4FX0A

Crystal structure of m. tuberculosis transcriptional regulator mosr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
122
Chain Sequence
AFDECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLTMSELAARIGVERTTLTRNLEVMRRDGLVRIELTAKGRAALQKAVPLWRGVQAEVTASVGDWPRVRRDIANLGQAAEAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTIONAL REPRESSOR PROTEIN
publication title The Oxidation-sensing Regulator (MosR) Is a New Redox-dependent Transcription Factor in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
total genus 45
structure length 122
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4fx0A00
2JZYA 1R00A 5IT9K 2FU4A 4WXDA 4YFXF 1ON2A 3FWEA 4LB6B 3IKVA 4GYIA 3JTGA 1EH8A 1UHMA 3ELKA 3C18A 4HF1A 2FOKA 4IF4A 4P5OA 5H20A 3W6KB 2ZKZA 3CLOA 1QNTA 2MLGA 4RB0A 3WTVC 3ZMSA 5JHUA 3U9GA 3TDUC 4Y13A 3EUHA 2ZMEA 2JT1A 2E1CA 4HX8A 3TO6A 2EV5A 1XB4A 1FX7A 3JTHA 2KIFA 2LF8A 2VT3A 2VT2A 2L01A 4KIFA 2HYGD 1SFUA 4F7ZA 1K7AA 1MKMA 3REOA 3ZMTA 1R5HA 2BEOA 3GLXA 1AOYA 5E8GA 3RTRA 2QENA 1KGSA 2A69F 1FBSA 2XAQA 2LKPA 1U5TB 2NS0A 2V1DA 5HLGA 1W5SA 2VE9A 1ZRDA 4JQFA 3ERED 1P4WA 3E5UA 3E5QA 4XRFA 1R1TA 3K1PA 3M1EA 1K79A 3R0JA 3DV8A 4MEXF 1HW5A 3ECHA 1TW2A 2A5YB 1ZLKA 4G94A 4OINF 2Q2EA 3RI4A 4ZH4F 1HKQA 2KKOA 3J81K 2LNBA 2X0LA 2IA2A 4EM2A 4HZFA 3VB2A 4EM1A 1ZLJA 3SXYA 4ENKA 5HDKA 2Q0OA 4H0EA 3V7CA 4A6EA 2EV6A 3WTUC 3MZHA 3NEUA 3V8KA 3M8EA 4P55A 4I0BA 3U2RA 5AONA 4EM0B 3CDHA 4JBAA 3K0LA 4XBFA 2Y48A 1D8JA 3D0SA 3PQKA 3ROUA 4KIGA 1IXRC 1I1SA 3KCCA 2P6SA 5BOXA 4BHBA 2D1HA 1ZRCA 4P9UA 4A0XA 1R1VA 1E2XA 1G3TA 1LB2A 1ZG3A 2QWWA 5L3DA 2GZWA 4I01A 4KT5C 4EJUA 5HVQC 5BQTA 5E20A 1ONVA 2DT5A 3DP7A 4UVAA 4ZYEA 3EYIA 3WTSC 3J7AO 4MNUA 4UV8A 1ULYA 2ETHA 4AVPA 1A04A 3EETA 2CGPA 1D8KA 2HTJA 1W4MA 2RNJA 4HW0A 3QOPA 5CVJA 1FOKA 2FA5A 4M71A 4AIKA 1IAWA 4L5JA 1HQCA 2CG4A 2EK5A 1ZGJA 5ICCA 1S6LA 2D1VA 3LAJA 2O61A 1B6AA 2BV6A 1HSTA 2ESNA 1JGSA 4WWCA 3Q9VA 1KU9A 3LWFA 3KP7A 3HSEA 2IJLA 2AXLA 3CUQB 1S3JA 5LGTA 1J9IA 3LA7A 2HYFA 1MDMB 4A12A 2V79A 4FX4A 1U78A 4ESFA 2IT0A 4CICA 3QRFF 4Q5SF 3AAFA 4KYWA 2XAFA 3ISPA 1Z6TA 3IRQA 2RDPA 5ICGA 2HFHA 3BP8A 3T1BA 1ZGAA 2YU3A 5DD4A 3JSPA 1X3UA 3MWMA 1HSJA 1B4AA 3JAMK 5BPIA 3P7NA 1BBYA 3DKWA 4LD5A 3WTZA 1Z1DA 4BH9A 5DDGA 1LEAA 2IA0A 3DEUA 1WKMA 3LA2A 1W5TA 1XDSA 1QGPA 2IVMA 3J80Z 3OOPA 2J5OA 2EJRA 5DYMA 4A5MA 3KEOA 1OPCA 4G7OF 4HX4A 4GO1A 1S29A 2Y75A 3F22A 1KQ9A 4TV7A 5J8FA 2A68F 3F3XA 5HS9A 3L09A 3HHGA 2FSWA 1T98A 1QZYA 2VOOA 4FX0A 3I58A 4HA8A 2Y0MA 5LHGA 4G6DA 2CSOA 4M6XA 4OIQF 1S7AA 3GVAA 2HGCA 2A07F 2PG4A 4CO8A 3KP4A 3QU3A 3F8CA 4L9TA 1SMYF 3WTYC 5J6XA 5A2QK 3E6CC 2H6CA 2QQBA 2H6BA 1Z6RA 4MTEA 1Z7UA 2UXXA 4AD9A 2H27A 4CGZA 2DQRA 1R1UA 3KP6A 1K78A 2ZJ2A 3RYRA 3RYPA 3QU6A 3HOTA 4ZYGA 4QLCU 2NRAC 4KNYA 3KEQA 2O6GE 3K1MA 1JHHA 5L3BA 1Y0UA 3QP5A 5D4SA 2OQRA 2MC3A 1U5TA 3RKYA 4IXAA 2PJPA 3DPLC 2DAOA 1R22A 1O57A 2GA1A 3P9CA 2XHKA 2P4WA 5LLQA 2YX7A 1AWCA 3S2WA 2HQRA 3RPQA 4WF2A 1LQ1A 2PI0A 5E17F 3WU0A 4HV6A 2MH2A 5F1RA 2F5DA 5DUIA 5E1ZB 3H3ZA 4HF2A 1J5YA 2G7HA 4KFCA 1P4AA 3RDIA 3D5LA 3L9FA 4M74A 1KA8A 2ZNYA 2OZ6A 4LK1F 4O6JA 3RJPA 2OA4A 5KVRA 3JSOA 4EGYA 1PP7U 2EA4A 1XGSA 4U7DA 1I5ZA 2VONA 1RUNA 1FBQA 2OAZA 3ABUA 4G8XA 4KMUX 3WGHA 2TDXA 3O2PE 2Z3YA 5AIQA 5E1WA 2G7UA 2CWEA 2J5PA 1R5GA 3BZ6A 1L3LA 1FC3A 2KJBA 4MGRA 2QBYB 3GW2A 2IW5A 1B59A 3WG9A 2XAHA 5HOOA 4HV5A 4CYDA 5EEHA 3GZ6A 2WTEA 2PFBA 1H9TA 2Z5UA 2F5CA 5JI6A 3KZYA 4L5IA 4OU0A 4PGHA 5LBQA 2EWNA 4HLYA 4EJWA 4XLNF 4ZYDA 3GUDA 1DPRA 4GYGA 2ZCWA 3VODA 1CF7B 3COAC 1K6OA 1OYYA 3ZPLA 1IN6A 3WODF 4KUMA 3N97A 1XSVA 3FMSA 3N4MA 3FMQA 4G6QA 1UFMA 1ODDA 3EDPA 1Z91A 3BPVA 2GWRA 1D3YA 4RGRA 1IN4A 1F4KA 1SD6A 2P6TA 3GEZA 1FZPB 1BC8C 3RKXA 3FXRA 1MD0A 1EH7A 1MDMA 5ED4A 2FBKA 3BJ6A 1YFHA 2D2WA 3QPHA 2LF7A 2M1BA 3HRTA 5HLHA 4WK8F 1FYMA 2F5FA 3F8MA 1SD4A 5K5RA 4IPAA 4ASNA 4EV0A 4Y15A 5DEQA 5DCMB 2XVCA 3HYIA 4YFNF 3LQQA 4HLXA 1LEBA 2F5EA 1TNSA 2JTVA 1ZRFA 5FLXZ 4RGUA 4OIPF 4I7HA 5LEKA 2UZKA 3C1DA 4O3MA 2M30A 4MQ9F 1RNLA 1UB9A 4WCGA 2QVOA 2M45A 4LG0B 2VN2A 3SQNA 2FNPA 2AS5F 2HOEA 1XGOA 3BJAA 2ZXJA 2ACJA 2QM3A 2ISZA 4ENNA 2HKOA 2DW4A 3FF5A 3KP5A 3T8TA 3ZN0A 2HTSA 3BY6A 2JSCA 2M87A 3DXJF 3WE3A 2EFNA 3I71A 1FPQA 3DFGA 4NQWA 1MGTA 1G3WA 1YIOA 4ZZDA 2Z33A 2V9VA 1QBJA 1P2FA 2NAZA 2VBWA 2PBIA 2MA3A 3F23A 1WWXA 2MBFA 5CJ9A 5CVRA 2K27A 1IF1A 4U0WA 4EMSA 2HEOA 4UVCA 4R1HA 3HUGA 3IC7A 1ZARA 2RV8A 3WTWC 5LRRA 3LSTA 1IN8A 1IZ1A 1W7PB 4M9ZA 3BOQA 3TO7A 2DBBA 2UWMA 1S7OA 4R79A 4RAYA 1VTNC 1IRGA 5D4RA 4HYEA 1FWZA 1GHCA 4KA4A 4XLPF 1UHWA 4KIBA 4HQMA 1O7LA 4WXCA 1FBUA 4LGWA 5EEGA 3K69A 3GWZA 1G3SA 2FBHA 1NHAA 3SZPA 2JRTA 1U6GA 3DQVC 2HWVA 2XV4S 3F8BA 5TJJA 2JPBA 1R36A 2DK8A 4BNCA 4NHJA 1BJAA 3TQNA 1KU2A 1U2WA 2HKXA 4ZYHA 3LQRA 3I4PA 1H9GA 3FM3A 5D6EA 3NRVA 3KE2A 3KFWX 3MCZA 1IN5A 2OQGA 1SAXA 3VFZA 2ADUA 1QO0D 5J8CA 4HQEA 4IRGA 4OIRF 1YS6A 5LGUA 3E6DA 3Q9SA 1I1GA 2FF4A 4M72A 3R60A 2WC2A 4RB1A 2E7XA 1T2KA 2RN7A 4GXOA 4L9JA 5HDGA 3V7SA 1F5TA 3WU1B 4IRIA 1UCRA 3RKWA 5ICEA 2W85A 2OU2A 4LB5A 3HTUA 4AWXB 2L54A 1USTA 2ZMEB 4MEYF 5BPDA 1GXPA 4KN4X 2XROA 1BI1A 4HAMA 3TO9A 2QQAA 4IJAA 1O7FA 2QBYA 3P9IA 2W84A 3HTSB 1LJ9A 4S04A 2P7CB 2PMHA 3VOEA 4EJVA 4ESJA 4L0ZB 2DPUA 4G7ZF 2V1XA 3IKTA 3ZMDA 3E6MA 4BHPA 5IT9Z 2FRHA 1T38A 3I54A 4L9NA 2G9WA 2E1NA 1F9NA 1CF7A 4MQVA 4LK0F 1SFEA 3FM5A 5BMZA 2O8XA 2H94A 2ELHA 1WRJA 1V3FA 2HR3A 4HOBA 3CO6C 2ZBKA 3NQOA 4L0YB 1G4DA 5D5WB 3KLOA 1JXSA 3M9AA 3KLNA 4XSZF 2X4HA 2P8TA 1O3TA 1HBXG 5DUKA 4BXUA 5JVTA 1FP2A 3PFIA 3VEPA 1YW8A 3K9TA 4DQ2A 3C3WA 3MQ0A 4I98B 1Z05A 4BYYA 3F21A 2O0YA 3DPTA 3K2ZA 4B8XA 1YG2A 3V4GA 4PDKA 2R7FA 2BYVE 2W24A 1BI3A 2L4MA 5DCMA 3I59B 1USSA 5D5XB 1U3EM 3TOAA 2FXAA 3FX3A 1HXDA 3E5XA 3BPXA 1XCBA 5FFZA 2A6HF 2KRFA 2IP2A 3EQLF 2A3SA 4IHSA 3QPTA 2DPDA 1FSEA 1DDNA 1ON1A 2OBPA 2DI3A 5H6QA 2FMYA 5BS6A 2K4BA 2FQ3A 2VXZA 3WTTC 1ZHFA 2PLYA 3SZTA 1T0FA 4LG0A 4K2EA 1SMTA 3R6SA 2PEXA 5HS8A 2VOPA 1YLFA 1RI7A 3J81Z 4UVBA 4O5VA 1LDKB 4EQQA 3CUOA 4HF0A 4UHTA 2HZTA 2QYOA 5CVUA 3C7JA 3KP2A 4WX9A 1XSXA 5DCFA 2RQPA 2VC0A 3FXUA 2D45A 1XCVA 1B9MA 3HRUA 3K1NA 5FB2A 2YSRA 2RGVA 4PGGA 2DK5A 5CLSA 5K1YA 1TQMA 3QAHA 5CVIA 3ECOA 1P92A 5LHIA 2Z9OA 3GXOA 1KU3A 2IA1A 4HDVA 2CYYA 1MJBA 3FHZA 2WV0A 1RUOA 1XN7A 3TOBA 1TNTA 3LFKA 3WGIA 2GXBA 3O6BB 4FHTA 3HSRA 4E70A 1ZN2A 5FD5A 4UXNA 1PP8F 3G73A 3ZP5A 1ZH5A 1STZA 3TKYA 4DNCA 4ENMA 2M8EA 5FGMA 2GIVA 1HW1A 4YIIA 5E18F 1OYIA 1KU7A 1BIAA 4ENJA 1DUXC 1I27A 5L3CA 4EGZA 3GFMA 1ZAOA 3ZMZA 2GAUA 3TGNA 2XAJA 4XSXF 2A61A 4NB5A 3GX4X 3V8LA 3P9KA 2UXNA 4L9VA 2W57A 4KMFA 3SFZA 3J80K 4BAYA 1LDDA 3FMRA 1Z9CA 2P5KA 1XSDA 2P5LC 1FT9A 1J75A 1CGPA 1FSHA 3CJNA 4UNOA 1GVJA 2M5WA 3SHFA 2VE8A 1KYWA 3CUQA 3RPUA 1ZYRF 2PQ8A 5ICFA 3IL2A 4CHUA 2CW0F 3GFJA 3KZZA 1FYKA 2L4AA 3I64A 1OYWA 1PUEE 3ULQB 3ML6A 1GXQA 3BJOA 2DFIA 2XASA 2RVCA 4Z2YA 3JAMZ 5L3EA 2XAGA 1E17A 5D5UB 4BHCA 1IW7F 3I0TA 4WXHA 3FZVA 1EH6A 1O3SA 3MEXA 4I02A 4D0PA 2VC1A 3HHHA 4LMYA 3EYYA 3V7RA 1QQIA 2NNYA 2KIMA 2EFQA 4HX7A 1K78B 1TTYA 3RIRA 1MJ9A 5FO5A 1O3RA 5K5OA 2KJCA 4GCVA 3ZMVA 1RZ4A 1ZG5A 1WQ2A 1SD7A 1BI2A 1SD5A 2V1UA 2CQKA 5HLIA 2COMA 5K5QA 5ILVA 4Q47A 1XGMA 2DU9A 5F6FA 1YQAA 1SFXA 2GQQA 2RKHA 2MH9A 1IN7A 1YO5C 2BBYA 1G6NA 3H92A 1LDJA 5JFRA 1BC7C 1BN5A 1J2XA 2FEZA 1IUYA 2QQ9A 4U0VA 3F8NA 3E6BA 2NYXA 3O3KA 1B1BA 5A2QZ 1LNWA 3L2CA 2ZFWA 2ZNZA 2F2EA 3MZYA 4ETSA 4EJTA 5E8IA 2HDCA 4I09A 3U1DA 3W6JB 3IHUA 5IT3A 1H0MA 4P9FA 3BDDA 2ZO4A 5D8KB 4A5NA 1TLHB 4A0ZA 3I59A 4OMYA 4UUVA 1O3QA 4B09A 2C6YA 1KYZA 2O03A 1TQIA 1REPC 1YS7A 3V8JA 3I5UA 4RS8A 3GO5A 1XGNA 2K4JA 5HS7A 1L0OC 3L7WA 5DD8A 4GGGA 5LEJA 3B73A 2QZ8A 4UV9A 3GFIA 3R61A 2STTA 4IRHA 1T39A 5H6RA 3MAJA 1MZBA 2FE3A 2B0LA 3I53A 4R8HA 4LLNA 4S05A 1W7PD 1HW2A 3KETA 1V4RA 3HRSA 2VBYA 2QLZA 3M8FA 2L02A 3B02A 4N9IA 3ZQ7A 4AIJA 5D8LB 5CVVA 4M73A 3F72A 4G7HF 1TQPA 4ESBA 2GXGA 2FBIA 2CO5A 4LLGF 2LSOA 2EFPA 5CYVA 5FFXA 1XD7A 4OIOF 4YG2F 1YW9A 4U0YA 1LVAA 3CTAA 5KK1A 2JPCA 1QPMA 1EV7A 2HS5A 1R7JA 1BOAA 4YIFA 4Q48A 3ABTA 1HKTA 1IRFA 2HQNA 2K7LA 4IHTA 5HDNA 1J7KA 2DQLA 2R7DA 2V6CA 4PCQA 2XKOA 6PAXA 2DTRA 4CZZA 1J0RA 2XIGA 2O3FA 5D6FA 4I0AA 5LHHA 2WWYA 3R0AA 4LJZF 2P7VB 3OV8A 1YYVA 1ZG1A 1WSUA 1OR7A 5FLXK 1JE8A 2EB7A 3Q5FA 1G3YA 2R3SA 4U7BA 5AIPA 1WI9A 3M7GA 1BIBA 3WE2A 4M9XA 1FNNA 4FT8A 3L00A 2GA2A 1D5VA 4N9HA 3ZMUA 2PMUA 1OMIA 4N0BA 4EJOA 1RIOH 2STWA 1P6RA 3IWFA 1C0WA 2OD5A 2Z99A 2DLLA 1U5TC 2P5VA 3TDZC 2NNNA 4QWQA 3T0YA 4OMZA 5ILUA 3GF2A 4RGXA 2EA2A 1KQ0A 4Y17A 2XRNA 3E3VA 5L3GA 4MTDA 4LLLA 2FNAA 3H3UA 4BQAA 1OKRA 2VBXA 2FMLA 2W25A 1KQ8A 4RGSA 3F6OA 2XUBA 3LAPA 3DF8A 1HKSA 1R58A 3T5XA 3BROA 4A2UA 2VODA 5LRSA 5JR3A 3F6VA 1YW7A 1F1ZA 3IRRA 2H09A 1I6XA 4MHGA 2K86A 2RC4A 1P4XA 4KDPA 2IPQX 1Q1HA 4YFKF 2YX4A 3CO7C 2BE5F 2QUFA 2E7WA 1FYLA 4Q4ZF 5ILSA 3PQJA 2BGCA 4OOIA 3GZ5A 1DP7P 4P96A 1FP1D 5DV5A 2CFXA 5F64A 4AIHA 3F8FA 2DO7A 4HDUA 2KIUA 2EFWA 4PZJA 2Q8KA 1XDUA 1U8RA 3HSFA 5FD6A 3MFKA 2K02A 1R23A 1TBXA 1BI0A 4U88A 2IRFG 1BM9A 2LDUA 3T8RA 1DPUA 2EV0A 3FXQA 4M6YA 1W7PA 3R4KA 3HIFA 4KN7X 1XMKA 1B9NA 2ESHA 4RB3C 1IXCA 1S8NA 1TW3A 3BWGA 5ERIA 1MJAA 4I2OA 4A0YA 2MLKA 3WTXC 4JK1X 4ON0A 5TRDA 1YTYA 2YR2A 4A6DA 3GYHX 3IWZA 4CDGA 3GFLA 4RAZA 3HRMA 4CXFA 3E97A 4LFUA 3WGGA 3ZN1A 3CUQC 5L3FA 5E1XA 1PDNC 2ISYA 4G9YA 1J59A 4M9SA 1ZREA 4EVIA 4HBLA 5LGNA 2OZUA 4L18B 1JHFA 1IXSB 5D5VB 3LA3A 2L3DA 2MD5A 1QZZA 4RB2C 3JW4A 2EFOA 4KICA 3HOSA 2A6EF 2XKPA 3KP3A 2YPRA 4IVNA 1XMAA 4ZZLA 2XGXA 2PN6A 2VBZA 1FY7A 3QP6A 3G3ZA 1FLIA 1T6SA
chains in the Genus database with same CATH superfamily
1T33A 3PNVA 5FKOA 2JZYA 5LD2C 1R00A 2F4MB 5IT9K 1FOXA 4B3AA 2FU4A 3UR3C 1KZHA 4WXDA 2TRTA 4YFXF 1ETXA 1ON2A 3FWEA 1K4SA 4LB6B 2DA5A 1APLC 3IKVA 4GYIA 3JTGA 2DTZA 1EH8A 4ABZA 1LPQA 1UHMA 3H9JA 3OYEA 1QA6A 3ELKA 2JA7J 1R4MB 2F48A 2KL4A 3MD2A 3C18A 1LFUP 1ZR4A 4HF1A 3A01B 2KIQA 1YOVB 2R7WA 2FOKA 3RQIA 2E35A 4IF4A 4P5OA 3GTJJ 2HVSA 1IRZA 5H20A 3W6KB 2ZKZA 3CLOA 1QNTA 2IGMA 1VFCA 4UUTA 2MLGA 4RB0A 5GAHJ 4DYQA 2XPUA 3ZMSA 3WTVC 5JHUA 3U9GA 2VKEA 3TDUC 1HCRA 4Y13A 3S2HJ 1WHUA 4AM3A 2EINH 4CYCA 2CQ7A 3EUHA 2ZMEA 1RR7A 3ZCOA 2JT1A 2M4KA 1TWGJ 1EKEA 5IPAA 2E1CA 3OYJA 4HX8A 3TO6A 2EV5A 1W36D 1X4PA 1XB4A 1FX7A 3JTHA 3QPSA 2KIFA 2LF8A 2VT3A 4A3GJ 2CUEA 3HM5A 2VT2A 2L01A 4KIFA 3M4OJ 1N77A 2X1CA 2HYGD 1SFUA 5EZHA 1BA5A 4F7ZA 2WY7Q 3PM1A 1K7AA 1MKMA 3REOA 5E3MA 3ZMTA 1R5HA 2BEOA 3ABLH 4C3IJ 3GLXA 4Y33A 3DTKA 1AOYA 5E8GA 3RTRA 2QENA 2PJRA 1KGSA 2A69F 1FBSA 2NVTJ 4DZPA 5J1YA 2XAQA 2LKPA 1Z3YA 3HPHA 2E2JJ 3S2DJ 1U5TB 2NS0A 1Y56A 2V1DA 5HLGA 1W5SA 2VE9A 3G71I 1ZRDA 3BQZA 4JQFA 3ERED 5GADJ 1P4WA 3OYDA 3E5UA 3E5QA 4XRFA 1R1TA 3K1PA 3M1EA 1AA7A 2LVSA 3HOXJ 3R0JA 3DV8A 1BR1A 1K79A 4MEXF 1HW5A 2I10A 4XOPA 3ECHA 1TW2A 2A5YB 3B6CA 1ZLKA 4NBQA 3RSNA 3NWSA 4G94A 3GTPJ 4RBOA 3A4CA 1Y8QB 2Q2EA 4OINF 4XICA 5TISC 3K4CA 3RI4A 4ZH4F 2Z2SB 5J4VA 3JRBA 2A6TA 2KFDA 1HKQA 1R5ID 2L9NA 4RM3A 3DBLB 2KKOA 2VASA 3J81K 2LNBA 1ITYA 4BY1J 2NVQJ 2E36A 3MZ8A 5EG0A 2X0LA 2IA2A 4EM2A 4HZFA 3VB2A 4EM1A 1ZLJA 1OCRH 3SXYA 4ENKA 2BVMA 3S1QJ 4GDFA 3F9KA 2JSPA 4Y3OA 2VIXA 5HDKA 2V7FA 2R7VA 2Q0OA 4H0EA 3V7CA 3HBLA 4A6EA 2KZVA 2Z16A 2EV6A 1FIAA 3WTUC 3MZHA 1X2MA 3P5JA 2CMPA 1SVLA 3NEUA 4N4NB 3V8KA 1TT0A 3M8EA 4P55A 1IV8A 4I0BA 3U2RA 1OCCH 3K4JA 1POGA 2XGDA 3K70C 2O5RA 5AONA 4EM0B 4BGDA 4NUBA 1QHHD 3DU6A 3CDHA 3CJTB 2LTPA 2HNHA 4IHWA 4JBAA 3K0LA 1VF9A 2KHMA 4XBFA 1E3PA 4A3MJ 2Y48A 2BHYA 1D8JA 3D0SA 3PQKA 3PSIA 5J1UA 1WH5A 3QOEA 4KIGA 3ROUA 1IXRC 1I1SA 3KCCA 2P6SA 5BOXA 3S93A 4BHBA 2D1HA 2K9NA 3CCYA 5J4YA 1ZRCA 4P9UA 2ZSHB 2JA8J 4A0XA 4M3GA 1R1VA 5K7ZA 2EZHA 3CC2I 2JN6A 1E2XA 1G3TA 1BOBA 1ZG3A 4U87A 1LB2A 3K4KA 1X1AA 2QWWA 5E3LA 5L3DA 1X19A 2GZWA 4BXFA 4I01A 4KT5C 4EJUA 5BQTA 5HVQC 3PSFA 5E20A 4JYKA 1P9QC 4HG2A 1TC3C 3HB9A 2VXDA 2O7OA 1ONVA 2DT5A 3DP7A 4UVAA 4ZYEA 4QTRA 3EYIA 4BJTA 3WTSC 3J7AO 4MNUA 2VJ5A 4CCNA 4UV8A 3CCJI 1O4XA 1YIJI 1GT0C 1OFCX 1ULYA 3OR1C 4BDZA 2OC6A 4LITA 2ETHA 4AVPA 2XB0X 1A04A 1RESA 3EETA 2CGPA 2L2OA 1D8KA 2HTJA 1W4MA 2RNJA 2VJ4A 3LSMA 4HW0A 4DOZA 3QOPA 5CVJA 4LOCA 4E4HA 4D5CA 1FOKA 1IGNA 5KCMA 2FA5A 3ZQLA 2LOOA 3A03A 4M71A 4AIKA 1IAWA 4CA0A 3MKLA 1ETQA 4L5JA 2BW3B 1HQCA 3KYCB 4D7NA 2CG4A 2EK5A 4A3EJ 1ZGJA 1K4TA 5ICCA 1DU0A 3OYBA 1S6LA 2D1VA 3JRCA 3G4SI 3LAJA 2O61A 1B6AA 2BV6A 1HSTA 2ESNA 1JGSA 2DT6A 1GVDA 4BXXJ 1T95A 4WWCA 2FOWA 3Q9VA 1KU9A 1MBEA 3LWFA 3KP7A 3CCEI 3HSEA 2BZTA 1VQ9I 2IJLA 2AXLA 3CUQB 1S3JA 5LGTA 1J9IA 3LA7A 2HYFA 2GOXB 1MDMB 4W1UA 2WB1A 4A12A 2V79A 4FX4A 1U78A 4ESFA 2IT0A 2LP0A 2VQCA 4CICA 2XF5A 3CCRI 3QRFF 4Q5SF 4IQJA 3AAFA 1FTZA 4KYWA 2XAFA 2LFBA 3ISPA 1EJ9A 1Z6TA 3GTOJ 3IRQA 4F93B 3PL8A 2RDPA 1ETWA 4RAGA 2HFHA 5ICGA 3BP8A 2FX0A 4IHXA 3FXMA 3W6VA 1WCMJ 4XLFA 4XMYA 3T1BA 1ZGAA 2YU3A 1D1AA 3CCVI 1WPKA 1VNDA 2K40A 5DD4A 3JSPA 2X9DA 4V19K 1TWFJ 1X3UA 3MWMA 1HSJA 1B4AA 3JAMK 5BPIA 4GRIA 4BQQA 3P7NA 5FROA 1BBYA 3H3VK 3DKWA 4LD5A 3WTZA 1Z1DA 1OCZH 1P7JA 4BH9A 5DDGA 4XM3A 1V54H 4XLAA 3OYHA 1VQOI 2VJJA 1LEAA 2IA0A 3DEUA 3HGGA 3OMYA 3OWTA 2V9PA 1WKMA 3LA2A 3ZQCA 1ENHA 1W5TA 1XDSA 1QGPA 2M7AA 3K4LA 2IVMA 3OL3A 3J80Z 4A3FJ 4IOAF 3HC7A 2HXIA 2F4OB 3OOPA 4QSHA 2LY9A 4C3HJ 3CMMA 2J5OA 1I6HJ 3CC7I 1W0UA 3H1CA 2EJRA 4PJ0C 2V26A 1X3WB 2IS1A 5DYMA 4A5MA 3KEOA 1OPCA 3MMYB 4G7OF 4HX4A 3DKYA 4GO1A 1JUMA 4J01A 5EYRA 1S29A 3VYSB 1DU6A 2Y75A 3F22A 1D5YA 1KQ9A 4TV7A 2XGEA 3O8GA 5J8FA 2V9KA 2A68F 3F3XA 5HS9A 3L09A 3HHGA 1F36A 2E34A 5KNLA 2FSWA 1T98A 2N8GA 3AFHA 2JVHA 2R92J 2R7OA 1QZYA 1W1WE 4PUSA 5M5XJ 2VOOA 4FX0A 1XC5A 1X1CA 4NQWB 3I58A 3QQAA 4FISA 4HA8A 2Y0MA 2E71A 5LHGA 4G6DA 2CSOA 4N4OB 3ZQHA 5C4XJ 4M6XA 4OIQF 3K7AJ 1S7AA 3GVAA 2HGCA 4E7JA 3TMOA 2LMDA 2KDZA 3VPRA 1LE8B 2A07F 5JHFA 5M3FJ 2PG4A 4CO8A 3KP4A 3QU3A 1GUUA 3F8CA 5H2FC 4L9TA 1SMYF 3WTYC 3LMMA 5J6XA 1WJAA 3BC8A 5A2QK 3E6CC 3RZDJ 3ZQIA 2OJED 3HUGB 2H6CA 2Q1ZB 2R5YB 3TW7A 2BY3A 2OV7A 2WB1N 4FASD 2QQBA 1K61A 2H6BA 1Z6RA 2KMUA 4BY7J 4MTEA 1Z7UA 2UXXA 3FKJA 4AD9A 2QSFX 2YS9A 2H27A 4A3JJ 4CGZA 2DMNA 2DQRA 2W1OA 1MH4A 3DWLE 2JA2A 1R1UA 3GTKJ 3KP6A 1K78A 2ZJ2A 2IS4A 4D1QA 2A05A 3RYRA 3BLYA 2DA1A 1HDPA 3RYPA 4BKXA 3FXOA 2CQQA 3QU6A 3HOTA 4ZYGA 4QLCU 2NRAC 4X6AJ 3DLAA 4KNYA 3KEQA 3VSKA 3HG9A 1HOMA 2O6GE 3K1MA 1JHHA 3CMEI 5L3BA 4KITB 4XKBA 2LLKA 4H4KC 1Y0UA 3QP5A 4HEA2 4J19A 4ZDOA 1MMDA 3GMEA 5D4SA 2BHZA 2OQRA 2MC3A 1U5TA 1PUFB 3RKYA 2DA7A 4IXAA 2PJPA 3S1NJ 3DPLC 1XPXA 3ZRGA 2DAOA 1R22A 1O57A 5KAIC 2BXYA 2GA1A 1FMVA 3P9CA 3E1SA 3CMYA 2XHKA 2P4WA 4HSTA 5LLQA 2YX7A 1AWCA 3S2WA 3DEEA 2JMWA 2HQRA 3RPQA 4WF2A 2EZLA 2RREA 1MIJA 1LQ1A 2PI0A 3LSPA 5E17F 4F55A 3TL4X 4HV6A 3WU0A 2V6EA 5FRNA 2MH2A 3CZ6A 3K6GA 1G59A 5F1RA 2F5DA 1TL8A 3IP4B 4ANJA 5E1ZB 5DUIA 4ZC3A 3H3ZA 4HF2A 1ZK8A 2AXTC 1J5YA 1ZELA 2G7HA 4KFCA 5F1JA 1P4AA 2QSGX 2HYJA 2LY2A 3EUKL 4XONA 4PK4A 3D5LA 3L9FA 3RDIA 5JLXA 4M74A 4IHVA 3I9V2 4RMNA 1KA8A 2ZNYA 2OZ6A 4LK1F 1VQLI 4FTHA 4A3LJ 2Y69H 4O6JA 3RJPA 1D1BA 3M3YJ 3W3CA 1X4OA 2OA4A 5KVRA 1UMQA 2R7UA 3JSOA 4EGYA 1PP7U 4FQGA 1YRNB 3OIQA 2EA4A 1BJZA 4Z6YA 1MMAA 1JUSA 1XGSA 4U7DA 1I5ZA 5J40A 5IY5H 2VONA 2HOAA 3ERMA 4BQOA 1RUNA 1NTCA 2LG4A 4LIUA 2MG4A 1FBQA 2OAZA 3RQ4A 3PIOF 4B4CA 1BW5A 2IGOA 3ABUA 2OUMA 4G8XA 4KMUX 3WGHA 2TDXA 4DBQA 3O2PE 2Z3YA 5B1AH 5AIQA 2L7KA 1TWHJ 5E1WA 2G7UA 4LIVA 3I56I 2CWEA 3FBNB 4E7ZA 1D0XA 3OR2C 4RLFA 3GBGA 2J5PA 3ABKH 1R5GA 3BZ6A 3EUAA 1L3LA 1FC3A 2KJBA 4E7SA 3ZGKA 4MGRA 2QBYB 2KZGA 3GW2A 4DBRA 2IW5A 4QIWN 1B59A 4QPQA 3A02A 3WG9A 2WBMA 2BXZA 2XAHA 5HOOA 4HV5A 4CYDA 2DOEA 5EEHA 3GZ6A 5F27A 2WTEA 2PFBA 1H9TA 2Z5UA 2F5CA 5JI6A 2W48A 3KZYA 4OAZA 4L5IA 4DW6A 1K83J 4EATA 1MMNA 4OU0A 3OS0A 1JJ6C 4PGHA 4BE2A 1R71A 5LBQA 3LOCA 2OCCH 2EWNA 3A0HC 2ZFUA 4HLYA 2HDDA 4EJWA 4XLNF 4ZYDA 3GUDA 1DPRA 4GYGA 2ZCWA 2DDBA 1S5LC 3BR2A 5J47A 3VODA 1CF7B 2ZXIA 2CFOA 4C2TA 3HXLA 3COAC 1K6OA 3EUHC 2DMTA 1OYYA 2ZMEC 3VYRB 3ZPLA 1IN6A 2B63J 3HZJA 3S15J 3WODF 2AQEA 4KUMA 2GBYA 3N97A 1XSVA 3C2GA 3G1MA 2QEXI 1QPIA 2EH3A 3FMSA 3IAS2 3FMQA 3N4MA 1Z3XA 5FRMA 4G6QA 1UFMA 1ODDA 3OIOA 3EDPA 1IC8A 2VQLA 1Z91A 3BPVA 3K4BA 2GWRA 1D3YA 4Y4RA 4RGRA 2ZB9A 1V55H 4II2A 3S17J 2ID3A 4IQ4A 3PUBA 1IN4A 1VQ7I 1F4KA 1SD6A 3M1CA 2P6TA 3GEZA 1FZPB 1BC8C 3OYNA 3RKXA 3FXRA 1MD0A 1EH7A 3QYBA 1VQPI 1ZR2A 3CF5F 1SC7A 1MDMA 5ED4A 2FBKA 1LKXA 4XRMA 4G6TB 5B1BH 3BJ6A 3N05A 1YFHA 2D2WA 2ZXHA 3BG3A 1JGGA 3QPHA 2M8GX 2LF7A 1VQ8I 4ZDLA 2M1BA 3HRTA 4FETA 5EZGA 5IP7J 5HLHA 4WK8F 1FYMA 2DFEA 2F5FA 3F8MA 3WHCA 2Z1DA 1YX3A 4XLHA 1SD4A 5K5RA 4IPAA 4ASNA 4EV0A 1IV6A 4Y15A 5DEQA 1YX5A 2H1LA 5DCMB 2XVCA 3HYIA 2LBFB 4W97A 4YFNF 2IBDA 2DCEA 5B66C 2RQQA 2XRLA 3LQQA 5EF6A 2QCOA 2P81A 1XX5A 3CJRB 2DYRH 4HLXA 1VQNI 3AG2H 4BJ5C 1LEBA 2F5EA 3PJRA 4HNVA 1TNSA 2JTVA 2BY0A 1MH3A 1ZRFA 5FLXZ 4RGUA 2IAIA 1X3ZB 4OIPF 4I7HA 5LEKA 2UZKA 3C1DA 4O3MA 3F0CA 2M30A 4MQ9F 2HVRA 3HOUJ 1T08B 2R7QA 1RNLA 4LG3A 1A6IA 1XS9A 1JTXA 4IKFA 1FEXA 1UB9A 4WCGA 2QVOA 3ONQA 4B44A 2QGUA 3TP0A 2M45A 4LG0B 3S3NA 2EIMH 3H9QA 2VN2A 2OCEA 3SQNA 3FXLA 2ZXWH 3IH3A 4KJZA 2FNPA 3B6AA 1AKHB 4F91B 2AS5F 2HOEA 2K5CA 3LFUA 4YRVA 1DP3A 1BL0A 1XGOA 1WJDA 3OL4A 1IO2A 3HOWJ 3BJAA 2ZXJA 2ACJA 1Z7LA 2QM3A 2ISZA 4ENNA 3VWBA 2HKOA 5F0CA 2DW4A 3FF5A 3KP5A 5KAFC 1HC8A 3T8TA 3ZN0A 1E3OC 4F3QA 2HTSA 4E7LA 3BY6A 2JSCA 2RAEA 3AG4H 2M87A 3SEQA 1SVOA 3DXJF 2K9MA 3TBIA 3WE3A 2EFNA 3I71A 2L5QA 1FPQA 3DFGA 1XTAA 2DFFA 2LRDA 4NQWA 1MGTA 1T56A 1G3WA 1YIOA 1X1BA 2DJIA 2K3PA 5DTDA 4ZZDA 2Z33A 2V9VA 3E0JB 1QBJA 3QYFA 1P2FA 2NAZA 2VBWA 3K10A 3GZNB 4PJNA 2PBIA 1SEUA 2MA3A 3F23A 1WWXA 1IJWC 1LE8A 1LFBA 4XLCA 2MBFA 5CJ9A 5CVRA 2K27A 2Y30A 1IF1A 4U0WA 1T8IA 4UUSA 4EMSA 2GOMA 2VL8A 4B43A 2HEOA 4DYCA 1YITI 5HODA 1TT5B 4UVCA 4XR6A 1XMXA 2L7ZA 4R1HA 4RAFA 3A1YA 3HUGA 4FE7A 3IC7A 1ZARA 2QF7A 2RV8A 2KT0A 2R93J 3WTWC 5LRRA 3LSTA 1IN8A 1IZ1A 1W7PB 4M9ZA 2QSHX 2HVQA 3BOQA 3TO7A 2DBBA 2UWMA 3S1MJ 1S7OA 3CJQB 4R79A 4RAYA 1VTNC 1IRGA 2E1OA 2CUZA 1BR2A 3IUOA 5D4RA 4JX6A 2ID6A 4HYEA 4KISA 1IDYA 1FWZA 1GHCA 3WU2C 4KA4A 4HSRA 2HI3A 1UHWA 4XLPF 4KIBA 3HDDA 2IGNA 2ICWG 4HQMA 1O7LA 1V5EA 1SVMA 4WXCA 1FBUA 4LGWA 5EEGA 3K69A 3GWZA 2KDOA 1G3SA 2FBHA 1AHDP 1OQYA 4MFDA 2CW8A 1G8XA 1NHAA 3SZPA 2JRTA 1U6GA 3DQVC 3JRIA 2HWVA 2XV4S 2XB5A 3F8BA 2DMPA 3M8JA 3DLLF 2NOJB 5TJJA 5EJCA 1MNDA 3JRHA 2JPBA 1PUFA 1I50J 1R36A 2DK8A 4IL6C 1U9NA 4BNCA 2JJ7A 4NHJA 1BJAA 3TQNA 5C3EJ 1KU2A 1U2WA 2HKXA 3JREA 4ZYHA 3LQRA 3I4PA 1H9GA 2XAUA 2Y0SA 3FM3A 4IHYA 4BUPA 1B8IA 3SDGA 5D6EA 3NRVA 3KE2A 3KFWX 4PJLA 3MCZA 4RA2A 2JA6J 1IN5A 2FD5A 2X6OA 2OQGA 4BBRJ 4UB6C 1SAXA 3VFZA 4A69C 3OS1A 2M7BA 4OWRB 5DM7F 5LFAA 2FJ1A 2ADUA 1QO0D 5J8CA 3K4MA 5IOZA 1Y39A 4HQEA 1RRJA 4HNUA 4X0GA 1U8BA 5EGOB 4DJAA 3BZCA 4IRGA 4OIRF 1YS6A 1SANA 5GTHC 5LGUA 3E6DA 1RR8C 3Q9SA 3Q0UA 3J7ZI 1I1GA 2FF4A 1LFPA 2DA4A 1NK3P 4M72A 3R60A 2WC2A 4RB1A 2E7XA 5HNHA 1T2KA 2XSJC 2RN7A 4GXOA 1OR7C 2KISA 4L9JA 2KLOA 2XF6A 5HDGA 3V7SA 1F5TA 1YRNA 2JQ7A 2JVGA 3WU1B 4IRIA 4YIRX 2JRMA 1UCRA 1EA3A 1W36C 2VKHA 3RKWA 2NS8A 5ICEA 4D7MA 3ASOH 4AYBA 2W4SA 2OU2A 2W85A 4LB5A 3HTUA 5GAGJ 4BDYA 4AWXB 2W7NA 2L54A 3CCQI 3SDBA 2HDWA 4KT6A 4BE1A 1JI8A 2EZIA 1USTA 2ZMEB 4MEYF 3GTLJ 3OYCA 1QRYA 5BPDA 1GXPA 4KN4X 2XROA 1ETKA 3I4MJ 1BI1A 4HAMA 1JT0A 3TO9A 2QQAA 4IJAA 2MD0A 1O7FA 2QBYA 1TP4A 2YU9J 3P9IA 1ZQ3P 2DN0A 4XN0A 2K9SA 2W84A 3HTSB 1LJ9A 4S04A 2P7CB 2PMHA 1Z77A 3VOEA 3S16J 2X1EA 4EJVA 2KQRA 3J7AY 4ESJA 4L0ZB 2DPUA 4G7ZF 2V1XA 3IKTA 3KIOA 1JT6A 4BL0B 3ZMDA 4CCLA 3FXJA 3E6MA 3FIWA 4C2MJ 2WAEA 4BHPA 2LREA 3ESWB 5IT9Z 2FRHA 2GIZA 1T38A 3I54A 4L9NA 2R7ZJ 2G9WA 1F9NA 3PNTA 2HQAA 1CF7A 4C3JJ 4MQVA 4LK0F 1SFEA 3FM5A 2B7EA 3OYFA 3LNQA 5BMZA 2O8XA 2Y0SN 3QPLA 2H94A 2ELHA 1WRJA 1V3FA 2HR3A 3BR0A 3NARA 3CQZJ 3IH4A 4HOBA 3CO6C 2ZBKA 3NQOA 1R4NB 3ZOBA 2XSDC 1MSFC 4BACA 4L0YB 1G4DA 5D5WB 3KLOA 1JXSA 2O8KA 2FUG2 3MN2A 2VPRA 3M9AA 3A01A 2DXIA 3KLNA 4XSZF 2X4HA 2P8TA 1U9OA 1FOWA 1O3TA 5DUKA 4BXUA 1HBXG 5JVTA 2NVYJ 3ZQFA 2VLAA 1FP2A 3LSIA 3GTMJ 4XIDA 3PFIA 5E3OA 3VEPA 1YW8A 3CDLA 3PFYA 2B9SA 3K9TA 1TWCJ 4DQ2A 1JKOC 3C3WA 5F0HA 3MQ0A 3L1PA 4I98B 1Z05A 3BR6A 4C2UA 1PVEA 2LK2A 4BYYA 1R6RA 2X6YA 3F21A 1DQUA 1MBGA 4PSWA 2O0YA 3DPTA 3K2ZA 4B8XA 3W2AA 1YG2A 2ELKA 2WY8Q 1QHGA 3SEZA 3V4GA 5EEAA 1IDZA 4PDKA 2R7FA 2BYVE 2W24A 1ETYA 2MYSA 1BI3A 2FQ4A 3OSGA 2L4MA 5DCMA 2LBFA 3MVPA 3I59B 4XOTA 1USSA 2VQGA 2R7SA 5D5XB 1U3EM 4AYBN 3TOAA 2FXAA 2LKSA 3FX3A 1HXDA 3H0DA 3E5XA 3BPXA 3GCMA 3LSKA 1XCBA 5FFZA 2A6HF 2VB6A 2M2EA 3UNGC 3K4NA 2KRFA 2QKLB 2IP2A 3EQLF 2A3SA 5DS9A 3L2RA 4IHSA 1UZCA 3A0BC 3QPTA 2DPDA 1FSEA 5CKTA 5M5YJ 3SYTA 1DDNA 1ON1A 2OBPA 3ASNH 3HPGA 1NG7A 2DI3A 5H6QA 2MFZA 4YELA 2FMYA 5BS6A 2K4BA 2X48A 2FQ3A 4V2GA 2VXZA 1FTTA 3BTCA 4M3FA 1ZHFA 3HGYA 4NNJA 3SZTA 2OPTA 4CH7A 3WTTC 2PLYA 3S32A 4MIMA 1T0FA 4RM2A 4LG0A 1S72I 4K2EA 1SMTA 2L7MP 3DU5A 3R6SA 4UY8I 2I8DA 1GV2A 2M9HA 3DBHB 4XORA 2PEXA 5F08A 4A3IJ 1NH3A 5HS8A 4UB8C 4NC6A 3OYIA 2VOPA 3RZOJ 1YLFA 4BE0A 1R9TJ 3BR3A 9ANTA 1RI7A 3TW6A 3J81Z 4UVBA 2AHQA 3CESA 3OY9A 1K6YA 4O5VA 1LDKB 4EQQA 5GTIC 2BVLA 2W00A 5FLMJ 1Y8RB 3CUOA 3DKXA 1RETA 2V4JC 2ME0A 4HF0A 4UHTA 4XRSA 5C44J 2XF7A 3KEYA 3OYMA 4IO9F 2HZTA 2QYOA 3G6EI 2M3AA 2E60A 5CVUA 2DJNA 5IYBJ 3C7JA 3LSRA 1J09A 1V5GA 1QVTA 3KP2A 3DPUA 3ABMH 5FLVA 4JX4A 1XSXA 5DCFA 2RQPA 1GLNA 3BT9A 4WX9A 1H88C 1UAAA 1JKPC 2VC0A 3FXUA 2D45A 3FHNA 2NVUB 4XKVA 3CD6I 1XCVA 2R7XA 1B9MA 2LYCA 2VI6A 3HRUA 3K1NA 3I3LA 5FKLA 5FB2A 2YSRA 3K2AA 2RGVA 1V5FA 4PGGA 2DK5A 5CLSA 1N25A 5K1YA 1HLVA 3KYDB 2DT7B 2R4GA 1TQMA 2WAFA 2BY2A 3QAHA 1N75A 2R5ZB 5CVIA 3ECOA 1P92A 5LHIA 2Z9OA 3GXOA 1SFKA 2HU9A 1GDTA 1KU3A 2K9LA 4DIQA 1GV5A 4IX7A 2IA1A 4HDVA 2CYYA 1MJBA 3FHZA 2WV0A 1I3AA 4RLQA 2PMZA 2DA6A 1ORKA 2BY1A 1RUOA 1XN7A 3TOBA 1TNTA 2IGKA 2PX9A 3LFKA 1HA8A 3WGIA 2GXBA 3O6BB 4FHTA 3HSRA 4E70A 1ZN2A 5FD5A 4UXNA 1R49A 3K70D 1PP8F 2ECBA 3G73A 3ZP5A 2D5VA 1ZH5A 1STZA 3TKYA 3FISA 5FKNA 3VDXA 4DNCA 4ENMA 1MNEA 2M8EA 5FGMA 2GIVA 2QKMB 2JA5J 1HW1A 4YIIA 4BU2A 2F5VA 2K3FA 1M1EB 3EPZA 1I3QJ 2MSYA 5E18F 2LD5A 1OYIA 2MGQA 1RC9A 1CQTA 3FK7A 4NDLA 1KU7A 3BTJA 1BIAA 4ENJA 2A5WA 5B5EC 1DUXC 1I27A 3CCLI 5L3CA 4EGZA 3GFMA 2HZDA 1ZAOA 1Q1VA 3ZMZA 2GAUA 1RPWA 3TGNA 2XAJA 4C9YA 3LSHA 4XSXF 2CRGA 2A61A 1JKRC 4NB5A 3GX4X 3V8LA 2V1NA 3P9KA 2UXNA 1MBKA 4L9VA 4F52A 4I6ZA 2W57A 3TEDA 3JRAA 4KMFA 3C2HA 2XPWA 3SFZA 3J80K 2BW3A 1LDDA 3FMRA 4BAYA 3OSFA 2P5KA 2X85A 4CUGA 1OCOH 1Z9CA 2CW7A 1XSDA 1S7EA 4XLEA 3I55I 2P5LC 1FT9A 1W5CC 3PO3J 3H5NA 1J75A 1CGPA 1FSHA 3CJNA 3G1LA 3A2KA 5EGOA 2P0WA 3H36A 4A3BJ 4UNOA 3VYUB 1WJCA 1GVJA 2M5WA 3SHFA 2VE8A 3OIPA 1KYWA 1X1DA 1OCTC 3CUQA 3RPUA 5M5WJ 1ZYRF 2CS3A 2PQ8A 1WJBA 4ZTJA 3PO2J 5ICFA 2E19A 3IL2A 4CHUA 2ZSIB 2CW0F 2WADA 3GFJA 3KZZA 1FYKA 1JJ8C 2L4AA 3I64A 2EIJH 2VJIA 2KRCA 1OJLA 5FJ8J 1OYWA 2EILH 4BJ6C 1PUEE 3RCOA 2E2HJ 3ULQB 2R7RA 1FMWA 1GXQA 3ML6A 2L9RA 4A3CJ 1MMSA 3BJOA 1QVUA 2DFIA 2XASA 3S3MA 4IOCF 2RVCA 4Z2YA 3JAMZ 5L3EA 3ZR8X 2OF7A 1A31A 2XAGA 1HDDC 1E17A 2WV1A 4PJJA 5D5UB 4BHCA 1IW7F 3I0TA 4WXHA 2H8WA 3FZVA 5DM6F 1EH6A 1O3SA 3MEXA 4I02A 3W2VA 4D0PA 4HRIA 3OYGA 5B3SH 2VC1A 2ECCA 1SFOJ 3Q0VA 4HNTA 3NAUA 2PMZN 3HHHA 4LMYA 3SJMA 3EYYA 3V7RA 1QQIA 3ZQGA 2KIMA 2NNYA 4BEHB 3CC4I 2EFQA 2K85A 4HX7A 1UHSA 1K78B 1TTYA 3RIRA 4NC7A 1MJ9A 3BTIA 5FO5A 1O3RA 4YEJA 2H1KA 4E7IA 1VQ4I 1E3HA 5K5OA 1AU7A 3MKZA 2KJCA 3BCAA 2OTJI 4GCVA 3ZMVA 5F04A 5GPAA 3HOVJ 4DZJA 1RZ4A 2I5UA 1ZG5A 2M4GA 1PYVA 1WQ2A 2CQXA 1SD7A 5KHDA 3CCMI 1BI2A 1SD5A 2M34A 2V1UA 1I39A 2CQKA 5HLIA 2COMA 3TP3A 5JVGF 5K5QA 2L9VA 5ILVA 4Q47A 1BR4A 1XGMA 2DU9A 2JUGA 3O8HA 1YI2I 5F6FA 2IS6A 2LY1A 1YQAA 3JCUC 5J1RA 1SFXA 4DGWB 2F6CA 1WH7A 2GQQA 2RKHA 2COBA 2MH9A 2UV1A 1P7IA 1IN7A 3PUFA 1YO5C 2BBYA 1G6NA 1B72B 3BG6A 1D0YA 2DYSH 3H92A 1LDJA 3D5RC 5JFRA 4A3DJ 1BC7C 1BN5A 4C30A 1J2XA 2FEZA 1IUYA 2QQ9A 2IEKA 2ZJPF 2CUFA 4U0VA 3F8NA 4BBSJ 4ZDPA 2TCTA 3E6BA 2NYXA 3CP2A 3O3KA 1B1BA 5A2QZ 4XKCA 2CV2A 1LNWA 3AG1H 4BQNA 3JRFA 3L2CA 2LR8A 3H0GJ 1ETVA 1F43A 1E0EA 2ZFWA 2ZNZA 4XRSG 2Y2ZA 2F2EA 3MZYA 2RNGA 5F0FA 1OISA 4ETSA 1H89C 4EJTA 3HOZJ 5E8IA 2HDCA 4I99C 4I09A 3GTQJ 3KX2A 3U1DA 2R5YA 1VQ6I 3W6JB 3IHUA 2AO9A 3CLQA 3H5RA 3BR1A 5IT3A 3ZXSA 1H0MA 4PJMA 3AL0C 4D5FA 3HKZA 3AKZA 4P9FA 5FKMA 2HOTA 4FE4A 3BDDA 1Y0NA 3D5SC 4CZCA 2F4IA 3G2BA 2ZO4A 5D8KB 1NG6A 4A5NA 1TLHB 4A0ZA 3I59A 5HLTA 4OMYA 1X1PA 4UUVA 2GXAA 1O3QA 2E1MC 4B09A 1HF0A 4ZJZA 1KYZA 3DEWA 2C6YA 3W2WA 2R7TA 2E5NA 2O03A 2CH0A 1TQIA 3DBRB 1REPC 3VSLA 2NVXJ 2GLOA 3GTGJ 1YS7A 2QQ8A 3V8JA 3I5UA 1QZEA 3J7YJ 2KRHA 4RS8A 3GO5A 1XGNA 2K4JA 2Y9ZA 4OAYA 3FXKA 5HS7A 1L0OC 3FK6A 1VI0A 4CCKA 2JWTA 3S1RJ 4M3DA 1G2HA 3KPHA 3KYLA 2UUZA 2OTLI 4AU7A 4D9JA 3CDIA 3L7WA 5DD8A 4GGGA 5LEJA 3B73A 3H9GA 2QZ8A 2ME6A 5CPRB 4XQFA 1FJLA 2VUMJ 4UV9A 3FKIJ 3GFIA 3R61A 3OOUA 2STTA 1LVKA 2QA4I 4IRHA 1WJFA 5FKKA 2ZC2A 1T39A 5H6RA 1IUFA 2IXSA 3MAJA 1MZBA 1A35A 2FE3A 2HOSA 4JP0A 4G12A 1WJ5A 2B0LA 3DTIA 3I53A 4R8HA 4LLNA 4S05A 3HJEA 3D1NI 1W7PD 1Y1VJ 2H8RA 1HW2A 3KETA 4M3BA 2XDVA 3S8PA 1V4RA 3HRSA 2VBYA 3OYAA 2QLZA 1VQ5I 3M8FA 4FCYA 1UG2A 4GFBA 2L02A 3BCBA 3B02A 4N9IA 4MLOA 3ZQ7A 3G3ZA 4AIJA 2DOAA 4PFOA 4V2FA 1D1CA 5D8LB 1WVRA 3I4NJ 2EZKA 5CVVA 4M73A 1YE9A 3F72A 4ZYAA 4G7HF 5TGTA 3G1OA 4E6KG 1TQPA 2DOFA 1VQKI 4ESBA 2GXGA 1X2NA 4MO7A 1EF4A 2FBIA 2CO5A 2NXNB 4LLGF 2LSOA 2M0CA 4MFEA 2Y9YA 2EFPA 2LKXA 2E2IJ 2R5ZA 4CSWA 2WAQA 1MBFA 5JLWA 2ZJQF 5CYVA 5FFXA 3HL2A 4I76A 1S9HA 1XD7A 4CCOA 4OIOF 3SFIA 4DYRA 4YG2F 1YW9A 2EPFA 3QODA 4U0YA 1LVAA 1U0JA 2X1DA 3CTAA 5KK1A 4AVZA 4CYCB 2X6XA 3SZGA 1ZGWA 3FDYA 3QWLA 4A93J 2JPCA 1QPMA 3HKZN 1EV7A 5IYCJ 2HS5A 2ELJA 5GP9A 4L5EA 1R7JA 1BOAA 4YIFA 2L7FP 4Q48A 1A6QA 3ABTA 1HKTA 1IRFA 2HQNA 2K7LA 2DMUA 3M07A 4IHTA 2VPLA 5HDNA 1J7KA 2DQLA 5IYDJ 5K7HA 2R7DA 2V6CA 4PCQA 2XKOA 4BS9A 5C4JJ 2GM4A 3UKGA 1Y6IA 5GAEJ 1LUJB 4M6VA 6PAXA 1IG7A 1JUPA 2DTRA 4CZZA 5GPCA 1J0RA 2DDAA 2O3FA 2XIGA 5D6FA 3HOYJ 1UG0A 4I0AA 3HEFA 5LHHA 1KONA 3MKYB 2WWYA 2DFHA 2VKVA 3R0AA 2PJRB 4LJZF 2JUCA 2P7VB 3OV8A 3U1KA 4ZTFA 2HQ5A 1YYVA 3RPUD 4Y7NJ 2DODA 1ZG1A 1FIPA 1MBHA 5CQEA 1OR7A 1WSUA 2L9SA 2ZJRF 2DA2A 5FLXK 2BOLA 3BG5A 3BZKA 1JE8A 2R0QC 4CCMA 3AG3H 2M0MA 2WA0A 2EB7A 3Q5FA 4B48A 1G3YA 1TWAJ 2R3SA 1MNMC 4J00A 3S3OA 4E7KA 4U7BA 4E7HA 1A5JA 5AIPA 1WI9A 3M7GA 1MMGA 1BIBA 3WE2A 2Q2EB 4M9XA 1FNNA 4FT8A 3L00A 2GA2A 1D5VA 3GLLA 4N9HA 3ZMUA 2PMUA 3OS2A 1OMIA 4N0BA 4EJOA 4PFPA 1RIOH 5EG0B 2G0EA 2STWA 1P6RA 3IWFA 1C0WA 2OD5A 2Z99A 2DLLA 1U5TC 2P5VA 3TDZC 2EBIA 3LSGA 3C2BA 2NNNA 4QWQA 3T0YA 3L2VA 2YUSA 4OMZA 5ILUA 4PSXA 3L2WA 1T0FC 2AQFA 2MW8A 3GF2A 4RGXA 2EA2A 1KQ0A 4Y17A 3H5AA 2XRNA 3OYKA 1OLTA 1MBJA 1WI3A 1DGWY 3VYTB 4UUSB 2CV1A 3KZIC 4XNFA 3E3VA 5L3GA 4MTDA 2HPMA 2KP6A 1VQMI 1YJ9I 4LLLA 2FNAA 3JRDA 4XK4A 2WAQN 1PJRA 4QPOA 3H3UA 4BQAA 1OKRA 2VBXA 2FMLA 3L2QA 4IEJA 3QYEA 2XPVA 3S14J 2W25A 2CQNA 4B3XA 1Z21A 2NOGA 1KQ8A 4RGSA 3F6OA 2XUBA 4BEHA 3LAPA 3DF8A 1HKSA 1R58A 3IAM2 3T5XA 3JR9A 2W82A 5J3LA 3IH2A 3BROA 4F92B 3LL7A 1MW7A 4A2UA 3FBIB 2VODA 1BW6A 1DGRM 5LRSA 4NC8A 5JR3A 4JX5A 2VKDA 4JOMA 1AKHA 3PNYA 3F6VA 3CMAI 1YW7A 4HPQA 1F1ZA 3IRRA 2H09A 2NS7A 3CCSI 1I6XA 4MHGA 2K86A 2RC4A 1P4XA 4KDPA 2IPQX 1Q1HA 4P1WA 4YFKF 2YX4A 1N78A 1YJNI 3CO7C 4M3EA 2BE5F 2QUFA 2EIKH 2X51A 1H8AC 1MSEC 1X58A 1JKQC 1XG1A 2E7WA 5IP9J 1FYLA 3AL0B 1UJ8A 1RKTA 2XC7A 1B8IB 4Q4ZF 1B72A 5ILSA 3PQJA 1JTYA 2BGCA 2K9QA 2XGCA 4OOIA 3GZ5A 3BQYA 1DP7P 4P96A 1FP1D 5DV5A 2CFXA 5F64A 4AIHA 3F8FA 2DO7A 4AC0A 5M3MJ 4HDUA 1TZLA 2KIUA 3LSJA 2EFWA 2X6WA 4CCJA 2E1MB 4PZJA 2Q8KA 4AIDA 3OYLA 1XDUA 3H35A 2Y31A 1U8RA 1VZ0A 1OCPA 3HSFA 2LC2A 5FD6A 1ETOA 3BTLA 3MFKA 3CCUI 2K02A 4S0HB 1QU3A 2E5ZA 3WHBA 1R23A 1TBXA 4XN3A 1SAUA 5BNGA 1WFXA 1BI0A 2HPIA 5E3NA 4U88A 2IRFG 1BM9A 2LDUA 2MABA 3T8RA 3MKWB 1DPUA 2EV0A 3RKQA 3FXQA 4ITVA 4M6YA 2CV0A 4B47A 1W7PA 1Z67A 4IZZA 5E79C 4EEFG 3R4KA 3BG7A 3HIFA 4KN7X 1XMKA 1B9NA 2ESHA 4Y52J 4RB3C 1IXCA 3CP8A 1S8NA 1TW3A 2CU7A 4X1EA 3BWGA 5ERIA 2DA3A 1Y1WJ 1IRXA 4XL9A 3U21A 1ERDA 4AUXA 1MJAA 1YHQI 3JRGA 2JK3A 1RKWA 4RDUA 4I2OA 5HNFA 4A0YA 2MLKA 3CF2A 3WTXC 1ZKGA 4JK1X 4ON0A 5TRDA 2O9LA 1YTYA 3DTEA 3X2QH 2YR2A 4A6DA 2KPMA 3GYHX 3IWZA 4CDGA 2MC4A 5IOYA 3GFLA 4RAZA 3IV5A 3HRMA 4II3A 2CUJA 3E97A 4CXFA 1WZ2A 3ZQQA 3L2UA 2VQHA 4XKWA 4LFUA 3WGGA 3BR5A 5K7FA 3ZN1A 3CUQC 5L3FA 3PIPF 5E1XA 1PDNC 3V42A 3BG9A 2ISYA 3NWTA 2L0KA 4B1RA 4G9YA 1J59A 4M9SA 2DMQA 1ZREA 3DCFA 1W0TA 4EVIA 4HBLA 1NK2P 1ACIA 5LGNA 2OZUA 1UELB 1ZTRA 4L18B 1JHFA 1IXSB 5D5VB 3Q0WA 5EDNA 1WGXA 1WJEA 2L3DA 3LA3A 5IP6A 2HXOA 1QZZA 2MD5A 4RB2C 3WG7H 4A3KJ 2IS2A 3Q3SA 1D0ZA 2EFOA 3JW4A 4KICA 3HOSA 1FOYA 2A6EF 2XKPA 3KP3A 2YPRA 4IVNA 1Z0XA 1YJWI 1XMAA 2LH9A 1A36A 4ZZLA 3E7LA 2XGXA 2CJJA 2PN6A 2VBZA 1FY7A 3QP6A 5CQGA 2E1NA 1FLIA 2EQRA 1T6SA
chains in the Genus database with same CATH topology
2JZYA 1R00A 5IT9K 2FU4A 4WXDA 4YFXF 1ON2A 3FWEA 4LB6B 3IKVA 4GYIA 3JTGA 1EH8A 1UHMA 3ELKA 3C18A 4HF1A 2FOKA 4IF4A 4P5OA 5H20A 3W6KB 2ZKZA 3CLOA 1QNTA 2MLGA 4RB0A 3WTVC 3ZMSA 5JHUA 3U9GA 3TDUC 4Y13A 3EUHA 2ZMEA 2JT1A 2E1CA 4HX8A 3TO6A 2EV5A 1XB4A 1FX7A 3JTHA 2KIFA 2LF8A 2VT3A 2VT2A 2L01A 4KIFA 2HYGD 1SFUA 4F7ZA 1K7AA 1MKMA 3REOA 3ZMTA 1R5HA 2BEOA 3GLXA 1AOYA 5E8GA 3RTRA 2QENA 1KGSA 2A69F 1FBSA 2XAQA 2LKPA 1U5TB 2NS0A 2V1DA 5HLGA 1W5SA 2VE9A 1ZRDA 4JQFA 3ERED 1P4WA 3E5UA 3E5QA 4XRFA 1R1TA 3K1PA 3M1EA 1K79A 3R0JA 3DV8A 4MEXF 1HW5A 3ECHA 1TW2A 2A5YB 1ZLKA 4G94A 4OINF 2Q2EA 3RI4A 4ZH4F 1HKQA 2KKOA 3J81K 2LNBA 2X0LA 2IA2A 4EM2A 4HZFA 3VB2A 4EM1A 1ZLJA 3SXYA 4ENKA 5HDKA 2Q0OA 4H0EA 3V7CA 4A6EA 2EV6A 3WTUC 3MZHA 3NEUA 3V8KA 3M8EA 4P55A 4I0BA 3U2RA 5AONA 4EM0B 3CDHA 4JBAA 3K0LA 4XBFA 2Y48A 1D8JA 3D0SA 3PQKA 3ROUA 4KIGA 1IXRC 1I1SA 3KCCA 2P6SA 5BOXA 4BHBA 2D1HA 1ZRCA 4P9UA 4A0XA 1R1VA 1E2XA 1G3TA 1LB2A 1ZG3A 2QWWA 5L3DA 2GZWA 4I01A 4KT5C 4EJUA 5HVQC 5BQTA 5E20A 1ONVA 2DT5A 3DP7A 4UVAA 4ZYEA 3EYIA 3WTSC 3J7AO 4MNUA 4UV8A 1ULYA 2ETHA 4AVPA 1A04A 3EETA 2CGPA 1D8KA 2HTJA 1W4MA 2RNJA 4HW0A 3QOPA 5CVJA 1FOKA 2FA5A 4M71A 4AIKA 1IAWA 4L5JA 1HQCA 2CG4A 2EK5A 1ZGJA 5ICCA 1S6LA 2D1VA 3LAJA 2O61A 1B6AA 2BV6A 1HSTA 2ESNA 1JGSA 4WWCA 3Q9VA 1KU9A 3LWFA 3KP7A 3HSEA 2IJLA 2AXLA 3CUQB 1S3JA 5LGTA 1J9IA 3LA7A 2HYFA 1MDMB 4A12A 2V79A 4FX4A 1U78A 4ESFA 2IT0A 4CICA 3QRFF 4Q5SF 3AAFA 4KYWA 2XAFA 3ISPA 1Z6TA 3IRQA 2RDPA 5ICGA 2HFHA 3BP8A 3T1BA 1ZGAA 2YU3A 5DD4A 3JSPA 1X3UA 3MWMA 1HSJA 1B4AA 3JAMK 5BPIA 3P7NA 1BBYA 3DKWA 4LD5A 3WTZA 1Z1DA 4BH9A 5DDGA 1LEAA 2IA0A 3DEUA 1WKMA 3LA2A 1W5TA 1XDSA 1QGPA 2IVMA 3J80Z 3OOPA 2J5OA 2EJRA 5DYMA 4A5MA 3KEOA 1OPCA 4G7OF 4HX4A 4GO1A 1S29A 2Y75A 3F22A 1KQ9A 4TV7A 5J8FA 2A68F 3F3XA 5HS9A 3L09A 3HHGA 2FSWA 1T98A 1QZYA 2VOOA 4FX0A 3I58A 4HA8A 2Y0MA 5LHGA 4G6DA 2CSOA 4M6XA 4OIQF 1S7AA 3GVAA 2HGCA 2A07F 2PG4A 4CO8A 3KP4A 3QU3A 3F8CA 4L9TA 1SMYF 3WTYC 5J6XA 5A2QK 3E6CC 2H6CA 2QQBA 2H6BA 1Z6RA 4MTEA 1Z7UA 2UXXA 4AD9A 2H27A 4CGZA 2DQRA 1R1UA 3KP6A 1K78A 2ZJ2A 3RYRA 3RYPA 3QU6A 3HOTA 4ZYGA 4QLCU 2NRAC 4KNYA 3KEQA 2O6GE 3K1MA 1JHHA 5L3BA 1Y0UA 3QP5A 5D4SA 2OQRA 2MC3A 1U5TA 3RKYA 4IXAA 2PJPA 3DPLC 2DAOA 1R22A 1O57A 2GA1A 3P9CA 2XHKA 2P4WA 5LLQA 2YX7A 1AWCA 3S2WA 2HQRA 3RPQA 4WF2A 1LQ1A 2PI0A 5E17F 3WU0A 4HV6A 2MH2A 5F1RA 2F5DA 5DUIA 5E1ZB 3H3ZA 4HF2A 1J5YA 2G7HA 4KFCA 1P4AA 3RDIA 3D5LA 3L9FA 4M74A 1KA8A 2ZNYA 2OZ6A 4LK1F 4O6JA 3RJPA 2OA4A 5KVRA 3JSOA 4EGYA 1PP7U 2EA4A 1XGSA 4U7DA 1I5ZA 2VONA 1RUNA 1FBQA 2OAZA 3ABUA 4G8XA 4KMUX 3WGHA 2TDXA 3O2PE 2Z3YA 5AIQA 5E1WA 2G7UA 2CWEA 2J5PA 1R5GA 3BZ6A 1L3LA 1FC3A 2KJBA 4MGRA 2QBYB 3GW2A 2IW5A 1B59A 3WG9A 2XAHA 5HOOA 4HV5A 4CYDA 5EEHA 3GZ6A 2WTEA 2PFBA 1H9TA 2Z5UA 2F5CA 5JI6A 3KZYA 4L5IA 4OU0A 4PGHA 5LBQA 2EWNA 4HLYA 4EJWA 4XLNF 4ZYDA 3GUDA 1DPRA 4GYGA 2ZCWA 3VODA 1CF7B 3COAC 1K6OA 1OYYA 3ZPLA 1IN6A 3WODF 4KUMA 3N97A 1XSVA 3FMSA 3N4MA 3FMQA 4G6QA 1UFMA 1ODDA 3EDPA 1Z91A 3BPVA 2GWRA 1D3YA 4RGRA 1IN4A 1F4KA 1SD6A 2P6TA 3GEZA 1FZPB 1BC8C 3RKXA 3FXRA 1MD0A 1EH7A 1MDMA 5ED4A 2FBKA 3BJ6A 1YFHA 2D2WA 3QPHA 2LF7A 2M1BA 3HRTA 5HLHA 4WK8F 1FYMA 2F5FA 3F8MA 1SD4A 5K5RA 4IPAA 4ASNA 4EV0A 4Y15A 5DEQA 5DCMB 2XVCA 3HYIA 4YFNF 3LQQA 4HLXA 1LEBA 2F5EA 1TNSA 2JTVA 1ZRFA 5FLXZ 4RGUA 4OIPF 4I7HA 5LEKA 2UZKA 3C1DA 4O3MA 2M30A 4MQ9F 1RNLA 1UB9A 4WCGA 2QVOA 2M45A 4LG0B 2VN2A 3SQNA 2FNPA 2AS5F 2HOEA 1XGOA 3BJAA 2ZXJA 2ACJA 2QM3A 2ISZA 4ENNA 2HKOA 2DW4A 3FF5A 3KP5A 3T8TA 3ZN0A 2HTSA 3BY6A 2JSCA 2M87A 3DXJF 3WE3A 2EFNA 3I71A 1FPQA 3DFGA 4NQWA 1MGTA 1G3WA 1YIOA 4ZZDA 2Z33A 2V9VA 1QBJA 1P2FA 2NAZA 2VBWA 2PBIA 2MA3A 3F23A 1WWXA 2MBFA 5CJ9A 5CVRA 2K27A 1IF1A 4U0WA 4EMSA 2HEOA 4UVCA 4R1HA 3HUGA 3IC7A 1ZARA 2RV8A 3WTWC 5LRRA 3LSTA 1IN8A 1IZ1A 1W7PB 4M9ZA 3BOQA 3TO7A 2DBBA 2UWMA 1S7OA 4R79A 4RAYA 1VTNC 1IRGA 5D4RA 4HYEA 1FWZA 1GHCA 4KA4A 4XLPF 1UHWA 4KIBA 4HQMA 1O7LA 4WXCA 1FBUA 4LGWA 5EEGA 3K69A 3GWZA 1G3SA 2FBHA 1NHAA 3SZPA 2JRTA 1U6GA 3DQVC 2HWVA 2XV4S 3F8BA 5TJJA 2JPBA 1R36A 2DK8A 4BNCA 4NHJA 1BJAA 3TQNA 1KU2A 1U2WA 2HKXA 4ZYHA 3LQRA 3I4PA 1H9GA 3FM3A 5D6EA 3NRVA 3KE2A 3KFWX 3MCZA 1IN5A 2OQGA 1SAXA 3VFZA 2ADUA 1QO0D 5J8CA 4HQEA 4IRGA 4OIRF 1YS6A 5LGUA 3E6DA 3Q9SA 1I1GA 2FF4A 4M72A 3R60A 2WC2A 4RB1A 2E7XA 1T2KA 2RN7A 4GXOA 4L9JA 5HDGA 3V7SA 1F5TA 3WU1B 4IRIA 1UCRA 3RKWA 5ICEA 2W85A 2OU2A 4LB5A 3HTUA 4AWXB 2L54A 1USTA 2ZMEB 4MEYF 5BPDA 1GXPA 4KN4X 2XROA 1BI1A 4HAMA 3TO9A 2QQAA 4IJAA 1O7FA 2QBYA 3P9IA 2W84A 3HTSB 1LJ9A 4S04A 2P7CB 2PMHA 3VOEA 4EJVA 4ESJA 4L0ZB 2DPUA 4G7ZF 2V1XA 3IKTA 3ZMDA 3E6MA 4BHPA 5IT9Z 2FRHA 1T38A 3I54A 4L9NA 2G9WA 2E1NA 1F9NA 1CF7A 4MQVA 4LK0F 1SFEA 3FM5A 5BMZA 2O8XA 2H94A 2ELHA 1WRJA 1V3FA 2HR3A 4HOBA 3CO6C 2ZBKA 3NQOA 4L0YB 1G4DA 5D5WB 3KLOA 1JXSA 3M9AA 3KLNA 4XSZF 2X4HA 2P8TA 1O3TA 1HBXG 5DUKA 4BXUA 5JVTA 1FP2A 3PFIA 3VEPA 1YW8A 3K9TA 4DQ2A 3C3WA 3MQ0A 4I98B 1Z05A 4BYYA 3F21A 2O0YA 3DPTA 3K2ZA 4B8XA 1YG2A 3V4GA 4PDKA 2R7FA 2BYVE 2W24A 1BI3A 2L4MA 5DCMA 3I59B 1USSA 5D5XB 1U3EM 3TOAA 2FXAA 3FX3A 1HXDA 3E5XA 3BPXA 1XCBA 5FFZA 2A6HF 2KRFA 2IP2A 3EQLF 2A3SA 4IHSA 3QPTA 2DPDA 1FSEA 1DDNA 1ON1A 2OBPA 2DI3A 5H6QA 2FMYA 5BS6A 2K4BA 2FQ3A 2VXZA 3WTTC 1ZHFA 2PLYA 3SZTA 1T0FA 4LG0A 4K2EA 1SMTA 3R6SA 2PEXA 5HS8A 2VOPA 1YLFA 1RI7A 3J81Z 4UVBA 4O5VA 1LDKB 4EQQA 3CUOA 4HF0A 4UHTA 2HZTA 2QYOA 5CVUA 3C7JA 3KP2A 4WX9A 1XSXA 5DCFA 2RQPA 2VC0A 3FXUA 2D45A 1XCVA 1B9MA 3HRUA 3K1NA 5FB2A 2YSRA 2RGVA 4PGGA 2DK5A 5CLSA 5K1YA 1TQMA 3QAHA 5CVIA 3ECOA 1P92A 5LHIA 2Z9OA 3GXOA 1KU3A 2IA1A 4HDVA 2CYYA 1MJBA 3FHZA 2WV0A 1RUOA 1XN7A 3TOBA 1TNTA 3LFKA 3WGIA 2GXBA 3O6BB 4FHTA 3HSRA 4E70A 1ZN2A 5FD5A 4UXNA 1PP8F 3G73A 3ZP5A 1ZH5A 1STZA 3TKYA 4DNCA 4ENMA 2M8EA 5FGMA 2GIVA 1HW1A 4YIIA 5E18F 1OYIA 1KU7A 1BIAA 4ENJA 1DUXC 1I27A 5L3CA 4EGZA 3GFMA 1ZAOA 3ZMZA 2GAUA 3TGNA 2XAJA 4XSXF 2A61A 4NB5A 3GX4X 3V8LA 3P9KA 2UXNA 4L9VA 2W57A 4KMFA 3SFZA 3J80K 4BAYA 1LDDA 3FMRA 1Z9CA 2P5KA 1XSDA 2P5LC 1FT9A 1J75A 1CGPA 1FSHA 3CJNA 4UNOA 1GVJA 2M5WA 3SHFA 2VE8A 1KYWA 3CUQA 3RPUA 1ZYRF 2PQ8A 5ICFA 3IL2A 4CHUA 2CW0F 3GFJA 3KZZA 1FYKA 2L4AA 3I64A 1OYWA 1PUEE 3ULQB 3ML6A 1GXQA 3BJOA 2DFIA 2XASA 2RVCA 4Z2YA 3JAMZ 5L3EA 2XAGA 1E17A 5D5UB 4BHCA 1IW7F 3I0TA 4WXHA 3FZVA 1EH6A 1O3SA 3MEXA 4I02A 4D0PA 2VC1A 3HHHA 4LMYA 3EYYA 3V7RA 1QQIA 2NNYA 2KIMA 2EFQA 4HX7A 1K78B 1TTYA 3RIRA 1MJ9A 5FO5A 1O3RA 5K5OA 2KJCA 4GCVA 3ZMVA 1RZ4A 1ZG5A 1WQ2A 1SD7A 1BI2A 1SD5A 2V1UA 2CQKA 5HLIA 2COMA 5K5QA 5ILVA 4Q47A 1XGMA 2DU9A 5F6FA 1YQAA 1SFXA 2GQQA 2RKHA 2MH9A 1IN7A 1YO5C 2BBYA 1G6NA 3H92A 1LDJA 5JFRA 1BC7C 1BN5A 1J2XA 2FEZA 1IUYA 2QQ9A 4U0VA 3F8NA 3E6BA 2NYXA 3O3KA 1B1BA 5A2QZ 1LNWA 3L2CA 2ZFWA 2ZNZA 2F2EA 3MZYA 4ETSA 4EJTA 5E8IA 2HDCA 4I09A 3U1DA 3W6JB 3IHUA 5IT3A 1H0MA 4P9FA 3BDDA 2ZO4A 5D8KB 4A5NA 1TLHB 4A0ZA 3I59A 4OMYA 4UUVA 1O3QA 4B09A 2C6YA 1KYZA 2O03A 1TQIA 1REPC 1YS7A 3V8JA 3I5UA 4RS8A 3GO5A 1XGNA 2K4JA 5HS7A 1L0OC 3L7WA 5DD8A 4GGGA 5LEJA 3B73A 2QZ8A 4UV9A 3GFIA 3R61A 2STTA 4IRHA 1T39A 5H6RA 3MAJA 1MZBA 2FE3A 2B0LA 3I53A 4R8HA 4LLNA 4S05A 1W7PD 1HW2A 3KETA 1V4RA 3HRSA 2VBYA 2QLZA 3M8FA 2L02A 3B02A 4N9IA 3ZQ7A 4AIJA 5D8LB 5CVVA 4M73A 3F72A 4G7HF 1TQPA 4ESBA 2GXGA 2FBIA 2CO5A 4LLGF 2LSOA 2EFPA 5CYVA 5FFXA 1XD7A 4OIOF 4YG2F 1YW9A 4U0YA 1LVAA 3CTAA 5KK1A 2JPCA 1QPMA 1EV7A 2HS5A 1R7JA 1BOAA 4YIFA 4Q48A 3ABTA 1HKTA 1IRFA 2HQNA 2K7LA 4IHTA 5HDNA 1J7KA 2DQLA 2R7DA 2V6CA 4PCQA 2XKOA 6PAXA 2DTRA 4CZZA 1J0RA 2XIGA 2O3FA 5D6FA 4I0AA 5LHHA 2WWYA 3R0AA 4LJZF 2P7VB 3OV8A 1YYVA 1ZG1A 1WSUA 1OR7A 5FLXK 1JE8A 2EB7A 3Q5FA 1G3YA 2R3SA 4U7BA 5AIPA 1WI9A 3M7GA 1BIBA 3WE2A 4M9XA 1FNNA 4FT8A 3L00A 2GA2A 1D5VA 4N9HA 3ZMUA 2PMUA 1OMIA 4N0BA 4EJOA 1RIOH 2STWA 1P6RA 3IWFA 1C0WA 2OD5A 2Z99A 2DLLA 1U5TC 2P5VA 3TDZC 2NNNA 4QWQA 3T0YA 4OMZA 5ILUA 3GF2A 4RGXA 2EA2A 1KQ0A 4Y17A 2XRNA 3E3VA 5L3GA 4MTDA 4LLLA 2FNAA 3H3UA 4BQAA 1OKRA 2VBXA 2FMLA 2W25A 1KQ8A 4RGSA 3F6OA 2XUBA 3LAPA 3DF8A 1HKSA 1R58A 3T5XA 3BROA 4A2UA 2VODA 5LRSA 5JR3A 3F6VA 1YW7A 1F1ZA 3IRRA 2H09A 1I6XA 4MHGA 2K86A 2RC4A 1P4XA 4KDPA 2IPQX 1Q1HA 4YFKF 2YX4A 3CO7C 2BE5F 2QUFA 2E7WA 1FYLA 4Q4ZF 5ILSA 3PQJA 2BGCA 4OOIA 3GZ5A 1DP7P 4P96A 1FP1D 5DV5A 2CFXA 5F64A 4AIHA 3F8FA 2DO7A 4HDUA 2KIUA 2EFWA 4PZJA 2Q8KA 1XDUA 1U8RA 3HSFA 5FD6A 3MFKA 2K02A 1R23A 1TBXA 1BI0A 4U88A 2IRFG 1BM9A 2LDUA 3T8RA 1DPUA 2EV0A 3FXQA 4M6YA 1W7PA 3R4KA 3HIFA 4KN7X 1XMKA 1B9NA 2ESHA 4RB3C 1IXCA 1S8NA 1TW3A 3BWGA 5ERIA 1MJAA 4I2OA 4A0YA 2MLKA 3WTXC 4JK1X 4ON0A 5TRDA 1YTYA 2YR2A 4A6DA 3GYHX 3IWZA 4CDGA 3GFLA 4RAZA 3HRMA 4CXFA 3E97A 4LFUA 3WGGA 3ZN1A 3CUQC 5L3FA 5E1XA 1PDNC 2ISYA 4G9YA 1J59A 4M9SA 1ZREA 4EVIA 4HBLA 5LGNA 2OZUA 4L18B 1JHFA 1IXSB 5D5VB 3LA3A 2L3DA 2MD5A 1QZZA 4RB2C 3JW4A 2EFOA 4KICA 3HOSA 2A6EF 2XKPA 3KP3A 2YPRA 4IVNA 1XMAA 4ZZLA 2XGXA 2PN6A 2VBZA 1FY7A 3QP6A 3G3ZA 1FLIA 1T6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZY A;  1R00 A;  5IT9 K;  2FU4 A;  4WXD A;  4YFX F;  1ON2 A;  3FWE A;  4LB6 B;  3IKV A;  4GYI A;  3JTG A;  1EH8 A;  1UHM A;  3ELK A;  3C18 A;  4HF1 A;  2FOK A;  4IF4 A;  4P5O A;  5H20 A;  3W6K B;  2ZKZ A;  3CLO A;  1QNT A;  2MLG A;  4RB0 A;  3WTV C;  3ZMS A;  5JHU A;  3U9G A;  3TDU C;  4Y13 A;  3EUH A;  2ZME A;  2JT1 A;  2E1C A;  4HX8 A;  3TO6 A;  2EV5 A;  1XB4 A;  1FX7 A;  3JTH A;  2KIF A;  2LF8 A;  2VT3 A;  2VT2 A;  2L01 A;  4KIF A;  2HYG D;  1SFU A;  4F7Z A;  1K7A A;  1MKM A;  3REO A;  3ZMT A;  1R5H A;  2BEO A;  3GLX A;  1AOY A;  5E8G A;  3RTR A;  2QEN A;  1KGS A;  2A69 F;  1FBS A;  2XAQ A;  2LKP A;  1U5T B;  2NS0 A;  2V1D A;  5HLG A;  1W5S A;  2VE9 A;  1ZRD A;  4JQF A;  3ERE D;  1P4W A;  3E5U A;  3E5Q A;  4XRF A;  1R1T A;  3K1P A;  3M1E A;  1K79 A;  3R0J A;  3DV8 A;  4MEX F;  1HW5 A;  3ECH A;  1TW2 A;  2A5Y B;  1ZLK A;  4G94 A;  4OIN F;  2Q2E A;  3RI4 A;  4ZH4 F;  1HKQ A;  2KKO A;  3J81 K;  2LNB A;  2X0L A;  2IA2 A;  4EM2 A;  4HZF A;  3VB2 A;  4EM1 A;  1ZLJ A;  3SXY A;  4ENK A;  5HDK A;  2Q0O A;  4H0E A;  3V7C A;  4A6E A;  2EV6 A;  3WTU C;  3MZH A;  3NEU A;  3V8K A;  3M8E A;  4P55 A;  4I0B A;  3U2R A;  5AON A;  4EM0 B;  3CDH A;  4JBA A;  3K0L A;  4XBF A;  2Y48 A;  1D8J A;  3D0S A;  3PQK A;  3ROU A;  4KIG A;  1IXR C;  1I1S A;  3KCC A;  2P6S A;  5BOX A;  4BHB A;  2D1H A;  1ZRC A;  4P9U A;  4A0X A;  1R1V A;  1E2X A;  1G3T A;  1LB2 A;  1ZG3 A;  2QWW A;  5L3D A;  2GZW A;  4I01 A;  4KT5 C;  4EJU A;  5HVQ C;  5BQT A;  5E20 A;  1ONV A;  2DT5 A;  3DP7 A;  4UVA A;  4ZYE A;  3EYI A;  3WTS C;  3J7A O;  4MNU A;  4UV8 A;  1ULY A;  2ETH A;  4AVP A;  1A04 A;  3EET A;  2CGP A;  1D8K A;  2HTJ A;  1W4M A;  2RNJ A;  4HW0 A;  3QOP A;  5CVJ A;  1FOK A;  2FA5 A;  4M71 A;  4AIK A;  1IAW A;  4L5J A;  1HQC A;  2CG4 A;  2EK5 A;  1ZGJ A;  5ICC A;  1S6L A;  2D1V A;  3LAJ A;  2O61 A;  1B6A A;  2BV6 A;  1HST A;  2ESN A;  1JGS A;  4WWC A;  3Q9V A;  1KU9 A;  3LWF A;  3KP7 A;  3HSE A;  2IJL A;  2AXL A;  3CUQ B;  1S3J A;  5LGT A;  1J9I A;  3LA7 A;  2HYF A;  1MDM B;  4A12 A;  2V79 A;  4FX4 A;  1U78 A;  4ESF A;  2IT0 A;  4CIC A;  3QRF F;  4Q5S F;  3AAF A;  4KYW A;  2XAF A;  3ISP A;  1Z6T A;  3IRQ A;  2RDP A;  5ICG A;  2HFH A;  3BP8 A;  3T1B A;  1ZGA A;  2YU3 A;  5DD4 A;  3JSP A;  1X3U A;  3MWM A;  1HSJ A;  1B4A A;  3JAM K;  5BPI A;  3P7N A;  1BBY A;  3DKW A;  4LD5 A;  3WTZ A;  1Z1D A;  4BH9 A;  5DDG A;  1LEA A;  2IA0 A;  3DEU A;  1WKM A;  3LA2 A;  1W5T A;  1XDS A;  1QGP A;  2IVM A;  3J80 Z;  3OOP A;  2J5O A;  2EJR A;  5DYM A;  4A5M A;  3KEO A;  1OPC A;  4G7O F;  4HX4 A;  4GO1 A;  1S29 A;  2Y75 A;  3F22 A;  1KQ9 A;  4TV7 A;  5J8F A;  2A68 F;  3F3X A;  5HS9 A;  3L09 A;  3HHG A;  2FSW A;  1T98 A;  1QZY A;  2VOO A;  4FX0 A;  3I58 A;  4HA8 A;  2Y0M A;  5LHG A;  4G6D A;  2CSO A;  4M6X A;  4OIQ F;  1S7A A;  3GVA A;  2HGC A;  2A07 F;  2PG4 A;  4CO8 A;  3KP4 A;  3QU3 A;  3F8C A;  4L9T A;  1SMY F;  3WTY C;  5J6X A;  5A2Q K;  3E6C C;  2H6C A;  2QQB A;  2H6B A;  1Z6R A;  4MTE A;  1Z7U A;  2UXX A;  4AD9 A;  2H27 A;  4CGZ A;  2DQR A;  1R1U A;  3KP6 A;  1K78 A;  2ZJ2 A;  3RYR A;  3RYP A;  3QU6 A;  3HOT A;  4ZYG A;  4QLC U;  2NRA C;  4KNY A;  3KEQ A;  2O6G E;  3K1M A;  1JHH A;  5L3B A;  1Y0U A;  3QP5 A;  5D4S A;  2OQR A;  2MC3 A;  1U5T A;  3RKY A;  4IXA A;  2PJP A;  3DPL C;  2DAO A;  1R22 A;  1O57 A;  2GA1 A;  3P9C A;  2XHK A;  2P4W A;  5LLQ A;  2YX7 A;  1AWC A;  3S2W A;  2HQR A;  3RPQ A;  4WF2 A;  1LQ1 A;  2PI0 A;  5E17 F;  3WU0 A;  4HV6 A;  2MH2 A;  5F1R A;  2F5D A;  5DUI A;  5E1Z B;  3H3Z A;  4HF2 A;  1J5Y A;  2G7H A;  4KFC A;  1P4A A;  3RDI A;  3D5L A;  3L9F A;  4M74 A;  1KA8 A;  2ZNY A;  2OZ6 A;  4LK1 F;  4O6J A;  3RJP A;  2OA4 A;  5KVR A;  3JSO A;  4EGY A;  1PP7 U;  2EA4 A;  1XGS A;  4U7D A;  1I5Z A;  2VON A;  1RUN A;  1FBQ A;  2OAZ A;  3ABU A;  4G8X A;  4KMU X;  3WGH A;  2TDX A;  3O2P E;  2Z3Y A;  5AIQ A;  5E1W A;  2G7U A;  2CWE A;  2J5P A;  1R5G A;  3BZ6 A;  1L3L A;  1FC3 A;  2KJB A;  4MGR A;  2QBY B;  3GW2 A;  2IW5 A;  1B59 A;  3WG9 A;  2XAH A;  5HOO A;  4HV5 A;  4CYD A;  5EEH A;  3GZ6 A;  2WTE A;  2PFB A;  1H9T A;  2Z5U A;  2F5C A;  5JI6 A;  3KZY A;  4L5I A;  4OU0 A;  4PGH A;  5LBQ A;  2EWN A;  4HLY A;  4EJW A;  4XLN F;  4ZYD A;  3GUD A;  1DPR A;  4GYG A;  2ZCW A;  3VOD A;  1CF7 B;  3COA C;  1K6O A;  1OYY A;  3ZPL A;  1IN6 A;  3WOD F;  4KUM A;  3N97 A;  1XSV A;  3FMS A;  3N4M A;  3FMQ A;  4G6Q A;  1UFM A;  1ODD A;  3EDP A;  1Z91 A;  3BPV A;  2GWR A;  1D3Y A;  4RGR A;  1IN4 A;  1F4K A;  1SD6 A;  2P6T A;  3GEZ A;  1FZP B;  1BC8 C;  3RKX A;  3FXR A;  1MD0 A;  1EH7 A;  1MDM A;  5ED4 A;  2FBK A;  3BJ6 A;  1YFH A;  2D2W A;  3QPH A;  2LF7 A;  2M1B A;  3HRT A;  5HLH A;  4WK8 F;  1FYM A;  2F5F A;  3F8M A;  1SD4 A;  5K5R A;  4IPA A;  4ASN A;  4EV0 A;  4Y15 A;  5DEQ A;  5DCM B;  2XVC A;  3HYI A;  4YFN F;  3LQQ A;  4HLX A;  1LEB A;  2F5E A;  1TNS A;  2JTV A;  1ZRF A;  5FLX Z;  4RGU A;  4OIP F;  4I7H A;  5LEK A;  2UZK A;  3C1D A;  4O3M A;  2M30 A;  4MQ9 F;  1RNL A;  1UB9 A;  4WCG A;  2QVO A;  2M45 A;  4LG0 B;  2VN2 A;  3SQN A;  2FNP A;  2AS5 F;  2HOE A;  1XGO A;  3BJA A;  2ZXJ A;  2ACJ A;  2QM3 A;  2ISZ A;  4ENN A;  2HKO A;  2DW4 A;  3FF5 A;  3KP5 A;  3T8T A;  3ZN0 A;  2HTS A;  3BY6 A;  2JSC A;  2M87 A;  3DXJ F;  3WE3 A;  2EFN A;  3I71 A;  1FPQ A;  3DFG A;  4NQW A;  1MGT A;  1G3W A;  1YIO A;  4ZZD A;  2Z33 A;  2V9V A;  1QBJ A;  1P2F A;  2NAZ A;  2VBW A;  2PBI A;  2MA3 A;  3F23 A;  1WWX A;  2MBF A;  5CJ9 A;  5CVR A;  2K27 A;  1IF1 A;  4U0W A;  4EMS A;  2HEO A;  4UVC A;  4R1H A;  3HUG A;  3IC7 A;  1ZAR A;  2RV8 A;  3WTW C;  5LRR A;  3LST A;  1IN8 A;  1IZ1 A;  1W7P B;  4M9Z A;  3BOQ A;  3TO7 A;  2DBB A;  2UWM A;  1S7O A;  4R79 A;  4RAY A;  1VTN C;  1IRG A;  5D4R A;  4HYE A;  1FWZ A;  1GHC A;  4KA4 A;  4XLP F;  1UHW A;  4KIB A;  4HQM A;  1O7L A;  4WXC A;  1FBU A;  4LGW A;  5EEG A;  3K69 A;  3GWZ A;  1G3S A;  2FBH A;  1NHA A;  3SZP A;  2JRT A;  1U6G A;  3DQV C;  2HWV A;  2XV4 S;  3F8B A;  5TJJ A;  2JPB A;  1R36 A;  2DK8 A;  4BNC A;  4NHJ A;  1BJA A;  3TQN A;  1KU2 A;  1U2W A;  2HKX A;  4ZYH A;  3LQR A;  3I4P A;  1H9G A;  3FM3 A;  5D6E A;  3NRV A;  3KE2 A;  3KFW X;  3MCZ A;  1IN5 A;  2OQG A;  1SAX A;  3VFZ A;  2ADU A;  1QO0 D;  5J8C A;  4HQE A;  4IRG A;  4OIR F;  1YS6 A;  5LGU A;  3E6D A;  3Q9S A;  1I1G A;  2FF4 A;  4M72 A;  3R60 A;  2WC2 A;  4RB1 A;  2E7X A;  1T2K A;  2RN7 A;  4GXO A;  4L9J A;  5HDG A;  3V7S A;  1F5T A;  3WU1 B;  4IRI A;  1UCR A;  3RKW A;  5ICE A;  2W85 A;  2OU2 A;  4LB5 A;  3HTU A;  4AWX B;  2L54 A;  1UST A;  2ZME B;  4MEY F;  5BPD A;  1GXP A;  4KN4 X;  2XRO A;  1BI1 A;  4HAM A;  3TO9 A;  2QQA A;  4IJA A;  1O7F A;  2QBY A;  3P9I A;  2W84 A;  3HTS B;  1LJ9 A;  4S04 A;  2P7C B;  2PMH A;  3VOE A;  4EJV A;  4ESJ A;  4L0Z B;  2DPU A;  4G7Z F;  2V1X A;  3IKT A;  3ZMD A;  3E6M A;  4BHP A;  5IT9 Z;  2FRH A;  1T38 A;  3I54 A;  4L9N A;  2G9W A;  2E1N A;  1F9N A;  1CF7 A;  4MQV A;  4LK0 F;  1SFE A;  3FM5 A;  5BMZ A;  2O8X A;  2H94 A;  2ELH A;  1WRJ A;  1V3F A;  2HR3 A;  4HOB A;  3CO6 C;  2ZBK A;  3NQO A;  4L0Y B;  1G4D A;  5D5W B;  3KLO A;  1JXS A;  3M9A A;  3KLN A;  4XSZ F;  2X4H A;  2P8T A;  1O3T A;  1HBX G;  5DUK A;  4BXU A;  5JVT A;  1FP2 A;  3PFI A;  3VEP A;  1YW8 A;  3K9T A;  4DQ2 A;  3C3W A;  3MQ0 A;  4I98 B;  1Z05 A;  4BYY A;  3F21 A;  2O0Y A;  3DPT A;  3K2Z A;  4B8X A;  1YG2 A;  3V4G A;  4PDK A;  2R7F A;  2BYV E;  2W24 A;  1BI3 A;  2L4M A;  5DCM A;  3I59 B;  1USS A;  5D5X B;  1U3E M;  3TOA A;  2FXA A;  3FX3 A;  1HXD A;  3E5X A;  3BPX A;  1XCB A;  5FFZ A;  2A6H F;  2KRF A;  2IP2 A;  3EQL F;  2A3S A;  4IHS A;  3QPT A;  2DPD A;  1FSE A;  1DDN A;  1ON1 A;  2OBP A;  2DI3 A;  5H6Q A;  2FMY A;  5BS6 A;  2K4B A;  2FQ3 A;  2VXZ A;  3WTT C;  1ZHF A;  2PLY A;  3SZT A;  1T0F A;  4LG0 A;  4K2E A;  1SMT A;  3R6S A;  2PEX A;  5HS8 A;  2VOP A;  1YLF A;  1RI7 A;  3J81 Z;  4UVB A;  4O5V A;  1LDK B;  4EQQ A;  3CUO A;  4HF0 A;  4UHT A;  2HZT A;  2QYO A;  5CVU A;  3C7J A;  3KP2 A;  4WX9 A;  1XSX A;  5DCF A;  2RQP A;  2VC0 A;  3FXU A;  2D45 A;  1XCV A;  1B9M A;  3HRU A;  3K1N A;  5FB2 A;  2YSR A;  2RGV A;  4PGG A;  2DK5 A;  5CLS A;  5K1Y A;  1TQM A;  3QAH A;  5CVI A;  3ECO A;  1P92 A;  5LHI A;  2Z9O A;  3GXO A;  1KU3 A;  2IA1 A;  4HDV A;  2CYY A;  1MJB A;  3FHZ A;  2WV0 A;  1RUO A;  1XN7 A;  3TOB A;  1TNT A;  3LFK A;  3WGI A;  2GXB A;  3O6B B;  4FHT A;  3HSR A;  4E70 A;  1ZN2 A;  5FD5 A;  4UXN A;  1PP8 F;  3G73 A;  3ZP5 A;  1ZH5 A;  1STZ A;  3TKY A;  4DNC A;  4ENM A;  2M8E A;  5FGM A;  2GIV A;  1HW1 A;  4YII A;  5E18 F;  1OYI A;  1KU7 A;  1BIA A;  4ENJ A;  1DUX C;  1I27 A;  5L3C A;  4EGZ A;  3GFM A;  1ZAO A;  3ZMZ A;  2GAU A;  3TGN A;  2XAJ A;  4XSX F;  2A61 A;  4NB5 A;  3GX4 X;  3V8L A;  3P9K A;  2UXN A;  4L9V A;  2W57 A;  4KMF A;  3SFZ A;  3J80 K;  4BAY A;  1LDD A;  3FMR A;  1Z9C A;  2P5K A;  1XSD A;  2P5L C;  1FT9 A;  1J75 A;  1CGP A;  1FSH A;  3CJN A;  4UNO A;  1GVJ A;  2M5W A;  3SHF A;  2VE8 A;  1KYW A;  3CUQ A;  3RPU A;  1ZYR F;  2PQ8 A;  5ICF A;  3IL2 A;  4CHU A;  2CW0 F;  3GFJ A;  3KZZ A;  1FYK A;  2L4A A;  3I64 A;  1OYW A;  1PUE E;  3ULQ B;  3ML6 A;  1GXQ A;  3BJO A;  2DFI A;  2XAS A;  2RVC A;  4Z2Y A;  3JAM Z;  5L3E A;  2XAG A;  1E17 A;  5D5U B;  4BHC A;  1IW7 F;  3I0T A;  4WXH A;  3FZV A;  1EH6 A;  1O3S A;  3MEX A;  4I02 A;  4D0P A;  2VC1 A;  3HHH A;  4LMY A;  3EYY A;  3V7R A;  1QQI A;  2NNY A;  2KIM A;  2EFQ A;  4HX7 A;  1K78 B;  1TTY A;  3RIR A;  1MJ9 A;  5FO5 A;  1O3R A;  5K5O A;  2KJC A;  4GCV A;  3ZMV A;  1RZ4 A;  1ZG5 A;  1WQ2 A;  1SD7 A;  1BI2 A;  1SD5 A;  2V1U A;  2CQK A;  5HLI A;  2COM A;  5K5Q A;  5ILV A;  4Q47 A;  1XGM A;  2DU9 A;  5F6F A;  1YQA A;  1SFX A;  2GQQ A;  2RKH A;  2MH9 A;  1IN7 A;  1YO5 C;  2BBY A;  1G6N A;  3H92 A;  1LDJ A;  5JFR A;  1BC7 C;  1BN5 A;  1J2X A;  2FEZ A;  1IUY A;  2QQ9 A;  4U0V A;  3F8N A;  3E6B A;  2NYX A;  3O3K A;  1B1B A;  5A2Q Z;  1LNW A;  3L2C A;  2ZFW A;  2ZNZ A;  2F2E A;  3MZY A;  4ETS A;  4EJT A;  5E8I A;  2HDC A;  4I09 A;  3U1D A;  3W6J B;  3IHU A;  5IT3 A;  1H0M A;  4P9F A;  3BDD A;  2ZO4 A;  5D8K B;  4A5N A;  1TLH B;  4A0Z A;  3I59 A;  4OMY A;  4UUV A;  1O3Q A;  4B09 A;  2C6Y A;  1KYZ A;  2O03 A;  1TQI A;  1REP C;  1YS7 A;  3V8J A;  3I5U A;  4RS8 A;  3GO5 A;  1XGN A;  2K4J A;  5HS7 A;  1L0O C;  3L7W A;  5DD8 A;  4GGG A;  5LEJ A;  3B73 A;  2QZ8 A;  4UV9 A;  3GFI A;  3R61 A;  2STT A;  4IRH A;  1T39 A;  5H6R A;  3MAJ A;  1MZB A;  2FE3 A;  2B0L A;  3I53 A;  4R8H A;  4LLN A;  4S05 A;  1W7P D;  1HW2 A;  3KET A;  1V4R A;  3HRS A;  2VBY A;  2QLZ A;  3M8F A;  2L02 A;  3B02 A;  4N9I A;  3ZQ7 A;  4AIJ A;  5D8L B;  5CVV A;  4M73 A;  3F72 A;  4G7H F;  1TQP A;  4ESB A;  2GXG A;  2FBI A;  2CO5 A;  4LLG F;  2LSO A;  2EFP A;  5CYV A;  5FFX A;  1XD7 A;  4OIO F;  4YG2 F;  1YW9 A;  4U0Y A;  1LVA A;  3CTA A;  5KK1 A;  2JPC A;  1QPM A;  1EV7 A;  2HS5 A;  1R7J A;  1BOA A;  4YIF A;  4Q48 A;  3ABT A;  1HKT A;  1IRF A;  2HQN A;  2K7L A;  4IHT A;  5HDN A;  1J7K A;  2DQL A;  2R7D A;  2V6C A;  4PCQ A;  2XKO A;  6PAX A;  2DTR A;  4CZZ A;  1J0R A;  2XIG A;  2O3F A;  5D6F A;  4I0A A;  5LHH A;  2WWY A;  3R0A A;  4LJZ F;  2P7V B;  3OV8 A;  1YYV A;  1ZG1 A;  1WSU A;  1OR7 A;  5FLX K;  1JE8 A;  2EB7 A;  3Q5F A;  1G3Y A;  2R3S A;  4U7B A;  5AIP A;  1WI9 A;  3M7G A;  1BIB A;  3WE2 A;  4M9X A;  1FNN A;  4FT8 A;  3L00 A;  2GA2 A;  1D5V A;  4N9H A;  3ZMU A;  2PMU A;  1OMI A;  4N0B A;  4EJO A;  1RIO H;  2STW A;  1P6R A;  3IWF A;  1C0W A;  2OD5 A;  2Z99 A;  2DLL A;  1U5T C;  2P5V A;  3TDZ C;  2NNN A;  4QWQ A;  3T0Y A;  4OMZ A;  5ILU A;  3GF2 A;  4RGX A;  2EA2 A;  1KQ0 A;  4Y17 A;  2XRN A;  3E3V A;  5L3G A;  4MTD A;  4LLL A;  2FNA A;  3H3U A;  4BQA A;  1OKR A;  2VBX A;  2FML A;  2W25 A;  1KQ8 A;  4RGS A;  3F6O A;  2XUB A;  3LAP A;  3DF8 A;  1HKS A;  1R58 A;  3T5X A;  3BRO A;  4A2U A;  2VOD A;  5LRS A;  5JR3 A;  3F6V A;  1YW7 A;  1F1Z A;  3IRR A;  2H09 A;  1I6X A;  4MHG A;  2K86 A;  2RC4 A;  1P4X A;  4KDP A;  2IPQ X;  1Q1H A;  4YFK F;  2YX4 A;  3CO7 C;  2BE5 F;  2QUF A;  2E7W A;  1FYL A;  4Q4Z F;  5ILS A;  3PQJ A;  2BGC A;  4OOI A;  3GZ5 A;  1DP7 P;  4P96 A;  1FP1 D;  5DV5 A;  2CFX A;  5F64 A;  4AIH A;  3F8F A;  2DO7 A;  4HDU A;  2KIU A;  2EFW A;  4PZJ A;  2Q8K A;  1XDU A;  1U8R A;  3HSF A;  5FD6 A;  3MFK A;  2K02 A;  1R23 A;  1TBX A;  1BI0 A;  4U88 A;  2IRF G;  1BM9 A;  2LDU A;  3T8R A;  1DPU A;  2EV0 A;  3FXQ A;  4M6Y A;  1W7P A;  3R4K A;  3HIF A;  4KN7 X;  1XMK A;  1B9N A;  2ESH A;  4RB3 C;  1IXC A;  1S8N A;  1TW3 A;  3BWG A;  5ERI A;  1MJA A;  4I2O A;  4A0Y A;  2MLK A;  3WTX C;  4JK1 X;  4ON0 A;  5TRD A;  1YTY A;  2YR2 A;  4A6D A;  3GYH X;  3IWZ A;  4CDG A;  3GFL A;  4RAZ A;  3HRM A;  4CXF A;  3E97 A;  4LFU A;  3WGG A;  3ZN1 A;  3CUQ C;  5L3F A;  5E1X A;  1PDN C;  2ISY A;  4G9Y A;  1J59 A;  4M9S A;  1ZRE A;  4EVI A;  4HBL A;  5LGN A;  2OZU A;  4L18 B;  1JHF A;  1IXS B;  5D5V B;  3LA3 A;  2L3D A;  2MD5 A;  1QZZ A;  4RB2 C;  3JW4 A;  2EFO A;  4KIC A;  3HOS A;  2A6E F;  2XKP A;  3KP3 A;  2YPR A;  4IVN A;  1XMA A;  4ZZL A;  2XGX A;  2PN6 A;  2VBZ A;  1FY7 A;  3QP6 A;  3G3Z A;  1FLI A;  1T6S A; 
#chains in the Genus database with same CATH topology
 1T33 A;  3PNV A;  5FKO A;  2JZY A;  5LD2 C;  1R00 A;  2F4M B;  5IT9 K;  1FOX A;  4B3A A;  2FU4 A;  3UR3 C;  1KZH A;  4WXD A;  2TRT A;  4YFX F;  1ETX A;  1ON2 A;  3FWE A;  1K4S A;  4LB6 B;  2DA5 A;  1APL C;  3IKV A;  4GYI A;  3JTG A;  2DTZ A;  1EH8 A;  4ABZ A;  1LPQ A;  1UHM A;  3H9J A;  3OYE A;  1QA6 A;  3ELK A;  2JA7 J;  1R4M B;  2F48 A;  2KL4 A;  3MD2 A;  3C18 A;  1LFU P;  1ZR4 A;  4HF1 A;  3A01 B;  2KIQ A;  1YOV B;  2R7W A;  2FOK A;  3RQI A;  2E35 A;  4IF4 A;  4P5O A;  3GTJ J;  2HVS A;  1IRZ A;  5H20 A;  3W6K B;  2ZKZ A;  3CLO A;  1QNT A;  2IGM A;  1VFC A;  4UUT A;  2MLG A;  4RB0 A;  5GAH J;  4DYQ A;  2XPU A;  3ZMS A;  3WTV C;  5JHU A;  3U9G A;  2VKE A;  3TDU C;  1HCR A;  4Y13 A;  3S2H J;  1WHU A;  4AM3 A;  2EIN H;  4CYC A;  2CQ7 A;  3EUH A;  2ZME A;  1RR7 A;  3ZCO A;  2JT1 A;  2M4K A;  1TWG J;  1EKE A;  5IPA A;  2E1C A;  3OYJ A;  4HX8 A;  3TO6 A;  2EV5 A;  1W36 D;  1X4P A;  1XB4 A;  1FX7 A;  3JTH A;  3QPS A;  2KIF A;  2LF8 A;  2VT3 A;  4A3G J;  2CUE A;  3HM5 A;  2VT2 A;  2L01 A;  4KIF A;  3M4O J;  1N77 A;  2X1C A;  2HYG D;  1SFU A;  5EZH A;  1BA5 A;  4F7Z A;  2WY7 Q;  3PM1 A;  1K7A A;  1MKM A;  3REO A;  5E3M A;  3ZMT A;  1R5H A;  2BEO A;  3ABL H;  4C3I J;  3GLX A;  4Y33 A;  3DTK A;  1AOY A;  5E8G A;  3RTR A;  2QEN A;  2PJR A;  1KGS A;  2A69 F;  1FBS A;  2NVT J;  4DZP A;  5J1Y A;  2XAQ A;  2LKP A;  1Z3Y A;  3HPH A;  2E2J J;  3S2D J;  1U5T B;  2NS0 A;  1Y56 A;  2V1D A;  5HLG A;  1W5S A;  2VE9 A;  3G71 I;  1ZRD A;  3BQZ A;  4JQF A;  3ERE D;  5GAD J;  1P4W A;  3OYD A;  3E5U A;  3E5Q A;  4XRF A;  1R1T A;  3K1P A;  3M1E A;  1AA7 A;  2LVS A;  3HOX J;  3R0J A;  3DV8 A;  1BR1 A;  1K79 A;  4MEX F;  1HW5 A;  2I10 A;  4XOP A;  3ECH A;  1TW2 A;  2A5Y B;  3B6C A;  1ZLK A;  4NBQ A;  3RSN A;  3NWS A;  4G94 A;  3GTP J;  4RBO A;  3A4C A;  1Y8Q B;  2Q2E A;  4OIN F;  4XIC A;  5TIS C;  3K4C A;  3RI4 A;  4ZH4 F;  2Z2S B;  5J4V A;  3JRB A;  2A6T A;  2KFD A;  1HKQ A;  1R5I D;  2L9N A;  4RM3 A;  3DBL B;  2KKO A;  2VAS A;  3J81 K;  2LNB A;  1ITY A;  4BY1 J;  2NVQ J;  2E36 A;  3MZ8 A;  5EG0 A;  2X0L A;  2IA2 A;  4EM2 A;  4HZF A;  3VB2 A;  4EM1 A;  1ZLJ A;  1OCR H;  3SXY A;  4ENK A;  2BVM A;  3S1Q J;  4GDF A;  3F9K A;  2JSP A;  4Y3O A;  2VIX A;  5HDK A;  2V7F A;  2R7V A;  2Q0O A;  4H0E A;  3V7C A;  3HBL A;  4A6E A;  2KZV A;  2Z16 A;  2EV6 A;  1FIA A;  3WTU C;  3MZH A;  1X2M A;  3P5J A;  2CMP A;  1SVL A;  3NEU A;  4N4N B;  3V8K A;  1TT0 A;  3M8E A;  4P55 A;  1IV8 A;  4I0B A;  3U2R A;  1OCC H;  3K4J A;  1POG A;  2XGD A;  3K70 C;  2O5R A;  5AON A;  4EM0 B;  4BGD A;  4NUB A;  1QHH D;  3DU6 A;  3CDH A;  3CJT B;  2LTP A;  2HNH A;  4IHW A;  4JBA A;  3K0L A;  1VF9 A;  2KHM A;  4XBF A;  1E3P A;  4A3M J;  2Y48 A;  2BHY A;  1D8J A;  3D0S A;  3PQK A;  3PSI A;  5J1U A;  1WH5 A;  3QOE A;  4KIG A;  3ROU A;  1IXR C;  1I1S A;  3KCC A;  2P6S A;  5BOX A;  3S93 A;  4BHB A;  2D1H A;  2K9N A;  3CCY A;  5J4Y A;  1ZRC A;  4P9U A;  2ZSH B;  2JA8 J;  4A0X A;  4M3G A;  1R1V A;  5K7Z A;  2EZH A;  3CC2 I;  2JN6 A;  1E2X A;  1G3T A;  1BOB A;  1ZG3 A;  4U87 A;  1LB2 A;  3K4K A;  1X1A A;  2QWW A;  5E3L A;  5L3D A;  1X19 A;  2GZW A;  4BXF A;  4I01 A;  4KT5 C;  4EJU A;  5BQT A;  5HVQ C;  3PSF A;  5E20 A;  4JYK A;  1P9Q C;  4HG2 A;  1TC3 C;  3HB9 A;  2VXD A;  2O7O A;  1ONV A;  2DT5 A;  3DP7 A;  4UVA A;  4ZYE A;  4QTR A;  3EYI A;  4BJT A;  3WTS C;  3J7A O;  4MNU A;  2VJ5 A;  4CCN A;  4UV8 A;  3CCJ I;  1O4X A;  1YIJ I;  1GT0 C;  1OFC X;  1ULY A;  3OR1 C;  4BDZ A;  2OC6 A;  4LIT A;  2ETH A;  4AVP A;  2XB0 X;  1A04 A;  1RES A;  3EET A;  2CGP A;  2L2O A;  1D8K A;  2HTJ A;  1W4M A;  2RNJ A;  2VJ4 A;  3LSM A;  4HW0 A;  4DOZ A;  3QOP A;  5CVJ A;  4LOC A;  4E4H A;  4D5C A;  1FOK A;  1IGN A;  5KCM A;  2FA5 A;  3ZQL A;  2LOO A;  3A03 A;  4M71 A;  4AIK A;  1IAW A;  4CA0 A;  3MKL A;  1ETQ A;  4L5J A;  2BW3 B;  1HQC A;  3KYC B;  4D7N A;  2CG4 A;  2EK5 A;  4A3E J;  1ZGJ A;  1K4T A;  5ICC A;  1DU0 A;  3OYB A;  1S6L A;  2D1V A;  3JRC A;  3G4S I;  3LAJ A;  2O61 A;  1B6A A;  2BV6 A;  1HST A;  2ESN A;  1JGS A;  2DT6 A;  1GVD A;  4BXX J;  1T95 A;  4WWC A;  2FOW A;  3Q9V A;  1KU9 A;  1MBE A;  3LWF A;  3KP7 A;  3CCE I;  3HSE A;  2BZT A;  1VQ9 I;  2IJL A;  2AXL A;  3CUQ B;  1S3J A;  5LGT A;  1J9I A;  3LA7 A;  2HYF A;  2GOX B;  1MDM B;  4W1U A;  2WB1 A;  4A12 A;  2V79 A;  4FX4 A;  1U78 A;  4ESF A;  2IT0 A;  2LP0 A;  2VQC A;  4CIC A;  2XF5 A;  3CCR I;  3QRF F;  4Q5S F;  4IQJ A;  3AAF A;  1FTZ A;  4KYW A;  2XAF A;  2LFB A;  3ISP A;  1EJ9 A;  1Z6T A;  3GTO J;  3IRQ A;  4F93 B;  3PL8 A;  2RDP A;  1ETW A;  4RAG A;  2HFH A;  5ICG A;  3BP8 A;  2FX0 A;  4IHX A;  3FXM A;  3W6V A;  1WCM J;  4XLF A;  4XMY A;  3T1B A;  1ZGA A;  2YU3 A;  1D1A A;  3CCV I;  1WPK A;  1VND A;  2K40 A;  5DD4 A;  3JSP A;  2X9D A;  4V19 K;  1TWF J;  1X3U A;  3MWM A;  1HSJ A;  1B4A A;  3JAM K;  5BPI A;  4GRI A;  4BQQ A;  3P7N A;  5FRO A;  1BBY A;  3H3V K;  3DKW A;  4LD5 A;  3WTZ A;  1Z1D A;  1OCZ H;  1P7J A;  4BH9 A;  5DDG A;  4XM3 A;  1V54 H;  4XLA A;  3OYH A;  1VQO I;  2VJJ A;  1LEA A;  2IA0 A;  3DEU A;  3HGG A;  3OMY A;  3OWT A;  2V9P A;  1WKM A;  3LA2 A;  3ZQC A;  1ENH A;  1W5T A;  1XDS A;  1QGP A;  2M7A A;  3K4L A;  2IVM A;  3OL3 A;  3J80 Z;  4A3F J;  4IOA F;  3HC7 A;  2HXI A;  2F4O B;  3OOP A;  4QSH A;  2LY9 A;  4C3H J;  3CMM A;  2J5O A;  1I6H J;  3CC7 I;  1W0U A;  3H1C A;  2EJR A;  4PJ0 C;  2V26 A;  1X3W B;  2IS1 A;  5DYM A;  4A5M A;  3KEO A;  1OPC A;  3MMY B;  4G7O F;  4HX4 A;  3DKY A;  4GO1 A;  1JUM A;  4J01 A;  5EYR A;  1S29 A;  3VYS B;  1DU6 A;  2Y75 A;  3F22 A;  1D5Y A;  1KQ9 A;  4TV7 A;  2XGE A;  3O8G A;  5J8F A;  2V9K A;  2A68 F;  3F3X A;  5HS9 A;  3L09 A;  3HHG A;  1F36 A;  2E34 A;  5KNL A;  2FSW A;  1T98 A;  2N8G A;  3AFH A;  2JVH A;  2R92 J;  2R7O A;  1QZY A;  1W1W E;  4PUS A;  5M5X J;  2VOO A;  4FX0 A;  1XC5 A;  1X1C A;  4NQW B;  3I58 A;  3QQA A;  4FIS A;  4HA8 A;  2Y0M A;  2E71 A;  5LHG A;  4G6D A;  2CSO A;  4N4O B;  3ZQH A;  5C4X J;  4M6X A;  4OIQ F;  3K7A J;  1S7A A;  3GVA A;  2HGC A;  4E7J A;  3TMO A;  2LMD A;  2KDZ A;  3VPR A;  1LE8 B;  2A07 F;  5JHF A;  5M3F J;  2PG4 A;  4CO8 A;  3KP4 A;  3QU3 A;  1GUU A;  3F8C A;  5H2F C;  4L9T A;  1SMY F;  3WTY C;  3LMM A;  5J6X A;  1WJA A;  3BC8 A;  5A2Q K;  3E6C C;  3RZD J;  3ZQI A;  2OJE D;  3HUG B;  2H6C A;  2Q1Z B;  2R5Y B;  3TW7 A;  2BY3 A;  2OV7 A;  2WB1 N;  4FAS D;  2QQB A;  1K61 A;  2H6B A;  1Z6R A;  2KMU A;  4BY7 J;  4MTE A;  1Z7U A;  2UXX A;  3FKJ A;  4AD9 A;  2QSF X;  2YS9 A;  2H27 A;  4A3J J;  4CGZ A;  2DMN A;  2DQR A;  2W1O A;  1MH4 A;  3DWL E;  2JA2 A;  1R1U A;  3GTK J;  3KP6 A;  1K78 A;  2ZJ2 A;  2IS4 A;  4D1Q A;  2A05 A;  3RYR A;  3BLY A;  2DA1 A;  1HDP A;  3RYP A;  4BKX A;  3FXO A;  2CQQ A;  3QU6 A;  3HOT A;  4ZYG A;  4QLC U;  2NRA C;  4X6A J;  3DLA A;  4KNY A;  3KEQ A;  3VSK A;  3HG9 A;  1HOM A;  2O6G E;  3K1M A;  1JHH A;  3CME I;  5L3B A;  4KIT B;  4XKB A;  2LLK A;  4H4K C;  1Y0U A;  3QP5 A;  4HEA 2;  4J19 A;  4ZDO A;  1MMD A;  3GME A;  5D4S A;  2BHZ A;  2OQR A;  2MC3 A;  1U5T A;  1PUF B;  3RKY A;  2DA7 A;  4IXA A;  2PJP A;  3S1N J;  3DPL C;  1XPX A;  3ZRG A;  2DAO A;  1R22 A;  1O57 A;  5KAI C;  2BXY A;  2GA1 A;  1FMV A;  3P9C A;  3E1S A;  3CMY A;  2XHK A;  2P4W A;  4HST A;  5LLQ A;  2YX7 A;  1AWC A;  3S2W A;  3DEE A;  2JMW A;  2HQR A;  3RPQ A;  4WF2 A;  2EZL A;  2RRE A;  1MIJ A;  1LQ1 A;  2PI0 A;  3LSP A;  5E17 F;  4F55 A;  3TL4 X;  4HV6 A;  3WU0 A;  2V6E A;  5FRN A;  2MH2 A;  3CZ6 A;  3K6G A;  1G59 A;  5F1R A;  2F5D A;  1TL8 A;  3IP4 B;  4ANJ A;  5E1Z B;  5DUI A;  4ZC3 A;  3H3Z A;  4HF2 A;  1ZK8 A;  2AXT C;  1J5Y A;  1ZEL A;  2G7H A;  4KFC A;  5F1J A;  1P4A A;  2QSG X;  2HYJ A;  2LY2 A;  3EUK L;  4XON A;  4PK4 A;  3D5L A;  3L9F A;  3RDI A;  5JLX A;  4M74 A;  4IHV A;  3I9V 2;  4RMN A;  1KA8 A;  2ZNY A;  2OZ6 A;  4LK1 F;  1VQL I;  4FTH A;  4A3L J;  2Y69 H;  4O6J A;  3RJP A;  1D1B A;  3M3Y J;  3W3C A;  1X4O A;  2OA4 A;  5KVR A;  1UMQ A;  2R7U A;  3JSO A;  4EGY A;  1PP7 U;  4FQG A;  1YRN B;  3OIQ A;  2EA4 A;  1BJZ A;  4Z6Y A;  1MMA A;  1JUS A;  1XGS A;  4U7D A;  1I5Z A;  5J40 A;  5IY5 H;  2VON A;  2HOA A;  3ERM A;  4BQO A;  1RUN A;  1NTC A;  2LG4 A;  4LIU A;  2MG4 A;  1FBQ A;  2OAZ A;  3RQ4 A;  3PIO F;  4B4C A;  1BW5 A;  2IGO A;  3ABU A;  2OUM A;  4G8X A;  4KMU X;  3WGH A;  2TDX A;  4DBQ A;  3O2P E;  2Z3Y A;  5B1A H;  5AIQ A;  2L7K A;  1TWH J;  5E1W A;  2G7U A;  4LIV A;  3I56 I;  2CWE A;  3FBN B;  4E7Z A;  1D0X A;  3OR2 C;  4RLF A;  3GBG A;  2J5P A;  3ABK H;  1R5G A;  3BZ6 A;  3EUA A;  1L3L A;  1FC3 A;  2KJB A;  4E7S A;  3ZGK A;  4MGR A;  2QBY B;  2KZG A;  3GW2 A;  4DBR A;  2IW5 A;  4QIW N;  1B59 A;  4QPQ A;  3A02 A;  3WG9 A;  2WBM A;  2BXZ A;  2XAH A;  5HOO A;  4HV5 A;  4CYD A;  2DOE A;  5EEH A;  3GZ6 A;  5F27 A;  2WTE A;  2PFB A;  1H9T A;  2Z5U A;  2F5C A;  5JI6 A;  2W48 A;  3KZY A;  4OAZ A;  4L5I A;  4DW6 A;  1K83 J;  4EAT A;  1MMN A;  4OU0 A;  3OS0 A;  1JJ6 C;  4PGH A;  4BE2 A;  1R71 A;  5LBQ A;  3LOC A;  2OCC H;  2EWN A;  3A0H C;  2ZFU A;  4HLY A;  2HDD A;  4EJW A;  4XLN F;  4ZYD A;  3GUD A;  1DPR A;  4GYG A;  2ZCW A;  2DDB A;  1S5L C;  3BR2 A;  5J47 A;  3VOD A;  1CF7 B;  2ZXI A;  2CFO A;  4C2T A;  3HXL A;  3COA C;  1K6O A;  3EUH C;  2DMT A;  1OYY A;  2ZME C;  3VYR B;  3ZPL A;  1IN6 A;  2B63 J;  3HZJ A;  3S15 J;  3WOD F;  2AQE A;  4KUM A;  2GBY A;  3N97 A;  1XSV A;  3C2G A;  3G1M A;  2QEX I;  1QPI A;  2EH3 A;  3FMS A;  3IAS 2;  3FMQ A;  3N4M A;  1Z3X A;  5FRM A;  4G6Q A;  1UFM A;  1ODD A;  3OIO A;  3EDP A;  1IC8 A;  2VQL A;  1Z91 A;  3BPV A;  3K4B A;  2GWR A;  1D3Y A;  4Y4R A;  4RGR A;  2ZB9 A;  1V55 H;  4II2 A;  3S17 J;  2ID3 A;  4IQ4 A;  3PUB A;  1IN4 A;  1VQ7 I;  1F4K A;  1SD6 A;  3M1C A;  2P6T A;  3GEZ A;  1FZP B;  1BC8 C;  3OYN A;  3RKX A;  3FXR A;  1MD0 A;  1EH7 A;  3QYB A;  1VQP I;  1ZR2 A;  3CF5 F;  1SC7 A;  1MDM A;  5ED4 A;  2FBK A;  1LKX A;  4XRM A;  4G6T B;  5B1B H;  3BJ6 A;  3N05 A;  1YFH A;  2D2W A;  2ZXH A;  3BG3 A;  1JGG A;  3QPH A;  2M8G X;  2LF7 A;  1VQ8 I;  4ZDL A;  2M1B A;  3HRT A;  4FET A;  5EZG A;  5IP7 J;  5HLH A;  4WK8 F;  1FYM A;  2DFE A;  2F5F A;  3F8M A;  3WHC A;  2Z1D A;  1YX3 A;  4XLH A;  1SD4 A;  5K5R A;  4IPA A;  4ASN A;  4EV0 A;  1IV6 A;  4Y15 A;  5DEQ A;  1YX5 A;  2H1L A;  5DCM B;  2XVC A;  3HYI A;  2LBF B;  4W97 A;  4YFN F;  2IBD A;  2DCE A;  5B66 C;  2RQQ A;  2XRL A;  3LQQ A;  5EF6 A;  2QCO A;  2P81 A;  1XX5 A;  3CJR B;  2DYR H;  4HLX A;  1VQN I;  3AG2 H;  4BJ5 C;  1LEB A;  2F5E A;  3PJR A;  4HNV A;  1TNS A;  2JTV A;  2BY0 A;  1MH3 A;  1ZRF A;  5FLX Z;  4RGU A;  2IAI A;  1X3Z B;  4OIP F;  4I7H A;  5LEK A;  2UZK A;  3C1D A;  4O3M A;  3F0C A;  2M30 A;  4MQ9 F;  2HVR A;  3HOU J;  1T08 B;  2R7Q A;  1RNL A;  4LG3 A;  1A6I A;  1XS9 A;  1JTX A;  4IKF A;  1FEX A;  1UB9 A;  4WCG A;  2QVO A;  3ONQ A;  4B44 A;  2QGU A;  3TP0 A;  2M45 A;  4LG0 B;  3S3N A;  2EIM H;  3H9Q A;  2VN2 A;  2OCE A;  3SQN A;  3FXL A;  2ZXW H;  3IH3 A;  4KJZ A;  2FNP A;  3B6A A;  1AKH B;  4F91 B;  2AS5 F;  2HOE A;  2K5C A;  3LFU A;  4YRV A;  1DP3 A;  1BL0 A;  1XGO A;  1WJD A;  3OL4 A;  1IO2 A;  3HOW J;  3BJA A;  2ZXJ A;  2ACJ A;  1Z7L A;  2QM3 A;  2ISZ A;  4ENN A;  3VWB A;  2HKO A;  5F0C A;  2DW4 A;  3FF5 A;  3KP5 A;  5KAF C;  1HC8 A;  3T8T A;  3ZN0 A;  1E3O C;  4F3Q A;  2HTS A;  4E7L A;  3BY6 A;  2JSC A;  2RAE A;  3AG4 H;  2M87 A;  3SEQ A;  1SVO A;  3DXJ F;  2K9M A;  3TBI A;  3WE3 A;  2EFN A;  3I71 A;  2L5Q A;  1FPQ A;  3DFG A;  1XTA A;  2DFF A;  2LRD A;  4NQW A;  1MGT A;  1T56 A;  1G3W A;  1YIO A;  1X1B A;  2DJI A;  2K3P A;  5DTD A;  4ZZD A;  2Z33 A;  2V9V A;  3E0J B;  1QBJ A;  3QYF A;  1P2F A;  2NAZ A;  2VBW A;  3K10 A;  3GZN B;  4PJN A;  2PBI A;  1SEU A;  2MA3 A;  3F23 A;  1WWX A;  1IJW C;  1LE8 A;  1LFB A;  4XLC A;  2MBF A;  5CJ9 A;  5CVR A;  2K27 A;  2Y30 A;  1IF1 A;  4U0W A;  1T8I A;  4UUS A;  4EMS A;  2GOM A;  2VL8 A;  4B43 A;  2HEO A;  4DYC A;  1YIT I;  5HOD A;  1TT5 B;  4UVC A;  4XR6 A;  1XMX A;  2L7Z A;  4R1H A;  4RAF A;  3A1Y A;  3HUG A;  4FE7 A;  3IC7 A;  1ZAR A;  2QF7 A;  2RV8 A;  2KT0 A;  2R93 J;  3WTW C;  5LRR A;  3LST A;  1IN8 A;  1IZ1 A;  1W7P B;  4M9Z A;  2QSH X;  2HVQ A;  3BOQ A;  3TO7 A;  2DBB A;  2UWM A;  3S1M J;  1S7O A;  3CJQ B;  4R79 A;  4RAY A;  1VTN C;  1IRG A;  2E1O A;  2CUZ A;  1BR2 A;  3IUO A;  5D4R A;  4JX6 A;  2ID6 A;  4HYE A;  4KIS A;  1IDY A;  1FWZ A;  1GHC A;  3WU2 C;  4KA4 A;  4HSR A;  2HI3 A;  1UHW A;  4XLP F;  4KIB A;  3HDD A;  2IGN A;  2ICW G;  4HQM A;  1O7L A;  1V5E A;  1SVM A;  4WXC A;  1FBU A;  4LGW A;  5EEG A;  3K69 A;  3GWZ A;  2KDO A;  1G3S A;  2FBH A;  1AHD P;  1OQY A;  4MFD A;  2CW8 A;  1G8X A;  1NHA A;  3SZP A;  2JRT A;  1U6G A;  3DQV C;  3JRI A;  2HWV A;  2XV4 S;  2XB5 A;  3F8B A;  2DMP A;  3M8J A;  3DLL F;  2NOJ B;  5TJJ A;  5EJC A;  1MND A;  3JRH A;  2JPB A;  1PUF A;  1I50 J;  1R36 A;  2DK8 A;  4IL6 C;  1U9N A;  4BNC A;  2JJ7 A;  4NHJ A;  1BJA A;  3TQN A;  5C3E J;  1KU2 A;  1U2W A;  2HKX A;  3JRE A;  4ZYH A;  3LQR A;  3I4P A;  1H9G A;  2XAU A;  2Y0S A;  3FM3 A;  4IHY A;  4BUP A;  1B8I A;  3SDG A;  5D6E A;  3NRV A;  3KE2 A;  3KFW X;  4PJL A;  3MCZ A;  4RA2 A;  2JA6 J;  1IN5 A;  2FD5 A;  2X6O A;  2OQG A;  4BBR J;  4UB6 C;  1SAX A;  3VFZ A;  4A69 C;  3OS1 A;  2M7B A;  4OWR B;  5DM7 F;  5LFA A;  2FJ1 A;  2ADU A;  1QO0 D;  5J8C A;  3K4M A;  5IOZ A;  1Y39 A;  4HQE A;  1RRJ A;  4HNU A;  4X0G A;  1U8B A;  5EGO B;  4DJA A;  3BZC A;  4IRG A;  4OIR F;  1YS6 A;  1SAN A;  5GTH C;  5LGU A;  3E6D A;  1RR8 C;  3Q9S A;  3Q0U A;  3J7Z I;  1I1G A;  2FF4 A;  1LFP A;  2DA4 A;  1NK3 P;  4M72 A;  3R60 A;  2WC2 A;  4RB1 A;  2E7X A;  5HNH A;  1T2K A;  2XSJ C;  2RN7 A;  4GXO A;  1OR7 C;  2KIS A;  4L9J A;  2KLO A;  2XF6 A;  5HDG A;  3V7S A;  1F5T A;  1YRN A;  2JQ7 A;  2JVG A;  3WU1 B;  4IRI A;  4YIR X;  2JRM A;  1UCR A;  1EA3 A;  1W36 C;  2VKH A;  3RKW A;  2NS8 A;  5ICE A;  4D7M A;  3ASO H;  4AYB A;  2W4S A;  2OU2 A;  2W85 A;  4LB5 A;  3HTU A;  5GAG J;  4BDY A;  4AWX B;  2W7N A;  2L54 A;  3CCQ I;  3SDB A;  2HDW A;  4KT6 A;  4BE1 A;  1JI8 A;  2EZI A;  1UST A;  2ZME B;  4MEY F;  3GTL J;  3OYC A;  1QRY A;  5BPD A;  1GXP A;  4KN4 X;  2XRO A;  1ETK A;  3I4M J;  1BI1 A;  4HAM A;  1JT0 A;  3TO9 A;  2QQA A;  4IJA A;  2MD0 A;  1O7F A;  2QBY A;  1TP4 A;  2YU9 J;  3P9I A;  1ZQ3 P;  2DN0 A;  4XN0 A;  2K9S A;  2W84 A;  3HTS B;  1LJ9 A;  4S04 A;  2P7C B;  2PMH A;  1Z77 A;  3VOE A;  3S16 J;  2X1E A;  4EJV A;  2KQR A;  3J7A Y;  4ESJ A;  4L0Z B;  2DPU A;  4G7Z F;  2V1X A;  3IKT A;  3KIO A;  1JT6 A;  4BL0 B;  3ZMD A;  4CCL A;  3FXJ A;  3E6M A;  3FIW A;  4C2M J;  2WAE A;  4BHP A;  2LRE A;  3ESW B;  5IT9 Z;  2FRH A;  2GIZ A;  1T38 A;  3I54 A;  4L9N A;  2R7Z J;  2G9W A;  1F9N A;  3PNT A;  2HQA A;  1CF7 A;  4C3J J;  4MQV A;  4LK0 F;  1SFE A;  3FM5 A;  2B7E A;  3OYF A;  3LNQ A;  5BMZ A;  2O8X A;  2Y0S N;  3QPL A;  2H94 A;  2ELH A;  1WRJ A;  1V3F A;  2HR3 A;  3BR0 A;  3NAR A;  3CQZ J;  3IH4 A;  4HOB A;  3CO6 C;  2ZBK A;  3NQO A;  1R4N B;  3ZOB A;  2XSD C;  1MSF C;  4BAC A;  4L0Y B;  1G4D A;  5D5W B;  3KLO A;  1JXS A;  2O8K A;  2FUG 2;  3MN2 A;  2VPR A;  3M9A A;  3A01 A;  2DXI A;  3KLN A;  4XSZ F;  2X4H A;  2P8T A;  1U9O A;  1FOW A;  1O3T A;  5DUK A;  4BXU A;  1HBX G;  5JVT A;  2NVY J;  3ZQF A;  2VLA A;  1FP2 A;  3LSI A;  3GTM J;  4XID A;  3PFI A;  5E3O A;  3VEP A;  1YW8 A;  3CDL A;  3PFY A;  2B9S A;  3K9T A;  1TWC J;  4DQ2 A;  1JKO C;  3C3W A;  5F0H A;  3MQ0 A;  3L1P A;  4I98 B;  1Z05 A;  3BR6 A;  4C2U A;  1PVE A;  2LK2 A;  4BYY A;  1R6R A;  2X6Y A;  3F21 A;  1DQU A;  1MBG A;  4PSW A;  2O0Y A;  3DPT A;  3K2Z A;  4B8X A;  3W2A A;  1YG2 A;  2ELK A;  2WY8 Q;  1QHG A;  3SEZ A;  3V4G A;  5EEA A;  1IDZ A;  4PDK A;  2R7F A;  2BYV E;  2W24 A;  1ETY A;  2MYS A;  1BI3 A;  2FQ4 A;  3OSG A;  2L4M A;  5DCM A;  2LBF A;  3MVP A;  3I59 B;  4XOT A;  1USS A;  2VQG A;  2R7S A;  5D5X B;  1U3E M;  4AYB N;  3TOA A;  2FXA A;  2LKS A;  3FX3 A;  1HXD A;  3H0D A;  3E5X A;  3BPX A;  3GCM A;  3LSK A;  1XCB A;  5FFZ A;  2A6H F;  2VB6 A;  2M2E A;  3UNG C;  3K4N A;  2KRF A;  2QKL B;  2IP2 A;  3EQL F;  2A3S A;  5DS9 A;  3L2R A;  4IHS A;  1UZC A;  3A0B C;  3QPT A;  2DPD A;  1FSE A;  5CKT A;  5M5Y J;  3SYT A;  1DDN A;  1ON1 A;  2OBP A;  3ASN H;  3HPG A;  1NG7 A;  2DI3 A;  5H6Q A;  2MFZ A;  4YEL A;  2FMY A;  5BS6 A;  2K4B A;  2X48 A;  2FQ3 A;  4V2G A;  2VXZ A;  1FTT A;  3BTC A;  4M3F A;  1ZHF A;  3HGY A;  4NNJ A;  3SZT A;  2OPT A;  4CH7 A;  3WTT C;  2PLY A;  3S32 A;  4MIM A;  1T0F A;  4RM2 A;  4LG0 A;  1S72 I;  4K2E A;  1SMT A;  2L7M P;  3DU5 A;  3R6S A;  4UY8 I;  2I8D A;  1GV2 A;  2M9H A;  3DBH B;  4XOR A;  2PEX A;  5F08 A;  4A3I J;  1NH3 A;  5HS8 A;  4UB8 C;  4NC6 A;  3OYI A;  2VOP A;  3RZO J;  1YLF A;  4BE0 A;  1R9T J;  3BR3 A;  9ANT A;  1RI7 A;  3TW6 A;  3J81 Z;  4UVB A;  2AHQ A;  3CES A;  3OY9 A;  1K6Y A;  4O5V A;  1LDK B;  4EQQ A;  5GTI C;  2BVL A;  2W00 A;  5FLM J;  1Y8R B;  3CUO A;  3DKX A;  1RET A;  2V4J C;  2ME0 A;  4HF0 A;  4UHT A;  4XRS A;  5C44 J;  2XF7 A;  3KEY A;  3OYM A;  4IO9 F;  2HZT A;  2QYO A;  3G6E I;  2M3A A;  2E60 A;  5CVU A;  2DJN A;  5IYB J;  3C7J A;  3LSR A;  1J09 A;  1V5G A;  1QVT A;  3KP2 A;  3DPU A;  3ABM H;  5FLV A;  4JX4 A;  1XSX A;  5DCF A;  2RQP A;  1GLN A;  3BT9 A;  4WX9 A;  1H88 C;  1UAA A;  1JKP C;  2VC0 A;  3FXU A;  2D45 A;  3FHN A;  2NVU B;  4XKV A;  3CD6 I;  1XCV A;  2R7X A;  1B9M A;  2LYC A;  2VI6 A;  3HRU A;  3K1N A;  3I3L A;  5FKL A;  5FB2 A;  2YSR A;  3K2A A;  2RGV A;  1V5F A;  4PGG A;  2DK5 A;  5CLS A;  1N25 A;  5K1Y A;  1HLV A;  3KYD B;  2DT7 B;  2R4G A;  1TQM A;  2WAF A;  2BY2 A;  3QAH A;  1N75 A;  2R5Z B;  5CVI A;  3ECO A;  1P92 A;  5LHI A;  2Z9O A;  3GXO A;  1SFK A;  2HU9 A;  1GDT A;  1KU3 A;  2K9L A;  4DIQ A;  1GV5 A;  4IX7 A;  2IA1 A;  4HDV A;  2CYY A;  1MJB A;  3FHZ A;  2WV0 A;  1I3A A;  4RLQ A;  2PMZ A;  2DA6 A;  1ORK A;  2BY1 A;  1RUO A;  1XN7 A;  3TOB A;  1TNT A;  2IGK A;  2PX9 A;  3LFK A;  1HA8 A;  3WGI A;  2GXB A;  3O6B B;  4FHT A;  3HSR A;  4E70 A;  1ZN2 A;  5FD5 A;  4UXN A;  1R49 A;  3K70 D;  1PP8 F;  2ECB A;  3G73 A;  3ZP5 A;  2D5V A;  1ZH5 A;  1STZ A;  3TKY A;  3FIS A;  5FKN A;  3VDX A;  4DNC A;  4ENM A;  1MNE A;  2M8E A;  5FGM A;  2GIV A;  2QKM B;  2JA5 J;  1HW1 A;  4YII A;  4BU2 A;  2F5V A;  2K3F A;  1M1E B;  3EPZ A;  1I3Q J;  2MSY A;  5E18 F;  2LD5 A;  1OYI A;  2MGQ A;  1RC9 A;  1CQT A;  3FK7 A;  4NDL A;  1KU7 A;  3BTJ A;  1BIA A;  4ENJ A;  2A5W A;  5B5E C;  1DUX C;  1I27 A;  3CCL I;  5L3C A;  4EGZ A;  3GFM A;  2HZD A;  1ZAO A;  1Q1V A;  3ZMZ A;  2GAU A;  1RPW A;  3TGN A;  2XAJ A;  4C9Y A;  3LSH A;  4XSX F;  2CRG A;  2A61 A;  1JKR C;  4NB5 A;  3GX4 X;  3V8L A;  2V1N A;  3P9K A;  2UXN A;  1MBK A;  4L9V A;  4F52 A;  4I6Z A;  2W57 A;  3TED A;  3JRA A;  4KMF A;  3C2H A;  2XPW A;  3SFZ A;  3J80 K;  2BW3 A;  1LDD A;  3FMR A;  4BAY A;  3OSF A;  2P5K A;  2X85 A;  4CUG A;  1OCO H;  1Z9C A;  2CW7 A;  1XSD A;  1S7E A;  4XLE A;  3I55 I;  2P5L C;  1FT9 A;  1W5C C;  3PO3 J;  3H5N A;  1J75 A;  1CGP A;  1FSH A;  3CJN A;  3G1L A;  3A2K A;  5EGO A;  2P0W A;  3H36 A;  4A3B J;  4UNO A;  3VYU B;  1WJC A;  1GVJ A;  2M5W A;  3SHF A;  2VE8 A;  3OIP A;  1KYW A;  1X1D A;  1OCT C;  3CUQ A;  3RPU A;  5M5W J;  1ZYR F;  2CS3 A;  2PQ8 A;  1WJB A;  4ZTJ A;  3PO2 J;  5ICF A;  2E19 A;  3IL2 A;  4CHU A;  2ZSI B;  2CW0 F;  2WAD A;  3GFJ A;  3KZZ A;  1FYK A;  1JJ8 C;  2L4A A;  3I64 A;  2EIJ H;  2VJI A;  2KRC A;  1OJL A;  5FJ8 J;  1OYW A;  2EIL H;  4BJ6 C;  1PUE E;  3RCO A;  2E2H J;  3ULQ B;  2R7R A;  1FMW A;  1GXQ A;  3ML6 A;  2L9R A;  4A3C J;  1MMS A;  3BJO A;  1QVU A;  2DFI A;  2XAS A;  3S3M A;  4IOC F;  2RVC A;  4Z2Y A;  3JAM Z;  5L3E A;  3ZR8 X;  2OF7 A;  1A31 A;  2XAG A;  1HDD C;  1E17 A;  2WV1 A;  4PJJ A;  5D5U B;  4BHC A;  1IW7 F;  3I0T A;  4WXH A;  2H8W A;  3FZV A;  5DM6 F;  1EH6 A;  1O3S A;  3MEX A;  4I02 A;  3W2V A;  4D0P A;  4HRI A;  3OYG A;  5B3S H;  2VC1 A;  2ECC A;  1SFO J;  3Q0V A;  4HNT A;  3NAU A;  2PMZ N;  3HHH A;  4LMY A;  3SJM A;  3EYY A;  3V7R A;  1QQI A;  3ZQG A;  2KIM A;  2NNY A;  4BEH B;  3CC4 I;  2EFQ A;  2K85 A;  4HX7 A;  1UHS A;  1K78 B;  1TTY A;  3RIR A;  4NC7 A;  1MJ9 A;  3BTI A;  5FO5 A;  1O3R A;  4YEJ A;  2H1K A;  4E7I A;  1VQ4 I;  1E3H A;  5K5O A;  1AU7 A;  3MKZ A;  2KJC A;  3BCA A;  2OTJ I;  4GCV A;  3ZMV A;  5F04 A;  5GPA A;  3HOV J;  4DZJ A;  1RZ4 A;  2I5U A;  1ZG5 A;  2M4G A;  1PYV A;  1WQ2 A;  2CQX A;  1SD7 A;  5KHD A;  3CCM I;  1BI2 A;  1SD5 A;  2M34 A;  2V1U A;  1I39 A;  2CQK A;  5HLI A;  2COM A;  3TP3 A;  5JVG F;  5K5Q A;  2L9V A;  5ILV A;  4Q47 A;  1BR4 A;  1XGM A;  2DU9 A;  2JUG A;  3O8H A;  1YI2 I;  5F6F A;  2IS6 A;  2LY1 A;  1YQA A;  3JCU C;  5J1R A;  1SFX A;  4DGW B;  2F6C A;  1WH7 A;  2GQQ A;  2RKH A;  2COB A;  2MH9 A;  2UV1 A;  1P7I A;  1IN7 A;  3PUF A;  1YO5 C;  2BBY A;  1G6N A;  1B72 B;  3BG6 A;  1D0Y A;  2DYS H;  3H92 A;  1LDJ A;  3D5R C;  5JFR A;  4A3D J;  1BC7 C;  1BN5 A;  4C30 A;  1J2X A;  2FEZ A;  1IUY A;  2QQ9 A;  2IEK A;  2ZJP F;  2CUF A;  4U0V A;  3F8N A;  4BBS J;  4ZDP A;  2TCT A;  3E6B A;  2NYX A;  3CP2 A;  3O3K A;  1B1B A;  5A2Q Z;  4XKC A;  2CV2 A;  1LNW A;  3AG1 H;  4BQN A;  3JRF A;  3L2C A;  2LR8 A;  3H0G J;  1ETV A;  1F43 A;  1E0E A;  2ZFW A;  2ZNZ A;  4XRS G;  2Y2Z A;  2F2E A;  3MZY A;  2RNG A;  5F0F A;  1OIS A;  4ETS A;  1H89 C;  4EJT A;  3HOZ J;  5E8I A;  2HDC A;  4I99 C;  4I09 A;  3GTQ J;  3KX2 A;  3U1D A;  2R5Y A;  1VQ6 I;  3W6J B;  3IHU A;  2AO9 A;  3CLQ A;  3H5R A;  3BR1 A;  5IT3 A;  3ZXS A;  1H0M A;  4PJM A;  3AL0 C;  4D5F A;  3HKZ A;  3AKZ A;  4P9F A;  5FKM A;  2HOT A;  4FE4 A;  3BDD A;  1Y0N A;  3D5S C;  4CZC A;  2F4I A;  3G2B A;  2ZO4 A;  5D8K B;  1NG6 A;  4A5N A;  1TLH B;  4A0Z A;  3I59 A;  5HLT A;  4OMY A;  1X1P A;  4UUV A;  2GXA A;  1O3Q A;  2E1M C;  4B09 A;  1HF0 A;  4ZJZ A;  1KYZ A;  3DEW A;  2C6Y A;  3W2W A;  2R7T A;  2E5N A;  2O03 A;  2CH0 A;  1TQI A;  3DBR B;  1REP C;  3VSL A;  2NVX J;  2GLO A;  3GTG J;  1YS7 A;  2QQ8 A;  3V8J A;  3I5U A;  1QZE A;  3J7Y J;  2KRH A;  4RS8 A;  3GO5 A;  1XGN A;  2K4J A;  2Y9Z A;  4OAY A;  3FXK A;  5HS7 A;  1L0O C;  3FK6 A;  1VI0 A;  4CCK A;  2JWT A;  3S1R J;  4M3D A;  1G2H A;  3KPH A;  3KYL A;  2UUZ A;  2OTL I;  4AU7 A;  4D9J A;  3CDI A;  3L7W A;  5DD8 A;  4GGG A;  5LEJ A;  3B73 A;  3H9G A;  2QZ8 A;  2ME6 A;  5CPR B;  4XQF A;  1FJL A;  2VUM J;  4UV9 A;  3FKI J;  3GFI A;  3R61 A;  3OOU A;  2STT A;  1LVK A;  2QA4 I;  4IRH A;  1WJF A;  5FKK A;  2ZC2 A;  1T39 A;  5H6R A;  1IUF A;  2IXS A;  3MAJ A;  1MZB A;  1A35 A;  2FE3 A;  2HOS A;  4JP0 A;  4G12 A;  1WJ5 A;  2B0L A;  3DTI A;  3I53 A;  4R8H A;  4LLN A;  4S05 A;  3HJE A;  3D1N I;  1W7P D;  1Y1V J;  2H8R A;  1HW2 A;  3KET A;  4M3B A;  2XDV A;  3S8P A;  1V4R A;  3HRS A;  2VBY A;  3OYA A;  2QLZ A;  1VQ5 I;  3M8F A;  4FCY A;  1UG2 A;  4GFB A;  2L02 A;  3BCB A;  3B02 A;  4N9I A;  4MLO A;  3ZQ7 A;  3G3Z A;  4AIJ A;  2DOA A;  4PFO A;  4V2F A;  1D1C A;  5D8L B;  1WVR A;  3I4N J;  2EZK A;  5CVV A;  4M73 A;  1YE9 A;  3F72 A;  4ZYA A;  4G7H F;  5TGT A;  3G1O A;  4E6K G;  1TQP A;  2DOF A;  1VQK I;  4ESB A;  2GXG A;  1X2N A;  4MO7 A;  1EF4 A;  2FBI A;  2CO5 A;  2NXN B;  4LLG F;  2LSO A;  2M0C A;  4MFE A;  2Y9Y A;  2EFP A;  2LKX A;  2E2I J;  2R5Z A;  4CSW A;  2WAQ A;  1MBF A;  5JLW A;  2ZJQ F;  5CYV A;  5FFX A;  3HL2 A;  4I76 A;  1S9H A;  1XD7 A;  4CCO A;  4OIO F;  3SFI A;  4DYR A;  4YG2 F;  1YW9 A;  2EPF A;  3QOD A;  4U0Y A;  1LVA A;  1U0J A;  2X1D A;  3CTA A;  5KK1 A;  4AVZ A;  4CYC B;  2X6X A;  3SZG A;  1ZGW A;  3FDY A;  3QWL A;  4A93 J;  2JPC A;  1QPM A;  3HKZ N;  1EV7 A;  5IYC J;  2HS5 A;  2ELJ A;  5GP9 A;  4L5E A;  1R7J A;  1BOA A;  4YIF A;  2L7F P;  4Q48 A;  1A6Q A;  3ABT A;  1HKT A;  1IRF A;  2HQN A;  2K7L A;  2DMU A;  3M07 A;  4IHT A;  2VPL A;  5HDN A;  1J7K A;  2DQL A;  5IYD J;  5K7H A;  2R7D A;  2V6C A;  4PCQ A;  2XKO A;  4BS9 A;  5C4J J;  2GM4 A;  3UKG A;  1Y6I A;  5GAE J;  1LUJ B;  4M6V A;  6PAX A;  1IG7 A;  1JUP A;  2DTR A;  4CZZ A;  5GPC A;  1J0R A;  2DDA A;  2O3F A;  2XIG A;  5D6F A;  3HOY J;  1UG0 A;  4I0A A;  3HEF A;  5LHH A;  1KON A;  3MKY B;  2WWY A;  2DFH A;  2VKV A;  3R0A A;  2PJR B;  4LJZ F;  2JUC A;  2P7V B;  3OV8 A;  3U1K A;  4ZTF A;  2HQ5 A;  1YYV A;  3RPU D;  4Y7N J;  2DOD A;  1ZG1 A;  1FIP A;  1MBH A;  5CQE A;  1OR7 A;  1WSU A;  2L9S A;  2ZJR F;  2DA2 A;  5FLX K;  2BOL A;  3BG5 A;  3BZK A;  1JE8 A;  2R0Q C;  4CCM A;  3AG3 H;  2M0M A;  2WA0 A;  2EB7 A;  3Q5F A;  4B48 A;  1G3Y A;  1TWA J;  2R3S A;  1MNM C;  4J00 A;  3S3O A;  4E7K A;  4U7B A;  4E7H A;  1A5J A;  5AIP A;  1WI9 A;  3M7G A;  1MMG A;  1BIB A;  3WE2 A;  2Q2E B;  4M9X A;  1FNN A;  4FT8 A;  3L00 A;  2GA2 A;  1D5V A;  3GLL A;  4N9H A;  3ZMU A;  2PMU A;  3OS2 A;  1OMI A;  4N0B A;  4EJO A;  4PFP A;  1RIO H;  5EG0 B;  2G0E A;  2STW A;  1P6R A;  3IWF A;  1C0W A;  2OD5 A;  2Z99 A;  2DLL A;  1U5T C;  2P5V A;  3TDZ C;  2EBI A;  3LSG A;  3C2B A;  2NNN A;  4QWQ A;  3T0Y A;  3L2V A;  2YUS A;  4OMZ A;  5ILU A;  4PSX A;  3L2W A;  1T0F C;  2AQF A;  2MW8 A;  3GF2 A;  4RGX A;  2EA2 A;  1KQ0 A;  4Y17 A;  3H5A A;  2XRN A;  3OYK A;  1OLT A;  1MBJ A;  1WI3 A;  1DGW Y;  3VYT B;  4UUS B;  2CV1 A;  3KZI C;  4XNF A;  3E3V A;  5L3G A;  4MTD A;  2HPM A;  2KP6 A;  1VQM I;  1YJ9 I;  4LLL A;  2FNA A;  3JRD A;  4XK4 A;  2WAQ N;  1PJR A;  4QPO A;  3H3U A;  4BQA A;  1OKR A;  2VBX A;  2FML A;  3L2Q A;  4IEJ A;  3QYE A;  2XPV A;  3S14 J;  2W25 A;  2CQN A;  4B3X A;  1Z21 A;  2NOG A;  1KQ8 A;  4RGS A;  3F6O A;  2XUB A;  4BEH A;  3LAP A;  3DF8 A;  1HKS A;  1R58 A;  3IAM 2;  3T5X A;  3JR9 A;  2W82 A;  5J3L A;  3IH2 A;  3BRO A;  4F92 B;  3LL7 A;  1MW7 A;  4A2U A;  3FBI B;  2VOD A;  1BW6 A;  1DGR M;  5LRS A;  4NC8 A;  5JR3 A;  4JX5 A;  2VKD A;  4JOM A;  1AKH A;  3PNY A;  3F6V A;  3CMA I;  1YW7 A;  4HPQ A;  1F1Z A;  3IRR A;  2H09 A;  2NS7 A;  3CCS I;  1I6X A;  4MHG A;  2K86 A;  2RC4 A;  1P4X A;  4KDP A;  2IPQ X;  1Q1H A;  4P1W A;  4YFK F;  2YX4 A;  1N78 A;  1YJN I;  3CO7 C;  4M3E A;  2BE5 F;  2QUF A;  2EIK H;  2X51 A;  1H8A C;  1MSE C;  1X58 A;  1JKQ C;  1XG1 A;  2E7W A;  5IP9 J;  1FYL A;  3AL0 B;  1UJ8 A;  1RKT A;  2XC7 A;  1B8I B;  4Q4Z F;  1B72 A;  5ILS A;  3PQJ A;  1JTY A;  2BGC A;  2K9Q A;  2XGC A;  4OOI A;  3GZ5 A;  3BQY A;  1DP7 P;  4P96 A;  1FP1 D;  5DV5 A;  2CFX A;  5F64 A;  4AIH A;  3F8F A;  2DO7 A;  4AC0 A;  5M3M J;  4HDU A;  1TZL A;  2KIU A;  3LSJ A;  2EFW A;  2X6W A;  4CCJ A;  2E1M B;  4PZJ A;  2Q8K A;  4AID A;  3OYL A;  1XDU A;  3H35 A;  2Y31 A;  1U8R A;  1VZ0 A;  1OCP A;  3HSF A;  2LC2 A;  5FD6 A;  1ETO A;  3BTL A;  3MFK A;  3CCU I;  2K02 A;  4S0H B;  1QU3 A;  2E5Z A;  3WHB A;  1R23 A;  1TBX A;  4XN3 A;  1SAU A;  5BNG A;  1WFX A;  1BI0 A;  2HPI A;  5E3N A;  4U88 A;  2IRF G;  1BM9 A;  2LDU A;  2MAB A;  3T8R A;  3MKW B;  1DPU A;  2EV0 A;  3RKQ A;  3FXQ A;  4ITV A;  4M6Y A;  2CV0 A;  4B47 A;  1W7P A;  1Z67 A;  4IZZ A;  5E79 C;  4EEF G;  3R4K A;  3BG7 A;  3HIF A;  4KN7 X;  1XMK A;  1B9N A;  2ESH A;  4Y52 J;  4RB3 C;  1IXC A;  3CP8 A;  1S8N A;  1TW3 A;  2CU7 A;  4X1E A;  3BWG A;  5ERI A;  2DA3 A;  1Y1W J;  1IRX A;  4XL9 A;  3U21 A;  1ERD A;  4AUX A;  1MJA A;  1YHQ I;  3JRG A;  2JK3 A;  1RKW A;  4RDU A;  4I2O A;  5HNF A;  4A0Y A;  2MLK A;  3CF2 A;  3WTX C;  1ZKG A;  4JK1 X;  4ON0 A;  5TRD A;  2O9L A;  1YTY A;  3DTE A;  3X2Q H;  2YR2 A;  4A6D A;  2KPM A;  3GYH X;  3IWZ A;  4CDG A;  2MC4 A;  5IOY A;  3GFL A;  4RAZ A;  3IV5 A;  3HRM A;  4II3 A;  2CUJ A;  3E97 A;  4CXF A;  1WZ2 A;  3ZQQ A;  3L2U A;  2VQH A;  4XKW A;  4LFU A;  3WGG A;  3BR5 A;  5K7F A;  3ZN1 A;  3CUQ C;  5L3F A;  3PIP F;  5E1X A;  1PDN C;  3V42 A;  3BG9 A;  2ISY A;  3NWT A;  2L0K A;  4B1R A;  4G9Y A;  1J59 A;  4M9S A;  2DMQ A;  1ZRE A;  3DCF A;  1W0T A;  4EVI A;  4HBL A;  1NK2 P;  1ACI A;  5LGN A;  2OZU A;  1UEL B;  1ZTR A;  4L18 B;  1JHF A;  1IXS B;  5D5V B;  3Q0W A;  5EDN A;  1WGX A;  1WJE A;  2L3D A;  3LA3 A;  5IP6 A;  2HXO A;  1QZZ A;  2MD5 A;  4RB2 C;  3WG7 H;  4A3K J;  2IS2 A;  3Q3S A;  1D0Z A;  2EFO A;  3JW4 A;  4KIC A;  3HOS A;  1FOY A;  2A6E F;  2XKP A;  3KP3 A;  2YPR A;  4IVN A;  1Z0X A;  1YJW I;  1XMA A;  2LH9 A;  1A36 A;  4ZZL A;  3E7L A;  2XGX A;  2CJJ A;  2PN6 A;  2VBZ A;  1FY7 A;  3QP6 A;  5CQG A;  2E1N A;  1FLI A;  2EQR A;  1T6S A; 
#chains in the Genus database with same CATH homology
 2JZY A;  1R00 A;  5IT9 K;  2FU4 A;  4WXD A;  4YFX F;  1ON2 A;  3FWE A;  4LB6 B;  3IKV A;  4GYI A;  3JTG A;  1EH8 A;  1UHM A;  3ELK A;  3C18 A;  4HF1 A;  2FOK A;  4IF4 A;  4P5O A;  5H20 A;  3W6K B;  2ZKZ A;  3CLO A;  1QNT A;  2MLG A;  4RB0 A;  3WTV C;  3ZMS A;  5JHU A;  3U9G A;  3TDU C;  4Y13 A;  3EUH A;  2ZME A;  2JT1 A;  2E1C A;  4HX8 A;  3TO6 A;  2EV5 A;  1XB4 A;  1FX7 A;  3JTH A;  2KIF A;  2LF8 A;  2VT3 A;  2VT2 A;  2L01 A;  4KIF A;  2HYG D;  1SFU A;  4F7Z A;  1K7A A;  1MKM A;  3REO A;  3ZMT A;  1R5H A;  2BEO A;  3GLX A;  1AOY A;  5E8G A;  3RTR A;  2QEN A;  1KGS A;  2A69 F;  1FBS A;  2XAQ A;  2LKP A;  1U5T B;  2NS0 A;  2V1D A;  5HLG A;  1W5S A;  2VE9 A;  1ZRD A;  4JQF A;  3ERE D;  1P4W A;  3E5U A;  3E5Q A;  4XRF A;  1R1T A;  3K1P A;  3M1E A;  1K79 A;  3R0J A;  3DV8 A;  4MEX F;  1HW5 A;  3ECH A;  1TW2 A;  2A5Y B;  1ZLK A;  4G94 A;  4OIN F;  2Q2E A;  3RI4 A;  4ZH4 F;  1HKQ A;  2KKO A;  3J81 K;  2LNB A;  2X0L A;  2IA2 A;  4EM2 A;  4HZF A;  3VB2 A;  4EM1 A;  1ZLJ A;  3SXY A;  4ENK A;  5HDK A;  2Q0O A;  4H0E A;  3V7C A;  4A6E A;  2EV6 A;  3WTU C;  3MZH A;  3NEU A;  3V8K A;  3M8E A;  4P55 A;  4I0B A;  3U2R A;  5AON A;  4EM0 B;  3CDH A;  4JBA A;  3K0L A;  4XBF A;  2Y48 A;  1D8J A;  3D0S A;  3PQK A;  3ROU A;  4KIG A;  1IXR C;  1I1S A;  3KCC A;  2P6S A;  5BOX A;  4BHB A;  2D1H A;  1ZRC A;  4P9U A;  4A0X A;  1R1V A;  1E2X A;  1G3T A;  1LB2 A;  1ZG3 A;  2QWW A;  5L3D A;  2GZW A;  4I01 A;  4KT5 C;  4EJU A;  5HVQ C;  5BQT A;  5E20 A;  1ONV A;  2DT5 A;  3DP7 A;  4UVA A;  4ZYE A;  3EYI A;  3WTS C;  3J7A O;  4MNU A;  4UV8 A;  1ULY A;  2ETH A;  4AVP A;  1A04 A;  3EET A;  2CGP A;  1D8K A;  2HTJ A;  1W4M A;  2RNJ A;  4HW0 A;  3QOP A;  5CVJ A;  1FOK A;  2FA5 A;  4M71 A;  4AIK A;  1IAW A;  4L5J A;  1HQC A;  2CG4 A;  2EK5 A;  1ZGJ A;  5ICC A;  1S6L A;  2D1V A;  3LAJ A;  2O61 A;  1B6A A;  2BV6 A;  1HST A;  2ESN A;  1JGS A;  4WWC A;  3Q9V A;  1KU9 A;  3LWF A;  3KP7 A;  3HSE A;  2IJL A;  2AXL A;  3CUQ B;  1S3J A;  5LGT A;  1J9I A;  3LA7 A;  2HYF A;  1MDM B;  4A12 A;  2V79 A;  4FX4 A;  1U78 A;  4ESF A;  2IT0 A;  4CIC A;  3QRF F;  4Q5S F;  3AAF A;  4KYW A;  2XAF A;  3ISP A;  1Z6T A;  3IRQ A;  2RDP A;  5ICG A;  2HFH A;  3BP8 A;  3T1B A;  1ZGA A;  2YU3 A;  5DD4 A;  3JSP A;  1X3U A;  3MWM A;  1HSJ A;  1B4A A;  3JAM K;  5BPI A;  3P7N A;  1BBY A;  3DKW A;  4LD5 A;  3WTZ A;  1Z1D A;  4BH9 A;  5DDG A;  1LEA A;  2IA0 A;  3DEU A;  1WKM A;  3LA2 A;  1W5T A;  1XDS A;  1QGP A;  2IVM A;  3J80 Z;  3OOP A;  2J5O A;  2EJR A;  5DYM A;  4A5M A;  3KEO A;  1OPC A;  4G7O F;  4HX4 A;  4GO1 A;  1S29 A;  2Y75 A;  3F22 A;  1KQ9 A;  4TV7 A;  5J8F A;  2A68 F;  3F3X A;  5HS9 A;  3L09 A;  3HHG A;  2FSW A;  1T98 A;  1QZY A;  2VOO A;  4FX0 A;  3I58 A;  4HA8 A;  2Y0M A;  5LHG A;  4G6D A;  2CSO A;  4M6X A;  4OIQ F;  1S7A A;  3GVA A;  2HGC A;  2A07 F;  2PG4 A;  4CO8 A;  3KP4 A;  3QU3 A;  3F8C A;  4L9T A;  1SMY F;  3WTY C;  5J6X A;  5A2Q K;  3E6C C;  2H6C A;  2QQB A;  2H6B A;  1Z6R A;  4MTE A;  1Z7U A;  2UXX A;  4AD9 A;  2H27 A;  4CGZ A;  2DQR A;  1R1U A;  3KP6 A;  1K78 A;  2ZJ2 A;  3RYR A;  3RYP A;  3QU6 A;  3HOT A;  4ZYG A;  4QLC U;  2NRA C;  4KNY A;  3KEQ A;  2O6G E;  3K1M A;  1JHH A;  5L3B A;  1Y0U A;  3QP5 A;  5D4S A;  2OQR A;  2MC3 A;  1U5T A;  3RKY A;  4IXA A;  2PJP A;  3DPL C;  2DAO A;  1R22 A;  1O57 A;  2GA1 A;  3P9C A;  2XHK A;  2P4W A;  5LLQ A;  2YX7 A;  1AWC A;  3S2W A;  2HQR A;  3RPQ A;  4WF2 A;  1LQ1 A;  2PI0 A;  5E17 F;  3WU0 A;  4HV6 A;  2MH2 A;  5F1R A;  2F5D A;  5DUI A;  5E1Z B;  3H3Z A;  4HF2 A;  1J5Y A;  2G7H A;  4KFC A;  1P4A A;  3RDI A;  3D5L A;  3L9F A;  4M74 A;  1KA8 A;  2ZNY A;  2OZ6 A;  4LK1 F;  4O6J A;  3RJP A;  2OA4 A;  5KVR A;  3JSO A;  4EGY A;  1PP7 U;  2EA4 A;  1XGS A;  4U7D A;  1I5Z A;  2VON A;  1RUN A;  1FBQ A;  2OAZ A;  3ABU A;  4G8X A;  4KMU X;  3WGH A;  2TDX A;  3O2P E;  2Z3Y A;  5AIQ A;  5E1W A;  2G7U A;  2CWE A;  2J5P A;  1R5G A;  3BZ6 A;  1L3L A;  1FC3 A;  2KJB A;  4MGR A;  2QBY B;  3GW2 A;  2IW5 A;  1B59 A;  3WG9 A;  2XAH A;  5HOO A;  4HV5 A;  4CYD A;  5EEH A;  3GZ6 A;  2WTE A;  2PFB A;  1H9T A;  2Z5U A;  2F5C A;  5JI6 A;  3KZY A;  4L5I A;  4OU0 A;  4PGH A;  5LBQ A;  2EWN A;  4HLY A;  4EJW A;  4XLN F;  4ZYD A;  3GUD A;  1DPR A;  4GYG A;  2ZCW A;  3VOD A;  1CF7 B;  3COA C;  1K6O A;  1OYY A;  3ZPL A;  1IN6 A;  3WOD F;  4KUM A;  3N97 A;  1XSV A;  3FMS A;  3N4M A;  3FMQ A;  4G6Q A;  1UFM A;  1ODD A;  3EDP A;  1Z91 A;  3BPV A;  2GWR A;  1D3Y A;  4RGR A;  1IN4 A;  1F4K A;  1SD6 A;  2P6T A;  3GEZ A;  1FZP B;  1BC8 C;  3RKX A;  3FXR A;  1MD0 A;  1EH7 A;  1MDM A;  5ED4 A;  2FBK A;  3BJ6 A;  1YFH A;  2D2W A;  3QPH A;  2LF7 A;  2M1B A;  3HRT A;  5HLH A;  4WK8 F;  1FYM A;  2F5F A;  3F8M A;  1SD4 A;  5K5R A;  4IPA A;  4ASN A;  4EV0 A;  4Y15 A;  5DEQ A;  5DCM B;  2XVC A;  3HYI A;  4YFN F;  3LQQ A;  4HLX A;  1LEB A;  2F5E A;  1TNS A;  2JTV A;  1ZRF A;  5FLX Z;  4RGU A;  4OIP F;  4I7H A;  5LEK A;  2UZK A;  3C1D A;  4O3M A;  2M30 A;  4MQ9 F;  1RNL A;  1UB9 A;  4WCG A;  2QVO A;  2M45 A;  4LG0 B;  2VN2 A;  3SQN A;  2FNP A;  2AS5 F;  2HOE A;  1XGO A;  3BJA A;  2ZXJ A;  2ACJ A;  2QM3 A;  2ISZ A;  4ENN A;  2HKO A;  2DW4 A;  3FF5 A;  3KP5 A;  3T8T A;  3ZN0 A;  2HTS A;  3BY6 A;  2JSC A;  2M87 A;  3DXJ F;  3WE3 A;  2EFN A;  3I71 A;  1FPQ A;  3DFG A;  4NQW A;  1MGT A;  1G3W A;  1YIO A;  4ZZD A;  2Z33 A;  2V9V A;  1QBJ A;  1P2F A;  2NAZ A;  2VBW A;  2PBI A;  2MA3 A;  3F23 A;  1WWX A;  2MBF A;  5CJ9 A;  5CVR A;  2K27 A;  1IF1 A;  4U0W A;  4EMS A;  2HEO A;  4UVC A;  4R1H A;  3HUG A;  3IC7 A;  1ZAR A;  2RV8 A;  3WTW C;  5LRR A;  3LST A;  1IN8 A;  1IZ1 A;  1W7P B;  4M9Z A;  3BOQ A;  3TO7 A;  2DBB A;  2UWM A;  1S7O A;  4R79 A;  4RAY A;  1VTN C;  1IRG A;  5D4R A;  4HYE A;  1FWZ A;  1GHC A;  4KA4 A;  4XLP F;  1UHW A;  4KIB A;  4HQM A;  1O7L A;  4WXC A;  1FBU A;  4LGW A;  5EEG A;  3K69 A;  3GWZ A;  1G3S A;  2FBH A;  1NHA A;  3SZP A;  2JRT A;  1U6G A;  3DQV C;  2HWV A;  2XV4 S;  3F8B A;  5TJJ A;  2JPB A;  1R36 A;  2DK8 A;  4BNC A;  4NHJ A;  1BJA A;  3TQN A;  1KU2 A;  1U2W A;  2HKX A;  4ZYH A;  3LQR A;  3I4P A;  1H9G A;  3FM3 A;  5D6E A;  3NRV A;  3KE2 A;  3KFW X;  3MCZ A;  1IN5 A;  2OQG A;  1SAX A;  3VFZ A;  2ADU A;  1QO0 D;  5J8C A;  4HQE A;  4IRG A;  4OIR F;  1YS6 A;  5LGU A;  3E6D A;  3Q9S A;  1I1G A;  2FF4 A;  4M72 A;  3R60 A;  2WC2 A;  4RB1 A;  2E7X A;  1T2K A;  2RN7 A;  4GXO A;  4L9J A;  5HDG A;  3V7S A;  1F5T A;  3WU1 B;  4IRI A;  1UCR A;  3RKW A;  5ICE A;  2W85 A;  2OU2 A;  4LB5 A;  3HTU A;  4AWX B;  2L54 A;  1UST A;  2ZME B;  4MEY F;  5BPD A;  1GXP A;  4KN4 X;  2XRO A;  1BI1 A;  4HAM A;  3TO9 A;  2QQA A;  4IJA A;  1O7F A;  2QBY A;  3P9I A;  2W84 A;  3HTS B;  1LJ9 A;  4S04 A;  2P7C B;  2PMH A;  3VOE A;  4EJV A;  4ESJ A;  4L0Z B;  2DPU A;  4G7Z F;  2V1X A;  3IKT A;  3ZMD A;  3E6M A;  4BHP A;  5IT9 Z;  2FRH A;  1T38 A;  3I54 A;  4L9N A;  2G9W A;  2E1N A;  1F9N A;  1CF7 A;  4MQV A;  4LK0 F;  1SFE A;  3FM5 A;  5BMZ A;  2O8X A;  2H94 A;  2ELH A;  1WRJ A;  1V3F A;  2HR3 A;  4HOB A;  3CO6 C;  2ZBK A;  3NQO A;  4L0Y B;  1G4D A;  5D5W B;  3KLO A;  1JXS A;  3M9A A;  3KLN A;  4XSZ F;  2X4H A;  2P8T A;  1O3T A;  1HBX G;  5DUK A;  4BXU A;  5JVT A;  1FP2 A;  3PFI A;  3VEP A;  1YW8 A;  3K9T A;  4DQ2 A;  3C3W A;  3MQ0 A;  4I98 B;  1Z05 A;  4BYY A;  3F21 A;  2O0Y A;  3DPT A;  3K2Z A;  4B8X A;  1YG2 A;  3V4G A;  4PDK A;  2R7F A;  2BYV E;  2W24 A;  1BI3 A;  2L4M A;  5DCM A;  3I59 B;  1USS A;  5D5X B;  1U3E M;  3TOA A;  2FXA A;  3FX3 A;  1HXD A;  3E5X A;  3BPX A;  1XCB A;  5FFZ A;  2A6H F;  2KRF A;  2IP2 A;  3EQL F;  2A3S A;  4IHS A;  3QPT A;  2DPD A;  1FSE A;  1DDN A;  1ON1 A;  2OBP A;  2DI3 A;  5H6Q A;  2FMY A;  5BS6 A;  2K4B A;  2FQ3 A;  2VXZ A;  3WTT C;  1ZHF A;  2PLY A;  3SZT A;  1T0F A;  4LG0 A;  4K2E A;  1SMT A;  3R6S A;  2PEX A;  5HS8 A;  2VOP A;  1YLF A;  1RI7 A;  3J81 Z;  4UVB A;  4O5V A;  1LDK B;  4EQQ A;  3CUO A;  4HF0 A;  4UHT A;  2HZT A;  2QYO A;  5CVU A;  3C7J A;  3KP2 A;  4WX9 A;  1XSX A;  5DCF A;  2RQP A;  2VC0 A;  3FXU A;  2D45 A;  1XCV A;  1B9M A;  3HRU A;  3K1N A;  5FB2 A;  2YSR A;  2RGV A;  4PGG A;  2DK5 A;  5CLS A;  5K1Y A;  1TQM A;  3QAH A;  5CVI A;  3ECO A;  1P92 A;  5LHI A;  2Z9O A;  3GXO A;  1KU3 A;  2IA1 A;  4HDV A;  2CYY A;  1MJB A;  3FHZ A;  2WV0 A;  1RUO A;  1XN7 A;  3TOB A;  1TNT A;  3LFK A;  3WGI A;  2GXB A;  3O6B B;  4FHT A;  3HSR A;  4E70 A;  1ZN2 A;  5FD5 A;  4UXN A;  1PP8 F;  3G73 A;  3ZP5 A;  1ZH5 A;  1STZ A;  3TKY A;  4DNC A;  4ENM A;  2M8E A;  5FGM A;  2GIV A;  1HW1 A;  4YII A;  5E18 F;  1OYI A;  1KU7 A;  1BIA A;  4ENJ A;  1DUX C;  1I27 A;  5L3C A;  4EGZ A;  3GFM A;  1ZAO A;  3ZMZ A;  2GAU A;  3TGN A;  2XAJ A;  4XSX F;  2A61 A;  4NB5 A;  3GX4 X;  3V8L A;  3P9K A;  2UXN A;  4L9V A;  2W57 A;  4KMF A;  3SFZ A;  3J80 K;  4BAY A;  1LDD A;  3FMR A;  1Z9C A;  2P5K A;  1XSD A;  2P5L C;  1FT9 A;  1J75 A;  1CGP A;  1FSH A;  3CJN A;  4UNO A;  1GVJ A;  2M5W A;  3SHF A;  2VE8 A;  1KYW A;  3CUQ A;  3RPU A;  1ZYR F;  2PQ8 A;  5ICF A;  3IL2 A;  4CHU A;  2CW0 F;  3GFJ A;  3KZZ A;  1FYK A;  2L4A A;  3I64 A;  1OYW A;  1PUE E;  3ULQ B;  3ML6 A;  1GXQ A;  3BJO A;  2DFI A;  2XAS A;  2RVC A;  4Z2Y A;  3JAM Z;  5L3E A;  2XAG A;  1E17 A;  5D5U B;  4BHC A;  1IW7 F;  3I0T A;  4WXH A;  3FZV A;  1EH6 A;  1O3S A;  3MEX A;  4I02 A;  4D0P A;  2VC1 A;  3HHH A;  4LMY A;  3EYY A;  3V7R A;  1QQI A;  2NNY A;  2KIM A;  2EFQ A;  4HX7 A;  1K78 B;  1TTY A;  3RIR A;  1MJ9 A;  5FO5 A;  1O3R A;  5K5O A;  2KJC A;  4GCV A;  3ZMV A;  1RZ4 A;  1ZG5 A;  1WQ2 A;  1SD7 A;  1BI2 A;  1SD5 A;  2V1U A;  2CQK A;  5HLI A;  2COM A;  5K5Q A;  5ILV A;  4Q47 A;  1XGM A;  2DU9 A;  5F6F A;  1YQA A;  1SFX A;  2GQQ A;  2RKH A;  2MH9 A;  1IN7 A;  1YO5 C;  2BBY A;  1G6N A;  3H92 A;  1LDJ A;  5JFR A;  1BC7 C;  1BN5 A;  1J2X A;  2FEZ A;  1IUY A;  2QQ9 A;  4U0V A;  3F8N A;  3E6B A;  2NYX A;  3O3K A;  1B1B A;  5A2Q Z;  1LNW A;  3L2C A;  2ZFW A;  2ZNZ A;  2F2E A;  3MZY A;  4ETS A;  4EJT A;  5E8I A;  2HDC A;  4I09 A;  3U1D A;  3W6J B;  3IHU A;  5IT3 A;  1H0M A;  4P9F A;  3BDD A;  2ZO4 A;  5D8K B;  4A5N A;  1TLH B;  4A0Z A;  3I59 A;  4OMY A;  4UUV A;  1O3Q A;  4B09 A;  2C6Y A;  1KYZ A;  2O03 A;  1TQI A;  1REP C;  1YS7 A;  3V8J A;  3I5U A;  4RS8 A;  3GO5 A;  1XGN A;  2K4J A;  5HS7 A;  1L0O C;  3L7W A;  5DD8 A;  4GGG A;  5LEJ A;  3B73 A;  2QZ8 A;  4UV9 A;  3GFI A;  3R61 A;  2STT A;  4IRH A;  1T39 A;  5H6R A;  3MAJ A;  1MZB A;  2FE3 A;  2B0L A;  3I53 A;  4R8H A;  4LLN A;  4S05 A;  1W7P D;  1HW2 A;  3KET A;  1V4R A;  3HRS A;  2VBY A;  2QLZ A;  3M8F A;  2L02 A;  3B02 A;  4N9I A;  3ZQ7 A;  4AIJ A;  5D8L B;  5CVV A;  4M73 A;  3F72 A;  4G7H F;  1TQP A;  4ESB A;  2GXG A;  2FBI A;  2CO5 A;  4LLG F;  2LSO A;  2EFP A;  5CYV A;  5FFX A;  1XD7 A;  4OIO F;  4YG2 F;  1YW9 A;  4U0Y A;  1LVA A;  3CTA A;  5KK1 A;  2JPC A;  1QPM A;  1EV7 A;  2HS5 A;  1R7J A;  1BOA A;  4YIF A;  4Q48 A;  3ABT A;  1HKT A;  1IRF A;  2HQN A;  2K7L A;  4IHT A;  5HDN A;  1J7K A;  2DQL A;  2R7D A;  2V6C A;  4PCQ A;  2XKO A;  6PAX A;  2DTR A;  4CZZ A;  1J0R A;  2XIG A;  2O3F A;  5D6F A;  4I0A A;  5LHH A;  2WWY A;  3R0A A;  4LJZ F;  2P7V B;  3OV8 A;  1YYV A;  1ZG1 A;  1WSU A;  1OR7 A;  5FLX K;  1JE8 A;  2EB7 A;  3Q5F A;  1G3Y A;  2R3S A;  4U7B A;  5AIP A;  1WI9 A;  3M7G A;  1BIB A;  3WE2 A;  4M9X A;  1FNN A;  4FT8 A;  3L00 A;  2GA2 A;  1D5V A;  4N9H A;  3ZMU A;  2PMU A;  1OMI A;  4N0B A;  4EJO A;  1RIO H;  2STW A;  1P6R A;  3IWF A;  1C0W A;  2OD5 A;  2Z99 A;  2DLL A;  1U5T C;  2P5V A;  3TDZ C;  2NNN A;  4QWQ A;  3T0Y A;  4OMZ A;  5ILU A;  3GF2 A;  4RGX A;  2EA2 A;  1KQ0 A;  4Y17 A;  2XRN A;  3E3V A;  5L3G A;  4MTD A;  4LLL A;  2FNA A;  3H3U A;  4BQA A;  1OKR A;  2VBX A;  2FML A;  2W25 A;  1KQ8 A;  4RGS A;  3F6O A;  2XUB A;  3LAP A;  3DF8 A;  1HKS A;  1R58 A;  3T5X A;  3BRO A;  4A2U A;  2VOD A;  5LRS A;  5JR3 A;  3F6V A;  1YW7 A;  1F1Z A;  3IRR A;  2H09 A;  1I6X A;  4MHG A;  2K86 A;  2RC4 A;  1P4X A;  4KDP A;  2IPQ X;  1Q1H A;  4YFK F;  2YX4 A;  3CO7 C;  2BE5 F;  2QUF A;  2E7W A;  1FYL A;  4Q4Z F;  5ILS A;  3PQJ A;  2BGC A;  4OOI A;  3GZ5 A;  1DP7 P;  4P96 A;  1FP1 D;  5DV5 A;  2CFX A;  5F64 A;  4AIH A;  3F8F A;  2DO7 A;  4HDU A;  2KIU A;  2EFW A;  4PZJ A;  2Q8K A;  1XDU A;  1U8R A;  3HSF A;  5FD6 A;  3MFK A;  2K02 A;  1R23 A;  1TBX A;  1BI0 A;  4U88 A;  2IRF G;  1BM9 A;  2LDU A;  3T8R A;  1DPU A;  2EV0 A;  3FXQ A;  4M6Y A;  1W7P A;  3R4K A;  3HIF A;  4KN7 X;  1XMK A;  1B9N A;  2ESH A;  4RB3 C;  1IXC A;  1S8N A;  1TW3 A;  3BWG A;  5ERI A;  1MJA A;  4I2O A;  4A0Y A;  2MLK A;  3WTX C;  4JK1 X;  4ON0 A;  5TRD A;  1YTY A;  2YR2 A;  4A6D A;  3GYH X;  3IWZ A;  4CDG A;  3GFL A;  4RAZ A;  3HRM A;  4CXF A;  3E97 A;  4LFU A;  3WGG A;  3ZN1 A;  3CUQ C;  5L3F A;  5E1X A;  1PDN C;  2ISY A;  4G9Y A;  1J59 A;  4M9S A;  1ZRE A;  4EVI A;  4HBL A;  5LGN A;  2OZU A;  4L18 B;  1JHF A;  1IXS B;  5D5V B;  3LA3 A;  2L3D A;  2MD5 A;  1QZZ A;  4RB2 C;  3JW4 A;  2EFO A;  4KIC A;  3HOS A;  2A6E F;  2XKP A;  3KP3 A;  2YPR A;  4IVN A;  1XMA A;  4ZZL A;  2XGX A;  2PN6 A;  2VBZ A;  1FY7 A;  3QP6 A;  3G3Z A;  1FLI A;  1T6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...