1R00A

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-homocysteine (sah)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r00A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r00A03
3UBTA 5E1MA 2DK8A 3CCFA 5ILVA 4RAZA 3I9FA 1UB9A 4HC4A 1TW2A 3ULQB 2GXBA 1FYKA 2MBFA 2BBYA 5E8GA 5HOQA 1YS7A 3QAHA 4CDGA 1NW5A 3JTGA 2CKDA 4Y2HA 4V0RA 4Y17A 2ZULA 4KIFA 2DFIA 1K78A 1R1TA 1BC7C 4A5MA 2P3OA 1ZGAA 4GQBA 3NVKI 3ECOA 2HWVA 1CF7A 4RGRA 4YV0A 4YUVA 1QBJA 1JGSA 1I27A 4YFXF 3AY0A 1AQIA 4L9JA 4AIHA 1ZYRF 3F23A 4MQVA 2FNPA 4M72A 5HEKA 2G72A 4F84A 2STWA 1IM8A 1MDMA 3TRKA 1S6LA 1XSXA 1JG3A 1XVAA 3FUXA 1WRJA 5K1YA 4YV1A 1GHCA 1RJEA 2JPCA 1JHFA 4I0AA 2CMHA 3VC1A 4Q5SF 2YXDA 3G7UA 2YQZA 2WA1A 5ILUA 3MZYA 4BHCA 3CJRA 2WA2A 5P8WA 1KQ8A 2AOTA 1SFXA 3K0LA 4M74A 2Y1XA 1T6SA 1T98A 4IV0A 5HLGA 5IKMA 3CTAA 4M71A 3GFIA 4PYJA 2D1VA 3VFZA 4GO1A 1Q0SA 2KIUA 4ZTBA 3FUWA 2G7HA 2DAOA 3HTSB 2ZMEB 2UWMA 1TNSA 2OZ6A 3C3YA 5HIMA 3QPTA 2V79A 4AZTA 4L9NA 2BR4A 5FHQA 5DUIA 1QAOA 5E1DA 3JTHA 3TO7A 2PX2A 3DF8A 3KZZA 1P1BA 2OY0A 2HR3A 3V4GA 2AS5F 4X1OA 4TV7A 2P7HA 2P6SA 2ADMA 2PXCA 4HQEA 4QQKA 4PCQA 1JR4A 2VT2A 2O05A 5CIYA 1KYZA 2DU9A 4YG2F 4MQ9F 2FYTA 5M5BA 3OOPA 3LCUA 4FT8A 3SM3A 3EVBA 3P97A 3DH0A 2V9VA 1X19A 1Z9CA 4XBFA 5K8VA 1V39A 5EQJB 2CW0F 4RAYA 1YZ3A 1DCTA 3DMHA 3TO9A 3RYPA 2WC2A 4G56A 1O57A 1MJBA 1U5TB 5EEHA 2ZIFA 4XUDA 5LQRA 3G73A 5DDGA 3RIEA 3LAPA 5L3GA 3T0IA 1P4XA 5KK1A 3L8DA 4P96A 3T8TA 1IN5A 1P91A 4UVAA 4RX1A 1RUNA 5FWDA 2ZNYA 3EETA 3LL7A 5DM4A 4QPPA 5K0JA 4A2UA 5J6XA 2YX1A 3HVKA 5D1NA 2AOUA 5LQAA 4EQQA 2M30A 1FBUA 4JXJA 4CZZA 3NQOA 1YIOA 3F8FA 1MJ9A 1FSHA 3A7DA 4MHTA 2P35A 1FY7A 5E18F 2PGXA 5LGNA 5JHUA 3BWYA 3NDJA 5CM2Z 1WWXA 4A6DA 5K05A 3B3JA 2V1UA 1SVUA 2OA4A 3COAC 2DK5A 2I9KA 2PEXA 4G7HF 3JAMZ 4CTKA 2VDWA 4YIIA 3DP7A 3CC8A 5FB2A 3K1PA 2AN3A 5E20A 2I7CA 2WK1A 3ORHA 3BT7A 1P6RA 3JWJA 4AX8A 1RI3A 4HQMA 4LB6B 4CTJA 1FLIA 2FBIA 5HS7A 4L18B 2PKWA 2ISYA 1O3RA 1UWVA 2GIVA 3QV2A 3ID6C 3HM2A 2COMA 2XBMA 5JFRA 5LHIA 2M8EA 4U0WA 2PT9A 4EM1A 2HWKA 2IIPA 1SUIA 1IZ1A 2ZBKA 3E05A 1ULYA 4P7GA 3UJAA 3G8AA 4RB0A 3CO7C 5E2AA 4ZH4F 3E6BA 3TM4A 5B1SA 2RVCA 4GGGA 2ZO4A 2C7OA 4O6JA 1ZRFA 3KQVA 1XCBA 3KEOA 1XD7A 4LLGF 1EH7A 1INLA 3EVEA 4IV8A 2ZTHA 5FLXZ 1KYWA 2GH1A 4RVFA 2JG3A 2ZZMA 1X1AA 2QRVB 5BQTA 1JG4A 2ZCJA 4M9SA 4DM3A 3HRUA 4U7PB 5F64A 2IBSA 2GAUA 3ME5A 3TLJA 5DM1A 1FZPB 3LDGA 1W7PB 3SHFA 4UV9A 5GINE 3F3XA 1ZAOA 1P2FA 5IT9K 4Y15A 4PNEA 1BIAA 1KGSA 4FHTA 2IH2A 5LSAA 5C1IA 1RI4A 4AD9A 4WVLA 1NBHA 5E9WA 2G8NA 5LQCA 5DXAA 5BPDA 3R0QA 3JWHA 1KU2A 4MHGA 2OBFA 1GXQA 1S29A 5DTRA 3MAGA 4P7KA 4RTKA 3E6CC 1J0RA 3FTEA 2ESNA 3Q9SA 4KRGA 4HX7A 4I09A 3P2EA 4P7FA 2AOXA 2L3DA 2QYOA 1B4AA 4WX9A 3PX2A 1QZYA 3R4KA 1RZ4A 4KA4A 4L7VA 2HKXA 3FM5A 2A61A 1LNWA 4G8XA 1YFHA 1FOKA 2HTSA 2QLZA 1BHJA 2NRAC 1VP9A 4V0QA 3VB2A 2A6EF 2Z33A 4ZYDA 2PX5A 3DXZA 2PG4A 5DLYA 2F5FA 2VBWA 2NYUA 2VBYA 2TDXA 3E97A 3MZHA 1WXXA 4LG0B 3EVDA 1YFJA 2IA2A 1X1CA 1NW6A 3ZQ7A 3EYYA 4H0NA 1I1NA 4MWZA 3CO6C 1Z7UA 3TO6A 4PZJA 1J75A 1QPMA 3CVOA 4I2OA 1EH6A 5HIIA 3EPPA 4HF1A 2Z6QA 4HAMA 2ORED 3L09A 4HZFA 3B7PA 4Y30A 4I01A 3KP5A 4KMUX 1SFUA 3QP5A 3MGGA 1SMTA 1HW5A 3CGGA 2RGVA 1G8SA 3W6JB 3DLCA 3HCBA 3M6XA 2G7UA 4NECA 2N47A 2HR1A 1PDNC 4GC5A 4RWZA 4BHBA 1VL5A 5EC8A 2FSWA 3KZYA 3LA3A 2PLYA 3R6TA 4BHPA 3IHUA 3LHDA 3HRMA 2CYYA 3GZ5A 4KW7A 1R58A 4FX0A 1RJFA 4A5NA 4R6WA 2K4MA 2HZTA 3J80K 2A6HF 4UNOA 2YSRA 2IDKA 5LRRA 2Y0MA 4D0PA 2OB1A 5E8JA 3TMAA 4HSGA 4L0ZB 2P1DA 3P9NA 1HKSA 2ZZNA 4EGYA 1XGNA 3I53A 3C6MA 2VE9A 4UHTA 1ZKDA 5FD6A 1ZG5A 3FUVA 1D8JA 4KN7X 3KPYA 3G2MA 5LEJA 1HKQA 5CVUA 2JTVA 2YXEA 1JTFA 4C07A 4IVNA 2FEZA 2LNBA 3HCDA 3EVCA 3OU7A 4HV6A 1XSVA 3R60A 3M6UA 1NHAA 2AOWA 5CLSA 1R22A 1KA8A 3KHKA 2UXNA 4M9XA 5DX0A 3SXYA 2DI3A 1RIOH 1FBSA 2NXEA 3RDIA 1EH8A 1O7LA 3ZMVA 1MJAA 3GXOA 5TRDA 3SFZA 4PCLA 4RB1A 1L9KA 1EJ6A 2A5YB 3ER9A 2P40A 4XSXF 1NKVA 3BUSA 3SZTA 5LEKA 2AXLA 2EJUA 3PFGA 2IH4A 5CVJA 4KT5C 3PFHA 3PQJA 1R5HA 3CJQA 4E2WA 3CBGA 4P9UA 2KIFA 5CJ9A 5FQOA 3ZN1A 3NW9A 5A2QK 1H9TA 5DSXA 4PDKA 2P7IA 2LF8A 4GOLD 4DZRA 3M8FA 4NB5A 2ADUA 3LA7A 1O9HA 4F7ZA 2Z3YA 4HTFA 3KR9A 5FLXK 1D2HA 1ZRCA 2DW4A 2PVCA 1R8YA 3M7GA 2Y1WA 4YFNF 2PJPA 1BC5A 3NDIA 3CJNA 4X60A 1NW8A 2HOEA 4OIQF 4AVPA 4AIKA 3EVGA 4OMZA 4KIBA 4A0XA 1FC3A 1J2XA 3S2WA 2VODA 1C0WA 1XDSA 3R3HA 2QBYB 3FPJA 3K1MA 4BP1A 1TQPA 2HS5A 2BZGA 3BROA 3RIRA 4KDPA 4AIJA 1WXWA 2Q41A 2BH2A 1SFEA 2RN7A 1FBQA 4I0BA 2P6TA 1G3TA 1LVAA 1V3FA 1XCLA 4QQNA 1JXSA 5EZQA 2XHKA 2OO3A 2YR0A 4JK1X 1BM9A 2CFXA 3KPVA 3LGAA 4XUEA 1XCJA 3LQRA 4DMGA 3LBFA 4G6QA 1Z6RA 5ERGB 2UXXA 4C04A 2FBKA 1RJDA 3Q7EA 2E7WA 5EPEA 4UXNA 2XAJA 3JAMK 3X0DA 1U2ZA 3HSRA 3FUUA 3B73A 1DPRA 2GQQA 4MTEA 5IT3A 3E8SA 1P92A 2M45A 1XJ5A 3KFWX 4E31A 1AV6A 1L0OC 2LF7A 2L4MA 2AN5A 5GM1A 5JI6A 2OPBA 4IJAA 3GO4A 2NNNA 2O57A 2PJDA 1WI9A 1HQCA 1IN8A 2O06A 3ANXA 3FTDA 3FZVA 1F5TA 5K5QA 4RVDA 5DXJA 2C7RA 4PYKA 3HUGA 8MHTA 3SR4A 4HLXA 5K0GA 3WTVC 3C18A 2JH9A 3T7SA 2AOTB 2F5DA 3OPNA 2BE5F 2DPUA 1Z6TA 5F2OA 3VYWA 1G6NA 5LLQA 3G5LA 4K2EA 4DQ2A 3PT9A 5GP1A 2CMGA 3RKYA 1N7IA 1LJ9A 3E5UA 5E17F 1ORIA 5IT9Z 3BPXA 4OOIA 1OPCA 4FR0A 2FE3A 4G94A 3BWMA 2VZ9A 2WTEA 5HDKA 4R6XA 3AJDA 3NWEA 3H2BA 4GOND 3A25A 3TKYA 2JHPA 2KW5A 2AVDA 3F8MA 2G71A 4U7TB 1NE2A 3ZN0A 2O6GE 2BV6A 4M73A 1LDKB 2XIGA 1EIZA 5GIPE 5DD8A 1LQ1A 3KQOA 4DCMA 1B59A 1G3WA 3DKWA 2IH5A 4CKCA 4MTDA 3MEXA 3MQ2A 2EA2A 2PBFA 5FFZA 5BS6A 1KU7A 5CVRA 4ZZDA 1Y8CA 2ERCA 2XKOA 3LECA 4BY9E 2VN2A 4RYLA 5DUKA 3G2PA 1VP3A 4GEKA 1KXZA 2M87A 1SAXA 2PN6A 2FK7A 2PX8A 3FPEA 4FP9A 3GGDA 5C0OE 4Q48A 4XRFA 5HILA 3M4XA 3LFKA 2VDUE 2I6GA 2ZZKA 2VXZA 3QU6A 4GBED 3FYCA 4OQEA 3FTFA 3ROUA 4L0YB 3HCCA 2ELHA 2H09A 4QTTB 1G4DA 3WU0A 5CVDA 5K5RA 1YW9A 3UJ7A 1PJZA 1S7AA 3FM3A 3J81K 5DX8A 5T67A 2IP2A 2P5LC 1U8RA 1F3LA 4KVZA 5EZSA 3GRVA 3EEOA 2YX7A 3HRSA 3T7TA 3ZMDA 3WTWC 3I59A 2ZBPA 5DV5A 1BKYA 3ER8A 4A6EA 1XMKA 2VOPA 2QQAA 1H1DA 4RVHA 2FF4A 5E1XA 2V74B 5CCXA 3R24A 1BOOA 1OKRA 3EGEA 3K69A 3KLOA 1S8NA 4ESJA 1RNLA 1OYWA 1CGPA 4ESBA 3V8KA 1LEAA 2QE6A 2IT0A 4OIRF 3F22A 5H02A 1ZH5A 2PWPA 4IHSA 3I54A 3BGIA 2YVLA 4WF2A 3UZUA 5EIFA 2NXNA 3BGDA 3RI4A 4OMYA 5EMMA 1WKMA 5DT2A 2P5VA 3E3VA 2B2CA 2X4HA 4B09A 3L2CA 3GX4X 1KPGA 2IBTA 2UZ4A 1S3JA 4KUMA 3GFJA 1R18A 2P5KA 5EMJA 1KQ9A 3M6VA 2OBPA 4ZYGA 2ZWVA 5AIQA 1R36A 4XLPF 3E7PA 5LQUA 3TOAA 2M1BA 2EWNA 5FHRA 3CUOA 4M6YA 3KE2A 4CWAA 4RTPA 1ON1A 1L3BA 2MLKA 5D8LB 3THRA 2E5WA 4RTMA 3MTEA 2O0LA 1GXPA 4U88A 2OQGA 1I6XA 3BGVA 5DM0A 1U6GA 3KQMA 4KICA 1P39A 2IRFG 4E2YA 4DA4A 4R1HA 2OKCA 4PGHA 4GC9A 5A2QZ 1HSJA 3NWBA 5LQKA 4NQWA 1BIBA 3HP7A 3QOXA 4EJVA 3IRQA 2QM3A 4UVCA 1TNTA 1YW7A 2H6CA 4ASNA 3A7EA 4ISCA 2P7CB 4EJTA 2XVAA 2ZIGA 5HVQC 5TJJA 4PGGA 5DX1A 1B6AA 5HLIA 5E1WA 4LWPA 4CXFA 2V7EA 4M38A 2VS1A 2F8LA 4WWCA 3GZ6A 1QYRA 2STTA 5LGUA 4EM2A 2H6BA 1K7AA 1AF7A 2PQ8A 2XYVA 1BC8C 1RI2A 2ETHA 4YUXA 3WGHA 1EQAA 2QZ8A 1X1DA 3FRHA 4ON0A 1FWZA 2P8TA 3KP6A 3G89A 3DPLC 3DTNA 1PRYA 5C9ZA 1G38A 1JTEA 1I4WA 3HTXA 5LBQA 5DTQA 5K03A 2NP6A 2JZYA 4K6MA 1F1ZA 5HZMA 2BR5A 3KKZA 4ER6A 4BYYA 2XKPA 3J80Z 1KPHA 4M7RA 1KU3A 2YX4A 4RTQA 2DT5A 4S05A 2NXCA 2DQRA 3UA3A 3GJYA 4FSDA 2FQ3A 2LKPA 3HVHA 3WTXC 1UCRA 2G70A 1Y0UA 1ZRDA 1B42A 1IXRC 4KNYA 1W5SA 4O29A 2CG4A 2DLLA 3UJ8A 1OR7A 3NEUA 4JQFA 4EV0A 4BLUA 3T8RA 1SD5A 2LDUA 3ELKA 1NV8A 2HFHA 5DCMB 1T0FA 2R7DA 4HTFB 3GO5A 1YS6A 4C03A 1VBFA 4ATNA 5ILSA 4AZVA 5L3DA 3ELUA 1T43A 4EJUA 4QPNA 2PY6A 5CYVA 3KR2A 3O7WA 4X63A 4AWXB 4F85A 3IL2A 2AVNA 2K7LA 4EK9A 3P2IA 1R00A 4I7HA 2QENA 3IYLW 4EM0B 5F2NA 4OX9Y 3OE4A 3OZSA 4A0ZA 3B89A 4RTLA 2HEOA 1YF3A 3IWFA 2O07A 5E9QA 2PFBA 5KYGA 1F38A 4HX4A 3MFKA 3ELYA 5EMLA 1Q1HA 2ZVJA 5LRSA 3V7CA 3PX3A 2E1NA 4CHUA 2EJTA 1UIRA 5K0CA 3E6MA 2QQBA 2MA3A 4KIGA 2C7QA 4XLNF 1QZZA 1IN6A 4LK1F 3GVAA 2A68F 4CO8A 3K9TA 1HSTA 2FRHA 3BWGA 3AXTA 4M9ZA 1R6AA 3F6OA 2P3QA 2A14A 3W6KB 5K0NA 1I5ZA 2IPXA 3KQQA 4KYWA 2XGXA 3TGNA 3PFIA 4C4AA 2VE8A 1VQ1A 3PVCA 2K02A 3K0BA 3HCEA 3OFJA 1IXCA 1IRGA 5E8RA 5DCFA 5H6RA 4FSXA 1NT2A 3G8BA 1R1UA 2PT6A 2ISZA 3BWBA 2FOKA 1HNNA 4LJZF 4Z2YA 2R7FA 1L3LA 5BMZA 4DCGA 2J5PA 1ZG1A 2Z5UA 1USSA 5D5WB 5H20A 1VE3A 4EQZA 4RTOA 2Z99A 2IJLA 1N7JA 1QAQA 5GIOE 3LWFA 4PYMA 5KQRA 2KIMA 4LK0F 4RTSA 1YUBA 2JT1A 3EGIA 2XUBA 4RV9A 3GCZA 1BI0A 1FJXA 4RGUA 2JJQA 5CUQA 5HS8A 2CSOA 2H1RA 5HFJA 1IXKA 1XB4A 2Z6AA 2HTJA 4R8RA 3DMFA 3SSNA 3AWIA 4A12A 3CUQB 3KPJA 3F8BA 5K09A 1DUSA 4C06A 3CJTA 2FNAA 2ZJ2A 3F72A 2OD5A 3RPUA 4MNUA 3O3KA 2RQPA 3IHTA 3UJ6A 3NMUF 2EJRA 2F2EA 2W25A 4YUYA 2ESHA 3GFMA 3R0JA 3U9GA 3EYIA 4OQDA 3EVAA 2IGTA 4F86A 2NP7A 1G60A 2JRTA 3JSOA 3HCFA 3QOWA 4XUCA 4PIMA 3MCZA 5ICCA 5FA5A 2VONA 2DPDA 4YUZA 2ZBRA 3P7NA 3BXOA 4PYQA 2MH2A 1Q0TA 1L3IA 1K78B 1W7PD 3FHZA 5D4SA 3KQSA 3M70A 4I02A 4CKEA 3GF2A 1KR5A 4HG2A 3DXJF 2NYXA 2W24A 4HRAA 4P9FA 4P58A 2DTRA 2EB7A 2L4AA 5F6FA 2XAGA 4GCVA 1SD6A 5FWAA 1YQAA 1R1VA 1IXSB 3G5TA 5EVJA 3E23A 2CWEA 2BYVE 3FRIA 5FTWA 4IRIA 5CD1A 1YB2A 3ZMSA 3P9CA 1Z91A 5DWQA 3M33A 3IKVA 3O6BB 1FPQA 1FT9A 3TDZC 3ERED 4ER5A 5HIKA 5EHIA 3G3ZA 2O03A 4MQ4A 1WS6A 2PV0A 3GNLA 1FP2A 2HYGD 2RV8A 5ED4A 2DO7A 1W7PA 2FBHA 1WG8A 3HOSA 1JQ3A 1MD0A 2CQKA 3V7SA 3TFWA 3GRUA 2H00A 5EMKA 2NS0A 2IFTA 1SKMA 3PQKA 1F4KA 1RI1A 3N4MA 1I1GA 3I59B 3FWEA 3ZMUA 3SMQA 3MB5A 5FD5A 9MHTA 3QPHA 4S04A 2VC1A 2FRXA 1ZQ9A 2MH9A 2XRNA 2V1DA 4FGZA 3FUTA 3HRTA 1RI5A 4OU0A 3LKDA 1BJAA 2IA1A 1ZLJA 2P41A 4E30A 1JHHA 1Z1DA 4X61A 1ZG3A 1UHMA 3WGIA 2OU2A 2O61A 1IW7F 3LX6A 4UOEA 2PXXA 1TTYA 2MLGA 2HNKA 4EJWA 5BXYA 2HMYB 4DKJA 2J5OA 1SQFA 2KKOA 3BZ6A 3A27A 3A26A 3KPUA 4GYIA 5EIWA 2K4BA 4UVBA 1IUYA 3AXSA 5DRTA 2XROA 3BOQA 2B25A 5F2KA 4G6DA 3B02A 4MGRA 2XAQA 3KETA 4P7JA 2MD5A 4GOMD 3LA2A 3RKXA 5CVIA 2NXJA 4GUAA 3GRYA 1JQDA 3KQYA 4HW0A 4G7OF 3OU2A 2IDJA 5K0BA 4RS8A 2OQRA 1BOAA 5AIPA 5E2BA 1BI1A 3ZP5A 2G9WA 2XASA 5D8KB 3MHTA 5E1ZB 1O7FA 3WODF 2ONZA 5EGSA 1O3SA 3O2PE 3TQNA 4BP3A 3B3FA 2WWYA 2HTEA 3EMDA 4L9TA 3DXYA 1MDMB 3TR6A 5E1BA 2QWWA 1L1EA 5T6BA 5FO5A 5E9JA 3HSFA 4E32A 4R8SA 1SUSA 3I64A 5L3BA 3I5UA 1N2XA 5KVAA 2B3TA 3QU3A 4CKBA 3FMRA 2L54A 3ELDA 1XGMA 3DQVC 5J8CA 1YTYA 1XXLA 4WXHA 3GLXA 3R61A 2BM9A 2JPBA 3F8NA 3WTUC 1ZREA 5HOOA 2YUIA 2GPYA 4EVIA 5L3EA 5BW4A 3G2OA 4R79A 2O8XA 3V8JA 2JSCA 2HQNA 5HDGA 1M6EX 5D5VB 4PYIA 2PXAA 1TQMA 1VPTA 4GOOD 4MEYF 5EKUA 1HXDA 4WXCA 2H27A 3ECHA 3WTZA 4OBWA 3GFLA 3WTTC 3G2QA 3P71T 1TLHB 5FQNA 3Q9VA 1XGSA 3CDHA 1GVJA 3GU3A 5K0LA 3HTUA 4IRGA 5KQSA 2DQLA 1WZNA 3K1NA 1J59A 4QTUB 3R9XB 5DEQA 4YV2A 5KS2A 3UJDA 4LECA 3HVIA 3EVZA 2QUFA 4N0BA 2DPMA 3C3PA 3CUQC 1KPIA 4XCXA 1B9NA 2RKHA 4HDUA 2PLWA 3BKXA 2FU4A 4DNCA 3RW9A 1LB2A 3SGLA 5MHTA 3RODA 2ZMEA 2Z9OA 3H3ZA 5U4XA 2GA9A 2ZFWA 4A0YA 4G9YA 4LMYA 2OB2A 3FXRA 3DULA 2GAFA 2HV9A 1W4MA 5DPMA 2ZKZA 2HKOA 3QRFF 2O3FA 3IWZA 3SQNA 3DOUA 4QVKA 2XV4S 1IN7A 2K4JA 5D6EA 1Z3CA 1FNNA 3JWIA 3K2ZA 5D6FA 2YR2A 4P55A 3GWZA 4HGYA 3GRZA 4RTRA 3EMBA 2GWRA 1IRFA 1YZHA 1FBNA 4CGZA 1HBXG 5EG5A 4EKIA 3MERA 1K6OA 1BN5A 1JSZA 2GA1A 3GW2A 3ERCA 2HGCA 3H92A 4Q4ZF 1NBIA 1FYMA 2PX4A 2KJCA 4U0YA 3HSEA 5D5XB 2BGCA 3OCJA 1G3YA 2W85A 3P9KA 2ZSUA 3BP8A 2RC4A 2EV0A 2P3LA 2ZLBA 1LDJA 3LSTA 1D8KA 1AOYA 4BAYA 4RGXA 2EFWA 2MC3A 1R7JA 4E2XA 1TBXA 5L3FA 4MIKA 4U7DA 2B78A 3WTYC 4HA8A 2XVMA 1USTA 3QP6A 3LAJA 1ZARA 2X0LA 1SMYF 4QVGA 3SX0A 3GYHX 3BWCA 1EG2A 1D2CA 1OYIA 1QAMA 3DV8A 5K0EA 3TDUC 4R05A 4WXDA 3Q87B 3D0SA 3BKWA 1NW3A 2ESRA 1UFMA 3FTCA 2NNWB 3KP2A 1FP1D 4ZZLA 4HLYA 3FXQA 2ZWAA 2A69F 3F4KA 5ICGA 4Y13A 2FCAA 4I98B 1XDZA 4LLNA 5J8FA 5FULA 2PSSA 2YTZA 4EJOA 5EEGA 2E1CA 2IW5A 2JHAA 3ISPA 3OZTA 3DMGA 3P2KA 1KP9A 1E2XA 3KP7A 3MWMA 5BOXA 1R74A 3BDDA 4CXMA 1DPUA 4E70A 2C6YA 4PYNA 4EGZA 4KFCA 3L9FA 4RGSA 5K01A 1DL5A 2CO5A 3THSA 5LQJA 3B5IA 3SSMA 4IPAA 4KMFA 4O5VA 2C7PA 3ZMZA 3RTRA 1BI3A 2OXTA 2W84A 1KQ0A 3MCTA 2YU3A 1U5TA 1R5GA 2QVOA 3KP4A 2VT3A 3EEYA 3WU1B 3I58A 3C6KA 4P5OA 1BI2A 3HCAA 4ER0A 1ZGJA 4GYGA 2Y75A 5FADA 2GLUA 3PLAE 1YO5C 4IXAA 1YYVA 4ESFA 1TPYA 4NHJA 2F5EA 2H94A 3VOEA 2CGPA 3KQTA 2V1XA 4OIPF 5ICEA 3P9IA 5DRYA 1WQ2A 5FFXA 2EFQA 1EJ0A 3V7RA 4LWOA 1UHWA 2EFOA 3ZPLA 1MZBA 2OAZA 3LDUA 3SZPA 3VEPA 1T39A 3WTSC 3HA5A 3FPHA 3KR0A 4O3MA 2QQ9A 4L9VA 1ZLKA 2ONYA 2L01A 2PBIA 2UYHA 3KP3A 2GB4A 4GF5A 5ICFA 1JSXA 2M5WA 3WSTA 2FMLA 1W5TA 3LDFA 3R6SA 3KCCA 2E7XA 1LEBA 3HEMA 1P4AA 4RB3C 2QY6A 3DEUA 1JG1A 2FHPA 5EKXA 1IY9A 5E8IA 2R3SA 4N9IA 2JHCA 2A3SA 4HDVA 2PI0A 2ZFUA 4M36A 4HBLA 2I62A 1P4WA 1HW2A 5HIJA 4HF0A 2HQRA 4IKPA 2BR3A 2UZKA 2VDVE 1J5YA 3PTAA 4ENNA 3UFBA 1SD7A 4L5JA 2NNYA 3B3GA 2K86A 4MEXF 1X3UA 3SVZA 3HVJA 3HYIA 1FX7A 4XSZF 4U0VA 1RI7A 4LB5A 4BNCA 2FPOA 3F8CA 1WSUA 5BW5A 4LG0A 2LSOA 1G55A 1PP7U 3C7JA 4KN4X 1YW8A 4LLLA 3UWPA 3FMQA 4IF4A 1NV9A 4PWYA 4FX4A 3SSOA 1IF1A 1R23A 4IRHA 4H0EA 3FPFA 1LDDA 3HOTA 4WCGA 3UJCA 2BM8A 1XCVA 2B0LA 2BEOA 3BJ6A 1UFKA 4IWNA 5L3CA 4BLWA 1CF7B 3OFKA 3T7RA 2UYCA 2P4WA 4OINF 1YFLA 4ENKA 3ABTA 1JE8A 2XYRA 1HKTA 3IKTA 2PWYA 5LHHA 1G3SA 1JQEA 1ZN2A 3ZMTA 2HDCA 1E17A 4RVGA 4FZVA 5KVRA 5K5OA 3J7AO 3ELWA 3V97A 1FSEA 2LD4A 3SXJA 4YUWA 3F6VA 1Z05A 5CVVA 4FS8A 3VODA 5HLHA 3OU6A 4PONA 3HHHA 1B9MA 5LHGA 1HW1A 4E33A 1S7OA 1U5TC 3GRRA 5D5UB 2P7VB 2FK8A 3HNRA 3FX3A 4C08A 4QDJA 2D45A 2VC0A 1AWCA 2ZNZA 4ZYHA 3LCVB 5K0FA 2KJBA 3GUDA 1YLFA 5FGMA 1ODDA 2OZVA 3MTIA 2B9EA 3CKKA 3FMSA 1O54A 2QRVA 3T5XA 1OMIA 2FMYA 4DF3A 2XVCA 2IPQX 2NAZA 3IV6A 1SG9A 3DR5A 3JWGA 3RJPA 2VOOA 10MHA 3DXXA 1XDUA 2FXAA 4BLVA 1DDNA 3I0TA 3BZBA 2IVMA 2ZBQA 3K6RA 3NRVA 2D1HA 3WE2A 1XGOA 2W57A 3LKZA 3ABUA 4B17A 3BJAA 4CYDA 3IRRA 1T2KA 2DULA 3P8ZA 2QBYA 4PIPA 3WG9A 4POOA 3DPTA 5ERIA 1QO0D 3GEZA 3KR1A 5LGTA 4QDKA 3NTVA 3TOBA 2OYRA 4ER3A 2GXGA 4OIOF 3HIFA 2ZW9A 1B1BA 3KU1A 2DBBA 3M9AA 2D2WA 4HYEA 4AUKA 4QWQA 3E5XA 3HHGA 5FUBA 2AZTA 2L02A 5DD4A 1O9GA 1YG2A 2VP3A 1PUEE 1IN4A 4DQ0A 3I4PA 3FYDA 4IHTA 2EA4A 1SD4A 1QNTA 3TPZA 1IAWA 5D4RA 3DLIA 3DFGA 3M6WA 2EV6A 2Q2EA 3KQWA 4LGWA 4Q47A 1VIDA 2AN4A 3M1EA 2AOVA 3D2LA 1I1SA 3RPQA 4LG1A 1T38A 3TKAA 1H0MA 3KQPA 4YMHA 2YPRA 4BH9A 2XAFA 3C3WA 1OR8A 2EK5A 2G1PA 1KU9A 4WK8F 4KDCA 4RTNA 2KRFA 5DSTA 2EX4A 5E1OA 1P1CA 2AOUB 3BJOA 5DYMA 1QGPA 1J9IA 2XAHA 5DTMA 3MAJA 1DUXC 3O4FA 3KPWA 2EG5A 3FZGA 1L3CA 4OBXA 3TOSA 3J81Z 3O31A 1QQIA 4YFKF 4EMSA 5EOVA 3NVMB 4PCAA 1STZA 1NW7A 1WY7A 3I71A 4M37A 1KIAA 1MKMA 5FCDA 1KHHA 5DM2A 2WV0A 3UJ9A 2EFPA 3PB3A 2RDPA 3JSPA 4PINA 3Q5FA 2A07F 2CL5A 1REPC 1D5VA 2R6ZA 5JUWA 4B8XA 3U81A 5LR6A 4HV5A 1EAMA 4ZYEA 5CVEA 3V8VA 3EUHA 2JH8A 2Q0OA 4KWCA 3AAFA 2K27A 4EKGA 2GS9A 3EQLF 3L00A 1G6Q1 2GZWA 3CLOA 3V8LA 4BXUA 3WGGA 1D2GA 3G88A 2Z6UA 4MTLA 2ZCWA 2Y48A 4HH4A 1JG2A 4CICA 2XYQA 1A04A 3E5QA 2V6CA 4G7ZF 4HGZA 5H6QA 4YIFA 2AS0A 4PYOA 2H11A 6PAXA 1HMYA 4OA5A 3N97A 3BPVA 2EFJA 1ORHA 3REOA 3EVFA 1U3EM 2F5CA 4RB2C 2P8JA 3BY6A 3MQ0A 1D3YA 1XMAA 1ZHFA 4AZSA 3LQQA 1VTNC 1X1BA 2UYOA 3HA7A 3JW4A 2YXLA 3LPMA 2GA2A 3RYRA 1O3TA 1BBYA 4HX8A 1EV7A 4ENMA 1I9GA 1AQJA 4JBAA 4FT2A 5D1HA 3WE3A 4ER7A 2EFNA 2ZXJA 2FA5A 2ACJA 4C05A 5CCBA 3TM5A 1O3QA 3L7WA 3FPGA 3C0KA 5JVTA 1H9GA 3FXUA 1DP7P 4ETSA 2OZUA 3U2RA 4GXOA 3RKWA 5FA8A 3H3UA 4ENJA 3VC2A 3IC7A 4LD5A 5GM2A 1R8XA 2ZIEA 5BPIA 3E6DA 1MHTA 1RJGA 5JR3A 5G02A 3FF5A 2VBXA 5AONA 1XSDA 2EV5A 4RSRA 4N9HA 1J7KA 4L5IA 1XN7A 3LBYA 2PMHA 5GWXA 3QOPA 1G8AA 4HOBA 5HDNA 3ML6A 3A4TA 3DUWA 3U1DA 3GDHA 3KEQA 2O0YA 3T0YA 4PYLA 3EGVA 4HF2A 5IH3A 1PP8F 1F9NA 1V4RA 5T64A 3IEIA 1OYYA 3S68A 3T1BA 1VLMA 2Q8KA 3C1DA 1M0EA 4YMGA 3TQSA 5BP7A 3VSEA 3OV8A 4RTJA 3CUQA 1ONVA 2AR0A 2CWWA 4U7BA 4UV8A 4AZWA 5DCMA 4X41A 5LQNA 3F21A 4QLCU 3EDPA 2PMUA 5EHGA 1TW3A 3NJRA 4KDRA 3UA4A 5HS9A 3UJBA 4LFUA 1SQGA 2RNJA 1QANA 1XTPA 3OZRA 3R0AA 3D5LA 5F1RA 4R8HA 4BQAA 5GOZA 2HYFA 4FT4A 1MJFA 4M6XA 3PS9A 3M8EA 1U2WA 3GIWA 1M6YA 1MGTA 1ON2A 1FYLA 2IA0A 3OE5A 2VBZA 3HA3A 2UYQA 1K79A 3KLNA 1RUOA 3LCCA 4UUVA 1U78A 4OA8A 1TQIA 4E2ZA 7MHTA
chains in the Genus database with same CATH superfamily
1F3OA 2HYDA 3PS9A 2GPTA 3EQ9A 3UUFA 2P9QA 5KNDH 2G4LA 2DUWA 3LWZA 3W2VA 3UBTA 1SC7A 3E5MA 3TZQA 4BFXA 3IBTA 2DK8A 3C3DA 1NLUA 2HZDA 3ESYA 2PJRB 2HHAA 4RAZA 3J7ZI 4BVAA 1SFOJ 4R71A 4P3OA 2NGRA 3ETDA 5KAIC 2CF6A 4P33A 3DZGA 4D74A 4J1TA 2O2CA 4JT2A 5IXYA 1UPTA 1VB5A 2DX7A 1GZ4A 1EESA 1CZLA 4LC9A 1YS7A 4QWWA 4XQ9A 5HOQA 3SC2B 1UMBA 1XEWX 4Y2HA 2ZULA 2DFIA 4DJTA 3MC1A 2CHFA 1ZK8A 1ULZA 3FROA 3ZWDA 4A5MA 4DBRA 4QLAA 5CLGA 4RGVA 4EG4A 1ZSNA 2QWXA 4LY6A 2ZG6A 1FFHA 2DF8A 3NTUA 4ZHQF 1EHCA 3OTIA 4DR4B 3MCAA 1K8QA 2XNDD 2CQ7A 3F0CA 3LE8A 4FD2A 2C95A 1XK7A 3U7JA 3LYHA 4YV0A 1LJUA 2EGUA 1SH7A 1XDWA 5I7HA 3QITA 4AIHA 5G1OA 3T8YA 1T9DA 3H5LA 3PI6A 2AFIA 1EFHA 4QJ5A 3KQTA 4MWTA 3V8QA 4RPCA 5D5HA 4BEJA 5J1SB 4LJ8A 4B3GA 3RUPA 1MDFA 3E35A 1RWNA 1CE8A 1Q1EA 1OXBB 1D7AA 4YN3A 1S6LA 1OWNA 4A3IJ 1XSXA 1ZVMA 1V43A 2O4CA 2QSJA 3E2IA 1M2NA 5JSQA 1WRJA 3SIWA 1PL6A 2BEUB 1HTWA 4CJXA 3RARA 1PZHA 2DUNA 1DBWA 5TB5A 3AP3A 2I4NA 3VDNB 2CMHA 1HF3A 1OXVA 3GLFA 4KYIB 5CT5A 5J58A 3HMKA 1BO6A 4TXHA 1KDYA 3H2KA 2ZUSA 2WA1A 3WV5A 2PS0A 4CF4A 3MZYA 1E2JA 1KVUA 2HK9A 2L7KA 2WPNA 4QELA 4M6WA 2TMKA 1Z0KA 2XWJI 4B3MB 4FQGA 1NI4B 3RNLA 1AA9A 1UG2A 5EQDA 4MS4B 3TTXA 1YIJI 3CRW1 3B6MA 2CLEB 3E9MA 2QD4A 1G1MA 1MNMC 1WY5A 1YDHA 4KDCA 2QL7A 4AKGA 2EGGA 2Y1XA 2JIQA 2I99A 4JQCA 4KIUA 5AVWA 1IIBA 1C80A 2XDQA 4N3BA 1MABA 1RYMA 3CFYA 1E3HA 3KLPX 4ZYVA 5FL7A 1R6RA 2AFHE 2V5UA 3CTAA 2E34A 1R6XA 1C30B 4BEHB 4Y2TA 4CR8A 5J2TA 4V0MA 3I6IA 2H8WA 1Z12A 2BF7A 2OZEA 3ZE6A 4EW2A 4GO1A 2RIRA 1OXSC 2KIUA 1RP1A 3WIBA 5IW8A 3ROFA 1NVBA 2DAOA 2L7MP 4FCYA 2ZMEB 1FFEA 3MG9A 1R4MA 3O83A 1IXYA 3D5EA 3W2EA 5FBZA 1JBKA 1ULSA 4JQSA 3QPTA 1GG5A 4PHCA 3BG7A 2NAPA 3RVLA 3VJLA 1U4OA 2KHZA 4JFAA 4P36A 5J1TB 4MWDA 4DMHA 5EE0A 1SZJG 2NZUG 3INRA 1W5CC 3IXMA 2DOEA 2QJRA 5E1DA 3Q9LA 3BDAA 1MMNA 4G2NA 3NEAA 2A1UA 3ZX4A 1UJ8A 3EVNA 1E3PA 2M3AA 1G7RA 4URZR 1ML3A 2PX2A 3T7DA 4ASUD 1M10A 1Y5RA 3K94A 3OOHA 4AKTA 2VZ8A 5TRTA 4JZKA 1T8SA 2AS5F 3GTLJ 4KH0A 4EHKA 4BWYA 2FE1A 2P6SA 1E60A 4EEFG 1DTWB 1EVLA 2XA9A 4ENSA 4P5EA 4JLAA 4QQKA 3T1HB 2XQIA 5FWXB 1JR4A 3NLLA 1JHMA 4KXNA 3G4SI 1KYZA 4YELA 5BWBA 1GYPA 2RE8A 4XLEA 5E3NA 1AKHA 3VYRB 2E4ZA 2R7WA 3QWFA 1PLLA 4PLGA 3KXKA 1LUAA 3V9PA 4W5QA 2MJLA 4TT3D 3RWMB 4N39A 1FTQA 1ZVKA 2PX6A 2IOYA 2VOJA 2YV3A 3A0HC 4FT8A 1DKUA 1NYRA 3DYBA 2PL3A 3EPRA 3F74A 3Q0IA 2CJFA 3U13A 3W1WA 2FVYA 4B4VA 2V9VA 4EL0A 3AV3A 1X19A 1WUKS 5DNVA 1V39A 4UEKA 2CW0F 3QGMA 3X1XA 5IF9A 1YZ3A 1KNXA 2BIFA 3A05A 4D5EA 2PYDA 2H54A 4MA5A 3DJYA 1C3VA 1VSBA 2HDNB 3G59A 3O8OB 5EJFA 5IC4A 3RYPA 1T4CA 4KU4A 2WC2A 3MLEA 1Q1AA 4MYUA 1XMJA 2DBQA 3K92A 1LVKA 1JU4A 3AI7A 1MJBA 4N0EA 3RVSA 1VPWA 3GDOA 4Y1EA 5TSDA 1MVLA 2VPQA 5DP1A 3KYIB 1PT7A 5FUWA 1TC2A 2BJVA 2VQDA 2ZIFA 3PR2B 4DM4A 4E5DA 2EERA 5CDUA 3WYAA 4DOMA 4QA9A 1K2WA 1ACIA 2C2HA 3LAPA 3OSZA 3S2UA 1GSOA 1T2EA 5KK1A 3QPVA 1V16A 2CDNA 3L8DA 4P96A 4V0ME 2QLFA 4IDQA 5B66C 1AS3A 1QH1A 4QPOA 2DA3A 1GQOA 1R9NA 2R2AA 4S2UA 4XEUA 4ND5A 4HRIA 3V3KA 3KOXA 1W2WB 2CDCA 3DE6X 2F43A 1OAAA 1KEEB 2HWYA 4KQHA 4OD0A 1YX3A 3S1QJ 2HCJB 4MP8A 3CCUI 3M81A 1OJ7A 3G1LA 4PBSA 1Y6QA 5AOCA 2F5VA 2OUMA 2X6QA 3SBEA 4S1VA 1N5RA 1DCMA 2X4DA 4IIXA 4LK3A 1W0TA 2ONJA 2YX1A 1O8CA 1SKQA 4BE4A 3B2NA 3D4BA 1N9KA 5TEVA 3C1UA 2GFQA 4F3RA 2ZRMA 4UXHA 4J7XA 1GNQA 4EQQA 4UFPA 1RBMA 1MX1A 1XYGA 2NPIA 2OD2A 2M30A 2ZGVA 3JYOA 3NHLA 4I5GA 4RXTA 1FBUA 3K70D 4JXJA 2N42A 1KFCB 3CVVA 2F1IA 3O91A 4H7IA 3FJYA 2VT7A 4ND3A 4O5OA 3TLMA 1VCIA 2OEPA 2BMEA 1ISIA 3S4YA 1HT1E 2C9DA 5E18F 2PGXA 3TI9A 3UANA 1NJFA 4HRVA 3P9YA 5JAPA 3K8ZA 3TB6A 3BAZA 4RC9A 2ATIA 2CL0X 2H59A 4A6DA 2QEXI 2EKZA 3OZDA 4I2VA 2GUGA 3AO0B 3B3JA 4GYJA 4XIGS 3TUZC 2M7BA 3WB2A 3LNQA 3COAC 1G291 1L5SA 1ZHHA 2N46A 1HT3A 2QAGB 3IT2A 3QVMA 2C4NA 3DPSA 4R8VA 4XIYA 3SIPA 1OFUX 1AA6A 1N6RA 5AR1A 3H11A 5AKGA 2RGUA 1G20B 1K27A 4FVTA 5KVSA 1N34B 2HBRA 1VRCA 2PCLA 5GZ6A 5IBRA 4ZWNA 3WADA 3NR2A 4U6NA 3DP7A 3WLRA 5FB2A 1Y3CE 4KGXA 2WJJA 4MUFA 1E2PA 4U3JA 3VC3A 1Y9AA 5CX1B 3QYFA 3I9OA 3BT7A 3W9BA 4NSNA 1ZKGA 1SXJA 4HQMA 3K0FA 8ATCA 1JUSA 2QTLA 4JR0A 1FLIA 1R6BX 2FBIA 2PYZA 4AU1A 4GKJB 2HO4A 4MVJH 3ZE1B 1TKBA 2QRUA 3GVXA 3X2SA 3GN2A 4B4DA 2GD0A 3EIUA 1UANA 3CDLA 2JANA 4PSWA 1O3RA 2AD1A 2Q2QA 2XYPA 2A57A 2Z5VA 4RLSA 3H2YA 4RKFA 1PUFA 4TYMA 4WA7A 2Z16A 4Z4HA 1J6UA 1MH9A 4QOJA 4DR2B 2V8BA 1UQRA 4GH5A 3TWOA 4ZO9A 5FNVF 5DFAA 2NU8A 4ADSG 4KE6A 1VHWA 3LV8A 4X85A 4YJHA 3IKLA 3INTA 3L8FA 2M8EA 5IFLA 5J4KA 4U0WA 3ZDDA 3K0HA 3ZXSA 1FVFA 2WWXA 1W9HA 1GGMA 4AMZA 1ORRA 1P2SA 1M34E 2IIPA 1SUIA 3AYZB 3RTAA 2M4GA 4Z54A 1H6BA 4WCFC 2B20A 3VHQA 1EXDA 1ULYA 4DG8A 5J63A 3I61A 3HSKA 3JXEA 3RSSA 1PKEA 3PFFA 1YHQI 3G8AA 4UBNA 3FH0A 3CO7C 2ZPTX 4YT4A 3HWX1 3AY3A 1IK4A 1ZJJA 4FHEA 2RVCA 1JKQC 4QPZA 3LX5A 1OT3A 1NZFA 3C8DA 3PC6A 2ZO4A 3GLRA 1BH6A 1DQPA 1ZIYA 4ERXA 5C37A 1XRPA 2C7OA 1W0JA 4MI9A 4O6JA 3NPMA 4Y7DA 4DV4B 3KEOA 1U1DA 1OB2A 4WTOA 3MJVA 3N76A 1ZESA 4ZO4A 1Q11A 3EVEA 1VQ7I 2XGGA 4N76A 3FGPA 1E9DA 1YIAA 2ZTHA 3RNOA 1VG1A 1Q6YA 5T5QA 3WKBA 3MWGA 3OQIA 1KYWA 2DP4E 2GH1A 3S28A 1IBKB 3TW0A 4BVHA 3WGVA 3H97A 3ZDQA 4H15A 4KKXB 3PGVA 4D02A 1IHPA 1E5TA 1TLLA 1YZLA 5IJAA 1Z4IA 4M9SA 4CKYA 1ZJWA 1JDUA 5EEAA 1EGMB 5DULA 2IOQA 4AN1A 5E3LA 4DXAA 2IBSA 1G3MA 5KJ6A 3FKJA 5DM1A 1C7ZA 3HS3A 2H07A 3LDGA 5BR7A 4QOFA 1K83J 3RTCA 1RMYA 3IMCA 1CS0B 3OFNA 4F93B 1FUIA 1FLAA 4UV9A 1XB2A 2JIMA 4WZBE 2IS2A 1CUCA 1ZAOA 3OZVA 2H2IA 4UZEA 4BBRJ 1KFKB 3KOOA 2YIJA 1P2FA 4P31A 4PNEA 1KGSA 3DOEA 4FHTA 1OGYA 2ZUWA 5JY1A 2F55A 2N75A 4Q9LA 4ZHQA 1YI8A 4WVLA 1NBHA 4QDOA 4FYMA 1LKXA 4BY7J 1H6DA 1S1CA 2G8NA 2QLJA 3D1LA 3JQBA 3JWPA 4NOKA 4QNMA 5HTOA 2ZI7A 3UBMA 2FDCA 3UNXA 4L8YA 3HSSA 2PX9A 1R0SA 4HB3A 3E2MA 3GAAA 1D5WA 2ZB4A 1GTG1 1ZW1A 3F6SA 3A9CA 3MTJA 5DTRA 2MCFA 1F0PA 3MEQA 4P7KA 2M6KA 5BN5A 3AI2A 5K5EA 3HYNA 3A9SA 1QB8A 3H3XA 3H6KA 3EJWA 2BFBA 4OP2A 4V0KA 1CY7A 3F46A 3CW9A 3P2EA 1L7OA 4TV8F 5ECWA 2VKDA 1ZK3A 3MD0A 3NUGA 5EUQB 4OIMA 3QA9A 2BDTA 1M34A 2W6ZA 4B32A 5F7ZA 2LWIA 4FFPA 4ID9A 2XY4A 4S0ZA 3HBLA 4J0HA 1MC8A 1VI2A 1ELOA 2KLBA 3K5IA 2IVZA 2XUAA 1RZ4A 4KA4A 1K4TA 1IG0A 2HKXA 3D31A 3VKVA 3UAXA 2R1VB 4WGFA 4NC9A 4XIFA 3U26A 4OXQA 4PVDA 3CF5F 1BHJA 1V11A 3F1KA 3OZGA 5LYJA 3FBTA 3SIRA 1X2NA 1K8XB 4NJMA 3VB2A 1RYEA 3KK0A 2QNBA 1OBFO 1RE1A 3CX7A 1G8FA 4JOMA 1ONNA 4ZYDA 2Z33A 3LKVA 5HHTA 3AJEA 3DXZA 5ECYA 1HLGA 4ALNA 2K9QA 4C2UA 2F5FA 1I3AA 3WL7A 3BR0A 2VBWA 5GP9A 3O82A 1SG6A 1WUHS 4IEIA 3E97A 2VBYA 3MZHA 1G2HA 2CXNA 2NZXA 3IJPA 4RY0A 4BVBA 1L8OA 1Y81A 1QFZA 2WTXA 4LG0B 3EA0A 1BQEA 5C4IA 4CLOA 2KZVA 1YE3A 3TPFA 2BW3A 4HPJB 3VU9B 5C7OO 1X1CA 4QYMA 4LRSB 3ZQ7A 2FUCA 4KBGA 2O2DA 4OF4A 1PT9A 3E5NA 3WLKX 2J9FA 1CFZA 2WTNA 4JASB 5FPSA 3TO6A 2HPMA 1YE5A 3SXPA 1UCFA 2IHZA 4Y2RA 2OFWA 3TCXB 3H2GA 4D4LA 1JEQB 3S2FA 3OQMA 1SRQA 4LQDA 3STUA 1KP3A 4BFZA 1G0NA 4IIJA 2XT9A 1MBKA 4AIRA 1EA3A 2NW6A 4JJ6A 3IPRA 4P32A 1Z77A 3CG4A 2H5JA 4WESB 4HF1A 3DVLA 2BLLA 2Z6QA 3PQ5A 3HB4X 3JQPA 4W9NA 1H85A 3C45A 4Y30A 4I01A 2Q5OA 3K9FC 3QMVA 3JWEA 3T52A 1IZ9A 2Q2EB 1MRZA 2CXXA 1PYGA 1YJBA 2P8SA 4UVHA 4B3FX 2C29D 1DINA 2BI7A 3VTFA 5G0WA 4C14A 3U7QB 2D1SA 1TIPA 3BRCA 3KOZA 3DFZA 2IF2A 3H2ZA 4GFBA 1NOIA 1MAAA 3LQ1A 3O8NA 2DRIA 1U04A 4GUDA 4V1CB 2B0CA 3I3SR 4YRTA 2Q4RA 2H8KA 2J67A 3AI3A 3T4UA 3LH5A 4QT4A 2XOEA 4UDXX 3LNCA 4TTRA 2HR1A 4OAYA 3CZPA 2FSVA 4K9RA 2MU1A 3L49A 1ZQ3P 2AIRA 4QRIA 5EC8A 3WB9A 2HO5A 1HV8A 1M67A 2FMUA 2NTYC 3WB1A 9GPBA 2HIHA 4TKLA 3P26A 3KHTA 4IFIA 4ZCIA 3K9CA 5EG0A 3ZTYA 4AO6A 2D0DA 3ZGXA 4AYBN 4JBNA 3G71I 2QU8A 3HLKA 1FFCA 1RJFA 3VSAA 3WLMA 2WKQA 4E5KA 3CEMA 4J0FA 2HZTA 4DYVA 3FNBA 3A9TA 4QOEA 4WH0A 4NZNA 2JCGA 2IDKA 2OHHA 2R7MA 1YJQA 2BGKA 3NKLA 1QHHB 3WGUA 4TKUB 1H2WA 1ONOA 2FZEA 2PUGA 2FW1A 3CRVA 1XK6A 3WV4A 2D5VA 1HI9A 3IP1A 1FW6A 4L0ZB 3QMWA 5KQLA 4K2HA 1JKXA 3U44A 2DFDA 1PFUA 3V00A 3HC7A 2DTDA 1SEUA 2JGRA 2UKDA 1O94A 2I54A 3BTOA 3DD5A 3N2GB 2VE9A 4PZUA 5B2EA 1VJCA 3T9DA 5FD6A 1QIKA 5AUNB 5LU9A 1KK1A 3PO3J 1R50A 1CJUC 2IXGA 4AWBA 4DQLA 5LDGA 5FPQA 2WHRA 4XR4A 4EB6A 5LP6A 1K5GA 2JDID 1DEOA 3SLKA 4YK7A 1P44A 4RAGA 2PSEA 1DWUA 1UZCA 1GZSA 2Z0MA 2YV2A 3WWPA 1NF9A 3MJ4A 3P2MA 3O8GA 1T8RA 1W8DA 3M6UA 2POCA 4GLJA 5C4JJ 4IGFA 3B7WA 1SJ9A 4O4HB 4XJSA 4PNPA 4D96A 3M5WA 3LQKA 4MPDA 2ODQA 3ITDA 3ZDFA 1R22A 4Z9AA 1SANA 5JV5A 4N01A 1J9GA 3C24A 3N1UA 4PTZA 1H9CA 2DI3A 3SXYA 2W48A 1ZD1A 1IC6A 3WQRA 1N5OX 2Q7XA 2F8MA 4YXWA 3L8YA 4MQMA 4AICA 4U5XA 3ANYB 2E1MB 1ISPA 1W85B 1G0OA 2CK3D 2Q4BA 5B4UA 2QQ0A 4CN9A 1FLDA 2NVWA 3K4MA 3ZMVA 4BQOA 1JPUA 1RC9A 2B5WA 3GXOA 2J0VA 2JAWA 2YY7A 4EA6A 2VT6A 3SFZA 4GE3A 1PFVA 4DXDA 2QTHA 5I5EA 1BU8A 4J0DA 4WWHA 3FDXA 4YRIA 1SBNE 2CLLB 5CGZA 1Z15A 2I33A 3I1FA 4G23A 4RVCA 4DCNA 2R00C 1YRLA 2PIDA 1SBYA 1ZY2A 2AB0A 3HZZA 2GRUA 4PG8A 1JMYA 2GOXB 5KCZA 1QQAA 3K3PA 2P0WA 3P2OA 2DUJA 1M6NA 1YS1X 4K88A 1V8BA 3W9SA 3ZY2A 3E0QA 4E2WA 6ADHA 5CA1F 5CJ9A 2KWIA 1T5SA 1CUEA 4G1EB 3WGNA 2QPTA 4LX8A 3NW9A 4BBZA 3NVKI 1JEDA 1R5BA 3ODPA 3H7AA 1R4NA 1TGYA 4DZRA 5K7SA 4JA2A 1XG1A 1OPRA 4HTFA 2ODWA 3T3IA 3RJ5A 5FLXK 3LXUX 1P7IA 1MBEA 4B3XA 3H1CA 1GOTA 4DZJA 1QH1B 2YXNA 4IH1A 3V46A 1FTZA 3FSRA 1FC0A 3O92A 3OPVA 1FUUA 2BJHA 3PEEA 3PKJA 3UV3A 4DY6A 1X1TA 3IOEA 4F9GA 4CLDA 5SYMA 4DDWA 3O8RA 3FLBA 4TN5A 3JQAA 3U4MA 4D46A 3TR0A 1I4TD 1VRVA 2G1AA 2DFPA 1EP9A 2IYTA 2ZBDA 3CZ9A 1NW8A 2PZLA 2HOEA 3FGOA 1OI3A 4XTRA 4V2IA 4YJ3B 1RWVA 2ILVA 4XM2A 4CF5A 5LLTA 3ZW8A 3U7FB 3U3OA 2F4IA 1T6YA 5TQ0B 2VODA 1J2XA 1FC3A 2K5CA 1U6IA 1V35A 3PNTA 1C0WA 1V48A 4HNVA 2O3JA 1PJSA 5KX5B 3PU6A 4A03A 3L4EA 4BAGA 3LUPA 1GA1A 3R3HA 3PE6A 3UC5A 2QBYB 3VKGA 4JLJA 1HQYE 3RUIA 1VPEA 2DFVA 2X5JO 3L40A 4D80A 3K6SA 2DPXA 3CLQA 3ZNNA 2HS5A 2ZJFA 2HBYA 3D0OA 2RONA 4RM3A 3TZEA 4MR8A 2Q41A 5F51A 1A9XA 4PZAA 5E6SA 2CW8A 1MVNA 4GMKA 3JYQA 4IILA 2GSWA 3CX4A 1PYDA 1SFEA 1S7EA 4PXSA 4F8YA 2BH2A 2RN7A 3VWBA 4RULA 1S3GA 1FBQA 1XQ6A 2E2WA 4HAUA 1FYVA 5LMUB 3RB8A 1XCLA 2P5YA 3EIHA 2AJCA 3UK7A 4NEQA 4E7LA 1DAKA 2IE0A 1DJPA 1E4VA 2OO3A 1X3LA 4L8LA 4JK1X 3QNUA 1QH8A 2H2AA 1HDOA 2CFXA 5BOSA 5HYVA 1O97D 3NIFB 4G6QA 2C5LA 1M83A 1P5FA 2BH9A 2UXXA 3CCEI 3ESWB 3MELA 4L0CA 4QEZA 2P27A 2Q4EA 2JJ2A 2IS6A 4BYMA 2HBZA 1LX7A 1ENPA 2GYVA 1L4HA 3LW8A 3M34A 3Q7EA 4QYTA 2ZUTA 2FRDA 2PZAA 3QY9A 1TCUA 2XAJA 1FX1A 1P7YA 3DE1X 5KDLA 1OTHA 5A9RA 5I7EA 2QG6A 1GNLA 1CZNA 3HSRA 3KJQA 2BY2A 3FUUA 4KQJA 1EDEA 4IGKA 5ARBA 1GFWA 1J7JA 1I33A 3H8WA 5B3SH 4FEEA 2GR9A 1DEAA 1TTPB 3JD2A 3MRXA 2ZYVX 5LOVB 1LY1A 3HBMA 2QX6A 4E31A 3VISA 2LF7A 3TP3A 3N8DA 1HETA 1WXIA 4Y6GB 1RRKA 2K40A 2TMGA 3GTQJ 2HA0A 2NSHA 2XRYA 1ZI9A 4IXDA 2HC9A 4JENA 4M1EA 1HQCA 2X9QA 2ZRFA 3C6YA 4OVKA 1ZJ6A 1TO1E 1R9MA 1COWD 3FZVA 1F5TA 2EQBA 3FTDA 2AZDA 4JN6B 2YMPA 1Q95A 1P45A 4HH1A 3UTCA 2FW9A 1EWRA 1JWAB 2QN3A 3HUGA 1MQ8B 3LUCA 4YRBA 3SR4A 2J3DA 4HFJA 3IS3A 3BCUA 4OPMA 3ZEIA 3SOZA 4NCNA 4BCDA 4HP8A 4N0MA 5JQGF 1X1RA 1XTBA 3WIEA 4J2OA 1JQKA 3NARA 2F5DA 2FG5A 4JEMA 4PFQA 3ZQ4A 1NBME 2DPUA 1I2CA 1Z6TA 2NO0A 4N0PA 2I6FA 2ZSKA 3BD7A 2HLNA 3OT4A 5F2OA 4FX2A 4ZT5A 1XTSA 2PCJA 3SOPA 3S1AA 4BRUA 1C1XA 2N1BA 1JG7A 1G6NA 2AWNA 5LLQA 1R3UA 1FQOA 1RHQA 3G5LA 3U0VA 5GP1A 2O3QA 4BUCA 2CMGA 3HKBA 1J21A 1JHQA 1SU4A 4WCVA 5LXTA 1E2LA 2W90A 4HBGA 1DV2A 2JW5A 4KQ2A 2IZ5A 4MO2A 4EMTA 2ZM5A 2VJOA 4FR0A 4Q93A 1IDOA 4L4YA 5HA5A 4BZWA 1Y3FE 1F2VA 2FE3A 4G94A 1T2AA 2W2MA 3BDVA 4AD8A 4UVGA 1BA5A 2WTEA 4M21A 4RACA 1ZD5A 1PZXA 1U5BA 2XGMA 1IUPA 3BA1A 1K66A 1JIQA 3N6XA 4N5MA 3W2GA 1PP4A 3NWEA 1D5YA 3F71A 4LPKA 3HPGA 3DLPX 1UZUA 1Z83A 1AUOA 3HGMA 3QUCA 4GT1A 2V6MA 1QU2A 2VSQA 3GFVA 4OHRA 3FZYA 1PSZA 3NBFA 3CUKA 4KODA 1NE2A 3OQBA 3ZN0A 1QZTA 1HOMA 3LOUA 4GGOA 4JYPA 4M73A 3ZDCA 4C2MJ 1Q1VA 2XIGA 3JCZA 1MMFB 1EIZA 1QR2A 2NO6A 4KO8A 4OHWA 3VKWA 2A5GA 5GIPE 4W1SA 3QE3A 5E4TA 1YZKA 3C5VA 4P4TA 1B59A 3QX7A 3KJEA 3PNMA 2IH5A 1UMCB 4AJIA 1KAOA 2NADA 2ZSAA 2PZFA 7ADHA 4YCLA 1Y1SA 3H8VA 2VEOA 3H9QA 3PICA 2WT8A 1ZNXA 3SC6A 3ILXA 4CR7A 4XB2A 2FN9A 2AXQA 2L0XA 2ZT5A 1ULUA 3DAFA 4N8DA 2A6TA 2EA2A 3WA6A 4M7OA 5FFZA 5BS6A 5AFSA 2BHYA 4BL0B 5TQ2A 4JYKA 4BU0A 1Y8CA 4FYYA 1HG0A 2E48A 1LJ8A 3LECA 4Q3EA 2VHZA 1VYTA 3RFUA 5IZCC 2IYRA 2PN6A 1J2UA 2YRWA 4NZMA 5DSZA 3OQIB 1QVVA 1YCGA 1PKXA 3LC7O 2X1CA 2GXAA 3H8JA 4FYKA 1KK3A 4I5IA 4BMNA 2QQFA 1OASA 5LJLA 2D2EA 3OE7D 5C0OE 4Q48A 2ZI5A 4BVFA 3DLTA 3DBVO 1SOAA 1VKJA 2Q2NA 3CZRA 3LFKA 3PUKA 2OJED 4UB8C 1CQTA 3K4HA 4KHZA 3WLEA 1BG6A 2O54A 4URYR 1KFEB 1NXWA 5GONB 3AVPA 4IBOA 2W93A 3N75A 6GPBA 4ZDLA 5GY7A 1ETHA 3OY2A 3QJYA 2XOKA 4Q3KA 2GMWA 3S29A 4IINA 4WGGA 4BNKA 3FTFA 3HCCA 4H0CA 1KKMA 2PTGA 1B72A 4IH4A 5T3YA 3JZMA 4D7MA 1BVUA 4B3HA 4BTEA 5CLFA 5JEEA 3EQ7A 4Y2PA 2BVNA 3WU0A 3FI0A 1BMTA 1OFUA 1SULA 1XRQA 2Q1TA 3HCWA 4FFMA 3MLBA 5HFAA 5GZ1A 3NOXA 2DPGA 1A9OA 1PT8A 5BSUA 1JEYA 5T67A 1NG9A 2V6JA 1RXCA 4DA0A 3BMQA 5AKEA 4EELA 1F3LA 1GAEO 1FQJA 1Z5OA 1WFXA 2YX7A 3PZRA 1RBQA 5DV5A 3RRZA 4A6EA 3KL4A 4LY3A 2J33A 2RFLA 2VKVA 3JQAB 5ULLA 3ISJA 4IOJA 5IOYA 2A0KA 2V7VA 2QORA 3R24A 1BOOA 3MTDA 1ZXBA 3R0VA 2PUHA 3K6KA 1E79D 2W8BA 3KELA 5T7BA 1HA3A 1KY5A 1CUWA 5H9WA 3WDSA 5BWMA 1IY1A 1RNLA 3IP8A 5LIPA 3HN7A 3FOZA 1LEAA 1SB8A 1U99A 1XKTA 1VG0B 2C4WA 3CEHA 2OCDA 3EZ6A 1GVDA 2QMYA 3H2SA 3GGCA 2W0SA 5ECGC 4LV5B 5EJ2A 3VKUA 3ZQUA 1Z4QA 1B4DA 1KYYA 1FMTA 3EDRA 1ND5A 2XX3A 4NTZA 1W35A 2C4KA 3BGIA 4G01B 3REQB 4M8NE 4FYIA 2QQGA 2YVLA 3O8DA 4JS0A 2LP4Y 3TLBA 5PNTA 3TAXA 1OAOC 2I3DA 2IHVA 3CISA 5JYBA 5EIHA 1H3FA 2NXNA 2RCYA 1ZEJA 4OMYA 5MDHA 4DUGA 5BVGA 4HVLA 3JQ7B 1W88A 3NH9A 2OC4A 4US0R 2H16A 5CQGA 1IOLA 3A1VA 1MA0A 1JKMA 4NEGA 3RFFA 2Q29A 2E4YA 3JZDA 4FJ2A 2B2CA 3TQRA 4CF3A 2X4HA 1K89A 2V3VA 3F49S 4Z9XA 5MF6A 4OYRA 3TBFA 3L2CA 1J4AA 4LOHA 4FOTA 1JA1A 1U5CA 4HGOA 1YQ9A 3CCBA 4GYWA 2QVLA 3UXEA 4CMBA 3GFJA 1EFKA 1MW8X 1KY4A 1CUIA 4Y33A 3MQFA 2B5VA 4IR7A 1QVAA 1BRTA 2PGNA 3Q5EA 3M6VA 1PR6A 4XRMA 3NFRA 2XWSA 3W8EA 4CM1A 1DIAA 2J32A 4K0RA 4KMSA 2GTIA 4C3ZA 4ZYGA 2C0CA 2JLSA 4CG3A 4UTRA 5AIQA 3RKQA 1HC8A 2I4OA 2OGUA 3FKQA 1NRWA 3FYHA 4CYCA 1ORVA 4Y7NJ 4D1QA 1B3BA 2BHLA 2Z5GA 2WVJA 2M1BA 1HZZC 4IIJB 4Q37A 5D01A 1KAEA 5FHRA 4KXQA 3KE2A 3FPCA 1R27A 3CJTB 1ON1A 1NVTA 1ZM7A 2M6SA 4S24A 2A5WA 2QLLA 4QEKA 5JD3A 2K3PA 5D8LB 8OHMA 4RTMA 2O0LA 1C9EA 4KQFA 2FPPA 1W36B 4EYQA 1GXPA 1YTUA 2BISA 3WDKA 2OQGA 3KZMA 3QLTA 1O95D 2DYKA 5LB4A 4JJFA 3WGTA 5KC9A 1EFCA 1LXCA 3M8JA 1T2DA 2HU7A 4L5BA 3JRNA 5AK0A 3A6LA 2UZ1B 2BI4A 3COZA 1P39A 1G17A 1EM8B 3D7SA 1ZISA 2QV7A 3DR3A 4AY4A 4E2YA 2O1SA 4UTNA 2I55A 4GC9A 4F2GA 3ONQA 5BV7A 3PHJA 1F2DA 4J9VA 1HSJA 1A9QA 3I9NA 4EYSA 3DTTA 1EK0A 4CI9A 4A3SA 3HP7A 3QOXA 1EZ1A 1QH8B 1KKUA 1BW5A 3HDVA 2QM3A 4MQFA 2O3TA 3BL6A 5T8KC 1UXHA 4EB6B 2LW7A 4KE9A 4MS1A 1CBUA 4UVCA 2NU7B 1K8RA 2FTKE 4QO7A 1QVRA 1MQ9A 2FJPA 1E9SA 2ID6A 3Q0VA 2I8AA 2O20A 3GQBA 4ISCA 1V8OA 4UEOA 3SCZA 1WB6A 3WLIA 4DMLA 1VDMA 4EF6A 3BSYA 1ETYA 3KEGA 5EG0B 3CR8A 4ZCMA 4BDTA 4EJTA 3TR5A 1VHDA 1X13A 4HYTA 1VMEA 1PWYE 4RKYA 3S5JA 4PGGA 4PQRA 2FUEA 3Q85A 2XMGA 5K3SA 2CVOA 5AI8A 4OB8A 1B6AA 5K7FA 3TLAA 1I13A 5KQPA 5E1WA 4A23A 3FNRA 1RQNA 4H18A 1MT3A 3DDNA 4XLLA 3UB3A 1WJ5A 1H1LA 2F8LA 2WC1A 3WL4A 1QYRA 3JARA 4AJ1A 1BIFA 3QQ5A 4AI6A 4R0NA 4RNDB 2EEPA 4CEHB 1GNPA 3F7TA 3RG8A 1AGXA 1X7DA 2C2BA 2NTEA 1ETVA 3EPKA 1AF7A 2C5FA 4I7EA 5FH9A 2O50A 2XYVA 2QQ8A 1FSSA 1WB9A 2ETHA 3BHNA 1NRJB 3DFIA 4YJGB 3EX7C 4MKHA 3QBEA 2QZ8A 2G7MC 4HDQB 2NVBA 3FRHA 5EP2A 1M2EA 3AEXA 1F8UA 3JRFA 1I4EB 3E7WA 3C5HA 621PA 3AHHA 2YNMC 5JAHA 1HF0A 1YONA 3BJMA 4NBLA 1G38A 1JTEA 3NT2A 4JLPA 3OOUA 4TYYA 2Y77A 1ZP6A 5F1YA 1IATA 1JT9A 2P30A 2XOKD 2NUAA 3GUHA 3OYCA 1E5QA 4DDMA 4N5DA 2WNIA 4TZTA 4FCWA 2JIPA 4WCFA 1NA5A 2HJGA 4GPTA 5DTQA 2ZIUB 3IBFA 3NTRA 2B1GA 4X3PA 2NP6A 3ET4A 2QVZX 2XIJA 1ZD8A 4TYQA 4JOQA 2XF5A 3G5AA 2BR5A 3C3MA 3JQ9A 3NORA 2RHTA 4GLBA 1D6MA 4MUKA 1ENOA 4TMKA 3F6RA 2W6NA 1KH2A 1KU6A 2VUHB 4BYYA 2QN6A 3MZ0A 4RETA 3ED5A 4Y67A 1KPHA 1UC4B 3FX2A 5A4IS 5FROA 4M7RA 5LP6C 2YX4A 2G5PA 5CG2A 3E53A 2Q8PA 3RQIA 1AQLA 3H8SA 4FMBB 3RCOA 4S05A 3GCGA 1CR0A 4LOCA 1Z45A 2KBFA 4X65B 3UA3A 2VOEA 3GJYA 5AJXA 4FDMA 3ADOA 1SVSA 2PVPA 4YIKA 2Y76A 3EBOA 4O2AB 3TUJC 1UCRA 5C81A 4NBVA 2XZPA 1DTSA 4ZEWA 4A0RA 1UAAA 1Y0UA 4UNQA 1ZXXA 3IULA 1RLIA 5A7GA 4KNYA 1JT2A 2Q5QA 2Z6AA 1IBRA 5J59A 1ODKA 3RVDA 1W5SA 1DRUA 4MKZA 3QVSA 5ICMA 5IT5A 2DLLA 4PBRA 3UJ8A 3NEUA 4JQFA 4EV0A 5DH9A 1IPFA 4CN8A 1KMHA 1I0ZA 2H5LA 1B0UA 1KSFX 4M7PA 2LDUA 4C5CA 3PUXA 4BOYA 2ZE6A 4CM4B 4DW8A 4DRXA 5C5CA 3L6DA 5C8ZA 3M6AA 1FE8A 2AR7A 3SC4A 4TZ6A 5TT0A 4HTFB 3GO5A 1B74A 5BV8A 1YC2A 4ZRDA 2XNCA 1N5IA 3MPOA 1ZN7A 2C8JA 3OY9A 2L19A 1Q7GA 2XZLA 5KNDA 2ONKA 2VH5R 4RMGA 2DY0A 5FLXA 1SVLA 5L3DA 4BNJA 3OQPA 2PSDA 2DUUA 4HNRA 3V4LA 2PUEA 4H4KC 1N8NA 2ZBUA 2XRFA 2YVQA 2QYTA 3JR7A 4IJVA 5AM4A 3RAGA 1KEEA 2WFZA 4XGNA 2P0EA 2PY6A 3PCRB 4CKWB 4AM8A 2VDRB 2JGLA 5KREA 2QN7A 4Y6SA 3M4OJ 5CGQB 1GUBA 2PANA 1R5OA 4XGIA 1J5PA 1YNOA 5PGMA 5T4EA 3GTPJ 4F3CA 5KNDD 2VWQA 4HNQA 3LMMA 3PRYA 4Q0MA 4RABA 4EVSA 3HOYJ 5CLHA 5AHRA 4URUR 1R00A 5JO0A 4KYUA 4EM0B 1ZD9A 5KYWA 4ACBA 4OX9Y 2VJYA 2ZCUA 2VWGA 2W83A 1NU6A 1T10A 2QI9C 3PPIA 4W7IA 4WT7A 3BIXA 2WVAA 1OFTA 5DVZA 5EVCA 4CLEA 4ETNA 4G1FA 3K0SA 2BFEB 5EJ5A 1QYDA 3MS2A 3ZGOA 4LRUA 4R3WA 2OQVA 3ELYA 5EMLA 5AESA 3QFSA 1Q1HA 3EZLA 3HY4A 4XYLA 5BSVA 2GM9A 5LRSA 3LF1A 4DC0A 1R15A 2Y67A 1EQUA 4LVOA 1CS4C 1VLVA 4AFNA 1M73E 5L3RA 3VPBA 4QXRA 1KRXA 3ZX5A 1V4NA 2EJTA 5G0UA 4ZTFA 3OYLA 2MA3A 4YH1A 4Q7KA 4KIGA 3WLNA 1O5OA 1DQUA 2JVHA 4EUNA 3HJEA 2LTPA 1QS0B 3GJ0A 4B44A 4LK1F 3QV1A 1T6BY 4XIDA 3GVAA 4B2LA 5BUSA 4Q16A 1BX3A 1WUTA 3QKRB 4JV5B 1RWXA 2FRHA 2MGQA 2IZ7A 1SD1A 2MG4A 1G98A 3KRTA 1NGSA 5HQ3B 2Y2ZA 3ANLA 2NVUB 1ZOOA 2ECQA 3UHOA 4KYWA 1U8AA 3V7NA 3AVXA 4G41A 1ZNWA 5JTUA 2PPLA 5C1BA 4C4AA 1AKTA 1K8ZB 1T0UA 2HHCA 3VH1A 2VE8A 1VQ1A 4DV0B 1YJXA 4GX5A 1H8HA 2RJ3A 3RS9A 4BFCA 4DY4A 2VDNB 5E3IA 4ZGGA 1GKIA 4A8JA 1IXCA 1PS0A 1RMQA 2QTAA 1YKSA 3I34X 3KJGA 4I8DA 4YRJA 2LLKA 4W5OA 1JIVA 2F4OB 1OBCA 2ARKA 3DWIA 4RQTA 4TUYB 5D7BA 2GSDA 2IDZA 2L2OA 2X6XA 1JF8A 2J5QA 4AY3A 3RSZA 4BNWA 1Z26A 4JLSA 4WV3A 3HWSA 1CUHA 3L1HA 1A4RA 4E21A 3GJSA 1XZQA 2FSUA 2O7VA 3HB1A 4XUGB 3W6ZA 1MEEA 3SYLA 4M3GA 1U6JA 4LJZF 4Z2YA 1CKEA 1WEKA 1X15A 4K9SA 2FQQA 3O38A 3RRXA 3KO8A 1QCZA 1CLEA 4AL4A 3HBFA 4ZZ1A 4XOPA 5EJ4A 2Z5UA 2D7JA 4U1RA 1USSA 4W5TA 4OH7A 4RL6A 5A3SA 4F1JA 1SXIA 3HVUA 4ZMSA 3BG6A 1XRRA 2BMAA 2WIBA 1IUFA 3H86A 3LQYA 2W6MA 3M82A 4RFSB 5DNEA 4BVJA 4F7WA 2YWJA 1I1OA 4OQYA 3FZNA 5LNK6 4PYMA 4R2IA 4YREA 5KQRA 4RKWA 2O7SA 3FOFC 1JDVA 1YUBA 2JT1A 3FWYA 3ZE9A 5JH7B 4UE2A 4D3ZA 4KPFC 4LBWA 1AKWA 4N03A 3Q12A 1YJNI 3EF0A 4K0KB 2EZLA 3L8GA 1J1ZA 3AUSA 1FJXA 1AUXA 1G63A 5L95A 1WPGA 2EZ4A 3T7CA 3UOWA 2CSOA 1JJ8C 1N77A 1VKNA 2JLRA 3L7AA 1IXKA 1XB4A 3EZGA 1A5JA 1AOXA 1MFZA 4YP0A 5EXEA 5F1KA 4R8RA 2UYGA 3V7WA 5L7TA 4F9EA 4J75A 3TAUA 1U5BB 2BYTA 4X00A 4A92A 3FM9A 1Z75A 2I1LA 2CW7A 2KMUA 3KKLA 4DR6B 5EMNA 1BW6A 2GEBA 1TO6A 4NG5A 2NO1A 3KPJA 4EB0A 3ZU6A 4RDUA 2HLDD 2EIJH 2HA4A 1W34A 1H0HA 3X1JA 3CLUD 4YQZA 5D51S 1ZVJA 3LUFA 4NK4A 3F72A 1ZWKA 2XMPA 3O3KA 1Q0ZA 4W1PA 1GCOA 2BI8A 5H7XA 2RQPA 3RC3A 3C8HA 4S35A 1NUPA 1YZVA 3CLTD 3ZHQA 4YUYA 5BMVB 3EYIA 3U9GA 2O8VA 3CNBA 3EEQA 3L9XA 4U2EA 5G1PA 3Q6IA 1G60A 2X2OA 3HCFA 4Q12A 4PRLA 3V4OA 5KSWB 2K7FA 5SZJA 3FBNB 2LY9A 5ICCA 2DPDA 2VONA 1V5FA 3ECAA 3K0KA 3N70A 4RZQA 2CU7A 4X66B 1U28A 1I36A 4XYEA 1ETQA 5K4AA 4FEYA 3FMVA 4PUSA 1DIHA 2R8ZA 3EA5A 4YACA 3V1YA 3GGJA 2YU9J 3GF2A 1VQMI 1GZUA 1KR5A 1MAVA 2IYNA 1ZUD1 3DYVA 1HTBA 4URFA 4F4IA 3ZDAA 2I6XA 5AVSA 1N36B 1YO6A 3DWFA 1R64A 3BHJA 2L4AA 5F6FA 2P6OA 3DOCA 3JQDA 4C22A 5FWAA 5FEMA 1UK7A 5B1HA 5EVJA 3QWIA 3E23A 5E95A 2CWEA 3FRIA 2HIAA 2CD7A 3RIMA 4X1IB 3MF4A 4X90A 3UIEA 2JAXA 2P1RA 3WKDA 5DWQA 3M33A 3IKVA 2Q9CA 3ERED 4LUCA 3AQIA 4M1ZA 2X58A 3K4BA 1A5SB 4ER5A 5HIKA 2ZYRA 5LD2C 2V0NA 3FB1A 4JAVC 4FJ0A 1LPNA 2QNIA 3P7MA 1HL3A 5IJ0B 4EGCB 4KIJA 1S5PA 1L0BA 2IEZA 4MMXB 4R9RA 1JZQA 1T4CB 1Y9JA 2CXQA 1XX5A 2WYVA 2HYGD 5ED4A 3KLMX 3NANA 4BO1A 4ZDPA 2FBHA 3C2GA 1H1TA 3DEZA 3EUWA 4LKRA 2EEZA 4KFRA 4X8HA 1MD0A 2CQKA 3V7SA 2PBLA 2Q8QA 2ISQA 1JE0A 2AEMA 2Q9AA 3TW7A 1YK1A 3JSAA 4ME6A 3GRUA 4KN8A 3QELA 4BO3A 1E6MA 3STYA 4TKVA 5FV4A 2E55A 4L6AA 3L3BA 5EMKA 2IFTA 4LMBA 3H3FA 3LY9A 3PQKA 1F4KA 1RI1A 4BY1J 1QHFA 1SVIA 3DWGA 3ZMUA 5FD5A 3AF3A 2FDRA 3QPHA 1K5PA 4S04A 1XNHA 3FNIA 4I99A 9MHTA 2FRXA 1ZQ9A 2CEAA 3HKCB 5ELMA 3N8IA 4Z0TA 4EG3A 3HRTA 2BEJA 5BSHA 2PS3A 4I9HA 1BJAA 2IA1A 2DTZA 4WKCA 4YYEA 1JBQA 3FPSA 3HPQA 3RC2A 1R37A 3CDIA 3KSZO 1TKCA 3I6YA 4GL4A 3WGIA 1XC5A 3PDIB 3HI6A 4D6XA 5KDDA 4RAQA 4BCCA 1IW7F 3GEDA 3O7MA 4IPTA 2VHXA 4WOCA 3ZXIA 1ZCFA 3JQGA 2MLGA 5KOJB 3H6GA 4IHKA 2XI4A 3AFIA 4KXYA 5F1OA 3T4EA 3VUEA 2VWPA 4BBSJ 1L5WA 2V03A 3L1KA 3F9KA 2QTRA 4KN9S 2ZIXB 4Q05A 1EFRD 4C88A 3ENQA 3T3NA 1D0YA 3V42A 4EARA 1CY2A 1F6DA 3X1WA 3JARB 4DRXB 1XJCA 3E18A 3IAAA 2NXNB 1XBTA 4GYIA 5I48A 1ZS9A 4GXTA 1U02A 1IUYA 3DV0A 3ZY4A 4MR7B 1PGOA 5DRTA 3AMVA 3CLKA 3E58A 3SBXA 2XROA 3BOQA 4UUMA 4CNBA 2B25A 4TS3A 2G80A 4LZWA 3KETA 4GSLA 3WMEA 4Z2AA 1QGOA 2JL1A 1LBHA 2O5EA 4AURA 4MA4A 1SA0B 4QTYA 4LXHA 1DU0A 1YVRA 2XH8A 1UM8A 5KCMA 2NXJA 2X23A 3LM8A 3LWNA 3LWDA 4KLZA 4JROA 1A5AB 4N7BA 4PF1A 3GRYA 4WDQA 4CG2A 4IHJF 5IU6A 4HW0A 4PQGA 1J23A 3VVMA 1IHOA 1JDPA 1VPLA 5C8YA 5JFOA 2OOSA 1ZH4A 2WMOB 2F67A 2Z2KA 5CP8A 2XASA 1BWRA 1C0EA 2W4QA 4G0YA 4O4IF 2OC6A 4NUBA 2DWPA 3AETA 4JB0A 2VLBA 2VPIA 3WODF 2ONZA 1XZGA 4ITVA 2Z8YM 3LTEA 3UHPA 2A3RA 4DDTA 4RDIA 5EZHA 4BATA 1JLMA 3DEJA 1KZ1A 4WHMA 3SN6A 1SQ5A 4FYHA 5BN3A 2OLEA 2FRDC 4OHYA 4YV2A 5JQWA 3FK6A 3IELA 3SKYA 4L9TA 3GGOA 4NYJQ 4DT1B 3GT4A 1KVSA 3DL7A 3QQAA 3QEJA 3TZCA 1A27A 4CM6A 5MN4A 5DIZA 1IMJA 3N86A 4GP7A 2HMUA 4MR9B 4YDHB 5E1BA 3V1UA 3O3NB 3PQFA 4KFTA 1L1EA 4B6EA 2JFXA 4F92B 3KM0A 3PQCA 4RTSA 5DHUA 3AVWA 5E9JA 1BXZA 1DC4A 1E1MA 2PR2A 5EWMB 2P4EA 5JWHA 2WVHA 3EDCA 1N1MA 3LU1A 1N2XA 4G4SO 5HJ2A 1M2HA 3C6QA 2VAWA 2CSXA 3EE6A 1WR8A 1SQ6A 1TIBA 3T34A 2YFKA 1P31A 3ELDA 4GD3Q 2PJUA 3OJXA 3WLSA 2FRVA 4D4KA 1HLDA 1E6KA 3JTMA 3QLVC 4U2DA 3H9EO 4LHXA 1IHXA 4DL9A 4B6RA 3ZCSA 3IEPA 3BTJA 2X1MA 5UKDA 1E8MA 2W70A 3R61A 2FZLA 2BM9A 3TMYA 2QM7A 2Q50A 3WTUC 3C3KA 2ORYA 3IRUA 4RD6A 2DBZA 2CYAA 2HSJA 4A1FA 2GPYA 3I2FA 3WK9A 1CUSA 3HJHA 1Z74A 2HN9A 4FC7A 3ENWA 2O8XA 2O9LA 3D8SA 2IXAA 1OFVA 4WASA 2QA4I 1D09A 5HDGA 2DDBA 2C96A 3O75A 1XR3A 4DDVA 2PXAA 4V39A 4BQNA 3OMYA 1AMOA 1TQMA 2QD2A 1CIPA 2ZWMA 3EBPA 4K6OA 2WF9A 3BQMB 5EUMA 3OVMA 4WXCA 4C2AA 2H27A 2EKBA 2WF5A 2AQEA 3ECHA 2VH2A 3CF0A 2Q3LA 4ARUA 3KXIA 4QG7A 1CRPA 3WTTC 1XHFA 2VJQA 4GBJA 4M8KA 4AMVA 1CC1S 3F5QA 4ZOAA 1KI6B 3QWAA 3Q9VA 1KMHB 1RQLA 2Q6TA 2WSLA 3CDHA 3I2IA 4D26A 1GVJA 1KYIA 3E5HA 2EHDA 1Q22A 3GU3A 4HDSA 3J7AY 5HK9A 1BU5A 2RGBA 3KAQA 3OFND 2DQLA 4LAFA 1WZNA 1TMOA 3HU3A 3K2BA 1TECE 1YULA 5CFMA 1J25A 3QYPA 3O1HB 1HPLA 5DTDA 3K9GA 1GAQA 4V2UA 4JT8A 3JD3A 4L5CA 2E4XA 3EVZA 3HVIA 5TJ9A 3C3PA 4C4SA 2C58A 4HEA6 4LZLA 2HXGA 5AHWA 5AKIA 1U5AA 4XCXA 4HXGA 5B57C 3CC7I 3LG2A 1JT6A 3URKA 1B9NA 2CS3A 1FVHA 3HSYA 1R6VA 2HHHB 2P4HX 2J5XA 4URWR 5G0VA 5EJ9A 4RGQA 5K3CA 2ZXEA 1P9QC 2I1VB 2BVLA 2OQIA 1E2IA 4J19A 1JFFB 1SZPA 3SGLA 4EI9A 3RODA 1RLJA 2Z9OA 1R10A 1TOAA 2MSEB 2BSAA 3FXRA 3I56I 1KYVA 1W0JD 1YK0A 1Y6RA 3BMCA 3BVPA 3I0NA 4P0TA 4WLNA 3WO0A 2HV9A 1A4IA 3CZ6A 1S2OA 2F1RA 1YL7A 3WK6A 2JFNA 5LQMA 3ICPA 3LUAA 1CF4A 3I76A 3QRFF 2YFHA 4C1NA 4UUAA 4OXYA 3RR2A 3A3PA 4D9NA 1N75A 1DPGA 2D7CA 4UB6C 2JKVA 3OQVA 1ENZA 1IB6A 4MITA 4M98A 4QVKA 5T6MA 1Q20A 2MSKA 3TJRA 3U7QA 2WTUA 1YIDA 4YRFA 1Y4DE 2E9SA 3DB2A 3UCEA 1V8PA 2ZAYA 4N3AA 4MR7A 2LD5A 2KSQA 1JFSA 1PR3A 4XR6A 2YR2A 1NONA 4HGYA 4KSCA 3VDMA 4GLOA 2VJIA 1LLQA 3ZPXA 4MV7A 3HABA 1NXXA 1NJ5A 1FBNA 3WICA 4BUJA 1D7OA 1G3UA 2IUUA 1D0IA 1E2EA 4XIIA 2EZUA 1HBXG 4Q4AB 3UT6A 8AT1A 2R48A 4O63O 2PYIA 3PNPA 5EQTA 1YOVB 1YS2X 2QF7A 4KXMA 1CZUA 4YP1A 3OPXA 4E7OA 1LW6E 2QPOA 1WCMJ 1O94C 1Y5NA 4YO7A 4J0GA 4NWIA 2W6IA 2DGDA 1UJ6A 3OX3A 3V2UA 4B45A 3ERCA 5INTA 5ETJA 4JQZA 2NO4A 2PX4A 1YTLA 4J2HA 4MLDA 3WXMA 4C87A 2KJCA 3INGA 3HSEA 1RYZA 2HDHA 3CE9A 4FZ5A 2ATVA 4D97A 2A88A 3OCJA 1DFIA 4KLAA 3CRRA 2CHQA 3KVVA 4CCKA 1E6LA 2W85A 2HA5A 3IQDB 4MWSA 4OUKX 1QC5B 1G5TA 1T36A 4PCVA 1W2HA 4WZBA 2BKUA 4G8BA 5JCJA 5SY6A 4F2WA 3QSYA 4F3TA 5F12A 2VHVA 3E3NA 4GBGA 4J1TC 1XZMA 4L76A 2P3LA 4OL9A 5C5DA 1KOJA 2ZXWH 1LDJA 1EWYA 5GAHJ 3CP2A 1QM5A 1DIBA 3PDCA 3R4VA 5KUTA 2BGGA 4B3TB 2FPRA 2AFVA 1R7JA 1R12A 5L3FA 2ZTUA 2WIAA 4GI7A 2XUDA 3VOBA 4NU6A 3BTSA 5A2GA 5EERA 4FMPA 3T54A<