3P9IA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and sinapaldehyde
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 116
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9iA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9iA02
1QO0D 3LFKA 1G4DA 3JWGA 4H0EA 3HCBA 5FD5A 3V8LA 5F1RA 3T1BA 3HCEA 4DCMA 3GFJA 2FEZA 3GEZA 5LHHA 4UV8A 3FTFA 2QLZA 3L2CA 3T5XA 3GX4X 4P58A 4MIKA 3DEUA 4YMHA 1NBHA 3WGGA 2ZMEB 5GINE 4EKIA 5E8JA 4FSDA 1SUSA 4AZTA 5JFRA 5D5XB 2ZZMA 5LQRA 4HLYA 1SUIA 1NT2A 5D6FA 2LD4A 5CCBA 2P8TA 4PYLA 5LQAA 3E3VA 3ECOA 3LKZA 5FHQA 2GWRA 2UZKA 3GZ6A 3GDHA 2IPXA 1S7OA 2FOKA 3CJNA 1VL5A 1G60A 2P7HA 5AIQA 1TPYA 3G2PA 3NVMB 1ZLJA 3LA7A 3G2QA 5FHRA 3TM5A 4YIIA 1HSTA 3OPNA 3KZYA 3R3HA 4DQ2A 1R7JA 4ER6A 2DO7A 1BBYA 4AVPA 3T8RA 4ESFA 1DL5A 5GIPE 1N2XA 3KQYA 1KU9A 4P9FA 3BWMA 2FK7A 4FSXA 1Z1DA 5FO5A 2D2WA 3I54A 5DSTA 2QWWA 1H1DA 4ZZLA 1R00A 3HYIA 1L1EA 4RGRA 3FXQA 3ISPA 2VBZA 1WKMA 2A6EF 1F9NA 2N47A 2KJCA 1J9IA 2P40A 5JVTA 3V97A 2OZVA 3VC2A 2AOVA 3ULQB 5DM1A 3MZYA 2UYHA 2PT9A 3M4XA 4KT5C 5FWAA 3GNLA 3UJ7A 1BC8C 2NYXA 2P5VA 4FGZA 3OFJA 5P8WA 1U5TA 3KLNA 3VSEA 3PLAE 4I01A 3E8SA 5FB2A 2P6TA 4LG0B 1R23A 3WTUC 4PYIA 1MHTA 5KVAA 5DD8A 5E18F 4RYLA 3FRIA 4RVGA 1QPMA 2NP7A 3PT9A 2EV6A 5CVVA 5K01A 2OO3A 3LBYA 1T98A 1YG2A 4A6DA 4OA5A 3CGGA 2HWKA 3SXYA 1BI1A 2JH8A 1YS7A 2OA4A 4FT8A 4O6JA 4EM0B 1RI3A 3HTUA 1WZNA 2LDUA 1SAXA 4G7OF 3HIFA 4ESJA 1MZBA 4CHUA 1FBNA 1XDZA 4HF2A 3D2LA 1Z91A 3MEXA 5E9QA 1LB2A 5DCMA 3EMBA 3GFIA 2DT5A 3FYDA 3C3YA 4PNEA 2OU2A 3RTRA 3TMAA 2IT0A 1RUOA 2V7EA 1XB4A 4MTLA 5EKXA 1S7AA 1XCLA 2FMYA 1J0RA 4OMZA 1IN5A 3E6MA 4ENJA 1XGMA 3SGLA 1U78A 3OZSA 4YMGA 4YUXA 5C1IA 1KXZA 1L9KA 3HP7A 3JWIA 2H6BA 4WXHA 2OXTA 2KIFA 1QAOA 3E6BA 3KU1A 3ELWA 2A3SA 5K0BA 1EG2A 1OYWA 1S6LA 5L3GA 3BUSA 2GXBA 2PMHA 2AOWA 2G7HA 1PJZA 5GOZA 4KFCA 4LECA 3ER8A 3JWJA 3S2WA 4LK1F 3ECHA 3R6TA 1XGNA 2ZULA 5CLSA 3THSA 2ZLBA 4F85A 2EA2A 3SVZA 3LECA 2XVCA 2QRVB 4NECA 1MD0A 1HMYA 1X19A 1VPTA 4GEKA 1QANA 2P7VB 2IPQX 2JG3A 2PV0A 4O5VA 3Q87B 3DPTA 5KQRA 2JZYA 4IRGA 2O61A 2G70A 5JR3A 4HZFA 3EVGA 4ZTBA 5K09A 2E1CA 3QOWA 3QOPA 2XAHA 4OBWA 4U7TB 1K78A 3T7RA 1RNLA 4MTEA 2Y0MA 6PAXA 4A0ZA 2GS9A 2FXAA 2RC4A 3I64A 5A2QK 2XROA 4QVGA 5FQNA 5HDNA 1U5TB 3V7RA 1M6EX 4QPPA 5EC8A 3K6RA 3KPJA 1YFJA 4PINA 1WXXA 2FNPA 3UJCA 2DU9A 1BI3A 3NVKI 4Q5SF 1SFUA 2NS0A 1BI0A 2QBYA 1I5ZA 2R6ZA 2CQKA 1I1GA 2COMA 1ZG5A 1JG4A 5EEHA 2HTEA 3P71T 4PCLA 5L3CA 3LAJA 2YVLA 3IHUA 3KFWX 5LEJA 5BPIA 3NRVA 5E1ZB 4TV7A 3B7PA 3KR9A 5E1WA 3IWFA 4OQDA 2M45A 4K6MA 3M9AA 1V4RA 3MGGA 3CC8A 5ICGA 1TQMA 2LF8A 2M8EA 4ESBA 1OPCA 2V79A 3GFLA 3KPVA 4IKPA 4AUKA 3FPJA 3LGAA 3WTXC 3FPGA 4OX9Y 1B42A 1ZRCA 1FOKA 3FMRA 4PWYA 2EJRA 3E23A 4R6WA 3TKAA 2ZBKA 2GIVA 5CJ9A 3VOEA 4ZYDA 3I5UA 2V1DA 4KIGA 3RKYA 1ON2A 3ELYA 1WRJA 4CZZA 4RB3C 3I9FA 2D1HA 5CD1A 3X0DA 2P4WA 3C0KA 3Q9SA 2QE6A 3E05A 3I59A 1GXQA 4AIHA 2CL5A 1G38A 3BJ6A 3BOQA 3BWCA 3CUQB 1USSA 2WC2A 1REPC 3WU1B 1E2XA 1NV8A 4RTRA 5E2AA 3G88A 4HC4A 5ICCA 1P92A 5KK1A 3O4FA 5E1MA 2JPBA 2HTSA 4ENMA 4EQQA 3GVAA 1X1AA 5E8IA 1KPHA 1FYKA 5GM1A 1R8XA 5E17F 3WTYC 2FBIA 2XV4S 4Y15A 3KP3A 3FWEA 5D5VB 3DR5A 5F64A 1XXLA 4R8HA 3SSOA 3ZMUA 3BGDA 4G9YA 4ENKA 1KQ0A 3LAPA 5H02A 2PSSA 1WY7A 1BN5A 2A61A 4IRIA 5K03A 2RV8A 4PCAA 3AXTA 1K79A 3L7WA 1KA8A 3MCTA 4WX9A 4M37A 2ZXJA 4PYKA 2KRFA 2CW0F 4HA8A 1G55A 3C7JA 3EPPA 2MD5A 3CLOA 3RIEA 4IHSA 1AV6A 5DM0A 3HVHA 1JHHA 3IRQA 4EVIA 3RIRA 1ORHA 4BYYA 5DTMA 1P4XA 4CXFA 4LWOA 1LDJA 1VBFA 1PP7U 5FWDA 4P7FA 4MGRA 1XTPA 4HGYA 1D5VA 4FS8A 1YW8A 3JWHA 2Y48A 1OR8A 4PIMA 2ZBPA 3H3ZA 3TM4A 2O8XA 3ERCA 1XJ5A 4N0BA 3SR4A 3FX3A 4MNUA 3SSMA 2Y1WA 4KDCA 3I4PA 1L3BA 3MQ2A 5EZSA 2VDUE 3N4MA 4MHGA 3ZQ7A 1P91A 1G6NA 1R18A 4YFXF 3G89A 3OU7A 1RJDA 4HAMA 3R24A 2F2EA 3P9KA 5HDGA 1F4KA 3AWIA 5FULA 1XSXA 2MH2A 2PJDA 4L9JA 1FT9A 4EK9A 5EHGA 3GZ5A 3ROUA 5T64A 3MB5A 2DW4A 1BKYA 3QPHA 1R1VA 1QZYA 2BH2A 2JHCA 5G02A 4G8XA 1XVAA 3C1DA 1ZREA 3BROA 3NWBA 4DKJA 3WTSC 3HCDA 5F2NA 2GB4A 3B3GA 4H0NA 4UOEA 1YUBA 3HSFA 3GGDA 4JBAA 4C06A 1O3SA 3HA3A 4M6YA 1XDSA 2X0LA 4BXUA 3CBGA 1P4WA 1JQEA 3JAMZ 3BKXA 5LEKA 4KUMA 4U0VA 5E1XA 3H3UA 3M7GA 4RV9A 2BGCA 4L18B 3E97A 2G9WA 1P4AA 1MJAA 4U0YA 3ZPLA 5U4XA 1YS6A 1HSJA 2H11A 2CMHA 1YF3A 5E20A 1Z7UA 5ILUA 2H00A 1DCTA 4G94A 4RTOA 4Y17A 4M7RA 3C3PA 4M71A 1WSUA 2W57A 1MKMA 1ZN2A 2DI3A 3R4KA 3SHFA 3HHHA 1FC3A 1O3RA 3HVJA 1Z6TA 3UFBA 2FSWA 1ZG1A 1SMTA 3VFZA 4DMGA 3BZ6A 2XKOA 5HIMA 2YU3A 3AAFA 3DMFA 3KQPA 2VT3A 3GLXA 5DPMA 1FBQA 2EB7A 4B09A 3EQLF 4ON0A 3I59B 5LRSA 4RSRA 4RVHA 4HW0A 2ISZA 4IVNA 3G73A 5K0JA 3TOSA 1LNWA 4KIBA 3A25A 1B59A 3I0TA 3WGIA 2G72A 2JHAA 1R6AA 4GOLD 4RTMA 1Z6RA 2G8NA 4M9XA 1KGSA 4KICA 2HKXA 4XUDA 4O29A 1BM9A 1XDUA 2AOTB 5JUWA 2LF7A 2A69F 3K1MA 4GBED 3OV8A 3KLOA 3DULA 3N97A 2P6SA 3RPQA 1I1SA 2PBIA 1TQPA 1R36A 4ZYHA 5D8LB 3SZTA 1JHFA 3BWBA 2CWEA 2A5YB 1FPQA 2D1VA 3NQOA 1XMKA 1ONVA 5IT3A 3P9NA 5LQCA 5E9WA 2P7CB 1YTYA 2FYTA 2NNNA 4LWPA 1F5TA 2Z9OA 4U7BA 2V1XA 1IXSB 4HX4A 5DM2A 5DD4A 4XUCA 1IN4A 1FNNA 1YW7A 2DK5A 2ADUA 3NJRA 1O9HA 3GRZA 5F2KA 1T6SA 2Z3YA 1KU7A 2JHPA 4M38A 4RX1A 2JRTA 4HRAA 1SD7A 5FA5A 1SFXA 4YIFA 4PGHA 3UA4A 3BJAA 5D6EA 1NW3A 2NNYA 5BOXA 3ZN0A 2JT1A 4EM1A 3TRKA 2VP3A 3D5LA 1LDKB 4UVAA 4I2OA 3LA2A 1IAWA 3EVAA 5MHTA 5EOVA 1U2ZA 3U1DA 3FZVA 1BC7C 1UHWA 3GW2A 3PFGA 2K7LA 3FUUA 3U9GA 4RB1A 3ABUA 3EVDA 4S04A 2EV5A 1INLA 3G8AA 1MJBA 1RI7A 2F8LA 3DQVC 1JXSA 1UFKA 1LVAA 3K0BA 3P9IA 1RI5A 2V1UA 2RGVA 3DMGA 1XGSA 4HTFA 3NDJA 5DM4A 1IUYA 5DRYA 2DK8A 4XSZF 4EGYA 1QQIA 2XUBA 3GWZA 3RYPA 4QDJA 4QLCU 2P3QA 1H9GA 3ME5A 3BY6A 4YUZA 2PG4A 1BOOA 2HNKA 2IIPA 3D0SA 1O57A 4CTJA 1P1CA 4OQEA 3KEOA 3T7TA 1UB9A 3PFHA 1Z3CA 5K0CA 1XN7A 5KVRA 3EYIA 2A14A 3BWGA 4MEYF 3HOTA 2CSOA 2OB1A 3EVEA 1SD6A 4L7VA 3UJ9A 2ZFWA 2DPMA 4C07A 2FK8A 5EKUA 4UVBA 4MTDA 5HLIA 4HQMA 3K9TA 2VBXA 4LMYA 3WE2A 2V74B 4P96A 1O3QA 2D45A 3BP8A 2KIUA 4LGWA 3FUWA 5EMJA 3ELDA 4E2WA 4I09A 1IXKA 1TW2A 2XKPA 3ANXA 3OOPA 3UA3A 1WI9A 2OD5A 2CKDA 3FUTA 1F1ZA 5LQJA 4UHTA 4PONA 3UJDA 3DMHA 2AR0A 2NXNA 3EDPA 2IBSA 3SZPA 3HCAA 4BP1A 4RAZA 4WF2A 3KQVA 4QQKA 4EJOA 3PQKA 1D2HA 2DPDA 3EVZA 2XAGA 2E7WA 4M9SA 1Y8CA 5HLHA 5B1SA 3MZHA 3LCUA 3R0QA 4M74A 3L09A 4L0ZB 4MQ4A 3TQSA 2BR4A 1FSEA 4DF3A 5HEKA 4E2YA 5DDGA 3EMDA 2FF4A 3MAJA 3VB2A 5LRRA 1LEBA 1EH7A 1DP7P 3RDIA 3A26A 2EJTA 1ZRFA 3DLIA 2PVCA 4LJZF 3A7EA 3GO5A 2HV9A 4LG0A 2FU4A 1QAQA 2FPOA 2AOUA 4F86A 4X61A 5BW5A 2X4HA 3E5UA 1YZHA 4BHBA 1VP9A 3MAGA 2OYRA 2IA0A 2QYOA 4YUVA 2BM8A 2P3LA 1S3JA 1EIZA 3G7UA 1P39A 2IDKA 5K0NA 3A7DA 3SSNA 1JTEA 1AOYA 3ID6C 4KW7A 2M1BA 2IW5A 3A4TA 4Y2HA 1XD7A 4M72A 3RI4A 1S8NA 3OZRA 4HSGA 4U0WA 1TNSA 1XCBA 3KCCA 2PX2A 3AXSA 3F8MA 3DOUA 3ABTA 2W24A 2BEOA 2QY6A 2B3TA 3TO7A 2VS1A 2YR2A 2XYRA 3DPLC 5F2OA 3HVKA 2C7PA 3ZMSA 1XMAA 4HOBA 5DSXA 4Q47A 3FUXA 4QTUB 3KQSA 3LDFA 4X63A 1CF7A 1T0FA 2PX8A 1YB2A 2QM3A 3WU0A 2IJLA 1HKSA 3U2RA 3B02A 3KPYA 4CKCA 4BH9A 1IY9A 2EFWA 5HS9A 1OR7A 1ODDA 3QU6A 2YUIA 5HIIA 3WTVC 3EGEA 4PYOA 4AIKA 2AXLA 2AOTA 2PEXA 4A6EA 2YX1A 1P1BA 4C4AA 2C7QA 4KYWA 2L4MA 4DNCA 5A2QZ 1E17A 1KQ9A 4XBFA 5DX8A 1XSDA 5HLGA 1KPGA 2ZSUA 4KWCA 4P9UA 3C6KA 2LSOA 2L4AA 2P35A 2AN4A 4NHJA 5KS2A 3HA7A 2BZGA 4A5NA 4PZJA 2DBBA 4E2XA 4OU0A 2QUFA 5ERIA 3NW9A 5D1NA 3HA5A 2ZNYA 4RGXA 4BLWA 3FPFA 2VXZA 3ZP5A 5FFXA 5DXAA 4R8SA 3FXRA 3I58A 2HQRA 5D1HA 2DTRA 3FXUA 1ZLKA 1FY7A 1W5SA 2VDWA 1X1CA 4IXAA 5FUBA 2PT6A 1X1DA 4M73A 4XSXF 1PUEE 1D8KA 2B9EA 2ZBQA 1ON1A 1OYYA 5GP1A 1UFMA 4OBXA 5DT2A 3JSOA 2ORED 4GGGA 5CVJA 2E7XA 3F6OA 1JG2A 2B2CA 2PGXA 3LKDA 4EJWA 2OPBA 1I27A 5ILSA 2VE8A 3B5IA 3GRYA 4NB5A 3CCFA 1KR5A 4LK0F 5LR6A 5CUQA 1P6RA 1V3FA 4A2UA 5FGMA 2Z99A 1VIDA 1IXRC 1Z9CA 4HYEA 1AWCA 2HDCA 2Z6QA 1DDNA 3PB3A 1FBSA 2ZKZA 2WK1A 3HCFA 4KDPA 2O3FA 5CVDA 5DX0A 1D8JA 3GU3A 4HX7A 4LB5A 3ZMVA 1KHHA 4KVZA 3IWZA 4QTTB 3OZTA 1B9MA 3EGIA 4KA4A 1RI1A 1MDMA 5BS6A 1QYRA 4QVKA 4N9IA 1UWVA 1L3IA 5CVRA 3KP7A 1H9TA 4YFNF 1WG8A 1HKTA 3UBTA 3E5QA 4QPNA 5K0EA 2QQAA 4WK8F 5HIKA 4RS8A 5LBQA 4HV5A 3RKXA 3MTEA 3WTWC 3PX2A 5K05A 1ZYRF 3VC1A 3HVIA 4K2EA 3W6KB 1WQ2A 2BV6A 3P2EA 2AN3A 1TNTA 1FYLA 4FT2A 2R7DA 3DTNA 4L5IA 5BW4A 3QP6A 1IN8A 4D0PA 2QRVA 2UXNA 4X1OA 3T0IA 2I6GA 4YV0A 4OIRF 4RB2C 4B17A 5K0LA 2VOOA 4GYIA 4I0BA 2VT2A 2STTA 1JSZA 3DP7A 3F21A 2PXXA 3FUVA 2AVNA 1NW8A 3BDDA 3O3KA 4KIFA 4YUYA 2UYOA 2Y1XA 2VBYA 2L02A 5FLXZ 2UZ4A 2CMGA 4V0RA 3HSEA 3HRTA 2QBYB 1O54A 4KN4X 4XRFA 2RDPA 1TQIA 4PYNA 1CGPA 2BBYA 2HQNA 4BHPA 3R61A 2EFQA 1BIBA 1KQ8A 4P5OA 1FYMA 2YXEA 4Z2YA 4X41A 2YSRA 3S68A 4E32A 3V7SA 3SQNA 3KPUA 2J5PA 2ADMA 3COAC 3TOAA 4E2ZA 1DPRA 3F3XA 4LB6B 3TGNA 1YO5C 1KYWA 3T0YA 3VODA 3CO7C 4WWCA 3ERED 3GJYA 4EGZA 4WVLA 4G56A 2VZ9A 3G5TA 3KQOA 2XAFA 3EETA 1V39A 1AQJA 3O6BB 3G5LA 2AOUB 4ASNA 2GA1A 5K8VA 2IH5A 3ZMTA 2C6YA 4QWQA 5AONA 2YTZA 2FA5A 2HWVA 2HYFA 4A0YA 4FT4A 4PIPA 1R5GA 1G3WA 1JR4A 4R8RA 1IW7F 1R1UA 3CJTA 5HZMA 1IXCA 1ZRDA 3WTZA 2YX4A 3DUWA 3GO4A 2CO5A 2K27A 5IT9Z 1VLMA 2XGXA 4LG1A 3P7NA 4FX0A 2BYVE 1C0WA 1HQCA 3T8TA 3ELUA 1U2WA 2MLGA 3CDHA 3DXZA 5DXJA 2CGPA 3DF8A 4PYMA 5EGSA 2XVMA 4DQ0A 4FX4A 1U5TC 1Q0SA 2H94A 3TQNA 5DTRA 2Z33A 3NTVA 1MJFA 1SD5A 3P8ZA 5F6FA 5HOOA 3V8KA 2FCAA 3PTAA 2XIGA 5IKMA 3O2PE 3V8VA 3U81A 5LHIA 3SM3A 1FX7A 2G1PA 2YQZA 1TLHB 4CICA 4Y30A 3BGVA 3TOBA 1UIRA 1WXWA 2O07A 4EJTA 3NEUA 4G6DA 2OAZA 4HF0A 4U7DA 2K4JA 2R3SA 5TRDA 3DXYA 5E1BA 5BP7A 3C3WA 4GF5A 4BY9E 5LGTA 5K1YA 1Y0UA 4AD9A 3RYRA 3H92A 3DFGA 4ETSA 2HGCA 3BZBA 5DTQA 4C05A 4HDVA 1K78B 2ZFUA 4HTFB 2MH9A 3FPHA 2QQ9A 3LPMA 2YXDA 3L9FA 2VN2A 3E7PA 5EPEA 3WTTC 2VBWA 1ZQ9A 3P97A 3FMQA 4MEXF 3B89A 4RTPA 2LKPA 3KETA 4V0QA 1D2GA 3MHTA 1K7AA 3FTDA 1KPIA 3KR2A 2GXGA 2ZIGA 2IH2A 2O0YA 4I7HA 1ORIA 5E2BA 1B6AA 5FA8A 4JXJA 4M9ZA 2PI0A 5EQJB 2PXCA 3F8BA 2AS5F 1W4MA 3OFKA 3TDZC 4CXMA 4R1HA 2OB2A 3KHKA 3P2IA 1KU2A 4U88A 4R05A 5IH3A 1MJ9A 1AQIA 3M6UA 3NWEA 2GA2A 1LQ1A 5DX1A 3TR6A 4KMFA 2PBFA 1IN7A 2PMUA 1LDDA 1O3TA 3EEYA 4M36A 4EKGA 4IV0A 2B25A 5EMKA 3QP5A 2Q41A 1AF7A 3IKVA 4QDKA 3EGVA 2O05A 4ZH4F 4ZYGA 4LLNA 4RVDA 5BXYA 8MHTA 3E6CC 2ZNZA 3TO9A 1DPUA 1BHJA 4HQEA 3RKWA 1NHAA 4HF1A 5TJJA 4N9HA 2AZTA 3WE3A 4P7GA 5GIOE 2ZWAA 2KJBA 2NRAC 1EJ0A 2ZBRA 5DWQA 1YZ3A 1TBXA 5HFJA 2H6CA 2DQRA 2OBPA 2XAQA 2FHPA 2JPCA 4RGSA 1T2KA 3CTAA 1ULYA 3RODA 5ILVA 3HOSA 5FCDA 1FSHA 2GH1A 2Y75A 3BPXA 3VEPA 1H0MA 2RKHA 4I98B 3QV2A 4HLXA 2W85A 3DV8A 1G8SA 5BQTA 2H1RA 4IWNA 5BMZA 2F5CA 2UXXA 2F5FA 2A68F 2XBMA 3P2KA 1W7PA 4MHTA 3THRA 3EVCA 1SQFA 4BHCA 2XAJA 1VTNC 4YUWA 5HOQA 4C04A 2K4BA 2P3OA 1JQ3A 4RAYA 2RVCA 3QRFF 3V4GA 2EX4A 3F23A 5ERGB 1HW5A 4IV8A 5K0FA 2HOEA 3PS9A 1NW5A 2IA1A 4RTJA 2HMYB 2G71A 5JI6A 3LCCA 2G7UA 1N7JA 1O7FA 2QZ8A 4LLGF 4GO1A 3QPTA 3LSTA 3MWMA 2AOXA 4QQNA 3FPEA 2WA1A 4BP3A 3HTXA 1I1NA 1N7IA 2DULA 3QOXA 4GOND 3F8CA 3HRSA 2AVDA 2FE3A 2ZW9A 2NP6A 3OCJA 5C0OE 1L3CA 4ER5A 3PX3A 1M6YA 1YQAA 3HSRA 1U3EM 1IZ1A 1PP8F 1ZARA 5LQKA 3K1PA 3GYHX 1RJGA 4YV1A 3TFWA 3DXJF 3LHDA 1ZHFA 2WWYA 2JJQA 1IF1A 1OYIA 3G3ZA 3R0AA 2XHKA 4CDGA 1DUXC 2NXEA 3QU3A 3J80Z 3CJQA 1HW1A 5E1DA 4OOIA 4JK1X 2KW5A 2PJPA 4FP9A 3FTCA 2OY0A 5DCFA 3EVFA 1B4AA 3EVBA 4PCQA 3MERA 4I0AA 3VYWA 3IRRA 2K4MA 5LQNA 3FMSA 5T67A 5HVQC 1XCVA 3MFKA 10MHA 4X60A 3M6XA 2VONA 5K5QA 1G3SA 1IN6A 2OBFA 5KQSA 1RZ4A 1J5YA 2EFJA 4B8XA 2K86A 2P5LC 4AZSA 3TDUC 1ZG3A 2FQ3A 2EFOA 5DEQA 2C7RA 1JE8A 4LLLA 2ESRA 3T7SA 2HFHA 1UHMA 7MHTA 3EYYA 2NXCA 3HCCA 4DCGA 3L8DA 1LJ9A 2HS5A 3EUHA 1KU3A 1XGOA 4DM3A 3CUQC 3K2ZA 3M8EA 4FHTA 5D4RA 1NV9A 4I02A 2HEOA 3WODF 2QQBA 2CG4A 4LD5A 4GQBA 1YIOA 1EH8A 3KR0A 5D5UB 1GHCA 2L3DA 3I53A 3BXOA 4PYJA 3AJDA 1SQGA 4HBLA 3HM2A 4DA4A 5BPDA 1RJEA 2O03A 2EJUA 2PWYA 2RQPA 4RB0A 3GCZA 4RTKA 3TLJA 2NAZA 3JAMK 1J7KA 2HR3A 4BQAA 2GPYA 4A5MA 4LFUA 3KP6A 1FLIA 1IRFA 2K02A 2VOPA 2BE5F 2ESHA 2ZJ2A 2P8JA 1JQDA 3RW9A 3P9CA 5J8FA 1R5HA 5H20A 3R0JA 1YLFA 4HV6A 3FTEA 2P1DA 1QNTA 1NW6A 5LSAA 3LWFA 2I62A 1YYVA 3G8BA 4E70A 2YR0A 1KYZA 4PYQA 4OIOF 4BAYA 2O06A 4XCXA 4ZZDA 2UWMA 2WTEA 5K5RA 1HW2A 1DUSA 1F3LA 5E1OA 3UJBA 5AIPA 1VQ1A 2ACJA 1HKQA 3HUGA 3ORHA 4EMSA 2IA2A 5GM2A 1STZA 3KPWA 3M8FA 2PFBA 2PXAA 5DV5A 5K0GA 3BGIA 3JW4A 5EIWA 3KQWA 3FRHA 2EWNA 1W7PB 2ZWVA 4L9VA 2Z6UA 4JQFA 4KN7X 3WGHA 5LGNA 2IRFG 3HTSB 2VC1A 1CF7B 2B0LA 1W5TA 4HG2A 3RJPA 4HX8A 5HS7A 3CO6C 2B78A 2IH4A 3TO6A 3ER9A 2KIMA 2IFTA 1TW3A 3HRMA 1F38A 1M0EA 1R74A 3M33A 4A0XA 4BNCA 3IEIA 3BWYA 1O7LA 4RTNA 5FTWA 4WXCA 1JTFA 4CWAA 1NKVA 1J2XA 1NE2A 1GVJA 2E1NA 3B73A 4KMUX 1SFEA 3LBFA 4XLPF 3PQJA 1LEAA 5E8GA 4PDKA 3LL7A 3J7AO 3LDUA 1L0OC 1QZZA 1EV7A 2PQ8A 2C7OA 1SVUA 4F7ZA 2ZIEA 4CTKA 1FJXA 3FHZA 2PX4A 2FBKA 1TTYA 3I71A 3R60A 2ZO4A 3UJAA 5DRTA 4OMYA 1QGPA 3NMUF 1L3LA 1SKMA 1EAMA 1R58A 1I4WA 1FP1D 5FLXK 2IP2A 2E5WA 2UYCA 4AZWA 3E5XA 3LQRA 2GAFA 2M30A 3UZUA 1OKRA 5IT9K 4G6QA 1KIAA 4GYGA 2V6CA 3MQ0A 2ZZKA 3LA3A 2ETHA 3FM5A 2JTVA 1BOAA 2P5KA 1O9GA 4OA8A 3KZZA 5H6QA 4ZYEA 2ZIFA 2YPRA 3SFZA 1YFHA 2I7CA 3SXJA 4CKEA 5EG5A 4P7KA 2CWWA 1HNNA 3A27A 4E30A 4UUVA 3OE4A 1JGSA 1FZPB 2VODA 3V8JA 2A07F 1I9GA 3KP5A 3M1EA 4S05A 4UXNA 1ZH5A 1SG9A 1QAMA 4ISCA 3DLCA 4EJVA 1P2FA 5FQOA 2LNBA 3IYLW 2HYGD 3KKZA 5EEGA 2V9VA 4O3MA 2XYVA 2ERCA 1J75A 4M6XA 1IM8A 2H27A 4PGGA 3GUDA 2WA2A 3R9XB 4ER7A 3IL2A 4MWZA 4RWZA 3DXXA 4POOA 4HH4A 3WSTA 1NW7A 2YX7A 4GUAA 2IDJA 1B1BA 3IV6A 4WXDA 9MHTA 2PY6A 4KRGA 5L3BA 2I9KA 4XLNF 5EMMA 2IBTA 2GLUA 2FNAA 4GOMD 2IVMA 3CKKA 3HHGA 2EA4A 1SMYF 3BJOA 5CVUA 2O57A 2H09A 3NDIA 4BLUA 2OZUA 2KKOA 5DCMB 4CYDA 3AY0A 3HRUA 3BKWA 5CYVA 5D5WB 4DZRA 3TKYA 2RN7A 2PWPA 3LCVB 1ZGJA 2GA9A 3ZMZA 3ZN1A 3F22A 1WS6A 1Q1HA 1T38A 3KE2A 4RVFA 4ATNA 1D3YA 5H6RA 3Q7EA 3JTGA 2HTJA 2FRHA 4ENNA 1YW9A 2FBHA 3IC7A 4Q48A 3R6SA 3CJRA 3M70A 4UNOA 3V7CA 2ZCWA 3BPVA 4HGZA 4ER3A 4YG2F 3GXOA 4GC9A 3F72A 5FFZA 1RIOH 4C03A 1ZAOA 3GRVA 3OU2A 4U7PB 1T43A 2JSCA 4IPAA 2DPUA 4P7JA 1USTA 5DUKA 3J80K 3GF2A 3K0LA 5EHIA 1RI2A 5EZQA 3KP4A 4R6XA 4EQZA 3TPZA 4C08A 5LQUA 5CM2Z 4GOOD 3SMQA 1YFLA 4AX8A 4OIQF 3GIWA 2XRNA 2NXJA 1MDMB 2F5DA 5L3EA 2EFNA 3G2OA 2FRXA 2JH9A 5C9ZA 3O7WA 2AN5A 3F8FA 5ED4A 2Z6AA 4F84A 2CFXA 1G6Q1 5J8CA 2IGTA 3LX6A 5HILA 5CVEA 5J6XA 3J81K 3ZMDA 2PLWA 4AIJA 1JG3A 2XVAA 3HEMA 1A04A 4ER0A 1BI2A 2DQLA 4L9TA 4L0YB 2EG5A 5K5OA 5HDKA 4HDUA 2ZMEA 2P7IA 3UJ8A 3B3FA 1MGTA 3Q5FA 3SX0A 1U6GA 3FM3A 5T6BA 2FMLA 4UV9A 5D8KB 2W84A 2Q0OA 2DFIA 1XCJA 2ZZNA 1D2CA 3F4KA 1X3UA 4G7HF 3O31A 4IF4A 1EQAA 2Q8KA 1FP2A 2OZ6A 3DKWA 2DLLA 3KQQA 3Q9VA 2ZCJA 3F8NA 2L01A 2CYYA 2VE9A 4RGUA 5DLYA 3GRRA 5DYMA 1BJAA 2L54A 3CVOA 2EV0A 3IKTA 5LLQA 5LHGA 3J81Z 3CUOA 2ESNA 3BT7A 2MLKA 2HKOA 2ISYA 1BC5A 1G8AA 1NBIA 1VP3A 2STWA 1HBXG 2R7FA 5L3FA 2O0LA 1FWZA 4GXOA 1R22A 3M6WA 3M6VA 3E6DA 5EVJA 2GAUA 3C6MA 1Z05A 4Y13A 2WV0A 2ZTHA 5EMLA 3KR1A 2XASA 2VDVE 1BIAA 5HIJA 3WG9A 2HR1A 3PFIA 1RUNA 2M5WA 4KNYA 1T39A 2W25A 2BR3A 1KP9A 3L00A 3EEOA 4CKBA 2QENA 1SD4A 4AZVA 4BLVA 3K69A 2NYUA 3IHTA 3B3JA 4Q4ZF 3F6VA 2PLYA 1OMIA 3RPUA 1PRYA 4G7ZF 3UWPA 1ZKDA 4L9NA 4EM2A 4AWXB 4MQ9F 1FBUA 3JSPA 1J59A 3FZGA 3HNRA 3OU6A 1WWXA 4FZVA 3GRUA 4UVCA 3K1NA 5E8RA 2Z5UA 2P41A 4GC5A 5ICFA 5FD6A 3W6JB 2RNJA 4MQVA 2GQQA 2GZWA 4CGZA 1RJFA 4IHTA 1W7PD 2ONYA 4RTLA 2ZVJA 2ELHA 3QAHA 2A6HF 1IRGA 4YV2A 1JG1A 1HXDA 2HZTA 5E9JA 3GFMA 4GCVA 2J5OA 1U8RA 3C18A 2OKCA 1X1BA 1VE3A 1UCRA 4IJAA 2TDXA 1G3YA 2DAOA 2VC0A 3H2BA 3JTHA 2QVOA 3ELKA 3LQQA 3KQMA 1S29A 4EV0A 1EJ6A 3ML6A 2EFPA 1JSXA 2UYQA 4E31A 3KQTA 2MC3A 4CO8A 1R8YA 5CCXA 1PDNC 1GXPA 4IRHA 4FR0A 1K6OA 5HS8A 1EH6A 4RTSA 2BM9A 5EIFA 1ZGAA 3REOA 5D4SA 3MCZA 2AS0A 1QBJA 1G3TA 3DH0A 4NQWA 2PX5A 3G2MA 5CVIA 5LGUA 4WCGA 4E33A 2M87A 5CIYA 4XUEA 1XSVA 2OQGA 3KEQA 3PVCA 1R1TA 5L3DA 4YFKF 1RI4A 3FYCA 2BR5A 2OQRA 3FF5A 2MA3A 4R79A 2F5EA 4EJUA 1Q0TA 3UJ6A 2NNWB 5M5BA 4OIPF 2O6GE 4L5JA 4RTQA 5KYGA 4A12A 2YXLA 2XYQA 5DUIA 1B9NA 1I6XA 2PN6A 3MTIA 2ONZA 5GWXA 2Q2EA 5ICEA 4KDRA 3KP2A 5FADA 5JHUA 2MBFA 4OINF 3OE5A 3CUQA 2EK5A 3LDGA 4P55A 2PKWA
chains in the Genus database with same CATH superfamily
3GTPJ 2QCOA 5CFQA 3LFKA 1CD5A 1TQ4A 5DYWA 3HCBA 5FD5A 3FLEA 3KKKA 3V8LA 2ZDQA 1GG2A 1M2GA 5REQB 4EJSB 3T1BA 1F7VA 2NO9A 2QP4A 3CESA 4OU5A 3GQBB 3LZCA 2FEZA 2D5VA 1VIYA 4P33A 2NM0A 2LDBA 5EUCA 3A1VA 4ZEXA 5JWHA 1A9TA 1YB1A 3L0DA 3L84A 4G01B 4OMFG 4AIRA 4B1FA 3PKJA 2G1UA 5BMVF 1T36B 3AOEA 1LX7A 3BIXA 4ITVA 1YJQA 1F2UB 3I2FA 1MJHA 2ZMEB 3D0KA 4BECA 1E20A 1VE7A 4JITA 3ZZMA 2JJ1D 4JLBA 4B8YA 5GINE 1W2WB 1D6SA 1RXVA 3LQ2A 4JX8A 2Y0SN 4HZUB 5JFRA 5FTLA 4QWWA 5D5XB 2ZZMA 2CHGA 4RK4A 2GOYA 2HBZA 4RPGA 2VQ6A 3PNSA 3O74A 1U9CA 4CM6A 4GYWA 1WWKA 3COZA 2HGSA 4HFJA 4OV6B 3E3VA 3SZGA 3PU6A 4IX9A 1JIQA 2VOJA 5FHQA 5AM0A 2ZREA 4BGEA 1VG8A 3ZPXA 1FU8A 1MRZA 1DNPA 2PKYX 2JKVA 1Q1AA 3D64A 4FFDA 4G0XA 1N7GA 5JAQA 1TPYA 1U0GA 2ZTMA 4ABZA 1BXRB 1OXXK 2ZWIA 2V7VA 3M8KA 3NG1A 5FHRA 4CFYA 2NAFA 3MLAA 1S01A 3RKUA 1K97A 5COAA 1GTMA 1FMTA 2DO7A 3T8RA 4FUQA 4KXVA 1X9HA 1XCMA 3RF6A 4PSWA 4I66A 4U6SA 1N2XA 3EAQA 3RYHB 4AIIA 4DJDC 3ABQB 1T8PA 1WOYA 4HX2A 4MPDA 5FUQA 4P9FA 4MCIA 2FK7A 1FLNA 5H83A 1NQOA 1JI8A 2I2FA 1Z1DA 5FO5A 3JQCA 5JWRA 1TD1A 4MXDA 3ZUGA 4XWTA 2B82A 1YFKA 3MMNA 1CDOA 3LM8A 3STYA 3G1UA 4Q1AA 3AW9A 3HYIA 4CCYA 4IMJB 3VYRB 1IEQA 4RGRA 3FXQA 1ZIPA 2EZ8A 3C41J 3D5TA 3BT9A 3P0HA 4KQ1A 2FPSA 3A36A 1LB1B 3EPZA 3VDXA 2XRLA 3ONWA 1WKMA 5KYYB 3R8FA 3AL0B 2X77A 2ZUSA 4NG4A 2A6EF 1OYVA 4KBGA 4OQYA 1F9NA 1LPQA 4I6EA 2OQ2A 4YLEA 3IMGA 1J9IA 5GJVC 2HPVA 1P2GA 1Q1NA 5JVTA 1H05A 3TTWA 5KX5F 2WWRA 2C8JA 5FV7A 1SUDA 3DZHA 2Q2EB 1WETA 1DTSA 1K92A 1QZXA 1EX9A 2OORA 1KJWA 2VJDA 2ZG6A 4J43A 4MYSA 2ARKA 4QC2A 3ZHQA 1XJ0A 2AE1A 4UUOA 2BDTA 4J0DA 5IJ0A 2PT9A 3GI1A 4NBRA 4P3OA 1E2UA 4IDFA 5FWAA 3UJ7A 5K0ZA 4QUKA 2NYXA 3R3XA 2ETVA 2F1OA 3OFJA 3P5JA 5F0CA 1CDDA 2PSEA 1U5TA 3JR3A 3L79A 4G9EA 3RUCA 5HMLA 4WV3A 3A3OA 3HFJA 4QJIA 1R23A 2I1WA 4RV5A 3P27A 4BVEA 1JI0A 1S7GA 2WUDA 3AFGA 4NULA 5HLTA 1SCJA 3R0ZA 4Y1EA 3TFOA 2ZJAA 3I9KA 3FRIA 2D59A 4WADA 1SFRA 1VE6A 5AJTA 3TSWA 3VDNB 5K01A 1XZIA 3LBYA 2MCFA 4RKQA 1Y8ZA 3L7NA 2B1IA 4OA5A 3B3QA 1YFZA 3KHSA 4NWIA 1DOAA 3ZIAA 2JH8A 4JC4A 1X8KA 1C3JA 4GGOA 2IYXA 1OHHD 2OA4A 1GTG1 1YVEI 1CERA 2DG2A 3GVPA 4FWBA 4I50B 4Q1DA 1I6WA 4BO8A 4JLNA 2C8LA 3AEZA 3HUFA 5D6NA 1E32A 4GBGA 2IEAA 4LJYA 4NU5A 5J3LA 4QHTA 1SAXA 1HFEL 4G7OF 1OXBB 3HIFA 4XIYA 4QPQA 4FFWA 3JTMA 4ZVQA 2D00A 2CLSA 3DUFA 4MGEA 4ESJA 1FP6A 1JA1A 3HOYJ 4QPCA 5A71A 3UPUA 4YRZA 4JBGA 1ZJWA 3RRBA 1AXGA 1ABFA 1XDZA 3QVJA 1SQ6A 4XVQA 4YP6A 4DMLA 3BQYA 4V24A 4ZZ3A 4G4JA 1LB2A 1B8VA 1UAAA 3DLTA 4KN9S 1MH4A 4HH3C 5DCMA 3RRMA 3H0CA 4DRZA 1CJMA 2QQFA 2YW2A 1PJCA 4RD3A 1TKAA 3Q3VA 5LYJA 4F6RA 4F6RB 2NQ2C 4JODA 3CVXA 2OU2A 3KPHA 1SHJA 2PZGA 2IT0A 4NBVA 1PYGA 1BJKA 3K8QA 1XB4A 2F1RA 2M98A 4MOWA 4MTLA 5EKXA 3SXUB 2BHRA 1XCLA 4OMZA 4EJSC 1IN5A 4UXHA 1GG9A 3GLKA 4OOFA 2E55A 2EKPA 4LRYA 1QIEA 1Z2NX 1PWZA 1JUSA 1DAKA 2V6JA 1G41A 3U6KA 2JAQA 4TT8A 2WM3A 4W7HA 2IYRA 3IVAA 3N58A 3NHYA 3K6KA 1BQ3A 3OZSA 4YUXA 1ESMA 5C1IA 3PUIA 3T1OA 5BNWA 1S2DA 4LXGA 4CV2A 4UPDA 2BEVA 4RXUA 5HQ3B 1NZJA 5E3LA 1V5IA 2DX7A 3DPUA 5ALQA 5KTTA 3EZNA 4C7MA 1MJGM 2P9GA 2KIFA 3E6BA 3NCTA 1M34E 4WT7A 1HK7A 2A3SA 3U4CA 4BV2A 1DI0A 5K0BA 2GK4A 4BB6A 1F43A 3NM4A 1IBLB 3AM1A 2Z1MA 4EW6A 1YR8A 3OOWA 2AOWA 1BAPA 3A1EA 4B8ZA 1FFGA 1L5OA 4PO8A 4GZ3A 5GOZA 4CLRA 4LHZA 5I9LA 1E18A 1TVKB 3K9BA 1VKHA 4LF6B 1N2GA 4AJ4A 1KO4A 5B1BH 2Q1TA 2ZULA 5CLSA 1E1RD 2BKAA 4ZDLA 3THSA 3QEAZ 3X1MA 5DGHA 3AI2A 4PTLA 3RLIA 2GRJA 2XVCA 2JVGA 1GU7A 4G25A 4NECA 1RKTA 1HMYA 1YBMA 1BOFA 1YE3A 4R98A 3WHIA 1MD9A 3RGWS 4BVAA 2BLLA 1G42A 1QANA 2XNCA 3CSDA 3OZ7A 3PDIA 1Z08A 1RAHA 3C3BA 5J1SB 1X1TA 3WRYA 4F3TA 3N0XA 4UY8I 2OE2A 3DD5A 1NW9B 3OLXA 1X1QA 3QMVA 4CCAA 1XALA 5B12A 3ZQFA 4V0OA 4YCJA 2CK3A 3F1LA 5EXXA 3C1TA 5F35A 4EI9A 4HZFA 5K09A 2ZRDA 5DCYA 3QOPA 3ZNPA 4U7TB 3JQ7A 5JZVA 1RNLA 4XR6A 3EZ6A 2PNFA 4H7EA 5SZJA 4MTEA 2OHFA 1MC1A 6PAXA 4MRSA 3F1KA 3ZCXA 3RJMA 1U8AA 3R41A 4C2BA 2RC4A 4W97A 3AL0C 4EG3A 2HF7A 4B6SA 5HDNA 1ZK4A 4L8GA 3V7RA 4C6HA 4GSKA 4H7PA 3TJZA 5EC8A 5AXAA 3K6RA 1P6XA 5A0TA 1YFJA 2BMAA 5D7BA 1Y56A 1DT3A 4IWXA 1V1RA 1BI3A 1D2MA 4Q5SF 1CZKA 3NRBA 1EE1A 1NQAO 1QVWA 2P2LA 5EPUA 9ABPA 1L4GA 1I5ZA 3HXQA 2IV2X 3CCUI 2OA0A 2HA4A 4WCDA 4BNNA 4BATA 3G0GA 4RABA 1Y1WJ 4JT8A 5CJJA 4BMDA 3VOBA 4PCLA 5F1JA 3DZDA 4O8ZA 4YCNA 1R9MA 3EDCA 1FDRA 4AXBA 4D9BA 1WCV1 1OLXA 3AV0B 3NBUA 1TL8A 3LQKA 3D8UA 1YR6A 4PNHA 2VHVA 3C70A 1IJEA 1WLYA 2Z2XA 3USES 5F0HA 3OOJA 5ALFA 5HIAA 3VPDA 2F1JA 1RYZA 4CRWB 5B2EA 3KR9A 5E1WA 4P2GA 5T4EA 3VTFA 4FN5A 4XH9B 3B13B 3KLPX 4LC1A 1NVVQ 2W2QA 1KJ9A 1G16A 4TV8F 3X1WA 2W6PA 2I91A 2BY4A 2EWVA 4YT5A 5TQJA 1E1NA 4V1CI 2AJTA 1ZVKA 4XK4A 2B37A 1OPCA 3HKZA 3OX3A 3CF4A 1R6RA 4AUKA 5JS1A 1O6BA 1Q74A 1JAYA 2X0JA 2VKTA 3HB7A 5KHLB 4D7NA 2C8KA 5ES3A 1TVMA 3H8WA 4QRDA 4C7VA 4I5GA 2J0SA 1J9ZA 1SZPA 3KWJA 2XBMA 1ZRCA 1FOKA 4UNSA 1EWVA 1O3YA 2ECQA 4R6WA 4PZYA 4EJ2A 3VOEA 3I5UA 4EGQA 3FZEA 1CZOA 2ASEA 3BTIA 4ZC8A 3ELYA 3RT9A 4P93A 3BWDD 3SZUA 2CHUA 3IUNA 5B4TA 3L4KA 4G6TB 4O2BB 4EMUA 1QO9A 4XJSA 1XQXA 5DM70 4RB3C 4ZDIA 1K4TA 3REGA 3I4FA 2KYRA 4K28A 3TUZC 1VTKA 3IPXA 2P4WA 4YDHB 3WGUA 3E05A 3I59A 4AIHA 1GPAA 1D2NA 4JMPA 5A02A 2QMZA 2VEDA 3BJ6A 1CG6A 4XIIA 2DQSA 3N8KA 4M88A 2XMDA 4XRMA 1F4PA 3CUQB 1USSA 1NV8A 4QULA 3WU1B 3W8FA 4DLPA 2BP7B 3DJFA 5E2AA 3IT2A 3VKGA 5ICCA 1QMPA 3RC7A 2EL7A 3L8EA 4XYBA 3S3NA 2VP4A 3O4FA 1BHSA 2C78A 2COKA 4GXQA 2JPBA 1ZH8A 3JYQA 4TX1A 3MRTA 3UCFA 3ETHA 4IIGA 3DMTA 4EF4A 1UM9B 3NC0C 5E8IA 1K9VF 5AVXA 4NBUA 1N2CB 2I54A 2XGEA 1B73A 1KPHA 1FYKA 3WDKA 3LSIA 1K89A 2G5TA 1TX4B 3FFBA 4KAXA 3IKJA 3S99A 3G0HA 1A98A 3WTYC 1XRMA 2FBIA 2P90A 5K4HA 3I1IA 1JDUA 4QAJA 3FWEA 5D2CA 4HRVA 3RR2A 5EHZA 2XZDA 3QU5A 4XQCA 5EZYB 4DV3B 4C14A 4R8HA 1NP7A 4PLFA 3ZMUA 2YINC 2XUPA 4G9YA 3W2WA 2R5YA 3BGDA 2R5YB 1P0IA 4F91B 2PRJA 2YYYA 2EINH 1YOVA 3LAPA 1I0LA 3EUKL 1V5GA 1G3IA 3D6JA 3H3FA 1HFWA 3WLOA 2GBLC 5GPCA 2LKXA 3WYGA 4PCAA 1HQKA 1B43A 1Q7TA 2M2EA 1J24A 4URXR 3I6ZA 3C3JA 3UT5A 3D8BA 1RLMA 2PH5A 1YQTA 1KA8A 2OKGA 4IGIA 3CRRA 1ZC4A 4KQFA 1I2CA 1OLTA 5CT4A 4MPTA 1BEEA 3RS4A 1EXVA 2CW0F 4HA8A 5CYOA 2IZZA 1G55A 1JHQA 1HY3A 2X13A 3ZCPA 3TSCA 3RAFC 5J1YA 4IHSA 4HAIA 5DM0A 3K20A 1K7FB 2EW2A 2O8DB 1NMSA 2AMVA 2IF2A 2V7QA 3PJEA 1JHHA 1CF2O 4JLAA 4IOKA 4XTRA 1L5YA 5M5YJ 3L2RA 2K3FA 4UVIA 4BYYA 1QIIA 2OCGA 3FYUC 4LUCA 5IYZF 4ED9A 4CXFA 3T1HB 4C9YA 3IXQA 2IS6A 2RIRA 4R9UC 1Z83A 2KISA 5KNCH 1I8TA 3WWEA 1TT5A 3SBOA 4AMYA 5FWDA 4BVBA 5AVZA 1THGA 1LNQA 2GCGA 2J45A 3D6HA 1FUEA 1WP9A 2QLNA 5JSZA 2WAOA 3IDSA 2WKWA 1ZUD1 1F1JA 4GKJB 2JLRA 1D5VA 4TPKA 3CA8A 1GARA 3ED1A 4IIBA 4TZTA 1KSHA 1E9RA 3L0IB 1DMSA 1PFUA 1XV5A 3JWHA 5DTJA 3VBCA 2ZBPA 4AW9A 5FDFA 5JAMA 2QB5A 2VAXA 1QUFA 3FVQA 1N0WA 1PEDA 3WLRA 1TA0A 5JAZA 1B3RA 1K5GA 4A10A 3ERCA 1Y3FE 1ZYUA 2NX2A 3JQ8A 3SR4A 1TMOA 3FXJA 4DBQA 2CDNA 3IDZA 3SSMA 4P35A 3MGBA 2ERYA 2Y1WA 4KDCA 1LF0A 4KSYA 3WRXA 5AP9A 4TSFD 1WU7A 4JB2A 2G0NA 3KJIA 5U4QA 3ZZ0A 5F27A 1KQGA 1GYPA 2Y3IA 4RIHA 3CZCA 2A7XA 1BNCA 2NYRA 2VDUE 4D4KA 5JBNA 3Q40A 3OHSX 3WLAA 4DV6B 3PK0A 4ZAGA 4YFXF 3OU7A 4PBSA 5AM2A 4BN5A 4QEDA 2WJIA 3LNTA 2WFLA 5H5JA 1DKMA 1IRXA 1C7JA 2IL1A 3NJ8A 3S4YA 1XQVA 1RWBA 1VJGA 3T6KA 1DUVG 4C01A 1SIOA 3GCDA 1HXHA 4YMWA 2XCRB 4LF8B 5BW6B 4QFDA 5HDGA 4UB8C 1GKUB 1ZD5A 3R77A 4J8PA 5FULA 4C0SA 4QPOA 4YY3B 1XELA 2WSMA 1U2QA 1NQ5A 1M6HA 5EP1A 5CLFA 4DDWA 3N07A 3HLTA 13PKA 2GVZC 2Q4OA 3OEYA 4BL0B 2MH2A 1EZZA 3L8CA 4M0UA 4QOHA 3MKYB 3FFXA 4E08A 1PW7A 1RQLA 1K2VN 4IHJF 1Z0UA 4X92A 3MJSA 2VJAA 5KTYA 3ROUA 3PHBE 3D6MA 4FETA 5T64A 1OXUA 2AH5A 4BNDB 3BFVA 3EXG1 5IDQA 1T95A 5I9SA 4BVJA 4KPGA 1A82A 1GZVA 2IOFA 4B9AA 3HYLA 4TTVA 4F8YA 2C9ZA 1KQ3A 4I08A 1RQGA 3HCOA 4B2IA 1YI0A 1W5CC 5THQA 1UQUA 2NZVG 1CUSA 2HQOA 1QZYA 2I6UA 4FYHA 4CIXA 4BO7A 1HLGA 1LRJA 5FYDA 3UK6A 4IILA 3C1DA 1ZREA 5BPHA 2FPPB 3NWBA 4LZOA 3ZZ1A 1MRSA 1O94A 1TA9A 4KRXA 3A31A 4O1HA 4DKJA 4YPFA 1FFBA 4H7FA 3IAFA 3WTSC 3LGXA 3AF5A 1A9QA 3IBFA 4AM8A 1Q0RA 2CDBA 2GB4A 3ZDYB 2D0IA 3GQVA 5IG2A 2Y2UA 3WLHA 3LQ1A 2ODNA 1MKYA 3HSFA 1F8GA 1P7VA 2BRUC 3AVPA 3GGDA 4H0NA 4A8JB 1J1IA 3U4HA 2P9TA 3D7MA 5KYVA 3MVPA 8ABPA 4UNNA 1P4WA 1JQEA 2GN2A 5FTNA 3JQQA 2FQ1A 1GL9B 3MT9A 4L0QA 3SBDA 4U0VA 2QVGA 2ECBA 2HRDA 3ENWA 1UJCA 3H3UA 5CG1A 2IXTA 2B9SA 2XPCA 4A0SA 5J9FA 1FXWA 3PHJA 4J4BA 4M49A 3M7GA 2WSSD 2R44A 2BGCA 4XONA 4L18B 2G9WA 3I2IA 3OZCA 4IXMA 2JCGA 2IGKA 1NWHA 4P86A 4C22A 3ZPLA 3G1OA 4FYMA 3GFTA 3QUTA 3G9XA 4EY5A 4V3CA 1RT9A 1TTQB 1Y82A 2BMJA 3IJPA 4MUBA 4XTCS 2HF8A 1YS6A 5SICE 4QBTA 3CNOA 3I30X 4BQQA 1V7CA 4BEHB 3RHZA 3RREA 4PLGA 1K5DA 2YJNA 1Z7UA 2WD9A 2WWWA 3A2MA 3KT0A 2FG5A 5THKA 3BB4A 3OYAA 2BAGA 1UG2A 2XD9A 4KMSA 4G23A 1PZXA 4P31A 2HK9A 2O23A 5ILQA 4M71A 3LLCA 4MWTA 4W9MC 1ZN2A 2ZB7A 4Y2VA 2E6UX 2FQXA 5ARDA 1OXMA 2GD2A 4A3CJ 1FSZA 1NNEA 2VYVA 3WISA 3H5AA 1O3RA 2DWUA 4FHEA 5K6TA 4ND3A 2FSWA 3ZQUA 1YJNI 2X8WA 3NX4A 1GUUA 5FRMA 3CPEA 2VPZA 4BFZA 4DMGA 3IGFA 3TLGA 3LIIA 5ALWA 1M2KA 5HIMA 3WGMA 4CNBA 1NQWA 2XTNA 3V1NA 5K7FA 4YGXB 3AAFA 2ES4A 4IIUA 3KQPA 5BW8A 2VOEA 2PUTA 2WD7B 2X6XA 2WOOA 1Y4AE 3QGMA 5LRSA 3M4NA 6GPBA 3Q8XB 3S2IA 1GUAA 4DGSA 1IY0A 1Q1VA 1JJ7A 3A9WA 1K86A 4W5HA 1FOYA 1OHHA 2ATXA 3LCJA 1OAAA 2GZ3A 2X42A 4IVNA 1M8PA 2RHOA 4KV9A 3RVSA 1LNWA 1W0UA 4IQFA 1DEAA 2I78A 3ZNOA 2BY1A 1ULTA 4LYDA 2HA2A 1R6AA 1MLDA 1SEVA 2Q07A 2HNAA 3A9UA 2G8NA 4RAQA 3KT8A 4KICA 1AQ6A 4F5ZA 2Y1KA 2OQVA 4FNAA 4BMPB 1BM9A 1FNSA 1JXQA 5DHFA 1YGPA 3HKBA 1CKEA 4PO9A 1ZD8A 4MICA 4Q15A 2BEWB 2LF7A 2A69F 3L06A 2EL9A 2PGOA 3KLOA 4L8FA 2O6HA 3U31A 5GTDA 1A71A 2O3QA 4AJIA 4HWRA 4DHWA 1IDOA 1GGFA 3ST7A 4EM6A 3OA0A 1P1IA 4ZYHA 3JR9A 1LQUA 1VGRA 1I3QJ 1YKSA 3DEYX 4NZZA 1Q1BA 4RIIA 1JHFA 3CO5A 4TWJA 1SIBE 2OCYC 2JGEA 1XMPA 3HL4A 4NPAA 3OIQA 4N5MA 3H86A 1R66A 5F3RA 4PW0A 3THXB 1YQQA 3IAM2 4ZRMA 3ASYA 3NH6A 4XSVA 1RFLA 3TS1A 4MW7A 4RAFA 2HMSA 4J1TA 1HWYA 1Z4NA 5BT9A 5LQCA 3AU8A 2O8BB 1XDGA 5FTMA 2Q3CA 5KTKA 2GO1A 2XMQA 3LUCA 3VPHA 3ZD9A 3ZU6A 3KYJB 3R3ZA 2FJUA 5C8DA 4BXOB 4R9SA 4F4HA 1L7RA 4YMUA 2D0DA 4FK8A 3K4LA 5KWJA 2M2IA 4GRIA 1LKZA 1RWQA 1FOEB 2QJOA 2DWCA 2DK5A 1HZZC 1M7HA 2D2XA 2O6LA 2HJSA 3KUKA 4O25A 4A1FA 4AO8A 4D0LB 4C2TA 5DLQC 2RKBA 3R44A 4X93A 2Z3YA 2C2MA 1G17A 2SKCA 4KODA 3D6NB 4L74A 4LXHA 4NVRA 3FWNA 5AVWA 5TY0A 5C5DA 1I14A 5PNTA 4KX5A 1K3TA 1DU0A 1V6SA 3IC5A 3T5BA 5H4HA 4PGHA 1MSFC 1JR3D 3BJMA 1WSBA 4BQRA 3VU1A 2RGAA 1ISGA 1YNOA 3ZN0A 4MR9A 2YWJA 1OWNA 1YVRA 4N3NA 1LDKB 2QEQA 2MSNA 3LA2A 1F8XA 3AJ9A 3GJ3A 3I04M 3EVAA 4KH0A 4KVGA 4NU8X 4PNPA 3KZ1E 1PZGA 1RVV1 3LQYA 1PDOA 4O4HB 2BSXA 1M8FA 2V7TA 1DU6A 1BC7C 3J81A 2BFNA 2M1ZA 5JAPA 2K7LA 4OHZA 1UT5A 4G5YA 3C3EA 3ABUA 4U63A 3F7TA 1BJTA 3HU2A 3KQHA 1E98A 2WP0A 4DRXB 5A06A 2ZI5A 3UGQA 1WOMA 3DQVC 1UFKA 3K4QA 4QUIA 3P9IA 2FEWB 3F2IA 3FCXA 1TWFJ 4BFXA 3OYFA 3DMGA 2J4FA 3GUYA 2PH1A 4XB1A 4BCDA 2ZAGA 3Q85A 5DBEX 5A9SB 1EE2A 4IEEA 2RMKA 2ZJOA 5COQA 3DKXA 1VQ7I 4FMDF 3T61A 4KN8A 1JE0A 4YIHA 2PFSA 3AHDA 3GWZA 4U02A 3KLMX 4H60A 3CF6R 3RYPA 1M0SA 1C4WA 1ZRSA 1YI1A 3AG1H 2XT9A 2P3QA 3RG8A 1H9GA 4EG6A 3C2GA 1ULZA 3BY6A 1O5OA 3DMPA 3JRNA 4PGFA 4CIDA 5A4IS 1P5HA 1U3VA 3R3SA 3ZD7A 2VTBB 4N49A 5HS6A 4XD2A 5L3SB 3ZEAA 3DLHA 1O57A 3IMCA 1P1CA 4RVCA 3CCRI 1UF9A 3KEOA 2WIKA 3T7TA 3PFHA 3IA7A 4ARZA 4JIGA 4BJ5C 1SXIA 2HDNB 5KVRA 4L50A 4Q1CA 3BWGA 2BKXA 3K35A 2D4HA 3INGA 5HDQA 1NU6A 5EGOB 5C1BA 2IUEA 1SD6A 3BTSA 2QTZA 4KQ9A 1RBMA 2H4XA 3QWHA 1XFDA 2QUJA 2IITA 3N2KA 2PS0A 1P77A 2HI3A 1Q7GA 1TUEA 4AROA 4AAYA 2EX1A 721PA 2V4JC 1ADYA 1O95A 5AICA 3QUAA 4QIHA 3UKDA 1MENA 1DGRM 4MTDA 1LFDB 4HRXA 1YZQA 3RBXA 4DMCA 4I99A 4P08A 2R6JA 1B8NA 4IDEA 2I76A 3FPSA 4GLOA 4DDKA 4TOIA 3GFQA 5F5LA 4P96A 1O3QA 1RKQA 3CH4B 4R81A 1PBTA 2DHRA 3F8SA 4MKIA 4H4EA 5ERYA 5BVHA 3TL4X 2OCLA 3EEQA 3LUDA 3GLTA 1IHPA 5FAXA 1VMKA 1BWPA 4UC0A 2G8LA 1GWNA 3OYMA 1XZMA 1MW9X 2RHBA 4OFXA 3ANXA 1TW2A 4QYWA 2CVPA 5G41A 3OOPA 1XF1A 2O1SA 4WRRA 4BZZA 5I4CA 5F98A 1OFVA 1FDWA 4TMTA 4WWHA 1SZDA 3ZJ4A 4G37A 1WI9A 2Y68A 2GESA 4PZEA 2OD5A 3TZKA 4BVKA 3I8SA 1LTQA 1UBJS 1Y33E 3AUTA 4C3ZA 5AW4A 3C6QA 2CVQA 3P19A 4YAJA 2A5JA 1F1ZA 3D4BA 4E0BA 5KSOA 4DS3A 2VTBA 2O8CB 1D4ZA 4GKKB 3A9SA 1ZJ6A 1ZK0A 1ZY2A 4W1UA 3T7IA 3AUKA 2A5LA 3KSMA 1V7PC 4PONA 2HSZA 4WCFB 4L6CA 6REQA 5KOYA 1TT0A 1U99A 5K8JB 2JAPA 1EP1B 1RCTE 5BV2P 2K9QA 4CM5A 4D9CA 2R7LA 1GNPA 4HRIA 2R8PA 3CX6A 3GGPA 5DASA 4F71A 1Q3HA 1IHDA 2YDXA 2FG7C 3Q11A 4H7DA 1OBHA 3PXBA 4CF6A 4QGSA 4OHMA 5JD6A 3FHNA 4ZRNA 1P0CA 3CT6A 4N5DA 4GGPA 4NUBA 4EGAA 1LJ8A 1PUXA 2XAGA 4O4IF 3ROQA 5L7WA 1OI7A 4I6GA 2R9VA 3RYTC 3K4HA 1J0DA 5JO9A 5KTNA 2I8DA 1KAHA 1R6VA 3M6AA 2C0QA 3N5KA 3R0QA 2JAUA 3MTQA 3EEFA 4WHMA 2I7XA 4ADSG 5BQXA 5IRCD 1C9EA 2XIQA 1SCNE 3PIDA 1HT0A 1TL7C 1W35A 1Z8HA 2C88A 4RMHA 3I8XA 3PWSA 3BCUA 1JXAA 2D54A 4IHAA 4ZJPA 1FE8A 1P9QC 4Y6PA 4OLBA 1M1ZA 1GVHA 4MB2A 1ZCBA 2QRNA 3M1AA 5IU6A 4F38A 1UKBA 2O4CA 4GRDA 4Y2XA 4QJ4A 4ALJA 3ZCUA 1M7BA 3CDLA 2D7CA 2GILA 3F5DA 2LOOA 1T3GA 5K20A 4ZOLF 1XXHA 1ZRFA 3OQBA 4JLWA 3WBBA 3WGNA 4CKWA 3U44B 3J81k 4LJZF 5D7NA 5K3DA 2QN3A 1OH7A 3A7EA 4C3UA 3AGPA 4RS3A 2ZJ6A 4BKPA 4LG0A 2FU4A 3OPXA 1HE8B 2FPOA 1NFFA 5IHXA 2AQKA 1VPWA 4HQNA 2XB4A 2WICA 4HDNA 4QQ8A 4YTEA 1YZHA 4D81A 4NG5A 3VU0A 3LVRE 1T5IA 3W2HA 3TF5A 2B7EA 1PE0A 4NSNA 2B20A 3NEJA 4RK6A 5A7FA 1S3JA 1F6BA 4QELA 3RBAA 1Z7YA 1EIZA 5GPBA 2IWHA 1P0QA 1PK7A 3T4EA 1UKAA 3JYPA 4HN2A 1YHYA 2WTAA 3ORFA 3QHPA 4N9QA 1H5UA 1OILA 2PL1A 1C1DB 4N5NA 3VR6H 5HGXA 4PPNA 4YJ3F 3QVSA 1AOYA 2Z43A 3DT6A 1AHDP 2M1BA 4QX6A 3U2QA 3A4TA 1JVSA 5JJLA 4BV3A 2VKQA 4YRMA 5INTA 2ZB2A 3RI4A 2ORYA 2X6RA 5C8YB 3TQOA 3AFIA 2YVUA 4MDYA 4OWRB 4WEQA 4FYPA 2GHIA 5H7XA 3TEFA 1EE9A 2Z9BA 2GPNA 4E4TA 2L17A 1EUCB 2C59A 4M8KA 4ZCIA 4GXRA 2TMYA 3OIFA 4GVPA 2PX2A 1TU4A 4MDHA 3X1YA 3F8MA 4DLSA 4F7WA 3LFTA 1E1MA 2WAAA 4GKVA 4MPJA 1MT3A 3V2GA 2QY6A 1BU8A 3VR6A 3OYKA 1ZD9A 2VS1A 4R1PA 3GLVA 2FFHA 2W6JD 2Z9DA 1ZR2A 3ZHSA 2W6MA 3N8NA 3PDWA 4AMGA 4F9EA 3W5CA 1ZVJA 2YR2A 2HRBA 5F2OA 4LWOA 3KKOA 1CQTA 4YECA 1Q7CA 5AIAA 3OLWA 3BCBA 4IJ6A 5ALHA 3PQCA 3V8EA 1YH3A 1XMAA 1DP4A 3AR8A 4HOBA 4ZMSA 1CR2A 2WFAA 3QK7A 4W5JA 3FUXA 5AHKA 3VTKA 1KRXA 4MR7A 4X63A 3IAS2 1T0FA 2AZMA 1HBJA 2HTFA 2K5UA 2QAJA 4YJFB 1QP0A 3DJYA 1YB2A 2CD7A 3CW8X 3WB9A 3FXMA 2OCBA 3WU0A 4WOJA 4JENA 4N5IX 4MUYA 1BCRA 5ELLA 2Z09A 4CKCA 4JBHA 2WWVD 4XAQA 1DIBA 2UAGA 3F5QA 5HS9A 2ZCVA 1OR7A 3K9NA 1Q77A 1RQXA 3QU6A 3ZOBA 2O4UX 4JI3B 3KYDB 5HIIA 3T4XA 5HKBA 4BUJA 2P2CA 2WE7A 4AIKA 4PYOA 2R1VB 1P4HA 3G2JA 2W22A 2XDQB 4BMXA 3W3AD 4QGHA 3F3YA 3HEAA 3QYEA 2QLJA 4W8HA 1MMAA 1APBA 1XLUA 4KYWA 4ETIA 5F3WB 2I3BA 3F2VA 1KQ9A 4JU8A 5EXTA 5A05A 4N7RA 1RMTA 4H18A 2CH0A 3FK6A 3IE0A 4MW1A 4OQFA 1PCXA 1YZKA 2WG0A 1BG6A 3W6PA 1R37A 2QTBA 5LWQA 2G08A 2QA5A 2UZAA 4F4UA 5HLGA 1UAYA 5L3QA 3DE3X 2H5IA 3Q5EA 4TWBA 4M3BA 1Z2CA 5DTDA 3CZ6A 1TZBA 2XGCA 2LSOA 3AR4A 3W2GA 2L4AA 3X2SA 2QSGX 2GBGA 2E37A 4RKWA 4A5NA 4PZJA 1KR2A 2X9VA 4LV6A 4ZODA 1C3LA 3SSAA 1HE1C 1ZGHA 5DLEA 2I5UA 1NLMA 5D1NA 4MR7B 1ZOIA 1L6IA 3HDTA 4XPIA 5ADUS 3VH1A 4GL2A 1AGPA 4PJMA 2AKAB 4KKVA 4BLWA 4XE5A 3FPFA 5CT5A 3WNCA 4K9LA 2J3IA 2FZVA 3U3XA 5CB4F 1IUOA 1DRKA 4PBRA 1EK0A 3M5CA 2RD2A 4EHBA 3FXRA 4TKMA 2JSPA 2GBLA 4NOKA 5FR1A 4Y9RA 5LZ8A 3F5MA 3CE9A 1I3KA 4L57A 1U0SY 2QX8A 1KTVA 3FXUA 3AL2A 3GPCA 4HLDA 4WZAA 2DA4A 3IAAA 4A73A 1A9RA 5JRJA 3KJGA 3LH5A 5MN5A 3TH5A 2ZQYA 4UZSA 1ZL2A 1MB0A 4I9HA 2CV2A 1XNHA 4M0LA 4WJLA 1X1DA 1J49A 1YRHA 2VL7A 4ZMBA 4D9NA 1ZELA 2VP0A 5DN6A 1PUEE 2JFQA 1D8KA 3ABSB 1JT6A 3PL1A 4OHUA 4REQB 2AZDA 2AYZA 3LU1A 2AE2A 4KFSA 4AUNA 2E34A 1WCIB 2AMYA 3B38A 1SFKA 2Q6IA 5GP1A 1CQPA 4RD1A 5DT2A 4A5SA 3LOCA 3IA2A 4GGGA 5CVJA 2CUFA 4HEA1 2FB9A 2EWMA 5BQOA 4YDQA 5LP6B 4FDUA 1RR8C 5CB4B 3DCFA 5TLSA 2WABA 2HA5A 4HSRA 3CCCA 3OQ1A 1XD2B 4QBHA 2W2MA 3AIIA 1NR7A 3ILHA 5EIHA 2VE8A 2O0MA 3BERA 4H59A 2PWAA 1PG5A 2VYVD 3AUSA 5D5QA 2OAGA 3CCFA 3DNMA 4LK0F 3D6TB 3OG9A 4ZREA 1ULUA 1KORA 2QP9X 5KJEA 4KQMA 2MU1A 5JS6A 1VIDA 1N1DA 4YQEA 3U37A 2CSXA 1AWCA 5AYVA 3TW0A 2PLFA 5IABA 2PD6A 1D8AA 2ZKZA 1IB0A 2FSIA 1T0BA 2RGUA 3B1XA 5IAKA 3GHYA 3UAWA 1PQ4A 1DDOA 3QPVA 2I2DA 3UMJA 4KDPA 5CVDA 3PC7A 1B1AA 1N3IA 1CUWA 2AG8A 5TMPA 1KHHA 4KVZA 3C98A 1GV2A 3DNFA 3DAFA 3CWQA 1TYAE 4QTTB 3U62A 3ZGXA 4CR7A 1LE8B 1T9HA 2J3KA 4KA4A 1RI1A 1D0XA 2ZCJA 2NSJA 3VOTA 2WBMA 2FLVA 2F1KA 3D0OA 3W79A 1NUUA 3LUHA 1WPXA 4N9IA 4LZAA 2R7WA 1WG8A 2OHXA 2DBQA 4C6SA 1DPFA 1Z5OA 3E5QA 1H85A 3HCPA 4QPNA 2ID3A 2DC1A 3KAJA 1U2RA 1B7GO 2BJWA 3DYBA 4KIUA 1EB9A 2ZI4A 4EO7A 1PL0A 4FJ2A 4EG0A 1XK7A 1ULAA 4RS8A 4MV7A 5LBQA 4HV5A 3BXPA 5ESDA 5JNTA 1NBMD 3LVBA 1EWKA 3KD3A 5K8CA 4BE9A 4YT8A 1IEXA 5K05A 3O94A 4B83A 5IVKA 2PCJA 3H99A 2XEXA 3WA7A 2IHYA 3MWLA 4CXMA 2CB9A 1IC6A 4Y0AA 1BA3A 1N0IA 4YELA 5C3UA 5BRJA 2P4EA 4OTZA 3JRDA 4BNMA 3L2OB 3SBXA 1GQYA 3GGCA 1JKOC 1I6HJ 1UDCA 1MH3A 2R7DA 1XL0A 3DTNA 1QX4A 3RC3A 1A8QA 1J20A 1MA0A 1XZKA 3REQB 3W90A 5BWOA 2IX3A 1XVTA 4TZKA 2Y6UA 4ND4A 3IAXA 4HMOA 1RXSA 1KK3A 1H88C 1PJ4A 3BH7A 1CUBA 3G23A 3GVXA 1RHUA 4O4JA 2I6GA 5JDIC 4RB2C 4CLHA 1AB6A 2CUKA 5KQMA 2Z8YA 3R4CA 3R5JA 4J16C 3CT4A 3NXSA 5ULLA 2XQKA 2ICAA 2IZ6A 2HXGA 3NWOA 5JVDB 3GUZA 3SX2A 5L4LA 1JSZA 4BJHB 3DP7A 1WSAA 3F21A 3FUVA 1RC1A 2JFNA 3OETA 1SANA 3BDDA 1GL6A 1E4YA 1HF3A 3OY7A 4ZT5A 4CT5A 2W71A 4JU9A 1OOEA 2Y1XA 1W5FA 5K8LA 3PKZA 2JZNA 3ZHZA 3SEZA 1GCOA 1GOTA 4FYYA 1NI3A 3HB5X 2VBYA 3F4BA 3HWRA 4HRYA 1IVSA 4HD8A 2ZC2A 3M6FA 1ETQA 1J2UA 2CMGA 1CUDA 3BE5A 3BRSA 3L8MA 4YJ3B 3SN6A 3TXXA 1YJ5A 4KN4X 3G02A 5F0FA 3ANYB 4QNNA 4J16A 2VFAA 1TQIA 3NFRA 4MKGA 5A4JA 2HO4A 4U2BA 3HBJA 5KB3A 1KEKA 3DQPA 1UZCA 4KEAA 1FDUA 2BBYA 2HQNA 3O1IC 4W7IA 4YCBA 5DB4A 3R61A 2I4NA 1IBMB 5M5XJ 2EFQA 3OIUA 1JJ8C 1Q19A 4MZDA 2ZRGA 2OLEA 3B1WA 3VVLA 1WRBA 5LQSA 4Q34A 3VYTB 2ZYVX 3W1VA 3ZWAA 4BO6A 5KC8A 1FYMA 4D3DA 3OTHA 4JJEA 3NNSA 1N8KA 2YMMA 1TIBA 5JMTA 3R76A 4LC9A 4R51A 4WXRA 4X41A 4CR8A 5HS4A 4WKNA 4MMZB 1WVRA 3EWSA 4L75A 5BMOA 2WTXA 3CR7A 5JSHA 4MVJA 1NAHA 1IY2A 3V7SA 1GU0A 1KMQA 4IKOA 4KAAA 3HKDA 1MW7A 2X48A 2CY0A 4L1KA 4PLPA 3V6LA 3X2EA 2F3RA 3TGNA 1YK0A 4LB6B 2LBFA 2L82A 3NZEA 1IDN1 3H18A 1AQNA 1I4TD 3LX4A 3UY4A 3WLQA 5ED0A 3IAUA 3BC1A 3VODA 1C3OA 1QH0A 2AXQA 3BHNA 4GI2A 1WJCA 4JJ4A 2KZVA 3GJYA 1OQAA 2H4ZA 4TS1A 1X2BA 1PR2A 2XAFA 1Z16A 4BX2A 1AQJA 1ZXLA 3JQDA 3G5LA 3H2JA 3OWHA 1A95A 2AOUB 1KAEA 4FVTA 2PKCA 4X3OA 5CDFE 2VF8A 1U7DA 4ZVNA 3ZMTA 3WFIA 4QWQA 5LJIA 2WJ6A 5KVQA 2ME0A 4UQLA 4Y33A 3LC1O 3DZFA 3O4GA 4IMRA 2P62A 2OWDA 4YFYA 4RBOA 2B30A 3L8GA 1LNSA 4XYGA 2QAGA 4LFBB 1OX4A 1R5GA 3Q8MA 4YYZA 3HJBA 1N36B 4Y4RA 3CJTA 2ACEA 4LBYA 4RJIA 3V7YA 4D98A 1WH7A 2NQTA 4FR2A 4H6WA 2O1WA 3L6BA 3QYAA 4IDBA 5FL3A 3ZXUB 4KNWA 4NMMA 5IJ0B 1UEXC 3WTZA 1S8AA 5DCWA 3SLGA 3QSYA 4OAQA 4AB1A 3A02A 5IP5A 2CO5A 2K27A 3EW7A 2GEVA 2WUEA 3TQQA 1NM5C 3ZE0B 5IT5A 4PS0A 4M7WA 1E5TA 2WW8A 4PFKA 2XA2A 1H4SA 1YMVA 3BREA 5K3CA 3TINA 3ELUA 5KQPA 1H2ZA 4WBNA 1FU4A 1UWLA 7MDHA 5B7GA 6YASA 1A4UA 2MLGA 2J7PD 3SZOA 1IPFA 3AEKB 1MB3A 2HCTA 4KQJA 1WO8A 3VZCA 1K8YB 4RAGA 4IQ8A 2QL6A 1X0XA 1BA2A 3KJZA 4JC8A 3JQGA 4UREA 5CPBA 2ZWMA 1Q0SA 3VTAA 2N1MA 1PSZA 3TSOA 5CXQA 3TQNA 3V3TA 4Z7OB 5M7EA 1SB9A 3NTVA 1MJFA 1OV4A 3ANSA 4OHBA 4OKIA 3QPSA 1N8TA 4TS9A 4WE3A 2ZCUA 2NPFA 4BKXA 2VHJA 3AP1A 4WCVA 4A0FA 2WQ7A 4MUEA 1X80B 5IKMA 1QE5A 3QLUC 4R1UA 3JALA 3PNBA 5C4XJ 1J25A 1TLHB 3G2LA 5KAIC 4CICA 3DW1X 3NUQA 4OP1A 3OQPA 2WF7A 1ETYA 3TOBA 1WXWA 4JQCA 2FMTA 4MCJA 4QD3A 1DIHA 1E9SA 2ZUTA 4G6DA 4I76A 4B45A 3NGXA 1PEKE 2Z3WA 1B8OA 3H0EA 3FOEC 3TUJC 2K4JA 4M98A 3LP8A 2R8OA 2R3SA 4COKA 4I3HA 3UQYS 1ZSYA 5TRDA 5E1BA 2BZ0A 1U8TA 4N4AA 4PAOA 5BP7A 2ZJRF 2XGDA 2AK2A 5LGTA 4BY9E 2ZSAA 1LV7A 4ETSA 4BY1J 2H31A 2ROQA 3OM1A 2HGCA 1NHGA 3W1WA 4XLEA 1OXSC 4KHPB 1DAFA 4NX2A 5DTQA 2F8TA 3G82C 2QXTA 4HDVA 2G7ZA 4BKMA 4C05A 4ERXA 1X38A 1ZZEA 1FQKA 2MH9A 3KC2A 4LMBA 4MWOA 4NOMA 3LPMA 4MA0A 1SU7A 1VB3A 3BMQB 1UWKA 3LSKA 4MKFA 2DSTA 4MQFB 2UUOA 2YMLA 3K0CC 1KNXA 3PEFA 4WXYB 3GPLA 4ZEMA 1I3NA 2G0AA 3RGGA 4BEWA 2QMEA 2UYYA 4ZICA 5LLDA 3E2IA 2J09A 1SB8A 4RD2A 1KKMA 1Z82A 5TQ2A 4IG4A 3CRVA 5TGZA 3H16A 4DCTA 5ALMA 3P97A 3EZGA 4BBPA 1YRYE 4E15A 5ADVA 2AWOA 3T7JA 1T34A 4GDMA 5CQGA 1DPGA 1UAGA 3DA8A 2WB1A 4D0GA 3AHFA 5F21A 1Q44A 5K0TA 3MHTA 3TD9A 3HJTA 2N0SA 1ETKA 1FOWA 2DHEA 4LJ7A 2BY3A 3A3YA 3GX1A 4BDYA 5A5GA 2OD7A 3STXA 1M34A 2GXGA 2O48X 2OSBA 1RRJA 1ZRNA 4W63A 3UWKA 2O0YA 3CEJA 3OFSA 1ORIA 3VU8A 4DXHA 2IH2A 2HDWA 2G9NA 4GDFA 1ODTC 4JUIA 1VHQA 4OHOA 4XD7D 3FPAA 2R96A 3UAGA 5BNGA 1RRGA 3IUYA 3WKAA 4UCQA 2H7YA 4G0PA 1D5YA 3GT0A 3QXCA 4JAVC 4OX9B 5AD1A 5BWBA 5AJHA 4R1HA 4R3WA 4K9SA 3WIUA 3UKOA 1T6XA 1QU3A 1RRVA 2EBWA 3L1IA 1GO2A 4F12A 3IQIX 4U88A 4E5PA 5IH3A 1XPRA 4LHSA 5FOQA 2NZWA 1AQIA 1U7UA 3NWEA 4C4TA 2GA2A 2E1MB 1LQ1A 2HHJA 3AFMA 3F6CA 4WKBA 1U6JA 4FX5A 2J9RA 4Q5IA 3EEYA 3F3SA 4M36A 1HDXA 2CJYA 4RANA 3GHHA 3W6UA 2PA3A 4EUSA 4KSBA 4EDFA 3CNEA 4IV0A 1DP3A 4Q37A 4Q7QA 3SDSA 4Z2AA 1XYGA 1M2OB 2QD2A 4CDMA 2WT8A 4URFA 2FWJA 1EF4A 4QDKA 1U5BB 3OLZA 1KDPA 1T0JB 4ZYGA 2IEYA 2Z6VA 4RVDA 2F4NA 4Z9AA 3NTUA 4I2NA 1ZLYA 5IYZA 1EFKA 4KO2S 1DPUA 1BHJA 3ETLA 1RBQA 2QGNA 5I7AA 4N40A 4AG6A 5JCZA 2XWSA 4S0HB 4LPKA 4KMOA 1VKNA 2GK3A 3GZTB 3D5SC 4D8UA 4HF1A 4WCFA 2OILA 3HFGA 4QT4A 1Z8DA 1TUBB 1AKYA 2GRUA 4N8SA 2AQEA 2VI6A 5JD3A 2C2KA 4C29A 5L8VA 1OFCX 3AOGA 1FMLA 3BDAA 3F0TA 2ZWAA 2IYTA 4UCXA 3D7SA 4CIAA 2KJBA 1EAYA 5HF9A 2ZP1A 1M66A 3EXEB 2NADA 1BRMA 1O9BA 4HWKA 4R16A 1HOMA 5HFJA 2GPTA 3MYRA 5C32A 3EBPA 1EBUA 3HXKA 3ZJVA 2O2ZA 4RGSA 1O2DA 1TGYA 3MYYA 5ITZB 1GXSA 4DR6B 3PIOF 4TYQA 1DV1A 2E2JJ 1MP0A 4RLFA 1T2KA 1FA9A 1PFKA 2EKBA 2O8KA 1H2RS 3HOSA 1Z5WA 2BFEA 2JGJA 5FOUA 3RODA 1A5JA 4WBSA 2G88A 2ECKA 2R84A 1ETOA 2P3SA 4KACA 3BPXA 4AJOA 1KP3A 4BKOA 4DBZA 5L6LB 2YQ5A 3QV2A 3A0RB 4CIWA 3TG2A 1ZQ3P 4GI3A 3DV8A 5BQTA 2X5KO 1MQAA 4OK3A 5IJAA 2WT4A 3EF3A 1NP6A 2VBGA 4YRFA 1F0KA 3ZDEA 3ZGVA 1YDFA 1C7IA 1I4EB 4C5BA 1SNYA 1IIBA 4XEHA 5HF6A 1T56A 2QY9A 2LY9A 1NYQA 3IE2A 3IIMA 3CXRA 1SQFA 4QTRA 3FVRA 4BHCA 1VTNC 3I8OA 3P0FA 5KNBD 3DOOA 4I14A 5BUQA 3DOIA 2HLDD 3WQRA 2A0YA 3K0SA 1K63A 2QGZA 3QRFF 1XEXB 4G97A 5ERGB 5DULA 2IYPA 3WVNA 4RSGA 2WU1A 3KS9A 3NC4A 1JFFB 4DIDA 2OZLA 4LJLA 1NW5A 1OCPA 1PP4A 3VX3A 2JN6A 3U48A 1S2GA 2RARA 3AYZB 4EA9A 2HHHB 2WIFA 3SX4A 3VI4B 2DN0A 4O59O 2XUIA 1D8TA 5EZHA 4BUPA 2VRCA 3E2PA 3LCCA 3PGJA 5CIQA 3R74A 4ZXFA 3THOA 1O7FA 4UDXX 2QZ8A 3GDGA 2OGSA 1XZAA 4I99C 3OIOA 3QPTA 1K0FA 1C7RA 2AOXA 3OMXA 1DJLA 5FUVA 5FPQA 2G0EA 2WA1A 5JAHA 3L7BA 1AO3A 1N7IA 3RIXA 3HRSA 1MAWA 2M32A 4EY4A 3L2VA 3WIEA 3UUWA 1BE6A 2EKQA 3LSGA 2C9YA 4C4OA 4NCBA 2AC4A 1X7GA 2PIDA 4K6GA 1XHFA 2NP6A 4MUNA 3ZVNA 3UW1A 1XNRB 3IULA 1Y4DE 1PZHA 2QN8A 5LWHA 4N18A 1TO1E 1ZUWA 1DIOB 3QPUA 4UXJA 1USIA 3SFTA 1OY1A 1TZJA 3GDWA 1G5IA 3BBLA 3D3NA 3V8RA 4UTRA 7AT1A 1I33A 2IAIA 1SO8A 3R40A 1YZNA 1RJGA 2GTPA 4YV1A 2EATA 2WVHA 4M0EA 1JYEA 2K7ZA 4G3XA 4TRNA 4I1UA 1QF6A 3LHDA 1H4TA 5JT1A 3RFXA 2EKDA 3FWHA 1FSGA 4TXHA 1Y98A 1PNTA 1Y8RB 2BFCA 1MJ5A 3F6BX 1C29B 3HLYA 3PYMA 1OYIA 4L8LA 1TMKA 2FR0A 4LX0A 4WVFA 5JWOA 3T1QA 1POXA 3HSYA 3C3CA 1Y1SA 2BF4A 1MC8A 2NXEA 3CJQA 3KSZO 3RE1A 3X1DA 1JKQC 5BNFA 4A8JC 2H1FA 4MQ5A 5AKZA 3HJFA 3CUEF 4WPGA 2KZGA 3Q9UA 3K5PA 1ORVA 4WN3A 3O4IA 4XVCA 2RGBA 3HJAA 5C4MA 2H8KA 3UB3A 5DCFA 3A58B 1W29A 5CBPB 2HRRA 5I3ZA 2A94A 1Y8QB 1W9MA 4AU7A 1C3EA 1VXRA 4GR5A 4IHJB 4OFBA 4P22A 2FW9A 4M3EA 1ZAKA 1DS6A 3IVCA 3VR6D 4WBNF 1E2QA 1R6UA 1YB4A 2RGGA 4IFTA 4MS1A 2QVCA 4M46A 3EGDA 5I8ZA 5T67A 4JV5B 4LVUA 4BC1A 2GSWA 3AX6A 1G64A 4FQ7A 3T4PA 5EIEA 2VWHA 4FEEA 2PGDA 2XWJI 1IN6A 2P0EA 3CF4G 1GNQA 2PMFA 4KGVA 1ZK2A 4JJKA 4RMIA 1N6IA 1AVTA 3HYSA 3SEQA 2VH5R 3GUHA 4X6XA 1E1CB 3I3LA 3CGWA 2WYIA 4DDHA 5AH0A 4PSXA 4B8XA 1N6NA 2OCAA 3TLZA 3HJGA 1CR0A 3TDUC 2X1LA 5DEQA 2FV8A 1SU4A 3MWDA 4WIAA 2JCXA 2Q1YA 1XTAA 3H1EA 3UMCA 4Z51A 4CCOA 1VQ9I 3PWTA 2ESRA 1F3OA 2DOFA 2HFHA 4RACA 2PMWB 1U9JA 4C0BA 4F2WA 1SOAA 1OCZH 3OJLA 1NE7A 2Z30A 3H2HA 4LSGA 1KU3A 2JEYA 1Q3TA 1YR7A 2Q5IA 3AZQA 3WL5A 3R8XA 1KEEA 2GT1A 3TNDA 1SULA 1PK8A 3NBAA 3P52A 4FDTA 2JLVA 2X7XA 5IAAA 1UR5A 1UK8A 4US0R 2IHVA 4QJ3A 4RO0A 4MA5A 4EA8A 3EPHA 4Y2SA 5JO0A 1TC2A 3EC2A 3T5AA 2QQBA 2MOKA 3TK1A 1QHFA 1MNAA 1Z0IA 2MSKA 1Z35A 1E4OA 4UM9B 1OZFA 4ZYYA 2YJ4A 4IO0A 2Q1UA 3U60B 3ZCOA 3A1FA 2VEOA 2DTEA 3OPQA 4LY9A 4OI2A 4S0XA 2OXFA 4OSPA 2JPDA 3RJ5A 4NZ9A 5DOZA 3U17A 3BXOA 5JOQA 3AJDA 1SQGA 4HBLA 4OGKA 1EDDA 4YCAA 2BGGA 1J21A 1RJEA 3JSXA 2PWYA 3FTNA 3OQOA 4RB0A 4XM3A 3DHEA