3P9IA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and sinapaldehyde
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
b'TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
molecule tags Transferase
source organism Lolium perenne
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9iA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9iA02
4B17A 4YV0A 4A0ZA 1I1GA 4OU0A 2WK1A 5LGNA 2UYHA 2OB1A 2XUBA 1Z7UA 1IAWA 4X41A 5FULA 3GZ5A 5KQSA 5D4SA 2Y75A 2P3LA 1FBUA 2MA3A 4BYYA 1REPC 3TOSA 4ER3A 1IXSB 2YX7A 1MZBA 4HV5A 4RTQA 3WTSC 3BZ6A 4EVIA 2JHCA 2H09A 3NDJA 1O3TA 1QPMA 1WQ2A 4PDKA 1JSXA 3UA3A 5DTQA 4RB0A 2OAZA 2XVAA 2FBHA 3HCAA 1R74A 1G3TA 2A3SA 3EYIA 1NW3A 3NJRA 5EEHA 3MHTA 5DSXA 3HSEA 2XV4S 4OA8A 2H27A 3C18A 4LECA 3UJBA 2DAOA 5FWDA 2P8JA 2XAFA 4GF5A 1LDKB 2L4MA 4U7TB 3SSNA 3PLAE 5J8CA 3JWGA 3A27A 1Z3CA 3E5UA 3GFIA 1M6YA 1YTYA 2IIPA 3W6JB 1FSHA 1G3YA 2H00A 3DMFA 2FNPA 5FQOA 3IKVA 2RQPA 2UXNA 1TLHB 4ENKA 1HMYA 3HP7A 2PXXA 5FHQA 3LCCA 3UJ9A 2Q0OA 3JTHA 5D5WB 1SG9A 3G5LA 2JSCA 2M1BA 5DDGA 4EV0A 2ZO4A 4OIPF 1G4DA 1KPIA 5EHIA 5HIIA 2ZULA 4M9ZA 5A2QZ 3F4KA 2B3TA 5T67A 5H6QA 3SR4A 4ENNA 5BW5A 3FRIA 1L3LA 5D1HA 2DQRA 3K69A 1JQEA 3SXYA 2P1DA 2D2WA 5EGSA 1XXLA 1NV9A 3QV2A 3KLNA 2I6GA 4HF0A 4PYQA 2IJLA 2BV6A 1XTPA 1FX7A 5LGTA 1UCRA 2O07A 1I27A 1XGOA 3KE2A 1KP9A 1F38A 4CICA 2YUIA 3WTUC 3GFMA 1XGMA 1G3SA 3PQJA 1R00A 1ON1A 5EMKA 2Z99A 1N7JA 4QVKA 1HSTA 3R0JA 1JG3A 2V1DA 3ABUA 3KKZA 2K7LA 2FBKA 5J6XA 4CXFA 4XCXA 4CYDA 2WC2A 3R61A 2PJDA 4Y17A 3IL2A 2KRFA 4MGRA 3O7WA 1B59A 2HEOA 2O3FA 4RVHA 4RB2C 3ZQ7A 4EQZA 5FTWA 5FO5A 1OR7A 3IWZA 2AOTA 1QAOA 3DEUA 2KIUA 1IM8A 4U7BA 1FP1D 2IH4A 3FTEA 4G56A 4GOMD 3RPQA 2JTVA 2XRNA 2HKXA 1EV7A 1FT9A 3CUQA 3I0TA 5FD6A 2Z3YA 5ILVA 3KETA 4XRFA 4AVPA 1WXXA 3GZ6A 2WA2A 4G8XA 2IA0A 5EPEA 5EMMA 4E70A 1G55A 3TKYA 4WWCA 2A69F 2RNJA 3KZZA 4QTUB 4U88A 1UB9A 4PGGA 3FUUA 3FM5A 2GAUA 4PYMA 2DLLA 4XUDA 2XGXA 4CKCA 4MWZA 1S6LA 3MCZA 2W25A 2OQRA 1FP2A 2Z33A 5DX1A 3M9AA 3UWPA 3HNRA 2HQRA 4U0WA 2GA2A 2G9WA 4U7DA 2JHPA 2VE8A 2P35A 2FPOA 2M30A 4P96A 2ORED 3KQMA 4FSXA 2A5YB 2B78A 5FCDA 4EKGA 4YMGA 5M5BA 3FMSA 1NT2A 3Q5FA 2R6ZA 5E2BA 3F8NA 4Y13A 2OZ6A 1WY7A 4Q5SF 1FLIA 3LA2A 1MHTA 1O3RA 1XVAA 1QAMA 3BGDA 2PN6A 5CYVA 4EM2A 3GRRA 2AOXA 5D6EA 4LFUA 3VC1A 2P7IA 3ELWA 1DUSA 5IT3A 2ZVJA 5E20A 3BGIA 1FJXA 2PKWA 3GF2A 3GRYA 3RI4A 3KQTA 1W5TA 4HLYA 3U1DA 1FBQA 1IW7F 4GCVA 1R5GA 2NNYA 3GRZA 3HVJA 4E32A 1YZHA 3ID6C 4FGZA 5AIQA 1IF1A 2GPYA 2B2CA 1P92A 3GFLA 4M37A 1U5TA 2NAZA 4PGHA 3B73A 1WSUA 3M6UA 5BS6A 2HZTA 2GA1A 2MH9A 5LGUA 1RZ4A 3IC7A 3HCDA 4FR0A 3PS9A 2L01A 3M4XA 4BP1A 4RVDA 3G3ZA 5ED4A 3TO6A 2LD4A 3D0SA 4RTPA 2WTEA 4F86A 4HX4A 3KCCA 5EEGA 1XMAA 2HYGD 4FT2A 2A14A 2PX8A 3SM3A 2XAHA 3J81Z 2A07F 2QRVA 3A25A 5FA8A 2QE6A 1O57A 4JXJA 2XVCA 5LRSA 2RVCA 5L3CA 2EFWA 5DLYA 3MCTA 5EZSA 3I59A 1P1CA 2P41A 3T7RA 3FWEA 1E17A 3G7UA 2VOOA 2RC4A 1U3EM 4BP3A 1Z9CA 1BOAA 3NRVA 1O3SA 5FD5A 4ENMA 3G2OA 2F5FA 2FEZA 1R1UA 3M70A 2L4AA 2G1PA 4GC5A 3RKXA 1XCLA 3CGGA 4CKBA 3GU3A 2DO7A 4IRHA 2D1VA 2GZWA 3SQNA 4HQMA 5LLQA 3H2BA 3F8BA 3KFWX 1FOKA 5DTRA 1JGSA 2YVLA 2AN4A 3I64A 4KT5C 3S2WA 1FBNA 3WGGA 1IN8A 1R1VA 2JPCA 1WI9A 3FM3A 3ZMDA 2KJBA 4WK8F 1H9TA 2DQLA 2N47A 3TOAA 2XYQA 5D1NA 4I09A 5HIKA 1S7OA 3E05A 1CF7B 2GWRA 4RS8A 4A6DA 3EVFA 5C9ZA 2EWNA 2VBWA 1FZPB 2FSWA 2HYFA 1SD4A 5HDKA 2ADMA 1KYWA 3T7TA 1O9HA 3I9FA 1RI1A 1NE2A 3QPHA 4OX9Y 1XGNA 1EH8A 4RGXA 3ML6A 1EIZA 2VS1A 3UJDA 1H9GA 2XYRA 2PJPA 5F2NA 1F1ZA 1HQCA 3R9XB 5K0BA 4QVGA 2EB7A 3K1MA 5JHUA 2I62A 3A7EA 3MZHA 4UVCA 3WE2A 5EKUA 4PONA 1NHAA 4FX0A 4KIBA 2A68F 2G8NA 3I59B 4RAZA 4UVAA 2PX5A 1YFJA 3L09A 1ZRDA 4ENJA 3EVCA 4WF2A 3ELUA 4BAYA 3EDPA 3TM4A 2HV9A 3R6TA 1KHHA 5HIJA 2AOTB 3PFHA 2EV5A 1BM9A 1BC8C 1J59A 4PYIA 2FE3A 4DNCA 3CTAA 4IJAA 5DCMA 5KK1A 2IDKA 4BLUA 3LA3A 4IHSA 4G9YA 3BDDA 2FMYA 4YG2F 3LAJA 2PVCA 2H1RA 1LJ9A 4MEYF 3MEXA 1IY9A 3JSPA 3J80Z 4EKIA 4EJWA 2NXEA 2NXNA 3H3ZA 3BKWA 4KW7A 3V8VA 1FBSA 1Y8CA 5LQRA 3TMAA 4I0BA 2L54A 3F8CA 5ILUA 1I1NA 3HVKA 2PLWA 3TLJA 6PAXA 3QP5A 5T6BA 2GXBA 5K0CA 4CHUA 3COAC 2HDCA 5HDGA 4OIOF 2HGCA 3UJ7A 5HS8A 5ICGA 4DZRA 3K0LA 1L3CA 2DPUA 2HR3A 2GH1A 4U0YA 4I7HA 1DL5A 3KR9A 4IXAA 4U0VA 1SFUA 4FZVA 2FMLA 2XYVA 3IYLW 1MDMA 3C3PA 5E8IA 5GP1A 2HWKA 3BWBA 1EH7A 1ULYA 4RTRA 1MKMA 3OZSA 3FTDA 5IH3A 1J9IA 4HTFB 2M8EA 4PYLA 2M45A 4P9UA 2YXEA 4NECA 3SGLA 4XUEA 1X1BA 4F7ZA 3ZN1A 2YPRA 2HMYB 4E31A 2ZTHA 4H0EA 2ZFWA 3BKXA 3LPMA 5HIMA 4KNYA 1R18A 2A6EF 2HTEA 5TRDA 3HA7A 2UZ4A 3UBTA 2CFXA 4LJZF 2B0LA 3D2LA 4MIKA 3LA7A 5CUQA 4FSDA 4Y30A 1XDSA 1PP8F 3ELKA 3KQYA 1VBFA 2J5OA 1E2XA 4I98B 1N2XA 3NEUA 4MQ4A 2FF4A 1G3WA 2BGCA 5LHHA 1XCJA 5E8JA 5EVJA 3NVKI 2LDUA 2IPXA 3BWCA 5LBQA 2OB2A 2QLZA 3FUVA 4I02A 4GUAA 3TQSA 1NW7A 3A26A 3R60A 2K4MA 5B1SA 3CUQB 5FFZA 3P2KA 3C6MA 3ZMVA 2OKCA 1IN7A 1KQ0A 1YQAA 3KQOA 2GA9A 1MJBA 2P7VB 2PV0A 3P2EA 3KP3A 3DUWA 3ECOA 3MTEA 3EETA 4B8XA 3DMGA 3IRQA 5DRYA 2IBTA 1R22A 3TR6A 4ISCA 1YW7A 1TQPA 4ER7A 2C7RA 1ZN2A 1HW5A 2XROA 3C3WA 3M8FA 4M74A 1HKTA 4L9VA 2EV0A 1SFEA 5BXYA 5D5VB 3RKYA 2MBFA 3DXZA 4HW0A 1Z05A 5FGMA 4RTSA 2NRAC 3JWIA 1G38A 2MLGA 1X1AA 5DEQA 4YUVA 1LEBA 4KN4X 4PYOA 3E5XA 3BZBA 1MJ9A 1USSA 2YX1A 4L18B 1KYZA 2JG3A 1LB2A 2PXCA 4KRGA 3LBFA 2PLYA 3LCVB 1QBJA 3GFJA 3CJNA 3B7PA 1AOYA 4P7FA 3ZPLA 5CVJA 1O7LA 2V1UA 5E9WA 2PWYA 5H02A 5CCBA 2HWVA 4CWAA 3HCCA 5JUWA 3QP6A 2ZJ2A 4G7HF 1O9GA 1VE3A 3DR5A 3P9KA 3JWHA 4RTMA 2W85A 2G72A 2ZLBA 3M1EA 5LRRA 2B25A 2X4HA 2ZZMA 1SUSA 1BIAA 2DFIA 4IV0A 5LR6A 5DWQA 2JHAA 3HTXA 1EH6A 2P5VA 1Z91A 1IRGA 5ICCA 5E1ZB 2QQ9A 4BHCA 1ZRFA 3EMBA 1V39A 1SD5A 1JG1A 4O29A 4RAYA 3BGVA 1AQIA 4ESJA 5DUIA 3UJAA 5L3EA 5LQJA 4KWCA 3O31A 3MAJA 3PT9A 3V7CA 5D8KB 4P7JA 2JZYA 4HX8A 4PYKA 1G60A 1LEAA 1TNTA 4GYIA 3R0QA 2IA1A 2NS0A 5IKMA 4KDPA 2KIFA 2O8XA 3O4FA 1XDZA 4M6XA 4IVNA 3OZTA 2NYXA 1BI0A 1KXZA 5E1OA 4HAMA 5DSTA 1DCTA 3T7SA 2YTZA 5TJJA 2VZ9A 2ZNYA 1YYVA 5EQJB 4HLXA 4P55A 1XN7A 2ZKZA 3EVAA 1P6RA 4ZYDA 3WSTA 5K03A 3MZYA 3K6RA 5EIWA 2HQNA 3Q9VA 2V6CA 5LQUA 4YV1A 4UV8A 4O3MA 4GGGA 3GEZA 4HH4A 2ZXJA 3B02A 1HBXG 3WTXC 5DX8A 2K86A 5K05A 2UWMA 3OU6A 1F9NA 1KU9A 2E7WA 1Q0SA 1K6OA 5BQTA 1K78B 5H20A 1V4RA 1PDNC 1D5VA 4P9FA 4LB6B 2LNBA 1O54A 4BY9E 2DW4A 3C0KA 3LKDA 3B3FA 2H94A 3AXTA 2E7XA 3RYRA 1JG4A 1I4WA 2STTA 1RIOH 3KP2A 5EZQA 2Q2EA 3N97A 1OMIA 3OOPA 3ULQB 3SXJA 4L9NA 5DD4A 2IW5A 4M6YA 3B5IA 3KQVA 3ORHA 1U6GA 3DH0A 2P7HA 5GM1A 2P6TA 4L0ZB 1R23A 4Q47A 3G89A 2NP7A 3OE4A 4C03A 2ZBRA 4PINA 4YFKF 3B3GA 4MHTA 3EQLF 3K2ZA 3OE5A 1DDNA 1TPYA 3GUDA 3TRKA 2RN7A 2ZCWA 3EMDA 2ONZA 1TNSA 5K5QA 4K2EA 4ESBA 3E6MA 2XKOA 3EVDA 1ZHFA 2G7UA 3KZYA 4HC4A 3LKZA 4N0BA 1Z6TA 4H0NA 4CO8A 3KEOA 3Q87B 1EAMA 4BHPA 3LECA 4YIIA 2VP3A 2ISZA 5CLSA 3IRRA 4RTLA 3M6VA 3T8RA 1RJEA 4MQVA 2KKOA 2ZBPA 3ELYA 4M7RA 3KP6A 4A5MA 4HGZA 4R8RA 5CCXA 1SKMA 4ON0A 4ER5A 9MHTA 2CWWA 2PQ8A 3KR0A 4R79A 2FRXA 3MWMA 4YMHA 5KQRA 4AZVA 1IXCA 2VODA 1KPGA 4KDRA 1CF7A 2PI0A 3DV8A 3RIEA 4IRIA 2EV6A 2ZZKA 5EG5A 5KYGA 4IF4A 1B9NA 1V3FA 3G5TA 4RGUA 4G7OF 1TW2A 2EK5A 3WGIA 1R58A 2E1NA 1WS6A 3ER9A 3T0YA 5U4XA 3FXRA 3HHGA 1AQJA 1R1TA 5AONA 5K1YA 3ME5A 1S8NA 3PX2A 5E9QA 3GWZA 4DQ0A 1FPQA 2DK5A 2Y0MA 2VT3A 5ICEA 3BT7A 1QO0D 1QYRA 2Z6AA 4AZTA 5HZMA 2Y1WA 3M6WA 4QDKA 2UYQA 4YFNF 2IPQX 2V7EA 4GEKA 3GGDA 2AS5F 1BKYA 2GLUA 2DI3A 4ZZLA 3RW9A 2ONYA 3M33A 2EFOA 3KEQA 1NKVA 1X19A 4FS8A 5F64A 5FWAA 4UV9A 3SVZA 3LQRA 4ZZDA 2F5EA 2YR0A 2FQ3A 4NHJA 3AY0A 1YZ3A 3EPPA 3EVBA 2CYYA 3EYYA 4QPNA 5HDNA 5L3DA 5DYMA 2EJUA 5P8WA 3GX4X 3FPEA 3TDZC 2PWPA 5CIYA 4BH9A 4HDUA 4RTNA 4GO1A 1JHFA 3LL7A 3I58A 4G6QA 1IN6A 2C7OA 5D4RA 2ETHA 4ZYEA 2UYOA 2IVMA 3THRA 2WA1A 4PIPA 3KHKA 2AN5A 2BR3A 3PB3A 2C7QA 4E2ZA 3FZVA 4QQKA 3FZGA 3F21A 5DPMA 4M38A 3CBGA 4I0AA 2I7CA 3DULA 4ER6A 4RTOA 3FUTA 3E23A 3LX6A 1FY7A 1O3QA 2H6CA 4CTJA 2BM8A 5DTMA 4Q4ZF 4XLPF 2ZIGA 3H3UA 3L9FA 2QRVB 2COMA 3REOA 1MJFA 1ZGAA 3AXSA 1ODDA 5HLGA 4EM0B 3GXOA 1W7PB 4AIKA 3GIWA 5E1XA 5E2AA 5J8FA 2OD5A 1LVAA 4LB5A 2Y48A 2F8LA 3EVGA 5CD1A 1VP3A 1R36A 1S7AA 4BLVA 5K09A 1D2CA 2LF7A 2ERCA 5FADA 4FHTA 2NP6A 2AS0A 3LGAA 1ZAOA 3J80K 2CSOA 3ERED 2OY0A 2QZ8A 3CUQC 3G2MA 3HVHA 3Q7EA 3H92A 3N4MA 5LEJA 3KP7A 5LQKA 1TQIA 4HYEA 2YQZA 2ZW9A 3OCJA 5HVQC 1ZG5A 3P8ZA 5HS7A 4U7PB 1JR4A 2ZMEB 2WV0A 4LWOA 4AIJA 3FTFA 5CJ9A 10MHA 3VODA 4ZTBA 5FUBA 1IUYA 3HRMA 3V7SA 1BC7C 3EGVA 3X0DA 4KMFA 4LG0B 1OR8A 1G8AA 5DM4A 4IV8A 1SD7A 3V8JA 3ELDA 1SVUA 3G88A 3JWJA 1HW2A 1EJ0A 2G7HA 1JSZA 3M6XA 4M36A 1L3IA 2EJTA 2VBZA 4HBLA 4KYWA 5K0EA 4V0RA 5L3FA 3FPFA 2GB4A 3OZRA 3V8KA 2L02A 4NQWA 4YIFA 4EK9A 3TGNA 1MJAA 4RX1A 1R6AA 4FT8A 1EG2A 2EA2A 3WGHA 1P4XA 1P4AA 3SZPA 1U8RA 2E5WA 3WU1B 2MH2A 4M9XA 1W7PA 1BI1A 2ESNA 4M73A 5LEKA 4IPAA 4LGWA 4F85A 2NXCA 3F6VA 2BZGA 4F84A 5BOXA 1GVJA 3WTVC 5ICFA 3HTUA 2A6HF 3OU2A 3I5UA 4M72A 1YB2A 3DTNA 5C1IA 1BI3A 3SSMA 2NNWB 4RGSA 4PNEA 1QNTA 4EGZA 1QANA 2AZTA 3F3XA 4FX4A 1UWVA 4K6MA 2RDPA 2O06A 5E1MA 1BI2A 3GRUA 1JHHA 1QGPA 3JW4A 3TDUC 2X0LA 1JE8A 4AUKA 3TFWA 2W24A 3F6OA 3HSRA 5D8LB 1W4MA 3BPXA 3FYDA 5JVTA 1KR5A 2F5CA 2KW5A 1O7FA 2W84A 1FYMA 1BIBA 4XSXF 5CVIA 3I54A 2E1CA 3TO7A 3G8BA 1XDUA 3HCBA 3FMRA 3CC8A 4LLGF 4ETSA 3G8AA 1HNNA 1K7AA 1C0WA 1AWCA 3T5XA 3HEMA 5HEKA 1JG2A 3FF5A 5EKXA 2OBFA 3EVEA 2Z5UA 1BBYA 2K4BA 3GRVA 4BNCA 3F22A 3THSA 1NBHA 4YUYA 4LLNA 1KPHA 3CKKA 5MHTA 3LWFA 4E33A 2EFNA 4OOIA 2UZKA 3G2PA 5BW4A 5D6FA 4DM3A 5DCFA 2BBYA 3LHDA 3CDHA 2BM9A 5LQAA 5JFRA 1B42A 5CVRA 3ERCA 3MQ0A 2DK8A 2M87A 4DCGA 4GYGA 5LQCA 3MGGA 5HILA 3HTSB 1ORIA 1OKRA 2H6BA 1W7PD 2FBIA 3FUXA 2IH2A 2XASA 2D1HA 4IRGA 2IGTA 1KU2A 5K0FA 3VC2A 3MERA 3RYPA 1ONVA 4I01A 1KQ9A 3F72A 5HLIA 2JH9A 2O57A 4XSZF 4E2YA 4MHGA 4P58A 2W57A 2HTJA 3DF8A 2Z9OA 3FUWA 4RVGA 4L5IA 2GIVA 4C04A 3C1DA 3TO9A 4ZH4F 3SZTA 2K4JA 4Z2YA 3FRHA 3RTRA 3EEYA 1G8SA 3BPVA 2CGPA 4OMYA 5F2OA 2XBMA 3BJ6A 1DUXC 3FPHA 2NNNA 2VC1A 2BYVE 2EFQA 4EJVA 4MNUA 1SAXA 3ZMUA 3HM2A 3U9GA 2IDJA 2NXJA 3FTCA 2FCAA 2DBBA 2OA4A 4M71A 2F2EA 1HKSA 3J81K 1WXWA 4YFXF 1PJZA 3NQOA 2PBFA 3J7AO 1NW6A 4GOND 1IN5A 1L0OC 1RI2A 2P6SA 3B89A 2YXLA 1I1SA 2P40A 3HVIA 1X3UA 3L00A 2CL5A 3I53A 3HSFA 3ROUA 4RB3C 3KR1A 4A5NA 4ZYHA 2OU2A 4GQBA 2PBIA 4L7VA 5E9JA 3IWFA 4GOLD 2FU4A 3U81A 2QBYB 3BY6A 3GNLA 1RI3A 1FYLA 4L0YB 1K79A 2PX2A 1GHCA 1H0MA 3OFJA 4QPPA 3MTIA 4A6EA 1SQGA 4XBFA 2CO5A 4KICA 3LBYA 2PX4A 1J7KA 5BPDA 2Y1XA 4POOA 5E8RA 1QZZA 1F4KA 2TDXA 1LNWA 3D5LA 3ANXA 2ESHA 4C07A 2FRHA 3P9CA 5E17F 1U5TC 3C3YA 4HA8A 4GOOD 1U5TB 3HRUA 3IV6A 1ZREA 4EQQA 1IZ1A 1MD0A 2H11A 3JSOA 4L9JA 3KLOA 3BWYA 2IRFG 2QY6A 3CJRA 5FLXK 5K0LA 1NBIA 3SFZA 1IN4A 1VQ1A 4GC9A 1B4AA 2JRTA 1TTYA 1PP7U 4N9IA 3R3HA 2AVNA 2MLKA 4KFCA 1WG8A 1YIOA 3KQWA 4YUXA 2GS9A 1OYIA 3Q9SA 1KA8A 2PMHA 4G6DA 1I6XA 2VONA 1DPRA 1ZRCA 3GVAA 4WXCA 1EJ6A 4KVZA 5H6RA 4RWZA 4MTEA 5BP7A 3I4PA 4EJUA 4QTTB 3FMQA 3ZMSA 1D3YA 4A0XA 1ORHA 3NMUF 1IXRC 4RSRA 4L9TA 3RDIA 2AOUA 3A7DA 3B3JA 1XB4A 4MQ9F 4X60A 3DKWA 5E18F 3MFKA 5CVUA 2XVMA 4GBED 2AXLA 3F8FA 1J2XA 5FA5A 2YX4A 3MB5A 1SD6A 4DA4A 1HKQA 4KN7X 4X63A 4CXMA 2P5LC 1XD7A 1XSXA 4NB5A 3E3VA 3E97A 1F3LA 5LSAA 2P4WA 3LSTA 2VN2A 4HQEA 3IHUA 4LG0A 4UXNA 4HGYA 3GO5A 4OA5A 1D2HA 1BN5A 1K78A 2RV8A 3CUOA 3GDHA 4LD5A 2HNKA 3IEIA 2XAQA 3VEPA 2QQBA 2XIGA 2GXGA 2MD5A 1R5HA 3PFGA 1KU3A 2O61A 1HXDA 2CWEA 1XCVA 2QVOA 3KP5A 2ZSUA 4ATNA 1VTNC 2BE5F 4MEXF 2MC3A 5LHIA 3R24A 1RNLA 2ZMEA 4PYJA 3VFZA 3CJQA 4RV9A 4OQEA 3ZMZA 1OYWA 2O0LA 2PSSA 2DTRA 4EGYA 3V4GA 5EHGA 1YS7A 2BEOA 1Y0UA 2CKDA 3HOSA 3P9IA 4HDVA 2AN3A 5DD8A 2IFTA 1T0FA 2JT1A 2LKPA 4LMYA 5L3BA 5LHGA 3VOEA 1Z6RA 4E30A 2DPMA 3TM5A 2V74B 3F8MA 5HS9A 2ELHA 5K8VA 1X1CA 5K0NA 3SSOA 5HLHA 1XGSA 3WE3A 4D0PA 2JPBA 4LG1A 4S04A 4FP9A 1XJ5A 3GLXA 4R6XA 3F23A 2HKOA 2HS5A 3EEOA 4BHBA 2CMHA 4CZZA 4C08A 2M5WA 4PZJA 1NW8A 2L3DA 1VLMA 1U2ZA 3NW9A 5F1RA 2XKPA 2EJRA 2FYTA 5DXAA 1GXQA 5EMLA 4PYNA 3HHHA 2ZZNA 1SFXA 1QAQA 5E1DA 5GWXA 2K02A 1B9MA 2YSRA 1YFHA 1T39A 4XUCA 1SMTA 4LK0F 4G7ZF 3KQSA 1H1DA 3CLOA 3TQNA 1XSVA 1BC5A 3QRFF 3LCUA 3UZUA 1PRYA 2FOKA 3GCZA 5K0GA 4QLCU 3PVCA 2P3QA 3R0AA 1FNNA 1B1BA 4LK1F 3QPTA 4CDGA 2BH2A 1S3JA 3T0IA 3UJCA 2B9EA 4R6WA 1ON2A 2PT9A 1KIAA 2DU9A 4YUZA 5EMJA 1T38A 5HFJA 5K0JA 3KPVA 4HX7A 4Q48A 4UHTA 2ZIEA 2OO3A 5IT9Z 3FPJA 5D5XB 4PCAA 2KIMA 1R8YA 3WODF 3ER8A 1BHJA 3WU0A 4IKPA 4DF3A 4JBAA 2ZBKA 3FXUA 3QU3A 3NWEA 2AOUB 1MDMB 1QZYA 2OZUA 3QOXA 1ZG3A 3WTTC 5DM0A 1A04A 2AOVA 4E2XA 3HYIA 4B09A 3BP8A 3RPUA 4AIHA 4FT4A 2ZWAA 5DX0A 3BUSA 3DOUA 4WXHA 3K0BA 4TV7A 1YS6A 3NVMB 1P91A 2FHPA 3SX0A 4AZSA 3HA3A 2UYCA 3JAMK 4X1OA 4LLLA 2OXTA 4X61A 1JTEA 2ZCJA 4HF2A 2RKHA 4N9HA 5DV5A 2AR0A 4EM1A 5T64A 1YUBA 1UHWA 3EGIA 3E7PA 2C7PA 3DMHA 4HSGA 3E6BA 1HSJA 2D45A 2VT2A 5KVAA 5JI6A 4Y15A 3G73A 2FK8A 1WZNA 3KQQA 3KU1A 1J5YA 5CVEA 3PX3A 2CW0F 1U78A 1M6EX 3HOTA 2PGXA 4WCGA 2ESRA 2A61A 3HUGA 2BR5A 4YV2A 3CO6C 3AJDA 4DCMA 2PY6A 5GIOE 2VBYA 4RGRA 3DLCA 2ZBQA 1GXPA 1M0EA 4M9SA 1UIRA 2G71A 3LDGA 3S68A 5HOQA 1YW9A 3E8SA 4AZWA 1T98A 4WXDA 1YG2A 2EA4A 1VIDA 4CGZA 2V1XA 4EJTA 4HRAA 5LQNA 4I2OA 2VDWA 2PXAA 4RTJA 3NDIA 1VL5A 1JXSA 4QQNA 3P7NA 3V7RA 1INLA 4XLNF 4R1HA 1RJDA 2FA5A 3DPLC 1YLFA 3KQPA 1CGPA 2XAGA 4LWPA 4BXUA 3CCFA 4Y2HA 3UJ8A 1X1DA 3AWIA 2EX4A 5FHRA 2P3OA 2RGVA 2QBYA 2ACJA 3LDUA 4E2WA 4WVLA 3V8LA 4DKJA 2CQKA 5E1BA 2KJCA 4EMSA 4KDCA 3UA4A 5G02A 1L9KA 3ZMTA 3BWGA 2R3SA 4YUWA 3PQKA 4A0YA 4OBXA 3LAPA 2VC0A 5E8GA 5GOZA 4HV6A 2JJQA 2HOEA 4QDJA 2ADUA 2IA2A 3T8TA 3AAFA 1Q1HA 4HZFA 5HOOA 3GW2A 1IXKA 3EUHA 1ZKDA 4IWNA 5L3GA 2XAJA 4UOEA 5DRTA 3TKAA 4L5JA 3UFBA 3HA5A 2UXXA 1J75A 1L1EA 2QM3A 5DUKA 5CM2Z 2LSOA 3SHFA 1KQ8A 4JK1X 1VPTA 3DFGA 2Z6UA 1YW8A 4BLWA 1OYYA 2VE9A 2ZIFA 3BROA 4KIGA 4HG2A 4OIQF 3BXOA 4AX8A 5FQNA 1I5ZA 1YFLA 2P8TA 3QAHA 1LDDA 3HIFA 2F5DA 1J0RA 1G6Q1 1OPCA 3RJPA 5KS2A 1R7JA 2O6GE 5DM2A 1WWXA 3DLIA 2HFHA 4G94A 3HCFA 2JH8A 2PFBA 1YO5C 2FXAA 3NWBA 5DXJA 2V9VA 1LQ1A 1RUNA 5CVVA 3TPZA 3K1NA 1P39A 1UHMA 2CMGA 2R7DA 4O5VA 3JAMZ 2STWA 5GINE 4RYLA 3WTYC 3OU7A 1T2KA 4BQAA 2J5PA 2PMUA 4PWYA 3MQ2A 2YR2A 5F2KA 3PFIA 5CVDA 1AV6A 3W6KB 3BJOA 3FX3A 3LQQA 5AIPA 4AD9A 3OFKA 3CVOA 3A4TA 2HR1A 5FLXZ 1AF7A 1DPUA 2FNAA 5C0OE 1ZQ9A 4UNOA 3OV8A 4OBWA 3MAGA 1PUEE 1JTFA 2GQQA 1YF3A 3WTWC 5K01A 4P5OA 4QWQA 2XHKA 1RJFA 3LFKA 4RTKA 1N7IA 1WKMA 3CJTA 3FXQA 2YXDA 2BR4A 4ASNA 1UFKA 5DCMB 3UJ6A 2O03A 1XMKA 5JR3A 2IP2A 4UUVA 2IBSA 2OPBA 5ERIA 3RIRA 3DP7A 4EJOA 2FK7A 4OINF 2ZWVA 4O6JA 5GIPE 5A2QK 2OZVA 3FPGA 4P7GA 4IHTA 2K27A 4DMGA 3KPWA 3ABTA 2C6YA 3EGEA 3GO4A 2DPDA 3HRTA 2IT0A 5ERGB 3DXXA 1Z1DA 1VP9A 1D8KA 1TW3A 3P2IA 1Q0TA 4JQFA 4PCLA 2EFPA 1USTA 3KPUA 2QQAA 2AVDA 2PEXA 1P4WA 3HCEA 2WWYA 1FC3A 3M7GA 1LDJA 3JTGA 1XCBA 1D8JA 2NYUA 2PT6A 2DT5A 1P2FA 3E6CC 3FHZA 4R8SA 4HF1A 3QOWA 5D5UB 1JQ3A 3EVZA 4A12A 3GYHX 7MHTA 3KPJA 2VDUE 2ZFUA 3M8EA 3C7JA 2O0YA 3HRSA 3R4KA 1ZH5A 1EQAA 2CG4A 3P97A 1RI4A 1FSEA 2EFJA 1JQDA 2P7CB 4HTFA 3E5QA 1ZG1A 2VDVE 1RJGA 2R7FA 3WG9A 2P5KA 2QYOA 4ZYGA 2Q41A 5K5OA 4C05A 3DXYA 3TOBA 2QENA 2QUFA 3V97A 1L3BA 1RI5A 2DULA 3QOPA 3ISPA 3VSEA 3KR2A 1SQFA 2HTSA 1T43A 4CKEA 1ZGJA 3BWMA 1P1BA 1U2WA 8MHTA 1IRFA 1QQIA 5FB2A 3T1BA 4KIFA 1R8XA 2O05A 4R05A 1KU7A 4KUMA 3P9NA 1MGTA 2QWWA 2EG5A 3K1PA 3BJAA 1NV8A 2LF8A 5KVRA 2G70A 4UVBA 5BPIA 1FWZA 1ZYRF 1FYKA 2AOWA 1RI7A 4OIRF 1STZA 1TBXA 3BOQA 3K9TA 5ILSA 1ZLJA 4KA4A 3WTZA 4RVFA 4V0QA 5GM2A 1T6SA 2ISYA 3DPTA 1SUIA 1G6NA 2I9KA 5FFXA 3LDFA 4AWXB 4MTDA 4PIMA 1WRJA 4WX9A 3I71A 1BJAA 3G2QA 4C06A 3ZN0A 4ER0A 2VOPA 1W5SA 5DT2A 2OBPA 3O3KA 3FYCA 2YU3A 3E6DA 4S05A 1D2GA 2ZNZA 2PG4A 2VXZA 3C6KA 3IHTA 3RKWA 3R6SA 4R8HA 1B6AA 3O2PE 4OMZA 1F5TA 2IH5A 4MTLA 1NW5A 2OYRA 4PCQA 5K5RA 4DQ2A 3IKTA 1ZLKA 3OPNA 5F6FA 5IT9K 1SMYF 2GAFA 3SMQA 5EOVA 1BOOA 3L7WA 3PTAA 1HW1A 4GXOA 3L2CA 4ESFA 4C4AA 5EC8A 1KGSA 3KPYA 1TQMA 5EIFA 3P71T 2Z6QA 1ZARA 2V79A 1S29A 3ECHA 3GJYA 4HOBA 4CTKA 1RUOA 3NTVA 2OQGA 5BMZA 1DP7P 3DXJF 1I9GA 3CO7C 4P7KA 3DQVC 4OQDA 5E1WA 3KP4A 2VBXA 4KMUX 4RB1A 3U2RA 3QU6A 3O6BB 3L8DA 1XSDA 3VB2A 3RODA 4A2UA 3VYWA 2Q8KA 3ZP5A 5DM1A 1UFMA
chains in the Genus database with same CATH superfamily
3S2IA 2OAP1 1X7YB 3MIZA 3N2NA 1V8FA 3N2EA 3O6VA 2VCHA 4FMPA 3A1CA 4HAIA 1I1GA 3UH1A 2NTEA 2QM0A 3V8BA 4GIBA 3PNVA 2DYRH 2WY2D 3V8MA 3ESQA 3TZQA 1VB5A 2A86A 3S93A 1W85A 5HPYB 2C0PA 1Z7UA 4H17A 4IOJA 4M0PA 4MROA 3TH5A 3IVXA 5CA0B 2P3LA 3IEKA 3UUGA 1REPC 1PTKA 1HT2E 4WV3A 3TOSA 1YIDA 2WHXA 4BFSA 4EG1A 4RULA 4KU4A 2XBUA 3TGWA 3DEZA 5IYZF 1ZM3A 5EFOA 4CV2A 2H59A 1SU8A 4HV5A 1J0DA 2X8JA 4A82A 3HXQA 5H3HA 1MOQA 3BHJA 4QOHA 1Q7GA 2QLTA 1AKQA 3BZ6A 1FE8A 3B1XA 3IURA 4GE0A 1VSTA 3A05A 1ZO8A 3H36A 1KYTA 2C2MA 1O3TA 4B2PA 2D13A 3H8VA 1T3GA 1ZU5A 1ZXXA 4MUNA 3RADC 4OGLA 2HQOA 2W7TA 3OIUA 3UFXA 1C4WA 4RB0A 2D5VA 1L7NA 1YR6A 4RA6B 2LWIA 4HNUA 2R8OA 4JMLA 2XVAA 2ODWA 2FBHA 3MTGA 4F2GA 5AUOB 1OLXB 1G3TA 1W59A 2K9NA 2Z57A 4OSEA 4Y98A 3UG6A 2FFHA 3WK9A 2GBGA 4OL9A 5IWCA 1LLUA 4OIMA 4GLJA 3TSYA 3HSEA 2XV4S 1I5RA 2EGHA 2VBFA 3C24A 3RIGA 5DCUA 3TCXB 2QLNA 3WIOA 4QARA 2P6RA 1Q6YA 2UKDA 2W37A 1X2EA 1S01A 1UM8A 2XNSA 4C88A 2DYSH 2RHJA 2P8JA 4I5DA 1IK4A 4N5LA 2LD5A 3I0ZA 3DBHA 3ZQ4A 3F73A 2EKZA 4MA4A 3ZE7A 4CEIA 2L4MA 4UNQA 2AG6A 1J23A 3M6MD 1FSPA 13PKA 3A27A 1QONA 2D54A 1QP7A 2JK3A 1Z3CA 1OCPA 3E5UA 1FZTA 3P4YA 4G85A 1IAVA 2GXAA 3WLIA 1LJ8A 3OE7D 2IIPA 2ICAA 3KSZO 5IW8A 2YJNA 1FSHA 1G3YA 2H00A 3TL4X 2NV0A 3ABOB 3GCGA 3R0IA 3PFKA 1AG9A 1WDWB 4ERXA 2VP4A 3PEEA 2QM7A 1JHQA 2PWAA 4GDFA 1PK8A 1XKTA 2PXXA 1W52X 2YJGA 3A0HC 5FHQA 2HPZA 3LCCA 3M1YA 2Q0OA 3UJ9A 5AXCA 5BV1A 3G9UA 2M1BA 1RXIA 5DDGA 1VJGA 2DMTA 2VT7A 3RT7A 3NB0A 3U4CA 4CQMD 1UT8A 4E4YA 1LF0A 5HIIA 3H5AA 3IXLA 2XUGA 3MNFA 4MR8A 5GY7A 2RGRA 4D25A 4M6VA 5H6QA 1QIMA 4ENNA 4JLPA 2HCJB 2OVFA 5HE9A 3FRIA 3CCCA 5BW5A 1MW9X 2EWVA 2B7CA 5D6NA 5F23A 2XZLA 3MK31 4CUGA 1XAGA 3ZWDA 2GXSA 4Y4RA 3LSYA 3M3YJ 4HF0A 3ZU2A 5BORA 1CEEA 5F12A 3JYNA 4BV9A 1M6VA 1PKEA 4CFYA 2IJLA 4E14A 4JDPA 4MI6A 4TUYA 3B52X 3VNQA 4WOKA 4LF9B 1I27A 1XGOA 1TKRA 1GGMA 1THGA 2FZ5A 2ODAA 2W6IA 3IB6A 4JA0A 4O1MA 2NO7A 2MG4A 1A8QA 4B3FX 2R87A 2YUIA 3EEFA 3SR0A 4EB6B 5F21A 4DQLA 1C0PA 1JR2A 1S2IA 4EY8A 3UATA 2XCRB 2XNDA 4M98A 3RAFC 3T3OA 3GFTA 1JXAA 3PQJA 1I7LA 3OY9A 1M1EB 1USKA 3A1NA 3GN2A 1ISGA 2A2ZA 4QFBA 4ZODA 1P6QA 3W1EA 3FROA 2F4VB 1KDRA 1N7JA 3L0OA 5P21A 5JMPA 1HSTA 2PRZA 4FCVA 3U48A 5CLQA 1A9XA 1TF5A 2AQIA 3TF5A 3K0EA 4KGVA 3A32A 1VL6A 4N01A 2DEUA 2K7LA 1W5BA 4BXFA 3CW2A 4L8FA 1Y1PA 1RU3A 5EQJB 1CY6A 5HZGA 5KTMA 2WC2A 4N03A 4ENVA 3QBVA 4Y17A 2O3RA 2O4CA 3FWNA 3NKVA 4HH3C 4S0ZA 4WLOA 3IL2A 1KSJA 1EF4A 2BKLA 3NTRA 4H2DA 4MGRA 1TCCA 1ESDA 3O7WA 1E9VA 1HLDA 2FPSA 1H2RS 2F3UA 2W6OA 3CWCA 3LVRE 5IBCA 4BBRJ 5J3JA 4XRMA 3RS4A 2Y0SA 1YHNA 3AT1A 1BHO1 3ROMA 3DV2A 3SSNA 3ZQ7A 1SCJA 3NG1A 4BVJA 5IAGA 1QCDA 1QR2A 1R88A 1H2FA 1N3YA 1JTYA 1SXJA 1TFRA 1UQUA 1XRMA 2HLHA 3B3QA 5K45A 1ZY2A 1EPUA 3GT0A 2G0NA 3JVIA 4IZZA 2KIUA 2CUZA 3QU5A 4RA9A 4N3GA 3E9QA 2WD8A 4IGEA 4RAQA 1CE8A 5H82A 1ZN8A 2GPNA 1FP1D 2N42A 2IH4A 3ITEA 2X85A 4L0DA 4FFNA 2JLXA 2FWBA 4YC7A 4ZV9A 4OFBA 1SUDA 1YNOA 2W48A 2EH3A 5E3LA 4A3FJ 1CK4A 1E2KA 2WSMA 4HZUB 3PSIA 3DFZA 4IMJB 1NYQA 1OA1A 2V45A 4AXXA 1ZHOA 1XG5A 2A1UA 2HXYA 2JFNA 1AA9A 2BGWA 4D2IA 3AHJA 3QIAA 3PJEA 4R0MA 4MS4B 1FNMA 4NAHA 3TDKA 1JBEA 3WGZA 1SPBS 2G36A 1FT9A 1OX4B 2V7FA 5FD6A 3R3UA 4MS1A 1Z5VA 1V8BA 3Q0VA 5IC4A 1NHWA 1Z21A 5G0WA 1K8YB 3KETA 1E3LA 1VL8A 1FYEA 4XRFA 2C29D 3OH8A 4HUQA 4OYLA 4ZO8A 4GAEA 3GZ6A 1X14A 5ALTA 3BWEA 3JS5A 4DCTA 3AFGA 1IRIA 3W7VA 5IYZA 2YY6A 1J90A 1H2EA 4N5HX 4G8XA 4LI3X 2W8BA 1HDRA 5DLDA 5EPEA 4MV6A 3T61A 2FQ4A 1GGNA 2XGEA 3AM3A 4LY6A 4O4LB 3ZIUA 5CA0F 3S17J 5AI9A 2IS2A 4Q18A 3AG3H 1N2IA 3MQ4A 3MXTA 1H8HD 4N3BA 3ONQA 1TKCA 2GPBA 4U88A 1C0EA 1QYCA 3GG2A 3K10A 1MB0A 2J3MA 4L22A 3MKLA 3AKZA 5KWEA 3BR5A 1DXOA 1X80A 3T3IA 4D9CA 3QX7A 5AK5A 5AVWA 4JBIA 2R7QA 2HT1A 3ISVA 3JCZA 2GAUA 4F11A 2DOFA 1ADBA 2JGDB 4GI7A 1VJ5A 1EM8A 4QSMA 1YXMA 3PJFA 2Z04A 2XGXA 4X54A 5BNGA 4MWZA 3U1KA 1S6LA 2W25A 3AF6A 3W7BA 2ZI3A 3M9AA 4OL0A 1GHTA 1LFAA 3GVPA 2VJMB 4AP5A 3QFCA 3VKHA 3BTJA 1F2VA 3K8OE 2G9WA 3WZ2A 4XIIA 6CHYA 2VE8A 1DINA 2YFKA 2AIRA 2PS3A 1QS0B 1C30B 2ORED 3KQMA 2B78A 3DW3X 1IH8A 4O4IA 4AG5A 3UQYS 4F1KA 5M5BA 1NT2A 3AILA 3BJIC 1WXEA 2XSDC 2EGUA 3GTPJ 3DE3X 3KWJA 3PR3A 3DDZX 1B0ZA 2OZ6A 2WIDA 4QBFA 2GVNA 4RPGA 4YMLA 1MHTA 2P0WA 4HNVA 1M1ZA 1RWOA 2HQBA 1XVAA 3PFYA 1KDYA 5CYVA 1GEEA 4L4SA 4LWZA 3TBHA 1KJ8A 1Y0BA 1B2LA 1GG8A 2QTVB 5FOTA 3EEBA 1G5RA 2PRJA 3R8FA 2SCUA 2OP0A 4HSEA 4D4MA 3GTJJ 1ZH2A 3U9TA 4E94A 2QG9A 2BMJA 3L1KA 4QBGB 1JH8A 1DFHA 1F0YA 1GQ2A 1KMHA 4OBEA 5EJ7A 1AGRA 5K3SA 3W2FA 2O8CA 2PZ8A 2ZKIA 2JNWA 2JFUA 3QUTA 2JVJA 4EUEA 5EUMA 3TOXA 5IT3A 2O0MA 1BX0A 5H9WA 1JHPA 4UUOA 3AI3A 1C3OA 4N12A 3BQYA 2XMRA 4AP6A 1XELA 2FDXA 5FLXA 3MGKA 4Q4JA 1JEYA 4DL9A 3BICA 2VDKB 2QRHA 2CMPA 4NC8A 5EUQB 5LUBA 1AIPA 5BW8A 3K6SB 2F9MA 3KQTA 3U1DA 2QJFA 4AN0A 7YASA 1Z3XA 3ZHZA 1VHQA 1YZHA 4FGZA 4XYMA 5HM8A 2YYSA 4LV8B 3WX0A 5ABPA 3GFLA 5A04A 4L8YA 2RKOA 3DTKA 1W6RA 1RPWA 3B73A 2J07A 3AKDA 4CM9D 5BS6A 1RTKA 2MH9A 4FR0A 5AIAA 3HCDA 3BWVA 3K0SA 1R0YA 3EZYA 3NP7A 5CEEA 2JJ2D 3S1SA 2CJYA 2NXNB 2DJNA 1F3OA 1H65A 4DR4B 3G6EI 1E6KA 2VYND 4WRRA 3DVSX 1SO8A 2E2IJ 5GAHJ 4AD8A 1D5YA 4NMXB 4RTPA 1HG1A 4IV5A 4LXGA 2I80A 2QX8A 1SVKA 3M6AA 4FLMA 5JNVA 3BDIA 3OJCA 3OIFA 2IQ5A 1ODFA 2FQXA 1GIAA 1OBOA 3BBLA 3NO4A 2A14A 4LE1A 1KQ3A 2BHNA 1ZNWA 5LB2A 2OV2A 1L8QA 2XAHA 5AW9A 3J81Z 4IHJB 4IO0A 5ARDA 4DTCA 3B3AA 4HNGA 1GUUA 5IVKA 2J7PA 2WJ4A 4EJMA 3FYUC 1U2GC 2QE6A 1S9HA 1YL7A 2ZRMA 4ZAWA 4CW7A 4JYPA 2XVCA 2V6EA 3I2KA 4DEVA 1JR6A 4GS5A 3QFSA 3U4IA 1U0FA 1XROA 2XC7A 1VI6A 1U9JA 3MCTA 2GETA 5BY2A 1NLYA 3OX3A 2NIPA 4MI1A 3TBFA 3ZS9A 3BFKA 2L7ZA 3G7UA 3G6WA 3PNQA 2H51A 2XSZA 1BOAA 1CP3A 2QE7D 3EGOA 2YXPX 3NORA 1FOXA 3S55A 2F5FA 2FQ1A 3QVXA 5D6OA 5AM0A 5JVGF 5FRMA 3WFZA 1UHSA 4BO4A 3KX2A 3DHWC 4FEYA 5FBRB 5FPKA 1X38A 1YHYA 3CGGA 4Q34A 1X7XB 1T8TA 4BP9A 1JBQA 1ZK8A 3OIQA 3GU3A 2WEKA 4TV8A 2WU8A 5A4FS 2O1XA 1FSSA 2GZWA 4YRIA 4HQMA 2JAQA 1L4NA 3VPXA 4B2IA 1RPJA 3OAAA 5E38A 5F3WB 1RR6A 5DTRA 3ZQHA 2YVLA 5DWDA 4FMDF 3I64A 3QWHA 1TUIA 3C16C 1FBNA 4JR1A 4TLMB 4A2CA 3PKZA 1IN8A 5AOVA 4QZVA 5E0OA 1LV7A 1J0EA 3L6BA 1VHDA 3V5NA 2IHZA 3FM3A 1UBEA 4IJWA 2KJBA 1YA6A 4JLVA 4CMGA 1Q11A 3S15J 3E7FA 4BN5A 2VG8A 3HU1A 1HOMA 1YMUA 2F64A 3TOAA 1DAKA 1MMFB 4LRYA 1KKUA 4S2UA 3JATA 2QTWB 4E21A 3MMXA 1L5KA 5AW7A 1OLOA 5HIKA 3KNZA 1S7OA 1AB6A 2CUTA 3E05A 2PUDA 1LRKA 1MG5A 1BD3A 1Z56C 2EWNA 4I1SA 5AICA 4AY3A 5CEJA 2Y27A 3GRPA 1SD4A 5HDKA 1ESNA 1NMSA 1NR1A 1OXXK 2ADMA 2R1TA 2XV1A 5LP6C 3T7TA 3TQRA 2CSUA 1MNEA 5DMXA 4BB5A 1DTSA 3EGCA 1B72B 5I7AA 3X1JA 3OY7A 5L4LA 1EIWA 3ZWMA 1K6EA 1LSJA 2IP1A 4OP3A 1RI1A 3I42A 5CYFA 5LCXA 4DJFC 4OX9Y 3D43A 4ZDOA 3OOUA 4U6QA 1EEHA 4RGXA 2REBA 3CRQA 3NJ4A 3OYEA 1EIZA 1LUAA 1CXZA 1XNHA 1H9GA 1ECGA 1YB7A 2QAJA 3JQ7A 4W7HA 4ZO6A 4Z4GA 2XUDA 3NYQA 1WVGA 1BCSA 4D57A 2R4TA 5JLJA 4A9AA 5K0BA 3R9XB 2QQFA 2CXXA 2LIPA 4RC9A 3ZD8A 2FWJA 2EZTA 4K1XA 4TROA 1RRFA 2I62A 4G0OA 1J2TA 1SUFA 3MZHA 1Y3CE 2OHHA 1L5GB 1CY0A 2CBZA 4UB6C 4MRVA 5HHTA 1JFTA 2CNDA 1YQ9A 1E3WB 3K1TA 4HJXA 4L8GA 2P65A 4PONA 3TQIA 2WKSA 4Y1RA 3G8DA 2EKQA 1FFGA 2A68F 2E19A 3I59B 3VHRA 1VJ0A 2PX5A 2VQFB 1ZRDA 1WCV1 1XZ8A 3PF9A 2C3UA 4M4SA 1JR3D 1C7IA 4QPOA 2GZMA 1KYQA 3TM4A 2HV9A 1R9GA 1YASA 1J6UA 3FNEA 4HZGA 1I0IA 4E22A 1KHHA 1TM7E 3Q5EA 1LVUA 3KKQA 3S3OA 1A9OA 2XRYA 3CSSA 2CFOA 4JLOA 5HIJA 2NVQJ 2LBFB 2R0QC 2HQ1A 4BRWA 4YWHA 4AROA 3PFHA 1GLVA 3G17A 1ZVVA 5CDHA 2B8TA 3A9VA 4AQYB 1NI4B 3IAM2 4PC1A 4ZXFA 4ZMRA 3JRNA 4G0UA 2R93J 1VLLA 1F5SA 1Z36A 4X44A 4IJUA 4IJAA 5H80A 5E95A 1AKMA 3GUYA 3U9LA 1GA6A 4BQRA 4G9YA 1L4BA 3LDAA 3IMFA 3Q72A 3IO5A 5J3LA 1I39A 4TV9B 4MEYF 1OE0A 3OG9A 5FI0B 4CCOA 2OT3B 2XE7A 1IY9A 3TMYA 3B9RA 1U9IA 3WWDA 4EVRA 4FW9A 3QNMA 1QO9A 4Q3KA 1A31A 1QQ7A 4EJWA 2QW1A 4QFMA 5LIPA 2BFPA 3PDJA 2J9FB 4MMYB 1WFXA 3AUUA 4KW7A 4MUEA 3RTGA 5F9HA 1CPYA 3FE2A 2I5PO 1FBSA 1Y8CA 3JQRA 1CIVA 4FHDA 2EZKA 1CUCA 2DFLA 2PH5A 1NBEA 1VE9A 4WOPA 4P2GA 4C4YA 3VKUA 5JW6A 2R7VA 2QYHA 5F0FA 2JCVA 4UTZA 2L54A 2VHUA 1G2IA 2EFYA 3UH0A 5ILUA 4LDQA 4ESHA 4V0OA 1QB7A 1HOTA 2VB6A 3HBFA 3N5KA 4GWLA 5KJ6A 3NTXA 5JASA 1WPQA 3QP5A 2OOSA 1D07A 3O1JC 3R44A 5AW8A 1B00A 2GXBA 1QU3A 3KWFA 3ANMA 4NQRA 3SD7A 4ZGGA 2I7XA 3ESRA 5EVCA 2HDCA 2PZKA 1XTQA 2PM8A 2R6R1 3HDVA 4JAVC 2HGCA 1LDMA 3N7AA 4WK2B 4GZ3A 1FMVA 2F8SA 1J2RA 3I1FA 2JI9A 4DR1B 1QU2A 1C8VB 4DZRA 1K4MA 3LSPA 2W7NA 1TTHA 1TVKA 2H9AA 3QI2A 4PM4A 1EESA 3NFRA 4M3EA 3EHDA 2XGJA 3SZ3A 1I4TD 4U0YA 4I7HA 1LBEA 4YRQA 2XF7A 2ISQA 4B17A 4IHYA 2OV6A 3FGNA 4R5MA 1SFUA 2FSVC 1AKYA 1N9GA 2FMLA 4JJGA 5BR1A 3FNHA 1QGUB 4DT1B 1JYFA 2XYVA 3CE9A 4EW1A 1MDMA 4DHEA 4B35A 2QL7A 3DL4A 2IYOA 5BUZA 1HKUA 2HWKA 4CDRA 2VHCA 1JWLA 3L4BC 1G3IA 4DR5B 4FHCA 3GPLA 4UHHA 3QW2A 4JB8A 1S1MA 4BZPA 1FTTA 3OZSA 3CF4G 3FTDA 1QIEA 1FTGA 2JIBA 2HOSA 2M8EA 1XCGB 2HCBA 3L7AA 4P9UA 4HTFB 1P80A 3FCUB 2X1EA 3SGLA 3MWGA 1E79A 1X1BA 2JEYA 3UXHA 1NY6A 2REQA 2ZB2A 4PPQA 2EP7A 3OLZA 4HPJB 4E31A 2ZTHA 5BURA 1CD5A 3ZQGA 1ZISA 5FBKA 3FZQA 4H0EA 1UQTA 1D09A 3H4MA 1XTZA 2FWPA 4RS4A 1LX6A 3UBTA 1IG0A 3T7EA 4JX5A 4IGIA 2DA3A 4ZVKA 3RUAA 1JRLA 3QQ5A 2X9LA 3NH6A 4F12A 3RROA 1IBLB 4V2FA 1WHTA 3AJ8A 4Y30A 2BY1A 1JLLA 4KHPB 2KPMA 1XDSA 3IP7A 4MGZR 3KQYA 3WQHA 3ODGA 1FVXA 2IYZA 2GYUA 3DM9B 2J5OA 1MMSA 1OIXA 2WINI 4NIMA 3OQBA 3I37X 4AMVA 2ZRBA 3MMPA 4HV4A 4NBLA 1G7SA 3KXLA 3M82A 4CGYA 4DV6B 1A2OA 3NEUA 3OPMA 5DCLA 1X92A 3NWTA 2Q21A 3I1JA 4D99A 1GKLA 2WRZA 3LO5A 4JWTA 3B6AA 2B6HA 3NVKI 2LDUA 2D8AA 1VSUA 2OB2A 3E15A 3TX2A 3PFFA 4M8SA 4ZHSA 2QHXA 1K6MA 4F5ZA 3K5IA 2F4MB 3BPSA 3OCVA 3PWKA 4YNBA 3IH3A 3DWEX 1U63A 3FPKA 5KQPA 3R60A 1VPLA 4A16A 4PJNA 3OF3A 2BGKA 2CXRA 4DBLE 4D4LA 3ENQA 4DQXA 5DNYB 1TCAA 2V5AA 1Z74A 3C6MA 3GD7A 2HHCA 4J1TC 2ACVA 2RKBA 4CA0A 2EZIA 5HNHA 2IZZA 2WF7A 1YB1A 1CS0B 2YQ5A 1IN7A 1KQ0A 1IUNA 3OMWA 3QELA 4HUTA 2G28A 1CR4A 2PV0A 3KVRA 4OOFA 3Q1LA 2IHNA 4UVHA 5KKNB 3ZV4A 3MTEA 4PFQA 1Y9ZA 1LK5A 4B8XA 4QASA 1OFVA 1ILWA 3DMGA 3ZE6A 2MOKA 2V6MA 3UT5B 1N1DA 4Z51A 3TR6A 1Y42X 1VYUA 2ELJA 3PUZA 3NBKA 2C2ZA 3UC5A 2FD5A 3AL2A 4RK7A 1XRQA 3FVWA 4FZ5A 1HW5A 1EMDA 2B21A 3C3WA 2P5SA 3C7KA 2JA7J 1P7WA 1WF3A 3M1AA 1GPUA 4L9VA 5FNVA 3U3JA 5DBHX 2QK4A 1QPBA 5FJ8J 1BJTA 1GZHB 1NPTO 1P7VA 1XJCA 2GZ2A 5DHTA 4DMHA 5BXYA 1FBTA 3D81A 1ZZEA 3I05A 3MVEA 4EEFG 3DFKA 2CHEA 2XMDA 2NQTA 4HOYA 1G5HA 3DXZA 4LGMA 4ZYYA 1Z05A 4XDZA 3RRJA 5A5EA 2EATA 3VV2A 2GEJA 3WAGA 2BBSA 2VHQA 3L0DA 1P7IA 2BI7A 1YKFA 2I8CA 4KQWA 3JWIA 5DM70 3NIFB 4QNRA 3ET4A 2L0KA 4X3PA 1G38A 4RO0A 3BB4A 4BTVA 2M7BA 3G1TA 5ALDA 3IOCA 5IDVA 4REQB 4WFJA 2F9LA 3VI3B 5JSQA 3BWXA 1MBJA 1OOEA 3VM6A 3E5XA 4BJHB 3H5IA 4ZYUA 4WEOA 3FFBA 4EUFA 3OLWA 4LYDA 1SANA 3QVGA 4BFZA 2AUTA 2I1WA 2FWRA 4GQAA 4RKFA 4L18B 3CRMA 3NHMA 5KUTA 1GRCA 2ZE5A 4CU5A 5BT8A 5DTIA 3NS7A 2GIZA 1K4KA 4MQBA 2HTFA 4OD0A 4D45A 1WH5A 1WXGA 1E7WA 1ETUA 2F17A 1O8BA 4KSYA 3PUYA 3GFJA 3CJNA 1ULSA 4TGLA 4I14A 3C3EA 2LZ0A 2P0EA 1O7LA 1M2NA 1TMYA 2W6PA 4G1UC 3PHBE 5I9MA 4CWAA 3NDBB 3EAFA 3CC2I 3HCCA 4URYR 2JCBA 3ZCSA 3ZD7A 2PNFA 4G7HF 3AJRA 5BUCA 1O9GA 1X7ZB 3HZHA 4IRMA 3JWHA 5LYJA 1UM9A 2ZR8A 3E8MA 4H15A 3AUFA 1F48A 3M1EA 5JTUA 2QD2A 4RZXA 3FFTA 2AFIB 2HWUA 3JZIA 3K7EA 3NV7A 3KYCB 4HB4A 2DFIA 4HBGA 4NZPA 3EYAA 4UKDA 3JAWB 1A2KC 2W22A 3TIGA 1J2EA 1V95A 3ZWAA 5DWQA 1ZOIA 3U3RA 4C4XA 2JHAA 5LR6A 2JFGA 2Q3BA 1EH6A 5DW3A 1Z91A 4Y8VA 2RC6A 4ZT3A 2J6BA 5E1ZB 3QLUA 4J0DA 1B8IA 4M8KA 3ABZA 1NWHA 1F06A 1OYOA 3VXKA 1YS1X 5CKTA 5M3FJ 1NM5A 2WFLA 3AHFA 4X1YA 3CCQI 3O9VA 5DUIA 1MRNA 2EIHA 1KAOA 1E9AA 1OFTA 2GYWA 1RRJA 1KBOA 1ZMOA 3N75A 4M1EA 4Q6WA 4KWCA 5AK4A 1NN1A 2H8KA 2P6NA 5LWQA 2KLOA 1XU7A 4M7OA 2JIDA 3QU4A 3SNKA 2IHVA 5JXWA 2P2SA 3IIJA 1Q6ZA 3N8DA 4MSUA 2O3SA 4J76A 2ELKA 4PYKA 1CY2A 1N2OA 3DO8A 3CG4A 3SKXA 1TNTA 2P9EA 2W0MA 1CC1S 4PUSA 1T5SA 1KZ9A 3DMYA 2XD4A 1E8NA 2GO1A 3JRXA 3URMA 1TUEA 5HXAA 2HSZA 4LCBA 2IXDA 3IRUA 2A35A 2ZVDA 3FFWA 4I6EA 4S24A 3QUAA 1MC4A 3JQGA 4KACA 3AZQA 4XLEA 5EE9A 1UC8A 1NTRA 4XOIA 3H84A 3WYEA 5B5EC 2XYPA 4HDNA 5DYNA 1U7XA 2CEKA 5JD6A 3KT3A 4KXYA 3HUFA 3QK7A 1X8JA 4F6LA 1ZSVA 3V9PA 1DCTA 1E61A 2YTZA 4FDAA 5TJJA 4WX2B 3LH5A 4NTZA 4KPYA 2AYYA 1UPUA 2R7TA 3SBDA 1WI3A 1T15A 1Z4KA 1XJ0A 1J42A 1YYVA 1HG0A 1UJ2A 2CBXA 2W6CX 3HKDB 4PZEA 5D3KA 4P55A 3PNLA 3F8SA 4GICA 4MPJA 4QU9A 4XGRA 2ZKZA 1D4AA 1P6RA 1MQSA 1SBCA 2SCUB 3D8SA 5ALZA 2WKQA 2HDHA 3B1VA 5K03A 2HQNA 1G0NA 3SKYA 3U5TA 2V26A 1C2TA 4MDEA 3TSWA 3AIMA 5FKMA 5GTIC 1M2VA 1UMCA 1XTVA 2VDRB 4HH4A 3V1LA 2FR1A 4YGYA 2QSHX 4L5CA 4WN9A 3DONA 3CMMA 2PZLA 2W58A 1KU9A 2GBCA 4R1QA 5JSYA 3I6ZA 3ZGNA 5BQTA 1MPTA 1J0XO 1H3FA 4B4OA 4QKQA 5K8JB 1V4RA 3AX6A 4LB6B 1HEIA 1RXUA 1O54A 2SKDA 3PZBA 2ZBEA 3W6ZA 1NI3A 5BQ3A 3SS9X 1LPAB 3W8NA 1MQAA 2H1LA 5D00A 2IYQA 2NUPB 2UUOA 1SHLA 3LO8A 4HQ6A 3A58B 4UARA 1MBHA 2PRYA 4Y67A 3IPRA 3RNLA 3KP2A 2HJWA 4O4HB 1M7BA 4Y0NA 3SJAA 1VC2A 4WK0B 4DY6A 5JZ9A 4PHFA 3N97A 4YS6A 2HREA 3CQZJ 1E0EA 2RHWA 3UOGA 3P7MA 5IEJA 1HE1C 2JAWA 5JSHA 4EP1A 5JQWA 3CVYA 3ADPA 1NSFA 1XV5A 2O7QA 4L9NA 4CR8A 4WCFA 4BB6A 5ERYA 4EB0A 2B5OA 1YA4A 2IW5A 2QUHA 2ZREA 3O4RA 4H3HB 3LQFA 3HJHA 1FQKA 2X7XA 9ABPA 2GI4A 2CHVA 3DH0A 2P7HA 4UOQA 2M2IA 4QUAA 4Z9YA 4C0HA 3V6MA 1GA1A 2P4HX 4L0ZB 2ZJAA 2XGDA 3R7LA 1TECE 3BEDA 4D1YA 5GVSA 3BIOA 3S16J 1DEOA 5DGXA 1DADA 4BY7J 1F17A 4HLNA 3HSSA 1KYXA 1E5TA 3W4IA 2RB4A 1IGNA 3RTEA 1M76A 4PTZA 1QNLA 2V3CC 2W0SA 5SZHB 2YC2C 2RGBA 1V5EA 4QGBA 1NVBA 4YALA 2BTEA 1WF6A 3GI1A 3OE5A 1NRXA 5TQ2B 4GKKB 3WG7H 2EJCA 2KP6A 3NGMA 3OJ0A 1X1QA 3I9NA 3L2UA 1X7GA 3OT5A 1TPYA 4HWGA 4LRUA 3TRKA 4H7KA 2BUBA 3GBSA 4RQTA 3K5PA 3WMFA 2CSXA 2YS7A 3Q3VA 3VDRA 4YY3B 3T3NA 1MXFA 1A50B 1TNSA 3DTTA 2N9UA 3E6MA 2XKOA 3MJCA 1ZHFA 2G7UA 2VCEA 3A3NA 3DWLE 3K1AA 3KBBA 4RACA 3W7AA 1DU6A 3KT6A 1JAYA 3DB2A 1H2XA 2FEWB 3L8CA 2Q45A 3LX4A 3PHJA 4K9OA 1AUOA 2NSYA 4JLUA 2Z30A 3IPXA 5EE5B 4CO8A 1KU6A 1QFXA 4LF7B 3GLLA 3Q87B 4DLSA 1V6SA 3C98A 1UAYA 3C3DA 1BX1A 1IZ0A 1QGOA 1YOVB 2VP3A 3JARB 4LDAA 1OXVA 1M2KA 1O7JA 2ZI7A 1GT0C 5AJZA 5DLQC 2NUTA 2RCNA 4B0OA 4RTLA 5BWOA 4BLRA 1DG3A 1I5EA 3M6VA 1G5TA 3P9ZA 3T8RA 1PTJA 3NAQA 1T24A 4RWEA 3H04A 4JLKA 2C3MA 5FBWB 4MPTA 3UJPA 5ILQA 2J32A 1N4DA 1ZW1A 3ELYA 3VR2D 5BVGB 5E7IA 3AERA 4LSMA 4QPCA 1IQ0A 4ZQIA 2EHDA 3U7JA 3UB2A 1D2MA 4ON0A 4ER5A 3LY8A 1ATIA 1NULA 3KJGA 5JEEA 1BJKA 1V41E 3HM9A 1UEXC 1MOSA 4B3RB 3K9FC 2PQ8A 3P4UA 3D0QA 4R79A 3JATB 3MWEB 1LX7A 1OAOC 4YK7A 1IXCA 3OT1B 5CVCA 4AZVA 5C4MA 3I8OA 3IEMA 1D2EA 2JB9A 2PI0A 4IFIA 5L7YA 2X0FA 3SU8A 5AUNB 3W6NA 3CVWA 1N2JA 3PEFA 4IRIA 1PBTA 1UK7A 4S12A 3SX2A 4LNAA 2C2BA 5B30A 3F8TA 4D9BA 1J2UA 2ZZKA 1LPMA 1EFVB 1LZLA 5EG5A 5KYGA 2B5VA 3G68A 5ESWA 2B9VA 1PQPA 2A59A 5KYXA 3V7UA 2A88A 1D03A 1J99A 1TW2A 3WGIA 3C8ZA 1PWYE 3S7ZA 5IEBA 3RWMB 1E3MA 1WS6A 1XPUA 3WTBA 1NOIA 3QUCA 3FJOA 3O0DA 2F6RA 2CY0A 3CRVA 1JLSA 4F6CA 3HDHA 4A27A 1AGNA 3OX2A 1ETKA 2WHRA 3F6RA 8OHMA 5K0SA 3HBMA 2HVRA 2C5LA 2VQLA 4CODB 2JGIA 2PL9A 3ZR4B 1B8NA 5AONA 3FHNA 1G8XA 5K1YA 2CYBA 1KI6A 3HYSA 4JP1A 1KQNA 3WIUA 3NAMA 2FDCA 1SK9A 2I2FA 3JRHA 3MS4A 4LMRA 4UBNA 3OZUA 5E4TA 4HEHA 4ZZ1A 1DC3A 3ENKA 1JQKA 2VVTA 5UKDA 3DKIA 2HVSA 3LOUA 2VT3A 5C4XJ 1RYBA 2CLDX 2AZDA 4HFJA 4JOQA 3DE6X 1BWQA 2YV1A 3KV3O 1QO0D 1QYRA 1TEXA 3MLEA 3DHVA 1SZJG 2Y1WA 5DF1A 4TT3D 1ZJ4A 2FMXA 4LXYA 4DPMA 2BSXA 1DRKA 1W4AA 3FIWA 1E4EB 4H6VA 1DIAA 4TS1A 5I9LA 4EEZA 4Z4EA 1QLJA 1PYGA 3OKCA 3IRVA 4K9SA 1NYRA 1BKYA 2PSDA 3TNJA 1SEPA 5FEMA 2GEFA 3M9LA 3ZN2A 1NG9A 2ONYA 3M33A 4FILA 3R5XA 2DTDA 2J0UA 5A4KA 3KEQA 1NKVA 1X19A 3K4LA 5F64A 4A0GA 4BX8A 5ITWA 3U7GA 5CDUA 1NC3A 1EH5A 2OGTA 4B47A 1C9MA 1W76A 4UJ3A 1R3UA 1Q7RA 2NV2B 5D3MB 1MOZA 1BOBA 2YR0A 3ESZA 1VHLA 1QIFA 2BRUC 2A67A 5CXXA 1ZA2A 1FRNA 3PYXA 3UGQA 2H48A 3EPPA 4L73A 1YB4A 2CYYA 1CZNA 4NK5A 3TW7A 1QOZA 1AGPA 5DYMA 4GBGA 4IDHA 1N2CB 1DQNA 4P54A 3R9IA 3W1WA 3IKMB 3WL8A 5CU7A 1L7VC 3FPEA 4BNGA 1KS2A 3TDZC 2PWPA 5B2EA 3QEBZ 4BVEA 3N0RA 3EN0A 4GO1A 3W3AA 3COWA 5AK3A 1J5EB 1SBQA 5EMNA 3LL7A 4B4DA 3I58A 2BZTA 1JJBA 2ANBA 2ZVPX 2VI5A 3B51X 4KX3A 1UOOA 2C7BA 2CD9A 2RAPA 3EGXA 3GMDA 1WPKA 1SA0B 2HCTA 1CLUA 2IVMA 1VRVA 2DKNA 2Y93A 2E1MB 3L01A 2AFHB 3MCUA 4PIPA 4URFA 1LW6E 1ZH6A 4B6JA 5JRDS 2J3KA 2IKSA 1RRCA 4KO3S 3PB3A 2XPCA 1T0PA 1T4CB 2EQBA 3PC2A 4BVBA 2E48A 3K2QA 4E5SA 1GV5A 3U17A 3DTEA 3AJEA 1VIMA 1CUGA 1C4OA 3X1MA 4C5BA 4YT4A 4PO9A 2IEGA 2VJDA 1M1UA 2QRQA 4UUPA 4WGFA 4ZOLB 1WPRA 3RSCA 1EBUA 4TUYB 2AK3A 4JP3A 3PXXA 4B7ZA 3DYIA 3OX4A 5DGDA 5KYVA 3ZU6A 5C8VA 1FY7A 4Q3LA 2C97A 2VKHA 4FONA 4P1ZA 4C3UA 2I22A 4ZOAA 5JJBA 2W6ZA 4GPD1 2H6CA 1XZKA 5ELXA 1RYHA 2IF2A 5IC6A 3NZEA 3GPBA 4RHCA 4UNIA 2VDPB 4O63O 5DTMA 1KDPA 3HL0A 4NF2A 1WCMJ 2BVNA 5B7QA 3L9FA 3K20A 3REOA 2JVIA 2OLKA 3N53A 1MJFA 4C4TA 3AEZA 4M22A 2GZ1A 4LOHA 4BVAA 1ODDA 4BJ5C 1OVGA 4FFVA 3WIVA 1U7UA 4PLTA 1W7PB 4CM9A 4ZU1X 1ILEA 4JSRA 4LE2A 5J8FA 4UCXA 3JREA 3Q4GA 4YJ2F 4OATA 3LQKA 4MA5A 2HADA 2VZ0A 3WWYA 2COUA 2DHRA 2RAEA 3VHXA 4EYKA 1BA2A 1PV1A 5CD1A 3TLBA 1ZJ5A 3A6GA 5B1DA 1HNXB 4CNQA 1ZP6A 4H59A 2JCYA 1ODKA 4ITUA 4DW8A 4HF7A 5K09A 2P9FA 1YVEI 2A92A 1JLKA 1CUZA 2FSGA 3PXGA 5FADA 5JPDA 3U3OA 1F2UA 3ETDA 4FHTA 4BDYA 1W30A 4EFNA 4IL5A 1YCGA 2W42A 2QT9A 4ML3A 3LGAA 2QGUA 4G67A 4PW0A 3L3BA 1AO3A 2CSOA 4HK4A 1WEKA 2UZIR 3HVHA 2QZ8A 1R4ZA 3HSYA 2DM6A 3NWJA 2QSYA 4O0MA 2BVMA 3H92A 3NTQA 3DCJA 2H8RA 3KP7A 2D2EA 2QLFA 3GMSA 4C0JA 1IWPB 1YX5A 4QGHA 1Y8AA 1VYTA 1CQIB 3TWOA 3ZGKA 4Q19A 1RKXA 4S1OA 5IJAA 3RVLA 3AF3A 3S0JA 2R11A 3WRXA 2ZW9A 4DMMA 5HVQC 3EYWA 1CJCA 1V54H 3NDPA 3SZUA 5CFLA 2I5UA 1Y6JA 2WV0A 3QE3A 3OTGA 2A33A 1L7EA 4N65A 2WAMA 1BAPA 1MVOA 3VODA 1FZQA 2CHUA 4ZTBA 2QEQA 1G66A 3HRMA 3DMRA 3D6JA 2ZROA 4IEIA 2UVDA 2QLLA 2E87A 3FDZA 1Y89A 2NSLA 2RIPA 4OV6B 1C80A 1E3DA 1VKJA 5AXDA 1BW5A 1Y37A 1AN0A 3DB1A 1Z75A 3L6OO 4IV8A 4MP8A 3ZWPA 1AH2A 4C78A 2BKAA 2C3PA 3LRXA 5JFGA 2OAEA 3NMUF 4FFBA 3M5PA 5K51A 4I8DA 1HW2A 2PR7A 3BIFA 2W2QA 1NK2P 3KEYA 2JLRA 3L0SA 4BFCA 1IPFA 4ZN6A 3HXPA 3ZVMA 1JXMA 2EJTA 4HEA1 1NX6A 1O6CA 2CN1A 4HBLA 1Z6AA 2Z6VA 3HV2A 3NFYA 4OUDA 4U2CA 3AESA 3P96A 5EGNA 3WLOA 1YS4A 3KTDA 4URZR 1JAXA 5K0EA 1X7WA 3PLRA 3H6GA 3K0KA 3ENWA 5CH8A 4ZT2A 3OZRA 1W9MA 2IKQA 1TGVA 1CWUA 2DQZA 1FUYB 3J7AY 1PJQA 2L02A 1TA9A 2R8PA 2VPPA 3MOGA 3RS3A 3V2HA 4YIFA 1DFGA 1P5JA 2QTNA 4UMFA 4Q9NA 2ENUA 5C3EJ 4RX1A 3CONA 3GR6A 2DFTA 2HMTA 1O9BA 3OEWA 2XVZA 1K2VN 1GAEO 3LYHA 2EA2A 2ZBDA 4CCNA 3S1AA 2VAVA 3GPIA 4YLGA 3WGHA 4D4JA 3O2QB 3SQOA 3BIXA 1P4AA 1MC5A 3DOEA 1CJUC 3VVLA 3WU1B 1HI9A 1PFKA 1ZN9A 2J3JA 3EZFA 4HBZA 4L4ZA 4FN5A 2B1QA 3TW8A 4Z4FA 4F91B 4M9XA 1W7PA 4A3GJ 1BI1A 2ESNA 1SZCA 2BWJA 5LEKA 3LWNA 1QO7A 1O4WA 2F7SA 4EDFA 1QCYA 3NUGA 3JASA 3WADA 2JA5J 4ZEXA 2G07A 4DVJA 4DJJA 3R7AA 1TQDA 5HF6A 4D0LB 3L7MA 3H3FA 3GUVA 3L7LA 3ZXIA 3SYTA 3L04A 3G1WA 1BMTA 3QXCA 1WJ5A 2R7MA 1H66A 3OU2A 4FR2A 1JXQA 4YMIA 1YB2A 3DTNA 5IBPA 5ALMA 2B36A 1JB9A 3VH3A 4DJ5X 2AD1A 4LHZA 1C7RA 4RSMA 4N0MA 1GUYA 1WSWA 4GR5A 1JYSA 1Y56A 2RGYA 1KMNA 1SK8A 2P27A 1QANA 2RSLA 3F3XA 2XQIA 1UWVA 2PKQO 3AMVA 4L2IA 4XKVA 1K5HA 4FTHA 1GYPA 2RDPA 1NQOA 2O06A 2QQEA 2QN7A 3GRUA 3H5WA 3M8JA 2UV8A 3IERA 1ONOA 1U65A 4NBUA 4ESEA 4A3JJ 2AEEA 4LC1A 3FMVA 1M7GA 4P3PA 4OWRB 2X0LA 2OA0A 3L18A 5FT9A 1QP0A 4ZTFA 5ALEA 3FVVA 3TFWA 5D8LB 3O3MB 3IOMA 3FYDA 1JLMA 4UFOA 4A3DJ 4EUSA 3CW8X 2QVCA 3HVRA 1UPCA 4E7JA 3SOPA 3D2AA 2F43A 3KL2A 3PJGA 2BMEA 3FYUB 5L3SB 4ESVA 2E1CA 1YRNB 1NLMA 2G0AA 2E6KA 1XDUA 3KOZA 1EQUA 1PG0A 4S1WA 1QZUA 2DSNA 4Q1BA 3UHJA 1WD5A 2C9DA 2ZJ3A 3CO5A 4N0PA 7REQB 2B4TO 5K6AC 4BPBA 4KNVA 1IOVA 4LLGF 1EWKA 4RM3A 3IPLA 4WXMA 5K8VA 2J6CA 3PGKA 4IH9A 4QXAA 4BGUA 1K7AA 3NONA 3ZGOA 4HP8A 3MWJA 4NBNA 3LF1A 5JBQA 1V3QE 1EA7A 3GDOA 2Q1XA 1E1YA 1T33A 1Z2CA 4HGPA 4RBOA 1SU4A 3S1LA 4NQWB 1V47A 3EVEA 4JS0A 1ZC3A 4XSGA 5IUKC 3B2EA 4QUHA 1N33B 5BYBA 1DC4A 4QLBA 3ECAA 2V7PA 1RXWA 3Q9UA 3QLVC 4MVWA 3RC7A 4BNCA 4HMPA 3THSA 5A5GA 2J5RA 3KZCA 4Q4HB 1B8OA 4FCYA 1P5RA 1KPHA 2VN8A 3A1FA 4KPUB 3GEBA 4NJEA 4R2WA 3WYNA 5CEFA 2BFFA 4LC9A 4M86A 4P81A 1A2BA 4MARA 5I47A 4PLZA 1M0SA 4ZI7B 5MHTA 1I2CA 4L51A 2EFNA 4OOIA 2C5FA 2CYCA 2GBFA 3SKVA 3OKPA 4AC0A 3PYMA 4P86A 4ZQEA 4YP6A 3OWHA 4ARUA 2HXGA 2HX1A 2L69A 3GFVA 4BN4A 2BBYA 3RNOA 1NUAA 1SCQA 2XT9A 1GGVA 1NKSA 4MKZA 3VO9A 3WRYC 4AWBA 4MEBA 3SQXA 3SOZA 2VAWA 4OHMA 2HJVA 4YHHB 1AURA 5AKEA 4TMKA 1EX1A 1G8HA 1KYYA 3E53A 4HQOA 1H94A 3K0AB 3ERCA 1P44A 1WDKA 3O1HB 3PG5A 3CISA 2ZUEA 3GQBA 2MC4A 2BEUB 3MGGA 3Q9LA 3BCAA 1N8TA 5KC8A 4KE6A 4YROA 4BAUA 4D3YA 5IYZB 3REGA 4QYIB 1OKRA 5BN4A 3D8BA 1ZUIA 2FKAA 3N6VA 3SS7X 5K20A 4EGCB 2XASA 2YRWA 2D1HA 4RZQA 2IGTA 2WVHA 3WYFA 4DDWA 1XTAA 1HL3A 4GYJA 3MERA 1NURA 2V6IA 2K7ZA 2VHYA 1NF8A 3ABLH 4KR7A 2H1WA 2LFBA 2G6BA 4FKBA 4DLKA 4EA9A 3BZWA 1OPRA 4ONEA 1L7OA 4XI9A 1C1DB 1VA4A 3I09A 3WYGA 1YVRA 4JQOA 4MHGA 1KFCB 4MKXA 4NBVA 4GZ5A 3AFMA 3LSRA 4P22A 3FUWA 4WHMA 4UTPA 3HK2A 4JXZA 3I56I 3O94A 4ZH4F 3TO9A 1VQ6I 1SXIA 1WB4A 3R3VA 1EVJA 2OE2A 2K4JA 2V0CA 2Y9ZA 3UR3C 2XXBA 4B8YA 2R4UA 4EHNA 3JAMA 2LG4A 5CB6A 1ZC4A 2B34A 4FEAA 1J9ZA 2HNAA 3BPVA 3EQZA 4P2BA 5KYWA 3W5CA 2G9ZA 1KJIA 3FPHA 3M9WA 4IH4A 4D74A 1A71A 3EQ2A 2VA8A 2NNNA 3GLHA 4KK3A 1ZCAA 2GN1A 1EE2A 1K4YA 1SAXA 2HHLA 2HO5A 2XVYA 3AOEA 4N40A 4QUIA 1TJNA 3U9GA 1Z7LA 3FTCA 4NCAA 2CDNA 2DBBA 1J97A 1E7YA 1NJSA 2DVMA 4WKBA 5TJ9A 3RVQA 1Z2OX 4M71A 2RGWA 4TYMA 3STUA 5BSKA 1R9NA 1PZHA 3GFSA 3LZDA 1AMOA 2PFSA 3LPNA 2QRPA 4G89A 4NDNE 1VCMA 2WG0A 4WASA 4E7PA 2PFGA 1NG6A 5TB5A 5D85A 1NW6A 4R16A 2IEAA 2PGLA 5ALSA 1L0OC 3QMPA 1UJNA 2P6SA 4QWMA 3FCXA 1FTZA 1MMGA 2YXLA 2SKCA 1T5IA 5I7WA 3HVIA 2NMVA 1E2NA 2V6FA 3FSGA 4HRXA 1SBIA 3HSFA 2CF5A 2KX7A 2PUJA 2RGDA 3A1DA 3A6DA 1H4QA 4RB3C 2VQSA 2VNJA 4N0EA 4QEDA 4MVJD 3H2IA 1BMFD 4A5NA 4L0QA 2XQGA 3IE1A 4R1MA 3OLXA 1CJTC 4LHEA 4OB8A 1N5IA 5E9JA 5SZKB 5HRCA 3ORFA 3ZY5A 4TN1A 1IATA 3LC1O 4Y0AA 4D98A 5A1TA 1G2HA 3BY6A 3GNLA 1W0KA 3C6ZA 2MYTA 1PWZA 4LBYA 1XD8A 3CNNA 1ZQ1A 5G2OA 3OZBA 4BNZA 4CE6A 3SZMA 4A6EA 4IZ6A 4E46A 2QSGX 1NNEA 4KICA 4QFCA 3S8MA 5CLJA 3MZ0A 3MUEA 1GFZA 2MIIA 5HX7A 2Y1GA 3FYSA 3G7NA 4QULA 2AN1A 3G9ZA 3K9CA 3NHLA 2I65A 4MO7A 4X6YA 4LS3A 2LE0A 3PDWA 5E8RA 2WP0A 1D2AA 5BSTA 5C8YB 2VXDA 1MDFA 2WV1A 4ENUA 1ZN7A 2CVPA 3OQOA 4D9EA 4Q4AB 1NK3P 3TLGA 2ZYWX 3BREA 1FIUA 3OPYA 5A1JA 3J7AC 1ODSA 3A3KA 3ANXA 3VPHA 5JV5A 2ESHA 4XX0B 1RESA 5E17F 2ECFA 2QVZX 2ZUSA 4G84A 4O2BB 4F2WA 1EHIA 1U5TB 5THQA 1DKPA 4DV3B 1N7HA 2E37A 2GPJA 2REXB 3RC3A 1IZ1A 2D1QA 1KYIA 2VK2A 2XEXA 5DN6A 1GSIA 3ZY2A 4B9AA 5IXSA 2NN3C 1VKZA 5F1PA 2RK3A 3HQ4O 3HDGA 3F49S 1L5LA 2H3EA 3LUFA 2X1DA 1U3VA 3SFZA 4HEQA 3GC6A 4R98A 1LGYA 3W77A 4BJ5A 1ZPDA 3AIIA 3PDIA 5F2EA 5L53A 4A92A 1JIIA 1TTYA 5KAMA 1X6VA 4FLFA 2HO4A 3II6X 1UBFA 2AVNA 4C3JJ 1XWWA 1YIOA 1KK0A 1CKEA 1HQYE 2DFKB 3HJCA 2D1YA 4A1OA 3Q9SA 5ITSA 3QFTA 2ZSEA 1B6GA 2MSKA 2VP2A 4G6DA 4ZV7A 4QX6A 2YU9J 2VONA 3NAZA 1LNSA 2BFNA 3QJ5A 1CUHA 1FC0A 1LF5A 2KWIA 4TL7A 4CVNA 3GVAA 1Z0ZA 4W97A 1RAAA 2FEAA 4NOLA 4UREA 4XLHA 3W2IA 2DFHA 5I8WA 1H1LA 4C0QC 4RWZA 3K2BA 5HIAA 5AM4A 2Z2JA 4B4VA 3SY8A 4B5LA 3ROZA 4TKVA 2XBLA 2ODPA 1WHSB 2WY8Q 5DI3B 3T5PA 3L4BA 4AO6A 1K6IA 3BRQA 1FDIA 1PJ8A 2YZNA 3CCVI 1YDEA 2XLBA 1KMQA 3OETA 3PFBA 4RSRA 4A69C 3UF0A 4E07A 1KIMA 1REQB 1Y9EA 1RHQA 1BXGA 3VBCA 5K6RA 3L2QA 1FX1A 1RLOA 1QHHD 3HGGA 3RRZA 4X60A 2D1TA 1ARZA 2MYNA 1ZVQA 4N39A 4PX2A 3PIDA 3NKFA 4D0GA 1NUTA 1MORA 2Z4SA 4J7UA 4YRCA 3VTZA 4B6PA 4O2RA 2JJ8A 2C5SA 1J2XA 1XLTA 1XI2A 1SC6A 3JD0A 1U8EA 2XKJE 1CV2A 3ZK7A 1X7HA 2W43A 3HCWA 4BWGA 1SD6A 1ZKGA 5IULC 1XZEA 4X63A 3T5AA 1CY1A 1XSXA 1QBGA 1T2UA 2B1GA 4L07A 3PDCA 3A3PA 1V35A 3E97A 4MQUA 3C39A 5IJWA 3LSTA 1Y7HA 1WVMA 4V3BA 1NQ5A 1ZESA 2ZJ1A 4MV5A 3HP4A 5KQLA 4JB0A 5EXDA 2MWMA 1UC9A 4DLBA 1GNSA 4LZWA 2PK3A 3JYPA 4OP2A 2FPWA 1CYEA 3H87A 3ECSA 3K05A 2AXTC 4LUCA 1BN5A 2AHQA 5C4JJ 1K78A 1R0LA 2RV8A 3IP5A 3CUOA 1TAHA 3KFLA 4OAZA 2CNWA 1UXIA 3A01A 1WCYA 2OESA 4MYCA 3P52A 5GVRA 4RIHA 4BC1A 3OTWA 2O2CA 5KNCH 2ANCA 3ESBA 5C8XA 1PSWA 1TIKA 1SB8A 1ZS9A 3ZWQA 3Q0TA 1ZBDA 3PFGA 4J6FA 4LAFA 1NRIA 2H65A 3O82A 3BMQB 2C95A 4QUDA 4RKEA 2X0EA 1HXDA 3KP5A 1YJXA 3HVUA 4PHTA 2LV8A 4CF5A 3I01A 1V3TA 4QPQA 4X0GA 3LSJA 1U7OA 3E2IA 2NTVA 3OLYA 2PZFA 4O2AF 5LHIA 1LUJB 2OHXA 3R24A 4G09A 4LV6A 4BLOA 3QYBA 4KXNA 2MSLA 1SJ9A 1OH6A 1BW9A 1DO0A 2F3QA 3JQFC 3VGJA 1E0DA 1BD4A 2P62A 4WN3A 2FEXA 3CJQA 1G6OA 4OQEA 3LT1A 4FYHA 4NARA 1GVNB 2XUHA 4OHCA 4X24A 2IBMA 4F96A 1GTRA 3VTKA 1N5DA 4N4AA 3WOHA 1U3DA 2D06A 1NNI1 1OJLA 2OBXA 4IIJF