3P9IA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and sinapaldehyde
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9iA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9iA02
1OMIA 4CTJA 3KR1A 4UV8A 2EFWA 1PDNC 5HIMA 4AZSA 2PKWA 2GZWA 5FHRA 5E8GA 4I2OA 4GOLD 2PX5A 1HSTA 4CGZA 5DLYA 2DW4A 5DX1A 3FMQA 5H02A 4YV2A 2O05A 2GQQA 4M72A 1UFKA 2E5WA 1YTYA 5E1ZB 3O2PE 1DUSA 4FSDA 5ERIA 1HSJA 4MEXF 3LCVB 1WRJA 2Z33A 3NVKI 2RGVA 4KMUX 3KQPA 3UFBA 1XCLA 4ER7A 1R5GA 2GPYA 2FSWA 3BP8A 4ZYEA 3DLCA 3E6DA 5JVTA 3M33A 3BPVA 4ENKA 2IH4A 5FLXZ 2BR4A 3L7WA 4EV0A 2RVCA 2XAJA 3F21A 1IAWA 5DXJA 4DF3A 4PDKA 4AIKA 1QANA 5L3FA 3FTEA 1R36A 1G38A 4YG2F 3M9AA 1RI5A 2GB4A 3M4XA 4LECA 8MHTA 3ZMTA 3FUXA 1YUBA 2Q2EA 3MTIA 3EVZA 1J0RA 5LGTA 3O7WA 5FHQA 2BR5A 4PIPA 2AXLA 2XYRA 1NKVA 1I1SA 3GRUA 4M71A 1IN5A 1ZREA 4CZZA 1Z1DA 5F2KA 3FUTA 2XGXA 4HX8A 1NV9A 1G3YA 1G6Q1 3ULQB 1HKSA 4OIPF 2EX4A 2ZWAA 2VOOA 3M8FA 4PINA 1SFEA 3HYIA 3F72A 4OU0A 2CG4A 1I1GA 2RV8A 2OA4A 4EM2A 2EG5A 3TR6A 3F8NA 5DV5A 3ME5A 3G3ZA 4HX7A 4QPPA 1U5TC 4M37A 1O3RA 2ZBKA 4KYWA 1VBFA 2CQKA 2KW5A 3HSFA 3GJYA 3SGLA 3HUGA 2ZFWA 2UYOA 4L5IA 2IJLA 2YU3A 3PX3A 1U8RA 3FUWA 6PAXA 5B1SA 4PZJA 1SQGA 2V9VA 3RKYA 2MA3A 3SSMA 2H11A 1BI1A 1MJAA 1QAMA 1MGTA 3G88A 2DO7A 1LDJA 2MH9A 3G2QA 4FP9A 5LQUA 1G4DA 3EETA 3NRVA 2ZCJA 3BOQA 5BPIA 4EJVA 4HYEA 3BROA 2NAZA 4AZWA 1ZH5A 3O31A 1LDKB 3FZGA 1XGOA 4IF4A 2OY0A 2XKOA 4ON0A 2O07A 3EEOA 1BN5A 2H1RA 1BIAA 5DDGA 5DWQA 1TPYA 3HCCA 3FYCA 2WA1A 1O57A 4L7VA 3WTUC 1K6OA 2FE3A 4EJUA 3L8DA 4P7GA 3IRRA 4YUWA 3THSA 1XXLA 2DTRA 1XTPA 1T2KA 3MWMA 1M0EA 4UVAA 2W24A 4ZTBA 1G3SA 3DV8A 2XAHA 2EV6A 3GO5A 3WTYC 2ESNA 4RB2C 1FNNA 3I54A 5EKUA 3FTFA 4BNCA 1FSEA 3EVDA 4OMYA 3T7RA 4ENJA 4XUEA 3TLJA 1NW5A 3A26A 2H09A 3CTAA 1FBUA 5T64A 4C04A 4KVZA 1MHTA 5ED4A 1JSZA 3HCBA 2J5PA 4YFXF 2A61A 4E31A 4E32A 5DYMA 5BXYA 3E5XA 4YUXA 5BP7A 3ABTA 5F64A 5LEJA 4GYIA 4M73A 4ER6A 1DP7P 4CXMA 3TRKA 2VOPA 1B6AA 1EG2A 3IKVA 4MQ4A 1R8XA 3MCZA 5FFXA 5CVIA 4ESBA 2ZKZA 1N7JA 5EG5A 1Q0SA 5J6XA 2QUFA 4F85A 3LDGA 2VODA 5F2OA 1VP3A 2PN6A 2K02A 4UNOA 3QOXA 3ELWA 2CWEA 4MIKA 4S04A 2VBYA 2DAOA 5E1MA 1JXSA 2W25A 5A2QZ 3PB3A 5KYGA 3LL7A 2ZBQA 4HQEA 2ACJA 2E7XA 1I9GA 2F5DA 1VLMA 1G8SA 3UJBA 3QRFF 5CCXA 1D5VA 3BJOA 1R8YA 2O61A 1J7KA 1QNTA 1TQPA 1LVAA 3VFZA 1I6XA 4C4AA 2O03A 1ORIA 4DNCA 4DCGA 3DH0A 1WS6A 2DULA 4DQ0A 5EZQA 5K5QA 3KP2A 5CVRA 2ZULA 5CM2Z 3G89A 4AIJA 3P9IA 1P4WA 3DF8A 3V8LA 1HXDA 4MEYF 3M70A 1BBYA 4X1OA 5D4RA 4OIOF 1WI9A 2XVAA 1BM9A 1R5HA 2FMYA 5F1RA 1JG2A 1RNLA 4YFKF 5HVQC 4RWZA 1P92A 2IA2A 1G8AA 4HF2A 3FHZA 4MTLA 1B1BA 3QAHA 4OQEA 2FRXA 3DMFA 2BM9A 5DM0A 2FHPA 4RAYA 3KQOA 4XUCA 2VBWA 2XBMA 2ISYA 3B02A 3G2PA 3BT7A 3C1DA 4X61A 4GOND 1P1CA 5LQKA 1ONVA 4IRHA 2F2EA 2Y48A 2YR0A 2AOTA 1VTNC 3HRSA 1O54A 5K09A 2IRFG 2AOXA 2DQRA 4LWPA 1T6SA 5EKXA 1Y0UA 4M7RA 3JSOA 1L9KA 2YTZA 1YF3A 2R3SA 2RDPA 3P2KA 1XSVA 3BZBA 1RIOH 1PP8F 5C0OE 3RDIA 3KP5A 2JT1A 4YUVA 1P6RA 4HGYA 3SM3A 3HA7A 2HTSA 1DCTA 3TO6A 2GS9A 3E5UA 2VE9A 2VT3A 2ZJ2A 3L00A 2V6CA 5GM1A 2TDXA 2P40A 3MQ0A 4POOA 1OYIA 5K0CA 4AD9A 5P8WA 5E1BA 3RYPA 4BH9A 1O3QA 2B0LA 3R0AA 1PP7U 3V97A 4C05A 2A68F 4BP3A 2ZBPA 2VE8A 5K5RA 1D2HA 2VC0A 4BYYA 3TM4A 3IL2A 5E9WA 3BWGA 4V0RA 2P1DA 4U7PB 5LEKA 3GDHA 2EFOA 3G2OA 3CUOA 4YMHA 4FS8A 3CO7C 5KS2A 2GA1A 2ZXJA 4C06A 1HW5A 3MHTA 1N7IA 1ZN2A 3VODA 1BOAA 1QGPA 4HOBA 3WU1B 2HNKA 3MGGA 1FBQA 2JPCA 3M7GA 5D5VB 2ORED 1R58A 2HFHA 3K0BA 1YIOA 3COAC 2YUIA 4R6XA 4KMFA 3PS9A 4HLXA 4MTDA 2NXCA 1G3WA 4G8XA 3GNLA 4LFUA 3ERCA 3GW2A 1IN6A 1ZG5A 2PXCA 1X1DA 2F5EA 4D0PA 1KU3A 2PJDA 5HOOA 4KUMA 5EMJA 4IRGA 4FZVA 4PYIA 2FBHA 5CIYA 2PSSA 3RIRA 3T5XA 3BXOA 5F2NA 3RJPA 3TDZC 2QVOA 1Z7UA 1RJGA 4G94A 1BHJA 4YFNF 5KVRA 5LHGA 1V4RA 3ER9A 5LLQA 5CVDA 1ZRDA 3LAPA 5F6FA 5E8JA 2B78A 4RB0A 3EQLF 1ZGJA 4LG1A 2ZIEA 2JH8A 3NDJA 3CGGA 4E33A 4Q48A 2P8TA 3KP7A 4KFCA 3CKKA 3ZMDA 4V0QA 4KDCA 1ZRFA 4U0YA 3HVHA 4YIIA 1I5ZA 1SAXA 3PLAE 4U88A 1O9GA 1W5SA 2NP6A 2VBZA 2D1VA 2K4MA 1OYYA 5D1NA 2FOKA 4CICA 4PCQA 1USTA 5EEHA 1REPC 4U0VA 2CFXA 1IY9A 3I59B 2ADMA 1S6LA 3KQSA 3OZTA 1R74A 5EGSA 4EJOA 3I71A 3B73A 2N47A 2FBIA 2LDUA 2HKXA 2YR2A 2G71A 3HVIA 2ZTHA 1ZRCA 4FT2A 2HZTA 3HTXA 3GZ6A 1ULYA 3NTVA 3UZUA 1DPRA 3AJDA 4YIFA 3T0YA 2FXAA 5TRDA 3FWEA 3I58A 1BC8C 1TQMA 4F7ZA 3I59A 4OMZA 2ZSUA 3IC7A 2V7EA 3UA4A 4A5MA 3IWZA 3FMRA 3R0QA 2PBFA 1L1EA 5D5UB 1IRGA 2KIFA 4RTKA 3E7PA 1YZ3A 2UZ4A 2X4HA 3H3ZA 2HMYB 3I4PA 1B4AA 4XBFA 2PEXA 5EMLA 3DFGA 3OZRA 2O3FA 1XJ5A 4PGGA 4XSXF 1J9IA 3FPHA 2PG4A 4KDRA 2EFQA 4A0ZA 4Q4ZF 5LSAA 2OXTA 1KXZA 4I01A 4CHUA 3LA3A 2GAFA 4Q47A 1BI0A 4LD5A 2P3LA 4HAMA 4OBWA 5FTWA 3MCTA 4IV0A 4G7OF 2KIUA 5D4SA 3LA7A 3C3PA 1RUOA 2CSOA 1OR7A 3BWCA 4ZZDA 2QWWA 3SMQA 2BR3A 1G60A 3QP5A 4PYMA 2GIVA 4WCGA 1ZG1A 1KGSA 3O4FA 2HQRA 4RTNA 1M6YA 4Q5SF 2PT9A 4U7TB 5HIJA 1VE3A 5JHUA 5KQRA 1TLHB 2IH5A 3G7UA 5K0BA 3ZN1A 1WWXA 1NE2A 2WTEA 2KIMA 4N9IA 4N0BA 5FADA 4GUAA 3LFKA 3J81K 1P2FA 4RGXA 3LQQA 1YFJA 4ZYHA 3HSRA 1T98A 3SXYA 1S3JA 2G8NA 2A6HF 2EFNA 4QQKA 1FSHA 1IM8A 3PFGA 4XRFA 4RTSA 1VIDA 4FGZA 1PUEE 2YVLA 4FT8A 5HLHA 4NHJA 2BH2A 4L9JA 2IA1A 2PI0A 4GC5A 1LB2A 4LLLA 2P6TA 2FMLA 3WTTC 4KW7A 3Q7EA 1ODDA 4P7JA 2L4MA 3KQYA 3ECOA 1XDSA 5BW4A 3HTSB 4E2YA 3DR5A 5T67A 3P9NA 1AWCA 4UV9A 4GYGA 3WTXC 3ZMSA 2ZBRA 4YMGA 5C1IA 1EAMA 4OQDA 3WTSC 4KRGA 1STZA 1FYLA 4LG0B 4EQZA 5DSXA 4PWYA 3E8SA 4EKGA 1IXRC 5E1XA 1KQ8A 4G7HF 1NBIA 3KP3A 5IT9K 2QYOA 4HW0A 4BP1A 3HM2A 4PCLA 4E2ZA 3HTUA 1USSA 1YS6A 1RI7A 5E17F 2NS0A 5GWXA 3Q9SA 2AN5A 3NVMB 1BI2A 2P7IA 4DKJA 3FX3A 2Z3YA 4HV6A 1YW9A 1BIBA 2BZGA 2VDUE 5DM1A 5FQOA 4LG0A 2V1UA 1W7PD 1NHAA 2Q0OA 1SD5A 4X41A 5FD6A 1EV7A 5K8VA 5LQCA 5G02A 1R1TA 2XAQA 1EH6A 4L9VA 5K0FA 4EJWA 2OB2A 2PV0A 2GWRA 4KA4A 3EGEA 3P2EA 3EVAA 4L5JA 2FBKA 1CGPA 2PJPA 5DRYA 3WSTA 2AN4A 2H6BA 3WTVC 2V1DA 5ICGA 4IJAA 1RZ4A 1QO0D 5FA5A 3WE3A 2OBPA 3GXOA 4ZH4F 2PY6A 4DQ2A 1ORHA 4B8XA 3T0IA 4RVFA 2HWKA 3DXJF 2Q41A 1O3TA 1INLA 3K6RA 1FZPB 2HV9A 3GLXA 3TDUC 1G55A 1Y8CA 5HEKA 2IBSA 3KHKA 4HF0A 3J80K 1AV6A 3V7SA 3MAGA 4QVKA 2OZUA 4A5NA 1KP9A 5FQNA 3FUUA 2VN2A 1J2XA 3A4TA 3B3GA 3GRRA 2K7LA 2IPQX 1MJFA 3K1MA 2HS5A 4HBLA 1YLFA 4R05A 4RGSA 1MDMB 2ISZA 5M5BA 2CO5A 4M6XA 4HSGA 3ANXA 4O29A 4GOOD 1IN4A 1DDNA 2OPBA 4MWZA 3BWMA 4CTKA 2VDVE 3JWHA 3MAJA 2NXNA 1WXXA 2PFBA 2P5VA 1SUIA 1B9MA 2IDKA 3I5UA 3QOPA 2QLZA 4XLNF 5LQAA 1UHWA 3HA3A 4P55A 2CKDA 4QQNA 1X1AA 1MDMA 1RJEA 4YUZA 3NQOA 3SZPA 2XVCA 5EEGA 1RI3A 4M9XA 4BLUA 2G9WA 1XGMA 2ZMEA 3JAMK 4Y2HA 3BJ6A 2EA4A 1W4MA 1XMKA 3E05A 4XUDA 1KYWA 4MGRA 5E8IA 3F8CA 3ECHA 4XCXA 2QQ9A 3GRVA 2ZCWA 2BEOA 1JG4A 3HCDA 1MKMA 5KK1A 1SUSA 3T1BA 2C7QA 4KIGA 2OYRA 1TNTA 4KT5C 3UA3A 3EVEA 2PBIA 3IYLW 4RB1A 2I62A 2D2WA 1O7FA 2YXEA 3CJTA 5FWAA 3V4GA 1XDZA 3GUDA 7MHTA 2Y0MA 5FUBA 4HDUA 3SSNA 3Q87B 4AIHA 5T6BA 4H0NA 3DQVC 3ER8A 3LAJA 2RN7A 2QRVA 2QQBA 2EFJA 2WWYA 3LDUA 4RGRA 4HG2A 2BYVE 4O3MA 5ERGB 1GVJA 2HR3A 1HMYA 3QPHA 4HV5A 3HSEA 1XVAA 1R7JA 5L3EA 4DCMA 3IEIA 5JI6A 1S7OA 3C3YA 3KPUA 2G1PA 2OO3A 2WA2A 5BPDA 3B3FA 3FUVA 4ASNA 2Z5UA 4IHTA 2Z6AA 5J8CA 4Y15A 4OA8A 3MB5A 3K1PA 3RPQA 3EYIA 3ZQ7A 2K86A 4CXFA 4A2UA 2Y1XA 4RAZA 4HRAA 4OA5A 2DT5A 2RNJA 1SMYF 3CC8A 2VBXA 3X0DA 2CL5A 4RB3C 2UZKA 3VC1A 1F9NA 5HIIA 3KFWX 4L9TA 2ZZNA 1V3FA 3FYDA 5GIOE 2CYYA 4AUKA 3FTCA 5HOQA 4RTMA 2PGXA 2VZ9A 1W7PA 2Z9OA 5E9QA 4RVHA 1YFHA 1X1BA 3H92A 4AWXB 1D2GA 1EIZA 4L0YB 5AIPA 1Z6RA 4IVNA 5FGMA 3M6UA 2L4AA 3TQSA 1D8JA 2IBTA 3KPJA 3GVAA 5HILA 3BKWA 3WTZA 2AOTB 3QV2A 2R6ZA 2OBFA 3F22A 3H3UA 1KU7A 1YFLA 4R79A 3LQRA 3ZMVA 3D2LA 1QYRA 2A69F 3B7PA 1EH7A 2J5OA 3EPPA 2IA0A 4QWQA 3DMGA 2PWPA 4RX1A 3E6CC 2FF4A 2V79A 4BQAA 3C3WA 1MJ9A 3PQJA 4FT4A 1UFMA 3FPJA 1EH8A 2IP2A 3WODF 3S2WA 2RC4A 3QU6A 2ZZMA 2H94A 2XAFA 4QLCU 2P3OA 1T43A 1R18A 3P8ZA 3PT9A 4M6YA 5FCDA 5CLSA 3OU7A 2I9KA 5K5OA 3PFIA 4O5VA 4OINF 2ZFUA 1ZG3A 4P7FA 3M6WA 1HKTA 2AOVA 3ROUA 3AXSA 3KQQA 1TTYA 4A6DA 5D5WB 2AN3A 5FA8A 5HLIA 5EHGA 4HZFA 5HDGA 1NT2A 3DMHA 2Z6QA 2VC1A 1VQ1A 4RVGA 5K0LA 3RPUA 2QENA 3GRYA 1YZHA 5EZSA 3G5TA 2P7VB 3LBFA 3BWBA 3OPNA 4K2EA 1RI1A 2HOEA 3CJQA 2CW0F 4KWCA 1IW7F 1AOYA 1NW3A 4QTTB 2XASA 2YXDA 3TFWA 3ZPLA 3DOUA 4I0BA 4UVBA 1F5TA 5FD5A 2E1CA 4GEKA 4RV9A 3UJCA 3SSOA 3R24A 2L01A 4HDVA 3CUQB 3MFKA 2X0LA 3A7DA 2ONZA 4C07A 2F5CA 3GFJA 5HFJA 1KR5A 2M30A 1IN7A 1R1UA 5LQJA 1UCRA 1IXSB 1IN8A 3GCZA 2IH2A 4L0ZB 1D3YA 2EV0A 1KPGA 5CUQA 1HNNA 1OR8A 2DU9A 1D2CA 3MERA 5E1DA 4HTFB 3TPZA 1JE8A 2JHPA 3CUQA 3P97A 4BHPA 3EUHA 3SZTA 4M9ZA 2XYQA 1Z9CA 3MEXA 5D6FA 2PVCA 3ABUA 3UJ8A 1YB2A 3SR4A 5K0GA 4PCAA 4QVGA 4DZRA 4I98B 1NW8A 1ZARA 3TGNA 3B89A 5DPMA 2FCAA 2VP3A 3U1DA 3SX0A 1TW3A 2HTJA 3KEQA 1P4XA 4LB6B 4HTFA 5FFZA 3GFMA 2JTVA 4ER3A 3KU1A 2W85A 2V74B 5DM2A 3IV6A 4QPNA 3GWZA 2HQNA 4ENMA 5D6EA 3GU3A 3U81A 2IFTA 3NDIA 1K78B 2Y1WA 2GXBA 2AS5F 2OKCA 4WWCA 3R61A 1P4AA 1A04A 1KPIA 1YS7A 2L54A 1Z3CA 2GA9A 3KR2A 3G2MA 1Z91A 3FXUA 5HDNA 2GXGA 4HH4A 3OZSA 3ISPA 5DSTA 3FM5A 2WV0A 1JSXA 5K03A 1KU2A 1IXCA 4U7DA 3TOAA 3OU6A 1K78A 1SQFA 4LGWA 2PXXA 3B5IA 3UJ6A 2UWMA 1CF7B 3HP7A 5DCMA 3T8TA 1JGSA 1LEBA 5H20A 2XHKA 4WXDA 4OIRF 1U3EM 2Y75A 3DPTA 3GZ5A 3RKXA 3HCEA 3AWIA 1UHMA 2B3TA 2JHCA 3E23A 1SD7A 5DT2A 4CKBA 1OKRA 3ZMUA 1RI2A 2V1XA 3P71T 2UYQA 3AAFA 1ZQ9A 2GLUA 3UJ7A 4R1HA 4IKPA 2DK5A 1CF7A 4H0EA 1TBXA 3I53A 3HVJA 3FPEA 4NQWA 1DL5A 1ZLJA 1QPMA 3LHDA 5E1OA 3LWFA 1IF1A 1LNWA 2EFPA 5BMZA 1R1VA 4P58A 5DX0A 4AZTA 3WE2A 4EMSA 3SXJA 2ZVJA 2AZTA 5K05A 4EK9A 1N2XA 1GHCA 2XVMA 4N9HA 5DCFA 1YG2A 3RIEA 3EVBA 1KU9A 5C9ZA 4G56A 1EQAA 2WK1A 4I09A 5IT9Z 4E2XA 2VS1A 1YW8A 5AONA 2PXAA 1LDDA 5DUKA 1FYKA 1JQDA 1R6AA 5D8LB 4KIBA 1L0OC 3O3KA 1TW2A 2IGTA 2P5LC 2AVNA 1ZLKA 3CBGA 4B17A 5DTRA 3FF5A 3F8FA 4MHGA 3TMAA 4YUYA 1BJAA 3PX2A 2AS0A 2C7OA 1WXWA 1FC3A 4XSZF 2L02A 2D45A 4PGHA 1ON1A 4C08A 5BW5A 3DLIA 3P9CA 5D8KB 1O7LA 2G72A 5DEQA 3QU3A 2ZLBA 1OPCA 2ESHA 3MZHA 4IPAA 2E7WA 4EGZA 1MZBA 1UB9A 3KE2A 2HTEA 2NNNA 3BGIA 5CJ9A 3OCJA 4JXJA 1EJ0A 5EHIA 4PYNA 4KN4X 2QE6A 3CLOA 4OIQF 3NWEA 2R7FA 5LQNA 3DKWA 3HCFA 2XUBA 2FNPA 1JQEA 2IT0A 3NJRA 1X1CA 2K4JA 1F1ZA 3R6SA 3W6KB 3J80Z 3K0LA 5HLGA 3E6BA 2HR1A 2LNBA 3GEZA 5ICFA 2BV6A 2WC2A 4OBXA 4IRIA 3OE5A 4NB5A 1O9HA 2MBFA 1XSDA 3GX4X 3G8AA 3IWFA 4U0WA 3JWGA 4K6MA 3GYHX 3CCFA 4UUVA 3T8RA 1HW1A 3HRTA 1NV8A 2E1NA 3P2IA 1T38A 1IRFA 5ILVA 1XCJA 3W6JB 4UVCA 2RKHA 5HS7A 2XV4S 3LGAA 4IWNA 4MHTA 5LGUA 4PYOA 3V8KA 2LD4A 1ON2A 4BLVA 3BGDA 2VONA 2C7RA 2O06A 3H2BA 3FPFA 3RTRA 2A5YB 1O3SA 1XMAA 4QDKA 4DA4A 3I9FA 1IXKA 2PQ8A 2ADUA 4HQMA 4BXUA 1FPQA 1WKMA 3U2RA 2PMHA 4ZYGA 4L9NA 3DP7A 4IV8A 2BGCA 2A6EF 5ICEA 4ISCA 3JAMZ 5EMMA 5HS9A 2A07F 2VXZA 1FBSA 4DM3A 3EGIA 2OZ6A 4LWOA 4YV0A 2KKOA 3D5LA 1JTEA 2ZIFA 4L18B 4PONA 3HVKA 4BY9E 10MHA 2BM8A 4KIFA 4EM1A 3FXQA 2QBYB 2DLLA 3GFLA 2Z6UA 2OQGA 2NP7A 4Y13A 3LCCA 5LQRA 4WK8F 1U6GA 4EGYA 4C03A 4UOEA 1EJ6A 5EIWA 1IZ1A 4JBAA 2XROA 1FLIA 1L3IA 3F6OA 2ONYA 3WGIA 3DXXA 5CVEA 5K01A 4O6JA 3U9GA 4EKIA 5LHHA 3EDPA 2QBYA 3HHGA 3JSPA 5JUWA 3DTNA 3HRMA 3F8MA 5HS8A 3HIFA 1R23A 3ELKA 2FQ3A 4ENNA 2DQLA 5TJJA 5LRRA 2DK8A 1DUXC 1X19A 3FRIA 2UYHA 2AVDA 1GXQA 2QM3A 4CDGA 2M1BA 1QBJA 1K79A 3DXYA 4RYLA 4RTOA 3JWJA 3REOA 4UHTA 3A27A 1PRYA 9MHTA 3E97A 4BAYA 3M1EA 1PJZA 2UXNA 4ETSA 4X63A 1JHFA 3UJ9A 5FB2A 1JTFA 3AY0A 3F4KA 5ILSA 4RTLA 2QQAA 4MNUA 5HIKA 2HDCA 2ZMEB 3DXZA 3LKDA 5CYVA 5E2AA 2FA5A 4KICA 5IKMA 5IH3A 2O8XA 1KQ0A 1YYVA 5DM4A 1F38A 3F8BA 2CMGA 2B25A 3UBTA 2G7UA 3F6VA 3KPWA 1SFUA 3DEUA 1U5TB 2G7HA 3SQNA 4HC4A 3KR0A 1L3LA 1WY7A 1L3BA 3BJAA 1ZYRF 4E70A 3FXRA 1JR4A 1KIAA 1B59A 2CGPA 3KQVA 1S29A 4PIMA 4M74A 3AXTA 3C0KA 2CWWA 2ELHA 3TM5A 3BUSA 1DPUA 4HLYA 2COMA 5LHIA 4F86A 4XLPF 2NRAC 4RTRA 2ZWVA 4EJTA 4BLWA 2QRVB 2EWNA 2FPOA 2OB1A 5ICCA 2O0YA 3KZYA 1AQIA 2IW5A 5CVJA 3NMUF 1U5TA 3V8JA 4R8HA 5GIPE 4GGGA 2O57A 1H9TA 5E9JA 4G6DA 5DUIA 1L3CA 5AIQA 3GFIA 3OFJA 5E2BA 2LF7A 1XN7A 1ZHFA 1FP2A 5FO5A 1ZKDA 5E1WA 2LF8A 3ELDA 5FLXK 1KQ9A 1TNSA 3G5LA 1G3TA 1RJFA 2JSCA 2ZZKA 2FNAA 1QQIA 3L09A 4FX0A 3KPVA 3VB2A 3R60A 1KPHA 2H00A 2XKPA 4GO1A 5LR6A 4A6EA 2M8EA 5L3DA 4KN7X 4P9UA 1RI4A 4CKEA 4Y17A 5CVUA 2QY6A 2ZW9A 3BGVA 1XSXA 3WTWC 1P39A 2GH1A 2DPUA 1WSUA 2BBYA 2IDJA 5DXAA 3C6MA 2FRHA 4LJZF 2DPMA 3EYYA 3V7CA 2LKPA 2W57A 1HW2A 1R00A 3HOTA 3HCAA 3NEUA 4PYQA 5DRTA 2OU2A 4PNEA 2PX4A 3CJNA 4GCVA 1SD4A 1M6EX 3NWBA 1W7PB 2JRTA 4Z2YA 3SHFA 2FK7A 3M8EA 1I4WA 3E3VA 3PQKA 2OAZA 3IHUA 4LLGF 2IVMA 3C7JA 2PX8A 4RTJA 3PVCA 3K9TA 4JQFA 1JG1A 2ZNYA 5KQSA 1YO5C 3CVOA 1H0MA 3CDHA 2NNYA 4GF5A 4RSRA 1QZYA 2BE5F 2P7CB 1H1DA 1FWZA 2JZYA 1K7AA 2M87A 3BWYA 3N4MA 1SMTA 2IPXA 2F5FA 2YX1A 1Z6TA 3EVCA 5K1YA 4CKCA 2YXLA 2P4WA 3LSTA 1QZZA 4WF2A 3CJRA 2NYUA 1JG3A 4A0XA 5GM2A 1QAOA 1XCVA 2HKOA 2F8LA 4IHSA 2M5WA 3KZZA 1J75A 3UWPA 1BC7C 5HDKA 3A25A 1XDUA 5EPEA 2DI3A 5FULA 1LEAA 2HWVA 4ER0A 4BHBA 1FX7A 1E17A 3KKZA 1OYWA 5CVVA 3E6MA 1XGSA 2B9EA 2XRNA 1WZNA 3MQ2A 3DPLC 4A12A 4G6QA 2B2CA 3K2ZA 4NECA 5CD1A 3B3JA 3KQTA 3WGGA 5K0NA 2EA2A 3OE4A 3WG9A 2MC3A 4P7KA 5DTMA 2D1HA 1HBXG 2EJTA 3KQWA 5GP1A 5DD4A 3KQMA 3KLNA 3N97A 3JTGA 3FTDA 1J5YA 3FRHA 5D5XB 3K69A 1Q0TA 1BKYA 1VL5A 1XB4A 1SD6A 4PYLA 1KYZA 1BI3A 5CCBA 2DFIA 5DX8A 4LK1F 1FT9A 1MD0A 1T39A 4P9FA 4E30A 5J8FA 4I7HA 4CWAA 3V7RA 4I0AA 3KEOA 4UXNA 3J7AO 2FEZA 5BS6A 3LKZA 4QDJA 1VPTA 2P8JA 3T7SA 3LECA 5U4XA 3OV8A 2EB7A 3MZYA 1LQ1A 2NNWB 1JQ3A 3EEYA 4R8RA 4RVDA 4AX8A 2H6CA 4LMYA 2DBBA 3LPMA 5E20A 3GF2A 4GQBA 4WXHA 1WG8A 2MLGA 3HHHA 3P9KA 1F3LA 4EQQA 3EMBA 2KRFA 3BDDA 2M45A 1XD7A 2R7DA 2L3DA 3LA2A 1S7AA 1P91A 2NXJA 1NBHA 2IIPA 3ID6C 3K1NA 3KETA 2P35A 2KJCA 1FYMA 2C7PA 2HEOA 3WGHA 4R8SA 3PFHA 5EQJB 1ZGAA 5FWDA 3CUQC 4AZVA 3VSEA 4B09A 3BY6A 1IUYA 2GAUA 4QTUB 3KLOA 3UJDA 3OU2A 2Q8KA 5A2QK 2HYFA 2P5KA 3GGDA 4GC9A 4WXCA 4AVPA 3GO4A 5EIFA 3EVGA 1I27A 3JW4A 2XYVA 1Q1HA 2ETHA 3EMDA 3O6BB 2XIGA 4Y30A 1JHHA 4GBED 4RS8A 3E5QA 1R22A 4M38A 3MTEA 3ML6A 2JJQA 3RODA 4JK1X 1KHHA 3LX6A 2LSOA 1U78A 3FPGA 4S05A 2NYXA 2JPBA 3QPTA 3LBYA 1LJ9A 3M6VA 3SFZA 3HEMA 4CYDA 2ERCA 3GRZA 3F23A 3BZ6A 4PYKA 2O0LA 3RYRA 4FR0A 3ZP5A 1FOKA 1QAQA 3HOSA 1F4KA 2PT6A 4PYJA 3CO6C 3V8VA 1S8NA 3G73A 2PLYA 1HKQA 1B9NA 3LDFA 3R3HA 1J59A 3IHTA 5D1HA 1SVUA 3EVFA 3KCCA 5GOZA 3L9FA 4EM0B 1V39A 4P5OA 3I0TA 2C6YA 2PMUA 2JG3A 2YQZA 3M6XA 3FMSA 4TV7A 2W84A 4RGUA 5H6RA 3TOBA 5E8RA 2QZ8A 2KJBA 1XGNA 1AQJA 3BPXA 3R0JA 3OFKA 1KA8A 3KPYA 1SFXA 2JHAA 5DCMB 3ELUA 3FZVA 4FSXA 1UWVA 2AOUB 2HYGD 2ZNZA 2I7CA 4I02A 5L3CA 2FK8A 5BQTA 1NW7A 4ZZLA 3TKYA 1BC5A 3EGVA 2DPDA 4HGZA 1U2WA 4GOMD 2K27A 3BKXA 2AR0A 4MTEA 2RQPA 1MJBA 2EJRA 4M36A 3THRA 3VYWA 1WQ2A 3OOPA 3ELYA 5IT3A 2PX2A 4U7BA 1FJXA 2O6GE 3G8BA 1ZAOA 2NXEA 1FP1D 2MH2A 2EV5A 2G70A 2AOUA 4LLNA 2STWA 5L3GA 4IXAA 1XCBA 4ESJA 4M9SA 2PLWA 2VDWA 3ERED 3J81Z 3VC2A 3Q9VA 3I64A 3JWIA 1B42A 5JFRA 5EMKA 1W5TA 4LK0F 3VOEA 1U2ZA 1VP9A 3HNRA 4CO8A 3DUWA 2EJUA 3KR9A 4ZYDA 1FBNA 1SKMA 2ZIGA 2YPRA 3L2CA 2ZO4A 2VT2A 3QP6A 2PWYA 5DD8A 5EC8A 3IKTA 4X60A 1Z05A 1GXPA 3HA5A 2AOWA 4R6WA 1H9GA 4GXOA 3R6TA 1T0FA 2OD5A 5LRSA 4EVIA 2MLKA 5K0JA 3ZN0A 4FHTA 2P3QA 5LGNA 5BOXA 4MQVA 3TOSA 2K4BA 2MD5A 2OZVA 4G9YA 3D0SA 2OQRA 3RKWA 3C6KA 5H6QA 4P96A 2Z99A 5JR3A 3UJAA 4HX4A 1YW7A 5KVAA 2JH9A 4E2WA 1UIRA 5ILUA 3KP4A 5LBQA 4F84A 1TQIA 3NW9A 2H27A 2P41A 3RW9A 3F3XA 3TO9A 5MHTA 2XAGA 3SVZA 2A14A 3A7EA 2YX4A 3PTAA 2GA2A 3Q5FA 3T7TA 2FYTA 2UXXA 5EVJA 5L3BA 1HQCA 3TO7A 4ESFA 3ORHA 4YV1A 1RJDA 5E18F 3JTHA 3R4KA 5DTQA 2ESRA 2P7HA 3TKAA 4KDPA 3WU0A 2CMHA 1SG9A 2I6GA 4ATNA 3FM3A 5HZMA 3ZMZA 2EK5A 1NW6A 1C0WA 4WX9A 1BOOA 2HGCA 1I1NA 3QOWA 3LCUA 4HF1A 4RTQA 2FU4A 1YQAA 3R9XB 1E2XA 1P1BA 1G6NA 3C18A 4A0YA 5K0EA 4OX9Y 1FY7A 4BHCA 2P6SA 4FX4A 4DMGA 3P7NA 4G7ZF 3VEPA 4WVLA 3GIWA 4KNYA 3HRUA 4OOIA 3S68A 3IRQA 3KP6A 2YX7A 1RUNA 4LB5A 2YSRA 5GINE 4HA8A 3RI4A 4RTPA 4MQ9F 4ER5A 1AF7A 2A3SA 3DULA 5EOVA 3TQNA 2UYCA 1D8KA 2STTA 1X3UA
chains in the Genus database with same CATH superfamily
4M3GA 1PJCA 1LDEA 2BBWA 4JYKA 3A1VA 4DEXA 4CEJB 2YWJA 4NDNE 2IHZA 1LWOA 2JIZD 2VXOA 4LV8B 1DBPA 1JKJA 3NEJA 3VISA 1GKKA 5F1KA 4YV2A 3WKEA 3ZQHA 1TGVA 1HYGA 2ZAYA 3ORSA 3NVKI 3SIRA 4YLYA 1JU9A 4JYBA 1XCLA 3QTTA 4O1MA 1R2QA 3BHJA 2IH4A 1K83J 2BL4A 4HDMA 4EV0A 4O5OA 3ZXYA 1QZXA 2H7YA 2CJWB 4U2EA 1V9CA 2GB4A 2R8OA 1QU2A 3S4YA 3JRFA 1AHIA 3MUOA 4OHRA 4K3UA 2ZMEC 2DQYA 3G2NA 1RHMA 4OIPF 5BWOA 4FK8A 1T0JB 1CJBA 5JNUA 4CLOA 3VAYA 4RZSA 4I5DA 1QGYA 4IDDA 3K0AA 3WGQA 4U3JB 1FW8A 2I0FA 2UYOA 1P3JA 1G7TA 3FUWA 5B1SA 1DG1G 2OGTA 2XE4A 4G4JA 5D3MB 1LDJA 2GN6A 2RGYA 4DR2B 4MO9A 3J7ZI 2OORC 3G0DA 2CFIA 3JSAA 3MYYA 1TZ2A 2VYNA 1N0UA 1CRQA 3BJMA 4A0RA 2CDRA 3WZLA 3DV8A 3H99A 1WEHA 1M6WA 2OCAA 1T8TA 3G6WA 2FW6A 4RB2C 2Q6KA 1MCZA 2VTDA 5K20A 1I4DD 3EVDA 4FMDB 3B1YA 2H09A 3HWX1 1E4YA 4KX5A 4ECAA 4WOCA 1ORWA 4QL3A 1JSZA 2CEKA 2J5PA 3DS8A 2A61A 4GPTA 1C0PA 1SBIA 1SWWA 1A5AB 2XZDA 4UCXA 2NO7A 3C8MA 1F1BA 5EJ5A 1T9GS 1FK8A 3I9MA 5J6XA 2BFAA 2ZRBA 3Q7TA 1GPYA 1BEZA 2OCPA 3W77A 1Y8RB 3K7EA 3GGJA 1RXYA 2ZUUA 4YRRA 2IBDA 2R8EA 3UJBA 2CHUA 2GAAA 3KT8A 3M9XA 2X0KA 4OHPA 3GHYA 4Q4CA 1PV2A 2IWHA 2ZJQF 3OEWA 5SZJA 4TKVB 2JI6A 8ABPA 2CDCA 1YO6A 3P9IA 1P4WA 1J07A 1SHUX 1UG0A 1V5GA 1KKLA 2G4CA 2GMWA 4QASA 1GCOA 3ROXA 4EG4A 4DJJA 3AWDA 2IUUA 4OI1A 3W6VA 2V59A 1T8SA 1JRLA 3DM9B 3W1EA 2I33A 1XAIA 5DM0A 2FHPA 2TMDA 4OWRB 1UH5A 2HLDA 2VLBA 4IO0A 1P1CA 3U7IA 2JGMA 2YR0A 4XQEA 1HEUA 4ZMRA 4E5KA 4MRNA 3PNBA 3EH2A 1SHLA 3TBKA 1U3VA 4OHXA 3UOAB 4LE1A 4NS1A 4DANA 4BNNA 3LA6A 2PM8A 5DYYA 1MU0A 2W98A 3PCRB 1E5LA 3G8DA 3RFUA 2IEBA 3ZQQA 3HA7A 4YAJA 4TSFD 1DVRA 5K0ZA 2I3DA 4JX5A 1VMAA 3I83A 1E3PA 4D26A 4LXYA 5LOVA 3NLLA 1CLUA 4CIYA 1QIJA 1GD1O 2JC3A 5HRUA 4HGOA 4LYDA 4ZDOA 3H4IA 4ZVPA 5K3SA 3IBYA 3NJ4A 3ZK7A 3O4RA 1TO2E 4N8EA 2EFOA 3IEPA 3L3BA 4P3NA 4AS3A 3IBSA 2F9LA 2I2DA 2EQAA 4UMEA 1DU0A 4ALNA 4BX0A 4YMIA 2RAPA 5BSWA 1G3WA 3L7JA 4ZRDA 4LFUA 3RS8A 3MJFA 2O4CA 4PZZA 1HF3A 4MWCA 2F5EA 3F9IA 3FOCA 3CIOA 1IXZA 4US1R 5F2NA 2TECE 5C35A 3TAHA 4B6PA 1OX5A 3RKSA 1FFDA 5LLQA 1H8ED 1G9SA 4CE6A 4L15A 3ZDDA 1OWNA 3LAPA 1VI5A 3VYRB 4V2IA 2BM1A 3G85A 3Q5DA 1ZGJA 4LG1A 4J94A 4OY3A 3LQ1A 4C0XA 4HY3A 4MWGA 1RZ3A 4KFCA 2XE7A 4FPXA 4TWZA 4U0YA 4C7KA 3EDRA 1L7RA 5ALTA 4JC8A 2Z3WA 1NI5A 4YRSA 2QPLA 3I28A 4U0VA 3P0HA 1HT3A 1EFDN 3CC7I 2MSYA 1RXVA 2HHLA 3EGDA 3ZQUA 1DKOA 2G77B 4DIKA 3K6SA 1HG0A 2HA5A 2YVAA 2OTJI 4CMIA 2HZTA 3TG2A 3GLIA 2ZROA 1ULYA 1I0LA 4BY7J 4JQYA 5BSTA 1XAHA 2B8TA 3GJ6A 1XTTA 1NVVR 3LZDA 4F21A 1WV1A 2KIFA 1B4AA 3QQPA 4TWIA 4MRAA 1IBMB 1A2KC 2FVXA 2FOLA 5DI3B 3PYMA 3WIUA 2GD2A 1N5RA 3MCTA 1K9SA 4LYYA 4DJFC 5SZKB 2JSPA 1LPMA 2EC5A 3TCNA 3O4FA 4BNGA 2Q0QA 1QIKA 5JHUA 1P2GA 4A3JJ 3OFVA 1U0EA 1MBEA 5IYBJ 1MMFB 1AB6A 3OM0A 3TD2A 4TV9A 4ZT4A 4YXFA 1EFVA 2PNFA 2O7OA 4RGXA 3P7MA 2V8OA 3ZCUA 4CG0A 1VBNA 4XRFA 3LS2A 1HMPA 3E58A 1O58A 4RFLA 1IV6A 1ZI8A 1QTIA 3Q7EA 3WKCA 4PPGA 3DVAB 2IODA 4XMYA 5BW4A 1KQOA 5LPNA 2OD9A 3Q2KA 1XWFA 3MN2A 4XUGB 3TPCA 1D4OA 4DDWA 5IT9K 3N0XA 1IL0A 3QLEA 3CVXA 1IONA 1OFTA 1DQNA 2AN5A 3H1AA 4QYWA 5BO5A 1PK9A 3ONVA 1FIUA 5EIAA 2VDUE 1W7PD 2GK4A 1QYCA 5LZ9A 1BL0A 5F7ZA 1Q1EA 4X41A 4FOTA 3MSXA 1R1TA 1K4MA 4BO0A 4PRKA 5ITZB 4LQDA 1ZONA 2DU8A 1NRWA 1GUZA 2P9BA 2DMNA 1SZPA 1ORHA 2VK8A 1JT6A 2HWKA 1J5XA 2VI6A 4NBVA 5BN3B 2HMTA 2Z58A 4ENWA 3VR3A 1PR3A 1NFQA 4DV0B 1R0LA 4D2IA 3L8FA 3OPMA 4E5PA 1XYYA 1CYEA 3ADKA 2KX7A 5IX8A 4AJIA 4A69C 4JI3B 3GT3A 3ANXA 2YXNA 3FOWA 3OF5A 4FGKA 3IMFA 4CU2A 1NMZA 2FPPB 2F8TA 1NXTA 3OTOB 1UHWA 3HA3A 1RM0A 5ER6A 2GTIA 2PL1A 1UWLA 1APLC 5LZ2A 4MGRA 3SIXA 2R1VB 4TM8A 4KVFA 1M7BA 4UHHA 5K6AC 1NUUA 1NXXA 2P2NA 3LTNC 1HFKA 4KIGA 3QYBA 3EVEA 3AVOA 3VTFA 4PPYA 1MIOA 2HY7A 1GL7A 5FUBA 7MHTA 3ETNA 3Q10A 1RIFA 4XIDA 3ZVNA 4DMKA 3GRCA 4E1BA 3CF6R 1U31A 4DCMA 3K32A 4XTCS 4ZO9A 4K9MA 3FUVA 3GUUA 2KMLA 3HJUA 1GRQA 2QSFX 3ZE6A 3CQZJ 2FPMA 3C3DA 2NW6A 1Z4OA 1UADA 4LC0A 1RESA 1OLUB 4MWOA 4Z2AA 4BV2A 3K4KA 1KFCB 1WF3A 3CC8A 2AFIE 4PWZA 2FUCA 3SHQA 1GNSA 4NZOA 5HOQA 3PFYA 2OG1A 3LT2A 4RVHA 4NBWA 3MLBA 3I73A 1EIZA 1ZGCA 1E66A 5IP7J 4EI7A 2HBYA 2WM3A 2IBTA 4I8IA 1WMSA 5M2QA 3H5AA 4BU1A 5FBWB 3PRYA 4DCSA 3LLUA 4PC1A 3EIUA 3IP4B 4YACA 1CHNA 4R31A 4FFNA 1TJYA 4KQGA 3L04A 2B1QA 3A3OA 4REQB 3RIYA 2BT4A 3GC6A 2ZSHB 3HWSA 1W6UA 4EG1A 2GYVA 5EFZA 2KL4A 3M07A 3UMVA 2QU7A 3SVTA 1LW7A 2L9VA 1ZG3A 2PKQP 1PZEA 3SHVA 2R00C 3AXSA 2VSFA 2Q0SA 1R4NB 1NT2A 3R5TA 4LCBA 5IHPA 2R5WA 1WSBA 2ZUTA 2P78A 3CJQA 2CW0F 4ENRA 4QTTB 3T38A 4NOJA 1R0XA 4DWJA 3G5AA 2RHTA 1AGXA 5H80A 1WDMA 3NHBA 3FNRA 3FNFA 2D62A 1II8B 4QZVA 2HJRA 2XPCA 4HNQA 1T6BY 2I10A 4J1QA 5CUQA 4P3KA 2GLOA 1HNNA 3V46A 5DBEX 3A6EA 4KQ6A 2W4IA 4L2IB 3AEKB 5ULLA 1FNSA 2NMVA 4FJ1A 5IRCD 1TJNA 2AMYA 1EZ1A 2XW6A 1MBGA 3TGNA 4BY1J 4AUMA 3WDMA 4O0MA 3AM3A 4FHFA 4UU1A 4F96A 5E4FA 5BSFA 2H5LA 2Y1WA 5KAPA 5FTKA 2HXOA 3DQPA 2Z16A 1CB7A 1AH2A 3LLSA 1DXHA 2B1IA 3URKA 4TRRA 1V16A 5KAFC 3TOXA 4BJ5A 2C59A 5F73A 1Z2DA 1T0FC 1FU7A 1KZ4A 1SQFA 3CT4A 2PXXA 4FZ3A 2G0NA 4HYYA 3UGKA 1TTQB 3DPTA 2BIFA 5DGIA 2OGZA 4C7JA 4UNIA 2EZ8A 2JZOA 2WUFA 2DA3A 3S93A 1B74A 4GI2A 3U44A 1EX1A 3FPEA 5FL7D 1NX6A 3B52X 4EMSA 5K05A 2FQXA 5JVGF 3V4LA 3EVBA 4B9AA 1Z63A 1LC3A 4JOCA 3SMVA 3V1KA 1A31A 4X85A 1HUQA 4CDMA 4FZJA 2GZ1A 1N5DA 5KSWB 2Q4DA 1P7PA 1ZLKA 2G0EA 1Z4JA 2HLNA 2CE7A 1NVUQ 1WXWA 4L8GA 4L9WA 4RD1A 2D45A 3HJBA 4TWAA 4LHYA 2Z6VA 2RI6A 2CXSA 3C3BA 5DEQA 1I8TA 3ULKA 3KUUA 4IPAA 2E7WA 2Y2ZA 3PJRA 3FVQA 2HTEA 3KZNA 3OI7A 1OCPA 3AC0A 2ZITA 2BCGY 1W4ZA 5SICE 3W5BA 3X2EA 2AMLA 1V7ZA 5JALA 3E6BA 4R9NA 1GFWA 1ZHHA 4Z53A 3G8AA 1U2PA 4RWEA 3C74A 2V26A 3V7UA 3DFMA 4ZAXA 1SU7A 4BYMA 1YTLA 4OQPA 5ILVA 1S1MA 1XZ8A 2XV4S 4GLLA 3ZGKA 1Y9ZA 2BVLA 5K3OA 1YS1X 1O3SA 4UVGA 5KJFA 4DA4A 1Y3IA 3QOYA 3SQOA 5H16A 1VHWA 3RYFA 3U2RA 3HCNA 1ZVQA 4QPZA 5M5WJ 4MWSA 3NRBA 4FDAA 3GJXC 3IXQA 5CB8A 1TUEA 4QOEA 4WK4B 1QRSA 2XJ4A 4AX4A 4E13A 5GPCA 4EUNA 1XZDA 2R8XA 2DLLA 4BDSA 1WZ2A 2YJTD 2VYCA 3OHMA 4EGYA 5GAGJ 4JHXA 2O0KA 2JLXA 1EJ6A 4XIJA 2XA1A 4BX8A 2JNWA 3LVQE 4X7PA 1Y63A 3BB4A 2BGTA 1Q74A 5EHZA 2WHXA 5TQ2B 5CDSA 3FB1A 2ZUCA 2EBUA 2CYAA 2XWJI 2Q9UA 6ADHA 3SQLA 3KEGA 3FYTA 1KVTA 4JLWA 1K79A 2OCGA 1YD7A 4MS3A 4XTRA 4IKOA 1WF6A 5DNYB 1OXVA 2D5VA 5HSGA 3AY0A 3F4KA 2QSHX 3ABMH 2C92A 4LYHA 5E2AA 2EP8A 5EE3A 2LBFA 2WIDA 3ICOA 3N39C 4B46A 5IBCA 3P9RA 4BHTA 4AY5A 1NVXQ 1ADCA 2VQLA 3AL0B 3TLZA 1WY7A 3TEFA 3QKWA 1TYDE 3FXRA 5C7IO 1JR4A 1VKJA 2QGFA 3C0KA 2MR6A 3OD5A 3U4HA 4ARUA 5U4QA 4FFVA 4BLWA 1SH7A 2OP1A 1I5RA 3PPYA 2XT9A 5ICCA 1AQIA 4BKXA 1THGA 1W36C 4BO2A 1M2VA 3IXMA 1TUBA 4D81A 4FLMA 1J0XO 1DPFA 1VGQA 3DUFA 1L6RA 1DJNA 1N2GA 1P74A 4AJ2A 3LUCA 5FPKA 2XKPA 2IZ0A 4A6EA 4D99A 1BWPA 4MP8A 2IYNA 3PD7A 3IPYA 1MX5A 8OHMA 5D51S 2QY6A 1ZLXA 1CZNA 4KGVA 2CNWA 1YCGA 3QUQA 1PHPA 3MSCA 3KALA 4Y2RA 4D3SA 1R49A 2VJJA 3CH6A 4B3IA 2ZRMA 4OM7A 3RSSA 3CJRB 5LD2C 2JIPA 1SBYA 3VR4H 2B8JA 1FWZA 3CW8X 1OAOA 2VAXA 4WOBA 2YY5A 1TQHA 3W8NA 2VA9A 1MMDA 4P36A 1BJRE 5JD4A 5F23A 1X1EA 1HOTA 2ODWA 2OV1A 1A5JA 5HKBA 4IUBS 2ZRCA 3C85A 3H8VA 3F5SA 2DH5A 3P9YA 3EC2A 3ZBQA 1B8NA 2H06A 3OT4A 5CK5A 5DTMA 2PO5A 3DT6A 5D5HA 5IAJA 1V96A 4J07A 3R0VA 2QL7A 1RQGA 1MUUA 3X43A 5TEWA 1H2FA 3CV3A 4MVCA 4R1LA 1IZ0A 3QXHA 1YK1A 3V7FA 1VPTA 5DV9A 1WABA 4UVHA 3MZYA 3PIOF 2H6CA 4WXHA 2LRDA 3FBNB 2A5LA 5KDOA 3WGUA 4ZYUA 4PTZA 5B7PA 1FYMA 4YY3B 1WM1A 2H1HA 2TMKA 2GAUA 4P5EA 1T9BA 4GC9A 3GLHE 2ACEA 4AVPA 4UD6A 2P2DA 3R1IA 5HTKA 5ALJA 3EMDA 1KRHA 3TBHA 2DPXA 3OQNA 4M38A 5BNGA 5HUHA 1QV6A 1Y5MA 4NCXA 2JPBA 3QPTA 1EXMA 1KI9A 3BR2A 4MR9A 1C3VA 3AR4A 2X4IA 3BZ6A 2GI4A 3A6FA 3MKZA 4IMPA 5DOZA 3G73A 3H3FA 4YAOA 4BKMA 4PJMA 3E4CA 1OT5A 4EKDA 2FEAA 5LP6A 3QJYA 1BQ3A 4HRXA 1CXZA 3WGOA 1Z47A 5IMBA 1KA8A 3KPYA 2RHRA 2BKUA 3D3EA 2PXHA 2WQ7A 3ZDYB 2HYGD 2ZNZA 1B1CA 2I7CA 2N46A 1Y1QA 4Q3OA 4BZWA 2P91A 2K27A 3A1SA 3BKXA 1ONBA 2PIAA 1N0VC 1BJKA 1VPWA 2JLZA 2DWQA 3DMPA 4B35A 2PX2A 4HUQA 3GBSA 2WSMA 1FP1D 4GE3A 2DC1A 4G63A 3JRIA 2STWA 2CJYA 4FFPA 4R1UA 4IFBA 3C5VA 1ZK3A 3BD7A 3QZUA 3HR8A 3F3MA 1M8GA 2BHRA 1FBNA 4O2AF 2ZO4A 2VT2A 2L9SA 5I6DA 2O5EA 4ZQCB 1I01A 1XKQA 1Y3HA 4JHLA 2NOJB 2AOWA 1J2TA 2HN9A 1GYQA 2ZIXA 4PLCA 1XN1A 2WAAA 1NKTA 4GXOA 3GCXA 4CF4A 4ZTZB 2AMJA 3IAHA 2ZE6A 1RRPA 3U7FB 1RTTA 1XDDA 4DGSA 2OQRA 2WY8Q 3URMA 5JAHA 2BFBB 1YW7A 3ISTA 5F9FA 2X41A 3RVNA 3IAEA 1U7ZA 3R7BA 2IPLA 3VHXB 5NLLA 5TSDA 2ICAA 2YYZA 4QRIA 5E18F 3VR2D 3PO2J 2GGSA 1QOZA 4YCLA 1W5AA 4AZ3B 2GXSA 3DW3X 1L4GA 3N2IA 1OVGA 2NU7B 2O0HA 2WSSA 1XLTA 2VAWA 5LMNB 2QTFA 1PLJA 1P1BA 2RONA 3I2FA 1DAFA 1EH5A 1DTSA 2CLDX 3WGZA 4XLCA 1KO1A 5DI9A 4G7ZF 3CRW1 3MUFA 1R5ID 3MTAA 2YX7A 1VMEA 3DEIA 1CUDA 3RI4A 3MTQA 4BGIA 1PTJC 1OX4A 3FXOA 2X1CA 4RA2A 3N8KA 2M7BA 5BW6B 3K09A 3W1WA 4D4JA 3TSZA 4K6GA 2C31A 4O6VA 1P4HA 2AC4A 4J6FA 2AA3A 2J9GA 4I2OA 4DR7B 3FMQA 2W6JD 2X0RA 3NI2A 3NM6B 2E5WA 4WKBA 4FSDA 3CMCO 3NYQA 1RWNA 2M98A 3RHFA 1JXQA 1TWFJ 5JVTA 4DG9A 3DHYA 2JIOA 4A93J 5GTDA 5H4HA 4AF8A 5LM3A 2CUTA 1GVNB 1JHMA 2XGGA 4A3LJ 3CUUA 5DH9A 4EVQA 3GD7A 4N8DA 5H7XA 4EH1A 4FTWA 5HX7A 2WZBA 2ZPAA 2VT6A 1Z6XA 3WZ2A 2CG4A 1VQ4I 3QH4A 3VOAA 5DV5A 1SVMA 1VYTA 2KW5A 3SGLA 2X8WA 3ED1A 1SVKA 1LFAA 3SLRA 3PX3A 1PLKA 2CY0A 2B63J 3ORFA 1L4BA 1BI1A 1ELOA 4EUSA 1P19A 4I2NA 2YJGA 4CCSA 4ZAWA 1JIJA 2XHZA 1Z28A 4IIJB 4AYXA 2WE8A 3UF0A 4YCNA 3F4LA 3RZOJ 1SK9A 1F36A 3JAMA 1K8YB 3BFVA 4JX9A 4L7VA 1C3JA 4P7GA 3UENA 1KZGB 3M7IA 2ZSDA 2EV6A 3KFLA 1C7EA 1UDCA 3DD5A 3ZS9A 1P6XA 1IDYA 3E7FA 4ZC8A 2PMZA 4NFSA 1JG6A 5J1UA 4DYVA 4S1VA 5COQA 2VJDA 4H6PA 4CQNA 2FW1A 5FFXA 3OYEA 4HDKA 5HK9A 1KEVA 4RK0A 1RRKA 5F2OA 1UJNA 3X1MA 1Z8FA 3LH5A 3GFSA 3LF2A 2XTNA 1PR0A 4QOFA 2RHHA 2YVQA 2E7XA 1TK9A 3MWJA 5JT1A 1XJQA 1X1SA 3A2MA 4X1IA 4Y3OA 3SC3A 5IK2D 1MC4A 2JA5J 2OC6A 4YRAA 3QKRA 1A95A 4YP6A 1KHTA 3AM4A 3RKRA 1ZNWA 3U4IA 5JD5A 3TZKA 2REXB 4A0FA 2WHQA 5D7NA 2J08A 1SULA 4DN6A 1QP0A 4YPVA 4BVBA 3UK2A 2EVWX 5CT4A 4B6QA 4JVNA 2R85A 4X61A 2Q6OA 1Z2AA 4GOND 1MTOA 3PRHA 3EXG1 2AOXA 4HB4A 4GUDA 4OUDB 1XZAA 5AVQA 1HR0B 3KC2A 1W4CA 3O3CA 3NB0A 3AUYA 5K8LA 1AB5A 1W4RA 4BO5A 1R9GA 1HYHA 2J5BA 4CM1A 1H42A 3KYLA 3IUMA 3BIWA 4FYYA 1W19A 2C9CA 4Q93A 1NQXA 3WLIA 1U2DA 2TDXA 3M49A 4XCQA 2FSUA 2IT1A 1O3QA 3E3MA 5ESRA 2HWYA 2VE8A 3U3RA 3F3KA 1EM6A 5CPRB 1RWQA 2Q1XA 4LYAA 2M8GX 3NTLA 1W49A 1LBIA 3CO7C 2ZWPA 1CHDA 4JODA 2CVPA 4C06A 3H1CA 4HOBA 4DBLC 3NAQA 3ER6A 4G37A 1T8WA 5D5QA 3FAKA 2VF7A 1EUYA 1V8BA 2V58A 2VWGA 3M6AA 2BKXA 4YTEA 3WYBA 1P0MA 2C4HA 3TTWA 2I1VB 2RI1A 5CIYA 4RAGA 1C7ZA 3RJPA 1GCAA 3E2MA 5CVDA 1ZRDA 4YIRX 1ZOLA 1T9ZA 3GY0A 2BAGA 2OBLA 2C7GA 1UK7A 1GG9A 3KUDA 5THXA 2VTKA 5KOHB 1TVEA 1D5CA 2Z4TA 1KAQA 1W5SA 3COZA 2I6UA 1F9AA 5I9IA 2BFFB 2J4CA 2HSEA 3UBMA 1FRVA 1JAIA 2GVZC 5ED0A 1JLKA 4JJEA 1FUIA 1WXFA 2BSQA 3WQBA 3CZAA 1SQ5A 4L5CA 2HKXA 3O3NB 1O6BA 2XWQA 2V7UA 3EOZA 4A0HA 3W90A 4UZEA 1W87A 3HL2A 4DOZA 3A6PC 4HEHA 2V7EA 4GM1A 1ESZA 4X64B 1QG0A 4NNJA 3WBBA 1USUA 2Y6UA 2UZ4A 4V0LA 3SEQA 3ZZUA 3LT0A 1E2QA 1JR2A 4EWLA 1Z7EA 8ATCA 4JT8A 5EUQB 2A9OA 2WV9A 4LHVA 3T7AA 1EB9A 1Q50A 2Z98A 3QEOA 5DT9A 3LA7A 3GFGA 1L7AA 2F2TA 3ZQ6A 4FYJA 2QUBA 3NG1A 3KKLA 3NT4A 2Z30A 1PL6A 1D5WA 1VE3A 2RGUA 3QNMA 2CLOB 2YNMC 1U7WA 4OJQA 3T3OA 2O8FA 2VUHB 2FLWA 4ZYHA 2BMJA 3THYA 2EFNA 1JKJB 3V2GA 1NG9A 3WO1A 5ELXA 2FE4A 1PYDA 4LBZA 4X71A 3U3KA 3CLRD 3WLQA 1JKXA 5T67A 1AWCA 2XCOA 4QBHA 4OQDA 3WTSC 1P9RA 5CBKA 1Z0KA 1LBSA 4EZEA 4ID9A 1V2HE 5ALIA 5JJIA 1TK2A 4DMUB 5FWXA 5T6MA 1I32A 3U39A 1GT91 2A57A 5J23A 4DKJA 2VYFA 3GLFE 1A0OA 2E4WA 4RBOA 5CYFA 2I76A 1OIVA 5K8VA 1CKEA 1UBFA 4JUDX 2JLYA 2OB2A 4B47A 3P2EA 5KNDA 2FBKA 4CLOB 2FZLA 2KRCA 1KOFA 3OESA 1RKQA 3TZQA 2G1AA 3K6RA 4RH3A 2G17A 2Z3VA 2IBSA 4UEKA 1M34E 3HYLA 1KETA 5FEMA 3F2IA 3QVOA 2HSGA 4ZOEA 3R7SA 2R86A 1ECGA 3CRQA 3BXGA 3M6FA 1OXSC 4H7HA 1JDVA 4RKFA 1ECCA 1S2GA 1Q92A 5E3LA 1ISIA 2O7SA 2ZT8A 4YRPA 2NVOA 3UB3A 1RI3A 1Q1ZA 1OCOH 4Q1DA 2QY9A 2JH3A 5A9TA 3AFNA 5HBGA 2Z4RA 3F96A 2CMFA 1EXWA 2PDAA 1JVSA 2R1TB 2E89A 5JFOA 1Z67A 4ZVQA 4TWJA 4UUSA 1KS2A 2OV6A 1N0HA 3FHTA 5B2ZA 3V80A 3HB4X 4LV5B 4AIHA 4J2HA 4H0NA 1JUDA 2PU5A 5JASA 4Q66C 3VSLA 2QLNA 3W2WA 1QHXA 3IEIA 1NC1A 2OO3A 2PUCA 5BPDA 1OILA 3BCUA 3G5UA 3DR3A 1PVDA 3W1VA 1OGYA 1I10A 3CNLA 2QROA 3T5GA 2YFQA 2XLBA 1PJTA 2YFHA 3Q0EA 1LJUA 4F71A 2Q3BA 1P60A 4NCJA 2PGXA 4BNDB 3QEKA 1TCVA 2P1ZA 3HGTA 2DLCX 2OK7A 1X1BA 2FW8A 4IDQA 3QFCA 2APJA 4M9CA 4HN9A 1KR2A 4QXRA 3KPJA 4MHSA 2IYXA 3QMVA 2J46A 4WKPA 1KU7A 5LNK6 1EH7A 2XUHA 1ZOOA 1FVHA 3M1YA 2I7DA 2FWAA 3PG5A 4F92B 1NUTA 3P0FA 4O0LA 1VIAA 5JYEA 1NVEA 4XD7D 2JGKA 1Z7GA 3GGSA 5CLSA 3FSGD 2CN1A 3PFIA 4P7FA 1GQQA 5B7GA 1HKTA 3AR9A 5FI1B 4QUGA 2NQ2C 1Y1KE 1KMIY 4MV4A 3A1YA 3MUNA 5JAMA 3CZQA 1GLNA 3F9RA 1PNOA 3SAJA 2OAEA 2ILVA 2R4TA 2KPMA 1LA2A 1D1PA 2FDXA 3R4VA 4OHVA 3S15J 3S44A 1Q0PA 2XSZA 1IXSB 1IN8A 2B4RO 3S2GA 2EJVA 1RWPA 3OMWA 2ZYIA 6REQA 3V34A 4RIEA 1FDSA 1RRGA 4QEKA 3HS3A 1LWNA 1Z9CA 1H8HD 1T8UA 2A4MA 2E85A 1WVRA 2BGJA 3B9RA 4IINA 4DZRA 1NW8A 3DVRX 5B1HA 5JHFA 1ZARA 4ZYWA 4BB5A 2NV2B 4M0CA 3SX0A 1P4XA 2WZQA 1MOQA 5AW8A 3IV6A 4DBLE 4JJ6A 1U9IC 4ENMA 1YDFA 1BGXT 3HRKA 4AYWA 3E22A 3V8NA 3KJFA 3ISPA 5DSTA 1I3KA 3ZHBA 5CT9A 3N76A 3K6SB 5C1OA 4LGWA 3MK31 4R2KA 2AFHA 3K9NA 1LFPA 2UWMA 2DA6A 4QUIA 3NWOA 4LYJA 4DIDA 3I6IA 5H20A 1PJ8A 2QPOA 2HU5A 2NADA 2PRZA 2W6ID 2HJGA 3E23A 3I6BA 4NE2A 3DCFA 2R7AA 2ATVA 1D0YA 1E8NA 3G2HA 1CF7A 4JJ7A 1LE8B 1EK2A 3G71I 1WJDA 1ZLJA 1LK0A 3MJ4A 4NMWA 2ZVPX 4X20B 5KVSA 5BMOA 4QTXA 5G40A 2G1KA 1GZUA 3EAGA 1M2WA 3QPVA 5IXYA 3KUKA 3TECE 3ZCSA 1NI4B 4CIBA 2EP5A 5CTJA 3F6YA 2K9QA 4Q4HA 4BXFA 2GZDA 3P32A 3MBOA 3V55A 4LBVA 2XOKD 2L02A 4MVJH 5JECA 2FJPA 3ABKH 4PG5A 4IX1A 3C8ZA 4TV9B 1JFLA 3ZLBA 4WY5A 4XXHA 1TZLA 4KN4X 1QWSA 4KRXA 1P0CA 2P6UA 4Q21A 3COVA 4XM2A 4G9GA 4YECA 3O1IC 4BLQA 3VH2A 3K9CA 3VDRA 1QZTA 3GX4X 3P1JA 3JWGA 3HUFA 3FF1A 3K1YA 1E2NA 1T38A 3MCAA 1H94A 1E3EA 4L72A 2QQ0A 1WCXA 4RZQA 4ZVUA 4QDKA 3W2IA 4EENA 1NN5A 2GHRA 3MUEA 3HXMA 4ZYGA 3ZD8A 1S02A 2QL9A 2XQFA 2XXAA 3AP2A 1S01A 2LVSA 1T6YA 4L18B 2P2CA 4Q34A 2WF7A 2VKEA 3O83A 3IX7A 4F12A 4LOHA 5I7RA 4Y13A 4PU0A 1LTHR 5A6VA 1UBEA 1HEIA 2JAPA 1GAEO 1E4EA 2XROA 1R6DA 4AT1A 1YKSA 1ZMRA 2QRPA 3WTCA 2XQVA 4EKIA 3R9WA 1LBHA 1PWHA 4MI3A 1CUJA 3FFXA 3PQ2A 3UICA 1R15A 3HFJA 4WFKA 4XDYA 2UUPA 1GAWA 3R0XA 4X1YB 4DA9A 2B69A 4Q9JA 1TFUA 4CUJA 1UXIA 3UJ9A 3B12A 4JQOA 1E3HA 1T5IA 1AV7A 1F48A 2CXQA 1P18A 2FWJA 4RV4A 1EA5A 2ZR8A 3F6VA 4CBVA 2EINH 5CLIA 3ECSA 1U5TB 3TQRA 2JFWA 3OQOA 2HVSA 4NYIQ 3VUEA 4CV1A 3NCHA 1Y1SA 4J7AA 4I7EA 1MIOB 1EVJA 2F4IA 3PFKA 2CB0A 1DC7A 2ELHA 1DPUA 2XX3A 2O48X 4XLPF 4CYMA 3E8MA 3GW8A 1ZRNA 1MJNA 3PRJA 1EVZA 1EXVA 3I3LA 1IM5A 1H9TA 3INGA 4XNFA 1D07A 2C3YA 1LPQA 3OZBA 4AWAA 4Q03A 4NK4A 4RM3A 4TMXA 5FLXK 2JSCA 4ODIA 3WK4A 4YV7A 1TTPB 2JJ1A 3L09A 4GO1A 1CFZA 3H75A 4NNPA 2O5CA 4BWVA 1E2IA 2J41A 1M5UA 1SCIA 4P9UA 2QZ9A 3EFOA 3FMVA 1MVLA 4NFYA 1HE5A 3FHNA 3CD6I 2BPOA 3VR6A 3T9EA 1AKNA 3PVCA 3NETA 1QCYA 4JLOA 1D6SA 2IIVA 3CO5A 3VPBA 1RZRA 4YJ2F 3ONWA 1YO5C 1SVLA 2GCEA 4HB2A 2BE5F 2JIBA 4Q9HA 4MPPA 4S2EA 4AY6A 4KLNA 3HV2A 3HDGA 1MB0A 4Z4QA 3TX6A 1NBAA 4WAUA 3EZLA 2O5RA 2I4LA 2B9SA 2GXAA 2JBAA 1I6HJ 4IHSA 1LZLA 4GP9A 3ROQA 1ST2A 1E3IA 2C4WA 5JZSA 5K0NA 3UC5A 3OE4A 3FWKA 1A35A 2DMRA 1YQGA 4P7KA 2D1HA 4WERA 5AW9A 3Q9UA 3EARA 1Q0TA 3VGPA 4PYLA 1XB4A 1PZMA 5DX8A 1T08B 1JL3A 2BFDB 1MH1A 2VRCD 3TOZA 2YWRA 3CJQB 3LECA 5U4XA 2YMPA 1LQ1A 1JKIA 1JTXA 1M76A 1UMDA 2AEMA 3D6NB 1F3LA 4O59O 3WP0A 4GX5A 3V5NA 1OLOA 2HCTA 3ID6C 1FP4B 1HSZA 4UM5A 2AJCA 3PFHA 3EOBI 5HP4A 2CS3A 1F8GA 1BZYA 2PBRA 5J4KA 3GP8A 1A5SB 3SFVA 4AFNA 3HM5A 5G1OA 1GNRA 3M89A 1B23P 1E7RA 4FONA 1T10A 5I9NA 2WJJA 2PTGA 2OHGA 4XARA 3WHCA 4ERXA 1DRJA 3FKQA 2GILA 3KOMA 1RYDA 2C2XA 3LX6A 3FPGA 5HRAA 1RADA 3GZJA 4B3CA 1BW6A 3UT5A 1BYIA 4V0NA 4YCBA 3I04M 3AERB 2C2ZA 1RBYA 2B35A 3DEJA 3RYRA 1SU6A 2QX9A 2P77A 4Y2PA 3WL3A 4ZQIA 4LE0A 1A3CA 1T2NA 2G7ZA 1EUZA 2A33A 2GBFA 1V16B 1RMYA 3WK7A 4AYBA 2SCUA 3GDGA 5HRCA 3JRGA 2UUBB 3ZGVA 2D1YA 1C9KA 2JLBA 5CXSA 3HH8A 2QNBA 3LLVA 3Q9LA 5JHHB 1CZHA 1JG7A 3ETJA 4BRWA 1RIIA 3S16J 2AJBA 3QENA 3ZNOA 4UUOA 5B5EC 3VYUB 1T9AA 3ELYA 4U7BA 5LCXA 4P9NA 3U44B 1PWEA 3CINA 4ITUA 1EGQA 2D4HA 5IS2A 3CP8A 2VDWA 3ICEA 4NSNA 3ERED 4WN3A 1XPUA 3LPLA 5K8JB 4GMKA 2QRUA 4GNRA 5FV4A 5JSZA 4CO8A 2HF7A 2EJUA 4PRYA 4UASA 2GNOA 1MNQA 5G4KB 1R6XA 2OK8A 1E2GA 3CCBA 3EBPA 2JW5A 3TVYA 1F20A 4G5QA 4E4YA 3TUIC 3TUJC 2HNBA 3AY7A 1O97C 2UVPB 2JFVA 1SXIA 2AJDA 4MQVA 1CG6A 1RMTA 3TEJA 2JFGA 1MEJA 2QF7A 1NMYA 1K0UA 1UR5A 2Q1YA 3MA0A 2UVQA 2W82A 1K6MA 1T8YA 2YX4A 3VU1A 5FOQA 3TTVA 3TO7A 1ZN7A 1XQ9A 3L93A 1USGA 4HT3B 3LSGA 3F49S 4WSOA 3P2OA 3QVWA 4JJKA 4AJ1A 1X6VA 3GV0A 3KO8A 2JLVA 4N9WA 1M2GA 2PE5A 4BFCA 2PZFA 3QWBA 3K0HA 1HQYE 1S3GA 1FY7A 2W8BB 4FX4A 3HLKA 3RYFB 3VEPA 4KNYA 3H0GJ 1L7XA 2GD1O 3E18A 3V2HA 2A2ZA 1MQ8B 2VJOA 3GDWA 4HQNA 3M3PA 5LWHA 3EXEB 1Z77A 4Y9RA 3VYVA 1V1RA 2GCGA 4L22A 2KB0A 2O2HA 1LJ8A 4IGIA 2GZWA 3Q5EA 3PICA 3I12A 3CEAA 5AKKA 2XPVA 4XFKA 4P98A 5JDIC 1I6LA 3PNQA 4QIWN 3PL1A 4WXYB 2IU4A 1CUUA 3PWZA 2WD7A 4KMUX 2R2AA 1R5GA 1LLUA 3VU8A 2FSWA 3L02A 4ZOBA 5JXWA 3K16A 1OIXA 5C8YF 2HF8A 1COZA 3NEAA 4LJYA 4M8LA 2DTEA 1YUBA 3MRXA 1UWCA 1JALA 3BFPA 4WZAE 5LBIA 2AXLA 4P1WA 2RQQA 3GRUA 4HR7A 4CZZA 2K87A 4AO7A 2CV0A 2OAP1 1AUQA 1E5TA 4N7BA 1ZUNA 4BEBA 2EG5A 1PV1A 5C1DA 3AI2A 1UBSB 2JCGA 3LY9A 5ELMA 1SEPA 3LI2A 2ASEA 1XI2A 2DCMA 2FZCA 2YU3A 2IZOA 2QEXI 3GLSA 2H11A 2XRYA 1MGTA 1UMKA 4R2XA 2CNBA 2DO7A 3T15A 3G2QA 1M2VB 4URWR 4BFSA 4H35A 1QP8A 1EK0A 4B4KA 1YJCA 5JVDA 1X1RA 3BROA 2NAZA 3DUFB 1IUNA 3S1AA 4N12A 4B2IA 1LDMA 3FZGA 4NAHA 1ZNYA 1HDRA 4ON0A 1GNVA 4MMYB 4BB6A 4K8RB 1HZZC 3AKEA 1AXRA 1P31A 3F3SA 4UVAA 3P2YA 3BXFA 4G5YA 2ZTMA 1PZXA 4ND7A 3WTYC 4UNQA 3I6ZA 4LVNA 1JU3A 2Y9YA 3O8BA 4QODA 3IT2A 1JHZA 3TLJA 4DIEA 3A26A 1WP4A 3OJFA 2Y2UA 1U7TA 4KVZA 5ED4A 3HKEA 1QZEA 1WD5A 3G0CA 1E77A 1CUEA 4FE7A 2QD2A 1JFSA 2Z08A 1R6RA 4CXMA 4BOYA 3O4JA 5K6AA 4OIMA 1G1AA 3PQDA 2H0RA 5EG5A 2C3MA 4R7GA 2XCTB 3PK0A 2VODA 1SEUA 3OKFA 4UNOA 5JY6A 4S04A 1JHQA 4JWKA 4O2AA 4KXNA 2ACJA 1HORA 2W2VA 3AGQA 1JPNA 4R54A 3NHUA 4UVEA 1A7KA 3ROFA 3QRFF 2C4VA 3WL7A 1UXGA 3IAS6 5JAOA 2E5FA 3KP2A 2HTFA 3IKJA 4KQJA 4GZ6A 1NF3A 4UVDA 1PQUA 2XTJA 3R5KA 4YDHB 3D8NA 2XTAA 2I9PA 3F73A 1TNDA 3CLTD 5JS1A 5HVQC 2ODEA 1H2HA 1P7ZA 4MTLA 1DG3A 4C7BA 2EBIA 5EIBC 3KQOA 2XBMA 3FGNA 1G42A 3RRJA 4C3UA 1E1NA 1V43A 1KDVA 1G4UR 3RU9A 1T5LA 4IZHA 4LKRA 1SBZA 5F1JA 3GROA 2A7QA 1O7JA 2PX3A 2YN0A 1ZIOA 2ENUA 3C7AA 1CUCA 2VCHA 3BZBA 3WQQA 4ESEA 2E2HJ 1Q44A 1A8IA 1OPXA 5I5GA 2W42A 4MV1A 4P80A 3ZS8A 1ZKMA 2IPAB 4BO6A 5KJEA 3L00A 4YJFA 2P40A 1K6YA 2IYRA 3G4SI 4MR9B 4POOA 3AJ9A 4ABTA 1AZSC 4JKYA 4C22A 4QHSA 4ZICA 1GTZA 3N8GA 2ZBPA 2XUJA 4QUHA 1HC7A 1RCFA 3PUJA 3RAGA 1CVIA 2CMKA 3E3LA 4RPHA 3NM5A 3OZAA 5B30A 2R00A 4FNAA 5DF1A 4C5AA 2X2PA 4H7DA 2KYRA 1TU3A 4RY8A 1RPWA 3G1UA 3NDBB 1QIHA 2IX9A 1E6CA 5GJBA 2JLQA 1HTTA 2R97A 3AB8A 5AM3A 4R6XA 4GPIB 2OMEA 2G08A 2NUTA 5BQFA 1ID1A 3EXHA 4Y2GA 1CY2A 5L45A 1B93A 4HUQB 2JL1A 4IRGA 2LRHA 1DKLA 1WXIA 1KYTA 2AMVA 2WILA 4OAQA 3RIRA 4JI8B 3Q98A 4GR4A 1F2TA 1R9JA 1VG9B 3QODA 4MHOA 4EATA 4ZI7F 2WYOA 4EYOA 1FJLA 1N1EA 1MBKA 4L4YA 3EW9A 4IR7A 2H0QA 1CIVA 2B78A 4E7JA 2GEKA 4Q4JA 4LN1A 4QT0A 4RLFA 2JFZA 4D8YA 2BGRA 4CNQA 1ZRFA 1TYEB 3C98A 4YIIA 1PI3A 5FH9A 5KNBA 4Z4EA 2ZIXB 4A3DJ 3LBNA 4KAJA 2VBZA 3AVUA 5DK6A 5TPWB 2PS3A 2ADMA 2Z95A 3LY8A 3GAMA 3ZHTA 1LS1A 1Z5UA 3D3NA 3GCDA 4D4MA 1TEZA 1G5TA 2JARA 2RH5A 4G0NA 1ZIPA 4P4SB 4QDUA 2Q4EA 2P0YA 4PZLA 5I7OA 1MQAA 2IXDA 2WU1A 1G5PA 4PICA 4M8KA 3UJ3X 1BU8A 3V6MA 3M5CA 3A58B 1IUKA 5JCPA 1QIFA 3D0RA 1DADA 1ZGBA 5DGCA 5D84A 2PG4A 3T7JA 2DXIA 3KT6A 2G4VA 2XUKA 2OILA 5D4SA 4W9NC 1UBHS 4P8RA 2NX2A 3SMQA 4QOHA 1OX4B 2ZUSA 4CMAA 1Y6QA 4B82A 2CL6X 5AVZA 4PNPA 3IHLA 2Q5QA 2X5NA 2WJVA 1XWIA 5TRTA 1P2FA 2P0AA 2OZPA 2VF4X 3PFGA 2Z8ZA 2BH2A 1LB2A 3HBNA 3WTTC 4COKA 2PQMA 2UZ0A 3OUTA 3AR2A 3ECOA 1MXFA 4DEVA 4YMGA 4UAGA 2TRTA 1KOLA 4EB0A 1DJQA 2OHOA 4MVYA 3O8OA 1V45E 3OOJA 2B98A 4BS9A 2X1MA 3DDNA 1KBOA 5AXCA 1QORA 4XGIA 2TMYA 2Z3YA 3AW9A 3KEYA 4TT3A 4GD3Q 2GYYA 4WEOA 5DB4A 4WZBA 1BXKA 3B1WA 4R16A 4D9NA 4IOCF 4V2GA 1OV4A 1RZUA 4F9FA 2W83A 1NWHA 2YHSA 4H77A 1EVLA 3OEED 1RQ2A 1CUBA 3PPVA 1CBUA 1NVKA 3PXCX 5IM5A 2OZUA 2CL0X 2OV2A 4PQYA 2ZYRA 4XR9A 3B3GA 3FGPA 2K7LA 2WJGA 4CQMD 5BVGA 2X1HA 3GLGB 5BWBA 1YVPA 1SCUA 3FWHA 4REMA 1IV8A 2LY9A 4MWZA 1U5BA 2NU8A 1KONA 2WJYA 4B74A 2F1JA 2Z8YA 3BQNB 3J7AC 1T4GA 3NHRA 3G49A 2G83A 4Q3EA 4PLTA 3CA8A 2DR3A 3I2IA 4LI0A 4ZQGA 3TRDA 1Q15A 2JA1A 3NBXX 2PSFA 3T1OA 2MMGA 2V6BA 2FFBA 1SHJA 4QBIA 4BMOB 4U2GA 4AIDA 2RREA 2WVHA 3DKRA 2OEPA 1QRAA 1SOWA 4HLCA 3RH0A 2RHJA 1HL3A 5CB0A 1VJDA 4WCFB 4ZOQI 4HDKB 1GGNA 3H4TA 2IW1A 4AMYA 1XZEA 3N2GA 1BEEA 3D02A 1LFDB 2OHJA 1WNFA 2B94A 2PJZA 4EB6B 4X1IB 4IHTA 4CCAA 1YKFA 4OA8A 2GZ3A 4RHEA 1TUIA 2K86A 4MDYA 2G40A 1N9KA 1VJTA 2MIIA 3KOZA 1BVRA 1KOJA 2IUFA 5B64A 3AKZA 2CYYA 2DKFA 4RTMA 2IP1A 2FD5A 2Q4TA 3ZLVA 3A1NA 2Z5GA 5K6RA 1TCCA 1X2MA 3WRWA 3STYA 4YP9A 3M6UA 2IF2A 2ZETA 4MP3A 4WY2A 1XC5A 4DRZA 3S1SA 2FPXA 4GH5A 3K0FA 3U48A 1G4HA 3TFOA 1QYRA 4QA9A 4BFLA 1C1DA 4K6FA 4M22A 2FF4A 5BYBA 3C7CB 3H2YA 1L5QA 1ZIYA 1UJ8A 3RS2A 2DWOA 1KQNA 2QLMA 4DLUA 4OSOA 4FASD 2XCUA 1GPNA 4G25A 2CJXA 1ES9A 1E92A 1HG1A 5HJ5A 1K92A 2EWVA 2XB5A 3OMYA 4CTOA 1FP7A 2Q27A 2QVYX 3GBVA 3N8NA 4RVGA 1NYTA 1NTRA 2FPWA 3U19A 2HOEA 2B5VA 1IN1A 3CKYA 3ZPLA 2HDHA 2BY4A 3U62A 2GRAA 1KK2A 3RS5A 3N07A 5M29A 3GFJA 3SFTA 1VXRA 1W1UA 2B20A 4J0KA 4W1SA 2WC1A 4Y98A 3T4PA 3QKUA 4L0ZB 1ZGZA 4FSHA 1D3YA 4NMXB 3USZA 2CGEA 3WG7H 3JWEA 3TPZA 4K1LA 5ES3A 3OHSX 4NYJR 1ISGA 1NU8A 3SG0A 1KVSA 4IIFA 5K7HA 5DHUA 4QFCA 4ZU1X 2XTZA 4AY3A 1WMDA 2ATCA 3WI7A 3KEQA 4WE3A 1C9MA 2W85A 1CDDA 1UUFA 3D3JA 4HWKA 2OKCA 1A04A 5HNFA 2L54A 1Z91A 3CTPA 2FX3A 2V7VA 3FOFC 2EGUA 3NBZC 4U7DA 3BTIA 3DZKA 4RVOA 3HJEA 1C4KA 1EP9A 4B6FA 4DDKA 3QA3E 2VXCA 4ZIRA 3SNHA 5GVSA 1XMOB 1T3SA 2PKXA 4NH0A 2B30A 4RULA 2CYBA 4D82A 3UQYS 1FSGA 5ALEA 1UBJS 5GAHJ 1EDOA 3AGPA 3DOEA 3LHDA 1CQJB 1HA8A 3V7WA 3I0MA 5DM60 5AONA 3FAZA 2PXAA 4WI1A 2I03A 3WS7A 1HURA 1X2EA 3SKVA 4AJLA 3GFTA 5IT0A 2EGGA 4QU9A 3BH0A 5K0SA 2C61A 3IIJA 2HOAA 3M1CA 3BFKA 4GP7A 1G8KA 2Q9BA 1GWNA 4WA7A 2O8FB 2L7MP 2A58A 1FBTA 3BGIA 3L4BC 2R4UA 1EM8A 4KSBA 3THYB 3BLYA 1RP7A 3NWEA 3WX0A 1DXYA 4NU0A 3R5HA 3LHSA 1I3MA 2F1OA 3THOA 1F1ZA 1GZ4A 1VI2A 2PBZA 1JXMA 2QSYA 1IJKA 5D2CA 2H3HA 2DQ4A 3V9AA 2BLLA 4IOAF 1XU7A 3EW7A 5EKSA 1DC3A 1G9TA 1VRWA 4K9NA 1EJBA 3C7TA 2D59A 2E1NA 4KUEA 5FWXB 1QIIA 4UVCA 2L0KA 1B16A 1FOEB 4W5QA 1TF2A 4CZCA 1A5TA 3OCVA 2VK2A 1WCV1 5KMGA 5JD3A 2PQ8A 2ADUA 2I55A 3L0SA 1Z5WA 3C3AA 4B83A 4TLEA 1NVWQ 3QI2A 3JAMZ 2RDMA 3I9V2 2ZXFA 3MG9A 3BCBA 2B2NA 2BFMA 2Y05A 1VHDA 3AU9A 3RVKA 2KKOA 3RBAA 4MXDA 3HVKA 4DQLA 2KBEA 2Q3HA 4FINA 3ZKWA 1GGMA 1BHQ1 3NHAA 3E3AA 1H6CA 1KDTA 2HIHA 5EIWA 2VKDA 4DCPA 5D86A 1ODIA 4FDVA 1MABA 1KNQA 3QU9A 4URHA 5K01A 5IVIA 2QBYA 3HHGA 5JUWA 2P4QA 3F8MA 4PZCA 3KE9A 1X94A 2DK8A 3A3PA 2QZ4A 5TE9A 4C0LA 3JWJA 5JTTA 1BTOA 2GUWA 1ZLYA 4QUBA 1HDDC 1TQ8A 2X8JB 1FEXA 4OYLA 5IUNC 4RTLA 5HIKA 1ISJA 2WU0A 4BFUA 3L8MA 3HSYA 1RETA 4X91A 4EW3A 4R4JA 5TS3A 5AVYA 3ENNA 4GOXA 1C1XA 4R8KA 1QVTA 3HACA 1WZEA 5AUOB 3FF4A 5CH3A 3KR0A 4D9BA 1L3BA 1PSZA 1DKUA 1C9NA 3A6DA 2CGPA 1G0OA 4JCCA 2NZJA 2ZWVA 1IQ0A 4LS3A 4R8HA 5JC1A 1PFUA 1OXTA 3LXXA 1PJ3A 1XKTA 1XELA 3KWFA 1ZHFA 1FP2A 4NEHB 1ZKDA 4B84A 4HX5A 4HRVA 4LXTA 5KC9A 1H1LB 4FX0A 2FN8A 3R60A 1SOAA 3LDHA 1WNTA 2M8EA 2DDAA 1G20E 5JIBA 4RACA 4M1QA 4R7ZA 1VSQA 3WOVA 3B2NA 4K5QA 4Z2YA 1L4YA 4OD0A 1QPIA 3R77A 5KTOA 3EWSA 1GNTA 2BHLA 2JGDA 4WKGA 3CVOA 2P7CB 2DWPA 3FXMA 1VKNA 2O8EB 3C2HA 2F5FA 2HQBA 1QH1A 1TXGA 3EVCA 1O87A 4IZ6A 2AIRA 3TL2A 4JMLA 4WNAA 1HRKA 1K4TA 2IRWA 3A25A 1QO0A 3HEAA 2FDCA 3JYPA 1Y7LA 2BFEA 1GV1A 5CD1A 4LOKA 4AK9A 3WG9A 2QTLA 4TXNA 4CPDA 3PQCA 1AO3A 3KQMA 3PF9A 4L27A 1GRVA 3Q3CA 1KYZA 4DILA 1VM6A 2VUSA 4JVMA 4CWAA 1APBA 3A31A 4B7AA 1AMNA 2EB7A 4MR8A 2VRNA 3LPMA 5CFMA 4RKQA 4GQBA 4MVJM 2IOHA 1F60A 2GPAA 4EFKA 1IU9A 1B0AA 1GGFA 5CNMA 5KYKA 4ND8B 5FD8A 2IIPA 4XDZA 3V8QA 2ZRDA 1CR0A 5CPBA 3NHPA 2GEDA 1VF9A 2D8MA 1H2BA 1T91A 5G0UA 1A8UA 2B82A 3L7CA 3F2VA 2EFDB 2BKVA 4MGKR 2JJ7A 3E9NA 2LBPA 2PKQO 1JFFA 4BU2A 1JPVA 4UFPA 5JATA 1GKUB 4ISBA 1Y3AA 3JALA 1EVQA 1TKBA 5ALLA 2JCBA 4MWEA 1RKBA 2GM9A 1H9BA 3LP5A 3G9XA 4RKYA 3S81A 3LC2O 1U8BA 1H3FA 1T1IA 4PYJA 5LKRA 3IVGA 4EQ6A