3M1EA

Crystal structure of benm_dbd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the unbound LysR-type transcriptional regulator BenM DNA binding domain
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator benM
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m1eA00
2TDXA 5BPIA 3FM5A 4UVBA 1GXPA 3GFIA 2M5WA 4MQ9F 5ICCA 4U88A 2HR3A 3BPVA 2XKPA 2FXAA 1FSEA 2RGVA 2PBIA 3S2WA 4WCGA 3IHUA 4LD5A 2OAZA 1TTYA 1FP1D 2QLZA 3HRUA 2MD5A 3Q9VA 3ZQ7A 1KQ8A 2VBYA 5HS9A 1KQ0A 3BPXA 2O03A 3ZMSA 1CF7B 1FYMA 3U2RA 2YX4A 2P8TA 4G9YA 4Q4ZF 1JHHA 1FNNA 3WE2A 5D4RA 4I0AA 1U8RA 3WU1B 4CGZA 4ENKA 2DFIA 4M71A 5L3FA 3RJPA 1Z1DA 1P4WA 2W57A 4UNOA 1O3QA 2M45A 2QENA 2HS5A 4AVPA 3MFKA 1W7PB 1ZARA 4A5MA 4ZYHA 2UXNA 3M1EA 4HQMA 2RQPA 2V9VA 1XMAA 2YU3A 3LFKA 4H0EA 1ZG3A 3JSOA 4IPAA 4RS8A 1FYLA 3W6KB 2M87A 2BE5F 3KLNA 4ON0A 1YTYA 3IRQA 5E1WA 1IXSB 1R1UA 3HSEA 4HBLA 3HYIA 3Q5FA 4HLXA 2E7XA 5L3DA 2DPUA 1D3YA 1O7LA 2Y48A 2FBIA 1U5TB 3FZVA 1I1GA 1REPC 1V3FA 2QQ9A 2M8EA 4KN4X 4GYIA 4GGGA 2HOEA 4U0YA 4A5NA 4R1HA 1G3YA 3WU0A 1S7OA 5LRRA 1TNSA 3R0AA 2BV6A 3I59A 5JFRA 1RIOH 4EVIA 2RNJA 5K5OA 4K2EA 2O6GE 3F8MA 4G7OF 4ASNA 3KP5A 5D5WB 4HX8A 6PAXA 3J7AO 1TW2A 1XSDA 2EJRA 2Q8KA 5D8KB 2X4HA 3U9GA 1Y0UA 4HF1A 3ISPA 1B9NA 3ROUA 2Y0MA 3E5QA 1U6GA 5F1RA 2F5FA 3ULQB 4L0ZB 2IA2A 3TDZC 3M7GA 2RDPA 3F6OA 4A0XA 3KEOA 1B9MA 2A6EF 1KGSA 1ZRDA 1TBXA 2DK8A 1TLHB 2GIVA 3T8RA 1IW7F 4FX0A 1IAWA 2JRTA 1YG2A 3E6MA 2XAJA 4RAYA 3ZMTA 3J80K 1XGOA 4LFUA 4EM1A 2D45A 4KFCA 3QP5A 1WRJA 3GZ5A 1MJAA 4Y13A 4UUVA 2VC0A 3EYYA 3ZN0A 4PDKA 2L02A 3V7RA 3ECHA 5FGMA 4BYYA 3GYHX 3I71A 3GO5A 4S04A 4CICA 2H94A 5K1YA 2YX7A 2LDUA 1XCBA 2NNYA 4BHPA 4I01A 1BI0A 2EK5A 2QWWA 1P6RA 1I1SA 5CYVA 1SAXA 3CTAA 2MLKA 3E5UA 4I2OA 2ETHA 5H6RA 3RYPA 2V79A 4N0BA 3QOPA 5J6XA 4ZYGA 1ULYA 4KIBA 2HDCA 3VB2A 2VT2A 1G4DA 2FRHA 4O5VA 5FD5A 2DAOA 1D5VA 2DO7A 1KYZA 3MZHA 3REOA 1QPMA 4JBAA 2IA1A 4RB1A 1W5SA 2A68F 3F8BA 4R79A 4R8HA 2PN6A 1DP7P 4A0ZA 3F22A 1TQMA 3N97A 5AIPA 4HF2A 3ZMVA 2OU2A 1F5TA 1XSXA 2IA0A 2HKOA 1U3EM 1SFEA 1F4KA 1X3UA 5E8IA 3MAJA 1W5TA 2MH2A 4IRHA 3RIRA 3ERED 2VOPA 2FU4A 1B1BA 1W4MA 3HOTA 1U78A 3F21A 2EFWA 4CXFA 4CYDA 3RTRA 4IF4A 2HYFA 5DYMA 2DQLA 3DF8A 5LHHA 2W24A 1SMYF 1G3SA 1KU2A 2KIUA 3IL2A 2ZNYA 1UHMA 4WF2A 1F9NA 3FX3A 2JT1A 3C1DA 2CQKA 3DEUA 2FSWA 4HW0A 5H6QA 4KT5C 2QBYA 1IN6A 1IRGA 3W6JB 5FLXK 3EETA 3B02A 4IXAA 1B59A 2XUBA 3HRSA 2G9WA 5ILSA 3I0TA 5IT9K 1U5TC 1I27A 5HDKA 4LK1F 3K2ZA 3GFMA 4M6XA 3JSPA 2JTVA 4L9VA 2PLYA 3O6BB 1HSJA 1J5YA 3P7NA 5K5RA 2KIFA 5E1XA 3TKYA 5LEKA 3DQVC 4IVNA 2UWMA 4WK8F 1WQ2A 2PFBA 4BHCA 4NHJA 3BJOA 2L54A 3GFJA 2FOKA 1D8KA 4G6DA 1GXQA 5HLHA 1YS7A 4MQVA 4A6EA 2XIGA 1WI9A 2GA2A 3TO9A 4I7HA 1XMKA 4B09A 1HW5A 2PG4A 2PI0A 1LDDA 2IW5A 3P9KA 2NS0A 3O3KA 2CW0F 4AIHA 1FYKA 5D6EA 1XGMA 1ON2A 2HZTA 3DP7A 3VEPA 5CVJA 1IXCA 4FT8A 4UXNA 1W7PD 5D5VB 1JXSA 4UVCA 2XAFA 1EH8A 2VONA 3F23A 3CLOA 2R3SA 4MHGA 2DK5A 3C18A 2EA4A 2JPCA 3V4GA 4HZFA 1DDNA 4MGRA 3CO6C 4KA4A 2EFOA 4XLNF 1ZHFA 4HV5A 4HX7A 1KU9A 5D6FA 3I5UA 2DTRA 2Z33A 3TO6A 1SMTA 4P96A 1KA8A 2E7WA 3JW4A 3C3WA 4Z2YA 5FB2A 1L3LA 1GVJA 3R60A 3D5LA 4G7ZF 1R36A 2H6BA 3IKVA 3MEXA 1BI2A 4LLNA 1LVAA 3QRFF 3BDDA 4HV6A 4CHUA 1IN4A 1H9TA 2Z99A 1HSTA 2FMYA 2XAHA 2K27A 2KRFA 2KJCA 1FX7A 3I64A 2RKHA 3CO7C 3COAC 3FXUA 4HX4A 1LB2A 5FLXZ 1R23A 1ZGJA 2MH9A 2JZYA 3WTTC 2W84A 3I4PA 3O2PE 1TQPA 2OQRA 2PMUA 5E20A 3T0YA 3ML6A 4M73A 2COMA 3E6BA 2AXLA 3E6DA 5DCMA 2VBXA 3H92A 3FWEA 5HDNA 2LNBA 1JGSA 2IJLA 1C0WA 4L9TA 3BZ6A 2WTEA 1ZGAA 4IJAA 2VN2A 4XSZF 1IN8A 1OYIA 3SQNA 3NQOA 4YFKF 3T8TA 5ICFA 1SD6A 5CVUA 2A07F 3QU3A 3Q9SA 3L00A 1G6NA 4EGYA 5JR3A 4BQAA 1PUEE 2QM3A 5LLQA 3V8LA 4UHTA 1J0RA 1O57A 1BIBA 2OZ6A 1T6SA 2DI3A 2LF7A 3J81Z 4OMZA 1HQCA 4DNCA 1QQIA 1S3JA 2M1BA 3KE2A 4EM0B 4U0WA 4YG2F 1XD7A 4HOBA 1K78B 3RDIA 3NEUA 2D1VA 2MA3A 3MQ0A 1UCRA 2GAUA 2O3FA 1BI1A 3GWZA 2GXBA 4I0BA 5IT9Z 1MGTA 1YLFA 1ZG1A 1DPUA 4RGXA 3D0SA 4S05A 1BC7C 3T5XA 3F6VA 2H09A 5TJJA 2X0LA 1QZYA 5K5QA 3GZ6A 1FBQA 2NNNA 2HGCA 1MDMB 3T1BA 2A6HF 2J5OA 4E70A 1MD0A 2ZKZA 3GUDA 1FY7A 3TOAA 4EJTA 4RB3C 5LHGA 2HKXA 5LEJA 3KZYA 3SZPA 4P9FA 4LB6B 4LMYA 1TQIA 4I09A 3MZYA 5KVRA 1YYVA 2EV6A 4CZZA 3F8FA 3HSFA 4TV7A 3LQRA 3KP6A 4OINF 3P9CA 2VXZA 1BC8C 3WTWC 4EJWA 4QWQA 5HVQC 2YPRA 2VE9A 2ZFWA 4L0YB 4L5JA 4A0YA 4M9ZA 1R1TA 1L0OC 4N9HA 4ZH4F 2D1HA 3WGHA 2J5PA 2QZ8A 1QO0D 5DCMB 5D4SA 3WTZA 5ERIA 2ESNA 2YR2A 1MJ9A 2K4BA 2PQ8A 2FNAA 3VODA 1RZ4A 1NHAA 1HBXG 5EEGA 1T39A 2IP2A 3BWGA 2CSOA 2FEZA 5JI6A 1FZPB 2WC2A 2PEXA 3ZP5A 3HHGA 1Z91A 3EQLF 4RB0A 3PQJA 2VC1A 3FXQA 4NQWA 3P9IA 5LRSA 3BY6A 2EV5A 3HRMA 1ONVA 1ODDA 5DV5A 5AIQA 4EJVA 4IRIA 3TOBA 3FMSA 3SZTA 2ACJA 1ON1A 3V7SA 4KYWA 3KP2A 4YFXF 1IZ1A 3L7WA 1XCVA 3GFLA 1G3WA 5HLGA 2NAZA 1TW3A 1HXDA 4BH9A 1HKSA 4KDPA 1BM9A 2H27A 4L5IA 1J9IA 1ZG5A 2QQBA 3MWMA 3TO7A 1OR7A 2OQGA 2MC3A 3PFIA 1W7PA 1OYWA 4PGGA 2RV8A 5L3EA 1P4AA 4BXUA 4MEXF 3R0JA 1RNLA 2Z5UA 1KQ9A 3V8JA 3RKWA 4FX4A 4HYEA 4HQEA 2JPBA 1LEBA 1OMIA 4OIOF 1UFMA 3ZMZA 3BOQA 1O3SA 4EMSA 2R7DA 1BJAA 3JTHA 5J8FA 1S6LA 4RGUA 3KZZA 3HOSA 1MZBA 4L18B 5D5XB 1FBUA 2QQAA 2PJPA 2HTSA 1G3TA 1AWCA 4AIKA 3RPUA 1STZA 2XROA 2ZMEA 2F5EA 4HDVA 1B6AA 5ICGA 3J81K 1SD4A 4XRFA 4AIJA 3HHHA 1FWZA 1T2KA 2FF4A 3IRRA 1FP2A 2LKPA 2ADUA 1R5HA 5E18F 4YFNF 2IVMA 4XBFA 5E17F 4KIFA 3MCZA 3KEQA 2H6CA 4BHBA 3HIFA 2A5YB 4ETSA 4Q5SF 2STWA 5BQTA 3G73A 3WG9A 4HA8A 4PZJA 3WTYC 5BPDA 1T38A 4N9IA 5LGUA 2GWRA 2W85A 2V1XA 4P5OA 1WSUA 5LGNA 1KU3A 1EH6A 3RYRA 1LDJA 2AS5F 1T0FA 4L9NA 3L2CA 2ZXJA 4EGZA 4G94A 1DPRA 4BNCA 3JAMZ 3GEZA 1MJBA 3K0LA 2A69F 1RI7A 1AOYA 3F8NA 3FHZA 4ZZLA 4RAZA 4IHTA 1SFUA 2GQQA 1U2WA 2P7CB 3CDHA 1V4RA 2VBWA 3HTSB 1SD5A 1USSA 2RVCA 2L4MA 4BAYA 1R58A 4A2UA 4OU0A 4I98B 3BJ6A 3E97A 4AWXB 2FE3A 2G7HA 2EFPA 1YQAA 1E17A 3DFGA 3E5XA 1RUNA 1R22A 2OBPA 3DPTA 3VFZA 4JQFA 1D8JA 3I59B 5LGTA 1Z05A 2P5LC 4EJOA 2HYGD 2FMLA 2QBYB 1ZRCA 2BBYA 5FD6A 1QZZA 3CUQB 1BN5A 5F64A 5FO5A 2OD5A 3ZN1A 2UZKA 1XGNA 3R61A 2P4WA 1UB9A 4LLLA 1H9GA 1KU7A 3HRTA 2Q0OA 1VTNC 2CFXA 4ESBA 2IPQX 2EV0A 3FMRA 2GXGA 3FMQA 4M9SA 4LG0A 3I53A 4KMUX 4G8XA 2DT5A 2Q2EA 1A04A 1FOKA 4GYGA 4B8XA 2R7FA 1K7AA 3WE3A 4ZYEA 1FC3A 4HAMA 4EV0A 5DDGA 2RN7A 1MKMA 4GCVA 3V7CA 2XAQA 2A61A 3WTSC 4HLYA 2K02A 4YIFA 5LHIA 1H0MA 5EEHA 3WGIA 3KP4A 2GZWA 2ZNZA 1PDNC 3CUOA 3SXYA 4D0PA 4O6JA 2F2EA 1QBJA 1YW8A 1ZYRF 4OIRF 1LEAA 1USTA 2C6YA 4Y17A 3NRVA 2YSRA 1XN7A 2O0YA 3TQNA 5H20A 1KYWA 5DCFA 2XVCA 3K1MA 4A12A 4XLPF 3E3VA 3H3UA 1YS6A 5JVTA 1F1ZA 5J8CA 1EV7A 3RKXA 4LGWA 2IRFG 3KP3A 2ISZA 3CUQA 2A3SA 3C7JA 2DW4A 4CDGA 3WTVC 2L4AA 3EYIA 2O61A 1LQ1A 2Z3YA 1JE8A 2BYVE 3ZMUA 2L01A 1CF7A 5FFZA 5AONA 1OKRA 3B73A 1MDMA 3TDUC 3F8CA 4G7HF 2ZMEB 2HQRA 2ISYA 5HDGA 3SFZA 1BBYA 5L3BA 1IN7A 2LF8A 3FM3A 3K1NA 1EH7A 3WGGA 1HW1A 4M74A 2VT3A 1I5ZA 5L3GA 2STTA 2NYXA 3OV8A 3HUGA 1PP8F 4L9JA 4ENJA 5CVVA 3GF2A 4OIPF 3GW2A 2G7UA 3K69A 2DPDA 1XDUA 2LSOA 5HLIA 2QUFA 2ZCWA 1QNTA 3N4MA 4UV8A 1JHFA 4ESJA 2L3DA 3QPHA 1Z7UA 3ZPLA 3ABTA 1O3RA 1J7KA 3LA7A 2VOOA 2ZO4A 4KMFA 1FLIA 1SFXA 4ZZDA 3RI4A 1J75A 4MNUA 4P55A 2BGCA 3ZMDA 5HS7A 5BS6A 5CLSA 4P9UA 3AAFA 3IKTA 3GXOA 3KCCA 3DV8A 5ILVA 2P5KA 1S7AA 2ELHA 1S29A 1UHWA 2NRAC 2OZUA 4KUMA 3GLXA 2HQNA 2HWVA 4EJUA 5CVIA 2HFHA 1RUOA 3M8EA 1P4XA 3WTUC 1ZAOA 2WWYA 3DXJF 2VODA 1Q1HA 2GA1A 2XAGA 2EB7A 1HW2A 4HDUA 2MBFA 1XSVA 1R5GA 2XASA 1GHCA 1Z9CA 2W25A 3QU6A 1XGSA 3WTXC 3BROA 2P5VA 5DD4A 3CJNA 1K79A 3L9FA 1WWXA 1Z6RA 2CYYA 4FHTA 5FFXA 2F5DA 2MLGA 5ED4A 3IWZA 1BOAA 2P6TA 4YIIA 2M30A 2HEOA 1FT9A 2OA4A 5L3CA 2O8XA 3BP8A 2E1CA 3JTGA 3KFWX 4M72A 4GO1A 3LWFA 3GX4X 5F6FA 1OPCA 3F72A 4OMYA 3G3ZA 2EFNA 1J59A 1BIAA 2EA2A 5JHUA 3HSRA 5LBQA 3M9AA 4KN7X 1Z6TA 3KETA 4I02A 5E8GA 4ENMA 3LQQA 2CO5A 2V6CA 1XDSA 3DKWA 5BOXA 2F5CA 1ZN2A 1R00A 5A2QZ 1IUYA 2CG4A 4MTDA 5CJ9A 4G6QA 3LA3A 4M9XA 2EFQA 1LJ9A 2K86A 3I58A 4UV9A 1CGPA 3FF5A 4KICA 4A6DA 2B0LA 3IC7A 3BJAA 4QLCU 1PP7U 3E6CC 2KIMA 1ZLJA 3FXRA 3LSTA 2P7VB 5BMZA 3ABUA 4WWCA 4OIQF 3R6SA 2FNPA 4WXCA 1P92A 4LB5A 3SHFA 4LK0F 2IT0A 2FBHA 4KIGA 4LLGF 5CVRA 4MTEA 5HOOA 4KNYA 1FBSA 1I6XA 4ENNA 1ZREA 2V1UA 3U1DA 3TGNA 3VOEA 2FA5A 3M8FA 1K78A 4M6YA 1HKQA 1IF1A 4NB5A 1FPQA 5KK1A 3IWFA 1ZLKA 4MEYF 2K4JA 2JSCA 1HKTA 4CO8A 1SD7A 2Y75A 4IHSA 4LG0B 1LNWA 4DQ2A 2DBBA 4HF0A 4WX9A 5A2QK 3CUQC 5ILUA 2KKOA 1R1VA 4ZYDA 2RC4A 2K7LA 2V1DA 4PGHA 1O7FA 1OYYA 3ELKA 1J2XA 5DUKA 2CWEA 4WXHA 4WXDA 1U5TA 2DU9A 5E1ZB 3OOPA 2UXXA 1E2XA 1ZRFA 2QYOA 2XV4S 2ZBKA 4Q48A 2XRNA 5TRDA 3PQKA 2E1NA 2VBZA 2EWNA 4OOIA 1K6OA 1QGPA 3HTUA 3RPQA 5D8LB 4IRGA 2FBKA 1TNTA 1YW9A 3QPTA 1O3TA 1WKMA 1XB4A 1YO5C 5IT3A 4RB2C 4AD9A 2ESHA 3LAPA 1P2FA 4RGRA 2XHKA 2BEOA 2DQRA 1S8NA 3R4KA 3F3XA 1YFHA 3J80Z 3EUHA 2P6SA 1IXRC 2FQ3A 1YIOA 5ICEA 1BI3A 1R7JA 4UVAA 5HS8A 3I54A 3QP6A 1T98A 3L09A 4Q47A 3GVAA 3LAJA 1IRFA 3H3ZA 2PMHA 4ESFA 4RGSA 2XKOA 3DPLC 1DUXC 3JAMK 1B4AA 2QVOA 4EQQA 3KP7A 3RKYA 4O3MA 3ECOA 3EDPA 4F7ZA 5D5UB 4U7DA 4XSXF 1IN5A 5DEQA 2HTJA 2DLLA 4JK1X 3QAHA 1LDKB 1ZH5A 3WODF 1YW7A 2Z9OA 2ZJ2A 4GXOA 3V8KA 2WV0A 4LJZF 4EM2A 3LA2A 3K9TA 1FSHA 4U7BA 4PCQA 2D2WA 2XGXA 3K1PA 2CGPA 2KJBA 4Y15A 5DD8A 2VE8A 4U0VA 5DUIA 3KLOA
chains in the Genus database with same CATH superfamily
2TDXA 5BPIA 3FM5A 4UVBA 1GXPA 3GFIA 2M5WA 5GADJ 4MQ9F 5ICCA 4U88A 2HR3A 3BPVA 2W00A 1PYVA 1DGRM 2XKPA 3OSFA 2FXAA 1FEXA 3P5JA 2DYSH 3OYHA 1FSEA 1SVLA 2RGVA 2PBIA 3S2WA 4WCGA 3IHUA 3QYBA 4LD5A 3CCSI 4DOZA 2QEXI 2OAZA 5B1BH 1TTYA 2OTLI 2HQAA 1FP1D 2ZSIB 2QLZA 3HRUA 1ZR4A 2WAFA 1YRNA 3FBNB 2BXZA 1X1PA 2VQCA 2MD5A 3KX2A 3Q9VA 4HRIA 3ZQ7A 2EINH 2ECCA 1KQ8A 2VBYA 1MNEA 5HS9A 1KQ0A 3BPXA 2O03A 3ZMSA 1WJFA 1CF7B 4UY8I 2LBFA 1DU0A 1FYMA 3U2RA 1MSFC 2GLOA 2JQ7A 2X6YA 2YX4A 3H9QA 2DYRH 2P8TA 3LSJA 3CCLI 4G9YA 3CJTB 2FQ4A 3TP3A 4F92B 1JHHA 4Q4ZF 1JKRC 1G8XA 1FNNA 3WE2A 5D4RA 2EIKH 3TL4X 4I0AA 1U8RA 1F36A 3C2GA 5KAIC 3WU1B 4CGZA 4ENKA 1PUFA 4D5FA 2O7OA 1DU6A 4HNTA 3OYMA 2DFIA 2R92J 4M71A 4BXXJ 5L3FA 2WB1A 2ELKA 3RJPA 1Z1DA 1P4WA 2W57A 4UNOA 3TW6A 1MNDA 1O3QA 2KT0A 2M45A 2F48A 3HPHA 3HEFA 1SEUA 2QENA 4F52A 1XPXA 2NVYJ 2Y0SN 2HS5A 1FOWA 4AVPA 3J7YJ 4CCKA 3MFKA 3BR1A 1P9QC 1W7PB 1ZARA 4A5MA 4ZYHA 3BLYA 5J4VA 2UXNA 3SJMA 2DCEA 1EA3A 3M1EA 4PJLA 3A2KA 2K9SA 1VQ8I 4HQMA 4ZTJA 2AXTC 2RQPA 2V9VA 1XMAA 2YU3A 2VQGA 2V9KA 3LFKA 2PMZA 4H0EA 1YX5A 1ZG3A 3JSOA 4A3EJ 4IPAA 1I6HJ 4Y52J 4RS8A 1FYLA 1JUSA 3H36A 3W6KB 2M87A 2BE5F 4A3MJ 4XNFA 3KLNA 2MD0A 4X1EA 4ON0A 1YTYA 3IRQA 5E1WA 3RCOA 1IXSB 1R1UA 3HSEA 2BY0A 4HBLA 3HYIA 4UUTA 3Q5FA 2JUGA 2E7XA 4HLXA 5EG0B 5M5YJ 5L3DA 4D1QA 2DPUA 1D3YA 1O7LA 3I3LA 2Y48A 5M3MJ 2FBIA 1U5TB 3FZVA 3FBIB 3G71I 2EZLA 1I1GA 2V26A 3BR6A 3K4CA 2HVQA 3MVPA 1REPC 1IRZA 4A3DJ 1V3FA 2QQ9A 2M8EA 4KN4X 4GYIA 4GGGA 4C3IJ 1RRJA 4I6ZA 1T8IA 2HOEA 2IGNA 2PX9A 4U0YA 1HOMA 2DFEA 2MC4A 3E7LA 4DW6A 4A5NA 4R1HA 1G3YA 3GTGJ 1U9OA 3PIPF 2GOMA 5FROA 2IS2A 1I3QJ 3ESWB 3WU0A 1PUFB 1S7OA 3ZRGA 5LRRA 1TNSA 3R0AA 1LVKA 1YIJI 2BV6A 1D1BA 3I59A 5CQGA 5JFRA 2L5QA 3OL3A 1RIOH 2QKLB 4EVIA 2RNJA 5K5OA 4K2EA 2O6GE 3F8MA 4G7OF 4ASNA 3KP5A 5D5WB 4HX8A 3OSGA 2JVGA 1TW2A 6PAXA 3J7AO 1VFCA 2UV1A 4B3AA 2ME0A 2MFZA 4BQNA 2R7UA 4YRVA 1XSDA 2EJRA 2Q8KA 1HLVA 5D8KB 4RAGA 1YJNI 2AQEA 2X4HA 2L7ZA 3U9GA 3O8HA 1Y0UA 3MKLA 3Q0WA 5GAHJ 4HF1A 2X85A 3ISPA 1B9NA 3ROUA 2Y0MA 5DM7F 1U8BA 3QODA 2JMWA 2EPFA 2CUZA 1ZGWA 1UMQA 3E5QA 1QZEA 3PNYA 4RLQA 1U6GA 4B1RA 5J4YA 5EF6A 5F1RA 4KT6A 4XIDA 2F5FA 3ULQB 3JRFA 4L0ZB 2IA2A 3IAS2 3TDZC 5J47A 3BTJA 3M7GA 3V42A 2E2IJ 4B47A 2RDPA 3F6OA 4A0XA 1ITYA 2R7WA 2DA4A 3KEOA 3H9JA 5EJCA 1B9MA 2ME6A 2DA7A 2A6EF 1KGSA 1H88C 1ZRDA 1TBXA 2DK8A 1UJ8A 3BR2A 1TLHB 1WJEA 2GIVA 3T8RA 1IW7F 2QKMB 3FKIJ 4FX0A 1X1AA 5EG0A 2JRTA 1YG2A 1IAWA 3E6MA 3UR3C 2XAJA 4RAYA 3ZMTA 5GP9A 4UUSA 3J80K 5KAFC 1XGOA 2ZMEC 4LFUA 4EM1A 2D45A 5GPAA 4KFCA 1NK2P 3QP5A 1WRJA 3FDYA 3CQZJ 1WPKA 1Y1WJ 3BQZA 2DDBA 3GZ5A 5LFAA 1MJAA 4Y13A 1R49A 2VC0A 4UUVA 2W82A 3EYYA 3ZN0A 3G1LA 4NUBA 1A36A 4PDKA 3L2UA 3LMMA 2GIZA 4X0GA 2L02A 3V7RA 3ECHA 3IH2A 5FGMA 2M7AA 2DA2A 4RLFA 4BYYA 3GYHX 3A01A 3I71A 3GO5A 3GTJJ 2HXIA 2M4KA 4S04A 4CICA 2H94A 2ZXWH 1GV5A 2KIQA 4FETA 4XN3A 5K1YA 2YX7A 1NTCA 3EUHC 1WJ5A 2LDUA 1XCBA 4FTHA 4QTRA 4BHPA 2NNYA 4I01A 2E1OA 4XLFA 1BI0A 1SC7A 2EK5A 1MBJA 3BTIA 1IDYA 1YJWI 3S8PA 1WJDA 2QWWA 1P6RA 2K85A 1I1SA 1LPQA 5CYVA 1SAXA 3CTAA 2M0CA 3BC8A 2MLKA 3E5UA 4I2OA 2BY2A 2ETHA 5H6RA 1W36C 2OUMA 3RYPA 3HOWJ 2V79A 1X3ZB 4N0BA 3QOPA 5EYRA 4A69C 1X3WB 4CUGA 1A5JA 2KZVA 2XF7A 4IOCF 3ZQLA 5J6XA 4ZYGA 1S5LC 1ULYA 1QHGA 4GFBA 4KIBA 4PJMA 4C2TA 2MSYA 4JYKA 1OCCH 1IDZA 2HDCA 2XPWA 3HOUJ 3VB2A 1BJZA 2VT2A 3PIOF 4OAYA 3S3NA 5FKKA 1G4DA 2FRHA 2RQQA 1TWCJ 2IS6A 4O5VA 5FD5A 2DAOA 1D5VA 2DO7A 4NC6A 2HNHA 1KYZA 2W4SA 1IG7A 2XDVA 5E3OA 3MZHA 3REOA 3HBLA 4XOTA 1QPMA 2Z1DA 1HF0A 4XMYA 2X6OA 4JBAA 3LSIA 3ZQIA 2IA1A 3WHCA 4RB1A 1W5SA 2A68F 1W5CC 3K10A 3HXLA 3RQ4A 3F8BA 3QPSA 4R79A 4R8HA 1XTAA 2PN6A 1DP7P 4A0ZA 2ICWG 2WB1N 3F22A 1TQMA 5EZHA 4OAZA 4IL6C 5AIPA 3N97A 4HF2A 1MH3A 3ZMVA 2OU2A 1F5TA 4MLOA 4BE0A 1MMSA 1UAAA 4BL0B 1XSXA 4FISA 2IA0A 2HKOA 1U3EM 3DPUA 1SFEA 4BQQA 1X3UA 5E8IA 1F4KA 1HDPA 4N4NB 4PJ0C 2AHQA 2VKDA 3FXLA 3L2VA 4XLCA 3MAJA 3HL2A 1ETWA 1W5TA 2HXOA 2MH2A 2VB6A 4IRHA 3RIRA 4B48A 3ERED 2L9NA 2VOPA 2K9QA 2FU4A 1B1BA 1VF9A 2VKHA 2OCEA 2VJIA 1W4MA 4IHYA 3HOTA 3K70C 2NOJB 1TL8A 2GM4A 3AL0B 1F43A 1X1CA 1U78A 3F21A 1NG7A 2EFWA 4CXFA 5K7HA 1ZK8A 4CYDA 3RTRA 4IF4A 4MIMA 2HYFA 2MABA 5DYMA 4RA2A 2DQLA 2E1MC 3DF8A 5LHHA 1VQOI 2W24A 1SMYF 2CW8A 5CPRB 1G3SA 4XL9A 2CW7A 1KU2A 2KIUA 3IL2A 2DXIA 2ZNYA 5GAEJ 4Y7NJ 4BEHB 2XC7A 5KNLA 1EJ9A 1UHMA 3E0JB 4WF2A 3FX3A 1F9NA 2LY1A 3C1DA 2JT1A 2CQKA 2F4MB 3LSPA 3JRDA 1MW7A 1T08B 4RM2A 3KYLA 1JUPA 3ONQA 3D1NI 3DEUA 4PSXA 2FSWA 1YJ9I 4HW0A 5H6QA 3TEDA 4KT5C 2QBYA 2JA2A 2VPRA 1GLNA 2AO9A 3G4SI 1IN6A 1JKQC 3DBHB 1IRGA 3W6JB 3BZCA 1VQMI 1LKXA 2DJNA 2K3PA 2L2OA 2LP0A 5FLXK 3EETA 2CV0A 2AQFA 3OL4A 3B02A 1DGWY 1MBFA 4IXAA 1B59A 4D7MA 2XUBA 2CQNA 3HRSA 1VQ9I 2G9WA 5ILSA 3I0TA 3JRAA 4IO9F 3ZGKA 3LFUA 2ZB9A 5IT9K 4PFPA 1D0ZA 1U5TC 1J09A 1ETVA 2NS7A 1I27A 3PUBA 3W3CA 5HDKA 4LK1F 3OYNA 2X51A 3K2ZA 3OIPA 3GFMA 2OPTA 4M6XA 1ZQ3P 2R5ZB 4M3FA 3JSPA 4RBOA 3HGGA 2CRGA 4IEJA 2Q2EB 2Q1ZB 2JTVA 4L9VA 2PLYA 3O6BB 1HSJA 1J5YA 4E6KG 3F9KA 3P7NA 5K5RA 3PUFA 3HUGB 2KIFA 4RMNA 5E1XA 3TKYA 5LEKA 3DQVC 2LG4A 4IVNA 2UWMA 3NWTA 4BDYA 4WK8F 1WQ2A 1AA7A 2JSPA 2PFBA 4BHCA 4NHJA 3ABLH 3BJOA 1WHUA 5BNGA 2OV7A 2L54A 1V5FA 3GFJA 2FOKA 3UNGC 5CKTA 1D8KA 4G6DA 2M8GX 1GT0C 1GXQA 5HLHA 1YS7A 5HODA 4MQVA 4A6EA 2XIGA 1W0TA 1WI9A 2GA2A 1JTYA 4F3QA 3TO9A 4J00A 1YHQI 1QVUA 4I7HA 5EDNA 1XMKA 2I10A 4B09A 1D0XA 1HW5A 2PG4A 2PI0A 1LDDA 2IW5A 3IV5A 3P9KA 4AVZA 1VQKI 2HDWA 1BR2A 2NS0A 3O3KA 3S16J 1U9NA 2CW0F 4IQ4A 3TP0A 3GTLJ 3E1SA 4AIHA 1Y56A 1FYKA 5D6EA 1XGMA 1ON2A 2HZTA 3DP7A 3H5NA 4OWRB 3SYTA 2H1LA 3VEPA 3VSKA 3DU5A 1WFXA 5CVJA 1IXCA 5FLVA 5B3SH 3J7ZI 4CA0A 4E7JA 3I4NJ 2IGOA 4FT8A 3PSFA 4UXNA 4CZCA 4PFOA 1W7PD 3KYCB 1T0FC 5D5VB 1JXSA 1VQPI 4XONA 4UVCA 2BHYA 2XAFA 3IH3A 1EH8A 2VONA 3F23A 4F93B 4AIDA 3CLOA 5GTIC 5EEAA 1Z21A 2R3SA 4MHGA 2MYSA 2DK5A 2D5VA 4XLHA 3L1PA 3C18A 2DDAA 2EA4A 2BY1A 3G2BA 4IHWA 2EIJH 4NQWB 4A3JJ 4BQOA 2XGEA 3CC2I 3MZ8A 4H4KC 2JJ7A 2JPCA 4NC7A 3U21A 3V4GA 4HZFA 1DDNA 2PJRA 2XGDA 2X6WA 4MGRA 3ZQFA 3CO6C 4KA4A 2EFOA 4XLNF 4BY1J 4IHXA 1Z67A 5JLXA 1E3OC 1ZHFA 3IP4B 4HV5A 4II3A 5F27A 3SZGA 4HX7A 1JGGA 4I99C 3ZQQA 1KU9A 2JA8J 2QF7A 2CS3A 5D6FA 3I5UA 2DTRA 2Z33A 1HC8A 3TO6A 5J40A 1SMTA 5JVGF 1KONA 2HYJA 4P96A 1FTZA 1RKTA 3NWSA 4JX4A 3CMAI 4XRSG 1KA8A 3GTOJ 2LVSA 2E7WA 2W1OA 5EGOA 2UUZA 3WU2C 5LD2C 3JW4A 2OJED 4ZYAA 1ZELA 3C3WA 4Z2YA 5C4XJ 5FB2A 2VQHA 3Q3SA 3LOCA 1L3LA 1GVJA 3R60A 3D5LA 2X1DA 3QYEA 4HNVA 4G7ZF 1R36A 3S17J 2H6BA 3IKVA 1T95A 3MEXA 1BI2A 4CCJA 3OS2A 4LLNA 1LVAA 4XM3A 3BDDA 4FE7A 4HV6A 3TW7A 5GAGJ 3QRFF 4CHUA 1IN4A 1X1DA 3K4MA 1H9TA 2JVHA 2Z99A 1Z0XA 1HSTA 3KYDB 2FMYA 2VLAA 2XAHA 2K27A 2KRFA 3OYKA 5E3MA 1TP4A 2KJCA 1FX7A 3I64A 2RKHA 3CO7C 3COAC 1RR7A 3FXUA 4HX4A 1LB2A 1XC5A 1R23A 4Y3OA 1UELB 1ZGJA 5FLXZ 3CCMI 5E3NA 2MH9A 2JZYA 2ZFUA 3WTTC 2A6TA 1FMVA 1GUUA 2W84A 3MMYB 3QQAA 3I4PA 3O2PE 1LE8A 2E1MB 4IQJA 1TQPA 2OQRA 2PMUA 5H2FC 5E20A 3T0YA 3HOYJ 3ML6A 1FIPA 4M73A 2LC2A 3AG2H 3HC7A 2BY3A 2Y69H 2ZJRF 4ZDPA 1XS9A 2COMA 3E6BA 1BW6A 2AXLA 1WJBA 3E6DA 5DCMA 2BHZA 2VBXA 3H92A 2TCTA 3FXMA 3FWEA 3S2DJ 2HPIA 1YOVB 2FD5A 2HVSA 5HDNA 2LNBA 3BCBA 2ZC2A 3K4NA 1JGSA 4I76A 4LOCA 2IJLA 4D5CA 1C0WA 4L9TA 3BZ6A 2VJ4A 4KITB 2WTEA 1ZGAA 4IJAA 4IX7A 2VN2A 4XSZF 4NC8A 3DBLB 3CCEI 3CCYA 1IN8A 3JRGA 1OYIA 3CC4I 1H8AC 1WCMJ 3SQNA 2XB0X 1YE9A 3NQOA 1TWFJ 4YFKF 5EGOB 4A93J 1K61A 2HOAA 4E7SA 1W1WE 5ICFA 3T8TA 1SD6A 1OCZH 4V2FA 3ABMH 2OCCH 5CVUA 2A07F 4HG2A 3QU3A 3Q9SA 3CDLA 3L00A 1G6NA 1NH3A 1MSEC 4KISA 4EGYA 4A3FJ 3GTKJ 5JR3A 4BQAA 2LH9A 1PUEE 2QM3A 5LLQA 4BJ6C 2Y30A 3K4BA 3B6AA 1BR4A 3BG6A 2LOOA 1Y8RB 3MKYB 4A3GJ 3V8LA 1A35A 4UHTA 1J0RA 3LL7A 5TGTA 2KPMA 3M4OJ 1O57A 1BIBA 2OZ6A 1T6SA 2DI3A 2LF7A 1GDTA 4CSWA 2DT6A 3J81Z 4DBRA 1KZHA 2CUJA 4OMZA 1R4MB 1HQCA 2LREA 4DNCA 2R0QC 1QQIA 4YIRX 3ZR8X 1S3JA 2M1BA 2XGCA 2DTZA 4D7NA 4IHVA 3KE2A 4EM0B 2LR8A 3H9GA 2XF5A 4U0WA 1XD7A 4YG2F 4HOBA 1G59A 1K78B 3RDIA 2X48A 4BJ5C 2CV1A 3CP2A 3NEUA 3HKZA 4V2GA 2D1VA 3AFHA 2MA3A 3MQ0A 1BOBA 1ERDA 1SAUA 1UCRA 3K6GA 3DLLF 2VUMJ 2HI3A 3TBIA 2GAUA 1AU7A 2O3FA 1BI1A 2B9SA 1MMGA 3GWZA 2GXBA 2E2HJ 4I0BA 5IT9Z 1MGTA 1YLFA 3WHBA 1ZG1A 3DLAA 3NARA 1DPUA 1WJAA 3CCUI 5FKMA 4RGXA 2XRLA 3D0SA 1N25A 2BOLA 1RC9A 4S05A 1BC7C 5GPCA 3I4MJ 3T5XA 3F6VA 1MBEA 3C2HA 1T56A 4LITA 2H09A 5TJJA 2ZSHB 2X0LA 4CCMA 1QZYA 4YELA 5K5QA 3GZ6A 1FBQA 2NNNA 4LIVA 2HGCA 1MDMB 3FKJA 4MO7A 5IP6A 3QPLA 3ZQHA 4AYBA 3T1BA 2A6HF 2J5OA 1MD0A 2ZKZA 3GUDA 4E70A 1FY7A 3TOAA 4EJTA 4RB3C 1DQUA 4ZTFA 3A1YA 5LHGA 2HKXA 5FKOA 1FJLA 3GCMA 5LEJA 3KZYA 3SZPA 1D0YA 3VYTB 4P9FA 1FTTA 4LB6B 4LMYA 1TQIA 1S72I 3PO2J 4I09A 2JK3A 3MZYA 5KVRA 2KLOA 2MGQA 2A5WA 1YYVA 2EV6A 4B44A 4CZZA 3F8FA 3FISA 1WJCA 3HSFA 3K7AJ 4TV7A 3LQRA 2EZIA 3KP6A 2VPLA 4OINF 4D9JA 3P9CA 1OCTC 2VXZA 1JJ8C 3A4CA 1M1EB 3OOUA 2CJJA 2FX0A 3AL0C 2R7OA 3VDXA 3DTIA 1BC8C 3WTWC 2JA6J 4EJWA 3HB9A 3OYCA 4B3XA 3TMOA 2H8WA 4QWQA 5HVQC 2YPRA 2VE9A 2ZFWA 3HOZJ 4KJZA 4L0YB 3PNVA 3K70D 3FIWA 4L5JA 4A0YA 4M9ZA 1R1TA 2DJIA 1L0OC 4N9HA 2WAEA 3CESA 3D5SC 2D1HA 3BTCA 2K9NA 2J5PA 2QZ8A 3WGHA 1QO0D 4ZH4F 1X2MA 3LSRA 1YX3A 4HEA2 5DCMB 5D4SA 2I5UA 3WTZA 2LRDA 1NK3P 5ERIA 4BBSJ 1K83J 2KDZA 2ESNA 1SANA 2YR2A 4Y33A 1POGA 1MJ9A 2K4BA 1X58A 2PQ8A 2FNAA 4XRMA 5F1JA 3VODA 1OR7C 1RZ4A 2OTJI 3DBRB 1NHAA 3M07A 1HBXG 5EEGA 1IGNA 1T39A 2R4GA 3CLQA 3FXKA 2IP2A 4BJTA 1ETXA 2R5YA 3BWGA 4BE2A 2KRCA 3W2WA 2K3FA 2CSOA 2FEZA 4BKXA 2DMTA 1S7EA 5JI6A 1FZPB 5DTDA 2LTPA 2WC2A 2PEXA 5C4JJ 3ZP5A 1HA8A 2RREA 3HHGA 1WI3A 1MH4A 1B8IB 1Z91A 3EQLF 4XKWA 2R5YB 1UG2A 2B63J 2M7BA 4M3DA 4RB0A 3PQJA 4BU2A 1RR8C 2DA1A 3Q0UA 1IJWC 2VC1A 2VIXA 3OYGA 1X19A 3FXQA 4NQWA 3P9IA 5LRSA 3BY6A 2EV5A 1JKOC 2IGKA 5F0FA 3HRMA 2R7ZJ 3OS0A 1ONVA 4IKFA 1ODDA 1VI0A 3CJQB 5DV5A 5AIQA 4EJVA 4IRIA 5J1RA 2L7FP 3TOBA 3BT9A 3FMSA 3SZTA 3L2RA 3OYJA 2YU9J 1ETYA 3CF5F 1ON1A 3V7SA 2ACJA 4KYWA 3KP2A 2V9PA 1I3AA 5E79C 4YFXF 1G2HA 5IP7J 4XICA 1IZ1A 2L9SA 3B6CA 3BR0A 3FXOA 3L7WA 1XCVA 3H5RA 3GFLA 1W36D 1G3WA 1MIJA 5HLGA 3LSKA 2CH0A 3CMMA 3CD6I 2E71A 1TW3A 2NAZA 1HXDA 2VQLA 4BH9A 1HKSA 3EUAA 3IH4A 4HSTA 1BM9A 4E7ZA 4W1UA 2H27A 1X2NA 2QSGX 4L5IA 3JRHA 2L0KA 4XLAA 3G6EI 4M6VA 1J9IA 2O9LA 2KISA 1ZG5A 2QQBA 3MWMA 3TO7A 1OR7A 2QCOA 4QSHA 2OQGA 2MC3A 1RPWA 3PFIA 5IOYA 4U87A 1W7PA 1OYWA 4PJNA 4PGGA 2RV8A 4ZJZA 3DKXA 3M1CA 5L3EA 1P4AA 1AHDP 4BXUA 1PVEA 2NVXJ 4MEXF 2KRHA 3R0JA 1TWGJ 1V54H 2X6XA 4E7IA 3OYLA 1RNLA 3MKWB 2Z5UA 1ZTRA 4RDUA 1WH7A 3EUKL 3FK7A 1KQ9A 4M3EA 3V8JA 3X2QH 3SEZA 4ABZA 1BW5A 3RKWA 4S0HB 2FUG2 4FX4A 1VQ7I 2CMPA 4HYEA 4BS9A 4HQEA 2JPBA 1LEBA 1R5ID 1OMIA 4OIOF 1UFMA 3ZMZA 4CCOA 3BOQA 3OYFA 1O4XA 2CUFA 1O3SA 4EMSA 5IYBJ 1QPIA 1XMXA 2R7DA 1BJAA 2E60A 3JTHA 5J8FA 1S6LA 1A6IA 2DN0A 1ACIA 4RGUA 3I56I 3KZZA 1TC3C 2YS9A 3HOSA 2N8GA 2EH3A 2MG4A 5F0CA 2QQ8A 2HOSA 1VQLI 3KEYA 3OIQA 4C3HJ 2E5ZA 1MZBA 4L18B 2XSDC 3CZ6A 5D5XB 1FBUA 3LSHA 1K4TA 2QQAA 2PJPA 3BZKA 3ABKH 2HTSA 1G3TA 2PJRB 2R5ZA 2CQXA 1AWCA 4AIKA 2COBA 1MBKA 2EZHA 3A01B 2QSHX 3RPUA 1STZA 2XROA 5B5EC 2HZDA 2ZMEA 2F5EA 2WADA 4HDVA 2L9RA 1B6AA 5ICGA 3J81K 1SD4A 1QVTA 4XRFA 4AIJA 3JR9A 3HHHA 3CCQI 1FWZA 2DMPA 3N05A 4JX6A 4YEJA 5HNFA 2VKVA 2FF4A 2GOXB 3IRRA 1T2KA 1MMAA 3ASOH 1FP2A 2LKPA 2ADUA 1R5HA 2E35A 1I39A 2DA6A 3QYFA 4NNJA 5E18F 4AYBN 2V4JC 4YFNF 2R7TA 1EKEA 2IVMA 3BR3A 4N4OB 4XBFA 4KDPA 5GTHC 3CMYA 2CV2A 1RETA 3AG1H 4BY7J 5E17F 2F5VA 4KIFA 3RSNA 3MCZA 3KEQA 2H6CA 4BHBA 3HIFA 2A5YB 3OR2C 4ETSA 4Q5SF 1K6YA 2STWA 5BQTA 4BBRJ 3G73A 4X6AJ 5IOZA 3WG9A 5KCMA 2JUCA 4HA8A 1JI8A 2X1CA 4PZJA 4Y4RA 2IEKA 3HZJA 3WTYC 5BPDA 3G1MA 2V6EA 2HQ5A 1QRYA 2DA3A 1T38A 2O5RA 4N9IA 5B1AH 2QSFX 5LGUA 1D5YA 2GWRA 2W85A 2V1XA 4P5OA 1WSUA 1HCRA 5LGNA 2DMNA 1KU3A 2RAEA 3S15J 4G6TB 4NDLA 5J1YA 3S2HJ 1EH6A 1ENHA 3A02A 3RYRA 2FOWA 4E7KA 1LDJA 5KHDA 2PMZN 2AS5F 2WBMA 4NBQA 1LE8B 4II2A 1T0FA 4L9NA 5F0HA 2JRMA 2EZKA 3DEEA 2DOEA 3L2CA 5J3LA 2ZJPF 2ZXJA 5F08A 2M0MA 5J1UA 4EGZA 3CCJI 2F6CA 2Y9YA 2HU9A 1DPRA 4G94A 4BNCA 3JAMZ 3GEZA 1EF4A 4CYCB 1MJBA 2IGMA 3K0LA 2A69F 1RI7A 1AOYA 3F8NA 3FHZA 4ZZLA 2KDOA 4RAZA 4IHTA 1SFUA 4ZC3A 4ZDOA 1FIAA 2GQQA 1U2WA 4BUPA 2P7CB 2LBFB 3CDHA 1V4RA 3QWLA 2VBWA 3HTSB 1SD5A 1USSA 2BXYA 3RZOJ 3RPUD 1D1CA 2RVCA 3DKYA 2L4MA 3BG9A 3G1OA 4BAYA 4C2MJ 2ZJQF 1ZR2A 4GDFA 3JREA 2CQ7A 1Z77A 3MKZA 1R58A 4A2UA 4OU0A 4I98B 4DYRA 3BJ6A 4A3LJ 3E97A 2NVUB 3AG3H 4AWXB 3OIOA 1X4OA 2VASA 2FE3A 2G7HA 4AC0A 4G12A 2EFPA 1YQAA 5C44J 4MFDA 1UZCA 3DFGA 1E17A 1U0JA 2Z16A 3E5XA 2ELJA 3RQIA 3BTLA 1RUNA 1R22A 2OBPA 4XORA 3DPTA 1JT6A 3CMEI 1QU3A 1RKWA 3VFZA 4JQFA 1D8JA 3I59B 1BR1A 2LLKA 5LGTA 1SFOJ 2BVLA 3D5RC 1OJLA 1Z05A 2P5LC 1TWHJ 2Y0SA 4EJOA 2HYGD 1VQNI 2FMLA 4XN0A 2QBYB 2HDDA 1ZRCA 2BBYA 3OYAA 5FD6A 1QZZA 3CUQB 1BN5A 4FE4A 1Z7LA 4JOMA 5F64A 5FO5A 2E19A 3H0DA 4JX5A 1Y39A 2OD5A 3S3MA 2K40A 3ZN1A 2UZKA 4M3GA 1XGNA 3R61A 2R7SA 1ETOA 1VQ6I 2P4WA 1UB9A 1IV8A 4LLLA 2EIMH 3SDGA 2H8RA 1H9GA 1KU7A 4ITVA 3HRTA 5M5XJ 3S1QJ 2X9DA 2Q0OA 3OYBA 2R7VA 1VTNC 2CFXA 1ORKA 4ESBA 2IPQX 2EV0A 2XB5A 3S1NJ 1MMNA 2KFDA 3FMRA 2GXGA 3FMQA 4M9SA 4LG0A 4CYCA 3I53A 2VJ5A 4KMUX 1B72A 4F91B 3U1KA 1NG6A 3SFIA 3OMYA 3GZNB 4G8XA 2DT5A 4C30A 2Q2EA 4BACA 1A04A 1MBGA 1FOKA 1IUFA 1SFKA 4GYGA 4B8XA 2R7FA 1K7AA 3WE3A 4ZYEA 4E7HA 4A3IJ 1SVOA 1FC3A 3PFYA 1DP3A 4HAMA 4EV0A 2KZGA 2RN7A 1MKMA 5DDGA 1A31A 2DA5A 3PSIA 1ZKGA 5FKLA 1AKHB 4GCVA 3V7CA 5M5WJ 2M34A 2XAQA 2A61A 1YI2I 3WTSC 4HLYA 2K02A 3J7AY 3BQYA 1GV2A 4YIFA 2XPUA 5LHIA 3FHNA 3K4KA 3IUOA 2JA5J 1H0MA 3W6VA 5EEHA 3WGIA 3HOXJ 1MBHA 1YRNB 1YITI 1D1AA 3ZQGA 3IAM2 1B8IA 3KP4A 2GZWA 4ANJA 4DGWB 2ZNZA 1PDNC 4A3BJ 3CUOA 1Y6IA 3JCUC 4XKVA 4AU7A 4DZPA 3HOVJ 1OCOH 3SXYA 4D0PA 2DFHA 1WGXA 4O6JA 2IS1A 3GBGA 3L2QA 1R4NB 2F2EA 2TRTA 3VPRA 1QBJA 1YW8A 1ZYRF 2QA4I 1LFBA 5HNHA 5M3FJ 4OIRF 1LEAA 1USTA 4HPQA 1QHHD 3CJRB 2C6YA 4Y17A 3NRVA 2YSRA 3K4JA 3BG3A 2M2EA 1TWAJ 3ERMA 2NS8A 1XN7A 1N78A 2O0YA 3TQNA 4DYCA 4PJJA 1Y1VJ 5H20A 3FK6A 3GMEA 1KYWA 1I50J 3CCRI 2GBYA 4GRIA 2NOGA 5DCFA 4A3CJ 2XVCA 4B4CA 2WA0A 3K1MA 4A12A 4Z6YA 5IPAA 5DM6F 4XLPF 3NAUA 3E3VA 2NVTJ 2WAQA 3H3UA 1YS6A 5JVTA 3GTQJ 1F1ZA 4A3KJ 5J8CA 1EV7A 3RKXA 3DCFA 4LGWA 1APLC 4M3BA 2V7FA 2IRFG 3KP3A 2ISZA 3CUQA 3GLLA 2A3SA 4LG3A 1QA6A 3C7JA 2DW4A 4CDGA 3WTVC 2L4AA 3EYIA 2O61A 1Q1VA 1LQ1A 2Z3YA 4FASD 3H1CA 3OR1C 2DFFA 2KL4A 1JE8A 1LFPA 4E7LA 3ASNH 1ETQA 2BYVE 3ZMUA 2L01A 1CF7A 5EZGA 2BVMA 4XOPA 4IOAF 2WY7Q 3QOEA 5FFZA 5AONA 2HOTA 2O8KA 1OKRA 3B73A 2E34A 1MDMA 4QIWN 1VZ0A 4BE1A 3TDUC 2VI6A 3F8CA 4G7HF 2ZMEB 4DZJA 2HQRA 2LKXA 2VXDA 4BDZA 2ISYA 2R93J 5HDGA 1JKPC 3SFZA 1BA5A 1BBYA 5L3BA 2DT7B 1IN7A 2LF8A 3FM3A 3KPHA 3K1NA 3HM5A 3PJRA 3ZCOA 1EH7A 3LSMA 9ANTA 1TT5B 3WGGA 1S9HA 1HW1A 2H1KA 2E5NA 4M74A 2VT3A 1I5ZA 2LKSA 5L3GA 2STTA 2NYXA 1N77A 3OV8A 5E3LA 3HUGA 1PP8F 2KHMA 3S93A 3ZOBA 5DS9A 4L9JA 4ENJA 5CVVA 3HJEA 3GF2A 4OIPF 3GW2A 2W7NA 2G7UA 3K69A 5F04A 2DPDA 4UB8C 1XDUA 4C9YA 2LSOA 5HLIA 2JA7J 2QUFA 1XX5A 4CCLA 5JHFA 2ZCWA 1QNTA 2YUSA 3N4MA 3EPZA 2M3AA 2E36A 4UV8A 5FKNA 1JHFA 4ESJA 3JRCA 2L3DA 3HDDA 3QPHA 1FOXA 1Z7UA 2LY2A 3ZPLA 1A6QA 2DMQA 3JRBA 3ABTA 1O3RA 1J7KA 1P7IA 4PUSA 3VYUB 3L2WA 3LA7A 3OYEA 2VOOA 2ZO4A 4KMFA 3KIOA 1FLIA 4J01A 1SFXA 4ZZDA 3RI4A 1J75A 2R7XA 2WAQN 4MNUA 4P55A 4E4HA 2BGCA 3ZMDA 2EILH 2X1EA 1OLTA 5HS7A 5BS6A 5CLSA 4P9UA 3AAFA 3IKTA 3GXOA 3KCCA 4CCNA 3DV8A 3C2BA 5ILVA 2P5KA 3M3YJ 1VQ4I 2L7MP 1S7AA 2ELHA 2KP6A 1S29A 1UHWA 2NRAC 2OZUA 4KUMA 3GLXA 2HQNA 2RNGA 2NVQJ 2NXNB 2EQRA 2HWVA 2R7RA 3GTMJ 4EJUA 5CVIA 4UUSB 2HFHA 1RUOA 3M8EA 1P4XA 3RZDJ 4DJAA 5K7FA 3LSGA 3WTUC 1ZAOA 2HVRA 2ID3A 2WWYA 3DXJF 2VODA 1Q1HA 2GA1A 2XAGA 4C3JJ 2EB7A 3DU6A 1HW2A 4HDUA 3DEWA 1TZLA 2MBFA 2CQQA 1XSVA 2B7EA 4DYQA 1R5GA 2XASA 5IP9J 5K7ZA 3VYRB 1GHCA 1Z9CA 2W25A 3QU6A 1XGSA 3WTXC 1LFUP 1E3PA 3BROA 1H89C 2P5VA 1T33A 5DD4A 4XLEA 3CJNA 1K79A 2Y9ZA 1Z3XA 1MMDA 3L9FA 4FCYA 1WWXA 5C3EJ 1Z6RA 2CYYA 1P7JA 2I8DA 2F4OB 4FHTA 5IY5H 2L9VA 4RAFA 3OY9A 5FFXA 2F5DA 2MLGA 5ED4A 3IWZA 3S1RJ 1BOAA 1MNMC 4FQGA 2P6TA 4YIIA 2M30A 3OWTA 2HEOA 1OCPA 3GTPJ 1FT9A 2OA4A 4XKCA 5L3CA 1V55H 1W0UA 2O8XA 3BP8A 2E1CA 3JTGA 3KFWX 4M72A 4GO1A 4DIQA 2JWTA 3LWFA 3VSLA 3GX4X 5F6FA 1OPCA 3F72A 4OMYA 3M8JA 2KMUA 3G3ZA 1R6RA 2EFNA 3VYSB 2BW3B 1J59A 4LIUA 1BIAA 2EA2A 3CCVI 2XPVA 5JHUA 3HSRA 5LBQA 1Y0NA 3M9AA 4KN7X 1Z6TA 3KETA 4I02A 5E8GA 2LY9A 4ENMA 3LQQA 3W2VA 2CO5A 2V6CA 1XDSA 3DKWA 3H0GJ 5BOXA 2LFBA 4F55A 2F5CA 1ZN2A 3UKGA 2DODA 1E3HA 4XKBA 2JN6A 3CF2A 5TISC 4XK4A 3CP8A 1GVDA 3KZIC 1R00A 4C2UA 3OYDA 3A03A 3PM1A 4B43A 5A2QZ 1IUYA 2CG4A 3ZXSA 4MTDA 5CJ9A 4G6QA 2VKEA 3LA3A 2EFQA 4M9XA 2LD5A 3S3OA 4ZDLA 4MFEA 1PJRA 1JT0A 4UB6C 2ZXHA 1LJ9A 1RESA 2K86A 3PL8A 3I58A 2XF6A 4UV9A 1CGPA 3HG9A 1FMWA 1B72B 3FF5A 4KICA 4PSWA 4HSRA 3WG7H 2XSJC 4A6DA 4EEFG 2B0LA 3IC7A 4XR6A 3BJAA 2WV1A 4QLCU 1PP7U 4V19K 3E6CC 2KIMA 3MD2A 1ZLJA 2LK2A 3FXRA 2P7VB 3LSTA 5BMZA 2DOAA 2IAIA 2P0WA 1UG0A 3BG5A 3ABUA 4IZZA 4WWCA 3W2AA 2BZTA 4OIQF 3R6SA 2FNPA 4RM3A 4WXCA 1P92A 4LB5A 2Y31A 5FLMJ 3SHFA 4LK0F 2LMDA 2ZXIA 2IT0A 2FBHA 2Z2SB 3H35A 1LUJB 4KIGA 2E2JJ 4LLGF 1BL0A 5CVRA 4MTEA 1VQ5I 2IBDA 1OFCX 5HOOA 4KNYA 1FBSA 1I6XA 1WZ2A 4ENNA 1K4SA 1ZREA 1UHSA 2V1NA 3AG4H 2V1UA 3U1DA 3TGNA 3VOEA 3RKQA 1IC8A 3A0BC 4PK4A 2FA5A 3M8FA 1K78A 2VJJA 4M6YA 1VNDA 4BEHA 1HKQA 1IF1A 4NB5A 3PO3J 1FPQA 5KK1A 3IWFA 1X4PA 5IYCJ 1ZLKA 2HPMA 4MEYF 1E0EA 2K4JA 2JSCA 1HKTA 4CO8A 3CC7I 1OISA 1SD7A 2Y75A 4CH7A 4IHSA 1SVMA 3K4LA 4LG0B 2CFOA 1LNWA 3BCAA 4DQ2A 3FXJA 2DBBA 2M4GA 5JLWA 5FJ8J 2A05A 4HF0A 3A0HC 4WX9A 2CU7A 4W97A 3S32A 2OF7A 2QGUA 3CUQC 5ILUA 2KKOA 5A2QK 1R1VA 4ZYDA 3OYIA 2RC4A 2K7LA 1XG1A 2V1DA 4PGHA 1O7FA 1OYYA 3ELKA 3F0CA 1J2XA 5DUKA 4XRSA 3MN2A 4P1WA 2CWEA 4WXHA 1JJ6C 4WXDA 1IRXA 2VL8A 1CQTA 1Y8QB 1X1BA 1V5EA 1U5TA 1AKHA 2DU9A 2K9LA 3LNQA 5CQEA 5E1ZB 3OOPA 2UXXA 1E2XA 4L5EA 1ZRFA 2QYOA 5HLTA 2XV4S 2ZBKA 4Q48A 2XRNA 3AKZA 5TRDA 1OCRH 3PQKA 2E1NA 1OQYA 2VBZA 2EWNA 4OOIA 1Z3YA 1K6OA 1QGPA 3HTUA 3RPQA 5D8LB 2L7KA 2KQRA 4IRGA 2FBKA 3I55I 2MW8A 1TNTA 1YW9A 2G0EA 1JUMA 3QPTA 1O3TA 4HNUA 4BXFA 1WKMA 2Y2ZA 1XB4A 5IT3A 3CDIA 1YO5C 4RB2C 4AD9A 1JTXA 2DOFA 1V5GA 2ESHA 4J19A 2K5CA 3LAPA 1P2FA 4RGRA 1R71A 2LYCA 2XHKA 3H5AA 1N75A 2BEOA 2DQRA 3BR5A 1S8NA 2DMUA 3R4KA 4DBQA 2R7QA 4JP0A 3F3XA 1YFHA 3S14J 3J80Z 3DTKA 3EUHA 2K9MA 2P6SA 4QPOA 1HDDC 1IXRC 2FQ3A 3BG7A 1YIOA 5ICEA 2IXSA 1BI3A 3DWLE 3H3VK 3DTEA 1R7JA 2BW3A 4UVAA 5HS8A 3I54A 3QP6A 1T98A 2ID6A 3L09A 3Q0VA 4Q47A 3GVAA 3K2AA 3LAJA 1IV6A 1IRFA 3H3ZA 2PMHA 4ESFA 4RGSA 2XKOA 3DPLC 1DUXC 1R9TJ 3HPGA 3JAMK 2FJ1A 2WY8Q 1B4AA 2IS4A 3SEQA 2QVOA 4EQQA 3KP7A 3RKYA 2W48A 4O3MA 4QPQA 4XQFA 3ECOA 3EDPA 5B66C 3HGYA 3HKZN 4F7ZA 3O8GA 3S1MJ 5D5UB 4U7DA 4XSXF 1IN5A 5DEQA 2HTJA 2CUEA 3ZQCA 2DLLA 4BGDA 4JK1X 3QAHA 1LDKB 1ZH5A 3WODF 1YW7A 3VWBA 2Z9OA 5FRNA 2ZJ2A 3JRIA 4GXOA 2EBIA 3I9V2 3V8KA 1WH5A 4AM3A 2OC6A 1WVRA 2WV0A 4LJZF 3PNTA 4EM2A 2F4IA 2M9HA 3SDBA 3LA2A 3OS1A 3K9TA 2GXAA 1FSHA 1IO2A 4U7BA 4PCQA 2D2WA 5IYDJ 2XGXA 3K1PA 1TT0A 2P81A 2CGPA 2KJBA 4Y15A 5DD8A 1FOYA 2VE8A 5FRMA 4AUXA 4U0VA 4EATA 5DUIA 1ETKA 3KLOA 2ECBA 2XAUA
chains in the Genus database with same CATH topology
2TDXA 5BPIA 3FM5A 4UVBA 1GXPA 3GFIA 2M5WA 4MQ9F 5ICCA 4U88A 2HR3A 3BPVA 2XKPA 2FXAA 1FSEA 2RGVA 2PBIA 3S2WA 4WCGA 3IHUA 4LD5A 2OAZA 1TTYA 1FP1D 2QLZA 3HRUA 2MD5A 3Q9VA 3ZQ7A 1KQ8A 2VBYA 5HS9A 1KQ0A 3BPXA 2O03A 3ZMSA 1CF7B 1FYMA 3U2RA 2YX4A 2P8TA 4G9YA 4Q4ZF 1JHHA 1FNNA 3WE2A 5D4RA 4I0AA 1U8RA 3WU1B 4CGZA 4ENKA 2DFIA 4M71A 5L3FA 3RJPA 1Z1DA 1P4WA 2W57A 4UNOA 1O3QA 2M45A 2QENA 2HS5A 4AVPA 3MFKA 1W7PB 1ZARA 4A5MA 4ZYHA 2UXNA 3M1EA 4HQMA 2RQPA 2V9VA 1XMAA 2YU3A 3LFKA 4H0EA 1ZG3A 3JSOA 4IPAA 4RS8A 1FYLA 3W6KB 2M87A 2BE5F 3KLNA 4ON0A 1YTYA 3IRQA 5E1WA 1IXSB 1R1UA 3HSEA 4HBLA 3HYIA 3Q5FA 4HLXA 2E7XA 5L3DA 2DPUA 1D3YA 1O7LA 2Y48A 2FBIA 1U5TB 3FZVA 1I1GA 1REPC 1V3FA 2QQ9A 2M8EA 4KN4X 4GYIA 4GGGA 2HOEA 4U0YA 4A5NA 4R1HA 1G3YA 3WU0A 1S7OA 5LRRA 1TNSA 3R0AA 2BV6A 3I59A 5JFRA 1RIOH 4EVIA 2RNJA 5K5OA 4K2EA 2O6GE 3F8MA 4G7OF 4ASNA 3KP5A 5D5WB 4HX8A 6PAXA 3J7AO 1TW2A 1XSDA 2EJRA 2Q8KA 5D8KB 2X4HA 3U9GA 1Y0UA 4HF1A 3ISPA 1B9NA 3ROUA 2Y0MA 3E5QA 1U6GA 5F1RA 2F5FA 3ULQB 4L0ZB 2IA2A 3TDZC 3M7GA 2RDPA 3F6OA 4A0XA 3KEOA 1B9MA 2A6EF 1KGSA 1ZRDA 1TBXA 2DK8A 1TLHB 2GIVA 3T8RA 1IW7F 4FX0A 1IAWA 2JRTA 1YG2A 3E6MA 2XAJA 4RAYA 3ZMTA 3J80K 1XGOA 4LFUA 4EM1A 2D45A 4KFCA 3QP5A 1WRJA 3GZ5A 1MJAA 4Y13A 4UUVA 2VC0A 3EYYA 3ZN0A 4PDKA 2L02A 3V7RA 3ECHA 5FGMA 4BYYA 3GYHX 3I71A 3GO5A 4S04A 4CICA 2H94A 5K1YA 2YX7A 2LDUA 1XCBA 2NNYA 4BHPA 4I01A 1BI0A 2EK5A 2QWWA 1P6RA 1I1SA 5CYVA 1SAXA 3CTAA 2MLKA 3E5UA 4I2OA 2ETHA 5H6RA 3RYPA 2V79A 4N0BA 3QOPA 5J6XA 4ZYGA 1ULYA 4KIBA 2HDCA 3VB2A 2VT2A 1G4DA 2FRHA 4O5VA 5FD5A 2DAOA 1D5VA 2DO7A 1KYZA 3MZHA 3REOA 1QPMA 4JBAA 2IA1A 4RB1A 1W5SA 2A68F 3F8BA 4R79A 4R8HA 2PN6A 1DP7P 4A0ZA 3F22A 1TQMA 3N97A 5AIPA 4HF2A 3ZMVA 2OU2A 1F5TA 1XSXA 2IA0A 2HKOA 1U3EM 1SFEA 1F4KA 1X3UA 5E8IA 3MAJA 1W5TA 2MH2A 4IRHA 3RIRA 3ERED 2VOPA 2FU4A 1B1BA 1W4MA 3HOTA 1U78A 3F21A 2EFWA 4CXFA 4CYDA 3RTRA 4IF4A 2HYFA 5DYMA 2DQLA 3DF8A 5LHHA 2W24A 1SMYF 1G3SA 1KU2A 2KIUA 3IL2A 2ZNYA 1UHMA 4WF2A 1F9NA 3FX3A 2JT1A 3C1DA 2CQKA 3DEUA 2FSWA 4HW0A 5H6QA 4KT5C 2QBYA 1IN6A 1IRGA 3W6JB 5FLXK 3EETA 3B02A 4IXAA 1B59A 2XUBA 3HRSA 2G9WA 5ILSA 3I0TA 5IT9K 1U5TC 1I27A 5HDKA 4LK1F 3K2ZA 3GFMA 4M6XA 3JSPA 2JTVA 4L9VA 2PLYA 3O6BB 1HSJA 1J5YA 3P7NA 5K5RA 2KIFA 5E1XA 3TKYA 5LEKA 3DQVC 4IVNA 2UWMA 4WK8F 1WQ2A 2PFBA 4BHCA 4NHJA 3BJOA 2L54A 3GFJA 2FOKA 1D8KA 4G6DA 1GXQA 5HLHA 1YS7A 4MQVA 4A6EA 2XIGA 1WI9A 2GA2A 3TO9A 4I7HA 1XMKA 4B09A 1HW5A 2PG4A 2PI0A 1LDDA 2IW5A 3P9KA 2NS0A 3O3KA 2CW0F 4AIHA 1FYKA 5D6EA 1XGMA 1ON2A 2HZTA 3DP7A 3VEPA 5CVJA 1IXCA 4FT8A 4UXNA 1W7PD 5D5VB 1JXSA 4UVCA 2XAFA 1EH8A 2VONA 3F23A 3CLOA 2R3SA 4MHGA 2DK5A 3C18A 2EA4A 2JPCA 3V4GA 4HZFA 1DDNA 4MGRA 3CO6C 4KA4A 2EFOA 4XLNF 1ZHFA 4HV5A 4HX7A 1KU9A 5D6FA 3I5UA 2DTRA 2Z33A 3TO6A 1SMTA 4P96A 1KA8A 2E7WA 3JW4A 3C3WA 4Z2YA 5FB2A 1L3LA 1GVJA 3R60A 3D5LA 4G7ZF 1R36A 2H6BA 3IKVA 3MEXA 1BI2A 4LLNA 1LVAA 3QRFF 3BDDA 4HV6A 4CHUA 1IN4A 1H9TA 2Z99A 1HSTA 2FMYA 2XAHA 2K27A 2KRFA 2KJCA 1FX7A 3I64A 2RKHA 3CO7C 3COAC 3FXUA 4HX4A 1LB2A 5FLXZ 1R23A 1ZGJA 2MH9A 2JZYA 3WTTC 2W84A 3I4PA 3O2PE 1TQPA 2OQRA 2PMUA 5E20A 3T0YA 3ML6A 4M73A 2COMA 3E6BA 2AXLA 3E6DA 5DCMA 2VBXA 3H92A 3FWEA 5HDNA 2LNBA 1JGSA 2IJLA 1C0WA 4L9TA 3BZ6A 2WTEA 1ZGAA 4IJAA 2VN2A 4XSZF 1IN8A 1OYIA 3SQNA 3NQOA 4YFKF 3T8TA 5ICFA 1SD6A 5CVUA 2A07F 3QU3A 3Q9SA 3L00A 1G6NA 4EGYA 5JR3A 4BQAA 1PUEE 2QM3A 5LLQA 3V8LA 4UHTA 1J0RA 1O57A 1BIBA 2OZ6A 1T6SA 2DI3A 2LF7A 3J81Z 4OMZA 1HQCA 4DNCA 1QQIA 1S3JA 2M1BA 3KE2A 4EM0B 4U0WA 4YG2F 1XD7A 4HOBA 1K78B 3RDIA 3NEUA 2D1VA 2MA3A 3MQ0A 1UCRA 2GAUA 2O3FA 1BI1A 3GWZA 2GXBA 4I0BA 5IT9Z 1MGTA 1YLFA 1ZG1A 1DPUA 4RGXA 3D0SA 4S05A 1BC7C 3T5XA 3F6VA 2H09A 5TJJA 2X0LA 1QZYA 5K5QA 3GZ6A 1FBQA 2NNNA 2HGCA 1MDMB 3T1BA 2A6HF 2J5OA 4E70A 1MD0A 2ZKZA 3GUDA 1FY7A 3TOAA 4EJTA 4RB3C 5LHGA 2HKXA 5LEJA 3KZYA 3SZPA 4P9FA 4LB6B 4LMYA 1TQIA 4I09A 3MZYA 5KVRA 1YYVA 2EV6A 4CZZA 3F8FA 3HSFA 4TV7A 3LQRA 3KP6A 4OINF 3P9CA 2VXZA 1BC8C 3WTWC 4EJWA 4QWQA 5HVQC 2YPRA 2VE9A 2ZFWA 4L0YB 4L5JA 4A0YA 4M9ZA 1R1TA 1L0OC 4N9HA 4ZH4F 2D1HA 3WGHA 2J5PA 2QZ8A 1QO0D 5DCMB 5D4SA 3WTZA 5ERIA 2ESNA 2YR2A 1MJ9A 2K4BA 2PQ8A 2FNAA 3VODA 1RZ4A 1NHAA 1HBXG 5EEGA 1T39A 2IP2A 3BWGA 2CSOA 2FEZA 5JI6A 1FZPB 2WC2A 2PEXA 3ZP5A 3HHGA 1Z91A 3EQLF 4RB0A 3PQJA 2VC1A 3FXQA 4NQWA 3P9IA 5LRSA 3BY6A 2EV5A 3HRMA 1ONVA 1ODDA 5DV5A 5AIQA 4EJVA 4IRIA 3TOBA 3FMSA 3SZTA 2ACJA 1ON1A 3V7SA 4KYWA 3KP2A 4YFXF 1IZ1A 3L7WA 1XCVA 3GFLA 1G3WA 5HLGA 2NAZA 1TW3A 1HXDA 4BH9A 1HKSA 4KDPA 1BM9A 2H27A 4L5IA 1J9IA 1ZG5A 2QQBA 3MWMA 3TO7A 1OR7A 2OQGA 2MC3A 3PFIA 1W7PA 1OYWA 4PGGA 2RV8A 5L3EA 1P4AA 4BXUA 4MEXF 3R0JA 1RNLA 2Z5UA 1KQ9A 3V8JA 3RKWA 4FX4A 4HYEA 4HQEA 2JPBA 1LEBA 1OMIA 4OIOF 1UFMA 3ZMZA 3BOQA 1O3SA 4EMSA 2R7DA 1BJAA 3JTHA 5J8FA 1S6LA 4RGUA 3KZZA 3HOSA 1MZBA 4L18B 5D5XB 1FBUA 2QQAA 2PJPA 2HTSA 1G3TA 1AWCA 4AIKA 3RPUA 1STZA 2XROA 2ZMEA 2F5EA 4HDVA 1B6AA 5ICGA 3J81K 1SD4A 4XRFA 4AIJA 3HHHA 1FWZA 1T2KA 2FF4A 3IRRA 1FP2A 2LKPA 2ADUA 1R5HA 5E18F 4YFNF 2IVMA 4XBFA 5E17F 4KIFA 3MCZA 3KEQA 2H6CA 4BHBA 3HIFA 2A5YB 4ETSA 4Q5SF 2STWA 5BQTA 3G73A 3WG9A 4HA8A 4PZJA 3WTYC 5BPDA 1T38A 4N9IA 5LGUA 2GWRA 2W85A 2V1XA 4P5OA 1WSUA 5LGNA 1KU3A 1EH6A 3RYRA 1LDJA 2AS5F 1T0FA 4L9NA 3L2CA 2ZXJA 4EGZA 4G94A 1DPRA 4BNCA 3JAMZ 3GEZA 1MJBA 3K0LA 2A69F 1RI7A 1AOYA 3F8NA 3FHZA 4ZZLA 4RAZA 4IHTA 1SFUA 2GQQA 1U2WA 2P7CB 3CDHA 1V4RA 2VBWA 3HTSB 1SD5A 1USSA 2RVCA 2L4MA 4BAYA 1R58A 4A2UA 4OU0A 4I98B 3BJ6A 3E97A 4AWXB 2FE3A 2G7HA 2EFPA 1YQAA 1E17A 3DFGA 3E5XA 1RUNA 1R22A 2OBPA 3DPTA 3VFZA 4JQFA 1D8JA 3I59B 5LGTA 1Z05A 2P5LC 4EJOA 2HYGD 2FMLA 2QBYB 1ZRCA 2BBYA 5FD6A 1QZZA 3CUQB 1BN5A 5F64A 5FO5A 2OD5A 3ZN1A 2UZKA 1XGNA 3R61A 2P4WA 1UB9A 4LLLA 1H9GA 1KU7A 3HRTA 2Q0OA 1VTNC 2CFXA 4ESBA 2IPQX 2EV0A 3FMRA 2GXGA 3FMQA 4M9SA 4LG0A 3I53A 4KMUX 4G8XA 2DT5A 2Q2EA 1A04A 1FOKA 4GYGA 4B8XA 2R7FA 1K7AA 3WE3A 4ZYEA 1FC3A 4HAMA 4EV0A 5DDGA 2RN7A 1MKMA 4GCVA 3V7CA 2XAQA 2A61A 3WTSC 4HLYA 2K02A 4YIFA 5LHIA 1H0MA 5EEHA 3WGIA 3KP4A 2GZWA 2ZNZA 1PDNC 3CUOA 3SXYA 4D0PA 4O6JA 2F2EA 1QBJA 1YW8A 1ZYRF 4OIRF 1LEAA 1USTA 2C6YA 4Y17A 3NRVA 2YSRA 1XN7A 2O0YA 3TQNA 5H20A 1KYWA 5DCFA 2XVCA 3K1MA 4A12A 4XLPF 3E3VA 3H3UA 1YS6A 5JVTA 1F1ZA 5J8CA 1EV7A 3RKXA 4LGWA 2IRFG 3KP3A 2ISZA 3CUQA 2A3SA 3C7JA 2DW4A 4CDGA 3WTVC 2L4AA 3EYIA 2O61A 1LQ1A 2Z3YA 1JE8A 2BYVE 3ZMUA 2L01A 1CF7A 5FFZA 5AONA 1OKRA 3B73A 1MDMA 3TDUC 3F8CA 4G7HF 2ZMEB 2HQRA 2ISYA 5HDGA 3SFZA 1BBYA 5L3BA 1IN7A 2LF8A 3FM3A 3K1NA 1EH7A 3WGGA 1HW1A 4M74A 2VT3A 1I5ZA 5L3GA 2STTA 2NYXA 3OV8A 3HUGA 1PP8F 4L9JA 4ENJA 5CVVA 3GF2A 4OIPF 3GW2A 2G7UA 3K69A 2DPDA 1XDUA 2LSOA 5HLIA 2QUFA 2ZCWA 1QNTA 3N4MA 4UV8A 1JHFA 4ESJA 2L3DA 3QPHA 1Z7UA 3ZPLA 3ABTA 1O3RA 1J7KA 3LA7A 2VOOA 2ZO4A 4KMFA 1FLIA 1SFXA 4ZZDA 3RI4A 1J75A 4MNUA 4P55A 2BGCA 3ZMDA 5HS7A 5BS6A 5CLSA 4P9UA 3AAFA 3IKTA 3GXOA 3KCCA 3DV8A 5ILVA 2P5KA 1S7AA 2ELHA 1S29A 1UHWA 2NRAC 2OZUA 4KUMA 3GLXA 2HQNA 2HWVA 4EJUA 5CVIA 2HFHA 1RUOA 3M8EA 1P4XA 3WTUC 1ZAOA 2WWYA 3DXJF 2VODA 1Q1HA 2GA1A 2XAGA 2EB7A 1HW2A 4HDUA 2MBFA 1XSVA 1R5GA 2XASA 1GHCA 1Z9CA 2W25A 3QU6A 1XGSA 3WTXC 3BROA 2P5VA 5DD4A 3CJNA 1K79A 3L9FA 1WWXA 1Z6RA 2CYYA 4FHTA 5FFXA 2F5DA 2MLGA 5ED4A 3IWZA 1BOAA 2P6TA 4YIIA 2M30A 2HEOA 1FT9A 2OA4A 5L3CA 2O8XA 3BP8A 2E1CA 3JTGA 3KFWX 4M72A 4GO1A 3LWFA 3GX4X 5F6FA 1OPCA 3F72A 4OMYA 3G3ZA 2EFNA 1J59A 1BIAA 2EA2A 5JHUA 3HSRA 5LBQA 3M9AA 4KN7X 1Z6TA 3KETA 4I02A 5E8GA 4ENMA 3LQQA 2CO5A 2V6CA 1XDSA 3DKWA 5BOXA 2F5CA 1ZN2A 1R00A 5A2QZ 1IUYA 2CG4A 4MTDA 5CJ9A 4G6QA 3LA3A 4M9XA 2EFQA 1LJ9A 2K86A 3I58A 4UV9A 1CGPA 3FF5A 4KICA 4A6DA 2B0LA 3IC7A 3BJAA 4QLCU 1PP7U 3E6CC 2KIMA 1ZLJA 3FXRA 3LSTA 2P7VB 5BMZA 3ABUA 4WWCA 4OIQF 3R6SA 2FNPA 4WXCA 1P92A 4LB5A 3SHFA 4LK0F 2IT0A 2FBHA 4KIGA 4LLGF 5CVRA 4MTEA 5HOOA 4KNYA 1FBSA 1I6XA 4ENNA 1ZREA 2V1UA 3U1DA 3TGNA 3VOEA 2FA5A 3M8FA 1K78A 4M6YA 1HKQA 1IF1A 4NB5A 1FPQA 5KK1A 3IWFA 1ZLKA 4MEYF 2K4JA 2JSCA 1HKTA 4CO8A 1SD7A 2Y75A 4IHSA 4LG0B 1LNWA 4DQ2A 2DBBA 4HF0A 4WX9A 5A2QK 3CUQC 5ILUA 2KKOA 1R1VA 4ZYDA 2RC4A 2K7LA 2V1DA 4PGHA 1O7FA 1OYYA 3ELKA 1J2XA 5DUKA 2CWEA 4WXHA 4WXDA 1U5TA 2DU9A 5E1ZB 3OOPA 2UXXA 1E2XA 1ZRFA 2QYOA 2XV4S 2ZBKA 4Q48A 2XRNA 5TRDA 3PQKA 2E1NA 2VBZA 2EWNA 4OOIA 1K6OA 1QGPA 3HTUA 3RPQA 5D8LB 4IRGA 2FBKA 1TNTA 1YW9A 3QPTA 1O3TA 1WKMA 1XB4A 1YO5C 5IT3A 4RB2C 4AD9A 2ESHA 3LAPA 1P2FA 4RGRA 2XHKA 2BEOA 2DQRA 1S8NA 3R4KA 3F3XA 1YFHA 3J80Z 3EUHA 2P6SA 1IXRC 2FQ3A 1YIOA 5ICEA 1BI3A 1R7JA 4UVAA 5HS8A 3I54A 3QP6A 1T98A 3L09A 4Q47A 3GVAA 3LAJA 1IRFA 3H3ZA 2PMHA 4ESFA 4RGSA 2XKOA 3DPLC 1DUXC 3JAMK 1B4AA 2QVOA 4EQQA 3KP7A 3RKYA 4O3MA 3ECOA 3EDPA 4F7ZA 5D5UB 4U7DA 4XSXF 1IN5A 5DEQA 2HTJA 2DLLA 4JK1X 3QAHA 1LDKB 1ZH5A 3WODF 1YW7A 2Z9OA 2ZJ2A 4GXOA 3V8KA 2WV0A 4LJZF 4EM2A 3LA2A 3K9TA 1FSHA 4U7BA 4PCQA 2D2WA 2XGXA 3K1PA 2CGPA 2KJBA 4Y15A 5DD8A 2VE8A 4U0VA 5DUIA 3KLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TDX A;  5BPI A;  3FM5 A;  4UVB A;  1GXP A;  3GFI A;  2M5W A;  4MQ9 F;  5ICC A;  4U88 A;  2HR3 A;  3BPV A;  2XKP A;  2FXA A;  1FSE A;  2RGV A;  2PBI A;  3S2W A;  4WCG A;  3IHU A;  4LD5 A;  2OAZ A;  1TTY A;  1FP1 D;  2QLZ A;  3HRU A;  2MD5 A;  3Q9V A;  3ZQ7 A;  1KQ8 A;  2VBY A;  5HS9 A;  1KQ0 A;  3BPX A;  2O03 A;  3ZMS A;  1CF7 B;  1FYM A;  3U2R A;  2YX4 A;  2P8T A;  4G9Y A;  4Q4Z F;  1JHH A;  1FNN A;  3WE2 A;  5D4R A;  4I0A A;  1U8R A;  3WU1 B;  4CGZ A;  4ENK A;  2DFI A;  4M71 A;  5L3F A;  3RJP A;  1Z1D A;  1P4W A;  2W57 A;  4UNO A;  1O3Q A;  2M45 A;  2QEN A;  2HS5 A;  4AVP A;  3MFK A;  1W7P B;  1ZAR A;  4A5M A;  4ZYH A;  2UXN A;  3M1E A;  4HQM A;  2RQP A;  2V9V A;  1XMA A;  2YU3 A;  3LFK A;  4H0E A;  1ZG3 A;  3JSO A;  4IPA A;  4RS8 A;  1FYL A;  3W6K B;  2M87 A;  2BE5 F;  3KLN A;  4ON0 A;  1YTY A;  3IRQ A;  5E1W A;  1IXS B;  1R1U A;  3HSE A;  4HBL A;  3HYI A;  3Q5F A;  4HLX A;  2E7X A;  5L3D A;  2DPU A;  1D3Y A;  1O7L A;  2Y48 A;  2FBI A;  1U5T B;  3FZV A;  1I1G A;  1REP C;  1V3F A;  2QQ9 A;  2M8E A;  4KN4 X;  4GYI A;  4GGG A;  2HOE A;  4U0Y A;  4A5N A;  4R1H A;  1G3Y A;  3WU0 A;  1S7O A;  5LRR A;  1TNS A;  3R0A A;  2BV6 A;  3I59 A;  5JFR A;  1RIO H;  4EVI A;  2RNJ A;  5K5O A;  4K2E A;  2O6G E;  3F8M A;  4G7O F;  4ASN A;  3KP5 A;  5D5W B;  4HX8 A;  6PAX A;  3J7A O;  1TW2 A;  1XSD A;  2EJR A;  2Q8K A;  5D8K B;  2X4H A;  3U9G A;  1Y0U A;  4HF1 A;  3ISP A;  1B9N A;  3ROU A;  2Y0M A;  3E5Q A;  1U6G A;  5F1R A;  2F5F A;  3ULQ B;  4L0Z B;  2IA2 A;  3TDZ C;  3M7G A;  2RDP A;  3F6O A;  4A0X A;  3KEO A;  1B9M A;  2A6E F;  1KGS A;  1ZRD A;  1TBX A;  2DK8 A;  1TLH B;  2GIV A;  3T8R A;  1IW7 F;  4FX0 A;  1IAW A;  2JRT A;  1YG2 A;  3E6M A;  2XAJ A;  4RAY A;  3ZMT A;  3J80 K;  1XGO A;  4LFU A;  4EM1 A;  2D45 A;  4KFC A;  3QP5 A;  1WRJ A;  3GZ5 A;  1MJA A;  4Y13 A;  4UUV A;  2VC0 A;  3EYY A;  3ZN0 A;  4PDK A;  2L02 A;  3V7R A;  3ECH A;  5FGM A;  4BYY A;  3GYH X;  3I71 A;  3GO5 A;  4S04 A;  4CIC A;  2H94 A;  5K1Y A;  2YX7 A;  2LDU A;  1XCB A;  2NNY A;  4BHP A;  4I01 A;  1BI0 A;  2EK5 A;  2QWW A;  1P6R A;  1I1S A;  5CYV A;  1SAX A;  3CTA A;  2MLK A;  3E5U A;  4I2O A;  2ETH A;  5H6R A;  3RYP A;  2V79 A;  4N0B A;  3QOP A;  5J6X A;  4ZYG A;  1ULY A;  4KIB A;  2HDC A;  3VB2 A;  2VT2 A;  1G4D A;  2FRH A;  4O5V A;  5FD5 A;  2DAO A;  1D5V A;  2DO7 A;  1KYZ A;  3MZH A;  3REO A;  1QPM A;  4JBA A;  2IA1 A;  4RB1 A;  1W5S A;  2A68 F;  3F8B A;  4R79 A;  4R8H A;  2PN6 A;  1DP7 P;  4A0Z A;  3F22 A;  1TQM A;  3N97 A;  5AIP A;  4HF2 A;  3ZMV A;  2OU2 A;  1F5T A;  1XSX A;  2IA0 A;  2HKO A;  1U3E M;  1SFE A;  1F4K A;  1X3U A;  5E8I A;  3MAJ A;  1W5T A;  2MH2 A;  4IRH A;  3RIR A;  3ERE D;  2VOP A;  2FU4 A;  1B1B A;  1W4M A;  3HOT A;  1U78 A;  3F21 A;  2EFW A;  4CXF A;  4CYD A;  3RTR A;  4IF4 A;  2HYF A;  5DYM A;  2DQL A;  3DF8 A;  5LHH A;  2W24 A;  1SMY F;  1G3S A;  1KU2 A;  2KIU A;  3IL2 A;  2ZNY A;  1UHM A;  4WF2 A;  1F9N A;  3FX3 A;  2JT1 A;  3C1D A;  2CQK A;  3DEU A;  2FSW A;  4HW0 A;  5H6Q A;  4KT5 C;  2QBY A;  1IN6 A;  1IRG A;  3W6J B;  5FLX K;  3EET A;  3B02 A;  4IXA A;  1B59 A;  2XUB A;  3HRS A;  2G9W A;  5ILS A;  3I0T A;  5IT9 K;  1U5T C;  1I27 A;  5HDK A;  4LK1 F;  3K2Z A;  3GFM A;  4M6X A;  3JSP A;  2JTV A;  4L9V A;  2PLY A;  3O6B B;  1HSJ A;  1J5Y A;  3P7N A;  5K5R A;  2KIF A;  5E1X A;  3TKY A;  5LEK A;  3DQV C;  4IVN A;  2UWM A;  4WK8 F;  1WQ2 A;  2PFB A;  4BHC A;  4NHJ A;  3BJO A;  2L54 A;  3GFJ A;  2FOK A;  1D8K A;  4G6D A;  1GXQ A;  5HLH A;  1YS7 A;  4MQV A;  4A6E A;  2XIG A;  1WI9 A;  2GA2 A;  3TO9 A;  4I7H A;  1XMK A;  4B09 A;  1HW5 A;  2PG4 A;  2PI0 A;  1LDD A;  2IW5 A;  3P9K A;  2NS0 A;  3O3K A;  2CW0 F;  4AIH A;  1FYK A;  5D6E A;  1XGM A;  1ON2 A;  2HZT A;  3DP7 A;  3VEP A;  5CVJ A;  1IXC A;  4FT8 A;  4UXN A;  1W7P D;  5D5V B;  1JXS A;  4UVC A;  2XAF A;  1EH8 A;  2VON A;  3F23 A;  3CLO A;  2R3S A;  4MHG A;  2DK5 A;  3C18 A;  2EA4 A;  2JPC A;  3V4G A;  4HZF A;  1DDN A;  4MGR A;  3CO6 C;  4KA4 A;  2EFO A;  4XLN F;  1ZHF A;  4HV5 A;  4HX7 A;  1KU9 A;  5D6F A;  3I5U A;  2DTR A;  2Z33 A;  3TO6 A;  1SMT A;  4P96 A;  1KA8 A;  2E7W A;  3JW4 A;  3C3W A;  4Z2Y A;  5FB2 A;  1L3L A;  1GVJ A;  3R60 A;  3D5L A;  4G7Z F;  1R36 A;  2H6B A;  3IKV A;  3MEX A;  1BI2 A;  4LLN A;  1LVA A;  3QRF F;  3BDD A;  4HV6 A;  4CHU A;  1IN4 A;  1H9T A;  2Z99 A;  1HST A;  2FMY A;  2XAH A;  2K27 A;  2KRF A;  2KJC A;  1FX7 A;  3I64 A;  2RKH A;  3CO7 C;  3COA C;  3FXU A;  4HX4 A;  1LB2 A;  5FLX Z;  1R23 A;  1ZGJ A;  2MH9 A;  2JZY A;  3WTT C;  2W84 A;  3I4P A;  3O2P E;  1TQP A;  2OQR A;  2PMU A;  5E20 A;  3T0Y A;  3ML6 A;  4M73 A;  2COM A;  3E6B A;  2AXL A;  3E6D A;  5DCM A;  2VBX A;  3H92 A;  3FWE A;  5HDN A;  2LNB A;  1JGS A;  2IJL A;  1C0W A;  4L9T A;  3BZ6 A;  2WTE A;  1ZGA A;  4IJA A;  2VN2 A;  4XSZ F;  1IN8 A;  1OYI A;  3SQN A;  3NQO A;  4YFK F;  3T8T A;  5ICF A;  1SD6 A;  5CVU A;  2A07 F;  3QU3 A;  3Q9S A;  3L00 A;  1G6N A;  4EGY A;  5JR3 A;  4BQA A;  1PUE E;  2QM3 A;  5LLQ A;  3V8L A;  4UHT A;  1J0R A;  1O57 A;  1BIB A;  2OZ6 A;  1T6S A;  2DI3 A;  2LF7 A;  3J81 Z;  4OMZ A;  1HQC A;  4DNC A;  1QQI A;  1S3J A;  2M1B A;  3KE2 A;  4EM0 B;  4U0W A;  4YG2 F;  1XD7 A;  4HOB A;  1K78 B;  3RDI A;  3NEU A;  2D1V A;  2MA3 A;  3MQ0 A;  1UCR A;  2GAU A;  2O3F A;  1BI1 A;  3GWZ A;  2GXB A;  4I0B A;  5IT9 Z;  1MGT A;  1YLF A;  1ZG1 A;  1DPU A;  4RGX A;  3D0S A;  4S05 A;  1BC7 C;  3T5X A;  3F6V A;  2H09 A;  5TJJ A;  2X0L A;  1QZY A;  5K5Q A;  3GZ6 A;  1FBQ A;  2NNN A;  2HGC A;  1MDM B;  3T1B A;  2A6H F;  2J5O A;  4E70 A;  1MD0 A;  2ZKZ A;  3GUD A;  1FY7 A;  3TOA A;  4EJT A;  4RB3 C;  5LHG A;  2HKX A;  5LEJ A;  3KZY A;  3SZP A;  4P9F A;  4LB6 B;  4LMY A;  1TQI A;  4I09 A;  3MZY A;  5KVR A;  1YYV A;  2EV6 A;  4CZZ A;  3F8F A;  3HSF A;  4TV7 A;  3LQR A;  3KP6 A;  4OIN F;  3P9C A;  2VXZ A;  1BC8 C;  3WTW C;  4EJW A;  4QWQ A;  5HVQ C;  2YPR A;  2VE9 A;  2ZFW A;  4L0Y B;  4L5J A;  4A0Y A;  4M9Z A;  1R1T A;  1L0O C;  4N9H A;  4ZH4 F;  2D1H A;  3WGH A;  2J5P A;  2QZ8 A;  1QO0 D;  5DCM B;  5D4S A;  3WTZ A;  5ERI A;  2ESN A;  2YR2 A;  1MJ9 A;  2K4B A;  2PQ8 A;  2FNA A;  3VOD A;  1RZ4 A;  1NHA A;  1HBX G;  5EEG A;  1T39 A;  2IP2 A;  3BWG A;  2CSO A;  2FEZ A;  5JI6 A;  1FZP B;  2WC2 A;  2PEX A;  3ZP5 A;  3HHG A;  1Z91 A;  3EQL F;  4RB0 A;  3PQJ A;  2VC1 A;  3FXQ A;  4NQW A;  3P9I A;  5LRS A;  3BY6 A;  2EV5 A;  3HRM A;  1ONV A;  1ODD A;  5DV5 A;  5AIQ A;  4EJV A;  4IRI A;  3TOB A;  3FMS A;  3SZT A;  2ACJ A;  1ON1 A;  3V7S A;  4KYW A;  3KP2 A;  4YFX F;  1IZ1 A;  3L7W A;  1XCV A;  3GFL A;  1G3W A;  5HLG A;  2NAZ A;  1TW3 A;  1HXD A;  4BH9 A;  1HKS A;  4KDP A;  1BM9 A;  2H27 A;  4L5I A;  1J9I A;  1ZG5 A;  2QQB A;  3MWM A;  3TO7 A;  1OR7 A;  2OQG A;  2MC3 A;  3PFI A;  1W7P A;  1OYW A;  4PGG A;  2RV8 A;  5L3E A;  1P4A A;  4BXU A;  4MEX F;  3R0J A;  1RNL A;  2Z5U A;  1KQ9 A;  3V8J A;  3RKW A;  4FX4 A;  4HYE A;  4HQE A;  2JPB A;  1LEB A;  1OMI A;  4OIO F;  1UFM A;  3ZMZ A;  3BOQ A;  1O3S A;  4EMS A;  2R7D A;  1BJA A;  3JTH A;  5J8F A;  1S6L A;  4RGU A;  3KZZ A;  3HOS A;  1MZB A;  4L18 B;  5D5X B;  1FBU A;  2QQA A;  2PJP A;  2HTS A;  1G3T A;  1AWC A;  4AIK A;  3RPU A;  1STZ A;  2XRO A;  2ZME A;  2F5E A;  4HDV A;  1B6A A;  5ICG A;  3J81 K;  1SD4 A;  4XRF A;  4AIJ A;  3HHH A;  1FWZ A;  1T2K A;  2FF4 A;  3IRR A;  1FP2 A;  2LKP A;  2ADU A;  1R5H A;  5E18 F;  4YFN F;  2IVM A;  4XBF A;  5E17 F;  4KIF A;  3MCZ A;  3KEQ A;  2H6C A;  4BHB A;  3HIF A;  2A5Y B;  4ETS A;  4Q5S F;  2STW A;  5BQT A;  3G73 A;  3WG9 A;  4HA8 A;  4PZJ A;  3WTY C;  5BPD A;  1T38 A;  4N9I A;  5LGU A;  2GWR A;  2W85 A;  2V1X A;  4P5O A;  1WSU A;  5LGN A;  1KU3 A;  1EH6 A;  3RYR A;  1LDJ A;  2AS5 F;  1T0F A;  4L9N A;  3L2C A;  2ZXJ A;  4EGZ A;  4G94 A;  1DPR A;  4BNC A;  3JAM Z;  3GEZ A;  1MJB A;  3K0L A;  2A69 F;  1RI7 A;  1AOY A;  3F8N A;  3FHZ A;  4ZZL A;  4RAZ A;  4IHT A;  1SFU A;  2GQQ A;  1U2W A;  2P7C B;  3CDH A;  1V4R A;  2VBW A;  3HTS B;  1SD5 A;  1USS A;  2RVC A;  2L4M A;  4BAY A;  1R58 A;  4A2U A;  4OU0 A;  4I98 B;  3BJ6 A;  3E97 A;  4AWX B;  2FE3 A;  2G7H A;  2EFP A;  1YQA A;  1E17 A;  3DFG A;  3E5X A;  1RUN A;  1R22 A;  2OBP A;  3DPT A;  3VFZ A;  4JQF A;  1D8J A;  3I59 B;  5LGT A;  1Z05 A;  2P5L C;  4EJO A;  2HYG D;  2FML A;  2QBY B;  1ZRC A;  2BBY A;  5FD6 A;  1QZZ A;  3CUQ B;  1BN5 A;  5F64 A;  5FO5 A;  2OD5 A;  3ZN1 A;  2UZK A;  1XGN A;  3R61 A;  2P4W A;  1UB9 A;  4LLL A;  1H9G A;  1KU7 A;  3HRT A;  2Q0O A;  1VTN C;  2CFX A;  4ESB A;  2IPQ X;  2EV0 A;  3FMR A;  2GXG A;  3FMQ A;  4M9S A;  4LG0 A;  3I53 A;  4KMU X;  4G8X A;  2DT5 A;  2Q2E A;  1A04 A;  1FOK A;  4GYG A;  4B8X A;  2R7F A;  1K7A A;  3WE3 A;  4ZYE A;  1FC3 A;  4HAM A;  4EV0 A;  5DDG A;  2RN7 A;  1MKM A;  4GCV A;  3V7C A;  2XAQ A;  2A61 A;  3WTS C;  4HLY A;  2K02 A;  4YIF A;  5LHI A;  1H0M A;  5EEH A;  3WGI A;  3KP4 A;  2GZW A;  2ZNZ A;  1PDN C;  3CUO A;  3SXY A;  4D0P A;  4O6J A;  2F2E A;  1QBJ A;  1YW8 A;  1ZYR F;  4OIR F;  1LEA A;  1UST A;  2C6Y A;  4Y17 A;  3NRV A;  2YSR A;  1XN7 A;  2O0Y A;  3TQN A;  5H20 A;  1KYW A;  5DCF A;  2XVC A;  3K1M A;  4A12 A;  4XLP F;  3E3V A;  3H3U A;  1YS6 A;  5JVT A;  1F1Z A;  5J8C A;  1EV7 A;  3RKX A;  4LGW A;  2IRF G;  3KP3 A;  2ISZ A;  3CUQ A;  2A3S A;  3C7J A;  2DW4 A;  4CDG A;  3WTV C;  2L4A A;  3EYI A;  2O61 A;  1LQ1 A;  2Z3Y A;  1JE8 A;  2BYV E;  3ZMU A;  2L01 A;  1CF7 A;  5FFZ A;  5AON A;  1OKR A;  3B73 A;  1MDM A;  3TDU C;  3F8C A;  4G7H F;  2ZME B;  2HQR A;  2ISY A;  5HDG A;  3SFZ A;  1BBY A;  5L3B A;  1IN7 A;  2LF8 A;  3FM3 A;  3K1N A;  1EH7 A;  3WGG A;  1HW1 A;  4M74 A;  2VT3 A;  1I5Z A;  5L3G A;  2STT A;  2NYX A;  3OV8 A;  3HUG A;  1PP8 F;  4L9J A;  4ENJ A;  5CVV A;  3GF2 A;  4OIP F;  3GW2 A;  2G7U A;  3K69 A;  2DPD A;  1XDU A;  2LSO A;  5HLI A;  2QUF A;  2ZCW A;  1QNT A;  3N4M A;  4UV8 A;  1JHF A;  4ESJ A;  2L3D A;  3QPH A;  1Z7U A;  3ZPL A;  3ABT A;  1O3R A;  1J7K A;  3LA7 A;  2VOO A;  2ZO4 A;  4KMF A;  1FLI A;  1SFX A;  4ZZD A;  3RI4 A;  1J75 A;  4MNU A;  4P55 A;  2BGC A;  3ZMD A;  5HS7 A;  5BS6 A;  5CLS A;  4P9U A;  3AAF A;  3IKT A;  3GXO A;  3KCC A;  3DV8 A;  5ILV A;  2P5K A;  1S7A A;  2ELH A;  1S29 A;  1UHW A;  2NRA C;  2OZU A;  4KUM A;  3GLX A;  2HQN A;  2HWV A;  4EJU A;  5CVI A;  2HFH A;  1RUO A;  3M8E A;  1P4X A;  3WTU C;  1ZAO A;  2WWY A;  3DXJ F;  2VOD A;  1Q1H A;  2GA1 A;  2XAG A;  2EB7 A;  1HW2 A;  4HDU A;  2MBF A;  1XSV A;  1R5G A;  2XAS A;  1GHC A;  1Z9C A;  2W25 A;  3QU6 A;  1XGS A;  3WTX C;  3BRO A;  2P5V A;  5DD4 A;  3CJN A;  1K79 A;  3L9F A;  1WWX A;  1Z6R A;  2CYY A;  4FHT A;  5FFX A;  2F5D A;  2MLG A;  5ED4 A;  3IWZ A;  1BOA A;  2P6T A;  4YII A;  2M30 A;  2HEO A;  1FT9 A;  2OA4 A;  5L3C A;  2O8X A;  3BP8 A;  2E1C A;  3JTG A;  3KFW X;  4M72 A;  4GO1 A;  3LWF A;  3GX4 X;  5F6F A;  1OPC A;  3F72 A;  4OMY A;  3G3Z A;  2EFN A;  1J59 A;  1BIA A;  2EA2 A;  5JHU A;  3HSR A;  5LBQ A;  3M9A A;  4KN7 X;  1Z6T A;  3KET A;  4I02 A;  5E8G A;  4ENM A;  3LQQ A;  2CO5 A;  2V6C A;  1XDS A;  3DKW A;  5BOX A;  2F5C A;  1ZN2 A;  1R00 A;  5A2Q Z;  1IUY A;  2CG4 A;  4MTD A;  5CJ9 A;  4G6Q A;  3LA3 A;  4M9X A;  2EFQ A;  1LJ9 A;  2K86 A;  3I58 A;  4UV9 A;  1CGP A;  3FF5 A;  4KIC A;  4A6D A;  2B0L A;  3IC7 A;  3BJA A;  4QLC U;  1PP7 U;  3E6C C;  2KIM A;  1ZLJ A;  3FXR A;  3LST A;  2P7V B;  5BMZ A;  3ABU A;  4WWC A;  4OIQ F;  3R6S A;  2FNP A;  4WXC A;  1P92 A;  4LB5 A;  3SHF A;  4LK0 F;  2IT0 A;  2FBH A;  4KIG A;  4LLG F;  5CVR A;  4MTE A;  5HOO A;  4KNY A;  1FBS A;  1I6X A;  4ENN A;  1ZRE A;  2V1U A;  3U1D A;  3TGN A;  3VOE A;  2FA5 A;  3M8F A;  1K78 A;  4M6Y A;  1HKQ A;  1IF1 A;  4NB5 A;  1FPQ A;  5KK1 A;  3IWF A;  1ZLK A;  4MEY F;  2K4J A;  2JSC A;  1HKT A;  4CO8 A;  1SD7 A;  2Y75 A;  4IHS A;  4LG0 B;  1LNW A;  4DQ2 A;  2DBB A;  4HF0 A;  4WX9 A;  5A2Q K;  3CUQ C;  5ILU A;  2KKO A;  1R1V A;  4ZYD A;  2RC4 A;  2K7L A;  2V1D A;  4PGH A;  1O7F A;  1OYY A;  3ELK A;  1J2X A;  5DUK A;  2CWE A;  4WXH A;  4WXD A;  1U5T A;  2DU9 A;  5E1Z B;  3OOP A;  2UXX A;  1E2X A;  1ZRF A;  2QYO A;  2XV4 S;  2ZBK A;  4Q48 A;  2XRN A;  5TRD A;  3PQK A;  2E1N A;  2VBZ A;  2EWN A;  4OOI A;  1K6O A;  1QGP A;  3HTU A;  3RPQ A;  5D8L B;  4IRG A;  2FBK A;  1TNT A;  1YW9 A;  3QPT A;  1O3T A;  1WKM A;  1XB4 A;  1YO5 C;  5IT3 A;  4RB2 C;  4AD9 A;  2ESH A;  3LAP A;  1P2F A;  4RGR A;  2XHK A;  2BEO A;  2DQR A;  1S8N A;  3R4K A;  3F3X A;  1YFH A;  3J80 Z;  3EUH A;  2P6S A;  1IXR C;  2FQ3 A;  1YIO A;  5ICE A;  1BI3 A;  1R7J A;  4UVA A;  5HS8 A;  3I54 A;  3QP6 A;  1T98 A;  3L09 A;  4Q47 A;  3GVA A;  3LAJ A;  1IRF A;  3H3Z A;  2PMH A;  4ESF A;  4RGS A;  2XKO A;  3DPL C;  1DUX C;  3JAM K;  1B4A A;  2QVO A;  4EQQ A;  3KP7 A;  3RKY A;  4O3M A;  3ECO A;  3EDP A;  4F7Z A;  5D5U B;  4U7D A;  4XSX F;  1IN5 A;  5DEQ A;  2HTJ A;  2DLL A;  4JK1 X;  3QAH A;  1LDK B;  1ZH5 A;  3WOD F;  1YW7 A;  2Z9O A;  2ZJ2 A;  4GXO A;  3V8K A;  2WV0 A;  4LJZ F;  4EM2 A;  3LA2 A;  3K9T A;  1FSH A;  4U7B A;  4PCQ A;  2D2W A;  2XGX A;  3K1P A;  2CGP A;  2KJB A;  4Y15 A;  5DD8 A;  2VE8 A;  4U0V A;  5DUI A;  3KLO A; 
#chains in the Genus database with same CATH topology
 2TDX A;  5BPI A;  3FM5 A;  4UVB A;  1GXP A;  3GFI A;  2M5W A;  5GAD J;  4MQ9 F;  5ICC A;  4U88 A;  2HR3 A;  3BPV A;  2W00 A;  1PYV A;  1DGR M;  2XKP A;  3OSF A;  2FXA A;  1FEX A;  3P5J A;  2DYS H;  3OYH A;  1FSE A;  1SVL A;  2RGV A;  2PBI A;  3S2W A;  4WCG A;  3IHU A;  3QYB A;  4LD5 A;  3CCS I;  4DOZ A;  2QEX I;  2OAZ A;  5B1B H;  1TTY A;  2OTL I;  2HQA A;  1FP1 D;  2ZSI B;  2QLZ A;  3HRU A;  1ZR4 A;  2WAF A;  1YRN A;  3FBN B;  2BXZ A;  1X1P A;  2VQC A;  2MD5 A;  3KX2 A;  3Q9V A;  4HRI A;  3ZQ7 A;  2EIN H;  2ECC A;  1KQ8 A;  2VBY A;  1MNE A;  5HS9 A;  1KQ0 A;  3BPX A;  2O03 A;  3ZMS A;  1WJF A;  1CF7 B;  4UY8 I;  2LBF A;  1DU0 A;  1FYM A;  3U2R A;  1MSF C;  2GLO A;  2JQ7 A;  2X6Y A;  2YX4 A;  3H9Q A;  2DYR H;  2P8T A;  3LSJ A;  3CCL I;  4G9Y A;  3CJT B;  2FQ4 A;  3TP3 A;  4F92 B;  1JHH A;  4Q4Z F;  1JKR C;  1G8X A;  1FNN A;  3WE2 A;  5D4R A;  2EIK H;  3TL4 X;  4I0A A;  1U8R A;  1F36 A;  3C2G A;  5KAI C;  3WU1 B;  4CGZ A;  4ENK A;  1PUF A;  4D5F A;  2O7O A;  1DU6 A;  4HNT A;  3OYM A;  2DFI A;  2R92 J;  4M71 A;  4BXX J;  5L3F A;  2WB1 A;  2ELK A;  3RJP A;  1Z1D A;  1P4W A;  2W57 A;  4UNO A;  3TW6 A;  1MND A;  1O3Q A;  2KT0 A;  2M45 A;  2F48 A;  3HPH A;  3HEF A;  1SEU A;  2QEN A;  4F52 A;  1XPX A;  2NVY J;  2Y0S N;  2HS5 A;  1FOW A;  4AVP A;  3J7Y J;  4CCK A;  3MFK A;  3BR1 A;  1P9Q C;  1W7P B;  1ZAR A;  4A5M A;  4ZYH A;  3BLY A;  5J4V A;  2UXN A;  3SJM A;  2DCE A;  1EA3 A;  3M1E A;  4PJL A;  3A2K A;  2K9S A;  1VQ8 I;  4HQM A;  4ZTJ A;  2AXT C;  2RQP A;  2V9V A;  1XMA A;  2YU3 A;  2VQG A;  2V9K A;  3LFK A;  2PMZ A;  4H0E A;  1YX5 A;  1ZG3 A;  3JSO A;  4A3E J;  4IPA A;  1I6H J;  4Y52 J;  4RS8 A;  1FYL A;  1JUS A;  3H36 A;  3W6K B;  2M87 A;  2BE5 F;  4A3M J;  4XNF A;  3KLN A;  2MD0 A;  4X1E A;  4ON0 A;  1YTY A;  3IRQ A;  5E1W A;  3RCO A;  1IXS B;  1R1U A;  3HSE A;  2BY0 A;  4HBL A;  3HYI A;  4UUT A;  3Q5F A;  2JUG A;  2E7X A;  4HLX A;  5EG0 B;  5M5Y J;  5L3D A;  4D1Q A;  2DPU A;  1D3Y A;  1O7L A;  3I3L A;  2Y48 A;  5M3M J;  2FBI A;  1U5T B;  3FZV A;  3FBI B;  3G71 I;  2EZL A;  1I1G A;  2V26 A;  3BR6 A;  3K4C A;  2HVQ A;  3MVP A;  1REP C;  1IRZ A;  4A3D J;  1V3F A;  2QQ9 A;  2M8E A;  4KN4 X;  4GYI A;  4GGG A;  4C3I J;  1RRJ A;  4I6Z A;  1T8I A;  2HOE A;  2IGN A;  2PX9 A;  4U0Y A;  1HOM A;  2DFE A;  2MC4 A;  3E7L A;  4DW6 A;  4A5N A;  4R1H A;  1G3Y A;  3GTG J;  1U9O A;  3PIP F;  2GOM A;  5FRO A;  2IS2 A;  1I3Q J;  3ESW B;  3WU0 A;  1PUF B;  1S7O A;  3ZRG A;  5LRR A;  1TNS A;  3R0A A;  1LVK A;  1YIJ I;  2BV6 A;  1D1B A;  3I59 A;  5CQG A;  5JFR A;  2L5Q A;  3OL3 A;  1RIO H;  2QKL B;  4EVI A;  2RNJ A;  5K5O A;  4K2E A;  2O6G E;  3F8M A;  4G7O F;  4ASN A;  3KP5 A;  5D5W B;  4HX8 A;  3OSG A;  2JVG A;  1TW2 A;  6PAX A;  3J7A O;  1VFC A;  2UV1 A;  4B3A A;  2ME0 A;  2MFZ A;  4BQN A;  2R7U A;  4YRV A;  1XSD A;  2EJR A;  2Q8K A;  1HLV A;  5D8K B;  4RAG A;  1YJN I;  2AQE A;  2X4H A;  2L7Z A;  3U9G A;  3O8H A;  1Y0U A;  3MKL A;  3Q0W A;  5GAH J;  4HF1 A;  2X85 A;  3ISP A;  1B9N A;  3ROU A;  2Y0M A;  5DM7 F;  1U8B A;  3QOD A;  2JMW A;  2EPF A;  2CUZ A;  1ZGW A;  1UMQ A;  3E5Q A;  1QZE A;  3PNY A;  4RLQ A;  1U6G A;  4B1R A;  5J4Y A;  5EF6 A;  5F1R A;  4KT6 A;  4XID A;  2F5F A;  3ULQ B;  3JRF A;  4L0Z B;  2IA2 A;  3IAS 2;  3TDZ C;  5J47 A;  3BTJ A;  3M7G A;  3V42 A;  2E2I J;  4B47 A;  2RDP A;  3F6O A;  4A0X A;  1ITY A;  2R7W A;  2DA4 A;  3KEO A;  3H9J A;  5EJC A;  1B9M A;  2ME6 A;  2DA7 A;  2A6E F;  1KGS A;  1H88 C;  1ZRD A;  1TBX A;  2DK8 A;  1UJ8 A;  3BR2 A;  1TLH B;  1WJE A;  2GIV A;  3T8R A;  1IW7 F;  2QKM B;  3FKI J;  4FX0 A;  1X1A A;  5EG0 A;  2JRT A;  1YG2 A;  1IAW A;  3E6M A;  3UR3 C;  2XAJ A;  4RAY A;  3ZMT A;  5GP9 A;  4UUS A;  3J80 K;  5KAF C;  1XGO A;  2ZME C;  4LFU A;  4EM1 A;  2D45 A;  5GPA A;  4KFC A;  1NK2 P;  3QP5 A;  1WRJ A;  3FDY A;  3CQZ J;  1WPK A;  1Y1W J;  3BQZ A;  2DDB A;  3GZ5 A;  5LFA A;  1MJA A;  4Y13 A;  1R49 A;  2VC0 A;  4UUV A;  2W82 A;  3EYY A;  3ZN0 A;  3G1L A;  4NUB A;  1A36 A;  4PDK A;  3L2U A;  3LMM A;  2GIZ A;  4X0G A;  2L02 A;  3V7R A;  3ECH A;  3IH2 A;  5FGM A;  2M7A A;  2DA2 A;  4RLF A;  4BYY A;  3GYH X;  3A01 A;  3I71 A;  3GO5 A;  3GTJ J;  2HXI A;  2M4K A;  4S04 A;  4CIC A;  2H94 A;  2ZXW H;  1GV5 A;  2KIQ A;  4FET A;  4XN3 A;  5K1Y A;  2YX7 A;  1NTC A;  3EUH C;  1WJ5 A;  2LDU A;  1XCB A;  4FTH A;  4QTR A;  4BHP A;  2NNY A;  4I01 A;  2E1O A;  4XLF A;  1BI0 A;  1SC7 A;  2EK5 A;  1MBJ A;  3BTI A;  1IDY A;  1YJW I;  3S8P A;  1WJD A;  2QWW A;  1P6R A;  2K85 A;  1I1S A;  1LPQ A;  5CYV A;  1SAX A;  3CTA A;  2M0C A;  3BC8 A;  2MLK A;  3E5U A;  4I2O A;  2BY2 A;  2ETH A;  5H6R A;  1W36 C;  2OUM A;  3RYP A;  3HOW J;  2V79 A;  1X3Z B;  4N0B A;  3QOP A;  5EYR A;  4A69 C;  1X3W B;  4CUG A;  1A5J A;  2KZV A;  2XF7 A;  4IOC F;  3ZQL A;  5J6X A;  4ZYG A;  1S5L C;  1ULY A;  1QHG A;  4GFB A;  4KIB A;  4PJM A;  4C2T A;  2MSY A;  4JYK A;  1OCC H;  1IDZ A;  2HDC A;  2XPW A;  3HOU J;  3VB2 A;  1BJZ A;  2VT2 A;  3PIO F;  4OAY A;  3S3N A;  5FKK A;  1G4D A;  2FRH A;  2RQQ A;  1TWC J;  2IS6 A;  4O5V A;  5FD5 A;  2DAO A;  1D5V A;  2DO7 A;  4NC6 A;  2HNH A;  1KYZ A;  2W4S A;  1IG7 A;  2XDV A;  5E3O A;  3MZH A;  3REO A;  3HBL A;  4XOT A;  1QPM A;  2Z1D A;  1HF0 A;  4XMY A;  2X6O A;  4JBA A;  3LSI A;  3ZQI A;  2IA1 A;  3WHC A;  4RB1 A;  1W5S A;  2A68 F;  1W5C C;  3K10 A;  3HXL A;  3RQ4 A;  3F8B A;  3QPS A;  4R79 A;  4R8H A;  1XTA A;  2PN6 A;  1DP7 P;  4A0Z A;  2ICW G;  2WB1 N;  3F22 A;  1TQM A;  5EZH A;  4OAZ A;  4IL6 C;  5AIP A;  3N97 A;  4HF2 A;  1MH3 A;  3ZMV A;  2OU2 A;  1F5T A;  4MLO A;  4BE0 A;  1MMS A;  1UAA A;  4BL0 B;  1XSX A;  4FIS A;  2IA0 A;  2HKO A;  1U3E M;  3DPU A;  1SFE A;  4BQQ A;  1X3U A;  5E8I A;  1F4K A;  1HDP A;  4N4N B;  4PJ0 C;  2AHQ A;  2VKD A;  3FXL A;  3L2V A;  4XLC A;  3MAJ A;  3HL2 A;  1ETW A;  1W5T A;  2HXO A;  2MH2 A;  2VB6 A;  4IRH A;  3RIR A;  4B48 A;  3ERE D;  2L9N A;  2VOP A;  2K9Q A;  2FU4 A;  1B1B A;  1VF9 A;  2VKH A;  2OCE A;  2VJI A;  1W4M A;  4IHY A;  3HOT A;  3K70 C;  2NOJ B;  1TL8 A;  2GM4 A;  3AL0 B;  1F43 A;  1X1C A;  1U78 A;  3F21 A;  1NG7 A;  2EFW A;  4CXF A;  5K7H A;  1ZK8 A;  4CYD A;  3RTR A;  4IF4 A;  4MIM A;  2HYF A;  2MAB A;  5DYM A;  4RA2 A;  2DQL A;  2E1M C;  3DF8 A;  5LHH A;  1VQO I;  2W24 A;  1SMY F;  2CW8 A;  5CPR B;  1G3S A;  4XL9 A;  2CW7 A;  1KU2 A;  2KIU A;  3IL2 A;  2DXI A;  2ZNY A;  5GAE J;  4Y7N J;  4BEH B;  2XC7 A;  5KNL A;  1EJ9 A;  1UHM A;  3E0J B;  4WF2 A;  3FX3 A;  1F9N A;  2LY1 A;  3C1D A;  2JT1 A;  2CQK A;  2F4M B;  3LSP A;  3JRD A;  1MW7 A;  1T08 B;  4RM2 A;  3KYL A;  1JUP A;  3ONQ A;  3D1N I;  3DEU A;  4PSX A;  2FSW A;  1YJ9 I;  4HW0 A;  5H6Q A;  3TED A;  4KT5 C;  2QBY A;  2JA2 A;  2VPR A;  1GLN A;  2AO9 A;  3G4S I;  1IN6 A;  1JKQ C;  3DBH B;  1IRG A;  3W6J B;  3BZC A;  1VQM I;  1LKX A;  2DJN A;  2K3P A;  2L2O A;  2LP0 A;  5FLX K;  3EET A;  2CV0 A;  2AQF A;  3OL4 A;  3B02 A;  1DGW Y;  1MBF A;  4IXA A;  1B59 A;  4D7M A;  2XUB A;  2CQN A;  3HRS A;  1VQ9 I;  2G9W A;  5ILS A;  3I0T A;  3JRA A;  4IO9 F;  3ZGK A;  3LFU A;  2ZB9 A;  5IT9 K;  4PFP A;  1D0Z A;  1U5T C;  1J09 A;  1ETV A;  2NS7 A;  1I27 A;  3PUB A;  3W3C A;  5HDK A;  4LK1 F;  3OYN A;  2X51 A;  3K2Z A;  3OIP A;  3GFM A;  2OPT A;  4M6X A;  1ZQ3 P;  2R5Z B;  4M3F A;  3JSP A;  4RBO A;  3HGG A;  2CRG A;  4IEJ A;  2Q2E B;  2Q1Z B;  2JTV A;  4L9V A;  2PLY A;  3O6B B;  1HSJ A;  1J5Y A;  4E6K G;  3F9K A;  3P7N A;  5K5R A;  3PUF A;  3HUG B;  2KIF A;  4RMN A;  5E1X A;  3TKY A;  5LEK A;  3DQV C;  2LG4 A;  4IVN A;  2UWM A;  3NWT A;  4BDY A;  4WK8 F;  1WQ2 A;  1AA7 A;  2JSP A;  2PFB A;  4BHC A;  4NHJ A;  3ABL H;  3BJO A;  1WHU A;  5BNG A;  2OV7 A;  2L54 A;  1V5F A;  3GFJ A;  2FOK A;  3UNG C;  5CKT A;  1D8K A;  4G6D A;  2M8G X;  1GT0 C;  1GXQ A;  5HLH A;  1YS7 A;  5HOD A;  4MQV A;  4A6E A;  2XIG A;  1W0T A;  1WI9 A;  2GA2 A;  1JTY A;  4F3Q A;  3TO9 A;  4J00 A;  1YHQ I;  1QVU A;  4I7H A;  5EDN A;  1XMK A;  2I10 A;  4B09 A;  1D0X A;  1HW5 A;  2PG4 A;  2PI0 A;  1LDD A;  2IW5 A;  3IV5 A;  3P9K A;  4AVZ A;  1VQK I;  2HDW A;  1BR2 A;  2NS0 A;  3O3K A;  3S16 J;  1U9N A;  2CW0 F;  4IQ4 A;  3TP0 A;  3GTL J;  3E1S A;  4AIH A;  1Y56 A;  1FYK A;  5D6E A;  1XGM A;  1ON2 A;  2HZT A;  3DP7 A;  3H5N A;  4OWR B;  3SYT A;  2H1L A;  3VEP A;  3VSK A;  3DU5 A;  1WFX A;  5CVJ A;  1IXC A;  5FLV A;  5B3S H;  3J7Z I;  4CA0 A;  4E7J A;  3I4N J;  2IGO A;  4FT8 A;  3PSF A;  4UXN A;  4CZC A;  4PFO A;  1W7P D;  3KYC B;  1T0F C;  5D5V B;  1JXS A;  1VQP I;  4XON A;  4UVC A;  2BHY A;  2XAF A;  3IH3 A;  1EH8 A;  2VON A;  3F23 A;  4F93 B;  4AID A;  3CLO A;  5GTI C;  5EEA A;  1Z21 A;  2R3S A;  4MHG A;  2MYS A;  2DK5 A;  2D5V A;  4XLH A;  3L1P A;  3C18 A;  2DDA A;  2EA4 A;  2BY1 A;  3G2B A;  4IHW A;  2EIJ H;  4NQW B;  4A3J J;  4BQO A;  2XGE A;  3CC2 I;  3MZ8 A;  4H4K C;  2JJ7 A;  2JPC A;  4NC7 A;  3U21 A;  3V4G A;  4HZF A;  1DDN A;  2PJR A;  2XGD A;  2X6W A;  4MGR A;  3ZQF A;  3CO6 C;  4KA4 A;  2EFO A;  4XLN F;  4BY1 J;  4IHX A;  1Z67 A;  5JLX A;  1E3O C;  1ZHF A;  3IP4 B;  4HV5 A;  4II3 A;  5F27 A;  3SZG A;  4HX7 A;  1JGG A;  4I99 C;  3ZQQ A;  1KU9 A;  2JA8 J;  2QF7 A;  2CS3 A;  5D6F A;  3I5U A;  2DTR A;  2Z33 A;  1HC8 A;  3TO6 A;  5J40 A;  1SMT A;  5JVG F;  1KON A;  2HYJ A;  4P96 A;  1FTZ A;  1RKT A;  3NWS A;  4JX4 A;  3CMA I;  4XRS G;  1KA8 A;  3GTO J;  2LVS A;  2E7W A;  2W1O A;  5EGO A;  2UUZ A;  3WU2 C;  5LD2 C;  3JW4 A;  2OJE D;  4ZYA A;  1ZEL A;  3C3W A;  4Z2Y A;  5C4X J;  5FB2 A;  2VQH A;  3Q3S A;  3LOC A;  1L3L A;  1GVJ A;  3R60 A;  3D5L A;  2X1D A;  3QYE A;  4HNV A;  4G7Z F;  1R36 A;  3S17 J;  2H6B A;  3IKV A;  1T95 A;  3MEX A;  1BI2 A;  4CCJ A;  3OS2 A;  4LLN A;  1LVA A;  4XM3 A;  3BDD A;  4FE7 A;  4HV6 A;  3TW7 A;  5GAG J;  3QRF F;  4CHU A;  1IN4 A;  1X1D A;  3K4M A;  1H9T A;  2JVH A;  2Z99 A;  1Z0X A;  1HST A;  3KYD B;  2FMY A;  2VLA A;  2XAH A;  2K27 A;  2KRF A;  3OYK A;  5E3M A;  1TP4 A;  2KJC A;  1FX7 A;  3I64 A;  2RKH A;  3CO7 C;  3COA C;  1RR7 A;  3FXU A;  4HX4 A;  1LB2 A;  1XC5 A;  1R23 A;  4Y3O A;  1UEL B;  1ZGJ A;  5FLX Z;  3CCM I;  5E3N A;  2MH9 A;  2JZY A;  2ZFU A;  3WTT C;  2A6T A;  1FMV A;  1GUU A;  2W84 A;  3MMY B;  3QQA A;  3I4P A;  3O2P E;  1LE8 A;  2E1M B;  4IQJ A;  1TQP A;  2OQR A;  2PMU A;  5H2F C;  5E20 A;  3T0Y A;  3HOY J;  3ML6 A;  1FIP A;  4M73 A;  2LC2 A;  3AG2 H;  3HC7 A;  2BY3 A;  2Y69 H;  2ZJR F;  4ZDP A;  1XS9 A;  2COM A;  3E6B A;  1BW6 A;  2AXL A;  1WJB A;  3E6D A;  5DCM A;  2BHZ A;  2VBX A;  3H92 A;  2TCT A;  3FXM A;  3FWE A;  3S2D J;  2HPI A;  1YOV B;  2FD5 A;  2HVS A;  5HDN A;  2LNB A;  3BCB A;  2ZC2 A;  3K4N A;  1JGS A;  4I76 A;  4LOC A;  2IJL A;  4D5C A;  1C0W A;  4L9T A;  3BZ6 A;  2VJ4 A;  4KIT B;  2WTE A;  1ZGA A;  4IJA A;  4IX7 A;  2VN2 A;  4XSZ F;  4NC8 A;  3DBL B;  3CCE I;  3CCY A;  1IN8 A;  3JRG A;  1OYI A;  3CC4 I;  1H8A C;  1WCM J;  3SQN A;  2XB0 X;  1YE9 A;  3NQO A;  1TWF J;  4YFK F;  5EGO B;  4A93 J;  1K61 A;  2HOA A;  4E7S A;  1W1W E;  5ICF A;  3T8T A;  1SD6 A;  1OCZ H;  4V2F A;  3ABM H;  2OCC H;  5CVU A;  2A07 F;  4HG2 A;  3QU3 A;  3Q9S A;  3CDL A;  3L00 A;  1G6N A;  1NH3 A;  1MSE C;  4KIS A;  4EGY A;  4A3F J;  3GTK J;  5JR3 A;  4BQA A;  2LH9 A;  1PUE E;  2QM3 A;  5LLQ A;  4BJ6 C;  2Y30 A;  3K4B A;  3B6A A;  1BR4 A;  3BG6 A;  2LOO A;  1Y8R B;  3MKY B;  4A3G J;  3V8L A;  1A35 A;  4UHT A;  1J0R A;  3LL7 A;  5TGT A;  2KPM A;  3M4O J;  1O57 A;  1BIB A;  2OZ6 A;  1T6S A;  2DI3 A;  2LF7 A;  1GDT A;  4CSW A;  2DT6 A;  3J81 Z;  4DBR A;  1KZH A;  2CUJ A;  4OMZ A;  1R4M B;  1HQC A;  2LRE A;  4DNC A;  2R0Q C;  1QQI A;  4YIR X;  3ZR8 X;  1S3J A;  2M1B A;  2XGC A;  2DTZ A;  4D7N A;  4IHV A;  3KE2 A;  4EM0 B;  2LR8 A;  3H9G A;  2XF5 A;  4U0W A;  1XD7 A;  4YG2 F;  4HOB A;  1G59 A;  1K78 B;  3RDI A;  2X48 A;  4BJ5 C;  2CV1 A;  3CP2 A;  3NEU A;  3HKZ A;  4V2G A;  2D1V A;  3AFH A;  2MA3 A;  3MQ0 A;  1BOB A;  1ERD A;  1SAU A;  1UCR A;  3K6G A;  3DLL F;  2VUM J;  2HI3 A;  3TBI A;  2GAU A;  1AU7 A;  2O3F A;  1BI1 A;  2B9S A;  1MMG A;  3GWZ A;  2GXB A;  2E2H J;  4I0B A;  5IT9 Z;  1MGT A;  1YLF A;  3WHB A;  1ZG1 A;  3DLA A;  3NAR A;  1DPU A;  1WJA A;  3CCU I;  5FKM A;  4RGX A;  2XRL A;  3D0S A;  1N25 A;  2BOL A;  1RC9 A;  4S05 A;  1BC7 C;  5GPC A;  3I4M J;  3T5X A;  3F6V A;  1MBE A;  3C2H A;  1T56 A;  4LIT A;  2H09 A;  5TJJ A;  2ZSH B;  2X0L A;  4CCM A;  1QZY A;  4YEL A;  5K5Q A;  3GZ6 A;  1FBQ A;  2NNN A;  4LIV A;  2HGC A;  1MDM B;  3FKJ A;  4MO7 A;  5IP6 A;  3QPL A;  3ZQH A;  4AYB A;  3T1B A;  2A6H F;  2J5O A;  1MD0 A;  2ZKZ A;  3GUD A;  4E70 A;  1FY7 A;  3TOA A;  4EJT A;  4RB3 C;  1DQU A;  4ZTF A;  3A1Y A;  5LHG A;  2HKX A;  5FKO A;  1FJL A;  3GCM A;  5LEJ A;  3KZY A;  3SZP A;  1D0Y A;  3VYT B;  4P9F A;  1FTT A;  4LB6 B;  4LMY A;  1TQI A;  1S72 I;  3PO2 J;  4I09 A;  2JK3 A;  3MZY A;  5KVR A;  2KLO A;  2MGQ A;  2A5W A;  1YYV A;  2EV6 A;  4B44 A;  4CZZ A;  3F8F A;  3FIS A;  1WJC A;  3HSF A;  3K7A J;  4TV7 A;  3LQR A;  2EZI A;  3KP6 A;  2VPL A;  4OIN F;  4D9J A;  3P9C A;  1OCT C;  2VXZ A;  1JJ8 C;  3A4C A;  1M1E B;  3OOU A;  2CJJ A;  2FX0 A;  3AL0 C;  2R7O A;  3VDX A;  3DTI A;  1BC8 C;  3WTW C;  2JA6 J;  4EJW A;  3HB9 A;  3OYC A;  4B3X A;  3TMO A;  2H8W A;  4QWQ A;  5HVQ C;  2YPR A;  2VE9 A;  2ZFW A;  3HOZ J;  4KJZ A;  4L0Y B;  3PNV A;  3K70 D;  3FIW A;  4L5J A;  4A0Y A;  4M9Z A;  1R1T A;  2DJI A;  1L0O C;  4N9H A;  2WAE A;  3CES A;  3D5S C;  2D1H A;  3BTC A;  2K9N A;  2J5P A;  2QZ8 A;  3WGH A;  1QO0 D;  4ZH4 F;  1X2M A;  3LSR A;  1YX3 A;  4HEA 2;  5DCM B;  5D4S A;  2I5U A;  3WTZ A;  2LRD A;  1NK3 P;  5ERI A;  4BBS J;  1K83 J;  2KDZ A;  2ESN A;  1SAN A;  2YR2 A;  4Y33 A;  1POG A;  1MJ9 A;  2K4B A;  1X58 A;  2PQ8 A;  2FNA A;  4XRM A;  5F1J A;  3VOD A;  1OR7 C;  1RZ4 A;  2OTJ I;  3DBR B;  1NHA A;  3M07 A;  1HBX G;  5EEG A;  1IGN A;  1T39 A;  2R4G A;  3CLQ A;  3FXK A;  2IP2 A;  4BJT A;  1ETX A;  2R5Y A;  3BWG A;  4BE2 A;  2KRC A;  3W2W A;  2K3F A;  2CSO A;  2FEZ A;  4BKX A;  2DMT A;  1S7E A;  5JI6 A;  1FZP B;  5DTD A;  2LTP A;  2WC2 A;  2PEX A;  5C4J J;  3ZP5 A;  1HA8 A;  2RRE A;  3HHG A;  1WI3 A;  1MH4 A;  1B8I B;  1Z91 A;  3EQL F;  4XKW A;  2R5Y B;  1UG2 A;  2B63 J;  2M7B A;  4M3D A;  4RB0 A;  3PQJ A;  4BU2 A;  1RR8 C;  2DA1 A;  3Q0U A;  1IJW C;  2VC1 A;  2VIX A;  3OYG A;  1X19 A;  3FXQ A;  4NQW A;  3P9I A;  5LRS A;  3BY6 A;  2EV5 A;  1JKO C;  2IGK A;  5F0F A;  3HRM A;  2R7Z J;  3OS0 A;  1ONV A;  4IKF A;  1ODD A;  1VI0 A;  3CJQ B;  5DV5 A;  5AIQ A;  4EJV A;  4IRI A;  5J1R A;  2L7F P;  3TOB A;  3BT9 A;  3FMS A;  3SZT A;  3L2R A;  3OYJ A;  2YU9 J;  1ETY A;  3CF5 F;  1ON1 A;  3V7S A;  2ACJ A;  4KYW A;  3KP2 A;  2V9P A;  1I3A A;  5E79 C;  4YFX F;  1G2H A;  5IP7 J;  4XIC A;  1IZ1 A;  2L9S A;  3B6C A;  3BR0 A;  3FXO A;  3L7W A;  1XCV A;  3H5R A;  3GFL A;  1W36 D;  1G3W A;  1MIJ A;  5HLG A;  3LSK A;  2CH0 A;  3CMM A;  3CD6 I;  2E71 A;  1TW3 A;  2NAZ A;  1HXD A;  2VQL A;  4BH9 A;  1HKS A;  3EUA A;  3IH4 A;  4HST A;  1BM9 A;  4E7Z A;  4W1U A;  2H27 A;  1X2N A;  2QSG X;  4L5I A;  3JRH A;  2L0K A;  4XLA A;  3G6E I;  4M6V A;  1J9I A;  2O9L A;  2KIS A;  1ZG5 A;  2QQB A;  3MWM A;  3TO7 A;  1OR7 A;  2QCO A;  4QSH A;  2OQG A;  2MC3 A;  1RPW A;  3PFI A;  5IOY A;  4U87 A;  1W7P A;  1OYW A;  4PJN A;  4PGG A;  2RV8 A;  4ZJZ A;  3DKX A;  3M1C A;  5L3E A;  1P4A A;  1AHD P;  4BXU A;  1PVE A;  2NVX J;  4MEX F;  2KRH A;  3R0J A;  1TWG J;  1V54 H;  2X6X A;  4E7I A;  3OYL A;  1RNL A;  3MKW B;  2Z5U A;  1ZTR A;  4RDU A;  1WH7 A;  3EUK L;  3FK7 A;  1KQ9 A;  4M3E A;  3V8J A;  3X2Q H;  3SEZ A;  4ABZ A;  1BW5 A;  3RKW A;  4S0H B;  2FUG 2;  4FX4 A;  1VQ7 I;  2CMP A;  4HYE A;  4BS9 A;  4HQE A;  2JPB A;  1LEB A;  1R5I D;  1OMI A;  4OIO F;  1UFM A;  3ZMZ A;  4CCO A;  3BOQ A;  3OYF A;  1O4X A;  2CUF A;  1O3S A;  4EMS A;  5IYB J;  1QPI A;  1XMX A;  2R7D A;  1BJA A;  2E60 A;  3JTH A;  5J8F A;  1S6L A;  1A6I A;  2DN0 A;  1ACI A;  4RGU A;  3I56 I;  3KZZ A;  1TC3 C;  2YS9 A;  3HOS A;  2N8G A;  2EH3 A;  2MG4 A;  5F0C A;  2QQ8 A;  2HOS A;  1VQL I;  3KEY A;  3OIQ A;  4C3H J;  2E5Z A;  1MZB A;  4L18 B;  2XSD C;  3CZ6 A;  5D5X B;  1FBU A;  3LSH A;  1K4T A;  2QQA A;  2PJP A;  3BZK A;  3ABK H;  2HTS A;  1G3T A;  2PJR B;  2R5Z A;  2CQX A;  1AWC A;  4AIK A;  2COB A;  1MBK A;  2EZH A;  3A01 B;  2QSH X;  3RPU A;  1STZ A;  2XRO A;  5B5E C;  2HZD A;  2ZME A;  2F5E A;  2WAD A;  4HDV A;  2L9R A;  1B6A A;  5ICG A;  3J81 K;  1SD4 A;  1QVT A;  4XRF A;  4AIJ A;  3JR9 A;  3HHH A;  3CCQ I;  1FWZ A;  2DMP A;  3N05 A;  4JX6 A;  4YEJ A;  5HNF A;  2VKV A;  2FF4 A;  2GOX B;  3IRR A;  1T2K A;  1MMA A;  3ASO H;  1FP2 A;  2LKP A;  2ADU A;  1R5H A;  2E35 A;  1I39 A;  2DA6 A;  3QYF A;  4NNJ A;  5E18 F;  4AYB N;  2V4J C;  4YFN F;  2R7T A;  1EKE A;  2IVM A;  3BR3 A;  4N4O B;  4XBF A;  4KDP A;  5GTH C;  3CMY A;  2CV2 A;  1RET A;  3AG1 H;  4BY7 J;  5E17 F;  2F5V A;  4KIF A;  3RSN A;  3MCZ A;  3KEQ A;  2H6C A;  4BHB A;  3HIF A;  2A5Y B;  3OR2 C;  4ETS A;  4Q5S F;  1K6Y A;  2STW A;  5BQT A;  4BBR J;  3G73 A;  4X6A J;  5IOZ A;  3WG9 A;  5KCM A;  2JUC A;  4HA8 A;  1JI8 A;  2X1C A;  4PZJ A;  4Y4R A;  2IEK A;  3HZJ A;  3WTY C;  5BPD A;  3G1M A;  2V6E A;  2HQ5 A;  1QRY A;  2DA3 A;  1T38 A;  2O5R A;  4N9I A;  5B1A H;  2QSF X;  5LGU A;  1D5Y A;  2GWR A;  2W85 A;  2V1X A;  4P5O A;  1WSU A;  1HCR A;  5LGN A;  2DMN A;  1KU3 A;  2RAE A;  3S15 J;  4G6T B;  4NDL A;  5J1Y A;  3S2H J;  1EH6 A;  1ENH A;  3A02 A;  3RYR A;  2FOW A;  4E7K A;  1LDJ A;  5KHD A;  2PMZ N;  2AS5 F;  2WBM A;  4NBQ A;  1LE8 B;  4II2 A;  1T0F A;  4L9N A;  5F0H A;  2JRM A;  2EZK A;  3DEE A;  2DOE A;  3L2C A;  5J3L A;  2ZJP F;  2ZXJ A;  5F08 A;  2M0M A;  5J1U A;  4EGZ A;  3CCJ I;  2F6C A;  2Y9Y A;  2HU9 A;  1DPR A;  4G94 A;  4BNC A;  3JAM Z;  3GEZ A;  1EF4 A;  4CYC B;  1MJB A;  2IGM A;  3K0L A;  2A69 F;  1RI7 A;  1AOY A;  3F8N A;  3FHZ A;  4ZZL A;  2KDO A;  4RAZ A;  4IHT A;  1SFU A;  4ZC3 A;  4ZDO A;  1FIA A;  2GQQ A;  1U2W A;  4BUP A;  2P7C B;  2LBF B;  3CDH A;  1V4R A;  3QWL A;  2VBW A;  3HTS B;  1SD5 A;  1USS A;  2BXY A;  3RZO J;  3RPU D;  1D1C A;  2RVC A;  3DKY A;  2L4M A;  3BG9 A;  3G1O A;  4BAY A;  4C2M J;  2ZJQ F;  1ZR2 A;  4GDF A;  3JRE A;  2CQ7 A;  1Z77 A;  3MKZ A;  1R58 A;  4A2U A;  4OU0 A;  4I98 B;  4DYR A;  3BJ6 A;  4A3L J;  3E97 A;  2NVU B;  3AG3 H;  4AWX B;  3OIO A;  1X4O A;  2VAS A;  2FE3 A;  2G7H A;  4AC0 A;  4G12 A;  2EFP A;  1YQA A;  5C44 J;  4MFD A;  1UZC A;  3DFG A;  1E17 A;  1U0J A;  2Z16 A;  3E5X A;  2ELJ A;  3RQI A;  3BTL A;  1RUN A;  1R22 A;  2OBP A;  4XOR A;  3DPT A;  1JT6 A;  3CME I;  1QU3 A;  1RKW A;  3VFZ A;  4JQF A;  1D8J A;  3I59 B;  1BR1 A;  2LLK A;  5LGT A;  1SFO J;  2BVL A;  3D5R C;  1OJL A;  1Z05 A;  2P5L C;  1TWH J;  2Y0S A;  4EJO A;  2HYG D;  1VQN I;  2FML A;  4XN0 A;  2QBY B;  2HDD A;  1ZRC A;  2BBY A;  3OYA A;  5FD6 A;  1QZZ A;  3CUQ B;  1BN5 A;  4FE4 A;  1Z7L A;  4JOM A;  5F64 A;  5FO5 A;  2E19 A;  3H0D A;  4JX5 A;  1Y39 A;  2OD5 A;  3S3M A;  2K40 A;  3ZN1 A;  2UZK A;  4M3G A;  1XGN A;  3R61 A;  2R7S A;  1ETO A;  1VQ6 I;  2P4W A;  1UB9 A;  1IV8 A;  4LLL A;  2EIM H;  3SDG A;  2H8R A;  1H9G A;  1KU7 A;  4ITV A;  3HRT A;  5M5X J;  3S1Q J;  2X9D A;  2Q0O A;  3OYB A;  2R7V A;  1VTN C;  2CFX A;  1ORK A;  4ESB A;  2IPQ X;  2EV0 A;  2XB5 A;  3S1N J;  1MMN A;  2KFD A;  3FMR A;  2GXG A;  3FMQ A;  4M9S A;  4LG0 A;  4CYC A;  3I53 A;  2VJ5 A;  4KMU X;  1B72 A;  4F91 B;  3U1K A;  1NG6 A;  3SFI A;  3OMY A;  3GZN B;  4G8X A;  2DT5 A;  4C30 A;  2Q2E A;  4BAC A;  1A04 A;  1MBG A;  1FOK A;  1IUF A;  1SFK A;  4GYG A;  4B8X A;  2R7F A;  1K7A A;  3WE3 A;  4ZYE A;  4E7H A;  4A3I J;  1SVO A;  1FC3 A;  3PFY A;  1DP3 A;  4HAM A;  4EV0 A;  2KZG A;  2RN7 A;  1MKM A;  5DDG A;  1A31 A;  2DA5 A;  3PSI A;  1ZKG A;  5FKL A;  1AKH B;  4GCV A;  3V7C A;  5M5W J;  2M34 A;  2XAQ A;  2A61 A;  1YI2 I;  3WTS C;  4HLY A;  2K02 A;  3J7A Y;  3BQY A;  1GV2 A;  4YIF A;  2XPU A;  5LHI A;  3FHN A;  3K4K A;  3IUO A;  2JA5 J;  1H0M A;  3W6V A;  5EEH A;  3WGI A;  3HOX J;  1MBH A;  1YRN B;  1YIT I;  1D1A A;  3ZQG A;  3IAM 2;  1B8I A;  3KP4 A;  2GZW A;  4ANJ A;  4DGW B;  2ZNZ A;  1PDN C;  4A3B J;  3CUO A;  1Y6I A;  3JCU C;  4XKV A;  4AU7 A;  4DZP A;  3HOV J;  1OCO H;  3SXY A;  4D0P A;  2DFH A;  1WGX A;  4O6J A;  2IS1 A;  3GBG A;  3L2Q A;  1R4N B;  2F2E A;  2TRT A;  3VPR A;  1QBJ A;  1YW8 A;  1ZYR F;  2QA4 I;  1LFB A;  5HNH A;  5M3F J;  4OIR F;  1LEA A;  1UST A;  4HPQ A;  1QHH D;  3CJR B;  2C6Y A;  4Y17 A;  3NRV A;  2YSR A;  3K4J A;  3BG3 A;  2M2E A;  1TWA J;  3ERM A;  2NS8 A;  1XN7 A;  1N78 A;  2O0Y A;  3TQN A;  4DYC A;  4PJJ A;  1Y1V J;  5H20 A;  3FK6 A;  3GME A;  1KYW A;  1I50 J;  3CCR I;  2GBY A;  4GRI A;  2NOG A;  5DCF A;  4A3C J;  2XVC A;  4B4C A;  2WA0 A;  3K1M A;  4A12 A;  4Z6Y A;  5IPA A;  5DM6 F;  4XLP F;  3NAU A;  3E3V A;  2NVT J;  2WAQ A;  3H3U A;  1YS6 A;  5JVT A;  3GTQ J;  1F1Z A;  4A3K J;  5J8C A;  1EV7 A;  3RKX A;  3DCF A;  4LGW A;  1APL C;  4M3B A;  2V7F A;  2IRF G;  3KP3 A;  2ISZ A;  3CUQ A;  3GLL A;  2A3S A;  4LG3 A;  1QA6 A;  3C7J A;  2DW4 A;  4CDG A;  3WTV C;  2L4A A;  3EYI A;  2O61 A;  1Q1V A;  1LQ1 A;  2Z3Y A;  4FAS D;  3H1C A;  3OR1 C;  2DFF A;  2KL4 A;  1JE8 A;  1LFP A;  4E7L A;  3ASN H;  1ETQ A;  2BYV E;  3ZMU A;  2L01 A;  1CF7 A;  5EZG A;  2BVM A;  4XOP A;  4IOA F;  2WY7 Q;  3QOE A;  5FFZ A;  5AON A;  2HOT A;  2O8K A;  1OKR A;  3B73 A;  2E34 A;  1MDM A;  4QIW N;  1VZ0 A;  4BE1 A;  3TDU C;  2VI6 A;  3F8C A;  4G7H F;  2ZME B;  4DZJ A;  2HQR A;  2LKX A;  2VXD A;  4BDZ A;  2ISY A;  2R93 J;  5HDG A;  1JKP C;  3SFZ A;  1BA5 A;  1BBY A;  5L3B A;  2DT7 B;  1IN7 A;  2LF8 A;  3FM3 A;  3KPH A;  3K1N A;  3HM5 A;  3PJR A;  3ZCO A;  1EH7 A;  3LSM A;  9ANT A;  1TT5 B;  3WGG A;  1S9H A;  1HW1 A;  2H1K A;  2E5N A;  4M74 A;  2VT3 A;  1I5Z A;  2LKS A;  5L3G A;  2STT A;  2NYX A;  1N77 A;  3OV8 A;  5E3L A;  3HUG A;  1PP8 F;  2KHM A;  3S93 A;  3ZOB A;  5DS9 A;  4L9J A;  4ENJ A;  5CVV A;  3HJE A;  3GF2 A;  4OIP F;  3GW2 A;  2W7N A;  2G7U A;  3K69 A;  5F04 A;  2DPD A;  4UB8 C;  1XDU A;  4C9Y A;  2LSO A;  5HLI A;  2JA7 J;  2QUF A;  1XX5 A;  4CCL A;  5JHF A;  2ZCW A;  1QNT A;  2YUS A;  3N4M A;  3EPZ A;  2M3A A;  2E36 A;  4UV8 A;  5FKN A;  1JHF A;  4ESJ A;  3JRC A;  2L3D A;  3HDD A;  3QPH A;  1FOX A;  1Z7U A;  2LY2 A;  3ZPL A;  1A6Q A;  2DMQ A;  3JRB A;  3ABT A;  1O3R A;  1J7K A;  1P7I A;  4PUS A;  3VYU B;  3L2W A;  3LA7 A;  3OYE A;  2VOO A;  2ZO4 A;  4KMF A;  3KIO A;  1FLI A;  4J01 A;  1SFX A;  4ZZD A;  3RI4 A;  1J75 A;  2R7X A;  2WAQ N;  4MNU A;  4P55 A;  4E4H A;  2BGC A;  3ZMD A;  2EIL H;  2X1E A;  1OLT A;  5HS7 A;  5BS6 A;  5CLS A;  4P9U A;  3AAF A;  3IKT A;  3GXO A;  3KCC A;  4CCN A;  3DV8 A;  3C2B A;  5ILV A;  2P5K A;  3M3Y J;  1VQ4 I;  2L7M P;  1S7A A;  2ELH A;  2KP6 A;  1S29 A;  1UHW A;  2NRA C;  2OZU A;  4KUM A;  3GLX A;  2HQN A;  2RNG A;  2NVQ J;  2NXN B;  2EQR A;  2HWV A;  2R7R A;  3GTM J;  4EJU A;  5CVI A;  4UUS B;  2HFH A;  1RUO A;  3M8E A;  1P4X A;  3RZD J;  4DJA A;  5K7F A;  3LSG A;  3WTU C;  1ZAO A;  2HVR A;  2ID3 A;  2WWY A;  3DXJ F;  2VOD A;  1Q1H A;  2GA1 A;  2XAG A;  4C3J J;  2EB7 A;  3DU6 A;  1HW2 A;  4HDU A;  3DEW A;  1TZL A;  2MBF A;  2CQQ A;  1XSV A;  2B7E A;  4DYQ A;  1R5G A;  2XAS A;  5IP9 J;  5K7Z A;  3VYR B;  1GHC A;  1Z9C A;  2W25 A;  3QU6 A;  1XGS A;  3WTX C;  1LFU P;  1E3P A;  3BRO A;  1H89 C;  2P5V A;  1T33 A;  5DD4 A;  4XLE A;  3CJN A;  1K79 A;  2Y9Z A;  1Z3X A;  1MMD A;  3L9F A;  4FCY A;  1WWX A;  5C3E J;  1Z6R A;  2CYY A;  1P7J A;  2I8D A;  2F4O B;  4FHT A;  5IY5 H;  2L9V A;  4RAF A;  3OY9 A;  5FFX A;  2F5D A;  2MLG A;  5ED4 A;  3IWZ A;  3S1R J;  1BOA A;  1MNM C;  4FQG A;  2P6T A;  4YII A;  2M30 A;  3OWT A;  2HEO A;  1OCP A;  3GTP J;  1FT9 A;  2OA4 A;  4XKC A;  5L3C A;  1V55 H;  1W0U A;  2O8X A;  3BP8 A;  2E1C A;  3JTG A;  3KFW X;  4M72 A;  4GO1 A;  4DIQ A;  2JWT A;  3LWF A;  3VSL A;  3GX4 X;  5F6F A;  1OPC A;  3F72 A;  4OMY A;  3M8J A;  2KMU A;  3G3Z A;  1R6R A;  2EFN A;  3VYS B;  2BW3 B;  1J59 A;  4LIU A;  1BIA A;  2EA2 A;  3CCV I;  2XPV A;  5JHU A;  3HSR A;  5LBQ A;  1Y0N A;  3M9A A;  4KN7 X;  1Z6T A;  3KET A;  4I02 A;  5E8G A;  2LY9 A;  4ENM A;  3LQQ A;  3W2V A;  2CO5 A;  2V6C A;  1XDS A;  3DKW A;  3H0G J;  5BOX A;  2LFB A;  4F55 A;  2F5C A;  1ZN2 A;  3UKG A;  2DOD A;  1E3H A;  4XKB A;  2JN6 A;  3CF2 A;  5TIS C;  4XK4 A;  3CP8 A;  1GVD A;  3KZI C;  1R00 A;  4C2U A;  3OYD A;  3A03 A;  3PM1 A;  4B43 A;  5A2Q Z;  1IUY A;  2CG4 A;  3ZXS A;  4MTD A;  5CJ9 A;  4G6Q A;  2VKE A;  3LA3 A;  2EFQ A;  4M9X A;  2LD5 A;  3S3O A;  4ZDL A;  4MFE A;  1PJR A;  1JT0 A;  4UB6 C;  2ZXH A;  1LJ9 A;  1RES A;  2K86 A;  3PL8 A;  3I58 A;  2XF6 A;  4UV9 A;  1CGP A;  3HG9 A;  1FMW A;  1B72 B;  3FF5 A;  4KIC A;  4PSW A;  4HSR A;  3WG7 H;  2XSJ C;  4A6D A;  4EEF G;  2B0L A;  3IC7 A;  4XR6 A;  3BJA A;  2WV1 A;  4QLC U;  1PP7 U;  4V19 K;  3E6C C;  2KIM A;  3MD2 A;  1ZLJ A;  2LK2 A;  3FXR A;  2P7V B;  3LST A;  5BMZ A;  2DOA A;  2IAI A;  2P0W A;  1UG0 A;  3BG5 A;  3ABU A;  4IZZ A;  4WWC A;  3W2A A;  2BZT A;  4OIQ F;  3R6S A;  2FNP A;  4RM3 A;  4WXC A;  1P92 A;  4LB5 A;  2Y31 A;  5FLM J;  3SHF A;  4LK0 F;  2LMD A;  2ZXI A;  2IT0 A;  2FBH A;  2Z2S B;  3H35 A;  1LUJ B;  4KIG A;  2E2J J;  4LLG F;  1BL0 A;  5CVR A;  4MTE A;  1VQ5 I;  2IBD A;  1OFC X;  5HOO A;  4KNY A;  1FBS A;  1I6X A;  1WZ2 A;  4ENN A;  1K4S A;  1ZRE A;  1UHS A;  2V1N A;  3AG4 H;  2V1U A;  3U1D A;  3TGN A;  3VOE A;  3RKQ A;  1IC8 A;  3A0B C;  4PK4 A;  2FA5 A;  3M8F A;  1K78 A;  2VJJ A;  4M6Y A;  1VND A;  4BEH A;  1HKQ A;  1IF1 A;  4NB5 A;  3PO3 J;  1FPQ A;  5KK1 A;  3IWF A;  1X4P A;  5IYC J;  1ZLK A;  2HPM A;  4MEY F;  1E0E A;  2K4J A;  2JSC A;  1HKT A;  4CO8 A;  3CC7 I;  1OIS A;  1SD7 A;  2Y75 A;  4CH7 A;  4IHS A;  1SVM A;  3K4L A;  4LG0 B;  2CFO A;  1LNW A;  3BCA A;  4DQ2 A;  3FXJ A;  2DBB A;  2M4G A;  5JLW A;  5FJ8 J;  2A05 A;  4HF0 A;  3A0H C;  4WX9 A;  2CU7 A;  4W97 A;  3S32 A;  2OF7 A;  2QGU A;  3CUQ C;  5ILU A;  2KKO A;  5A2Q K;  1R1V A;  4ZYD A;  3OYI A;  2RC4 A;  2K7L A;  1XG1 A;  2V1D A;  4PGH A;  1O7F A;  1OYY A;  3ELK A;  3F0C A;  1J2X A;  5DUK A;  4XRS A;  3MN2 A;  4P1W A;  2CWE A;  4WXH A;  1JJ6 C;  4WXD A;  1IRX A;  2VL8 A;  1CQT A;  1Y8Q B;  1X1B A;  1V5E A;  1U5T A;  1AKH A;  2DU9 A;  2K9L A;  3LNQ A;  5CQE A;  5E1Z B;  3OOP A;  2UXX A;  1E2X A;  4L5E A;  1ZRF A;  2QYO A;  5HLT A;  2XV4 S;  2ZBK A;  4Q48 A;  2XRN A;  3AKZ A;  5TRD A;  1OCR H;  3PQK A;  2E1N A;  1OQY A;  2VBZ A;  2EWN A;  4OOI A;  1Z3Y A;  1K6O A;  1QGP A;  3HTU A;  3RPQ A;  5D8L B;  2L7K A;  2KQR A;  4IRG A;  2FBK A;  3I55 I;  2MW8 A;  1TNT A;  1YW9 A;  2G0E A;  1JUM A;  3QPT A;  1O3T A;  4HNU A;  4BXF A;  1WKM A;  2Y2Z A;  1XB4 A;  5IT3 A;  3CDI A;  1YO5 C;  4RB2 C;  4AD9 A;  1JTX A;  2DOF A;  1V5G A;  2ESH A;  4J19 A;  2K5C A;  3LAP A;  1P2F A;  4RGR A;  1R71 A;  2LYC A;  2XHK A;  3H5A A;  1N75 A;  2BEO A;  2DQR A;  3BR5 A;  1S8N A;  2DMU A;  3R4K A;  4DBQ A;  2R7Q A;  4JP0 A;  3F3X A;  1YFH A;  3S14 J;  3J80 Z;  3DTK A;  3EUH A;  2K9M A;  2P6S A;  4QPO A;  1HDD C;  1IXR C;  2FQ3 A;  3BG7 A;  1YIO A;  5ICE A;  2IXS A;  1BI3 A;  3DWL E;  3H3V K;  3DTE A;  1R7J A;  2BW3 A;  4UVA A;  5HS8 A;  3I54 A;  3QP6 A;  1T98 A;  2ID6 A;  3L09 A;  3Q0V A;  4Q47 A;  3GVA A;  3K2A A;  3LAJ A;  1IV6 A;  1IRF A;  3H3Z A;  2PMH A;  4ESF A;  4RGS A;  2XKO A;  3DPL C;  1DUX C;  1R9T J;  3HPG A;  3JAM K;  2FJ1 A;  2WY8 Q;  1B4A A;  2IS4 A;  3SEQ A;  2QVO A;  4EQQ A;  3KP7 A;  3RKY A;  2W48 A;  4O3M A;  4QPQ A;  4XQF A;  3ECO A;  3EDP A;  5B66 C;  3HGY A;  3HKZ N;  4F7Z A;  3O8G A;  3S1M J;  5D5U B;  4U7D A;  4XSX F;  1IN5 A;  5DEQ A;  2HTJ A;  2CUE A;  3ZQC A;  2DLL A;  4BGD A;  4JK1 X;  3QAH A;  1LDK B;  1ZH5 A;  3WOD F;  1YW7 A;  3VWB A;  2Z9O A;  5FRN A;  2ZJ2 A;  3JRI A;  4GXO A;  2EBI A;  3I9V 2;  3V8K A;  1WH5 A;  4AM3 A;  2OC6 A;  1WVR A;  2WV0 A;  4LJZ F;  3PNT A;  4EM2 A;  2F4I A;  2M9H A;  3SDB A;  3LA2 A;  3OS1 A;  3K9T A;  2GXA A;  1FSH A;  1IO2 A;  4U7B A;  4PCQ A;  2D2W A;  5IYD J;  2XGX A;  3K1P A;  1TT0 A;  2P81 A;  2CGP A;  2KJB A;  4Y15 A;  5DD8 A;  1FOY A;  2VE8 A;  5FRM A;  4AUX A;  4U0V A;  4EAT A;  5DUI A;  1ETK A;  3KLO A;  2ECB A;  2XAU A; 
#chains in the Genus database with same CATH homology
 2TDX A;  5BPI A;  3FM5 A;  4UVB A;  1GXP A;  3GFI A;  2M5W A;  4MQ9 F;  5ICC A;  4U88 A;  2HR3 A;  3BPV A;  2XKP A;  2FXA A;  1FSE A;  2RGV A;  2PBI A;  3S2W A;  4WCG A;  3IHU A;  4LD5 A;  2OAZ A;  1TTY A;  1FP1 D;  2QLZ A;  3HRU A;  2MD5 A;  3Q9V A;  3ZQ7 A;  1KQ8 A;  2VBY A;  5HS9 A;  1KQ0 A;  3BPX A;  2O03 A;  3ZMS A;  1CF7 B;  1FYM A;  3U2R A;  2YX4 A;  2P8T A;  4G9Y A;  4Q4Z F;  1JHH A;  1FNN A;  3WE2 A;  5D4R A;  4I0A A;  1U8R A;  3WU1 B;  4CGZ A;  4ENK A;  2DFI A;  4M71 A;  5L3F A;  3RJP A;  1Z1D A;  1P4W A;  2W57 A;  4UNO A;  1O3Q A;  2M45 A;  2QEN A;  2HS5 A;  4AVP A;  3MFK A;  1W7P B;  1ZAR A;  4A5M A;  4ZYH A;  2UXN A;  3M1E A;  4HQM A;  2RQP A;  2V9V A;  1XMA A;  2YU3 A;  3LFK A;  4H0E A;  1ZG3 A;  3JSO A;  4IPA A;  4RS8 A;  1FYL A;  3W6K B;  2M87 A;  2BE5 F;  3KLN A;  4ON0 A;  1YTY A;  3IRQ A;  5E1W A;  1IXS B;  1R1U A;  3HSE A;  4HBL A;  3HYI A;  3Q5F A;  4HLX A;  2E7X A;  5L3D A;  2DPU A;  1D3Y A;  1O7L A;  2Y48 A;  2FBI A;  1U5T B;  3FZV A;  1I1G A;  1REP C;  1V3F A;  2QQ9 A;  2M8E A;  4KN4 X;  4GYI A;  4GGG A;  2HOE A;  4U0Y A;  4A5N A;  4R1H A;  1G3Y A;  3WU0 A;  1S7O A;  5LRR A;  1TNS A;  3R0A A;  2BV6 A;  3I59 A;  5JFR A;  1RIO H;  4EVI A;  2RNJ A;  5K5O A;  4K2E A;  2O6G E;  3F8M A;  4G7O F;  4ASN A;  3KP5 A;  5D5W B;  4HX8 A;  6PAX A;  3J7A O;  1TW2 A;  1XSD A;  2EJR A;  2Q8K A;  5D8K B;  2X4H A;  3U9G A;  1Y0U A;  4HF1 A;  3ISP A;  1B9N A;  3ROU A;  2Y0M A;  3E5Q A;  1U6G A;  5F1R A;  2F5F A;  3ULQ B;  4L0Z B;  2IA2 A;  3TDZ C;  3M7G A;  2RDP A;  3F6O A;  4A0X A;  3KEO A;  1B9M A;  2A6E F;  1KGS A;  1ZRD A;  1TBX A;  2DK8 A;  1TLH B;  2GIV A;  3T8R A;  1IW7 F;  4FX0 A;  1IAW A;  2JRT A;  1YG2 A;  3E6M A;  2XAJ A;  4RAY A;  3ZMT A;  3J80 K;  1XGO A;  4LFU A;  4EM1 A;  2D45 A;  4KFC A;  3QP5 A;  1WRJ A;  3GZ5 A;  1MJA A;  4Y13 A;  4UUV A;  2VC0 A;  3EYY A;  3ZN0 A;  4PDK A;  2L02 A;  3V7R A;  3ECH A;  5FGM A;  4BYY A;  3GYH X;  3I71 A;  3GO5 A;  4S04 A;  4CIC A;  2H94 A;  5K1Y A;  2YX7 A;  2LDU A;  1XCB A;  2NNY A;  4BHP A;  4I01 A;  1BI0 A;  2EK5 A;  2QWW A;  1P6R A;  1I1S A;  5CYV A;  1SAX A;  3CTA A;  2MLK A;  3E5U A;  4I2O A;  2ETH A;  5H6R A;  3RYP A;  2V79 A;  4N0B A;  3QOP A;  5J6X A;  4ZYG A;  1ULY A;  4KIB A;  2HDC A;  3VB2 A;  2VT2 A;  1G4D A;  2FRH A;  4O5V A;  5FD5 A;  2DAO A;  1D5V A;  2DO7 A;  1KYZ A;  3MZH A;  3REO A;  1QPM A;  4JBA A;  2IA1 A;  4RB1 A;  1W5S A;  2A68 F;  3F8B A;  4R79 A;  4R8H A;  2PN6 A;  1DP7 P;  4A0Z A;  3F22 A;  1TQM A;  3N97 A;  5AIP A;  4HF2 A;  3ZMV A;  2OU2 A;  1F5T A;  1XSX A;  2IA0 A;  2HKO A;  1U3E M;  1SFE A;  1F4K A;  1X3U A;  5E8I A;  3MAJ A;  1W5T A;  2MH2 A;  4IRH A;  3RIR A;  3ERE D;  2VOP A;  2FU4 A;  1B1B A;  1W4M A;  3HOT A;  1U78 A;  3F21 A;  2EFW A;  4CXF A;  4CYD A;  3RTR A;  4IF4 A;  2HYF A;  5DYM A;  2DQL A;  3DF8 A;  5LHH A;  2W24 A;  1SMY F;  1G3S A;  1KU2 A;  2KIU A;  3IL2 A;  2ZNY A;  1UHM A;  4WF2 A;  1F9N A;  3FX3 A;  2JT1 A;  3C1D A;  2CQK A;  3DEU A;  2FSW A;  4HW0 A;  5H6Q A;  4KT5 C;  2QBY A;  1IN6 A;  1IRG A;  3W6J B;  5FLX K;  3EET A;  3B02 A;  4IXA A;  1B59 A;  2XUB A;  3HRS A;  2G9W A;  5ILS A;  3I0T A;  5IT9 K;  1U5T C;  1I27 A;  5HDK A;  4LK1 F;  3K2Z A;  3GFM A;  4M6X A;  3JSP A;  2JTV A;  4L9V A;  2PLY A;  3O6B B;  1HSJ A;  1J5Y A;  3P7N A;  5K5R A;  2KIF A;  5E1X A;  3TKY A;  5LEK A;  3DQV C;  4IVN A;  2UWM A;  4WK8 F;  1WQ2 A;  2PFB A;  4BHC A;  4NHJ A;  3BJO A;  2L54 A;  3GFJ A;  2FOK A;  1D8K A;  4G6D A;  1GXQ A;  5HLH A;  1YS7 A;  4MQV A;  4A6E A;  2XIG A;  1WI9 A;  2GA2 A;  3TO9 A;  4I7H A;  1XMK A;  4B09 A;  1HW5 A;  2PG4 A;  2PI0 A;  1LDD A;  2IW5 A;  3P9K A;  2NS0 A;  3O3K A;  2CW0 F;  4AIH A;  1FYK A;  5D6E A;  1XGM A;  1ON2 A;  2HZT A;  3DP7 A;  3VEP A;  5CVJ A;  1IXC A;  4FT8 A;  4UXN A;  1W7P D;  5D5V B;  1JXS A;  4UVC A;  2XAF A;  1EH8 A;  2VON A;  3F23 A;  3CLO A;  2R3S A;  4MHG A;  2DK5 A;  3C18 A;  2EA4 A;  2JPC A;  3V4G A;  4HZF A;  1DDN A;  4MGR A;  3CO6 C;  4KA4 A;  2EFO A;  4XLN F;  1ZHF A;  4HV5 A;  4HX7 A;  1KU9 A;  5D6F A;  3I5U A;  2DTR A;  2Z33 A;  3TO6 A;  1SMT A;  4P96 A;  1KA8 A;  2E7W A;  3JW4 A;  3C3W A;  4Z2Y A;  5FB2 A;  1L3L A;  1GVJ A;  3R60 A;  3D5L A;  4G7Z F;  1R36 A;  2H6B A;  3IKV A;  3MEX A;  1BI2 A;  4LLN A;  1LVA A;  3QRF F;  3BDD A;  4HV6 A;  4CHU A;  1IN4 A;  1H9T A;  2Z99 A;  1HST A;  2FMY A;  2XAH A;  2K27 A;  2KRF A;  2KJC A;  1FX7 A;  3I64 A;  2RKH A;  3CO7 C;  3COA C;  3FXU A;  4HX4 A;  1LB2 A;  5FLX Z;  1R23 A;  1ZGJ A;  2MH9 A;  2JZY A;  3WTT C;  2W84 A;  3I4P A;  3O2P E;  1TQP A;  2OQR A;  2PMU A;  5E20 A;  3T0Y A;  3ML6 A;  4M73 A;  2COM A;  3E6B A;  2AXL A;  3E6D A;  5DCM A;  2VBX A;  3H92 A;  3FWE A;  5HDN A;  2LNB A;  1JGS A;  2IJL A;  1C0W A;  4L9T A;  3BZ6 A;  2WTE A;  1ZGA A;  4IJA A;  2VN2 A;  4XSZ F;  1IN8 A;  1OYI A;  3SQN A;  3NQO A;  4YFK F;  3T8T A;  5ICF A;  1SD6 A;  5CVU A;  2A07 F;  3QU3 A;  3Q9S A;  3L00 A;  1G6N A;  4EGY A;  5JR3 A;  4BQA A;  1PUE E;  2QM3 A;  5LLQ A;  3V8L A;  4UHT A;  1J0R A;  1O57 A;  1BIB A;  2OZ6 A;  1T6S A;  2DI3 A;  2LF7 A;  3J81 Z;  4OMZ A;  1HQC A;  4DNC A;  1QQI A;  1S3J A;  2M1B A;  3KE2 A;  4EM0 B;  4U0W A;  4YG2 F;  1XD7 A;  4HOB A;  1K78 B;  3RDI A;  3NEU A;  2D1V A;  2MA3 A;  3MQ0 A;  1UCR A;  2GAU A;  2O3F A;  1BI1 A;  3GWZ A;  2GXB A;  4I0B A;  5IT9 Z;  1MGT A;  1YLF A;  1ZG1 A;  1DPU A;  4RGX A;  3D0S A;  4S05 A;  1BC7 C;  3T5X A;  3F6V A;  2H09 A;  5TJJ A;  2X0L A;  1QZY A;  5K5Q A;  3GZ6 A;  1FBQ A;  2NNN A;  2HGC A;  1MDM B;  3T1B A;  2A6H F;  2J5O A;  4E70 A;  1MD0 A;  2ZKZ A;  3GUD A;  1FY7 A;  3TOA A;  4EJT A;  4RB3 C;  5LHG A;  2HKX A;  5LEJ A;  3KZY A;  3SZP A;  4P9F A;  4LB6 B;  4LMY A;  1TQI A;  4I09 A;  3MZY A;  5KVR A;  1YYV A;  2EV6 A;  4CZZ A;  3F8F A;  3HSF A;  4TV7 A;  3LQR A;  3KP6 A;  4OIN F;  3P9C A;  2VXZ A;  1BC8 C;  3WTW C;  4EJW A;  4QWQ A;  5HVQ C;  2YPR A;  2VE9 A;  2ZFW A;  4L0Y B;  4L5J A;  4A0Y A;  4M9Z A;  1R1T A;  1L0O C;  4N9H A;  4ZH4 F;  2D1H A;  3WGH A;  2J5P A;  2QZ8 A;  1QO0 D;  5DCM B;  5D4S A;  3WTZ A;  5ERI A;  2ESN A;  2YR2 A;  1MJ9 A;  2K4B A;  2PQ8 A;  2FNA A;  3VOD A;  1RZ4 A;  1NHA A;  1HBX G;  5EEG A;  1T39 A;  2IP2 A;  3BWG A;  2CSO A;  2FEZ A;  5JI6 A;  1FZP B;  2WC2 A;  2PEX A;  3ZP5 A;  3HHG A;  1Z91 A;  3EQL F;  4RB0 A;  3PQJ A;  2VC1 A;  3FXQ A;  4NQW A;  3P9I A;  5LRS A;  3BY6 A;  2EV5 A;  3HRM A;  1ONV A;  1ODD A;  5DV5 A;  5AIQ A;  4EJV A;  4IRI A;  3TOB A;  3FMS A;  3SZT A;  2ACJ A;  1ON1 A;  3V7S A;  4KYW A;  3KP2 A;  4YFX F;  1IZ1 A;  3L7W A;  1XCV A;  3GFL A;  1G3W A;  5HLG A;  2NAZ A;  1TW3 A;  1HXD A;  4BH9 A;  1HKS A;  4KDP A;  1BM9 A;  2H27 A;  4L5I A;  1J9I A;  1ZG5 A;  2QQB A;  3MWM A;  3TO7 A;  1OR7 A;  2OQG A;  2MC3 A;  3PFI A;  1W7P A;  1OYW A;  4PGG A;  2RV8 A;  5L3E A;  1P4A A;  4BXU A;  4MEX F;  3R0J A;  1RNL A;  2Z5U A;  1KQ9 A;  3V8J A;  3RKW A;  4FX4 A;  4HYE A;  4HQE A;  2JPB A;  1LEB A;  1OMI A;  4OIO F;  1UFM A;  3ZMZ A;  3BOQ A;  1O3S A;  4EMS A;  2R7D A;  1BJA A;  3JTH A;  5J8F A;  1S6L A;  4RGU A;  3KZZ A;  3HOS A;  1MZB A;  4L18 B;  5D5X B;  1FBU A;  2QQA A;  2PJP A;  2HTS A;  1G3T A;  1AWC A;  4AIK A;  3RPU A;  1STZ A;  2XRO A;  2ZME A;  2F5E A;  4HDV A;  1B6A A;  5ICG A;  3J81 K;  1SD4 A;  4XRF A;  4AIJ A;  3HHH A;  1FWZ A;  1T2K A;  2FF4 A;  3IRR A;  1FP2 A;  2LKP A;  2ADU A;  1R5H A;  5E18 F;  4YFN F;  2IVM A;  4XBF A;  5E17 F;  4KIF A;  3MCZ A;  3KEQ A;  2H6C A;  4BHB A;  3HIF A;  2A5Y B;  4ETS A;  4Q5S F;  2STW A;  5BQT A;  3G73 A;  3WG9 A;  4HA8 A;  4PZJ A;  3WTY C;  5BPD A;  1T38 A;  4N9I A;  5LGU A;  2GWR A;  2W85 A;  2V1X A;  4P5O A;  1WSU A;  5LGN A;  1KU3 A;  1EH6 A;  3RYR A;  1LDJ A;  2AS5 F;  1T0F A;  4L9N A;  3L2C A;  2ZXJ A;  4EGZ A;  4G94 A;  1DPR A;  4BNC A;  3JAM Z;  3GEZ A;  1MJB A;  3K0L A;  2A69 F;  1RI7 A;  1AOY A;  3F8N A;  3FHZ A;  4ZZL A;  4RAZ A;  4IHT A;  1SFU A;  2GQQ A;  1U2W A;  2P7C B;  3CDH A;  1V4R A;  2VBW A;  3HTS B;  1SD5 A;  1USS A;  2RVC A;  2L4M A;  4BAY A;  1R58 A;  4A2U A;  4OU0 A;  4I98 B;  3BJ6 A;  3E97 A;  4AWX B;  2FE3 A;  2G7H A;  2EFP A;  1YQA A;  1E17 A;  3DFG A;  3E5X A;  1RUN A;  1R22 A;  2OBP A;  3DPT A;  3VFZ A;  4JQF A;  1D8J A;  3I59 B;  5LGT A;  1Z05 A;  2P5L C;  4EJO A;  2HYG D;  2FML A;  2QBY B;  1ZRC A;  2BBY A;  5FD6 A;  1QZZ A;  3CUQ B;  1BN5 A;  5F64 A;  5FO5 A;  2OD5 A;  3ZN1 A;  2UZK A;  1XGN A;  3R61 A;  2P4W A;  1UB9 A;  4LLL A;  1H9G A;  1KU7 A;  3HRT A;  2Q0O A;  1VTN C;  2CFX A;  4ESB A;  2IPQ X;  2EV0 A;  3FMR A;  2GXG A;  3FMQ A;  4M9S A;  4LG0 A;  3I53 A;  4KMU X;  4G8X A;  2DT5 A;  2Q2E A;  1A04 A;  1FOK A;  4GYG A;  4B8X A;  2R7F A;  1K7A A;  3WE3 A;  4ZYE A;  1FC3 A;  4HAM A;  4EV0 A;  5DDG A;  2RN7 A;  1MKM A;  4GCV A;  3V7C A;  2XAQ A;  2A61 A;  3WTS C;  4HLY A;  2K02 A;  4YIF A;  5LHI A;  1H0M A;  5EEH A;  3WGI A;  3KP4 A;  2GZW A;  2ZNZ A;  1PDN C;  3CUO A;  3SXY A;  4D0P A;  4O6J A;  2F2E A;  1QBJ A;  1YW8 A;  1ZYR F;  4OIR F;  1LEA A;  1UST A;  2C6Y A;  4Y17 A;  3NRV A;  2YSR A;  1XN7 A;  2O0Y A;  3TQN A;  5H20 A;  1KYW A;  5DCF A;  2XVC A;  3K1M A;  4A12 A;  4XLP F;  3E3V A;  3H3U A;  1YS6 A;  5JVT A;  1F1Z A;  5J8C A;  1EV7 A;  3RKX A;  4LGW A;  2IRF G;  3KP3 A;  2ISZ A;  3CUQ A;  2A3S A;  3C7J A;  2DW4 A;  4CDG A;  3WTV C;  2L4A A;  3EYI A;  2O61 A;  1LQ1 A;  2Z3Y A;  1JE8 A;  2BYV E;  3ZMU A;  2L01 A;  1CF7 A;  5FFZ A;  5AON A;  1OKR A;  3B73 A;  1MDM A;  3TDU C;  3F8C A;  4G7H F;  2ZME B;  2HQR A;  2ISY A;  5HDG A;  3SFZ A;  1BBY A;  5L3B A;  1IN7 A;  2LF8 A;  3FM3 A;  3K1N A;  1EH7 A;  3WGG A;  1HW1 A;  4M74 A;  2VT3 A;  1I5Z A;  5L3G A;  2STT A;  2NYX A;  3OV8 A;  3HUG A;  1PP8 F;  4L9J A;  4ENJ A;  5CVV A;  3GF2 A;  4OIP F;  3GW2 A;  2G7U A;  3K69 A;  2DPD A;  1XDU A;  2LSO A;  5HLI A;  2QUF A;  2ZCW A;  1QNT A;  3N4M A;  4UV8 A;  1JHF A;  4ESJ A;  2L3D A;  3QPH A;  1Z7U A;  3ZPL A;  3ABT A;  1O3R A;  1J7K A;  3LA7 A;  2VOO A;  2ZO4 A;  4KMF A;  1FLI A;  1SFX A;  4ZZD A;  3RI4 A;  1J75 A;  4MNU A;  4P55 A;  2BGC A;  3ZMD A;  5HS7 A;  5BS6 A;  5CLS A;  4P9U A;  3AAF A;  3IKT A;  3GXO A;  3KCC A;  3DV8 A;  5ILV A;  2P5K A;  1S7A A;  2ELH A;  1S29 A;  1UHW A;  2NRA C;  2OZU A;  4KUM A;  3GLX A;  2HQN A;  2HWV A;  4EJU A;  5CVI A;  2HFH A;  1RUO A;  3M8E A;  1P4X A;  3WTU C;  1ZAO A;  2WWY A;  3DXJ F;  2VOD A;  1Q1H A;  2GA1 A;  2XAG A;  2EB7 A;  1HW2 A;  4HDU A;  2MBF A;  1XSV A;  1R5G A;  2XAS A;  1GHC A;  1Z9C A;  2W25 A;  3QU6 A;  1XGS A;  3WTX C;  3BRO A;  2P5V A;  5DD4 A;  3CJN A;  1K79 A;  3L9F A;  1WWX A;  1Z6R A;  2CYY A;  4FHT A;  5FFX A;  2F5D A;  2MLG A;  5ED4 A;  3IWZ A;  1BOA A;  2P6T A;  4YII A;  2M30 A;  2HEO A;  1FT9 A;  2OA4 A;  5L3C A;  2O8X A;  3BP8 A;  2E1C A;  3JTG A;  3KFW X;  4M72 A;  4GO1 A;  3LWF A;  3GX4 X;  5F6F A;  1OPC A;  3F72 A;  4OMY A;  3G3Z A;  2EFN A;  1J59 A;  1BIA A;  2EA2 A;  5JHU A;  3HSR A;  5LBQ A;  3M9A A;  4KN7 X;  1Z6T A;  3KET A;  4I02 A;  5E8G A;  4ENM A;  3LQQ A;  2CO5 A;  2V6C A;  1XDS A;  3DKW A;  5BOX A;  2F5C A;  1ZN2 A;  1R00 A;  5A2Q Z;  1IUY A;  2CG4 A;  4MTD A;  5CJ9 A;  4G6Q A;  3LA3 A;  4M9X A;  2EFQ A;  1LJ9 A;  2K86 A;  3I58 A;  4UV9 A;  1CGP A;  3FF5 A;  4KIC A;  4A6D A;  2B0L A;  3IC7 A;  3BJA A;  4QLC U;  1PP7 U;  3E6C C;  2KIM A;  1ZLJ A;  3FXR A;  3LST A;  2P7V B;  5BMZ A;  3ABU A;  4WWC A;  4OIQ F;  3R6S A;  2FNP A;  4WXC A;  1P92 A;  4LB5 A;  3SHF A;  4LK0 F;  2IT0 A;  2FBH A;  4KIG A;  4LLG F;  5CVR A;  4MTE A;  5HOO A;  4KNY A;  1FBS A;  1I6X A;  4ENN A;  1ZRE A;  2V1U A;  3U1D A;  3TGN A;  3VOE A;  2FA5 A;  3M8F A;  1K78 A;  4M6Y A;  1HKQ A;  1IF1 A;  4NB5 A;  1FPQ A;  5KK1 A;  3IWF A;  1ZLK A;  4MEY F;  2K4J A;  2JSC A;  1HKT A;  4CO8 A;  1SD7 A;  2Y75 A;  4IHS A;  4LG0 B;  1LNW A;  4DQ2 A;  2DBB A;  4HF0 A;  4WX9 A;  5A2Q K;  3CUQ C;  5ILU A;  2KKO A;  1R1V A;  4ZYD A;  2RC4 A;  2K7L A;  2V1D A;  4PGH A;  1O7F A;  1OYY A;  3ELK A;  1J2X A;  5DUK A;  2CWE A;  4WXH A;  4WXD A;  1U5T A;  2DU9 A;  5E1Z B;  3OOP A;  2UXX A;  1E2X A;  1ZRF A;  2QYO A;  2XV4 S;  2ZBK A;  4Q48 A;  2XRN A;  5TRD A;  3PQK A;  2E1N A;  2VBZ A;  2EWN A;  4OOI A;  1K6O A;  1QGP A;  3HTU A;  3RPQ A;  5D8L B;  4IRG A;  2FBK A;  1TNT A;  1YW9 A;  3QPT A;  1O3T A;  1WKM A;  1XB4 A;  1YO5 C;  5IT3 A;  4RB2 C;  4AD9 A;  2ESH A;  3LAP A;  1P2F A;  4RGR A;  2XHK A;  2BEO A;  2DQR A;  1S8N A;  3R4K A;  3F3X A;  1YFH A;  3J80 Z;  3EUH A;  2P6S A;  1IXR C;  2FQ3 A;  1YIO A;  5ICE A;  1BI3 A;  1R7J A;  4UVA A;  5HS8 A;  3I54 A;  3QP6 A;  1T98 A;  3L09 A;  4Q47 A;  3GVA A;  3LAJ A;  1IRF A;  3H3Z A;  2PMH A;  4ESF A;  4RGS A;  2XKO A;  3DPL C;  1DUX C;  3JAM K;  1B4A A;  2QVO A;  4EQQ A;  3KP7 A;  3RKY A;  4O3M A;  3ECO A;  3EDP A;  4F7Z A;  5D5U B;  4U7D A;  4XSX F;  1IN5 A;  5DEQ A;  2HTJ A;  2DLL A;  4JK1 X;  3QAH A;  1LDK B;  1ZH5 A;  3WOD F;  1YW7 A;  2Z9O A;  2ZJ2 A;  4GXO A;  3V8K A;  2WV0 A;  4LJZ F;  4EM2 A;  3LA2 A;  3K9T A;  1FSH A;  4U7B A;  4PCQ A;  2D2W A;  2XGX A;  3K1P A;  2CGP A;  2KJB A;  4Y15 A;  5DD8 A;  2VE8 A;  4U0V A;  5DUI A;  3KLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...