1RETA

Determination of the structure of the dna binding domain of gamma delta resolvase in solution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
43
structure length
43
Chain Sequence
b'GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA DELTA-RESOLVASE
molecule tags Site-specific recombinase
source organism Escherichia coli
publication title Determination of the structure of the DNA binding domain of gamma delta resolvase in solution.
pubmed rcsb
total genus 9
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1994-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1retA00
5M3MJ 2R5YB 2ECCA 2JWTA 1A5JA 3S2HJ 1LE8B 1GV5A 1XG1A 2LP0A 1U9OA 2I10A 2IAIA 2XGCA 2E19A 2LFBA 1H89C 5K7HA 2GM4A 1JJ8C 2HYJA 1IGNA 5F27A 4JX6A 2DTZA 1TWHJ 3S15J 1FEXA 1FTZA 3BTLA 3JRBA 1YRNA 2WAQN 3GTPJ 4A3BJ 1ORKA 1T33A 3BR5A 2D5VA 3GTKJ 1ZQ3P 1MNMC 3GBGA 4M3DA 1JT6A 2DMUA 1MBJA 4M3GA 2ECBA 3L1PA 1UG2A 1I3QJ 5GPCA 3H0GJ 3RKQA 4MLOA 4Y52J 2XB5A 3HOYJ 3DCFA 1ZK8A 1ETXA 1PUFB 2HXOA 3TW6A 4BY7J 1RR7A 1I50J 3LOCA 4HNVA 2CJJA 3JRFA 3HDDA 1IG7A 3OSGA 1MSFC 1GV2A 3S14J 1U8BA 1U78A 2VKVA 2ELKA 2WV1A 2DA4A 2TCTA 4NDLA 4GFBA 2R92J 2R0QC 1IRZA 1RETA 2H1KA 5EGOB 4B4CA 4AYBN 3E7LA 2X48A 2VUMJ 1XS9A 4A3DJ 4W1UA 2R5YA 4JX5A 1D5YA 3GTMJ 4RBOA 1GT0C 1IC8A 4IHXA 4ABZA 1GDTA 1AKHB 9ANTA 2LVSA 4XRMA 3LSRA 2X6OA 4QSHA 4FE7A 2IEKA 3LSJA 2O9LA 3S1MJ 2AHQA 3JRIA 3Q3SA 2AO9A 1XC5A 2G0EA 1QVUA 3CCYA 1OCTC 3BR1A 1BW5A 3Q0WA 5E3OA 1FTTA 1H8AC 3GTJJ 2NVQJ 3HGGA 2VPRA 4BY1J 1MBEA 4XRSA 1MBGA 3ZQLA 3QPLA 4A3FJ 2M34A 4C3IJ 1SANA 3G1MA 2JJ7A 4L5EA 4JYKA 3S2DJ 2EZKA 1QVTA 2HOAA 5F08A 1O4XA 4A3LJ 1MSEC 5GP9A 1IDYA 3DEWA 5F04A 4C3HJ 4DYRA 1TWGJ 4CYCA 2X9DA 3ZQIA 3JR9A 5J1UA 2XPWA 1WH5A 4QTRA 1Z0XA 4X1EA 3HKZN 4I6ZA 1LE8A 2M0CA 3HB9A 2K40A 1JJ6C 4V2FA 2DN0A 3IV5A 1RKWA 3ZOBA 1Y1WJ 3BG3A 1ITYA 2QCOA 2XGDA 4RDUA 3A01A 2O8KA 1IV6A 2W48A 2Y0SN 3F0CA 1WGXA 2EZHA 3TP3A 3JRDA 1LFBA 2LLKA 1MBKA 2LY9A 3NARA 2R7ZJ 1IJWC 3GTLJ 1MH3A 3OSFA 1QPIA 2E2IJ 5F0FA 1F36A 5EEAA 2Y30A 5GPAA 3Q0UA 3WHBA 3BQYA 2Y9ZA 1BJZA 4UUTA 5FJ8J 2EBIA 3HOWJ 2XSDC 4S0HB 4D7NA 3K2AA 2DA2A 1FIAA 4XK4A 1EF4A 2CQXA 2LTPA 4QIWN 3I4NJ 2L7ZA 5J1RA 2HOTA 2TRTA 2VI6A 3H3VK 2YS9A 2DJNA 3BR2A 4G12A 1GUUA 4LOCA 2XGEA 2NVXJ 2L7FP 3S1QJ 2DA3A 2JK3A 3BR6A 3FISA 5C4JJ 1K83J 4W97A 3ZQFA 5K7ZA 2QF7A 1JKPC 3B6AA 2JA7J 4X6AJ 3O8HA 5EGOA 3A03A 4Y7NJ 2LK2A 4A3CJ 2K9QA 3HEFA 3JRGA 4I76A 1ZR2A 2ID3A 4XIDA 2JMWA 2LD5A 4MIMA 3IH2A 3S1NJ 2O7OA 1IUFA 2DMNA 5IYBJ 2ME6A 3QQAA 1MBFA 3HOXJ 3CQZJ 2CQQA 1QRYA 1DU0A 1ETYA 5FKKA 1WH7A 4A93J 4BXXJ 4A3JJ 4BBRJ 1G2HA 2GLOA 4IHYA 5IYDJ 3OOUA 2JA6J 1K61A 4M6VA 2L0KA 1F43A 2M8GX 1POGA 1LFUP 2E1OA 2PMZN 2CUFA 2KDZA 3WHCA 3BTIA 3D1NI 2Y31A 2YUSA 3JRAA 4A3GJ 1SFOJ 4BKXA 1JUPA 2K9SA 5EG0A 1OFCX 2NOGA 2VKEA 5J3LA 5DTDA 1DU6A 1VF9A 3CDLA 2E2JJ 3BG9A 2HOSA 5IYCJ 2EQRA 3PM1A 1R9TJ 3LSGA 1JKQC 5C3EJ 3JRCA 2DA5A 2MW8A 4D7MA 4M3FA 3ZQGA 5K7FA 5E3LA 1HDPA 3CMYA 3HOUJ 1B72A 5M3FJ 3O8GA 5F0CA 2JA8J 4IEJA 1B72B 5IP7J 4FCYA 2FD5A 1ENHA 5J1YA 2R5ZA 1B8IA 5FKOA 3BTCA 5FLMJ 2EH3A 1H88C 2L9RA 4XICA 2DA1A 2NVTJ 4B3AA 1VNDA 1HLVA 4AUXA 2Y9YA 5E3MA 1JUMA 3G1OA 1NTCA 3VPRA 3BQZA 4DZJA 1X2NA 4FTHA 2HDDA 1S7EA 4B1RA 1GVDA 4AC0A 1ETVA 5F0HA 3LSPA 1ETQA 3PO2J 1JTXA 4MFDA 2DMTA 1CQTA 3BTJA 5E3NA 5FKNA 2NS7A 2JN6A 4A3KJ 5EYRA 4MFEA 5IOYA 1ZKGA 1YRNB 1HDDC 4IHVA 4J19A 3OIOA 3GTOJ 1HOMA 4C2MJ 1JUSA 1BA5A 4BBSJ 2FJ1A 3A01B 2ME0A 3FK6A 5M5YJ 1VFCA 4UUSB 2M9HA 2MGQA 1TWCJ 3HOZJ 5EZGA 3JRHA 3Q0VA 2CUEA 4M3BA 1RPWA 4DYQA 3BR0A 3IH4A 1MH4A 1JKRC 3W6VA 5EDNA 5JLXA 1ETKA 3S17J 3SFIA 3NAUA 1B8IB 2EZLA 1OCPA 2LKXA 1RKTA 5JLWA 3MN2A 2NVYJ 1OJLA 4DYCA 1ZTRA 1T56A 2N8GA 1ZR4A 5FKLA 3BG5A 3B6CA 3S1RJ 2R93J 2DMPA 3HM5A 2WB1N 2FX0A 3TEDA 1W0UA 3G1LA 1JGGA 1APLC 3ZQHA 1WCMJ 4A69C 4XRSG 1UMQA 1P7IA 1WI3A 4CYCB 3JREA 2FQ4A 2ZB9A 4FISA 5EG0B 1BW6A 2DA6A 1HF0A 2HXIA 1JTYA 3I4MJ 1Z77A 3LNQA 2R5ZB 4UUSA 1JT0A 5HODA 3C2BA 5F1JA 2P81A 1Y1VJ 2GBYA 3FIWA 4A3EJ 2KT0A 1TWAJ 5EF6A 2CU7A 1NK2P 2DMQA 5IP6A 2ID6A 2K9NA 1AKHA 1RESA 1TWFJ 3M3YJ 3M4OJ 3IH3A 1IDZA 1PUFA 4A3MJ 1E3OC 2XRLA 1UHSA 4V2GA 3TW7A 2HQ5A 2CRGA 2MSYA 4DW6A 2MG4A 1MBHA 4JP0A 3GTGJ 5EZHA 3S16J 3UKGA 2XB0X 3BR3A 4DZPA 1ETOA 1I6HJ 5C4XJ 1HCRA 4FE4A 1BL0A 2LR8A 3A02A 2HI3A 3TP0A 4M3EA 1AU7A 3PO3J 3RZOJ 3MVPA 3RZDJ 3FKIJ 2L7MP 4MO7A 3SJMA 2NS8A 2EZIA 5DS9A 2IBDA 2B63J 4JX4A 3HGYA 3ZQCA 4EEFG 2OF7A 2RAEA 2Y2ZA 5BNGA 2XPUA 2JA5J 5FLVA 1U9NA 3HOVJ 3QPSA 1A6IA 1TC3C 3MKLA 1FJLA 1P7JA 3BT9A 3HBLA 5M5WJ 4D5FA 2DA7A 5M5XJ 1WPKA 1ETWA 4A3IJ 3FK7A 1W0TA 1AHDP 5C44J 1X2MA 2E2HJ 4IHWA 5IOZA 1ZGWA 1VI0A 2OPTA 3K7AJ 4D5CA 1JKOC 3GTQJ 5IP9J 2XPVA 1Q1VA 3SDGA 2COBA 1X58A 4C3JJ 1NK3P 1FIPA 2YU9J 5IPAA 5FKMA 2H8RA 2M2EA 3RQIA
chains in the Genus database with same CATH superfamily
4A0XA 3VFZA 5M3MJ 2PJRA 2JWTA 3ULQB 3MQ0A 2LP0A 2Y0SA 3EDPA 3HHGA 1U9OA 1WQ2A 2E19A 4AVPA 3FMRA 2M7AA 3G73A 5JI6A 1YHQI 2K27A 2HYJA 4X0GA 1FYLA 3QU6A 3GXOA 2JUCA 3A0BC 4JX6A 3ZGKA 3ECHA 3WGIA 5L3CA 1N25A 2R7SA 3F8NA 1FEXA 2F5CA 3BTLA 1FTZA 4A3BJ 4LGWA 1U0JA 1T33A 2D5VA 3HYIA 5FROA 2RGVA 2VQCA 1SFXA 3HPHA 1MNMC 1B6AA 1OMIA 3GBGA 3AG2H 3DFGA 1WJ5A 1R1TA 3BZ6A 1JT6A 2DMUA 2ELJA 3BG6A 1ODDA 2K86A 2ECBA 2OQRA 1BR4A 5GPCA 2K3PA 3W2AA 2KDOA 5GAEJ 3FHNA 3Q9VA 3RKQA 1IN6A 4MLOA 3V8JA 3DCFA 4D1QA 1ZK8A 1T0FC 1PUFB 2QQ8A 2V1DA 4LJZF 4CO8A 1MMNA 3LOCA 3GW2A 5HDNA 2CJJA 3JRFA 3HDDA 2P6TA 1U5TA 3DPUA 4M9SA 3TBIA 5D4RA 1GV2A 2K9MA 1VQ6I 2XROA 3U9GA 2ZNZA 1KU3A 2VKVA 1HXDA 3L7WA 4EM0B 2D1VA 4CZCA 2FA5A 4D9JA 1LDKB 4BHBA 2QSFX 4KT5C 2R92J 1D8KA 3H0DA 4B4CA 4AVZA 3RPUA 4AYBN 1MNEA 2AXTC 5KAFC 5J6XA 3DF8A 4W1UA 3H9GA 3ZPLA 4XONA 1Z7LA 1IC8A 2VASA 4I09A 1IF1A 1BI0A 1G8XA 2VXZA 3LSRA 2X6OA 3RKWA 2IW5A 3F72A 5DUKA 3VDXA 1YJNI 2IEKA 3LSJA 3G6EI 2AHQA 4F55A 4NBQA 2M3AA 3I59A 3RIRA 1P2FA 5CVUA 5HLIA 2W24A 5BQTA 1FPQA 2M45A 4XN0A 3KETA 3BR1A 3D5LA 4FQGA 1H8AC 2WA0A 3HRMA 4NB5A 3HGGA 2VPRA 2XAGA 1ZREA 1G3WA 2IGNA 3OYLA 1IRGA 4XSXF 4RAZA 1ZG1A 4PCQA 2HQRA 1Q1HA 3G1MA 3TGNA 3MKYB 1K4TA 1W5TA 2JJ7A 1ERDA 1YJ9I 3CP8A 3G71I 4IRGA 2HOAA 3I0TA 2DDAA 3K69A 5F08A 3WGHA 3FMSA 2OJED 1P4XA 4C3HJ 4EM1A 3J81Z 2X9DA 3ZQIA 3JR9A 2XPWA 1GXQA 4XLCA 5B1AH 2BVMA 4P55A 4I6ZA 2Z3YA 4HAMA 1TTYA 3HRUA 3S3MA 1D3YA 3KEOA 1XPXA 2JTVA 2DN0A 3IV5A 3OY9A 2R3SA 4RS8A 5KHDA 4LB5A 3BG3A 3LA2A 2Z9OA 3CCMI 4C9YA 1YYVA 2EZHA 1USSA 3TP3A 1IN7A 3JRDA 4O6JA 4LMYA 3DU5A 3VSKA 2LY9A 2A5YB 1KQ0A 1QPIA 2CFOA 3WTTC 3MCZA 1F36A 3IC7A 2JRMA 1X4OA 3WE2A 4BU2A 5EEAA 1FP1D 5GPAA 3Q0UA 2X85A 4BH9A 3CJNA 3E0JB 4KN7X 2FMYA 3TO6A 1USTA 2EBIA 4ZC3A 4HYEA 1WRJA 3QPHA 3K2AA 1YO5C 5IT9K 2IS4A 4ENMA 2H6CA 3CCEI 4G7OF 3QOPA 2M8EA 1IXSB 4OWRB 5KCMA 1XX5A 2L7ZA 3DXJF 1PP8F 4WK8F 2VKHA 2O61A 2BYVE 4LOCA 2ZNYA 3HJEA 3L9FA 3QYBA 2DK5A 3OYFA 3PJRA 1JHHA 3KEYA 3SFZA 2NVXJ 2OU2A 5BS6A 2DA3A 2JK3A 4KFCA 4U0VA 2R7TA 4U0WA 2JVHA 1S6LA 2KPMA 1ZRFA 3ZQFA 3VB2A 5K7ZA 1RRJA 4RB0A 2FXAA 5D5VB 3C7JA 1I6XA 3KZYA 1CF7B 5B5EC 4CDGA 3WGGA 2K9QA 2FBHA 1OCOH 3C2GA 2ZBKA 3DLLF 1ZR2A 4XIDA 2QKLB 3GEZA 3MMYB 2HVSA 3S1NJ 2W57A 5J4VA 3CQZJ 3ML6A 1LJ9A 2O0YA 1DU0A 2GXBA 3E6BA 5LHGA 3T5XA 4A93J 4BXXJ 2RVCA 3BCBA 5DD8A 2GLOA 3RSNA 4RB3C 3CCVI 1K6OA 1Z67A 3E6DA 3OOUA 2V6EA 3HHHA 3PQKA 1IRFA 2L0KA 1F43A 1YS7A 3OR1C 2BY0A 2E1OA 4DJAA 2CUFA 4CSWA 3WHCA 2KDZA 1H0MA 4IHSA 5EEGA 2ETHA 2YUSA 1V5GA 4KJZA 4Y3OA 5KK1A 3I9V2 3K10A 2IP2A 1H9TA 5CVVA 2OZUA 2B0LA 3MEXA 2K9SA 4BJTA 1J5YA 2KIUA 3VYUB 2E60A 4MQVA 1R71A 5JHFA 3CDLA 4HLXA 5HNHA 2ZXIA 4IX7A 4PJMA 1JKQC 3SQNA 1JGSA 4D7MA 3VWBA 1R4NB 3FX3A 2OTLI 3ZQGA 3HIFA 3CMYA 3TQNA 1CGPA 1FOWA 4IEJA 2QEXI 4FCYA 4E7SA 2DTRA 4XICA 1FOXA 3K70C 2K9LA 5BPIA 1VNDA 3GMEA 3E3VA 4YIFA 4XKWA 2AQEA 3EUHA 4DIQA 5E3MA 1D5VA 2FBKA 3BQZA 3M1CA 1X2NA 3D5SC 5D5UB 4LK1F 4K2EA 5FLXZ 3OS1A 1BC8C 2A61A 3T0YA 3MKWB 3KP5A 3ZMUA 1MJAA 4OMZA 2VOPA 4A2UA 3P7NA 2CV2A 4MFDA 4RA2A 3ZMZA 2KJBA 2A5WA 2XKOA 3LMMA 1YITI 1UAAA 3R6SA 1MMDA 3KYLA 2DPUA 4ENNA 3Q5FA 4GXOA 5FKNA 5E3NA 2JN6A 1OCZH 4LG0B 1LQ1A 3HXLA 2FF4A 1HDDC 3J80K 1MDMB 4ETSA 1HOMA 1BBYA 3WTWC 2VKDA 2O03A 3A01B 4HDUA 4EJVA 4ZYEA 1HKSA 4UUSB 3CC4I 4UY8I 2EB7A 4ASNA 1ACIA 5EZGA 5K5OA 1S3JA 4M3BA 3H5NA 2F4IA 4IPAA 3OS0A 2HOEA 1PVEA 4WXCA 5D6EA 2NRAC 2GIZA 3H3ZA 5EDNA 3ZQ7A 5JLXA 1HA8A 4P5OA 1E3HA 3NAUA 1X4PA 2EZLA 3WTUC 1OCPA 2R7OA 3VSLA 1R1UA 2JVGA 2A6EF 1ZTRA 2L9SA 4LFUA 4N9HA 3O6BB 4RM3A 2XIGA 2A05A 2XHKA 1T56A 4EJWA 2A07F 4B43A 2N8GA 1FSHA 2MABA 3HOSA 5FKLA 3EYIA 4LD5A 2JT1A 4L18B 2M0MA 1W0UA 4MHGA 3TMOA 4A69C 1S9HA 1Z6TA 4ZYDA 1S72I 4CYCB 3JREA 1P7IA 2W4SA 2ZB9A 2HZDA 4IQJA 3CO6C 1BW6A 2ICWG 2ZSHB 4LG0A 3V8LA 1HF0A 4OIPF 1DP7P 4NC8A 3I4MJ 3PSIA 4A5NA 2F4OB 4Y33A 3BROA 5HODA 3M7GA 5F1JA 3DEEA 2YR2A 2PQ8A 2L01A 2Z99A 3FIWA 1ZG5A 3ECOA 1H9GA 2DMQA 4BQAA 1XN7A 5IP6A 2ID6A 2W85A 1TWFJ 5D5XB 3ZMDA 3M3YJ 1YJWI 2L4AA 3TO9A 3CUQB 3BPVA 1VQ9I 4FT8A 2MSYA 3UNGC 1DPUA 3VEPA 2VN2A 3PNVA 2MG4A 1BC7C 3IUOA 4FHTA 3SYTA 2L7KA 2IRFG 1ETOA 1HCRA 1SFUA 2LR8A 2HI3A 2OBPA 3TP0A 2F5EA 1RZ4A 2OTJI 2PBIA 2Q2EB 4L0ZB 3PO3J 2KJCA 3MVPA 3RZOJ 3RZDJ 4E7ZA 3SJMA 4HSTA 4Z2YA 3K4KA 1OYIA 1ZAOA 3HGYA 3ZQCA 4EEFG 3FXUA 1J7KA 2Y2ZA 2XF7A 1W7PD 1TBXA 1G3SA 3QPSA 1A6IA 1YLFA 3RKYA 2EWNA 2WY8Q 2WWYA 2JUGA 2FQ3A 3BT9A 3IWZA 2PG4A 4KIFA 5M5WJ 1IRXA 4HDVA 1B4AA 4D5FA 3GFLA 2DA7A 2MFZA 1G3TA 1ZYRF 2H09A 1BI3A 3CJTB 1AHDP 4BJ5C 4IHTA 4IHWA 3MWMA 5IOZA 4MNUA 2JA2A 3J7AO 2KIQA 1G4DA 4S05A 2QVOA 4ENJA 2COBA 1QHGA 5HOOA 4MGRA 3PIOF 1ZGJA 4C3JJ 1NK3P 1S5LC 3OR2C 1LDJA 2HVRA 2VQLA 2VBZA 1V5EA 4Y17A 2DOEA 3U2RA 2YU9J 3EYYA 3V7CA 3F3XA 2E1MB 5FKMA 2I8DA 2H8RA 4KIBA 4BE2A 1WVRA 1M1EB 3RPUD 1VQLI 4B44A 3S2HJ 4HQEA 1LE8B 1XGOA 1GV5A 2EINH 5BOXA 2I10A 3IWFA 4Y15A 2XGCA 3CF2A 1Z91A 1MW7A 2BEOA 3PQJA 4KIGA 5JVGF 2F2EA 3DBHB 2GM4A 1LKXA 4NC6A 1G59A 4LITA 1SFKA 2K7LA 1W7PA 2FBIA 2ZCWA 3LL7A 3S15J 5L3DA 2KRFA 1YRNA 4AM3A 2WAQN 5LD2C 1XMXA 1WJBA 1I3AA 1W5CC 2LDUA 4IXAA 4NQWB 2LH9A 1F4KA 3HUGA 2VOOA 4ITVA 2WV0A 3GO5A 1LFPA 4ZYGA 3GFJA 5F1RA 4L0YB 1YIOA 4M3DA 4IOAF 3CUQA 1X1PA 4F92B 3HSFA 1UCRA 4M3GA 3JAMZ 2ELHA 4D0PA 1MJBA 1UG2A 1I3QJ 4BAYA 2P7CB 2PLYA 3H0GJ 2MLKA 3KP4A 3HSEA 4N4OB 1EJ9A 1YX5A 3HOYJ 4N0BA 2HYFA 4A6EA 3OS2A 1RR7A 1WKMA 2HQNA 3M9AA 4BJ6C 2IGKA 1BN5A 1SD5A 5EJCA 1FYMA 2HDWA 1MSFC 4DBRA 1MZBA 2XVCA 2PFBA 2VE8A 1U8BA 4MTEA 5DDGA 1U78A 3S14J 2ELKA 2WV1A 3LAPA 3S3OA 2TCTA 4GFBA 3SZGA 2R7RA 5EGOB 1XSDA 2XDVA 2H1KA 1RR8C 3T1BA 3F6VA 2VT2A 5ILSA 5FO5A 2VUMJ 4A3DJ 1D5YA 4F52A 1GT0C 4ABZA 1GDTA 1AWCA 1N75A 2CYYA 2KRHA 3BPXA 5CJ9A 2COMA 5FGMA 4UHTA 3GCMA 2E36A 1BM9A 2FU4A 4XKBA 2MC4A 3Q3SA 2KMUA 4I0BA 4Z6YA 2EPFA 1MNDA 1Z3XA 1QVUA 1Y56A 3CCYA 4IRHA 1OCTC 2O6GE 1TW2A 1XCVA 2EFQA 3QAHA 3GTJJ 2L3DA 4HW0A 1R7JA 2RREA 5DCMA 1MBEA 2RNGA 1MBGA 3DTIA 3P5JA 1QGPA 4QWQA 2X51A 4C3IJ 3LSHA 2CGPA 1U3EM 1MMAA 1X1BA 3ZR8X 1OCRH 2WAFA 5ILVA 3K4LA 4A3LJ 1T8IA 1O4XA 2H27A 4MEYF 4II2A 1YE9A 3DEWA 2PJRB 5F04A 4DYRA 3RTRA 1WZ2A 4CYCA 3R61A 1SAUA 2LKPA 3MZYA 4QTRA 1FMVA 4X1EA 4YEJA 1LE8A 4U7BA 2WB1A 4KYWA 1MIJA 3ERMA 3D0SA 3N97A 4ZDLA 1IN8A 2P6SA 1XMKA 4YFXF 5E1ZB 1XDSA 2DU9A 2LOOA 1UB9A 2QCOA 2XGDA 2O8KA 4C30A 2W48A 4JBAA 4AIDA 4BQOA 1IUYA 1LFBA 3FM3A 1TNSA 3K9TA 3R4KA 1QO0D 4HPQA 4E70A 1VQ7I 4HF2A 1IJWC 3HUGB 3GTLJ 2E2IJ 3VOEA 3CLOA 1TT5B 4JQFA 4YIRX 1XB4A 3E6MA 5F0FA 1L3LA 4BUPA 2Y30A 1X3UA 3K4MA 4F91B 2X1CA 4UUTA 5FJ8J 2WADA 5DCFA 3QP5A 4OU0A 4UB6C 3V7RA 2XSDC 4I01A 3GZ6A 4UVCA 2LTPA 2ZJPF 2WTEA 1IN4A 2ZMEB 4PJLA 5LHIA 1ZRDA 2LKSA 5J8FA 4F7ZA 3HKZA 5J1RA 3FBNB 4BEHA 3W2WA 3H3VK 1ULYA 3FWEA 3BR2A 1ON2A 5L3BA 4G12A 2HFHA 2RC4A 4E7IA 2ISZA 3Q9SA 2XGEA 3F8MA 3BZCA 2VIXA 4HG2A 2E34A 3BR6A 1BI2A 2L02A 3PUBA 2J5PA 4W97A 3HTSB 3NRVA 3JW4A 3BP8A 2CMPA 2B9SA 2P7VB 2HYGD 2DCEA 5EGOA 4NUBA 4GO1A 4L9JA 1O3SA 2R7UA 2LK2A 2VXDA 3NQOA 1LUJB 4A3CJ 3AFHA 3J7ZI 1B9NA 3QU3A 3JRGA 2EFNA 4I76A 5DEQA 4BXUA 2LD5A 2O7OA 1IUFA 2CWEA 5IYBJ 3WTYC 1FLIA 3OMYA 3QQAA 1FP2A 4I0AA 2CQQA 2K4JA 1QRYA 4L5JA 3H1CA 2VONA 1ETYA 2VBXA 2K3FA 2CQNA 3TO7A 4WX9A 1ZG3A 5IYDJ 2Z2SB 1TQIA 3V4GA 1QBJA 3MD2A 3RQ4A 3QRFF 3C2HA 1POGA 2PMZN 4A6DA 3BTIA 1S7OA 3BWGA 1J59A 5ILUA 1PJRA 5ICCA 4ZDPA 1SFOJ 1JUPA 1OPCA 2RDPA 4HNTA 1UZCA 4L5IA 3DKXA 5EG0A 1XMAA 3FBIB 3QYEA 1SD6A 5J3LA 2PEXA 1YS6A 3VYRB 3OYHA 4J01A 1DU6A 2JPCA 2DO7A 5IYCJ 3CLQA 1WJFA 3PM1A 5FLXK 3KYCB 3U1DA 1VQNI 3IKVA 5J47A 5C3EJ 3JRCA 2DA5A 2V9KA 4YELA 4AD9A 2MW8A 4EMSA 2D45A 4IJAA 4M3FA 3AL0C 5K7FA 3F6OA 3OYNA 3HOUJ 1R00A 2FNAA 2DT6A 1WI9A 2KRCA 3O8GA 3S93A 3AL0B 1B72B 3I59B 3E6CC 4IVNA 2ZFUA 2XSJC 4HV6A 3HZJA 2E71A 3DV8A 2EH3A 4P1WA 2EIJH 2I5UA 5JR3A 4ZTFA 1HLVA 2NNNA 2FRHA 4RMNA 2LF7A 2Y69H 2NAZA 3LSTA 1RUNA 4LIVA 5J4YA 3T8RA 5B66C 3A0HC 2Y9YA 2WY7Q 2KP6A 2QZ8A 5H6QA 3G1OA 4YIIA 2KQRA 1SFEA 3F21A 2KKOA 2PMZA 2HDDA 3QOEA 4YFNF 2VJ5A 4L9NA 4B1RA 1J0RA 4AC0A 1ETVA 2QYOA 4XLHA 2DOFA 3WTVC 3PNTA 3LSKA 2HGCA 1ZLKA 5TGTA 4CCMA 1HQCA 1KZHA 3KEQA 3L00A 2LNBA 4Y4RA 2XAQA 3ZMTA 1D0XA 4M6YA 1HSTA 3DKWA 4CZZA 2HPIA 3CDHA 2UV1A 1TNTA 5IOYA 2CFXA 3OL3A 3OIOA 1JUSA 1X1AA 2OD5A 1B9MA 4BBSJ 1KQ9A 2RNJA 1P92A 3FK6A 4BE0A 2VQHA 2BV6A 2UWMA 2M9HA 2ZMEC 3HOZJ 3Q0VA 4DYQA 3FXQA 1X1DA 1L0OC 1VQMI 3I53A 1JKRC 3W6VA 3ASNH 4YG2F 4TV7A 1LVAA 1ETKA 1IXRC 4HSRA 1B8IB 2IS6A 3E97A 3F9KA 4QLCU 5LBQA 1RKTA 2CS3A 2ZSIB 4P9UA 1SD7A 1K79A 1T38A 4BQQA 4DYCA 2MH2A 2YX4A 3L2WA 2R7QA 3RYRA 4BE1A 2HEOA 4KISA 1HC8A 1LNWA 3GYHX 4XKCA 3H5AA 4AIKA 1RIOH 5HS9A 5AIQA 2DMPA 4FX0A 1F1ZA 3FDYA 2F6CA 2FX0A 3TEDA 3G1LA 5CKTA 1D1CA 4XRSG 2LG4A 3I56I 2FQ4A 4V19K 4FISA 1ZN2A 4ENKA 2DA6A 2IGOA 3LA7A 3U1KA 3EQLF 1Z77A 2J5OA 3K4JA 2AQFA 4KDPA 2AXLA 3H9QA 4H4KC 1BIBA 4U7DA 2GBYA 4AIJA 4A3EJ 1C0WA 2KT0A 1TWAJ 3HPGA 5EF6A 3CF5F 3DEUA 4PSWA 1AKHA 3QPTA 4ZDOA 3M4OJ 3HSRA 3IH3A 1PUFA 4A3MJ 2WC2A 3TW7A 4DW6A 2GA1A 2W00A 3R0AA 2XRNA 2OQGA 2KFDA 2V1XA 4ANJA 3CD6I 3GTGJ 3I71A 5GAHJ 3UKGA 3BR3A 2A3SA 1QNTA 2IA0A 1I6HJ 4Q47A 1E17A 1OKRA 5CYVA 5FD5A 5ICFA 2F4MB 4G7HF 2E7XA 4M71A 5L3FA 1OCCH 1YW9A 4M3EA 2HKOA 5CVJA 3G4SI 2IS1A 4GDFA 5JHUA 2E1CA 2H94A 4P9FA 1AU7A 2CO5A 3FXMA 2L7MP 3WTSC 1T0FA 1PDNC 4NHJA 2NYXA 2VLAA 2EZIA 1J09A 5DS9A 3ABTA 3OYKA 5LRSA 1KQ8A 3PFIA 4S04A 2VQGA 1R49A 1SVMA 2IPQX 5HLHA 5GTIC 4HRIA 2QGUA 2UXXA 4EV0A 3CMAI 3KYDB 5E17F 3H5RA 4I2OA 1HW5A 4GGGA 3J7YJ 4KMUX 4EGYA 3HTUA 2NVUB 1NG7A 3N05A 1HKTA 1TW3A 4BACA 2NXNB 2XF5A 1WPKA 2G7UA 4HOBA 3FK7A 4IQ4A 4A3IJ 1W0TA 1RC9A 3G2BA 1Y0NA 1YQAA 1DGWY 1ZGWA 2P5KA 5IY5H 2DFEA 4R79A 4ZTJA 1JKOC 3C18A 1JE8A 3QODA 5IP9J 2QQBA 3VYSB 1Q1VA 2LREA 3CO7C 1AOYA 1FZPB 2HTSA 2MBFA 3S3NA 3EUHC 4OIOF 1MMSA 2ZMEA 2WAQA 3TKYA 2JRTA 3X2QH 3ZN0A 3GVAA 5A2QK 2UZKA 4HNUA 4GYGA 2V79A 2EFWA 1KU2A 4E7HA 3V8KA 3ABMH 2Y48A 3GZ5A 3WODF 2LFBA 2KISA 3L2VA 5K7HA 3KP7A 3HG9A 4GYIA 3I55I 3ELKA 3CMEI 3WTXC 1RI7A 3ABLH 2OA4A 3FM5A 3UR3C 2K02A 2R7VA 3PSFA 4E6KG 3JRBA 1ORKA 4HX4A 1FOYA 4BDYA 2M87A 2A6HF 1R36A 1XDUA 1ZQ3P 3E5XA 3GLXA 1R5ID 3A1YA 3R0JA 5DYMA 2EJRA 1MBJA 4YFKF 2QENA 3BY6A 3L1PA 1BOAA 4BXFA 1OLTA 4WXDA 2TDXA 1QZZA 4ON0A 3KZZA 3LSIA 2XB5A 3A4CA 1ETXA 1NG6A 4PJ0C 3TW6A 2BHYA 4BY7J 1I50J 1QZEA 4RB2C 1IG7A 3F8FA 3SEZA 3OSGA 1WSUA 3CC7I 4FASD 2DQLA 1D1AA 3CCLI 2DA4A 1IRZA 1A31A 4UNOA 3E7LA 2X48A 2FOWA 1I27A 3DLAA 5H2FC 4G9YA 1N77A 4JX5A 2XKPA 4CCNA 4RBOA 2R7DA 1RUOA 5TJJA 1AKHB 4FETA 9ANTA 3TOAA 2BHZA 3LQQA 1ON1A 2LVSA 4XRMA 1T2KA 3DKYA 4WWCA 1SMTA 4NC7A 2CG4A 2JPBA 3VYTB 2O9LA 4PGHA 2XUBA 3N4MA 1ZGAA 3JRIA 1F5TA 1FNNA 1XC5A 2AO9A 4N4NB 5F64A 1OISA 2PMHA 1SD4A 3LWFA 1SMYF 4XKVA 3Q0WA 5KAIC 2HPMA 5E3OA 1BW5A 1WJEA 1TP4A 3FXLA 1HBXG 2NVQJ 2R7XA 3K1MA 1E0EA 1VQ5I 3CMMA 1OYWA 3QPLA 4A3FJ 5DCMB 1X1CA 4L5EA 1KONA 1QVTA 2Z1DA 2ZC2A 3IAS2 4ZYHA 2EV5A 2HR3A 5GP9A 1IDYA 3K4NA 3LSMA 2HKXA 3OWTA 4EJOA 4OMYA 3ESWB 5J1UA 3V7SA 1WH5A 2M4KA 4KA4A 3FXRA 4U88A 2K85A 2M0CA 3RKXA 3AAFA 1JHFA 2Q1ZB 2K40A 1JJ6C 2VT3A 2ESNA 2VBYA 1ITYA 2QWWA 2DAOA 4RDUA 1GLNA 2KHMA 3F0CA 2Y0SN 1XGMA 2W7NA 2LY2A 2X6WA 1HSJA 3H3UA 4ZZLA 2L5QA 1OR7C 3I5UA 1KYZA 3ZMSA 3W6JB 4QPQA 1V5FA 3OIQA 3WHBA 3BQYA 4I02A 1BJZA 3HOTA 3DQVC 1FBSA 3HOWJ 2C6YA 4XOTA 4S0HB 2GXGA 2M4GA 1HW2A 4D7NA 5BPDA 2DA2A 1GHCA 1O3QA 2CQXA 1EF4A 4EM2A 3W2VA 2M5WA 3K6GA 4QIWN 3AKZA 3I4NJ 4A5MA 3MFKA 2XAJA 3OYEA 3F8CA 4N9IA 3S8PA 1N78A 1SAXA 4XNFA 2TRTA 3L2CA 2YS9A 2O5RA 4OOIA 1GUUA 5FFXA 5HNFA 5LFAA 3IAM2 1X3WB 1EA3A 3KFWX 2L7FP 3S1QJ 3F8BA 3FISA 4RAGA 3DTKA 3BJAA 4RGRA 1U8RA 1JKPC 4X6AJ 2Z16A 3I54A 4CH7A 3K4CA 1OQYA 3A03A 3OYDA 3SXYA 4Y7NJ 1YW8A 2NOJB 3HEFA 2DODA 2OAZA 2ID3A 2HZTA 2JMWA 3F23A 1DDNA 4MIMA 6PAXA 1JXSA 3OYAA 3CCQI 2KZVA 4HF0A 4DBQA 1O3TA 3I64A 1MBFA 5E1XA 1Z7UA 3HC7A 5KNLA 3RPQA 1K6YA 2FEZA 5FKKA 1DPRA 1WH7A 4PJJA 4BBRJ 4A3JJ 1G2HA 1IV8A 2X6XA 4IHYA 1UFMA 2VC1A 2E5NA 3CUOA 4C2TA 3AG4H 4M6VA 3AG3H 2KLOA 2M8GX 3OYJA 1LFUP 3K1NA 1UHMA 3D1NI 4R8HA 4Q5SF 5K5QA 5CPRB 3JRAA 1XTAA 2DT7B 4GRIA 3J7AY 1D0ZA 1WJAA 4A3GJ 5FB2A 4M9XA 5H20A 3K70D 3GX4X 5LGTA 1R5GA 1QPMA 2VKEA 2A68F 2NOGA 2ZFWA 4HV5A 4MQ9F 2R4GA 1UHWA 1Z1DA 1RNLA 4F3QA 2H8WA 1BOBA 1V4RA 2EQRA 2MLGA 2W84A 4O3MA 3K0LA 3GF2A 1MD0A 3AG1H 4UB8C 1W4MA 3MKZA 2CUZA 3CTAA 2X1DA 1U2WA 1T98A 4KT6A 5JFRA 1B72A 3DU6A 2HTJA 5M3FJ 3PNYA 3ISPA 4U0YA 1R58A 1LVKA 2IA2A 2CW0F 1I1SA 5FKOA 3BTCA 3TOBA 5FLMJ 1H88C 2L9RA 4I7HA 2DA1A 4PFPA 3ZP5A 3RCOA 4BL0B 4RM2A 2NS0A 5J40A 1F9NA 2ZXWH 4M73A 4A0YA 3OL4A 2XGXA 4UXNA 4BHPA 3REOA 3VPRA 2DLLA 1S7EA 4EJTA 5LRRA 1GVDA 5TRDA 1QHHD 2MA3A 5F0HA 3LSPA 1I5ZA 4DOZA 4RAFA 2EA4A 3O3KA 2E1MC 5D6FA 1Y0UA 2DMTA 2QSHX 1CQTA 1A6QA 2BZTA 1TZLA 1U5TC 2BE5F 1VZ0A 1BR2A 1ZKGA 3OV8A 1YRNB 4IHVA 3E1SA 3GTOJ 1R4MB 5CVRA 4C2MJ 4EQQA 1IO2A 4RGXA 4CYDA 1BA5A 3RJPA 2FJ1A 1J9IA 2CH0A 1O7FA 1XSVA 4PUSA 4NNJA 5M5YJ 2GZWA 3M8FA 1TWCJ 1S7AA 2CUEA 2YU3A 3NWTA 4G6TB 3CP2A 2IA1A 3CCSI 1MH4A 2ZXHA 2GA2A 4O5VA 2ADUA 3L09A 5D8KB 4R1HA 2MD0A 4XQFA 3T8TA 5ICGA 2LKXA 1KA8A 4CXFA 2P8TA 1T39A 2EIMH 3MN2A 3P9KA 5LGUA 3TDZC 1OJLA 4M72A 2ZKZA 2KIFA 3LA3A 4Y13A 3ZQQA 5LLQA 2OC6A 3ZMVA 1EH7A 4AYBA 4J00A 3BG5A 3S1RJ 3HM5A 4JOMA 2WB1N 5CLSA 3FZVA 5E8IA 2XV4S 1WCMJ 1TT0A 2JZYA 3IP4B 3KLNA 5CQEA 2BOLA 1O7LA 1WI3A 4PDKA 3PFYA 5DM7F 2E7WA 3JTGA 2HXIA 2F5VA 1STZA 3QWLA 1ZRCA 1FMWA 1MDMA 3BG7A 3FKJA 2W82A 5J8CA 1JT0A 1TQMA 2BBYA 4LLLA 2P81A 1J2XA 3C1DA 1BR1A 1NK2P 2CU7A 3BC8A 3E5QA 3M07A 5D5WB 3H92A 4B47A 1RESA 2HDCA 2VC0A 1J75A 4XLEA 1VQKI 4M9ZA 2V4JC 2G9WA 1T08B 4B8XA 2OCCH 2XRLA 4V2GA 2CV0A 2HQ5A 2CRGA 4HX8A 2L2OA 3CJQB 3IRRA 1GVJA 1O3RA 2IT0A 2P4WA 1MBHA 3J80Z 5EZHA 3S16J 4P96A 1DQUA 1QU3A 4DZPA 3OOPA 2RV8A 4FE4A 4PGGA 1G3YA 4BQNA 2LSOA 3P9IA 2DYRH 4XOPA 4DNCA 5E1WA 4LG3A 3FKIJ 3DPTA 1R5HA 1IN5A 2OUMA 2NS8A 4LLNA 4CHUA 2ZJ2A 2B63J 4KICA 2IS2A 1P4AA 4M74A 3M8JA 2Y75A 5BNGA 2JA5J 4ZH4F 1U9NA 2XASA 2RQQA 3I4PA 1XD7A 4B48A 1TC3C 4AIHA 2L4MA 3HBLA 4EATA 1ZH5A 2PMUA 5E8GA 4CCOA 1ONVA 4HQMA 4RAYA 1DP3A 3G3ZA 4Q4ZF 2VE9A 1K78A 2V26A 5ERIA 4CCLA 5C44J 1X2MA 2KZGA 4IZZA 1Y6IA 2L54A 4L9TA 1YI2I 2E2HJ 1VI0A 5E18F 3GFIA 4D5CA 3GTQJ 3ZRGA 5KVRA 2XPVA 3EUAA 2KL4A 1B1BA 5K5RA 1R23A 4UUVA 1FOKA 2QA4I 4BGDA 2VL8A 4OAYA 4OIRF 1FIPA 4XLAA 4HBLA 5IPAA 2DI3A 3I3LA 1SEUA 2R5YB 2ECCA 1A5JA 1YW7A 3D5RC 1XG1A 5DV5A 2IAIA 1H89C 2Z5UA 3GFMA 3LAJA 2GOMA 3BCAA 4XL9A 2Z33A 1JJ8C 3TL4X 2LBFA 3C3WA 1IGNA 5F27A 1SVOA 2DTZA 4PFOA 3SHFA 1TLHB 1TWHJ 5GAGJ 2DFFA 3WU0A 3ZN1A 3GTPJ 2FSWA 4L9VA 1PP7U 1JI8A 4ESFA 4IO9F 3BR5A 3L2QA 3GTKJ 3RYPA 4UVBA 3H36A 2W25A 2OZ6A 3V42A 1EH8A 4WXHA 1R1VA 2ZJRF 1U5TB 3OYGA 3IHUA 2IXSA 3LFKA 3KP3A 2R7WA 4Y52J 2UXNA 4GCVA 4XLFA 2BGCA 2HXOA 2W1OA 3PUFA 1VQOI 4CCKA 4CGZA 1S8NA 2CSOA 2VBWA 1I1GA 2D1HA 1FBUA 1KYWA 4HNVA 1S29A 2OCEA 2H6BA 5TISC 5HLTA 1W1WE 4BS9A 2HS5A 4NDLA 2R0QC 1HKQA 1RETA 3CESA 3M8EA 1SC7A 4H0EA 3P9CA 2EILH 1Y8QB 4F93B 1XS9A 1UJ8A 2R5YA 3GTMJ 4IF4A 4RLFA 1K4SA 2D2WA 4IHXA 3LFUA 3JTHA 5LHHA 2DFIA 3U21A 4QSHA 1O57A 3EPZA 3K1PA 2V1UA 2X6YA 3KPHA 4FE7A 3S1MJ 1XSXA 3FXJA 1EKEA 2V1NA 1W5SA 3OYCA 2AS5F 2FE3A 3JSPA 2G0EA 3QYFA 2V7FA 1X3ZB 4DQ2A 4ZZDA 4FX4A 2F48A 3DBRB 1ZLJA 2KIMA 1V54H 1FTTA 2GIVA 3HRTA 4BHCA 2G7HA 2EV6A 4BY1J 2DW4A 3OYIA 4XRSA 3CZ6A 4XLPF 5BMZA 3ZQLA 5AONA 5EEHA 1REPC 2M34A 1SANA 2R7FA 1LB2A 5HS8A 4IL6C 1P6RA 2Q2EA 4JYKA 3S2DJ 2EZKA 1IZ1A 3OYBA 3QP6A 4XM3A 1MSEC 4RLQA 4RGUA 4HF1A 1TWGJ 1IW7F 2LY1A 1Z05A 2QKMB 2M7BA 3FXKA 4OINF 1Z0XA 1YTYA 2ZJQF 4G6DA 4E7KA 3BZKA 3HKZN 3CCJI 3KP6A 5A2QZ 3HB9A 5FRMA 4KMFA 1R22A 4V2FA 4XR6A 3KZIC 2K4BA 4UV9A 1VQPI 1A04A 1TQPA 5AIPA 1RKWA 5DD4A 2F5FA 1EH6A 3ZOBA 1Y1WJ 4ZJZA 3ABKH 5D8LB 3A01A 2JSCA 1IV6A 3BOQA 1W7PB 3DWLE 4E4HA 3IRQA 4Q48A 1FY7A 2E1NA 2X4HA 1DGRM 1WGXA 2EA2A 1GXPA 1LEBA 1I39A 1Y39A 2LLKA 1VQ8I 1MBKA 3NARA 2VJ4A 3KLOA 4YRVA 2R7ZJ 1BIAA 1MH3A 3OSFA 4XRFA 4HA8A 1K78B 2EIKH 4KN4X 2HNHA 2HVQA 4PK4A 1UG0A 2WBMA 2Y9ZA 3KIOA 3H35A 1YFHA 1D8JA 1YOVB 2OV7A 3LQRA 5F6FA 3GUDA 1Z21A 1FIAA 4XK4A 5D4SA 1QQIA 3IKTA 2IVMA 2HOTA 3CDIA 2FOKA 4XLNF 2VI6A 5HDKA 4KNYA 2DJNA 4PSXA 2ISYA 2MYSA 2H1LA 2PI0A 2P5LC 2LBFB 3JAMK 2BY2A 2X1EA 5B1BH 3CCRI 2BY3A 5C4JJ 1VTNC 1K83J 1T6SA 3PIPF 1XCBA 4XSZF 2CUJA 2QF7A 2JA7J 3B6AA 2YSRA 5E20A 5GADJ 3TDUC 5L3EA 2GXAA 4I99C 3O8HA 1WJCA 2LYCA 4XN3A 1ZHFA 2P0WA 1FC3A 3H9JA 1AA7A 2MH9A 2IJLA 1MJ9A 4A12A 3IH2A 2DDBA 2DMNA 2ME6A 2XAHA 3HOXJ 3EETA 3FXOA 4PJNA 2Q8KA 2LC2A 4ESJA 5CQGA 3KX2A 3M1EA 2QM3A 2EK5A 5H6RA 4CCJA 1D1BA 2RN7A 4B09A 2JA6J 4UV8A 1K61A 4WCGA 2DT5A 2BW3A 1Z9CA 1HW1A 3BJ6A 2Y31A 2DYSH 2JSPA 5ICEA 1WHUA 2Q0OA 4EGZA 2YX7A 3R60A 1KGSA 2STTA 2VODA 4BKXA 5FD6A 3HL2A 2CQKA 3DPLC 4LK0F 3NWSA 1OFCX 1BI1A 5DTDA 1VF9A 1T95A 2E2JJ 3BG9A 2CQ7A 4BEHB 2HOSA 4HZFA 2XC7A 1R9TJ 3COAC 3LSGA 1QA6A 2DBBA 2QBYA 1PYVA 3B02A 3DTEA 3WE3A 4A0ZA 2PN6A 3CCUI 5E3LA 1HDPA 4ESBA 4U87A 2PJPA 1FT9A 4KUMA 1CF7A 4UVAA 5F0CA 2JA8J 1Y8RB 5IP7J 2HU9A 2FD5A 2ZXJA 4HX7A 1ENHA 2DK8A 2BY1A 3BJOA 3KCCA 5J1YA 2R5ZA 4IOCF 1B8IA 2IGMA 1MMGA 2LF8A 3MZ8A 5E79C 5HLGA 2NVTJ 2LMDA 4G8XA 3GLLA 3SEQA 4B3AA 1W36C 4AUXA 2BVLA 2BXZA 1G6NA 4HEA2 5CVIA 2E35A 3IL2A 3OYMA 1WFXA 4LIUA 2HWVA 3F22A 5L3GA 2GAUA 4BDZA 2VPLA 1JUMA 4PZJA 1NTCA 4DZJA 3SZTA 3EUKL 4FTHA 2VB6A 2LRDA 1R6RA 2CW7A 2DQRA 2ZO4A 2GWRA 2K5CA 1ETQA 2QQ9A 3PO2J 1V3FA 1JTXA 2MD5A 2FUG2 4RGSA 1NH3A 3S32A 3ERED 4EJUA 3SDBA 2XF6A 3MAJA 1IAWA 3BTJA 2NS7A 4A3KJ 5EYRA 1LDDA 2V6CA 3DBLB 4MFEA 2CW8A 1X19A 4OIQF 2GOXB 2JQ7A 1YG2A 4J19A 5LEJA 1YX3A 4IKFA 2ME0A 5HDGA 1MGTA 1VFCA 4BNCA 3BLYA 4CUGA 2MGQA 5LGNA 3CUQC 4XORA 5B3SH 3JRHA 2DXIA 2STWA 1RPWA 2MC3A 1KU7A 3BR0A 3E5UA 3IH4A 5GTHC 3HRSA 4G7ZF 1E2XA 2L9NA 1U6GA 3GZNB 4LLGF 4CICA 3O2PE 4II3A 2DPDA 3S17J 3SFIA 3WG9A 1QZYA 1FSEA 3FMQA 1FWZA 1ZARA 4IRIA 3CJRB 3ROUA 5JLWA 2NVYJ 4E7JA 2B7EA 2PX9A 2QUFA 2XAUA 2XAFA 3RI4A 1E3PA 5FFZA 3W3CA 3NEUA 1ZR4A 4AU7A 3B6CA 2R93J 3S2WA 2FNPA 1VQ4I 1JGGA 1APLC 3ZQHA 1P4WA 3WG7H 1UMQA 3WU1B 2YPRA 1UELB 5EG0B 5DM6F 2ACJA 1JTYA 4ZYAA 1OR7A 1FBQA 1WJDA 3W6KB 3LNQA 2R5ZB 1A35A 2E5ZA 2QLZA 4RB1A 4UUSA 3C2BA 5ED4A 4QPOA 1Y1VJ 1PUEE 3DP7A 1WWXA 3I58A 3ABUA 2EV0A 4OAZA 5K1YA 2NNYA 2K9NA 5HS7A 3SZPA 2QBYB 1IDZA 2DOAA 3KE2A 2EFPA 2CV1A 1E3OC 1LEAA 1UHSA 2VJIA 1B59A 4G6QA 1MKMA 1EV7A 3CC2I 1BJAA 4WF2A 2QQAA 2DFHA 4JP0A 2HQAA 2XB0X 5C4XJ 2QSGX 3FF5A 1BL0A 4BYYA 2A6TA 3A02A 2BW3B 4EVIA 4AWXB 2M30A 3L2RA 3VODA 1IXCA 1D0YA 4MEXF 2RQPA 3B73A 2O3FA 2A69F 3PL8A 5IT3A 4G94A 3OIPA 4I98B 3J81K 2ESHA 3ASOH 4MO7A 1YIJI 3FHZA 2IBDA 4MTDA 5DUIA 2P5VA 2V9PA 4JX4A 1Z6RA 3ONQA 1DUXC 5LEKA 4DGWB 1LPQA 2OF7A 3KP2A 2RAEA 2L9VA 2XPUA 4M6XA 5FLVA 2RKHA 1Z3YA 5HVQC 3HOVJ 1TL8A 1FYKA 4JK1X 1V55H 1NHAA 3K2ZA 2UUZA 3MKLA 4CA0A 3RDIA 3JCUC 1FJLA 1P7JA 2FMLA 2V9VA 2X0LA 3WTZA 2VJJA 2O8XA 1FX7A 3ZXSA 3L2UA 5M5XJ 1ZELA 3GWZA 4C2UA 2F5DA 1ETWA 2GQQA 1XGNA 2WAEA 3BDDA 3MZHA 4NQWA 5FRNA 4LB6B 2OPTA 3K7AJ 1XGSA 4B3XA 1W36D 2EFOA 2BXYA 3ZCOA 1K7AA 3SDGA 2DJIA 4E7LA 3A2KA 4XBFA 1X58A 3JSOA 5IT9Z 2M1BA 4XMYA 4HLYA 3WU2C 4KITB 1KU9A 5JVTA 1A36A 1P9QC 1OYYA 3K4BA 2Y0MA 1SVLA 2M2EA 3RQIA
chains in the Genus database with same CATH topology
5M3MJ 2R5YB 2ECCA 2JWTA 1A5JA 3S2HJ 1LE8B 1GV5A 1XG1A 2LP0A 1U9OA 2I10A 2IAIA 2XGCA 2E19A 2LFBA 1H89C 5K7HA 2GM4A 1JJ8C 2HYJA 1IGNA 5F27A 4JX6A 2DTZA 1TWHJ 3S15J 1FEXA 1FTZA 3BTLA 3JRBA 1YRNA 2WAQN 3GTPJ 4A3BJ 1ORKA 1T33A 3BR5A 2D5VA 3GTKJ 1ZQ3P 1MNMC 3GBGA 4M3DA 1JT6A 2DMUA 1MBJA 4M3GA 2ECBA 3L1PA 1UG2A 1I3QJ 5GPCA 3H0GJ 3RKQA 4MLOA 4Y52J 2XB5A 3HOYJ 3DCFA 1ZK8A 1ETXA 1PUFB 2HXOA 3TW6A 4BY7J 1RR7A 1I50J 3LOCA 4HNVA 2CJJA 3JRFA 3HDDA 1IG7A 3OSGA 1MSFC 1GV2A 3S14J 1U8BA 1U78A 2VKVA 2ELKA 2WV1A 2DA4A 2TCTA 4NDLA 4GFBA 2R92J 2R0QC 1IRZA 1RETA 2H1KA 5EGOB 4B4CA 4AYBN 3E7LA 2X48A 2VUMJ 1XS9A 4A3DJ 4W1UA 2R5YA 4JX5A 1D5YA 3GTMJ 4RBOA 1GT0C 1IC8A 4IHXA 4ABZA 1GDTA 1AKHB 9ANTA 2LVSA 4XRMA 3LSRA 2X6OA 4QSHA 4FE7A 2IEKA 3LSJA 2O9LA 3S1MJ 2AHQA 3JRIA 3Q3SA 2AO9A 1XC5A 2G0EA 1QVUA 3CCYA 1OCTC 3BR1A 1BW5A 3Q0WA 5E3OA 1FTTA 1H8AC 3GTJJ 2NVQJ 3HGGA 2VPRA 4BY1J 1MBEA 4XRSA 1MBGA 3ZQLA 3QPLA 4A3FJ 2M34A 4C3IJ 1SANA 3G1MA 2JJ7A 4L5EA 4JYKA 3S2DJ 2EZKA 1QVTA 2HOAA 5F08A 1O4XA 4A3LJ 1MSEC 5GP9A 1IDYA 3DEWA 5F04A 4C3HJ 4DYRA 1TWGJ 4CYCA 2X9DA 3ZQIA 3JR9A 5J1UA 2XPWA 1WH5A 4QTRA 1Z0XA 4X1EA 3HKZN 4I6ZA 1LE8A 2M0CA 3HB9A 2K40A 1JJ6C 4V2FA 2DN0A 3IV5A 1RKWA 3ZOBA 1Y1WJ 3BG3A 1ITYA 2QCOA 2XGDA 4RDUA 3A01A 2O8KA 1IV6A 2W48A 2Y0SN 3F0CA 1WGXA 2EZHA 3TP3A 3JRDA 1LFBA 2LLKA 1MBKA 2LY9A 3NARA 2R7ZJ 1IJWC 3GTLJ 1MH3A 3OSFA 1QPIA 2E2IJ 5F0FA 1F36A 5EEAA 2Y30A 5GPAA 3Q0UA 3WHBA 3BQYA 2Y9ZA 1BJZA 4UUTA 5FJ8J 2EBIA 3HOWJ 2XSDC 4S0HB 4D7NA 3K2AA 2DA2A 1FIAA 4XK4A 1EF4A 2CQXA 2LTPA 4QIWN 3I4NJ 2L7ZA 5J1RA 2HOTA 2TRTA 2VI6A 3H3VK 2YS9A 2DJNA 3BR2A 4G12A 1GUUA 4LOCA 2XGEA 2NVXJ 2L7FP 3S1QJ 2DA3A 2JK3A 3BR6A 3FISA 5C4JJ 1K83J 4W97A 3ZQFA 5K7ZA 2QF7A 1JKPC 3B6AA 2JA7J 4X6AJ 3O8HA 5EGOA 3A03A 4Y7NJ 2LK2A 4A3CJ 2K9QA 3HEFA 3JRGA 4I76A 1ZR2A 2ID3A 4XIDA 2JMWA 2LD5A 4MIMA 3IH2A 3S1NJ 2O7OA 1IUFA 2DMNA 5IYBJ 2ME6A 3QQAA 1MBFA 3HOXJ 3CQZJ 2CQQA 1QRYA 1DU0A 1ETYA 5FKKA 1WH7A 4A93J 4BXXJ 4A3JJ 4BBRJ 1G2HA 2GLOA 4IHYA 5IYDJ 3OOUA 2JA6J 1K61A 4M6VA 2L0KA 1F43A 2M8GX 1POGA 1LFUP 2E1OA 2PMZN 2CUFA 2KDZA 3WHCA 3BTIA 3D1NI 2Y31A 2YUSA 3JRAA 4A3GJ 1SFOJ 4BKXA 1JUPA 2K9SA 5EG0A 1OFCX 2NOGA 2VKEA 5J3LA 5DTDA 1DU6A 1VF9A 3CDLA 2E2JJ 3BG9A 2HOSA 5IYCJ 2EQRA 3PM1A 1R9TJ 3LSGA 1JKQC 5C3EJ 3JRCA 2DA5A 2MW8A 4D7MA 4M3FA 3ZQGA 5K7FA 5E3LA 1HDPA 3CMYA 3HOUJ 1B72A 5M3FJ 3O8GA 5F0CA 2JA8J 4IEJA 1B72B 5IP7J 4FCYA 2FD5A 1ENHA 5J1YA 2R5ZA 1B8IA 5FKOA 3BTCA 5FLMJ 2EH3A 1H88C 2L9RA 4XICA 2DA1A 2NVTJ 4B3AA 1VNDA 1HLVA 4AUXA 2Y9YA 5E3MA 1JUMA 3G1OA 1NTCA 3VPRA 3BQZA 4DZJA 1X2NA 4FTHA 2HDDA 1S7EA 4B1RA 1GVDA 4AC0A 1ETVA 5F0HA 3LSPA 1ETQA 3PO2J 1JTXA 4MFDA 2DMTA 1CQTA 3BTJA 5E3NA 5FKNA 2NS7A 2JN6A 4A3KJ 5EYRA 4MFEA 5IOYA 1ZKGA 1YRNB 1HDDC 4IHVA 4J19A 3OIOA 3GTOJ 1HOMA 4C2MJ 1JUSA 1BA5A 4BBSJ 2FJ1A 3A01B 2ME0A 3FK6A 5M5YJ 1VFCA 4UUSB 2M9HA 2MGQA 1TWCJ 3HOZJ 5EZGA 3JRHA 3Q0VA 2CUEA 4M3BA 1RPWA 4DYQA 3BR0A 3IH4A 1MH4A 1JKRC 3W6VA 5EDNA 5JLXA 1ETKA 3S17J 3SFIA 3NAUA 1B8IB 2EZLA 1OCPA 2LKXA 1RKTA 5JLWA 3MN2A 2NVYJ 1OJLA 4DYCA 1ZTRA 1T56A 2N8GA 1ZR4A 5FKLA 3BG5A 3B6CA 3S1RJ 2R93J 2DMPA 3HM5A 2WB1N 2FX0A 3TEDA 1W0UA 3G1LA 1JGGA 1APLC 3ZQHA 1WCMJ 4A69C 4XRSG 1UMQA 1P7IA 1WI3A 4CYCB 3JREA 2FQ4A 2ZB9A 4FISA 5EG0B 1BW6A 2DA6A 1HF0A 2HXIA 1JTYA 3I4MJ 1Z77A 3LNQA 2R5ZB 4UUSA 1JT0A 5HODA 3C2BA 5F1JA 2P81A 1Y1VJ 2GBYA 3FIWA 4A3EJ 2KT0A 1TWAJ 5EF6A 2CU7A 1NK2P 2DMQA 5IP6A 2ID6A 2K9NA 1AKHA 1RESA 1TWFJ 3M3YJ 3M4OJ 3IH3A 1IDZA 1PUFA 4A3MJ 1E3OC 2XRLA 1UHSA 4V2GA 3TW7A 2HQ5A 2CRGA 2MSYA 4DW6A 2MG4A 1MBHA 4JP0A 3GTGJ 5EZHA 3S16J 3UKGA 2XB0X 3BR3A 4DZPA 1ETOA 1I6HJ 5C4XJ 1HCRA 4FE4A 1BL0A 2LR8A 3A02A 2HI3A 3TP0A 4M3EA 1AU7A 3PO3J 3RZOJ 3MVPA 3RZDJ 3FKIJ 2L7MP 4MO7A 3SJMA 2NS8A 2EZIA 5DS9A 2IBDA 2B63J 4JX4A 3HGYA 3ZQCA 4EEFG 2OF7A 2RAEA 2Y2ZA 5BNGA 2XPUA 2JA5J 5FLVA 1U9NA 3HOVJ 3QPSA 1A6IA 1TC3C 3MKLA 1FJLA 1P7JA 3BT9A 3HBLA 5M5WJ 4D5FA 2DA7A 5M5XJ 1WPKA 1ETWA 4A3IJ 3FK7A 1W0TA 1AHDP 5C44J 1X2MA 2E2HJ 4IHWA 5IOZA 1ZGWA 1VI0A 2OPTA 3K7AJ 4D5CA 1JKOC 3GTQJ 5IP9J 2XPVA 1Q1VA 3SDGA 2COBA 1X58A 4C3JJ 1NK3P 1FIPA 2YU9J 5IPAA 5FKMA 2H8RA 2M2EA 3RQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M J;  2R5Y B;  2ECC A;  2JWT A;  1A5J A;  3S2H J;  1LE8 B;  1GV5 A;  1XG1 A;  2LP0 A;  1U9O A;  2I10 A;  2IAI A;  2XGC A;  2E19 A;  2LFB A;  1H89 C;  5K7H A;  2GM4 A;  1JJ8 C;  2HYJ A;  1IGN A;  5F27 A;  4JX6 A;  2DTZ A;  1TWH J;  3S15 J;  1FEX A;  1FTZ A;  3BTL A;  3JRB A;  1YRN A;  2WAQ N;  3GTP J;  4A3B J;  1ORK A;  1T33 A;  3BR5 A;  2D5V A;  3GTK J;  1ZQ3 P;  1MNM C;  3GBG A;  4M3D A;  1JT6 A;  2DMU A;  1MBJ A;  4M3G A;  2ECB A;  3L1P A;  1UG2 A;  1I3Q J;  5GPC A;  3H0G J;  3RKQ A;  4MLO A;  4Y52 J;  2XB5 A;  3HOY J;  3DCF A;  1ZK8 A;  1ETX A;  1PUF B;  2HXO A;  3TW6 A;  4BY7 J;  1RR7 A;  1I50 J;  3LOC A;  4HNV A;  2CJJ A;  3JRF A;  3HDD A;  1IG7 A;  3OSG A;  1MSF C;  1GV2 A;  3S14 J;  1U8B A;  1U78 A;  2VKV A;  2ELK A;  2WV1 A;  2DA4 A;  2TCT A;  4NDL A;  4GFB A;  2R92 J;  2R0Q C;  1IRZ A;  1RET A;  2H1K A;  5EGO B;  4B4C A;  4AYB N;  3E7L A;  2X48 A;  2VUM J;  1XS9 A;  4A3D J;  4W1U A;  2R5Y A;  4JX5 A;  1D5Y A;  3GTM J;  4RBO A;  1GT0 C;  1IC8 A;  4IHX A;  4ABZ A;  1GDT A;  1AKH B;  9ANT A;  2LVS A;  4XRM A;  3LSR A;  2X6O A;  4QSH A;  4FE7 A;  2IEK A;  3LSJ A;  2O9L A;  3S1M J;  2AHQ A;  3JRI A;  3Q3S A;  2AO9 A;  1XC5 A;  2G0E A;  1QVU A;  3CCY A;  1OCT C;  3BR1 A;  1BW5 A;  3Q0W A;  5E3O A;  1FTT A;  1H8A C;  3GTJ J;  2NVQ J;  3HGG A;  2VPR A;  4BY1 J;  1MBE A;  4XRS A;  1MBG A;  3ZQL A;  3QPL A;  4A3F J;  2M34 A;  4C3I J;  1SAN A;  3G1M A;  2JJ7 A;  4L5E A;  4JYK A;  3S2D J;  2EZK A;  1QVT A;  2HOA A;  5F08 A;  1O4X A;  4A3L J;  1MSE C;  5GP9 A;  1IDY A;  3DEW A;  5F04 A;  4C3H J;  4DYR A;  1TWG J;  4CYC A;  2X9D A;  3ZQI A;  3JR9 A;  5J1U A;  2XPW A;  1WH5 A;  4QTR A;  1Z0X A;  4X1E A;  3HKZ N;  4I6Z A;  1LE8 A;  2M0C A;  3HB9 A;  2K40 A;  1JJ6 C;  4V2F A;  2DN0 A;  3IV5 A;  1RKW A;  3ZOB A;  1Y1W J;  3BG3 A;  1ITY A;  2QCO A;  2XGD A;  4RDU A;  3A01 A;  2O8K A;  1IV6 A;  2W48 A;  2Y0S N;  3F0C A;  1WGX A;  2EZH A;  3TP3 A;  3JRD A;  1LFB A;  2LLK A;  1MBK A;  2LY9 A;  3NAR A;  2R7Z J;  1IJW C;  3GTL J;  1MH3 A;  3OSF A;  1QPI A;  2E2I J;  5F0F A;  1F36 A;  5EEA A;  2Y30 A;  5GPA A;  3Q0U A;  3WHB A;  3BQY A;  2Y9Z A;  1BJZ A;  4UUT A;  5FJ8 J;  2EBI A;  3HOW J;  2XSD C;  4S0H B;  4D7N A;  3K2A A;  2DA2 A;  1FIA A;  4XK4 A;  1EF4 A;  2CQX A;  2LTP A;  4QIW N;  3I4N J;  2L7Z A;  5J1R A;  2HOT A;  2TRT A;  2VI6 A;  3H3V K;  2YS9 A;  2DJN A;  3BR2 A;  4G12 A;  1GUU A;  4LOC A;  2XGE A;  2NVX J;  2L7F P;  3S1Q J;  2DA3 A;  2JK3 A;  3BR6 A;  3FIS A;  5C4J J;  1K83 J;  4W97 A;  3ZQF A;  5K7Z A;  2QF7 A;  1JKP C;  3B6A A;  2JA7 J;  4X6A J;  3O8H A;  5EGO A;  3A03 A;  4Y7N J;  2LK2 A;  4A3C J;  2K9Q A;  3HEF A;  3JRG A;  4I76 A;  1ZR2 A;  2ID3 A;  4XID A;  2JMW A;  2LD5 A;  4MIM A;  3IH2 A;  3S1N J;  2O7O A;  1IUF A;  2DMN A;  5IYB J;  2ME6 A;  3QQA A;  1MBF A;  3HOX J;  3CQZ J;  2CQQ A;  1QRY A;  1DU0 A;  1ETY A;  5FKK A;  1WH7 A;  4A93 J;  4BXX J;  4A3J J;  4BBR J;  1G2H A;  2GLO A;  4IHY A;  5IYD J;  3OOU A;  2JA6 J;  1K61 A;  4M6V A;  2L0K A;  1F43 A;  2M8G X;  1POG A;  1LFU P;  2E1O A;  2PMZ N;  2CUF A;  2KDZ A;  3WHC A;  3BTI A;  3D1N I;  2Y31 A;  2YUS A;  3JRA A;  4A3G J;  1SFO J;  4BKX A;  1JUP A;  2K9S A;  5EG0 A;  1OFC X;  2NOG A;  2VKE A;  5J3L A;  5DTD A;  1DU6 A;  1VF9 A;  3CDL A;  2E2J J;  3BG9 A;  2HOS A;  5IYC J;  2EQR A;  3PM1 A;  1R9T J;  3LSG A;  1JKQ C;  5C3E J;  3JRC A;  2DA5 A;  2MW8 A;  4D7M A;  4M3F A;  3ZQG A;  5K7F A;  5E3L A;  1HDP A;  3CMY A;  3HOU J;  1B72 A;  5M3F J;  3O8G A;  5F0C A;  2JA8 J;  4IEJ A;  1B72 B;  5IP7 J;  4FCY A;  2FD5 A;  1ENH A;  5J1Y A;  2R5Z A;  1B8I A;  5FKO A;  3BTC A;  5FLM J;  2EH3 A;  1H88 C;  2L9R A;  4XIC A;  2DA1 A;  2NVT J;  4B3A A;  1VND A;  1HLV A;  4AUX A;  2Y9Y A;  5E3M A;  1JUM A;  3G1O A;  1NTC A;  3VPR A;  3BQZ A;  4DZJ A;  1X2N A;  4FTH A;  2HDD A;  1S7E A;  4B1R A;  1GVD A;  4AC0 A;  1ETV A;  5F0H A;  3LSP A;  1ETQ A;  3PO2 J;  1JTX A;  4MFD A;  2DMT A;  1CQT A;  3BTJ A;  5E3N A;  5FKN A;  2NS7 A;  2JN6 A;  4A3K J;  5EYR A;  4MFE A;  5IOY A;  1ZKG A;  1YRN B;  1HDD C;  4IHV A;  4J19 A;  3OIO A;  3GTO J;  1HOM A;  4C2M J;  1JUS A;  1BA5 A;  4BBS J;  2FJ1 A;  3A01 B;  2ME0 A;  3FK6 A;  5M5Y J;  1VFC A;  4UUS B;  2M9H A;  2MGQ A;  1TWC J;  3HOZ J;  5EZG A;  3JRH A;  3Q0V A;  2CUE A;  4M3B A;  1RPW A;  4DYQ A;  3BR0 A;  3IH4 A;  1MH4 A;  1JKR C;  3W6V A;  5EDN A;  5JLX A;  1ETK A;  3S17 J;  3SFI A;  3NAU A;  1B8I B;  2EZL A;  1OCP A;  2LKX A;  1RKT A;  5JLW A;  3MN2 A;  2NVY J;  1OJL A;  4DYC A;  1ZTR A;  1T56 A;  2N8G A;  1ZR4 A;  5FKL A;  3BG5 A;  3B6C A;  3S1R J;  2R93 J;  2DMP A;  3HM5 A;  2WB1 N;  2FX0 A;  3TED A;  1W0U A;  3G1L A;  1JGG A;  1APL C;  3ZQH A;  1WCM J;  4A69 C;  4XRS G;  1UMQ A;  1P7I A;  1WI3 A;  4CYC B;  3JRE A;  2FQ4 A;  2ZB9 A;  4FIS A;  5EG0 B;  1BW6 A;  2DA6 A;  1HF0 A;  2HXI A;  1JTY A;  3I4M J;  1Z77 A;  3LNQ A;  2R5Z B;  4UUS A;  1JT0 A;  5HOD A;  3C2B A;  5F1J A;  2P81 A;  1Y1V J;  2GBY A;  3FIW A;  4A3E J;  2KT0 A;  1TWA J;  5EF6 A;  2CU7 A;  1NK2 P;  2DMQ A;  5IP6 A;  2ID6 A;  2K9N A;  1AKH A;  1RES A;  1TWF J;  3M3Y J;  3M4O J;  3IH3 A;  1IDZ A;  1PUF A;  4A3M J;  1E3O C;  2XRL A;  1UHS A;  4V2G A;  3TW7 A;  2HQ5 A;  2CRG A;  2MSY A;  4DW6 A;  2MG4 A;  1MBH A;  4JP0 A;  3GTG J;  5EZH A;  3S16 J;  3UKG A;  2XB0 X;  3BR3 A;  4DZP A;  1ETO A;  1I6H J;  5C4X J;  1HCR A;  4FE4 A;  1BL0 A;  2LR8 A;  3A02 A;  2HI3 A;  3TP0 A;  4M3E A;  1AU7 A;  3PO3 J;  3RZO J;  3MVP A;  3RZD J;  3FKI J;  2L7M P;  4MO7 A;  3SJM A;  2NS8 A;  2EZI A;  5DS9 A;  2IBD A;  2B63 J;  4JX4 A;  3HGY A;  3ZQC A;  4EEF G;  2OF7 A;  2RAE A;  2Y2Z A;  5BNG A;  2XPU A;  2JA5 J;  5FLV A;  1U9N A;  3HOV J;  3QPS A;  1A6I A;  1TC3 C;  3MKL A;  1FJL A;  1P7J A;  3BT9 A;  3HBL A;  5M5W J;  4D5F A;  2DA7 A;  5M5X J;  1WPK A;  1ETW A;  4A3I J;  3FK7 A;  1W0T A;  1AHD P;  5C44 J;  1X2M A;  2E2H J;  4IHW A;  5IOZ A;  1ZGW A;  1VI0 A;  2OPT A;  3K7A J;  4D5C A;  1JKO C;  3GTQ J;  5IP9 J;  2XPV A;  1Q1V A;  3SDG A;  2COB A;  1X58 A;  4C3J J;  1NK3 P;  1FIP A;  2YU9 J;  5IPA A;  5FKM A;  2H8R A;  2M2E A;  3RQI A; 
#chains in the Genus database with same CATH topology
 4A0X A;  3VFZ A;  5M3M J;  2PJR A;  2JWT A;  3ULQ B;  3MQ0 A;  2LP0 A;  2Y0S A;  3EDP A;  3HHG A;  1U9O A;  1WQ2 A;  2E19 A;  4AVP A;  3FMR A;  2M7A A;  3G73 A;  5JI6 A;  1YHQ I;  2K27 A;  2HYJ A;  4X0G A;  1FYL A;  3QU6 A;  3GXO A;  2JUC A;  3A0B C;  4JX6 A;  3ZGK A;  3ECH A;  3WGI A;  5L3C A;  1N25 A;  2R7S A;  3F8N A;  1FEX A;  2F5C A;  3BTL A;  1FTZ A;  4A3B J;  4LGW A;  1U0J A;  1T33 A;  2D5V A;  3HYI A;  5FRO A;  2RGV A;  2VQC A;  1SFX A;  3HPH A;  1MNM C;  1B6A A;  1OMI A;  3GBG A;  3AG2 H;  3DFG A;  1WJ5 A;  1R1T A;  3BZ6 A;  1JT6 A;  2DMU A;  2ELJ A;  3BG6 A;  1ODD A;  2K86 A;  2ECB A;  2OQR A;  1BR4 A;  5GPC A;  2K3P A;  3W2A A;  2KDO A;  5GAE J;  3FHN A;  3Q9V A;  3RKQ A;  1IN6 A;  4MLO A;  3V8J A;  3DCF A;  4D1Q A;  1ZK8 A;  1T0F C;  1PUF B;  2QQ8 A;  2V1D A;  4LJZ F;  4CO8 A;  1MMN A;  3LOC A;  3GW2 A;  5HDN A;  2CJJ A;  3JRF A;  3HDD A;  2P6T A;  1U5T A;  3DPU A;  4M9S A;  3TBI A;  5D4R A;  1GV2 A;  2K9M A;  1VQ6 I;  2XRO A;  3U9G A;  2ZNZ A;  1KU3 A;  2VKV A;  1HXD A;  3L7W A;  4EM0 B;  2D1V A;  4CZC A;  2FA5 A;  4D9J A;  1LDK B;  4BHB A;  2QSF X;  4KT5 C;  2R92 J;  1D8K A;  3H0D A;  4B4C A;  4AVZ A;  3RPU A;  4AYB N;  1MNE A;  2AXT C;  5KAF C;  5J6X A;  3DF8 A;  4W1U A;  3H9G A;  3ZPL A;  4XON A;  1Z7L A;  1IC8 A;  2VAS A;  4I09 A;  1IF1 A;  1BI0 A;  1G8X A;  2VXZ A;  3LSR A;  2X6O A;  3RKW A;  2IW5 A;  3F72 A;  5DUK A;  3VDX A;  1YJN I;  2IEK A;  3LSJ A;  3G6E I;  2AHQ A;  4F55 A;  4NBQ A;  2M3A A;  3I59 A;  3RIR A;  1P2F A;  5CVU A;  5HLI A;  2W24 A;  5BQT A;  1FPQ A;  2M45 A;  4XN0 A;  3KET A;  3BR1 A;  3D5L A;  4FQG A;  1H8A C;  2WA0 A;  3HRM A;  4NB5 A;  3HGG A;  2VPR A;  2XAG A;  1ZRE A;  1G3W A;  2IGN A;  3OYL A;  1IRG A;  4XSX F;  4RAZ A;  1ZG1 A;  4PCQ A;  2HQR A;  1Q1H A;  3G1M A;  3TGN A;  3MKY B;  1K4T A;  1W5T A;  2JJ7 A;  1ERD A;  1YJ9 I;  3CP8 A;  3G71 I;  4IRG A;  2HOA A;  3I0T A;  2DDA A;  3K69 A;  5F08 A;  3WGH A;  3FMS A;  2OJE D;  1P4X A;  4C3H J;  4EM1 A;  3J81 Z;  2X9D A;  3ZQI A;  3JR9 A;  2XPW A;  1GXQ A;  4XLC A;  5B1A H;  2BVM A;  4P55 A;  4I6Z A;  2Z3Y A;  4HAM A;  1TTY A;  3HRU A;  3S3M A;  1D3Y A;  3KEO A;  1XPX A;  2JTV A;  2DN0 A;  3IV5 A;  3OY9 A;  2R3S A;  4RS8 A;  5KHD A;  4LB5 A;  3BG3 A;  3LA2 A;  2Z9O A;  3CCM I;  4C9Y A;  1YYV A;  2EZH A;  1USS A;  3TP3 A;  1IN7 A;  3JRD A;  4O6J A;  4LMY A;  3DU5 A;  3VSK A;  2LY9 A;  2A5Y B;  1KQ0 A;  1QPI A;  2CFO A;  3WTT C;  3MCZ A;  1F36 A;  3IC7 A;  2JRM A;  1X4O A;  3WE2 A;  4BU2 A;  5EEA A;  1FP1 D;  5GPA A;  3Q0U A;  2X85 A;  4BH9 A;  3CJN A;  3E0J B;  4KN7 X;  2FMY A;  3TO6 A;  1UST A;  2EBI A;  4ZC3 A;  4HYE A;  1WRJ A;  3QPH A;  3K2A A;  1YO5 C;  5IT9 K;  2IS4 A;  4ENM A;  2H6C A;  3CCE I;  4G7O F;  3QOP A;  2M8E A;  1IXS B;  4OWR B;  5KCM A;  1XX5 A;  2L7Z A;  3DXJ F;  1PP8 F;  4WK8 F;  2VKH A;  2O61 A;  2BYV E;  4LOC A;  2ZNY A;  3HJE A;  3L9F A;  3QYB A;  2DK5 A;  3OYF A;  3PJR A;  1JHH A;  3KEY A;  3SFZ A;  2NVX J;  2OU2 A;  5BS6 A;  2DA3 A;  2JK3 A;  4KFC A;  4U0V A;  2R7T A;  4U0W A;  2JVH A;  1S6L A;  2KPM A;  1ZRF A;  3ZQF A;  3VB2 A;  5K7Z A;  1RRJ A;  4RB0 A;  2FXA A;  5D5V B;  3C7J A;  1I6X A;  3KZY A;  1CF7 B;  5B5E C;  4CDG A;  3WGG A;  2K9Q A;  2FBH A;  1OCO H;  3C2G A;  2ZBK A;  3DLL F;  1ZR2 A;  4XID A;  2QKL B;  3GEZ A;  3MMY B;  2HVS A;  3S1N J;  2W57 A;  5J4V A;  3CQZ J;  3ML6 A;  1LJ9 A;  2O0Y A;  1DU0 A;  2GXB A;  3E6B A;  5LHG A;  3T5X A;  4A93 J;  4BXX J;  2RVC A;  3BCB A;  5DD8 A;  2GLO A;  3RSN A;  4RB3 C;  3CCV I;  1K6O A;  1Z67 A;  3E6D A;  3OOU A;  2V6E A;  3HHH A;  3PQK A;  1IRF A;  2L0K A;  1F43 A;  1YS7 A;  3OR1 C;  2BY0 A;  2E1O A;  4DJA A;  2CUF A;  4CSW A;  3WHC A;  2KDZ A;  1H0M A;  4IHS A;  5EEG A;  2ETH A;  2YUS A;  1V5G A;  4KJZ A;  4Y3O A;  5KK1 A;  3I9V 2;  3K10 A;  2IP2 A;  1H9T A;  5CVV A;  2OZU A;  2B0L A;  3MEX A;  2K9S A;  4BJT A;  1J5Y A;  2KIU A;  3VYU B;  2E60 A;  4MQV A;  1R71 A;  5JHF A;  3CDL A;  4HLX A;  5HNH A;  2ZXI A;  4IX7 A;  4PJM A;  1JKQ C;  3SQN A;  1JGS A;  4D7M A;  3VWB A;  1R4N B;  3FX3 A;  2OTL I;  3ZQG A;  3HIF A;  3CMY A;  3TQN A;  1CGP A;  1FOW A;  4IEJ A;  2QEX I;  4FCY A;  4E7S A;  2DTR A;  4XIC A;  1FOX A;  3K70 C;  2K9L A;  5BPI A;  1VND A;  3GME A;  3E3V A;  4YIF A;  4XKW A;  2AQE A;  3EUH A;  4DIQ A;  5E3M A;  1D5V A;  2FBK A;  3BQZ A;  3M1C A;  1X2N A;  3D5S C;  5D5U B;  4LK1 F;  4K2E A;  5FLX Z;  3OS1 A;  1BC8 C;  2A61 A;  3T0Y A;  3MKW B;  3KP5 A;  3ZMU A;  1MJA A;  4OMZ A;  2VOP A;  4A2U A;  3P7N A;  2CV2 A;  4MFD A;  4RA2 A;  3ZMZ A;  2KJB A;  2A5W A;  2XKO A;  3LMM A;  1YIT I;  1UAA A;  3R6S A;  1MMD A;  3KYL A;  2DPU A;  4ENN A;  3Q5F A;  4GXO A;  5FKN A;  5E3N A;  2JN6 A;  1OCZ H;  4LG0 B;  1LQ1 A;  3HXL A;  2FF4 A;  1HDD C;  3J80 K;  1MDM B;  4ETS A;  1HOM A;  1BBY A;  3WTW C;  2VKD A;  2O03 A;  3A01 B;  4HDU A;  4EJV A;  4ZYE A;  1HKS A;  4UUS B;  3CC4 I;  4UY8 I;  2EB7 A;  4ASN A;  1ACI A;  5EZG A;  5K5O A;  1S3J A;  4M3B A;  3H5N A;  2F4I A;  4IPA A;  3OS0 A;  2HOE A;  1PVE A;  4WXC A;  5D6E A;  2NRA C;  2GIZ A;  3H3Z A;  5EDN A;  3ZQ7 A;  5JLX A;  1HA8 A;  4P5O A;  1E3H A;  3NAU A;  1X4P A;  2EZL A;  3WTU C;  1OCP A;  2R7O A;  3VSL A;  1R1U A;  2JVG A;  2A6E F;  1ZTR A;  2L9S A;  4LFU A;  4N9H A;  3O6B B;  4RM3 A;  2XIG A;  2A05 A;  2XHK A;  1T56 A;  4EJW A;  2A07 F;  4B43 A;  2N8G A;  1FSH A;  2MAB A;  3HOS A;  5FKL A;  3EYI A;  4LD5 A;  2JT1 A;  4L18 B;  2M0M A;  1W0U A;  4MHG A;  3TMO A;  4A69 C;  1S9H A;  1Z6T A;  4ZYD A;  1S72 I;  4CYC B;  3JRE A;  1P7I A;  2W4S A;  2ZB9 A;  2HZD A;  4IQJ A;  3CO6 C;  1BW6 A;  2ICW G;  2ZSH B;  4LG0 A;  3V8L A;  1HF0 A;  4OIP F;  1DP7 P;  4NC8 A;  3I4M J;  3PSI A;  4A5N A;  2F4O B;  4Y33 A;  3BRO A;  5HOD A;  3M7G A;  5F1J A;  3DEE A;  2YR2 A;  2PQ8 A;  2L01 A;  2Z99 A;  3FIW A;  1ZG5 A;  3ECO A;  1H9G A;  2DMQ A;  4BQA A;  1XN7 A;  5IP6 A;  2ID6 A;  2W85 A;  1TWF J;  5D5X B;  3ZMD A;  3M3Y J;  1YJW I;  2L4A A;  3TO9 A;  3CUQ B;  3BPV A;  1VQ9 I;  4FT8 A;  2MSY A;  3UNG C;  1DPU A;  3VEP A;  2VN2 A;  3PNV A;  2MG4 A;  1BC7 C;  3IUO A;  4FHT A;  3SYT A;  2L7K A;  2IRF G;  1ETO A;  1HCR A;  1SFU A;  2LR8 A;  2HI3 A;  2OBP A;  3TP0 A;  2F5E A;  1RZ4 A;  2OTJ I;  2PBI A;  2Q2E B;  4L0Z B;  3PO3 J;  2KJC A;  3MVP A;  3RZO J;  3RZD J;  4E7Z A;  3SJM A;  4HST A;  4Z2Y A;  3K4K A;  1OYI A;  1ZAO A;  3HGY A;  3ZQC A;  4EEF G;  3FXU A;  1J7K A;  2Y2Z A;  2XF7 A;  1W7P D;  1TBX A;  1G3S A;  3QPS A;  1A6I A;  1YLF A;  3RKY A;  2EWN A;  2WY8 Q;  2WWY A;  2JUG A;  2FQ3 A;  3BT9 A;  3IWZ A;  2PG4 A;  4KIF A;  5M5W J;  1IRX A;  4HDV A;  1B4A A;  4D5F A;  3GFL A;  2DA7 A;  2MFZ A;  1G3T A;  1ZYR F;  2H09 A;  1BI3 A;  3CJT B;  1AHD P;  4BJ5 C;  4IHT A;  4IHW A;  3MWM A;  5IOZ A;  4MNU A;  2JA2 A;  3J7A O;  2KIQ A;  1G4D A;  4S05 A;  2QVO A;  4ENJ A;  2COB A;  1QHG A;  5HOO A;  4MGR A;  3PIO F;  1ZGJ A;  4C3J J;  1NK3 P;  1S5L C;  3OR2 C;  1LDJ A;  2HVR A;  2VQL A;  2VBZ A;  1V5E A;  4Y17 A;  2DOE A;  3U2R A;  2YU9 J;  3EYY A;  3V7C A;  3F3X A;  2E1M B;  5FKM A;  2I8D A;  2H8R A;  4KIB A;  4BE2 A;  1WVR A;  1M1E B;  3RPU D;  1VQL I;  4B44 A;  3S2H J;  4HQE A;  1LE8 B;  1XGO A;  1GV5 A;  2EIN H;  5BOX A;  2I10 A;  3IWF A;  4Y15 A;  2XGC A;  3CF2 A;  1Z91 A;  1MW7 A;  2BEO A;  3PQJ A;  4KIG A;  5JVG F;  2F2E A;  3DBH B;  2GM4 A;  1LKX A;  4NC6 A;  1G59 A;  4LIT A;  1SFK A;  2K7L A;  1W7P A;  2FBI A;  2ZCW A;  3LL7 A;  3S15 J;  5L3D A;  2KRF A;  1YRN A;  4AM3 A;  2WAQ N;  5LD2 C;  1XMX A;  1WJB A;  1I3A A;  1W5C C;  2LDU A;  4IXA A;  4NQW B;  2LH9 A;  1F4K A;  3HUG A;  2VOO A;  4ITV A;  2WV0 A;  3GO5 A;  1LFP A;  4ZYG A;  3GFJ A;  5F1R A;  4L0Y B;  1YIO A;  4M3D A;  4IOA F;  3CUQ A;  1X1P A;  4F92 B;  3HSF A;  1UCR A;  4M3G A;  3JAM Z;  2ELH A;  4D0P A;  1MJB A;  1UG2 A;  1I3Q J;  4BAY A;  2P7C B;  2PLY A;  3H0G J;  2MLK A;  3KP4 A;  3HSE A;  4N4O B;  1EJ9 A;  1YX5 A;  3HOY J;  4N0B A;  2HYF A;  4A6E A;  3OS2 A;  1RR7 A;  1WKM A;  2HQN A;  3M9A A;  4BJ6 C;  2IGK A;  1BN5 A;  1SD5 A;  5EJC A;  1FYM A;  2HDW A;  1MSF C;  4DBR A;  1MZB A;  2XVC A;  2PFB A;  2VE8 A;  1U8B A;  4MTE A;  5DDG A;  1U78 A;  3S14 J;  2ELK A;  2WV1 A;  3LAP A;  3S3O A;  2TCT A;  4GFB A;  3SZG A;  2R7R A;  5EGO B;  1XSD A;  2XDV A;  2H1K A;  1RR8 C;  3T1B A;  3F6V A;  2VT2 A;  5ILS A;  5FO5 A;  2VUM J;  4A3D J;  1D5Y A;  4F52 A;  1GT0 C;  4ABZ A;  1GDT A;  1AWC A;  1N75 A;  2CYY A;  2KRH A;  3BPX A;  5CJ9 A;  2COM A;  5FGM A;  4UHT A;  3GCM A;  2E36 A;  1BM9 A;  2FU4 A;  4XKB A;  2MC4 A;  3Q3S A;  2KMU A;  4I0B A;  4Z6Y A;  2EPF A;  1MND A;  1Z3X A;  1QVU A;  1Y56 A;  3CCY A;  4IRH A;  1OCT C;  2O6G E;  1TW2 A;  1XCV A;  2EFQ A;  3QAH A;  3GTJ J;  2L3D A;  4HW0 A;  1R7J A;  2RRE A;  5DCM A;  1MBE A;  2RNG A;  1MBG A;  3DTI A;  3P5J A;  1QGP A;  4QWQ A;  2X51 A;  4C3I J;  3LSH A;  2CGP A;  1U3E M;  1MMA A;  1X1B A;  3ZR8 X;  1OCR H;  2WAF A;  5ILV A;  3K4L A;  4A3L J;  1T8I A;  1O4X A;  2H27 A;  4MEY F;  4II2 A;  1YE9 A;  3DEW A;  2PJR B;  5F04 A;  4DYR A;  3RTR A;  1WZ2 A;  4CYC A;  3R61 A;  1SAU A;  2LKP A;  3MZY A;  4QTR A;  1FMV A;  4X1E A;  4YEJ A;  1LE8 A;  4U7B A;  2WB1 A;  4KYW A;  1MIJ A;  3ERM A;  3D0S A;  3N97 A;  4ZDL A;  1IN8 A;  2P6S A;  1XMK A;  4YFX F;  5E1Z B;  1XDS A;  2DU9 A;  2LOO A;  1UB9 A;  2QCO A;  2XGD A;  2O8K A;  4C30 A;  2W48 A;  4JBA A;  4AID A;  4BQO A;  1IUY A;  1LFB A;  3FM3 A;  1TNS A;  3K9T A;  3R4K A;  1QO0 D;  4HPQ A;  4E70 A;  1VQ7 I;  4HF2 A;  1IJW C;  3HUG B;  3GTL J;  2E2I J;  3VOE A;  3CLO A;  1TT5 B;  4JQF A;  4YIR X;  1XB4 A;  3E6M A;  5F0F A;  1L3L A;  4BUP A;  2Y30 A;  1X3U A;  3K4M A;  4F91 B;  2X1C A;  4UUT A;  5FJ8 J;  2WAD A;  5DCF A;  3QP5 A;  4OU0 A;  4UB6 C;  3V7R A;  2XSD C;  4I01 A;  3GZ6 A;  4UVC A;  2LTP A;  2ZJP F;  2WTE A;  1IN4 A;  2ZME B;  4PJL A;  5LHI A;  1ZRD A;  2LKS A;  5J8F A;  4F7Z A;  3HKZ A;  5J1R A;  3FBN B;  4BEH A;  3W2W A;  3H3V K;  1ULY A;  3FWE A;  3BR2 A;  1ON2 A;  5L3B A;  4G12 A;  2HFH A;  2RC4 A;  4E7I A;  2ISZ A;  3Q9S A;  2XGE A;  3F8M A;  3BZC A;  2VIX A;  4HG2 A;  2E34 A;  3BR6 A;  1BI2 A;  2L02 A;  3PUB A;  2J5P A;  4W97 A;  3HTS B;  3NRV A;  3JW4 A;  3BP8 A;  2CMP A;  2B9S A;  2P7V B;  2HYG D;  2DCE A;  5EGO A;  4NUB A;  4GO1 A;  4L9J A;  1O3S A;  2R7U A;  2LK2 A;  2VXD A;  3NQO A;  1LUJ B;  4A3C J;  3AFH A;  3J7Z I;  1B9N A;  3QU3 A;  3JRG A;  2EFN A;  4I76 A;  5DEQ A;  4BXU A;  2LD5 A;  2O7O A;  1IUF A;  2CWE A;  5IYB J;  3WTY C;  1FLI A;  3OMY A;  3QQA A;  1FP2 A;  4I0A A;  2CQQ A;  2K4J A;  1QRY A;  4L5J A;  3H1C A;  2VON A;  1ETY A;  2VBX A;  2K3F A;  2CQN A;  3TO7 A;  4WX9 A;  1ZG3 A;  5IYD J;  2Z2S B;  1TQI A;  3V4G A;  1QBJ A;  3MD2 A;  3RQ4 A;  3QRF F;  3C2H A;  1POG A;  2PMZ N;  4A6D A;  3BTI A;  1S7O A;  3BWG A;  1J59 A;  5ILU A;  1PJR A;  5ICC A;  4ZDP A;  1SFO J;  1JUP A;  1OPC A;  2RDP A;  4HNT A;  1UZC A;  4L5I A;  3DKX A;  5EG0 A;  1XMA A;  3FBI B;  3QYE A;  1SD6 A;  5J3L A;  2PEX A;  1YS6 A;  3VYR B;  3OYH A;  4J01 A;  1DU6 A;  2JPC A;  2DO7 A;  5IYC J;  3CLQ A;  1WJF A;  3PM1 A;  5FLX K;  3KYC B;  3U1D A;  1VQN I;  3IKV A;  5J47 A;  5C3E J;  3JRC A;  2DA5 A;  2V9K A;  4YEL A;  4AD9 A;  2MW8 A;  4EMS A;  2D45 A;  4IJA A;  4M3F A;  3AL0 C;  5K7F A;  3F6O A;  3OYN A;  3HOU J;  1R00 A;  2FNA A;  2DT6 A;  1WI9 A;  2KRC A;  3O8G A;  3S93 A;  3AL0 B;  1B72 B;  3I59 B;  3E6C C;  4IVN A;  2ZFU A;  2XSJ C;  4HV6 A;  3HZJ A;  2E71 A;  3DV8 A;  2EH3 A;  4P1W A;  2EIJ H;  2I5U A;  5JR3 A;  4ZTF A;  1HLV A;  2NNN A;  2FRH A;  4RMN A;  2LF7 A;  2Y69 H;  2NAZ A;  3LST A;  1RUN A;  4LIV A;  5J4Y A;  3T8R A;  5B66 C;  3A0H C;  2Y9Y A;  2WY7 Q;  2KP6 A;  2QZ8 A;  5H6Q A;  3G1O A;  4YII A;  2KQR A;  1SFE A;  3F21 A;  2KKO A;  2PMZ A;  2HDD A;  3QOE A;  4YFN F;  2VJ5 A;  4L9N A;  4B1R A;  1J0R A;  4AC0 A;  1ETV A;  2QYO A;  4XLH A;  2DOF A;  3WTV C;  3PNT A;  3LSK A;  2HGC A;  1ZLK A;  5TGT A;  4CCM A;  1HQC A;  1KZH A;  3KEQ A;  3L00 A;  2LNB A;  4Y4R A;  2XAQ A;  3ZMT A;  1D0X A;  4M6Y A;  1HST A;  3DKW A;  4CZZ A;  2HPI A;  3CDH A;  2UV1 A;  1TNT A;  5IOY A;  2CFX A;  3OL3 A;  3OIO A;  1JUS A;  1X1A A;  2OD5 A;  1B9M A;  4BBS J;  1KQ9 A;  2RNJ A;  1P92 A;  3FK6 A;  4BE0 A;  2VQH A;  2BV6 A;  2UWM A;  2M9H A;  2ZME C;  3HOZ J;  3Q0V A;  4DYQ A;  3FXQ A;  1X1D A;  1L0O C;  1VQM I;  3I53 A;  1JKR C;  3W6V A;  3ASN H;  4YG2 F;  4TV7 A;  1LVA A;  1ETK A;  1IXR C;  4HSR A;  1B8I B;  2IS6 A;  3E97 A;  3F9K A;  4QLC U;  5LBQ A;  1RKT A;  2CS3 A;  2ZSI B;  4P9U A;  1SD7 A;  1K79 A;  1T38 A;  4BQQ A;  4DYC A;  2MH2 A;  2YX4 A;  3L2W A;  2R7Q A;  3RYR A;  4BE1 A;  2HEO A;  4KIS A;  1HC8 A;  1LNW A;  3GYH X;  4XKC A;  3H5A A;  4AIK A;  1RIO H;  5HS9 A;  5AIQ A;  2DMP A;  4FX0 A;  1F1Z A;  3FDY A;  2F6C A;  2FX0 A;  3TED A;  3G1L A;  5CKT A;  1D1C A;  4XRS G;  2LG4 A;  3I56 I;  2FQ4 A;  4V19 K;  4FIS A;  1ZN2 A;  4ENK A;  2DA6 A;  2IGO A;  3LA7 A;  3U1K A;  3EQL F;  1Z77 A;  2J5O A;  3K4J A;  2AQF A;  4KDP A;  2AXL A;  3H9Q A;  4H4K C;  1BIB A;  4U7D A;  2GBY A;  4AIJ A;  4A3E J;  1C0W A;  2KT0 A;  1TWA J;  3HPG A;  5EF6 A;  3CF5 F;  3DEU A;  4PSW A;  1AKH A;  3QPT A;  4ZDO A;  3M4O J;  3HSR A;  3IH3 A;  1PUF A;  4A3M J;  2WC2 A;  3TW7 A;  4DW6 A;  2GA1 A;  2W00 A;  3R0A A;  2XRN A;  2OQG A;  2KFD A;  2V1X A;  4ANJ A;  3CD6 I;  3GTG J;  3I71 A;  5GAH J;  3UKG A;  3BR3 A;  2A3S A;  1QNT A;  2IA0 A;  1I6H J;  4Q47 A;  1E17 A;  1OKR A;  5CYV A;  5FD5 A;  5ICF A;  2F4M B;  4G7H F;  2E7X A;  4M71 A;  5L3F A;  1OCC H;  1YW9 A;  4M3E A;  2HKO A;  5CVJ A;  3G4S I;  2IS1 A;  4GDF A;  5JHU A;  2E1C A;  2H94 A;  4P9F A;  1AU7 A;  2CO5 A;  3FXM A;  2L7M P;  3WTS C;  1T0F A;  1PDN C;  4NHJ A;  2NYX A;  2VLA A;  2EZI A;  1J09 A;  5DS9 A;  3ABT A;  3OYK A;  5LRS A;  1KQ8 A;  3PFI A;  4S04 A;  2VQG A;  1R49 A;  1SVM A;  2IPQ X;  5HLH A;  5GTI C;  4HRI A;  2QGU A;  2UXX A;  4EV0 A;  3CMA I;  3KYD B;  5E17 F;  3H5R A;  4I2O A;  1HW5 A;  4GGG A;  3J7Y J;  4KMU X;  4EGY A;  3HTU A;  2NVU B;  1NG7 A;  3N05 A;  1HKT A;  1TW3 A;  4BAC A;  2NXN B;  2XF5 A;  1WPK A;  2G7U A;  4HOB A;  3FK7 A;  4IQ4 A;  4A3I J;  1W0T A;  1RC9 A;  3G2B A;  1Y0N A;  1YQA A;  1DGW Y;  1ZGW A;  2P5K A;  5IY5 H;  2DFE A;  4R79 A;  4ZTJ A;  1JKO C;  3C18 A;  1JE8 A;  3QOD A;  5IP9 J;  2QQB A;  3VYS B;  1Q1V A;  2LRE A;  3CO7 C;  1AOY A;  1FZP B;  2HTS A;  2MBF A;  3S3N A;  3EUH C;  4OIO F;  1MMS A;  2ZME A;  2WAQ A;  3TKY A;  2JRT A;  3X2Q H;  3ZN0 A;  3GVA A;  5A2Q K;  2UZK A;  4HNU A;  4GYG A;  2V79 A;  2EFW A;  1KU2 A;  4E7H A;  3V8K A;  3ABM H;  2Y48 A;  3GZ5 A;  3WOD F;  2LFB A;  2KIS A;  3L2V A;  5K7H A;  3KP7 A;  3HG9 A;  4GYI A;  3I55 I;  3ELK A;  3CME I;  3WTX C;  1RI7 A;  3ABL H;  2OA4 A;  3FM5 A;  3UR3 C;  2K02 A;  2R7V A;  3PSF A;  4E6K G;  3JRB A;  1ORK A;  4HX4 A;  1FOY A;  4BDY A;  2M87 A;  2A6H F;  1R36 A;  1XDU A;  1ZQ3 P;  3E5X A;  3GLX A;  1R5I D;  3A1Y A;  3R0J A;  5DYM A;  2EJR A;  1MBJ A;  4YFK F;  2QEN A;  3BY6 A;  3L1P A;  1BOA A;  4BXF A;  1OLT A;  4WXD A;  2TDX A;  1QZZ A;  4ON0 A;  3KZZ A;  3LSI A;  2XB5 A;  3A4C A;  1ETX A;  1NG6 A;  4PJ0 C;  3TW6 A;  2BHY A;  4BY7 J;  1I50 J;  1QZE A;  4RB2 C;  1IG7 A;  3F8F A;  3SEZ A;  3OSG A;  1WSU A;  3CC7 I;  4FAS D;  2DQL A;  1D1A A;  3CCL I;  2DA4 A;  1IRZ A;  1A31 A;  4UNO A;  3E7L A;  2X48 A;  2FOW A;  1I27 A;  3DLA A;  5H2F C;  4G9Y A;  1N77 A;  4JX5 A;  2XKP A;  4CCN A;  4RBO A;  2R7D A;  1RUO A;  5TJJ A;  1AKH B;  4FET A;  9ANT A;  3TOA A;  2BHZ A;  3LQQ A;  1ON1 A;  2LVS A;  4XRM A;  1T2K A;  3DKY A;  4WWC A;  1SMT A;  4NC7 A;  2CG4 A;  2JPB A;  3VYT B;  2O9L A;  4PGH A;  2XUB A;  3N4M A;  1ZGA A;  3JRI A;  1F5T A;  1FNN A;  1XC5 A;  2AO9 A;  4N4N B;  5F64 A;  1OIS A;  2PMH A;  1SD4 A;  3LWF A;  1SMY F;  4XKV A;  3Q0W A;  5KAI C;  2HPM A;  5E3O A;  1BW5 A;  1WJE A;  1TP4 A;  3FXL A;  1HBX G;  2NVQ J;  2R7X A;  3K1M A;  1E0E A;  1VQ5 I;  3CMM A;  1OYW A;  3QPL A;  4A3F J;  5DCM B;  1X1C A;  4L5E A;  1KON A;  1QVT A;  2Z1D A;  2ZC2 A;  3IAS 2;  4ZYH A;  2EV5 A;  2HR3 A;  5GP9 A;  1IDY A;  3K4N A;  3LSM A;  2HKX A;  3OWT A;  4EJO A;  4OMY A;  3ESW B;  5J1U A;  3V7S A;  1WH5 A;  2M4K A;  4KA4 A;  3FXR A;  4U88 A;  2K85 A;  2M0C A;  3RKX A;  3AAF A;  1JHF A;  2Q1Z B;  2K40 A;  1JJ6 C;  2VT3 A;  2ESN A;  2VBY A;  1ITY A;  2QWW A;  2DAO A;  4RDU A;  1GLN A;  2KHM A;  3F0C A;  2Y0S N;  1XGM A;  2W7N A;  2LY2 A;  2X6W A;  1HSJ A;  3H3U A;  4ZZL A;  2L5Q A;  1OR7 C;  3I5U A;  1KYZ A;  3ZMS A;  3W6J B;  4QPQ A;  1V5F A;  3OIQ A;  3WHB A;  3BQY A;  4I02 A;  1BJZ A;  3HOT A;  3DQV C;  1FBS A;  3HOW J;  2C6Y A;  4XOT A;  4S0H B;  2GXG A;  2M4G A;  1HW2 A;  4D7N A;  5BPD A;  2DA2 A;  1GHC A;  1O3Q A;  2CQX A;  1EF4 A;  4EM2 A;  3W2V A;  2M5W A;  3K6G A;  4QIW N;  3AKZ A;  3I4N J;  4A5M A;  3MFK A;  2XAJ A;  3OYE A;  3F8C A;  4N9I A;  3S8P A;  1N78 A;  1SAX A;  4XNF A;  2TRT A;  3L2C A;  2YS9 A;  2O5R A;  4OOI A;  1GUU A;  5FFX A;  5HNF A;  5LFA A;  3IAM 2;  1X3W B;  1EA3 A;  3KFW X;  2L7F P;  3S1Q J;  3F8B A;  3FIS A;  4RAG A;  3DTK A;  3BJA A;  4RGR A;  1U8R A;  1JKP C;  4X6A J;  2Z16 A;  3I54 A;  4CH7 A;  3K4C A;  1OQY A;  3A03 A;  3OYD A;  3SXY A;  4Y7N J;  1YW8 A;  2NOJ B;  3HEF A;  2DOD A;  2OAZ A;  2ID3 A;  2HZT A;  2JMW A;  3F23 A;  1DDN A;  4MIM A;  6PAX A;  1JXS A;  3OYA A;  3CCQ I;  2KZV A;  4HF0 A;  4DBQ A;  1O3T A;  3I64 A;  1MBF A;  5E1X A;  1Z7U A;  3HC7 A;  5KNL A;  3RPQ A;  1K6Y A;  2FEZ A;  5FKK A;  1DPR A;  1WH7 A;  4PJJ A;  4BBR J;  4A3J J;  1G2H A;  1IV8 A;  2X6X A;  4IHY A;  1UFM A;  2VC1 A;  2E5N A;  3CUO A;  4C2T A;  3AG4 H;  4M6V A;  3AG3 H;  2KLO A;  2M8G X;  3OYJ A;  1LFU P;  3K1N A;  1UHM A;  3D1N I;  4R8H A;  4Q5S F;  5K5Q A;  5CPR B;  3JRA A;  1XTA A;  2DT7 B;  4GRI A;  3J7A Y;  1D0Z A;  1WJA A;  4A3G J;  5FB2 A;  4M9X A;  5H20 A;  3K70 D;  3GX4 X;  5LGT A;  1R5G A;  1QPM A;  2VKE A;  2A68 F;  2NOG A;  2ZFW A;  4HV5 A;  4MQ9 F;  2R4G A;  1UHW A;  1Z1D A;  1RNL A;  4F3Q A;  2H8W A;  1BOB A;  1V4R A;  2EQR A;  2MLG A;  2W84 A;  4O3M A;  3K0L A;  3GF2 A;  1MD0 A;  3AG1 H;  4UB8 C;  1W4M A;  3MKZ A;  2CUZ A;  3CTA A;  2X1D A;  1U2W A;  1T98 A;  4KT6 A;  5JFR A;  1B72 A;  3DU6 A;  2HTJ A;  5M3F J;  3PNY A;  3ISP A;  4U0Y A;  1R58 A;  1LVK A;  2IA2 A;  2CW0 F;  1I1S A;  5FKO A;  3BTC A;  3TOB A;  5FLM J;  1H88 C;  2L9R A;  4I7H A;  2DA1 A;  4PFP A;  3ZP5 A;  3RCO A;  4BL0 B;  4RM2 A;  2NS0 A;  5J40 A;  1F9N A;  2ZXW H;  4M73 A;  4A0Y A;  3OL4 A;  2XGX A;  4UXN A;  4BHP A;  3REO A;  3VPR A;  2DLL A;  1S7E A;  4EJT A;  5LRR A;  1GVD A;  5TRD A;  1QHH D;  2MA3 A;  5F0H A;  3LSP A;  1I5Z A;  4DOZ A;  4RAF A;  2EA4 A;  3O3K A;  2E1M C;  5D6F A;  1Y0U A;  2DMT A;  2QSH X;  1CQT A;  1A6Q A;  2BZT A;  1TZL A;  1U5T C;  2BE5 F;  1VZ0 A;  1BR2 A;  1ZKG A;  3OV8 A;  1YRN B;  4IHV A;  3E1S A;  3GTO J;  1R4M B;  5CVR A;  4C2M J;  4EQQ A;  1IO2 A;  4RGX A;  4CYD A;  1BA5 A;  3RJP A;  2FJ1 A;  1J9I A;  2CH0 A;  1O7F A;  1XSV A;  4PUS A;  4NNJ A;  5M5Y J;  2GZW A;  3M8F A;  1TWC J;  1S7A A;  2CUE A;  2YU3 A;  3NWT A;  4G6T B;  3CP2 A;  2IA1 A;  3CCS I;  1MH4 A;  2ZXH A;  2GA2 A;  4O5V A;  2ADU A;  3L09 A;  5D8K B;  4R1H A;  2MD0 A;  4XQF A;  3T8T A;  5ICG A;  2LKX A;  1KA8 A;  4CXF A;  2P8T A;  1T39 A;  2EIM H;  3MN2 A;  3P9K A;  5LGU A;  3TDZ C;  1OJL A;  4M72 A;  2ZKZ A;  2KIF A;  3LA3 A;  4Y13 A;  3ZQQ A;  5LLQ A;  2OC6 A;  3ZMV A;  1EH7 A;  4AYB A;  4J00 A;  3BG5 A;  3S1R J;  3HM5 A;  4JOM A;  2WB1 N;  5CLS A;  3FZV A;  5E8I A;  2XV4 S;  1WCM J;  1TT0 A;  2JZY A;  3IP4 B;  3KLN A;  5CQE A;  2BOL A;  1O7L A;  1WI3 A;  4PDK A;  3PFY A;  5DM7 F;  2E7W A;  3JTG A;  2HXI A;  2F5V A;  1STZ A;  3QWL A;  1ZRC A;  1FMW A;  1MDM A;  3BG7 A;  3FKJ A;  2W82 A;  5J8C A;  1JT0 A;  1TQM A;  2BBY A;  4LLL A;  2P81 A;  1J2X A;  3C1D A;  1BR1 A;  1NK2 P;  2CU7 A;  3BC8 A;  3E5Q A;  3M07 A;  5D5W B;  3H92 A;  4B47 A;  1RES A;  2HDC A;  2VC0 A;  1J75 A;  4XLE A;  1VQK I;  4M9Z A;  2V4J C;  2G9W A;  1T08 B;  4B8X A;  2OCC H;  2XRL A;  4V2G A;  2CV0 A;  2HQ5 A;  2CRG A;  4HX8 A;  2L2O A;  3CJQ B;  3IRR A;  1GVJ A;  1O3R A;  2IT0 A;  2P4W A;  1MBH A;  3J80 Z;  5EZH A;  3S16 J;  4P96 A;  1DQU A;  1QU3 A;  4DZP A;  3OOP A;  2RV8 A;  4FE4 A;  4PGG A;  1G3Y A;  4BQN A;  2LSO A;  3P9I A;  2DYR H;  4XOP A;  4DNC A;  5E1W A;  4LG3 A;  3FKI J;  3DPT A;  1R5H A;  1IN5 A;  2OUM A;  2NS8 A;  4LLN A;  4CHU A;  2ZJ2 A;  2B63 J;  4KIC A;  2IS2 A;  1P4A A;  4M74 A;  3M8J A;  2Y75 A;  5BNG A;  2JA5 J;  4ZH4 F;  1U9N A;  2XAS A;  2RQQ A;  3I4P A;  1XD7 A;  4B48 A;  1TC3 C;  4AIH A;  2L4M A;  3HBL A;  4EAT A;  1ZH5 A;  2PMU A;  5E8G A;  4CCO A;  1ONV A;  4HQM A;  4RAY A;  1DP3 A;  3G3Z A;  4Q4Z F;  2VE9 A;  1K78 A;  2V26 A;  5ERI A;  4CCL A;  5C44 J;  1X2M A;  2KZG A;  4IZZ A;  1Y6I A;  2L54 A;  4L9T A;  1YI2 I;  2E2H J;  1VI0 A;  5E18 F;  3GFI A;  4D5C A;  3GTQ J;  3ZRG A;  5KVR A;  2XPV A;  3EUA A;  2KL4 A;  1B1B A;  5K5R A;  1R23 A;  4UUV A;  1FOK A;  2QA4 I;  4BGD A;  2VL8 A;  4OAY A;  4OIR F;  1FIP A;  4XLA A;  4HBL A;  5IPA A;  2DI3 A;  3I3L A;  1SEU A;  2R5Y B;  2ECC A;  1A5J A;  1YW7 A;  3D5R C;  1XG1 A;  5DV5 A;  2IAI A;  1H89 C;  2Z5U A;  3GFM A;  3LAJ A;  2GOM A;  3BCA A;  4XL9 A;  2Z33 A;  1JJ8 C;  3TL4 X;  2LBF A;  3C3W A;  1IGN A;  5F27 A;  1SVO A;  2DTZ A;  4PFO A;  3SHF A;  1TLH B;  1TWH J;  5GAG J;  2DFF A;  3WU0 A;  3ZN1 A;  3GTP J;  2FSW A;  4L9V A;  1PP7 U;  1JI8 A;  4ESF A;  4IO9 F;  3BR5 A;  3L2Q A;  3GTK J;  3RYP A;  4UVB A;  3H36 A;  2W25 A;  2OZ6 A;  3V42 A;  1EH8 A;  4WXH A;  1R1V A;  2ZJR F;  1U5T B;  3OYG A;  3IHU A;  2IXS A;  3LFK A;  3KP3 A;  2R7W A;  4Y52 J;  2UXN A;  4GCV A;  4XLF A;  2BGC A;  2HXO A;  2W1O A;  3PUF A;  1VQO I;  4CCK A;  4CGZ A;  1S8N A;  2CSO A;  2VBW A;  1I1G A;  2D1H A;  1FBU A;  1KYW A;  4HNV A;  1S29 A;  2OCE A;  2H6B A;  5TIS C;  5HLT A;  1W1W E;  4BS9 A;  2HS5 A;  4NDL A;  2R0Q C;  1HKQ A;  1RET A;  3CES A;  3M8E A;  1SC7 A;  4H0E A;  3P9C A;  2EIL H;  1Y8Q B;  4F93 B;  1XS9 A;  1UJ8 A;  2R5Y A;  3GTM J;  4IF4 A;  4RLF A;  1K4S A;  2D2W A;  4IHX A;  3LFU A;  3JTH A;  5LHH A;  2DFI A;  3U21 A;  4QSH A;  1O57 A;  3EPZ A;  3K1P A;  2V1U A;  2X6Y A;  3KPH A;  4FE7 A;  3S1M J;  1XSX A;  3FXJ A;  1EKE A;  2V1N A;  1W5S A;  3OYC A;  2AS5 F;  2FE3 A;  3JSP A;  2G0E A;  3QYF A;  2V7F A;  1X3Z B;  4DQ2 A;  4ZZD A;  4FX4 A;  2F48 A;  3DBR B;  1ZLJ A;  2KIM A;  1V54 H;  1FTT A;  2GIV A;  3HRT A;  4BHC A;  2G7H A;  2EV6 A;  4BY1 J;  2DW4 A;  3OYI A;  4XRS A;  3CZ6 A;  4XLP F;  5BMZ A;  3ZQL A;  5AON A;  5EEH A;  1REP C;  2M34 A;  1SAN A;  2R7F A;  1LB2 A;  5HS8 A;  4IL6 C;  1P6R A;  2Q2E A;  4JYK A;  3S2D J;  2EZK A;  1IZ1 A;  3OYB A;  3QP6 A;  4XM3 A;  1MSE C;  4RLQ A;  4RGU A;  4HF1 A;  1TWG J;  1IW7 F;  2LY1 A;  1Z05 A;  2QKM B;  2M7B A;  3FXK A;  4OIN F;  1Z0X A;  1YTY A;  2ZJQ F;  4G6D A;  4E7K A;  3BZK A;  3HKZ N;  3CCJ I;  3KP6 A;  5A2Q Z;  3HB9 A;  5FRM A;  4KMF A;  1R22 A;  4V2F A;  4XR6 A;  3KZI C;  2K4B A;  4UV9 A;  1VQP I;  1A04 A;  1TQP A;  5AIP A;  1RKW A;  5DD4 A;  2F5F A;  1EH6 A;  3ZOB A;  1Y1W J;  4ZJZ A;  3ABK H;  5D8L B;  3A01 A;  2JSC A;  1IV6 A;  3BOQ A;  1W7P B;  3DWL E;  4E4H A;  3IRQ A;  4Q48 A;  1FY7 A;  2E1N A;  2X4H A;  1DGR M;  1WGX A;  2EA2 A;  1GXP A;  1LEB A;  1I39 A;  1Y39 A;  2LLK A;  1VQ8 I;  1MBK A;  3NAR A;  2VJ4 A;  3KLO A;  4YRV A;  2R7Z J;  1BIA A;  1MH3 A;  3OSF A;  4XRF A;  4HA8 A;  1K78 B;  2EIK H;  4KN4 X;  2HNH A;  2HVQ A;  4PK4 A;  1UG0 A;  2WBM A;  2Y9Z A;  3KIO A;  3H35 A;  1YFH A;  1D8J A;  1YOV B;  2OV7 A;  3LQR A;  5F6F A;  3GUD A;  1Z21 A;  1FIA A;  4XK4 A;  5D4S A;  1QQI A;  3IKT A;  2IVM A;  2HOT A;  3CDI A;  2FOK A;  4XLN F;  2VI6 A;  5HDK A;  4KNY A;  2DJN A;  4PSX A;  2ISY A;  2MYS A;  2H1L A;  2PI0 A;  2P5L C;  2LBF B;  3JAM K;  2BY2 A;  2X1E A;  5B1B H;  3CCR I;  2BY3 A;  5C4J J;  1VTN C;  1K83 J;  1T6S A;  3PIP F;  1XCB A;  4XSZ F;  2CUJ A;  2QF7 A;  2JA7 J;  3B6A A;  2YSR A;  5E20 A;  5GAD J;  3TDU C;  5L3E A;  2GXA A;  4I99 C;  3O8H A;  1WJC A;  2LYC A;  4XN3 A;  1ZHF A;  2P0W A;  1FC3 A;  3H9J A;  1AA7 A;  2MH9 A;  2IJL A;  1MJ9 A;  4A12 A;  3IH2 A;  2DDB A;  2DMN A;  2ME6 A;  2XAH A;  3HOX J;  3EET A;  3FXO A;  4PJN A;  2Q8K A;  2LC2 A;  4ESJ A;  5CQG A;  3KX2 A;  3M1E A;  2QM3 A;  2EK5 A;  5H6R A;  4CCJ A;  1D1B A;  2RN7 A;  4B09 A;  2JA6 J;  4UV8 A;  1K61 A;  4WCG A;  2DT5 A;  2BW3 A;  1Z9C A;  1HW1 A;  3BJ6 A;  2Y31 A;  2DYS H;  2JSP A;  5ICE A;  1WHU A;  2Q0O A;  4EGZ A;  2YX7 A;  3R60 A;  1KGS A;  2STT A;  2VOD A;  4BKX A;  5FD6 A;  3HL2 A;  2CQK A;  3DPL C;  4LK0 F;  3NWS A;  1OFC X;  1BI1 A;  5DTD A;  1VF9 A;  1T95 A;  2E2J J;  3BG9 A;  2CQ7 A;  4BEH B;  2HOS A;  4HZF A;  2XC7 A;  1R9T J;  3COA C;  3LSG A;  1QA6 A;  2DBB A;  2QBY A;  1PYV A;  3B02 A;  3DTE A;  3WE3 A;  4A0Z A;  2PN6 A;  3CCU I;  5E3L A;  1HDP A;  4ESB A;  4U87 A;  2PJP A;  1FT9 A;  4KUM A;  1CF7 A;  4UVA A;  5F0C A;  2JA8 J;  1Y8R B;  5IP7 J;  2HU9 A;  2FD5 A;  2ZXJ A;  4HX7 A;  1ENH A;  2DK8 A;  2BY1 A;  3BJO A;  3KCC A;  5J1Y A;  2R5Z A;  4IOC F;  1B8I A;  2IGM A;  1MMG A;  2LF8 A;  3MZ8 A;  5E79 C;  5HLG A;  2NVT J;  2LMD A;  4G8X A;  3GLL A;  3SEQ A;  4B3A A;  1W36 C;  4AUX A;  2BVL A;  2BXZ A;  1G6N A;  4HEA 2;  5CVI A;  2E35 A;  3IL2 A;  3OYM A;  1WFX A;  4LIU A;  2HWV A;  3F22 A;  5L3G A;  2GAU A;  4BDZ A;  2VPL A;  1JUM A;  4PZJ A;  1NTC A;  4DZJ A;  3SZT A;  3EUK L;  4FTH A;  2VB6 A;  2LRD A;  1R6R A;  2CW7 A;  2DQR A;  2ZO4 A;  2GWR A;  2K5C A;  1ETQ A;  2QQ9 A;  3PO2 J;  1V3F A;  1JTX A;  2MD5 A;  2FUG 2;  4RGS A;  1NH3 A;  3S32 A;  3ERE D;  4EJU A;  3SDB A;  2XF6 A;  3MAJ A;  1IAW A;  3BTJ A;  2NS7 A;  4A3K J;  5EYR A;  1LDD A;  2V6C A;  3DBL B;  4MFE A;  2CW8 A;  1X19 A;  4OIQ F;  2GOX B;  2JQ7 A;  1YG2 A;  4J19 A;  5LEJ A;  1YX3 A;  4IKF A;  2ME0 A;  5HDG A;  1MGT A;  1VFC A;  4BNC A;  3BLY A;  4CUG A;  2MGQ A;  5LGN A;  3CUQ C;  4XOR A;  5B3S H;  3JRH A;  2DXI A;  2STW A;  1RPW A;  2MC3 A;  1KU7 A;  3BR0 A;  3E5U A;  3IH4 A;  5GTH C;  3HRS A;  4G7Z F;  1E2X A;  2L9N A;  1U6G A;  3GZN B;  4LLG F;  4CIC A;  3O2P E;  4II3 A;  2DPD A;  3S17 J;  3SFI A;  3WG9 A;  1QZY A;  1FSE A;  3FMQ A;  1FWZ A;  1ZAR A;  4IRI A;  3CJR B;  3ROU A;  5JLW A;  2NVY J;  4E7J A;  2B7E A;  2PX9 A;  2QUF A;  2XAU A;  2XAF A;  3RI4 A;  1E3P A;  5FFZ A;  3W3C A;  3NEU A;  1ZR4 A;  4AU7 A;  3B6C A;  2R93 J;  3S2W A;  2FNP A;  1VQ4 I;  1JGG A;  1APL C;  3ZQH A;  1P4W A;  3WG7 H;  1UMQ A;  3WU1 B;  2YPR A;  1UEL B;  5EG0 B;  5DM6 F;  2ACJ A;  1JTY A;  4ZYA A;  1OR7 A;  1FBQ A;  1WJD A;  3W6K B;  3LNQ A;  2R5Z B;  1A35 A;  2E5Z A;  2QLZ A;  4RB1 A;  4UUS A;  3C2B A;  5ED4 A;  4QPO A;  1Y1V J;  1PUE E;  3DP7 A;  1WWX A;  3I58 A;  3ABU A;  2EV0 A;  4OAZ A;  5K1Y A;  2NNY A;  2K9N A;  5HS7 A;  3SZP A;  2QBY B;  1IDZ A;  2DOA A;  3KE2 A;  2EFP A;  2CV1 A;  1E3O C;  1LEA A;  1UHS A;  2VJI A;  1B59 A;  4G6Q A;  1MKM A;  1EV7 A;  3CC2 I;  1BJA A;  4WF2 A;  2QQA A;  2DFH A;  4JP0 A;  2HQA A;  2XB0 X;  5C4X J;  2QSG X;  3FF5 A;  1BL0 A;  4BYY A;  2A6T A;  3A02 A;  2BW3 B;  4EVI A;  4AWX B;  2M30 A;  3L2R A;  3VOD A;  1IXC A;  1D0Y A;  4MEX F;  2RQP A;  3B73 A;  2O3F A;  2A69 F;  3PL8 A;  5IT3 A;  4G94 A;  3OIP A;  4I98 B;  3J81 K;  2ESH A;  3ASO H;  4MO7 A;  1YIJ I;  3FHZ A;  2IBD A;  4MTD A;  5DUI A;  2P5V A;  2V9P A;  4JX4 A;  1Z6R A;  3ONQ A;  1DUX C;  5LEK A;  4DGW B;  1LPQ A;  2OF7 A;  3KP2 A;  2RAE A;  2L9V A;  2XPU A;  4M6X A;  5FLV A;  2RKH A;  1Z3Y A;  5HVQ C;  3HOV J;  1TL8 A;  1FYK A;  4JK1 X;  1V55 H;  1NHA A;  3K2Z A;  2UUZ A;  3MKL A;  4CA0 A;  3RDI A;  3JCU C;  1FJL A;  1P7J A;  2FML A;  2V9V A;  2X0L A;  3WTZ A;  2VJJ A;  2O8X A;  1FX7 A;  3ZXS A;  3L2U A;  5M5X J;  1ZEL A;  3GWZ A;  4C2U A;  2F5D A;  1ETW A;  2GQQ A;  1XGN A;  2WAE A;  3BDD A;  3MZH A;  4NQW A;  5FRN A;  4LB6 B;  2OPT A;  3K7A J;  1XGS A;  4B3X A;  1W36 D;  2EFO A;  2BXY A;  3ZCO A;  1K7A A;  3SDG A;  2DJI A;  4E7L A;  3A2K A;  4XBF A;  1X58 A;  3JSO A;  5IT9 Z;  2M1B A;  4XMY A;  4HLY A;  3WU2 C;  4KIT B;  1KU9 A;  5JVT A;  1A36 A;  1P9Q C;  1OYY A;  3K4B A;  2Y0M A;  1SVL A;  2M2E A;  3RQI A; 
#chains in the Genus database with same CATH homology
 5M3M J;  2R5Y B;  2ECC A;  2JWT A;  1A5J A;  3S2H J;  1LE8 B;  1GV5 A;  1XG1 A;  2LP0 A;  1U9O A;  2I10 A;  2IAI A;  2XGC A;  2E19 A;  2LFB A;  1H89 C;  5K7H A;  2GM4 A;  1JJ8 C;  2HYJ A;  1IGN A;  5F27 A;  4JX6 A;  2DTZ A;  1TWH J;  3S15 J;  1FEX A;  1FTZ A;  3BTL A;  3JRB A;  1YRN A;  2WAQ N;  3GTP J;  4A3B J;  1ORK A;  1T33 A;  3BR5 A;  2D5V A;  3GTK J;  1ZQ3 P;  1MNM C;  3GBG A;  4M3D A;  1JT6 A;  2DMU A;  1MBJ A;  4M3G A;  2ECB A;  3L1P A;  1UG2 A;  1I3Q J;  5GPC A;  3H0G J;  3RKQ A;  4MLO A;  4Y52 J;  2XB5 A;  3HOY J;  3DCF A;  1ZK8 A;  1ETX A;  1PUF B;  2HXO A;  3TW6 A;  4BY7 J;  1RR7 A;  1I50 J;  3LOC A;  4HNV A;  2CJJ A;  3JRF A;  3HDD A;  1IG7 A;  3OSG A;  1MSF C;  1GV2 A;  3S14 J;  1U8B A;  1U78 A;  2VKV A;  2ELK A;  2WV1 A;  2DA4 A;  2TCT A;  4NDL A;  4GFB A;  2R92 J;  2R0Q C;  1IRZ A;  1RET A;  2H1K A;  5EGO B;  4B4C A;  4AYB N;  3E7L A;  2X48 A;  2VUM J;  1XS9 A;  4A3D J;  4W1U A;  2R5Y A;  4JX5 A;  1D5Y A;  3GTM J;  4RBO A;  1GT0 C;  1IC8 A;  4IHX A;  4ABZ A;  1GDT A;  1AKH B;  9ANT A;  2LVS A;  4XRM A;  3LSR A;  2X6O A;  4QSH A;  4FE7 A;  2IEK A;  3LSJ A;  2O9L A;  3S1M J;  2AHQ A;  3JRI A;  3Q3S A;  2AO9 A;  1XC5 A;  2G0E A;  1QVU A;  3CCY A;  1OCT C;  3BR1 A;  1BW5 A;  3Q0W A;  5E3O A;  1FTT A;  1H8A C;  3GTJ J;  2NVQ J;  3HGG A;  2VPR A;  4BY1 J;  1MBE A;  4XRS A;  1MBG A;  3ZQL A;  3QPL A;  4A3F J;  2M34 A;  4C3I J;  1SAN A;  3G1M A;  2JJ7 A;  4L5E A;  4JYK A;  3S2D J;  2EZK A;  1QVT A;  2HOA A;  5F08 A;  1O4X A;  4A3L J;  1MSE C;  5GP9 A;  1IDY A;  3DEW A;  5F04 A;  4C3H J;  4DYR A;  1TWG J;  4CYC A;  2X9D A;  3ZQI A;  3JR9 A;  5J1U A;  2XPW A;  1WH5 A;  4QTR A;  1Z0X A;  4X1E A;  3HKZ N;  4I6Z A;  1LE8 A;  2M0C A;  3HB9 A;  2K40 A;  1JJ6 C;  4V2F A;  2DN0 A;  3IV5 A;  1RKW A;  3ZOB A;  1Y1W J;  3BG3 A;  1ITY A;  2QCO A;  2XGD A;  4RDU A;  3A01 A;  2O8K A;  1IV6 A;  2W48 A;  2Y0S N;  3F0C A;  1WGX A;  2EZH A;  3TP3 A;  3JRD A;  1LFB A;  2LLK A;  1MBK A;  2LY9 A;  3NAR A;  2R7Z J;  1IJW C;  3GTL J;  1MH3 A;  3OSF A;  1QPI A;  2E2I J;  5F0F A;  1F36 A;  5EEA A;  2Y30 A;  5GPA A;  3Q0U A;  3WHB A;  3BQY A;  2Y9Z A;  1BJZ A;  4UUT A;  5FJ8 J;  2EBI A;  3HOW J;  2XSD C;  4S0H B;  4D7N A;  3K2A A;  2DA2 A;  1FIA A;  4XK4 A;  1EF4 A;  2CQX A;  2LTP A;  4QIW N;  3I4N J;  2L7Z A;  5J1R A;  2HOT A;  2TRT A;  2VI6 A;  3H3V K;  2YS9 A;  2DJN A;  3BR2 A;  4G12 A;  1GUU A;  4LOC A;  2XGE A;  2NVX J;  2L7F P;  3S1Q J;  2DA3 A;  2JK3 A;  3BR6 A;  3FIS A;  5C4J J;  1K83 J;  4W97 A;  3ZQF A;  5K7Z A;  2QF7 A;  1JKP C;  3B6A A;  2JA7 J;  4X6A J;  3O8H A;  5EGO A;  3A03 A;  4Y7N J;  2LK2 A;  4A3C J;  2K9Q A;  3HEF A;  3JRG A;  4I76 A;  1ZR2 A;  2ID3 A;  4XID A;  2JMW A;  2LD5 A;  4MIM A;  3IH2 A;  3S1N J;  2O7O A;  1IUF A;  2DMN A;  5IYB J;  2ME6 A;  3QQA A;  1MBF A;  3HOX J;  3CQZ J;  2CQQ A;  1QRY A;  1DU0 A;  1ETY A;  5FKK A;  1WH7 A;  4A93 J;  4BXX J;  4A3J J;  4BBR J;  1G2H A;  2GLO A;  4IHY A;  5IYD J;  3OOU A;  2JA6 J;  1K61 A;  4M6V A;  2L0K A;  1F43 A;  2M8G X;  1POG A;  1LFU P;  2E1O A;  2PMZ N;  2CUF A;  2KDZ A;  3WHC A;  3BTI A;  3D1N I;  2Y31 A;  2YUS A;  3JRA A;  4A3G J;  1SFO J;  4BKX A;  1JUP A;  2K9S A;  5EG0 A;  1OFC X;  2NOG A;  2VKE A;  5J3L A;  5DTD A;  1DU6 A;  1VF9 A;  3CDL A;  2E2J J;  3BG9 A;  2HOS A;  5IYC J;  2EQR A;  3PM1 A;  1R9T J;  3LSG A;  1JKQ C;  5C3E J;  3JRC A;  2DA5 A;  2MW8 A;  4D7M A;  4M3F A;  3ZQG A;  5K7F A;  5E3L A;  1HDP A;  3CMY A;  3HOU J;  1B72 A;  5M3F J;  3O8G A;  5F0C A;  2JA8 J;  4IEJ A;  1B72 B;  5IP7 J;  4FCY A;  2FD5 A;  1ENH A;  5J1Y A;  2R5Z A;  1B8I A;  5FKO A;  3BTC A;  5FLM J;  2EH3 A;  1H88 C;  2L9R A;  4XIC A;  2DA1 A;  2NVT J;  4B3A A;  1VND A;  1HLV A;  4AUX A;  2Y9Y A;  5E3M A;  1JUM A;  3G1O A;  1NTC A;  3VPR A;  3BQZ A;  4DZJ A;  1X2N A;  4FTH A;  2HDD A;  1S7E A;  4B1R A;  1GVD A;  4AC0 A;  1ETV A;  5F0H A;  3LSP A;  1ETQ A;  3PO2 J;  1JTX A;  4MFD A;  2DMT A;  1CQT A;  3BTJ A;  5E3N A;  5FKN A;  2NS7 A;  2JN6 A;  4A3K J;  5EYR A;  4MFE A;  5IOY A;  1ZKG A;  1YRN B;  1HDD C;  4IHV A;  4J19 A;  3OIO A;  3GTO J;  1HOM A;  4C2M J;  1JUS A;  1BA5 A;  4BBS J;  2FJ1 A;  3A01 B;  2ME0 A;  3FK6 A;  5M5Y J;  1VFC A;  4UUS B;  2M9H A;  2MGQ A;  1TWC J;  3HOZ J;  5EZG A;  3JRH A;  3Q0V A;  2CUE A;  4M3B A;  1RPW A;  4DYQ A;  3BR0 A;  3IH4 A;  1MH4 A;  1JKR C;  3W6V A;  5EDN A;  5JLX A;  1ETK A;  3S17 J;  3SFI A;  3NAU A;  1B8I B;  2EZL A;  1OCP A;  2LKX A;  1RKT A;  5JLW A;  3MN2 A;  2NVY J;  1OJL A;  4DYC A;  1ZTR A;  1T56 A;  2N8G A;  1ZR4 A;  5FKL A;  3BG5 A;  3B6C A;  3S1R J;  2R93 J;  2DMP A;  3HM5 A;  2WB1 N;  2FX0 A;  3TED A;  1W0U A;  3G1L A;  1JGG A;  1APL C;  3ZQH A;  1WCM J;  4A69 C;  4XRS G;  1UMQ A;  1P7I A;  1WI3 A;  4CYC B;  3JRE A;  2FQ4 A;  2ZB9 A;  4FIS A;  5EG0 B;  1BW6 A;  2DA6 A;  1HF0 A;  2HXI A;  1JTY A;  3I4M J;  1Z77 A;  3LNQ A;  2R5Z B;  4UUS A;  1JT0 A;  5HOD A;  3C2B A;  5F1J A;  2P81 A;  1Y1V J;  2GBY A;  3FIW A;  4A3E J;  2KT0 A;  1TWA J;  5EF6 A;  2CU7 A;  1NK2 P;  2DMQ A;  5IP6 A;  2ID6 A;  2K9N A;  1AKH A;  1RES A;  1TWF J;  3M3Y J;  3M4O J;  3IH3 A;  1IDZ A;  1PUF A;  4A3M J;  1E3O C;  2XRL A;  1UHS A;  4V2G A;  3TW7 A;  2HQ5 A;  2CRG A;  2MSY A;  4DW6 A;  2MG4 A;  1MBH A;  4JP0 A;  3GTG J;  5EZH A;  3S16 J;  3UKG A;  2XB0 X;  3BR3 A;  4DZP A;  1ETO A;  1I6H J;  5C4X J;  1HCR A;  4FE4 A;  1BL0 A;  2LR8 A;  3A02 A;  2HI3 A;  3TP0 A;  4M3E A;  1AU7 A;  3PO3 J;  3RZO J;  3MVP A;  3RZD J;  3FKI J;  2L7M P;  4MO7 A;  3SJM A;  2NS8 A;  2EZI A;  5DS9 A;  2IBD A;  2B63 J;  4JX4 A;  3HGY A;  3ZQC A;  4EEF G;  2OF7 A;  2RAE A;  2Y2Z A;  5BNG A;  2XPU A;  2JA5 J;  5FLV A;  1U9N A;  3HOV J;  3QPS A;  1A6I A;  1TC3 C;  3MKL A;  1FJL A;  1P7J A;  3BT9 A;  3HBL A;  5M5W J;  4D5F A;  2DA7 A;  5M5X J;  1WPK A;  1ETW A;  4A3I J;  3FK7 A;  1W0T A;  1AHD P;  5C44 J;  1X2M A;  2E2H J;  4IHW A;  5IOZ A;  1ZGW A;  1VI0 A;  2OPT A;  3K7A J;  4D5C A;  1JKO C;  3GTQ J;  5IP9 J;  2XPV A;  1Q1V A;  3SDG A;  2COB A;  1X58 A;  4C3J J;  1NK3 P;  1FIP A;  2YU9 J;  5IPA A;  5FKM A;  2H8R A;  2M2E A;  3RQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...