1R00A

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-homocysteine (sah)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin-10-hydroxylase
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r00A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r00A03
4KDPA 5D4SA 3KPUA 2PXAA 3NWBA 3EVBA 3C7JA 2VC1A 1XDSA 1MKMA 2OZ6A 1EQAA 2PVCA 2XKPA 2FHPA 4RS8A 1BOOA 1VQ1A 3CVOA 3E05A 4ZTBA 2AXLA 4RYLA 4C07A 1QPMA 1U5TC 3ZQ7A 3B7PA 1YO5C 1K79A 1O3RA 2WK1A 2OBFA 3ULQB 4RB0A 2HWVA 1EAMA 2ELHA 4R8SA 5E1MA 6PAXA 4PDKA 3G73A 1D2CA 5BMZA 3M8EA 4ESBA 2PX8A 5KQRA 3JTGA 1UCRA 3LGAA 4MQVA 4I7HA 3BJ6A 5EIFA 3I54A 2PMHA 3RIRA 4M9SA 3T7TA 1F38A 1ZG1A 4FR0A 3U81A 2FMLA 4Q5SF 2ZIFA 5DPMA 2O07A 3O3KA 1G3TA 3GLXA 5HLGA 3UA3A 1X1BA 3P97A 3IWZA 2XAJA 1P92A 3JAMK 1JQDA 1R18A 3B3JA 4UVBA 1BI0A 1DPRA 2PXXA 1R1TA 5J6XA 3LCCA 2AOVA 3W6KB 1ZAOA 3BUSA 3QOWA 2VDVE 1PUEE 1RUNA 2ESHA 1QNTA 1BM9A 1B9NA 1UB9A 2UXNA 2PKWA 4N0BA 2ZLBA 3BT7A 1B9MA 4IKPA 4HBLA 4R1HA 2Q8KA 1VTNC 2XAFA 1FLIA 2K4MA 2HZTA 1T2KA 2FF4A 3KZZA 1LB2A 3FPGA 3M6VA 3I59A 1HSTA 4PNEA 3P9IA 1ZGAA 3W6JB 4LG0B 2QRVB 3BROA 2C7QA 4PGGA 3DKWA 1H9TA 4B09A 3M6UA 3L8DA 1YF3A 3HHGA 3NMUF 2DK8A 3KP5A 5HS8A 2Z33A 3HA3A 3LSTA 5AIQA 3LAPA 3TFWA 3NEUA 3TOSA 2ORED 2PFBA 1IRGA 5CUQA 2P3OA 3I58A 5K05A 4F7ZA 3CGGA 1KPHA 4OX9Y 2PGXA 1QQIA 4M71A 4ZZDA 3M8FA 2Z6UA 2PWPA 3LBYA 4X60A 5DTQA 1R22A 2P7VB 3KQWA 4L9TA 3J81Z 2O6GE 2Y0MA 3ELUA 3EMBA 2ESRA 3QRFF 3DPLC 4YMGA 3V8VA 1ZLJA 4KVZA 3EEOA 5E8RA 3R9XB 1ONVA 4HTFA 4M36A 5D5XB 4DKJA 1SQFA 2EFJA 3EETA 4DF3A 2ZWAA 3MERA 2YR2A 2XGXA 3FWEA 4YUZA 1MDMB 2JZYA 1NW5A 2PY6A 5C0OE 2YX4A 1BI1A 2VS1A 2G7HA 5FWAA 4QVKA 1DP7P 2E1NA 2P7CB 4L9VA 3T7RA 1KQ8A 2AVNA 4L9JA 4CWAA 1J0RA 1G60A 1LEAA 2GXGA 4EKIA 4JQFA 3NJRA 1SQGA 4YV1A 5K0CA 5CIYA 2NRAC 2GWRA 4HGZA 4PYLA 2A5YB 1GVJA 4FSXA 1N7IA 2JTVA 4YUVA 4O29A 1G3YA 2B2CA 2W24A 1BJAA 4AD9A 2O8XA 3KPVA 5LEJA 2FK8A 2D1HA 4WWCA 4RTPA 1I9GA 3M9AA 5ILVA 2YVLA 4KICA 2F5CA 2IVMA 4HYEA 5FLXK 1YW8A 3EPPA 1Z91A 4F84A 2NXJA 3FYDA 4OIRF 5HEKA 1VLMA 2ISZA 3R0AA 3BJOA 5FGMA 2XAGA 2QENA 2NXCA 1FOKA 3N97A 5JI6A 1ORHA 1PDNC 2R7DA 3P2EA 4PINA 2V1DA 3M1EA 5BS6A 3B5IA 3GFMA 3MWMA 4M38A 3TDZC 2ZZKA 1DDNA 2QBYB 1IN4A 1BKYA 4F85A 3KR1A 3K0LA 3THSA 4ER3A 5LQUA 3KP3A 2PXCA 3REOA 3WODF 4X1OA 3OCJA 1XJ5A 3IHUA 3L00A 5LQRA 4AX8A 2P5KA 3RKYA 4RTJA 4OQDA 2GIVA 3FPHA 4GC5A 3CUOA 5ICCA 4P7KA 3TRKA 2P35A 1S3JA 1RNLA 1YS7A 2M45A 2O3FA 3BY6A 3K9TA 3M7GA 3R60A 3TDUC 3TR6A 3LA7A 4PCQA 5JVTA 3FTFA 4M37A 5BPIA 2ZULA 3FUTA 2IH4A 2IDKA 3V7RA 2P8JA 3EVZA 3RODA 5E1BA 1KR5A 1CF7A 3F4KA 1Y8CA 5K1YA 3V97A 1O3TA 4IJAA 3FXUA 2Z9OA 2C7OA 3G2QA 1XCVA 2QUFA 2R7FA 4UV9A 1WZNA 4RVFA 1EV7A 5IH3A 4L5JA 3ELYA 3F6OA 2RGVA 2N47A 1LQ1A 2YQZA 1O9HA 5DRYA 4RGUA 1TPYA 5EEHA 4OA5A 3ZMUA 3SVZA 2G70A 1ZHFA 5EG5A 1BN5A 1E2XA 3I53A 1VPTA 1EH6A 1ULYA 3ZP5A 1RI1A 3B89A 4QQNA 5JR3A 3OZSA 1F4KA 2QM3A 4L0ZB 4OINF 2LF7A 3F8MA 4RTLA 4DCMA 2QYOA 4CKEA 3KR2A 1LDJA 2AN5A 2OBPA 5C1IA 1HNNA 4RVGA 4ENKA 3LQRA 4P9FA 3TO7A 5DX1A 2DK5A 3WTTC 4P58A 2DU9A 3EGIA 4IF4A 4G6QA 3IC7A 5D5WB 3ISPA 5DD8A 3LL7A 2GXBA 4Z2YA 4FP9A 2PJDA 1C0WA 4HA8A 4WX9A 4KT5C 2XIGA 4IV8A 2IJLA 3E3VA 3TM4A 1GXQA 3FM3A 5FQOA 1XVAA 2JT1A 4PIMA 3GFJA 4ER5A 3VYWA 3CLOA 4I0AA 3BGIA 2HR1A 5CVJA 2C7RA 2MLKA 4U88A 2AOXA 3TQSA 4HG2A 3HCDA 3NWEA 1T6SA 3WTVC 1USTA 4RTQA 5LBQA 1OKRA 5FHRA 3DULA 4PYQA 1B1BA 4QWQA 2PBIA 2KW5A 4PYNA 3H3ZA 1KGSA 4IRIA 4FT4A 4IHTA 3F8NA 2PT6A 1B59A 4HF2A 4PYIA 4HQEA 3TGNA 3P9KA 2XV4S 3Q7EA 2FCAA 3LCUA 3BP8A 5EZSA 1VIDA 2P40A 2O03A 2H27A 2Z6AA 3GFIA 4RTNA 3ERED 2BYVE 3V4GA 2JJQA 3GYHX 2JPBA 2ERCA 2X0LA 3G2OA 3DFGA 3I71A 4KNYA 4DNCA 3SX0A 4OBXA 4PWYA 4KMFA 3RPUA 2UYHA 5BP7A 1QO0D 2HKOA 3I5UA 2QLZA 3EVAA 4R8HA 3A7DA 5CVRA 4IXAA 1X1CA 1JGSA 4X61A 4RVDA 1NW6A 1O9GA 4BP1A 5DYMA 5C9ZA 3HA7A 2IGTA 1P2FA 2I7CA 2PLWA 5ICGA 1FBNA 5JHUA 5E9QA 1X1DA 2ZZNA 5DLYA 1R8YA 2DO7A 3TO6A 4N9IA 4CKBA 2RQPA 4DQ0A 3SXJA 5EMKA 1G6NA 1IXRC 4KWCA 4CHUA 3QP5A 1K78A 3FPEA 3FTCA 4BY9E 3VFZA 3SSMA 4DM3A 3PQJA 2NP6A 2NAZA 2ZMEB 3M33A 2J5PA 1STZA 4YFNF 5IT9K 2IPXA 1K7AA 1YW9A 2LSOA 2A68F 5FB2A 3J7AO 1HW5A 4AZWA 1GHCA 5CVDA 4P5OA 3HSEA 1N7JA 1U8RA 2VDUE 1BC7C 2O0YA 4EJTA 3BJAA 3B3FA 3D5LA 1Q0SA 3GF2A 4CICA 1G3SA 3E5QA 4AVPA 3SQNA 4EMSA 1KIAA 3J80Z 2GAFA 2GZWA 3ZMDA 3BZBA 4G9YA 1E17A 3FF5A 4G94A 2FPOA 1FY7A 3VSEA 2OYRA 5DUIA 1BOAA 3CO6C 2CL5A 4FX0A 4OIPF 1T43A 3LKZA 3OFJA 3TPZA 2A14A 2AN4A 7MHTA 4A6DA 5HDNA 4NECA 4H0NA 4MNUA 4XBFA 5LQJA 2UZ4A 3FTDA 4HGYA 2OZUA 4L18B 1G4DA 1VE3A 4MQ4A 1HW2A 3RTRA 3MFKA 3LECA 4U0YA 5EMJA 2B78A 3OZTA 2BR3A 1QAMA 2I9KA 1XDUA 2ZNYA 2Y1XA 3GUDA 1J75A 4CGZA 2I6GA 4G56A 2MLGA 3UJ8A 4BHCA 3M70A 2NXNA 4RSRA 2E7XA 4HRAA 1D2HA 4QDKA 2QQBA 5IKMA 5ILSA 3T8TA 1S29A 2HGCA 3R0JA 4KUMA 1H9GA 5FULA 5K5OA 1MJAA 2A6EF 5U4XA 4K2EA 3QU3A 1HBXG 4I09A 3DEUA 4R79A 2FA5A 3H92A 2W25A 5D4RA 1XSXA 2G1PA 2HQNA 5LQNA 4AZTA 2UYCA 2L4AA 3ABTA 2WWYA 2AOUA 4ISCA 3KU1A 3C0KA 3G88A 3ECHA 2XYRA 3RYPA 3I59B 4Y13A 2HMYB 5P8WA 2PV0A 3PTAA 2CGPA 4BHBA 5E1DA 3CUQB 2BM9A 1KHHA 1M6EX 2AS0A 2CQKA 3P71T 1USSA 5E2AA 3PT9A 1IM8A 2JRTA 3PQKA 4GOOD 4GQBA 5EIWA 4YIIA 3T0YA 4R8RA 1WS6A 3WGGA 4U7DA 1D8JA 4QQKA 5AONA 3PLAE 5DD4A 3LA3A 3MZYA 2FXAA 4QLCU 4WK8F 1FT9A 1TW2A 2OAZA 3DUWA 3GX4X 2DFIA 1U6GA 4X41A 2K4BA 5GWXA 3R24A 2H1RA 4KRGA 2B0LA 3WE3A 1AF7A 5LQKA 4PYJA 1R6AA 4JK1X 1FPQA 4HTFB 4P7GA 4A0ZA 1FYMA 3IV6A 3EYYA 2GA2A 2EFWA 1UWVA 2XVAA 4CZZA 2G72A 2P7HA 5CD1A 3GZ6A 5HDGA 3ME5A 2M1BA 3K6RA 5F6FA 1LDDA 3E5XA 3V7CA 3ZMVA 5LGTA 2V79A 3SZTA 2FE3A 2V1UA 4XSXF 2L4MA 3QPHA 4ER7A 1NV8A 2XVCA 2H6CA 1IW7F 3T1BA 3OOPA 2H6BA 1JG1A 1FYKA 3R4KA 4LD5A 3LBFA 1Q1HA 4CKCA 1F3LA 3DLCA 3EVEA 3DPTA 3GCZA 3BKXA 2L3DA 1P4AA 5LGUA 3V8JA 2VODA 5DSTA 5GIOE 4IHSA 3EVCA 1PJZA 2P5LC 1L1EA 4OOIA 2DQRA 2MH9A 1RIOH 5DXAA 1Z7UA 1JSZA 3KKZA 3JWHA 2MBFA 2BZGA 3HRSA 5LR6A 1IN6A 5ERGB 5E18F 1O54A 5HIJA 3PFHA 3TLJA 4C03A 1YQAA 1D8KA 2FBHA 3V8LA 5CJ9A 3DXYA 5E1WA 3HUGA 2OO3A 1W7PD 3MZHA 3KE2A 3Q9SA 5GM1A 3HRUA 1UHWA 4WCGA 3A7EA 5K5QA 3E6BA 2ZIGA 1L0OC 1B6AA 1KXZA 1NW3A 5JUWA 4KDCA 1SVUA 4ENMA 1P39A 2OA4A 3GVAA 2DPMA 3DMHA 4K6MA 3HVJA 4E2XA 4P55A 3HTXA 1XXLA 2EV0A 3RPQA 4V0QA 3CDHA 5LSAA 1YB2A 3GRVA 3CUQA 4KIBA 3LAJA 4ZYEA 5HS7A 5EHGA 1W4MA 2O05A 1NW8A 1BC8C 1XGOA 4HH4A 1YFJA 1Z05A 1ORIA 1CF7B 5EVJA 3GXOA 4E31A 4L0YB 1LDKB 1KU3A 2EG5A 3J81K 2EJUA 2PEXA 2VE8A 3ML6A 5FFZA 2EFPA 5LGNA 1ZQ9A 3UJ9A 2XYQA 3F8CA 2DT5A 4S04A 2PWYA 2BGCA 4PYOA 5LHGA 3EDPA 1INLA 4LWOA 5E1ZB 5T67A 5K5RA 2L02A 1HW1A 1KPIA 2NNWB 5GOZA 5FFXA 4S05A 4G6DA 4GXOA 3TQNA 3EYIA 2K02A 1OR8A 1W5SA 2HTEA 3KQTA 1O3SA 2H09A 5FD6A 1B4AA 1F1ZA 4ZZLA 5EKUA 1NHAA 4LLGF 1XMKA 1T39A 2HS5A 4M9ZA 2GPYA 3C6MA 3WTSC 2EA4A 3K1MA 1TQPA 4Y2HA 3U9GA 2RKHA 4XLPF 1OMIA 3G2MA 3FZGA 3LPMA 5EC8A 3HTUA 2ZVJA 3TO9A 3HOTA 3LDUA 3DH0A 5HIMA 5HLHA 4M6XA 2STTA 4YFKF 2P4WA 1IY9A 1NKVA 4X63A 5LRSA 3E8SA 4QPPA 3GEZA 1XB4A 3LA2A 3I4PA 2PN6A 5GIPE 4HF0A 1XSVA 3OU6A 2W84A 1Z6TA 4Y17A 3ZMZA 1DUXC 5F2NA 5E8JA 2P41A 3GNLA 4XCXA 2ONZA 1XMAA 5M5BA 5ICFA 3RJPA 4AWXB 4N9HA 2CYYA 4ZYHA 2F8LA 4LFUA 1JG3A 4OU0A 10MHA 3X0DA 2GS9A 4GEKA 2OB2A 4XLNF 5T6BA 3OU2A 4GF5A 2Y75A 5L3BA 3MTEA 2ZCWA 3BGDA 2IBSA 3MQ2A 1IUYA 2HV9A 4GBED 2JPCA 3BPXA 5DV5A 2STWA 3HP7A 5D8LB 1DUSA 3E7PA 2GB4A 2K86A 4E30A 3MHTA 4LWPA 2E7WA 1R5HA 1RUOA 5EZQA 5E9WA 3GU3A 4WXHA 2P3QA 4AZVA 4QVGA 3K1PA 1L9KA 2AVDA 2HWKA 4E2WA 5D1HA 5LQAA 2ZBKA 2EFQA 4XSZF 2GLUA 4ER0A 4QPNA 2AS5F 2V74B 1XD7A 2YTZA 5F2OA 3GJYA 3DMGA 4RB3C 3LHDA 4GOLD 1KP9A 2RNJA 1SUSA 3O31A 1AQIA 3VC2A 3MAJA 1K78B 4M73A 5L3EA 2NS0A 4HV6A 2UYOA 2VP3A 2Y48A 3MQ0A 2HOEA 5L3GA 5AIPA 4YFXF 1FP1D 3K69A 1MZBA 5DX0A 3P7NA 4RTKA 3C3YA 4HX8A 4RGSA 4EM1A 2ZZMA 5LLQA 3Q5FA 5IT3A 1SMTA 2YPRA 2G7UA 1R58A 2HQRA 2ZJ2A 4M74A 3OFKA 1SD7A 1JTEA 1IN5A 4FX4A 4OMYA 3PB3A 4EGZA 3QV2A 4Y30A 3RW9A 4NQWA 4BLVA 4LG1A 2EB7A 2A3SA 3E6DA 2EV6A 4I2OA 3JW4A 2QQ9A 5FQNA 2FU4A 1T38A 2YX1A 4BXUA 2V1XA 1MD0A 3KQMA 3AJDA 2HYGD 2Y1WA 2VN2A 4TV7A 4HZFA 3ZPLA 4DQ2A 1V3FA 3CUQC 4IRGA 2EWNA 3NVMB 4IWNA 4CTKA 1AQJA 3WTWC 4LGWA 4ATNA 3AXTA 4CXFA 2HTSA 3HVKA 1RJEA 4IV0A 5L3FA 3SM3A 3EQLF 5FWDA 4YV2A 4HDUA 1BI3A 2FRXA 1R74A 3BDDA 3JWGA 4ON0A 2XUBA 5ILUA 3FPJA 3NDJA 4HC4A 5K01A 1YYVA 3TKAA 2XBMA 2NYUA 4RX1A 3L9FA 3IYLW 3B73A 2ETHA 4LK1F 3R0QA 4OQEA 5E1OA 1XTPA 3O6BB 1ON2A 4U7TB 2DAOA 3SGLA 5HOQA 1TW3A 5HS9A 4XRFA 2J5OA 1KA8A 1RI7A 4AIKA 4E2YA 5E2BA 4PZJA 2FOKA 4LJZF 2FBKA 1SMYF 3RYRA 3R3HA 1S7AA 2FNAA 2M87A 5DWQA 4JBAA 2B3TA 1UIRA 5HDKA 4ENNA 2XVMA 5D8KB 4HSGA 3KETA 3THRA 3U2RA 3S68A 2YUIA 1JG2A 1KPGA 3JWJA 1SFXA 2JHPA 4BHPA 3JSPA 3RI4A 5KYGA 5DCMA 4UHTA 4GOMD 2QE6A 4PONA 3FMRA 3GW2A 1J7KA 5E20A 2P5VA 4C08A 3FMQA 2ZW9A 2IH5A 4MQ9F 2AOUB 1LEBA 1D3YA 1IXSB 2TDXA 2COMA 4I01A 4UOEA 1OPCA 2PG4A 1ZG3A 2EX4A 4ZYDA 2CKDA 4R05A 3DF8A 3L2CA 2PX2A 3UBTA 3IHTA 2C7PA 4A6EA 2NNNA 4UVCA 4MHGA 2V7EA 1O3QA 1T98A 3KQSA 5DEQA 3FXRA 1HMYA 2O61A 3WGIA 1MJBA 5H02A 4MIKA 1I6XA 2BV6A 2VE9A 1NBHA 2OU2A 2O06A 2ZTHA 4ENJA 1W7PA 2D1VA 2GH1A 1N2XA 3GO4A 4L5IA 2FRHA 1DCTA 4F86A 4JXJA 3BWCA 1QAOA 2E1CA 3BWYA 3IRQA 5E8IA 1IXKA 2G8NA 2ZIEA 4V0RA 2GAUA 2FNPA 2PBFA 3JSOA 4P96A 3FUWA 1ZKDA 3BWGA 3ABUA 3BWBA 5A2QZ 3UA4A 3J80K 2A69F 2MA3A 1YUBA 3LKDA 4MGRA 2Z3YA 3FUVA 3PX3A 2HKXA 2DBBA 2ZCJA 4QTUB 2ADMA 1MGTA 5DCFA 5K0BA 1EJ6A 3E6MA 4RTMA 4HDVA 3EEYA 4OA8A 3EGVA 3OE4A 4FT2A 5FADA 1ZYRF 4PCAA 1P91A 1NV9A 2YX7A 1UFMA 3K2ZA 5G02A 4GUAA 4OBWA 3DXZA 3UJDA 4R6WA 2WC2A 3A4TA 3VEPA 4L7VA 4YUXA 4EJVA 1X19A 4U0WA 4HF1A 1FP2A 2Q41A 1I1GA 5CVUA 5DXJA 2HNKA 3L09A 1L3BA 3P9CA 1WG8A 2D45A 2YR0A 1MJ9A 3MCTA 5EMMA 5CVVA 4M9XA 1S7OA 5F64A 3IL2A 4LB5A 4PYMA 2DI3A 2OD5A 1YFLA 1R7JA 2OKCA 2L54A 5K0FA 2FYTA 1CGPA 1KYZA 1BIAA 1A04A 4FS8A 4KIFA 1IN7A 1QZZA 1AOYA 2OY0A 5D1NA 1YS6A 3KLOA 1H1DA 2ZBPA 3KQPA 3NQOA 2FK7A 4RGRA 3WG9A 1JTFA 2OB1A 5E17F 1HQCA 5EOVA 2QY6A 4M72A 4E32A 2AOTA 3T0IA 1EH7A 2A07F 3KZYA 3TOBA 1X1AA 5HIIA 4EV0A 4OIQF 1BHJA 1IF1A 2M30A 4BLWA 2DQLA 2UWMA 5JFRA 4A0YA 3QP6A 3F22A 4EGYA 2B25A 5DM1A 5K0GA 5H6QA 3WU0A 3ELDA 4DA4A 3S2WA 2OQGA 1M0EA 5L3DA 2XKOA 1KU9A 4ASNA 2XAQA 2PMUA 2W57A 4FHTA 3AWIA 4BNCA 4GGGA 4RAYA 3UJCA 3HSFA 4Q4ZF 1XGSA 3TM5A 2IH2A 3ERCA 2R3SA 1P1BA 3DV8A 4GCVA 3RDIA 5LHIA 3FYCA 3BWMA 3BOQA 5E1XA 2NNYA 5HILA 4POOA 1VBFA 1JQEA 5EQJB 2EA2A 1I4WA 3UJ7A 4I02A 4HV5A 2VXZA 3D0SA 2JSCA 4CO8A 3HEMA 3CCFA 3FZVA 1PP7U 4Q48A 3PFIA 4B8XA 3BXOA 4CYDA 4U7PB 5LHHA 3HCFA 2G71A 3O7WA 4DZRA 2V6CA 1OYIA 1RI2A 3DMFA 3GRRA 3QOPA 2NP7A 3KEOA 3OZRA 3SHFA 3ORHA 1JG4A 2VT2A 3FHZA 1FBUA 5CCBA 2LKPA 3L7WA 1NT2A 4IVNA 2YXEA 4UNOA 5T64A 3CTAA 1R00A 2H11A 2OQRA 4L9NA 4O6JA 2UYQA 3MGGA 3ZMTA 1G8AA 2FEZA 1YG2A 5BW5A 5EPEA 2BM8A 4RWZA 2MD5A 3E23A 3FMSA 2V9VA 2G9WA 1TNTA 1WI9A 1YLFA 3EVDA 5BXYA 5FTWA 1ZLKA 4QTTB 3KLNA 1JE8A 1TTYA 3HOSA 1FBSA 4A5MA 4CXMA 2VONA 1OR7A 2HYFA 1Q0TA 1FNNA 3KHKA 5FCDA 5DTMA 2O57A 5DSXA 4EKGA 4KDRA 2M8EA 5DM4A 3GRUA 3AXSA 5K0LA 5KS2A 4I98B 5KVRA 3MCZA 4BH9A 1J9IA 1VP3A 1F5TA 2FQ3A 3H3UA 1Z6RA 5BOXA 3WSTA 2IDJA 2D2WA 5CYVA 3IEIA 1WXWA 4WXCA 4XUCA 4NHJA 4EM0B 1XCLA 1H0MA 3G3ZA 1P1CA 3HCBA 2VBYA 2VBZA 4G7OF 4KW7A 1NE2A 4ESFA 1R1UA 2KIFA 5D5VB 2LNBA 4OMZA 1UFKA 2W85A 1RJDA 3JWIA 4UV8A 3K1NA 2F5DA 3EMDA 3NRVA 2AN3A 3MB5A 3ER9A 2IPQX 3CC8A 4YG2F 3UFBA 4AUKA 3P2IA 2ZBRA 4NB5A 5CLSA 3C3WA 3KP7A 3JAMZ 3VODA 5LRRA 1QAQA 2DTRA 4M6YA 3WGHA 1I5ZA 2KJBA 3EVGA 3ELKA 1G3WA 8MHTA 1DPUA 2H00A 2Z5UA 5HVQC 3KQYA 1ZN2A 2XAHA 5ERIA 1HKTA 5FA5A 4HOBA 3WTYC 3T8RA 3E5UA 3C1DA 3GRZA 2XROA 3SFZA 3VOEA 3CJRA 2PLYA 5DUKA 2ZKZA 3P9NA 3DOUA 4G7HF 3FPFA 4DMGA 5GP1A 1SD4A 5L3CA 3FXQA 2HDCA 4P7FA 5FHQA 3IRRA 5K03A 4GO1A 1FX7A 3LX6A 3SZPA 4XUEA 4UUVA 3HVIA 5GM2A 2VOPA 4HLYA 2CW0F 2VC0A 1QYRA 4C05A 2P6TA 4RVHA 3VB2A 3WU1B 3E6CC 3OPNA 5DM2A 3UJAA 1L3CA 2E5WA 4CDGA 1IXCA 3ANXA 1ZRCA 4A2UA 2VBWA 1I27A 1JQ3A 3KPYA 3KCCA 1M6YA 3OU7A 2IT0A 4C06A 5TJJA 5E8GA 2GQQA 4EJUA 2CWWA 3UZUA 4YV0A 4HX4A 5MHTA 1G55A 4O5VA 1ZRDA 1G38A 2WA1A 3M6WA 5HOOA 4PCLA 1FSEA 1Z1DA 2Q0OA 4MTDA 2PX5A 5D6EA 4I0BA 4EQZA 2BH2A 4IRHA 3QPTA 2C6YA 2RVCA 3ZMSA 1TQMA 3OV8A 4EJOA 2NYXA 3FM5A 4OIOF 3ID6C 3F6VA 2BR4A 3PS9A 4XUDA 3PFGA 4E2ZA 1YZ3A 2K7LA 2CWEA 5DT2A 3R6TA 1WKMA 3WTZA 1YZHA 3HNRA 2RN7A 5KK1A 2PSSA 3SSOA 3GIWA 2P7IA 3O2PE 3KFWX 3HYIA 3LWFA 5LQCA 4EVIA 1OYWA 3CO7C 1S8NA 1BBYA 4PIPA 1QGPA 3ER8A 3GWZA 4P7JA 1IRFA 2YXLA 5F2KA 2Q2EA 5FO5A 1Z3CA 1P6RA 4FSDA 4BYYA 1IN8A 3UJ6A 5DX8A 4KFCA 3BZ6A 5FLXZ 2OZVA 1KU2A 5BPDA 1YTYA 2PX4A 3OE5A 1I1NA 4RTRA 3F3XA 2AOWA 1JR4A 5DCMB 2A61A 2QWWA 3Q9VA 2QZ8A 2LDUA 5BW4A 4G8XA 3CJTA 2OXTA 1XGNA 4HAMA 2DW4A 3F23A 1LVAA 1WQ2A 3R6SA 5F1RA 2O0LA 3GFLA 3BPVA 3GRYA 3V7SA 3SSNA 4GYGA 1TQIA 3VC1A 4EQQA 1XCBA 2P3LA 4QDJA 3T5XA 4LG0A 2QRVA 2BBYA 3FX3A 5BQTA 4KYWA 4ETSA 2B9EA 1YFHA 2IIPA 5HFJA 4LMYA 1U5TB 4EK9A 4C4AA 1WRJA 2IA0A 1YIOA 1BIBA 3KR9A 3PVCA 1W7PB 3KQOA 4AIJA 3ELWA 3RKWA 1GXPA 1U2WA 2KKOA 4YIFA 4PGHA 3K0BA 3IWFA 2DLLA 1XDZA 3HRMA 4RAZA 5HZMA 1SUIA 2XHKA 3JTHA 1D5VA 2WA2A 2CFXA 2KRFA 1OYYA 1QBJA 5GINE 3F8BA 2GA9A 2XYVA 3I9FA 2VZ9A 1J2XA 1J59A 2KJCA 1J5YA 1FBQA 4UXNA 4YUWA 2ZFWA 5ED4A 1HKQA 3GZ5A 5ICEA 5D6FA 1G8SA 1FZPB 3B3GA 1MDMA 4M7RA 4WF2A 2DULA 3CKKA 1EH8A 4RTSA 5D5UB 1S6LA 1KU7A 4BP3A 1JXSA 3NVKI 2CSOA 2WTEA 1HXDA 4D0PA 4EJWA 3CJNA 2P1DA 1LNWA 1EIZA 1RZ4A 1VL5A 1SD5A 5J8CA 2MH2A 3T7SA 2Z99A 3HSRA 1X3UA 2UXXA 3FRHA 2BEOA 4E70A 1R8XA 1BI2A 2FMYA 1JHFA 3EGEA 1YW7A 4GOND 3C3PA 1IZ1A 3DQVC 2JH8A 5CVIA 3DP7A 2ONYA 2XRNA 1ON1A 3HCAA 1TNSA 4KIGA 3A26A 4C04A 1BC5A 3KPWA 1JHHA 3SMQA 2JG3A 2A6HF 3KPJA 1XSDA 1QZYA 4ER6A 1WXXA 4E33A 2MC3A 3HA5A 1L3LA 2K4JA 1FSHA 1RI5A 3FUXA 2NXEA 4ZYGA 2KIUA 3MAGA 5HIKA 2ZXJA 1EJ0A 1SKMA 2ZNZA 2JHAA 5EGSA 1P4XA 3F72A 1FYLA 2ZO4A 4Y15A 3DLIA 3ZN1A 2YSRA 4RB2C 4LB6B 4LLLA 1PRYA 2VBXA 4H0EA 2CO5A 1SG9A 2AOTB 1ZG5A 3BKWA 4MEYF 4MHTA 4U0VA 3LCVB 2QBYA 2WV0A 2ZFUA 5K09A 2VT3A 3HRTA 2RDPA 3WE2A 1FWZA 2IBTA 3RKXA 1Z9CA 1XCJA 4FZVA 2RC4A 1TBXA 2VDWA 1XGMA 1VP9A 5H20A 1Y0UA 1U5TA 1XN7A 2ZBQA 4GYIA 3Q87B 5EHIA 1PP8F 1ZRFA 3TMAA 4WXDA 1SAXA 2JHCA 5DTRA 5FUBA 2IP2A 2PI0A 4A12A 3M4XA 4G7ZF 1NBIA 1FC3A 3P8ZA 3LQQA 3HVHA 4B17A 3FTEA 2ZSUA 2YU3A 2Z6QA 2CMHA 3PX2A 5A2QK 2YXDA 3G8AA 2I62A 4A0XA 3KR0A 3DR5A 4RGXA 3U1DA 1EG2A 3I0TA 1AWCA 5K0JA 5EEGA 2EFNA 2PJPA 1T0FA 2EV5A 4R6XA 3H2BA 2P6SA 3AY0A 3BGVA 2DPUA 3G2PA 3WTXC 4HQMA 5K8VA 5IT9Z 4IPAA 3FRIA 5HLIA 4MTLA 3KP6A 1DL5A 3SXYA 4FGZA 2EK5A 2LF8A 1U78A 1LJ9A 5TRDA 3LDFA 3HIFA 3G5TA 2EJRA 5CVEA 1AV6A 3EUHA 2ISYA 3CBGA 3AAFA 4AZSA 3HCEA 3DXXA 3C6KA 3I64A 1K6OA 3N4MA 3COAC 3ROUA 2RV8A 2IW5A 3G89A 1WWXA 3SR4A 1B42A 3TOAA 5LEKA 3NW9A 3A25A 3KQQA 1UHMA 2X4HA 3HTSB 4HLXA 5EKXA 2L01A 5DRTA 4ESJA 3IKTA 4LK0F 4KA4A 2EFOA 5KVAA 1I1SA 1SFUA 9MHTA 3D2LA 4KN7X 3QU6A 2HR3A 2PQ8A 3MEXA 3GO5A 3KP4A 1FJXA 2HFHA 4GC9A 5FA8A 1ODDA 2BR5A 1R36A 2HEOA 3O4FA 2R6ZA 2VOOA 4UVAA 4RV9A 3E97A 4BQAA 1ZGJA 4KN4X 1R5GA 3FUUA 5FD5A 1HKSA 2PT9A 5DM0A 4LECA 3GDHA 1KQ9A 1P4WA 2DPDA 4Q47A 1RI3A 3G7UA 4CTJA 1D2GA 2IA1A 3GGDA 5H6RA 3WTUC 2F5EA 2JH9A 5EMLA 1O7FA 2QQAA 3KP2A 2ACJA 3UJBA 2ADUA 2FSWA 2CMGA 1W5TA 3QAHA 1ZH5A 1L3IA 2F2EA 2F5FA 5K0EA 4BLUA 1V4RA 1SD6A 3C18A 4RB1A 3KEQA 4MWZA 4RTOA 4HX7A 1RJFA 1QANA 1RJGA 4AIHA 2IRFG 3RIEA 3NDIA 1R23A 4YUYA 2GA1A 2H94A 1MJFA 1IAWA 2KIMA 3LFKA 5CCXA 2LD4A 2HTJA 3HHHA 2XASA 3HCCA 1KQ0A 3DTNA 1V39A 5K0NA 2ESNA 3DXJF 2QVOA 2P8TA 4P9UA 2K27A 3IKVA 1RI4A 2FBIA 1KYWA 3ZN0A 4O3MA 1ZREA 2ZWVA 1TLHB 3B02A 2OPBA 3G8BA 3P2KA 4PYKA 3F8FA 3HM2A 2AR0A 5E9JA 1U3EM 5CM2Z 3ECOA 2EJTA 1WY7A 1SFEA 4ZH4F 2BE5F 1O57A 5J8FA 1U2ZA 3TKYA 2IA2A 2UZKA 4LLNA 4HW0A 3KQVA 3LDGA 4DCGA 4MTEA 3A27A 2ZMEA 3NTVA 4BAYA 1NW7A 1REPC 2M5WA 3G5LA 4WVLA 1F9NA 4FT8A 1WSUA 1ZARA 2AZTA 4EM2A 1HSJA 2CG4A 3CJQA 3F21A 1G6Q1 2IFTA 3R61A 5B1SA 4MEXF 5DDGA 3M6XA 3UWPA 3MTIA 1O7LA 4A5NA 1MHTA 5KQSA 1R1VA 1JSXA 3EVFA 4YMHA 4KMUX 3QOXA 3V8KA 4U7BA
chains in the Genus database with same CATH superfamily
2G7MC 3K15A 5D4SA 3WFIA 1RRKA 3FD8A 3DWEX 2ZU6A 4MUBA 4HI0E 1KAQA 2CB9A 3ADDA 3K0HA 4OUDB 1CE8A 3T0FA 1C3LA 3DE3X 4FDVA 5FL7A 4CIVA 4R8SA 1V3VA 5ITVA 4NPCA 4YRKA 4I7HA 5EIXA 3ZZTA 2HJSA 2FMLA 3CF0A 4X3PA 2A88A 1G3TA 1QP0A 5I7WA 4B40A 2FOXA 1KYTA 4ZKEA 5BSHA 3U7EB 3DSRA 3STUA 3A3KA 3EDOA 1C1XA 3GLHE 1BE0A 2K4MA 4JL5A 5AHOA 5E3OA 1RPNA 1U0SY 2OWDA 2EFGA 3AU9A 4JSYA 1X0XA 4PLHA 1KO5A 4CM7A 3ZTYA 3MJTA 2ALJA 2MT9A 3PPXA 3LY8A 3LAPA 2PFBA 1P29A 1TA9A 1ZI6A 4F7ZA 3DOIA 1NGSA 1PR9A 4YMLA 2Z6UA 3DHYA 2O2JA 2G9NA 2R6JA 4X60A 5HF6A 2P2DA 3QY0A 1WUKS 4BL0B 2P2CA 2Z1MA 4KVZA 2BFOA 1UFVA 4L3WA 3DLHA 5KX5A 4ZMRA 2XE6A 4LSMA 4Y2TA 5CFOA 4I0WB 3JQDA 1MDMB 1GTMA 1QXSA 2PH7A 1XUOA 3ZU2A 1OLXB 4GXRA 3TOCA 1UDCA 4JC5A 3ZCRA 4E3WA 1KQ8A 4AU1A 2AEEA 1G60A 3H97A 2BMAA 1EGAA 3HU3A 1VCMA 1AKTA 4QJ5A 2FJPA 1XKTA 3INGA 1LRKA 4PZAA 3LCJA 4HNRA 5BN3B 4FSXA 1NVGA 4YUVA 1G3YA 5DISB 3ZNQA 2W24A 3S1AB 1KQOA 1WBDA 1T2VA 5I3ZA 3IV5A 5TQ0A 5M5XJ 4BQPA 3FYDA 4LC9A 1LPSA 4YAJA 1L7OA 4URZR 3TBHA 3GEDA 2R7DA 3VOAA 3OE1A 4DW8A 1ZJJA 1P77A 2CXQA 3DWLE 4GH5A 2QBYB 3VPXA 3L84A 3S5JA 5LQRA 1T3GA 1W44A 4XONA 2P69A 3FISA 2MINB 2LP0A 1O6GA 1S9DA 3GMEA 1E1DA 3R60A 3TDUC 3BOSA 1VSVA 1ZN9A 2JGJA 1CF7A 4BO7A 2DA5A 3V97A 1Y33E 4KBYA 1EVKA 1IRZA 1WB6A 1MBEA 5C7LO 1U7HA 5JATA 4MQFA 4LJYA 4BNYA 3B13B 1L4NA 2IS6A 4OA5A 4U4AA 3KS9A 3PUFA 1KY2A 2AD1A 3I53A 5G2OA 2GXUA 2A05A 4QQNA 1CIJA 5CIWA 1WTCA 4ZCQA 1XLUA 4B79A 4FYVA 4F5WA 4REOA 3TOZA 4M53A 2LR0A 2ZWMA 5SYNA 3KXDA 4EUHA 4MYUA 3DEIA 4RH0A 3EGIA 1GQOA 5DD8A 4K3UA 4B35A 2PJDA 1TUBB 3SEZA 3PUIA 3I9MA 4LGYA 2PS1A 1VRWA 2HR1A 2GEBA 3U40A 2C7RA 1NTCA 1QHEA 5KTTA 4PAQA 5DCWA 4HF7A 2CVQA 2YRFA 3M82A 3PI6A 5IM5A 1BJTA 5CA0F 3TTTA 5G3YA 4F4HA 4RLQA 5ESDA 3OYIA 5EZSA 3IDOA 3EXHC 2O03A 3R5TA 3HKCA 1VQNI 2YJTD 4R0NA 3R0XA 5E3HA 2W7NA 5F04A 1M7HA 4RL6A 4Z9BA 4RELA 2Y1LA 5KTPA 4F2GA 2ODQA 2ZGVA 1S4QA 3LHIA 3AVUA 4UUQA 4D4HA 4BKMA 5KU7A 2UYHA 1JLLA 2JVJA 1F8YA 3I4FA 2HQAA 4X62B 1PS0A 3UATA 4CLRA 4RENA 1I4TD 2LIPA 3PTLA 3HXKA 3P96A 4M9UA 1U2QA 4BP9A 4KAJA 3AB3A 4A3DJ 4KSYA 1JQBA 3C5VA 1V2GA 4NS1A 3FPEA 3FTCA 1E32A 4ZDJA 1XZFA 2NP6A 4YFNF 4QUAA 2R84A 3IUOA 2FUEA 4A92A 3M07A 1MAVA 4WFQA 2KSQA 1GHCA 5CXUA 3A04A 5F5XA 1ZGBA 4CW7A 3B3FA 1KJYA 3GF2A 2WVAA 4H4CA 4L8FA 1VSTA 1CRZA 4QGGA 1RLMA 2IEDA 3DZIA 1BOAA 3CO6C 4CR8A 3S16J 4TXLA 4AMYA 1VQOI 2NZVG 1B6GA 3A1NA 4C9YA 3AKCA 2R1ZA 4AVZA 5LQJA 4V02A 2CUFA 5FI5A 2Z08A 3F6EX 1HW2A 3L0OA 4L08A 4CMGA 2ZQZA 3U4DA 1E6CA 1SC6A 4C7OA 1WXDA 4D5EA 1QTIA 4AY4A 2ZTUA 1E0EA 1RYNA 3ZVRA 3TNDA 2ZSEA 1ICIA 2IZOA 3L5KA 3LV8A 1E64A 2IQ5A 1W2HA 2XCQA 3VA7A 3IBYA 5ILSA 2R62A 4HD8A 2H17A 5CYOA 2QZPA 3ECCA 1U1IA 3JYLA 2F8SA 1KYVA 3ES9A 4BO9A 1EP3B 1OCTC 1IY1A 1X42A 4G65A 4EEXA 1NXTA 4OHOA 3TSWA 1Z5PA 2A0WA 3H5IA 1XL0A 2G83A 4G0NA 4OMFG 4MFDA 4OM8A 3VU3A 1T9BA 2FN9A 1IV6A 4BHBA 1EE9A 4Y6OA 1HC7A 3JYPA 2XUDA 2C82A 4Q93A 2ATEA 1USSA 4CA0A 2W6JD 1LK7A 4GOOD 1G3RA 4WZBB 3U7IA 5IT5A 5AONA 2PPLA 1WCMJ 2F8TA 3U13A 4MQLA 4RJ2A 4AKTA 5BWNA 2XTAA 3BT9A 4B2IA 1X7WA 4D9MA 1HM5A 4DHEA 3FKQA 5DBIA 1EVIA 3N8DA 1A9XA 3D4PA 2BEWA 4FE4A 5IVPA 1CUEA 3RT1A 3SZTA 1BDBA 5HNKA 2ZAOA 5DCUA 3I5XA 1QV9A 3UWOA 4DABA 2F17A 4DUPA 1XEXB 4Y2QA 3LM8A 4GRIA 1WEHA 1NP6A 5L45A 3R2JA 3DPTA 1QV7A 2YJ6A 5JC1A 3MRXA 3WHLA 3IDQA 1P0FA 4D2IA 4BDYA 1NBAA 2M6RA 2UXDB 1B3BA 5DNCA 1P2SA 3U1KA 3KX2A 3K8OE 3A2KA 3E6BA 4QDZA 1UKVY 1YK1A 1PGNA 4JYAB 1G0NA 3ND6A 4IXDA 3A6KA 1G4UR 3HTXA 3U4AA 1QTRA 3L46A 4YJ3B 1R8QA 3QX3A 4R8MA 2QAIA 1KI2A 1X7XA 1ORIA 4JA0A 3F7TA 3CY6A 3OO1A 3LY9A 4ETIA 1Z0FA 5I7EA 2PGAA 4J1SA 1PU2A 2VE8A 4HLCA 1BXZA 5JY6A 4NK5A 3CCQI 2DT5A 4S04A 3QYFA 1OXVA 4MPTA 1SQSA 2Y77A 3C4JA 3PDWA 3LBHA 2Z2YA 1E69A 1XRRA 1H2BA 3EYIA 2TMYA 4IDAA 1HDRA 3VWBA 1L5GB 2IOYA 4BV3A 2B7EA 4QOGA 3HWSA 4F4CA 3C7DB 1TCVA 3FLMA 1CQJA 4UCQA 1LVUA 3FZGA 4TV9A 3NXKA 3K9NA 4M1ZA 1Y1SA 1EWRA 3ZDFA 2CHFA 3DH0A 1EUCB 4WKCA 3EGDA 1YV9A 4ETNA 1M2OA 5KZMB 4X63A 5LRSA 4OGFA 4F55A 3RQSA 4ZYAA 5ITZA 1GPJA 1PJSA 3L06A 2VJMB 4LZAA 4ZYHA 2Y1KA 3W2FA 2IXSA 2Y75A 2VNSA 5EJEA 5AP9A 2EIJH 5CFLA 3KD3A 3A2NA 5CDFE 3UW1A 3MHTA 3F5QA 4HGOA 3Q0WA 4RGBA 1PYGA 3OY2A 3SYMA 2NQ2C 4DNOA 3ZV6A 2JI9A 3TXYA 1DWUA 2DLNA 2BW0A 3OLXA 2YCBA 2IYRA 3UKGA 3IPLA 1WXEA 2VJ4A 1WF3A 5L3EA 1VLHA 2QTVB 2ENUA 3WLTA 2VJQA 4UU1A 1UEIA 4HX8A 4NJOA 2FEAA 2X1VA 2G7UA 2ISCA 3LPLA 3BRSA 1Y9JA 1GSOA 3EPHA 4FGJA 2BMFA 4GSKA 4P3YA 4FX4A 2YFYA 2O0MA 1ND6A 3AJEA 3RW9A 3IT2A 4YREA 2FKAA 2QNRA 2A3SA 3QLUA 2CDAA 3M0EA 4UHKA 2CLEB 2CNWD 1AKRA 2V4UA 1V3FA 2BTQB 3ENQA 4GXQA 1IQUA 1SVSA 3GLGB 3F4LA 4G0VA 4GR9A 3AG4H 5EJMA 2Z8YA 2RHOA 3HS3A 2A5FA 1AN0A 5AOBA 5LA6B 3TKAA 6LDHA 1QGZA 1FU7A 4RYDA 5E1OA 2CK3D 1FQKA 4AIKA 2RAUA 4N5NA 4XKCA 5ADWA 4WZAA 4JBAA 2ZITA 3CUYA 3IJRA 2B3TA 2XVMA 4D57A 2D3WA 2EJCA 1ADGA 4YALA 3RASA 4TYNA 3GJRA 3V6MA 2ID3A 2D1FA 1UXHA 1L4GA 3DZKA 5K20A 3VYSB 4IJ6A 4MR7A 3X1JA 3O5AA 4BBZA 4EY8A 1QP4A 4PGAA 3ZUGA 2IU3A 3KOZA 1ZG3A 3INRA 1BHSA 2EP7A 3W3CA 3IE1A 1ICEA 3Q3IA 3WGIA 1DRVA 2VSNA 4JYBA 4EF6A 4D4IA 2JF0A 3D6FA 1XRJA 3QU2A 2O0JA 4L6AA 2O8FA 3VDRA 3O4RA 1MGTA 1EJ6A 2HSJA 2Z16A 4Q3LA 3WGOA 1NG1A 5HFNA 5FADA 5AIBA 2O8BB 1W7AA 1P91A 5EP1A 4TYYA 3OYCA 4LGCA 1FCJA 4EYKA 3QU4A 3OM8A 1K61A 3VR6D 3MSCA 3C1AA 1BIFA 4JLMA 2ZXUA 5LB4A 2EFEB 2Q41A 3GAAA 1TWFJ 4A5OA 4L7QA 5C5CA 5CVVA 3T1YB 4HNUA 1TJNA 4ZI5A 2CNKA 5IFKA 2OKCA 2L54A 3IULA 4BVAA 3FCEA 1KYZA 2WJYA 2X8AA 2P5UA 3WV4A 4D3XA 1A04A 2VUSA 1QZZA 2C2YA 1BGVA 3U7QA 3H2ZA 2X41A 4B9EA 3ZGYA 2IYSA 3DAHA 1D4AA 3BR3A 3DBIA 2AFIB 3RG8A 3UGJA 2HA4A 1T5IA 3PI7A 1BDHA 3I9V2 5GY7A 4M3NA 1IF1A 4YBZA 2XLCA 4XQEA 3HU2A 3FBNB 1S96A 2OQGA 4WNCA 3RSFA 1NNSA 4GGGA 4M7WA 3EIFA 3HSFA 3VH3A 3DV8A 5ARBA 2DJ5A 1QYIA 1AN9A 5E1XA 4POOA 2EA2A 3R23A 3GUYA 2RKWA 3VKUA 2VDJA 3ED5A 5CA1F 3KC2A 1PF7E 3Q6NA 2ZRCA 3HCFA 4KO2S 3ASVA 2V6CA 1RI2A 3DMFA 1UDBA 3KEOA 3FSRA 1G4AE 1UZAA 1HOTA 2DPXA 2YXEA 4JYCA 2DPYA 4NENB 2F55A 2C4HA 5HXAA 3QUTA 3BERA 4A5SA 1GT6A 4H4KC 3IIKA 4E07A 1GVDA 4A5MA 5C2JB 1HQYE 3AYXB 1UWCA 5FCDA 4OQXA 5K8TA 4BMZA 3QYJA 1VG0B 4WY2A 5KVRA 1W4ZA 4O4IB 5EIAA 1RXYA 1LJLA 4A3BJ 4LQ4A 3UQYS 4BO1A 3S2EA 1YC5A 1NLFA 4IS3A 3D1NI 3KOXA 4DPKA 3CRQA 4KE9A 3A58B 3BAFA 1RXEA 3QKIA 4L72A 3TTYA 4M55A 2VUMJ 1FLVA 1LA2A 2IPMA 1XZ8A 2FJ1A 3D4BA 2K5CA 5K8UA 1ZC4A 5CLSA 1UMDA 2PKRA 4RKYA 4DLRA 4QBFA 5TGZA 3KQKA 1T5DX 4IVRA 1TIKA 4RZIA 4FIZA 4PZ0A 1KRHA 3WTYC 2I3BA 4E6KG 1UAAA 1ULZA 5KAFC 4PX9A 3FLEA 3FSGD 4P84A 1FXWF 2C78A 1SCDA 1WMBA 2ENWA 3FXQA 2XRZA 2OAEA 3RABA 1C8KA 4C0QC 3AJ8A 1SOUA 2CW0F 1JHZA 4OD0A 3OPNA 3HR4A 1L3CA 1Z18A 2L9SA 4AUMA 1T2UA 3HBFA 3WIDA 4R7TA 3LDAA 1NN1A 1NIPA 2IF2A 2IRWA 4O5VA 4PR3A 4UMDA 4IJMA 3OAAD 3S2GA 1H6BA 3TSOA 1C81A 5EKSA 3RRXA 4I0BA 4D92A 1UPXA 1LSJA 2QR5A 1RPJA 2J46A 4AROA 3L93A 1SCQA 4TGLA 5AVOA 4F4JA 2BR4A 4XUDA 3F71A 4ZAGA 5K0SA 1A31A 2EYQA 3VJKA 5CA0B 3LUHA 2L9VA 1ZCBA 3WTZA 1T0PA 1NM5C 3QKWA 4UMVA 4A2CA 4GI5A 4MJ7A 2RG7A 3K35A 3K7AJ 4PAMA 4IJUA 3K0CC 2LY9A 4RHUA 1H2FA 5FO5A 4JJGA 4QFDA 5JCZA 1H2WA 3SMVA 1BWPA 3HUUA 3TVYA 1E3JA 1FJLA 2QUZA 3QUBA 4YLGA 5JDIA 4B75A 1N77A 4UBLA 1HQDA 3O8CA 1MMNA 2X9NA 1KNQA 5GP9A 4E7LA 4DYCA 4AUXA 3L7OA 4I55A 3KR9A 3JWPA 4Y7NJ 1BW6A 2WYWA 3ZW8A 4BBSJ 3LBAA 3AF3A 1GXPA 2ZU0C 2VJLA 4PGHA 4DR3B 1YT5A 1X1QA 2FX2A 1OYYA 1DBQA 3WJ2A 5AUPB 2Q99A 2IUSA 4GMHA 4XCVA 3OLVA 3Q98A 1FBQA 4BNDB 3OIVA 4DLTA 3WWCA 1SBYA 3B3GA 1OX4A 4RE6A 4FINA 4B3MB 2POQX 4RLSA 1JDTA 1KI4A 3CJNA 4HEJA 2XHEA 1GCIA 5J8CA 5DM7F 3NFYA 5I9NA 2Q2NA 4KC0A 2FMYA 3O8OA 4IUDS 2ONYA 1NTRA 4RQBA 2YIDA 3UY4A 1VLZA 1ZICA 2GZRA 1J56A 3I3OA 2A86A 4C04A 1PGPA 2EIXA 1Q1VA 1LLCA 2VDLB 4JU9A 3ITDA 1JUDA 1SKQA 1R8JA 1EKXA 1L3LA 3MOSA 4H0FA 4QU5A 2XE8A 5CYGA 4O33A 1USKA 1K66A 3ANSA 3ZN1A 2ZR7A 1CY1A 1ZG5A 1RXSA 2ET6A 2XGJA 3K0AA 4WBSA 2JIDA 2J0UB 4TMZA 3B6KA 4PC1A 1N9GB 3IUJA 2RDPA 3LC7O 4ACBA 4RACA 4IZIA 1VJ5A 2X0NA 4RVCA 4L4XA 2OBLA 3C8ZA 2GNAA 3DNMA 1XN7A 2A9PA 2X1MA 4WXDA 1QBGA 3LKBA 1NBIA 3KFXA 5HBGA 1P4GA 3U26A 1UMCA 3EPKA 1W9HA 5IK2D 2IS1A 4J0FA 1JAIA 2EFNA 1T0FA 3RT9A 2NZ2A 2IU0A 4FYPA 4DJJA 3ANYB 1UMBB 1E1MA 3A0UA 2ZSJA 4FFSA 3WK8A 2AHRA 3ABSB 2LE0A 2IW5A 5EKTA 3BG7A 4XRGA 3KQQA 3EMKA 3U19A 2FE4A 1DAIA 4ZDOA 2JKZA 3LJKA 1HORA 3TDMA 1C5KA 3MGBA 1S8AA 1Z2DA 3PEWA 4FYKA 3T41A 3CDLA 4IEIA 4PG4A 3UV7A 4EHBA 2O2GA 2PXHA 3AEKA 2HEGA 4M1QA 1OGIA 1CUYA 1O7FA 1CDEA 2R8OA 5K7HA 2H7VA 2AKAB 4Z8YA 3H16A 4Q4JB 4RB1A 2EEPA 4XJSA 2GD2A 2JBAB 1JJVA 3TDKA 3RTDA 3M1IA 5JXWA 3HB4X 4FI3C 2GPTA 1DC8A 5BW8A 1KYIA 4GLBA 2ZJ1A 2JLXA 1IPFA 3PQ5A 3H5NA 1XB2A 4QIWN 3HYCA 5ALUA 3W8RA 2NOJB 1E9RA 2QIOA 2JEOA 3IVMA 1VJCA 2AJBA 3G8BA 1X38A 3LUJA 3QBVA 4RE5A 1QF6A 3HUTA 4TKVB 1AQ6A 2XF7A 4BAYA 2QN9A 4JI6B 4YRCA 2M5WA 2P3SA 1F9NA 2K9MA 3L0PA 4RPCA 4RF5A 5JEDA 1C7EA 2IFTA 4MYCA 4F38A 4FNOA 3R61A 4Q4DA 3UWPA 4A5NA 2HL6A 4B3TB 2VYND 1Q1QA 3OJFA 5AW5A 5H3LA 5HLGA 1G8PA 2CW8A 5MDHA 3EC2A 3RVDA 3NWBA 1P5FA 4LOKA 3B1XA 3WNZA 3M9WA 5DLEA 1BOOA 4HH3C 1Z4NA 4DG8A 4ZV4A 4OMUA 2ON6A 3BA1A 4TQ9A 1XG1A 3OX2A 4YA6A 2WQZA 5B6PA 2HWVA 1ZI8A 4ND6A 4IL6C 1QPBA 1JWLA 1JUSA 2QR2A 1PL0A 4WKGA 2HDWA 3F2VA 4A0SA 3DOCA 1DAEA 3HKZA 3LWBA 2V65A 2XNKA 4IDBA 4FFDA 2FY8A 3ANLA 1QCZA 1DPRA 4MW7A 2ECFA 3SXUA 5JO0A 2ZLBA 3RSLA 1IZZA 1ORVA 3AF2A 3R6LA 4IIJA 1P3JA 3GFPA 1GFSA 3KZZA 1Y4ZA 5FWYB 3SC6A 2C7QA 2PGJA 2XTJA 4DIMA 3DKWA 3C5CA 5CGZA 4KQWA 5E3LA 5AIQA 3TKLA 4NG5A 2FSSA 3NEUA 3RIXA 4MRAA 5CUQA 2BFFA 1IB6A 3SX4A 1KPHA 1Q5PA 4FHDA 3K9WA 1FK8A 2MU1A 3DDUA 1V9LA 3I73A 2YL2A 1UODA 3OMXA 3IUMA 2Y4OA 1QO0A 2C5SA 1W1IA 1UBSB 2OZLA 1BI1A 4W9RA 4KOEC 4AJHA 1W4AA 2KBFA 2E1NA 4TRRA 3FMVA 4DDTA 1E9CA 5EG0A 1J0RA 3IT3A 4YV1A 2NRAC 4HGZA 4LPSA 2HBQA 4KGXA 2E48A 1I1QB 3GCWA 2O8XA 3CX7A 3S8PA 3Q3HA 4BX3A 2FG5A 2ZSHB 4MK4A 2I5PO 4IDCA 1KO1A 2G77B 3QUCA 5JI6A 1ORHA 1AH2A 4DBQA 1HURA 1VG8A 2AG5A 5J3JA 3W0LB 1KAOA 2Q0QA 3B5IA 1Z3YA 2EVWX 1SOMA 1R10A 1OU0A 2NZXA 3GGGA 2ONKA 4AJJA 4AX8A 5JZBA 4QHTA 3T5CA 2GIVA 3LUPA 3FJYA 1AQNA 1TZLA 3O95A 2Z2ZA 4NZZA 5A5VA 2VJNA 4MLDA 2ANBA 4N8DA 3RIHA 4ZOEA 3NZEA 3DZJA 1OQAA 4TMWA 1E6WA 3CCJI 5T41A 2QTNA 1TAHA 1E1CB 2IHTA 3IKJA 2XD9A 4URXR 1VLJA 2TMGA 2YVQA 1EH6A 4O59O 3IPYA 3SF8A 2QYOA 4CKEA 4WOJA 3SF0A 3EZ2A 3NOXA 4BTLA 1TC1A 1L4KA 4HEA2 1B8IB 3K1AB 3WTTC 2DOEA 1AS0A 3AF0A 4H0CA 4QLAA 2JFPA 4ZI7A 3FYHA 5I9SA 1FY2A 2OO5A 1LW7A 1IAVA 4KQJA 3E3VA 2YW2A 4RWEA 2GK7A 2Q49A 1K5GA 3KIPA 4U2GA 3IOBA 4D9FA 5IKOA 3AQ4A 3HC7A 2A1TR 2KI5A 2D7CA 2AOXA 4TSRA 4HG2A 4RTQA 4O4HA 3VHLB 3VGJA 4FXPA 1YASA 3ZK9A 1B1BA 3VXKA 3NAUA 1Z0DA 1LE8B 4MYRA 4FT4A 5IHXA 3VR4H 4KO4S 4HF2A 3UANA 5KVCA 3DFFA 1ETHA 1E9DA 2HBZA 3PJRA 3GFIA 4BO0A 1UJ6A 3WRYA 2B30A 1GL7A 3UAOA 4E2FA 2JD0A 2YJ5A 1LSUA 4JBLA 5C1DA 1T26A 1U90A 4X6YA 4WHMA 3BG6A 5MGNA 2O6LA 4R8HA 2H31A 2OHFA 5CA1B 4QU9A 1V1MB 2PLWA 2VWQA 2QM7A 2UZIR 5A71A 1M6WA 3U1BA 3O1HB 1GU7A 3CT6A 2RQPA 3WLHA 1ZDMA 3DV2A 1S2MA 2O7NA 1MRNA 4GDFA 3W1VA 2R8EA 3CLVA 1XXHA 3CP8A 1UJ2A 1RLUA 4P5OA 4IZ6A 1YS1X 2VDUE 4MFEA 5FKOA 3DFKA 1RWWA 2PWBA 1CR4A 3BZBA 3NC4A 2NUAA 1XP8A 1MJHA 2BY0A 5B1BH 3FVVA 5LWQA 2LKCA 2O8NA 1I4EB 5TLSA 4W8HA 3KEFA 3RVOA 1DPGA 4I50F 3AEUB 3U48A 1G4DA 1VE3A 2EFCB 2HADA 3RC2A 1H3NA 2H1SA 1A27A 2FEPA 3HRIA 2REQB 3VR5A 4OOFA 3D6UA 2MR5A 3PEEA 4TL6A 4P4SA 1UBMS 2R8YA 1Z34A 1E5DA 2Y4NA 1M73E 3BJRA 1R0WA 4LDPA 3B70A 5IKMA 2YASA 1QYWA 2HGCA 1A2OA 4KR6A 5K5OA 3KSBC 2CHUA 3AERA 4INAA 3KYLA 5LQNA 1E2QA 5EIEA 3PNTA 3KU1A 4LNHA 2ZKIA 1W85B 2WYOA 2XYRA 4EA6A 4BNXA 2WYVA 4ZRNA 1EFHA 4CMBA 3KQLA 3NBAA 3DC7A 3KALA 5E1DA 3ZE9A 2UVPA 2AS0A 4OI1A 1JFSA 1J2YA 3CS3A 3IP6A 2YU9J 2JRTA 1NWCA 4YIIA 3GFSA 1K4YA 3WGGA 1C3OB 3VISA 2WTXA 1FT9A 2EJVA 2K3PA 3W5VA 4BMSA 4OHVA 4DBLC 4RVOA 2EGHA 3OC0A 2UXBB 5LQKA 2P5TB 4R0MA 3CH6A 4HTFB 4O2BB 2V98A 5JJLA 4P1ZA 4DJFC 2XVAA 3ABLH 2XRFA 1U8BA 3AUFA 3MJHA 3AQIA 2QL5A 4R51A 2WIAA 1F0YA 3QOEA 3TD6A 1G3IA 1I30A 4RHCA 1CEQA 3AU8A 4GQAA 1Y8RA 1QIDA 1OXSC 1FYKA 4NF2A 4CMCA 1HFKA 2FPIA 3F2IA 3EVEA 1KY5A 1FL9A 2ZRQA 4A8TA 4C0KA 2GCOB 4XXHA 2DM6A 2E2WA 4QJIA 4O1HA 3C4QA 2VF7A 3HKEA 3IH5A 2DVMA 1CWUA 1K83J 1DC5A 1O54A 4ARSA 5KYTA 1D04A 4A10A 1EFPB 1YA6A 1KEUA 4QU0A 3B6MA 1YH3A 4WACA 4NFSA 4WXPA 2EW1A 3A7EA 4US0R 2M98A 4XQCA 4M0UA 2IGMA 3M3HA 3Q0VA 4E2XA 3KBBA 4LDZA 1M6NA 3T4UA 4CCLA 1G8GA 3V46A 1C9JA 4FQ8A 4JEHA 2H85A 1G3QA 4G2NA 3W1EA 1U3DA 1QGAA 5D5QA 5FPQA 1H0RA 5BSKA 3PEVA 3DTTA 3W4JA 3CZ9A 3NO4A 2QRUA 3GARA 1RD4A 5EVJA 2O20A 2JAUA 5JLJA 3RS8A 3UPDA 4ESHA 2EG5A 4NZYA 4BLPA 4XORA 4Y2JA 4IH9A 5HHTA 5MN5A 1N5RA 1U6JA 2WUGA 2XCUA 3D8TA 3OTGA 4PSKA 1U0BB 3OX1A 4XYLA 2ZG6A 5K45A 4TV8B 4FYJA 2YUTA 4LAFA 5DI3B 4K86A 2KZVA 1OR8A 2Q0SA 1NW4A 3OWHA 2XWQA 1VMEA 5KYUB 2PSDA 1GUUA 2OPTA 4JV5B 1DP4A 1IHDA 4TTAA 4D0NA 1OWMA 5EC8A 2CLIB 2VH5R 1YE3A 4DZTA 1NKVA 3E8SA 2G28A 1XB4A 3RV4A 1XSVA 3GT4A 4TWBA 521PA 4PM4A 5F2NA 1QG0A 4L02A 2OFWA 3RJPA 3CZPA 4BRSA 2GS9A 3L7BA 1P5ZB 4MA4A 2HOTA 1QVWA 2R93J 3O90A 3CUTA 3A11A 3W6NA 2IBSA 3DONA 2QM8A 5DV5A 5L3QA 3O73A 3CZCA 1R5HA 5E9WA 2WLTA 5BYJA 1HF3A 3GU3A 3VBCA 2GLUA 1YTUA 2WF8A 4FFWA 4AX4A 1PR6A 2YTZA 4CEIA 5F2OA 3GJYA 3QSYA 1R5JA 4PHGA 3SXPA 4BY1J 2QOEA 3KO8A 3VC2A 5TEWA 5J2UB 4ZI3A 1K78B 1F9AA 1A96A 5AHKA 2AG0A 3IIEA 4F9EA 1FP1D 1IWOA 1HT0A 1J2UA 3A4IA 4DGWB 4QYMA 2XNDD 1MABB 5F27A 1I3KA 2H4WA 3KSAC 4JP5A 4LZZA 5TARA 4UHFA 1ZOOA 1J4AA 4JKOA 4HQOA 3BFJA 2JZCA 4CIYA 2E1MB 5CDTA 3BWEA 4M8LA 2HYGD 1USGA 1T56A 3KJIA 1ULBA 2Q1WA 2JDID 4KZPA 5ICSA 5BT9A 4EPWA 4TMKA 3SQOA 2D5VA 4HC4A 5DGIA 5B2FA 1QOQB 2Q4BA 3HEAA 2XBMA 1R6BX 4IILA 4KVGA 4YRLA 4YH1A 1ON2A 5F5NA 1RLOA 4N0PA 4F5YA 4BJ1A 5CFMA 1PG0A 3RTGA 5HCIA 2VUTA 2PD3A 3R3HA 1S7AA 1GKKA 4PXAA 5JMTA 5D8KB 4D3DA 2B9SA 2ECBA 3VC7A 4DA9A 3RRBA 3AFGA 2TYSB 4UHTA 1E98A 3UB4A 5AI4A 1Z2CA 3C3BA 2HXOA 5IVHA 3K6SA 1YS9A 1DX4A 5KYWB 1QNFA 4HUJA 1D3YA 5LD2B 2MSEB 2TDXA 1VA4A 4H1UA 3VR1A 3L1UA 4FOSA 4NQZA 4AYBA 4HDNB 3E3NA 3EEFA 5HBRA 1YQDA 2YY5A 2LBFB 3BIOA 1ZA1A 1B76A 3RU3A 4A2PA 4B6EA 1DKQA 3AMVA 2OM2A 2NPFA 2WZQA 3RVKA 2H0AA 5CFRA 5EHNA 4DPMA 3BWGA 4WA8A 2R7SA 3CHYA 4MGRA 5FLVA 3GRCA 4KWIA 4Q4AB 1Z5NA 4WZAE 3P9YA 5DNAA 4OHBA 4FXOA 5K6TA 1XAIA 2Q1UA 4XLFA 3W79A 5C8YF 2PMWB 4Q7KA 1KK0A 2V9KA 3U5ZB 1TFRA 4UNRA 2WOJA 3N5KA 1YB4A 2W8ZA 1OA0A 2H1HA 3NEPX 4XZ3A 2FUKA 3UH0A 2A1TS 4K8RB 5B53A 4D4GA 4N7RA 2OD5A 3INNA 5BV2P 1TF2A 3PSAA 1D1BA 5F9MA 4HDMB 4O4LA 3N75A 3KLOA 2EH3A 3OUTA 1Y9ZA 1M8GA 2L2OA 1WW3A 2Z9DA 3I72A 3RQIA 1Q44A 1NQAO 3MCVA 4LG3A 4ZRDA 5JFRA 1QGOA 2BVMA 2PIDA 1HK7A 3H1EA 3UOGA 3JQAA 1U0HC 4Q4ZF 2FSPA 5DH9A 3H4IA 3RDIA 2DWCA 4MPDA 4ETMA 2NNYA 5EQJB 3C3XA 2JSCA 5A04A 2AC7A 5LHHA 5HNHA 3CNBA 4PHCA 3JQGB 1Z8FA 4MGEA 2NP7A 3WU2C 3GQBB 2CZCA 1A3CA 1DAHA 1FBUA 2RSLA 2C57A 4ZVUA 4L9NA 4O6JA 5L95A 1YG2A 1HLDA 1C7IA 2BM8A 5BNZA 2B20A 3FMSA 1WI9A 3D7RA 3A14A 4DMLA 1GDHA 1KFCB 4XH9B 1U9JA 5COAA 1POWA 3BJIC 3CYFA 3JYQA 4BH9A 3I34X 2VYVA 3ORFA 4RJLA 1JECA 5CYVA 1P74A 2AHOA 3G3ZA 4EMBA 4ZK2A 2P0AA 3N53A 2BHRA 4N4AA 1KZ6A 1ZNXA 1GTSA 5DZSA 4HATA 3F1KA 1RRFA 2V6FA 5FJIA 5FL3A 3NRVA 2WV1A 4JVMA 1TT5A 3MTDA 2QA5A 3VI4B 3U2QA 3ONWA 3UKOA 1FIUA 4Z99A 2QW8A 3H8JA 3TRJA 1NMQA 3LUAA 3S2ZA 4O08A 3HL4A 5FJ8J 5FA5A 1NQTA 1R0RE 5HM6A 3A6GA 4D8VA 4N0MA 5A2QA 4IYRA 5JSYA 4G7HF 3ZPXA 5ADUS 4YP7A 2HPZA 2G04A 3UWSA 1ZQ3P 2O5VA 3AR2A 3R7NA 2AI1A 4HEA1 4P4LA 1YJXA 2WKPA 2A1IA 4WDQA 4HGRA 4QC2A 2HVQA 5ALDA 1FFAA 4BFYA 3RBAA 2XJ4A 4XLEA 1BGXT 4B6FA 1XDDA 3HY4A 1G55A 2X6OA 4DW6A 4PHTA 1ZD2P 1G3UA 4ZEWA 4NYIQ 2JVGA 2C9CA 3QPTA 1JIVA 2OO7A 3U3OA 1ZP6A 3JAKB 5ALSA 2VVTA 4C6TB 4D44A 2ZATA 5AESA 2WMOB 4IYJA 3ZJVA 1RFLA 4JXKA 5BQFA 3QSGA 3WDSA 3CQ9A 3SSOA 4LJLA 2XYPA 4IOMA 2IUEA 1GA6A 2AMVA 1OYWA 4K6HA 4CL2A 1ZA2A 3UJ3X 3AV3A 3GWZA 1LNSA 5GPBA 3FVWA 4D0LB 4XVRA 2QP9X 2E18A 2HU9A 2XW6A 3ADOA 1OFHA 2OZVA 3EGXB 3RC8A 2X6TA 5CEJA 5ALXA 1IUNA 4INPA 3KB6A 4HKTA 1USIA 1LKXA 1LH0A 2WYIA 2Q5CA 2WWHA 3W5CA 1J49A 3CQZJ 5FRDA 2H65A 5DK4A 1GGEA 5FLKA 4F96A 4KYWA 2WJVA 2IIPA 4FIDA 3A9SA 4EG6A 1X94A 5KOJA 3UMBA 3CMYA 5JAUA 1YOVB 2Z56A 4EG1A 4D43A 3VAZA 4LXYA 2ILTA 3KJFA 4BV9A 2DQ4A 4TMFA 4XGKA 5JYDA 5H83A 4PLGA 5HZMA 3ZE7A 5A4DA 5FNVF 1MJGM 1X1PA 4LYHA 2EZLA 3LSKA 3ZIAD 5AMXA 5IBCA 1XU9A 1SU6A 4JC0A 5ALQA 4IEFB 2NPIA 2YWHA 4C0JA 4M1KA 2NZJA 3DUFA 3FYUB 1HXDA 4BZPA 4HJRA 3AYZB 4KPFC 1SNYA 3AVVA 3T7SA 2BI7A 3K32A 1U3WA 1YZVA 2A78A 4GOND 1P7PA 1E2EA 2CXNA 4E7PA 3DZHA 1JLMA 4ENRA 1BC5A 3K8YA 5CBPB 1BA3A 5T4EA 4FOOA 2D7JA 2XB5A 1E5TA 3KT6A 1BH2A 3LP8A 4PAOA 1UBUS 1WXXA 1N2HA 1YBVA 2F1HA 1A5SB 2E5ZA 3AFOA 3SJBA 2IAIA 5J1YA 5E38A 3OIFA 1VC2A 4OIFA 3ILHA 3ASOH 2GETA 4ZVRA 3WE2A 3GJ7A 1VNDA 1FWZA 1C4OA 4B4VA 3FK6A 1GZVA 3FYTA 2XB9A 5U1PA 1B72A 2H3HA 3HDQA 3MQFA 3ZHVA 4D42A 3Q87B 1SAXA 4XWKA 3HJUA 4CF6A 2O2YA 1EK2A 3BMOB 1EK1A 3CTMA 4B17A 3DO8A 2REXB 2P2YA 1DI0A 3I0TA 1NJ6A 1Y4DE 5FPSA 3ZV5A 4BVFA 1PUFB 4HB0A 1SBTA 3KP6A 4Q1DA 4FGZA 5HE9A 4YXWD 3DBRA 5C7IO 2HF2A 5G41A 1Z07A 3QELB 5GTHC 1E3PA 1YR8A 2XBLA 3WR5A 2GQ0A 3FMGA 3ROUA 4Y1GA 3SR4A 1CDZA 1TZBA 5JS8A 4KAFA 5EKXA 4EB0A 1A7JA 4TN5A 3JTEA 4JJ6A 1SFUA 4PSCA 4ZTFA 2FZCA 3R5FA 4H08A 3JD1A 4A3IJ 1CNEA 1UJBA 2L42A 1WHSA 1C14A 4LRUA 4UVAA 3T9DA 2E37A 4W1PA 5IBQA 1KQ9A 1RI3A 2ZE7A 2R2GA 3LA8A 3K2IA 4S3MA 4RPLA 4LN1A 1AJEA 3NKVA 4YJ2A 1Z9BA 3FFBA 2QLLA 3IVRA 3NIDB 4EF4A 4Z4QA 2F1RA 2FMUA 3TPFA 3ZGXA 2P6OA 1AUQA 1MJFA 2XKBA 1E1KA 2WJ6A 2JFXA 5GOTA 1YDGA 2QHXA 4DBVO 1V39A 3T3GA 4IHAA 2K27A 4Q1BA 1YVEI 4I5DA 4J03A 2JGFA 3OLWA 4DN6A 1U3EM 2R7ZJ 4RA6A 3TECE 4KQ6A 1QONA 2DBQA 4ZH4F 4WD3A 3OTIA 3E9RA 2O4UX 1I2CA 2IOFA 1B0PA 2GJ4A 3UEOA 3K05A 1T3ZA 5TS2A 2OZKA 3OUUA 3MLAA 2L18A 2AZTA 1U98A 5JCJD 4MI1A 2W2NA 3DD1A 1NU8A 5L6LB 4LYJA 4X1YA 2V8OA 1KR2A 5JNRA 3EVFA 3U1VA 2CT8A 1C8VB 1DSSG 4NCHA 4BEHB 1Y0NA 2DH5A 2PQ0A 1JAZA 3LY5A 2VUIB 5AO9A 3EIWA 5FO1A 4C3UA 5K9ZA 2VP9A 3N70A 1GGHA 3MAAC 2OCYC 2OHXA 2WF6A 4JROA 2HRBA 4F6RA 4YRFA 2J3QA 1RQXA 4G85A 3Q0UA 1I3OA 4KYIB 2H51A 2R6HA 2ZETA 4XPIA 1HQKA 2X0JA 4AQYB 1Y3FE 3BTVA 3OHMA 1R18A 2GZAA 5B30A 2BRUA 3THOA 5JZMA 3K0FB 1NF2A 1HUQA 3RK4A 3QOWA 4EELA 4ECAA 2EKBA 3DTYA 2C31A 3JQFC 2I2DA 1IOVA 1ZXBA 1VTNC 1DFHA 3U4MA 2GZHA 3QLVA 3IPCA 2FF4A 3M6VA 2I1WA 1GVNB 3RAJA 3ZOZA 2OTCA 4OI0A 3O74A 1AHIA 2X48A 1YF3A 5HS8A 1MDFA 1DT5A 3LSTA 2VL7A 1O94C 2JD2A 5CAEA 5A4AA 5SYMA 1EDEA 4ZDPA 3BDIA 4FYYA 4FGLA 2PWPA 1CUWA 2HHAA 2D4AA 3UV6A 4H6PA 1G8XA 4FKZA 4V0NA 1Z7LA 1REQB 5AKXA 2WB1A 1G21B 3PFWO 2IVFA 2EERA 1K08A 2AI3A 1OC4A 2N9UA 1W5CC 5C0OE 3HB9A 3DT6A 3PHJA 2OAGA 3ZHYA 4Q37A 4JQFA 3PCTA 4MWGA 4GL4A 3QHAA 2YMMA 1RQ2A 1TYAE 5LDGA 1V8FA 1H2AS 1R1DA 5I8PA 2XWPA 1WDLA 2IY8A 4KOAA 4U2CA 5F9HA 1P5JA 3PNYA 1J90A 1U3UA 2XVYA 4CMJA 1GADO 4K1XA 4ZHQF 3U7HB 3N97A 3WLLA 1RZUA 5BN5A 3JQQA 1PR5A 5ER6A 4C4YA 4YS6A 3BBPA 1IN4A 1Q57A 3RKUA 1OFIA 1X7DA 3UOWA 4H6WA 4D96A 1RLIA 3IH3A 1HDGO 1UBHS 2RB5A 3TEFA 4UNNA 4IMIB 3PNSA 2FMKA 1B16A 3RZDJ 5AUOB 2QDKA 1FTTA 4LMPA 5IEJA 2C9ZA 1DBSA 1E2MA 2XRYA 1ZJ4A 4LC1A 4D0SA 3HE3A 3LS2A 4ZRMA 1XSEA 1TLTA 1MT3A 2HMSA 4IJAA 2OFFA 2Z9OA 2BSQA 4EIWA 3HP4A 3C6QA 2J7KA 4AL4A 2Y2UA 2WAQN 3BR1A 4L4RA 1TPYA 3VU9B 3AUTA 5C8YB 4I4TB 1X58A 2QM3A 2QL7A 1T4GA 4DCMA 5I47A 4HVAA 3MEQA 3NTXA 1HNNA 4M8NE 5KC8A 2TMKA 1Q7TA 1QDUA 3VYUB 2YV3A 2AYXA 1OGJA 2H52A 4K6OA 1F0PA 4M6WB 2DLCX 3OH8A 3DLPX 4BMDA 3ACBA 2ZDQA 4ICIA 1MHPA 3K8ZA 4LJ7A 2BGMA 2MTBA 5KDDA 2YV5A 2BTEA 1A9QA 3K2AA 1D1CA 5LFAA 2KW5A 4PO1A 4EA8A 3G4SI 4PYNA 1KGSA 2YDXA 1ODIA 2JN6A 1XEWY 5FTKA 3FHJA 1N2CB 3QU5A 3EJWA 3LLCA 4N76A 3Q9NA 2ERCA 2X0LA 4BB9A 1E3HA 2Z57A 4RANA 2YRWA 1I7LA 1TYZA 2WD7B 4LKRA 4ITUA 3HZOA 1QIGA 1TAGA 2JLBA 1X1CA 4BWVA 2ZBFA 2F00A 1UXJA 5HTOA 1MVOA 3JALB 2CXRA 2FD5A 1CLEA 4O8ZA 4Y0VA 1K89A 4XVCA 5KNDD 3RNOA 2PLRA 1Q1AA 2XEXA 5EMKA 4TQAA 2QD2A 1YBAA 4P93A 3VNSA 5B64A 3CH5A 1XYVA 4XOPA 2EV9A 4YASA 3NQ41 2AR9A 3T3MB 2JJ2A 1VRVA 3OF3A 4MQEB 3SSAA 1ISPA 1E17A 2PS3A 2PUTA 3L4BC 4K9OA 4FX0A 7MHTA 1YCGA 1RPZA 3ZBQA 1MTOA 3QVUA 1T8SA 2YJGA 2OZUA 2ZWIA 3F47A 4HOYA 3U4GA 4JLBA 3IGFA 2DTZA 2VO1A 3IP5A 1ZGZA 4UZEA 3KQNA 2ZNYA 2MLGA 5B7QA 4FBLA 4RSRA 3TTVA 2ZRPA 1KARA 2ZWPA 1QE0A 3PRKE 3WSVA 4TLBA 4IR7A 3ILVA 1MENA 5D3KA 2A6EF 1QG2A 4I09A 4B4WA 4IJ5A 1W5FA 1LVGA 1XSXA 4KKVA 2DOAA 3JS5A 4FDUA 4AZTA 2UYCA 1OZ0A 1Y1RA 5GVSA 4EAAA 1AGYA 2WZCA 3G88A 3HHEA 4I8IA 4IHJF 1SWVA 1O6BA 2CXXA 2PV0A 1NBOA 2YY6A 3KXLA 4D8XA 1UEXC 2ID6A 1H1LA 2YHBA 1KDVA 3UICA 4RK4A 4CFZA 3DEKA 2C9YA 2YCLA 2AZ4A 1GWNA 4A4DA 4JI3B 3G7SA 3H0DA 5KNBD 1WM1A 3IQIX 3H65A 1R6AA 3IV6A 3R8CA 5LMUB 2JGDB 2ME0A 3EIUA 5CD1A 1T4CA 3VKVA 3S2UA 3AI2A 3ZMVA 1KJZA 1X7ZB 2CL6X 4C43A 2ELKA 2B9VA 5E7MA 1I80A 4QDUA 2A57A 1YS2X 2GBLC 2GI4A 4RAOA 3H2IA 2C0CA 4EHIA 5ES3A 3KAQA 2W71A 3ZGVA 2EWWA 2W8BA 2DA1A 2AKEA 2I2BA 2P8SA 1ZSVA 1VKJA 1NXOA 4P3OA 2RI6A 3I6ZA 4B1FA 3VOTA 5AUNB 1RHMA 4C4OA 1W7PD 1VMKA 4J0GA 2NVXJ 3WA6A 3AUAA 2YWCA 1JSCA 2GEVA 4JOMA 1A0OA 2E1MC 3ED1A 4O4JA 2WWFA 5K8JB 1BXGB 3H11B 2X2EA 2QKLB 4KIBA 1JR3E 5IG2A 2HW8A 5K7ZA 1W4MA 2P2NA 1NW8A 4FTHA 2PJZA 1XGOA 3B85A 4MKXA 3OYFA 1YFJA 4FASD 4CTNA 4HEHA 4Z53A 1OXKB 1KVSA 1LDKB 1KU3A 2JLUA 3BLYA 1AHPA 1EWTA 4NSNA 4R3NA 2I4LA 1K06A 2AI2A 4XL9A 2DHEA 5IWCA 2W1OA 4GZLA 5KNCH 5IX8A 5FFXA 4XYMA 1FNMA 4JCCA 3VM6A 2H1FA 1EP9A 1HY3A 2HJ9A 2ID4A 4CDMA 2ZT6A 2HS5A 4M9ZA 5LD2C 1Z0AA 1N32B 1ESCA 1GYQA 2RHWA 4QECA 1VI5A 1NJ1A 1OKKA 2DBYA 1U7DA 1ZVJA 5KWSA 3EISA 1IY9A 4EWLA 3OBBA 4BX2A 1Z6TA 2WAOA 1TCUA 1Z12A 1KQPA 3QFSA 4JFAA 2R68A 4AYTA 2KT0A 2VF4X 3BGDA 3ZWYA 1IUYA 4GBED 1DQYA 2GB4A 5JOQA 1Q92A 2V6JA 3QVGB 4W9MC 1MMSA 1KC1A 4R2MA 2HRRA 1CUIA 1HA3A 4WXHA 1SJ9A 2Q9AA 1L9KA 2AVDA 4X8OA 3G1MA 5LBUA 1SZCA 1JPUA 3RAEC 4RZHA 3SEFA 2UUBB 3GFQA 1HSZA 1U1GA 1Y0BA 4JGBA 4R8KA 4KP7A 5KAPA 2NS0A 5FFNA 2IOFK 3DMDA 1MZBA 3PFCA 2PX3A 3VDMA 2NX2A 2GCIA 4INZA 4F56A 1ZTRA 1V4NA 5ARCA 1JILA 1SMTA 2R6AA 3FPBA 1V11A 4MVJG 1FOXA 1PTJC 3HGYA 4OMYA 4EGZA 2F62A 2H7CA 4R5HA 1G20E 4R2KA 3IA2A 3CC2I 2WAXA 3BE8A 4D8WA 3NORA 3PD7A 2EBWA 1QZUA 2DOKA 4RY8A 1MNDA 4MI9A 2IUUA 4QGFA 2RC6A 3GFTA 2GYUA 4Y98A 3B6EA 1ZK4A 2BGGA 2HTSA 4UHEA 4IV0A 4IM7A 4XICA 5E3NA 1MD9A 3CBQA 4LRXA 1T36B 3FCYA 4RX1A 3R0QA 1FC0A 3SGLA 2WZBA 1P1RA 2J5OA 1KA8A 3RUPA 4PZJA 1PIWA 1PSZA 2SCUB 1UIRA 5GAJA 5JISA 4Y6QA 4IZOA 3S68A 2J67A 4JP2A 3D2AA 1IM2A 3AM5A 5GV7A 1GAXA 4PONA 1S9HA 2YWDA 3R3UA 3O8BA 3BGWA 2HA5A 3TTXA 3OWOA 2JLWA 1NF9A 5A3RA 3TBKA 5KVSA 3USZA 2XPWA 4LA4A 3DF8A 2ZS8A 3ET4A 2ZSIA 3RBZA 2V7EA 3KQSA 4L9AA 4ABTA 2K5UA 2OU2A 3MC1A 3FNRA 2GH1A 4IZZA 4HQKA 1EHIA 1KEWA 5KWIA 2CFTA 3CRW1 2FW8A 1NBME 5DKFA 3WO0A 5A2QZ 2OLEA 1C9MA 1OSNA 1T6NA 1KZYC 5DYIA 2YY7A 4KIWA 4YCCA 4N9QA 3OE4A 1UKYA 5EUMA 1D0XA 4IVPA 4K0RA 1SPXA 5E6SB 4L2IB 3IJPA 3A4TA 4IXTA 4L7VA 2EP8A 3L0IB 5KTOA 4M1SA 2RH5A 4EB8A 3L09A 2V4JC 3E3MA 3IAFA 4R8LA 1W36B 2DHDA 1SC4A 3OPYI 5B3JC 2W2OA 3G2HA 2Q7XA 1RC0A 1NASA 5HDQA 4BP8A 1MW8X 4M0FA 4NL4H 2OV2A 2W43A 1BVRA 2QY6A 5KHLB 2C5GA 3WGLA 4EVQA 3OESA 3TNJA 3NYIA 2CFCA 2E5FA 1E9VA 1M0EA 3QBJA 1UXKA 5D5PA 3ZHSA 1RZRD 1DOZA 4FHTA 1HTWA 1N2GA 4XNFA 2O5EA 4LXQA 3RE1A 5THXA 1U2RA 1SCJA 2IH2A 1N0VC 1X8LA 3OQIB 1M66A 5LHIA 1OWLA 3ZG6A 4NU5A 3FCSB 2CSXA 3UJ7A 4HV5A 1DHRA 4JBWA 5C3UA 3T52A 1DX6A 2MWMA 4M3BA 1BEUB 1MJ5A 3L7WA 2SNIE 1NA5A 1G8AA 2FEZA 4CM4B 1KI1A 3ZV7A 3I5YA 1Y1LA 3SQWA 4ZJUA 1TWAJ 1FBSA 3ADPA 4RMJA 3BXPA 3HO1A 2KQRA 1QVVA 2D0DA 2W0MA 1H69A 1TL8A 1ZUD1 1MXFA 4ZOLF 1KFJB 1YKFA 4IHKA 1OXMA 1Z33A 1YDMA 2QJFA 2YHSA 3R3VA 5JQGA 3H3UA 5JCOA 1OVGA 4DA6A 3ZZ0A 1UK8A 4MJLA 4EM0B 3VVLA 1U2TA 4HSEA 4RDXA 4JLAA 1NULA 5D5VB 3B53X 4OMZA 2GBPA 3SS9X 4UV8A 1PEDA 1ZXXA 5T57A 4YT4A 4XDGA 4YMIA 1SZPA 3UFBA 2EJBA 1BN7A 3ESQA 3VZPA 4KXNA 3IQWA 1JQKA 3FYUC 3HJNA 3EVGA 1VKHA 4LGVA 4AU7A 5LQMA 2VC2B 5HZHA 1N8SA 3BWVA 2H16A 1SIOA 2C54A 1N92A 5D51S 1EINA 3JQ8A 5EJ6A 2H5IA 4YHBA 2WIJA 4XFJA 5HUHA 4CLXA 3H13A 1FX7A 1J0DA 4F5ZA 2LUOA 1E3LA 3BD7A 1VQ8I 1AKVA 1XLWA 4X1KA 1BJZA 4C05A 1F36A 4RVHA 3GMTA 3E6CC 4Q7EA 5EJFA 1PQPA 3MWJA 1YKSA 2CQNA 1IXCA 1QLJA 2QA4I 4LX0A 3N3BC 3IV7A 3GJ8A 4YQZA 1M74A 1R49A 3WQRA 2Q1XA 4WXEA 2BGLA 1YI0A 2GDZA 3ABRB 1FSEA 1W0CA 5EE1A 5DN6D 1EHYA 2RVCA 5KEIA 2QRMA 3AR5A 2W2PA 1EXNA 3FM5A 5DT2A 3DM9B 3OPVA 1X74A 3HLTA 2QT9A 3D2BA 2CKMA 3T1QA 2Q5LA 4ZYYA 4CIBA 5KK1A 1Z47A 2IXEA 3BF8A 3LOCA 2IXFA 4PAWA 3RSGA 5FWNA 3SLRA 1QGPA 4P7JA 4ZOCA 5FOVA 1P6RA 2JIPA 4MVJH 3BRCA 3ZZ1A 3H99A 1JR4A 5DCMB 4N0EA 1N0UA 2IYNA 2GLTA 2GHTA 4LI3X 5EWLB 3HCOA 1A9OA 1PLKA 3IQDB 1NSFA 3K9CA 1OR7C 1QHHB 5K3CA 1BS1A 4EEFG