3P9IA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and sinapaldehyde
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9iA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9iA02
4CICA 1LEBA 3H3ZA 3C3PA 2QM3A 4PYJA 3LA2A 5P8WA 2Y48A 5EMKA 3O2PE 3KE2A 3EEYA 4HC4A 3T7SA 4KW7A 3I59A 2FA5A 3G7UA 2F2EA 1KGSA 2AOVA 2PKWA 3MHTA 2AXLA 1D2CA 2MH9A 2RQPA 5CLSA 2COMA 5EEHA 4E2WA 3DXXA 4FT2A 1LDDA 5ERGB 1I27A 1ZLKA 4KNYA 4U7TB 2VBXA 5L3EA 3G5TA 5DRYA 4G94A 2BZGA 2HV9A 10MHA 5CVDA 5E9QA 2RGVA 2K7LA 4EM1A 4DF3A 5DCMB 1YZ3A 2PLWA 5GM1A 1WRJA 3E5UA 1S3JA 3ZMSA 1FBQA 5K09A 3NW9A 4FT8A 5FHQA 1BC7C 4R05A 3D5LA 2FMYA 2ISYA 1XGMA 1AWCA 5EEGA 1BC8C 3PLAE 1JXSA 2DAOA 2NXNA 1B1BA 3ML6A 3P9IA 3DH0A 3ECOA 3OU7A 3IL2A 4ZYGA 4PYLA 4EQZA 3KR9A 3NEUA 1MJAA 4DQ2A 1UB9A 3QP5A 1VBFA 4AVPA 3LA7A 3C6KA 5LLQA 7MHTA 2B9EA 4ER6A 4X61A 3HA3A 1BC5A 4OA8A 4RVHA 4XSZF 3UJBA 4OQEA 4RGSA 5EZSA 1D8JA 2A69F 4OU0A 2JT1A 3TDUC 4IRIA 3GRZA 5DRTA 5FCDA 3TQSA 3LWFA 4FX4A 2B3TA 1JR4A 1K78B 4UUVA 1B9NA 4FS8A 4YV1A 1YW9A 2P7HA 1QZZA 5DYMA 1OYYA 4RB0A 2PY6A 2CMHA 3JTHA 2A07F 5D8KB 1TPYA 4M37A 1DCTA 4U7BA 3UJ6A 2PG4A 4ZYEA 5FB2A 3LGAA 3K1PA 2P7IA 1P4XA 2KIMA 4OQDA 1NW6A 2ADUA 4Y15A 4RGUA 2P1DA 2MBFA 1FJXA 2OBFA 3LSTA 2DULA 3HVJA 1XB4A 5AIPA 3GDHA 2DFIA 1RJEA 2AOWA 5KYGA 1O57A 2V1DA 4UV8A 3CO6C 2IT0A 1T39A 1EJ0A 3DR5A 1K6OA 1K7AA 3P2EA 4YMHA 2ESHA 4EJUA 2IVMA 3WU0A 3NDJA 4BLVA 5CIYA 4EJOA 4S04A 3CKKA 2RN7A 3SSMA 4P55A 3LBFA 2JZYA 1J7KA 1T38A 1R22A 1NW7A 1TQIA 3HHHA 3SSOA 4U0VA 2C6YA 4GEKA 4YMGA 2C7QA 1KQ0A 1JTEA 3EMBA 1IRFA 4R8RA 3A27A 3DMFA 2JTVA 3P71T 2PGXA 4GOOD 3ZMTA 2EB7A 2A6EF 3MQ2A 2H11A 5E8RA 3NMUF 2J5PA 3H92A 3BUSA 3PT9A 1U5TA 1Z1DA 4KIGA 1MKMA 2W24A 3ID6C 3G2QA 2GQQA 2FNAA 3NTVA 3ANXA 4FSXA 3KLOA 3QU6A 5HS8A 1Y8CA 4JXJA 3CJRA 5B1SA 2XKPA 5CVUA 4IV0A 5DUKA 2PQ8A 3J81Z 2OXTA 3FXQA 4BAYA 1M6YA 3RW9A 4QVGA 3KPYA 5K0LA 4ER3A 4O6JA 2DTRA 4RGXA 4POOA 5BW5A 4B17A 3KZZA 1HXDA 1RIOH 1USSA 5LRSA 4QDKA 5AIQA 1R7JA 1LB2A 2ZTHA 3FX3A 3G73A 3E7PA 1BI0A 2QUFA 5H6QA 4PCQA 4B09A 3CLOA 2CFXA 4IJAA 2ACJA 2AVNA 2BM8A 4A0ZA 5FFXA 3QP6A 3NVMB 3LQRA 2CG4A 1CGPA 4GCVA 1R36A 2OQGA 5F1RA 3IV6A 5E1MA 4L9TA 2OYRA 1R18A 3LDGA 4U88A 1BM9A 1VPTA 5GIOE 2YX7A 2H6CA 4M71A 2CSOA 1Z91A 3WTXC 1X1AA 2D1HA 2PMHA 5BQTA 2VOPA 1XSVA 1PJZA 5FA8A 5EVJA 2ZIEA 1VL5A 2EFWA 4I09A 5DCMA 3CTAA 1PP7U 1FZPB 1QBJA 3AWIA 5BPDA 3JW4A 1ONVA 1Z6TA 3OE5A 3OFJA 1XMAA 2B2CA 2M30A 4PYMA 3HSEA 3M6XA 2H27A 2R6ZA 3UJ7A 3O3KA 2IDJA 1YUBA 3MWMA 2W57A 1I1GA 2ONZA 4RTSA 4LD5A 1O9HA 2HFHA 5KK1A 1TW3A 5FADA 1TBXA 2VBZA 3BJOA 2VODA 3FXRA 1JHHA 2GLUA 2BBYA 1NHAA 3LCCA 5EPEA 2IPQX 2G9WA 3GO4A 3P9CA 4IHTA 4ZZDA 4C05A 1GXPA 4H0EA 5J8CA 1RJFA 5FHRA 5EHIA 3B7PA 2P41A 2V6CA 1RI3A 5E1WA 3SVZA 4LECA 3TRKA 2X4HA 1JQDA 4OX9Y 5JHUA 5ILUA 4RV9A 2JPBA 5AONA 2LDUA 2G8NA 3CO7C 2QWWA 2O57A 1HW5A 2HEOA 2KRFA 4HG2A 4P7JA 4BYYA 3OU6A 4X60A 5DWQA 4E31A 2QBYB 3U2RA 2GAUA 3C7JA 3HYIA 5GM2A 4A0XA 2AN3A 3THRA 3DLIA 4HTFB 5BOXA 1R5HA 1CF7A 4DCMA 5IT3A 4HSGA 2UYHA 2JHAA 1J0RA 2FCAA 1RI4A 4IF4A 2KJBA 4PCAA 3EDPA 3JAMK 1ZG5A 5FULA 3AY0A 3VEPA 2V1XA 1BIBA 3ROUA 5E8GA 3TO7A 1AV6A 1G8AA 1VP3A 5DPMA 1U3EM 3OCJA 3UJCA 4G9YA 3HRSA 3FZGA 1DUSA 2N47A 3FYDA 1MD0A 2Z9OA 3BJ6A 1MDMB 5DXJA 5EOVA 2NP7A 3HHGA 1D2HA 1W7PD 1G4DA 5FD6A 3K1NA 2A3SA 3B3FA 4KUMA 3SHFA 3RKXA 3PS9A 3ZMUA 3N4MA 1ZARA 1H1DA 1QQIA 3FMSA 4AZWA 4YFXF 2JRTA 3BGVA 2XVCA 3PVCA 3HCFA 4LB6B 4PYNA 3MCZA 2QQBA 5HLIA 3QV2A 2FRXA 1QZYA 2A68F 3G89A 1G3SA 3SGLA 1NT2A 2KW5A 5F2NA 1XXLA 3G8AA 3ELKA 2GAFA 3FMRA 3DTNA 4C07A 3UJAA 2K02A 2A14A 1YIOA 2DO7A 3KZYA 5F6FA 3CJNA 4U7PB 3V7CA 3X0DA 1MJFA 3E5QA 2GWRA 5ICCA 3HOSA 1XCBA 1D8KA 3OV8A 3CCFA 3EVAA 4GOLD 2VBWA 1C0WA 3KPWA 3F6OA 3EGEA 3EVZA 4EM0B 3KP7A 4KRGA 4QTTB 4EVIA 4GYIA 3RPQA 1ZYRF 4EQQA 3MERA 2FBIA 2HGCA 2XHKA 3L2CA 5F64A 4Y17A 3GCZA 1N7IA 3QOXA 2F5CA 2STTA 1IRGA 5E9WA 3ERCA 4XLNF 4G6DA 1WXXA 1KU7A 2RV8A 2XRNA 1YW8A 3EYIA 2FHPA 3R4KA 5LHGA 2XAQA 1WWXA 4RS8A 5D5VB 1REPC 4HF2A 2D2WA 2AOTB 2DBBA 2HNKA 5E9JA 3B5IA 1TW2A 4S05A 2UYQA 2DU9A 3RYRA 3R60A 4O5VA 4RTKA 3WTWC 1V4RA 4CYDA 3NQOA 4BY9E 3MB5A 2IH4A 1FP1D 5HDGA 2CL5A 4PYQA 5HDNA 2FK8A 2QQ9A 2VOOA 4ZYDA 2Z6AA 3V8JA 4Y30A 2GXBA 2H00A 4CTKA 2Z33A 4NECA 2L02A 4LK1F 2BM9A 1R23A 2M1BA 4HQMA 4M73A 4Q5SF 3C3WA 2L54A 2A6HF 5K0BA 2ZZMA 3UA3A 4P7GA 4FR0A 3DXJF 5DSTA 3LKZA 1INLA 1SMTA 2IA1A 1XCJA 2NP6A 4YFKF 5DLYA 4CTJA 3T1BA 2KIFA 4X41A 2P35A 3CJQA 4RTNA 1YW7A 3KQYA 4OBWA 2YUIA 1JE8A 3VC2A 1F9NA 1IAWA 2KIUA 2QBYA 5DEQA 1NW8A 3FTEA 4KIFA 3DOUA 3BWGA 1ZN2A 5CM2Z 2VT3A 4U0WA 4KICA 5D6FA 1VIDA 2HOEA 4LLNA 2HR1A 3A7EA 4ENJA 5C9ZA 1ZH5A 5HDKA 2G70A 4HAMA 2E7XA 4IRHA 2IW5A 5LQKA 1R58A 1UHWA 2Y75A 5J6XA 3EGIA 2HS5A 1EIZA 1X3UA 3KFWX 3UJ9A 3F8MA 1WS6A 2Q2EA 1FNNA 4WX9A 1ZG3A 1G3TA 4MEXF 4E32A 2EJTA 4Q47A 5L3GA 3D0SA 2V79A 5F2OA 2VZ9A 3OZTA 5E2AA 3AXTA 2XGXA 1WG8A 3ER8A 3HA7A 3HCCA 2G7HA 2TDXA 2VC1A 5E2BA 2O8XA 3E6DA 3RTRA 4BLUA 3RPUA 3PX3A 1JHFA 1S7OA 1XGOA 3K2ZA 1YFLA 2R7FA 2QYOA 2VDVE 1BOOA 2PWPA 3MTIA 1G38A 1TLHB 1YFHA 3Q7EA 5ILSA 5JFRA 4GBED 1WZNA 3SXYA 2AOUA 4YUWA 1H9TA 1F5TA 5L3DA 4G6QA 5FLXK 4QQNA 3KPJA 4L5JA 5LR6A 1IXKA 3SFZA 4WVLA 5JI6A 1YLFA 1J9IA 5K05A 3SZTA 2NNNA 1RUOA 4AZSA 3P8ZA 3F21A 4M6XA 2XVMA 4UNOA 1USTA 3IEIA 5FQNA 2QLZA 3Q9SA 1U2WA 1P6RA 5EZQA 5IKMA 2L4MA 4OOIA 4QDJA 3E97A 3F6VA 3I71A 1G3YA 2EV6A 2NRAC 3BY6A 2HTJA 2ZNYA 3I64A 1O3TA 1YZHA 5HIIA 3ER9A 1XDUA 3ZMZA 3HA5A 4MIKA 3QU3A 4MQVA 1OPCA 2DLLA 3S68A 5E8JA 3HIFA 4E70A 1EH8A 3KQQA 2XVAA 3IC7A 1Q1HA 3JSPA 2STWA 1TTYA 2OB1A 1GXQA 4OIQF 3EVEA 1KHHA 1HKTA 4OA5A 2IH5A 1TQPA 1R1TA 3RYPA 3EGVA 3WE3A 4QPNA 2VDUE 5LEKA 2C7PA 3VC1A 3UJDA 3G2PA 3E6MA 4LJZF 5LGTA 2I9KA 5HZMA 5JUWA 2ELHA 4C08A 4IKPA 3EQLF 4GQBA 3O31A 4MTEA 1NBIA 2XKOA 1UHMA 1JG3A 1L3CA 3ZN1A 4AUKA 5LQCA 3BKWA 3GRVA 4EGYA 2AOTA 2XUBA 5LGNA 1EAMA 3HSFA 1BIAA 3BOQA 1FY7A 1D5VA 2ZZNA 4IPAA 5ICFA 5FLXZ 4HF1A 2W84A 5D8LB 4K6MA 1FYLA 3KPVA 2CW0F 4RTPA 1NW5A 4GC9A 2W25A 3NWBA 1J5YA 5D5XB 2O03A 5E8IA 1KPGA 4EKIA 2LSOA 1T43A 1L3LA 2ZXJA 2BYVE 1DUXC 5H02A 3L00A 2IP2A 3FMQA 2P4WA 1E17A 2JH9A 3BGIA 3CUOA 3NDIA 5LQUA 2LF8A 4MQ4A 4RAYA 3OOPA 2WWYA 4WF2A 2P5VA 3M9AA 5KVRA 1VTNC 5LHHA 5DM4A 2XAJA 1HMYA 2FPOA 1PP8F 1IM8A 2VP3A 4D0PA 1YYVA 1P4WA 3IKVA 1U8RA 2OY0A 2AOXA 4KWCA 2HYFA 1YQAA 5HIJA 2JHPA 2OZUA 5HEKA 3E6BA 4ZH4F 3R0QA 4CKEA 1KU2A 2UZ4A 4EM2A 3K0BA 3BGDA 1GVJA 1B4AA 2ZLBA 4PONA 1B9MA 4XRFA 3HRUA 1QGPA 1U78A 4PWYA 2NYXA 3KU1A 4I2OA 3RODA 3TGNA 4LG0B 4P5OA 3UBTA 2MC3A 3ZN0A 4IHSA 1DP7P 3VYWA 5DX8A 1SQGA 2ZIGA 1IXRC 2UWMA 3BWMA 3R3HA 5EMJA 1L0OC 1KIAA 5ED4A 4KMUX 4M38A 4ER5A 4GOMD 2D45A 1L9KA 1RI7A 1ON1A 3FZVA 4HGYA 4L0YB 2F8LA 1QANA 4CKBA 5DDGA 4R6WA 3HNRA 4DZRA 4ESJA 4NQWA 1E2XA 3ERED 3PB3A 1HW2A 5DX1A 4WCGA 4GGGA 1Z7UA 1G55A 1EV7A 1KPIA 5D5UB 5TJJA 5ICGA 4RWZA 4TV7A 3H3UA 2ZBKA 4MGRA 3IYLW 2A5YB 2FOKA 1YO5C 4HDVA 2OO3A 3JWIA 4O29A 3HSRA 2BGCA 4LWOA 3CGGA 2IBTA 1LVAA 1RNLA 5EIFA 1XGNA 5GOZA 1I1SA 3IRQA 2GA9A 4NHJA 4R79A 2IPXA 2ZWAA 5HS7A 5LQRA 3BP8A 4G8XA 5LEJA 4EJWA 5A2QK 2OZ6A 4CZZA 3DPTA 1WKMA 1XSDA 3DUWA 1BJAA 1QO0D 5BXYA 5L3BA 5DD8A 3HEMA 5D6EA 4FP9A 4ZTBA 2IDKA 4OMYA 4IWNA 3SR4A 5EC8A 1B59A 1OKRA 3KP6A 4YV2A 2PBIA 3LHDA 2CMGA 3WSTA 4E2XA 2BR4A 2XROA 2PXCA 3KKZA 5IH3A 3B89A 4IVNA 1JG2A 5T67A 1NW3A 4F86A 2FXAA 1JSXA 2YQZA 3BWYA 3FPHA 1I5ZA 2P7CB 4RYLA 3FYCA 4ENKA 1KQ9A 3E23A 1T2KA 1UWVA 4M9ZA 2JG3A 2GA2A 2I6GA 3R6SA 1W5SA 1VE3A 1FOKA 3BDDA 1F1ZA 2PX2A 1KYZA 3JWHA 2LKPA 2IBSA 3PQKA 1LQ1A 1SVUA 1J2XA 2Q8KA 3GGDA 1XJ5A 2PX8A 3M33A 3VOEA 1FYMA 2C7RA 3CDHA 4R6XA 1P91A 1HKQA 3K0LA 3IWFA 4JK1X 3FUUA 2CWEA 3ULQB 1FC3A 2FE3A 2G71A 2ERCA 4YUZA 1AQIA 2B78A 1G6NA 3BPVA 1P4AA 2YU3A 3PQJA 3ZMVA 2EFJA 2ETHA 3W6KB 2ZVJA 3SQNA 1ZHFA 2YXEA 2PI0A 4CKCA 4I7HA 3FPFA 3NJRA 4L0ZB 2P8TA 4EKGA 1ZRCA 1HSTA 1O9GA 4BNCA 5BW4A 3EVDA 4L5IA 1XDZA 2GPYA 3BROA 2PMUA 1L3BA 3FRHA 1K78A 4RX1A 3GEZA 3LPMA 3F8FA 2H6BA 2PXAA 2WTEA 4ON0A 1KXZA 1YF3A 1RJGA 3AJDA 5LSAA 4UVAA 3J80K 4RTJA 3REOA 1P2FA 3Q5FA 2PV0A 4I0BA 2P40A 2Z3YA 2AR0A 3UFBA 2XBMA 2XIGA 1SAXA 3FPEA 4ZZLA 5IT9K 3LAJA 2HTEA 1NV9A 1XD7A 2ZWVA 2L4AA 4M7RA 1XSXA 3HVKA 4N0BA 4EMSA 4LMYA 1OMIA 1DL5A 2ZO4A 3OE4A 3ABTA 1TNTA 2DQLA 3MCTA 3K6RA 4KDRA 1BI2A 3ORHA 3VSEA 4A5NA 4R8SA 2L3DA 4HA8A 2P3LA 2E1NA 1IY9A 3KEOA 1FPQA 4YFNF 4F85A 1AF7A 2ZJ2A 1LJ9A 4RB3C 3R24A 3KQOA 3QPTA 4RB1A 3BT7A 1SD4A 5LQAA 4A0YA 1M6EX 1WY7A 1F4KA 5HIKA 4AZTA 2O6GE 3DFGA 1QYRA 4PIPA 4DA4A 1ZGAA 4U0YA 3DV8A 4M6YA 3HVHA 2WA1A 3V4GA 1D3YA 1YB2A 2LD4A 2BV6A 4OMZA 5C0OE 3PTAA 5EKXA 2PX5A 4UVBA 2GZWA 2JH8A 2JPCA 3J7AO 3MTEA 5FGMA 4YUYA 1SQFA 2JJQA 4ISCA 3WU1B 3T0YA 1EQAA 1EG2A 4PZJA 4L9VA 2PX4A 3MQ0A 1TQMA 1A04A 5K0NA 3DXYA 4HRAA 3LCUA 3OFKA 3FXUA 3QAHA 2B0LA 2O07A 3DMHA 1FBSA 2GA1A 3NVKI 2XAHA 2DPDA 4ETSA 4X63A 3UA4A 5DV5A 1SUSA 3KQMA 2M45A 3JAMZ 2YX1A 2ZBPA 3HRTA 2IA2A 1BI3A 5HILA 3OZSA 3GYHX 5L3FA 5LHIA 1M0EA 3M6VA 4ER7A 3EETA 3WG9A 2DW4A 1X19A 3AXSA 3G2MA 1S6LA 2DPMA 1L1EA 4UOEA 4IXAA 2FMLA 2NAZA 3DP7A 4HLXA 2UYCA 2DK8A 3GVAA 2Z99A 2BR3A 2QE6A 5KS2A 2DQRA 3Q87B 1ULYA 3A26A 4XCXA 5KVAA 1Q0TA 3TQNA 3FM5A 3R9XB 2P3QA 5CVRA 5DTRA 1SD6A 4OIPF 2K4JA 2G7UA 1FLIA 1PRYA 2ZCWA 3SM3A 1KU3A 4KA4A 4RSRA 4DKJA 2YXDA 4OBXA 4M72A 2K4BA 4QPPA 1SD5A 2L01A 2EFQA 4KDCA 4C03A 2XAGA 2OB2A 3GRYA 2PWYA 1P92A 1IN5A 2EFNA 3EUHA 2P5KA 3H2BA 3COAC 5LBQA 4V0RA 2FF4A 2I62A 3HCBA 5E17F 4I0AA 2P7VB 2PEXA 4AD9A 1ZRDA 2FRHA 3C18A 1ZQ9A 3HP7A 1X1CA 2O3FA 2ZFUA 3ELUA 1XGSA 5EKUA 2ZULA 3IKTA 1R5GA 2OU2A 4G7ZF 5DCFA 4OIRF 3NRVA 3ISPA 4DCGA 4BHBA 4OINF 3V97A 1IN7A 1SFEA 1Z9CA 2LNBA 4GC5A 5EHGA 3KP4A 4RTMA 2YX4A 4KVZA 3LBYA 4HTFA 3U81A 3V8KA 2IGTA 1I9GA 4AX8A 3MGGA 4O3MA 8MHTA 2ADMA 4AIKA 2CGPA 1OR7A 4KIBA 2OBPA 2XYVA 3ELDA 1JQ3A 2YTZA 1JG4A 3EMDA 3K9TA 4HOBA 4M9SA 4L9JA 3BZ6A 1GHCA 2DPUA 4HH4A 5FTWA 3DQVC 3M8EA 4B8XA 1H9GA 2ZNZA 2I7CA 3JSOA 2P8JA 3WGGA 1I6XA 1N2XA 2EJRA 1RI2A 5K0EA 1DPRA 1B42A 2YXLA 3DLCA 2ESNA 2P5LC 4PGGA 1KU9A 1R1UA 1MDMA 3KQPA 3E3VA 3WTUC 4V0QA 4P9FA 4HV6A 3M8FA 2ZMEB 1HSJA 3GRUA 2ISZA 3LDUA 5FQOA 3KQTA 4GF5A 5BS6A 2LF7A 3GJYA 1XN7A 2H94A 2EA2A 1O3SA 3KR0A 3HTUA 4E33A 1MZBA 1P39A 3C3YA 4FHTA 3JWJA 2UZKA 1WQ2A 4EK9A 4MTLA 1ZKDA 3FUVA 4YG2F 1XVAA 3P2IA 1XDSA 3P97A 3EPPA 4HQEA 4BQAA 3ABUA 3TMAA 5DD4A 3GFIA 4FGZA 4CGZA 3O4FA 2HKXA 1F3LA 1W7PB 3RI4A 2BEOA 2FBKA 5BP7A 1ZGJA 2ZKZA 2OD5A 3P2KA 4PGHA 3W6JB 3OPNA 2ZFWA 2VXZA 2ZBRA 4A6DA 3FUWA 5DM2A 5D5WB 3TOSA 2IH2A 4AZVA 4YIIA 2GB4A 1FP2A 3GUDA 3T8RA 4A5MA 5DSXA 4JBAA 1FSHA 2XAFA 3GU3A 1KYWA 1S29A 5HOOA 2NXCA 2QRVB 1SFUA 2MLKA 3VODA 3WGHA 2ZIFA 3HUGA 3V7SA 5CJ9A 5KQRA 4HDUA 5FWDA 3GFMA 2VONA 1IXCA 4M74A 2MD5A 1FX7A 3SSNA 3TLJA 3GZ6A 2EJUA 3M70A 3FPJA 4LLLA 4HV5A 4HX7A 1MGTA 3TO9A 2VS1A 3I54A 1Z05A 3T8TA 3MAGA 3HTSB 2NXEA 2IFTA 4MHTA 3LECA 4FX0A 3WGIA 5K0CA 4AIJA 1O54A 5E1BA 4UVCA 3MZYA 2FNPA 3T7RA 2Z6QA 2UXXA 4Q48A 3TKAA 4A2UA 3DKWA 2PXXA 3CJTA 1ORHA 4UXNA 5K01A 2JSCA 5CD1A 2CKDA 1RUNA 5CCBA 4DQ0A 3I0TA 3LDFA 1DPUA 4PCLA 3SZPA 4EV0A 5E1DA 1G3WA 2HWKA 3EYYA 3T5XA 3TM4A 2EFPA 4CDGA 3DXZA 5E20A 3SMQA 3TKYA 1BI1A 2MLGA 3CUQB 1R8XA 1SUIA 1XCLA 2O0YA 3BJAA 4ATNA 1RI5A 1IF1A 3HVIA 4L18B 4HX4A 5LGUA 3HCEA 4BLWA 5K5OA 1NKVA 1VLMA 2DT5A 4QTUB 2EK5A 1IN4A 5CYVA 2EV5A 4PYOA 2F5DA 4PIMA 3U9GA 5EG5A 2O05A 4KT5C 2V9VA 3TR6A 5K03A 4LLGF 3KHKA 4PINA 3ELYA 4HF0A 4Z2YA 5E18F 4JQFA 4UV9A 3ECHA 3GNLA 1T98A 5K1YA 1SG9A 2CYYA 5G02A 5HIMA 2P6SA 3MZHA 3KCCA 1QAQA 1X1BA 2AZTA 1UFMA 3G8BA 3FWEA 4CXMA 2XASA 4OIOF 2VE8A 3N97A 2NNWB 4ER0A 1RI1A 3EVCA 3KP3A 2XYRA 1HKSA 3FHZA 4EJTA 3GIWA 4P96A 4ZYHA 3J81K 3M7GA 5HVQC 4MHGA 2QVOA 3V8VA 4AIHA 1ZLJA 2H09A 5DXAA 3V7RA 3ME5A 2AS5F 3FUXA 2OPBA 1BOAA 4XSXF 3IRRA 1CF7B 3LCVB 4RVGA 4X1OA 4LWPA 2G72A 1SMYF 3L09A 3TPZA 1PUEE 1ORIA 4GUAA 4HYEA 4QVKA 1EH7A 1I4WA 3RIRA 5K8VA 4RTRA 1T0FA 1IZ1A 5CUQA 1MJBA 2OA4A 4GOND 2Y1WA 3K1MA 2ZMEA 5FA5A 4CHUA 2GS9A 3R6TA 5J8FA 1OYIA 3GFJA 2D1VA 4Y13A 5BPIA 3L9FA 2HTSA 3U1DA 2DI3A 3HOTA 3NWEA 4EJVA 5ERIA 4WWCA 1QAMA 1R1VA 3QOPA 4HBLA 1R00A 3PFGA 3G3ZA 5JR3A 4BP3A 1H0MA 4MEYF 3D2LA 2EFOA 3RJPA 1ZRFA 2FQ3A 4XUCA 1W7PA 5DX0A 2AN5A 5LRRA 4K2EA 4YUXA 2PT6A 1HQCA 3KLNA 2ONYA 3I9FA 3VFZA 3KR2A 1D2GA 3I53A 3GZ5A 2HQRA 4M9XA 3LFKA 4PDKA 2PBFA 5GP1A 4XLPF 4N9IA 2QRVA 1O7LA 1WI9A 2E1CA 2FSWA 3PX2A 5D4RA 4FSDA 1OYWA 2NNYA 2ORED 3C0KA 1KPHA 4P7FA 1S8NA 4RTOA 2HQNA 1O3RA 1MJ9A 4FT4A 2QZ8A 4DM3A 4HLYA 5D4SA 2FU4A 3TM5A 3ZMDA 3T7TA 4P7KA 3E05A 4ESBA 3ELWA 4F7ZA 1X1DA 2DK5A 4WXHA 2WK1A 2OQRA 2AS0A 2WV0A 1JGSA 1Q0SA 2NS0A 2PJPA 2PFBA 4KN7X 2EA4A 4Y2HA 4MNUA 3UWPA 3CBGA 3E5XA 2WC2A 3FM3A 1VQ1A 3TO6A 1ON2A 4I01A 4GYGA 3GXOA 3G5LA 1HW1A 2KKOA 4BHPA 3CVOA 3GRRA 2X0LA 5LQNA 3KQSA 2OKCA 2RVCA 3L8DA 2IJLA 5LQJA 2CO5A 2MA3A 3B3GA 1B6AA 1NE2A 4BXUA 3HCAA 5U4XA 3AAFA 2PT9A 2EG5A 3DF8A 1R74A 3K69A 2V74B 3I5UA 2YPRA 4RAZA 3CUQA 5EGSA 3MFKA 5HOQA 4KFCA 3F8NA 2YR2A 6PAXA 4BH9A 2ZCJA 4ASNA 1U2ZA 4R8HA 3EVBA 5A2QZ 4HW0A 5T64A 4RGRA 5CVEA 4GXOA 5DT2A 4WXCA 2OZVA 5DTMA 2HKOA 5FD5A 3LL7A 1YS6A 3BPXA 1BHJA 1QAOA 3GFLA 3LQQA 2PLYA 1IUYA 3WTSC 1HBXG 1EH6A 4ENMA 3F4KA 1QNTA 1VP9A 2M8EA 4LK0F 3T0IA 2IRFG 2YR0A 1UCRA 1J75A 2ESRA 2H1RA 3WTYC 3R61A 1BKYA 3HTXA 1BN5A 2MH2A 4HGZA 2HZTA 3FTCA 2VT2A 2R3SA 1I1NA 2E5WA 3EVFA 5E1ZB 5H6RA 1XCVA 1SFXA 5HS9A 1P1BA 3HCDA 4QQKA 4A12A 5JVTA 4KMFA 3SX0A 1ZREA 4LG0A 2M87A 2QQAA 3KPUA 3M4XA 1V39A 2V7EA 3C6MA 1LDKB 5CVIA 3LA3A 5TRDA 3BKXA 2G1PA 5CCXA 4A6EA 1NV8A 5T6BA 2ZSUA 3ZP5A 3FTDA 2BH2A 1LNWA 3R0JA 3G88A 2B25A 2PVCA 2FK7A 3WTZA 4XBFA 2VDWA 4ESFA 3ZPLA 3PFIA 5HLGA 2HYGD 3FUTA 2P3OA 4YUVA 3F8CA 5EIWA 2CWWA 1XMKA 2HMYB 5GWXA 1JTFA 3IHUA 3KQWA 3TDZC 3VB2A 2O0LA 3EVGA 3R0AA 3QRFF 3HM2A 2AN4A 1KA8A 4ENNA 3F72A 5E1XA 4L7VA 5HFJA 4DNCA 2GH1A 2R7DA 2ZZKA 5ICEA 2AOUB 3IWZA 4H0NA 2FBHA 2VE9A 2VN2A 1K79A 2AVDA 3TFWA 3V8LA 2YVLA 3J80Z 3WODF 5K0JA 3S2WA 2ZW9A 3DULA 1SKMA 4I98B 4MWZA 3UJ8A 2P6TA 3WTVC 2RKHA 4E30A 5MHTA 4LGWA 4MTDA 1R8YA 4G56A 3JWGA 5IT9Z 3HRMA 1YFJA 4LG1A 4WK8F 4HZFA 2UYOA 2E7WA 1FT9A 3E8SA 1XTPA 2HR3A 2BE5F 3THSA 4E2YA 3LX6A 1W5TA 2GIVA 4LFUA 3TOAA 3FF5A 3A4TA 3GO5A 3P9KA 5FO5A 2XYQA 3WTTC 2EWNA 1AQJA 2NXJA 4YV0A 4Q4ZF 4C04A 1DDNA 5C1IA 3I59B 2Q0OA 2W85A 3KEQA 4R1HA 1WXWA 3B3JA 3O6BB 4RTQA 5D1NA 5K0FA 1NBHA 3G2OA 3KQVA 1G60A 1Y0UA 3M1EA 3DMGA 1JQEA 2Q41A 3QPHA 9MHTA 2Y0MA 2IIPA 5H20A 3KETA 5DM0A 1U6GA 2PJDA 3MAJA 3FRIA 2O06A 2RDPA 3E6CC 2QENA 4LB5A 4YIFA 4G7OF 3BWCA 4RTLA 1FSEA 3DPLC 3BWBA 2RC4A 4WXDA 3PFHA 2EV0A 4PYKA 2VBYA 3P7NA 2Z6UA 1LDJA 1ODDA 4IRGA 2JHCA 2KJCA 2IA0A 3QOWA 4XUEA 4HX8A 1F38A 2K4MA 3C1DA 3UZUA 4F84A 1Z3CA 1U5TC 4E2ZA 1IW7F 2FEZA 3DEUA 4UHTA 1TNSA 3OU2A 1IN6A 1RJDA 1UFKA 1OR8A 5K5RA 4BP1A 2M5WA 3EEOA 4BHCA 4L9NA 4MQ9F 3RDIA 4U7DA 3B73A 5FUBA 1FBNA 4QWQA 4KYWA 1S7AA 3M6WA 3F22A 1BBYA 4EGZA 5GINE 4CO8A 2VC0A 2F5FA 3GW2A 5M5BA 3I4PA 2K86A 2EX4A 3BXOA 4RVFA 2J5OA 5K0GA 2OAZA 1UIRA 3KR1A 4I02A 1IN8A 1PDNC 3B02A 1V3FA 1IXSB 3F3XA 1YS7A 4C06A 2XV4S 2A61A 3L7WA 1P1CA 5EMLA 1FWZA 3GLXA 1YG2A 3GWZA 1N7JA 3RIEA 2UXNA 4P58A 2C7OA 4RVDA 3JTGA 3KP5A 4FZVA 5L3CA 4QLCU 3LKDA 3O7WA 2GXGA 3TOBA 3GF2A 4AWXB 2PSSA 3MEXA 2Y1XA 2F5EA 1KP9A 2PN6A 4KN4X 3BZBA 3KP2A 4GO1A 1JSZA 4C4AA 1W4MA 5K5QA 5EMMA 1EJ6A 1FYKA 1KQ8A 2FYTA 4XUDA 4M36A 1LEAA 1G6Q1 1ZG1A 2K27A 3CC8A 1QPMA 3ZQ7A 4NB5A 5ILVA 5FFZA 5CVJA 4DMGA 3A7DA 5HLHA 3CUQC 5D1HA 1JG1A 2YSRA 3IHTA 1HNNA 4CWAA 1STZA 3GX4X 1KR5A 3LAPA 1MHTA 5EQJB 1O3QA 5E1OA 2ZBQA 1WSUA 1L3IA 4PNEA 3A25A 3F23A 4G7HF 1O7FA 2HDCA 3M6UA 2QY6A 1U5TB 5GIPE 1SD7A 5DM1A 3FTFA 5KQSA 1J59A 1YTYA 2RNJA 3FPGA 1AOYA 3RKWA 4KDPA 1G8SA 5BMZA 1Z6RA 2NYUA 4PYIA 2WA2A 3OZRA 5CVVA 1ZAOA 3F8BA 3I58A 2V1UA 4P9UA 4RB2C 2O61A 5FWAA 3WE2A 1RZ4A 3RKYA 3P9NA 4IV8A 4CXFA 2HWVA 4N9HA 1R6AA 3SXJA 2Z5UA 2BR5A 3Q9VA 5DTQA 5F2KA 1FBUA 1T6SA 5DUIA 2CQKA
chains in the Genus database with same CATH superfamily
1NSYA 3V8BA 1O94A 3IOMA 5JWRA 1SU8A 2LWIA 2VHCA 2WTXA 3NONA 3QE4A 2EZHA 4Z4EA 3TEMA 1FS6A 1VJDA 1D2CA 1D6MA 5KJ1A 3IAXA 3EZGA 1TO2E 2JIOA 4U7TB 1MQ9A 1KFEB 2RHWA 4ZV7A 1RU3A 1N5JA 5JXIA 4HB3A 2XB0X 2VP2A 3V8EA 3LFUA 3KALA 2YIMA 1NW4A 4M99A 3GHYA 5IUJC 1V9CA 2JFUA 2FF5A 2HXIA 2JUCA 2A9QA 3ML6A 1DC8A 3VYTB 4TXJA 1RKTA 5EJEA 4NZNA 4LJSA 4Y1GA 5ED0A 3WIEA 2ODTX 2GLXA 2A78A 1OLUB 3EEIA 3DGFC 3SI7A 2Z8YM 1GZUA 2F4MB 4DZPA 5EWJA 3ETNA 2GBLA 3UW3A 5FCDA 4ESHA 2IZ7A 2CNKA 1I7NA 1XYGA 4YV1A 1KVTA 1OYYA 2YOHA 1YHYA 4RXUA 5D8KB 1NN1A 4M0DA 1EAYA 2OFWA 5B1AH 2FVYA 1L5KA 4DUZB 3B6EA 4Q4JB 2V98A 5LVAA 5CFLA 4QEZA 5L3SA 2JNWA 3ZQFA 3ITDA 2Q5OA 2R6HA 1XLTA 3MKLA 3ZBTA 4NG5A 4EHLA 4Q1AA 2IOYA 4GI1A 2BFEA 1G8GA 5JJKA 5CFMA 2H11A 1DLJA 3KCQA 1C30A 1XZBA 4CT4B 3RKQA 2KDZA 1K2VN 3Q3IA 1FMLA 1NXPA 4LJ9A 1VQ6I 2POCA 1Y8CA 2VJ4A 3CO0S 3AK4A 2O48X 4ER3A 1BU5A 4POOA 4D9FA 4AS2A 3GAFA 1YRNA 4BDYA 4I1OA 4Q9IA 1QQBA 2QLMA 2CG4A 1O95A 2RC5A 2GJ9A 5F1RA 4RWEA 2JCBA 3RTBA 3FW1A 5JBIA 4AZ0A 4JLBA 5B3JC 1JMKC 4BN4A 2XNSA 1SVLA 1H93A 2R751 4KGZA 2HO4A 3N0TA 4E5SA 2C3YA 1PP7U 4C5AA 2LW7A 1FB5A 4DWVA 3JW4A 4J1SA 3HSEA 1N7HA 1YUBA 2WI8A 5KK1A 4B4DA 1TW3A 2ZS8A 2N1BA 4WDRA 2ZI3A 3MOGA 621PA 2ZATA 3TQRA 1EFTA 3ABLH 4D5GA 4KN9S 4OX9Y 4EW2A 2H8RA 1GP2A 1W5FA 3THYA 1HW5A 1VI0A 1JJFA 1LV7A 1YASA 3OU6A 5DWQA 3IT2A 3MRVA 4E31A 3M6LA 3AEUA 3U2RA 4N49A 3HYIA 3GTGJ 2D1SA 4L3OA 3UN1A 1TTTA 1G2HA 4EMBA 3P94A 2QD5A 2G5CA 5CBKA 2RKWA 3DTVD 1Q11A 3WOHA 4IDDA 2NLOA 2VJIA 4NK5A 1FE8A 3DVRX 1AV6A 3BTVA 2MCFA 1XU9A 3FZGA 3HP1A 2C5AA 1N2HA 1MDMB 2NP7A 3AL3A 2GDJA 1CYEA 3LO8A 3CURA 4TTIA 3RRYA 2ICWG 2R5YA 2K9QA 1FQWA 3TW8B 2LTPA 4R5HA 2OPTA 3ZYZA 3L8CA 4QGBA 2B36A 3HCFA 3EAQA 4R7ZA 4NQZA 4C7BA 4G4SO 4WBNB 3RTGA 3BAFA 4FFBA 3AP2A 1GTRA 1E0KA 4YAOA 1FSPA 1D8KA 3EVAA 1L4GA 5J4KA 1KE1A 1S96A 3UMSA 3IUBA 2W93A 2R11A 1R5BA 3R09A 2XR1A 3V1NA 2FBIA 1GGMA 3IAS6 5E9WA 3DFKA 5B6JA 4BLOA 2RV8A 4HX9A 2W98A 4E7HA 2WB2A 1OZHA 4KE6A 2PO5A 4Q1EA 2ZBUA 3D5TA 2BGRA 4IQ0A 4DDUA 2WAQA 3MTBA 1E4VA 1MVOA 4KNWA 4A16A 1UDRA 4DIQA 2FI1A 2W00A 4Q0MA 1YDHA 2WNSA 1N0VC 2IZOA 3IUNA 1XRRA 2M0CA 4CTKA 4LK1F 4HQMA 1R0ZA 1OAKA 1SNYA 5K0BA 5JJIA 4P5PA 5D85A 3DXJF 1E58A 2CK3D 2CMKA 4ZQHA 1X74A 4X41A 3AM1A 3V8RA 3QV1A 4JS0A 5LD2C 3UWOA 3OQPA 1HYHA 3DOUA 1ZN2A 2GZSA 2WFAA 2JGNA 1Z4PX 4GX5A 1KMQA 3KL2A 3IV9A 1T9AA 4G0QA 2IW5A 3AIMA 3H6KA 3EGIA 2HSJA 5SICE 4P0TA 5F3RA 3MOIA 2EJTA 5L3GA 4NI5A 2WEKA 1RXWA 2HM7A 5GY7A 1K8XB 2FN7A 2ZVDA 4CV3A 4TL6A 2I5PO 3KHUA 1Z3IX 1FQKA 3GMDA 1NVXQ 3SZLA 3ZD6A 1NVFA 5DM70 2GETA 1JHZA 4LF5B 4AQ7A 3BICA 4KU4A 2BH9A 1USTA 4MR8A 5K3EA 1TJYA 2BHZA 2Y9MB 5IRCD 5MN4A 3FFBA 2B7LA 5IKMA 2L4MA 3MGCA 4XA8A 2B6HA 3I32A 1XTZA 3BC1A 4LV8B 4WNAB 5KKNB 3ZMZA 3WP0A 5GQSA 2DLLA 2GN4A 1NXVA 2PSHA 1I14A 4G0ZA 3M8JA 1M2HA 2P2CA 4EG5A 4EZIA 1HYEA 3PQ3A 3QF4B 1C1XA 1YAHA 1DUVG 4HDMB 1GKLA 4MCIA 4DTIA 2R97A 4OAOA 4GPTA 1TVMA 1P61B 1PQYA 3E6MA 5GTHC 4ZEXA 5JUWA 4DEVA 4GQBA 1Y9ZA 3C3JA 5REQA 4AUKA 1RMQA 4IHAA 4V2UA 2FWIA 3Q4GA 4CCWA 4DJ5X 2QNRA 4ZAZA 1NAHA 2CW0F 4BLQA 4S2EA 2CLMB 1V16B 2YZMA 4BDSA 2IEDA 3I2HA 5D5XB 3QA9A 1FCJA 1OX4B 3DMPA 3KB6A 1YZLA 1JI0A 3EE6A 1WHSB 3GR6A 3ZX4A 3M07A 3AR4A 3FMQA 3R77A 4QXPA 5EY5B 3SG0A 4EEKA 1U6JA 1A8IA 1E1RD 4B44A 1D1QA 2OHJA 1UZCA 1PP8F 1F12A 2II6A 1ZI9A 5EG0B 1CZNA 4K9KA 1W59A 4ICIA 3DEWA 1U4NA 3WGKA 3IKVA 1G4AE 4GZ5A 1T4GA 2J3HA 2YJ3A 3AHIA 2MABA 1B9MA 3UBTA 2KX7A 3GEIA 3NRBA 2WZCA 2GO7A 2Z2KA 5DMHA 4HQ0A 1RQLA 3DEKA 1YL5A 3VRHA 3ERED 4JUIA 1MFZA 4L85A 2J31A 1FX0B 4H6WA 2W2QA 5THXA 3ZDZB 1FS5A 4HP8A 1NQAO 3ABMH 3JRFA 4PZLA 2HCRA 4H7PA 4EHNA 3C5WP 4G85A 5FUVA 4FGJA 2R8BA 1LU9A 4NQRA 1WKMA 4J76A 3CN7A 2RAPA 2R8EA 4OMYA 4IWNA 2WFLB 3DZCA 4ZVMA 4CN8A 1RQ2A 3N5CA 1H3NA 4Q3KA 1DUIA 2HYDA 3INNA 2EHJA 1Z6AA 2BGTA 4CIAA 4WQMA 5CIWA 1C3EA 1KQ9A 4JROA 4DLKA 1UWVA 2IIVA 4KB5A 1VMAA 4D92A 1DIOB 1E61A 1HRKA 1UFQA 3F6RA 1LQ1A 4KC0A 2N0SA 2OBNA 3VOEA 2AC7A 2V55B 2GHQA 3FXMA 1W4ZA 3FUUA 2R93J 1Q12A 4U7GA 1OKKA 4B43A 4C0BA 1PGPA 3W6KB 3UTCA 3NJRA 4IGAA 2YN4A 1NUAA 4TVOA 3QPVA 3ESCA 4AZ3A 2VPZA 1I94B 2PQMA 1CG6A 3HL4A 2DLNA 2ZRPA 3ITNA 2JC3A 1KO8A 4B6RA 1RJGA 4TV8A 4JX5A 2V6MA 1KDZA 3MBKA 3HOVJ 2P9FA 3IE0A 3EPHA 2AR0A 2W2NA 3H7IA 1YA4A 3FOBA 3ZZUA 4X20A 4QLOA 4BLRA 1XSXA 4A8JA 1QV9A 2PSDA 4DBZA 5IABA 4L76A 3S1QJ 3E5NA 3MSCA 3W2EA 2FKNA 1Y9EA 2OK7A 2HHAA 1UCFA 1OLSA 1WY7A 3PI7A 3R5SA 3WLFA 1F4KA 3TSAA 4AZTA 4MB2A 2A0UA 4CQMA 4M6YA 1OA0A 4HNQA 2AFHB 4Y6SA 4L4YA 4L16A 4OMZA 1BVYF 3TW6A 4HVLA 1K0UA 1A77A 1BXKA 1C1HA 3R3SA 5JDCC 3A37A 5HXAA 3JQQA 5FV7A 1SQFA 4HVAA 2CHVA 3PA8A 2VC2B 5CB4F 3O38A 2G5TA 3OIDA 4RFSB 4W5WA 4E6KG 4P4GA 3B1VA 1AK9A 3LHIA 4FC7A 2IA2A 4IZ6A 4UOQA 1M0EA 1NRIA 1QHHD 4ER7A 2Q3DA 3NANA 5ENVA 3HU5A 3MRXA 3P9SA 2QVGA 3NHRA 3HXPA 2ZRFA 4GPAA 4D80A 1OBOA 1V4BA 2BI7A 3WB1A 4C3OB 2R6CA 1Z16A 4DE5A 1JKIA 3IALA 4LDQA 4RD3A 4RETA 3SM3A 2XWJI 3NM5A 4HFJA 5EYPA 1Z0FA 2CXQA 3EUHA 2C4NA 4JUBA 1NI3A 1L4FA 1PAUA 3QQAA 2JAPA 3CW8X 2IOHA 4WCFC 3M5DA 1DTEA 1HG0A 5AKEA 1RZUA 1FYFA 1LPOA 1J5PA 1GTSA 1CUGA 2WU8A 3CT4A 2XBUA 1Z9CA 1A9XA 3IAEA 4Z7JA 3CF4A 3VZQA 5KJCA 2ZU6A 4D7AA 3LBYA 2IGTA 4AX8A 3HSKA 4I1IA 4C5BA 4DPLA 2YDYA 3PJGA 1X8LA 2D2IA 3S5UA 4GPZA 3DQVC 2ZNZA 2C7BA 3WRXA 1I6XA 2P6RA 4TXNA 2GUGA 3BULA 4CZ2A 1BO6A 4X6UA 3CW2A 1NQTA 5TB5A 1NH3A 4UHDA 4TXHA 4YQZA 2GD1O 4BRWA 2QORA 2CNOA 1ORWA 3G17A 3PGXA 3KR0A 3HTUA 2J0EA 1B3RA 3H9GA 4YG2F 2AC4A 2B30A 1OISA 3GLIE 2OA0A 3RU2A 4CF4A 1C30B 5BP7A 3OY2A 2E71A 2BJVA 3ZS9A 1CK4A 4YIIA 3WLOA 1Z73A 4R2LA 2WKPA 1JIVA 2N1MA 4F5EA 3K0AA 5FYDA 5SYNA 1JAYA 3MCVA 1E3SA 1JKXA 3RJMA 3O91A 2MYPA 5KQRA 2C2YA 3EQ6A 4HN9A 4OQPA 2NXEA 1GGJA 2V45A 3B7WA 1OPXA 4X84A 5L6LB 3TYXA 4MAFA 1ZRHA 4CFSA 4L1KA 4AZ0B 4H0FA 2GILA 4ZQIA 2QRJA 4L7QA 2G8LA 1J9GA 3ZE1B 4DM7A 3UWDA 2QJOA 4QOSA 1XIVA 1MQAA 4J0DA 3M5WA 1FMVA 4X90A 2QLBA 3ENWA 2C5FA 2RKBA 2X85A 5CYVA 1P4JA 1ZOOA 1J20A 3UV3A 2F5DA 4J3FA 4ZWNA 1IZ0A 4M0PA 4HQNA 1U04A 3VKVA 1AK1A 2GYVA 4HCJA 3LWZA 3HDGA 1KBZA 4IDGA 1DMRA 3MN1A 1CQXA 8ATCA 3G6WA 4CXMA 1Y42X 3I0NA 4QULA 2A9PA 1MN6A 2XDQA 4YAGA 4BMYA 4P96A 4P22A 3THYB 2GPTA 3E35A 1TVEA 3FNBA 3QG5A 3HCWA 4KYIB 3U9SA 4US2R 3ME5A 3AERA 1NKTA 1A35A 1BE6A 3FUXA 1GUFA 1GGNA 4X1OA 5C35A 3AETA 2FSPA 1E2EA 4GUAA 2SKDA 1TF7A 1YV9A 1ZMBA 2E55A 5K8VA 3EFEA 1QTIA 3QFFA 1DWUA 2CE7A 4XN3A 3QEMA 3IXLA 1O7JA 3NHBA 4D9HA 4F5YA 4TS4A 3H86A 5I6DA 3PQDA 2R8ZA 3KSZO 5M7EA 5HUQA 3STYA 4F8JA 3QHPA 1Q16A 5J5CA 1L7OA 2JBHA 3AR8A 1WRBA 2R5YB 4MEYF 3PDWA 1PF7E 4GXQA 4KQWA 3RJ5A 4WT7A 1E99A 2RB5A 3KR2A 3CCBA 2XKJE 4QYTA 2QMOA 1URPA 2YVAA 2HQRA 1H3FA 4NAVA 2CDCA 4UZEA 1ULTA 1L7XA 3MCWA 4B6GA 4C4TA 1LVGA 4XM3A 1AS3A 4MQLA 3NAUA 4Y9DA 5K3BA 2G4VA 4R4JA 2KZGA 4DWJA 4HLYA 3SAJA 3W4IA 4X8LA 3ZMDA 3PQFA 3SF8A 3T5BA 2OEPA 3W6OA 4G81A 3ZV4A 1ZN7A 1GKUB 2H1CA 3AEKA 5JASA 3F71A 2PT9A 1A8SA 1AKVA 2QVLA 1OBHA 2IGNA 3UW1A 1E77A 4N7BA 5LC1A 4IRUB 2LBPA 1OJLA 1F8YA 3U19A 1SIBE 4P6VF 5T64A 4EPRA 4GXOA 2CXUA 2NZVG 1VXOA 1UPBA 3IC5A 2JFOA 2KSQA 3PC4A 3WTSC 1QNTA 5KAFC 1LV8A 4UUBA 5EN4A 5CTJA 4MCHA 4YC7A 1ZP6A 2Z2IA 1XCVA 3JRHA 1X7GA 2WHPA 5HF6A 1O4WA 2QCOA 2BMJA 2VHUA 3QU5A 2H1LA 5JAZA 4J01A 1UBLS 2Y76A 1TWHJ 4F92B 1E18A 2QNIA 2DEUA 1ZHHA 1SXJE 4NG4A 4AM8A 5AQ1A 5I7OA 2ZSUA 1UF9A 4Q1VA 2GZ3A 1ZBDA 1HR0B 3BAZA 4EHJA 3L7MA 4LY6A 1W7AA 2A94A 5KNBH 2F90A 4HWOA 3DD5A 5AFSA 1YQWA 4G5SA 4CG3A 2BFMA 3KE9A 2IV3A 2BFDB 3HM2A 1LB1B 3T7CA 1ENPA 2P9YA 4L2IA 2WRZA 4HSEA 4M49A 3V7YA 5CTAA 4BBAA 1JFRA 4PO9A 1D0YA 2R8YA 3WRYC 5HKKA 3ZHQA 2RKHA 2WP0A 4EHDA 1PK7A 3QZUA 4LG1A 1XZQA 2ZYVX 3VR6A 1LI5A 2BE5F 2K5CA 2V7TA 1G2OA 1R0XA 4CT0A 4Q4ZF 3B3JA 1DJPA 4QOFA 1BWRA 1FFDA 1GXSA 3TSOA 3NTXA 3UB2A 3C15C 3DLPX 4KR9A 4YN3A 2RD2A 4P35A 4O1IA 1KY5A 2NU7B 1WZCA 4GRDA 3AVPA 3K15A 4OAQA 1O03A 4BNDB 4YIFA 1BZYA 5LBIA 2Z6UA 3L43A 1GA4A 3DDNA 2V03A 5AH0A 5CNMA 5TXGA 1ZX1A 4R8LA 5K5RA 5H8WA 3T61A 1L7AA 3AVQA 1P0MA 3ESXA 4MK4A 4LJLA 2WADA 5GINE 1UT6A 1VJ0A 1E2PA 4RVFA 3E1KA 5GONA 3RYFA 1V2HE 4LIPD 2EARA 1OBCA 4GSYA 3JALA 4YAFA 5B2EA 2DPGA 2UXNA 9ANTA 2N75A 3K16A 4NBSA 4XASA 1BG6A 3C45A 4WZ6A 4XOUA 3REFA 3BZBA 4O2LA 3RS5A 4PC3A 1FYKA 2ZC2A 4M36A 4JI7B 1DRVA 1U8TA 5ILVA 1WXQA 4ZVRA 2IOFK 3OI7A 4LGMA 2C2ZA 1D07A 2P9EA 5DBOA 1O8CA 1U5TB 3KXDA 2XPVA 1KDVA 3FTFA 2E5NA 4AWBA 2REOA 1FXWA 4XI9A 5AI6A 1Z6RA 4XYGA 1NYRA 2QA5A 4Q3CA 4PYIA 2WSYB 1LTKA 2H0RA 4FB5A 2CLFB 3PIIA 3P9NA 1I33A 4Y52J 4D6PA 3HVRA 2PTGA 1X15A 4UBJA 5DTQA 4MB0A 4BMPB 3TEDA 2ZB9A 1LEBA 2HF9A 3K1YA 1WPGA 2LCIA 4EEFG 1JGGA 3DAFA 1PJTA 3IIMA 1KGSA 5TNXA 5ITWA 3MHTA 1RIFA 2GRJA 4RFLA 3DXXA 2IYFA 2XGSA 5DRYA 5F3DA 2GSDA 5CX1A 1M6VA 10MHA 4EM1A 1NJ1A 5A62A 3FB4A 2YV3A 1E2HA 1BC7C 4PFPA 3JXEA 5BN3B 2MFZA 3KTDA 3BE8A 1B1BA 4COOA 4P86A 3G2KA 3BD7A 4BVEA 4HXGA 1BC5A 4OA8A 5HQ3A 2C8LA 3UJBA 1D8JA 1CEEA 4ZMSA 1UR5A 1FTYA 4WESA 2B3TA 1SU6A 5BUZA 4HAXA 4BUJA 4RB0A 3VJKA 5AM2A 3R9IA 1OLOA 1ZIOA 3G7NA 1DRWA 1VI2A 4TV8B 2IGMA 1QVZA 1RIIA 2KIMA 4DCCA 3CSSA 4ZOLA 3MJEA 4OG2A 4CV2A 1VCIA 3LWBA 3GC6A 1EFLA 1H69A 4X20B 1PJAA 2OV4A 4JX6A 1TCAA 3S2EA 4S04A 3OQIA 3DTVA 3ROMA 5DHQA 1R3DA 2XCQA 1KQ0A 1KEZA 4L75A 1CCWA 2RHHA 3H35A 1WF6A 1T34A 2PZKA 2ZIAA 4C0KA 2PUGA 3IOCA 3N86A 1MKMA 5BRJA 4CQMB 3TFQA 4I1UA 4EFLA 3AF1A 5KYYB 1PBTA 4HNSA 5C8YA 5B58C 5A6SA 4MJ7A 4C7VA 5CVUA 3GLTA 2DERA 4H59A 4NBLA 4OP3A 1MP0A 5KDOA 2OXTA 1AKNA 4QVGA 4RGXA 4FSHA 2RI1A 3TSCA 4AKSA 2ZTHA 4AG3A 1T9KA 2OC9A 821PA 2ZM6B 1USVA 2VOJA 4W99A 4MDEA 3GTKJ 1U65A 2HH9A 1R36A 3H13A 4R16A 4YRBA 1P75A 2OYRA 4PNPA 4JX4A 2CSOA 3ZR4B 1M9NA 1NXWA 2QGFA 4XQGA 3D6HA 5BR7A 3KWLA 2GEKA 5JNRA 4GD3Q 4X6AJ 3FGOA 1NE7A 1K7EB 3ELBA 2FVXA 3A02A 3FIJA 5EYPB 4DIBA 1JG6A 2QF7A 1ZKGA 3LQYA 2H0QA 3CP2A 1XMPA 4CM4A 2W2OA 3BH6A 1V7ZA 3P0RA 1IL0A 3JQ9C 3N07A 1BH2A 1QG0A 4E14A 3IFSA 5JAHA 4LDRA 3BXGA 2CK3A 2HEOA 2OESA 3K5PA 3A1EA 2NTJA 5CLIA 5I7VA 1BWSA 4DLBA 3RRNA 3DLIA 3SLKA 4D1QA 5IMSA 2RC6A 2XB6A 4Q4JA 4IF4A 1X4OA 4QUKA 2VLIA 4PG8A 4WOPA 3S2DJ 1V8BA 3IUQA 2QRLA 3VDQA 5KVSA 2WHXA 1Z56C 2GPSA 1N7GA 4JJEA 4DMHA 3CZAA 1PJBA 4Z8YA 4YCJA 2QAJA 3I9V1 3GL9A 1H85A 3OCZA 3CEAA 4WY8A 3H1PA 1H1DA 4OAZA 3VKUA 2I54A 4P31A 4PYNA 3HLTA 3QWLA 3ZJYA 2QUJA 3WLMA 1GJRA 3W8RA 5C51B 3KLMX 3UJAA 2K02A 3TLYA 1I7DA 1F8UA 2L7ZA 4J94A 4MIEA 3VZSA 1I6MA 3K0AB 5BNTA 3F6OA 2Y1DA 4ZYUA 4TWZA 5EIAA 5FKNA 3GFSA 2HGCA 2COUA 5JRJA 1FL9A 1HDZA 3ONWA 5EHZA 1FOXA 2VJQA 4U8GA 3VO1A 1NKSA 4UDYX 4H4KC 1FYVA 1NPTO 2W2TA 1X3LA 1UBTS 5H9WA 4AJEA 3H4TA 1NF2A 2YYZA 3JQCA 2ZJ8A 3UQZA 3AI7A 1N34B 1U31A 4K6HA 3LCMA 1BGVA 1MXFA 2KE5A 1W46A 1HA3A 3CX3A 4C9YA 4JCOA 3LSGA 2QZSA 4AIIA 1Y89A 4BE2A 3C3BA 2L02A 2BBWA 1N9GB 1ZAKA 1KZGB 1J0EA 1DC7A 3LGXA 5DLYA 3JVDA 1SK8A 1ZUWA 2P35A 3SC4A 1RCUA 1E1RA 5FWYA 2VI5A 4HS9A 4H1WA 3JZDA 2F48A 5CQEA 2HOEA 2H2FA 2QGZA 4XQCA 3RDPA 2DDBA 2A7XA 5LQKA 4YRDA 1A96A 4XFDA 2OUKA 1NBOA 4GM0A 3AETB 2TDXA 1WD7A 4ID9A 1QP7A 1F5NA 2GBFA 2HYIC 1HFKA 2QYOA 3IPAA 5AVKA 4BX3A 4HGOA 1MO4A 1GTMA 3X2SA 3QEMB 3TW8A 1F5TA 3RRFA 3TZLA 3ZC3A 4IDOA 3QX8A 4CN9A 1VRWA 3LX5A 1J24A 4BAGA 3OZWA 2QU7A 2IKQA 2ZI6A 4WBNA 1XF9A 4M1SA 3WK9A 1GRQA 4ZAWA 3I71A 3UG6A 3IR6A 3AHFA 2V7GA 2AGVA 2XA2A 2FEWB 5JVGF 3HN6A 4PPQA 2WJIA 1U6KA 5K8TA 4QPNA 4TZ0A 1CEYA 2HKIA 1VKOA 2C7PA 4LJZF 5LGTA 3SF8B 4FFDA 2P81A 3S1MJ 5AT1A 2I2AA 1P7PA 2WJYA 4KXWA 1ISPA 3L1KA 3D6JA 4QKQA 1BIAA 4DVJA 4PSAA 4Z3OA 3KYJB 3GLKA 1D5VA 4JC8A 1CF9A 4FYHA 1CUAA 2VUTA 3K9WA 5K3DA 3AEKB 2C04A 3JREA 1Z4OA 1KPGA 2E60A 4RVCA 1Q3TA 1R5OA 1IWBB 1P5JA 1L3LA 3K1AB 4ISBA 2I4IA 4OGKA 1M83A 4OD0A 4YRFA 1U8AA 1G17A 2CB0A 1ECFA 4IDBA 3SX2A 2UYYA 2E6UX 1PK9A 2XUJA 1NNSA 4F72A 4KODA 3ZIDA 4YJ2A 5C32A 3BILA 4MO2A 5KHAA 5HEKA 2VATA 3BL6A 4FFLA 4L0QA 2WHPB 2JGEA 3CVYA 4KVAA 4D4LA 5GVSA 5DP2A 2YJ4A 4KGDA 4PHFA 4P5OA 2IWHA 1ZW6A 5DX8A 4LI0A 3ZQQA 4TYWA 3GP8A 5EMJA 2G1UA 3QPDA 3FGPA 1P60A 721PA 4M1ZA 3H5WA 3FZVA 3ED1A 3HFGA 3ASYA 4OOFA 1H2HA 2C4TA 2ELKA 2VDMB 1FJ2A 2OMEA 4KAAA 2R7ZJ 4CM6A 2DCMA 1S2NA 4AM3A 5BV0A 3ZE9A 3HSRA 5DEOA 2JGLA 3RIGA 4Q24A 4TMWA 1FOWA 4A2WA 5BR8B 4HF7A 4L2IB 1QFMA 1J4AA 1JYEA 4TT8A 4E7ZA 4FMDB 3R0XA 1HRDA 3V2IA 3STHA 4XGRA 1SOWA 1O3YA 3SJUA 3LBNA 2G88A 3Q0VA 3OYJA 2X4DA 4ZT5A 2AMJA 2I8AA 1U2PA 1QKJA 3GJ7A 2JGIA 3QF4A 3I56I 1OR7C 4NF2A 4DJTA 1RC9A 1G64A 3GYGA 1IQRA 3BM5A 5T7BA 4MS3B 2BY1A 5T67A 5CXSA 1GXSB 2OV7A 1OFUA 3GEHA 2FSHA 3K05A 4NE2A 3NT4A 4F4CA 4AW9A 4EOGA 1YOBA 1OZFA 4UBKA 1L6RA 1MU0A 3UKGA 5IBPA 5IUKC 1ZU4A 2FRVA 4JK1X 4KFSA 5ALOA 3RSOA 4INPA 4EB8A 4YUZA 3GOHA 1P4AA 3IUYA 4AP6A 2YXEA 4KIWA 2X4IA 2NAPA 3JD3A 3LOCA 5DI3A 3L6BA 4U7FA 3PRKE 1A5ZA 1SKQA 1Z08A 3DL2A 3I0ZA 1CWUA 3VUEA 4JU8A 4TOIA 1HORA 2ZI5A 5B3LA 1PTJA 4B4KA 4MGHA 1YF3A 2VPRA 5GONB 1FMCA 3RYFB 4D7MA 1BW9B 2IK8A 4AJLA 1LLQA 3JALB 1XROA 3X43A 5D51S 3P0EA 2CFSA 1A88A 5HJ5A 2MSCB 2F1IA 4V0SA 4JJZA 1HT2E 1GILA 1TK3A 4X1KA 1QR6A 2HTFA 1ZMXA 3AINA 4R8SA 1RM0A 1O6CA 2P3LA 2C2HA 4QZVA 1TCUA 3OWHA 1ZGAA 3DV8A 2LD4A 3OPYI 5EJ2A 5IXJA 3OHPA 1VYHA 1BR4A 1TKCA 1IEQA 2ZPUA 3RS2A 3MTEA 4EY6A 1ODLA 2JJQA 4V38A 4L9VA 3EXHC 1G0OA 2ZQZA 2B0LA 1R50A 4U2CA 4IAOA 3BE5A 4IFTA 2XAHA 3NIGB 2I33A 2WDZA 3OSUA 1JZSA 2X8LA 3WYNA 3O82A 4CIYA 1XPUA 1WUJS 5LLDA 3HZRA 1CP3A 1NU8A 3UB3A 3PRHA 3T5AA 5EZ5A 2XH8A 4HEJA 2CFOA 3CLTC 4HDCA 2QVYX 2P4QA 2I0FA 5CX1B 2A9RA 1O6ZA 3C7AA 1IUOA 5JXWA 1A4XA 2EFNA 1NXOA 1JFTA 5TQ2A 1V43A 3LXXA 2P1ZA 4UUNA 4KAFA 4CG1A 5I5GA 1VHTA 1YQQA 2WKRA 3RBVA 5HZKA 2OU2A 5AI0A 3A0BC 3TAXA 2EIHA 1AGPA 2XGJA 4YP0A 5HQ3B 1QK3A 1T6NA 4MEAA 5FLXA 4YXFA 3Q6NA 3L06A 1E0JA 1THGA 3L4BC 2AC2A 1YCGA 3AUUA 3V8KA 3U4QB 5K0SA 4WH0A 4WESB 2CGPA 3A6JA 4B83A 2AV6A 2XYVA 2H31A 1HE5A 4E6EA 2EFEB 3B52X 5FTWA 4B8XA 2XZDA 1UEJA 4J7AA 4MR7B 4QOEA 1L8LA 1YI8A 1IBCA 1B42A 4GKJB 1W8IA 1ATIA 3R7WA 1YK0A 2PK3A 1II9A 2P4SA 3COPA 2NZ2A 2ZMEB 2DHDA 2FJUA 2QYSA 3DTVB 1ZI8A 2LF7A 3O7MA 4PLHA 5JSZA 1EEXB 5C37A 3JWJA 4EK9A 1OPRA 2I2BA 1KJIA 5JDIC 4O1HA 2HPIA 2GCGA 1UXOA 4UZFA 1GU1A 5DD4A 1VYUA 4PO8A 3O4FA 3R3YA 3K96A 3OETA 3CPEA 4G36A 5AI5A 3OICA 2ZXHA 4HGQA 5C8YB 2I67A 3PWTA 2ZFWA 1SU4A 4G1BA 1TE2A 5A6SB 2GB4A 2RDMA 5U9CA 3HYSA 4Q05A 2XDYA 3IPRA 2FUNB 4DLSA 2NMVA 3KBOA 4YFYA 1WETA 4G5QA 2HU5A 1UELB 3ZDFA 3W7AA 2MD5A 3KKEA 1XQVA 3MAGA 3DBRA 4DABA 3TZEA 1U9NA 1IHUA 1UUFA 3JAWA 3IX7A 4MAMA 3WQHA 2BEUB 2A9OA 3B8HA 4EV0A 3TW0A 3JVIA 3T5XA 2CDBA 1BRTA 4W1RA 3NEYA 1F6DA 2OUMA 3OKPA 1RWBA 3L7CA 1KO7A 1VIVA 5KOHB 4ATNA 4BRZA 3FMGA 2AA3A 4L18B 2VXBA 3ZXSA 3LCRA 5K5OA 4QTUB 4M53A 5AOAA 1AQNA 3FOFC 1U28A 1Y82A 2EFHB 3KBBA 4WGGA 4CM4B 3OWOA 3L2WA 3K9BA 3GVCA 4ZZIA 4F6RA 3IEVA 5I47A 3MINB 3GIWA 1U9OA 5G1OA 4MOWA 1K66A 1QFJA 2PIDA 2NYRA 1YJ9I 4ARAA 4FDMA 4M6VA 5TRTA 1SCQA 3QJGA 3C3EA 4RTRA 3VPHA 2JKVA 4AN0A 1GN8A 3QEKA 5GOTA 1JDBB 3UIEA 1PD1A 4NHOA 1OYIA 3GFJA 3U1DA 2DWUA 5ERIA 5A71A 4HBLA 1OCPA 5JMPA 1EHIA 4MWGA 4QTXA 3CCSI 4RY0A 3VU0A 3BCUA 3RJPA 2FZGA 2WF5A 1I7SB 4HDNB 2AN5A 4YUXA 3GTLJ 3MMZA 3GJSA 1GNLA 4OK5A 1F0KA 3I9FA 3Q40A 4D45A 1ORRA 1MABA 3OD5A 4A10A 5LWHA 5FP0A 3F4BA 5BQXA 4M9QA 2J5BA 3L5KA 5GAEJ 1KPHA 1U3DA 2BMVA 2KQRA 5EF6A 2IHBA 2AW5A 3AR6A 4R5MA 3ELWA 1HETA 5IXSA 1J2JA 3RS9A 4RDIA 2C9CA 4KN7X 3AR9A 2WWXA 3SVLA 4XB6B 2EWMA 3W9YA 3PUJA 4AY5A 5HDBB 1FXUA 1IPHA 1D1BA 1YDFA 3O90A 2QX6A 2N3ZA 3AM3A 3B3GA 3LM8A 2XNDD 4EMUA 3UWKA 1NJ5A 1E5TA 5DFAA 3FKQA 3EVBA 4EENA 1V5IA 3CT6A 1T5BA 1QAOA 4H4EA 4LAFA 3EXG1 2PGDA 2VJPA 1JAXA 2YR0A 1I30A 3QKIA 3QYAA 4BVAA 1DSSG 3OZXA 4MIYA 3VC7A 3KAJA 1TYEB 3HNOA 5FWYB 1Z2AA 1WBDA 2FW9A 4WK4B 4MHSA 3SYNA 2QQAA 3KPUA 4JP1A 5CVIA 1JLMA 2H4WA 4RPCA 3VSCA 5MFPA 3FZQA 4BASA 4L0MA 4Q7MB 3BJRA 4RHTA 3FNIA 4DAEA 2BOVA 3WADA 2DQ4A 4DY4A 3OA2A 4LCEA 2PVCA 2QXTA 3A4MA 1MQ8B 3I2GA 3DVQX 2JFYA 2XEXA 2OD9A 1P1KA 4F4FA 5CPRB 2HMYB 4JL8A 2V96A 1E6CA 3R0IA 2JI9A 3KZXA 4UBMA 3TDZC 1XA4A 4BB0A 5A02A 5JSHA 2PAAA 5DASA 3OC6A 3FDJA 1YR9A 2P0EA 5D6OA 2RJOA 4EZEA 2HDOA 5MHTA 2E7WA 4DXDA 2OK8A 3UB4A 2HR3A 2WLSA 1TAHA 2CJWB 3HS3A 3PQ5A 1GNPA 3ECSA 3CCMI 4O1MA 2W4MA 4YV0A 4C7XA 1IDOA 2I1WA 2LXNA 3W7BA 3I4CA 3DLHA 3JR7A 4B2PA 1NTRA 1H0RA 3KETA 2R7LA 2OF7A 1F0YA 3C2GA 4XRRA 1X1RA 4FDVA 3ISJA 2H5LA 3EEBA 3CLQA 1Y4ZA 1IH8A 1UBRS 1VGVA 3EH2A 3LXMA 1T56A 2L82A 5TF4A 5KVCA 3QFHA 2BGIA 3H1FA 3EARA 4CCMA 3KHTA 1Y8ZA 1U2SA 1A4RA 1MX3A 3U0VA 4PIVA 3OIQA 4BPBA 1J97A 1E2GA 1P2VA 4IH9A 1R71A 2ZBDA 1USIA 4U7DA 1YR8A 2FX0A 1TRHA 1GQSA 1SXJC 3H84A 5M5BA 1XKQA 3GBGA 1QS0A 1LRLA 4S35A 1K9VF 2Q6KA 2XGGA 4ZYYA 1YS7A 3P26A 1P9LA 1NF3A 4YJ2B 3HUDA 5JJBA 3VVLA 1TNDA 3NBQA 4NXMB 3PEFA 3DLBA 2IY8A 3LKDA 2X1VA 3D8SA 4LHVA 1T08B 2PD3A 3T0GA 3B8EA 5AVSA 4RD4A 4Y9SA 4ALJA 4OCZA 2ORIA 2CQQA 1W4MA 1U0HC 5EMMA 4ACBA 4FWBA 1FUIA 3OBIA 3D3WB 4TLBA 5F9FA 3FXKA 2OXEA 3CC8A 1MF7A 5B4UA 4QYIA 3P4UA 1E2FA 2R1VA 2YSRA 3MRTA 3PT5A 3QWHA 2RIPA 1E32A 1TUGA 3LQ1A 5E1OA 3WYAA 4KXNA 2BFDA 1HEYA 3O4JA 2X2FA 4EY3A 1YULA 1TCVA 3DEHA 4R3WA 5K3SA 2CLSA 1YB4A 4CV0A 4OKIA 4XLHA 1JDUA 4KE9A 4ZD6A 3DKPA 5C3UA 5ALIA 2V4UA 1AXRA 4G5OA 3LDHA 5F2KA 3RYTC 3R1IA 2AMLA 3DDHA 4GM4A 2JLUA 1S8FA 3U4IA 1FYEA 4ZXPA 4MIMA 4NAUA 4D9EA 3HKDA 1RWNA 2PKWA 2QAGA 2CDAA 1P1JA 4ALKA 4FLFA 2AD1A 2AYXA 1QHHB 4RK4A 4DXAA 3W1EA 2NU7A 4DCJA 3WC4A 5DOZA 4K6KA 3WGTA 4BNDA 1ND6A 4PJNA 1KJ8A 1D6NA 9LDTA 1CPYA 2D2XA 3L7AA 1K75A 1U3GA 5K09A 1FP4B 4GUDA 1D4OA 2PKEA 4HJXA 4JJFA 2FRDC 5HFNA 1IG3A 1BC8C 2H7VA 1I39A 3ECOA 4NOLA 5KHOC 3G2IA 5FRNA 4CNQA 2ZQ5A 1PWXA 4WEQA 4F2HA 4WOBA 5DCYA 2PEYA 4B71A 4Q7EA 2GZRA 3L7BA 1LDMA 5DI3B 2DUWA 3W9BA 2OHGA 4FU0A 2MSWA 3PDIA 3UC5A 3ZE2B 1YW9A 3ROPA 1LFBA 1VLHA 3NS7A 5HMLA 3RASA 2CXRA 4YI5A 2ZSDA 4D81A 1C0IA 1ECJA 3RU7A 3UUWA 4RGUA 1U1GA 2CXNA 2ZYRA 2V97A 3CH7A 1ATZA 4RU1A 4JI2B 1T39A 5J43A 3P2EA 3PUXA 1F48A 1SFRA 1N6PA 3GN1A 3GAMA 2IDMA 2J6IA 3A0RB 4X1KB 5CG1A 4IDHA 4IG4A 3F6CA 4EAQA 4H7HA 2JTVA 2PSFA 2I3GA 2A92A 4CMIB 2QVXX 2JJMA 1X6VA 1U5TA 4HPXB 4U7HA 3PNBA 1Y81A 3JCZA 3C3CA 1FDRA 1FLVA 2CZCA 4IXNA 2A05A 2BLNA 1NVDA 3N8NA 4FFMA 4CKZA 3IESA 3OPQA 5DYIA 4KNVA 4PZYA 3OYKA 5K0LA 2VPQA 2WJ3A 3KPYA 1AJEA 4O6JA 3D4BA 4DJAA 1RYYA 4D4JA 3DO6A 3GLGB 3PKIA 1E96A 4MVJF 3SJBA 4D3FA 4MV6A 5DV9A 3WKEA 2PIAA 2IY7A 4UEQA 3R5XA 5LYJF 4MUHA 5HOEA 1KAQA 4GX1A 2VQ6A 4OLHA 2XXBA 3H83A 5GTIC 3HJNA 4XQFA 2FSVC 2WV1A 4K8RB 4X24A 2OFPA 1AUXA 1J5XA 2XAUA 1YJWI 3K6KA 3BCSA 4YA6A 2VCHA 2VPLA 1CVIA 2HY7A 5BN3A 4EYKA 4FCVA 4K86A 1N2IA 3FROA 2GJKA 5LOVA 3KKPA 4JI0B 5TQ2B 1GSIA 1H9BA 3N28A 5CA0A 1UBFA 2G9WA 4PFOA 3Q9NA 1Z4KA 3S16J 2V6CA 5K6TA 1Y8AA 2B99A 4QYMA 2QWWA 1ABBA 4JC5A 3B6KA 3C7JA 2HMTA 3BR0A 4HRVA 4ZVUA 2VT6A 3CLTD 4M4SA 3QOFA 4P4LA 4DOMA 4ZDKA 1D9ZA 5J9FA 1IWPB 1P31A 2ZM5A 2KJBA 3W79A 4I9UA 1YRBA 5FFNA 2ZB7A 1MBHA 4GP9A 1MNQA 2Z5LA 4HD8A 3HLKA 1TAQA 4H1TA 3ULKA 3D6TB 4EY8A 3HB7A 3NDBB 1Y7PA 4Q7JB 1MD0A 3R0ZA 1XMOB 3R7WB 3BJ6A 4D0LB 3PNTA 3PLNA 3HM9A 3M5CA 1MO2A 2DKFA 3NH9A 5JSZB 1O4XA 1GWNA 5KYYA 3LUKA 4LRYA 1PW7A 4CNBA 1ZCFA 3DOCA 4L6AA 1TIKA 4JVMA 2DCEA 5C4IA 1G63A 2H4JA 3H5IA 3KZYA 3CCRI 1ZVJA 3LXUX 4U7PB 1K4TA 4NFLA 3GAAA 3G0IA 3OYCA 1AHDP 4X91A 1C0WA 4B80A 1JEQA 1ZOSA 1UC5B 3NG1A 2WM2A 4QTTB 2JIZD 5KTSA 4MYUA 2I55A 2QB5A 5AUPB 3K5IA 3DBRB 1OXVA 3L7NA 3C6ZA 2H2IA 4P3NA 5G0WA 2O8DA 2KLHA 2WE8A 2D2WA 1JSCA 2KIQA 1U98A 2HNKA 3JAWB 2GPBA 4Q34A 1NC1A 2ZDGA 1DP3A 2WSBA 5IZCC 3CF0A 1FSSA 3TG2A 1LJLA 1ZY2A 1YB1A 3MS7A 1WSWA 4DIOA 2HEIA 3OUUA 3QM1A 1ADYA 4AJ1A 3SIRA 4JT4A 1DTWB 2UU9B 4DMRA 2R48A 1OCRH 2PPVA 4G1MB 1OH5A 2JK3A 4KL8S 2ECCA 3HN2A 2PG3A 1HE1C 4JASB 3DZIA 4IL6C 2NOAA 5LMNB 1M1YE 3VC2A 1F9NA 2CL0X 2XRYA 1M8JA 5HQTA 2RHJA 3DKKA 1NG7A 3IAAA 4F6RB 2QRPA 3HUFA 3SC6A 5IKXA 4TMYA 2HR1A 5KNCD 1U2EA 2XV1A 4HAMA 4Q19A 1ZNXA 4IQFA 1EIZA 3NFRA 1IVNA 4E32A 4YK7A 4E08A 4KAJA 4LBWA 4AN1A 4ZK2A 3NB0A 5TSDA 2OFFA 1YFLA 2MWMA 1X80A 1QRSA 4RMJA 3UPUA 2HLPA 4A3GJ 3KPJA 1HTBA 4HFMA 2FZCA 4WVLA 5EJGA 1U0SY 2OSVA 4M6XA 4RVUA 2BFNA 1P6RA 2Q5LA 2VZ8A 3JQ6A 2XQVA 2L18A 2P0AA 3QBEA 1VQLI 3HA5A 4MQVA 2GN0A 3FOZA 3VGPA 1MABB 4KPGA 1RKWA 4WKPA 5B37A 1HKTA 4QQRA 4C0LA 2H2AA 3CE9A 1PR2A 4TL8A 2VDUE 4TTQA 9ABPA 3VC1A 1Y4SA 5CU7A 4M0EA 5FI5A 3PGMA 4N4AA 3TR0A 5HF5A 3ZNNA 3ESQA 4NFYA 1MH3A 4QBIA 1W75A 4FGKA 4CM7A 3VR3D 2DUMA 1XRSB 2EIKH 4EA9A 2EATA 2O03A 3NOQA 3BK2A 3IAM2 2BYVE 4BNZA 1N9GA 1XZFA 5LQUA 2QN6A 3L4SO 3TSZA 2MINB 3GLSA 4FYWA 1Z12A 1W2WB 2DYSH 2R44A 2L9SA 5BSUA 1YYVA 4QODA 1VHLA 4PGFA 3WDKA 2H8GA 2D1QA 4M1OA 5ISMA 4MVJG 2A6PA 5AXBA 2LZ0A 1PYDA 4IJMA 4CV1A 5A1TA 1LPSA 2PFSA 1JGTA 3AYZB 4ZQFA 4LGYA 4MKXA 1V8ZA 1ZU5A 1Z88A 1YI2I 4QL3A 2X9VA 3A1VA 3RU3A 2D1RA 4ER5A 2O1SA 4RIIA 1QH8A 2QMQA 3KV3O 2CBGA 3IH3A 4NQWA 4C5CA 4NE7A 2JLCA 4OUDB 1G55A 4RWZA 2NZUG 5BT9A 2FOKA 5LP1A 4P83A 3I9LA 3F6BX 4I99A 2IJGX 2ZRMA 3DOIA 4PAOA 3RWOA 2NZJA 2I3BA 1JVNA 4BXFA 5BXYA 4QPCA 1BNCA 4MB6A 3M6AA 2JAQA 4FP9A 2IRWA 2QN7A 3ZVMA 1QG4A 3ZKAA 4D82A 4DA8A 4BEJA 4EGQA 4QJIA 5CK4A 3AF5A 2D62A 3AOGA 2CLHB 1PFYA 4JN6B 4UY8I 3WZLA 3HM5A 4RYLA 3MGBA 4YCSA 3CZ6A 2EKBA 4R2XA 3ZLJA 1VZ2A 2GA2A 1WJBA 5AIAA 1E64A 4L5CA 4AJ9A 1PW5A 1TA9A 4QDXA 3V1LA 1YVRA 2P2NA 1SY7A 3MWFA 1J5EB 4UPDA 4QXMA 3H2HA 4QC2A 1G6NA 3K1AA 4W5QA 1EVKA 3DDUA 3KJNA 3OX1A 1P2DA 3X3HA 4LXIA 2J5XA 4OAPA 1TGYA 4QU5A 4ZVVA 1M1ZA 4GQIA 2GPYA 2P5YA 2IBMA 5KYNA 2PRYA 3WLRA 1WULS 3UC9A 4Y3OA 4ON0A 2WP8J 1GRRA 1DIBA 1QS0B 4RTJA 3REOA 3M4NA 2WVAA 3LUGA 4KBFA 2NS7A 3CMEI 2H06A 1FF9A 2QZZA 3IBTA 3CH5A 1TUEA 2HTEA 3L1VA 1KNQA 2L4AA 4M7RA 2YY7A 2IT1A 3U3MA 4CU2A 1T9GS 2PBLA 1X3ZB 3AFMA 2AI1A 4CTNA 4YRJA 1MA0A 3PTLA 4QHTA 4DDWA 3PE6A 4F56A 1LJ9A 3GT0A 4GOKA 5KSPA 1AQ6A 3ETEA 4QYIB 4LSZA 2R1VB 3W9SA 3QYBA 5KQLA 5J2UA 4UVBA 1E2DA 2QKYA 5CLLA 3W2HA 4BGEA 3UMCA 2CL7X 4WD3A 2ODBA 3E7WA 1EK6A 3VDRA 2KM1A 3S2YA 3WU1B 1CNMA 2PX4A 2H3HA 1Z38A 2VL7A 2CEKA 5TEWA 3QAHA 3JD0A 4O2RA 1LJ8A 1NFFA 2QM0A 4DLNA 3TNYA 4L8LA 3PO2J 1ID1A 1C7ZA 2PLFA 5AW1A 5HTOA 1R27A 4QOHA 3WLSA 3Q72A 3EETA 4CLDA 4MMXB 5J4LA 1T3HA 2DJIA 1PBNA 1L1EA 1R0BA 4YR9A 3BX1A 3D64A 3RVBA 1X1EA 4MS3A 3WDSA 2GKSA 3GVAA 2Z99A 4KXVA 3GROA 3HEAA 4Q5IA 4ZEVA 1VG8A 4LF4B 5H4HA 3HKDB 4OMUA 4NONA 3RADC 2Q9CA 2K4JA 2NVUA 2JLXA 3HYCA 2QAGB 2FZWA 2PMDA 1WZIA 2ECBA 3H3VK 1N0HA 3SOPA 1SD5A 2VVTA 3PXAA 4KDCA 3WNQA 2VF5X 4DPMA 2W83A 3AEZA 2FHSA 4D9IA 4LBYA 2XMZA 3VOBA 1TK9A 4V0RA 3A3YA 3FXAA 4PLGA 1SULA 1IONA 2WB4A 3RHZA 4CDRA 1Z18A 3ELUA 4E1VA 1FJHA 1B23P 2OAEA 1YDWA 3QI7A 4DCGA 4EGAA 3E9YA 4MUMA 5F0CA 4Z1OA 2FMFA 5ILOA 6CHYA 4PHCA 4KQMA 2GEJA 5DH9A 3LUPA 1CQWA 2NGRA 4IHYA 4HTFA 3WYGA 5YASA 4ENTA 3PDIB 3U7QB 1BW9A 2KMLA 1SUCA 2IOQA 3ELDA 3ICEA 3ZHUA 4YAUA 4D4GA 4HH4A 3KB2A 4ZT2A 3CSUA 2QYTA 2I7CA 2X9QA 4EMTA 4YNBA 3WP1B 2QROA 1UKEA 1E5QA 3LQKA 3NZEA 3AI2A 3M8FA 1XD8A 1HSJA 5FQOA 5IKOA 3WYBA 4GF5A 3GJYA 3OCWA 3DM5A 2V3VA 4E33A 1OWOA 5HM8A 1QO9A 4EA8A 1F6BA 5E3LA 5F52A 5CPBA 4X0GA 4JKIA 2P9GA 4YCNA 2P5SA 1F3LA 3P2KA 1GPMA 1TYDE 2E4ZA 3OPNA 3CMAI 1AKQA 4F52A 4W5TA 1RAFA 4C7MA 1RWWA 1X2MA 5HOOA 2ZIFA 4ZIRA 3JZAA 5FLKA 2HL6A 1R0YA 3TJMA 1XVTA 2A2ZA 1NNLA 4BJ6C 1A72A 2P69A 3PQ7A 4XYEA 3ND8A 3GFQA 4P1WA 1S6YA 2XAAA 4UVCA 4OWRB 5LJLA 4V0LA 4GBGA 5F9MA 3A3NA 3KWJA 1QYDA 5HSGA 1HTTA 3U6KA 4X6YA 3JQ7B 2DOFA 1NJ6A 3FG9A 2HDDA 2DHCA 4TTRA 2QLLA 4MRPA 4J6FA 2P6MA 4PPYA 4QWMA 1VJCA 2XNDA 1VBKA 3P9YA 1T91A 2VQ3A 4P7BA 3C1AA 1VLMA 4KR7A 4K8OA 5BV1A 2PQ0A 4NP6A 3LAWA 5LOVB 1DARA 4KQXA 3HU2A 3ELYA 2XT0A 3ECHA 5CA0B 2C7VA 3Q8XB 1TJNA 3NPMA 5B4VA 3KCCA 1IQ0A 1WB9A 1T36A 4W7IA 1FFAA 3HG9A 3U4QA 1RI1A 1RBMA 2CHGA 5FBWB 5TVKA 4KI0A 1B6RA 3TGLA 1FBTA 1RHMA 1PQWA 4WJZA 3ML1A 3D1LA 5EJ7A 3R7FA 2DYRH 4R8MA 1A5SB 4P4TA 3OM0A 3FN4A 5IARA 5EGOA 3T1VA 4MR7A 4YPVA 1SMYF 1T6ZA 1KE2A 3H5TA 2V5VA 4E6PA 5F7OA 3U9LA 1WSBA 2ZMEA 3F6YA 1L5FA 2P1RA 4XNFA 4Y13A 2HHJA 1YZYA 5L7TA 4PNZA 3P5SA 3R6LA 3MWGA 1DJOA 3NC1C 1R00A 1OCOH 3UK0A 4MW5A 4TZ6A 4FEGA 1XAIA 1QHYA 4GRAA 4K5QA 1DAKA 3VFZA 3U56A 2C7GA 4U8HA 1V4VA 2AJ8A 3FX2A 1XTBA 5FL3A 3OYFA 4EO7A 1TYAE 2E1CA 4XVQA 1YRWA 1IYZA 4XM1A 3ENZA 1ISMA 4NICA 2IV2X 3IQEA 3QMVA 5FPYA 1LTHR 3T7TA 3KX2A 4YELA 4ESBA 1JEQB 2WDPA 1T8UA 2O2SA 1SVMA 4BBSJ 1MBFA 2AS0A 4HYTA 2PFBA 2EA4A 4I5DA 2Z83A 3KOUA 1WIWA 3FM3A 1VQ1A 5GADl 2BEUA 4GYGA 3D59A 5IOZA 1HC8A 1ETKA 4Y7CA 3OLXA 5ITSA 4P93A 3W2GA 3VFDA 2O8DB 4E22A 3P0HA 2YWRA 2QTNA 3D54D 5KOHA 4RZQA 1XFAA 1G19A 1U2ZA 5IDVA 4AUXA 1Q0ZA 2PH1A 4HNAB 5KJFA 1MRNA 1S3SA 2ZAYA 1W19A 5K3AA 2I4TA 3T1QA 2R8OA 4DC9A 3T0IA 1SRQA 4M0UA 1XTKA 4XL9A 5AVTA 4DR1B 5DBEX 5E1ZB 3MINA