3VOEA

Crystal structure of wild type marr (apo form) from e.coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
136
structure length
136
Chain Sequence
NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Multiple antibiotic resistance protein marR
publication title MarR structures
rcsb
source organism Escherichia coli
total genus 42
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3voeA00
1MD0A 1XCVA 3BJOA 1T2KA 1ZRDA 4HAMA 4KICA 1KYWA 4A0XA 3BOQA 4LK1F 2VBZA 2G7UA 1ZH5A 4EJUA 3RDIA 2HKOA 3GZ5A 2FXAA 3IKTA 4LG0B 4ZZDA 2PFBA 2HQNA 4M9ZA 5LGTA 1YO5C 1SD6A 2O61A 1R22A 1R1TA 4WXCA 5E1WA 3HRMA 4DNCA 4G7HF 3P9CA 2Q2EA 4HW0A 3TDZC 4ESFA 5HS9A 4LB6B 4ESJA 3ZMDA 1VTNC 1ZN2A 3FXQA 3QRFF 2OU2A 2IW5A 3K1NA 1JXSA 3I54A 3WTUC 2GA2A 2IT0A 5D5VB 5BS6A 5K5RA 2M5WA 4RGUA 1EH8A 4KIFA 3C1DA 2ZFWA 3ZPLA 2BGCA 4Y13A 5L3EA 3KP2A 3IWZA 3BWGA 1XGNA 3K1MA 1LVAA 4YFNF 3HTUA 2EV6A 1BOAA 1Z9CA 1HW1A 4AWXB 1XD7A 3J7AO 2K4JA 2EA4A 3PQJA 5HLIA 3FWEA 1XDUA 4XSXF 3K0LA 5E8GA 1R5HA 1KA8A 1ULYA 2QLZA 3I0TA 4Q4ZF 4LMYA 1G6NA 3IHUA 1MDMA 1TW3A 2D1VA 1CGPA 3U9GA 1O3SA 1MKMA 3HHGA 4KMUX 1ZLKA 2DTRA 4Z2YA 4NB5A 2WC2A 1JHHA 4QWQA 3B73A 5KK1A 4HX7A 3R4KA 2OAZA 3E5XA 1LQ1A 5E18F 3H92A 4G8XA 3W6KB 4R79A 2EK5A 1FNNA 3NRVA 4LLGF 2E1NA 2GQQA 3O2PE 4ON0A 3F8MA 4I7HA 5CVVA 3ZMTA 2K4BA 1SD5A 4RAYA 2LSOA 3QAHA 3V7CA 2HWVA 4GO1A 3I71A 1I1GA 3NEUA 2Q8KA 3HOSA 1JHFA 3EQLF 5FB2A 1PUEE 2V1UA 1P4XA 1FYLA 1BC8C 5L3BA 4M9XA 2QQBA 3CTAA 4M74A 5ERIA 5HVQC 1SAXA 2ADUA 1XSXA 2PMUA 1Z05A 3DFGA 5BMZA 1FYKA 2VN2A 2K27A 2RNJA 1IXCA 2PG4A 4UV8A 3SQNA 1FZPB 2EJRA 1G3YA 3F23A 3WU1B 1AOYA 3KP6A 1FBSA 3F8CA 1USTA 1ODDA 2BEOA 4G94A 5ILSA 2XASA 1ZGAA 3F22A 2QUFA 5L3CA 3M8EA 3M8FA 1D5VA 1KGSA 3TKYA 4A5NA 3LFKA 4S05A 2K7LA 2Z5UA 2OA4A 2XGXA 4MQ9F 4QLCU 1FBQA 4B8XA 2XHKA 4HA8A 3KZZA 2JPBA 1LJ9A 1R36A 1K7AA 5CVJA 2DK8A 3F8FA 3FF5A 4L0YB 3DKWA 4Q48A 1Z1DA 3VEPA 3EETA 4XLPF 1S3JA 3ML6A 2QBYA 2A5YB 5LEKA 1R58A 1UHMA 1WI9A 2LF7A 1JE8A 2O0YA 1O3TA 3RI4A 3RIRA 3T8TA 1S8NA 1XMKA 1IXRC 2JPCA 4RB2C 2ISYA 4KT5C 1R00A 1RUNA 1IXSB 1SFEA 1R23A 3HSRA 2NAZA 2FMLA 2KIMA 3EYYA 4RS8A 5DUKA 3M9AA 3FXUA 5K1YA 4D0PA 5D4RA 2F5DA 1O7LA 5J8CA 2FNAA 4CZZA 2A68F 4BHBA 1OPCA 2KJBA 2K86A 4LLNA 4R8HA 3K2ZA 1SMTA 3Q9VA 1LEBA 2WWYA 1FP2A 3TO7A 3FM3A 3V7RA 2O8XA 4KN7X 4L9JA 1U5TB 3RKXA 2COMA 3ISPA 4BXUA 4M72A 1XGSA 1J75A 1FP1D 1YIOA 1FPQA 3GO5A 1F1ZA 5DD4A 4ENMA 5E1ZB 1P4WA 3WTWC 2OZ6A 5DV5A 3T0YA 1EH6A 5LBQA 1D8KA 2DU9A 2MA3A 3HRSA 2ELHA 4KYWA 2VODA 3LAPA 2LF8A 4OOIA 2PLYA 4FX0A 4U0VA 1F9NA 2MLKA 2EFPA 2ZBKA 5DEQA 3BPXA 3LSTA 1BM9A 5BQTA 1GVJA 2BYVE 1Y0UA 3TDUC 3JAMZ 5LLQA 3ROUA 1XN7A 3JSPA 4PZJA 2E7XA 1U2WA 4LG0A 2H6BA 4TV7A 2RV8A 1HW5A 4G7OF 1XSVA 3JSOA 1U5TC 2EV0A 5HDKA 2HYFA 4R1HA 2EFQA 3ZN1A 4AIHA 5D5WB 4MEYF 1YS6A 1ZAOA 1LDKB 4M6XA 4XBFA 3IRQA 5DCFA 1L3LA 5AONA 1L0OC 2GIVA 3G3ZA 3CUQC 1QZZA 4EGYA 4ENJA 5CVIA 5HS8A 2QM3A 2M30A 1XB4A 4BYYA 1FBUA 4EM1A 5LEJA 2GA1A 2D45A 2CG4A 3HRUA 1Z6RA 3KCCA 4S04A 2XKOA 1YS7A 3F6OA 1G3TA 1B9NA 4UNOA 1SD4A 4EV0A 2CWEA 1PP8F 4LJZF 1MZBA 4IHTA 1YYVA 3RJPA 3L7WA 3N4MA 2Z33A 2ZJ2A 1USSA 3QP6A 1FSHA 5E17F 2HS5A 3GFLA 4KDPA 4KNYA 3D0SA 4BHCA 4MTDA 1IRGA 1FWZA 4E70A 1HBXG 2PEXA 1KU7A 1FC3A 1OYYA 1T6SA 2IVMA 1DP7P 3E6BA 1IW7F 3C18A 2RGVA 1TW2A 2XAGA 2EWNA 4G7ZF 3M1EA 2CO5A 1ONVA 1S6LA 4AIKA 3I64A 5DCMB 2ZO4A 4HX4A 1HKSA 3V8KA 3H3ZA 1X3UA 2NNNA 2LKPA 2FQ3A 4ETSA 3K9TA 3TQNA 3DXJF 4A2UA 4L9VA 4CO8A 6PAXA 3G73A 3L00A 3L09A 1CF7B 2DO7A 4O5VA 2L54A 4IVNA 2KJCA 1ZG1A 2V1DA 3MCZA 4YIFA 1QNTA 2WV0A 4CHUA 4KIBA 4HLXA 4EM0B 2M1BA 1ZREA 3WE3A 5F1RA 2MD5A 1H9GA 2M45A 5HDGA 1XCBA 3KEQA 2E7WA 1P6RA 3O3KA 2D1HA 4IRGA 1XGOA 2XAJA 5H20A 1FYMA 2IPQX 1HSJA 2PN6A 5L3FA 5JI6A 5CVRA 4RGRA 5AIQA 3FZVA 3HHHA 4GXOA 5A2QK 3I53A 2O03A 4KIGA 4EGZA 3B02A 3F3XA 4ZYDA 1O3QA 3ZMVA 2YSRA 3BP8A 1UHWA 2F2EA 4RB1A 4HX8A 2MBFA 1RUOA 4U0YA 1BI2A 4CXFA 3KLNA 2VC0A 1UB9A 3D5LA 3FM5A 3HYIA 3R0AA 4Q5SF 5BPDA 2VT2A 3GFJA 4ZYGA 5L3GA 1RIOH 1DDNA 5A2QZ 2DK5A 4KN4X 2VT3A 3DP7A 4GCVA 1HW2A 1TQPA 4YIIA 4EJTA 1J9IA 3VFZA 4WX9A 3SXYA 1ZG3A 4H0EA 3LA7A 3GZ6A 1QO0D 3R6SA 2QZ8A 2K02A 2ETHA 2A3SA 4IJAA 1WSUA 5CJ9A 3OV8A 2FSWA 3AAFA 1KU9A 2UXNA 4M6YA 2M8EA 1OYIA 1SD7A 2H27A 1XSDA 5FO5A 1J7KA 1H0MA 2P7VB 2XROA 3FXRA 1ZHFA 2FMYA 4PGHA 1W5TA 1R1UA 1J5YA 3FHZA 3CJNA 5D8KB 4BAYA 3GXOA 5EEHA 4FX4A 5TRDA 4I0AA 2YPRA 1DUXC 4MGRA 5F64A 4K2EA 4P96A 2Z99A 4EJVA 4OMZA 3KP7A 4ZH4F 1U5TA 4L18B 1BI3A 2VE8A 1SFUA 1T98A 2HDCA 3LA2A 1RNLA 1V4RA 2DQRA 2G9WA 3KP4A 2MH9A 2G7HA 1B1BA 4KMFA 4HQEA 3PQKA 1HKTA 1MJBA 1BI1A 5LHHA 1YLFA 3CUQA 3MQ0A 3N97A 1B59A 3GFIA 4I98B 1HQCA 4G9YA 5DUIA 2R3SA 4RB3C 4LB5A 5D5XB 2B0LA 3WGGA 1BJAA 4IHSA 2X4HA 4O3MA 2DW4A 4G6DA 5FFXA 1BIAA 5L3DA 2E1CA 4WXHA 1TLHB 4A6EA 2DBBA 3GUDA 1DPUA 1FSEA 3ELKA 2GZWA 2RDPA 1WQ2A 4KUMA 2MC3A 4RAZA 1KU2A 2BV6A 1KQ8A 1W7PB 5LHGA 5DYMA 1IF1A 2PBIA 2P4WA 3GF2A 1O57A 1W4MA 1J0RA 5FFZA 2KKOA 2OBPA 3GVAA 3ZQ7A 1BN5A 2RC4A 4WXDA 2W84A 2P5LC 3HRTA 1K78B 2DPDA 2BE5F 5JR3A 4L0ZB 1D8JA 5J8FA 4XSZF 1T38A 2NS0A 1EH7A 2TDXA 2GXBA 1WRJA 2VBWA 5H6RA 3V8LA 3FMSA 4PGGA 3E5QA 1LDDA 2JZYA 2AXLA 1V3FA 4IXAA 1QGPA 3QP5A 2VE9A 4ESBA 2V1XA 1TTYA 3T8RA 4XRFA 2HEOA 2V6CA 1EV7A 2ZCWA 3ZN0A 3WTSC 1TQIA 1B4AA 2W25A 4BQAA 1C0WA 1R5GA 3P7NA 3WE2A 1MJ9A 2ZMEB 3ZMUA 4LK0F 2RVCA 3DF8A 1Z6TA 5AIPA 3LAJA 3JAMK 2ZNYA 1K79A 4UVBA 1P4AA 2EA2A 2PMHA 2GWRA 3SZPA 3RYRA 2OQRA 1I1SA 4EQQA 4JQFA 1I27A 5FLXZ 1RZ4A 2P5VA 4Q47A 2A69F 3K1PA 4UVAA 2AS5F 2C6YA 2MLGA 2NYXA 4JBAA 2L4MA 2Y0MA 1HKQA 2XV4S 1R1VA 1IAWA 4CDGA 3I4PA 2PI0A 2IA1A 2KIFA 2EB7A 3TO6A 1XDSA 5FD6A 4G6QA 2YR2A 1MGTA 4ENNA 3J81K 3GEZA 5KVRA 1IN4A 2F5FA 4I01A 3WG9A 4WF2A 5ILUA 3KETA 1YW9A 2L02A 4A0YA 2D2WA 3JTHA 2FBIA 4WWCA 3MAJA 4HZFA 2ESNA 2HFHA 3J81Z 2WTEA 3BDDA 2FEZA 2KRFA 1YW8A 3MFKA 5LRRA 5D6EA 1YW7A 2A61A 4MNUA 3FX3A 4I0BA 1IN6A 4OU0A 1YFHA 1QPMA 2UXXA 1IN7A 2HOEA 2CGPA 3KZYA 3ERED 1IN8A 2CW0F 4IRIA 2UWMA 2UZKA 3C3WA 1J59A 2P6SA 2FOKA 1O7FA 4U88A 1ZRCA 3VODA 2DAOA 2F5CA 2FBKA 1HSTA 4UHTA 1S29A 2J5OA 4MHGA 3F72A 3L9FA 2FU4A 3I59B 2DT5A 4U0WA 4YFXF 1ZARA 2HGCA 3KP3A 3J80K 1GHCA 1T0FA 3JW4A 3DPLC 1W7PD 1MJAA 4MTEA 2XVCA 3HOTA 2STWA 4GYIA 3IC7A 3MWMA 1Q1HA 4A5MA 3V8JA 2XUBA 2V9VA 4HOBA 4OIOF 4A12A 1G3WA 1OKRA 1I5ZA 4EVIA 4WCGA 2IP2A 1R7JA 3CO7C 2DLLA 3MEXA 5LGUA 3J80Z 1U78A 5CYVA 2IRFG 4UV9A 1LNWA 4AIJA 3H3UA 2R7FA 1WKMA 4I02A 4Y17A 5HS7A 3ECHA 4JK1X 4HBLA 2DFIA 4HF2A 2L4AA 4P9FA 2RN7A 2OQGA 5ICEA 2VC1A 3IRRA 2H6CA 2DPUA 1W5SA 2EFNA 2W85A 4NQWA 4AD9A 3Q5FA 3GX4X 3F6VA 5IT3A 4ZZLA 3WTXC 3KEOA 4PDKA 3WTTC 2XRNA 3HSEA 1OYWA 3WODF 3LQRA 3FMQA 2YX4A 4NHJA 4I2OA 2HTJA 4KFCA 4FHTA 3EYIA 2FA5A 1P92A 1H9TA 4LGWA 4F7ZA 3R60A 1TQMA 1E2XA 5DD8A 3IWFA 4CICA 2H94A 2QQAA 1ZYRF 1FY7A 3SZTA 2JSCA 2ZNZA 3BJ6A 3RYPA 4P55A 5D4SA 1Z7UA 3GLXA 3COAC 1B6AA 2FE3A 4GGGA 2JRTA 3ABTA 3QU6A 5HDNA 3CO6C 1IRFA 3KP5A 3R0JA 1RI7A 4M9SA 5HLHA 2IJLA 3LA3A 5E20A 2RKHA 2RQPA 2HYGD 3FMRA 3PFIA 1HXDA 4GYGA 4L5JA 5ICFA 1WWXA 2OD5A 2CSOA 1YQAA 2JTVA 4EJOA 2R7DA 4L5IA 3GYHX 2P8TA 4LLLA 3E6CC 1AWCA 1W7PA 4OMYA 3DEUA 5D6FA 4HF0A 3F8NA 2NRAC 2HZTA 2LDUA 1ZGJA 4XLNF 2Y48A 1DPRA 2QQ9A 1U3EM 3T1BA 3CDHA 2JT1A 2P5KA 3REOA 1GXQA 2P7CB 2ACJA 2FRHA 2OZUA 3HTSB 2J5PA 1KYZA 3IL2A 4M71A 5JVTA 2IA0A 3WTYC 2LNBA 1K78A 2Q0OA 4UXNA 4HYEA 1SFXA 2Z9OA 3RPQA 5JHUA 5FD5A 4PCQA 4A6DA 4CGZA 4KA4A 1B9MA 2VOPA 2KIUA 4ZYHA 4HDVA 4RGSA 3IKVA 1QQIA 5BPIA 1D3YA 2H09A 4I09A 3S2WA 4CYDA 1FOKA 4LD5A 3Q9SA 1BC7C 2FBHA 1LEAA 3MZYA 3EDPA 3MZHA 3GWZA 3CLOA 1J2XA 3TOAA 2ZMEA 1ZLJA 5E8IA 3KFWX 5IT9K 2YX7A 4OINF 4ENKA 2W24A 3VOEA 3TO9A 3K69A 3QU3A 5E1XA 3DQVC 5DDGA 4FT8A 2QWWA 1Z91A 3C7JA 3E6DA 4WK8F 2L3DA 2Z3YA 2M87A 2EV5A 1FX7A 1QZYA 2XAQA 2GAUA 5ICCA 5IT9Z 1YTYA 4YFKF 1O3RA 3BY6A 1MDMB 3L2CA 1ZG5A 1G4DA 2NNYA 1FLIA 2CFXA 2STTA 1P2FA 5HOOA 1U8RA 3M7GA 4Y15A 3SFZA 4DQ2A 3JTGA 2O6GE 3BJAA 1T39A 2PJPA 3QPHA 5ED4A 4UVCA 3E3VA 3WU0A 1ON1A 5LRSA 1ON2A 2BBYA 1UFMA 3O6BB 3WGIA 3I5UA 4MQVA 3HIFA 4HV6A 4RB0A 3ABUA 1ZRFA 1BI0A 3NQOA 1IN5A 3RTRA 2ISZA 3ZP5A 4OIPF 3WTZA 2A07F 3DPTA 1JGSA 4L9TA 4ASNA 4U7DA 2VOOA 5HLGA 1KU3A 5K5QA 2F5EA 1YG2A 4BHPA 1OMIA 2Y75A 1S7AA 2YU3A 3V4GA 5FLXK 4L9NA 5CLSA 1PDNC 1XMAA 2CYYA 2CQKA 5H6QA 3I58A 3I59A 3RKWA 2X0LA 4N9HA 3EUHA 1REPC 1A04A 3RKYA 2DI3A 3ZMZA 5EEGA 2ZKZA 3RPUA 4HV5A 3ZMSA 4IRHA 3HUGA 3VB2A 2IA2A 1KQ9A 4O6JA 1F4KA 3KLOA 3CUQB 3T5XA 1I6XA 4HDUA 3E5UA 4BH9A 3GFMA 4HLYA 1OR7A 4LFUA 5D8LB 2DQLA 5LGNA 2PQ8A 2XIGA 5FGMA 2QENA 3R61A 3LWFA 2VXZA 1TBXA 3SHFA 5TJJA 3LQQA 5ILVA 2VONA 2A6HF 5DCMA 4UUVA 3U2RA 1S7OA 2MH2A 2HR3A 5LHIA 4HQMA 2QYOA 2QBYB 3TOBA 4EM2A 3P9IA 5J6XA 3WTVC 3DV8A 3BZ6A 4RGXA 4OIRF 2L01A 3ULQB 4AVPA 2ESHA 3WGHA 1CF7A 1TNTA 1PP7U 1LB2A 3W6JB 2GXGA 2HQRA 1UCRA 3GW2A 3CUOA 1LDJA 3E97A 1TNSA 2O3FA 4M73A 1FT9A 4U7BA 3HSFA 1BIBA 2HTSA 1E17A 4OIQF 3U1DA 1NHAA 2P6TA 5CVUA 1QBJA 2V79A 3BROA 2EFWA 4B09A 5K5OA 4A0ZA 3F21A 4EMSA 5JFRA 3V7SA 3E6MA 2W57A 5F6FA 1XGMA 3OOPA 2ZXJA 4N0BA 4P5OA 1IUYA 2EFOA 3KE2A 3QOPA 3F8BA 1GXPA 2FNPA 2QVOA 2HKXA 5D5UB 4P9UA 3BPVA 1U6GA 5BOXA 2VBYA 4IPAA 4HF1A 1STZA 4YG2F 1F5TA 2FF4A 3QPTA 4MEXF 1SMYF 1K6OA 1IZ1A 2XAFA 1G3SA 3ECOA 2XKPA 4ZYEA 2A6EF 3TGNA 2VBXA 2XAHA 4N9IA 5ICGA 3P9KA 1BBYA 4IF4A 4EJWA 4BNCA 1KQ0A
chains in the Genus database with same CATH superfamily
1MD0A 4XORA 1XCVA 4QTRA 1GDTA 3BJOA 1T2KA 3ERMA 1ZRDA 3PSFA 4HAMA 2X48A 4KICA 1KYWA 4RA2A 2CV2A 1QA6A 1TT0A 2L7ZA 3UR3C 4A0XA 3BOQA 4LK1F 4XLAA 2VBZA 2G7UA 2ELJA 1ZH5A 4EJUA 3RDIA 2HKOA 3PL8A 3GZ5A 3QPSA 1FIAA 2FXAA 3ZQFA 3IKTA 2IXSA 4LG0B 2X1CA 1NK2P 3N05A 1ORKA 1P7IA 4ZZDA 1E3PA 4FE7A 2PFBA 2HQNA 2XF7A 4AU7A 5IOZA 4M9ZA 5LGTA 2VJ4A 1YO5C 2LY2A 3BR1A 1SD6A 3W2WA 5B5EC 2O61A 1BOBA 1R22A 1WCMJ 2GLOA 2DA5A 1R1TA 4WXCA 5E1WA 2FOWA 3HRMA 3LOCA 3HEFA 1VQ6I 4DNCA 4G7HF 3P9CA 2Q2EA 1ETYA 4S0HB 4HW0A 3FISA 3TDZC 4ESFA 3S1RJ 1OCPA 2ZB9A 5HS9A 4LB6B 2WA0A 4ESJA 2B7EA 3ZMDA 1VTNC 3VYTB 3OS2A 1ZN2A 3JRCA 2DDBA 3FXQA 5JHFA 3QRFF 1Z0XA 2OU2A 1U0JA 2IW5A 3K1NA 1JXSA 1V5FA 3K4CA 2AXTC 5KCMA 3I54A 3WTUC 2GA2A 2IT0A 4CCMA 5D5VB 2CUZA 4D7MA 2YU9J 1SVMA 1DU6A 5BS6A 2KZGA 2RREA 5K5RA 1W36C 2M5WA 4RGUA 1EH8A 4KIFA 3C1DA 4OAZA 2ZFWA 3MMYB 3ZPLA 4E7HA 1GV2A 3PJRA 2BGCA 4Y13A 2DCEA 5L3EA 3KP2A 2EBIA 4DYRA 3IWZA 3CF5F 2EZIA 4XLFA 3BWGA 1XGNA 3K1MA 1LVAA 4YFNF 3HTUA 2EV6A 1BOAA 3HDDA 1Z9CA 1HW1A 1N78A 2VQHA 1AA7A 1MNMC 3S2HJ 5GAGJ 4AWXB 1X3WB 3OYHA 3D5RC 4MFEA 1XD7A 5HLTA 5CPRB 3J7AO 1X4OA 2K4JA 2EA4A 3PQJA 5HLIA 2N8GA 1WVRA 1XDUA 3FWEA 2NS8A 2R7VA 4XSXF 2HPMA 3K0LA 2M0CA 5J40A 5E8GA 1R5HA 2K9QA 1KA8A 1ULYA 2QLZA 1M1EB 3I0TA 1BW6A 2R0QC 2R5ZB 2I5UA 2L9RA 4BBRJ 4LMYA 4Q4ZF 3EPZA 1G6NA 3QODA 1WGXA 1ZTRA 4W97A 5DS9A 3IHUA 1MDMA 1TW3A 2D1VA 4D5FA 1CGPA 1AU7A 1IDYA 1RETA 5C4XJ 3U9GA 3CZ6A 1O3SA 1MKMA 4HSTA 1XC5A 3HHGA 4KMUX 2NXNB 1ZLKA 2DTRA 3OR2C 2ZC2A 4Y33A 1U9OA 1MMDA 2KMUA 3CDLA 4Z2YA 3DLLF 4NB5A 2VJJA 2WC2A 1XTAA 1U8BA 1JHHA 4QWQA 3B73A 5KK1A 4HX7A 3BG3A 2LKXA 3R4KA 2BVMA 2OAZA 3E5XA 3HM5A 2K85A 1LQ1A 2D5VA 1OLTA 1QPIA 5DTDA 5E18F 3ASNH 3H92A 4G8XA 3W6KB 4R79A 2EK5A 1FNNA 5F04A 3I56I 3NRVA 4LLGF 2E1NA 2EILH 1OFCX 2LTPA 5KHDA 1UAAA 3MVPA 2GQQA 3O2PE 4ON0A 3F8MA 3M07A 4I7HA 3PSIA 4RLFA 5CVVA 2K4BA 1SD5A 3ZMTA 4RAYA 2LSOA 2CV0A 3QAHA 3V7CA 1X58A 2M8GX 2HWVA 4GO1A 4M3GA 3I71A 1I1GA 1BL0A 2CW7A 3I4NJ 3NEUA 4NQWB 2Q8KA 3HOSA 1JHFA 3EQLF 5FB2A 1PUEE 2V1UA 3H5NA 1P4XA 1FYLA 2V7FA 1BC8C 1Z77A 2BW3B 5L3BA 4M9XA 2QQBA 5F0FA 3CTAA 3RPUD 4M74A 3GTGJ 5ERIA 5HVQC 1SAXA 2ADUA 3AFHA 1XSXA 2PMUA 3PM1A 1Z05A 2M9HA 3DCFA 3DFGA 3AG3H 5BMZA 1FYKA 2VN2A 2EPFA 3CCJI 2K27A 2RNJA 2DA3A 2DJIA 1IXCA 2PG4A 4UV8A 4BUPA 4NDLA 3SQNA 3S1QJ 2I8DA 1FZPB 4U87A 2EJRA 1IO2A 1G3YA 3F23A 1K4TA 3PNYA 3WU1B 3JRGA 1WPKA 5GADJ 2L0KA 5CKTA 1AOYA 3KP6A 1W5CC 5IOYA 2XB5A 1FBSA 3F8CA 4V2GA 1ZQ3P 1USTA 1ODDA 2LH9A 3FHNA 2BEOA 3LMMA 1RRJA 1N75A 4G94A 5ILSA 1UMQA 5J1YA 2XASA 3OR1C 1ZGAA 2PX9A 2QUFA 5L3CA 3M8EA 3F22A 3M8FA 3H35A 1MMGA 1W36D 1D5VA 4IQJA 1KGSA 3TKYA 1OQYA 4A5NA 3LFKA 1YHQI 5FLVA 4S05A 2ZJPF 2I10A 2K7LA 2Z5UA 2BXYA 3IAS2 2OA4A 2XGXA 4MQ9F 4QLCU 2CU7A 1FBQA 4B8XA 4CYCB 2Y0SN 4DJAA 3OIPA 2XHKA 4A3DJ 4HA8A 4RLQA 4AIDA 3BQYA 4M6VA 3E1SA 1JUMA 1P7JA 2IGMA 3KZZA 1PUFA 3GZNB 2K40A 3IV5A 2JPBA 4J19A 1LJ9A 1R36A 1K7AA 5CVJA 2DK8A 5IP9J 3F8FA 5J47A 2KT0A 2K5CA 3FF5A 2DYSH 2E34A 1ZGWA 4MFDA 1OCTC 4L0YB 3DKWA 3Q0UA 4Q48A 4FE4A 4BGDA 1VQ4I 3DKYA 5DM7F 2NVTJ 4AM3A 1B72A 3A0BC 5IYCJ 1Z1DA 1YX3A 1A5JA 3OYMA 3VEPA 3EETA 4XLPF 3VSLA 1MMNA 1ETVA 1S9HA 1S3JA 3ML6A 4XKCA 1J09A 3A2KA 4IHVA 2QBYA 2LLKA 2A5YB 3SDGA 3TP0A 5LEKA 3G2BA 4XM3A 1R58A 4NBQA 3K6GA 2LYCA 4C3HJ 1UHMA 1WI9A 2LF7A 1A36A 3BG6A 1JE8A 2O0YA 1O3TA 3RI4A 1YE9A 3RIRA 4IO9F 3T8TA 1S8NA 5J4YA 2G0EA 2Y30A 1ETOA 3JRAA 1OJLA 1XMKA 1IXRC 1OCZH 1SANA 1TP4A 3S93A 3S15J 2JPCA 4XN0A 3TW7A 4RB2C 2ISYA 4KT5C 5IY5H 3PO3J 1R00A 3OSGA 1RUNA 3ZQGA 1IXSB 1SFEA 2OF7A 1R23A 2BOLA 2NAZA 1Y56A 3CLQA 3HSRA 1PVEA 3CC4I 2FMLA 2KIMA 3EYYA 4RS8A 1T8IA 2DOFA 5DUKA 3M9AA 2FJ1A 3ABKH 3CMAI 3FXUA 5K1YA 2E1MB 1YIJI 4D0PA 4B44A 1UHSA 5D4RA 5CQEA 2F5DA 1O7LA 4IEJA 5J8CA 3JRHA 2FNAA 3KPHA 2XAUA 4CZZA 3ZR8X 2A68F 4BHBA 1ZK8A 2HZDA 1OPCA 3K4NA 3OMYA 3HZJA 4M3DA 3QYBA 2KJBA 2X85A 4F55A 2K3FA 4LITA 4QSHA 1WFXA 2K86A 4LLNA 4R8HA 3K2ZA 1SMTA 3Q9VA 1JTXA 2ZSHB 2PMZN 4KJZA 2WAQN 1BR2A 2RAEA 3LSGA 3JRBA 1LEBA 3K7AJ 2WWYA 1FP2A 2F6CA 3TO7A 3FM3A 3GTJJ 2VKEA 3V7RA 2O8XA 3FBIB 4KN7X 4DZPA 5EG0B 4L9JA 1ZR4A 1U5TB 3RKXA 2DODA 2COMA 3ISPA 1MSFC 4BXUA 4DGWB 4C2TA 5J4VA 4M72A 1XGSA 5GTHC 4X6AJ 2MW8A 5IYDJ 5E3MA 1J75A 1FP1D 2E19A 1YIOA 1FPQA 1Y8QB 2LG4A 3GO5A 3A02A 1F1ZA 5DD4A 4ENMA 2EQRA 5E1ZB 3SEZA 1SAUA 1P4WA 5FKLA 3WTWC 1X2NA 2OZ6A 5DV5A 3T0YA 1EH6A 5LBQA 4OAYA 1AHDP 1D8KA 1WJBA 5TISC 2DU9A 4BY7J 1VQ5I 3GMEA 1E0EA 1H8AC 1ETQA 2MA3A 3HRSA 3JRDA 2ECBA 2ELHA 4XIDA 4KYWA 3ZRGA 4PJJA 2VODA 2RNGA 5K7ZA 2A5WA 4A3KJ 3LAPA 4NNJA 2LF8A 3LFUA 5EYRA 1FTZA 3LSJA 4OOIA 3QWLA 3AKZA 3SEQA 3HGYA 2PLYA 4DOZA 4FX0A 1MW7A 3Q3SA 4U0VA 3CQZJ 5IYBJ 4C30A 4RAGA 3VDXA 1F9NA 3A03A 2MLKA 2EFPA 2ZBKA 4JYKA 5GPAA 5DEQA 3BPXA 3LSTA 1BM9A 5E3OA 3DTIA 4E7JA 4D5CA 1AKHA 3ABMH 4C3JJ 5BQTA 1GVJA 2BYVE 1Y0UA 3TDUC 1WJ5A 3JAMZ 3PUBA 5LLQA 3OS1A 3ROUA 1XN7A 3JSPA 1RPWA 2E7XA 4PZJA 1U2WA 1TWFJ 5B3SH 4M3EA 4XLCA 4LG0A 2H6BA 1R71A 4TV7A 1XG1A 2RV8A 2LVSA 1R9TJ 1HW5A 4G7OF 1XSVA 4N4OB 3TP3A 4V2FA 1VFCA 3JSOA 4A3FJ 1U5TC 2EV0A 2VXDA 5HDKA 2HYFA 4R1HA 2EFQA 1G59A 3ZN1A 4AIHA 5D5WB 2NOGA 2JJ7A 4MEYF 4XICA 1YS6A 1ZAOA 3CMYA 4ANJA 1LDKB 4M6XA 4XBFA 3IRQA 3CCMI 2HOTA 2CW8A 4PSWA 4IHYA 2LBFB 5DCFA 1L3LA 3MKWB 5AONA 3KEYA 3MKYB 1KONA 3L2RA 1L0OC 2DOEA 2GIVA 3ZQQA 4IHXA 3G3ZA 3CUQC 1QZZA 4ZYAA 4EGYA 5CVIA 4ENJA 1JI8A 1YOVB 3W3CA 5HS8A 2V1NA 4CCOA 4A69C 1YJ9I 1N25A 2QM3A 2M30A 2X1DA 3ABLH 1JKRC 1XB4A 1QHHD 4BYYA 1A6IA 1FBUA 2W82A 4EM1A 4BU2A 5LEJA 3PIPF 1MH3A 3WU2C 3K4MA 2GA1A 3H0GJ 2D45A 3PNVA 2CG4A 3HRUA 1Z6RA 3KCCA 4S04A 2XKOA 1YS7A 2E60A 1NTCA 2ZXWH 4BEHB 3HBLA 3H36A 3F6OA 1G3TA 4D1QA 1TWAJ 3OIOA 1B9NA 4UNOA 3TBIA 1HDPA 2MYSA 2IGNA 1SD4A 4EV0A 2CWEA 1PP8F 4LJZF 4KITB 3D1NI 1MBKA 1MZBA 1OISA 1YYVA 3NWSA 1BJZA 3RJPA 3S8PA 4IHTA 3L7WA 3N4MA 3BZKA 2Z33A 2DA1A 2DFEA 1HF0A 3CCVI 2HU9A 4E7KA 2ZJ2A 3MKLA 1USSA 1ACIA 2HXOA 3QP6A 2F4MB 4XKBA 2XPUA 1FSHA 3S3NA 2W00A 5E17F 2HS5A 3GFLA 4KDPA 4BXXJ 3BR0A 4KNYA 3D0SA 4BHCA 3RQIA 1IDZA 4MTDA 1JUSA 4NC8A 1IRGA 1FWZA 4E70A 2IEKA 3DEEA 4XRSG 1HBXG 2O9LA 2PEXA 1D0ZA 4MO7A 1KU7A 3OYGA 4BE0A 2R92J 2DMPA 1FC3A 2R5ZA 2HVSA 1OYYA 1T6SA 2IVMA 1DP7P 2OJED 2VPLA 1ZELA 2IAIA 3E6BA 3CCUI 4PJLA 1IW7F 4RDUA 1JJ8C 1UELB 5J1RA 3C18A 1BR1A 2DTZA 2RGVA 1TW2A 2E2IJ 2WB1N 2XAGA 2XDVA 2EWNA 4G7ZF 3M1EA 1QRYA 2CO5A 1ONVA 3S1MJ 1S6LA 4II3A 3W6VA 4AIKA 5EDNA 2H8RA 3I64A 5DCMB 3K4BA 2QSFX 2ZO4A 4BJTA 4HX4A 2CQQA 1XX5A 3BG5A 1HKSA 3V8KA 3H3ZA 1ETWA 1X3UA 2AO9A 2NNNA 3HKZN 2LKPA 1LE8B 1MBFA 3UNGC 2FQ3A 4ETSA 2EIJH 3BTJA 3K9TA 1WH7A 1LUJB 5EZGA 3TQNA 3HOYJ 3DXJF 4A2UA 2L9VA 2DOAA 2R7QA 4L9VA 4CO8A 6PAXA 3G73A 3FBNB 3JR9A 3L00A 3L09A 4BXFA 3OYNA 4Z6YA 1CF7B 2DO7A 4A3CJ 4O5VA 2L54A 4IVNA 1Z7LA 2KJCA 3BQZA 1ZG1A 2BW3A 1XMXA 2V1DA 3MCZA 4YIFA 1ERDA 2WADA 2FX0A 2Z1DA 1QNTA 3RKQA 4JP0A 2M7BA 4ZDLA 2WV0A 3ZQIA 4CHUA 4KIBA 1GT0C 4A3MJ 4HLXA 2KRHA 4EM0B 2M1BA 1ZREA 3WE3A 5F1RA 2MD5A 2XGEA 4BDZA 1H9GA 2M45A 5HDGA 1XCBA 2HVQA 2E7WA 3KEQA 2QA4I 3CD6I 1P6RA 4BQNA 4BS9A 5FKNA 3O3KA 2D1HA 4IRGA 2JA8J 1HDDC 1XGOA 3LL7A 2XAJA 4A3JJ 4X1EA 2XF5A 5H20A 1FYMA 2IPQX 2XSDC 2O7OA 1HSJA 2L5QA 2PN6A 2XRLA 3ONQA 1SVLA 4PJNA 5L3FA 3GTPJ 5JI6A 5CVRA 4RGRA 5AIQA 3FZVA 3HHHA 3IH4A 2VI6A 4GXOA 5A2QK 1I50J 2EIKH 2IBDA 2O03A 3I53A 4KIGA 4EGZA 2M7AA 3B02A 3F9KA 3F3XA 4ZYDA 2LR8A 1O3QA 1MBGA 5M3FJ 3ZMVA 2YSRA 3JCUC 3BP8A 1UHWA 2F2EA 2KP6A 4RB1A 2Z2SB 4HX8A 2MBFA 2FUG2 1TL8A 1RUOA 5FJ8J 4B1RA 4U0YA 1BI2A 3OYCA 2KL4A 4CXFA 3KLNA 2AHQA 2VC0A 1XPXA 1UB9A 3D5LA 3FM5A 3HYIA 3R0AA 4Q5SF 2MFZA 5BPDA 2VT2A 3GFJA 1VQOI 4ZYGA 5L3GA 1RIOH 1DDNA 2M4KA 5A2QZ 2WY8Q 4ABZA 1LFBA 2DK5A 3JRFA 4PJ0C 4KISA 4KN4X 5FROA 2QSHX 2VT3A 4ZJZA 3DP7A 4GCVA 1HW2A 1DGWY 1TQPA 2ZFUA 4YIIA 2CV1A 1IC8A 2F48A 4EJTA 2BY2A 4RAFA 1IV6A 1J9IA 3QYEA 5F1JA 3VFZA 4WX9A 3SXYA 5HNFA 2X51A 1A31A 1X4PA 1FIPA 3OY9A 1ZG3A 1QZEA 2VQGA 1FMWA 4H0EA 3LA7A 3CCYA 3QYFA 3GZ6A 1VQ7I 3HPHA 2VB6A 1QVTA 3A4CA 2KZVA 1QO0D 3R6SA 2QZ8A 2K02A 2ETHA 2A3SA 3J7ZI 4DIQA 4YIRX 1IG7A 2KLOA 4IJAA 1WSUA 5CJ9A 1DP3A 4UB8C 4OWRB 3OV8A 3CCLI 2FSWA 3AAFA 1KU9A 2UXNA 3SJMA 4M6YA 2M8EA 1OYIA 1SD7A 2H27A 1XSDA 5FO5A 1J7KA 1W1WE 1WI3A 1H0MA 2R5YB 3ZQHA 3DBLB 4B3XA 4YELA 2P7VB 2XROA 2UV1A 3FXRA 2XGCA 1ZHFA 3QQAA 2FMYA 4RM3A 1FJLA 4PGHA 3KYLA 3G1OA 3BG7A 1W5TA 3GBGA 1T0FC 2JA2A 1MBHA 1R1UA 2WAEA 1J5YA 3FHZA 3CJNA 5D8KB 3OIQA 4BAYA 3HPGA 2EIMH 1X1CA 3GXOA 5EEHA 2DA6A 4NC6A 4XNFA 4FX4A 1R4MB 3I4MJ 5TRDA 2VKVA 2OUMA 4I0AA 2KRCA 1IV8A 2YPRA 4HNUA 1DUXC 2HDDA 4MGRA 5F64A 4LOCA 3DEWA 3MKZA 4K2EA 1MIJA 2NVYJ 4P96A 2ELKA 1D1BA 2KFDA 2Z99A 4EJVA 1ZKGA 4OMZA 2CQNA 3KP7A 3IH3A 4ZH4F 1A6QA 5EG0A 1U5TA 2DMUA 1B8IA 3LSIA 4L18B 1BI3A 3CJRB 2JA7J 2VE8A 3ZGKA 3DTKA 1SFUA 1T98A 4CA0A 1RR8C 2L7KA 2HDCA 2LREA 3LA2A 1SEUA 1RNLA 1V4RA 2DQRA 2G9WA 1I39A 3KP4A 2MH9A 2G7HA 1B1BA 4KMFA 3S14J 5FRMA 5GTIC 3D5SC 2KHMA 5EGOB 5M5YJ 2OPTA 3PQKA 4HQEA 1HKTA 5K7HA 1MJBA 1NH3A 1BI1A 3BC8A 1IRXA 5LHHA 1YLFA 1E3HA 1JKOC 2HVRA 1X19A 2B63J 3CUQA 3MQ0A 3N97A 1B59A 2CRGA 3GFIA 2ZXHA 4I98B 1HQCA 4G9YA 5DUIA 2R3SA 3ZCOA 4RB3C 4LB5A 5D5XB 2B0LA 3WGGA 1BJAA 1TWHJ 4IHSA 2X4HA 2W48A 4O3MA 4F52A 2DW4A 3OSFA 3QOEA 2KDOA 4G6DA 5FFXA 1SFOJ 4Y3OA 1BIAA 3PIOF 1YITI 2L9NA 5L3DA 2O5RA 1UZCA 3K4LA 2IGKA 4WXHA 2E1CA 1TLHB 4A6EA 3F0CA 2DBBA 3GUDA 5B1BH 1DPUA 4FCYA 1FSEA 3ELKA 3KYCB 2GZWA 2RDPA 1WQ2A 2KDZA 4XKVA 2QEXI 2XB0X 4KUMA 2XF6A 4I99C 2MC3A 2CH0A 4V19K 4RAZA 2CUFA 4JOMA 1KU2A 2BV6A 3RCOA 2LY9A 1LPQA 4PUSA 3GTOJ 1KQ8A 3W2VA 1W7PB 2L2OA 4B47A 1T08B 2W1OA 5LHGA 5DYMA 1IF1A 2QKLB 2PBIA 2BZTA 3BTCA 2P4WA 5F0CA 4CUGA 2BHZA 3GF2A 2MABA 1O57A 1W4MA 1J0RA 5FFZA 2ME6A 1X1AA 2LP0A 5F08A 2PJRB 2KKOA 2YS9A 2LY1A 5FKKA 3K70C 1IUFA 1MMSA 2E2JJ 2OBPA 3GVAA 3ZQ7A 2DJNA 3FK7A 1BN5A 1FEXA 2ZSIB 5HNHA 5LFAA 2RC4A 2KPMA 1UG0A 3MZ8A 4XLHA 4WXDA 2BY3A 2W84A 1V55H 2P5LC 3HRTA 4HRIA 2Y0SA 1K78B 4CH7A 2DPDA 2LBFA 3OYJA 3OYBA 2BE5F 5JR3A 4L0ZB 4NUBA 1D8JA 5J8FA 4XSZF 4IQ4A 3S1NJ 1T38A 2R7ZJ 4LIVA 2NS0A 1EH7A 2TDXA 3ASOH 4LG3A 5TGTA 2QCOA 1MH4A 2JVHA 1Y39A 2GXBA 1WRJA 2VBWA 4Y7NJ 5H6RA 4ZTJA 1T33A 1FTTA 1K83J 3K4JA 3V8LA 3HOVJ 2EZKA 1RKWA 3FMSA 2JUCA 4PGGA 3E5QA 1IJWC 1LDDA 2JZYA 2AXLA 1V3FA 4IXAA 1QGPA 2M4GA 3BR3A 2E2HJ 3QP5A 4BEHA 2VE9A 1VQ8I 2JVGA 4ESBA 2V1XA 1TTYA 3ZQLA 2X6YA 5KAFC 3T8RA 4BDYA 4ZDOA 1EA3A 1GV5A 4XRFA 1S72I 2HEOA 2V6CA 1EV7A 2ZCWA 3ZN0A 2H8WA 2E1OA 3WTSC 1TQIA 1V54H 4E4HA 1R49A 1B4AA 3M3YJ 2W25A 3BT9A 4BQAA 3CCQI 1C0WA 1LFPA 4ZTFA 1R5GA 4GDFA 3P7NA 2CS3A 3VSKA 3EUAA 3WE2A 1MJ9A 2ZMEB 4X0GA 3ZMUA 2P81A 4PJMA 4LK0F 4DBQA 2RVCA 5FLMJ 4A3EJ 3DF8A 1F43A 1Z6TA 5AIPA 4P1WA 3A01B 4XLEA 3LAJA 3ZXSA 2L9SA 3O8HA 4XOPA 4XONA 4HEA2 3JAMK 2ZNYA 1K79A 1K6YA 4UVBA 1DU0A 2ZXIA 1P4AA 2EA2A 2ID6A 4CCJA 9ANTA 4D9JA 2PMHA 2GWRA 3SZPA 1VQNI 3RYRA 2OQRA 3TL4X 4EQQA 4E7LA 2E1MC 1I1SA 4JQFA 1I27A 2RQQA 5FLXZ 1RZ4A 1X2MA 3CMMA 2P5VA 4Q47A 2VL8A 2A69F 3K1PA 3AG2H 3H5AA 3FXMA 4UVAA 1QU3A 2X6OA 1RESA 2AS5F 1O4XA 2C6YA 2MLGA 1ITYA 4AYBA 2NYXA 4JBAA 2L4MA 2Y0MA 1HKQA 3A0HC 3AG4H 2XV4S 3PFYA 5FKOA 1R1VA 2R7RA 4M3FA 1IAWA 4CDGA 2VKDA 3W2AA 2DMTA 3GTQJ 3I4PA 2PMZA 4YRVA 2PI0A 2IA1A 2KIFA 2WAQA 3S2DJ 2QF7A 1B72B 3FXKA 2EB7A 1IRZA 3TO6A 2VJIA 2R7TA 1XDSA 5FD6A 4G6QA 3V42A 2YR2A 4IZZA 5B66C 1MGTA 2XC7A 4ENNA 1LFUP 4BL0B 3J81K 3GEZA 5KVRA 1LE8A 1IN4A 2F5FA 4BKXA 2M2EA 4I01A 3WG9A 1Y0NA 4WF2A 5ILUA 3OYKA 1BW5A 2MGQA 5E79C 3KETA 1YW9A 2L02A 4A0YA 1TT5B 2D2WA 3JTHA 4FASD 2FBIA 4WWCA 4QIWN 2JK3A 3J7YJ 2ZMEC 3L2VA 5C3EJ 3HJEA 3K70D 3MAJA 4HZFA 3VYUB 1A35A 2WAFA 1HCRA 1WJAA 3BZCA 2ESNA 2HFHA 1DGRM 3J81Z 4DW6A 4FQGA 2WTEA 1X1PA 3BDDA 4H4KC 2V26A 4DYQA 4JX6A 2FEZA 2KRFA 1LVKA 1YW8A 5LRRA 5D6EA 3MFKA 3OYLA 1YW7A 4KT6A 3H9JA 2A61A 2DN0A 4MNUA 3FX3A 2BVLA 4I0BA 4A3LJ 1IN6A 2Y2ZA 4OU0A 1YFHA 1QPMA 2UXXA 1IN7A 5E3LA 1MSEC 4PK4A 2R93J 3K10A 5C44J 2DMNA 4W1UA 2MC4A 1S5LC 4B4CA 4E7ZA 2HOEA 2CGPA 1D0XA 1FOXA 3KZYA 3ERED 4XR6A 1EJ9A 1IN8A 1G8XA 1BR4A 2CW0F 3IAM2 4IRIA 2UWMA 1FMVA 2VUMJ 2UZKA 1BA5A 3C3WA 1J59A 3X2QH 3DBHB 2KIQA 3GTLJ 3OYEA 2P6SA 2FOKA 3L1PA 4C9YA 1O7FA 4U88A 1ZRCA 3DKXA 1MNEA 2BY1A 3VODA 1T56A 3J7AY 3DWLE 2DAOA 2XSJC 2F5CA 2FBKA 1HSTA 4UHTA 1S29A 2J5OA 2HYJA 4MHGA 3F72A 3L9FA 5GP9A 5HODA 3HOXJ 2FU4A 3I59B 1W0UA 2DT5A 4U0WA 4YFXF 1ZARA 2HGCA 3KP3A 5B1AH 3J80K 5JVGF 4FISA 1T0FA 1GHCA 1APLC 3JW4A 2OCCH 3DPLC 4JX4A 4XK4A 1W7PD 2GOXB 3FDYA 1MJAA 1ENHA 2EZLA 4MTEA 1JUPA 1RR7A 4IL6C 3OS0A 3HUGB 2XVCA 3H1CA 3HOTA 2STWA 3HOZJ 4GYIA 1D1CA 3G71I 2X9DA 3IC7A 3MWMA 3E7LA 5C4JJ 1Q1HA 4A5MA 3V8JA 2XUBA 2V9VA 1Z3XA 4A3BJ 2HDWA 4HOBA 1E3OC 4OIOF 4A12A 3TEDA 1G3WA 1OKRA 1I5ZA 2CQ7A 3EUKL 4EVIA 2GBYA 1YI2I 2XPVA 3SFIA 4WCGA 2MD0A 2JQ7A 2IP2A 1R7JA 3CO7C 2JN6A 4BE1A 2DLLA 3MD2A 3MEXA 3Q0VA 1CQTA 3CDIA 5LGUA 3J80Z 2BY0A 1U9NA 1U78A 4ZC3A 4DZJA 5CYVA 4UUSB 2IRFG 4UV9A 1LNWA 4AIJA 5KAIC 3H3UA 2JUGA 2R7FA 1F36A 3CCSI 1WKMA 1POGA 3IP4B 4I02A 1UJ8A 4Y17A 4M3BA 3KZIC 5HS7A 3ECHA 4JK1X 1AKHB 2ZJQF 3C2BA 4HBLA 3H9QA 2DFIA 4HF2A 1DQUA 3HL2A 2IS1A 2FD5A 2L4AA 3BTIA 4P9FA 3HOWJ 3IH2A 2CUJA 2RN7A 2OQGA 5ICEA 2VC1A 2HNHA 3IRRA 2H6CA 5KNLA 2DPUA 2GIZA 1W5SA 2EFNA 2NVQJ 2W85A 2E5ZA 3O8GA 4L5EA 2Y9ZA 1VQKI 4NQWA 5K7FA 4AD9A 3Q5FA 2R5YA 1JJ6C 1NG7A 3F6VA 3GX4X 5IT3A 4ZZLA 3WTXC 3I3LA 5GPCA 2DA2A 3EUHC 3KEOA 2ICWG 4PDKA 3WTTC 2XRNA 3FIWA 1RC9A 1TC3C 3HSEA 3G4SI 1OYWA 3WODF 3LQRA 3FMQA 4J01A 2YX4A 4CCNA 3AL0B 1TWCJ 4NHJA 4RMNA 4I2OA 2HTJA 3PO2J 2LC2A 4KFCA 1W0TA 2F5VA 3ESWB 4FHTA 3L2QA 3EYIA 2FA5A 1JT6A 1ETXA 3OYDA 1P92A 1H9TA 2AQFA 1EKEA 1FOWA 1HLVA 4C2MJ 4LGWA 1OR7C 2WB1A 3M8JA 4F7ZA 3R60A 1EF4A 4BY1J 1Q1VA 4ITVA 1TQMA 5EZHA 1E2XA 2HQAA 5DD8A 2M0MA 3IWFA 4CICA 2LMDA 2H94A 2QQAA 2E36A 3MN2A 2K9LA 4E7IA 1ZYRF 1FY7A 3SZTA 2KQRA 3G1LA 2CUEA 3LSMA 4A3GJ 2JSCA 2ID3A 3CJTB 3WHCA 2ZNZA 3HKZA 3RQ4A 3RSNA 3BJ6A 3RYPA 2O8KA 3DU5A 2K9SA 5EGOA 4P55A 5D4SA 1Z7UA 5EJCA 4BQQA 3GLXA 4CYCA 3COAC 1B6AA 2FE3A 2MSYA 3C2GA 2W4SA 4GGGA 4GRIA 2JRTA 3B6AA 3ABTA 3P5JA 3PUFA 2CMPA 2R7UA 3QU6A 5HDNA 2HPIA 2E35A 3LSHA 4LIUA 3CO6C 1TZLA 1IRFA 3VWBA 5M3MJ 4F3QA 3KP5A 3R0JA 3FKIJ 1RI7A 2IS4A 4QPOA 1YRNB 2XPWA 4M9SA 5HLHA 2IJLA 3HB9A 3LA3A 5E20A 4DBRA 1SVOA 2RKHA 3FKJA 2M34A 2RQPA 2HYGD 3CJQB 3FMRA 3PFIA 3AL0C 1HXDA 1WH5A 4GYGA 4L5JA 1X1BA 5ICFA 3G6EI 3BTLA 1WWXA 2VJ5A 2OD5A 2CSOA 5J3LA 1YQAA 2JTVA 2LFBA 4EJOA 4Y52J 2R7DA 2IS2A 4L5IA 3SZGA 3GYHX 2P8TA 4LLLA 5LD2C 1LKXA 3E6CC 1AWCA 1V5EA 1W7PA 2BHYA 2OTLI 4OMYA 1HC8A 3DEUA 5D6FA 3U1KA 1WZ2A 2WV1A 4AUXA 4HF0A 3F8NA 2NRAC 3OL4A 2HZTA 2QQ8A 2LDUA 1ZGJA 4XLNF 2Y48A 3I9V2 1VQLI 2CJJA 2PJRA 1DPRA 2VPRA 1NG6A 2QQ9A 1U3EM 3T1BA 2DFHA 3CDHA 2JT1A 2P5KA 2GM4A 2F4OB 3BR6A 5IPAA 3REOA 1GXQA 2DYRH 4BQOA 2P7CB 3G1MA 2H1LA 2ACJA 2W7NA 1Y8RB 2FRHA 2OZUA 4CCLA 3HTSB 3HOUJ 2J5PA 1KYZA 2DT6A 3TW6A 3IL2A 4M71A 2VASA 5JVTA 1WJEA 2IA0A 2LNBA 4Y4RA 3WTYC 1K78A 2Q0OA 1H88C 2Q2EB 4UXNA 2MG4A 4XL9A 4HYEA 3CCRI 1ZR2A 1SFXA 1I3AA 2Z9OA 3RPQA 5JHUA 3OYIA 2KISA 5FD5A 4PCQA 4A6DA 4CGZA 3M1CA 1JGGA 2LD5A 2COBA 1KZHA 4KA4A 2A6TA 1B9MA 2VOPA 4I76A 2VIXA 1Z3YA 2GXAA 2KIUA 4UB6C 4AC0A 2K3PA 1VQ9I 4UUTA 4ZYHA 4HDVA 4RGSA 4F91B 3IKVA 1QQIA 5BPIA 1D3YA 4DYCA 2H09A 4I09A 3GTMJ 2ECCA 4F93B 3GLLA 4A3IJ 4E7SA 3S2WA 4CYDA 1VQPI 1YJNI 1FOKA 2V6EA 3Q0WA 3CF2A 2TCTA 4LD5A 1XS9A 3H9GA 3Q9SA 3BCBA 2QKMB 1BC7C 2FBHA 3ZQCA 1JKPC 1LEAA 3MZYA 1Z21A 3NARA 3EDPA 2NS7A 3MZHA 1D5YA 3QPLA 3M4OJ 3GWZA 2EH3A 3CLOA 1J2XA 2VQCA 1OCCH 1VQMI 3TOAA 2ZMEA 1ZLJA 3RZOJ 3KX2A 5E8IA 3KFWX 4XOTA 5IT9K 4YEJA 2YX7A 2L7FP 2X6WA 4OINF 3LSRA 4ENKA 2V9PA 3A01A 1I3QJ 2W24A 3U21A 3VOEA 3TO9A 2DT7B 4HNTA 2E71A 1UG2A 3K69A 3QU3A 2V4JC 5E1XA 3DQVC 5DDGA 3K4KA 4CZCA 4FT8A 2QWWA 2Y31A 4CSWA 1Z91A 3C7JA 3E6DA 3DBRB 3KIOA 4WK8F 2L3DA 2Z3YA 3H0DA 4HG2A 4II2A 2M87A 2EV5A 4XN3A 2BXZA 5GAEJ 1FX7A 1QZYA 1TWGJ 1SFKA 2XAQA 2GAUA 5ICCA 5IT9Z 1YTYA 4YFKF 3HG9A 1WHUA 4FETA 1O3RA 3BY6A 1MDMB 2ME0A 3L2CA 4QPQA 1ZG5A 2NNYA 4BJ6C 1K4SA 2CQXA 2IGOA 1G4DA 1FLIA 2CFXA 2STTA 1P2FA 4XKWA 4BJ5C 5HOOA 2HOSA 4IX7A 3RZDJ 1U8RA 4C3IJ 1RKTA 1GLNA 3BLYA 2Q1ZB 3M7GA 4Y15A 1K61A 3SFZA 4DQ2A 3JTGA 3OWTA 2O6GE 1X3ZB 3BJAA 2K9MA 1FOYA 1T39A 2PJPA 3QPHA 5ED4A 1R6RA 4UVCA 3E3VA 3WU0A 1ON1A 2EZHA 5LRSA 5CQGA 1JTYA 3K2AA 1ON2A 2M3AA 2HQ5A 2WBMA 3L2UA 3FXLA 2DXIA 2JRMA 3UKGA 2BBYA 4BE2A 2X1EA 1UFMA 2JMWA 3NAUA 3O6BB 4G6TB 3FXOA 3WGIA 4FTHA 3CCEI 3I5UA 3OOUA 3HGGA 4MQVA 2L7MP 3HIFA 3WHBA 2K9NA 1Y1VJ 4N4NB 2R7OA 1MMAA 4HV6A 1QHGA 4RB0A 3ABUA 3LSPA 1ZRFA 1BI0A 1P9QC 5FKMA 3NQOA 3GCMA 4C2UA 1IN5A 1YJWI 3RTRA 3LNQA 2ISZA 3ZP5A 4OIPF 3WTZA 3FK6A 2A07F 1OCRH 1MNDA 3DPTA 2V9KA 1JGSA 3VPRA 4L9TA 2R7SA 4ASNA 2R4GA 4U7DA 5IP7J 4AYBN 2VOOA 1MBJA 5HLGA 2DFFA 2YUSA 2R7XA 1KU3A 5K5QA 2F5EA 2CFOA 2LRDA 1YG2A 4B43A 4BHPA 1OMIA 5FRNA 4HNVA 5GAHJ 2Y75A 1S7AA 2HXIA 2YU3A 3LSKA 3V4GA 3E0JB 1I6HJ 5FLXK 4PFOA 5JLWA 1PYVA 4L9NA 5CLSA 2GOMA 2Z16A 1PDNC 1XMAA 2CYYA 2CQKA 3DTEA 5H6QA 1B8IB 2OC6A 3I58A 3SYTA 2QSGX 5F0HA 3I59A 3RKWA 1GVDA 2R7WA 2X0LA 4N9HA 1Y6IA 3EUHA 1WJCA 1REPC 5JLXA 1A04A 3RKYA 3SDBA 2DI3A 5EEGA 3ZMZA 2ZKZA 3RPUA 4HV5A 2JWTA 3ZMSA 4IRHA 4PSXA 3HUGA 3VB2A 2IA2A 2P0WA 2X6XA 1N77A 1KQ9A 4O6JA 2LKSA 1F4KA 1QVUA 3KLOA 4HSRA 3CUQB 3T5XA 1I6XA 2XGDA 4HDUA 3IUOA 3H5RA 3E5UA 4BH9A 3GFMA 1PUFB 4HLYA 1S7EA 1OR7A 4LFUA 5D8LB 2LK2A 2DQLA 3DU6A 5LGNA 3TMOA 2JA5J 2PQ8A 2XIGA 5FGMA 4IOCF 2QENA 3R61A 4RBOA 3S32A 3CESA 3LWFA 2VXZA 3A1YA 1TBXA 1VI0A 3SHFA 4UUSA 2NOJB 2TRTA 2HI3A 4IOAF 5TJJA 3LQQA 5ILVA 2VONA 1GUUA 2A6HF 5DCMA 3VYRB 1NK3P 3U2RA 1S7OA 4UUVA 3CC7I 2MH2A 1OCOH 1V5GA 2HR3A 5LHIA 4HQMA 1HOMA 4EEFG 2Y69H 2QYOA 2OCEA 4F92B 2QBYB 3TOBA 3CP2A 2DMQA 2Y9YA 3JREA 3B6CA 3GTKJ 4MIMA 1R4NB 4EM2A 5EEAA 3P9IA 5J6XA 3S3OA 3WTVC 4IKFA 3DV8A 4XMYA 3BZ6A 4RGXA 4OIRF 2VKHA 3JRIA 3S17J 2DA4A 1IGNA 2L01A 3ULQB 4E6KG 4AVPA 2ESHA 3FXJA 2DDAA 5M5WJ 3WGHA 1CF7A 5F27A 1TNTA 4XQFA 2IS6A 1PP7U 1LB2A 2NVXJ 1VNDA 3W6JB 1JKQC 5EF6A 2LOOA 2VQLA 3BCAA 1VZ0A 4MLOA 2GXGA 2HQRA 1UCRA 2JSPA 3GW2A 3CUOA 1Y1WJ 2H1KA 1LDJA 4B48A 4CCKA 3E97A 1TNSA 2O3FA 4M73A 2E5NA 4XRSA 1FT9A 4XRMA 3HC7A 3HSFA 1BIBA 4U7BA 1H89C 5IP6A 2HTSA 1PJRA 1MBEA 3H3VK 2NVUB 1X1DA 1E17A 5E3NA 2HOAA 4OIQF 3NWTA 1NHAA 4HPQA 3U1DA 4D7NA 2P6TA 3L2WA 2WY7Q 5CVUA 1QBJA 1Z67A 2EINH 2V79A 3BROA 4ZDPA 5BNGA 2EFWA 4B09A 2DA7A 4J00A 3BR2A 2F4IA 5K5OA 3ZOBA 4A0ZA 3F21A 4G12A 4EMSA 3WG7H 5JFRA 2UUZA 1JT0A 3BR5A 3V7SA 3CP8A 3E6MA 2W57A 5F6FA 3PNTA 3VYSB 4NC7A 3I55I 2A05A 1ETKA 1SC7A 1XGMA 1T95A 3AG1H 3OL3A 3OOPA 4GFBA 2JA6J 3C2HA 4A93J 2ZXJA 1HA8A 2VLAA 3DLAA 4N0BA 4P5OA 3S16J 1IUYA 2OV7A 2EFOA 3KE2A 3QOPA 4BACA 3OYAA 1R5ID 3F8BA 1GXPA 4JX5A 2FNPA 1G2HA 3S3MA 4UY8I 2QVOA 2HKXA 5D5UB 4P9UA 3OYFA 3BPVA 1U6GA 5BOXA 2AQEA 4PFPA 2VBYA 1D0YA 4IPAA 4HF1A 5M5XJ 1STZA 4YG2F 4EATA 5H2FC 3CMEI 1F5TA 2FF4A 3QPTA 4B3AA 2OTJI 3HXLA 4MEXF 3KYDB 5DM6F 1D1AA 1SMYF 4RM2A 4I6ZA 1K6OA 1IZ1A 2QGUA 2XAFA 1G3SA 2ZJRF 2B9SA 3ECOA 1VF9A 2XKPA 4ZYEA 1YX5A 2A6EF 3TGNA 1YRNA 2VBXA 4BBSJ 3CC2I 3BG9A 2XAHA 1WJDA 4N9IA 1WJFA 3P9KA 5ICGA 3DPUA 5J1UA 2FQ4A 4AVZA 1BBYA 4IF4A 4EJWA 4BNCA 4IHWA 1KQ0A
chains in the Genus database with same CATH topology
1MD0A 1XCVA 3BJOA 1T2KA 1ZRDA 4HAMA 4KICA 1KYWA 4A0XA 3BOQA 4LK1F 2VBZA 2G7UA 1ZH5A 4EJUA 3RDIA 2HKOA 3GZ5A 2FXAA 3IKTA 4LG0B 4ZZDA 2PFBA 2HQNA 4M9ZA 5LGTA 1YO5C 1SD6A 2O61A 1R22A 1R1TA 4WXCA 5E1WA 3HRMA 4DNCA 4G7HF 3P9CA 2Q2EA 4HW0A 3TDZC 4ESFA 5HS9A 4LB6B 4ESJA 3ZMDA 1VTNC 1ZN2A 3FXQA 3QRFF 2OU2A 2IW5A 3K1NA 1JXSA 3I54A 3WTUC 2GA2A 2IT0A 5D5VB 5BS6A 5K5RA 2M5WA 4RGUA 1EH8A 4KIFA 3C1DA 2ZFWA 3ZPLA 2BGCA 4Y13A 5L3EA 3KP2A 3IWZA 3BWGA 1XGNA 3K1MA 1LVAA 4YFNF 3HTUA 2EV6A 1BOAA 1Z9CA 1HW1A 4AWXB 1XD7A 3J7AO 2K4JA 2EA4A 3PQJA 5HLIA 3FWEA 1XDUA 4XSXF 3K0LA 5E8GA 1R5HA 1KA8A 1ULYA 2QLZA 3I0TA 4Q4ZF 4LMYA 1G6NA 3IHUA 1MDMA 1TW3A 2D1VA 1CGPA 3U9GA 1O3SA 1MKMA 3HHGA 4KMUX 1ZLKA 2DTRA 4Z2YA 4NB5A 2WC2A 1JHHA 4QWQA 3B73A 5KK1A 4HX7A 3R4KA 2OAZA 3E5XA 1LQ1A 5E18F 3H92A 4G8XA 3W6KB 4R79A 2EK5A 1FNNA 3NRVA 4LLGF 2E1NA 2GQQA 3O2PE 4ON0A 3F8MA 4I7HA 5CVVA 3ZMTA 2K4BA 1SD5A 4RAYA 2LSOA 3QAHA 3V7CA 2HWVA 4GO1A 3I71A 1I1GA 3NEUA 2Q8KA 3HOSA 1JHFA 3EQLF 5FB2A 1PUEE 2V1UA 1P4XA 1FYLA 1BC8C 5L3BA 4M9XA 2QQBA 3CTAA 4M74A 5ERIA 5HVQC 1SAXA 2ADUA 1XSXA 2PMUA 1Z05A 3DFGA 5BMZA 1FYKA 2VN2A 2K27A 2RNJA 1IXCA 2PG4A 4UV8A 3SQNA 1FZPB 2EJRA 1G3YA 3F23A 3WU1B 1AOYA 3KP6A 1FBSA 3F8CA 1USTA 1ODDA 2BEOA 4G94A 5ILSA 2XASA 1ZGAA 3F22A 2QUFA 5L3CA 3M8EA 3M8FA 1D5VA 1KGSA 3TKYA 4A5NA 3LFKA 4S05A 2K7LA 2Z5UA 2OA4A 2XGXA 4MQ9F 4QLCU 1FBQA 4B8XA 2XHKA 4HA8A 3KZZA 2JPBA 1LJ9A 1R36A 1K7AA 5CVJA 2DK8A 3F8FA 3FF5A 4L0YB 3DKWA 4Q48A 1Z1DA 3VEPA 3EETA 4XLPF 1S3JA 3ML6A 2QBYA 2A5YB 5LEKA 1R58A 1UHMA 1WI9A 2LF7A 1JE8A 2O0YA 1O3TA 3RI4A 3RIRA 3T8TA 1S8NA 1XMKA 1IXRC 2JPCA 4RB2C 2ISYA 4KT5C 1R00A 1RUNA 1IXSB 1SFEA 1R23A 3HSRA 2NAZA 2FMLA 2KIMA 3EYYA 4RS8A 5DUKA 3M9AA 3FXUA 5K1YA 4D0PA 5D4RA 2F5DA 1O7LA 5J8CA 2FNAA 4CZZA 2A68F 4BHBA 1OPCA 2KJBA 2K86A 4LLNA 4R8HA 3K2ZA 1SMTA 3Q9VA 1LEBA 2WWYA 1FP2A 3TO7A 3FM3A 3V7RA 2O8XA 4KN7X 4L9JA 1U5TB 3RKXA 2COMA 3ISPA 4BXUA 4M72A 1XGSA 1J75A 1FP1D 1YIOA 1FPQA 3GO5A 1F1ZA 5DD4A 4ENMA 5E1ZB 1P4WA 3WTWC 2OZ6A 5DV5A 3T0YA 1EH6A 5LBQA 1D8KA 2DU9A 2MA3A 3HRSA 2ELHA 4KYWA 2VODA 3LAPA 2LF8A 4OOIA 2PLYA 4FX0A 4U0VA 1F9NA 2MLKA 2EFPA 2ZBKA 5DEQA 3BPXA 3LSTA 1BM9A 5BQTA 1GVJA 2BYVE 1Y0UA 3TDUC 3JAMZ 5LLQA 3ROUA 1XN7A 3JSPA 4PZJA 2E7XA 1U2WA 4LG0A 2H6BA 4TV7A 2RV8A 1HW5A 4G7OF 1XSVA 3JSOA 1U5TC 2EV0A 5HDKA 2HYFA 4R1HA 2EFQA 3ZN1A 4AIHA 5D5WB 4MEYF 1YS6A 1ZAOA 1LDKB 4M6XA 4XBFA 3IRQA 5DCFA 1L3LA 5AONA 1L0OC 2GIVA 3G3ZA 3CUQC 1QZZA 4EGYA 4ENJA 5CVIA 5HS8A 2QM3A 2M30A 1XB4A 4BYYA 1FBUA 4EM1A 5LEJA 2GA1A 2D45A 2CG4A 3HRUA 1Z6RA 3KCCA 4S04A 2XKOA 1YS7A 3F6OA 1G3TA 1B9NA 4UNOA 1SD4A 4EV0A 2CWEA 1PP8F 4LJZF 1MZBA 4IHTA 1YYVA 3RJPA 3L7WA 3N4MA 2Z33A 2ZJ2A 1USSA 3QP6A 1FSHA 5E17F 2HS5A 3GFLA 4KDPA 4KNYA 3D0SA 4BHCA 4MTDA 1IRGA 1FWZA 4E70A 1HBXG 2PEXA 1KU7A 1FC3A 1OYYA 1T6SA 2IVMA 1DP7P 3E6BA 1IW7F 3C18A 2RGVA 1TW2A 2XAGA 2EWNA 4G7ZF 3M1EA 2CO5A 1ONVA 1S6LA 4AIKA 3I64A 5DCMB 2ZO4A 4HX4A 1HKSA 3V8KA 3H3ZA 1X3UA 2NNNA 2LKPA 2FQ3A 4ETSA 3K9TA 3TQNA 3DXJF 4A2UA 4L9VA 4CO8A 6PAXA 3G73A 3L00A 3L09A 1CF7B 2DO7A 4O5VA 2L54A 4IVNA 2KJCA 1ZG1A 2V1DA 3MCZA 4YIFA 1QNTA 2WV0A 4CHUA 4KIBA 4HLXA 4EM0B 2M1BA 1ZREA 3WE3A 5F1RA 2MD5A 1H9GA 2M45A 5HDGA 1XCBA 3KEQA 2E7WA 1P6RA 3O3KA 2D1HA 4IRGA 1XGOA 2XAJA 5H20A 1FYMA 2IPQX 1HSJA 2PN6A 5L3FA 5JI6A 5CVRA 4RGRA 5AIQA 3FZVA 3HHHA 4GXOA 5A2QK 3I53A 2O03A 4KIGA 4EGZA 3B02A 3F3XA 4ZYDA 1O3QA 3ZMVA 2YSRA 3BP8A 1UHWA 2F2EA 4RB1A 4HX8A 2MBFA 1RUOA 4U0YA 1BI2A 4CXFA 3KLNA 2VC0A 1UB9A 3D5LA 3FM5A 3HYIA 3R0AA 4Q5SF 5BPDA 2VT2A 3GFJA 4ZYGA 5L3GA 1RIOH 1DDNA 5A2QZ 2DK5A 4KN4X 2VT3A 3DP7A 4GCVA 1HW2A 1TQPA 4YIIA 4EJTA 1J9IA 3VFZA 4WX9A 3SXYA 1ZG3A 4H0EA 3LA7A 3GZ6A 1QO0D 3R6SA 2QZ8A 2K02A 2ETHA 2A3SA 4IJAA 1WSUA 5CJ9A 3OV8A 2FSWA 3AAFA 1KU9A 2UXNA 4M6YA 2M8EA 1OYIA 1SD7A 2H27A 1XSDA 5FO5A 1J7KA 1H0MA 2P7VB 2XROA 3FXRA 1ZHFA 2FMYA 4PGHA 1W5TA 1R1UA 1J5YA 3FHZA 3CJNA 5D8KB 4BAYA 3GXOA 5EEHA 4FX4A 5TRDA 4I0AA 2YPRA 1DUXC 4MGRA 5F64A 4K2EA 4P96A 2Z99A 4EJVA 4OMZA 3KP7A 4ZH4F 1U5TA 4L18B 1BI3A 2VE8A 1SFUA 1T98A 2HDCA 3LA2A 1RNLA 1V4RA 2DQRA 2G9WA 3KP4A 2MH9A 2G7HA 1B1BA 4KMFA 4HQEA 3PQKA 1HKTA 1MJBA 1BI1A 5LHHA 1YLFA 3CUQA 3MQ0A 3N97A 1B59A 3GFIA 4I98B 1HQCA 4G9YA 5DUIA 2R3SA 4RB3C 4LB5A 5D5XB 2B0LA 3WGGA 1BJAA 4IHSA 2X4HA 4O3MA 2DW4A 4G6DA 5FFXA 1BIAA 5L3DA 2E1CA 4WXHA 1TLHB 4A6EA 2DBBA 3GUDA 1DPUA 1FSEA 3ELKA 2GZWA 2RDPA 1WQ2A 4KUMA 2MC3A 4RAZA 1KU2A 2BV6A 1KQ8A 1W7PB 5LHGA 5DYMA 1IF1A 2PBIA 2P4WA 3GF2A 1O57A 1W4MA 1J0RA 5FFZA 2KKOA 2OBPA 3GVAA 3ZQ7A 1BN5A 2RC4A 4WXDA 2W84A 2P5LC 3HRTA 1K78B 2DPDA 2BE5F 5JR3A 4L0ZB 1D8JA 5J8FA 4XSZF 1T38A 2NS0A 1EH7A 2TDXA 2GXBA 1WRJA 2VBWA 5H6RA 3V8LA 3FMSA 4PGGA 3E5QA 1LDDA 2JZYA 2AXLA 1V3FA 4IXAA 1QGPA 3QP5A 2VE9A 4ESBA 2V1XA 1TTYA 3T8RA 4XRFA 2HEOA 2V6CA 1EV7A 2ZCWA 3ZN0A 3WTSC 1TQIA 1B4AA 2W25A 4BQAA 1C0WA 1R5GA 3P7NA 3WE2A 1MJ9A 2ZMEB 3ZMUA 4LK0F 2RVCA 3DF8A 1Z6TA 5AIPA 3LAJA 3JAMK 2ZNYA 1K79A 4UVBA 1P4AA 2EA2A 2PMHA 2GWRA 3SZPA 3RYRA 2OQRA 1I1SA 4EQQA 4JQFA 1I27A 5FLXZ 1RZ4A 2P5VA 4Q47A 2A69F 3K1PA 4UVAA 2AS5F 2C6YA 2MLGA 2NYXA 4JBAA 2L4MA 2Y0MA 1HKQA 2XV4S 1R1VA 1IAWA 4CDGA 3I4PA 2PI0A 2IA1A 2KIFA 2EB7A 3TO6A 1XDSA 5FD6A 4G6QA 2YR2A 1MGTA 4ENNA 3J81K 3GEZA 5KVRA 1IN4A 2F5FA 4I01A 3WG9A 4WF2A 5ILUA 3KETA 1YW9A 2L02A 4A0YA 2D2WA 3JTHA 2FBIA 4WWCA 3MAJA 4HZFA 2ESNA 2HFHA 3J81Z 2WTEA 3BDDA 2FEZA 2KRFA 1YW8A 3MFKA 5LRRA 5D6EA 1YW7A 2A61A 4MNUA 3FX3A 4I0BA 1IN6A 4OU0A 1YFHA 1QPMA 2UXXA 1IN7A 2HOEA 2CGPA 3KZYA 3ERED 1IN8A 2CW0F 4IRIA 2UWMA 2UZKA 3C3WA 1J59A 2P6SA 2FOKA 1O7FA 4U88A 1ZRCA 3VODA 2DAOA 2F5CA 2FBKA 1HSTA 4UHTA 1S29A 2J5OA 4MHGA 3F72A 3L9FA 2FU4A 3I59B 2DT5A 4U0WA 4YFXF 1ZARA 2HGCA 3KP3A 3J80K 1GHCA 1T0FA 3JW4A 3DPLC 1W7PD 1MJAA 4MTEA 2XVCA 3HOTA 2STWA 4GYIA 3IC7A 3MWMA 1Q1HA 4A5MA 3V8JA 2XUBA 2V9VA 4HOBA 4OIOF 4A12A 1G3WA 1OKRA 1I5ZA 4EVIA 4WCGA 2IP2A 1R7JA 3CO7C 2DLLA 3MEXA 5LGUA 3J80Z 1U78A 5CYVA 2IRFG 4UV9A 1LNWA 4AIJA 3H3UA 2R7FA 1WKMA 4I02A 4Y17A 5HS7A 3ECHA 4JK1X 4HBLA 2DFIA 4HF2A 2L4AA 4P9FA 2RN7A 2OQGA 5ICEA 2VC1A 3IRRA 2H6CA 2DPUA 1W5SA 2EFNA 2W85A 4NQWA 4AD9A 3Q5FA 3GX4X 3F6VA 5IT3A 4ZZLA 3WTXC 3KEOA 4PDKA 3WTTC 2XRNA 3HSEA 1OYWA 3WODF 3LQRA 3FMQA 2YX4A 4NHJA 4I2OA 2HTJA 4KFCA 4FHTA 3EYIA 2FA5A 1P92A 1H9TA 4LGWA 4F7ZA 3R60A 1TQMA 1E2XA 5DD8A 3IWFA 4CICA 2H94A 2QQAA 1ZYRF 1FY7A 3SZTA 2JSCA 2ZNZA 3BJ6A 3RYPA 4P55A 5D4SA 1Z7UA 3GLXA 3COAC 1B6AA 2FE3A 4GGGA 2JRTA 3ABTA 3QU6A 5HDNA 3CO6C 1IRFA 3KP5A 3R0JA 1RI7A 4M9SA 5HLHA 2IJLA 3LA3A 5E20A 2RKHA 2RQPA 2HYGD 3FMRA 3PFIA 1HXDA 4GYGA 4L5JA 5ICFA 1WWXA 2OD5A 2CSOA 1YQAA 2JTVA 4EJOA 2R7DA 4L5IA 3GYHX 2P8TA 4LLLA 3E6CC 1AWCA 1W7PA 4OMYA 3DEUA 5D6FA 4HF0A 3F8NA 2NRAC 2HZTA 2LDUA 1ZGJA 4XLNF 2Y48A 1DPRA 2QQ9A 1U3EM 3T1BA 3CDHA 2JT1A 2P5KA 3REOA 1GXQA 2P7CB 2ACJA 2FRHA 2OZUA 3HTSB 2J5PA 1KYZA 3IL2A 4M71A 5JVTA 2IA0A 3WTYC 2LNBA 1K78A 2Q0OA 4UXNA 4HYEA 1SFXA 2Z9OA 3RPQA 5JHUA 5FD5A 4PCQA 4A6DA 4CGZA 4KA4A 1B9MA 2VOPA 2KIUA 4ZYHA 4HDVA 4RGSA 3IKVA 1QQIA 5BPIA 1D3YA 2H09A 4I09A 3S2WA 4CYDA 1FOKA 4LD5A 3Q9SA 1BC7C 2FBHA 1LEAA 3MZYA 3EDPA 3MZHA 3GWZA 3CLOA 1J2XA 3TOAA 2ZMEA 1ZLJA 5E8IA 3KFWX 5IT9K 2YX7A 4OINF 4ENKA 2W24A 3VOEA 3TO9A 3K69A 3QU3A 5E1XA 3DQVC 5DDGA 4FT8A 2QWWA 1Z91A 3C7JA 3E6DA 4WK8F 2L3DA 2Z3YA 2M87A 2EV5A 1FX7A 1QZYA 2XAQA 2GAUA 5ICCA 5IT9Z 1YTYA 4YFKF 1O3RA 3BY6A 1MDMB 3L2CA 1ZG5A 1G4DA 2NNYA 1FLIA 2CFXA 2STTA 1P2FA 5HOOA 1U8RA 3M7GA 4Y15A 3SFZA 4DQ2A 3JTGA 2O6GE 3BJAA 1T39A 2PJPA 3QPHA 5ED4A 4UVCA 3E3VA 3WU0A 1ON1A 5LRSA 1ON2A 2BBYA 1UFMA 3O6BB 3WGIA 3I5UA 4MQVA 3HIFA 4HV6A 4RB0A 3ABUA 1ZRFA 1BI0A 3NQOA 1IN5A 3RTRA 2ISZA 3ZP5A 4OIPF 3WTZA 2A07F 3DPTA 1JGSA 4L9TA 4ASNA 4U7DA 2VOOA 5HLGA 1KU3A 5K5QA 2F5EA 1YG2A 4BHPA 1OMIA 2Y75A 1S7AA 2YU3A 3V4GA 5FLXK 4L9NA 5CLSA 1PDNC 1XMAA 2CYYA 2CQKA 5H6QA 3I58A 3I59A 3RKWA 2X0LA 4N9HA 3EUHA 1REPC 1A04A 3RKYA 2DI3A 3ZMZA 5EEGA 2ZKZA 3RPUA 4HV5A 3ZMSA 4IRHA 3HUGA 3VB2A 2IA2A 1KQ9A 4O6JA 1F4KA 3KLOA 3CUQB 3T5XA 1I6XA 4HDUA 3E5UA 4BH9A 3GFMA 4HLYA 1OR7A 4LFUA 5D8LB 2DQLA 5LGNA 2PQ8A 2XIGA 5FGMA 2QENA 3R61A 3LWFA 2VXZA 1TBXA 3SHFA 5TJJA 3LQQA 5ILVA 2VONA 2A6HF 5DCMA 4UUVA 3U2RA 1S7OA 2MH2A 2HR3A 5LHIA 4HQMA 2QYOA 2QBYB 3TOBA 4EM2A 3P9IA 5J6XA 3WTVC 3DV8A 3BZ6A 4RGXA 4OIRF 2L01A 3ULQB 4AVPA 2ESHA 3WGHA 1CF7A 1TNTA 1PP7U 1LB2A 3W6JB 2GXGA 2HQRA 1UCRA 3GW2A 3CUOA 1LDJA 3E97A 1TNSA 2O3FA 4M73A 1FT9A 4U7BA 3HSFA 1BIBA 2HTSA 1E17A 4OIQF 3U1DA 1NHAA 2P6TA 5CVUA 1QBJA 2V79A 3BROA 2EFWA 4B09A 5K5OA 4A0ZA 3F21A 4EMSA 5JFRA 3V7SA 3E6MA 2W57A 5F6FA 1XGMA 3OOPA 2ZXJA 4N0BA 4P5OA 1IUYA 2EFOA 3KE2A 3QOPA 3F8BA 1GXPA 2FNPA 2QVOA 2HKXA 5D5UB 4P9UA 3BPVA 1U6GA 5BOXA 2VBYA 4IPAA 4HF1A 1STZA 4YG2F 1F5TA 2FF4A 3QPTA 4MEXF 1SMYF 1K6OA 1IZ1A 2XAFA 1G3SA 3ECOA 2XKPA 4ZYEA 2A6EF 3TGNA 2VBXA 2XAHA 4N9IA 5ICGA 3P9KA 1BBYA 4IF4A 4EJWA 4BNCA 1KQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MD0 A;  1XCV A;  3BJO A;  1T2K A;  1ZRD A;  4HAM A;  4KIC A;  1KYW A;  4A0X A;  3BOQ A;  4LK1 F;  2VBZ A;  2G7U A;  1ZH5 A;  4EJU A;  3RDI A;  2HKO A;  3GZ5 A;  2FXA A;  3IKT A;  4LG0 B;  4ZZD A;  2PFB A;  2HQN A;  4M9Z A;  5LGT A;  1YO5 C;  1SD6 A;  2O61 A;  1R22 A;  1R1T A;  4WXC A;  5E1W A;  3HRM A;  4DNC A;  4G7H F;  3P9C A;  2Q2E A;  4HW0 A;  3TDZ C;  4ESF A;  5HS9 A;  4LB6 B;  4ESJ A;  3ZMD A;  1VTN C;  1ZN2 A;  3FXQ A;  3QRF F;  2OU2 A;  2IW5 A;  3K1N A;  1JXS A;  3I54 A;  3WTU C;  2GA2 A;  2IT0 A;  5D5V B;  5BS6 A;  5K5R A;  2M5W A;  4RGU A;  1EH8 A;  4KIF A;  3C1D A;  2ZFW A;  3ZPL A;  2BGC A;  4Y13 A;  5L3E A;  3KP2 A;  3IWZ A;  3BWG A;  1XGN A;  3K1M A;  1LVA A;  4YFN F;  3HTU A;  2EV6 A;  1BOA A;  1Z9C A;  1HW1 A;  4AWX B;  1XD7 A;  3J7A O;  2K4J A;  2EA4 A;  3PQJ A;  5HLI A;  3FWE A;  1XDU A;  4XSX F;  3K0L A;  5E8G A;  1R5H A;  1KA8 A;  1ULY A;  2QLZ A;  3I0T A;  4Q4Z F;  4LMY A;  1G6N A;  3IHU A;  1MDM A;  1TW3 A;  2D1V A;  1CGP A;  3U9G A;  1O3S A;  1MKM A;  3HHG A;  4KMU X;  1ZLK A;  2DTR A;  4Z2Y A;  4NB5 A;  2WC2 A;  1JHH A;  4QWQ A;  3B73 A;  5KK1 A;  4HX7 A;  3R4K A;  2OAZ A;  3E5X A;  1LQ1 A;  5E18 F;  3H92 A;  4G8X A;  3W6K B;  4R79 A;  2EK5 A;  1FNN A;  3NRV A;  4LLG F;  2E1N A;  2GQQ A;  3O2P E;  4ON0 A;  3F8M A;  4I7H A;  5CVV A;  3ZMT A;  2K4B A;  1SD5 A;  4RAY A;  2LSO A;  3QAH A;  3V7C A;  2HWV A;  4GO1 A;  3I71 A;  1I1G A;  3NEU A;  2Q8K A;  3HOS A;  1JHF A;  3EQL F;  5FB2 A;  1PUE E;  2V1U A;  1P4X A;  1FYL A;  1BC8 C;  5L3B A;  4M9X A;  2QQB A;  3CTA A;  4M74 A;  5ERI A;  5HVQ C;  1SAX A;  2ADU A;  1XSX A;  2PMU A;  1Z05 A;  3DFG A;  5BMZ A;  1FYK A;  2VN2 A;  2K27 A;  2RNJ A;  1IXC A;  2PG4 A;  4UV8 A;  3SQN A;  1FZP B;  2EJR A;  1G3Y A;  3F23 A;  3WU1 B;  1AOY A;  3KP6 A;  1FBS A;  3F8C A;  1UST A;  1ODD A;  2BEO A;  4G94 A;  5ILS A;  2XAS A;  1ZGA A;  3F22 A;  2QUF A;  5L3C A;  3M8E A;  3M8F A;  1D5V A;  1KGS A;  3TKY A;  4A5N A;  3LFK A;  4S05 A;  2K7L A;  2Z5U A;  2OA4 A;  2XGX A;  4MQ9 F;  4QLC U;  1FBQ A;  4B8X A;  2XHK A;  4HA8 A;  3KZZ A;  2JPB A;  1LJ9 A;  1R36 A;  1K7A A;  5CVJ A;  2DK8 A;  3F8F A;  3FF5 A;  4L0Y B;  3DKW A;  4Q48 A;  1Z1D A;  3VEP A;  3EET A;  4XLP F;  1S3J A;  3ML6 A;  2QBY A;  2A5Y B;  5LEK A;  1R58 A;  1UHM A;  1WI9 A;  2LF7 A;  1JE8 A;  2O0Y A;  1O3T A;  3RI4 A;  3RIR A;  3T8T A;  1S8N A;  1XMK A;  1IXR C;  2JPC A;  4RB2 C;  2ISY A;  4KT5 C;  1R00 A;  1RUN A;  1IXS B;  1SFE A;  1R23 A;  3HSR A;  2NAZ A;  2FML A;  2KIM A;  3EYY A;  4RS8 A;  5DUK A;  3M9A A;  3FXU A;  5K1Y A;  4D0P A;  5D4R A;  2F5D A;  1O7L A;  5J8C A;  2FNA A;  4CZZ A;  2A68 F;  4BHB A;  1OPC A;  2KJB A;  2K86 A;  4LLN A;  4R8H A;  3K2Z A;  1SMT A;  3Q9V A;  1LEB A;  2WWY A;  1FP2 A;  3TO7 A;  3FM3 A;  3V7R A;  2O8X A;  4KN7 X;  4L9J A;  1U5T B;  3RKX A;  2COM A;  3ISP A;  4BXU A;  4M72 A;  1XGS A;  1J75 A;  1FP1 D;  1YIO A;  1FPQ A;  3GO5 A;  1F1Z A;  5DD4 A;  4ENM A;  5E1Z B;  1P4W A;  3WTW C;  2OZ6 A;  5DV5 A;  3T0Y A;  1EH6 A;  5LBQ A;  1D8K A;  2DU9 A;  2MA3 A;  3HRS A;  2ELH A;  4KYW A;  2VOD A;  3LAP A;  2LF8 A;  4OOI A;  2PLY A;  4FX0 A;  4U0V A;  1F9N A;  2MLK A;  2EFP A;  2ZBK A;  5DEQ A;  3BPX A;  3LST A;  1BM9 A;  5BQT A;  1GVJ A;  2BYV E;  1Y0U A;  3TDU C;  3JAM Z;  5LLQ A;  3ROU A;  1XN7 A;  3JSP A;  4PZJ A;  2E7X A;  1U2W A;  4LG0 A;  2H6B A;  4TV7 A;  2RV8 A;  1HW5 A;  4G7O F;  1XSV A;  3JSO A;  1U5T C;  2EV0 A;  5HDK A;  2HYF A;  4R1H A;  2EFQ A;  3ZN1 A;  4AIH A;  5D5W B;  4MEY F;  1YS6 A;  1ZAO A;  1LDK B;  4M6X A;  4XBF A;  3IRQ A;  5DCF A;  1L3L A;  5AON A;  1L0O C;  2GIV A;  3G3Z A;  3CUQ C;  1QZZ A;  4EGY A;  4ENJ A;  5CVI A;  5HS8 A;  2QM3 A;  2M30 A;  1XB4 A;  4BYY A;  1FBU A;  4EM1 A;  5LEJ A;  2GA1 A;  2D45 A;  2CG4 A;  3HRU A;  1Z6R A;  3KCC A;  4S04 A;  2XKO A;  1YS7 A;  3F6O A;  1G3T A;  1B9N A;  4UNO A;  1SD4 A;  4EV0 A;  2CWE A;  1PP8 F;  4LJZ F;  1MZB A;  4IHT A;  1YYV A;  3RJP A;  3L7W A;  3N4M A;  2Z33 A;  2ZJ2 A;  1USS A;  3QP6 A;  1FSH A;  5E17 F;  2HS5 A;  3GFL A;  4KDP A;  4KNY A;  3D0S A;  4BHC A;  4MTD A;  1IRG A;  1FWZ A;  4E70 A;  1HBX G;  2PEX A;  1KU7 A;  1FC3 A;  1OYY A;  1T6S A;  2IVM A;  1DP7 P;  3E6B A;  1IW7 F;  3C18 A;  2RGV A;  1TW2 A;  2XAG A;  2EWN A;  4G7Z F;  3M1E A;  2CO5 A;  1ONV A;  1S6L A;  4AIK A;  3I64 A;  5DCM B;  2ZO4 A;  4HX4 A;  1HKS A;  3V8K A;  3H3Z A;  1X3U A;  2NNN A;  2LKP A;  2FQ3 A;  4ETS A;  3K9T A;  3TQN A;  3DXJ F;  4A2U A;  4L9V A;  4CO8 A;  6PAX A;  3G73 A;  3L00 A;  3L09 A;  1CF7 B;  2DO7 A;  4O5V A;  2L54 A;  4IVN A;  2KJC A;  1ZG1 A;  2V1D A;  3MCZ A;  4YIF A;  1QNT A;  2WV0 A;  4CHU A;  4KIB A;  4HLX A;  4EM0 B;  2M1B A;  1ZRE A;  3WE3 A;  5F1R A;  2MD5 A;  1H9G A;  2M45 A;  5HDG A;  1XCB A;  3KEQ A;  2E7W A;  1P6R A;  3O3K A;  2D1H A;  4IRG A;  1XGO A;  2XAJ A;  5H20 A;  1FYM A;  2IPQ X;  1HSJ A;  2PN6 A;  5L3F A;  5JI6 A;  5CVR A;  4RGR A;  5AIQ A;  3FZV A;  3HHH A;  4GXO A;  5A2Q K;  3I53 A;  2O03 A;  4KIG A;  4EGZ A;  3B02 A;  3F3X A;  4ZYD A;  1O3Q A;  3ZMV A;  2YSR A;  3BP8 A;  1UHW A;  2F2E A;  4RB1 A;  4HX8 A;  2MBF A;  1RUO A;  4U0Y A;  1BI2 A;  4CXF A;  3KLN A;  2VC0 A;  1UB9 A;  3D5L A;  3FM5 A;  3HYI A;  3R0A A;  4Q5S F;  5BPD A;  2VT2 A;  3GFJ A;  4ZYG A;  5L3G A;  1RIO H;  1DDN A;  5A2Q Z;  2DK5 A;  4KN4 X;  2VT3 A;  3DP7 A;  4GCV A;  1HW2 A;  1TQP A;  4YII A;  4EJT A;  1J9I A;  3VFZ A;  4WX9 A;  3SXY A;  1ZG3 A;  4H0E A;  3LA7 A;  3GZ6 A;  1QO0 D;  3R6S A;  2QZ8 A;  2K02 A;  2ETH A;  2A3S A;  4IJA A;  1WSU A;  5CJ9 A;  3OV8 A;  2FSW A;  3AAF A;  1KU9 A;  2UXN A;  4M6Y A;  2M8E A;  1OYI A;  1SD7 A;  2H27 A;  1XSD A;  5FO5 A;  1J7K A;  1H0M A;  2P7V B;  2XRO A;  3FXR A;  1ZHF A;  2FMY A;  4PGH A;  1W5T A;  1R1U A;  1J5Y A;  3FHZ A;  3CJN A;  5D8K B;  4BAY A;  3GXO A;  5EEH A;  4FX4 A;  5TRD A;  4I0A A;  2YPR A;  1DUX C;  4MGR A;  5F64 A;  4K2E A;  4P96 A;  2Z99 A;  4EJV A;  4OMZ A;  3KP7 A;  4ZH4 F;  1U5T A;  4L18 B;  1BI3 A;  2VE8 A;  1SFU A;  1T98 A;  2HDC A;  3LA2 A;  1RNL A;  1V4R A;  2DQR A;  2G9W A;  3KP4 A;  2MH9 A;  2G7H A;  1B1B A;  4KMF A;  4HQE A;  3PQK A;  1HKT A;  1MJB A;  1BI1 A;  5LHH A;  1YLF A;  3CUQ A;  3MQ0 A;  3N97 A;  1B59 A;  3GFI A;  4I98 B;  1HQC A;  4G9Y A;  5DUI A;  2R3S A;  4RB3 C;  4LB5 A;  5D5X B;  2B0L A;  3WGG A;  1BJA A;  4IHS A;  2X4H A;  4O3M A;  2DW4 A;  4G6D A;  5FFX A;  1BIA A;  5L3D A;  2E1C A;  4WXH A;  1TLH B;  4A6E A;  2DBB A;  3GUD A;  1DPU A;  1FSE A;  3ELK A;  2GZW A;  2RDP A;  1WQ2 A;  4KUM A;  2MC3 A;  4RAZ A;  1KU2 A;  2BV6 A;  1KQ8 A;  1W7P B;  5LHG A;  5DYM A;  1IF1 A;  2PBI A;  2P4W A;  3GF2 A;  1O57 A;  1W4M A;  1J0R A;  5FFZ A;  2KKO A;  2OBP A;  3GVA A;  3ZQ7 A;  1BN5 A;  2RC4 A;  4WXD A;  2W84 A;  2P5L C;  3HRT A;  1K78 B;  2DPD A;  2BE5 F;  5JR3 A;  4L0Z B;  1D8J A;  5J8F A;  4XSZ F;  1T38 A;  2NS0 A;  1EH7 A;  2TDX A;  2GXB A;  1WRJ A;  2VBW A;  5H6R A;  3V8L A;  3FMS A;  4PGG A;  3E5Q A;  1LDD A;  2JZY A;  2AXL A;  1V3F A;  4IXA A;  1QGP A;  3QP5 A;  2VE9 A;  4ESB A;  2V1X A;  1TTY A;  3T8R A;  4XRF A;  2HEO A;  2V6C A;  1EV7 A;  2ZCW A;  3ZN0 A;  3WTS C;  1TQI A;  1B4A A;  2W25 A;  4BQA A;  1C0W A;  1R5G A;  3P7N A;  3WE2 A;  1MJ9 A;  2ZME B;  3ZMU A;  4LK0 F;  2RVC A;  3DF8 A;  1Z6T A;  5AIP A;  3LAJ A;  3JAM K;  2ZNY A;  1K79 A;  4UVB A;  1P4A A;  2EA2 A;  2PMH A;  2GWR A;  3SZP A;  3RYR A;  2OQR A;  1I1S A;  4EQQ A;  4JQF A;  1I27 A;  5FLX Z;  1RZ4 A;  2P5V A;  4Q47 A;  2A69 F;  3K1P A;  4UVA A;  2AS5 F;  2C6Y A;  2MLG A;  2NYX A;  4JBA A;  2L4M A;  2Y0M A;  1HKQ A;  2XV4 S;  1R1V A;  1IAW A;  4CDG A;  3I4P A;  2PI0 A;  2IA1 A;  2KIF A;  2EB7 A;  3TO6 A;  1XDS A;  5FD6 A;  4G6Q A;  2YR2 A;  1MGT A;  4ENN A;  3J81 K;  3GEZ A;  5KVR A;  1IN4 A;  2F5F A;  4I01 A;  3WG9 A;  4WF2 A;  5ILU A;  3KET A;  1YW9 A;  2L02 A;  4A0Y A;  2D2W A;  3JTH A;  2FBI A;  4WWC A;  3MAJ A;  4HZF A;  2ESN A;  2HFH A;  3J81 Z;  2WTE A;  3BDD A;  2FEZ A;  2KRF A;  1YW8 A;  3MFK A;  5LRR A;  5D6E A;  1YW7 A;  2A61 A;  4MNU A;  3FX3 A;  4I0B A;  1IN6 A;  4OU0 A;  1YFH A;  1QPM A;  2UXX A;  1IN7 A;  2HOE A;  2CGP A;  3KZY A;  3ERE D;  1IN8 A;  2CW0 F;  4IRI A;  2UWM A;  2UZK A;  3C3W A;  1J59 A;  2P6S A;  2FOK A;  1O7F A;  4U88 A;  1ZRC A;  3VOD A;  2DAO A;  2F5C A;  2FBK A;  1HST A;  4UHT A;  1S29 A;  2J5O A;  4MHG A;  3F72 A;  3L9F A;  2FU4 A;  3I59 B;  2DT5 A;  4U0W A;  4YFX F;  1ZAR A;  2HGC A;  3KP3 A;  3J80 K;  1GHC A;  1T0F A;  3JW4 A;  3DPL C;  1W7P D;  1MJA A;  4MTE A;  2XVC A;  3HOT A;  2STW A;  4GYI A;  3IC7 A;  3MWM A;  1Q1H A;  4A5M A;  3V8J A;  2XUB A;  2V9V A;  4HOB A;  4OIO F;  4A12 A;  1G3W A;  1OKR A;  1I5Z A;  4EVI A;  4WCG A;  2IP2 A;  1R7J A;  3CO7 C;  2DLL A;  3MEX A;  5LGU A;  3J80 Z;  1U78 A;  5CYV A;  2IRF G;  4UV9 A;  1LNW A;  4AIJ A;  3H3U A;  2R7F A;  1WKM A;  4I02 A;  4Y17 A;  5HS7 A;  3ECH A;  4JK1 X;  4HBL A;  2DFI A;  4HF2 A;  2L4A A;  4P9F A;  2RN7 A;  2OQG A;  5ICE A;  2VC1 A;  3IRR A;  2H6C A;  2DPU A;  1W5S A;  2EFN A;  2W85 A;  4NQW A;  4AD9 A;  3Q5F A;  3GX4 X;  3F6V A;  5IT3 A;  4ZZL A;  3WTX C;  3KEO A;  4PDK A;  3WTT C;  2XRN A;  3HSE A;  1OYW A;  3WOD F;  3LQR A;  3FMQ A;  2YX4 A;  4NHJ A;  4I2O A;  2HTJ A;  4KFC A;  4FHT A;  3EYI A;  2FA5 A;  1P92 A;  1H9T A;  4LGW A;  4F7Z A;  3R60 A;  1TQM A;  1E2X A;  5DD8 A;  3IWF A;  4CIC A;  2H94 A;  2QQA A;  1ZYR F;  1FY7 A;  3SZT A;  2JSC A;  2ZNZ A;  3BJ6 A;  3RYP A;  4P55 A;  5D4S A;  1Z7U A;  3GLX A;  3COA C;  1B6A A;  2FE3 A;  4GGG A;  2JRT A;  3ABT A;  3QU6 A;  5HDN A;  3CO6 C;  1IRF A;  3KP5 A;  3R0J A;  1RI7 A;  4M9S A;  5HLH A;  2IJL A;  3LA3 A;  5E20 A;  2RKH A;  2RQP A;  2HYG D;  3FMR A;  3PFI A;  1HXD A;  4GYG A;  4L5J A;  5ICF A;  1WWX A;  2OD5 A;  2CSO A;  1YQA A;  2JTV A;  4EJO A;  2R7D A;  4L5I A;  3GYH X;  2P8T A;  4LLL A;  3E6C C;  1AWC A;  1W7P A;  4OMY A;  3DEU A;  5D6F A;  4HF0 A;  3F8N A;  2NRA C;  2HZT A;  2LDU A;  1ZGJ A;  4XLN F;  2Y48 A;  1DPR A;  2QQ9 A;  1U3E M;  3T1B A;  3CDH A;  2JT1 A;  2P5K A;  3REO A;  1GXQ A;  2P7C B;  2ACJ A;  2FRH A;  2OZU A;  3HTS B;  2J5P A;  1KYZ A;  3IL2 A;  4M71 A;  5JVT A;  2IA0 A;  3WTY C;  2LNB A;  1K78 A;  2Q0O A;  4UXN A;  4HYE A;  1SFX A;  2Z9O A;  3RPQ A;  5JHU A;  5FD5 A;  4PCQ A;  4A6D A;  4CGZ A;  4KA4 A;  1B9M A;  2VOP A;  2KIU A;  4ZYH A;  4HDV A;  4RGS A;  3IKV A;  1QQI A;  5BPI A;  1D3Y A;  2H09 A;  4I09 A;  3S2W A;  4CYD A;  1FOK A;  4LD5 A;  3Q9S A;  1BC7 C;  2FBH A;  1LEA A;  3MZY A;  3EDP A;  3MZH A;  3GWZ A;  3CLO A;  1J2X A;  3TOA A;  2ZME A;  1ZLJ A;  5E8I A;  3KFW X;  5IT9 K;  2YX7 A;  4OIN F;  4ENK A;  2W24 A;  3VOE A;  3TO9 A;  3K69 A;  3QU3 A;  5E1X A;  3DQV C;  5DDG A;  4FT8 A;  2QWW A;  1Z91 A;  3C7J A;  3E6D A;  4WK8 F;  2L3D A;  2Z3Y A;  2M87 A;  2EV5 A;  1FX7 A;  1QZY A;  2XAQ A;  2GAU A;  5ICC A;  5IT9 Z;  1YTY A;  4YFK F;  1O3R A;  3BY6 A;  1MDM B;  3L2C A;  1ZG5 A;  1G4D A;  2NNY A;  1FLI A;  2CFX A;  2STT A;  1P2F A;  5HOO A;  1U8R A;  3M7G A;  4Y15 A;  3SFZ A;  4DQ2 A;  3JTG A;  2O6G E;  3BJA A;  1T39 A;  2PJP A;  3QPH A;  5ED4 A;  4UVC A;  3E3V A;  3WU0 A;  1ON1 A;  5LRS A;  1ON2 A;  2BBY A;  1UFM A;  3O6B B;  3WGI A;  3I5U A;  4MQV A;  3HIF A;  4HV6 A;  4RB0 A;  3ABU A;  1ZRF A;  1BI0 A;  3NQO A;  1IN5 A;  3RTR A;  2ISZ A;  3ZP5 A;  4OIP F;  3WTZ A;  2A07 F;  3DPT A;  1JGS A;  4L9T A;  4ASN A;  4U7D A;  2VOO A;  5HLG A;  1KU3 A;  5K5Q A;  2F5E A;  1YG2 A;  4BHP A;  1OMI A;  2Y75 A;  1S7A A;  2YU3 A;  3V4G A;  5FLX K;  4L9N A;  5CLS A;  1PDN C;  1XMA A;  2CYY A;  2CQK A;  5H6Q A;  3I58 A;  3I59 A;  3RKW A;  2X0L A;  4N9H A;  3EUH A;  1REP C;  1A04 A;  3RKY A;  2DI3 A;  3ZMZ A;  5EEG A;  2ZKZ A;  3RPU A;  4HV5 A;  3ZMS A;  4IRH A;  3HUG A;  3VB2 A;  2IA2 A;  1KQ9 A;  4O6J A;  1F4K A;  3KLO A;  3CUQ B;  3T5X A;  1I6X A;  4HDU A;  3E5U A;  4BH9 A;  3GFM A;  4HLY A;  1OR7 A;  4LFU A;  5D8L B;  2DQL A;  5LGN A;  2PQ8 A;  2XIG A;  5FGM A;  2QEN A;  3R61 A;  3LWF A;  2VXZ A;  1TBX A;  3SHF A;  5TJJ A;  3LQQ A;  5ILV A;  2VON A;  2A6H F;  5DCM A;  4UUV A;  3U2R A;  1S7O A;  2MH2 A;  2HR3 A;  5LHI A;  4HQM A;  2QYO A;  2QBY B;  3TOB A;  4EM2 A;  3P9I A;  5J6X A;  3WTV C;  3DV8 A;  3BZ6 A;  4RGX A;  4OIR F;  2L01 A;  3ULQ B;  4AVP A;  2ESH A;  3WGH A;  1CF7 A;  1TNT A;  1PP7 U;  1LB2 A;  3W6J B;  2GXG A;  2HQR A;  1UCR A;  3GW2 A;  3CUO A;  1LDJ A;  3E97 A;  1TNS A;  2O3F A;  4M73 A;  1FT9 A;  4U7B A;  3HSF A;  1BIB A;  2HTS A;  1E17 A;  4OIQ F;  3U1D A;  1NHA A;  2P6T A;  5CVU A;  1QBJ A;  2V79 A;  3BRO A;  2EFW A;  4B09 A;  5K5O A;  4A0Z A;  3F21 A;  4EMS A;  5JFR A;  3V7S A;  3E6M A;  2W57 A;  5F6F A;  1XGM A;  3OOP A;  2ZXJ A;  4N0B A;  4P5O A;  1IUY A;  2EFO A;  3KE2 A;  3QOP A;  3F8B A;  1GXP A;  2FNP A;  2QVO A;  2HKX A;  5D5U B;  4P9U A;  3BPV A;  1U6G A;  5BOX A;  2VBY A;  4IPA A;  4HF1 A;  1STZ A;  4YG2 F;  1F5T A;  2FF4 A;  3QPT A;  4MEX F;  1SMY F;  1K6O A;  1IZ1 A;  2XAF A;  1G3S A;  3ECO A;  2XKP A;  4ZYE A;  2A6E F;  3TGN A;  2VBX A;  2XAH A;  4N9I A;  5ICG A;  3P9K A;  1BBY A;  4IF4 A;  4EJW A;  4BNC A;  1KQ0 A; 
#chains in the Genus database with same CATH topology
 1MD0 A;  4XOR A;  1XCV A;  4QTR A;  1GDT A;  3BJO A;  1T2K A;  3ERM A;  1ZRD A;  3PSF A;  4HAM A;  2X48 A;  4KIC A;  1KYW A;  4RA2 A;  2CV2 A;  1QA6 A;  1TT0 A;  2L7Z A;  3UR3 C;  4A0X A;  3BOQ A;  4LK1 F;  4XLA A;  2VBZ A;  2G7U A;  2ELJ A;  1ZH5 A;  4EJU A;  3RDI A;  2HKO A;  3PL8 A;  3GZ5 A;  3QPS A;  1FIA A;  2FXA A;  3ZQF A;  3IKT A;  2IXS A;  4LG0 B;  2X1C A;  1NK2 P;  3N05 A;  1ORK A;  1P7I A;  4ZZD A;  1E3P A;  4FE7 A;  2PFB A;  2HQN A;  2XF7 A;  4AU7 A;  5IOZ A;  4M9Z A;  5LGT A;  2VJ4 A;  1YO5 C;  2LY2 A;  3BR1 A;  1SD6 A;  3W2W A;  5B5E C;  2O61 A;  1BOB A;  1R22 A;  1WCM J;  2GLO A;  2DA5 A;  1R1T A;  4WXC A;  5E1W A;  2FOW A;  3HRM A;  3LOC A;  3HEF A;  1VQ6 I;  4DNC A;  4G7H F;  3P9C A;  2Q2E A;  1ETY A;  4S0H B;  4HW0 A;  3FIS A;  3TDZ C;  4ESF A;  3S1R J;  1OCP A;  2ZB9 A;  5HS9 A;  4LB6 B;  2WA0 A;  4ESJ A;  2B7E A;  3ZMD A;  1VTN C;  3VYT B;  3OS2 A;  1ZN2 A;  3JRC A;  2DDB A;  3FXQ A;  5JHF A;  3QRF F;  1Z0X A;  2OU2 A;  1U0J A;  2IW5 A;  3K1N A;  1JXS A;  1V5F A;  3K4C A;  2AXT C;  5KCM A;  3I54 A;  3WTU C;  2GA2 A;  2IT0 A;  4CCM A;  5D5V B;  2CUZ A;  4D7M A;  2YU9 J;  1SVM A;  1DU6 A;  5BS6 A;  2KZG A;  2RRE A;  5K5R A;  1W36 C;  2M5W A;  4RGU A;  1EH8 A;  4KIF A;  3C1D A;  4OAZ A;  2ZFW A;  3MMY B;  3ZPL A;  4E7H A;  1GV2 A;  3PJR A;  2BGC A;  4Y13 A;  2DCE A;  5L3E A;  3KP2 A;  2EBI A;  4DYR A;  3IWZ A;  3CF5 F;  2EZI A;  4XLF A;  3BWG A;  1XGN A;  3K1M A;  1LVA A;  4YFN F;  3HTU A;  2EV6 A;  1BOA A;  3HDD A;  1Z9C A;  1HW1 A;  1N78 A;  2VQH A;  1AA7 A;  1MNM C;  3S2H J;  5GAG J;  4AWX B;  1X3W B;  3OYH A;  3D5R C;  4MFE A;  1XD7 A;  5HLT A;  5CPR B;  3J7A O;  1X4O A;  2K4J A;  2EA4 A;  3PQJ A;  5HLI A;  2N8G A;  1WVR A;  1XDU A;  3FWE A;  2NS8 A;  2R7V A;  4XSX F;  2HPM A;  3K0L A;  2M0C A;  5J40 A;  5E8G A;  1R5H A;  2K9Q A;  1KA8 A;  1ULY A;  2QLZ A;  1M1E B;  3I0T A;  1BW6 A;  2R0Q C;  2R5Z B;  2I5U A;  2L9R A;  4BBR J;  4LMY A;  4Q4Z F;  3EPZ A;  1G6N A;  3QOD A;  1WGX A;  1ZTR A;  4W97 A;  5DS9 A;  3IHU A;  1MDM A;  1TW3 A;  2D1V A;  4D5F A;  1CGP A;  1AU7 A;  1IDY A;  1RET A;  5C4X J;  3U9G A;  3CZ6 A;  1O3S A;  1MKM A;  4HST A;  1XC5 A;  3HHG A;  4KMU X;  2NXN B;  1ZLK A;  2DTR A;  3OR2 C;  2ZC2 A;  4Y33 A;  1U9O A;  1MMD A;  2KMU A;  3CDL A;  4Z2Y A;  3DLL F;  4NB5 A;  2VJJ A;  2WC2 A;  1XTA A;  1U8B A;  1JHH A;  4QWQ A;  3B73 A;  5KK1 A;  4HX7 A;  3BG3 A;  2LKX A;  3R4K A;  2BVM A;  2OAZ A;  3E5X A;  3HM5 A;  2K85 A;  1LQ1 A;  2D5V A;  1OLT A;  1QPI A;  5DTD A;  5E18 F;  3ASN H;  3H92 A;  4G8X A;  3W6K B;  4R79 A;  2EK5 A;  1FNN A;  5F04 A;  3I56 I;  3NRV A;  4LLG F;  2E1N A;  2EIL H;  1OFC X;  2LTP A;  5KHD A;  1UAA A;  3MVP A;  2GQQ A;  3O2P E;  4ON0 A;  3F8M A;  3M07 A;  4I7H A;  3PSI A;  4RLF A;  5CVV A;  2K4B A;  1SD5 A;  3ZMT A;  4RAY A;  2LSO A;  2CV0 A;  3QAH A;  3V7C A;  1X58 A;  2M8G X;  2HWV A;  4GO1 A;  4M3G A;  3I71 A;  1I1G A;  1BL0 A;  2CW7 A;  3I4N J;  3NEU A;  4NQW B;  2Q8K A;  3HOS A;  1JHF A;  3EQL F;  5FB2 A;  1PUE E;  2V1U A;  3H5N A;  1P4X A;  1FYL A;  2V7F A;  1BC8 C;  1Z77 A;  2BW3 B;  5L3B A;  4M9X A;  2QQB A;  5F0F A;  3CTA A;  3RPU D;  4M74 A;  3GTG J;  5ERI A;  5HVQ C;  1SAX A;  2ADU A;  3AFH A;  1XSX A;  2PMU A;  3PM1 A;  1Z05 A;  2M9H A;  3DCF A;  3DFG A;  3AG3 H;  5BMZ A;  1FYK A;  2VN2 A;  2EPF A;  3CCJ I;  2K27 A;  2RNJ A;  2DA3 A;  2DJI A;  1IXC A;  2PG4 A;  4UV8 A;  4BUP A;  4NDL A;  3SQN A;  3S1Q J;  2I8D A;  1FZP B;  4U87 A;  2EJR A;  1IO2 A;  1G3Y A;  3F23 A;  1K4T A;  3PNY A;  3WU1 B;  3JRG A;  1WPK A;  5GAD J;  2L0K A;  5CKT A;  1AOY A;  3KP6 A;  1W5C C;  5IOY A;  2XB5 A;  1FBS A;  3F8C A;  4V2G A;  1ZQ3 P;  1UST A;  1ODD A;  2LH9 A;  3FHN A;  2BEO A;  3LMM A;  1RRJ A;  1N75 A;  4G94 A;  5ILS A;  1UMQ A;  5J1Y A;  2XAS A;  3OR1 C;  1ZGA A;  2PX9 A;  2QUF A;  5L3C A;  3M8E A;  3F22 A;  3M8F A;  3H35 A;  1MMG A;  1W36 D;  1D5V A;  4IQJ A;  1KGS A;  3TKY A;  1OQY A;  4A5N A;  3LFK A;  1YHQ I;  5FLV A;  4S05 A;  2ZJP F;  2I10 A;  2K7L A;  2Z5U A;  2BXY A;  3IAS 2;  2OA4 A;  2XGX A;  4MQ9 F;  4QLC U;  2CU7 A;  1FBQ A;  4B8X A;  4CYC B;  2Y0S N;  4DJA A;  3OIP A;  2XHK A;  4A3D J;  4HA8 A;  4RLQ A;  4AID A;  3BQY A;  4M6V A;  3E1S A;  1JUM A;  1P7J A;  2IGM A;  3KZZ A;  1PUF A;  3GZN B;  2K40 A;  3IV5 A;  2JPB A;  4J19 A;  1LJ9 A;  1R36 A;  1K7A A;  5CVJ A;  2DK8 A;  5IP9 J;  3F8F A;  5J47 A;  2KT0 A;  2K5C A;  3FF5 A;  2DYS H;  2E34 A;  1ZGW A;  4MFD A;  1OCT C;  4L0Y B;  3DKW A;  3Q0U A;  4Q48 A;  4FE4 A;  4BGD A;  1VQ4 I;  3DKY A;  5DM7 F;  2NVT J;  4AM3 A;  1B72 A;  3A0B C;  5IYC J;  1Z1D A;  1YX3 A;  1A5J A;  3OYM A;  3VEP A;  3EET A;  4XLP F;  3VSL A;  1MMN A;  1ETV A;  1S9H A;  1S3J A;  3ML6 A;  4XKC A;  1J09 A;  3A2K A;  4IHV A;  2QBY A;  2LLK A;  2A5Y B;  3SDG A;  3TP0 A;  5LEK A;  3G2B A;  4XM3 A;  1R58 A;  4NBQ A;  3K6G A;  2LYC A;  4C3H J;  1UHM A;  1WI9 A;  2LF7 A;  1A36 A;  3BG6 A;  1JE8 A;  2O0Y A;  1O3T A;  3RI4 A;  1YE9 A;  3RIR A;  4IO9 F;  3T8T A;  1S8N A;  5J4Y A;  2G0E A;  2Y30 A;  1ETO A;  3JRA A;  1OJL A;  1XMK A;  1IXR C;  1OCZ H;  1SAN A;  1TP4 A;  3S93 A;  3S15 J;  2JPC A;  4XN0 A;  3TW7 A;  4RB2 C;  2ISY A;  4KT5 C;  5IY5 H;  3PO3 J;  1R00 A;  3OSG A;  1RUN A;  3ZQG A;  1IXS B;  1SFE A;  2OF7 A;  1R23 A;  2BOL A;  2NAZ A;  1Y56 A;  3CLQ A;  3HSR A;  1PVE A;  3CC4 I;  2FML A;  2KIM A;  3EYY A;  4RS8 A;  1T8I A;  2DOF A;  5DUK A;  3M9A A;  2FJ1 A;  3ABK H;  3CMA I;  3FXU A;  5K1Y A;  2E1M B;  1YIJ I;  4D0P A;  4B44 A;  1UHS A;  5D4R A;  5CQE A;  2F5D A;  1O7L A;  4IEJ A;  5J8C A;  3JRH A;  2FNA A;  3KPH A;  2XAU A;  4CZZ A;  3ZR8 X;  2A68 F;  4BHB A;  1ZK8 A;  2HZD A;  1OPC A;  3K4N A;  3OMY A;  3HZJ A;  4M3D A;  3QYB A;  2KJB A;  2X85 A;  4F55 A;  2K3F A;  4LIT A;  4QSH A;  1WFX A;  2K86 A;  4LLN A;  4R8H A;  3K2Z A;  1SMT A;  3Q9V A;  1JTX A;  2ZSH B;  2PMZ N;  4KJZ A;  2WAQ N;  1BR2 A;  2RAE A;  3LSG A;  3JRB A;  1LEB A;  3K7A J;  2WWY A;  1FP2 A;  2F6C A;  3TO7 A;  3FM3 A;  3GTJ J;  2VKE A;  3V7R A;  2O8X A;  3FBI B;  4KN7 X;  4DZP A;  5EG0 B;  4L9J A;  1ZR4 A;  1U5T B;  3RKX A;  2DOD A;  2COM A;  3ISP A;  1MSF C;  4BXU A;  4DGW B;  4C2T A;  5J4V A;  4M72 A;  1XGS A;  5GTH C;  4X6A J;  2MW8 A;  5IYD J;  5E3M A;  1J75 A;  1FP1 D;  2E19 A;  1YIO A;  1FPQ A;  1Y8Q B;  2LG4 A;  3GO5 A;  3A02 A;  1F1Z A;  5DD4 A;  4ENM A;  2EQR A;  5E1Z B;  3SEZ A;  1SAU A;  1P4W A;  5FKL A;  3WTW C;  1X2N A;  2OZ6 A;  5DV5 A;  3T0Y A;  1EH6 A;  5LBQ A;  4OAY A;  1AHD P;  1D8K A;  1WJB A;  5TIS C;  2DU9 A;  4BY7 J;  1VQ5 I;  3GME A;  1E0E A;  1H8A C;  1ETQ A;  2MA3 A;  3HRS A;  3JRD A;  2ECB A;  2ELH A;  4XID A;  4KYW A;  3ZRG A;  4PJJ A;  2VOD A;  2RNG A;  5K7Z A;  2A5W A;  4A3K J;  3LAP A;  4NNJ A;  2LF8 A;  3LFU A;  5EYR A;  1FTZ A;  3LSJ A;  4OOI A;  3QWL A;  3AKZ A;  3SEQ A;  3HGY A;  2PLY A;  4DOZ A;  4FX0 A;  1MW7 A;  3Q3S A;  4U0V A;  3CQZ J;  5IYB J;  4C30 A;  4RAG A;  3VDX A;  1F9N A;  3A03 A;  2MLK A;  2EFP A;  2ZBK A;  4JYK A;  5GPA A;  5DEQ A;  3BPX A;  3LST A;  1BM9 A;  5E3O A;  3DTI A;  4E7J A;  4D5C A;  1AKH A;  3ABM H;  4C3J J;  5BQT A;  1GVJ A;  2BYV E;  1Y0U A;  3TDU C;  1WJ5 A;  3JAM Z;  3PUB A;  5LLQ A;  3OS1 A;  3ROU A;  1XN7 A;  3JSP A;  1RPW A;  2E7X A;  4PZJ A;  1U2W A;  1TWF J;  5B3S H;  4M3E A;  4XLC A;  4LG0 A;  2H6B A;  1R71 A;  4TV7 A;  1XG1 A;  2RV8 A;  2LVS A;  1R9T J;  1HW5 A;  4G7O F;  1XSV A;  4N4O B;  3TP3 A;  4V2F A;  1VFC A;  3JSO A;  4A3F J;  1U5T C;  2EV0 A;  2VXD A;  5HDK A;  2HYF A;  4R1H A;  2EFQ A;  1G59 A;  3ZN1 A;  4AIH A;  5D5W B;  2NOG A;  2JJ7 A;  4MEY F;  4XIC A;  1YS6 A;  1ZAO A;  3CMY A;  4ANJ A;  1LDK B;  4M6X A;  4XBF A;  3IRQ A;  3CCM I;  2HOT A;  2CW8 A;  4PSW A;  4IHY A;  2LBF B;  5DCF A;  1L3L A;  3MKW B;  5AON A;  3KEY A;  3MKY B;  1KON A;  3L2R A;  1L0O C;  2DOE A;  2GIV A;  3ZQQ A;  4IHX A;  3G3Z A;  3CUQ C;  1QZZ A;  4ZYA A;  4EGY A;  5CVI A;  4ENJ A;  1JI8 A;  1YOV B;  3W3C A;  5HS8 A;  2V1N A;  4CCO A;  4A69 C;  1YJ9 I;  1N25 A;  2QM3 A;  2M30 A;  2X1D A;  3ABL H;  1JKR C;  1XB4 A;  1QHH D;  4BYY A;  1A6I A;  1FBU A;  2W82 A;  4EM1 A;  4BU2 A;  5LEJ A;  3PIP F;  1MH3 A;  3WU2 C;  3K4M A;  2GA1 A;  3H0G J;  2D45 A;  3PNV A;  2CG4 A;  3HRU A;  1Z6R A;  3KCC A;  4S04 A;  2XKO A;  1YS7 A;  2E60 A;  1NTC A;  2ZXW H;  4BEH B;  3HBL A;  3H36 A;  3F6O A;  1G3T A;  4D1Q A;  1TWA J;  3OIO A;  1B9N A;  4UNO A;  3TBI A;  1HDP A;  2MYS A;  2IGN A;  1SD4 A;  4EV0 A;  2CWE A;  1PP8 F;  4LJZ F;  4KIT B;  3D1N I;  1MBK A;  1MZB A;  1OIS A;  1YYV A;  3NWS A;  1BJZ A;  3RJP A;  3S8P A;  4IHT A;  3L7W A;  3N4M A;  3BZK A;  2Z33 A;  2DA1 A;  2DFE A;  1HF0 A;  3CCV I;  2HU9 A;  4E7K A;  2ZJ2 A;  3MKL A;  1USS A;  1ACI A;  2HXO A;  3QP6 A;  2F4M B;  4XKB A;  2XPU A;  1FSH A;  3S3N A;  2W00 A;  5E17 F;  2HS5 A;  3GFL A;  4KDP A;  4BXX J;  3BR0 A;  4KNY A;  3D0S A;  4BHC A;  3RQI A;  1IDZ A;  4MTD A;  1JUS A;  4NC8 A;  1IRG A;  1FWZ A;  4E70 A;  2IEK A;  3DEE A;  4XRS G;  1HBX G;  2O9L A;  2PEX A;  1D0Z A;  4MO7 A;  1KU7 A;  3OYG A;  4BE0 A;  2R92 J;  2DMP A;  1FC3 A;  2R5Z A;  2HVS A;  1OYY A;  1T6S A;  2IVM A;  1DP7 P;  2OJE D;  2VPL A;  1ZEL A;  2IAI A;  3E6B A;  3CCU I;  4PJL A;  1IW7 F;  4RDU A;  1JJ8 C;  1UEL B;  5J1R A;  3C18 A;  1BR1 A;  2DTZ A;  2RGV A;  1TW2 A;  2E2I J;  2WB1 N;  2XAG A;  2XDV A;  2EWN A;  4G7Z F;  3M1E A;  1QRY A;  2CO5 A;  1ONV A;  3S1M J;  1S6L A;  4II3 A;  3W6V A;  4AIK A;  5EDN A;  2H8R A;  3I64 A;  5DCM B;  3K4B A;  2QSF X;  2ZO4 A;  4BJT A;  4HX4 A;  2CQQ A;  1XX5 A;  3BG5 A;  1HKS A;  3V8K A;  3H3Z A;  1ETW A;  1X3U A;  2AO9 A;  2NNN A;  3HKZ N;  2LKP A;  1LE8 B;  1MBF A;  3UNG C;  2FQ3 A;  4ETS A;  2EIJ H;  3BTJ A;  3K9T A;  1WH7 A;  1LUJ B;  5EZG A;  3TQN A;  3HOY J;  3DXJ F;  4A2U A;  2L9V A;  2DOA A;  2R7Q A;  4L9V A;  4CO8 A;  6PAX A;  3G73 A;  3FBN B;  3JR9 A;  3L00 A;  3L09 A;  4BXF A;  3OYN A;  4Z6Y A;  1CF7 B;  2DO7 A;  4A3C J;  4O5V A;  2L54 A;  4IVN A;  1Z7L A;  2KJC A;  3BQZ A;  1ZG1 A;  2BW3 A;  1XMX A;  2V1D A;  3MCZ A;  4YIF A;  1ERD A;  2WAD A;  2FX0 A;  2Z1D A;  1QNT A;  3RKQ A;  4JP0 A;  2M7B A;  4ZDL A;  2WV0 A;  3ZQI A;  4CHU A;  4KIB A;  1GT0 C;  4A3M J;  4HLX A;  2KRH A;  4EM0 B;  2M1B A;  1ZRE A;  3WE3 A;  5F1R A;  2MD5 A;  2XGE A;  4BDZ A;  1H9G A;  2M45 A;  5HDG A;  1XCB A;  2HVQ A;  2E7W A;  3KEQ A;  2QA4 I;  3CD6 I;  1P6R A;  4BQN A;  4BS9 A;  5FKN A;  3O3K A;  2D1H A;  4IRG A;  2JA8 J;  1HDD C;  1XGO A;  3LL7 A;  2XAJ A;  4A3J J;  4X1E A;  2XF5 A;  5H20 A;  1FYM A;  2IPQ X;  2XSD C;  2O7O A;  1HSJ A;  2L5Q A;  2PN6 A;  2XRL A;  3ONQ A;  1SVL A;  4PJN A;  5L3F A;  3GTP J;  5JI6 A;  5CVR A;  4RGR A;  5AIQ A;  3FZV A;  3HHH A;  3IH4 A;  2VI6 A;  4GXO A;  5A2Q K;  1I50 J;  2EIK H;  2IBD A;  2O03 A;  3I53 A;  4KIG A;  4EGZ A;  2M7A A;  3B02 A;  3F9K A;  3F3X A;  4ZYD A;  2LR8 A;  1O3Q A;  1MBG A;  5M3F J;  3ZMV A;  2YSR A;  3JCU C;  3BP8 A;  1UHW A;  2F2E A;  2KP6 A;  4RB1 A;  2Z2S B;  4HX8 A;  2MBF A;  2FUG 2;  1TL8 A;  1RUO A;  5FJ8 J;  4B1R A;  4U0Y A;  1BI2 A;  3OYC A;  2KL4 A;  4CXF A;  3KLN A;  2AHQ A;  2VC0 A;  1XPX A;  1UB9 A;  3D5L A;  3FM5 A;  3HYI A;  3R0A A;  4Q5S F;  2MFZ A;  5BPD A;  2VT2 A;  3GFJ A;  1VQO I;  4ZYG A;  5L3G A;  1RIO H;  1DDN A;  2M4K A;  5A2Q Z;  2WY8 Q;  4ABZ A;  1LFB A;  2DK5 A;  3JRF A;  4PJ0 C;  4KIS A;  4KN4 X;  5FRO A;  2QSH X;  2VT3 A;  4ZJZ A;  3DP7 A;  4GCV A;  1HW2 A;  1DGW Y;  1TQP A;  2ZFU A;  4YII A;  2CV1 A;  1IC8 A;  2F48 A;  4EJT A;  2BY2 A;  4RAF A;  1IV6 A;  1J9I A;  3QYE A;  5F1J A;  3VFZ A;  4WX9 A;  3SXY A;  5HNF A;  2X51 A;  1A31 A;  1X4P A;  1FIP A;  3OY9 A;  1ZG3 A;  1QZE A;  2VQG A;  1FMW A;  4H0E A;  3LA7 A;  3CCY A;  3QYF A;  3GZ6 A;  1VQ7 I;  3HPH A;  2VB6 A;  1QVT A;  3A4C A;  2KZV A;  1QO0 D;  3R6S A;  2QZ8 A;  2K02 A;  2ETH A;  2A3S A;  3J7Z I;  4DIQ A;  4YIR X;  1IG7 A;  2KLO A;  4IJA A;  1WSU A;  5CJ9 A;  1DP3 A;  4UB8 C;  4OWR B;  3OV8 A;  3CCL I;  2FSW A;  3AAF A;  1KU9 A;  2UXN A;  3SJM A;  4M6Y A;  2M8E A;  1OYI A;  1SD7 A;  2H27 A;  1XSD A;  5FO5 A;  1J7K A;  1W1W E;  1WI3 A;  1H0M A;  2R5Y B;  3ZQH A;  3DBL B;  4B3X A;  4YEL A;  2P7V B;  2XRO A;  2UV1 A;  3FXR A;  2XGC A;  1ZHF A;  3QQA A;  2FMY A;  4RM3 A;  1FJL A;  4PGH A;  3KYL A;  3G1O A;  3BG7 A;  1W5T A;  3GBG A;  1T0F C;  2JA2 A;  1MBH A;  1R1U A;  2WAE A;  1J5Y A;  3FHZ A;  3CJN A;  5D8K B;  3OIQ A;  4BAY A;  3HPG A;  2EIM H;  1X1C A;  3GXO A;  5EEH A;  2DA6 A;  4NC6 A;  4XNF A;  4FX4 A;  1R4M B;  3I4M J;  5TRD A;  2VKV A;  2OUM A;  4I0A A;  2KRC A;  1IV8 A;  2YPR A;  4HNU A;  1DUX C;  2HDD A;  4MGR A;  5F64 A;  4LOC A;  3DEW A;  3MKZ A;  4K2E A;  1MIJ A;  2NVY J;  4P96 A;  2ELK A;  1D1B A;  2KFD A;  2Z99 A;  4EJV A;  1ZKG A;  4OMZ A;  2CQN A;  3KP7 A;  3IH3 A;  4ZH4 F;  1A6Q A;  5EG0 A;  1U5T A;  2DMU A;  1B8I A;  3LSI A;  4L18 B;  1BI3 A;  3CJR B;  2JA7 J;  2VE8 A;  3ZGK A;  3DTK A;  1SFU A;  1T98 A;  4CA0 A;  1RR8 C;  2L7K A;  2HDC A;  2LRE A;  3LA2 A;  1SEU A;  1RNL A;  1V4R A;  2DQR A;  2G9W A;  1I39 A;  3KP4 A;  2MH9 A;  2G7H A;  1B1B A;  4KMF A;  3S14 J;  5FRM A;  5GTI C;  3D5S C;  2KHM A;  5EGO B;  5M5Y J;  2OPT A;  3PQK A;  4HQE A;  1HKT A;  5K7H A;  1MJB A;  1NH3 A;  1BI1 A;  3BC8 A;  1IRX A;  5LHH A;  1YLF A;  1E3H A;  1JKO C;  2HVR A;  1X19 A;  2B63 J;  3CUQ A;  3MQ0 A;  3N97 A;  1B59 A;  2CRG A;  3GFI A;  2ZXH A;  4I98 B;  1HQC A;  4G9Y A;  5DUI A;  2R3S A;  3ZCO A;  4RB3 C;  4LB5 A;  5D5X B;  2B0L A;  3WGG A;  1BJA A;  1TWH J;  4IHS A;  2X4H A;  2W48 A;  4O3M A;  4F52 A;  2DW4 A;  3OSF A;  3QOE A;  2KDO A;  4G6D A;  5FFX A;  1SFO J;  4Y3O A;  1BIA A;  3PIO F;  1YIT I;  2L9N A;  5L3D A;  2O5R A;  1UZC A;  3K4L A;  2IGK A;  4WXH A;  2E1C A;  1TLH B;  4A6E A;  3F0C A;  2DBB A;  3GUD A;  5B1B H;  1DPU A;  4FCY A;  1FSE A;  3ELK A;  3KYC B;  2GZW A;  2RDP A;  1WQ2 A;  2KDZ A;  4XKV A;  2QEX I;  2XB0 X;  4KUM A;  2XF6 A;  4I99 C;  2MC3 A;  2CH0 A;  4V19 K;  4RAZ A;  2CUF A;  4JOM A;  1KU2 A;  2BV6 A;  3RCO A;  2LY9 A;  1LPQ A;  4PUS A;  3GTO J;  1KQ8 A;  3W2V A;  1W7P B;  2L2O A;  4B47 A;  1T08 B;  2W1O A;  5LHG A;  5DYM A;  1IF1 A;  2QKL B;  2PBI A;  2BZT A;  3BTC A;  2P4W A;  5F0C A;  4CUG A;  2BHZ A;  3GF2 A;  2MAB A;  1O57 A;  1W4M A;  1J0R A;  5FFZ A;  2ME6 A;  1X1A A;  2LP0 A;  5F08 A;  2PJR B;  2KKO A;  2YS9 A;  2LY1 A;  5FKK A;  3K70 C;  1IUF A;  1MMS A;  2E2J J;  2OBP A;  3GVA A;  3ZQ7 A;  2DJN A;  3FK7 A;  1BN5 A;  1FEX A;  2ZSI B;  5HNH A;  5LFA A;  2RC4 A;  2KPM A;  1UG0 A;  3MZ8 A;  4XLH A;  4WXD A;  2BY3 A;  2W84 A;  1V55 H;  2P5L C;  3HRT A;  4HRI A;  2Y0S A;  1K78 B;  4CH7 A;  2DPD A;  2LBF A;  3OYJ A;  3OYB A;  2BE5 F;  5JR3 A;  4L0Z B;  4NUB A;  1D8J A;  5J8F A;  4XSZ F;  4IQ4 A;  3S1N J;  1T38 A;  2R7Z J;  4LIV A;  2NS0 A;  1EH7 A;  2TDX A;  3ASO H;  4LG3 A;  5TGT A;  2QCO A;  1MH4 A;  2JVH A;  1Y39 A;  2GXB A;  1WRJ A;  2VBW A;  4Y7N J;  5H6R A;  4ZTJ A;  1T33 A;  1FTT A;  1K83 J;  3K4J A;  3V8L A;  3HOV J;  2EZK A;  1RKW A;  3FMS A;  2JUC A;  4PGG A;  3E5Q A;  1IJW C;  1LDD A;  2JZY A;  2AXL A;  1V3F A;  4IXA A;  1QGP A;  2M4G A;  3BR3 A;  2E2H J;  3QP5 A;  4BEH A;  2VE9 A;  1VQ8 I;  2JVG A;  4ESB A;  2V1X A;  1TTY A;  3ZQL A;  2X6Y A;  5KAF C;  3T8R A;  4BDY A;  4ZDO A;  1EA3 A;  1GV5 A;  4XRF A;  1S72 I;  2HEO A;  2V6C A;  1EV7 A;  2ZCW A;  3ZN0 A;  2H8W A;  2E1O A;  3WTS C;  1TQI A;  1V54 H;  4E4H A;  1R49 A;  1B4A A;  3M3Y J;  2W25 A;  3BT9 A;  4BQA A;  3CCQ I;  1C0W A;  1LFP A;  4ZTF A;  1R5G A;  4GDF A;  3P7N A;  2CS3 A;  3VSK A;  3EUA A;  3WE2 A;  1MJ9 A;  2ZME B;  4X0G A;  3ZMU A;  2P81 A;  4PJM A;  4LK0 F;  4DBQ A;  2RVC A;  5FLM J;  4A3E J;  3DF8 A;  1F43 A;  1Z6T A;  5AIP A;  4P1W A;  3A01 B;  4XLE A;  3LAJ A;  3ZXS A;  2L9S A;  3O8H A;  4XOP A;  4XON A;  4HEA 2;  3JAM K;  2ZNY A;  1K79 A;  1K6Y A;  4UVB A;  1DU0 A;  2ZXI A;  1P4A A;  2EA2 A;  2ID6 A;  4CCJ A;  9ANT A;  4D9J A;  2PMH A;  2GWR A;  3SZP A;  1VQN I;  3RYR A;  2OQR A;  3TL4 X;  4EQQ A;  4E7L A;  2E1M C;  1I1S A;  4JQF A;  1I27 A;  2RQQ A;  5FLX Z;  1RZ4 A;  1X2M A;  3CMM A;  2P5V A;  4Q47 A;  2VL8 A;  2A69 F;  3K1P A;  3AG2 H;  3H5A A;  3FXM A;  4UVA A;  1QU3 A;  2X6O A;  1RES A;  2AS5 F;  1O4X A;  2C6Y A;  2MLG A;  1ITY A;  4AYB A;  2NYX A;  4JBA A;  2L4M A;  2Y0M A;  1HKQ A;  3A0H C;  3AG4 H;  2XV4 S;  3PFY A;  5FKO A;  1R1V A;  2R7R A;  4M3F A;  1IAW A;  4CDG A;  2VKD A;  3W2A A;  2DMT A;  3GTQ J;  3I4P A;  2PMZ A;  4YRV A;  2PI0 A;  2IA1 A;  2KIF A;  2WAQ A;  3S2D J;  2QF7 A;  1B72 B;  3FXK A;  2EB7 A;  1IRZ A;  3TO6 A;  2VJI A;  2R7T A;  1XDS A;  5FD6 A;  4G6Q A;  3V42 A;  2YR2 A;  4IZZ A;  5B66 C;  1MGT A;  2XC7 A;  4ENN A;  1LFU P;  4BL0 B;  3J81 K;  3GEZ A;  5KVR A;  1LE8 A;  1IN4 A;  2F5F A;  4BKX A;  2M2E A;  4I01 A;  3WG9 A;  1Y0N A;  4WF2 A;  5ILU A;  3OYK A;  1BW5 A;  2MGQ A;  5E79 C;  3KET A;  1YW9 A;  2L02 A;  4A0Y A;  1TT5 B;  2D2W A;  3JTH A;  4FAS D;  2FBI A;  4WWC A;  4QIW N;  2JK3 A;  3J7Y J;  2ZME C;  3L2V A;  5C3E J;  3HJE A;  3K70 D;  3MAJ A;  4HZF A;  3VYU B;  1A35 A;  2WAF A;  1HCR A;  1WJA A;  3BZC A;  2ESN A;  2HFH A;  1DGR M;  3J81 Z;  4DW6 A;  4FQG A;  2WTE A;  1X1P A;  3BDD A;  4H4K C;  2V26 A;  4DYQ A;  4JX6 A;  2FEZ A;  2KRF A;  1LVK A;  1YW8 A;  5LRR A;  5D6E A;  3MFK A;  3OYL A;  1YW7 A;  4KT6 A;  3H9J A;  2A61 A;  2DN0 A;  4MNU A;  3FX3 A;  2BVL A;  4I0B A;  4A3L J;  1IN6 A;  2Y2Z A;  4OU0 A;  1YFH A;  1QPM A;  2UXX A;  1IN7 A;  5E3L A;  1MSE C;  4PK4 A;  2R93 J;  3K10 A;  5C44 J;  2DMN A;  4W1U A;  2MC4 A;  1S5L C;  4B4C A;  4E7Z A;  2HOE A;  2CGP A;  1D0X A;  1FOX A;  3KZY A;  3ERE D;  4XR6 A;  1EJ9 A;  1IN8 A;  1G8X A;  1BR4 A;  2CW0 F;  3IAM 2;  4IRI A;  2UWM A;  1FMV A;  2VUM J;  2UZK A;  1BA5 A;  3C3W A;  1J59 A;  3X2Q H;  3DBH B;  2KIQ A;  3GTL J;  3OYE A;  2P6S A;  2FOK A;  3L1P A;  4C9Y A;  1O7F A;  4U88 A;  1ZRC A;  3DKX A;  1MNE A;  2BY1 A;  3VOD A;  1T56 A;  3J7A Y;  3DWL E;  2DAO A;  2XSJ C;  2F5C A;  2FBK A;  1HST A;  4UHT A;  1S29 A;  2J5O A;  2HYJ A;  4MHG A;  3F72 A;  3L9F A;  5GP9 A;  5HOD A;  3HOX J;  2FU4 A;  3I59 B;  1W0U A;  2DT5 A;  4U0W A;  4YFX F;  1ZAR A;  2HGC A;  3KP3 A;  5B1A H;  3J80 K;  5JVG F;  4FIS A;  1T0F A;  1GHC A;  1APL C;  3JW4 A;  2OCC H;  3DPL C;  4JX4 A;  4XK4 A;  1W7P D;  2GOX B;  3FDY A;  1MJA A;  1ENH A;  2EZL A;  4MTE A;  1JUP A;  1RR7 A;  4IL6 C;  3OS0 A;  3HUG B;  2XVC A;  3H1C A;  3HOT A;  2STW A;  3HOZ J;  4GYI A;  1D1C A;  3G71 I;  2X9D A;  3IC7 A;  3MWM A;  3E7L A;  5C4J J;  1Q1H A;  4A5M A;  3V8J A;  2XUB A;  2V9V A;  1Z3X A;  4A3B J;  2HDW A;  4HOB A;  1E3O C;  4OIO F;  4A12 A;  3TED A;  1G3W A;  1OKR A;  1I5Z A;  2CQ7 A;  3EUK L;  4EVI A;  2GBY A;  1YI2 I;  2XPV A;  3SFI A;  4WCG A;  2MD0 A;  2JQ7 A;  2IP2 A;  1R7J A;  3CO7 C;  2JN6 A;  4BE1 A;  2DLL A;  3MD2 A;  3MEX A;  3Q0V A;  1CQT A;  3CDI A;  5LGU A;  3J80 Z;  2BY0 A;  1U9N A;  1U78 A;  4ZC3 A;  4DZJ A;  5CYV A;  4UUS B;  2IRF G;  4UV9 A;  1LNW A;  4AIJ A;  5KAI C;  3H3U A;  2JUG A;  2R7F A;  1F36 A;  3CCS I;  1WKM A;  1POG A;  3IP4 B;  4I02 A;  1UJ8 A;  4Y17 A;  4M3B A;  3KZI C;  5HS7 A;  3ECH A;  4JK1 X;  1AKH B;  2ZJQ F;  3C2B A;  4HBL A;  3H9Q A;  2DFI A;  4HF2 A;  1DQU A;  3HL2 A;  2IS1 A;  2FD5 A;  2L4A A;  3BTI A;  4P9F A;  3HOW J;  3IH2 A;  2CUJ A;  2RN7 A;  2OQG A;  5ICE A;  2VC1 A;  2HNH A;  3IRR A;  2H6C A;  5KNL A;  2DPU A;  2GIZ A;  1W5S A;  2EFN A;  2NVQ J;  2W85 A;  2E5Z A;  3O8G A;  4L5E A;  2Y9Z A;  1VQK I;  4NQW A;  5K7F A;  4AD9 A;  3Q5F A;  2R5Y A;  1JJ6 C;  1NG7 A;  3F6V A;  3GX4 X;  5IT3 A;  4ZZL A;  3WTX C;  3I3L A;  5GPC A;  2DA2 A;  3EUH C;  3KEO A;  2ICW G;  4PDK A;  3WTT C;  2XRN A;  3FIW A;  1RC9 A;  1TC3 C;  3HSE A;  3G4S I;  1OYW A;  3WOD F;  3LQR A;  3FMQ A;  4J01 A;  2YX4 A;  4CCN A;  3AL0 B;  1TWC J;  4NHJ A;  4RMN A;  4I2O A;  2HTJ A;  3PO2 J;  2LC2 A;  4KFC A;  1W0T A;  2F5V A;  3ESW B;  4FHT A;  3L2Q A;  3EYI A;  2FA5 A;  1JT6 A;  1ETX A;  3OYD A;  1P92 A;  1H9T A;  2AQF A;  1EKE A;  1FOW A;  1HLV A;  4C2M J;  4LGW A;  1OR7 C;  2WB1 A;  3M8J A;  4F7Z A;  3R60 A;  1EF4 A;  4BY1 J;  1Q1V A;  4ITV A;  1TQM A;  5EZH A;  1E2X A;  2HQA A;  5DD8 A;  2M0M A;  3IWF A;  4CIC A;  2LMD A;  2H94 A;  2QQA A;  2E36 A;  3MN2 A;  2K9L A;  4E7I A;  1ZYR F;  1FY7 A;  3SZT A;  2KQR A;  3G1L A;  2CUE A;  3LSM A;  4A3G J;  2JSC A;  2ID3 A;  3CJT B;  3WHC A;  2ZNZ A;  3HKZ A;  3RQ4 A;  3RSN A;  3BJ6 A;  3RYP A;  2O8K A;  3DU5 A;  2K9S A;  5EGO A;  4P55 A;  5D4S A;  1Z7U A;  5EJC A;  4BQQ A;  3GLX A;  4CYC A;  3COA C;  1B6A A;  2FE3 A;  2MSY A;  3C2G A;  2W4S A;  4GGG A;  4GRI A;  2JRT A;  3B6A A;  3ABT A;  3P5J A;  3PUF A;  2CMP A;  2R7U A;  3QU6 A;  5HDN A;  2HPI A;  2E35 A;  3LSH A;  4LIU A;  3CO6 C;  1TZL A;  1IRF A;  3VWB A;  5M3M J;  4F3Q A;  3KP5 A;  3R0J A;  3FKI J;  1RI7 A;  2IS4 A;  4QPO A;  1YRN B;  2XPW A;  4M9S A;  5HLH A;  2IJL A;  3HB9 A;  3LA3 A;  5E20 A;  4DBR A;  1SVO A;  2RKH A;  3FKJ A;  2M34 A;  2RQP A;  2HYG D;  3CJQ B;  3FMR A;  3PFI A;  3AL0 C;  1HXD A;  1WH5 A;  4GYG A;  4L5J A;  1X1B A;  5ICF A;  3G6E I;  3BTL A;  1WWX A;  2VJ5 A;  2OD5 A;  2CSO A;  5J3L A;  1YQA A;  2JTV A;  2LFB A;  4EJO A;  4Y52 J;  2R7D A;  2IS2 A;  4L5I A;  3SZG A;  3GYH X;  2P8T A;  4LLL A;  5LD2 C;  1LKX A;  3E6C C;  1AWC A;  1V5E A;  1W7P A;  2BHY A;  2OTL I;  4OMY A;  1HC8 A;  3DEU A;  5D6F A;  3U1K A;  1WZ2 A;  2WV1 A;  4AUX A;  4HF0 A;  3F8N A;  2NRA C;  3OL4 A;  2HZT A;  2QQ8 A;  2LDU A;  1ZGJ A;  4XLN F;  2Y48 A;  3I9V 2;  1VQL I;  2CJJ A;  2PJR A;  1DPR A;  2VPR A;  1NG6 A;  2QQ9 A;  1U3E M;  3T1B A;  2DFH A;  3CDH A;  2JT1 A;  2P5K A;  2GM4 A;  2F4O B;  3BR6 A;  5IPA A;  3REO A;  1GXQ A;  2DYR H;  4BQO A;  2P7C B;  3G1M A;  2H1L A;  2ACJ A;  2W7N A;  1Y8R B;  2FRH A;  2OZU A;  4CCL A;  3HTS B;  3HOU J;  2J5P A;  1KYZ A;  2DT6 A;  3TW6 A;  3IL2 A;  4M71 A;  2VAS A;  5JVT A;  1WJE A;  2IA0 A;  2LNB A;  4Y4R A;  3WTY C;  1K78 A;  2Q0O A;  1H88 C;  2Q2E B;  4UXN A;  2MG4 A;  4XL9 A;  4HYE A;  3CCR I;  1ZR2 A;  1SFX A;  1I3A A;  2Z9O A;  3RPQ A;  5JHU A;  3OYI A;  2KIS A;  5FD5 A;  4PCQ A;  4A6D A;  4CGZ A;  3M1C A;  1JGG A;  2LD5 A;  2COB A;  1KZH A;  4KA4 A;  2A6T A;  1B9M A;  2VOP A;  4I76 A;  2VIX A;  1Z3Y A;  2GXA A;  2KIU A;  4UB6 C;  4AC0 A;  2K3P A;  1VQ9 I;  4UUT A;  4ZYH A;  4HDV A;  4RGS A;  4F91 B;  3IKV A;  1QQI A;  5BPI A;  1D3Y A;  4DYC A;  2H09 A;  4I09 A;  3GTM J;  2ECC A;  4F93 B;  3GLL A;  4A3I J;  4E7S A;  3S2W A;  4CYD A;  1VQP I;  1YJN I;  1FOK A;  2V6E A;  3Q0W A;  3CF2 A;  2TCT A;  4LD5 A;  1XS9 A;  3H9G A;  3Q9S A;  3BCB A;  2QKM B;  1BC7 C;  2FBH A;  3ZQC A;  1JKP C;  1LEA A;  3MZY A;  1Z21 A;  3NAR A;  3EDP A;  2NS7 A;  3MZH A;  1D5Y A;  3QPL A;  3M4O J;  3GWZ A;  2EH3 A;  3CLO A;  1J2X A;  2VQC A;  1OCC H;  1VQM I;  3TOA A;  2ZME A;  1ZLJ A;  3RZO J;  3KX2 A;  5E8I A;  3KFW X;  4XOT A;  5IT9 K;  4YEJ A;  2YX7 A;  2L7F P;  2X6W A;  4OIN F;  3LSR A;  4ENK A;  2V9P A;  3A01 A;  1I3Q J;  2W24 A;  3U21 A;  3VOE A;  3TO9 A;  2DT7 B;  4HNT A;  2E71 A;  1UG2 A;  3K69 A;  3QU3 A;  2V4J C;  5E1X A;  3DQV C;  5DDG A;  3K4K A;  4CZC A;  4FT8 A;  2QWW A;  2Y31 A;  4CSW A;  1Z91 A;  3C7J A;  3E6D A;  3DBR B;  3KIO A;  4WK8 F;  2L3D A;  2Z3Y A;  3H0D A;  4HG2 A;  4II2 A;  2M87 A;  2EV5 A;  4XN3 A;  2BXZ A;  5GAE J;  1FX7 A;  1QZY A;  1TWG J;  1SFK A;  2XAQ A;  2GAU A;  5ICC A;  5IT9 Z;  1YTY A;  4YFK F;  3HG9 A;  1WHU A;  4FET A;  1O3R A;  3BY6 A;  1MDM B;  2ME0 A;  3L2C A;  4QPQ A;  1ZG5 A;  2NNY A;  4BJ6 C;  1K4S A;  2CQX A;  2IGO A;  1G4D A;  1FLI A;  2CFX A;  2STT A;  1P2F A;  4XKW A;  4BJ5 C;  5HOO A;  2HOS A;  4IX7 A;  3RZD J;  1U8R A;  4C3I J;  1RKT A;  1GLN A;  3BLY A;  2Q1Z B;  3M7G A;  4Y15 A;  1K61 A;  3SFZ A;  4DQ2 A;  3JTG A;  3OWT A;  2O6G E;  1X3Z B;  3BJA A;  2K9M A;  1FOY A;  1T39 A;  2PJP A;  3QPH A;  5ED4 A;  1R6R A;  4UVC A;  3E3V A;  3WU0 A;  1ON1 A;  2EZH A;  5LRS A;  5CQG A;  1JTY A;  3K2A A;  1ON2 A;  2M3A A;  2HQ5 A;  2WBM A;  3L2U A;  3FXL A;  2DXI A;  2JRM A;  3UKG A;  2BBY A;  4BE2 A;  2X1E A;  1UFM A;  2JMW A;  3NAU A;  3O6B B;  4G6T B;  3FXO A;  3WGI A;  4FTH A;  3CCE I;  3I5U A;  3OOU A;  3HGG A;  4MQV A;  2L7M P;  3HIF A;  3WHB A;  2K9N A;  1Y1V J;  4N4N B;  2R7O A;  1MMA A;  4HV6 A;  1QHG A;  4RB0 A;  3ABU A;  3LSP A;  1ZRF A;  1BI0 A;  1P9Q C;  5FKM A;  3NQO A;  3GCM A;  4C2U A;  1IN5 A;  1YJW I;  3RTR A;  3LNQ A;  2ISZ A;  3ZP5 A;  4OIP F;  3WTZ A;  3FK6 A;  2A07 F;  1OCR H;  1MND A;  3DPT A;  2V9K A;  1JGS A;  3VPR A;  4L9T A;  2R7S A;  4ASN A;  2R4G A;  4U7D A;  5IP7 J;  4AYB N;  2VOO A;  1MBJ A;  5HLG A;  2DFF A;  2YUS A;  2R7X A;  1KU3 A;  5K5Q A;  2F5E A;  2CFO A;  2LRD A;  1YG2 A;  4B43 A;  4BHP A;  1OMI A;  5FRN A;  4HNV A;  5GAH J;  2Y75 A;  1S7A A;  2HXI A;  2YU3 A;  3LSK A;  3V4G A;  3E0J B;  1I6H J;  5FLX K;  4PFO A;  5JLW A;  1PYV A;  4L9N A;  5CLS A;  2GOM A;  2Z16 A;  1PDN C;  1XMA A;  2CYY A;  2CQK A;  3DTE A;  5H6Q A;  1B8I B;  2OC6 A;  3I58 A;  3SYT A;  2QSG X;  5F0H A;  3I59 A;  3RKW A;  1GVD A;  2R7W A;  2X0L A;  4N9H A;  1Y6I A;  3EUH A;  1WJC A;  1REP C;  5JLX A;  1A04 A;  3RKY A;  3SDB A;  2DI3 A;  5EEG A;  3ZMZ A;  2ZKZ A;  3RPU A;  4HV5 A;  2JWT A;  3ZMS A;  4IRH A;  4PSX A;  3HUG A;  3VB2 A;  2IA2 A;  2P0W A;  2X6X A;  1N77 A;  1KQ9 A;  4O6J A;  2LKS A;  1F4K A;  1QVU A;  3KLO A;  4HSR A;  3CUQ B;  3T5X A;  1I6X A;  2XGD A;  4HDU A;  3IUO A;  3H5R A;  3E5U A;  4BH9 A;  3GFM A;  1PUF B;  4HLY A;  1S7E A;  1OR7 A;  4LFU A;  5D8L B;  2LK2 A;  2DQL A;  3DU6 A;  5LGN A;  3TMO A;  2JA5 J;  2PQ8 A;  2XIG A;  5FGM A;  4IOC F;  2QEN A;  3R61 A;  4RBO A;  3S32 A;  3CES A;  3LWF A;  2VXZ A;  3A1Y A;  1TBX A;  1VI0 A;  3SHF A;  4UUS A;  2NOJ B;  2TRT A;  2HI3 A;  4IOA F;  5TJJ A;  3LQQ A;  5ILV A;  2VON A;  1GUU A;  2A6H F;  5DCM A;  3VYR B;  1NK3 P;  3U2R A;  1S7O A;  4UUV A;  3CC7 I;  2MH2 A;  1OCO H;  1V5G A;  2HR3 A;  5LHI A;  4HQM A;  1HOM A;  4EEF G;  2Y69 H;  2QYO A;  2OCE A;  4F92 B;  2QBY B;  3TOB A;  3CP2 A;  2DMQ A;  2Y9Y A;  3JRE A;  3B6C A;  3GTK J;  4MIM A;  1R4N B;  4EM2 A;  5EEA A;  3P9I A;  5J6X A;  3S3O A;  3WTV C;  4IKF A;  3DV8 A;  4XMY A;  3BZ6 A;  4RGX A;  4OIR F;  2VKH A;  3JRI A;  3S17 J;  2DA4 A;  1IGN A;  2L01 A;  3ULQ B;  4E6K G;  4AVP A;  2ESH A;  3FXJ A;  2DDA A;  5M5W J;  3WGH A;  1CF7 A;  5F27 A;  1TNT A;  4XQF A;  2IS6 A;  1PP7 U;  1LB2 A;  2NVX J;  1VND A;  3W6J B;  1JKQ C;  5EF6 A;  2LOO A;  2VQL A;  3BCA A;  1VZ0 A;  4MLO A;  2GXG A;  2HQR A;  1UCR A;  2JSP A;  3GW2 A;  3CUO A;  1Y1W J;  2H1K A;  1LDJ A;  4B48 A;  4CCK A;  3E97 A;  1TNS A;  2O3F A;  4M73 A;  2E5N A;  4XRS A;  1FT9 A;  4XRM A;  3HC7 A;  3HSF A;  1BIB A;  4U7B A;  1H89 C;  5IP6 A;  2HTS A;  1PJR A;  1MBE A;  3H3V K;  2NVU B;  1X1D A;  1E17 A;  5E3N A;  2HOA A;  4OIQ F;  3NWT A;  1NHA A;  4HPQ A;  3U1D A;  4D7N A;  2P6T A;  3L2W A;  2WY7 Q;  5CVU A;  1QBJ A;  1Z67 A;  2EIN H;  2V79 A;  3BRO A;  4ZDP A;  5BNG A;  2EFW A;  4B09 A;  2DA7 A;  4J00 A;  3BR2 A;  2F4I A;  5K5O A;  3ZOB A;  4A0Z A;  3F21 A;  4G12 A;  4EMS A;  3WG7 H;  5JFR A;  2UUZ A;  1JT0 A;  3BR5 A;  3V7S A;  3CP8 A;  3E6M A;  2W57 A;  5F6F A;  3PNT A;  3VYS B;  4NC7 A;  3I55 I;  2A05 A;  1ETK A;  1SC7 A;  1XGM A;  1T95 A;  3AG1 H;  3OL3 A;  3OOP A;  4GFB A;  2JA6 J;  3C2H A;  4A93 J;  2ZXJ A;  1HA8 A;  2VLA A;  3DLA A;  4N0B A;  4P5O A;  3S16 J;  1IUY A;  2OV7 A;  2EFO A;  3KE2 A;  3QOP A;  4BAC A;  3OYA A;  1R5I D;  3F8B A;  1GXP A;  4JX5 A;  2FNP A;  1G2H A;  3S3M A;  4UY8 I;  2QVO A;  2HKX A;  5D5U B;  4P9U A;  3OYF A;  3BPV A;  1U6G A;  5BOX A;  2AQE A;  4PFP A;  2VBY A;  1D0Y A;  4IPA A;  4HF1 A;  5M5X J;  1STZ A;  4YG2 F;  4EAT A;  5H2F C;  3CME I;  1F5T A;  2FF4 A;  3QPT A;  4B3A A;  2OTJ I;  3HXL A;  4MEX F;  3KYD B;  5DM6 F;  1D1A A;  1SMY F;  4RM2 A;  4I6Z A;  1K6O A;  1IZ1 A;  2QGU A;  2XAF A;  1G3S A;  2ZJR F;  2B9S A;  3ECO A;  1VF9 A;  2XKP A;  4ZYE A;  1YX5 A;  2A6E F;  3TGN A;  1YRN A;  2VBX A;  4BBS J;  3CC2 I;  3BG9 A;  2XAH A;  1WJD A;  4N9I A;  1WJF A;  3P9K A;  5ICG A;  3DPU A;  5J1U A;  2FQ4 A;  4AVZ A;  1BBY A;  4IF4 A;  4EJW A;  4BNC A;  4IHW A;  1KQ0 A; 
#chains in the Genus database with same CATH homology
 1MD0 A;  1XCV A;  3BJO A;  1T2K A;  1ZRD A;  4HAM A;  4KIC A;  1KYW A;  4A0X A;  3BOQ A;  4LK1 F;  2VBZ A;  2G7U A;  1ZH5 A;  4EJU A;  3RDI A;  2HKO A;  3GZ5 A;  2FXA A;  3IKT A;  4LG0 B;  4ZZD A;  2PFB A;  2HQN A;  4M9Z A;  5LGT A;  1YO5 C;  1SD6 A;  2O61 A;  1R22 A;  1R1T A;  4WXC A;  5E1W A;  3HRM A;  4DNC A;  4G7H F;  3P9C A;  2Q2E A;  4HW0 A;  3TDZ C;  4ESF A;  5HS9 A;  4LB6 B;  4ESJ A;  3ZMD A;  1VTN C;  1ZN2 A;  3FXQ A;  3QRF F;  2OU2 A;  2IW5 A;  3K1N A;  1JXS A;  3I54 A;  3WTU C;  2GA2 A;  2IT0 A;  5D5V B;  5BS6 A;  5K5R A;  2M5W A;  4RGU A;  1EH8 A;  4KIF A;  3C1D A;  2ZFW A;  3ZPL A;  2BGC A;  4Y13 A;  5L3E A;  3KP2 A;  3IWZ A;  3BWG A;  1XGN A;  3K1M A;  1LVA A;  4YFN F;  3HTU A;  2EV6 A;  1BOA A;  1Z9C A;  1HW1 A;  4AWX B;  1XD7 A;  3J7A O;  2K4J A;  2EA4 A;  3PQJ A;  5HLI A;  3FWE A;  1XDU A;  4XSX F;  3K0L A;  5E8G A;  1R5H A;  1KA8 A;  1ULY A;  2QLZ A;  3I0T A;  4Q4Z F;  4LMY A;  1G6N A;  3IHU A;  1MDM A;  1TW3 A;  2D1V A;  1CGP A;  3U9G A;  1O3S A;  1MKM A;  3HHG A;  4KMU X;  1ZLK A;  2DTR A;  4Z2Y A;  4NB5 A;  2WC2 A;  1JHH A;  4QWQ A;  3B73 A;  5KK1 A;  4HX7 A;  3R4K A;  2OAZ A;  3E5X A;  1LQ1 A;  5E18 F;  3H92 A;  4G8X A;  3W6K B;  4R79 A;  2EK5 A;  1FNN A;  3NRV A;  4LLG F;  2E1N A;  2GQQ A;  3O2P E;  4ON0 A;  3F8M A;  4I7H A;  5CVV A;  3ZMT A;  2K4B A;  1SD5 A;  4RAY A;  2LSO A;  3QAH A;  3V7C A;  2HWV A;  4GO1 A;  3I71 A;  1I1G A;  3NEU A;  2Q8K A;  3HOS A;  1JHF A;  3EQL F;  5FB2 A;  1PUE E;  2V1U A;  1P4X A;  1FYL A;  1BC8 C;  5L3B A;  4M9X A;  2QQB A;  3CTA A;  4M74 A;  5ERI A;  5HVQ C;  1SAX A;  2ADU A;  1XSX A;  2PMU A;  1Z05 A;  3DFG A;  5BMZ A;  1FYK A;  2VN2 A;  2K27 A;  2RNJ A;  1IXC A;  2PG4 A;  4UV8 A;  3SQN A;  1FZP B;  2EJR A;  1G3Y A;  3F23 A;  3WU1 B;  1AOY A;  3KP6 A;  1FBS A;  3F8C A;  1UST A;  1ODD A;  2BEO A;  4G94 A;  5ILS A;  2XAS A;  1ZGA A;  3F22 A;  2QUF A;  5L3C A;  3M8E A;  3M8F A;  1D5V A;  1KGS A;  3TKY A;  4A5N A;  3LFK A;  4S05 A;  2K7L A;  2Z5U A;  2OA4 A;  2XGX A;  4MQ9 F;  4QLC U;  1FBQ A;  4B8X A;  2XHK A;  4HA8 A;  3KZZ A;  2JPB A;  1LJ9 A;  1R36 A;  1K7A A;  5CVJ A;  2DK8 A;  3F8F A;  3FF5 A;  4L0Y B;  3DKW A;  4Q48 A;  1Z1D A;  3VEP A;  3EET A;  4XLP F;  1S3J A;  3ML6 A;  2QBY A;  2A5Y B;  5LEK A;  1R58 A;  1UHM A;  1WI9 A;  2LF7 A;  1JE8 A;  2O0Y A;  1O3T A;  3RI4 A;  3RIR A;  3T8T A;  1S8N A;  1XMK A;  1IXR C;  2JPC A;  4RB2 C;  2ISY A;  4KT5 C;  1R00 A;  1RUN A;  1IXS B;  1SFE A;  1R23 A;  3HSR A;  2NAZ A;  2FML A;  2KIM A;  3EYY A;  4RS8 A;  5DUK A;  3M9A A;  3FXU A;  5K1Y A;  4D0P A;  5D4R A;  2F5D A;  1O7L A;  5J8C A;  2FNA A;  4CZZ A;  2A68 F;  4BHB A;  1OPC A;  2KJB A;  2K86 A;  4LLN A;  4R8H A;  3K2Z A;  1SMT A;  3Q9V A;  1LEB A;  2WWY A;  1FP2 A;  3TO7 A;  3FM3 A;  3V7R A;  2O8X A;  4KN7 X;  4L9J A;  1U5T B;  3RKX A;  2COM A;  3ISP A;  4BXU A;  4M72 A;  1XGS A;  1J75 A;  1FP1 D;  1YIO A;  1FPQ A;  3GO5 A;  1F1Z A;  5DD4 A;  4ENM A;  5E1Z B;  1P4W A;  3WTW C;  2OZ6 A;  5DV5 A;  3T0Y A;  1EH6 A;  5LBQ A;  1D8K A;  2DU9 A;  2MA3 A;  3HRS A;  2ELH A;  4KYW A;  2VOD A;  3LAP A;  2LF8 A;  4OOI A;  2PLY A;  4FX0 A;  4U0V A;  1F9N A;  2MLK A;  2EFP A;  2ZBK A;  5DEQ A;  3BPX A;  3LST A;  1BM9 A;  5BQT A;  1GVJ A;  2BYV E;  1Y0U A;  3TDU C;  3JAM Z;  5LLQ A;  3ROU A;  1XN7 A;  3JSP A;  4PZJ A;  2E7X A;  1U2W A;  4LG0 A;  2H6B A;  4TV7 A;  2RV8 A;  1HW5 A;  4G7O F;  1XSV A;  3JSO A;  1U5T C;  2EV0 A;  5HDK A;  2HYF A;  4R1H A;  2EFQ A;  3ZN1 A;  4AIH A;  5D5W B;  4MEY F;  1YS6 A;  1ZAO A;  1LDK B;  4M6X A;  4XBF A;  3IRQ A;  5DCF A;  1L3L A;  5AON A;  1L0O C;  2GIV A;  3G3Z A;  3CUQ C;  1QZZ A;  4EGY A;  4ENJ A;  5CVI A;  5HS8 A;  2QM3 A;  2M30 A;  1XB4 A;  4BYY A;  1FBU A;  4EM1 A;  5LEJ A;  2GA1 A;  2D45 A;  2CG4 A;  3HRU A;  1Z6R A;  3KCC A;  4S04 A;  2XKO A;  1YS7 A;  3F6O A;  1G3T A;  1B9N A;  4UNO A;  1SD4 A;  4EV0 A;  2CWE A;  1PP8 F;  4LJZ F;  1MZB A;  4IHT A;  1YYV A;  3RJP A;  3L7W A;  3N4M A;  2Z33 A;  2ZJ2 A;  1USS A;  3QP6 A;  1FSH A;  5E17 F;  2HS5 A;  3GFL A;  4KDP A;  4KNY A;  3D0S A;  4BHC A;  4MTD A;  1IRG A;  1FWZ A;  4E70 A;  1HBX G;  2PEX A;  1KU7 A;  1FC3 A;  1OYY A;  1T6S A;  2IVM A;  1DP7 P;  3E6B A;  1IW7 F;  3C18 A;  2RGV A;  1TW2 A;  2XAG A;  2EWN A;  4G7Z F;  3M1E A;  2CO5 A;  1ONV A;  1S6L A;  4AIK A;  3I64 A;  5DCM B;  2ZO4 A;  4HX4 A;  1HKS A;  3V8K A;  3H3Z A;  1X3U A;  2NNN A;  2LKP A;  2FQ3 A;  4ETS A;  3K9T A;  3TQN A;  3DXJ F;  4A2U A;  4L9V A;  4CO8 A;  6PAX A;  3G73 A;  3L00 A;  3L09 A;  1CF7 B;  2DO7 A;  4O5V A;  2L54 A;  4IVN A;  2KJC A;  1ZG1 A;  2V1D A;  3MCZ A;  4YIF A;  1QNT A;  2WV0 A;  4CHU A;  4KIB A;  4HLX A;  4EM0 B;  2M1B A;  1ZRE A;  3WE3 A;  5F1R A;  2MD5 A;  1H9G A;  2M45 A;  5HDG A;  1XCB A;  3KEQ A;  2E7W A;  1P6R A;  3O3K A;  2D1H A;  4IRG A;  1XGO A;  2XAJ A;  5H20 A;  1FYM A;  2IPQ X;  1HSJ A;  2PN6 A;  5L3F A;  5JI6 A;  5CVR A;  4RGR A;  5AIQ A;  3FZV A;  3HHH A;  4GXO A;  5A2Q K;  3I53 A;  2O03 A;  4KIG A;  4EGZ A;  3B02 A;  3F3X A;  4ZYD A;  1O3Q A;  3ZMV A;  2YSR A;  3BP8 A;  1UHW A;  2F2E A;  4RB1 A;  4HX8 A;  2MBF A;  1RUO A;  4U0Y A;  1BI2 A;  4CXF A;  3KLN A;  2VC0 A;  1UB9 A;  3D5L A;  3FM5 A;  3HYI A;  3R0A A;  4Q5S F;  5BPD A;  2VT2 A;  3GFJ A;  4ZYG A;  5L3G A;  1RIO H;  1DDN A;  5A2Q Z;  2DK5 A;  4KN4 X;  2VT3 A;  3DP7 A;  4GCV A;  1HW2 A;  1TQP A;  4YII A;  4EJT A;  1J9I A;  3VFZ A;  4WX9 A;  3SXY A;  1ZG3 A;  4H0E A;  3LA7 A;  3GZ6 A;  1QO0 D;  3R6S A;  2QZ8 A;  2K02 A;  2ETH A;  2A3S A;  4IJA A;  1WSU A;  5CJ9 A;  3OV8 A;  2FSW A;  3AAF A;  1KU9 A;  2UXN A;  4M6Y A;  2M8E A;  1OYI A;  1SD7 A;  2H27 A;  1XSD A;  5FO5 A;  1J7K A;  1H0M A;  2P7V B;  2XRO A;  3FXR A;  1ZHF A;  2FMY A;  4PGH A;  1W5T A;  1R1U A;  1J5Y A;  3FHZ A;  3CJN A;  5D8K B;  4BAY A;  3GXO A;  5EEH A;  4FX4 A;  5TRD A;  4I0A A;  2YPR A;  1DUX C;  4MGR A;  5F64 A;  4K2E A;  4P96 A;  2Z99 A;  4EJV A;  4OMZ A;  3KP7 A;  4ZH4 F;  1U5T A;  4L18 B;  1BI3 A;  2VE8 A;  1SFU A;  1T98 A;  2HDC A;  3LA2 A;  1RNL A;  1V4R A;  2DQR A;  2G9W A;  3KP4 A;  2MH9 A;  2G7H A;  1B1B A;  4KMF A;  4HQE A;  3PQK A;  1HKT A;  1MJB A;  1BI1 A;  5LHH A;  1YLF A;  3CUQ A;  3MQ0 A;  3N97 A;  1B59 A;  3GFI A;  4I98 B;  1HQC A;  4G9Y A;  5DUI A;  2R3S A;  4RB3 C;  4LB5 A;  5D5X B;  2B0L A;  3WGG A;  1BJA A;  4IHS A;  2X4H A;  4O3M A;  2DW4 A;  4G6D A;  5FFX A;  1BIA A;  5L3D A;  2E1C A;  4WXH A;  1TLH B;  4A6E A;  2DBB A;  3GUD A;  1DPU A;  1FSE A;  3ELK A;  2GZW A;  2RDP A;  1WQ2 A;  4KUM A;  2MC3 A;  4RAZ A;  1KU2 A;  2BV6 A;  1KQ8 A;  1W7P B;  5LHG A;  5DYM A;  1IF1 A;  2PBI A;  2P4W A;  3GF2 A;  1O57 A;  1W4M A;  1J0R A;  5FFZ A;  2KKO A;  2OBP A;  3GVA A;  3ZQ7 A;  1BN5 A;  2RC4 A;  4WXD A;  2W84 A;  2P5L C;  3HRT A;  1K78 B;  2DPD A;  2BE5 F;  5JR3 A;  4L0Z B;  1D8J A;  5J8F A;  4XSZ F;  1T38 A;  2NS0 A;  1EH7 A;  2TDX A;  2GXB A;  1WRJ A;  2VBW A;  5H6R A;  3V8L A;  3FMS A;  4PGG A;  3E5Q A;  1LDD A;  2JZY A;  2AXL A;  1V3F A;  4IXA A;  1QGP A;  3QP5 A;  2VE9 A;  4ESB A;  2V1X A;  1TTY A;  3T8R A;  4XRF A;  2HEO A;  2V6C A;  1EV7 A;  2ZCW A;  3ZN0 A;  3WTS C;  1TQI A;  1B4A A;  2W25 A;  4BQA A;  1C0W A;  1R5G A;  3P7N A;  3WE2 A;  1MJ9 A;  2ZME B;  3ZMU A;  4LK0 F;  2RVC A;  3DF8 A;  1Z6T A;  5AIP A;  3LAJ A;  3JAM K;  2ZNY A;  1K79 A;  4UVB A;  1P4A A;  2EA2 A;  2PMH A;  2GWR A;  3SZP A;  3RYR A;  2OQR A;  1I1S A;  4EQQ A;  4JQF A;  1I27 A;  5FLX Z;  1RZ4 A;  2P5V A;  4Q47 A;  2A69 F;  3K1P A;  4UVA A;  2AS5 F;  2C6Y A;  2MLG A;  2NYX A;  4JBA A;  2L4M A;  2Y0M A;  1HKQ A;  2XV4 S;  1R1V A;  1IAW A;  4CDG A;  3I4P A;  2PI0 A;  2IA1 A;  2KIF A;  2EB7 A;  3TO6 A;  1XDS A;  5FD6 A;  4G6Q A;  2YR2 A;  1MGT A;  4ENN A;  3J81 K;  3GEZ A;  5KVR A;  1IN4 A;  2F5F A;  4I01 A;  3WG9 A;  4WF2 A;  5ILU A;  3KET A;  1YW9 A;  2L02 A;  4A0Y A;  2D2W A;  3JTH A;  2FBI A;  4WWC A;  3MAJ A;  4HZF A;  2ESN A;  2HFH A;  3J81 Z;  2WTE A;  3BDD A;  2FEZ A;  2KRF A;  1YW8 A;  3MFK A;  5LRR A;  5D6E A;  1YW7 A;  2A61 A;  4MNU A;  3FX3 A;  4I0B A;  1IN6 A;  4OU0 A;  1YFH A;  1QPM A;  2UXX A;  1IN7 A;  2HOE A;  2CGP A;  3KZY A;  3ERE D;  1IN8 A;  2CW0 F;  4IRI A;  2UWM A;  2UZK A;  3C3W A;  1J59 A;  2P6S A;  2FOK A;  1O7F A;  4U88 A;  1ZRC A;  3VOD A;  2DAO A;  2F5C A;  2FBK A;  1HST A;  4UHT A;  1S29 A;  2J5O A;  4MHG A;  3F72 A;  3L9F A;  2FU4 A;  3I59 B;  2DT5 A;  4U0W A;  4YFX F;  1ZAR A;  2HGC A;  3KP3 A;  3J80 K;  1GHC A;  1T0F A;  3JW4 A;  3DPL C;  1W7P D;  1MJA A;  4MTE A;  2XVC A;  3HOT A;  2STW A;  4GYI A;  3IC7 A;  3MWM A;  1Q1H A;  4A5M A;  3V8J A;  2XUB A;  2V9V A;  4HOB A;  4OIO F;  4A12 A;  1G3W A;  1OKR A;  1I5Z A;  4EVI A;  4WCG A;  2IP2 A;  1R7J A;  3CO7 C;  2DLL A;  3MEX A;  5LGU A;  3J80 Z;  1U78 A;  5CYV A;  2IRF G;  4UV9 A;  1LNW A;  4AIJ A;  3H3U A;  2R7F A;  1WKM A;  4I02 A;  4Y17 A;  5HS7 A;  3ECH A;  4JK1 X;  4HBL A;  2DFI A;  4HF2 A;  2L4A A;  4P9F A;  2RN7 A;  2OQG A;  5ICE A;  2VC1 A;  3IRR A;  2H6C A;  2DPU A;  1W5S A;  2EFN A;  2W85 A;  4NQW A;  4AD9 A;  3Q5F A;  3GX4 X;  3F6V A;  5IT3 A;  4ZZL A;  3WTX C;  3KEO A;  4PDK A;  3WTT C;  2XRN A;  3HSE A;  1OYW A;  3WOD F;  3LQR A;  3FMQ A;  2YX4 A;  4NHJ A;  4I2O A;  2HTJ A;  4KFC A;  4FHT A;  3EYI A;  2FA5 A;  1P92 A;  1H9T A;  4LGW A;  4F7Z A;  3R60 A;  1TQM A;  1E2X A;  5DD8 A;  3IWF A;  4CIC A;  2H94 A;  2QQA A;  1ZYR F;  1FY7 A;  3SZT A;  2JSC A;  2ZNZ A;  3BJ6 A;  3RYP A;  4P55 A;  5D4S A;  1Z7U A;  3GLX A;  3COA C;  1B6A A;  2FE3 A;  4GGG A;  2JRT A;  3ABT A;  3QU6 A;  5HDN A;  3CO6 C;  1IRF A;  3KP5 A;  3R0J A;  1RI7 A;  4M9S A;  5HLH A;  2IJL A;  3LA3 A;  5E20 A;  2RKH A;  2RQP A;  2HYG D;  3FMR A;  3PFI A;  1HXD A;  4GYG A;  4L5J A;  5ICF A;  1WWX A;  2OD5 A;  2CSO A;  1YQA A;  2JTV A;  4EJO A;  2R7D A;  4L5I A;  3GYH X;  2P8T A;  4LLL A;  3E6C C;  1AWC A;  1W7P A;  4OMY A;  3DEU A;  5D6F A;  4HF0 A;  3F8N A;  2NRA C;  2HZT A;  2LDU A;  1ZGJ A;  4XLN F;  2Y48 A;  1DPR A;  2QQ9 A;  1U3E M;  3T1B A;  3CDH A;  2JT1 A;  2P5K A;  3REO A;  1GXQ A;  2P7C B;  2ACJ A;  2FRH A;  2OZU A;  3HTS B;  2J5P A;  1KYZ A;  3IL2 A;  4M71 A;  5JVT A;  2IA0 A;  3WTY C;  2LNB A;  1K78 A;  2Q0O A;  4UXN A;  4HYE A;  1SFX A;  2Z9O A;  3RPQ A;  5JHU A;  5FD5 A;  4PCQ A;  4A6D A;  4CGZ A;  4KA4 A;  1B9M A;  2VOP A;  2KIU A;  4ZYH A;  4HDV A;  4RGS A;  3IKV A;  1QQI A;  5BPI A;  1D3Y A;  2H09 A;  4I09 A;  3S2W A;  4CYD A;  1FOK A;  4LD5 A;  3Q9S A;  1BC7 C;  2FBH A;  1LEA A;  3MZY A;  3EDP A;  3MZH A;  3GWZ A;  3CLO A;  1J2X A;  3TOA A;  2ZME A;  1ZLJ A;  5E8I A;  3KFW X;  5IT9 K;  2YX7 A;  4OIN F;  4ENK A;  2W24 A;  3VOE A;  3TO9 A;  3K69 A;  3QU3 A;  5E1X A;  3DQV C;  5DDG A;  4FT8 A;  2QWW A;  1Z91 A;  3C7J A;  3E6D A;  4WK8 F;  2L3D A;  2Z3Y A;  2M87 A;  2EV5 A;  1FX7 A;  1QZY A;  2XAQ A;  2GAU A;  5ICC A;  5IT9 Z;  1YTY A;  4YFK F;  1O3R A;  3BY6 A;  1MDM B;  3L2C A;  1ZG5 A;  1G4D A;  2NNY A;  1FLI A;  2CFX A;  2STT A;  1P2F A;  5HOO A;  1U8R A;  3M7G A;  4Y15 A;  3SFZ A;  4DQ2 A;  3JTG A;  2O6G E;  3BJA A;  1T39 A;  2PJP A;  3QPH A;  5ED4 A;  4UVC A;  3E3V A;  3WU0 A;  1ON1 A;  5LRS A;  1ON2 A;  2BBY A;  1UFM A;  3O6B B;  3WGI A;  3I5U A;  4MQV A;  3HIF A;  4HV6 A;  4RB0 A;  3ABU A;  1ZRF A;  1BI0 A;  3NQO A;  1IN5 A;  3RTR A;  2ISZ A;  3ZP5 A;  4OIP F;  3WTZ A;  2A07 F;  3DPT A;  1JGS A;  4L9T A;  4ASN A;  4U7D A;  2VOO A;  5HLG A;  1KU3 A;  5K5Q A;  2F5E A;  1YG2 A;  4BHP A;  1OMI A;  2Y75 A;  1S7A A;  2YU3 A;  3V4G A;  5FLX K;  4L9N A;  5CLS A;  1PDN C;  1XMA A;  2CYY A;  2CQK A;  5H6Q A;  3I58 A;  3I59 A;  3RKW A;  2X0L A;  4N9H A;  3EUH A;  1REP C;  1A04 A;  3RKY A;  2DI3 A;  3ZMZ A;  5EEG A;  2ZKZ A;  3RPU A;  4HV5 A;  3ZMS A;  4IRH A;  3HUG A;  3VB2 A;  2IA2 A;  1KQ9 A;  4O6J A;  1F4K A;  3KLO A;  3CUQ B;  3T5X A;  1I6X A;  4HDU A;  3E5U A;  4BH9 A;  3GFM A;  4HLY A;  1OR7 A;  4LFU A;  5D8L B;  2DQL A;  5LGN A;  2PQ8 A;  2XIG A;  5FGM A;  2QEN A;  3R61 A;  3LWF A;  2VXZ A;  1TBX A;  3SHF A;  5TJJ A;  3LQQ A;  5ILV A;  2VON A;  2A6H F;  5DCM A;  4UUV A;  3U2R A;  1S7O A;  2MH2 A;  2HR3 A;  5LHI A;  4HQM A;  2QYO A;  2QBY B;  3TOB A;  4EM2 A;  3P9I A;  5J6X A;  3WTV C;  3DV8 A;  3BZ6 A;  4RGX A;  4OIR F;  2L01 A;  3ULQ B;  4AVP A;  2ESH A;  3WGH A;  1CF7 A;  1TNT A;  1PP7 U;  1LB2 A;  3W6J B;  2GXG A;  2HQR A;  1UCR A;  3GW2 A;  3CUO A;  1LDJ A;  3E97 A;  1TNS A;  2O3F A;  4M73 A;  1FT9 A;  4U7B A;  3HSF A;  1BIB A;  2HTS A;  1E17 A;  4OIQ F;  3U1D A;  1NHA A;  2P6T A;  5CVU A;  1QBJ A;  2V79 A;  3BRO A;  2EFW A;  4B09 A;  5K5O A;  4A0Z A;  3F21 A;  4EMS A;  5JFR A;  3V7S A;  3E6M A;  2W57 A;  5F6F A;  1XGM A;  3OOP A;  2ZXJ A;  4N0B A;  4P5O A;  1IUY A;  2EFO A;  3KE2 A;  3QOP A;  3F8B A;  1GXP A;  2FNP A;  2QVO A;  2HKX A;  5D5U B;  4P9U A;  3BPV A;  1U6G A;  5BOX A;  2VBY A;  4IPA A;  4HF1 A;  1STZ A;  4YG2 F;  1F5T A;  2FF4 A;  3QPT A;  4MEX F;  1SMY F;  1K6O A;  1IZ1 A;  2XAF A;  1G3S A;  3ECO A;  2XKP A;  4ZYE A;  2A6E F;  3TGN A;  2VBX A;  2XAH A;  4N9I A;  5ICG A;  3P9K A;  1BBY A;  4IF4 A;  4EJW A;  4BNC A;  1KQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...