3P9IA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and sinapaldehyde
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
b'TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9iA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9iA02
1OPCA 4L0ZB 2ZCJA 5CM2Z 2G8NA 4XUCA 3V4GA 5H20A 1D5VA 2X4HA 3BROA 1S3JA 2LF8A 1MZBA 1QO0D 2BM9A 4KWCA 4E30A 3LA7A 2MH2A 2EJUA 1KPGA 2Z6AA 5HOOA 3P2KA 5FLXZ 2UYOA 5EMJA 1SUSA 3M6WA 1SMTA 3M8EA 3H3UA 1I9GA 1L3CA 2L4MA 5AIQA 2FRXA 3KQMA 1BJAA 2JHCA 5EIWA 3ZMTA 2DW4A 4KDPA 3OOPA 1CF7A 4PYMA 2F2EA 2H1RA 5T6BA 3E5UA 3RKYA 4ETSA 4UV9A 3CC8A 4DKJA 3H3ZA 3OZTA 2Z99A 4RAZA 4KUMA 4A6DA 2IT0A 2HV9A 3WTZA 3QOPA 4M37A 3C6MA 4MQ9F 4HG2A 2OQGA 4WX9A 1P6RA 3OZRA 4YFNF 5K0LA 5HIKA 4EMSA 4X60A 3CTAA 3ZN1A 1B42A 4P55A 5DM2A 4AZSA 2UXNA 3C3PA 1YS7A 5F2KA 2YX1A 2KJCA 1KA8A 4HV5A 2UWMA 2P3OA 3GNLA 4X63A 1RIOH 1BC8C 1UIRA 3C0KA 3HA3A 1G60A 2F5DA 4IWNA 4C08A 1GVJA 1JG4A 3I53A 4BY9E 2NRAC 2F5CA 2IH5A 3G2MA 3R24A 2ZZMA 3DULA 1FWZA 2XAFA 2NYUA 3LL7A 5LHIA 2EWNA 5BPIA 1RI7A 3HSFA 3RPUA 2XAJA 3VSEA 1B59A 3CJQA 3FM3A 4CXFA 4YV2A 3QPHA 4U0WA 5LEKA 3V97A 4A0YA 1NW3A 3PX2A 5EMMA 1GXQA 3KP7A 4UVBA 2GA2A 1FOKA 2DAOA 4XUDA 3BT7A 3GRZA 3JAMK 4G9YA 2K02A 3G8BA 4N0BA 4OMYA 1LDDA 4UXNA 3ZPLA 5DT2A 4G94A 3R3HA 5E9QA 3HA5A 1K79A 1ZREA 1JQEA 3EQLF 2A6EF 3R0AA 3FXQA 5E20A 2QENA 1QZZA 3TOSA 1LEBA 3C3WA 1TW3A 2RC4A 2DO7A 1AQIA 4OIPF 1P1BA 1BN5A 3GO4A 3TQNA 4YUXA 3ME5A 4KNYA 3GFMA 2ZFUA 1X19A 4YFXF 1IN6A 2NNNA 5GIPE 3GRRA 1ODDA 3ERED 2UZKA 3EGIA 5A2QZ 3FTCA 1REPC 2G72A 1FYMA 3HNRA 4RTPA 3F4KA 5FCDA 2YXDA 3LA3A 3K6RA 2GXGA 2HOEA 3CBGA 4ER7A 2A3SA 3FUUA 4RGXA 3MCZA 3ZMUA 4L7VA 5GIOE 2EA2A 3WU1B 5HOQA 3J80K 5E2AA 4LGWA 1UCRA 1BM9A 2O61A 4DQ2A 2C6YA 5FHRA 4C07A 2JT1A 4UNOA 2B25A 4EM2A 3DV8A 3G8AA 1QBJA 4U7TB 5DRTA 4LWOA 2ZTHA 2JPBA 2F8LA 3L9FA 1XJ5A 5DTQA 4PNEA 2B9EA 2ESHA 4OMZA 2EJTA 2STTA 4RGSA 1TLHB 3NWEA 3PFGA 5H6QA 4I98B 5EOVA 2OZ6A 4L0YB 1QAOA 4DCGA 1HSJA 3RPQA 4EQQA 5P8WA 2A69F 4IJAA 1XSDA 3UBTA 4ON0A 2PX5A 5JUWA 1WZNA 3E8SA 1A04A 1IRGA 4MEXF 4YV1A 3B02A 1X3UA 2LSOA 4JQFA 3LPMA 3JWIA 1BKYA 3EVBA 3O2PE 1T0FA 2ZFWA 1V3FA 5GWXA 1JQDA 4HGYA 2GAUA 4A5NA 2DI3A 4EJVA 1PP7U 2CWWA 4R6WA 5CLSA 4R79A 2BV6A 3W6KB 2FBKA 1JSXA 4M9SA 3CO6C 3EYYA 3I58A 2IBSA 3SM3A 3CJRA 3FXUA 3EMBA 5E2BA 2YTZA 3ER9A 4MGRA 4OQEA 3KQVA 5HZMA 1IUYA 4C05A 1YS6A 1SUIA 4QVGA 1P2FA 4LLNA 5HFJA 4MQVA 2ISZA 2ZIFA 3V7RA 1J7KA 3BWCA 5FD5A 4UUVA 4O3MA 1WS6A 2XAQA 1DUSA 2JRTA 3E6MA 1PDNC 1ONVA 5DCMA 3J7AO 2ERCA 4RTRA 4GEKA 2XVAA 3DTNA 5B1SA 3IHTA 2R3SA 5EZQA 1QGPA 3C7JA 1L3LA 5ILUA 1RUOA 2STWA 4GBED 5E8RA 1MD0A 1JG3A 4OA5A 2OA4A 2VOOA 1CF7B 1KP9A 3FXRA 4P7KA 5CVRA 3KR0A 1RJGA 4BLWA 2PMHA 4CXMA 5HDGA 1MKMA 1KGSA 1BC7C 3ANXA 1XXLA 1FP2A 1KPHA 1QAMA 2YXLA 2LF7A 3I54A 3V7CA 1DP7P 5DV5A 3LFKA 3G73A 2NNYA 2L01A 3ELYA 3T7RA 3MAJA 4I2OA 4FS8A 4V0QA 4ENNA 2CYYA 1JG1A 5GOZA 5TRDA 1RJFA 3ZMVA 2QUFA 1YF3A 5FQNA 4UVAA 2JJQA 3SHFA 1S6LA 1NHAA 3G5TA 3F8NA 1I5ZA 4P9FA 4AIHA 3O31A 3P71T 3BJ6A 1W5SA 4HW0A 3BDDA 1UFKA 1RI5A 5EVJA 1Z9CA 2PVCA 3WE3A 2EK5A 2OZUA 2IVMA 3DLIA 3IC7A 3HTXA 3M6VA 2AN4A 1HBXG 2DQLA 4M71A 2J5PA 1ZGAA 5K01A 4MIKA 4FT4A 4GUAA 2CGPA 4QQNA 1O9GA 5DXJA 3IWFA 4KVZA 4CKEA 2OU2A 1G6NA 5D5VB 4ESJA 1R5HA 3DFGA 3Q9VA 5K5OA 1Q0TA 4RB1A 2D45A 2BBYA 1TTYA 2E1NA 2RV8A 4G8XA 2IGTA 5F6FA 3RDIA 2ZZNA 1TW2A 3CUQC 4ESFA 1XGOA 2IRFG 2L4AA 4R8RA 1ORHA 2XGXA 5BMZA 2P8JA 3IRRA 4LJZF 2VDVE 4FSXA 2E5WA 3NDJA 3B3FA 4GF5A 2BYVE 4BHBA 1ORIA 4HX7A 2O05A 2L02A 3U81A 1XVAA 1BBYA 1KU2A 1ZGJA 5LEJA 3MWMA 2ZWVA 5EKXA 2Z6UA 3NEUA 3BZBA 4HAMA 2KW5A 4FHTA 3ECHA 3FRHA 5GINE 5HDNA 3O6BB 5CCXA 4FGZA 2VP3A 4S04A 4WWCA 1SG9A 2ADUA 3HCDA 5DTRA 2EV6A 2MH9A 4P9UA 1R8XA 1Q0SA 3SVZA 4E33A 4YG2F 2XVCA 3MEXA 3WU0A 1J75A 3JTHA 2H27A 2FSWA 5JR3A 4K2EA 3JTGA 5LLQA 5CYVA 3O7WA 1XCJA 1ZKDA 2VONA 1U2ZA 1FZPB 1H9TA 2PG4A 2HTSA 2V1XA 4AVPA 3GX4X 3OCJA 4JXJA 2OKCA 5E1XA 2VE8A 1RJEA 1RZ4A 1S7AA 1B4AA 1EQAA 1G3WA 2A07F 1O7LA 3DUWA 5FWAA 4MTDA 1WXXA 3GDHA 4EVIA 1ULYA 3LQQA 4ZTBA 1U3EM 2VBWA 2LD4A 5BQTA 3U2RA 2NP7A 3WGIA 4ER6A 3FZVA 1R00A 3UJCA 3FWEA 4LFUA 3RYRA 2OB2A 1BIBA 4U0VA 3N97A 4E2WA 3HCFA 2DK8A 1RI4A 3CUQA 4FSDA 1I1GA 5TJJA 4RTNA 3HTUA 2VODA 4I7HA 2VOPA 3LKZA 2ZZKA 5CCBA 2ORED 2K86A 1GXPA 4LB5A 4YMGA 7MHTA 3R0QA 2ZO4A 3G3ZA 3D0SA 4GYGA 2PY6A 1XGNA 3CO7C 4RB3C 1UB9A 3GF2A 1KYWA 3NRVA 4M6YA 2UZ4A 5LQCA 4XUEA 5FGMA 4PIPA 2ZBQA 2MLKA 1SD4A 2AOWA 3F22A 5E9JA 2K4MA 2WC2A 3HVJA 1VL5A 3G5LA 4M9ZA 4EQZA 2FRHA 3MQ0A 5DCMB 2NP6A 1XTPA 4POOA 3SFZA 4NQWA 2VBZA 1WI9A 5DDGA 4M7RA 3DQVC 5EIFA 3BWYA 3F8BA 2DFIA 4KMUX 4GOOD 1BI2A 2ZNZA 1JE8A 4GOND 3RI4A 3FYDA 1OYWA 2C7OA 1X1CA 5LQUA 3IV6A 3KU1A 3KP5A 2ZIEA 3LKDA 3ZN0A 3BGDA 4ESBA 1JQ3A 2Y75A 3FHZA 1R8YA 2ZVJA 2H6BA 3B3GA 3CGGA 2KJBA 4E32A 1QAQA 4OU0A 3C6KA 3BKXA 3EPPA 2CW0F 1USTA 5HLIA 3LSTA 1JTFA 4AIJA 2PXAA 2EB7A 4RS8A 4PYKA 4K6MA 1FBQA 2QYOA 2Y48A 4NHJA 1KU7A 1MJAA 3KQTA 3KR1A 3P9KA 4YUVA 3NMUF 4JK1X 4RYLA 1P91A 5D6EA 1XMAA 3ELWA 2GLUA 1EJ0A 1DCTA 4ZYHA 1QYRA 2L54A 2ESRA 3J81Z 3KR9A 5FHQA 4RTKA 1RJDA 4G56A 4ER5A 4IF4A 3ZMSA 1PP8F 4LECA 5IT9Z 2KIUA 2PEXA 3THSA 4PZJA 2ZLBA 2HR3A 5DUIA 3K2ZA 4P58A 2YU3A 4D0PA 4BXUA 3KR2A 4HRAA 1XDSA 1MJBA 2NAZA 2XYQA 5J8FA 3I4PA 3MERA 3M9AA 4UOEA 5GM2A 1XDZA 2UYQA 1XB4A 3R4KA 3DR5A 5U4XA 3KQSA 2RVCA 2COMA 3DOUA 4Q4ZF 3LAPA 2GB4A 1SKMA 3P9CA 1ZRFA 2VC0A 1AV6A 1D2GA 4A6EA 5DD8A 3HYIA 3E7PA 1P4WA 2C7QA 5K0GA 3FF5A 3JW4A 2FYTA 4OX9Y 1IZ1A 3B7PA 1KQ0A 2I7CA 1RI2A 1D2CA 3FZGA 5HS7A 1KQ8A 2P7HA 1W4MA 3SX0A 2PXCA 4CWAA 4OIOF 5FFZA 2M5WA 5D8KB 2MLGA 4HSGA 4HC4A 2JH9A 1HNNA 1VTNC 5EPEA 2Q0OA 5D5WB 1AOYA 4BQAA 3FUXA 4JBAA 5IKMA 5DCFA 3HP7A 1R5GA 3LBFA 3T7SA 5K0EA 2D2WA 2Z33A 3L7WA 1IW7F 4KN4X 2P5LC 3MFKA 4A2UA 3MAGA 3KHKA 2ZSUA 4DQ0A 2K4BA 2M30A 3WTSC 4WXHA 5LHGA 3TRKA 2V6CA 2Q41A 2E1CA 2W57A 5ILVA 1DPUA 3NVKI 2Q8KA 3OFJA 2WWYA 2B2CA 1USSA 2P7CB 1FYLA 4CTJA 4O29A 3HOTA 3GLXA 1IN4A 1LDJA 4I01A 1KPIA 5CVEA 4HQEA 4BH9A 1O3TA 3ABTA 3TR6A 1YO5C 4NB5A 3B3JA 1L0OC 2XAHA 3PQKA 2QQBA 2XAGA 1EV7A 1ZLJA 3K9TA 1Z1DA 2H6CA 4HYEA 3R6TA 2P3QA 3CJTA 1MJFA 3ORHA 2XHKA 4N9HA 4UHTA 3KQYA 3P8ZA 2ZULA 5ICFA 2XYVA 3F3XA 1IXRC 4ER3A 5EC8A 5HLHA 4QVKA 2ELHA 2WK1A 2CFXA 3CUQB 3QOXA 3TM4A 2GPYA 2GQQA 2CWEA 1ZHFA 4P7JA 3AXTA 1L1EA 3CLOA 4KW7A 1K78A 1P4XA 5K0BA 3ML6A 1NV8A 3BWBA 5EEHA 3DMGA 2I9KA 3JWHA 4QPPA 4HF1A 2KIFA 3S68A 2HFHA 4L5JA 2HS5A 4P7FA 4M73A 2OY0A 3TOBA 2O0LA 2B0LA 1J5YA 3UJAA 1B9NA 1UFMA 2O57A 3I59A 1VE3A 1K6OA 3FX3A 3GVAA 3SSOA 2JPCA 3DP7A 3VEPA 3IYLW 5EG5A 1R18A 1R6AA 2BM8A 4HA8A 4H0NA 3GWZA 2DK5A 4HF0A 1WWXA 3NW9A 5KK1A 3BJAA 3I64A 2RGVA 4AIKA 2HNKA 2JTVA 5G02A 3M33A 1TNSA 1SVUA 4C04A 4MNUA 5EQJB 3ISPA 4EKGA 3KP3A 1YW7A 5E8GA 2PX8A 3UJDA 2EJRA 2OPBA 3FMRA 1M6YA 1HQCA 3HOSA 3L2CA 2XBMA 4EKIA 1TQPA 5K1YA 4U0YA 2Y0MA 1JHHA 4CZZA 1O57A 4AZVA 4U7PB 4A5MA 5MHTA 5HIJA 2YR2A 2HTJA 1L3IA 4DCMA 5DM4A 1SD7A 3SSNA 1ZG1A 3OV8A 3PX3A 3VYWA 4KYWA 3SGLA 1BI3A 1U78A 5E17F 4M36A 3LDGA 4RVGA 2HKXA 5ERGB 4RTSA 1BOAA 1HMYA 1BI0A 4LG0A 2BR5A 4A0ZA 4S05A 1YG2A 3HRSA 1S7OA 2X0LA 3UJ6A 1B6AA 1U6GA 3K0LA 3JSOA 4ZYGA 3G89A 4IVNA 4R8HA 4G7OF 4MEYF 1FSHA 4RGRA 1U2WA 2CKDA 1O3RA 3HVIA 3GEZA 2OAZA 2DTRA 3SZTA 5L3DA 2V1UA 3K1NA 5KQSA 2HTEA 3HVKA 3ROUA 4U7DA 2EFQA 3BP8A 4GGGA 2QLZA 4Y2HA 3KLOA 2BEOA 5DEQA 5KYGA 1HW5A 3PVCA 5FO5A 3HHHA 2ADMA 2A14A 5DWQA 4GOMD 4ATNA 3EMDA 5DUKA 1P92A 1G3TA 4KIBA 3GZ6A 2ONYA 3E6DA 5H6RA 4CHUA 4PONA 3FPGA 2P7VB 5E1BA 1VP9A 3TM5A 4PWYA 3TFWA 3HM2A 2XKOA 1R74A 2FBIA 3MHTA 2EFNA 1CGPA 1YZHA 3CJNA 3KE2A 4YIFA 3ERCA 3MZHA 4KMFA 6PAXA 5E8JA 2BH2A 1UWVA 2FEZA 3KP4A 3M6UA 2DPMA 5CUQA 3JAMZ 3BGVA 1T38A 3BY6A 4OIRF 1G8SA 3GZ5A 2VXZA 2HKOA 5K05A 3EEYA 2RQPA 3R0JA 2IH2A 4EJTA 2AS5F 3BPVA 4L9JA 1OYYA 4Y13A 3LCCA 5DTMA 2VDUE 2PLWA 5BP7A 3T8RA 2PQ8A 4OQDA 3PTAA 4PYLA 4KIFA 2PGXA 1KU3A 5FULA 3QP5A 3OU6A 2DLLA 3GUDA 4KIGA 3RKWA 3SMQA 5J6XA 2HQRA 4BP3A 3FTFA 4XSZF 5JVTA 3TQSA 3EETA 3LAJA 4IXAA 4PCLA 3UZUA 3T8TA 2XV4S 1V4RA 2K27A 4L9TA 5FUBA 5DD4A 4DM3A 4MWZA 4ZZLA 1T39A 1WY7A 9MHTA 3E3VA 1D8KA 2VBXA 5FB2A 2BR4A 1AQJA 1NBHA 2RN7A 2AZTA 4QQKA 3LX6A 3NJRA 3VC1A 3M7GA 3J80Z 4GOLD 5C0OE 4CDGA 3E23A 2OO3A 3EVAA 1KR5A 5CD1A 1HSTA 2P5VA 3GO5A 3KQOA 3OU2A 4PYOA 3IEIA 2H00A 5DX0A 1FBNA 4R8SA 4V0RA 1FC3A 5LQAA 2FMYA 2EX4A 3FUTA 3EGVA 10MHA 3LDUA 4KN7X 3HA7A 3E05A 4LG1A 3TO9A 2B78A 1WSUA 3E6BA 1XMKA 3KEQA 4G6DA 1TQMA 1K78B 4PYNA 2B3TA 2VE9A 4FZVA 2O8XA 2JZYA 1QQIA 3MZYA 2H94A 2EFJA 1B1BA 2CG4A 3FUVA 2K4JA 3ZMDA 2FMLA 5F1RA 2YQZA 1INLA 1LQ1A 4I0BA 1NW6A 4OA8A 2FNAA 5D1HA 3IHUA 1OYIA 4LK0F 2FK8A 1EG2A 1WXWA 2F5EA 3OPNA 3I59B 4IRGA 2R7DA 2P4WA 3EDPA 4F84A 2DPUA 3TMAA 3G2OA 4KFCA 3DEUA 5DSXA 2VC1A 2FE3A 1QPMA 3H2BA 2XIGA 4RTOA 2QY6A 2IFTA 4RVDA 4HLXA 1U5TC 2NXCA 1WG8A 4BP1A 3HEMA 2ETHA 3V7SA 1IF1A 2XVMA 2ESNA 4YV0A 3P7NA 3BOQA 3HTSB 1F9NA 3PFHA 4G7HF 3P9NA 4CGZA 1XGMA 2PV0A 4GC9A 3PLAE 3OE5A 1WRJA 2VZ9A 2BR3A 3CVOA 4ZH4F 1NBIA 1DL5A 5LQNA 1LEAA 3UFBA 5D4RA 5KVAA 1IN7A 1BC5A 2IDJA 5E1MA 4WXDA 1T98A 1HKQA 2QRVA 1J9IA 2JHPA 4HH4A 3REOA 1J0RA 1DUXC 2PX4A 1OR7A 3VFZA 1U8RA 5ICEA 1I6XA 5AIPA 2Z9OA 2CL5A 2EG5A 3DLCA 4A12A 4LG0B 1I1SA 1SAXA 4U7BA 1EIZA 2NXNA 1KYZA 1LJ9A 1E17A 3T1BA 3I71A 1ZQ9A 2E7WA 3LA2A 3UJ7A 3NTVA 3WTVC 1FY7A 4PINA 3M70A 3EUHA 4U88A 1PJZA 1VLMA 3K1MA 5LQRA 3LHDA 3F72A 5LQKA 3HCEA 5FLXK 4C03A 2Z6QA 1HKTA 4MHTA 2MC3A 1ZG3A 4RVFA 2FXAA 3HSEA 4F7ZA 4RX1A 1UHMA 2CO5A 1EH7A 3QAHA 1YZ3A 3TGNA 3VOEA 3IRQA 8MHTA 1JGSA 2HDCA 2AOXA 2ACJA 3FPJA 4DNCA 3E6CC 4PYIA 4RB2C 4XLPF 1P39A 2FU4A 4LLGF 2HMYB 4RWZA 3LGAA 1FSEA 1STZA 2YSRA 5L3FA 2V7EA 2ZCWA 4O5VA 4ASNA 5ICGA 1XCVA 2GA1A 3LCUA 1YFHA 5FFXA 4I09A 2IIPA 5BXYA 4XCXA 1KXZA 5K03A 3PB3A 4GC5A 4BLUA 4EGYA 1VBFA 1D3YA 2PWYA 4RGUA 2HWKA 4P7GA 3KPUA 3JWGA 3NVMB 1Z91A 1U5TA 1SQFA 1IN5A 4FT8A 1XSXA 4BHPA 3K0BA 5LQJA 4E2XA 4HGZA 4OOIA 4P5OA 3DF8A 4XLNF 2M1BA 2P41A 3ECOA 3C18A 2FK7A 2AN5A 1ZLKA 3F6VA 5HIMA 1TBXA 1KQ9A 3A4TA 3QU6A 3HCBA 1G3SA 2BZGA 4YIIA 3D2LA 3GGDA 1SD5A 5CVDA 2KRFA 2YPRA 2FQ3A 2ZIGA 1IXCA 3BGIA 2H09A 2R7FA 4KA4A 5DXAA 3LCVB 2FF4A 1Z6TA 4CICA 1EAMA 3FRIA 2IA1A 3T0YA 2FHPA 3KQWA 3WSTA 1YW8A 2G9WA 2HYFA 4BHCA 3OE4A 2IDKA 1EJ6A 3THRA 4QLCU 2PFBA 1XDUA 4CTKA 1JXSA 3DMHA 3KPVA 1FP1D 1T43A 1YB2A 5CVJA 3RKXA 4M38A 2PJDA 3OZSA 3WODF 2G7UA 4BAYA 2XROA 3GRVA 3VC2A 1RI3A 5HDKA 1W7PA 1O3SA 1B9MA 2PBFA 4L5IA 5BW4A 1O7FA 3A27A 4UVCA 3SSMA 3HVHA 2UXXA 1N2XA 1S29A 5DM0A 2D1VA 3UJ8A 2EFPA 2V1DA 3B73A 5LRSA 5K5RA 1QZYA 2W84A 5A2QK 2G1PA 2FCAA 4YUWA 2LDUA 2MBFA 1R1UA 3T7TA 1AF7A 2E7XA 4Q5SF 1G3YA 5K0JA 4X61A 5ED4A 5HIIA 3S2WA 2R6ZA 2Q2EA 2BGCA 4Q48A 3KQQA 3PQJA 5E1DA 5LR6A 2IJLA 2RKHA 2JH8A 3F21A 2OD5A 4HLYA 5F2NA 4YUZA 1WQ2A 1I27A 3BXOA 4HX4A 3QV2A 3HRUA 3G7UA 5LGTA 5L3BA 5CVVA 3GIWA 5GM1A 1KHHA 1Z6RA 4M74A 4AZWA 1ZRCA 4BNCA 5DLYA 5EEGA 4AWXB 1BHJA 4HDVA 3WTWC 1R23A 3G2QA 2AOUA 3GJYA 4E31A 2ZBRA 1YW9A 2A61A 5GP1A 2XKPA 3TKYA 5F2OA 1DDNA 3V8KA 2W24A 2HEOA 2FPOA 2EA4A 4IRHA 4WF2A 1O9HA 4OIQF 1PRYA 3UA3A 3V8VA 2P3LA 4IKPA 4X1OA 1TQIA 3R9XB 5ERIA 3KPJA 1SFUA 3RTRA 3R60A 2O0YA 2AOVA 4GCVA 3TOAA 2FNPA 3EVEA 2M45A 2IP2A 2V79A 2AOTA 3ZQ7A 4QTUB 1TPYA 2MA3A 4CKCA 3AWIA 1X1BA 3IWZA 2YX4A 3BWMA 3KPWA 3M6XA 3MQ2A 2VT3A 2HR1A 2G71A 4L9VA 2NXJA 5D6FA 4IHSA 3NQOA 3KETA 5D5UB 3CCFA 5FTWA 1FX7A 1W7PD 1Z05A 2QRVB 3GCZA 4CKBA 5DM1A 4RTMA 3BUSA 4EV0A 2O3FA 1SFEA 2M8EA 1OKRA 1ZG5A 3UJBA 3CUOA 2XASA 1FPQA 1F38A 3LWFA 4KICA 3Q7EA 1ZYRF 1YFLA 3MTIA 5IT3A 2Y1XA 3O4FA 2ZKZA 5D5XB 2EFOA 1O54A 4KRGA 1R22A 2A5YB 1VPTA 2O07A 1G6Q1 2QVOA 4GXOA 4QDJA 4QWQA 4EJOA 2GXBA 4KDCA 2GIVA 2ZNYA 2G70A 2G7HA 1ZN2A 3I0TA 3FMSA 2FOKA 4O6JA 4E2ZA 1K7AA 1R7JA 2Y1WA 3V8JA 1O3QA 2ZMEA 2VT2A 2BE5F 2NNWB 5EZSA 3TPZA 3PS9A 1OR8A 4P96A 5J8CA 3BPXA 2P35A 5CIYA 2AVDA 3E97A 1YTYA 4Q47A 5EGSA 2ZWAA 4UV8A 2AR0A 3FYCA 2P6SA 4H0EA 2YUIA 2OYRA 1GHCA 4IPAA 1HW1A 1U5TB 4XRFA 1IXSB 2VN2A 2HQNA 4MHGA 1NE2A 3EVFA 5BPDA 3FTDA 1WKMA 5LBQA 2GWRA 2GA9A 5K5QA 5JI6A 1FYKA 2YXEA 5D8LB 4B8XA 3FMQA 3TDZC 4ENMA 4EK9A 2HZTA 3R61A 1E2XA 4L9NA 1Y0UA 3TO6A 3KZYA 4ZYEA 4HTFA 4C4AA 2V74B 2N47A 4PCAA 3DXXA 2PI0A 1XN7A 5M5BA 1G55A 5L3EA 3G2PA 1H0MA 2WV0A 1OMIA 1NKVA 3Q5FA 1YYVA 4MTEA 3B5IA 1N7IA 1XCBA 1RI1A 1ZH5A 3GFLA 2XUBA 2D1HA 2HWVA 1IAWA 3RODA 3WGHA 2CQKA 2RDPA 1Z7UA 2ISYA 1W7PB 1H9GA 3HSRA 2GS9A 1FNNA 3MTEA 2K7LA 1KIAA 3DKWA 2PSSA 4HQMA 4PGHA 4WXCA 3ULQB 2QQAA 5L3CA 2C7PA 3ZP5A 5E1OA 1SMYF 4WVLA 2J5OA 3OU7A 2ZBKA 4ZZDA 1FBSA 1XSVA 3KZZA 3FTEA 1T2KA 3I9FA 1JG2A 2WTEA 1L9KA 3U1DA 2IA2A 4RTJA 1QNTA 1FJXA 2A6HF 4XSXF 3EVCA 3P97A 5T64A 3A7DA 3T5XA 5JFRA 4LK1F 4PIMA 5T67A 3SXYA 1LVAA 5DPMA 2P6TA 2QBYA 2IBTA 3MCTA 3QPTA 3WE2A 3TO7A 4HOBA 1D8JA 2O6GE 3FPEA 3BWGA 2GZWA 4GQBA 4F85A 2PLYA 4Y17A 3GFJA 4M72A 3IL2A 4RB0A 3FPFA 5EMKA 2O06A 1YIOA 2V9VA 5E18F 2P40A 3MGGA 1QANA 4RTQA 4DMGA 1MDMA 2JHAA 3AXSA 3ZMZA 2DQRA 4E2YA 3KP6A 1NW7A 1ZAOA 2AOUB 4QTTB 1SQGA 3KP2A 5KQRA 1ZRDA 3TLJA 2IH4A 1ON1A 3L09A 5IH3A 2P8TA 3DXZA 2DT5A 3R6SA 2I62A 5K0NA 3X0DA 5DRYA 3GYHX 5H02A 2FBHA 2M87A 3SR4A 2AOTB 3F6OA 4XBFA 1YUBA 3WGGA 4PYQA 3TKAA 1BIAA 2DBBA 3DPTA 3T0IA 2EV5A 4EJUA 3JSPA 3KCCA 2P7IA 5E9WA 2QWWA 1FT9A 2NYXA 3E5XA 4HF2A 3LECA 5LGUA 2DPDA 3HCCA 5HEKA 2QE6A 2O03A 1H1DA 2C7RA 1V39A 3GFIA 4LD5A 4DA4A 1UHWA 2IPQX 1F4KA 2WA2A 1I1NA 4YUYA 4PGGA 4MTLA 4OINF 2IW5A 3AY0A 2PX2A 2VDWA 2KIMA 3K1PA 2TDXA 5BOXA 3BJOA 3MB5A 5FADA 5KVRA 1M6EX 1W5TA 3FUWA 3OFKA 3M1EA 1X1AA 1R1VA 2PWPA 3GU3A 2ZXJA 4HV6A 2VBYA 5FD6A 2QZ8A 3JWJA 5F64A 1I4WA 3G88A 3EGEA 2RNJA 1NW5A 2FA5A 4KDRA 3L8DA 4BLVA 3UWPA 3DMFA 3EVDA 2PXXA 2AN3A 2DU9A 3EYIA 1AWCA 4G7ZF 2CMGA 2PT6A 3N4MA 2XRNA 3QP6A 2VS1A 2HGCA 1IN8A 5E8IA 4LWPA 4RAYA 2IA0A 4QDKA 1G38A 2ZMEB 2XYRA 3HRTA 5CVIA 4ISCA 5DYMA 4FR0A 2Z3YA 3BZ6A 3KLNA 1IRFA 5CVUA 3SZPA 3ELUA 4PDKA 3QOWA 4M9XA 3M4XA 4RV9A 4MQ4A 1PUEE 3HHGA 1XCLA 3C3YA 2P5KA 3F8MA 4PYJA 1LNWA 4RTLA 1F3LA 4HZFA 2L3DA 4NECA 4YFKF 3UA4A 4RSRA 1VQ1A 3KKZA 1YLFA 3DH0A 3LBYA 3ER8A 1RUNA 1F5TA 2UYCA 4Z2YA 1NW8A 3DPLC 3DXYA 4ENJA 5ILSA 3HCAA 3J81K 2W85A 2ZBPA 5KS2A 2GAFA 4TV7A 4WK8F 5HVQC 1MHTA 1G4DA 4I0AA 4GYIA 4EGZA 3P9IA 3QU3A 1JSZA 5IT9K 2YR0A 5HS8A 3WTXC 3WTUC 3LDFA 4FX4A 3K69A 4N9IA 3DXJF 1LB2A 3A7EA 3F8FA 3P2IA 2JSCA 5ICCA 2F5FA 4HTFB 2AVNA 1KU9A 3EVZA 4CO8A 1EH8A 3V8LA 1X1DA 4LLLA 1IM8A 3RJPA 2HYGD 4KT5C 1EH6A 2QQ9A 4I02A 4OBWA 2PN6A 5K8VA 2PT9A 5FA8A 3KPYA 4E70A 3VB2A 3ELDA 4PCQA 4AUKA 1IXKA 2EV0A 3P2EA 1BI1A 3BKWA 3F8CA 1XGSA 5DX8A 1JR4A 5D1NA 1MGTA 2YX7A 2OB1A 2MD5A 3U9GA 5FA5A 5LSAA 3ID6C 1Y8CA 3TDUC 3IKTA 4IV8A 2OXTA 3M8FA 4HBLA 4EM1A 1FBUA 3WTTC 4ER0A 5AONA 3VODA 2P1DA 5DX1A 5C9ZA 5E1WA 4CYDA 1NT2A 5BS6A 4HX8A 1DPRA 1JTEA 2OQRA 1FLIA 3SQNA 1SFXA 3B89A 2PBIA 1G8AA 4WCGA 3GRUA 3RIRA 2QM3A 4DZRA 2EFWA 3AAFA 5L3GA 3PT9A 5FWDA 1JHFA 4R1HA 3CKKA 2IPXA 1RNLA 4DF3A 1HW2A 2ONZA 4AD9A 2NS0A 3A26A 3GW2A 2ZJ2A 2QBYB 2OBFA 1R36A 3FPHA 5K0CA 1R58A 3Q87B 3F23A 3NDIA 5C1IA 1S8NA 4RVHA 3IKVA 3UJ9A 1J59A 3AJDA 1R1TA 2PKWA 5LGNA 3L00A 3W6JB 1ZARA 4Y15A 1MDMB 2Z5UA 2UYHA 4EM0B 3Q9SA 4M6XA 4ZYDA 5HS9A 3WG9A 5K09A 1M0EA 4G6QA 1IY9A 3E5QA 1Z3CA 5DSTA 4Y30A 5K0FA 2LKPA 4F86A 2ZW9A 4ENKA 2DULA 2A68F 2H11A 3D5LA 3LQRA 1TNTA 3GXOA 3KFWX 3I5UA 1HXDA 4R05A 4HDUA 2CSOA 4FX0A 1MJ9A 2I6GA 4QPNA 5FQOA 5CJ9A 4IRIA 2AS0A 1F1ZA 2LNBA 4A0XA 3ABUA 1T6SA 5LHHA 4AZTA 1Q1HA 1XD7A 3KEOA 3NWBA 4R6XA 1L3BA 1P4AA 1ON2A 2KKOA 4LMYA 5E1ZB 3CDHA 1YQAA 2JG3A 3EVGA 3RYPA 1BOOA 4B17A 1VIDA 3ELKA 3FM5A 3O3KA 1N7JA 4L18B 5LRRA 2AXLA 1VP3A 2OZVA 4FP9A 2GH1A 4FT2A 5D4SA 2W25A 2NXEA 3RIEA 3PFIA 3SXJA 4AX8A 2OBPA 2CMHA 3WTYC 4B09A 4BYYA 5JHUA 5BW5A 1D2HA 4EJWA 4LB6B 4YMHA 2PMUA 5HLGA 4X41A 5EHIA 3HRMA 4IHTA 3EEOA 1LDKB 1SD6A 1HKSA 2YVLA 3A25A 4C06A 3HIFA 5EMLA 2WA1A 3QRFF 3C1DA 5HILA 3GRYA 2PJPA 3H92A 4OBXA 4GO1A 4IV0A 3KQPA 1C0WA 3HUGA 3COAC 5EHGA 1J2XA 1NV9A 3RW9A 1P1CA 1YFJA 5EKUA
chains in the Genus database with same CATH superfamily
5TRTA 3N75A 4ZMRA 2KB0A 2W2NA 2IGMA 2QZZA 2VKQA 5CB4F 2H7CA 1LFUP 1A97A 3WC4A 5TT0A 2Z6AA 3T1OA 5AOCA 5H4HA 1TJ5A 1SC7A 3M8EA 1I9GA 4BU2A 1VZ0A 1X0XA 2EU8A 3OX4A 3TX6A 1Z5NA 1GGVA 4P4GA 4AN4A 3EG9B 4HB2A 3LQ2A 4YRFA 2QZSA 2ID4A 5JCXA 3AY7A 2TMGA 2AJLI 4A6DA 3QK7A 4HG2A 1ZCZA 3OZRA 3ZN1A 2E4UA 4I99C 1MNMC 5F2KA 2V6BA 4RPLA 4XLLA 5IASA 2Q28A 2AV6A 4S0HB 1EZ4A 4B79A 3HO6A 4HXFB 2B4RO 3HOUJ 5BOSB 1S2MA 5LHIA 2VLBA 4TZ0A 1RI7A 3ZHXA 4JLKA 2FI1A 3FKSD 2DSTA 4IOJA 3B51X 4ZGWA 5CG2A 5LEKA 2OTCA 3JRCA 2VDOB 4MR8A 4JGGA 4YJ2F 3K05A 4OMYA 4BXOB 3RS3A 2QQGA 5GAEJ 2VSYA 3DE3X 3FXQA 2XGOA 3BA6A 4UBJA 1JAHA 2PAFA 3K4QA 5DEOA 2DO7A 1SD2A 2WJ6A 3ZDYB 3BH0A 1V54H 1P0IA 3FX2A 4YFXF 5ESWA 1ODDA 1NATA 4MW0A 4BO9A 3BA1A 3OEYA 3I8OA 3AEUB 2HOEA 1O94A 3H2YA 3HXOA 4AG6A 4M98A 5IBQA 1Y3CE 2MABA 4NYJR 3OUZA 1VDMA 2PZMA 2ZTHA 2AH5A 1ADBA 5DHUA 1MJGM 2EJTA 1NUHA 1DI0A 4DV4B 1Y1WJ 1XC7A 2ZATA 1R6TA 3I9V6 5FH9A 2I1WA 1I3NA 1ORTA 1A04A 2NU6B 4FYPA 2HMSA 3M4ZA 2CNOA 2EZTA 4ZVSA 1XELA 3M07A 4NHOA 4WFQA 4YAEA 1G8KA 4RJIA 2H52A 3JQ9A 2I4TA 2JJ7A 5CT8A 4LF5B 5EFOA 5GPAA 5P21A 1HQKA 3P9XA 4A73A 4ARCA 5KJCA 3PIRA 1L1FA 3FY4A 4O3MA 2YUSA 1XX6A 2VWQA 4MW4A 3PE4A 3R7AA 2JRTA 4K9NA 3RS8A 4RTRA 2FZ4A 1TT5B 1IDN1 4KWTA 2V9KA 2QD2A 3GZTB 3SOZA 3OF2A 1J00A 2ROQA 4CLRA 3FXRA 5CVRA 3SKYA 5ALLA 5KWVA 4EJFA 2AZ4A 1BL0A 1VC2A 1YQ9A 3OSUA 3NRBA 3HDTA 3COZA 2ZRQA 4RWEA 1H94A 3QX9A 3ETHA 4HXGA 3ZIUA 1P2TA 3OPMA 4JSTA 5KNBA 1Z68A 3OYNA 1RJFA 4HX9A 4QO7A 1RD4A 1YF3A 1E7YA 3KOYA 3GCGA 4HW0A 1PR4A 3NJ8A 4HFMA 4MUNA 2O6HA 3CCQI 4ASUA 4M71A 3ZZ0A 4MIKA 4UMFA 2CGPA 4JEHA 4B6FA 1XI2A 1BGVA 4U0KA 5K7HA 2WQ6A 3WXBA 1R5HA 4BCCA 3HB9A 2X8LA 1TC3C 1I4EB 5F6FA 4DABA 1BD4A 3GGOA 4HS4A 1HSZA 5KKNB 3DCNA 2P8JA 5GADJ 3ZQUA 3AG2H 3AQ4A 4IXWA 2E5WA 5KOYA 2XKJE 3OG9A 2CXHA 1JBEA 1N5MA 1TJYA 3BEOA 4DV7B 5DLPA 1E9CA 3BGSA 3JQAB 2WVAA 1B8OA 3CBQA 2LG4A 3HU5A 5L3ZA 1UC5B 5JARA 1J6UA 4B8YA 3HBMA 3RWOA 3ECHA 4ARAA 3TXYA 5J4YA 1N9GA 3HCDA 5HBRA 1FXWA 1C2YA 4UU7A 4EA6A 3M3PA 4R98A 1XD2B 3UXMA 1E2JA 1RP1A 5C4GB 3UAVA 1E2PA 1O08A 2NXWA 3K0SA 3BQ9A 2FZWA 5KVQA 3WNZA 3RTBA 2G09A 1FFXB 5CLJA 3W79A 1B4AA 5H3LA 4BNLA 1XCGB 3VZDA 5CEJA 5KYXB 3ED1A 1LVKA 2ZB8A 1ULYA 4F60A 2C5EA 1BEEA 3HKEA 3U2RA 5JNSA 3R5SA 3LUGA 3IAXA 4Z3OA 2BFPA 1T4DA 1M76A 2QL7A 4ZXFA 1RTTA 3ETDA 5GY7A 4DLSA 2DUWA 4MV5A 3G3ZA 3GARA 2OBBA 3GOQA 3U9SA 4QRDA 1T4GA 1ZRHA 3INRA 1CR6A 3FD8A 4DIFA 1PS9A 4POOA 1GZ6A 3KXPA 4Z9FA 5LZ4A 3DF7A 3QJGA 4MVJP 4NQZA 4BVKA 2W8BA 3GMTA 1JE8A 2W6JD 1N25A 1CK4A 4CPDA 2NAPA 5BSUA 1MRNA 2PGJA 5BSMA 2YWFA 3BGDA 1TVMA 4W8HA 4I55F 3M9WA 1GCGA 3ICOA 5E3MA 1ZJWA 3ZHOA 3DAOA 3GT7A 5F1YA 1QAQA 3AGPA 1DO0A 4GU5A 4C78A 1FS4A 2PXAA 2JAOA 4XJXA 4RA9B 5IBPA 2QYOA 3G8YA 1FQKA 1DQPA 2GN6A 4M9UA 3JQGB 4P08A 1RJDA 4B4CA 2AF3C 5IT9Z 1E1YA 4HX5A 3O84A 4MV7A 5B1HA 4BQQA 1EBUA 4F1JA 4CL3A 2WSSD 2DMRA 4GIBA 1FX0B 1Z56C 2VHTA 2OPHA 1ZOPA 1WZ2A 2RGBA 2ZRDA 3BR3A 1S5PA 3CGWA 1X3LA 1DG9A 4FX2A 3ZEIA 4ZCSA 1IZ1A 1KQ0A 1RAIA 3D8NA 1RI2A 3T3EA 1N5RA 3BVPA 4B31A 2CD7A 4DR2B 4O2LA 4OIOF 2M4KA 1DWOA 4OKIA 4RH1A 3G6EI 3M49A 4ANFA 1D6JA 2CCGA 2OGTA 2GJAA 4A2UA 2JA1A 4OQPA 4P81A 1UDXA 1Z5OA 5C31A 3KSMA 1HY3A 3I9OA 3LPCA 3SAJA 5I9TA 1CJBA 3L46A 1XEWX 3NVKI 3GCXA 4KPUA 4CTJA 1USSA 1NR5A 2QZJA 3E58A 1EHCA 4HVAA 1XJCA 1SQSA 2W48A 1FMWA 2WB2A 2PJRA 3ZJ5A 3WLKX 2X0KA 4HQRA 2VKTA 2COUA 4JYCA 4HD8A 1C81A 3F96A 3V1MA 3KQYA 4DTCA 4KBFA 2XYVA 2OXIA 3BFPA 2P90A 2BXZA 4PRZA 4P7JA 2GILA 2WJPA 1XWWA 1X1SA 3JQ9C 3QVJA 3ORRA 1P4XA 3PQ5A 3ZK8A 5TC4A 2ZRAA 2B98A 4TYWA 1W5CC 3VVMA 4L5JA 3CURA 2Q9UA 3Q8WA 3V8PA 4LRXA 4RA2A 2YJ5A 2FEMA 4OUDB 1BNCA 2ACVA 1P5ZB 2Q1TA 4MW6A 1E5VA 1MH1A 1WWXA 4Y6SA 2ZYGA 1U98A 1BWPA 2HNKA 4BVGA 1PUXA 3W4IA 4OM8A 2C4VA 4PV7A 5E8GA 1PDVA 4AUMA 1WUIS 2K9LA 3HOSA 4A1FA 4JX8A 1X7XB 3N2GB 5MDHA 1W4BA 2GBGA 1JHHA 5K3BA 2RSLA 2YR2A 1ITZA 5DHAA 1L3IA 4TKVB 4KYWA 1D2NA 4KT6A 4A0ZA 3I34X 1V8PA 3ETNA 1SKBA 2Z9CA 1BROA 2J48A 4NCAA 4UAUA 5BMVA 4NXNB 4KREA 1JPNA 1XXHB 1I4LD 3ZHQA 1UFRA 1BJZA 4BN0A 5KQSA 3RH0A 4DMHA 4EFMA 5KTOA 2JGLA 1WQ1R 5AUQA 1RESA 1FEXA 3AY6A 4YCSA 1P6QA 2H2GA 3MINA 1YIAA 3WWDA 3SBXA 4D9IA 2H8WA 5JJKA 2X9QA 2NT3A 1THZA 3MMNA 1ZI9A 4CUJA 4Z9XA 2V59A 1C7JA 4MDYA 5FR2A 2G76A 1T3LA 4CHUA 3T61A 1ERDA 3TPCA 3E61A 4UXHA 4AL4A 1RHUA 4YIHA 3CCVI 3KZNA 4BVBA 2DR0A 4LSWA 4AWBA 2NYVA 4MA4A 4NCJA 5JIBA 4YIFA 3C3BA 5E8JA 1ZHOA 1UZMA 2RH9B 3M6UA 3HR4A 4OIRF 3IAAA 2NZWA 4JEIA 2K9SA 2XPCA 4WOJA 3T8RA 1ENHA 1YTUA 4KIGA 3RKWA 1FDIA 4V0KA 3GMIA 3S28A 4P1WA 1FW8A 5JW6A 1WY7A 4H0CA 3NBKA 3OOEA 1E7QA 1D8KA 1I6LA 2ZJ4A 4ANJA 3B6JA 3OPYA 1KZGB 3BRWA 3MLEA 4GOLD 1FU8A 3IELA 2ZDQA 2OO3A 3C8DA 1U8AA 2BEUA 4J7UA 4H7IA 1WKBA 10MHA 1Y5LA 3R20A 3JYOA 3E05A 3ZS8A 1AIPA 1QVZA 4ALJA 4AYWA 4KWIA 2K4JA 1WLSA 4PRLA 1JHVA 2QKMB 5K4AA 1G2QA 2MSCB 4PHFA 3SQLA 4MR9A 4F84A 4HPQA 4QA9A 5KNBD 5BQ3A 3DKKA 1U2DA 2HMTA 3K3PA 2O5CA 1Q7EA 1E98A 2CV0A 2HWXA 2R7WA 2CY0A 1ISSA 2R2GA 4WOCA 4MGYR 4MR7A 1QRTA 2BW3B 2XEXA 4FDUA 4L4XA 5E1MA 4YB8A 4WXDA 4X90A 2RCNA 1OJLA 1ZA2A 1DUXC 2MT9A 2PE5A 4GPZA 4U7BA 1H2YA 1RM5A 2KM1A 3BG5A 1FY7A 3M81A 5EKDA 5LQRA 1DTSA 3AM3A 2OK8A 1SULA 3HYTA 1CUBA 4M0EA 2ZB9A 2BGTA 3FRJA 1IXYA 3CW8X 3CX8A 3T34A 4NV1A 1JL3A 5HODA 3E6CC 4XLPF 4PNHA 1ZVVA 1E9EA 5L3FA 1RPTA 1V3VA 3VU3A 4KTTE 5CM8B 4O4IA 1XLTC 3M4NA 4WCFC 2BY4A 3A1DA 1KJNA 3AERB 5GVSA 1SPXA 1WD7A 2CLCX 3K20A 2ZI3A 1F2TA 3KPUA 1IN5A 3BH7A 4TV9A 2CUJA 1CJKC 1GL3A 3RJTA 3LCRA 3NC0C 4A0HA 3U5ZB 2AN5A 1MBKA 3A4TA 1OQAA 2WJIA 1SRRA 4WNCA 5K7ZA 2P78A 3N28A 1F8XA 1IXCA 2O8CA 5LZ2A 1U8YA 3S93A 2VWGA 1ZN8A 3NBMA 2HJSA 1BR4A 5L4NA 1PYDA 3AI3A 1XDUA 4F6CA 3PNBA 5AQ1A 3RKXA 5BUCA 4ZAFA 3ST7A 2BDEA 1HYEA 4FFLA 2DSNA 1WGXA 1X1EA 3C3MA 1O7FA 3HFGA 1W93A 2BGJA 4AXBA 4NCXA 1ZITA 3OZIA 2MBFA 2PN1A 1Y1PA 4NTZA 3MPOA 4H17A 3KQQA 3PQJA 2YZKA 1D09A 4DT1A 3FWZA 4XIYA 5JCPA 3MCUA 3GEPA 3A1FA 4AZWA 4IXTA 5A6VA 5FB3A 1AS3A 2KQRA 3IDAA 2GLXA 1K97A 3JQQA 3IP8A 1DDNA 4XOPA 3E53A 2FPOA 1CDDA 4OJMX 4OIQF 4M9QA 2YXNA 4EPYA 1Q0PA 4LQ4A 4ND7A 1HYGA 5BWLA 2FR1A 3R74A 4QTUB 3WYBA 2XGSA 2YX4A 2XXAB 4ZVUA 4BUZA 3THXB 4X1EA 3CCFA 1V11A 4E7JA 1Y8QA 1R5OA 1L8AA 4IH9A 1Z5PA 4B3TB 1X9IA 3I23A 4EUNA 1WCIA 3KG2A 2D74A 1U31A 3W6OA 1C4KA 4O2RA 2XB9A 3OQIA 1UINA 4WASA 4GXOA 1PKXA 4KDCA 2XX3A 1K6YA 4I1PA 2ZNYA 5JYCA 3EIFA 5JYDA 2Z2IA 4JP2A 1R16A 3NM5A 5DLQC 2IYWA 4BJ6C 1CUSA 1DRWA 3TYXA 3TPZA 2BZSA 3DEEA 3JRNA 5KVVA 1C1YA 5J1TB 3KJGA 3FNGA 1YTYA 1DTEA 1VBMA 5BQXA 4ZAGA 4FZJA 3C43A 2P6SA 4I6ZA 2YUIA 4OXQA 1LLDA 3ZBTA 4C20A 3OMWA 5I8ZA 4CTNA 4OGFA 2GBIA 1X7HA 2J7PA 3WLTA 3GJQA 3BWEA 2NS8A 1W36B 1FYKA 2VXOA 2YXEA 4Y6PA 3K35A 4HAWA 3F9KA 4IM7A 5FT9A 5MFPA 4URVR 2FEAA 2H8GA 3IPAA 3A9UA 4IVRA 1FDSA 3LLVA 2Q1ZB 2GLTA 4CETA 1PGJA 3PKZA 5LDGA 5BMVF 5JI2E 3PI6A 4E14A 4QOGA 3H11A 1YZYA 3NHYA 1NN1A 3KZZA 3SBDA 3BTSA 3HBNA 3OBIA 1FJXA 3R75A 2OCYC 1XA4A 3L7NA 1I2ZA 2EQ5A 2IU6A 3QPTA 3WE2A 2PH1A 4HOBA 1E3HA 1DU6A 1WCV1 4NBSA 4OAPA 1RTKA 4ZICA 2WAQA 2B7EA 3VTZA 4RTQA 4RO0A 1W1WA 4BV8A 4IEEA 1BOBA 1AGPA 2LKCA 3ANSA 2HSGA 2B8EA 4FMCB 3G6WA 3BERA 3K6SA 2H1WA 5H8WA 2EF1A 4KDFA 1G1MA 4XBFA 3DHEA 4MRMB 1YDWA 2ET6A 4L0CA 4ZVRA 4XWOA 1FTGA 2IU0A 1UJ8A 1DRUA 1V39A 4KRYA 1GDTA 3WDKA 3OJXA 2QP9X 4NDLA 5KWIA 1I1NA 4MUIA 2IW5A 1CUZA 2GAIA 1HFKA 2Y8EA 4AIIA 3U0VA 5CMLA 1IUFA 3I9V1 5LOVB 3HM5A 4HV6A 5T7BA 1EINA 1XFAA 1ZBDA 1PQ4A 4WKPA 1MMDA 2WF6A 1GPYA 1QR6A 3EYIA 3QP6A 4XX0A 4RULA 1H89C 4WWHA 2WJVA 2ZMEB 3A2NA 5EXXA 4CFZA 3FCYA 2WIFA 2VJNA 1H5NA 3WJ2A 1IRFA 3SZPA 2Q50A 3ELUA 1IUKA 4W5HA 1CNEA 4RTLA 3KXLA 1QU3A 2L3DA 4YFKF 4LX8A 5FIUA 3EXG2 2IGNA 4ZYXA 2LPMA 3C5HA 5AW4A 1NW8A 2ZT6A 5KS2A 4WK8F 5HVQC 3VI3B 5KHLB 3DNFA 4HNQA 2QMUA 1ZSNA 5B4VA 1TM4E 2QQFA 2CKMA 4XRRA 2ZDHA 1IVNA 4M3EA 2IOFA 1TWAJ 4CO8A 4B6JA 3QMMA 4UNNA 2M7AA 4FVTA 3H9JA 2V6MA 1IHDA 3WLIA 4IWXA 1USIA 2PT9A 3VR6H 3P2EA 2NU9B 5AT1A 5KTNA 1SCNE 2MD5A 3BK7A 2H0QA 1SFKA 1BW9A 4YWJA 3OSZA 1KKLA 2C9BA 2XUHA 3GLFA 1KJZA 2RAVA 5EJIA 1J0XO 1SFXA 2PL1A 4URFA 3SU8A 1WU8A 5FWDA 3N7TA 4FE7A 2Y76A 2ZB2A 5F04A 1JB1A 1S8NA 1K8XB 3M5DA 1GHTA 4OB6A 3Q5EA 2JAHA 4O4IF 2HIMA 3W6JB 5DWVA 1PEKE 2QNIA 2YL2A 1QTQA 4QNNA 1LF5A 3E9QA 3PZBA 3I3SR 5ELMA 2FA9A 4AJ9A 2EINH 1SXJB 4LE2A 4GYKA 5LIRA 4AMUA 1DFHA 1JR3A 5HGXA 4XIFA 4QM6A 2JG3A 1VHLA 5E6RB 3FMPB 3ELKA 1S9DA 4TVSA 3PF8A 4OJKA 2Q4EA 5HNFA 2GOMA 1MDFA 3UWMA 4ZJPA 3GPLA 2OKGA 4V0SA 2QSHX 4YMHA 2F4IA 5CK4A 4YDRA 1S1MA 2C4WA 2IT1A 3GRYA 5L3SA 3FNIA 2YYAA 3TGLA 3Q5DA 1TAHA 1PS0A 3HUGA 4ARBA 3MJSA 1NV9A 3KDSE 1G5PA 4QE3A 3DMTA 5T8KA 1REQA 3P4UA 4F5YA 2NLOA 5BUSA 3RG8A 1CKEA 1SCQA 4JZKA 1YI0A 4UUOA 4HXEB 2G7ZA 1AK2A 3W77A 1FDOA 2QORA 4S0ZA 5DCWA 5LM3A 3QELB 1V37A 3OF5A 3HKCA 3V8RA 2AW5A 3CC8A 2IT0A 1MBHA 1YHNA 4PICA 1Z0JA 3CTAA 4AZSA 2A5LA 1AHDP 2GZDA 2IOFK 4IKEA 4YJKA 3ESXA 1RIOH 1BC8C 2IS6A 4RGQA 2IKQA 4IDFA 3EEQA 4IEJA 4LYYA 3R8XA 5BPIA 3U1VA 2GIZA 2J3KA 1S89A 1EVYA 1WKCA 4YV2A 1I5EA 4UVBA 3IVXA 3JQ6A 5J1YA 2ISCA 4DR5B 3PNKA 4RPHA 3ZKWA 2E71A 1ATZA 4HDSA 4URXR 1LDDA 3F71A 3CF6R 1YS2X 1I5OA 4JI0B 2A6EF 4RHYA 1N8NA 1YS1X 2FMIA 5KPJA 5JLXA 3C4JA 2QL5A 3B13B 1M1NB 4YRCA 5CAEB 2GXAA 4EPTA 5AM2A 1C3VA 3AP3A 2NNNA 1PWEA 2FE4A 4KBYA 3EGIA 3LUHA 4I1RA 3CUSA 3WLSA 5BQOA 3JAKB 4B46A 2LXNA 5CTAA 3X2SA 1HC7A 2BCJQ 3K96A 1KYTA 4C07A 3K70B 3RU9A 1NMQA 4WBSA 5EA2A 1AA9A 5DTQA 1ZUNA 1N2CB 3IKMB 5ALIA 3ZD7A 2JLCA 2QLTA 4DQUA 1U6JA 1TLHB 1N9KA 3KTAB 3OOYA 1Y0NA 1TM7E 1HOMA 5JJ5A 3ZTYA 2JGRA 1FMLA 4JUIA 4B35A 1MB3A 3SX4A 1FBTA 2BW0A 1OI3A 1VYUA 4DY4A 1ISRA 1XKTA 1UT8A 4TMFA 2HKIA 2FFHA 2GM4A 4FDLA 1J97A 2ZSHA 3R7BA 1PSWA 5ADVA 4UMDA 1MTOA 2OYCA 2WIAA 2J7PD 2YRXA 5HFJA 3UQZA 2I1VB 1S01A 3HS3A 3BWCA 1VJ1A 4S12A 1Z5GA 2IIQA 4RAQA 3E6MA 5A7HA 2XDVA 4YP9A 4L0QA 5CKTA 3P5SA 1VMDA 5ADHA 1NOKA 3K9WA 2GSWA 2PIAA 3UT5B 4FN4A 2YXLA 4MRAA 4CMIA 2ETVA 4GPAA 2EFGA 3V2GA 5KQMA 1KNXA 2JJMA 5I8PA 1XB2A 3SS8A 4GM4A 1HEUA 1YX3A 5IWAB 5TRDA 4BC0A 1EXNA 5A4AA 4ZTUB 4QQFA 4RESA 3RSFA 3IQHX 1S6LA 2IXAA 3DV2A 3IPXA 4HZGA 2DT7B 3HTXA 1C9NA 3D6UA 4TV8F 5K3FA 3PKJA 4N3AA 5LPNA 3W7AA 2XSDC 4J3JA 1GUAA 4DHWA 3HWSA 1SIBE 2JIRA 3Q9VA 3NARA 2D45A 4ZVNA 4KKVA 3WWYA 3KK0A 1EFHA 4HMPA 4CA0A 1H0HA 2JFUA 3LOPA 2IGKA 2YVAA 1WUHS 4QUGA 5CEFA 1M5TA 1QK5A 4XJVA 1I94B 3KCQA 4A0SA 4HX7A 2O05A 1D8AA 4YRRA 4FKMA 2Q3BA 3GD7A 3ASYA 4ZEWA 3E2MA 1VFNA 2ZUSA 4LNUB 3V33A 2K5CA 1MENA 3O6BB 5CCXA 2BTQB 2E9SA 1I32A 2V3VA 4TQ9A 3P52A 5F08A 4A03A 3I4FA 4Y6LA 1A27A 3SF8B 3FDFA 1KH2A 1T9CA 2WC1A 3QKSB 2CZQA 3VZRA 1Y8RA 4CM7A 4RF2A 4FYXA 2EZKA 3BR6A 5LP6B 3F5MA 2A07F 1T2UA 3A4MA 4L85A 3PNVA 4B2LA 4C0QC 2R00C 1U3EM 1H88C 3FYSA 2VBWA 2IHZA 3WGIA 3WLFA 1R00A 3EY4A 2OB2A 1WEHA 1XO1A 1JLLB 1QYDA 4JBLA 3TL6A 2GBLA 4W7HA 3KZKA 5CFRA 2PSJA 3AB3A 1GGKA 1MAWA 2ZZKA 1CF4A 3I62A 1D9XA 5EESA 3CO7C 3ZUPA 4FR5A 5KB3A 2HU9A 4ZCRA 1CW2B 1WPKA 2AOWA 3W3CA 3CVUA 5KQGA 3G5LA 1N9ZA 4CCMA 1PT7A 1NJ2A 5DCMB 3O1IC 2ZT7A 1HC8A 2KJQA 1XTIA 2B4YA 3AB7A 3ET5A 1VXOA 2YY6A 1GITA 1M6HA 1G21A 1S9HA 1TTHA 1SQ0A 1T9BA 3RVKA 3L07A 4IJ6A 3LKDA 1WMAA 1T13A 1V47A 1PWZA 3QG5A 1L4LA 5AKZA 3QPAA 3O90A 1KVQA 3B3GA 2QD3A 3QXHA 2KDOA 5HLIA 1FZQA 3CM0A 3G2JA 2NGRA 4AM3A 4K6MA 1SPBS 5JVDA 4TTSA 1JAZA 2BFDA 4ENVA 2AD1A 1JHDA 4IRXA 3CE9A 1QYRA 4M6WB 2JGAA 2C96A 2PKQP 3GMSA 1VIMA 5LB4A 3QWHA 1FTYA 4J0GA 2X6YA 4MKGA 4JYPA 5AOBA 4CHGA 2YU3A 4D0PA 1QG4A 3FWKA 3K2AA 4N4NB 2UYQA 3A6ZA 4JJEA 2PJUA 3IESA 4KFSA 2GRJA 2XDYA 3ZQ6A 3P9CA 1XQ9A 1NIJA 2FJ1A 2VC0A 4ZVOA 1J06A 4V1CA 4JYZA 4UZFA 4JC8A 1DDGA 4OX9Y 1F17A 2I7CA 5E3OA 5HS7A 4IEIA 4C0XA 1MPTA 3NATA 2XPUA 1YIJI 3ZWMA 3D7LA 5D5WB 4R9VA 5ELXA 5DCFA 1R5GA 4RD6A 5EYPA 1L7QA 4IJWA 4IFIA 4WZ6A 1DGRM 4BMPB 4F3CA 3A36A 3AEQB 2CJPA 4N5HX 5LDDC 2HDOA 2Q0QA 1VJRA 3UATA 3K1AA 2JW5A 1MF7A 1KMMA 2ON6A 2WG0A 1GEGA 2WYVA 3ESWB 4ERNA 4O29A 3IA2A 4F2PA 3EGWA 5A9SA 3IQIX 1U7XA 4GGMX 2W2LD 3IE0A 2WKQA 2Z9DA 4IHVA 2H6CA 3EF0A 2ZIWB 2BI4A 2CLLB 1E2NA 2BMVA 4G97A 3TZ6A 4ER3A 4XSVA 3U48A 2A88A 1NBEA 4CF4A 1R27A 2FFRA 1NQTA 1Y80A 4M49A 3PPWA 2OM6A 2CHQA 3ZXIA 4QPPA 2XY4A 2KIFA 2KHZA 1KAHA 1LS6A 2XQJA 4X62B 1X80A 5KOJA 4XRSA 2REBA 1IV6A 4BWYA 1G19A 1S4MA 2PD3A 4UM7A 3V4PB 1XXHE 1QH8B 1E3MA 2Y68A 3NW9A 1JHYA 3E8XA 3IMCA 2VT7A 1T1SA 4DAOA 3EG5A 1YW7A 5I48A 3L2CA 4R2LA 3ZHRA 1XJQA 4D0LB 3D3JA 5FPSA 1U28A 2Z57A 1PT8A 1ETQA 1ZG1A 1MJHA 4R2WA 4IMJB 1BI3A 3AV3A 3UUEA 2DMNA 1IL0A 1VL6A 4UOQA 7ADHA 2QTBA 4MQ6A 3PT5A 3SS7X 5TQVA 4YRGA 1F8FA 3ZE7A 4M21A 3K1NA 2AXQA 4J9UE 3M7IA 3QPDA 4IOAF 1FVOA 1XN4A 1TM3E 4YRLA 4IDHA 2GSDA 3FMIA 1WX1A 3P45A 1LBHA 1FFSA 1T10A 3AI7A 3I01M 2E2HJ 4DXHA 3TM5A 2HA4A 2BEWB 5A5EA 3QLVA 1T3TA 1GGEA 3O4HA 1EKEA 2Z56A 5J23A 2JLRA 2GYVA 4IEFB 1V2HE 3EGXA 3VKFA 1JKOC 2AUTA 1GV5A 4PC6A 3UIEA 4FONA 5LU8A 3SMQA 5BWNA 4GLLA 5LLSA 3HDJA 4EJ2A 3T7IA 2OTLI 1OAKA 5JAQA 4PCLA 3F8TA 1UOOA 2J3LA 2WYWA 2Y0BA 2QVGA 9MHTA 4QXMA 5C0OE 3U3JA 2YJTD 2YFKA 2XRZA 4R8SA 3P4YA 2FMYA 4HH3C 3BM5A 1VNDA 2PUWA 3NU1A 3QKRB 1CF9A 3HA7A 4DSTA 3DMPA 1K78B 2EFJA 4F04A 4ZT4A 1O97D 1SK9A 3AHFA 3WK7A 5ADWA 1XQ1A 3V7YA 2R11A 3RB8A 1PL6A 4IUBS 4KXWA 4CL0A 2F5EA 3MW8A 4JH0A 3G2OA 3QLUA 4AY4A 1YT5A 4UATA 3L7MA 4IDAA 1LDMA 3A6EA 1WPXA 1PJ4A 4R51A 3ZDAA 1EUYA 3VR6D 3G0CA 4JHXA 1NUAA 5FA6A 2C29D 1F9NA 2DA7A 2FU5C 1XGMA 5KX5B 2QJTA 4R68A 3PLAE 2FD5A 4UFNA 4HN9A 3W0LB 3G2NA 1IN7A 1O96A 5CIQA 4OJTA 4HH4A 2H5LA 3UPTA 3QOFA 3VFZA 3HYCA 1JXMA 2AG6A 2AX4A 1XE3A 1U5CA 3UJ7A 4DDTA 3SICE 2E4AA 4BE7B 5U9CA 2FW8A 2UAGA 1P4SA 2CO5A 1ZI8A 3MKWB 5G1OA 3T5MA 3TGNA 4UARA 2XUKA 1KYVA 4PYRA 4P22A 1QZUA 2PUEA 5HQ3B 3M1IA 4RWZA 4UNRA 3KS9A 4NULA 3LNCA 1PX0A 2MSNA 1Y4AE 1NXPA 1YFHA 4MVJA 4DIUA 3Q41A 5ANRB 3TAUA 3TDKA 5A2GA 1Z91A 2ZTLA 3K92A 3ACDA 1Y3IA 3ZVMA 1Y6GA 1HH4A 2QUJA 3G17A 1YSCA 4JUAA 4D0SA 2LMDA 2VQ3A 1U0NA 2WPDD 2X6TA 4UPEA 2QV0A 1V6CA 1AUPA 3DOCA 2ZJOA 3M6AA 3A6FA 3VISA 2E82A 2FQ3A 1CVLA 1MAUA 1N0IA 3Q8KA 2IZ0A 2XMGA 3W6PA 1YRBA 2P67A 2JIZA 2DFLA 3N3BC 5DOZA 2DPYA 2NO0A 1Z3IX 2VH1A 3DTTA 3C87A 5BW4A 1GT91 4IFTA 4NBLA 2UXXA 1KI8A 4JQOA 2G1PA 4KI7A 4CMKA 2BKUA 2LDUA 3F5SA 5FOVA 5IT5A 3PSIA 5ED4A 4J0DA 4CHTA 3TQIA 1W47A 3B85A 1FUUA 1VJGA 1I6MA 3COYA 4HAZA 1E5XA 5DO9A 5T3YA 1OLXA 1A98A 1Z74A 1CX9B 5F1PA 1E7RA 3FPLA 4M74A 3SM9A 1EK0A 1ZRCA 1JZTA 5EZYB 1OMOA 5CDYA 2AOUA 2DOEA 1DJOA 3ZH9B 2AZDA 3NBZC 3MRVA 4FFWA 2FPXA 1J22A 2H9IA 1CE8B 1JEDA 4RH3A 1J8MF 3KZMA 2BJVA 4P3KA 2XVZA 4ZD6A 4R0MA 1PN3A 2QN6A 2GYUA 2O2SA 3EARA 1UZNA 2QN9A 4BNVA 1JJAA 2QRVB 3O93A 5B30A 3R5XA 3K5HA 2O3FA 1E96A 1SFEA 2M8EA 1BVRA 1XMQB 1R5NA 1VKHA 3UTCA 1AH2A 2HHCA 1J56A 1JR6A 1NWHA 2ZSIB 4BXFA 2VRCA 2QTZA 3E35A 4AP9A 2VJMA 4PPQA 4RNCA 3DO8A 2EJVA 3C74A 4REQB 3LWZA 2XUFA 1FDRA 1N8SA 4FFPA 5A7FA 5EZSA 2KLOA 2I6XA 3BPXA 3QLVC 4MUGA 5KYVA 5FYDA 3E97A 3N7AA 1JIQA 2PX6A 2QXUA 3CNQS 4V39A 2PEYA 3SBOA 1I2MA 3BDIA 3ROFA 3HSSA 3TI7A 5IG2A 3E9YA 1D2EA 2AFRA 4WI1A 5TR9A 5J4HA 4E15A 4RW0A 4UPVA 3QFHA 2ZS8A 1D07A 1GTG1 5AI0A 2LW7A 4KYTA 4COOA 4FLMA 2WV0A 1E2EA 2A0YA 1JDPA 2GN1A 1CR4A 2VDMB 3CTPA 3DEFA 2I71A 1XCBA 3OWHA 1QX4A 1CUVA 2BMDA 2FZCA 2AC7A 3AU9A 3WGHA 1TQ4A 3S1AA 3KV3O 3R0IA 2BONA 1XZAA 2J85A 1W7PB 1H9GA 2H85A 3IAM1 1PL7A 3AUYA 1U3FA 3UK6A 4ZDWA 3T3IA 1RKUA 4QTXA 4UTZA 3CCUI 4OQXA 2IA2A 3GG2A 3N2EA 5E79C 4FIZA 4X91A 1YBMA 5JFRA 3DAGA 4A2CA 1JEQA 1GG9A 4W7IA 2RKOA 5JS1A 2HFJA 3TO7A 4H3KB 2O6GE 3Q11A 5DHPA 5HRCA 3KHSA 2F1JA 2X5JO 1M6NA 2V9VA 1Z12A 1I0IA 4HNTA 2JHAA 3S7ZA 3JYLA 3ROZA 3PDJA 1B72B 3KP2A 2VQCA 1ZRDA 4BGEA 5K8TA 4WECA 3M89A 4KUEA 5F7OA 3KXIA 2GF2A 4HJRA 2VJJA 1L7XA 2QMEA 5J2TA 3I04A 3SR4A 5JZOA 1ORRA 2FETA 4HNAA 1PL8A 2EV5A 1A5JA 3L92A 5WRFA 2W7NA 1AUXA 3SK0A 5DXFA 1G8MA 4UTNA 2QE6A 5AK6A 2W42A 2QTWB 2AMFA 4MQUA 1G4UR 4ZHQB 3KJHA 4FEYA 1MV5A 3LZCA 4KP7A 1EDBA 2XMSA 1AE1A 2B34A 3U4AA 2IEKA 1GP2A 1I4WA 2I8LA 1QOQB 2CZCA 3EVDA 2O8DB 1LRKA 2FUG2 5TPWB 2HGCA 2RGGA 4GXQA 1S7GA 3QHQA 4NYJQ 5BV0A 1M1YA 2HYJA 3WL8A 3WK8A 1F3LA 1E1KA 1LBSA 1R0BA 4B3IA 1PUIA 1RKXA 4ROSA 3LBYA 3C6QA 1SUCA 5FNVA 1XKLA 3EX7C 4OY3A 1KL7A 3H0DA 5AESA 5ALTA 1JBQA 3H1AA 1Z7GA 4FCYA 5AUNB 1YRQA 5E4YA 3LQYA 3RC2A 3UAYA 5CA1F 1X42A 1QVAA 3F6YA 3F8FA 4BN5A 2D6FA 4HTFB 2B7BA 2AVNA 2A1TS 5T4BA 2E21A 3OUUA 1X1DA 1T2AA 3ONFA 2FMUA 3KVYA 4WN3A 1GY8A 2Q7XA 5FA8A 5H70A 3KPYA 4YAGA 2JA2A 4E70A 4D9FA 1EBBA 2GVDC 2HNHA 5D1NA 2AF4C 4TYQA 1P29A 4XDHA 3U9GA 3AVOA 2NO9A 1E6MA 4EM1A 1SIUA 4M0FA 4EVSA 2CHEA 2FX0A 1H8ED 4CYDA 2QIPA 3U7HB 4CT0A 1DPRA 1SXJE 5EWJA 2PBIA 4YVFA 4S2EA 4EI2A 2HQOA 3C1OA 4X6UA 4M1EA 4BKRA 4ZCIA 2QX7A 5K0CA 2FJ0A 3RIMA 2NUPA 1IC8A 4GMGA 1XZCA 5GV8A 4PXYA 3TI9A 2ZW9A 3GIDA 1D5WA 1EESA 1NXOA 1H4VB 1I2DA 2C3PA 3KEOA 4UUAA 2PSEA 2NO5A 3EVGA 3RYPA 3RS4A 1XPOA 1ESCA 1TD9A 2IUUA 3FM5A 1FY2A 2AEEA 5BV1A 3ABSB 3QEKA 3FISA 4FP9A 1DFGA 4MH0R 5D4SA 3JATA 5L4SA 2WWRA 4ZJZA 2AE2A 5BW6B 3PFKA 4ME6A 4YX9A 4C0AC 2ZE8A 3E9CA 4NCHA 4JIMA 2XBUA 1Q7BA 2ID7A 1T25A 2CEAA 4MLOA 4KE9A 5CXXA 4COKA 3RF7A 3PFWO 2H8RA 2WV9A 5LA6F 3ZK7A 4DJDC 4GO1A 3C98A 4UMVA 4K9OA 4D6YA 1XMPA 3PGMA 4NCNA 2BVMA 3DBHB 3EUEA 2YDYA 3LUJA 2XCSB 3TKLA 3KAJA 4UBMA 2C5GA 4YJ3F 3LA7A 2ZJ6A 3I42A 2VF7A 5EMJA 1GGHA 4WKCA 4OXYA 2M6RA 5AIQA 3KCNA 1I1QB 4BDYA 1O94C 3ANNA 2F2EA 2EAUA 4AO7A 3QNMA 1OE0A 5TQJA 3BGWA 1BG6A 4EATA 2X9DA 1RCFA 4WX9A 1K6JA 2OCXA 1M66A 3CEPB 5L45A 1X8KA 1QGAA 2L69A 2UWMA 4NDAA 2JLSA 1TU0A 1CNFA 1HTBA 1XHEA 4B1RA 2X1EA 3HOYJ 4C4ZA 3GCMA 3G2MA 2XAFA 3LL7A 2EWNA 4ZAXA 2EWVA 3QVUA 1Q5PA 2P2NA 1PW5A 4FGLA 1L7OA 4A0YA 4EY4A 2FN3A 3KP7A 2I6FA 5EMMA 5DBHX 1YOVA 3E0JB 4OHCA 1SZJG 3G8BA 1WJCA 1FMFA 4Q1CA 3LKVA 1JQEA 1YA6A 1GUUA 3NVAA 1N2CE 4PSDA 3HEAA 3TOSA 3GT0A 3QBDA 1UPAA 2R5FA 3GO4A 3GJ6A 3BTIA 4MHSA 1A7AA 3GFMA 3L93A 4EF5A 2ZFUA 5IEBA 2PK3A 5JCOA 2NVTJ 2XKBA 3JRHA 1FYMA 1HX7A 2O2JA 4QSMA 1LBTA 2PXHA 2HT6A 3IALA 1PHRA 1AD2A 1GFSA 4L6CA 5IP9J 1Z21A 4A27A 1W2WB 4LDJA 4BFXA 5E95A 1QBJA 1N1EA 3WWZA 3A4YA 1RHQA 4H7JA 2VRCD 5TVGA 1S7EA 1A7UA 4HDKA 1OLSA 3DTEA 4I98B 2IXDA 4L0YB 1HRDA 4FDVA 3UBTA 4ON0A 4MYSA 3EQ7A 1QORA 2R6DA 1XRLA 1JWLA 3OQPA 1XMSA 4KSYA 1AB6A 1ISPA 3HBJA 3RNOA 1X8JA 2VWHA 5JYBA 3GLSA 2ZYRA 4QBHA 4WW0A 4Q01A 2MC4A 3WKEA 5KYWB 2WV7A 3OI7A 4E5YA 1ETUA 3ITEA 3V7RA 4UUVA 4QXQA 1O94D 1Q1BA 2VQGA 4NOJA 4V1CI 4U2KA 3IURA 1L6IA 3DB1A 4YRTA 2BD0A 4MO9A 3CF2A 1IGNA 1JSCA 1N3LA 1BA3A 1NW4A 2CF6A 2HU8A 3DC2A 2EP7A 2QNRA 4YJGA 3PXXA 4P7KA 3F5FA 4BE9A 3Q8MA 1MO6A 5KNCH 1YE9A 1FP2A 1QH1A 5KYUB 4GLFA 1KVSA 1UBCA 2GZ2A 4NH0A 4NVRA 3BEDA 4D4GA 4HSRA 1KZ6A 4BHTA 2JFNA 4MHOA 3HDQA 5LXTB 5LZ7A 3WYCA 1Z26A 1HI9A 2J87A 5K01A 2NTNA 5JSQA 3E27A 3DKYA 4P38A 3DTYA 5D5VB 1QDUA 4ESJA 3VZSA 2DLCX 5D5HA 3ZCXA 2ZYWX 4ESFA 2WYUA 2CDRA 3UMGA 4Y67A 4AF6A 4BHBA 5C8XA 4QYMA 4FNMA 1TECE 2ZUTA 1JNYA 1SA0B 5HA5A 2KQUA 4UCWA 5AJWA 1UM8A 2QVBA 3KSBC 4HAMA 3I83A 5JG7A 1N6PA 3PGXA 2BGRA 4AY6A 2DH5A 5JI3E 2LVBA 1BXZA 4ID9A 3NORA 3L2QA 2UKDA 1O4VA 2RHMA 3VNQA 2Q4DA 5FNVF 2KPMA 5FD8A 2FQXA 3F6CA 2XOEA 1FXWF 4NIMA 4RHEA 2QRJA 2II6A 3S8EA 3IO3A 2BE9A 2BBWA 4Q1VA 1IUNA 4ASUD 1AGYA 4DBLC 2R25B 2AFVA 1RZ4A 1A8PA 1WDWB 1WVIA 1N4AA 4C30A 4G0PA 4LWQA 2P6PA 2PKXA 1F0KA 3AG3H 3N87A 3BG6A 4RK0A 5TJJA 2FJUA 3JZFA 1SELA 1L9XA 1PSZA 4EUKA 2W2KB 1GPH1 1KFBB 1B76A 1QGED 4C7KA 3RNLA 2BUCA 4TUYA 3IERA 2Z98A 2GZHA 3LUDA 3HVJA 1Z0ZA 5TY0A 2KL4A 5K1ZA 3HI4A 4AZ3A 4MUAA 5KVCA 4RJKA 2AYZA 1JHRA 3KKQA 3TLGB 5IN4A 3IV6A 3KP5A 4AECA 1UXJA 4IUDS 2UZAA 4HI0E 3N59A 4ESBA 4HNRA 2QLBA 4F8JA 4B85A 3JQEA 5EG0A 2DZDA 2BBTA 4JD5A 1Z6YA 1EUDB 3AL2A 1ID8A 4W1UA 4XQ0A 2QGZA 2Y48A 4GI1A 4JZYA 2CZGA 4R8KA 2E1RA 1DCTA 1H2WA 3CR7A 4B4DA 3K9NA 4JQZA 2FUEA 3P0JA 4QSHA 1EYZA 1FK8A 4KAJA 3SCZA 4L8YA 3K2ZA 4CMBA 2NAZA 3FOCA 4G07A 5A7GA 2NG1A 2XYQA 3EPRA 3AM4A 3I4PA 3TO5A 3J7AC 1G7TA 4R7ZA 1XDZA 4E0BA 1EK5A 2VJDA 4HUTA 2COMA 3AH8A 4BKXA 4MGIR 4HJXA 3FDXA 4A82A 1VZ3A 3AF3A 4IR7A 2VF2A 4BKQA 2Z6VA 1X7WA 3OTOB 2ZI5A 5D8KB 4CLDA 3RSLA 1M6VB 3AVYA 3FG9A 1IW7F 1EWVA 3M1LA 2H63A 5DH9A 2K4BA 2XNDA 2QEXI 3ASVA 3RRXA 3A2MA 4L22A 6ABPA 4MWCA 3ICEA 1ICEA 3A9SA 2I2BA 3KYLA 2BFCA 3CNEA 1UG2A 4ND6A 4RCYA 2PRJA 3ZIAA 3HOTA 2XVYA 3TR6A 3ABTA 1TYAE 4JUDX 3GRKA 2LUOA 4JYKA 4P35A 3QTTA 2NW6A 3E3MA 4CEHA 4R5MA 1MJFA 4B76A 1J2YA 1PUFB 3GP5A 3V80A 3QOYA 3OTGA 1X74A 5KJ1A 4Q9IA 4NNOA 1Z25A 4JLVA 3Q0UA 3CZCA 2JFGA 4W5TA 2N3ZA 1Q16A 2GDZA 1V8BA 2DCMA 2HS5A 2RD2A 2KRHA 2YWXA 1B9NA 3GVHA 3UG6A 4YLGA 1K6OA 2VH5R 1VLQA 3MWJA 4J0IA 4PQRA 4NQWB 5KK1A 3JD0A 5B1AH 5KNCA 1I3CA 3IVRA 4RUKA 1Y3BE 1PF7E 3I6MA 4M22A 4ENPA 3UJDA 1W87A 2HI3A 3N8DA 1J7JA 4U7PB 2DCUA 3R9IA 2A92A 5KO2A 3H4MA 2IIBA 3TNLA 4NBRA 4B4KA 3JASB 4LG0A 3E18A 3L8EA 4B4WA 1A8IA 2M0CA 2X0LA 4PLHA 1U6GA 5AVWA 1JKMA 3OE7A 2V7BA 1NU6A 2GJ8A 1J25A 3QSGA 3PSFA 1VHWA 3E82A 3HVIA 1K61A 3QI7A 3HVKA 5CLLA 3TMKA 1Y6FA 2V7XA 3FSJX 5C8YB 3LSJA 1CF2O 5B6JA 2VOEA 4UDOA 5H82A 1VSBA 2GJ4A 3FIJA 2YMLA 3M2TA 4BNWA 3FE2A 4FFSA 4OK3A 4IHXA 2ZJAA 1GSAA 3E3NA 5IPAA 1AG9A 4CYCA 3IODA 4I8XA 3ERMA 4DG8A 3R76A 4ZYZA 4PWYA 1S8FA 1G5QA 2WLSA 1UKBA 1IFXA 2XDWA 3KE2A 2NU7A 5HDBB 4KQXA 1YR2A 2HNAA 3T5AA 2H6EA 3BQZA 4JOBA 3NONA 2ZS7A 4W6ZA 3ZQHA 3DZHA 5C1DA 4UEWA 1U2DC 5TV2A 2A7XA 1G9TA 5J9FA 2JKYA 2I3GA 1TYBE 3GLLA 3EHDA 4P83A 5L7YA 1P9OA 1ZRNA 1ZVQA 3SZ3A 4PYLA 4L16A 3EZ9A 5D87A 2AN9A 4BP3A 1G7CA 1TM1E 2IZOA 1Z0IA 1M8PA 1V4RA 3KB6A 4P0QB 4FGJA 5T6MA 5TSDA 1VHTA 4TWZA 2PGIA 4LDNA 4JLAA 4B8WA 5HF8A 3M7GA 4U39A 4CDGA 1QHHB 4HWRA 5B1BH 1SBQA 2FDXA 2FE1A 1JA9A 1OWLA 3WLNA 1AGXA 1XZEA 3V42A 3IXQA 3B6AA 1U1DA 2WM2A 2M7BA 1XMKA 3KEQA 4GKBA 2B3TA 1KO7A 1U94A 4YJHA 2H94A 2DM6A 2ZE5A 2EL9A 4ITVA 1YTLA 2ZT8A 2NM0A 1SCIA 5EKSA 5D1HA 4AWXA 1ULAA 4XKVA 3GJRA 3IQDB 3TMAA 2B8WA 3DEUA 4ZEXA 3LVQE 1XQWA 1QPMA 4BZWA 3TZHA 3FB1A 5KJEA 3CCCA 5K6AA 1GAXA 3MG9A 3P7NA 2PUTA 4M7OA 2V5VA 5ALHA 5T57A 2ONCA 4KAAA 1XTSA 3N2ZB 1R49A 1B6TA 3WRWA 1QB7A 4K81B 2HRDA 1DJQA 1XNQB 1NBIA 1DL5A 3HKZN 1QUFA 5IJXA 3FMFA 1C8KA 4LYJA 3VUFA 1L5WA 5JC1A 1JU4A 3TPFA 4B5KA 3BRWD 1N7GA 3G4SI 2GXQA 4E5VA 2QEQA 4EG0A 5L3VA 3DC7A 3QMVA 2H4ZA 1Y3FE 4HZUB 1PNQA 1OFIA 3C16C 2IWRA 2YHSA 4C87A 1OF1A 4F7ZA 4ZO9A 4K9PA 3K1TA 2TRTA 5HUHA 1KQ3A 3MELA 1N78A 3C14C 3L5KA 6ADHA 2HOSA 1EJBA 3TINA 1I7PA 4QJBA 5AOAA 4GMHA 3GFRA 2PLFA 4O5VA 1KJQA 5EGOB 5AKXA 3OAAA 3TF5A 4IIHA 4XCXA 1U7ZA 4TUYF 3BD6A 4TLBA 1HDRA 1M5RA 2A5JA 3UQYS 1UOPA 3LC7O 1LVGA 3FJOA 4RD1A 2UZ1A 5F33A 3L6UA 5L40A 3HY6A 4KQ6A 1AOXA 4QNMA 3L1UA 2HZBA 5DGTA 3UCFA 3N74A 2NVWA 5J2UA 4TV9F 3HCBA 2IXTA 4EHKA 1G3SA 9GPBA 2YW9A 1XRMA 3NM4A 5CVDA 3EPJA 4XB6B 3O83A 2H09A 1P9NA 4XAQA 4CLOA 2GPBA 1R6DA 1EAMA 3TIIA 2ZJQF 5CK5A 4O25A 3ZK9A 2V4JC 5AYVA 5ALKA 4ZU1X 3Q3CA 3RHSA 3OZSA 1LNQA 1PZFA 4QBGB 1NUUA 3A27A 2G8LA 1ULHA 3JD1A 3C2QA 3VTKA 4J07A 5HBGA 4CG2A 4FZ5A 2FCAA 5A1JA 4Y33A 1VKJA 4Q5SF 4XJSA 2FDRA 1T33A 4PHGA 3C7DB 2BDTA 3BG9A 1UXOA 4Q48A 1IE3A 2LDXA 1GXSB 3CCLI 2D1YA 2J9FA 1TMYA 1HT0A 3NETA 2CXTA 2O59A 4CKYA 3H1GA 5A02A 1VIVA 3IOMA 4LITA 3AUSA 4HQNA 3HU3A 3RKSA 5DI9A 2V9CA 1KJIA 2P3LA 5EVCA 3WRXA 1HYQA 4G09A 3VPRA 3NHLA 3TUIC 3KX2A 3OIDA 4UKDA 3ZD6A 2V79A 1WOMA 3AWIA 3W90A 1Z6XA 3VU8A 4UFOA 1P0QA 3PKIA 3QIVA 3U09A 4CL2A 1Q0HA 2Y30A 2H2FA 2AEFA 3A9WA 2QY9A 1N77A 1JNXX 4TSRA 1KOGA 2AHOA 4XQ9A 5LIPA 4RTMA 1GZUA 3T5BA 3RAEC 4J8PA 3ZGOA 4NJEA 1EXWA 5I7RA 3OZXA 1UXGA 2ZI4A 4PC2A 2QSJA 4OJYA 3I5XA 2YXBA 3R7DA 3O03A 5JY6A 2B0CA 2PVPA 4O6JA 2BWJA 1GU7A 3RVRA 3J7YJ 3SDZA 3TP3A 1OW3B 3NEPX 5DK6A 3BMQB 3W5VA 3PS9A 1Z75A 1BMTA 5EE1A 5I7AA 3H87A 2A6TA 3F67A 4D4IA 5CIYA 2ZWAA 2RCYA 1V3TA 4ICIA 2QAIA 2XNDD 2BF4A 1SQ5A 1XZMA 5IDVA 3FNHA 1SO8A 4RL4A 1Q12A 5E3HA 1S2DA 1C30B 5IJZA 2ZYAA 1V8FA 2HTFA 2GWRA 5HM6A 4A26A 2JBHA 4RM3A 2NUBA 4HQKA 1QGDA 3SZRA 2HZTA 1A9SA 3B9RA 2FFAA 5DW3A 3CEMA 1NX9A 2RK6A 5M5BA 3EIOA 4G1FA 3BJMA 3Q5FA 1PZNA 3DFMA 1IEWA 2O2DA 3OX3A 1N7IA 3V1TC 4N3NA 4CG0A 3C1AA 3VR1A 3DJYA 4K6CA 2O3QA 1ZK2A 2TECE 4LRUA 4B84A 3I45A 1FNNA 1UBJS 1AUOA 1TKBA 5IKEA 2GI4A 2O2ZA 3TLAA 3NRJA 1BVHA 4GSKA 1HYBA 3DEZA 1KFKB 3OU7A 3QE0A 2WY7Q 4MMXB 1GZDA 4M3FA 1QIKA 1OGYA 5KNCD 3MCTA 1UZAA 3HZJA 5AI5A 3QA3E 3OJWA 4LDPA 1XZJA 4UBKA 3GJ4A 3ZWOA 4JFRA 3GNTA 3A0HC 2PZEA 4BE4A 3L0DA 4B3SB 4ECAA 5CX1B 2DT5A 3CIFA 4HB3A 2FBHA 1X14A 1Z47A 4ZIRB 4FCCA 3WLHA 3JARA 3JSPA 5FTMA 4IGEA 2EBHX 3MNFA 3ODGA 3IEUA 4LZZA 2EZ9A 4HLNA 4G8BA 4A3CJ 1TQHA 4G81A 5I7UA 2GVZC 2WFZA 4R16A 2PLAA 3GAMA 3OR1C 3H4IA 4ETIA 3L4JA 3PCTA 4ZOAA 2TDXA 3AKCA 1JJFA 1B2RA 5KVRA 3VZPA 3PQ8A 5FUYA 1F14A 3NXSA 3JWJA