1R00A

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-homocysteine (sah)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
b'LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin-10-hydroxylase
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r00A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r00A03
1SD7A 3T8TA 4EQQA 2QE6A 3DKWA 3M6UA 3G8AA 4C07A 1RUOA 1XB4A 2GH1A 2P8TA 1M6YA 3DMHA 2I62A 4H0NA 3GNLA 1XJ5A 3DOUA 4ETSA 1BBYA 2C6YA 4LK1F 4C05A 1JG2A 5TJJA 4KRGA 4KWCA 2ONZA 5C0OE 1BHJA 3GVAA 3EEOA 4R6WA 3SZPA 3IKTA 3PFIA 3A7DA 1V39A 2HKXA 4K2EA 3C1DA 3DH0A 1LNWA 3R6SA 4GOLD 1F4KA 3CO6C 2IT0A 3I64A 4OOIA 3CCFA 4G94A 4IRHA 3V8LA 3EPPA 2UYQA 1ULYA 5DXAA 2A68F 4EV0A 4O6JA 1RI2A 3RIEA 3VB2A 3E8SA 2E7XA 2IIPA 3F8FA 4KFCA 4YV2A 4HQEA 3U1DA 4E70A 1VP9A 3HP7A 3OU7A 1NHAA 1GXQA 2B3TA 2GA2A 1SUIA 4ZH4F 4X63A 3QRFF 5ICEA 2PBIA 4EJWA 3DXZA 4XUCA 4Y15A 3G8BA 5E1MA 2RQPA 4UXNA 4RSRA 1ZRCA 1KU2A 5EMMA 2VT2A 3OU2A 2KRFA 4HG2A 3KLNA 5IH3A 2FE3A 3LCVB 5EHGA 2XVCA 3IV6A 1V3FA 3SGLA 1LEAA 3ML6A 3HTSB 3Q87B 2V79A 3SM3A 2FRHA 2VBZA 1YZHA 4ER6A 2HWKA 5FUBA 5KQRA 2VXZA 1UFKA 2VBYA 4WWCA 1XSVA 2ZMEB 3CUQB 5D6EA 4OQDA 3KE2A 4E2YA 2W25A 4R05A 2XV4S 3I4PA 2DQLA 3WG9A 2P7CB 1D8KA 1XTPA 5F2KA 1HW5A 2HTJA 3M9AA 2VE9A 4AZTA 2UZKA 4CZZA 4ENJA 2GIVA 4RTMA 4IWNA 2PLYA 3ME5A 4WXHA 4A6DA 1NW5A 2FNAA 2BM8A 1J9IA 1I1NA 5EZQA 5GOZA 2FBHA 2QQAA 2ZJ2A 3NW9A 2IBSA 3FYDA 5E1OA 1E17A 3BWGA 5E1BA 2YPRA 2H09A 3GW2A 3I5UA 4HTFB 3HCFA 4KVZA 2R7FA 3C0KA 2IA0A 1OPCA 1VLMA 4P7KA 5DRTA 3M6WA 3G2PA 2I9KA 4RGUA 2NYXA 2CFXA 4P5OA 2DK8A 5CVDA 3A25A 5LSAA 1KYZA 5ICFA 3WTUC 4QTTB 1MGTA 1S3JA 2FK7A 4RYLA 2XVMA 5BOXA 1SQGA 1G4DA 2EK5A 5BPIA 1FBNA 2K4JA 2IRFG 3BGIA 1BI3A 4PINA 4KW7A 1W7PA 2QENA 3GZ5A 1I5ZA 4NB5A 4ESFA 5BQTA 2DULA 1WKMA 2I6GA 1SQFA 4RTNA 3HCAA 1LB2A 1L3BA 5HS8A 2ZBQA 4CYDA 4ATNA 2FBIA 2Y75A 5LQJA 1K78B 2DPDA 2P7HA 5HVQC 4S05A 1D5VA 2HFHA 4IXAA 2MD5A 5DWQA 2ZNZA 3VYWA 4I7HA 1J2XA 3GLXA 3E05A 2OO3A 3F8MA 5CVRA 2ZFUA 5K0BA 3VC1A 3MAJA 2FF4A 3FMQA 3KFWX 4QVKA 2A3SA 1R1TA 3SQNA 3UWPA 5CVJA 4XLNF 3T7RA 5TRDA 3MTEA 4KDPA 1XGMA 3BKWA 3O6BB 4P96A 2ZVJA 2XAGA 5HS7A 3DLIA 2OZVA 4BH9A 5HOQA 4A5NA 4BXUA 1QO0D 3J81Z 4LJZF 2VZ9A 4OIPF 3AJDA 1HKQA 2HNKA 3E5QA 3VC2A 1FBUA 4HV5A 2JT1A 3J80K 1IXKA 5LRSA 3HA3A 4PYNA 4JQFA 4ASNA 3QV2A 3G5TA 3P71T 1X1BA 3THSA 1YZ3A 5LHIA 2PXAA 4YUZA 5IT3A 2IJLA 1XMAA 5DRYA 5DX8A 4KICA 2AN4A 5ILVA 2K4MA 3Q5FA 2EJUA 1TW2A 1FNNA 4FX4A 2L02A 3O7WA 2ISYA 1QYRA 3PT9A 1YS7A 2CYYA 4KN7X 2A61A 4Y17A 4DMGA 4IV8A 5H02A 5EIFA 4UVAA 2CMHA 2QRVA 4BAYA 4MQ9F 3BWBA 2D2WA 5AIPA 3LDFA 2GXGA 5L3CA 4PYQA 5GIPE 3C7JA 5EIWA 5LEJA 4ER3A 2R6ZA 4M72A 2J5OA 3CUQC 5E2AA 5FCDA 2BH2A 2VBWA 4Q5SF 4X61A 1SD5A 1JE8A 3ER9A 5FD5A 4MEYF 3R9XB 3DXYA 4Y13A 2BR4A 3B02A 3R60A 1Q1HA 5HLIA 2RKHA 3HSRA 3JWGA 4DCMA 5E18F 1R7JA 1X1DA 1MJ9A 2PXCA 4P58A 4DM3A 2PJDA 1PJZA 3LA3A 1WY7A 3G89A 2CW0F 3BY6A 3I59B 3E3VA 2IA2A 3UJAA 3E7PA 3HVKA 4R1HA 4E30A 4D0PA 5GWXA 2R7DA 5HIKA 1M6EX 3TMAA 3G5LA 2HOEA 5JUWA 4BP1A 1HQCA 1G8SA 1R5HA 2D1HA 5ILSA 1O3QA 2COMA 3QOPA 5LGTA 3GYHX 4L5IA 1S7OA 2C7QA 2P6SA 2G70A 1UFMA 5HDGA 3GF2A 4C03A 3C3PA 5GM1A 3PQJA 3K2ZA 3ELKA 3UJ6A 4IJAA 1G6NA 2FA5A 2AOUA 2HQRA 2ZKZA 3K6RA 4HAMA 3ELUA 3MERA 1ZGJA 1XCJA 5DTMA 2PT9A 5FO5A 3WTVC 1I9GA 4GXOA 2QM3A 2E7WA 1BM9A 3KCCA 3S68A 2IH4A 5M5BA 2OB2A 4BYYA 1U5TB 5BP7A 1L3CA 1JG3A 4X41A 2Z33A 3IWFA 3L2CA 2MLKA 4ENNA 1H0MA 1MJAA 2AXLA 5H6QA 3DXJF 2QY6A 1FSEA 3NDIA 5HILA 1IXCA 1ZLJA 1XCVA 2G1PA 4CTKA 3I9FA 1USTA 1GXPA 1R18A 1KYWA 2PX8A 1UCRA 1T39A 2PGXA 1DPUA 5HDKA 1EAMA 5EMJA 4EKGA 3GFLA 4RTJA 2PMUA 4CDGA 1P4AA 1O7LA 3CJRA 1XGSA 4OMZA 5L3FA 1VL5A 3KP4A 3T0YA 3D5LA 2OBFA 1XCBA 1YLFA 4MNUA 2STWA 5DPMA 1RJEA 2IPXA 5FB2A 3UA4A 2NYUA 3FTDA 4E32A 2MBFA 1Z6RA 3EVZA 4F84A 1N7JA 2UWMA 3FUXA 1KU7A 4HLXA 4NHJA 1GVJA 5DUIA 3I53A 3HYIA 5IKMA 4KDRA 5K5QA 5K03A 1BOAA 3D0SA 4JK1X 3HEMA 1BI2A 1U2WA 3E5UA 2ZWVA 3Q9VA 1FZPB 3WTSC 5EMLA 1IF1A 4QPNA 3LGAA 2P6TA 4U0WA 4ENKA 3L00A 4LLNA 2YXEA 2PXXA 5A2QK 4KUMA 1FBSA 3SMQA 4UVCA 1G3WA 2JHCA 3RIRA 3M6VA 5T67A 3TOSA 4HZFA 1XCLA 3F4KA 2GZWA 1QBJA 5D5XB 3K9TA 1EV7A 4LK0F 2V74B 2AOXA 5CM2Z 4HH4A 3BJOA 3LBYA 4BLVA 3IHUA 3MHTA 3OU6A 1S7AA 3HUGA 3LDGA 1HBXG 3CJTA 1ZKDA 1F3LA 1T98A 1IN7A 2IPQX 1JHHA 1V4RA 2EWNA 2H1RA 1J5YA 4AZVA 1BJAA 3H92A 3CDHA 4ZYEA 5K0EA 4V0RA 1YW8A 1CF7A 3KQVA 5D1NA 5DX1A 2LF7A 4Q48A 1EH6A 5CD1A 1U8RA 2AOVA 4YUXA 1TLHB 3RKWA 3RI4A 1Q0TA 2PMHA 1FJXA 3LDUA 3OOPA 2VS1A 3GRYA 1NKVA 2IDJA 4PYOA 2ZMEA 3CUQA 2RVCA 3WE3A 4AVPA 4P7GA 1K79A 2W84A 3VSEA 1IW7F 2GLUA 3BZBA 2CSOA 4ZYDA 1WSUA 3EYYA 1YW9A 5E1DA 2MH9A 1ZREA 4ESJA 2OPBA 3CTAA 1ZHFA 5L3DA 3TOBA 3TKAA 3LSTA 3KZYA 1UWVA 2P3LA 3TPZA 3FUUA 1RI1A 1X19A 1Q0SA 3ABUA 2C7RA 4DF3A 2C7OA 2OXTA 4OX9Y 1VP3A 2XAFA 3CLOA 3ZMUA 5EMKA 3A7EA 1DUSA 3UJ7A 4OU0A 3RODA 2RV8A 3HRTA 4RWZA 3WTTC 5DD4A 4BLWA 4M6YA 1BC8C 1WG8A 5DXJA 3TM4A 1YF3A 2GA9A 4PYJA 4B09A 2XAJA 2YU3A 5FQOA 4XRFA 1ORIA 2V1XA 3DEUA 4LG1A 4HTFA 5K0FA 1S8NA 3T1BA 2JPCA 4HGYA 3P9NA 3EVBA 3LKZA 3SX0A 1RI4A 5J6XA 2HTEA 4FT2A 3GXOA 3C18A 2DK5A 3ZMDA 5E8RA 1R74A 4GEKA 4L0YB 1WXWA 1T0FA 3TO9A 1JSXA 4WXCA 4CTJA 5FULA 2CGPA 1U5TC 3HVHA 3GRZA 5JHUA 1Y8CA 4GQBA 3KLOA 2NXEA 2YUIA 4IRGA 3N97A 5BW4A 2JTVA 3C6KA 1D8JA 3HIFA 3QU3A 2ELHA 1U2ZA 2UZ4A 1O3SA 3RW9A 1WQ2A 2IVMA 4U7BA 4PIPA 4RVFA 3WODF 4CXMA 2GXBA 5GINE 2EX4A 2EFQA 1TW3A 2M45A 3EVFA 1K78A 2FU4A 2W24A 4KIGA 4LLLA 4GGGA 4UHTA 3WGHA 3GU3A 2UYOA 1G55A 3CBGA 4HSGA 3RYPA 3KKZA 2YXDA 5FTWA 1R36A 4QQNA 3EYIA 4PIMA 3JTHA 2YR0A 5K01A 1HSJA 4GC5A 5LQAA 5C9ZA 1NW7A 4HF1A 4M9SA 4BNCA 2VC1A 2LDUA 2D1VA 4RV9A 2WC2A 4EM2A 2Y1WA 1YFLA 4GUAA 4PCQA 1MDMB 2O6GE 2M8EA 4I01A 3P2EA 4AX8A 4BLUA 3E6DA 3K0LA 1O3TA 3NDJA 1MKMA 4MTLA 4L5JA 2G72A 3DMGA 4OA5A 5EOVA 4PCAA 3FTEA 3SSNA 1FC3A 4HYEA 4M6XA 1ZN2A 3BUSA 1UB9A 3TOAA 1SAXA 1DP7P 2P8JA 1U3EM 1ZG5A 3LPMA 2L54A 2ZULA 2PN6A 5ED4A 4UV9A 3KP6A 3IRQA 3GRVA 1XN7A 3C6MA 4RGXA 1G38A 4V0QA 1FBQA 2Z5UA 2ZIGA 5LQKA 1Z3CA 3PX2A 2CL5A 2YX1A 3FWEA 4M7RA 3KPWA 2OYRA 4HOBA 5LLQA 1D2HA 1KQ8A 1OYYA 2EV5A 1SMTA 1BI1A 1SG9A 3WTXC 1U78A 1PP8F 3JAMK 4LWPA 5C1IA 4AWXB 4KDCA 4HDVA 1HXDA 4I02A 3LKDA 3KETA 1B59A 4U0VA 4XLPF 4EGYA 1YG2A 2LKPA 5DM2A 1KPHA 2BEOA 2XASA 3W6KB 3ECHA 3FXRA 3UJDA 2ZZNA 2JHAA 4ESBA 3PX3A 3WTZA 2FMYA 4G8XA 1K7AA 1LDDA 5HIIA 3MB5A 2WWYA 3SZTA 3TRKA 2GWRA 2HYGD 2PY6A 3WTWC 1FLIA 4PWYA 2EV0A 1UHMA 2H6BA 3L09A 3J7AO 1S29A 1XGNA 5LGNA 3G88A 2XHKA 4RTPA 4MEXF 3I59A 2PQ8A 2DQRA 4R79A 5CCBA 1I1GA 3G2QA 1X1CA 4KN4X 3JWHA 1KHHA 5LEKA 5AONA 3O31A 2P3QA 2AN3A 1R1UA 2KJCA 1R8YA 3LFKA 1EG2A 1W5SA 1G8AA 1HNNA 2LD4A 2E5WA 2XKPA 3B7PA 1P92A 4F85A 3E6MA 2PBFA 4RTLA 4HBLA 3KQQA 4H0EA 1X3UA 2P5LC 1QAQA 3IC7A 1XD7A 1ZRFA 4I98B 4LMYA 1G60A 2XYVA 5G02A 1IXRC 4CICA 1Z91A 4HQMA 3P7NA 5HDNA 2HZTA 3HCDA 1AV6A 3K1PA 4LD5A 3FM5A 5E8GA 1N7IA 3R4KA 4XSZF 2WA1A 3G2MA 1SMYF 3DF8A 3HRUA 5T64A 5H6RA 4YIFA 3KP2A 2EA2A 1JGSA 1PUEE 3IL2A 4XCXA 1KQ9A 3T5XA 2WK1A 5CVUA 3JWJA 2ZBKA 2XUBA 1BKYA 2OQRA 2V7EA 3EDPA 4EKIA 2FCAA 2A69F 2H27A 3BJ6A 3M4XA 5ERGB 5HLHA 1BOOA 4M38A 3GO4A 4YG2F 1VQ1A 4LB6B 3NRVA 2MC3A 4G6DA 4Y2HA 3GEZA 1JSZA 3V8KA 3J80Z 4P55A 4QTUB 3OFJA 2HMYB 2O3FA 3QOXA 3KPJA 1HMYA 2OQGA 1YB2A 1MJBA 4OA8A 4IRIA 1JR4A 3KP3A 1KP9A 1QPMA 3RKYA 4ZZLA 3LAPA 4F7ZA 3M1EA 5K0LA 4ISCA 2HGCA 3WTYC 4WF2A 5EC8A 2XYQA 3F8CA 5AIQA 5DTRA 3L9FA 4YUVA 4AIKA 1ORHA 2PG4A 4L9VA 2JRTA 3BWMA 4E33A 2G71A 5BMZA 4HGZA 2HDCA 1G3SA 1AF7A 4I09A 4KNYA 2CKDA 3NJRA 4XUEA 2Z6UA 1O54A 1UHWA 4B17A 3IEIA 4EM0B 4RGRA 1IXSB 3ROUA 3GJYA 4A2UA 4EJVA 1RNLA 3KP7A 5E9QA 5LHHA 3FMSA 2E1NA 4CO8A 4KMUX 2VOOA 3THRA 4RTQA 2LNBA 2NRAC 3R0AA 4XUDA 4FT4A 1KPIA 4IPAA 3PFHA 3SSMA 2OA4A 2IP2A 3U9GA 3J81K 5CYVA 2VT3A 3HM2A 3TFWA 3ELYA 3GIWA 3EGIA 4KMFA 3PTAA 5E8JA 1O9HA 3QP5A 3RJPA 5HLGA 2CQKA 3MFKA 2PX4A 3QOWA 6PAXA 1FSHA 3EUHA 5GM2A 3CVOA 1OYIA 1SUSA 3FTFA 5FHQA 2PX5A 2ZFWA 5FGMA 3COAC 3CJQA 3JW4A 3AXTA 5LQUA 5J8FA 2A14A 4K6MA 4HLYA 5LBQA 5E2BA 1QZZA 3B89A 3RTRA 3PVCA 2G7UA 2FRXA 2XKOA 3GFJA 1XDSA 3L7WA 3KR0A 2NS0A 3HRSA 5K05A 2H6CA 3F8NA 3GZ6A 3OZSA 4UOEA 3E23A 2RDPA 3FF5A 5DSXA 1T6SA 5FA8A 3GGDA 5DX0A 2P7IA 2W57A 1Z7UA 2BE5F 4CXFA 2HV9A 4RAZA 3B3FA 2Z6QA 2MH2A 3CO7C 5K0GA 3FMRA 3FUTA 1NW3A 1P1CA 1W4MA 5CUQA 3KU1A 3KZZA 1KIAA 4MHTA 1J75A 1XVAA 3KEQA 2ZIFA 3C3YA 2AOTA 5K1YA 3TQNA 2BM9A 2Q2EA 2O07A 1FYMA 2H00A 2HTSA 4L9JA 1UIRA 5K0NA 3C3WA 2Z9OA 2AOWA 2K27A 5DM4A 2ZTHA 5FHRA 3OZTA 4OBXA 1H9GA 1IRFA 2B9EA 3M8EA 3T7SA 3V7RA 5E9JA 1SFUA 1HSTA 3FXQA 3ELDA 2H11A 3UJ8A 1W7PB 5K0JA 2DI3A 1L3LA 1L9KA 1WRJA 3V8JA 2V1DA 3OE5A 2P35A 2VOPA 1WZNA 2R3SA 1NW8A 2IW5A 5D1HA 4GYIA 5EVJA 3EVDA 1LQ1A 1FY7A 3DMFA 2P41A 4R8RA 3MWMA 4DNCA 2STTA 2BGCA 2W85A 4UNOA 2QQBA 2PI0A 1G6Q1 1Z05A 1RJDA 2L4AA 1ZAOA 2DPUA 3BT7A 3GDHA 3WE2A 2I7CA 1L1EA 4EJUA 5A2QZ 2ZO4A 2ADMA 2NNYA 1JTEA 1WI9A 1R00A 4CWAA 1NBIA 4IHTA 3K1MA 4GOND 4DCGA 3LAJA 2QBYB 3UJBA 5L3EA 4HF2A 2A07F 3BKXA 1YUBA 2FBKA 4B8XA 2XBMA 1RJFA 4QVGA 3LWFA 1HW1A 3H3UA 2Y0MA 1EH7A 2J5PA 4R8SA 1P2FA 2MLGA 5DUKA 5EZSA 4RVDA 4OINF 3JTGA 4EJTA 2K02A 2OKCA 4AZWA 2YX7A 2PWYA 10MHA 4YIIA 4QQKA 1MDMA 2AS0A 3OPNA 4CKBA 3K69A 4EM1A 3F22A 4RAYA 2Q41A 3PS9A 1ZG3A 3GWZA 5DM1A 3MCZA 5EQJB 4WX9A 2ZBPA 2X0LA 4PZJA 2NXJA 2WTEA 5BS6A 1T38A 5D5VB 1AQJA 4EQZA 5FLXK 2BR5A 3CGGA 3UJ9A 5IT9K 2P5KA 4HX4A 1ZLKA 4RTSA 3M7GA 3K1NA 3FPFA 1ON1A 3HRMA 1D2GA 3NWEA 4MQ4A 2OBPA 5E8IA 2OY0A 3MAGA 2CO5A 4FZVA 3BJAA 4Z2YA 5EKXA 5JR3A 5E20A 4JXJA 3E6BA 1YFHA 3DP7A 2RNJA 3BDDA 4FSXA 3UA3A 3TO7A 2YX4A 5DCMB 3TKYA 1WXXA 1Z6TA 3TDUC 2BR3A 3R0JA 3FRHA 5K0CA 3FPHA 4FP9A 2HKOA 2V9VA 3E97A 1QQIA 3O2PE 1OYWA 1NV9A 1JQEA 3D2LA 3F72A 1KU9A 2P3OA 3F21A 3HSEA 4HC4A 1B42A 5FADA 3HVJA 2VBXA 1JG1A 1VBFA 5FFZA 4M73A 3OV8A 7MHTA 3OE4A 3MQ2A 1WWXA 3ECOA 3KEOA 3KPUA 4A0XA 5CIYA 4MHGA 1ODDA 4XSXF 5EHIA 1QAMA 2O06A 5DDGA 3GRUA 1H1DA 3QPHA 4IHSA 3KR1A 4BY9E 5B1SA 3WU1B 2FMLA 2UYHA 3R0QA 4YUYA 3BP8A 1XGOA 2JSCA 4UV8A 2ISZA 3BWCA 4X60A 4L9NA 3NEUA 5DEQA 2VONA 3LQRA 2V1UA 4G7HF 2AR0A 3DLCA 4P9FA 4RS8A 3BOQA 3TO6A 2QUFA 2CWWA 9MHTA 1TNSA 5KQSA 3EVCA 1HKSA 2O03A 1WS6A 2FXAA 3HHHA 5FD6A 2LSOA 2RGVA 1NE2A 4QDKA 4YV1A 4F86A 3EGVA 3LA2A 3HSFA 4PONA 4FR0A 1YO5C 1SD4A 3M33A 2IGTA 4CKEA 2XYRA 5KYGA 2NXNA 3UBTA 2O57A 4UUVA 3EVGA 4YFNF 3K0BA 2BYVE 2K4BA 5K5OA 3HTUA 5CLSA 3ZN1A 5ICCA 2Z6AA 2KIFA 3KPYA 3NWBA 2ORED 1BC7C 3O4FA 5DCFA 3N4MA 1FOKA 5E1XA 1J0RA 4XBFA 2ZLBA 3KPVA 2M87A 5CVEA 2KJBA 5E9WA 5HS9A 5DV5A 3LL7A 4Y30A 3CUOA 2FSWA 4U88A 1G3TA 3RDIA 2QZ8A 2EFNA 3GFIA 3HOTA 2JG3A 3KP5A 3RKXA 4LLGF 1YIOA 1KGSA 1FYLA 2ESHA 2IA1A 1PDNC 3FX3A 4G56A 4G7OF 1HW2A 3DV8A 2LF8A 5JI6A 2PKWA 4N9IA 3LCCA 1ONVA 3OCJA 2ACJA 1KXZA 2GAUA 4YUWA 3FM3A 3MZYA 3HHGA 1YQAA 3VEPA 5HIJA 2PVCA 3RYRA 1KPGA 4PYIA 1F9NA 3P97A 4G6QA 4ER0A 2DAOA 1B9MA 3GFMA 1W7PD 2A6EF 4FHTA 4YMHA 4RB0A 4HDUA 4IF4A 2O0LA 5KVAA 3P2KA 4PDKA 3FUWA 2NNNA 4FX0A 1QAOA 4ZYHA 4WK8F 1ZG1A 3RPQA 2DBBA 2EFOA 1O3RA 3BROA 4E2XA 2EFPA 3OZRA 5D8KB 3R24A 5BW5A 2Q8KA 2F5EA 4M71A 2PLWA 5FQNA 1KU3A 1Z1DA 2F2EA 2YTZA 2HEOA 3MQ0A 4PNEA 2ESNA 2AZTA 3LQQA 2FEZA 3W6JB 5JFRA 5FFXA 3TGNA 1TBXA 3LA7A 1T43A 1EQAA 4P7JA 2GB4A 3GRRA 1YFJA 2HQNA 1QZYA 5P8WA 4YV0A 3DTNA 3ABTA 2AVDA 2IDKA 2RC4A 1A04A 2XRNA 5JVTA 4LECA 1USSA 2JJQA 5BPDA 5J8CA 3JAMZ 5LGUA 2DU9A 4DKJA 3ULQB 1B4AA 1L3IA 4U7TB 2Z3YA 2XAHA 4GBED 5D4SA 2EG5A 3GO5A 5CJ9A 3ISPA 4Q47A 5D6FA 1DL5A 3BWYA 3HCBA 3IHTA 1RUNA 3I71A 3GX4X 1REPC 1I1SA 1FYKA 1OKRA 1LDKB 3R6TA 3F6OA 3AAFA 3U81A 4WCGA 2ESRA 4LG0B 3PLAE 2VC0A 2GS9A 4IVNA 4YMGA 2K86A 3B3JA 2ZCJA 1VIDA 4P9UA 2YSRA 4MGRA 1CF7B 5LR6A 2IH2A 3V97A 2GQQA 3DUWA 3HA5A 1R22A 1YS6A 2Z99A 3ID6C 1J59A 3NTVA 3SFZA 3MGGA 2K7LA 3F8BA 2M5WA 4DA4A 5CCXA 2ZZMA 1OR8A 2Y48A 4U7PB 1LDJA 4E31A 2A6HF 2UXXA 3H3ZA 1MHTA 1IN8A 2M1BA 2JH8A 3T0IA 3TLJA 1W5TA 3VFZA 2B78A 2CMGA 3KQPA 3I58A 2P1DA 4WVLA 3P9IA 1X1AA 4NQWA 2PWPA 4OIRF 2FHPA 4A5MA 3PB3A 2ZSUA 2YVLA 2A5YB 4E2WA 1RZ4A 3KR9A 3F6VA 2B25A 2BBYA 4P7FA 3WGGA 2P7VB 4GOOD 5ILUA 3B5IA 4A12A 3KQYA 5GIOE 2VDUE 1OR7A 3ZMZA 4BHPA 3FYCA 1P4XA 2VDWA 3NVMB 2WA2A 1RI5A 3FXUA 1ZH5A 4ER7A 2QYOA 4C06A 5FWDA 4QWQA 1O7FA 1LVAA 3CKKA 3SR4A 3F3XA 2ADUA 5F64A 3SVZA 4OMYA 5CVIA 3PFGA 3DXXA 3EVEA 4BQAA 3LCUA 3WU0A 3X0DA 1RIOH 1R58A 2FNPA 2HR1A 4E2ZA 2FYTA 3V4GA 3SHFA 4QDJA 5D5WB 3P9CA 4RB3C 2XVAA 4GCVA 1U5TA 3I0TA 3ORHA 2JH9A 4FGZA 2L3DA 3EMBA 1D3YA 3MEXA 2O8XA 3M6XA 4OQEA 3H2BA 1YW7A 3FHZA 3ER8A 2IH5A 4HF0A 3HOSA 4L9TA 4EGZA 1BI0A 2ZWAA 2KIUA 4AUKA 2QLZA 4FSDA 3R61A 4A6EA 2DLLA 1IN6A 4I0AA 2P4WA 3QAHA 1B6AA 3FPGA 4ZTBA 4HW0A 4C04A 4N9HA 4RB1A 3ZMTA 2XIGA 2CG4A 1KA8A 2PX2A 3RPUA 2DO7A 4QLCU 3LHDA 4ON0A 4JBAA 4CGZA 1XMKA 2OZ6A 2QWWA 2ZNYA 4WXDA 4IKPA 2G7HA 4RTOA 3QPTA 4LB5A 3JSPA 2OD5A 2ETHA 2Q0OA 4AZSA 4YFKF 2HWVA 3B73A 5LRRA 3KQSA 2DTRA 2F5CA 3JWIA 1IN5A 5D5UB 4MQVA 5F2NA 5HZMA 2QBYA 3BPXA 2ZCWA 4C08A 2RN7A 3GUDA 1EJ0A 5E17F 1XDZA 4UVBA 4EMSA 4L7VA 3WSTA 3HCCA 4GF5A 1BIAA 1DPRA 4G7ZF 4DQ2A 3DQVC 3EQLF 5LHGA 1SVUA 1LJ9A 4RVHA 4C4AA 4RTKA 4GYGA 3OFKA 3ANXA 4M36A 4RTRA 1IY9A 1H9TA 3O3KA 3G7UA 2PT6A 3DFGA 3F23A 4AIJA 3E5XA 1AOYA 2GA1A 1BIBA 4FT8A 4RX1A 4MTDA 2G9WA 4PYLA 3IRRA 2F5DA 2XROA 4OIOF 1B9NA 1SD6A 1IN4A 4GOMD 1ZRDA 1SFEA 3Q7EA 3S2WA 4EK9A 1C0WA 1F1ZA 2FQ3A 2ONYA 4PYMA 1JHFA 4LWOA 2UYCA 3MCTA 5E1WA 3UZUA 2PV0A 3IYLW 2F8LA 5HEKA 4BP3A 3ZMVA 5DCMA 3P9KA 4PYKA 2EFWA 3U2RA 5DTQA 4A0YA 2DW4A 5GP1A 1PRYA 5DSTA 4DZRA 3G3ZA 3DPTA 4LFUA 1FP1D 3A27A 1NV8A 4EVIA 1VTNC 2KIMA 1R1VA 1ZARA 1INLA 5LQCA 2VDVE 4CHUA 1ZQ9A 1CGPA 3VOEA 4QPPA 4MTEA 5ERIA 1O9GA 2PJPA 3TDZC 5K8VA 5DD8A 3A26A 3ERED 5EGSA 1NBHA 5EKUA 5U4XA 1O57A 5EEHA 4FS8A 4ZZDA 2O61A 3ZPLA 3GCZA 1TTYA 2OB1A 4KIBA 3ELWA 4O5VA 5HOOA 3DPLC 2OU2A 2EJTA 1QGPA 4L0ZB 4R8HA 2AN5A 1FPQA 4M9XA 1JTFA 2EJRA 3NMUF 3AY0A 4GO1A 2ZIEA 1JG4A 3FZGA 4POOA 3SXYA 3NQOA 2V6CA 2FPOA 4M37A 1GHCA 1TQIA 1IAWA 4ER5A 2XAQA 1P39A 2IBTA 1U6GA 3BGVA 5F6FA 2PEXA 2G8NA 5L3BA 3FUVA 3KQOA 1JXSA 2H94A 4KIFA 2NXCA 4EJOA 1R5GA 1IUYA 2B0LA 3KQWA 4A0ZA 2JZYA 3DULA 1BN5A 3P8ZA 1P91A 4O29A 1AQIA 4MIKA 3I54A 2O0YA 4IV0A 4BHBA 3FZVA 1I4WA 2NP7A 2HS5A 1KQ0A 1YYVA 5EG5A 2YR2A 2GPYA 2ZZKA 3ZMSA 2B2CA 3ZN0A 1F38A 2DT5A 1P1BA 3BZ6A 4BHCA 3KR2A 5EEGA 2JPBA 2MA3A 1FX7A 3QP6A 3EETA 3PQKA 5BXYA 4NECA 2FK8A 4RVGA 2VODA 3FPEA 2VN2A 3Q9SA 4HX8A 1XSXA 3EEYA 1T2KA 3E6CC 1JQDA 1ZYRF 5LQRA 4KYWA 2EV6A 1XSDA 2FOKA 4L18B 4M9ZA 5ICGA 4CKCA 3REOA 5FLXZ 2D45A 3BGDA 2VE8A 3IWZA 4S04A 5EPEA 5FWAA 5IT9Z 1EH8A 3V7SA 5H20A 4KA4A 1RI3A 2UXNA 2JHPA 4HV6A 1E2XA 3VODA 1KR5A 1NT2A 3TM5A 3DR5A 2KKOA 5CVVA 2NP6A 3B3GA 2HR3A 5E1ZB 2PFBA 3NVKI 5LQNA 3FPJA 5KS2A 3T7TA 2L4MA 5HIMA 3BPVA 1TPYA 2P40A 1MZBA 2DFIA 2TDXA 3FTCA 5T6BA 4O3MA 5FA5A 3SXJA 1ZGAA 1I6XA 2EFJA 1OMIA 4OBWA 5F2OA 2F5FA 1I27A 1TQMA 3HVIA 1L0OC 2P5VA 2OAZA 4U7DA 1J7KA 2ZXJA 2BZGA 3AXSA 1SKMA 1QNTA 1N2XA 1MJFA 4G9YA 1K6OA 2C7PA 1BC5A 3ZP5A 1P4WA 1VPTA 1Z9CA 2NAZA 4RB2C 3T8RA 1IRGA 5F1RA 1FT9A 4PGGA 4KT5C 5DYMA 1MD0A 4R6XA 2Y1XA 2QRVB 1RI7A 1PP7U 3CC8A 4ENMA 3LBFA 5MHTA 1XXLA 2KW5A 2ZBRA 1LEBA 2AVNA 3TR6A 1ON2A 5HFJA 4LG0A 2WV0A 4PCLA 4PGHA 2ZW9A 4N0BA 3V8VA 1M0EA 1DUXC 5D4RA 5KK1A 1AWCA 4HX7A 3ZQ7A 2XGXA 3IKVA 3SSOA 1FWZA 3UJCA 4DQ0A 2QQ9A 2BV6A 2QVOA 3AWIA 1JQ3A 4X1OA 3V7CA 3TQSA 1P6RA 1Y0UA 5DLYA 1EJ6A 3UFBA 3R3HA 4OIQF 4RGSA 2DPMA 2N47A 3LX6A 2L01A 4I0BA 4U0YA 3HCEA 3G2OA 3P2IA 3LECA 3QU6A 2O05A 4MWZA 3HA7A 5L3GA 3HNRA 4HRAA 3HTXA 1NW6A 1G3YA 2YXLA 4YFXF 2PSSA 2YQZA 2M30A 1S6LA 1R6AA 1IZ1A 1F5TA 4GC9A 3BXOA 2NNWB 3MZHA 5DM0A 3G73A 2CWEA 2AOTB 3L8DA 5K5RA 4Q4ZF 2E1CA 2AS5F 1FP2A 1YTYA 4I2OA 1QANA 1EIZA 1SFXA 3EGEA 2AOUB 1B1BA 1VE3A 5DT2A 1RJGA 2EB7A 4ZYGA 1STZA 1R8XA 3KQTA 5KVRA 1DCTA 2VP3A 4AIHA 3MTIA 2EA4A 1DDNA 1D2CA 4M74A 2HYFA 3CJNA 3EVAA 3KQMA 2IFTA 3ERCA 8MHTA 1IM8A 2ERCA 1TNTA 1XDUA 4HA8A 3KHKA 4LGWA 3M8FA 2GAFA 3EMDA 1TQPA 2OZUA 3M70A 4AD9A 3FRIA 5D8LB 1HKTA 2X4HA 3WGIA 1R23A 5K09A 3A4TA 3JSOA 4TV7A
chains in the Genus database with same CATH superfamily
4OXYA 2CYCA 2BEJA 2I2BA 1XB4A 1YI8A 1JS1X 2A0KA 2R4TA 3VJRA 5H3CA 4Y2RA 4DAEA 2HX1A 4ND2A 5JD3A 3L8EA 3IBGA 4YAKA 4XVUA 3LSPA 1QGED 5TJJA 4D41A 3NH9A 2ONZA 3VU1A 1B8IB 4K8OA 2E2IJ 3V3KA 2BIFA 3TCNA 3H2KA 4WIAA 3HZHA 4IXMA 3I2JA 4Q7KA 3WOVA 3W9UA 4G5YA 4U4AA 5I3ZA 4EAAA 1KVUA 2BISA 3C8UA 2N3ZA 3FKSA 2R7NA 4I0WB 2Y4OA 1WU7A 1KAHA 2QUHA 4YP0A 1OCPA 3OU7A 3AG5A 4ZC3A 1XA0A 2J3QA 2G7MC 1QBKC 2ZAIA 1K4MA 3DXZA 1V45E 1V9SA 4I4TA 2WFAA 3LI2A 4OU4A 3WHKA 3OU2A 2ACVA 1K68A 4YMWA 2XVCA 3VYSB 5LFAA 4HFJA 3CN9A 1LEAA 2MR5A 3V80A 4CQLB 2NU7A 2IJGX 4NK4A 1FFSA 3RZDJ 4WWCA 1C8LA 3DHNA 2NVUB 1TYAE 3BIWA 3CS3A 1EQ2A 4DCOA 3TBHA 4IDPA 3LF2A 2P7CB 1D8KA 3VDXA 3QVGB 1G1AA 5EIEA 4Y9TA 4H7EA 2PLYA 4OJKA 4X3PA 2BM8A 3EGXA 4YS6A 1P33A 3D8NA 3K4QA 4YAUA 5JT1A 3KAKA 4B6QA 4HTFB 5F08A 1A7AA 1ORTA 2HN9A 4PZ0A 3AB7A 3T5TA 1OI4A 2ORIA 1Q17A 1FU8A 3KJFA 3JATB 3E4CA 1Z82A 1JV2B 4MUXA 4B2IA 1G4DA 4NCNA 4EY7A 4NB5A 3S2SA 3EGOA 1OCOH 3ICWA 4HNTA 4RTNA 1M1EB 4B0OA 2QXYA 4QYIA 1ETXA 4WE3A 1VJCA 1K78B 4HUJA 5DWQA 1GD1O 4UD2A 1J2XA 2PLAA 4NCXA 3JRBA 3UXYA 3FPCA 3FMQA 4DZJA 2EZKA 4S1VA 2I78A 1M8JA 3ZGNA 1XNJA 3DLIA 1EWYA 1TADA 1OWLA 2QW8A 4FLFA 3SNHA 4CKYA 3D8UA 4EHIA 1FBUA 4HV5A 3H9GA 3AR5A 2JT1A 3KC2A 1U4OA 3F5FA 1UK6A 1E5LA 1T56A 3RU3A 3SJCA 3GX1A 4PTLA 3ZYZA 2MG4A 3LY9A 1WMEA 1NRIA 2HPVA 1IN1A 2AUNA 4BIMA 3RVRA 1Q20A 2VTEA 4MRMB 2XQGA 3EXEB 3S1RJ 1NNLA 1KY2A 4F4UA 3D1NI 3PDHA 2Z3VA 4YJ2F 3GLHE 1L7VC 4C4RA 1MNDA 1QF7A 4KACA 4Q01A 4ZQIA 4YRCA 1QHSA 4Y67A 3IJRA 4A3BJ 4ESOA 4H1UA 1MJ9A 2FJ1A 4P53A 1WY7A 3LA3A 1NNUA 5IC4A 1M1YE 4LGMA 3UUEA 2GCOB 2VQDA 1SUFA 1MB4A 5JHHB 1WBDA 1ZD8A 1HQCA 4UASA 2R8YA 5A3VA 1O3QA 3UCFA 3OJEA 4JI4B 3KVOA 4XDGA 3B36A 3USES 3IT3A 3UCXA 3L7YA 1ZU5A 2P6SA 4I1VA 3OQVA 5K7SA 5AVQA 2WU0A 4X8LA 3GRCA 1G42A 1G8YA 1E4OA 3A1TA 3PO3J 1YH3A 1Z26A 2VUMJ 1H4VB 2BI8A 2QAJA 1I9GA 1KGDA 4QXRA 3S68A 2JA2A 2LC2A 1U5TB 2Q49A 3ESRA 3DDZX 1SBHA 1S2LA 4MR8B 4FQ5A 1LSJA 1V0JA 4F2GA 2XF6A 3QI7A 1UCRA 1GSAA 1GITA 4EKGA 3HG7A 1RRPA 3TSYA 3QOYA 5G4KA 1MH9A 5ARDA 4JJEA 5KHLB 5DU2A 3M5DA 2HY7A 5HKAA 4EHAA 4FOLA 2UWMA 1IRIA 1Z6GA 4P92A 1KYXA 3PUWA 1VHWA 1LE8A 3G6KA 4FEEA 5FNZA 1FSPA 3K70C 4C7XA 3CX6A 2E0IA 1DBWA 3HFRA 4KFRA 2WNHA 2C78A 1Y1WJ 3W90A 3LP6A 4DXHA 2GLOA 8LDHA 3F4KA 2BEWA 1M2VB 1P2SA 3LOUA 5BV1A 2D5VA 1DU4A 3LDGA 1W6RA 1IN7A 2IPQX 9LDBA 1DRJA 1NG1A 3HACA 4R7ZA 4XZ3A 1V5EA 2CFOA 2G82A 2X6RA 5KYUB 1TI7A 1EH6A 4RV4A 3JCZA 1TLHB 4JODA 4CCWA 2PMHA 2G63A 2X2PA 2XWQA 2ZMEA 5AVWA 1HLVA 4Z5XA 1YW9A 4NU6A 1XQVA 3M4NA 3OZCA 3D7MA 2KB0A 1Y63A 1PG5A 3GFSA 5D85A 2OXTA 2FDCA 1VP3A 1SC1A 2VWPA 3PC4A 2HLHA 3UK7A 1SKBA 2GA9A 1K4KA 1U0EA 2PUTA 4FPXA 5JZOA 1V9CA 2CFRA 4JLNA 3LKZA 4EH1A 5DT9A 4FT2A 3ZMDA 1T0FA 1NF8A 5E3HA 1K61A 4RSHA 3GLHA 3HVHA 1CG6A 2PS9A 4AFNA 4R9VA 4FONA 2V7UA 3QU3A 2P0YA 4L72A 2UZ4A 4MCJA 1EP2B 4FX5A 2BWJA 2ZWIA 2X8WA 3QKSA 3HGQA 2M45A 2W24A 4AVYA 3JAWB 2HNHA 5IP9J 3G59A 1U0RA 4FX2A 5FTWA 1R36A 3EYIA 2ZTVA 1X86B 3NAMA 3W1VA 4UDXX 4L4YA 3S5JA 13PKA 1VQNI 1J4AA 1XPOA 2OSBA 4K6CA 1ZVVA 1K83J 1FJHA 1FC3A 4KK4A 5HX7A 1UB9A 4B3AA 4QYXA 2EILH 5F1PA 1IWBB 4DV4B 4OVKA 4CF4A 4OQYA 5BSHA 3O8NA 3FK7A 1HLDA 5ALVA 4PGFA 4W1QA 2ODWA 4H3KB 4M7RA 2RH4A 2IHYA 3DOEA 4LHEA 5I48A 1UMBA 4NS4A 3L0DA 4B3RB 4KE6A 1QVUA 1SMTA 4K0RA 2J4FA 1NURA 4KPYA 3AFNA 4FVTA 4BOYA 3SZRA 3OQ6A 1OLXA 3WB1A 1SY7A 3BIXA 1TCAA 1HFKA 3NP9A 4TX1A 2FJ0A 4FW8A 1VXOA 5FR2A 2GWRA 3GC6A 3WIBA 1B3RA 1VG1A 3JY6A 5A06A 1Y6IA 2H6BA 1ZBDA 4TRRA 4LXYA 2NPOA 2E2HJ 2C5HA 4D56A 4XSVA 2BHNA 3WGUA 2NM0A 1R1UA 1TK9A 3LFKA 1FSZA 1GGNA 1THZA 3FJOA 4ZO7A 2WWFA 2Z56A 1V1JA 1X3UA 3HNPA 1J9ZA 3NJ4A 2JF0A 3L0BA 3PEFA 1GNLA 1R9MA 3RG2A 1EF4A 1N36B 2F8MA 4DRXA 3HCDA 4GZ5A 1N7IA 4RPHA 3I3LA 1Q11A 1J49A 4EX7A 2WF6A 1W96A 4XCXA 4PAGA 2Y1OA 5BN4A 1OFHA 1JQAA 3BJ6A 2W90A 3K09C 1XXHA 5IAKA 2MC3A 2DU8A 3VDRA 2IEKA 1QIEA 2IYOA 2D0PB 1GL6A 3WA6A 1JR4A 1VQ9I 3OHSX 1KP9A 2Q1SA 3FF1A 5HXAA 1YL6A 3SEZA 4JFAA 4QTXA 3FYSA 4AIKA 1SC7A 1A5TA 2IYRA 3U26A 4B17A 3GJYA 3D54D 1GQSA 3SDGA 1WTCA 4LEIA 1O77A 4X9XA 3DVAA 3R0AA 3PFKA 4J0KA 4QG3A 1YGPA 2OHIA 2XOKD 2QHXA 1ZNXA 3LU1A 3FHJA 1CUFA 1SQ6A 3DFIA 4XVHA 1TE2A 1V6AA 1UBCA 3KKQA 1J1ZA 3AM5A 3X1KA 4LC0A 4YLGA 3TX6A 3VX4A 2FRXA 1XDSA 2RHJA 2H1SA 3KR0A 4ALMA 4PCUA 1G21B 4E5YA 3CNOA 3GFTA 3UC5A 1T6SA 5FI0B 2LW7A 1ZAKA 1BWSA 3WIEA 4BNVA 4NYIQ 2W57A 3PF8A 4NAVA 2MH2A 1N5KA 2EF0A 4ZHQA 4BL5A 4QTZA 3ZE2B 5FKOA 1NZJA 4KR6A 1NW3A 3PUFA 2ME6A 3MJHA 5CUQA 3TZCA 3KU1A 3DC2A 3THOA 4Q3LA 1U90A 3CUVA 4G0OA 1FYMA 2D5BA 5KNBA 2ZXHA 2FZ4A 1H9GA 3LYHA 2NZXA 4PO1A 1IJWC 3UH0A 3V7RA 5E9JA 3FG9A 1AKVA 2IOFA 4MROA 2HOAA 3U7GA 1N1EA 4HV4A 4Q3CA 2W4QA 1QVZA 4OJMX 4Q9KA 1LQ1A 2AKEA 5IN5A 4KQFA 3W9SA 2IIBA 4W6ZA 3WSWA 2NYVA 3F5DA 3FVTA 3FVWA 4CT0A 4URHA 3RYIB 2W2PA 1TYCA 4BWFB 4J16C 1PWYE 1EGMB 4M60A 4CWAA 2OGSA 4Y2SA 4DCGA 4UARA 3UC9A 5THKA 2NO6A 2BY1A 2X0DA 1GPNA 2O2XA 1ETOA 4E7ZA 4CKBA 4E7IA 2JEZA 2HCRA 4CQMA 1B6TA 5FLXK 3DDWA 2D0IA 3UJ9A 3IUNA 2P5KA 5F4BA 1MSEC 4RULA 4DDUA 3T1YB 1TJ5A 1XJ0A 4JOCA 1NQXA 3I32A 4NXMB 5E20A 2O2YA 3LMKA 3TDUC 2YKGA 1MJNA 5JLXA 2V9VA 5TIIA 3R7FA 3BE6A 4H16A 3WV4A 1OQAA 4EJ0A 1UXJA 2M1ZA 4MUGA 1KJWA 3L07A 4PLFA 4A0XA 1PJ4A 6YASA 2Q2NA 4AWXA 3EAFA 4D44A 4L76A 3WU1B 2UYHA 4B81A 4FEGA 1CS4C 3LPLA 1FFXA 3TD6A 5MN6A 3BXHA 1S3IA 3HHHA 1UDCA 1FMJA 4FMDF 1YKGA 2VVTA 3HSFA 1EWQA 4BMNA 2W2OA 2D8AA 4ETMA 1T3GA 4J0GA 2XD4A 3DHWC 2WUGA 3OTOB 2Z2IA 2KJBA 5ILOA 2WYIA 1PZXA 4W1SA 1X70A 4GWGA 5CDUA 1TC3C 3LWBA 2YFHA 3VYTB 3DBRA 4O8CA 3K05A 1NJGA 3PF9A 1KA9H 3I9V2 2WPNA 4IICA 2O8FB 5D5HA 3LCCA 3TLKA 4KXQA 4EZBA 4I7EA 1A8SA 2PMFA 1UDXA 3JVIA 4CSWA 2AQEA 3WB2A 4I1SA 4HOYA 1V2GA 3PP8A 5LLSA 5LQMA 1IZYA 2IWHA 3BXEA 1KO5A 3AZPA 1V48A 3MC1A 4PC1A 2J0EA 4JD5A 4LRWA 4QJ5A 1KKMA 2HZ7A 3LNCA 5LOVF 4K9RA 1U4NA 1IK6A 1YDHA 3RTCA 1QE3A 1KEZA 4LZPA 1T6YA 3SZ3A 3MYRA 4G2NA 2H0QA 2RSLA 4CM9D 4Q47A 5D6FA 4KKXB 4QM7A 3HI6A 2DJ5A 2A8YA 3OQNA 4I99C 4QGGA 4LZLA 5J2TB 1T0IA 4MLOA 2GQQA 1QZXA 3O5AA 2RBGA 3OT5A 3ZWQA 2BEUA 2XCUA 4HGQA 3HMKA 4E5VA 3THXA 4GH5A 1HDIA 2X4GA 1LDJA 4WI1A 4E31A 1EA3A 2B4KA 3LE8A 2I3AA 4F6RB 3O8QA 4OIRF 4A5MA 4X6XA 4TYMA 1RXCA 4KAJA 1O4WA 2RD2A 3WGGA 3B1ZA 3EXG2 1AA7A 4H35A 1WHUA 4O1HA 3EY4A 3VQTA 3T06B 2QR2A 1QS0B 1H0RA 1QX4A 3R5XA 3FXUA 1ZH5A 3AF5A 2NVOA 4UREA 4ZI7B 1UPBA 1FMTA 5E3JA 4DLVA 3WMWA 3OCXA 3QE9Y 4C1BA 4OMYA 3PFGA 2XGEA 2ZK7A 2W2KB 1KH3A 2AD5A 2JARA 1R58A 2A78A 3OESA 2JK3A 1SOVA 5LD2B 1T95A 1M67A 1Y80A 3UV3A 5TR9A 1JKPC 2R48A 1BI0A 1L7PA 2ZWAA 3I9LA 3BRWA 3DEYX 4A3SA 4MUYA 4YGYA 4IEIA 1X77A 4B75A 3ZMTA 4W9NA 2PX2A 2FPWA 2LD5A 4O4JA 4R98A 2IEIA 2X22A 1PO7A 2JKYA 1BD4A 3QPTA 5ISMA 3PR3A 1RCUA 3V46A 4C08A 1YI0A 5E17F 4EMSA 3HCCA 3C1UA 5BSMA 2VQ3A 3ZH9B 3G7UA 5DN6A 2ZAGA 3PFCA 2PMCA 1MMGA 3QXGA 1QQAA 3PC8C 3DE0X 3ZJ4A 1F14A 2NNLD 4DMRA 1BL0A 4K9LA 2C4NA 2CHFA 1IJBA 5E1WA 3ZMVA 5DCMA 2JK1A 2J0UB 1S2NA 3AUYA 3G3ZA 5CR9A 2EWVA 2OGWA 3E9RA 1NV8A 2GN9A 1R1VA 1KJYA 4BQPA 3ESBA 3TNYA 3E82A 4X20B 2J08A 1W49A 3F7NA 3IUPA 1QR2A 3OQOA 4DV6B 5B3SH 3AFIA 1EFVB 4B6EA 3DPLC 3FHCB 3CZRA 4R8HA 2VO1A 1E5QA 1SU4A 2J67A 1J99A 2PUJA 3RNOA 5CMLA 1D1QA 2FN3A 2JEOA 4Z86A 2CK3D 4DABA 1TPZA 4WDRA 4XDZA 4PN7A 3KQOA 2QVLA 4ZQFA 2OWEA 5DBIA 1KJIA 1MDFA 4FCCA 4GM4A 2DZDA 1O87A 4L9RA 1F12A 5J43A 4O4LA 3NARA 3KQWA 1KQGA 4NZZA 3ZU4A 4EB6B 1PT8A 4IDAA 1UDAA 5FBHA 4X7BA 4J7AA 5EEAA 1EGAA 2PTHA 1TL7C 3ZDDA 3SX4A 3TR5A 4NBLA 5EI5A 3L7MA 4HQRA 5FBWB 2VN2A 3PXGA 5DTDA 3L04A 4J43A 3HJRA 3HN2A 5LLTA 1Y1VJ 2J3DA 1D03A 3QE2A 1ZYRF 5HWSA 5LQRA 1JIJA 2EV6A 4IM7A 2I03A 2HO5A 5ICGA 3C5HA 1U3DA 1E2MA 1MJHA 3O4HA 1QHGA 1RI3A 2J6HA 1BCSB 2HD4A 3U4QA 2CXHA 5B58T 1NT2A 5IFLA 2BELA 5DMHA 4ARCA 4PAWA 4HUQA 4NYJR 1BXKA 5DGCA 3DWEX 3RHFA 1P44A 5TPZA 1MBKA 1NI3A 2C4VA 1I6XA 4L51A 5F2OA 4ODIA 2XQVA 2Z2YA 3E0XA 3L05A 4K81B 2KLHA 1TFRA 3MMXA 3OKCA 3NVDA 3H1FA 3A9RA 4AIRA 1K9SA 4ALNA 1ZINA 5JPIA 1E2EA 3GJSA 4ZK6A 1IQPA 4NX2A 2XXAB 4KLCA 4Y2GA 4TZ6A 4PEVA 3CA8A 1R12A 1FY2A 2Y6VA 5D4RA 4QUAA 1SXJC 1AXRA 4M9UA 2PZMA 1CRPA 5DNDA 4OX9B 3SIXA 3V4ZA 2L01A 4LF7B 1RQGA 3LECA 1YQWA 4GR5A 1VI6A 5L3GA 1JIQA 3GZJA 4DGWB 3JQPA 2M30A 2MIIA 1KYQA 4LSWA 2B5OA 2I0FA 3D4LA 2XMSA 1CIVA 2YY5A 2P4SA 2Q6LA 1YTYA 1ESCA 2ZKLA 2J3KA 1STZA 2HBYA 1ZRMA 1N5MA 1VDMA 4CM8A 4R71A 5K6AA 4YP5A 3H3JA 4WSOA 4B9EA 2C4WA 1J0DA 3PYXA 3C16C 3QG5A 5JCXA 1G2OA 3E27A 1N1DA 1AO3A 4GECA 3F7TA 4YP9A 3A70A 1BBYA 4X1KA 3JQQA 1JT9A 4BO1A 3R75A 5EE0A 2ZETA 1IFXA 4FYHA 2IUSA 2OUIA 1M10A 2CNKA 2QVCA 1X80A 3R6SA 1H0KA 4D1QA 3WL5A 4MRSA 4TS3A 3EPPA 3G1MA 3NASA 1UJ6A 1UXHA 4RNDB 1T6ZA 4PWZA 1H69A 1ZQ1A 1KQ3A 2ASEA 4JC0A 3CJTB 4BWGA 1WEHA 1VJRA 2D1QA 2ZJBA 3OG9A 3L7IA 3TEMA 3RSQA 2VJYA 2OC6A 3PQEA 1BH6A 1RETA 1KU2A 4KXNA 4HDMB 1EP3B 3K1AB 1GFZA 3A06A 1C29B 3A6PC 3LSIA 3EUHC 1N9KA 1PFGA 3R3XA 1EESA 3KYJB 3SG0A 1UR5A 3RNLA 2R6CA 2CH0A 2V79A 2BI7A 4Q3KA 2I1VB 1WHSB 1T26A 1E5DA 1O2DA 1U9IA 4Q4LA 3EJWA 5G3YA 3VOBA 3OLVA 4BNWA 1MMAA 4QX6A 2DQLA 3BBPA 2ZG6A 3J7YJ 1Z35A 2OXEA 5KCZA 1HEIA 2B1GA 1S8FA 5BVGB 1MC4A 1A72A 2GR9A 1U3WA 3KXIA 5I9BA 3WYBA 3O9ZA 2RCNA 1SU6A 4B6SA 4YAOA 3G2PA 1WW2A 4JP3A 4QGFA 3G4SI 5CVDA 4CMJA 1KYZA 2OBLA 3WTUC 5EJIA 4CLDA 1XR3A 1XIVA 3H6KA 2I7XA 1NQWA 4LRQA 2XSZD 3G8DA 2WIAA 1IOZA 2O7OA 1PR6A 3U3RA 3DZJA 1RM0A 1XZLA 1CY7A 2CNOA 4RM2A 2P9YA 2YVUA 4YPVA 3JQFC 1OXSC 1RHQA 4Y2VA 5DH9A 1SURA 2W4IA 3LC0A 5GZ1A 4XFJA 2FZ5A 3Q2IA 1SC3A 2XAGA 2ONKA 3O47A 2UUPA 1XB2A 5HOQA 1TA4A 2A84A 1MORA 3T34A 1S89A 1HE8B 1GT6A 4OIPF 1CDZA 5CBPA 4BFCA 1RQPA 4ZJUA 4XYBA 3KSAC 4W5QA 1WTAA 4IOAF 2FEXA 4B40A 2K4MA 2VBIA 2FMKA 3V7NA 2IXTA 3U09A 1AMOA 5C32A 4CM7A 1USKA 2HJGA 3FMFA 4GZ3A 4DJ5X 3IPLA 1J97A 5H02A 5EIFA 4JX6A 4ASUA 3TF5A 5AIPA 3E7XA 2GXGA 5KC8A 1USWA 5B1YA 2VBCA 5CLJA 4OQPA 1NP6A 4M98A 2NTVA 1CR2A 3AY3A 1IPEA 4MEYF 1MNAA 4JVLA 2DQYA 1Q1HA 1YOBA 4EHKA 3LBIA 1FCJA 4CL0A 5GTDA 4CW7A 1YA8A 3QYJA 2ZU6A 5HR5A 5JS8A 4E30A 1M6EX 1Y3CE 4LY6A 4M8KA 4KN5A 1DBQA 3REQA 4GGOA 5LGTA 3WR5A 3F71A 1MRZA 1WF3A 1DBIA 2ZRKA 2BOLA 1XN1A 3UEOA 1V11B 3WGOA 2A5LA 1K6YA 2DLCX 3OWHA 5FRMA 2EHJA 1M2OA 5AOBA 3WLIA 5GVSA 4TTJA 3ELUA 2GN8A 4OI1A 3D2BA 3V9PA 4EW3A 3NNNA 2PSJA 2M4GA 4E21A 3LX5A 1WH5A 5GJVC 2N75A 1DNPA 5JAZA 1PUFA 5IPFA 3D43A 4JQZA 3MSCA 1L6RA 5B30A 2FN7A 4TV9F 1YVPA 4OIMA 1F0KA 3GFLA 1T1JA 2C3OA 4B2LA 2E5NA 1W5FA 1P4AA 3IP5A 2FMTA 4JBNA 2Z5FA 1LVUA 3PPWA 5K3FA 2FX2A 2VC2B 4JJIA 4P4SB 3V6MA 2MBFA 2N1MA 4RY8A 3EGWA 2F1HA 1UZNA 4DLYA 3COPA 3QNMA 2PH1A 1J22A 3N3AC 1XKXA 1RR7A 4B43A 2P5TB 3L77A 3R7WB 2DF8A 2ICWG 1IF1A 2YHAA 4XOIA 3GLKA 4BKMA 1JDNA 3DO5A 3L1UA 3BA6A 4CM4B 4Z49A 2Q1ZB 1LRLA 3FFTA 1R8SA 1NI4B 2XB0X 4DVJA 3IV7A 5GAJA 1QNLA 3DWLE 4YREA 3AR3A 3X2EA 3EOZA 5CAEA 1FTZA 5KYWB 4TZTA 2GN0A 3HOWJ 3OJLA 1QVRA 5DX1A 5K3CA 1FRQA 5CD1A 5JNWA 5FPYA 5L3QB 4U0KA 3W3CA 3ZQIA 4K9QA 2PZJA 4K9OA 3IEXA 2O50A 3AQ4A 5BSKA 3VSEA 1FOEB 2BFCA 4Q6WA 1CUSA 3IUOA 4ESJA 3EXHA 5L3DA 1H2ZA 2POQX 2L9NA 4IQ0A 2WAEA 3FUUA 2BBOA 3WTCA 1F06A 2WUVA 4XOTA 2JRMA 1S01A 4IFBA 3AI1A 2IF0A 2YU3A 3EASA 2DT6A 4EJSA 4FGSA 1Z13A 5KWIA 3FI0A 5JSKA 2NSDA 1NK2P 2X85A 3SX0A 2Z5LA 3BJEA 2DK5A 1FUYB 1SZPA 2G1UA 3AEUA 2XB6A 3AERB 2JLZA 3B9QA 3MCUA 1W1IA 4K7JA 2XWBF 2Z57A 5JHUA 4GQBA 1ZICA 2GPSA 2JASA 2H52A 1VZ2A 2EPFA 1PGNA 1T9GS 3HXPA 1U2ZA 4W6QA 4KREA 2Z2KA 4KQ6A 4X93A 4JYZA 1PU2A 3GU3A 1HLGA 3DZCA 1UC4B 1SA0A 1NR5A 4J7UA 3CRQA 1YUMA 5KKNB 2QGZA 4RE5A 3TO5A 2GK4A 3LW8A 5AI5A 1YE8A 1CEYA 1UELB 1EXNA 3D0KA 1MDMB 1ZY2A 1O7JA 1X3ZB 4AJNA 3HJUA 2L82A 3HXQA 2NVWA 1K97A 4IMIB 2CLSA 3FFBA 1OV4A 2H3EA 3KP6A 1DEAA 2HM7A 1A8IA 3FNQA 1LX7A 2Y0PA 3IQZA 1Z3CA 4ETWA 1GRVA 2HSZA 2VI6A 3FWEA 1SKQA 5EJ4A 2J5QA 3ZQ6A 4KK3A 5GGYA 2DYSH 2Q1YA 2WY2D 3W3ZB 5IYCJ 2Q6TA 4GXTA 3AEXA 1XEFA 1Q3KA 1YG2A 1HDPA 3ECHA 5FPQA 4F46A 3RYHB 5JFGA 2ZZNA 4ESBA 3BAZA 4PZZA 4RVCA 4IGKA 1LDDA 3ZNOA 4C2MJ 3MJRA 4HNQA 1JDJA 4BLQA 3RRJA 4JXXA 1JHPA 1FLAA 2FSSA 2PKRA 2ST1A 5CDSA 3HBMA 3VHRA 4MVWA 4PO3X 4FD2A 5D8DA 2AH5A 4KN4X 3OSZA 2RJNA 1EG2A 2JH3A 2CVZA 1GG2A 1F51E 1JKQC 1QAQA 1DG1G 4BAUA 2DERA 3D2AA 4DEXA 4EUHA 2Q7DA 3ILXA 5EIAA 2PSDA 2BRUC 1JGTA 4IMRA 1XNGA 1QYXA 4CLRA 3DNMA 4YIFA 2J7PD 3QBDA 4KFTA 4R9SA 4INJA 3UKGA 1BKYA 3C3KA 4UMEA 1LWNA 4QUGA 2H8WA 4NP6A 2Z16A 2JAQA 1GNPA 2B1RA 3DQQA 4LB6B 2O3FA 2EZ4A 3BIOA 1DKLA 3TECE 2WC1A 1HTTA 1KDPA 1ANKA 1XZPA 4LVNA 4RXUA 3HPQA 2IGMA 3O8HA 3N59A 3E0QA 3LAPA 1WIWA 5HHTA 2AFRA 5K0LA 1YR7A 1RIFA 4XQCA 1AKEA 4AS3A 4YUVA 1ORHA 1OAOA 5IEJA 2PG4A 1VA5A 3CW2A 3IAM1 2WM8A 3HLKA 4ISBA 4HGZA 5AM0A 2O8EA 3C15C 2Z6UA 1O54A 1Z6QA 5E3MA 4LNHA 1E3WA 3ROUA 2C5LA 5EJ2A 1A5SB 2DOFA 3THRA 4D9BA 3UGJA 2FQYA 3EMKA 4NFLA 4X24A 1CJVC 2F3RA 5L7TA 3DBHB 4AUXA 2R1TB 3C74A 4GIBA 5J1SB 6PAXA 3OYIA 1F48A 5DLQC 3RYFA 4ZC1A 1FEXA 5BOSA 2J9ZB 4D0LB 2V7TA 1E99A 1UWLA 2Z2ZA 1HOTA 5KPJA 1ZM2A 1QIMA 3A6JA 4JYCA 3GFJA 3NWTA 1NAHA 2NS0A 2GEVA 3GZ6A 4MWTA 1ONNA 2KJQA 4MR9A 2XB9A 4FETA 1PK8A 2HIHA 2VJNA 3VAYA 5DTJA 1XQ9A 1XZQA 4HYYA 1U7WA 3O83A 1SBCA 1S2OA 2OGUA 1ISFA 3CQZJ 1RKUA 4RK7A 2O3UA 4RDHA 1BOBA 3KYDA 4E22A 2BM9A 1NULA 2VSNA 4P3YA 2ODBA 3LT0A 3RG8A 1T3ZA 4E07A 4C0AC 2AOWA 2UYYA 5JVDF 1H1TA 1V55H 1M2KA 1K2VN 3SE0A 3JPWA 5FBLB 4I5FA 2V1DA 4BNLA 3ZE0B 1YI2I 1NW8A 3C5VA 3K4CA 2XA2A 1G9XA 4ND8B 3MWMA 1ZNQO 2JK0A 4ZK2A 2QQBA 2WHQA 2AI3A 4MUBA 2E37A 4RD0A 5C31A 2XSDC 1Y8QB 3M1CA 5D5PA 2XYPA 4EX6A 5EJ8A 4QXAA 4TRNA 2FUG1 1MC8A 3OC0A 1TZBA 1VCIA 2LZ0A 5ICSA 3U7HB 4MSUA 4UM7A 3L6DA 2XHZA 2HMVA 1RLTA 2HRQA 2AS0A 2WHEA 4RAYA 2VNJA 4YWJA 3GWZA 4PLYA 2R7ZJ 1A2OA 2WTEA 1CE8B 2IC5A 4MWBA 3RJMA 2HLDA 4HFNA 1ZUNA 2GPBA 5TS3A 3K1NA 1TT5B 4X85A 2CQQA 3K73O 3WNQA 1XPUA 3ZY5A 4D8VA 2FSVC 8ABPA 5BWLA 3FPHA 1XD8A 2IQIA 1NV9A 3MIZA 1KU9A 3F21A 3IA7A 3MGCA 1RD4A 4UTOA 4DXDA 7MHTA 4MMXB 3SQDA 4HNHA 4PX3A 2X0IA 3STUA 5M3BA 2H92A 1AS0A 4CLXA 3UK0A 2FMLA 1DJQA 2I34A 1ZHHA 3DLBA 1XGOA 3R3ZA 4L9NA 3O95A 4CCMA 3DU6A 5INTA 4W1RA 4P9FA 5DW3A 3RC7A 3KTAA 4U2GA 3BIJA 2BKXA 1QFXA 1LUJB 2ODTX 4AX4A 4NCAA 1XWWA 4CKEA 3KBOA 3AM3A 2O57A 3IXQA 4MPDA 4XBFA 3KPVA 1LPOA 3MOGA 1PJSA 4ZDLA 4WACA 5AUOB 2DA4A 2XUGA 4LLGF 4Q1VA 5BPFA 2GWHA 3GGGA 3J7TA 5IJ9A 1AKHB 4YQZA 3HBJA 2VKEA 2GBGA 1HW2A 3DV8A 5JI6A 1ZOLA 1KF0A 2R66A 4QG7A 3QFSA 4IPTA 2G06A 1VC2A 1A97A 4MDFA 3FWHA 2B20A 4GL2A 3CLUC 5IDVA 3ROFA 2IYPA 1NBMA 4NY1A 3PIIA 1TGVA 3CSUA 1CW2B 4JC8A 4DV5B 3TG8A 3I01A 3DMYA 1O4XA 2V7VA 4DY4A 2IIVA 3GCXA 4XJTA 5K7ZA 2E6UX 1US8A 4ZKEA 3RVNA 2HEOA 1JB1A 3HOZJ 4PZDA 1TBXA 2RK4A 3F6SA 2C9CA 3BM5A 2HV8A 4P7JA 3GRRA 1E4VA 1YE3A 3M9XA 4L2IA 3AW9A 3VJMA 5KNLA 1N0VC 5F0HA 3CLRC 1U7UA 4LMBA 4RD1A 3T35A 4QZVA 4ADSG 2QRPA 1G2QA 4M87A 3K1YA 2APJA 1GPKA 2I2CA 1W9HA 4HCJA 2QTLA 3MBKA 1XMOB 3E7LA 1RTTA 3FD8A 2ZCJA 4FFBB 4XGNA 3UXEA 4MV5A 2CHQA 1EUQA 3NHJA 1AB5A 3F97A 4BJ3A 3PNQA 5SYAA 5J4LA 1DO0A 4ZP1A 1PGOA 1KFCB 1MQ9A 4OHZA 3ZK8A 3PSIA 1JEQA 4S1TA 1TCCA 4ETNA 3O9MA 1R0RE 1KVRA 5BT9A 4ZZ2A 3CHYA 3LNTA 3TIFA 3GEGA 1SZJG 4K2HA 4ZCMA 2A4MA 4XD7D 3CUYA 4GOOD 3ETGA 4A12A 4B74A 4DYDA 4MYDA 3DZKA 2VDWA 3ZWXA 2CC2A 4CKWA 4EKDA 5C8ZA 2X8AA 2FPIB 4QWQA 3CKKA 1ZD5A 4L15A 3VV2A 1X38A 3DTVB 3O4RA 2AG1A 4LSMA 2RNGA 5AJXA 5JSZB 2UZAA 1OLOA 3P9CA 2I5PO 2BFEA 3O8DA 2L3DA 2YJNA 3TIXB 1QKKA 2JLAA 5EQTA 3UBMA 5TLSA 4EGZA 4AUKA 4Z0PA 3WGYA 4UHEA 1IQRA 2I10A 2DH5A 5IOYA 2GAAA 3WC4A 4XVRA 2CG4A 4N40A 2XZDA 3Q7SA 2DPGA 3ZI4A 3LQ2A 3AYZB 4JBAA 4CGZA 2Z95A 2ETHA 4A10A 2DTRA 2K5UA 5F2NA 4G8DA 4YRRA 2Y1FA 5LHGA 1E9SA 2H29A 3H7IA 4J94A 4QBFA 5BW6B 4RAFA 1FDUA 4J03A 4BMXA 2O6HA 3HJTA 3SIWA 2QAGC 2K2QB 5A4MS 4MTDA 3WIUA 2PFGA 4I4TB 1QF9A 1IN4A 1PFWA 2RGWA 3X2QH 3WKEA 4HGPA 1KDOA 3NU1A 3W5VA 1E9DA 1WWKA 1HUQA 5FJ8J 4A3EJ 2QVZX 2NU7B 3FVRA 4KX5A 1EEHA 4KR3A 3W8DA 2QEXI 1F8YA 4OV6B 4XIJA 3U21A 1CGPA 2GD0A 2NVBA 3ZGKA 1SFRA 2IYUA 4FKBA 4YBZA 5DD8A 2NUAA 4L8FA 2DODA 1SIOA 3GB9A 4ND7A 3S99A 4D9FA 4DCUA 3IIIA 4N6NA 1MPXA 5G0SA 2FPOA 4M37A 3CEJA 4WAUA 5D86A 5EP2A 4V03A 2V4UA 2JLSA 4C76A 2VRCD 1EGVB 2HCBA 3DULA 4AUNA 4WERA 3OOEA 3BCAA 4B3MB 5BSFA 3NKFA 4LSGA 1OPRA 5B4VA 1ONSA 3T3HA 5AP9A 5LU8A 1M7GA 4JJ8A 4QYIB 1P1BA 2P9CA 4YRDA 1NVMB 2NTYC 3DNPA 3RADC 1DTWB 3AC0A 4YP6A 3WGMA 1UOOA 2NYAA 4YHHB 1J20A 2FOKA 1EE1A 4M9ZA 1YMVA 4FTHA 1E9VA 3B60A 4KXFB 5IT9Z 1EH8A 4F1WA 1YB1A 4M0PA 4XASA 3VODA 3ZEAA 3LMMA 2CCGA 3QFTA 1YONA 2QMHA 3WAKA 2JI6A 1I27A 3CCJI 4UU7A 2YWBA 3OOYA 1BHSA 2Q3EA 1J7KA 3EUFA 1YJAA 3ZVKA 1JEOA 3B6CA 3EBPA 1AA9A 3UPTA 2W9XA 1SWWA 1CJKC 2C5FA 2OCEA 4D8YA 1D4FA 2L7FP 1ZPDA 2BHLA 3W04A 3RVMA 1NMSA 2XGXA 2BDUA 3AWIA 1ZC4A 4OTZA 2K9QA 3W5AA 2QD1A 3EOAI 3ONQA 1W5CC 1QWOA 1DKOA 4UM9D 3U6BA 4OD0A 3VKVA 3Q3IA 3U7FB 1I2CA 2XDYA 4ZQCB 1DQPA 3WK6A 1N6PA 4YFXF 5BV2P 2GKSA 3BILA 2VYVA 5KTSA 4V38A 3OTGA 4Q02A 3G73A 1IHYA 1J2YA 5BPHA 3I1IA 1KR2A 4QRDA 3ADKA 3FVVA 3OCUA 3ZGXA 4AF7A 2CDCA 1I6LA 5IC6A 3DWFA 3USCS 1A2BA 1MAVA 3IDSA 3L1HA 1YCHA 3COYA 3ML1A 4HHEA 3DWIA 4UUNA 4UHJA 4NEQA 2C83A 8MHTA 1TNTA 1CVIA 1XDUA 4JR2A 1ZEMA 3G1TA 1L7NA 3QUAA 4DNOA 3F6EX 4B31A 1XRRA 2JAPA 3NALA 4A8HA 4TTTS 1J0BA 4AG5A 2HK6A 3M6UA 1U5AA 1RUOA 3WL6A 1M1YA 2OV3A 3PHJA 3O82A 2XTMA 1NATA 1B76A 5T4HA 1EK1A 1XHEA 1I5EA 1LE8B 1T13A 3O6VA 4DPLA 4MI6A 3JRFA 5FH9A 3ZR8X 1QLHA 4KNVA 1JLMA 4HDRA 3ZU3A 1EFRD 3ENVA 4HGNA 1CUBA 1SD1A 1RI2A 2BEWB 2E7XA 2IUTA 2VAPA 2X1DA 4L3WA 4CNQA 1BRMA 3ZWVA 4AIIA 1GYQA 1HG1A 4ZH4F 2ATXA 4EY3A 3D3QA 2JFPA 4V39A 4BEJA 5B4UA 1EH5A 3D7RA 1W59A 2WM3A 4KI0A 1V3FA 3SHQA 4ZOBA 2LCFA 2RB5A 2HWKA 5FUBA 1XGKA 2ZMEB 2IGKA 4PR0A 4E2YA 3JCUC 4U2BA 1TM2A 1C2YA 4LE2A 4LNAA 5F1OA 5TGZA 1W4RA 4JJ7A 2XPVA 1ID8A 2J4CA 2PUWA 2WLSA 3C2QA 2R7AA 2HTJA 3E53A 3VPHA 4AZTA 3SEFA 1V7ZA 5TEWA 5CFQA 4JENA 2ZJ4A 4RTMA 4CRWB 1F4PA 1THGA 3HY6A 2FBHA 2OTCA 2JBHA 3AU8A 4BFWA 1NF9A 4EQ6A 2AFHB 2PRSA 4NTZA 4TS4A 2WVJA 2EEPA 2NTNA 1AY0A 4OFBA 3WL3A 2H4YA 3GLHB 2Q1WA 5FTMA 3MF4A 3KUCA 4PINA 5ADWA 1W7PA 3HPGA 5IYZF 1MJ5A 4QQ8A 1EB9A 3KBBA 3HJBA 4ATNA 1FFBA 3QKSB 2XDQA 4JDPA 4BNYA 3BCRA 4HFRA 1QTQA 2MSKA 2Q21A 5EE1A 2CHEA 1HC8A 1WU8A 3I8XA 3TSCA 1LPSA 4LJYA 4XLNF 4YLYA 2MCFA 3H13A 3GEIA 4MWGA 4Y9DA 4P96A 3M9WA 2PANA 5FO1A 1JX6A 1QUFA 1ZBQA 3I4NJ 1TTTA 1CU1A 2NV0A 1NUHA 3TTYA 3KQLA 3K72B 3LHKA 4FCVA 3HA3A 4JQFA 3OM1A 1Y7PA 3CFYA 3W4KA 4ZAVA 3QEJA 3FRJA 4YUZA 2WZQA 1PNOA 5DRYA 5FOWA 4KICA 3WGQA 5I7VA 2GM4A 3ZCPA 4R81A 1HA3A 4BVFA 1UMBB 5AVOA 3ZDYB 1WPQA 1C7QA 1A1VA 4K1XA 4X92A 3G9TA 4DMGA 5CIQA 2A5DA 2G76A 4DIQA 2CMHA 2JW5A 3FCEA 1OLXB 4PAOA 5EIWA 4RZHA 3AP1A 4HEA1 4Z4QA 5E2AA 4X61A 3R7SA 4WA7A 5G41A 5JXJA 1MMFB 5FD5A 3P9XA 3R9WA 4Y13A 5A1TA 4B4OA 2PAAA 3RTAA 5IC5A 5EJ9A 3QG1A 1EXVA 2IHKA 3TMAA 4AB1A 4WN3A 3DJFA 5ILSA 2NADA 2I65A 2VIXA 4NYJQ 1N9ZA 3AF6A 2GAIA 3WLRA 3DHVA 2E1RA 1MENA 2J5XA 4HRIA 4JKIA 2WV9A 1I9CA 4WX2B 2L0XA 2XUQA 3LWDA 5BN4B 1F2DA 3MTQA 3O2NA 1L3CA 1RXYA 2GAJA 4X41A 4L4UA 1XXHB 5JANA 1DIOB 2WOJA 1HFWA 2CKMA 3PDWA 3SFIA 5JY6A 1NOJA 2KLBA 1LK7A 5EMJA 3K1JA 1Z2EA 1H42A 3SQMA 1MXHA 2J33A 1B73A 1M73E 4INPA 1O7LA 5FBVB 2F9LA 1HDCA 5AXCA 4RFSA 3TOVA 1IEVA 1QO0A 1SOAA 1EA7A 6PFKA 3K1TA 1MQSA 2DGDA 2FMFA 4B3SB 2WAMA 1N7JA 5IHXA 2JBWA 1BVUA 2BGKA 3HYIA 1BOAA 2ZSAA 3GYBA 3L00A 2XMDA 2YXEA 3HYTA 4GLBA 3M2TA 3OTWA 2CYBA 5CITA 4K6GA 2JLRA 4HBZA 3WDKA 1JAHA 5TB5A 1AUOA 3DVAB 4LK0F 4HH4A 5FPKA 4XWYA 2TMYA 1I7SB 5BYAA 1ZKDA 1T98A 1W0TA 1KEWA 4AUEA 3RJ5A 1O6ZA 4EY5A 1Z0IA 3P1JA 3CVVA 3CEAA 3LQYA 3CCCA 5KNDD 4HAYA 4Q7JB 4GD3Q 2DMUA 2Q5CA 4C3IJ 5EYPA 3ENQA 4YUXA 3RKWA 3SLGA 2RK3A 1RPAA 3H5TA 2ZVPX 3PI6A 3M3YJ 1E89A 3BDVA 2IE0A 4LGCA 3WE3A 4EGAA 1K79A 4KTTE 1B7GO 1BVRA 4GSKA 4R2MA 1YVRA 5JXGA 4ZHQB 1F6WA 1ZSVA 2DBQA 2VPRA 2I2AA 3L79A 1CWUA 1UJCA 2DCMA 3UMGA 3T41A 4BNJA 2GHTA 1BGVA 1L5MA 4LYFA 1LDGA 3T9FA 4BZQA 2I80A 3K8QA 4LGYA 2IEGA 4C2UA 1RHRA 5EL0A 4M4SA 5J59A 3H35A 1NC3A 2BMDA 4TPKA 5JAPA 1YZFA 3FFAA 3KB8A 3BG9A 1K92A 1GPBA 4DMLA 3DM9B 3C24A 3BREA 2NZYA 3TB4A 1ATZA 1K8XB 1U99A 1S3FA 2W2NA 1YWGO 3QELA 1XRNA 3U1KA 1RR6A 5KSYA 1TYEB 4IRGA 4XDYA 5HG0A 3HI4A 4I9UA 3C8DA 4G9GA 3PSFA 4S24A 1HEUA 1DV1A 3WODF 1QB8A 1CHDA 3NBQA 3VPFA 1GDTA 2XBUA 3FJYA 2OHGA 4UB8C 3EIFA 1Y5IA 3AI3A 3KKZA 1R5BA 3NOVA 2CLEB 3I6MA 3KJHA 3QBTA 5IJAA 4RL6A 2D1VA 4JB2A 4JGIA 4LC1A 5T3YA 4NVRA 1WDKA 1K4SA 4G23A 3BXXA 3EN0A 1WNFA 4CQMB 1YS4A 2EFGA 1IHXA 5KUTA 2P8JA 4YDRA 1WFXA 1P9OA 1CQXA 4WY2A 4BE0A 4NBKA 1MG0A 5CGZA 4V0QA 3OF3A 4JNCA 4PLCA 4XUGB 1N0IA 3L4JA 5JSUA 1I7DA 1DSSG 4J19A 2WSLA 3WLSA 3TJMA 1VIAA 3RBZA 1D2HA 2KX7A 4FDUA 4GLOA 3RR2A 5JC8A 5C7YA 3JAMK 2YUSA 4AWXB 1HXDA 4QGAA 1C0PA 3UM9A 1ML4A 3KAPA 5FRNA 4V2UA 3VKUA 2BKLA 2FMYA 1AF4A 3QA3E 2RAVA 1FFXB 3B5EA 5HBRA 2EV0A 3H9CA 1YJWI 4R0MA 2IY7A 3G88A 4CG1A 3GUZA 1MVLA 4C78A 1E6UA 4MQUA 3I72A 3V00A 3IAS6 1TWHJ 2X8JA 1VKHA 2D1SA 1UP6A 4YPOA 2Q5FA 3DOFA 3LY7A 4P5PA 3R0ZA 1ZRFA 1N1GA 3PWZA 3D1JA 2GBLA 3B85A 2P9QA 3R4KA 3DBRB 1IE3A 1GPWB 5GAHJ 2WA1A 1IB6A 3AM4A 1TRKA 2P2LA 2Y76A 4HDKA 1EDBA 3KSZO 2GBPA 2V4MA 2QD5A 1V5FA 3WRXA 2F9FA 1VQ1A 2FRDC 3K4PA 3OFJA 2GK6A 3W2IA 2H17A 4MW5A 1MJBA 4PO8A 4HN9A 3K9HA 4ZZLA 4GOXA 2GX6A 4QOJA 5F33A 1Y3IA 2XYQA 3F8CA 4R7GA 3T3OA 1CD5A 4G41A 1L5SA 1RBMA 5EGOA 4E33A 3AK4A 1BH2A 5BMZA 1YXMA 4TV9A 4WZZA 1RAEA 1LV8A 2HIAA 3A36A 1G7TA 3PFNA 5JCJD 3DKRA 4KH1A 4JIMA 1ZOSA 3ZXYA 1QGZA 1T5IA 1JVNA 3L84A 3NT4A 4LVOA 3DZIA 1Z37A 5LHHA 1J7JA 2FPXA 3K2IA 4P3OA 4P32A 5IWAB 2WTUA 2M0CA 2WJPA 5EAIA 3R7NA 4QYWA 5CYVA 2JIZD 4C2AA 5E8JA 3CD6I 2BEUB 5A3RA 3FTFA 1Z2NX 3ETDA 5EUCA 3CJQA 2E60A 4PYRA 3THXB 3HZRA 4EI9A 2G09A 2JFUA 4KWTA 1NZDA 3I55I 2RDPA 1Q7GA 1VSVA 1GU7A 2P7IA 4CXFA 3ZHTA 2JZOA 1IG3A 5A4JA 1UFOA 4MQFA 5AHWA 1XG1A 4BB5A 3A0RB 1UKAA 3CRMA 1KARA 3T3PB 4KV7A 4D3DA 4YJ3F 3KZOA 2KSQA 1NI5A 3KUXA 2CNDA 4EDHA 1N25A 3EDRA 1X7HA 1XG5A 2J5BA 1O6FA 3JQGA 1EP9A 3FXQA 1SUDA 1CY0A 1A9TA 1E9AA 4BFXA 1CK4A 4E7KA 5JMPA 1Q0LA 3MJTA 2VOPA 4MXDA 2WMOB 4Q6BA 5BSTA 2PHZA 1TKBA 4BIIA 1WUTA 2HO4A 5AKIA 1CQWA 1V8BA 2W85A 1ESZA 3ORQA 3OX1A 1YJ9I 4IKFA 3TPFA 4R1MA 1FXSA 4O4JB 4RKYA 5AI8A 3H0GJ 1E3MA 3I6BA 5JCOA 4LMPA 3FZQA 3UJBA 3GTLJ 2GPAA 3H3UA 4R8SA 5BNGA 4C0KA 3JTGA 2O5VA 1T2VA 1BU5A 2HPZA 3U9TA 2G0EA 4L6IA 2Y0SA 2JA5J 5BSGA 1MD9A 2L69A 4A92A 3DT8A 1CS0A 3VAZA 1ETVA 3WX0A 4P3PA 4LZNA 3HRMA 4MZDA 3RK4A 4RM3A 2WUFA 3W1EA 1NUAA 4FZVA 5JR3A 1QXSA 4URVR 3DP7A 3JSAA 1HNXB 4FSXA 1JECA 2W6JD 4PSXA 5DCMB 3D0QA 1S72I 1ITZA 1NXSA 3T7KA 1YZLA 1J8YF 5BRAA 2DQ4A 2WHPA 5CHEA 2AC7A 2Q8NA 2VL7A 4CMIA 1HDYA 4BNXA 1Y81A 4B7ZA 5DDGA 1O5IA 4OF4A 5ECYA 3ZD9A 3QITA 5FLYA 4NDNE 3E5NA 3R3YA 1BEEA 3U17A 4X60A 1ZSYA 1R64A 3E8MA 4FKMA 4NS1A 4A3KJ 4XLLA 5KSZA 3R76A 1FZTA 3KKPA 4BVKA 1XVLA 4GL4A 4WKBA 2O48X 3A9WA 1SD4A 1PF7E 2NXNA 3CCUI 4Z0HO 1W6UA 3HTUA 3STVA 4EG3A 3TUJC 4O4LB 2E82A 3D02A 4BQQA 1ESNA 1UH5A 3G9UA 5BNFA 3RS0A 4E7HA 1FIUA 3G2HA 2LXNA 2FI1A 5AXDA 3KP5A 1CB0A 4BS9A 1FYLA 3SC6A 1UWCA 2UXBB 3TNJA 4JX4A 2J32A 3RHSA 3DW3X 5EZ5A 5GPBA 3U4AA 3LDAA 1VKNA 3ZXUB 1PJ2A 1ZGCA 5IT4A 3VEPA 4AP6A 4PYIA 1EVZA 2QJOA 3JR3A 4C0LA 4V3BA 3H7AA 1ZJYA 3HUTA 2O14A 1I33A 1YTUA 3PIOF 1W73A 3CW9A 3Q3JB 5E2IA 5CT9A 3U4QB 5F5NA 2DC1A 5J58A 4E2XA 2EFPA 2CVQA 4HUQB 1FDTA 3TRIA 5JADA 4M71A 4WOKA 3CE6A 1HOXA 1I14A 5FFXA 1WOMA 3MT7A 1NXVA 2FXIA 4BTVA 4WNAA 4ED9A 2JPDA 3ZJ5A 3VU9A 4QJ3A 3FXKA 5FI3A 2NV6A 4CCYA 1LFBA 1BD3A 4ZXPA 4GQIA 3GIDA 2JUGA 3ZHCA 2R65A 4M7OA 4C5BA 2XGDA 3VH4A 1I4EB 5LKRA 2VTBA 4G6ZA 3GHHA 3F6OA 2IA5A 1IHDA 3ACDA 1N78A 3M1LA 2JGIA 4M1WA 3BTJA 1VIDA 4ZTZB 1R22A 1M0TA 1T3HA 4QDOA 1GPYA 2Z9DA 3FWNA 1DQRA 1J59A 5AKZA 3WLMA 1BR2A 4BEBA 1ZA2A 1SC4A 2AKYA 5CHYA 3TLJA 2OILA 1AOXA 3KQPA 3B2EA 1PL8A 2PWPA 4BKOA 1NLZA 5GGXA 1K2WA 3ONFA 3IJ5A 4S2UA 4L9WA 1RWWA 2FMIA 4MQ5A 4LF5B 1W52X 4EO9A 5ILUA 3B5IA 2Q9UA 2WA2A 4Q3OA 3TP0A 1GOTA 4YFYA 1L4FA 3U16A 1GZHB 4N18A 4F0JA 2HJSA 1LS6A 4CM8B 3OLYA 3VPCA 1A96A 2BTQB 3PJGA 4OHKA 4KR9A 1FC0A 2GCPA 3LLSA 3LUAA 4M0DA 1QHHD 4E2ZA 1U7ZA 3GPDG 3UIEA 4L50A 3RK0A 2NO7A 2YXNA 2V7WA 5KZMB 5E6RA 5FLXA 1JSCA 2Y9YA 3PHLA 4AY2A 4TV8A 2QJWA 4I9HA 1CQJA 2ZXEA 5KQGA 2H1CA 2WLTA 3RPEA 1EFAA 1U7TA 2CMDA 2UUZA 1QCDA 4X1KB 5JVDA 2QJFA 1Y6QA 1OOEA 4XEHA 4N4NB 1ZVMA 4CH7A 1CQIB 1X80B 4J49A 2QTTA 4INOA 4N7JA 4OYRA 1OBHA 1FUEA 1E0SA 4MEBA 1U5BB 1PX0A 5KSPA 3MWDB 4BRZA 4RVHA 1MTZA 4RTKA 3OFKA 5J5AA 1BU8A 1ZH2A 5EY5B 2D0OB 1IV6A 2PT6A 1MIOA 1XMSA 4P4UA 5C80A 1AOYA 2XPUA 2QLMA 1ZI8A 3NHFA 4FT8A 2ZRQA 3GUUA 2HYJA 3AWDA 1SD6A 1PSDA 2NN3C 2ONYA 4HRVA 2R60A 3JRDA 5E7QA 2PV0A 1BSVA 4NICA 1KZHA 3U2RA 1KRHA 2VSOA 1MJGA 3HSSA 3EUWA 4UNQA