ASVA 4CUKA 4TVBA 5AK5A 3GNLA 4G2TA 2IPNA 1Q1NA 4P81A 1TVKA 4G67A 3LFHA 3Q11A 3FA2A 4EW3A 4HPQA 1Y5NA 3ETJA 3KOWA 3QJ5A 4OYYA 4CU2A 3HCFA 3NTRA 1ZM7A 3A11A 5HHTA 2AR0A 2PU7A 4F4DA 3A7EA 1NW7A 1MH4A 4WK8F 3FYSA 3TMYA 3I4CA 3VHQA 1TCBA 1VQ4I 3KHSA 1P18A 4BQAA 5JNRA 5HZHA 2GSWA 3G7UA 4MRNA 5IANA 5LOVF 3NT2A 4NABA 1MRNA 1JBKA 3WZMA 1NUSA 2ZIGA 1Z5GA 4ESVA 4BKXA 1GPJA 3E0QA 3ND7A 4NAVA 4R1TA 5CM2Z 5ED0A 2IDJA 1Z28A 3BHNA 4DQKA 2QUKA 5C81A 5FWXB 5JCJD 2GA9A 3D4NA 4PAQA 4B83A 2O20A 3K32A 3SEQA 5TF0A 4BVAA 4PX9A 3QU5A 2BLNA 3RVDA 2YV2A 4C4ZA 1OJ7A 2ADOA 1OROA 4FFOA 3ZH2A 1BG6A 2UV1A 4YRJA 1TE2A 1IB6A 4IJWA 1E20A 3GRKA 1ON2A 1A69A 3LSRA 5FJJA 3RSLA 5KTPA 2G8LA 1NBMD 3HFGA 4RTLA 2H6CA 1E1CA 1A88A 1X39A 3RAGA 1LK0A 3BA6A 2O06A 3WMGA 4YI3A 3QTTA 1XCBA 3OEED 2X3UA 2HQRA 4MGIR 3D3JA 4JC5A 5CVEA 3V7WA 5LA6A 1XIVA 1SG6A 1IATA 1XC5A 1JB1A 3TQHA 4UTVA 3UB3A 1N2JA 1KFCB 3JQBC 4MQ6A 4R31A 4JLJA 3LKVA 3U3MA 2IHBA 2A6PA 2GRUA 3NB0A 3L7OA 3S5JA 3WNQA 5A5DA 5KU7A 3LGSA 3UWOA 3H5VA 2M1BA 3EUKL 2P9FA 3R3ZA 3T61A 3Q6NA 4YQEA 4H7HA 3HTXA 4B5LA 3C8DA 1SBQA 4WFJA 4B71A 3HKCB 3EBLA 2QLLA 3WYEA 2CZCA 1GL6A 2IE0A 3FUUA 2DXIA 3NTXA 1EHIA 5DSZA 1A35A 2XCUA 4PFOA 4IH1A 1PEAA 3HCDA 4YJKA 1DELA 4A0SA 1PJLA 1ZGBA 2QNRA 2GBFA 2FWBA 4RAZA 2O8EB 2N1MA 1G19A 1YJ5A 4LGVA 2BCGY 3K16A 3SZGA 3DV8A 4PG5A 1T6XA 1Z17A 1MN6A 2NQTA 2IGOA 3LLCA 3QU2A 2IGNA 2AD5A 3N8DA 1I0IA 2Z5GA 4ZTUB 2JAPA 2CJWB 2L0XA 4RV4A 1GPMA 4FEGA 4HWOA 1MAAA 5FOQA 3GD7A 3KSDO 2X5OA 3BEDA 2AXNA 3OUZA 5AICA 5KWJA 5AJXA 5IT3A 1A5SB 3LFUA 1IUOA 2ZI6A 5TV2A 1ZOOA 3L18A 4NYMQ 3LSJA 4ZPJA 3EZ2A 2OTLI 1G7SA 2H1FA 3QE2A 2DLDA 1J5PA 4EPYA 4BAGA 1R0BA 3CJTA 4X93A 3OX3A 4DZRA 2W25A 3JU3A 5CA1A 3CBQA 1UFOA 5IYZB 1U28C 1VDZA 1IZ9A 1U9IA 3WWEA 4DYHA 4EV0A 4R1UA 4TUYF 4OYLA 3CF4A 4PDKA 3F7MA 1PN3A 1FOYA 2GBIA 5JLXA 2OESA 2PA0A 3C85A 1TQ8A 4PS1A 4WEOA 2NO1A 3TIFA 4GBMA 5FO1A 1XJ0A 3UUWA 1E6UA 2E55A 2HPZA 3JQ8A 1WI3A 4JUIA 2GXGA 1ELOA 3MGAA 3I5MA 1ILWA 3EGIA 2FUNB 1QFSA 1UXHA 2Q7DA 2R7AA 2AZTA 1AS0A 4ZQGA 1GGFA 2Y30A 3F7TA 5FR1A 2QORA 4F3KA 2CO5A 2DQRA 1YZKA 3VDXA 4WA7A 2ENUA 2AV6A 4OQ4A 4X7PA 3AMVA 3PKIA 2RGRA 2DMRA 1D7OA 1Z4MA 3PQ7A 1XVTA 4UB8C 2ZRGA 1W0JA 1I9GA 2HPHA 5TQ0B 5A9RA 3JWPA 1XD7A 5LP6A 1Z68A 3F6CA 4UMEA 2G40A 2KQUA 2JEOA 5IYCJ 4G07A 1JPVA 1EB8A 3VC1A 1WP4A 5DBGA 3NH6A 3PQ4A 4OKNA 1D09A 2GZMA 3FDZA 1BU5A 4I4LA 2Y0SN 3A4TA 4J0HA 3CLUC 1DLIA 3TNYA 3WL6A 4MI1A 5JXWA 5IVHA 1FT9A 2N8GA 2RREA 3ZN0A 3FZVA 2PR2A 3SFIA 5CVDA 1GZHB 1JTEA 1VF9A 1GOTA 2OMEA 2YQ4A 2PZKA 2NSLA 1JE8A 1G18A 3GEZA 3RFTA 5EI5A 3FOFC 1S7GA 5HODA 4D8YA 4E7KA 5DHUA 3ZVNA 1UP4A 1NLZA 3ONQA 4O6JA 3KYIB 4X1EA 3KYDA 1HH4A 4BN5A 4NZ9A 5LMUB 2H5IA 1T1GA 2AG6A 1XHFA 1I6WA 4NU0A 3RLIA 3ZV5A 1O0BA 1EWYA 4PSCA 2WYIA 3F5QA 1K5HA 2O7QA 2V7XA 5DTRA 4WZZA 3TOZA 5LHIA 1E1MA 3PDIB 1KI7A 2DUWA 3OI7A 1ZIDA 3CLSC 5EEAA 1TL8A 1VLJA 3B36A 4V0QA 4JJ4A 5KEIA 2EFDB 3CT4A 2G8NA 3FX3A 1ISRA 2NVUA 4MHTA 2ZMEA 4IO1A 3HWSA 4HKTA 2BFBA 4M0DA 5ELXA 4IXWA 1NJGA 4C88A 2M87A 3PFCA 1A4IA 3BY6A 3QYBA 4N49A 3FWYA 5AW8A 2WA1A 4C7JA 1UPFA 3SYTA 4FHDA 3U0VA 4J4HA 1IY2A 3MJDA 4RJLA 3BXXA 1J4AA 121PA 2D2XA 2MABA 3EASA 2AK2A 5DN6A 4RVHA 3S2WA 3MAGA 1KI8A 4WWHA 3TR0A 4M9RA 4BTEA 4FMPA 1EFDN 2I2FA 3B5EA 3RF7A 1ISIA 4WXMA 4JBGA 4LXUA 1FFYA 1SXIA 3PWSA 3Q8XB 1T5SA 3E7FA 4C4OA 3L40A 3AF3A 4RCZA 2ZQ5A 3A3YA 5EIOA 4CLRB 2NU8A 4LOJA 2W4MA 4NNJA 2RI6A 4G86A 3E3VA 3PCRB 3CTAA 3EFEA 1L9KA 4MW5A 3DFZA 3GT3A 2N46A 2HA5A 3KXLA 9ABPA 3I9OA 4E13A 1E99A 4PHGA 2ANBA 2CBGA 4LIVA 3EXEA 1SG9A 2QZJA 3PP8A 2Y69H 1HE5A 5J2UB 3OE1A 1UJ2A 3FSJX 5KJ1A 3NQOA 4IGEA 3T9DA 1QIGA 5K9ZA 2CDBA 9MHTA 2DYRH 2LW7A 1SPXA 3CZAA 4EG1A 1HW5A 5I7SA 2AUMA 2J41A 3HFSA 4QHTA 1MX3A 4ZVUA 1QYRA 2QQAA 3HRSA 3ZDXB 1OXKB 3H6KA 3H7IA 5SZJA 2EF1A 3RV4A 1L1FA 5C44J 3ZHXA 3P32A 5EJ2A 5CFOA 1HFEL 1T15A 3A6GA 1TP4A 4UEQA 4HOYA 4L51A 3U7EB 1T3GA 2ZRQA 1H0SA 3G88A 4N3NA 4UTNA 2M7AA 4YRCA 4JR2A 4OCZA 3LHIA 4YXWA 2BOLA 1F20A 3SDGA 2IGMA 4MO7A 2I5PO 2DT8A 2VP6A 1NULA 4MNUA 3BFVA 4HDQB 4YMVA 3DP9A 4KLRA 1T2FA 3GJSA 1QOQB 2I4RA 3CFYA 1CZHA 3KHKA 4UE3S 3A9CA 4X94A 1Z05A 2SKDA 3W34A 3G71I 2JJ1D 2JBWA 3RPEA 1PZFA 1W6UA 5A7HA 2MINA 5BO5A 2OZPA 1BMFA 2WRZA 3QXCA 2WU0A 5A5EA 3DDHA 1JA1A 5F7JA 1T38A 3OCXA 2VH1A 2ZO4A 1KJQA 3LV8A 4OGGA 2R6AA 2GNPA 4ZT5A 3WS7A 3ROEA 1C8BA 3LPCA 1P4AA 1R8QA 3ZBTA 4W5RA 3GLFA 4IKFA 2E4XA 4I1SA 4LJ8A 1D4OA 1QGED 1AXGA 3K0CC 2BSQA 1K5PA 5HFAA 1UHWA 2PH5A 3OQ6A 1BMQA 3JVDA 5JC1A 4PLTA 1XXLA 2DUNA 3EX7C 3EXFA 2H1CA 3P19A 4I55B 4H3KB 4YAFA 2WQZA 2DAOA 1OFUX 4W9MC 3VPFA 1JXQA 4XARA 2GN1A 3TEFA 2WIDA 3AF5A 5K7SA 3KQTA 3SX2A 4EHLA 5D86A 1ERDA 5C34B 4QXMA 2QVCA 5JASA 1FYLA 2FJPA 1FP7A 1S2NA 3QFRA 1R22A 5EOVA 4HP8A 4E0BA 4O2AF 2XIQA 3S5UA 2O9JA 1R74A 2F17A 5I7RA 1C30A 3HPGA 5LM3A 1OH7A 3HR7A 3BWCA 3THXA 1OTYA 3ZNNA 1FEZA 4RTMA 3FWEA 4LUCA 3BMOB 2ZJOA 2ON6A 3X1WA 3AL0C 1RKVA 3C3AA 2FW9A 2JVIA 3LC7O 1RAEA 1C9KA 4BYYA 2NYAA 4TRRA 1WMEA 4DMCA 1POWA 4EITA 3LUDA 1OCCH 4A1FA 5DULA 1Q5PA 2AYXA 4P7BA 2E87A 2GLXA 5D85A 2I7TA 5JZOA 3EDMA 4JB2A 3A4CA 3C3CA 1DUSA 1COZA 5FPYA 4AJHA 1GL7A 2H7XA 3B3GA 1WSBA 1NQXA 2V26A 3IAS2 2VJOA 4FHFA 1QRAA 2AXEA 3ANYB 4EI9A 2VL8A 7MHTA 3OJXA 3IBCA 3DPUA 2Y1WA 1M1UA 2FKNA 3MLEA 2BKEA 1FFBA 1YF3A 3A0HC 5JARA 5KBYA 4Q24A 4IMJB 4EYGA 3RRJA 1LFBA 1R5NA 3DUWA 2IIBA 3J81Z 4RFSB 1WB6A 1E3OC 1XKXA 3L43A 4IIGA 1YWGO 3DT9A 3OT1A 4UAVA 3JSAA 3MQ2A 2Q1ZB 3VUFA 1KDPA 3LC1O 4UAJA 3VC7A 4QASA 3WIDA 5DASA 3BD6A 3CCFA 3CNEA 3C98A 1OCRH 4G7HF 1UM9B 4UNSA 1WULS 2D1TA 3HVHA 1B16A 3ZJ5A 4MJ3A 5LQSA 1ND5A 2YWRA 5IM5A 3P2MA 1IK6A 4E30A 1X38A 4ETWA 5K3BA 2GK4A 4QUHA 2CVZA 4RSMA 3P9NA 1M7GA 1U2RA 3MTEA 4Q9NA 5KVAA 2Z99A 3DVAA 4KYTA 1M6HA 3JSPA 2GZ2A 4IWYA 1PEYA 1RRGA 1MTOA 2VNKA 4MQ9F 1DIGA 4OIPF 3AB7A 4MX8A 2COKA 4GVLA 3FCEA 1CNMA 2BYTA 1TRHA 1FEXA 4C3VA 4YJ3B 4LXIA 4M74A 3N53A 1RXUA 2ZB3A 4HY3A 2PZ8A 1BDMA 3OMWA 2CMHA 4BFWA 3ESAA 1HDZA 4IHSA 1ZISA 2QZSA 5L4SA 3C3PA 1P33A 4Q3DA 1RR6A 3RJPA 2QTBA 2AHOA 2Y0DA 2I6GA 3WWYA 1N7HA 1NHGA 4EG7A 3ZHTA 1ZYRF 2YINC 1I5OA 5ILSA 4G8DA 5TT0A 4PQEA 3CF0A 1HDRA 3CV3A 1BDIA 5BSFA 1LLCA 1NNSA 4Q9HA 4GGGA 2VZLA 4QTYA 3GLIB 2ODQA 1MNDA 4FK8A 4YXFA 1OAKA 3K31A 3ECHA 4YCAA 1ZGHA 2ZIEA 2ZZKA 3H18A 3ZVMA 1RNLA 4XN0A 3G8AA 3I0ZA 1ON1A 3ZHYA 1LVKA 5E3HA 4D0PA 3UMRA 3IPYA 2FB9A 3E7DA 5CKTA 5B1HA 2HVSA 2RC6A 1TZJA 3QWHA 1BKYA 2X0JA 2IIQA 4B6SA 1NW6A 2OCXA 1T6BY 3EDOA 4AZSA 2XE7A 2O8VA 2R6DA 3IRUA 3SI7A 2F43A 3MKWB 2BH9A 4XDHA 2NN3C 1YONA 1TW3A 1JVSA 3TEMA 3CO7C 2AX3A 1S4QA 1BJZA 3C6QA 3V1TC 2RKBA 4CF5A 3GT0A 3HP7A 4I46A 3TLJA 4KYIB 2ZIAA 1TC1A 2IW1A 1Z6GA 3L1UA 2Y1EA 1YULA 3O4RA 2O8BA 2X0FA 1SUIA 2RQPA 2YXNA 3Q3GE 4TLLB 1MG0A 4DN6A 4BUZA 3OJLA 3V1MA 4DCOA 2QN9A 3U9TA 5CT6A 2PKQP 4I99A 1T3ZA 1G4DA 5DI3B 2AJ8A 5E7JA 2LBFA 1NM5C 4WECA 2PFSA 3OWTA 3HLTA 4ZVLA 2VEDA 1IF1A 3ZGKA 1PEKE 5AKHA 1J2UA 5KJFA 3AF1A 1GR1A 5CB4F 3FUTA 3L2QA 1CY2A 2OORA 1CUUA 1YIDA 3QYFA 2ID7A 1N3BA 4XSVA 2FW0A 1Q15A 3L8HA 4YEDA 3RYRA 2V65A 3I1YA 4C4YA 3R6DA 4ITRC 4TVOA 3FYUB 3I9V2 2H4XA 3AESA 3MLAA 3SZMA 2PUJA 2DECA 3GA7A 3P9PA 2W2NA 2F64A 4HO1X 2V3VA 1PJ3A 1N4DA 4YJHA 5DGHA 2CNLA 4HBZA 1RKQA 3D6VA 4BMNA 3LK6A 4W7HA 2NU7B 4FISA 4IQFA 3OU2A 1LKZA 1AA6A 1S3GA 4HSEA 3MT7A 4CIDA 1IAWA 5K3FB 3W3CA 3N4MA 1G5PA 4OA8A 2VPRA 1LE8A 1ZOIA 3S2UA 1XMOB 1BCRA 1A9QA 3RJTA 4ZIRB 4G1MB 3BFXA 3OOWA 2HK8A 5TF4A 2ACKA 1U78A 3K9FC 1KFBB 4EHAA 2FH5B 2G70A 3ANXA 4RNCA 3K6GA 3CSSA 2PT7A 4H31A 5E1XA 1GXPA 1B3BA 2ZT7A 2WU8A 2PZBA 2Z9OA 3QA9A 2ZE7A 4K26A 3HB5X 3OPNA 2Q1TA 1I36A 3K1AA 3NYRA 3BXZA 4DEVA 3KHTA 5CGZA 2XDQB 3EGEA 4MWCA 1WMBA 3IQZA 3V8LA 3ZHSA 2VL7A 1D2GA 5H16A 2YFQA 1TEXA 2V0CA 1FTNA 4ZAVA 4OUDB 1IV6A 4YHHB 3L8EA 4CM9A 2VT7A 3VAAA 3MJTA 1IG0A 4ZYXA 4MJLA 4BBZA 1COWD 3K94A 5KX5A 3A6KA 3WMWA 3WWDA 2WWIA 1NNEA 2FPKA 4Y2QA 1WUJS 1U3DA 1U8YA 2W6OA 4K8RB 2XF5A 4FGUA 3AEKB 4Q9IA 2C4MA 1DQZA 3MS4A 2IRFG 4BKUA 5IDQA 1LFDB 3COPA 3RCBA 3VA7A 3AG1H 2DBRA 3WV5A 3AWDA 3I64A 4QJ4A 3PUFA 2CXPA 2VPYA 5DPMA 5K6TA 3AYZB 1Q0UA 1U0GA 5LXTB 1VI2A 2XCIA 3VRHA 1ITYA 1D8KA 2WF8A 2FUG2 4UHHA 4HN9A 1VI0A 3H2KA 2Z58A 2VA8A 3CCVI 1IB0A 2EW2A 1SMYF 3TL2A 4RPGA 3LKBA 3JPWA 5L3VA 5JWRA 2PT9A 4AMUA 2H06A 1S2MA 4BVHA 3N2GB 3NNNA 4KPYA 4KRYA 4DVJA 4TKVA 3WYBA 3L5KA 4V2FA 5AD1A 2HK9A 5KK1A 5BT8A 1ZONA 3R9KA 4A0ZA 3TNDA 2WJGA 2QZZA 5L3QA 3UO8B 4AU1A 2BGMA 2NAZA 2RK3A 1QVRA 2XB4A 5DKFA 2I76A 3PXBA 2ZRLA 4E4TA 1LDBA 3VDQA 3J80Z 2FBHA 1ZFNA 1EVLA 3G2QA 2P67A 2M8GX 4BLUA 2NRAC 1F0YA 1AE1A 4C06A 2F9FA 1X74A 3JRAA 1KI9A 3QWBA 4KMSA 2EWVA 4MVJP 3U4HA 2BELA 3QP5A 3ENZA 4E09A 4R8VA 1XF1A 3IUMA 4Y7DA 4JYBA 1MOQA 4P9FA 3UKJA 1IM2A 2ZXEA 3CEPB 4ZZIA 3IO5A 1W5SA 2G67A 1H88C 3R2JA 2J0UA 4NBVA 3STWA 2B37A 1BW5A 3B1FA 2OCDA 3F5DA 2WPDA 1UPTA 4JXZA 1ZL0A 1E6LA 3IUEA 3VO8A 3R3SA 1T0BA 2H65A 3TEJA 3BF8A 3CZCA 1P6RA 2IHKA 2P5YA 3GW8A 4YRPA 5CYVA 1U3TA 3S0JA 4RE6A 4EGSA 2DHQA 3BMXA 5HWSA 1Q20A 5BSHA 1E1QD 3L7YA 2B5WA 1F2UB 3W5CA 2CYYA 5B3JC 2GR9A 2TMGA 3T5PA 1LDMA 1YX3A 4FSXA 1FJXA 2BI4A 4UBJA 2WSLA 5CCXA 2FMKA 1KOJA 4YUYA 3FJYA 4BL5A 1KVTA 3EGXA 1W9MA 4ACAA 3NKVA 3HEBA 2FEKA 3LDFA 3H0GJ 1KDZA 3GUZA 2ZVJA 5BSWA 3MOGA 4DR6B 1DO2A 1H2AS 3IAM1 2I7DA 4E3ZA 2FPWA 2FR8C 3Q40A 4LY9A 4PVDA 4ZVNA 5I01A 1P2BA 3ELYA 4WNYA 1I94B 1SKYB 3H6HA 5LLDA 3SSAA 1TTPB 1WPKA 3F3MA 1UIMA 1Y0NA 2MSDB 3LX6A 1LI5A 2OM6A 3ZDQA 2ZYDA 3MTGA 2CV0A 2FR0A 3PWZA 1RQNA 4DQVA 3W5UA 5AW0A 2HSDA 3OIVA 3HYLA 2VH2A 2Z9DA 3IIEA 2IRWA 1ZU4A 1M2OA 3PFIA 3PM1A 3UMMA 3QSYA 1PAUA 4WX9A 1OHHA 2JK1A 5BSRA 4KQHA 2XGXA 4R3UC 2HDDA 3UQYS 4Z5XA 1OTXA 3BJZA 1MV8A 4M2LA 2J4CA 1OC2A 1HFWA 1I3OA 3GRUA 1YR3A 3FXQA 4HF0A 5L45A 1QK5A 3L1VA 2XGOA 3WK7A 2Q49A 3B48A 3LF2A 4NPHA 2FG6C 2R5YB 3F21A 1T4BA 1FQKA 2V5UA 3IT1A 2XCOA 5A4DA 2PH7A 5A4JA 1HYHA 3OQIB 2ZJ2A 3INGA 3UHPA 1ZW1A 5JADA 2VJJA 1JR6A 1W5FA 1X2BA 2Q9CA 3II6X 1PYGA 1SAYA 4KJXA 3PEWA 3SZUA 1NN5A 2VODA 4BKOA 3F6OA 1H0RA 2IUUA 4JA2A 2BGWA 1SBNE 4OI0A 1N75A 1SHLA 5FBKA 4DILA 2XV1A 2J9GA 3TP3A 1GPAA 5KOHB 3IVCA 4EKNB 4RTSA 2HO5A 3HQ4O 4Y3UA 2AN3A 2CV1A 1R00A 5D5QA 1EZ1A 2XVZA 4MVXA 3TH5A 4P0TA 1PJ4A 3AI7A 2JBHA 3QPDA 4CEJB 1W7PA 4TOIA 3IPXA 3TMAA 1N0UA 4ZZLA 2IUEA 2W43A 1UZMA 1SBZA 1EEHA 1HQKA 3EPKA 2DFVA 4JYKA 4N54A 2J8ZA 1I7LA 5K5OA 1LBTA 4XB1A 1QH8A 3BWVA 4DDWA 2ZAYA 1L5VA 4FMBB 2M45A 3O6BB 4A8TA 1UKEA 1X8LA 1FSSA 4PLWA 1RWXA 5A0VA 1XPJA 1Z56C 4IH9A 3KRTA 6PAXA 1RKBA 4TV7A 5HKBA 4G09A 5I3CA 2K85A 4OXNA 4QJBA 1IN8A 3S8PA 1E3DA 4FOLA 2NZXA 4CO8A 3A3NA 3E9RA 4BB6A 3BG6A 1NXWA 2QUFA 5JS1A 4G6QA 2A5GA 1N6HA 1NFFA 2G25A 3E5HA 5AVSA 2OV8A 3S16J 4P93A 4FN5A 2FHSA 3GFIA 1L3LA 2AF4C 4L28A 4FMDF 1KK2A 2QX7A 3ZCUA 4AUMA 4OIQF 4ADSG 4ZYGA 4JVMA 1X7ZA 3P2EA 3GROA 2YUTA 4AAYA 1O6FA 1W25A 4ARBA 1QQIA 4Q5SF 1EA3A 3J81K 4ZWNA 3TNLA 2QX8A 3ZRGA 1X87A 2P8TA 2JFOA 4UBOA 1MO6A 4PBSA 4OHZA 4TXNA 4NKRA 2Q1UA 3Q88A 1T24A 4NZYA 2G1AA 3QHPA 5F1PA 4FONA 1ZITA 2NUTB 2CEAA 2EBHX 3L00A 1ENHA 3LP6A 2WTAA 2ODBA 3ELWA 3MN1A 4RVNA 4DR5B 3ESXA 1IRZA 4A8PA 1VZ3A 4DR2B 4LE1A 1TX4B 3Q5DA 4F3QA 1NJ2A 4KISA 5BWBA 2CK3A 2EWNA 5A1JA 3QKIA 4FETA 3K1JA 5TRTA 1KAGA 3HVIA 5F51A 4YMLA 2C3MA 2J33A 3WOVA 2XUGA 1X80B 3WE3A 1OWMA 2Y0BA 4Y9UA 2RC5A 1JT9A 1R8YA 3AETA 5B1SA 1ECCA 1N2XA 1S6LA 1TVCA 3FZQA 2BDUA 4F7WA 3QPTA 5ALSA 2NLOA 5BN3B 3I9NA 5D6EA 2FDCA 4DABA 4DR4B 3DKRA 2QUJA 1P2UA 4ZI7A 3G2NA 3RWOA 4II3A 3ZMVA 3K53A 1EVJA 1R0ZA 4RPKA 1V7QA 2H5LA 3AW8A 1WWXA 3DJFA 2R62A 4EJ2A 4KGZA 2Z0MA 2FKAA 5K0LA 5GTDA 2IQIA 1XTRA 4ZXPA 3BTCA 3ZOBA 1S8OA 1X8KA 1GXSA 2HXOA 5IP6A 1XNQB 2YYSA 3L2RA 3VVMA 3ZZUA 3R3UA 1G16A 4FJ1A 4EKEA 1TQMA 5H3CA 3TOSA 2AQFA 3AJ8A 4BE7B 1XTBA 3R7WB 1V2HE 3EVCA 3DEWA 3GCXA 1JG3A 3OO1A 4YRSA 4ARZB 4K6GA 3UK1A 4DCVA 3V5NA 2BVMA 2NX2A 2HV9A 4DXHA 4BNIA 5DU2A 5KYVA 3F23A 4IUBS 4AECA 3T7IA 1WTCA 3LU1A 4GOLD 1ZOPA 1NP7A 5LEKA 2ZVQX 2FXVA 3GGSA 5EEHA 5ITZA 4FX5A 1M3SA 1JN0A 1HURA 4RZ3A 4ETSA 4EKDA 5IDVA 5JBIA 1YFJA 2F2EA 4LDJA 2G0TA 5CIWA 3H1TA 3COZA 4MEXF 1O7JA 1TZMA 2J3QA 4IQ4A 1D2EA 1T6YA 3WTYC 2Q41A 2O3UA 1Y81A 5IFKA 3CUTA 2Q3DA 1AGPA 5DGDA 5TPWB 4LOHA 2XOKD 4GDFA 2DT7B 5DWDA 3ZI4A 3KEOA 2STWA 2W98A 3UNXA 1I9CA 2RGVA 4CF6A 1S96A 3O3MB 2WWFA 1ZKMA 3TZQA 1J1IA 3M3PA 2ZRKA 2DPXA 3G1LA 3EGCA 4TT3D 2EFOA 3GRAA 4QWQA 1KWGA 4TYMA 3IBFA 4YMGA 4YFKF 2ECCA 4N4AA 4UQOA 2HRDA 3O74A 4MS4B 1L4YA 3FKIJ 1CR6A 4HAIA 3WLPA 1G2QA 1ZS9A 2X0LA 4AS1A 1BL0A 2NZVG 2D7DA 4HH0A 2DKFA 1Z4NA 3FZYA 1GPH1 2PMFA 3DTKA 2QNBA 4RYDA 4XMYA 1M5RA 1Z2DA 4L9JA 3EMBA 4BN0A 1D03A 4LXHA 2ONZA 1ZHHA 4HR7A 1P5HA 1ST2A 4FZ5A 2VI5A 4CR6A 4KQGA 4S1WA 4G56A 1MH3A 2EDCA 3B52X 3C6ZA 5FTLA 2K2WA 3AGPA 4AZVA 1D4FA 4Y6SA 2PKQO 4EABA 1GUYA 4P86A 3WP1B 3TW8B 3QYJA 3Q4GA 4KSBA 4Z86A 3QV1A 3GJ0A 4KUGA 3ZWVA 5EE0A 4DQUA 2R60A 3CC7I 2C96A 2KJBA 5HZGA 4YDSA 2AG0A 4CMJA 1K7SN 4N0QA 1KEVA 2X8AA 4I9UA 2OVBA 1BOAA 1UT6A 3KEMA 5A0TA 4E51A 1DGQA 5JQGA 1YKGA 2ZYVX 3D5QA 2CFTA 3GWZA 2EZIA 4ZU6X 1UZNA 2C84A 4QBIA 2MYPA 3D0QA 4GMXA 4IEIA 1W94A 3WTBA 3DNPA 1YD7A 3LYAA 5KYXA 4QD3A 4XQEA 4R01A 2XKBA 2W6IA 3IP9A 5EESA 1GV0A 1SBCA 3DQPA 3RTDA 5HDGA 1QHNA 4EG5A 1DS6A 3WYAA 5K8CA 4AKTA 1CZLA 1B15A 3TR5A 1OI3A 2JGIA 4EVIA 2P90A 3CURA 1THMA 5JZBA 2VAVA 2XWSA 4N48A 4C4AA 3PXGA 4L73A 4JCOA 5BMVB 1E2NA 1Z6XA 2QG4A 2XUQA 1BIFA 3JD2A 4MIYA 1VLLA 3I09A 1FQWA 1U3FA 1M7BA 6REQB 2PX5A 3H35A 1SUDA 4A3LJ 3B85A 4WLEA 3QXSA 1FTWA 3D6HA 3MKLA 2VP0A 5L3CA 3B6EA 3RYIB 1VE6A 4MWZA 1NDQA 1XZNA 5HMMA 4GPEA 2W4SA 4HEJA 5C2JB 3I54A 6NULA 1GG9A 1A76A 1E18A 2X9NA 2QEQA 4JT2A 3NOXA 4PPFA 1HL7A 3GRYA 2I8AA 4UUMA 2JA2A 2ISCA 3R8XA 3QU9A 1NR7A 3IYLW 4KTVE 3V8PA 5JDIC 5JJKA 3ML6A 3WGUA 2IZ1A 4G23A 3KKLA 1NKVA 1OXVA 3SCZA 5ENDA 5BOSA 4ZYVA 2WZQA 3RVQA 4OYHA 1TUBA 3G0DA 3T1NA 3IAS1 4G36A 1Z6PA 5L3GA 2HFKA 3DHYA 3IOMA 3J80K 2I1QA 4XWGA 3NPAA 3A6FA 4C6TB 4TMTA 1MAVA 2OVFA 4J16C 3PO3J 1FX1A 3H4IA 1YW8A 4AJ1A 4I7EA 3S70A 3KDAA 2VRNA 2IU3A 1ONPA 1R9NA 3CCRI 3KOXA 2QIPA 4L78A 2I6QA 1P17A 4HV6A 3ZIAA 3EZ6A 2PMUA 2YS7A 4HD8A 3KR0A 4E88A 4FZVA 1UT5A 3PUBA 2J67A 3GIDA 3H92A 2W85A 2R6ZA 4D79A 1G41A 1XJQA 3GYGA 1M6VA 5DEQA 1SVMA 1ZCBA 1TM5E 5JSKA 4MLDA 4X0EA 3ESBA 1LPOA 4CV2A 2JLWA 2PKXA 1FBUA 3PJFA 4J0QA 3FLBA 4DLZA 4XQ0A 3BRWD 5LC1A 4YACA 1AMOA 3BD7A 1WHUA 5AKYA 2R3SA 3MBIA 1E6KA 5E9JA 3AEQA 2P3QA 2H8GA 3NP7A 2RHMA 2P77A 5DWQA 1CUDA 4CG2A 4TXJA 4HDNA 5MN5A 3WG9A 4NU8X 1WXEA 5GZ6A 1U2GA 1LRJA 1OT3A 2VJCA 3PJDA 1Z4KA 1YKSA 5IBQA 5ISMA 1X7WA 3VPGA 3SYMA 3AVWA 3QVWA 2NO6A 3S7ZA 3U16A 3DTVB 2EJUA 5FI1B 2YZNA 3WTTC 2X4DA 2BBOA 3OQ1A 1UAAA 4RKQA 4IIFA 1L4UA 1WLSA 3ER8A 2YWEA 1YZGA 2UYCA 1LDJA 3EUHA 4XSZF 2R6R1 3HKEA 4GMKA 3KD2A 1XEXA 1KDTA 2C8VA 3BN3A 1RZUA 1K98A 1DP3A 2P8SA 1VYHA 2IHZA 1XDSA 1KU6A 3GLHE 1TIKA 4IUCS 4LG3A 4JI6B 3PGKA 2V9KA 2ZPAA 4ITUA 1O4WA 2IOHA 2XRYA 2EP8A 4LOAA 3GW2A 2LRHA 4AN1A 3DM5A 5JTTA 2EIKH 1UJBA 3IEMA 4QU0A 2ZJYA 3KQWA 4L76A 1JHMA 4IJKA 3TW6A 2WSBA 4DT1A 4I1YA 3BAFA 4AO8A 4F6RA 4XVRA 1QCDA 2WJPA 2E6KA 3D7KA 5JI6A 5C53B 1G3RA 3THYA 4M6WB 1UJ4A 3R5JA 4QOFA 3TUJC 4FGZA 4R8SA 3G1TA 2C1ZA 4DIQA 5J4YA 1Q16A 2JAXA 1UPXA 3DTIA 3IOEA 4X7BA 2ELHA 1HW2A 2A1UB 5C5CA 3I92A 3WNVA 5FNVB 5MDHA 4RJ2A 4HNHA 3RRXA 2C61A 1KIFA 1YB6A 4MQMA 1Z67A 1K7FB 1RYMA 4C4SA 1ZWKA 3WK9A 4ESEA 2ONKA 3BZWA 3HKZN 1VE7A 4P34A 1ECFA 1JZTA 3LRTA 3DV9A 4IGIA 1XCLA 1NYLA 2FN7A 2YIMA 4DGSA 4OAZA 3GBSA 1FS5A 1Z15A 3UJAA 3HEAA 3U39A 4MYCA 3FSGD 1I33A 2G9VA 4D3DA 3I9V1 3DV2A 1A95A 3RU7A 3HCAA 3I4NJ 3IP6A 4EJFA 2XCLA 4TQAA 2RKOA 3I9JA 5DLPA 5CBKA 2QGFA 4JK1X 3M8JA 1V8ZA 3AUYA 3SX0A 1CF4A 5EMMA 4K2HA 4IYRA 1D4ZA 1Y9AA 5F2EA 3MD0A 1A9XB 4J1TA 2XCTB 2V3WA 2NPFA 1X7XA 4JXXA 2QPLA 1T3TA 2YYZA 5DBIA 5HDQA 2JN6A 3TAUA 4NMHA 3AYXB 2X19A 3AL0B 2B9SA 1BX1A 2OTJI 1YI2I 2C5SA 2TRTA 1JMYA 1A96A 1D8AA 2AI2A 1OXTA 4C7KA 1RWWA 4L07A 2KZVA 1PLLA 1MVNA 3SVZA 1XZQA 1GG8A 1MZPA 1IJEA 2ZYAA 2JI7A 4BQOA 1C7ZA 1ZVJA 3BTLA 2JI8A 1JA9A 3INNA 4DV6B 3ODGA 2UYHA 2HDNB 2CXOA 1TB4A 1OAAA 2PH3A 1YL5A 2CVFA 1TQ4A 1PG0A 3OIOA 2XZOA 3QNUA 1AIPA 1PQYA 5FOUA 2G63A 5EUMA 5M34A 1UELB 3EPLA 3HUDA 5GM1A 3FXOA 1LXCA 3OFJA 4GGPA 5DT2A 3I5XA 5HS4A 1XEWX 3AEUA 2CLMB 4P0QB 4ZJZA 3PGJA 5CYOA 4UDYX 1KSGA 1U5TB 3TSYA 3E4CA 4YP1A 4RHEA 5HW0A 1DHRA 4TWJA 1N8TA 4CT0A 3GEIA 3MM4A 5HM8A 5ARDA 4HSRA 4E5VA 9ATCA 5D5WB 2NPOA 4TS4A 1URPA 2EKQA 3IH3A 4R40A 4B75A 5KVRA 4FR2A 1T0JB 2IVFA 3S3TA 1KSJA 4RK0A 3P4UA 1NOIA 5FROA 2OPTA 5K3SA 1XMAA 2P9GA 3CB4A 3LLMA 2EIXA 3TM4A 3IH5A 2ZBFA 4UCXA 2BM8A 1FMWA 1GN9A 1A7UA 2XODA 2K9SA 5BQ3A 4P5OA 4Z4CA 2FUG1 2XD9A 1Y8AA 2JBAB 4ETIA 4UTXA 2UVPA 1CQJB 4E6EA 1XGOA 4G1CA 1H2HA 3B51X 3QY0A 4B3FX 3WOHA 2PX3A 1GQQA 3TQOA 3X2QH 4RLFA 1WQ1R 4DYVA 2CXXA 4E4YA 4TWIA 2ZS9A 4LRQA 2VBCA 4L0MA 3DHWC 5EZ6B 3CB2A 3LG2A 4DYRA 3HABA 1ZEJA 1DIRA 1RXSA 5JY1A 4TUYA 4UJ5A 3HUGA 2O8DA 1QF9A 4OHWA 1LFUP 4ZAZA 1E1LA 3IBTA 3OICA 4IEJA 4UREA 2CDNA 4MW4A 4X8LA 2CJJA 5JYBA 2GN8A 1L5ZA 5DGIA 4N3CA 1O96A 3D9QX 2DR0A 4MQ5A 4AJKA 7YASA 4BXOA 3FFWA 2BFOA 1E5TA 2LBPA 4N5MA 1E79D 4LECA 4Q3BA 5E38A 1H5NA 4PUSA 4Q93A 3PNOA 2JAUA 1QAMA 2YS6A 4QOEA 4LNAA 2VJPA 4ZYZA 1QOPB 4U5QA 3MKZA 4NZPA 4KK3A 4N01A 4MGHA 3H04A 3SC4A 5KWIA 5I8WA 1DPGA 2H31A 5K8UA 3HL4A 4WZBB 5HG0A 4PSXA 2PZAA 1BIBA 3I1JA 1ISJA 4NAHA 3COWA 2BDTA 1ZIYA 3RIGA 3EVNA 4TQUS 2VJBA 4L6IA 1DC4A 4GWGA 1LLFA 2WLTA 1SA0A 1XXHA 5J2TB 2JF0A 1E4EB 3OX2A 1DAHA 3IQWA 1PS8A 1CY6A 4MS1B 2OWEA 1BROA 1X3ZB 3E9ZA 3TTVA 4N5LA 4FFSA 2DA3A 1WPGA 2GCIA 3ZHZA 1ODJA 2C7PA 1XVLA 1U7HA 2E19A 4BU0A 4WCGA 3FPCA 2OGWA 3VPCA 2XWQA 1ZLKA 1B0PA 2OHJA 5EJEA 3TINA 4RA9B 3VAZA 1NW8A 1FU4A 2VEOA 4W5HA 1QMGA 2CL0X 4C6HA 4YUZA 4PGHA 4XDZA 4LDNA 1ECJA 2Q5FA 2P2SA 4CXFA 2ISYA 2HBQA 2FGKA 3WICA 2QMHA 2RI0A 3C5VA 1KYZA 2Q2VA 4XPZA 4QGBA 2MD0A 1O54A 4M0EA 1VL8A 3CF2A 2F3SA 5AVYA 4FT8A 4IHJF 2MSKA 2LKSA 3PUJA 1VE3A 5EIEA 2HF7A 4Q3OA 2L54A 2ZSDA 2GRAA 4HB3A 2YFHA 3V2HA 1OU0A 1GIAA 1SAXA 3WADA 4BNTA 2AUTA 3LHFA 1GL9B 3GCMA 4GC5A 1FFGA 4IHAA 2HT6A 1MMGA 2FW8A 1DX9A 2GBLA 3W9UA 3PTAA 2RGBA 4G1EB 3MJSA 2UZAA 3QHAA 5ALLA 1X4OA 4EO9A 1KHHA 4ZREA 5I9LA 2O57A 4LHYA 2VLBA 3RDPA 1T8RA 3AU8A 5C1OA 4PBRA 3DBRB 2MSEB 5C18A 1I6KA 3AT1A 1T8PA 2FG7C 1P19A 3HJCA 3NBQA 2IYFA 1KQPA 1P4GA 3WQBA 5K20A 2C58A 1IBMB 4MUIA 1HSJA 1FP1D 3RIRA 2PRSA 3BR1A 1S9DA 4RNDB 3ZDFA 4HGRA 2XH8A 1GAEO 4MUKA 1RBMA 4Y2GA 1NWCA 4G9BA 3RV3A 1VSTA 1UPBA 5AIPA 1BRTA 1X77A 3AB8A 5KSPA 3R7NA 2LVBA 1KO8A 4MAFA 5E6RB 1ZH4A 4UHFA 3OZSA 2QR2A 3QX3A 1DBIA 3VNSA 4Q82A 3P7MA 4YJFA 5GGYA 4TSFA 3AIIA 1VB5A 4YCMA 3KR1A 5FTKA 3OL3A 1R27A 4EUFA 1YU6A 3OKFA 3V00A 1DJLA 5EZ5A 3G6WA 3RYHA 3SGLA 3J81k 4AXXA 4NCHA 1QHHB 3C3EA 1ISSA 3EEFA 5A02A 4PXAA 4YYEA 1IPHA 8ATCA 3CX4A 1R4NA 5AYVA 5CM9C 3U7RA 5JHHB 2HZDA 3NKLA 5AHWA 4IDFA 2VKQA 1CQZA 1NMQA 4DQ0A 1M10A 5KSYA 4DNXA 2FZ4A 1WXXA 2IXBA 4Q3EA 2IOQA 1YK1A 1MTZA 4RD2A 2PXXA 3GOHA 5AW7A 3FCCA 3FY4A 4CYMA 4WFIA 3SP1A 1TCUA 1E9CA 2NYUA 4JMPA 4AYXA 3T9EA 3DZHA 4F86A 4LXXA 5J9FA 1IGNA 3OFND 2EA4A 3PD1A 4KZKA 1JS1X 1L4FA 2B2XA 2PKCA 5FJIA 2XKOA 1G8SA 1TUGA 2MA3A 1G8FA 4DLRA 4ZANA 1U7TA 2BGLA 2FZVA 3T7JA 2HNKA 3GJ4A 3I58A 5L8VA 2I4MA 1AGYA 1LNSA 4Q37A 1OR7A 1T5BA 2WJ3A 3UAGA 3HKBA 2OQRA 1JW9B 1OUMA 1AUPA 1ZGAA 1VQMI 3NNDA 4FMCF 1JFFA 1UHSA 4IHQA 4LRUA 4MJ7A 2Y1DA 4KMFA 1IHYA 1ADBA 3KOUA 2CHQA 1E5QA 1EXVA 4KGDA 2RGNC 2EINH 5B7NA 3IULA 3KZZA 3UMSA 3VV2A 3ASYA 3G68A 3ACCA 3GMTA 4TQGA 2D3WA 1UBFA 2O7RA 5C8XA 2VPXA 3WK4A 4AMYA 2IKQA 3BOQA 4FTWA 2PRZA 1FP2A 3IHUA 4MYSA 1OX4B 4TWAA 1C1HA 4JEHA 4ZO4A 3A6DA 4O2AA 2C8KA 4DMMA 2A9FA 2VIIA 4YCNA 4F2PA 2Q21A 4ZQEA 3BIFA 1LSUA 1IIRA 1DTEA 3CX3A 1JHXA 3MINA 3AHGA 4W99A 4MZXA 2GCPA 1ACJA 1WRJA 3IEKA 5DJ5A 3NWTA 5KB3A 4B6PA 4QUEA 5DS9A 2FPGB 3DDWA 4M0CA 1Z77A 4OQMA 1QIFA 1V9SA 3EVDA 5JVDF 1T26A 2FR1A 1XRMA 1OFVA 4AVZA 5HKKD 3SLRA 2G07A 2PYDA 4MGEA 4NDAA 5FTWA 3IPCA 1DBVO 3VTKA 1AQUA 3VR3A 2GTHA 1APBA 1V7CA 2P2ZA 1EK0A 4FM9A 4KX5A 5I47A 3IELA 3AP1A 3W2VA 3ORQA 1Q50A 1N92A 5AUPB 3DUFA 3AG4H 3RUIA 5FLMJ 5C8DA 4GNKA 1JQDA 3CVUA 2DMPA 4V0RA 2BMJA 4KR0A 2QTMA 1RIIA 3TKYA 1EIZA 2IGKA 3F4BA 3HRIA 2XSDC 2J5XA 1YVEI 4L3WA 2AQEA 1AHNA 1VPVA 3IVAA 1RQRA 3R40A 3VWBA 3QOXA 2X8BA 3RG8A 1NPTO 1GQYA 3O3CA 1EPUA 3SLGA 1CZUA 4IH4A 2GI4A 4A10A 4WXCA 1ZH2A 4FLFA 2WY2D 3OESA 1YZUA 3K5PA 2AMJA 4CT5A 2DSTA 4BDZA 2F67A 5CPFA 4JC8A 2FMUA 3H4MA 2BEUA 2A30A 3MFQA 4TL8A 4PR0A 1OI2A 4I01A 3T15A 4QECA 4HQ0A 2J7PD 5KTRA 4AVYA 2ME0A 1V55H 4G4GA 4V0ME 1RC0A 2P5VA 1DEXA 3QVKA 2WWRA 3PUVA 4JITA 1V3FA 2ZAOA 1K5DA 3COAC 1XVUA 4MCAA 3Q10A 2OD5A 1WUTA 1AB5A 1NG6A 2PGJA 1X7YA 1JLLA 2FN3A 4A4DA 2X4IA 1BFUA 1M1XB 4I3HA 3G5LA 2TMYA 1GGEA 4OREX 3WYGA 2PMCA 2J5BA 4WDQA 4D6XA 3AIKA 5MFPA 1JDSA 2D0DA 2HZBA 1E2XA 3P2IA 3FBWA 4V3BA 1N7GA 3K8QA 4AVPA 1WUYA 3DOHA 2YTZA 2C2MA 4ZD6A 2EBIA 3ACBA 3RJZA 3UMGA 1MORA 4IGAA 1K3FA 3AKCA 3M4JA 4U4AA 4L0QA 1J07A 1KDYA 4YLGA 5JROA 2B5OA 2Q4OA 2HRQA 4DREA 2LD5A 2BAGA 4WOCA 2XASA 4KR2A 3A01B 4DSTA 4Q01A 1OKKA 2DPLA 1R6AA 2RQQA 2A2ZA 4PAOA 4D7AA 2NU9B 3LGXA 1AXEA 1ZAKA 2FF5A 3DAOA 1C9YA 4LJSA 4YS6A 2FEZA 3G0BA 4RMGA 3MJFA 1W59A 2QM3A 5BNTA 1BJTA 3G9UA 3FMPB 3CO5A 2UXCB 4DV2B 3LX5A 4KIWA 3EA0A 3ZU2A 1RHQA 1WJGA 2K4MA 3FDXA 1E2BA 2SECE 4A0XA 3GPBA 1VFPA 4Y2RA 1K68A 1MNQA 3ZH9B 3GBGA 1CR4A 5DM4A 1ULHA 4XR9A 3E9NA 3VH2A 5IC6A 4OH7A 1R4AA 2AL7A 3GB9A 3U17A 5LQKA 5DYTA 1W5TA 2ZS7A 1DQUA 1IJKA 2C5AA 3BBPA 4HAWA 4MRSA 4OB6A 5F7ZA 1TD1A 4W82A 4DWOA 1K2VN 1V16B 3KHUA 2ZXWH 4OHYA 5FRNA 4JBYA 1KAHA 4G89A 3NJRA 5AOCA 3FI9A 5F77A 5FKLA 1RWBA 4GXNA 4AIRA 3WC4A 3DGFC 2Q8QA 1KKMA 1ESEA 5L3RA 3SS9X 3DXXA 5CB4A 3D2BA 3OECA 1U99A 4RVSA 1MRZA 3W04A 1OAOA 1X8JA 3CLHA 5EIWA 3E70C 1BM9A 5E8GA 3N5CA 4EGYA 2HC9A 3TYXA 4QQ8A 4AZ3A 5ICCA 3LOCA 3VU3A 3R5XA 1Z5VA 4CQMB 1AY0A 4LF6B 2F00A 3I1FA 4O4IB 3MMSA 4UEWA 2E4AA 4P92A 5KYTA 2L9RA 2IYWA 7REQB 5D5HA 2W2KB 3LIPA 5KAPA 4JBXA 3NAQA 3NBZC 1MB3A 4AC9A 5G2OA 2REQA 3K6SA 4MXDA 5ESXA 1QUEA 3OUTA 1OLXB 5KYKA 3WB9A 1VG1A 2HRBA 3AFIA 4QT4A 4LBZA 1X8XA 1JSLA 1GVDA 1E2MA 3VR5A 3EF0A 3BJRA 4FYWA 2RAPA 3BCBA 2LF7A 2JAOA