3VOEA

Crystal structure of wild type marr (apo form) from e.coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
136
structure length
136
Chain Sequence
NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multiple antibiotic resistance protein marR
publication title MarR structures
rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 42
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3voeA00
1OYIA 2ADUA 5J8CA 2QZ8A 1OPCA 1WKMA 3K2ZA 4G94A 1R1UA 5CLSA 1LVAA 1K6OA 4N0BA 3L2CA 1HW2A 2J5OA 3G3ZA 5LGNA 5FGMA 4OMZA 4XLNF 3L9FA 5ICGA 1PP7U 1LJ9A 3KE2A 2HKOA 4HF0A 4HW0A 3R0JA 3LSTA 2X0LA 4KT5C 4KA4A 2BYVE 2Q2EA 1USSA 2P8TA 3KLOA 2XKOA 1TNSA 2ACJA 3BOQA 2B0LA 5IT9Z 2IRFG 1S3JA 1DPUA 3JW4A 3GEZA 4RGSA 4JK1X 1J59A 4OINF 1BC7C 2FNAA 3VEPA 3HTUA 1L3LA 3M9AA 3WE2A 4WWCA 2Z99A 3FXRA 1ODDA 3FXUA 1B9NA 2QLZA 2PI0A 3MCZA 4OOIA 1WQ2A 1BJAA 4BHCA 2CO5A 1KYZA 5LGUA 3QRFF 3V7RA 3O3KA 4A12A 2Q0OA 5CJ9A 4HQEA 3ABUA 3IRRA 1O3SA 1U78A 1TNTA 3V8JA 2V1UA 2OQGA 3HTSB 1JGSA 4UVBA 1HSTA 1LDJA 4PZJA 3ZMDA 4LLLA 2P7VB 4I2OA 2W24A 2QQ9A 4LFUA 1EH8A 1QZYA 5F6FA 3E5QA 2XRNA 3F72A 2E1CA 2YU3A 1P4AA 1FNNA 1DPRA 2HDCA 2L02A 5L3CA 5AONA 5CVJA 1H0MA 3MEXA 3E6MA 5D5WB 5L3FA 3G73A 5CVRA 5DD8A 2GXGA 5K5OA 2ESNA 2YPRA 1K78A 1S29A 2A5YB 4R79A 3FX3A 2XV4S 1MDMA 1G3SA 4WX9A 1P92A 1ZARA 5DUIA 2KKOA 1MJ9A 4O3MA 4A6DA 1W5SA 5HVQC 3BROA 5HS7A 5CVUA 1G4DA 1P2FA 2A68F 3TOBA 2VOOA 5E18F 5H6QA 3C7JA 2FSWA 4GO1A 4FHTA 1K78B 3IWZA 3WTSC 4JQFA 4Y17A 3JTGA 1IN5A 1MDMB 2YX7A 3BY6A 3F6OA 3K69A 1REPC 4LG0A 1LQ1A 3QU6A 1A04A 2XIGA 3T0YA 4A0ZA 4CO8A 3F23A 1MGTA 2VONA 2UXNA 5E1WA 5HLIA 1QGPA 1R00A 3RYRA 3HSFA 3T8TA 1T2KA 1Z7UA 4IJAA 2XAFA 2K02A 1TW2A 3BP8A 4LK1F 4M9XA 3LA7A 3E6CC 1FYLA 4LG0B 2ISYA 2NNYA 4R1HA 2QM3A 4RB2C 2FBIA 1OR7A 4MTEA 4IRGA 2IA0A 1FSHA 4GCVA 4UVCA 3ZMVA 3M8FA 2P6TA 4I01A 5LLQA 3RTRA 1VTNC 1HQCA 2E1NA 1R5GA 5JFRA 1IN6A 4L9TA 2AXLA 5D8KB 2DAOA 3H92A 3MQ0A 2PG4A 2VE8A 4S05A 3SFZA 4EGYA 2HTSA 4OIRF 3HUGA 4Q47A 1FBQA 1XDSA 2A61A 4KFCA 3NEUA 4DQ2A 4OIOF 3I53A 4ENKA 5KVRA 4ENNA 1YTYA 4HF1A 2JTVA 4CDGA 3WTYC 1BC8C 5DYMA 3IWFA 5CYVA 2VBYA 1IXSB 2CW0F 4TV7A 4MTDA 1J9IA 4ZYDA 4UV9A 2FF4A 2UZKA 3P9CA 5JR3A 4U88A 2J5PA 2KIUA 1R58A 1HSJA 2BBYA 3BZ6A 5CVIA 2LNBA 5FD6A 4F7ZA 1ZRDA 3J81K 4I7HA 2EV5A 2HQRA 2W57A 4LMYA 3GYHX 5H20A 2QBYA 2FA5A 2K7LA 1B4AA 2G9WA 3BWGA 2M45A 2M87A 2DU9A 1BIBA 3WGIA 4RGUA 2A69F 1HKTA 5LEJA 2HTJA 4HF2A 4HZFA 5ILUA 3F21A 3RJPA 2C6YA 4ZYHA 4L0YB 2R7FA 4YIIA 3GZ6A 1KU9A 1O3RA 2EFNA 1ZRCA 1FT9A 1GHCA 4MEXF 1ZN2A 2QBYB 3CUQC 3KP3A 5JI6A 2P5VA 4KMUX 1YW7A 4HX7A 3F8MA 4IHTA 3V7SA 5DCMA 1SD5A 1V3FA 1T39A 1V4RA 3F8NA 4IHSA 2EA4A 4GGGA 4RB3C 3EYYA 4UHTA 2ETHA 4AWXB 3KP6A 3VODA 4E70A 2VT3A 1P4XA 3RPQA 1O7FA 1U5TA 2K86A 1F5TA 3V4GA 4U0YA 3QPHA 2KJCA 4LB6B 5DCMB 4CHUA 1JE8A 1U2WA 2NYXA 3KZZA 1D3YA 3CDHA 2BEOA 5L3DA 4GXOA 2RKHA 1R7JA 1TQIA 3B73A 3PFIA 2WWYA 3BJOA 4XSXF 1HW1A 5IT3A 4I02A 4XLPF 4ZYEA 1TW3A 4Q4ZF 1R36A 1U5TB 5DEQA 1OMIA 4M73A 3ELKA 3GZ5A 5K5RA 1IRGA 3WG9A 1DP7P 1QNTA 1XCBA 1WSUA 4KICA 2HOEA 4WXDA 2F2EA 1GVJA 1K79A 5F1RA 2VBZA 4XBFA 2IVMA 3KP2A 1PUEE 4K2EA 3TOAA 2L4AA 2IPQX 2V79A 1ON1A 3W6JB 2D2WA 2FXAA 1Z6RA 1S7OA 2QWWA 2PBIA 2Q8KA 3WU1B 2YR2A 2P7CB 1Z1DA 3JSOA 2LSOA 4ENMA 1J5YA 1BI1A 3F8CA 1ZGJA 1E2XA 3F6VA 2G7HA 2HEOA 4MGRA 4RGRA 3FMRA 1Q1HA 5AIPA 4CZZA 5ICCA 2Y0MA 3HSRA 3ZN1A 2DI3A 3W6KB 4O6JA 2YX4A 5EEGA 1JHHA 2VODA 1D8JA 3M8EA 4KIBA 4G7HF 3ERED 1K7AA 1B1BA 5FFZA 4P55A 3J80K 2L54A 3P9IA 2STWA 2VC1A 4ASNA 2Y48A 3F22A 3LAPA 2BGCA 2EWNA 3P9KA 3ZMZA 4ZZDA 2Z9OA 2F5CA 2RNJA 4AD9A 1XSXA 2CG4A 1ZG5A 2QENA 2HYGD 2H27A 3IKTA 3WODF 3JAMK 1YO5C 1ZAOA 4EJTA 5HS9A 2ZCWA 1MJAA 4I09A 3ULQB 2D45A 5FD5A 1IF1A 1FY7A 3EYIA 3TGNA 3ROUA 3M1EA 2XAHA 3K1NA 4G8XA 2A6HF 4WXHA 2FE3A 3CUOA 3F8FA 2RGVA 2O3FA 1Z9CA 4AVPA 3FHZA 5HLGA 4HV6A 2LF8A 1SAXA 1T38A 5D4RA 1XGSA 3V8LA 1DDNA 4EV0A 4ZH4F 1IZ1A 4G9YA 1P4WA 2DT5A 2EFQA 4IRIA 1B6AA 2HGCA 1BBYA 3E97A 2QYOA 3IKVA 3C1DA 4GYGA 2HFHA 5D8LB 1UHMA 4EGZA 4L5JA 3I4PA 2EV0A 5E1XA 3HRMA 2FMYA 2DQRA 1RI7A 5E8IA 1XGNA 2FEZA 1S6LA 3BPXA 2A3SA 1I5ZA 4NHJA 1NHAA 4NB5A 1XB4A 3DPTA 4A5MA 4CYDA 3MZYA 3ZN0A 4QLCU 3L00A 3KZYA 4HV5A 3LA2A 1C0WA 1ZG1A 1TQMA 2W25A 3NRVA 2H09A 1D5VA 1ZG3A 1ZH5A 2NAZA 3DP7A 1CF7A 4EM0B 4LK0F 3I0TA 5DUKA 4NQWA 4R8HA 4HLXA 5A2QZ 3JSPA 1ZRFA 3R4KA 3E5UA 4G7OF 3KP5A 4EM1A 3N97A 3GW2A 5H6RA 3CJNA 4Y15A 4MQ9F 2BE5F 4P5OA 2FQ3A 3KFWX 4HA8A 3HRUA 1WWXA 1RIOH 4M6YA 3TO9A 3SQNA 5HS8A 4ESFA 1J7KA 3HRSA 2F5FA 3SXYA 3QAHA 1CF7B 3RKXA 2VC0A 1BIAA 1KU2A 3DQVC 4M9SA 3MWMA 2Z3YA 3GFLA 2O6GE 2DBBA 2E7XA 1TQPA 3IC7A 3WGHA 4L5IA 5IT9K 5FLXZ 1JHFA 5L3BA 1XSDA 5HLHA 1O7LA 2KJBA 1GXQA 2MH2A 1FP1D 2FMLA 4CXFA 3EETA 2EFWA 2P4WA 4M9ZA 1XMAA 2FRHA 3RIRA 3VB2A 1U3EM 3KP7A 5K5QA 2V1XA 2IP2A 2PJPA 5LBQA 5L3EA 2RV8A 3GFJA 4L9VA 3RKYA 1YIOA 3M7GA 1JXSA 2H6BA 3C18A 2DQLA 2GQQA 1STZA 1FBUA 2ESHA 1EH6A 1FWZA 1AWCA 2FNPA 4OIPF 2P6SA 1WI9A 1R1TA 2XHKA 2VT2A 4G7ZF 1XN7A 3E6DA 2O03A 3TQNA 2IJLA 3IHUA 3ECOA 3K0LA 4AIJA 1YW8A 2VE9A 2LDUA 3S2WA 2QUFA 1BI3A 1ZYRF 2TDXA 3ZP5A 3HOTA 4M72A 1QZZA 4ESJA 1G3YA 4M6XA 3DEUA 4P9FA 4YIFA 5ILVA 3QP5A 4EM2A 4KNYA 1DUXC 4G6QA 4U0VA 3H3ZA 1YW9A 4KN4X 4L0ZB 2VBWA 2RN7A 3WTTC 1KU3A 4HLYA 2ZNZA 2XAJA 1KU7A 2CFXA 4IF4A 1LEBA 3LFKA 1HKQA 3R0AA 1FX7A 1FYMA 2A07F 2GIVA 4MNUA 3WTVC 3GF2A 2OA4A 1YQAA 1UB9A 3Q5FA 4MQVA 3BJAA 4L18B 4YG2F 3N4MA 4JBAA 1FP2A 4B8XA 5D6FA 3K9TA 4FX0A 2GAUA 5KK1A 4RAZA 2DTRA 5FFXA 3IL2A 4KIGA 2V9VA 3V7CA 4ESBA 2L3DA 4RS8A 3HOSA 2DK8A 3T8RA 2GXBA 3CUQA 4HDVA 2MH9A 3H3UA 5D5XB 1TLHB 1U5TC 1FPQA 3WTWC 4HDUA 2F5DA 1HXDA 4Y13A 2EJRA 3WGGA 2IA1A 1Y0UA 1Z6TA 1FZPB 2Z5UA 3RKWA 3WE3A 4U7DA 3E6BA 3T5XA 1LDKB 3TO6A 3WTUC 2GZWA 3HSEA 2DPUA 1SFEA 1PP8F 2KIMA 3CUQB 3ZQ7A 3VOEA 3KETA 2WTEA 2O8XA 1SD7A 3V8KA 3ML6A 2EFPA 1W7PD 2L01A 4KDPA 1J0RA 1BOAA 2DO7A 1F4KA 2PEXA 3DXJF 3ABTA 3GX4X 4FX4A 2F5EA 3O2PE 1KQ9A 4IXAA 1R22A 3SZPA 2FOKA 2BV6A 1OYWA 3F8BA 3BJ6A 2YSRA 3FZVA 3AAFA 4I0AA 4L9JA 2FU4A 3MZHA 1IRFA 3SZTA 1UHWA 3K1PA 1BI2A 3GFMA 5ILSA 1O3QA 4BAYA 5CVVA 1IAWA 3TDZC 2PQ8A 1J75A 1BI0A 5TRDA 5HDKA 2RDPA 2KRFA 2PMUA 1XD7A 2EK5A 2K4JA 1QBJA 2IW5A 3HIFA 2CQKA 4A0XA 2XAQA 4G6DA 2V1DA 2RC4A 3TDUC 1ON2A 1XGMA 1W4MA 2OQRA 4I0BA 2PLYA 4ZZLA 4RB1A 4XRFA 3DPLC 1F1ZA 2DPDA 4PDKA 4LLGF 5JHUA 2FBHA 2P5LC 3FM3A 2JSCA 3GXOA 1TTYA 1OYYA 3BDDA 4BHPA 3WTXC 3I5UA 1KA8A 1W5TA 4S04A 1P6RA 3I64A 5HDGA 2RQPA 2E7WA 1FOKA 3FM5A 3PQJA 2PN6A 5BPDA 2H94A 3QOPA 1MJBA 4HQMA 2K27A 4FT8A 4HOBA 4GYIA 1IXCA 3LWFA 2WC2A 4MHGA 1XSVA 2EB7A 2XASA 1G6NA 5L3GA 4BHBA 4A0YA 1O57A 2OZUA 2UWMA 2OAZA 3IRQA 2M8EA 4EMSA 1SMYF 2ZKZA 4P96A 4H0EA 1W7PA 1IUYA 3QP6A 3HHHA 4BH9A 2HYFA 2CGPA 4OIQF 1MZBA 1BM9A 1HW5A 2MC3A 4KMFA 1UFMA 3OOPA 3GO5A 4KN7X 2ZFWA 4A2UA 2R7DA 5DDGA 4HBLA 3R60A 2VXZA 2CSOA 2JRTA 5BOXA 1W7PB 4I98B 4RAYA 1QPMA 5DV5A 3COAC 2XKPA 4KYWA 5D5UB 2G7UA 3ZMSA 1RUOA 1YS7A 3F3XA 5FB2A 4RGXA 3CO7C 1R5HA 4ON0A 4AIKA 1SFXA 1QO0D 3SHFA 3REOA 5E20A 1H9TA 2CYYA 3E5XA 1D8KA 1ZGAA 1X3UA 2LKPA 5LHHA 3J81Z 1LDDA 4YFNF 4YFXF 2STTA 4PCQA 2MBFA 3CTAA 1J2XA 4WK8F 3GLXA 4EVIA 1KGSA 4M71A 4U0WA 3DF8A 2R3SA 3JTHA 1YG2A 1KYWA 2Z33A 3LQQA 2A6EF 3TO7A 3FMQA 5LEKA 2ZBKA 3D0SA 4EJVA 2RVCA 2NRAC 1T0FA 1SD4A 1I1SA 3KEOA 1LNWA 1HBXG 1I6XA 3RI4A 4ENJA 2EV6A 1IW7F 2HR3A 5LHIA 4EQQA 3P7NA 3J7AO 5ED4A 4KIFA 4LGWA 5ICFA 2MD5A 2H6CA 5F64A 1RZ4A 4MEYF 5DD4A 4IPAA 2HZTA 1FSEA 3I71A 5EEHA 2O0YA 2X4HA 3U9GA 4BYYA 4EJUA 2UXXA 3OV8A 2MLKA 2XROA 4CGZA 1YS6A 2ZXJA 4BNCA 3C3WA 1EH7A 4EJWA 4OMYA 2VN2A 5E1ZB 2EFOA 1ZREA 3KEQA 2DFIA 2PFBA 1T6SA 2WV0A 1XMKA 2W85A 4UVAA 1O3TA 3Q9VA 2JPBA 4A5NA 4N9HA 3U2RA 2DLLA 3LA3A 1RUNA 5LRRA 1YFHA 4WF2A 3DKWA 1BN5A 4A6EA 5J6XA 2W84A 5E8GA 2GA2A 2EA2A 3L7WA 1B59A 4KUMA 2IT0A 2V6CA 2OU2A 1LEAA 2JZYA 1IN4A 2M5WA 3FXQA 5D5VB 2NNNA 3HRTA 2ZMEA 4RB0A 2P5KA 5D6EA 3BPVA 4Q48A 3ZMUA 2O61A 3I59A 1G3TA 3R6SA 2FBKA 1YLFA 1QQIA 4D0PA 4BQAA 3GWZA 2JPCA 4AIHA 3E3VA 1T98A 1ZHFA 2CWEA 4ETSA 3FF5A 3GUDA 1S7AA 3FWEA 4ZYGA 2XUBA 2ZMEB 1XDUA 4IVNA 2XGXA 1SMTA 2DK5A 2HWVA 1ONVA 3HYIA 2KIFA 2D1HA 2DW4A 5LGTA 3I59B 2PMHA 5HDNA 4HX8A 1XCVA 1WRJA 4HX4A 4L9NA 3WTZA 1E17A 4UV8A 3ZMTA 3VFZA 2COMA 3EUHA 4WXCA 5A2QK 1USTA 4LB5A 2MLGA 3ZPLA 2QQAA 1HKSA 1OKRA 3NQOA 3DFGA 1ZLJA 1H9GA 1UCRA 5K1YA 2AS5F 3QPTA 4EJOA 5LRSA 1EV7A 4DNCA 2K4BA 2OD5A 5E17F 2VOPA 3GFIA 1YYVA 3J80Z 1U6GA 4LD5A 1LB2A 1RNLA 4IRHA 2HKXA 1GXPA 5LHGA 1Z91A 5DCFA 3MFKA 2XAGA 2OZ6A 1B9MA 4M74A 1FBSA 2GA1A 2NS0A 3K1MA 1AOYA 3L09A 2QQBA 5FLXK 3T1BA 3FMSA 1IN8A 3O6BB 4LJZF 2JT1A 3B02A 3QU3A 3JAMZ 1IXRC 4UXNA 2QVOA 3WU0A 2ISZA 3KLNA 3D5LA 5AIQA 2HQNA 3RYPA 4XSZF 4B09A 5J8FA 1ULYA 3MAJA 2ZO4A 4WCGA 2D1VA 5BS6A 4Z2YA 1MD0A 2LF7A 1TBXA 4O5VA 2MA3A 1G3WA 3DV8A 1ZLKA 3GVAA 4U7BA 2GWRA 1I27A 1I1GA 1FYKA 3Q9SA 5ICEA 5D4SA 4UUVA 3RPUA 1R23A 1XGOA 3R61A 1CGPA 3LAJA 1L0OC 3PQKA 1SD6A 5BPIA 2Y75A 5FO5A 2ZNYA 4CICA 3CO6C 4Q5SF 1MKMA 3KP4A 6PAXA 5BMZA 4PGHA 1U8RA 2XVCA 2L4MA 1KQ8A 5ERIA 1FC3A 1Z05A 3HHGA 4QWQA 4UNOA 4N9IA 3LQRA 3ISPA 3EDPA 4BXUA 1R1VA 2ELHA 3I58A 1IN7A 4P9UA 1KQ0A 3EQLF 5BQTA 4HYEA 2IA2A 3ECHA 3RDIA 2HS5A 3U1DA 2OBPA 5HOOA 2VBXA 4YFKF 5TJJA 4HAMA 5JVTA 1S8NA 4OU0A 4PGGA 1F9NA 1FLIA 3CLOA 1PDNC 3I54A 2M30A 1SFUA 4LLNA 2ZJ2A 3TKYA 2M1BA 3KCCA
chains in the Genus database with same CATH superfamily
1OYIA 3LSKA 3ZR8X 2ADUA 5J8CA 2E35A 2QZ8A 4AUXA 2WAQN 3J7AY 1OPCA 1ETOA 3L2RA 1WKMA 3K2ZA 4G94A 9ANTA 3S1QJ 1R1UA 2CUJA 4XR6A 5CLSA 1LVAA 1K6OA 4N0BA 2I10A 3L2CA 1HW2A 2J5OA 3G3ZA 3HGYA 5LGNA 5FGMA 4OMZA 4XLNF 2X51A 2DMUA 4DZPA 1HA8A 3L9FA 5ICGA 2K9SA 2VASA 4ZDLA 1FEXA 1TL8A 2IEKA 2FJ1A 1PP7U 1LJ9A 1TWCJ 3KE2A 1HDPA 2HKOA 4HF0A 4Y52J 4BE0A 4HW0A 3R0JA 2ZXIA 2A6TA 1RKWA 3LSTA 4LIUA 2X0LA 1VQ6I 4KT5C 4KA4A 5CKTA 2BYVE 1IUFA 2Q2EA 2HVRA 3GMEA 1USSA 2P8TA 3KLOA 2R7OA 2XKOA 1M1EB 1TNSA 2NXNB 2ACJA 1P7JA 3BOQA 2CUZA 5DM7F 2B0LA 5IT9Z 1YX5A 2L7ZA 2L9VA 4X1EA 2IRFG 1S3JA 3BTLA 3CD6I 3CF5F 1DPUA 1GDTA 3JW4A 3QOEA 3GEZA 4RGSA 4JK1X 4CCOA 3J7YJ 1J59A 4OINF 3CF2A 2PMZA 1BC7C 2FNAA 3CCEI 3VEPA 3HTUA 2BW3A 2R7QA 1L3LA 1S72I 3JRFA 3M9AA 3WE2A 4WWCA 2DOFA 2Z99A 3FXRA 1HCRA 1ODDA 2AXTC 2MFZA 3FXUA 1BR2A 4F92B 3S15J 1XG1A 2CW7A 3HDDA 1B9NA 2QLZA 3SJMA 2PI0A 3MCZA 4DYQA 2QKLB 4OOIA 2OJED 3K6GA 5KCMA 1WQ2A 4JYKA 2JSPA 2EIKH 3DU5A 3OS2A 2OPTA 1BJAA 1P9QC 4YELA 3VPRA 4BHCA 2CO5A 1NH3A 1HOMA 2ECBA 1KYZA 4M3EA 5LGUA 3CDIA 5J47A 4FISA 1A36A 5FKLA 2QQ8A 3QRFF 3V7RA 3O3KA 4A12A 2Q0OA 2DN0A 3GTOJ 2BY3A 5CJ9A 4HQEA 2E2HJ 3ABUA 3IRRA 3LOCA 1O3SA 1E3HA 1MSFC 1U78A 2BW3B 1TNTA 3BR3A 4JX6A 3V8JA 1QHHD 2V1UA 2OQGA 3FHNA 2MC4A 1FIPA 3HTSB 1JGSA 4UVBA 2VQLA 1HSTA 1D0ZA 3WHBA 1LDJA 1B8IA 4PZJA 4IHWA 1A6IA 3ZMDA 4BJ6C 2JA7J 1VQ4I 4LLLA 4BJTA 4XONA 2O7OA 5E3OA 2EILH 1X1DA 2P7VB 2COBA 4OAZA 4I2OA 2W24A 2QQ9A 4LFUA 1EH8A 1QZYA 5F6FA 1MIJA 3E5QA 2XRNA 2VQHA 3F72A 2E1CA 2HYJA 3OMYA 4IX7A 2YU3A 1P4AA 5HLTA 2R4GA 1FNNA 3MKWB 1DPRA 1XPXA 2HDCA 2L02A 1B72A 5L3CA 1WH7A 4XNFA 3BG3A 5CVJA 5AONA 4C3HJ 1MMDA 1H0MA 2KIQA 3MEXA 4G6TB 1B8IB 2M34A 2VLAA 2DFHA 3OOUA 3E6MA 3RQ4A 5D5WB 5L3FA 3G73A 1KONA 1SFKA 2KZVA 1YIJI 3LSMA 5CVRA 4YEJA 5DD8A 2GXGA 5B1BH 4BBSJ 5K5OA 2ESNA 2YPRA 1K78A 3X2QH 1S29A 4E7SA 2A5YB 3F9KA 4R79A 2M0CA 4RM2A 2DXIA 3FX3A 2XV4S 3CQZJ 5GPCA 2IGKA 3CJRB 1WJ5A 4HRIA 4IKFA 3P5JA 1MDMA 2E2JJ 1G3SA 2Y9YA 4WX9A 3RCOA 1P92A 1B72B 1ZARA 5DUIA 2KKOA 1MJ9A 3HOVJ 4O3MA 1PVEA 4A6DA 1W5SA 3BQYA 5HVQC 2KHMA 5B3SH 3BROA 1ETQA 5HS7A 4GRIA 5CVUA 1G4DA 1P2FA 3HOWJ 2A68F 3IAS2 1BW5A 3TOBA 2VOOA 2X1DA 5E18F 3BTIA 5H6QA 3C7JA 1IV6A 1Z3XA 2FSWA 4GO1A 4FHTA 1MBKA 4XK4A 1K78B 2VUMJ 2MG4A 3HEFA 3CZ6A 3IWZA 4U87A 5J4VA 3WTSC 3AL0B 3MKZA 4JQFA 4Y17A 1WJAA 3JTGA 1IN5A 4F93B 1MDMB 4BXXJ 2YX7A 3FBIB 1YI2I 1Z67A 3BY6A 2ICWG 5IYBJ 3F6OA 3K69A 2EZHA 1REPC 2NVTJ 4LG0A 1LQ1A 2R5YA 1VNDA 2MW8A 3QU6A 2PMZN 1A04A 2XIGA 4XORA 3T0YA 4A0ZA 4CO8A 2L2OA 3F23A 1MGTA 5IOZA 2XSJC 2VONA 2UXNA 1T33A 5E1WA 2ZJQF 5HLIA 1YE9A 1QGPA 2BY2A 1R00A 3DCFA 2DCEA 2QGUA 4QTRA 1PUFA 4KITB 2B9SA 1T8IA 4AYBN 2QF7A 4IOAF 3RYRA 1WH5A 3HSFA 3T8TA 3CC2I 1T2KA 4ZDOA 3ESWB 1Z7UA 3OYGA 2VB6A 4IJAA 1Y39A 2HOSA 2XAFA 2K02A 1TW2A 3BP8A 4LK1F 4M9XA 3LA7A 3E6CC 1U0JA 1FYLA 1HC8A 1MNDA 4LG0B 2ISYA 2NNYA 2R5YB 4R1HA 1TZLA 2QM3A 3D5SC 4RB2C 2FBIA 1OR7A 1LUJB 2JJ7A 4MTEA 4IRGA 2IA0A 1WFXA 5IP9J 1FSHA 4GCVA 4UVCA 3ZMVA 2LTPA 3M8FA 2E5NA 3OY9A 2LD5A 2DMNA 2V9KA 3KYLA 1PUFB 2P6TA 3K4JA 4I01A 3CCUI 5LLQA 2K3PA 3RTRA 1VTNC 3PFYA 2CV1A 1HQCA 2K9LA 5FKMA 2CJJA 2E1NA 1R5GA 1W1WE 5JFRA 3CMEI 1JKRC 1Z21A 5GPAA 2LH9A 4BACA 1IN6A 4L9TA 2AXLA 5D8KB 4RAFA 2DAOA 3H92A 3MQ0A 2CH0A 2PG4A 2VE8A 2GXAA 4S05A 3SFZA 3SYTA 4EGYA 2HTSA 4OIRF 3HUGA 4Q47A 1K83J 1FBQA 3GTPJ 3A02A 1XDSA 2A61A 4KFCA 3NEUA 2TRTA 4DQ2A 4HSRA 2VKHA 2NVXJ 4ZJZA 1R4MB 4OIOF 3M8JA 3I53A 3Q0WA 4ENKA 5KVRA 1XS9A 4ENNA 4D9JA 1YTYA 3DWLE 4NDLA 3J7ZI 2QA4I 2CW8A 4HF1A 2CQ7A 2JTVA 3TEDA 4CDGA 4B3XA 3WTYC 1BC8C 5DYMA 3IWFA 1YHQI 5CYVA 2VBYA 1IXSB 4DW6A 5EZGA 2CW0F 4TV7A 1N77A 4MTDA 4C9YA 2WY7Q 1J9IA 2Z1DA 4ZYDA 2LP0A 4UV9A 2FF4A 1U8BA 3H9QA 3HUGB 1HLVA 1OQYA 2LY9A 1WJBA 5DTDA 3HOZJ 4PSXA 2UZKA 1J09A 2RQQA 3P9CA 4XL9A 5JR3A 3OSFA 4U88A 5IOYA 2J5PA 2KIUA 1R58A 1HSJA 4IOCF 1JI8A 5H2FC 2BBYA 4GDFA 3BZ6A 5CVIA 3G1LA 1YX3A 2LNBA 5FD6A 2OTLI 4AM3A 4F7ZA 1ZRDA 5JVGF 5FKKA 3J81K 2EIJH 4I7HA 1K4SA 2EV5A 2HQRA 2W57A 4LMYA 4HNUA 3IUOA 3VYTB 5H20A 2W48A 3GYHX 2QBYA 2FA5A 2K7LA 1MMSA 1B4AA 1VQOI 2G9WA 3BWGA 3JRBA 1I3AA 4Y4RA 2M45A 2M87A 4JOMA 2DU9A 1IC8A 1BIBA 3WGIA 3D5RC 4RGUA 2A69F 3CCSI 1K6YA 1HKTA 5LEJA 2HTJA 1XX5A 1I39A 4HF2A 2LOOA 2KLOA 4HZFA 5ILUA 3CCLI 3F21A 3OS1A 3RJPA 1LFUP 3BZKA 3A03A 2C6YA 4Y3OA 4ZYHA 2R7FA 3JREA 4YIIA 4L0YB 3FXKA 3QPLA 4JX4A 3ASOH 2IXSA 3GZ6A 1KU9A 4W97A 1O3RA 1U9NA 2EFNA 1ZRCA 4A3DJ 1FT9A 4J01A 1GHCA 3C2GA 4XRSG 3OYMA 3ZQIA 4MEXF 4ZTJA 1ZN2A 4F91B 2IGMA 2QBYB 2O9LA 5GTHC 1E3OC 3CUQC 2ZSHB 5M5WJ 3KP3A 3PNTA 3RKQA 4ZYAA 5JI6A 3L2UA 2LR8A 2P5VA 3PSIA 1Z7LA 1YW7A 4KMUX 3SZGA 4HX7A 3GTQJ 3F8MA 4IHTA 3V7SA 4OAYA 2VKEA 2JVGA 5DCMA 2DDBA 1SD5A 3I3LA 4V2GA 1V3FA 3AG2H 1T39A 1V4RA 3F8NA 4CUGA 2EA4A 4IHSA 4GGGA 1R5ID 4RB3C 4RDUA 3DBRB 3EYYA 4UHTA 2IS6A 2ETHA 2VIXA 3PNVA 1MMGA 1ENHA 1MBJA 3ABKH 1X1CA 4AWXB 3KP6A 4F52A 3VODA 4E70A 1FTTA 1Y1VJ 2YU9J 1BW6A 2VT3A 1P4XA 4LG3A 3RPQA 1O7FA 1U5TA 2K86A 1F5TA 4V2FA 3V4GA 4U0YA 3CP8A 5HNFA 1TT5B 3QPHA 4NC8A 3G2BA 2LY2A 3W2AA 2KJCA 4LB6B 5DCMB 4CHUA 1JE8A 2Y31A 5EEAA 1MMAA 1U2WA 2NYXA 1OCCH 3KZZA 4E6KG 3KIOA 2KQRA 3K4NA 1D3YA 3CDHA 2BEOA 3HC7A 5L3DA 5TGTA 4GXOA 2RKHA 1R7JA 2BY1A 1TQIA 1A35A 3B73A 3PFIA 2ID6A 2KISA 2WWYA 4HG2A 5M5YJ 2A05A 3BJOA 3Q3SA 2DMPA 3ABMH 2N8GA 4XSXF 1HW1A 5IT3A 4I02A 3FISA 4XLPF 4ZYEA 1TW3A 3PNYA 3HXLA 4Q4ZF 1R36A 2K9NA 2E60A 1U5TB 5DEQA 5GAGJ 1OMIA 5EYRA 4IQ4A 3LSHA 4M73A 4B43A 5EGOA 1LPQA 2PX9A 3ELKA 4NBQA 3CC7I 3OL4A 2Z16A 3EUKL 3DTKA 5J40A 1Q1VA 3GZ5A 4ITVA 1GLNA 2CUEA 5K5RA 1IRGA 3IP4B 1R6RA 3WG9A 1DP7P 3S1NJ 1QNTA 2VPLA 2KL4A 1XCBA 1WSUA 3LSIA 2OCCH 2HOEA 4KICA 4WXDA 3O8HA 2F2EA 1AKHA 3PSFA 1GVJA 2EQRA 1K79A 5F1RA 2VBZA 4XBFA 3TP0A 1SAUA 1SANA 3LMMA 1H89C 5F27A 2IVMA 3KP2A 1YITI 1PUEE 4K2EA 2D5VA 3TOAA 1QVTA 2L4AA 3MKYB 1I6HJ 3L2VA 2IPQX 4XM3A 2V79A 4BY1J 4CA0A 1ON1A 3W6JB 2D2WA 5EGOB 2LKSA 2FXAA 2M4KA 1Z6RA 4A69C 4BKXA 4A3CJ 1S7OA 4CYCA 2QWWA 2XF6A 2PBIA 2Q8KA 1GUUA 3WU1B 3W6VA 2YR2A 1JJ6C 2P7CB 3M3YJ 1JUSA 3G1MA 3OSGA 2LMDA 1Z1DA 1AKHB 2BHYA 2HNHA 3JSOA 2Y0SA 2LSOA 4BBRJ 4ENMA 1J5YA 1BI1A 3F8CA 2CFOA 1ZGJA 1F43A 1E2XA 3F6VA 4PJNA 2G7HA 5E3LA 2DA6A 2HEOA 4MGRA 3L1PA 4RGRA 3FMRA 2R7XA 1Q1HA 3H0DA 5AIPA 4E7KA 2CQQA 4CZZA 1D1CA 2XAUA 5ICCA 2Y0MA 3HSRA 3ZN1A 1I50J 2DI3A 3W6KB 4O6JA 1OCZH 2YX4A 4XLHA 5EEGA 1JHHA 2VODA 4CYCB 1UG2A 1D8JA 3M8EA 2MABA 2BZTA 4KIBA 5BNGA 4G7HF 2FQ4A 5KNLA 5CQEA 2VJIA 3S3OA 3M4OJ 3SFIA 3ERED 4H4KC 4B44A 1K7AA 2IGNA 2X6WA 1B1BA 2NS7A 5FFZA 4P55A 3J80K 3OR2C 2KDOA 2L54A 2FOWA 2R7RA 3P9IA 2STWA 2VC1A 4ASNA 4BJ5C 2XF5A 3KYCB 3DTIA 2Y48A 3F22A 3LAPA 2BGCA 2EWNA 3MMYB 3P9KA 3ZMZA 1W0TA 3ABLH 4EEFG 4ZZDA 2Z9OA 3S1RJ 2F5CA 4NUBA 2RNJA 2JWTA 4AD9A 3HOXJ 5F0CA 1XSXA 2CG4A 1ZG5A 4XN0A 2QENA 2XF7A 2HYGD 1RETA 2H27A 3WODF 3JAMK 3IKTA 1YO5C 1ZAOA 2LYCA 5HS9A 2E1MC 1MSEC 4EJTA 1UMQA 3M1CA 2ZCWA 3PJRA 1MJAA 4J19A 4I09A 3ULQB 3S3MA 2D45A 4XIDA 1X3ZB 3N05A 5FD5A 1IF1A 3OYBA 2RREA 1FY7A 3H9GA 3Q0VA 3EYIA 3TGNA 3ZQHA 3OYCA 3ROUA 3M1EA 2XAHA 2L9SA 4NNJA 2AQEA 3K1NA 4G8XA 3QQAA 5IYDJ 2A6HF 4WXHA 2FE3A 3CUOA 2Q2EB 1IV8A 1Z77A 2LKXA 3F8FA 3W2WA 4XKCA 1S9HA 2K9MA 1VI0A 3HOYJ 2RGVA 4A3FJ 1ZR2A 2O3FA 1Z9CA 5B66C 2AO9A 4AVPA 3FHZA 3FXLA 5HLGA 4HV6A 2LF8A 2JRMA 1SAXA 1T38A 5D4RA 2CU7A 1XGSA 5J1YA 3V8LA 5J1RA 1DDNA 2HPMA 4EV0A 4ZH4F 4D7NA 1IZ1A 4G9YA 1P4WA 4PUSA 2DT5A 3VDXA 1FIAA 2EFQA 4IRIA 5EJCA 1B6AA 4XLEA 2HGCA 1BBYA 3E97A 1GV5A 1FOYA 2QYOA 3IKVA 2PJRA 3C1DA 2HDDA 3GTJJ 2DYSH 4GYGA 4B48A 2HFHA 3RZOJ 5D8LB 1UHMA 3DEEA 3RSNA 3LNQA 4EGZA 2R7WA 2ZFUA 3GTLJ 5IP7J 4CCLA 1EKEA 2Y69H 2ZJRF 4GFBA 4L5JA 3I4PA 2EV0A 5E1XA 3HRMA 3LSPA 2FMYA 3K4KA 2K40A 2DQRA 2KP6A 1RI7A 2DJNA 5E8IA 1TWHJ 3K70C 3EPZA 3FKIJ 1JKPC 4MFDA 2Y0SN 3V42A 2G0EA 1XGNA 2L5QA 1ZK8A 3FDYA 4AVZA 4ANJA 2PJRB 1UELB 5IP6A 4UUTA 2W1OA 2FEZA 1S6LA 2ZC2A 3BPXA 2A3SA 1I5ZA 3KPHA 4NHJA 1ETWA 1NHAA 1X3WB 4NB5A 5F1JA 4KISA 1XB4A 3DPTA 3PIPF 4A5MA 2GLOA 3H36A 1G8XA 4CYDA 2QSHX 3DLAA 3MZYA 3ZN0A 4QLCU 4E7LA 3L00A 3KZYA 4HV5A 3LA2A 1C0WA 1ZG1A 1TQMA 3LSJA 5KAFC 2W25A 4DGWB 3GTMJ 3K2AA 3NRVA 2H09A 1D5VA 2B63J 1ZG3A 1S7EA 4Y7NJ 1ZH5A 2KRCA 2LRDA 2NAZA 3DP7A 1V5FA 3FK7A 1CF7A 4EM0B 2M9HA 4LK0F 3I0TA 5DUKA 4NQWA 4R8HA 2L0KA 2P0WA 4HLXA 2HVQA 3H1CA 5A2QZ 3QYFA 3JSPA 5LD2C 1Y0NA 1ZRFA 3R4KA 1T0FC 3OR1C 2X6YA 3E5UA 4G7OF 2CRGA 3KP5A 3KYDB 4EM1A 3N97A 1V55H 1D5YA 1X58A 1MH3A 2FX0A 3GW2A 5H6RA 2UV1A 2UUZA 3CJNA 4II2A 4MQ9F 4Y15A 3JR9A 2BE5F 3GBGA 4P5OA 1MBFA 2FQ3A 1DQUA 3KFWX 4HA8A 3HRUA 3CCJI 2BY0A 1WWXA 2EIMH 1VQ7I 1RIOH 1D1BA 4M6YA 3TO9A 4BS9A 3SQNA 5HS8A 4ESFA 3S93A 1J7KA 3HRSA 2F5FA 3QAHA 3SXYA 1CF7B 4FE7A 2VC0A 3RKXA 3A0BC 1E0EA 2NOGA 1BIAA 3HGGA 4NQWB 1KU2A 3DQVC 4DZJA 2M3AA 4M9SA 3MWMA 2Z3YA 3GFLA 2O6GE 2DBBA 2E7XA 1TQPA 3IC7A 3WGHA 4L5IA 5IT9K 5FLXZ 3NWTA 3VSLA 3HPHA 2L7KA 2MYSA 3CJQB 1HDDC 1JHFA 5L3BA 4IQJA 2DA7A 1MH4A 1XSDA 5HLHA 1O7LA 2KJBA 1WHUA 2WADA 1GXQA 2MH2A 1ZQ3P 1FP1D 1GV2A 2FMLA 4CXFA 4PJ0C 1T08B 3DEWA 2WB1A 3EETA 2EFWA 1POGA 2P4WA 1R49A 2Y30A 4M9ZA 4BU2A 1XMAA 2WAFA 2FRHA 3RIRA 3VB2A 1QRYA 1U3EM 1S5LC 3KP7A 5K5QA 2QCOA 2V1XA 5FROA 2IP2A 4FCYA 2PJPA 2GIZA 4C2UA 1N78A 2KT0A 5LBQA 5L3EA 3HKZA 4A3BJ 5K7ZA 2RV8A 1MNMC 3GFJA 4IHYA 3ZCOA 4L9VA 3RKYA 2VJ5A 1BOBA 1YIOA 2DMTA 3OYIA 4C30A 2H1LA 3A2KA 3M7GA 1BR1A 1JXSA 3NARA 3IH4A 2H6BA 3TP3A 2ZMEC 3UNGC 3C18A 5E3NA 2X6XA 2DQLA 2GQQA 2V1NA 1NTCA 3FXMA 2JUGA 1STZA 2ME0A 3BR6A 1OCPA 2W4SA 1FBUA 1FJLA 2ESHA 5F08A 4FETA 4XOTA 1EH6A 1FWZA 1BR4A 3RPUD 1AWCA 3W3CA 2FNPA 1VQPI 4OIPF 4DBRA 2P6SA 2VQCA 4CCMA 1K4TA 1WI9A 2MD0A 4AIDA 1R1TA 3LFUA 2XHKA 2VT2A 4G12A 4G7ZF 1XN7A 3E6DA 4A3EJ 2O03A 1DU0A 1Y6IA 5GTIC 1LE8A 4A3IJ 1EA3A 3TQNA 2IJLA 3JRHA 3IHUA 3ECOA 1FOWA 5LFAA 1WZ2A 3OYFA 1TP4A 1JGGA 3K0LA 4B47A 4AIJA 1YW8A 2VE9A 4UB8C 2NVQJ 2LDUA 4BY7J 3DKYA 3S2WA 2QUFA 1BI3A 2CQNA 3VYRB 4D5CA 4L5EA 1ZYRF 2TDXA 3ZP5A 3BR5A 3HOTA 2F4IA 2DT6A 1OJLA 2JA2A 1JTYA 4M72A 1QZZA 4ESJA 1G3YA 4M6XA 3DEUA 4P9FA 4YIFA 5ILVA 4I6ZA 1UAAA 3QP5A 1JT6A 4EM2A 4KNYA 3EUHC 3U21A 1QA6A 1DUXC 4G6QA 5KAIC 2KPMA 1LE8B 4U0VA 1WCMJ 3H3ZA 1YW9A 4KN4X 4PJLA 3WG7H 4L0ZB 2VBWA 3G71I 3I56I 1TT0A 1APLC 2KDZA 3GTGJ 4LOCA 4BXFA 2RN7A 3WTTC 1KU3A 3JCUC 4HLYA 2ELJA 2ZNZA 2XAJA 2VXDA 1KU7A 2CFXA 2K85A 3E7LA 4IF4A 1LEBA 2LREA 3LFKA 3L2QA 1HKQA 3R0AA 2R5ZA 1FX7A 5HODA 1A31A 1FYMA 4BQQA 1R71A 2A07F 2GIVA 4MNUA 3WTVC 3L2WA 3GF2A 2OA4A 1YQAA 4HNTA 1UB9A 3Q5FA 4MQVA 3BJAA 4L18B 4YG2F 2KZGA 4ZDPA 3ZGKA 3AG4H 2NVYJ 2VI6A 3N4MA 4RMNA 4JBAA 1DU6A 1FP2A 4YRVA 5CQGA 4B8XA 5D6FA 4FQGA 2W00A 3B6AA 3K9TA 3ZRGA 4FX0A 3G4SI 1IJWC 4HNVA 3HL2A 1RESA 2GAUA 5KK1A 3HBLA 2WAEA 5IPAA 1IG7A 3HG9A 3CCVI 4RAZA 2CV0A 2QSGX 2DTRA 5FFXA 3PO2J 3IL2A 4KIGA 4X6AJ 2V9VA 3V7CA 2F48A 2WB1N 1WJFA 2L3DA 2VKVA 3OIQA 2JN6A 4ESBA 2IBDA 2R5ZB 2L7MP 4RS8A 3HOSA 2DK8A 3T8RA 2GXBA 2Y9ZA 1LVKA 3CUQA 4XKWA 4HDVA 2JQ7A 2MH9A 1DP3A 3H3UA 5D5XB 1TLHB 4CCKA 3D1NI 4PSWA 3S2DJ 2JA6J 4ABZA 2CV2A 3HKZN 2NOJB 3KZIC 3C2BA 1U5TC 1FPQA 2F4OB 4CZCA 3WTWC 3QYBA 3M07A 4HDUA 3PO3J 2F5DA 1HXDA 4Y13A 2EJRA 3WGGA 5IYCJ 2IA1A 1Y0UA 1Z6TA 1LFPA 1FZPB 2Z5UA 1RKTA 1RC9A 3RKWA 3C2HA 2ZXWH 4PFPA 3WE3A 2EPFA 2M8GX 4C2MJ 2F6CA 3E6BA 4U7DA 2XPUA 3T5XA 5EDNA 2KFDA 2EZLA 1LDKB 3TO6A 3WTUC 2GZWA 1BL0A 3HSEA 3CLQA 1SFEA 2DPUA 1PP8F 2KIMA 1IRXA 3BT9A 2H8WA 3CUQB 3WHCA 2Q1ZB 4C3IJ 3ZQ7A 3VOEA 3KETA 2WBMA 2WTEA 2IS1A 4XICA 2O8XA 5M3FJ 1SD7A 3V8KA 3ML6A 2EFPA 2CUFA 2M2EA 2ZB9A 1VZ0A 1W7PD 3PL8A 4B1RA 2M0MA 2L01A 1V5EA 2W82A 3TW7A 2QKMB 4RLFA 4DYCA 2X85A 4HSTA 4KDPA 1J0RA 1O4XA 1BOAA 2R92J 3H5AA 3QPSA 2DO7A 5F0FA 2DTZA 2WA0A 1F4KA 2PEXA 3DXJF 4I99C 3ABTA 3BQZA 3CDLA 3PUFA 1ERDA 4XQFA 4FASD 1W0UA 3GX4X 2W7NA 4FX4A 5EG0A 2F5EA 3O2PE 1VQ9I 1KQ9A 2DA2A 4QSHA 4MO7A 4IXAA 3K10A 1JT0A 2LBFA 1R22A 4F55A 3OYDA 1JKOC 1ITYA 2XDVA 3DBHB 3SZPA 5F04A 5C44J 2GM4A 3AG1H 2FOKA 2BV6A 2QSFX 1OYWA 3BR1A 1YJNI 2OF7A 3F8BA 1I3QJ 2ZJPF 3BJ6A 2YSRA 3FZVA 3AAFA 4I0AA 4L9JA 2FU4A 3MZHA 1IRFA 3SZTA 1UHWA 3K1PA 1BI2A 3GFMA 3DBLB 4BL0B 4XMYA 5ILSA 2LLKA 1O3QA 2HQ5A 4BAYA 5GAHJ 5CVVA 1WGXA 3K70D 4W1UA 5EG0B 1IAWA 3TDZC 2PQ8A 1J75A 1BI0A 3VYUB 5TRDA 2OC6A 5HDKA 2RDPA 2LBFB 2KRFA 2PMUA 4M3DA 1XD7A 4LITA 2EK5A 4E4HA 1ZR4A 2K4JA 2VKDA 1QBJA 2IW5A 3HIFA 2CQKA 2WV1A 4IHVA 1P7IA 1U9OA 4A0XA 2DA4A 2XAQA 1FMWA 5GADJ 3Q0UA 4G6DA 4AC0A 1SVOA 2V1DA 2RC4A 2V6EA 3TDUC 2DT7B 1ACIA 4P1WA 5K7HA 1ON2A 1X2NA 1XGMA 1HF0A 2V7FA 4A3JJ 3A1YA 1W4MA 1QHGA 2EBIA 1VFCA 2OQRA 4X0GA 4I0BA 3VSKA 2PLYA 4ZZLA 2M4GA 4RB1A 4XRFA 3DPLC 3ERMA 2A5WA 2DFEA 2XB0X 1SEUA 1F1ZA 1DGRM 2DPDA 5FLMJ 4PDKA 1W36C 2LFBA 4LLGF 5JHUA 1PYVA 2FBHA 1ETXA 2L9NA 3FK6A 1T95A 2P5LC 3FM3A 4CCNA 2JSCA 3GXOA 4XOPA 4BDZA 1TTYA 3H0GJ 1OYYA 3BDDA 4RAGA 3OL3A 3WU2C 4BHPA 2X48A 4JX5A 1JKQC 3WTXC 3I5UA 1KA8A 1W5TA 4S04A 3ZQFA 3S17J 3K4LA 3RZDJ 4XLCA 2FD5A 2FUG2 3FXJA 1P6RA 3I64A 5HDGA 2RQPA 2E7WA 1FOKA 2OTJI 3FM5A 2OCEA 5J4YA 3PQJA 2PN6A 5BPDA 1UHSA 3I55I 2H94A 1ETVA 2AHQA 3DU6A 3QOPA 2K9QA 3QWLA 1MJBA 2HOTA 5JLXA 2DFFA 4CSWA 4HQMA 3MD2A 2K27A 3CMAI 4FT8A 4HOBA 5J1UA 2K5CA 4BDYA 2RAEA 3MKLA 4GYIA 2QEXI 1IXCA 2JMWA 1MBGA 1FMVA 3LSGA 3B6CA 3LWFA 2ID3A 2WC2A 4MHGA 1G2HA 1XSVA 2DA1A 4Z6YA 2EB7A 2XASA 4MIMA 5JHFA 1G6NA 1WPKA 3BR2A 4NC6A 4BHBA 5L3GA 2HQAA 4A0YA 5FLVA 1O57A 2OZUA 3OYEA 2UWMA 1Y56A 2OAZA 3IRQA 5FRMA 2R7VA 2M8EA 4AYBA 4BUPA 1A6QA 1SMYF 4EMSA 2ZKZA 3ZOBA 4F3QA 3I4NJ 4P96A 4H0EA 1W7PA 1IUYA 2M7BA 2Z2SB 3QP6A 3HHHA 1OFCX 4ZTFA 1VQNI 4BH9A 2HYFA 1MBEA 4KT6A 2CGPA 4OIQF 5J3LA 3I9V2 1MZBA 1BM9A 4C2TA 1UG0A 1XMXA 2E1MB 1RR7A 1HW5A 3H5NA 4FE4A 1XC5A 2MC3A 4KMFA 1UFMA 1UJ8A 3OOPA 4J00A 3GO5A 4DOZA 4RBOA 4KN7X 5IY5H 2ZFWA 3OYHA 1LKXA 4A2UA 4EATA 2R7DA 1NK2P 5DDGA 4E7HA 3HM5A 2H8RA 3GCMA 2E1OA 1JJ8C 4HBLA 3BG5A 1VF9A 3R60A 2VXZA 2CSOA 2BHZA 3BG9A 2JRTA 4PJMA 3BLYA 1W7PB 3HJEA 4I98B 2EZIA 4RAYA 1QPMA 5DV5A 5BOXA 3ZXSA 1BA5A 2B7EA 3COAC 2XKPA 4KYWA 2DDAA 2R7SA 4D7MA 5D5UB 2G7UA 2X9DA 3ZMSA 5GP9A 1RUOA 3KEYA 1SVMA 1YS7A 2V9PA 3F3XA 5FB2A 2IGOA 4RGXA 3AFHA 3CO7C 2VL8A 1R5HA 1SVLA 4ON0A 4AIKA 3JRGA 3AL0C 1TWAJ 1X4PA 1G59A 1WJCA 4E7ZA 1SFXA 1QO0D 3SHFA 3REOA 5E20A 3HB9A 3CCRI 4A3MJ 2BVLA 1H9TA 4D5FA 1QPIA 4A93J 3OWTA 1VQKI 2CYYA 3E5XA 1D8KA 1ZGAA 4N4NB 1YJWI 1ZTRA 1X3UA 2HI3A 3DPUA 4ZC3A 1ZGWA 2LKPA 5LHHA 1A5JA 3G1OA 1Y8QB 3J81Z 1X1AA 2ZSIB 1LDDA 4YFNF 2EH3A 4YFXF 2STTA 1OCOH 4PCQA 2R7TA 2MBFA 2EINH 3CTAA 1J2XA 4WK8F 3GLXA 1JUMA 3FBNB 4PK4A 4EVIA 1KGSA 3NAUA 4M71A 4AU7A 4XRMA 3HOUJ 4U0WA 2F5VA 3DF8A 2R3SA 2BOLA 3MZ8A 3JTHA 1YG2A 1KYWA 2Z33A 3LQQA 2A6EF 3TO7A 2V26A 3FMQA 3HZJA 2ZBKA 3BTCA 3D0SA 4EJVA 2NS8A 2RVCA 5LEKA 3A01A 1ZELA 1X1BA 3OIOA 1N25A 3OYJA 3VWBA 2NRAC 1YJ9I 3I4MJ 1T0FA 1SD4A 1I1SA 3KEOA 1LNWA 5EZHA 5C3EJ 2HDWA 1HBXG 1VQ5I 4C3JJ 1I6XA 2DJIA 3H5RA 5M5XJ 3S1MJ 1TWFJ 4UB6C 1SFOJ 3RI4A 4ENJA 2X6OA 2BVMA 2EV6A 4IEJA 4KJZA 4D1QA 1QU3A 1IW7F 2HR3A 5LHIA 4MLOA 3SDGA 1H88C 4BQNA 2BXYA 5FRNA 4Y33A 2GOMA 1H8AC 4EQQA 2E71A 3P7NA 3GLLA 1R9TJ 3K4MA 2O8KA 5FKOA 3J7AO 5ED4A 4KIFA 4LGWA 5ICFA 2WY8Q 2MD5A 1OCRH 2H6CA 5F64A 2DYRH 2XGCA 2IS4A 1RZ4A 4MEYF 3H3VK 1JUPA 3UR3C 5DD4A 2R93J 4IPAA 5EF6A 4UUSA 3A01B 3PM1A 3TW6A 3IV5A 2HZTA 1FSEA 3I71A 4DYRA 5EEHA 2O0YA 1KZHA 2X4HA 3AG3H 3RQIA 4E7JA 3U9GA 4BYYA 1NG6A 1MMNA 1OR7C 3BZCA 5FKNA 3CJTB 2XGDA 2DMQA 4EJUA 2UXXA 3OV8A 1YRNA 2DODA 2MLKA 5E79C 2XROA 3FKJA 2YUSA 3BTJA 3IH2A 4CGZA 1YS6A 3VYSB 2ZXJA 4BNCA 4DIQA 3C3WA 4XLAA 2XGEA 1EH7A 4EJWA 4OMYA 2VN2A 5E1ZB 2ECCA 2EFOA 2IS2A 2JK3A 5DM6F 1TC3C 2R7UA 1ZREA 3KEQA 2DFIA 1IDYA 2PFBA 1T6SA 2WV0A 1VQMI 2YS9A 1XMKA 4XN3A 2W85A 1D0XA 4UVAA 1RR8C 1O3TA 3Q9VA 2R0QC 3NWSA 2JPBA 4A5NA 1X1PA 2ME6A 4N9HA 3U2RA 4UUSB 2DLLA 3LA3A 1WJDA 1RUNA 1F36A 5LRRA 2K3FA 1YFHA 4WF2A 3DKWA 1BN5A 3E1SA 4A6EA 2W84A 5J6XA 2LC2A 2XRLA 3EUAA 5E8GA 4CCJA 2GA2A 2LVSA 3W2VA 2EA2A 2XB5A 1YRNB 3L7WA 1B59A 1OCTC 4CH7A 1GT0C 3BR0A 3CMMA 2OV7A 2GOXB 4KUMA 4MFEA 2IT0A 1XTAA 4IL6C 2V6CA 2OU2A 1LEAA 2JZYA 1IN4A 1RPWA 2VJ4A 1JTXA 2M5WA 3FXQA 4M3BA 1FTZA 5D5VB 2NNNA 3HRTA 2ZMEA 3JRAA 1ZKGA 5DS9A 4RB0A 2NVUB 2P5KA 2O5RA 4PJJA 1WJEA 5D6EA 4OWRB 3BPVA 2KRHA 1IGNA 3E0JB 4Q48A 3ZMUA 3H9JA 2HPIA 2O61A 4B3AA 3OS0A 1AU7A 1Z3YA 3G6EI 3I59A 1G3TA 3R6SA 3H35A 2FBKA 1BJZA 1QQIA 1YLFA 4D0PA 4DBQA 4BQAA 3GWZA 3BCBA 2JPCA 3BG6A 5GAEJ 4AIHA 3PIOF 3E3VA 1T98A 1ZHFA 2CWEA 2DOEA 3K4CA 4ETSA 3DLLF 3FF5A 3CMYA 3GUDA 1S7AA 3S3NA 3FWEA 4ZYGA 3MN2A 2XUBA 2ZMEB 5HNHA 1XDUA 4IVNA 4RM3A 4IO9F 2XGXA 1SMTA 3SEQA 2DK5A 2HWVA 1V54H 5KHDA 3U1KA 1ONVA 3HYIA 4JP0A 1IDZA 2KIFA 2D1HA 2DW4A 3OYKA 5LGTA 3DTEA 4BQOA 1AA7A 1X4OA 1V5GA 3I59B 2JA5J 2PMHA 5HDNA 4HX8A 1XCVA 1Z0XA 3GZNB 4N4OB 2F4MB 1WRJA 4HX4A 4L9NA 3S32A 1GVDA 5B1AH 3WTZA 1E3PA 2VJJA 1E17A 4UV8A 3ZMTA 3VFZA 1WVRA 2COMA 3A0HC 3EUHA 1FOXA 1AHDP 4WXCA 2E36A 4QIWN 5A2QK 2P81A 1USTA 3OYNA 2CQXA 3TL4X 4LB5A 3S16J 2MLGA 1MNEA 3OYLA 3ZPLA 4A3LJ 1CQTA 5C4JJ 2QQAA 5C4XJ 1HKSA 1OKRA 3NQOA 3SDBA 3DFGA 1ZLJA 2CMPA 1H9GA 1UCRA 2AQFA 3CCYA 5K1YA 2AS5F 3QPTA 1W5CC 4EJOA 5LRSA 1EV7A 2L9RA 4DNCA 4DJAA 3QODA 4BEHA 2K4BA 1MW7A 3S14J 5FJ8J 3GTKJ 5E3MA 3A4CA 2OD5A 5E17F 2VOPA 3QYEA 3GFIA 5B5EC 1YYVA 3J80Z 1U6GA 4LD5A 2TCTA 1LB2A 1RNLA 4IRHA 2JUCA 2HKXA 2HXIA 2E2IJ 2WAQA 1GXPA 2I8DA 4XRSA 2OUMA 5LHGA 1Z91A 2BXZA 5DCFA 3MFKA 2XAGA 1R4NB 4BE1A 2OZ6A 1B9MA 4S0HB 4M3GA 4M74A 1FBSA 1EF4A 2GA1A 2NS0A 3K1MA 2XSDC 1AOYA 3L09A 2LY1A 2ELKA 4RA2A 2QQBA 2DOAA 5FLXK 3T1BA 4BE2A 2R7ZJ 1W36D 4M3FA 1EJ9A 1YOVB 3LSRA 3FMSA 1IN8A 3O6BB 4NC7A 4LJZF 2JT1A 3MVPA 4BEHB 3B02A 3QU3A 4QPOA 3JAMZ 1TWGJ 1IXRC 2L7FP 2H1KA 2X1CA 4UXNA 2LG4A 2QVOA 1RRJA 3WU0A 2ISZA 4IHXA 3KLNA 3K4BA 2HZDA 4I76A 3D5LA 5AIQA 2HQNA 2JVHA 4UY8I 4IZZA 3S8PA 3RYPA 4XSZF 3FIWA 4B09A 2IAIA 5J8FA 1ULYA 2HOAA 3MAJA 5F0HA 1WI3A 2JA8J 2GBYA 3IH3A 1Y8RB 2DA3A 2MSYA 2ZO4A 2HVSA 4PFOA 2XPVA 4WCGA 2M7AA 3TMOA 2D1VA 2CS3A 1DGWY 1X2MA 5BS6A 4V19K 2DA5A 4Z2YA 3IAM2 1MD0A 4II3A 2XC7A 2LF7A 2RNGA 3JRDA 1TBXA 4O5VA 2MA3A 1G3WA 3DV8A 3ZQCA 3TBIA 1ZLKA 3CCMI 3GVAA 4BGDA 4U7BA 2GWRA 1NG7A 2V4JC 2X1EA 4FTHA 3AKZA 3SEZA 2XPWA 5K7FA 1VQ8I 1I27A 1I1GA 4HEA2 3KX2A 3Q9SA 1FYKA 1UZCA 1ORKA 2KMUA 5ICEA 5D4SA 2Y2ZA 1LFBA 4UUVA 3RPUA 1R23A 1XGOA 3R61A 1CGPA 3LAJA 1L0OC 3OIPA 3PQKA 1SD6A 3ZQLA 5BPIA 2Y75A 4XKBA 5FO5A 2ZNYA 4CICA 3CO6C 4Q5SF 1MKMA 3KP4A 1N75A 6PAXA 5BMZA 1ETKA 2E19A 4PGHA 1U8RA 4HPQA 2XVCA 3CESA 2L4MA 3ZQGA 2LK2A 1KQ8A 4XLFA 1FC3A 5ERIA 3JRCA 5TISC 2VPRA 4A3GJ 1Z05A 2I5UA 3DKXA 3JRIA 1PJRA 3HHGA 1Y1WJ 4QWQA 4UNOA 4N9IA 4A3KJ 2EZKA 1D0YA 4QPQA 3LQRA 3ISPA 1VQLI 3EDPA 3PUBA 1MBHA 4B4CA 4BXUA 3UKGA 3CC4I 2VQGA 2E34A 1R1VA 3HPGA 1X19A 2ELHA 3I58A 1IN7A 2HXOA 3BG7A 1QZEA 3OYAA 4E7IA 4P9UA 5CPRB 1KQ0A 2MGQA 3CP2A 3EQLF 1ETYA 5BQTA 4HYEA 2IA2A 3ECHA 3RDIA 2HS5A 3F0CA 1IO2A 2ZXHA 3U1DA 3BCAA 1D1AA 2OBPA 5JLWA 4RLQA 4M6VA 5M3MJ 2VBXA 5HOOA 3LL7A 1K61A 4YFKF 1T56A 3S2HJ 5TJJA 4HAMA 5JVTA 3FXOA 3ZQQA 1OISA 1S8NA 1QVUA 4OU0A 1OLTA 4PGGA 1SC7A 1F9NA 1FLIA 3CLOA 1PDNC 2HU9A 1IRZA 4YIRX 3I54A 3K7AJ 3CCQI 3O8GA 2M30A 1SFUA 4LLNA 4XKVA 4LIVA 2ZJ2A 2E5ZA 3TKYA 3BC8A 1NK3P 2M1BA 3ASNH 3KCCA 3ONQA
chains in the Genus database with same CATH topology
1OYIA 2ADUA 5J8CA 2QZ8A 1OPCA 1WKMA 3K2ZA 4G94A 1R1UA 5CLSA 1LVAA 1K6OA 4N0BA 3L2CA 1HW2A 2J5OA 3G3ZA 5LGNA 5FGMA 4OMZA 4XLNF 3L9FA 5ICGA 1PP7U 1LJ9A 3KE2A 2HKOA 4HF0A 4HW0A 3R0JA 3LSTA 2X0LA 4KT5C 4KA4A 2BYVE 2Q2EA 1USSA 2P8TA 3KLOA 2XKOA 1TNSA 2ACJA 3BOQA 2B0LA 5IT9Z 2IRFG 1S3JA 1DPUA 3JW4A 3GEZA 4RGSA 4JK1X 1J59A 4OINF 1BC7C 2FNAA 3VEPA 3HTUA 1L3LA 3M9AA 3WE2A 4WWCA 2Z99A 3FXRA 1ODDA 3FXUA 1B9NA 2QLZA 2PI0A 3MCZA 4OOIA 1WQ2A 1BJAA 4BHCA 2CO5A 1KYZA 5LGUA 3QRFF 3V7RA 3O3KA 4A12A 2Q0OA 5CJ9A 4HQEA 3ABUA 3IRRA 1O3SA 1U78A 1TNTA 3V8JA 2V1UA 2OQGA 3HTSB 1JGSA 4UVBA 1HSTA 1LDJA 4PZJA 3ZMDA 4LLLA 2P7VB 4I2OA 2W24A 2QQ9A 4LFUA 1EH8A 1QZYA 5F6FA 3E5QA 2XRNA 3F72A 2E1CA 2YU3A 1P4AA 1FNNA 1DPRA 2HDCA 2L02A 5L3CA 5AONA 5CVJA 1H0MA 3MEXA 3E6MA 5D5WB 5L3FA 3G73A 5CVRA 5DD8A 2GXGA 5K5OA 2ESNA 2YPRA 1K78A 1S29A 2A5YB 4R79A 3FX3A 2XV4S 1MDMA 1G3SA 4WX9A 1P92A 1ZARA 5DUIA 2KKOA 1MJ9A 4O3MA 4A6DA 1W5SA 5HVQC 3BROA 5HS7A 5CVUA 1G4DA 1P2FA 2A68F 3TOBA 2VOOA 5E18F 5H6QA 3C7JA 2FSWA 4GO1A 4FHTA 1K78B 3IWZA 3WTSC 4JQFA 4Y17A 3JTGA 1IN5A 1MDMB 2YX7A 3BY6A 3F6OA 3K69A 1REPC 4LG0A 1LQ1A 3QU6A 1A04A 2XIGA 3T0YA 4A0ZA 4CO8A 3F23A 1MGTA 2VONA 2UXNA 5E1WA 5HLIA 1QGPA 1R00A 3RYRA 3HSFA 3T8TA 1T2KA 1Z7UA 4IJAA 2XAFA 2K02A 1TW2A 3BP8A 4LK1F 4M9XA 3LA7A 3E6CC 1FYLA 4LG0B 2ISYA 2NNYA 4R1HA 2QM3A 4RB2C 2FBIA 1OR7A 4MTEA 4IRGA 2IA0A 1FSHA 4GCVA 4UVCA 3ZMVA 3M8FA 2P6TA 4I01A 5LLQA 3RTRA 1VTNC 1HQCA 2E1NA 1R5GA 5JFRA 1IN6A 4L9TA 2AXLA 5D8KB 2DAOA 3H92A 3MQ0A 2PG4A 2VE8A 4S05A 3SFZA 4EGYA 2HTSA 4OIRF 3HUGA 4Q47A 1FBQA 1XDSA 2A61A 4KFCA 3NEUA 4DQ2A 4OIOF 3I53A 4ENKA 5KVRA 4ENNA 1YTYA 4HF1A 2JTVA 4CDGA 3WTYC 1BC8C 5DYMA 3IWFA 5CYVA 2VBYA 1IXSB 2CW0F 4TV7A 4MTDA 1J9IA 4ZYDA 4UV9A 2FF4A 2UZKA 3P9CA 5JR3A 4U88A 2J5PA 2KIUA 1R58A 1HSJA 2BBYA 3BZ6A 5CVIA 2LNBA 5FD6A 4F7ZA 1ZRDA 3J81K 4I7HA 2EV5A 2HQRA 2W57A 4LMYA 3GYHX 5H20A 2QBYA 2FA5A 2K7LA 1B4AA 2G9WA 3BWGA 2M45A 2M87A 2DU9A 1BIBA 3WGIA 4RGUA 2A69F 1HKTA 5LEJA 2HTJA 4HF2A 4HZFA 5ILUA 3F21A 3RJPA 2C6YA 4ZYHA 4L0YB 2R7FA 4YIIA 3GZ6A 1KU9A 1O3RA 2EFNA 1ZRCA 1FT9A 1GHCA 4MEXF 1ZN2A 2QBYB 3CUQC 3KP3A 5JI6A 2P5VA 4KMUX 1YW7A 4HX7A 3F8MA 4IHTA 3V7SA 5DCMA 1SD5A 1V3FA 1T39A 1V4RA 3F8NA 4IHSA 2EA4A 4GGGA 4RB3C 3EYYA 4UHTA 2ETHA 4AWXB 3KP6A 3VODA 4E70A 2VT3A 1P4XA 3RPQA 1O7FA 1U5TA 2K86A 1F5TA 3V4GA 4U0YA 3QPHA 2KJCA 4LB6B 5DCMB 4CHUA 1JE8A 1U2WA 2NYXA 3KZZA 1D3YA 3CDHA 2BEOA 5L3DA 4GXOA 2RKHA 1R7JA 1TQIA 3B73A 3PFIA 2WWYA 3BJOA 4XSXF 1HW1A 5IT3A 4I02A 4XLPF 4ZYEA 1TW3A 4Q4ZF 1R36A 1U5TB 5DEQA 1OMIA 4M73A 3ELKA 3GZ5A 5K5RA 1IRGA 3WG9A 1DP7P 1QNTA 1XCBA 1WSUA 4KICA 2HOEA 4WXDA 2F2EA 1GVJA 1K79A 5F1RA 2VBZA 4XBFA 2IVMA 3KP2A 1PUEE 4K2EA 3TOAA 2L4AA 2IPQX 2V79A 1ON1A 3W6JB 2D2WA 2FXAA 1Z6RA 1S7OA 2QWWA 2PBIA 2Q8KA 3WU1B 2YR2A 2P7CB 1Z1DA 3JSOA 2LSOA 4ENMA 1J5YA 1BI1A 3F8CA 1ZGJA 1E2XA 3F6VA 2G7HA 2HEOA 4MGRA 4RGRA 3FMRA 1Q1HA 5AIPA 4CZZA 5ICCA 2Y0MA 3HSRA 3ZN1A 2DI3A 3W6KB 4O6JA 2YX4A 5EEGA 1JHHA 2VODA 1D8JA 3M8EA 4KIBA 4G7HF 3ERED 1K7AA 1B1BA 5FFZA 4P55A 3J80K 2L54A 3P9IA 2STWA 2VC1A 4ASNA 2Y48A 3F22A 3LAPA 2BGCA 2EWNA 3P9KA 3ZMZA 4ZZDA 2Z9OA 2F5CA 2RNJA 4AD9A 1XSXA 2CG4A 1ZG5A 2QENA 2HYGD 2H27A 3IKTA 3WODF 3JAMK 1YO5C 1ZAOA 4EJTA 5HS9A 2ZCWA 1MJAA 4I09A 3ULQB 2D45A 5FD5A 1IF1A 1FY7A 3EYIA 3TGNA 3ROUA 3M1EA 2XAHA 3K1NA 4G8XA 2A6HF 4WXHA 2FE3A 3CUOA 3F8FA 2RGVA 2O3FA 1Z9CA 4AVPA 3FHZA 5HLGA 4HV6A 2LF8A 1SAXA 1T38A 5D4RA 1XGSA 3V8LA 1DDNA 4EV0A 4ZH4F 1IZ1A 4G9YA 1P4WA 2DT5A 2EFQA 4IRIA 1B6AA 2HGCA 1BBYA 3E97A 2QYOA 3IKVA 3C1DA 4GYGA 2HFHA 5D8LB 1UHMA 4EGZA 4L5JA 3I4PA 2EV0A 5E1XA 3HRMA 2FMYA 2DQRA 1RI7A 5E8IA 1XGNA 2FEZA 1S6LA 3BPXA 2A3SA 1I5ZA 4NHJA 1NHAA 4NB5A 1XB4A 3DPTA 4A5MA 4CYDA 3MZYA 3ZN0A 4QLCU 3L00A 3KZYA 4HV5A 3LA2A 1C0WA 1ZG1A 1TQMA 2W25A 3NRVA 2H09A 1D5VA 1ZG3A 1ZH5A 2NAZA 3DP7A 1CF7A 4EM0B 4LK0F 3I0TA 5DUKA 4NQWA 4R8HA 4HLXA 5A2QZ 3JSPA 1ZRFA 3R4KA 3E5UA 4G7OF 3KP5A 4EM1A 3N97A 3GW2A 5H6RA 3CJNA 4Y15A 4MQ9F 2BE5F 4P5OA 2FQ3A 3KFWX 4HA8A 3HRUA 1WWXA 1RIOH 4M6YA 3TO9A 3SQNA 5HS8A 4ESFA 1J7KA 3HRSA 2F5FA 3SXYA 3QAHA 1CF7B 3RKXA 2VC0A 1BIAA 1KU2A 3DQVC 4M9SA 3MWMA 2Z3YA 3GFLA 2O6GE 2DBBA 2E7XA 1TQPA 3IC7A 3WGHA 4L5IA 5IT9K 5FLXZ 1JHFA 5L3BA 1XSDA 5HLHA 1O7LA 2KJBA 1GXQA 2MH2A 1FP1D 2FMLA 4CXFA 3EETA 2EFWA 2P4WA 4M9ZA 1XMAA 2FRHA 3RIRA 3VB2A 1U3EM 3KP7A 5K5QA 2V1XA 2IP2A 2PJPA 5LBQA 5L3EA 2RV8A 3GFJA 4L9VA 3RKYA 1YIOA 3M7GA 1JXSA 2H6BA 3C18A 2DQLA 2GQQA 1STZA 1FBUA 2ESHA 1EH6A 1FWZA 1AWCA 2FNPA 4OIPF 2P6SA 1WI9A 1R1TA 2XHKA 2VT2A 4G7ZF 1XN7A 3E6DA 2O03A 3TQNA 2IJLA 3IHUA 3ECOA 3K0LA 4AIJA 1YW8A 2VE9A 2LDUA 3S2WA 2QUFA 1BI3A 1ZYRF 2TDXA 3ZP5A 3HOTA 4M72A 1QZZA 4ESJA 1G3YA 4M6XA 3DEUA 4P9FA 4YIFA 5ILVA 3QP5A 4EM2A 4KNYA 1DUXC 4G6QA 4U0VA 3H3ZA 1YW9A 4KN4X 4L0ZB 2VBWA 2RN7A 3WTTC 1KU3A 4HLYA 2ZNZA 2XAJA 1KU7A 2CFXA 4IF4A 1LEBA 3LFKA 1HKQA 3R0AA 1FX7A 1FYMA 2A07F 2GIVA 4MNUA 3WTVC 3GF2A 2OA4A 1YQAA 1UB9A 3Q5FA 4MQVA 3BJAA 4L18B 4YG2F 3N4MA 4JBAA 1FP2A 4B8XA 5D6FA 3K9TA 4FX0A 2GAUA 5KK1A 4RAZA 2DTRA 5FFXA 3IL2A 4KIGA 2V9VA 3V7CA 4ESBA 2L3DA 4RS8A 3HOSA 2DK8A 3T8RA 2GXBA 3CUQA 4HDVA 2MH9A 3H3UA 5D5XB 1TLHB 1U5TC 1FPQA 3WTWC 4HDUA 2F5DA 1HXDA 4Y13A 2EJRA 3WGGA 2IA1A 1Y0UA 1Z6TA 1FZPB 2Z5UA 3RKWA 3WE3A 4U7DA 3E6BA 3T5XA 1LDKB 3TO6A 3WTUC 2GZWA 3HSEA 2DPUA 1SFEA 1PP8F 2KIMA 3CUQB 3ZQ7A 3VOEA 3KETA 2WTEA 2O8XA 1SD7A 3V8KA 3ML6A 2EFPA 1W7PD 2L01A 4KDPA 1J0RA 1BOAA 2DO7A 1F4KA 2PEXA 3DXJF 3ABTA 3GX4X 4FX4A 2F5EA 3O2PE 1KQ9A 4IXAA 1R22A 3SZPA 2FOKA 2BV6A 1OYWA 3F8BA 3BJ6A 2YSRA 3FZVA 3AAFA 4I0AA 4L9JA 2FU4A 3MZHA 1IRFA 3SZTA 1UHWA 3K1PA 1BI2A 3GFMA 5ILSA 1O3QA 4BAYA 5CVVA 1IAWA 3TDZC 2PQ8A 1J75A 1BI0A 5TRDA 5HDKA 2RDPA 2KRFA 2PMUA 1XD7A 2EK5A 2K4JA 1QBJA 2IW5A 3HIFA 2CQKA 4A0XA 2XAQA 4G6DA 2V1DA 2RC4A 3TDUC 1ON2A 1XGMA 1W4MA 2OQRA 4I0BA 2PLYA 4ZZLA 4RB1A 4XRFA 3DPLC 1F1ZA 2DPDA 4PDKA 4LLGF 5JHUA 2FBHA 2P5LC 3FM3A 2JSCA 3GXOA 1TTYA 1OYYA 3BDDA 4BHPA 3WTXC 3I5UA 1KA8A 1W5TA 4S04A 1P6RA 3I64A 5HDGA 2RQPA 2E7WA 1FOKA 3FM5A 3PQJA 2PN6A 5BPDA 2H94A 3QOPA 1MJBA 4HQMA 2K27A 4FT8A 4HOBA 4GYIA 1IXCA 3LWFA 2WC2A 4MHGA 1XSVA 2EB7A 2XASA 1G6NA 5L3GA 4BHBA 4A0YA 1O57A 2OZUA 2UWMA 2OAZA 3IRQA 2M8EA 4EMSA 1SMYF 2ZKZA 4P96A 4H0EA 1W7PA 1IUYA 3QP6A 3HHHA 4BH9A 2HYFA 2CGPA 4OIQF 1MZBA 1BM9A 1HW5A 2MC3A 4KMFA 1UFMA 3OOPA 3GO5A 4KN7X 2ZFWA 4A2UA 2R7DA 5DDGA 4HBLA 3R60A 2VXZA 2CSOA 2JRTA 5BOXA 1W7PB 4I98B 4RAYA 1QPMA 5DV5A 3COAC 2XKPA 4KYWA 5D5UB 2G7UA 3ZMSA 1RUOA 1YS7A 3F3XA 5FB2A 4RGXA 3CO7C 1R5HA 4ON0A 4AIKA 1SFXA 1QO0D 3SHFA 3REOA 5E20A 1H9TA 2CYYA 3E5XA 1D8KA 1ZGAA 1X3UA 2LKPA 5LHHA 3J81Z 1LDDA 4YFNF 4YFXF 2STTA 4PCQA 2MBFA 3CTAA 1J2XA 4WK8F 3GLXA 4EVIA 1KGSA 4M71A 4U0WA 3DF8A 2R3SA 3JTHA 1YG2A 1KYWA 2Z33A 3LQQA 2A6EF 3TO7A 3FMQA 5LEKA 2ZBKA 3D0SA 4EJVA 2RVCA 2NRAC 1T0FA 1SD4A 1I1SA 3KEOA 1LNWA 1HBXG 1I6XA 3RI4A 4ENJA 2EV6A 1IW7F 2HR3A 5LHIA 4EQQA 3P7NA 3J7AO 5ED4A 4KIFA 4LGWA 5ICFA 2MD5A 2H6CA 5F64A 1RZ4A 4MEYF 5DD4A 4IPAA 2HZTA 1FSEA 3I71A 5EEHA 2O0YA 2X4HA 3U9GA 4BYYA 4EJUA 2UXXA 3OV8A 2MLKA 2XROA 4CGZA 1YS6A 2ZXJA 4BNCA 3C3WA 1EH7A 4EJWA 4OMYA 2VN2A 5E1ZB 2EFOA 1ZREA 3KEQA 2DFIA 2PFBA 1T6SA 2WV0A 1XMKA 2W85A 4UVAA 1O3TA 3Q9VA 2JPBA 4A5NA 4N9HA 3U2RA 2DLLA 3LA3A 1RUNA 5LRRA 1YFHA 4WF2A 3DKWA 1BN5A 4A6EA 5J6XA 2W84A 5E8GA 2GA2A 2EA2A 3L7WA 1B59A 4KUMA 2IT0A 2V6CA 2OU2A 1LEAA 2JZYA 1IN4A 2M5WA 3FXQA 5D5VB 2NNNA 3HRTA 2ZMEA 4RB0A 2P5KA 5D6EA 3BPVA 4Q48A 3ZMUA 2O61A 3I59A 1G3TA 3R6SA 2FBKA 1YLFA 1QQIA 4D0PA 4BQAA 3GWZA 2JPCA 4AIHA 3E3VA 1T98A 1ZHFA 2CWEA 4ETSA 3FF5A 3GUDA 1S7AA 3FWEA 4ZYGA 2XUBA 2ZMEB 1XDUA 4IVNA 2XGXA 1SMTA 2DK5A 2HWVA 1ONVA 3HYIA 2KIFA 2D1HA 2DW4A 5LGTA 3I59B 2PMHA 5HDNA 4HX8A 1XCVA 1WRJA 4HX4A 4L9NA 3WTZA 1E17A 4UV8A 3ZMTA 3VFZA 2COMA 3EUHA 4WXCA 5A2QK 1USTA 4LB5A 2MLGA 3ZPLA 2QQAA 1HKSA 1OKRA 3NQOA 3DFGA 1ZLJA 1H9GA 1UCRA 5K1YA 2AS5F 3QPTA 4EJOA 5LRSA 1EV7A 4DNCA 2K4BA 2OD5A 5E17F 2VOPA 3GFIA 1YYVA 3J80Z 1U6GA 4LD5A 1LB2A 1RNLA 4IRHA 2HKXA 1GXPA 5LHGA 1Z91A 5DCFA 3MFKA 2XAGA 2OZ6A 1B9MA 4M74A 1FBSA 2GA1A 2NS0A 3K1MA 1AOYA 3L09A 2QQBA 5FLXK 3T1BA 3FMSA 1IN8A 3O6BB 4LJZF 2JT1A 3B02A 3QU3A 3JAMZ 1IXRC 4UXNA 2QVOA 3WU0A 2ISZA 3KLNA 3D5LA 5AIQA 2HQNA 3RYPA 4XSZF 4B09A 5J8FA 1ULYA 3MAJA 2ZO4A 4WCGA 2D1VA 5BS6A 4Z2YA 1MD0A 2LF7A 1TBXA 4O5VA 2MA3A 1G3WA 3DV8A 1ZLKA 3GVAA 4U7BA 2GWRA 1I27A 1I1GA 1FYKA 3Q9SA 5ICEA 5D4SA 4UUVA 3RPUA 1R23A 1XGOA 3R61A 1CGPA 3LAJA 1L0OC 3PQKA 1SD6A 5BPIA 2Y75A 5FO5A 2ZNYA 4CICA 3CO6C 4Q5SF 1MKMA 3KP4A 6PAXA 5BMZA 4PGHA 1U8RA 2XVCA 2L4MA 1KQ8A 5ERIA 1FC3A 1Z05A 3HHGA 4QWQA 4UNOA 4N9IA 3LQRA 3ISPA 3EDPA 4BXUA 1R1VA 2ELHA 3I58A 1IN7A 4P9UA 1KQ0A 3EQLF 5BQTA 4HYEA 2IA2A 3ECHA 3RDIA 2HS5A 3U1DA 2OBPA 5HOOA 2VBXA 4YFKF 5TJJA 4HAMA 5JVTA 1S8NA 4OU0A 4PGGA 1F9NA 1FLIA 3CLOA 1PDNC 3I54A 2M30A 1SFUA 4LLNA 2ZJ2A 3TKYA 2M1BA 3KCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYI A;  2ADU A;  5J8C A;  2QZ8 A;  1OPC A;  1WKM A;  3K2Z A;  4G94 A;  1R1U A;  5CLS A;  1LVA A;  1K6O A;  4N0B A;  3L2C A;  1HW2 A;  2J5O A;  3G3Z A;  5LGN A;  5FGM A;  4OMZ A;  4XLN F;  3L9F A;  5ICG A;  1PP7 U;  1LJ9 A;  3KE2 A;  2HKO A;  4HF0 A;  4HW0 A;  3R0J A;  3LST A;  2X0L A;  4KT5 C;  4KA4 A;  2BYV E;  2Q2E A;  1USS A;  2P8T A;  3KLO A;  2XKO A;  1TNS A;  2ACJ A;  3BOQ A;  2B0L A;  5IT9 Z;  2IRF G;  1S3J A;  1DPU A;  3JW4 A;  3GEZ A;  4RGS A;  4JK1 X;  1J59 A;  4OIN F;  1BC7 C;  2FNA A;  3VEP A;  3HTU A;  1L3L A;  3M9A A;  3WE2 A;  4WWC A;  2Z99 A;  3FXR A;  1ODD A;  3FXU A;  1B9N A;  2QLZ A;  2PI0 A;  3MCZ A;  4OOI A;  1WQ2 A;  1BJA A;  4BHC A;  2CO5 A;  1KYZ A;  5LGU A;  3QRF F;  3V7R A;  3O3K A;  4A12 A;  2Q0O A;  5CJ9 A;  4HQE A;  3ABU A;  3IRR A;  1O3S A;  1U78 A;  1TNT A;  3V8J A;  2V1U A;  2OQG A;  3HTS B;  1JGS A;  4UVB A;  1HST A;  1LDJ A;  4PZJ A;  3ZMD A;  4LLL A;  2P7V B;  4I2O A;  2W24 A;  2QQ9 A;  4LFU A;  1EH8 A;  1QZY A;  5F6F A;  3E5Q A;  2XRN A;  3F72 A;  2E1C A;  2YU3 A;  1P4A A;  1FNN A;  1DPR A;  2HDC A;  2L02 A;  5L3C A;  5AON A;  5CVJ A;  1H0M A;  3MEX A;  3E6M A;  5D5W B;  5L3F A;  3G73 A;  5CVR A;  5DD8 A;  2GXG A;  5K5O A;  2ESN A;  2YPR A;  1K78 A;  1S29 A;  2A5Y B;  4R79 A;  3FX3 A;  2XV4 S;  1MDM A;  1G3S A;  4WX9 A;  1P92 A;  1ZAR A;  5DUI A;  2KKO A;  1MJ9 A;  4O3M A;  4A6D A;  1W5S A;  5HVQ C;  3BRO A;  5HS7 A;  5CVU A;  1G4D A;  1P2F A;  2A68 F;  3TOB A;  2VOO A;  5E18 F;  5H6Q A;  3C7J A;  2FSW A;  4GO1 A;  4FHT A;  1K78 B;  3IWZ A;  3WTS C;  4JQF A;  4Y17 A;  3JTG A;  1IN5 A;  1MDM B;  2YX7 A;  3BY6 A;  3F6O A;  3K69 A;  1REP C;  4LG0 A;  1LQ1 A;  3QU6 A;  1A04 A;  2XIG A;  3T0Y A;  4A0Z A;  4CO8 A;  3F23 A;  1MGT A;  2VON A;  2UXN A;  5E1W A;  5HLI A;  1QGP A;  1R00 A;  3RYR A;  3HSF A;  3T8T A;  1T2K A;  1Z7U A;  4IJA A;  2XAF A;  2K02 A;  1TW2 A;  3BP8 A;  4LK1 F;  4M9X A;  3LA7 A;  3E6C C;  1FYL A;  4LG0 B;  2ISY A;  2NNY A;  4R1H A;  2QM3 A;  4RB2 C;  2FBI A;  1OR7 A;  4MTE A;  4IRG A;  2IA0 A;  1FSH A;  4GCV A;  4UVC A;  3ZMV A;  3M8F A;  2P6T A;  4I01 A;  5LLQ A;  3RTR A;  1VTN C;  1HQC A;  2E1N A;  1R5G A;  5JFR A;  1IN6 A;  4L9T A;  2AXL A;  5D8K B;  2DAO A;  3H92 A;  3MQ0 A;  2PG4 A;  2VE8 A;  4S05 A;  3SFZ A;  4EGY A;  2HTS A;  4OIR F;  3HUG A;  4Q47 A;  1FBQ A;  1XDS A;  2A61 A;  4KFC A;  3NEU A;  4DQ2 A;  4OIO F;  3I53 A;  4ENK A;  5KVR A;  4ENN A;  1YTY A;  4HF1 A;  2JTV A;  4CDG A;  3WTY C;  1BC8 C;  5DYM A;  3IWF A;  5CYV A;  2VBY A;  1IXS B;  2CW0 F;  4TV7 A;  4MTD A;  1J9I A;  4ZYD A;  4UV9 A;  2FF4 A;  2UZK A;  3P9C A;  5JR3 A;  4U88 A;  2J5P A;  2KIU A;  1R58 A;  1HSJ A;  2BBY A;  3BZ6 A;  5CVI A;  2LNB A;  5FD6 A;  4F7Z A;  1ZRD A;  3J81 K;  4I7H A;  2EV5 A;  2HQR A;  2W57 A;  4LMY A;  3GYH X;  5H20 A;  2QBY A;  2FA5 A;  2K7L A;  1B4A A;  2G9W A;  3BWG A;  2M45 A;  2M87 A;  2DU9 A;  1BIB A;  3WGI A;  4RGU A;  2A69 F;  1HKT A;  5LEJ A;  2HTJ A;  4HF2 A;  4HZF A;  5ILU A;  3F21 A;  3RJP A;  2C6Y A;  4ZYH A;  4L0Y B;  2R7F A;  4YII A;  3GZ6 A;  1KU9 A;  1O3R A;  2EFN A;  1ZRC A;  1FT9 A;  1GHC A;  4MEX F;  1ZN2 A;  2QBY B;  3CUQ C;  3KP3 A;  5JI6 A;  2P5V A;  4KMU X;  1YW7 A;  4HX7 A;  3F8M A;  4IHT A;  3V7S A;  5DCM A;  1SD5 A;  1V3F A;  1T39 A;  1V4R A;  3F8N A;  4IHS A;  2EA4 A;  4GGG A;  4RB3 C;  3EYY A;  4UHT A;  2ETH A;  4AWX B;  3KP6 A;  3VOD A;  4E70 A;  2VT3 A;  1P4X A;  3RPQ A;  1O7F A;  1U5T A;  2K86 A;  1F5T A;  3V4G A;  4U0Y A;  3QPH A;  2KJC A;  4LB6 B;  5DCM B;  4CHU A;  1JE8 A;  1U2W A;  2NYX A;  3KZZ A;  1D3Y A;  3CDH A;  2BEO A;  5L3D A;  4GXO A;  2RKH A;  1R7J A;  1TQI A;  3B73 A;  3PFI A;  2WWY A;  3BJO A;  4XSX F;  1HW1 A;  5IT3 A;  4I02 A;  4XLP F;  4ZYE A;  1TW3 A;  4Q4Z F;  1R36 A;  1U5T B;  5DEQ A;  1OMI A;  4M73 A;  3ELK A;  3GZ5 A;  5K5R A;  1IRG A;  3WG9 A;  1DP7 P;  1QNT A;  1XCB A;  1WSU A;  4KIC A;  2HOE A;  4WXD A;  2F2E A;  1GVJ A;  1K79 A;  5F1R A;  2VBZ A;  4XBF A;  2IVM A;  3KP2 A;  1PUE E;  4K2E A;  3TOA A;  2L4A A;  2IPQ X;  2V79 A;  1ON1 A;  3W6J B;  2D2W A;  2FXA A;  1Z6R A;  1S7O A;  2QWW A;  2PBI A;  2Q8K A;  3WU1 B;  2YR2 A;  2P7C B;  1Z1D A;  3JSO A;  2LSO A;  4ENM A;  1J5Y A;  1BI1 A;  3F8C A;  1ZGJ A;  1E2X A;  3F6V A;  2G7H A;  2HEO A;  4MGR A;  4RGR A;  3FMR A;  1Q1H A;  5AIP A;  4CZZ A;  5ICC A;  2Y0M A;  3HSR A;  3ZN1 A;  2DI3 A;  3W6K B;  4O6J A;  2YX4 A;  5EEG A;  1JHH A;  2VOD A;  1D8J A;  3M8E A;  4KIB A;  4G7H F;  3ERE D;  1K7A A;  1B1B A;  5FFZ A;  4P55 A;  3J80 K;  2L54 A;  3P9I A;  2STW A;  2VC1 A;  4ASN A;  2Y48 A;  3F22 A;  3LAP A;  2BGC A;  2EWN A;  3P9K A;  3ZMZ A;  4ZZD A;  2Z9O A;  2F5C A;  2RNJ A;  4AD9 A;  1XSX A;  2CG4 A;  1ZG5 A;  2QEN A;  2HYG D;  2H27 A;  3IKT A;  3WOD F;  3JAM K;  1YO5 C;  1ZAO A;  4EJT A;  5HS9 A;  2ZCW A;  1MJA A;  4I09 A;  3ULQ B;  2D45 A;  5FD5 A;  1IF1 A;  1FY7 A;  3EYI A;  3TGN A;  3ROU A;  3M1E A;  2XAH A;  3K1N A;  4G8X A;  2A6H F;  4WXH A;  2FE3 A;  3CUO A;  3F8F A;  2RGV A;  2O3F A;  1Z9C A;  4AVP A;  3FHZ A;  5HLG A;  4HV6 A;  2LF8 A;  1SAX A;  1T38 A;  5D4R A;  1XGS A;  3V8L A;  1DDN A;  4EV0 A;  4ZH4 F;  1IZ1 A;  4G9Y A;  1P4W A;  2DT5 A;  2EFQ A;  4IRI A;  1B6A A;  2HGC A;  1BBY A;  3E97 A;  2QYO A;  3IKV A;  3C1D A;  4GYG A;  2HFH A;  5D8L B;  1UHM A;  4EGZ A;  4L5J A;  3I4P A;  2EV0 A;  5E1X A;  3HRM A;  2FMY A;  2DQR A;  1RI7 A;  5E8I A;  1XGN A;  2FEZ A;  1S6L A;  3BPX A;  2A3S A;  1I5Z A;  4NHJ A;  1NHA A;  4NB5 A;  1XB4 A;  3DPT A;  4A5M A;  4CYD A;  3MZY A;  3ZN0 A;  4QLC U;  3L00 A;  3KZY A;  4HV5 A;  3LA2 A;  1C0W A;  1ZG1 A;  1TQM A;  2W25 A;  3NRV A;  2H09 A;  1D5V A;  1ZG3 A;  1ZH5 A;  2NAZ A;  3DP7 A;  1CF7 A;  4EM0 B;  4LK0 F;  3I0T A;  5DUK A;  4NQW A;  4R8H A;  4HLX A;  5A2Q Z;  3JSP A;  1ZRF A;  3R4K A;  3E5U A;  4G7O F;  3KP5 A;  4EM1 A;  3N97 A;  3GW2 A;  5H6R A;  3CJN A;  4Y15 A;  4MQ9 F;  2BE5 F;  4P5O A;  2FQ3 A;  3KFW X;  4HA8 A;  3HRU A;  1WWX A;  1RIO H;  4M6Y A;  3TO9 A;  3SQN A;  5HS8 A;  4ESF A;  1J7K A;  3HRS A;  2F5F A;  3SXY A;  3QAH A;  1CF7 B;  3RKX A;  2VC0 A;  1BIA A;  1KU2 A;  3DQV C;  4M9S A;  3MWM A;  2Z3Y A;  3GFL A;  2O6G E;  2DBB A;  2E7X A;  1TQP A;  3IC7 A;  3WGH A;  4L5I A;  5IT9 K;  5FLX Z;  1JHF A;  5L3B A;  1XSD A;  5HLH A;  1O7L A;  2KJB A;  1GXQ A;  2MH2 A;  1FP1 D;  2FML A;  4CXF A;  3EET A;  2EFW A;  2P4W A;  4M9Z A;  1XMA A;  2FRH A;  3RIR A;  3VB2 A;  1U3E M;  3KP7 A;  5K5Q A;  2V1X A;  2IP2 A;  2PJP A;  5LBQ A;  5L3E A;  2RV8 A;  3GFJ A;  4L9V A;  3RKY A;  1YIO A;  3M7G A;  1JXS A;  2H6B A;  3C18 A;  2DQL A;  2GQQ A;  1STZ A;  1FBU A;  2ESH A;  1EH6 A;  1FWZ A;  1AWC A;  2FNP A;  4OIP F;  2P6S A;  1WI9 A;  1R1T A;  2XHK A;  2VT2 A;  4G7Z F;  1XN7 A;  3E6D A;  2O03 A;  3TQN A;  2IJL A;  3IHU A;  3ECO A;  3K0L A;  4AIJ A;  1YW8 A;  2VE9 A;  2LDU A;  3S2W A;  2QUF A;  1BI3 A;  1ZYR F;  2TDX A;  3ZP5 A;  3HOT A;  4M72 A;  1QZZ A;  4ESJ A;  1G3Y A;  4M6X A;  3DEU A;  4P9F A;  4YIF A;  5ILV A;  3QP5 A;  4EM2 A;  4KNY A;  1DUX C;  4G6Q A;  4U0V A;  3H3Z A;  1YW9 A;  4KN4 X;  4L0Z B;  2VBW A;  2RN7 A;  3WTT C;  1KU3 A;  4HLY A;  2ZNZ A;  2XAJ A;  1KU7 A;  2CFX A;  4IF4 A;  1LEB A;  3LFK A;  1HKQ A;  3R0A A;  1FX7 A;  1FYM A;  2A07 F;  2GIV A;  4MNU A;  3WTV C;  3GF2 A;  2OA4 A;  1YQA A;  1UB9 A;  3Q5F A;  4MQV A;  3BJA A;  4L18 B;  4YG2 F;  3N4M A;  4JBA A;  1FP2 A;  4B8X A;  5D6F A;  3K9T A;  4FX0 A;  2GAU A;  5KK1 A;  4RAZ A;  2DTR A;  5FFX A;  3IL2 A;  4KIG A;  2V9V A;  3V7C A;  4ESB A;  2L3D A;  4RS8 A;  3HOS A;  2DK8 A;  3T8R A;  2GXB A;  3CUQ A;  4HDV A;  2MH9 A;  3H3U A;  5D5X B;  1TLH B;  1U5T C;  1FPQ A;  3WTW C;  4HDU A;  2F5D A;  1HXD A;  4Y13 A;  2EJR A;  3WGG A;  2IA1 A;  1Y0U A;  1Z6T A;  1FZP B;  2Z5U A;  3RKW A;  3WE3 A;  4U7D A;  3E6B A;  3T5X A;  1LDK B;  3TO6 A;  3WTU C;  2GZW A;  3HSE A;  2DPU A;  1SFE A;  1PP8 F;  2KIM A;  3CUQ B;  3ZQ7 A;  3VOE A;  3KET A;  2WTE A;  2O8X A;  1SD7 A;  3V8K A;  3ML6 A;  2EFP A;  1W7P D;  2L01 A;  4KDP A;  1J0R A;  1BOA A;  2DO7 A;  1F4K A;  2PEX A;  3DXJ F;  3ABT A;  3GX4 X;  4FX4 A;  2F5E A;  3O2P E;  1KQ9 A;  4IXA A;  1R22 A;  3SZP A;  2FOK A;  2BV6 A;  1OYW A;  3F8B A;  3BJ6 A;  2YSR A;  3FZV A;  3AAF A;  4I0A A;  4L9J A;  2FU4 A;  3MZH A;  1IRF A;  3SZT A;  1UHW A;  3K1P A;  1BI2 A;  3GFM A;  5ILS A;  1O3Q A;  4BAY A;  5CVV A;  1IAW A;  3TDZ C;  2PQ8 A;  1J75 A;  1BI0 A;  5TRD A;  5HDK A;  2RDP A;  2KRF A;  2PMU A;  1XD7 A;  2EK5 A;  2K4J A;  1QBJ A;  2IW5 A;  3HIF A;  2CQK A;  4A0X A;  2XAQ A;  4G6D A;  2V1D A;  2RC4 A;  3TDU C;  1ON2 A;  1XGM A;  1W4M A;  2OQR A;  4I0B A;  2PLY A;  4ZZL A;  4RB1 A;  4XRF A;  3DPL C;  1F1Z A;  2DPD A;  4PDK A;  4LLG F;  5JHU A;  2FBH A;  2P5L C;  3FM3 A;  2JSC A;  3GXO A;  1TTY A;  1OYY A;  3BDD A;  4BHP A;  3WTX C;  3I5U A;  1KA8 A;  1W5T A;  4S04 A;  1P6R A;  3I64 A;  5HDG A;  2RQP A;  2E7W A;  1FOK A;  3FM5 A;  3PQJ A;  2PN6 A;  5BPD A;  2H94 A;  3QOP A;  1MJB A;  4HQM A;  2K27 A;  4FT8 A;  4HOB A;  4GYI A;  1IXC A;  3LWF A;  2WC2 A;  4MHG A;  1XSV A;  2EB7 A;  2XAS A;  1G6N A;  5L3G A;  4BHB A;  4A0Y A;  1O57 A;  2OZU A;  2UWM A;  2OAZ A;  3IRQ A;  2M8E A;  4EMS A;  1SMY F;  2ZKZ A;  4P96 A;  4H0E A;  1W7P A;  1IUY A;  3QP6 A;  3HHH A;  4BH9 A;  2HYF A;  2CGP A;  4OIQ F;  1MZB A;  1BM9 A;  1HW5 A;  2MC3 A;  4KMF A;  1UFM A;  3OOP A;  3GO5 A;  4KN7 X;  2ZFW A;  4A2U A;  2R7D A;  5DDG A;  4HBL A;  3R60 A;  2VXZ A;  2CSO A;  2JRT A;  5BOX A;  1W7P B;  4I98 B;  4RAY A;  1QPM A;  5DV5 A;  3COA C;  2XKP A;  4KYW A;  5D5U B;  2G7U A;  3ZMS A;  1RUO A;  1YS7 A;  3F3X A;  5FB2 A;  4RGX A;  3CO7 C;  1R5H A;  4ON0 A;  4AIK A;  1SFX A;  1QO0 D;  3SHF A;  3REO A;  5E20 A;  1H9T A;  2CYY A;  3E5X A;  1D8K A;  1ZGA A;  1X3U A;  2LKP A;  5LHH A;  3J81 Z;  1LDD A;  4YFN F;  4YFX F;  2STT A;  4PCQ A;  2MBF A;  3CTA A;  1J2X A;  4WK8 F;  3GLX A;  4EVI A;  1KGS A;  4M71 A;  4U0W A;  3DF8 A;  2R3S A;  3JTH A;  1YG2 A;  1KYW A;  2Z33 A;  3LQQ A;  2A6E F;  3TO7 A;  3FMQ A;  5LEK A;  2ZBK A;  3D0S A;  4EJV A;  2RVC A;  2NRA C;  1T0F A;  1SD4 A;  1I1S A;  3KEO A;  1LNW A;  1HBX G;  1I6X A;  3RI4 A;  4ENJ A;  2EV6 A;  1IW7 F;  2HR3 A;  5LHI A;  4EQQ A;  3P7N A;  3J7A O;  5ED4 A;  4KIF A;  4LGW A;  5ICF A;  2MD5 A;  2H6C A;  5F64 A;  1RZ4 A;  4MEY F;  5DD4 A;  4IPA A;  2HZT A;  1FSE A;  3I71 A;  5EEH A;  2O0Y A;  2X4H A;  3U9G A;  4BYY A;  4EJU A;  2UXX A;  3OV8 A;  2MLK A;  2XRO A;  4CGZ A;  1YS6 A;  2ZXJ A;  4BNC A;  3C3W A;  1EH7 A;  4EJW A;  4OMY A;  2VN2 A;  5E1Z B;  2EFO A;  1ZRE A;  3KEQ A;  2DFI A;  2PFB A;  1T6S A;  2WV0 A;  1XMK A;  2W85 A;  4UVA A;  1O3T A;  3Q9V A;  2JPB A;  4A5N A;  4N9H A;  3U2R A;  2DLL A;  3LA3 A;  1RUN A;  5LRR A;  1YFH A;  4WF2 A;  3DKW A;  1BN5 A;  4A6E A;  5J6X A;  2W84 A;  5E8G A;  2GA2 A;  2EA2 A;  3L7W A;  1B59 A;  4KUM A;  2IT0 A;  2V6C A;  2OU2 A;  1LEA A;  2JZY A;  1IN4 A;  2M5W A;  3FXQ A;  5D5V B;  2NNN A;  3HRT A;  2ZME A;  4RB0 A;  2P5K A;  5D6E A;  3BPV A;  4Q48 A;  3ZMU A;  2O61 A;  3I59 A;  1G3T A;  3R6S A;  2FBK A;  1YLF A;  1QQI A;  4D0P A;  4BQA A;  3GWZ A;  2JPC A;  4AIH A;  3E3V A;  1T98 A;  1ZHF A;  2CWE A;  4ETS A;  3FF5 A;  3GUD A;  1S7A A;  3FWE A;  4ZYG A;  2XUB A;  2ZME B;  1XDU A;  4IVN A;  2XGX A;  1SMT A;  2DK5 A;  2HWV A;  1ONV A;  3HYI A;  2KIF A;  2D1H A;  2DW4 A;  5LGT A;  3I59 B;  2PMH A;  5HDN A;  4HX8 A;  1XCV A;  1WRJ A;  4HX4 A;  4L9N A;  3WTZ A;  1E17 A;  4UV8 A;  3ZMT A;  3VFZ A;  2COM A;  3EUH A;  4WXC A;  5A2Q K;  1UST A;  4LB5 A;  2MLG A;  3ZPL A;  2QQA A;  1HKS A;  1OKR A;  3NQO A;  3DFG A;  1ZLJ A;  1H9G A;  1UCR A;  5K1Y A;  2AS5 F;  3QPT A;  4EJO A;  5LRS A;  1EV7 A;  4DNC A;  2K4B A;  2OD5 A;  5E17 F;  2VOP A;  3GFI A;  1YYV A;  3J80 Z;  1U6G A;  4LD5 A;  1LB2 A;  1RNL A;  4IRH A;  2HKX A;  1GXP A;  5LHG A;  1Z91 A;  5DCF A;  3MFK A;  2XAG A;  2OZ6 A;  1B9M A;  4M74 A;  1FBS A;  2GA1 A;  2NS0 A;  3K1M A;  1AOY A;  3L09 A;  2QQB A;  5FLX K;  3T1B A;  3FMS A;  1IN8 A;  3O6B B;  4LJZ F;  2JT1 A;  3B02 A;  3QU3 A;  3JAM Z;  1IXR C;  4UXN A;  2QVO A;  3WU0 A;  2ISZ A;  3KLN A;  3D5L A;  5AIQ A;  2HQN A;  3RYP A;  4XSZ F;  4B09 A;  5J8F A;  1ULY A;  3MAJ A;  2ZO4 A;  4WCG A;  2D1V A;  5BS6 A;  4Z2Y A;  1MD0 A;  2LF7 A;  1TBX A;  4O5V A;  2MA3 A;  1G3W A;  3DV8 A;  1ZLK A;  3GVA A;  4U7B A;  2GWR A;  1I27 A;  1I1G A;  1FYK A;  3Q9S A;  5ICE A;  5D4S A;  4UUV A;  3RPU A;  1R23 A;  1XGO A;  3R61 A;  1CGP A;  3LAJ A;  1L0O C;  3PQK A;  1SD6 A;  5BPI A;  2Y75 A;  5FO5 A;  2ZNY A;  4CIC A;  3CO6 C;  4Q5S F;  1MKM A;  3KP4 A;  6PAX A;  5BMZ A;  4PGH A;  1U8R A;  2XVC A;  2L4M A;  1KQ8 A;  5ERI A;  1FC3 A;  1Z05 A;  3HHG A;  4QWQ A;  4UNO A;  4N9I A;  3LQR A;  3ISP A;  3EDP A;  4BXU A;  1R1V A;  2ELH A;  3I58 A;  1IN7 A;  4P9U A;  1KQ0 A;  3EQL F;  5BQT A;  4HYE A;  2IA2 A;  3ECH A;  3RDI A;  2HS5 A;  3U1D A;  2OBP A;  5HOO A;  2VBX A;  4YFK F;  5TJJ A;  4HAM A;  5JVT A;  1S8N A;  4OU0 A;  4PGG A;  1F9N A;  1FLI A;  3CLO A;  1PDN C;  3I54 A;  2M30 A;  1SFU A;  4LLN A;  2ZJ2 A;  3TKY A;  2M1B A;  3KCC A; 
#chains in the Genus database with same CATH topology
 1OYI A;  3LSK A;  3ZR8 X;  2ADU A;  5J8C A;  2E35 A;  2QZ8 A;  4AUX A;  2WAQ N;  3J7A Y;  1OPC A;  1ETO A;  3L2R A;  1WKM A;  3K2Z A;  4G94 A;  9ANT A;  3S1Q J;  1R1U A;  2CUJ A;  4XR6 A;  5CLS A;  1LVA A;  1K6O A;  4N0B A;  2I10 A;  3L2C A;  1HW2 A;  2J5O A;  3G3Z A;  3HGY A;  5LGN A;  5FGM A;  4OMZ A;  4XLN F;  2X51 A;  2DMU A;  4DZP A;  1HA8 A;  3L9F A;  5ICG A;  2K9S A;  2VAS A;  4ZDL A;  1FEX A;  1TL8 A;  2IEK A;  2FJ1 A;  1PP7 U;  1LJ9 A;  1TWC J;  3KE2 A;  1HDP A;  2HKO A;  4HF0 A;  4Y52 J;  4BE0 A;  4HW0 A;  3R0J A;  2ZXI A;  2A6T A;  1RKW A;  3LST A;  4LIU A;  2X0L A;  1VQ6 I;  4KT5 C;  4KA4 A;  5CKT A;  2BYV E;  1IUF A;  2Q2E A;  2HVR A;  3GME A;  1USS A;  2P8T A;  3KLO A;  2R7O A;  2XKO A;  1M1E B;  1TNS A;  2NXN B;  2ACJ A;  1P7J A;  3BOQ A;  2CUZ A;  5DM7 F;  2B0L A;  5IT9 Z;  1YX5 A;  2L7Z A;  2L9V A;  4X1E A;  2IRF G;  1S3J A;  3BTL A;  3CD6 I;  3CF5 F;  1DPU A;  1GDT A;  3JW4 A;  3QOE A;  3GEZ A;  4RGS A;  4JK1 X;  4CCO A;  3J7Y J;  1J59 A;  4OIN F;  3CF2 A;  2PMZ A;  1BC7 C;  2FNA A;  3CCE I;  3VEP A;  3HTU A;  2BW3 A;  2R7Q A;  1L3L A;  1S72 I;  3JRF A;  3M9A A;  3WE2 A;  4WWC A;  2DOF A;  2Z99 A;  3FXR A;  1HCR A;  1ODD A;  2AXT C;  2MFZ A;  3FXU A;  1BR2 A;  4F92 B;  3S15 J;  1XG1 A;  2CW7 A;  3HDD A;  1B9N A;  2QLZ A;  3SJM A;  2PI0 A;  3MCZ A;  4DYQ A;  2QKL B;  4OOI A;  2OJE D;  3K6G A;  5KCM A;  1WQ2 A;  4JYK A;  2JSP A;  2EIK H;  3DU5 A;  3OS2 A;  2OPT A;  1BJA A;  1P9Q C;  4YEL A;  3VPR A;  4BHC A;  2CO5 A;  1NH3 A;  1HOM A;  2ECB A;  1KYZ A;  4M3E A;  5LGU A;  3CDI A;  5J47 A;  4FIS A;  1A36 A;  5FKL A;  2QQ8 A;  3QRF F;  3V7R A;  3O3K A;  4A12 A;  2Q0O A;  2DN0 A;  3GTO J;  2BY3 A;  5CJ9 A;  4HQE A;  2E2H J;  3ABU A;  3IRR A;  3LOC A;  1O3S A;  1E3H A;  1MSF C;  1U78 A;  2BW3 B;  1TNT A;  3BR3 A;  4JX6 A;  3V8J A;  1QHH D;  2V1U A;  2OQG A;  3FHN A;  2MC4 A;  1FIP A;  3HTS B;  1JGS A;  4UVB A;  2VQL A;  1HST A;  1D0Z A;  3WHB A;  1LDJ A;  1B8I A;  4PZJ A;  4IHW A;  1A6I A;  3ZMD A;  4BJ6 C;  2JA7 J;  1VQ4 I;  4LLL A;  4BJT A;  4XON A;  2O7O A;  5E3O A;  2EIL H;  1X1D A;  2P7V B;  2COB A;  4OAZ A;  4I2O A;  2W24 A;  2QQ9 A;  4LFU A;  1EH8 A;  1QZY A;  5F6F A;  1MIJ A;  3E5Q A;  2XRN A;  2VQH A;  3F72 A;  2E1C A;  2HYJ A;  3OMY A;  4IX7 A;  2YU3 A;  1P4A A;  5HLT A;  2R4G A;  1FNN A;  3MKW B;  1DPR A;  1XPX A;  2HDC A;  2L02 A;  1B72 A;  5L3C A;  1WH7 A;  4XNF A;  3BG3 A;  5CVJ A;  5AON A;  4C3H J;  1MMD A;  1H0M A;  2KIQ A;  3MEX A;  4G6T B;  1B8I B;  2M34 A;  2VLA A;  2DFH A;  3OOU A;  3E6M A;  3RQ4 A;  5D5W B;  5L3F A;  3G73 A;  1KON A;  1SFK A;  2KZV A;  1YIJ I;  3LSM A;  5CVR A;  4YEJ A;  5DD8 A;  2GXG A;  5B1B H;  4BBS J;  5K5O A;  2ESN A;  2YPR A;  1K78 A;  3X2Q H;  1S29 A;  4E7S A;  2A5Y B;  3F9K A;  4R79 A;  2M0C A;  4RM2 A;  2DXI A;  3FX3 A;  2XV4 S;  3CQZ J;  5GPC A;  2IGK A;  3CJR B;  1WJ5 A;  4HRI A;  4IKF A;  3P5J A;  1MDM A;  2E2J J;  1G3S A;  2Y9Y A;  4WX9 A;  3RCO A;  1P92 A;  1B72 B;  1ZAR A;  5DUI A;  2KKO A;  1MJ9 A;  3HOV J;  4O3M A;  1PVE A;  4A6D A;  1W5S A;  3BQY A;  5HVQ C;  2KHM A;  5B3S H;  3BRO A;  1ETQ A;  5HS7 A;  4GRI A;  5CVU A;  1G4D A;  1P2F A;  3HOW J;  2A68 F;  3IAS 2;  1BW5 A;  3TOB A;  2VOO A;  2X1D A;  5E18 F;  3BTI A;  5H6Q A;  3C7J A;  1IV6 A;  1Z3X A;  2FSW A;  4GO1 A;  4FHT A;  1MBK A;  4XK4 A;  1K78 B;  2VUM J;  2MG4 A;  3HEF A;  3CZ6 A;  3IWZ A;  4U87 A;  5J4V A;  3WTS C;  3AL0 B;  3MKZ A;  4JQF A;  4Y17 A;  1WJA A;  3JTG A;  1IN5 A;  4F93 B;  1MDM B;  4BXX J;  2YX7 A;  3FBI B;  1YI2 I;  1Z67 A;  3BY6 A;  2ICW G;  5IYB J;  3F6O A;  3K69 A;  2EZH A;  1REP C;  2NVT J;  4LG0 A;  1LQ1 A;  2R5Y A;  1VND A;  2MW8 A;  3QU6 A;  2PMZ N;  1A04 A;  2XIG A;  4XOR A;  3T0Y A;  4A0Z A;  4CO8 A;  2L2O A;  3F23 A;  1MGT A;  5IOZ A;  2XSJ C;  2VON A;  2UXN A;  1T33 A;  5E1W A;  2ZJQ F;  5HLI A;  1YE9 A;  1QGP A;  2BY2 A;  1R00 A;  3DCF A;  2DCE A;  2QGU A;  4QTR A;  1PUF A;  4KIT B;  2B9S A;  1T8I A;  4AYB N;  2QF7 A;  4IOA F;  3RYR A;  1WH5 A;  3HSF A;  3T8T A;  3CC2 I;  1T2K A;  4ZDO A;  3ESW B;  1Z7U A;  3OYG A;  2VB6 A;  4IJA A;  1Y39 A;  2HOS A;  2XAF A;  2K02 A;  1TW2 A;  3BP8 A;  4LK1 F;  4M9X A;  3LA7 A;  3E6C C;  1U0J A;  1FYL A;  1HC8 A;  1MND A;  4LG0 B;  2ISY A;  2NNY A;  2R5Y B;  4R1H A;  1TZL A;  2QM3 A;  3D5S C;  4RB2 C;  2FBI A;  1OR7 A;  1LUJ B;  2JJ7 A;  4MTE A;  4IRG A;  2IA0 A;  1WFX A;  5IP9 J;  1FSH A;  4GCV A;  4UVC A;  3ZMV A;  2LTP A;  3M8F A;  2E5N A;  3OY9 A;  2LD5 A;  2DMN A;  2V9K A;  3KYL A;  1PUF B;  2P6T A;  3K4J A;  4I01 A;  3CCU I;  5LLQ A;  2K3P A;  3RTR A;  1VTN C;  3PFY A;  2CV1 A;  1HQC A;  2K9L A;  5FKM A;  2CJJ A;  2E1N A;  1R5G A;  1W1W E;  5JFR A;  3CME I;  1JKR C;  1Z21 A;  5GPA A;  2LH9 A;  4BAC A;  1IN6 A;  4L9T A;  2AXL A;  5D8K B;  4RAF A;  2DAO A;  3H92 A;  3MQ0 A;  2CH0 A;  2PG4 A;  2VE8 A;  2GXA A;  4S05 A;  3SFZ A;  3SYT A;  4EGY A;  2HTS A;  4OIR F;  3HUG A;  4Q47 A;  1K83 J;  1FBQ A;  3GTP J;  3A02 A;  1XDS A;  2A61 A;  4KFC A;  3NEU A;  2TRT A;  4DQ2 A;  4HSR A;  2VKH A;  2NVX J;  4ZJZ A;  1R4M B;  4OIO F;  3M8J A;  3I53 A;  3Q0W A;  4ENK A;  5KVR A;  1XS9 A;  4ENN A;  4D9J A;  1YTY A;  3DWL E;  4NDL A;  3J7Z I;  2QA4 I;  2CW8 A;  4HF1 A;  2CQ7 A;  2JTV A;  3TED A;  4CDG A;  4B3X A;  3WTY C;  1BC8 C;  5DYM A;  3IWF A;  1YHQ I;  5CYV A;  2VBY A;  1IXS B;  4DW6 A;  5EZG A;  2CW0 F;  4TV7 A;  1N77 A;  4MTD A;  4C9Y A;  2WY7 Q;  1J9I A;  2Z1D A;  4ZYD A;  2LP0 A;  4UV9 A;  2FF4 A;  1U8B A;  3H9Q A;  3HUG B;  1HLV A;  1OQY A;  2LY9 A;  1WJB A;  5DTD A;  3HOZ J;  4PSX A;  2UZK A;  1J09 A;  2RQQ A;  3P9C A;  4XL9 A;  5JR3 A;  3OSF A;  4U88 A;  5IOY A;  2J5P A;  2KIU A;  1R58 A;  1HSJ A;  4IOC F;  1JI8 A;  5H2F C;  2BBY A;  4GDF A;  3BZ6 A;  5CVI A;  3G1L A;  1YX3 A;  2LNB A;  5FD6 A;  2OTL I;  4AM3 A;  4F7Z A;  1ZRD A;  5JVG F;  5FKK A;  3J81 K;  2EIJ H;  4I7H A;  1K4S A;  2EV5 A;  2HQR A;  2W57 A;  4LMY A;  4HNU A;  3IUO A;  3VYT B;  5H20 A;  2W48 A;  3GYH X;  2QBY A;  2FA5 A;  2K7L A;  1MMS A;  1B4A A;  1VQO I;  2G9W A;  3BWG A;  3JRB A;  1I3A A;  4Y4R A;  2M45 A;  2M87 A;  4JOM A;  2DU9 A;  1IC8 A;  1BIB A;  3WGI A;  3D5R C;  4RGU A;  2A69 F;  3CCS I;  1K6Y A;  1HKT A;  5LEJ A;  2HTJ A;  1XX5 A;  1I39 A;  4HF2 A;  2LOO A;  2KLO A;  4HZF A;  5ILU A;  3CCL I;  3F21 A;  3OS1 A;  3RJP A;  1LFU P;  3BZK A;  3A03 A;  2C6Y A;  4Y3O A;  4ZYH A;  2R7F A;  3JRE A;  4YII A;  4L0Y B;  3FXK A;  3QPL A;  4JX4 A;  3ASO H;  2IXS A;  3GZ6 A;  1KU9 A;  4W97 A;  1O3R A;  1U9N A;  2EFN A;  1ZRC A;  4A3D J;  1FT9 A;  4J01 A;  1GHC A;  3C2G A;  4XRS G;  3OYM A;  3ZQI A;  4MEX F;  4ZTJ A;  1ZN2 A;  4F91 B;  2IGM A;  2QBY B;  2O9L A;  5GTH C;  1E3O C;  3CUQ C;  2ZSH B;  5M5W J;  3KP3 A;  3PNT A;  3RKQ A;  4ZYA A;  5JI6 A;  3L2U A;  2LR8 A;  2P5V A;  3PSI A;  1Z7L A;  1YW7 A;  4KMU X;  3SZG A;  4HX7 A;  3GTQ J;  3F8M A;  4IHT A;  3V7S A;  4OAY A;  2VKE A;  2JVG A;  5DCM A;  2DDB A;  1SD5 A;  3I3L A;  4V2G A;  1V3F A;  3AG2 H;  1T39 A;  1V4R A;  3F8N A;  4CUG A;  2EA4 A;  4IHS A;  4GGG A;  1R5I D;  4RB3 C;  4RDU A;  3DBR B;  3EYY A;  4UHT A;  2IS6 A;  2ETH A;  2VIX A;  3PNV A;  1MMG A;  1ENH A;  1MBJ A;  3ABK H;  1X1C A;  4AWX B;  3KP6 A;  4F52 A;  3VOD A;  4E70 A;  1FTT A;  1Y1V J;  2YU9 J;  1BW6 A;  2VT3 A;  1P4X A;  4LG3 A;  3RPQ A;  1O7F A;  1U5T A;  2K86 A;  1F5T A;  4V2F A;  3V4G A;  4U0Y A;  3CP8 A;  5HNF A;  1TT5 B;  3QPH A;  4NC8 A;  3G2B A;  2LY2 A;  3W2A A;  2KJC A;  4LB6 B;  5DCM B;  4CHU A;  1JE8 A;  2Y31 A;  5EEA A;  1MMA A;  1U2W A;  2NYX A;  1OCC H;  3KZZ A;  4E6K G;  3KIO A;  2KQR A;  3K4N A;  1D3Y A;  3CDH A;  2BEO A;  3HC7 A;  5L3D A;  5TGT A;  4GXO A;  2RKH A;  1R7J A;  2BY1 A;  1TQI A;  1A35 A;  3B73 A;  3PFI A;  2ID6 A;  2KIS A;  2WWY A;  4HG2 A;  5M5Y J;  2A05 A;  3BJO A;  3Q3S A;  2DMP A;  3ABM H;  2N8G A;  4XSX F;  1HW1 A;  5IT3 A;  4I02 A;  3FIS A;  4XLP F;  4ZYE A;  1TW3 A;  3PNY A;  3HXL A;  4Q4Z F;  1R36 A;  2K9N A;  2E60 A;  1U5T B;  5DEQ A;  5GAG J;  1OMI A;  5EYR A;  4IQ4 A;  3LSH A;  4M73 A;  4B43 A;  5EGO A;  1LPQ A;  2PX9 A;  3ELK A;  4NBQ A;  3CC7 I;  3OL4 A;  2Z16 A;  3EUK L;  3DTK A;  5J40 A;  1Q1V A;  3GZ5 A;  4ITV A;  1GLN A;  2CUE A;  5K5R A;  1IRG A;  3IP4 B;  1R6R A;  3WG9 A;  1DP7 P;  3S1N J;  1QNT A;  2VPL A;  2KL4 A;  1XCB A;  1WSU A;  3LSI A;  2OCC H;  2HOE A;  4KIC A;  4WXD A;  3O8H A;  2F2E A;  1AKH A;  3PSF A;  1GVJ A;  2EQR A;  1K79 A;  5F1R A;  2VBZ A;  4XBF A;  3TP0 A;  1SAU A;  1SAN A;  3LMM A;  1H89 C;  5F27 A;  2IVM A;  3KP2 A;  1YIT I;  1PUE E;  4K2E A;  2D5V A;  3TOA A;  1QVT A;  2L4A A;  3MKY B;  1I6H J;  3L2V A;  2IPQ X;  4XM3 A;  2V79 A;  4BY1 J;  4CA0 A;  1ON1 A;  3W6J B;  2D2W A;  5EGO B;  2LKS A;  2FXA A;  2M4K A;  1Z6R A;  4A69 C;  4BKX A;  4A3C J;  1S7O A;  4CYC A;  2QWW A;  2XF6 A;  2PBI A;  2Q8K A;  1GUU A;  3WU1 B;  3W6V A;  2YR2 A;  1JJ6 C;  2P7C B;  3M3Y J;  1JUS A;  3G1M A;  3OSG A;  2LMD A;  1Z1D A;  1AKH B;  2BHY A;  2HNH A;  3JSO A;  2Y0S A;  2LSO A;  4BBR J;  4ENM A;  1J5Y A;  1BI1 A;  3F8C A;  2CFO A;  1ZGJ A;  1F43 A;  1E2X A;  3F6V A;  4PJN A;  2G7H A;  5E3L A;  2DA6 A;  2HEO A;  4MGR A;  3L1P A;  4RGR A;  3FMR A;  2R7X A;  1Q1H A;  3H0D A;  5AIP A;  4E7K A;  2CQQ A;  4CZZ A;  1D1C A;  2XAU A;  5ICC A;  2Y0M A;  3HSR A;  3ZN1 A;  1I50 J;  2DI3 A;  3W6K B;  4O6J A;  1OCZ H;  2YX4 A;  4XLH A;  5EEG A;  1JHH A;  2VOD A;  4CYC B;  1UG2 A;  1D8J A;  3M8E A;  2MAB A;  2BZT A;  4KIB A;  5BNG A;  4G7H F;  2FQ4 A;  5KNL A;  5CQE A;  2VJI A;  3S3O A;  3M4O J;  3SFI A;  3ERE D;  4H4K C;  4B44 A;  1K7A A;  2IGN A;  2X6W A;  1B1B A;  2NS7 A;  5FFZ A;  4P55 A;  3J80 K;  3OR2 C;  2KDO A;  2L54 A;  2FOW A;  2R7R A;  3P9I A;  2STW A;  2VC1 A;  4ASN A;  4BJ5 C;  2XF5 A;  3KYC B;  3DTI A;  2Y48 A;  3F22 A;  3LAP A;  2BGC A;  2EWN A;  3MMY B;  3P9K A;  3ZMZ A;  1W0T A;  3ABL H;  4EEF G;  4ZZD A;  2Z9O A;  3S1R J;  2F5C A;  4NUB A;  2RNJ A;  2JWT A;  4AD9 A;  3HOX J;  5F0C A;  1XSX A;  2CG4 A;  1ZG5 A;  4XN0 A;  2QEN A;  2XF7 A;  2HYG D;  1RET A;  2H27 A;  3WOD F;  3JAM K;  3IKT A;  1YO5 C;  1ZAO A;  2LYC A;  5HS9 A;  2E1M C;  1MSE C;  4EJT A;  1UMQ A;  3M1C A;  2ZCW A;  3PJR A;  1MJA A;  4J19 A;  4I09 A;  3ULQ B;  3S3M A;  2D45 A;  4XID A;  1X3Z B;  3N05 A;  5FD5 A;  1IF1 A;  3OYB A;  2RRE A;  1FY7 A;  3H9G A;  3Q0V A;  3EYI A;  3TGN A;  3ZQH A;  3OYC A;  3ROU A;  3M1E A;  2XAH A;  2L9S A;  4NNJ A;  2AQE A;  3K1N A;  4G8X A;  3QQA A;  5IYD J;  2A6H F;  4WXH A;  2FE3 A;  3CUO A;  2Q2E B;  1IV8 A;  1Z77 A;  2LKX A;  3F8F A;  3W2W A;  4XKC A;  1S9H A;  2K9M A;  1VI0 A;  3HOY J;  2RGV A;  4A3F J;  1ZR2 A;  2O3F A;  1Z9C A;  5B66 C;  2AO9 A;  4AVP A;  3FHZ A;  3FXL A;  5HLG A;  4HV6 A;  2LF8 A;  2JRM A;  1SAX A;  1T38 A;  5D4R A;  2CU7 A;  1XGS A;  5J1Y A;  3V8L A;  5J1R A;  1DDN A;  2HPM A;  4EV0 A;  4ZH4 F;  4D7N A;  1IZ1 A;  4G9Y A;  1P4W A;  4PUS A;  2DT5 A;  3VDX A;  1FIA A;  2EFQ A;  4IRI A;  5EJC A;  1B6A A;  4XLE A;  2HGC A;  1BBY A;  3E97 A;  1GV5 A;  1FOY A;  2QYO A;  3IKV A;  2PJR A;  3C1D A;  2HDD A;  3GTJ J;  2DYS H;  4GYG A;  4B48 A;  2HFH A;  3RZO J;  5D8L B;  1UHM A;  3DEE A;  3RSN A;  3LNQ A;  4EGZ A;  2R7W A;  2ZFU A;  3GTL J;  5IP7 J;  4CCL A;  1EKE A;  2Y69 H;  2ZJR F;  4GFB A;  4L5J A;  3I4P A;  2EV0 A;  5E1X A;  3HRM A;  3LSP A;  2FMY A;  3K4K A;  2K40 A;  2DQR A;  2KP6 A;  1RI7 A;  2DJN A;  5E8I A;  1TWH J;  3K70 C;  3EPZ A;  3FKI J;  1JKP C;  4MFD A;  2Y0S N;  3V42 A;  2G0E A;  1XGN A;  2L5Q A;  1ZK8 A;  3FDY A;  4AVZ A;  4ANJ A;  2PJR B;  1UEL B;  5IP6 A;  4UUT A;  2W1O A;  2FEZ A;  1S6L A;  2ZC2 A;  3BPX A;  2A3S A;  1I5Z A;  3KPH A;  4NHJ A;  1ETW A;  1NHA A;  1X3W B;  4NB5 A;  5F1J A;  4KIS A;  1XB4 A;  3DPT A;  3PIP F;  4A5M A;  2GLO A;  3H36 A;  1G8X A;  4CYD A;  2QSH X;  3DLA A;  3MZY A;  3ZN0 A;  4QLC U;  4E7L A;  3L00 A;  3KZY A;  4HV5 A;  3LA2 A;  1C0W A;  1ZG1 A;  1TQM A;  3LSJ A;  5KAF C;  2W25 A;  4DGW B;  3GTM J;  3K2A A;  3NRV A;  2H09 A;  1D5V A;  2B63 J;  1ZG3 A;  1S7E A;  4Y7N J;  1ZH5 A;  2KRC A;  2LRD A;  2NAZ A;  3DP7 A;  1V5F A;  3FK7 A;  1CF7 A;  4EM0 B;  2M9H A;  4LK0 F;  3I0T A;  5DUK A;  4NQW A;  4R8H A;  2L0K A;  2P0W A;  4HLX A;  2HVQ A;  3H1C A;  5A2Q Z;  3QYF A;  3JSP A;  5LD2 C;  1Y0N A;  1ZRF A;  3R4K A;  1T0F C;  3OR1 C;  2X6Y A;  3E5U A;  4G7O F;  2CRG A;  3KP5 A;  3KYD B;  4EM1 A;  3N97 A;  1V55 H;  1D5Y A;  1X58 A;  1MH3 A;  2FX0 A;  3GW2 A;  5H6R A;  2UV1 A;  2UUZ A;  3CJN A;  4II2 A;  4MQ9 F;  4Y15 A;  3JR9 A;  2BE5 F;  3GBG A;  4P5O A;  1MBF A;  2FQ3 A;  1DQU A;  3KFW X;  4HA8 A;  3HRU A;  3CCJ I;  2BY0 A;  1WWX A;  2EIM H;  1VQ7 I;  1RIO H;  1D1B A;  4M6Y A;  3TO9 A;  4BS9 A;  3SQN A;  5HS8 A;  4ESF A;  3S93 A;  1J7K A;  3HRS A;  2F5F A;  3QAH A;  3SXY A;  1CF7 B;  4FE7 A;  2VC0 A;  3RKX A;  3A0B C;  1E0E A;  2NOG A;  1BIA A;  3HGG A;  4NQW B;  1KU2 A;  3DQV C;  4DZJ A;  2M3A A;  4M9S A;  3MWM A;  2Z3Y A;  3GFL A;  2O6G E;  2DBB A;  2E7X A;  1TQP A;  3IC7 A;  3WGH A;  4L5I A;  5IT9 K;  5FLX Z;  3NWT A;  3VSL A;  3HPH A;  2L7K A;  2MYS A;  3CJQ B;  1HDD C;  1JHF A;  5L3B A;  4IQJ A;  2DA7 A;  1MH4 A;  1XSD A;  5HLH A;  1O7L A;  2KJB A;  1WHU A;  2WAD A;  1GXQ A;  2MH2 A;  1ZQ3 P;  1FP1 D;  1GV2 A;  2FML A;  4CXF A;  4PJ0 C;  1T08 B;  3DEW A;  2WB1 A;  3EET A;  2EFW A;  1POG A;  2P4W A;  1R49 A;  2Y30 A;  4M9Z A;  4BU2 A;  1XMA A;  2WAF A;  2FRH A;  3RIR A;  3VB2 A;  1QRY A;  1U3E M;  1S5L C;  3KP7 A;  5K5Q A;  2QCO A;  2V1X A;  5FRO A;  2IP2 A;  4FCY A;  2PJP A;  2GIZ A;  4C2U A;  1N78 A;  2KT0 A;  5LBQ A;  5L3E A;  3HKZ A;  4A3B J;  5K7Z A;  2RV8 A;  1MNM C;  3GFJ A;  4IHY A;  3ZCO A;  4L9V A;  3RKY A;  2VJ5 A;  1BOB A;  1YIO A;  2DMT A;  3OYI A;  4C30 A;  2H1L A;  3A2K A;  3M7G A;  1BR1 A;  1JXS A;  3NAR A;  3IH4 A;  2H6B A;  3TP3 A;  2ZME C;  3UNG C;  3C18 A;  5E3N A;  2X6X A;  2DQL A;  2GQQ A;  2V1N A;  1NTC A;  3FXM A;  2JUG A;  1STZ A;  2ME0 A;  3BR6 A;  1OCP A;  2W4S A;  1FBU A;  1FJL A;  2ESH A;  5F08 A;  4FET A;  4XOT A;  1EH6 A;  1FWZ A;  1BR4 A;  3RPU D;  1AWC A;  3W3C A;  2FNP A;  1VQP I;  4OIP F;  4DBR A;  2P6S A;  2VQC A;  4CCM A;  1K4T A;  1WI9 A;  2MD0 A;  4AID A;  1R1T A;  3LFU A;  2XHK A;  2VT2 A;  4G12 A;  4G7Z F;  1XN7 A;  3E6D A;  4A3E J;  2O03 A;  1DU0 A;  1Y6I A;  5GTI C;  1LE8 A;  4A3I J;  1EA3 A;  3TQN A;  2IJL A;  3JRH A;  3IHU A;  3ECO A;  1FOW A;  5LFA A;  1WZ2 A;  3OYF A;  1TP4 A;  1JGG A;  3K0L A;  4B47 A;  4AIJ A;  1YW8 A;  2VE9 A;  4UB8 C;  2NVQ J;  2LDU A;  4BY7 J;  3DKY A;  3S2W A;  2QUF A;  1BI3 A;  2CQN A;  3VYR B;  4D5C A;  4L5E A;  1ZYR F;  2TDX A;  3ZP5 A;  3BR5 A;  3HOT A;  2F4I A;  2DT6 A;  1OJL A;  2JA2 A;  1JTY A;  4M72 A;  1QZZ A;  4ESJ A;  1G3Y A;  4M6X A;  3DEU A;  4P9F A;  4YIF A;  5ILV A;  4I6Z A;  1UAA A;  3QP5 A;  1JT6 A;  4EM2 A;  4KNY A;  3EUH C;  3U21 A;  1QA6 A;  1DUX C;  4G6Q A;  5KAI C;  2KPM A;  1LE8 B;  4U0V A;  1WCM J;  3H3Z A;  1YW9 A;  4KN4 X;  4PJL A;  3WG7 H;  4L0Z B;  2VBW A;  3G71 I;  3I56 I;  1TT0 A;  1APL C;  2KDZ A;  3GTG J;  4LOC A;  4BXF A;  2RN7 A;  3WTT C;  1KU3 A;  3JCU C;  4HLY A;  2ELJ A;  2ZNZ A;  2XAJ A;  2VXD A;  1KU7 A;  2CFX A;  2K85 A;  3E7L A;  4IF4 A;  1LEB A;  2LRE A;  3LFK A;  3L2Q A;  1HKQ A;  3R0A A;  2R5Z A;  1FX7 A;  5HOD A;  1A31 A;  1FYM A;  4BQQ A;  1R71 A;  2A07 F;  2GIV A;  4MNU A;  3WTV C;  3L2W A;  3GF2 A;  2OA4 A;  1YQA A;  4HNT A;  1UB9 A;  3Q5F A;  4MQV A;  3BJA A;  4L18 B;  4YG2 F;  2KZG A;  4ZDP A;  3ZGK A;  3AG4 H;  2NVY J;  2VI6 A;  3N4M A;  4RMN A;  4JBA A;  1DU6 A;  1FP2 A;  4YRV A;  5CQG A;  4B8X A;  5D6F A;  4FQG A;  2W00 A;  3B6A A;  3K9T A;  3ZRG A;  4FX0 A;  3G4S I;  1IJW C;  4HNV A;  3HL2 A;  1RES A;  2GAU A;  5KK1 A;  3HBL A;  2WAE A;  5IPA A;  1IG7 A;  3HG9 A;  3CCV I;  4RAZ A;  2CV0 A;  2QSG X;  2DTR A;  5FFX A;  3PO2 J;  3IL2 A;  4KIG A;  4X6A J;  2V9V A;  3V7C A;  2F48 A;  2WB1 N;  1WJF A;  2L3D A;  2VKV A;  3OIQ A;  2JN6 A;  4ESB A;  2IBD A;  2R5Z B;  2L7M P;  4RS8 A;  3HOS A;  2DK8 A;  3T8R A;  2GXB A;  2Y9Z A;  1LVK A;  3CUQ A;  4XKW A;  4HDV A;  2JQ7 A;  2MH9 A;  1DP3 A;  3H3U A;  5D5X B;  1TLH B;  4CCK A;  3D1N I;  4PSW A;  3S2D J;  2JA6 J;  4ABZ A;  2CV2 A;  3HKZ N;  2NOJ B;  3KZI C;  3C2B A;  1U5T C;  1FPQ A;  2F4O B;  4CZC A;  3WTW C;  3QYB A;  3M07 A;  4HDU A;  3PO3 J;  2F5D A;  1HXD A;  4Y13 A;  2EJR A;  3WGG A;  5IYC J;  2IA1 A;  1Y0U A;  1Z6T A;  1LFP A;  1FZP B;  2Z5U A;  1RKT A;  1RC9 A;  3RKW A;  3C2H A;  2ZXW H;  4PFP A;  3WE3 A;  2EPF A;  2M8G X;  4C2M J;  2F6C A;  3E6B A;  4U7D A;  2XPU A;  3T5X A;  5EDN A;  2KFD A;  2EZL A;  1LDK B;  3TO6 A;  3WTU C;  2GZW A;  1BL0 A;  3HSE A;  3CLQ A;  1SFE A;  2DPU A;  1PP8 F;  2KIM A;  1IRX A;  3BT9 A;  2H8W A;  3CUQ B;  3WHC A;  2Q1Z B;  4C3I J;  3ZQ7 A;  3VOE A;  3KET A;  2WBM A;  2WTE A;  2IS1 A;  4XIC A;  2O8X A;  5M3F J;  1SD7 A;  3V8K A;  3ML6 A;  2EFP A;  2CUF A;  2M2E A;  2ZB9 A;  1VZ0 A;  1W7P D;  3PL8 A;  4B1R A;  2M0M A;  2L01 A;  1V5E A;  2W82 A;  3TW7 A;  2QKM B;  4RLF A;  4DYC A;  2X85 A;  4HST A;  4KDP A;  1J0R A;  1O4X A;  1BOA A;  2R92 J;  3H5A A;  3QPS A;  2DO7 A;  5F0F A;  2DTZ A;  2WA0 A;  1F4K A;  2PEX A;  3DXJ F;  4I99 C;  3ABT A;  3BQZ A;  3CDL A;  3PUF A;  1ERD A;  4XQF A;  4FAS D;  1W0U A;  3GX4 X;  2W7N A;  4FX4 A;  5EG0 A;  2F5E A;  3O2P E;  1VQ9 I;  1KQ9 A;  2DA2 A;  4QSH A;  4MO7 A;  4IXA A;  3K10 A;  1JT0 A;  2LBF A;  1R22 A;  4F55 A;  3OYD A;  1JKO C;  1ITY A;  2XDV A;  3DBH B;  3SZP A;  5F04 A;  5C44 J;  2GM4 A;  3AG1 H;  2FOK A;  2BV6 A;  2QSF X;  1OYW A;  3BR1 A;  1YJN I;  2OF7 A;  3F8B A;  1I3Q J;  2ZJP F;  3BJ6 A;  2YSR A;  3FZV A;  3AAF A;  4I0A A;  4L9J A;  2FU4 A;  3MZH A;  1IRF A;  3SZT A;  1UHW A;  3K1P A;  1BI2 A;  3GFM A;  3DBL B;  4BL0 B;  4XMY A;  5ILS A;  2LLK A;  1O3Q A;  2HQ5 A;  4BAY A;  5GAH J;  5CVV A;  1WGX A;  3K70 D;  4W1U A;  5EG0 B;  1IAW A;  3TDZ C;  2PQ8 A;  1J75 A;  1BI0 A;  3VYU B;  5TRD A;  2OC6 A;  5HDK A;  2RDP A;  2LBF B;  2KRF A;  2PMU A;  4M3D A;  1XD7 A;  4LIT A;  2EK5 A;  4E4H A;  1ZR4 A;  2K4J A;  2VKD A;  1QBJ A;  2IW5 A;  3HIF A;  2CQK A;  2WV1 A;  4IHV A;  1P7I A;  1U9O A;  4A0X A;  2DA4 A;  2XAQ A;  1FMW A;  5GAD J;  3Q0U A;  4G6D A;  4AC0 A;  1SVO A;  2V1D A;  2RC4 A;  2V6E A;  3TDU C;  2DT7 B;  1ACI A;  4P1W A;  5K7H A;  1ON2 A;  1X2N A;  1XGM A;  1HF0 A;  2V7F A;  4A3J J;  3A1Y A;  1W4M A;  1QHG A;  2EBI A;  1VFC A;  2OQR A;  4X0G A;  4I0B A;  3VSK A;  2PLY A;  4ZZL A;  2M4G A;  4RB1 A;  4XRF A;  3DPL C;  3ERM A;  2A5W A;  2DFE A;  2XB0 X;  1SEU A;  1F1Z A;  1DGR M;  2DPD A;  5FLM J;  4PDK A;  1W36 C;  2LFB A;  4LLG F;  5JHU A;  1PYV A;  2FBH A;  1ETX A;  2L9N A;  3FK6 A;  1T95 A;  2P5L C;  3FM3 A;  4CCN A;  2JSC A;  3GXO A;  4XOP A;  4BDZ A;  1TTY A;  3H0G J;  1OYY A;  3BDD A;  4RAG A;  3OL3 A;  3WU2 C;  4BHP A;  2X48 A;  4JX5 A;  1JKQ C;  3WTX C;  3I5U A;  1KA8 A;  1W5T A;  4S04 A;  3ZQF A;  3S17 J;  3K4L A;  3RZD J;  4XLC A;  2FD5 A;  2FUG 2;  3FXJ A;  1P6R A;  3I64 A;  5HDG A;  2RQP A;  2E7W A;  1FOK A;  2OTJ I;  3FM5 A;  2OCE A;  5J4Y A;  3PQJ A;  2PN6 A;  5BPD A;  1UHS A;  3I55 I;  2H94 A;  1ETV A;  2AHQ A;  3DU6 A;  3QOP A;  2K9Q A;  3QWL A;  1MJB A;  2HOT A;  5JLX A;  2DFF A;  4CSW A;  4HQM A;  3MD2 A;  2K27 A;  3CMA I;  4FT8 A;  4HOB A;  5J1U A;  2K5C A;  4BDY A;  2RAE A;  3MKL A;  4GYI A;  2QEX I;  1IXC A;  2JMW A;  1MBG A;  1FMV A;  3LSG A;  3B6C A;  3LWF A;  2ID3 A;  2WC2 A;  4MHG A;  1G2H A;  1XSV A;  2DA1 A;  4Z6Y A;  2EB7 A;  2XAS A;  4MIM A;  5JHF A;  1G6N A;  1WPK A;  3BR2 A;  4NC6 A;  4BHB A;  5L3G A;  2HQA A;  4A0Y A;  5FLV A;  1O57 A;  2OZU A;  3OYE A;  2UWM A;  1Y56 A;  2OAZ A;  3IRQ A;  5FRM A;  2R7V A;  2M8E A;  4AYB A;  4BUP A;  1A6Q A;  1SMY F;  4EMS A;  2ZKZ A;  3ZOB A;  4F3Q A;  3I4N J;  4P96 A;  4H0E A;  1W7P A;  1IUY A;  2M7B A;  2Z2S B;  3QP6 A;  3HHH A;  1OFC X;  4ZTF A;  1VQN I;  4BH9 A;  2HYF A;  1MBE A;  4KT6 A;  2CGP A;  4OIQ F;  5J3L A;  3I9V 2;  1MZB A;  1BM9 A;  4C2T A;  1UG0 A;  1XMX A;  2E1M B;  1RR7 A;  1HW5 A;  3H5N A;  4FE4 A;  1XC5 A;  2MC3 A;  4KMF A;  1UFM A;  1UJ8 A;  3OOP A;  4J00 A;  3GO5 A;  4DOZ A;  4RBO A;  4KN7 X;  5IY5 H;  2ZFW A;  3OYH A;  1LKX A;  4A2U A;  4EAT A;  2R7D A;  1NK2 P;  5DDG A;  4E7H A;  3HM5 A;  2H8R A;  3GCM A;  2E1O A;  1JJ8 C;  4HBL A;  3BG5 A;  1VF9 A;  3R60 A;  2VXZ A;  2CSO A;  2BHZ A;  3BG9 A;  2JRT A;  4PJM A;  3BLY A;  1W7P B;  3HJE A;  4I98 B;  2EZI A;  4RAY A;  1QPM A;  5DV5 A;  5BOX A;  3ZXS A;  1BA5 A;  2B7E A;  3COA C;  2XKP A;  4KYW A;  2DDA A;  2R7S A;  4D7M A;  5D5U B;  2G7U A;  2X9D A;  3ZMS A;  5GP9 A;  1RUO A;  3KEY A;  1SVM A;  1YS7 A;  2V9P A;  3F3X A;  5FB2 A;  2IGO A;  4RGX A;  3AFH A;  3CO7 C;  2VL8 A;  1R5H A;  1SVL A;  4ON0 A;  4AIK A;  3JRG A;  3AL0 C;  1TWA J;  1X4P A;  1G59 A;  1WJC A;  4E7Z A;  1SFX A;  1QO0 D;  3SHF A;  3REO A;  5E20 A;  3HB9 A;  3CCR I;  4A3M J;  2BVL A;  1H9T A;  4D5F A;  1QPI A;  4A93 J;  3OWT A;  1VQK I;  2CYY A;  3E5X A;  1D8K A;  1ZGA A;  4N4N B;  1YJW I;  1ZTR A;  1X3U A;  2HI3 A;  3DPU A;  4ZC3 A;  1ZGW A;  2LKP A;  5LHH A;  1A5J A;  3G1O A;  1Y8Q B;  3J81 Z;  1X1A A;  2ZSI B;  1LDD A;  4YFN F;  2EH3 A;  4YFX F;  2STT A;  1OCO H;  4PCQ A;  2R7T A;  2MBF A;  2EIN H;  3CTA A;  1J2X A;  4WK8 F;  3GLX A;  1JUM A;  3FBN B;  4PK4 A;  4EVI A;  1KGS A;  3NAU A;  4M71 A;  4AU7 A;  4XRM A;  3HOU J;  4U0W A;  2F5V A;  3DF8 A;  2R3S A;  2BOL A;  3MZ8 A;  3JTH A;  1YG2 A;  1KYW A;  2Z33 A;  3LQQ A;  2A6E F;  3TO7 A;  2V26 A;  3FMQ A;  3HZJ A;  2ZBK A;  3BTC A;  3D0S A;  4EJV A;  2NS8 A;  2RVC A;  5LEK A;  3A01 A;  1ZEL A;  1X1B A;  3OIO A;  1N25 A;  3OYJ A;  3VWB A;  2NRA C;  1YJ9 I;  3I4M J;  1T0F A;  1SD4 A;  1I1S A;  3KEO A;  1LNW A;  5EZH A;  5C3E J;  2HDW A;  1HBX G;  1VQ5 I;  4C3J J;  1I6X A;  2DJI A;  3H5R A;  5M5X J;  3S1M J;  1TWF J;  4UB6 C;  1SFO J;  3RI4 A;  4ENJ A;  2X6O A;  2BVM A;  2EV6 A;  4IEJ A;  4KJZ A;  4D1Q A;  1QU3 A;  1IW7 F;  2HR3 A;  5LHI A;  4MLO A;  3SDG A;  1H88 C;  4BQN A;  2BXY A;  5FRN A;  4Y33 A;  2GOM A;  1H8A C;  4EQQ A;  2E71 A;  3P7N A;  3GLL A;  1R9T J;  3K4M A;  2O8K A;  5FKO A;  3J7A O;  5ED4 A;  4KIF A;  4LGW A;  5ICF A;  2WY8 Q;  2MD5 A;  1OCR H;  2H6C A;  5F64 A;  2DYR H;  2XGC A;  2IS4 A;  1RZ4 A;  4MEY F;  3H3V K;  1JUP A;  3UR3 C;  5DD4 A;  2R93 J;  4IPA A;  5EF6 A;  4UUS A;  3A01 B;  3PM1 A;  3TW6 A;  3IV5 A;  2HZT A;  1FSE A;  3I71 A;  4DYR A;  5EEH A;  2O0Y A;  1KZH A;  2X4H A;  3AG3 H;  3RQI A;  4E7J A;  3U9G A;  4BYY A;  1NG6 A;  1MMN A;  1OR7 C;  3BZC A;  5FKN A;  3CJT B;  2XGD A;  2DMQ A;  4EJU A;  2UXX A;  3OV8 A;  1YRN A;  2DOD A;  2MLK A;  5E79 C;  2XRO A;  3FKJ A;  2YUS A;  3BTJ A;  3IH2 A;  4CGZ A;  1YS6 A;  3VYS B;  2ZXJ A;  4BNC A;  4DIQ A;  3C3W A;  4XLA A;  2XGE A;  1EH7 A;  4EJW A;  4OMY A;  2VN2 A;  5E1Z B;  2ECC A;  2EFO A;  2IS2 A;  2JK3 A;  5DM6 F;  1TC3 C;  2R7U A;  1ZRE A;  3KEQ A;  2DFI A;  1IDY A;  2PFB A;  1T6S A;  2WV0 A;  1VQM I;  2YS9 A;  1XMK A;  4XN3 A;  2W85 A;  1D0X A;  4UVA A;  1RR8 C;  1O3T A;  3Q9V A;  2R0Q C;  3NWS A;  2JPB A;  4A5N A;  1X1P A;  2ME6 A;  4N9H A;  3U2R A;  4UUS B;  2DLL A;  3LA3 A;  1WJD A;  1RUN A;  1F36 A;  5LRR A;  2K3F A;  1YFH A;  4WF2 A;  3DKW A;  1BN5 A;  3E1S A;  4A6E A;  2W84 A;  5J6X A;  2LC2 A;  2XRL A;  3EUA A;  5E8G A;  4CCJ A;  2GA2 A;  2LVS A;  3W2V A;  2EA2 A;  2XB5 A;  1YRN B;  3L7W A;  1B59 A;  1OCT C;  4CH7 A;  1GT0 C;  3BR0 A;  3CMM A;  2OV7 A;  2GOX B;  4KUM A;  4MFE A;  2IT0 A;  1XTA A;  4IL6 C;  2V6C A;  2OU2 A;  1LEA A;  2JZY A;  1IN4 A;  1RPW A;  2VJ4 A;  1JTX A;  2M5W A;  3FXQ A;  4M3B A;  1FTZ A;  5D5V B;  2NNN A;  3HRT A;  2ZME A;  3JRA A;  1ZKG A;  5DS9 A;  4RB0 A;  2NVU B;  2P5K A;  2O5R A;  4PJJ A;  1WJE A;  5D6E A;  4OWR B;  3BPV A;  2KRH A;  1IGN A;  3E0J B;  4Q48 A;  3ZMU A;  3H9J A;  2HPI A;  2O61 A;  4B3A A;  3OS0 A;  1AU7 A;  1Z3Y A;  3G6E I;  3I59 A;  1G3T A;  3R6S A;  3H35 A;  2FBK A;  1BJZ A;  1QQI A;  1YLF A;  4D0P A;  4DBQ A;  4BQA A;  3GWZ A;  3BCB A;  2JPC A;  3BG6 A;  5GAE J;  4AIH A;  3PIO F;  3E3V A;  1T98 A;  1ZHF A;  2CWE A;  2DOE A;  3K4C A;  4ETS A;  3DLL F;  3FF5 A;  3CMY A;  3GUD A;  1S7A A;  3S3N A;  3FWE A;  4ZYG A;  3MN2 A;  2XUB A;  2ZME B;  5HNH A;  1XDU A;  4IVN A;  4RM3 A;  4IO9 F;  2XGX A;  1SMT A;  3SEQ A;  2DK5 A;  2HWV A;  1V54 H;  5KHD A;  3U1K A;  1ONV A;  3HYI A;  4JP0 A;  1IDZ A;  2KIF A;  2D1H A;  2DW4 A;  3OYK A;  5LGT A;  3DTE A;  4BQO A;  1AA7 A;  1X4O A;  1V5G A;  3I59 B;  2JA5 J;  2PMH A;  5HDN A;  4HX8 A;  1XCV A;  1Z0X A;  3GZN B;  4N4O B;  2F4M B;  1WRJ A;  4HX4 A;  4L9N A;  3S32 A;  1GVD A;  5B1A H;  3WTZ A;  1E3P A;  2VJJ A;  1E17 A;  4UV8 A;  3ZMT A;  3VFZ A;  1WVR A;  2COM A;  3A0H C;  3EUH A;  1FOX A;  1AHD P;  4WXC A;  2E36 A;  4QIW N;  5A2Q K;  2P81 A;  1UST A;  3OYN A;  2CQX A;  3TL4 X;  4LB5 A;  3S16 J;  2MLG A;  1MNE A;  3OYL A;  3ZPL A;  4A3L J;  1CQT A;  5C4J J;  2QQA A;  5C4X J;  1HKS A;  1OKR A;  3NQO A;  3SDB A;  3DFG A;  1ZLJ A;  2CMP A;  1H9G A;  1UCR A;  2AQF A;  3CCY A;  5K1Y A;  2AS5 F;  3QPT A;  1W5C C;  4EJO A;  5LRS A;  1EV7 A;  2L9R A;  4DNC A;  4DJA A;  3QOD A;  4BEH A;  2K4B A;  1MW7 A;  3S14 J;  5FJ8 J;  3GTK J;  5E3M A;  3A4C A;  2OD5 A;  5E17 F;  2VOP A;  3QYE A;  3GFI A;  5B5E C;  1YYV A;  3J80 Z;  1U6G A;  4LD5 A;  2TCT A;  1LB2 A;  1RNL A;  4IRH A;  2JUC A;  2HKX A;  2HXI A;  2E2I J;  2WAQ A;  1GXP A;  2I8D A;  4XRS A;  2OUM A;  5LHG A;  1Z91 A;  2BXZ A;  5DCF A;  3MFK A;  2XAG A;  1R4N B;  4BE1 A;  2OZ6 A;  1B9M A;  4S0H B;  4M3G A;  4M74 A;  1FBS A;  1EF4 A;  2GA1 A;  2NS0 A;  3K1M A;  2XSD C;  1AOY A;  3L09 A;  2LY1 A;  2ELK A;  4RA2 A;  2QQB A;  2DOA A;  5FLX K;  3T1B A;  4BE2 A;  2R7Z J;  1W36 D;  4M3F A;  1EJ9 A;  1YOV B;  3LSR A;  3FMS A;  1IN8 A;  3O6B B;  4NC7 A;  4LJZ F;  2JT1 A;  3MVP A;  4BEH B;  3B02 A;  3QU3 A;  4QPO A;  3JAM Z;  1TWG J;  1IXR C;  2L7F P;  2H1K A;  2X1C A;  4UXN A;  2LG4 A;  2QVO A;  1RRJ A;  3WU0 A;  2ISZ A;  4IHX A;  3KLN A;  3K4B A;  2HZD A;  4I76 A;  3D5L A;  5AIQ A;  2HQN A;  2JVH A;  4UY8 I;  4IZZ A;  3S8P A;  3RYP A;  4XSZ F;  3FIW A;  4B09 A;  2IAI A;  5J8F A;  1ULY A;  2HOA A;  3MAJ A;  5F0H A;  1WI3 A;  2JA8 J;  2GBY A;  3IH3 A;  1Y8R B;  2DA3 A;  2MSY A;  2ZO4 A;  2HVS A;  4PFO A;  2XPV A;  4WCG A;  2M7A A;  3TMO A;  2D1V A;  2CS3 A;  1DGW Y;  1X2M A;  5BS6 A;  4V19 K;  2DA5 A;  4Z2Y A;  3IAM 2;  1MD0 A;  4II3 A;  2XC7 A;  2LF7 A;  2RNG A;  3JRD A;  1TBX A;  4O5V A;  2MA3 A;  1G3W A;  3DV8 A;  3ZQC A;  3TBI A;  1ZLK A;  3CCM I;  3GVA A;  4BGD A;  4U7B A;  2GWR A;  1NG7 A;  2V4J C;  2X1E A;  4FTH A;  3AKZ A;  3SEZ A;  2XPW A;  5K7F A;  1VQ8 I;  1I27 A;  1I1G A;  4HEA 2;  3KX2 A;  3Q9S A;  1FYK A;  1UZC A;  1ORK A;  2KMU A;  5ICE A;  5D4S A;  2Y2Z A;  1LFB A;  4UUV A;  3RPU A;  1R23 A;  1XGO A;  3R61 A;  1CGP A;  3LAJ A;  1L0O C;  3OIP A;  3PQK A;  1SD6 A;  3ZQL A;  5BPI A;  2Y75 A;  4XKB A;  5FO5 A;  2ZNY A;  4CIC A;  3CO6 C;  4Q5S F;  1MKM A;  3KP4 A;  1N75 A;  6PAX A;  5BMZ A;  1ETK A;  2E19 A;  4PGH A;  1U8R A;  4HPQ A;  2XVC A;  3CES A;  2L4M A;  3ZQG A;  2LK2 A;  1KQ8 A;  4XLF A;  1FC3 A;  5ERI A;  3JRC A;  5TIS C;  2VPR A;  4A3G J;  1Z05 A;  2I5U A;  3DKX A;  3JRI A;  1PJR A;  3HHG A;  1Y1W J;  4QWQ A;  4UNO A;  4N9I A;  4A3K J;  2EZK A;  1D0Y A;  4QPQ A;  3LQR A;  3ISP A;  1VQL I;  3EDP A;  3PUB A;  1MBH A;  4B4C A;  4BXU A;  3UKG A;  3CC4 I;  2VQG A;  2E34 A;  1R1V A;  3HPG A;  1X19 A;  2ELH A;  3I58 A;  1IN7 A;  2HXO A;  3BG7 A;  1QZE A;  3OYA A;  4E7I A;  4P9U A;  5CPR B;  1KQ0 A;  2MGQ A;  3CP2 A;  3EQL F;  1ETY A;  5BQT A;  4HYE A;  2IA2 A;  3ECH A;  3RDI A;  2HS5 A;  3F0C A;  1IO2 A;  2ZXH A;  3U1D A;  3BCA A;  1D1A A;  2OBP A;  5JLW A;  4RLQ A;  4M6V A;  5M3M J;  2VBX A;  5HOO A;  3LL7 A;  1K61 A;  4YFK F;  1T56 A;  3S2H J;  5TJJ A;  4HAM A;  5JVT A;  3FXO A;  3ZQQ A;  1OIS A;  1S8N A;  1QVU A;  4OU0 A;  1OLT A;  4PGG A;  1SC7 A;  1F9N A;  1FLI A;  3CLO A;  1PDN C;  2HU9 A;  1IRZ A;  4YIR X;  3I54 A;  3K7A J;  3CCQ I;  3O8G A;  2M30 A;  1SFU A;  4LLN A;  4XKV A;  4LIV A;  2ZJ2 A;  2E5Z A;  3TKY A;  3BC8 A;  1NK3 P;  2M1B A;  3ASN H;  3KCC A;  3ONQ A; 
#chains in the Genus database with same CATH homology
 1OYI A;  2ADU A;  5J8C A;  2QZ8 A;  1OPC A;  1WKM A;  3K2Z A;  4G94 A;  1R1U A;  5CLS A;  1LVA A;  1K6O A;  4N0B A;  3L2C A;  1HW2 A;  2J5O A;  3G3Z A;  5LGN A;  5FGM A;  4OMZ A;  4XLN F;  3L9F A;  5ICG A;  1PP7 U;  1LJ9 A;  3KE2 A;  2HKO A;  4HF0 A;  4HW0 A;  3R0J A;  3LST A;  2X0L A;  4KT5 C;  4KA4 A;  2BYV E;  2Q2E A;  1USS A;  2P8T A;  3KLO A;  2XKO A;  1TNS A;  2ACJ A;  3BOQ A;  2B0L A;  5IT9 Z;  2IRF G;  1S3J A;  1DPU A;  3JW4 A;  3GEZ A;  4RGS A;  4JK1 X;  1J59 A;  4OIN F;  1BC7 C;  2FNA A;  3VEP A;  3HTU A;  1L3L A;  3M9A A;  3WE2 A;  4WWC A;  2Z99 A;  3FXR A;  1ODD A;  3FXU A;  1B9N A;  2QLZ A;  2PI0 A;  3MCZ A;  4OOI A;  1WQ2 A;  1BJA A;  4BHC A;  2CO5 A;  1KYZ A;  5LGU A;  3QRF F;  3V7R A;  3O3K A;  4A12 A;  2Q0O A;  5CJ9 A;  4HQE A;  3ABU A;  3IRR A;  1O3S A;  1U78 A;  1TNT A;  3V8J A;  2V1U A;  2OQG A;  3HTS B;  1JGS A;  4UVB A;  1HST A;  1LDJ A;  4PZJ A;  3ZMD A;  4LLL A;  2P7V B;  4I2O A;  2W24 A;  2QQ9 A;  4LFU A;  1EH8 A;  1QZY A;  5F6F A;  3E5Q A;  2XRN A;  3F72 A;  2E1C A;  2YU3 A;  1P4A A;  1FNN A;  1DPR A;  2HDC A;  2L02 A;  5L3C A;  5AON A;  5CVJ A;  1H0M A;  3MEX A;  3E6M A;  5D5W B;  5L3F A;  3G73 A;  5CVR A;  5DD8 A;  2GXG A;  5K5O A;  2ESN A;  2YPR A;  1K78 A;  1S29 A;  2A5Y B;  4R79 A;  3FX3 A;  2XV4 S;  1MDM A;  1G3S A;  4WX9 A;  1P92 A;  1ZAR A;  5DUI A;  2KKO A;  1MJ9 A;  4O3M A;  4A6D A;  1W5S A;  5HVQ C;  3BRO A;  5HS7 A;  5CVU A;  1G4D A;  1P2F A;  2A68 F;  3TOB A;  2VOO A;  5E18 F;  5H6Q A;  3C7J A;  2FSW A;  4GO1 A;  4FHT A;  1K78 B;  3IWZ A;  3WTS C;  4JQF A;  4Y17 A;  3JTG A;  1IN5 A;  1MDM B;  2YX7 A;  3BY6 A;  3F6O A;  3K69 A;  1REP C;  4LG0 A;  1LQ1 A;  3QU6 A;  1A04 A;  2XIG A;  3T0Y A;  4A0Z A;  4CO8 A;  3F23 A;  1MGT A;  2VON A;  2UXN A;  5E1W A;  5HLI A;  1QGP A;  1R00 A;  3RYR A;  3HSF A;  3T8T A;  1T2K A;  1Z7U A;  4IJA A;  2XAF A;  2K02 A;  1TW2 A;  3BP8 A;  4LK1 F;  4M9X A;  3LA7 A;  3E6C C;  1FYL A;  4LG0 B;  2ISY A;  2NNY A;  4R1H A;  2QM3 A;  4RB2 C;  2FBI A;  1OR7 A;  4MTE A;  4IRG A;  2IA0 A;  1FSH A;  4GCV A;  4UVC A;  3ZMV A;  3M8F A;  2P6T A;  4I01 A;  5LLQ A;  3RTR A;  1VTN C;  1HQC A;  2E1N A;  1R5G A;  5JFR A;  1IN6 A;  4L9T A;  2AXL A;  5D8K B;  2DAO A;  3H92 A;  3MQ0 A;  2PG4 A;  2VE8 A;  4S05 A;  3SFZ A;  4EGY A;  2HTS A;  4OIR F;  3HUG A;  4Q47 A;  1FBQ A;  1XDS A;  2A61 A;  4KFC A;  3NEU A;  4DQ2 A;  4OIO F;  3I53 A;  4ENK A;  5KVR A;  4ENN A;  1YTY A;  4HF1 A;  2JTV A;  4CDG A;  3WTY C;  1BC8 C;  5DYM A;  3IWF A;  5CYV A;  2VBY A;  1IXS B;  2CW0 F;  4TV7 A;  4MTD A;  1J9I A;  4ZYD A;  4UV9 A;  2FF4 A;  2UZK A;  3P9C A;  5JR3 A;  4U88 A;  2J5P A;  2KIU A;  1R58 A;  1HSJ A;  2BBY A;  3BZ6 A;  5CVI A;  2LNB A;  5FD6 A;  4F7Z A;  1ZRD A;  3J81 K;  4I7H A;  2EV5 A;  2HQR A;  2W57 A;  4LMY A;  3GYH X;  5H20 A;  2QBY A;  2FA5 A;  2K7L A;  1B4A A;  2G9W A;  3BWG A;  2M45 A;  2M87 A;  2DU9 A;  1BIB A;  3WGI A;  4RGU A;  2A69 F;  1HKT A;  5LEJ A;  2HTJ A;  4HF2 A;  4HZF A;  5ILU A;  3F21 A;  3RJP A;  2C6Y A;  4ZYH A;  4L0Y B;  2R7F A;  4YII A;  3GZ6 A;  1KU9 A;  1O3R A;  2EFN A;  1ZRC A;  1FT9 A;  1GHC A;  4MEX F;  1ZN2 A;  2QBY B;  3CUQ C;  3KP3 A;  5JI6 A;  2P5V A;  4KMU X;  1YW7 A;  4HX7 A;  3F8M A;  4IHT A;  3V7S A;  5DCM A;  1SD5 A;  1V3F A;  1T39 A;  1V4R A;  3F8N A;  4IHS A;  2EA4 A;  4GGG A;  4RB3 C;  3EYY A;  4UHT A;  2ETH A;  4AWX B;  3KP6 A;  3VOD A;  4E70 A;  2VT3 A;  1P4X A;  3RPQ A;  1O7F A;  1U5T A;  2K86 A;  1F5T A;  3V4G A;  4U0Y A;  3QPH A;  2KJC A;  4LB6 B;  5DCM B;  4CHU A;  1JE8 A;  1U2W A;  2NYX A;  3KZZ A;  1D3Y A;  3CDH A;  2BEO A;  5L3D A;  4GXO A;  2RKH A;  1R7J A;  1TQI A;  3B73 A;  3PFI A;  2WWY A;  3BJO A;  4XSX F;  1HW1 A;  5IT3 A;  4I02 A;  4XLP F;  4ZYE A;  1TW3 A;  4Q4Z F;  1R36 A;  1U5T B;  5DEQ A;  1OMI A;  4M73 A;  3ELK A;  3GZ5 A;  5K5R A;  1IRG A;  3WG9 A;  1DP7 P;  1QNT A;  1XCB A;  1WSU A;  4KIC A;  2HOE A;  4WXD A;  2F2E A;  1GVJ A;  1K79 A;  5F1R A;  2VBZ A;  4XBF A;  2IVM A;  3KP2 A;  1PUE E;  4K2E A;  3TOA A;  2L4A A;  2IPQ X;  2V79 A;  1ON1 A;  3W6J B;  2D2W A;  2FXA A;  1Z6R A;  1S7O A;  2QWW A;  2PBI A;  2Q8K A;  3WU1 B;  2YR2 A;  2P7C B;  1Z1D A;  3JSO A;  2LSO A;  4ENM A;  1J5Y A;  1BI1 A;  3F8C A;  1ZGJ A;  1E2X A;  3F6V A;  2G7H A;  2HEO A;  4MGR A;  4RGR A;  3FMR A;  1Q1H A;  5AIP A;  4CZZ A;  5ICC A;  2Y0M A;  3HSR A;  3ZN1 A;  2DI3 A;  3W6K B;  4O6J A;  2YX4 A;  5EEG A;  1JHH A;  2VOD A;  1D8J A;  3M8E A;  4KIB A;  4G7H F;  3ERE D;  1K7A A;  1B1B A;  5FFZ A;  4P55 A;  3J80 K;  2L54 A;  3P9I A;  2STW A;  2VC1 A;  4ASN A;  2Y48 A;  3F22 A;  3LAP A;  2BGC A;  2EWN A;  3P9K A;  3ZMZ A;  4ZZD A;  2Z9O A;  2F5C A;  2RNJ A;  4AD9 A;  1XSX A;  2CG4 A;  1ZG5 A;  2QEN A;  2HYG D;  2H27 A;  3IKT A;  3WOD F;  3JAM K;  1YO5 C;  1ZAO A;  4EJT A;  5HS9 A;  2ZCW A;  1MJA A;  4I09 A;  3ULQ B;  2D45 A;  5FD5 A;  1IF1 A;  1FY7 A;  3EYI A;  3TGN A;  3ROU A;  3M1E A;  2XAH A;  3K1N A;  4G8X A;  2A6H F;  4WXH A;  2FE3 A;  3CUO A;  3F8F A;  2RGV A;  2O3F A;  1Z9C A;  4AVP A;  3FHZ A;  5HLG A;  4HV6 A;  2LF8 A;  1SAX A;  1T38 A;  5D4R A;  1XGS A;  3V8L A;  1DDN A;  4EV0 A;  4ZH4 F;  1IZ1 A;  4G9Y A;  1P4W A;  2DT5 A;  2EFQ A;  4IRI A;  1B6A A;  2HGC A;  1BBY A;  3E97 A;  2QYO A;  3IKV A;  3C1D A;  4GYG A;  2HFH A;  5D8L B;  1UHM A;  4EGZ A;  4L5J A;  3I4P A;  2EV0 A;  5E1X A;  3HRM A;  2FMY A;  2DQR A;  1RI7 A;  5E8I A;  1XGN A;  2FEZ A;  1S6L A;  3BPX A;  2A3S A;  1I5Z A;  4NHJ A;  1NHA A;  4NB5 A;  1XB4 A;  3DPT A;  4A5M A;  4CYD A;  3MZY A;  3ZN0 A;  4QLC U;  3L00 A;  3KZY A;  4HV5 A;  3LA2 A;  1C0W A;  1ZG1 A;  1TQM A;  2W25 A;  3NRV A;  2H09 A;  1D5V A;  1ZG3 A;  1ZH5 A;  2NAZ A;  3DP7 A;  1CF7 A;  4EM0 B;  4LK0 F;  3I0T A;  5DUK A;  4NQW A;  4R8H A;  4HLX A;  5A2Q Z;  3JSP A;  1ZRF A;  3R4K A;  3E5U A;  4G7O F;  3KP5 A;  4EM1 A;  3N97 A;  3GW2 A;  5H6R A;  3CJN A;  4Y15 A;  4MQ9 F;  2BE5 F;  4P5O A;  2FQ3 A;  3KFW X;  4HA8 A;  3HRU A;  1WWX A;  1RIO H;  4M6Y A;  3TO9 A;  3SQN A;  5HS8 A;  4ESF A;  1J7K A;  3HRS A;  2F5F A;  3SXY A;  3QAH A;  1CF7 B;  3RKX A;  2VC0 A;  1BIA A;  1KU2 A;  3DQV C;  4M9S A;  3MWM A;  2Z3Y A;  3GFL A;  2O6G E;  2DBB A;  2E7X A;  1TQP A;  3IC7 A;  3WGH A;  4L5I A;  5IT9 K;  5FLX Z;  1JHF A;  5L3B A;  1XSD A;  5HLH A;  1O7L A;  2KJB A;  1GXQ A;  2MH2 A;  1FP1 D;  2FML A;  4CXF A;  3EET A;  2EFW A;  2P4W A;  4M9Z A;  1XMA A;  2FRH A;  3RIR A;  3VB2 A;  1U3E M;  3KP7 A;  5K5Q A;  2V1X A;  2IP2 A;  2PJP A;  5LBQ A;  5L3E A;  2RV8 A;  3GFJ A;  4L9V A;  3RKY A;  1YIO A;  3M7G A;  1JXS A;  2H6B A;  3C18 A;  2DQL A;  2GQQ A;  1STZ A;  1FBU A;  2ESH A;  1EH6 A;  1FWZ A;  1AWC A;  2FNP A;  4OIP F;  2P6S A;  1WI9 A;  1R1T A;  2XHK A;  2VT2 A;  4G7Z F;  1XN7 A;  3E6D A;  2O03 A;  3TQN A;  2IJL A;  3IHU A;  3ECO A;  3K0L A;  4AIJ A;  1YW8 A;  2VE9 A;  2LDU A;  3S2W A;  2QUF A;  1BI3 A;  1ZYR F;  2TDX A;  3ZP5 A;  3HOT A;  4M72 A;  1QZZ A;  4ESJ A;  1G3Y A;  4M6X A;  3DEU A;  4P9F A;  4YIF A;  5ILV A;  3QP5 A;  4EM2 A;  4KNY A;  1DUX C;  4G6Q A;  4U0V A;  3H3Z A;  1YW9 A;  4KN4 X;  4L0Z B;  2VBW A;  2RN7 A;  3WTT C;  1KU3 A;  4HLY A;  2ZNZ A;  2XAJ A;  1KU7 A;  2CFX A;  4IF4 A;  1LEB A;  3LFK A;  1HKQ A;  3R0A A;  1FX7 A;  1FYM A;  2A07 F;  2GIV A;  4MNU A;  3WTV C;  3GF2 A;  2OA4 A;  1YQA A;  1UB9 A;  3Q5F A;  4MQV A;  3BJA A;  4L18 B;  4YG2 F;  3N4M A;  4JBA A;  1FP2 A;  4B8X A;  5D6F A;  3K9T A;  4FX0 A;  2GAU A;  5KK1 A;  4RAZ A;  2DTR A;  5FFX A;  3IL2 A;  4KIG A;  2V9V A;  3V7C A;  4ESB A;  2L3D A;  4RS8 A;  3HOS A;  2DK8 A;  3T8R A;  2GXB A;  3CUQ A;  4HDV A;  2MH9 A;  3H3U A;  5D5X B;  1TLH B;  1U5T C;  1FPQ A;  3WTW C;  4HDU A;  2F5D A;  1HXD A;  4Y13 A;  2EJR A;  3WGG A;  2IA1 A;  1Y0U A;  1Z6T A;  1FZP B;  2Z5U A;  3RKW A;  3WE3 A;  4U7D A;  3E6B A;  3T5X A;  1LDK B;  3TO6 A;  3WTU C;  2GZW A;  3HSE A;  2DPU A;  1SFE A;  1PP8 F;  2KIM A;  3CUQ B;  3ZQ7 A;  3VOE A;  3KET A;  2WTE A;  2O8X A;  1SD7 A;  3V8K A;  3ML6 A;  2EFP A;  1W7P D;  2L01 A;  4KDP A;  1J0R A;  1BOA A;  2DO7 A;  1F4K A;  2PEX A;  3DXJ F;  3ABT A;  3GX4 X;  4FX4 A;  2F5E A;  3O2P E;  1KQ9 A;  4IXA A;  1R22 A;  3SZP A;  2FOK A;  2BV6 A;  1OYW A;  3F8B A;  3BJ6 A;  2YSR A;  3FZV A;  3AAF A;  4I0A A;  4L9J A;  2FU4 A;  3MZH A;  1IRF A;  3SZT A;  1UHW A;  3K1P A;  1BI2 A;  3GFM A;  5ILS A;  1O3Q A;  4BAY A;  5CVV A;  1IAW A;  3TDZ C;  2PQ8 A;  1J75 A;  1BI0 A;  5TRD A;  5HDK A;  2RDP A;  2KRF A;  2PMU A;  1XD7 A;  2EK5 A;  2K4J A;  1QBJ A;  2IW5 A;  3HIF A;  2CQK A;  4A0X A;  2XAQ A;  4G6D A;  2V1D A;  2RC4 A;  3TDU C;  1ON2 A;  1XGM A;  1W4M A;  2OQR A;  4I0B A;  2PLY A;  4ZZL A;  4RB1 A;  4XRF A;  3DPL C;  1F1Z A;  2DPD A;  4PDK A;  4LLG F;  5JHU A;  2FBH A;  2P5L C;  3FM3 A;  2JSC A;  3GXO A;  1TTY A;  1OYY A;  3BDD A;  4BHP A;  3WTX C;  3I5U A;  1KA8 A;  1W5T A;  4S04 A;  1P6R A;  3I64 A;  5HDG A;  2RQP A;  2E7W A;  1FOK A;  3FM5 A;  3PQJ A;  2PN6 A;  5BPD A;  2H94 A;  3QOP A;  1MJB A;  4HQM A;  2K27 A;  4FT8 A;  4HOB A;  4GYI A;  1IXC A;  3LWF A;  2WC2 A;  4MHG A;  1XSV A;  2EB7 A;  2XAS A;  1G6N A;  5L3G A;  4BHB A;  4A0Y A;  1O57 A;  2OZU A;  2UWM A;  2OAZ A;  3IRQ A;  2M8E A;  4EMS A;  1SMY F;  2ZKZ A;  4P96 A;  4H0E A;  1W7P A;  1IUY A;  3QP6 A;  3HHH A;  4BH9 A;  2HYF A;  2CGP A;  4OIQ F;  1MZB A;  1BM9 A;  1HW5 A;  2MC3 A;  4KMF A;  1UFM A;  3OOP A;  3GO5 A;  4KN7 X;  2ZFW A;  4A2U A;  2R7D A;  5DDG A;  4HBL A;  3R60 A;  2VXZ A;  2CSO A;  2JRT A;  5BOX A;  1W7P B;  4I98 B;  4RAY A;  1QPM A;  5DV5 A;  3COA C;  2XKP A;  4KYW A;  5D5U B;  2G7U A;  3ZMS A;  1RUO A;  1YS7 A;  3F3X A;  5FB2 A;  4RGX A;  3CO7 C;  1R5H A;  4ON0 A;  4AIK A;  1SFX A;  1QO0 D;  3SHF A;  3REO A;  5E20 A;  1H9T A;  2CYY A;  3E5X A;  1D8K A;  1ZGA A;  1X3U A;  2LKP A;  5LHH A;  3J81 Z;  1LDD A;  4YFN F;  4YFX F;  2STT A;  4PCQ A;  2MBF A;  3CTA A;  1J2X A;  4WK8 F;  3GLX A;  4EVI A;  1KGS A;  4M71 A;  4U0W A;  3DF8 A;  2R3S A;  3JTH A;  1YG2 A;  1KYW A;  2Z33 A;  3LQQ A;  2A6E F;  3TO7 A;  3FMQ A;  5LEK A;  2ZBK A;  3D0S A;  4EJV A;  2RVC A;  2NRA C;  1T0F A;  1SD4 A;  1I1S A;  3KEO A;  1LNW A;  1HBX G;  1I6X A;  3RI4 A;  4ENJ A;  2EV6 A;  1IW7 F;  2HR3 A;  5LHI A;  4EQQ A;  3P7N A;  3J7A O;  5ED4 A;  4KIF A;  4LGW A;  5ICF A;  2MD5 A;  2H6C A;  5F64 A;  1RZ4 A;  4MEY F;  5DD4 A;  4IPA A;  2HZT A;  1FSE A;  3I71 A;  5EEH A;  2O0Y A;  2X4H A;  3U9G A;  4BYY A;  4EJU A;  2UXX A;  3OV8 A;  2MLK A;  2XRO A;  4CGZ A;  1YS6 A;  2ZXJ A;  4BNC A;  3C3W A;  1EH7 A;  4EJW A;  4OMY A;  2VN2 A;  5E1Z B;  2EFO A;  1ZRE A;  3KEQ A;  2DFI A;  2PFB A;  1T6S A;  2WV0 A;  1XMK A;  2W85 A;  4UVA A;  1O3T A;  3Q9V A;  2JPB A;  4A5N A;  4N9H A;  3U2R A;  2DLL A;  3LA3 A;  1RUN A;  5LRR A;  1YFH A;  4WF2 A;  3DKW A;  1BN5 A;  4A6E A;  5J6X A;  2W84 A;  5E8G A;  2GA2 A;  2EA2 A;  3L7W A;  1B59 A;  4KUM A;  2IT0 A;  2V6C A;  2OU2 A;  1LEA A;  2JZY A;  1IN4 A;  2M5W A;  3FXQ A;  5D5V B;  2NNN A;  3HRT A;  2ZME A;  4RB0 A;  2P5K A;  5D6E A;  3BPV A;  4Q48 A;  3ZMU A;  2O61 A;  3I59 A;  1G3T A;  3R6S A;  2FBK A;  1YLF A;  1QQI A;  4D0P A;  4BQA A;  3GWZ A;  2JPC A;  4AIH A;  3E3V A;  1T98 A;  1ZHF A;  2CWE A;  4ETS A;  3FF5 A;  3GUD A;  1S7A A;  3FWE A;  4ZYG A;  2XUB A;  2ZME B;  1XDU A;  4IVN A;  2XGX A;  1SMT A;  2DK5 A;  2HWV A;  1ONV A;  3HYI A;  2KIF A;  2D1H A;  2DW4 A;  5LGT A;  3I59 B;  2PMH A;  5HDN A;  4HX8 A;  1XCV A;  1WRJ A;  4HX4 A;  4L9N A;  3WTZ A;  1E17 A;  4UV8 A;  3ZMT A;  3VFZ A;  2COM A;  3EUH A;  4WXC A;  5A2Q K;  1UST A;  4LB5 A;  2MLG A;  3ZPL A;  2QQA A;  1HKS A;  1OKR A;  3NQO A;  3DFG A;  1ZLJ A;  1H9G A;  1UCR A;  5K1Y A;  2AS5 F;  3QPT A;  4EJO A;  5LRS A;  1EV7 A;  4DNC A;  2K4B A;  2OD5 A;  5E17 F;  2VOP A;  3GFI A;  1YYV A;  3J80 Z;  1U6G A;  4LD5 A;  1LB2 A;  1RNL A;  4IRH A;  2HKX A;  1GXP A;  5LHG A;  1Z91 A;  5DCF A;  3MFK A;  2XAG A;  2OZ6 A;  1B9M A;  4M74 A;  1FBS A;  2GA1 A;  2NS0 A;  3K1M A;  1AOY A;  3L09 A;  2QQB A;  5FLX K;  3T1B A;  3FMS A;  1IN8 A;  3O6B B;  4LJZ F;  2JT1 A;  3B02 A;  3QU3 A;  3JAM Z;  1IXR C;  4UXN A;  2QVO A;  3WU0 A;  2ISZ A;  3KLN A;  3D5L A;  5AIQ A;  2HQN A;  3RYP A;  4XSZ F;  4B09 A;  5J8F A;  1ULY A;  3MAJ A;  2ZO4 A;  4WCG A;  2D1V A;  5BS6 A;  4Z2Y A;  1MD0 A;  2LF7 A;  1TBX A;  4O5V A;  2MA3 A;  1G3W A;  3DV8 A;  1ZLK A;  3GVA A;  4U7B A;  2GWR A;  1I27 A;  1I1G A;  1FYK A;  3Q9S A;  5ICE A;  5D4S A;  4UUV A;  3RPU A;  1R23 A;  1XGO A;  3R61 A;  1CGP A;  3LAJ A;  1L0O C;  3PQK A;  1SD6 A;  5BPI A;  2Y75 A;  5FO5 A;  2ZNY A;  4CIC A;  3CO6 C;  4Q5S F;  1MKM A;  3KP4 A;  6PAX A;  5BMZ A;  4PGH A;  1U8R A;  2XVC A;  2L4M A;  1KQ8 A;  5ERI A;  1FC3 A;  1Z05 A;  3HHG A;  4QWQ A;  4UNO A;  4N9I A;  3LQR A;  3ISP A;  3EDP A;  4BXU A;  1R1V A;  2ELH A;  3I58 A;  1IN7 A;  4P9U A;  1KQ0 A;  3EQL F;  5BQT A;  4HYE A;  2IA2 A;  3ECH A;  3RDI A;  2HS5 A;  3U1D A;  2OBP A;  5HOO A;  2VBX A;  4YFK F;  5TJJ A;  4HAM A;  5JVT A;  1S8N A;  4OU0 A;  4PGG A;  1F9N A;  1FLI A;  3CLO A;  1PDN C;  3I54 A;  2M30 A;  1SFU A;  4LLN A;  2ZJ2 A;  3TKY A;  2M1B A;  3KCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...