1R00A

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-homocysteine (sah)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin-10-hydroxylase
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r00A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r00A03
4YMHA 2BBYA 4U7TB 2ZIGA 1RUNA 3TDZC 4BYYA 1ZRDA 2V1XA 1ZG5A 3UJDA 1K79A 1CF7B 2Q8KA 1CGPA 3B3JA 2R7DA 1DPRA 4KWCA 2JPCA 5ICGA 3AAFA 3W6KB 2GWRA 5EMJA 2DQLA 2XYRA 2V79A 4ATNA 3BXOA 2Z6AA 3HP7A 2HOEA 4M73A 4IHSA 3FUVA 4RYLA 4UV8A 2OD5A 1T2KA 4U0WA 1AV6A 3I9FA 3T7SA 1XMAA 4JK1X 2CMHA 4AZSA 4R05A 5FD6A 5J8FA 3PTAA 3TFWA 4WXHA 1BKYA 5FA5A 1B42A 4L0ZB 3CO7C 2FA5A 3HTSB 4L5IA 4R79A 1Z1DA 3G2OA 3FRIA 1XSDA 3CJNA 3DPTA 2GLUA 3SSMA 4CZZA 2V7EA 2P8JA 2F8LA 2Q41A 1U3EM 3JAMK 5K0GA 5D5XB 3EYYA 3GYHX 4CYDA 4RVHA 2AOWA 2OZVA 1LDDA 4ZYEA 3HIFA 1SUIA 3ZP5A 4BP3A 1R5GA 2TDXA 3ZN1A 1QO0D 1B59A 3UJ7A 4HBLA 3CJRA 1XVAA 2RKHA 4O6JA 1NKVA 4EMSA 1FC3A 1XCJA 1I9GA 3DMGA 3KP2A 3N97A 3VC1A 1T38A 1G4DA 5HLIA 1TPYA 3KCCA 1USTA 4QLCU 2AOUA 4E2YA 2EWNA 3P97A 1Q1HA 5GOZA 1FNNA 4GOND 3LDFA 2R6ZA 2GB4A 1SAXA 4G7ZF 4DQ2A 1JQDA 1XB4A 1FP1D 1O57A 2WA2A 1NW7A 4ER5A 2ZZNA 5FQOA 1ZHFA 2YX4A 1KGSA 1K7AA 1U5TB 4PIMA 3GF2A 2PBIA 3OOPA 2A3SA 2Q0OA 1UWVA 1T43A 4PDKA 1QAMA 3DXJF 3NWEA 3U2RA 1KPHA 5L3EA 2P6TA 4I02A 1Z9CA 3GDHA 4HF2A 3TGNA 4IV0A 5DRTA 1OR8A 1W7PD 2PSSA 2M30A 4GCVA 4YUYA 4RTSA 3ID6C 3NWBA 2YR0A 3J81K 5LRSA 2A07F 1VE3A 4MWZA 3FYCA 3EEOA 3KKZA 1GHCA 1EH8A 3V8LA 2PX4A 3NQOA 2RVCA 3HHHA 1ZLKA 2RGVA 3RW9A 2GA9A 3LKZA 4A0YA 2J5OA 4LWOA 3CUQB 1FZPB 2JPBA 3THSA 2XROA 3U81A 4AD9A 1FBSA 2FNAA 5HS7A 1WKMA 4HOBA 1U78A 2XUBA 1P4XA 1LDJA 3Q7EA 3R24A 1KQ0A 1LNWA 2ADUA 4CGZA 3PX2A 2E1NA 2NXNA 3KPVA 4LB6B 3E6CC 2ACJA 1UHMA 1KXZA 5EKXA 4YUZA 5CVIA 4IJAA 3ZMTA 4ASNA 3KZYA 2IT0A 2UZ4A 4NQWA 5H20A 1G3YA 1M6EX 2BR3A 2OBFA 5E1WA 3E6MA 3K1MA 4QTTB 1IRGA 3DQVC 2YPRA 3PS9A 3C6KA 1Z91A 2DU9A 1YW7A 4DM3A 1QANA 1X3UA 3K9TA 3VOEA 4K6MA 2XAFA 3WTWC 3I53A 4PONA 2LD4A 1J7KA 1UIRA 3WU1B 1HKSA 4H0EA 3NTVA 5DX1A 2O07A 1RJFA 3DMFA 1BOOA 1WXXA 5C0OE 1YW8A 2FEZA 2PI0A 2HV9A 1P92A 3FUTA 4C08A 3NRVA 4EQQA 5LQRA 2Y48A 3KQQA 1ZARA 2YUIA 3E8SA 3OZSA 2UWMA 4FP9A 2OAZA 5EIFA 1XDUA 4KA4A 3RDIA 2ESRA 4H0NA 3EDPA 1XD7A 2F2EA 2I62A 3MERA 2AR0A 3G5TA 3GFMA 4GUAA 2QBYA 3JWGA 4GGGA 5BMZA 2QRVB 3BWMA 3SMQA 2AS0A 3EGEA 3KQYA 2ZWVA 3GFLA 3UZUA 1IRFA 1I5ZA 2O05A 1IN7A 2L02A 5EG5A 4PGHA 3OZTA 4BH9A 1DCTA 3TO6A 5CVEA 2PG4A 1YYVA 4AVPA 2HNKA 1RIOH 4RTMA 4FGZA 1P4WA 3C18A 1ZG3A 1L3IA 4MTDA 2ERCA 5A2QZ 3IC7A 1LEAA 2PMHA 4P96A 3UJCA 4FT4A 5FWDA 4ER0A 3GRVA 4CHUA 3NVMB 2IH2A 2P40A 4RAZA 3KQOA 3KLOA 4RGSA 1JSXA 4PIPA 2HWVA 2V1DA 2PJPA 4U7BA 3V97A 2G70A 2ZSUA 4KFCA 1P39A 3FM3A 3ER8A 4EJWA 3B7PA 3MAGA 2BR4A 1V4RA 3LA7A 3ERCA 3L8DA 4EJVA 3A7EA 3AXTA 4L18B 2A6HF 2OYRA 5LQNA 2NNYA 3EVDA 1R1TA 1L1EA 2VONA 4MIKA 5L3BA 5FB2A 3HCDA 5EPEA 3M6UA 4MQ9F 3EUHA 1HMYA 2N47A 2W84A 3O4FA 1F9NA 4Y17A 1Z05A 3ZPLA 3ELWA 2HMYB 5DX8A 2XV4S 4UV9A 5JFRA 3UWPA 3HVJA 1WZNA 2O06A 3BPVA 2NXJA 3EYIA 2V74B 3R3HA 1ZH5A 5D5VB 1O54A 4RS8A 3HVIA 1ORIA 4A12A 3IKTA 4MNUA 2DI3A 5HDGA 2DPDA 2QQAA 1BC8C 1QBJA 2EFNA 4IHTA 5EMLA 9MHTA 1G6NA 4HTFB 1OPCA 2YTZA 3F4KA 5E1MA 3H3UA 1DUXC 4POOA 3P2EA 2GZWA 3F21A 3HCBA 2VC0A 2XBMA 4M74A 3QAHA 4XLPF 3HA5A 4KW7A 3KP7A 1G8SA 4Q5SF 4PGGA 5IH3A 1SMTA 4V0RA 2A68F 4KICA 4AZVA 2YSRA 3GZ6A 4QDKA 2BGCA 2E1CA 4I2OA 1VP9A 4LG0A 3LL7A 2P6SA 4GOMD 5LEJA 4HW0A 3E5QA 3KFWX 4PYQA 1FYKA 4XRFA 4E2WA 1U2ZA 4OU0A 1F5TA 3BKXA 2F5DA 1ZRCA 2HQNA 5ICCA 4YV0A 1KA8A 2ZJ2A 2CG4A 1FYLA 2G8NA 2ZTHA 2XAGA 2KKOA 4P55A 4GXOA 2RDPA 2MBFA 3IRQA 1R6AA 2QE6A 1SKMA 2V6CA 3COAC 4HA8A 2YXLA 5CUQA 4UUVA 2NS0A 5LHIA 3QP6A 4ER3A 1EQAA 3JWHA 3G7UA 3Q9SA 3Q9VA 4Z2YA 3EVBA 2HTEA 5FHQA 1YF3A 2Z5UA 2B9EA 4OBXA 3QPTA 2Y1WA 1BC7C 1B9MA 4CTJA 3FPEA 1U5TC 5DEQA 2JHAA 2IJLA 5K01A 5A2QK 2P7HA 2EFPA 5E9QA 4OBWA 1K78A 1EIZA 3O31A 3R0JA 2NYUA 1F1ZA 2CFXA 4L9JA 3C6MA 3AJDA 2E5WA 4BQAA 1FLIA 4X61A 1HW1A 4K2EA 5BW4A 3ZMZA 1QYRA 4LB5A 2PT9A 3EPPA 3G2QA 1KU7A 3C1DA 4JBAA 4KIFA 1N2XA 2VXZA 2YX1A 2QY6A 1IN4A 1MGTA 2FRHA 3ELDA 4QVKA 2O61A 1NW8A 4C04A 4MHGA 2WV0A 3HVHA 1XSVA 2JG3A 1IY9A 5D6FA 3K0LA 2HFHA 3RKXA 3CBGA 4IPAA 2IBTA 3CUQC 2L3DA 1BM9A 2NNWB 4ENMA 5K09A 3CGGA 3MEXA 1SQGA 5K0BA 3JAMZ 5D6EA 1VPTA 3ELKA 2BM9A 4LD5A 1YO5C 2OO3A 3MZYA 3LCUA 2QYOA 4EGYA 3FXQA 4WCGA 2D45A 4OIRF 4N9HA 4HRAA 4P7GA 3V7SA 4G7HF 4IF4A 3DV8A 2ZBRA 4CXFA 1QZYA 3J80Z 5K0JA 3RPQA 5LEKA 3EVAA 1FBQA 1MKMA 3HRSA 3M6WA 3IV6A 4RTJA 4ENNA 4F84A 4DCGA 2LSOA 4ON0A 2DPUA 1YTYA 2C7PA 3DUWA 5EZSA 5HDKA 4GEKA 4L7VA 5E1XA 4QPPA 3E97A 1O3QA 1L3LA 3BKWA 2E7XA 2IBSA 2XAJA 2L01A 2GAFA 3WTTC 3A27A 8MHTA 3KQTA 1ZQ9A 3L09A 1HKTA 5DT2A 3DULA 5CIYA 4GQBA 2NYXA 1FPQA 3GRUA 2Z9OA 4C03A 2DBBA 1X1BA 4L5JA 5LLQA 4DMGA 4YV1A 2OQRA 1JHFA 3KQPA 3TO9A 2VBZA 5H6QA 3ZMUA 5LHGA 3U9GA 2G71A 3PFHA 1I1NA 3NVKI 1EV7A 5K03A 1JR4A 2EJRA 1XMKA 1FX7A 5M5BA 3QRFF 3FTEA 4I0AA 3L7WA 3WTVC 1DPUA 4GC5A 4HF1A 4RB2C 1DUSA 2H1RA 2EA2A 3SZPA 3FPHA 4AIKA 5JVTA 4C06A 2ESHA 2M1BA 3LSTA 3R6SA 5HS8A 1KIAA 4P5OA 2ZMEB 2P7IA 4FT8A 4KN4X 3T0YA 1REPC 4MGRA 2P3QA 2XRNA 2G9WA 2QLZA 3T0IA 1W7PA 2IDJA 3M6XA 2FNPA 2YX7A 1TQPA 4CKEA 4RGUA 3OFKA 4EM0B 3T8TA 2DW4A 4R6XA 2LDUA 1S29A 3DTNA 4ZYDA 2H27A 2KW5A 1JGSA 4V0QA 1V39A 1KHHA 3UA4A 3WGGA 2STTA 3S2WA 5ICFA 2VE8A 4YFXF 3LBFA 1ULYA 2CO5A 1QGPA 5GINE 1H0MA 2XYQA 2P4WA 2V9VA 1MZBA 4DQ0A 1D2GA 1BJAA 2K86A 2QWWA 3QOWA 2AVNA 2D2WA 3FYDA 5FTWA 4I09A 2ZXJA 1T0FA 1T6SA 4KDRA 1L3BA 4HGYA 2QZ8A 3TM4A 2ELHA 1NHAA 3T1BA 4F7ZA 4PYNA 4RWZA 5EHIA 3FPGA 4E31A 4U88A 1MJ9A 3FTCA 4WXCA 5JUWA 1X1CA 3RI4A 4NB5A 3P2KA 2CYYA 3LFKA 5DTMA 2PLWA 2L4AA 1ON2A 3F72A 2P5KA 4QWQA 3LHDA 3GEZA 2BM8A 2JHPA 1P91A 5HFJA 1YFHA 1OR7A 4G56A 2HWKA 1LQ1A 1GXQA 3SZTA 3HTXA 4QQKA 4BLVA 1ZKDA 3J80K 2AN3A 2DQRA 3EQLF 4EJOA 4LGWA 4E2ZA 5E8JA 1STZA 1JG4A 1Q0TA 1VIDA 1HW5A 4XSZF 4BHPA 2VODA 3ZMDA 3B73A 4HSGA 2NP7A 3DLIA 3GCZA 4KN7X 1ZGAA 4R6WA 4HDVA 3ZQ7A 1XGOA 2AXLA 3V8VA 2HTJA 3K2ZA 3LWFA 2EJTA 3R6TA 3HEMA 3DXZA 5DSTA 1ZYRF 2HS5A 5E2BA 3GRZA 3C7JA 2I9KA 2OPBA 4P7FA 2XVMA 4KRGA 3G8BA 3HA7A 4YFKF 2ZIEA 5F2NA 2UYOA 3Q87B 1TQMA 4A6DA 1YS7A 3VODA 5DM4A 4OA5A 5EMMA 5DUKA 3E3VA 3HSRA 5LR6A 2O6GE 2NXCA 3FZGA 3HSEA 1PJZA 3GUDA 2A14A 1FP2A 2I7CA 2B0LA 3M1EA 5CCXA 2IGTA 3M8EA 4E32A 1G3SA 3DFGA 2XYVA 3KP6A 2ADMA 2FRXA 2FBKA 2OXTA 4ETSA 1R74A 2A5YB 3X0DA 1MHTA 2BR5A 4RGXA 5FWAA 4R8RA 2DT5A 2RNJA 2OU2A 1YFJA 5LGNA 4R1HA 3HCEA 5E2AA 3OZRA 1D8KA 10MHA 2KIMA 1IW7F 2HEOA 4R8SA 1OYYA 2XAHA 5C9ZA 3LDGA 3LBYA 5H02A 1WQ2A 1BC5A 5EKUA 1MJBA 1XSXA 3G73A 1LB2A 3R9XB 3EVZA 3T5XA 4PWYA 3T8RA 4YG2F 3TMAA 1N7JA 1INLA 5FHRA 4HZFA 4ZZLA 3TOBA 1T39A 2PGXA 5K8VA 1NW6A 1P1CA 1SD6A 3IKVA 1XTPA 3WGHA 1KQ8A 4RV9A 5E9JA 3OU6A 5G02A 3FXRA 3SSOA 1R18A 4IWNA 3ECOA 1KQ9A 3R0QA 2MC3A 1W5TA 2Z33A 4GF5A 4O29A 4YUVA 1GVJA 5CVDA 4EM2A 5LGUA 2OA4A 2ZFUA 5K5OA 1ZLJA 4QQNA 1JQ3A 3G2PA 2OQGA 4G9YA 4X63A 5AIQA 1P6RA 4XUCA 2M45A 3DH0A 3IWFA 1PUEE 1Y0UA 5DD8A 4BLWA 2C7RA 2WC2A 3ZMVA 1OYIA 4PYKA 4PYOA 5KYGA 3MTEA 4LLLA 1MDMA 5FA8A 3AWIA 3ZN0A 3THRA 3TLJA 4AIJA 3CVOA 2H6BA 3M4XA 4G6DA 5EMKA 2PMUA 4EM1A 3M7GA 5BQTA 1X1DA 2IDKA 2MH9A 3TRKA 4EKGA 3E05A 3A26A 2OB1A 4KIBA 1HBXG 1XCVA 1AWCA 3DMHA 1BI1A 4KDPA 4PZJA 2YXEA 2LF8A 2A69F 2DAOA 5E18F 1UB9A 4U0VA 2FHPA 2V1UA 5DCMB 4OIQF 4S04A 3NEUA 2JTVA 2FCAA 1D8JA 3CDHA 2QQ9A 3ERED 3P9IA 4RVGA 2FXAA 2VT3A 3BDDA 4UXNA 4RTPA 2JZYA 1E2XA 4KYWA 1RI3A 3LDUA 1RZ4A 2IP2A 4AWXB 2I6GA 3O6BB 2EFQA 3G2MA 1Z3CA 5D5UB 2D1VA 1I6XA 2JRTA 4Y13A 2ZFWA 4RAYA 4UVCA 1RNLA 4CWAA 1FBUA 2PQ8A 2JH9A 5LQKA 1R5HA 1I4WA 4KT5C 1YUBA 3P7NA 1BI0A 1EJ6A 5LRRA 2PJDA 3EMDA 3FM5A 3BP8A 3HA3A 2BYVE 4HAMA 4O3MA 5BXYA 3LQRA 5EZQA 1VP3A 5CLSA 4P9FA 3M70A 1YS6A 1O7LA 5FO5A 2ZULA 5L3FA 3LAPA 2G7HA 1N7IA 2VOOA 5DCFA 3GWZA 1MJAA 4ZH4F 2L4MA 3TKAA 2K02A 1DP7P 3LX6A 4OIPF 2B25A 2IIPA 1Z6TA 1KPIA 1OKRA 2JSCA 3QV2A 2DULA 4P7KA 1J2XA 4X1OA 1O7FA 3QU3A 5EQJB 3DXXA 2VOPA 4PYIA 5D4RA 4BXUA 1E17A 5DXAA 4Y30A 3HCAA 2JJQA 2EV0A 2OZ6A 4WWCA 3OU2A 3GVAA 1BI3A 1W7PB 2AN4A 3UJ9A 3VC2A 3M6VA 4G7OF 3HVKA 5BS6A 1EG2A 3LGAA 1HW2A 3H2BA 2P8TA 1JQEA 1M6YA 1U2WA 1NV9A 3LA3A 4LFUA 5FD5A 4OX9Y 1XN7A 1YLFA 1FT9A 3WTZA 2WA1A 3BT7A 2FBIA 5LQJA 4JQFA 5E20A 5K0FA 3CUOA 2UYHA 5FGMA 1RUOA 4GOLD 3KZZA 1DL5A 1H9TA 1S7OA 2ESNA 2ZKZA 2IPXA 3GU3A 5DPMA 3BGVA 5ICEA 2VP3A 4WVLA 5DDGA 2BE5F 3GXOA 3FPFA 2UXXA 5P8WA 1J0RA 4E2XA 1IN6A 2J5PA 3M33A 2CWEA 2EK5A 1BHJA 3F8NA 4XCXA 5DSXA 3SQNA 2FK7A 2WWYA 3DP7A 3VSEA 3BZBA 3ANXA 2VS1A 2R3SA 2MLKA 5EHGA 2K27A 3GZ5A 1J9IA 3SM3A 3KP5A 3HUGA 1O3RA 2ISZA 1IXKA 3VYWA 1B6AA 3GFIA 2CKDA 5DM2A 2G72A 1U5TA 1L0OC 4BY9E 3I64A 3KR9A 2H09A 2XKPA 5E9WA 3KR0A 3WODF 4EV0A 2E7WA 1R8XA 5CVRA 5LQCA 2KJCA 1LEBA 3HRUA 4EGZA 1JTFA 2R7FA 3E7PA 2PY6A 2H00A 2W57A 5JI6A 3ML6A 2QVOA 2AOUB 3KPJA 1EH6A 2O0LA 5GIOE 2OZUA 3E6DA 4Y2HA 3AXSA 1PDNC 2RQPA 1EAMA 1FWZA 2IA2A 2GIVA 3MQ2A 1SFXA 3F8FA 3IRRA 3H92A 3QPHA 4A6EA 3WU0A 5GP1A 5T64A 3AY0A 3CUQA 4PCQA 4M38A 4I98B 3CC8A 3MHTA 1B1BA 1IF1A 3G89A 4EJTA 3ME5A 2P5LC 3RIRA 1R7JA 1OYWA 3DXYA 3I0TA 1XJ5A 3GX4X 2P3LA 3TQSA 5K0CA 1BIAA 3GNLA 4ENJA 2ONYA 2ISYA 1R58A 2FBHA 1I1SA 2EFWA 2IPQX 6PAXA 1JSZA 3UJ6A 5BPDA 1D2HA 4C4AA 4LJZF 2EFJA 5LQUA 1SFEA 4B17A 5E8IA 1AOYA 1YQAA 3KEOA 2UXNA 1DDNA 1TLHB 1LJ9A 1EH7A 3SHFA 4DNCA 3LAJA 4FX0A 3VEPA 2VBXA 1G38A 3I4PA 5DXJA 5T67A 4CKBA 1HSTA 2HR3A 3ROUA 2X0LA 5HS9A 5FLXZ 3O7WA 1NW3A 1G3WA 4X60A 5AIPA 4A5NA 2H94A 4AUKA 3OFJA 4IXAA 5DTQA 2K4JA 3HRTA 4UVAA 4M37A 2WTEA 4QVGA 3C3PA 4OQEA 4HH4A 1D2CA 4AZTA 4HF0A 2B2CA 5HLHA 4E30A 3EVCA 2K4MA 2L54A 3SGLA 3K1NA 5GWXA 4WXDA 5DV5A 2PXAA 3B02A 3KQWA 2D1HA 3H3ZA 3GIWA 4FSDA 2Y1XA 2EV6A 4OIOF 4IV8A 1B9NA 1XCLA 1R00A 3DLCA 3TOSA 1WY7A 2QRVA 3QP5A 3TOAA 2W24A 3I5UA 4F86A 4F85A 1WI9A 5DM0A 1BI2A 3PQKA 2NNNA 2EA4A 4OQDA 4BLUA 4IRGA 1S8NA 5L3CA 3FMQA 2COMA 2XASA 5F6FA 1KU9A 1GXPA 1S6LA 1J5YA 1XCBA 2STWA 2XKOA 4D0PA 1PP8F 3V7CA 1SFUA 4GO1A 1NE2A 3E5UA 2W25A 3SXYA 2VDUE 5IT3A 2XVAA 4LMYA 3J7AO 3WTUC 4RSRA 5HOQA 1YZHA 2JH8A 2O0YA 4AX8A 1ZAOA 4LWPA 3GGDA 2C6YA 4M7RA 1MDMB 3D0SA 1Q0SA 4FS8A 1YIOA 3UJ8A 1TTYA 3LCVB 3PX3A 3O3KA 2CQKA 3OPNA 1FOKA 2AVDA 3V8JA 3ELYA 3S68A 2VT2A 5GM2A 2FF4A 4RTLA 1M0EA 3NJRA 3RTRA 4OA8A 2QBYB 2LF7A 1SD7A 1B4AA 4RB0A 1L9KA 3MWMA 2AN5A 5CVUA 4PYMA 2UZKA 4MHTA 5E8GA 2C7OA 3BJ6A 3G5LA 1IXCA 1PRYA 1D5VA 1FSEA 4EVIA 1ZGJA 3KU1A 3EEYA 1QZZA 3P9CA 2QENA 4ZZDA 1HXDA 3GO5A 4YUWA 5K0NA 1T98A 1VBFA 5ERIA 2PWPA 4FHTA 5HIIA 2P3OA 4UVBA 2EJUA 2PFBA 1X1AA 1U6GA 1QNTA 1PP7U 4I01A 2Y0MA 3KLNA 3ISPA 3SR4A 3EGVA 2VC1A 1WS6A 2FPOA 2YVLA 2IA1A 2AOTA 2XIGA 3HYIA 2PKWA 4L0YB 3BJOA 5CJ9A 3LA2A 4HQEA 1FY7A 5BPIA 5E1OA 3BOQA 5F64A 4HTFA 5J6XA 1IN8A 4L9NA 2FU4A 2ZBPA 5D5WB 2ZBKA 2HTSA 2Z99A 3FXUA 3HCFA 5F2OA 3SXJA 2HGCA 1JG1A 5FLXK 1IZ1A 4BHBA 3UA3A 3RYRA 4XUDA 2HKOA 5DD4A 4L9TA 5F1RA 2PXCA 4FZVA 3RKWA 1NBIA 4QTUB 4CKCA 3RPUA 4YMGA 3TKYA 3BWYA 3MCZA 2FMLA 4MQVA 2ZZMA 4RB3C 1KYZA 3QU6A 4IRIA 3V8KA 1HSJA 4PNEA 4HLYA 3W6JB 5HEKA 2LNBA 5E8RA 5HILA 4OOIA 4G6QA 5F2KA 3R4KA 2X4HA 3BUSA 3JTGA 3FTDA 3BZ6A 5EIWA 1G3TA 3WE3A 2VZ9A 2ZVJA 3HNRA 2QUFA 2O57A 3GLXA 3UFBA 5CD1A 4IVNA 1C0WA 5D8LB 2HQRA 3EVFA 1EJ0A 3BPXA 4HG2A 5L3DA 5HIJA 4LLNA 2M8EA 1F3LA 4FT2A 3BWCA 3OE4A 1L3CA 5EC8A 2ZW9A 2P35A 3UJAA 2CGPA 2P7VB 1IAWA 2ZBQA 5DM1A 4LLGF 4CICA 3FUWA 4LG0B 2W85A 3P71T 3OCJA 3TPZA 2GH1A 5K0LA 3IHTA 3PT9A 4PYLA 3RODA 1KR5A 2M5WA 2ZZKA 3GFJA 2IRFG 5DYMA 3DEUA 3I58A 1XGNA 2RV8A 2FYTA 3FHZA 3BWGA 3I59A 3A4TA 3F8BA 5DRYA 2Z6UA 5HDNA 2OB2A 3MQ0A 1R8YA 7MHTA 2Y75A 3P9NA 1W5SA 2FQ3A 3CCFA 4GC9A 1ZREA 1NV8A 2HYGD 1TNTA 4P58A 1JG3A 3I71A 2RN7A 3TO7A 5CVJA 5J8CA 2ZIFA 4R8HA 4CO8A 4GOOD 3FX3A 4RTKA 3BJAA 3GO4A 1UHWA 1IN5A 5IT9Z 2XAQA 4WF2A 3CJQA 4NECA 3HOSA 5DTRA 1ON1A 4DF3A 3KPYA 5KK1A 5EOVA 2DK5A 2KJBA 3F8MA 4G8XA 3R60A 1ZRFA 5JR3A 1HNNA 4E33A 5E1ZB 3G3ZA 1K6OA 4LK1F 5KQRA 1TBXA 4FSXA 5CCBA 2FE3A 2JT1A 3Q5FA 3MTIA 2F5EA 5ERGB 1TQIA 1KU3A 4E70A 4N0BA 3QOPA 4MTLA 1SMYF 3UJBA 1K78B 3BGDA 3KQSA 5MHTA 1ZG1A 3KP4A 4U7PB 5KVAA 1RJGA 2PWYA 1WRJA 2P5VA 3WG9A 3DR5A 4GYIA 4Q4ZF 3RJPA 2UYQA 1SVUA 2O03A 5FFZA 4CTKA 2GXBA 3WTYC 1VL5A 1LDKB 3LPMA 3FUXA 3MFKA 2OKCA 3CTAA 4RVFA 3JSOA 3M8FA 4DCMA 3V4GA 1UFKA 3G88A 5LQAA 4HQMA 1IUYA 4YIFA 1MJFA 1A04A 5K0EA 5E17F 5JHUA 1W4MA 2PX2A 1NW5A 3A7DA 1KYWA 2GAUA 3FMSA 3ABTA 4AZWA 3OV8A 4PCLA 4YIIA 4EQZA 4HC4A 4MEYF 3D5LA 5EEHA 3K1PA 4HX8A 3B89A 1RI4A 4RX1A 1VTNC 1UFMA 4I0BA 1G8AA 3SFZA 2VN2A 5EGSA 2M87A 1YG2A 4RGRA 3ORHA 4HYEA 4XSXF 1VLMA 3JWJA 4YUXA 1QQIA 5D1NA 2AOXA 5K5RA 1TNSA 4Q47A 2HDCA 3ELUA 4P9UA 3LECA 2ONZA 1ODDA 1P1BA 3BGIA 4A5MA 3KQMA 2UYCA 1BBYA 3FTFA 5DUIA 1O3TA 3JW4A 2EB7A 5FCDA 4EKIA 3NW9A 4MQ4A 2HYFA 4ER6A 1TW2A 4ZYHA 1P2FA 4U0YA 1Z6RA 2YU3A 4WK8F 2QM3A 4ESJA 3P8ZA 1USSA 5FFXA 4HDUA 5FUBA 1RI1A 2ZMEA 1SUSA 2PLYA 1F38A 2LKPA 1H9GA 4Y15A 1RI7A 4XBFA 3I54A 1KP9A 3TM5A 4KNYA 5FULA 1CF7A 4G94A 2PN6A 4M6YA 3SSNA 2F5CA 3JTHA 3TDUC 3VB2A 3C0KA 3T7RA 1G6Q1 3EVGA 2G1PA 1JXSA 5BP7A 2HR1A 3IHUA 1XDSA 4HV5A 1SD4A 3KPUA 5HIMA 5ILVA 4RTNA 1J59A 3FPJA 3HSFA 2XGXA 3CJTA 3KE2A 3G8AA 1BIBA 4ENKA 3C3WA 2AOVA 5BOXA 2JHCA 3C3YA 3LKDA 1X19A 3KEQA 2PVCA 2K4BA 4B8XA 2QQBA 5CYVA 2VBWA 4ESBA 4C07A 2KIUA 2AS5F 2P1DA 2VDWA 5IT9K 1WWXA 1R1VA 1WXWA 3F8CA 5KS2A 3BY6A 2MA3A 2DO7A 3EGIA 3BROA 4C05A 3ZMSA 2O8XA 3V7RA 4P7JA 3ECHA 2GS9A 3OU7A 2IH4A 3UBTA 2H11A 1BN5A 2CW0F 1JTEA 4FR0A 4UOEA 4U7DA 5IKMA 2EFOA 5GIPE 3LQQA 1I27A 5LGTA 1WSUA 3T7TA 3RYPA 1YB2A 4O5VA 4DA4A 3DOUA 4RTQA 2NP6A 4MTEA 4ISCA 3PFIA 2PBFA 5KQSA 1TW3A 3NMUF 5E1BA 2Q2EA 2IH5A 4YV2A 3ABUA 2AOTB 2G7UA 3ULQB 1KU2A 3WGIA 2KRFA 1RI2A 3TQNA 2CWWA 3TR6A 2ZWAA 5H6RA 3LCCA 3O2PE 2HZTA 4A2UA 4RTOA 1HQCA 3N4MA 3KR2A 2XVCA 4EK9A 4KDCA 4PCAA 2VE9A 3JWIA 1FJXA 1SG9A 3EVEA 2ZLBA 2ZNYA 3CLOA 3E6BA 3QOXA 2FK8A 2F5FA 4KIGA 4LK0F 3MCTA 3B5IA 1S3JA 4NHJA 3E5XA 3VFZA 2VBYA 2GPYA 3B3GA 1UCRA 4PYJA 4A0XA 2EX4A 2PX5A 4M72A 4CXMA 1JG2A 1SD5A 5TJJA 3HOTA 4BNCA 1VQ1A 3ER9A 4LG1A 1ORHA 1S7AA 5AONA 2A61A 2PEXA 3REOA 5GM1A 2NAZA 4CDGA 4LECA 3WTXC 2ZNZA 1G60A 2DK8A 1WG8A 4M9ZA 2DTRA 4ZYGA 4ZTBA 4RVDA 1R36A 4KMFA 2KIFA 5E1DA 2O3FA 2PV0A 4BP1A 3U1DA 2ZO4A 1ONVA 2MD5A 3FUUA 5DLYA 1RI5A 3M9AA 2GXGA 3MB5A 4IKPA 1KPGA 4B09A 4KUMA 5D8KB 3F6VA 2BV6A 2PX8A 3E23A 2CL5A 3PLAE 4M9XA 1FBNA 2VDVE 3K0BA 3GRYA 3DF8A 4WX9A 1QAQA 3P2IA 4HV6A 4L9VA 5BW5A 3B3FA 5EVJA 3K69A 2GA1A 2IFTA 2BEOA 3GRRA 1YZ3A 1OMIA 1XGSA 3IWZA 4ER7A 3I59B 3PQJA 4DZRA 4KVZA 1I1GA 1Z7UA 4RTRA 3HHGA 4EJUA 5FADA 4A0ZA 5HVQC 1O9GA 5EEGA 3RKYA 4BAYA 2CMGA 2FOKA 4JXJA 4XLNF 4GYGA 3R0AA 4BHCA 5HOOA 3KPWA 1YFLA 3NDIA 2ETHA 3WE2A 2IA0A 3PB3A 3GW2A 3EMBA 4QDJA 3SX0A 4AIHA 4DKJA 4FX4A 1NT2A 3GJYA 2NRAC 3MAJA 4HX7A 2DPMA 4HLXA 3A25A 5CM2Z 3WTSC 2Z6QA 3FZVA 4I7HA 2B3TA 1MD0A 5D1HA 5LSAA 1R22A 1J75A 5T6BA 2A6EF 2PXXA 1D3YA 1IXRC 4HGZA 5ED4A 3BWBA 2RC4A 4M6XA 5FQNA 3KR1A 3HRMA 5LHHA 1FYMA 5C1IA 3SVZA 5K1YA 1AQIA 4UNOA 2HKXA 4M71A 3FF5A 4RB1A 3KQVA 5ILSA 4QPNA 1AF7A 2BZGA 3CKKA 1O3SA 2H6CA 4X41A 3WSTA 2P7CB 4TV7A 4S05A 2PT6A 1IM8A 1SQFA 1F4KA 2P41A 1P4AA 1IXSB 2EV5A 3FWEA 5KVRA 4ESFA 2YQZA 1H1DA 3L2CA 2AZTA 4UHTA 3KP3A 2IVMA 5CVVA 3IL2A 3EETA 1LVAA 4M9SA 3NDJA 3PVCA 1R23A 2K7LA 1G55A 3PFGA 2GQQA 5TRDA 4YFNF 5DCMA 1Y8CA 2B78A 5HZMA 3MGGA 4KMUX 2ORED 3F22A 3HTUA 2OBPA 2FMYA 2GA2A 2BH2A 3IYLW 1XXLA 1HKQA 2IW5A 3CO6C 3IEIA 2MH2A 1BOAA 3MZHA 1ZN2A 1QPMA 2ZCWA 3KETA 2YR2A 3L9FA 2EG5A 2MLGA 4IRHA 4OMZA 5B1SA 5HLGA 3FRHA 1YW9A 3F6OA 3JSPA 1FSHA 3F3XA 3OE5A 3R61A 3K6RA 5U4XA 2OY0A 2WK1A 4MEXF 1R1UA 1RJDA 1AQJA 1NBHA 4XUEA 1XDZA 5HIKA 3DPLC 2YXDA 3D2LA 1JHHA 5LBQA 2CSOA 4Q48A 4OINF 3P9KA 2ZCJA 3KHKA 3J81Z 1XGMA 5K05A 2DFIA 4GBED 4M36A 3RIEA 5ILUA 5L3GA 2XHKA 1V3FA 4PINA 5DWQA 3F23A 3DKWA 1JE8A 4OMYA 2NXEA 5K5QA 2DLLA 1QAOA 5DX0A 2FSWA 3FMRA 3L00A 3HM2A 2C7QA 4N9IA 5D4SA 2Z3YA 4HX4A 1U8RA 1RJEA 1O9HA 3HCCA
chains in the Genus database with same CATH superfamily
1C7ZA 3TDZC 5A1JA 2P6UA 2R5ZB 1D4OA 5T3YA 3PL8A 4RK6A 2Q8KA 4N49A 1VQNI 3JZFA 2VZEA 3FDYA 4DQUA 2R8OA 3KQKA 1IVSA 1QPIA 5CDSA 1OIWA 3CZRA 4EHLA 4QHTA 4MUFA 4U0WA 1SC9A 3OQJA 4BGVA 2OD9A 1YRQA 3ZNNA 3KU4A 3LZCA 5FA5A 2Q6VA 4LTDA 3KTDA 4A8HA 3L0PA 1XSDA 2KP6A 1HNZB 4G0WA 1FPMA 3A9CA 5THKA 4QWWA 2YN2A 5AT1A 2X48A 1F8YA 1TLFA 3ASZA 2IZ5A 1UZCA 4F56A 4ZMRA 1VQKI 4DTIA 1GHTA 2WZDA 1TPYA 3RS2A 3I1JA 2AOUA 1J0XO 5GOZA 4O4HA 3DGFC 3Q0IA 3NHMA 1CSEE 4TV8A 1ZD5A 2CLOB 1VLVA 1YIDA 3AL2A 4YIKA 2ZIWB 2Y05A 4IJQA 4RF5A 1DO0A 1F4VA 1Z9CA 2MT9A 5A7GA 3CE6A 3HCWA 4DEVA 4YUYA 2PKRA 3J81K 4BNWA 1G63A 5KQPA 4V2IA 3I6BA 4IUBS 2VRNA 3V8LA 1UXHA 3OCUA 3NQOA 2RVCA 1ZOPA 1VE9A 2GA9A 4UPDA 7MDHA 4LWOA 3H9EO 4AD9A 2G9UA 1SA0B 1WKMA 3QW2A 4HOBA 4L75A 4K8OA 4EKYA 2EIXA 1P7IA 4KITB 1CU1A 1SAYA 3CUWA 4TTIA 2ACJA 2D7CA 4TRRA 2W9XA 3V4ZA 3ZMTA 2FZCA 3K5WA 1KEZA 4B3HA 2VKVA 4I1UA 1IRGA 5JSZB 1JU3A 1QANA 4DR1B 2IUSA 5L3ZA 4XICA 3GTQJ 2ODQA 2IV3A 2HXSA 4MRSA 3STVA 2ZRJA 1W85B 1G2OA 1CWUA 1LCIA 3W3ZB 2GOYA 2AQ8A 4KLAA 5HKKA 2XHEA 2J6IA 4E6KG 3MFQA 1H2WA 1L5FA 3DU5A 3RDIA 2YY7A 5KPJA 4H0NA 2J0SA 2FEOA 1IFXA 2HTFA 1RYDA 4Z4CA 1EM8A 1M6HA 9GPBA 2WSYB 3BWMA 3I8XA 2ZB4A 5E4TA 2QOEA 3RS0A 2HA0A 4Z7OB 4XKVA 4MPPA 3TW0A 2O05A 1ONBA 3CX8A 1OX4A 2R8BA 3OO1A 5ELXA 3PIRA 3DAHA 4N5MA 1L8LA 3BVPA 5JSKA 3VWBA 4P96A 4RD4A 2D1FA 4FT4A 3R5XA 3RAJA 1DNPA 5J2UF 5D01A 1TZCA 4QEZA 3S2DJ 5GGXA 3PC6A 3TD2A 3ER8A 3E9QA 1MC4A 2G9VA 4R16A 3F47A 3I8OA 1QXSA 5CXUA 3CS3A 4UUSA 4HBZA 2YCBA 4B6RA 3EUHA 1A9XB 1HMYA 4D4IA 4IXTA 5AQ1A 3TGWA 1E2PA 4JLOA 4AN4A 2Y27A 1K6MA 3AH8A 3WL7A 3EYIA 1DEAA 2O0KA 3SBEA 1MQSA 1OBHA 4RS8A 3HVIA 2VTVA 2DA1A 3Q3GE 3RRNA 4QJ5A 4B84A 3IBYA 1I3CA 4URVR 3A0BC 4C78A 4DIDA 2YNMC 3C16C 3P2EA 3P0JA 2NV2B 4JGBA 4KW7A 3NANA 4R1TA 4OG2A 3EIHA 3PF9A 4PGGA 1AZSC 4V0RA 4KICA 4B83A 1A9OA 4MKZA 4G4IA 4Z1MD 3N2GB 5CYGA 2P6SA 1UXJA 1NX9A 1E2DA 2I80A 1NG7A 1G7CA 1U2ZA 5EJ2A 2W0SA 1U6KA 4LY9A 3AIOA 4PWZA 1MV8A 5JXGA 5BN1A 4XRGA 4NAUA 5H3CA 4NFLA 5E4FA 2OCLA 5D3MA 5IAEA 3PHGA 1RQXA 5DNDA 2J3QA 3NTLA 2F4OB 4QXOA 3A4MA 4CEJB 5LB4A 3QP6A 2ALJA 1SU6A 2PYZA 4R2JA 3TSCA 2FAXA 1MJ5A 2GEVA 5B7NA 2JHAA 2WB2A 4CMAA 5CBPA 5A2QK 3LGXA 3VX4A 1IHPA 1FNMA 4HDKA 4YCDA 2E5WA 1YRLA 4HNRA 5CT4A 1ETVA 4JBAA 3AC0A 2HA3A 4MQEB 4XWYA 4C04A 1WHTB 4BNIA 3MCUA 2HLHA 2OHVA 1JFFA 1OW3B 2EILH 3W79A 2FW8A 3LIPA 3SCZA 5K09A 3UNGC 3VZQA 1S2OA 4DPLA 2OHJA 3ELKA 1SBHA 1VLJA 3MZYA 1TK3A 4DGWB 1TEHA 4EATA 1AUPA 4IOMA 4AYTA 3I01A 4RNCA 3U44B 1NQTA 4WPGA 3ZQQA 1OC2A 2GJKA 4RH3A 2DPUA 4ODIA 2F3RA 5IG2A 4BNHA 4JT2A 1YGPA 4L7VA 1QUFA 2YZGA 4K3UA 1CR1A 1LFDB 3BIWA 4HLNA 3UXHA 4AZ0A 5E6SB 3R2JA 3VU8A 2BRUA 2GK3A 1OROA 1DI0A 4N4AA 4C03A 3I8SA 5LLQA 1OLUB 1B8IB 3ZPXA 5CDFE 1QGUA 4LN1A 3JQGA 4Z7JA 4C1NA 4FW8A 4YXWD 3GTPJ 3OPQA 1YRAA 2KB0A 3B60A 1MA3A 1HX7A 3FTEA 2PUHA 4QIHA 3HJHA 3FPHA 1VJRA 2YJ4A 5H82A 1UOOA 5HS8A 2FPGB 3D2BA 3JV7A 2YINC 4IMIB 2JBWA 1I0IA 3CZ6A 4JWTA 1NJ6A 3DW3X 3HB4X 5KAIC 4MGRA 1LE8A 2QLZA 1W7PA 5AKEA 3IQGX 4MR9B 4B3CA 4BLQA 1HA3A 4JLNA 2YRFA 4V0QA 1SM4A 3MMXA 2IWHA 2NSLA 1Z0XA 2P2GA 2ZB2A 4WK4B 5TQVA 3OP4A 4EJMA 1R6BX 4UARA 2K86A 1KY4A 4JVSB 2EATA 2LTPA 3AVPA 4FFOA 4TYPA 4OJKA 2EQAA 1XPRA 2WIBA 2N0SA 4XUGB 3LUJA 1DVRA 2PLWA 3M07A 2Q5HA 1MG5A 2IY9A 3DDHA 1UAYA 3VV2A 3QXHA 3HJUA 3T34A 1YJ8A 2HYIC 3HTXA 2QI9F 4PPGA 3KXDA 3X44A 4GFDA 4ZRNA 2QJRA 5LD2B 2X42A 4B2PA 4L6IA 1PZHA 3DLIA 4HDVA 2AXLA 4GPAA 3OQIB 4FJ0A 3WLEA 3QBTA 1P44A 5K6AA 4HFNA 3JTEA 1DXQA 3IBGA 2DTEA 3GRZA 5LLTA 4KRGA 3O8LA 4ZOEA 5HR5A 4LZPA 3C15C 3QEKA 3HR7A 3GEIA 3SEZA 3D2CA 4E32A 2GTHA 3WYNA 1WJFA 4NDZA 4U39A 4B43A 5JDCA 4Y3OA 3ZYZA 4AROA 5HDBB 1V95A 2C04A 3CDLA 1T15A 2XAHA 1LF5A 2BEJA 3A3NA 4EGQA 2Q0SA 4EFMA 2OCIA 3IUJA 3O4IA 1T39A 5J43A 2A84A 3GHHA 2HX1A 5EG0B 4GMXA 4EA8A 4LHYA 4JQZA 3QE2A 3BREA 1W5CC 3ECOA 3T3PB 2A58A 5J63A 5CVDA 1C4WA 4D8XA 4PHTA 4NJMA 4LK2A 3RTAA 2ZC2A 2PL3A 3OWHA 2PKYX 4IR7A 3EQ8A 4G9YA 2BHSA 1PZGA 2L18A 4D6PA 1GDHA 4MWGA 1JVSA 3QG1A 4ND6A 4DMFA 5KYGA 1EDDA 1E1MA 3RSLA 1CQIB 1ACLA 2H6BA 3HGMA 3FSGD 2AKEA 2CXTA 1Z67A 2FWMX 1LTKA 1U2SA 2CUEA 1V25A 4G67A 2FCAA 3OJWA 2IYLD 3L3BA 4XLAA 2D1VA 1Z47A 5FPSA 4DHWA 4UVCA 1U2PA 1FW8A 1UKEA 1R5HA 5DBOA 5JNUA 2PT5A 4OI1A 1ESZA 3EMDA 2BYVE 1YR1A 1D9ZA 1RE0A 1GPWB 2BCGY 2H8GA 3CLUD 5G3ZA 1EVJA 1Z5NA 3AFOA 3LTEA 3PXAA 1W0KD 1KI6B 4YEDA 1PTJA 2Z2IA 3ASVA 1RHJA 3T6KA 4BQOA 1HE1C 4TXLA 1ZZGA 4J7XA 5JH7B 1ECFA 1RYZA 4AECA 3M6VA 3HVKA 3PGXA 3B38A 4ND1A 5EJ9A 3LA3A 5KYTA 1RRGA 3PEFA 4OX9Y 1DT5A 1YLFA 3IA2A 2J6HA 2VHZA 4F1WA 4LG3A 4OQ4A 1M2VA 1FLDA 4I36A 5L6MB 4ZHQF 4B45A 1N2EA 4I99A 4F1JA 1WRBA 3IIIA 3IXQA 1J0RA 1UC4B 1B3BA 3PJRA 1A8HA 3S8PA 4Q16A 1XT6A 4KE6A 1EVLA 4BDYA 1V3QE 2UUPA 2C42A 2GPBA 1IXKA 3W8FA 4N47A 2G9ZA 4BY9E 5SYNA 4KVGA 2Z16A 2FW9A 4DC9A 3L1VA 1XQXA 2PY6A 5JI6A 3DZDA 1CR6A 3AY6A 2DFKB 1OX5A 3MM4A 1REQB 5L3SB 5FL7D 1PDNC 3OF2A 4NABA 3KAJA 2VTBB 4HEQA 1KEVA 2FWIA 1JR3E 4A6EA 4C3ZA 2J67A 4A3LJ 3BRQA 4FDMA 1FQOA 2GAJA 1OYWA 1YI1A 3KYCA 1VA4A 1U0RA 2QTVB 3H9GA 1OXUA 2OAP1 2EDAA 5E8IA 1KEPA 3R77A 2EZUA 1Y9AA 1D2AA 3IEMA 1FFBA 3ET5A 3RUFA 3F2VA 1XMOB 5BSMA 5T67A 2ZB3A 4R5HA 5BWCA 4JROA 1TUBA 2EQRA 4C4TA 1R88A 4KE8A 5DTQA 4H1HA 4M37A 2P78A 3C3PA 1QCCA 3KKNA 3CXUA 2B2CA 1CEQA 3PA8A 3TPCA 3HRKA 1ST2A 2AIRA 3ITKA 3WDKA 3EZ6A 2KX7A 3R3ZA 1PGOA 3KHUA 4TKMA 3NALA 2Y1XA 4MS1A 4E5SA 1XEXB 4FEYA 4EG3A 1O08A 3TOVA 1J42A 4BKRA 5BUQA 2MABA 4KUGA 2OAGA 4OQXA 1Y9EA 1TKBA 3TOAA 3Q3CA 5ALSA 2FZ5A 3I45A 2D5BA 4HLUC 3HVRA 1S8NA 2IGMA 2XCRB 5F6FA 1PK8A 3BAZA 4XWKA 2UUBB 1MW9X 2XMPA 1L1RA 4JEUA 2CD7A 2CFRA 5FUMA 4LWPA 4XMYA 2JA5J 3UJ8A 1DIHA 3UUGA 5H1YA 4EHAA 1Q3TA 1GY8A 2GCEA 2IU0A 4LJ8A 4BBRJ 2JAXA 3L7CA 3WL8A 2X6WA 4Q9AA 2C7OA 3AKEA 2VJLA 1R16A 3KVNA 2ZOSA 2R8RA 1YK0A 2FFQA 4ICIA 4RW0A 3ZY5A 3GOHA 2R87A 2PWPA 1WJAA 4FK8A 1NATA 3Q5GA 4UVBA 3BHNA 3TSAA 4IIBA 4I2VA 5T7BA 3ISPA 4L9WA 1E2NA 2W8BB 4TLEA 1RRVA 4XR4A 2OCKA 4WN9A 5L53A 3H5LA 3CVUA 1G8HA 4OH1A 2VNKA 3WRXC 5B1YA 3FXUA 4DANA 3SXJA 4ENUA 5FLXK 2XYPA 3TLGA 3H65A 3QFTA 2O2YA 1JI0A 2ZI3A 3IBTA 1NBIA 4CKCA 1Y7LA 3DVRX 5GV8A 4MQVA 3BR2A 3MWJA 3FYSA 4MWBA 4HLYA 5HEKA 2CNKA 1AKHA 2A59A 2WOOA 1OH8A 2C4VA 1KWGA 3AJRA 2QUFA 2V4JC 5LXTB 2F43B 3UWKA 5F98A 2I33A 1YU9A 4NP6A 4GXTA 2QVYX 3WA6A 3ZWBA 2WB1N 1J00A 1POWA 2I6SA 4I1YA 1OREA 2PCLA 2M4KA 4I3GA 1N1DA 5FJIA 4G84A 3OCJA 3M6MD 3SLKA 1ODJA 3TF5A 3DEUA 4QEKA 1G98A 1AVTA 1SBIA 5JOQA 3BWGA 3ODPA 5FNVB 4CDNA 4C3JJ 4UDYX 5DM6F 1W5SA 3CCFA 5JAUA 1WOYA 3GLIE 3ZQUA 4EG4A 2MFZA 1GKLA 4UVDA 5A5EA 4LXTA 4LUCA 1RLTA 4YMLA 4DF3A 4XX0B 1GJRA 4CG0A 3IP9A 3OMWA 3I2HA 1HDXA 5AKYA 4GE0A 1KU3A 3QOPA 5FLKA 3TOCA 3KP4A 3DLTA 1V43A 3G5AA 3WG9A 4FN5A 3CKMA 2OV4A 1T0BA 3G9ZA 4U63A 4D9EA 1DXYA 1M8KA 3LYLA 3FUXA 3DTKA 3JSOA 4ECEA 4Z4GA 5FTJA 1OASA 1J90A 2PX2A 3WL5A 3F5QA 3A7DA 2P69A 5CLLA 1P9NA 1COZA 2GOMA 1E6MA 3IBCA 3B89A 4QPCA 1E9AA 1YULA 1YB6A 4R83A 1K8RA 5ALWA 2PUBA 2EJVA 2L0KA 2FPIB 4UE3S 5K5RA 4M6WA 5F1KA 4EG1A 1G3MA 5KTSA 5BYKA 1Q3KA 2I66A 3EZ2A 2COKA 3ZQFA 2A9RA 2PNJA 1ZH2A 2FP4B 4ESJA 1USSA 4HDUA 3ZWOA 1MAAA 3I54A 4QFCA 2XNCA 4QSHA 4JBGA 4F52A 1GRRA 3D43A 3LXUX 4N0PA 4ZT4A 1M6VA 3LWZA 4JUAA 3GUUA 2M3AA 1U0TA 2ZQZA 2ID9A 1J59A 1HE4A 3GEDA 4KODA 1PFQA 3KE2A 4XWWA 4C7OA 3RWOA 1ZRHA 5BOXA 3V00A 4YQYA 4GQAA 2C9CA 2EP8A 2CK3A 4C07A 1ZNWA 5F23A 4KLZA 2P1DA 2BFNA 3BK7A 1XC5A 3BY6A 2XAUA 2OOSA 4C05A 1X0VA 3VR2D 3AR7A 1X9GA 4NNOA 2WIKA 4F6RA 4YT8A 4YAFA 4CKEB 4G5RA 2EOAA 4L0MA 2WD7A 3B2QA 3NFYA 5LGTA 1WDKA 3RYPA 1GUBA 2CFIA 1N7HA 4PRLA 1V1RA 2VZLA 2Q2EA 1SKYE 1BFKA 4RGVA 3MCVA 3I61A 1IBLB 3REGA 4I1OA 3TXXA 1XNQB 3N4MA 3V8PA 4U7FA 4N48A 1DBSA 5K9ZA 1NXXA 2VRBA 2EHJA 1WMDA 4BTVA 1LJUA 1VKHA 1JYFA 1H6BA 2KISA 1M2WA 1F9AA 2AZMA 2D0PB 1IZYA 4ERXA 3ASUA 2RHBA 2NAZA 4U02A 1MENA 4GLJA 2JKYA 2K9SA 4IIJF 4YCAA 4AUEA 4UMDA 1E9SA 3H5WA 3URKA 1YTLA 1U7TA 3V4PB 2IHJA 3AR4A 3NHLA 4M1WA 1ACIA 3FG9A 4ZEVA 2IYXA 1W1UA 3K0BA 4YCLA 1ZH0A 2VRWA 3KHSA 3K69A 5LA6F 2UVPA 2WPDA 4GQIA 1OMIA 1N77A 4NJOA 3K8OE 1BXRB 2XCSB 2CJFA 4IMRA 1R5ID 3CEJA 3WE2A 1WEHA 3SX0A 1C29B 1TUIA 4FJ1A 3D5TA 1IEWA 1FVFA 2K87A 3TMYA 4OFZA 2Q46A 3TD9A 5J58A 1FMVA 4A36A 1FYMA 4UDXX 1UPFA 1V9LA 2PJUA 4M71A 1US8B 4Z8XA 1MB4A 3K1AA 4MV3A 2NAPA 1E60A 3F98A 3NH6A 4BASA 1OUMA 2VXYA 2TMDA 2IXGA 4H3SA 2HCFA 3G5MA 4AKGA 2FWPA 1Y4UA 1OC4A 3UKJA 2B4RO 2LR8A 3CPEA 3PCXA 3BQNB 5G4KB 1ZD8A 1TTTA 1VE1A 2GQQA 4L9RA 3I2GA 5LBTA 4F96A 1ODFA 1OHHD 3IEIA 4ZRDA 1X4PA 4OYHA 4KZPA 2X0KA 2BFDA 1KS2A 4GGOA 1PLKA 1LBTA 1KSGA 4UUPA 4KQMA 4C0WA 1HDRA 1XGMA 3SNHA 5FI1B 4M36A 2AMYA 3ND7A 2Q7OE 2FJUA 3A4NA 3H11A 4QOIA 3L00A 4WMLA 2BMFA 4F21A 3OQOA 4HVAA 1RUNA 3GBGA 1E1NA 1K79A 1UAAA 4UTVA 2LCQA 3UAOA 4DDVA 1FP7A 3AAFA 1E0JA 2YKGA 1ULTA 2Z6AA 3IALA 2N46A 3KKQA 4G1EB 3GPLA 4N9QA 1Z88A 4LF7B 4B2LA 5IK2A 2OZKA 3I9FA 2RK4A 3H86A 1VI0A 4BFVA 4HD8A 4HH1A 1RMYA 5JZVA 1BCSA 1C4OA 4TTJA 5FIUA 2XUFA 4NVRA 1IK4A 1DP4A 5ARCA 1P2GA 2QTFA 3EYYA 5AH0A 4B5KA 3WQRA 1FDSA 2XDQB 3LFTA 2XUIA 2EX0A 5DSZA 2P68A 3AHHA 1QYCA 1J07A 2BBOA 2Z9BA 4MV7A 2D1YA 3E9MA 1XB4A 3UK2A 4FGWA 4EB0A 1IJBA 2QZPA 1Z5OA 3EWNA 1KGSA 4XOTA 1D6MA 3OOPA 3ZLUA 3BJMA 3AY3A 4FI3C 5AKLA 3H83A 1W30A 4WKCA 1ISJA 3LLCA 1CBUA 4IZHA 4XEUA 4GZMA 3HHHA 1ZLKA 4D80A 3WLOA 1DKQA 1J56A 3CUQB 1P61B 1FBSA 1ZHHA 1P4XA 1BNCA 4O8CA 2B3DA 3KBOA 1T5HX 2ZRPA 1NF8A 4E5MA 5CVIA 1Z29A 4NU5A 1LB1B 2J6BA 4G09A 4ZCSA 5T3UA 5FTMA 1N5DA 3IAEA 3MBIA 4YP7A 3EG5A 2C57A 2JK0A 4L0QA 3C6KA 5F51A 2F9MA 4P0TA 2D0OB 1X92A 2HOAA 5ECGC 1K06A 1UIRA 3IQXA 3ZWNA 2C7VA 1XJ0A 2J9GA 2NSDA 1CZOA 1ZARA 2MW8A 3PCTA 5LPNA 3JYHA 1ZW1A 2F2EA 4YRZA 1O5OA 1VGRA 3N2KB 4MAAA 2AS0A 2QP3A 3AG3H 5F4BA 4A92A 4RD1A 5JWHA 3IP3A 3AT1A 2IXBA 1TT7A 1J09A 3ZKWB 4PZYA 1WGXA 4E13A 4YLEA 5CVEA 1XAIA 3LCJA 2A1UB 2JJYA 1Y6IA 3NEAA 3OQNA 3G1WA 2W58A 3GRVA 4MGYR 3CBQA 3OQBA 1NMXA 5EUBA 2FRDA 2P9FA 4EJWA 4FISA 4B87A 2BR4A 3N59A 3TYXA 4IDDA 3ERCA 3JRWA 3QELA 4EJVA 1KVRA 1TTQB 2FU5C 3GVPA 4ZDJA 1E2EA 2OYRA 2Z2XA 3VYRB 1ID8A 1R1TA 5DW0A 5FB2A 3RTEA 3DE6X 1Q91A 4RFSA 3T5GA 3UFXA 4MKFA 3OIOA 4ND7A 1XVTA 4DV3B 1LI4A 1BYIA 3AGPA 4QEDA 5JS1A 3ICCA 3X1DA 3DO6A 1KMHB 1C9KA 3WLJA 2PUCA 3G5UA 2HI0A 5E6UB 2XITA 1FLAA 3K4NA 2LMDA 3O8QA 3KIOA 3F21A 2W6JD 3OLVA 3RKSA 1G8SA 3TB6A 2PFKA 1Z0KA 3OAAD 2XWSA 2QLBA 2WJYA 4BGUA 4MRRA 2CV0A 4R31A 3HGGA 4I2OA 4QUEA 3M1LA 1D1BA 2YMMA 5C80A 1YZGA 4RA9A 2HQNA 1K6IA 3ZU6A 5B3SH 4TV9B 3P7MA 4KO1S 4IYRA 5HBGA 5L9AA 1IG7A 1R6AA 2QE6A 3DBVO 3K3PA 1G5FA 3COAC 1V4VA 2ZJBA 2G28A 4AF7A 2CYCA 4DC0A 4Z2YA 2YDYA 1KWKA 1FVOA 4N8SA 1EX1A 3SQLA 2YBDA 3I32A 2PSJA 2Y1WA 5KNDH 2ID7A 4XONA 1YRWA 3GLRA 3CMYA 2IJLA 2QSUA 1BVRA 3DW1X 2NYUA 4HEJA 3PUIA 1JQLB 4DOMA 1QRAA 4KIJA 4INAA 3OL4A 3RROA 3E0XA 2QY6A 3NEYA 3W1EA 5GV7A 3ET4A 1Z7WA 4I1RA 4IPAA 2GRAA 4JGGA 4TN1A 2F9LA 1RTTA 1YA4A 2L7KA 3QVKA 1T36A 1YJQA 3W77A 2RBKA 5FJJA 4PU0A 2BM9A 1YO5C 1WO8A 5CITA 4Q7JB 5J4YA 4L27A 2RGGA 5IMSA 1XZDA 4B8WA 5EUMA 4G0OA 3RPQA 1GGKA 3QWIA 1OPXA 1L5RA 4QECA 2UDPA 1NT4A 4LSMA 2F5VA 4OSPA 2W4QA 3VO1A 3QI2A 4AJEA 1G19A 2R7VA 2CLLB 4UUQA 4UXIA 5DT2A 2C9MA 3OCZA 3QU9A 1X1BA 2HLDA 5I8WA 5JI3E 3EVNA 4MI3A 4RXUA 2XOKA 5EGOB 3ZMUA 3LY9A 2WV7A 5KOYA 8AT1A 3GEMA 4YUAA 1I1NA 3MWEB 2TSYB 3AOEA 4JQCA 1XMKA 3Q4GA 4BAZA 3OQPA 5M5BA 2VP9A 2ELKA 5ALXA 1I7DA 1CF4A 2EA2A 4AWBA 2BGMA 2PSDA 1UODA 1OV4A 4RHXA 4TS4A 1KIAA 4NMWA 5BSWA 1SVNA 4L5AA 4KN4X 1A5TA 1JT6A 2OF7A 4TMZA 5B4UA 1Y4AE 3D3WB 4IIVA 2ZIZA 3OS0A 4TGLA 2FMFA 5I48A 3DTNA 3AQIA 4I50B 2AD1A 4HZUB 4HH3C 3UA4A 3WGGA 2VE8A 4YFXF 4NC8A 5L4SA 2CO5A 4RCYA 3TMOA 1Y4DE 4I09A 1S3GA 4YCMA 1G291 2ZJ5A 4KFSA 4UREA 1JH9A 5HVNA 4RS4A 5JHGB 4JSTA 1UL1X 1RTKA 3FFXA 2E6UX 5KYNA 1O6GA 4CU5A 3EFOB 4W1QA 4ZT3A 4PCUA 1OI4A 4DCNA 3IPCA 3GAFA 1J9GA 4BLPA 4C3OB 2ECOA 2Y0SA 4KPUA 2EV9A 1VIVA 5AIBA 3R1IA 4GP6A 3V4OA 2QPLA 3QFSA 3B73A 2R93J 2CXQA 2HTJA 3LWFA 1ZM3A 4B7UA 5ITVA 3USZA 3DEEA 2XMCA 4EGJA 9ABPA 1ZYRF 4NAHA 1JNXX 1VKNA 1UKAA 3VR4A 2C4MA 3FXLA 4D26A 2H2HA 1W36D 2HKIA 1H9AA 2HU7A 3FD8A 3NJ4A 3SDBA 4PN7A 2I7CA 3TL3A 3H9JA 1UIMA 5EXXA 3M8EA 2FRXA 2JIZA 5HUJA 5EZYA 5E2IA 4X94A 2OP0A 2JCYA 2E34A 4XIFA 5JMOA 1N1MA 1BYUA 2E2JJ 5H2FC 3WYDA 1SXHA 3B1KA 1DTWB 1MRZA 3VKWA 3LDGA 3ETCA 3G73A 3WYGA 4QGGA 3OPYI 3WMWA 1YS4A 2XB5A 3GELA 4L22A 5CB4B 4RAGA 2LZ0A 2VDPB 1WSDA 3PIOF 1GNTA 2HSWA 1R18A 3HR8A 1TUEA 2CLHB 3WHCA 4GF5A 5IAOA 4QBKA 4GICA 4PGFA 1NBEA 1MBJA 3OPMA 2KDZA 1CUUA 4DE5A 4EHDA 1OI7A 3RVNA 2QEXI 3MMSA 2EKDA 2R00A 4WVFA 1EX7A 2AJBA 2M45A 5CFNA 2YH2A 3NP7A 3JD4A 4F38A 3ZI0A 1OYIA 3BXGA 1MEEA 2QEQA 4GWKA 4I9UA 1UQUA 5ESWA 2CCGA 4B7XA 4MGKR 2HRZA 2CL7X 1T0JB 4W8GA 1QE5A 2M0CA 1G16A 5H68A 2O6LA 4KIBA 1M34A 1W4ZA 1UB9A 5JO0A 2QW1A 2OM2A 4A8JB 4KIUA 2ZJYA 3S70A 1XP5A 2NM0A 1J8FA 4UXNA 2UV1A 1Y3BE 2I3DA 1Z3CA 2A0UA 3GLKA 4RAYA 3WGYA 1WQ3A 4GRIA 2IEKA 3P7NA 1U63A 5LRRA 4FIDA 5C1OA 2B21A 1Z26A 3NM4A 4YAEA 1A9ZA 5I9IA 1F43A 3M70A 8ADHA 4E2FA 1E6CA 2Y76A 3TZLA 3O2QB 3WNBA 1Z6TA 4IDHA 1KJ8A 3FY4A 1O7FA 4UUMA 2GFIA 4L4YA 2N1MA 3LWNA 2XGDA 5IS2A 3FNBA 4PYIA 4BXUA 1YWGO 1KFKB 3HCAA 1Y6QA 2JJQA 5E3LA 1HPLA 2JI9A 3P9PA 1YQWA 1VSUA 4IDPA 3VZCA 4YC7A 2FI1A 3IVAA 4XVCA 3H2BA 3TI9A 3BT7A 2FBIA 4LFCB 4D8VA 5L4LA 4GM0A 4UMEA 1M54A 4BNKA 3HWWA 4U6NA 3KZZA 3EWAA 1VRCA 5KU1A 4IBOA 1YB5A 1E1QA 1A36A 2J5PA 1IOWA 4XCXA 2VH1A 2PK3A 4J94A 2FSIA 4C7VA 1JA1A 1XZKA 3GTKJ 3I9KA 1PJ4A 3GZ5A 2H9YA 3ZCUA 3HUGA 3ABKH 4Y6RA 1RPAA 2B2NA 1D0ZA 1L7MA 1UK9A 2H5LA 3I6MA 3DP9A 1NK2P 1A9PA 5JAZA 4JDUA 3OZDA 2L2OA 1N8TA 1KA9H 4OHYA 3L43A 3K53A 1WNTA 1B76A 3NV7A 2FKNA 3E6DA 2IYQA 4IFEA 4JMPA 3SZOA 2AQHA 1V0JA 3V7NA 1K6JA 3IC5A 1NN0A 1PS0A 4UBJA 2JDIA 3M1IA 1QIMA 2GAOA 2R65A 2QB5A 1R7JA 3LT4A 3GX4X 1D2MA 2XBUA 3QUBA 2P3LA 5FI5A 3ZV3A 2QE7D 4TUYA 3DFKA 2ISYA 2P1RA 2VASA 1SRQA 2H0RA 4MWSA 3EPJA 4M0MA 3GT0A 1MAUA 2OFOA 5BNGA 5DIFA 2XGGA 2R48A 1MAHA 3VEPA 4GZLA 3ZVKA 3TAUA 1NHGA 4HGOA 4V1CB 1CY8A 1NVXQ 2W93A 2K4JA 2FDRA 3HCNA 4RPKA 4UZSA 2O5RA 1Z2PX 5CPFA 1UJMA 4EPRA 2YZNA 1ECCA 2JGIA 1I5RA 1FX1A 5C1PA 3BB1A 3LUAA 4D02A 3ZDZB 5EZ5A 4QLOA 1ULAA 4D57A 3WHIA 1ZD3A 1XZCA 3D7NA 4YACA 4H1WA 2IS2A 2IYRA 4DUPA 3F9IA 1L8OA 3TP3A 3O73A 1QDUA 1SFUA 1NE2A 2MHCA 2ZRNA 2WAAA 5CDFA 2XVAA 5E3IA 4UOQA 5E9AA 2R6HA 2P4HX 4YJGB 5E3OA 1FYFA 4BQSA 1H0KA 3IHWA 3L8YA 4EPXA 2DODA 5BRAA 2WAQA 2QBYB 1CB7A 4LF9B 3NAGA 2CDCA 1L9KA 5EIAA 4Z3KA 4F5EA 3LW7A 1DDIA 3T1NA 2XKBA 2YS9A 2V3WA 1HOTA 1L1QA 1WMAA 1VBFA 3L8GA 5HM8A 4WGGA 5DNEA 5BN5B 4BRWA 1X1AA 1K8XB 3EGVA 4LI3X 4PPNA 2VC1A 1P7JA 2YVLA 2IF0A 2Z2JA 4JLSA 3ABOB 2A7XA 3KUUA 2WINI 1XHLA 1YL6A 3EPKA 1M8FA 3DT9A 3RASA 2X51A 1YR9A 3EQZA 3FI0A 4XUDA 5DD4A 1FMFA 2W6CX 1XMVA 3HV2A 1H2FA 3VVBA 3D1VA 1B23P 2L7ZA 1OXTA 4UTRA 3EQ7A 5J2TB 3AR8A 4K26A 4CTNA 1WTAA 3CLHA 1BS9A 4CHGA 5ADVA 3F97A 4OO3A 1M1YB 5C2JB 5COAA 3MEQA 2WD9A 4AYXA 1PW5A 1YKFA 3SK0A 3OE4A 2W6NA 3K0AA 1OLXB 4D6YA 4JP2A 2C88A 5DM1A 1BW9B 4CICA 4AJHA 1KRWA 3IPAA 3IHTA 5G0VA 3ANLA 2KPMA 4HVTA 4MUAA 4ALLA 4HQ0A 1I39A 3RSZA 5JANA 4HFJA 1Z38A 4LRTB 4UHKA 1M0SA 3M9WA 4QOHA 1R4MB 3CWCA 3C3AA 2HYGD 4C22A 4B85A 2D5LA 4LA4A 3TO7A 3WV4A 1E4EA 2JKVA 1BS2A 1IN5A 5K0TA 3CJQA 3AEUA 1J20A 4KZKA 4MVCA 1ZRFA 3R60A 3ZS8A 3K09C 4E33A 4LZOA 2IHUA 4TN5A 2GBGA 1NVKA 1Y5MA 4MYSA 4E70A 1QRDA 1J22A 1YD7A 4JVOA 4F2GA 4DY4A 1TCUA 3RJPA 3ZD6A 3SFIA 3ML1A 1TF7A 4UHDA 2ECBA 4HWOA 4DYCA 4NMLA 5HFAA 1M2KA 5JJBA 1A7UA 5K0EA 1GUFA 4OAPA 1UPAA 3UXEA 1V8OA 1WCIA 1L7PA 1IRXA 2H1WA 4NZ9A 1YKSA 1E2FA 4HWKA 1VTNC 4N3NA 2E1OA 1YG2A 2BFBA 3JWJA 5D1NA 4UCXA 1IY0A 5LWQA 2X4GA 1BBYA 1M1NB 3ZGYA 3GCXA 3HEFA 1TO2E 4ALJA 2V7VA 2FX2A 1KRXA 4WA7A 5KC9A 2QM3A 2X4DA 3GW8A 3EGXB 5HKAA 5FUBA 1GPH1 4W9MC 1M34E 2OCBA 1RP7A 4MUKA 4KNYA 5JI2E 1I7NA 3D3NA 5IP6A 1RABA 3TDUC 3HADA 2W2NA 3T3GA 5IAGA 2DERA 1M3SA 2WAMA 1FQKA 3FPJA 1LI5A 3OTWA 4ENKA 2GK6A 3L8HA 4YQEA 3ZQGA 3IMEA 5A4KA 1C0LA 1X7WA 3W90A 2CUKA 3IEUA 4RXMA 2PLAA 3TJRA 3O90A 1H8HA 4IH1A 4LBWA 2CW0F 2XNKA 4XORA 1I27A 3G8DA 2OCGA 5FORA 2PJRA 4XJVA 5TS3A 5E1BA 1CV2A 2AOTB 2UUAB 2QNRA 4JJ7A 4UNQA 3ESWB 1Z2NX 3E6BA 4RQAA 1U2DC 2YYSA 1VGVA 4XZ3A 5JEDA 1FFEA 4FM9A 1H4SA 1AS3A 1Y6JA 4INPA 1TJPB 5LXTF 1JG2A 4RAFA 3FKSD 2PLNA 2OQVA 4N6OA 3TQHA 3EJ6A 3KEMA 3HJRA 1E3IA 4ZOLB 5DULA 2EYQA 4R0MA 2NO6A 3NATA 2X3YA 4ZYGA 2E3JA 1JR3A 2XWQA 5FNVF 4BP1A 1F8UA 1J2JA 2ZO4A 4B4UA 2I3ZA 3O91A 1A95A 3A1VA 1E6EA 1ZA1A 2DUNA 2YMPA 4JJAA 2QPTA 3TEFA 5B3JC 2XUQA 4BV9A 1RFGE 4JDPA 1D3AA 4COOA 3IWZA 5KSWB 3T5AA 3U6KA 3BL5A 4E7JA 2R62A 1RRCA 3FOWA 2G09A 1K0FA 1J2UA 4V24A 3RSOA 1TAUA 3KPWA 1MG0A 1VPVA 2R11A 3PB3A 1DWUA 5AYVA 3O3OB 1JJBA 2Z6QA 4L4ZA 2B3TA 5LSAA 2Z9CA 5JZSA 3P0IA 4U7WA 2RI6A 4G8DA 2O8FB 2O59A 3A06A 3AUKA 1SHJA 5KTYA 4RB1A 2XRLA 3FLBA 1ODTC 1X8JA 3GBPA 3I9NA 5D5QA 4S05A 3ZXSA 1P2TA 3BFKA 1W96A 3U56A 4Z4QA 1V71A 2FEPA 3LA8A 2PZKA 4MV8A 3Q8XB 4CSWA 3Q0WA 2DOEA 2E19A 1C8LA 1B2LA 5FKNA 2R7MA 4CV0A 3CLRD 2FMYA 3COWA 3N2NA 4PICA 3CVWA 4RZSA 2DHCA 1QPMA 1BDHA 1A4XA 1DKNA 4TSFA 2FPPA 4P1WA 2VATA 2CE2X 2R7OA 1U1FA 1GGJA 2OY0A 2EKQA 4HMOA 1NBHA 2WTBA 1QZXA 5TQ0A 1XDZA 2YXDA 2G4CA 4GR9A 2ZRDA 3DTEA 4TYNA 5CR9A 4Q4LA 3ZN2A 2M0MA 1T5DX 4H35A 4ZN6A 4BFCA 4BNYA 4WBSA 1ONPA 2J7KA 4WZAE 3F23A 1SUDA 4LBYA 4OFXA 4DIMA 3LQ4A 4HCJA 3G79A 1IM2A 1ZEJA 4B8YA 1RJEA 4JI8B 2Q1XA 5FYQA 1C3OA 3T3MB 1WLSA 1I0LA 3NVAA 1Q0QA 3TPFA 2H16A 1NNEA 5KMGA 1KBQA 4JOBA 2DKFA 3KKMA 3JD3A 4E6EA 1D2EA 1A4RA 5TGTA 5DS9A 6CHYA 3CCSI 4IKOA 1C50A 4XGQA 1DKRA 4G65A 3IUPA 3KKLA 2A9KA 4L5IA 4FHGA 3Q85A 3NHJA 3GL9A 2DLDA 2F9FA 2Q5IA 5D5XB 4RMIA 2Y6UA 2OMEA 3ZP5A 3V1YA 3TG2A 4QARA 3Q3EA 4HBLA 5TV2A 2RKHA 1SIOA 4ZDWA 3LYUA 5EE9A 4Z7QB 2COBA 2HHJA 5EIEA 1XSEA 4EABA 3U7FB 2EF1A 4US1R 4E1AA 2C9ZA 4BNVA 5AVTA 2XSDC 5TVGA 4ALNA 1PO7A 5I4KA 3SBDA 1M8PA 2YX4A 3GLIA 2G7MC 5FA6A 1A72A 2YHAA 2PEYA 1IDYA 2H31A 1KPHA 4I02A 5C7YA 1P81A 1GEEA 1XRQA 2OQIA 1DPFA 4PAOA 4RKFA 2JAOA 1C0IA 1KDYA 4N3CA 3NBXX 1NSFA 2GSWA 1NJSA 3NWBA 4LKOA 2A07F 5I7HA 3KXKA 1ULSA 2Z8XA 6REQB 5CK5A 3EEOA 1ORTA 4IDNA 2PX4A 2Q4RA 3HUFA 3OJ0A 1GQQA 2VHYA 4A0YA 2YJ5A 1IPFA 1FZPB 5ALOA 1P8AA 3HB1A 4QDTA 1LDJA 5L6LB 2ADUA 1K2WA 4W1SA 2PMZN 3D4OA 2PZ8A 2VLIA 5CW1A 3C48A 5KOJB 1YW7A 4IO1A 1N6PA 4Y2QA 1E62A 2ICAA 5BR1A 2E4XA 2NG1A 2AFIB 1J7KA 1J8DA 3OFSA 2JFGA 5EXDA 2VLAA 3BLYA 4RH1A 4GECA 1JFTA 1XCPA 4MDFA 2YUIA 3WK8A 1NSTA 4K9KA 2OAZA 1QPGA 4MWOA 2QQEA 3JQ7B 1QBGA 4LOIA 2EINH 3MVEA 3A1TA 3QVLA 1TAHA 3W5SA 1R0LA 4FB4A 4HB4A 4OMFG 3P0HA 1PR5A 3E9YA 3TDKA 2LRDA 3N07A 2Y31A 1PNRA 4RTMA 1P0IA 2O3TA 1NL3A 3ROGA 4COKA 3NT4A 3SD7A 4RAZA 1TT5A 3KLOA 3B6ZA 2J30A 1Q0ZA 2HWVA 3GN1A 4CG1A 5KYWB 3GAMA 3ZCPA 2LOOA 4LRQA 4A5SA 4M1MA 3CONA 5BNTA 4TM8A 3KYJB 3MOIA 3IPLA 2H48A 4O1HA 3S17J 3QVSA 3N2LA 4TQ9A 5A4IS 1MNEA 2Q07A 3AUJB 3ZHYA 3LC7O 3ELWA 2ZXUA 1U2GA 5A7FA 1VB3A 3UGJA 2HUPA 4D0RA 1BD3A 3MS7A 4F9EA 1NURA 4NE9A 3DTVA 3PNLA 2DPDA 3K73O 5EMLA 2B1JA 3CT6A 3ABRB 2DPXA 2XMBA 5K4GA 2J3JA 3H3UA 1VG0B 5CNKA 2Q3MA 2XD9A 4BX9A 1HNXB 3OYAA 2VQEB 2XNDD 5J1YA 1JKRC 3OESA 4AZVA 5ALQA 5FKJA 4U3JA 4IFTA 4M1EA 3KFWX 1R49A 3GUYA 5E0KB 3S1QJ 1WW8A 4QT0A 3VC7A 2ZB7A 3ZOKA 3R7FA 1RXWA 2KKOA 2HSZA 3V2HA 4HDNA 1JQJC 1H4QA 4ETWA 4HA8A 1UT5A 3UMMA 1BN7A 5JZ9A 2NS0A 3O8OA 2WWIA 1XTRA 3LJKA 4OYYA 4LMPA 3D6HA 2HNAA 3T7EA 5I47A 2Z5UA 4GZ6A 3ZD9A 1SIUA 4OAOA 1EFUA 2QIPA 5HGJA 3IQFA 4MGIR 5DHUA 4OBWA 3R7LA 9ANTA 5HCUA 2J31A 4UFPA 1E0DA 1NI4A 3FR7A 4WLOA 1IUOA 5BW4A 1N1GA 1QYRA 3EPPA 3JZAA 3B1WA 2M7BA 1IN4A 5EJEA 2CLDX 1QR2A 4RVCA 3PD0A 4FR2A 4LCEA 2YXPX 4L51A 3BE5A 3CUQC 3TBHA 1TCVA 4UEWA 4I1IA 4IJWA 3UUEA 1FRVA 1NVVR 4E11A 4CM7A 4I8DA 1IEQA 1M74A 1SIWA 3I0MA 4OIRF 3C7KA 5KTMA 4TZKA 4CKXA 5LEKA 4JX9A 5EJFA 3AX6A 4DCGA 2WE8A 5CFLA 3MC1A 2EKLA 1RACA 2MR5A 2IBSA 1XNRB 2L01A 2DG2A 1U8BA 3L09A 3HKDA 4AL4A 1D5CA 4Z1OA 4B1RA 5I01A 1L4MA 4GX1A 3GRUA 2C3MA 1NBMD 4Q34A 1RC9A 3IP7A 1C8BA 4DZJA 1YZUA 5LKRA 2GPAA 4RZUA 1F12A 1H0HA 4UU7A 3KQPA 3TO9A 2GCOA 2G1JA 3N28A 2CLKB 1YHQI 4G0QA 3NVKI 1ETQA 1EV7A 2F1JA 3TE7A 3A4YA 5AK5A 1OOEA 1QH9A 1RYHA 1R6VA 3WYEA 1W19A 4R9SA 1P5RA 4PLWA 4JJ6A 4D5CA 2XSZA 5KTOA 1X7XB 3H99A 4RJKA 4EG8A 2IYNA 1CUSA 1N8SA 4PV7A 3KJQA 2LIPA 4XQCA 4E5UA 2RGXA 1Z2OX 1DRVA 2Y1LA 5E7QA 4Q4AA 1RYMA 2IQIA 2O3SA 3WBFA 3NXSA 1XLWA 1JPUA 3TDMA 3S2WA 1EK6A 2H4JA 3JS5A 3KTFA 3OX2A 4ZICA 5CLIA 4ZDPA 4G0ZA 2MIIA 2VDWB 1HG1A 2IHNA 3QOWA 3FYDA 1AK2A 4G25A 3E7LA 1G59A 2QUHA 3TM4A 2A4MA 4PYNA 3F5MA 1HWYA 4UTOA 4JSYA 5TDHA 5L3VA 3FTCA 4WXCA 4C6HA 2AC4A 5BQPA 3RI4A 3OHMA 3OJLA 3VR3D 2Q3FA 2YBEA 2ZXFA 4YAUA 2LTAA 2GYUA 4URHA 3GEZA 2B4QA 3OKCA 5HFJA 2HWKA 1F0YA 1PZXA 4XL9A 1UKVY 2JIBA 2AN3A 3RHTA 1NYTA 1STZA 3I1IA 3M6FA 3OH8A 2P27A 4MB6A 2C9OA 2FXIA 4DSOA 4HFMA 1H69A 2QN6A 4AP6A 1XRRA 4Q66C 3DYBA 4EDFA 4TV9F 1XZMA 2CT8A 1ZUHA 4EFDA 4KR0A 5FOQA 2HS5A 4DV7B 5E2BA 1PUFA 2GJ4A 1AJEA 4P33A 1AGNA 3C7JA 1MJNA 1PQWA 1GNLA 1MNAA 4HPJB 1ZLYA 5HYVA 2O7QA 3UHOA 1GKUB 1EUDA 1FTWA 4U2BA 2QRZA 2BY2A 4NMMA 4EHBA 2DAPA 4CI0B 1W7AA 4J7AA 4WE3A 1WH5A 4ZANA 3OLCX 4R8RA 2RNJA 4L5CA 4BBPA 3RJMA 4F6CA 5E2AA 3OZRA 1PYVA 4HX2A 2H2GA 2O2CA 4B7CA 4MVJM 3VHXA 4BU0A 4YG2F 5FHRA 2MR6A 2Q3CA 2V8BA 1ZMBA 3H84A 1O95C 1MNQA 4YHBA 1JB9A 4D96A 3DZKA 4QFMA 1XQ1A 1B73A 1R12A 3H3XA 1J2RA 1RT9A 3W2HA 1LNZA 3ZDYB 3H5TA 4Z4FA 1ZFNA 1UJ5A 3Q9LA 1LDYA 3VHQA 3SI7A 1SXGA 1DX6A 3IP8A 3T3EA 3TRJA 3FF4A 4QLAA 3L7MA 4KXWA 2PIAA 2AH5A 5LQMA 3NWPA 3PIIA 3ER6A 4GYWA 2FQXA 3TZQA 3SE7A 1W35A 1J2TA 3U37A 3EXIB 3V4VB 3VYUB 1I14A 3BWXA 3ZBQA 4RF2A 1XCVA 3DMHA 3AUUA 5FBKA 5EIBD 4U0VA 1ULBA 5DBHX 3AG5A 2JTVA 2A1TR 1EVQA 4B46A 4Q9JA 2WSMA 4A3EJ 1RZ4A 3MRTA 3G2MA 2Q2NA 3I9V2 2CW8A 2F8TA 1Y6FA 4GRAA 3LAWA 2O54A 3D59A 3N8HA 5GADl 4X84A 1YU6A 3ZKAA 3JYPA 1X7ZA 1SCBA 4BN0A 3BP8A 4LBVA 4O3MA 2NUTA 1GNVA 1OFCX 3D8NA 4DV1B 1YS6A 1KF0A 3Q7IA 2FPKA 1HZZA 2JRLA 2VOOA 3TWOA 3LX6A 1EQ2A 3O83A 4DSNA 1VF9A 4J0DA 4YDHB 4I50F 1SHLA 2JGDA 4YRBA 5U4QA 4KO2S 2D5VA 4DB4A 2OLJA 3L6RA 1J7JA 2MSLA 3UQYS 4NDAA 3GVAA 5FO0A 1IPHA 2WC1A 1Z5UA 3LVQE 2QAGA 1EG2A 4MA5A 5T6MA 3LGAA 4OI0A 1T0IA 2C00A 5KHLB 2DFVA 3CX7A 3EH1A 1LV8A 2IU4A 1KI7A 4HYQA 5AW2A 3QPWA 2QORA 2CQ7A 3EXEB 3DAPA 1URPA 3TCXB 3TLKA 3ZE6A 4NWIA 3LNQA 3TEJA 5DCLA 2VSXA 5JAQA 4EIWA 2O9LA 4FEEA 3BZBA 5KYVA 2R3SA 3KZ1E 1T8IA 4BYGA 4QATA 5EHGA 2QQ0A 1EFPA 4DTCA 4DIBA 3OIDA 4MYDA 1ZI9A 4XNFA 2EPFA 3USES 3ZZMA 1SOAA 4JYMA 1QFXA 5E9WA 3ZHXA 3BR1A 3AZOA 2QAJA 3ICPA 4PLZA 3GRFA 1BWSA 1JVNA 5LP6C 3UGQA 3WAJA 2QVOA 4ITRC 2H1FA 2O0LA 5AKKA 2FB9A 1QONA 4ALKA 4Z0PA 4TWBA 3LQ2A 4LJ4A 3X2SA 2DMQA 1N6IA 3BQYA 3Q3HA 5GJVC 3D7LA 3DV2A 2PA3A 1LC0A 3QPVA 1GTRA 5BV1A 2ZRGA 1USGA 5I6DA 5PNTA 6PAXA 3SZMA 2G3YA 4F8YA 2H65A 2P9CA 1O6ZA 1TE2A 4WNAB 3GCDA 1PR0A 1KEEA 5HS9A 1PL8A 1EK1A 2PUJA 5CB4F 1IXZA 4FQ5A 1NOIA 4QREA 1IY1A 1K3FA 2H1OA 5DHAA 1NLUA 2PVPA 3MKZA 4Z49A 4JLDA 1YA8A 2RJNA 4IJMA 4M8NE 4PRZA 1R5NA 3PC8C 3KLMX 1OTYA 2D1HA 4HADA 5G1PA 2ZXHA 4RJJA 1ECGA 1NM5C 4XIJA 5FTKA 1G8MA 2IGBA 2VPZA 4E09A 4D0GA 5DM0A 3PQKA 2XD4A 2A67A 5L3CA 2A86A 4C9YA 1KU9A 1GXPA 4HNAB 2C5GA 4X3OA 3HYNA 5A5DA 3I4MJ 1T8WA 3ZVMA 3NO4A 4Q24A 1GUUA 3NYWA 3UK7A 1E7MA 3LCVB 3O3KA 1PNVA 2XUZA 3M82A 4FOLA 4DDTA 3GYGA 5GM2A 4RTLA 4UW9A 4J16C 3NJRA 2X0EA 4M8LA 2JVKA 3HPHA 1J33A 1IEXA 1OZGA 3OTIA 5JTUA 4A8JC 1GGNA 4BLSA 3A04A 4BE1A 3JZMA 1CXZA 5BN4A 3KYDB 2PM8A 4EFLA 2V45A 4RLHA 2O7SA 2HV8A 1E79A 4ZKDA 2VKHA 4FHTA 2BEVA 4MFDA 1EGQA 1VXOA 1CE8A 3RM3A 2XIGA 4ZC8A 3SS7X 3FCAA 5DGCA 1FZTA 2YFYA 1SQ0A 3ZWQA 4J2TA 1BSVA 4HTFA 3GLHA 3P9ZA 4NHOA 3BH7A 5D5WB 2ZBKA 3HYCA 2BXZA 1KMIY 6AT1A 2O8CA 4I46A 2ZSEA 5HXAA 3UA3A 3NHSA 2PXCA 1K8YB 1GFIA 2VJBA 2FMLA 2W37A 4IRIA 4YWJA 3HEAA 3STXA 1FEZA 4NJEB 1KDVA 4OOIA 4X95A 1AQ6A 3I9OA 1OWPA 2CDRA 5EIWA 3RSSA 1HDPA 1WF3A 1AMUA 4ZIRA 1ULUA 3GPCA 4RY8A 2LD5A 1W0UA 4BS9A 2OC9A 3WIBA 3G6WA 2BGJA 1V41E 2A7QA 1XRJA 3IAS6 3VAAA 3RAEC 3C7AA 3R44A 4FI3F 1B6SA 4IL6C 1XZLA 2W83A 4ZTZB 5IOZA 4RPHA 4QM7A 4GC9A 4AT1A 1VCIA 1TNTA 3QE3A 3FJYA 2G5TA 3C3DA 4UU0A 3PZBA 2W70A 3JQAA 4ZCRA 4RTKA 2A0FA 1L5NA 4K03A 4QG3A 1OXVA 2PFGA 3OQVA 3VSKA 3D8BA 4Q4JB 1ON1A 2DK5A 1PR6A 1QH1B 5AW3A 1FQWA 5G40A 3W6VA 3ZUPA 4CV2A 4P5EA 1HORA 2JT1A 3AINA 4Q3EA 2F5EA 3WG7H 2FP3A 3R5SA 4ZO8A 4Y18A 5MHTA 5NULA 2PWYA 1QTIA 5CX4A 3SEAA 4YJ3A 2WBMA 2EFGA 5JS6A 3FYUB 5LIRA 3S2SA 4OMCA 3HCPA 3VSBA 1L4KA 3TSWA 3FBTA 1QG2A 5JHUA 3K9LA 5JD6A 1Z4IA 4C4YA 2FFJA 4M9UA 1N6OA 521PA 4HX8A 3NOQA 4GPZA 2YWJA 5D6NA 3HO6A 1JWAB 2C61A 1P5ZB 4AO7A 5EGSA 1ZEMA 2DU8A