1RETA

Determination of the structure of the dna binding domain of gamma delta resolvase in solution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
43
structure length
43
Chain Sequence
GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the structure of the DNA binding domain of gamma delta resolvase in solution.
pubmed rcsb
source organism Escherichia coli
molecule tags Site-specific recombinase
molecule keywords GAMMA DELTA-RESOLVASE
total genus 9
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1994-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1retA00
2LVSA 2NVQJ 3S14J 1VF9A 5FKKA 2L7FP 3PM1A 1GV2A 1O4XA 1W0TA 4QIWN 2FX0A 4UUTA 1BJZA 1PUFB 2R93J 2M0CA 2PMZN 2DJNA 2ME6A 3S2HJ 2HOSA 2R5YA 1IRZA 5E3MA 3OSFA 2O8KA 1JTYA 1RKTA 3HM5A 1PUFA 3RQIA 3H0GJ 5F1JA 1GVDA 3S16J 2WV1A 1CQTA 1ENHA 1GUUA 4M3DA 1P7JA 2MG4A 1ETQA 3JR9A 3JRCA 2DA7A 2ID3A 1MBEA 3C2BA 2TCTA 2Y9YA 2E2IJ 3IV5A 5F0CA 2VUMJ 1HOMA 2IEKA 2DMQA 1ZKGA 3Q3SA 2X9DA 3UKGA 1MSEC 3LSJA 1WGXA 4G12A 3LOCA 4EEFG 1AU7A 4Y7NJ 2YS9A 4V2FA 2K9NA 1MBHA 2M9HA 5IP9J 5GP9A 1X2MA 2DMTA 4FISA 1Y1WJ 3HOWJ 1HCRA 4C3IJ 3HOZJ 1X2NA 5E3OA 3S1RJ 1TWFJ 1AKHA 4JX4A 5F08A 3G1OA 2IBDA 2JA5J 5EF6A 1IDZA 3BG5A 4A3EJ 2NVYJ 2KT0A 1TWCJ 3IH2A 5FKOA 5F27A 3I4NJ 2QF7A 1RKWA 2OF7A 2GM4A 2R5ZB 1K61A 1A6IA 4D7NA 5F04A 3HKZN 1BW6A 3WHBA 4BY1J 1QRYA 4FE7A 1MH3A 2QCOA 2Y2ZA 3OOUA 4A3DJ 2VI6A 1GV5A 1ETYA 3FIWA 5J1YA 5IOZA 1MH4A 4DZJA 3JRBA 2NOGA 3A01B 4D5CA 2LR8A 1LE8A 3HEFA 2FD5A 1I3QJ 1UHSA 1BL0A 2EH3A 3M3YJ 1FIPA 3B6CA 1B72A 5C4XJ 1IC8A 4A93J 2XSDC 3Q0UA 3JRAA 2XPVA 4A3MJ 1NK3P 2DA4A 3BR0A 1FJLA 3ZQGA 2JMWA 4XRMA 5IPAA 2DMNA 3RZOJ 2WB1N 3JRHA 3CMYA 4BXXJ 2LD5A 2CU7A 1ETVA 1JUPA 4CYCA 1T56A 4BBRJ 1GDTA 2X6OA 1MBKA 1JKQC 3Q0VA 2R7ZJ 1T33A 5BNGA 2COBA 4MO7A 4X6AJ 2LP0A 1H89C 4IEJA 1WCMJ 2DA3A 2HXIA 1MBJA 4V2GA 1W0UA 1B8IA 1R9TJ 5C44J 1IUFA 4M3GA 1GT0C 4BY7J 2R5YB 2M34A 3ZOBA 3S1MJ 3ZQFA 1S7EA 2L7MP 2HDDA 2ECCA 1ZR4A 2VKEA 4B1RA 1B72B 3O8HA 2XB5A 4B3AA 4A3BJ 1SANA 1A5JA 4S0HB 2YUSA 4JYKA 1JTXA 2ECBA 4MFEA 1HLVA 1HDDC 1FTTA 2FJ1A 1MNMC 2B63J 1F36A 9ANTA 2Y9ZA 5E3NA 4I6ZA 1JUMA 3HOUJ 3BQYA 3BQZA 3M4OJ 4AUXA 1LE8B 3WHCA 2XPUA 3O8GA 2E2HJ 2JA7J 4DYRA 3D1NI 1ZGWA 4ABZA 2DTZA 3A02A 4L5EA 5JLXA 2K40A 3CQZJ 1NTCA 2EZKA 2TRTA 3BTCA 3LNQA 4X1EA 4J19A 2X48A 4A69C 1ZTRA 2DMPA 5IOYA 3BG3A 5K7ZA 4JP0A 3L1PA 2E19A 4XK4A 1VFCA 3G1MA 1I50J 2L0KA 3SJMA 5EZHA 2I10A 4XRSG 3HOVJ 1QVTA 3MKLA 5M3MJ 4A3IJ 2OPTA 4M3EA 4DZPA 2R92J 3BR5A 3TP0A 3LSPA 2DA6A 1EF4A 1XG1A 1F43A 2XB0X 5E3LA 1XC5A 5EGOA 2NS8A 2FQ4A 4FE4A 1JUSA 2AO9A 1RETA 5K7FA 3GTPJ 4I76A 1RESA 4DW6A 4BKXA 4AC0A 2JA6J 2JJ7A 2HYJA 1QVUA 4W97A 2KDZA 1H8AC 1HDPA 5GPCA 4Y52J 1OJLA 3BG9A 3BT9A 5J3LA 3IH3A 3RKQA 1HF0A 4DYQA 5EYRA 3LSGA 5FKNA 1TWGJ 1TWHJ 2CUEA 4FCYA 3TEDA 3TW7A 3FISA 2VPRA 1TC3C 3ZQHA 4A3CJ 5IYDJ 1LFUP 1UMQA 4B4CA 1ZQ3P 3A01A 1JKOC 2LLKA 2R5ZA 3I4MJ 1VI0A 2LFBA 3CDLA 3HGGA 4W1UA 4XIDA 1WI3A 1P7IA 1APLC 2ID6A 2Y30A 2DA5A 2E1OA 3B6AA 5J1UA 3ZQLA 3JRDA 1ETXA 2XGDA 4BBSJ 4HNVA 5EGOB 3A03A 3OIOA 1AKHB 1WH5A 1YRNA 1IJWC 2LKXA 3GTJJ 4D5FA 3H3VK 1ZK8A 1ETWA 1NK2P 5K7HA 2XGEA 3HBLA 2M8GX 4NDLA 4DYCA 4M3BA 3PO3J 1X58A 2JA8J 1U9NA 2ME0A 3RZDJ 1FIAA 4D7MA 3HOYJ 2AHQA 2R0QC 2D5VA 4MLOA 1Z0XA 4AYBN 1YRNB 4JX6A 4UUSA 1I6HJ 4A3JJ 4RBOA 2IAIA 3ZQIA 2HOTA 5C4JJ 2K9SA 3QQAA 2E2JJ 2GLOA 2EZHA 5M5YJ 3G1LA 4FTHA 1OCPA 4UUSB 1LFBA 3S15J 2EZIA 2O9LA 2JN6A 1JGGA 4RDUA 3S1QJ 2XPWA 4QTRA 1QPIA 2RAEA 3HGYA 1OCTC 4A3LJ 1H88C 2WAQN 3Q0WA 5M5XJ 2HQ5A 1SFOJ 1FEXA 2CUFA 3QPSA 5EZGA 3S17J 2K9QA 4MFDA 2EZLA 2XGCA 5JLWA 1WH7A 2EQRA 5EDNA 4XICA 5IP6A 1B8IB 2W48A 3PO2J 1ETOA 1DU6A 5DS9A 3FK6A 3MVPA 1VNDA 4JX5A 3SFIA 2CQXA 4MIMA 3HB9A 2P81A 3SDGA 3JRGA 3GTGJ 5F0FA 5FJ8J 3GTKJ 3K7AJ 2NVTJ 1ZR2A 4LOCA 1U9OA 1JKRC 5DTDA 2ZB9A 4M6VA 5IYCJ 2DN0A 4C3HJ 2MGQA 2L7ZA 1IV6A 2O7OA 3ZQCA 2MW8A 3BTLA 5IYBJ 4M3FA 2GBYA 1DU0A 2VKVA 3W6VA 1ITYA 2LTPA 1JKPC 1WPKA 1K83J 3FK7A 3BTJA 4QSHA 3MN2A 1IG7A 3DEWA 1JJ8C 5EG0B 3GTOJ 3BR6A 1JT6A 3DCFA 3CCYA 3JRFA 5HODA 3BR1A 5J1RA 5FKLA 2G0EA 4A3GJ 3GTMJ 1OFCX 5IP7J 2CJJA 3NAUA 1E3OC 3E7LA 3BR3A 1UG2A 2HOAA 3F0CA 5GPAA 3GTLJ 2NVXJ 4A3KJ 1POGA 2L9RA 4IHWA 3QPLA 1IDYA 2HXOA 5FLVA 1U78A 3K2AA 2YU9J 2HI3A 1Z77A 1JT0A 1ETKA 5FKMA 2ELKA 1Y1VJ 1FTZA 2DA1A 3TP3A 3GBGA 1D5YA 2CRGA 5M5WJ 4IHVA 2CQQA 5M3FJ 5C3EJ 2M2EA 1Q1VA 1BA5A 2XRLA 4XRSA 4IHYA 1RR7A 3OSGA 5EEAA 1MSFC 2MSYA 1G2HA 2LK2A 1ORKA 4A3FJ 1MBFA 1JJ6C 4C3JJ 5EG0A 1MBGA 3GTQJ 3HDDA 3TW6A 1U8BA 4IHXA 2H8RA 5F0HA 2JWTA 3HOXJ 3VPRA 2EBIA 2NS7A 3S1NJ 1AHDP 2Y31A 1BW5A 2DMUA 2Y0SN 3JRIA 1IGNA 3BR2A 1RPWA 1TWAJ 4CYCB 4C2MJ 3JREA 2DA2A 3S2DJ 3FKIJ 3BTIA 2JK3A 2H1KA 3IH4A 3NARA 2LY9A 5FLMJ 3LSRA 4GFBA 2N8GA 1XS9A
chains in the Genus database with same CATH superfamily
2QSFX 1D0YA 4ZYGA 4YIIA 5TGTA 3CLOA 5J4YA 5ICEA 1IN5A 3PM1A 1MD0A 3G2BA 3PQJA 1GV2A 3KZIC 4UV8A 4ZYAA 4OU0A 2W25A 2HYFA 2Q2EA 1BIBA 1MNEA 2STTA 1JHHA 2M0CA 2M4KA 2HOSA 2BVMA 3TMOA 1ZREA 3K1NA 3OYAA 2O8KA 1S7OA 1Y8QB 3HM5A 2Y75A 4A2UA 3SZTA 5CVVA 3RQIA 1DGRM 2M87A 2KHMA 2OQRA 3H0GJ 4BE0A 4KIGA 1CQTA 4BHCA 3ECOA 2ZJ2A 1VTNC 2ACJA 1ETQA 3CUQB 3C2BA 2FNPA 2IGOA 3IV5A 2GXAA 3U1KA 3LAJA 1FYMA 2IEKA 2V1NA 1TLHB 2BHYA 3Q3SA 4KMFA 2LKSA 2QUFA 2V6CA 1UAAA 3WE3A 2O3FA 1TTYA 1WFXA 3H3ZA 4F7ZA 1BJAA 3S3NA 2LG4A 4JK1X 1O7FA 1X2MA 2DMTA 2GOXB 1Y1WJ 2HVRA 3K4JA 4LLGF 5JI6A 2A07F 1IN6A 4L9VA 3HOZJ 4RAGA 3ZCOA 1TWFJ 1XMKA 4KJZA 2JZYA 2QM3A 3M7GA 1XGNA 2W85A 5JHUA 1K6YA 1TWCJ 4RGUA 4M9XA 3OS1A 1ACIA 3I4NJ 1WWXA 3CCRI 3CCLI 4LIVA 4NUBA 1UFMA 2PJRA 3F6OA 4XLHA 2GM4A 2R5ZB 2JPCA 3NRVA 5FGMA 5F04A 4E7HA 1V4RA 4KISA 2ZXIA 3WHBA 2DFHA 2G7UA 3NQOA 1PP8F 3F3XA 5LEKA 3DKWA 2HKXA 2KKOA 3W2WA 3CMMA 2ELHA 1D8KA 1U5TC 3ZRGA 5J1YA 2JT1A 3TKYA 4ON0A 2LR8A 4PGHA 1OYYA 1VZ0A 3QPTA 2DXIA 2WB1A 1UHSA 2JUGA 2ZMEB 3M3YJ 3ZMZA 2V1DA 3KYLA 3ZQ7A 5C4XJ 2NS0A 1TL8A 4YFKF 1V5EA 3S2WA 3DLLF 2DOFA 2DMNA 1K6OA 3BDDA 3RZOJ 3I56I 2HNHA 2LF8A 2EPFA 2CU7A 1JUPA 4CYCA 3BJ6A 3QOPA 3K0LA 4R1HA 4GRIA 1I1SA 3BOQA 5B1AH 1E0EA 1V54H 2X6WA 2W00A 2R7ZJ 4FHTA 3NWSA 4X6AJ 2H09A 4NC6A 4IEJA 2O6GE 1LNWA 2VXZA 4V2GA 2K85A 3N97A 5DYMA 5TJJA 1R9TJ 3P9KA 2ETHA 4XONA 3EUKL 2BY3A 3KLNA 2R5YB 1YX3A 1T0FC 2VQGA 2W4SA 3H9JA 3K70D 2XF5A 1R1VA 2L7KA 4ZTFA 3R0AA 4UB6C 1DQUA 4HDVA 1ZR4A 2VKEA 2WA0A 4UB8C 4B1RA 1BI2A 2AXTC 3DKYA 4B3AA 1SANA 1LUJB 3OOPA 2YUSA 5FLXZ 2RREA 1R22A 3AAFA 2A5YB 2ECBA 1HLVA 3ABMH 2NRAC 2Y48A 3WGGA 1FP1D 3F8MA 4XLAA 1F36A 5E3NA 2EFQA 3IKVA 4L9TA 3CC4I 2BOLA 2RC4A 4E7KA 4Y17A 4S05A 3K4LA 1HW1A 4HAMA 1L3LA 2V1UA 4P55A 3WHCA 4B3XA 3PSIA 4O5VA 1H0MA 2KJCA 3KEQA 2NNYA 3O8GA 1QBJA 2KP6A 3DV8A 3L9FA 2HQAA 4HRIA 1S7AA 4DYRA 4YEJA 2IT0A 1OCCH 1U3EM 3AG4H 2X1CA 3HSFA 1Y39A 4Z6YA 3HRMA 4EJVA 2WBMA 2W82A 4I99C 3DEUA 5BQTA 1FYKA 1VQLI 1JXSA 4X1EA 4ZDOA 4CCLA 2DMPA 3GEZA 1EH6A 5L3GA 5K7ZA 1D1CA 3LSMA 1XCVA 2L0KA 1MMNA 3FXOA 3WTZA 3G3ZA 2ZNZA 2CQ7A 4G7HF 4EGZA 3HOVJ 4O3MA 3MKLA 5M3MJ 1YLFA 2OPTA 4DZPA 4A3IJ 4MTDA 3BR5A 3IAM2 2DA6A 4GYIA 2HR3A 2HTSA 2HQNA 1S5LC 4HDUA 2XB0X 4NQWB 1M1EB 1XC5A 4MNUA 4ZYDA 3IL2A 4FE4A 2MYSA 5K7FA 4I76A 1RESA 4YG2F 1OR7A 2VOPA 4LD5A 1KQ9A 4RM2A 2Y0SA 4W97A 1ZRCA 2K7LA 4WF2A 3PFYA 3K4NA 4G6DA 3OYKA 3DP7A 2CV2A 2FXAA 3IH3A 2KISA 5J3LA 2OD5A 1SEUA 5EYRA 3ABUA 3LSGA 4CO8A 3BLYA 5GAGJ 4GCVA 4CZZA 2CW7A 4FCYA 3TEDA 2VPRA 4BNCA 2V1XA 2YX7A 3CO6C 3P7NA 4HX8A 3RYPA 3QPHA 4A3CJ 1MDMB 3C18A 3WU2C 2FNAA 2BW3A 1LFUP 3SHFA 2XF6A 2XRNA 2LLKA 1EH8A 1JE8A 2XROA 1VI0A 1G3YA 3J80Z 1P7IA 2CFOA 1EH7A 3JSOA 2OTJI 3R60A 4L5JA 2P4WA 2E1OA 3H5NA 1S6LA 3FM5A 2W7NA 3IP4B 1LFPA 5HVQC 3CO7C 2MH2A 4HNVA 5EGOB 2CW0F 1XX5A 2HFHA 2IVMA 4GXOA 2YR2A 3VWBA 2IRFG 2KIFA 2DDBA 2P5VA 2VQHA 2IW5A 2IS2A 2F5EA 2ISYA 3KPHA 3HBLA 2M8GX 3CC2I 4NDLA 1K78A 3DEEA 1ZLJA 4M3BA 3PO3J 1Y0UA 1IZ1A 2BVLA 1S29A 4XLCA 3R0JA 3COAC 2DO7A 4D7MA 5CLSA 4BGDA 3HOYJ 3WU0A 1FOYA 2R0QC 1CGPA 2VQCA 1Z0XA 2WY8Q 3BG6A 4HLXA 3ZMTA 3PNVA 1G3SA 4UUSA 2CGPA 4A3JJ 1I6HJ 1R5ID 2DCEA 5C4JJ 4EJWA 5D5WB 2E2JJ 1Q1HA 2GLOA 2EZHA 2BW3B 5M5YJ 1Y8RB 4OAYA 1OCPA 2VXDA 4UUSB 3J81Z 2MABA 4CSWA 5GTHC 1G3TA 5DD8A 2MFZA 3S15J 1D1AA 3E5UA 1ODDA 1JGGA 2B7EA 3S3MA 2RAEA 3KYCB 4B48A 2IA0A 5D4SA 4A3LJ 4DQ2A 1YITI 1BR4A 2EJRA 1BOAA 2HQ5A 1SFOJ 1FEXA 3BY6A 5EZGA 4G8XA 4IZZA 3H0DA 3V42A 2QSGX 1WH7A 2GIVA 3CMAI 1GXPA 5EDNA 4XICA 2P6SA 4G6QA 2W48A 2UXNA 3WTSC 3DPUA 2FF4A 3FXKA 3V8KA 2DPUA 5JVTA 3LL7A 3SFIA 4ZJZA 2LBFA 4WXDA 5F0FA 1GLNA 2LNBA 1GVJA 2PG4A 2UUZA 1HBXG 1ZR2A 3W6KB 5DTDA 3RYRA 3HPHA 1I5ZA 2DN0A 4C3HJ 4RMNA 4CZCA 2F6CA 1VQ6I 2A69F 3TO6A 1FSEA 2L7ZA 3T5XA 3M8EA 2ZSHB 3ECHA 1KU2A 3F8NA 1X3UA 4PSXA 2VKVA 4AIJA 4HNTA 2ZC2A 1WPKA 3GLLA 2VJ4A 4O6JA 4PFPA 4MEXF 1B4AA 4AM3A 1QHHD 3BR6A 1JT6A 2KFDA 1LJ9A 2IGNA 1A6QA 3PUFA 4D0PA 3EYIA 4L9NA 5FKLA 4ZH4F 3D5RC 1WJCA 1QPMA 3TL4X 3R61A 1OFCX 2F2EA 2F5DA 4G7OF 5IP7J 1E3OC 3NAUA 3BR3A 5ILSA 1RI7A 5L3FA 1UG2A 2LREA 4PGGA 5GPAA 4EM2A 2COMA 3H36A 4A3KJ 1H9GA 2GIZA 1SFXA 4IHWA 3QAHA 2BZTA 1IDYA 3PFIA 5FLVA 3K2AA 1UHMA 5FKMA 5LHGA 3CCMI 3GZNB 1FTZA 1E3PA 4OAZA 3CDIA 1RUNA 1D5YA 2FA5A 2H6CA 2CRGA 3DXJF 4P9UA 2CQQA 2VBWA 1R71A 2DDAA 3NWTA 1R36A 1YX5A 3EDPA 5B66C 2E1CA 2ZJPF 1WJFA 5H20A 5CVJA 2L3DA 4U88A 3Q9VA 3JAMZ 3HOTA 1MSFC 2MSYA 1FNNA 2DBBA 2HDWA 3FXUA 1ORKA 5BPDA 1IV8A 1MBGA 1X1CA 3LA3A 3GTQJ 2WAFA 3K70C 2CQNA 2KMUA 3HXLA 3TW6A 4N9IA 3WU1B 1BR2A 2NYXA 3OIPA 3BJOA 2H8RA 1DPUA 1FYLA 3ABLH 2IJLA 4KT5C 3T1BA 5L3EA 3VPRA 2EBIA 3BG7A 5F1RA 5HDNA 5HLHA 2XC7A 3ZP5A 6PAXA 1I39A 5CQEA 1BW5A 3SEZA 2Y0SN 3C1DA 1MZBA 3T8TA 2R7QA 3BR2A 4CYCB 3DQVC 4XMYA 3FKIJ 3BTIA 2JK3A 3SQNA 3IH4A 3CJTB 4N9HA 2N8GA 3MFKA 4IJAA 3OL4A 1SD4A 4HSTA 1QZEA 2YU3A 3IRQA 1VF9A 2L01A 2C6YA 2H8WA 1SD6A 4P9FA 4ESBA 4J01A 1O4XA 1QHGA 3PJRA 4QIWN 2X0LA 1WVRA 3OYEA 3HL2A 3W2AA 2PMZN 2DJNA 1Z3YA 2R5YA 1J0RA 1IRZA 5ERIA 3L2WA 1YIOA 1JTYA 3SEQA 1W5SA 1Y56A 4PDKA 1W5CC 2AXLA 2CUJA 1GVDA 2WV1A 1ENHA 1GUUA 3BZCA 1P7JA 1R4MB 5E1WA 4IO9F 3KETA 1SVLA 2ID3A 5FD5A 1U5TA 2HEOA 1HOMA 1IXSB 3CP8A 5DEQA 1BOBA 1YO5C 2X9DA 2F5FA 1XSVA 3MAJA 2BXZA 1YOVB 4B8XA 5KNLA 4EEFG 4Y7NJ 4XORA 2YS9A 2VB6A 1MBHA 2FSWA 1V5GA 4HV5A 2EWNA 1KZHA 1S9HA 3E6DA 4BQAA 4C3IJ 2BV6A 1X2NA 1VQ7I 4EGYA 1KGSA 2V6EA 1FX7A 2D1HA 5F08A 3G1OA 3E3VA 5J4VA 2VQLA 4L5IA 3E1SA 2IBDA 2L4MA 2V26A 5EF6A 2JA5J 5HS8A 4A3EJ 2NVYJ 2QGUA 1IDZA 2KT0A 2OZ6A 2R7OA 2VONA 2WAQA 1T8IA 2P8TA 2QF7A 5LRRA 4KICA 4HNUA 4EM1A 3RTRA 3K10A 5A2QK 3TOAA 3MWMA 2CS3A 3BCBA 3HKZN 1LKXA 3D5SC 1QRYA 2IS4A 3CP2A 2JRTA 3WGHA 3OOUA 4PSWA 1GV5A 4QWQA 2R7XA 3FIWA 2DPDA 4DZJA 1R1TA 2DOEA 1TZLA 4DNCA 4LK0F 4CXFA 2HDCA 1I3QJ 3M9AA 2QQBA 1EKEA 4ENNA 3DKXA 4E7IA 1FIPA 4IOCF 2XIGA 1B72A 4M9SA 4ENMA 3FKJA 4A3MJ 2R7DA 3BR0A 2UV1A 1R1UA 2DFFA 3LFKA 4XRMA 4XOPA 1WJBA 2VASA 1HKQA 3C7JA 4BXXJ 3JRHA 1KU7A 4ENJA 1ZG3A 2W1OA 2LD5A 3ZR8X 3A4CA 4WX9A 1T56A 1QZYA 2DW4A 4L9JA 5AIPA 2OV7A 1GDTA 1REPC 4OIPF 4LK1F 4DGWB 2VBYA 3DBLB 2X6OA 1CF7A 1TBXA 3C2GA 3Q0VA 1ZYRF 1T33A 5ILVA 3QYFA 1H89C 2RN7A 2DA3A 4G6TB 5D8KB 1MBJA 1X4PA 2M3AA 3MCZA 2Z16A 4IPAA 4HSRA 4N0BA 1W0UA 3H92A 1CF7B 5K5OA 4BE1A 2I5UA 2YPRA 4RAZA 4BY7J 3CCEI 1J7KA 2KRCA 1OKRA 3ZOBA 4ZYEA 4GYGA 1S7EA 1ZAOA 4IF4A 5DCFA 4IHTA 2PN6A 1HSTA 2M8EA 1FPQA 1U0JA 2QWWA 1KQ8A 1UB9A 3E6BA 1Z7LA 2FJ1A 5DCMB 3F21A 5EJCA 3L7WA 2A68F 3BC8A 4BJ6C 3RKXA 4KA4A 4BACA 2Y9ZA 3PQKA 4BJ5C 3E5QA 1D0XA 1JUMA 2DFEA 3CF2A 4OWRB 4BEHA 3WTTC 3CESA 1BIAA 2V9KA 5L3BA 4M9ZA 4KITB 4ZDLA 4U0WA 5DD4A 5E79C 1UCRA 3E6MA 3BP8A 3D1NI 2DQRA 2WV0A 1PDNC 2PBIA 2ZFWA 3OL3A 4QLCU 3CJNA 2IPQX 2OTLI 1ZARA 3DLAA 3AL0B 2EZKA 3BTCA 1OPCA 3F9KA 3DPTA 3C2HA 2HZDA 2IGKA 2X48A 3R6SA 3FF5A 2DODA 2R7FA 3M1EA 5DV5A 1G3WA 1R4NB 4PUSA 2E19A 2GZWA 3H9GA 4KIBA 4RLQA 4RB0A 2VN2A 3G1MA 3PSFA 4XK4A 1X1AA 3OYGA 4OIQF 5EZHA 1BC7C 2PQ8A 3GCMA 3B02A 2M4GA 2ZXHA 3TP0A 4NB5A 4CYDA 3FMQA 3FBIB 3HJEA 3EPZA 1F43A 4CGZA 2FBIA 4LMYA 2FQ4A 3QWLA 2AO9A 1EA3A 2MBFA 3DU5A 1I6XA 2NXNB 1P6RA 5CVUA 4DW6A 2KLOA 1YE9A 2M45A 3ISPA 3L00A 4GO1A 5LEJA 1SFUA 2JA6J 1DP3A 5KAFC 2XDVA 1H8AC 2AQEA 2MLKA 1SAXA 2GA1A 2EIJH 2W24A 2Z5UA 3KYDB 2A6HF 3RDIA 5GPCA 4XM3A 1ZGAA 3CTAA 4N4OB 2KDOA 5FKNA 1U2WA 4A0ZA 3F23A 2DLLA 3TW7A 1TC3C 4M72A 4C9YA 5D5XB 3ZQHA 4RB3C 2IS1A 5IYDJ 3FXRA 2A6TA 4B4CA 1ZQ3P 3HUGB 4LFUA 1G59A 1W5TA 4HOBA 2LFBA 3HGGA 1IW7F 2RDPA 1IRFA 4MGRA 1R7JA 2XKPA 2HVSA 1BN5A 2K27A 2Q1ZB 4XN3A 4Y13A 4UNOA 3B6AA 3OS0A 2ZBKA 4DIQA 2ZXWH 1SC7A 1EJ9A 2ELJA 5HDGA 4E4HA 4BBSJ 3QOEA 4M74A 3CZ6A 3CUOA 3L2RA 1E17A 1TNSA 1YRNA 1Z6TA 4YELA 3GTJJ 4F91B 3OYLA 2VT2A 2ZJRF 1X3ZB 1SMYF 4PJNA 1FLIA 4YIRX 5K7HA 3GFLA 1XCBA 1IN7A 4LLLA 4BJTA 1OLTA 1VQ8I 1U9NA 2EFOA 5KK1A 2HZTA 2QLZA 3KP4A 4I0BA 2B0LA 4RLFA 2KL4A 2WY7Q 5IT9Z 1K7AA 4BQNA 3MD2A 2AHQA 2AS5F 3FM3A 2IAIA 2MC3A 3ZQIA 2K9SA 3BWGA 1WJAA 1MJAA 2PI0A 2L5QA 3G1LA 4OMYA 3J7ZI 2ADUA 2H6BA 2O9LA 3DWLE 1BI3A 3FWEA 2ZO4A 1QPIA 5DCMA 2VPLA 3HGYA 1OCTC 4BH9A 3L2VA 3HSRA 5M5XJ 3VYSB 3IHUA 3F72A 1YW9A 2FRHA 2QQ8A 4LIUA 5BMZA 3KP3A 3S17J 4WK8F 2OC6A 2EZLA 4H0EA 1T95A 2GA2A 3LSKA 3OY9A 2LF7A 2R7SA 2Q2EB 3PO2J 3CCSI 2IS6A 3J81K 5DS9A 3S3OA 4JX5A 3WTVC 2CQXA 1FC3A 1MMGA 2P81A 3HB9A 4MIMA 4ANJA 3GTGJ 4A6DA 5FJ8J 3ZXSA 1Z7UA 4LOCA 4M73A 1K4SA 1T0FA 4A0XA 1T38A 2MGQA 3O3KA 2ZNYA 4XR6A 4A12A 2K3FA 5L3DA 3VB2A 2O7OA 2FMYA 3OR1C 3ZQCA 4I2OA 3L2UA 2MW8A 3I64A 4HG2A 1LVAA 2OCCH 5AIQA 2GBYA 1ITYA 2ZSIB 5J47A 2Y0MA 3AG3H 3JCUC 3V8JA 4HPQA 2H94A 2CFXA 1SFEA 4LG3A 2L9NA 2IP2A 2M30A 1XMAA 3BCAA 1JJ8C 3ML6A 5EG0B 3GTOJ 3CCYA 3C3WA 2R7VA 5HODA 2ZXJA 1D3YA 4XN0A 4AD9A 5IY5H 3H5AA 4HQEA 3W2VA 4XL9A 3GTMJ 3ABKH 2A61A 2CJJA 3E7LA 3DF8A 1A31A 4RAYA 4J00A 1F9NA 1FP2A 1PUEE 4A5NA 4HQMA 3S8PA 3JAMK 2DQLA 1POGA 3CJQB 3HTUA 5ICGA 1Z91A 4G9YA 2HXOA 4TV7A 1EV7A 4KN7X 1U78A 1MJ9A 2HI3A 3EETA 1BC8C 1DPRA 2DK5A 4XSZF 2I8DA 2XSJC 2ISZA 2DFIA 2K5CA 3GBGA 4AU7A 3AL0C 3D5LA 2M2EA 3EUHC 1HQCA 1W7PD 1BA5A 2LSOA 2LYCA 3R4KA 1HSJA 2KRHA 1FOKA 4IHYA 5DUIA 1RR7A 3HSEA 1TP4A 4KUMA 2A05A 2DJIA 4ETSA 1P4AA 1MBFA 1JJ6C 3PNYA 3GZ6A 3K1MA 2M1BA 3OYFA 2P5LC 2VKDA 4IX7A 1U6GA 2FBHA 3HOXJ 3ZPLA 2NS7A 2L9SA 4QPQA 5IT9K 4AYBA 2MD0A 2FOKA 2DMUA 3BZKA 3RKYA 1YIJI 3HRSA 1RPWA 1TWAJ 4C2MJ 2LY1A 4I01A 1NG6A 3FHZA 1P2FA 2H1KA 2Q0OA 5FLMJ 2LY9A 1I27A 3LSRA 5LD2C 4GFBA 1XS9A 2LVSA 5FRNA 1E2XA 2CG4A 3VYRB 3S14J 4E70A 1P4XA 4S04A 1F4KA 4L0ZB 3IKTA 5FKKA 1MMDA 4OMZA 2G7HA 1U8RA 2Q8KA 2O03A 1W0TA 3HC7A 2OAZA 2FX0A 1PJRA 2YSRA 4UUTA 1BJZA 5KVRA 1PUFB 1R6RA 2ME6A 1F5TA 1J59A 1IXCA 5LGTA 5E3MA 3I54A 2O5RA 3VEPA 4P1WA 1RKTA 1F1ZA 3U21A 1PUFA 4II2A 1ZHFA 1FBSA 3TO7A 4IOAF 4OOIA 2BY0A 1MW7A 4M3DA 1LPQA 1AOYA 5J8CA 3H5RA 1XGOA 4XOTA 3JR9A 4Z2YA 3F22A 2TCTA 3GFMA 2DAOA 2X6YA 4B09A 2DT6A 1YFHA 1FY7A 1ZKGA 2DMQA 1YS7A 2O8XA 3LSJA 4G12A 4C30A 4FT8A 1G8XA 1T6SA 5CKTA 3FMSA 1LDJA 4FX0A 4CH7A 4KYWA 5F6FA 1B9MA 4RB2C 4UXNA 4V2FA 1V5FA 2M9HA 2VC0A 5IP9J 4EJUA 1FZPB 3HOWJ 1J75A 4FISA 1YS6A 1ZRFA 1N25A 5FD6A 3FZVA 1VQ4I 1HCRA 4HV6A 2MA3A 5E3OA 3TQNA 4Y4RA 3S1RJ 4XKBA 5D5UB 1WKMA 3DU6A 1RC9A 4I0AA 1Z21A 3ESWB 3KLOA 3V4GA 4UVCA 2KIMA 5CQGA 1B59A 4IRHA 4PJMA 4GGGA 3BG5A 2OQGA 3QU3A 4C2TA 3IH2A 3MEXA 2E60A 1X1BA 4WXHA 1TT5B 3JTHA 2EILH 1RKWA 3K1PA 3V8LA 2VIXA 4PZJA 1X1PA 1ZRDA 1K61A 4D7NA 3QYBA 1BW6A 3IWZA 3L09A 3WGIA 2E7XA 4PJLA 4BY1J 5B5EC 2KIUA 1MH3A 3LA7A 3HRTA 2VI6A 1YJ9I 1ETYA 2QKLB 4DJAA 4IXAA 4BQQA 3OV8A 3JRBA 3I55I 3A01B 4D5CA 3HEFA 1ZH5A 2FD5A 2QQ9A 2WTEA 5LBQA 1K78B 3ELKA 3FBNB 1O3SA 1BL0A 2EH3A 3RSNA 3OYCA 4BXUA 1XMXA 2XSDC 2ICWG 3O6BB 1YTYA 1L0OC 1ZGJA 4FASD 4XKWA 3IUOA 4U7DA 1W36D 3L2QA 4R8HA 5HDKA 5IPAA 4E7SA 1WJDA 3H1CA 5J8FA 4DOZA 1VQNI 4BBRJ 1B6AA 3OR2C 4WWCA 1WJEA 4EJTA 1IF1A 2P7VB 1AA7A 2EK5A 2XAGA 4IVNA 3OYIA 5DM7F 5BNGA 4MEYF 2LRDA 2M0MA 2DT5A 3E97A 2LP0A 4NC7A 2LBFB 4BS9A 2UWMA 4II3A 1WCMJ 3DTIA 4QPOA 1FBQA 3RIRA 1MIJA 2Z1DA 2HXIA 3GW2A 5ED4A 5JVGF 1WJ5A 3FXQA 2HKOA 4BDZA 4DBRA 1MDMA 5DDGA 2E7WA 1O3QA 1IUFA 1GT0C 2M34A 3M8JA 3GYHX 3S1MJ 1QO0D 2HDDA 5F64A 3GXOA 3M07A 1X1DA 4CHUA 1MJBA 3O8HA 2XB5A 4A3BJ 2E1MB 3K4MA 1V55H 2BE5F 3PNTA 4MFEA 1HDDC 1BM9A 3BPXA 1T08B 1XSDA 1MNMC 3U1DA 1SD5A 2GOMA 5CPRB 5B1BH 5HS7A 4I6ZA 2F4OB 3IRRA 1Y0NA 3V7CA 2OUMA 3HOUJ 5DUKA 2LC2A 1LVKA 4UVBA 2K9LA 4IL6C 1J5YA 2Z3YA 2XPUA 2E2HJ 2JUCA 2JA7J 1VQMI 3GLXA 2CQKA 4A5MA 2DTZA 2XVCA 4XSXF 4JBAA 3MKYB 3A02A 4HEA2 1S3JA 4RS8A 2VC1A 5JLXA 3OYNA 5FROA 2L4AA 4PJ0C 3A1YA 1NH3A 4M71A 1NTCA 4Q5SF 2TRTA 2CSOA 2MLGA 3SDBA 3HHHA 4EJOA 1IXRC 5IOYA 3BG3A 4JP0A 3L1PA 2PJPA 1ONVA 1YQAA 1VFCA 4CUGA 3GMEA 2RQPA 5EEGA 3TDZC 2I10A 3CF5F 4L18B 2F48A 1FWZA 3HPGA 3LSPA 4CCNA 2RV8A 1EF4A 4LG0A 1R00A 3J7YJ 3RJPA 3PL8A 5E3LA 1XPXA 1JHFA 5FB2A 4CDGA 4PFOA 4OIRF 3ERED 1NG7A 2KZGA 3KP5A 2EB7A 3T0YA 3GTPJ 1UG0A 3I59B 1FBUA 3Q5FA 4E6KG 1DUXC 3E5XA 4AC0A 2NVUB 3DFGA 2HYJA 1QVUA 3ZN0A 2OU2A 3K9TA 2R3SA 3LSHA 1HDPA 3DTKA 4XKVA 3V7RA 4Y52J 1OJLA 3BT9A 2HS5A 3E0JB 4BQOA 1QQIA 2CW8A 3I71A 3QRFF 1HF0A 4DYQA 3B73A 1G4DA 2M7BA 2LKPA 1OCOH 3ULQB 3KCCA 5ICFA 4XLPF 4HLYA 2EFNA 2NAZA 3M8FA 3I4PA 1FSHA 2BY2A 1UMQA 4IQJA 2V4JC 5J40A 4ZZDA 2QKMB 4I02A 5JHFA 2QA4I 4AIDA 3A01A 2Z2SB 1IAWA 2L02A 2VE9A 2PFBA 1VQ9I 3RPUA 1STZA 2R5ZA 3I4MJ 1IO2A 3RPQA 3CDLA 4Q47A 5HLTA 4LG0B 1APLC 4KFCA 4LLNA 2QVOA 5J1UA 4ESJA 2DI3A 3JRDA 2XGDA 2E34A 1WHUA 4I7HA 4ZTJA 1H9TA 3A03A 4M6YA 3BJAA 2CO5A 2GAUA 3AG1H 2EIKH 4KDPA 1WQ2A 1TQPA 1IJWC 3EQLF 1R58A 3I3LA 2LKXA 1XDSA 1ZK8A 1UELB 4F55A 5HNFA 4OINF 1Z67A 2ZFUA 1NHAA 3FXJA 2VLAA 5K5RA 4ESFA 2E1NA 1I3AA 4UV9A 3JSPA 3WG9A 3MKWB 2WAEA 1X58A 2EV0A 2JA8J 2JTVA 1YG2A 2ME0A 3Q9SA 4U0VA 2P0WA 4RGSA 1FIAA 2CYYA 3T8RA 1FOXA 2D5VA 1OISA 4MLOA 1YRNB 4JX6A 4ZZLA 2JVGA 2JA2A 2OBPA 5JR3A 3HKZA 3JW4A 2K3PA 3G71I 1KONA 2M7AA 2K4BA 2UZKA 2EIMH 2XASA 4FTHA 3QP6A 3TBIA 3H9QA 1KYWA 2EZIA 2JN6A 2P7CB 1X3WB 3WTUC 3OYBA 2LY2A 4N4NB 5HS9A 3LSTA 2WAQN 1H88C 3U9GA 3OYDA 4BEHB 3P9IA 2CUFA 5LGNA 4EM0B 2V79A 5HNHA 2OCEA 3LSIA 3CDHA 3K4KA 4MFDA 2BXYA 2EA4A 4R79A 3HG9A 2EQRA 3K69A 1UHWA 2TDXA 3ZMVA 2WWYA 2DOAA 2RQQA 3UR3C 2E35A 5IP6A 4RM3A 4NHJA 4ASNA 1ETOA 4BXFA 1DU6A 1FMVA 3MVPA 1VNDA 3H35A 3VFZA 4BYYA 1UZCA 4YFNF 1A36A 3SDGA 3JRGA 3WG7H 4ZC3A 4V19K 3GTKJ 1HKTA 2HTJA 1TQIA 1S8NA 4Y33A 2JQ7A 1JKRC 2XGXA 2ZB9A 2XUBA 3ZQQA 4G94A 4M6VA 1JI8A 3VYTB 4F52A 2GXBA 3WTWC 1IRGA 1IV6A 1HW5A 4RAFA 5D8LB 1YI2I 2IGMA 1TNTA 2A6EF 4KIFA 5E8GA 1MMAA 1SMTA 1Z05A 2CUZA 1DU0A 3W6VA 2Z99A 2LTPA 3A0BC 5CYVA 1USSA 1K83J 3IWFA 3BTJA 4NNJA 4QSHA 3SXYA 3TDUC 2CMPA 2NNNA 1HXDA 1J9IA 1IG7A 1O7LA 2E1MC 3DEWA 3IAS2 2VT3A 3M1CA 4XRFA 3OWTA 1OMIA 1KA8A 2CH0A 3VYUB 5GAEJ 5J1RA 1FOWA 4HA8A 1T39A 4A3GJ 2K02A 1P92A 1WZ2A 4BUPA 2A3SA 4MQVA 1TT0A 4BHPA 3I59A 2NVXJ 1LDKB 4XKCA 1J09A 4B44A 2NOJB 2L9RA 2IA1A 2BYVE 2YU9J 1Z77A 2PJRB 4CCJA 4YIFA 1QA6A 3J80K 4HW0A 2HGCA 3SZPA 3TP3A 2X1EA 1TW2A 2QZ8A 2X51A 5M3FJ 2BGCA 2XRLA 5GTIC 4XRSA 1LB2A 4ZYHA 4F93B 2JSCA 2QYOA 3GWZA 2R7WA 2LK2A 4CICA 3ASOH 4JQFA 2ESNA 1XN7A 4C3JJ 5E20A 5EG0A 4PJJA 3WTYC 4Y15A 1HW2A 1USTA 4IHXA 1U8BA 1KU3A 3KEOA 5H2FC 1VQKI 2LDUA 2LMDA 4K2EA 5LGUA 2P6TA 2PX9A 4BU2A 1AHDP 2Y31A 3K4BA 3GFIA 3L2CA 3JRIA 2VJJA 3ABTA 3GFJA 4WCGA 3JREA 2FE3A 4F92B 1D1BA 2WC2A 3S2DJ 1O3TA 5KAIC 2DT7B 1W1WE 4MHGA 1OQYA 2NVQJ 4B43A 4EMSA 5B3SH 1IUYA 2L7FP 2RKHA 2KQRA 5LRSA 3FX3A 3TGNA 2FOWA 3CUQC 3KE2A 3VSKA 4UY8I 3X2QH 2IXSA 5H6RA 3TO9A 3U2RA 5ILUA 2F4MB 5FFZA 2DTRA 2XAUA 1W7PB 2VOOA 2R93J 2R7TA 3OYMA 2E5ZA 3PIOF 1AWCA 2RVCA 1YHQI 3S2HJ 4M6XA 5D5VB 2VODA 3OSFA 1N75A 2K9MA 3BZ6A 2QBYA 1LDDA 2Z9OA 5F1JA 3S16J 4D1QA 3WTXC 4IRIA 2MG4A 1ERDA 4IQ4A 2H1LA 3JRCA 1XB4A 2DA7A 3F6VA 1MBEA 2E2IJ 2VUMJ 2Y9YA 2ZJQF 5F0CA 2VL8A 5GAHJ 4PK4A 3P9CA 1N78A 3UKGA 1MSEC 1WGXA 2X85A 2A5WA 3AFHA 3ZMSA 1B1BA 3LWFA 3O2PE 1T98A 4NC8A 3LOCA 1AU7A 3MMYB 2EFWA 2K9NA 2HQRA 3EYYA 2R4GA 5GP9A 1RRJA 2UXXA 3FXMA 1PYVA 1Z3XA 3LQQA 2YX4A 1AKHA 4JX4A 5D4RA 3FHNA 5BPIA 1X4OA 2XAFA 2OJED 2BHZA 5AONA 1IRXA 1OCRH 2KPMA 1A35A 5FKOA 5F27A 3VOEA 2EV5A 4HX4A 2OF7A 3OS2A 5E1ZB 1ZG1A 5IT3A 1A6IA 2BBYA 4HBLA 4C2UA 4YFXF 2XHKA 4FE7A 3UNGC 4RB1A 2QCOA 2Y2ZA 2PLYA 4A3DJ 4CCOA 4E7ZA 2K86A 4H4KC 5IOZA 1MH4A 3CMEI 2NOGA 1BI0A 1LE8A 3HUGA 2AQFA 3HIFA 4BHBA 2OA4A 3SFZA 3KZZA 3B6CA 1SD7A 2QSHX 3GO5A 1IC8A 4A93J 3Q0UA 3JRAA 3HRUA 2XPVA 1NK3P 2VKHA 1SVOA 2DA4A 1FJLA 3ZQGA 1BBYA 2JMWA 3I58A 5LLQA 2GXGA 5E18F 3JTGA 2FU4A 3K4CA 1C0WA 5DM6F 1LEAA 5CJ9A 3A2KA 2WB1N 3CMYA 2VE8A 1ETVA 4IKFA 2HVQA 3H3UA 3NEUA 3G73A 4P96A 1ZELA 5E8IA 3D0SA 1G6NA 1BI1A 2RNGA 4EQQA 2EV6A 3CCJI 1YJNI 1K4TA 1ULYA 3W6JB 4G7ZF 1MBKA 1JKQC 2L54A 4AWXB 1VQ5I 1A04A 1YYVA 2COBA 4HZFA 1RUOA 1OR7C 3DTEA 4MO7A 2IA2A 3GX4X 2HU9A 4Q4ZF 5LHHA 3MKZA 5K1YA 4LJZF 1B8IA 4AVZA 2V9PA 5C44J 4M3GA 2F5VA 3TOBA 4KN4X 5H6QA 1MNDA 5K5QA 1VQOI 4L0YB 2CV1A 2M5WA 3ZQFA 2L7MP 2ECCA 2ZMEA 2H27A 5EEHA 2X1DA 1B72B 1HC8A 3I9V2 5ICCA 1A5JA 4S0HB 4JYKA 5E1XA 3LQRA 4XNFA 1JTXA 1FTTA 3RPUD 3CCVI 2V7FA 1ZLKA 2B63J 9ANTA 1RR8C 2KIQA 2R7UA 2W84A 3BQYA 3BQZA 3M4OJ 3KIOA 1YW8A 4KNYA 4AUXA 4BL0B 1LE8B 1FMWA 4CA0A 2R7RA 2BEOA 3PIPF 1D0ZA 1Z9CA 1XGSA 3I53A 1VQPI 3F8BA 4B47A 2X4HA 1ZGWA 1ON2A 4ABZA 3LAPA 5FO5A 4L5EA 5FLXK 2K40A 1Z1DA 2FMLA 4FQGA 3QODA 1ZG5A 3MQ0A 3HTSB 4I98B 3CQZJ 2B9SA 2QBYB 3GVAA 1HKSA 3FXLA 3LNQA 4J19A 4HF0A 1BR1A 4A69C 1KU9A 1ZTRA 2F4IA 3FMRA 2PEXA 1RNLA 1W7PA 3QU6A 3RCOA 2JSPA 1B9NA 1I50J 5CVRA 4XQFA 3SJMA 4XRSG 2GWRA 1QVTA 1MMSA 2CV0A 4M3EA 2R92J 2GQQA 2D45A 3ROUA 5KHDA 4F3QA 1XG1A 5TISC 2QEXI 1XTAA 5EGOA 5A2QZ 4HF2A 2NS8A 2VBZA 2VJIA 1SAUA 1JUSA 3OMYA 5LHIA 3CCUI 1RETA 1SVMA 2P5KA 4NQWA 4BAYA 4A6EA 4BKXA 2EA2A 4EVIA 2CWEA 2JJ7A 2FEZA 3E6CC 4EATA 2KDZA 2LH9A 3GF2A 3ZMUA 3BG9A 3RKWA 4MQ9F 3RQ4A 3RKQA 4XLNF 1GHCA 3DBRB 4DBQA 5BS6A 1QU3A 1OCZH 3F8FA 1TWGJ 4XBFA 1TWHJ 2CUEA 2JVHA 1RZ4A 2EFPA 2ZMEC 3KX2A 3FISA 3VDXA 3CC7I 1K79A 1KYZA 1ON1A 3V7SA 2L9VA 2HYGD 1FT9A 2MH9A 5D6EA 1RIOH 3HOSA 2HWVA 3ZN1A 3KEYA 4HX7A 1JKOC 4W1UA 4XIDA 3HHGA 1WI3A 5TRDA 2EINH 2OZUA 2ID6A 2Y30A 2DA5A 3ASNH 4ENKA 2Z33A 2L2OA 3SYTA 1XGMA 3ZQLA 4AIHA 1ETXA 2WADA 4CCKA 1V3FA 3OIOA 4AIKA 1AKHB 4BE2A 1IN4A 1WH5A 4FETA 4D5FA 3H3VK 1QGPA 5GADJ 1ETWA 1S72I 2PMHA 3ZGKA 4A0YA 2HPIA 1NK2P 2XGEA 2DYRH 3I5UA 2HOEA 2E71A 4U87A 2QENA 1JGSA 4DYCA 2G9WA 1O3RA 4HF1A 1ZN2A 4OIOF 2X6XA 3WODF 3RZDJ 1XDUA 3N05A 4AYBN 3OYJA 4U7BA 2HPMA 1TQMA 3S32A 4E7LA 5FFXA 5FRMA 2XV4S 3REOA 2Y69H 1LQ1A 4RBOA 2HOTA 4XLEA 3QQAA 5HOOA 1R49A 4D9JA 1LFBA 3OYHA 1D8JA 1SFKA 3DBHB 3LA2A 5HLIA 3G6EI 1U5TB 4RDUA 3S1QJ 2XPWA 3K6GA 4QTRA 2E36A 2J5OA 3QYEA 4HYEA 4IHSA 4I09A 3MZ8A 3Q0WA 3P5JA 2JPBA 3ERMA 3QPSA 3HYIA 4Y3OA 1WRJA 3BROA 4AVPA 3VSLA 2K9QA 1Y6IA 1WSUA 2ESHA 2XGCA 5JLWA 3OIQA 2FBKA 4MTEA 4XLFA 2XAJA 3K2ZA 1B8IB 1YJWI 2J5PA 5E17F 1P4WA 1UJ8A 2BY1A 3AG2H 3FK6A 4PCQA 2STWA 3DPLC 3J7AY 3BPVA 2K4JA 3PUBA 4KMUX 5KCMA 3K7AJ 2NVTJ 3KP6A 2KJBA 1U9OA 1WI9A 3WE2A 2JRMA 4LGWA 3ZMDA 1W36C 5IYCJ 3GZ5A 4RGXA 5HLGA 1OYIA 3KZYA 4FX4A 4E7JA 2V9VA 2XAHA 3I0TA 4YRVA 3CCQI 3J7AO 4LB5A 2FQ3A 1J2XA 3BTLA 1O57A 1OYWA 5IYBJ 4M3FA 1DDNA 3A0HC 4NBQA 5LFAA 3HZJA 1KQ0A 1JKPC 2PMZA 3FK7A 3AKZA 3FDYA 3CD6I 2W57A 2E5NA 1XSXA 3G4SI 1XD7A 3MN2A 2DU9A 5L3CA 4KT6A 4P5OA 2DYSH 2XKOA 4ZDPA 3GUDA 3IC7A 2F5CA 3DCFA 3KFWX 1Z6RA 2KRFA 3JRFA 3BR1A 2G0EA 2RNJA 4LB6B 3MZYA 2XAQA 1YW7A 3SZGA 4BDYA 3F0CA 2DK8A 2HOAA 3GTLJ 1MGTA 3CJRB 2PMUA 3F8CA 1R23A 4RGRA 3KP7A 1DGWY 1GXQA 3EUHA 3VODA 3QPLA 1QNTA 1IN8A 2FUG2 1TW3A 3LFUA 4UVAA 1ETKA 1JT0A 2ELKA 1Y1VJ 4GDFA 2DA1A 3CUQA 2VJ5A 4U0YA 4JOMA 2MC4A 5BOXA 2MD5A 5M5WJ 4IHVA 3QP5A 1PVEA 3S93A 5C3EJ 1Q1VA 5CVIA 1PP7U 2VBXA 2QQAA 2KZVA 4IRGA 5D6FA 4UHTA 3OSGA 4ITVA 5J6XA 4WXCA 5EEAA 3CLQA 5JFRA 3RI4A 2XF7A 1R5HA 4X0GA 1LEBA 3W3CA 1G2HA 1MKMA 1W4MA 2ZCWA 4A3FJ 2ZKZA 3KP2A 3HDDA 2O61A 3N4MA 1P9QC 4EV0A 1DP7P 1N77A 5F0HA 1T2KA 2LOOA 1X19A 2JWTA 4CCMA 1R5GA 1QZZA 4RA2A 3S1NJ 2D2WA 1HA8A 1IGNA 3EUAA 3ONQA 1I1GA 3LMMA 2DA2A 1E3HA 2O0YA 4Q48A 2RGVA 3MZHA 3NARA 4LITA 4UUVA 1D5VA 2D1VA
chains in the Genus database with same CATH topology
2LVSA 2NVQJ 3S14J 1VF9A 5FKKA 2L7FP 3PM1A 1GV2A 1O4XA 1W0TA 4QIWN 2FX0A 4UUTA 1BJZA 1PUFB 2R93J 2M0CA 2PMZN 2DJNA 2ME6A 3S2HJ 2HOSA 2R5YA 1IRZA 5E3MA 3OSFA 2O8KA 1JTYA 1RKTA 3HM5A 1PUFA 3RQIA 3H0GJ 5F1JA 1GVDA 3S16J 2WV1A 1CQTA 1ENHA 1GUUA 4M3DA 1P7JA 2MG4A 1ETQA 3JR9A 3JRCA 2DA7A 2ID3A 1MBEA 3C2BA 2TCTA 2Y9YA 2E2IJ 3IV5A 5F0CA 2VUMJ 1HOMA 2IEKA 2DMQA 1ZKGA 3Q3SA 2X9DA 3UKGA 1MSEC 3LSJA 1WGXA 4G12A 3LOCA 4EEFG 1AU7A 4Y7NJ 2YS9A 4V2FA 2K9NA 1MBHA 2M9HA 5IP9J 5GP9A 1X2MA 2DMTA 4FISA 1Y1WJ 3HOWJ 1HCRA 4C3IJ 3HOZJ 1X2NA 5E3OA 3S1RJ 1TWFJ 1AKHA 4JX4A 5F08A 3G1OA 2IBDA 2JA5J 5EF6A 1IDZA 3BG5A 4A3EJ 2NVYJ 2KT0A 1TWCJ 3IH2A 5FKOA 5F27A 3I4NJ 2QF7A 1RKWA 2OF7A 2GM4A 2R5ZB 1K61A 1A6IA 4D7NA 5F04A 3HKZN 1BW6A 3WHBA 4BY1J 1QRYA 4FE7A 1MH3A 2QCOA 2Y2ZA 3OOUA 4A3DJ 2VI6A 1GV5A 1ETYA 3FIWA 5J1YA 5IOZA 1MH4A 4DZJA 3JRBA 2NOGA 3A01B 4D5CA 2LR8A 1LE8A 3HEFA 2FD5A 1I3QJ 1UHSA 1BL0A 2EH3A 3M3YJ 1FIPA 3B6CA 1B72A 5C4XJ 1IC8A 4A93J 2XSDC 3Q0UA 3JRAA 2XPVA 4A3MJ 1NK3P 2DA4A 3BR0A 1FJLA 3ZQGA 2JMWA 4XRMA 5IPAA 2DMNA 3RZOJ 2WB1N 3JRHA 3CMYA 4BXXJ 2LD5A 2CU7A 1ETVA 1JUPA 4CYCA 1T56A 4BBRJ 1GDTA 2X6OA 1MBKA 1JKQC 3Q0VA 2R7ZJ 1T33A 5BNGA 2COBA 4MO7A 4X6AJ 2LP0A 1H89C 4IEJA 1WCMJ 2DA3A 2HXIA 1MBJA 4V2GA 1W0UA 1B8IA 1R9TJ 5C44J 1IUFA 4M3GA 1GT0C 4BY7J 2R5YB 2M34A 3ZOBA 3S1MJ 3ZQFA 1S7EA 2L7MP 2HDDA 2ECCA 1ZR4A 2VKEA 4B1RA 1B72B 3O8HA 2XB5A 4B3AA 4A3BJ 1SANA 1A5JA 4S0HB 2YUSA 4JYKA 1JTXA 2ECBA 4MFEA 1HLVA 1HDDC 1FTTA 2FJ1A 1MNMC 2B63J 1F36A 9ANTA 2Y9ZA 5E3NA 4I6ZA 1JUMA 3HOUJ 3BQYA 3BQZA 3M4OJ 4AUXA 1LE8B 3WHCA 2XPUA 3O8GA 2E2HJ 2JA7J 4DYRA 3D1NI 1ZGWA 4ABZA 2DTZA 3A02A 4L5EA 5JLXA 2K40A 3CQZJ 1NTCA 2EZKA 2TRTA 3BTCA 3LNQA 4X1EA 4J19A 2X48A 4A69C 1ZTRA 2DMPA 5IOYA 3BG3A 5K7ZA 4JP0A 3L1PA 2E19A 4XK4A 1VFCA 3G1MA 1I50J 2L0KA 3SJMA 5EZHA 2I10A 4XRSG 3HOVJ 1QVTA 3MKLA 5M3MJ 4A3IJ 2OPTA 4M3EA 4DZPA 2R92J 3BR5A 3TP0A 3LSPA 2DA6A 1EF4A 1XG1A 1F43A 2XB0X 5E3LA 1XC5A 5EGOA 2NS8A 2FQ4A 4FE4A 1JUSA 2AO9A 1RETA 5K7FA 3GTPJ 4I76A 1RESA 4DW6A 4BKXA 4AC0A 2JA6J 2JJ7A 2HYJA 1QVUA 4W97A 2KDZA 1H8AC 1HDPA 5GPCA 4Y52J 1OJLA 3BG9A 3BT9A 5J3LA 3IH3A 3RKQA 1HF0A 4DYQA 5EYRA 3LSGA 5FKNA 1TWGJ 1TWHJ 2CUEA 4FCYA 3TEDA 3TW7A 3FISA 2VPRA 1TC3C 3ZQHA 4A3CJ 5IYDJ 1LFUP 1UMQA 4B4CA 1ZQ3P 3A01A 1JKOC 2LLKA 2R5ZA 3I4MJ 1VI0A 2LFBA 3CDLA 3HGGA 4W1UA 4XIDA 1WI3A 1P7IA 1APLC 2ID6A 2Y30A 2DA5A 2E1OA 3B6AA 5J1UA 3ZQLA 3JRDA 1ETXA 2XGDA 4BBSJ 4HNVA 5EGOB 3A03A 3OIOA 1AKHB 1WH5A 1YRNA 1IJWC 2LKXA 3GTJJ 4D5FA 3H3VK 1ZK8A 1ETWA 1NK2P 5K7HA 2XGEA 3HBLA 2M8GX 4NDLA 4DYCA 4M3BA 3PO3J 1X58A 2JA8J 1U9NA 2ME0A 3RZDJ 1FIAA 4D7MA 3HOYJ 2AHQA 2R0QC 2D5VA 4MLOA 1Z0XA 4AYBN 1YRNB 4JX6A 4UUSA 1I6HJ 4A3JJ 4RBOA 2IAIA 3ZQIA 2HOTA 5C4JJ 2K9SA 3QQAA 2E2JJ 2GLOA 2EZHA 5M5YJ 3G1LA 4FTHA 1OCPA 4UUSB 1LFBA 3S15J 2EZIA 2O9LA 2JN6A 1JGGA 4RDUA 3S1QJ 2XPWA 4QTRA 1QPIA 2RAEA 3HGYA 1OCTC 4A3LJ 1H88C 2WAQN 3Q0WA 5M5XJ 2HQ5A 1SFOJ 1FEXA 2CUFA 3QPSA 5EZGA 3S17J 2K9QA 4MFDA 2EZLA 2XGCA 5JLWA 1WH7A 2EQRA 5EDNA 4XICA 5IP6A 1B8IB 2W48A 3PO2J 1ETOA 1DU6A 5DS9A 3FK6A 3MVPA 1VNDA 4JX5A 3SFIA 2CQXA 4MIMA 3HB9A 2P81A 3SDGA 3JRGA 3GTGJ 5F0FA 5FJ8J 3GTKJ 3K7AJ 2NVTJ 1ZR2A 4LOCA 1U9OA 1JKRC 5DTDA 2ZB9A 4M6VA 5IYCJ 2DN0A 4C3HJ 2MGQA 2L7ZA 1IV6A 2O7OA 3ZQCA 2MW8A 3BTLA 5IYBJ 4M3FA 2GBYA 1DU0A 2VKVA 3W6VA 1ITYA 2LTPA 1JKPC 1WPKA 1K83J 3FK7A 3BTJA 4QSHA 3MN2A 1IG7A 3DEWA 1JJ8C 5EG0B 3GTOJ 3BR6A 1JT6A 3DCFA 3CCYA 3JRFA 5HODA 3BR1A 5J1RA 5FKLA 2G0EA 4A3GJ 3GTMJ 1OFCX 5IP7J 2CJJA 3NAUA 1E3OC 3E7LA 3BR3A 1UG2A 2HOAA 3F0CA 5GPAA 3GTLJ 2NVXJ 4A3KJ 1POGA 2L9RA 4IHWA 3QPLA 1IDYA 2HXOA 5FLVA 1U78A 3K2AA 2YU9J 2HI3A 1Z77A 1JT0A 1ETKA 5FKMA 2ELKA 1Y1VJ 1FTZA 2DA1A 3TP3A 3GBGA 1D5YA 2CRGA 5M5WJ 4IHVA 2CQQA 5M3FJ 5C3EJ 2M2EA 1Q1VA 1BA5A 2XRLA 4XRSA 4IHYA 1RR7A 3OSGA 5EEAA 1MSFC 2MSYA 1G2HA 2LK2A 1ORKA 4A3FJ 1MBFA 1JJ6C 4C3JJ 5EG0A 1MBGA 3GTQJ 3HDDA 3TW6A 1U8BA 4IHXA 2H8RA 5F0HA 2JWTA 3HOXJ 3VPRA 2EBIA 2NS7A 3S1NJ 1AHDP 2Y31A 1BW5A 2DMUA 2Y0SN 3JRIA 1IGNA 3BR2A 1RPWA 1TWAJ 4CYCB 4C2MJ 3JREA 2DA2A 3S2DJ 3FKIJ 3BTIA 2JK3A 2H1KA 3IH4A 3NARA 2LY9A 5FLMJ 3LSRA 4GFBA 2N8GA 1XS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVS A;  2NVQ J;  3S14 J;  1VF9 A;  5FKK A;  2L7F P;  3PM1 A;  1GV2 A;  1O4X A;  1W0T A;  4QIW N;  2FX0 A;  4UUT A;  1BJZ A;  1PUF B;  2R93 J;  2M0C A;  2PMZ N;  2DJN A;  2ME6 A;  3S2H J;  2HOS A;  2R5Y A;  1IRZ A;  5E3M A;  3OSF A;  2O8K A;  1JTY A;  1RKT A;  3HM5 A;  1PUF A;  3RQI A;  3H0G J;  5F1J A;  1GVD A;  3S16 J;  2WV1 A;  1CQT A;  1ENH A;  1GUU A;  4M3D A;  1P7J A;  2MG4 A;  1ETQ A;  3JR9 A;  3JRC A;  2DA7 A;  2ID3 A;  1MBE A;  3C2B A;  2TCT A;  2Y9Y A;  2E2I J;  3IV5 A;  5F0C A;  2VUM J;  1HOM A;  2IEK A;  2DMQ A;  1ZKG A;  3Q3S A;  2X9D A;  3UKG A;  1MSE C;  3LSJ A;  1WGX A;  4G12 A;  3LOC A;  4EEF G;  1AU7 A;  4Y7N J;  2YS9 A;  4V2F A;  2K9N A;  1MBH A;  2M9H A;  5IP9 J;  5GP9 A;  1X2M A;  2DMT A;  4FIS A;  1Y1W J;  3HOW J;  1HCR A;  4C3I J;  3HOZ J;  1X2N A;  5E3O A;  3S1R J;  1TWF J;  1AKH A;  4JX4 A;  5F08 A;  3G1O A;  2IBD A;  2JA5 J;  5EF6 A;  1IDZ A;  3BG5 A;  4A3E J;  2NVY J;  2KT0 A;  1TWC J;  3IH2 A;  5FKO A;  5F27 A;  3I4N J;  2QF7 A;  1RKW A;  2OF7 A;  2GM4 A;  2R5Z B;  1K61 A;  1A6I A;  4D7N A;  5F04 A;  3HKZ N;  1BW6 A;  3WHB A;  4BY1 J;  1QRY A;  4FE7 A;  1MH3 A;  2QCO A;  2Y2Z A;  3OOU A;  4A3D J;  2VI6 A;  1GV5 A;  1ETY A;  3FIW A;  5J1Y A;  5IOZ A;  1MH4 A;  4DZJ A;  3JRB A;  2NOG A;  3A01 B;  4D5C A;  2LR8 A;  1LE8 A;  3HEF A;  2FD5 A;  1I3Q J;  1UHS A;  1BL0 A;  2EH3 A;  3M3Y J;  1FIP A;  3B6C A;  1B72 A;  5C4X J;  1IC8 A;  4A93 J;  2XSD C;  3Q0U A;  3JRA A;  2XPV A;  4A3M J;  1NK3 P;  2DA4 A;  3BR0 A;  1FJL A;  3ZQG A;  2JMW A;  4XRM A;  5IPA A;  2DMN A;  3RZO J;  2WB1 N;  3JRH A;  3CMY A;  4BXX J;  2LD5 A;  2CU7 A;  1ETV A;  1JUP A;  4CYC A;  1T56 A;  4BBR J;  1GDT A;  2X6O A;  1MBK A;  1JKQ C;  3Q0V A;  2R7Z J;  1T33 A;  5BNG A;  2COB A;  4MO7 A;  4X6A J;  2LP0 A;  1H89 C;  4IEJ A;  1WCM J;  2DA3 A;  2HXI A;  1MBJ A;  4V2G A;  1W0U A;  1B8I A;  1R9T J;  5C44 J;  1IUF A;  4M3G A;  1GT0 C;  4BY7 J;  2R5Y B;  2M34 A;  3ZOB A;  3S1M J;  3ZQF A;  1S7E A;  2L7M P;  2HDD A;  2ECC A;  1ZR4 A;  2VKE A;  4B1R A;  1B72 B;  3O8H A;  2XB5 A;  4B3A A;  4A3B J;  1SAN A;  1A5J A;  4S0H B;  2YUS A;  4JYK A;  1JTX A;  2ECB A;  4MFE A;  1HLV A;  1HDD C;  1FTT A;  2FJ1 A;  1MNM C;  2B63 J;  1F36 A;  9ANT A;  2Y9Z A;  5E3N A;  4I6Z A;  1JUM A;  3HOU J;  3BQY A;  3BQZ A;  3M4O J;  4AUX A;  1LE8 B;  3WHC A;  2XPU A;  3O8G A;  2E2H J;  2JA7 J;  4DYR A;  3D1N I;  1ZGW A;  4ABZ A;  2DTZ A;  3A02 A;  4L5E A;  5JLX A;  2K40 A;  3CQZ J;  1NTC A;  2EZK A;  2TRT A;  3BTC A;  3LNQ A;  4X1E A;  4J19 A;  2X48 A;  4A69 C;  1ZTR A;  2DMP A;  5IOY A;  3BG3 A;  5K7Z A;  4JP0 A;  3L1P A;  2E19 A;  4XK4 A;  1VFC A;  3G1M A;  1I50 J;  2L0K A;  3SJM A;  5EZH A;  2I10 A;  4XRS G;  3HOV J;  1QVT A;  3MKL A;  5M3M J;  4A3I J;  2OPT A;  4M3E A;  4DZP A;  2R92 J;  3BR5 A;  3TP0 A;  3LSP A;  2DA6 A;  1EF4 A;  1XG1 A;  1F43 A;  2XB0 X;  5E3L A;  1XC5 A;  5EGO A;  2NS8 A;  2FQ4 A;  4FE4 A;  1JUS A;  2AO9 A;  1RET A;  5K7F A;  3GTP J;  4I76 A;  1RES A;  4DW6 A;  4BKX A;  4AC0 A;  2JA6 J;  2JJ7 A;  2HYJ A;  1QVU A;  4W97 A;  2KDZ A;  1H8A C;  1HDP A;  5GPC A;  4Y52 J;  1OJL A;  3BG9 A;  3BT9 A;  5J3L A;  3IH3 A;  3RKQ A;  1HF0 A;  4DYQ A;  5EYR A;  3LSG A;  5FKN A;  1TWG J;  1TWH J;  2CUE A;  4FCY A;  3TED A;  3TW7 A;  3FIS A;  2VPR A;  1TC3 C;  3ZQH A;  4A3C J;  5IYD J;  1LFU P;  1UMQ A;  4B4C A;  1ZQ3 P;  3A01 A;  1JKO C;  2LLK A;  2R5Z A;  3I4M J;  1VI0 A;  2LFB A;  3CDL A;  3HGG A;  4W1U A;  4XID A;  1WI3 A;  1P7I A;  1APL C;  2ID6 A;  2Y30 A;  2DA5 A;  2E1O A;  3B6A A;  5J1U A;  3ZQL A;  3JRD A;  1ETX A;  2XGD A;  4BBS J;  4HNV A;  5EGO B;  3A03 A;  3OIO A;  1AKH B;  1WH5 A;  1YRN A;  1IJW C;  2LKX A;  3GTJ J;  4D5F A;  3H3V K;  1ZK8 A;  1ETW A;  1NK2 P;  5K7H A;  2XGE A;  3HBL A;  2M8G X;  4NDL A;  4DYC A;  4M3B A;  3PO3 J;  1X58 A;  2JA8 J;  1U9N A;  2ME0 A;  3RZD J;  1FIA A;  4D7M A;  3HOY J;  2AHQ A;  2R0Q C;  2D5V A;  4MLO A;  1Z0X A;  4AYB N;  1YRN B;  4JX6 A;  4UUS A;  1I6H J;  4A3J J;  4RBO A;  2IAI A;  3ZQI A;  2HOT A;  5C4J J;  2K9S A;  3QQA A;  2E2J J;  2GLO A;  2EZH A;  5M5Y J;  3G1L A;  4FTH A;  1OCP A;  4UUS B;  1LFB A;  3S15 J;  2EZI A;  2O9L A;  2JN6 A;  1JGG A;  4RDU A;  3S1Q J;  2XPW A;  4QTR A;  1QPI A;  2RAE A;  3HGY A;  1OCT C;  4A3L J;  1H88 C;  2WAQ N;  3Q0W A;  5M5X J;  2HQ5 A;  1SFO J;  1FEX A;  2CUF A;  3QPS A;  5EZG A;  3S17 J;  2K9Q A;  4MFD A;  2EZL A;  2XGC A;  5JLW A;  1WH7 A;  2EQR A;  5EDN A;  4XIC A;  5IP6 A;  1B8I B;  2W48 A;  3PO2 J;  1ETO A;  1DU6 A;  5DS9 A;  3FK6 A;  3MVP A;  1VND A;  4JX5 A;  3SFI A;  2CQX A;  4MIM A;  3HB9 A;  2P81 A;  3SDG A;  3JRG A;  3GTG J;  5F0F A;  5FJ8 J;  3GTK J;  3K7A J;  2NVT J;  1ZR2 A;  4LOC A;  1U9O A;  1JKR C;  5DTD A;  2ZB9 A;  4M6V A;  5IYC J;  2DN0 A;  4C3H J;  2MGQ A;  2L7Z A;  1IV6 A;  2O7O A;  3ZQC A;  2MW8 A;  3BTL A;  5IYB J;  4M3F A;  2GBY A;  1DU0 A;  2VKV A;  3W6V A;  1ITY A;  2LTP A;  1JKP C;  1WPK A;  1K83 J;  3FK7 A;  3BTJ A;  4QSH A;  3MN2 A;  1IG7 A;  3DEW A;  1JJ8 C;  5EG0 B;  3GTO J;  3BR6 A;  1JT6 A;  3DCF A;  3CCY A;  3JRF A;  5HOD A;  3BR1 A;  5J1R A;  5FKL A;  2G0E A;  4A3G J;  3GTM J;  1OFC X;  5IP7 J;  2CJJ A;  3NAU A;  1E3O C;  3E7L A;  3BR3 A;  1UG2 A;  2HOA A;  3F0C A;  5GPA A;  3GTL J;  2NVX J;  4A3K J;  1POG A;  2L9R A;  4IHW A;  3QPL A;  1IDY A;  2HXO A;  5FLV A;  1U78 A;  3K2A A;  2YU9 J;  2HI3 A;  1Z77 A;  1JT0 A;  1ETK A;  5FKM A;  2ELK A;  1Y1V J;  1FTZ A;  2DA1 A;  3TP3 A;  3GBG A;  1D5Y A;  2CRG A;  5M5W J;  4IHV A;  2CQQ A;  5M3F J;  5C3E J;  2M2E A;  1Q1V A;  1BA5 A;  2XRL A;  4XRS A;  4IHY A;  1RR7 A;  3OSG A;  5EEA A;  1MSF C;  2MSY A;  1G2H A;  2LK2 A;  1ORK A;  4A3F J;  1MBF A;  1JJ6 C;  4C3J J;  5EG0 A;  1MBG A;  3GTQ J;  3HDD A;  3TW6 A;  1U8B A;  4IHX A;  2H8R A;  5F0H A;  2JWT A;  3HOX J;  3VPR A;  2EBI A;  2NS7 A;  3S1N J;  1AHD P;  2Y31 A;  1BW5 A;  2DMU A;  2Y0S N;  3JRI A;  1IGN A;  3BR2 A;  1RPW A;  1TWA J;  4CYC B;  4C2M J;  3JRE A;  2DA2 A;  3S2D J;  3FKI J;  3BTI A;  2JK3 A;  2H1K A;  3IH4 A;  3NAR A;  2LY9 A;  5FLM J;  3LSR A;  4GFB A;  2N8G A;  1XS9 A; 
#chains in the Genus database with same CATH topology
 2QSF X;  1D0Y A;  4ZYG A;  4YII A;  5TGT A;  3CLO A;  5J4Y A;  5ICE A;  1IN5 A;  3PM1 A;  1MD0 A;  3G2B A;  3PQJ A;  1GV2 A;  3KZI C;  4UV8 A;  4ZYA A;  4OU0 A;  2W25 A;  2HYF A;  2Q2E A;  1BIB A;  1MNE A;  2STT A;  1JHH A;  2M0C A;  2M4K A;  2HOS A;  2BVM A;  3TMO A;  1ZRE A;  3K1N A;  3OYA A;  2O8K A;  1S7O A;  1Y8Q B;  3HM5 A;  2Y75 A;  4A2U A;  3SZT A;  5CVV A;  3RQI A;  1DGR M;  2M87 A;  2KHM A;  2OQR A;  3H0G J;  4BE0 A;  4KIG A;  1CQT A;  4BHC A;  3ECO A;  2ZJ2 A;  1VTN C;  2ACJ A;  1ETQ A;  3CUQ B;  3C2B A;  2FNP A;  2IGO A;  3IV5 A;  2GXA A;  3U1K A;  3LAJ A;  1FYM A;  2IEK A;  2V1N A;  1TLH B;  2BHY A;  3Q3S A;  4KMF A;  2LKS A;  2QUF A;  2V6C A;  1UAA A;  3WE3 A;  2O3F A;  1TTY A;  1WFX A;  3H3Z A;  4F7Z A;  1BJA A;  3S3N A;  2LG4 A;  4JK1 X;  1O7F A;  1X2M A;  2DMT A;  2GOX B;  1Y1W J;  2HVR A;  3K4J A;  4LLG F;  5JI6 A;  2A07 F;  1IN6 A;  4L9V A;  3HOZ J;  4RAG A;  3ZCO A;  1TWF J;  1XMK A;  4KJZ A;  2JZY A;  2QM3 A;  3M7G A;  1XGN A;  2W85 A;  5JHU A;  1K6Y A;  1TWC J;  4RGU A;  4M9X A;  3OS1 A;  1ACI A;  3I4N J;  1WWX A;  3CCR I;  3CCL I;  4LIV A;  4NUB A;  1UFM A;  2PJR A;  3F6O A;  4XLH A;  2GM4 A;  2R5Z B;  2JPC A;  3NRV A;  5FGM A;  5F04 A;  4E7H A;  1V4R A;  4KIS A;  2ZXI A;  3WHB A;  2DFH A;  2G7U A;  3NQO A;  1PP8 F;  3F3X A;  5LEK A;  3DKW A;  2HKX A;  2KKO A;  3W2W A;  3CMM A;  2ELH A;  1D8K A;  1U5T C;  3ZRG A;  5J1Y A;  2JT1 A;  3TKY A;  4ON0 A;  2LR8 A;  4PGH A;  1OYY A;  1VZ0 A;  3QPT A;  2DXI A;  2WB1 A;  1UHS A;  2JUG A;  2ZME B;  3M3Y J;  3ZMZ A;  2V1D A;  3KYL A;  3ZQ7 A;  5C4X J;  2NS0 A;  1TL8 A;  4YFK F;  1V5E A;  3S2W A;  3DLL F;  2DOF A;  2DMN A;  1K6O A;  3BDD A;  3RZO J;  3I56 I;  2HNH A;  2LF8 A;  2EPF A;  2CU7 A;  1JUP A;  4CYC A;  3BJ6 A;  3QOP A;  3K0L A;  4R1H A;  4GRI A;  1I1S A;  3BOQ A;  5B1A H;  1E0E A;  1V54 H;  2X6W A;  2W00 A;  2R7Z J;  4FHT A;  3NWS A;  4X6A J;  2H09 A;  4NC6 A;  4IEJ A;  2O6G E;  1LNW A;  2VXZ A;  4V2G A;  2K85 A;  3N97 A;  5DYM A;  5TJJ A;  1R9T J;  3P9K A;  2ETH A;  4XON A;  3EUK L;  2BY3 A;  3KLN A;  2R5Y B;  1YX3 A;  1T0F C;  2VQG A;  2W4S A;  3H9J A;  3K70 D;  2XF5 A;  1R1V A;  2L7K A;  4ZTF A;  3R0A A;  4UB6 C;  1DQU A;  4HDV A;  1ZR4 A;  2VKE A;  2WA0 A;  4UB8 C;  4B1R A;  1BI2 A;  2AXT C;  3DKY A;  4B3A A;  1SAN A;  1LUJ B;  3OOP A;  2YUS A;  5FLX Z;  2RRE A;  1R22 A;  3AAF A;  2A5Y B;  2ECB A;  1HLV A;  3ABM H;  2NRA C;  2Y48 A;  3WGG A;  1FP1 D;  3F8M A;  4XLA A;  1F36 A;  5E3N A;  2EFQ A;  3IKV A;  4L9T A;  3CC4 I;  2BOL A;  2RC4 A;  4E7K A;  4Y17 A;  4S05 A;  3K4L A;  1HW1 A;  4HAM A;  1L3L A;  2V1U A;  4P55 A;  3WHC A;  4B3X A;  3PSI A;  4O5V A;  1H0M A;  2KJC A;  3KEQ A;  2NNY A;  3O8G A;  1QBJ A;  2KP6 A;  3DV8 A;  3L9F A;  2HQA A;  4HRI A;  1S7A A;  4DYR A;  4YEJ A;  2IT0 A;  1OCC H;  1U3E M;  3AG4 H;  2X1C A;  3HSF A;  1Y39 A;  4Z6Y A;  3HRM A;  4EJV A;  2WBM A;  2W82 A;  4I99 C;  3DEU A;  5BQT A;  1FYK A;  1VQL I;  1JXS A;  4X1E A;  4ZDO A;  4CCL A;  2DMP A;  3GEZ A;  1EH6 A;  5L3G A;  5K7Z A;  1D1C A;  3LSM A;  1XCV A;  2L0K A;  1MMN A;  3FXO A;  3WTZ A;  3G3Z A;  2ZNZ A;  2CQ7 A;  4G7H F;  4EGZ A;  3HOV J;  4O3M A;  3MKL A;  5M3M J;  1YLF A;  2OPT A;  4DZP A;  4A3I J;  4MTD A;  3BR5 A;  3IAM 2;  2DA6 A;  4GYI A;  2HR3 A;  2HTS A;  2HQN A;  1S5L C;  4HDU A;  2XB0 X;  4NQW B;  1M1E B;  1XC5 A;  4MNU A;  4ZYD A;  3IL2 A;  4FE4 A;  2MYS A;  5K7F A;  4I76 A;  1RES A;  4YG2 F;  1OR7 A;  2VOP A;  4LD5 A;  1KQ9 A;  4RM2 A;  2Y0S A;  4W97 A;  1ZRC A;  2K7L A;  4WF2 A;  3PFY A;  3K4N A;  4G6D A;  3OYK A;  3DP7 A;  2CV2 A;  2FXA A;  3IH3 A;  2KIS A;  5J3L A;  2OD5 A;  1SEU A;  5EYR A;  3ABU A;  3LSG A;  4CO8 A;  3BLY A;  5GAG J;  4GCV A;  4CZZ A;  2CW7 A;  4FCY A;  3TED A;  2VPR A;  4BNC A;  2V1X A;  2YX7 A;  3CO6 C;  3P7N A;  4HX8 A;  3RYP A;  3QPH A;  4A3C J;  1MDM B;  3C18 A;  3WU2 C;  2FNA A;  2BW3 A;  1LFU P;  3SHF A;  2XF6 A;  2XRN A;  2LLK A;  1EH8 A;  1JE8 A;  2XRO A;  1VI0 A;  1G3Y A;  3J80 Z;  1P7I A;  2CFO A;  1EH7 A;  3JSO A;  2OTJ I;  3R60 A;  4L5J A;  2P4W A;  2E1O A;  3H5N A;  1S6L A;  3FM5 A;  2W7N A;  3IP4 B;  1LFP A;  5HVQ C;  3CO7 C;  2MH2 A;  4HNV A;  5EGO B;  2CW0 F;  1XX5 A;  2HFH A;  2IVM A;  4GXO A;  2YR2 A;  3VWB A;  2IRF G;  2KIF A;  2DDB A;  2P5V A;  2VQH A;  2IW5 A;  2IS2 A;  2F5E A;  2ISY A;  3KPH A;  3HBL A;  2M8G X;  3CC2 I;  4NDL A;  1K78 A;  3DEE A;  1ZLJ A;  4M3B A;  3PO3 J;  1Y0U A;  1IZ1 A;  2BVL A;  1S29 A;  4XLC A;  3R0J A;  3COA C;  2DO7 A;  4D7M A;  5CLS A;  4BGD A;  3HOY J;  3WU0 A;  1FOY A;  2R0Q C;  1CGP A;  2VQC A;  1Z0X A;  2WY8 Q;  3BG6 A;  4HLX A;  3ZMT A;  3PNV A;  1G3S A;  4UUS A;  2CGP A;  4A3J J;  1I6H J;  1R5I D;  2DCE A;  5C4J J;  4EJW A;  5D5W B;  2E2J J;  1Q1H A;  2GLO A;  2EZH A;  2BW3 B;  5M5Y J;  1Y8R B;  4OAY A;  1OCP A;  2VXD A;  4UUS B;  3J81 Z;  2MAB A;  4CSW A;  5GTH C;  1G3T A;  5DD8 A;  2MFZ A;  3S15 J;  1D1A A;  3E5U A;  1ODD A;  1JGG A;  2B7E A;  3S3M A;  2RAE A;  3KYC B;  4B48 A;  2IA0 A;  5D4S A;  4A3L J;  4DQ2 A;  1YIT I;  1BR4 A;  2EJR A;  1BOA A;  2HQ5 A;  1SFO J;  1FEX A;  3BY6 A;  5EZG A;  4G8X A;  4IZZ A;  3H0D A;  3V42 A;  2QSG X;  1WH7 A;  2GIV A;  3CMA I;  1GXP A;  5EDN A;  4XIC A;  2P6S A;  4G6Q A;  2W48 A;  2UXN A;  3WTS C;  3DPU A;  2FF4 A;  3FXK A;  3V8K A;  2DPU A;  5JVT A;  3LL7 A;  3SFI A;  4ZJZ A;  2LBF A;  4WXD A;  5F0F A;  1GLN A;  2LNB A;  1GVJ A;  2PG4 A;  2UUZ A;  1HBX G;  1ZR2 A;  3W6K B;  5DTD A;  3RYR A;  3HPH A;  1I5Z A;  2DN0 A;  4C3H J;  4RMN A;  4CZC A;  2F6C A;  1VQ6 I;  2A69 F;  3TO6 A;  1FSE A;  2L7Z A;  3T5X A;  3M8E A;  2ZSH B;  3ECH A;  1KU2 A;  3F8N A;  1X3U A;  4PSX A;  2VKV A;  4AIJ A;  4HNT A;  2ZC2 A;  1WPK A;  3GLL A;  2VJ4 A;  4O6J A;  4PFP A;  4MEX F;  1B4A A;  4AM3 A;  1QHH D;  3BR6 A;  1JT6 A;  2KFD A;  1LJ9 A;  2IGN A;  1A6Q A;  3PUF A;  4D0P A;  3EYI A;  4L9N A;  5FKL A;  4ZH4 F;  3D5R C;  1WJC A;  1QPM A;  3TL4 X;  3R61 A;  1OFC X;  2F2E A;  2F5D A;  4G7O F;  5IP7 J;  1E3O C;  3NAU A;  3BR3 A;  5ILS A;  1RI7 A;  5L3F A;  1UG2 A;  2LRE A;  4PGG A;  5GPA A;  4EM2 A;  2COM A;  3H36 A;  4A3K J;  1H9G A;  2GIZ A;  1SFX A;  4IHW A;  3QAH A;  2BZT A;  1IDY A;  3PFI A;  5FLV A;  3K2A A;  1UHM A;  5FKM A;  5LHG A;  3CCM I;  3GZN B;  1FTZ A;  1E3P A;  4OAZ A;  3CDI A;  1RUN A;  1D5Y A;  2FA5 A;  2H6C A;  2CRG A;  3DXJ F;  4P9U A;  2CQQ A;  2VBW A;  1R71 A;  2DDA A;  3NWT A;  1R36 A;  1YX5 A;  3EDP A;  5B66 C;  2E1C A;  2ZJP F;  1WJF A;  5H20 A;  5CVJ A;  2L3D A;  4U88 A;  3Q9V A;  3JAM Z;  3HOT A;  1MSF C;  2MSY A;  1FNN A;  2DBB A;  2HDW A;  3FXU A;  1ORK A;  5BPD A;  1IV8 A;  1MBG A;  1X1C A;  3LA3 A;  3GTQ J;  2WAF A;  3K70 C;  2CQN A;  2KMU A;  3HXL A;  3TW6 A;  4N9I A;  3WU1 B;  1BR2 A;  2NYX A;  3OIP A;  3BJO A;  2H8R A;  1DPU A;  1FYL A;  3ABL H;  2IJL A;  4KT5 C;  3T1B A;  5L3E A;  3VPR A;  2EBI A;  3BG7 A;  5F1R A;  5HDN A;  5HLH A;  2XC7 A;  3ZP5 A;  6PAX A;  1I39 A;  5CQE A;  1BW5 A;  3SEZ A;  2Y0S N;  3C1D A;  1MZB A;  3T8T A;  2R7Q A;  3BR2 A;  4CYC B;  3DQV C;  4XMY A;  3FKI J;  3BTI A;  2JK3 A;  3SQN A;  3IH4 A;  3CJT B;  4N9H A;  2N8G A;  3MFK A;  4IJA A;  3OL4 A;  1SD4 A;  4HST A;  1QZE A;  2YU3 A;  3IRQ A;  1VF9 A;  2L01 A;  2C6Y A;  2H8W A;  1SD6 A;  4P9F A;  4ESB A;  4J01 A;  1O4X A;  1QHG A;  3PJR A;  4QIW N;  2X0L A;  1WVR A;  3OYE A;  3HL2 A;  3W2A A;  2PMZ N;  2DJN A;  1Z3Y A;  2R5Y A;  1J0R A;  1IRZ A;  5ERI A;  3L2W A;  1YIO A;  1JTY A;  3SEQ A;  1W5S A;  1Y56 A;  4PDK A;  1W5C C;  2AXL A;  2CUJ A;  1GVD A;  2WV1 A;  1ENH A;  1GUU A;  3BZC A;  1P7J A;  1R4M B;  5E1W A;  4IO9 F;  3KET A;  1SVL A;  2ID3 A;  5FD5 A;  1U5T A;  2HEO A;  1HOM A;  1IXS B;  3CP8 A;  5DEQ A;  1BOB A;  1YO5 C;  2X9D A;  2F5F A;  1XSV A;  3MAJ A;  2BXZ A;  1YOV B;  4B8X A;  5KNL A;  4EEF G;  4Y7N J;  4XOR A;  2YS9 A;  2VB6 A;  1MBH A;  2FSW A;  1V5G A;  4HV5 A;  2EWN A;  1KZH A;  1S9H A;  3E6D A;  4BQA A;  4C3I J;  2BV6 A;  1X2N A;  1VQ7 I;  4EGY A;  1KGS A;  2V6E A;  1FX7 A;  2D1H A;  5F08 A;  3G1O A;  3E3V A;  5J4V A;  2VQL A;  4L5I A;  3E1S A;  2IBD A;  2L4M A;  2V26 A;  5EF6 A;  2JA5 J;  5HS8 A;  4A3E J;  2NVY J;  2QGU A;  1IDZ A;  2KT0 A;  2OZ6 A;  2R7O A;  2VON A;  2WAQ A;  1T8I A;  2P8T A;  2QF7 A;  5LRR A;  4KIC A;  4HNU A;  4EM1 A;  3RTR A;  3K10 A;  5A2Q K;  3TOA A;  3MWM A;  2CS3 A;  3BCB A;  3HKZ N;  1LKX A;  3D5S C;  1QRY A;  2IS4 A;  3CP2 A;  2JRT A;  3WGH A;  3OOU A;  4PSW A;  1GV5 A;  4QWQ A;  2R7X A;  3FIW A;  2DPD A;  4DZJ A;  1R1T A;  2DOE A;  1TZL A;  4DNC A;  4LK0 F;  4CXF A;  2HDC A;  1I3Q J;  3M9A A;  2QQB A;  1EKE A;  4ENN A;  3DKX A;  4E7I A;  1FIP A;  4IOC F;  2XIG A;  1B72 A;  4M9S A;  4ENM A;  3FKJ A;  4A3M J;  2R7D A;  3BR0 A;  2UV1 A;  1R1U A;  2DFF A;  3LFK A;  4XRM A;  4XOP A;  1WJB A;  2VAS A;  1HKQ A;  3C7J A;  4BXX J;  3JRH A;  1KU7 A;  4ENJ A;  1ZG3 A;  2W1O A;  2LD5 A;  3ZR8 X;  3A4C A;  4WX9 A;  1T56 A;  1QZY A;  2DW4 A;  4L9J A;  5AIP A;  2OV7 A;  1GDT A;  1REP C;  4OIP F;  4LK1 F;  4DGW B;  2VBY A;  3DBL B;  2X6O A;  1CF7 A;  1TBX A;  3C2G A;  3Q0V A;  1ZYR F;  1T33 A;  5ILV A;  3QYF A;  1H89 C;  2RN7 A;  2DA3 A;  4G6T B;  5D8K B;  1MBJ A;  1X4P A;  2M3A A;  3MCZ A;  2Z16 A;  4IPA A;  4HSR A;  4N0B A;  1W0U A;  3H92 A;  1CF7 B;  5K5O A;  4BE1 A;  2I5U A;  2YPR A;  4RAZ A;  4BY7 J;  3CCE I;  1J7K A;  2KRC A;  1OKR A;  3ZOB A;  4ZYE A;  4GYG A;  1S7E A;  1ZAO A;  4IF4 A;  5DCF A;  4IHT A;  2PN6 A;  1HST A;  2M8E A;  1FPQ A;  1U0J A;  2QWW A;  1KQ8 A;  1UB9 A;  3E6B A;  1Z7L A;  2FJ1 A;  5DCM B;  3F21 A;  5EJC A;  3L7W A;  2A68 F;  3BC8 A;  4BJ6 C;  3RKX A;  4KA4 A;  4BAC A;  2Y9Z A;  3PQK A;  4BJ5 C;  3E5Q A;  1D0X A;  1JUM A;  2DFE A;  3CF2 A;  4OWR B;  4BEH A;  3WTT C;  3CES A;  1BIA A;  2V9K A;  5L3B A;  4M9Z A;  4KIT B;  4ZDL A;  4U0W A;  5DD4 A;  5E79 C;  1UCR A;  3E6M A;  3BP8 A;  3D1N I;  2DQR A;  2WV0 A;  1PDN C;  2PBI A;  2ZFW A;  3OL3 A;  4QLC U;  3CJN A;  2IPQ X;  2OTL I;  1ZAR A;  3DLA A;  3AL0 B;  2EZK A;  3BTC A;  1OPC A;  3F9K A;  3DPT A;  3C2H A;  2HZD A;  2IGK A;  2X48 A;  3R6S A;  3FF5 A;  2DOD A;  2R7F A;  3M1E A;  5DV5 A;  1G3W A;  1R4N B;  4PUS A;  2E19 A;  2GZW A;  3H9G A;  4KIB A;  4RLQ A;  4RB0 A;  2VN2 A;  3G1M A;  3PSF A;  4XK4 A;  1X1A A;  3OYG A;  4OIQ F;  5EZH A;  1BC7 C;  2PQ8 A;  3GCM A;  3B02 A;  2M4G A;  2ZXH A;  3TP0 A;  4NB5 A;  4CYD A;  3FMQ A;  3FBI B;  3HJE A;  3EPZ A;  1F43 A;  4CGZ A;  2FBI A;  4LMY A;  2FQ4 A;  3QWL A;  2AO9 A;  1EA3 A;  2MBF A;  3DU5 A;  1I6X A;  2NXN B;  1P6R A;  5CVU A;  4DW6 A;  2KLO A;  1YE9 A;  2M45 A;  3ISP A;  3L00 A;  4GO1 A;  5LEJ A;  1SFU A;  2JA6 J;  1DP3 A;  5KAF C;  2XDV A;  1H8A C;  2AQE A;  2MLK A;  1SAX A;  2GA1 A;  2EIJ H;  2W24 A;  2Z5U A;  3KYD B;  2A6H F;  3RDI A;  5GPC A;  4XM3 A;  1ZGA A;  3CTA A;  4N4O B;  2KDO A;  5FKN A;  1U2W A;  4A0Z A;  3F23 A;  2DLL A;  3TW7 A;  1TC3 C;  4M72 A;  4C9Y A;  5D5X B;  3ZQH A;  4RB3 C;  2IS1 A;  5IYD J;  3FXR A;  2A6T A;  4B4C A;  1ZQ3 P;  3HUG B;  4LFU A;  1G59 A;  1W5T A;  4HOB A;  2LFB A;  3HGG A;  1IW7 F;  2RDP A;  1IRF A;  4MGR A;  1R7J A;  2XKP A;  2HVS A;  1BN5 A;  2K27 A;  2Q1Z B;  4XN3 A;  4Y13 A;  4UNO A;  3B6A A;  3OS0 A;  2ZBK A;  4DIQ A;  2ZXW H;  1SC7 A;  1EJ9 A;  2ELJ A;  5HDG A;  4E4H A;  4BBS J;  3QOE A;  4M74 A;  3CZ6 A;  3CUO A;  3L2R A;  1E17 A;  1TNS A;  1YRN A;  1Z6T A;  4YEL A;  3GTJ J;  4F91 B;  3OYL A;  2VT2 A;  2ZJR F;  1X3Z B;  1SMY F;  4PJN A;  1FLI A;  4YIR X;  5K7H A;  3GFL A;  1XCB A;  1IN7 A;  4LLL A;  4BJT A;  1OLT A;  1VQ8 I;  1U9N A;  2EFO A;  5KK1 A;  2HZT A;  2QLZ A;  3KP4 A;  4I0B A;  2B0L A;  4RLF A;  2KL4 A;  2WY7 Q;  5IT9 Z;  1K7A A;  4BQN A;  3MD2 A;  2AHQ A;  2AS5 F;  3FM3 A;  2IAI A;  2MC3 A;  3ZQI A;  2K9S A;  3BWG A;  1WJA A;  1MJA A;  2PI0 A;  2L5Q A;  3G1L A;  4OMY A;  3J7Z I;  2ADU A;  2H6B A;  2O9L A;  3DWL E;  1BI3 A;  3FWE A;  2ZO4 A;  1QPI A;  5DCM A;  2VPL A;  3HGY A;  1OCT C;  4BH9 A;  3L2V A;  3HSR A;  5M5X J;  3VYS B;  3IHU A;  3F72 A;  1YW9 A;  2FRH A;  2QQ8 A;  4LIU A;  5BMZ A;  3KP3 A;  3S17 J;  4WK8 F;  2OC6 A;  2EZL A;  4H0E A;  1T95 A;  2GA2 A;  3LSK A;  3OY9 A;  2LF7 A;  2R7S A;  2Q2E B;  3PO2 J;  3CCS I;  2IS6 A;  3J81 K;  5DS9 A;  3S3O A;  4JX5 A;  3WTV C;  2CQX A;  1FC3 A;  1MMG A;  2P81 A;  3HB9 A;  4MIM A;  4ANJ A;  3GTG J;  4A6D A;  5FJ8 J;  3ZXS A;  1Z7U A;  4LOC A;  4M73 A;  1K4S A;  1T0F A;  4A0X A;  1T38 A;  2MGQ A;  3O3K A;  2ZNY A;  4XR6 A;  4A12 A;  2K3F A;  5L3D A;  3VB2 A;  2O7O A;  2FMY A;  3OR1 C;  3ZQC A;  4I2O A;  3L2U A;  2MW8 A;  3I64 A;  4HG2 A;  1LVA A;  2OCC H;  5AIQ A;  2GBY A;  1ITY A;  2ZSI B;  5J47 A;  2Y0M A;  3AG3 H;  3JCU C;  3V8J A;  4HPQ A;  2H94 A;  2CFX A;  1SFE A;  4LG3 A;  2L9N A;  2IP2 A;  2M30 A;  1XMA A;  3BCA A;  1JJ8 C;  3ML6 A;  5EG0 B;  3GTO J;  3CCY A;  3C3W A;  2R7V A;  5HOD A;  2ZXJ A;  1D3Y A;  4XN0 A;  4AD9 A;  5IY5 H;  3H5A A;  4HQE A;  3W2V A;  4XL9 A;  3GTM J;  3ABK H;  2A61 A;  2CJJ A;  3E7L A;  3DF8 A;  1A31 A;  4RAY A;  4J00 A;  1F9N A;  1FP2 A;  1PUE E;  4A5N A;  4HQM A;  3S8P A;  3JAM K;  2DQL A;  1POG A;  3CJQ B;  3HTU A;  5ICG A;  1Z91 A;  4G9Y A;  2HXO A;  4TV7 A;  1EV7 A;  4KN7 X;  1U78 A;  1MJ9 A;  2HI3 A;  3EET A;  1BC8 C;  1DPR A;  2DK5 A;  4XSZ F;  2I8D A;  2XSJ C;  2ISZ A;  2DFI A;  2K5C A;  3GBG A;  4AU7 A;  3AL0 C;  3D5L A;  2M2E A;  3EUH C;  1HQC A;  1W7P D;  1BA5 A;  2LSO A;  2LYC A;  3R4K A;  1HSJ A;  2KRH A;  1FOK A;  4IHY A;  5DUI A;  1RR7 A;  3HSE A;  1TP4 A;  4KUM A;  2A05 A;  2DJI A;  4ETS A;  1P4A A;  1MBF A;  1JJ6 C;  3PNY A;  3GZ6 A;  3K1M A;  2M1B A;  3OYF A;  2P5L C;  2VKD A;  4IX7 A;  1U6G A;  2FBH A;  3HOX J;  3ZPL A;  2NS7 A;  2L9S A;  4QPQ A;  5IT9 K;  4AYB A;  2MD0 A;  2FOK A;  2DMU A;  3BZK A;  3RKY A;  1YIJ I;  3HRS A;  1RPW A;  1TWA J;  4C2M J;  2LY1 A;  4I01 A;  1NG6 A;  3FHZ A;  1P2F A;  2H1K A;  2Q0O A;  5FLM J;  2LY9 A;  1I27 A;  3LSR A;  5LD2 C;  4GFB A;  1XS9 A;  2LVS A;  5FRN A;  1E2X A;  2CG4 A;  3VYR B;  3S14 J;  4E70 A;  1P4X A;  4S04 A;  1F4K A;  4L0Z B;  3IKT A;  5FKK A;  1MMD A;  4OMZ A;  2G7H A;  1U8R A;  2Q8K A;  2O03 A;  1W0T A;  3HC7 A;  2OAZ A;  2FX0 A;  1PJR A;  2YSR A;  4UUT A;  1BJZ A;  5KVR A;  1PUF B;  1R6R A;  2ME6 A;  1F5T A;  1J59 A;  1IXC A;  5LGT A;  5E3M A;  3I54 A;  2O5R A;  3VEP A;  4P1W A;  1RKT A;  1F1Z A;  3U21 A;  1PUF A;  4II2 A;  1ZHF A;  1FBS A;  3TO7 A;  4IOA F;  4OOI A;  2BY0 A;  1MW7 A;  4M3D A;  1LPQ A;  1AOY A;  5J8C A;  3H5R A;  1XGO A;  4XOT A;  3JR9 A;  4Z2Y A;  3F22 A;  2TCT A;  3GFM A;  2DAO A;  2X6Y A;  4B09 A;  2DT6 A;  1YFH A;  1FY7 A;  1ZKG A;  2DMQ A;  1YS7 A;  2O8X A;  3LSJ A;  4G12 A;  4C30 A;  4FT8 A;  1G8X A;  1T6S A;  5CKT A;  3FMS A;  1LDJ A;  4FX0 A;  4CH7 A;  4KYW A;  5F6F A;  1B9M A;  4RB2 C;  4UXN A;  4V2F A;  1V5F A;  2M9H A;  2VC0 A;  5IP9 J;  4EJU A;  1FZP B;  3HOW J;  1J75 A;  4FIS A;  1YS6 A;  1ZRF A;  1N25 A;  5FD6 A;  3FZV A;  1VQ4 I;  1HCR A;  4HV6 A;  2MA3 A;  5E3O A;  3TQN A;  4Y4R A;  3S1R J;  4XKB A;  5D5U B;  1WKM A;  3DU6 A;  1RC9 A;  4I0A A;  1Z21 A;  3ESW B;  3KLO A;  3V4G A;  4UVC A;  2KIM A;  5CQG A;  1B59 A;  4IRH A;  4PJM A;  4GGG A;  3BG5 A;  2OQG A;  3QU3 A;  4C2T A;  3IH2 A;  3MEX A;  2E60 A;  1X1B A;  4WXH A;  1TT5 B;  3JTH A;  2EIL H;  1RKW A;  3K1P A;  3V8L A;  2VIX A;  4PZJ A;  1X1P A;  1ZRD A;  1K61 A;  4D7N A;  3QYB A;  1BW6 A;  3IWZ A;  3L09 A;  3WGI A;  2E7X A;  4PJL A;  4BY1 J;  5B5E C;  2KIU A;  1MH3 A;  3LA7 A;  3HRT A;  2VI6 A;  1YJ9 I;  1ETY A;  2QKL B;  4DJA A;  4IXA A;  4BQQ A;  3OV8 A;  3JRB A;  3I55 I;  3A01 B;  4D5C A;  3HEF A;  1ZH5 A;  2FD5 A;  2QQ9 A;  2WTE A;  5LBQ A;  1K78 B;  3ELK A;  3FBN B;  1O3S A;  1BL0 A;  2EH3 A;  3RSN A;  3OYC A;  4BXU A;  1XMX A;  2XSD C;  2ICW G;  3O6B B;  1YTY A;  1L0O C;  1ZGJ A;  4FAS D;  4XKW A;  3IUO A;  4U7D A;  1W36 D;  3L2Q A;  4R8H A;  5HDK A;  5IPA A;  4E7S A;  1WJD A;  3H1C A;  5J8F A;  4DOZ A;  1VQN I;  4BBR J;  1B6A A;  3OR2 C;  4WWC A;  1WJE A;  4EJT A;  1IF1 A;  2P7V B;  1AA7 A;  2EK5 A;  2XAG A;  4IVN A;  3OYI A;  5DM7 F;  5BNG A;  4MEY F;  2LRD A;  2M0M A;  2DT5 A;  3E97 A;  2LP0 A;  4NC7 A;  2LBF B;  4BS9 A;  2UWM A;  4II3 A;  1WCM J;  3DTI A;  4QPO A;  1FBQ A;  3RIR A;  1MIJ A;  2Z1D A;  2HXI A;  3GW2 A;  5ED4 A;  5JVG F;  1WJ5 A;  3FXQ A;  2HKO A;  4BDZ A;  4DBR A;  1MDM A;  5DDG A;  2E7W A;  1O3Q A;  1IUF A;  1GT0 C;  2M34 A;  3M8J A;  3GYH X;  3S1M J;  1QO0 D;  2HDD A;  5F64 A;  3GXO A;  3M07 A;  1X1D A;  4CHU A;  1MJB A;  3O8H A;  2XB5 A;  4A3B J;  2E1M B;  3K4M A;  1V55 H;  2BE5 F;  3PNT A;  4MFE A;  1HDD C;  1BM9 A;  3BPX A;  1T08 B;  1XSD A;  1MNM C;  3U1D A;  1SD5 A;  2GOM A;  5CPR B;  5B1B H;  5HS7 A;  4I6Z A;  2F4O B;  3IRR A;  1Y0N A;  3V7C A;  2OUM A;  3HOU J;  5DUK A;  2LC2 A;  1LVK A;  4UVB A;  2K9L A;  4IL6 C;  1J5Y A;  2Z3Y A;  2XPU A;  2E2H J;  2JUC A;  2JA7 J;  1VQM I;  3GLX A;  2CQK A;  4A5M A;  2DTZ A;  2XVC A;  4XSX F;  4JBA A;  3MKY B;  3A02 A;  4HEA 2;  1S3J A;  4RS8 A;  2VC1 A;  5JLX A;  3OYN A;  5FRO A;  2L4A A;  4PJ0 C;  3A1Y A;  1NH3 A;  4M71 A;  1NTC A;  4Q5S F;  2TRT A;  2CSO A;  2MLG A;  3SDB A;  3HHH A;  4EJO A;  1IXR C;  5IOY A;  3BG3 A;  4JP0 A;  3L1P A;  2PJP A;  1ONV A;  1YQA A;  1VFC A;  4CUG A;  3GME A;  2RQP A;  5EEG A;  3TDZ C;  2I10 A;  3CF5 F;  4L18 B;  2F48 A;  1FWZ A;  3HPG A;  3LSP A;  4CCN A;  2RV8 A;  1EF4 A;  4LG0 A;  1R00 A;  3J7Y J;  3RJP A;  3PL8 A;  5E3L A;  1XPX A;  1JHF A;  5FB2 A;  4CDG A;  4PFO A;  4OIR F;  3ERE D;  1NG7 A;  2KZG A;  3KP5 A;  2EB7 A;  3T0Y A;  3GTP J;  1UG0 A;  3I59 B;  1FBU A;  3Q5F A;  4E6K G;  1DUX C;  3E5X A;  4AC0 A;  2NVU B;  3DFG A;  2HYJ A;  1QVU A;  3ZN0 A;  2OU2 A;  3K9T A;  2R3S A;  3LSH A;  1HDP A;  3DTK A;  4XKV A;  3V7R A;  4Y52 J;  1OJL A;  3BT9 A;  2HS5 A;  3E0J B;  4BQO A;  1QQI A;  2CW8 A;  3I71 A;  3QRF F;  1HF0 A;  4DYQ A;  3B73 A;  1G4D A;  2M7B A;  2LKP A;  1OCO H;  3ULQ B;  3KCC A;  5ICF A;  4XLP F;  4HLY A;  2EFN A;  2NAZ A;  3M8F A;  3I4P A;  1FSH A;  2BY2 A;  1UMQ A;  4IQJ A;  2V4J C;  5J40 A;  4ZZD A;  2QKM B;  4I02 A;  5JHF A;  2QA4 I;  4AID A;  3A01 A;  2Z2S B;  1IAW A;  2L02 A;  2VE9 A;  2PFB A;  1VQ9 I;  3RPU A;  1STZ A;  2R5Z A;  3I4M J;  1IO2 A;  3RPQ A;  3CDL A;  4Q47 A;  5HLT A;  4LG0 B;  1APL C;  4KFC A;  4LLN A;  2QVO A;  5J1U A;  4ESJ A;  2DI3 A;  3JRD A;  2XGD A;  2E34 A;  1WHU A;  4I7H A;  4ZTJ A;  1H9T A;  3A03 A;  4M6Y A;  3BJA A;  2CO5 A;  2GAU A;  3AG1 H;  2EIK H;  4KDP A;  1WQ2 A;  1TQP A;  1IJW C;  3EQL F;  1R58 A;  3I3L A;  2LKX A;  1XDS A;  1ZK8 A;  1UEL B;  4F55 A;  5HNF A;  4OIN F;  1Z67 A;  2ZFU A;  1NHA A;  3FXJ A;  2VLA A;  5K5R A;  4ESF A;  2E1N A;  1I3A A;  4UV9 A;  3JSP A;  3WG9 A;  3MKW B;  2WAE A;  1X58 A;  2EV0 A;  2JA8 J;  2JTV A;  1YG2 A;  2ME0 A;  3Q9S A;  4U0V A;  2P0W A;  4RGS A;  1FIA A;  2CYY A;  3T8R A;  1FOX A;  2D5V A;  1OIS A;  4MLO A;  1YRN B;  4JX6 A;  4ZZL A;  2JVG A;  2JA2 A;  2OBP A;  5JR3 A;  3HKZ A;  3JW4 A;  2K3P A;  3G71 I;  1KON A;  2M7A A;  2K4B A;  2UZK A;  2EIM H;  2XAS A;  4FTH A;  3QP6 A;  3TBI A;  3H9Q A;  1KYW A;  2EZI A;  2JN6 A;  2P7C B;  1X3W B;  3WTU C;  3OYB A;  2LY2 A;  4N4N B;  5HS9 A;  3LST A;  2WAQ N;  1H88 C;  3U9G A;  3OYD A;  4BEH B;  3P9I A;  2CUF A;  5LGN A;  4EM0 B;  2V79 A;  5HNH A;  2OCE A;  3LSI A;  3CDH A;  3K4K A;  4MFD A;  2BXY A;  2EA4 A;  4R79 A;  3HG9 A;  2EQR A;  3K69 A;  1UHW A;  2TDX A;  3ZMV A;  2WWY A;  2DOA A;  2RQQ A;  3UR3 C;  2E35 A;  5IP6 A;  4RM3 A;  4NHJ A;  4ASN A;  1ETO A;  4BXF A;  1DU6 A;  1FMV A;  3MVP A;  1VND A;  3H35 A;  3VFZ A;  4BYY A;  1UZC A;  4YFN F;  1A36 A;  3SDG A;  3JRG A;  3WG7 H;  4ZC3 A;  4V19 K;  3GTK J;  1HKT A;  2HTJ A;  1TQI A;  1S8N A;  4Y33 A;  2JQ7 A;  1JKR C;  2XGX A;  2ZB9 A;  2XUB A;  3ZQQ A;  4G94 A;  4M6V A;  1JI8 A;  3VYT B;  4F52 A;  2GXB A;  3WTW C;  1IRG A;  1IV6 A;  1HW5 A;  4RAF A;  5D8L B;  1YI2 I;  2IGM A;  1TNT A;  2A6E F;  4KIF A;  5E8G A;  1MMA A;  1SMT A;  1Z05 A;  2CUZ A;  1DU0 A;  3W6V A;  2Z99 A;  2LTP A;  3A0B C;  5CYV A;  1USS A;  1K83 J;  3IWF A;  3BTJ A;  4NNJ A;  4QSH A;  3SXY A;  3TDU C;  2CMP A;  2NNN A;  1HXD A;  1J9I A;  1IG7 A;  1O7L A;  2E1M C;  3DEW A;  3IAS 2;  2VT3 A;  3M1C A;  4XRF A;  3OWT A;  1OMI A;  1KA8 A;  2CH0 A;  3VYU B;  5GAE J;  5J1R A;  1FOW A;  4HA8 A;  1T39 A;  4A3G J;  2K02 A;  1P92 A;  1WZ2 A;  4BUP A;  2A3S A;  4MQV A;  1TT0 A;  4BHP A;  3I59 A;  2NVX J;  1LDK B;  4XKC A;  1J09 A;  4B44 A;  2NOJ B;  2L9R A;  2IA1 A;  2BYV E;  2YU9 J;  1Z77 A;  2PJR B;  4CCJ A;  4YIF A;  1QA6 A;  3J80 K;  4HW0 A;  2HGC A;  3SZP A;  3TP3 A;  2X1E A;  1TW2 A;  2QZ8 A;  2X51 A;  5M3F J;  2BGC A;  2XRL A;  5GTI C;  4XRS A;  1LB2 A;  4ZYH A;  4F93 B;  2JSC A;  2QYO A;  3GWZ A;  2R7W A;  2LK2 A;  4CIC A;  3ASO H;  4JQF A;  2ESN A;  1XN7 A;  4C3J J;  5E20 A;  5EG0 A;  4PJJ A;  3WTY C;  4Y15 A;  1HW2 A;  1UST A;  4IHX A;  1U8B A;  1KU3 A;  3KEO A;  5H2F C;  1VQK I;  2LDU A;  2LMD A;  4K2E A;  5LGU A;  2P6T A;  2PX9 A;  4BU2 A;  1AHD P;  2Y31 A;  3K4B A;  3GFI A;  3L2C A;  3JRI A;  2VJJ A;  3ABT A;  3GFJ A;  4WCG A;  3JRE A;  2FE3 A;  4F92 B;  1D1B A;  2WC2 A;  3S2D J;  1O3T A;  5KAI C;  2DT7 B;  1W1W E;  4MHG A;  1OQY A;  2NVQ J;  4B43 A;  4EMS A;  5B3S H;  1IUY A;  2L7F P;  2RKH A;  2KQR A;  5LRS A;  3FX3 A;  3TGN A;  2FOW A;  3CUQ C;  3KE2 A;  3VSK A;  4UY8 I;  3X2Q H;  2IXS A;  5H6R A;  3TO9 A;  3U2R A;  5ILU A;  2F4M B;  5FFZ A;  2DTR A;  2XAU A;  1W7P B;  2VOO A;  2R93 J;  2R7T A;  3OYM A;  2E5Z A;  3PIO F;  1AWC A;  2RVC A;  1YHQ I;  3S2H J;  4M6X A;  5D5V B;  2VOD A;  3OSF A;  1N75 A;  2K9M A;  3BZ6 A;  2QBY A;  1LDD A;  2Z9O A;  5F1J A;  3S16 J;  4D1Q A;  3WTX C;  4IRI A;  2MG4 A;  1ERD A;  4IQ4 A;  2H1L A;  3JRC A;  1XB4 A;  2DA7 A;  3F6V A;  1MBE A;  2E2I J;  2VUM J;  2Y9Y A;  2ZJQ F;  5F0C A;  2VL8 A;  5GAH J;  4PK4 A;  3P9C A;  1N78 A;  3UKG A;  1MSE C;  1WGX A;  2X85 A;  2A5W A;  3AFH A;  3ZMS A;  1B1B A;  3LWF A;  3O2P E;  1T98 A;  4NC8 A;  3LOC A;  1AU7 A;  3MMY B;  2EFW A;  2K9N A;  2HQR A;  3EYY A;  2R4G A;  5GP9 A;  1RRJ A;  2UXX A;  3FXM A;  1PYV A;  1Z3X A;  3LQQ A;  2YX4 A;  1AKH A;  4JX4 A;  5D4R A;  3FHN A;  5BPI A;  1X4O A;  2XAF A;  2OJE D;  2BHZ A;  5AON A;  1IRX A;  1OCR H;  2KPM A;  1A35 A;  5FKO A;  5F27 A;  3VOE A;  2EV5 A;  4HX4 A;  2OF7 A;  3OS2 A;  5E1Z B;  1ZG1 A;  5IT3 A;  1A6I A;  2BBY A;  4HBL A;  4C2U A;  4YFX F;  2XHK A;  4FE7 A;  3UNG C;  4RB1 A;  2QCO A;  2Y2Z A;  2PLY A;  4A3D J;  4CCO A;  4E7Z A;  2K86 A;  4H4K C;  5IOZ A;  1MH4 A;  3CME I;  2NOG A;  1BI0 A;  1LE8 A;  3HUG A;  2AQF A;  3HIF A;  4BHB A;  2OA4 A;  3SFZ A;  3KZZ A;  3B6C A;  1SD7 A;  2QSH X;  3GO5 A;  1IC8 A;  4A93 J;  3Q0U A;  3JRA A;  3HRU A;  2XPV A;  1NK3 P;  2VKH A;  1SVO A;  2DA4 A;  1FJL A;  3ZQG A;  1BBY A;  2JMW A;  3I58 A;  5LLQ A;  2GXG A;  5E18 F;  3JTG A;  2FU4 A;  3K4C A;  1C0W A;  5DM6 F;  1LEA A;  5CJ9 A;  3A2K A;  2WB1 N;  3CMY A;  2VE8 A;  1ETV A;  4IKF A;  2HVQ A;  3H3U A;  3NEU A;  3G73 A;  4P96 A;  1ZEL A;  5E8I A;  3D0S A;  1G6N A;  1BI1 A;  2RNG A;  4EQQ A;  2EV6 A;  3CCJ I;  1YJN I;  1K4T A;  1ULY A;  3W6J B;  4G7Z F;  1MBK A;  1JKQ C;  2L54 A;  4AWX B;  1VQ5 I;  1A04 A;  1YYV A;  2COB A;  4HZF A;  1RUO A;  1OR7 C;  3DTE A;  4MO7 A;  2IA2 A;  3GX4 X;  2HU9 A;  4Q4Z F;  5LHH A;  3MKZ A;  5K1Y A;  4LJZ F;  1B8I A;  4AVZ A;  2V9P A;  5C44 J;  4M3G A;  2F5V A;  3TOB A;  4KN4 X;  5H6Q A;  1MND A;  5K5Q A;  1VQO I;  4L0Y B;  2CV1 A;  2M5W A;  3ZQF A;  2L7M P;  2ECC A;  2ZME A;  2H27 A;  5EEH A;  2X1D A;  1B72 B;  1HC8 A;  3I9V 2;  5ICC A;  1A5J A;  4S0H B;  4JYK A;  5E1X A;  3LQR A;  4XNF A;  1JTX A;  1FTT A;  3RPU D;  3CCV I;  2V7F A;  1ZLK A;  2B63 J;  9ANT A;  1RR8 C;  2KIQ A;  2R7U A;  2W84 A;  3BQY A;  3BQZ A;  3M4O J;  3KIO A;  1YW8 A;  4KNY A;  4AUX A;  4BL0 B;  1LE8 B;  1FMW A;  4CA0 A;  2R7R A;  2BEO A;  3PIP F;  1D0Z A;  1Z9C A;  1XGS A;  3I53 A;  1VQP I;  3F8B A;  4B47 A;  2X4H A;  1ZGW A;  1ON2 A;  4ABZ A;  3LAP A;  5FO5 A;  4L5E A;  5FLX K;  2K40 A;  1Z1D A;  2FML A;  4FQG A;  3QOD A;  1ZG5 A;  3MQ0 A;  3HTS B;  4I98 B;  3CQZ J;  2B9S A;  2QBY B;  3GVA A;  1HKS A;  3FXL A;  3LNQ A;  4J19 A;  4HF0 A;  1BR1 A;  4A69 C;  1KU9 A;  1ZTR A;  2F4I A;  3FMR A;  2PEX A;  1RNL A;  1W7P A;  3QU6 A;  3RCO A;  2JSP A;  1B9N A;  1I50 J;  5CVR A;  4XQF A;  3SJM A;  4XRS G;  2GWR A;  1QVT A;  1MMS A;  2CV0 A;  4M3E A;  2R92 J;  2GQQ A;  2D45 A;  3ROU A;  5KHD A;  4F3Q A;  1XG1 A;  5TIS C;  2QEX I;  1XTA A;  5EGO A;  5A2Q Z;  4HF2 A;  2NS8 A;  2VBZ A;  2VJI A;  1SAU A;  1JUS A;  3OMY A;  5LHI A;  3CCU I;  1RET A;  1SVM A;  2P5K A;  4NQW A;  4BAY A;  4A6E A;  4BKX A;  2EA2 A;  4EVI A;  2CWE A;  2JJ7 A;  2FEZ A;  3E6C C;  4EAT A;  2KDZ A;  2LH9 A;  3GF2 A;  3ZMU A;  3BG9 A;  3RKW A;  4MQ9 F;  3RQ4 A;  3RKQ A;  4XLN F;  1GHC A;  3DBR B;  4DBQ A;  5BS6 A;  1QU3 A;  1OCZ H;  3F8F A;  1TWG J;  4XBF A;  1TWH J;  2CUE A;  2JVH A;  1RZ4 A;  2EFP A;  2ZME C;  3KX2 A;  3FIS A;  3VDX A;  3CC7 I;  1K79 A;  1KYZ A;  1ON1 A;  3V7S A;  2L9V A;  2HYG D;  1FT9 A;  2MH9 A;  5D6E A;  1RIO H;  3HOS A;  2HWV A;  3ZN1 A;  3KEY A;  4HX7 A;  1JKO C;  4W1U A;  4XID A;  3HHG A;  1WI3 A;  5TRD A;  2EIN H;  2OZU A;  2ID6 A;  2Y30 A;  2DA5 A;  3ASN H;  4ENK A;  2Z33 A;  2L2O A;  3SYT A;  1XGM A;  3ZQL A;  4AIH A;  1ETX A;  2WAD A;  4CCK A;  1V3F A;  3OIO A;  4AIK A;  1AKH B;  4BE2 A;  1IN4 A;  1WH5 A;  4FET A;  4D5F A;  3H3V K;  1QGP A;  5GAD J;  1ETW A;  1S72 I;  2PMH A;  3ZGK A;  4A0Y A;  2HPI A;  1NK2 P;  2XGE A;  2DYR H;  3I5U A;  2HOE A;  2E71 A;  4U87 A;  2QEN A;  1JGS A;  4DYC A;  2G9W A;  1O3R A;  4HF1 A;  1ZN2 A;  4OIO F;  2X6X A;  3WOD F;  3RZD J;  1XDU A;  3N05 A;  4AYB N;  3OYJ A;  4U7B A;  2HPM A;  1TQM A;  3S32 A;  4E7L A;  5FFX A;  5FRM A;  2XV4 S;  3REO A;  2Y69 H;  1LQ1 A;  4RBO A;  2HOT A;  4XLE A;  3QQA A;  5HOO A;  1R49 A;  4D9J A;  1LFB A;  3OYH A;  1D8J A;  1SFK A;  3DBH B;  3LA2 A;  5HLI A;  3G6E I;  1U5T B;  4RDU A;  3S1Q J;  2XPW A;  3K6G A;  4QTR A;  2E36 A;  2J5O A;  3QYE A;  4HYE A;  4IHS A;  4I09 A;  3MZ8 A;  3Q0W A;  3P5J A;  2JPB A;  3ERM A;  3QPS A;  3HYI A;  4Y3O A;  1WRJ A;  3BRO A;  4AVP A;  3VSL A;  2K9Q A;  1Y6I A;  1WSU A;  2ESH A;  2XGC A;  5JLW A;  3OIQ A;  2FBK A;  4MTE A;  4XLF A;  2XAJ A;  3K2Z A;  1B8I B;  1YJW I;  2J5P A;  5E17 F;  1P4W A;  1UJ8 A;  2BY1 A;  3AG2 H;  3FK6 A;  4PCQ A;  2STW A;  3DPL C;  3J7A Y;  3BPV A;  2K4J A;  3PUB A;  4KMU X;  5KCM A;  3K7A J;  2NVT J;  3KP6 A;  2KJB A;  1U9O A;  1WI9 A;  3WE2 A;  2JRM A;  4LGW A;  3ZMD A;  1W36 C;  5IYC J;  3GZ5 A;  4RGX A;  5HLG A;  1OYI A;  3KZY A;  4FX4 A;  4E7J A;  2V9V A;  2XAH A;  3I0T A;  4YRV A;  3CCQ I;  3J7A O;  4LB5 A;  2FQ3 A;  1J2X A;  3BTL A;  1O57 A;  1OYW A;  5IYB J;  4M3F A;  1DDN A;  3A0H C;  4NBQ A;  5LFA A;  3HZJ A;  1KQ0 A;  1JKP C;  2PMZ A;  3FK7 A;  3AKZ A;  3FDY A;  3CD6 I;  2W57 A;  2E5N A;  1XSX A;  3G4S I;  1XD7 A;  3MN2 A;  2DU9 A;  5L3C A;  4KT6 A;  4P5O A;  2DYS H;  2XKO A;  4ZDP A;  3GUD A;  3IC7 A;  2F5C A;  3DCF A;  3KFW X;  1Z6R A;  2KRF A;  3JRF A;  3BR1 A;  2G0E A;  2RNJ A;  4LB6 B;  3MZY A;  2XAQ A;  1YW7 A;  3SZG A;  4BDY A;  3F0C A;  2DK8 A;  2HOA A;  3GTL J;  1MGT A;  3CJR B;  2PMU A;  3F8C A;  1R23 A;  4RGR A;  3KP7 A;  1DGW Y;  1GXQ A;  3EUH A;  3VOD A;  3QPL A;  1QNT A;  1IN8 A;  2FUG 2;  1TW3 A;  3LFU A;  4UVA A;  1ETK A;  1JT0 A;  2ELK A;  1Y1V J;  4GDF A;  2DA1 A;  3CUQ A;  2VJ5 A;  4U0Y A;  4JOM A;  2MC4 A;  5BOX A;  2MD5 A;  5M5W J;  4IHV A;  3QP5 A;  1PVE A;  3S93 A;  5C3E J;  1Q1V A;  5CVI A;  1PP7 U;  2VBX A;  2QQA A;  2KZV A;  4IRG A;  5D6F A;  4UHT A;  3OSG A;  4ITV A;  5J6X A;  4WXC A;  5EEA A;  3CLQ A;  5JFR A;  3RI4 A;  2XF7 A;  1R5H A;  4X0G A;  1LEB A;  3W3C A;  1G2H A;  1MKM A;  1W4M A;  2ZCW A;  4A3F J;  2ZKZ A;  3KP2 A;  3HDD A;  2O61 A;  3N4M A;  1P9Q C;  4EV0 A;  1DP7 P;  1N77 A;  5F0H A;  1T2K A;  2LOO A;  1X19 A;  2JWT A;  4CCM A;  1R5G A;  1QZZ A;  4RA2 A;  3S1N J;  2D2W A;  1HA8 A;  1IGN A;  3EUA A;  3ONQ A;  1I1G A;  3LMM A;  2DA2 A;  1E3H A;  2O0Y A;  4Q48 A;  2RGV A;  3MZH A;  3NAR A;  4LIT A;  4UUV A;  1D5V A;  2D1V A; 
#chains in the Genus database with same CATH homology
 2LVS A;  2NVQ J;  3S14 J;  1VF9 A;  5FKK A;  2L7F P;  3PM1 A;  1GV2 A;  1O4X A;  1W0T A;  4QIW N;  2FX0 A;  4UUT A;  1BJZ A;  1PUF B;  2R93 J;  2M0C A;  2PMZ N;  2DJN A;  2ME6 A;  3S2H J;  2HOS A;  2R5Y A;  1IRZ A;  5E3M A;  3OSF A;  2O8K A;  1JTY A;  1RKT A;  3HM5 A;  1PUF A;  3RQI A;  3H0G J;  5F1J A;  1GVD A;  3S16 J;  2WV1 A;  1CQT A;  1ENH A;  1GUU A;  4M3D A;  1P7J A;  2MG4 A;  1ETQ A;  3JR9 A;  3JRC A;  2DA7 A;  2ID3 A;  1MBE A;  3C2B A;  2TCT A;  2Y9Y A;  2E2I J;  3IV5 A;  5F0C A;  2VUM J;  1HOM A;  2IEK A;  2DMQ A;  1ZKG A;  3Q3S A;  2X9D A;  3UKG A;  1MSE C;  3LSJ A;  1WGX A;  4G12 A;  3LOC A;  4EEF G;  1AU7 A;  4Y7N J;  2YS9 A;  4V2F A;  2K9N A;  1MBH A;  2M9H A;  5IP9 J;  5GP9 A;  1X2M A;  2DMT A;  4FIS A;  1Y1W J;  3HOW J;  1HCR A;  4C3I J;  3HOZ J;  1X2N A;  5E3O A;  3S1R J;  1TWF J;  1AKH A;  4JX4 A;  5F08 A;  3G1O A;  2IBD A;  2JA5 J;  5EF6 A;  1IDZ A;  3BG5 A;  4A3E J;  2NVY J;  2KT0 A;  1TWC J;  3IH2 A;  5FKO A;  5F27 A;  3I4N J;  2QF7 A;  1RKW A;  2OF7 A;  2GM4 A;  2R5Z B;  1K61 A;  1A6I A;  4D7N A;  5F04 A;  3HKZ N;  1BW6 A;  3WHB A;  4BY1 J;  1QRY A;  4FE7 A;  1MH3 A;  2QCO A;  2Y2Z A;  3OOU A;  4A3D J;  2VI6 A;  1GV5 A;  1ETY A;  3FIW A;  5J1Y A;  5IOZ A;  1MH4 A;  4DZJ A;  3JRB A;  2NOG A;  3A01 B;  4D5C A;  2LR8 A;  1LE8 A;  3HEF A;  2FD5 A;  1I3Q J;  1UHS A;  1BL0 A;  2EH3 A;  3M3Y J;  1FIP A;  3B6C A;  1B72 A;  5C4X J;  1IC8 A;  4A93 J;  2XSD C;  3Q0U A;  3JRA A;  2XPV A;  4A3M J;  1NK3 P;  2DA4 A;  3BR0 A;  1FJL A;  3ZQG A;  2JMW A;  4XRM A;  5IPA A;  2DMN A;  3RZO J;  2WB1 N;  3JRH A;  3CMY A;  4BXX J;  2LD5 A;  2CU7 A;  1ETV A;  1JUP A;  4CYC A;  1T56 A;  4BBR J;  1GDT A;  2X6O A;  1MBK A;  1JKQ C;  3Q0V A;  2R7Z J;  1T33 A;  5BNG A;  2COB A;  4MO7 A;  4X6A J;  2LP0 A;  1H89 C;  4IEJ A;  1WCM J;  2DA3 A;  2HXI A;  1MBJ A;  4V2G A;  1W0U A;  1B8I A;  1R9T J;  5C44 J;  1IUF A;  4M3G A;  1GT0 C;  4BY7 J;  2R5Y B;  2M34 A;  3ZOB A;  3S1M J;  3ZQF A;  1S7E A;  2L7M P;  2HDD A;  2ECC A;  1ZR4 A;  2VKE A;  4B1R A;  1B72 B;  3O8H A;  2XB5 A;  4B3A A;  4A3B J;  1SAN A;  1A5J A;  4S0H B;  2YUS A;  4JYK A;  1JTX A;  2ECB A;  4MFE A;  1HLV A;  1HDD C;  1FTT A;  2FJ1 A;  1MNM C;  2B63 J;  1F36 A;  9ANT A;  2Y9Z A;  5E3N A;  4I6Z A;  1JUM A;  3HOU J;  3BQY A;  3BQZ A;  3M4O J;  4AUX A;  1LE8 B;  3WHC A;  2XPU A;  3O8G A;  2E2H J;  2JA7 J;  4DYR A;  3D1N I;  1ZGW A;  4ABZ A;  2DTZ A;  3A02 A;  4L5E A;  5JLX A;  2K40 A;  3CQZ J;  1NTC A;  2EZK A;  2TRT A;  3BTC A;  3LNQ A;  4X1E A;  4J19 A;  2X48 A;  4A69 C;  1ZTR A;  2DMP A;  5IOY A;  3BG3 A;  5K7Z A;  4JP0 A;  3L1P A;  2E19 A;  4XK4 A;  1VFC A;  3G1M A;  1I50 J;  2L0K A;  3SJM A;  5EZH A;  2I10 A;  4XRS G;  3HOV J;  1QVT A;  3MKL A;  5M3M J;  4A3I J;  2OPT A;  4M3E A;  4DZP A;  2R92 J;  3BR5 A;  3TP0 A;  3LSP A;  2DA6 A;  1EF4 A;  1XG1 A;  1F43 A;  2XB0 X;  5E3L A;  1XC5 A;  5EGO A;  2NS8 A;  2FQ4 A;  4FE4 A;  1JUS A;  2AO9 A;  1RET A;  5K7F A;  3GTP J;  4I76 A;  1RES A;  4DW6 A;  4BKX A;  4AC0 A;  2JA6 J;  2JJ7 A;  2HYJ A;  1QVU A;  4W97 A;  2KDZ A;  1H8A C;  1HDP A;  5GPC A;  4Y52 J;  1OJL A;  3BG9 A;  3BT9 A;  5J3L A;  3IH3 A;  3RKQ A;  1HF0 A;  4DYQ A;  5EYR A;  3LSG A;  5FKN A;  1TWG J;  1TWH J;  2CUE A;  4FCY A;  3TED A;  3TW7 A;  3FIS A;  2VPR A;  1TC3 C;  3ZQH A;  4A3C J;  5IYD J;  1LFU P;  1UMQ A;  4B4C A;  1ZQ3 P;  3A01 A;  1JKO C;  2LLK A;  2R5Z A;  3I4M J;  1VI0 A;  2LFB A;  3CDL A;  3HGG A;  4W1U A;  4XID A;  1WI3 A;  1P7I A;  1APL C;  2ID6 A;  2Y30 A;  2DA5 A;  2E1O A;  3B6A A;  5J1U A;  3ZQL A;  3JRD A;  1ETX A;  2XGD A;  4BBS J;  4HNV A;  5EGO B;  3A03 A;  3OIO A;  1AKH B;  1WH5 A;  1YRN A;  1IJW C;  2LKX A;  3GTJ J;  4D5F A;  3H3V K;  1ZK8 A;  1ETW A;  1NK2 P;  5K7H A;  2XGE A;  3HBL A;  2M8G X;  4NDL A;  4DYC A;  4M3B A;  3PO3 J;  1X58 A;  2JA8 J;  1U9N A;  2ME0 A;  3RZD J;  1FIA A;  4D7M A;  3HOY J;  2AHQ A;  2R0Q C;  2D5V A;  4MLO A;  1Z0X A;  4AYB N;  1YRN B;  4JX6 A;  4UUS A;  1I6H J;  4A3J J;  4RBO A;  2IAI A;  3ZQI A;  2HOT A;  5C4J J;  2K9S A;  3QQA A;  2E2J J;  2GLO A;  2EZH A;  5M5Y J;  3G1L A;  4FTH A;  1OCP A;  4UUS B;  1LFB A;  3S15 J;  2EZI A;  2O9L A;  2JN6 A;  1JGG A;  4RDU A;  3S1Q J;  2XPW A;  4QTR A;  1QPI A;  2RAE A;  3HGY A;  1OCT C;  4A3L J;  1H88 C;  2WAQ N;  3Q0W A;  5M5X J;  2HQ5 A;  1SFO J;  1FEX A;  2CUF A;  3QPS A;  5EZG A;  3S17 J;  2K9Q A;  4MFD A;  2EZL A;  2XGC A;  5JLW A;  1WH7 A;  2EQR A;  5EDN A;  4XIC A;  5IP6 A;  1B8I B;  2W48 A;  3PO2 J;  1ETO A;  1DU6 A;  5DS9 A;  3FK6 A;  3MVP A;  1VND A;  4JX5 A;  3SFI A;  2CQX A;  4MIM A;  3HB9 A;  2P81 A;  3SDG A;  3JRG A;  3GTG J;  5F0F A;  5FJ8 J;  3GTK J;  3K7A J;  2NVT J;  1ZR2 A;  4LOC A;  1U9O A;  1JKR C;  5DTD A;  2ZB9 A;  4M6V A;  5IYC J;  2DN0 A;  4C3H J;  2MGQ A;  2L7Z A;  1IV6 A;  2O7O A;  3ZQC A;  2MW8 A;  3BTL A;  5IYB J;  4M3F A;  2GBY A;  1DU0 A;  2VKV A;  3W6V A;  1ITY A;  2LTP A;  1JKP C;  1WPK A;  1K83 J;  3FK7 A;  3BTJ A;  4QSH A;  3MN2 A;  1IG7 A;  3DEW A;  1JJ8 C;  5EG0 B;  3GTO J;  3BR6 A;  1JT6 A;  3DCF A;  3CCY A;  3JRF A;  5HOD A;  3BR1 A;  5J1R A;  5FKL A;  2G0E A;  4A3G J;  3GTM J;  1OFC X;  5IP7 J;  2CJJ A;  3NAU A;  1E3O C;  3E7L A;  3BR3 A;  1UG2 A;  2HOA A;  3F0C A;  5GPA A;  3GTL J;  2NVX J;  4A3K J;  1POG A;  2L9R A;  4IHW A;  3QPL A;  1IDY A;  2HXO A;  5FLV A;  1U78 A;  3K2A A;  2YU9 J;  2HI3 A;  1Z77 A;  1JT0 A;  1ETK A;  5FKM A;  2ELK A;  1Y1V J;  1FTZ A;  2DA1 A;  3TP3 A;  3GBG A;  1D5Y A;  2CRG A;  5M5W J;  4IHV A;  2CQQ A;  5M3F J;  5C3E J;  2M2E A;  1Q1V A;  1BA5 A;  2XRL A;  4XRS A;  4IHY A;  1RR7 A;  3OSG A;  5EEA A;  1MSF C;  2MSY A;  1G2H A;  2LK2 A;  1ORK A;  4A3F J;  1MBF A;  1JJ6 C;  4C3J J;  5EG0 A;  1MBG A;  3GTQ J;  3HDD A;  3TW6 A;  1U8B A;  4IHX A;  2H8R A;  5F0H A;  2JWT A;  3HOX J;  3VPR A;  2EBI A;  2NS7 A;  3S1N J;  1AHD P;  2Y31 A;  1BW5 A;  2DMU A;  2Y0S N;  3JRI A;  1IGN A;  3BR2 A;  1RPW A;  1TWA J;  4CYC B;  4C2M J;  3JRE A;  2DA2 A;  3S2D J;  3FKI J;  3BTI A;  2JK3 A;  2H1K A;  3IH4 A;  3NAR A;  2LY9 A;  5FLM J;  3LSR A;  4GFB A;  2N8G A;  1XS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...