1R00A

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-homocysteine (sah)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r00A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r00A03
1EAMA 2DT5A 2BH2A 4GCVA 1MJFA 3FPJA 1BHJA 2FF4A 3M8EA 1YTYA 5DRTA 1I5ZA 2OB1A 1J9IA 3GRZA 4FS8A 2CG4A 2H6BA 4XRFA 4HX8A 4PCLA 5T64A 5DM1A 3UA3A 1UIRA 2Q0OA 3CBGA 1S7AA 2FBKA 3WG9A 3UJBA 2P3OA 3A7DA 3IL2A 3R0AA 4U7BA 2NYUA 4OIQF 3BKXA 2BEOA 5LLQA 3WE2A 2ZIGA 5ICFA 2HR3A 3CKKA 2PX4A 2W84A 2UYCA 3HOSA 2HZTA 2VP3A 3UJAA 2XRNA 1P2FA 1QBJA 4KVZA 2XAJA 3ZMVA 1R5HA 2O06A 1R1UA 3V8VA 3AXTA 1WXWA 3BWBA 3UA4A 3KP4A 3JSPA 3GFLA 4OOIA 4DKJA 2EFQA 2WA2A 4WXCA 1ZARA 1XGNA 5K5QA 4X61A 5L3BA 4UXNA 4LG0B 1XSXA 4C08A 1H9TA 2PLYA 4ON0A 4EKGA 1B6AA 2ZNZA 2P4WA 4CTKA 1H1DA 4ESJA 4HF0A 1U5TB 2K4BA 3J80Z 4N0BA 4LLGF 1XDZA 3CDHA 2I9KA 1QAMA 3I0TA 3LDUA 4XLPF 4GYIA 4ZYEA 5E17F 3F6VA 3WTSC 4ESBA 5K0NA 4C04A 4QWQA 3T5XA 1KYWA 2AOVA 4ATNA 3FX3A 3G2QA 3WGHA 2IFTA 5BPIA 4KYWA 2IW5A 3NWEA 1VBFA 4G7ZF 4N9HA 3FRHA 3OU6A 5DTQA 5FTWA 3R61A 3G89A 3I5UA 1FLIA 3MZYA 5EKUA 4LG1A 3RDIA 1PDNC 3LA2A 1K7AA 1DUXC 1ZLKA 4HQMA 3JTHA 4HA8A 2OKCA 3KETA 3BGDA 2YXDA 3HUGA 2DPMA 3ZMDA 4O3MA 1SFXA 3E05A 2F5CA 1FP1D 1JR4A 3EDPA 5DSXA 2EA4A 4O5VA 2GPYA 1NBHA 5HOOA 2EV6A 1RI7A 2KRFA 2ELHA 1YS7A 2V79A 1HSTA 3HRMA 2RKHA 1HMYA 3KP7A 3E6CC 2AXLA 3GFJA 1BC5A 3I71A 5ILSA 3JAMK 2F2EA 3D5LA 3IKVA 3V7SA 2UYOA 3ELDA 3FZGA 3TM4A 2PX2A 2V6CA 4K6MA 2NAZA 4YUXA 2F8LA 3UJCA 3ME5A 3HTUA 1MKMA 4AZWA 3FF5A 1I1SA 1G6NA 3ML6A 1IN5A 2OBFA 4R8HA 4IV8A 3IWFA 5FA8A 4A0YA 4MEXF 4EQZA 4RAZA 3MTIA 2KKOA 3MHTA 2W85A 2M30A 4FZVA 5E18F 2X0LA 3Q9SA 2PBIA 3M1EA 3U2RA 2CWWA 3CVOA 1IN8A 4AZSA 5K0LA 4UVAA 2WTEA 4L18B 4E2XA 4IRHA 4YV1A 3K2ZA 3GFMA 2GB4A 1G3TA 2LKPA 3EMDA 3QRFF 1SQFA 2GQQA 4HX4A 4KNYA 4EV0A 2PWYA 3E6BA 1OYWA 1YG2A 1Q0SA 3ECHA 1FSEA 3FHZA 1V39A 4CGZA 3F21A 2YTZA 2QQ9A 2XKOA 2DQLA 1LJ9A 3P9NA 2DFIA 4EMSA 4KRGA 2DW4A 1NV9A 4H0NA 1IY9A 2QUFA 4M73A 3BPXA 4PDKA 3WODF 1K78A 1FYKA 1QANA 4RVFA 3NEUA 3BXOA 3GDHA 4G56A 2HTSA 2CKDA 4EJWA 4F85A 2LD4A 2PXAA 2VDVE 1SFEA 4LD5A 3RKYA 2QE6A 4XUEA 2YPRA 4G7HF 3KU1A 1CF7B 5GIPE 1HKQA 1P39A 2K02A 3Q7EA 1SUIA 3Q5FA 2IGTA 2GLUA 1K6OA 2GWRA 4I2OA 5KS2A 4M9ZA 3L9FA 3EVEA 4BLWA 2UYQA 5BS6A 4BQAA 3B02A 2Y1XA 1FZPB 4OBWA 1LEAA 2V1UA 2ZULA 4FHTA 5JVTA 3GRRA 1TTYA 4L0ZB 3OFJA 3FUXA 4MTLA 3GUDA 4Y13A 1ZG5A 5D6EA 1STZA 3FYDA 1G8SA 1L0OC 4RGUA 4EM0B 2XYQA 3TLJA 4CXFA 3TDUC 3TO6A 3E5QA 3WGIA 4WXHA 5EGSA 4AIJA 3C6KA 2DI3A 3R0JA 3TOSA 3KFWX 5JI6A 5E8RA 1ZH5A 2PWPA 2FSWA 5D5WB 5FQNA 3DUWA 3P9CA 4G8XA 3BJAA 5BPDA 2H27A 4HV5A 2P7IA 3PX2A 3QOWA 1WSUA 3K6RA 2IPXA 2FE3A 3GIWA 3HCFA 2ESRA 1IN6A 4OQDA 2LSOA 5GINE 4ESFA 2STWA 2XHKA 2FCAA 4RTSA 1Q0TA 1EJ0A 2STTA 2EX4A 3KQVA 4RTOA 2YXEA 5A2QZ 3SXYA 5DM4A 1VTNC 3EGVA 3EEYA 2K7LA 2PXXA 1TQIA 2RGVA 1ZRCA 4HH4A 2KJBA 3DULA 1ZQ9A 1HW1A 2VE8A 3MERA 3OE4A 4X60A 3SQNA 3JAMZ 1YLFA 3R6SA 3M33A 2GZWA 4EQQA 4C07A 4MHGA 1U2ZA 3BP8A 4B8XA 1L3CA 2OO3A 2QQAA 4IPAA 1BBYA 3TMAA 3L09A 4ZH4F 3AY0A 1P1CA 4ZYHA 3V8JA 3DFGA 2D1VA 2Z6AA 4XBFA 1KA8A 1ON1A 4KWCA 3AXSA 3KP6A 1RJDA 2JZYA 4FT8A 2RDPA 3LL7A 4YUVA 5IT9K 1M6YA 2O03A 1R7JA 4Y15A 3ABUA 2CGPA 2CW0F 2ESHA 3LHDA 3BJ6A 1SMTA 4FR0A 1E2XA 4UUVA 5P8WA 3FTDA 3O31A 3CC8A 5CM2Z 4OA5A 2P41A 5HIIA 2L4MA 2FMLA 1MJAA 1UHMA 2YX7A 1EH6A 3FM5A 1HNNA 1JSZA 5EG5A 4V0QA 1IF1A 2PXCA 4MTDA 5CVRA 3J81K 3I59A 3UJDA 2AN5A 3KQSA 5D1NA 3F3XA 5EZSA 2FA5A 2HOEA 1KIAA 4MQ4A 4WK8F 1XDSA 3UJ8A 2FMYA 2OBPA 3EYIA 3C0KA 2L4AA 3LWFA 2ZXJA 2EFOA 2ZMEA 3HM2A 1INLA 1JSXA 3LKZA 5BW4A 3JWIA 1O7FA 3PQKA 1FBUA 5LQKA 1OR7A 2ESNA 2Q8KA 4NQWA 4QDJA 1KU9A 5HVQC 1MDMB 3P9KA 4KMUX 3KEQA 2VXZA 3WGGA 3ZMZA 2M45A 1EIZA 3KP3A 2HS5A 2Z3YA 2Z33A 4LG0A 2I62A 5E1MA 3IYLW 3MCTA 5FHRA 5B1SA 3H3UA 2AZTA 3BWCA 2KW5A 3BDDA 5F2NA 1FYMA 1U3EM 2ZZKA 3DP7A 3TDZC 1VQ1A 2P5LC 3WTUC 3VSEA 3HTXA 3BGVA 2IIPA 3KCCA 2IH2A 5KK1A 1IXKA 5GIOE 3GLXA 1UFMA 4XUDA 3A25A 2ZZMA 5BP7A 3JWHA 5GP1A 1YO5C 3QPHA 4IRGA 1OYIA 2PG4A 2Z99A 4L5JA 2A69F 2AVNA 4PIPA 1NT2A 2DULA 4KIGA 2CL5A 5DM2A 3ELWA 3G8AA 2B2CA 4XSXF 5LEJA 3KHKA 3HNRA 4OX9Y 1BJAA 1V4RA 2NNYA 2QRVB 4IXAA 4MNUA 1FNNA 2UZKA 1L3IA 1MHTA 3CUQB 3E97A 3UBTA 1S8NA 1J0RA 3BROA 3L7WA 5DCMA 4EJUA 2PJPA 1QAQA 1AQIA 2ZLBA 2EFWA 5CVVA 3QOPA 3ZPLA 3ERED 2A6EF 2LF8A 2JH9A 1VP9A 2C7OA 2GH1A 4RGXA 3CO6C 4LLLA 1JE8A 3MQ2A 3IHUA 5KQSA 4HQEA 2OA4A 4E2YA 2H94A 3S68A 2EV5A 1YW7A 1F5TA 1R22A 3KPUA 3C3YA 3BGIA 3OPNA 2M5WA 4FSDA 1EQAA 4YFNF 1HKTA 1B42A 4YG2F 1YB2A 4LWPA 3HVIA 3C3PA 1T0FA 1XJ5A 3AAFA 3RYRA 4BHPA 3GYHX 2P8TA 4GYGA 5ILVA 1I6XA 2VBZA 1TW2A 5LRSA 4GOMD 5DLYA 4YUWA 5GWXA 5DXAA 5K0FA 2F5DA 1Z05A 3CUOA 3HRTA 3CJNA 2N47A 3LCVB 2PJDA 5DX8A 1NW3A 1BI1A 2C6YA 3HVJA 4OA8A 4RB1A 1MZBA 1IRFA 2FNPA 4XLNF 1PP7U 5M5BA 3WTWC 2GAUA 3PFHA 4LECA 3B5IA 4YMHA 1UFKA 2ONZA 3FTCA 4CTJA 4L7VA 4Y2HA 3HVKA 1MJBA 2VBWA 1D5VA 2L3DA 2UZ4A 1EH7A 1I4WA 5E1ZB 1B4AA 1YW9A 2EA2A 2W24A 2FRXA 2VN2A 2F5EA 4IHSA 3M6WA 3MQ0A 3KP2A 5HIKA 3GEZA 1RJGA 1Z91A 2A6HF 3KR9A 2MD5A 2FK8A 1XGOA 3PX3A 4M9XA 5LQRA 3GF2A 3EPPA 2PX8A 4ZZLA 2QYOA 1FSHA 4F84A 2C7RA 1MDMA 4M9SA 2EB7A 3KR0A 3DXYA 1VL5A 1X19A 4AVPA 3LAJA 1WXXA 1U5TA 4GEKA 4R6XA 4KN4X 4GO1A 4UVBA 5EKXA 5LHGA 3RYPA 1JG2A 4A0ZA 3K69A 1BC7C 3G73A 4UV8A 1TBXA 2MH2A 2AN3A 3FMQA 1BKYA 4AZTA 2XIGA 4GUAA 1R00A 4HGZA 4RV9A 4E2WA 3CJRA 3C7JA 3T8TA 1W5SA 4PYNA 4JQFA 3B3FA 5L3EA 3WU1B 2M1BA 4U7PB 3DEUA 3I64A 1KGSA 3GWZA 2NXEA 3ZMSA 4ZYGA 3BWGA 5EHIA 3EUHA 4UHTA 5CYVA 2QZ8A 3A7EA 2ZO4A 4QDKA 2ZBPA 1WKMA 1S7OA 1ZRDA 3E7PA 3TGNA 1GVJA 5FB2A 3KQOA 1R8YA 4IWNA 5JR3A 1YQAA 1DPRA 1SKMA 2LF7A 2ZBQA 3J80K 7MHTA 3QU3A 1G55A 3ECOA 4LJZF 5CCXA 1XMAA 4QTUB 4KICA 1T2KA 4PONA 4POOA 2AOWA 1KP9A 2IBTA 2HTJA 2WWYA 2OU2A 2G71A 1CGPA 5HDKA 2OB2A 1OKRA 1KU7A 1NHAA 5TRDA 2B3TA 1EG2A 3R0QA 3P9IA 5DYMA 3LCCA 2CQKA 4RS8A 3IWZA 2ACJA 5DUKA 1G60A 4PYLA 2CWEA 2ZBRA 3F23A 2CMHA 1P6RA 3HTSB 3OCJA 2O0LA 2VT3A 2FBHA 3NDIA 3LA3A 2YU3A 3LGAA 1X1AA 3ZN1A 2JHPA 1SMYF 2TDXA 5K5RA 1Q1HA 1G6Q1 4CYDA 4QTTB 4EJOA 3EVBA 3HHHA 4BNCA 1TW3A 2G72A 4DQ0A 2AS5F 3JWJA 3PS9A 4HRAA 1BIAA 1R8XA 3KQMA 2AN4A 3DLCA 1ZRFA 5IT3A 1TQMA 4P9FA 2DK8A 4IVNA 1RI1A 3BOQA 1IN4A 4RVHA 5LHHA 1KYZA 1R5GA 3LKDA 3LA7A 5T67A 2AS0A 5E1XA 3IHTA 3BY6A 1JGSA 3G5TA 3C6MA 4MQVA 2ZSUA 3IKTA 4HSGA 3G2PA 4A12A 4I98B 5GOZA 3KQYA 3VB2A 1HKSA 2A5YB 4HTFA 5E8GA 1D2GA 1IXRC 4RB0A 1SG9A 4E30A 1XTPA 2VC0A 1KHHA 2OZUA 5BOXA 1ZKDA 5CVIA 4RGRA 2LDUA 1QGPA 3M8FA 4B09A 3DH0A 3LSTA 3I9FA 3DMHA 3KP5A 2HWKA 3FPHA 1Z3CA 1MJ9A 2RVCA 4K2EA 3KPJA 3FXQA 1SQGA 3WTVC 1JG1A 3HA3A 3LDFA 2R3SA 2JPCA 3SHFA 2NYXA 4R1HA 3SZTA 1TQPA 1XB4A 2OY0A 1JG3A 2ETHA 3J7AO 4CWAA 5FWAA 6PAXA 5K09A 2FBIA 3DPTA 1KXZA 4M38A 2YR0A 1YS6A 1SUSA 3FUTA 3HEMA 1ZGJA 4U88A 3I58A 3RTRA 4RB3C 1RJFA 4PYIA 2Y1WA 2AR0A 4RB2C 4FP9A 3PQJA 5EIFA 3JSOA 1MGTA 5FFXA 5E9WA 3RKWA 4DA4A 5EMKA 1F38A 5FHQA 1IXSB 1I1GA 2A14A 2G7HA 2BM9A 3NRVA 4PINA 4PYKA 1TNSA 3CTAA 3M6UA 5KQRA 4HZFA 5K01A 3GGDA 1JTFA 4WWCA 2IRFG 2ZMEB 4LK0F 2DTRA 3S2WA 3DLIA 3U81A 1YF3A 3QP6A 5D4RA 4HDVA 4P7JA 3VEPA 5DPMA 1Z7UA 3GW2A 4AD9A 4RTQA 1IW7F 4HV6A 4QVGA 5EC8A 1D3YA 4L9VA 4U7DA 5E1OA 4DNCA 2BZGA 2P1DA 2VC1A 5ICCA 3LAPA 1ZAOA 3ORHA 2BGCA 4HW0A 5LGNA 2IT0A 3FPGA 3TRKA 3FXRA 3BT7A 1FJXA 1KQ8A 1HQCA 3W6KB 3U9GA 3OZTA 2K4MA 2NXJA 2L02A 2M8EA 3DQVC 3LQRA 4RX1A 1X1DA 3O6BB 5BQTA 2DU9A 3DV8A 1ZYRF 4I09A 4ZTBA 5KVRA 1T98A 5E1BA 1QQIA 2P3LA 5DSTA 5CJ9A 4ENNA 2ZFUA 2AOTA 2FPOA 4EJVA 4A5MA 1A04A 4I0AA 2YR2A 5DDGA 1F4KA 3OU7A 4GF5A 2PGXA 3GJYA 5FFZA 2E7XA 3K1NA 3E5UA 4KDCA 3SSNA 4DM3A 2P3QA 1MD0A 4KIFA 5CLSA 1USSA 5E20A 4O29A 2PFBA 3P2KA 3FRIA 3DKWA 5U4XA 4YUYA 3HHGA 4MTEA 4LGWA 1LB2A 3X0DA 2PT9A 1AV6A 5JFRA 1G3SA 4OU0A 1T39A 4RVGA 1PUEE 4G6DA 5DX1A 3SM3A 1SFUA 1BOOA 5LQUA 2HDCA 1EJ6A 2VZ9A 4IV0A 5F6FA 3LCUA 5FADA 4RTLA 3KEOA 3ISPA 1XVAA 1WG8A 5ERIA 2HYGD 2EFJA 1XGSA 2RNJA 4BLVA 2FRHA 4HAMA 5ERGB 2IDJA 3N4MA 5HIMA 1RNLA 1D8JA 2H11A 4ER3A 5LQJA 1P92A 2VBYA 3IV6A 1OMIA 1Z1DA 1SD7A 2YUIA 2F5FA 3HA5A 3CUQC 3P7NA 5DUIA 4ENMA 3IRRA 4X1OA 2IBSA 3KZZA 1BM9A 4OINF 3GFIA 2DK5A 4I01A 3L2CA 3PFGA 3T7TA 5FGMA 3BKWA 1LNWA 3SX0A 3Q87B 1K79A 5DX0A 5FD5A 1IM8A 2YVLA 1BC8C 5A2QK 3T1BA 5FULA 2IPQX 5F64A 4YFKF 4P7FA 3ZMUA 3ROUA 4Q4ZF 1U6GA 1W5TA 1RUOA 3FUUA 1BIBA 5HDGA 2VE9A 5F2KA 5DWQA 2BR4A 3KLNA 1W7PD 2K86A 2HR1A 1WI9A 4X41A 5CVJA 1NKVA 4OBXA 2ZCWA 1YFJA 2ADMA 4OIOF 4C05A 2P35A 4NHJA 3B7PA 2KJCA 3LECA 1QZZA 1R36A 2XYRA 3BJOA 2ONYA 4UNOA 3MWMA 3RIEA 1E17A 2FOKA 2XKPA 1X1BA 4Y30A 2J5PA 4M37A 3HCDA 2G9WA 2JT1A 3J81Z 3BWYA 5CVUA 3DMFA 1BI0A 3HRUA 4FX0A 2EJTA 2E1NA 5L3CA 1BN5A 4AZVA 1YZ3A 2GS9A 5C1IA 1AWCA 4KUMA 4BH9A 3HCCA 2IA0A 3F8MA 2ISZA 2BYVE 4CZZA 4M74A 3MB5A 1N7JA 4OQEA 4EVIA 1FOKA 2IA2A 3WU0A 3P97A 3QAHA 1FT9A 2NP7A 1HBXG 2BE5F 2UXNA 2O57A 2Q41A 2PMUA 3TO7A 5FD6A 3F8CA 1YIOA 4I02A 2XVMA 1SVUA 1GHCA 4ZYDA 4E32A 5BW5A 2PMHA 3VYWA 4LB5A 2A07F 4M7RA 4E33A 1U5TC 5EEGA 2AOXA 4EM1A 3KPYA 2Z6UA 3E6DA 4PCQA 4C03A 5HZMA 1R58A 4KIBA 4Z2YA 2FNAA 1GXPA 1OYYA 1QYRA 4CICA 2HTEA 5D6FA 4HF2A 4CKBA 3C1DA 1IRGA 4F86A 5J8CA 3HP7A 2BM8A 4M36A 5H20A 4WVLA 2BV6A 1R1TA 5DTRA 2C7QA 3SSOA 4IHTA 1DCTA 3KPVA 4LFUA 1O54A 3OZRA 4AUKA 5EMMA 4ENJA 5EPEA 2CYYA 2PBFA 2RC4A 1J5YA 3O2PE 2Z6QA 2E1CA 4GC5A 4ER0A 4G7OF 1TLHB 2HQRA 3T0YA 2B25A 1XCVA 1ZHFA 3HA7A 3LPMA 1YFHA 3MZHA 1ON2A 3KR1A 5FWDA 2VT2A 3AWIA 2O05A 3IC7A 2P7VB 2GXBA 3NVMB 4KW7A 3DOUA 5D5VB 1G4DA 4NECA 2R7FA 4GGGA 4GOLD 4GOND 2L54A 3UJ7A 3CUQA 3O7WA 2D1HA 3KQWA 3SMQA 3TKAA 5ICGA 3SR4A 2NXCA 4QLCU 3I53A 4HG2A 3TOBA 3HCBA 1TPYA 3UWPA 4OMYA 5D1HA 4DMGA 3THRA 1WQ2A 1DP7P 2HGCA 3COAC 4M6YA 2L01A 2OZVA 1I1NA 3T7SA 3CLOA 1SAXA 4JK1X 4IKPA 3B3GA 4DF3A 4GXOA 4RSRA 4QPPA 3G88A 2XROA 4TV7A 4Q47A 1EH8A 2G8NA 3NQOA 3I59B 4HX7A 3FUWA 3FM3A 2LNBA 5DV5A 1NE2A 4RTKA 1LEBA 1T6SA 1FC3A 5G02A 2WC2A 4EJTA 2JHAA 3FTFA 4F7ZA 4UOEA 2VONA 1D8KA 1YYVA 3F8BA 3KQQA 5LQAA 3WTXC 4P5OA 2P5VA 2ZIEA 5E9JA 4PZJA 4OIPF 1M0EA 3M9AA 1P1BA 2MC3A 2PQ8A 3M70A 3THSA 3EVZA 3CGGA 4CKEA 2O6GE 2VDWA 4CKCA 3F22A 1JG4A 4EK9A 1X3UA 2H09A 2Y0MA 5D4SA 5LRRA 5J8FA 2H6CA 3ZN0A 2VS1A 2HYFA 3VFZA 1W7PB 4DCGA 4A0XA 2JG3A 1EV7A 5EOVA 4I7HA 1G3WA 3FZVA 3EVFA 5DM0A 1DDNA 3M6VA 2JRTA 3RW9A 3V7CA 4HTFB 3PVCA 4LWOA 4WXDA 2E7WA 4IJAA 2HMYB 4FX4A 3G8BA 5K0CA 4U0WA 3LDGA 1VPTA 3GO5A 1JHFA 2NNNA 1AF7A 5CD1A 2O61A 4MWZA 2CSOA 2UWMA 4HLYA 5CVDA 2RQPA 1KPGA 3E8SA 3HSEA 5TJJA 2BBYA 5K8VA 1XCJA 4QQKA 3WTYC 2WV0A 5FA5A 1XDUA 1LDDA 5LR6A 3WSTA 4UV9A 4V0RA 1P4AA 5LBQA 1XXLA 3SGLA 1G3YA 4G94A 3TQNA 2UYHA 2NP6A 2FXAA 4ZZDA 1RI4A 5FLXK 5EIWA 4QPNA 2XAGA 2E5WA 2QRVA 1R23A 3MGGA 4OIRF 2XAHA 2DLLA 3RI4A 2AOUB 4MIKA 3SFZA 3G2OA 4PYOA 5HIJA 3EVAA 3TFWA 3A26A 4MEYF 1WS6A 2B78A 2QLZA 4BY9E 1N7IA 1P4XA 1BI3A 2OQGA 2DO7A 4ISCA 1BOAA 4QQNA 3C18A 4YFXF 4P9UA 2V9VA 3GVAA 5GM1A 2DAOA 2R7DA 3O3KA 4ASNA 3R6TA 4JXJA 4DCMA 2IJLA 5H02A 3DXJF 2COMA 3P2IA 5IKMA 3GZ5A 2HFHA 5DD4A 2XASA 5K0EA 2O8XA 2QQBA 4JBAA 1FWZA 1F1ZA 1B59A 4IRIA 5EMJA 5JUWA 3DF8A 4FT4A 4D0PA 1VLMA 2VDUE 3T0IA 4YIIA 5E1DA 5DCMB 3EQLF 2PI0A 2AVDA 3EEOA 1H0MA 1HW5A 3NW9A 5HS7A 2DPDA 2JH8A 3DMGA 3LBYA 3OZSA 4EGYA 2PSSA 3FXUA 4YIFA 1O3SA 3GRVA 3UJ9A 1XD7A 2ZZNA 5K0GA 2ZWVA 2HKOA 4NB5A 1R1VA 1YUBA 2ISYA 2OAZA 3P8ZA 3KPWA 3ER9A 5EQJB 2QENA 4AIHA 4FSXA 2B0LA 5DD8A 4WCGA 4CXMA 2EK5A 5D8LB 5EHGA 3GCZA 2G1PA 1QNTA 3ID6C 3P71T 1FBQA 1UB9A 1JQEA 2ZCJA 4C06A 2NS0A 4BYYA 2GAFA 1W4MA 1J75A 2EG5A 3ANXA 2K4JA 1KR5A 4H0EA 1L1EA 3BZ6A 3IRQA 5L3FA 4P7GA 1D2HA 2Y75A 4RGSA 2G70A 2I7CA 5C9ZA 3H92A 4FT2A 3KLOA 4P55A 2GA9A 4Y17A 4IF4A 3RIRA 2OZ6A 2YX1A 10MHA 1LDKB 2FYTA 1J7KA 5HS9A 3UZUA 2ZWAA 3V8LA 2PT6A 1D2CA 4HGYA 1ZGAA 2IH4A 4M6XA 5K0BA 3M4XA 1F3LA 1RJEA 4KN7X 1PP8F 2C7PA 4A6DA 1UCRA 1PJZA 4YMGA 2IP2A 3B73A 4S05A 3MFKA 4AWXB 4E70A 2D2WA 4ER5A 1FBSA 3ABTA 2AOUA 4M71A 1IUYA 2P40A 5ILUA 1ZLJA 4LK1F 1K78B 3E23A 3QV2A 4B17A 1XN7A 3F8FA 2JHCA 1QPMA 5L3DA 4A5NA 4MQ9F 4R8RA 2ERCA 1FY7A 1NW5A 3SVZA 5K03A 4HYEA 1O9GA 4CHUA 3CO7C 2QBYB 2NXNA 4RTJA 2ZTHA 9MHTA 4LB6B 2ZW9A 2Z5UA 4BAYA 3K1MA 1ZN2A 4HOBA 3FPEA 2XYVA 2VODA 4U0VA 4KA4A 3KR2A 3RPQA 1U8RA 5DTMA 2P8JA 1JQDA 5D5UB 2XGXA 2XBMA 3NWBA 2ORED 4GBED 4KDPA 2KIUA 4ETSA 1I27A 5IH3A 4R05A 2IH5A 2ZBKA 2CO5A 5BMZA 3R3HA 1NV8A 3K1PA 5HILA 3UJ6A 2A3SA 1WZNA 1T38A 4EKIA 4A2UA 4Q5SF 2PV0A 2Y48A 4O6JA 1ZREA 3LFKA 1O57A 4M72A 2QM3A 3OFKA 2CMGA 2O07A 3PT9A 1NBIA 3EGIA 2A68F 1KQ0A 5K0JA 4RTMA 3GRUA 1J2XA 1SD5A 5HLGA 4I0BA 1X1CA 2HEOA 5AIQA 4R6WA 3TM5A 3RJPA 2V74B 5CVEA 5DEQA 4AX8A 4N9IA 1O7LA 2FHPA 3EGEA 3I54A 2DBBA 4U0YA 1L3LA 4RVDA 2V7EA 5DRYA 4R79A 1L3BA 1RI2A 3BZBA 1WY7A 1DUSA 4L9JA 2MLGA 3P2EA 2IA1A 3GX4X 5HLIA 5HLHA 2QVOA 4LMYA 2NNWB 4ER7A 3C3WA 5LSAA 2RN7A 3KQTA 3IEIA 1P4WA 3WTZA 1YFLA 3V7RA 1I9GA 2DQRA 5EZQA 3UFBA 1OPCA 4C4AA 2P6SA 2P6TA 3EVCA 5EMLA 5FUBA 3WE3A 3ER8A 2YX4A 1ODDA 2ZVJA 4FGZA 5H6RA 4HF1A 2GIVA 2W57A 5D8KB 5FCDA 3TQSA 2PN6A 3DR5A 5IT9Z 3ELKA 3K0LA 3FMRA 3W6JB 4BLUA 3F4KA 2HWVA 1S29A 2X4HA 2PX5A 1ZG1A 5E1WA 5BXYA 4PYJA 3KE2A 3R24A 3NMUF 4BP1A 5K1YA 1J59A 3BWMA 1W7PA 1REPC 1HXDA 3LBFA 3F8NA 3EVGA 3EYYA 3OV8A 2ZJ2A 4PGHA 3JWGA 4GC9A 4E2ZA 1LVAA 4GOOD 1OR8A 3PFIA 1AOYA 5LGTA 1R74A 1XCLA 1RIOH 4BHCA 2FQ3A 3HRSA 3FTEA 3LX6A 1NW7A 3RODA 3NDJA 2XAQA 3D0SA 3MAGA 4BXUA 5CIYA 3K9TA 3KZYA 4GQBA 2DPUA 4RWZA 3FPFA 2EJRA 2YSRA 4MHTA 4RTPA 1N2XA 4DZRA 3EVDA 3PB3A 3MCZA 2OD5A 2XVCA 5K05A 1KPHA 1VE3A 3L8DA 1RI5A 4L5IA 4PYMA 2M87A 5CUQA 1XMKA 5KVAA 1JHHA 1XGMA 4XCXA 2PEXA 4RAYA 5DT2A 1KU2A 5T6BA 1O9HA 5ED4A 4S04A 4PCAA 2ZNYA 3FYCA 2IVMA 5F1RA 2JSCA 3F72A 2QY6A 4HBLA 3VODA 2XAFA 3DXZA 2PY6A 2FK7A 1FX7A 2WA1A 1IXCA 3VC2A 4HLXA 4KDRA 5HFJA 3PTAA 3HSFA 3G5LA 4R8SA 5E8IA 1IAWA 4HDUA 4WF2A 2VOPA 3Q9VA 3E5XA 3TO9A 1YZHA 3CJTA 4PWYA 2O3FA 1B9MA 3VOEA 4P58A 1T43A 1O3RA 2ZFWA 4HC4A 3MAJA 1XSDA 2EFPA 3GU3A 1KU3A 3D2LA 1ORIA 1R6AA 3FWEA 2Z9OA 4PIMA 1RI3A 3QP5A 2J5OA 1JXSA 1DPUA 3RKXA 2MA3A 1QAOA 3G3ZA 1Z6RA 5FLXZ 5LEKA 5CCBA 4U7TB 1QZYA 3QU6A 3ERCA 2O0YA 1USTA 1B9NA 2P7CB 1ONVA 4A6EA 4RTNA 1P91A 2OYRA 2P7HA 3TPZA 3REOA 2XUBA 8MHTA 5E2AA 1FPQA 5ICEA 3RPUA 2Q2EA 1G8AA 1IZ1A 5F2OA 3FMSA 4WX9A 3R9XB 1ULYA 1SD6A 3TR6A 3H3ZA 3I4PA 4EM2A 3ELYA 1NW6A 2WK1A 1FYLA 3BPVA 2RV8A 1Z9CA 5E9QA 2A61A 3DXXA 2VBXA 1QO0D 3G7UA 2BR5A 2KIMA 3T7RA 4LLNA 3JW4A 3ZMTA 3G2MA 4PYQA 2MLKA 1NW8A 2AOTB 3SSMA 1ZG3A 1VIDA 3SXJA 4XSZF 3TKYA 2GA1A 4EGZA 4CO8A 5C0OE 3EMBA 5E8JA 4X63A 5D5XB 2G7UA 2EWNA 1O3TA 3LQQA 1JQ3A 3NJRA 1VP3A 5E2BA 1O3QA 2IDKA 3U1DA 1R18A 4ER6A 1FBNA 4KT5C 1RUNA 4YV2A 3GNLA 1Y8CA 4MGRA 3V97A 4BP3A 3OOPA 3QOXA 2PVCA 3HVHA 2OQRA 2B9EA 1H9GA 3ZQ7A 5LHIA 3R60A 2VOOA 4P96A 5HDNA 2R6ZA 3CJQA 3QPTA 4Q48A 4G9YA 4XUCA 4PGGA 3HOTA 1Y0UA 1YW8A 4ENKA 1TNTA 3OU2A 1F9NA 2ZKZA 3M7GA 1M6EX 1CF7A 3MTEA 1AQJA 3NVKI 3KKZA 3NTVA 2CFXA 1RZ4A 5K5OA 4L0YB 2HQNA 2HNKA 2FEZA 2MBFA 3B89A 4QVKA 2YQZA 3H2BA 5H6QA 2ZIFA 2GA2A 3KQPA 5KYGA 3L00A 3AJDA 2KIFA 3FUVA 5MHTA 1XCBA 5AONA 2JJQA 2BR3A 5LQCA 4RTRA 4BHBA 2H00A 3DTNA 5HOQA 3HCEA 3OE5A 2W25A 2D45A 3V8KA 5GM2A 4CDGA 3JTGA 5J6XA 3R4KA 1V3FA 3K0BA 1BI2A 4YV0A 1S6LA 1HSJA 5L3GA 4L9TA 2EFNA 1Z6TA 3T8RA 1S3JA 3GZ6A 2QWWA 4L9NA 2HV9A 1U78A 2UXXA 2ADUA 2HKXA 2PLWA 2OPBA 1HW2A 2YXLA 3E3VA 3F6OA 3HCAA 4OMZA 1LQ1A 1GXQA 4P7KA 4DQ2A 3B3JA 1ORHA 3TOAA 2XV4S 3DPLC 2MH9A 2V1XA 2P5KA 1KQ9A 4KMFA 5HEKA 5LQNA 2K27A 1WWXA 3V4GA 3M6XA 5LGUA 2GXGA 1JTEA 4E31A 3PLAE 2FU4A 5EVJA 2NRAC 1IN7A 5EEHA 3ZP5A 1LDJA 3O4FA 5FO5A 4G6QA 5HS8A 5AIPA 3HIFA 3GO4A 3GRYA 5DXJA 3ULQB 2XVAA 1XSVA 1WRJA 4RYLA 2JTVA 1U2WA 3SZPA 3CCFA 3N97A 1UHWA 4PNEA 1FP2A 1SD4A 2JPBA 3WTTC 2V1DA 5JHUA 4YUZA 1UWVA 4AIKA 1B1BA 1DL5A 2PKWA 1C0WA 3HYIA 5DCFA 5FQOA 2QBYA 2EV0A 3ELUA 3BUSA 1PRYA 3GXOA 3A27A 1KPIA 2EJUA 1G38A 3HSRA 4KFCA 3E6MA 3MEXA 3A4TA 1L9KA 2H1RA 2I6GA 2OXTA 3EETA 3VC1A 4UVCA
chains in the Genus database with same CATH superfamily
3B3QA 2DC1A 5B7PA 2G04A 3OS2A 4LCEA 3IQZA 3LBAA 2ONJA 2LY1A 3I23A 1Y48E 1YCGA 1MJFA 2Y30A 1STOA 2QLTA 4NATA 2VDJA 3M8EA 5HVNA 5DRTA 4YO7A 4YP1A 4ZRMA 2BMDA 5IDQA 1VCOA 4HNGA 5JCJA 5KTNA 2OTLI 1LS6A 4XRFA 1JEOA 2ZJ8A 3G49A 4MQBA 4FN5A 4WK6A 1X4OA 3H8JA 2HU2A 3UA3A 4CM3A 5EE1A 3CBGA 4MWBA 5BSKA 2FBKA 1SHJA 1U8ZA 4M54A 2EJBA 2P3OA 2QI9F 3A7DA 4M53A 4ZU6X 4ZYTA 1MMAA 3IL2A 4LYAA 3R0AA 4U7BA 5F7ZA 2L19A 1LPPA 2JAPA 5F33A 3QE9Y 4D7NA 1FBTA 1U7UA 4AWXA 1JIQA 2VRCA 4CQMD 5FEUA 4NK4A 3WE2A 4ICIA 2JLAA 1Q1NA 2OO5A 1M76A 4KV9A 2AEJA 3NTLA 1CLUA 3DDHA 3PUJA 2HR3A 3JWEA 3PKIA 2W84A 2QX6A 2ZE5A 2UYCA 4Q9KA 2ZXHA 2QTWB 4CLEA 1Z77A 3AUKA 3K1TA 3UQYS 2DAPA 2BFEA 3OT1A 4KGDA 5FUVA 4KVZA 2HQOA 2XAJA 1R5HA 4ZTFA 4YBZA 4LRXA 2OK7A 3RC2A 3H2JA 1VRCA 1PV4A 2RCNA 3BWBA 1YO6A 4BB6A 3K09C 3KP4A 1LX6A 3FUCA 1ML3A 4ZCSA 3QYPA 2VCEA 1RBYA 3HNOA 5GZ1A 1LX7A 1NZFA 1PE0A 1PVVA 2AUMA 4Z3KA 1WNTA 1NMXA 2HLDD 3BJZA 4WXCA 3DCFA 2PMZA 4X1IB 4GSYA 4BVKA 1HNWB 2OM6A 5AJTA 4TYNA 3DDOA 3GBSA 5L3BA 3VC3A 1TJ3A 4LG0B 2QVZX 1XSXA 4B8YA 1NYTA 2VBFA 2PLYA 4NBTA 1Z3IX 2AFRA 1G18A 4AF7A 1B6AA 4URHA 4G26A 5I5EA 4J7AA 2PUBA 1TT7A 2IEBA 4ESJA 4C2UA 3GAAA 1OBCA 1VBKA 2ZBFA 4JASB 3I92A 1U5TB 3CUYA 4AKEA 2AJBA 3FCXA 4LLGF 1XDZA 3N0TA 3N86A 2HSJA 4PW0A 2VJOA 3ONNA 3I0TA 3LDUA 4ED9A 3VDRA 2WLSA 1SXGA 4I81A 5E3OA 2DXIA 4LOHA 4ZYEA 4IX9A 1K7XB 5B1HA 5CLJA 3WTSC 1REQB 2BMVA 3C3CA 2BEVB 2ME0A 1ETOA 1Z8DA 1EFCA 4MKGA 4EDFA 2ZM5A 3T5XA 1XDGA 2OL4A 1KYWA 4XXHA 2Q4BA 4HDOB 3RGWS 3ZV7A 4B3JA 2GX6A 4HYYA 3VV2A 5L4SA 1QH8B 4PO9A 3BE5A 2SKDA 5CIQA 3EBPA 1ZTRA 1ZIXA 2AOVA 3CMYA 2D0PB 2C9CA 2X77A 3UCXA 4ATNA 1GZSA 4JBGA 1NJFA 4Q3OA 4TL6A 3U3RA 5IJXA 5B3JC 1V8OA 2WYOA 3LUKA 5A4DA 2R6DA 1PVOA 1VBFA 5F51A 4J0IA 2P2SA 3KD2A 4AJ2A 1EP3B 4LQLA 4TQUS 4AL4A 5JPCA 4H35A 2J3QA 3ZD8A 3ABKH 1HYEA 2VF5X 3G89A 3I5UA 1Y98A 3A1DA 4ND8B 3WMEA 5BPFA 1OFVA 1UC5B 1A8IA 2GXUA 4CMHA 1Z0XA 2VJCA 1H5UA 3GNSA 1LZKA 3AEYA 1D4FA 3GDOA 2HJRA 3Q3IA 4FFBB 3UBMA 4UXJA 4E1AA 3RVPA 4BASA 3AILA 3ACBA 5J2TF 2G1UA 3TZKA 1YA4A 1RXIA 4BO8A 1YHYA 1J06A 2KRCA 2CNOA 4G5SA 3JTHA 2JLCA 1LVUA 3CUKA 3QHAA 3TW4A 1FNSA 4MV0A 2QEXI 2HK7A 4CEJA 1D3AA 3BG6A 1GPNA 1M74A 1UMDB 2J6CA 2WW8A 4O4JB 4AJ4A 4TWBA 4B31A 5DYIA 3IV7A 4YNBA 4EY6A 1RJ9B 2FPIA 4UM8B 1P9RA 3HOXJ 3QNWA 2HJVA 1E6KA 4KIUA 3EXEA 4CUGA 4EG4A 3ZMDA 4JDUA 1S3IA 1TAHA 1VL0A 1SFXA 5HNFA 2PYIA 3CRRA 3LP8A 1Z12A 3PUWA 4XKJA 3EDPA 1OC2A 4AWAA 2EA4A 2DT6A 2O9JA 3TUJC 9LDBA 1GIAA 3IPAA 2EINH 5COQA 3RH0A 4DM7A 4H3SA 4BX2A 2GN6A 4EUNA 4L07A 5B3JA 1BYIA 2V65A 3ZCVA 3LTEA 2OUMA 5FWYB 3WVNA 4XYLA 3SN6A 1UPXA 4C0XA 1MH3A 2JKVA 2X4DA 4F8YA 3HR7A 3E6CC 1QRRA 3A3NA 1DC8A 4EEFG 4HNAB 4M0KA 5DGTA 3R76A 2BGKA 2BMWA 2D7DA 2KT0A 3BTVA 1DAFA 4B7XA 4D1YA 1RWBA 2NT4A 3CWCA 1U02A 1ACMA 1ZUHA 2C94A 3H0KA 5A3VA 3SLKA 2V7QA 5ALUA 1TZKA 3I5MA 3O8HA 5ILSA 2IVZA 3QYFA 1JFRA 4BVFA 3V7SA 1S72I 3EGWA 4MJ3A 5K2MA 4L4UA 4CVNA 1GPLA 3C6ZA 3FCEA 4S1NA 4A8JB 3D6VA 2O2SA 2JVHA 4G1FA 3UICA 2YQ4A 2ETVA 4EEXA 3Q0EA 3UJCA 5H8WA 2OFPA 3NHWA 5L3RA 3K1AA 3ODGA 4R1SA 3OCYA 5U4QA 1QRTA 2PRKA 1ESEA 3HTUA 1RQ7A 4D2IA 1IHYA 1I1SA 3DT9A 1IIRA 2YQ5A 1E61A 4HRYA 1RAIA 4C3VA 4EHBA 3SQWA 1FZTA 2VF7A 5B4UA 4R8HA 2O48X 2R7AA 5BSFA 1IXYA 5A7FA 5HXAA 2EP7A 2ZBEA 3BL6A 2JNWA 4EQZA 3MTIA 5BW5A 3KXDA 4KFSA 3G0HA 2M30A 3C5HA 2Y9YA 1XZNA 5E18F 2FR0A 3DZ8A 4H9GA 2PBIA 2H57A 3EA4A 2R92J 4TYQA 3CU5A 4WPGA 3O03A 4Y9SA 3FWPA 3U2RA 2CWWA 1WJAA 5DBIA 3RRMA 2HL6A 5JY1A 4DR4B 4YBRA 1IN8A 3GLIB 3SR3A 4LRYA 4X1YA 1RPTA 2CE2X 4O8CA 2UKDA 3H2ZA 1AM4D 2B8TA 3I6IA 3IT2A 3K6JA 1Y8QB 1EWVA 4I9FA 3WGUA 5JFOA 3HVUA 5K8IA 1MBZA 2PBLA 3DL0A 3K2ZA 1XLUA 3HMQA 3L7OA 4HEA6 1G3TA 4ZJZA 4YMUA 1WETA 2YC4C 3S14J 3IP7A 1EI9A 5J5VA 5B7NA 1H1TA 1T2FA 1PP4A 3B12A 5FFNA 1IHDA 3ZU2A 4KL8S 5KYWA 3QX3A 1X80B 3AKZA 1R6UA 2EG9A 1NVDA 3OYCA 1Z39A 2UYGA 2VTVA 2ZJ7A 4JC5A 4R0MA 2GQQA 2W4SA 3OURA 1D1AA 3U7RA 1BA3A 3FYUC 5EG0A 3U1KA 3AP3A 3FDZB 3RYFA 1R6XA 2XF2A 2AYZA 2NU8A 1GCOA 3MD9A 5CB8A 3ECHA 1ITZA 2XGCA 1E1YA 1OA0A 1FSEA 3FHZA 5IY5H 2AI3A 2AXPA 3OSFA 2QP4A 4PV7A 3F21A 3AEKB 3TG2A 2AQFA 3SEQA 4UVEA 4ZVNA 2XTJA 3LUFA 2PSDA 1Z7GA 4L9SA 3WYAA 2QQ9A 3ZGKA 1MHTA 1KEEA 3CCSI 2J87A 4ZREA 2DQLA 1XRMA 2GM3A 3ZCUA 4ECAA 5CB4B 2XVYA 1BS1A 1U80A 1YB5A 1U3TA 3EUAA 2GRJA 1LDMA 3CNBA 4GR9A 2AC4A 2BY4A 4K6CA 3ZH2A 3RAJA 4ONEA 5C3MA 2BKLA 2JVKA 2Q5EA 4RKQA 3S7ZA 3WWYA 3TDMA 3DFMA 2BEJA 2K9LA 4ALKA 2NACA 3KYCA 4HGNA 3C2GA 1WZEA 1L5LA 2ECPA 1W59A 1JJ8C 3KEFA 3KKEA 3M6LA 4GR5A 4IHJF 1QANA 1QIMA 5TMEA 1UZMA 1WRBA 3BFVA 3ZWOA 2RHJA 3MRSA 2G63A 1WOYA 1F17A 6LDHA 2AH5A 4ZYLA 1IUNA 4EJWA 5CT9A 3FSJX 4F85A 3L7AA 1ZI8A 5D6OA 1Y9ZA 4DKXA 2GM5A 2O3JA 5TT1A 3OYEA 3AQ4A 2C84A 3MCWA 4DDMA 3KZIC 5DM60 1EESA 4LD5A 1KJYA 1HE1C 1XS9A 1SC1A 3AKCA 3OWOA 4UARA 1LB1B 2FJ0A 3I42A 2IGMA 1EFLA 4G7HF 3IBCA 3KKMA 4LI0A 4M1WA 2JEYA 4UAGA 2RJNA 5IS2A 3RF6A 3OX1A 3Q7PA 1G9TA 1YQUA 4PFJA 2BC9A 4P3KA 5F73A 3DL4A 4YHHB 1SUIA 2AUTA 2IGTA 5AHKA 2GLUA 1TIPA 3L0DA 2QD1A 5BMVB 3SDSA 3LNTA 1N6NA 3BXHA 3H9UA 5KS2A 1XNGA 4LSMA 5AI6A 2LK2A 4P0TA 3EVEA 2GJKA 2FFAA 2DMQA 5J4YA 2VN8A 2WICA 5BS6A 4BQAA 1EQ2A 4AYTA 1TYAE 1W9MA 1CQZA 5WRFA 4OLAA 1P60A 1LEAA 1LPOA 2V1UA 2OESA 1P1RA 1RKQA 2ZULA 5KQRA 5DK6A 4G1BA 1YI8A 3E8MA 4HT3B 2BJWA 4LZWA 4L0ZB 2QUZA 3LC2O 4CSWA 4HAOA 4HDMB 1DAPA 1YDMA 4KZKA 1R0SA 4MTLA 3Q1KA 5T6MA 5K4GA 3DEWA 3GUDA 4Y13A 1M0WA 1FYFA 1FNBA 4KITB 2DUJA 1RW4A 2NSYA 4OQQA 4AWBA 4H60A 1BVRA 1UBKS 5DBOA 4Z7QB 2LCQA 3U5TA 1G8SA 2NUPB 4IHWA 1W52X 2VJ5A 3L7NA 3W4KA 1Q1ZA 5IYZB 1PJRA 1L0OC 3TLJA 4XPIB 1D4ZA 4E4YA 5KNDA 2GOMA 1VNDA 4NPHA 4DUGD 5BORA 2VYQA 2C8VA 5EGSA 4JT9A 1NN0A 1RWPA 2B7BA 1G98A 4P4LA 3BMQB 2DI3A 5HSGA 3NOVA 1RQRA 1FIUA 5T4EA 1HOTA 2I3BA 1KAEA 2PZBA 2YINC 2NPFA 4QT4A 4RXTA 3VR4A 1RKXA 2FSWA 5D5WB 1XG5A 2OKGA 1HE2A 5FQNA 5IK2D 1S9DA 3DUWA 1W0UA 1BD4A 4E1VA 3P9CA 2WF8A 3U4HA 4IUDS 3BJAA 3CSSA 1WCYA 3M49A 3FOWA 1S89A 5FORA 2DTDA 1XL1A 4IIJB 2AQEA 2ZRBA 2Q7OE 4Q7QA 3KC2A 5KZMB 1V5GA 1W5EA 2JIZD 4IUCS 4X95A 4L57A 3ROMA 3PWZA 1S01A 2IYLD 3O90A 4K9DA 1GNRA 1TO6A 4TKUA 4HNTA 2HPMA 3NAMA 4HLQB 2G7MC 2I8LA 3RHFA 1KZ9A 4U2EA 3SI7A 4XM2A 1MEJA 5JD6A 4DQDA 4KLNA 5U1PA 4OO3A 1KRHA 3JRAA 4RTSA 4IRXA 4PLGA 4C2TA 3UPTA 4O1MA 3ZCQA 2NVUA 4DAEA 5IYBJ 2N1MA 3THWB 1T8RA 4Z4FA 4RGYA 3CLSC 1OLSB 4YJ2B 3UXMA 3SXYA 3ED1A 2ODEA 4CTNA 3KQLA 3EEYA 4QARA 2K7LA 1FF9A 3H9GA 3MYYA 4R1TA 1ZRCA 4LZOA 4CLDA 5LP6B 2X0IA 2CSXA 3MZ0A 3DMRA 1HW1A 1T5IA 1YASA 2IKQA 4I6EA 1QIJA 4I99A 2YWCA 2K9MA 3OR2C 2ZI7A 5A4KA 4O2BF 3OLWA 4JMLA 1CUEA 2W8BB 2GK7A 4ISBA 3Q3EA 4JMPA 4M3NA 4Y7DA 5AESA 5J4VA 1HDXA 4YP0A 5H80A 3ENVA 4QREA 5J59A 4MAAA 1SA0B 1L3CA 4N5MA 4GKJB 1WH7A 2E5NA 1FTWA 3BQ9A 4YQYA 5JEDA 2CH0A 1KWKA 4BGVA 1BBYA 4QFMA 2C5AA 1XF9A 3ABZA 1AN9A 4Z3OA 1Z74A 5AKEA 5E9AA 5EZGA 2NO1A 3AY0A 4J4BA 5FR1A 4ZYHA 2OGWA 4G65A 3ZVMA 3LPCA 2PLNA 3DFGA 4U5XA 2PAFA 2Z6AA 5JNRA 5F9HA 4KXNA 2IIBA 4XFJA 1Z18A 3U4IA 1TMGE 4XBFA 1GNVA 1OE0A 1QQ5A 1OKKD 2PU5A 3T7CA 4G8BA 4A8HA 3IERA 2X85A 3MWKA 1E9CA 5CDTA 3B60A 4CM1A 2RHMA 2X9LA 1XELA 3RFCA 3WL7A 4FT8A 1UR5A 2CFIA 1KYTA 4CQNA 5FDFA 1RJWA 4PTZA 4DWWA 1CY2A 2P2YA 2ZQYA 3B1WA 5HKKA 2J9FB 3DOJA 2O03A 4Y15A 2NLOA 3KJQA 3KTAA 3NTRA 5LDGA 3ABUA 3RNOA 4CMKA 1Z29A 1U2PA 3PRHA 1PIWA 1DHTA 2H8KA 1KZHA 4JJEA 4M8IA 1TC2A 3INTA 4TLBA 5HBRA 1T9BA 2ERYA 1E2XA 2UAGA 3AUSA 3L01A 4IIVA 1V5EA 1K2VN 1A2KC 1L4KA 4FR2A 2O6HA 4H15A 1OGYA 1YIAA 2V6GA 1BR4A 2XSZA 4EG3A 3MM4A 1NVBA 3E1KA 4BFWA 3FVWA 1SC7A 1G5RA 4PQRA 1FC0A 2OTJI 4ZDJA 5AOAA 1I7SB 1YFZA 2OLJA 2FDRA 2BHNA 2GKSA 3O8NA 3Q5EA 4G5QA 3NIWA 2JFWA 1UBTS 3VO9A 4KQ2A 1JSZA 1EH6A 1KSHA 2P9BA 4JLUA 3TW0A 1HT0A 4POAA 4JC8A 5EG5A 2OCYC 1J5EB 3A01A 1ESMA 1P7CA 4Z7OB 4MTDA 5CVRA 3DLAA 4B44A 1Y7IA 3DGEC 1C0KA 1KKMA 2H08A 1A50B 1K97A 3KAPA 1KQOA 4PC6A 5H7XA 3TNJA 3R3JA 1G5TA 2YCLA 2X76A 5D1NA 3AFGA 1XD8A 1E3TA 2DT8A 3CR8A 4Q1BA 1D8TA 3B1KA 4R7GA 3LSMA 2FA5A 4KIJA 4WK8F 3UJ8A 3VO2A 4K7JA 3WK4A 2ODAA 3C0KA 2O0JA 3ORYA 2K6GA 3ECSA 5J4HA 2ZMEA 5I4IA 1T6ZA 2C3PA 1GP2A 1RP7A 3TXYA 1ITYA 5AVVA 3LKZA 2DF8A 2H9AA 1FRQA 1Z06A 5L53A 3JY6A 2K5UA 4R1NA 1U3GA 1O7FA 3C2HA 3NATA 2JJ8A 1A6IA 2IWHA 4U2DA 1CY0A 1L4FA 1X2NA 2YY5A 4LJ6A 4PSAA 1JLLA 2IF2A 5DHFA 3WRXA 5A0TA 2QQGA 3CCCA 3E81A 3FA2A 4S24A 4W82A 4NV0A 1K6JA 3WGGA 1ECCA 2M45A 5HGXA 3KP3A 1E5VA 1FNCA 2IHUA 1IPEA 4RA9B 3T7AA 3LDHA 1DG9A 4ZK6A 3UAWA 2Z33A 5E1MA 3ILVA 1HC7A 2IEAA 2DY0A 3IYLW 3EFHA 1KZYC 3OBBA 5FTLA 3I4MJ 2EDCA 3TP0A 2Q4TA 1RLMA 2ZJ0A 2ZT8A 4GYYA 5FI5A 2PD3A 3A8TA 4PAMA 5FHRA 5B1SA 1DIHA 1LK7A 1Z8NA 4A8TA 2HCJB 4CCAA 4DEXA 3X1ZA 1BDJA 4OREX 3HA2A 3VISA 4AXXA 3BDDA 1J8YF 1FYMA 1AURA 1FRVA 4DQXA 3OE7A 2JK0A 4NCAA 1PNOA 1YR8A 5IDVA 4PLYA 3BGOS 2VQSA 2F6CA 3DP7A 1BXGA 3H1TA 4BX8A 1KMCA 2R2AA 4FLMA 3D5SC 1T3LA 1VF9A 3BR5A 2WD7B 3WTUC 4FVTA 2G4CA 5CLLA 4V2GA 3C3XA 1ZNYA 2J7PD 2EL9A 2GBPA 4R2KA 4PTLA 3PNSA 3KCCA 4E7OA 5CFRA 3AF6A 2IU6A 1EXMA 1IXKA 3TBIA 3PDJA 1Q84A 1Y3AA 3K0EA 2DJNA 1ULUA 1V2GA 5KJCA 3A25A 2DMNA 1UBEA 1UBSB 2BCGY 3IAHA 3NGXA 3M07A 3DBOB 3IXMA 1M0SA 2Q3CA 3SZRA 1X7YB 1M7HA 1BDBA 1T2VA 3EFOB 3JYLA 3SDBA 5KYYB 4B3TB 2YBDA 1RLOA 4KAAA 1KK1A 3H0CA 4PIPA 1NT2A 2ZAMA 3BJMA 5KKNB 3MGBA 5G4KB 3NWSA 1E3EA 2CL5A 3EUEA 5DM2A 3MVPA 4K81B 1V2HE 3ELWA 3G8AA 5E95A 4Y9TA 5LEJA 3ZJUA 2NVXJ 1TQDA 1E59A 1MXFA 3HNRA 1ADYA 4X1YB 4Z86A 4E0BA 1G3UA 1T0FC 3GLSA 2P0AA 3SEAA 1VCIA 1JYEA 1OASA 2ZPAA 4IICA 4B6PA 3NDRA 3PJDA 1XTJA 3PSIA 1PCXA 3DUFA 4CG2A 5LZ4A 2GNAA 2DDBA 4IXAA 2C98A 3MUNA 4KDFA 4MZDA 5BRNA 3Q0IA 3GK3A 5B37A 3TB4A 2E4WA 3EH1A 1L3IA 2YV3A 3IPYA 3OI7A 3NYWA 4GICA 1V7PC 4MUFA 3E9EA 4NBWA 3AM5A 4ZVPA 1N4AA 4M9RA 4Z4EA 3B6AA 2PKQP 2ZUTA 3IURA 3PBKA 3OCUA 4OMCA 3FHJA 4XR6A 4R3WA 2EFWA 2OR3A 4X3PA 3IOCA 1GHTA 2A6EF 1O94D 1Z17A 4FDTA 4FFMA 3ZQCA 3PC3A 1CY4A 1T5TA 4KU4A 4HD8A 1RKTA 3VVCA 3AF2A 3OX4A 1QYIA 3EH2A 1H9BA 3BZWA 4RGXA 3CO6C 2YZMA 3AF5A 4LLLA 3MQ2A 3I3LA 1EXWA 2O2IA 1EFHA 2XYHA 5EJGA 4AJEA 1NNUA 2Q2EB 3QIAA 4G0VA 2OA4A 2ZXWH 4KO4S 1SPBS 4BO7A 4FHDA 1N4DA 2CZCA 3S68A 1OJLA 2DWUA 1GTRA 1QQAA 1R22A 4KSYA 5EINA 2P67A 3C3YA 2OV7A 1E2IA 5ADVA 4WNIA 1XEWY 2F17A 2KP6A 1CS0A 5FOVA 4DABA 2VTBA 1EQAA 3GLQA 4JVMA 2CJWA 2BUAA 1V8PA 1DBPA 3O8QB 2GLXA 3HBJA 3C3PA 1DFIA 4ASUA 2GBGA 3ZDFA 2P8TA 2F8MA 3TLCA 2YNMD 1B14A 4J0QA 5LRSA 1TT5A 3NTOA 4RQAA 4TVOA 1HXHA 4V3BA 5GWXA 5DXAA 3ROXA 3WLOA 1MW9X 2VZ8A 1EAYA 3KD3A 1WQ4A 4QLBA 5K0FA 1OPXA 3WIOA 4DLRA 1D1CA 3CUOA 4FQ8A 1VG8A 2G9UA 3W2GA 2GZ1A 4TKZA 3LCVB 3C41J 2Q21A 4RIIA 3F90A 5DX8A 2A9QA 4BJ6C 2EAUA 4F3TA 3U9TA 2IX3A 2CW7A 1QJCA 1QIHA 1Z8HA 4RMNA 1X39A 2V45A 3A4NA 3GPDG 3O2SB 4OHUA 5KJFA 2Z2ZA 2RHDA 4AY6A 5BPHA 5FPTA 1W4AA 4RB1A 1U7XA 3EUKL 4QGSA 4LWQA 3R8CA 1Z5UA 1IRFA 3RRJA 4J01A 3ICEA 2HQSA 3E35A 3WTWC 4EUKA 1TEXA 4KQHA 2VHXA 1UMBB 4L5YA 5DHUA 5DLQC 1A7JA 1EXDA 4CYCB 3DNFA 2ASVA 3PFYA 1E8DA 4RK0A 4L5EA 4RH1A 3LWZA 1YL7A 1VXOA 1YDWA 1PG2A 1T34A 4CTJA 2CXSA 4CCOA 1YS9A 2JCGA 2UVPA 3BBPA 3HVKA 3IJEB 3U2QA 2L3DA 3TI9A 1Q50A 4FYPA 1Y6GA 1CUXA 2WKPA 1GRRA 4F52A 1DI0A 1V37A 5FLEX 2DMTA 1GV2A 2C7VA 3CF5F 2V7UA 1O2DA 1TMYA 3CSDA 2HRDA 3M6WA 4O1HA 4Q7JB 4FE7A 1R9TJ 1MVLA 1GL9B 2GCIA 3OX3A 3PC8A 4RNCA 4TMFA 1Q0PA 2HZ7A 1L5HB 2DGDA 2IW1A 1EVZA 3K6KA 4JEIA 3MN2A 1RJGA 3FKIJ 2CN1A 2IUTA 1N2IA 3KJXA 3LX4A 1Z75A 2I4OA 3RKRA 4KR6A 4OI4A 2AHOA 2X41A 3OY9A 2Q28A 3GTOJ 2C2OA 1IGNA 4ZK2A 2HCRA 2ZI6A 5ALWA 4CIBA 5JYBA 1SG0A 5LQRA 3QLEA 5LOVF 2X2FA 3AOEA 2QYOA 3RFVA 4F84A 1XC5A 4OAZA 1QH1A 3FHNA 1ZGBA 1NJ8A 1ZJWA 3FCOA 1BYUA 3N6VA 1MJ5A 3Q5DA 3DXYA 1TM4E 7YASA 4G23A 1Q83A 2QA5A 4I55B 4WJZA 4AVPA 4BNVA 1QTIA 9LDTA 1J33A 3QVGA 1WV1A 4LC1A 5JZSA 1P6UA 2JLZA 3LAJA 3Q3JB 2IOQA 4GEKA 4BLQA 1GTZA 3ASVA 4QG7A 2JLXA 1DPFA 2E1OA 1EDDA 3GJ6A 1D04A 2HBYA 2I6UA 5LHGA 4A3LJ 2LKSA 3LYAA 4U9HS 5FEMA 1HE8B 1OIXA 1XZQA 4AY5A 3K69A 4UV8A 1CP2A 1JQBA 3EW9A 4PQGA 2O5VA 3MT9A 5ED0A 2OFFA 2IITA 1H23A 3BCSA 2AEEA 2AN3A 4D80A 1HOMA 4IDOA 4L5BA 4XM0A 5A4FS 2EZ8A 4YRFA 2DWQA 3HXQA 5CCEA 4C30A 2GEDA 2VJMB 2WB1A 1X6VA 1ACIA 1JDSA 4RV9A 2ZAOA 1Q19A 2YHBA 1NUPA 2RMKA 4MRPA 5F7JA 4B82A 4UY8I 4JB0A 3C7JA 3T8TA 3S2HJ 1PQUA 4LYDA 4WBXC 4DCPA 1YAJA 4B74A 1VSBA 3S1AB 1UKVY 1M2GA 1P1KA 2QKYA 2M1BA 2HA7A 2DPLA 5C53B 3SOZA 2BGGA 4RZ2A 3A1WA 1TWCJ 1Z7BA 1KGSA 4TQ9A 5CA0F 3CIFA 2RAEA 4IV5A 2NXEA 4FYIA 1F5SA 4JQYA 1PLJA 4ZYGA 2QUIA 3WV4A 3DB2A 2JVJA 4CU5A 3WK6A 3KXIA 4RLQA 3PLRA 5HF8A 1FCJA 3LQ4A 2HK8A 4MVJM 5EHIA 4MVJP 4MCAA 3OAAD 3CCQI 3BSYA 5K99A 4M98A 4W5QA 2SHKA 3A7EA 1ZIYA 3WLJA 2ZO4A 1JAXA 2WZCA 3A3OA 3NTXA 4BECA 4NDZA 4XIDA 4QDKA 3IP3A 4H7KA 2QN7A 5M3FJ 4UUBA 4BZWA 3RO7A 2C5GA 1S7OA 1ZRDA 2X8JA 5JI2E 1K7FB 4A7PA 3TGNA 2BSXA 4IUBS 4L3WA 4TLDA 1F7UA 2KMLA 2BI4A 3DZBA 4AYBA 1R8YA 5JR3A 2WF9A 1DPRA 4L51A 3WK8A 1G3IA 4BU1A 1E6MA 1SUCA 4C9YA 1AKHB 4TTTS 3P9YA 1EGMB 2YS7A 3NPMA 3S55A 2W6PA 4G1VA 4FZ3A 4ZEMA 2BI8A 1ZYUA 3LP5A 1XMAA 2E1MC 4AROA 3I2KA 3MFQA 4POOA 4XN0A 2G8LA 3DYBA 3SXUB 3TSAA 4EPVA 2QU7A 3DZHA 1FUKA 4G5OA 3FNIA 2X2OA 5FPQA 5ITZB 4EGFA 2B69A 2HTJA 4FW8A 5KNBH 2WWYA 2X6YA 1HWYA 1VKNA 3GUZA 3H11A 4JSYA 5GGXA 4ESOA 2KQUA 2G71A 3MINA 4BNZA 2A84A 2RDMA 3R9IA 2XBUA 1HETA 1CGPA 2FUCA 3RB8A 4O1IA 2YJ6A 4HXGA 1KU7A 5JNTA 1EG2A 2BFDB 3LNQA 3LCCA 2DJ5A 1Q92A 1B4DA 3QE4A 2CQKA 3KOOA 1PR2A 4IP0A 4KWTA 4PYLA 3G9TA 3QODA 3A4CA 2NVQJ 2ZBRA 5JYEA 3W4IA 2C82A 4IOAF 4FFSA 3EULA 2YWRA 5TQJA 2J85A 3BIJA 4MVJF 4R81A 1T5DX 4MA5A 4ZQGA 3TMYA 4BEBA 2VT3A 2QMZA 1ODSA 1OA1A 4B1FA 4KNVA 4L72A 3VU9B 5CDGA 2JFUA 2YU3A 1BMDA 1WA5A 1Z4MA 1IE3A 2J30A 4AXBA 1RWXA 2JHPA 2HC9A 2W2KB 3K4QA 3HDDA 3ZHSA 2YOGA 4UTPA 3COYA 3FPKA 1ICEA 4N6NA 4NMXB 4QJBA 1M10A 2IEYA 3VH4A 1JDUA 3QMVA 1G6Q1 1BVHA 1S3GA 4CYDA 3GAFA 1W30A 3KUDA 1P2BA 3H6GA 5IOYA 1XNJA 4FYMA 3TIGA 2K2WA 4K05A 4LF8B 2BE7A 2XDWA 3STHA 4DUPA 2IV3A 1V48A 2G72A 2Z16A 1ZIPA 3ZE0B 1KO1A 2EJCA 1W93A 1ZCAA 2AS5F 3GJ5A 4HBGA 4KQGA 2E4AA 2WYVA 1T1JA 4D6YA 1T5BA 2VNHA 4UAJA 2QTGA 3L4BA 4MPJA 1S4QA 4BRZA 1BIAA 3H86A 2ID6A 4NMWA 3VSKA 2AN4A 4O3FA 4XRSA 5FT9A 1ZRFA 5IT3A 5HKLA 4EJ6A 2W1OA 1M8JA 3TFQA 1XTSA 2WHYA 3IVGA 1AY0A 3DMYA 1Y5NA 3TLEA 4QJ5A 2O59A 2DK8A 4IVNA 1XU7A 2CDBA 5CM9C 4EDHA 4HATA 2QN9A 1IN4A 2RREA 3LWDA 2BFCA 3CR3C 3CXRA 4FK8A 4L28A 4MQFB 3WLPA 1JR3D 4NE9A 1KYZA 3X1KA 4H18A 3LA7A 1SULA 3QW4B 2HI3A 3P9SA 4X7MA 3LY9A 3ZX5A 4G0ZA 2AG1A 2NVUB 2CBZA 3QLVC 2AQHA 4ZJUA 2AD5A 3C6MA 1GUUA 2JFGA 1NX6A 3IE2A 5I51A 3JYHA 3FZEA 5JWHA 1XV5A 1JZTA 1KZGB 1YAHA 5BT9A 4LAFA 4TTPA 5IBCA 4AZ3A 1IXRC 1O97D 1QQ6A 4L4ZA 4WJKB 4DT1B 1XTPA 1TAQA 2X9GA 2H1WA 3D4BA 3KEMA 2M3AA 4UHCA 4V3CA 1KJWA 2QMOA 3T99A 5BOXA 4KTVE 3AL0C 1Z28A 2JI8A 5CVIA 1E18A 3GRAA 3RRBA 4EB3A 4LY9A 4EA6A 2D2IA 4GLLA 5IHXA 1QS0B 4B09A 3GTLJ 1ERDA 1SA0A 2K87A 2PBZA 1G42A 3K0FA 3F6CA 4A5OA 1O95C 3HO1A 3WB2A 1MIJA 1GSOA 3OZDA 2HWKA 1GZHB 1Q1GA 2A1UB 1GFWA 5CJPA 1E77A 5KUTA 2Q49A 3FXQA 5A2GA 1TCBA 1XXHB 4RGBA 4FEEA 1W85A 3WTVC 2X2PA 2AG5A 2RGNC 4UUTA 2YFKA 1OYVA 3RRZA 3IILA 2C3YA 5CNMA 3GDGA 5F2EA 3QI2A 4R1HA 1PAUA 4PEVA 3BXGA 3RBZA 2VFAA 3U1TA 2AI1A 4ZYVA 3GT3A 2G9QA 3A9TA 2B3DA 4M87A 4GGPA 2VT7A 3SF8A 1QP8A 2UVDA 3CQZJ 1VPEA 2FBIA 1KXZA 5K09A 4ARAA 3KUKA 4REOA 4I4NA 2JBAA 3A0HC 2HIAA 3DOFA 1KA9H 2GCOA 2C07A 2WFLA 3HPRA 4MRMB 3HEMA 2X8WA 3MTDA 4Q9HA 1ZGJA 3EQZA 3VMFA 1M72A 4PYIA 3TMKA 1FMFA 2YMMA 2IF0A 1P6XA 4M89A 4CCLA 1C7QA 1ZMXA 9ABPA 4RM3A 2OHXA 2CT8A 3E53A 2C1EA 1QVWA 1JFFB 4RPJA 4RB2C 5EXDA 3R7DA 2CJFA 4J7UA 2WD9A 4PZEA 1K4YA 1BJRE 2V6MA 5EIFA 3ZE7A 4EPWA 5IT5A 1ZU5A 1P5JA 1EFUA 2PS3A 3K0FB 5HOEA 4ADSG 3IE1A 2AW3A 4CEHB 4WN9A 3ZJ5A 4TT8A 5ENVA 5LYYA 3VZCA 2NN3C 3C3JA 4P80A 5IBRA 3SKXA 4BQIA 5C37A 4ILKA 3EXFB 3C15C 4GNRA 5FLKA 1RC8A 1UP6A 2IU0A 1UFQA 2YKGA 4MA0A 3ESCA 1RP1A 1RWMA 1T25A 2BM0A 3DZKA 2HU8A 4HZFA 1XZGA 1G41A 2PKYX 3B82A 3OY7A 3WJAA 1VMKA 5K01A 1AHPA 1O97C 1NXVA 3WFZA 3O7MA 4ARZA 4LK0F 1UG0A 4Q0MA 3Q2KA 5D00A 2VASA 2ZS7A 4M7PA 3E3LA 1CF9A 3IQIX 1N6KA 1E3QA 1WB6A 3PIIA 3DLIA 3Q7IA 2PH7A 2IUUA 3NHZA 3T06B 2DSNA 4BCBA 1V71A 3RS2A 1JG6A 5M29A 5UKDA 3QIVA 4R1OA 3UMCA 2R11A 3QBTA 3E1SA 3QP6A 1PKEA 1CDEA 1AZTA 4LOAA 1UOEA 2VJQA 1TLFA 4BQPA 1B0ZA 4XDGA 3K4LA 1Z7UA 4AD9A 4WDRA 3N7TA 3SHVA 1I24A 3O8OB 2GHRA 2C4KA 1R0XA 2BFCB 3OOEA 4NPCA 4IXWA 2X7XA 4QVGA 4UASA 4WGFA 4C3OB 3N2EA 2MOKA 5C8ZA 1Z5ZA 2MIIA 4IY1A 2RFLA 4EOGA 4DNCA 1YR9A 2J4CA 2Q3DA 4H1TA 5T41A 1RLUA 3LAPA 1ZAOA 2HH9A 1AG9A 3N5KA 3FXRA 2FUKA 1Z62A 3AEXA 5TX7A 4PR3A 1KQ8A 4W9NC 1HQCA 4DG8A 2FUNB 2FCRA 2WJVA 2K4MA 3KUCA 5GMOA 1MA3A 3DFKA 1U99A 2HCBA 2C5HA 3LE8A 4RV5A 4YFVA 4Z8XA 3EG5A 3DQVC 1G8JA 4QSHA 1UPFA 2ZKIA 3K53A 2GEUA 2XZLA 1NAHA 5KYVA 4G9GA 4TT3D 4CL3A 5AD1A 5F1YA 3WGLA 3ZDCA 4KGZA 3ZWDA 5BWMA 3HWSA 4I09A 2KIQA 1CW2B 2DHEA 2ZSFA 4NDNE 1BO6A 2Q7XA 2OZLA 5E1BA 4ZTBA 1QQIA 2P3LA 3D9QX 5AXBA 3W8FA 2IPOA 2CDCA 2WVGA 1NNSA 1JJ7A 1Z13A 1GT0C 2FPOA 3CTPA 1HH4A 2O1XA 3WK9A 4EJVA 3FNEA 4LBZA 1A04A 5BN4B 1Q7GA 1I4EB 2KL4A 2IXFA 1QLJA 5DDGA 3B2NA 3II6X 1LKZA 1DX9A 3KG2A 5JVDA 1JS1X 1X8LA 4GSLA 4B3FX 4YRZA 3T4XA 3TINA 3O8GA 3DV0A 3M81A 4QPDA 3BAZA 2Y0SA 2MSDB 3HZZA 1Y5IA 2L18A 1QGUB 2PGXA 3GJYA 3K1NA 2AG8A 4TUYB 1QHHA 3UAXA 1Q12A 4CODB 4QOJA 1ULAA 1JA0A 2QTNA 4IDGA 4WL0A 5LXTB 2OLKA 4UDYX 4D3DA 1N6RA 1VE5A 1QIKA 2MGQA 2VEDA 2E5ZA 2YOHA 3SEZA 2LP4Y 3AWDA 4O29A 2KMUA 4ENRA 1ETQA 1HTWA 3F9RA 3OJCA 3N39C 3P2KA 4WX2B 2RHGB 3FRIA 5D8DA 3UB2A 3N53A 4WW0A 1Q6YA 2XPCA 2EWWA 4URWR 4CR8A 1LE8A 4BL0B 3ZIDA 4PQFA 4MTEA 1KYXA 1DGWY 4WLVA 4JOSA 4EB0A 4LJ9A 5LL6P 2OCBA 1V7ZA 3KKKA 2OHOA 3BTLA 1ADBA 2AE1A 3X0DA 4BYGA 4B45A 4LOCA 4TQGA 1AV6A 3WS7A 3PYMA 1ETWA 3LYHA 4N48A 2P62A 5DX1A 2ADOA 2B1GA 5FBQB 1TMKA 2JARA 3BK1A 3X43A 4BUZA 5HHTA 1P3JA 2PWZA 1E3WA 3JQAB 5LQUA 4RAOA 1TPZA 1ENPA 1A9SA 4PHCA 2GJ8A 2EKZA 1PNVA 3UAVA 1Y37A 2H4ZA 3LHSA 5ERIA 4X20B 1XLTA 3FJOA 4KX5A 4N7RA 4BLVA 4EJSB 3BRWD 4HAMA 5FROA 4AUXA 1K3UB 3D6FA 4J3JA 2CLCX 5ERGB 4RY2A 1RNLA 3CWZA 4WFQA 4M83A 2OENG 5FBKA 1D8JA 3K8OE 2H11A 3B8HA 4XPZA 3V1KA 1UOPA 4EZEA 1UPBA 5JXWA 3A1SA 13PKA 3R5KA 2HA2A 4EG8A 1UZLA 1AXEA 4TXNA 3HJEA 3AR8A 4TXHA 4TSFA 5CT5A 2V6IA 5KJ1A 1CWUA 1BGVA 2M4KA 2HSGA 1DTWB 3RSZA 4BPRA 4AU7A 1AO3A 4KPUB 4EX7A 3KSAC 2DMRA 3ASNH 3TLAA 5DHRA 1SD7A 3OIQA 2H2GA 3DHVA 3B2EA 3O8OA 4BNJA 2I7TA 2ZIXA 4WUVA 2W2MA 4W8OA 1LWNA 5G0VA 4PLPA 3VI4B 1E66A 3DKVA 4KXUA 3RS8A 3CF0A 2FUEA 3A3PA 4ALMA 3KZZA 4BTVA 5K7FA 2IZ1A 2XRFA 4IOLA 1T4CA 3EIHA 5M7EA 1RWWA 3A70A 2A92A 3NTUA 5FGMA 4G84A 5C4GB 1QV9A 1BHSA 3L8CA 3WADA 3Q87B 3H5NA 1PJAA 4RE5A 1GQRA 3T9FA 2VZ0A 2WDPA 2GRAA 3PVSA 3WISA 2YVLA 3S3MA 2Y1EA 1BKSB 3G0DA 3JYNA 4MKHA 4URZR 4CPDA 4MGIR 5CFPA 4QG3A 3EIWA 4GMGA 3PENA 1YRBA 1G20A 3QEMA 4O4IF 3FY4A 3RFFA 1R37A 3TJMA 2H5JA 1C1HA 3M7IA 4Y1RA 2E36A 1U6GA 1W5TA 4Q4ZF 1RUOA 2FW7A 4OSPA 1I3MA 2K9QA 2Q1UA 3FUUA 2Q6OA 3I6YA 4C3ZA 2G25A 2WIAA 3IC5A 2LFBA 4NDLA 5B3KA 4BKOA 1ORKA 4BMNA 1YVRA 1VECA 3R5HA 3KCQA 5I9MA 5DN9A 1MBJA 2HHHB 3S1AA 2MSLA 5FKOA 2GD6A 2QY9A 5C8VA 2HR1A 1KONA 1C4XA 1FW8A 2JGJA 3PXBA 2B21A 4NEGA 3UR3C 3LHIA 3W7AA 5I9NA 4HADA 3KV1A 2OHHA 3BG7A 2XPUA 2P2ZA 3WC4A 2ZCWA 4EW6A 2DODA 4BS9A 3LRPA 1YFJA 4REQA 1AKUA 4J7CA 2P35A 4IHAA 2ATCA 3OEYA 3NRJA 3S1QJ 3ZHXA 1I5EA 1J0AA 1Z9BA 2JD1A 4PN7A 1SCIA 5JDCA 4DA8A 4HGRA 3VDNB 3ZG6A 4Q19A 4BKMA 5AW7A 1SQ5A 4F9FA 3GLGE 1J07A 1KKLA 1LSSA 4LDNA 1MNEA 1NJGA 3E61A 4UUQA 3JR3A 1UC9A 4IFBA 4OFZA 2PPLA 3MVEA 4C6TA 1N78A 3BYZA 2WYUA 3BJOA 3KVYA 2EIHA 3HFRA 4U6SA 4LCBA 1F2VA 1CYDA 1K27A 2EYQA 3RIEA 1X92A 1LLDA 2LCFA 4QIHA 1R0KA 2VKTA 4YP6A 5A1TA 4AMVA 2G9WA 1URPA 1EFRA 1O3YA 1X80A 2ZRQA 3OJWA 4HEQA 4LXGA 5E3JA 3BWYA 5CVUA 3I05A 3O9ZA 4DCUA 1YKGA 1BI0A 3HRUA 2R00A 4QAJA 4B85A 1S9HA 4BDZA 4HNUA 2LD5A 1X1EA 3FDZA 4NZNA 4CEIA 1E0DA 2A6PA 1UM9B 3WZ2A 1CY6A 3B78A 1EBFA 5C1IA 4KUMA 1K4TA 5IARA 4XD2A 1Y1SA 4GSKA 3R7WA 5ETJA 4GOJA 3B13B 3DOCA 3CLRD 3L7JA 2DA7A 1SIWA 2BYVE 4FILA 3F97A 3M3DA 1TYBE 4Q7EA 4KXXA 3EXHC 4BP8A 2XY4A 5GQSA 2WYIA 2VYVA 3C74A 1JDBB 3WU0A 4EGJA 2FMTA 1VJTA 2I2FA 2PMDA 2ZP1A 3PKJA 4TVKA 3X44A 2CXUA 1KY4A 1CUVA 1HBXG 5BWOA 2EL7A 1YBHA 2UXNA 1Y82A 4OUDA 4ZC3A 2O57A 1NK2P 2Q41A 2PMUA 1SKBA 1SHKA 2LUOA 2QTTA 3HDHA 2WAMA 4KQIA 3R7AA 4BBPA 1PYGA 5AJHA 1H9AA 1EK1A 5L45A 4IH4A 1CZUA 2XVMA 4KMSA 3ZWAA 4N6GA 3ZCTA 5BUQA 3R77A 3RS4A 2A9JA 1XJWA 3LIIA 3TE6A 4NOJA 3VYWA 4YRMA 4LB5A 1CNMA 1ZM9A 4KI7A 4BEHA 3KX2A 2WRZA 3QNMA 3D4LA 4HGQA 1Q91A 1J22A 2K7ZA 4IUYA 1W73A 1BA2A 9ANTA 1ZXLA 4O08A 5D5QA 4ZC8A 1C0IA 1RWNA 3NBKA 3ZJ4A 4EM1A 2Y6UA 1B72B 1E3LA 4H2DA 3VSLA 3ZJTA 4DPMA 3BSSA 4XOUA 1Q3TA 1TM5E 1RPJA 1CUFA 2RJ3A 2R96A 4UKDA 3PGMA 2H52A 5DXFA 1C9NA 4PRKA 3IAXA 3TCNA 2RHLA 3I9V6 4ZARA 4KGVA 5EIAA 5F12A 2FNAA 3JRBA 3D8TA 3SIRA 4EYQA 5EWMA 1YZGA 4DR6B 4NY1A 2ABWA 2R7OA 1CQTA 1JL3A 2HTEA 2YV2A 3FWHA 5D3MB 1SBHA 3EG9A 1H2EA 2D1FA 2CXOA 3CZ5A 2H63A 4HF2A 3LWNA 5KAPA 1T8TA 1YS2X 4G12A 2QXTA 3L4BC 4UMVA 4WXMA 1MO6A 1HSOA 3WNZA 1RRJA 5E4TA 3AVXA 3HP7A 2M8GX 5FBRB 1P5FA 1YVEI 3FNRA 4X93A 2DETA 3I6QA 1I6HJ 2PJUA 2V3VA 1VMEA 4YHBA 1IOWA 1P1IA 1DLIA 4EKDA 5CITA 1JEDA 4D6PA 1C9DB 5CPRB 2JFNA 1Z25A 4X8LA 4LNHA 5DNVA 1Z68A 2C7QA 4IX7A 3QA9A 5ECGC 4XWYA 3OVMA 5JASA 4LFUA 3SNKA 1O54A 1W0CA 3ICOA 3HUFA 2Y69H 2QVCA 3LA6A 1WIWA 1QPGA 2EP5A 2QSJA 9ATCA 1QXSA 1Z0AA 5JXGA 1XDWA 3O2PE 1LRKA 3HBMA 1E1RD 2E1CA 1P4GA 3L07A 2OHFA 4P53A 5IAJA 3S2IA 5JNSA 4F91B 5JZMA 4G7OF 4I9NA 1TLHB 5J9FA 3HXOA 3ICQB 2HDWA 5CT4A 4B2PA 3N2LA 2HQRA 1MG0A 1X13A 3BORA 1QG6A 3JWPA 2B25A 2IDMA 2BY2A 2X86A 1P1FA 2VHUA 4RHYA 5LIRA 4ME6A 4QM6A 3HGMA 3ILYA 1V16B 3RT7A 3UHPA 4F4JA 1MB9A 4ZPXA 5A5GA 3MZHA 4J75A 3KR1A 5TPWA 1JT0A 1X1QA 5EEAA 4ETWA 2O05A 2JLUA 2PUEA 3IC7A 2CD7A 4OHWA 4FE3A 2P7VB 3NVMB 2QJTA 2OXIA 1OZFA 4JUAA 1NUTA 3CRQA 4RK1A 4CIAA 1ZBQA 2YYAA 1ZO8A 4LG3A 4UXHA 2FAXA 2MABA 3P4UA 3H1EA 3RSHA 2R8OA 3RVDA 1T6XA 4FTHA 2I33A 4JVNA 5ICGA 3TKAA 4RDXA 3QX9A 5BP7A 5KX5F 3SWWA 3OETA 2YC2C 4ZI7F 1V96A 3HLYA 3EA5A 4P3NA 3OQJA 5EF6A 3AHDA 5IAGA 1FS4A 4RKEA 3TOZA 3I53A 2CLFB 2HA5A 3PP8A 4JBXA 4TL7A 3V2GA 2JFPA 4A5SA 4DLLA 5EE5B 4OMYA 1Z0FA 3S3OA 2GO7A 3WLIA 5MFPA 1OV6A 3PA8A 4FWTA 3THRA 4B2IA 2DHCA 5EWJA 3R4VA 3R7SA 1Y4AE 5DYTA 3GLRA 4CKCB 3DBHB 4BKUA 4OYRA 2CW8A 2OZVA 5HJ2A 1OH6A 1MIHA 3G1UA 3BRCA 2QQ5A 2XMSA 3KOYA 4C1NA 5J1SB 1VIAA 2CHUA 3GZNB 1MKYA 2EKDA 3CLOA 1SAXA 3R6LA 4NX2A 4EW1A 4ZQEA 2NV6A 1KZ6A 4BU2A 4IKPA 4WKCA 4C4PA 2CUNA 5FNVA 1D4AA 3O8CA 3G88A 1MAUA 2MW8A 1VHLA 3AUAA 2CCKA 5LA6B 1MLDA 1BXKA 3V8NA 4YRPA 2V9KA 1W36C 2Z2SB 1ZH8A 2OBNA 3ONDA 2G8NA 1P0MA 1T24A 3J7YJ 3I59B 5EIHA 4BC0A 1ZAYA 1ESDA 3DMTA 1EWTA 3HSSA 3EZLA 1GAWA 4IGKA 1BW6A 1T6SA 3LOCA 4NV3A 1E5XA 1ETXA 4EJTA 1TCAA 2D13A 2JHAA 1H8EA 3BTSA 1AUOA 1YE5A 2VONA 1ZD2P 3D54D 4MVJG 1RMYA 2I9PA 3IUPA 3OT5A 4G89A 2X2EA 4RZSA 5LQAA 1GPUA 4P5OA 2ZIEA 1KS2A 4HVAA 5KSPA 4PZJA 4OIPF 1RR7A 4PRLA 1JEJA 1MFZA 3ETNA 5JISA 3GRKA 1Z7WA 5I9TA 4BNKA 3JQQA 2ZYWX 3N58A 5H3LA 3O2JA 1LV8A 2FMFA 4GI1A 2O6GE 4CKCA 1Z07A 1ZM3A 4RD6A 3R7LA 1FQWA 3GBVA 2QP3A 4QPCA 3RYHA 3BTIA 1FDOA 2VK1A 1E2KA 1PWEA 5SY6A 3MKZA 3ZIAA 5LRRA 3D3NA 3DCIA 3HDVA 4B73A 5J8FA 2H6CA 2OFWA 2XCUA 1HFJA 3FWNA 4Z9XA 5TARA 1K89A 3SLRA 4DCGA 4L50A 4A0XA 2I54A 1Z5WA 2NO5A 2NU8B 2Q5QA 3VDQA 3ZHZA 3ZDAA 2Q5HA 3VKGA 2I2XB 4AKHA 3FZVA 4LRSB 1Z4JA 4XCVA 2YWGA 4ZTZB 3EVFA 1FW6A 3F6RA 1JXAA 5DM7F 3RW9A 2QTCA 5KAIC 4QXOA 5DCWA 4DDWA 2G36A 3KJGA 4WXDA 4LWOA 4B5LA 2HMYB 4CMBA 1OCZH 2B36A 4X65B 3FNHA 5JRJA 5DB4A 2O7NA 4I1PA 4U0WA 4AVYA 1R4NB 4PXAA 2JBWA 3VBEA 3ROZA 3T94A 4U2FA 1AF7A 1O89A 1EWYA 3DFFA 3UNXA 1VL6A 2VKEA 2O61A 4B4DA 1XQVA 4HLYA 1IWPB 3UPDA 1DB3A 2ZTUA 5DHPA 2IT1A 3QYEA 3HSEA 1X2EA 1BCRA 2RAUA 4ZMRA 5JAOA 2C97A 3O93A 2BBYA 2REQA 3AL2A 4QQKA 3HLTA 4BZPA 1ZD8A 1XDUA 4JX6A 2VYVD 5LR6A 1H2WA 1ZXXA 2IYSA 2KSQA 2ZJ1A 1O4WA 1L7AA 2QVYX 3D6HA 3N8DA 3NT5A 4V0RA 5COAA 3T1YB 1ZUWA 3FIWA 1AUPA 2AC2A 3HB9A 1RCFA 2B4RO 2QP9X 3MJEA 4Q02A 4QLAA 3RT1A 3PRKE 2IXGA 2XGJA 2ZPUA 3OCVA 2V58A 4KACA 1G3YA 2VJIA 1AIPA 3S16J 2I7VA 1N9ZA 2O0MA 4JIGA 3JVUA 1GCAA 4J0GA 5AMXA 5BR1A 1LFAA 4ZA2A 3T8YA 3EX7C 4ZZDA 1RI4A 5KYXA 5FLXK 1UFRA 3OLYA 4CCSA 5JSFA 3NYQA 5EGOA 1E9SA 3OZ7A 4FMDF 3RSGA 1GQ2A 4X1KB 4LSWA 2AOUB 2R7LA 4IW3B 1T56A 3TJRA 3EJ6A 3F9KA 5B55A 1DX4A 3SFZA 2PUWA 4PYOA 1BL0A 2VDKB 4U7HA 5CK5A 3N8NA 1QSGA 4MEYF 1WS6A 2CXNA 4BE1A 1C1XB 3LA8A 4RAQA 3IUSA 4FKMA 4B3CA 3GEGA 3F8SA 1T8IA 2GMWA 3JQ8A 4MVJA 1ZXBA 5ARDA 2A88A 3U0VA 3GFOA 1MH9A 3U9LA 5C35A 4ISCA 4M8SA 3I55I 3ZWKA 4WOPA 2L17A 3ZNPA 4YFXF 1CT9A 1FU4A<