4FX0A

Crystal structure of m. tuberculosis transcriptional regulator mosr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
122
Chain Sequence
AFDECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLTMSELAARIGVERTTLTRNLEVMRRDGLVRIELTAKGRAALQKAVPLWRGVQAEVTASVGDWPRVRRDIANLGQAAEAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords PROBABLE TRANSCRIPTIONAL REPRESSOR PROTEIN
publication title The Oxidation-sensing Regulator (MosR) Is a New Redox-dependent Transcription Factor in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 45
structure length 122
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4fx0A00
2NRAC 2VOPA 1U78A 2V1DA 3LA2A 4EGZA 1K78A 4PCQA 4KFCA 1FY7A 3KZYA 2MH2A 4G7OF 3K1MA 1ZREA 3COAC 2FSWA 4UVBA 2FF4A 3GEZA 2COMA 1YO5C 1B4AA 3RIRA 3TKYA 5BMZA 2A07F 4CO8A 2HTSA 4R79A 2Z33A 1QPMA 3RJPA 3RKWA 4KMFA 1MZBA 3F23A 2Z9OA 2QZ8A 2P5LC 3R0AA 3RPQA 3ZQ7A 2VT3A 1Z91A 4GCVA 3T8TA 1BC8C 3JAMK 3TDUC 1LQ1A 1RI7A 1JGSA 4GXOA 3BJAA 4M74A 2XAGA 5JI6A 3EDPA 2D1VA 4KN4X 1EH8A 3VODA 5F1RA 2O61A 1IUYA 2ZMEB 2ZNZA 4IJAA 1XSDA 2RV8A 1F4KA 1X3UA 3QRFF 1KQ8A 5DUIA 2V1UA 4HAMA 4PDKA 3F6OA 5D5WB 3HTSB 1HW1A 3GFMA 2EFNA 2DU9A 2OAZA 1QO0D 5E8GA 4HA8A 4AIHA 3NEUA 5E1ZB 1ZRDA 4MGRA 4P96A 5DCMB 4RB2C 1BBYA 3LSTA 1U6GA 1IRGA 3EETA 5EEHA 3CO7C 4KA4A 3LQQA 5HOOA 4WX9A 1D8KA 1OPCA 1YW9A 1TNTA 3TO7A 4KIGA 1SFEA 4I2OA 4CGZA 4LB5A 2IW5A 1R5HA 3SZTA 2MA3A 3R61A 4R1HA 5CVIA 3HRUA 3Q5FA 4FX4A 1GHCA 1P4AA 1J59A 5L3EA 3V8KA 2G7HA 1E2XA 1ZLJA 3E3VA 3E6CC 4U0VA 1SD6A 4OIPF 1IW7F 1IZ1A 1P92A 3PQJA 2P7VB 4MEYF 2MBFA 3KETA 1O57A 4GYGA 4IRIA 1ZGJA 4ENMA 4XBFA 1OYWA 4HOBA 1XSXA 4HF0A 2FU4A 2OBPA 2M30A 3ZMSA 2DQLA 4UVCA 2LSOA 4LJZF 2EA2A 3I5UA 5DV5A 1C0WA 2XIGA 3EYYA 4OIOF 3RYPA 3ML6A 1LB2A 4WXHA 4HQMA 1LNWA 4L0YB 3F8FA 2MC3A 2PLYA 3ERED 2O03A 2EJRA 4KMUX 2HFHA 3J81Z 3I4PA 3L7WA 1P4WA 4ESJA 4Q48A 2QWWA 5L3FA 1JHFA 4L9VA 3MZHA 1G3WA 1P4XA 2NNYA 1IXRC 4M73A 4U88A 2EFQA 4WWCA 1STZA 3QPHA 3E5UA 4Q47A 3R6SA 3RPUA 2BEOA 2LDUA 1S29A 1BI2A 3E97A 2ESNA 5J6XA 1O3TA 5LHIA 4L9NA 3FMRA 1R7JA 2QQBA 5CYVA 2EFWA 3VOEA 4E70A 2M5WA 1HXDA 1TNSA 4KICA 3BJOA 3V8JA 4ESBA 1T38A 1SFXA 1Z9CA 1ONVA 2H6BA 2ACJA 1R36A 4N9HA 3KEOA 1KU9A 4NQWA 1W5SA 4HZFA 1FT9A 3F21A 2IP2A 1KGSA 3ZMVA 1R00A 1B6AA 2CWEA 1AOYA 1T2KA 3I58A 2G9WA 3MFKA 5HS7A 1LDKB 1MJBA 3ZP5A 4M6YA 3VB2A 1LVAA 1QZZA 4MEXF 2FEZA 5LEKA 3ABTA 4N0BA 5FD6A 5ED4A 4ASNA 3CTAA 3CO6C 1QZYA 1DPRA 1YQAA 4I98B 4WXCA 4DQ2A 3GW2A 4EJOA 2HGCA 2L02A 4RGRA 4S05A 2G7UA 1YW8A 4WCGA 5E1WA 4Y15A 3WGHA 3HTUA 1G4DA 5D5VB 4IVNA 3K9TA 2KIUA 3C18A 4MQVA 1GXQA 2M1BA 5K5RA 5BS6A 3JAMZ 3ELKA 2R7DA 2E1NA 1GXPA 1YS7A 1YFHA 3T8RA 1MDMB 3O3KA 3L9FA 3BWGA 2H27A 1JXSA 1RIOH 1L0OC 2NAZA 2OU2A 3GLXA 4N9IA 5HLIA 2OD5A 1FNNA 3H3UA 2E7WA 1IN7A 3HYIA 3S2WA 4BHPA 2QVOA 2BBYA 3IKTA 4AIJA 2PBIA 3TOAA 2K02A 2Z99A 5E18F 3WU1B 3U2RA 3RTRA 5L3CA 5E8IA 3H3ZA 3MEXA 4HV6A 2H94A 1YS6A 2P4WA 1XMKA 2XASA 1R23A 2EV5A 4I0AA 4G6QA 3DQVC 2PJPA 3HRTA 3PQKA 2IT0A 3TO6A 1T6SA 1EH6A 1ZARA 1I27A 3I0TA 2PQ8A 2K86A 3B73A 2CQKA 4ZH4F 4HLXA 4LB6B 2DT5A 3QP6A 1IN4A 1QGPA 1FBSA 2DW4A 3P9KA 3I71A 1MDMA 4ZZLA 3P9IA 1RZ4A 6PAXA 4M9XA 2JZYA 3H92A 1K79A 2W25A 3IWZA 5ILVA 4A12A 2VBXA 4CDGA 1KQ9A 2HTJA 4R8HA 1ZHFA 5E20A 4L0ZB 5HS9A 1U2WA 1I1GA 2R3SA 2Y48A 1TW2A 1K78B 5FD5A 1W5TA 3OV8A 3HHHA 2WWYA 3SFZA 2JT1A 3RKXA 3BOQA 4LD5A 4EJVA 4ENJA 4HDUA 3ISPA 5K5QA 2EA4A 4U0WA 1IXSB 3GX4X 3PFIA 3KP2A 3HHGA 3KP5A 2DQRA 1KA8A 4M72A 3V4GA 1SMYF 1B1BA 1OYYA 3QAHA 3RI4A 2OQRA 3L00A 4BH9A 3E6DA 4AIKA 2DK5A 3HUGA 1W7PD 4BYYA 1BC7C 2MLGA 1BI3A 3V8LA 1FP1D 3CUQA 1Z6RA 1Z1DA 1I5ZA 1BM9A 3TO9A 4FX0A 5CVUA 3WG9A 5HLGA 2HZTA 2RVCA 3FWEA 3E5QA 1J2XA 3QU3A 3HIFA 4EJUA 3E6BA 5BPDA 3LA3A 1ZRCA 2YX4A 1FYLA 4NB5A 4UVAA 2X4HA 1O3QA 4XLPF 5DYMA 1TQMA 1D3YA 2KIFA 1TBXA 1USTA 2FNPA 1T39A 1R1VA 1REPC 1TW3A 3RYRA 1J5YA 1DUXC 3E6MA 3LAPA 1FOKA 4LFUA 1PP8F 4M71A 3F6VA 1FBQA 4A0XA 2VBYA 2UZKA 4A6DA 3M8FA 2VC0A 1UHMA 1AWCA 1ON1A 3HOSA 1F9NA 4UV9A 2EB7A 2E1CA 2D2WA 3W6KB 3IRRA 1A04A 2ISZA 1ZH5A 3DFGA 5CVJA 3I59A 1Z7UA 2FE3A 5DEQA 3WTYC 1XCBA 2FRHA 4UNOA 5L3GA 2ELHA 5LLQA 2WV0A 2UXNA 4BAYA 2J5OA 4A0ZA 1KQ0A 2H6CA 1FSHA 2C6YA 2L4AA 2NS0A 4KDPA 3GYHX 3FMSA 2DFIA 2GXBA 3ZN1A 2LF7A 3DKWA 1YYVA 4JBAA 1CF7A 2XAQA 2MLKA 1G3SA 1S3JA 5H20A 2X0LA 2FQ3A 1UFMA 4CHUA 1HKQA 1TLHB 5JFRA 3GFIA 4FHTA 2O0YA 5HLHA 3FM3A 3JTGA 3QU6A 2XRNA 5CVVA 3WTWC 3WTUC 4BXUA 2A6HF 4LK0F 1ULYA 5ILUA 2WTEA 3F22A 3DPTA 5DCFA 1RUNA 2OZUA 5FFXA 4I02A 2L4MA 2A3SA 4I0BA 3P9CA 3U1DA 2D45A 1U5TC 1HKTA 5HDKA 2VBWA 1U8RA 4QLCU 2A68F 2PMUA 3WU0A 2JSCA 3SXYA 4RAYA 2AS5F 1IN6A 4I09A 3WODF 2PG4A 4U7DA 3RDIA 1MD0A 5D4RA 4XRFA 1IAWA 2RDPA 3J80K 5DUKA 1K6OA 5DDGA 3JSPA 4EV0A 1FZPB 3R0JA 1CGPA 4P5OA 3K2ZA 2XGXA 3KE2A 1J9IA 2V1XA 2DO7A 3J7AO 2OZ6A 4AD9A 1XCVA 1IN5A 2V9VA 3F8BA 4KUMA 2EV0A 2ZJ2A 4RAZA 2YX7A 3MAJA 4PGGA 1I1SA 2BYVE 1T0FA 1G3TA 3QPTA 4GYIA 3GO5A 3DF8A 1R1UA 4YFKF 4G8XA 1SD5A 4EMSA 3M8EA 5FGMA 1OMIA 5K1YA 2QQAA 2FOKA 1H9TA 2F5DA 2PN6A 4NHJA 3IWFA 2XV4S 2HKXA 1MGTA 4YIFA 1B9MA 4A5MA 5ERIA 5E1XA 2GIVA 2DTRA 3OOPA 3KLNA 1ZGAA 1XGSA 5F6FA 4YFXF 3KP7A 3CLOA 5LRRA 5CJ9A 3E5XA 3IL2A 2VE9A 1J7KA 4IHTA 4YG2F 3M1EA 3FX3A 2VXZA 3KZZA 4OU0A 3IKVA 1IXCA 4RB1A 5E17F 1O7LA 2A6EF 4EM0B 2A61A 4L9JA 3LAJA 3FZVA 2GA1A 2NYXA 1ZRFA 5ICFA 4P55A 2M45A 1J0RA 4M9SA 1XGOA 4RGXA 1PP7U 1EH7A 2P6TA 5LGNA 5BOXA 2HDCA 2HYGD 1O3SA 2YSRA 2IRFG 3IC7A 1DP7P 1YTYA 2FNAA 2E7XA 4ZYHA 5K5OA 3G3ZA 4CICA 1DPUA 2Y0MA 3DP7A 4U7BA 3Q9SA 3MQ0A 3KFWX 5LHHA 1B9NA 3GFJA 2VN2A 5FLXZ 3REOA 1G3YA 2XHKA 4EM2A 2BGCA 3BPXA 4OIQF 1R1TA 2KIMA 2FBKA 3BJ6A 4B8XA 2PFBA 4OMYA 1TTYA 4O6JA 2Z3YA 2FBIA 1W7PA 1NHAA 3AAFA 2NNNA 4HQEA 3M7GA 4OMZA 5KK1A 1UB9A 4IF4A 2HR3A 3D5LA 3B02A 1ZG5A 1WSUA 2J5PA 3M9AA 2CG4A 2GZWA 4LK1F 2ZXJA 5J8CA 1K7AA 2VE8A 2ZFWA 3DV8A 4M9ZA 2YPRA 3BY6A 4GO1A 3CUQB 3T1BA 3MZYA 3ZMUA 3ZMTA 3GF2A 3FF5A 2STWA 4A2UA 1YLFA 2JTVA 5AONA 2ZNYA 1B59A 2A69F 3ECHA 3F3XA 2QM3A 3EUHA 4RB0A 3U9GA 1XGNA 3KP3A 4UV8A 4OOIA 2QENA 3ULQB 2DPUA 5AIQA 5D4SA 1F1ZA 4EM1A 4HF2A 2GAUA 1LEBA 3L2CA 2XKOA 1F5TA 4HV5A 1L3LA 1D5VA 2L54A 2UXXA 4Q4ZF 4K2EA 1QBJA 4MTDA 4EJTA 1J75A 3LWFA 1SD7A 4EVIA 3KP4A 1ZG3A 2MH9A 4L5JA 1D8JA 2XUBA 2LKPA 2Q2EA 5BPIA 2ETHA 1BJAA 4HYEA 3J80Z 1WWXA 3BP8A 4ON0A 4LMYA 2P6SA 2TDXA 3SHFA 3Q9VA 3ZMZA 3IRQA 3KP6A 4WXDA 3I59B 3QOPA 1P2FA 3WGGA 3ZPLA 2STTA 1SMTA 1E17A 3GZ5A 4M6XA 4DNCA 4G7ZF 1FP2A 1QQIA 1WKMA 2IPQX 3HRMA 1SD4A 1BI1A 1O7FA 3BROA 4O3MA 5IT9Z 1Y0UA 2JRTA 1FYMA 4ZYGA 2PMHA 5ICCA 2RC4A 5D8LB 4ENNA 1GVJA 1ZAOA 1CF7B 1HKSA 5AIPA 1EV7A 2KKOA 3JSOA 2OA4A 3K1PA 1OYIA 5HDGA 1T98A 2QUFA 1XDUA 2FA5A 5TRDA 4GGGA 4ZYDA 4Z2YA 1ODDA 2GWRA 2M87A 1V4RA 2HEOA 3HRSA 1UHWA 4G94A 3SQNA 5FLXK 1FPQA 4L18B 3LA7A 3FHZA 2FMYA 2HYFA 2KRFA 5LBQA 5FFZA 2Q0OA 2CGPA 1Z05A 1RNLA 1JE8A 5JHUA 4O5VA 3I53A 2ESHA 4LG0B 5ICEA 2RQPA 2CFXA 3MCZA 2RN7A 2IJLA 1W4MA 3WTXC 2O6GE 4MQ9F 4L9TA 4ZYEA 3FM5A 4I7HA 2ZCWA 3K69A 4YIIA 5LEJA 3HSRA 2K4BA 5FO5A 1QNTA 4IPAA 2D1HA 2QLZA 2ZBKA 4EJWA 2F5EA 2IA0A 3HSFA 3CUOA 3WTZA 3FXRA 4Y13A 4CXFA 2VC1A 3ABUA 4P9FA 3SZPA 5HS8A 4Q5SF 1KYZA 4D0PA 4U0YA 4UHTA 3N4MA 2DAOA 3IHUA 2ZMEA 2OQGA 2GXGA 2HQNA 5A2QZ 4EGYA 1R5GA 2IVMA 2K7LA 4LG0A 4KIBA 2XKPA 5H6QA 4IRHA 2VT2A 2DI3A 1MKMA 4ETSA 4JK1X 1ZG1A 1BOAA 4HW0A 5DCMA 2HS5A 3ZN0A 5CLSA 5F64A 2P7CB 2CSOA 1XN7A 3EYIA 4OIRF 2YR2A 4KYWA 2IA2A 3R4KA 4B09A 4ESFA 3BPVA 2HKOA 1LEAA 5D6FA 2PEXA 1ZYRF 5DD8A 1SFUA 4A5NA 3JW4A 1Z6TA 4WF2A 4LLNA 1OKRA 1UCRA 2PI0A 5H6RA 4XSXF 2LF8A 1TQIA 3C7JA 3CJNA 5ILSA 1BN5A 1LDJA 1HBXG 3O6BB 1S7AA 2VODA 3W6JB 2DK8A 1S6LA 2H09A 3GZ6A 1USSA 1S8NA 2W85A 1YW7A 4XSZF 5IT9K 2EFPA 2P5KA 3D0SA 2RGVA 5D6EA 2KJCA 4G7HF 2FMLA 4BHBA 1TQPA 4RB3C 2CO5A 2F5CA 5KVRA 3T0YA 1HSJA 5L3BA 5L3DA 3WTTC 2K27A 4L5IA 3TOBA 1R22A 3F8CA 5LGUA 4HX8A 3BZ6A 5FB2A 4HDVA 3HSEA 4HF1A 2QYOA 1WQ2A 4UUVA 1KU2A 2BV6A 3F72A 3EQLF 4IRGA 3KLOA 2CYYA 5JVTA 2QBYB 1MJAA 3C3WA 1XSVA 1S7OA 4RGSA 1XD7A 3VEPA 3ROUA 5LHGA 3DEUA 2M8EA 1KU3A 4PZJA 3F8NA 3DPLC 4CZZA 1U5TB 4KNYA 2AXLA 1KU7A 4ENKA 1ZLKA 2W57A 3NRVA 1HW5A 2FXAA 3GFLA 2L3DA 4F7ZA 3TDZC 3LFKA 4EQQA 3CUQC 4A6EA 2GA2A 5LGTA 1PUEE 4RGUA 1V3FA 2DLLA 2QQ9A 2WC2A 3KEQA 4HLYA 1OR7A 1W7PB 4HX7A 2ZKZA 2F2EA 3FXQA 1G6NA 2ADUA 1ON2A 5D8KB 5HVQC 4RS8A 4H0EA 2KJBA 3GXOA 2XAFA 2EWNA 3JTHA 4A0YA 3TGNA 1FX7A 4AVPA 2XVCA 3C1DA 4XLNF 3CDHA 5DD4A 3VFZA 1XDSA 1H0MA 2EK5A 2IA1A 1VTNC 4JQFA 2QBYA 3FXUA 1HSTA 1U3EM 2ISYA 4UXNA 2XAHA 2XROA 5IT3A 4HX4A 2O8XA 3V7SA 2JPCA 4LLGF 1PDNC 1Q1HA 1WRJA 2L01A 4AWXB 5HDNA 1XB4A 3V7RA 4KT5C 4I01A 1U5TA 1IRFA 4S04A 3WE2A 1KYWA 1LJ9A 3F8MA 5ICGA 4IHSA 2JPBA 3QP5A 5A2QK 5BQTA 2P5VA 4WK8F 2Y75A 3WTSC 2DPDA 3RKYA 2A5YB 4CYDA 3LQRA 1FWZA 3FMQA 2EFOA 3BDDA 2RKHA 1H9GA 3I64A 1FYKA 3WGIA 2F5FA 2GQQA 2EV6A 1HW2A 4MHGA 1RUOA 4OINF 4BQAA 1FBUA 2RNJA 1XMAA 1YIOA 2O3FA 4MTEA 4BNCA 4BHCA 3MWMA 4MNUA 3K1NA 2W24A 3T5XA 3R60A 3KCCA 1SAXA 4PGHA 2VONA 4HBLA 4IXAA 3DXJF 4P9UA 1MJ9A 3ZMDA 4LGWA 3G73A 3GUDA 4G6DA 4KIFA 4FT8A 2CW0F 2FBHA 1IN8A 1HQCA 1LDDA 3J81K 5D5XB 1FLIA 2HOEA 3O2PE 5D5UB 3P7NA 1P6RA 2V79A 5J8FA 5JR3A 4Y17A 2LNBA 2VBZA 5LRSA 5TJJA 1R58A 1BIAA 3I54A 4YFNF 1ZN2A 1DDNA 5EEGA 1BI0A 1FC3A 3HOTA 2V6CA 2DBBA 2HQRA 4LLLA 3N97A 2VOOA 5CVRA 2R7FA 3K0LA 2BE5F 2W84A 2ZO4A 1FSEA 4ZZDA 3GWZA 3WTVC 3V7CA 1WI9A 3L09A 1I6XA 1YG2A 2XAJA 2K4JA 1IF1A 4TV7A 2UWMA 2Z5UA 1XGMA 2HWVA 2MD5A 1JHHA 3GVAA 4KN7X 2P8TA 2YU3A 3ECOA 4QWQA 3WE3A 3NQOA 1O3RA 2B0LA 2Q8KA 3TQNA 4G9YA 1BIBA
chains in the Genus database with same CATH superfamily
4FASD 2NRAC 3QODA 4EEFG 2VOPA 1U78A 1N77A 2V1DA 3LA2A 3NWSA 4EGZA 3CP2A 2R4GA 2QQ8A 3IAM2 3K10A 1K78A 1IV8A 1MMGA 4A3LJ 4PCQA 4XKWA 3HZJA 3TMOA 3RCOA 2X6YA 4DBQA 2OTLI 4KFCA 1FY7A 2XF6A 2LVSA 2G0EA 3KZYA 4DYCA 2WAFA 2MH2A 1IO2A 5GP9A 3FXMA 4G7OF 3K1MA 3DKYA 1ZREA 3COAC 2FSWA 4UVBA 2FF4A 3GEZA 2COMA 3KPHA 1OCOH 1HDDC 3Q0UA 1YO5C 3OIQA 1DQUA 1B4AA 3RIRA 3TKYA 2BHYA 2KT0A 5BMZA 4DGWB 3S2HJ 1W0UA 1IUFA 4AM3A 2BY1A 2A07F 4IQJA 1WJAA 1U0JA 4CO8A 2HTSA 3DKXA 4R79A 2Z33A 1QPMA 1T0FC 3RJPA 1OLTA 3RKWA 4X6AJ 4KMFA 1MZBA 2XF5A 2XRLA 3F23A 2Z9OA 2QZ8A 2P5LC 3R0AA 3X2QH 3QPLA 3RPQA 2EH3A 4C2MJ 2W4SA 3JRAA 4GFBA 3ZQ7A 2VT3A 2KL4A 1Z91A 4GCVA 4NDLA 3QYBA 4YELA 3T8TA 2IS4A 2DA5A 1BC8C 3CMMA 3JAMK 3TDUC 3B6CA 1RI7A 1LQ1A 3EUAA 1JGSA 3DWLE 4DW6A 3A0HC 5E79C 4GXOA 3BJAA 4M74A 1HCRA 2XAGA 5JI6A 3EDPA 2D1VA 5EGOA 4KN4X 3K4CA 4AUXA 4FETA 1EH8A 4Y7NJ 3AL0C 2H8RA 3QWLA 4XLFA 3VODA 5F1RA 2O61A 1IUYA 3D5SC 2MW8A 1X2MA 2ZMEB 2ZNZA 3MN2A 4IJAA 2RV8A 3BG3A 2OUMA 1XSDA 1X3UA 1F4KA 3QRFF 3PO3J 1KQ8A 2DA6A 3DBLB 5DUIA 3Q0WA 2V1UA 4HAMA 4PDKA 3F6OA 5D5WB 3HTSB 1HW1A 3GFMA 2DU9A 2EFNA 2OAZA 5GAEJ 1JKPC 1QO0D 2DA3A 2K9QA 5E8GA 4BDYA 4DIQA 3OYDA 2H1LA 4HA8A 4AIHA 3I55I 1YX3A 1IV6A 3NEUA 5HNHA 5E1ZB 2R0QC 1ZRDA 5TISC 4MGRA 4P96A 5DCMB 2VI6A 4RB2C 5B3SH 2LBFB 3RZDJ 1BBYA 1R4NB 4JYKA 4ANJA 1ITYA 4BXFA 5KAFC 3LSTA 1U6GA 1T08B 2HNHA 1IRGA 3EETA 5EEHA 3CO7C 1I3AA 1VQNI 2QSGX 1QU3A 1P9QC 4KA4A 3LQQA 4LITA 5HOOA 1FOYA 1RKTA 4WX9A 1D8KA 1OPCA 1O4XA 1YW9A 1TNTA 3TO7A 4KIGA 2JA7J 1SFEA 1IRXA 3TL4X 1FMWA 4I2OA 2R7RA 1J09A 4CGZA 4LB5A 3LSPA 1RR8C 5CPRB 5B1AH 2IW5A 2WADA 4XN3A 3HOZJ 5E3OA 1R5HA 4PFOA 3TW7A 3SZTA 1BJZA 4E7KA 2MA3A 3R61A 3OYCA 3H35A 1T56A 2VPRA 2MD0A 3A01B 4R1HA 5CVIA 1GV5A 1U9OA 3HRUA 3CF5F 1OQYA 4HEA2 4I6ZA 3Q5FA 3PIOF 4FX4A 1GHCA 1P4AA 2F4MB 1V5GA 1J59A 2NOGA 3D5RC 2HVQA 2YUSA 5L3EA 3DEEA 3K4MA 3V8KA 2G7HA 2ZSIB 1E2XA 5F0FA 3MKWB 1ZLJA 1XG1A 3E3VA 4JX5A 2K3PA 3OYFA 2EZHA 3E6CC 3PIPF 3BR2A 1JTXA 3LSKA 4U0VA 3VYSB 4HRIA 3PM1A 1W0TA 1SD6A 2R7ZJ 5EZGA 4OIPF 1IW7F 1JI8A 1IZ1A 1NG7A 1P92A 3FDYA 1DGRM 1B72A 1HA8A 3PQJA 2P7VB 1LVKA 4MEYF 3K4JA 3LSMA 4UUTA 2MBFA 3CJRB 2I10A 4B43A 3KETA 1VQMI 3DBHB 1O57A 3GTLJ 1R6RA 4GYGA 4IRIA 1ZGJA 3ASNH 2X1CA 4ENMA 4ZTJA 4XBFA 4V19K 3H9QA 1OYWA 2K40A 5B66C 3OR2C 1XSXA 2VKEA 4HOBA 3BG6A 1UMQA 5GPAA 4HF0A 2FU4A 2OBPA 2M30A 3ZMSA 3S32A 4XRSA 1ORKA 2DQLA 4UVCA 2RREA 2LSOA 3VYUB 4LJZF 2EA2A 3I5UA 5DV5A 2W7NA 1C0WA 2XIGA 1LFUP 3EYYA 1SFOJ 4OIOF 3ASOH 2VQLA 3RYPA 2O9LA 3ML6A 1LB2A 4WXHA 4HQMA 1LNWA 2F4OB 3A01A 4L0YB 3DEWA 3F8FA 1WFXA 2MC3A 5M5WJ 1N75A 2PLYA 3ERED 2O03A 3H0DA 2EJRA 4KMUX 2HFHA 3J81Z 3I4PA 3L7WA 1P4WA 4ESJA 5C4JJ 4Q48A 2LY2A 2QWWA 5DTDA 3SFIA 5L3FA 5J40A 1JHFA 4L9VA 3OYKA 3MZHA 1A36A 1H8AC 1G3WA 3CESA 3ESWB 1P4XA 2JQ7A 4UB6C 1TZLA 2NNYA 1IXRC 4M73A 4H4KC 3MVPA 5E3MA 1DU6A 3CCQI 2JN6A 4U88A 3M8JA 2EFQA 5F1JA 4ZJZA 1YX5A 3U1KA 4WWCA 1STZA 2K9NA 2VQHA 1OJLA 3QPHA 1UG2A 3FXLA 3C2GA 4L5EA 4CCOA 1IC8A 1S9HA 1HF0A 3E5UA 4Q47A 3R6SA 3RPUA 3FK7A 4Y33A 2XAUA 2R7TA 2BEOA 3NWTA 2H1KA 2DJIA 3OR1C 2LDUA 2ZXWH 1S29A 2OC6A 2ZFUA 1BI2A 4B3AA 3E97A 2ESNA 3EUHC 5J6XA 1O3TA 2OPTA 5LHIA 4L9NA 5JLWA 3IH2A 3FMRA 1R7JA 2QQBA 1MBKA 1R9TJ 5CYVA 2EFWA 3L2UA 2ZSHB 4FE7A 3VOEA 5GAHJ 4IHXA 1JTYA 4E70A 2M5WA 1HXDA 2YU9J 1TNSA 4KICA 4B1RA 1A35A 4NC8A 2HPMA 2BOLA 1LFPA 3BJOA 3V8JA 4ESBA 4YRVA 1IGNA 1T38A 3CCSI 1BW6A 5KHDA 3A1YA 3VSKA 1I39A 1SFXA 2V9PA 1JGGA 1Y56A 1Z9CA 1JKRC 1ONVA 2H6BA 2EZKA 2HXIA 2ACJA 1R36A 4FQGA 4N9HA 3KEOA 1A6IA 1KU9A 2BVMA 4NQWA 4RMNA 1W5SA 4HZFA 1FT9A 3F21A 2CW7A 3CJTB 2NVTJ 2IP2A 1KGSA 2X6WA 3BTIA 3ZMVA 4BE0A 1R00A 1B6AA 1FIPA 2CWEA 2LY9A 1AOYA 4XKBA 3ZRGA 1T2KA 3LSRA 2HDDA 3I58A 2G9WA 3MFKA 1BOBA 2CW8A 5HS7A 1LDKB 2I8DA 4PJNA 1MJBA 1MBFA 4A3BJ 3H9JA 3ZP5A 4M6YA 2DOAA 3VB2A 1LVAA 1QZZA 2IS1A 4MEXF 2FEZA 5LEKA 3ABTA 4N0BA 5FD6A 4CYCB 1ZKGA 5ED4A 3ZR8X 2D5VA 4JP0A 1X1AA 3CTAA 4ASNA 3CO6C 3FXOA 3H5NA 5K7FA 1Z7LA 2E5NA 3OYEA 1QZYA 1DPRA 1YQAA 4I98B 4WXCA 4DQ2A 4XOPA 1SEUA 2GBYA 3GW2A 4EJOA 2ZJQF 1A6QA 1D1BA 2HGCA 3WHBA 2L02A 4RGRA 1JUPA 3UKGA 4NNJA 2NVQJ 3PUFA 4AVZA 4S05A 2G7UA 2KHMA 2JUGA 2H8WA 2Z1DA 1YW8A 2M2EA 4WCGA 5E1WA 3I3LA 1VZ0A 4Y15A 1WI3A 4Y4RA 5CQEA 3WGHA 4J00A 3HTUA 1G4DA 4B48A 5D5VB 4IVNA 1YIJI 1YJNI 3K9TA 1K4SA 2KIUA 3C18A 2IXSA 2ELKA 4MQVA 3CDIA 4XR6A 1GXQA 2M1BA 2XF7A 3ZOBA 4DZJA 2R7XA 5K5RA 5BS6A 2VUMJ 3N05A 3JAMZ 3ELKA 2R7DA 1ZQ3P 3I4NJ 2E1NA 1GXPA 1YS7A 1N25A 3T8RA 1YFHA 1MDMB 3OWTA 3O3KA 1TWAJ 3L9FA 3BWGA 1Z21A 2H27A 1JXSA 5H2FC 1RIOH 1L0OC 2NAZA 2OU2A 2L7MP 3GLXA 1YRNB 4N9IA 5HLIA 2OD5A 3BZKA 1FNNA 3H3UA 3MKYB 2E7WA 1A5JA 1IN7A 4PSWA 3HYIA 3S2WA 4BHPA 2L9NA 2QVOA 2BBYA 1HOMA 3A2KA 3IKTA 2R7UA 3GTJJ 4AIJA 2DMUA 1WJFA 2PBIA 3CCRI 3TOAA 2K02A 2CH0A 2Z99A 4BJ5C 5E18F 3WU1B 1PUFB 2GIZA 3U2RA 3RTRA 2ZB9A 5E8IA 3H3ZA 5L3CA 3MEXA 2VKHA 4UY8I 1VQ7I 2M8GX 4AU7A 4HV6A 2H94A 1YS6A 2P4WA 1XMKA 3BTLA 3FIWA 2XASA 3DTKA 4DYRA 1R23A 2EV5A 3CP8A 4CCMA 1W1WE 4I0AA 3BLYA 4G6QA 3DQVC 2PJPA 3HRTA 3PQKA 2IT0A 3TO6A 1T6SA 1EH6A 1ZARA 1I27A 3S1RJ 2DFHA 3I0TA 2PQ8A 2K86A 3B73A 5IOYA 4UUSB 2CQKA 1HC8A 3HBLA 3PNYA 4ZH4F 5F0HA 2L7FP 4FE4A 4HLXA 1D1AA 3MMYB 5IYBJ 2Y30A 5DM6F 1TC3C 2UV1A 4LB6B 2ELJA 4Y52J 5FKOA 2DT5A 1X3WB 1X4PA 3QP6A 4RM2A 5C44J 1IN4A 1QGPA 2DJNA 4A69C 4J19A 1FBSA 5IYDJ 2DW4A 3J7AY 2ECCA 3P9KA 3I71A 1MDMA 4ZZLA 4D7NA 3JRFA 1WVRA 3P9IA 3HUGB 1RZ4A 1IJWC 4M9XA 6PAXA 2JZYA 3H92A 4CCJA 4DOZA 1WZ2A 1X1PA 2KRCA 5J3LA 4LOCA 1K79A 2W25A 2CQQA 3GBGA 1S5LC 2F5VA 1IG7A 2HPIA 2DMTA 3ZQGA 3IWZA 1OCRH 5ILVA 2KZVA 5EG0B 3S15J 4B47A 4A12A 2VBXA 2HXOA 4QPQA 2Y9ZA 4CDGA 1KQ9A 2A5WA 2HTJA 2QA4I 3HPHA 1JKOC 4XLCA 3CJQB 1G2HA 4R8HA 1ZHFA 5E20A 4JX4A 4L0ZB 5HS9A 1U2WA 1I1GA 2R3SA 4IX7A 3M1CA 2Y48A 1TW2A 5B1BH 1K78B 1E3PA 4MLOA 2EPFA 2E36A 4KT6A 5FD5A 1W5TA 3OV8A 1FEXA 1X1DA 3HHHA 2OCCH 2QEXI 2WA0A 3LMMA 2WWYA 3SFZA 2JT1A 3RKXA 3BOQA 1GUUA 4LD5A 4EJVA 3JRIA 3CQZJ 4ENJA 2Z2SB 3HOWJ 4HDUA 4BY1J 3ISPA 5K5QA 2BW3B 2EA4A 1YJ9I 4BDZA 3NAUA 4U0WA 3S2DJ 2Y9YA 3ABMH 3FKJA 1IXSB 3GX4X 3PFIA 3KP2A 2NVYJ 3HHGA 3KP5A 3ZCOA 3PSIA 1K61A 2DQRA 1KA8A 4M72A 3V4GA 1SMYF 1B1BA 1OYYA 3QAHA 3RI4A 2OQRA 1WCMJ 2OCEA 3L00A 4BH9A 4HPQA 3E6DA 4AIKA 3L2QA 1VQ9I 3BTCA 3GMEA 2CFOA 3ABLH 2DK5A 3HUGA 1W7PD 4BYYA 4A93J 2VLAA 1BC7C 2MLGA 1BI3A 4XLAA 3V8LA 2JRMA 1FP1D 3CUQA 3S1MJ 1Z6RA 2LY1A 1Z1DA 4KJZA 1I5ZA 1BM9A 3TO9A 3D1NI 1LUJB 2F6CA 2P0WA 4FX0A 2CV1A 5CVUA 3WG9A 5FRNA 5HLGA 2HZTA 2RVCA 5EGOB 1X4OA 3FWEA 3E5QA 5EG0A 2CQNA 1J2XA 3QU3A 3KIOA 2LKXA 2FUG2 3HIFA 3S3OA 4EJUA 3E6BA 5BPDA 3LA3A 2HQ5A 1ZRCA 3ZXSA 2BHZA 1GVDA 2YX4A 2ME6A 1FYLA 4NB5A 4UVAA 3K6GA 2X4HA 4ZDPA 2O8KA 1O3QA 1ACIA 4XLPF 5DYMA 3OS1A 2DMNA 1TQMA 1D3YA 3CCYA 3CZ6A 2KIFA 1TBXA 4XRSG 2DOFA 2GLOA 4LIVA 3AG3H 1USTA 4C9YA 2FNPA 4BACA 2BW3A 1R1VA 2VJ4A 1T39A 2X1DA 1TW3A 3HKZN 3RYRA 1J5YA 1REPC 1ENHA 2Q1ZB 2TRTA 1DUXC 4A3MJ 3G2BA 3E6MA 4XN0A 3LAPA 4F91B 3HGYA 2X6OA 1FOKA 1AKHB 4LFUA 1PP8F 2E34A 3I4MJ 3V42A 4M71A 3F6VA 1FBQA 2O7OA 4M3EA 4A0XA 2VBYA 2K5CA 2UZKA 2ID6A 3AG4H 4A6DA 3M8FA 2VC0A 1UHMA 5IP9J 1AWCA 1FIAA 1PYVA 2LR8A 3S93A 1ON1A 3HOSA 1VQOI 2XPUA 1F9NA 4UV9A 2EB7A 2E1CA 1WH5A 2D2WA 3W6KB 2EILH 2IAIA 2JSPA 3IRRA 2JWTA 5K7ZA 4AYBN 1A04A 2ISZA 5DM7F 2MFZA 3ZQFA 1ZH5A 1I6HJ 3DFGA 4XKCA 4A3CJ 4BY7J 2Z16A 5J4VA 5CVJA 2QKMB 4MFEA 1JKQC 4F52A 1UELB 1EJ9A 1VQLI 4PFPA 3E1SA 4X1EA 4IZZA 3OYMA 1X3ZB 2MABA 3I59A 3TBIA 2VJJA 2JA6J 3GTQJ 5J4YA 1G8XA 2A6TA 3JRDA 1Z7UA 2FX0A 2FE3A 3AFHA 4BJTA 5DEQA 4PUSA 3WTYC 3OYGA 1XCBA 2FRHA 1YI2I 4UNOA 5L3GA 3PO2J 3VSLA 3QYEA 2ELHA 1DP3A 2E1MC 2NVUB 4A3EJ 1JUMA 5LLQA 2WV0A 2UXNA 3O8GA 2YS9A 4BAYA 2J5OA 4A0ZA 1JUSA 2OF7A 3BQYA 1B72B 4HNUA 2CS3A 4QIWN 1KQ0A 4MO7A 2H6CA 3BR1A 1ZR2A 2DA1A 2C6YA 1FSHA 2L4AA 2NS0A 4KDPA 5JHFA 3GYHX 1AKHA 3DTIA 1QPIA 3FMSA 2DFIA 2GXBA 4IO9F 3ZN1A 3K4NA 2XB0X 2LF7A 1BR4A 4MFDA 3DKWA 4P1WA 4BKXA 3S1NJ 1YYVA 4JBAA 2K9LA 3DCFA 2JA5J 1FOWA 1OCZH 1CF7A 1ETXA 4GDFA 2M3AA 2XAQA 2MLKA 3KYLA 1G3SA 1AA7A 1S3JA 2VQGA 5H20A 2AQEA 2KDOA 2PJRA 2X0LA 2FQ3A 1UFMA 3MKZA 1OR7C 1Y39A 4IHWA 4M3BA 2HOSA 4OAYA 1HKQA 4CHUA 1W36D 2W48A 1Y6IA 1TLHB 5JFRA 3GFIA 4FHTA 1Z77A 2O0YA 3DU6A 3CCLI 5HLHA 2VB6A 4B3XA 3FM3A 3JTGA 2HYJA 3CF2A 3QU6A 1W5CC 2XRNA 4RAFA 3LOCA 5CVVA 1D0XA 3WTWC 3WTUC 4BXUA 2A6HF 1I50J 3P5JA 4LK0F 2CUJA 1ULYA 1LFBA 5ILUA 2WTEA 4XLEA 3M4OJ 1D1CA 3OS2A 3DPTA 3F22A 5DCFA 3S3MA 1RUNA 3AG2H 4QTRA 3JRCA 2OZUA 5FFXA 1RETA 1SVOA 4A3IJ 1MBHA 4I02A 4F3QA 2L4MA 1D0YA 2DT7B 2A3SA 4A3GJ 4I0BA 3P9CA 3SZGA 1ETYA 3M3YJ 3U1DA 4N4NB 1X2NA 2D45A 4CH7A 1U5TC 3LNQA 2DT6A 1HKTA 1UG0A 4D7MA 2K9MA 1Z0XA 5HDKA 2VBWA 1U8RA 4QLCU 2A68F 2PMUA 2RNGA 4E6KG 2HQAA 2HDWA 3FBNB 3WU0A 2JSCA 1UZCA 3HKZA 3SXYA 2VL8A 1WJDA 4RAYA 4KITB 2AS5F 1ETWA 1YHQI 2BXZA 3ERMA 2Y31A 1IN6A 4I09A 3WODF 2PG4A 4U7DA 2E2HJ 3RDIA 2W1OA 3SYTA 1MD0A 2JVHA 2W82A 5D4RA 4XRFA 2CQXA 1TWFJ 4MIMA 1IAWA 2KP6A 2XPWA 4RAGA 2RDPA 4D1QA 3J80K 1S72I 3PSFA 5DUKA 1K6OA 5DDGA 3ZQIA 4EV0A 3JSPA 5GPCA 3CDLA 1G59A 1MSFC 1FZPB 3R0JA 1CGPA 4P5OA 1IDZA 3K2ZA 2PMZN 2XGXA 2GOXB 3KE2A 4AYBA 1J9IA 2LLKA 2V1XA 2DO7A 3J7AO 2OZ6A 2KZGA 4AD9A 1XCVA 3FXKA 1IN5A 4NQWB 2CUFA 2V9VA 3GTKJ 1SVLA 3HG9A 5M3MJ 1D0ZA 3F8BA 1MIJA 3G1MA 4BL0B 3W3CA 4KUMA 1MW7A 2EV0A 2ZJ2A 3K70D 2LREA 4RAZA 2L7ZA 3CC2I 2YX7A 3OSFA 1F36A 3MAJA 2KPMA 2FOWA 4PGGA 1TWHJ 4BEHA 1A31A 1Z67A 4F55A 3K2AA 1SVMA 1U8BA 1I1SA 2BYVE 1T0FA 2R7OA 3HM5A 3GCMA 4DZPA 1G3TA 3CCMI 1OCCH 3HB9A 2DCEA 3LSIA 1TT5B 3QPTA 4GYIA 3GO5A 3DF8A 3WG7H 1R1UA 4YFKF 4G8XA 3PFYA 1SD5A 3DLAA 5FJ8J 2ICWG 5KNLA 3RQ4A 1XX5A 4NC7A 4EMSA 3M8EA 5FGMA 1OMIA 3SDGA 5K1YA 2QF7A 2QQAA 2FOKA 1H9TA 3LFUA 2F5DA 5E3NA 3CMAI 4M3DA 3ABKH 2PN6A 3A0BC 4NHJA 4IOAF 5J1UA 3ZQCA 3H1CA 1RRJA 3IWFA 2XV4S 2HKXA 3M07A 1MGTA 4YIFA 1K83J 1B9MA 3CCJI 4A5MA 5ERIA 3VYTB 5E1XA 1WGXA 5HODA 2E71A 2L9VA 2EIKH 2JA8J 2GIVA 2DA2A 2DTRA 3BG5A 3CCVI 3OOPA 5HLTA 3VYRB 3CCEI 4E4HA 5HNFA 3KLNA 4BE1A 1E3OC 5M3FJ 2WB1N 1ZGAA 1XGSA 5F6FA 4YFXF 2R93J 3KP7A 3OY9A 3CLOA 5LRRA 1WJEA 4PJMA 4E7SA 3CCUI 4LG3A 2QGUA 5CJ9A 4BQNA 3H36A 2EBIA 3E5XA 4CUGA 2HOAA 2CQ7A 3PNTA 1J7KA 3IL2A 3CMYA 2VE9A 4IHTA 2IBDA 4YG2F 1V5EA 3M1EA 1ZR4A 3FX3A 3OYBA 2NXNB 2VXZA 4BUPA 4DYQA 3KZZA 1VQPI 4OU0A 3IKVA 1IXCA 5BNGA 5EYRA 4RB1A 3BCAA 2L9SA 2E5ZA 3QOEA 5E17F 1O7LA 4BXXJ 2B7EA 1TT0A 2A6EF 4NUBA 3OIPA 4EM0B 2V9KA 2A61A 4L9JA 3LAJA 4II2A 3FZVA 2F4IA 2FD5A 2GA1A 2NYXA 5LD2C 1ZRFA 5ICFA 1W36C 4P55A 2M45A 1J0RA 4M9SA 1XGOA 4RGXA 1PP7U 1EH7A 2P6TA 5LGNA 2M9HA 1XS9A 3K4BA 5LFAA 5BOXA 1AHDP 3F9KA 2HDCA 2HYGD 1O3SA 1X19A 2Y69H 2YSRA 1I3QJ 2IRFG 1IDYA 3IC7A 1SC7A 3FKIJ 1DP7P 1YTYA 2FNAA 2E7XA 3ZQHA 3FISA 4ZYHA 5K5OA 2VKVA 2Y2ZA 3G3ZA 1B8IB 4C3HJ 3GLLA 4CICA 3G4SI 5IOZA 2XB5A 4ZDLA 2XSJC 1DPUA 2M0CA 2Y0MA 3RPUD 3DP7A 4U7BA 3Q9SA 3MQ0A 3KFWX 5LHHA 1B9NA 2PMZA 2VJIA 4M3GA 3GFJA 2VKDA 4DJAA 2VN2A 2AQFA 1JJ6C 1FOXA 2HOTA 5FLXZ 3REOA 1G3YA 2XHKA 4EM2A 2BGCA 2M4KA 4E7IA 1MMNA 2X6XA 2E1OA 2ME0A 3BPXA 1BR2A 4OIQF 1X1BA 1R1TA 2KIMA 2FBKA 2UUZA 3BJ6A 1ZK8A 5F04A 4NBQA 2WY8Q 5J1YA 1U9NA 2XDVA 1MH4A 4B8XA 2PFBA 4OMYA 4DBRA 4XKVA 1NK3P 1RC9A 1TTYA 3OYJA 2A05A 4O6JA 2Z3YA 2FBIA 1W7PA 2DDAA 1SFKA 2R5YA 1NHAA 4CCNA 3AAFA 2IEKA 2NNNA 4HQEA 3M7GA 3MZ8A 4RM3A 4OMZA 4JX6A 5KK1A 2DMQA 2ZXIA 5IPAA 1UB9A 4IF4A 2HR3A 3D5LA 2B63J 5EZHA 2QSFX 2XSDC 3B02A 1Y8QB 4BU2A 1ZG5A 1WJCA 4F93B 1WSUA 2J5PA 2KISA 3M9AA 2CG4A 2GZWA 4LK1F 2ZXJA 2LG4A 4Z6YA 1KZHA 4XMYA 3LSJA 1B8IA 5J8CA 4A3KJ 1K7AA 2VE8A 3FBIB 2ZFWA 5JLXA 3DV8A 4LIUA 2CMPA 3OOUA 4M9ZA 2YPRA 3BY6A 4CZCA 2CU7A 4GO1A 3CUQB 2GXAA 3T1BA 2L5QA 3K70C 3BR5A 2CUZA 1T33A 3GTOJ 3MZYA 3ZMUA 1E0EA 2M7BA 3BCBA 1BW5A 3IP4B 4D5FA 3ZMTA 2EIMH 4KISA 2ZC2A 2RAEA 3GF2A 3FF5A 3FHNA 2STWA 4A2UA 1POGA 1YLFA 2JTVA 5AONA 3DBRB 2ZNYA 1B59A 2A69F 2L0KA 4XLHA 4CSWA 3KZIC 9ANTA 2OV7A 3ECHA 4BJ6C 1ZELA 3F3XA 1XC5A 1DGWY 2QM3A 3EUHA 2IS2A 1MMDA 4RB0A 5IP6A 3U9GA 1XGNA 4IQ4A 2X48A 3KP3A 5FLMJ 4UV8A 1RR7A 2DMPA 1Z3YA 2ZMEC 4OOIA 3OIOA 3QYFA 2LP0A 2QENA 3BZCA 3ULQB 2DPUA 2X85A 4XONA 5J1RA 5AIQA 5D4SA 1F1ZA 4EM1A 2Y0SN 2GAUA 4HF2A 4C30A 2XKOA 3L2CA 1F5TA 3Q0VA 1LEBA 3J7YJ 4HV5A 3K4KA 5E3LA 1L3LA 4ZYAA 1D5VA 2L54A 2MG4A 2UXXA 4B4CA 2V6EA 4Q4ZF 3BTJA 4K2EA 3OYNA 1QBJA 4MTDA 4EJTA 1VF9A 2E2JJ 2ZJRF 1J75A 3LWFA 1SD7A 4EVIA 2KQRA 1LE8A 2V1NA 3KP4A 2EQRA 1MNEA 2IGOA 1QVTA 1ZG3A 2MH9A 5FKNA 1JT6A 4L5JA 4ITVA 1DU0A 1D8JA 2XUBA 3C2HA 2LKPA 2Q2EA 4NC6A 2ETHA 5BPIA 1BJAA 4I76A 4HYEA 3J80Z 1VQ8I 1FTZA 2EZLA 1WWXA 3BP8A 3H0GJ 3GTPJ 4IHYA 4ON0A 4E7ZA 4LMYA 2P6SA 2TDXA 3SHFA 4OWRB 3Q9VA 5EDNA 3ZMZA 1VI0A 3IRQA 3KP6A 1SANA 4WXDA 3I59B 3QOPA 1P2FA 2LTPA 3WGGA 4BBSJ 4PJLA 2STTA 3ZPLA 2AHQA 1V55H 4A3DJ 1SMTA 1ETOA 2R7VA 5K7HA 1M1EB 1CQTA 2DFEA 2DODA 4BS9A 1E17A 3GZ5A 1VQ6I 3IH4A 1MMSA 4M6XA 2V4JC 3ZQLA 4DNCA 4G7ZF 1FP2A 1P7JA 2L2OA 1QQIA 2K85A 1WKMA 3IUOA 2EIJH 3DTEA 1TL8A 2IPQX 3HRMA 1SD4A 1BI1A 1O7FA 3BROA 5M5XJ 3BR3A 3RSNA 1XTAA 4O3MA 5IT9Z 1Y0UA 5GAGJ 3S14J 2JRTA 1FYMA 2BVLA 3B6AA 4CA0A 4ZYGA 2PMHA 2RC4A 5D8LB 5ICCA 1LPQA 2DYSH 4ENNA 1GVJA 3RZOJ 1OISA 1ZAOA 1CF7B 1HKSA 5AIPA 4HSRA 1EV7A 2LYCA 4XM3A 1ETKA 4B44A 1JJ8C 2DOEA 2KKOA 3JSOA 5TGTA 1IRZA 2OA4A 1XPXA 3OYIA 1PJRA 4EATA 2PJRB 3RKQA 5GTIC 3G1LA 1OYIA 3K1PA 5HDGA 5FRMA 4V2GA 2L9RA 1F43A 1QHHD 1T98A 3IV5A 1AU7A 3DPUA 2QUFA 1XDUA 3L2WA 2FA5A 4GGGA 1GLNA 4ZYDA 4Z2YA 5TRDA 1D5YA 5IP7J 1ODDA 2KMUA 2GWRA 1H88C 4IEJA 3A03A 2M87A 1V4RA 5FKLA 3S17J 2JK3A 4ZDOA 2HEOA 3HRSA 1UHWA 3WHCA 4G94A 3SQNA 5FLXK 1FPQA 4E7JA 4L18B 3LA7A 3FHZA 3FXJA 2FMYA 1FJLA 3CD6I 1VQ5I 2HYFA 2KRFA 4FTHA 2FQ4A 5LBQA 1OCTC 2X9DA 2R5ZA 5FFZA 1MBEA 2Q0OA 2DXIA 2CGPA 1Z05A 1RNLA 1ETQA 2MYSA 4O5VA 5JHUA 2M4GA 3I53A 1JE8A 4BQQA 2X51A 1WJ5A 2ESHA 3W2AA 1FTTA 3I9V2 4XIDA 5CKTA 4HG2A 3GZNB 5ICEA 4LG0B 2LOOA 2RQPA 2CFXA 3BT9A 3MCZA 2RN7A 2KDZA 2E60A 2IJLA 1W4MA 3WTXC 2O6GE 4MQ9F 4L9TA 4ZYEA 2JMWA 2Y0SA 3NARA 1T95A 3FM5A 3OS0A 4I7HA 2ZCWA 3H3VK 1HLVA 3K69A 1OCPA 5F0CA 2I5UA 4ABZA 4YIIA 3E7LA 5LEJA 4BBRJ 1HDPA 1TP4A 2QKLB 3S1QJ 3HSRA 2K4BA 3KX2A 5FO5A 2GOMA 1P7IA 2NS7A 1QNTA 4IPAA 2D1HA 2QLZA 2ZBKA 4EJWA 2F5EA 2AXTC 2IA0A 3L1PA 2JUCA 3HSFA 2M34A 3CUOA 4RLFA 3WTZA 3FXRA 2E19A 4C3JJ 4Y13A 4CXFA 2VPLA 2VC1A 2XC7A 3ABUA 4P9FA 4W97A 3SZPA 3PJRA 5HS8A 3SJMA 4JOMA 4Q5SF 5FLVA 2R7QA 1KYZA 5CQGA 4D0PA 4U0YA 1BA5A 4UHTA 3N4MA 3VWBA 2DAOA 3IHUA 2ZMEA 2RQQA 2OQGA 2GXGA 4PJ0C 4RA2A 1QA6A 4BQOA 3CMEI 2NVXJ 2HQNA 5A2QZ 2DTZA 4EGYA 3PL8A 1R5GA 2IVMA 2K7LA 3LSHA 5EEAA 4UB8C 4LG0A 1H89C 4KIBA 2XKPA 3W2VA 5H6QA 4IRHA 2BY2A 3JRGA 2DFFA 2IGNA 2VT2A 3QPSA 3SEQA 4BEHB 4FCYA 1NK2P 2DI3A 1UAAA 1MKMA 3HL2A 4ETSA 4JK1X 1ZG1A 1BOAA 4HW0A 5DCMA 3BG9A 3K7AJ 1APLC 2LBFA 2HS5A 2V26A 3ZN0A 2JVGA 5CLSA 2VIXA 2LC2A 3G71I 3HXLA 5F64A 2P7CB 1GT0C 2CSOA 5M5YJ 2B9SA 1XN7A 3K4LA 1MMAA 3EYIA 3HOVJ 3GTMJ 3BR0A 3BQZA 4OIRF 2EZIA 1Y8RB 1R4MB 3JCUC 3JRBA 3S8PA 4Y3OA 1X1CA 2YR2A 4KYWA 2IA2A 3R4KA 4B09A 4ESFA 3BPVA 2HKOA 3W2WA 2L7KA 5J47A 3VPRA 1LEAA 5D6FA 3KYDB 2PEXA 3ZQQA 2WV1A 1ZYRF 4YEJA 5DD8A 1SFUA 4A5NA 3JW4A 4ZC3A 1Z6TA 4WF2A 4LLNA 1OKRA 1Q1VA 3J7ZI 1UCRA 2PI0A 5H6RA 2P81A 2KLOA 3HOUJ 2E1MB 2WAQN 4XSXF 2LF8A 1TQIA 4C2TA 3C7JA 3CJNA 5ILSA 1BN5A 4I99C 1LDJA 1HBXG 2WY7Q 4G12A 3O6BB 1S7AA 2VODA 2ZXHA 3W6JB 2DK8A 5C3EJ 3KEYA 2V7FA 3H9GA 4XORA 1S6LA 2H09A 3GZ6A 1EF4A 2M0MA 1USSA 2XPVA 1GDTA 1V5FA 5KCMA 3A02A 4PJJA 4E7HA 1S8NA 3MKLA 3VDXA 4E7LA 2W85A 1YW7A 4XSZF 2HVSA 2EFPA 5IT9K 2ECBA 2P5KA 3D0SA 2RGVA 5D6EA 2KJCA 4G7HF 2XGEA 2FMLA 4BHBA 1TQPA 4RB3C 2CO5A 2F5CA 5KVRA 3T0YA 1HSJA 2X1EA 4A3JJ 5L3BA 4PK4A 1UJ8A 2HZDA 5FKKA 1N78A 2LFBA 5L3DA 3E0JB 3WTTC 2K27A 4L5IA 3TOBA 1R22A 1VQKI 1Y1VJ 2HI3A 3F8CA 5LGUA 4HX8A 4HNVA 3BZ6A 5FB2A 2R7WA 4HDVA 3HSEA 4HF1A 3G1OA 1Y1WJ 2QYOA 1WQ2A 4UUVA 1KU2A 3HOXJ 2BV6A 3F72A 1QHGA 3EQLF 2GM4A 4IRGA 3KLOA 2CYYA 5JVTA 2QBYB 1MJAA 3C3WA 3F0CA 1XSVA 2PX9A 3AKZA 1S7OA 4RGSA 1XD7A 2VQCA 2AO9A 4S0HB 3VEPA 2BY3A 3ROUA 3HOYJ 1QZEA 5LHGA 3WU2C 3G6EI 2IGKA 1T8IA 5F08A 3AG1H 3DEUA 2M8EA 1KU3A 1MH3A 3CLQA 4PZJA 3F8NA 4BGDA 3DPLC 4HNTA 4CZZA 3OL4A 1BR1A 1U5TB 3JR9A 4KNYA 3GTGJ 2OJED 1WPKA 2AXLA 3PUBA 1KU7A 5F27A 5IYCJ 3BC8A 4ENKA 1ZLKA 2W57A 3NRVA 1HW5A 2FXAA 2CV0A 3GFLA 3OMYA 2L3DA 3UNGC 4F7ZA 4XRMA 1NTCA 1QVUA 2WAEA 2JJ7A 3TDZC 3LFKA 4EQQA 3CUQC 2XGDA 2R92J 1ZTRA 2E35A 2DYRH 4A6EA 2DDBA 2GA2A 3H5RA 5LGTA 1PUEE 1MBJA 4RGUA 1V3FA 2DLLA 2QQ9A 2CUEA 2WC2A 3KEQA 3KYCB 2IS6A 1Z3XA 2DA4A 1QRYA 4HLYA 1OR7A 4V2FA 1W7PB 4HX7A 2ZKZA 2R5YB 2F2EA 3FXQA 2HVRA 3L2VA 1G6NA 2ADUA 1X58A 3PNVA 1ON2A 5D8KB 5HVQC 4RS8A 4H0EA 2KJBA 3QQAA 1SAUA 2ID3A 3GXOA 2XAFA 3C2BA 2EWNA 3JTHA 1YOVB 3TGNA 4A0YA 1FX7A 2W00A 2F48A 4AVPA 2M7AA 2BY0A 2XVCA 5FKMA 3C1DA 4XLNF 3CDHA 5DD4A 3VFZA 2WBMA 3L2RA 2LMDA 1XDSA 1VQ4I 1H0MA 2EK5A 2IA1A 4C3IJ 3TEDA 3EPZA 1VTNC 4AIDA 4JQFA 2QBYA 3FXUA 2VXDA 1HSTA 2HU9A 5DS9A 2LK2A 4XNFA 1UHSA 1U3EM 2ISYA 2NOJB 2QCOA 4UXNA 2XAHA 3HC7A 2XROA 5IT3A 1OFCX 4HX4A 1R71A 4RDUA 2K9SA 2O8XA 3V7SA 1RKWA 4II3A 2JPCA 4LLGF 1PDNC 1Q1HA 1WRJA 2L01A 3LL7A 4AWXB 5HDNA 1XB4A 3LSGA 3V7RA 4KT5C 4I01A 1U5TA 4YIRX 4M6VA 4ZTFA 1IRFA 4S04A 2JA2A 3WE2A 1KYWA 1LJ9A 3F8MA 5ICGA 4N4OB 1KONA 1VNDA 4IHSA 3I56I 2MSYA 2JPBA 2O5RA 3QP5A 5A2QK 4FISA 2FJ1A 5BQTA 2P5VA 3DLLF 4WK8F 2LH9A 2WAQA 2Y75A 4CCKA 1YITI 4M3FA 5FROA 3WTSC 3IAS2 4AC0A 2CV2A 2KRHA 1XMXA 2DPDA 3OYHA 3RKYA 5IY5H 4D9JA 4A3FJ 2A5YB 1GV2A 4CYDA 3LQRA 2MGQA 1RPWA 1FWZA 4CCLA 3FMQA 3CC4I 1MSEC 2EFOA 1R5ID 3W6VA 4CYCA 3BDDA 1YE9A 5JVGF 1BL0A 3DU5A 2RKHA 1H9GA 1WJBA 3I64A 2EINH 2K3FA 3WGIA 1FYKA 2F5FA 2MC4A 2GQQA 2EV6A 1HW2A 2LRDA 4MHGA 4OINF 4IOCF 1RUOA 4BQAA 3FK6A 1FBUA 2RNJA 1XMAA 1YIOA 2O3FA 3BG7A 4MTEA 4BNCA 4BHCA 4IHVA 3HGGA 1TWGJ 3MWMA 2NS8A 4MNUA 3HEFA 3K1NA 5KAIC 2W24A 1EA3A 4HSTA 1LE8B 2QSHX 1ZGWA 3T5XA 2VJ5A 3R60A 5GADJ 3KCCA 1SAXA 1WH7A 2R7SA 4C2UA 4PGHA 1EKEA 2VONA 4HBLA 4IXAA 3OL3A 2Q2EB 3DXJF 4G6TB 4P9UA 1MJ9A 3ZMDA 4LGWA 2OTJI 3G73A 4GRIA 3GUDA 1LKXA 3O8HA 4G6DA 2KIQA 1E3HA 4KIFA 4FT8A 4U87A 2CW0F 3CC7I 2FBHA 1IN8A 3ONQA 1HQCA 3TP3A 1LDDA 3OSGA 3RQIA 5D5XB 3J81K 3AL0B 1FLIA 2HOEA 1V54H 3O2PE 5D5UB 3ZGKA 2DA7A 3P7NA 1K4TA 2LKSA 2KFDA 1YRNA 3HDDA 1P6RA 2V79A 5J8FA 5JR3A 4Y17A 2LNBA 2VBZA 5LRSA 5TJJA 2WB1A 2LD5A 4BE2A 1R58A 1BIAA 1FMVA 3I54A 1MNMC 2XGCA 4YFNF 1ZN2A 3HPGA 4XQFA 1DDNA 3UR3C 5EEGA 1VFCA 1BI0A 1FC3A 3HOTA 4XICA 3S16J 4RLQA 2V6CA 2DBBA 2HQRA 4LLLA 4F92B 2E2IJ 1PUFA 2COBA 3A4CA 4XL9A 3N97A 1NG6A 1S7EA 2VOOA 5CVRA 2R7FA 3K0LA 4PSXA 2BE5F 2BXYA 2CJJA 2W84A 2BZTA 3SEZA 4J01A 1RESA 2ZO4A 3OYLA 1FSEA 3H5AA 4ZZDA 3IH3A 4OAZA 1MNDA 3JRHA 1YJWI 3GWZA 1Y0NA 3TP0A 3WTVC 5EF6A 5C4XJ 4UUSA 3V7CA 2DN0A 2N8GA 4RBOA 1WI9A 3L09A 1I6XA 1NH3A 1YG2A 2XAJA 5B5EC 1ERDA 2K4JA 3U21A 3EUKL 2IGMA 4D5CA 2VASA 1IF1A 4TV7A 2TCTA 2UWMA 5GTHC 2Z5UA 3Q3SA 1PVEA 2CRGA 3S3NA 1WHUA 1XGMA 2HWVA 1ETVA 2MD5A 4IKFA 1TWCJ 4IL6C 1JHHA 3GVAA 3HJEA 4KN7X 2P8TA 2YU3A 3ECOA 4W1UA 3TW6A 3BR6A 3SDBA 4XOTA 3MD2A 4QWQA 1K6YA 1MBGA 4QSHA 3WE3A 3NQOA 3JREA 1O3RA 5EJCA 2B0LA 4X0GA 1R49A 2Q8KA 3TQNA 4G9YA 1BIBA 2R5ZB 1JT0A 4XK4A 4QPOA 2ZJPF 3OYAA
chains in the Genus database with same CATH topology
2NRAC 2VOPA 1U78A 2V1DA 3LA2A 4EGZA 1K78A 4PCQA 4KFCA 1FY7A 3KZYA 2MH2A 4G7OF 3K1MA 1ZREA 3COAC 2FSWA 4UVBA 2FF4A 3GEZA 2COMA 1YO5C 1B4AA 3RIRA 3TKYA 5BMZA 2A07F 4CO8A 2HTSA 4R79A 2Z33A 1QPMA 3RJPA 3RKWA 4KMFA 1MZBA 3F23A 2Z9OA 2QZ8A 2P5LC 3R0AA 3RPQA 3ZQ7A 2VT3A 1Z91A 4GCVA 3T8TA 1BC8C 3JAMK 3TDUC 1LQ1A 1RI7A 1JGSA 4GXOA 3BJAA 4M74A 2XAGA 5JI6A 3EDPA 2D1VA 4KN4X 1EH8A 3VODA 5F1RA 2O61A 1IUYA 2ZMEB 2ZNZA 4IJAA 1XSDA 2RV8A 1F4KA 1X3UA 3QRFF 1KQ8A 5DUIA 2V1UA 4HAMA 4PDKA 3F6OA 5D5WB 3HTSB 1HW1A 3GFMA 2EFNA 2DU9A 2OAZA 1QO0D 5E8GA 4HA8A 4AIHA 3NEUA 5E1ZB 1ZRDA 4MGRA 4P96A 5DCMB 4RB2C 1BBYA 3LSTA 1U6GA 1IRGA 3EETA 5EEHA 3CO7C 4KA4A 3LQQA 5HOOA 4WX9A 1D8KA 1OPCA 1YW9A 1TNTA 3TO7A 4KIGA 1SFEA 4I2OA 4CGZA 4LB5A 2IW5A 1R5HA 3SZTA 2MA3A 3R61A 4R1HA 5CVIA 3HRUA 3Q5FA 4FX4A 1GHCA 1P4AA 1J59A 5L3EA 3V8KA 2G7HA 1E2XA 1ZLJA 3E3VA 3E6CC 4U0VA 1SD6A 4OIPF 1IW7F 1IZ1A 1P92A 3PQJA 2P7VB 4MEYF 2MBFA 3KETA 1O57A 4GYGA 4IRIA 1ZGJA 4ENMA 4XBFA 1OYWA 4HOBA 1XSXA 4HF0A 2FU4A 2OBPA 2M30A 3ZMSA 2DQLA 4UVCA 2LSOA 4LJZF 2EA2A 3I5UA 5DV5A 1C0WA 2XIGA 3EYYA 4OIOF 3RYPA 3ML6A 1LB2A 4WXHA 4HQMA 1LNWA 4L0YB 3F8FA 2MC3A 2PLYA 3ERED 2O03A 2EJRA 4KMUX 2HFHA 3J81Z 3I4PA 3L7WA 1P4WA 4ESJA 4Q48A 2QWWA 5L3FA 1JHFA 4L9VA 3MZHA 1G3WA 1P4XA 2NNYA 1IXRC 4M73A 4U88A 2EFQA 4WWCA 1STZA 3QPHA 3E5UA 4Q47A 3R6SA 3RPUA 2BEOA 2LDUA 1S29A 1BI2A 3E97A 2ESNA 5J6XA 1O3TA 5LHIA 4L9NA 3FMRA 1R7JA 2QQBA 5CYVA 2EFWA 3VOEA 4E70A 2M5WA 1HXDA 1TNSA 4KICA 3BJOA 3V8JA 4ESBA 1T38A 1SFXA 1Z9CA 1ONVA 2H6BA 2ACJA 1R36A 4N9HA 3KEOA 1KU9A 4NQWA 1W5SA 4HZFA 1FT9A 3F21A 2IP2A 1KGSA 3ZMVA 1R00A 1B6AA 2CWEA 1AOYA 1T2KA 3I58A 2G9WA 3MFKA 5HS7A 1LDKB 1MJBA 3ZP5A 4M6YA 3VB2A 1LVAA 1QZZA 4MEXF 2FEZA 5LEKA 3ABTA 4N0BA 5FD6A 5ED4A 4ASNA 3CTAA 3CO6C 1QZYA 1DPRA 1YQAA 4I98B 4WXCA 4DQ2A 3GW2A 4EJOA 2HGCA 2L02A 4RGRA 4S05A 2G7UA 1YW8A 4WCGA 5E1WA 4Y15A 3WGHA 3HTUA 1G4DA 5D5VB 4IVNA 3K9TA 2KIUA 3C18A 4MQVA 1GXQA 2M1BA 5K5RA 5BS6A 3JAMZ 3ELKA 2R7DA 2E1NA 1GXPA 1YS7A 1YFHA 3T8RA 1MDMB 3O3KA 3L9FA 3BWGA 2H27A 1JXSA 1RIOH 1L0OC 2NAZA 2OU2A 3GLXA 4N9IA 5HLIA 2OD5A 1FNNA 3H3UA 2E7WA 1IN7A 3HYIA 3S2WA 4BHPA 2QVOA 2BBYA 3IKTA 4AIJA 2PBIA 3TOAA 2K02A 2Z99A 5E18F 3WU1B 3U2RA 3RTRA 5L3CA 5E8IA 3H3ZA 3MEXA 4HV6A 2H94A 1YS6A 2P4WA 1XMKA 2XASA 1R23A 2EV5A 4I0AA 4G6QA 3DQVC 2PJPA 3HRTA 3PQKA 2IT0A 3TO6A 1T6SA 1EH6A 1ZARA 1I27A 3I0TA 2PQ8A 2K86A 3B73A 2CQKA 4ZH4F 4HLXA 4LB6B 2DT5A 3QP6A 1IN4A 1QGPA 1FBSA 2DW4A 3P9KA 3I71A 1MDMA 4ZZLA 3P9IA 1RZ4A 6PAXA 4M9XA 2JZYA 3H92A 1K79A 2W25A 3IWZA 5ILVA 4A12A 2VBXA 4CDGA 1KQ9A 2HTJA 4R8HA 1ZHFA 5E20A 4L0ZB 5HS9A 1U2WA 1I1GA 2R3SA 2Y48A 1TW2A 1K78B 5FD5A 1W5TA 3OV8A 3HHHA 2WWYA 3SFZA 2JT1A 3RKXA 3BOQA 4LD5A 4EJVA 4ENJA 4HDUA 3ISPA 5K5QA 2EA4A 4U0WA 1IXSB 3GX4X 3PFIA 3KP2A 3HHGA 3KP5A 2DQRA 1KA8A 4M72A 3V4GA 1SMYF 1B1BA 1OYYA 3QAHA 3RI4A 2OQRA 3L00A 4BH9A 3E6DA 4AIKA 2DK5A 3HUGA 1W7PD 4BYYA 1BC7C 2MLGA 1BI3A 3V8LA 1FP1D 3CUQA 1Z6RA 1Z1DA 1I5ZA 1BM9A 3TO9A 4FX0A 5CVUA 3WG9A 5HLGA 2HZTA 2RVCA 3FWEA 3E5QA 1J2XA 3QU3A 3HIFA 4EJUA 3E6BA 5BPDA 3LA3A 1ZRCA 2YX4A 1FYLA 4NB5A 4UVAA 2X4HA 1O3QA 4XLPF 5DYMA 1TQMA 1D3YA 2KIFA 1TBXA 1USTA 2FNPA 1T39A 1R1VA 1REPC 1TW3A 3RYRA 1J5YA 1DUXC 3E6MA 3LAPA 1FOKA 4LFUA 1PP8F 4M71A 3F6VA 1FBQA 4A0XA 2VBYA 2UZKA 4A6DA 3M8FA 2VC0A 1UHMA 1AWCA 1ON1A 3HOSA 1F9NA 4UV9A 2EB7A 2E1CA 2D2WA 3W6KB 3IRRA 1A04A 2ISZA 1ZH5A 3DFGA 5CVJA 3I59A 1Z7UA 2FE3A 5DEQA 3WTYC 1XCBA 2FRHA 4UNOA 5L3GA 2ELHA 5LLQA 2WV0A 2UXNA 4BAYA 2J5OA 4A0ZA 1KQ0A 2H6CA 1FSHA 2C6YA 2L4AA 2NS0A 4KDPA 3GYHX 3FMSA 2DFIA 2GXBA 3ZN1A 2LF7A 3DKWA 1YYVA 4JBAA 1CF7A 2XAQA 2MLKA 1G3SA 1S3JA 5H20A 2X0LA 2FQ3A 1UFMA 4CHUA 1HKQA 1TLHB 5JFRA 3GFIA 4FHTA 2O0YA 5HLHA 3FM3A 3JTGA 3QU6A 2XRNA 5CVVA 3WTWC 3WTUC 4BXUA 2A6HF 4LK0F 1ULYA 5ILUA 2WTEA 3F22A 3DPTA 5DCFA 1RUNA 2OZUA 5FFXA 4I02A 2L4MA 2A3SA 4I0BA 3P9CA 3U1DA 2D45A 1U5TC 1HKTA 5HDKA 2VBWA 1U8RA 4QLCU 2A68F 2PMUA 3WU0A 2JSCA 3SXYA 4RAYA 2AS5F 1IN6A 4I09A 3WODF 2PG4A 4U7DA 3RDIA 1MD0A 5D4RA 4XRFA 1IAWA 2RDPA 3J80K 5DUKA 1K6OA 5DDGA 3JSPA 4EV0A 1FZPB 3R0JA 1CGPA 4P5OA 3K2ZA 2XGXA 3KE2A 1J9IA 2V1XA 2DO7A 3J7AO 2OZ6A 4AD9A 1XCVA 1IN5A 2V9VA 3F8BA 4KUMA 2EV0A 2ZJ2A 4RAZA 2YX7A 3MAJA 4PGGA 1I1SA 2BYVE 1T0FA 1G3TA 3QPTA 4GYIA 3GO5A 3DF8A 1R1UA 4YFKF 4G8XA 1SD5A 4EMSA 3M8EA 5FGMA 1OMIA 5K1YA 2QQAA 2FOKA 1H9TA 2F5DA 2PN6A 4NHJA 3IWFA 2XV4S 2HKXA 1MGTA 4YIFA 1B9MA 4A5MA 5ERIA 5E1XA 2GIVA 2DTRA 3OOPA 3KLNA 1ZGAA 1XGSA 5F6FA 4YFXF 3KP7A 3CLOA 5LRRA 5CJ9A 3E5XA 3IL2A 2VE9A 1J7KA 4IHTA 4YG2F 3M1EA 3FX3A 2VXZA 3KZZA 4OU0A 3IKVA 1IXCA 4RB1A 5E17F 1O7LA 2A6EF 4EM0B 2A61A 4L9JA 3LAJA 3FZVA 2GA1A 2NYXA 1ZRFA 5ICFA 4P55A 2M45A 1J0RA 4M9SA 1XGOA 4RGXA 1PP7U 1EH7A 2P6TA 5LGNA 5BOXA 2HDCA 2HYGD 1O3SA 2YSRA 2IRFG 3IC7A 1DP7P 1YTYA 2FNAA 2E7XA 4ZYHA 5K5OA 3G3ZA 4CICA 1DPUA 2Y0MA 3DP7A 4U7BA 3Q9SA 3MQ0A 3KFWX 5LHHA 1B9NA 3GFJA 2VN2A 5FLXZ 3REOA 1G3YA 2XHKA 4EM2A 2BGCA 3BPXA 4OIQF 1R1TA 2KIMA 2FBKA 3BJ6A 4B8XA 2PFBA 4OMYA 1TTYA 4O6JA 2Z3YA 2FBIA 1W7PA 1NHAA 3AAFA 2NNNA 4HQEA 3M7GA 4OMZA 5KK1A 1UB9A 4IF4A 2HR3A 3D5LA 3B02A 1ZG5A 1WSUA 2J5PA 3M9AA 2CG4A 2GZWA 4LK1F 2ZXJA 5J8CA 1K7AA 2VE8A 2ZFWA 3DV8A 4M9ZA 2YPRA 3BY6A 4GO1A 3CUQB 3T1BA 3MZYA 3ZMUA 3ZMTA 3GF2A 3FF5A 2STWA 4A2UA 1YLFA 2JTVA 5AONA 2ZNYA 1B59A 2A69F 3ECHA 3F3XA 2QM3A 3EUHA 4RB0A 3U9GA 1XGNA 3KP3A 4UV8A 4OOIA 2QENA 3ULQB 2DPUA 5AIQA 5D4SA 1F1ZA 4EM1A 4HF2A 2GAUA 1LEBA 3L2CA 2XKOA 1F5TA 4HV5A 1L3LA 1D5VA 2L54A 2UXXA 4Q4ZF 4K2EA 1QBJA 4MTDA 4EJTA 1J75A 3LWFA 1SD7A 4EVIA 3KP4A 1ZG3A 2MH9A 4L5JA 1D8JA 2XUBA 2LKPA 2Q2EA 5BPIA 2ETHA 1BJAA 4HYEA 3J80Z 1WWXA 3BP8A 4ON0A 4LMYA 2P6SA 2TDXA 3SHFA 3Q9VA 3ZMZA 3IRQA 3KP6A 4WXDA 3I59B 3QOPA 1P2FA 3WGGA 3ZPLA 2STTA 1SMTA 1E17A 3GZ5A 4M6XA 4DNCA 4G7ZF 1FP2A 1QQIA 1WKMA 2IPQX 3HRMA 1SD4A 1BI1A 1O7FA 3BROA 4O3MA 5IT9Z 1Y0UA 2JRTA 1FYMA 4ZYGA 2PMHA 5ICCA 2RC4A 5D8LB 4ENNA 1GVJA 1ZAOA 1CF7B 1HKSA 5AIPA 1EV7A 2KKOA 3JSOA 2OA4A 3K1PA 1OYIA 5HDGA 1T98A 2QUFA 1XDUA 2FA5A 5TRDA 4GGGA 4ZYDA 4Z2YA 1ODDA 2GWRA 2M87A 1V4RA 2HEOA 3HRSA 1UHWA 4G94A 3SQNA 5FLXK 1FPQA 4L18B 3LA7A 3FHZA 2FMYA 2HYFA 2KRFA 5LBQA 5FFZA 2Q0OA 2CGPA 1Z05A 1RNLA 1JE8A 5JHUA 4O5VA 3I53A 2ESHA 4LG0B 5ICEA 2RQPA 2CFXA 3MCZA 2RN7A 2IJLA 1W4MA 3WTXC 2O6GE 4MQ9F 4L9TA 4ZYEA 3FM5A 4I7HA 2ZCWA 3K69A 4YIIA 5LEJA 3HSRA 2K4BA 5FO5A 1QNTA 4IPAA 2D1HA 2QLZA 2ZBKA 4EJWA 2F5EA 2IA0A 3HSFA 3CUOA 3WTZA 3FXRA 4Y13A 4CXFA 2VC1A 3ABUA 4P9FA 3SZPA 5HS8A 4Q5SF 1KYZA 4D0PA 4U0YA 4UHTA 3N4MA 2DAOA 3IHUA 2ZMEA 2OQGA 2GXGA 2HQNA 5A2QZ 4EGYA 1R5GA 2IVMA 2K7LA 4LG0A 4KIBA 2XKPA 5H6QA 4IRHA 2VT2A 2DI3A 1MKMA 4ETSA 4JK1X 1ZG1A 1BOAA 4HW0A 5DCMA 2HS5A 3ZN0A 5CLSA 5F64A 2P7CB 2CSOA 1XN7A 3EYIA 4OIRF 2YR2A 4KYWA 2IA2A 3R4KA 4B09A 4ESFA 3BPVA 2HKOA 1LEAA 5D6FA 2PEXA 1ZYRF 5DD8A 1SFUA 4A5NA 3JW4A 1Z6TA 4WF2A 4LLNA 1OKRA 1UCRA 2PI0A 5H6RA 4XSXF 2LF8A 1TQIA 3C7JA 3CJNA 5ILSA 1BN5A 1LDJA 1HBXG 3O6BB 1S7AA 2VODA 3W6JB 2DK8A 1S6LA 2H09A 3GZ6A 1USSA 1S8NA 2W85A 1YW7A 4XSZF 5IT9K 2EFPA 2P5KA 3D0SA 2RGVA 5D6EA 2KJCA 4G7HF 2FMLA 4BHBA 1TQPA 4RB3C 2CO5A 2F5CA 5KVRA 3T0YA 1HSJA 5L3BA 5L3DA 3WTTC 2K27A 4L5IA 3TOBA 1R22A 3F8CA 5LGUA 4HX8A 3BZ6A 5FB2A 4HDVA 3HSEA 4HF1A 2QYOA 1WQ2A 4UUVA 1KU2A 2BV6A 3F72A 3EQLF 4IRGA 3KLOA 2CYYA 5JVTA 2QBYB 1MJAA 3C3WA 1XSVA 1S7OA 4RGSA 1XD7A 3VEPA 3ROUA 5LHGA 3DEUA 2M8EA 1KU3A 4PZJA 3F8NA 3DPLC 4CZZA 1U5TB 4KNYA 2AXLA 1KU7A 4ENKA 1ZLKA 2W57A 3NRVA 1HW5A 2FXAA 3GFLA 2L3DA 4F7ZA 3TDZC 3LFKA 4EQQA 3CUQC 4A6EA 2GA2A 5LGTA 1PUEE 4RGUA 1V3FA 2DLLA 2QQ9A 2WC2A 3KEQA 4HLYA 1OR7A 1W7PB 4HX7A 2ZKZA 2F2EA 3FXQA 1G6NA 2ADUA 1ON2A 5D8KB 5HVQC 4RS8A 4H0EA 2KJBA 3GXOA 2XAFA 2EWNA 3JTHA 4A0YA 3TGNA 1FX7A 4AVPA 2XVCA 3C1DA 4XLNF 3CDHA 5DD4A 3VFZA 1XDSA 1H0MA 2EK5A 2IA1A 1VTNC 4JQFA 2QBYA 3FXUA 1HSTA 1U3EM 2ISYA 4UXNA 2XAHA 2XROA 5IT3A 4HX4A 2O8XA 3V7SA 2JPCA 4LLGF 1PDNC 1Q1HA 1WRJA 2L01A 4AWXB 5HDNA 1XB4A 3V7RA 4KT5C 4I01A 1U5TA 1IRFA 4S04A 3WE2A 1KYWA 1LJ9A 3F8MA 5ICGA 4IHSA 2JPBA 3QP5A 5A2QK 5BQTA 2P5VA 4WK8F 2Y75A 3WTSC 2DPDA 3RKYA 2A5YB 4CYDA 3LQRA 1FWZA 3FMQA 2EFOA 3BDDA 2RKHA 1H9GA 3I64A 1FYKA 3WGIA 2F5FA 2GQQA 2EV6A 1HW2A 4MHGA 1RUOA 4OINF 4BQAA 1FBUA 2RNJA 1XMAA 1YIOA 2O3FA 4MTEA 4BNCA 4BHCA 3MWMA 4MNUA 3K1NA 2W24A 3T5XA 3R60A 3KCCA 1SAXA 4PGHA 2VONA 4HBLA 4IXAA 3DXJF 4P9UA 1MJ9A 3ZMDA 4LGWA 3G73A 3GUDA 4G6DA 4KIFA 4FT8A 2CW0F 2FBHA 1IN8A 1HQCA 1LDDA 3J81K 5D5XB 1FLIA 2HOEA 3O2PE 5D5UB 3P7NA 1P6RA 2V79A 5J8FA 5JR3A 4Y17A 2LNBA 2VBZA 5LRSA 5TJJA 1R58A 1BIAA 3I54A 4YFNF 1ZN2A 1DDNA 5EEGA 1BI0A 1FC3A 3HOTA 2V6CA 2DBBA 2HQRA 4LLLA 3N97A 2VOOA 5CVRA 2R7FA 3K0LA 2BE5F 2W84A 2ZO4A 1FSEA 4ZZDA 3GWZA 3WTVC 3V7CA 1WI9A 3L09A 1I6XA 1YG2A 2XAJA 2K4JA 1IF1A 4TV7A 2UWMA 2Z5UA 1XGMA 2HWVA 2MD5A 1JHHA 3GVAA 4KN7X 2P8TA 2YU3A 3ECOA 4QWQA 3WE3A 3NQOA 1O3RA 2B0LA 2Q8KA 3TQNA 4G9YA 1BIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRA C;  2VOP A;  1U78 A;  2V1D A;  3LA2 A;  4EGZ A;  1K78 A;  4PCQ A;  4KFC A;  1FY7 A;  3KZY A;  2MH2 A;  4G7O F;  3K1M A;  1ZRE A;  3COA C;  2FSW A;  4UVB A;  2FF4 A;  3GEZ A;  2COM A;  1YO5 C;  1B4A A;  3RIR A;  3TKY A;  5BMZ A;  2A07 F;  4CO8 A;  2HTS A;  4R79 A;  2Z33 A;  1QPM A;  3RJP A;  3RKW A;  4KMF A;  1MZB A;  3F23 A;  2Z9O A;  2QZ8 A;  2P5L C;  3R0A A;  3RPQ A;  3ZQ7 A;  2VT3 A;  1Z91 A;  4GCV A;  3T8T A;  1BC8 C;  3JAM K;  3TDU C;  1LQ1 A;  1RI7 A;  1JGS A;  4GXO A;  3BJA A;  4M74 A;  2XAG A;  5JI6 A;  3EDP A;  2D1V A;  4KN4 X;  1EH8 A;  3VOD A;  5F1R A;  2O61 A;  1IUY A;  2ZME B;  2ZNZ A;  4IJA A;  1XSD A;  2RV8 A;  1F4K A;  1X3U A;  3QRF F;  1KQ8 A;  5DUI A;  2V1U A;  4HAM A;  4PDK A;  3F6O A;  5D5W B;  3HTS B;  1HW1 A;  3GFM A;  2EFN A;  2DU9 A;  2OAZ A;  1QO0 D;  5E8G A;  4HA8 A;  4AIH A;  3NEU A;  5E1Z B;  1ZRD A;  4MGR A;  4P96 A;  5DCM B;  4RB2 C;  1BBY A;  3LST A;  1U6G A;  1IRG A;  3EET A;  5EEH A;  3CO7 C;  4KA4 A;  3LQQ A;  5HOO A;  4WX9 A;  1D8K A;  1OPC A;  1YW9 A;  1TNT A;  3TO7 A;  4KIG A;  1SFE A;  4I2O A;  4CGZ A;  4LB5 A;  2IW5 A;  1R5H A;  3SZT A;  2MA3 A;  3R61 A;  4R1H A;  5CVI A;  3HRU A;  3Q5F A;  4FX4 A;  1GHC A;  1P4A A;  1J59 A;  5L3E A;  3V8K A;  2G7H A;  1E2X A;  1ZLJ A;  3E3V A;  3E6C C;  4U0V A;  1SD6 A;  4OIP F;  1IW7 F;  1IZ1 A;  1P92 A;  3PQJ A;  2P7V B;  4MEY F;  2MBF A;  3KET A;  1O57 A;  4GYG A;  4IRI A;  1ZGJ A;  4ENM A;  4XBF A;  1OYW A;  4HOB A;  1XSX A;  4HF0 A;  2FU4 A;  2OBP A;  2M30 A;  3ZMS A;  2DQL A;  4UVC A;  2LSO A;  4LJZ F;  2EA2 A;  3I5U A;  5DV5 A;  1C0W A;  2XIG A;  3EYY A;  4OIO F;  3RYP A;  3ML6 A;  1LB2 A;  4WXH A;  4HQM A;  1LNW A;  4L0Y B;  3F8F A;  2MC3 A;  2PLY A;  3ERE D;  2O03 A;  2EJR A;  4KMU X;  2HFH A;  3J81 Z;  3I4P A;  3L7W A;  1P4W A;  4ESJ A;  4Q48 A;  2QWW A;  5L3F A;  1JHF A;  4L9V A;  3MZH A;  1G3W A;  1P4X A;  2NNY A;  1IXR C;  4M73 A;  4U88 A;  2EFQ A;  4WWC A;  1STZ A;  3QPH A;  3E5U A;  4Q47 A;  3R6S A;  3RPU A;  2BEO A;  2LDU A;  1S29 A;  1BI2 A;  3E97 A;  2ESN A;  5J6X A;  1O3T A;  5LHI A;  4L9N A;  3FMR A;  1R7J A;  2QQB A;  5CYV A;  2EFW A;  3VOE A;  4E70 A;  2M5W A;  1HXD A;  1TNS A;  4KIC A;  3BJO A;  3V8J A;  4ESB A;  1T38 A;  1SFX A;  1Z9C A;  1ONV A;  2H6B A;  2ACJ A;  1R36 A;  4N9H A;  3KEO A;  1KU9 A;  4NQW A;  1W5S A;  4HZF A;  1FT9 A;  3F21 A;  2IP2 A;  1KGS A;  3ZMV A;  1R00 A;  1B6A A;  2CWE A;  1AOY A;  1T2K A;  3I58 A;  2G9W A;  3MFK A;  5HS7 A;  1LDK B;  1MJB A;  3ZP5 A;  4M6Y A;  3VB2 A;  1LVA A;  1QZZ A;  4MEX F;  2FEZ A;  5LEK A;  3ABT A;  4N0B A;  5FD6 A;  5ED4 A;  4ASN A;  3CTA A;  3CO6 C;  1QZY A;  1DPR A;  1YQA A;  4I98 B;  4WXC A;  4DQ2 A;  3GW2 A;  4EJO A;  2HGC A;  2L02 A;  4RGR A;  4S05 A;  2G7U A;  1YW8 A;  4WCG A;  5E1W A;  4Y15 A;  3WGH A;  3HTU A;  1G4D A;  5D5V B;  4IVN A;  3K9T A;  2KIU A;  3C18 A;  4MQV A;  1GXQ A;  2M1B A;  5K5R A;  5BS6 A;  3JAM Z;  3ELK A;  2R7D A;  2E1N A;  1GXP A;  1YS7 A;  1YFH A;  3T8R A;  1MDM B;  3O3K A;  3L9F A;  3BWG A;  2H27 A;  1JXS A;  1RIO H;  1L0O C;  2NAZ A;  2OU2 A;  3GLX A;  4N9I A;  5HLI A;  2OD5 A;  1FNN A;  3H3U A;  2E7W A;  1IN7 A;  3HYI A;  3S2W A;  4BHP A;  2QVO A;  2BBY A;  3IKT A;  4AIJ A;  2PBI A;  3TOA A;  2K02 A;  2Z99 A;  5E18 F;  3WU1 B;  3U2R A;  3RTR A;  5L3C A;  5E8I A;  3H3Z A;  3MEX A;  4HV6 A;  2H94 A;  1YS6 A;  2P4W A;  1XMK A;  2XAS A;  1R23 A;  2EV5 A;  4I0A A;  4G6Q A;  3DQV C;  2PJP A;  3HRT A;  3PQK A;  2IT0 A;  3TO6 A;  1T6S A;  1EH6 A;  1ZAR A;  1I27 A;  3I0T A;  2PQ8 A;  2K86 A;  3B73 A;  2CQK A;  4ZH4 F;  4HLX A;  4LB6 B;  2DT5 A;  3QP6 A;  1IN4 A;  1QGP A;  1FBS A;  2DW4 A;  3P9K A;  3I71 A;  1MDM A;  4ZZL A;  3P9I A;  1RZ4 A;  6PAX A;  4M9X A;  2JZY A;  3H92 A;  1K79 A;  2W25 A;  3IWZ A;  5ILV A;  4A12 A;  2VBX A;  4CDG A;  1KQ9 A;  2HTJ A;  4R8H A;  1ZHF A;  5E20 A;  4L0Z B;  5HS9 A;  1U2W A;  1I1G A;  2R3S A;  2Y48 A;  1TW2 A;  1K78 B;  5FD5 A;  1W5T A;  3OV8 A;  3HHH A;  2WWY A;  3SFZ A;  2JT1 A;  3RKX A;  3BOQ A;  4LD5 A;  4EJV A;  4ENJ A;  4HDU A;  3ISP A;  5K5Q A;  2EA4 A;  4U0W A;  1IXS B;  3GX4 X;  3PFI A;  3KP2 A;  3HHG A;  3KP5 A;  2DQR A;  1KA8 A;  4M72 A;  3V4G A;  1SMY F;  1B1B A;  1OYY A;  3QAH A;  3RI4 A;  2OQR A;  3L00 A;  4BH9 A;  3E6D A;  4AIK A;  2DK5 A;  3HUG A;  1W7P D;  4BYY A;  1BC7 C;  2MLG A;  1BI3 A;  3V8L A;  1FP1 D;  3CUQ A;  1Z6R A;  1Z1D A;  1I5Z A;  1BM9 A;  3TO9 A;  4FX0 A;  5CVU A;  3WG9 A;  5HLG A;  2HZT A;  2RVC A;  3FWE A;  3E5Q A;  1J2X A;  3QU3 A;  3HIF A;  4EJU A;  3E6B A;  5BPD A;  3LA3 A;  1ZRC A;  2YX4 A;  1FYL A;  4NB5 A;  4UVA A;  2X4H A;  1O3Q A;  4XLP F;  5DYM A;  1TQM A;  1D3Y A;  2KIF A;  1TBX A;  1UST A;  2FNP A;  1T39 A;  1R1V A;  1REP C;  1TW3 A;  3RYR A;  1J5Y A;  1DUX C;  3E6M A;  3LAP A;  1FOK A;  4LFU A;  1PP8 F;  4M71 A;  3F6V A;  1FBQ A;  4A0X A;  2VBY A;  2UZK A;  4A6D A;  3M8F A;  2VC0 A;  1UHM A;  1AWC A;  1ON1 A;  3HOS A;  1F9N A;  4UV9 A;  2EB7 A;  2E1C A;  2D2W A;  3W6K B;  3IRR A;  1A04 A;  2ISZ A;  1ZH5 A;  3DFG A;  5CVJ A;  3I59 A;  1Z7U A;  2FE3 A;  5DEQ A;  3WTY C;  1XCB A;  2FRH A;  4UNO A;  5L3G A;  2ELH A;  5LLQ A;  2WV0 A;  2UXN A;  4BAY A;  2J5O A;  4A0Z A;  1KQ0 A;  2H6C A;  1FSH A;  2C6Y A;  2L4A A;  2NS0 A;  4KDP A;  3GYH X;  3FMS A;  2DFI A;  2GXB A;  3ZN1 A;  2LF7 A;  3DKW A;  1YYV A;  4JBA A;  1CF7 A;  2XAQ A;  2MLK A;  1G3S A;  1S3J A;  5H20 A;  2X0L A;  2FQ3 A;  1UFM A;  4CHU A;  1HKQ A;  1TLH B;  5JFR A;  3GFI A;  4FHT A;  2O0Y A;  5HLH A;  3FM3 A;  3JTG A;  3QU6 A;  2XRN A;  5CVV A;  3WTW C;  3WTU C;  4BXU A;  2A6H F;  4LK0 F;  1ULY A;  5ILU A;  2WTE A;  3F22 A;  3DPT A;  5DCF A;  1RUN A;  2OZU A;  5FFX A;  4I02 A;  2L4M A;  2A3S A;  4I0B A;  3P9C A;  3U1D A;  2D45 A;  1U5T C;  1HKT A;  5HDK A;  2VBW A;  1U8R A;  4QLC U;  2A68 F;  2PMU A;  3WU0 A;  2JSC A;  3SXY A;  4RAY A;  2AS5 F;  1IN6 A;  4I09 A;  3WOD F;  2PG4 A;  4U7D A;  3RDI A;  1MD0 A;  5D4R A;  4XRF A;  1IAW A;  2RDP A;  3J80 K;  5DUK A;  1K6O A;  5DDG A;  3JSP A;  4EV0 A;  1FZP B;  3R0J A;  1CGP A;  4P5O A;  3K2Z A;  2XGX A;  3KE2 A;  1J9I A;  2V1X A;  2DO7 A;  3J7A O;  2OZ6 A;  4AD9 A;  1XCV A;  1IN5 A;  2V9V A;  3F8B A;  4KUM A;  2EV0 A;  2ZJ2 A;  4RAZ A;  2YX7 A;  3MAJ A;  4PGG A;  1I1S A;  2BYV E;  1T0F A;  1G3T A;  3QPT A;  4GYI A;  3GO5 A;  3DF8 A;  1R1U A;  4YFK F;  4G8X A;  1SD5 A;  4EMS A;  3M8E A;  5FGM A;  1OMI A;  5K1Y A;  2QQA A;  2FOK A;  1H9T A;  2F5D A;  2PN6 A;  4NHJ A;  3IWF A;  2XV4 S;  2HKX A;  1MGT A;  4YIF A;  1B9M A;  4A5M A;  5ERI A;  5E1X A;  2GIV A;  2DTR A;  3OOP A;  3KLN A;  1ZGA A;  1XGS A;  5F6F A;  4YFX F;  3KP7 A;  3CLO A;  5LRR A;  5CJ9 A;  3E5X A;  3IL2 A;  2VE9 A;  1J7K A;  4IHT A;  4YG2 F;  3M1E A;  3FX3 A;  2VXZ A;  3KZZ A;  4OU0 A;  3IKV A;  1IXC A;  4RB1 A;  5E17 F;  1O7L A;  2A6E F;  4EM0 B;  2A61 A;  4L9J A;  3LAJ A;  3FZV A;  2GA1 A;  2NYX A;  1ZRF A;  5ICF A;  4P55 A;  2M45 A;  1J0R A;  4M9S A;  1XGO A;  4RGX A;  1PP7 U;  1EH7 A;  2P6T A;  5LGN A;  5BOX A;  2HDC A;  2HYG D;  1O3S A;  2YSR A;  2IRF G;  3IC7 A;  1DP7 P;  1YTY A;  2FNA A;  2E7X A;  4ZYH A;  5K5O A;  3G3Z A;  4CIC A;  1DPU A;  2Y0M A;  3DP7 A;  4U7B A;  3Q9S A;  3MQ0 A;  3KFW X;  5LHH A;  1B9N A;  3GFJ A;  2VN2 A;  5FLX Z;  3REO A;  1G3Y A;  2XHK A;  4EM2 A;  2BGC A;  3BPX A;  4OIQ F;  1R1T A;  2KIM A;  2FBK A;  3BJ6 A;  4B8X A;  2PFB A;  4OMY A;  1TTY A;  4O6J A;  2Z3Y A;  2FBI A;  1W7P A;  1NHA A;  3AAF A;  2NNN A;  4HQE A;  3M7G A;  4OMZ A;  5KK1 A;  1UB9 A;  4IF4 A;  2HR3 A;  3D5L A;  3B02 A;  1ZG5 A;  1WSU A;  2J5P A;  3M9A A;  2CG4 A;  2GZW A;  4LK1 F;  2ZXJ A;  5J8C A;  1K7A A;  2VE8 A;  2ZFW A;  3DV8 A;  4M9Z A;  2YPR A;  3BY6 A;  4GO1 A;  3CUQ B;  3T1B A;  3MZY A;  3ZMU A;  3ZMT A;  3GF2 A;  3FF5 A;  2STW A;  4A2U A;  1YLF A;  2JTV A;  5AON A;  2ZNY A;  1B59 A;  2A69 F;  3ECH A;  3F3X A;  2QM3 A;  3EUH A;  4RB0 A;  3U9G A;  1XGN A;  3KP3 A;  4UV8 A;  4OOI A;  2QEN A;  3ULQ B;  2DPU A;  5AIQ A;  5D4S A;  1F1Z A;  4EM1 A;  4HF2 A;  2GAU A;  1LEB A;  3L2C A;  2XKO A;  1F5T A;  4HV5 A;  1L3L A;  1D5V A;  2L54 A;  2UXX A;  4Q4Z F;  4K2E A;  1QBJ A;  4MTD A;  4EJT A;  1J75 A;  3LWF A;  1SD7 A;  4EVI A;  3KP4 A;  1ZG3 A;  2MH9 A;  4L5J A;  1D8J A;  2XUB A;  2LKP A;  2Q2E A;  5BPI A;  2ETH A;  1BJA A;  4HYE A;  3J80 Z;  1WWX A;  3BP8 A;  4ON0 A;  4LMY A;  2P6S A;  2TDX A;  3SHF A;  3Q9V A;  3ZMZ A;  3IRQ A;  3KP6 A;  4WXD A;  3I59 B;  3QOP A;  1P2F A;  3WGG A;  3ZPL A;  2STT A;  1SMT A;  1E17 A;  3GZ5 A;  4M6X A;  4DNC A;  4G7Z F;  1FP2 A;  1QQI A;  1WKM A;  2IPQ X;  3HRM A;  1SD4 A;  1BI1 A;  1O7F A;  3BRO A;  4O3M A;  5IT9 Z;  1Y0U A;  2JRT A;  1FYM A;  4ZYG A;  2PMH A;  5ICC A;  2RC4 A;  5D8L B;  4ENN A;  1GVJ A;  1ZAO A;  1CF7 B;  1HKS A;  5AIP A;  1EV7 A;  2KKO A;  3JSO A;  2OA4 A;  3K1P A;  1OYI A;  5HDG A;  1T98 A;  2QUF A;  1XDU A;  2FA5 A;  5TRD A;  4GGG A;  4ZYD A;  4Z2Y A;  1ODD A;  2GWR A;  2M87 A;  1V4R A;  2HEO A;  3HRS A;  1UHW A;  4G94 A;  3SQN A;  5FLX K;  1FPQ A;  4L18 B;  3LA7 A;  3FHZ A;  2FMY A;  2HYF A;  2KRF A;  5LBQ A;  5FFZ A;  2Q0O A;  2CGP A;  1Z05 A;  1RNL A;  1JE8 A;  5JHU A;  4O5V A;  3I53 A;  2ESH A;  4LG0 B;  5ICE A;  2RQP A;  2CFX A;  3MCZ A;  2RN7 A;  2IJL A;  1W4M A;  3WTX C;  2O6G E;  4MQ9 F;  4L9T A;  4ZYE A;  3FM5 A;  4I7H A;  2ZCW A;  3K69 A;  4YII A;  5LEJ A;  3HSR A;  2K4B A;  5FO5 A;  1QNT A;  4IPA A;  2D1H A;  2QLZ A;  2ZBK A;  4EJW A;  2F5E A;  2IA0 A;  3HSF A;  3CUO A;  3WTZ A;  3FXR A;  4Y13 A;  4CXF A;  2VC1 A;  3ABU A;  4P9F A;  3SZP A;  5HS8 A;  4Q5S F;  1KYZ A;  4D0P A;  4U0Y A;  4UHT A;  3N4M A;  2DAO A;  3IHU A;  2ZME A;  2OQG A;  2GXG A;  2HQN A;  5A2Q Z;  4EGY A;  1R5G A;  2IVM A;  2K7L A;  4LG0 A;  4KIB A;  2XKP A;  5H6Q A;  4IRH A;  2VT2 A;  2DI3 A;  1MKM A;  4ETS A;  4JK1 X;  1ZG1 A;  1BOA A;  4HW0 A;  5DCM A;  2HS5 A;  3ZN0 A;  5CLS A;  5F64 A;  2P7C B;  2CSO A;  1XN7 A;  3EYI A;  4OIR F;  2YR2 A;  4KYW A;  2IA2 A;  3R4K A;  4B09 A;  4ESF A;  3BPV A;  2HKO A;  1LEA A;  5D6F A;  2PEX A;  1ZYR F;  5DD8 A;  1SFU A;  4A5N A;  3JW4 A;  1Z6T A;  4WF2 A;  4LLN A;  1OKR A;  1UCR A;  2PI0 A;  5H6R A;  4XSX F;  2LF8 A;  1TQI A;  3C7J A;  3CJN A;  5ILS A;  1BN5 A;  1LDJ A;  1HBX G;  3O6B B;  1S7A A;  2VOD A;  3W6J B;  2DK8 A;  1S6L A;  2H09 A;  3GZ6 A;  1USS A;  1S8N A;  2W85 A;  1YW7 A;  4XSZ F;  5IT9 K;  2EFP A;  2P5K A;  3D0S A;  2RGV A;  5D6E A;  2KJC A;  4G7H F;  2FML A;  4BHB A;  1TQP A;  4RB3 C;  2CO5 A;  2F5C A;  5KVR A;  3T0Y A;  1HSJ A;  5L3B A;  5L3D A;  3WTT C;  2K27 A;  4L5I A;  3TOB A;  1R22 A;  3F8C A;  5LGU A;  4HX8 A;  3BZ6 A;  5FB2 A;  4HDV A;  3HSE A;  4HF1 A;  2QYO A;  1WQ2 A;  4UUV A;  1KU2 A;  2BV6 A;  3F72 A;  3EQL F;  4IRG A;  3KLO A;  2CYY A;  5JVT A;  2QBY B;  1MJA A;  3C3W A;  1XSV A;  1S7O A;  4RGS A;  1XD7 A;  3VEP A;  3ROU A;  5LHG A;  3DEU A;  2M8E A;  1KU3 A;  4PZJ A;  3F8N A;  3DPL C;  4CZZ A;  1U5T B;  4KNY A;  2AXL A;  1KU7 A;  4ENK A;  1ZLK A;  2W57 A;  3NRV A;  1HW5 A;  2FXA A;  3GFL A;  2L3D A;  4F7Z A;  3TDZ C;  3LFK A;  4EQQ A;  3CUQ C;  4A6E A;  2GA2 A;  5LGT A;  1PUE E;  4RGU A;  1V3F A;  2DLL A;  2QQ9 A;  2WC2 A;  3KEQ A;  4HLY A;  1OR7 A;  1W7P B;  4HX7 A;  2ZKZ A;  2F2E A;  3FXQ A;  1G6N A;  2ADU A;  1ON2 A;  5D8K B;  5HVQ C;  4RS8 A;  4H0E A;  2KJB A;  3GXO A;  2XAF A;  2EWN A;  3JTH A;  4A0Y A;  3TGN A;  1FX7 A;  4AVP A;  2XVC A;  3C1D A;  4XLN F;  3CDH A;  5DD4 A;  3VFZ A;  1XDS A;  1H0M A;  2EK5 A;  2IA1 A;  1VTN C;  4JQF A;  2QBY A;  3FXU A;  1HST A;  1U3E M;  2ISY A;  4UXN A;  2XAH A;  2XRO A;  5IT3 A;  4HX4 A;  2O8X A;  3V7S A;  2JPC A;  4LLG F;  1PDN C;  1Q1H A;  1WRJ A;  2L01 A;  4AWX B;  5HDN A;  1XB4 A;  3V7R A;  4KT5 C;  4I01 A;  1U5T A;  1IRF A;  4S04 A;  3WE2 A;  1KYW A;  1LJ9 A;  3F8M A;  5ICG A;  4IHS A;  2JPB A;  3QP5 A;  5A2Q K;  5BQT A;  2P5V A;  4WK8 F;  2Y75 A;  3WTS C;  2DPD A;  3RKY A;  2A5Y B;  4CYD A;  3LQR A;  1FWZ A;  3FMQ A;  2EFO A;  3BDD A;  2RKH A;  1H9G A;  3I64 A;  1FYK A;  3WGI A;  2F5F A;  2GQQ A;  2EV6 A;  1HW2 A;  4MHG A;  1RUO A;  4OIN F;  4BQA A;  1FBU A;  2RNJ A;  1XMA A;  1YIO A;  2O3F A;  4MTE A;  4BNC A;  4BHC A;  3MWM A;  4MNU A;  3K1N A;  2W24 A;  3T5X A;  3R60 A;  3KCC A;  1SAX A;  4PGH A;  2VON A;  4HBL A;  4IXA A;  3DXJ F;  4P9U A;  1MJ9 A;  3ZMD A;  4LGW A;  3G73 A;  3GUD A;  4G6D A;  4KIF A;  4FT8 A;  2CW0 F;  2FBH A;  1IN8 A;  1HQC A;  1LDD A;  3J81 K;  5D5X B;  1FLI A;  2HOE A;  3O2P E;  5D5U B;  3P7N A;  1P6R A;  2V79 A;  5J8F A;  5JR3 A;  4Y17 A;  2LNB A;  2VBZ A;  5LRS A;  5TJJ A;  1R58 A;  1BIA A;  3I54 A;  4YFN F;  1ZN2 A;  1DDN A;  5EEG A;  1BI0 A;  1FC3 A;  3HOT A;  2V6C A;  2DBB A;  2HQR A;  4LLL A;  3N97 A;  2VOO A;  5CVR A;  2R7F A;  3K0L A;  2BE5 F;  2W84 A;  2ZO4 A;  1FSE A;  4ZZD A;  3GWZ A;  3WTV C;  3V7C A;  1WI9 A;  3L09 A;  1I6X A;  1YG2 A;  2XAJ A;  2K4J A;  1IF1 A;  4TV7 A;  2UWM A;  2Z5U A;  1XGM A;  2HWV A;  2MD5 A;  1JHH A;  3GVA A;  4KN7 X;  2P8T A;  2YU3 A;  3ECO A;  4QWQ A;  3WE3 A;  3NQO A;  1O3R A;  2B0L A;  2Q8K A;  3TQN A;  4G9Y A;  1BIB A; 
#chains in the Genus database with same CATH topology
 4FAS D;  2NRA C;  3QOD A;  4EEF G;  2VOP A;  1U78 A;  1N77 A;  2V1D A;  3LA2 A;  3NWS A;  4EGZ A;  3CP2 A;  2R4G A;  2QQ8 A;  3IAM 2;  3K10 A;  1K78 A;  1IV8 A;  1MMG A;  4A3L J;  4PCQ A;  4XKW A;  3HZJ A;  3TMO A;  3RCO A;  2X6Y A;  4DBQ A;  2OTL I;  4KFC A;  1FY7 A;  2XF6 A;  2LVS A;  2G0E A;  3KZY A;  4DYC A;  2WAF A;  2MH2 A;  1IO2 A;  5GP9 A;  3FXM A;  4G7O F;  3K1M A;  3DKY A;  1ZRE A;  3COA C;  2FSW A;  4UVB A;  2FF4 A;  3GEZ A;  2COM A;  3KPH A;  1OCO H;  1HDD C;  3Q0U A;  1YO5 C;  3OIQ A;  1DQU A;  1B4A A;  3RIR A;  3TKY A;  2BHY A;  2KT0 A;  5BMZ A;  4DGW B;  3S2H J;  1W0U A;  1IUF A;  4AM3 A;  2BY1 A;  2A07 F;  4IQJ A;  1WJA A;  1U0J A;  4CO8 A;  2HTS A;  3DKX A;  4R79 A;  2Z33 A;  1QPM A;  1T0F C;  3RJP A;  1OLT A;  3RKW A;  4X6A J;  4KMF A;  1MZB A;  2XF5 A;  2XRL A;  3F23 A;  2Z9O A;  2QZ8 A;  2P5L C;  3R0A A;  3X2Q H;  3QPL A;  3RPQ A;  2EH3 A;  4C2M J;  2W4S A;  3JRA A;  4GFB A;  3ZQ7 A;  2VT3 A;  2KL4 A;  1Z91 A;  4GCV A;  4NDL A;  3QYB A;  4YEL A;  3T8T A;  2IS4 A;  2DA5 A;  1BC8 C;  3CMM A;  3JAM K;  3TDU C;  3B6C A;  1RI7 A;  1LQ1 A;  3EUA A;  1JGS A;  3DWL E;  4DW6 A;  3A0H C;  5E79 C;  4GXO A;  3BJA A;  4M74 A;  1HCR A;  2XAG A;  5JI6 A;  3EDP A;  2D1V A;  5EGO A;  4KN4 X;  3K4C A;  4AUX A;  4FET A;  1EH8 A;  4Y7N J;  3AL0 C;  2H8R A;  3QWL A;  4XLF A;  3VOD A;  5F1R A;  2O61 A;  1IUY A;  3D5S C;  2MW8 A;  1X2M A;  2ZME B;  2ZNZ A;  3MN2 A;  4IJA A;  2RV8 A;  3BG3 A;  2OUM A;  1XSD A;  1X3U A;  1F4K A;  3QRF F;  3PO3 J;  1KQ8 A;  2DA6 A;  3DBL B;  5DUI A;  3Q0W A;  2V1U A;  4HAM A;  4PDK A;  3F6O A;  5D5W B;  3HTS B;  1HW1 A;  3GFM A;  2DU9 A;  2EFN A;  2OAZ A;  5GAE J;  1JKP C;  1QO0 D;  2DA3 A;  2K9Q A;  5E8G A;  4BDY A;  4DIQ A;  3OYD A;  2H1L A;  4HA8 A;  4AIH A;  3I55 I;  1YX3 A;  1IV6 A;  3NEU A;  5HNH A;  5E1Z B;  2R0Q C;  1ZRD A;  5TIS C;  4MGR A;  4P96 A;  5DCM B;  2VI6 A;  4RB2 C;  5B3S H;  2LBF B;  3RZD J;  1BBY A;  1R4N B;  4JYK A;  4ANJ A;  1ITY A;  4BXF A;  5KAF C;  3LST A;  1U6G A;  1T08 B;  2HNH A;  1IRG A;  3EET A;  5EEH A;  3CO7 C;  1I3A A;  1VQN I;  2QSG X;  1QU3 A;  1P9Q C;  4KA4 A;  3LQQ A;  4LIT A;  5HOO A;  1FOY A;  1RKT A;  4WX9 A;  1D8K A;  1OPC A;  1O4X A;  1YW9 A;  1TNT A;  3TO7 A;  4KIG A;  2JA7 J;  1SFE A;  1IRX A;  3TL4 X;  1FMW A;  4I2O A;  2R7R A;  1J09 A;  4CGZ A;  4LB5 A;  3LSP A;  1RR8 C;  5CPR B;  5B1A H;  2IW5 A;  2WAD A;  4XN3 A;  3HOZ J;  5E3O A;  1R5H A;  4PFO A;  3TW7 A;  3SZT A;  1BJZ A;  4E7K A;  2MA3 A;  3R61 A;  3OYC A;  3H35 A;  1T56 A;  2VPR A;  2MD0 A;  3A01 B;  4R1H A;  5CVI A;  1GV5 A;  1U9O A;  3HRU A;  3CF5 F;  1OQY A;  4HEA 2;  4I6Z A;  3Q5F A;  3PIO F;  4FX4 A;  1GHC A;  1P4A A;  2F4M B;  1V5G A;  1J59 A;  2NOG A;  3D5R C;  2HVQ A;  2YUS A;  5L3E A;  3DEE A;  3K4M A;  3V8K A;  2G7H A;  2ZSI B;  1E2X A;  5F0F A;  3MKW B;  1ZLJ A;  1XG1 A;  3E3V A;  4JX5 A;  2K3P A;  3OYF A;  2EZH A;  3E6C C;  3PIP F;  3BR2 A;  1JTX A;  3LSK A;  4U0V A;  3VYS B;  4HRI A;  3PM1 A;  1W0T A;  1SD6 A;  2R7Z J;  5EZG A;  4OIP F;  1IW7 F;  1JI8 A;  1IZ1 A;  1NG7 A;  1P92 A;  3FDY A;  1DGR M;  1B72 A;  1HA8 A;  3PQJ A;  2P7V B;  1LVK A;  4MEY F;  3K4J A;  3LSM A;  4UUT A;  2MBF A;  3CJR B;  2I10 A;  4B43 A;  3KET A;  1VQM I;  3DBH B;  1O57 A;  3GTL J;  1R6R A;  4GYG A;  4IRI A;  1ZGJ A;  3ASN H;  2X1C A;  4ENM A;  4ZTJ A;  4XBF A;  4V19 K;  3H9Q A;  1OYW A;  2K40 A;  5B66 C;  3OR2 C;  1XSX A;  2VKE A;  4HOB A;  3BG6 A;  1UMQ A;  5GPA A;  4HF0 A;  2FU4 A;  2OBP A;  2M30 A;  3ZMS A;  3S32 A;  4XRS A;  1ORK A;  2DQL A;  4UVC A;  2RRE A;  2LSO A;  3VYU B;  4LJZ F;  2EA2 A;  3I5U A;  5DV5 A;  2W7N A;  1C0W A;  2XIG A;  1LFU P;  3EYY A;  1SFO J;  4OIO F;  3ASO H;  2VQL A;  3RYP A;  2O9L A;  3ML6 A;  1LB2 A;  4WXH A;  4HQM A;  1LNW A;  2F4O B;  3A01 A;  4L0Y B;  3DEW A;  3F8F A;  1WFX A;  2MC3 A;  5M5W J;  1N75 A;  2PLY A;  3ERE D;  2O03 A;  3H0D A;  2EJR A;  4KMU X;  2HFH A;  3J81 Z;  3I4P A;  3L7W A;  1P4W A;  4ESJ A;  5C4J J;  4Q48 A;  2LY2 A;  2QWW A;  5DTD A;  3SFI A;  5L3F A;  5J40 A;  1JHF A;  4L9V A;  3OYK A;  3MZH A;  1A36 A;  1H8A C;  1G3W A;  3CES A;  3ESW B;  1P4X A;  2JQ7 A;  4UB6 C;  1TZL A;  2NNY A;  1IXR C;  4M73 A;  4H4K C;  3MVP A;  5E3M A;  1DU6 A;  3CCQ I;  2JN6 A;  4U88 A;  3M8J A;  2EFQ A;  5F1J A;  4ZJZ A;  1YX5 A;  3U1K A;  4WWC A;  1STZ A;  2K9N A;  2VQH A;  1OJL A;  3QPH A;  1UG2 A;  3FXL A;  3C2G A;  4L5E A;  4CCO A;  1IC8 A;  1S9H A;  1HF0 A;  3E5U A;  4Q47 A;  3R6S A;  3RPU A;  3FK7 A;  4Y33 A;  2XAU A;  2R7T A;  2BEO A;  3NWT A;  2H1K A;  2DJI A;  3OR1 C;  2LDU A;  2ZXW H;  1S29 A;  2OC6 A;  2ZFU A;  1BI2 A;  4B3A A;  3E97 A;  2ESN A;  3EUH C;  5J6X A;  1O3T A;  2OPT A;  5LHI A;  4L9N A;  5JLW A;  3IH2 A;  3FMR A;  1R7J A;  2QQB A;  1MBK A;  1R9T J;  5CYV A;  2EFW A;  3L2U A;  2ZSH B;  4FE7 A;  3VOE A;  5GAH J;  4IHX A;  1JTY A;  4E70 A;  2M5W A;  1HXD A;  2YU9 J;  1TNS A;  4KIC A;  4B1R A;  1A35 A;  4NC8 A;  2HPM A;  2BOL A;  1LFP A;  3BJO A;  3V8J A;  4ESB A;  4YRV A;  1IGN A;  1T38 A;  3CCS I;  1BW6 A;  5KHD A;  3A1Y A;  3VSK A;  1I39 A;  1SFX A;  2V9P A;  1JGG A;  1Y56 A;  1Z9C A;  1JKR C;  1ONV A;  2H6B A;  2EZK A;  2HXI A;  2ACJ A;  1R36 A;  4FQG A;  4N9H A;  3KEO A;  1A6I A;  1KU9 A;  2BVM A;  4NQW A;  4RMN A;  1W5S A;  4HZF A;  1FT9 A;  3F21 A;  2CW7 A;  3CJT B;  2NVT J;  2IP2 A;  1KGS A;  2X6W A;  3BTI A;  3ZMV A;  4BE0 A;  1R00 A;  1B6A A;  1FIP A;  2CWE A;  2LY9 A;  1AOY A;  4XKB A;  3ZRG A;  1T2K A;  3LSR A;  2HDD A;  3I58 A;  2G9W A;  3MFK A;  1BOB A;  2CW8 A;  5HS7 A;  1LDK B;  2I8D A;  4PJN A;  1MJB A;  1MBF A;  4A3B J;  3H9J A;  3ZP5 A;  4M6Y A;  2DOA A;  3VB2 A;  1LVA A;  1QZZ A;  2IS1 A;  4MEX F;  2FEZ A;  5LEK A;  3ABT A;  4N0B A;  5FD6 A;  4CYC B;  1ZKG A;  5ED4 A;  3ZR8 X;  2D5V A;  4JP0 A;  1X1A A;  3CTA A;  4ASN A;  3CO6 C;  3FXO A;  3H5N A;  5K7F A;  1Z7L A;  2E5N A;  3OYE A;  1QZY A;  1DPR A;  1YQA A;  4I98 B;  4WXC A;  4DQ2 A;  4XOP A;  1SEU A;  2GBY A;  3GW2 A;  4EJO A;  2ZJQ F;  1A6Q A;  1D1B A;  2HGC A;  3WHB A;  2L02 A;  4RGR A;  1JUP A;  3UKG A;  4NNJ A;  2NVQ J;  3PUF A;  4AVZ A;  4S05 A;  2G7U A;  2KHM A;  2JUG A;  2H8W A;  2Z1D A;  1YW8 A;  2M2E A;  4WCG A;  5E1W A;  3I3L A;  1VZ0 A;  4Y15 A;  1WI3 A;  4Y4R A;  5CQE A;  3WGH A;  4J00 A;  3HTU A;  1G4D A;  4B48 A;  5D5V B;  4IVN A;  1YIJ I;  1YJN I;  3K9T A;  1K4S A;  2KIU A;  3C18 A;  2IXS A;  2ELK A;  4MQV A;  3CDI A;  4XR6 A;  1GXQ A;  2M1B A;  2XF7 A;  3ZOB A;  4DZJ A;  2R7X A;  5K5R A;  5BS6 A;  2VUM J;  3N05 A;  3JAM Z;  3ELK A;  2R7D A;  1ZQ3 P;  3I4N J;  2E1N A;  1GXP A;  1YS7 A;  1N25 A;  3T8R A;  1YFH A;  1MDM B;  3OWT A;  3O3K A;  1TWA J;  3L9F A;  3BWG A;  1Z21 A;  2H27 A;  1JXS A;  5H2F C;  1RIO H;  1L0O C;  2NAZ A;  2OU2 A;  2L7M P;  3GLX A;  1YRN B;  4N9I A;  5HLI A;  2OD5 A;  3BZK A;  1FNN A;  3H3U A;  3MKY B;  2E7W A;  1A5J A;  1IN7 A;  4PSW A;  3HYI A;  3S2W A;  4BHP A;  2L9N A;  2QVO A;  2BBY A;  1HOM A;  3A2K A;  3IKT A;  2R7U A;  3GTJ J;  4AIJ A;  2DMU A;  1WJF A;  2PBI A;  3CCR I;  3TOA A;  2K02 A;  2CH0 A;  2Z99 A;  4BJ5 C;  5E18 F;  3WU1 B;  1PUF B;  2GIZ A;  3U2R A;  3RTR A;  2ZB9 A;  5E8I A;  3H3Z A;  5L3C A;  3MEX A;  2VKH A;  4UY8 I;  1VQ7 I;  2M8G X;  4AU7 A;  4HV6 A;  2H94 A;  1YS6 A;  2P4W A;  1XMK A;  3BTL A;  3FIW A;  2XAS A;  3DTK A;  4DYR A;  1R23 A;  2EV5 A;  3CP8 A;  4CCM A;  1W1W E;  4I0A A;  3BLY A;  4G6Q A;  3DQV C;  2PJP A;  3HRT A;  3PQK A;  2IT0 A;  3TO6 A;  1T6S A;  1EH6 A;  1ZAR A;  1I27 A;  3S1R J;  2DFH A;  3I0T A;  2PQ8 A;  2K86 A;  3B73 A;  5IOY A;  4UUS B;  2CQK A;  1HC8 A;  3HBL A;  3PNY A;  4ZH4 F;  5F0H A;  2L7F P;  4FE4 A;  4HLX A;  1D1A A;  3MMY B;  5IYB J;  2Y30 A;  5DM6 F;  1TC3 C;  2UV1 A;  4LB6 B;  2ELJ A;  4Y52 J;  5FKO A;  2DT5 A;  1X3W B;  1X4P A;  3QP6 A;  4RM2 A;  5C44 J;  1IN4 A;  1QGP A;  2DJN A;  4A69 C;  4J19 A;  1FBS A;  5IYD J;  2DW4 A;  3J7A Y;  2ECC A;  3P9K A;  3I71 A;  1MDM A;  4ZZL A;  4D7N A;  3JRF A;  1WVR A;  3P9I A;  3HUG B;  1RZ4 A;  1IJW C;  4M9X A;  6PAX A;  2JZY A;  3H92 A;  4CCJ A;  4DOZ A;  1WZ2 A;  1X1P A;  2KRC A;  5J3L A;  4LOC A;  1K79 A;  2W25 A;  2CQQ A;  3GBG A;  1S5L C;  2F5V A;  1IG7 A;  2HPI A;  2DMT A;  3ZQG A;  3IWZ A;  1OCR H;  5ILV A;  2KZV A;  5EG0 B;  3S15 J;  4B47 A;  4A12 A;  2VBX A;  2HXO A;  4QPQ A;  2Y9Z A;  4CDG A;  1KQ9 A;  2A5W A;  2HTJ A;  2QA4 I;  3HPH A;  1JKO C;  4XLC A;  3CJQ B;  1G2H A;  4R8H A;  1ZHF A;  5E20 A;  4JX4 A;  4L0Z B;  5HS9 A;  1U2W A;  1I1G A;  2R3S A;  4IX7 A;  3M1C A;  2Y48 A;  1TW2 A;  5B1B H;  1K78 B;  1E3P A;  4MLO A;  2EPF A;  2E36 A;  4KT6 A;  5FD5 A;  1W5T A;  3OV8 A;  1FEX A;  1X1D A;  3HHH A;  2OCC H;  2QEX I;  2WA0 A;  3LMM A;  2WWY A;  3SFZ A;  2JT1 A;  3RKX A;  3BOQ A;  1GUU A;  4LD5 A;  4EJV A;  3JRI A;  3CQZ J;  4ENJ A;  2Z2S B;  3HOW J;  4HDU A;  4BY1 J;  3ISP A;  5K5Q A;  2BW3 B;  2EA4 A;  1YJ9 I;  4BDZ A;  3NAU A;  4U0W A;  3S2D J;  2Y9Y A;  3ABM H;  3FKJ A;  1IXS B;  3GX4 X;  3PFI A;  3KP2 A;  2NVY J;  3HHG A;  3KP5 A;  3ZCO A;  3PSI A;  1K61 A;  2DQR A;  1KA8 A;  4M72 A;  3V4G A;  1SMY F;  1B1B A;  1OYY A;  3QAH A;  3RI4 A;  2OQR A;  1WCM J;  2OCE A;  3L00 A;  4BH9 A;  4HPQ A;  3E6D A;  4AIK A;  3L2Q A;  1VQ9 I;  3BTC A;  3GME A;  2CFO A;  3ABL H;  2DK5 A;  3HUG A;  1W7P D;  4BYY A;  4A93 J;  2VLA A;  1BC7 C;  2MLG A;  1BI3 A;  4XLA A;  3V8L A;  2JRM A;  1FP1 D;  3CUQ A;  3S1M J;  1Z6R A;  2LY1 A;  1Z1D A;  4KJZ A;  1I5Z A;  1BM9 A;  3TO9 A;  3D1N I;  1LUJ B;  2F6C A;  2P0W A;  4FX0 A;  2CV1 A;  5CVU A;  3WG9 A;  5FRN A;  5HLG A;  2HZT A;  2RVC A;  5EGO B;  1X4O A;  3FWE A;  3E5Q A;  5EG0 A;  2CQN A;  1J2X A;  3QU3 A;  3KIO A;  2LKX A;  2FUG 2;  3HIF A;  3S3O A;  4EJU A;  3E6B A;  5BPD A;  3LA3 A;  2HQ5 A;  1ZRC A;  3ZXS A;  2BHZ A;  1GVD A;  2YX4 A;  2ME6 A;  1FYL A;  4NB5 A;  4UVA A;  3K6G A;  2X4H A;  4ZDP A;  2O8K A;  1O3Q A;  1ACI A;  4XLP F;  5DYM A;  3OS1 A;  2DMN A;  1TQM A;  1D3Y A;  3CCY A;  3CZ6 A;  2KIF A;  1TBX A;  4XRS G;  2DOF A;  2GLO A;  4LIV A;  3AG3 H;  1UST A;  4C9Y A;  2FNP A;  4BAC A;  2BW3 A;  1R1V A;  2VJ4 A;  1T39 A;  2X1D A;  1TW3 A;  3HKZ N;  3RYR A;  1J5Y A;  1REP C;  1ENH A;  2Q1Z B;  2TRT A;  1DUX C;  4A3M J;  3G2B A;  3E6M A;  4XN0 A;  3LAP A;  4F91 B;  3HGY A;  2X6O A;  1FOK A;  1AKH B;  4LFU A;  1PP8 F;  2E34 A;  3I4M J;  3V42 A;  4M71 A;  3F6V A;  1FBQ A;  2O7O A;  4M3E A;  4A0X A;  2VBY A;  2K5C A;  2UZK A;  2ID6 A;  3AG4 H;  4A6D A;  3M8F A;  2VC0 A;  1UHM A;  5IP9 J;  1AWC A;  1FIA A;  1PYV A;  2LR8 A;  3S93 A;  1ON1 A;  3HOS A;  1VQO I;  2XPU A;  1F9N A;  4UV9 A;  2EB7 A;  2E1C A;  1WH5 A;  2D2W A;  3W6K B;  2EIL H;  2IAI A;  2JSP A;  3IRR A;  2JWT A;  5K7Z A;  4AYB N;  1A04 A;  2ISZ A;  5DM7 F;  2MFZ A;  3ZQF A;  1ZH5 A;  1I6H J;  3DFG A;  4XKC A;  4A3C J;  4BY7 J;  2Z16 A;  5J4V A;  5CVJ A;  2QKM B;  4MFE A;  1JKQ C;  4F52 A;  1UEL B;  1EJ9 A;  1VQL I;  4PFP A;  3E1S A;  4X1E A;  4IZZ A;  3OYM A;  1X3Z B;  2MAB A;  3I59 A;  3TBI A;  2VJJ A;  2JA6 J;  3GTQ J;  5J4Y A;  1G8X A;  2A6T A;  3JRD A;  1Z7U A;  2FX0 A;  2FE3 A;  3AFH A;  4BJT A;  5DEQ A;  4PUS A;  3WTY C;  3OYG A;  1XCB A;  2FRH A;  1YI2 I;  4UNO A;  5L3G A;  3PO2 J;  3VSL A;  3QYE A;  2ELH A;  1DP3 A;  2E1M C;  2NVU B;  4A3E J;  1JUM A;  5LLQ A;  2WV0 A;  2UXN A;  3O8G A;  2YS9 A;  4BAY A;  2J5O A;  4A0Z A;  1JUS A;  2OF7 A;  3BQY A;  1B72 B;  4HNU A;  2CS3 A;  4QIW N;  1KQ0 A;  4MO7 A;  2H6C A;  3BR1 A;  1ZR2 A;  2DA1 A;  2C6Y A;  1FSH A;  2L4A A;  2NS0 A;  4KDP A;  5JHF A;  3GYH X;  1AKH A;  3DTI A;  1QPI A;  3FMS A;  2DFI A;  2GXB A;  4IO9 F;  3ZN1 A;  3K4N A;  2XB0 X;  2LF7 A;  1BR4 A;  4MFD A;  3DKW A;  4P1W A;  4BKX A;  3S1N J;  1YYV A;  4JBA A;  2K9L A;  3DCF A;  2JA5 J;  1FOW A;  1OCZ H;  1CF7 A;  1ETX A;  4GDF A;  2M3A A;  2XAQ A;  2MLK A;  3KYL A;  1G3S A;  1AA7 A;  1S3J A;  2VQG A;  5H20 A;  2AQE A;  2KDO A;  2PJR A;  2X0L A;  2FQ3 A;  1UFM A;  3MKZ A;  1OR7 C;  1Y39 A;  4IHW A;  4M3B A;  2HOS A;  4OAY A;  1HKQ A;  4CHU A;  1W36 D;  2W48 A;  1Y6I A;  1TLH B;  5JFR A;  3GFI A;  4FHT A;  1Z77 A;  2O0Y A;  3DU6 A;  3CCL I;  5HLH A;  2VB6 A;  4B3X A;  3FM3 A;  3JTG A;  2HYJ A;  3CF2 A;  3QU6 A;  1W5C C;  2XRN A;  4RAF A;  3LOC A;  5CVV A;  1D0X A;  3WTW C;  3WTU C;  4BXU A;  2A6H F;  1I50 J;  3P5J A;  4LK0 F;  2CUJ A;  1ULY A;  1LFB A;  5ILU A;  2WTE A;  4XLE A;  3M4O J;  1D1C A;  3OS2 A;  3DPT A;  3F22 A;  5DCF A;  3S3M A;  1RUN A;  3AG2 H;  4QTR A;  3JRC A;  2OZU A;  5FFX A;  1RET A;  1SVO A;  4A3I J;  1MBH A;  4I02 A;  4F3Q A;  2L4M A;  1D0Y A;  2DT7 B;  2A3S A;  4A3G J;  4I0B A;  3P9C A;  3SZG A;  1ETY A;  3M3Y J;  3U1D A;  4N4N B;  1X2N A;  2D45 A;  4CH7 A;  1U5T C;  3LNQ A;  2DT6 A;  1HKT A;  1UG0 A;  4D7M A;  2K9M A;  1Z0X A;  5HDK A;  2VBW A;  1U8R A;  4QLC U;  2A68 F;  2PMU A;  2RNG A;  4E6K G;  2HQA A;  2HDW A;  3FBN B;  3WU0 A;  2JSC A;  1UZC A;  3HKZ A;  3SXY A;  2VL8 A;  1WJD A;  4RAY A;  4KIT B;  2AS5 F;  1ETW A;  1YHQ I;  2BXZ A;  3ERM A;  2Y31 A;  1IN6 A;  4I09 A;  3WOD F;  2PG4 A;  4U7D A;  2E2H J;  3RDI A;  2W1O A;  3SYT A;  1MD0 A;  2JVH A;  2W82 A;  5D4R A;  4XRF A;  2CQX A;  1TWF J;  4MIM A;  1IAW A;  2KP6 A;  2XPW A;  4RAG A;  2RDP A;  4D1Q A;  3J80 K;  1S72 I;  3PSF A;  5DUK A;  1K6O A;  5DDG A;  3ZQI A;  4EV0 A;  3JSP A;  5GPC A;  3CDL A;  1G59 A;  1MSF C;  1FZP B;  3R0J A;  1CGP A;  4P5O A;  1IDZ A;  3K2Z A;  2PMZ N;  2XGX A;  2GOX B;  3KE2 A;  4AYB A;  1J9I A;  2LLK A;  2V1X A;  2DO7 A;  3J7A O;  2OZ6 A;  2KZG A;  4AD9 A;  1XCV A;  3FXK A;  1IN5 A;  4NQW B;  2CUF A;  2V9V A;  3GTK J;  1SVL A;  3HG9 A;  5M3M J;  1D0Z A;  3F8B A;  1MIJ A;  3G1M A;  4BL0 B;  3W3C A;  4KUM A;  1MW7 A;  2EV0 A;  2ZJ2 A;  3K70 D;  2LRE A;  4RAZ A;  2L7Z A;  3CC2 I;  2YX7 A;  3OSF A;  1F36 A;  3MAJ A;  2KPM A;  2FOW A;  4PGG A;  1TWH J;  4BEH A;  1A31 A;  1Z67 A;  4F55 A;  3K2A A;  1SVM A;  1U8B A;  1I1S A;  2BYV E;  1T0F A;  2R7O A;  3HM5 A;  3GCM A;  4DZP A;  1G3T A;  3CCM I;  1OCC H;  3HB9 A;  2DCE A;  3LSI A;  1TT5 B;  3QPT A;  4GYI A;  3GO5 A;  3DF8 A;  3WG7 H;  1R1U A;  4YFK F;  4G8X A;  3PFY A;  1SD5 A;  3DLA A;  5FJ8 J;  2ICW G;  5KNL A;  3RQ4 A;  1XX5 A;  4NC7 A;  4EMS A;  3M8E A;  5FGM A;  1OMI A;  3SDG A;  5K1Y A;  2QF7 A;  2QQA A;  2FOK A;  1H9T A;  3LFU A;  2F5D A;  5E3N A;  3CMA I;  4M3D A;  3ABK H;  2PN6 A;  3A0B C;  4NHJ A;  4IOA F;  5J1U A;  3ZQC A;  3H1C A;  1RRJ A;  3IWF A;  2XV4 S;  2HKX A;  3M07 A;  1MGT A;  4YIF A;  1K83 J;  1B9M A;  3CCJ I;  4A5M A;  5ERI A;  3VYT B;  5E1X A;  1WGX A;  5HOD A;  2E71 A;  2L9V A;  2EIK H;  2JA8 J;  2GIV A;  2DA2 A;  2DTR A;  3BG5 A;  3CCV I;  3OOP A;  5HLT A;  3VYR B;  3CCE I;  4E4H A;  5HNF A;  3KLN A;  4BE1 A;  1E3O C;  5M3F J;  2WB1 N;  1ZGA A;  1XGS A;  5F6F A;  4YFX F;  2R93 J;  3KP7 A;  3OY9 A;  3CLO A;  5LRR A;  1WJE A;  4PJM A;  4E7S A;  3CCU I;  4LG3 A;  2QGU A;  5CJ9 A;  4BQN A;  3H36 A;  2EBI A;  3E5X A;  4CUG A;  2HOA A;  2CQ7 A;  3PNT A;  1J7K A;  3IL2 A;  3CMY A;  2VE9 A;  4IHT A;  2IBD A;  4YG2 F;  1V5E A;  3M1E A;  1ZR4 A;  3FX3 A;  3OYB A;  2NXN B;  2VXZ A;  4BUP A;  4DYQ A;  3KZZ A;  1VQP I;  4OU0 A;  3IKV A;  1IXC A;  5BNG A;  5EYR A;  4RB1 A;  3BCA A;  2L9S A;  2E5Z A;  3QOE A;  5E17 F;  1O7L A;  4BXX J;  2B7E A;  1TT0 A;  2A6E F;  4NUB A;  3OIP A;  4EM0 B;  2V9K A;  2A61 A;  4L9J A;  3LAJ A;  4II2 A;  3FZV A;  2F4I A;  2FD5 A;  2GA1 A;  2NYX A;  5LD2 C;  1ZRF A;  5ICF A;  1W36 C;  4P55 A;  2M45 A;  1J0R A;  4M9S A;  1XGO A;  4RGX A;  1PP7 U;  1EH7 A;  2P6T A;  5LGN A;  2M9H A;  1XS9 A;  3K4B A;  5LFA A;  5BOX A;  1AHD P;  3F9K A;  2HDC A;  2HYG D;  1O3S A;  1X19 A;  2Y69 H;  2YSR A;  1I3Q J;  2IRF G;  1IDY A;  3IC7 A;  1SC7 A;  3FKI J;  1DP7 P;  1YTY A;  2FNA A;  2E7X A;  3ZQH A;  3FIS A;  4ZYH A;  5K5O A;  2VKV A;  2Y2Z A;  3G3Z A;  1B8I B;  4C3H J;  3GLL A;  4CIC A;  3G4S I;  5IOZ A;  2XB5 A;  4ZDL A;  2XSJ C;  1DPU A;  2M0C A;  2Y0M A;  3RPU D;  3DP7 A;  4U7B A;  3Q9S A;  3MQ0 A;  3KFW X;  5LHH A;  1B9N A;  2PMZ A;  2VJI A;  4M3G A;  3GFJ A;  2VKD A;  4DJA A;  2VN2 A;  2AQF A;  1JJ6 C;  1FOX A;  2HOT A;  5FLX Z;  3REO A;  1G3Y A;  2XHK A;  4EM2 A;  2BGC A;  2M4K A;  4E7I A;  1MMN A;  2X6X A;  2E1O A;  2ME0 A;  3BPX A;  1BR2 A;  4OIQ F;  1X1B A;  1R1T A;  2KIM A;  2FBK A;  2UUZ A;  3BJ6 A;  1ZK8 A;  5F04 A;  4NBQ A;  2WY8 Q;  5J1Y A;  1U9N A;  2XDV A;  1MH4 A;  4B8X A;  2PFB A;  4OMY A;  4DBR A;  4XKV A;  1NK3 P;  1RC9 A;  1TTY A;  3OYJ A;  2A05 A;  4O6J A;  2Z3Y A;  2FBI A;  1W7P A;  2DDA A;  1SFK A;  2R5Y A;  1NHA A;  4CCN A;  3AAF A;  2IEK A;  2NNN A;  4HQE A;  3M7G A;  3MZ8 A;  4RM3 A;  4OMZ A;  4JX6 A;  5KK1 A;  2DMQ A;  2ZXI A;  5IPA A;  1UB9 A;  4IF4 A;  2HR3 A;  3D5L A;  2B63 J;  5EZH A;  2QSF X;  2XSD C;  3B02 A;  1Y8Q B;  4BU2 A;  1ZG5 A;  1WJC A;  4F93 B;  1WSU A;  2J5P A;  2KIS A;  3M9A A;  2CG4 A;  2GZW A;  4LK1 F;  2ZXJ A;  2LG4 A;  4Z6Y A;  1KZH A;  4XMY A;  3LSJ A;  1B8I A;  5J8C A;  4A3K J;  1K7A A;  2VE8 A;  3FBI B;  2ZFW A;  5JLX A;  3DV8 A;  4LIU A;  2CMP A;  3OOU A;  4M9Z A;  2YPR A;  3BY6 A;  4CZC A;  2CU7 A;  4GO1 A;  3CUQ B;  2GXA A;  3T1B A;  2L5Q A;  3K70 C;  3BR5 A;  2CUZ A;  1T33 A;  3GTO J;  3MZY A;  3ZMU A;  1E0E A;  2M7B A;  3BCB A;  1BW5 A;  3IP4 B;  4D5F A;  3ZMT A;  2EIM H;  4KIS A;  2ZC2 A;  2RAE A;  3GF2 A;  3FF5 A;  3FHN A;  2STW A;  4A2U A;  1POG A;  1YLF A;  2JTV A;  5AON A;  3DBR B;  2ZNY A;  1B59 A;  2A69 F;  2L0K A;  4XLH A;  4CSW A;  3KZI C;  9ANT A;  2OV7 A;  3ECH A;  4BJ6 C;  1ZEL A;  3F3X A;  1XC5 A;  1DGW Y;  2QM3 A;  3EUH A;  2IS2 A;  1MMD A;  4RB0 A;  5IP6 A;  3U9G A;  1XGN A;  4IQ4 A;  2X48 A;  3KP3 A;  5FLM J;  4UV8 A;  1RR7 A;  2DMP A;  1Z3Y A;  2ZME C;  4OOI A;  3OIO A;  3QYF A;  2LP0 A;  2QEN A;  3BZC A;  3ULQ B;  2DPU A;  2X85 A;  4XON A;  5J1R A;  5AIQ A;  5D4S A;  1F1Z A;  4EM1 A;  2Y0S N;  2GAU A;  4HF2 A;  4C30 A;  2XKO A;  3L2C A;  1F5T A;  3Q0V A;  1LEB A;  3J7Y J;  4HV5 A;  3K4K A;  5E3L A;  1L3L A;  4ZYA A;  1D5V A;  2L54 A;  2MG4 A;  2UXX A;  4B4C A;  2V6E A;  4Q4Z F;  3BTJ A;  4K2E A;  3OYN A;  1QBJ A;  4MTD A;  4EJT A;  1VF9 A;  2E2J J;  2ZJR F;  1J75 A;  3LWF A;  1SD7 A;  4EVI A;  2KQR A;  1LE8 A;  2V1N A;  3KP4 A;  2EQR A;  1MNE A;  2IGO A;  1QVT A;  1ZG3 A;  2MH9 A;  5FKN A;  1JT6 A;  4L5J A;  4ITV A;  1DU0 A;  1D8J A;  2XUB A;  3C2H A;  2LKP A;  2Q2E A;  4NC6 A;  2ETH A;  5BPI A;  1BJA A;  4I76 A;  4HYE A;  3J80 Z;  1VQ8 I;  1FTZ A;  2EZL A;  1WWX A;  3BP8 A;  3H0G J;  3GTP J;  4IHY A;  4ON0 A;  4E7Z A;  4LMY A;  2P6S A;  2TDX A;  3SHF A;  4OWR B;  3Q9V A;  5EDN A;  3ZMZ A;  1VI0 A;  3IRQ A;  3KP6 A;  1SAN A;  4WXD A;  3I59 B;  3QOP A;  1P2F A;  2LTP A;  3WGG A;  4BBS J;  4PJL A;  2STT A;  3ZPL A;  2AHQ A;  1V55 H;  4A3D J;  1SMT A;  1ETO A;  2R7V A;  5K7H A;  1M1E B;  1CQT A;  2DFE A;  2DOD A;  4BS9 A;  1E17 A;  3GZ5 A;  1VQ6 I;  3IH4 A;  1MMS A;  4M6X A;  2V4J C;  3ZQL A;  4DNC A;  4G7Z F;  1FP2 A;  1P7J A;  2L2O A;  1QQI A;  2K85 A;  1WKM A;  3IUO A;  2EIJ H;  3DTE A;  1TL8 A;  2IPQ X;  3HRM A;  1SD4 A;  1BI1 A;  1O7F A;  3BRO A;  5M5X J;  3BR3 A;  3RSN A;  1XTA A;  4O3M A;  5IT9 Z;  1Y0U A;  5GAG J;  3S14 J;  2JRT A;  1FYM A;  2BVL A;  3B6A A;  4CA0 A;  4ZYG A;  2PMH A;  2RC4 A;  5D8L B;  5ICC A;  1LPQ A;  2DYS H;  4ENN A;  1GVJ A;  3RZO J;  1OIS A;  1ZAO A;  1CF7 B;  1HKS A;  5AIP A;  4HSR A;  1EV7 A;  2LYC A;  4XM3 A;  1ETK A;  4B44 A;  1JJ8 C;  2DOE A;  2KKO A;  3JSO A;  5TGT A;  1IRZ A;  2OA4 A;  1XPX A;  3OYI A;  1PJR A;  4EAT A;  2PJR B;  3RKQ A;  5GTI C;  3G1L A;  1OYI A;  3K1P A;  5HDG A;  5FRM A;  4V2G A;  2L9R A;  1F43 A;  1QHH D;  1T98 A;  3IV5 A;  1AU7 A;  3DPU A;  2QUF A;  1XDU A;  3L2W A;  2FA5 A;  4GGG A;  1GLN A;  4ZYD A;  4Z2Y A;  5TRD A;  1D5Y A;  5IP7 J;  1ODD A;  2KMU A;  2GWR A;  1H88 C;  4IEJ A;  3A03 A;  2M87 A;  1V4R A;  5FKL A;  3S17 J;  2JK3 A;  4ZDO A;  2HEO A;  3HRS A;  1UHW A;  3WHC A;  4G94 A;  3SQN A;  5FLX K;  1FPQ A;  4E7J A;  4L18 B;  3LA7 A;  3FHZ A;  3FXJ A;  2FMY A;  1FJL A;  3CD6 I;  1VQ5 I;  2HYF A;  2KRF A;  4FTH A;  2FQ4 A;  5LBQ A;  1OCT C;  2X9D A;  2R5Z A;  5FFZ A;  1MBE A;  2Q0O A;  2DXI A;  2CGP A;  1Z05 A;  1RNL A;  1ETQ A;  2MYS A;  4O5V A;  5JHU A;  2M4G A;  3I53 A;  1JE8 A;  4BQQ A;  2X51 A;  1WJ5 A;  2ESH A;  3W2A A;  1FTT A;  3I9V 2;  4XID A;  5CKT A;  4HG2 A;  3GZN B;  5ICE A;  4LG0 B;  2LOO A;  2RQP A;  2CFX A;  3BT9 A;  3MCZ A;  2RN7 A;  2KDZ A;  2E60 A;  2IJL A;  1W4M A;  3WTX C;  2O6G E;  4MQ9 F;  4L9T A;  4ZYE A;  2JMW A;  2Y0S A;  3NAR A;  1T95 A;  3FM5 A;  3OS0 A;  4I7H A;  2ZCW A;  3H3V K;  1HLV A;  3K69 A;  1OCP A;  5F0C A;  2I5U A;  4ABZ A;  4YII A;  3E7L A;  5LEJ A;  4BBR J;  1HDP A;  1TP4 A;  2QKL B;  3S1Q J;  3HSR A;  2K4B A;  3KX2 A;  5FO5 A;  2GOM A;  1P7I A;  2NS7 A;  1QNT A;  4IPA A;  2D1H A;  2QLZ A;  2ZBK A;  4EJW A;  2F5E A;  2AXT C;  2IA0 A;  3L1P A;  2JUC A;  3HSF A;  2M34 A;  3CUO A;  4RLF A;  3WTZ A;  3FXR A;  2E19 A;  4C3J J;  4Y13 A;  4CXF A;  2VPL A;  2VC1 A;  2XC7 A;  3ABU A;  4P9F A;  4W97 A;  3SZP A;  3PJR A;  5HS8 A;  3SJM A;  4JOM A;  4Q5S F;  5FLV A;  2R7Q A;  1KYZ A;  5CQG A;  4D0P A;  4U0Y A;  1BA5 A;  4UHT A;  3N4M A;  3VWB A;  2DAO A;  3IHU A;  2ZME A;  2RQQ A;  2OQG A;  2GXG A;  4PJ0 C;  4RA2 A;  1QA6 A;  4BQO A;  3CME I;  2NVX J;  2HQN A;  5A2Q Z;  2DTZ A;  4EGY A;  3PL8 A;  1R5G A;  2IVM A;  2K7L A;  3LSH A;  5EEA A;  4UB8 C;  4LG0 A;  1H89 C;  4KIB A;  2XKP A;  3W2V A;  5H6Q A;  4IRH A;  2BY2 A;  3JRG A;  2DFF A;  2IGN A;  2VT2 A;  3QPS A;  3SEQ A;  4BEH B;  4FCY A;  1NK2 P;  2DI3 A;  1UAA A;  1MKM A;  3HL2 A;  4ETS A;  4JK1 X;  1ZG1 A;  1BOA A;  4HW0 A;  5DCM A;  3BG9 A;  3K7A J;  1APL C;  2LBF A;  2HS5 A;  2V26 A;  3ZN0 A;  2JVG A;  5CLS A;  2VIX A;  2LC2 A;  3G71 I;  3HXL A;  5F64 A;  2P7C B;  1GT0 C;  2CSO A;  5M5Y J;  2B9S A;  1XN7 A;  3K4L A;  1MMA A;  3EYI A;  3HOV J;  3GTM J;  3BR0 A;  3BQZ A;  4OIR F;  2EZI A;  1Y8R B;  1R4M B;  3JCU C;  3JRB A;  3S8P A;  4Y3O A;  1X1C A;  2YR2 A;  4KYW A;  2IA2 A;  3R4K A;  4B09 A;  4ESF A;  3BPV A;  2HKO A;  3W2W A;  2L7K A;  5J47 A;  3VPR A;  1LEA A;  5D6F A;  3KYD B;  2PEX A;  3ZQQ A;  2WV1 A;  1ZYR F;  4YEJ A;  5DD8 A;  1SFU A;  4A5N A;  3JW4 A;  4ZC3 A;  1Z6T A;  4WF2 A;  4LLN A;  1OKR A;  1Q1V A;  3J7Z I;  1UCR A;  2PI0 A;  5H6R A;  2P81 A;  2KLO A;  3HOU J;  2E1M B;  2WAQ N;  4XSX F;  2LF8 A;  1TQI A;  4C2T A;  3C7J A;  3CJN A;  5ILS A;  1BN5 A;  4I99 C;  1LDJ A;  1HBX G;  2WY7 Q;  4G12 A;  3O6B B;  1S7A A;  2VOD A;  2ZXH A;  3W6J B;  2DK8 A;  5C3E J;  3KEY A;  2V7F A;  3H9G A;  4XOR A;  1S6L A;  2H09 A;  3GZ6 A;  1EF4 A;  2M0M A;  1USS A;  2XPV A;  1GDT A;  1V5F A;  5KCM A;  3A02 A;  4PJJ A;  4E7H A;  1S8N A;  3MKL A;  3VDX A;  4E7L A;  2W85 A;  1YW7 A;  4XSZ F;  2HVS A;  2EFP A;  5IT9 K;  2ECB A;  2P5K A;  3D0S A;  2RGV A;  5D6E A;  2KJC A;  4G7H F;  2XGE A;  2FML A;  4BHB A;  1TQP A;  4RB3 C;  2CO5 A;  2F5C A;  5KVR A;  3T0Y A;  1HSJ A;  2X1E A;  4A3J J;  5L3B A;  4PK4 A;  1UJ8 A;  2HZD A;  5FKK A;  1N78 A;  2LFB A;  5L3D A;  3E0J B;  3WTT C;  2K27 A;  4L5I A;  3TOB A;  1R22 A;  1VQK I;  1Y1V J;  2HI3 A;  3F8C A;  5LGU A;  4HX8 A;  4HNV A;  3BZ6 A;  5FB2 A;  2R7W A;  4HDV A;  3HSE A;  4HF1 A;  3G1O A;  1Y1W J;  2QYO A;  1WQ2 A;  4UUV A;  1KU2 A;  3HOX J;  2BV6 A;  3F72 A;  1QHG A;  3EQL F;  2GM4 A;  4IRG A;  3KLO A;  2CYY A;  5JVT A;  2QBY B;  1MJA A;  3C3W A;  3F0C A;  1XSV A;  2PX9 A;  3AKZ A;  1S7O A;  4RGS A;  1XD7 A;  2VQC A;  2AO9 A;  4S0H B;  3VEP A;  2BY3 A;  3ROU A;  3HOY J;  1QZE A;  5LHG A;  3WU2 C;  3G6E I;  2IGK A;  1T8I A;  5F08 A;  3AG1 H;  3DEU A;  2M8E A;  1KU3 A;  1MH3 A;  3CLQ A;  4PZJ A;  3F8N A;  4BGD A;  3DPL C;  4HNT A;  4CZZ A;  3OL4 A;  1BR1 A;  1U5T B;  3JR9 A;  4KNY A;  3GTG J;  2OJE D;  1WPK A;  2AXL A;  3PUB A;  1KU7 A;  5F27 A;  5IYC J;  3BC8 A;  4ENK A;  1ZLK A;  2W57 A;  3NRV A;  1HW5 A;  2FXA A;  2CV0 A;  3GFL A;  3OMY A;  2L3D A;  3UNG C;  4F7Z A;  4XRM A;  1NTC A;  1QVU A;  2WAE A;  2JJ7 A;  3TDZ C;  3LFK A;  4EQQ A;  3CUQ C;  2XGD A;  2R92 J;  1ZTR A;  2E35 A;  2DYR H;  4A6E A;  2DDB A;  2GA2 A;  3H5R A;  5LGT A;  1PUE E;  1MBJ A;  4RGU A;  1V3F A;  2DLL A;  2QQ9 A;  2CUE A;  2WC2 A;  3KEQ A;  3KYC B;  2IS6 A;  1Z3X A;  2DA4 A;  1QRY A;  4HLY A;  1OR7 A;  4V2F A;  1W7P B;  4HX7 A;  2ZKZ A;  2R5Y B;  2F2E A;  3FXQ A;  2HVR A;  3L2V A;  1G6N A;  2ADU A;  1X58 A;  3PNV A;  1ON2 A;  5D8K B;  5HVQ C;  4RS8 A;  4H0E A;  2KJB A;  3QQA A;  1SAU A;  2ID3 A;  3GXO A;  2XAF A;  3C2B A;  2EWN A;  3JTH A;  1YOV B;  3TGN A;  4A0Y A;  1FX7 A;  2W00 A;  2F48 A;  4AVP A;  2M7A A;  2BY0 A;  2XVC A;  5FKM A;  3C1D A;  4XLN F;  3CDH A;  5DD4 A;  3VFZ A;  2WBM A;  3L2R A;  2LMD A;  1XDS A;  1VQ4 I;  1H0M A;  2EK5 A;  2IA1 A;  4C3I J;  3TED A;  3EPZ A;  1VTN C;  4AID A;  4JQF A;  2QBY A;  3FXU A;  2VXD A;  1HST A;  2HU9 A;  5DS9 A;  2LK2 A;  4XNF A;  1UHS A;  1U3E M;  2ISY A;  2NOJ B;  2QCO A;  4UXN A;  2XAH A;  3HC7 A;  2XRO A;  5IT3 A;  1OFC X;  4HX4 A;  1R71 A;  4RDU A;  2K9S A;  2O8X A;  3V7S A;  1RKW A;  4II3 A;  2JPC A;  4LLG F;  1PDN C;  1Q1H A;  1WRJ A;  2L01 A;  3LL7 A;  4AWX B;  5HDN A;  1XB4 A;  3LSG A;  3V7R A;  4KT5 C;  4I01 A;  1U5T A;  4YIR X;  4M6V A;  4ZTF A;  1IRF A;  4S04 A;  2JA2 A;  3WE2 A;  1KYW A;  1LJ9 A;  3F8M A;  5ICG A;  4N4O B;  1KON A;  1VND A;  4IHS A;  3I56 I;  2MSY A;  2JPB A;  2O5R A;  3QP5 A;  5A2Q K;  4FIS A;  2FJ1 A;  5BQT A;  2P5V A;  3DLL F;  4WK8 F;  2LH9 A;  2WAQ A;  2Y75 A;  4CCK A;  1YIT I;  4M3F A;  5FRO A;  3WTS C;  3IAS 2;  4AC0 A;  2CV2 A;  2KRH A;  1XMX A;  2DPD A;  3OYH A;  3RKY A;  5IY5 H;  4D9J A;  4A3F J;  2A5Y B;  1GV2 A;  4CYD A;  3LQR A;  2MGQ A;  1RPW A;  1FWZ A;  4CCL A;  3FMQ A;  3CC4 I;  1MSE C;  2EFO A;  1R5I D;  3W6V A;  4CYC A;  3BDD A;  1YE9 A;  5JVG F;  1BL0 A;  3DU5 A;  2RKH A;  1H9G A;  1WJB A;  3I64 A;  2EIN H;  2K3F A;  3WGI A;  1FYK A;  2F5F A;  2MC4 A;  2GQQ A;  2EV6 A;  1HW2 A;  2LRD A;  4MHG A;  4OIN F;  4IOC F;  1RUO A;  4BQA A;  3FK6 A;  1FBU A;  2RNJ A;  1XMA A;  1YIO A;  2O3F A;  3BG7 A;  4MTE A;  4BNC A;  4BHC A;  4IHV A;  3HGG A;  1TWG J;  3MWM A;  2NS8 A;  4MNU A;  3HEF A;  3K1N A;  5KAI C;  2W24 A;  1EA3 A;  4HST A;  1LE8 B;  2QSH X;  1ZGW A;  3T5X A;  2VJ5 A;  3R60 A;  5GAD J;  3KCC A;  1SAX A;  1WH7 A;  2R7S A;  4C2U A;  4PGH A;  1EKE A;  2VON A;  4HBL A;  4IXA A;  3OL3 A;  2Q2E B;  3DXJ F;  4G6T B;  4P9U A;  1MJ9 A;  3ZMD A;  4LGW A;  2OTJ I;  3G73 A;  4GRI A;  3GUD A;  1LKX A;  3O8H A;  4G6D A;  2KIQ A;  1E3H A;  4KIF A;  4FT8 A;  4U87 A;  2CW0 F;  3CC7 I;  2FBH A;  1IN8 A;  3ONQ A;  1HQC A;  3TP3 A;  1LDD A;  3OSG A;  3RQI A;  5D5X B;  3J81 K;  3AL0 B;  1FLI A;  2HOE A;  1V54 H;  3O2P E;  5D5U B;  3ZGK A;  2DA7 A;  3P7N A;  1K4T A;  2LKS A;  2KFD A;  1YRN A;  3HDD A;  1P6R A;  2V79 A;  5J8F A;  5JR3 A;  4Y17 A;  2LNB A;  2VBZ A;  5LRS A;  5TJJ A;  2WB1 A;  2LD5 A;  4BE2 A;  1R58 A;  1BIA A;  1FMV A;  3I54 A;  1MNM C;  2XGC A;  4YFN F;  1ZN2 A;  3HPG A;  4XQF A;  1DDN A;  3UR3 C;  5EEG A;  1VFC A;  1BI0 A;  1FC3 A;  3HOT A;  4XIC A;  3S16 J;  4RLQ A;  2V6C A;  2DBB A;  2HQR A;  4LLL A;  4F92 B;  2E2I J;  1PUF A;  2COB A;  3A4C A;  4XL9 A;  3N97 A;  1NG6 A;  1S7E A;  2VOO A;  5CVR A;  2R7F A;  3K0L A;  4PSX A;  2BE5 F;  2BXY A;  2CJJ A;  2W84 A;  2BZT A;  3SEZ A;  4J01 A;  1RES A;  2ZO4 A;  3OYL A;  1FSE A;  3H5A A;  4ZZD A;  3IH3 A;  4OAZ A;  1MND A;  3JRH A;  1YJW I;  3GWZ A;  1Y0N A;  3TP0 A;  3WTV C;  5EF6 A;  5C4X J;  4UUS A;  3V7C A;  2DN0 A;  2N8G A;  4RBO A;  1WI9 A;  3L09 A;  1I6X A;  1NH3 A;  1YG2 A;  2XAJ A;  5B5E C;  1ERD A;  2K4J A;  3U21 A;  3EUK L;  2IGM A;  4D5C A;  2VAS A;  1IF1 A;  4TV7 A;  2TCT A;  2UWM A;  5GTH C;  2Z5U A;  3Q3S A;  1PVE A;  2CRG A;  3S3N A;  1WHU A;  1XGM A;  2HWV A;  1ETV A;  2MD5 A;  4IKF A;  1TWC J;  4IL6 C;  1JHH A;  3GVA A;  3HJE A;  4KN7 X;  2P8T A;  2YU3 A;  3ECO A;  4W1U A;  3TW6 A;  3BR6 A;  3SDB A;  4XOT A;  3MD2 A;  4QWQ A;  1K6Y A;  1MBG A;  4QSH A;  3WE3 A;  3NQO A;  3JRE A;  1O3R A;  5EJC A;  2B0L A;  4X0G A;  1R49 A;  2Q8K A;  3TQN A;  4G9Y A;  1BIB A;  2R5Z B;  1JT0 A;  4XK4 A;  4QPO A;  2ZJP F;  3OYA A; 
#chains in the Genus database with same CATH homology
 2NRA C;  2VOP A;  1U78 A;  2V1D A;  3LA2 A;  4EGZ A;  1K78 A;  4PCQ A;  4KFC A;  1FY7 A;  3KZY A;  2MH2 A;  4G7O F;  3K1M A;  1ZRE A;  3COA C;  2FSW A;  4UVB A;  2FF4 A;  3GEZ A;  2COM A;  1YO5 C;  1B4A A;  3RIR A;  3TKY A;  5BMZ A;  2A07 F;  4CO8 A;  2HTS A;  4R79 A;  2Z33 A;  1QPM A;  3RJP A;  3RKW A;  4KMF A;  1MZB A;  3F23 A;  2Z9O A;  2QZ8 A;  2P5L C;  3R0A A;  3RPQ A;  3ZQ7 A;  2VT3 A;  1Z91 A;  4GCV A;  3T8T A;  1BC8 C;  3JAM K;  3TDU C;  1LQ1 A;  1RI7 A;  1JGS A;  4GXO A;  3BJA A;  4M74 A;  2XAG A;  5JI6 A;  3EDP A;  2D1V A;  4KN4 X;  1EH8 A;  3VOD A;  5F1R A;  2O61 A;  1IUY A;  2ZME B;  2ZNZ A;  4IJA A;  1XSD A;  2RV8 A;  1F4K A;  1X3U A;  3QRF F;  1KQ8 A;  5DUI A;  2V1U A;  4HAM A;  4PDK A;  3F6O A;  5D5W B;  3HTS B;  1HW1 A;  3GFM A;  2EFN A;  2DU9 A;  2OAZ A;  1QO0 D;  5E8G A;  4HA8 A;  4AIH A;  3NEU A;  5E1Z B;  1ZRD A;  4MGR A;  4P96 A;  5DCM B;  4RB2 C;  1BBY A;  3LST A;  1U6G A;  1IRG A;  3EET A;  5EEH A;  3CO7 C;  4KA4 A;  3LQQ A;  5HOO A;  4WX9 A;  1D8K A;  1OPC A;  1YW9 A;  1TNT A;  3TO7 A;  4KIG A;  1SFE A;  4I2O A;  4CGZ A;  4LB5 A;  2IW5 A;  1R5H A;  3SZT A;  2MA3 A;  3R61 A;  4R1H A;  5CVI A;  3HRU A;  3Q5F A;  4FX4 A;  1GHC A;  1P4A A;  1J59 A;  5L3E A;  3V8K A;  2G7H A;  1E2X A;  1ZLJ A;  3E3V A;  3E6C C;  4U0V A;  1SD6 A;  4OIP F;  1IW7 F;  1IZ1 A;  1P92 A;  3PQJ A;  2P7V B;  4MEY F;  2MBF A;  3KET A;  1O57 A;  4GYG A;  4IRI A;  1ZGJ A;  4ENM A;  4XBF A;  1OYW A;  4HOB A;  1XSX A;  4HF0 A;  2FU4 A;  2OBP A;  2M30 A;  3ZMS A;  2DQL A;  4UVC A;  2LSO A;  4LJZ F;  2EA2 A;  3I5U A;  5DV5 A;  1C0W A;  2XIG A;  3EYY A;  4OIO F;  3RYP A;  3ML6 A;  1LB2 A;  4WXH A;  4HQM A;  1LNW A;  4L0Y B;  3F8F A;  2MC3 A;  2PLY A;  3ERE D;  2O03 A;  2EJR A;  4KMU X;  2HFH A;  3J81 Z;  3I4P A;  3L7W A;  1P4W A;  4ESJ A;  4Q48 A;  2QWW A;  5L3F A;  1JHF A;  4L9V A;  3MZH A;  1G3W A;  1P4X A;  2NNY A;  1IXR C;  4M73 A;  4U88 A;  2EFQ A;  4WWC A;  1STZ A;  3QPH A;  3E5U A;  4Q47 A;  3R6S A;  3RPU A;  2BEO A;  2LDU A;  1S29 A;  1BI2 A;  3E97 A;  2ESN A;  5J6X A;  1O3T A;  5LHI A;  4L9N A;  3FMR A;  1R7J A;  2QQB A;  5CYV A;  2EFW A;  3VOE A;  4E70 A;  2M5W A;  1HXD A;  1TNS A;  4KIC A;  3BJO A;  3V8J A;  4ESB A;  1T38 A;  1SFX A;  1Z9C A;  1ONV A;  2H6B A;  2ACJ A;  1R36 A;  4N9H A;  3KEO A;  1KU9 A;  4NQW A;  1W5S A;  4HZF A;  1FT9 A;  3F21 A;  2IP2 A;  1KGS A;  3ZMV A;  1R00 A;  1B6A A;  2CWE A;  1AOY A;  1T2K A;  3I58 A;  2G9W A;  3MFK A;  5HS7 A;  1LDK B;  1MJB A;  3ZP5 A;  4M6Y A;  3VB2 A;  1LVA A;  1QZZ A;  4MEX F;  2FEZ A;  5LEK A;  3ABT A;  4N0B A;  5FD6 A;  5ED4 A;  4ASN A;  3CTA A;  3CO6 C;  1QZY A;  1DPR A;  1YQA A;  4I98 B;  4WXC A;  4DQ2 A;  3GW2 A;  4EJO A;  2HGC A;  2L02 A;  4RGR A;  4S05 A;  2G7U A;  1YW8 A;  4WCG A;  5E1W A;  4Y15 A;  3WGH A;  3HTU A;  1G4D A;  5D5V B;  4IVN A;  3K9T A;  2KIU A;  3C18 A;  4MQV A;  1GXQ A;  2M1B A;  5K5R A;  5BS6 A;  3JAM Z;  3ELK A;  2R7D A;  2E1N A;  1GXP A;  1YS7 A;  1YFH A;  3T8R A;  1MDM B;  3O3K A;  3L9F A;  3BWG A;  2H27 A;  1JXS A;  1RIO H;  1L0O C;  2NAZ A;  2OU2 A;  3GLX A;  4N9I A;  5HLI A;  2OD5 A;  1FNN A;  3H3U A;  2E7W A;  1IN7 A;  3HYI A;  3S2W A;  4BHP A;  2QVO A;  2BBY A;  3IKT A;  4AIJ A;  2PBI A;  3TOA A;  2K02 A;  2Z99 A;  5E18 F;  3WU1 B;  3U2R A;  3RTR A;  5L3C A;  5E8I A;  3H3Z A;  3MEX A;  4HV6 A;  2H94 A;  1YS6 A;  2P4W A;  1XMK A;  2XAS A;  1R23 A;  2EV5 A;  4I0A A;  4G6Q A;  3DQV C;  2PJP A;  3HRT A;  3PQK A;  2IT0 A;  3TO6 A;  1T6S A;  1EH6 A;  1ZAR A;  1I27 A;  3I0T A;  2PQ8 A;  2K86 A;  3B73 A;  2CQK A;  4ZH4 F;  4HLX A;  4LB6 B;  2DT5 A;  3QP6 A;  1IN4 A;  1QGP A;  1FBS A;  2DW4 A;  3P9K A;  3I71 A;  1MDM A;  4ZZL A;  3P9I A;  1RZ4 A;  6PAX A;  4M9X A;  2JZY A;  3H92 A;  1K79 A;  2W25 A;  3IWZ A;  5ILV A;  4A12 A;  2VBX A;  4CDG A;  1KQ9 A;  2HTJ A;  4R8H A;  1ZHF A;  5E20 A;  4L0Z B;  5HS9 A;  1U2W A;  1I1G A;  2R3S A;  2Y48 A;  1TW2 A;  1K78 B;  5FD5 A;  1W5T A;  3OV8 A;  3HHH A;  2WWY A;  3SFZ A;  2JT1 A;  3RKX A;  3BOQ A;  4LD5 A;  4EJV A;  4ENJ A;  4HDU A;  3ISP A;  5K5Q A;  2EA4 A;  4U0W A;  1IXS B;  3GX4 X;  3PFI A;  3KP2 A;  3HHG A;  3KP5 A;  2DQR A;  1KA8 A;  4M72 A;  3V4G A;  1SMY F;  1B1B A;  1OYY A;  3QAH A;  3RI4 A;  2OQR A;  3L00 A;  4BH9 A;  3E6D A;  4AIK A;  2DK5 A;  3HUG A;  1W7P D;  4BYY A;  1BC7 C;  2MLG A;  1BI3 A;  3V8L A;  1FP1 D;  3CUQ A;  1Z6R A;  1Z1D A;  1I5Z A;  1BM9 A;  3TO9 A;  4FX0 A;  5CVU A;  3WG9 A;  5HLG A;  2HZT A;  2RVC A;  3FWE A;  3E5Q A;  1J2X A;  3QU3 A;  3HIF A;  4EJU A;  3E6B A;  5BPD A;  3LA3 A;  1ZRC A;  2YX4 A;  1FYL A;  4NB5 A;  4UVA A;  2X4H A;  1O3Q A;  4XLP F;  5DYM A;  1TQM A;  1D3Y A;  2KIF A;  1TBX A;  1UST A;  2FNP A;  1T39 A;  1R1V A;  1REP C;  1TW3 A;  3RYR A;  1J5Y A;  1DUX C;  3E6M A;  3LAP A;  1FOK A;  4LFU A;  1PP8 F;  4M71 A;  3F6V A;  1FBQ A;  4A0X A;  2VBY A;  2UZK A;  4A6D A;  3M8F A;  2VC0 A;  1UHM A;  1AWC A;  1ON1 A;  3HOS A;  1F9N A;  4UV9 A;  2EB7 A;  2E1C A;  2D2W A;  3W6K B;  3IRR A;  1A04 A;  2ISZ A;  1ZH5 A;  3DFG A;  5CVJ A;  3I59 A;  1Z7U A;  2FE3 A;  5DEQ A;  3WTY C;  1XCB A;  2FRH A;  4UNO A;  5L3G A;  2ELH A;  5LLQ A;  2WV0 A;  2UXN A;  4BAY A;  2J5O A;  4A0Z A;  1KQ0 A;  2H6C A;  1FSH A;  2C6Y A;  2L4A A;  2NS0 A;  4KDP A;  3GYH X;  3FMS A;  2DFI A;  2GXB A;  3ZN1 A;  2LF7 A;  3DKW A;  1YYV A;  4JBA A;  1CF7 A;  2XAQ A;  2MLK A;  1G3S A;  1S3J A;  5H20 A;  2X0L A;  2FQ3 A;  1UFM A;  4CHU A;  1HKQ A;  1TLH B;  5JFR A;  3GFI A;  4FHT A;  2O0Y A;  5HLH A;  3FM3 A;  3JTG A;  3QU6 A;  2XRN A;  5CVV A;  3WTW C;  3WTU C;  4BXU A;  2A6H F;  4LK0 F;  1ULY A;  5ILU A;  2WTE A;  3F22 A;  3DPT A;  5DCF A;  1RUN A;  2OZU A;  5FFX A;  4I02 A;  2L4M A;  2A3S A;  4I0B A;  3P9C A;  3U1D A;  2D45 A;  1U5T C;  1HKT A;  5HDK A;  2VBW A;  1U8R A;  4QLC U;  2A68 F;  2PMU A;  3WU0 A;  2JSC A;  3SXY A;  4RAY A;  2AS5 F;  1IN6 A;  4I09 A;  3WOD F;  2PG4 A;  4U7D A;  3RDI A;  1MD0 A;  5D4R A;  4XRF A;  1IAW A;  2RDP A;  3J80 K;  5DUK A;  1K6O A;  5DDG A;  3JSP A;  4EV0 A;  1FZP B;  3R0J A;  1CGP A;  4P5O A;  3K2Z A;  2XGX A;  3KE2 A;  1J9I A;  2V1X A;  2DO7 A;  3J7A O;  2OZ6 A;  4AD9 A;  1XCV A;  1IN5 A;  2V9V A;  3F8B A;  4KUM A;  2EV0 A;  2ZJ2 A;  4RAZ A;  2YX7 A;  3MAJ A;  4PGG A;  1I1S A;  2BYV E;  1T0F A;  1G3T A;  3QPT A;  4GYI A;  3GO5 A;  3DF8 A;  1R1U A;  4YFK F;  4G8X A;  1SD5 A;  4EMS A;  3M8E A;  5FGM A;  1OMI A;  5K1Y A;  2QQA A;  2FOK A;  1H9T A;  2F5D A;  2PN6 A;  4NHJ A;  3IWF A;  2XV4 S;  2HKX A;  1MGT A;  4YIF A;  1B9M A;  4A5M A;  5ERI A;  5E1X A;  2GIV A;  2DTR A;  3OOP A;  3KLN A;  1ZGA A;  1XGS A;  5F6F A;  4YFX F;  3KP7 A;  3CLO A;  5LRR A;  5CJ9 A;  3E5X A;  3IL2 A;  2VE9 A;  1J7K A;  4IHT A;  4YG2 F;  3M1E A;  3FX3 A;  2VXZ A;  3KZZ A;  4OU0 A;  3IKV A;  1IXC A;  4RB1 A;  5E17 F;  1O7L A;  2A6E F;  4EM0 B;  2A61 A;  4L9J A;  3LAJ A;  3FZV A;  2GA1 A;  2NYX A;  1ZRF A;  5ICF A;  4P55 A;  2M45 A;  1J0R A;  4M9S A;  1XGO A;  4RGX A;  1PP7 U;  1EH7 A;  2P6T A;  5LGN A;  5BOX A;  2HDC A;  2HYG D;  1O3S A;  2YSR A;  2IRF G;  3IC7 A;  1DP7 P;  1YTY A;  2FNA A;  2E7X A;  4ZYH A;  5K5O A;  3G3Z A;  4CIC A;  1DPU A;  2Y0M A;  3DP7 A;  4U7B A;  3Q9S A;  3MQ0 A;  3KFW X;  5LHH A;  1B9N A;  3GFJ A;  2VN2 A;  5FLX Z;  3REO A;  1G3Y A;  2XHK A;  4EM2 A;  2BGC A;  3BPX A;  4OIQ F;  1R1T A;  2KIM A;  2FBK A;  3BJ6 A;  4B8X A;  2PFB A;  4OMY A;  1TTY A;  4O6J A;  2Z3Y A;  2FBI A;  1W7P A;  1NHA A;  3AAF A;  2NNN A;  4HQE A;  3M7G A;  4OMZ A;  5KK1 A;  1UB9 A;  4IF4 A;  2HR3 A;  3D5L A;  3B02 A;  1ZG5 A;  1WSU A;  2J5P A;  3M9A A;  2CG4 A;  2GZW A;  4LK1 F;  2ZXJ A;  5J8C A;  1K7A A;  2VE8 A;  2ZFW A;  3DV8 A;  4M9Z A;  2YPR A;  3BY6 A;  4GO1 A;  3CUQ B;  3T1B A;  3MZY A;  3ZMU A;  3ZMT A;  3GF2 A;  3FF5 A;  2STW A;  4A2U A;  1YLF A;  2JTV A;  5AON A;  2ZNY A;  1B59 A;  2A69 F;  3ECH A;  3F3X A;  2QM3 A;  3EUH A;  4RB0 A;  3U9G A;  1XGN A;  3KP3 A;  4UV8 A;  4OOI A;  2QEN A;  3ULQ B;  2DPU A;  5AIQ A;  5D4S A;  1F1Z A;  4EM1 A;  4HF2 A;  2GAU A;  1LEB A;  3L2C A;  2XKO A;  1F5T A;  4HV5 A;  1L3L A;  1D5V A;  2L54 A;  2UXX A;  4Q4Z F;  4K2E A;  1QBJ A;  4MTD A;  4EJT A;  1J75 A;  3LWF A;  1SD7 A;  4EVI A;  3KP4 A;  1ZG3 A;  2MH9 A;  4L5J A;  1D8J A;  2XUB A;  2LKP A;  2Q2E A;  5BPI A;  2ETH A;  1BJA A;  4HYE A;  3J80 Z;  1WWX A;  3BP8 A;  4ON0 A;  4LMY A;  2P6S A;  2TDX A;  3SHF A;  3Q9V A;  3ZMZ A;  3IRQ A;  3KP6 A;  4WXD A;  3I59 B;  3QOP A;  1P2F A;  3WGG A;  3ZPL A;  2STT A;  1SMT A;  1E17 A;  3GZ5 A;  4M6X A;  4DNC A;  4G7Z F;  1FP2 A;  1QQI A;  1WKM A;  2IPQ X;  3HRM A;  1SD4 A;  1BI1 A;  1O7F A;  3BRO A;  4O3M A;  5IT9 Z;  1Y0U A;  2JRT A;  1FYM A;  4ZYG A;  2PMH A;  5ICC A;  2RC4 A;  5D8L B;  4ENN A;  1GVJ A;  1ZAO A;  1CF7 B;  1HKS A;  5AIP A;  1EV7 A;  2KKO A;  3JSO A;  2OA4 A;  3K1P A;  1OYI A;  5HDG A;  1T98 A;  2QUF A;  1XDU A;  2FA5 A;  5TRD A;  4GGG A;  4ZYD A;  4Z2Y A;  1ODD A;  2GWR A;  2M87 A;  1V4R A;  2HEO A;  3HRS A;  1UHW A;  4G94 A;  3SQN A;  5FLX K;  1FPQ A;  4L18 B;  3LA7 A;  3FHZ A;  2FMY A;  2HYF A;  2KRF A;  5LBQ A;  5FFZ A;  2Q0O A;  2CGP A;  1Z05 A;  1RNL A;  1JE8 A;  5JHU A;  4O5V A;  3I53 A;  2ESH A;  4LG0 B;  5ICE A;  2RQP A;  2CFX A;  3MCZ A;  2RN7 A;  2IJL A;  1W4M A;  3WTX C;  2O6G E;  4MQ9 F;  4L9T A;  4ZYE A;  3FM5 A;  4I7H A;  2ZCW A;  3K69 A;  4YII A;  5LEJ A;  3HSR A;  2K4B A;  5FO5 A;  1QNT A;  4IPA A;  2D1H A;  2QLZ A;  2ZBK A;  4EJW A;  2F5E A;  2IA0 A;  3HSF A;  3CUO A;  3WTZ A;  3FXR A;  4Y13 A;  4CXF A;  2VC1 A;  3ABU A;  4P9F A;  3SZP A;  5HS8 A;  4Q5S F;  1KYZ A;  4D0P A;  4U0Y A;  4UHT A;  3N4M A;  2DAO A;  3IHU A;  2ZME A;  2OQG A;  2GXG A;  2HQN A;  5A2Q Z;  4EGY A;  1R5G A;  2IVM A;  2K7L A;  4LG0 A;  4KIB A;  2XKP A;  5H6Q A;  4IRH A;  2VT2 A;  2DI3 A;  1MKM A;  4ETS A;  4JK1 X;  1ZG1 A;  1BOA A;  4HW0 A;  5DCM A;  2HS5 A;  3ZN0 A;  5CLS A;  5F64 A;  2P7C B;  2CSO A;  1XN7 A;  3EYI A;  4OIR F;  2YR2 A;  4KYW A;  2IA2 A;  3R4K A;  4B09 A;  4ESF A;  3BPV A;  2HKO A;  1LEA A;  5D6F A;  2PEX A;  1ZYR F;  5DD8 A;  1SFU A;  4A5N A;  3JW4 A;  1Z6T A;  4WF2 A;  4LLN A;  1OKR A;  1UCR A;  2PI0 A;  5H6R A;  4XSX F;  2LF8 A;  1TQI A;  3C7J A;  3CJN A;  5ILS A;  1BN5 A;  1LDJ A;  1HBX G;  3O6B B;  1S7A A;  2VOD A;  3W6J B;  2DK8 A;  1S6L A;  2H09 A;  3GZ6 A;  1USS A;  1S8N A;  2W85 A;  1YW7 A;  4XSZ F;  5IT9 K;  2EFP A;  2P5K A;  3D0S A;  2RGV A;  5D6E A;  2KJC A;  4G7H F;  2FML A;  4BHB A;  1TQP A;  4RB3 C;  2CO5 A;  2F5C A;  5KVR A;  3T0Y A;  1HSJ A;  5L3B A;  5L3D A;  3WTT C;  2K27 A;  4L5I A;  3TOB A;  1R22 A;  3F8C A;  5LGU A;  4HX8 A;  3BZ6 A;  5FB2 A;  4HDV A;  3HSE A;  4HF1 A;  2QYO A;  1WQ2 A;  4UUV A;  1KU2 A;  2BV6 A;  3F72 A;  3EQL F;  4IRG A;  3KLO A;  2CYY A;  5JVT A;  2QBY B;  1MJA A;  3C3W A;  1XSV A;  1S7O A;  4RGS A;  1XD7 A;  3VEP A;  3ROU A;  5LHG A;  3DEU A;  2M8E A;  1KU3 A;  4PZJ A;  3F8N A;  3DPL C;  4CZZ A;  1U5T B;  4KNY A;  2AXL A;  1KU7 A;  4ENK A;  1ZLK A;  2W57 A;  3NRV A;  1HW5 A;  2FXA A;  3GFL A;  2L3D A;  4F7Z A;  3TDZ C;  3LFK A;  4EQQ A;  3CUQ C;  4A6E A;  2GA2 A;  5LGT A;  1PUE E;  4RGU A;  1V3F A;  2DLL A;  2QQ9 A;  2WC2 A;  3KEQ A;  4HLY A;  1OR7 A;  1W7P B;  4HX7 A;  2ZKZ A;  2F2E A;  3FXQ A;  1G6N A;  2ADU A;  1ON2 A;  5D8K B;  5HVQ C;  4RS8 A;  4H0E A;  2KJB A;  3GXO A;  2XAF A;  2EWN A;  3JTH A;  4A0Y A;  3TGN A;  1FX7 A;  4AVP A;  2XVC A;  3C1D A;  4XLN F;  3CDH A;  5DD4 A;  3VFZ A;  1XDS A;  1H0M A;  2EK5 A;  2IA1 A;  1VTN C;  4JQF A;  2QBY A;  3FXU A;  1HST A;  1U3E M;  2ISY A;  4UXN A;  2XAH A;  2XRO A;  5IT3 A;  4HX4 A;  2O8X A;  3V7S A;  2JPC A;  4LLG F;  1PDN C;  1Q1H A;  1WRJ A;  2L01 A;  4AWX B;  5HDN A;  1XB4 A;  3V7R A;  4KT5 C;  4I01 A;  1U5T A;  1IRF A;  4S04 A;  3WE2 A;  1KYW A;  1LJ9 A;  3F8M A;  5ICG A;  4IHS A;  2JPB A;  3QP5 A;  5A2Q K;  5BQT A;  2P5V A;  4WK8 F;  2Y75 A;  3WTS C;  2DPD A;  3RKY A;  2A5Y B;  4CYD A;  3LQR A;  1FWZ A;  3FMQ A;  2EFO A;  3BDD A;  2RKH A;  1H9G A;  3I64 A;  1FYK A;  3WGI A;  2F5F A;  2GQQ A;  2EV6 A;  1HW2 A;  4MHG A;  1RUO A;  4OIN F;  4BQA A;  1FBU A;  2RNJ A;  1XMA A;  1YIO A;  2O3F A;  4MTE A;  4BNC A;  4BHC A;  3MWM A;  4MNU A;  3K1N A;  2W24 A;  3T5X A;  3R60 A;  3KCC A;  1SAX A;  4PGH A;  2VON A;  4HBL A;  4IXA A;  3DXJ F;  4P9U A;  1MJ9 A;  3ZMD A;  4LGW A;  3G73 A;  3GUD A;  4G6D A;  4KIF A;  4FT8 A;  2CW0 F;  2FBH A;  1IN8 A;  1HQC A;  1LDD A;  3J81 K;  5D5X B;  1FLI A;  2HOE A;  3O2P E;  5D5U B;  3P7N A;  1P6R A;  2V79 A;  5J8F A;  5JR3 A;  4Y17 A;  2LNB A;  2VBZ A;  5LRS A;  5TJJ A;  1R58 A;  1BIA A;  3I54 A;  4YFN F;  1ZN2 A;  1DDN A;  5EEG A;  1BI0 A;  1FC3 A;  3HOT A;  2V6C A;  2DBB A;  2HQR A;  4LLL A;  3N97 A;  2VOO A;  5CVR A;  2R7F A;  3K0L A;  2BE5 F;  2W84 A;  2ZO4 A;  1FSE A;  4ZZD A;  3GWZ A;  3WTV C;  3V7C A;  1WI9 A;  3L09 A;  1I6X A;  1YG2 A;  2XAJ A;  2K4J A;  1IF1 A;  4TV7 A;  2UWM A;  2Z5U A;  1XGM A;  2HWV A;  2MD5 A;  1JHH A;  3GVA A;  4KN7 X;  2P8T A;  2YU3 A;  3ECO A;  4QWQ A;  3WE3 A;  3NQO A;  1O3R A;  2B0L A;  2Q8K A;  3TQN A;  4G9Y A;  1BIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...