3M1EA

Crystal structure of benm_dbd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Crystal structure of the unbound LysR-type transcriptional regulator BenM DNA binding domain
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription regulator
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m1eA00
5HDNA 2XV4S 1BIAA 3F6VA 2CSOA 2COMA 3J81Z 2NRAC 4DQ2A 4EM0B 4G9YA 1XGNA 1F9NA 2PJPA 4LGWA 4U0WA 5FFXA 3K1NA 5D4SA 4G7ZF 3DKWA 5IT9Z 3KZYA 1JHFA 1SD4A 4EJTA 2P6TA 1U5TC 2KIMA 5LEJA 5F1RA 2YPRA 3F8CA 5DYMA 1KYZA 3BWGA 4IRIA 3BJAA 3V8KA 1VTNC 5LGNA 2VBWA 1J7KA 1R5HA 5D6EA 2A6HF 1E17A 1T38A 2DI3A 4M74A 2DQLA 3TDUC 1SMYF 5CVVA 2V6CA 1IF1A 3WTZA 3WTUC 1B1BA 4HBLA 3GLXA 2GAUA 2P8TA 2NNYA 2Z99A 4L9TA 5ED4A 4KUMA 3WTYC 3M7GA 3BPXA 2AS5F 2XUBA 3EUHA 1RUNA 4HF2A 5JFRA 4Q5SF 2LF8A 4OIRF 5J8CA 3I59B 2EWNA 2KJBA 5CVUA 5AONA 2P6SA 1IW7F 4EQQA 1HQCA 5L3CA 2Z33A 1USTA 1W5SA 1OR7A 2Q0OA 3SZTA 2EFQA 3IRRA 4FX4A 4AIKA 3M8FA 3ZQ7A 3DEUA 4JQFA 5E17F 1TNSA 4CZZA 3P9KA 5CVRA 3C18A 5ICGA 2VC0A 5L3FA 4EGZA 2Z9OA 1I5ZA 1T2KA 3HRUA 4ZYEA 1SFUA 4I01A 1KQ0A 4UV9A 4WCGA 2XAGA 5HDKA 3KP7A 1QGPA 3TO7A 5ILSA 5LGTA 2IRFG 4B09A 2OU2A 3DFGA 3L7WA 5D8LB 4LLGF 5FO5A 4RAZA 3GZ6A 3GFLA 4G8XA 2M5WA 1TLHB 1XMKA 2GA2A 3FF5A 3VODA 2MLKA 3J80Z 1R5GA 4LMYA 2M1BA 2WWYA 4G6DA 2KKOA 3HHGA 4L9NA 4LK1F 3DPTA 4FHTA 3BPVA 1YLFA 3K0LA 2XKPA 5IT9K 2GIVA 2FSWA 4OIPF 4S04A 2A07F 3BZ6A 3EDPA 4GO1A 1MDMB 3WGGA 1R1TA 4EM1A 1ON1A 5CYVA 3OV8A 2BGCA 5LHHA 1H9GA 2OZ6A 2VBXA 1FX7A 3T8TA 4EV0A 1I1GA 1O57A 5DCMB 1X3UA 1H0MA 4DNCA 1IN8A 1EH6A 1HW1A 1G4DA 4Z2YA 4HDUA 4RS8A 3WTSC 1R00A 3N4MA 3DQVC 4K2EA 5CVIA 1KYWA 1UCRA 1OKRA 3PQJA 2Z5UA 3R6SA 1QPMA 1LEAA 4CICA 3CLOA 2VONA 2L4MA 1G3SA 1S29A 2PEXA 3WU0A 4RB1A 1DUXC 1OYYA 3CUQA 4KA4A 3SZPA 4G94A 5HLGA 2K7LA 1HXDA 3LWFA 2HR3A 3QPHA 2L54A 4HF0A 1IZ1A 1SFEA 4GXOA 4BNCA 4AIJA 3Q5FA 3JTGA 4JBAA 1FBUA 5ICFA 1CGPA 5EEHA 3ZP5A 3WE2A 4CGZA 3I4PA 2FXAA 2A61A 5L3EA 1MD0A 1I6XA 2L3DA 4AVPA 3CTAA 2RNJA 1KGSA 2A5YB 2K4BA 3MFKA 5E8IA 5LEKA 3RTRA 5ERIA 1XCVA 1Z1DA 2EFPA 2BV6A 5EEGA 2H09A 4KT5C 4R1HA 5L3GA 2LDUA 4EM2A 3L2CA 1XSVA 3R0JA 1KQ9A 1YYVA 5E18F 5D5XB 2ZMEA 3ABUA 2HQNA 1XCBA 2QBYB 3J80K 2D2WA 4ZYDA 3CJNA 2QQBA 1RUOA 3I71A 4KNYA 4YFXF 3JTHA 4M6YA 4MQ9F 1QZYA 4N0BA 4L9VA 3CO6C 2ETHA 2Y0MA 4A6EA 2NAZA 1KU2A 1O3TA 4IRGA 3HRTA 1FOKA 4IHSA 4AWXB 2K27A 1ZHFA 2JPBA 2DQRA 3O6BB 2WC2A 3FM5A 4KFCA 1LJ9A 3T0YA 3GFJA 2FNPA 3E6MA 3RPUA 3CUQC 2Z3YA 4HW0A 2EB7A 2GQQA 1MDMA 4IF4A 4UNOA 4G7OF 1I27A 4ENKA 4D0PA 1H9TA 1BIBA 2DK5A 1FBQA 2FMLA 4TV7A 4UVCA 2EV5A 1WQ2A 1XGOA 2XAFA 3LQQA 3HHHA 3RKWA 1LNWA 2DT5A 2HEOA 4ETSA 4RGUA 1LQ1A 1QO0D 3HIFA 4LG0B 4A6DA 2H6BA 1EH8A 2QUFA 2VOOA 4AIHA 1I1SA 3WE3A 1BJAA 3WGHA 2DAOA 1B9MA 1IN4A 5BPIA 3E6CC 3TKYA 2ZKZA 3WTTC 4M9SA 2JPCA 4M9XA 1V4RA 4CDGA 3HTUA 4FT8A 4I0AA 3BROA 1K79A 4GYIA 1R58A 2QQ9A 4HF1A 2Y48A 2RDPA 1RI7A 2IW5A 4MTDA 2QYOA 2E1NA 3W6KB 2VODA 1W7PB 1K78B 4MNUA 3C7JA 4BQAA 3R60A 2YSRA 2F5CA 4HV5A 1ZG3A 3DPLC 2L02A 3MZYA 4N9HA 3U2RA 4HA8A 3T1BA 4EVIA 1CF7B 1ZLJA 4N9IA 2MH9A 1ZARA 2ZO4A 3QPTA 1YFHA 1V3FA 2H6CA 3M1EA 1MJBA 1LDKB 3ERED 2HKXA 1B4AA 1GHCA 2PFBA 3JAMK 1QNTA 4IPAA 1KU9A 4P96A 1R1UA 5LRSA 1S6LA 2LF7A 2DPDA 1R36A 5LHIA 2R7DA 5LLQA 4EJWA 5A2QZ 4FX0A 5HS7A 3VB2A 2B0LA 4O5VA 3KLNA 2EFWA 4ENMA 1S3JA 3GUDA 4ON0A 3FMRA 2D1HA 2Q8KA 3P9IA 2PMHA 2JSCA 1FBSA 2FOKA 4P55A 2R7FA 2VBYA 3ZMZA 4A0YA 1SFXA 3E5QA 1IXRC 3LSTA 2RQPA 2CFXA 3K2ZA 2DPUA 4YFNF 3LFKA 2VOPA 2QZ8A 1YW9A 1J0RA 2CGPA 1DDNA 3IRQA 3I64A 1O3RA 5TJJA 4YFKF 2ZNYA 5JI6A 3GF2A 5AIPA 1KU7A 1IAWA 2F2EA 4ZYGA 2RGVA 5LBQA 2EJRA 4OMZA 5J6XA 4XSXF 3KP6A 1MJ9A 2KJCA 1R1VA 1XMAA 1F5TA 4M71A 5K1YA 3F72A 2DTRA 1YS6A 4XLPF 3GXOA 2FE3A 4Y15A 4B8XA 1ZH5A 2MH2A 1G3TA 5FB2A 2CWEA 4KICA 3QU3A 4LK0F 2ADUA 2MBFA 4LG0A 5FLXZ 1IXSB 2X0LA 1C0WA 3H3UA 4UHTA 3TDZC 1Z6TA 3KP3A 1ULYA 3I54A 3SFZA 4PZJA 5E1ZB 3ML6A 4XBFA 5HOOA 1QBJA 4NHJA 4Y17A 1BM9A 2DLLA 2FBIA 2ISYA 2RVCA 4EJUA 3RYPA 1A04A 4Q47A 4KN7X 1W7PA 2WTEA 2FEZA 3HOTA 2PLYA 3G73A 4L0YB 3KP4A 4RGXA 3NRVA 4ENJA 4L18B 3GVAA 2D45A 1MGTA 4P9UA 4OIOF 5F64A 4R79A 2FF4A 1CF7A 3J81K 1ZLKA 2L01A 4MEXF 1GXPA 1PP8F 3BJOA 3TQNA 2GA1A 3V8JA 5HLIA 4QWQA 2H27A 2HZTA 3K1PA 3MCZA 3H92A 1EV7A 5K5QA 2GXBA 3QU6A 4HZFA 4Q48A 3JSPA 1T98A 4L5JA 3FMQA 6PAXA 1HKQA 2UXNA 5BQTA 3R61A 2V1XA 4HLYA 1FSHA 1LDDA 3OOPA 1XD7A 3G3ZA 1FY7A 3EQLF 1D3YA 4UUVA 3L09A 4EMSA 3HTSB 3ABTA 4ZZDA 4PGGA 3L00A 2Q2EA 4WXHA 1P4AA 3U1DA 5BOXA 2VBZA 3ZMTA 3IWFA 1IUYA 4ESBA 1FSEA 1BI0A 1FYKA 2FNAA 1K6OA 1JXSA 4P5OA 4KYWA 4XSZF 2G7UA 3MWMA 1T0FA 1JGSA 1JHHA 1HSTA 1O3SA 3S2WA 5DCFA 3TGNA 1ZG5A 4IXAA 3LA7A 1OMIA 1REPC 4HX8A 2IA0A 1FNNA 2RC4A 4H0EA 3WODF 2F5DA 4ASNA 1IXCA 3VEPA 1S7OA 5E1WA 5BPDA 2P5LC 4QLCU 3BP8A 4MEYF 1ZREA 4Q4ZF 4U0VA 3COAC 4Y13A 2EK5A 3LA3A 4YIFA 3I59A 4MQVA 3U9GA 3GFIA 2RKHA 1RZ4A 4BHCA 4A12A 3F23A 3BOQA 3TO9A 1XSXA 3I53A 1ON2A 3GWZA 1LDJA 2O8XA 3SHFA 4AD9A 5DD8A 2M87A 1F4KA 4IRHA 4PGHA 3I5UA 1USSA 4MGRA 3EYIA 1LB2A 4CHUA 2DFIA 3TOAA 2KRFA 3MZHA 4A5MA 3I0TA 1XGMA 3NQOA 3F22A 2BEOA 2PBIA 3Q9VA 1UFMA 1WRJA 2OD5A 4BYYA 1JE8A 3HYIA 3VOEA 3KETA 3Q9SA 3O2PE 2F5EA 2LNBA 2DK8A 1RIOH 1B9NA 1TW2A 2H94A 4KDPA 3HSRA 4GYGA 1AOYA 1OYIA 3IWZA 3R0AA 1DPUA 1IN6A 1FZPB 4EJVA 2FQ3A 2XRNA 3GEZA 4NB5A 3PFIA 1TBXA 1LVAA 1Y0UA 3DP7A 4WF2A 2ACJA 3IHUA 2K4JA 3E97A 3FWEA 2CO5A 3ZMDA 4M73A 1Z9CA 1ZRDA 4F7ZA 3ISPA 4HV6A 1EH7A 4HQMA 1J75A 1YO5C 1TW3A 3T8RA 3H3ZA 2ZFWA 4LFUA 4IHTA 3WTVC 3B73A 4BH9A 1BC8C 2ISZA 5KK1A 2QENA 1TQPA 2YX7A 1U3EM 2HOEA 2UZKA 4HYEA 3F8FA 3HRSA 3MQ0A 1O3QA 1MJAA 2VE9A 5JHUA 5ILUA 2FRHA 1O7LA 5DCMA 1YQAA 2QVOA 2M45A 1HW5A 1B59A 3FXUA 3QRFF 5AIQA 1XSDA 4A0ZA 2ELHA 1D8JA 2DO7A 1FLIA 1Z7UA 2XAQA 1PP7U 3V7CA 1QQIA 1OYWA 1ZAOA 2QLZA 1OPCA 4EJOA 2YX4A 2OBPA 2X4HA 2KIFA 1P6RA 2MC3A 3MEXA 2HDCA 2A68F 1BI3A 3EYYA 1TTYA 4KIFA 2VXZA 1PDNC 4LB5A 3REOA 4A2UA 3F8BA 1ZGAA 1E2XA 2K02A 4BHBA 2WV0A 3ZN1A 4L0ZB 3RKYA 4I0BA 2GZWA 1J2XA 1T39A 2ESHA 3P9CA 3F8MA 2G9WA 3AAFA 1P92A 4RB2C 2DW4A 1D5VA 4HQEA 2HYGD 5HS9A 3J7AO 2ZBKA 5D5VB 2CW0F 4L5IA 1HKTA 1RNLA 4UXNA 3GYHX 1TNTA 5FFZA 4I2OA 2CG4A 2A3SA 4RAYA 4CO8A 3KE2A 5LHGA 1P4XA 1O7FA 3E5UA 3NEUA 2MLGA 5BMZA 2PG4A 3KLOA 2IA1A 4I09A 2XHKA 4MHGA 2V79A 3IC7A 2C6YA 5DV5A 1LEBA 2P5VA 2OAZA 1BBYA 4O6JA 1FP2A 1UB9A 1NHAA 2CQKA 2HTSA 3ELKA 4L9JA 2BYVE 4U7BA 1P2FA 3ZMVA 3BJ6A 3VFZA 1SD7A 2ZCWA 2QBYA 2VT2A 1BC7C 2O0YA 3PQKA 4HX7A 5ILVA 1R22A 5KVRA 1T6SA 1IRGA 3CDHA 1S7AA 3RPQA 2XVCA 1W5TA 5BS6A 1U2WA 3KFWX 2W57A 4CYDA 4O3MA 3BDDA 3FMSA 3KEQA 2J5OA 1ODDA 1G6NA 3D5LA 3JSOA 5L3DA 1SMTA 3RIRA 2XAHA 4GCVA 3C3WA 1TQIA 2FBHA 5LRRA 4HLXA 4WX9A 5CLSA 5CVJA 4ENNA 1L0OC 1G3YA 2MD5A 2P5KA 3CUQB 1G3WA 3R4KA 2BBYA 1Z05A 3CO7C 5JR3A 2HGCA 2LSOA 3SQNA 4IVNA 2XROA 4G6QA 3IKVA 4LLLA 4XRFA 1S8NA 1XDUA 1W4MA 2O61A 3RDIA 2K86A 2HFHA 2BE5F 2E7XA 4KIBA 4EGYA 2HS5A 1P4WA 2STWA 2RV8A 1BI2A 2RN7A 2JT1A 5FGMA 2KIUA 1MKMA 1Q1HA 5E1XA 2R3SA 2XAJA 3HOSA 3IL2A 4XLNF 5F6FA 4U7DA 3ZMSA 3IKTA 1KU3A 2O6GE 4KIGA 4JK1X 5H6QA 1FC3A 4UVBA 4RB0A 3MAJA 3KP2A 1ZGJA 1K78A 1SD5A 3E3VA 1XB4A 1ZN2A 2AXLA 4WK8F 3HSFA 2IJLA 5H6RA 3KP5A 2P7VB 2O03A 2ZMEB 3D0SA 2PI0A 4BHPA 1U6GA 4MTEA 2A6EF 2FMYA 2XIGA 4ZYHA 3JW4A 3GZ5A 5A2QK 2W84A 4R8HA 2VT3A 4U0YA 4G7HF 3V4GA 1AWCA 1FP1D 1IRFA 1ZRFA 2DBBA 1F1ZA 1ZYRF 1TQMA 2ZNZA 2IVMA 2NYXA 5FD6A 3ROUA 5K5OA 1YW7A 4OIQF 2ZXJA 1PUEE 2M8EA 4RGSA 2OA4A 2QM3A 3WTWC 1FWZA 3L9FA 3T5XA 1L3LA 1U5TB 3M9AA 4WWCA 2OZUA 2UXXA 4UV8A 3TO6A 4LD5A 3O3KA 3KEOA 4S05A 4OOIA 2V1DA 3B02A 5K5RA 1YIOA 4ZH4F 5IT3A 1FT9A 4YIIA 5JVTA 5L3BA 2L4AA 3V7RA 3WGIA 1XGSA 2IPQX 3RI4A 2XGXA 4RGRA 3SXYA 1B6AA 2JZYA 4A0XA 2PMUA 3F3XA 4OMYA 1QZZA 4ESFA 3FM3A 1J5YA 5HDGA 2MA3A 3RJPA 2F5FA 1WWXA 4KMFA 3TOBA 3GFMA 4OINF 4I98B 2FBKA 2TDXA 1Z91A 4LLNA 2EV6A 3FX3A 4BAYA 5FLXK 4HDVA 5HS8A 3FXRA 1K7AA 4WXCA 1U78A 1ZG1A 4ESJA 4YG2F 1UHWA 2YR2A 3LAJA 2D1VA 2E7WA 5ICCA 1SAXA 2VE8A 3ULQB 3HSEA 2EFNA 1KQ8A 5E8GA 5DUKA 1YW8A 5HLHA 5D6FA 4I02A 3DF8A 1J59A 5DEQA 2W25A 2P4WA 2GXGA 1GVJA 4M72A 2Y75A 3LAPA 3K1MA 2V1UA 3QP6A 1D8KA 2OQGA 5TRDA 5D4RA 3JAMZ 2HYFA 5DD4A 3HRMA 1DPRA 3QOPA 2EFOA 3GX4X 2JRTA 2E1CA 2NS0A 2QWWA 2M30A 2W24A 4PDKA 1UHMA 3E6DA 2FU4A 3QAHA 3E6BA 1WKMA 2VC1A 1BOAA 3WG9A 1FYMA 1HSJA 2DU9A 3EETA 1IN7A 1XDSA 1YS7A 3K9TA 3BY6A 1WSUA 4LB6B 2HKOA 4I7HA 2ZJ2A 1FPQA 5J8FA 2OQRA 5ICEA 5D8KB 4RB3C 2O3FA 1HW2A 4WXDA 3V7SA 4LJZF 4UVAA 4A5NA 4P9FA 3GO5A 2EV0A 2LKPA 4U88A 5DUIA 4E70A 2XKOA 3E5XA 2GWRA 2XASA 1W7PD 3N97A 3ECHA 1WI9A 3KZZA 4NQWA 4PCQA 2W85A 1MZBA 5H20A 4HX4A 3ZN0A 3GW2A 3RKXA 1U5TA 3FZVA 1ONVA 1YG2A 4HAMA 3DV8A 1DP7P 2CYYA 4OU0A 2A69F 3RYRA 5HVQC 5D5UB 4GGGA 4ZZLA 2STTA 2UWMA 5D5WB 2PQ8A 2HQRA 3FHZA 3FXQA 1R7JA 3I58A 2QQAA 2NNNA 4KMUX 3KCCA 1STZA 3DXJF 2J5PA 1XN7A 1BN5A 3K69A 3QP5A 2JTVA 2YU3A 3LA2A 5FD5A 1J9IA 2V9VA 5LGUA 1BI1A 3CUOA 3WU1B 2IA2A 3HUGA 5CJ9A 2VN2A 4IJAA 3W6JB 2IP2A 4M9ZA 3C1DA 2HWVA 2HTJA 2IT0A 3LQRA 1HBXG 2G7HA 3F6OA 4CXFA 4HOBA 3M8EA 2PN6A 1YTYA 2EA4A 1ZRCA 3ZPLA 3F21A 2FA5A 3F8NA 3WTXC 5E20A 1SD6A 4KN4X 4M6XA 2ESNA 5DDGA 3ZMUA 3ECOA 4BXUA 1FYLA 1KA8A 2EA2A 1R23A 2P7CB 3V8LA 3P7NA 1Z6RA 1GXQA 1IN5A 1U8RA 1HKSA
chains in the Genus database with same CATH superfamily
4LIUA 1S9HA 2VQCA 5HDNA 2XV4S 5J1YA 2VPRA 1D0YA 3U1KA 1BIAA 3F6VA 2CSOA 2Y0SA 4BE0A 2COMA 3IP4B 3J81Z 2NRAC 4DQ2A 4EM0B 3PIOF 4G9YA 3FDYA 1XGNA 1F9NA 2PJPA 3BR6A 5GPCA 4XQFA 4F93B 2LR8A 4LGWA 4U0WA 5FFXA 3K1NA 2O9LA 5D4SA 4G7ZF 3DKWA 4OWRB 5IT9Z 2R5ZB 3KZYA 2KDOA 1JHFA 2VJIA 1SD4A 4EJTA 5B3SH 2P6TA 1U5TC 3HC7A 5HNFA 3DLLF 3H3VK 3CF2A 2KIMA 4ZYAA 1YJWI 2E5NA 3ESWB 5LEJA 5F1RA 3DKXA 2GM4A 1X2MA 2K5CA 1TWAJ 1B72A 3FBNB 2Q2EB 2YPRA 3F8CA 5DYMA 3AG4H 3EUKL 1KYZA 3BWGA 4IRIA 1M1EB 3BJAA 1JKPC 3FISA 3V8KA 2WAFA 2E71A 1VTNC 1K6YA 5FKLA 5LGNA 2VBWA 3OR1C 1J7KA 1R5HA 1RR7A 2NVQJ 4XN3A 2CFOA 5D6EA 2A6HF 1E17A 1T38A 5J47A 2DI3A 1T95A 3OIPA 4A3GJ 1WJ5A 4M74A 2DQLA 1JJ6C 1YRNB 1X19A 1MMGA 3TDUC 3VSLA 1SMYF 1LVKA 3OL4A 5CVVA 2V6CA 3UKGA 1IF1A 3WTZA 3WTUC 1B1BA 3H5RA 3BTJA 4HBLA 3GLXA 1TC3C 4RAFA 3OWTA 1N77A 2GAUA 2P8TA 2NNYA 2Z99A 4L9TA 2ZXHA 4A3DJ 2ZSHB 5ED4A 1O4XA 1PUFA 2DA5A 3ASNH 1I39A 2VKHA 1Z0XA 4KUMA 3WTYC 3PIPF 4AU7A 3M7GA 1MH3A 3K6GA 1X1PA 1E3HA 2RQQA 3CMMA 3BPXA 4PUSA 2AS5F 2B7EA 4RDUA 2GLOA 2UV1A 2XUBA 3F0CA 2E1MC 3EUHA 1RUNA 4HF2A 1AU7A 5JFRA 4Q5SF 2LF8A 3EPZA 1FEXA 4OIRF 4ZC3A 2JA7J 5C3EJ 1JUPA 5DTDA 5J8CA 1JKRC 1FOXA 2F4IA 3I59B 2KIQA 2EWNA 3BQZA 2KJBA 5CVUA 1WGXA 4JX4A 5AONA 2P6SA 2CV0A 3S2DJ 1IW7F 4EQQA 3VWBA 1ENHA 1HQCA 1GT0C 5L3CA 2Z33A 2TRTA 1USTA 4A3FJ 1W5SA 1OR7A 1YE9A 2K9NA 2Q0OA 2BVMA 2HPIA 3SZTA 2EFQA 3IRRA 3O8HA 2K3FA 1NG7A 3W2AA 4FX4A 4AIKA 3CJQB 3M8FA 3DEUA 4G6TB 1UMQA 3ZQ7A 4JQFA 1DGRM 1XC5A 1QA6A 5E17F 1TT0A 1WVRA 1IG7A 1TNSA 1VQPI 3KZIC 4CZZA 3P9KA 5CVRA 3C18A 4B4CA 5ICGA 2VC0A 5L3FA 4EGZA 2Z9OA 5FRMA 3HOVJ 4BEHA 3IH2A 1JTYA 4LG3A 1I5ZA 4EEFG 1T2KA 3HPHA 1ITYA 3HRUA 4ZYEA 1SFUA 4I01A 2LY1A 4A3EJ 3CP2A 3VYRB 1KQ0A 4UV9A 4WCGA 2JA8J 2LOOA 2XAGA 5HDKA 2HDWA 4DBQA 3KP7A 4UUSA 1QGPA 4IEJA 3TO7A 5ILSA 1MMNA 4D7MA 1WJFA 2IXSA 5LGTA 2KP6A 4M3GA 2IRFG 4B09A 2OU2A 5LFAA 3DFGA 4BBSJ 3L7WA 3PM1A 5D8LB 1GDTA 4LLGF 5FO5A 4OAZA 3HL2A 1ZQ3P 1YITI 1SC7A 4FCYA 2X1DA 4RAZA 3GZ6A 1PVEA 2X6WA 2MFZA 3BR2A 3GFLA 3GBGA 1HDDC 3QYEA 3CJTB 4G8XA 2M5WA 1TLHB 2Y2ZA 1A5JA 3Q0VA 4AUXA 3HGGA 1XMKA 2Q1ZB 3SDBA 1Z3YA 2L7FP 1MBGA 2GA2A 5B5EC 4DBRA 3FF5A 3VODA 3L1PA 2MLKA 3J80Z 1R5GA 4LMYA 2M1BA 2WWYA 1UZCA 4G6DA 2KKOA 3HHGA 3HGYA 4L9NA 3WHCA 4LK1F 1A31A 3SYTA 3DPTA 3IAM2 2JWTA 2Y9ZA 4FHTA 3BPVA 1YLFA 3K0LA 3AFHA 4OAYA 2XKPA 2IGNA 4F55A 5IT9K 2GIVA 5FKMA 2FSWA 1VQLI 4S04A 2A07F 4OIPF 2R7SA 2E1OA 3OYCA 3CCLI 3BZ6A 2LRDA 3EDPA 4GO1A 4E6KG 1MDMB 4ZDOA 3WGGA 5GAEJ 3I4MJ 1QVTA 3FHNA 1R1TA 2BY2A 3ABMH 3VPRA 1ON1A 4EM1A 3EUHC 2NVXJ 1X3WB 5CYVA 3OV8A 2BGCA 5LHHA 1H9GA 2OZ6A 4AIDA 3PO2J 1V55H 1VQ5I 2VBXA 2E5ZA 5B66C 1X1BA 1FX7A 4XL9A 3T8TA 1ETOA 1FTZA 3ONQA 5F0FA 4EV0A 1I1GA 1O57A 5F0HA 5DCMB 3CC2I 1X3UA 3K4BA 4GRIA 1OR7C 1H0MA 4DNCA 1IN8A 2EIMH 2ELKA 5F0CA 3OYHA 2R7ZJ 3FBIB 1EH6A 1HW1A 3LNQA 5JVGF 2M3AA 3OOUA 1ZELA 1G4DA 2X48A 4Z2YA 2PMZN 4HDUA 2QGUA 4RS8A 3WTSC 3H35A 1R00A 4QSHA 3N4MA 1FJLA 3DQVC 2L7MP 4K2EA 2XB0X 3NWTA 5CVIA 1KYWA 1UCRA 4XICA 3GTKJ 4XIDA 1OKRA 1AHDP 3PQJA 2Z5UA 2PJRB 3R6SA 1QPMA 1LEAA 4CICA 3CLOA 2VONA 2L4MA 1G3SA 1I3QJ 4FISA 1YHQI 1S29A 4A93J 3OYKA 2MC4A 2PEXA 3WU0A 4RB1A 1DUXC 1OYYA 3I56I 3CUQA 4KA4A 3SZPA 3OYBA 4G94A 5HLGA 3MKLA 3Q0UA 2K7LA 1XS9A 1HXDA 1UHSA 3H36A 1SVMA 3LWFA 4E7SA 2CUEA 2HR3A 2F4OB 1QHGA 3F9KA 3QPHA 1MNEA 2UUZA 2XF6A 2L54A 4HF0A 4KISA 1IZ1A 1SFEA 4GXOA 4A3KJ 4BNCA 2VUMJ 2R7VA 2K9LA 4AIJA 3LMMA 1ZR4A 2GIZA 1N75A 3UR3C 3Q5FA 3JTGA 4JBAA 1FBUA 5DM6F 3L2RA 3QQAA 4XOPA 4X6AJ 3OIQA 4D1QA 5ICFA 2EILH 1CGPA 5EEHA 3ZP5A 2BHZA 2JK3A 1HC8A 4E7ZA 3WE2A 1QRYA 4CGZA 3I4PA 2HXOA 2L9SA 2WADA 2XPUA 3G1OA 3HEFA 2QA4I 2XF5A 2FXAA 3LSPA 2A61A 5L3EA 1MD0A 1HOMA 1I6XA 2WB1N 2L3DA 2LC2A 3S1NJ 4II2A 4AVPA 4NNJA 3CTAA 3K70C 2RNJA 3OS1A 3S16J 4E4HA 1KGSA 3DU5A 3ZCOA 2A5YB 5KNLA 2DYRH 2K4BA 3S1RJ 3AKZA 3MFKA 2O7OA 5E8IA 5F1JA 1RC9A 5LEKA 4LITA 3J7ZI 3RTRA 5ERIA 2DOFA 3HB9A 2W00A 1XCVA 4BBRJ 1Z1DA 2EFPA 2BV6A 3CQZJ 5EEGA 3AL0C 2H09A 2ME0A 4KT5C 4R1HA 2V7FA 5CQGA 3HDDA 4BU2A 5L3GA 2LDUA 2EH3A 3LSKA 3MVPA 3MKWB 1Y39A 2L9RA 1FTTA 4BE1A 3QWLA 2VIXA 2X6YA 1SVOA 4EM2A 3L2CA 1DQUA 1EF4A 1XSVA 3R0JA 1KQ9A 1YYVA 3TBIA 3LSRA 3G71I 1V54H 5E18F 3MKZA 5FRNA 1GV5A 3D5RC 2R7TA 5D5XB 2VQLA 2ZMEA 3ABUA 2HQNA 2VKVA 3CCVI 1XCBA 2QBYB 3J80K 2LK2A 1X2NA 2D2WA 3DBHB 2OF7A 1OCZH 4ZYDA 4IZZA 2DDBA 4BUPA 3CJNA 3EUAA 2QQBA 1RUOA 1BW5A 5DS9A 4XNFA 3UNGC 3I71A 4KNYA 4YFXF 3JTHA 4M6YA 4MQ9F 1A6IA 1QZYA 2IS6A 4N0BA 1T0FC 3HOXJ 4L9VA 1MMSA 3RQIA 1MW7A 3CO6C 2ETHA 2Y0MA 4A6EA 5EDNA 2JVGA 2NAZA 5FROA 1KU2A 3OSFA 1O3TA 4IRGA 3HRTA 1FOKA 4E7IA 2H1KA 3BTCA 1B8IB 4IHSA 4AWXB 2K27A 1ZHFA 2JPBA 3DLAA 3TMOA 4EATA 4D5FA 2DQRA 5IPAA 1N25A 2WC2A 3O6BB 2ZFUA 5J4VA 4CCJA 4FTHA 3FM5A 4KFCA 1LJ9A 3T0YA 3GFJA 2LG4A 2FNPA 3E6MA 1JI8A 3RPUA 1X4OA 3CUQC 4C3IJ 1MSFC 2D5VA 2Z3YA 1R6RA 4HW0A 2EB7A 2GQQA 2F6CA 1MDMA 2ZC2A 4FE4A 2DA1A 4IF4A 4A3BJ 4UNOA 4G7OF 1I27A 1TWCJ 4ENKA 4D0PA 1H9TA 1OCRH 4XRSG 1BIBA 2DK5A 3V42A 1JT0A 2FJ1A 1FBQA 2FMLA 2DA3A 1OCTC 2Y31A 4A3CJ 1DU6A 4TV7A 3CCRI 4UVCA 1WQ2A 2EV5A 1XGOA 3CZ6A 2XAFA 1ZTRA 3LQQA 1QHHD 3QPLA 5J40A 4JX6A 2XPVA 3HHHA 3RKWA 4CYCB 1LNWA 1X1CA 3GTLJ 2DT5A 2NOGA 4MFEA 3OYLA 2HEOA 4ETSA 4RGUA 2CW8A 4FQGA 1LQ1A 3ZQCA 3W2WA 2Z2SB 1VQ6I 2I10A 4FE7A 1TL8A 1QO0D 2R93J 3HOUJ 5GADJ 2DMNA 4PK4A 4Y3OA 1YJ9I 1JKOC 3HIFA 3BZCA 1HLVA 3SZGA 4LG0B 4A6DA 2H6BA 1EH8A 2QUFA 2VJJA 1Y1VJ 4AIHA 1HCRA 2VOOA 1I1SA 3WE3A 1BJAA 3WGHA 2BOLA 2M4GA 3LSJA 3M07A 5DM7F 5M5XJ 2DAOA 1B9MA 1IN4A 4RA2A 3SFIA 3W6VA 3K70D 4M3EA 3E6CC 5BPIA 2OUMA 1Z21A 1W1WE 3TKYA 2ZKZA 3WTTC 4M9SA 2JPCA 4M9XA 2CU7A 1VQ9I 2E34A 1V4RA 2AQEA 3KPHA 3S17J 4CDGA 3HTUA 4FT8A 2JRMA 3TW7A 4I0AA 3BROA 4XRSA 1K79A 2R7QA 4GYIA 1MMDA 1R58A 3CCYA 1MNMC 2HVSA 3RQ4A 1XMXA 2QQ9A 4HF1A 2Y48A 2RDPA 1RI7A 4KITB 2IW5A 3JRAA 4MTDA 2QYOA 2E1NA 3W6KB 2VODA 1W7PB 1K78B 1IC8A 2K3PA 5IYBJ 3A4CA 4MNUA 2ZMEC 3C7JA 3DKYA 1BOBA 4IOAF 1XG1A 3BTIA 2GXAA 1WJEA 4KT6A 4U87A 3S14J 4D7NA 3A0BC 2CJJA 4BQAA 2ZJRF 3PSIA 2YSRA 1WCMJ 3R60A 2F5CA 2AXTC 4HV5A 2R7RA 1ZG3A 3OYFA 3DPLC 2QEXI 2L02A 3MZYA 4N9HA 3U2RA 5FLVA 2A5WA 4CCOA 1Y0NA 4HA8A 3T1BA 4EVIA 1CF7B 4C2MJ 1ZLJA 2HPMA 1MH4A 4N9IA 5KAIC 2MH9A 1ZARA 9ANTA 4DYQA 1D1BA 2ZO4A 1WJCA 4A69C 3JCUC 3VYUB 1LFBA 1P7IA 3GLLA 3QPTA 4RMNA 1K61A 1YFHA 1V3FA 2LBFB 2H6CA 4ZTJA 2DDAA 4DYRA 2HXIA 3M1EA 1MJBA 1LDKB 3ERED 2HKXA 5M5WJ 1B4AA 1VQ7I 2PFBA 2XF7A 3B6AA 3JAMK 1GHCA 1QNTA 3PSFA 3TL4X 4IPAA 1KU9A 4P96A 3H1CA 4BY7J 1R1UA 2IS2A 1PYVA 5LRSA 1S6LA 1OCCH 2LF7A 2DPDA 1OQYA 2K9QA 1R36A 1S72I 1S7EA 4XLFA 2R7DA 5LHIA 5LLQA 4EJWA 3DBLB 4MFDA 5A2QZ 3AG1H 1J09A 2V4JC 3ERMA 3S3NA 4FX0A 1RESA 5HS7A 2DA7A 2EQRA 3VB2A 4G12A 2I5UA 2NOJB 2JA2A 2B0LA 4O5VA 3KLNA 2EFWA 2HNHA 5K7ZA 4ENMA 1VQOI 1S3JA 3GUDA 4ON0A 2HQAA 1X4PA 3FMRA 3GCMA 2D1HA 2M34A 2Q8KA 3SDGA 4QIWN 1SVLA 3P9IA 2PMHA 2JSCA 2IS1A 2R92J 2P0WA 3CC4I 3HOYJ 1FBSA 2VJ4A 2FOKA 4UUTA 4P55A 2R7FA 1Y56A 2VBYA 3ZMZA 4A0YA 1SFXA 1FIPA 3E5QA 3KYDB 1IXRC 2JJ7A 3LSTA 2RQPA 2CFXA 2V26A 4DZJA 3K2ZA 2DPUA 2X6OA 4YFNF 1IGNA 1V5GA 4C2TA 3LFKA 2VOPA 1JUSA 2QZ8A 1YW9A 1J0RA 2CGPA 2V1NA 2K9SA 1DDNA 5FKKA 3IRQA 3I64A 3E1SA 5JLWA 1O3RA 1TWGJ 2CW7A 5TJJA 4YFKF 2ZNYA 4JYKA 5JI6A 2M8GX 3C2HA 2DMUA 3GF2A 1B8IA 3BR0A 4ZDLA 1W5CC 5AIPA 1KU7A 1IAWA 1PJRA 4BJTA 4B48A 2MD0A 2F2EA 3QYFA 4CH7A 3G6EI 3BG6A 4ZYGA 2RGVA 5LBQA 2EJRA 4OMZA 5J6XA 4XSXF 3KP6A 1MJ9A 2CS3A 4S0HB 3C2GA 4LOCA 3LFUA 1F43A 1VQMI 2H1LA 3PFYA 2KJCA 1R1VA 3H9QA 4CCNA 1XMAA 2R5YB 2COBA 2M4KA 2W7NA 2ZXIA 1F5TA 2JA5J 4M71A 5K1YA 4IOCF 2M7AA 2BW3B 3J7AY 3F72A 2DTRA 1YS6A 4XLPF 3GXOA 2FE3A 4Y15A 4B8XA 5EG0A 3RCOA 1ZH5A 1HDPA 3NWSA 2MH2A 1G3TA 5FB2A 2CWEA 4KICA 2VL8A 3QU3A 4LK0F 3A0HC 2V9KA 3BZKA 3HOWJ 2ADUA 2MBFA 4LG0A 1MBHA 5FLXZ 1IXSB 5JHFA 2X0LA 3MKYB 3CESA 3DU6A 2LY9A 1C0WA 2E35A 2XGEA 2L9NA 3JRGA 1U8BA 3H3UA 2K9MA 4UHTA 4C3JJ 3TDZC 1Z6TA 2FX0A 2ZJPF 1I6HJ 3KP3A 1Z67A 1ULYA 3CJRB 3PNVA 2KQRA 3I54A 3SFZA 1JUMA 4PZJA 4RBOA 5E1ZB 3ML6A 4XKCA 4XBFA 5HOOA 1MMAA 1QBJA 4NHJA 1JTXA 4Y17A 1AA7A 2E60A 1BM9A 3RPUD 5GAHJ 2HOSA 2DLLA 3H9GA 1Y8QB 2OCCH 2VQHA 2FBIA 4M3DA 4BDZA 2ISYA 2Z16A 2RAEA 2L5QA 2RVCA 4AC0A 4EJUA 3CCEI 3WG7H 3RYPA 5JLXA 1A04A 2AO9A 2XSJC 4Q47A 5EJCA 2Z1DA 5GTIC 3PJRA 4KN7X 1W7PA 2M7BA 2WTEA 1U9NA 5FJ8J 2FEZA 1FOWA 3KX2A 3HOTA 3GTGJ 2PLYA 3G73A 4L0YB 3M4OJ 3KP4A 4FASD 4XLCA 4RGXA 2CQQA 3PNYA 3NRVA 5J3LA 4ENJA 4L18B 3GVAA 2D45A 1MGTA 1HA8A 3HKZA 1ACIA 4P9UA 3G1LA 4OIOF 5F64A 2MSYA 2OPTA 2X6XA 1E3OC 4D5CA 4R79A 2FF4A 1MBEA 4B3XA 4I76A 1CF7A 2F48A 3J81K 3ZQFA 1OJLA 1ZLKA 1WJAA 2WY7Q 2L01A 3OYIA 1ZR2A 3BG5A 4MEXF 4BJ6C 1GXPA 1PP8F 1HF0A 3H9JA 4W97A 3BJOA 4X1EA 2LBFA 1A6QA 2KRCA 3TQNA 4DOZA 2XDVA 1T56A 2GA1A 2ECCA 4IQ4A 4XOTA 5HLIA 3V8JA 3C2BA 4QWQA 2H27A 2HZTA 2CV1A 3K1PA 3MCZA 2QSHX 3OYGA 3OSGA 1FIAA 3H92A 1EV7A 2XB5A 5K5QA 2GXBA 3QU6A 4XM3A 3VSKA 4HZFA 1IJWC 2DYSH 4Q48A 3RKQA 3JSPA 1T98A 4L5JA 2CH0A 1MIJA 3FMQA 4ANJA 6PAXA 2YUSA 3TP3A 4RM3A 3TW6A 2R5ZA 1HKQA 2UXNA 3S8PA 5BQTA 3R61A 2V1XA 4HLYA 1FSHA 1LDDA 3OOPA 3LSIA 1XD7A 3G3ZA 2MGQA 1FY7A 4M3BA 3EQLF 1D3YA 4ZTFA 4UUVA 1YOVB 3L09A 4EMSA 1EKEA 3HTSB 3ABTA 4ZZDA 4PGGA 3L00A 3I4NJ 5IOZA 2Q2EA 2CV2A 2X1EA 3JREA 4WXHA 5E3LA 1P4AA 3U1DA 2XC7A 4Y33A 4BE2A 1IDZA 5BOXA 4IHWA 2VBZA 4A3JJ 1G2HA 3ZMTA 1D0ZA 3BG3A 2EZHA 3IWFA 2XGDA 1R71A 2K85A 1FSEA 4ESBA 3ASOH 1IUYA 2NS8A 1BI0A 3BG7A 1FYKA 1A35A 4XLHA 3K7AJ 1LKXA 2FNAA 2V9PA 4RLQA 2DT6A 1K6OA 2IEKA 5H2FC 4QTRA 1JXSA 3CMAI 4P5OA 1YRNA 4XSZF 4KYWA 2R7WA 2G7UA 1E0EA 4ITVA 3MWMA 5EYRA 1T0FA 1ZKGA 4NBQA 1JGSA 1JHHA 3D1NI 1HSTA 1O3SA 3S2WA 5DCFA 3TGNA 2F5VA 2DOAA 3MD2A 1ZG5A 1RPWA 4IXAA 3FXKA 2XRLA 1T33A 1P9QC 2G0EA 3LA7A 2LP0A 3L2VA 1OMIA 4E7LA 1REPC 3BC8A 4HX8A 3IH4A 2IA0A 1FNNA 2RC4A 4H0EA 3S3MA 2DJNA 3GTPJ 2X1CA 3WODF 2RREA 3A2KA 2F5DA 4ASNA 1IXCA 1QPIA 3VEPA 1S7OA 4PJMA 2R7XA 1KZHA 3S15J 5E1WA 5BPDA 3HZJA 2P5LC 4QLCU 2L7KA 3BP8A 1FMWA 3D5SC 4MEYF 4Q4ZF 1ZREA 4U0VA 3VYSB 1APLC 3COAC 3IUOA 1WFXA 1UJ8A 2VB6A 4Y13A 2DTZA 3J7YJ 2EK5A 3LA3A 4YIFA 4CUGA 2LFBA 3I59A 4MQVA 3U9GA 3GFIA 2RKHA 1RZ4A 2CQNA 4BS9A 2LYCA 4GFBA 2ID3A 4I6ZA 2FOWA 4BHCA 2JN6A 3K4JA 1QZEA 2HQ5A 2WA0A 2XAUA 1ORKA 4BGDA 3A03A 4A12A 1IRZA 3F23A 3BOQA 4XORA 3TO9A 2HYJA 1XSXA 3FK6A 3JR9A 3I53A 1ON2A 3OYNA 3GMEA 3GWZA 1LDJA 2O8XA 3SHFA 2P81A 1Z7LA 5DD8A 4AD9A 1LE8B 5IP7J 2L9VA 2M87A 1UG0A 4IRHA 1F4KA 2DT7B 2ICWG 1EJ9A 1N78A 4PGHA 3I5UA 1USSA 3DEEA 1MSEC 4MGRA 4KJZA 1GUUA 2KT0A 5B1BH 3DBRB 1LB2A 3EYIA 4CHUA 2LY2A 3AG2H 3H5NA 3ZQHA 3CCQI 5F04A 2DFIA 1UAAA 3TOAA 2KRFA 3MZHA 4A5MA 3I0TA 1XGMA 1IDYA 3NQOA 3F22A 2BEOA 2PBIA 3JRDA 4GDFA 2OCEA 3KYLA 3Q9VA 3Q3SA 1UFMA 1WRJA 2OD5A 4BYYA 4V2GA 3LSGA 2Y9YA 4YELA 5C4JJ 3G4SI 1JE8A 1W0UA 3HYIA 3VOEA 2X85A 2K40A 3OMYA 3Q9SA 4PJNA 3KETA 3O2PE 2F5EA 2LNBA 1DP3A 3KIOA 2DK8A 1LPQA 1RIOH 4XLAA 1B9NA 1UELB 2IGMA 1VQ8I 1TW2A 2H94A 1Z3XA 4IX7A 2XPWA 4KDPA 3HSRA 4GYGA 1SANA 2XGCA 1AOYA 5GP9A 1OYIA 3IWZA 3R0AA 1DPUA 1IN6A 3ZXSA 1FZPB 5KCMA 3CD6I 4XR6A 4ABZA 4EJVA 1WJDA 1YX3A 1AKHB 2FQ3A 2XRNA 2Y69H 3GEZA 4NB5A 4J19A 4UB6C 3BG9A 4YIRX 3PFIA 1TBXA 1LVAA 1Y0UA 3DP7A 2JA6J 1H89C 3E7LA 4WF2A 4BJ5C 4B44A 5C44J 3IHUA 2ACJA 2ZSIB 1SEUA 5EGOB 4E7KA 2K4JA 4IKFA 3E97A 3FWEA 3WU2C 2CO5A 3ZMDA 1YJNI 4M73A 1RKTA 1W36C 4F91B 1Z9CA 1S5LC 4A3MJ 4F7ZA 1ZRDA 3ISPA 1G8XA 4HV6A 2VI6A 3KEYA 1EH7A 4HQMA 3PL8A 4IHXA 1J75A 3DEWA 1YO5C 1TW3A 4AM3A 3T8RA 1BR4A 3H3ZA 2ZFWA 4LFUA 4IHTA 1IO2A 4F52A 5IY5H 3WTVC 4AYBA 3B73A 4BH9A 2YS9A 3LSHA 1BC8C 2ISZA 5KK1A 2QENA 1TQPA 1V5FA 2YX7A 5CPRB 5EF6A 1U3EM 2HOEA 5FLMJ 2UZKA 4HYEA 1TWFJ 3F8FA 3HRSA 4M6VA 3MQ0A 2LKXA 4JP0A 1O3QA 4IHVA 1MJAA 3TP0A 3ZR8X 2VE9A 3JRHA 1GV2A 4J01A 5JHUA 5ILUA 2FRHA 1O7LA 4HEA2 4QPQA 5DCMA 3PO3J 1YQAA 2QVOA 2B9SA 2M45A 1XPXA 1BR2A 1HW5A 1B59A 2EINH 3FXUA 3QRFF 5AIQA 1XSDA 4IQJA 4A0ZA 1GVDA 3M1CA 2O8KA 2M2EA 1BL0A 1JJ8C 1K4TA 2ELHA 4MO7A 5M3MJ 1A36A 1D8JA 1VQKI 2X51A 2DO7A 1MNDA 1FLIA 1Z7UA 2QSGX 2XAQA 1VNDA 1PP7U 2PJRA 3HPGA 2IGOA 3V7CA 1QQIA 1OYWA 1ZAOA 3HJEA 3FIWA 2QLZA 1OPCA 4EJOA 2YX4A 1RKWA 3DTEA 1Q1VA 4HNUA 2OBPA 2X4HA 3E0JB 2KIFA 1P6RA 2MC3A 3BLYA 3DTKA 4PFOA 1WHUA 3MEXA 2HDCA 2A68F 3PUBA 1BI3A 4XKWA 3EYYA 1TTYA 3DWLE 4KIFA 3K4NA 2KDZA 1ETXA 2VXZA 3TEDA 2JSPA 1PDNC 4LB5A 3PNTA 2IBDA 4JOMA 4W1UA 3REOA 4A2UA 4BQQA 1R5ID 3FKIJ 2FD5A 1ZGWA 3F8BA 1ZGAA 1E2XA 2HDDA 2A05A 3GTOJ 2K02A 4BHBA 2WV0A 3GZNB 3ZN1A 4L0ZB 3RKYA 1R4NB 4PJ0C 4I0BA 2GZWA 1J2XA 1T39A 1SFOJ 1VQNI 2ESHA 3DPUA 3P9CA 3F8MA 3OR2C 2G9WA 3AAFA 1JKQC 1P92A 1TT5B 3K4CA 4RB2C 1VQ4I 2DW4A 1Z77A 4XKVA 1D5VA 4HQEA 2HYGD 1Y6IA 5HS9A 3J7AO 3O8GA 2ZBKA 5D5VB 2CW0F 4L5IA 1HKTA 1RNLA 4UXNA 3JRBA 2E2IJ 3GYHX 3A02A 3RSNA 1TNTA 5FFZA 1T8IA 1R49A 4I2OA 2CG4A 2A3SA 1YIJI 4RAYA 4CO8A 3KE2A 5IYDJ 5LHGA 2VASA 4CZCA 1P4XA 2M9HA 1O7FA 2DFFA 4HNTA 1LE8A 4ZDPA 3OYJA 5HNHA 2BZTA 1U0JA 3FXOA 3QOEA 3CCSI 2BY1A 3K2AA 3E5UA 3NEUA 2MLGA 5BMZA 2IAIA 1WH5A 2DA6A 1X1AA 2PG4A 3SEQA 2R0QC 2WV1A 1WJBA 3ABKH 3KLOA 2IA1A 4I09A 2XHKA 4MHGA 4F3QA 2V79A 2KZGA 2KZVA 3IAS2 3IC7A 1POGA 2DN0A 2C6YA 1ZK8A 5DV5A 4F92B 1LEBA 2P5VA 2OAZA 2EZKA 1BBYA 2KL4A 4O6JA 2YU9J 1FP2A 2LH9A 2CQ7A 1UB9A 1NHAA 2CQKA 2HTSA 3ELKA 1JT6A 4L9JA 1I3AA 2BYVE 3SJMA 3AL0B 4U7BA 1P2FA 3ZMVA 3S93A 4BKXA 3BJ6A 5F27A 2BVLA 3VFZA 2KFDA 2ID6A 2HI3A 3MZ8A 3HKZN 4L5EA 1SD7A 3ZGKA 2LREA 1OCOH 1WH7A 3G1MA 2ZCWA 2DCEA 2QBYA 2W48A 2VT2A 1T08B 4M3FA 1BC7C 2NVTJ 3ZQLA 2O0YA 1BJZA 3PQKA 4LIVA 4HX7A 2ZJQF 4AVZA 2E2HJ 3A01B 5ILVA 1P7JA 1JGGA 1R22A 5KVRA 1T6SA 2ZB9A 1IRGA 2GOXB 3CDHA 1AKHA 1S7AA 3RPQA 2XVCA 2I8DA 1W5TA 5BS6A 4C2UA 2JMWA 1U2WA 2BXYA 2WAQA 3KFWX 3BCBA 3CDIA 3K4LA 2W57A 4PFPA 2E19A 4RAGA 4CYDA 4O3MA 5EGOA 4CCKA 1WPKA 3AG3H 3BDDA 3FMSA 1OLTA 5HLTA 3KEQA 1UG2A 2J5OA 4DW6A 1ODDA 3JRIA 1G6NA 2MABA 3D5LA 3JSOA 3CP8A 5L3DA 3QODA 3CCJI 1SMTA 3RIRA 1NK3P 2AHQA 2XAHA 4GCVA 3C3WA 1TQIA 2FBHA 3B6CA 3W3CA 5LRRA 4HLXA 4WX9A 3NARA 5CLSA 3S2HJ 2VLAA 5CVJA 4ENNA 1L0OC 1G3YA 2MD5A 2P5KA 3CUQB 1VFCA 2LLKA 1G3WA 4PSWA 3R4KA 2LKSA 2BBYA 2NS7A 1Z05A 4HPQA 4CYCA 2KLOA 4RM2A 4BDYA 1OCPA 3CO7C 1OFCX 5JR3A 3L2QA 2HGCA 2LSOA 4NC6A 2N8GA 3SQNA 2NVYJ 4IVNA 2XROA 4G6QA 3IKVA 4UB8C 2Y30A 4LLLA 2EBIA 4XRFA 3VDXA 1S8NA 1XDUA 1W4MA 2O61A 3RDIA 2K86A 1RRJA 2O5RA 2HFHA 2BE5F 2E7XA 5J4YA 4KIBA 4EGYA 1NTCA 2HS5A 1P4WA 2DFEA 3IV5A 4BACA 2STWA 2RV8A 4I99C 1BI2A 4V19K 4Y4RA 2RN7A 2JT1A 5FGMA 2NXNB 5F08A 2KIUA 5M3FJ 1MKMA 1Q1HA 5E1XA 2DA2A 1E3PA 1IRXA 2R3SA 4UY8I 2XAJA 4PSXA 3FXLA 2ECBA 3HOSA 3LL7A 4NDLA 3IL2A 2HU9A 5F6FA 4XLNF 4U7DA 1RR8C 3ZMSA 3IKTA 1KU3A 2O6GE 4KIGA 3BR3A 4JK1X 5H6QA 2F4MB 2JVHA 4Z6YA 1FC3A 4UVBA 5BNGA 4RB0A 4RLFA 2QF7A 5GTHC 3MAJA 4BXXJ 3KP2A 4CCLA 1X3ZB 3S3OA 1ZGJA 2DFHA 1K78A 1ETYA 1SD5A 3E3VA 1XB4A 1ZN2A 5M5YJ 2AXLA 4WK8F 4MLOA 3HSFA 3OIOA 4Y7NJ 2GBYA 2IJLA 1U9OA 5H6RA 5TGTA 3FK7A 1ETWA 3KP5A 2P7VB 4E7JA 3RZOJ 2O03A 2ZMEB 4B3AA 3D0SA 4IL6C 2PI0A 1YI2I 2M0CA 4BHPA 4J00A 1U6GA 4MTEA 2JUCA 2A6EF 2FMYA 2KHMA 2VJ5A 2XIGA 3PUFA 4ZYHA 3JW4A 3GZ5A 5A2QK 4MIMA 3ABLH 2W84A 3S1MJ 2OTLI 4R8HA 1MBJA 3BQYA 2VT3A 4YRVA 4XK4A 3G2BA 4BL0B 4U0YA 1TWHJ 2VQGA 2CRGA 5K7HA 4G7HF 5C4XJ 3V4GA 1AWCA 1FP1D 3BR1A 3VYTB 1IRFA 3ZOBA 2TCTA 1ZRFA 2DBBA 1F1ZA 2DMQA 1BA5A 2OV7A 2X9DA 2MG4A 1ZYRF 3QPSA 4II3A 1TQMA 2E36A 2QQ8A 2ZNZA 4P1WA 5IP9J 5K7FA 4NC7A 2IVMA 2NYXA 5FD6A 2ZXWH 1W0TA 3ROUA 5K5OA 1H88C 5IP6A 1YW7A 1DU0A 1ETVA 4OIQF 2CUJA 2ZXJA 1PUEE 3L2WA 2M8EA 2WAEA 4RGSA 2OA4A 2ELJA 3Q0WA 3I3LA 2QM3A 2JUGA 3RZDJ 3WTWC 1FWZA 3CMYA 4NQWB 3L9FA 3T5XA 1L3LA 1U5TB 3SEZA 3M9AA 4WWCA 3OY9A 2WY8Q 4ZJZA 2EIJH 2W4SA 4N4NB 2EPFA 2OZUA 2UXXA 4UV8A 3TO6A 3CDLA 4LD5A 3O3KA 5LD2C 3KEOA 1V5EA 3A01A 2LVSA 2IGKA 1IUFA 3K4KA 1YX5A 2W82A 4S05A 5KAFC 4OOIA 2V1DA 2HOAA 2A6TA 4PJJA 1SFKA 3B02A 5K5RA 1YIOA 4ZH4F 5IT3A 1FT9A 4YIIA 5JVTA 5L3BA 4BQOA 2OTJI 2L4AA 3HXLA 4H4KC 1D1AA 3H0DA 3NAUA 3V7RA 3JRFA 4V2FA 1CQTA 1ERDA 3X2QH 1DGWY 3WGIA 4BY1J 1XGSA 2IPQX 3RI4A 2XGXA 1H8AC 4AYBN 4RGRA 4DIQA 2QCOA 3SXYA 1B6AA 2JZYA 5CKTA 4A0XA 5EZHA 2PMUA 3JRCA 3F3XA 4OMYA 4IO9F 1QZZA 4ESFA 3FM3A 2R7UA 1J5YA 5HDGA 2MA3A 3RJPA 3GTJJ 2F5FA 1WWXA 1XX5A 2OJED 3L2UA 4KMFA 2HVQA 2VKDA 4IHYA 3TOBA 4XMYA 3GFMA 4OINF 3HUGB 3LOCA 4I98B 2FBKA 2TDXA 2H8RA 1Z91A 3K4MA 4LLNA 2R5YA 5TISC 2EV6A 2E1MB 3BCAA 3FX3A 4BAYA 1NK2P 5FLXK 3OYMA 3OYAA 1K83J 2BW3A 1RETA 2WBMA 5E3OA 2CUZA 4HDVA 5HS8A 3FXRA 1K7AA 5E3NA 4WXCA 3OYDA 1U78A 5EEAA 1ZG1A 4ESJA 1KONA 4YG2F 1UHWA 4XRMA 2BY0A 3HOZJ 3S1QJ 4XN0A 2YR2A 3HG9A 3LAJA 2D1VA 2E7WA 2LMDA 2MW8A 5ICCA 1SAXA 2VE8A 3ULQB 3HSEA 3M3YJ 2EFNA 1G59A 1KQ8A 5E8GA 1BW6A 5DUKA 1YW8A 1IV8A 5HLHA 5B1AH 5D6FA 4I02A 2FUG2 2KISA 2BY3A 3P5JA 1R4MB 3DF8A 4HNVA 1J59A 5DEQA 5E3MA 2W25A 2DJIA 2P4WA 3BTLA 1D0XA 2GXGA 1GVJA 4M72A 4B47A 2Y75A 1TZLA 4PJLA 4XLEA 3LAPA 3K1MA 2H8WA 2FQ4A 2V1UA 3QP6A 2LTPA 3MMYB 1D8KA 2IS4A 1OISA 2OQGA 5TRDA 1MBKA 5D4RA 4XKBA 3JAMZ 2RNGA 1WZ2A 5IOYA 2GOMA 1I50J 2HYFA 4DGWB 3DTIA 3S32A 5DD4A 3HRMA 2DMTA 1DPRA 1MBFA 3QOPA 1BR1A 4DZPA 3CCMI 2EFOA 3GX4X 1B72B 2JRTA 2E1CA 2NS0A 4DJAA 3GTQJ 4HRIA 3W2VA 2QWWA 1R9TJ 2M30A 2W24A 4PDKA 2EZIA 4JX5A 1UHMA 3E6DA 2FU4A 2HZDA 3H0GJ 2V6EA 3QAHA 2CQXA 4X0GA 3M8JA 3E6BA 1WKMA 2PX9A 2VC1A 1FOYA 1BOAA 3FXMA 3I9V2 4N4OB 3WG9A 1HSJA 1LUJB 2DU9A 1FYMA 2VXDA 3EETA 2L2OA 1IN7A 1X1DA 4NUBA 1XDSA 1YS7A 1ETQA 3U21A 3K9TA 4CA0A 3BY6A 3DCFA 1WSUA 2VPLA 4LB6B 4CSWA 2HKOA 4D9JA 4I7HA 1VF9A 2ZJ2A 2PMZA 5KHDA 3BT9A 1FPQA 5J8FA 2BXZA 2OQRA 4B1RA 4C3HJ 2Y0SN 5ICEA 5D8KB 4RB3C 1PUFB 2O3FA 2E2JJ 1HW2A 3N05A 4WXDA 3V7SA 4LJZF 2NVUB 4C9YA 4BQNA 4UVAA 2CMPA 2R7OA 1WI3A 3BR5A 4A5NA 2HOTA 2ME6A 4P9FA 3GO5A 2EV0A 2LKPA 4U88A 3FXJA 3ZRGA 1Y8RB 5DUIA 4XONA 4E70A 2XKOA 3E5XA 2GWRA 2XASA 2MYSA 1W7PD 3KYCB 5FKOA 3N97A 1D1CA 1ETKA 3ECHA 1NH3A 1WI9A 3KZZA 4NQWA 4PCQA 2W85A 1MZBA 5H20A 3OYEA 4HX4A 3ZN0A 3GW2A 3RKXA 1U5TA 3FZVA 3ZQQA 1ONVA 1YG2A 4HAMA 1LFPA 3DV8A 2OC6A 4NC8A 2KRHA 1DP7P 2CYYA 5IYCJ 4OU0A 2R4GA 3QYBA 4A3IJ 2QSFX 2A69F 2WAQN 1NG6A 1X58A 3RYRA 3OS0A 4BXFA 5HVQC 5D5UB 5EG0B 2M0MA 3CC7I 3ZQIA 4GGGA 4E7HA 4ZZLA 2STTA 1QVUA 2UWMA 2KPMA 5D5WB 4C30A 2PQ8A 2HQRA 2EZLA 3FHZA 3OL3A 3FXQA 4QPOA 1R7JA 3I58A 3ZQGA 1VZ0A 1SAUA 2QQAA 2NNNA 4KMUX 1TP4A 3A1YA 1Y1WJ 3KCCA 1STZA 4BEHB 2WB1A 3MN2A 3DXJF 5E79C 4HSTA 1FMVA 5J1RA 2J5PA 1QU3A 1F36A 1XN7A 4YEJA 5GPAA 1BN5A 3K69A 4UUSB 3WHBA 2B63J 3QP5A 2JTVA 2KMUA 2YU3A 3CMEI 3LA2A 5FD5A 1J9IA 2L0KA 2BHYA 1BI1A 2V9VA 5LGUA 3CUOA 3K10A 3WU1B 2L7ZA 2IA2A 3HUGA 3HM5A 3H5AA 4DYCA 5CQEA 5CJ9A 5GAGJ 2VN2A 4IJAA 3W6JB 2IP2A 3CF5F 3LSMA 4M9ZA 1XTAA 3C1DA 4B43A 2DXIA 2HWVA 2HTJA 3CCUI 5HODA 1IV6A 2IT0A 3LQRA 1EA3A 4CCMA 3FKJA 2G7HA 3F6OA 4CXFA 1HBXG 3I55I 3CLQA 4HOBA 1D5YA 3M8EA 3GTMJ 2DODA 4FETA 2XSDC 2PN6A 2JQ7A 1YTYA 3HBLA 2EA4A 2AQFA 1ZRCA 2HVRA 2DA4A 3ZPLA 5FKNA 3F21A 2FA5A 3F8NA 3WTXC 5E20A 5J1UA 1SD6A 2EIKH 3OS2A 4KN4X 4M6XA 2LD5A 2ESNA 1VI0A 1LFUP 3IH3A 2W1OA 5DDGA 4A3LJ 3ECOA 3ZMUA 4Y52J 4BXUA 2QKMB 1FYLA 1KA8A 1W36D 2EA2A 1R23A 4HG2A 2P7CB 2DMPA 4HSRA 2CUFA 5EZGA 2DOEA 3P7NA 3V8LA 2QKLB 1K4SA 1Z6RA 1GXQA 1IN5A 2VKEA 1U8RA 1HKSA 1GLNA
chains in the Genus database with same CATH topology
5HDNA 2XV4S 1BIAA 3F6VA 2CSOA 2COMA 3J81Z 2NRAC 4DQ2A 4EM0B 4G9YA 1XGNA 1F9NA 2PJPA 4LGWA 4U0WA 5FFXA 3K1NA 5D4SA 4G7ZF 3DKWA 5IT9Z 3KZYA 1JHFA 1SD4A 4EJTA 2P6TA 1U5TC 2KIMA 5LEJA 5F1RA 2YPRA 3F8CA 5DYMA 1KYZA 3BWGA 4IRIA 3BJAA 3V8KA 1VTNC 5LGNA 2VBWA 1J7KA 1R5HA 5D6EA 2A6HF 1E17A 1T38A 2DI3A 4M74A 2DQLA 3TDUC 1SMYF 5CVVA 2V6CA 1IF1A 3WTZA 3WTUC 1B1BA 4HBLA 3GLXA 2GAUA 2P8TA 2NNYA 2Z99A 4L9TA 5ED4A 4KUMA 3WTYC 3M7GA 3BPXA 2AS5F 2XUBA 3EUHA 1RUNA 4HF2A 5JFRA 4Q5SF 2LF8A 4OIRF 5J8CA 3I59B 2EWNA 2KJBA 5CVUA 5AONA 2P6SA 1IW7F 4EQQA 1HQCA 5L3CA 2Z33A 1USTA 1W5SA 1OR7A 2Q0OA 3SZTA 2EFQA 3IRRA 4FX4A 4AIKA 3M8FA 3ZQ7A 3DEUA 4JQFA 5E17F 1TNSA 4CZZA 3P9KA 5CVRA 3C18A 5ICGA 2VC0A 5L3FA 4EGZA 2Z9OA 1I5ZA 1T2KA 3HRUA 4ZYEA 1SFUA 4I01A 1KQ0A 4UV9A 4WCGA 2XAGA 5HDKA 3KP7A 1QGPA 3TO7A 5ILSA 5LGTA 2IRFG 4B09A 2OU2A 3DFGA 3L7WA 5D8LB 4LLGF 5FO5A 4RAZA 3GZ6A 3GFLA 4G8XA 2M5WA 1TLHB 1XMKA 2GA2A 3FF5A 3VODA 2MLKA 3J80Z 1R5GA 4LMYA 2M1BA 2WWYA 4G6DA 2KKOA 3HHGA 4L9NA 4LK1F 3DPTA 4FHTA 3BPVA 1YLFA 3K0LA 2XKPA 5IT9K 2GIVA 2FSWA 4OIPF 4S04A 2A07F 3BZ6A 3EDPA 4GO1A 1MDMB 3WGGA 1R1TA 4EM1A 1ON1A 5CYVA 3OV8A 2BGCA 5LHHA 1H9GA 2OZ6A 2VBXA 1FX7A 3T8TA 4EV0A 1I1GA 1O57A 5DCMB 1X3UA 1H0MA 4DNCA 1IN8A 1EH6A 1HW1A 1G4DA 4Z2YA 4HDUA 4RS8A 3WTSC 1R00A 3N4MA 3DQVC 4K2EA 5CVIA 1KYWA 1UCRA 1OKRA 3PQJA 2Z5UA 3R6SA 1QPMA 1LEAA 4CICA 3CLOA 2VONA 2L4MA 1G3SA 1S29A 2PEXA 3WU0A 4RB1A 1DUXC 1OYYA 3CUQA 4KA4A 3SZPA 4G94A 5HLGA 2K7LA 1HXDA 3LWFA 2HR3A 3QPHA 2L54A 4HF0A 1IZ1A 1SFEA 4GXOA 4BNCA 4AIJA 3Q5FA 3JTGA 4JBAA 1FBUA 5ICFA 1CGPA 5EEHA 3ZP5A 3WE2A 4CGZA 3I4PA 2FXAA 2A61A 5L3EA 1MD0A 1I6XA 2L3DA 4AVPA 3CTAA 2RNJA 1KGSA 2A5YB 2K4BA 3MFKA 5E8IA 5LEKA 3RTRA 5ERIA 1XCVA 1Z1DA 2EFPA 2BV6A 5EEGA 2H09A 4KT5C 4R1HA 5L3GA 2LDUA 4EM2A 3L2CA 1XSVA 3R0JA 1KQ9A 1YYVA 5E18F 5D5XB 2ZMEA 3ABUA 2HQNA 1XCBA 2QBYB 3J80K 2D2WA 4ZYDA 3CJNA 2QQBA 1RUOA 3I71A 4KNYA 4YFXF 3JTHA 4M6YA 4MQ9F 1QZYA 4N0BA 4L9VA 3CO6C 2ETHA 2Y0MA 4A6EA 2NAZA 1KU2A 1O3TA 4IRGA 3HRTA 1FOKA 4IHSA 4AWXB 2K27A 1ZHFA 2JPBA 2DQRA 3O6BB 2WC2A 3FM5A 4KFCA 1LJ9A 3T0YA 3GFJA 2FNPA 3E6MA 3RPUA 3CUQC 2Z3YA 4HW0A 2EB7A 2GQQA 1MDMA 4IF4A 4UNOA 4G7OF 1I27A 4ENKA 4D0PA 1H9TA 1BIBA 2DK5A 1FBQA 2FMLA 4TV7A 4UVCA 2EV5A 1WQ2A 1XGOA 2XAFA 3LQQA 3HHHA 3RKWA 1LNWA 2DT5A 2HEOA 4ETSA 4RGUA 1LQ1A 1QO0D 3HIFA 4LG0B 4A6DA 2H6BA 1EH8A 2QUFA 2VOOA 4AIHA 1I1SA 3WE3A 1BJAA 3WGHA 2DAOA 1B9MA 1IN4A 5BPIA 3E6CC 3TKYA 2ZKZA 3WTTC 4M9SA 2JPCA 4M9XA 1V4RA 4CDGA 3HTUA 4FT8A 4I0AA 3BROA 1K79A 4GYIA 1R58A 2QQ9A 4HF1A 2Y48A 2RDPA 1RI7A 2IW5A 4MTDA 2QYOA 2E1NA 3W6KB 2VODA 1W7PB 1K78B 4MNUA 3C7JA 4BQAA 3R60A 2YSRA 2F5CA 4HV5A 1ZG3A 3DPLC 2L02A 3MZYA 4N9HA 3U2RA 4HA8A 3T1BA 4EVIA 1CF7B 1ZLJA 4N9IA 2MH9A 1ZARA 2ZO4A 3QPTA 1YFHA 1V3FA 2H6CA 3M1EA 1MJBA 1LDKB 3ERED 2HKXA 1B4AA 1GHCA 2PFBA 3JAMK 1QNTA 4IPAA 1KU9A 4P96A 1R1UA 5LRSA 1S6LA 2LF7A 2DPDA 1R36A 5LHIA 2R7DA 5LLQA 4EJWA 5A2QZ 4FX0A 5HS7A 3VB2A 2B0LA 4O5VA 3KLNA 2EFWA 4ENMA 1S3JA 3GUDA 4ON0A 3FMRA 2D1HA 2Q8KA 3P9IA 2PMHA 2JSCA 1FBSA 2FOKA 4P55A 2R7FA 2VBYA 3ZMZA 4A0YA 1SFXA 3E5QA 1IXRC 3LSTA 2RQPA 2CFXA 3K2ZA 2DPUA 4YFNF 3LFKA 2VOPA 2QZ8A 1YW9A 1J0RA 2CGPA 1DDNA 3IRQA 3I64A 1O3RA 5TJJA 4YFKF 2ZNYA 5JI6A 3GF2A 5AIPA 1KU7A 1IAWA 2F2EA 4ZYGA 2RGVA 5LBQA 2EJRA 4OMZA 5J6XA 4XSXF 3KP6A 1MJ9A 2KJCA 1R1VA 1XMAA 1F5TA 4M71A 5K1YA 3F72A 2DTRA 1YS6A 4XLPF 3GXOA 2FE3A 4Y15A 4B8XA 1ZH5A 2MH2A 1G3TA 5FB2A 2CWEA 4KICA 3QU3A 4LK0F 2ADUA 2MBFA 4LG0A 5FLXZ 1IXSB 2X0LA 1C0WA 3H3UA 4UHTA 3TDZC 1Z6TA 3KP3A 1ULYA 3I54A 3SFZA 4PZJA 5E1ZB 3ML6A 4XBFA 5HOOA 1QBJA 4NHJA 4Y17A 1BM9A 2DLLA 2FBIA 2ISYA 2RVCA 4EJUA 3RYPA 1A04A 4Q47A 4KN7X 1W7PA 2WTEA 2FEZA 3HOTA 2PLYA 3G73A 4L0YB 3KP4A 4RGXA 3NRVA 4ENJA 4L18B 3GVAA 2D45A 1MGTA 4P9UA 4OIOF 5F64A 4R79A 2FF4A 1CF7A 3J81K 1ZLKA 2L01A 4MEXF 1GXPA 1PP8F 3BJOA 3TQNA 2GA1A 3V8JA 5HLIA 4QWQA 2H27A 2HZTA 3K1PA 3MCZA 3H92A 1EV7A 5K5QA 2GXBA 3QU6A 4HZFA 4Q48A 3JSPA 1T98A 4L5JA 3FMQA 6PAXA 1HKQA 2UXNA 5BQTA 3R61A 2V1XA 4HLYA 1FSHA 1LDDA 3OOPA 1XD7A 3G3ZA 1FY7A 3EQLF 1D3YA 4UUVA 3L09A 4EMSA 3HTSB 3ABTA 4ZZDA 4PGGA 3L00A 2Q2EA 4WXHA 1P4AA 3U1DA 5BOXA 2VBZA 3ZMTA 3IWFA 1IUYA 4ESBA 1FSEA 1BI0A 1FYKA 2FNAA 1K6OA 1JXSA 4P5OA 4KYWA 4XSZF 2G7UA 3MWMA 1T0FA 1JGSA 1JHHA 1HSTA 1O3SA 3S2WA 5DCFA 3TGNA 1ZG5A 4IXAA 3LA7A 1OMIA 1REPC 4HX8A 2IA0A 1FNNA 2RC4A 4H0EA 3WODF 2F5DA 4ASNA 1IXCA 3VEPA 1S7OA 5E1WA 5BPDA 2P5LC 4QLCU 3BP8A 4MEYF 1ZREA 4Q4ZF 4U0VA 3COAC 4Y13A 2EK5A 3LA3A 4YIFA 3I59A 4MQVA 3U9GA 3GFIA 2RKHA 1RZ4A 4BHCA 4A12A 3F23A 3BOQA 3TO9A 1XSXA 3I53A 1ON2A 3GWZA 1LDJA 2O8XA 3SHFA 4AD9A 5DD8A 2M87A 1F4KA 4IRHA 4PGHA 3I5UA 1USSA 4MGRA 3EYIA 1LB2A 4CHUA 2DFIA 3TOAA 2KRFA 3MZHA 4A5MA 3I0TA 1XGMA 3NQOA 3F22A 2BEOA 2PBIA 3Q9VA 1UFMA 1WRJA 2OD5A 4BYYA 1JE8A 3HYIA 3VOEA 3KETA 3Q9SA 3O2PE 2F5EA 2LNBA 2DK8A 1RIOH 1B9NA 1TW2A 2H94A 4KDPA 3HSRA 4GYGA 1AOYA 1OYIA 3IWZA 3R0AA 1DPUA 1IN6A 1FZPB 4EJVA 2FQ3A 2XRNA 3GEZA 4NB5A 3PFIA 1TBXA 1LVAA 1Y0UA 3DP7A 4WF2A 2ACJA 3IHUA 2K4JA 3E97A 3FWEA 2CO5A 3ZMDA 4M73A 1Z9CA 1ZRDA 4F7ZA 3ISPA 4HV6A 1EH7A 4HQMA 1J75A 1YO5C 1TW3A 3T8RA 3H3ZA 2ZFWA 4LFUA 4IHTA 3WTVC 3B73A 4BH9A 1BC8C 2ISZA 5KK1A 2QENA 1TQPA 2YX7A 1U3EM 2HOEA 2UZKA 4HYEA 3F8FA 3HRSA 3MQ0A 1O3QA 1MJAA 2VE9A 5JHUA 5ILUA 2FRHA 1O7LA 5DCMA 1YQAA 2QVOA 2M45A 1HW5A 1B59A 3FXUA 3QRFF 5AIQA 1XSDA 4A0ZA 2ELHA 1D8JA 2DO7A 1FLIA 1Z7UA 2XAQA 1PP7U 3V7CA 1QQIA 1OYWA 1ZAOA 2QLZA 1OPCA 4EJOA 2YX4A 2OBPA 2X4HA 2KIFA 1P6RA 2MC3A 3MEXA 2HDCA 2A68F 1BI3A 3EYYA 1TTYA 4KIFA 2VXZA 1PDNC 4LB5A 3REOA 4A2UA 3F8BA 1ZGAA 1E2XA 2K02A 4BHBA 2WV0A 3ZN1A 4L0ZB 3RKYA 4I0BA 2GZWA 1J2XA 1T39A 2ESHA 3P9CA 3F8MA 2G9WA 3AAFA 1P92A 4RB2C 2DW4A 1D5VA 4HQEA 2HYGD 5HS9A 3J7AO 2ZBKA 5D5VB 2CW0F 4L5IA 1HKTA 1RNLA 4UXNA 3GYHX 1TNTA 5FFZA 4I2OA 2CG4A 2A3SA 4RAYA 4CO8A 3KE2A 5LHGA 1P4XA 1O7FA 3E5UA 3NEUA 2MLGA 5BMZA 2PG4A 3KLOA 2IA1A 4I09A 2XHKA 4MHGA 2V79A 3IC7A 2C6YA 5DV5A 1LEBA 2P5VA 2OAZA 1BBYA 4O6JA 1FP2A 1UB9A 1NHAA 2CQKA 2HTSA 3ELKA 4L9JA 2BYVE 4U7BA 1P2FA 3ZMVA 3BJ6A 3VFZA 1SD7A 2ZCWA 2QBYA 2VT2A 1BC7C 2O0YA 3PQKA 4HX7A 5ILVA 1R22A 5KVRA 1T6SA 1IRGA 3CDHA 1S7AA 3RPQA 2XVCA 1W5TA 5BS6A 1U2WA 3KFWX 2W57A 4CYDA 4O3MA 3BDDA 3FMSA 3KEQA 2J5OA 1ODDA 1G6NA 3D5LA 3JSOA 5L3DA 1SMTA 3RIRA 2XAHA 4GCVA 3C3WA 1TQIA 2FBHA 5LRRA 4HLXA 4WX9A 5CLSA 5CVJA 4ENNA 1L0OC 1G3YA 2MD5A 2P5KA 3CUQB 1G3WA 3R4KA 2BBYA 1Z05A 3CO7C 5JR3A 2HGCA 2LSOA 3SQNA 4IVNA 2XROA 4G6QA 3IKVA 4LLLA 4XRFA 1S8NA 1XDUA 1W4MA 2O61A 3RDIA 2K86A 2HFHA 2BE5F 2E7XA 4KIBA 4EGYA 2HS5A 1P4WA 2STWA 2RV8A 1BI2A 2RN7A 2JT1A 5FGMA 2KIUA 1MKMA 1Q1HA 5E1XA 2R3SA 2XAJA 3HOSA 3IL2A 4XLNF 5F6FA 4U7DA 3ZMSA 3IKTA 1KU3A 2O6GE 4KIGA 4JK1X 5H6QA 1FC3A 4UVBA 4RB0A 3MAJA 3KP2A 1ZGJA 1K78A 1SD5A 3E3VA 1XB4A 1ZN2A 2AXLA 4WK8F 3HSFA 2IJLA 5H6RA 3KP5A 2P7VB 2O03A 2ZMEB 3D0SA 2PI0A 4BHPA 1U6GA 4MTEA 2A6EF 2FMYA 2XIGA 4ZYHA 3JW4A 3GZ5A 5A2QK 2W84A 4R8HA 2VT3A 4U0YA 4G7HF 3V4GA 1AWCA 1FP1D 1IRFA 1ZRFA 2DBBA 1F1ZA 1ZYRF 1TQMA 2ZNZA 2IVMA 2NYXA 5FD6A 3ROUA 5K5OA 1YW7A 4OIQF 2ZXJA 1PUEE 2M8EA 4RGSA 2OA4A 2QM3A 3WTWC 1FWZA 3L9FA 3T5XA 1L3LA 1U5TB 3M9AA 4WWCA 2OZUA 2UXXA 4UV8A 3TO6A 4LD5A 3O3KA 3KEOA 4S05A 4OOIA 2V1DA 3B02A 5K5RA 1YIOA 4ZH4F 5IT3A 1FT9A 4YIIA 5JVTA 5L3BA 2L4AA 3V7RA 3WGIA 1XGSA 2IPQX 3RI4A 2XGXA 4RGRA 3SXYA 1B6AA 2JZYA 4A0XA 2PMUA 3F3XA 4OMYA 1QZZA 4ESFA 3FM3A 1J5YA 5HDGA 2MA3A 3RJPA 2F5FA 1WWXA 4KMFA 3TOBA 3GFMA 4OINF 4I98B 2FBKA 2TDXA 1Z91A 4LLNA 2EV6A 3FX3A 4BAYA 5FLXK 4HDVA 5HS8A 3FXRA 1K7AA 4WXCA 1U78A 1ZG1A 4ESJA 4YG2F 1UHWA 2YR2A 3LAJA 2D1VA 2E7WA 5ICCA 1SAXA 2VE8A 3ULQB 3HSEA 2EFNA 1KQ8A 5E8GA 5DUKA 1YW8A 5HLHA 5D6FA 4I02A 3DF8A 1J59A 5DEQA 2W25A 2P4WA 2GXGA 1GVJA 4M72A 2Y75A 3LAPA 3K1MA 2V1UA 3QP6A 1D8KA 2OQGA 5TRDA 5D4RA 3JAMZ 2HYFA 5DD4A 3HRMA 1DPRA 3QOPA 2EFOA 3GX4X 2JRTA 2E1CA 2NS0A 2QWWA 2M30A 2W24A 4PDKA 1UHMA 3E6DA 2FU4A 3QAHA 3E6BA 1WKMA 2VC1A 1BOAA 3WG9A 1FYMA 1HSJA 2DU9A 3EETA 1IN7A 1XDSA 1YS7A 3K9TA 3BY6A 1WSUA 4LB6B 2HKOA 4I7HA 2ZJ2A 1FPQA 5J8FA 2OQRA 5ICEA 5D8KB 4RB3C 2O3FA 1HW2A 4WXDA 3V7SA 4LJZF 4UVAA 4A5NA 4P9FA 3GO5A 2EV0A 2LKPA 4U88A 5DUIA 4E70A 2XKOA 3E5XA 2GWRA 2XASA 1W7PD 3N97A 3ECHA 1WI9A 3KZZA 4NQWA 4PCQA 2W85A 1MZBA 5H20A 4HX4A 3ZN0A 3GW2A 3RKXA 1U5TA 3FZVA 1ONVA 1YG2A 4HAMA 3DV8A 1DP7P 2CYYA 4OU0A 2A69F 3RYRA 5HVQC 5D5UB 4GGGA 4ZZLA 2STTA 2UWMA 5D5WB 2PQ8A 2HQRA 3FHZA 3FXQA 1R7JA 3I58A 2QQAA 2NNNA 4KMUX 3KCCA 1STZA 3DXJF 2J5PA 1XN7A 1BN5A 3K69A 3QP5A 2JTVA 2YU3A 3LA2A 5FD5A 1J9IA 2V9VA 5LGUA 1BI1A 3CUOA 3WU1B 2IA2A 3HUGA 5CJ9A 2VN2A 4IJAA 3W6JB 2IP2A 4M9ZA 3C1DA 2HWVA 2HTJA 2IT0A 3LQRA 1HBXG 2G7HA 3F6OA 4CXFA 4HOBA 3M8EA 2PN6A 1YTYA 2EA4A 1ZRCA 3ZPLA 3F21A 2FA5A 3F8NA 3WTXC 5E20A 1SD6A 4KN4X 4M6XA 2ESNA 5DDGA 3ZMUA 3ECOA 4BXUA 1FYLA 1KA8A 2EA2A 1R23A 2P7CB 3V8LA 3P7NA 1Z6RA 1GXQA 1IN5A 1U8RA 1HKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDN A;  2XV4 S;  1BIA A;  3F6V A;  2CSO A;  2COM A;  3J81 Z;  2NRA C;  4DQ2 A;  4EM0 B;  4G9Y A;  1XGN A;  1F9N A;  2PJP A;  4LGW A;  4U0W A;  5FFX A;  3K1N A;  5D4S A;  4G7Z F;  3DKW A;  5IT9 Z;  3KZY A;  1JHF A;  1SD4 A;  4EJT A;  2P6T A;  1U5T C;  2KIM A;  5LEJ A;  5F1R A;  2YPR A;  3F8C A;  5DYM A;  1KYZ A;  3BWG A;  4IRI A;  3BJA A;  3V8K A;  1VTN C;  5LGN A;  2VBW A;  1J7K A;  1R5H A;  5D6E A;  2A6H F;  1E17 A;  1T38 A;  2DI3 A;  4M74 A;  2DQL A;  3TDU C;  1SMY F;  5CVV A;  2V6C A;  1IF1 A;  3WTZ A;  3WTU C;  1B1B A;  4HBL A;  3GLX A;  2GAU A;  2P8T A;  2NNY A;  2Z99 A;  4L9T A;  5ED4 A;  4KUM A;  3WTY C;  3M7G A;  3BPX A;  2AS5 F;  2XUB A;  3EUH A;  1RUN A;  4HF2 A;  5JFR A;  4Q5S F;  2LF8 A;  4OIR F;  5J8C A;  3I59 B;  2EWN A;  2KJB A;  5CVU A;  5AON A;  2P6S A;  1IW7 F;  4EQQ A;  1HQC A;  5L3C A;  2Z33 A;  1UST A;  1W5S A;  1OR7 A;  2Q0O A;  3SZT A;  2EFQ A;  3IRR A;  4FX4 A;  4AIK A;  3M8F A;  3ZQ7 A;  3DEU A;  4JQF A;  5E17 F;  1TNS A;  4CZZ A;  3P9K A;  5CVR A;  3C18 A;  5ICG A;  2VC0 A;  5L3F A;  4EGZ A;  2Z9O A;  1I5Z A;  1T2K A;  3HRU A;  4ZYE A;  1SFU A;  4I01 A;  1KQ0 A;  4UV9 A;  4WCG A;  2XAG A;  5HDK A;  3KP7 A;  1QGP A;  3TO7 A;  5ILS A;  5LGT A;  2IRF G;  4B09 A;  2OU2 A;  3DFG A;  3L7W A;  5D8L B;  4LLG F;  5FO5 A;  4RAZ A;  3GZ6 A;  3GFL A;  4G8X A;  2M5W A;  1TLH B;  1XMK A;  2GA2 A;  3FF5 A;  3VOD A;  2MLK A;  3J80 Z;  1R5G A;  4LMY A;  2M1B A;  2WWY A;  4G6D A;  2KKO A;  3HHG A;  4L9N A;  4LK1 F;  3DPT A;  4FHT A;  3BPV A;  1YLF A;  3K0L A;  2XKP A;  5IT9 K;  2GIV A;  2FSW A;  4OIP F;  4S04 A;  2A07 F;  3BZ6 A;  3EDP A;  4GO1 A;  1MDM B;  3WGG A;  1R1T A;  4EM1 A;  1ON1 A;  5CYV A;  3OV8 A;  2BGC A;  5LHH A;  1H9G A;  2OZ6 A;  2VBX A;  1FX7 A;  3T8T A;  4EV0 A;  1I1G A;  1O57 A;  5DCM B;  1X3U A;  1H0M A;  4DNC A;  1IN8 A;  1EH6 A;  1HW1 A;  1G4D A;  4Z2Y A;  4HDU A;  4RS8 A;  3WTS C;  1R00 A;  3N4M A;  3DQV C;  4K2E A;  5CVI A;  1KYW A;  1UCR A;  1OKR A;  3PQJ A;  2Z5U A;  3R6S A;  1QPM A;  1LEA A;  4CIC A;  3CLO A;  2VON A;  2L4M A;  1G3S A;  1S29 A;  2PEX A;  3WU0 A;  4RB1 A;  1DUX C;  1OYY A;  3CUQ A;  4KA4 A;  3SZP A;  4G94 A;  5HLG A;  2K7L A;  1HXD A;  3LWF A;  2HR3 A;  3QPH A;  2L54 A;  4HF0 A;  1IZ1 A;  1SFE A;  4GXO A;  4BNC A;  4AIJ A;  3Q5F A;  3JTG A;  4JBA A;  1FBU A;  5ICF A;  1CGP A;  5EEH A;  3ZP5 A;  3WE2 A;  4CGZ A;  3I4P A;  2FXA A;  2A61 A;  5L3E A;  1MD0 A;  1I6X A;  2L3D A;  4AVP A;  3CTA A;  2RNJ A;  1KGS A;  2A5Y B;  2K4B A;  3MFK A;  5E8I A;  5LEK A;  3RTR A;  5ERI A;  1XCV A;  1Z1D A;  2EFP A;  2BV6 A;  5EEG A;  2H09 A;  4KT5 C;  4R1H A;  5L3G A;  2LDU A;  4EM2 A;  3L2C A;  1XSV A;  3R0J A;  1KQ9 A;  1YYV A;  5E18 F;  5D5X B;  2ZME A;  3ABU A;  2HQN A;  1XCB A;  2QBY B;  3J80 K;  2D2W A;  4ZYD A;  3CJN A;  2QQB A;  1RUO A;  3I71 A;  4KNY A;  4YFX F;  3JTH A;  4M6Y A;  4MQ9 F;  1QZY A;  4N0B A;  4L9V A;  3CO6 C;  2ETH A;  2Y0M A;  4A6E A;  2NAZ A;  1KU2 A;  1O3T A;  4IRG A;  3HRT A;  1FOK A;  4IHS A;  4AWX B;  2K27 A;  1ZHF A;  2JPB A;  2DQR A;  3O6B B;  2WC2 A;  3FM5 A;  4KFC A;  1LJ9 A;  3T0Y A;  3GFJ A;  2FNP A;  3E6M A;  3RPU A;  3CUQ C;  2Z3Y A;  4HW0 A;  2EB7 A;  2GQQ A;  1MDM A;  4IF4 A;  4UNO A;  4G7O F;  1I27 A;  4ENK A;  4D0P A;  1H9T A;  1BIB A;  2DK5 A;  1FBQ A;  2FML A;  4TV7 A;  4UVC A;  2EV5 A;  1WQ2 A;  1XGO A;  2XAF A;  3LQQ A;  3HHH A;  3RKW A;  1LNW A;  2DT5 A;  2HEO A;  4ETS A;  4RGU A;  1LQ1 A;  1QO0 D;  3HIF A;  4LG0 B;  4A6D A;  2H6B A;  1EH8 A;  2QUF A;  2VOO A;  4AIH A;  1I1S A;  3WE3 A;  1BJA A;  3WGH A;  2DAO A;  1B9M A;  1IN4 A;  5BPI A;  3E6C C;  3TKY A;  2ZKZ A;  3WTT C;  4M9S A;  2JPC A;  4M9X A;  1V4R A;  4CDG A;  3HTU A;  4FT8 A;  4I0A A;  3BRO A;  1K79 A;  4GYI A;  1R58 A;  2QQ9 A;  4HF1 A;  2Y48 A;  2RDP A;  1RI7 A;  2IW5 A;  4MTD A;  2QYO A;  2E1N A;  3W6K B;  2VOD A;  1W7P B;  1K78 B;  4MNU A;  3C7J A;  4BQA A;  3R60 A;  2YSR A;  2F5C A;  4HV5 A;  1ZG3 A;  3DPL C;  2L02 A;  3MZY A;  4N9H A;  3U2R A;  4HA8 A;  3T1B A;  4EVI A;  1CF7 B;  1ZLJ A;  4N9I A;  2MH9 A;  1ZAR A;  2ZO4 A;  3QPT A;  1YFH A;  1V3F A;  2H6C A;  3M1E A;  1MJB A;  1LDK B;  3ERE D;  2HKX A;  1B4A A;  1GHC A;  2PFB A;  3JAM K;  1QNT A;  4IPA A;  1KU9 A;  4P96 A;  1R1U A;  5LRS A;  1S6L A;  2LF7 A;  2DPD A;  1R36 A;  5LHI A;  2R7D A;  5LLQ A;  4EJW A;  5A2Q Z;  4FX0 A;  5HS7 A;  3VB2 A;  2B0L A;  4O5V A;  3KLN A;  2EFW A;  4ENM A;  1S3J A;  3GUD A;  4ON0 A;  3FMR A;  2D1H A;  2Q8K A;  3P9I A;  2PMH A;  2JSC A;  1FBS A;  2FOK A;  4P55 A;  2R7F A;  2VBY A;  3ZMZ A;  4A0Y A;  1SFX A;  3E5Q A;  1IXR C;  3LST A;  2RQP A;  2CFX A;  3K2Z A;  2DPU A;  4YFN F;  3LFK A;  2VOP A;  2QZ8 A;  1YW9 A;  1J0R A;  2CGP A;  1DDN A;  3IRQ A;  3I64 A;  1O3R A;  5TJJ A;  4YFK F;  2ZNY A;  5JI6 A;  3GF2 A;  5AIP A;  1KU7 A;  1IAW A;  2F2E A;  4ZYG A;  2RGV A;  5LBQ A;  2EJR A;  4OMZ A;  5J6X A;  4XSX F;  3KP6 A;  1MJ9 A;  2KJC A;  1R1V A;  1XMA A;  1F5T A;  4M71 A;  5K1Y A;  3F72 A;  2DTR A;  1YS6 A;  4XLP F;  3GXO A;  2FE3 A;  4Y15 A;  4B8X A;  1ZH5 A;  2MH2 A;  1G3T A;  5FB2 A;  2CWE A;  4KIC A;  3QU3 A;  4LK0 F;  2ADU A;  2MBF A;  4LG0 A;  5FLX Z;  1IXS B;  2X0L A;  1C0W A;  3H3U A;  4UHT A;  3TDZ C;  1Z6T A;  3KP3 A;  1ULY A;  3I54 A;  3SFZ A;  4PZJ A;  5E1Z B;  3ML6 A;  4XBF A;  5HOO A;  1QBJ A;  4NHJ A;  4Y17 A;  1BM9 A;  2DLL A;  2FBI A;  2ISY A;  2RVC A;  4EJU A;  3RYP A;  1A04 A;  4Q47 A;  4KN7 X;  1W7P A;  2WTE A;  2FEZ A;  3HOT A;  2PLY A;  3G73 A;  4L0Y B;  3KP4 A;  4RGX A;  3NRV A;  4ENJ A;  4L18 B;  3GVA A;  2D45 A;  1MGT A;  4P9U A;  4OIO F;  5F64 A;  4R79 A;  2FF4 A;  1CF7 A;  3J81 K;  1ZLK A;  2L01 A;  4MEX F;  1GXP A;  1PP8 F;  3BJO A;  3TQN A;  2GA1 A;  3V8J A;  5HLI A;  4QWQ A;  2H27 A;  2HZT A;  3K1P A;  3MCZ A;  3H92 A;  1EV7 A;  5K5Q A;  2GXB A;  3QU6 A;  4HZF A;  4Q48 A;  3JSP A;  1T98 A;  4L5J A;  3FMQ A;  6PAX A;  1HKQ A;  2UXN A;  5BQT A;  3R61 A;  2V1X A;  4HLY A;  1FSH A;  1LDD A;  3OOP A;  1XD7 A;  3G3Z A;  1FY7 A;  3EQL F;  1D3Y A;  4UUV A;  3L09 A;  4EMS A;  3HTS B;  3ABT A;  4ZZD A;  4PGG A;  3L00 A;  2Q2E A;  4WXH A;  1P4A A;  3U1D A;  5BOX A;  2VBZ A;  3ZMT A;  3IWF A;  1IUY A;  4ESB A;  1FSE A;  1BI0 A;  1FYK A;  2FNA A;  1K6O A;  1JXS A;  4P5O A;  4KYW A;  4XSZ F;  2G7U A;  3MWM A;  1T0F A;  1JGS A;  1JHH A;  1HST A;  1O3S A;  3S2W A;  5DCF A;  3TGN A;  1ZG5 A;  4IXA A;  3LA7 A;  1OMI A;  1REP C;  4HX8 A;  2IA0 A;  1FNN A;  2RC4 A;  4H0E A;  3WOD F;  2F5D A;  4ASN A;  1IXC A;  3VEP A;  1S7O A;  5E1W A;  5BPD A;  2P5L C;  4QLC U;  3BP8 A;  4MEY F;  1ZRE A;  4Q4Z F;  4U0V A;  3COA C;  4Y13 A;  2EK5 A;  3LA3 A;  4YIF A;  3I59 A;  4MQV A;  3U9G A;  3GFI A;  2RKH A;  1RZ4 A;  4BHC A;  4A12 A;  3F23 A;  3BOQ A;  3TO9 A;  1XSX A;  3I53 A;  1ON2 A;  3GWZ A;  1LDJ A;  2O8X A;  3SHF A;  4AD9 A;  5DD8 A;  2M87 A;  1F4K A;  4IRH A;  4PGH A;  3I5U A;  1USS A;  4MGR A;  3EYI A;  1LB2 A;  4CHU A;  2DFI A;  3TOA A;  2KRF A;  3MZH A;  4A5M A;  3I0T A;  1XGM A;  3NQO A;  3F22 A;  2BEO A;  2PBI A;  3Q9V A;  1UFM A;  1WRJ A;  2OD5 A;  4BYY A;  1JE8 A;  3HYI A;  3VOE A;  3KET A;  3Q9S A;  3O2P E;  2F5E A;  2LNB A;  2DK8 A;  1RIO H;  1B9N A;  1TW2 A;  2H94 A;  4KDP A;  3HSR A;  4GYG A;  1AOY A;  1OYI A;  3IWZ A;  3R0A A;  1DPU A;  1IN6 A;  1FZP B;  4EJV A;  2FQ3 A;  2XRN A;  3GEZ A;  4NB5 A;  3PFI A;  1TBX A;  1LVA A;  1Y0U A;  3DP7 A;  4WF2 A;  2ACJ A;  3IHU A;  2K4J A;  3E97 A;  3FWE A;  2CO5 A;  3ZMD A;  4M73 A;  1Z9C A;  1ZRD A;  4F7Z A;  3ISP A;  4HV6 A;  1EH7 A;  4HQM A;  1J75 A;  1YO5 C;  1TW3 A;  3T8R A;  3H3Z A;  2ZFW A;  4LFU A;  4IHT A;  3WTV C;  3B73 A;  4BH9 A;  1BC8 C;  2ISZ A;  5KK1 A;  2QEN A;  1TQP A;  2YX7 A;  1U3E M;  2HOE A;  2UZK A;  4HYE A;  3F8F A;  3HRS A;  3MQ0 A;  1O3Q A;  1MJA A;  2VE9 A;  5JHU A;  5ILU A;  2FRH A;  1O7L A;  5DCM A;  1YQA A;  2QVO A;  2M45 A;  1HW5 A;  1B59 A;  3FXU A;  3QRF F;  5AIQ A;  1XSD A;  4A0Z A;  2ELH A;  1D8J A;  2DO7 A;  1FLI A;  1Z7U A;  2XAQ A;  1PP7 U;  3V7C A;  1QQI A;  1OYW A;  1ZAO A;  2QLZ A;  1OPC A;  4EJO A;  2YX4 A;  2OBP A;  2X4H A;  2KIF A;  1P6R A;  2MC3 A;  3MEX A;  2HDC A;  2A68 F;  1BI3 A;  3EYY A;  1TTY A;  4KIF A;  2VXZ A;  1PDN C;  4LB5 A;  3REO A;  4A2U A;  3F8B A;  1ZGA A;  1E2X A;  2K02 A;  4BHB A;  2WV0 A;  3ZN1 A;  4L0Z B;  3RKY A;  4I0B A;  2GZW A;  1J2X A;  1T39 A;  2ESH A;  3P9C A;  3F8M A;  2G9W A;  3AAF A;  1P92 A;  4RB2 C;  2DW4 A;  1D5V A;  4HQE A;  2HYG D;  5HS9 A;  3J7A O;  2ZBK A;  5D5V B;  2CW0 F;  4L5I A;  1HKT A;  1RNL A;  4UXN A;  3GYH X;  1TNT A;  5FFZ A;  4I2O A;  2CG4 A;  2A3S A;  4RAY A;  4CO8 A;  3KE2 A;  5LHG A;  1P4X A;  1O7F A;  3E5U A;  3NEU A;  2MLG A;  5BMZ A;  2PG4 A;  3KLO A;  2IA1 A;  4I09 A;  2XHK A;  4MHG A;  2V79 A;  3IC7 A;  2C6Y A;  5DV5 A;  1LEB A;  2P5V A;  2OAZ A;  1BBY A;  4O6J A;  1FP2 A;  1UB9 A;  1NHA A;  2CQK A;  2HTS A;  3ELK A;  4L9J A;  2BYV E;  4U7B A;  1P2F A;  3ZMV A;  3BJ6 A;  3VFZ A;  1SD7 A;  2ZCW A;  2QBY A;  2VT2 A;  1BC7 C;  2O0Y A;  3PQK A;  4HX7 A;  5ILV A;  1R22 A;  5KVR A;  1T6S A;  1IRG A;  3CDH A;  1S7A A;  3RPQ A;  2XVC A;  1W5T A;  5BS6 A;  1U2W A;  3KFW X;  2W57 A;  4CYD A;  4O3M A;  3BDD A;  3FMS A;  3KEQ A;  2J5O A;  1ODD A;  1G6N A;  3D5L A;  3JSO A;  5L3D A;  1SMT A;  3RIR A;  2XAH A;  4GCV A;  3C3W A;  1TQI A;  2FBH A;  5LRR A;  4HLX A;  4WX9 A;  5CLS A;  5CVJ A;  4ENN A;  1L0O C;  1G3Y A;  2MD5 A;  2P5K A;  3CUQ B;  1G3W A;  3R4K A;  2BBY A;  1Z05 A;  3CO7 C;  5JR3 A;  2HGC A;  2LSO A;  3SQN A;  4IVN A;  2XRO A;  4G6Q A;  3IKV A;  4LLL A;  4XRF A;  1S8N A;  1XDU A;  1W4M A;  2O61 A;  3RDI A;  2K86 A;  2HFH A;  2BE5 F;  2E7X A;  4KIB A;  4EGY A;  2HS5 A;  1P4W A;  2STW A;  2RV8 A;  1BI2 A;  2RN7 A;  2JT1 A;  5FGM A;  2KIU A;  1MKM A;  1Q1H A;  5E1X A;  2R3S A;  2XAJ A;  3HOS A;  3IL2 A;  4XLN F;  5F6F A;  4U7D A;  3ZMS A;  3IKT A;  1KU3 A;  2O6G E;  4KIG A;  4JK1 X;  5H6Q A;  1FC3 A;  4UVB A;  4RB0 A;  3MAJ A;  3KP2 A;  1ZGJ A;  1K78 A;  1SD5 A;  3E3V A;  1XB4 A;  1ZN2 A;  2AXL A;  4WK8 F;  3HSF A;  2IJL A;  5H6R A;  3KP5 A;  2P7V B;  2O03 A;  2ZME B;  3D0S A;  2PI0 A;  4BHP A;  1U6G A;  4MTE A;  2A6E F;  2FMY A;  2XIG A;  4ZYH A;  3JW4 A;  3GZ5 A;  5A2Q K;  2W84 A;  4R8H A;  2VT3 A;  4U0Y A;  4G7H F;  3V4G A;  1AWC A;  1FP1 D;  1IRF A;  1ZRF A;  2DBB A;  1F1Z A;  1ZYR F;  1TQM A;  2ZNZ A;  2IVM A;  2NYX A;  5FD6 A;  3ROU A;  5K5O A;  1YW7 A;  4OIQ F;  2ZXJ A;  1PUE E;  2M8E A;  4RGS A;  2OA4 A;  2QM3 A;  3WTW C;  1FWZ A;  3L9F A;  3T5X A;  1L3L A;  1U5T B;  3M9A A;  4WWC A;  2OZU A;  2UXX A;  4UV8 A;  3TO6 A;  4LD5 A;  3O3K A;  3KEO A;  4S05 A;  4OOI A;  2V1D A;  3B02 A;  5K5R A;  1YIO A;  4ZH4 F;  5IT3 A;  1FT9 A;  4YII A;  5JVT A;  5L3B A;  2L4A A;  3V7R A;  3WGI A;  1XGS A;  2IPQ X;  3RI4 A;  2XGX A;  4RGR A;  3SXY A;  1B6A A;  2JZY A;  4A0X A;  2PMU A;  3F3X A;  4OMY A;  1QZZ A;  4ESF A;  3FM3 A;  1J5Y A;  5HDG A;  2MA3 A;  3RJP A;  2F5F A;  1WWX A;  4KMF A;  3TOB A;  3GFM A;  4OIN F;  4I98 B;  2FBK A;  2TDX A;  1Z91 A;  4LLN A;  2EV6 A;  3FX3 A;  4BAY A;  5FLX K;  4HDV A;  5HS8 A;  3FXR A;  1K7A A;  4WXC A;  1U78 A;  1ZG1 A;  4ESJ A;  4YG2 F;  1UHW A;  2YR2 A;  3LAJ A;  2D1V A;  2E7W A;  5ICC A;  1SAX A;  2VE8 A;  3ULQ B;  3HSE A;  2EFN A;  1KQ8 A;  5E8G A;  5DUK A;  1YW8 A;  5HLH A;  5D6F A;  4I02 A;  3DF8 A;  1J59 A;  5DEQ A;  2W25 A;  2P4W A;  2GXG A;  1GVJ A;  4M72 A;  2Y75 A;  3LAP A;  3K1M A;  2V1U A;  3QP6 A;  1D8K A;  2OQG A;  5TRD A;  5D4R A;  3JAM Z;  2HYF A;  5DD4 A;  3HRM A;  1DPR A;  3QOP A;  2EFO A;  3GX4 X;  2JRT A;  2E1C A;  2NS0 A;  2QWW A;  2M30 A;  2W24 A;  4PDK A;  1UHM A;  3E6D A;  2FU4 A;  3QAH A;  3E6B A;  1WKM A;  2VC1 A;  1BOA A;  3WG9 A;  1FYM A;  1HSJ A;  2DU9 A;  3EET A;  1IN7 A;  1XDS A;  1YS7 A;  3K9T A;  3BY6 A;  1WSU A;  4LB6 B;  2HKO A;  4I7H A;  2ZJ2 A;  1FPQ A;  5J8F A;  2OQR A;  5ICE A;  5D8K B;  4RB3 C;  2O3F A;  1HW2 A;  4WXD A;  3V7S A;  4LJZ F;  4UVA A;  4A5N A;  4P9F A;  3GO5 A;  2EV0 A;  2LKP A;  4U88 A;  5DUI A;  4E70 A;  2XKO A;  3E5X A;  2GWR A;  2XAS A;  1W7P D;  3N97 A;  3ECH A;  1WI9 A;  3KZZ A;  4NQW A;  4PCQ A;  2W85 A;  1MZB A;  5H20 A;  4HX4 A;  3ZN0 A;  3GW2 A;  3RKX A;  1U5T A;  3FZV A;  1ONV A;  1YG2 A;  4HAM A;  3DV8 A;  1DP7 P;  2CYY A;  4OU0 A;  2A69 F;  3RYR A;  5HVQ C;  5D5U B;  4GGG A;  4ZZL A;  2STT A;  2UWM A;  5D5W B;  2PQ8 A;  2HQR A;  3FHZ A;  3FXQ A;  1R7J A;  3I58 A;  2QQA A;  2NNN A;  4KMU X;  3KCC A;  1STZ A;  3DXJ F;  2J5P A;  1XN7 A;  1BN5 A;  3K69 A;  3QP5 A;  2JTV A;  2YU3 A;  3LA2 A;  5FD5 A;  1J9I A;  2V9V A;  5LGU A;  1BI1 A;  3CUO A;  3WU1 B;  2IA2 A;  3HUG A;  5CJ9 A;  2VN2 A;  4IJA A;  3W6J B;  2IP2 A;  4M9Z A;  3C1D A;  2HWV A;  2HTJ A;  2IT0 A;  3LQR A;  1HBX G;  2G7H A;  3F6O A;  4CXF A;  4HOB A;  3M8E A;  2PN6 A;  1YTY A;  2EA4 A;  1ZRC A;  3ZPL A;  3F21 A;  2FA5 A;  3F8N A;  3WTX C;  5E20 A;  1SD6 A;  4KN4 X;  4M6X A;  2ESN A;  5DDG A;  3ZMU A;  3ECO A;  4BXU A;  1FYL A;  1KA8 A;  2EA2 A;  1R23 A;  2P7C B;  3V8L A;  3P7N A;  1Z6R A;  1GXQ A;  1IN5 A;  1U8R A;  1HKS A; 
#chains in the Genus database with same CATH topology
 4LIU A;  1S9H A;  2VQC A;  5HDN A;  2XV4 S;  5J1Y A;  2VPR A;  1D0Y A;  3U1K A;  1BIA A;  3F6V A;  2CSO A;  2Y0S A;  4BE0 A;  2COM A;  3IP4 B;  3J81 Z;  2NRA C;  4DQ2 A;  4EM0 B;  3PIO F;  4G9Y A;  3FDY A;  1XGN A;  1F9N A;  2PJP A;  3BR6 A;  5GPC A;  4XQF A;  4F93 B;  2LR8 A;  4LGW A;  4U0W A;  5FFX A;  3K1N A;  2O9L A;  5D4S A;  4G7Z F;  3DKW A;  4OWR B;  5IT9 Z;  2R5Z B;  3KZY A;  2KDO A;  1JHF A;  2VJI A;  1SD4 A;  4EJT A;  5B3S H;  2P6T A;  1U5T C;  3HC7 A;  5HNF A;  3DLL F;  3H3V K;  3CF2 A;  2KIM A;  4ZYA A;  1YJW I;  2E5N A;  3ESW B;  5LEJ A;  5F1R A;  3DKX A;  2GM4 A;  1X2M A;  2K5C A;  1TWA J;  1B72 A;  3FBN B;  2Q2E B;  2YPR A;  3F8C A;  5DYM A;  3AG4 H;  3EUK L;  1KYZ A;  3BWG A;  4IRI A;  1M1E B;  3BJA A;  1JKP C;  3FIS A;  3V8K A;  2WAF A;  2E71 A;  1VTN C;  1K6Y A;  5FKL A;  5LGN A;  2VBW A;  3OR1 C;  1J7K A;  1R5H A;  1RR7 A;  2NVQ J;  4XN3 A;  2CFO A;  5D6E A;  2A6H F;  1E17 A;  1T38 A;  5J47 A;  2DI3 A;  1T95 A;  3OIP A;  4A3G J;  1WJ5 A;  4M74 A;  2DQL A;  1JJ6 C;  1YRN B;  1X19 A;  1MMG A;  3TDU C;  3VSL A;  1SMY F;  1LVK A;  3OL4 A;  5CVV A;  2V6C A;  3UKG A;  1IF1 A;  3WTZ A;  3WTU C;  1B1B A;  3H5R A;  3BTJ A;  4HBL A;  3GLX A;  1TC3 C;  4RAF A;  3OWT A;  1N77 A;  2GAU A;  2P8T A;  2NNY A;  2Z99 A;  4L9T A;  2ZXH A;  4A3D J;  2ZSH B;  5ED4 A;  1O4X A;  1PUF A;  2DA5 A;  3ASN H;  1I39 A;  2VKH A;  1Z0X A;  4KUM A;  3WTY C;  3PIP F;  4AU7 A;  3M7G A;  1MH3 A;  3K6G A;  1X1P A;  1E3H A;  2RQQ A;  3CMM A;  3BPX A;  4PUS A;  2AS5 F;  2B7E A;  4RDU A;  2GLO A;  2UV1 A;  2XUB A;  3F0C A;  2E1M C;  3EUH A;  1RUN A;  4HF2 A;  1AU7 A;  5JFR A;  4Q5S F;  2LF8 A;  3EPZ A;  1FEX A;  4OIR F;  4ZC3 A;  2JA7 J;  5C3E J;  1JUP A;  5DTD A;  5J8C A;  1JKR C;  1FOX A;  2F4I A;  3I59 B;  2KIQ A;  2EWN A;  3BQZ A;  2KJB A;  5CVU A;  1WGX A;  4JX4 A;  5AON A;  2P6S A;  2CV0 A;  3S2D J;  1IW7 F;  4EQQ A;  3VWB A;  1ENH A;  1HQC A;  1GT0 C;  5L3C A;  2Z33 A;  2TRT A;  1UST A;  4A3F J;  1W5S A;  1OR7 A;  1YE9 A;  2K9N A;  2Q0O A;  2BVM A;  2HPI A;  3SZT A;  2EFQ A;  3IRR A;  3O8H A;  2K3F A;  1NG7 A;  3W2A A;  4FX4 A;  4AIK A;  3CJQ B;  3M8F A;  3DEU A;  4G6T B;  1UMQ A;  3ZQ7 A;  4JQF A;  1DGR M;  1XC5 A;  1QA6 A;  5E17 F;  1TT0 A;  1WVR A;  1IG7 A;  1TNS A;  1VQP I;  3KZI C;  4CZZ A;  3P9K A;  5CVR A;  3C18 A;  4B4C A;  5ICG A;  2VC0 A;  5L3F A;  4EGZ A;  2Z9O A;  5FRM A;  3HOV J;  4BEH A;  3IH2 A;  1JTY A;  4LG3 A;  1I5Z A;  4EEF G;  1T2K A;  3HPH A;  1ITY A;  3HRU A;  4ZYE A;  1SFU A;  4I01 A;  2LY1 A;  4A3E J;  3CP2 A;  3VYR B;  1KQ0 A;  4UV9 A;  4WCG A;  2JA8 J;  2LOO A;  2XAG A;  5HDK A;  2HDW A;  4DBQ A;  3KP7 A;  4UUS A;  1QGP A;  4IEJ A;  3TO7 A;  5ILS A;  1MMN A;  4D7M A;  1WJF A;  2IXS A;  5LGT A;  2KP6 A;  4M3G A;  2IRF G;  4B09 A;  2OU2 A;  5LFA A;  3DFG A;  4BBS J;  3L7W A;  3PM1 A;  5D8L B;  1GDT A;  4LLG F;  5FO5 A;  4OAZ A;  3HL2 A;  1ZQ3 P;  1YIT I;  1SC7 A;  4FCY A;  2X1D A;  4RAZ A;  3GZ6 A;  1PVE A;  2X6W A;  2MFZ A;  3BR2 A;  3GFL A;  3GBG A;  1HDD C;  3QYE A;  3CJT B;  4G8X A;  2M5W A;  1TLH B;  2Y2Z A;  1A5J A;  3Q0V A;  4AUX A;  3HGG A;  1XMK A;  2Q1Z B;  3SDB A;  1Z3Y A;  2L7F P;  1MBG A;  2GA2 A;  5B5E C;  4DBR A;  3FF5 A;  3VOD A;  3L1P A;  2MLK A;  3J80 Z;  1R5G A;  4LMY A;  2M1B A;  2WWY A;  1UZC A;  4G6D A;  2KKO A;  3HHG A;  3HGY A;  4L9N A;  3WHC A;  4LK1 F;  1A31 A;  3SYT A;  3DPT A;  3IAM 2;  2JWT A;  2Y9Z A;  4FHT A;  3BPV A;  1YLF A;  3K0L A;  3AFH A;  4OAY A;  2XKP A;  2IGN A;  4F55 A;  5IT9 K;  2GIV A;  5FKM A;  2FSW A;  1VQL I;  4S04 A;  2A07 F;  4OIP F;  2R7S A;  2E1O A;  3OYC A;  3CCL I;  3BZ6 A;  2LRD A;  3EDP A;  4GO1 A;  4E6K G;  1MDM B;  4ZDO A;  3WGG A;  5GAE J;  3I4M J;  1QVT A;  3FHN A;  1R1T A;  2BY2 A;  3ABM H;  3VPR A;  1ON1 A;  4EM1 A;  3EUH C;  2NVX J;  1X3W B;  5CYV A;  3OV8 A;  2BGC A;  5LHH A;  1H9G A;  2OZ6 A;  4AID A;  3PO2 J;  1V55 H;  1VQ5 I;  2VBX A;  2E5Z A;  5B66 C;  1X1B A;  1FX7 A;  4XL9 A;  3T8T A;  1ETO A;  1FTZ A;  3ONQ A;  5F0F A;  4EV0 A;  1I1G A;  1O57 A;  5F0H A;  5DCM B;  3CC2 I;  1X3U A;  3K4B A;  4GRI A;  1OR7 C;  1H0M A;  4DNC A;  1IN8 A;  2EIM H;  2ELK A;  5F0C A;  3OYH A;  2R7Z J;  3FBI B;  1EH6 A;  1HW1 A;  3LNQ A;  5JVG F;  2M3A A;  3OOU A;  1ZEL A;  1G4D A;  2X48 A;  4Z2Y A;  2PMZ N;  4HDU A;  2QGU A;  4RS8 A;  3WTS C;  3H35 A;  1R00 A;  4QSH A;  3N4M A;  1FJL A;  3DQV C;  2L7M P;  4K2E A;  2XB0 X;  3NWT A;  5CVI A;  1KYW A;  1UCR A;  4XIC A;  3GTK J;  4XID A;  1OKR A;  1AHD P;  3PQJ A;  2Z5U A;  2PJR B;  3R6S A;  1QPM A;  1LEA A;  4CIC A;  3CLO A;  2VON A;  2L4M A;  1G3S A;  1I3Q J;  4FIS A;  1YHQ I;  1S29 A;  4A93 J;  3OYK A;  2MC4 A;  2PEX A;  3WU0 A;  4RB1 A;  1DUX C;  1OYY A;  3I56 I;  3CUQ A;  4KA4 A;  3SZP A;  3OYB A;  4G94 A;  5HLG A;  3MKL A;  3Q0U A;  2K7L A;  1XS9 A;  1HXD A;  1UHS A;  3H36 A;  1SVM A;  3LWF A;  4E7S A;  2CUE A;  2HR3 A;  2F4O B;  1QHG A;  3F9K A;  3QPH A;  1MNE A;  2UUZ A;  2XF6 A;  2L54 A;  4HF0 A;  4KIS A;  1IZ1 A;  1SFE A;  4GXO A;  4A3K J;  4BNC A;  2VUM J;  2R7V A;  2K9L A;  4AIJ A;  3LMM A;  1ZR4 A;  2GIZ A;  1N75 A;  3UR3 C;  3Q5F A;  3JTG A;  4JBA A;  1FBU A;  5DM6 F;  3L2R A;  3QQA A;  4XOP A;  4X6A J;  3OIQ A;  4D1Q A;  5ICF A;  2EIL H;  1CGP A;  5EEH A;  3ZP5 A;  2BHZ A;  2JK3 A;  1HC8 A;  4E7Z A;  3WE2 A;  1QRY A;  4CGZ A;  3I4P A;  2HXO A;  2L9S A;  2WAD A;  2XPU A;  3G1O A;  3HEF A;  2QA4 I;  2XF5 A;  2FXA A;  3LSP A;  2A61 A;  5L3E A;  1MD0 A;  1HOM A;  1I6X A;  2WB1 N;  2L3D A;  2LC2 A;  3S1N J;  4II2 A;  4AVP A;  4NNJ A;  3CTA A;  3K70 C;  2RNJ A;  3OS1 A;  3S16 J;  4E4H A;  1KGS A;  3DU5 A;  3ZCO A;  2A5Y B;  5KNL A;  2DYR H;  2K4B A;  3S1R J;  3AKZ A;  3MFK A;  2O7O A;  5E8I A;  5F1J A;  1RC9 A;  5LEK A;  4LIT A;  3J7Z I;  3RTR A;  5ERI A;  2DOF A;  3HB9 A;  2W00 A;  1XCV A;  4BBR J;  1Z1D A;  2EFP A;  2BV6 A;  3CQZ J;  5EEG A;  3AL0 C;  2H09 A;  2ME0 A;  4KT5 C;  4R1H A;  2V7F A;  5CQG A;  3HDD A;  4BU2 A;  5L3G A;  2LDU A;  2EH3 A;  3LSK A;  3MVP A;  3MKW B;  1Y39 A;  2L9R A;  1FTT A;  4BE1 A;  3QWL A;  2VIX A;  2X6Y A;  1SVO A;  4EM2 A;  3L2C A;  1DQU A;  1EF4 A;  1XSV A;  3R0J A;  1KQ9 A;  1YYV A;  3TBI A;  3LSR A;  3G71 I;  1V54 H;  5E18 F;  3MKZ A;  5FRN A;  1GV5 A;  3D5R C;  2R7T A;  5D5X B;  2VQL A;  2ZME A;  3ABU A;  2HQN A;  2VKV A;  3CCV I;  1XCB A;  2QBY B;  3J80 K;  2LK2 A;  1X2N A;  2D2W A;  3DBH B;  2OF7 A;  1OCZ H;  4ZYD A;  4IZZ A;  2DDB A;  4BUP A;  3CJN A;  3EUA A;  2QQB A;  1RUO A;  1BW5 A;  5DS9 A;  4XNF A;  3UNG C;  3I71 A;  4KNY A;  4YFX F;  3JTH A;  4M6Y A;  4MQ9 F;  1A6I A;  1QZY A;  2IS6 A;  4N0B A;  1T0F C;  3HOX J;  4L9V A;  1MMS A;  3RQI A;  1MW7 A;  3CO6 C;  2ETH A;  2Y0M A;  4A6E A;  5EDN A;  2JVG A;  2NAZ A;  5FRO A;  1KU2 A;  3OSF A;  1O3T A;  4IRG A;  3HRT A;  1FOK A;  4E7I A;  2H1K A;  3BTC A;  1B8I B;  4IHS A;  4AWX B;  2K27 A;  1ZHF A;  2JPB A;  3DLA A;  3TMO A;  4EAT A;  4D5F A;  2DQR A;  5IPA A;  1N25 A;  2WC2 A;  3O6B B;  2ZFU A;  5J4V A;  4CCJ A;  4FTH A;  3FM5 A;  4KFC A;  1LJ9 A;  3T0Y A;  3GFJ A;  2LG4 A;  2FNP A;  3E6M A;  1JI8 A;  3RPU A;  1X4O A;  3CUQ C;  4C3I J;  1MSF C;  2D5V A;  2Z3Y A;  1R6R A;  4HW0 A;  2EB7 A;  2GQQ A;  2F6C A;  1MDM A;  2ZC2 A;  4FE4 A;  2DA1 A;  4IF4 A;  4A3B J;  4UNO A;  4G7O F;  1I27 A;  1TWC J;  4ENK A;  4D0P A;  1H9T A;  1OCR H;  4XRS G;  1BIB A;  2DK5 A;  3V42 A;  1JT0 A;  2FJ1 A;  1FBQ A;  2FML A;  2DA3 A;  1OCT C;  2Y31 A;  4A3C J;  1DU6 A;  4TV7 A;  3CCR I;  4UVC A;  1WQ2 A;  2EV5 A;  1XGO A;  3CZ6 A;  2XAF A;  1ZTR A;  3LQQ A;  1QHH D;  3QPL A;  5J40 A;  4JX6 A;  2XPV A;  3HHH A;  3RKW A;  4CYC B;  1LNW A;  1X1C A;  3GTL J;  2DT5 A;  2NOG A;  4MFE A;  3OYL A;  2HEO A;  4ETS A;  4RGU A;  2CW8 A;  4FQG A;  1LQ1 A;  3ZQC A;  3W2W A;  2Z2S B;  1VQ6 I;  2I10 A;  4FE7 A;  1TL8 A;  1QO0 D;  2R93 J;  3HOU J;  5GAD J;  2DMN A;  4PK4 A;  4Y3O A;  1YJ9 I;  1JKO C;  3HIF A;  3BZC A;  1HLV A;  3SZG A;  4LG0 B;  4A6D A;  2H6B A;  1EH8 A;  2QUF A;  2VJJ A;  1Y1V J;  4AIH A;  1HCR A;  2VOO A;  1I1S A;  3WE3 A;  1BJA A;  3WGH A;  2BOL A;  2M4G A;  3LSJ A;  3M07 A;  5DM7 F;  5M5X J;  2DAO A;  1B9M A;  1IN4 A;  4RA2 A;  3SFI A;  3W6V A;  3K70 D;  4M3E A;  3E6C C;  5BPI A;  2OUM A;  1Z21 A;  1W1W E;  3TKY A;  2ZKZ A;  3WTT C;  4M9S A;  2JPC A;  4M9X A;  2CU7 A;  1VQ9 I;  2E34 A;  1V4R A;  2AQE A;  3KPH A;  3S17 J;  4CDG A;  3HTU A;  4FT8 A;  2JRM A;  3TW7 A;  4I0A A;  3BRO A;  4XRS A;  1K79 A;  2R7Q A;  4GYI A;  1MMD A;  1R58 A;  3CCY A;  1MNM C;  2HVS A;  3RQ4 A;  1XMX A;  2QQ9 A;  4HF1 A;  2Y48 A;  2RDP A;  1RI7 A;  4KIT B;  2IW5 A;  3JRA A;  4MTD A;  2QYO A;  2E1N A;  3W6K B;  2VOD A;  1W7P B;  1K78 B;  1IC8 A;  2K3P A;  5IYB J;  3A4C A;  4MNU A;  2ZME C;  3C7J A;  3DKY A;  1BOB A;  4IOA F;  1XG1 A;  3BTI A;  2GXA A;  1WJE A;  4KT6 A;  4U87 A;  3S14 J;  4D7N A;  3A0B C;  2CJJ A;  4BQA A;  2ZJR F;  3PSI A;  2YSR A;  1WCM J;  3R60 A;  2F5C A;  2AXT C;  4HV5 A;  2R7R A;  1ZG3 A;  3OYF A;  3DPL C;  2QEX I;  2L02 A;  3MZY A;  4N9H A;  3U2R A;  5FLV A;  2A5W A;  4CCO A;  1Y0N A;  4HA8 A;  3T1B A;  4EVI A;  1CF7 B;  4C2M J;  1ZLJ A;  2HPM A;  1MH4 A;  4N9I A;  5KAI C;  2MH9 A;  1ZAR A;  9ANT A;  4DYQ A;  1D1B A;  2ZO4 A;  1WJC A;  4A69 C;  3JCU C;  3VYU B;  1LFB A;  1P7I A;  3GLL A;  3QPT A;  4RMN A;  1K61 A;  1YFH A;  1V3F A;  2LBF B;  2H6C A;  4ZTJ A;  2DDA A;  4DYR A;  2HXI A;  3M1E A;  1MJB A;  1LDK B;  3ERE D;  2HKX A;  5M5W J;  1B4A A;  1VQ7 I;  2PFB A;  2XF7 A;  3B6A A;  3JAM K;  1GHC A;  1QNT A;  3PSF A;  3TL4 X;  4IPA A;  1KU9 A;  4P96 A;  3H1C A;  4BY7 J;  1R1U A;  2IS2 A;  1PYV A;  5LRS A;  1S6L A;  1OCC H;  2LF7 A;  2DPD A;  1OQY A;  2K9Q A;  1R36 A;  1S72 I;  1S7E A;  4XLF A;  2R7D A;  5LHI A;  5LLQ A;  4EJW A;  3DBL B;  4MFD A;  5A2Q Z;  3AG1 H;  1J09 A;  2V4J C;  3ERM A;  3S3N A;  4FX0 A;  1RES A;  5HS7 A;  2DA7 A;  2EQR A;  3VB2 A;  4G12 A;  2I5U A;  2NOJ B;  2JA2 A;  2B0L A;  4O5V A;  3KLN A;  2EFW A;  2HNH A;  5K7Z A;  4ENM A;  1VQO I;  1S3J A;  3GUD A;  4ON0 A;  2HQA A;  1X4P A;  3FMR A;  3GCM A;  2D1H A;  2M34 A;  2Q8K A;  3SDG A;  4QIW N;  1SVL A;  3P9I A;  2PMH A;  2JSC A;  2IS1 A;  2R92 J;  2P0W A;  3CC4 I;  3HOY J;  1FBS A;  2VJ4 A;  2FOK A;  4UUT A;  4P55 A;  2R7F A;  1Y56 A;  2VBY A;  3ZMZ A;  4A0Y A;  1SFX A;  1FIP A;  3E5Q A;  3KYD B;  1IXR C;  2JJ7 A;  3LST A;  2RQP A;  2CFX A;  2V26 A;  4DZJ A;  3K2Z A;  2DPU A;  2X6O A;  4YFN F;  1IGN A;  1V5G A;  4C2T A;  3LFK A;  2VOP A;  1JUS A;  2QZ8 A;  1YW9 A;  1J0R A;  2CGP A;  2V1N A;  2K9S A;  1DDN A;  5FKK A;  3IRQ A;  3I64 A;  3E1S A;  5JLW A;  1O3R A;  1TWG J;  2CW7 A;  5TJJ A;  4YFK F;  2ZNY A;  4JYK A;  5JI6 A;  2M8G X;  3C2H A;  2DMU A;  3GF2 A;  1B8I A;  3BR0 A;  4ZDL A;  1W5C C;  5AIP A;  1KU7 A;  1IAW A;  1PJR A;  4BJT A;  4B48 A;  2MD0 A;  2F2E A;  3QYF A;  4CH7 A;  3G6E I;  3BG6 A;  4ZYG A;  2RGV A;  5LBQ A;  2EJR A;  4OMZ A;  5J6X A;  4XSX F;  3KP6 A;  1MJ9 A;  2CS3 A;  4S0H B;  3C2G A;  4LOC A;  3LFU A;  1F43 A;  1VQM I;  2H1L A;  3PFY A;  2KJC A;  1R1V A;  3H9Q A;  4CCN A;  1XMA A;  2R5Y B;  2COB A;  2M4K A;  2W7N A;  2ZXI A;  1F5T A;  2JA5 J;  4M71 A;  5K1Y A;  4IOC F;  2M7A A;  2BW3 B;  3J7A Y;  3F72 A;  2DTR A;  1YS6 A;  4XLP F;  3GXO A;  2FE3 A;  4Y15 A;  4B8X A;  5EG0 A;  3RCO A;  1ZH5 A;  1HDP A;  3NWS A;  2MH2 A;  1G3T A;  5FB2 A;  2CWE A;  4KIC A;  2VL8 A;  3QU3 A;  4LK0 F;  3A0H C;  2V9K A;  3BZK A;  3HOW J;  2ADU A;  2MBF A;  4LG0 A;  1MBH A;  5FLX Z;  1IXS B;  5JHF A;  2X0L A;  3MKY B;  3CES A;  3DU6 A;  2LY9 A;  1C0W A;  2E35 A;  2XGE A;  2L9N A;  3JRG A;  1U8B A;  3H3U A;  2K9M A;  4UHT A;  4C3J J;  3TDZ C;  1Z6T A;  2FX0 A;  2ZJP F;  1I6H J;  3KP3 A;  1Z67 A;  1ULY A;  3CJR B;  3PNV A;  2KQR A;  3I54 A;  3SFZ A;  1JUM A;  4PZJ A;  4RBO A;  5E1Z B;  3ML6 A;  4XKC A;  4XBF A;  5HOO A;  1MMA A;  1QBJ A;  4NHJ A;  1JTX A;  4Y17 A;  1AA7 A;  2E60 A;  1BM9 A;  3RPU D;  5GAH J;  2HOS A;  2DLL A;  3H9G A;  1Y8Q B;  2OCC H;  2VQH A;  2FBI A;  4M3D A;  4BDZ A;  2ISY A;  2Z16 A;  2RAE A;  2L5Q A;  2RVC A;  4AC0 A;  4EJU A;  3CCE I;  3WG7 H;  3RYP A;  5JLX A;  1A04 A;  2AO9 A;  2XSJ C;  4Q47 A;  5EJC A;  2Z1D A;  5GTI C;  3PJR A;  4KN7 X;  1W7P A;  2M7B A;  2WTE A;  1U9N A;  5FJ8 J;  2FEZ A;  1FOW A;  3KX2 A;  3HOT A;  3GTG J;  2PLY A;  3G73 A;  4L0Y B;  3M4O J;  3KP4 A;  4FAS D;  4XLC A;  4RGX A;  2CQQ A;  3PNY A;  3NRV A;  5J3L A;  4ENJ A;  4L18 B;  3GVA A;  2D45 A;  1MGT A;  1HA8 A;  3HKZ A;  1ACI A;  4P9U A;  3G1L A;  4OIO F;  5F64 A;  2MSY A;  2OPT A;  2X6X A;  1E3O C;  4D5C A;  4R79 A;  2FF4 A;  1MBE A;  4B3X A;  4I76 A;  1CF7 A;  2F48 A;  3J81 K;  3ZQF A;  1OJL A;  1ZLK A;  1WJA A;  2WY7 Q;  2L01 A;  3OYI A;  1ZR2 A;  3BG5 A;  4MEX F;  4BJ6 C;  1GXP A;  1PP8 F;  1HF0 A;  3H9J A;  4W97 A;  3BJO A;  4X1E A;  2LBF A;  1A6Q A;  2KRC A;  3TQN A;  4DOZ A;  2XDV A;  1T56 A;  2GA1 A;  2ECC A;  4IQ4 A;  4XOT A;  5HLI A;  3V8J A;  3C2B A;  4QWQ A;  2H27 A;  2HZT A;  2CV1 A;  3K1P A;  3MCZ A;  2QSH X;  3OYG A;  3OSG A;  1FIA A;  3H92 A;  1EV7 A;  2XB5 A;  5K5Q A;  2GXB A;  3QU6 A;  4XM3 A;  3VSK A;  4HZF A;  1IJW C;  2DYS H;  4Q48 A;  3RKQ A;  3JSP A;  1T98 A;  4L5J A;  2CH0 A;  1MIJ A;  3FMQ A;  4ANJ A;  6PAX A;  2YUS A;  3TP3 A;  4RM3 A;  3TW6 A;  2R5Z A;  1HKQ A;  2UXN A;  3S8P A;  5BQT A;  3R61 A;  2V1X A;  4HLY A;  1FSH A;  1LDD A;  3OOP A;  3LSI A;  1XD7 A;  3G3Z A;  2MGQ A;  1FY7 A;  4M3B A;  3EQL F;  1D3Y A;  4ZTF A;  4UUV A;  1YOV B;  3L09 A;  4EMS A;  1EKE A;  3HTS B;  3ABT A;  4ZZD A;  4PGG A;  3L00 A;  3I4N J;  5IOZ A;  2Q2E A;  2CV2 A;  2X1E A;  3JRE A;  4WXH A;  5E3L A;  1P4A A;  3U1D A;  2XC7 A;  4Y33 A;  4BE2 A;  1IDZ A;  5BOX A;  4IHW A;  2VBZ A;  4A3J J;  1G2H A;  3ZMT A;  1D0Z A;  3BG3 A;  2EZH A;  3IWF A;  2XGD A;  1R71 A;  2K85 A;  1FSE A;  4ESB A;  3ASO H;  1IUY A;  2NS8 A;  1BI0 A;  3BG7 A;  1FYK A;  1A35 A;  4XLH A;  3K7A J;  1LKX A;  2FNA A;  2V9P A;  4RLQ A;  2DT6 A;  1K6O A;  2IEK A;  5H2F C;  4QTR A;  1JXS A;  3CMA I;  4P5O A;  1YRN A;  4XSZ F;  4KYW A;  2R7W A;  2G7U A;  1E0E A;  4ITV A;  3MWM A;  5EYR A;  1T0F A;  1ZKG A;  4NBQ A;  1JGS A;  1JHH A;  3D1N I;  1HST A;  1O3S A;  3S2W A;  5DCF A;  3TGN A;  2F5V A;  2DOA A;  3MD2 A;  1ZG5 A;  1RPW A;  4IXA A;  3FXK A;  2XRL A;  1T33 A;  1P9Q C;  2G0E A;  3LA7 A;  2LP0 A;  3L2V A;  1OMI A;  4E7L A;  1REP C;  3BC8 A;  4HX8 A;  3IH4 A;  2IA0 A;  1FNN A;  2RC4 A;  4H0E A;  3S3M A;  2DJN A;  3GTP J;  2X1C A;  3WOD F;  2RRE A;  3A2K A;  2F5D A;  4ASN A;  1IXC A;  1QPI A;  3VEP A;  1S7O A;  4PJM A;  2R7X A;  1KZH A;  3S15 J;  5E1W A;  5BPD A;  3HZJ A;  2P5L C;  4QLC U;  2L7K A;  3BP8 A;  1FMW A;  3D5S C;  4MEY F;  4Q4Z F;  1ZRE A;  4U0V A;  3VYS B;  1APL C;  3COA C;  3IUO A;  1WFX A;  1UJ8 A;  2VB6 A;  4Y13 A;  2DTZ A;  3J7Y J;  2EK5 A;  3LA3 A;  4YIF A;  4CUG A;  2LFB A;  3I59 A;  4MQV A;  3U9G A;  3GFI A;  2RKH A;  1RZ4 A;  2CQN A;  4BS9 A;  2LYC A;  4GFB A;  2ID3 A;  4I6Z A;  2FOW A;  4BHC A;  2JN6 A;  3K4J A;  1QZE A;  2HQ5 A;  2WA0 A;  2XAU A;  1ORK A;  4BGD A;  3A03 A;  4A12 A;  1IRZ A;  3F23 A;  3BOQ A;  4XOR A;  3TO9 A;  2HYJ A;  1XSX A;  3FK6 A;  3JR9 A;  3I53 A;  1ON2 A;  3OYN A;  3GME A;  3GWZ A;  1LDJ A;  2O8X A;  3SHF A;  2P81 A;  1Z7L A;  5DD8 A;  4AD9 A;  1LE8 B;  5IP7 J;  2L9V A;  2M87 A;  1UG0 A;  4IRH A;  1F4K A;  2DT7 B;  2ICW G;  1EJ9 A;  1N78 A;  4PGH A;  3I5U A;  1USS A;  3DEE A;  1MSE C;  4MGR A;  4KJZ A;  1GUU A;  2KT0 A;  5B1B H;  3DBR B;  1LB2 A;  3EYI A;  4CHU A;  2LY2 A;  3AG2 H;  3H5N A;  3ZQH A;  3CCQ I;  5F04 A;  2DFI A;  1UAA A;  3TOA A;  2KRF A;  3MZH A;  4A5M A;  3I0T A;  1XGM A;  1IDY A;  3NQO A;  3F22 A;  2BEO A;  2PBI A;  3JRD A;  4GDF A;  2OCE A;  3KYL A;  3Q9V A;  3Q3S A;  1UFM A;  1WRJ A;  2OD5 A;  4BYY A;  4V2G A;  3LSG A;  2Y9Y A;  4YEL A;  5C4J J;  3G4S I;  1JE8 A;  1W0U A;  3HYI A;  3VOE A;  2X85 A;  2K40 A;  3OMY A;  3Q9S A;  4PJN A;  3KET A;  3O2P E;  2F5E A;  2LNB A;  1DP3 A;  3KIO A;  2DK8 A;  1LPQ A;  1RIO H;  4XLA A;  1B9N A;  1UEL B;  2IGM A;  1VQ8 I;  1TW2 A;  2H94 A;  1Z3X A;  4IX7 A;  2XPW A;  4KDP A;  3HSR A;  4GYG A;  1SAN A;  2XGC A;  1AOY A;  5GP9 A;  1OYI A;  3IWZ A;  3R0A A;  1DPU A;  1IN6 A;  3ZXS A;  1FZP B;  5KCM A;  3CD6 I;  4XR6 A;  4ABZ A;  4EJV A;  1WJD A;  1YX3 A;  1AKH B;  2FQ3 A;  2XRN A;  2Y69 H;  3GEZ A;  4NB5 A;  4J19 A;  4UB6 C;  3BG9 A;  4YIR X;  3PFI A;  1TBX A;  1LVA A;  1Y0U A;  3DP7 A;  2JA6 J;  1H89 C;  3E7L A;  4WF2 A;  4BJ5 C;  4B44 A;  5C44 J;  3IHU A;  2ACJ A;  2ZSI B;  1SEU A;  5EGO B;  4E7K A;  2K4J A;  4IKF A;  3E97 A;  3FWE A;  3WU2 C;  2CO5 A;  3ZMD A;  1YJN I;  4M73 A;  1RKT A;  1W36 C;  4F91 B;  1Z9C A;  1S5L C;  4A3M J;  4F7Z A;  1ZRD A;  3ISP A;  1G8X A;  4HV6 A;  2VI6 A;  3KEY A;  1EH7 A;  4HQM A;  3PL8 A;  4IHX A;  1J75 A;  3DEW A;  1YO5 C;  1TW3 A;  4AM3 A;  3T8R A;  1BR4 A;  3H3Z A;  2ZFW A;  4LFU A;  4IHT A;  1IO2 A;  4F52 A;  5IY5 H;  3WTV C;  4AYB A;  3B73 A;  4BH9 A;  2YS9 A;  3LSH A;  1BC8 C;  2ISZ A;  5KK1 A;  2QEN A;  1TQP A;  1V5F A;  2YX7 A;  5CPR B;  5EF6 A;  1U3E M;  2HOE A;  5FLM J;  2UZK A;  4HYE A;  1TWF J;  3F8F A;  3HRS A;  4M6V A;  3MQ0 A;  2LKX A;  4JP0 A;  1O3Q A;  4IHV A;  1MJA A;  3TP0 A;  3ZR8 X;  2VE9 A;  3JRH A;  1GV2 A;  4J01 A;  5JHU A;  5ILU A;  2FRH A;  1O7L A;  4HEA 2;  4QPQ A;  5DCM A;  3PO3 J;  1YQA A;  2QVO A;  2B9S A;  2M45 A;  1XPX A;  1BR2 A;  1HW5 A;  1B59 A;  2EIN H;  3FXU A;  3QRF F;  5AIQ A;  1XSD A;  4IQJ A;  4A0Z A;  1GVD A;  3M1C A;  2O8K A;  2M2E A;  1BL0 A;  1JJ8 C;  1K4T A;  2ELH A;  4MO7 A;  5M3M J;  1A36 A;  1D8J A;  1VQK I;  2X51 A;  2DO7 A;  1MND A;  1FLI A;  1Z7U A;  2QSG X;  2XAQ A;  1VND A;  1PP7 U;  2PJR A;  3HPG A;  2IGO A;  3V7C A;  1QQI A;  1OYW A;  1ZAO A;  3HJE A;  3FIW A;  2QLZ A;  1OPC A;  4EJO A;  2YX4 A;  1RKW A;  3DTE A;  1Q1V A;  4HNU A;  2OBP A;  2X4H A;  3E0J B;  2KIF A;  1P6R A;  2MC3 A;  3BLY A;  3DTK A;  4PFO A;  1WHU A;  3MEX A;  2HDC A;  2A68 F;  3PUB A;  1BI3 A;  4XKW A;  3EYY A;  1TTY A;  3DWL E;  4KIF A;  3K4N A;  2KDZ A;  1ETX A;  2VXZ A;  3TED A;  2JSP A;  1PDN C;  4LB5 A;  3PNT A;  2IBD A;  4JOM A;  4W1U A;  3REO A;  4A2U A;  4BQQ A;  1R5I D;  3FKI J;  2FD5 A;  1ZGW A;  3F8B A;  1ZGA A;  1E2X A;  2HDD A;  2A05 A;  3GTO J;  2K02 A;  4BHB A;  2WV0 A;  3GZN B;  3ZN1 A;  4L0Z B;  3RKY A;  1R4N B;  4PJ0 C;  4I0B A;  2GZW A;  1J2X A;  1T39 A;  1SFO J;  1VQN I;  2ESH A;  3DPU A;  3P9C A;  3F8M A;  3OR2 C;  2G9W A;  3AAF A;  1JKQ C;  1P92 A;  1TT5 B;  3K4C A;  4RB2 C;  1VQ4 I;  2DW4 A;  1Z77 A;  4XKV A;  1D5V A;  4HQE A;  2HYG D;  1Y6I A;  5HS9 A;  3J7A O;  3O8G A;  2ZBK A;  5D5V B;  2CW0 F;  4L5I A;  1HKT A;  1RNL A;  4UXN A;  3JRB A;  2E2I J;  3GYH X;  3A02 A;  3RSN A;  1TNT A;  5FFZ A;  1T8I A;  1R49 A;  4I2O A;  2CG4 A;  2A3S A;  1YIJ I;  4RAY A;  4CO8 A;  3KE2 A;  5IYD J;  5LHG A;  2VAS A;  4CZC A;  1P4X A;  2M9H A;  1O7F A;  2DFF A;  4HNT A;  1LE8 A;  4ZDP A;  3OYJ A;  5HNH A;  2BZT A;  1U0J A;  3FXO A;  3QOE A;  3CCS I;  2BY1 A;  3K2A A;  3E5U A;  3NEU A;  2MLG A;  5BMZ A;  2IAI A;  1WH5 A;  2DA6 A;  1X1A A;  2PG4 A;  3SEQ A;  2R0Q C;  2WV1 A;  1WJB A;  3ABK H;  3KLO A;  2IA1 A;  4I09 A;  2XHK A;  4MHG A;  4F3Q A;  2V79 A;  2KZG A;  2KZV A;  3IAS 2;  3IC7 A;  1POG A;  2DN0 A;  2C6Y A;  1ZK8 A;  5DV5 A;  4F92 B;  1LEB A;  2P5V A;  2OAZ A;  2EZK A;  1BBY A;  2KL4 A;  4O6J A;  2YU9 J;  1FP2 A;  2LH9 A;  2CQ7 A;  1UB9 A;  1NHA A;  2CQK A;  2HTS A;  3ELK A;  1JT6 A;  4L9J A;  1I3A A;  2BYV E;  3SJM A;  3AL0 B;  4U7B A;  1P2F A;  3ZMV A;  3S93 A;  4BKX A;  3BJ6 A;  5F27 A;  2BVL A;  3VFZ A;  2KFD A;  2ID6 A;  2HI3 A;  3MZ8 A;  3HKZ N;  4L5E A;  1SD7 A;  3ZGK A;  2LRE A;  1OCO H;  1WH7 A;  3G1M A;  2ZCW A;  2DCE A;  2QBY A;  2W48 A;  2VT2 A;  1T08 B;  4M3F A;  1BC7 C;  2NVT J;  3ZQL A;  2O0Y A;  1BJZ A;  3PQK A;  4LIV A;  4HX7 A;  2ZJQ F;  4AVZ A;  2E2H J;  3A01 B;  5ILV A;  1P7J A;  1JGG A;  1R22 A;  5KVR A;  1T6S A;  2ZB9 A;  1IRG A;  2GOX B;  3CDH A;  1AKH A;  1S7A A;  3RPQ A;  2XVC A;  2I8D A;  1W5T A;  5BS6 A;  4C2U A;  2JMW A;  1U2W A;  2BXY A;  2WAQ A;  3KFW X;  3BCB A;  3CDI A;  3K4L A;  2W57 A;  4PFP A;  2E19 A;  4RAG A;  4CYD A;  4O3M A;  5EGO A;  4CCK A;  1WPK A;  3AG3 H;  3BDD A;  3FMS A;  1OLT A;  5HLT A;  3KEQ A;  1UG2 A;  2J5O A;  4DW6 A;  1ODD A;  3JRI A;  1G6N A;  2MAB A;  3D5L A;  3JSO A;  3CP8 A;  5L3D A;  3QOD A;  3CCJ I;  1SMT A;  3RIR A;  1NK3 P;  2AHQ A;  2XAH A;  4GCV A;  3C3W A;  1TQI A;  2FBH A;  3B6C A;  3W3C A;  5LRR A;  4HLX A;  4WX9 A;  3NAR A;  5CLS A;  3S2H J;  2VLA A;  5CVJ A;  4ENN A;  1L0O C;  1G3Y A;  2MD5 A;  2P5K A;  3CUQ B;  1VFC A;  2LLK A;  1G3W A;  4PSW A;  3R4K A;  2LKS A;  2BBY A;  2NS7 A;  1Z05 A;  4HPQ A;  4CYC A;  2KLO A;  4RM2 A;  4BDY A;  1OCP A;  3CO7 C;  1OFC X;  5JR3 A;  3L2Q A;  2HGC A;  2LSO A;  4NC6 A;  2N8G A;  3SQN A;  2NVY J;  4IVN A;  2XRO A;  4G6Q A;  3IKV A;  4UB8 C;  2Y30 A;  4LLL A;  2EBI A;  4XRF A;  3VDX A;  1S8N A;  1XDU A;  1W4M A;  2O61 A;  3RDI A;  2K86 A;  1RRJ A;  2O5R A;  2HFH A;  2BE5 F;  2E7X A;  5J4Y A;  4KIB A;  4EGY A;  1NTC A;  2HS5 A;  1P4W A;  2DFE A;  3IV5 A;  4BAC A;  2STW A;  2RV8 A;  4I99 C;  1BI2 A;  4V19 K;  4Y4R A;  2RN7 A;  2JT1 A;  5FGM A;  2NXN B;  5F08 A;  2KIU A;  5M3F J;  1MKM A;  1Q1H A;  5E1X A;  2DA2 A;  1E3P A;  1IRX A;  2R3S A;  4UY8 I;  2XAJ A;  4PSX A;  3FXL A;  2ECB A;  3HOS A;  3LL7 A;  4NDL A;  3IL2 A;  2HU9 A;  5F6F A;  4XLN F;  4U7D A;  1RR8 C;  3ZMS A;  3IKT A;  1KU3 A;  2O6G E;  4KIG A;  3BR3 A;  4JK1 X;  5H6Q A;  2F4M B;  2JVH A;  4Z6Y A;  1FC3 A;  4UVB A;  5BNG A;  4RB0 A;  4RLF A;  2QF7 A;  5GTH C;  3MAJ A;  4BXX J;  3KP2 A;  4CCL A;  1X3Z B;  3S3O A;  1ZGJ A;  2DFH A;  1K78 A;  1ETY A;  1SD5 A;  3E3V A;  1XB4 A;  1ZN2 A;  5M5Y J;  2AXL A;  4WK8 F;  4MLO A;  3HSF A;  3OIO A;  4Y7N J;  2GBY A;  2IJL A;  1U9O A;  5H6R A;  5TGT A;  3FK7 A;  1ETW A;  3KP5 A;  2P7V B;  4E7J A;  3RZO J;  2O03 A;  2ZME B;  4B3A A;  3D0S A;  4IL6 C;  2PI0 A;  1YI2 I;  2M0C A;  4BHP A;  4J00 A;  1U6G A;  4MTE A;  2JUC A;  2A6E F;  2FMY A;  2KHM A;  2VJ5 A;  2XIG A;  3PUF A;  4ZYH A;  3JW4 A;  3GZ5 A;  5A2Q K;  4MIM A;  3ABL H;  2W84 A;  3S1M J;  2OTL I;  4R8H A;  1MBJ A;  3BQY A;  2VT3 A;  4YRV A;  4XK4 A;  3G2B A;  4BL0 B;  4U0Y A;  1TWH J;  2VQG A;  2CRG A;  5K7H A;  4G7H F;  5C4X J;  3V4G A;  1AWC A;  1FP1 D;  3BR1 A;  3VYT B;  1IRF A;  3ZOB A;  2TCT A;  1ZRF A;  2DBB A;  1F1Z A;  2DMQ A;  1BA5 A;  2OV7 A;  2X9D A;  2MG4 A;  1ZYR F;  3QPS A;  4II3 A;  1TQM A;  2E36 A;  2QQ8 A;  2ZNZ A;  4P1W A;  5IP9 J;  5K7F A;  4NC7 A;  2IVM A;  2NYX A;  5FD6 A;  2ZXW H;  1W0T A;  3ROU A;  5K5O A;  1H88 C;  5IP6 A;  1YW7 A;  1DU0 A;  1ETV A;  4OIQ F;  2CUJ A;  2ZXJ A;  1PUE E;  3L2W A;  2M8E A;  2WAE A;  4RGS A;  2OA4 A;  2ELJ A;  3Q0W A;  3I3L A;  2QM3 A;  2JUG A;  3RZD J;  3WTW C;  1FWZ A;  3CMY A;  4NQW B;  3L9F A;  3T5X A;  1L3L A;  1U5T B;  3SEZ A;  3M9A A;  4WWC A;  3OY9 A;  2WY8 Q;  4ZJZ A;  2EIJ H;  2W4S A;  4N4N B;  2EPF A;  2OZU A;  2UXX A;  4UV8 A;  3TO6 A;  3CDL A;  4LD5 A;  3O3K A;  5LD2 C;  3KEO A;  1V5E A;  3A01 A;  2LVS A;  2IGK A;  1IUF A;  3K4K A;  1YX5 A;  2W82 A;  4S05 A;  5KAF C;  4OOI A;  2V1D A;  2HOA A;  2A6T A;  4PJJ A;  1SFK A;  3B02 A;  5K5R A;  1YIO A;  4ZH4 F;  5IT3 A;  1FT9 A;  4YII A;  5JVT A;  5L3B A;  4BQO A;  2OTJ I;  2L4A A;  3HXL A;  4H4K C;  1D1A A;  3H0D A;  3NAU A;  3V7R A;  3JRF A;  4V2F A;  1CQT A;  1ERD A;  3X2Q H;  1DGW Y;  3WGI A;  4BY1 J;  1XGS A;  2IPQ X;  3RI4 A;  2XGX A;  1H8A C;  4AYB N;  4RGR A;  4DIQ A;  2QCO A;  3SXY A;  1B6A A;  2JZY A;  5CKT A;  4A0X A;  5EZH A;  2PMU A;  3JRC A;  3F3X A;  4OMY A;  4IO9 F;  1QZZ A;  4ESF A;  3FM3 A;  2R7U A;  1J5Y A;  5HDG A;  2MA3 A;  3RJP A;  3GTJ J;  2F5F A;  1WWX A;  1XX5 A;  2OJE D;  3L2U A;  4KMF A;  2HVQ A;  2VKD A;  4IHY A;  3TOB A;  4XMY A;  3GFM A;  4OIN F;  3HUG B;  3LOC A;  4I98 B;  2FBK A;  2TDX A;  2H8R A;  1Z91 A;  3K4M A;  4LLN A;  2R5Y A;  5TIS C;  2EV6 A;  2E1M B;  3BCA A;  3FX3 A;  4BAY A;  1NK2 P;  5FLX K;  3OYM A;  3OYA A;  1K83 J;  2BW3 A;  1RET A;  2WBM A;  5E3O A;  2CUZ A;  4HDV A;  5HS8 A;  3FXR A;  1K7A A;  5E3N A;  4WXC A;  3OYD A;  1U78 A;  5EEA A;  1ZG1 A;  4ESJ A;  1KON A;  4YG2 F;  1UHW A;  4XRM A;  2BY0 A;  3HOZ J;  3S1Q J;  4XN0 A;  2YR2 A;  3HG9 A;  3LAJ A;  2D1V A;  2E7W A;  2LMD A;  2MW8 A;  5ICC A;  1SAX A;  2VE8 A;  3ULQ B;  3HSE A;  3M3Y J;  2EFN A;  1G59 A;  1KQ8 A;  5E8G A;  1BW6 A;  5DUK A;  1YW8 A;  1IV8 A;  5HLH A;  5B1A H;  5D6F A;  4I02 A;  2FUG 2;  2KIS A;  2BY3 A;  3P5J A;  1R4M B;  3DF8 A;  4HNV A;  1J59 A;  5DEQ A;  5E3M A;  2W25 A;  2DJI A;  2P4W A;  3BTL A;  1D0X A;  2GXG A;  1GVJ A;  4M72 A;  4B47 A;  2Y75 A;  1TZL A;  4PJL A;  4XLE A;  3LAP A;  3K1M A;  2H8W A;  2FQ4 A;  2V1U A;  3QP6 A;  2LTP A;  3MMY B;  1D8K A;  2IS4 A;  1OIS A;  2OQG A;  5TRD A;  1MBK A;  5D4R A;  4XKB A;  3JAM Z;  2RNG A;  1WZ2 A;  5IOY A;  2GOM A;  1I50 J;  2HYF A;  4DGW B;  3DTI A;  3S32 A;  5DD4 A;  3HRM A;  2DMT A;  1DPR A;  1MBF A;  3QOP A;  1BR1 A;  4DZP A;  3CCM I;  2EFO A;  3GX4 X;  1B72 B;  2JRT A;  2E1C A;  2NS0 A;  4DJA A;  3GTQ J;  4HRI A;  3W2V A;  2QWW A;  1R9T J;  2M30 A;  2W24 A;  4PDK A;  2EZI A;  4JX5 A;  1UHM A;  3E6D A;  2FU4 A;  2HZD A;  3H0G J;  2V6E A;  3QAH A;  2CQX A;  4X0G A;  3M8J A;  3E6B A;  1WKM A;  2PX9 A;  2VC1 A;  1FOY A;  1BOA A;  3FXM A;  3I9V 2;  4N4O B;  3WG9 A;  1HSJ A;  1LUJ B;  2DU9 A;  1FYM A;  2VXD A;  3EET A;  2L2O A;  1IN7 A;  1X1D A;  4NUB A;  1XDS A;  1YS7 A;  1ETQ A;  3U21 A;  3K9T A;  4CA0 A;  3BY6 A;  3DCF A;  1WSU A;  2VPL A;  4LB6 B;  4CSW A;  2HKO A;  4D9J A;  4I7H A;  1VF9 A;  2ZJ2 A;  2PMZ A;  5KHD A;  3BT9 A;  1FPQ A;  5J8F A;  2BXZ A;  2OQR A;  4B1R A;  4C3H J;  2Y0S N;  5ICE A;  5D8K B;  4RB3 C;  1PUF B;  2O3F A;  2E2J J;  1HW2 A;  3N05 A;  4WXD A;  3V7S A;  4LJZ F;  2NVU B;  4C9Y A;  4BQN A;  4UVA A;  2CMP A;  2R7O A;  1WI3 A;  3BR5 A;  4A5N A;  2HOT A;  2ME6 A;  4P9F A;  3GO5 A;  2EV0 A;  2LKP A;  4U88 A;  3FXJ A;  3ZRG A;  1Y8R B;  5DUI A;  4XON A;  4E70 A;  2XKO A;  3E5X A;  2GWR A;  2XAS A;  2MYS A;  1W7P D;  3KYC B;  5FKO A;  3N97 A;  1D1C A;  1ETK A;  3ECH A;  1NH3 A;  1WI9 A;  3KZZ A;  4NQW A;  4PCQ A;  2W85 A;  1MZB A;  5H20 A;  3OYE A;  4HX4 A;  3ZN0 A;  3GW2 A;  3RKX A;  1U5T A;  3FZV A;  3ZQQ A;  1ONV A;  1YG2 A;  4HAM A;  1LFP A;  3DV8 A;  2OC6 A;  4NC8 A;  2KRH A;  1DP7 P;  2CYY A;  5IYC J;  4OU0 A;  2R4G A;  3QYB A;  4A3I J;  2QSF X;  2A69 F;  2WAQ N;  1NG6 A;  1X58 A;  3RYR A;  3OS0 A;  4BXF A;  5HVQ C;  5D5U B;  5EG0 B;  2M0M A;  3CC7 I;  3ZQI A;  4GGG A;  4E7H A;  4ZZL A;  2STT A;  1QVU A;  2UWM A;  2KPM A;  5D5W B;  4C30 A;  2PQ8 A;  2HQR A;  2EZL A;  3FHZ A;  3OL3 A;  3FXQ A;  4QPO A;  1R7J A;  3I58 A;  3ZQG A;  1VZ0 A;  1SAU A;  2QQA A;  2NNN A;  4KMU X;  1TP4 A;  3A1Y A;  1Y1W J;  3KCC A;  1STZ A;  4BEH B;  2WB1 A;  3MN2 A;  3DXJ F;  5E79 C;  4HST A;  1FMV A;  5J1R A;  2J5P A;  1QU3 A;  1F36 A;  1XN7 A;  4YEJ A;  5GPA A;  1BN5 A;  3K69 A;  4UUS B;  3WHB A;  2B63 J;  3QP5 A;  2JTV A;  2KMU A;  2YU3 A;  3CME I;  3LA2 A;  5FD5 A;  1J9I A;  2L0K A;  2BHY A;  1BI1 A;  2V9V A;  5LGU A;  3CUO A;  3K10 A;  3WU1 B;  2L7Z A;  2IA2 A;  3HUG A;  3HM5 A;  3H5A A;  4DYC A;  5CQE A;  5CJ9 A;  5GAG J;  2VN2 A;  4IJA A;  3W6J B;  2IP2 A;  3CF5 F;  3LSM A;  4M9Z A;  1XTA A;  3C1D A;  4B43 A;  2DXI A;  2HWV A;  2HTJ A;  3CCU I;  5HOD A;  1IV6 A;  2IT0 A;  3LQR A;  1EA3 A;  4CCM A;  3FKJ A;  2G7H A;  3F6O A;  4CXF A;  1HBX G;  3I55 I;  3CLQ A;  4HOB A;  1D5Y A;  3M8E A;  3GTM J;  2DOD A;  4FET A;  2XSD C;  2PN6 A;  2JQ7 A;  1YTY A;  3HBL A;  2EA4 A;  2AQF A;  1ZRC A;  2HVR A;  2DA4 A;  3ZPL A;  5FKN A;  3F21 A;  2FA5 A;  3F8N A;  3WTX C;  5E20 A;  5J1U A;  1SD6 A;  2EIK H;  3OS2 A;  4KN4 X;  4M6X A;  2LD5 A;  2ESN A;  1VI0 A;  1LFU P;  3IH3 A;  2W1O A;  5DDG A;  4A3L J;  3ECO A;  3ZMU A;  4Y52 J;  4BXU A;  2QKM B;  1FYL A;  1KA8 A;  1W36 D;  2EA2 A;  1R23 A;  4HG2 A;  2P7C B;  2DMP A;  4HSR A;  2CUF A;  5EZG A;  2DOE A;  3P7N A;  3V8L A;  2QKL B;  1K4S A;  1Z6R A;  1GXQ A;  1IN5 A;  2VKE A;  1U8R A;  1HKS A;  1GLN A; 
#chains in the Genus database with same CATH homology
 5HDN A;  2XV4 S;  1BIA A;  3F6V A;  2CSO A;  2COM A;  3J81 Z;  2NRA C;  4DQ2 A;  4EM0 B;  4G9Y A;  1XGN A;  1F9N A;  2PJP A;  4LGW A;  4U0W A;  5FFX A;  3K1N A;  5D4S A;  4G7Z F;  3DKW A;  5IT9 Z;  3KZY A;  1JHF A;  1SD4 A;  4EJT A;  2P6T A;  1U5T C;  2KIM A;  5LEJ A;  5F1R A;  2YPR A;  3F8C A;  5DYM A;  1KYZ A;  3BWG A;  4IRI A;  3BJA A;  3V8K A;  1VTN C;  5LGN A;  2VBW A;  1J7K A;  1R5H A;  5D6E A;  2A6H F;  1E17 A;  1T38 A;  2DI3 A;  4M74 A;  2DQL A;  3TDU C;  1SMY F;  5CVV A;  2V6C A;  1IF1 A;  3WTZ A;  3WTU C;  1B1B A;  4HBL A;  3GLX A;  2GAU A;  2P8T A;  2NNY A;  2Z99 A;  4L9T A;  5ED4 A;  4KUM A;  3WTY C;  3M7G A;  3BPX A;  2AS5 F;  2XUB A;  3EUH A;  1RUN A;  4HF2 A;  5JFR A;  4Q5S F;  2LF8 A;  4OIR F;  5J8C A;  3I59 B;  2EWN A;  2KJB A;  5CVU A;  5AON A;  2P6S A;  1IW7 F;  4EQQ A;  1HQC A;  5L3C A;  2Z33 A;  1UST A;  1W5S A;  1OR7 A;  2Q0O A;  3SZT A;  2EFQ A;  3IRR A;  4FX4 A;  4AIK A;  3M8F A;  3ZQ7 A;  3DEU A;  4JQF A;  5E17 F;  1TNS A;  4CZZ A;  3P9K A;  5CVR A;  3C18 A;  5ICG A;  2VC0 A;  5L3F A;  4EGZ A;  2Z9O A;  1I5Z A;  1T2K A;  3HRU A;  4ZYE A;  1SFU A;  4I01 A;  1KQ0 A;  4UV9 A;  4WCG A;  2XAG A;  5HDK A;  3KP7 A;  1QGP A;  3TO7 A;  5ILS A;  5LGT A;  2IRF G;  4B09 A;  2OU2 A;  3DFG A;  3L7W A;  5D8L B;  4LLG F;  5FO5 A;  4RAZ A;  3GZ6 A;  3GFL A;  4G8X A;  2M5W A;  1TLH B;  1XMK A;  2GA2 A;  3FF5 A;  3VOD A;  2MLK A;  3J80 Z;  1R5G A;  4LMY A;  2M1B A;  2WWY A;  4G6D A;  2KKO A;  3HHG A;  4L9N A;  4LK1 F;  3DPT A;  4FHT A;  3BPV A;  1YLF A;  3K0L A;  2XKP A;  5IT9 K;  2GIV A;  2FSW A;  4OIP F;  4S04 A;  2A07 F;  3BZ6 A;  3EDP A;  4GO1 A;  1MDM B;  3WGG A;  1R1T A;  4EM1 A;  1ON1 A;  5CYV A;  3OV8 A;  2BGC A;  5LHH A;  1H9G A;  2OZ6 A;  2VBX A;  1FX7 A;  3T8T A;  4EV0 A;  1I1G A;  1O57 A;  5DCM B;  1X3U A;  1H0M A;  4DNC A;  1IN8 A;  1EH6 A;  1HW1 A;  1G4D A;  4Z2Y A;  4HDU A;  4RS8 A;  3WTS C;  1R00 A;  3N4M A;  3DQV C;  4K2E A;  5CVI A;  1KYW A;  1UCR A;  1OKR A;  3PQJ A;  2Z5U A;  3R6S A;  1QPM A;  1LEA A;  4CIC A;  3CLO A;  2VON A;  2L4M A;  1G3S A;  1S29 A;  2PEX A;  3WU0 A;  4RB1 A;  1DUX C;  1OYY A;  3CUQ A;  4KA4 A;  3SZP A;  4G94 A;  5HLG A;  2K7L A;  1HXD A;  3LWF A;  2HR3 A;  3QPH A;  2L54 A;  4HF0 A;  1IZ1 A;  1SFE A;  4GXO A;  4BNC A;  4AIJ A;  3Q5F A;  3JTG A;  4JBA A;  1FBU A;  5ICF A;  1CGP A;  5EEH A;  3ZP5 A;  3WE2 A;  4CGZ A;  3I4P A;  2FXA A;  2A61 A;  5L3E A;  1MD0 A;  1I6X A;  2L3D A;  4AVP A;  3CTA A;  2RNJ A;  1KGS A;  2A5Y B;  2K4B A;  3MFK A;  5E8I A;  5LEK A;  3RTR A;  5ERI A;  1XCV A;  1Z1D A;  2EFP A;  2BV6 A;  5EEG A;  2H09 A;  4KT5 C;  4R1H A;  5L3G A;  2LDU A;  4EM2 A;  3L2C A;  1XSV A;  3R0J A;  1KQ9 A;  1YYV A;  5E18 F;  5D5X B;  2ZME A;  3ABU A;  2HQN A;  1XCB A;  2QBY B;  3J80 K;  2D2W A;  4ZYD A;  3CJN A;  2QQB A;  1RUO A;  3I71 A;  4KNY A;  4YFX F;  3JTH A;  4M6Y A;  4MQ9 F;  1QZY A;  4N0B A;  4L9V A;  3CO6 C;  2ETH A;  2Y0M A;  4A6E A;  2NAZ A;  1KU2 A;  1O3T A;  4IRG A;  3HRT A;  1FOK A;  4IHS A;  4AWX B;  2K27 A;  1ZHF A;  2JPB A;  2DQR A;  3O6B B;  2WC2 A;  3FM5 A;  4KFC A;  1LJ9 A;  3T0Y A;  3GFJ A;  2FNP A;  3E6M A;  3RPU A;  3CUQ C;  2Z3Y A;  4HW0 A;  2EB7 A;  2GQQ A;  1MDM A;  4IF4 A;  4UNO A;  4G7O F;  1I27 A;  4ENK A;  4D0P A;  1H9T A;  1BIB A;  2DK5 A;  1FBQ A;  2FML A;  4TV7 A;  4UVC A;  2EV5 A;  1WQ2 A;  1XGO A;  2XAF A;  3LQQ A;  3HHH A;  3RKW A;  1LNW A;  2DT5 A;  2HEO A;  4ETS A;  4RGU A;  1LQ1 A;  1QO0 D;  3HIF A;  4LG0 B;  4A6D A;  2H6B A;  1EH8 A;  2QUF A;  2VOO A;  4AIH A;  1I1S A;  3WE3 A;  1BJA A;  3WGH A;  2DAO A;  1B9M A;  1IN4 A;  5BPI A;  3E6C C;  3TKY A;  2ZKZ A;  3WTT C;  4M9S A;  2JPC A;  4M9X A;  1V4R A;  4CDG A;  3HTU A;  4FT8 A;  4I0A A;  3BRO A;  1K79 A;  4GYI A;  1R58 A;  2QQ9 A;  4HF1 A;  2Y48 A;  2RDP A;  1RI7 A;  2IW5 A;  4MTD A;  2QYO A;  2E1N A;  3W6K B;  2VOD A;  1W7P B;  1K78 B;  4MNU A;  3C7J A;  4BQA A;  3R60 A;  2YSR A;  2F5C A;  4HV5 A;  1ZG3 A;  3DPL C;  2L02 A;  3MZY A;  4N9H A;  3U2R A;  4HA8 A;  3T1B A;  4EVI A;  1CF7 B;  1ZLJ A;  4N9I A;  2MH9 A;  1ZAR A;  2ZO4 A;  3QPT A;  1YFH A;  1V3F A;  2H6C A;  3M1E A;  1MJB A;  1LDK B;  3ERE D;  2HKX A;  1B4A A;  1GHC A;  2PFB A;  3JAM K;  1QNT A;  4IPA A;  1KU9 A;  4P96 A;  1R1U A;  5LRS A;  1S6L A;  2LF7 A;  2DPD A;  1R36 A;  5LHI A;  2R7D A;  5LLQ A;  4EJW A;  5A2Q Z;  4FX0 A;  5HS7 A;  3VB2 A;  2B0L A;  4O5V A;  3KLN A;  2EFW A;  4ENM A;  1S3J A;  3GUD A;  4ON0 A;  3FMR A;  2D1H A;  2Q8K A;  3P9I A;  2PMH A;  2JSC A;  1FBS A;  2FOK A;  4P55 A;  2R7F A;  2VBY A;  3ZMZ A;  4A0Y A;  1SFX A;  3E5Q A;  1IXR C;  3LST A;  2RQP A;  2CFX A;  3K2Z A;  2DPU A;  4YFN F;  3LFK A;  2VOP A;  2QZ8 A;  1YW9 A;  1J0R A;  2CGP A;  1DDN A;  3IRQ A;  3I64 A;  1O3R A;  5TJJ A;  4YFK F;  2ZNY A;  5JI6 A;  3GF2 A;  5AIP A;  1KU7 A;  1IAW A;  2F2E A;  4ZYG A;  2RGV A;  5LBQ A;  2EJR A;  4OMZ A;  5J6X A;  4XSX F;  3KP6 A;  1MJ9 A;  2KJC A;  1R1V A;  1XMA A;  1F5T A;  4M71 A;  5K1Y A;  3F72 A;  2DTR A;  1YS6 A;  4XLP F;  3GXO A;  2FE3 A;  4Y15 A;  4B8X A;  1ZH5 A;  2MH2 A;  1G3T A;  5FB2 A;  2CWE A;  4KIC A;  3QU3 A;  4LK0 F;  2ADU A;  2MBF A;  4LG0 A;  5FLX Z;  1IXS B;  2X0L A;  1C0W A;  3H3U A;  4UHT A;  3TDZ C;  1Z6T A;  3KP3 A;  1ULY A;  3I54 A;  3SFZ A;  4PZJ A;  5E1Z B;  3ML6 A;  4XBF A;  5HOO A;  1QBJ A;  4NHJ A;  4Y17 A;  1BM9 A;  2DLL A;  2FBI A;  2ISY A;  2RVC A;  4EJU A;  3RYP A;  1A04 A;  4Q47 A;  4KN7 X;  1W7P A;  2WTE A;  2FEZ A;  3HOT A;  2PLY A;  3G73 A;  4L0Y B;  3KP4 A;  4RGX A;  3NRV A;  4ENJ A;  4L18 B;  3GVA A;  2D45 A;  1MGT A;  4P9U A;  4OIO F;  5F64 A;  4R79 A;  2FF4 A;  1CF7 A;  3J81 K;  1ZLK A;  2L01 A;  4MEX F;  1GXP A;  1PP8 F;  3BJO A;  3TQN A;  2GA1 A;  3V8J A;  5HLI A;  4QWQ A;  2H27 A;  2HZT A;  3K1P A;  3MCZ A;  3H92 A;  1EV7 A;  5K5Q A;  2GXB A;  3QU6 A;  4HZF A;  4Q48 A;  3JSP A;  1T98 A;  4L5J A;  3FMQ A;  6PAX A;  1HKQ A;  2UXN A;  5BQT A;  3R61 A;  2V1X A;  4HLY A;  1FSH A;  1LDD A;  3OOP A;  1XD7 A;  3G3Z A;  1FY7 A;  3EQL F;  1D3Y A;  4UUV A;  3L09 A;  4EMS A;  3HTS B;  3ABT A;  4ZZD A;  4PGG A;  3L00 A;  2Q2E A;  4WXH A;  1P4A A;  3U1D A;  5BOX A;  2VBZ A;  3ZMT A;  3IWF A;  1IUY A;  4ESB A;  1FSE A;  1BI0 A;  1FYK A;  2FNA A;  1K6O A;  1JXS A;  4P5O A;  4KYW A;  4XSZ F;  2G7U A;  3MWM A;  1T0F A;  1JGS A;  1JHH A;  1HST A;  1O3S A;  3S2W A;  5DCF A;  3TGN A;  1ZG5 A;  4IXA A;  3LA7 A;  1OMI A;  1REP C;  4HX8 A;  2IA0 A;  1FNN A;  2RC4 A;  4H0E A;  3WOD F;  2F5D A;  4ASN A;  1IXC A;  3VEP A;  1S7O A;  5E1W A;  5BPD A;  2P5L C;  4QLC U;  3BP8 A;  4MEY F;  1ZRE A;  4Q4Z F;  4U0V A;  3COA C;  4Y13 A;  2EK5 A;  3LA3 A;  4YIF A;  3I59 A;  4MQV A;  3U9G A;  3GFI A;  2RKH A;  1RZ4 A;  4BHC A;  4A12 A;  3F23 A;  3BOQ A;  3TO9 A;  1XSX A;  3I53 A;  1ON2 A;  3GWZ A;  1LDJ A;  2O8X A;  3SHF A;  4AD9 A;  5DD8 A;  2M87 A;  1F4K A;  4IRH A;  4PGH A;  3I5U A;  1USS A;  4MGR A;  3EYI A;  1LB2 A;  4CHU A;  2DFI A;  3TOA A;  2KRF A;  3MZH A;  4A5M A;  3I0T A;  1XGM A;  3NQO A;  3F22 A;  2BEO A;  2PBI A;  3Q9V A;  1UFM A;  1WRJ A;  2OD5 A;  4BYY A;  1JE8 A;  3HYI A;  3VOE A;  3KET A;  3Q9S A;  3O2P E;  2F5E A;  2LNB A;  2DK8 A;  1RIO H;  1B9N A;  1TW2 A;  2H94 A;  4KDP A;  3HSR A;  4GYG A;  1AOY A;  1OYI A;  3IWZ A;  3R0A A;  1DPU A;  1IN6 A;  1FZP B;  4EJV A;  2FQ3 A;  2XRN A;  3GEZ A;  4NB5 A;  3PFI A;  1TBX A;  1LVA A;  1Y0U A;  3DP7 A;  4WF2 A;  2ACJ A;  3IHU A;  2K4J A;  3E97 A;  3FWE A;  2CO5 A;  3ZMD A;  4M73 A;  1Z9C A;  1ZRD A;  4F7Z A;  3ISP A;  4HV6 A;  1EH7 A;  4HQM A;  1J75 A;  1YO5 C;  1TW3 A;  3T8R A;  3H3Z A;  2ZFW A;  4LFU A;  4IHT A;  3WTV C;  3B73 A;  4BH9 A;  1BC8 C;  2ISZ A;  5KK1 A;  2QEN A;  1TQP A;  2YX7 A;  1U3E M;  2HOE A;  2UZK A;  4HYE A;  3F8F A;  3HRS A;  3MQ0 A;  1O3Q A;  1MJA A;  2VE9 A;  5JHU A;  5ILU A;  2FRH A;  1O7L A;  5DCM A;  1YQA A;  2QVO A;  2M45 A;  1HW5 A;  1B59 A;  3FXU A;  3QRF F;  5AIQ A;  1XSD A;  4A0Z A;  2ELH A;  1D8J A;  2DO7 A;  1FLI A;  1Z7U A;  2XAQ A;  1PP7 U;  3V7C A;  1QQI A;  1OYW A;  1ZAO A;  2QLZ A;  1OPC A;  4EJO A;  2YX4 A;  2OBP A;  2X4H A;  2KIF A;  1P6R A;  2MC3 A;  3MEX A;  2HDC A;  2A68 F;  1BI3 A;  3EYY A;  1TTY A;  4KIF A;  2VXZ A;  1PDN C;  4LB5 A;  3REO A;  4A2U A;  3F8B A;  1ZGA A;  1E2X A;  2K02 A;  4BHB A;  2WV0 A;  3ZN1 A;  4L0Z B;  3RKY A;  4I0B A;  2GZW A;  1J2X A;  1T39 A;  2ESH A;  3P9C A;  3F8M A;  2G9W A;  3AAF A;  1P92 A;  4RB2 C;  2DW4 A;  1D5V A;  4HQE A;  2HYG D;  5HS9 A;  3J7A O;  2ZBK A;  5D5V B;  2CW0 F;  4L5I A;  1HKT A;  1RNL A;  4UXN A;  3GYH X;  1TNT A;  5FFZ A;  4I2O A;  2CG4 A;  2A3S A;  4RAY A;  4CO8 A;  3KE2 A;  5LHG A;  1P4X A;  1O7F A;  3E5U A;  3NEU A;  2MLG A;  5BMZ A;  2PG4 A;  3KLO A;  2IA1 A;  4I09 A;  2XHK A;  4MHG A;  2V79 A;  3IC7 A;  2C6Y A;  5DV5 A;  1LEB A;  2P5V A;  2OAZ A;  1BBY A;  4O6J A;  1FP2 A;  1UB9 A;  1NHA A;  2CQK A;  2HTS A;  3ELK A;  4L9J A;  2BYV E;  4U7B A;  1P2F A;  3ZMV A;  3BJ6 A;  3VFZ A;  1SD7 A;  2ZCW A;  2QBY A;  2VT2 A;  1BC7 C;  2O0Y A;  3PQK A;  4HX7 A;  5ILV A;  1R22 A;  5KVR A;  1T6S A;  1IRG A;  3CDH A;  1S7A A;  3RPQ A;  2XVC A;  1W5T A;  5BS6 A;  1U2W A;  3KFW X;  2W57 A;  4CYD A;  4O3M A;  3BDD A;  3FMS A;  3KEQ A;  2J5O A;  1ODD A;  1G6N A;  3D5L A;  3JSO A;  5L3D A;  1SMT A;  3RIR A;  2XAH A;  4GCV A;  3C3W A;  1TQI A;  2FBH A;  5LRR A;  4HLX A;  4WX9 A;  5CLS A;  5CVJ A;  4ENN A;  1L0O C;  1G3Y A;  2MD5 A;  2P5K A;  3CUQ B;  1G3W A;  3R4K A;  2BBY A;  1Z05 A;  3CO7 C;  5JR3 A;  2HGC A;  2LSO A;  3SQN A;  4IVN A;  2XRO A;  4G6Q A;  3IKV A;  4LLL A;  4XRF A;  1S8N A;  1XDU A;  1W4M A;  2O61 A;  3RDI A;  2K86 A;  2HFH A;  2BE5 F;  2E7X A;  4KIB A;  4EGY A;  2HS5 A;  1P4W A;  2STW A;  2RV8 A;  1BI2 A;  2RN7 A;  2JT1 A;  5FGM A;  2KIU A;  1MKM A;  1Q1H A;  5E1X A;  2R3S A;  2XAJ A;  3HOS A;  3IL2 A;  4XLN F;  5F6F A;  4U7D A;  3ZMS A;  3IKT A;  1KU3 A;  2O6G E;  4KIG A;  4JK1 X;  5H6Q A;  1FC3 A;  4UVB A;  4RB0 A;  3MAJ A;  3KP2 A;  1ZGJ A;  1K78 A;  1SD5 A;  3E3V A;  1XB4 A;  1ZN2 A;  2AXL A;  4WK8 F;  3HSF A;  2IJL A;  5H6R A;  3KP5 A;  2P7V B;  2O03 A;  2ZME B;  3D0S A;  2PI0 A;  4BHP A;  1U6G A;  4MTE A;  2A6E F;  2FMY A;  2XIG A;  4ZYH A;  3JW4 A;  3GZ5 A;  5A2Q K;  2W84 A;  4R8H A;  2VT3 A;  4U0Y A;  4G7H F;  3V4G A;  1AWC A;  1FP1 D;  1IRF A;  1ZRF A;  2DBB A;  1F1Z A;  1ZYR F;  1TQM A;  2ZNZ A;  2IVM A;  2NYX A;  5FD6 A;  3ROU A;  5K5O A;  1YW7 A;  4OIQ F;  2ZXJ A;  1PUE E;  2M8E A;  4RGS A;  2OA4 A;  2QM3 A;  3WTW C;  1FWZ A;  3L9F A;  3T5X A;  1L3L A;  1U5T B;  3M9A A;  4WWC A;  2OZU A;  2UXX A;  4UV8 A;  3TO6 A;  4LD5 A;  3O3K A;  3KEO A;  4S05 A;  4OOI A;  2V1D A;  3B02 A;  5K5R A;  1YIO A;  4ZH4 F;  5IT3 A;  1FT9 A;  4YII A;  5JVT A;  5L3B A;  2L4A A;  3V7R A;  3WGI A;  1XGS A;  2IPQ X;  3RI4 A;  2XGX A;  4RGR A;  3SXY A;  1B6A A;  2JZY A;  4A0X A;  2PMU A;  3F3X A;  4OMY A;  1QZZ A;  4ESF A;  3FM3 A;  1J5Y A;  5HDG A;  2MA3 A;  3RJP A;  2F5F A;  1WWX A;  4KMF A;  3TOB A;  3GFM A;  4OIN F;  4I98 B;  2FBK A;  2TDX A;  1Z91 A;  4LLN A;  2EV6 A;  3FX3 A;  4BAY A;  5FLX K;  4HDV A;  5HS8 A;  3FXR A;  1K7A A;  4WXC A;  1U78 A;  1ZG1 A;  4ESJ A;  4YG2 F;  1UHW A;  2YR2 A;  3LAJ A;  2D1V A;  2E7W A;  5ICC A;  1SAX A;  2VE8 A;  3ULQ B;  3HSE A;  2EFN A;  1KQ8 A;  5E8G A;  5DUK A;  1YW8 A;  5HLH A;  5D6F A;  4I02 A;  3DF8 A;  1J59 A;  5DEQ A;  2W25 A;  2P4W A;  2GXG A;  1GVJ A;  4M72 A;  2Y75 A;  3LAP A;  3K1M A;  2V1U A;  3QP6 A;  1D8K A;  2OQG A;  5TRD A;  5D4R A;  3JAM Z;  2HYF A;  5DD4 A;  3HRM A;  1DPR A;  3QOP A;  2EFO A;  3GX4 X;  2JRT A;  2E1C A;  2NS0 A;  2QWW A;  2M30 A;  2W24 A;  4PDK A;  1UHM A;  3E6D A;  2FU4 A;  3QAH A;  3E6B A;  1WKM A;  2VC1 A;  1BOA A;  3WG9 A;  1FYM A;  1HSJ A;  2DU9 A;  3EET A;  1IN7 A;  1XDS A;  1YS7 A;  3K9T A;  3BY6 A;  1WSU A;  4LB6 B;  2HKO A;  4I7H A;  2ZJ2 A;  1FPQ A;  5J8F A;  2OQR A;  5ICE A;  5D8K B;  4RB3 C;  2O3F A;  1HW2 A;  4WXD A;  3V7S A;  4LJZ F;  4UVA A;  4A5N A;  4P9F A;  3GO5 A;  2EV0 A;  2LKP A;  4U88 A;  5DUI A;  4E70 A;  2XKO A;  3E5X A;  2GWR A;  2XAS A;  1W7P D;  3N97 A;  3ECH A;  1WI9 A;  3KZZ A;  4NQW A;  4PCQ A;  2W85 A;  1MZB A;  5H20 A;  4HX4 A;  3ZN0 A;  3GW2 A;  3RKX A;  1U5T A;  3FZV A;  1ONV A;  1YG2 A;  4HAM A;  3DV8 A;  1DP7 P;  2CYY A;  4OU0 A;  2A69 F;  3RYR A;  5HVQ C;  5D5U B;  4GGG A;  4ZZL A;  2STT A;  2UWM A;  5D5W B;  2PQ8 A;  2HQR A;  3FHZ A;  3FXQ A;  1R7J A;  3I58 A;  2QQA A;  2NNN A;  4KMU X;  3KCC A;  1STZ A;  3DXJ F;  2J5P A;  1XN7 A;  1BN5 A;  3K69 A;  3QP5 A;  2JTV A;  2YU3 A;  3LA2 A;  5FD5 A;  1J9I A;  2V9V A;  5LGU A;  1BI1 A;  3CUO A;  3WU1 B;  2IA2 A;  3HUG A;  5CJ9 A;  2VN2 A;  4IJA A;  3W6J B;  2IP2 A;  4M9Z A;  3C1D A;  2HWV A;  2HTJ A;  2IT0 A;  3LQR A;  1HBX G;  2G7H A;  3F6O A;  4CXF A;  4HOB A;  3M8E A;  2PN6 A;  1YTY A;  2EA4 A;  1ZRC A;  3ZPL A;  3F21 A;  2FA5 A;  3F8N A;  3WTX C;  5E20 A;  1SD6 A;  4KN4 X;  4M6X A;  2ESN A;  5DDG A;  3ZMU A;  3ECO A;  4BXU A;  1FYL A;  1KA8 A;  2EA2 A;  1R23 A;  2P7C B;  3V8L A;  3P7N A;  1Z6R A;  1GXQ A;  1IN5 A;  1U8R A;  1HKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...