1RETA

Determination of the structure of the dna binding domain of gamma delta resolvase in solution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
43
structure length
43
Chain Sequence
GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA DELTA-RESOLVASE
publication title Determination of the structure of the DNA binding domain of gamma delta resolvase in solution.
pubmed rcsb
source organism Escherichia coli
molecule tags Site-specific recombinase
total genus 9
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1994-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1retA00
3BG9A 4JX5A 4QIWN 4BY7J 1GUUA 3HDDA 1JTXA 1UG2A 1VF9A 4C2MJ 5M3MJ 4MLOA 5C3EJ 3CMYA 1B72A 1MSEC 1FTTA 2EQRA 3O8HA 3QPLA 3ZQFA 2H8RA 5F08A 1RKWA 2ECBA 4A69C 2OPTA 2EZHA 4FCYA 1GT0C 1OJLA 1O4XA 3A02A 2JWTA 3JRGA 1IGNA 2EH3A 1MBEA 2QF7A 3O8GA 4EEFG 3LSGA 2R93J 2XGEA 3ZQIA 3K7AJ 2ME6A 2H1KA 3LSJA 3OOUA 1W0UA 2NS7A 3Q0UA 2E1OA 1ETOA 4NDLA 4RBOA 5EZHA 2FJ1A 1A6IA 2HYJA 4W97A 1ORKA 4A3IJ 4D7MA 1AKHA 1Z0XA 2EZLA 2PMZN 4G12A 2EZIA 2L7MP 1HF0A 3HOWJ 1ETVA 1JT0A 2HXOA 1E3OC 5EZGA 5EGOB 2DA3A 2WAQN 4JX6A 3TP3A 4J19A 1Y1WJ 5J3LA 1TWHJ 4DYCA 3GTJJ 3JRFA 4DW6A 4CYCB 1B8IB 1ZQ3P 2HOAA 4XRSG 3JRBA 4HNVA 1Z77A 3HOVJ 1XS9A 4IHXA 3S2DJ 2NVTJ 1LFUP 3BQZA 4UUSA 5FKLA 3JRHA 3S1NJ 3A01A 4A3FJ 3TW7A 4FTHA 5EG0B 3L1PA 3BTCA 1MSFC 4BBSJ 2RAEA 3ZQCA 3HM5A 1GV5A 1SFOJ 2IAIA 1HOMA 1QRYA 1IDZA 5EF6A 3CDLA 2KT0A 1AU7A 3MKLA 4FE7A 1CQTA 3M4OJ 5F27A 2DJNA 4QTRA 2HXIA 2ME0A 3GTPJ 3WHBA 2DMNA 2DMUA 3HOZJ 2K9QA 2CU7A 1NK2P 3RQIA 2L7FP 3MN2A 1QVTA 1B72B 2IBDA 4FE4A 2EZKA 5GPCA 1P7JA 1Q1VA 1WI3A 4Y52J 1U8BA 3QQAA 1UMQA 1DU0A 2NS8A 5FKKA 1LE8A 2CUFA 2R92J 4IHYA 3QPSA 1T33A 5C4XJ 2LD5A 3BG5A 4XIDA 3MVPA 1FEXA 2TRTA 1XC5A 1FIAA 5E3OA 4BY1J 2JA7J 3S1QJ 3S1MJ 2VI6A 1X58A 1AKHB 3RZDJ 2LTPA 1ZR2A 3HEFA 2NVXJ 3BR0A 4Y7NJ 1HDPA 2LFBA 2LR8A 4QSHA 1K83J 1TWAJ 3FK7A 3BR2A 3OIOA 1WGXA 4IHVA 2JA6J 2QCOA 5IP6A 1I6HJ 2WB1N 3IH4A 4C3IJ 1ETQA 3HKZN 2XPWA 1T56A 5FKMA 4A3CJ 3BTJA 1G2HA 1MBGA 1H88C 1IUFA 4A93J 3Q0WA 1YRNA 5M5YJ 2X48A 2OF7A 4MIMA 1MH4A 5E3LA 1FTZA 1BW5A 4DZJA 4UUSB 4DYQA 5M5WJ 1AHDP 4A3GJ 5F0FA 3A01B 2TCTA 2GLOA 2DA5A 4X1EA 1FIPA 2ID6A 5IP7J 2DMQA 3BT9A 1GVDA 1GV2A 3PO2J 1U78A 1HLVA 1RR7A 3FIWA 2XB0X 1ZK8A 2DN0A 4AUXA 2Y2ZA 3D1NI 3DCFA 4A3DJ 3LSPA 3ZOBA 2IEKA 5GPAA 4ABZA 9ANTA 2Y9YA 3WHCA 3HGGA 1A5JA 1SANA 1R9TJ 2VKEA 2YS9A 1BL0A 2CJJA 2K40A 2YUSA 1DU6A 5F0HA 3B6CA 1LE8B 1APLC 2O7OA 2M2EA 1JUSA 4B3AA 3TEDA 3JREA 4M3DA 2CRGA 2M9HA 5C44J 2XGDA 3HGYA 1JT6A 4DZPA 4GFBA 2JN6A 2VPRA 1RPWA 5M5XJ 3SDGA 1BW6A 2I10A 2HOSA 4M3EA 4M3GA 4XRSA 4FISA 3NARA 3FKIJ 2O9LA 1JKQC 1RKTA 5EDNA 3SFIA 5K7HA 3B6AA 1JUPA 5IP9J 2COBA 2ELKA 1POGA 2LK2A 1BJZA 2WV1A 2CUEA 2MW8A 2DA6A 3S15J 5DTDA 3RKQA 1ETWA 3JRAA 4BXXJ 2E19A 3LOCA 3NAUA 2FX0A 1LFBA 5IOYA 1FJLA 3HOUJ 3K2AA 5JLXA 3BR1A 3GTQJ 1MH3A 1YRNB 1ETKA 1EF4A 2K9NA 1ZKGA 2XRLA 5FLMJ 1VNDA 2HQ5A 1IJWC 4BKXA 5E3MA 1TWGJ 4V2GA 5FKNA 4D7NA 3JRDA 2JJ7A 3PM1A 1HDDC 5J1RA 2JMWA 4W1UA 2DA7A 3JRCA 1XG1A 2LP0A 2DA1A 4I6ZA 3GTLJ 5K7FA 3Q0VA 2Y30A 1UHSA 5F04A 3OSGA 2AHQA 4B1RA 4D5CA 4MO7A 2X6OA 4AYBN 2W48A 1JUMA 1TC3C 4B4CA 1IRZA 3W6VA 2NVYJ 1B8IA 5C4JJ 3H3VK 4A3KJ 2XB5A 1VI0A 3OSFA 1ETYA 1JTYA 4BBRJ 5EEAA 2L9RA 1NK3P 3IV5A 1S7EA 3IH3A 1X2MA 2XSDC 3CQZJ 1H89C 5IYCJ 2P81A 3TP0A 1MBKA 2DMTA 2AO9A 3CCYA 2LVSA 2N8GA 1MBJA 2XPVA 4A3LJ 2YU9J 4MFDA 3LSRA 5J1UA 1RETA 2R0QC 1W0TA 3GTKJ 4M3BA 1WH5A 1IC8A 2VKVA 3S17J 4A3BJ 2LLKA 4IHWA 1IV6A 2NOGA 5J1YA 1H8AC 3Q3SA 4JYKA 3LNQA 5FJ8J 2FQ4A 3GTMJ 5BNGA 1PUFA 1NTCA 3GTOJ 2O8KA 4UUTA 1JKRC 1BA5A 1F43A 2DA4A 3G1MA 1ETXA 4XRMA 1IG7A 5F0CA 2R5YA 1I3QJ 2M0CA 3VPRA 2NVQJ 1JKOC 1ZR4A 4D5FA 3BTLA 2CQXA 5DS9A 2Y0SN 2X9DA 2K9SA 1MBFA 4XK4A 3ZQLA 1WPKA 1OCTC 3HB9A 2MG4A 2R5ZA 5JLWA 2JA8J 4DYRA 1TWFJ 4JP0A 1JKPC 2HOTA 2E2JJ 5EYRA 3UKGA 4I76A 3TW6A 3M3YJ 4M3FA 1IDYA 1I50J 2M8GX 1OCPA 2FD5A 5GP9A 4MFEA 1F36A 1ZTRA 2XGCA 3FISA 1GDTA 3HBLA 1OFCX 4M6VA 3IH2A 2LKXA 3BR6A 4LOCA 4A3EJ 3ZQHA 4X6AJ 1QVUA 5IOZA 3A03A 1X2NA 1D5YA 2ZB9A 5IPAA 4C3HJ 2EBIA 4A3JJ 3I4NJ 1U9NA 2Y9ZA 2Y31A 4XICA 2DA2A 2M34A 2HI3A 4RDUA 1WCMJ 5M3FJ 4JX4A 3ZQGA 2MSYA 1MNMC 2GM4A 1MBHA 2GBYA 3JR9A 3HOYJ 1QPIA 3BR5A 5IYDJ 2MGQA 5E3NA 2VUMJ 5EGOA 4A3MJ 4IEJA 3PO3J 3BR3A 3DEWA 4L5EA 1VFCA 1RESA 1WH7A 3H0GJ 1JJ8C 4V2FA 3S1RJ 3GBGA 1U9OA 2DMPA 1P7IA 2DTZA 1JGGA 1ITYA 1PUFB 3HOXJ 2CQQA 4CYCA 3E7LA 3S2HJ 2JK3A 5F1JA 2XPUA 4S0HB 3JRIA 2HDDA 1Y1VJ 2ECCA 3BTIA 2L0KA 3C2BA 4AC0A 1ZGWA 3G1OA 1JJ6C 2R5YB 2D5VA 2E2HJ 2JA5J 5FLVA 5HODA 2ID3A 5K7ZA 5EG0A 3RZOJ 1K61A 3G1LA 1ENHA 1TWCJ 3FK6A 2R7ZJ 5IYBJ 2G0EA 3I4MJ 4C3JJ 3BG3A 2LY9A 5FKOA 3BQYA 1HCRA 2KDZA 3SJMA 2R5ZB 2E2IJ 2B63J 3S16J 3GTGJ 3S14J 2L7ZA 3F0CA
chains in the Genus database with same CATH superfamily
2E60A 1GLNA 4AVZA 4IQ4A 4QIWN 4BY7J 1GUUA 3HKZA 1EF4A 4RB3C 1B72A 4MLOA 1FTTA 1YE9A 1LDJA 4C2TA 2H8RA 1RKWA 2ECBA 2FSWA 4A69C 2EZHA 4LD5A 2CV2A 2IT0A 3CUOA 3JRGA 2DOFA 1OQYA 3ZQ7A 4FQGA 3WU0A 2R93J 3R4KA 3ZQIA 2VXZA 2VBWA 3FXOA 4A6EA 1U5TA 1YOVB 4G7HF 1Q1HA 1W0UA 3Q0UA 4I99C 3L2CA 2JVGA 2QSGX 1ETOA 4RBOA 2FJ1A 5K5OA 1A6IA 4HPQA 4W97A 4NQWB 3CDIA 3BY6A 5A2QZ 1Z0XA 2EZLA 3RSNA 3NWTA 4QWQA 2PMZN 3OS1A 4G12A 3CESA 4ASNA 4Q4ZF 2QA4I 4HX8A 2FF4A 1FX7A 2KIQA 2OD5A 4RM2A 4RB2C 4HW0A 2ELJA 3HOWJ 1SFEA 4BXUA 2IA1A 1SAXA 5EZGA 2HQRA 4L0ZB 3LFUA 3QAHA 2LY2A 2WAQN 3GLXA 3M1EA 5LHIA 3G71I 4GXOA 1TWHJ 1Y56A 4L9TA 2DXIA 4XKVA 4G6QA 3IKVA 1H0MA 2HOAA 1ZQ3P 3JRBA 4XN3A 3GX4X 2QENA 3WGGA 3RIRA 1LFUP 3TO6A 3BQZA 3ULQB 4UUSA 2M5WA 1MDMA 3JRHA 3TW7A 1GHCA 4RS8A 5EG0B 2NXNB 3IWFA 1RR8C 3J81K 3IC7A 1MSFC 3J80Z 3I54A 4BBSJ 3CO7C 3ZQCA 2EA2A 3VDXA 1T2KA 3K10A 1SFOJ 4HDVA 2HWVA 2EFPA 3AL0C 1HOMA 1QRYA 2JRTA 3PNTA 2KT0A 3F21A 5DUKA 4R8HA 2DJNA 1CGPA 4I2OA 1S5LC 5L3GA 4YELA 3VYUB 3M8FA 1VQ9I 3BDDA 4L5IA 1LEAA 3GZ5A 3WHBA 3HOZJ 1XDSA 2FQ3A 2PEXA 4TV7A 2RDPA 4XN0A 1NK2P 2L02A 2QVOA 3E6MA 1HSJA 1IN4A 2GA2A 3GZNB 2L7FP 4F7ZA 1HKQA 4RGXA 3I64A 4BEHA 5E1XA 4YEJA 3LAJA 3AKZA 1A04A 4BS9A 3EETA 3ZQQA 3H1CA 4PJLA 3V7CA 4UNOA 2CUFA 2DFHA 4P1WA 3N4MA 4A0YA 3CCQI 1BC7C 4N9IA 4BQNA 3BG5A 5E17F 4E70A 2LKSA 1X3ZB 2HYFA 2EA4A 1TLHB 1AOYA 4MEYF 3W6KB 2LRDA 1ZGJA 4EGYA 3S1MJ 1MMAA 2VI6A 4U7DA 3QYBA 3AG4H 2DLLA 5DYMA 1QO0D 1D8KA 3BR0A 2CV0A 5DM7F 3OYMA 3HHHA 2GOMA 1J59A 2QYOA 4ENMA 3E5UA 2FMYA 3F72A 1XDUA 1DP3A 1I6HJ 3PIPF 3VYRB 2L9SA 4AIKA 4M71A 1ETQA 4BHPA 4XSXF 4XLHA 4UUVA 4WF2A 5FKMA 3QRFF 2EK5A 3C18A 3QOPA 1UAAA 5B66C 1MW7A 2WWYA 2OUMA 4CCJA 4EJOA 3W6JB 4UB6C 1FTZA 1WHUA 4HOBA 2IXSA 3DU6A 4EQQA 1VQMI 3A01B 4HNUA 4EMSA 5DCMA 1U6GA 1P4AA 2QGUA 1R1VA 5CVUA 3CLOA 4MTDA 1RR7A 2R3SA 2XB0X 3F22A 2RREA 4NC6A 2ZMEC 4MGRA 3KYCB 4M9ZA 2DN0A 3GFIA 5GTHC 5BPIA 2M1BA 1TNTA 4LIUA 3D1NI 4OWRB 1O57A 2MBFA 3DKXA 5CQGA 4GDFA 2OV7A 2IEKA 1A31A 5L3CA 1O3SA 4IHSA 5GPAA 4ABZA 3BWGA 2IJLA 3I4PA 4NNJA 5HDKA 3OYEA 1KGSA 4KNYA 3BCBA 1A5JA 3JSPA 4GO1A 2AXLA 2A6HF 2CQ7A 3D5RC 2PMUA 1GVJA 2QQ9A 1K78B 3ABMH 3IRRA 2CJJA 2R7FA 1DPUA 3MMYB 4LG3A 1WRJA 1APLC 2GIVA 2O7OA 2P4WA 1BBYA 3L2WA 5HS7A 1Z05A 4B3AA 3TEDA 2F2EA 2L9NA 2CRGA 4M3DA 2PJRA 2XGDA 3CCEI 4Z6YA 1UHMA 1S7OA 4GFBA 2JN6A 1F4KA 3CZ6A 4UHTA 2V7FA 4B09A 2DT7B 1AA7A 5M5XJ 5HDGA 2HPIA 1BW6A 4CCNA 2UXXA 3OYCA 2WAQA 4L9VA 4N9HA 4PJ0C 5CVVA 3SXYA 3NARA 4KN7X 4II3A 2HR3A 4G7ZF 3S3NA 2JQ7A 1JUPA 4C2UA 5IP9J 1I39A 2NNYA 1TP4A 3H9GA 3KP4A 3VSLA 3FBIB 2CQNA 1HA8A 1ONVA 5DTDA 3S15J 1ETWA 3JRAA 5BOXA 2D1VA 4BXXJ 2FX0A 1LFBA 3HOUJ 1FJLA 1MJBA 2ADUA 4C9YA 2HGCA 1MIJA 2QBYB 1ZG3A 3H3UA 5TISC 2MC3A 4XBFA 3Q5FA 1YRNB 1ETKA 3W2WA 1OMIA 2VKHA 2LF8A 4E6KG 3ZMDA 5FLMJ 2HQ5A 4BKXA 4M72A 4S04A 5E1ZB 3MCZA 4WXCA 5FKNA 4EGZA 4PCQA 1YIJI 2JJ7A 1L3LA 1HDDC 3CMMA 2NNNA 4W1UA 2LP0A 3GFLA 1ZAOA 3HRMA 4QPQA 3GTLJ 5K7FA 3JAMK 5KVRA 5F04A 1OR7C 4B1RA 3TGNA 3ZCOA 4D5CA 3BOQA 4AYBN 1TZLA 2KQRA 4BJ6C 2W48A 4M74A 1JUMA 2MH9A 1W5SA 2FOKA 3FXKA 2ZJPF 1VI0A 2R7VA 1JTYA 4PGGA 4BBRJ 2F5FA 4PJJA 1IN5A 1S7EA 2W24A 1R5ID 1YIOA 2DT6A 3CDHA 1OISA 3DPLC 5B3SH 5JR3A 3ESWB 4IVNA 3CQZJ 5HDNA 1IUYA 3WU2C 3GZ6A 1FBUA 1E3PA 1G6NA 1NG6A 1YW8A 3DU5A 2VONA 1KU2A 2VL8A 1YFHA 3K69A 4DNCA 2GQQA 3A1YA 1KU3A 2DODA 2N8GA 3WODF 5D5WB 5KNLA 4H4KC 1QZYA 3OR1C 4A3LJ 1FLIA 4ZZDA 1RETA 1ZG1A 3GMEA 3CD6I 1B59A 2ICWG 1Y8RB 1FMVA 4U88A 4XONA 1D1CA 3GO5A 3FKJA 4A3BJ 2RN7A 4KUMA 1IV6A 4Y33A 1J2XA 2PLYA 1H8AC 4OIOF 4XM3A 1LVAA 1FPQA 1DUXC 1QA6A 2HVSA 3SZTA 1QZZA 3GTMJ 2V26A 1ZARA 5BS6A 1PUFA 1EA3A 4MHGA 3LFKA 4EJWA 5DDGA 2E1NA 2HKOA 3CUQC 3F6VA 2DA4A 2XSJC 2X1DA 4XLNF 2ZXIA 2VB6A 3UNGC 1IG7A 1KZHA 3DP7A 2D45A 2R5YA 1JKOC 1IF1A 4IKFA 3P5JA 2CQXA 2X9DA 2XIGA 3S2WA 3DLLF 3CCVI 2HU9A 4I0AA 2BY1A 1OCTC 2K3PA 2R5ZA 2Q1ZB 2FBIA 1TWFJ 3F23A 2WV0A 2HOTA 2A69F 4GYIA 3TW6A 3M3YJ 1XMKA 4FASD 1REPC 3WU1B 4D9JA 3DWLE 4BDZA 2FD5A 4MFEA 4ZYDA 1ZTRA 4RM3A 5DEQA 4IOCF 4ENKA 3KETA 4KYWA 2GXAA 3F8FA 4IRIA 3NRVA 2F4OB 2V9VA 4M6VA 1UFMA 4E7JA 1PP7U 4BE0A 4X6AJ 3SQNA 1QVUA 2ZNZA 1ZHFA 3I9V2 5IOZA 3PSIA 2AS5F 4CCOA 2QQAA 1MMNA 1X2NA 4RAYA 3TOBA 1KQ9A 1QQIA 4G6DA 3EUKL 3H5NA 5F6FA 1V4RA 1HW2A 1R58A 4O3MA 3KIOA 2LDUA 3JSOA 2GA1A 4CXFA 1KA8A 1NH3A 2HI3A 1RUNA 4BACA 4RDUA 5ICFA 4HLXA 1YTYA 2MSYA 1CF7B 1MBHA 4F55A 4PUSA 5E3NA 4E4HA 3FHNA 3LSKA 5LHGA 1G4DA 4L18B 5B1BH 4M9XA 2BY3A 3HTUA 5FO5A 4BHBA 2CQKA 2HDWA 3BR3A 3R6SA 5J4YA 5DV5A 2K9MA 3H0GJ 4BQQA 3LSMA 3GBGA 1U9OA 2ESNA 4PGHA 4HA8A 3HJEA 5CPRB 4CYCA 1EH7A 5H20A 3S2HJ 5IT9Z 3T1BA 1TT5B 1OYIA 2OC6A 1U8RA 3E5XA 3OL3A 4AC0A 1JJ6C 2D5VA 2ZCWA 3G1OA 2DK5A 5HODA 4ETSA 1KU9A 3OS2A 2R7ZJ 2X1EA 3ABKH 3D5LA 1Y0NA 3I53A 3N05A 5ICCA 1TW3A 5CKTA 2XUBA 3DBLB 3F8MA 4M6YA 4N4OB 2KZVA 3MD2A 5HLHA 4P9UA 3SJMA 3AG3H 3HZJA 3S16J 2QM3A 5ILUA 1YX5A 3H92A 1HC8A 2OAZA 2BW3A 1VQOI 3A4CA 2HFHA 2R7DA 2Z2SB 5HS9A 2IA0A 2WB1A 2A6EF 3U1KA 5HLGA 3CMYA 5M3MJ 2DQLA 4C2MJ 1HBXG 1LJ9A 2HEOA 2KLOA 3NEUA 3QPLA 3ZQFA 5E8GA 3S93A 3G6EI 1FZPB 5F08A 3F3XA 2EV6A 2V79A 2W25A 2XF5A 1OJLA 1GT0C 2JWTA 3DKWA 1RI7A 1YJWI 2LBFA 3O8GA 1XN7A 2L9VA 1IW7F 2XGEA 3KPHA 2XAGA 2H1KA 4KITB 3OOUA 1TT0A 3REOA 1YW9A 3OIPA 1FYLA 1T38A 1S7AA 2E1OA 1DQUA 2R7OA 4HF1A 5EZHA 2DFIA 3CC7I 4LG0A 1V5FA 1AKHA 4D7MA 4LLGF 4RLFA 2DFFA 2M4GA 4PDKA 1W5CC 3VYTB 5FLXZ 1BOAA 2JVHA 1YLFA 2EV5A 2IGNA 4BQAA 2ZKZA 2EFWA 5EGOB 2V1NA 3EUHC 3S3MA 4UB8C 2YR2A 2MH2A 1X4PA 4M9SA 4LIVA 5CVJA 2V9KA 1HW5A 4J19A 5J3LA 3J80K 1L0OC 4DYCA 1FWZA 3ZN0A 2OCCH 3J7YJ 4DW6A 2OZ6A 1B8IB 4XRSG 2PI0A 4HNVA 1XCBA 1Z77A 1WSUA 3HOVJ 2X85A 3U1DA 4IZZA 3LQRA 5CVRA 5FKLA 4FTHA 3BTCA 4AVPA 5LGTA 1JXSA 4BGDA 3ECHA 2F5VA 3FMRA 5F27A 2BY0A 3EYYA 4HSTA 2RQQA 5E1WA 2Z33A 1X1PA 2DMNA 2DMUA 3HUGA 5L3EA 5D5XB 2DOEA 1YYVA 2BEOA 2K9QA 1YITI 1SEUA 1TQMA 2V6EA 2Y0MA 2JRMA 3QP5A 1MJ9A 2IBDA 4RAZA 1YJNI 1IAWA 1Q1VA 2XKOA 1Z1DA 2P6SA 2K5CA 3K4CA 1U8BA 1JHHA 3QQAA 1UMQA 2QKLB 3CP8A 3H36A 2NS8A 1LE8A 1E0EA 3T8TA 5J6XA 2RVCA 3ZN1A 4IHYA 3QPSA 1T33A 2ISZA 2P8TA 2KZGA 3KE2A 4NBQA 2LD5A 1EV7A 2GZWA 2WADA 2BY2A 3PNYA 5H6RA 2TRTA 4UVBA 1XC5A 3QPTA 2DI3A 3KLNA 2JA7J 1XSVA 3FHZA 5L3FA 4G6TB 3RZDJ 4B3XA 1VQ4I 2IP2A 5D6FA 2VODA 2OZUA 1KYWA 5J8CA 1WJCA 3IRQA 4XNFA 2WY8Q 4QSHA 1TWAJ 1BOBA 1E3HA 1Z7UA 3BR2A 1U5TC 5EEHA 1WGXA 3ZP5A 5LLQA 4ZC3A 4IHVA 1T39A 5F1RA 3CF2A 4UVAA 2K3FA 3IH4A 4C3IJ 3ZMTA 3MZ8A 3L2UA 3F8CA 4BNCA 1Z7LA 2HYGD 2X0LA 3RI4A 4ZTJA 1YJ9I 2WTEA 2BYVE 3TOAA 1K4TA 2PMHA 4A3CJ 2M0MA 1SFKA 3K4NA 2B0LA 4WCGA 2EFNA 5LRSA 1U2WA 2OF7A 2R4GA 3V4GA 2O0YA 2ZMEB 4HAMA 4KIFA 1XGOA 3V7RA 4O6JA 3WTVC 1WFXA 4LLNA 1R4MB 2J5OA 2TCTA 2DA5A 1FIPA 2B7EA 3SDBA 5IP7J 3BT9A 4MQVA 2A3SA 3BPXA 3RYRA 1V5EA 1RZ4A 3EUAA 4N4NB 3O6BB 2VPLA 2FE3A 2BGCA 5JHUA 1W36C 4NC8A 4Y4RA 1X3UA 3F9KA 3C7JA 2Y2ZA 3R60A 4KICA 1T08B 4HBLA 4RA2A 3ZOBA 3MKWB 2VBYA 3VWBA 1IRFA 3IUOA 1SFUA 3IP4B 4DOZA 1Z3XA 2P5KA 2LNBA 3V8KA 4BJTA 1BI3A 3WHCA 4PJMA 1MNDA 2GXGA 2HQAA 2BV6A 4D1QA 4CSWA 1SANA 1R9TJ 2MFZA 1D1BA 4B44A 3U2RA 2K40A 1D5VA 3H0DA 3IL2A 4WXDA 1M1EB 1JUSA 3FXJA 3HPGA 2HQNA 1W7PB 1B9NA 2L4AA 4CCKA 4DZPA 2EINH 3KEOA 2RKHA 1RPWA 4I98B 5J47A 5KHDA 1IRXA 3ZMZA 3SDGA 5F64A 5LGNA 4X0GA 4R1HA 1HKTA 4M3GA 2XC7A 1G3WA 5AONA 3ECOA 3FKIJ 1RKTA 2XKPA 1MNEA 3B6AA 4EVIA 2COBA 2BVMA 2XV4S 2DFEA 2WV1A 4CZCA 2MW8A 3HG9A 2DA6A 1SVOA 2L4MA 2MD0A 2VT2A 2E19A 3NAUA 4PSXA 3W3CA 4XKCA 5CQEA 4XR6A 4C30A 3K2AA 1ZELA 2LREA 4U0WA 2BE5F 1SVMA 2HTSA 5JLXA 2A07F 2NVUB 1VQNI 1BIAA 2K02A 3GTQJ 1MH3A 2OQGA 3K6GA 2K9NA 4A2UA 4KA4A 2ZJ2A 3OYJA 1VNDA 4CO8A 3DEEA 1IJWC 3TDZC 1K6OA 1TWGJ 3MAJA 5TGTA 4D7NA 5J1RA 4A0XA 1QGPA 2FUG2 3DPUA 3W2AA 3H3ZA 3VODA 4ITVA 3JRCA 4I6ZA 1Z9CA 1UHSA 3E6BA 3OSGA 2AHQA 4YIIA 3B02A 3PFIA 2X6OA 2QEXI 3RKWA 1EH6A 4DJAA 3ZRGA 3IHUA 4B4CA 2HNHA 4IRGA 2UV1A 2NVYJ 3TBIA 1B8IA 2CV1A 1QZEA 1ETYA 5EEAA 2E71A 1YHQI 2K86A 3IV5A 2X6XA 4YIFA 4I01A 4DIQA 3K4KA 3JTGA 5IYCJ 4HX4A 3GYHX 2F5EA 2AO9A 3CCYA 4PFPA 2LVSA 1WKMA 2RQPA 2XPVA 4G94A 5FFXA 3WGIA 2JSPA 4MFDA 5FRMA 1S72I 1ZLKA 2MD5A 4IX7A 5LEKA 2OBPA 3M1CA 1R22A 1OCRH 4MTEA 3D0SA 3CUQB 4XLEA 2IS2A 3HHGA 4XLAA 1FNNA 5D4RA 1PJRA 4IHWA 4G7OF 1VQ7I 4HQEA 3KZZA 5LGUA 2NOGA 5J1YA 3HL2A 4U0YA 3M9AA 2V1XA 2XAJA 5FD5A 2O8XA 3L09A 1KQ8A 3ABUA 3TKYA 1NTCA 3GTOJ 3I59B 3MZYA 4KIGA 4CYDA 3G1MA 2YX7A 2DT5A 1ETXA 2K4JA 5BPDA 2VBZA 3GUDA 2BBYA 4OIPF 5F0CA 1N78A 3L7WA 4XSZF 1I3QJ 4HDUA 3COAC 1ZR4A 4ZZLA 4DBRA 2CSOA 5DS9A 2Y0SN 5FB2A 2Q2EA 4ZYAA 3HB9A 3RYPA 2O61A 2MG4A 5JLWA 2PMZA 4DYRA 5BQTA 1Y0UA 4YG2F 2R7TA 2JTVA 3HPHA 5AIPA 4WK8F 3WTUC 4ZH4F 4IQJA 4NHJA 1EH8A 1QNTA 1B1BA 4KJZA 1R5GA 4I76A 5GADJ 5D8LB 1ON1A 3CCRI 2Q0OA 2M8GX 3H9QA 4XLPF 1OCPA 3BP8A 3DBHB 3M07A 1SFXA 2XGCA 1HXDA 2IW5A 2YPRA 3HBLA 2XAQA 3DBRB 4BAYA 3MKZA 2KJBA 3B73A 3CJNA 2FNPA 2P6TA 3BR6A 2HZDA 1PUEE 2PQ8A 5H2FC 2JPCA 2ZMEA 3PJRA 2EIMH 3PSFA 1IV8A 1UCRA 3A03A 2KRCA 3DV8A 3QYFA 4PSWA 1P92A 4C3HJ 1SMYF 5D4SA 4EJUA 3I4NJ 2Y9ZA 3OY9A 3E5QA 2Y69H 2HOEA 2TDXA 1FT9A 4NQWA 2ZNYA 2ZFWA 4Y15A 4A12A 4HNTA 4NC7A 5M3FJ 4JX4A 4KMUX 1WQ2A 1IN6A 3HOYJ 1QPIA 2XGXA 5IT9K 2NS0A 2MGQA 2F4MB 2VUMJ 3TO9A 4P96A 4IRHA 3IKTA 3LSIA 3KZYA 4A3MJ 2ZC2A 3PO3J 2KKOA 1VFCA 5E8IA 2EV0A 2VJ5A 3QPHA 2D1HA 2M8EA 4ENJA 5L3BA 3S1RJ 1P7IA 1S3JA 2CQQA 2VN2A 2M45A 3E7LA 3QYEA 3K70C 1X1AA 4Q47A 3VSKA 5F1JA 5DD4A 2V4JC 3JRIA 2FBKA 3V7SA 1Y1VJ 4HLYA 2ECCA 2L0KA 2QZ8A 1ZGWA 1TQPA 4BQOA 1JE8A 3OYKA 3AG1H 5EG0A 2P0WA 3FK6A 3M8EA 1P4WA 2G0EA 3I4MJ 2H94A 3K2ZA 5FKOA 3BQYA 4HV6A 5JHFA 2E2IJ 2JSCA 3IAS2 3G2BA 2B63J 2EFQA 4XOPA 1FYKA 1BN5A 2A61A 2X6WA 3WE3A 1D0YA 2CW8A 3GTGJ 4F92B 2IGKA 4ZYGA 1T0FC 1YI2I 2GXBA 4ZJZA 3FXMA 3HRUA 3BG9A 1XGMA 4OAZA 3EDPA 2FEZA 5JFRA 1G8XA 2XAFA 3FM5A 3Q9VA 1MSEC 3IWZA 3S32A 2EQRA 3O8HA 2GIZA 3JTHA 4G8XA 1IRGA 3ASOH 2OPTA 3WTYC 1O4XA 2E1MC 3A02A 1IGNA 2G9WA 3P9KA 4HF0A 4BH9A 1W5TA 5FLXK 2QF7A 4HG2A 2HDCA 2OTJI 3ZMUA 4IPAA 3RQ4A 3LSJA 2K4BA 2YU3A 1R4NB 2VJJA 1WJDA 4NDLA 1A36A 2BHYA 3JCUC 3HC7A 2HYJA 2XROA 2MABA 1YS7A 5AIQA 1OYYA 5CVIA 3RCOA 1W4MA 2W1OA 2EZIA 2L2OA 3A0BC 1I5ZA 1QHHD 1FBQA 3LQQA 1O7LA 2F48A 2L7MP 3FXLA 3R0JA 1HF0A 1IZ1A 4GRIA 4E7ZA 4XLCA 1ETVA 1RRJA 3I71A 1GXPA 2V1UA 3KP2A 1MMGA 1VQ5I 5HS8A 2DA3A 5KAIC 2X4HA 3I0TA 3BZ6A 5BMZA 4V19K 2DO7A 3I3LA 4FETA 2Q8KA 4JBAA 3U21A 1P9QC 2KIFA 3TP3A 1YW7A 1Y1WJ 4HV5A 3WG9A 1XSDA 5HOOA 2BZTA 4WWCA 2H6CA 3RKXA 3GTJJ 1SAUA 4GCVA 1JGSA 3ONQA 3AG2H 1ZG5A 2CUJA 1PDNC 1XS9A 3FX3A 4RGRA 3S1NJ 3HTSB 3BPVA 3A01A 4QLCU 3BJ6A 3L1PA 4IF4A 2DU9A 1UELB 2A6TA 1YO5C 2CMPA 2KPMA 3E6DA 3HM5A 3SZGA 5LBQA 3CCLI 1R36A 2IAIA 4DBQA 2DDAA 3L2VA 2E5NA 1IDZA 2KDOA 1QBJA 3ABLH 1AU7A 4FE7A 3M4OJ 1P6RA 3I59A 2QSHX 1D0ZA 1RIOH 1BJAA 2HXIA 2ME0A 1PVEA 2OU2A 3WTXC 1ERDA 2DBBA 4XQFA 1QU3A 1E17A 4AIDA 1XSXA 5D8KB 3KYDB 3T8RA 4LK0F 3LWFA 2E34A 2WC2A 3OYAA 1QVTA 4CA0A 1B72B 3VYSB 5E18F 2EZKA 5GPCA 4IHTA 5ERIA 4HX7A 1K78A 1BI0A 4FHTA 2I8DA 2LH9A 1QPMA 1DU0A 2A5WA 2OCEA 2RNJA 2E35A 3DTIA 2O3FA 3OYDA 3OOPA 1EJ9A 3N97A 2W82A 1RUOA 1J09A 2F4IA 2DDBA 3MVPA 4KT5C 2LYCA 1U5TB 2BOLA 1LVKA 4F3QA 4BHCA 3PFYA 2QSFX 4OIRF 1FIAA 4Y3OA 1MD0A 2ZO4A 2BVLA 3GF2A 1SVLA 2LOOA 3HOTA 1LFPA 2LTPA 3DKYA 1ZR2A 3HEFA 2NVXJ 4AYBA 2LR8A 2Z16A 1FOYA 1KQ0A 1K83J 3FK7A 4KT6A 2OA4A 3OIOA 5HLIA 1B6AA 3JW4A 2M3AA 3CMEI 2JA6J 1ZRFA 3G3ZA 1I6XA 3QOEA 4OAYA 3HKZN 2Z99A 2XPWA 5K5QA 3BROA 3MEXA 3C1DA 4UXNA 2QBYA 2FMLA 1BI1A 1S9HA 3BTJA 2ZSIB 1G2HA 2Z3YA 1MBGA 3OWTA 3Q0WA 1YRNA 4A93J 4OU0A 1SMTA 3GW2A 1MH4A 5DCFA 5E3LA 3SEZA 2VT3A 3BJOA 4DZJA 3C2GA 5D5UB 4UUSB 1J5YA 4DYQA 5M5WJ 2E7WA 5GAEJ 3HXLA 1Y39A 1MDMB 1HQCA 2GLOA 4XKWA 4X1EA 3TL4X 4AM3A 2DMQA 4LFUA 4XMYA 1GV2A 5GTIC 3SZPA 4EJTA 1U78A 1YX3A 4P55A 4U7BA 1G3TA 1SD5A 1BR4A 3FIWA 1GXQA 1J7KA 4IO9F 4N0BA 4XORA 2ESHA 2O03A 3DCFA 2VASA 4A3DJ 3LSPA 1DGWY 5KCMA 2CFXA 3BLYA 1T8IA 1Z67A 1TQIA 1Z21A 2W84A 3L2QA 1I1GA 3HGGA 4BXFA 4BEHB 1V3FA 3CCSI 4E7LA 4LB5A 4GYGA 3GLLA 2VKEA 2YS9A 3R61A 1BL0A 2LF7A 5F0HA 1PP8F 3CF5F 1IN8A 1R1TA 1PYVA 2M9HA 5C44J 4O5VA 2PN6A 2XVCA 4LB6B 2VPRA 4RGSA 2WAFA 2PJPA 4GGGA 1S6LA 3V42A 4ESBA 4FX4A 2HOSA 4M3EA 2KISA 4XRSA 1N75A 1JHFA 1JKQC 3DTEA 3L00A 2ZFUA 3BG6A 3SFIA 5K7HA 1FYMA 2ELKA 3K4LA 2IS6A 2LK2A 2OQRA 2QQ8A 4BU2A 1KONA 1SD7A 3K1MA 4A0ZA 3FBNB 3LOCA 3P9CA 3G4SI 3SEQA 2ISYA 5IOYA 2WAEA 3J7AY 3OYNA 5TRDA 3EUHA 2EWNA 1LNWA 4Y17A 2QKMB 2KRFA 3BG7A 3OYHA 2H27A 3L2RA 3LA7A 2XRLA 1FP2A 2VIXA 3LSTA 1MMDA 3BCAA 4KISA 4V2GA 4II2A 3K1PA 3PM1A 2JMWA 1XTAA 3FMQA 2CWEA 1XG1A 2DA1A 3BC8A 2FNAA 4M6XA 2Y30A 4FT8A 5DCMB 4CGZA 3ERED 2D2WA 3DLAA 3KEQA 1WJEA 2ETHA 1USTA 5LRRA 1IRZA 3W6VA 3FMSA 2LSOA 2W4SA 1K6YA 4I7HA 2X1CA 2K9LA 4Z2YA 2CS3A 3OSFA 1NK3P 2L9RA 2J5PA 2VQCA 5D5VB 4LITA 2FXAA 3IH3A 1X2MA 4YIRX 2AQFA 3K4BA 2COMA 1H89C 5K1YA 2HPMA 1MBKA 4F93B 1WVRA 3WG7H 3K0LA 1K79A 2DMTA 2M7BA 1ZLJA 4IJAA 5HNHA 3NQOA 4EJVA 1MBJA 1ZRCA 4KMFA 2YU9J 2VQHA 1TL8A 3SFZA 1DP7P 1CF7A 2HZTA 3FXRA 1I3AA 4M3BA 1ZGAA 1G3YA 2GWRA 2M30A 3J7ZI 1FOXA 2H09A 2K7LA 2LLKA 2VBXA 1ON2A 2P5LC 2XASA 3GVAA 3Q3SA 4JYKA 2Y48A 3LNQA 1W1WE 3MKYB 2FQ4A 2DPUA 2CO5A 2R7XA 2EPFA 2GOXB 2H6BA 2Z5UA 1JKRC 4B8XA 2YSRA 3ZMSA 4AD9A 2UUZA 2STWA 4XRMA 2PFBA 5B5EC 5KAFC 1BR2A 2M0CA 3VPRA 1VQPI 4R79A 4D5FA 1ZN2A 3FF5A 1R1UA 4U0VA 2K9SA 3DQVC 1MBFA 1IO2A 4XK4A 2HVQA 2A05A 1J75A 3VB2A 2VQLA 3HRTA 3HSFA 4HZFA 5IY5H 4JP0A 2QLZA 2F5CA 1NG7A 1FOWA 2E2JJ 3CTAA 2MLGA 3UKGA 3M8JA 1OPCA 3E97A 2CH0A 3MWMA 4ON0A 1YG2A 3V8JA 5GP9A 3OMYA 1F36A 2L54A 3HOSA 4QPOA 1O3TA 2ZJRF 1OFCX 1DDNA 3BZCA 3IH2A 2LKXA 3FXUA 4LOCA 4ESJA 1R71A 4J01A 2FOWA 3Q9SA 1D5YA 2ZB9A 4ESFA 5ILVA 3RDIA 2EIKH 4L9NA 1ACIA 1U9NA 1XMAA 1OCZH 4G9YA 2Y31A 1X19A 4XICA 2DA2A 2KMUA 2DAOA 1WCMJ 4Q48A 3ZQGA 4YRVA 2L01A 2QQBA 4ENNA 1BIBA 3WTZA 5D6EA 1LDDA 1FSHA 4JK1X 1FSEA 5EGOA 4IEJA 2EB7A 3DEWA 4L5EA 4PK4A 3RJPA 3CJRB 4B43A 1W36D 3EPZA 1JJ8C 4V2FA 5ED4A 3PUFA 4KIBA 2DTZA 2EILH 3SHFA 3EQLF 2R7WA 1PUFB 3HOXJ 1ITYA 3DTKA 4LGWA 2JK3A 1J0RA 1TTYA 2KFDA 5EEGA 2XAUA 4ZYEA 2XPUA 1FY7A 2B9SA 4S0HB 4AIJA 2BXYA 2CUZA 2KJCA 5E20A 4P5OA 1XGSA 2XHKA 4RB0A 2DYRH 3BTIA 3C2BA 2NRAC 2R5YB 2JA5J 1J9IA 1QHGA 3RZOJ 1K61A 1G59A 1TWCJ 1A35A 4PJNA 3CMAI 2V9PA 1Y8QB 5DD8A 4C3JJ 2LY9A 3FZVA 1N25A 1SD6A 3HIFA 1HCRA 2KDZA 1S29A 4PZJA 2R5ZB 5E79C 5GAGJ 3QWLA 3C3WA 3ROUA 1MJAA 4BE2A 2E1MB 2L5QA 1X1DA 3S14J 2KL4A 3TQNA 1TNSA 3S8PA 3E1SA 4I0BA 4JX5A 2JUGA 3PUBA 1IXSB 3HDDA 3FWEA 1JTXA 1UG2A 1VF9A 5C3EJ 4XL9A 4BY1J 4IHXA 4BJ5C 1Y6IA 3MQ0A 3ZGKA 4ZDOA 6PAXA 3K4MA 4B47A 4FCYA 4IL6C 2IVMA 2OJED 2EH3A 3KCCA 2P7CB 3HYIA 1MBEA 1Z6RA 3LL7A 4EEFG 3LSGA 4OOIA 2H8WA 3K7AJ 2ME6A 1LQ1A 2NS7A 2JPBA 3RKYA 2XRNA 1ODDA 5CJ9A 1ORKA 1R00A 1T98A 3R0AA 4A3IJ 3X2QH 2LKPA 3O2PE 5ILSA 3PNVA 2P7VB 2E5ZA 3H9JA 3WTTC 2R7UA 1JT0A 2HXOA 1E3OC 1Z91A 1USSA 3BZKA 3PIOF 3L9FA 3LMMA 4ZDLA 3WTWC 2IGOA 4JX6A 1O3QA 3FDYA 2VJIA 2W7NA 3JRFA 2O5RA 4CYCB 2DCEA 2VC1A 5JVTA 2M4KA 2KP6A 4NUBA 3WGHA 3J7AO 5CLSA 1D8JA 2DK8A 2RV8A 4S05A 2NVTJ 1XCVA 3S2DJ 4RB1A 3ZXSA 2E7XA 3KFWX 3RTRA 2ZXHA 4HQMA 5KK1A 4A3FJ 1ZRDA 3GCMA 2LG4A 5CYVA 1BI2A 4BL0B 2RAEA 3MZHA 3GXOA 4B48A 1ZH5A 1GV5A 3QODA 5FD6A 3KEYA 4UVCA 3DFGA 5EF6A 3CDLA 3OIQA 2K27A 3CLQA 1UB9A 3MKLA 4XKBA 1C0WA 1OLTA 1CQTA 5J8FA 4QTRA 2VOPA 2K85A 3OL4A 1X4OA 3GTPJ 1B4AA 4EM0B 2EJRA 1R23A 2IS1A 2BW3B 3LA2A 3J81Z 2CU7A 1MMSA 3K9TA 2ZSHB 4EM2A 3RQIA 1V5GA 3ERMA 3MN2A 1KU7A 4FE4A 2M87A 2V1DA 1P7JA 1SD4A 5GAHJ 1WI3A 3LA3A 4Y52J 5FKKA 2R92J 2M7AA 4IOAF 2RC4A 1WZ2A 2FA5A 3PL8A 2LBFB 5C4XJ 3IAM2 5DUIA 4F52A 4XIDA 1W7PA 4P9FA 1FEXA 2L3DA 4CCMA 4FX0A 1UG0A 3WTSC 5E3OA 3S1QJ 1D1AA 2DQRA 2W57A 4KN4X 2QUFA 2STTA 4LG0B 1X58A 3F8BA 4D0PA 1AKHB 3E0JB 3ASNH 4Y7NJ 4EATA 4YFNF 2VOOA 1HDPA 2LFBA 1X1BA 4CCLA 1BC8C 5B1AH 2JA2A 5DM6F 1V55H 3KX2A 4HEA2 2QCOA 5IP6A 2WB1N 1WJFA 3V8LA 4OINF 2NOJB 5LFAA 4HF2A 1OCOH 3HSEA 1STZA 5IT3A 1O7FA 3DPTA 1T56A 4L5JA 1VQKI 2R7SA 2YX4A 1XGNA 1VTNC 1H88C 5ICEA 1OR7A 2WBMA 1AWCA 1IUFA 3GFMA 1W7PD 3ABTA 5M5YJ 2X48A 4MIMA 1FMWA 3WE2A 3KYLA 1BW5A 1FP1D 2PX9A 4MNUA 3FM3A 1WI9A 1AHDP 2W85A 4A3GJ 5F0FA 4OMZA 2FU4A 2ID6A 1UJ8A 4XRFA 3LSHA 1GVDA 4KFCA 1R7JA 4UV8A 3GWZA 2ELHA 5HVQC 3A2KA 3PO2J 2FBHA 3OYFA 3OYLA 4E7HA 4ZYHA 1HLVA 1FBSA 3OYBA 2RNGA 1ZK8A 4LLLA 5HNFA 5LD2C 4AUXA 3AFHA 1VZ0A 2DJIA 2VC0A 3PQKA 2IPQX 1D0XA 2VE8A 5JVGF 3HUGB 2L7KA 3KP3A 4HYEA 5LEJA 1T0FA 4I09A 3C2HA 3I56I 9ANTA 2Y9YA 2MA3A 4BDYA 2CG4A 3TDUC 2GAUA 3K70D 1G3SA 4XOTA 2IA2A 3QU3A 2YUSA 1DU6A 2Y0SA 3B6CA 1LE8B 1LUJB 2CGPA 3CC2I 4RMNA 1P4XA 2M2EA 3VFZA 3DEUA 2RGVA 3DXJF 5FROA 3JREA 3HGYA 3CUQA 1I1SA 3T0YA 4AWXB 1JT6A 4E7SA 1HKSA 4ZTFA 2XF7A 4CHUA 1XX5A 1MGTA 3QP6A 2W00A 3M7GA 4UV9A 1MZBA 2G7UA 2I10A 1O3RA 1F5TA 4RGUA 1LB2A 4FISA 2MYSA 4L9JA 4BUPA 2O9LA 1D3YA 4I02A 4BYYA 4L0YB 5EDNA 2HVRA 3K1NA 3HRSA 3KP7A 1POGA 1BJZA 4Q5SF 2CUEA 1Z3YA 3CJTB 3RKQA 2VXDA 2UXNA 4Y13A 3FXQA 1XD7A 2PBIA 2KRHA 1U0JA 2A68F 3GEZA 3GFJA 2Z9OA 3BR1A 1K7AA 4LMYA 3ISPA 1ZKGA 3CJQB 3OR2C 2PG4A 2KHMA 3CC4I 3CCMI 2I5UA 2P5VA 5H6QA 3F8NA 5E3MA 3EYIA 4CICA 3P9IA 3JRDA 2KIUA 3VOEA 1WWXA 1B9MA 3HSRA 2DA7A 4AIHA 1JI8A 4JOMA 1MKMA 4M73A 4CZZA 4BE1A 3Q0VA 2O6GE 1YQAA 4MO7A 5ICGA 1IXRC 1X3WB 4LJZF 4A6DA 3CP2A 2V6CA 1OKRA 1TC3C 2FRHA 1YS6A 1RC9A 5C4JJ 3H3VK 1V54H 4A3KJ 2XB5A 3OS0A 4A5MA 3F6OA 2BHZA 2BXZA 1NHAA 2HS5A 4ZDPA 3JAMZ 4HSRA 2XSDC 2XDVA 3I55I 2ZBKA 2P81A 2ZXJA 3TP0A 3QU6A 1XPXA 2CW7A 5FFZA 2VQGA 3U9GA 1FC3A 1T6SA 2IRFG 2LY1A 2C6YA 3LSRA 5J1UA 2R0QC 4E7KA 1LPQA 1I27A 4PFOA 2AQEA 1W0TA 1SC7A 2XAHA 3GTKJ 3BJAA 2MLKA 1WH5A 1IC8A 2LMDA 5L3DA 2VKVA 1A6QA 2DW4A 3ZR8X 1S8NA 1R49A 3S17J 4F91B 1IN7A 5K5RA 3O3KA 3CCJI 2UZKA 2X6YA 1U3EM 1LDKB 2F5DA 4RAGA 1F9NA 5FJ8J 2VKDA 2JUCA 3H5RA 1BM9A 4EM1A 4OMYA 3A0HC 3KP5A 5BNGA 4XLFA 5A2QK 2O8KA 4UUTA 4A5NA 1Z6TA 1BA5A 1F43A 4CH7A 3ML6A 1OCCH 3TO7A 5HLTA 1RNLA 1WJBA 4DGWB 2NVQJ 3NWSA 2VLAA 3CCUI 4H0EA 2JZYA 1DPRA 2EFOA 2Y75A 4K2EA 3E6CC 1VQ6I 3BTLA 2NYXA 1UHWA 3OYGA 4NB5A 3ZQLA 1WPKA 1OYWA 2XF6A 4CUGA 4YFXF 2JA8J 4WX9A 3G73A 3S3OA 2WA0A 1VQ8I 3ZPLA 4IXAA 3T5XA 1JKPC 2EIJH 1ULYA 5EYRA 5LHHA 4M3FA 2QWWA 1R5HA 3ZMVA 1IDYA 4HRIA 1I50J 2F6CA 1X1CA 3SYTA 2DOAA 4U87A 2NAZA 4RAFA 1LKXA 4KDPA 3FISA 4UY8I 2X51A 1GDTA 4YFKF 5FRNA 1K4SA 2IGMA 3OV8A 3H35A 3UR3C 4MEXF 3AL0B 2MC4A 2VJ4A 1ZYRF 4A3EJ 3ZQHA 2IS4A 2G7HA 1EKEA 1E2XA 1H9TA 2H1LA 3W2VA 3RPUA 4EV0A 5IPAA 2EBIA 4RLQA 4A3JJ 2WY7Q 4ANJA 1HW1A 3LAPA 2UWMA 3TMOA 4LK1F 2ZJQF 2A5YB 2M34A 4WXHA 5JI6A 1WJAA 4E7IA 3ELKA 1MNMC 2GM4A 1R6RA 2GBYA 3JR9A 2DYSH 3I5UA 5EJCA 3BR5A 5IYDJ 3AAFA 2E1CA 4JQFA 2HKXA 2R7QA 1H9GA 1T95A 3CO6C 2AXTC 2VE9A 5FGMA 1UZCA 2Z1DA 4DQ2A 4MQ9F 2DTRA 1IXCA 1RESA 1WH7A 1XMXA 1LEBA 1KYZA 2DMPA 3VEPA 3KLOA 4J00A 1XB4A 2CFOA 3P7NA 3RPUD 1N77A 1JGGA 2R7RA 3PQJA 1WJ5A 5TJJA 3I58A 2HDDA 2HTJA 1F1ZA 1FOKA 5J4VA 3D5SC 2LC2A 2E2HJ 5FLVA 3KP6A 2ID3A 4AU7A 5K7ZA 4OIQF 3G1LA 3K4JA 2CYYA 1ENHA 3KZIC 3RPQA 1BR1A 1P2FA 5IYBJ 4CDGA 2DPDA 3BG3A 2E36A 2Q2EB 1TBXA 3H5AA 1TW2A 1DGRM 2JT1A 1HSTA 1VQLI 3DF8A 2KIMA 2CW0F 2ACJA 1ZREA 2PJRB 2L7ZA 3F0CA 2ZXWH 3MFKA 3E3VA 5J40A 3OYIA 2OTLI
chains in the Genus database with same CATH topology
3BG9A 4JX5A 4QIWN 4BY7J 1GUUA 3HDDA 1JTXA 1UG2A 1VF9A 4C2MJ 5M3MJ 4MLOA 5C3EJ 3CMYA 1B72A 1MSEC 1FTTA 2EQRA 3O8HA 3QPLA 3ZQFA 2H8RA 5F08A 1RKWA 2ECBA 4A69C 2OPTA 2EZHA 4FCYA 1GT0C 1OJLA 1O4XA 3A02A 2JWTA 3JRGA 1IGNA 2EH3A 1MBEA 2QF7A 3O8GA 4EEFG 3LSGA 2R93J 2XGEA 3ZQIA 3K7AJ 2ME6A 2H1KA 3LSJA 3OOUA 1W0UA 2NS7A 3Q0UA 2E1OA 1ETOA 4NDLA 4RBOA 5EZHA 2FJ1A 1A6IA 2HYJA 4W97A 1ORKA 4A3IJ 4D7MA 1AKHA 1Z0XA 2EZLA 2PMZN 4G12A 2EZIA 2L7MP 1HF0A 3HOWJ 1ETVA 1JT0A 2HXOA 1E3OC 5EZGA 5EGOB 2DA3A 2WAQN 4JX6A 3TP3A 4J19A 1Y1WJ 5J3LA 1TWHJ 4DYCA 3GTJJ 3JRFA 4DW6A 4CYCB 1B8IB 1ZQ3P 2HOAA 4XRSG 3JRBA 4HNVA 1Z77A 3HOVJ 1XS9A 4IHXA 3S2DJ 2NVTJ 1LFUP 3BQZA 4UUSA 5FKLA 3JRHA 3S1NJ 3A01A 4A3FJ 3TW7A 4FTHA 5EG0B 3L1PA 3BTCA 1MSFC 4BBSJ 2RAEA 3ZQCA 3HM5A 1GV5A 1SFOJ 2IAIA 1HOMA 1QRYA 1IDZA 5EF6A 3CDLA 2KT0A 1AU7A 3MKLA 4FE7A 1CQTA 3M4OJ 5F27A 2DJNA 4QTRA 2HXIA 2ME0A 3GTPJ 3WHBA 2DMNA 2DMUA 3HOZJ 2K9QA 2CU7A 1NK2P 3RQIA 2L7FP 3MN2A 1QVTA 1B72B 2IBDA 4FE4A 2EZKA 5GPCA 1P7JA 1Q1VA 1WI3A 4Y52J 1U8BA 3QQAA 1UMQA 1DU0A 2NS8A 5FKKA 1LE8A 2CUFA 2R92J 4IHYA 3QPSA 1T33A 5C4XJ 2LD5A 3BG5A 4XIDA 3MVPA 1FEXA 2TRTA 1XC5A 1FIAA 5E3OA 4BY1J 2JA7J 3S1QJ 3S1MJ 2VI6A 1X58A 1AKHB 3RZDJ 2LTPA 1ZR2A 3HEFA 2NVXJ 3BR0A 4Y7NJ 1HDPA 2LFBA 2LR8A 4QSHA 1K83J 1TWAJ 3FK7A 3BR2A 3OIOA 1WGXA 4IHVA 2JA6J 2QCOA 5IP6A 1I6HJ 2WB1N 3IH4A 4C3IJ 1ETQA 3HKZN 2XPWA 1T56A 5FKMA 4A3CJ 3BTJA 1G2HA 1MBGA 1H88C 1IUFA 4A93J 3Q0WA 1YRNA 5M5YJ 2X48A 2OF7A 4MIMA 1MH4A 5E3LA 1FTZA 1BW5A 4DZJA 4UUSB 4DYQA 5M5WJ 1AHDP 4A3GJ 5F0FA 3A01B 2TCTA 2GLOA 2DA5A 4X1EA 1FIPA 2ID6A 5IP7J 2DMQA 3BT9A 1GVDA 1GV2A 3PO2J 1U78A 1HLVA 1RR7A 3FIWA 2XB0X 1ZK8A 2DN0A 4AUXA 2Y2ZA 3D1NI 3DCFA 4A3DJ 3LSPA 3ZOBA 2IEKA 5GPAA 4ABZA 9ANTA 2Y9YA 3WHCA 3HGGA 1A5JA 1SANA 1R9TJ 2VKEA 2YS9A 1BL0A 2CJJA 2K40A 2YUSA 1DU6A 5F0HA 3B6CA 1LE8B 1APLC 2O7OA 2M2EA 1JUSA 4B3AA 3TEDA 3JREA 4M3DA 2CRGA 2M9HA 5C44J 2XGDA 3HGYA 1JT6A 4DZPA 4GFBA 2JN6A 2VPRA 1RPWA 5M5XJ 3SDGA 1BW6A 2I10A 2HOSA 4M3EA 4M3GA 4XRSA 4FISA 3NARA 3FKIJ 2O9LA 1JKQC 1RKTA 5EDNA 3SFIA 5K7HA 3B6AA 1JUPA 5IP9J 2COBA 2ELKA 1POGA 2LK2A 1BJZA 2WV1A 2CUEA 2MW8A 2DA6A 3S15J 5DTDA 3RKQA 1ETWA 3JRAA 4BXXJ 2E19A 3LOCA 3NAUA 2FX0A 1LFBA 5IOYA 1FJLA 3HOUJ 3K2AA 5JLXA 3BR1A 3GTQJ 1MH3A 1YRNB 1ETKA 1EF4A 2K9NA 1ZKGA 2XRLA 5FLMJ 1VNDA 2HQ5A 1IJWC 4BKXA 5E3MA 1TWGJ 4V2GA 5FKNA 4D7NA 3JRDA 2JJ7A 3PM1A 1HDDC 5J1RA 2JMWA 4W1UA 2DA7A 3JRCA 1XG1A 2LP0A 2DA1A 4I6ZA 3GTLJ 5K7FA 3Q0VA 2Y30A 1UHSA 5F04A 3OSGA 2AHQA 4B1RA 4D5CA 4MO7A 2X6OA 4AYBN 2W48A 1JUMA 1TC3C 4B4CA 1IRZA 3W6VA 2NVYJ 1B8IA 5C4JJ 3H3VK 4A3KJ 2XB5A 1VI0A 3OSFA 1ETYA 1JTYA 4BBRJ 5EEAA 2L9RA 1NK3P 3IV5A 1S7EA 3IH3A 1X2MA 2XSDC 3CQZJ 1H89C 5IYCJ 2P81A 3TP0A 1MBKA 2DMTA 2AO9A 3CCYA 2LVSA 2N8GA 1MBJA 2XPVA 4A3LJ 2YU9J 4MFDA 3LSRA 5J1UA 1RETA 2R0QC 1W0TA 3GTKJ 4M3BA 1WH5A 1IC8A 2VKVA 3S17J 4A3BJ 2LLKA 4IHWA 1IV6A 2NOGA 5J1YA 1H8AC 3Q3SA 4JYKA 3LNQA 5FJ8J 2FQ4A 3GTMJ 5BNGA 1PUFA 1NTCA 3GTOJ 2O8KA 4UUTA 1JKRC 1BA5A 1F43A 2DA4A 3G1MA 1ETXA 4XRMA 1IG7A 5F0CA 2R5YA 1I3QJ 2M0CA 3VPRA 2NVQJ 1JKOC 1ZR4A 4D5FA 3BTLA 2CQXA 5DS9A 2Y0SN 2X9DA 2K9SA 1MBFA 4XK4A 3ZQLA 1WPKA 1OCTC 3HB9A 2MG4A 2R5ZA 5JLWA 2JA8J 4DYRA 1TWFJ 4JP0A 1JKPC 2HOTA 2E2JJ 5EYRA 3UKGA 4I76A 3TW6A 3M3YJ 4M3FA 1IDYA 1I50J 2M8GX 1OCPA 2FD5A 5GP9A 4MFEA 1F36A 1ZTRA 2XGCA 3FISA 1GDTA 3HBLA 1OFCX 4M6VA 3IH2A 2LKXA 3BR6A 4LOCA 4A3EJ 3ZQHA 4X6AJ 1QVUA 5IOZA 3A03A 1X2NA 1D5YA 2ZB9A 5IPAA 4C3HJ 2EBIA 4A3JJ 3I4NJ 1U9NA 2Y9ZA 2Y31A 4XICA 2DA2A 2M34A 2HI3A 4RDUA 1WCMJ 5M3FJ 4JX4A 3ZQGA 2MSYA 1MNMC 2GM4A 1MBHA 2GBYA 3JR9A 3HOYJ 1QPIA 3BR5A 5IYDJ 2MGQA 5E3NA 2VUMJ 5EGOA 4A3MJ 4IEJA 3PO3J 3BR3A 3DEWA 4L5EA 1VFCA 1RESA 1WH7A 3H0GJ 1JJ8C 4V2FA 3S1RJ 3GBGA 1U9OA 2DMPA 1P7IA 2DTZA 1JGGA 1ITYA 1PUFB 3HOXJ 2CQQA 4CYCA 3E7LA 3S2HJ 2JK3A 5F1JA 2XPUA 4S0HB 3JRIA 2HDDA 1Y1VJ 2ECCA 3BTIA 2L0KA 3C2BA 4AC0A 1ZGWA 3G1OA 1JJ6C 2R5YB 2D5VA 2E2HJ 2JA5J 5FLVA 5HODA 2ID3A 5K7ZA 5EG0A 3RZOJ 1K61A 3G1LA 1ENHA 1TWCJ 3FK6A 2R7ZJ 5IYBJ 2G0EA 3I4MJ 4C3JJ 3BG3A 2LY9A 5FKOA 3BQYA 1HCRA 2KDZA 3SJMA 2R5ZB 2E2IJ 2B63J 3S16J 3GTGJ 3S14J 2L7ZA 3F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG9 A;  4JX5 A;  4QIW N;  4BY7 J;  1GUU A;  3HDD A;  1JTX A;  1UG2 A;  1VF9 A;  4C2M J;  5M3M J;  4MLO A;  5C3E J;  3CMY A;  1B72 A;  1MSE C;  1FTT A;  2EQR A;  3O8H A;  3QPL A;  3ZQF A;  2H8R A;  5F08 A;  1RKW A;  2ECB A;  4A69 C;  2OPT A;  2EZH A;  4FCY A;  1GT0 C;  1OJL A;  1O4X A;  3A02 A;  2JWT A;  3JRG A;  1IGN A;  2EH3 A;  1MBE A;  2QF7 A;  3O8G A;  4EEF G;  3LSG A;  2R93 J;  2XGE A;  3ZQI A;  3K7A J;  2ME6 A;  2H1K A;  3LSJ A;  3OOU A;  1W0U A;  2NS7 A;  3Q0U A;  2E1O A;  1ETO A;  4NDL A;  4RBO A;  5EZH A;  2FJ1 A;  1A6I A;  2HYJ A;  4W97 A;  1ORK A;  4A3I J;  4D7M A;  1AKH A;  1Z0X A;  2EZL A;  2PMZ N;  4G12 A;  2EZI A;  2L7M P;  1HF0 A;  3HOW J;  1ETV A;  1JT0 A;  2HXO A;  1E3O C;  5EZG A;  5EGO B;  2DA3 A;  2WAQ N;  4JX6 A;  3TP3 A;  4J19 A;  1Y1W J;  5J3L A;  1TWH J;  4DYC A;  3GTJ J;  3JRF A;  4DW6 A;  4CYC B;  1B8I B;  1ZQ3 P;  2HOA A;  4XRS G;  3JRB A;  4HNV A;  1Z77 A;  3HOV J;  1XS9 A;  4IHX A;  3S2D J;  2NVT J;  1LFU P;  3BQZ A;  4UUS A;  5FKL A;  3JRH A;  3S1N J;  3A01 A;  4A3F J;  3TW7 A;  4FTH A;  5EG0 B;  3L1P A;  3BTC A;  1MSF C;  4BBS J;  2RAE A;  3ZQC A;  3HM5 A;  1GV5 A;  1SFO J;  2IAI A;  1HOM A;  1QRY A;  1IDZ A;  5EF6 A;  3CDL A;  2KT0 A;  1AU7 A;  3MKL A;  4FE7 A;  1CQT A;  3M4O J;  5F27 A;  2DJN A;  4QTR A;  2HXI A;  2ME0 A;  3GTP J;  3WHB A;  2DMN A;  2DMU A;  3HOZ J;  2K9Q A;  2CU7 A;  1NK2 P;  3RQI A;  2L7F P;  3MN2 A;  1QVT A;  1B72 B;  2IBD A;  4FE4 A;  2EZK A;  5GPC A;  1P7J A;  1Q1V A;  1WI3 A;  4Y52 J;  1U8B A;  3QQA A;  1UMQ A;  1DU0 A;  2NS8 A;  5FKK A;  1LE8 A;  2CUF A;  2R92 J;  4IHY A;  3QPS A;  1T33 A;  5C4X J;  2LD5 A;  3BG5 A;  4XID A;  3MVP A;  1FEX A;  2TRT A;  1XC5 A;  1FIA A;  5E3O A;  4BY1 J;  2JA7 J;  3S1Q J;  3S1M J;  2VI6 A;  1X58 A;  1AKH B;  3RZD J;  2LTP A;  1ZR2 A;  3HEF A;  2NVX J;  3BR0 A;  4Y7N J;  1HDP A;  2LFB A;  2LR8 A;  4QSH A;  1K83 J;  1TWA J;  3FK7 A;  3BR2 A;  3OIO A;  1WGX A;  4IHV A;  2JA6 J;  2QCO A;  5IP6 A;  1I6H J;  2WB1 N;  3IH4 A;  4C3I J;  1ETQ A;  3HKZ N;  2XPW A;  1T56 A;  5FKM A;  4A3C J;  3BTJ A;  1G2H A;  1MBG A;  1H88 C;  1IUF A;  4A93 J;  3Q0W A;  1YRN A;  5M5Y J;  2X48 A;  2OF7 A;  4MIM A;  1MH4 A;  5E3L A;  1FTZ A;  1BW5 A;  4DZJ A;  4UUS B;  4DYQ A;  5M5W J;  1AHD P;  4A3G J;  5F0F A;  3A01 B;  2TCT A;  2GLO A;  2DA5 A;  4X1E A;  1FIP A;  2ID6 A;  5IP7 J;  2DMQ A;  3BT9 A;  1GVD A;  1GV2 A;  3PO2 J;  1U78 A;  1HLV A;  1RR7 A;  3FIW A;  2XB0 X;  1ZK8 A;  2DN0 A;  4AUX A;  2Y2Z A;  3D1N I;  3DCF A;  4A3D J;  3LSP A;  3ZOB A;  2IEK A;  5GPA A;  4ABZ A;  9ANT A;  2Y9Y A;  3WHC A;  3HGG A;  1A5J A;  1SAN A;  1R9T J;  2VKE A;  2YS9 A;  1BL0 A;  2CJJ A;  2K40 A;  2YUS A;  1DU6 A;  5F0H A;  3B6C A;  1LE8 B;  1APL C;  2O7O A;  2M2E A;  1JUS A;  4B3A A;  3TED A;  3JRE A;  4M3D A;  2CRG A;  2M9H A;  5C44 J;  2XGD A;  3HGY A;  1JT6 A;  4DZP A;  4GFB A;  2JN6 A;  2VPR A;  1RPW A;  5M5X J;  3SDG A;  1BW6 A;  2I10 A;  2HOS A;  4M3E A;  4M3G A;  4XRS A;  4FIS A;  3NAR A;  3FKI J;  2O9L A;  1JKQ C;  1RKT A;  5EDN A;  3SFI A;  5K7H A;  3B6A A;  1JUP A;  5IP9 J;  2COB A;  2ELK A;  1POG A;  2LK2 A;  1BJZ A;  2WV1 A;  2CUE A;  2MW8 A;  2DA6 A;  3S15 J;  5DTD A;  3RKQ A;  1ETW A;  3JRA A;  4BXX J;  2E19 A;  3LOC A;  3NAU A;  2FX0 A;  1LFB A;  5IOY A;  1FJL A;  3HOU J;  3K2A A;  5JLX A;  3BR1 A;  3GTQ J;  1MH3 A;  1YRN B;  1ETK A;  1EF4 A;  2K9N A;  1ZKG A;  2XRL A;  5FLM J;  1VND A;  2HQ5 A;  1IJW C;  4BKX A;  5E3M A;  1TWG J;  4V2G A;  5FKN A;  4D7N A;  3JRD A;  2JJ7 A;  3PM1 A;  1HDD C;  5J1R A;  2JMW A;  4W1U A;  2DA7 A;  3JRC A;  1XG1 A;  2LP0 A;  2DA1 A;  4I6Z A;  3GTL J;  5K7F A;  3Q0V A;  2Y30 A;  1UHS A;  5F04 A;  3OSG A;  2AHQ A;  4B1R A;  4D5C A;  4MO7 A;  2X6O A;  4AYB N;  2W48 A;  1JUM A;  1TC3 C;  4B4C A;  1IRZ A;  3W6V A;  2NVY J;  1B8I A;  5C4J J;  3H3V K;  4A3K J;  2XB5 A;  1VI0 A;  3OSF A;  1ETY A;  1JTY A;  4BBR J;  5EEA A;  2L9R A;  1NK3 P;  3IV5 A;  1S7E A;  3IH3 A;  1X2M A;  2XSD C;  3CQZ J;  1H89 C;  5IYC J;  2P81 A;  3TP0 A;  1MBK A;  2DMT A;  2AO9 A;  3CCY A;  2LVS A;  2N8G A;  1MBJ A;  2XPV A;  4A3L J;  2YU9 J;  4MFD A;  3LSR A;  5J1U A;  1RET A;  2R0Q C;  1W0T A;  3GTK J;  4M3B A;  1WH5 A;  1IC8 A;  2VKV A;  3S17 J;  4A3B J;  2LLK A;  4IHW A;  1IV6 A;  2NOG A;  5J1Y A;  1H8A C;  3Q3S A;  4JYK A;  3LNQ A;  5FJ8 J;  2FQ4 A;  3GTM J;  5BNG A;  1PUF A;  1NTC A;  3GTO J;  2O8K A;  4UUT A;  1JKR C;  1BA5 A;  1F43 A;  2DA4 A;  3G1M A;  1ETX A;  4XRM A;  1IG7 A;  5F0C A;  2R5Y A;  1I3Q J;  2M0C A;  3VPR A;  2NVQ J;  1JKO C;  1ZR4 A;  4D5F A;  3BTL A;  2CQX A;  5DS9 A;  2Y0S N;  2X9D A;  2K9S A;  1MBF A;  4XK4 A;  3ZQL A;  1WPK A;  1OCT C;  3HB9 A;  2MG4 A;  2R5Z A;  5JLW A;  2JA8 J;  4DYR A;  1TWF J;  4JP0 A;  1JKP C;  2HOT A;  2E2J J;  5EYR A;  3UKG A;  4I76 A;  3TW6 A;  3M3Y J;  4M3F A;  1IDY A;  1I50 J;  2M8G X;  1OCP A;  2FD5 A;  5GP9 A;  4MFE A;  1F36 A;  1ZTR A;  2XGC A;  3FIS A;  1GDT A;  3HBL A;  1OFC X;  4M6V A;  3IH2 A;  2LKX A;  3BR6 A;  4LOC A;  4A3E J;  3ZQH A;  4X6A J;  1QVU A;  5IOZ A;  3A03 A;  1X2N A;  1D5Y A;  2ZB9 A;  5IPA A;  4C3H J;  2EBI A;  4A3J J;  3I4N J;  1U9N A;  2Y9Z A;  2Y31 A;  4XIC A;  2DA2 A;  2M34 A;  2HI3 A;  4RDU A;  1WCM J;  5M3F J;  4JX4 A;  3ZQG A;  2MSY A;  1MNM C;  2GM4 A;  1MBH A;  2GBY A;  3JR9 A;  3HOY J;  1QPI A;  3BR5 A;  5IYD J;  2MGQ A;  5E3N A;  2VUM J;  5EGO A;  4A3M J;  4IEJ A;  3PO3 J;  3BR3 A;  3DEW A;  4L5E A;  1VFC A;  1RES A;  1WH7 A;  3H0G J;  1JJ8 C;  4V2F A;  3S1R J;  3GBG A;  1U9O A;  2DMP A;  1P7I A;  2DTZ A;  1JGG A;  1ITY A;  1PUF B;  3HOX J;  2CQQ A;  4CYC A;  3E7L A;  3S2H J;  2JK3 A;  5F1J A;  2XPU A;  4S0H B;  3JRI A;  2HDD A;  1Y1V J;  2ECC A;  3BTI A;  2L0K A;  3C2B A;  4AC0 A;  1ZGW A;  3G1O A;  1JJ6 C;  2R5Y B;  2D5V A;  2E2H J;  2JA5 J;  5FLV A;  5HOD A;  2ID3 A;  5K7Z A;  5EG0 A;  3RZO J;  1K61 A;  3G1L A;  1ENH A;  1TWC J;  3FK6 A;  2R7Z J;  5IYB J;  2G0E A;  3I4M J;  4C3J J;  3BG3 A;  2LY9 A;  5FKO A;  3BQY A;  1HCR A;  2KDZ A;  3SJM A;  2R5Z B;  2E2I J;  2B63 J;  3S16 J;  3GTG J;  3S14 J;  2L7Z A;  3F0C A; 
#chains in the Genus database with same CATH topology
 2E60 A;  1GLN A;  4AVZ A;  4IQ4 A;  4QIW N;  4BY7 J;  1GUU A;  3HKZ A;  1EF4 A;  4RB3 C;  1B72 A;  4MLO A;  1FTT A;  1YE9 A;  1LDJ A;  4C2T A;  2H8R A;  1RKW A;  2ECB A;  2FSW A;  4A69 C;  2EZH A;  4LD5 A;  2CV2 A;  2IT0 A;  3CUO A;  3JRG A;  2DOF A;  1OQY A;  3ZQ7 A;  4FQG A;  3WU0 A;  2R93 J;  3R4K A;  3ZQI A;  2VXZ A;  2VBW A;  3FXO A;  4A6E A;  1U5T A;  1YOV B;  4G7H F;  1Q1H A;  1W0U A;  3Q0U A;  4I99 C;  3L2C A;  2JVG A;  2QSG X;  1ETO A;  4RBO A;  2FJ1 A;  5K5O A;  1A6I A;  4HPQ A;  4W97 A;  4NQW B;  3CDI A;  3BY6 A;  5A2Q Z;  1Z0X A;  2EZL A;  3RSN A;  3NWT A;  4QWQ A;  2PMZ N;  3OS1 A;  4G12 A;  3CES A;  4ASN A;  4Q4Z F;  2QA4 I;  4HX8 A;  2FF4 A;  1FX7 A;  2KIQ A;  2OD5 A;  4RM2 A;  4RB2 C;  4HW0 A;  2ELJ A;  3HOW J;  1SFE A;  4BXU A;  2IA1 A;  1SAX A;  5EZG A;  2HQR A;  4L0Z B;  3LFU A;  3QAH A;  2LY2 A;  2WAQ N;  3GLX A;  3M1E A;  5LHI A;  3G71 I;  4GXO A;  1TWH J;  1Y56 A;  4L9T A;  2DXI A;  4XKV A;  4G6Q A;  3IKV A;  1H0M A;  2HOA A;  1ZQ3 P;  3JRB A;  4XN3 A;  3GX4 X;  2QEN A;  3WGG A;  3RIR A;  1LFU P;  3TO6 A;  3BQZ A;  3ULQ B;  4UUS A;  2M5W A;  1MDM A;  3JRH A;  3TW7 A;  1GHC A;  4RS8 A;  5EG0 B;  2NXN B;  3IWF A;  1RR8 C;  3J81 K;  3IC7 A;  1MSF C;  3J80 Z;  3I54 A;  4BBS J;  3CO7 C;  3ZQC A;  2EA2 A;  3VDX A;  1T2K A;  3K10 A;  1SFO J;  4HDV A;  2HWV A;  2EFP A;  3AL0 C;  1HOM A;  1QRY A;  2JRT A;  3PNT A;  2KT0 A;  3F21 A;  5DUK A;  4R8H A;  2DJN A;  1CGP A;  4I2O A;  1S5L C;  5L3G A;  4YEL A;  3VYU B;  3M8F A;  1VQ9 I;  3BDD A;  4L5I A;  1LEA A;  3GZ5 A;  3WHB A;  3HOZ J;  1XDS A;  2FQ3 A;  2PEX A;  4TV7 A;  2RDP A;  4XN0 A;  1NK2 P;  2L02 A;  2QVO A;  3E6M A;  1HSJ A;  1IN4 A;  2GA2 A;  3GZN B;  2L7F P;  4F7Z A;  1HKQ A;  4RGX A;  3I64 A;  4BEH A;  5E1X A;  4YEJ A;  3LAJ A;  3AKZ A;  1A04 A;  4BS9 A;  3EET A;  3ZQQ A;  3H1C A;  4PJL A;  3V7C A;  4UNO A;  2CUF A;  2DFH A;  4P1W A;  3N4M A;  4A0Y A;  3CCQ I;  1BC7 C;  4N9I A;  4BQN A;  3BG5 A;  5E17 F;  4E70 A;  2LKS A;  1X3Z B;  2HYF A;  2EA4 A;  1TLH B;  1AOY A;  4MEY F;  3W6K B;  2LRD A;  1ZGJ A;  4EGY A;  3S1M J;  1MMA A;  2VI6 A;  4U7D A;  3QYB A;  3AG4 H;  2DLL A;  5DYM A;  1QO0 D;  1D8K A;  3BR0 A;  2CV0 A;  5DM7 F;  3OYM A;  3HHH A;  2GOM A;  1J59 A;  2QYO A;  4ENM A;  3E5U A;  2FMY A;  3F72 A;  1XDU A;  1DP3 A;  1I6H J;  3PIP F;  3VYR B;  2L9S A;  4AIK A;  4M71 A;  1ETQ A;  4BHP A;  4XSX F;  4XLH A;  4UUV A;  4WF2 A;  5FKM A;  3QRF F;  2EK5 A;  3C18 A;  3QOP A;  1UAA A;  5B66 C;  1MW7 A;  2WWY A;  2OUM A;  4CCJ A;  4EJO A;  3W6J B;  4UB6 C;  1FTZ A;  1WHU A;  4HOB A;  2IXS A;  3DU6 A;  4EQQ A;  1VQM I;  3A01 B;  4HNU A;  4EMS A;  5DCM A;  1U6G A;  1P4A A;  2QGU A;  1R1V A;  5CVU A;  3CLO A;  4MTD A;  1RR7 A;  2R3S A;  2XB0 X;  3F22 A;  2RRE A;  4NC6 A;  2ZME C;  4MGR A;  3KYC B;  4M9Z A;  2DN0 A;  3GFI A;  5GTH C;  5BPI A;  2M1B A;  1TNT A;  4LIU A;  3D1N I;  4OWR B;  1O57 A;  2MBF A;  3DKX A;  5CQG A;  4GDF A;  2OV7 A;  2IEK A;  1A31 A;  5L3C A;  1O3S A;  4IHS A;  5GPA A;  4ABZ A;  3BWG A;  2IJL A;  3I4P A;  4NNJ A;  5HDK A;  3OYE A;  1KGS A;  4KNY A;  3BCB A;  1A5J A;  3JSP A;  4GO1 A;  2AXL A;  2A6H F;  2CQ7 A;  3D5R C;  2PMU A;  1GVJ A;  2QQ9 A;  1K78 B;  3ABM H;  3IRR A;  2CJJ A;  2R7F A;  1DPU A;  3MMY B;  4LG3 A;  1WRJ A;  1APL C;  2GIV A;  2O7O A;  2P4W A;  1BBY A;  3L2W A;  5HS7 A;  1Z05 A;  4B3A A;  3TED A;  2F2E A;  2L9N A;  2CRG A;  4M3D A;  2PJR A;  2XGD A;  3CCE I;  4Z6Y A;  1UHM A;  1S7O A;  4GFB A;  2JN6 A;  1F4K A;  3CZ6 A;  4UHT A;  2V7F A;  4B09 A;  2DT7 B;  1AA7 A;  5M5X J;  5HDG A;  2HPI A;  1BW6 A;  4CCN A;  2UXX A;  3OYC A;  2WAQ A;  4L9V A;  4N9H A;  4PJ0 C;  5CVV A;  3SXY A;  3NAR A;  4KN7 X;  4II3 A;  2HR3 A;  4G7Z F;  3S3N A;  2JQ7 A;  1JUP A;  4C2U A;  5IP9 J;  1I39 A;  2NNY A;  1TP4 A;  3H9G A;  3KP4 A;  3VSL A;  3FBI B;  2CQN A;  1HA8 A;  1ONV A;  5DTD A;  3S15 J;  1ETW A;  3JRA A;  5BOX A;  2D1V A;  4BXX J;  2FX0 A;  1LFB A;  3HOU J;  1FJL A;  1MJB A;  2ADU A;  4C9Y A;  2HGC A;  1MIJ A;  2QBY B;  1ZG3 A;  3H3U A;  5TIS C;  2MC3 A;  4XBF A;  3Q5F A;  1YRN B;  1ETK A;  3W2W A;  1OMI A;  2VKH A;  2LF8 A;  4E6K G;  3ZMD A;  5FLM J;  2HQ5 A;  4BKX A;  4M72 A;  4S04 A;  5E1Z B;  3MCZ A;  4WXC A;  5FKN A;  4EGZ A;  4PCQ A;  1YIJ I;  2JJ7 A;  1L3L A;  1HDD C;  3CMM A;  2NNN A;  4W1U A;  2LP0 A;  3GFL A;  1ZAO A;  3HRM A;  4QPQ A;  3GTL J;  5K7F A;  3JAM K;  5KVR A;  5F04 A;  1OR7 C;  4B1R A;  3TGN A;  3ZCO A;  4D5C A;  3BOQ A;  4AYB N;  1TZL A;  2KQR A;  4BJ6 C;  2W48 A;  4M74 A;  1JUM A;  2MH9 A;  1W5S A;  2FOK A;  3FXK A;  2ZJP F;  1VI0 A;  2R7V A;  1JTY A;  4PGG A;  4BBR J;  2F5F A;  4PJJ A;  1IN5 A;  1S7E A;  2W24 A;  1R5I D;  1YIO A;  2DT6 A;  3CDH A;  1OIS A;  3DPL C;  5B3S H;  5JR3 A;  3ESW B;  4IVN A;  3CQZ J;  5HDN A;  1IUY A;  3WU2 C;  3GZ6 A;  1FBU A;  1E3P A;  1G6N A;  1NG6 A;  1YW8 A;  3DU5 A;  2VON A;  1KU2 A;  2VL8 A;  1YFH A;  3K69 A;  4DNC A;  2GQQ A;  3A1Y A;  1KU3 A;  2DOD A;  2N8G A;  3WOD F;  5D5W B;  5KNL A;  4H4K C;  1QZY A;  3OR1 C;  4A3L J;  1FLI A;  4ZZD A;  1RET A;  1ZG1 A;  3GME A;  3CD6 I;  1B59 A;  2ICW G;  1Y8R B;  1FMV A;  4U88 A;  4XON A;  1D1C A;  3GO5 A;  3FKJ A;  4A3B J;  2RN7 A;  4KUM A;  1IV6 A;  4Y33 A;  1J2X A;  2PLY A;  1H8A C;  4OIO F;  4XM3 A;  1LVA A;  1FPQ A;  1DUX C;  1QA6 A;  2HVS A;  3SZT A;  1QZZ A;  3GTM J;  2V26 A;  1ZAR A;  5BS6 A;  1PUF A;  1EA3 A;  4MHG A;  3LFK A;  4EJW A;  5DDG A;  2E1N A;  2HKO A;  3CUQ C;  3F6V A;  2DA4 A;  2XSJ C;  2X1D A;  4XLN F;  2ZXI A;  2VB6 A;  3UNG C;  1IG7 A;  1KZH A;  3DP7 A;  2D45 A;  2R5Y A;  1JKO C;  1IF1 A;  4IKF A;  3P5J A;  2CQX A;  2X9D A;  2XIG A;  3S2W A;  3DLL F;  3CCV I;  2HU9 A;  4I0A A;  2BY1 A;  1OCT C;  2K3P A;  2R5Z A;  2Q1Z B;  2FBI A;  1TWF J;  3F23 A;  2WV0 A;  2HOT A;  2A69 F;  4GYI A;  3TW6 A;  3M3Y J;  1XMK A;  4FAS D;  1REP C;  3WU1 B;  4D9J A;  3DWL E;  4BDZ A;  2FD5 A;  4MFE A;  4ZYD A;  1ZTR A;  4RM3 A;  5DEQ A;  4IOC F;  4ENK A;  3KET A;  4KYW A;  2GXA A;  3F8F A;  4IRI A;  3NRV A;  2F4O B;  2V9V A;  4M6V A;  1UFM A;  4E7J A;  1PP7 U;  4BE0 A;  4X6A J;  3SQN A;  1QVU A;  2ZNZ A;  1ZHF A;  3I9V 2;  5IOZ A;  3PSI A;  2AS5 F;  4CCO A;  2QQA A;  1MMN A;  1X2N A;  4RAY A;  3TOB A;  1KQ9 A;  1QQI A;  4G6D A;  3EUK L;  3H5N A;  5F6F A;  1V4R A;  1HW2 A;  1R58 A;  4O3M A;  3KIO A;  2LDU A;  3JSO A;  2GA1 A;  4CXF A;  1KA8 A;  1NH3 A;  2HI3 A;  1RUN A;  4BAC A;  4RDU A;  5ICF A;  4HLX A;  1YTY A;  2MSY A;  1CF7 B;  1MBH A;  4F55 A;  4PUS A;  5E3N A;  4E4H A;  3FHN A;  3LSK A;  5LHG A;  1G4D A;  4L18 B;  5B1B H;  4M9X A;  2BY3 A;  3HTU A;  5FO5 A;  4BHB A;  2CQK A;  2HDW A;  3BR3 A;  3R6S A;  5J4Y A;  5DV5 A;  2K9M A;  3H0G J;  4BQQ A;  3LSM A;  3GBG A;  1U9O A;  2ESN A;  4PGH A;  4HA8 A;  3HJE A;  5CPR B;  4CYC A;  1EH7 A;  5H20 A;  3S2H J;  5IT9 Z;  3T1B A;  1TT5 B;  1OYI A;  2OC6 A;  1U8R A;  3E5X A;  3OL3 A;  4AC0 A;  1JJ6 C;  2D5V A;  2ZCW A;  3G1O A;  2DK5 A;  5HOD A;  4ETS A;  1KU9 A;  3OS2 A;  2R7Z J;  2X1E A;  3ABK H;  3D5L A;  1Y0N A;  3I53 A;  3N05 A;  5ICC A;  1TW3 A;  5CKT A;  2XUB A;  3DBL B;  3F8M A;  4M6Y A;  4N4O B;  2KZV A;  3MD2 A;  5HLH A;  4P9U A;  3SJM A;  3AG3 H;  3HZJ A;  3S16 J;  2QM3 A;  5ILU A;  1YX5 A;  3H92 A;  1HC8 A;  2OAZ A;  2BW3 A;  1VQO I;  3A4C A;  2HFH A;  2R7D A;  2Z2S B;  5HS9 A;  2IA0 A;  2WB1 A;  2A6E F;  3U1K A;  5HLG A;  3CMY A;  5M3M J;  2DQL A;  4C2M J;  1HBX G;  1LJ9 A;  2HEO A;  2KLO A;  3NEU A;  3QPL A;  3ZQF A;  5E8G A;  3S93 A;  3G6E I;  1FZP B;  5F08 A;  3F3X A;  2EV6 A;  2V79 A;  2W25 A;  2XF5 A;  1OJL A;  1GT0 C;  2JWT A;  3DKW A;  1RI7 A;  1YJW I;  2LBF A;  3O8G A;  1XN7 A;  2L9V A;  1IW7 F;  2XGE A;  3KPH A;  2XAG A;  2H1K A;  4KIT B;  3OOU A;  1TT0 A;  3REO A;  1YW9 A;  3OIP A;  1FYL A;  1T38 A;  1S7A A;  2E1O A;  1DQU A;  2R7O A;  4HF1 A;  5EZH A;  2DFI A;  3CC7 I;  4LG0 A;  1V5F A;  1AKH A;  4D7M A;  4LLG F;  4RLF A;  2DFF A;  2M4G A;  4PDK A;  1W5C C;  3VYT B;  5FLX Z;  1BOA A;  2JVH A;  1YLF A;  2EV5 A;  2IGN A;  4BQA A;  2ZKZ A;  2EFW A;  5EGO B;  2V1N A;  3EUH C;  3S3M A;  4UB8 C;  2YR2 A;  2MH2 A;  1X4P A;  4M9S A;  4LIV A;  5CVJ A;  2V9K A;  1HW5 A;  4J19 A;  5J3L A;  3J80 K;  1L0O C;  4DYC A;  1FWZ A;  3ZN0 A;  2OCC H;  3J7Y J;  4DW6 A;  2OZ6 A;  1B8I B;  4XRS G;  2PI0 A;  4HNV A;  1XCB A;  1Z77 A;  1WSU A;  3HOV J;  2X85 A;  3U1D A;  4IZZ A;  3LQR A;  5CVR A;  5FKL A;  4FTH A;  3BTC A;  4AVP A;  5LGT A;  1JXS A;  4BGD A;  3ECH A;  2F5V A;  3FMR A;  5F27 A;  2BY0 A;  3EYY A;  4HST A;  2RQQ A;  5E1W A;  2Z33 A;  1X1P A;  2DMN A;  2DMU A;  3HUG A;  5L3E A;  5D5X B;  2DOE A;  1YYV A;  2BEO A;  2K9Q A;  1YIT I;  1SEU A;  1TQM A;  2V6E A;  2Y0M A;  2JRM A;  3QP5 A;  1MJ9 A;  2IBD A;  4RAZ A;  1YJN I;  1IAW A;  1Q1V A;  2XKO A;  1Z1D A;  2P6S A;  2K5C A;  3K4C A;  1U8B A;  1JHH A;  3QQA A;  1UMQ A;  2QKL B;  3CP8 A;  3H36 A;  2NS8 A;  1LE8 A;  1E0E A;  3T8T A;  5J6X A;  2RVC A;  3ZN1 A;  4IHY A;  3QPS A;  1T33 A;  2ISZ A;  2P8T A;  2KZG A;  3KE2 A;  4NBQ A;  2LD5 A;  1EV7 A;  2GZW A;  2WAD A;  2BY2 A;  3PNY A;  5H6R A;  2TRT A;  4UVB A;  1XC5 A;  3QPT A;  2DI3 A;  3KLN A;  2JA7 J;  1XSV A;  3FHZ A;  5L3F A;  4G6T B;  3RZD J;  4B3X A;  1VQ4 I;  2IP2 A;  5D6F A;  2VOD A;  2OZU A;  1KYW A;  5J8C A;  1WJC A;  3IRQ A;  4XNF A;  2WY8 Q;  4QSH A;  1TWA J;  1BOB A;  1E3H A;  1Z7U A;  3BR2 A;  1U5T C;  5EEH A;  1WGX A;  3ZP5 A;  5LLQ A;  4ZC3 A;  4IHV A;  1T39 A;  5F1R A;  3CF2 A;  4UVA A;  2K3F A;  3IH4 A;  4C3I J;  3ZMT A;  3MZ8 A;  3L2U A;  3F8C A;  4BNC A;  1Z7L A;  2HYG D;  2X0L A;  3RI4 A;  4ZTJ A;  1YJ9 I;  2WTE A;  2BYV E;  3TOA A;  1K4T A;  2PMH A;  4A3C J;  2M0M A;  1SFK A;  3K4N A;  2B0L A;  4WCG A;  2EFN A;  5LRS A;  1U2W A;  2OF7 A;  2R4G A;  3V4G A;  2O0Y A;  2ZME B;  4HAM A;  4KIF A;  1XGO A;  3V7R A;  4O6J A;  3WTV C;  1WFX A;  4LLN A;  1R4M B;  2J5O A;  2TCT A;  2DA5 A;  1FIP A;  2B7E A;  3SDB A;  5IP7 J;  3BT9 A;  4MQV A;  2A3S A;  3BPX A;  3RYR A;  1V5E A;  1RZ4 A;  3EUA A;  4N4N B;  3O6B B;  2VPL A;  2FE3 A;  2BGC A;  5JHU A;  1W36 C;  4NC8 A;  4Y4R A;  1X3U A;  3F9K A;  3C7J A;  2Y2Z A;  3R60 A;  4KIC A;  1T08 B;  4HBL A;  4RA2 A;  3ZOB A;  3MKW B;  2VBY A;  3VWB A;  1IRF A;  3IUO A;  1SFU A;  3IP4 B;  4DOZ A;  1Z3X A;  2P5K A;  2LNB A;  3V8K A;  4BJT A;  1BI3 A;  3WHC A;  4PJM A;  1MND A;  2GXG A;  2HQA A;  2BV6 A;  4D1Q A;  4CSW A;  1SAN A;  1R9T J;  2MFZ A;  1D1B A;  4B44 A;  3U2R A;  2K40 A;  1D5V A;  3H0D A;  3IL2 A;  4WXD A;  1M1E B;  1JUS A;  3FXJ A;  3HPG A;  2HQN A;  1W7P B;  1B9N A;  2L4A A;  4CCK A;  4DZP A;  2EIN H;  3KEO A;  2RKH A;  1RPW A;  4I98 B;  5J47 A;  5KHD A;  1IRX A;  3ZMZ A;  3SDG A;  5F64 A;  5LGN A;  4X0G A;  4R1H A;  1HKT A;  4M3G A;  2XC7 A;  1G3W A;  5AON A;  3ECO A;  3FKI J;  1RKT A;  2XKP A;  1MNE A;  3B6A A;  4EVI A;  2COB A;  2BVM A;  2XV4 S;  2DFE A;  2WV1 A;  4CZC A;  2MW8 A;  3HG9 A;  2DA6 A;  1SVO A;  2L4M A;  2MD0 A;  2VT2 A;  2E19 A;  3NAU A;  4PSX A;  3W3C A;  4XKC A;  5CQE A;  4XR6 A;  4C30 A;  3K2A A;  1ZEL A;  2LRE A;  4U0W A;  2BE5 F;  1SVM A;  2HTS A;  5JLX A;  2A07 F;  2NVU B;  1VQN I;  1BIA A;  2K02 A;  3GTQ J;  1MH3 A;  2OQG A;  3K6G A;  2K9N A;  4A2U A;  4KA4 A;  2ZJ2 A;  3OYJ A;  1VND A;  4CO8 A;  3DEE A;  1IJW C;  3TDZ C;  1K6O A;  1TWG J;  3MAJ A;  5TGT A;  4D7N A;  5J1R A;  4A0X A;  1QGP A;  2FUG 2;  3DPU A;  3W2A A;  3H3Z A;  3VOD A;  4ITV A;  3JRC A;  4I6Z A;  1Z9C A;  1UHS A;  3E6B A;  3OSG A;  2AHQ A;  4YII A;  3B02 A;  3PFI A;  2X6O A;  2QEX I;  3RKW A;  1EH6 A;  4DJA A;  3ZRG A;  3IHU A;  4B4C A;  2HNH A;  4IRG A;  2UV1 A;  2NVY J;  3TBI A;  1B8I A;  2CV1 A;  1QZE A;  1ETY A;  5EEA A;  2E71 A;  1YHQ I;  2K86 A;  3IV5 A;  2X6X A;  4YIF A;  4I01 A;  4DIQ A;  3K4K A;  3JTG A;  5IYC J;  4HX4 A;  3GYH X;  2F5E A;  2AO9 A;  3CCY A;  4PFP A;  2LVS A;  1WKM A;  2RQP A;  2XPV A;  4G94 A;  5FFX A;  3WGI A;  2JSP A;  4MFD A;  5FRM A;  1S72 I;  1ZLK A;  2MD5 A;  4IX7 A;  5LEK A;  2OBP A;  3M1C A;  1R22 A;  1OCR H;  4MTE A;  3D0S A;  3CUQ B;  4XLE A;  2IS2 A;  3HHG A;  4XLA A;  1FNN A;  5D4R A;  1PJR A;  4IHW A;  4G7O F;  1VQ7 I;  4HQE A;  3KZZ A;  5LGU A;  2NOG A;  5J1Y A;  3HL2 A;  4U0Y A;  3M9A A;  2V1X A;  2XAJ A;  5FD5 A;  2O8X A;  3L09 A;  1KQ8 A;  3ABU A;  3TKY A;  1NTC A;  3GTO J;  3I59 B;  3MZY A;  4KIG A;  4CYD A;  3G1M A;  2YX7 A;  2DT5 A;  1ETX A;  2K4J A;  5BPD A;  2VBZ A;  3GUD A;  2BBY A;  4OIP F;  5F0C A;  1N78 A;  3L7W A;  4XSZ F;  1I3Q J;  4HDU A;  3COA C;  1ZR4 A;  4ZZL A;  4DBR A;  2CSO A;  5DS9 A;  2Y0S N;  5FB2 A;  2Q2E A;  4ZYA A;  3HB9 A;  3RYP A;  2O61 A;  2MG4 A;  5JLW A;  2PMZ A;  4DYR A;  5BQT A;  1Y0U A;  4YG2 F;  2R7T A;  2JTV A;  3HPH A;  5AIP A;  4WK8 F;  3WTU C;  4ZH4 F;  4IQJ A;  4NHJ A;  1EH8 A;  1QNT A;  1B1B A;  4KJZ A;  1R5G A;  4I76 A;  5GAD J;  5D8L B;  1ON1 A;  3CCR I;  2Q0O A;  2M8G X;  3H9Q A;  4XLP F;  1OCP A;  3BP8 A;  3DBH B;  3M07 A;  1SFX A;  2XGC A;  1HXD A;  2IW5 A;  2YPR A;  3HBL A;  2XAQ A;  3DBR B;  4BAY A;  3MKZ A;  2KJB A;  3B73 A;  3CJN A;  2FNP A;  2P6T A;  3BR6 A;  2HZD A;  1PUE E;  2PQ8 A;  5H2F C;  2JPC A;  2ZME A;  3PJR A;  2EIM H;  3PSF A;  1IV8 A;  1UCR A;  3A03 A;  2KRC A;  3DV8 A;  3QYF A;  4PSW A;  1P92 A;  4C3H J;  1SMY F;  5D4S A;  4EJU A;  3I4N J;  2Y9Z A;  3OY9 A;  3E5Q A;  2Y69 H;  2HOE A;  2TDX A;  1FT9 A;  4NQW A;  2ZNY A;  2ZFW A;  4Y15 A;  4A12 A;  4HNT A;  4NC7 A;  5M3F J;  4JX4 A;  4KMU X;  1WQ2 A;  1IN6 A;  3HOY J;  1QPI A;  2XGX A;  5IT9 K;  2NS0 A;  2MGQ A;  2F4M B;  2VUM J;  3TO9 A;  4P96 A;  4IRH A;  3IKT A;  3LSI A;  3KZY A;  4A3M J;  2ZC2 A;  3PO3 J;  2KKO A;  1VFC A;  5E8I A;  2EV0 A;  2VJ5 A;  3QPH A;  2D1H A;  2M8E A;  4ENJ A;  5L3B A;  3S1R J;  1P7I A;  1S3J A;  2CQQ A;  2VN2 A;  2M45 A;  3E7L A;  3QYE A;  3K70 C;  1X1A A;  4Q47 A;  3VSK A;  5F1J A;  5DD4 A;  2V4J C;  3JRI A;  2FBK A;  3V7S A;  1Y1V J;  4HLY A;  2ECC A;  2L0K A;  2QZ8 A;  1ZGW A;  1TQP A;  4BQO A;  1JE8 A;  3OYK A;  3AG1 H;  5EG0 A;  2P0W A;  3FK6 A;  3M8E A;  1P4W A;  2G0E A;  3I4M J;  2H94 A;  3K2Z A;  5FKO A;  3BQY A;  4HV6 A;  5JHF A;  2E2I J;  2JSC A;  3IAS 2;  3G2B A;  2B63 J;  2EFQ A;  4XOP A;  1FYK A;  1BN5 A;  2A61 A;  2X6W A;  3WE3 A;  1D0Y A;  2CW8 A;  3GTG J;  4F92 B;  2IGK A;  4ZYG A;  1T0F C;  1YI2 I;  2GXB A;  4ZJZ A;  3FXM A;  3HRU A;  3BG9 A;  1XGM A;  4OAZ A;  3EDP A;  2FEZ A;  5JFR A;  1G8X A;  2XAF A;  3FM5 A;  3Q9V A;  1MSE C;  3IWZ A;  3S32 A;  2EQR A;  3O8H A;  2GIZ A;  3JTH A;  4G8X A;  1IRG A;  3ASO H;  2OPT A;  3WTY C;  1O4X A;  2E1M C;  3A02 A;  1IGN A;  2G9W A;  3P9K A;  4HF0 A;  4BH9 A;  1W5T A;  5FLX K;  2QF7 A;  4HG2 A;  2HDC A;  2OTJ I;  3ZMU A;  4IPA A;  3RQ4 A;  3LSJ A;  2K4B A;  2YU3 A;  1R4N B;  2VJJ A;  1WJD A;  4NDL A;  1A36 A;  2BHY A;  3JCU C;  3HC7 A;  2HYJ A;  2XRO A;  2MAB A;  1YS7 A;  5AIQ A;  1OYY A;  5CVI A;  3RCO A;  1W4M A;  2W1O A;  2EZI A;  2L2O A;  3A0B C;  1I5Z A;  1QHH D;  1FBQ A;  3LQQ A;  1O7L A;  2F48 A;  2L7M P;  3FXL A;  3R0J A;  1HF0 A;  1IZ1 A;  4GRI A;  4E7Z A;  4XLC A;  1ETV A;  1RRJ A;  3I71 A;  1GXP A;  2V1U A;  3KP2 A;  1MMG A;  1VQ5 I;  5HS8 A;  2DA3 A;  5KAI C;  2X4H A;  3I0T A;  3BZ6 A;  5BMZ A;  4V19 K;  2DO7 A;  3I3L A;  4FET A;  2Q8K A;  4JBA A;  3U21 A;  1P9Q C;  2KIF A;  3TP3 A;  1YW7 A;  1Y1W J;  4HV5 A;  3WG9 A;  1XSD A;  5HOO A;  2BZT A;  4WWC A;  2H6C A;  3RKX A;  3GTJ J;  1SAU A;  4GCV A;  1JGS A;  3ONQ A;  3AG2 H;  1ZG5 A;  2CUJ A;  1PDN C;  1XS9 A;  3FX3 A;  4RGR A;  3S1N J;  3HTS B;  3BPV A;  3A01 A;  4QLC U;  3BJ6 A;  3L1P A;  4IF4 A;  2DU9 A;  1UEL B;  2A6T A;  1YO5 C;  2CMP A;  2KPM A;  3E6D A;  3HM5 A;  3SZG A;  5LBQ A;  3CCL I;  1R36 A;  2IAI A;  4DBQ A;  2DDA A;  3L2V A;  2E5N A;  1IDZ A;  2KDO A;  1QBJ A;  3ABL H;  1AU7 A;  4FE7 A;  3M4O J;  1P6R A;  3I59 A;  2QSH X;  1D0Z A;  1RIO H;  1BJA A;  2HXI A;  2ME0 A;  1PVE A;  2OU2 A;  3WTX C;  1ERD A;  2DBB A;  4XQF A;  1QU3 A;  1E17 A;  4AID A;  1XSX A;  5D8K B;  3KYD B;  3T8R A;  4LK0 F;  3LWF A;  2E34 A;  2WC2 A;  3OYA A;  1QVT A;  4CA0 A;  1B72 B;  3VYS B;  5E18 F;  2EZK A;  5GPC A;  4IHT A;  5ERI A;  4HX7 A;  1K78 A;  1BI0 A;  4FHT A;  2I8D A;  2LH9 A;  1QPM A;  1DU0 A;  2A5W A;  2OCE A;  2RNJ A;  2E35 A;  3DTI A;  2O3F A;  3OYD A;  3OOP A;  1EJ9 A;  3N97 A;  2W82 A;  1RUO A;  1J09 A;  2F4I A;  2DDB A;  3MVP A;  4KT5 C;  2LYC A;  1U5T B;  2BOL A;  1LVK A;  4F3Q A;  4BHC A;  3PFY A;  2QSF X;  4OIR F;  1FIA A;  4Y3O A;  1MD0 A;  2ZO4 A;  2BVL A;  3GF2 A;  1SVL A;  2LOO A;  3HOT A;  1LFP A;  2LTP A;  3DKY A;  1ZR2 A;  3HEF A;  2NVX J;  4AYB A;  2LR8 A;  2Z16 A;  1FOY A;  1KQ0 A;  1K83 J;  3FK7 A;  4KT6 A;  2OA4 A;  3OIO A;  5HLI A;  1B6A A;  3JW4 A;  2M3A A;  3CME I;  2JA6 J;  1ZRF A;  3G3Z A;  1I6X A;  3QOE A;  4OAY A;  3HKZ N;  2Z99 A;  2XPW A;  5K5Q A;  3BRO A;  3MEX A;  3C1D A;  4UXN A;  2QBY A;  2FML A;  1BI1 A;  1S9H A;  3BTJ A;  2ZSI B;  1G2H A;  2Z3Y A;  1MBG A;  3OWT A;  3Q0W A;  1YRN A;  4A93 J;  4OU0 A;  1SMT A;  3GW2 A;  1MH4 A;  5DCF A;  5E3L A;  3SEZ A;  2VT3 A;  3BJO A;  4DZJ A;  3C2G A;  5D5U B;  4UUS B;  1J5Y A;  4DYQ A;  5M5W J;  2E7W A;  5GAE J;  3HXL A;  1Y39 A;  1MDM B;  1HQC A;  2GLO A;  4XKW A;  4X1E A;  3TL4 X;  4AM3 A;  2DMQ A;  4LFU A;  4XMY A;  1GV2 A;  5GTI C;  3SZP A;  4EJT A;  1U78 A;  1YX3 A;  4P55 A;  4U7B A;  1G3T A;  1SD5 A;  1BR4 A;  3FIW A;  1GXQ A;  1J7K A;  4IO9 F;  4N0B A;  4XOR A;  2ESH A;  2O03 A;  3DCF A;  2VAS A;  4A3D J;  3LSP A;  1DGW Y;  5KCM A;  2CFX A;  3BLY A;  1T8I A;  1Z67 A;  1TQI A;  1Z21 A;  2W84 A;  3L2Q A;  1I1G A;  3HGG A;  4BXF A;  4BEH B;  1V3F A;  3CCS I;  4E7L A;  4LB5 A;  4GYG A;  3GLL A;  2VKE A;  2YS9 A;  3R61 A;  1BL0 A;  2LF7 A;  5F0H A;  1PP8 F;  3CF5 F;  1IN8 A;  1R1T A;  1PYV A;  2M9H A;  5C44 J;  4O5V A;  2PN6 A;  2XVC A;  4LB6 B;  2VPR A;  4RGS A;  2WAF A;  2PJP A;  4GGG A;  1S6L A;  3V42 A;  4ESB A;  4FX4 A;  2HOS A;  4M3E A;  2KIS A;  4XRS A;  1N75 A;  1JHF A;  1JKQ C;  3DTE A;  3L00 A;  2ZFU A;  3BG6 A;  3SFI A;  5K7H A;  1FYM A;  2ELK A;  3K4L A;  2IS6 A;  2LK2 A;  2OQR A;  2QQ8 A;  4BU2 A;  1KON A;  1SD7 A;  3K1M A;  4A0Z A;  3FBN B;  3LOC A;  3P9C A;  3G4S I;  3SEQ A;  2ISY A;  5IOY A;  2WAE A;  3J7A Y;  3OYN A;  5TRD A;  3EUH A;  2EWN A;  1LNW A;  4Y17 A;  2QKM B;  2KRF A;  3BG7 A;  3OYH A;  2H27 A;  3L2R A;  3LA7 A;  2XRL A;  1FP2 A;  2VIX A;  3LST A;  1MMD A;  3BCA A;  4KIS A;  4V2G A;  4II2 A;  3K1P A;  3PM1 A;  2JMW A;  1XTA A;  3FMQ A;  2CWE A;  1XG1 A;  2DA1 A;  3BC8 A;  2FNA A;  4M6X A;  2Y30 A;  4FT8 A;  5DCM B;  4CGZ A;  3ERE D;  2D2W A;  3DLA A;  3KEQ A;  1WJE A;  2ETH A;  1UST A;  5LRR A;  1IRZ A;  3W6V A;  3FMS A;  2LSO A;  2W4S A;  1K6Y A;  4I7H A;  2X1C A;  2K9L A;  4Z2Y A;  2CS3 A;  3OSF A;  1NK3 P;  2L9R A;  2J5P A;  2VQC A;  5D5V B;  4LIT A;  2FXA A;  3IH3 A;  1X2M A;  4YIR X;  2AQF A;  3K4B A;  2COM A;  1H89 C;  5K1Y A;  2HPM A;  1MBK A;  4F93 B;  1WVR A;  3WG7 H;  3K0L A;  1K79 A;  2DMT A;  2M7B A;  1ZLJ A;  4IJA A;  5HNH A;  3NQO A;  4EJV A;  1MBJ A;  1ZRC A;  4KMF A;  2YU9 J;  2VQH A;  1TL8 A;  3SFZ A;  1DP7 P;  1CF7 A;  2HZT A;  3FXR A;  1I3A A;  4M3B A;  1ZGA A;  1G3Y A;  2GWR A;  2M30 A;  3J7Z I;  1FOX A;  2H09 A;  2K7L A;  2LLK A;  2VBX A;  1ON2 A;  2P5L C;  2XAS A;  3GVA A;  3Q3S A;  4JYK A;  2Y48 A;  3LNQ A;  1W1W E;  3MKY B;  2FQ4 A;  2DPU A;  2CO5 A;  2R7X A;  2EPF A;  2GOX B;  2H6B A;  2Z5U A;  1JKR C;  4B8X A;  2YSR A;  3ZMS A;  4AD9 A;  2UUZ A;  2STW A;  4XRM A;  2PFB A;  5B5E C;  5KAF C;  1BR2 A;  2M0C A;  3VPR A;  1VQP I;  4R79 A;  4D5F A;  1ZN2 A;  3FF5 A;  1R1U A;  4U0V A;  2K9S A;  3DQV C;  1MBF A;  1IO2 A;  4XK4 A;  2HVQ A;  2A05 A;  1J75 A;  3VB2 A;  2VQL A;  3HRT A;  3HSF A;  4HZF A;  5IY5 H;  4JP0 A;  2QLZ A;  2F5C A;  1NG7 A;  1FOW A;  2E2J J;  3CTA A;  2MLG A;  3UKG A;  3M8J A;  1OPC A;  3E97 A;  2CH0 A;  3MWM A;  4ON0 A;  1YG2 A;  3V8J A;  5GP9 A;  3OMY A;  1F36 A;  2L54 A;  3HOS A;  4QPO A;  1O3T A;  2ZJR F;  1OFC X;  1DDN A;  3BZC A;  3IH2 A;  2LKX A;  3FXU A;  4LOC A;  4ESJ A;  1R71 A;  4J01 A;  2FOW A;  3Q9S A;  1D5Y A;  2ZB9 A;  4ESF A;  5ILV A;  3RDI A;  2EIK H;  4L9N A;  1ACI A;  1U9N A;  1XMA A;  1OCZ H;  4G9Y A;  2Y31 A;  1X19 A;  4XIC A;  2DA2 A;  2KMU A;  2DAO A;  1WCM J;  4Q48 A;  3ZQG A;  4YRV A;  2L01 A;  2QQB A;  4ENN A;  1BIB A;  3WTZ A;  5D6E A;  1LDD A;  1FSH A;  4JK1 X;  1FSE A;  5EGO A;  4IEJ A;  2EB7 A;  3DEW A;  4L5E A;  4PK4 A;  3RJP A;  3CJR B;  4B43 A;  1W36 D;  3EPZ A;  1JJ8 C;  4V2F A;  5ED4 A;  3PUF A;  4KIB A;  2DTZ A;  2EIL H;  3SHF A;  3EQL F;  2R7W A;  1PUF B;  3HOX J;  1ITY A;  3DTK A;  4LGW A;  2JK3 A;  1J0R A;  1TTY A;  2KFD A;  5EEG A;  2XAU A;  4ZYE A;  2XPU A;  1FY7 A;  2B9S A;  4S0H B;  4AIJ A;  2BXY A;  2CUZ A;  2KJC A;  5E20 A;  4P5O A;  1XGS A;  2XHK A;  4RB0 A;  2DYR H;  3BTI A;  3C2B A;  2NRA C;  2R5Y B;  2JA5 J;  1J9I A;  1QHG A;  3RZO J;  1K61 A;  1G59 A;  1TWC J;  1A35 A;  4PJN A;  3CMA I;  2V9P A;  1Y8Q B;  5DD8 A;  4C3J J;  2LY9 A;  3FZV A;  1N25 A;  1SD6 A;  3HIF A;  1HCR A;  2KDZ A;  1S29 A;  4PZJ A;  2R5Z B;  5E79 C;  5GAG J;  3QWL A;  3C3W A;  3ROU A;  1MJA A;  4BE2 A;  2E1M B;  2L5Q A;  1X1D A;  3S14 J;  2KL4 A;  3TQN A;  1TNS A;  3S8P A;  3E1S A;  4I0B A;  4JX5 A;  2JUG A;  3PUB A;  1IXS B;  3HDD A;  3FWE A;  1JTX A;  1UG2 A;  1VF9 A;  5C3E J;  4XL9 A;  4BY1 J;  4IHX A;  4BJ5 C;  1Y6I A;  3MQ0 A;  3ZGK A;  4ZDO A;  6PAX A;  3K4M A;  4B47 A;  4FCY A;  4IL6 C;  2IVM A;  2OJE D;  2EH3 A;  3KCC A;  2P7C B;  3HYI A;  1MBE A;  1Z6R A;  3LL7 A;  4EEF G;  3LSG A;  4OOI A;  2H8W A;  3K7A J;  2ME6 A;  1LQ1 A;  2NS7 A;  2JPB A;  3RKY A;  2XRN A;  1ODD A;  5CJ9 A;  1ORK A;  1R00 A;  1T98 A;  3R0A A;  4A3I J;  3X2Q H;  2LKP A;  3O2P E;  5ILS A;  3PNV A;  2P7V B;  2E5Z A;  3H9J A;  3WTT C;  2R7U A;  1JT0 A;  2HXO A;  1E3O C;  1Z91 A;  1USS A;  3BZK A;  3PIO F;  3L9F A;  3LMM A;  4ZDL A;  3WTW C;  2IGO A;  4JX6 A;  1O3Q A;  3FDY A;  2VJI A;  2W7N A;  3JRF A;  2O5R A;  4CYC B;  2DCE A;  2VC1 A;  5JVT A;  2M4K A;  2KP6 A;  4NUB A;  3WGH A;  3J7A O;  5CLS A;  1D8J A;  2DK8 A;  2RV8 A;  4S05 A;  2NVT J;  1XCV A;  3S2D J;  4RB1 A;  3ZXS A;  2E7X A;  3KFW X;  3RTR A;  2ZXH A;  4HQM A;  5KK1 A;  4A3F J;  1ZRD A;  3GCM A;  2LG4 A;  5CYV A;  1BI2 A;  4BL0 B;  2RAE A;  3MZH A;  3GXO A;  4B48 A;  1ZH5 A;  1GV5 A;  3QOD A;  5FD6 A;  3KEY A;  4UVC A;  3DFG A;  5EF6 A;  3CDL A;  3OIQ A;  2K27 A;  3CLQ A;  1UB9 A;  3MKL A;  4XKB A;  1C0W A;  1OLT A;  1CQT A;  5J8F A;  4QTR A;  2VOP A;  2K85 A;  3OL4 A;  1X4O A;  3GTP J;  1B4A A;  4EM0 B;  2EJR A;  1R23 A;  2IS1 A;  2BW3 B;  3LA2 A;  3J81 Z;  2CU7 A;  1MMS A;  3K9T A;  2ZSH B;  4EM2 A;  3RQI A;  1V5G A;  3ERM A;  3MN2 A;  1KU7 A;  4FE4 A;  2M87 A;  2V1D A;  1P7J A;  1SD4 A;  5GAH J;  1WI3 A;  3LA3 A;  4Y52 J;  5FKK A;  2R92 J;  2M7A A;  4IOA F;  2RC4 A;  1WZ2 A;  2FA5 A;  3PL8 A;  2LBF B;  5C4X J;  3IAM 2;  5DUI A;  4F52 A;  4XID A;  1W7P A;  4P9F A;  1FEX A;  2L3D A;  4CCM A;  4FX0 A;  1UG0 A;  3WTS C;  5E3O A;  3S1Q J;  1D1A A;  2DQR A;  2W57 A;  4KN4 X;  2QUF A;  2STT A;  4LG0 B;  1X58 A;  3F8B A;  4D0P A;  1AKH B;  3E0J B;  3ASN H;  4Y7N J;  4EAT A;  4YFN F;  2VOO A;  1HDP A;  2LFB A;  1X1B A;  4CCL A;  1BC8 C;  5B1A H;  2JA2 A;  5DM6 F;  1V55 H;  3KX2 A;  4HEA 2;  2QCO A;  5IP6 A;  2WB1 N;  1WJF A;  3V8L A;  4OIN F;  2NOJ B;  5LFA A;  4HF2 A;  1OCO H;  3HSE A;  1STZ A;  5IT3 A;  1O7F A;  3DPT A;  1T56 A;  4L5J A;  1VQK I;  2R7S A;  2YX4 A;  1XGN A;  1VTN C;  1H88 C;  5ICE A;  1OR7 A;  2WBM A;  1AWC A;  1IUF A;  3GFM A;  1W7P D;  3ABT A;  5M5Y J;  2X48 A;  4MIM A;  1FMW A;  3WE2 A;  3KYL A;  1BW5 A;  1FP1 D;  2PX9 A;  4MNU A;  3FM3 A;  1WI9 A;  1AHD P;  2W85 A;  4A3G J;  5F0F A;  4OMZ A;  2FU4 A;  2ID6 A;  1UJ8 A;  4XRF A;  3LSH A;  1GVD A;  4KFC A;  1R7J A;  4UV8 A;  3GWZ A;  2ELH A;  5HVQ C;  3A2K A;  3PO2 J;  2FBH A;  3OYF A;  3OYL A;  4E7H A;  4ZYH A;  1HLV A;  1FBS A;  3OYB A;  2RNG A;  1ZK8 A;  4LLL A;  5HNF A;  5LD2 C;  4AUX A;  3AFH A;  1VZ0 A;  2DJI A;  2VC0 A;  3PQK A;  2IPQ X;  1D0X A;  2VE8 A;  5JVG F;  3HUG B;  2L7K A;  3KP3 A;  4HYE A;  5LEJ A;  1T0F A;  4I09 A;  3C2H A;  3I56 I;  9ANT A;  2Y9Y A;  2MA3 A;  4BDY A;  2CG4 A;  3TDU C;  2GAU A;  3K70 D;  1G3S A;  4XOT A;  2IA2 A;  3QU3 A;  2YUS A;  1DU6 A;  2Y0S A;  3B6C A;  1LE8 B;  1LUJ B;  2CGP A;  3CC2 I;  4RMN A;  1P4X A;  2M2E A;  3VFZ A;  3DEU A;  2RGV A;  3DXJ F;  5FRO A;  3JRE A;  3HGY A;  3CUQ A;  1I1S A;  3T0Y A;  4AWX B;  1JT6 A;  4E7S A;  1HKS A;  4ZTF A;  2XF7 A;  4CHU A;  1XX5 A;  1MGT A;  3QP6 A;  2W00 A;  3M7G A;  4UV9 A;  1MZB A;  2G7U A;  2I10 A;  1O3R A;  1F5T A;  4RGU A;  1LB2 A;  4FIS A;  2MYS A;  4L9J A;  4BUP A;  2O9L A;  1D3Y A;  4I02 A;  4BYY A;  4L0Y B;  5EDN A;  2HVR A;  3K1N A;  3HRS A;  3KP7 A;  1POG A;  1BJZ A;  4Q5S F;  2CUE A;  1Z3Y A;  3CJT B;  3RKQ A;  2VXD A;  2UXN A;  4Y13 A;  3FXQ A;  1XD7 A;  2PBI A;  2KRH A;  1U0J A;  2A68 F;  3GEZ A;  3GFJ A;  2Z9O A;  3BR1 A;  1K7A A;  4LMY A;  3ISP A;  1ZKG A;  3CJQ B;  3OR2 C;  2PG4 A;  2KHM A;  3CC4 I;  3CCM I;  2I5U A;  2P5V A;  5H6Q A;  3F8N A;  5E3M A;  3EYI A;  4CIC A;  3P9I A;  3JRD A;  2KIU A;  3VOE A;  1WWX A;  1B9M A;  3HSR A;  2DA7 A;  4AIH A;  1JI8 A;  4JOM A;  1MKM A;  4M73 A;  4CZZ A;  4BE1 A;  3Q0V A;  2O6G E;  1YQA A;  4MO7 A;  5ICG A;  1IXR C;  1X3W B;  4LJZ F;  4A6D A;  3CP2 A;  2V6C A;  1OKR A;  1TC3 C;  2FRH A;  1YS6 A;  1RC9 A;  5C4J J;  3H3V K;  1V54 H;  4A3K J;  2XB5 A;  3OS0 A;  4A5M A;  3F6O A;  2BHZ A;  2BXZ A;  1NHA A;  2HS5 A;  4ZDP A;  3JAM Z;  4HSR A;  2XSD C;  2XDV A;  3I55 I;  2ZBK A;  2P81 A;  2ZXJ A;  3TP0 A;  3QU6 A;  1XPX A;  2CW7 A;  5FFZ A;  2VQG A;  3U9G A;  1FC3 A;  1T6S A;  2IRF G;  2LY1 A;  2C6Y A;  3LSR A;  5J1U A;  2R0Q C;  4E7K A;  1LPQ A;  1I27 A;  4PFO A;  2AQE A;  1W0T A;  1SC7 A;  2XAH A;  3GTK J;  3BJA A;  2MLK A;  1WH5 A;  1IC8 A;  2LMD A;  5L3D A;  2VKV A;  1A6Q A;  2DW4 A;  3ZR8 X;  1S8N A;  1R49 A;  3S17 J;  4F91 B;  1IN7 A;  5K5R A;  3O3K A;  3CCJ I;  2UZK A;  2X6Y A;  1U3E M;  1LDK B;  2F5D A;  4RAG A;  1F9N A;  5FJ8 J;  2VKD A;  2JUC A;  3H5R A;  1BM9 A;  4EM1 A;  4OMY A;  3A0H C;  3KP5 A;  5BNG A;  4XLF A;  5A2Q K;  2O8K A;  4UUT A;  4A5N A;  1Z6T A;  1BA5 A;  1F43 A;  4CH7 A;  3ML6 A;  1OCC H;  3TO7 A;  5HLT A;  1RNL A;  1WJB A;  4DGW B;  2NVQ J;  3NWS A;  2VLA A;  3CCU I;  4H0E A;  2JZY A;  1DPR A;  2EFO A;  2Y75 A;  4K2E A;  3E6C C;  1VQ6 I;  3BTL A;  2NYX A;  1UHW A;  3OYG A;  4NB5 A;  3ZQL A;  1WPK A;  1OYW A;  2XF6 A;  4CUG A;  4YFX F;  2JA8 J;  4WX9 A;  3G73 A;  3S3O A;  2WA0 A;  1VQ8 I;  3ZPL A;  4IXA A;  3T5X A;  1JKP C;  2EIJ H;  1ULY A;  5EYR A;  5LHH A;  4M3F A;  2QWW A;  1R5H A;  3ZMV A;  1IDY A;  4HRI A;  1I50 J;  2F6C A;  1X1C A;  3SYT A;  2DOA A;  4U87 A;  2NAZ A;  4RAF A;  1LKX A;  4KDP A;  3FIS A;  4UY8 I;  2X51 A;  1GDT A;  4YFK F;  5FRN A;  1K4S A;  2IGM A;  3OV8 A;  3H35 A;  3UR3 C;  4MEX F;  3AL0 B;  2MC4 A;  2VJ4 A;  1ZYR F;  4A3E J;  3ZQH A;  2IS4 A;  2G7H A;  1EKE A;  1E2X A;  1H9T A;  2H1L A;  3W2V A;  3RPU A;  4EV0 A;  5IPA A;  2EBI A;  4RLQ A;  4A3J J;  2WY7 Q;  4ANJ A;  1HW1 A;  3LAP A;  2UWM A;  3TMO A;  4LK1 F;  2ZJQ F;  2A5Y B;  2M34 A;  4WXH A;  5JI6 A;  1WJA A;  4E7I A;  3ELK A;  1MNM C;  2GM4 A;  1R6R A;  2GBY A;  3JR9 A;  2DYS H;  3I5U A;  5EJC A;  3BR5 A;  5IYD J;  3AAF A;  2E1C A;  4JQF A;  2HKX A;  2R7Q A;  1H9G A;  1T95 A;  3CO6 C;  2AXT C;  2VE9 A;  5FGM A;  1UZC A;  2Z1D A;  4DQ2 A;  4MQ9 F;  2DTR A;  1IXC A;  1RES A;  1WH7 A;  1XMX A;  1LEB A;  1KYZ A;  2DMP A;  3VEP A;  3KLO A;  4J00 A;  1XB4 A;  2CFO A;  3P7N A;  3RPU D;  1N77 A;  1JGG A;  2R7R A;  3PQJ A;  1WJ5 A;  5TJJ A;  3I58 A;  2HDD A;  2HTJ A;  1F1Z A;  1FOK A;  5J4V A;  3D5S C;  2LC2 A;  2E2H J;  5FLV A;  3KP6 A;  2ID3 A;  4AU7 A;  5K7Z A;  4OIQ F;  3G1L A;  3K4J A;  2CYY A;  1ENH A;  3KZI C;  3RPQ A;  1BR1 A;  1P2F A;  5IYB J;  4CDG A;  2DPD A;  3BG3 A;  2E36 A;  2Q2E B;  1TBX A;  3H5A A;  1TW2 A;  1DGR M;  2JT1 A;  1HST A;  1VQL I;  3DF8 A;  2KIM A;  2CW0 F;  2ACJ A;  1ZRE A;  2PJR B;  2L7Z A;  3F0C A;  2ZXW H;  3MFK A;  3E3V A;  5J40 A;  3OYI A;  2OTL I; 
#chains in the Genus database with same CATH homology
 3BG9 A;  4JX5 A;  4QIW N;  4BY7 J;  1GUU A;  3HDD A;  1JTX A;  1UG2 A;  1VF9 A;  4C2M J;  5M3M J;  4MLO A;  5C3E J;  3CMY A;  1B72 A;  1MSE C;  1FTT A;  2EQR A;  3O8H A;  3QPL A;  3ZQF A;  2H8R A;  5F08 A;  1RKW A;  2ECB A;  4A69 C;  2OPT A;  2EZH A;  4FCY A;  1GT0 C;  1OJL A;  1O4X A;  3A02 A;  2JWT A;  3JRG A;  1IGN A;  2EH3 A;  1MBE A;  2QF7 A;  3O8G A;  4EEF G;  3LSG A;  2R93 J;  2XGE A;  3ZQI A;  3K7A J;  2ME6 A;  2H1K A;  3LSJ A;  3OOU A;  1W0U A;  2NS7 A;  3Q0U A;  2E1O A;  1ETO A;  4NDL A;  4RBO A;  5EZH A;  2FJ1 A;  1A6I A;  2HYJ A;  4W97 A;  1ORK A;  4A3I J;  4D7M A;  1AKH A;  1Z0X A;  2EZL A;  2PMZ N;  4G12 A;  2EZI A;  2L7M P;  1HF0 A;  3HOW J;  1ETV A;  1JT0 A;  2HXO A;  1E3O C;  5EZG A;  5EGO B;  2DA3 A;  2WAQ N;  4JX6 A;  3TP3 A;  4J19 A;  1Y1W J;  5J3L A;  1TWH J;  4DYC A;  3GTJ J;  3JRF A;  4DW6 A;  4CYC B;  1B8I B;  1ZQ3 P;  2HOA A;  4XRS G;  3JRB A;  4HNV A;  1Z77 A;  3HOV J;  1XS9 A;  4IHX A;  3S2D J;  2NVT J;  1LFU P;  3BQZ A;  4UUS A;  5FKL A;  3JRH A;  3S1N J;  3A01 A;  4A3F J;  3TW7 A;  4FTH A;  5EG0 B;  3L1P A;  3BTC A;  1MSF C;  4BBS J;  2RAE A;  3ZQC A;  3HM5 A;  1GV5 A;  1SFO J;  2IAI A;  1HOM A;  1QRY A;  1IDZ A;  5EF6 A;  3CDL A;  2KT0 A;  1AU7 A;  3MKL A;  4FE7 A;  1CQT A;  3M4O J;  5F27 A;  2DJN A;  4QTR A;  2HXI A;  2ME0 A;  3GTP J;  3WHB A;  2DMN A;  2DMU A;  3HOZ J;  2K9Q A;  2CU7 A;  1NK2 P;  3RQI A;  2L7F P;  3MN2 A;  1QVT A;  1B72 B;  2IBD A;  4FE4 A;  2EZK A;  5GPC A;  1P7J A;  1Q1V A;  1WI3 A;  4Y52 J;  1U8B A;  3QQA A;  1UMQ A;  1DU0 A;  2NS8 A;  5FKK A;  1LE8 A;  2CUF A;  2R92 J;  4IHY A;  3QPS A;  1T33 A;  5C4X J;  2LD5 A;  3BG5 A;  4XID A;  3MVP A;  1FEX A;  2TRT A;  1XC5 A;  1FIA A;  5E3O A;  4BY1 J;  2JA7 J;  3S1Q J;  3S1M J;  2VI6 A;  1X58 A;  1AKH B;  3RZD J;  2LTP A;  1ZR2 A;  3HEF A;  2NVX J;  3BR0 A;  4Y7N J;  1HDP A;  2LFB A;  2LR8 A;  4QSH A;  1K83 J;  1TWA J;  3FK7 A;  3BR2 A;  3OIO A;  1WGX A;  4IHV A;  2JA6 J;  2QCO A;  5IP6 A;  1I6H J;  2WB1 N;  3IH4 A;  4C3I J;  1ETQ A;  3HKZ N;  2XPW A;  1T56 A;  5FKM A;  4A3C J;  3BTJ A;  1G2H A;  1MBG A;  1H88 C;  1IUF A;  4A93 J;  3Q0W A;  1YRN A;  5M5Y J;  2X48 A;  2OF7 A;  4MIM A;  1MH4 A;  5E3L A;  1FTZ A;  1BW5 A;  4DZJ A;  4UUS B;  4DYQ A;  5M5W J;  1AHD P;  4A3G J;  5F0F A;  3A01 B;  2TCT A;  2GLO A;  2DA5 A;  4X1E A;  1FIP A;  2ID6 A;  5IP7 J;  2DMQ A;  3BT9 A;  1GVD A;  1GV2 A;  3PO2 J;  1U78 A;  1HLV A;  1RR7 A;  3FIW A;  2XB0 X;  1ZK8 A;  2DN0 A;  4AUX A;  2Y2Z A;  3D1N I;  3DCF A;  4A3D J;  3LSP A;  3ZOB A;  2IEK A;  5GPA A;  4ABZ A;  9ANT A;  2Y9Y A;  3WHC A;  3HGG A;  1A5J A;  1SAN A;  1R9T J;  2VKE A;  2YS9 A;  1BL0 A;  2CJJ A;  2K40 A;  2YUS A;  1DU6 A;  5F0H A;  3B6C A;  1LE8 B;  1APL C;  2O7O A;  2M2E A;  1JUS A;  4B3A A;  3TED A;  3JRE A;  4M3D A;  2CRG A;  2M9H A;  5C44 J;  2XGD A;  3HGY A;  1JT6 A;  4DZP A;  4GFB A;  2JN6 A;  2VPR A;  1RPW A;  5M5X J;  3SDG A;  1BW6 A;  2I10 A;  2HOS A;  4M3E A;  4M3G A;  4XRS A;  4FIS A;  3NAR A;  3FKI J;  2O9L A;  1JKQ C;  1RKT A;  5EDN A;  3SFI A;  5K7H A;  3B6A A;  1JUP A;  5IP9 J;  2COB A;  2ELK A;  1POG A;  2LK2 A;  1BJZ A;  2WV1 A;  2CUE A;  2MW8 A;  2DA6 A;  3S15 J;  5DTD A;  3RKQ A;  1ETW A;  3JRA A;  4BXX J;  2E19 A;  3LOC A;  3NAU A;  2FX0 A;  1LFB A;  5IOY A;  1FJL A;  3HOU J;  3K2A A;  5JLX A;  3BR1 A;  3GTQ J;  1MH3 A;  1YRN B;  1ETK A;  1EF4 A;  2K9N A;  1ZKG A;  2XRL A;  5FLM J;  1VND A;  2HQ5 A;  1IJW C;  4BKX A;  5E3M A;  1TWG J;  4V2G A;  5FKN A;  4D7N A;  3JRD A;  2JJ7 A;  3PM1 A;  1HDD C;  5J1R A;  2JMW A;  4W1U A;  2DA7 A;  3JRC A;  1XG1 A;  2LP0 A;  2DA1 A;  4I6Z A;  3GTL J;  5K7F A;  3Q0V A;  2Y30 A;  1UHS A;  5F04 A;  3OSG A;  2AHQ A;  4B1R A;  4D5C A;  4MO7 A;  2X6O A;  4AYB N;  2W48 A;  1JUM A;  1TC3 C;  4B4C A;  1IRZ A;  3W6V A;  2NVY J;  1B8I A;  5C4J J;  3H3V K;  4A3K J;  2XB5 A;  1VI0 A;  3OSF A;  1ETY A;  1JTY A;  4BBR J;  5EEA A;  2L9R A;  1NK3 P;  3IV5 A;  1S7E A;  3IH3 A;  1X2M A;  2XSD C;  3CQZ J;  1H89 C;  5IYC J;  2P81 A;  3TP0 A;  1MBK A;  2DMT A;  2AO9 A;  3CCY A;  2LVS A;  2N8G A;  1MBJ A;  2XPV A;  4A3L J;  2YU9 J;  4MFD A;  3LSR A;  5J1U A;  1RET A;  2R0Q C;  1W0T A;  3GTK J;  4M3B A;  1WH5 A;  1IC8 A;  2VKV A;  3S17 J;  4A3B J;  2LLK A;  4IHW A;  1IV6 A;  2NOG A;  5J1Y A;  1H8A C;  3Q3S A;  4JYK A;  3LNQ A;  5FJ8 J;  2FQ4 A;  3GTM J;  5BNG A;  1PUF A;  1NTC A;  3GTO J;  2O8K A;  4UUT A;  1JKR C;  1BA5 A;  1F43 A;  2DA4 A;  3G1M A;  1ETX A;  4XRM A;  1IG7 A;  5F0C A;  2R5Y A;  1I3Q J;  2M0C A;  3VPR A;  2NVQ J;  1JKO C;  1ZR4 A;  4D5F A;  3BTL A;  2CQX A;  5DS9 A;  2Y0S N;  2X9D A;  2K9S A;  1MBF A;  4XK4 A;  3ZQL A;  1WPK A;  1OCT C;  3HB9 A;  2MG4 A;  2R5Z A;  5JLW A;  2JA8 J;  4DYR A;  1TWF J;  4JP0 A;  1JKP C;  2HOT A;  2E2J J;  5EYR A;  3UKG A;  4I76 A;  3TW6 A;  3M3Y J;  4M3F A;  1IDY A;  1I50 J;  2M8G X;  1OCP A;  2FD5 A;  5GP9 A;  4MFE A;  1F36 A;  1ZTR A;  2XGC A;  3FIS A;  1GDT A;  3HBL A;  1OFC X;  4M6V A;  3IH2 A;  2LKX A;  3BR6 A;  4LOC A;  4A3E J;  3ZQH A;  4X6A J;  1QVU A;  5IOZ A;  3A03 A;  1X2N A;  1D5Y A;  2ZB9 A;  5IPA A;  4C3H J;  2EBI A;  4A3J J;  3I4N J;  1U9N A;  2Y9Z A;  2Y31 A;  4XIC A;  2DA2 A;  2M34 A;  2HI3 A;  4RDU A;  1WCM J;  5M3F J;  4JX4 A;  3ZQG A;  2MSY A;  1MNM C;  2GM4 A;  1MBH A;  2GBY A;  3JR9 A;  3HOY J;  1QPI A;  3BR5 A;  5IYD J;  2MGQ A;  5E3N A;  2VUM J;  5EGO A;  4A3M J;  4IEJ A;  3PO3 J;  3BR3 A;  3DEW A;  4L5E A;  1VFC A;  1RES A;  1WH7 A;  3H0G J;  1JJ8 C;  4V2F A;  3S1R J;  3GBG A;  1U9O A;  2DMP A;  1P7I A;  2DTZ A;  1JGG A;  1ITY A;  1PUF B;  3HOX J;  2CQQ A;  4CYC A;  3E7L A;  3S2H J;  2JK3 A;  5F1J A;  2XPU A;  4S0H B;  3JRI A;  2HDD A;  1Y1V J;  2ECC A;  3BTI A;  2L0K A;  3C2B A;  4AC0 A;  1ZGW A;  3G1O A;  1JJ6 C;  2R5Y B;  2D5V A;  2E2H J;  2JA5 J;  5FLV A;  5HOD A;  2ID3 A;  5K7Z A;  5EG0 A;  3RZO J;  1K61 A;  3G1L A;  1ENH A;  1TWC J;  3FK6 A;  2R7Z J;  5IYB J;  2G0E A;  3I4M J;  4C3J J;  3BG3 A;  2LY9 A;  5FKO A;  3BQY A;  1HCR A;  2KDZ A;  3SJM A;  2R5Z B;  2E2I J;  2B63 J;  3S16 J;  3GTG J;  3S14 J;  2L7Z A;  3F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...