1R00A

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-homocysteine (sah)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r00A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r00A03
4GOMD 3HM2A 2K4BA 4GEKA 1ZG5A 1YG2A 1SQFA 4FSDA 4L9NA 4RTLA 3A26A 2V74B 4RVFA 2P7HA 3RIEA 4HLYA 1DDNA 2ACJA 3F8MA 1L3IA 4HV6A 5KS2A 1TQIA 1R5GA 3RYPA 4CWAA 2ESNA 2ZBRA 5HIJA 3TR6A 4G7ZF 1IN4A 4PYNA 1S7OA 5BP7A 1ORIA 2HKXA 4LLNA 4UVBA 2PX2A 1QAOA 4KFCA 1T98A 4RV9A 3BY6A 3HEMA 4KRGA 3CUOA 4B8XA 4PGGA 3VFZA 2FK8A 3ME5A 1ZH5A 2HWVA 4LG0B 5EQJB 3JWIA 1LDJA 2VBZA 1JG2A 4A0XA 1V4RA 1HNNA 3TLJA 1O9GA 1XTPA 3T7TA 3C1DA 2Z6QA 3EGIA 1T6SA 1W7PB 4I0BA 1L3CA 2CW0F 4Z2YA 2E7WA 2CL5A 3BWBA 3QRFF 4PYMA 4OX9Y 2TDXA 2BV6A 4EGYA 4PINA 1PRYA 2HS5A 2QY6A 2Y48A 1YB2A 2WTEA 5A2QZ 2M87A 4RSRA 3PTAA 1DL5A 1J59A 1UIRA 3NDJA 4XLPF 3KHKA 4AIKA 1U2ZA 2QVOA 1INLA 1DUXC 2PXAA 2PG4A 4NB5A 5D5WB 7MHTA 5FGMA 3IEIA 3HCEA 5CLSA 5DTQA 1YF3A 1X1DA 3BWGA 5E1DA 2AOXA 8MHTA 3VC2A 1BOAA 4FT8A 4MHTA 2YPRA 1P4WA 4FS8A 2F8LA 5ILUA 1I6XA 3LCCA 2YXDA 2VC1A 2VE8A 2XVAA 1KQ8A 4M37A 3GEZA 3J81Z 3KP5A 4EMSA 5CVEA 2ORED 3L9FA 2MH9A 2Y75A 3JTGA 2I6GA 4CGZA 4IKPA 5CVIA 2GLUA 2FPOA 2P5KA 1BI2A 3HIFA 2PXXA 3EVFA 5EPEA 1GXPA 2FA5A 2OA4A 4K2EA 3ZN1A 1G8SA 3BPXA 3ELDA 2K4MA 1JE8A 4QVGA 2L01A 2O05A 1Y8CA 4RWZA 3BZ6A 5J6XA 2QLZA 5K0GA 3DXXA 1YQAA 2WK1A 3V8KA 4HV5A 4EJWA 2UXXA 1FNNA 1NT2A 4UVAA 2ZBKA 4HX4A 3ELUA 5EMKA 5CYVA 3GVAA 2ZFUA 3ISPA 3QPHA 3HA5A 1BC5A 4BY9E 3Q5FA 5DX1A 1HKTA 4XSZF 3ZMVA 3CVOA 4IRHA 3CO7C 2JPBA 3H3ZA 2DK5A 3HRMA 4GBED 2NYXA 3CUQB 4OINF 2FQ3A 3FPEA 1U6GA 3FYCA 5FUBA 4P5OA 3F6OA 1WQ2A 1H0MA 3X0DA 1MGTA 2GH1A 4HC4A 3G5TA 4DQ0A 1PJZA 2HMYB 3A7DA 4MQVA 3PX2A 4IHTA 3AWIA 4AZTA 1Z91A 1M6EX 4S04A 3GU3A 1XJ5A 3C7JA 4EK9A 3HUGA 1CGPA 4L0YB 1KU2A 4AVPA 2JHCA 3TKYA 1FBQA 2C7QA 1MD0A 4V0QA 5FLXZ 1XCLA 1K79A 3GNLA 3WTXC 1P1BA 3NMUF 5D4RA 2XUBA 3SGLA 2EFJA 3S2WA 4BAYA 4GOLD 3GO5A 4DCMA 2Y1XA 1DCTA 2QQBA 4PYIA 3IHUA 2IJLA 1SD7A 2O06A 5LQUA 1R22A 3WTTC 2A14A 2DTRA 1KU3A 2COMA 2DBBA 2LDUA 3TOAA 4N0BA 5L3DA 3RKYA 1W4MA 3EETA 1SG9A 3PFGA 4ISCA 3ZN0A 2D1VA 3GRZA 3PT9A 4I01A 5DDGA 2HDCA 1OKRA 3TMAA 4KNYA 5FWDA 3TRKA 2GQQA 4C03A 5D6EA 1T38A 3KR9A 3K2ZA 1JTFA 4CKBA 3OZSA 4R1HA 4OIOF 5KVAA 3VYWA 1DPUA 5E1ZB 1WG8A 1IN7A 1ULYA 5ED4A 4R79A 3FUTA 5FA8A 5F64A 3H3UA 2J5PA 3EVCA 2BM8A 4PZJA 5IT9Z 4ESBA 1K6OA 4OA8A 3I58A 2A5YB 2VZ9A 1IM8A 3DXJF 2ESRA 5HFJA 5D8KB 3BWCA 5F6FA 2B2CA 3K0LA 2GPYA 4HZFA 2EFNA 2PWYA 2OO3A 5DRTA 3NWEA 5DXAA 3V8JA 2NXCA 4ENKA 2L02A 1O3SA 3IWFA 3LDFA 4PGHA 2IVMA 3QAHA 4XCXA 1R8XA 2P3OA 5DLYA 1O7LA 1LEAA 5DXJA 1UWVA 2EG5A 5J8CA 4YV2A 1KU9A 3R9XB 2EFOA 4KDPA 4MIKA 4LK1F 2EJRA 1H9TA 4L18B 1RI2A 3O4FA 1UFMA 3CUQA 4KN7X 3ROUA 3WGGA 4PIPA 3P9IA 4NHJA 3ECOA 1SVUA 3TDZC 5HS9A 4AWXB 5JHUA 2R7DA 5LSAA 1HSJA 2IFTA 10MHA 5E8IA 1A04A 1FP2A 3MQ0A 4LB6B 2ZBPA 2O8XA 1U8RA 3EEYA 3BROA 1LEBA 5LEJA 3LBYA 3L7WA 2VDVE 3LHDA 2Q41A 5F2OA 2E1CA 4ENJA 1RJDA 3NDIA 3M8FA 4A0YA 4QDKA 5DD8A 2H27A 1QAMA 2AOWA 2GS9A 3UA4A 3B3JA 2P8TA 2G8NA 4BHBA 4OQEA 4XRFA 4KDCA 1F5TA 5K0EA 2ZXJA 2PN6A 5GOZA 3M70A 2VBXA 2NXNA 5ILSA 3BUSA 4YV1A 3P2IA 3B89A 4GGGA 3C18A 3PFIA 3GRVA 4RTSA 5IT3A 1QNTA 4RYLA 2ZIFA 4EJTA 2WA1A 1WZNA 1YTYA 4F7ZA 1ZHFA 1XSXA 5DV5A 3K69A 2OQRA 2H00A 3BWYA 2BGCA 1VIDA 4L9JA 1EQAA 5EMLA 3LA7A 4PYLA 2DAOA 3FPJA 3VODA 1UB9A 4WXCA 4BYYA 1BC7C 2PY6A 5ICEA 3TFWA 5AONA 4I02A 5HS8A 5T64A 5LHHA 5HIKA 3FMRA 2JSCA 2STTA 3A7EA 1NW7A 5CVVA 5D5VB 3MERA 1SD5A 2OB2A 5DM0A 1AV6A 4KIGA 3HA3A 4BP1A 4PCAA 4WF2A 2O57A 4FP9A 2EA4A 1FYKA 1O7FA 1YW8A 4UV8A 3LCUA 3DULA 2HTEA 2IDJA 4P58A 2F5CA 2AN4A 5E17F 3FUUA 1TBXA 3RKXA 3M7GA 3JAMZ 2XAQA 4ON0A 3IKTA 3NQOA 1R5HA 3FM5A 3WGHA 4X41A 3RJPA 1YO5C 1LQ1A 1NV8A 1T0FA 1ZG3A 3SFZA 4BHCA 4LD5A 1P2FA 3O7WA 4EJVA 4R6XA 2VBWA 4YIFA 3I4PA 4QPNA 2KIUA 4LG1A 3E5XA 2ZVJA 3WG9A 3I0TA 2IPQX 3I71A 4G9YA 3MZYA 3WODF 2ZZMA 2PX4A 2P35A 2M1BA 3MQ2A 5DCMB 1FP1D 3TPZA 2CMGA 1G6NA 1LDDA 3WTYC 4P7KA 2P3QA 3HTUA 3UJCA 1MHTA 1SMTA 2JHPA 1WXWA 3UJBA 1RI1A 3M6VA 3GWZA 5TJJA 2PVCA 5E9JA 1HXDA 1HBXG 4IVNA 1IY9A 2XIGA 3UJ6A 1I1SA 1ZAOA 2Z99A 2EA2A 4KUMA 3QU3A 2STWA 3HCAA 4RVGA 3HCCA 2XGXA 4U7DA 4PNEA 4ASNA 3I53A 2OKCA 3DFGA 3O3KA 3OZRA 4S05A 2P7CB 2RNJA 3V8LA 2AN5A 2XBMA 3I54A 5FFXA 5LQCA 5FO5A 4HDUA 1FSHA 4H0EA 2G71A 5KVRA 3HRTA 3CJQA 1SFUA 3P9NA 1JQEA 4QTTB 3LAPA 5HILA 1O3QA 3KQSA 3ZMTA 4KYWA 3ZMUA 1G3WA 2XAGA 2K86A 4M9ZA 1N7IA 2ZMEA 5F2NA 3G5LA 4G6DA 5K0JA 1H9GA 2AOTA 4N9IA 2ZSUA 3HRSA 2ZBQA 4CDGA 3RODA 2VS1A 2PBIA 5HOOA 2ESHA 2MC3A 3R61A 2ISZA 4O29A 3E97A 2RVCA 1G38A 2MBFA 2DPMA 1HMYA 2QUFA 5FULA 4GYIA 1Q1HA 1LJ9A 2DO7A 2OBFA 5DM4A 4MTEA 2VDWA 1OYWA 4LECA 1K78A 4AIHA 1LNWA 2YU3A 1S29A 4JXJA 4UUVA 2PLWA 3SXYA 3R6TA 2KKOA 5CM2Z 4EJOA 3KP4A 1YFJA 3DOUA 4CTKA 5EKXA 4I09A 3UJ9A 5E8JA 3KEOA 1J5YA 3E5QA 2JH8A 3GYHX 2VDUE 4HAMA 2GZWA 3KLOA 1JXSA 3MTIA 4Q5SF 1JTEA 5FHQA 1X19A 4PCQA 1HKSA 3R24A 4CICA 1B59A 3FMSA 5FLXK 3Q9SA 1KU7A 3T0IA 3U2RA 3NRVA 3DMGA 4ENNA 3GRYA 3SX0A 2H11A 2NRAC 2EB7A 1BM9A 5DEQA 5EHGA 2I62A 5CCBA 3FRHA 3LECA 4HDVA 4ETSA 2NXJA 4RTPA 5GP1A 3HTXA 5GINE 2UYHA 5L3BA 4RB0A 4RX1A 3SM3A 4LLGF 4OU0A 4DA4A 2GAUA 1G3YA 1BKYA 2GB4A 2P3LA 4P96A 4IV8A 1YW7A 3S68A 3VSEA 1AQIA 1D2GA 4I98B 1C0WA 5EEGA 4E30A 3EMBA 3P2KA 1L1EA 4RB1A 3FXQA 4YG2F 2K4JA 2PEXA 5L3CA 2M30A 1CF7B 2PSSA 2IA2A 4OIRF 2NNYA 2RN7A 4HGYA 5DTMA 1S3JA 1CF7A 2P6SA 3SZTA 3MB5A 4M74A 2R3SA 2IH5A 2R6ZA 3GF2A 1YFLA 4U0VA 2A69F 1BI0A 2GWRA 1M6YA 4M7RA 1R1VA 1Z6TA 2F5EA 3R0JA 2IPXA 5KQSA 4GUAA 3LKZA 5K8VA 3FTFA 1F3LA 1G6Q1 4WX9A 2ZCJA 2CKDA 5FHRA 3AXSA 5GWXA 4Y15A 1FY7A 1O54A 2PT6A 4C06A 4RTNA 2PLYA 1ZYRF 3KZYA 2AOUB 3KE2A 3IC7A 1XSVA 1B6AA 4L9TA 4A2UA 3J81K 2OAZA 3CJRA 3VOEA 1UFKA 3TOSA 3EGEA 5DSTA 4IPAA 1MJBA 2LD4A 1R18A 4OBXA 4PONA 5B1SA 4WCGA 3CKKA 2ISYA 3LA2A 1RI7A 4M9SA 2A07F 4HX8A 3RTRA 4A6DA 1JSXA 3TQSA 5FB2A 4X1OA 5GM1A 3ERCA 1E2XA 2DK8A 4FR0A 4YFKF 4LWOA 5DX0A 5GIPE 4ER7A 1HW1A 3BGIA 2ONZA 3HA7A 1XVAA 4U88A 3KPJA 2IH4A 3I64A 1K78B 1ZLKA 4G7OF 4RTMA 3LGAA 3BPVA 4ZYEA 4M73A 5AIPA 3DLCA 1HW2A 5EHIA 1BC8C 2O0YA 3F8FA 3FZGA 4LGWA 5K01A 1BOOA 3QP6A 3V4GA 5C1IA 1IXKA 3G88A 4L0ZB 5HS7A 1EIZA 1MDMB 5D4SA 5LQKA 4ZYGA 3MWMA 2G1PA 1JSZA 2QRVA 1XDSA 1G3SA 3BT7A 3BKWA 2VT2A 3KPUA 5LBQA 5HDKA 5EG5A 3M8EA 2VC0A 2BR5A 2PQ8A 1FLIA 1NHAA 5FWAA 3LQRA 1RJGA 1GXQA 3SQNA 1P91A 3HSEA 1SAXA 4FZVA 4ZZDA 4IRGA 2M45A 3MHTA 4LLLA 4HA8A 4MNUA 5EMMA 1WS6A 3IHTA 4PYKA 2W84A 4P7GA 3TM5A 2FNAA 1WSUA 4C08A 4KMUX 3CO6C 1R23A 4HQEA 4KN4X 2ZTHA 4UNOA 4YUXA 4MQ9F 3LWFA 3VB2A 4FT2A 3O6BB 3C6KA 1WRJA 3G89A 4Y13A 3CUQC 5DWQA 3HP7A 4GOOD 5DM1A 2OD5A 1KYWA 2VN2A 3B73A 3K6RA 3GCZA 4RTRA 3HTSB 1AOYA 1SFXA 2O0LA 1R74A 3MCTA 4BLUA 2EJTA 2H6CA 3V7CA 4ENMA 3ID6C 3G2PA 2A6EF 5HDNA 5LR6A 1ZN2A 2G9WA 1J7KA 2FOKA 2WA2A 3MGGA 3TKAA 4PIMA 3FZVA 3MCZA 1D8KA 3GFMA 3AAFA 2NXEA 2GIVA 1YW9A 2R7FA 1TNTA 3BXOA 1J9IA 2ZZNA 2UXNA 3GDHA 3OFJA 1XGSA 2P6TA 4R05A 3A25A 5E1BA 1VP9A 4BP3A 2Q2EA 3PQKA 3F6VA 1OYIA 4CZZA 2WWYA 3AY0A 4RTOA 2AOUA 1STZA 3QOXA 2D2WA 5E2BA 2XRNA 2YVLA 3E6DA 4FX4A 5E9WA 2PI0A 3HSRA 4X63A 3WU0A 3KETA 1GHCA 2V1UA 4YV0A 4JQFA 1IXCA 4KMFA 3DPTA 3P7NA 4IV0A 2NYUA 4KDRA 2YR2A 1BI1A 2OU2A 4AIJA 3NJRA 4YUWA 5BW5A 1T43A 4C05A 4ZTBA 4MQ4A 2L54A 1ZRFA 3EYYA 5HDGA 2WC2A 4RS8A 2IRFG 1YLFA 3F72A 4EQQA 3E7PA 5DX8A 3THRA 2EWNA 3FX3A 4RB2C 1XCVA 2AXLA 3I5UA 2Z5UA 4I0AA 3CC8A 2VP3A 5C9ZA 1ZG1A 4A12A 2ZLBA 4JBAA 1G55A 3G7UA 3EDPA 5ICFA 3TDUC 1V39A 1Q0SA 3OCJA 1XB4A 2XAJA 1ZGJA 4ER0A 4KWCA 1U3EM 4HH4A 2KIMA 3FM3A 4F86A 1BIBA 3MEXA 3P9CA 1U5TC 2GA1A 4HSGA 4L5JA 3RIRA 2M5WA 4E32A 2FEZA 2AVDA 2X0LA 3RKWA 5E1XA 5FTWA 2DPUA 1NBIA 1WI9A 2CGPA 3P97A 2XVMA 2F5FA 2LF7A 3MAJA 2W24A 5G02A 4AD9A 1IN5A 5JR3A 5E9QA 2EV6A 3LDGA 1P39A 1IAWA 3AXTA 2IA0A 3D0SA 3GZ6A 2ERCA 3GFLA 4RGSA 2XAFA 5JVTA 2O61A 3O2PE 1HSTA 3D2LA 2DFIA 2DPDA 2P7VB 4MEYF 2XKPA 4A5MA 2ONYA 3BWMA 5K5QA 4DF3A 3HVKA 2RGVA 1ZRDA 1ZRCA 1K7AA 5LLQA 4DNCA 3PLAE 3KQYA 3O31A 4LG0A 1LB2A 5E1MA 4UVCA 5EVJA 3SVZA 2IH2A 2RDPA 3R0QA 2BH2A 5L3FA 5FD6A 2HR1A 5ERIA 4WXHA 2CYYA 5JUWA 2V1DA 4GC9A 2A68F 2AS5F 1TNSA 4O6JA 3HOTA 3KKZA 5K1YA 2OZVA 2HNKA 2B25A 3SR4A 4CKEA 1Q0TA 2FU4A 3TM4A 2KJCA 2EV0A 1IRFA 3CBGA 2AOTB 3G2MA 3FTDA 2HGCA 5ILVA 3FF5A 1R7JA 2UYOA 1F9NA 1TTYA 3IL2A 2CWEA 5CVDA 4GXOA 3WSTA 1IRGA 3LFKA 4UV9A 3JSPA 4C04A 5HZMA 2XYQA 3G3ZA 1J75A 3C3YA 2FSWA 3EVZA 1P4XA 1QGPA 2O6GE 4FHTA 1L3BA 2QBYA 3CJTA 3UZUA 3ZQ7A 1KPGA 3T5XA 3AJDA 1FOKA 4BNCA 3IWZA 1I5ZA 5BW4A 3PFHA 3JTHA 3WTZA 2M8EA 2UYCA 1HQCA 2AR0A 3LBFA 5HLIA 3KR1A 1M0EA 2BZGA 3EMDA 2VONA 2FRXA 4F84A 2ZWVA 3HCDA 4H0NA 1N2XA 3ER9A 2RV8A 3K1PA 2QWWA 1J2XA 1ZARA 3BJAA 3BOQA 3UJAA 2C7PA 3DEUA 1R1TA 4OQDA 1JQ3A 2L3DA 4QQNA 2GA2A 2C6YA 2HQRA 1YS6A 5ICCA 3DXYA 4U7PB 2WV0A 1OYYA 1FBSA 2G7UA 1RZ4A 1RI4A 2Y1WA 3UBTA 3LAJA 4XSXF 2PMHA 5HEKA 5KQRA 3PX3A 1RI5A 2DI3A 2ZJ2A 1MKMA 3FRIA 3L2CA 3U1DA 5F2KA 5K0LA 3F4KA 4E33A 1F1ZA 3FPFA 2AS0A 4HW0A 1R58A 5E8RA 5CD1A 3F22A 2NP7A 3SSNA 1QPMA 4N9HA 3CDHA 6PAXA 5EZQA 4OOIA 3JAMK 1ODDA 2RQPA 2ZCWA 1WKMA 4MGRA 4XLNF 4UOEA 5HOQA 3FYDA 2E7XA 2B0LA 3QP5A 3B3FA 2YTZA 5T6BA 3BJOA 4BLVA 3J80Z 5U4XA 4P55A 3JWGA 2VOPA 3RYRA 2NAZA 1O9HA 3E3VA 4HGZA 3KQQA 2EFQA 3SSOA 2BYVE 2PKWA 5K0CA 1W7PD 4B09A 4PCLA 3HNRA 1OPCA 4CKCA 2PT9A 3IYLW 4P7FA 5EC8A 2JPCA 2HQNA 4U7BA 2NP6A 4RTKA 1Z9CA 3LKDA 1U5TA 2UZKA 1ORHA 1W5SA 4ATNA 3F3XA 4L7VA 5E8GA 4OBWA 4EVIA 4QTUB 1TW3A 2C7RA 1JG4A 3OU2A 3FXRA 1BI3A 2G72A 3C3PA 1XCBA 2P5VA 3GUDA 2V1XA 3KQPA 1JQDA 2BE5F 4AUKA 1D2CA 2O03A 2H1RA 3UJ7A 3HVJA 1ZKDA 2H94A 4WWCA 1KPHA 2GXBA 5K09A 2QRVB 4L9VA 3HOSA 5MHTA 5H20A 4M71A 5DUIA 3PVCA 2FXAA 4RAYA 3NVKI 2RC4A 1QYRA 1BJAA 5A2QK 2OYRA 5HIMA 4KA4A 1TQPA 3KQVA 4HOBA 4P9FA 5CVJA 2JG3A 2BR3A 5T67A 3EUHA 3L09A 1MDMA 4NECA 5CVRA 4I7HA 3KP2A 2OBPA 2XROA 2DU9A 1TPYA 2MA3A 1QANA 1B42A 5L3GA 3P2EA 4QDJA 4XUEA 1KQ9A 5K0FA 4G56A 5K03A 2AZTA 2A61A 4AZWA 2HYGD 3P8ZA 4G7HF 4CO8A 2XHKA 1QAQA 5DRYA 5LQRA 3B02A 2ZULA 1F38A 1XDUA 4ER5A 3KLNA 2YUIA 2A3SA 1U2WA 4Q47A 2YX1A 4HBLA 1SUSA 3KQOA 3M4XA 5H6QA 1FBUA 1QZZA 2PX5A 3HHGA 4FGZA 3E23A 2YQZA 3T7RA 4EM1A 1UCRA 3E6BA 5D5UB 4ESJA 3E05A 1FJXA 1D3YA 3TQNA 1S6LA 4QVKA 5BMZA 2A6HF 4DCGA 2ZIEA 2LF8A 3KQMA 2Z3YA 1QQIA 3P71T 3KP3A 3WTUC 2D1HA 2MLKA 1KIAA 2Z33A 1KPIA 2FNPA 4DZRA 1IN8A 4WK8F 3MZHA 4ER6A 4BXUA 4LFUA 3IKVA 3DKWA 3U9GA 3FUWA 5LRRA 4G94A 2LSOA 5BS6A 2EFPA 4E31A 2JJQA 1HW5A 1L9KA 3UFBA 2K02A 3I59B 4EGZA 3IRRA 4V0RA 1IN6A 5LQNA 2BR4A 3PS9A 2V7EA 2HZTA 4KICA 1I4WA 1B4AA 5FQOA 3LCVB 4LJZF 1JG3A 1R36A 4XBFA 2EV5A 2NS0A 2D45A 1F4KA 1I1NA 2FE3A 1EJ6A 1KHHA 2CMHA 1G4DA 1DP7P 3M6UA 1BBYA 3CJNA 4MWZA 2PBFA 1YIOA 4ESFA 2JTVA 4DM3A 2QBYB 3GRRA 2ZFWA 1I9GA 2CO5A 3PB3A 2ZO4A 2ZIGA 3UWPA 1KXZA 3T7SA 4AZVA 2OZUA 1X1CA 2IW5A 5E2AA 3R0AA 5GIOE 2QZ8A 2CWWA 3FTEA 4XUCA 4QLCU 4FT4A 4ZZLA 2FK7A 3ELKA 1JHHA 2HTJA 1PP7U 5LRSA 3Q7EA 2VT3A 1VTNC 5DM2A 2L4AA 3F8BA 3GXOA 4PYQA 3ELWA 2F2EA 5LHGA 5K0NA 1EV7A 3B5IA 3KU1A 5DUKA 3FPHA 3IV6A 1JG1A 4U7TB 1Z6RA 3M1EA 4HF1A 5FA5A 5KYGA 1FYLA 1PP8F 1XCJA 3T8TA 4JK1X 3A27A 4EV0A 1Z3CA 3CLOA 3ML6A 3GX4X 1JR4A 2YXEA 3C3WA 5L3EA 3FXUA 4EKIA 2P41A 1NW6A 1USTA 3CTAA 1GVJA 5FD5A 2Q0OA 3ABUA 3THSA 2N47A 2P1DA 2I7CA 3JSOA 2I9KA 2BEOA 5IT9K 3HSFA 1PDNC 3V8VA 1SQGA 1O3TA 5BQTA 1XXLA 4E2YA 4GQBA 4CXFA 2PFBA 4O5VA 4E70A 4G6QA 4CTJA 4AX8A 2CFXA 5KK1A 4R8RA 1IXRC 2K27A 4OIQF 2YR0A 3WTWC 2XYRA 1XGMA 2P7IA 2MD5A 2YXLA 1LVAA 3KP7A 4MTDA 1VE3A 1VLMA 3DH0A 3OZTA 2DQRA 2HKOA 3NEUA 2HWKA 4X61A 3GFJA 2PJPA 4U0WA 5ICGA 4PYOA 1UHWA 1ZQ9A 1G60A 3G8AA 3SMQA 4X60A 4RGRA 3UJ8A 1YYVA 4YUYA 2HTSA 3KCCA 5M5BA 4HLXA 5HLGA 2EJUA 3LX6A 2VBYA 3REOA 4DQ2A 3EEOA 1E17A 4MEXF 5LGTA 3B3GA 2Z9OA 2CQKA 2DLLA 2JHAA 3WGIA 2ELHA 5CIYA 3FUXA 2OZ6A 5EGSA 3NWBA 4HF0A 1SMYF 3LA3A 3BDDA 5LGNA 5DYMA 3JWJA 2UZ4A 3W6KB 4HF2A 3FTCA 4E2XA 3KP6A 3G8BA 5DD4A 4Y2HA 3TO9A 2QQAA 5LGUA 2H09A 3N97A 4HTFA 2HV9A 1KQ0A 4BQAA 1EAMA 5BXYA 1MZBA 3DXZA 1FWZA 1X3UA 2JT1A 3ECHA 4Y17A 3OPNA 3EGVA 3T0YA 1MJFA 4IXAA 3F23A 1NE2A 2IT0A 1NW3A 2ADMA 1L3LA 4K6MA 4ZH4F 1R8YA 3Q87B 4YUVA 3OFKA 3GW2A 4YIIA 1VBFA 3QOWA 1XMKA 3T8RA 1B1BA 2ZWAA 4MHGA 5D5XB 1KYZA 2KRFA 2XAHA 5CJ9A 5E18F 3HCFA 3M9AA 4U0YA 3OE5A 2YSRA 2ZNZA 3E5UA 4RTJA 1Y0UA 3EVBA 1QBJA 3TOBA 3KR2A 4A0ZA 3J80K 1OMIA 1O3RA 4HG2A 1U78A 1BN5A 2GAFA 2Z6AA 3DUWA 3KPWA 5ERGB 3VEPA 1XD7A 3I9FA 1R6AA 4M6YA 3F8NA 3N4MA 4HYEA 3RW9A 1XGNA 2XKOA 3SSMA 5E1WA 3QV2A 3QPTA 3L8DA 3ORHA 4PYJA 3P9KA 3OE4A 3UA3A 5DCMA 3WU1B 1EJ0A 2UWMA 3EPPA 2JH9A 1N7JA 3HCBA 3OU7A 3K0BA 1KP9A 2KJBA 2NNWB 1P1CA 1EH8A 2UYQA 3CCFA 3KR0A 3PQJA 3H92A 2HOEA 2IGTA 1FX7A 1RUNA 1OR8A 4RTQA 1YUBA 3QOPA 2QE6A 1YZ3A 3IRQA 2LKPA 1FYMA 1O57A 2W25A 3Q9VA 1BIAA 1SD6A 4CHUA 3G2OA 3DTNA 4CYDA 2QYOA 5IH3A 1FSEA 4GYGA 1V3FA 4ZYHA 2PXCA 1TW2A 3K1MA 3M33A 4YUZA 1OR7A 4WXDA 4LK0F 3E8SA 5DTRA 3M6XA 5CCXA 5EZSA 3WE2A 4B17A 2FMLA 2O07A 2PX8A 2OPBA 2L4MA 1R00A 1ONVA 1S8NA 2F5DA 5EMJA 1WWXA 3U81A 3SZPA 1Z1DA 2AN3A 2FF4A 5D8LB 3E6MA 4KIBA 2ZKZA 1RJEA 2V9VA 5DCFA 4IRIA 5EEHA 2XV4S 3R6SA 4XUDA 4POOA 3G2QA 1RJFA 2J5OA 4R8HA 3EVAA 3TGNA 3FPGA 3F8CA 4FSXA 5D6FA 2AOVA 3BJ6A 2P8JA 4TV7A 3NTVA 3BGVA 2H6BA 5K5OA 3KZZA 5IKMA 5TRDA 4D0PA 1D2HA 3DR5A 3R3HA 3MAGA 5BPDA 4QWQA 2PJDA 2B3TA 2DW4A 2BM9A 3C0KA 4YMHA 1L0OC 3V7RA 2VODA 1X1BA 2ADUA 1ON1A 3OOPA 3NW9A 5E20A 4RAZA 4OMYA 1XSDA 2GXGA 1B9MA 2FHPA 2HEOA 3GIWA 4OIPF 2MH2A 1VPTA 1SFEA 3RPUA 3RPQA 1NV9A 3EVGA 3WTVC 1YZHA 1FPQA 3LSTA 1AF7A 2FCAA 4BHPA 1KGSA 4GC5A 3ZP5A 3BGDA 4LWPA 4M36A 1MJ9A 3ABTA 5LEKA 4KT5C 4EKGA 2ZNYA 3ZMDA 3LQQA 4Q4ZF 1G3TA 1D8JA 3DLIA 2OY0A 4GF5A 3GJYA 4C07A 3E6CC 5D1NA 1MJAA 4LMYA 3R60A 2KIFA 4M38A 1VQ1A 4A5NA 1XGOA 3DP7A 3DF8A 1FZPB 3EYIA 2W85A 3COAC 4ZYDA 1SUIA 2V79A 1RNLA 1X1AA 3L00A 3A4TA 4M9XA 3OU6A 3KPVA 2PWPA 3ZPLA 2XYVA 1UHMA 1IZ1A 4EM0B 2IA1A 4WVLA 2LNBA 2PMUA 3HRUA 2GA9A 4RGXA 2BBYA 3HHHA 4E2ZA 1REPC 4OA5A 5C0OE 2JRTA 4LB5A 4NQWA 3BZBA 2JZYA 3JWHA 1JGSA 4GCVA 1NW5A 2HFHA 3BP8A 3C6MA 5HIIA 4RVDA 2ZZKA 2XASA 4DKJA 3DMFA 4GO1A 1IF1A 1XMAA 2ZMEB 4O3MA 2XVCA 4IHSA 3MFKA 1KA8A 3TO6A 4EQZA 2OQGA 2FBIA 1Z7UA 1P6RA 1QZYA 1ZREA 3SHFA 2K7LA 4RVHA 4UHTA 3RDIA 2IP2A 1WXXA 3SXJA 2IIPA 2G7HA 2FBHA 9MHTA 4RB3C 4FX0A 5K0BA 3R4KA 3GZ5A 1W5TA 3MTEA 3FUVA 2ETHA 2W57A 3GFIA 4R6WA 3KFWX 3F21A 3EVDA 3KPYA 3CGGA 1U5TB 1USSA 4KVZA 5K5RA 2AVNA 4G8XA 1D5VA 3LL7A 4M6XA 4BLWA 4AZSA 3TO7A 3W6JB 2FBKA 1DUSA 1ZGAA 1IW7F 1TQMA 4F85A 4OMZA 4IWNA 1DPRA 1YFHA 5BPIA 4HRAA 2EFWA 2Z6UA 1XN7A 3K9TA 1I27A 4KIFA 5F1RA 1ZLJA 1XDZA 1TLHB 2HR3A 2OB1A 4PWYA 3DPLC 5E1OA 5EOVA 2DT5A 2YX7A 2G70A 4EJUA 2FMYA 1RUOA 3EVEA 2CSOA 4YFXF 1SD4A 2ZW9A 3V97A 2P40A 4CXMA 3QU6A 2V6CA 2EK5A 3ELYA 2VXZA 4C4AA 4QPPA 1PUEE 2QENA 4R8SA 5P8WA 3GGDA 2PGXA 2CG4A 3G73A 1P92A 3M6WA 4Y30A 5FQNA 1EG2A 3RI4A 1I1GA 5FCDA 5GM2A 1H1DA 3WTSC 1AQJA 2B9EA 1KR5A 3JW4A 3ER8A 5DSXA 2VOOA 1IXSB 4QQKA 1EH6A 3KEQA 2VE9A 2EX4A 2O3FA 2PV0A 1IUYA 1VP3A 5LQAA 2P4WA 5D1HA 4BH9A 3HVIA 1NKVA 3WE3A 5EIFA 2IBTA 1J0RA 3NVMB 1FC3A 5J8FA 4M72A 4I2OA 3LPMA 1R1UA 2MLGA 5DT2A 4E2WA 3DQVC 3ERED 1BHJA 5FADA 2DQLA 1W7PA 2Q8KA 3T1BA 3ANXA 3GLXA 1ON2A 3B7PA 1G8AA 1S7AA 4HX7A 5HLHA 3HVHA 1JHFA 2IDKA 5H6RA 5HVQC 1RIOH 1AWCA 5CUQA 3KQWA 4IF4A 5EIWA 1HKQA 1NBHA 5CVUA 5JFRA 2HYFA 3I59A 3LDUA 3K1NA 4YFNF 4EM2A 3D5LA 1NW8A 3VC1A 3FWEA 3H2BA 3DMHA 4GOND 5LQJA 2YX4A 2E5WA 2QQ9A 3FMQA 3FHZA 4L5IA 5DPMA 1P4AA 1RI3A 3ULQB 2Y0MA 4P9UA 1LDKB 3OV8A 2QM3A 1YS7A 3BKXA 3DV8A 3GO4A 2DULA 4HTFB 3J7AO 2NNNA 4P7JA 2P5LC 1VL5A 4ER3A 2X4HA 4DMGA 1EH7A 1Z05A 5FFZA 5K05A 5JI6A 3V7SA 4Q48A 1B9NA 5H02A 5LHIA 4IJAA 2B78A 3UJDA 3ZMZA 4MTLA 2C7OA 4A6EA 3EQLF 1SKMA 5BOXA 5EKUA 3HYIA 2FRHA 5AIQA 3GRUA 1T2KA 1T39A 2IBSA 1QO0D 1FBNA 4PDKA 3KQTA 2KW5A 4KW7A 4HQMA 2OXTA 2RKHA 4RGUA 3ZMSA 2E1NA 1WY7A 4UXNA 2FYTA 1FT9A 4YMGA
chains in the Genus database with same CATH superfamily
1H23A 5E0OA 4JV5B 1CVLA 3GLRA 4YQFA 2HT1A 3QRWA 1DAHA 1Q1GA 2FB9A 3HM2A 3LL4A 4C0BA 1PQYA 1Y7IA 1TVCA 2VUHB 3AFNA 2P6NA 3IA7A 1NN0A 1SQFA 2QOEA 3DQQA 1BNCA 4KH0A 1D1QA 4X95A 4TZ0A 4RTLA 4ON9A 1TF5A 1UPTA 3H4TA 4DA6A 2WQ6A 1TM4E 1IOZA 4CG2A 3UNGC 2BGKA 5EYPA 4CU5A 4DV2B 3DLTA 5CB6A 1TAHA 5G4KA 4BBPA 3H3JA 4DQVA 4L6CA 4NV1A 3PWKA 1U8XX 5B3JA 2A1TS 1GEEA 4F9EA 3F8MA 2I2BA 3G2LA 5K0SA 3QNMA 4R41A 2DE0X 3EDQA 4RJIA 2CGEA 4WLOA 3H5IA 4ALIA 2OTCA 1DKNA 4BNLA 4KLRA 1OX4A 3ED5A 4WOJA 1YT5A 5A06A 5JDIA 3K15A 4X6UA 4RWEA 1DIGA 5GZ1A 4D25A 3TR6A 2WLTA 3TIVA 2ZM5A 2WG1A 3HY4A 1FQWA 2EW1A 1OCZH 2KBFA 4XRGA 4PYNA 1VKZA 4J16C 3AB3A 2O7SA 3W7BA 1RLJA 3BZCA 2JEOA 3KOWA 4XEUA 4CHGA 4LLNA 1FNSA 1N5LA 4UVBA 3HPHA 1RC1A 1AN0A 2WOOA 1QK4A 4BBAA 4QTRA 2X5OA 3JATA 4J9VA 5J1SB 1T98A 3ESZA 4AG3A 4RV9A 4RAGA 3RTEA 3U9SA 1TJ3A 3TQFA 4B3JA 4M0UA 3NTUA 2VQ6A 4Q12A 3PL1A 4PGGA 2FK8A 5K8TA 3IP4B 3ME5A 4TX1A 2YJNA 2CJJA 1ZH5A 3KTDA 5AXDA 1FF9A 1V2GA 3WMWA 3R74A 3O8OB 4CMAA 4DY6A 3RVKA 1L2TA 2WYUA 4AC9A 4P3YA 1M0TA 1JU9A 5B6PA 3AB8A 3N86A 3TLXA 2ZTVA 1V4RA 5L3SA 4RNDB 4AYTA 4E7LA 1O9GA 3UR3C 1N57A 4BE2A 3MUFA 3C1DA 1X42A 4WKCA 5KDDA 1LE8B 3GLHE 2I4LA 4RA9A 3W3AH 4A3KJ 1T6SA 1E7WA 1YU6A 1W7PB 1C4KA 1RABA 1GGHA 2B1RA 3HCWA 4TT3A 3Q7SA 3VBEA 4RK0A 2OG1A 3SK0A 3RJMA 3AU8A 4QUAA 4AICA 4DMMA 3BCAA 1TUBB 3PNYA 2C5FA 3I23A 2NO6A 4K0KB 3WLTA 1CQJA 2BV6A 2JMWA 3N2KA 4OVKA 1XAGA 5ALIA 3RH0A 3JD4A 1Z2NX 4FX5A 4BLOA 3M07A 2PYZA 4CCYA 3RJZA 5CAEA 4E6PA 3KZNA 3WU2C 1YB2A 1ND5A 2XH8A 2A3NA 2M87A 1A27A 3H3XA 3FSEA 1DL5A 1J59A 4JP2A 2F43B 3U7RA 3HKBA 3ROKA 3FUCA 1C7ZA 1F0PA 3LYLA 4AIKA 2HJHA 4H4KC 5J4VA 2IEIA 4H1TA 2QVOA 1INLA 1NIPA 4DQUA 3WDLA 5DTDA 2JAWA 3M1AA 1IFXA 2PZ8A 3CX6A 3FK7A 2PXAA 3HFJA 3M9LA 3P2MA 3TW8B 3KOZA 1IYZA 3KKQA 3NIFB 4WUVA 3GLUA 4GWKA 1WUYA 3JQQA 3C2HA 3IBFA 5FGMA 5L6LB 1CR4A 2B83A 4OATA 1O0CA 4XD7A 3HCEA 5CLSA 4KR9A 5KJ6A 1YF3A 1V8BA 2RBKA 4G6TB 3FDZB 1HQDA 5HMMA 2P67A 1P75A 4DA7A 2CFSA 2W4MA 1FX1A 2YC4C 3ENWA 2P30A 2J6IA 2AOXA 2DA1A 2Y76A 3E7FA 1Z6XA 3IPRA 4JEHA 3H65A 4GXTA 5CJPA 3BX1A 3C97A 2HLPA 4DQKA 4EG4A 3GLFB 1OCEA 1HSOA 2JBAB 3DE7X 3Q10A 1A5BB 5LR6A 1UJMA 2GZDA 1R50A 4FS8A 5G1OA 1JXQA 5L4LA 3DAGA 4YO8A 1O5IA 3IV5A 1W9MA 2ZSFA 1HFWA 2YXDA 4XUGB 5A4MS 4P53A 2QGZA 4EB6A 1LF5A 2OHXA 4M1TA 2HX1A 3J81Z 1CRWG 1FYXA 1A77A 1L5VA 2A6PA 3KYBA 4G2NA 2YJGA 3EWSA 4UU0A 1EBFA 2HU2A 2HC9A 3AUKA 2D8AA 3WA7A 2ORED 3HJHA 4URFA 3RC3A 1CCWA 4AM8A 5AXBA 2P91A 2FW8A 2WJ3A 5BSHA 2I6GA 1QOPB 3ZQHA 1CG6A 3C7KA 4AG6A 2MR5A 4A15A 2GD6A 2FPOA 4UPEA 1MB3A 2PXXA 4XA8A 1AQUA 3JYNA 4JX8A 4AYWA 4Q9AA 4LUCA 1VIMA 4F46A 4KG7A 1VDMA 3SD7A 3WGQA 1QZ3A 2QMZA 3OH8A 4GSKA 2H3EA 3ZWXA 3AR4A 3ZN1A 3T06B 2IP1A 4ESEA 3CRNA 4UQPA 1JE8A 4I1VA 2OYSA 3WWYA 3LY9A 3PEEA 1F2UA 3UH1A 4CEHA 2O05A 2J5RA 3TSWA 4AURA 1NZFA 1MAVA 1XZPA 4HZGA 1GAXA 3UCEA 2P4UA 2QN1A 5K0GA 5BQOA 1N2GA 3IP6A 1YQAA 2WK1A 4O2AA 1I0ZA 4YQYA 1Y48E 3H9QA 2J41A 3F5FA 1NT2A 1QH8A 1XB2A 1RT9A 3LXMA 2H1OA 4COKA 4DQLA 3T9CA 4KQ6A 4Y2QA 3TRFA 4E1BA 1WETA 4RA6A 1TLLA 2J3MA 2H9YA 2PRSA 4HGRA 2IWHA 4C7KA 1X13A 3AGQA 5DEIA 3RS3A 1QKKA 1MNDA 2D5VA 2O2GA 4RC9A 3JPWA 5FBZA 3ZG6A 1BC5A 2Q5HA 1QVRA 4MSUA 3Q5FA 3FCCA 3VHLB 3DG9A 4XSZF 2Z8YM 4Y18A 3RFUA 3CMEI 3ZMVA 2ZUDA 3ABRB 4R2JA 1I7DA 3F9IA 5TQ2A 4MYCA 2VJAA 3TINA 3KRTA 1SUCA 4R3UC 3PSAA 2JPBA 3H3ZA 2A0XA 2O7NA 3Q3CA 4JP3A 3AYXB 1Z39A 2HSGA 1H2BA 2CVHA 3AKDA 3DVRX 3GJ6A 5KTOA 2NYXA 3VKUA 2O59A 3FYCA 1SFRA 2V03A 4RETA 2BCEA 1WQ2A 1Z47A 3I8SA 2IV7A 4ZYXA 3CSSA 1H0MA 2VQFB 3F2IA 3X0DA 1J56A 1MGTA 1RLUA 2EWMA 4Q15A 4HC4A 1ZVQA 3G5TA 3VOAA 4DQ0A 2J1LA 2ALJA 2O8BA 1PJZA 1YB6A 3A7DA 3ILVA 4AYBA 5JE8A 5FV7A 3AWIA 1SA0A 5H2FC 1S3SA 3JZIA 2VJQA 3A14A 3EXFB 3CLSC 3I30X 3VNSA 4QJ5A 4CCNA 1BO6A 2QLMA 3DYIA 2VZ0A 1JJ8C 1GXSB 2EIXA 1YITI 4R1LA 2JJ8A 3UGKA 3W1EA 2HRCA 2P9ZA 3GRFA 3T9EA 2ECFA 2MYPA 2QTRA 3WYNA 3FOEC 3ANNA 2ZRQA 3VR1A 1YBMA 3DMDA 4ZALA 1KAOA 2BKUA 3PHCA 3OLQA 1TA9A 1Z33A 4XIGS 2K3PA 2BM1A 2AF3C 3HUDA 4WFKA 1SKBA 2QJRA 4J4HA 5BNWA 3GFBA 4OAZA 3NH9A 1Z16A 3LUGA 1L7BA 2C88A 3BFKA 5FLXZ 4J01A 3RLIA 4D5FA 2D0OB 1LE8A 3IEUA 4D2IA 1K79A 3B2QA 1MBEA 3GNLA 5TQ0A 4XLCA 1MAHA 3C6QA 1RPZA 1PYOA 5F76A 1QPZA 2UVDA 5KINB 4E6KG 3S2WA 4F91B 1QE3A 4LIPD 5T8KC 3IXLA 4LBVA 4QUKA 2ZJ8A 4BVEA 3GO5A 1V41E 2X8AA 4F1WA 4QYXA 2FWBA 1NXWA 3ZX5A 2C57A 1U1DA 3OYLA 1DCTA 1A31A 5H1YA 2VF4X 2X6WA 1GN8A 4QU9A 4C3UA 3U2QA 4MI3A 1JX6A 4IG4A 2JBHA 4FE3A 3VTKA 4LC9A 3RE1A 4E46A 1ZINA 3GVHA 2FZWA 2X2OA 4DW6A 3C2QA 3L06A 2X42A 4BO0A 1BU8A 3HADA 5L3DA 4JJZA 3MELA 3TTVA 4BJ5C 4J7XA 1SB8A 4ISCA 4Y9DA 3ZN0A 2H5LA 521PA 3SBDA 2Q3HA 2VIXA 2D1VA 1WZ2A 1Z8NA 4I01A 5DDGA 3GRZA 4QGBA 4EEKA 1K8YB 1NVUQ 4HDNB 4FQGA 2ZJQF 1P80A 4U7WA 1T38A 1E2UA 3QHAA 1X70A 1UKAA 1UANA 3K2ZA 4ZI3A 2Z3WA 4B45A 4F6LA 4CV3A 1P9WA 2PSFA 3JQ8B 3OPYI 3OZSA 4KQIA 4IJQA 4NJMB 2AQEA 2N8GA 3C5HA 3EIQA 4PPFA 5KVAA 3W8FA 3PNKA 3DHEA 3EZXA 4FNMA 2IOFA 2F9LA 2VJKA 4N3NA 1IN7A 1E3EA 5ED4A 1UBFA 2FZVA 1JRLA 3FISA 4M1EA 2WTXA 5AM1A 4QYTA 3G5AA 3Q8WA 4AJEA 4K26A 1R4MA 4QUJA 4KREA 1G8MA 1AS2A 2Q5JA 3H2ZA 1QX4A 5FB3A 2XLBA 1Q2UA 4PNHA 4QGGA 3GCDA 2LY9A 5F5NA 1QH9A 4FHEA 2HCJB 1K86A 4ILEA 2QE7A 5TPZD 5LYJA 3BCUA 4XGKA 1XPXA 4R9SA 1WPQA 3H3VK 3ELBA 2G08A 1QE0A 1XPJA 1VXOA 2FUCA 1UBLS 5F6FA 1RHQA 2GK3A 3H97A 1ONNA 1CUZA 4UDXX 3K0LA 1SULA 4ND8B 5IVDA 3VMFA 2F55A 4H4DA 4KSYA 3UMBA 2WF8A 2ZSJA 2WMOB 5DRTA 1K88A 1KJNA 4OK6A 3R20A 2WJVA 1RAIA 1QHXA 4E7ZA 4JP5A 3IQEA 3IWFA 5JD4A 2CW7A 3ZWDA 1FW8A 2IVMA 2NIPA 1R8XA 2P3OA 1IZYA 1QQ5A 3NANA 1WZCA 2GN1A 4U7GA 5IBPA 3R76A 3A1CA 3ZV3A 1EBBA 4KQMA 2X0JA 3PJFA 1QGDA 2PM8A 1I4OA 4O4HA 1RETA 1YC5A 1WXEA 1PZXA 5I8PA 3FNEA 3EQ7A 3R8XA 4LK1F 3IE1A 3PSHA 1Q2XA 4B6SA 1W75A 4RHCA 2R84A 4OMCA 1Z0FA 4Q9JA 3NO4A 1JDBC 2ZWPA 2KDZA 1RI2A 1DKMA 1II8B 1VFCA 3INNA 3II6X 4HYYA 4PAQA 3W6PA 4KN7X 1IZ8A 3KAQA 2Q7DA 4ZMBA 3PGLA 1LDYA 2F4MB 2UVPA 4CIAA 3RU2A 4PIPA 2RHRA 2GF0A 1MPXA 3GRPA 5ALMA 1G6OA 1RLOA 1SUBA 1RAHA 2YW9A 3K92A 2CDRA 4MGIR 4TKZA 2DQZA 1FSZA 3TDZC 3FETA 3L7DA 4PSUA 2IHTA 3BTCA 5HS9A 1P31A 1QQTA 1J9GA 3GEMA 1X9HA 3RCBA 3KQHA 3ROXA 1CQIB 2IFTA 10MHA 2HHCA 5E8IA 1BCSB 2AJBA 3JTEA 5EFZA 1XCGB 3OYGA 3MQ0A 1DADA 2GBLC 5AKIA 5IAEA 1CR2A 1IJWC 1VFPA 2FFHA 2O8XA 2ZBPA 3DU6A 2C59A 3EEYA 4Y98A 3GYBA 1FC0A 4WZBE 2VDVE 5ELXA 2QL6A 3H5TA 3RRZA 1E9DA 3KYCA 1RR6A 3O9ZA 2JGKA 3ZCXA 2JW5A 4JKYA 3OIYA 2D62A 1U02A 4CCWA 1CUEA 1K4YA 4Y1EA 5F2OA 4EHLA 2E1CA 3DCJA 1WJEA 4W7HA 3RBVA 2X6OA 4ENJA 1FUIA 4PAGA 3M8FA 2IL1A 1BX1A 1N2CB 3OEYA 4KLZA 2R97A 4MGEA 4QDKA 1U9OA 5TS2A 4HS4A 2H27A 1QTNA 3M4YA 5EUMA 5I8ZA 2W43A 2R11A 4WTOA 4UOZA 4LSZA 1UBHS 5BN5A 3M5DA 1Y4SA 3VQTA 1H65A 2R44A 2G8NA 5ECWA 3KQNA 1F5TA 2BHZA 3K3PA 1PDWA 2DVMA 1PBTA 5D5QA 4U5QA 3GAZA 4GG1A 2VBXA 1V5EA 4HATA 2IBDA 4F8EA 1OV4A 1XXHA 3AI1A 4AZ0B 1TCCA 4OY3A 4DVJA 1LBIA 3DLAA 4A3BJ 2W6JD 5IYZB 1CKEA 1E5VA 5JJBA 4K0RA 3RT7A 4B3SB 3MNFA 1M6VA 2OVBA 4YJKA 5AJTA 3EZ2A 1U5BA 4J29A 1WZNA 1YTYA 1TOAA 2ERYA 1PLJA 1RKVA 2RC6A 4LYFA 5FNZA 2QPTA 3FOCA 3HSYA 4DILA 4D3FA 3LSRA 3OTOB 4XICA 1BG6A 1O95D 5DV5A 1UKBA 1H3EA 1QG2A 2OMKA 4YLYA 3S29A 5LKAA 1XYVA 3K69A 2Y0BA 1FK8A 4ZVNA 4CCOA 3S2FA 5K3SA 2RGYA 1VIDA 4DGSA 4L9JA 4U63A 5EA2A 4B82A 2FWIA 5EMLA 3EN0A 1NR5A 2DAOA 1B1CA 3E22B 3FPJA 3OC0A 4QG7A 3EASA 3VODA 5EZYF 1YHNA 2J0EA 3FBWA 4ZPXA 3P0FA 1BC7C 3GCXA 1IAVA 2EHJA 5J1RA 3RYTC 2CRGA 4YPFA 1E0EA 1Z75A 3I0MA 2CC2A 2YS9A 3SBEA 2JBAA 4RUKA 3B5JA 3Q2OA 2VJ4A 1SR8A 4BAUA 3EXG2 2ORIA 3CRZA 3S6JA 5FI3A 1GFIA 1SU8A 2W2KB 5HS8A 4J94A 5T64A 1GRVA 5LHHA 2HPZA 2BEKA 2A5FA 5HIKA 4TLDA 1R10A 1TIPA 2QX8A 4BJ1A 4WRRA 3U56A 4IH9A 5K5EA 1L5SA 3QPBA 1WMBA 2YINC 2XRFA 5E3JA 5KVQA 3WA6A 3W6ZA 5KU7A 2OB2A 3I6QA 4IQ8A 3PPWA 1GZVA 1AB5A 3VMMA 1GARA 4LXGA 2SECE 2AMLA 1A2QA 5EXXA 5B64A 5ICMA 4URYR 2PNFA 2IHNA 4PCAA 1MDFA 4FP9A 2EA4A 2YWGA 1AUPA 2VL8A 1RWOA 1O7FA 3X1MA 1YW8A 2DOAA 1T4CA 1IDZA 3SF8B 1YQDA 5B6IA 4UV8A 4A3LJ 2HN9A 2Z30A 3DULA 1MHPA 3GGJA 2WAQA 2F5CA 4XQFA 1ML3A 1XTKA 2I71A 1DXOA 3N7TA 4QE3A 5CNKA 1O95C 2JFPA 1TGYA 3UM9A 4BMPB 2NTVA 1MJ5A 4N47A 1GKUB 3D6HA 4R1OA 1HE2A 1T1RA 4EZEA 3N6VA 5IJXA 2XAQA 3WV5A 3EXIA 5JC8A 1G18A 3ONEA 2UXBB 4JKOA 1EWVA 3FM5A 1LPQA 4NVRA 2LBFA 2IYLD 4CJXA 3ET4A 4FINA 3O8RA 1NV8A 2IYRA 3TOZA 4BUJA 3SFZA 3MOGA 3QM1A 4MVYA 3T8YA 4AMZA 1P2FA 3QXGA 4P5PA 1J07A 4E5PA 3H87A 2XSZA 4XM1A 3N2LA 2O1SA 5GV8A 5CH5A 3L4BA 2QN3A 3TP3A 4HXYA 3I4PA 1G3UA 3SY8A 4LG1A 3ITNA 4OJMX 4QRDA 2NZWA 2NVUA 2H8RA 2RB5A 3KFXA 3DAOA 3MS4A 4N48A 4PX9A 4EY8A 4JVSB 2HLDA 4JI0B 2ARKA 4B3IA 3IR5A 4R3NA 1J8YF 2R7LA 2NACA 5C7OO 5K4HA 3WODF 1I1HA 2DA7A 3H1FA 4ZOBA 4BE9A 5DHTA 1G1AA 1H6DA 4IZZA 1HDXA 1MXFA 3ACCA 1B8NA 2M1BA 1L7NA 4RFSB 1BKSB 3A9CA 1T8UA 3R7FA 1OTYA 5FRMA 1XA3A 3LHSA 4XD7D 4A1OA 3DAPA 1G6NA 3OQJA 4HUJA 4V24A 2QD3A 5HFNA 1PNQA 3AQIA 1RCFA 4M49A 1Y3HA 2B1QA 3CZRA 3M1YA 4P3PA 1W2WB 4PPGA 1LZLA 1K6MA 2RCYA 2Z16A 1G63A 3GH1A 4JI4B 4X45A 4FFOA 3MWFA 5D3MA 4J7CA 3TZHA 1UAGA 2E18A 4OYRA 2JHPA 4TV9B 2CLSA 3AIKA 4OK3A 1RI1A 3ABZA 5BWLA 3QVVA 4V3CA 1QWOA 2O3RA 2QRZA 5TJJA 2VH5R 4JS0A 4LYJA 5E9JA 3U13A 5LP6F 4IVNA 2JFOA 1T5TA 2WYIA 3SXUA 4L5AA 2I66A 3D0QA 2E37A 4R2LA 5C1PA 2G5GX 1WHUA 2Z99A 3HPGA 1CP2A 3DF7A 4X44A 2GFHA 4FJ1A 1QIFA 4C0QC 1GU1A 1TJYA 4CM6A 4RVGA 1OKKD 2QL9A 4ASNA 3C5VA 1LNSA 4LDJA 2DMTA 1BEEA 3DFGA 3OZRA 2H54A 1G5HA 1G5IA 5IYZA 1I7SB 3ESXA 4B3CA 4JYAB 4DLBA 5FFXA 3IO3A 5FO5A 4QBKA 1U0BB 4YJFA 4C4XA 1V11A 2I65A 4H0EA 3LFHA 4CL0A 2G71A 3GT7A 5KVRA 1CR6A 5DM7F 2IS4A 2DFEA 1I2DA 1ZKMA 3BBLA 3EEQA 4IGIA 3VVLA 4QTTB 4TLEA 4K9OA 5FFMA 5FLKA 4C5CA 1GLGA 5ERXA 1E1QA 4MFEA 4F5WA 1R3UA 2Z9CA 4DAOA 4YT8A 1I2BA 2O48X 2HA7A 4HUQB 4O5OA 4DUPA 1FFXA 3A37A 4ARCA 4IHXA 4X8OA 2XAGA 4M9ZA 2HA5A 2QR2A 4LXYA 4M99A 5DLDA 3ZXIA 2BSAA 4BNJA 4MQBA 3RSQA 2BBTA 1P1RA 3G5LA 4G6DA 1YMUA 5BYAA 5IY5H 1IWOA 1I1OA 1Y5NA 4ZI7A 4L75A 2ZSUA 3OQIB 1LXCA 1WEKA 3HXMA 4LV8B 4XTCS 4P84A 5CMLA 1BOFA 2GEUA 4KJZA 2PBIA 5HOOA 3BF8A 3SCZA 2ESHA 5JCOA 1P1JA 2MC3A 2Z5LA 3UHJA 1A8HA 4QDXA 4O29A 1TD1A 3I28A 3UMSA 4D46A 5A4IS 4TN5A 2MBFA 3KEGA 2QUFA 3M5CA 4E3WA 3SN6A 1SCUA 1YTLA 2FPPA 2YMLA 3F5QA 4OUKX 2OBFA 5DM4A 1LLQA 1EXDA 4GUDA 4ZP1A 1NRXA 1OYWA 2CUJA 4A93J 1M10A 2VDWA 3GAFA 4AIHA 3OI7A 5LYJF 4M76B 1W0UA 1UWCA 5DASA 9ABPA 1OX6A 3N0XA 1FEZA 1ONBA 2K9NA 1Y6QA 2CNKA 3C8DA 5BWBA 4AULA 4PFSA 2ZI4A 1M66A 1NVVQ 1E89A 3R6TA 5KYWB 4GPD1 1UXJA 1LJ8A 2IOFK 3GK3A 3QJ5A 5SZIA 3Q72A 4Y2SA 2JGJA 1LEHA 1OLXA 4BMCA 4QDZA 3U1TA 2XPVA 1BA3A 3E2MA 3FTQA 3ES9A 3HJTA 5G3YA 4LI3X 4JX4A 2NTNA 4GYWA 1FFDA 1G21B 3RREA 3CISA 3KT3A 1GGMA 5FHQA 4PCQA 4QG3A 4CICA 4K6CA 3A03A 5J1YA 3FMOB 3OX2A 2QVYX 2NSYA 1D3AA 1ORVA 2NU9A 2HI3A 1FSSA 3OOJA 4W7IA 5GPBA 3MHPA 4A8TA 1G3QA 2V58A 4OP1A 4C0JA 5DM70 2JLUA 3PR3A 3DMGA 1P1FA 4ENNA 3EQ2A 1QKJA 1TM1E 3A3NA 3RZOJ 2HADA 3QG1A 3BA1A 4MQFA 4RF5A 1T5LA 4FHZA 2FPMA 2JK0A 2IU6A 2K87A 2ZCVA 4IIHA 5FL3A 3L77A 4IDNA 4CZ2A 2QMUA 4J8PA 2I3AA 1BM9A 1RWNA 2W2LD 5CCBA 5AD1A 4Z3OA 2X6YA 1CJBA 4I6JA 1W581 3FRHA 4HQ0A 2YWDA 3LECA 3WICA 4LOHA 1KJQA 3AVUA 4ETSA 4KQFA 1GPNA 1DC5A 3BK1A 5B36A 5GINE 2UYHA 3DCFA 2BFCA 2R7ZJ 1LW6E 4KPUB 2BN4A 1MKYA 2DHEA 2XT9A 4LLGF 3EIFA 1YQEA 4QYSA 3QW4B 3I2IA 4UZFA 3V3KA 3EJWA 1YZUA 4CNQA 1HE8B 4LE1A 2WY8Q 4W5WA 4B8YA 3GLGE 4P96A 1R7RA 4I81A 3L1VA 1NAHA 1DAIA 3HWWA 4ESVA 1ZIPA 2CUTA 2ZB9A 3LQFA 1V45E 4XARA 3OYNA 3C39A 3NHFA 3P2KA 3WHPA 3Q8MA 4FYWA 4U8HA 3KXDA 3C98A 3Q3IA 5G0VA 4PEVA 4D9BA 1K9VF 3FXQA 2W58A 4GOXA 3T1VA 5LD2B 5K0ZA 2FN3A 3DTEA 3Q5EA 2ZE6A 1NDQA 4WINA 2ODWA 1TCBA 3EBPA 5CDFA 2BUBA 4RHFA 2WJ6A 5I4IA 2LCIA 2PSSA 3CLUC 3GEEA 3EPLA 1KO4A 5I48A 3E9EA 4MO9A 1TO6A 2PGDA 3BXGA 1QP4A 2O5CA 5H4HA 1PUFA 1F1BA 4F3YA 1Z5NA 3K4QA 4CSWA 4MVJI 3FYUC 3WJ7A 2I33A 1SUFA 1IH8A 1YFLA 4NRDA 4RZIA 4EY7A 2XB4A 2GWRA 3FCEA 5LIPA 2WJ4A 4B6QA 1J23A 5KQSA 3NV9A 3CKMA 5GOTA 1D1TA 1M72A 1LPMA 2ZYRA 3V2UA 1DCMA 1VHTA 2PZFA 1GAQA 1E2MA 5C8DA 4WX9A 5IXSA 1C3OB 4RM3A 4Y4RA 2CKDA 2ODTX 3THWB 3EBOA 3R6DA 2BH9A 4JGBA 1A8PA 4Y15A 1OR7C 1FY7A 3BR2A 1C8VB 1ZM9A 2HRBA 3HBMA 4HYTA 4A03A 2CDNA 1EFCA 4C06A 4LMRA 1I10A 1R0WA 1KE2A 4U39A 3DHYA 4KODA 3WO1A 4DMUB 4CT5A 4HV4A 4B8WA 2Y0SA 1DS6A 2AOUB 4DWJA 2GPJA 4ID9A 4D42A 2IOYA 4IDBA 4MMXB 2FMUA 4FB4A 2OAZA 1YBVA 2M0CA 3CJRA 3CNLA 1I2ZA 3QE4A 3MBOA 1APLC 4MIEA 1XTBA 3GELA 4OD0A 4Y1FA 3TOSA 5FBRB 2RJNA 3V1NA 5IXYA 5DGCA 2I91A 1WNTA 2ZRDA 5FP0A 2GK6A 4KTVE 2CZCA 4OBXA 1CEEA 4BMXA 4LGMA 1A82A 4HQLA 2C58A 2CLOB 4RDCA 4D9EA 4MS4B 4ZYLA 2ISYA 2LTPA 1W30A 4EECA 4ANJA 2A07F 1PJ3A 4YREA 5COQA 5JJCA 2E3JA 4A6DA 1FJHA 5HA5A 4TM8A 3E3NA 5JJLA 2W2MA 4IVRA 3RVNA 3TQSA 2GXAA 1M83A 5AW3A 3WDMA 1SBHA 5CD9A 2Y8EA 3EFEA 4IWYA 1SCBA 3E9YA 4J0CA 2NM0A 5U1PA 4TYQA 4XOPA 1CF2O 4ER7A 3OD1A 2OZPA 1A97A 1UM9A 1SBIA 4B87A 4CTMA 2ONZA 1IBKB 2IT1A 5BSWA 4B4WA 4U88A 1LVKA 1OFUA 3BT9A 4C4YA 4EB0A 4Z54A 2HCRA 4RTMA 1N4DA 3F5MA 4RQAA 3K05A 1XQVA 3LGAA 3V2GA 3VNAA 3MEQA 4JA2A 1PZHA 3QEOA 4R1SA 3K2AA 4M73A 3E2IA 4HDRB 4ALMA 4C7BA 2QI9F 4MP3A 4HEJA 1QMPA 3D81A 3UOGA 2ZT5A 4XTRA 1LUJB 2BPOA 3NC0C 2WAQN 3WQRA 1LI7A 1G2QA 3DLCA 2M6SA 4DGQA 2JA5J 4B48A 2JRLA 3LF1A 3QXJA 4PX2A 2C8VA 4DIEA 1KH1A 3UHOA 2VHVA 3D4PA 4K8OA 5F77A 2AG5A 3ZK7A 1V4NA 1FU7A 3DMPA 5K01A 3SI7A 3L7JA 3AZOA 4C7XA 5IZCA 1QVZA 3Q6MA 4WZBA 4GFBA 2HOQA 3EK2A 5IDYA 4L0ZB 1IVNA 2P69A 2JFZA 3BQMB 4PLFA 2GERA 2Y77A 1HF3A 4JXKA 5IAKA 4ZYGA 3MWMA 4X1IB 2GCEA 4L0QA 1FLNA 4AUMA 1WULS 2AC4A 2EERA 1NNEA 3UKJA 2YCLA 5TARA 3OFND 2GZ2A 2PN1A 2ZSIA 3QVMA 4IICA 1PDOA 2VT2A 4IILA 2P6MA 3COYA 2HO4A 4L1KA 4ZIRB 4XONA 5EAIA 1LPBB 2V98A 4FFSA 4X1KB 3TQCA 3GNQA 2VC0A 2C04A 3PKJA 5ITZA 2BR5A 1OLUA 1NBMD 3IBCA 3VH3A 4HQKA 4KAFA 1NHAA 1CZLA 2X5JO 4WZZA 2NN3C 4L73A 4K5QA 5CG2A 1L4UA 5LIRA 4H2DA 2XRLA 2BF7A 4ZZDA 1M0SA 3DLPX 2M45A 3MHTA 2AH5A 3G2IA 4KTTE 1MZPA 3GJTA 2QSZA 3NOVA 2XNDD 4PYKA 2C96A 3OWXA 1PR0A 5DTJA 3SLGA 2CV0A 2FPIB 4YAEA 3QSGA 1MMSA 3OL3A 2NQ2C 3CO6C 1R23A 4HQEA 3D1LA 2UZ1A 1WCV1 3NH6A 4F52A 4MQ9F 1MFPA 4G36A 3OT1A 5BQ3A 2HF9A 3ZW7A 1ESZA 3LWFA 1WPRA 2NPIA 3AI2A 3VH1A 4AUNA 1BA2A 1RE0A 4FT2A 4QIHA 1ZN9A 3AG2H 5IANA 1WRJA 3G89A 4Y13A 1RD4A 3PFKA 1CTQA 3GA7A 1ECJA 3IDSA 2OD5A 2VN2A 3RTCA 2QUKA 1XVLA 4QJ3A 4NJOA 1EVZA 1YBFA 2O8EB 2HZ7A 2XTMA 3GLVA 4AIIA 2WHYA 1AKHB 5AHWA 3ZV4A 2P90A 1XQ6A 1NG6A 2AT1A 2XMRA 4JI3B 4PRKA 4M1ZA 5I01A 3ZKWB 4BLUA 1N25A 3A6EA 1W88A 4RF3A 4BZXA 1KETA 4Z2AA 1X92A 4DMKA 4V2FA 1ES9A 1T5OA 1LRLA 1UDAA 1UWLA 2OK8A 1ZN2A 2QJFA 3D8HA 4FMBB 4EITA 1DO0A 4YS6A 2G9WA 2W2XA 4AZ3B 2Q6TA 2WZBA 3MGGA 1G4HA 1GTG1 1ZESA 4FZRA 2NPFA 3ZDDA 1CV2A 1LFBA 4LTMA 1DWQA 4OI2A 3T5BA 5LXTA 3FZVA 1D8KA 2G80A 5EIAA 2JI6A 3OIVA 2GIVA 1YW9A 4A3DJ 1H6AA 2P9HA 2VBFA 3GNSA 4Q19A 4XFDA 3P9RA 4ZVKA 3T3MB 2XUQA 3SP1A 2J9YB 2GPAA 1TC3C 3BXXA 5JIBA 1GQRA 3CX7A 2I4OA 1TTPB 2GM5A 5AK0A 5ERYA 1VFNA 4EMUA 2XBLA 3OFJA 1DJMA 3PGVA 5L53A 1XGSA 2O23A 3OEED 1V7CA 1IJFA 1YI8A 1UT5A 1OPXA 1WU8A 1VLQA 2JCXA 2PZAA 2ZS9A 5E1BA 5EWJA 4CM8A 4TLBA 2MTBA 4Y1RA 3NCTA 2VHJA 1SAUA 2OP1A 2OA0A 4HDRA 2I2FA 3MJDA 2XD4A 2HJSA 2PQMA 2VFAA 3VKFA 4U0KA 2OCYC 1D03A 1N6IA 4WZAA 3ADKA 5DN9A 2IEAA 2XMQA 4YJGB 4HRIA 3RK1A 3RK4A 2XRNA 1UK6A 4C7JA 5JPDA 1ZSNA 3IUPA 4H1HA 4KO2S 1HEUA 1GHCA 2RBEA 4YJGA 4YV0A 4JQFA 2AE1A 5JAPA 5DBHX 2O5EA 2QKYA 2ZS7A 3ZEIA 3OWHA 5LB4A 1XTVA 2ID9A 5AH0A 1K97A 2HK6A 3MTJA 3IALA 5JS7A 1JJ7A 4NI5A 3BTLA 5DYIA 3TM5A 3B6AA 2N0SA 4JUBA 1RR8C 1BI1A 2FPWA 4JB0A 3ZQCA 2Q21A 3I8OA 4I5DA 3WRXA 4ZZ0A 3MKWB 1W6RA 5F23A 5JY1A 4BJ5A 3LSPA 1IY8A 2BMWA 4OQQA 4X0GA 2ZYAA 4MQ4A 2G1JA 1UBOS 3EYYA 1ADYA 2IXTA 2VEOA 4P3XA 3UGQA 3H6GA 2V4UA 3HDYA 3HJEA 2GRUA 5L4SA 5DX8A 3VSLA 1YLFA 3F72A 2H1HA 3E7PA 4KJXA 2N3ZA 5AOCA 5TPWA 3V9AA 4ARBA 3W5AA 1OGJA 4MUKA 2ATCA 2BFFA 4NONA 1OZGA 4XGIA 1EKXA 4GPTA 5C5EA 4X5OA 5B2ZA 2MG4A 3I5UA 4I0AA 4U7FA 4WBNB 3LPAA 4F3NA 3W5BA 1ZG1A 3DJYA 3L1IA 4JBAA 3HN6A 1C4WA 1G55A 1TMGE 3EDPA 2CLMB 3G7UA 4WCVA 2R4GA 4EHAA 1V39A 2YVKA 4X00A 1Q0SA 1OXVA 1XB4A 4DIQA 3PFFA 1EEHA 1BHQ1 4Z51A 1ZGJA 3LNQA 2Q7OE 2JKZA 3ANLA 2WHXA 5J2TF 2VYNA 3CN9A 4A0QA 4ZAWA 3W4JA 5K3FB 3ZQGA 1EVQA 2GA1A 4EL0A 2DP4E 1GU7A 3FSRA 2GKSA 4HSGA 2E19A 4X6AJ 1UT8A 2Y66A 4XE5A 5BW6B 4XGQA 1VE7A 4CCMA 4G1VA 4H6XA 4RHUA 1DVRA 4D92A 2AVDA 5I4CA 2JIRA 3RKWA 5FTWA 2RAPA 4MKGA 1QOZA 5ALPA 3HKCB 3WKDA 3NASA 2MU1A 1AIPA 2XVMA 5EN4A 2N46A 1R5NA 3F1KA 6Q21A 4GI3A 1TX4B 4QPJC 5TGDA 1E2JA 1UBGA 4AD9A 3TTXA 4JZYA 1SVIA 4ZKDA 1N2JA 2P6PA 1NMEA 1P81A 2X0KA 5FPQA 4ENWA 1QF9A 4Z9XA 4E5SA 2XUOA 3ABKH 2ZJAA 3OJFA 2MHCA 2DFHA 1X7GA 1YZFA 1G5FA 1QPBA 3AHEA 3G8DA 3O4JA 5E9QA 1P39A 1GRNA 1RRMA 1XC7A 2Y6UA 4G01B 5DP2A 4Z7QB 1EEXB 3NBAA 4YCNA 4F7DA 2PRJA 1P0FA 3ZWBA 4IDOA 4HH3C 4O1HA 1UOOA 3RUEA 3NHSA 3UWKA 2EQAA 1L4MA 2AJ8A 3E3MA 2XAFA 1B6GA 3QENA 4G41A 5L9AA 2WWFA 5DLQC 3VZCA 4A8JB 2Y05A 4CQMB 1LU9A 2XKPA 3DKIA 3MJ4A 3UMVA 4Q7QA 2ZP1A 1TAUA 1XE3A 4I9UA 5K5QA 4ZCTA 3I1FA 2R79A 1I5RA 4NC7A 1ZRDA 1C1YA 2ETXA 2Q0HA 4PRZA 4XASA 5A3JA 3AM1A 5LLQA 3OYCA 2GBCA 2EINH 2GR9A 3O31A 4QECA 1GTRA 5ALZA 4UZEA 1LB2A 3ZD9A 2Y9YA 1ONOA 4KXLA 1ST3A 3PE3A 3ZE7A 5KSWB 2RDPA 3QVUA 4Q05A 2BH2A 5CTJA 5FD6A 1NLYA 1Y7PA 2WTMA 3A1TA 4GYYA 3DO8A 4ZYYA 1DCFA 5AJZA 5C8YB 4LYGA 1YR9A 3VSAA 1YBHA 2ISSD 3E84A 1Z17A 3CH5A 3K0HA 3KJFA 2B6NA 4FYIA 4EUFA 5JVDB 2O2JA 2DRIA 2DA4A 1OGYA 2NO0A 2CYYA 1TQ6A 4OJTA 2YJ4A 3OJOA 3VJMA 2WPNA 2V1DA 4QAJA 3W3AD 1UEIA 3MUEA 2LZ0A 1U98A 3Q88A 4FASD 3KKZA 4C6RA 1LZKA 1P7PA 4H17A 2HNKA 4HMPA 4R9UC 2L9SA 4BO8A 2OC6A 1WW8A 2FJUA 1WNFA 4RMIA 2VK2A 2A5GA 3OIGA 3QMVA 4MS4A 5EPOA 3BMQB 3QFCA 3M6AA 1KK3A 4HUTA 3RUAA 1A9PA 4XJSA 4OMUA 4U1RA 4UFNA 2OUMA 2C3PA 3CBGA 1GG5A 1KDZA 3SR3A 3ZW9A 5KTTA 3G2MA 3DHVA 2XUKA 1IOLA 3FR8A 3IMEA 3FF5A 3CPEA 1S72I 3IUNA 3ZE0B 3PDIB 1TTYA 3TAUA 2XA2A 2XOEA 3M1CA 3DL2A 3OYEA 1SXGA 4PX5A 5CX1A 5DHQA 1KRWA 2Q2NA 3IQXA 1VL8A 3KZ1E 3O90A 4HXGA 4C04A 3EIOA 4YY3B 1E0JA 3THYB 4LXQA 3X1XA 2ZI7A 2JCYA 2XSDC 2H08A 2R85A 2PH5A 3SDBA 2OK7A 1JUSA 2YZ7A 1P4XA 1QGPA 1MW7A 2DCUA 3AKYA 4MOWA 1C0PA 4R2MA 2VF8A 3UT5A 2BGWA 2X48A 3ZQ7A 8MHTA 4UHFA 2NVYJ 5FROA 1T9BA 2X15A 3DCIA 2QVGA 2R4TA 3ZGYA 3ZK8A 1FOKA 4A0HA 3INRA 1YOBA 2V0GA 1DX9A 3PFHA 5ES4B 4ZK6A 3JTHA 4BV2A 3WTZA 2M8EA 2JUGA 1UMDB 1I7NA 3G9ZA 4RGBA 1E8MA 4W8GA 4XJVA 2AR0A 2DODA 1CUIA 1NA5A 1QKIA 3LBFA 1WBDA 5F98A 2GEJA 4R40A 3HABA 4UMEA 4G5QA 4YP7A 2BZGA 4A3FJ 1QNFA 3DFZA 3O2NA 3TDNA 1ZUHA 4FTWA 4ECEA 2VONA 4TMKA 4UATA 1DIHA 2EZKA 5GVRA 5I47A 1AO0A 1Q6YA 1D09A 2IITA 4GGOA 1P6XA 2DY1A 4RBOA 2FW9A 4IIGA 4WY8A 1EUDA 2CFTA 3ZVMA 3N5KA 2X9NA 3SOZA 3TZLA 1AK2A 4Q0MA 4JJ7A 4GZ6A 2WG0A 5BSGA 3GA5A 1IQUA 1OAAA 3MN2A 4CRWB 2Q28A 5BWCA 1OXSC 2JIMA 2PSHA 4O2AF 3PUHA 2AMJA 4G37A 4KH1A 1ZARA 3BJAA 1DBRA 2YRFA 3L2OB 3DEUA 4JBGA 3UXYA 5I7FA 2WWXA 3A2MA 3ZU4A 4G4JA 3F4LA 1JAYA 3CZMA 4GRAA 4YXWA 2L3DA 2V8BA 4QQNA 2GA2A 2R5NA 3B1KA 3CEJA 4OQ4A 3DXYA 4U7PB 1T24A 3EY9A 4YVFA 3PPVA 2WWIA 4RIGA 2WV0A 4D8XA 5H3LA 5HQJA 2EDCA 4KB5A 4OKIA 2JGAA 1NLZA 3R7BA 4OQNA 1CRPA 4D4LA 3WGVA 4RHTA 3EAFA 2PMKA 1Z4KA 1DDGA 4MGKR 2JAXA 1P5ZB 3WIOA 2BGIA 2PMHA 2X2PA 2BJHA 3FR7A 3N0VA 4IFIA 4DLTA 3G2KA 1O6GA 2EX1A 3E03A 1VCOA 3PX3A 3PA6A 2HBYA 4E0BA 4X9XA 3IJEB 3OJ0A 2WB1A 4BX2A 1MEOA 1BJTA 3WLNA 1C9EA 3CUKA 4D6PA 1S2MA 4FFRA 5K6TA 1QRUA 1KERA 4I50A 1Z0JA 3AETA 5E6RB 5F2KA 4I1UA 5HCNA 5A03A 3E70C 2F1HA 2QU8A 3QQ5A 1YI2I 4WXYB 4E33A 4Z53A 1NBME 2FN4A 3FPFA 3S1NJ 3T3OA 3ROFA 5C1BA 3UJPA 3QLVC 5FO1A 3MWYW 5DMHA 5E8RA 4YRPA 2EILH 1FNBA 4PLVA 4FEAA 3I5YA 1LFUP 3D2BA 1NVEA 3FNGA 4EQ6A 5AM2A 4UZSA 4OP3A 2Y93A 3FCUB 1X0XA 5E7IA 5LZ8A 4BGVA 5C5IA 4RESA 4CQMD 1PGOA 3HMQA 2LK2A 3A8TA 3K4HA 1VL2A 1N2HA 4FMDB 4HXEB 3SSNA 3EA4A 4OYLA 3H1GA 1FJ2A 2BFDA 1PT7A 4OOIA 2E0IA 3FW1A 3B5EA 4PZAA 4QHSA 4BHTA 2I6XA 2ZCWA 3NDBB 3ZBPA 3CIOA 1P8AA 2OMEA 1UODA 3QWHA 2Y67A 4YPOA 3AEKB 4HNTA 4UOEA 2J6BA 4GX5A 1ZC3A 4BB6A 1RJ9B 4MVJG 3E4DA 3QP5A 1JJAA 4A36A 4QXAA 4Z1MA 3ZKAA 4C7OB 5FBHA 2HJGA 4IHYA 2YTZA 4L9SA 1USWA 3FPCA 1VPVA 3MG9A 4LAFA 4GXNA 4YJDA 2HCBA 4QPDA 1DX4A 4MRAA 1JHRA 4FN5A 5L3SB 2QT1A 4IIBA 5JMOA 4P55A 3JWGA 3R0VA 4FC7A 4RDXA 2NU7A 1WXIA 5KPJA 3EIHA 2SKDA 3UAZA 1PCXA 2RDMA 5CAEB 3KQQA 4BB0A 3C3JA 2AQFA 3HRIA 3ZRGA 1DJLA 4DXAA 1YJ8A 3N7AA 2E5NA 2VXOA 3JYPA 4YP1A 1XEXB 2VDJA 1MGPA 3HNRA 1QYCA 4PRLA 4CFYA 1TP4A 4EARA 3NJ4A 1N6KA 3AR3A 5IW8A 2RGGA 5M3BA 1RWWA 4HDQB 4WACA 1IWPB 3JQBC 4BL0B 1M2OB 2HQNA 4Y9RA 4DA0A 3OZWA 3WLHA 1CQPA 2ZTSA 4MV3A 3LKDA 1K7XB 4X1YA 1XS9A 4NMLA 1SOUA 4N6OA 1BE8A 1J1ZA 4MICA 2C8KA 1YOVB 1TZKA 4OHPA 4ATNA 3DE4X 4BGEA 3NUZA 4S0HB 1L4HA 4H35A 4PXAA 2H2FA 1PJSA 1TW3A 4C2TA 4U8GA 4EPYA 4XK4A 3OU2A 2B4TO 3FSGA 1WVMA 3RYIB 5FOVA 1Z8FA 1C1HA 1BI3A 3BIFA 1QG4A 2VOJA 1GQOA 4L4ZA 4NTZA 1VJ0A 3WMFA 2EJWA 2P4SA 2VP5A 4GHWA 4NFLA 4OYYA 2CHFA 3GUDA 1IAQA 2NZ8A 3PNSA 3MOSA 3RQSA 2DMRA 4AUKA 3ONWA 3MFQA 4RPJA 4GSLA 4WWCA 1YA8A 3RFTA 2A7XA 2V7BA 1IN1A 1JT2A 2FZGA 3PD1A 1C0EA 5IBRA 5JI2E 2Q5IA 5LP6A 2D0DA 5A0FA 1RJWA 2FXAA 1S2NA 2CVOA 3NHZA 3Q12A 2GAAA 4C4PA 3NVKI 7YASA 5FTMA 2D5LA 1VLLA 5DCUA 1CVIA 4FXPA 5AW2A 4KXWA 2Q4EA 1P9QC 1ND6A 1XRNA 1JQ5A 2L2QA 2BR3A 3RABA 3K4NA 3DZDA 2B37A 3LI2A 5T67A 4MCIA 1K7YA 1SZPA 5JI3E 1MDMA 3G9QA 1PT9A 2WSYB 1OPRA 3MW8A 4NECA 2QMEA 2YV3A 2RAEA 3KP2A 2OBPA 3P26A 5CT5A 2DU9A 1Q1AA 2MA3A 1O89A 1UFQA 2WEKA 2L5QA 7MDHA 3DBRB 2GNOA 1WBJB 4A8JC 4YUVA 2ZI5A 4C21A 4CNBA 1ZNZA 2ODAA 4JC4A 2BHNA 2DJ5A 2DZDA 1E6KA 1I2AA 2WM3A 4XUEA 5B53A 1R37A 4CEHB 1QU2A 1NNSA 2HYGD 1AF4A 1DAKA 2XB8A 3I4MJ 2IW1A 4G7HF 1QAQA 2XHKA 4XQCA 5DRYA 3WRVA 5LQRA 1RYDA 5L45A 2PS0A 2FMHA 2B0CA 2AFIA 1XDUA 5CM8B 2O7RA 2A3SA 5EPUA 4NFSA 3IP7A 4IDFA 5ALFA 4HBLA 2J30A 2JARA 4N39A 5EKTA 1Z2OX 2DBQA 3ZCPA 1O94A 1QZZA 1GGFA 2PX5A 3EXHC 4EABA 2WIAA 4FGZA 5C4MA 5G4KB 4D3SA 3E23A 4OU5A 3QUBA 3T7RA 3WJAA 1POWA 5FWXA 1SC1A 4EM1A 1BQ3A 3OP1A 4AJ2A 3CTMA 3GBVA 3UWDA 1FJXA 1J2EA 4UXHA 1NOJA 2HK7A 5JH7A 1T3LA 2JHFA 2P5YA 4NF2A 1XTRA 1XZEA 1TM2A 2PZGA 2XWBF 1ZXXA 1T56A 1M5TA 2DECA 1BR2A 4GPEA 4IBOA 4UHEA 3HOUJ 3TLMA 1GZHB 5LXTB 4GL2A 1N1EA 4CKWA 3CN7A 2FZKA 4LGCA 2QN9A 3OIPA 1E5TA 4P93A 4PZYA 2VDPB 2GFIA 5F0FA 3JATB 4BFTA 2ZB2A 4YUWA 5KQMA 4TSFD 5T4BA 3CCSI 1MJNA 1C7FA 1VL6A 1GFSA 2V9KA 1SUEA 1X7YB 2R5FA 3MS2A 3P71T 2I2WA 1PJLA 3ITEA 3JQRA 3VYUB 4NEHB 4TKVB 2FNPA 1XJQA 1KFEB 2M7AA 1LWOA 1SU4A 1PJ2A 1HFJA 2OENG 2PKCA 4ZU6X 4LFUA 3BMNB 2G5CA 3DAYA 4BRZA 1U2RA 3HSSA 4WXPA 2ZUVA 2ELKA 4YFVA 5AW7A 5LRRA 2WFLA 3WWEA 1JHPA 4G94A 4AL4A 1A6QA 4Q7MB 4NHEA 1TWCJ 4IKOA 2POCA 2EP8A 5ILOA 3L4JA 3HDGA 1PG0A 3AH8A 4Q5IA 1TYAE 1C7IA 4GIBA 4EGZA 4JR1A 1TDJA 5ALTA 3QITA 3S7TA 1S7EA 2CMKA 1EWKA 4V0RA 2AL7A 3OOSA 1E5LA 1RXIA 2Q8PA 1KDYA 5BUCA 3QF4A 1TUBA 4C14A 2PX9A 4YR7A 1GFZA 5DNVA 4BX8A 4UUSB 3PXUA 3HDVA 1KMIY 2O1EA 3LCVB 1PJCA 2NUAA 4E5MA 4ZICA 1B2RA 3GZ4A 4QXMA 4BO7A 3F1LA 1AA9A 3WWCA 1G20A 4XBFA 2D45A 1F4KA 2ZIZA 3CB2A 3H4VA 3K16A 2DR2A 2FE3A 4RD4A 4JYBA 3X1KA 4AKEA 4ZYTA 3K70B 4A69C 1JHMA 1V5IA 2CMHA 4DDTA 1USGA 4BY7J 3W8NA 4V1CA 4JVMA 4H6PA 1QTQA 2C1ZA 4E12A 1UZCA 1VMKA 2R8RA 4ZU1X 1IY1A 1XSEA 4BLTA 3M6UA 3RBZA 1BWSA 2CMPA 2G5PA 2JPDA 2PBFA 4DWWA 2J9FA 4Z4HA 4Z4GA 2CJYA 1KZ4A 2R7OA 1Q7BA 4LPKA 2JTVA 5EUCA 4TTJA 4DM3A 2HGZA 4MYSA 2JFFA 4QWWA 2ZFWA 2GJ9A 2H2GA 1NXOA 1PGJA 2ZO4A 1QGED 1WQ3A 2XNCA 2IS2A 3LNTA 3DDUA 2KWIA 3N8NA 1T8IA 4MWEA 2RD2A 5GTIC 4EYGA 1FTWA 1K5DA 4OKSA 3DZKA 5GY7A 2IW5A 5E2AA 2O6HA 3SYNA 1U28A 2HDWA 3PJRA 1FUEA 2QZ8A 2WT8A 3OE7D 4XUCA 2WJAA 2EBWA 4ZZLA 4PK4A 3B52X 3LY5A 4RU1A 1RWMA 1GZDA 1SZCA 3ELKA 2VPLA 2CUZA 3NRJA 5DLPA 4DV5B 3GTLJ 2HTJA 1RW4A 1VQMI 2HWYA 4IMPA 3WNVA 1VJTA 4Q1FA 3K0SA 4HAOA 3W6NA 1VTNC 4D6YA 2LPMA 2VQLA 1QX3A 1D0VA 1XEAA 3H8JA 3IJPA 3PUVA 3Q0IA 3Q8XB 4QGSA 2HMTA 3K7AJ 3Q0UA 4LV5B 4HCJA 4UTOA 5K0NA 3SXPA 1KDOA 3VTFA 3IPAA 1XRLA 2WE7A 1W36C 2ZJZA 3LUFA 4L2IB 4MUHA 3IV6A 4UJ3A 1ICEA 3WK4A 3SYLA 1AK1A 1JG1A 2QX9A 2VHZA 5I7RA 2I8AA 1GKYA 3COPA 4U7TB 4LZWA 2XDYA 5HRCA 2Q99A 4HSEA 3PNTA 1FVHA 2H8KA 3R77A 1F0YA 4S1OA 1E1RD 1GGKA 1IV8A 1HH4A 3AF6A 3EEIA 3P9PA 4KQJA 4EV0A 1Z3CA 3IDOA 3ML6A 3GX4X 1DU0A 1UDWA 4NV3A 4BJ6A 2ZDGA 4CMJA 3R3WA 3VSBA 3A4NA 5EF6A 3K8YA 1DLIA 2FEXA 1NW6A 4PV7A 1RYYA 1USTA 1XBTA 1IUOA 4JBNA 1MBGA 4UTZA 5HE8A 5HSGA 4AS1A 5FDFA 3K10A 3ABUA 2JGRA 3THSA 4FSHA 2I7CA 3O75A 1N8TA 2ZXFA 4WFJA 3AIIA 5IT9K 3HSFA 2H1CA 1MG0A 2JFUA 2A9QA 3AETB 3I1YA 2MOKA 3QBJA 3UWMA 4NDLA 1PDNC 2C2ZA 3BH7A 2IHUA 4ESOA 4EY3A 1O3TA 4E2YA 4PQFA 2OF7A 1DIAA 1OLSA 3ZCSA 1FJGB 4G6QA<