1RETA

Determination of the structure of the dna binding domain of gamma delta resolvase in solution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
43
structure length
43
Chain Sequence
GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Site-specific recombinase
molecule keywords GAMMA DELTA-RESOLVASE
publication title Determination of the structure of the DNA binding domain of gamma delta resolvase in solution.
pubmed rcsb
source organism Escherichia coli
total genus 9
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1994-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1retA00
2GBYA 4MIMA 1WPKA 2Y31A 2JA7J 2TRTA 3HOZJ 3RQIA 4QSHA 2VPRA 5IPAA 2HYJA 4IHWA 1ENHA 2XPUA 2DA4A 2GM4A 4QIWN 1JGGA 2XB0X 2N8GA 2GLOA 4AC0A 3NAUA 1Z77A 1QVTA 3GTQJ 2TCTA 2E1OA 2MSYA 1JT6A 2HXIA 1G2HA 4QTRA 5K7ZA 2EH3A 4MO7A 3LSJA 2FJ1A 2ME6A 3SJMA 1ZTRA 1VF9A 3M4OJ 5IYDJ 5E3NA 2CU7A 2DA7A 2NVQJ 3DEWA 3HB9A 1GV5A 2M8GX 5C44J 3S1RJ 3IV5A 5FLVA 4CYCB 4A3KJ 1WGXA 1BW5A 3S2DJ 2G0EA 2O9LA 3GTOJ 2LTPA 1BA5A 1OCPA 4RDUA 5IYBJ 2ME0A 3QQAA 1ETWA 3S1MJ 5FKLA 5FJ8J 3BTJA 1X58A 1JJ8C 1GT0C 1K61A 4A3LJ 4B3AA 3BR2A 2E19A 1IDZA 5EDNA 3JRGA 3IH3A 1MBJA 4JP0A 3LSGA 2XGCA 3IH4A 4IHXA 1AKHB 1I6HJ 1MBGA 1POGA 2IBDA 3UKGA 1WH7A 4DZPA 2EBIA 3C2BA 2M9HA 2NOGA 4A3GJ 2NVXJ 1TWFJ 2W48A 2L9RA 5FKOA 2XPVA 1WH5A 2DA1A 1F43A 2WB1N 2YS9A 5FKKA 4C3IJ 3Q0WA 3OOUA 4Y7NJ 4FE7A 1LFBA 2XB5A 3A03A 2CQQA 3L1PA 3LNQA 3LSPA 2P81A 4XIDA 3BG9A 2LY9A 1T56A 1QVUA 1HF0A 4D7NA 2QF7A 2Y30A 2Y9YA 4BY1J 2VUMJ 4MFEA 2DMPA 2K9NA 4AYBN 2L7ZA 1VFCA 5K7HA 3HDDA 4HNVA 3TW7A 1TWCJ 2CUFA 1TWGJ 1MBEA 1T33A 1HCRA 4D5FA 3JRCA 1MBKA 2YUSA 1ETQA 5F08A 3ZOBA 1O4XA 1SANA 1U8BA 2IEKA 1ZQ3P 2DTZA 2ECBA 1UHSA 2K9QA 3O8GA 5EZHA 2LFBA 1Y1VJ 4BXXJ 4BBRJ 3K7AJ 2DJNA 3ZQFA 4C2MJ 1PUFA 2DA5A 5JLXA 1YRNA 1JKQC 2Y2ZA 1DU0A 3OSGA 3RZOJ 2CUEA 4DYRA 3I4NJ 2ECCA 2NS7A 4J19A 4UUSA 3PO2J 4D7MA 1ETYA 2ID3A 2R5YA 3BQZA 2K40A 1RPWA 2ZB9A 3E7LA 3A01A 1IGNA 1U9OA 3BT9A 3QPSA 3CCYA 2L7FP 4C3HJ 3D1NI 3BTLA 5FKNA 1B72A 9ANTA 2X6OA 4M6VA 1H89C 4W97A 2R92J 1RR7A 3WHBA 1B8IA 3FIWA 2JJ7A 5EGOA 4BKXA 2HOTA 4XICA 3JR9A 4M3FA 1OJLA 1W0TA 3S1QJ 1GVDA 2DMTA 1RKTA 2Y9ZA 1DU6A 1TWHJ 1APLC 5J1RA 3Q0VA 2X9DA 4V2FA 1A5JA 2H8RA 5JLWA 1IUFA 2O7OA 3S15J 1MBFA 2MW8A 3TP3A 1ITYA 1LE8A 1EF4A 5EG0A 1HOMA 1IV6A 3MKLA 5E3MA 4XRSG 4X6AJ 5FKMA 2DA3A 1FIPA 1MBHA 1X2MA 4A3CJ 1X2NA 2HI3A 5IP9J 2HDDA 2K9SA 1WCMJ 2HOAA 2RAEA 4BY7J 3IH2A 2XSDC 4X1EA 1PUFB 1YRNB 4A69C 1E3OC 2JA6J 4AUXA 3S17J 2M2EA 5BNGA 2ID6A 4UUSB 3RKQA 1ETOA 2R5YB 4XRSA 1QRYA 3A01B 2WAQN 1ZR2A 5E3LA 3SFIA 5F0FA 4ABZA 2DN0A 2AHQA 3CDLA 1U9NA 1IJWC 4A3IJ 1FTTA 1I3QJ 2JWTA 1B72B 2E2IJ 3HOXJ 2DMUA 3BR3A 4A3DJ 3HBLA 2HQ5A 1B8IB 2DA2A 4FE4A 5EGOB 1D5YA 1A6IA 3JRBA 3HGYA 3S14J 1CQTA 4I76A 2CQXA 1ZKGA 1MH3A 5M3FJ 3PO3J 1ZK8A 1ZGWA 2D5VA 1RESA 3HGGA 2L0KA 3CQZJ 4FISA 4DW6A 2X48A 3A02A 3ZQHA 2VKVA 1R9TJ 1JUPA 2OPTA 1FIAA 4M3EA 5M5YJ 5EG0B 4A3JJ 1LE8B 1GV2A 2R7ZJ 2E2HJ 1HDPA 3CMYA 4JX5A 2EZKA 3HOUJ 3LSRA 3ZQLA 4IHYA 1GUUA 4A3FJ 2LP0A 2XPWA 5FLMJ 3JREA 5F04A 3O8HA 1XS9A 4C3JJ 3H0GJ 3OIOA 2LKXA 2LK2A 3MN2A 1JT0A 4M3BA 2JA8J 5GP9A 3VPRA 5F27A 2CRGA 3NARA 1SFOJ 1JJ6C 5IP7J 4NDLA 3GTPJ 1Z0XA 2B63J 2HXOA 4JX6A 1FTZA 5C3EJ 3G1MA 4L5EA 2JK3A 3TP0A 3RZDJ 1I50J 3GTKJ 3GTGJ 3HOVJ 2FX0A 1JKRC 3BQYA 4EEFG 1RKWA 4A3EJ 1JUMA 2KT0A 3I4MJ 4DZJA 1AKHA 1OCTC 1K83J 2JMWA 2IAIA 2YU9J 3BG3A 5F0HA 4B1RA 1QPIA 2LVSA 2M34A 1IDYA 2FD5A 3ZQGA 3OSFA 5C4JJ 2EZLA 1MSFC 3B6AA 1ETKA 5M5WJ 3Q0UA 4JYKA 4XK4A 5GPAA 3ZQCA 1H8AC 1JKPC 3JRIA 3FKIJ 4FTHA 5EF6A 2XRLA 1JKOC 1NK2P 2NS8A 3PM1A 2JA5J 1MSEC 1W0UA 2DA6A 3HOYJ 3M3YJ 3B6CA 1ETXA 4M3DA 4M3GA 1FEXA 2ELKA 1TC3C 1IRZA 2M0CA 2XGEA 2O8KA 3BR0A 3HM5A 3JRHA 5M3MJ 5K7FA 2L7MP 3W6VA 1RETA 4DYCA 1UMQA 3S1NJ 5IOZA 2NVYJ 3F0CA 5F0CA 3BTCA 2QCOA 1P7IA 3QPLA 1AU7A 5M5XJ 4S0HB 1VNDA 1BJZA 3HEFA 5IYCJ 1S7EA 4JX4A 4D5CA 1TWAJ 2XGDA 4BBSJ 1LFUP 3Q3SA 5HODA 3BTIA 1NTCA 4IEJA 1MNMC 3LOCA 5DS9A 1WI3A 4A3BJ 2Y0SN 4GFBA 3HOWJ 2R5ZA 4W1UA 1IC8A 2LLKA 1XC5A 1FJLA 4A3MJ 1Q1VA 2DMNA 5C4XJ 2LD5A 1ETVA 1F36A 2CJJA 2E2JJ 5J3LA 1ORKA 2OF7A 1XG1A 2R0QC 1OFCX 3FK7A 1MH4A 1UG2A 4MFDA 4V2GA 1JUSA 1P7JA 2LR8A 1JTXA 4RBOA 5J1UA 1JTYA 1Y1WJ 4A93J 3BR5A 2R93J 5IP6A 2MG4A 3DCFA 3SDGA 3G1LA 4B4CA 3JRDA 2KDZA 4LOCA 1HDDC 2MGQA 2COBA 5IOYA 3K2AA 4I6ZA 2HOSA 3ZQIA 3H3VK 4Y52J 2NVTJ 1ZR4A 4MLOA 1BW6A 5EZGA 1U78A 3BG5A 3FISA 4CYCA 3WHCA 2VKEA 4XRMA 3GTJJ 1IG7A 1VI0A 2VI6A 4UUTA 2I10A 3GTLJ 5J1YA 3TW6A 3TEDA 2DMQA 3G1OA 5DTDA 2EZIA 2WV1A 4IHVA 4DYQA 3S2HJ 2EZHA 1H88C 2AO9A 2PMZN 3GTMJ 4G12A 3MVPA 5EYRA 3BR6A 2R5ZB 1AHDP 1BL0A 3GBGA 5F1JA 3FK6A 3BR1A 5E3OA 5EEAA 3JRFA 5GPCA 1NK3P 2JN6A 3JRAA 4FCYA 1GDTA 1HLVA 2EQRA 3S16J 3HKZN 2FQ4A 2H1KA
chains in the Genus database with same CATH superfamily
5CJ9A 3PNYA 2BEOA 2BYVE 2GBYA 2A68F 2Y31A 4Z2YA 2B7EA 2EWNA 1TZLA 3RQIA 4YRVA 2PMHA 3V7CA 1OQYA 1S7AA 2HYJA 4IHWA 3ERMA 4XL9A 2XPUA 2RN7A 2O8XA 3LSMA 3FM3A 4AYBA 4E7SA 4E7ZA 2QZ8A 2K4JA 3GTQJ 3WG7H 3VDXA 1G2HA 1CGPA 3K1NA 2NOJB 3LSJA 3MKYB 1ZTRA 1VF9A 2DOAA 2V9KA 1K4TA 1XMKA 4N4OB 2DA7A 2GWRA 2KJCA 2QBYA 2KRCA 2W1OA 2NVQJ 3HB9A 1YQAA 4UV8A 4XORA 1GV5A 2M8GX 3S1RJ 4CYCB 2DT5A 5E20A 3J81Z 4HG2A 1YI2I 3TOBA 2ZFWA 3H9QA 3WU2C 2O9LA 3DWLE 3OR1C 3AG2H 3ML6A 3QQAA 1V5FA 2IA2A 3CJNA 3BTJA 2P4WA 5BMZA 1JJ8C 2CV2A 4E7KA 1K61A 2FUG2 3BR2A 2E19A 2HVSA 1IDZA 1XD7A 1MBJA 3FXLA 3IH4A 4IHXA 1MBGA 3M8JA 1XGOA 3OYKA 5A2QK 3UKGA 3MKZA 1BOAA 4CXFA 3HUGB 4DZPA 2OD5A 1IN7A 2AS5F 2NVXJ 2L9RA 4N9IA 2IXSA 1Z9CA 1MIJA 3BDDA 3F6OA 1X1PA 2F5FA 1Y8QB 2IS6A 1G3TA 1Z91A 4NQWB 4U7BA 2UXNA 1A31A 2P7CB 1DGRM 2CQQA 2P5VA 3LNQA 1QZYA 4RLFA 1WJ5A 2LY9A 3G2BA 3QWLA 5D5VB 4LJZF 2FMLA 2V9VA 5DUKA 4D7NA 2H94A 2QF7A 2V6CA 4KITB 4BY1J 2NNYA 2DMPA 4ENNA 2MD5A 1VFCA 3OYHA 1BJAA 1XGNA 4BS9A 4HYEA 3HDDA 3KYLA 3BJOA 4HNVA 3IKVA 2ICWG 3ZRGA 2R7XA 3CLQA 2RNGA 2L4MA 3ABKH 1MBKA 3JRCA 1ZELA 2YUSA 1D8JA 4ZC3A 1UCRA 3ZOBA 2LY1A 5TJJA 1SD5A 2FQ3A 4EJWA 3C2HA 2DDBA 2P8TA 5LRSA 2ECBA 1UHSA 1X1CA 4CICA 5GAGJ 4KA4A 4LIVA 2BY3A 4CGZA 2E5ZA 2K9QA 3O8GA 3RPUA 2JSCA 3T8TA 4CA0A 4IL6C 3RKXA 4C2MJ 4XLCA 5B66C 4R1HA 1X4OA 1PUFA 1REPC 2ESHA 1YRNA 3H9JA 2HNHA 4CCOA 2XIGA 2FOKA 1Z7UA 4Q4ZF 3V8JA 4HDVA 2H6CA 2LY2A 1OYYA 1WJFA 2CUEA 1SAUA 5L3DA 2ECCA 2NS7A 3FKJA 4DYRA 4BGDA 2HPMA 3PO2J 2OZUA 4RAFA 2ZJ2A 2ZMEB 1E2XA 3WGIA 5B5EC 1IGNA 3BT9A 3DBHB 1ZGJA 4YEJA 3W2VA 5LGUA 3QPSA 3ZN1A 2L7FP 3REOA 1KYZA 2VIXA 1YX5A 2EJRA 2KIMA 4GO1A 2X85A 2XAQA 5ILSA 1B72A 9ANTA 1W1WE 4M6VA 4W97A 3KE2A 4RA2A 3FIWA 3F3XA 1VQ7I 2HOTA 2NVUB 2PJRB 1USTA 4F91B 4M72A 3HG9A 3S1QJ 2FU4A 3I59A 2A61A 4I01A 2DMTA 4EM1A 1RKTA 1DU6A 1KA8A 1F4KA 3DQVC 3CUQB 3Q0VA 5DV5A 3RYRA 1A5JA 3I54A 4V2FA 4XKCA 2BGCA 1IUFA 2CFOA 2W4SA 3TP3A 1KU7A 1BI1A 4I2OA 3PFYA 4DQ2A 1Z05A 2R4GA 4OIQF 2QM3A 4B44A 1LDJA 1USSA 1FOXA 3WTZA 1MBHA 3CO7C 4A3CJ 1VTNC 1VQ8I 5K1YA 3BZ6A 3ONQA 4HQMA 2VE8A 5D5XB 2KHMA 2OU2A 3H9GA 1D5VA 5H2FC 2GAUA 2HOAA 2RAEA 5L3CA 2XSDC 4Y13A 3G4SI 3GZ5A 1VQMI 1SFKA 3FMSA 4N4NB 4A69C 4A6DA 1E3OC 2EV6A 1K78B 4C9YA 2BY2A 3S17J 2M2EA 2F5EA 2K4BA 4KJZA 2R5YB 1MMAA 3J80Z 2BXZA 1NG6A 1QRYA 2X1DA 2WAQN 3C1DA 4UY8I 3VYSB 1LNWA 5E8IA 2F6CA 1BR1A 2BOLA 3CDLA 4QPOA 1IJWC 3W2WA 1FTTA 1S5LC 3ABTA 3OL4A 1R71A 1Z6RA 4ENKA 2JWTA 4ZTFA 2DMUA 1OR7A 4HSRA 2X1CA 4BH9A 5FD5A 2HQ5A 1OLTA 2CG4A 4JOMA 4NB5A 2CH0A 2ETHA 5HDNA 2FBKA 3S14J 4E70A 2CQXA 3DP7A 5HOOA 5BPIA 4EM0B 1IN6A 2V1NA 1F9NA 3HGGA 2X0LA 3N05A 5LFAA 5ILUA 3OOPA 1TNTA 3P9KA 4XQFA 3SZTA 3H5AA 1MGTA 3ZQHA 2PJPA 4ZYAA 2VPLA 2VKVA 2JSPA 2OPTA 1X3WB 1QZZA 2NXNB 2R7ZJ 4XBFA 1HDPA 3CMYA 4JX5A 1OISA 3OYJA 4HQEA 2E2HJ 3HOUJ 2L9NA 2DT6A 4IHYA 1GUUA 2DFEA 2LP0A 4HNUA 5FLMJ 2HR3A 1S3JA 3R4KA 4QWQA 2Z1DA 3GMEA 5CQEA 4D0PA 3H35A 3MN2A 1N77A 1ZARA 2JA8J 1IRGA 2M45A 3ESWB 3FF5A 3V8KA 2DFIA 2EFWA 5FRNA 2CRGA 1V54H 5F64A 2F4IA 4P9FA 3VSLA 4Q5SF 1FTZA 4CCKA 5BOXA 2WV0A 3TOAA 3ZP5A 1FMWA 3PNTA 5IT3A 3HOVJ 2FX0A 4BQOA 2RGVA 2LREA 4P1WA 4A3EJ 1OR7C 3E97A 2FE3A 3CD6I 2XKOA 3I4MJ 2IAIA 4KT5C 5D4RA 3CCEI 3BG3A 3N4MA 3OYAA 1J75A 4LFUA 3GF2A 4LG0B 2FD5A 4LITA 2JTVA 3RIRA 5CVUA 4UVBA 5C4JJ 2V1UA 2A5YB 2ZFUA 5M5WJ 5KK1A 3U9GA 1MJAA 2R7TA 4IQJA 1R5HA 2BXYA 5DCMA 3F9KA 3WTXC 4FTHA 3CDHA 5CYVA 4DJAA 5HNHA 2ZCWA 4ESFA 1W5SA 5AIQA 3F72A 4KN7X 2XDVA 5DUIA 1V5GA 3CO6C 2FBIA 1SD4A 5HS9A 2M0CA 2XGEA 2O8KA 3BJAA 3BR0A 3BZCA 1XB4A 2OCCH 5M3MJ 1ON2A 1FZPB 4A5MA 5CLSA 2A05A 2PEXA 1BR2A 2PX9A 1RETA 4DYCA 3D5SC 1XGSA 1UMQA 2XHKA 3GX4X 3KPHA 1P4XA 4AU7A 1Z67A 2ELHA 4XSZF 2QCOA 2QA4I 2EK5A 2Q8KA 1P7IA 3ROUA 4GXOA 1GVJA 1P4AA 1XCBA 3TQNA 1AU7A 5GAEJ 2EFPA 1FYKA 2KP6A 5E17F 3GZNB 4JX4A 2VXDA 2F5DA 3CZ6A 4RAZA 1P4WA 3VEPA 1MNMC 5DS9A 2V79A 3FMQA 2CV1A 2R5ZA 2PG4A 2QQ8A 2OAZA 2E5NA 2M30A 3H36A 3RQ4A 4A0XA 4BQNA 4RB1A 1IC8A 1CF7A 5LLQA 2KIUA 4PJJA 2OCEA 2HVRA 3HSFA 4A3MJ 1GLNA 4PJLA 3HHHA 5L3BA 3PUFA 4II2A 4DOZA 1ETVA 1V4RA 3JAMK 2P6TA 5ICCA 1ORKA 2OF7A 3GLLA 3FK7A 1QHGA 1LDDA 1ZGAA 1MDMA 3SFZA 2FA5A 4PCQA 4RBOA 1ZN2A 3SXYA 1D0YA 5JFRA 1BI0A 3J7AY 3QPTA 4HX7A 3R0JA 3COAC 4MNUA 3SDGA 4PGGA 1KQ8A 2PJRA 3U21A 2COBA 2D1HA 2XF5A 5DEQA 5IOYA 4I6ZA 4WK8F 5J47A 1WFXA 4PJMA 2Z16A 3MWMA 5HLIA 3ZQIA 2HOSA 3P5JA 4XKVA 4Y52J 2NVTJ 1ZR4A 1BW6A 5E79C 5EZGA 1U78A 2PMUA 4XRMA 1VI0A 4UUTA 4OIRF 3CP2A 1TNSA 5JHUA 3JTHA 2DMQA 4R8HA 3G1OA 1D0XA 3TL4X 5DTDA 4CZZA 1R22A 2LKPA 3K69A 1MZBA 2KZGA 4G12A 3M1CA 2PN6A 1J59A 1BL0A 3GBGA 3HRSA 5DM7F 2DCEA 3HXLA 3WG9A 5LBQA 5GPCA 1YX3A 4D1QA 4IKFA 2K86A 3OR2C 4YIFA 2QGUA 2LMDA 2Y0MA 4QLCU 2JA7J 3QU3A 5LHHA 3A0BC 2VN2A 3CCUI 4QSHA 2OQGA 2NYXA 1ZRFA 3K0LA 2X6XA 1MD0A 1S29A 2H6BA 4QIWN 5E8GA 1JGGA 2GLOA 3NAUA 1Z77A 2MSYA 1JT6A 3ABUA 2JPBA 2YR2A 3KEOA 5K5OA 4QTRA 2EH3A 3VYRB 2RDPA 1PP8F 1I27A 2ZJPF 1HQCA 2MC4A 5BS6A 5E3NA 2CU7A 2CW7A 4YIIA 3FHZA 4HA8A 3CC4I 3DEWA 2LNBA 5C44J 4BJTA 3FBNB 2KIFA 4A3KJ 4XRFA 1BW5A 3GFLA 2EPFA 3GTOJ 1WWXA 2E34A 1FOWA 1OCPA 5IYBJ 1HKSA 2DBBA 1ETWA 5FKLA 3B02A 2UXXA 2ZJQF 1PDNC 4P9UA 3RPQA 4EJOA 2X51A 2XV4S 2BY1A 3M8EA 5L3GA 1QZEA 2HTJA 2IJLA 4A5NA 5EDNA 1LVAA 3JRGA 3F21A 2RNJA 3J81K 1DPRA 1I3AA 1KU9A 2EA4A 3LSGA 3CTAA 4RAGA 4IRIA 1POGA 2IBDA 4LLGF 5FFZA 5HLTA 3C18A 3KEYA 1A36A 5CKTA 2EBIA 2Y75A 3SHFA 4A3GJ 1IN5A 4OIOF 1VQ4I 4BNCA 1S72I 5EEHA 4Q48A 5E1XA 3ZMTA 4B8XA 2YS9A 4C3IJ 3AG1H 4YFXF 1R23A 2QVOA 3OOUA 4Y7NJ 1JI8A 4FE7A 2VOOA 2XB5A 3A03A 3VWBA 3BPXA 2R7FA 4FX0A 3MD2A 3LSPA 4XIDA 3RTRA 1T56A 4NNJA 1QVUA 3MZHA 3BROA 3IAS2 2YX4A 4UVCA 1HF0A 2KRHA 4ZZLA 2Y30A 2VE9A 3VB2A 2XAJA 1SVOA 2M0MA 2H27A 1Z7LA 1LEBA 1MBEA 3V4GA 1MMDA 2IS4A 2LF7A 4D5FA 4L5IA 3Q5FA 3WGGA 3AG3H 2K3FA 3BJ6A 4XOPA 4I98B 5F08A 2Y48A 1U8BA 2IEKA 2VB6A 5CVJA 4EQQA 1S9HA 2RQQA 1YHQI 1DQUA 2D1VA 2L7KA 2NAZA 2LFBA 1Y1VJ 3CMMA 4M71A 2DJNA 3L2CA 3ZQFA 4XR6A 5ED4A 4Z6YA 1DU0A 4UUVA 1D8KA 5E1ZB 1IRXA 2ELJA 2Q2EA 3PIOF 4U87A 4XLFA 3I4NJ 2KFDA 3HJEA 2E71A 4D7MA 1IW7F 2ID3A 3FXJA 3T8RA 1IUYA 3IL2A 2A3SA 2FOWA 4KIBA 3A01A 2MABA 2D45A 3SZGA 5TGTA 3TO9A 2RKHA 1R5GA 3CCYA 5CVIA 4FETA 2EIJH 3WGHA 5FGMA 4GYGA 3HTSB 1F1ZA 2LSOA 3F6VA 3D1NI 5FKNA 4X0GA 1T2KA 3SZPA 3QP5A 2R92J 4PDKA 1RR7A 1K6OA 2JJ7A 3OIPA 4BKXA 5EGOA 5D8LB 1OJLA 3L7WA 2R7OA 4E4HA 1HSTA 1I5ZA 2Y69H 2QQAA 2JA2A 3L09A 4KMUX 4HF2A 2Y9ZA 3RPUD 2VBXA 5DYMA 4HX8A 3DPTA 3Q9VA 3QP6A 4BQQA 5J1RA 1LUJB 2H8RA 3RI4A 1UZCA 5JLWA 3K6GA 3I53A 1MBFA 2MW8A 1ITYA 5JR3A 4ZTJA 4G9YA 1LE8A 1EF4A 4QPQA 1IV6A 1NH3A 4I02A 3K9TA 5E3MA 3DU6A 2MC3A 4HLYA 2DA3A 4G94A 1FIPA 2VJJA 3KZZA 4ZYGA 1R7JA 4XN0A 4AVZA 3C3WA 1JHHA 1RI7A 5IP9J 2K9SA 4S05A 4PJ0C 2W25A 3S2WA 4X1EA 1VQLI 5HDGA 1KQ0A 2JA6J 1K6YA 3GW2A 2QSHX 3M1EA 4HPQA 3PNVA 2ID6A 4M9SA 4UUSB 3RKQA 4EJTA 1V3FA 3FXKA 3PJRA 2E1MB 2F5VA 3OS2A 3CCVI 2A07F 2BVLA 2VL8A 4IQ4A 3ZMSA 2JZYA 2DN0A 2DFFA 2AHQA 3WU1B 1OKRA 3TGNA 1YG2A 3HOXJ 4ENJA 2H09A 3L2QA 3DTEA 2RV8A 3QU6A 1B8IB 3CC7I 2MFZA 2JQ7A 1A6IA 5KNLA 3JRBA 3HGYA 1WKMA 3J80K 3OYFA 1U0JA 3P9CA 4I76A 1ZLKA 3S3OA 3K70D 2JUGA 3KP5A 4XLEA 1ZGWA 2D5VA 2L0KA 3CQZJ 4FISA 2X48A 4ESJA 5HDKA 3IRRA 2ZKZA 2KPMA 4O3MA 4OMZA 3GZ6A 1AOYA 1R9TJ 4F52A 1WZ2A 1JUPA 3F8BA 3WE2A 5M5YJ 4G7OF 5EG0B 4A3JJ 2VBWA 4ZDOA 3EUHA 2ESNA 3CLOA 2EV5A 3DLLF 1N75A 3BC8A 3LSRA 3ZQLA 2HKXA 2XPWA 4NUBA 3JREA 4ZH4F 5F04A 3EUAA 1XS9A 1TL8A 2GXAA 3OIOA 5EJCA 4HRIA 2LK2A 3DTKA 1IV8A 5LRRA 4M3BA 1K7AA 3B73A 2AXLA 1I1SA 2VOPA 4LMYA 5GP9A 1IZ1A 4MTDA 1ZLJA 5F27A 3SDBA 1JJ6C 1QO0D 4BEHA 1Z0XA 2VC1A 4ZJZA 1YFHA 2KDOA 1W7PD 1U3EM 4NC6A 2XUBA 3PFIA 2OBPA 2LH9A 5KAFC 5J40A 4LLNA 5C3EJ 1QPMA 2Y0SA 3G1MA 4H0EA 3BWGA 4BXFA 2VBZA 3GTKJ 3GTGJ 1JKRC 3OS1A 3U2RA 4AD9A 5IY5H 3BQYA 4EEFG 5F1RA 1JUMA 1ONVA 2X4HA 2PBIA 2KT0A 3K4LA 4DZJA 1OCTC 3LFKA 4M6YA 1S7OA 4IPAA 2YU9J 1ZYRF 1Y0UA 1VQPI 2P7VB 2LVSA 4EMSA 1FOKA 1LPQA 1N78A 1IDYA 1FYLA 3K4MA 3RKYA 3OYEA 3OSFA 1HW1A 3B6AA 5BPDA 4JYKA 1WSUA 3DXJF 5GPAA 3IAM2 5FROA 1E17A 2W00A 4BE2A 1X19A 3ZQ7A 2XRLA 4CSWA 1EKEA 3FHNA 3CESA 1NK2P 3PM1A 3EUHC 3BZKA 1TBXA 5GADJ 4L9VA 3B6CA 2VT3A 1G3SA 4KNYA 2QQBA 5HNFA 4OU0A 3ZCOA 2E36A 1BC8C 1H9TA 1R58A 3BY6A 4EJVA 3WTUC 1WI9A 5K7FA 4RS8A 3CJQB 2HTSA 3D5RC 3GFJA 1KONA 2PLYA 1ZRDA 2CV0A 5A2QZ 2NVYJ 3KFWX 5F0CA 3CMEI 2L3DA 2QSFX 5K5RA 4UXNA 1YW9A 3C7JA 2PMZA 3HEFA 1ZREA 1WJCA 4ZDLA 1SMYF 2H1LA 4D5CA 2BW3A 4IRHA 1TWAJ 2XGDA 3ZXSA 4BBSJ 3Q3SA 1HA8A 2OUMA 1NTCA 1X1AA 1YW7A 4IEJA 1N25A 3S93A 4XLNF 3U1KA 2JVHA 1OMIA 4GFBA 3HOWJ 3HKZA 1TQIA 5LGTA 5ICGA 3H0DA 2O0YA 1IAWA 1W7PA 2B0LA 5D4SA 1J9IA 5FLXK 1KU3A 2DMNA 1UHWA 3HSEA 2WC2A 5C4XJ 4HW0A 2LD5A 1XSXA 1F36A 1YS6A 1SAXA 2M87A 2CJJA 2F4MB 1FP2A 2A5WA 2Z9OA 3DLAA 1XG1A 2CS3A 1XCVA 2XGXA 1TW3A 1FC3A 4MFDA 1X1DA 2E60A 5ICEA 1BC7C 1P7JA 2LR8A 3HIFA 2M7AA 4CHUA 4TV7A 3V8LA 3IRQA 3OMYA 4GDFA 1JTYA 1Y1WJ 3MAJA 5IP6A 3DCFA 2BV6A 3E5QA 2V6EA 4B4CA 3G3ZA 3JRDA 2KDZA 2QYOA 2CYYA 2YPRA 3NWTA 2VKHA 1HDDC 1RC9A 2ZNYA 3K70C 4L9NA 2BE5F 4EM2A 1R00A 1BR4A 4R79A 4XLHA 3MEXA 3QODA 3H3VK 3J7AO 2JPCA 4MLOA 2V7FA 1DP3A 1UELB 2OV7A 2R3SA 3FISA 4CYCA 2GZWA 2J5PA 1OCCH 2VKEA 3GTJJ 3OIQA 2WA0A 1YS7A 3E3VA 3LAJA 2O6GE 4M9XA 2I10A 2M4KA 2HFHA 3FXMA 5D6FA 4E7LA 2HGCA 3GTLJ 2IS1A 2F48A 4PGHA 3DFGA 4WWCA 4P5OA 4HV6A 2LYCA 2IGMA 2WV1A 4ESBA 2KKOA 3ECOA 3FXUA 1RNLA 1Z1DA 1QU3A 1TQMA 1V5EA 1WJBA 1F5TA 1BOBA 4NC8A 2PFBA 1AHDP 2LKSA 3QYEA 3FK6A 3NEUA 5EEAA 3HUGA 1NK3P 2JN6A 5ERIA 3JRAA 1HSJA 2COMA 4A6EA 2L5QA 1HLVA 3F22A 2K7LA 3KLNA 4PSXA 2QEXI 2TRTA 2GOXB 2I5UA 3KP2A 2L9SA 2QKLB 4NQWA 3WU0A 4AIDA 3ISPA 3L2RA 1QGPA 1WJDA 2NS0A 3KP6A 4JQFA 5IPAA 4KFCA 1BI3A 1ENHA 4KN4X 2DA4A 1XMAA 2L9VA 2RREA 3D5LA 2XB0X 2N8GA 3L2VA 3S8PA 4AC0A 2TCTA 2E1OA 1S8NA 4XMYA 5K7ZA 4MO7A 2XAHA 1FX7A 4LG3A 2G7HA 3K2ZA 3WTSC 3PQJA 4HX4A 1PYVA 3DF8A 4AIKA 1FOYA 1ODDA 2JUCA 2DDAA 2EFNA 3IV5A 5FLVA 2FNPA 2K9MA 1X3ZB 1VQNI 1P9QC 4LD5A 2G0EA 1B1BA 2R7QA 1HXDA 2LTPA 3DKWA 3CCMI 4RDUA 3WTWC 5TRDA 2ME0A 3RKWA 3S1MJ 5FJ8J 3HSRA 3CCLI 2VQHA 4A3LJ 1J5YA 4HBLA 3O2PE 2W24A 2DODA 3DEUA 2GQQA 3IH3A 4JP0A 3CCSI 3RJPA 1I6HJ 1XGMA 3S32A 4G6QA 4DBRA 4BU2A 3RYPA 1Y8RB 1UHMA 2F4OB 3C2BA 2NOGA 2AQEA 2RC4A 4GYIA 1TWFJ 2W48A 5FKOA 3IKTA 2CO5A 3F8CA 2XPVA 2CQKA 1SFXA 1TT0A 2DA1A 5AIPA 1YYVA 2ZMEA 2XKPA 3TDZC 2WB1N 4U7DA 3BCAA 4K2EA 1T8IA 3Q0WA 2JRTA 4B3XA 3KEQA 1WVRA 1LFBA 2KJBA 3JTGA 2EFQA 3WODF 3HYIA 2P81A 1G6NA 1DUXC 3F23A 3S3NA 3DBRB 2HQRA 2DXIA 1WJEA 2MYSA 2GXBA 2DJIA 2OQRA 3ZMDA 2M7BA 2ZSHB 3HTUA 2Y9YA 1VQKI 2VUMJ 2QBYB 3VSKA 2K9NA 2XAUA 4AYBN 2M8EA 5K7HA 3ECHA 1FPQA 3NQOA 2ZNZA 3CMAI 2F2EA 2VQCA 1TWCJ 3CUQA 2L54A 1SEUA 3OYLA 2LF8A 5F6FA 1HCRA 1LQ1A 2DO7A 2OJED 2ZO4A 1OCZH 1R5ID 1ETQA 4U0WA 4HLXA 1SFEA 4M6XA 2DLLA 3R6SA 2QSGX 3LA3A 1IXSB 4F55A 4BJ6C 5EZHA 2A6TA 2EA2A 2MBFA 2GA1A 3FDYA 5JVTA 4BXXJ 4BBRJ 3TKYA 3VYUB 1TT5B 4HF0A 1ZRCA 1WJAA 2V26A 4NBQA 2WAQA 3OSGA 1K78A 4G8XA 2HS5A 2XC7A 1O3RA 1AWCA 1W36D 4XOTA 4J19A 1JXSA 1ETYA 3MZ8A 2FNAA 2R5YA 2OC6A 1RPWA 2ZB9A 3AG4H 3TMOA 1U9OA 2QENA 2ZMEC 4BJ5C 1XX5A 2VBYA 3BPVA 3QRFF 2EILH 2KLOA 1O3TA 2Z33A 2YX7A 5FB2A 3VODA 1OCRH 3BTLA 2Q1ZB 4HNTA 4S04A 3CCQI 1MJBA 5KHDA 3DKYA 2XROA 1WQ2A 1H89C 5CPRB 3WHBA 1T98A 3HPHA 3PSIA 4O6JA 3KP3A 3JR9A 3DPUA 2G7UA 3BG6A 4Y17A 2W85A 2EINH 4CUGA 1R36A 3CUQC 3I4PA 4LK1F 1HW2A 4MEYF 2K85A 3SYTA 3KYDB 3RDIA 1XN7A 3EQLF 3MKLA 2QKMB 3K1MA 3RSNA 5GTIC 4X6AJ 1GHCA 2GIZA 4BUPA 3GFMA 4EVIA 3H5RA 4WXHA 4XM3A 1RUNA 3H3UA 1R6RA 4HAMA 4RB2C 3OS0A 1PUFB 4BY7J 2DOFA 3IH2A 1YRNB 2V9PA 3CC2I 3MZYA 1BN5A 3LL7A 3PIPF 1OCOH 3TO7A 1HW5A 3I71A 3ASOH 1QA6A 4CCLA 2CGPA 3EYYA 1I1GA 3PUBA 3Q9SA 5AONA 3G71I 3H3ZA 1STZA 3SFIA 5F0FA 4ABZA 3VOEA 1U9NA 4LIUA 3GUDA 4A3IJ 2ACJA 3U1DA 1GXPA 3EETA 4BHPA 4BACA 1B72B 2IT0A 3J7YJ 2VT2A 3BR3A 4XONA 3OY9A 2E2IJ 3R61A 4WCGA 4A3DJ 2OA4A 1G8XA 4ON0A 1E3PA 3I9V2 2DA2A 1EH8A 3P9IA 1IO2A 4IOAF 1D5YA 3V7RA 3OYDA 3GFIA 2CUZA 1CQTA 2ZSIB 5J8FA 1U5TB 4LG0A 1ZKGA 3I59B 1FNNA 1I39A 3LAPA 4B43A 1RESA 2JT1A 2R7RA 3T1BA 2IVMA 1T6SA 4H4KC 2E1CA 4KICA 2IW5A 4KMFA 2LBFB 3GWZA 4RGXA 5B1BH 2WAFA 2UZKA 1FIAA 4M3EA 2Z3YA 3CUOA 1A35A 2F5CA 1IXRC 3E0JB 3IWZA 2HEOA 4I0AA 3WTVC 5IT9Z 4JBAA 4A3FJ 4RAYA 2STWA 2A6EF 1KYWA 1BIAA 1RUOA 3O8HA 1XSDA 2WADA 3H0GJ 3JW4A 4C3JJ 2QWWA 1VQ6I 2IGNA 1K4SA 1Z21A 4BE0A 1JT0A 3QPHA 3ZQQA 4YIRX 4CCJA 4A0YA 3PSFA 4AM3A 3VPRA 1RIOH 3DPLC 3NARA 4HEA2 2Z2SB 4PSWA 1SFOJ 1G59A 3ELKA 4NDLA 5IP7J 3EYIA 3GTPJ 1FP1D 1V55H 4YG2F 2LOOA 3JSPA 4JX6A 4IVNA 3ZN0A 4ZYEA 1T39A 1PUEE 3HZJA 2DFHA 1W5TA 2G9WA 3GO5A 4FQGA 2BHYA 3DTIA 4Y3OA 4OIPF 1RKWA 3FBIB 5J8CA 4MGRA 2GXGA 3LA7A 4GCVA 4RGUA 4F7ZA 1K83J 2JMWA 2L01A 3LWFA 1B9NA 4RGSA 3I56I 2OZ6A 4B1RA 1W36C 1QPIA 5DD8A 3AKZA 5LHGA 3W6JB 4I09A 3ZQGA 2EZLA 1B9MA 3ABMH 1MSFC 1LFPA 3BOQA 1ETKA 3Q0UA 1E3HA 5H6QA 2VLAA 1TW2A 4XK4A 3ZQCA 1H8AC 3KZIC 4N9HA 3JSOA 3FKIJ 2EV0A 4L9TA 3E6MA 5EF6A 1JKOC 3X2QH 1D1AA 2NS8A 1W0UA 2DA6A 3HOYJ 4L5JA 2VQGA 2XASA 3M3YJ 3K4KA 3CDIA 4YELA 2MD0A 4P55A 3L00A 4RMNA 2ELKA 1IRZA 4F93B 2LC2A 2C6YA 1SD7A 4GRIA 3HM5A 1ZG5A 5JVGF 4XLPF 3QOPA 2L7MP 2GA2A 4EJUA 3EPZA 3W6VA 2DYSH 4U0VA 3S1NJ 2X1EA 4M9ZA 1P92A 3BTCA 3DEEA 3IC7A 4MQ9F 3BLYA 1VNDA 1BJZA 2VC0A 3HOTA 1J2XA 3H92A 1S7EA 4XN3A 3HPGA 1IF1A 3I3LA 2NNNA 3KP4A 1IXCA 2DQLA 1LFUP 3TDUC 1B4AA 2KIQA 1QNTA 1EV7A 1IRFA 4PJNA 1WI3A 3IP4B 2CQ7A 1FWZA 3OYIA 4IOCF 2M3AA 5B3SH 3MMYB 1ULYA 4P96A 2CWEA 2DYRH 2XAFA 4HV5A 4W1UA 3AAFA 4IF4A 3ZR8X 4GGGA 3IHUA 1XC5A 2BVMA 4CCNA 1FJLA 1Q1VA 2KRFA 1T95A 2RQPA 5KVRA 1T08B 2Z5UA 4UHTA 3J7ZI 2X6WA 4XNFA 4KISA 2E2JJ 3LSHA 3OWTA 5DCMB 2R0QC 1UG2A 2KL4A 3O6BB 4MEXF 1JUSA 3CJRB 4CH7A 3GXOA 3LSKA 2V1DA 1VQ9I 4CO8A 1LDKB 2R7SA 4G6DA 2JRMA 4G6TB 2MG4A 3MFKA 1J09A 3AL0B 5HS8A 4LOCA 2KZVA 2MGQA 4PK4A 2P5KA 4J01A 2PQ8A 2ZXWH 5D5WB 4L0ZB 1MMNA 3PL8A 1YITI 4HSTA 2YSRA 1Z3XA 1P2FA 4B48A 4CDGA 4PFPA 3BG5A 1MMGA 3DBLB 3WHCA 4A0ZA 1G3WA 1SMTA 3ZMZA 2STTA 4WXDA 5D6EA 3TBIA 2E7WA 1IG7A 1PP7U 3M07A 2VI6A 4BXUA 4HZFA 1H9GA 4D9JA 2EB7A 3LQQA 3H5NA 1MJ9A 3MCZA 1WRJA 2HVQA 5HVQC 2EIMH 3KZYA 3FZVA 4IHVA 1YO5C 3F8NA 1S6LA 3GTMJ 5EYRA 3MVPA 3BR6A 2R5ZB 3OYCA 5LEJA 2J5OA 1CF7B 1RZ4A 4XSXF 1MNDA 4IZZA 2IGOA 4MQVA 3FXRA 2VXZA 1KQ9A 3CF5F 3S16J 5JHFA 3P7NA 4G7HF 4EATA 4MIMA 2ZXIA 3ZMVA 4M74A 1WPKA 2MH2A 3WE3A 5LGNA 3L2UA 1MDMB 3HOZJ 2IP2A 3H1CA 2K02A 1LKXA 4FT8A 4C30A 2VPRA 2A6HF 1LB2A 5DDGA 1FYMA 4HOBA 2W7NA 1MNEA 2WAEA 1YE9A 2GM4A 1O3SA 2PI0A 2XVCA 2CW0F 1QVTA 3ZPLA 2HXIA 2DAOA 3FXOA 1EH7A 1U5TA 4OAYA 2FJ1A 4RB0A 2ME6A 3CCJI 3SJMA 3M4OJ 5IYDJ 1UB9A 5CQGA 5HS7A 5H20A 1TLHB 2BHZA 1R4MB 2LBFA 2R7DA 1BBYA 1WGXA 2DK8A 3HL2A 3S2DJ 3NRVA 4CYDA 1PJRA 3A0HC 3BG7A 1BA5A 4DNCA 1SD6A 1YTYA 4PZJA 5H6RA 3CCRI 2DK5A 1X58A 1Z6TA 4I0BA 1DP7P 4RM3A 4BQAA 1GT0C 4B47A 3E1SA 3OV8A 4B3AA 4G7ZF 1ACIA 2M1BA 4XKBA 2XGCA 1D3YA 1AKHB 2IA1A 1YOVB 5HLHA 1YJNI 1WH7A 4BE1A 2FF4A 3BP8A 2M4GA 2M9HA 4C2UA 1YJWI 2DI3A 2VJ5A 2ZXHA 1Y56A 5FRMA 3CF2A 2HDCA 2VONA 1WH5A 1B59A 3SEQA 1F43A 2FEZA 4AWXB 1Y0NA 5FKKA 4E6KG 3KYCB 2Z99A 4ASNA 2HQAA 1HKQA 3PQKA 2QQ9A 3L1PA 1U6GA 2CW8A 3BG9A 3VFZA 1Y6IA 1MMSA 4IJAA 3I64A 3MQ0A 1X1BA 6PAXA 1L3LA 3EUKL 2RVCA 1YIOA 3VYTB 4A2UA 5ICFA 4ZDPA 2IA0A 1U5TC 1VZ0A 3OL3A 4MFEA 1YJ9I 3V7SA 2L7ZA 4IX7A 4B09A 3RCOA 2HPIA 3ABLH 2L4AA 3C2GA 2JVGA 4M73A 3TW7A 2CUFA 1TWGJ 2K5CA 1T33A 2ZC2A 1O3QA 2W82A 4RM2A 1HKTA 4UB8C 1O4XA 3I58A 2VJIA 1KGSA 5ILVA 2P5LC 1SANA 2DTRA 2FRHA 3W3CA 3TO6A 1ZQ3P 1SVMA 2DTZA 2DW4A 1R1TA 2HOEA 4XKWA 4CCMA 2W84A 2YU3A 4BHBA 2EIKH 3K7AJ 5L3EA 3I0TA 2DA5A 1ZG1A 5JLXA 1JKQC 4YFKF 4J00A 2Y2ZA 5HLGA 4IRGA 3E5XA 3SQNA 3RZOJ 1YIJI 3O3KA 3W6KB 4NHJA 4UUSA 4DGWB 3GCMA 2DU9A 3GLXA 3LQRA 3BQZA 3K4JA 2K40A 4C2TA 1Z3YA 2D2WA 2V4JC 3E7LA 1KZHA 1AA7A 4F92B 2K27A 5J4VA 5LD2C 1VQ5I 1XTAA 1QHHD 2GIVA 2FBHA 2WTEA 1VQOI 4C3HJ 5L3FA 2ZXJA 3I5UA 2XAGA 1JE8A 2GOMA 2X6OA 3FXQA 3LA2A 1M1EB 1K79A 2X6YA 3SEZA 3LMMA 1J0RA 2ISZA 1B8IA 4MHGA 2XF7A 4XICA 3V42A 4M3FA 1J7KA 1YLFA 3ULQB 1W0TA 1FMVA 3M7GA 1DGWY 3FWEA 4DBQA 1GVDA 4FHTA 4BDZA 3W2AA 4EV0A 5GAHJ 1FT9A 4F3QA 1TWHJ 1APLC 2K3PA 3LFUA 3QOEA 3IWFA 1DPUA 1UG0A 2X9DA 4BHCA 2O61A 4UNOA 1X4PA 3FMRA 1Q1HA 2O7OA 3S15J 1X3UA 1RRJA 3QYBA 1IN4A 5EG0A 2L2OA 1HOMA 4KIFA 2OTLI 1MW7A 5K5QA 2ADUA 4E7JA 4XRSG 5FKMA 3NWSA 3ERED 2CUJA 2EFOA 1XPXA 1X2MA 2E7XA 1X2NA 2HI3A 3QYFA 4WX9A 3T0YA 2HDDA 1EA3A 5J6XA 2M5WA 1WCMJ 4AVPA 3HRUA 4AUXA 2HZDA 2DPUA 2Q2EB 1HC8A 4U0YA 4Q47A 2W57A 2WY8Q 5BNGA 3AFHA 3JCUC 1WHUA 5CVRA 1W5CC 4KYWA 1ETOA 4KT6A 1TQPA 5LEKA 5FLXZ 3LSTA 2P0WA 4XRSA 3A01B 2E1MC 1ZR2A 3IUOA 3WTTC 5E3LA 3HC7A 1EH6A 2IPQX 5B1AH 1I3QJ 2A69F 1BI2A 3R60A 5FD6A 4OMYA 3F8MA 4IHSA 3HBLA 3MKWB 4ANJA 5DD4A 1FBQA 4FE4A 5EGOB 3K4CA 4IXAA 2WY7Q 5E1WA 5LHIA 2KMUA 4AIJA 1MH3A 5M3FJ 3PO3J 1ZK8A 3WTYC 3K4BA 4DW6A 3A02A 1FSHA 2IGKA 2DT7B 2LG4A 4CZCA 4RLQA 1LE8B 2MA3A 2VODA 2IS2A 1GV2A 4ZYHA 2EZKA 1XDSA 1ZG3A 3L9FA 2L02A 4FX4A 1XMXA 1D0ZA 1UJ8A 4WF2A 2AXTC 3K1PA 1HBXG 3AL0C 4UV9A 2O3FA 2LKXA 3ZGKA 4OINF 4IHTA 4LGWA 5GTHC 3A2KA 1R49A 4RB3C 3GVAA 4KDPA 3DU5A 4E7HA 5IT9K 4RGRA 5JI6A 1T0FA 2B63J 3E6CC 2HXOA 2FSWA 2H8WA 4PFOA 4L5EA 4OAZA 4LB6B 2JK3A 3TP0A 1ZAOA 4AIHA 3RZDJ 1I50J 3M8FA 3OYMA 4JK1X 2XSJC 2HQNA 1YW8A 1PVEA 4V19K 2NRAC 4E7IA 2FMYA 1AKHA 1ZH5A 2TDXA 3KX2A 1MKMA 3E6DA 5F0HA 3G6EI 4UVAA 2HYGD 2M34A 3K10A 5FO5A 1R1VA 2QLZA 3OYNA 2B9SA 5D5UB 3CJTB 4HDUA 2DPDA 4ETSA 3KETA 2HU9A 3UNGC 3GYHX 1SFUA 2ZBKA 1JKPC 3JRIA 1OPCA 1D1CA 2HKOA 4L0YB 1U2WA 3OYGA 3ASNH 3CP8A 3T5XA 1MSEC 2JA5J 4L18B 1B6AA 5DM6F 4OOIA 1LVKA 1ETXA 2VASA 4M3DA 1EJ9A 1OYWA 1R1UA 4M3GA 1FEXA 2FXAA 4HF1A 1TC3C 2E35A 3HRMA 1DDNA 3DV8A 3L2WA 1BIBA 1GXQA 2MLKA 1OYIA 3R0AA 1FSEA 2I8DA 3JRHA 2OTJI 4PUSA 1D1BA 3A1YA 4LLLA 2DQRA 4BL0B 4Y4RA 3BCBA 4BDYA 1NG7A 2KISA 5IOZA 2KQRA 4U88A 2CFXA 3KLOA 4BEHB 4BYYA 3F0CA 4DIQA 1E0EA 1H0MA 4N0BA 1T0FC 2R7VA 1R4NB 2P6SA 3OYBA 4BAYA 3QPLA 1QQIA 5M5XJ 1A6QA 2QUFA 4S0HB 5IYCJ 2CQNA 3A4CA 2CMPA 2VQLA 2Q0OA 3JAMZ 5E18F 1LEAA 2LDUA 2MLGA 1O7LA 2WBMA 3E6BA 5HODA 3BTIA 1A04A 5EEGA 1IN8A 3GEZA 3LOCA 4LK0F 1TP4A 4A3BJ 2Y0SN 3HRTA 2K9LA 1RR8C 2ISYA 2R7UA 3G73A 1SVLA 2LLKA 2UV1A 1FBSA 4Y33A 4II3A 1T38A 1JHFA 2BBYA 1C0WA 4UB6C 1ON1A 2O5RA 5J3LA 3LSIA 5BQTA 1QBJA 1OFCX 3M9AA 1MH4A 4ZYDA 2VJ4A 1XDUA 1ZHFA 5KCMA 4V2GA 5CVVA 1UAAA 1JGSA 1JTXA 2HWVA 4EGYA 5J1UA 2ZJRF 4KUMA 3DKXA 4ITVA 4Y15A 5FFXA 1O7FA 3BR5A 2R93J 4A93J 3F8FA 3E5UA 1I6XA 4NC7A 3G1LA 3I55I 4LB5A 3QAHA 1Y39A 4ZZDA 3K2AA 1FY7A 4XLAA 3FX3A 3KCCA 1FLIA 2MH9A 4MTEA 1P6RA 1BM9A 1O57A 1W4MA 4IO9F 5DCFA 1SC7A 4I7HA 2AQFA 2WWYA 1U8RA 4L9JA 2BZTA 1G4DA 2R7WA 3N97A 4WXCA 2IRFG 2HYFA 3S3MA 5J1YA 2HZTA 3TW6A 3TEDA 2BW3B 1UFMA 1ERDA 1XSVA 4A12A 1LJ9A 2EZIA 2V1XA 4I99C 4YFNF 4DYQA 3S2HJ 2EZHA 1H88C 3KP7A 2LRDA 2AO9A 2PMZN 3K4NA 5KAIC 3HOSA 1L0OC 1NHAA 2UUZA 1G3YA 2CSOA 2VKDA 2XRNA 3FM5A 1KU2A 4KIGA 3KIOA 4O5VA 2XF6A 1FBUA 1TTYA 1W7PB 5F1JA 2E1NA 3UR3C 2HDWA 2WB1A 2BY0A 3BR1A 5E3OA 5J4YA 3JRFA 3D0SA 2O03A 3ZMUA 4FCYA 3EDPA 4OWRB 4FASD 5TISC 1GDTA 4ENMA 2UWMA 2DOEA 3HHGA 2EQRA 4EGZA 3HKZN 2FQ4A 5D8KB 2H1KA
chains in the Genus database with same CATH topology
2GBYA 4MIMA 1WPKA 2Y31A 2JA7J 2TRTA 3HOZJ 3RQIA 4QSHA 2VPRA 5IPAA 2HYJA 4IHWA 1ENHA 2XPUA 2DA4A 2GM4A 4QIWN 1JGGA 2XB0X 2N8GA 2GLOA 4AC0A 3NAUA 1Z77A 1QVTA 3GTQJ 2TCTA 2E1OA 2MSYA 1JT6A 2HXIA 1G2HA 4QTRA 5K7ZA 2EH3A 4MO7A 3LSJA 2FJ1A 2ME6A 3SJMA 1ZTRA 1VF9A 3M4OJ 5IYDJ 5E3NA 2CU7A 2DA7A 2NVQJ 3DEWA 3HB9A 1GV5A 2M8GX 5C44J 3S1RJ 3IV5A 5FLVA 4CYCB 4A3KJ 1WGXA 1BW5A 3S2DJ 2G0EA 2O9LA 3GTOJ 2LTPA 1BA5A 1OCPA 4RDUA 5IYBJ 2ME0A 3QQAA 1ETWA 3S1MJ 5FKLA 5FJ8J 3BTJA 1X58A 1JJ8C 1GT0C 1K61A 4A3LJ 4B3AA 3BR2A 2E19A 1IDZA 5EDNA 3JRGA 3IH3A 1MBJA 4JP0A 3LSGA 2XGCA 3IH4A 4IHXA 1AKHB 1I6HJ 1MBGA 1POGA 2IBDA 3UKGA 1WH7A 4DZPA 2EBIA 3C2BA 2M9HA 2NOGA 4A3GJ 2NVXJ 1TWFJ 2W48A 2L9RA 5FKOA 2XPVA 1WH5A 2DA1A 1F43A 2WB1N 2YS9A 5FKKA 4C3IJ 3Q0WA 3OOUA 4Y7NJ 4FE7A 1LFBA 2XB5A 3A03A 2CQQA 3L1PA 3LNQA 3LSPA 2P81A 4XIDA 3BG9A 2LY9A 1T56A 1QVUA 1HF0A 4D7NA 2QF7A 2Y30A 2Y9YA 4BY1J 2VUMJ 4MFEA 2DMPA 2K9NA 4AYBN 2L7ZA 1VFCA 5K7HA 3HDDA 4HNVA 3TW7A 1TWCJ 2CUFA 1TWGJ 1MBEA 1T33A 1HCRA 4D5FA 3JRCA 1MBKA 2YUSA 1ETQA 5F08A 3ZOBA 1O4XA 1SANA 1U8BA 2IEKA 1ZQ3P 2DTZA 2ECBA 1UHSA 2K9QA 3O8GA 5EZHA 2LFBA 1Y1VJ 4BXXJ 4BBRJ 3K7AJ 2DJNA 3ZQFA 4C2MJ 1PUFA 2DA5A 5JLXA 1YRNA 1JKQC 2Y2ZA 1DU0A 3OSGA 3RZOJ 2CUEA 4DYRA 3I4NJ 2ECCA 2NS7A 4J19A 4UUSA 3PO2J 4D7MA 1ETYA 2ID3A 2R5YA 3BQZA 2K40A 1RPWA 2ZB9A 3E7LA 3A01A 1IGNA 1U9OA 3BT9A 3QPSA 3CCYA 2L7FP 4C3HJ 3D1NI 3BTLA 5FKNA 1B72A 9ANTA 2X6OA 4M6VA 1H89C 4W97A 2R92J 1RR7A 3WHBA 1B8IA 3FIWA 2JJ7A 5EGOA 4BKXA 2HOTA 4XICA 3JR9A 4M3FA 1OJLA 1W0TA 3S1QJ 1GVDA 2DMTA 1RKTA 2Y9ZA 1DU6A 1TWHJ 1APLC 5J1RA 3Q0VA 2X9DA 4V2FA 1A5JA 2H8RA 5JLWA 1IUFA 2O7OA 3S15J 1MBFA 2MW8A 3TP3A 1ITYA 1LE8A 1EF4A 5EG0A 1HOMA 1IV6A 3MKLA 5E3MA 4XRSG 4X6AJ 5FKMA 2DA3A 1FIPA 1MBHA 1X2MA 4A3CJ 1X2NA 2HI3A 5IP9J 2HDDA 2K9SA 1WCMJ 2HOAA 2RAEA 4BY7J 3IH2A 2XSDC 4X1EA 1PUFB 1YRNB 4A69C 1E3OC 2JA6J 4AUXA 3S17J 2M2EA 5BNGA 2ID6A 4UUSB 3RKQA 1ETOA 2R5YB 4XRSA 1QRYA 3A01B 2WAQN 1ZR2A 5E3LA 3SFIA 5F0FA 4ABZA 2DN0A 2AHQA 3CDLA 1U9NA 1IJWC 4A3IJ 1FTTA 1I3QJ 2JWTA 1B72B 2E2IJ 3HOXJ 2DMUA 3BR3A 4A3DJ 3HBLA 2HQ5A 1B8IB 2DA2A 4FE4A 5EGOB 1D5YA 1A6IA 3JRBA 3HGYA 3S14J 1CQTA 4I76A 2CQXA 1ZKGA 1MH3A 5M3FJ 3PO3J 1ZK8A 1ZGWA 2D5VA 1RESA 3HGGA 2L0KA 3CQZJ 4FISA 4DW6A 2X48A 3A02A 3ZQHA 2VKVA 1R9TJ 1JUPA 2OPTA 1FIAA 4M3EA 5M5YJ 5EG0B 4A3JJ 1LE8B 1GV2A 2R7ZJ 2E2HJ 1HDPA 3CMYA 4JX5A 2EZKA 3HOUJ 3LSRA 3ZQLA 4IHYA 1GUUA 4A3FJ 2LP0A 2XPWA 5FLMJ 3JREA 5F04A 3O8HA 1XS9A 4C3JJ 3H0GJ 3OIOA 2LKXA 2LK2A 3MN2A 1JT0A 4M3BA 2JA8J 5GP9A 3VPRA 5F27A 2CRGA 3NARA 1SFOJ 1JJ6C 5IP7J 4NDLA 3GTPJ 1Z0XA 2B63J 2HXOA 4JX6A 1FTZA 5C3EJ 3G1MA 4L5EA 2JK3A 3TP0A 3RZDJ 1I50J 3GTKJ 3GTGJ 3HOVJ 2FX0A 1JKRC 3BQYA 4EEFG 1RKWA 4A3EJ 1JUMA 2KT0A 3I4MJ 4DZJA 1AKHA 1OCTC 1K83J 2JMWA 2IAIA 2YU9J 3BG3A 5F0HA 4B1RA 1QPIA 2LVSA 2M34A 1IDYA 2FD5A 3ZQGA 3OSFA 5C4JJ 2EZLA 1MSFC 3B6AA 1ETKA 5M5WJ 3Q0UA 4JYKA 4XK4A 5GPAA 3ZQCA 1H8AC 1JKPC 3JRIA 3FKIJ 4FTHA 5EF6A 2XRLA 1JKOC 1NK2P 2NS8A 3PM1A 2JA5J 1MSEC 1W0UA 2DA6A 3HOYJ 3M3YJ 3B6CA 1ETXA 4M3DA 4M3GA 1FEXA 2ELKA 1TC3C 1IRZA 2M0CA 2XGEA 2O8KA 3BR0A 3HM5A 3JRHA 5M3MJ 5K7FA 2L7MP 3W6VA 1RETA 4DYCA 1UMQA 3S1NJ 5IOZA 2NVYJ 3F0CA 5F0CA 3BTCA 2QCOA 1P7IA 3QPLA 1AU7A 5M5XJ 4S0HB 1VNDA 1BJZA 3HEFA 5IYCJ 1S7EA 4JX4A 4D5CA 1TWAJ 2XGDA 4BBSJ 1LFUP 3Q3SA 5HODA 3BTIA 1NTCA 4IEJA 1MNMC 3LOCA 5DS9A 1WI3A 4A3BJ 2Y0SN 4GFBA 3HOWJ 2R5ZA 4W1UA 1IC8A 2LLKA 1XC5A 1FJLA 4A3MJ 1Q1VA 2DMNA 5C4XJ 2LD5A 1ETVA 1F36A 2CJJA 2E2JJ 5J3LA 1ORKA 2OF7A 1XG1A 2R0QC 1OFCX 3FK7A 1MH4A 1UG2A 4MFDA 4V2GA 1JUSA 1P7JA 2LR8A 1JTXA 4RBOA 5J1UA 1JTYA 1Y1WJ 4A93J 3BR5A 2R93J 5IP6A 2MG4A 3DCFA 3SDGA 3G1LA 4B4CA 3JRDA 2KDZA 4LOCA 1HDDC 2MGQA 2COBA 5IOYA 3K2AA 4I6ZA 2HOSA 3ZQIA 3H3VK 4Y52J 2NVTJ 1ZR4A 4MLOA 1BW6A 5EZGA 1U78A 3BG5A 3FISA 4CYCA 3WHCA 2VKEA 4XRMA 3GTJJ 1IG7A 1VI0A 2VI6A 4UUTA 2I10A 3GTLJ 5J1YA 3TW6A 3TEDA 2DMQA 3G1OA 5DTDA 2EZIA 2WV1A 4IHVA 4DYQA 3S2HJ 2EZHA 1H88C 2AO9A 2PMZN 3GTMJ 4G12A 3MVPA 5EYRA 3BR6A 2R5ZB 1AHDP 1BL0A 3GBGA 5F1JA 3FK6A 3BR1A 5E3OA 5EEAA 3JRFA 5GPCA 1NK3P 2JN6A 3JRAA 4FCYA 1GDTA 1HLVA 2EQRA 3S16J 3HKZN 2FQ4A 2H1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBY A;  4MIM A;  1WPK A;  2Y31 A;  2JA7 J;  2TRT A;  3HOZ J;  3RQI A;  4QSH A;  2VPR A;  5IPA A;  2HYJ A;  4IHW A;  1ENH A;  2XPU A;  2DA4 A;  2GM4 A;  4QIW N;  1JGG A;  2XB0 X;  2N8G A;  2GLO A;  4AC0 A;  3NAU A;  1Z77 A;  1QVT A;  3GTQ J;  2TCT A;  2E1O A;  2MSY A;  1JT6 A;  2HXI A;  1G2H A;  4QTR A;  5K7Z A;  2EH3 A;  4MO7 A;  3LSJ A;  2FJ1 A;  2ME6 A;  3SJM A;  1ZTR A;  1VF9 A;  3M4O J;  5IYD J;  5E3N A;  2CU7 A;  2DA7 A;  2NVQ J;  3DEW A;  3HB9 A;  1GV5 A;  2M8G X;  5C44 J;  3S1R J;  3IV5 A;  5FLV A;  4CYC B;  4A3K J;  1WGX A;  1BW5 A;  3S2D J;  2G0E A;  2O9L A;  3GTO J;  2LTP A;  1BA5 A;  1OCP A;  4RDU A;  5IYB J;  2ME0 A;  3QQA A;  1ETW A;  3S1M J;  5FKL A;  5FJ8 J;  3BTJ A;  1X58 A;  1JJ8 C;  1GT0 C;  1K61 A;  4A3L J;  4B3A A;  3BR2 A;  2E19 A;  1IDZ A;  5EDN A;  3JRG A;  3IH3 A;  1MBJ A;  4JP0 A;  3LSG A;  2XGC A;  3IH4 A;  4IHX A;  1AKH B;  1I6H J;  1MBG A;  1POG A;  2IBD A;  3UKG A;  1WH7 A;  4DZP A;  2EBI A;  3C2B A;  2M9H A;  2NOG A;  4A3G J;  2NVX J;  1TWF J;  2W48 A;  2L9R A;  5FKO A;  2XPV A;  1WH5 A;  2DA1 A;  1F43 A;  2WB1 N;  2YS9 A;  5FKK A;  4C3I J;  3Q0W A;  3OOU A;  4Y7N J;  4FE7 A;  1LFB A;  2XB5 A;  3A03 A;  2CQQ A;  3L1P A;  3LNQ A;  3LSP A;  2P81 A;  4XID A;  3BG9 A;  2LY9 A;  1T56 A;  1QVU A;  1HF0 A;  4D7N A;  2QF7 A;  2Y30 A;  2Y9Y A;  4BY1 J;  2VUM J;  4MFE A;  2DMP A;  2K9N A;  4AYB N;  2L7Z A;  1VFC A;  5K7H A;  3HDD A;  4HNV A;  3TW7 A;  1TWC J;  2CUF A;  1TWG J;  1MBE A;  1T33 A;  1HCR A;  4D5F A;  3JRC A;  1MBK A;  2YUS A;  1ETQ A;  5F08 A;  3ZOB A;  1O4X A;  1SAN A;  1U8B A;  2IEK A;  1ZQ3 P;  2DTZ A;  2ECB A;  1UHS A;  2K9Q A;  3O8G A;  5EZH A;  2LFB A;  1Y1V J;  4BXX J;  4BBR J;  3K7A J;  2DJN A;  3ZQF A;  4C2M J;  1PUF A;  2DA5 A;  5JLX A;  1YRN A;  1JKQ C;  2Y2Z A;  1DU0 A;  3OSG A;  3RZO J;  2CUE A;  4DYR A;  3I4N J;  2ECC A;  2NS7 A;  4J19 A;  4UUS A;  3PO2 J;  4D7M A;  1ETY A;  2ID3 A;  2R5Y A;  3BQZ A;  2K40 A;  1RPW A;  2ZB9 A;  3E7L A;  3A01 A;  1IGN A;  1U9O A;  3BT9 A;  3QPS A;  3CCY A;  2L7F P;  4C3H J;  3D1N I;  3BTL A;  5FKN A;  1B72 A;  9ANT A;  2X6O A;  4M6V A;  1H89 C;  4W97 A;  2R92 J;  1RR7 A;  3WHB A;  1B8I A;  3FIW A;  2JJ7 A;  5EGO A;  4BKX A;  2HOT A;  4XIC A;  3JR9 A;  4M3F A;  1OJL A;  1W0T A;  3S1Q J;  1GVD A;  2DMT A;  1RKT A;  2Y9Z A;  1DU6 A;  1TWH J;  1APL C;  5J1R A;  3Q0V A;  2X9D A;  4V2F A;  1A5J A;  2H8R A;  5JLW A;  1IUF A;  2O7O A;  3S15 J;  1MBF A;  2MW8 A;  3TP3 A;  1ITY A;  1LE8 A;  1EF4 A;  5EG0 A;  1HOM A;  1IV6 A;  3MKL A;  5E3M A;  4XRS G;  4X6A J;  5FKM A;  2DA3 A;  1FIP A;  1MBH A;  1X2M A;  4A3C J;  1X2N A;  2HI3 A;  5IP9 J;  2HDD A;  2K9S A;  1WCM J;  2HOA A;  2RAE A;  4BY7 J;  3IH2 A;  2XSD C;  4X1E A;  1PUF B;  1YRN B;  4A69 C;  1E3O C;  2JA6 J;  4AUX A;  3S17 J;  2M2E A;  5BNG A;  2ID6 A;  4UUS B;  3RKQ A;  1ETO A;  2R5Y B;  4XRS A;  1QRY A;  3A01 B;  2WAQ N;  1ZR2 A;  5E3L A;  3SFI A;  5F0F A;  4ABZ A;  2DN0 A;  2AHQ A;  3CDL A;  1U9N A;  1IJW C;  4A3I J;  1FTT A;  1I3Q J;  2JWT A;  1B72 B;  2E2I J;  3HOX J;  2DMU A;  3BR3 A;  4A3D J;  3HBL A;  2HQ5 A;  1B8I B;  2DA2 A;  4FE4 A;  5EGO B;  1D5Y A;  1A6I A;  3JRB A;  3HGY A;  3S14 J;  1CQT A;  4I76 A;  2CQX A;  1ZKG A;  1MH3 A;  5M3F J;  3PO3 J;  1ZK8 A;  1ZGW A;  2D5V A;  1RES A;  3HGG A;  2L0K A;  3CQZ J;  4FIS A;  4DW6 A;  2X48 A;  3A02 A;  3ZQH A;  2VKV A;  1R9T J;  1JUP A;  2OPT A;  1FIA A;  4M3E A;  5M5Y J;  5EG0 B;  4A3J J;  1LE8 B;  1GV2 A;  2R7Z J;  2E2H J;  1HDP A;  3CMY A;  4JX5 A;  2EZK A;  3HOU J;  3LSR A;  3ZQL A;  4IHY A;  1GUU A;  4A3F J;  2LP0 A;  2XPW A;  5FLM J;  3JRE A;  5F04 A;  3O8H A;  1XS9 A;  4C3J J;  3H0G J;  3OIO A;  2LKX A;  2LK2 A;  3MN2 A;  1JT0 A;  4M3B A;  2JA8 J;  5GP9 A;  3VPR A;  5F27 A;  2CRG A;  3NAR A;  1SFO J;  1JJ6 C;  5IP7 J;  4NDL A;  3GTP J;  1Z0X A;  2B63 J;  2HXO A;  4JX6 A;  1FTZ A;  5C3E J;  3G1M A;  4L5E A;  2JK3 A;  3TP0 A;  3RZD J;  1I50 J;  3GTK J;  3GTG J;  3HOV J;  2FX0 A;  1JKR C;  3BQY A;  4EEF G;  1RKW A;  4A3E J;  1JUM A;  2KT0 A;  3I4M J;  4DZJ A;  1AKH A;  1OCT C;  1K83 J;  2JMW A;  2IAI A;  2YU9 J;  3BG3 A;  5F0H A;  4B1R A;  1QPI A;  2LVS A;  2M34 A;  1IDY A;  2FD5 A;  3ZQG A;  3OSF A;  5C4J J;  2EZL A;  1MSF C;  3B6A A;  1ETK A;  5M5W J;  3Q0U A;  4JYK A;  4XK4 A;  5GPA A;  3ZQC A;  1H8A C;  1JKP C;  3JRI A;  3FKI J;  4FTH A;  5EF6 A;  2XRL A;  1JKO C;  1NK2 P;  2NS8 A;  3PM1 A;  2JA5 J;  1MSE C;  1W0U A;  2DA6 A;  3HOY J;  3M3Y J;  3B6C A;  1ETX A;  4M3D A;  4M3G A;  1FEX A;  2ELK A;  1TC3 C;  1IRZ A;  2M0C A;  2XGE A;  2O8K A;  3BR0 A;  3HM5 A;  3JRH A;  5M3M J;  5K7F A;  2L7M P;  3W6V A;  1RET A;  4DYC A;  1UMQ A;  3S1N J;  5IOZ A;  2NVY J;  3F0C A;  5F0C A;  3BTC A;  2QCO A;  1P7I A;  3QPL A;  1AU7 A;  5M5X J;  4S0H B;  1VND A;  1BJZ A;  3HEF A;  5IYC J;  1S7E A;  4JX4 A;  4D5C A;  1TWA J;  2XGD A;  4BBS J;  1LFU P;  3Q3S A;  5HOD A;  3BTI A;  1NTC A;  4IEJ A;  1MNM C;  3LOC A;  5DS9 A;  1WI3 A;  4A3B J;  2Y0S N;  4GFB A;  3HOW J;  2R5Z A;  4W1U A;  1IC8 A;  2LLK A;  1XC5 A;  1FJL A;  4A3M J;  1Q1V A;  2DMN A;  5C4X J;  2LD5 A;  1ETV A;  1F36 A;  2CJJ A;  2E2J J;  5J3L A;  1ORK A;  2OF7 A;  1XG1 A;  2R0Q C;  1OFC X;  3FK7 A;  1MH4 A;  1UG2 A;  4MFD A;  4V2G A;  1JUS A;  1P7J A;  2LR8 A;  1JTX A;  4RBO A;  5J1U A;  1JTY A;  1Y1W J;  4A93 J;  3BR5 A;  2R93 J;  5IP6 A;  2MG4 A;  3DCF A;  3SDG A;  3G1L A;  4B4C A;  3JRD A;  2KDZ A;  4LOC A;  1HDD C;  2MGQ A;  2COB A;  5IOY A;  3K2A A;  4I6Z A;  2HOS A;  3ZQI A;  3H3V K;  4Y52 J;  2NVT J;  1ZR4 A;  4MLO A;  1BW6 A;  5EZG A;  1U78 A;  3BG5 A;  3FIS A;  4CYC A;  3WHC A;  2VKE A;  4XRM A;  3GTJ J;  1IG7 A;  1VI0 A;  2VI6 A;  4UUT A;  2I10 A;  3GTL J;  5J1Y A;  3TW6 A;  3TED A;  2DMQ A;  3G1O A;  5DTD A;  2EZI A;  2WV1 A;  4IHV A;  4DYQ A;  3S2H J;  2EZH A;  1H88 C;  2AO9 A;  2PMZ N;  3GTM J;  4G12 A;  3MVP A;  5EYR A;  3BR6 A;  2R5Z B;  1AHD P;  1BL0 A;  3GBG A;  5F1J A;  3FK6 A;  3BR1 A;  5E3O A;  5EEA A;  3JRF A;  5GPC A;  1NK3 P;  2JN6 A;  3JRA A;  4FCY A;  1GDT A;  1HLV A;  2EQR A;  3S16 J;  3HKZ N;  2FQ4 A;  2H1K A; 
#chains in the Genus database with same CATH topology
 5CJ9 A;  3PNY A;  2BEO A;  2BYV E;  2GBY A;  2A68 F;  2Y31 A;  4Z2Y A;  2B7E A;  2EWN A;  1TZL A;  3RQI A;  4YRV A;  2PMH A;  3V7C A;  1OQY A;  1S7A A;  2HYJ A;  4IHW A;  3ERM A;  4XL9 A;  2XPU A;  2RN7 A;  2O8X A;  3LSM A;  3FM3 A;  4AYB A;  4E7S A;  4E7Z A;  2QZ8 A;  2K4J A;  3GTQ J;  3WG7 H;  3VDX A;  1G2H A;  1CGP A;  3K1N A;  2NOJ B;  3LSJ A;  3MKY B;  1ZTR A;  1VF9 A;  2DOA A;  2V9K A;  1K4T A;  1XMK A;  4N4O B;  2DA7 A;  2GWR A;  2KJC A;  2QBY A;  2KRC A;  2W1O A;  2NVQ J;  3HB9 A;  1YQA A;  4UV8 A;  4XOR A;  1GV5 A;  2M8G X;  3S1R J;  4CYC B;  2DT5 A;  5E20 A;  3J81 Z;  4HG2 A;  1YI2 I;  3TOB A;  2ZFW A;  3H9Q A;  3WU2 C;  2O9L A;  3DWL E;  3OR1 C;  3AG2 H;  3ML6 A;  3QQA A;  1V5F A;  2IA2 A;  3CJN A;  3BTJ A;  2P4W A;  5BMZ A;  1JJ8 C;  2CV2 A;  4E7K A;  1K61 A;  2FUG 2;  3BR2 A;  2E19 A;  2HVS A;  1IDZ A;  1XD7 A;  1MBJ A;  3FXL A;  3IH4 A;  4IHX A;  1MBG A;  3M8J A;  1XGO A;  3OYK A;  5A2Q K;  3UKG A;  3MKZ A;  1BOA A;  4CXF A;  3HUG B;  4DZP A;  2OD5 A;  1IN7 A;  2AS5 F;  2NVX J;  2L9R A;  4N9I A;  2IXS A;  1Z9C A;  1MIJ A;  3BDD A;  3F6O A;  1X1P A;  2F5F A;  1Y8Q B;  2IS6 A;  1G3T A;  1Z91 A;  4NQW B;  4U7B A;  2UXN A;  1A31 A;  2P7C B;  1DGR M;  2CQQ A;  2P5V A;  3LNQ A;  1QZY A;  4RLF A;  1WJ5 A;  2LY9 A;  3G2B A;  3QWL A;  5D5V B;  4LJZ F;  2FML A;  2V9V A;  5DUK A;  4D7N A;  2H94 A;  2QF7 A;  2V6C A;  4KIT B;  4BY1 J;  2NNY A;  2DMP A;  4ENN A;  2MD5 A;  1VFC A;  3OYH A;  1BJA A;  1XGN A;  4BS9 A;  4HYE A;  3HDD A;  3KYL A;  3BJO A;  4HNV A;  3IKV A;  2ICW G;  3ZRG A;  2R7X A;  3CLQ A;  2RNG A;  2L4M A;  3ABK H;  1MBK A;  3JRC A;  1ZEL A;  2YUS A;  1D8J A;  4ZC3 A;  1UCR A;  3ZOB A;  2LY1 A;  5TJJ A;  1SD5 A;  2FQ3 A;  4EJW A;  3C2H A;  2DDB A;  2P8T A;  5LRS A;  2ECB A;  1UHS A;  1X1C A;  4CIC A;  5GAG J;  4KA4 A;  4LIV A;  2BY3 A;  4CGZ A;  2E5Z A;  2K9Q A;  3O8G A;  3RPU A;  2JSC A;  3T8T A;  4CA0 A;  4IL6 C;  3RKX A;  4C2M J;  4XLC A;  5B66 C;  4R1H A;  1X4O A;  1PUF A;  1REP C;  2ESH A;  1YRN A;  3H9J A;  2HNH A;  4CCO A;  2XIG A;  2FOK A;  1Z7U A;  4Q4Z F;  3V8J A;  4HDV A;  2H6C A;  2LY2 A;  1OYY A;  1WJF A;  2CUE A;  1SAU A;  5L3D A;  2ECC A;  2NS7 A;  3FKJ A;  4DYR A;  4BGD A;  2HPM A;  3PO2 J;  2OZU A;  4RAF A;  2ZJ2 A;  2ZME B;  1E2X A;  3WGI A;  5B5E C;  1IGN A;  3BT9 A;  3DBH B;  1ZGJ A;  4YEJ A;  3W2V A;  5LGU A;  3QPS A;  3ZN1 A;  2L7F P;  3REO A;  1KYZ A;  2VIX A;  1YX5 A;  2EJR A;  2KIM A;  4GO1 A;  2X85 A;  2XAQ A;  5ILS A;  1B72 A;  9ANT A;  1W1W E;  4M6V A;  4W97 A;  3KE2 A;  4RA2 A;  3FIW A;  3F3X A;  1VQ7 I;  2HOT A;  2NVU B;  2PJR B;  1UST A;  4F91 B;  4M72 A;  3HG9 A;  3S1Q J;  2FU4 A;  3I59 A;  2A61 A;  4I01 A;  2DMT A;  4EM1 A;  1RKT A;  1DU6 A;  1KA8 A;  1F4K A;  3DQV C;  3CUQ B;  3Q0V A;  5DV5 A;  3RYR A;  1A5J A;  3I54 A;  4V2F A;  4XKC A;  2BGC A;  1IUF A;  2CFO A;  2W4S A;  3TP3 A;  1KU7 A;  1BI1 A;  4I2O A;  3PFY A;  4DQ2 A;  1Z05 A;  2R4G A;  4OIQ F;  2QM3 A;  4B44 A;  1LDJ A;  1USS A;  1FOX A;  3WTZ A;  1MBH A;  3CO7 C;  4A3C J;  1VTN C;  1VQ8 I;  5K1Y A;  3BZ6 A;  3ONQ A;  4HQM A;  2VE8 A;  5D5X B;  2KHM A;  2OU2 A;  3H9G A;  1D5V A;  5H2F C;  2GAU A;  2HOA A;  2RAE A;  5L3C A;  2XSD C;  4Y13 A;  3G4S I;  3GZ5 A;  1VQM I;  1SFK A;  3FMS A;  4N4N B;  4A69 C;  4A6D A;  1E3O C;  2EV6 A;  1K78 B;  4C9Y A;  2BY2 A;  3S17 J;  2M2E A;  2F5E A;  2K4B A;  4KJZ A;  2R5Y B;  1MMA A;  3J80 Z;  2BXZ A;  1NG6 A;  1QRY A;  2X1D A;  2WAQ N;  3C1D A;  4UY8 I;  3VYS B;  1LNW A;  5E8I A;  2F6C A;  1BR1 A;  2BOL A;  3CDL A;  4QPO A;  1IJW C;  3W2W A;  1FTT A;  1S5L C;  3ABT A;  3OL4 A;  1R71 A;  1Z6R A;  4ENK A;  2JWT A;  4ZTF A;  2DMU A;  1OR7 A;  4HSR A;  2X1C A;  4BH9 A;  5FD5 A;  2HQ5 A;  1OLT A;  2CG4 A;  4JOM A;  4NB5 A;  2CH0 A;  2ETH A;  5HDN A;  2FBK A;  3S14 J;  4E70 A;  2CQX A;  3DP7 A;  5HOO A;  5BPI A;  4EM0 B;  1IN6 A;  2V1N A;  1F9N A;  3HGG A;  2X0L A;  3N05 A;  5LFA A;  5ILU A;  3OOP A;  1TNT A;  3P9K A;  4XQF A;  3SZT A;  3H5A A;  1MGT A;  3ZQH A;  2PJP A;  4ZYA A;  2VPL A;  2VKV A;  2JSP A;  2OPT A;  1X3W B;  1QZZ A;  2NXN B;  2R7Z J;  4XBF A;  1HDP A;  3CMY A;  4JX5 A;  1OIS A;  3OYJ A;  4HQE A;  2E2H J;  3HOU J;  2L9N A;  2DT6 A;  4IHY A;  1GUU A;  2DFE A;  2LP0 A;  4HNU A;  5FLM J;  2HR3 A;  1S3J A;  3R4K A;  4QWQ A;  2Z1D A;  3GME A;  5CQE A;  4D0P A;  3H35 A;  3MN2 A;  1N77 A;  1ZAR A;  2JA8 J;  1IRG A;  2M45 A;  3ESW B;  3FF5 A;  3V8K A;  2DFI A;  2EFW A;  5FRN A;  2CRG A;  1V54 H;  5F64 A;  2F4I A;  4P9F A;  3VSL A;  4Q5S F;  1FTZ A;  4CCK A;  5BOX A;  2WV0 A;  3TOA A;  3ZP5 A;  1FMW A;  3PNT A;  5IT3 A;  3HOV J;  2FX0 A;  4BQO A;  2RGV A;  2LRE A;  4P1W A;  4A3E J;  1OR7 C;  3E97 A;  2FE3 A;  3CD6 I;  2XKO A;  3I4M J;  2IAI A;  4KT5 C;  5D4R A;  3CCE I;  3BG3 A;  3N4M A;  3OYA A;  1J75 A;  4LFU A;  3GF2 A;  4LG0 B;  2FD5 A;  4LIT A;  2JTV A;  3RIR A;  5CVU A;  4UVB A;  5C4J J;  2V1U A;  2A5Y B;  2ZFU A;  5M5W J;  5KK1 A;  3U9G A;  1MJA A;  2R7T A;  4IQJ A;  1R5H A;  2BXY A;  5DCM A;  3F9K A;  3WTX C;  4FTH A;  3CDH A;  5CYV A;  4DJA A;  5HNH A;  2ZCW A;  4ESF A;  1W5S A;  5AIQ A;  3F72 A;  4KN7 X;  2XDV A;  5DUI A;  1V5G A;  3CO6 C;  2FBI A;  1SD4 A;  5HS9 A;  2M0C A;  2XGE A;  2O8K A;  3BJA A;  3BR0 A;  3BZC A;  1XB4 A;  2OCC H;  5M3M J;  1ON2 A;  1FZP B;  4A5M A;  5CLS A;  2A05 A;  2PEX A;  1BR2 A;  2PX9 A;  1RET A;  4DYC A;  3D5S C;  1XGS A;  1UMQ A;  2XHK A;  3GX4 X;  3KPH A;  1P4X A;  4AU7 A;  1Z67 A;  2ELH A;  4XSZ F;  2QCO A;  2QA4 I;  2EK5 A;  2Q8K A;  1P7I A;  3ROU A;  4GXO A;  1GVJ A;  1P4A A;  1XCB A;  3TQN A;  1AU7 A;  5GAE J;  2EFP A;  1FYK A;  2KP6 A;  5E17 F;  3GZN B;  4JX4 A;  2VXD A;  2F5D A;  3CZ6 A;  4RAZ A;  1P4W A;  3VEP A;  1MNM C;  5DS9 A;  2V79 A;  3FMQ A;  2CV1 A;  2R5Z A;  2PG4 A;  2QQ8 A;  2OAZ A;  2E5N A;  2M30 A;  3H36 A;  3RQ4 A;  4A0X A;  4BQN A;  4RB1 A;  1IC8 A;  1CF7 A;  5LLQ A;  2KIU A;  4PJJ A;  2OCE A;  2HVR A;  3HSF A;  4A3M J;  1GLN A;  4PJL A;  3HHH A;  5L3B A;  3PUF A;  4II2 A;  4DOZ A;  1ETV A;  1V4R A;  3JAM K;  2P6T A;  5ICC A;  1ORK A;  2OF7 A;  3GLL A;  3FK7 A;  1QHG A;  1LDD A;  1ZGA A;  1MDM A;  3SFZ A;  2FA5 A;  4PCQ A;  4RBO A;  1ZN2 A;  3SXY A;  1D0Y A;  5JFR A;  1BI0 A;  3J7A Y;  3QPT A;  4HX7 A;  3R0J A;  3COA C;  4MNU A;  3SDG A;  4PGG A;  1KQ8 A;  2PJR A;  3U21 A;  2COB A;  2D1H A;  2XF5 A;  5DEQ A;  5IOY A;  4I6Z A;  4WK8 F;  5J47 A;  1WFX A;  4PJM A;  2Z16 A;  3MWM A;  5HLI A;  3ZQI A;  2HOS A;  3P5J A;  4XKV A;  4Y52 J;  2NVT J;  1ZR4 A;  1BW6 A;  5E79 C;  5EZG A;  1U78 A;  2PMU A;  4XRM A;  1VI0 A;  4UUT A;  4OIR F;  3CP2 A;  1TNS A;  5JHU A;  3JTH A;  2DMQ A;  4R8H A;  3G1O A;  1D0X A;  3TL4 X;  5DTD A;  4CZZ A;  1R22 A;  2LKP A;  3K69 A;  1MZB A;  2KZG A;  4G12 A;  3M1C A;  2PN6 A;  1J59 A;  1BL0 A;  3GBG A;  3HRS A;  5DM7 F;  2DCE A;  3HXL A;  3WG9 A;  5LBQ A;  5GPC A;  1YX3 A;  4D1Q A;  4IKF A;  2K86 A;  3OR2 C;  4YIF A;  2QGU A;  2LMD A;  2Y0M A;  4QLC U;  2JA7 J;  3QU3 A;  5LHH A;  3A0B C;  2VN2 A;  3CCU I;  4QSH A;  2OQG A;  2NYX A;  1ZRF A;  3K0L A;  2X6X A;  1MD0 A;  1S29 A;  2H6B A;  4QIW N;  5E8G A;  1JGG A;  2GLO A;  3NAU A;  1Z77 A;  2MSY A;  1JT6 A;  3ABU A;  2JPB A;  2YR2 A;  3KEO A;  5K5O A;  4QTR A;  2EH3 A;  3VYR B;  2RDP A;  1PP8 F;  1I27 A;  2ZJP F;  1HQC A;  2MC4 A;  5BS6 A;  5E3N A;  2CU7 A;  2CW7 A;  4YII A;  3FHZ A;  4HA8 A;  3CC4 I;  3DEW A;  2LNB A;  5C44 J;  4BJT A;  3FBN B;  2KIF A;  4A3K J;  4XRF A;  1BW5 A;  3GFL A;  2EPF A;  3GTO J;  1WWX A;  2E34 A;  1FOW A;  1OCP A;  5IYB J;  1HKS A;  2DBB A;  1ETW A;  5FKL A;  3B02 A;  2UXX A;  2ZJQ F;  1PDN C;  4P9U A;  3RPQ A;  4EJO A;  2X51 A;  2XV4 S;  2BY1 A;  3M8E A;  5L3G A;  1QZE A;  2HTJ A;  2IJL A;  4A5N A;  5EDN A;  1LVA A;  3JRG A;  3F21 A;  2RNJ A;  3J81 K;  1DPR A;  1I3A A;  1KU9 A;  2EA4 A;  3LSG A;  3CTA A;  4RAG A;  4IRI A;  1POG A;  2IBD A;  4LLG F;  5FFZ A;  5HLT A;  3C18 A;  3KEY A;  1A36 A;  5CKT A;  2EBI A;  2Y75 A;  3SHF A;  4A3G J;  1IN5 A;  4OIO F;  1VQ4 I;  4BNC A;  1S72 I;  5EEH A;  4Q48 A;  5E1X A;  3ZMT A;  4B8X A;  2YS9 A;  4C3I J;  3AG1 H;  4YFX F;  1R23 A;  2QVO A;  3OOU A;  4Y7N J;  1JI8 A;  4FE7 A;  2VOO A;  2XB5 A;  3A03 A;  3VWB A;  3BPX A;  2R7F A;  4FX0 A;  3MD2 A;  3LSP A;  4XID A;  3RTR A;  1T56 A;  4NNJ A;  1QVU A;  3MZH A;  3BRO A;  3IAS 2;  2YX4 A;  4UVC A;  1HF0 A;  2KRH A;  4ZZL A;  2Y30 A;  2VE9 A;  3VB2 A;  2XAJ A;  1SVO A;  2M0M A;  2H27 A;  1Z7L A;  1LEB A;  1MBE A;  3V4G A;  1MMD A;  2IS4 A;  2LF7 A;  4D5F A;  4L5I A;  3Q5F A;  3WGG A;  3AG3 H;  2K3F A;  3BJ6 A;  4XOP A;  4I98 B;  5F08 A;  2Y48 A;  1U8B A;  2IEK A;  2VB6 A;  5CVJ A;  4EQQ A;  1S9H A;  2RQQ A;  1YHQ I;  1DQU A;  2D1V A;  2L7K A;  2NAZ A;  2LFB A;  1Y1V J;  3CMM A;  4M71 A;  2DJN A;  3L2C A;  3ZQF A;  4XR6 A;  5ED4 A;  4Z6Y A;  1DU0 A;  4UUV A;  1D8K A;  5E1Z B;  1IRX A;  2ELJ A;  2Q2E A;  3PIO F;  4U87 A;  4XLF A;  3I4N J;  2KFD A;  3HJE A;  2E71 A;  4D7M A;  1IW7 F;  2ID3 A;  3FXJ A;  3T8R A;  1IUY A;  3IL2 A;  2A3S A;  2FOW A;  4KIB A;  3A01 A;  2MAB A;  2D45 A;  3SZG A;  5TGT A;  3TO9 A;  2RKH A;  1R5G A;  3CCY A;  5CVI A;  4FET A;  2EIJ H;  3WGH A;  5FGM A;  4GYG A;  3HTS B;  1F1Z A;  2LSO A;  3F6V A;  3D1N I;  5FKN A;  4X0G A;  1T2K A;  3SZP A;  3QP5 A;  2R92 J;  4PDK A;  1RR7 A;  1K6O A;  2JJ7 A;  3OIP A;  4BKX A;  5EGO A;  5D8L B;  1OJL A;  3L7W A;  2R7O A;  4E4H A;  1HST A;  1I5Z A;  2Y69 H;  2QQA A;  2JA2 A;  3L09 A;  4KMU X;  4HF2 A;  2Y9Z A;  3RPU D;  2VBX A;  5DYM A;  4HX8 A;  3DPT A;  3Q9V A;  3QP6 A;  4BQQ A;  5J1R A;  1LUJ B;  2H8R A;  3RI4 A;  1UZC A;  5JLW A;  3K6G A;  3I53 A;  1MBF A;  2MW8 A;  1ITY A;  5JR3 A;  4ZTJ A;  4G9Y A;  1LE8 A;  1EF4 A;  4QPQ A;  1IV6 A;  1NH3 A;  4I02 A;  3K9T A;  5E3M A;  3DU6 A;  2MC3 A;  4HLY A;  2DA3 A;  4G94 A;  1FIP A;  2VJJ A;  3KZZ A;  4ZYG A;  1R7J A;  4XN0 A;  4AVZ A;  3C3W A;  1JHH A;  1RI7 A;  5IP9 J;  2K9S A;  4S05 A;  4PJ0 C;  2W25 A;  3S2W A;  4X1E A;  1VQL I;  5HDG A;  1KQ0 A;  2JA6 J;  1K6Y A;  3GW2 A;  2QSH X;  3M1E A;  4HPQ A;  3PNV A;  2ID6 A;  4M9S A;  4UUS B;  3RKQ A;  4EJT A;  1V3F A;  3FXK A;  3PJR A;  2E1M B;  2F5V A;  3OS2 A;  3CCV I;  2A07 F;  2BVL A;  2VL8 A;  4IQ4 A;  3ZMS A;  2JZY A;  2DN0 A;  2DFF A;  2AHQ A;  3WU1 B;  1OKR A;  3TGN A;  1YG2 A;  3HOX J;  4ENJ A;  2H09 A;  3L2Q A;  3DTE A;  2RV8 A;  3QU6 A;  1B8I B;  3CC7 I;  2MFZ A;  2JQ7 A;  1A6I A;  5KNL A;  3JRB A;  3HGY A;  1WKM A;  3J80 K;  3OYF A;  1U0J A;  3P9C A;  4I76 A;  1ZLK A;  3S3O A;  3K70 D;  2JUG A;  3KP5 A;  4XLE A;  1ZGW A;  2D5V A;  2L0K A;  3CQZ J;  4FIS A;  2X48 A;  4ESJ A;  5HDK A;  3IRR A;  2ZKZ A;  2KPM A;  4O3M A;  4OMZ A;  3GZ6 A;  1AOY A;  1R9T J;  4F52 A;  1WZ2 A;  1JUP A;  3F8B A;  3WE2 A;  5M5Y J;  4G7O F;  5EG0 B;  4A3J J;  2VBW A;  4ZDO A;  3EUH A;  2ESN A;  3CLO A;  2EV5 A;  3DLL F;  1N75 A;  3BC8 A;  3LSR A;  3ZQL A;  2HKX A;  2XPW A;  4NUB A;  3JRE A;  4ZH4 F;  5F04 A;  3EUA A;  1XS9 A;  1TL8 A;  2GXA A;  3OIO A;  5EJC A;  4HRI A;  2LK2 A;  3DTK A;  1IV8 A;  5LRR A;  4M3B A;  1K7A A;  3B73 A;  2AXL A;  1I1S A;  2VOP A;  4LMY A;  5GP9 A;  1IZ1 A;  4MTD A;  1ZLJ A;  5F27 A;  3SDB A;  1JJ6 C;  1QO0 D;  4BEH A;  1Z0X A;  2VC1 A;  4ZJZ A;  1YFH A;  2KDO A;  1W7P D;  1U3E M;  4NC6 A;  2XUB A;  3PFI A;  2OBP A;  2LH9 A;  5KAF C;  5J40 A;  4LLN A;  5C3E J;  1QPM A;  2Y0S A;  3G1M A;  4H0E A;  3BWG A;  4BXF A;  2VBZ A;  3GTK J;  3GTG J;  1JKR C;  3OS1 A;  3U2R A;  4AD9 A;  5IY5 H;  3BQY A;  4EEF G;  5F1R A;  1JUM A;  1ONV A;  2X4H A;  2PBI A;  2KT0 A;  3K4L A;  4DZJ A;  1OCT C;  3LFK A;  4M6Y A;  1S7O A;  4IPA A;  2YU9 J;  1ZYR F;  1Y0U A;  1VQP I;  2P7V B;  2LVS A;  4EMS A;  1FOK A;  1LPQ A;  1N78 A;  1IDY A;  1FYL A;  3K4M A;  3RKY A;  3OYE A;  3OSF A;  1HW1 A;  3B6A A;  5BPD A;  4JYK A;  1WSU A;  3DXJ F;  5GPA A;  3IAM 2;  5FRO A;  1E17 A;  2W00 A;  4BE2 A;  1X19 A;  3ZQ7 A;  2XRL A;  4CSW A;  1EKE A;  3FHN A;  3CES A;  1NK2 P;  3PM1 A;  3EUH C;  3BZK A;  1TBX A;  5GAD J;  4L9V A;  3B6C A;  2VT3 A;  1G3S A;  4KNY A;  2QQB A;  5HNF A;  4OU0 A;  3ZCO A;  2E36 A;  1BC8 C;  1H9T A;  1R58 A;  3BY6 A;  4EJV A;  3WTU C;  1WI9 A;  5K7F A;  4RS8 A;  3CJQ B;  2HTS A;  3D5R C;  3GFJ A;  1KON A;  2PLY A;  1ZRD A;  2CV0 A;  5A2Q Z;  2NVY J;  3KFW X;  5F0C A;  3CME I;  2L3D A;  2QSF X;  5K5R A;  4UXN A;  1YW9 A;  3C7J A;  2PMZ A;  3HEF A;  1ZRE A;  1WJC A;  4ZDL A;  1SMY F;  2H1L A;  4D5C A;  2BW3 A;  4IRH A;  1TWA J;  2XGD A;  3ZXS A;  4BBS J;  3Q3S A;  1HA8 A;  2OUM A;  1NTC A;  1X1A A;  1YW7 A;  4IEJ A;  1N25 A;  3S93 A;  4XLN F;  3U1K A;  2JVH A;  1OMI A;  4GFB A;  3HOW J;  3HKZ A;  1TQI A;  5LGT A;  5ICG A;  3H0D A;  2O0Y A;  1IAW A;  1W7P A;  2B0L A;  5D4S A;  1J9I A;  5FLX K;  1KU3 A;  2DMN A;  1UHW A;  3HSE A;  2WC2 A;  5C4X J;  4HW0 A;  2LD5 A;  1XSX A;  1F36 A;  1YS6 A;  1SAX A;  2M87 A;  2CJJ A;  2F4M B;  1FP2 A;  2A5W A;  2Z9O A;  3DLA A;  1XG1 A;  2CS3 A;  1XCV A;  2XGX A;  1TW3 A;  1FC3 A;  4MFD A;  1X1D A;  2E60 A;  5ICE A;  1BC7 C;  1P7J A;  2LR8 A;  3HIF A;  2M7A A;  4CHU A;  4TV7 A;  3V8L A;  3IRQ A;  3OMY A;  4GDF A;  1JTY A;  1Y1W J;  3MAJ A;  5IP6 A;  3DCF A;  2BV6 A;  3E5Q A;  2V6E A;  4B4C A;  3G3Z A;  3JRD A;  2KDZ A;  2QYO A;  2CYY A;  2YPR A;  3NWT A;  2VKH A;  1HDD C;  1RC9 A;  2ZNY A;  3K70 C;  4L9N A;  2BE5 F;  4EM2 A;  1R00 A;  1BR4 A;  4R79 A;  4XLH A;  3MEX A;  3QOD A;  3H3V K;  3J7A O;  2JPC A;  4MLO A;  2V7F A;  1DP3 A;  1UEL B;  2OV7 A;  2R3S A;  3FIS A;  4CYC A;  2GZW A;  2J5P A;  1OCC H;  2VKE A;  3GTJ J;  3OIQ A;  2WA0 A;  1YS7 A;  3E3V A;  3LAJ A;  2O6G E;  4M9X A;  2I10 A;  2M4K A;  2HFH A;  3FXM A;  5D6F A;  4E7L A;  2HGC A;  3GTL J;  2IS1 A;  2F48 A;  4PGH A;  3DFG A;  4WWC A;  4P5O A;  4HV6 A;  2LYC A;  2IGM A;  2WV1 A;  4ESB A;  2KKO A;  3ECO A;  3FXU A;  1RNL A;  1Z1D A;  1QU3 A;  1TQM A;  1V5E A;  1WJB A;  1F5T A;  1BOB A;  4NC8 A;  2PFB A;  1AHD P;  2LKS A;  3QYE A;  3FK6 A;  3NEU A;  5EEA A;  3HUG A;  1NK3 P;  2JN6 A;  5ERI A;  3JRA A;  1HSJ A;  2COM A;  4A6E A;  2L5Q A;  1HLV A;  3F22 A;  2K7L A;  3KLN A;  4PSX A;  2QEX I;  2TRT A;  2GOX B;  2I5U A;  3KP2 A;  2L9S A;  2QKL B;  4NQW A;  3WU0 A;  4AID A;  3ISP A;  3L2R A;  1QGP A;  1WJD A;  2NS0 A;  3KP6 A;  4JQF A;  5IPA A;  4KFC A;  1BI3 A;  1ENH A;  4KN4 X;  2DA4 A;  1XMA A;  2L9V A;  2RRE A;  3D5L A;  2XB0 X;  2N8G A;  3L2V A;  3S8P A;  4AC0 A;  2TCT A;  2E1O A;  1S8N A;  4XMY A;  5K7Z A;  4MO7 A;  2XAH A;  1FX7 A;  4LG3 A;  2G7H A;  3K2Z A;  3WTS C;  3PQJ A;  4HX4 A;  1PYV A;  3DF8 A;  4AIK A;  1FOY A;  1ODD A;  2JUC A;  2DDA A;  2EFN A;  3IV5 A;  5FLV A;  2FNP A;  2K9M A;  1X3Z B;  1VQN I;  1P9Q C;  4LD5 A;  2G0E A;  1B1B A;  2R7Q A;  1HXD A;  2LTP A;  3DKW A;  3CCM I;  4RDU A;  3WTW C;  5TRD A;  2ME0 A;  3RKW A;  3S1M J;  5FJ8 J;  3HSR A;  3CCL I;  2VQH A;  4A3L J;  1J5Y A;  4HBL A;  3O2P E;  2W24 A;  2DOD A;  3DEU A;  2GQQ A;  3IH3 A;  4JP0 A;  3CCS I;  3RJP A;  1I6H J;  1XGM A;  3S32 A;  4G6Q A;  4DBR A;  4BU2 A;  3RYP A;  1Y8R B;  1UHM A;  2F4O B;  3C2B A;  2NOG A;  2AQE A;  2RC4 A;  4GYI A;  1TWF J;  2W48 A;  5FKO A;  3IKT A;  2CO5 A;  3F8C A;  2XPV A;  2CQK A;  1SFX A;  1TT0 A;  2DA1 A;  5AIP A;  1YYV A;  2ZME A;  2XKP A;  3TDZ C;  2WB1 N;  4U7D A;  3BCA A;  4K2E A;  1T8I A;  3Q0W A;  2JRT A;  4B3X A;  3KEQ A;  1WVR A;  1LFB A;  2KJB A;  3JTG A;  2EFQ A;  3WOD F;  3HYI A;  2P81 A;  1G6N A;  1DUX C;  3F23 A;  3S3N A;  3DBR B;  2HQR A;  2DXI A;  1WJE A;  2MYS A;  2GXB A;  2DJI A;  2OQR A;  3ZMD A;  2M7B A;  2ZSH B;  3HTU A;  2Y9Y A;  1VQK I;  2VUM J;  2QBY B;  3VSK A;  2K9N A;  2XAU A;  4AYB N;  2M8E A;  5K7H A;  3ECH A;  1FPQ A;  3NQO A;  2ZNZ A;  3CMA I;  2F2E A;  2VQC A;  1TWC J;  3CUQ A;  2L54 A;  1SEU A;  3OYL A;  2LF8 A;  5F6F A;  1HCR A;  1LQ1 A;  2DO7 A;  2OJE D;  2ZO4 A;  1OCZ H;  1R5I D;  1ETQ A;  4U0W A;  4HLX A;  1SFE A;  4M6X A;  2DLL A;  3R6S A;  2QSG X;  3LA3 A;  1IXS B;  4F55 A;  4BJ6 C;  5EZH A;  2A6T A;  2EA2 A;  2MBF A;  2GA1 A;  3FDY A;  5JVT A;  4BXX J;  4BBR J;  3TKY A;  3VYU B;  1TT5 B;  4HF0 A;  1ZRC A;  1WJA A;  2V26 A;  4NBQ A;  2WAQ A;  3OSG A;  1K78 A;  4G8X A;  2HS5 A;  2XC7 A;  1O3R A;  1AWC A;  1W36 D;  4XOT A;  4J19 A;  1JXS A;  1ETY A;  3MZ8 A;  2FNA A;  2R5Y A;  2OC6 A;  1RPW A;  2ZB9 A;  3AG4 H;  3TMO A;  1U9O A;  2QEN A;  2ZME C;  4BJ5 C;  1XX5 A;  2VBY A;  3BPV A;  3QRF F;  2EIL H;  2KLO A;  1O3T A;  2Z33 A;  2YX7 A;  5FB2 A;  3VOD A;  1OCR H;  3BTL A;  2Q1Z B;  4HNT A;  4S04 A;  3CCQ I;  1MJB A;  5KHD A;  3DKY A;  2XRO A;  1WQ2 A;  1H89 C;  5CPR B;  3WHB A;  1T98 A;  3HPH A;  3PSI A;  4O6J A;  3KP3 A;  3JR9 A;  3DPU A;  2G7U A;  3BG6 A;  4Y17 A;  2W85 A;  2EIN H;  4CUG A;  1R36 A;  3CUQ C;  3I4P A;  4LK1 F;  1HW2 A;  4MEY F;  2K85 A;  3SYT A;  3KYD B;  3RDI A;  1XN7 A;  3EQL F;  3MKL A;  2QKM B;  3K1M A;  3RSN A;  5GTI C;  4X6A J;  1GHC A;  2GIZ A;  4BUP A;  3GFM A;  4EVI A;  3H5R A;  4WXH A;  4XM3 A;  1RUN A;  3H3U A;  1R6R A;  4HAM A;  4RB2 C;  3OS0 A;  1PUF B;  4BY7 J;  2DOF A;  3IH2 A;  1YRN B;  2V9P A;  3CC2 I;  3MZY A;  1BN5 A;  3LL7 A;  3PIP F;  1OCO H;  3TO7 A;  1HW5 A;  3I71 A;  3ASO H;  1QA6 A;  4CCL A;  2CGP A;  3EYY A;  1I1G A;  3PUB A;  3Q9S A;  5AON A;  3G71 I;  3H3Z A;  1STZ A;  3SFI A;  5F0F A;  4ABZ A;  3VOE A;  1U9N A;  4LIU A;  3GUD A;  4A3I J;  2ACJ A;  3U1D A;  1GXP A;  3EET A;  4BHP A;  4BAC A;  1B72 B;  2IT0 A;  3J7Y J;  2VT2 A;  3BR3 A;  4XON A;  3OY9 A;  2E2I J;  3R61 A;  4WCG A;  4A3D J;  2OA4 A;  1G8X A;  4ON0 A;  1E3P A;  3I9V 2;  2DA2 A;  1EH8 A;  3P9I A;  1IO2 A;  4IOA F;  1D5Y A;  3V7R A;  3OYD A;  3GFI A;  2CUZ A;  1CQT A;  2ZSI B;  5J8F A;  1U5T B;  4LG0 A;  1ZKG A;  3I59 B;  1FNN A;  1I39 A;  3LAP A;  4B43 A;  1RES A;  2JT1 A;  2R7R A;  3T1B A;  2IVM A;  1T6S A;  4H4K C;  2E1C A;  4KIC A;  2IW5 A;  4KMF A;  2LBF B;  3GWZ A;  4RGX A;  5B1B H;  2WAF A;  2UZK A;  1FIA A;  4M3E A;  2Z3Y A;  3CUO A;  1A35 A;  2F5C A;  1IXR C;  3E0J B;  3IWZ A;  2HEO A;  4I0A A;  3WTV C;  5IT9 Z;  4JBA A;  4A3F J;  4RAY A;  2STW A;  2A6E F;  1KYW A;  1BIA A;  1RUO A;  3O8H A;  1XSD A;  2WAD A;  3H0G J;  3JW4 A;  4C3J J;  2QWW A;  1VQ6 I;  2IGN A;  1K4S A;  1Z21 A;  4BE0 A;  1JT0 A;  3QPH A;  3ZQQ A;  4YIR X;  4CCJ A;  4A0Y A;  3PSF A;  4AM3 A;  3VPR A;  1RIO H;  3DPL C;  3NAR A;  4HEA 2;  2Z2S B;  4PSW A;  1SFO J;  1G59 A;  3ELK A;  4NDL A;  5IP7 J;  3EYI A;  3GTP J;  1FP1 D;  1V55 H;  4YG2 F;  2LOO A;  3JSP A;  4JX6 A;  4IVN A;  3ZN0 A;  4ZYE A;  1T39 A;  1PUE E;  3HZJ A;  2DFH A;  1W5T A;  2G9W A;  3GO5 A;  4FQG A;  2BHY A;  3DTI A;  4Y3O A;  4OIP F;  1RKW A;  3FBI B;  5J8C A;  4MGR A;  2GXG A;  3LA7 A;  4GCV A;  4RGU A;  4F7Z A;  1K83 J;  2JMW A;  2L01 A;  3LWF A;  1B9N A;  4RGS A;  3I56 I;  2OZ6 A;  4B1R A;  1W36 C;  1QPI A;  5DD8 A;  3AKZ A;  5LHG A;  3W6J B;  4I09 A;  3ZQG A;  2EZL A;  1B9M A;  3ABM H;  1MSF C;  1LFP A;  3BOQ A;  1ETK A;  3Q0U A;  1E3H A;  5H6Q A;  2VLA A;  1TW2 A;  4XK4 A;  3ZQC A;  1H8A C;  3KZI C;  4N9H A;  3JSO A;  3FKI J;  2EV0 A;  4L9T A;  3E6M A;  5EF6 A;  1JKO C;  3X2Q H;  1D1A A;  2NS8 A;  1W0U A;  2DA6 A;  3HOY J;  4L5J A;  2VQG A;  2XAS A;  3M3Y J;  3K4K A;  3CDI A;  4YEL A;  2MD0 A;  4P55 A;  3L00 A;  4RMN A;  2ELK A;  1IRZ A;  4F93 B;  2LC2 A;  2C6Y A;  1SD7 A;  4GRI A;  3HM5 A;  1ZG5 A;  5JVG F;  4XLP F;  3QOP A;  2L7M P;  2GA2 A;  4EJU A;  3EPZ A;  3W6V A;  2DYS H;  4U0V A;  3S1N J;  2X1E A;  4M9Z A;  1P92 A;  3BTC A;  3DEE A;  3IC7 A;  4MQ9 F;  3BLY A;  1VND A;  1BJZ A;  2VC0 A;  3HOT A;  1J2X A;  3H92 A;  1S7E A;  4XN3 A;  3HPG A;  1IF1 A;  3I3L A;  2NNN A;  3KP4 A;  1IXC A;  2DQL A;  1LFU P;  3TDU C;  1B4A A;  2KIQ A;  1QNT A;  1EV7 A;  1IRF A;  4PJN A;  1WI3 A;  3IP4 B;  2CQ7 A;  1FWZ A;  3OYI A;  4IOC F;  2M3A A;  5B3S H;  3MMY B;  1ULY A;  4P96 A;  2CWE A;  2DYR H;  2XAF A;  4HV5 A;  4W1U A;  3AAF A;  4IF4 A;  3ZR8 X;  4GGG A;  3IHU A;  1XC5 A;  2BVM A;  4CCN A;  1FJL A;  1Q1V A;  2KRF A;  1T95 A;  2RQP A;  5KVR A;  1T08 B;  2Z5U A;  4UHT A;  3J7Z I;  2X6W A;  4XNF A;  4KIS A;  2E2J J;  3LSH A;  3OWT A;  5DCM B;  2R0Q C;  1UG2 A;  2KL4 A;  3O6B B;  4MEX F;  1JUS A;  3CJR B;  4CH7 A;  3GXO A;  3LSK A;  2V1D A;  1VQ9 I;  4CO8 A;  1LDK B;  2R7S A;  4G6D A;  2JRM A;  4G6T B;  2MG4 A;  3MFK A;  1J09 A;  3AL0 B;  5HS8 A;  4LOC A;  2KZV A;  2MGQ A;  4PK4 A;  2P5K A;  4J01 A;  2PQ8 A;  2ZXW H;  5D5W B;  4L0Z B;  1MMN A;  3PL8 A;  1YIT I;  4HST A;  2YSR A;  1Z3X A;  1P2F A;  4B48 A;  4CDG A;  4PFP A;  3BG5 A;  1MMG A;  3DBL B;  3WHC A;  4A0Z A;  1G3W A;  1SMT A;  3ZMZ A;  2STT A;  4WXD A;  5D6E A;  3TBI A;  2E7W A;  1IG7 A;  1PP7 U;  3M07 A;  2VI6 A;  4BXU A;  4HZF A;  1H9G A;  4D9J A;  2EB7 A;  3LQQ A;  3H5N A;  1MJ9 A;  3MCZ A;  1WRJ A;  2HVQ A;  5HVQ C;  2EIM H;  3KZY A;  3FZV A;  4IHV A;  1YO5 C;  3F8N A;  1S6L A;  3GTM J;  5EYR A;  3MVP A;  3BR6 A;  2R5Z B;  3OYC A;  5LEJ A;  2J5O A;  1CF7 B;  1RZ4 A;  4XSX F;  1MND A;  4IZZ A;  2IGO A;  4MQV A;  3FXR A;  2VXZ A;  1KQ9 A;  3CF5 F;  3S16 J;  5JHF A;  3P7N A;  4G7H F;  4EAT A;  4MIM A;  2ZXI A;  3ZMV A;  4M74 A;  1WPK A;  2MH2 A;  3WE3 A;  5LGN A;  3L2U A;  1MDM B;  3HOZ J;  2IP2 A;  3H1C A;  2K02 A;  1LKX A;  4FT8 A;  4C30 A;  2VPR A;  2A6H F;  1LB2 A;  5DDG A;  1FYM A;  4HOB A;  2W7N A;  1MNE A;  2WAE A;  1YE9 A;  2GM4 A;  1O3S A;  2PI0 A;  2XVC A;  2CW0 F;  1QVT A;  3ZPL A;  2HXI A;  2DAO A;  3FXO A;  1EH7 A;  1U5T A;  4OAY A;  2FJ1 A;  4RB0 A;  2ME6 A;  3CCJ I;  3SJM A;  3M4O J;  5IYD J;  1UB9 A;  5CQG A;  5HS7 A;  5H20 A;  1TLH B;  2BHZ A;  1R4M B;  2LBF A;  2R7D A;  1BBY A;  1WGX A;  2DK8 A;  3HL2 A;  3S2D J;  3NRV A;  4CYD A;  1PJR A;  3A0H C;  3BG7 A;  1BA5 A;  4DNC A;  1SD6 A;  1YTY A;  4PZJ A;  5H6R A;  3CCR I;  2DK5 A;  1X58 A;  1Z6T A;  4I0B A;  1DP7 P;  4RM3 A;  4BQA A;  1GT0 C;  4B47 A;  3E1S A;  3OV8 A;  4B3A A;  4G7Z F;  1ACI A;  2M1B A;  4XKB A;  2XGC A;  1D3Y A;  1AKH B;  2IA1 A;  1YOV B;  5HLH A;  1YJN I;  1WH7 A;  4BE1 A;  2FF4 A;  3BP8 A;  2M4G A;  2M9H A;  4C2U A;  1YJW I;  2DI3 A;  2VJ5 A;  2ZXH A;  1Y56 A;  5FRM A;  3CF2 A;  2HDC A;  2VON A;  1WH5 A;  1B59 A;  3SEQ A;  1F43 A;  2FEZ A;  4AWX B;  1Y0N A;  5FKK A;  4E6K G;  3KYC B;  2Z99 A;  4ASN A;  2HQA A;  1HKQ A;  3PQK A;  2QQ9 A;  3L1P A;  1U6G A;  2CW8 A;  3BG9 A;  3VFZ A;  1Y6I A;  1MMS A;  4IJA A;  3I64 A;  3MQ0 A;  1X1B A;  6PAX A;  1L3L A;  3EUK L;  2RVC A;  1YIO A;  3VYT B;  4A2U A;  5ICF A;  4ZDP A;  2IA0 A;  1U5T C;  1VZ0 A;  3OL3 A;  4MFE A;  1YJ9 I;  3V7S A;  2L7Z A;  4IX7 A;  4B09 A;  3RCO A;  2HPI A;  3ABL H;  2L4A A;  3C2G A;  2JVG A;  4M73 A;  3TW7 A;  2CUF A;  1TWG J;  2K5C A;  1T33 A;  2ZC2 A;  1O3Q A;  2W82 A;  4RM2 A;  1HKT A;  4UB8 C;  1O4X A;  3I58 A;  2VJI A;  1KGS A;  5ILV A;  2P5L C;  1SAN A;  2DTR A;  2FRH A;  3W3C A;  3TO6 A;  1ZQ3 P;  1SVM A;  2DTZ A;  2DW4 A;  1R1T A;  2HOE A;  4XKW A;  4CCM A;  2W84 A;  2YU3 A;  4BHB A;  2EIK H;  3K7A J;  5L3E A;  3I0T A;  2DA5 A;  1ZG1 A;  5JLX A;  1JKQ C;  4YFK F;  4J00 A;  2Y2Z A;  5HLG A;  4IRG A;  3E5X A;  3SQN A;  3RZO J;  1YIJ I;  3O3K A;  3W6K B;  4NHJ A;  4UUS A;  4DGW B;  3GCM A;  2DU9 A;  3GLX A;  3LQR A;  3BQZ A;  3K4J A;  2K40 A;  4C2T A;  1Z3Y A;  2D2W A;  2V4J C;  3E7L A;  1KZH A;  1AA7 A;  4F92 B;  2K27 A;  5J4V A;  5LD2 C;  1VQ5 I;  1XTA A;  1QHH D;  2GIV A;  2FBH A;  2WTE A;  1VQO I;  4C3H J;  5L3F A;  2ZXJ A;  3I5U A;  2XAG A;  1JE8 A;  2GOM A;  2X6O A;  3FXQ A;  3LA2 A;  1M1E B;  1K79 A;  2X6Y A;  3SEZ A;  3LMM A;  1J0R A;  2ISZ A;  1B8I A;  4MHG A;  2XF7 A;  4XIC A;  3V42 A;  4M3F A;  1J7K A;  1YLF A;  3ULQ B;  1W0T A;  1FMV A;  3M7G A;  1DGW Y;  3FWE A;  4DBQ A;  1GVD A;  4FHT A;  4BDZ A;  3W2A A;  4EV0 A;  5GAH J;  1FT9 A;  4F3Q A;  1TWH J;  1APL C;  2K3P A;  3LFU A;  3QOE A;  3IWF A;  1DPU A;  1UG0 A;  2X9D A;  4BHC A;  2O61 A;  4UNO A;  1X4P A;  3FMR A;  1Q1H A;  2O7O A;  3S15 J;  1X3U A;  1RRJ A;  3QYB A;  1IN4 A;  5EG0 A;  2L2O A;  1HOM A;  4KIF A;  2OTL I;  1MW7 A;  5K5Q A;  2ADU A;  4E7J A;  4XRS G;  5FKM A;  3NWS A;  3ERE D;  2CUJ A;  2EFO A;  1XPX A;  1X2M A;  2E7X A;  1X2N A;  2HI3 A;  3QYF A;  4WX9 A;  3T0Y A;  2HDD A;  1EA3 A;  5J6X A;  2M5W A;  1WCM J;  4AVP A;  3HRU A;  4AUX A;  2HZD A;  2DPU A;  2Q2E B;  1HC8 A;  4U0Y A;  4Q47 A;  2W57 A;  2WY8 Q;  5BNG A;  3AFH A;  3JCU C;  1WHU A;  5CVR A;  1W5C C;  4KYW A;  1ETO A;  4KT6 A;  1TQP A;  5LEK A;  5FLX Z;  3LST A;  2P0W A;  4XRS A;  3A01 B;  2E1M C;  1ZR2 A;  3IUO A;  3WTT C;  5E3L A;  3HC7 A;  1EH6 A;  2IPQ X;  5B1A H;  1I3Q J;  2A69 F;  1BI2 A;  3R60 A;  5FD6 A;  4OMY A;  3F8M A;  4IHS A;  3HBL A;  3MKW B;  4ANJ A;  5DD4 A;  1FBQ A;  4FE4 A;  5EGO B;  3K4C A;  4IXA A;  2WY7 Q;  5E1W A;  5LHI A;  2KMU A;  4AIJ A;  1MH3 A;  5M3F J;  3PO3 J;  1ZK8 A;  3WTY C;  3K4B A;  4DW6 A;  3A02 A;  1FSH A;  2IGK A;  2DT7 B;  2LG4 A;  4CZC A;  4RLQ A;  1LE8 B;  2MA3 A;  2VOD A;  2IS2 A;  1GV2 A;  4ZYH A;  2EZK A;  1XDS A;  1ZG3 A;  3L9F A;  2L02 A;  4FX4 A;  1XMX A;  1D0Z A;  1UJ8 A;  4WF2 A;  2AXT C;  3K1P A;  1HBX G;  3AL0 C;  4UV9 A;  2O3F A;  2LKX A;  3ZGK A;  4OIN F;  4IHT A;  4LGW A;  5GTH C;  3A2K A;  1R49 A;  4RB3 C;  3GVA A;  4KDP A;  3DU5 A;  4E7H A;  5IT9 K;  4RGR A;  5JI6 A;  1T0F A;  2B63 J;  3E6C C;  2HXO A;  2FSW A;  2H8W A;  4PFO A;  4L5E A;  4OAZ A;  4LB6 B;  2JK3 A;  3TP0 A;  1ZAO A;  4AIH A;  3RZD J;  1I50 J;  3M8F A;  3OYM A;  4JK1 X;  2XSJ C;  2HQN A;  1YW8 A;  1PVE A;  4V19 K;  2NRA C;  4E7I A;  2FMY A;  1AKH A;  1ZH5 A;  2TDX A;  3KX2 A;  1MKM A;  3E6D A;  5F0H A;  3G6E I;  4UVA A;  2HYG D;  2M34 A;  3K10 A;  5FO5 A;  1R1V A;  2QLZ A;  3OYN A;  2B9S A;  5D5U B;  3CJT B;  4HDU A;  2DPD A;  4ETS A;  3KET A;  2HU9 A;  3UNG C;  3GYH X;  1SFU A;  2ZBK A;  1JKP C;  3JRI A;  1OPC A;  1D1C A;  2HKO A;  4L0Y B;  1U2W A;  3OYG A;  3ASN H;  3CP8 A;  3T5X A;  1MSE C;  2JA5 J;  4L18 B;  1B6A A;  5DM6 F;  4OOI A;  1LVK A;  1ETX A;  2VAS A;  4M3D A;  1EJ9 A;  1OYW A;  1R1U A;  4M3G A;  1FEX A;  2FXA A;  4HF1 A;  1TC3 C;  2E35 A;  3HRM A;  1DDN A;  3DV8 A;  3L2W A;  1BIB A;  1GXQ A;  2MLK A;  1OYI A;  3R0A A;  1FSE A;  2I8D A;  3JRH A;  2OTJ I;  4PUS A;  1D1B A;  3A1Y A;  4LLL A;  2DQR A;  4BL0 B;  4Y4R A;  3BCB A;  4BDY A;  1NG7 A;  2KIS A;  5IOZ A;  2KQR A;  4U88 A;  2CFX A;  3KLO A;  4BEH B;  4BYY A;  3F0C A;  4DIQ A;  1E0E A;  1H0M A;  4N0B A;  1T0F C;  2R7V A;  1R4N B;  2P6S A;  3OYB A;  4BAY A;  3QPL A;  1QQI A;  5M5X J;  1A6Q A;  2QUF A;  4S0H B;  5IYC J;  2CQN A;  3A4C A;  2CMP A;  2VQL A;  2Q0O A;  3JAM Z;  5E18 F;  1LEA A;  2LDU A;  2MLG A;  1O7L A;  2WBM A;  3E6B A;  5HOD A;  3BTI A;  1A04 A;  5EEG A;  1IN8 A;  3GEZ A;  3LOC A;  4LK0 F;  1TP4 A;  4A3B J;  2Y0S N;  3HRT A;  2K9L A;  1RR8 C;  2ISY A;  2R7U A;  3G73 A;  1SVL A;  2LLK A;  2UV1 A;  1FBS A;  4Y33 A;  4II3 A;  1T38 A;  1JHF A;  2BBY A;  1C0W A;  4UB6 C;  1ON1 A;  2O5R A;  5J3L A;  3LSI A;  5BQT A;  1QBJ A;  1OFC X;  3M9A A;  1MH4 A;  4ZYD A;  2VJ4 A;  1XDU A;  1ZHF A;  5KCM A;  4V2G A;  5CVV A;  1UAA A;  1JGS A;  1JTX A;  2HWV A;  4EGY A;  5J1U A;  2ZJR F;  4KUM A;  3DKX A;  4ITV A;  4Y15 A;  5FFX A;  1O7F A;  3BR5 A;  2R93 J;  4A93 J;  3F8F A;  3E5U A;  1I6X A;  4NC7 A;  3G1L A;  3I55 I;  4LB5 A;  3QAH A;  1Y39 A;  4ZZD A;  3K2A A;  1FY7 A;  4XLA A;  3FX3 A;  3KCC A;  1FLI A;  2MH9 A;  4MTE A;  1P6R A;  1BM9 A;  1O57 A;  1W4M A;  4IO9 F;  5DCF A;  1SC7 A;  4I7H A;  2AQF A;  2WWY A;  1U8R A;  4L9J A;  2BZT A;  1G4D A;  2R7W A;  3N97 A;  4WXC A;  2IRF G;  2HYF A;  3S3M A;  5J1Y A;  2HZT A;  3TW6 A;  3TED A;  2BW3 B;  1UFM A;  1ERD A;  1XSV A;  4A12 A;  1LJ9 A;  2EZI A;  2V1X A;  4I99 C;  4YFN F;  4DYQ A;  3S2H J;  2EZH A;  1H88 C;  3KP7 A;  2LRD A;  2AO9 A;  2PMZ N;  3K4N A;  5KAI C;  3HOS A;  1L0O C;  1NHA A;  2UUZ A;  1G3Y A;  2CSO A;  2VKD A;  2XRN A;  3FM5 A;  1KU2 A;  4KIG A;  3KIO A;  4O5V A;  2XF6 A;  1FBU A;  1TTY A;  1W7P B;  5F1J A;  2E1N A;  3UR3 C;  2HDW A;  2WB1 A;  2BY0 A;  3BR1 A;  5E3O A;  5J4Y A;  3JRF A;  3D0S A;  2O03 A;  3ZMU A;  4FCY A;  3EDP A;  4OWR B;  4FAS D;  5TIS C;  1GDT A;  4ENM A;  2UWM A;  2DOE A;  3HHG A;  2EQR A;  4EGZ A;  3HKZ N;  2FQ4 A;  5D8K B;  2H1K A; 
#chains in the Genus database with same CATH homology
 2GBY A;  4MIM A;  1WPK A;  2Y31 A;  2JA7 J;  2TRT A;  3HOZ J;  3RQI A;  4QSH A;  2VPR A;  5IPA A;  2HYJ A;  4IHW A;  1ENH A;  2XPU A;  2DA4 A;  2GM4 A;  4QIW N;  1JGG A;  2XB0 X;  2N8G A;  2GLO A;  4AC0 A;  3NAU A;  1Z77 A;  1QVT A;  3GTQ J;  2TCT A;  2E1O A;  2MSY A;  1JT6 A;  2HXI A;  1G2H A;  4QTR A;  5K7Z A;  2EH3 A;  4MO7 A;  3LSJ A;  2FJ1 A;  2ME6 A;  3SJM A;  1ZTR A;  1VF9 A;  3M4O J;  5IYD J;  5E3N A;  2CU7 A;  2DA7 A;  2NVQ J;  3DEW A;  3HB9 A;  1GV5 A;  2M8G X;  5C44 J;  3S1R J;  3IV5 A;  5FLV A;  4CYC B;  4A3K J;  1WGX A;  1BW5 A;  3S2D J;  2G0E A;  2O9L A;  3GTO J;  2LTP A;  1BA5 A;  1OCP A;  4RDU A;  5IYB J;  2ME0 A;  3QQA A;  1ETW A;  3S1M J;  5FKL A;  5FJ8 J;  3BTJ A;  1X58 A;  1JJ8 C;  1GT0 C;  1K61 A;  4A3L J;  4B3A A;  3BR2 A;  2E19 A;  1IDZ A;  5EDN A;  3JRG A;  3IH3 A;  1MBJ A;  4JP0 A;  3LSG A;  2XGC A;  3IH4 A;  4IHX A;  1AKH B;  1I6H J;  1MBG A;  1POG A;  2IBD A;  3UKG A;  1WH7 A;  4DZP A;  2EBI A;  3C2B A;  2M9H A;  2NOG A;  4A3G J;  2NVX J;  1TWF J;  2W48 A;  2L9R A;  5FKO A;  2XPV A;  1WH5 A;  2DA1 A;  1F43 A;  2WB1 N;  2YS9 A;  5FKK A;  4C3I J;  3Q0W A;  3OOU A;  4Y7N J;  4FE7 A;  1LFB A;  2XB5 A;  3A03 A;  2CQQ A;  3L1P A;  3LNQ A;  3LSP A;  2P81 A;  4XID A;  3BG9 A;  2LY9 A;  1T56 A;  1QVU A;  1HF0 A;  4D7N A;  2QF7 A;  2Y30 A;  2Y9Y A;  4BY1 J;  2VUM J;  4MFE A;  2DMP A;  2K9N A;  4AYB N;  2L7Z A;  1VFC A;  5K7H A;  3HDD A;  4HNV A;  3TW7 A;  1TWC J;  2CUF A;  1TWG J;  1MBE A;  1T33 A;  1HCR A;  4D5F A;  3JRC A;  1MBK A;  2YUS A;  1ETQ A;  5F08 A;  3ZOB A;  1O4X A;  1SAN A;  1U8B A;  2IEK A;  1ZQ3 P;  2DTZ A;  2ECB A;  1UHS A;  2K9Q A;  3O8G A;  5EZH A;  2LFB A;  1Y1V J;  4BXX J;  4BBR J;  3K7A J;  2DJN A;  3ZQF A;  4C2M J;  1PUF A;  2DA5 A;  5JLX A;  1YRN A;  1JKQ C;  2Y2Z A;  1DU0 A;  3OSG A;  3RZO J;  2CUE A;  4DYR A;  3I4N J;  2ECC A;  2NS7 A;  4J19 A;  4UUS A;  3PO2 J;  4D7M A;  1ETY A;  2ID3 A;  2R5Y A;  3BQZ A;  2K40 A;  1RPW A;  2ZB9 A;  3E7L A;  3A01 A;  1IGN A;  1U9O A;  3BT9 A;  3QPS A;  3CCY A;  2L7F P;  4C3H J;  3D1N I;  3BTL A;  5FKN A;  1B72 A;  9ANT A;  2X6O A;  4M6V A;  1H89 C;  4W97 A;  2R92 J;  1RR7 A;  3WHB A;  1B8I A;  3FIW A;  2JJ7 A;  5EGO A;  4BKX A;  2HOT A;  4XIC A;  3JR9 A;  4M3F A;  1OJL A;  1W0T A;  3S1Q J;  1GVD A;  2DMT A;  1RKT A;  2Y9Z A;  1DU6 A;  1TWH J;  1APL C;  5J1R A;  3Q0V A;  2X9D A;  4V2F A;  1A5J A;  2H8R A;  5JLW A;  1IUF A;  2O7O A;  3S15 J;  1MBF A;  2MW8 A;  3TP3 A;  1ITY A;  1LE8 A;  1EF4 A;  5EG0 A;  1HOM A;  1IV6 A;  3MKL A;  5E3M A;  4XRS G;  4X6A J;  5FKM A;  2DA3 A;  1FIP A;  1MBH A;  1X2M A;  4A3C J;  1X2N A;  2HI3 A;  5IP9 J;  2HDD A;  2K9S A;  1WCM J;  2HOA A;  2RAE A;  4BY7 J;  3IH2 A;  2XSD C;  4X1E A;  1PUF B;  1YRN B;  4A69 C;  1E3O C;  2JA6 J;  4AUX A;  3S17 J;  2M2E A;  5BNG A;  2ID6 A;  4UUS B;  3RKQ A;  1ETO A;  2R5Y B;  4XRS A;  1QRY A;  3A01 B;  2WAQ N;  1ZR2 A;  5E3L A;  3SFI A;  5F0F A;  4ABZ A;  2DN0 A;  2AHQ A;  3CDL A;  1U9N A;  1IJW C;  4A3I J;  1FTT A;  1I3Q J;  2JWT A;  1B72 B;  2E2I J;  3HOX J;  2DMU A;  3BR3 A;  4A3D J;  3HBL A;  2HQ5 A;  1B8I B;  2DA2 A;  4FE4 A;  5EGO B;  1D5Y A;  1A6I A;  3JRB A;  3HGY A;  3S14 J;  1CQT A;  4I76 A;  2CQX A;  1ZKG A;  1MH3 A;  5M3F J;  3PO3 J;  1ZK8 A;  1ZGW A;  2D5V A;  1RES A;  3HGG A;  2L0K A;  3CQZ J;  4FIS A;  4DW6 A;  2X48 A;  3A02 A;  3ZQH A;  2VKV A;  1R9T J;  1JUP A;  2OPT A;  1FIA A;  4M3E A;  5M5Y J;  5EG0 B;  4A3J J;  1LE8 B;  1GV2 A;  2R7Z J;  2E2H J;  1HDP A;  3CMY A;  4JX5 A;  2EZK A;  3HOU J;  3LSR A;  3ZQL A;  4IHY A;  1GUU A;  4A3F J;  2LP0 A;  2XPW A;  5FLM J;  3JRE A;  5F04 A;  3O8H A;  1XS9 A;  4C3J J;  3H0G J;  3OIO A;  2LKX A;  2LK2 A;  3MN2 A;  1JT0 A;  4M3B A;  2JA8 J;  5GP9 A;  3VPR A;  5F27 A;  2CRG A;  3NAR A;  1SFO J;  1JJ6 C;  5IP7 J;  4NDL A;  3GTP J;  1Z0X A;  2B63 J;  2HXO A;  4JX6 A;  1FTZ A;  5C3E J;  3G1M A;  4L5E A;  2JK3 A;  3TP0 A;  3RZD J;  1I50 J;  3GTK J;  3GTG J;  3HOV J;  2FX0 A;  1JKR C;  3BQY A;  4EEF G;  1RKW A;  4A3E J;  1JUM A;  2KT0 A;  3I4M J;  4DZJ A;  1AKH A;  1OCT C;  1K83 J;  2JMW A;  2IAI A;  2YU9 J;  3BG3 A;  5F0H A;  4B1R A;  1QPI A;  2LVS A;  2M34 A;  1IDY A;  2FD5 A;  3ZQG A;  3OSF A;  5C4J J;  2EZL A;  1MSF C;  3B6A A;  1ETK A;  5M5W J;  3Q0U A;  4JYK A;  4XK4 A;  5GPA A;  3ZQC A;  1H8A C;  1JKP C;  3JRI A;  3FKI J;  4FTH A;  5EF6 A;  2XRL A;  1JKO C;  1NK2 P;  2NS8 A;  3PM1 A;  2JA5 J;  1MSE C;  1W0U A;  2DA6 A;  3HOY J;  3M3Y J;  3B6C A;  1ETX A;  4M3D A;  4M3G A;  1FEX A;  2ELK A;  1TC3 C;  1IRZ A;  2M0C A;  2XGE A;  2O8K A;  3BR0 A;  3HM5 A;  3JRH A;  5M3M J;  5K7F A;  2L7M P;  3W6V A;  1RET A;  4DYC A;  1UMQ A;  3S1N J;  5IOZ A;  2NVY J;  3F0C A;  5F0C A;  3BTC A;  2QCO A;  1P7I A;  3QPL A;  1AU7 A;  5M5X J;  4S0H B;  1VND A;  1BJZ A;  3HEF A;  5IYC J;  1S7E A;  4JX4 A;  4D5C A;  1TWA J;  2XGD A;  4BBS J;  1LFU P;  3Q3S A;  5HOD A;  3BTI A;  1NTC A;  4IEJ A;  1MNM C;  3LOC A;  5DS9 A;  1WI3 A;  4A3B J;  2Y0S N;  4GFB A;  3HOW J;  2R5Z A;  4W1U A;  1IC8 A;  2LLK A;  1XC5 A;  1FJL A;  4A3M J;  1Q1V A;  2DMN A;  5C4X J;  2LD5 A;  1ETV A;  1F36 A;  2CJJ A;  2E2J J;  5J3L A;  1ORK A;  2OF7 A;  1XG1 A;  2R0Q C;  1OFC X;  3FK7 A;  1MH4 A;  1UG2 A;  4MFD A;  4V2G A;  1JUS A;  1P7J A;  2LR8 A;  1JTX A;  4RBO A;  5J1U A;  1JTY A;  1Y1W J;  4A93 J;  3BR5 A;  2R93 J;  5IP6 A;  2MG4 A;  3DCF A;  3SDG A;  3G1L A;  4B4C A;  3JRD A;  2KDZ A;  4LOC A;  1HDD C;  2MGQ A;  2COB A;  5IOY A;  3K2A A;  4I6Z A;  2HOS A;  3ZQI A;  3H3V K;  4Y52 J;  2NVT J;  1ZR4 A;  4MLO A;  1BW6 A;  5EZG A;  1U78 A;  3BG5 A;  3FIS A;  4CYC A;  3WHC A;  2VKE A;  4XRM A;  3GTJ J;  1IG7 A;  1VI0 A;  2VI6 A;  4UUT A;  2I10 A;  3GTL J;  5J1Y A;  3TW6 A;  3TED A;  2DMQ A;  3G1O A;  5DTD A;  2EZI A;  2WV1 A;  4IHV A;  4DYQ A;  3S2H J;  2EZH A;  1H88 C;  2AO9 A;  2PMZ N;  3GTM J;  4G12 A;  3MVP A;  5EYR A;  3BR6 A;  2R5Z B;  1AHD P;  1BL0 A;  3GBG A;  5F1J A;  3FK6 A;  3BR1 A;  5E3O A;  5EEA A;  3JRF A;  5GPC A;  1NK3 P;  2JN6 A;  3JRA A;  4FCY A;  1GDT A;  1HLV A;  2EQR A;  3S16 J;  3HKZ N;  2FQ4 A;  2H1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...