3M1EA

Crystal structure of benm_dbd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Crystal structure of the unbound LysR-type transcriptional regulator BenM DNA binding domain
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription regulator
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m1eA00
5DCFA 1BC8C 4OMYA 1SAXA 2GIVA 2BE5F 3M9AA 4BQAA 4ZZDA 1ZGJA 5LLQA 5BS6A 1YIOA 4ON0A 1BN5A 4ZYHA 3HOSA 4HDUA 1PUEE 2GZWA 3GVAA 1B6AA 1O7FA 2V6CA 1ZH5A 3U2RA 3P7NA 3ABTA 5DV5A 4JK1X 2JZYA 4UHTA 2QZ8A 1GVJA 2E7XA 3I4PA 2A5YB 4RAZA 4K2EA 2MLGA 1ZG5A 2EWNA 3MZHA 2RVCA 3KP2A 4IF4A 1TQPA 2HOEA 3HSRA 1MJ9A 5D5VB 3DQVC 3CO6C 2Z5UA 4LJZF 4M71A 4HF2A 3T1BA 3BPXA 3V8JA 1MDMA 3TOAA 2B0LA 2KIMA 1D3YA 2NAZA 3R0JA 4EVIA 4A12A 5CLSA 1SFEA 4Y13A 1J0RA 1E2XA 3MCZA 1QPMA 4PGGA 4CZZA 2JT1A 4U0YA 1YG2A 2EV6A 5D6EA 2EK5A 5LRRA 5HLGA 5ILVA 5JFRA 4EV0A 2W24A 2PI0A 5HDNA 4ETSA 4OIQF 1XSDA 4UV8A 3G3ZA 1FY7A 1YS7A 2MD5A 3I58A 4WXDA 1R5GA 3CUQA 5A2QZ 2Y0MA 3NRVA 2NYXA 3GLXA 3SHFA 4XLPF 1KQ8A 4I0AA 1HKSA 3K1MA 3MWMA 2LKPA 3F8NA 1S6LA 2EB7A 3F8BA 3L09A 3GFMA 5DDGA 3GYHX 1Z9CA 3GX4X 5CVJA 2Z33A 2UXXA 4PGHA 2JPCA 1K6OA 2IJLA 5FLXZ 5H20A 2C6YA 2L02A 1HSJA 1ZG3A 1BOAA 2QVOA 2DPDA 5D8LB 4MQVA 1R36A 4UXNA 2LF8A 2ZBKA 1ZRFA 4ENMA 4P55A 1H9GA 4LD5A 3D0SA 1K78B 4ESBA 3VEPA 1B9NA 1W7PD 2ZCWA 5L3CA 4M74A 1ULYA 3AAFA 3TQNA 3F22A 3GUDA 3ULQB 3KCCA 1R1TA 3C1DA 2XAQA 3B73A 3JAMZ 2LF7A 3T0YA 2ISYA 3IKTA 2FBKA 5LEJA 4LB6B 1HXDA 1SFXA 4L5JA 5DUIA 1XSVA 1BIAA 4WWCA 1WSUA 2QBYA 3FWEA 4OOIA 4B09A 4ESJA 4YFKF 1QNTA 3H3ZA 4YFNF 1UHMA 2EA2A 3ABUA 3LA3A 5D8KB 3SXYA 2RGVA 3J80K 1Z6TA 1RUOA 4HF1A 1VTNC 4Q5SF 2GAUA 4I98B 3RPUA 3I54A 2VBYA 2CSOA 5ICFA 1IAWA 3JTGA 4LK1F 3Q9VA 1AOYA 5CVUA 3FMQA 1UCRA 2ZKZA 1R22A 4E70A 1UFMA 4AD9A 3M8EA 1OPCA 4HAMA 4ENNA 2BBYA 2LNBA 3V8KA 1D5VA 1SD6A 2L01A 2VC1A 3CUQC 2EFNA 4R8HA 1ZRCA 2R7FA 3V8LA 1O3SA 3I71A 3W6KB 3PFIA 2Y75A 3MEXA 1WKMA 4H0EA 1U2WA 4BYYA 5ILSA 2OZ6A 2PG4A 2DLLA 3N97A 2V1DA 2W25A 1NHAA 4HF0A 1G3WA 1TBXA 3KLNA 2D2WA 1QQIA 4XLNF 3EETA 3EYYA 1XMAA 4LLGF 4ASNA 1SMYF 2EA4A 4A2UA 2DW4A 3ZMSA 2V1XA 1R23A 2HQNA 3PQJA 1BI1A 1XN7A 3TO9A 4YIFA 3COAC 1U5TB 3RYRA 2ZMEA 1FC3A 3WGGA 1IN5A 3E6MA 2DI3A 3KZYA 3R6SA 3WE3A 5F6FA 2M30A 1GHCA 1SD5A 2G7UA 3RI4A 1B4AA 1CF7A 3VFZA 1IN4A 3QAHA 4KYWA 5KVRA 3NEUA 2BGCA 3FF5A 5D6FA 1ZLJA 4IVNA 2OQGA 4RB2C 4HBLA 1FP2A 4S05A 3FXRA 1B9MA 3MAJA 3KP4A 4LG0B 2EV5A 4M72A 1MD0A 2ZNZA 5D4RA 1JE8A 1FZPB 1R5HA 2JPBA 4U0VA 3KLOA 4WCGA 2L4AA 4FX4A 3ZMVA 3I59A 5AIPA 5JHUA 4YIIA 3MZYA 4A5NA 1EH7A 3HOTA 4I01A 5LHIA 3HSFA 4CICA 2ADUA 4BNCA 1HW2A 1KYZA 1QO0D 4GXOA 2O03A 1I5ZA 1P4WA 4OU0A 4OIRF 3OV8A 5ICCA 2VE8A 1F5TA 5D5XB 2EFOA 3DV8A 2P5VA 3RPQA 1O3QA 2O61A 3JSOA 2HS5A 3GEZA 3LFKA 1CGPA 1EH6A 3WTUC 1J5YA 1XGSA 2QYOA 5HS9A 1LJ9A 2D45A 1MGTA 4F7ZA 1KU2A 2FEZA 1R58A 3I64A 4EGYA 1OR7A 1J75A 4KMUX 3CO7C 1P2FA 2BYVE 1ONVA 1O57A 2H6CA 3FM3A 2ELHA 2OBPA 5FFZA 4NQWA 3K2ZA 4L9VA 1S29A 4JQFA 1RZ4A 4P5OA 3K1NA 1TNSA 4Y15A 4XSXF 1DPRA 2A6HF 1IRFA 1KGSA 1T0FA 2KJBA 2VBXA 4KN4X 1IRGA 4A0YA 4OINF 1FT9A 3WTWC 1K79A 3VODA 5DEQA 1XCBA 2F2EA 3E5QA 4RAYA 4QWQA 5DYMA 1ZLKA 3HTUA 3Q5FA 1KU3A 2OQRA 1XD7A 1QZYA 4LB5A 2OD5A 4M9ZA 5LRSA 1SD7A 1FYKA 2AXLA 2ZJ2A 3QU6A 4A0ZA 3J80Z 1ZREA 4I0BA 4PDKA 3LQRA 1YW7A 2A07F 2RKHA 2ETHA 4L18B 5E8IA 2HR3A 3KP5A 1XSXA 4LK0F 1W7PB 4RB3C 4OIOF 4KMFA 2MC3A 5EEHA 1IXCA 1XGNA 2HKXA 1R00A 3HYIA 2H6BA 1KQ0A 2J5OA 2FU4A 4HW0A 3IWZA 2UXNA 4O5VA 1FBUA 3M8FA 3KETA 1S3JA 1XCVA 3WTZA 4MTEA 2J5PA 3F6VA 2LSOA 5IT3A 2PBIA 1ZHFA 1FX7A 1HW1A 2ZFWA 3R4KA 2PEXA 2KIUA 4WX9A 2CO5A 3CUOA 1KQ9A 1F9NA 2HTJA 2PMHA 3GFIA 1SMTA 2E1NA 3TKYA 3QPTA 3ELKA 3O6BB 1MKMA 3LAPA 5LEKA 2WWYA 5DCMB 3LA7A 3GWZA 3P9KA 1YTYA 3SQNA 4RGSA 5E8GA 2AS5F 4XRFA 2VT2A 4LGWA 5JVTA 3Q9SA 2GWRA 4HX4A 3ZQ7A 1LB2A 3TDZC 4KIGA 3RJPA 3BZ6A 3WE2A 3F8FA 1D8KA 1USSA 4EGZA 4MGRA 1AWCA 3WODF 4BHPA 4AVPA 2VBZA 3REOA 4BH9A 4RB0A 2HKOA 4ZH4F 5LGTA 2H09A 2CFXA 2YPRA 1TQMA 2XASA 1YLFA 1KA8A 1TNTA 3ZMUA 4HQEA 4ZZLA 1GXPA 3R60A 2NS0A 1IUYA 4G8XA 5HLIA 1JXSA 2V79A 4U0WA 4N0BA 4FHTA 3TO7A 2DQLA 2XIGA 5H6RA 1QGPA 3RYPA 3BWGA 2HEOA 3E6BA 3LSTA 1U3EM 5HS7A 1Y0UA 1USTA 2VE9A 4U7DA 3P9CA 3FX3A 1STZA 2R3SA 4EJTA 3RKXA 1WRJA 5LHGA 5L3FA 2CQKA 3T8TA 5IT9K 4LLNA 4RGUA 1RIOH 2VC0A 2L54A 2XKOA 4LLLA 3BROA 5HDGA 4M73A 4KIBA 1DPUA 1XDSA 3KE2A 2COMA 5JR3A 2M45A 3RDIA 3J81K 4AWXB 3FMSA 2P6SA 4GO1A 2DU9A 1YYVA 4GCVA 3F72A 2O0YA 5BPIA 3ML6A 1DP7P 4I7HA 4WXCA 5ICGA 4Q4ZF 3LA2A 4QLCU 1IN7A 1YFHA 1A04A 2D1VA 2CYYA 2GXBA 2L3DA 5BQTA 1BC7C 3F8CA 4N9IA 3ZMTA 2ACJA 1W5SA 1P92A 4OIPF 1Z7UA 4KICA 1YW8A 2HYFA 2RDPA 3ZPLA 2XAHA 4MNUA 3O2PE 4IRIA 2NRAC 4L9NA 1Z91A 5K5QA 1YQAA 3E6DA 3GZ5A 2PJPA 3TGNA 2DBBA 2P8TA 4YG2F 1RUNA 2XV4S 1LDJA 4HYEA 3KEQA 5E18F 2HDCA 4RGXA 4HQMA 2JSCA 3FXQA 2G7HA 3EUHA 3CJNA 4WXHA 4RGRA 1ZG1A 2W85A 1H9TA 3GW2A 3R0AA 4KA4A 3EQLF 3SZTA 4L5IA 4UUVA 2UZKA 3E5XA 1BM9A 1R1VA 4IRHA 2IP2A 4NB5A 4BHCA 2XUBA 3WU1B 2Z99A 3IHUA 2G9WA 3E3VA 4P9FA 2HYGD 3WTXC 3TOBA 1FPQA 3V7CA 3B02A 2Q8KA 2EFPA 4CGZA 3JW4A 1T39A 3C7JA 3F6OA 2LDUA 2PLYA 1S8NA 1QBJA 3M7GA 4HZFA 5HVQC 4N9HA 2XHKA 1K78A 2PQ8A 5A2QK 1YW9A 2FMLA 3E5UA 2FXAA 4I09A 1O3RA 2DK8A 2F5FA 5ED4A 1R1UA 5E20A 2W57A 4EMSA 3L2CA 2Q0OA 4IHTA 4UV9A 3V7SA 3DP7A 4A6EA 2XKPA 1FYLA 4L0YB 2ZO4A 4M6XA 1P4XA 1OMIA 5AIQA 2F5EA 2XVCA 4EJUA 5FD5A 5DUKA 4S04A 1ZYRF 1BBYA 3JSPA 4UVBA 1JGSA 2JRTA 3HRTA 1ON2A 3NQOA 2MH2A 2YU3A 1KYWA 2HZTA 3WTYC 3HHHA 1U8RA 1MDMB 3IWFA 3O3KA 1XGOA 2H27A 1O7LA 2VT3A 5FB2A 1QZZA 2Y48A 4AIHA 5E1XA 1WWXA 5DD4A 1FNNA 2K27A 5CVRA 1MJBA 2M8EA 3FHZA 4EM1A 2D1HA 5H6QA 3WTVC 1OYYA 1OYIA 4MEYF 4A0XA 3IKVA 1REPC 1Z05A 1WQ2A 3CUQB 4L9JA 4L9TA 4BHBA 3DPTA 1ZAOA 1FWZA 1TLHB 2F5DA 4IJAA 4L0ZB 5HOOA 2A68F 4MTDA 3ZN1A 3L00A 4HOBA 5IT9Z 5DD8A 2QLZA 1IN8A 5LGNA 1UB9A 4CXFA 2DFIA 5CYVA 2M87A 4D0PA 3K9TA 2MA3A 4Q47A 4RS8A 3U9GA 3J7AO 4G6DA 3GF2A 3ROUA 3PQKA 4KUMA 1D8JA 2Q2EA 5JI6A 1BI3A 3IRQA 2WC2A 1LEBA 3IL2A 1W4MA 4IRGA 3VB2A 2H94A 5E1WA 3J81Z 2ISZA 1U5TA 4KN7X 2VOOA 3ECOA 2XAJA 2P7VB 2RQPA 2VXZA 3S2WA 5KK1A 5HLHA 3ERED 2BV6A 2FRHA 3LQQA 3FXUA 2K4BA 1JHHA 3WTTC 2QENA 4O6JA 1T38A 2YX7A 5LHHA 1YS6A 1V4RA 1I1GA 4OMZA 3IC7A 3DFGA 1HBXG 4JBAA 3IRRA 1IN6A 4LG0A 2QBYB 1R7JA 5CVIA 4BXUA 5LGUA 4M9XA 3HRUA 2OAZA 4KIFA 5BMZA 3I5UA 2FSWA 4HV5A 3ZN0A 4PZJA 3HRMA 5L3BA 1BI0A 2FNAA 1G3TA 4MQ9F 4XBFA 2IW5A 1JHFA 3HUGA 4DQ2A 3RKWA 1Z1DA 2RV8A 4ZYDA 1TW2A 1LEAA 3BP8A 4EJOA 5FD6A 1T2KA 4GYGA 3BPVA 2IT0A 2STTA 1F1ZA 1PDNC 1SD4A 3HIFA 1W5TA 5CVVA 4MEXF 1TW3A 1OYWA 3KP6A 1LNWA 1IXRC 4G7HF 4YFXF 3VOEA 1TTYA 4M9SA 4ENJA 2A61A 2QM3A 3CLOA 2ZXJA 1L3LA 2FBHA 5F64A 5ILUA 2NNYA 5K5RA 1ON1A 1X3UA 4EQQA 2A3SA 2K4JA 5K5OA 2KRFA 4Y17A 2QQBA 3LAJA 5BPDA 1S7OA 1ZGAA 2V9VA 2VN2A 3FZVA 3DXJF 2FQ3A 3DPLC 1XGMA 1I6XA 2RNJA 4CO8A 5L3EA 4RB1A 1DDNA 4O3MA 5F1RA 1ZN2A 1G6NA 2P5KA 4G7ZF 3TDUC 2X0LA 5FGMA 3W6JB 1U5TC 3QOPA 4FT8A 2A6EF 2ZMEB 4U88A 4PCQA 5L3DA 2RN7A 1I1SA 3E97A 1T6SA 1RI7A 1RNLA 1CF7B 2DK5A 5EEGA 4HDVA 1GXQA 2K86A 5J8FA 5ERIA 3WTSC 3H92A 1W7PA 4HV6A 3KP3A 4KT5C 2VODA 2PN6A 4AIKA 5HDKA 5J8CA 3RKYA 4IHSA 2CGPA 2FOKA 3CDHA 3GO5A 1E17A 4R1HA 2EFQA 1SFUA 1LVAA 1MJAA 4MHGA 4NHJA 3D5LA 1C0WA 4GGGA 1YO5C 1LDKB 1BJAA 1I27A 3K0LA 4HX8A 2F5CA 5BOXA 4HLYA 3ZMDA 4LMYA 1Z6RA 2Z9OA 4I02A 1G3SA 1HW5A 4ZYGA 4G6QA 1ZRDA 1MZBA 3I59B 2RC4A 2OU2A 1U78A 4HLXA 3BJAA 3MQ0A 2IPQX 1Q1HA 3QP6A 5D5WB 3L9FA 2TDXA 4HA8A 3WGHA 2GXGA 2FE3A 2DTRA 4U7BA 4IXAA 1FBQA 2R7DA 4ZYEA 4DNCA 2K7LA 2DO7A 1P6RA 3K69A 3GXOA 2W84A 3E6CC 2FBIA 2NNNA 2DT5A 2UWMA 3KP7A 2KJCA 3WGIA 2OA4A 5DCMA 2K02A 2WV0A 2HQRA 4B8XA 3FMRA 2CW0F 5D4SA 2KIFA 3BY6A 2QQ9A 3F3XA 4GYIA 2VBWA 2JTVA 2GA2A 1O3TA 5HS8A 2CWEA 3FM5A 4TV7A 1ZARA 1J2XA 3T8RA 3ZMZA 1K7AA 2HTSA 1TQIA 1HSTA 3QU3A 2FMYA 2IA2A 2Z3YA 2IA1A 3I53A 3SZPA 1EV7A 3ISPA 1G4DA 1H0MA 3TO6A 1WI9A 3G73A 1PP7U 1FSEA 4UNOA 4KNYA 4AIJA 2YSRA 3QRFF 1OKRA 5LBQA 3HTSB 2YX4A 3F21A 3ECHA 1L0OC 2P6TA 2VOPA 3GFJA 3LWFA 3KFWX 1ODDA 4CHUA 3HSEA 3WU0A 1XB4A 1IW7F 2BEOA 2FF4A 2P4WA 1FLIA 1IXSB 3C18A 3DEUA 2KKOA 1LDDA 4G94A 4EJWA 2E7WA 2XGXA 2P5LC 2HGCA 1F4KA 3SFZA 1KU9A 4P9UA 2P7CB 4CYDA 2MH9A 3QP5A 2M5WA 1HKQA 4FX0A 3N4MA 5J6XA 5FFXA 5FO5A 3F8MA 3GFLA 1HKTA 2PFBA 2PMUA 1FYMA 4UVAA 3WG9A 2MLKA 3MFKA 3R61A 1J9IA 4KFCA 4LFUA 5TRDA 2YR2A 5FLXK 3DF8A 2FNPA 5E17F 3M1EA 2EFWA 3P9IA 1U6GA 4WK8F 1BIBA 3V4GA 2EJRA 3JTHA 3RTRA 1J7KA 2HWVA 1V3FA 3OOPA 2QUFA 2M1BA 2IVMA 3KEOA 2CG4A 4M6YA 2ZNYA 1FSHA 2O6GE 4HX7A 3QPHA 2O3FA 5L3GA 3U1DA 4EM2A 4IPAA 1FBSA 3HHGA 1FP1D 1LQ1A 1IZ1A 2WTEA 3ZP5A 4Q48A 1B1BA 2MBFA 2DQRA 2HFHA 4A6DA 5K1YA 2STWA 2XROA 3HRSA 1P4AA 2X4HA 2ESHA 1IF1A 1G3YA 5CJ9A 4ENKA 6PAXA 4EJVA 2L4MA 4ESFA 2ESNA 3JAMK 2IRFG 3BJOA 1KU7A 2GQQA 4G7OF 1FOKA 4Z2YA 4KDPA 2FA5A 1XDUA 4XSZF 3T5XA 4R79A 1B59A 4EM0B 3F23A 3EDPA 2GA1A 2E1CA 5E1ZB 3C3WA 1S7AA 1XMKA 2O8XA 4P96A 1HQCA 2EV0A 2VONA 2XRNA 2XAGA 4A5MA 2XAFA 4WF2A 3DKWA 3BDDA 4CDGA 3H3UA 3BOQA 3L7WA 5TJJA 5AONA 1DUXC 3V7RA 3I0TA 1UHWA 2OZUA 3K1PA 1PP8F 1BI2A 1T98A 4G9YA 2IA0A 3CTAA 5D5UB 3RIRA 2V1UA 1EH8A 2A69F 3KZZA 2DAOA 3BJ6A 4BAYA 1J59A 2DPUA 4I2OA 3GZ6A 2QQAA 2QWWA 5ICEA 3EYIA 4UVCA
chains in the Genus database with same CATH superfamily
1T08B 4ZDOA 5DCFA 4XLFA 1Z0XA 4I6ZA 1BR1A 1BC8C 2GIZA 4OMYA 1SAXA 2GIVA 4PJMA 2BZTA 2BE5F 2M7AA 3FXMA 3M9AA 4BQAA 4C9YA 4ZZDA 1ZGJA 5LLQA 5BS6A 4G6TB 1YIOA 4ON0A 1S5LC 2ZXWH 4IHXA 1BN5A 3W2AA 4ZYHA 3HOSA 1D1BA 4HDUA 4B4CA 2W48A 1PUEE 4KISA 1W1WE 2GZWA 3GVAA 1DQUA 1B6AA 3PUBA 5J1UA 2XPVA 1KONA 1O7FA 2V6CA 1ZH5A 3A03A 3G4SI 3U2RA 3F0CA 3P7NA 3ABTA 5DV5A 3CCLI 2TCTA 4JK1X 2CUZA 2JZYA 4UHTA 1BR2A 2QZ8A 1GVJA 2E7XA 3I4PA 2A5YB 4RAZA 4K2EA 2MLGA 1YJWI 4J01A 1ZG5A 2EWNA 3MZHA 2RVCA 1FJLA 3KP2A 4IF4A 1M1EB 2YUSA 1TQPA 2HOEA 3HSRA 1MJ9A 5D5VB 4W1UA 1UHSA 3DQVC 3CO6C 2HOSA 2HQ5A 2Z5UA 3K2AA 1X1CA 4LJZF 1OCPA 4M71A 1XS9A 4KITB 2WV1A 2OF7A 4HF2A 3T1BA 3BPXA 3V8JA 5TISC 1MDMA 1GV2A 2B0LA 3TOAA 5GPAA 4XRSA 2HOTA 2KIMA 1D3YA 2ICWG 2VXDA 3I3LA 4CCOA 3GTLJ 4OAZA 1U9NA 2NAZA 3R0JA 4EVIA 4A12A 5CLSA 1SFEA 4Y13A 1J0RA 1E2XA 3GTKJ 3MCZA 1A31A 1QPMA 2DFFA 4PGGA 4CZZA 3C2BA 2DA7A 3DCFA 5IYCJ 4BJ6C 2JT1A 4U0YA 2VQGA 1OR7C 1YG2A 2EV6A 2KLOA 2GBYA 5D6EA 2YS9A 2EK5A 2XGEA 5LRRA 5HLGA 5ILVA 5JFRA 2A5WA 4EATA 4RMNA 4EV0A 2W24A 1BA5A 2PI0A 5HDNA 4ETSA 4OIQF 1XSDA 4UV8A 2M4GA 3G3ZA 1FY7A 2DTZA 1YS7A 2MD5A 4HSTA 3I58A 1X2NA 1ETQA 2HDDA 4WXDA 1R5GA 3CUQA 2EZLA 5A2QZ 2Y0MA 3NRVA 5C4XJ 2NYXA 3GLXA 3SHFA 4XLPF 3RKQA 3PSFA 1HKSA 3K1MA 3MWMA 4I0AA 1KQ8A 3TL4X 3K6GA 2LKPA 2HYJA 1NK3P 1EKEA 4V2FA 5KAFC 2M7BA 3F8NA 3O8HA 1S6LA 4NNJA 1VQMI 2EB7A 2DJIA 4U87A 3F8BA 3L09A 3GFMA 3I4MJ 5DDGA 3BZKA 3GYHX 1FTZA 1IDYA 3PL8A 1K61A 3CCYA 1Z9CA 3GX4X 2AXTC 4DZPA 5CVJA 4LG3A 3UKGA 1DU6A 1FOXA 2Z33A 3DBRB 2UXXA 3CMEI 2E2HJ 4PGHA 2JPCA 2QCOA 1K6OA 4PUSA 1RR7A 2IJLA 1ZKGA 5FLXZ 5H20A 2C6YA 2L02A 1TWCJ 1HSJA 1ZG3A 1BOAA 2V1NA 1OLTA 2F48A 2QVOA 2HVSA 3IH3A 3U1KA 1W36D 2DPDA 5D8LB 4MQVA 2E2IJ 2XB0X 1QVUA 3RCOA 2OC6A 1R36A 2WADA 2XSJC 3BQZA 4UXNA 2LF8A 2JUCA 2ZBKA 1W0TA 3JREA 3BTCA 3CQZJ 1VQ9I 1ZRFA 5E3NA 4ENMA 2WY8Q 1T95A 1TZLA 4S0HB 1UMQA 2JRMA 4P55A 5EF6A 1E0EA 1H9GA 1QHGA 4JX6A 2KP6A 1HF0A 4LD5A 3D0SA 2Y2ZA 1K78B 4A3EJ 2R7UA 4ESBA 3VEPA 1WGXA 1B9NA 1W7PD 2EIKH 3H36A 3BG6A 2X51A 3M3YJ 2ZCWA 2HVRA 2OTLI 5L3CA 3E1SA 4M74A 1ULYA 4BY1J 2BVMA 3AAFA 5CQGA 1JUMA 3TQNA 3F22A 3GUDA 3ULQB 5GPCA 5FRMA 5GAHJ 3KCCA 1E3HA 3ZGKA 1R1TA 3C1DA 3DWLE 2XAQA 3B73A 1XMXA 3BR6A 3JAMZ 1IRXA 5EDNA 5IOYA 2LF7A 1MNMC 3T0YA 2ISYA 3IKTA 2FBKA 3QODA 3OYJA 5LEJA 2R7ZJ 5GTHC 4LB6B 4EEFG 5HLTA 2EINH 2R7VA 1HXDA 1SFXA 2EZKA 3FXLA 4L5JA 5DUIA 1XSVA 1BIAA 4WWCA 1WSUA 4AYBN 2QBYA 2EZHA 3FWEA 5CPRB 4OOIA 4B09A 4E6KG 5LD2C 4ESJA 4II2A 2V7FA 2DT7B 4C2TA 4YFKF 1QNTA 3H3ZA 4YFNF 1YIJI 1UHMA 2EA2A 2E19A 3ABUA 3GLLA 5M3FJ 1JUSA 3LA3A 5IYBJ 3IUOA 5D8KB 2V9KA 3JRIA 3SXYA 2CV2A 2RGVA 3J80K 1Z6TA 2DOAA 1RUOA 3CZ6A 4ITVA 4HF1A 4RM3A 1VTNC 1Y6IA 4Q5SF 2GAUA 2ZB9A 2VQCA 1UJ8A 5E3OA 2KZGA 1T8IA 2NOGA 4I98B 3RPUA 3I54A 2VBYA 2CSOA 5ICFA 3LNQA 2HPIA 1IAWA 3A0HC 2DA2A 3K4MA 3H5RA 2ELJA 4XOTA 3JTGA 4LK1F 3Q9VA 3A01A 3DKXA 1AOYA 3HBLA 5CVUA 3FMQA 2IGNA 4I99C 1GLNA 4M6VA 1UCRA 3OIQA 2ZKZA 5B3SH 1R22A 4E70A 1UFMA 5GAEJ 2XDVA 3CJRB 3QOEA 2VASA 4AD9A 2NVXJ 3M8EA 4BS9A 1YI2I 2KRCA 1BL0A 1OPCA 4HAMA 4ENNA 2BBYA 2LNBA 1LFUP 3V8KA 1D5VA 4PSWA 2MABA 4BJ5C 2X6XA 1SD6A 5KNLA 2L01A 2VC1A 3D5RC 3CUQC 2EFNA 1K4SA 4R8HA 1ZRCA 3W3CA 2R7FA 1LE8B 3V8LA 1O3SA 5H2FC 3I71A 3JRBA 1GT0C 4ZC3A 1ETXA 3L2QA 3W6KB 2CQNA 2R7WA 3FK7A 3PFIA 3HC7A 2MYSA 1UELB 4D1QA 4E7ZA 1PYVA 2Y75A 2GOXB 3MEXA 1WKMA 3CDIA 1X3WB 4H0EA 1VQ5I 1U2WA 3DBLB 3W2WA 4L5EA 1TWFJ 4BYYA 5ILSA 3D5SC 1RKWA 2X9DA 3K4BA 2OZ6A 2E1MB 3QQAA 2PG4A 3M1CA 1OQYA 2DLLA 3N97A 2V1DA 2W25A 1NHAA 1QVTA 1VQ7I 1ORKA 4HF0A 1G3WA 2K9NA 4CYCA 2R93J 1TBXA 3KYCB 3KLNA 2D2WA 4C30A 3ZQIA 2QSHX 1FTTA 1QQIA 2HQAA 4M3GA 4XLNF 2W7NA 3EETA 1LKXA 3OMYA 3EYYA 3VYRB 2Q2EB 3K7AJ 1XMAA 4LLGF 4ASNA 1SMYF 1B8IA 2EA4A 4A2UA 2K3PA 1PJRA 3HPGA 2DW4A 3ZMSA 2V1XA 2ZXIA 1R23A 2HQNA 3PQJA 1IG7A 2X1CA 2GOMA 1BI1A 1XN7A 3TO9A 4YIFA 2HI3A 3COAC 4F93B 4DBRA 3RQ4A 1U5TB 3MMYB 3L2UA 3ASOH 3RYRA 2ZMEA 1K6YA 3HOZJ 2HDWA 1FC3A 3WGGA 2V9PA 1IN5A 3FBNB 3E6MA 2DI3A 3KZYA 3WG7H 3R6SA 3WE3A 5F6FA 5FLVA 2M30A 1GHCA 1FIPA 3FKIJ 2XPUA 1SD5A 2G7UA 3RI4A 1B4AA 2UV1A 3K4KA 1RRJA 1CF7A 3VFZA 3WU2C 4BQNA 1IN4A 2B7EA 3QAHA 4KYWA 2KPMA 3A2KA 5KVRA 3NEUA 2VQLA 4D5CA 1ENHA 1JI8A 2BGCA 4GDFA 3FF5A 5D6FA 1ZTRA 5KCMA 1ZLJA 4IVNA 2OQGA 5C4JJ 4RB2C 4HBLA 3NWTA 1FP2A 4S05A 3G1OA 3FXRA 1B9MA 3QYEA 3MAJA 2JN6A 3KP4A 4LG0B 2WAQN 2VJIA 2EV5A 3ZRGA 4M72A 1FOYA 3OYDA 1MD0A 2ZNZA 5D4RA 4AUXA 1R9TJ 1JE8A 5J40A 1FZPB 1IDZA 1R5HA 1IV8A 2JPBA 3DLLF 4U0VA 3KLOA 4CCKA 3RZOJ 3VSLA 4HNUA 3OSFA 4WCGA 2L4AA 3V42A 4FX4A 2Z2SB 4XMYA 3ZMVA 1MBFA 3I59A 5AIPA 5JHUA 4YIIA 3MZYA 4A5NA 2LRDA 2H8RA 1EH7A 4P1WA 5B66C 3HOTA 4I01A 4IL6C 5GAGJ 5LHIA 3HSFA 3G1MA 2MGQA 4CICA 2ADUA 4BNCA 3H9JA 1HW2A 3HUGB 1KYZA 3OY9A 2X85A 1DGWY 4AYBA 1QO0D 2X6OA 4GXOA 1ZR2A 2EZIA 2VUMJ 5F0CA 2O03A 3Q0UA 2VJ5A 1ETOA 4XM3A 1I5ZA 2LY2A 4NC8A 1P4WA 4OU0A 4D9JA 4OIRF 2V26A 3OV8A 5ICCA 2NS8A 2VE8A 1F5TA 1SANA 5D5XB 3S16J 2EFOA 3DV8A 1YRNB 2P5VA 3CCEI 3KZIC 3RPQA 2EPFA 1O3QA 2O61A 3JSOA 2HS5A 4MO7A 3GEZA 3OYEA 3LFKA 4UB6C 1CGPA 1EH6A 3WTUC 3FXKA 2M0MA 1B72A 2Z1DA 1J5YA 1MW7A 1F36A 3OYCA 4BQQA 3S3OA 3G71I 3OS2A 4XIDA 1XGSA 2QYOA 5HS9A 4IKFA 1AA7A 2CQXA 3WHCA 1LJ9A 1JTXA 4PFOA 2D45A 3L2WA 1MGTA 3SDGA 3FDYA 1KU2A 4F7ZA 5M5WJ 2KT0A 2FEZA 1X1DA 1R58A 3I64A 1POGA 4EGYA 1OR7A 4IQ4A 1J75A 3JRDA 3KYDB 4KMUX 3CO7C 3SZGA 4XKCA 4FE7A 1P2FA 1JKOC 3LSPA 2BYVE 1ONVA 2Y31A 1O57A 2H6CA 3FM3A 4N4NB 2ELHA 2K9LA 2OBPA 5FFZA 4NQWA 3K70C 3K2ZA 4L9VA 3W6VA 1S29A 4FISA 4BL0B 3EUHC 5HNHA 1Y39A 4M3DA 4JQFA 3KPHA 1RZ4A 3CCJI 3GZNB 4P5OA 3K1NA 1H8AC 1TNSA 1A5JA 4Y15A 4XSXF 2M3AA 2IGKA 3DEWA 1DPRA 4FASD 2A6HF 2AQFA 3CCMI 1I39A 1IRFA 4F52A 1KGSA 1T0FA 2KJBA 2VBXA 1V5FA 2V4JC 4KN4X 4A0YA 1IRGA 1YJ9I 4OINF 1FT9A 3WTWC 1K79A 3LSJA 3VODA 2LK2A 3CCSI 5DEQA 1XCBA 2F2EA 2NVTJ 3E5QA 4M3BA 4RAYA 3AL0C 2OCCH 2K40A 4QWQA 1JJ6C 5DYMA 2ZJPF 2JVHA 3HTUA 1ZLKA 3Q5FA 1V5GA 3S3MA 2CW7A 2E71A 2WA0A 1Z77A 1KU3A 2F4IA 4Y7NJ 2OQRA 2ZMEC 1XD7A 2DMTA 1ZK8A 2LOOA 3EPZA 1QZYA 4YEJA 4LB5A 2OD5A 4M9ZA 5LRSA 1Z3YA 4PJJA 1SD7A 1FYKA 2AXLA 2ZJ2A 1MMGA 3QU6A 4BU2A 1IRZA 4A0ZA 2H1LA 2R7QA 4LITA 3J80Z 2HVQA 4A3GJ 1SAUA 4I0BA 1ZREA 4PDKA 3LQRA 5C44J 2XF5A 1YW7A 2A07F 2RKHA 2ETHA 4A3IJ 4L18B 3ABKH 3JRGA 4D5FA 5E8IA 3JRFA 2HR3A 3KP5A 1XSXA 1GV5A 4LK0F 3OYIA 1W7PB 1WJAA 3PNTA 4RB3C 3BR0A 2UUZA 4OIOF 1P7IA 4KMFA 2MC3A 2RAEA 2FJ1A 5EEHA 3ZCOA 3OS1A 1IXCA 1XGNA 2L7MP 2HKXA 5IY5H 1R00A 3HYIA 2H6BA 2KZVA 3BCAA 1KQ0A 1PUFA 1V54H 2J5OA 2FU4A 4DOZA 2ECCA 3M8JA 4HW0A 3IWZA 2UXNA 4O5VA 3I9V2 2VPRA 2L9SA 4FETA 3CC4I 1QU3A 3PO3J 1FBUA 3M8FA 3KETA 1S3JA 2LBFA 4XLHA 1XCVA 1MBHA 2OJED 3S2HJ 3KX2A 4IHYA 2V6EA 2IAIA 1ITYA 3WTZA 3G1LA 1WH5A 2QKLB 4MTEA 2F5VA 2J5PA 3F6VA 3BQYA 3M07A 2LSOA 1Y56A 1I3QJ 3ZXSA 4KT6A 5IT3A 3CJTB 2PBIA 1ZHFA 3HGGA 3BCBA 1FX7A 1HW1A 1ETYA 2ZFWA 3R4KA 4DYRA 2LH9A 2PEXA 2TRTA 2WAQA 2L7FP 2KIUA 2VJJA 1HOMA 4WX9A 2CO5A 3CUOA 3GTJJ 2BHYA 1KQ9A 4ZYAA 1F9NA 2HTJA 1OFCX 4YRVA 4MFEA 2PMHA 3QYFA 3GFIA 1SMTA 1FOWA 2E1NA 3S14J 3TKYA 3TW7A 5CQEA 3MD2A 3QPTA 3C2HA 1X19A 3ELKA 3O6BB 5F08A 4FCYA 1W5CC 3BR3A 2VI6A 1QHHD 2CV1A 1MKMA 1MMDA 3LAPA 4B1RA 1I3AA 5LEKA 2WWYA 3HB9A 4GRIA 3QYBA 5DCMB 2K3FA 2FUG2 3LA7A 4XN3A 3GWZA 3ZQLA 3P9KA 1YTYA 3SQNA 4RGSA 1OCRH 1LPQA 3IH2A 4PJLA 5E8GA 2AS5F 2XRLA 4XRFA 2VT2A 3FHNA 3DU5A 2P0WA 4LGWA 5FKOA 2LD5A 5JVTA 3Q9SA 2GWRA 2DJNA 2CJJA 4HX4A 4IZZA 1NH3A 3GCMA 5EJCA 1MBEA 3ZQ7A 3OL3A 1LB2A 3TDZC 4KIGA 3RJPA 3DKYA 1WPKA 4BXFA 2CRGA 5EGOB 2KDZA 3BZ6A 3WE2A 1T0FC 2X6WA 3F8FA 1D8KA 1U9OA 2LMDA 1USSA 4EGZA 2A6TA 3ESWB 2LREA 4MGRA 1AWCA 2ZSHB 3PNYA 3WODF 3GTPJ 2KHMA 4BHPA 4AVPA 2VBZA 3REOA 4BH9A 4NC6A 4RB0A 2HKOA 1HLVA 3Q0VA 1AKHA 1SVLA 4ZH4F 4BJTA 2XGDA 2R5ZB 5LGTA 4JX4A 2M4KA 4BEHA 2H09A 3HPHA 2CFXA 2YPRA 1TQMA 2XASA 2R7TA 2M2EA 2ELKA 1YLFA 4BE1A 3PUFA 1NK2P 1KA8A 1X1BA 1TNTA 3UR3C 3ZMUA 4HQEA 4ZZLA 1VNDA 1GXPA 3R60A 1HCRA 3ERMA 3MN2A 3K4NA 1Q1VA 5M5YJ 1HC8A 2NS0A 2XB5A 3HM5A 4RM2A 3BT9A 1IUYA 3CCVI 4G8XA 3A02A 1TL8A 3N05A 5HLIA 3FKJA 1JXSA 2V79A 4U0WA 1B8IB 4QIWN 4N0BA 4FHTA 3TO7A 2DQLA 2XIGA 5H6RA 1QGPA 2X6YA 3RYPA 3BR5A 3BWGA 2HEOA 3E6BA 3LSTA 5E3MA 1U3EM 1WHUA 3JCUC 4BE2A 1QRYA 2DODA 5HS7A 5JHFA 1Y0UA 1J09A 1USTA 1FMWA 4IOCF 2VE9A 3ABMH 1IO2A 4E7IA 1JGGA 1N77A 2EIMH 4H4KC 4U7DA 1MBKA 3TBIA 4BGDA 2XF7A 3P9CA 4CUGA 3OS0A 4XICA 2R5YA 3FX3A 1STZA 2R3SA 2DMPA 2NXNB 4EJTA 4QTRA 1UG2A 3RKXA 1WRJA 5LHGA 5L3FA 2CQKA 5EZGA 3J7ZI 3TW6A 3T8TA 2JMWA 5JVGF 1A35A 4E7SA 2Y9ZA 5IT9K 1AHDP 3PJRA 5GP9A 5E3LA 4LLNA 4RGUA 1H89C 2IS6A 1RIOH 2M8GX 2VC0A 3LOCA 2QQ8A 2L54A 2BW3B 2XKOA 2R7XA 3S32A 1KZHA 3BC8A 2LYCA 3BR1A 4LLLA 4MIMA 3BROA 5HDGA 3PO2J 2DYRH 1GDTA 4M73A 4KIBA 5KAIC 4CZCA 1DPUA 2ME6A 1XDSA 5IP6A 2ZXHA 3KE2A 2COMA 3I56I 1NG6A 4F3QA 5HODA 3GTMJ 3ZOBA 5JR3A 2IXSA 1WJDA 3HOXJ 3BR2A 2M45A 3RDIA 5JLXA 2PMZN 3J81K 4HSRA 5BNGA 4AWXB 3E7LA 3FMSA 1Y8QB 2P6SA 1JT6A 4GO1A 2DU9A 2IGOA 4D7NA 1YYVA 4GCVA 3VWBA 1MBGA 2XGCA 3F72A 3W2VA 2O0YA 5BPIA 3ML6A 4V19K 1TWAJ 1DP7P 1NTCA 3RPUD 4I7HA 3G6EI 4II3A 4WXCA 5ICGA 4Q4ZF 3DBHB 3LA2A 4QLCU 1IN7A 1YFHA 1A04A 5EG0B 3PNVA 2D1VA 2CYYA 2WAFA 1A36A 1WJEA 1X4OA 2WBMA 2L3DA 2GXBA 1LVKA 3RZDJ 5BQTA 1YJNI 5IPAA 1BC7C 3F8CA 2JA7J 2EILH 4N9IA 4XOPA 3ZMTA 2ACJA 4E7LA 3AG2H 2CUFA 1W5SA 5IYDJ 3K4CA 1P92A 1VI0A 3HKZN 3MKZA 4W97A 4OIPF 2JK3A 1VQNI 1Z7UA 4KICA 1YW8A 2E1OA 2HYFA 2DFEA 4YIRX 1AU7A 2RDPA 2E34A 3ZPLA 2XAHA 4MNUA 2Q1ZB 3O2PE 4IRIA 2NRAC 4CCLA 4L9NA 1Z91A 2M34A 5K5QA 2KRHA 3OYGA 3C2GA 1YQAA 4E4HA 1MBJA 4XLAA 2R0QC 2VJ4A 3HOYJ 3E6DA 2QKMB 1Z3XA 3GZ5A 1N78A 2PJPA 1G2HA 3H5NA 3TGNA 2DBBA 2P8TA 4YG2F 1RUNA 3DPUA 2JA5J 4C2MJ 1BJZA 4XL9A 2H1KA 2XV4S 1LDJA 4HYEA 3GTOJ 3KEQA 3L2RA 5E18F 5DM6F 3CMAI 2HDCA 4RGXA 4HQMA 2JSCA 3LL7A 3FXQA 3BG5A 1WJ5A 2G7HA 2VKDA 3EUHA 3CJNA 3M4OJ 3OYHA 4WXHA 4RGRA 1ZG1A 2W85A 1HDPA 1H9TA 2B63J 3GW2A 2ZJQF 1K4TA 3R0AA 4ZTFA 4KA4A 4B3AA 3EQLF 4BDYA 3OWTA 3HOUJ 3I4NJ 3IP4B 4B44A 3SZTA 5K7HA 5EEAA 1TT0A 4L5IA 4UUVA 3VYSB 2UZKA 3E5XA 2GXAA 1BM9A 1R1VA 3GTQJ 3LFUA 4IRHA 2DCEA 4UUSB 4M3FA 2IP2A 2VB6A 3KIOA 3SEQA 2L7KA 2MG4A 3RQIA 2PJRB 4NB5A 4BHCA 4XQFA 1VQ8I 1SVOA 2M9HA 2XUBA 3WU1B 3PIPF 4RAFA 2Z99A 3IHUA 2G9WA 4E7KA 3H5AA 4XK4A 3CC2I 3E3VA 2DOEA 4P9FA 2HYGD 3WTXC 3TOBA 3OYLA 1FPQA 3DEEA 3V7CA 3S1NJ 3B02A 2Q8KA 2EFPA 4PSXA 4CGZA 3JW4A 3BTJA 2BOLA 1T39A 1F43A 3OYAA 3C7JA 3F6OA 2G0EA 2LDUA 2PLYA 2VKEA 1S8NA 1QBJA 3OYFA 3M7GA 4HZFA 1IUFA 5HVQC 4N9HA 2CUJA 4OWRB 3F9KA 1X1PA 4UUTA 2XHKA 1K78A 4IHVA 2PQ8A 5A2QK 1YW9A 1D1AA 2FMLA 2W82A 3IAS2 3E5UA 1YE9A 2FXAA 3DTKA 4XR6A 4I09A 1O3RA 2DK8A 2Y30A 1R5ID 2F5FA 4PK4A 5ED4A 1R1UA 1TWHJ 4ABZA 5E20A 3H0GJ 4RAGA 1IC8A 2W57A 5FKMA 4EMSA 2FX0A 3L2CA 3ONQA 2Q0OA 4IHTA 4UV9A 2DMUA 3BLYA 3V7SA 4NDLA 3AG3H 2DA5A 4KJZA 3DP7A 4A6EA 1X1AA 2XKPA 2F6CA 1RPWA 2IEKA 2LKSA 3WHBA 4RLQA 4C3JJ 1FYLA 3S8PA 4L0YB 2ZO4A 4M6XA 1S7EA 1P4XA 1JT0A 1ETVA 1OMIA 1IV6A 5AIQA 4DBQA 1SVMA 2F5EA 2ZC2A 2XVCA 3A4CA 4EJUA 3BG3A 5DUKA 5FD5A 1U0JA 4S04A 1ZYRF 3OR1C 2W00A 3PSIA 1BBYA 1OJLA 3JSPA 4UVBA 2WY7Q 1JGSA 2JRTA 2VL8A 3HXLA 4XNFA 3HRTA 4Y3OA 1ON2A 1EF4A 3NQOA 2MH2A 2O5RA 2YU3A 1KYWA 2HZTA 4BUPA 3WTYC 3HHHA 1U8RA 1MDMB 1H88C 1Y0NA 3PFYA 4HRIA 4F55A 3IWFA 3O3KA 1LFPA 1XGOA 2PMZA 2XF6A 2H27A 2X1DA 1E3OC 1WCMJ 3HOVJ 3LSMA 2XPWA 1O7LA 2VT3A 3OYNA 2L7ZA 5FB2A 1QZZA 2F4OB 2Y48A 1WWXA 5DD4A 5E1XA 4AIHA 1MIJA 1FNNA 2K27A 1MJBA 2M8EA 3G2BA 5CVRA 4BQOA 4CSWA 3FHZA 4EM1A 2D1HA 5IP7J 5H6QA 2VKVA 3WTVC 5IP9J 1OYYA 4CCNA 1OYIA 4MEYF 4A3BJ 1X2MA 3I55I 3QPLA 2NS7A 4A0XA 5FROA 1LE8A 3IKVA 2A05A 1REPC 3HKZA 3AKZA 1Z05A 1WQ2A 3CUQB 4L9JA 4B48A 2LY1A 3IH4A 4L9TA 1GVDA 1R4NB 4BHBA 3K4JA 1OISA 4I76A 5J4YA 3DPTA 2EIJH 1ZAOA 1E3PA 4J19A 1FWZA 1TLHB 3S1RJ 1Y1VJ 2F5DA 4IJAA 4L0ZB 2CMPA 2Y69H 5K7ZA 5HOOA 2A68F 3IAM2 4MTDA 3ZN1A 3L00A 3OR2C 4HOBA 3DTEA 4CA0A 5IT9Z 5DD8A 2QLZA 1AKHB 1VQ4I 1IN8A 5LGNA 1UB9A 2E36A 2QGUA 2DFIA 2RNGA 4CXFA 4A93J 5CYVA 2M87A 4D0PA 3K9TA 3HGYA 3H9GA 2MA3A 4Q47A 3SEZA 1GUUA 2XC7A 4RS8A 3U9GA 3J7AO 4G6DA 4DW6A 3GF2A 4HNTA 2BVLA 3ROUA 3PQKA 2CQQA 3JRAA 1LFBA 2VLAA 4HPQA 4KUMA 3AG4H 1D8JA 2Q2EA 2K85A 5JI6A 3MKWB 3CCUI 5F0HA 1WZ2A 3JRCA 1ERDA 1BI3A 3IRQA 2WC2A 3VPRA 5TGTA 1LEBA 3IV5A 3IL2A 1Y1WJ 1W4MA 4IRGA 2NVUB 3VB2A 2H94A 2DDAA 5E1WA 3J81Z 1HA8A 2ISZA 2JQ7A 3ZQGA 1U5TA 2DA3A 4CH7A 4KN7X 2AQEA 2VOOA 3ECOA 3CMMA 2XAJA 4CCMA 1TP4A 4BBSJ 5FKNA 1P7JA 2ZSIB 2P7VB 2RQPA 2YU9J 2VXZA 3S2WA 5KK1A 4LOCA 2K9QA 1YOVB 5HLHA 3ERED 3CF2A 3CESA 2BV6A 3CLQA 5KHDA 2FRHA 3LQQA 3FXUA 2K4BA 2Z16A 1JHHA 1UG0A 4JP0A 2XAUA 3WTTC 3SJMA 3K4LA 1VQ6I 4XN0A 2QENA 4N4OB 4O6JA 2DOFA 2E5ZA 2JA6J 2Y0SN 1T38A 3CDLA 2YX7A 5LHHA 4RLFA 1YS6A 3B6AA 1V4RA 3CJQB 1I1GA 5FKKA 5B5EC 4OMZA 1QA6A 3IC7A 3DFGA 1HBXG 2DDBA 4JBAA 3IRRA 1IN6A 2L9RA 1I50J 1S72I 2IS4A 3DU6A 4LG0A 2QBYB 1R7JA 2KFDA 5CVIA 4BY7J 4BXUA 4BDZA 5GADJ 5LGUA 2JUGA 1RESA 4M9XA 3BG7A 2KQRA 3HRUA 2W4SA 3BG9A 3VYTB 2IS2A 2OAZA 1PVEA 1XPXA 2BY3A 2HZDA 4KIFA 5BMZA 9ANTA 1RETA 3I5UA 2F4MB 2FSWA 4HV5A 3ZN0A 4PZJA 4F92B 1SEUA 3HRMA 2O8KA 2CV0A 5L3BA 5FKLA 1BI0A 2FNAA 5J1RA 4IHWA 1G3TA 4MQ9F 4XBFA 2IW5A 1JHFA 4AU7A 1VFCA 2DXIA 3HUGA 3QWLA 2IGMA 1RKTA 3RKWA 4XRSG 4DQ2A 1Z1DA 2R7OA 2EQRA 2RV8A 1V5EA 4ZYDA 2LKXA 5F04A 4AC0A 2DYSH 1VZ0A 1TW2A 1LEAA 1TWGJ 2NVQJ 3A01B 5FRNA 2QEXI 2DN0A 3BP8A 4EJOA 5FD6A 1T2KA 2JSPA 1UZCA 4GYGA 3BPVA 2LR8A 2IT0A 2STTA 1F1ZA 3BZCA 1PDNC 1A6IA 1SD4A 4OAYA 1YRNA 3HIFA 1W5TA 5CVVA 4MEXF 1TW3A 2LFBA 5J1YA 3H3VK 2BHZA 1MNDA 3FXOA 1OYWA 1P9QC 3KP6A 1EJ9A 1X3ZB 1LNWA 4YELA 4HEA2 1IXRC 5K7FA 4G7HF 4A3DJ 2WB1N 4YFXF 3VOEA 2K9SA 3X2QH 1TTYA 2CFOA 4M9SA 1SFKA 1XTAA 4ZJZA 4ENJA 2JWTA 2A61A 4IOAF 2FD5A 2QM3A 1R4MB 3CLOA 3S17J 4GFBA 2ZXJA 1R49A 3GBGA 4PFPA 1L3LA 2FBHA 5F64A 5ILUA 2NNYA 2COBA 5DS9A 5F0FA 5K5RA 4ZTJA 1ON1A 1X3UA 4EQQA 1APLC 2CQ7A 2A3SA 2K4JA 2E1MC 4IX7A 5K5OA 2KRFA 4Y17A 2QQBA 4AVZA 5FLMJ 3LAJA 5BPDA 5CKTA 1S7OA 1ZGAA 2HPMA 2V9VA 4A3FJ 1YX5A 2VN2A 1MSEC 1TT5B 3FZVA 5DTDA 4E7HA 3HDDA 3DXJF 4X1EA 2FQ3A 3DPLC 5GTIC 1XGMA 1I6XA 2RNJA 4CO8A 5L3EA 4RB1A 1DDNA 4O3MA 1JUPA 4CYCB 1D1CA 5F1RA 2JVGA 4NUBA 2L2OA 2X48A 1ZN2A 1G6NA 1RR8C 2P5KA 3PIOF 4G7ZF 4HNVA 2LP0A 1Z7LA 1WJBA 3TDUC 3OYKA 2EH3A 3KEYA 2X0LA 3GTGJ 5FGMA 1YHQI 2K5CA 3AL0B 3W6JB 1U5TC 3HZJA 3SYTA 2P81A 5J4VA 3QOPA 3TMOA 4Y52J 2DMNA 4FT8A 1A6QA 2A6EF 3LSKA 2ZMEB 2E60A 4U88A 4QPOA 4DIQA 3EUAA 4PCQA 1O4XA 5L3DA 2RN7A 2MW8A 1LUJB 5B1AH 1JKPC 2E35A 1U8BA 3NWSA 1I1SA 3E97A 4J00A 4E7JA 1T6SA 2HXOA 3MKLA 1RI7A 3MZ8A 1RNLA 4HG2A 1CF7B 3H1CA 3O8GA 2DK5A 5EEGA 1JKQC 4HDVA 1GXQA 1X58A 2K86A 5J8FA 1D0ZA 5ERIA 3WTSC 3H92A 1W7PA 4HV6A 3KP3A 4KT5C 4XKWA 2VODA 1SC7A 2PN6A 4AIKA 5HDKA 4XONA 4RDUA 5J8CA 3RKYA 4IHSA 2CGPA 1VQPI 2L9NA 3K10A 2FOKA 3CDHA 3GO5A 1E17A 4R1HA 2EFQA 1SFUA 5F1JA 1LVAA 1MJAA 4MHGA 4NHJA 1BW5A 4UB8C 1FEXA 3VSKA 3BTIA 3HG9A 3D5LA 1WJCA 1R71A 1C0WA 5J47A 4GGGA 1YO5C 4ZDPA 1LDKB 1BJAA 1I27A 3ZQFA 4XKBA 2ME0A 3K0LA 4Y33A 2DA4A 4HX8A 2F5CA 4A3JJ 5BOXA 4HLYA 3RSNA 3ZMDA 4LMYA 2I8DA 1Z6RA 3E0JB 2Z9OA 4I02A 1G3SA 1HW5A 2Y0SA 2O7OA 4ZYGA 4G6QA 1ZRDA 1MZBA 3I59B 3CF5F 1RC9A 3LSGA 2R4GA 2NVYJ 2RC4A 2BY2A 2OU2A 4BE0A 1U78A 1CQTA 4HLXA 3BJAA 3FK6A 3MQ0A 2IPQX 1Q1HA 3QP6A 3A1YA 1XX5A 1T33A 4NBQA 1MNEA 5D5WB 3L9FA 1JKRC 4B47A 2TDXA 4HA8A 4XKVA 2R7SA 3WGHA 5DM7F 1IJWC 2EBIA 2GXGA 2FE3A 2DTRA 4U7BA 4IXAA 1FBQA 2BY1A 2R7DA 4ZYEA 4DNCA 2K7LA 1WH7A 3LSRA 2DO7A 1P6RA 3K69A 3GXOA 1Z67A 2W84A 3E6CC 2FBIA 2NNNA 5EYRA 2DT5A 3ABLH 2UWMA 3KP7A 4BBRJ 2QF7A 1XC5A 2KJCA 3WGIA 1B72B 2OA4A 5DCMA 2K02A 3LMMA 3AFHA 2L9VA 2AO9A 4JYKA 3NARA 2WV0A 4DGWB 2HQRA 3OIPA 2L5QA 3DTIA 3ASNH 4B8XA 2LVSA 1OCOH 1ETWA 3FMRA 2CW0F 5LFAA 5D4SA 2ID3A 2N8GA 2FQ4A 2KIFA 3BY6A 2QQ9A 3F3XA 4GYIA 4NQWB 2VBWA 2JTVA 2KIQA 2GA2A 4G12A 2GLOA 3L1PA 1WJFA 1O3TA 5HS8A 2CWEA 3FM5A 4QSHA 4TV7A 1ZARA 3K70D 5EGOA 1J2XA 5F27A 1SFOJ 3T8RA 2BY0A 3ZMZA 1K7AA 2HTSA 1TQIA 1HSTA 3QU3A 3SDBA 2WB1A 1YITI 4CCJA 2FMYA 2IA2A 2Z3YA 4DZJA 3HEFA 2IA1A 3I53A 2ECBA 3OYMA 3SZPA 3ZQQA 4AIDA 1FMVA 4B43A 1EV7A 3ISPA 1G4DA 5JLWA 1H0MA 2K9MA 2R5ZA 3TO6A 1WI9A 3PM1A 3CP2A 3G73A 1PP7U 3AG1H 1FSEA 4RBOA 4UNOA 4KNYA 4ANJA 4A3CJ 1W36C 4AIJA 2YSRA 2FOWA 3QRFF 1OKRA 5LBQA 3HTSB 1BOBA 2YX4A 5FJ8J 3ECHA 3F21A 1MH3A 1UAAA 1L0OC 3OOUA 2P6TA 2VOPA 2H8WA 3GFJA 3LWFA 3KFWX 2I10A 2R92J 1OCCH 2JJ7A 2HU9A 1ZELA 3QPSA 2BXYA 1ODDA 4CHUA 1MMSA 2ID6A 3HSEA 3WU0A 2JA2A 4Z6YA 1XB4A 1IW7F 2BEOA 3FIWA 2FF4A 3Q3SA 4DJAA 2P4WA 3KYLA 1FLIA 4C3HJ 1IXSB 3HOWJ 3C18A 3DEUA 3TEDA 2KKOA 1LDDA 2OCEA 4G94A 3ZR8X 4RA2A 4EJWA 2QA4I 5M5XJ 3MKYB 2E7WA 2XGXA 1MSFC 1G59A 2P5LC 2OPTA 2HGCA 1F4KA 3SFZA 1KU9A 5HNFA 4P9UA 2P7CB 3OYBA 4CYDA 1N25A 3J7YJ 2LC2A 1YX3A 2MH9A 3QP5A 2M5WA 4NC7A 2QSFX 1HKQA 2LY9A 1EA3A 4FX0A 4MFDA 2I5UA 3N4MA 4UY8I 2BXZA 4A69C 1V55H 5J6XA 5FFXA 5FO5A 3F8MA 1Z21A 4X6AJ 3GFLA 5E79C 4FE4A 1HKTA 1PUFB 2PFBA 2PMUA 1FYMA 3H35A 2MSYA 3TP0A 3CP8A 4UVAA 3WG9A 2PX9A 3FBIB 2R7RA 2MLKA 4C3IJ 3MFKA 3R61A 2LBFB 2MC4A 1J9IA 4KFCA 4LFUA 4DYQA 5TRDA 2YR2A 5FLXK 3DF8A 2FNPA 1OCTC 5E17F 3P5JA 3M1EA 2CU7A 2BW3A 3CC7I 3B6CA 3P9IA 1U6GA 4WK8F 2EFWA 3OSGA 1BIBA 3V4GA 2EJRA 3JTHA 3RTRA 1J7KA 2HWVA 1V3FA 4M3EA 3S2DJ 3OOPA 2QUFA 1IGNA 2M1BA 2IVMA 3FISA 4XORA 3CD6I 3A0BC 3KEOA 2CG4A 3CCRI 4M6YA 1DP3A 2ZNYA 1FSHA 2O6GE 4HX7A 3QPHA 1D0YA 1VF9A 2O3FA 3MVPA 5L3GA 1HDDC 1Y8RB 3U1DA 4EM2A 4IPAA 2DMQA 1D0XA 4BACA 4LIUA 3H0DA 1FBSA 3HHGA 1FP1D 1DGRM 1IZ1A 1LQ1A 2WTEA 2M0CA 3SFIA 3ZP5A 4Q48A 4BKXA 1B1BA 1BW6A 1NG7A 2KL4A 1OCZH 2MBFA 4V2GA 4XLCA 3L2VA 3CCQI 4A3MJ 1D5YA 3BTLA 1BR4A 2DQRA 1QZEA 1MMAA 2HFHA 4A6DA 5K1YA 3HL2A 2STWA 2RREA 2XROA 1R6RA 2CS3A 1FIAA 1P4AA 2RQQA 3HRSA 2X4HA 2O9LA 5EG0A 2ESHA 1W0UA 1IF1A 1G3YA 4Y4RA 5CJ9A 5J3LA 4ENKA 6PAXA 4EJVA 1ETKA 2L4MA 4A3LJ 3DLAA 2CUEA 2OV7A 3S93A 3S1QJ 3S15J 4ESFA 1ACIA 1WI3A 1ZQ3P 2DA1A 2ESNA 2HNHA 3JAMK 2NOJB 2JA8J 2IRFG 1MMNA 4IO9F 1DU0A 1ZR4A 3BJOA 1KU7A 4DYCA 2QSGX 2GQQA 4G7OF 3HJEA 2CW8A 4D7MA 1FOKA 4Z2YA 4KDPA 1WFXA 2KDOA 2HXIA 3J7AY 2DT6A 2FA5A 1XDUA 4XSZF 1G8XA 3T5XA 4A3KJ 3U21A 4R79A 1B59A 5EZHA 4X0GA 1XG1A 4EM0B 3F23A 3JRHA 3EDPA 2ZJRF 1S9HA 2MFZA 3ZQCA 2GA1A 2Y9YA 2DA6A 2E1CA 3EUKL 4XLEA 1I6HJ 2D5VA 5E1ZB 2B9SA 4JX5A 3C3WA 1S7AA 1XMKA 2MD0A 2O8XA 4P96A 1HQCA 2EV0A 4XRMA 2E2JJ 2OUMA 2VONA 3JR9A 2XRNA 3OIOA 2XAGA 1VQKI 3S3NA 3GMEA 4BEHB 4A5MA 1N75A 2XAFA 4WF2A 1VQLI 2CH0A 3CMYA 2VKHA 3DKWA 3BDDA 4CDGA 3D1NI 2IS1A 5IOZA 3H3UA 3BOQA 4PJNA 3L7WA 2LTPA 5TJJA 3VDXA 5AONA 1DUXC 3NAUA 1WVRA 2XSDC 1JJ8C 1T56A 3LSIA 1X4PA 4ZDLA 3V7RA 1VQOI 3I0TA 3UNGC 4UUSA 1UHWA 4BXXJ 2KMUA 1JTYA 5B1BH 3ZQHA 2OZUA 2L0KA 2PJRA 2WAEA 2IBDA 3K1PA 1PP8F 3TP3A 4FQGA 1BI2A 2GM4A 1T98A 2VIXA 1MH4A 2VQHA 4G9YA 2IA0A 3S1MJ 3CTAA 3VYUB 2VPLA 5D5UB 4QPQA 3RIRA 2V1UA 2HOAA 3Q0WA 1EH8A 2A69F 2DFHA 4FTHA 3KZZA 2LG4A 1K83J 4MLOA 2DAOA 3LSHA 3BJ6A 4BAYA 3OL4A 5C3EJ 4LIVA 1J59A 2DPUA 4I2OA 4F91B 1TC3C 2OTJI 4AM3A 1ZGWA 1QPIA 2R5YB 2W1OA 3GZ6A 2KISA 4PJ0C 5M3MJ 4C2UA 4IQJA 4IEJA 2QQAA 2AHQA 2E5NA 2QWWA 2LLKA 5ICEA 3H9QA 4JOMA 2ZFUA 3EYIA 3FXJA 4UVCA 4B3XA 2X1EA
chains in the Genus database with same CATH topology
5DCFA 1BC8C 4OMYA 1SAXA 2GIVA 2BE5F 3M9AA 4BQAA 4ZZDA 1ZGJA 5LLQA 5BS6A 1YIOA 4ON0A 1BN5A 4ZYHA 3HOSA 4HDUA 1PUEE 2GZWA 3GVAA 1B6AA 1O7FA 2V6CA 1ZH5A 3U2RA 3P7NA 3ABTA 5DV5A 4JK1X 2JZYA 4UHTA 2QZ8A 1GVJA 2E7XA 3I4PA 2A5YB 4RAZA 4K2EA 2MLGA 1ZG5A 2EWNA 3MZHA 2RVCA 3KP2A 4IF4A 1TQPA 2HOEA 3HSRA 1MJ9A 5D5VB 3DQVC 3CO6C 2Z5UA 4LJZF 4M71A 4HF2A 3T1BA 3BPXA 3V8JA 1MDMA 3TOAA 2B0LA 2KIMA 1D3YA 2NAZA 3R0JA 4EVIA 4A12A 5CLSA 1SFEA 4Y13A 1J0RA 1E2XA 3MCZA 1QPMA 4PGGA 4CZZA 2JT1A 4U0YA 1YG2A 2EV6A 5D6EA 2EK5A 5LRRA 5HLGA 5ILVA 5JFRA 4EV0A 2W24A 2PI0A 5HDNA 4ETSA 4OIQF 1XSDA 4UV8A 3G3ZA 1FY7A 1YS7A 2MD5A 3I58A 4WXDA 1R5GA 3CUQA 5A2QZ 2Y0MA 3NRVA 2NYXA 3GLXA 3SHFA 4XLPF 1KQ8A 4I0AA 1HKSA 3K1MA 3MWMA 2LKPA 3F8NA 1S6LA 2EB7A 3F8BA 3L09A 3GFMA 5DDGA 3GYHX 1Z9CA 3GX4X 5CVJA 2Z33A 2UXXA 4PGHA 2JPCA 1K6OA 2IJLA 5FLXZ 5H20A 2C6YA 2L02A 1HSJA 1ZG3A 1BOAA 2QVOA 2DPDA 5D8LB 4MQVA 1R36A 4UXNA 2LF8A 2ZBKA 1ZRFA 4ENMA 4P55A 1H9GA 4LD5A 3D0SA 1K78B 4ESBA 3VEPA 1B9NA 1W7PD 2ZCWA 5L3CA 4M74A 1ULYA 3AAFA 3TQNA 3F22A 3GUDA 3ULQB 3KCCA 1R1TA 3C1DA 2XAQA 3B73A 3JAMZ 2LF7A 3T0YA 2ISYA 3IKTA 2FBKA 5LEJA 4LB6B 1HXDA 1SFXA 4L5JA 5DUIA 1XSVA 1BIAA 4WWCA 1WSUA 2QBYA 3FWEA 4OOIA 4B09A 4ESJA 4YFKF 1QNTA 3H3ZA 4YFNF 1UHMA 2EA2A 3ABUA 3LA3A 5D8KB 3SXYA 2RGVA 3J80K 1Z6TA 1RUOA 4HF1A 1VTNC 4Q5SF 2GAUA 4I98B 3RPUA 3I54A 2VBYA 2CSOA 5ICFA 1IAWA 3JTGA 4LK1F 3Q9VA 1AOYA 5CVUA 3FMQA 1UCRA 2ZKZA 1R22A 4E70A 1UFMA 4AD9A 3M8EA 1OPCA 4HAMA 4ENNA 2BBYA 2LNBA 3V8KA 1D5VA 1SD6A 2L01A 2VC1A 3CUQC 2EFNA 4R8HA 1ZRCA 2R7FA 3V8LA 1O3SA 3I71A 3W6KB 3PFIA 2Y75A 3MEXA 1WKMA 4H0EA 1U2WA 4BYYA 5ILSA 2OZ6A 2PG4A 2DLLA 3N97A 2V1DA 2W25A 1NHAA 4HF0A 1G3WA 1TBXA 3KLNA 2D2WA 1QQIA 4XLNF 3EETA 3EYYA 1XMAA 4LLGF 4ASNA 1SMYF 2EA4A 4A2UA 2DW4A 3ZMSA 2V1XA 1R23A 2HQNA 3PQJA 1BI1A 1XN7A 3TO9A 4YIFA 3COAC 1U5TB 3RYRA 2ZMEA 1FC3A 3WGGA 1IN5A 3E6MA 2DI3A 3KZYA 3R6SA 3WE3A 5F6FA 2M30A 1GHCA 1SD5A 2G7UA 3RI4A 1B4AA 1CF7A 3VFZA 1IN4A 3QAHA 4KYWA 5KVRA 3NEUA 2BGCA 3FF5A 5D6FA 1ZLJA 4IVNA 2OQGA 4RB2C 4HBLA 1FP2A 4S05A 3FXRA 1B9MA 3MAJA 3KP4A 4LG0B 2EV5A 4M72A 1MD0A 2ZNZA 5D4RA 1JE8A 1FZPB 1R5HA 2JPBA 4U0VA 3KLOA 4WCGA 2L4AA 4FX4A 3ZMVA 3I59A 5AIPA 5JHUA 4YIIA 3MZYA 4A5NA 1EH7A 3HOTA 4I01A 5LHIA 3HSFA 4CICA 2ADUA 4BNCA 1HW2A 1KYZA 1QO0D 4GXOA 2O03A 1I5ZA 1P4WA 4OU0A 4OIRF 3OV8A 5ICCA 2VE8A 1F5TA 5D5XB 2EFOA 3DV8A 2P5VA 3RPQA 1O3QA 2O61A 3JSOA 2HS5A 3GEZA 3LFKA 1CGPA 1EH6A 3WTUC 1J5YA 1XGSA 2QYOA 5HS9A 1LJ9A 2D45A 1MGTA 4F7ZA 1KU2A 2FEZA 1R58A 3I64A 4EGYA 1OR7A 1J75A 4KMUX 3CO7C 1P2FA 2BYVE 1ONVA 1O57A 2H6CA 3FM3A 2ELHA 2OBPA 5FFZA 4NQWA 3K2ZA 4L9VA 1S29A 4JQFA 1RZ4A 4P5OA 3K1NA 1TNSA 4Y15A 4XSXF 1DPRA 2A6HF 1IRFA 1KGSA 1T0FA 2KJBA 2VBXA 4KN4X 1IRGA 4A0YA 4OINF 1FT9A 3WTWC 1K79A 3VODA 5DEQA 1XCBA 2F2EA 3E5QA 4RAYA 4QWQA 5DYMA 1ZLKA 3HTUA 3Q5FA 1KU3A 2OQRA 1XD7A 1QZYA 4LB5A 2OD5A 4M9ZA 5LRSA 1SD7A 1FYKA 2AXLA 2ZJ2A 3QU6A 4A0ZA 3J80Z 1ZREA 4I0BA 4PDKA 3LQRA 1YW7A 2A07F 2RKHA 2ETHA 4L18B 5E8IA 2HR3A 3KP5A 1XSXA 4LK0F 1W7PB 4RB3C 4OIOF 4KMFA 2MC3A 5EEHA 1IXCA 1XGNA 2HKXA 1R00A 3HYIA 2H6BA 1KQ0A 2J5OA 2FU4A 4HW0A 3IWZA 2UXNA 4O5VA 1FBUA 3M8FA 3KETA 1S3JA 1XCVA 3WTZA 4MTEA 2J5PA 3F6VA 2LSOA 5IT3A 2PBIA 1ZHFA 1FX7A 1HW1A 2ZFWA 3R4KA 2PEXA 2KIUA 4WX9A 2CO5A 3CUOA 1KQ9A 1F9NA 2HTJA 2PMHA 3GFIA 1SMTA 2E1NA 3TKYA 3QPTA 3ELKA 3O6BB 1MKMA 3LAPA 5LEKA 2WWYA 5DCMB 3LA7A 3GWZA 3P9KA 1YTYA 3SQNA 4RGSA 5E8GA 2AS5F 4XRFA 2VT2A 4LGWA 5JVTA 3Q9SA 2GWRA 4HX4A 3ZQ7A 1LB2A 3TDZC 4KIGA 3RJPA 3BZ6A 3WE2A 3F8FA 1D8KA 1USSA 4EGZA 4MGRA 1AWCA 3WODF 4BHPA 4AVPA 2VBZA 3REOA 4BH9A 4RB0A 2HKOA 4ZH4F 5LGTA 2H09A 2CFXA 2YPRA 1TQMA 2XASA 1YLFA 1KA8A 1TNTA 3ZMUA 4HQEA 4ZZLA 1GXPA 3R60A 2NS0A 1IUYA 4G8XA 5HLIA 1JXSA 2V79A 4U0WA 4N0BA 4FHTA 3TO7A 2DQLA 2XIGA 5H6RA 1QGPA 3RYPA 3BWGA 2HEOA 3E6BA 3LSTA 1U3EM 5HS7A 1Y0UA 1USTA 2VE9A 4U7DA 3P9CA 3FX3A 1STZA 2R3SA 4EJTA 3RKXA 1WRJA 5LHGA 5L3FA 2CQKA 3T8TA 5IT9K 4LLNA 4RGUA 1RIOH 2VC0A 2L54A 2XKOA 4LLLA 3BROA 5HDGA 4M73A 4KIBA 1DPUA 1XDSA 3KE2A 2COMA 5JR3A 2M45A 3RDIA 3J81K 4AWXB 3FMSA 2P6SA 4GO1A 2DU9A 1YYVA 4GCVA 3F72A 2O0YA 5BPIA 3ML6A 1DP7P 4I7HA 4WXCA 5ICGA 4Q4ZF 3LA2A 4QLCU 1IN7A 1YFHA 1A04A 2D1VA 2CYYA 2GXBA 2L3DA 5BQTA 1BC7C 3F8CA 4N9IA 3ZMTA 2ACJA 1W5SA 1P92A 4OIPF 1Z7UA 4KICA 1YW8A 2HYFA 2RDPA 3ZPLA 2XAHA 4MNUA 3O2PE 4IRIA 2NRAC 4L9NA 1Z91A 5K5QA 1YQAA 3E6DA 3GZ5A 2PJPA 3TGNA 2DBBA 2P8TA 4YG2F 1RUNA 2XV4S 1LDJA 4HYEA 3KEQA 5E18F 2HDCA 4RGXA 4HQMA 2JSCA 3FXQA 2G7HA 3EUHA 3CJNA 4WXHA 4RGRA 1ZG1A 2W85A 1H9TA 3GW2A 3R0AA 4KA4A 3EQLF 3SZTA 4L5IA 4UUVA 2UZKA 3E5XA 1BM9A 1R1VA 4IRHA 2IP2A 4NB5A 4BHCA 2XUBA 3WU1B 2Z99A 3IHUA 2G9WA 3E3VA 4P9FA 2HYGD 3WTXC 3TOBA 1FPQA 3V7CA 3B02A 2Q8KA 2EFPA 4CGZA 3JW4A 1T39A 3C7JA 3F6OA 2LDUA 2PLYA 1S8NA 1QBJA 3M7GA 4HZFA 5HVQC 4N9HA 2XHKA 1K78A 2PQ8A 5A2QK 1YW9A 2FMLA 3E5UA 2FXAA 4I09A 1O3RA 2DK8A 2F5FA 5ED4A 1R1UA 5E20A 2W57A 4EMSA 3L2CA 2Q0OA 4IHTA 4UV9A 3V7SA 3DP7A 4A6EA 2XKPA 1FYLA 4L0YB 2ZO4A 4M6XA 1P4XA 1OMIA 5AIQA 2F5EA 2XVCA 4EJUA 5FD5A 5DUKA 4S04A 1ZYRF 1BBYA 3JSPA 4UVBA 1JGSA 2JRTA 3HRTA 1ON2A 3NQOA 2MH2A 2YU3A 1KYWA 2HZTA 3WTYC 3HHHA 1U8RA 1MDMB 3IWFA 3O3KA 1XGOA 2H27A 1O7LA 2VT3A 5FB2A 1QZZA 2Y48A 4AIHA 5E1XA 1WWXA 5DD4A 1FNNA 2K27A 5CVRA 1MJBA 2M8EA 3FHZA 4EM1A 2D1HA 5H6QA 3WTVC 1OYYA 1OYIA 4MEYF 4A0XA 3IKVA 1REPC 1Z05A 1WQ2A 3CUQB 4L9JA 4L9TA 4BHBA 3DPTA 1ZAOA 1FWZA 1TLHB 2F5DA 4IJAA 4L0ZB 5HOOA 2A68F 4MTDA 3ZN1A 3L00A 4HOBA 5IT9Z 5DD8A 2QLZA 1IN8A 5LGNA 1UB9A 4CXFA 2DFIA 5CYVA 2M87A 4D0PA 3K9TA 2MA3A 4Q47A 4RS8A 3U9GA 3J7AO 4G6DA 3GF2A 3ROUA 3PQKA 4KUMA 1D8JA 2Q2EA 5JI6A 1BI3A 3IRQA 2WC2A 1LEBA 3IL2A 1W4MA 4IRGA 3VB2A 2H94A 5E1WA 3J81Z 2ISZA 1U5TA 4KN7X 2VOOA 3ECOA 2XAJA 2P7VB 2RQPA 2VXZA 3S2WA 5KK1A 5HLHA 3ERED 2BV6A 2FRHA 3LQQA 3FXUA 2K4BA 1JHHA 3WTTC 2QENA 4O6JA 1T38A 2YX7A 5LHHA 1YS6A 1V4RA 1I1GA 4OMZA 3IC7A 3DFGA 1HBXG 4JBAA 3IRRA 1IN6A 4LG0A 2QBYB 1R7JA 5CVIA 4BXUA 5LGUA 4M9XA 3HRUA 2OAZA 4KIFA 5BMZA 3I5UA 2FSWA 4HV5A 3ZN0A 4PZJA 3HRMA 5L3BA 1BI0A 2FNAA 1G3TA 4MQ9F 4XBFA 2IW5A 1JHFA 3HUGA 4DQ2A 3RKWA 1Z1DA 2RV8A 4ZYDA 1TW2A 1LEAA 3BP8A 4EJOA 5FD6A 1T2KA 4GYGA 3BPVA 2IT0A 2STTA 1F1ZA 1PDNC 1SD4A 3HIFA 1W5TA 5CVVA 4MEXF 1TW3A 1OYWA 3KP6A 1LNWA 1IXRC 4G7HF 4YFXF 3VOEA 1TTYA 4M9SA 4ENJA 2A61A 2QM3A 3CLOA 2ZXJA 1L3LA 2FBHA 5F64A 5ILUA 2NNYA 5K5RA 1ON1A 1X3UA 4EQQA 2A3SA 2K4JA 5K5OA 2KRFA 4Y17A 2QQBA 3LAJA 5BPDA 1S7OA 1ZGAA 2V9VA 2VN2A 3FZVA 3DXJF 2FQ3A 3DPLC 1XGMA 1I6XA 2RNJA 4CO8A 5L3EA 4RB1A 1DDNA 4O3MA 5F1RA 1ZN2A 1G6NA 2P5KA 4G7ZF 3TDUC 2X0LA 5FGMA 3W6JB 1U5TC 3QOPA 4FT8A 2A6EF 2ZMEB 4U88A 4PCQA 5L3DA 2RN7A 1I1SA 3E97A 1T6SA 1RI7A 1RNLA 1CF7B 2DK5A 5EEGA 4HDVA 1GXQA 2K86A 5J8FA 5ERIA 3WTSC 3H92A 1W7PA 4HV6A 3KP3A 4KT5C 2VODA 2PN6A 4AIKA 5HDKA 5J8CA 3RKYA 4IHSA 2CGPA 2FOKA 3CDHA 3GO5A 1E17A 4R1HA 2EFQA 1SFUA 1LVAA 1MJAA 4MHGA 4NHJA 3D5LA 1C0WA 4GGGA 1YO5C 1LDKB 1BJAA 1I27A 3K0LA 4HX8A 2F5CA 5BOXA 4HLYA 3ZMDA 4LMYA 1Z6RA 2Z9OA 4I02A 1G3SA 1HW5A 4ZYGA 4G6QA 1ZRDA 1MZBA 3I59B 2RC4A 2OU2A 1U78A 4HLXA 3BJAA 3MQ0A 2IPQX 1Q1HA 3QP6A 5D5WB 3L9FA 2TDXA 4HA8A 3WGHA 2GXGA 2FE3A 2DTRA 4U7BA 4IXAA 1FBQA 2R7DA 4ZYEA 4DNCA 2K7LA 2DO7A 1P6RA 3K69A 3GXOA 2W84A 3E6CC 2FBIA 2NNNA 2DT5A 2UWMA 3KP7A 2KJCA 3WGIA 2OA4A 5DCMA 2K02A 2WV0A 2HQRA 4B8XA 3FMRA 2CW0F 5D4SA 2KIFA 3BY6A 2QQ9A 3F3XA 4GYIA 2VBWA 2JTVA 2GA2A 1O3TA 5HS8A 2CWEA 3FM5A 4TV7A 1ZARA 1J2XA 3T8RA 3ZMZA 1K7AA 2HTSA 1TQIA 1HSTA 3QU3A 2FMYA 2IA2A 2Z3YA 2IA1A 3I53A 3SZPA 1EV7A 3ISPA 1G4DA 1H0MA 3TO6A 1WI9A 3G73A 1PP7U 1FSEA 4UNOA 4KNYA 4AIJA 2YSRA 3QRFF 1OKRA 5LBQA 3HTSB 2YX4A 3F21A 3ECHA 1L0OC 2P6TA 2VOPA 3GFJA 3LWFA 3KFWX 1ODDA 4CHUA 3HSEA 3WU0A 1XB4A 1IW7F 2BEOA 2FF4A 2P4WA 1FLIA 1IXSB 3C18A 3DEUA 2KKOA 1LDDA 4G94A 4EJWA 2E7WA 2XGXA 2P5LC 2HGCA 1F4KA 3SFZA 1KU9A 4P9UA 2P7CB 4CYDA 2MH9A 3QP5A 2M5WA 1HKQA 4FX0A 3N4MA 5J6XA 5FFXA 5FO5A 3F8MA 3GFLA 1HKTA 2PFBA 2PMUA 1FYMA 4UVAA 3WG9A 2MLKA 3MFKA 3R61A 1J9IA 4KFCA 4LFUA 5TRDA 2YR2A 5FLXK 3DF8A 2FNPA 5E17F 3M1EA 2EFWA 3P9IA 1U6GA 4WK8F 1BIBA 3V4GA 2EJRA 3JTHA 3RTRA 1J7KA 2HWVA 1V3FA 3OOPA 2QUFA 2M1BA 2IVMA 3KEOA 2CG4A 4M6YA 2ZNYA 1FSHA 2O6GE 4HX7A 3QPHA 2O3FA 5L3GA 3U1DA 4EM2A 4IPAA 1FBSA 3HHGA 1FP1D 1LQ1A 1IZ1A 2WTEA 3ZP5A 4Q48A 1B1BA 2MBFA 2DQRA 2HFHA 4A6DA 5K1YA 2STWA 2XROA 3HRSA 1P4AA 2X4HA 2ESHA 1IF1A 1G3YA 5CJ9A 4ENKA 6PAXA 4EJVA 2L4MA 4ESFA 2ESNA 3JAMK 2IRFG 3BJOA 1KU7A 2GQQA 4G7OF 1FOKA 4Z2YA 4KDPA 2FA5A 1XDUA 4XSZF 3T5XA 4R79A 1B59A 4EM0B 3F23A 3EDPA 2GA1A 2E1CA 5E1ZB 3C3WA 1S7AA 1XMKA 2O8XA 4P96A 1HQCA 2EV0A 2VONA 2XRNA 2XAGA 4A5MA 2XAFA 4WF2A 3DKWA 3BDDA 4CDGA 3H3UA 3BOQA 3L7WA 5TJJA 5AONA 1DUXC 3V7RA 3I0TA 1UHWA 2OZUA 3K1PA 1PP8F 1BI2A 1T98A 4G9YA 2IA0A 3CTAA 5D5UB 3RIRA 2V1UA 1EH8A 2A69F 3KZZA 2DAOA 3BJ6A 4BAYA 1J59A 2DPUA 4I2OA 3GZ6A 2QQAA 2QWWA 5ICEA 3EYIA 4UVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCF A;  1BC8 C;  4OMY A;  1SAX A;  2GIV A;  2BE5 F;  3M9A A;  4BQA A;  4ZZD A;  1ZGJ A;  5LLQ A;  5BS6 A;  1YIO A;  4ON0 A;  1BN5 A;  4ZYH A;  3HOS A;  4HDU A;  1PUE E;  2GZW A;  3GVA A;  1B6A A;  1O7F A;  2V6C A;  1ZH5 A;  3U2R A;  3P7N A;  3ABT A;  5DV5 A;  4JK1 X;  2JZY A;  4UHT A;  2QZ8 A;  1GVJ A;  2E7X A;  3I4P A;  2A5Y B;  4RAZ A;  4K2E A;  2MLG A;  1ZG5 A;  2EWN A;  3MZH A;  2RVC A;  3KP2 A;  4IF4 A;  1TQP A;  2HOE A;  3HSR A;  1MJ9 A;  5D5V B;  3DQV C;  3CO6 C;  2Z5U A;  4LJZ F;  4M71 A;  4HF2 A;  3T1B A;  3BPX A;  3V8J A;  1MDM A;  3TOA A;  2B0L A;  2KIM A;  1D3Y A;  2NAZ A;  3R0J A;  4EVI A;  4A12 A;  5CLS A;  1SFE A;  4Y13 A;  1J0R A;  1E2X A;  3MCZ A;  1QPM A;  4PGG A;  4CZZ A;  2JT1 A;  4U0Y A;  1YG2 A;  2EV6 A;  5D6E A;  2EK5 A;  5LRR A;  5HLG A;  5ILV A;  5JFR A;  4EV0 A;  2W24 A;  2PI0 A;  5HDN A;  4ETS A;  4OIQ F;  1XSD A;  4UV8 A;  3G3Z A;  1FY7 A;  1YS7 A;  2MD5 A;  3I58 A;  4WXD A;  1R5G A;  3CUQ A;  5A2Q Z;  2Y0M A;  3NRV A;  2NYX A;  3GLX A;  3SHF A;  4XLP F;  1KQ8 A;  4I0A A;  1HKS A;  3K1M A;  3MWM A;  2LKP A;  3F8N A;  1S6L A;  2EB7 A;  3F8B A;  3L09 A;  3GFM A;  5DDG A;  3GYH X;  1Z9C A;  3GX4 X;  5CVJ A;  2Z33 A;  2UXX A;  4PGH A;  2JPC A;  1K6O A;  2IJL A;  5FLX Z;  5H20 A;  2C6Y A;  2L02 A;  1HSJ A;  1ZG3 A;  1BOA A;  2QVO A;  2DPD A;  5D8L B;  4MQV A;  1R36 A;  4UXN A;  2LF8 A;  2ZBK A;  1ZRF A;  4ENM A;  4P55 A;  1H9G A;  4LD5 A;  3D0S A;  1K78 B;  4ESB A;  3VEP A;  1B9N A;  1W7P D;  2ZCW A;  5L3C A;  4M74 A;  1ULY A;  3AAF A;  3TQN A;  3F22 A;  3GUD A;  3ULQ B;  3KCC A;  1R1T A;  3C1D A;  2XAQ A;  3B73 A;  3JAM Z;  2LF7 A;  3T0Y A;  2ISY A;  3IKT A;  2FBK A;  5LEJ A;  4LB6 B;  1HXD A;  1SFX A;  4L5J A;  5DUI A;  1XSV A;  1BIA A;  4WWC A;  1WSU A;  2QBY A;  3FWE A;  4OOI A;  4B09 A;  4ESJ A;  4YFK F;  1QNT A;  3H3Z A;  4YFN F;  1UHM A;  2EA2 A;  3ABU A;  3LA3 A;  5D8K B;  3SXY A;  2RGV A;  3J80 K;  1Z6T A;  1RUO A;  4HF1 A;  1VTN C;  4Q5S F;  2GAU A;  4I98 B;  3RPU A;  3I54 A;  2VBY A;  2CSO A;  5ICF A;  1IAW A;  3JTG A;  4LK1 F;  3Q9V A;  1AOY A;  5CVU A;  3FMQ A;  1UCR A;  2ZKZ A;  1R22 A;  4E70 A;  1UFM A;  4AD9 A;  3M8E A;  1OPC A;  4HAM A;  4ENN A;  2BBY A;  2LNB A;  3V8K A;  1D5V A;  1SD6 A;  2L01 A;  2VC1 A;  3CUQ C;  2EFN A;  4R8H A;  1ZRC A;  2R7F A;  3V8L A;  1O3S A;  3I71 A;  3W6K B;  3PFI A;  2Y75 A;  3MEX A;  1WKM A;  4H0E A;  1U2W A;  4BYY A;  5ILS A;  2OZ6 A;  2PG4 A;  2DLL A;  3N97 A;  2V1D A;  2W25 A;  1NHA A;  4HF0 A;  1G3W A;  1TBX A;  3KLN A;  2D2W A;  1QQI A;  4XLN F;  3EET A;  3EYY A;  1XMA A;  4LLG F;  4ASN A;  1SMY F;  2EA4 A;  4A2U A;  2DW4 A;  3ZMS A;  2V1X A;  1R23 A;  2HQN A;  3PQJ A;  1BI1 A;  1XN7 A;  3TO9 A;  4YIF A;  3COA C;  1U5T B;  3RYR A;  2ZME A;  1FC3 A;  3WGG A;  1IN5 A;  3E6M A;  2DI3 A;  3KZY A;  3R6S A;  3WE3 A;  5F6F A;  2M30 A;  1GHC A;  1SD5 A;  2G7U A;  3RI4 A;  1B4A A;  1CF7 A;  3VFZ A;  1IN4 A;  3QAH A;  4KYW A;  5KVR A;  3NEU A;  2BGC A;  3FF5 A;  5D6F A;  1ZLJ A;  4IVN A;  2OQG A;  4RB2 C;  4HBL A;  1FP2 A;  4S05 A;  3FXR A;  1B9M A;  3MAJ A;  3KP4 A;  4LG0 B;  2EV5 A;  4M72 A;  1MD0 A;  2ZNZ A;  5D4R A;  1JE8 A;  1FZP B;  1R5H A;  2JPB A;  4U0V A;  3KLO A;  4WCG A;  2L4A A;  4FX4 A;  3ZMV A;  3I59 A;  5AIP A;  5JHU A;  4YII A;  3MZY A;  4A5N A;  1EH7 A;  3HOT A;  4I01 A;  5LHI A;  3HSF A;  4CIC A;  2ADU A;  4BNC A;  1HW2 A;  1KYZ A;  1QO0 D;  4GXO A;  2O03 A;  1I5Z A;  1P4W A;  4OU0 A;  4OIR F;  3OV8 A;  5ICC A;  2VE8 A;  1F5T A;  5D5X B;  2EFO A;  3DV8 A;  2P5V A;  3RPQ A;  1O3Q A;  2O61 A;  3JSO A;  2HS5 A;  3GEZ A;  3LFK A;  1CGP A;  1EH6 A;  3WTU C;  1J5Y A;  1XGS A;  2QYO A;  5HS9 A;  1LJ9 A;  2D45 A;  1MGT A;  4F7Z A;  1KU2 A;  2FEZ A;  1R58 A;  3I64 A;  4EGY A;  1OR7 A;  1J75 A;  4KMU X;  3CO7 C;  1P2F A;  2BYV E;  1ONV A;  1O57 A;  2H6C A;  3FM3 A;  2ELH A;  2OBP A;  5FFZ A;  4NQW A;  3K2Z A;  4L9V A;  1S29 A;  4JQF A;  1RZ4 A;  4P5O A;  3K1N A;  1TNS A;  4Y15 A;  4XSX F;  1DPR A;  2A6H F;  1IRF A;  1KGS A;  1T0F A;  2KJB A;  2VBX A;  4KN4 X;  1IRG A;  4A0Y A;  4OIN F;  1FT9 A;  3WTW C;  1K79 A;  3VOD A;  5DEQ A;  1XCB A;  2F2E A;  3E5Q A;  4RAY A;  4QWQ A;  5DYM A;  1ZLK A;  3HTU A;  3Q5F A;  1KU3 A;  2OQR A;  1XD7 A;  1QZY A;  4LB5 A;  2OD5 A;  4M9Z A;  5LRS A;  1SD7 A;  1FYK A;  2AXL A;  2ZJ2 A;  3QU6 A;  4A0Z A;  3J80 Z;  1ZRE A;  4I0B A;  4PDK A;  3LQR A;  1YW7 A;  2A07 F;  2RKH A;  2ETH A;  4L18 B;  5E8I A;  2HR3 A;  3KP5 A;  1XSX A;  4LK0 F;  1W7P B;  4RB3 C;  4OIO F;  4KMF A;  2MC3 A;  5EEH A;  1IXC A;  1XGN A;  2HKX A;  1R00 A;  3HYI A;  2H6B A;  1KQ0 A;  2J5O A;  2FU4 A;  4HW0 A;  3IWZ A;  2UXN A;  4O5V A;  1FBU A;  3M8F A;  3KET A;  1S3J A;  1XCV A;  3WTZ A;  4MTE A;  2J5P A;  3F6V A;  2LSO A;  5IT3 A;  2PBI A;  1ZHF A;  1FX7 A;  1HW1 A;  2ZFW A;  3R4K A;  2PEX A;  2KIU A;  4WX9 A;  2CO5 A;  3CUO A;  1KQ9 A;  1F9N A;  2HTJ A;  2PMH A;  3GFI A;  1SMT A;  2E1N A;  3TKY A;  3QPT A;  3ELK A;  3O6B B;  1MKM A;  3LAP A;  5LEK A;  2WWY A;  5DCM B;  3LA7 A;  3GWZ A;  3P9K A;  1YTY A;  3SQN A;  4RGS A;  5E8G A;  2AS5 F;  4XRF A;  2VT2 A;  4LGW A;  5JVT A;  3Q9S A;  2GWR A;  4HX4 A;  3ZQ7 A;  1LB2 A;  3TDZ C;  4KIG A;  3RJP A;  3BZ6 A;  3WE2 A;  3F8F A;  1D8K A;  1USS A;  4EGZ A;  4MGR A;  1AWC A;  3WOD F;  4BHP A;  4AVP A;  2VBZ A;  3REO A;  4BH9 A;  4RB0 A;  2HKO A;  4ZH4 F;  5LGT A;  2H09 A;  2CFX A;  2YPR A;  1TQM A;  2XAS A;  1YLF A;  1KA8 A;  1TNT A;  3ZMU A;  4HQE A;  4ZZL A;  1GXP A;  3R60 A;  2NS0 A;  1IUY A;  4G8X A;  5HLI A;  1JXS A;  2V79 A;  4U0W A;  4N0B A;  4FHT A;  3TO7 A;  2DQL A;  2XIG A;  5H6R A;  1QGP A;  3RYP A;  3BWG A;  2HEO A;  3E6B A;  3LST A;  1U3E M;  5HS7 A;  1Y0U A;  1UST A;  2VE9 A;  4U7D A;  3P9C A;  3FX3 A;  1STZ A;  2R3S A;  4EJT A;  3RKX A;  1WRJ A;  5LHG A;  5L3F A;  2CQK A;  3T8T A;  5IT9 K;  4LLN A;  4RGU A;  1RIO H;  2VC0 A;  2L54 A;  2XKO A;  4LLL A;  3BRO A;  5HDG A;  4M73 A;  4KIB A;  1DPU A;  1XDS A;  3KE2 A;  2COM A;  5JR3 A;  2M45 A;  3RDI A;  3J81 K;  4AWX B;  3FMS A;  2P6S A;  4GO1 A;  2DU9 A;  1YYV A;  4GCV A;  3F72 A;  2O0Y A;  5BPI A;  3ML6 A;  1DP7 P;  4I7H A;  4WXC A;  5ICG A;  4Q4Z F;  3LA2 A;  4QLC U;  1IN7 A;  1YFH A;  1A04 A;  2D1V A;  2CYY A;  2GXB A;  2L3D A;  5BQT A;  1BC7 C;  3F8C A;  4N9I A;  3ZMT A;  2ACJ A;  1W5S A;  1P92 A;  4OIP F;  1Z7U A;  4KIC A;  1YW8 A;  2HYF A;  2RDP A;  3ZPL A;  2XAH A;  4MNU A;  3O2P E;  4IRI A;  2NRA C;  4L9N A;  1Z91 A;  5K5Q A;  1YQA A;  3E6D A;  3GZ5 A;  2PJP A;  3TGN A;  2DBB A;  2P8T A;  4YG2 F;  1RUN A;  2XV4 S;  1LDJ A;  4HYE A;  3KEQ A;  5E18 F;  2HDC A;  4RGX A;  4HQM A;  2JSC A;  3FXQ A;  2G7H A;  3EUH A;  3CJN A;  4WXH A;  4RGR A;  1ZG1 A;  2W85 A;  1H9T A;  3GW2 A;  3R0A A;  4KA4 A;  3EQL F;  3SZT A;  4L5I A;  4UUV A;  2UZK A;  3E5X A;  1BM9 A;  1R1V A;  4IRH A;  2IP2 A;  4NB5 A;  4BHC A;  2XUB A;  3WU1 B;  2Z99 A;  3IHU A;  2G9W A;  3E3V A;  4P9F A;  2HYG D;  3WTX C;  3TOB A;  1FPQ A;  3V7C A;  3B02 A;  2Q8K A;  2EFP A;  4CGZ A;  3JW4 A;  1T39 A;  3C7J A;  3F6O A;  2LDU A;  2PLY A;  1S8N A;  1QBJ A;  3M7G A;  4HZF A;  5HVQ C;  4N9H A;  2XHK A;  1K78 A;  2PQ8 A;  5A2Q K;  1YW9 A;  2FML A;  3E5U A;  2FXA A;  4I09 A;  1O3R A;  2DK8 A;  2F5F A;  5ED4 A;  1R1U A;  5E20 A;  2W57 A;  4EMS A;  3L2C A;  2Q0O A;  4IHT A;  4UV9 A;  3V7S A;  3DP7 A;  4A6E A;  2XKP A;  1FYL A;  4L0Y B;  2ZO4 A;  4M6X A;  1P4X A;  1OMI A;  5AIQ A;  2F5E A;  2XVC A;  4EJU A;  5FD5 A;  5DUK A;  4S04 A;  1ZYR F;  1BBY A;  3JSP A;  4UVB A;  1JGS A;  2JRT A;  3HRT A;  1ON2 A;  3NQO A;  2MH2 A;  2YU3 A;  1KYW A;  2HZT A;  3WTY C;  3HHH A;  1U8R A;  1MDM B;  3IWF A;  3O3K A;  1XGO A;  2H27 A;  1O7L A;  2VT3 A;  5FB2 A;  1QZZ A;  2Y48 A;  4AIH A;  5E1X A;  1WWX A;  5DD4 A;  1FNN A;  2K27 A;  5CVR A;  1MJB A;  2M8E A;  3FHZ A;  4EM1 A;  2D1H A;  5H6Q A;  3WTV C;  1OYY A;  1OYI A;  4MEY F;  4A0X A;  3IKV A;  1REP C;  1Z05 A;  1WQ2 A;  3CUQ B;  4L9J A;  4L9T A;  4BHB A;  3DPT A;  1ZAO A;  1FWZ A;  1TLH B;  2F5D A;  4IJA A;  4L0Z B;  5HOO A;  2A68 F;  4MTD A;  3ZN1 A;  3L00 A;  4HOB A;  5IT9 Z;  5DD8 A;  2QLZ A;  1IN8 A;  5LGN A;  1UB9 A;  4CXF A;  2DFI A;  5CYV A;  2M87 A;  4D0P A;  3K9T A;  2MA3 A;  4Q47 A;  4RS8 A;  3U9G A;  3J7A O;  4G6D A;  3GF2 A;  3ROU A;  3PQK A;  4KUM A;  1D8J A;  2Q2E A;  5JI6 A;  1BI3 A;  3IRQ A;  2WC2 A;  1LEB A;  3IL2 A;  1W4M A;  4IRG A;  3VB2 A;  2H94 A;  5E1W A;  3J81 Z;  2ISZ A;  1U5T A;  4KN7 X;  2VOO A;  3ECO A;  2XAJ A;  2P7V B;  2RQP A;  2VXZ A;  3S2W A;  5KK1 A;  5HLH A;  3ERE D;  2BV6 A;  2FRH A;  3LQQ A;  3FXU A;  2K4B A;  1JHH A;  3WTT C;  2QEN A;  4O6J A;  1T38 A;  2YX7 A;  5LHH A;  1YS6 A;  1V4R A;  1I1G A;  4OMZ A;  3IC7 A;  3DFG A;  1HBX G;  4JBA A;  3IRR A;  1IN6 A;  4LG0 A;  2QBY B;  1R7J A;  5CVI A;  4BXU A;  5LGU A;  4M9X A;  3HRU A;  2OAZ A;  4KIF A;  5BMZ A;  3I5U A;  2FSW A;  4HV5 A;  3ZN0 A;  4PZJ A;  3HRM A;  5L3B A;  1BI0 A;  2FNA A;  1G3T A;  4MQ9 F;  4XBF A;  2IW5 A;  1JHF A;  3HUG A;  4DQ2 A;  3RKW A;  1Z1D A;  2RV8 A;  4ZYD A;  1TW2 A;  1LEA A;  3BP8 A;  4EJO A;  5FD6 A;  1T2K A;  4GYG A;  3BPV A;  2IT0 A;  2STT A;  1F1Z A;  1PDN C;  1SD4 A;  3HIF A;  1W5T A;  5CVV A;  4MEX F;  1TW3 A;  1OYW A;  3KP6 A;  1LNW A;  1IXR C;  4G7H F;  4YFX F;  3VOE A;  1TTY A;  4M9S A;  4ENJ A;  2A61 A;  2QM3 A;  3CLO A;  2ZXJ A;  1L3L A;  2FBH A;  5F64 A;  5ILU A;  2NNY A;  5K5R A;  1ON1 A;  1X3U A;  4EQQ A;  2A3S A;  2K4J A;  5K5O A;  2KRF A;  4Y17 A;  2QQB A;  3LAJ A;  5BPD A;  1S7O A;  1ZGA A;  2V9V A;  2VN2 A;  3FZV A;  3DXJ F;  2FQ3 A;  3DPL C;  1XGM A;  1I6X A;  2RNJ A;  4CO8 A;  5L3E A;  4RB1 A;  1DDN A;  4O3M A;  5F1R A;  1ZN2 A;  1G6N A;  2P5K A;  4G7Z F;  3TDU C;  2X0L A;  5FGM A;  3W6J B;  1U5T C;  3QOP A;  4FT8 A;  2A6E F;  2ZME B;  4U88 A;  4PCQ A;  5L3D A;  2RN7 A;  1I1S A;  3E97 A;  1T6S A;  1RI7 A;  1RNL A;  1CF7 B;  2DK5 A;  5EEG A;  4HDV A;  1GXQ A;  2K86 A;  5J8F A;  5ERI A;  3WTS C;  3H92 A;  1W7P A;  4HV6 A;  3KP3 A;  4KT5 C;  2VOD A;  2PN6 A;  4AIK A;  5HDK A;  5J8C A;  3RKY A;  4IHS A;  2CGP A;  2FOK A;  3CDH A;  3GO5 A;  1E17 A;  4R1H A;  2EFQ A;  1SFU A;  1LVA A;  1MJA A;  4MHG A;  4NHJ A;  3D5L A;  1C0W A;  4GGG A;  1YO5 C;  1LDK B;  1BJA A;  1I27 A;  3K0L A;  4HX8 A;  2F5C A;  5BOX A;  4HLY A;  3ZMD A;  4LMY A;  1Z6R A;  2Z9O A;  4I02 A;  1G3S A;  1HW5 A;  4ZYG A;  4G6Q A;  1ZRD A;  1MZB A;  3I59 B;  2RC4 A;  2OU2 A;  1U78 A;  4HLX A;  3BJA A;  3MQ0 A;  2IPQ X;  1Q1H A;  3QP6 A;  5D5W B;  3L9F A;  2TDX A;  4HA8 A;  3WGH A;  2GXG A;  2FE3 A;  2DTR A;  4U7B A;  4IXA A;  1FBQ A;  2R7D A;  4ZYE A;  4DNC A;  2K7L A;  2DO7 A;  1P6R A;  3K69 A;  3GXO A;  2W84 A;  3E6C C;  2FBI A;  2NNN A;  2DT5 A;  2UWM A;  3KP7 A;  2KJC A;  3WGI A;  2OA4 A;  5DCM A;  2K02 A;  2WV0 A;  2HQR A;  4B8X A;  3FMR A;  2CW0 F;  5D4S A;  2KIF A;  3BY6 A;  2QQ9 A;  3F3X A;  4GYI A;  2VBW A;  2JTV A;  2GA2 A;  1O3T A;  5HS8 A;  2CWE A;  3FM5 A;  4TV7 A;  1ZAR A;  1J2X A;  3T8R A;  3ZMZ A;  1K7A A;  2HTS A;  1TQI A;  1HST A;  3QU3 A;  2FMY A;  2IA2 A;  2Z3Y A;  2IA1 A;  3I53 A;  3SZP A;  1EV7 A;  3ISP A;  1G4D A;  1H0M A;  3TO6 A;  1WI9 A;  3G73 A;  1PP7 U;  1FSE A;  4UNO A;  4KNY A;  4AIJ A;  2YSR A;  3QRF F;  1OKR A;  5LBQ A;  3HTS B;  2YX4 A;  3F21 A;  3ECH A;  1L0O C;  2P6T A;  2VOP A;  3GFJ A;  3LWF A;  3KFW X;  1ODD A;  4CHU A;  3HSE A;  3WU0 A;  1XB4 A;  1IW7 F;  2BEO A;  2FF4 A;  2P4W A;  1FLI A;  1IXS B;  3C18 A;  3DEU A;  2KKO A;  1LDD A;  4G94 A;  4EJW A;  2E7W A;  2XGX A;  2P5L C;  2HGC A;  1F4K A;  3SFZ A;  1KU9 A;  4P9U A;  2P7C B;  4CYD A;  2MH9 A;  3QP5 A;  2M5W A;  1HKQ A;  4FX0 A;  3N4M A;  5J6X A;  5FFX A;  5FO5 A;  3F8M A;  3GFL A;  1HKT A;  2PFB A;  2PMU A;  1FYM A;  4UVA A;  3WG9 A;  2MLK A;  3MFK A;  3R61 A;  1J9I A;  4KFC A;  4LFU A;  5TRD A;  2YR2 A;  5FLX K;  3DF8 A;  2FNP A;  5E17 F;  3M1E A;  2EFW A;  3P9I A;  1U6G A;  4WK8 F;  1BIB A;  3V4G A;  2EJR A;  3JTH A;  3RTR A;  1J7K A;  2HWV A;  1V3F A;  3OOP A;  2QUF A;  2M1B A;  2IVM A;  3KEO A;  2CG4 A;  4M6Y A;  2ZNY A;  1FSH A;  2O6G E;  4HX7 A;  3QPH A;  2O3F A;  5L3G A;  3U1D A;  4EM2 A;  4IPA A;  1FBS A;  3HHG A;  1FP1 D;  1LQ1 A;  1IZ1 A;  2WTE A;  3ZP5 A;  4Q48 A;  1B1B A;  2MBF A;  2DQR A;  2HFH A;  4A6D A;  5K1Y A;  2STW A;  2XRO A;  3HRS A;  1P4A A;  2X4H A;  2ESH A;  1IF1 A;  1G3Y A;  5CJ9 A;  4ENK A;  6PAX A;  4EJV A;  2L4M A;  4ESF A;  2ESN A;  3JAM K;  2IRF G;  3BJO A;  1KU7 A;  2GQQ A;  4G7O F;  1FOK A;  4Z2Y A;  4KDP A;  2FA5 A;  1XDU A;  4XSZ F;  3T5X A;  4R79 A;  1B59 A;  4EM0 B;  3F23 A;  3EDP A;  2GA1 A;  2E1C A;  5E1Z B;  3C3W A;  1S7A A;  1XMK A;  2O8X A;  4P96 A;  1HQC A;  2EV0 A;  2VON A;  2XRN A;  2XAG A;  4A5M A;  2XAF A;  4WF2 A;  3DKW A;  3BDD A;  4CDG A;  3H3U A;  3BOQ A;  3L7W A;  5TJJ A;  5AON A;  1DUX C;  3V7R A;  3I0T A;  1UHW A;  2OZU A;  3K1P A;  1PP8 F;  1BI2 A;  1T98 A;  4G9Y A;  2IA0 A;  3CTA A;  5D5U B;  3RIR A;  2V1U A;  1EH8 A;  2A69 F;  3KZZ A;  2DAO A;  3BJ6 A;  4BAY A;  1J59 A;  2DPU A;  4I2O A;  3GZ6 A;  2QQA A;  2QWW A;  5ICE A;  3EYI A;  4UVC A; 
#chains in the Genus database with same CATH topology
 1T08 B;  4ZDO A;  5DCF A;  4XLF A;  1Z0X A;  4I6Z A;  1BR1 A;  1BC8 C;  2GIZ A;  4OMY A;  1SAX A;  2GIV A;  4PJM A;  2BZT A;  2BE5 F;  2M7A A;  3FXM A;  3M9A A;  4BQA A;  4C9Y A;  4ZZD A;  1ZGJ A;  5LLQ A;  5BS6 A;  4G6T B;  1YIO A;  4ON0 A;  1S5L C;  2ZXW H;  4IHX A;  1BN5 A;  3W2A A;  4ZYH A;  3HOS A;  1D1B A;  4HDU A;  4B4C A;  2W48 A;  1PUE E;  4KIS A;  1W1W E;  2GZW A;  3GVA A;  1DQU A;  1B6A A;  3PUB A;  5J1U A;  2XPV A;  1KON A;  1O7F A;  2V6C A;  1ZH5 A;  3A03 A;  3G4S I;  3U2R A;  3F0C A;  3P7N A;  3ABT A;  5DV5 A;  3CCL I;  2TCT A;  4JK1 X;  2CUZ A;  2JZY A;  4UHT A;  1BR2 A;  2QZ8 A;  1GVJ A;  2E7X A;  3I4P A;  2A5Y B;  4RAZ A;  4K2E A;  2MLG A;  1YJW I;  4J01 A;  1ZG5 A;  2EWN A;  3MZH A;  2RVC A;  1FJL A;  3KP2 A;  4IF4 A;  1M1E B;  2YUS A;  1TQP A;  2HOE A;  3HSR A;  1MJ9 A;  5D5V B;  4W1U A;  1UHS A;  3DQV C;  3CO6 C;  2HOS A;  2HQ5 A;  2Z5U A;  3K2A A;  1X1C A;  4LJZ F;  1OCP A;  4M71 A;  1XS9 A;  4KIT B;  2WV1 A;  2OF7 A;  4HF2 A;  3T1B A;  3BPX A;  3V8J A;  5TIS C;  1MDM A;  1GV2 A;  2B0L A;  3TOA A;  5GPA A;  4XRS A;  2HOT A;  2KIM A;  1D3Y A;  2ICW G;  2VXD A;  3I3L A;  4CCO A;  3GTL J;  4OAZ A;  1U9N A;  2NAZ A;  3R0J A;  4EVI A;  4A12 A;  5CLS A;  1SFE A;  4Y13 A;  1J0R A;  1E2X A;  3GTK J;  3MCZ A;  1A31 A;  1QPM A;  2DFF A;  4PGG A;  4CZZ A;  3C2B A;  2DA7 A;  3DCF A;  5IYC J;  4BJ6 C;  2JT1 A;  4U0Y A;  2VQG A;  1OR7 C;  1YG2 A;  2EV6 A;  2KLO A;  2GBY A;  5D6E A;  2YS9 A;  2EK5 A;  2XGE A;  5LRR A;  5HLG A;  5ILV A;  5JFR A;  2A5W A;  4EAT A;  4RMN A;  4EV0 A;  2W24 A;  1BA5 A;  2PI0 A;  5HDN A;  4ETS A;  4OIQ F;  1XSD A;  4UV8 A;  2M4G A;  3G3Z A;  1FY7 A;  2DTZ A;  1YS7 A;  2MD5 A;  4HST A;  3I58 A;  1X2N A;  1ETQ A;  2HDD A;  4WXD A;  1R5G A;  3CUQ A;  2EZL A;  5A2Q Z;  2Y0M A;  3NRV A;  5C4X J;  2NYX A;  3GLX A;  3SHF A;  4XLP F;  3RKQ A;  3PSF A;  1HKS A;  3K1M A;  3MWM A;  4I0A A;  1KQ8 A;  3TL4 X;  3K6G A;  2LKP A;  2HYJ A;  1NK3 P;  1EKE A;  4V2F A;  5KAF C;  2M7B A;  3F8N A;  3O8H A;  1S6L A;  4NNJ A;  1VQM I;  2EB7 A;  2DJI A;  4U87 A;  3F8B A;  3L09 A;  3GFM A;  3I4M J;  5DDG A;  3BZK A;  3GYH X;  1FTZ A;  1IDY A;  3PL8 A;  1K61 A;  3CCY A;  1Z9C A;  3GX4 X;  2AXT C;  4DZP A;  5CVJ A;  4LG3 A;  3UKG A;  1DU6 A;  1FOX A;  2Z33 A;  3DBR B;  2UXX A;  3CME I;  2E2H J;  4PGH A;  2JPC A;  2QCO A;  1K6O A;  4PUS A;  1RR7 A;  2IJL A;  1ZKG A;  5FLX Z;  5H20 A;  2C6Y A;  2L02 A;  1TWC J;  1HSJ A;  1ZG3 A;  1BOA A;  2V1N A;  1OLT A;  2F48 A;  2QVO A;  2HVS A;  3IH3 A;  3U1K A;  1W36 D;  2DPD A;  5D8L B;  4MQV A;  2E2I J;  2XB0 X;  1QVU A;  3RCO A;  2OC6 A;  1R36 A;  2WAD A;  2XSJ C;  3BQZ A;  4UXN A;  2LF8 A;  2JUC A;  2ZBK A;  1W0T A;  3JRE A;  3BTC A;  3CQZ J;  1VQ9 I;  1ZRF A;  5E3N A;  4ENM A;  2WY8 Q;  1T95 A;  1TZL A;  4S0H B;  1UMQ A;  2JRM A;  4P55 A;  5EF6 A;  1E0E A;  1H9G A;  1QHG A;  4JX6 A;  2KP6 A;  1HF0 A;  4LD5 A;  3D0S A;  2Y2Z A;  1K78 B;  4A3E J;  2R7U A;  4ESB A;  3VEP A;  1WGX A;  1B9N A;  1W7P D;  2EIK H;  3H36 A;  3BG6 A;  2X51 A;  3M3Y J;  2ZCW A;  2HVR A;  2OTL I;  5L3C A;  3E1S A;  4M74 A;  1ULY A;  4BY1 J;  2BVM A;  3AAF A;  5CQG A;  1JUM A;  3TQN A;  3F22 A;  3GUD A;  3ULQ B;  5GPC A;  5FRM A;  5GAH J;  3KCC A;  1E3H A;  3ZGK A;  1R1T A;  3C1D A;  3DWL E;  2XAQ A;  3B73 A;  1XMX A;  3BR6 A;  3JAM Z;  1IRX A;  5EDN A;  5IOY A;  2LF7 A;  1MNM C;  3T0Y A;  2ISY A;  3IKT A;  2FBK A;  3QOD A;  3OYJ A;  5LEJ A;  2R7Z J;  5GTH C;  4LB6 B;  4EEF G;  5HLT A;  2EIN H;  2R7V A;  1HXD A;  1SFX A;  2EZK A;  3FXL A;  4L5J A;  5DUI A;  1XSV A;  1BIA A;  4WWC A;  1WSU A;  4AYB N;  2QBY A;  2EZH A;  3FWE A;  5CPR B;  4OOI A;  4B09 A;  4E6K G;  5LD2 C;  4ESJ A;  4II2 A;  2V7F A;  2DT7 B;  4C2T A;  4YFK F;  1QNT A;  3H3Z A;  4YFN F;  1YIJ I;  1UHM A;  2EA2 A;  2E19 A;  3ABU A;  3GLL A;  5M3F J;  1JUS A;  3LA3 A;  5IYB J;  3IUO A;  5D8K B;  2V9K A;  3JRI A;  3SXY A;  2CV2 A;  2RGV A;  3J80 K;  1Z6T A;  2DOA A;  1RUO A;  3CZ6 A;  4ITV A;  4HF1 A;  4RM3 A;  1VTN C;  1Y6I A;  4Q5S F;  2GAU A;  2ZB9 A;  2VQC A;  1UJ8 A;  5E3O A;  2KZG A;  1T8I A;  2NOG A;  4I98 B;  3RPU A;  3I54 A;  2VBY A;  2CSO A;  5ICF A;  3LNQ A;  2HPI A;  1IAW A;  3A0H C;  2DA2 A;  3K4M A;  3H5R A;  2ELJ A;  4XOT A;  3JTG A;  4LK1 F;  3Q9V A;  3A01 A;  3DKX A;  1AOY A;  3HBL A;  5CVU A;  3FMQ A;  2IGN A;  4I99 C;  1GLN A;  4M6V A;  1UCR A;  3OIQ A;  2ZKZ A;  5B3S H;  1R22 A;  4E70 A;  1UFM A;  5GAE J;  2XDV A;  3CJR B;  3QOE A;  2VAS A;  4AD9 A;  2NVX J;  3M8E A;  4BS9 A;  1YI2 I;  2KRC A;  1BL0 A;  1OPC A;  4HAM A;  4ENN A;  2BBY A;  2LNB A;  1LFU P;  3V8K A;  1D5V A;  4PSW A;  2MAB A;  4BJ5 C;  2X6X A;  1SD6 A;  5KNL A;  2L01 A;  2VC1 A;  3D5R C;  3CUQ C;  2EFN A;  1K4S A;  4R8H A;  1ZRC A;  3W3C A;  2R7F A;  1LE8 B;  3V8L A;  1O3S A;  5H2F C;  3I71 A;  3JRB A;  1GT0 C;  4ZC3 A;  1ETX A;  3L2Q A;  3W6K B;  2CQN A;  2R7W A;  3FK7 A;  3PFI A;  3HC7 A;  2MYS A;  1UEL B;  4D1Q A;  4E7Z A;  1PYV A;  2Y75 A;  2GOX B;  3MEX A;  1WKM A;  3CDI A;  1X3W B;  4H0E A;  1VQ5 I;  1U2W A;  3DBL B;  3W2W A;  4L5E A;  1TWF J;  4BYY A;  5ILS A;  3D5S C;  1RKW A;  2X9D A;  3K4B A;  2OZ6 A;  2E1M B;  3QQA A;  2PG4 A;  3M1C A;  1OQY A;  2DLL A;  3N97 A;  2V1D A;  2W25 A;  1NHA A;  1QVT A;  1VQ7 I;  1ORK A;  4HF0 A;  1G3W A;  2K9N A;  4CYC A;  2R93 J;  1TBX A;  3KYC B;  3KLN A;  2D2W A;  4C30 A;  3ZQI A;  2QSH X;  1FTT A;  1QQI A;  2HQA A;  4M3G A;  4XLN F;  2W7N A;  3EET A;  1LKX A;  3OMY A;  3EYY A;  3VYR B;  2Q2E B;  3K7A J;  1XMA A;  4LLG F;  4ASN A;  1SMY F;  1B8I A;  2EA4 A;  4A2U A;  2K3P A;  1PJR A;  3HPG A;  2DW4 A;  3ZMS A;  2V1X A;  2ZXI A;  1R23 A;  2HQN A;  3PQJ A;  1IG7 A;  2X1C A;  2GOM A;  1BI1 A;  1XN7 A;  3TO9 A;  4YIF A;  2HI3 A;  3COA C;  4F93 B;  4DBR A;  3RQ4 A;  1U5T B;  3MMY B;  3L2U A;  3ASO H;  3RYR A;  2ZME A;  1K6Y A;  3HOZ J;  2HDW A;  1FC3 A;  3WGG A;  2V9P A;  1IN5 A;  3FBN B;  3E6M A;  2DI3 A;  3KZY A;  3WG7 H;  3R6S A;  3WE3 A;  5F6F A;  5FLV A;  2M30 A;  1GHC A;  1FIP A;  3FKI J;  2XPU A;  1SD5 A;  2G7U A;  3RI4 A;  1B4A A;  2UV1 A;  3K4K A;  1RRJ A;  1CF7 A;  3VFZ A;  3WU2 C;  4BQN A;  1IN4 A;  2B7E A;  3QAH A;  4KYW A;  2KPM A;  3A2K A;  5KVR A;  3NEU A;  2VQL A;  4D5C A;  1ENH A;  1JI8 A;  2BGC A;  4GDF A;  3FF5 A;  5D6F A;  1ZTR A;  5KCM A;  1ZLJ A;  4IVN A;  2OQG A;  5C4J J;  4RB2 C;  4HBL A;  3NWT A;  1FP2 A;  4S05 A;  3G1O A;  3FXR A;  1B9M A;  3QYE A;  3MAJ A;  2JN6 A;  3KP4 A;  4LG0 B;  2WAQ N;  2VJI A;  2EV5 A;  3ZRG A;  4M72 A;  1FOY A;  3OYD A;  1MD0 A;  2ZNZ A;  5D4R A;  4AUX A;  1R9T J;  1JE8 A;  5J40 A;  1FZP B;  1IDZ A;  1R5H A;  1IV8 A;  2JPB A;  3DLL F;  4U0V A;  3KLO A;  4CCK A;  3RZO J;  3VSL A;  4HNU A;  3OSF A;  4WCG A;  2L4A A;  3V42 A;  4FX4 A;  2Z2S B;  4XMY A;  3ZMV A;  1MBF A;  3I59 A;  5AIP A;  5JHU A;  4YII A;  3MZY A;  4A5N A;  2LRD A;  2H8R A;  1EH7 A;  4P1W A;  5B66 C;  3HOT A;  4I01 A;  4IL6 C;  5GAG J;  5LHI A;  3HSF A;  3G1M A;  2MGQ A;  4CIC A;  2ADU A;  4BNC A;  3H9J A;  1HW2 A;  3HUG B;  1KYZ A;  3OY9 A;  2X85 A;  1DGW Y;  4AYB A;  1QO0 D;  2X6O A;  4GXO A;  1ZR2 A;  2EZI A;  2VUM J;  5F0C A;  2O03 A;  3Q0U A;  2VJ5 A;  1ETO A;  4XM3 A;  1I5Z A;  2LY2 A;  4NC8 A;  1P4W A;  4OU0 A;  4D9J A;  4OIR F;  2V26 A;  3OV8 A;  5ICC A;  2NS8 A;  2VE8 A;  1F5T A;  1SAN A;  5D5X B;  3S16 J;  2EFO A;  3DV8 A;  1YRN B;  2P5V A;  3CCE I;  3KZI C;  3RPQ A;  2EPF A;  1O3Q A;  2O61 A;  3JSO A;  2HS5 A;  4MO7 A;  3GEZ A;  3OYE A;  3LFK A;  4UB6 C;  1CGP A;  1EH6 A;  3WTU C;  3FXK A;  2M0M A;  1B72 A;  2Z1D A;  1J5Y A;  1MW7 A;  1F36 A;  3OYC A;  4BQQ A;  3S3O A;  3G71 I;  3OS2 A;  4XID A;  1XGS A;  2QYO A;  5HS9 A;  4IKF A;  1AA7 A;  2CQX A;  3WHC A;  1LJ9 A;  1JTX A;  4PFO A;  2D45 A;  3L2W A;  1MGT A;  3SDG A;  3FDY A;  1KU2 A;  4F7Z A;  5M5W J;  2KT0 A;  2FEZ A;  1X1D A;  1R58 A;  3I64 A;  1POG A;  4EGY A;  1OR7 A;  4IQ4 A;  1J75 A;  3JRD A;  3KYD B;  4KMU X;  3CO7 C;  3SZG A;  4XKC A;  4FE7 A;  1P2F A;  1JKO C;  3LSP A;  2BYV E;  1ONV A;  2Y31 A;  1O57 A;  2H6C A;  3FM3 A;  4N4N B;  2ELH A;  2K9L A;  2OBP A;  5FFZ A;  4NQW A;  3K70 C;  3K2Z A;  4L9V A;  3W6V A;  1S29 A;  4FIS A;  4BL0 B;  3EUH C;  5HNH A;  1Y39 A;  4M3D A;  4JQF A;  3KPH A;  1RZ4 A;  3CCJ I;  3GZN B;  4P5O A;  3K1N A;  1H8A C;  1TNS A;  1A5J A;  4Y15 A;  4XSX F;  2M3A A;  2IGK A;  3DEW A;  1DPR A;  4FAS D;  2A6H F;  2AQF A;  3CCM I;  1I39 A;  1IRF A;  4F52 A;  1KGS A;  1T0F A;  2KJB A;  2VBX A;  1V5F A;  2V4J C;  4KN4 X;  4A0Y A;  1IRG A;  1YJ9 I;  4OIN F;  1FT9 A;  3WTW C;  1K79 A;  3LSJ A;  3VOD A;  2LK2 A;  3CCS I;  5DEQ A;  1XCB A;  2F2E A;  2NVT J;  3E5Q A;  4M3B A;  4RAY A;  3AL0 C;  2OCC H;  2K40 A;  4QWQ A;  1JJ6 C;  5DYM A;  2ZJP F;  2JVH A;  3HTU A;  1ZLK A;  3Q5F A;  1V5G A;  3S3M A;  2CW7 A;  2E71 A;  2WA0 A;  1Z77 A;  1KU3 A;  2F4I A;  4Y7N J;  2OQR A;  2ZME C;  1XD7 A;  2DMT A;  1ZK8 A;  2LOO A;  3EPZ A;  1QZY A;  4YEJ A;  4LB5 A;  2OD5 A;  4M9Z A;  5LRS A;  1Z3Y A;  4PJJ A;  1SD7 A;  1FYK A;  2AXL A;  2ZJ2 A;  1MMG A;  3QU6 A;  4BU2 A;  1IRZ A;  4A0Z A;  2H1L A;  2R7Q A;  4LIT A;  3J80 Z;  2HVQ A;  4A3G J;  1SAU A;  4I0B A;  1ZRE A;  4PDK A;  3LQR A;  5C44 J;  2XF5 A;  1YW7 A;  2A07 F;  2RKH A;  2ETH A;  4A3I J;  4L18 B;  3ABK H;  3JRG A;  4D5F A;  5E8I A;  3JRF A;  2HR3 A;  3KP5 A;  1XSX A;  1GV5 A;  4LK0 F;  3OYI A;  1W7P B;  1WJA A;  3PNT A;  4RB3 C;  3BR0 A;  2UUZ A;  4OIO F;  1P7I A;  4KMF A;  2MC3 A;  2RAE A;  2FJ1 A;  5EEH A;  3ZCO A;  3OS1 A;  1IXC A;  1XGN A;  2L7M P;  2HKX A;  5IY5 H;  1R00 A;  3HYI A;  2H6B A;  2KZV A;  3BCA A;  1KQ0 A;  1PUF A;  1V54 H;  2J5O A;  2FU4 A;  4DOZ A;  2ECC A;  3M8J A;  4HW0 A;  3IWZ A;  2UXN A;  4O5V A;  3I9V 2;  2VPR A;  2L9S A;  4FET A;  3CC4 I;  1QU3 A;  3PO3 J;  1FBU A;  3M8F A;  3KET A;  1S3J A;  2LBF A;  4XLH A;  1XCV A;  1MBH A;  2OJE D;  3S2H J;  3KX2 A;  4IHY A;  2V6E A;  2IAI A;  1ITY A;  3WTZ A;  3G1L A;  1WH5 A;  2QKL B;  4MTE A;  2F5V A;  2J5P A;  3F6V A;  3BQY A;  3M07 A;  2LSO A;  1Y56 A;  1I3Q J;  3ZXS A;  4KT6 A;  5IT3 A;  3CJT B;  2PBI A;  1ZHF A;  3HGG A;  3BCB A;  1FX7 A;  1HW1 A;  1ETY A;  2ZFW A;  3R4K A;  4DYR A;  2LH9 A;  2PEX A;  2TRT A;  2WAQ A;  2L7F P;  2KIU A;  2VJJ A;  1HOM A;  4WX9 A;  2CO5 A;  3CUO A;  3GTJ J;  2BHY A;  1KQ9 A;  4ZYA A;  1F9N A;  2HTJ A;  1OFC X;  4YRV A;  4MFE A;  2PMH A;  3QYF A;  3GFI A;  1SMT A;  1FOW A;  2E1N A;  3S14 J;  3TKY A;  3TW7 A;  5CQE A;  3MD2 A;  3QPT A;  3C2H A;  1X19 A;  3ELK A;  3O6B B;  5F08 A;  4FCY A;  1W5C C;  3BR3 A;  2VI6 A;  1QHH D;  2CV1 A;  1MKM A;  1MMD A;  3LAP A;  4B1R A;  1I3A A;  5LEK A;  2WWY A;  3HB9 A;  4GRI A;  3QYB A;  5DCM B;  2K3F A;  2FUG 2;  3LA7 A;  4XN3 A;  3GWZ A;  3ZQL A;  3P9K A;  1YTY A;  3SQN A;  4RGS A;  1OCR H;  1LPQ A;  3IH2 A;  4PJL A;  5E8G A;  2AS5 F;  2XRL A;  4XRF A;  2VT2 A;  3FHN A;  3DU5 A;  2P0W A;  4LGW A;  5FKO A;  2LD5 A;  5JVT A;  3Q9S A;  2GWR A;  2DJN A;  2CJJ A;  4HX4 A;  4IZZ A;  1NH3 A;  3GCM A;  5EJC A;  1MBE A;  3ZQ7 A;  3OL3 A;  1LB2 A;  3TDZ C;  4KIG A;  3RJP A;  3DKY A;  1WPK A;  4BXF A;  2CRG A;  5EGO B;  2KDZ A;  3BZ6 A;  3WE2 A;  1T0F C;  2X6W A;  3F8F A;  1D8K A;  1U9O A;  2LMD A;  1USS A;  4EGZ A;  2A6T A;  3ESW B;  2LRE A;  4MGR A;  1AWC A;  2ZSH B;  3PNY A;  3WOD F;  3GTP J;  2KHM A;  4BHP A;  4AVP A;  2VBZ A;  3REO A;  4BH9 A;  4NC6 A;  4RB0 A;  2HKO A;  1HLV A;  3Q0V A;  1AKH A;  1SVL A;  4ZH4 F;  4BJT A;  2XGD A;  2R5Z B;  5LGT A;  4JX4 A;  2M4K A;  4BEH A;  2H09 A;  3HPH A;  2CFX A;  2YPR A;  1TQM A;  2XAS A;  2R7T A;  2M2E A;  2ELK A;  1YLF A;  4BE1 A;  3PUF A;  1NK2 P;  1KA8 A;  1X1B A;  1TNT A;  3UR3 C;  3ZMU A;  4HQE A;  4ZZL A;  1VND A;  1GXP A;  3R60 A;  1HCR A;  3ERM A;  3MN2 A;  3K4N A;  1Q1V A;  5M5Y J;  1HC8 A;  2NS0 A;  2XB5 A;  3HM5 A;  4RM2 A;  3BT9 A;  1IUY A;  3CCV I;  4G8X A;  3A02 A;  1TL8 A;  3N05 A;  5HLI A;  3FKJ A;  1JXS A;  2V79 A;  4U0W A;  1B8I B;  4QIW N;  4N0B A;  4FHT A;  3TO7 A;  2DQL A;  2XIG A;  5H6R A;  1QGP A;  2X6Y A;  3RYP A;  3BR5 A;  3BWG A;  2HEO A;  3E6B A;  3LST A;  5E3M A;  1U3E M;  1WHU A;  3JCU C;  4BE2 A;  1QRY A;  2DOD A;  5HS7 A;  5JHF A;  1Y0U A;  1J09 A;  1UST A;  1FMW A;  4IOC F;  2VE9 A;  3ABM H;  1IO2 A;  4E7I A;  1JGG A;  1N77 A;  2EIM H;  4H4K C;  4U7D A;  1MBK A;  3TBI A;  4BGD A;  2XF7 A;  3P9C A;  4CUG A;  3OS0 A;  4XIC A;  2R5Y A;  3FX3 A;  1STZ A;  2R3S A;  2DMP A;  2NXN B;  4EJT A;  4QTR A;  1UG2 A;  3RKX A;  1WRJ A;  5LHG A;  5L3F A;  2CQK A;  5EZG A;  3J7Z I;  3TW6 A;  3T8T A;  2JMW A;  5JVG F;  1A35 A;  4E7S A;  2Y9Z A;  5IT9 K;  1AHD P;  3PJR A;  5GP9 A;  5E3L A;  4LLN A;  4RGU A;  1H89 C;  2IS6 A;  1RIO H;  2M8G X;  2VC0 A;  3LOC A;  2QQ8 A;  2L54 A;  2BW3 B;  2XKO A;  2R7X A;  3S32 A;  1KZH A;  3BC8 A;  2LYC A;  3BR1 A;  4LLL A;  4MIM A;  3BRO A;  5HDG A;  3PO2 J;  2DYR H;  1GDT A;  4M73 A;  4KIB A;  5KAI C;  4CZC A;  1DPU A;  2ME6 A;  1XDS A;  5IP6 A;  2ZXH A;  3KE2 A;  2COM A;  3I56 I;  1NG6 A;  4F3Q A;  5HOD A;  3GTM J;  3ZOB A;  5JR3 A;  2IXS A;  1WJD A;  3HOX J;  3BR2 A;  2M45 A;  3RDI A;  5JLX A;  2PMZ N;  3J81 K;  4HSR A;  5BNG A;  4AWX B;  3E7L A;  3FMS A;  1Y8Q B;  2P6S A;  1JT6 A;  4GO1 A;  2DU9 A;  2IGO A;  4D7N A;  1YYV A;  4GCV A;  3VWB A;  1MBG A;  2XGC A;  3F72 A;  3W2V A;  2O0Y A;  5BPI A;  3ML6 A;  4V19 K;  1TWA J;  1DP7 P;  1NTC A;  3RPU D;  4I7H A;  3G6E I;  4II3 A;  4WXC A;  5ICG A;  4Q4Z F;  3DBH B;  3LA2 A;  4QLC U;  1IN7 A;  1YFH A;  1A04 A;  5EG0 B;  3PNV A;  2D1V A;  2CYY A;  2WAF A;  1A36 A;  1WJE A;  1X4O A;  2WBM A;  2L3D A;  2GXB A;  1LVK A;  3RZD J;  5BQT A;  1YJN I;  5IPA A;  1BC7 C;  3F8C A;  2JA7 J;  2EIL H;  4N9I A;  4XOP A;  3ZMT A;  2ACJ A;  4E7L A;  3AG2 H;  2CUF A;  1W5S A;  5IYD J;  3K4C A;  1P92 A;  1VI0 A;  3HKZ N;  3MKZ A;  4W97 A;  4OIP F;  2JK3 A;  1VQN I;  1Z7U A;  4KIC A;  1YW8 A;  2E1O A;  2HYF A;  2DFE A;  4YIR X;  1AU7 A;  2RDP A;  2E34 A;  3ZPL A;  2XAH A;  4MNU A;  2Q1Z B;  3O2P E;  4IRI A;  2NRA C;  4CCL A;  4L9N A;  1Z91 A;  2M34 A;  5K5Q A;  2KRH A;  3OYG A;  3C2G A;  1YQA A;  4E4H A;  1MBJ A;  4XLA A;  2R0Q C;  2VJ4 A;  3HOY J;  3E6D A;  2QKM B;  1Z3X A;  3GZ5 A;  1N78 A;  2PJP A;  1G2H A;  3H5N A;  3TGN A;  2DBB A;  2P8T A;  4YG2 F;  1RUN A;  3DPU A;  2JA5 J;  4C2M J;  1BJZ A;  4XL9 A;  2H1K A;  2XV4 S;  1LDJ A;  4HYE A;  3GTO J;  3KEQ A;  3L2R A;  5E18 F;  5DM6 F;  3CMA I;  2HDC A;  4RGX A;  4HQM A;  2JSC A;  3LL7 A;  3FXQ A;  3BG5 A;  1WJ5 A;  2G7H A;  2VKD A;  3EUH A;  3CJN A;  3M4O J;  3OYH A;  4WXH A;  4RGR A;  1ZG1 A;  2W85 A;  1HDP A;  1H9T A;  2B63 J;  3GW2 A;  2ZJQ F;  1K4T A;  3R0A A;  4ZTF A;  4KA4 A;  4B3A A;  3EQL F;  4BDY A;  3OWT A;  3HOU J;  3I4N J;  3IP4 B;  4B44 A;  3SZT A;  5K7H A;  5EEA A;  1TT0 A;  4L5I A;  4UUV A;  3VYS B;  2UZK A;  3E5X A;  2GXA A;  1BM9 A;  1R1V A;  3GTQ J;  3LFU A;  4IRH A;  2DCE A;  4UUS B;  4M3F A;  2IP2 A;  2VB6 A;  3KIO A;  3SEQ A;  2L7K A;  2MG4 A;  3RQI A;  2PJR B;  4NB5 A;  4BHC A;  4XQF A;  1VQ8 I;  1SVO A;  2M9H A;  2XUB A;  3WU1 B;  3PIP F;  4RAF A;  2Z99 A;  3IHU A;  2G9W A;  4E7K A;  3H5A A;  4XK4 A;  3CC2 I;  3E3V A;  2DOE A;  4P9F A;  2HYG D;  3WTX C;  3TOB A;  3OYL A;  1FPQ A;  3DEE A;  3V7C A;  3S1N J;  3B02 A;  2Q8K A;  2EFP A;  4PSX A;  4CGZ A;  3JW4 A;  3BTJ A;  2BOL A;  1T39 A;  1F43 A;  3OYA A;  3C7J A;  3F6O A;  2G0E A;  2LDU A;  2PLY A;  2VKE A;  1S8N A;  1QBJ A;  3OYF A;  3M7G A;  4HZF A;  1IUF A;  5HVQ C;  4N9H A;  2CUJ A;  4OWR B;  3F9K A;  1X1P A;  4UUT A;  2XHK A;  1K78 A;  4IHV A;  2PQ8 A;  5A2Q K;  1YW9 A;  1D1A A;  2FML A;  2W82 A;  3IAS 2;  3E5U A;  1YE9 A;  2FXA A;  3DTK A;  4XR6 A;  4I09 A;  1O3R A;  2DK8 A;  2Y30 A;  1R5I D;  2F5F A;  4PK4 A;  5ED4 A;  1R1U A;  1TWH J;  4ABZ A;  5E20 A;  3H0G J;  4RAG A;  1IC8 A;  2W57 A;  5FKM A;  4EMS A;  2FX0 A;  3L2C A;  3ONQ A;  2Q0O A;  4IHT A;  4UV9 A;  2DMU A;  3BLY A;  3V7S A;  4NDL A;  3AG3 H;  2DA5 A;  4KJZ A;  3DP7 A;  4A6E A;  1X1A A;  2XKP A;  2F6C A;  1RPW A;  2IEK A;  2LKS A;  3WHB A;  4RLQ A;  4C3J J;  1FYL A;  3S8P A;  4L0Y B;  2ZO4 A;  4M6X A;  1S7E A;  1P4X A;  1JT0 A;  1ETV A;  1OMI A;  1IV6 A;  5AIQ A;  4DBQ A;  1SVM A;  2F5E A;  2ZC2 A;  2XVC A;  3A4C A;  4EJU A;  3BG3 A;  5DUK A;  5FD5 A;  1U0J A;  4S04 A;  1ZYR F;  3OR1 C;  2W00 A;  3PSI A;  1BBY A;  1OJL A;  3JSP A;  4UVB A;  2WY7 Q;  1JGS A;  2JRT A;  2VL8 A;  3HXL A;  4XNF A;  3HRT A;  4Y3O A;  1ON2 A;  1EF4 A;  3NQO A;  2MH2 A;  2O5R A;  2YU3 A;  1KYW A;  2HZT A;  4BUP A;  3WTY C;  3HHH A;  1U8R A;  1MDM B;  1H88 C;  1Y0N A;  3PFY A;  4HRI A;  4F55 A;  3IWF A;  3O3K A;  1LFP A;  1XGO A;  2PMZ A;  2XF6 A;  2H27 A;  2X1D A;  1E3O C;  1WCM J;  3HOV J;  3LSM A;  2XPW A;  1O7L A;  2VT3 A;  3OYN A;  2L7Z A;  5FB2 A;  1QZZ A;  2F4O B;  2Y48 A;  1WWX A;  5DD4 A;  5E1X A;  4AIH A;  1MIJ A;  1FNN A;  2K27 A;  1MJB A;  2M8E A;  3G2B A;  5CVR A;  4BQO A;  4CSW A;  3FHZ A;  4EM1 A;  2D1H A;  5IP7 J;  5H6Q A;  2VKV A;  3WTV C;  5IP9 J;  1OYY A;  4CCN A;  1OYI A;  4MEY F;  4A3B J;  1X2M A;  3I55 I;  3QPL A;  2NS7 A;  4A0X A;  5FRO A;  1LE8 A;  3IKV A;  2A05 A;  1REP C;  3HKZ A;  3AKZ A;  1Z05 A;  1WQ2 A;  3CUQ B;  4L9J A;  4B48 A;  2LY1 A;  3IH4 A;  4L9T A;  1GVD A;  1R4N B;  4BHB A;  3K4J A;  1OIS A;  4I76 A;  5J4Y A;  3DPT A;  2EIJ H;  1ZAO A;  1E3P A;  4J19 A;  1FWZ A;  1TLH B;  3S1R J;  1Y1V J;  2F5D A;  4IJA A;  4L0Z B;  2CMP A;  2Y69 H;  5K7Z A;  5HOO A;  2A68 F;  3IAM 2;  4MTD A;  3ZN1 A;  3L00 A;  3OR2 C;  4HOB A;  3DTE A;  4CA0 A;  5IT9 Z;  5DD8 A;  2QLZ A;  1AKH B;  1VQ4 I;  1IN8 A;  5LGN A;  1UB9 A;  2E36 A;  2QGU A;  2DFI A;  2RNG A;  4CXF A;  4A93 J;  5CYV A;  2M87 A;  4D0P A;  3K9T A;  3HGY A;  3H9G A;  2MA3 A;  4Q47 A;  3SEZ A;  1GUU A;  2XC7 A;  4RS8 A;  3U9G A;  3J7A O;  4G6D A;  4DW6 A;  3GF2 A;  4HNT A;  2BVL A;  3ROU A;  3PQK A;  2CQQ A;  3JRA A;  1LFB A;  2VLA A;  4HPQ A;  4KUM A;  3AG4 H;  1D8J A;  2Q2E A;  2K85 A;  5JI6 A;  3MKW B;  3CCU I;  5F0H A;  1WZ2 A;  3JRC A;  1ERD A;  1BI3 A;  3IRQ A;  2WC2 A;  3VPR A;  5TGT A;  1LEB A;  3IV5 A;  3IL2 A;  1Y1W J;  1W4M A;  4IRG A;  2NVU B;  3VB2 A;  2H94 A;  2DDA A;  5E1W A;  3J81 Z;  1HA8 A;  2ISZ A;  2JQ7 A;  3ZQG A;  1U5T A;  2DA3 A;  4CH7 A;  4KN7 X;  2AQE A;  2VOO A;  3ECO A;  3CMM A;  2XAJ A;  4CCM A;  1TP4 A;  4BBS J;  5FKN A;  1P7J A;  2ZSI B;  2P7V B;  2RQP A;  2YU9 J;  2VXZ A;  3S2W A;  5KK1 A;  4LOC A;  2K9Q A;  1YOV B;  5HLH A;  3ERE D;  3CF2 A;  3CES A;  2BV6 A;  3CLQ A;  5KHD A;  2FRH A;  3LQQ A;  3FXU A;  2K4B A;  2Z16 A;  1JHH A;  1UG0 A;  4JP0 A;  2XAU A;  3WTT C;  3SJM A;  3K4L A;  1VQ6 I;  4XN0 A;  2QEN A;  4N4O B;  4O6J A;  2DOF A;  2E5Z A;  2JA6 J;  2Y0S N;  1T38 A;  3CDL A;  2YX7 A;  5LHH A;  4RLF A;  1YS6 A;  3B6A A;  1V4R A;  3CJQ B;  1I1G A;  5FKK A;  5B5E C;  4OMZ A;  1QA6 A;  3IC7 A;  3DFG A;  1HBX G;  2DDB A;  4JBA A;  3IRR A;  1IN6 A;  2L9R A;  1I50 J;  1S72 I;  2IS4 A;  3DU6 A;  4LG0 A;  2QBY B;  1R7J A;  2KFD A;  5CVI A;  4BY7 J;  4BXU A;  4BDZ A;  5GAD J;  5LGU A;  2JUG A;  1RES A;  4M9X A;  3BG7 A;  2KQR A;  3HRU A;  2W4S A;  3BG9 A;  3VYT B;  2IS2 A;  2OAZ A;  1PVE A;  1XPX A;  2BY3 A;  2HZD A;  4KIF A;  5BMZ A;  9ANT A;  1RET A;  3I5U A;  2F4M B;  2FSW A;  4HV5 A;  3ZN0 A;  4PZJ A;  4F92 B;  1SEU A;  3HRM A;  2O8K A;  2CV0 A;  5L3B A;  5FKL A;  1BI0 A;  2FNA A;  5J1R A;  4IHW A;  1G3T A;  4MQ9 F;  4XBF A;  2IW5 A;  1JHF A;  4AU7 A;  1VFC A;  2DXI A;  3HUG A;  3QWL A;  2IGM A;  1RKT A;  3RKW A;  4XRS G;  4DQ2 A;  1Z1D A;  2R7O A;  2EQR A;  2RV8 A;  1V5E A;  4ZYD A;  2LKX A;  5F04 A;  4AC0 A;  2DYS H;  1VZ0 A;  1TW2 A;  1LEA A;  1TWG J;  2NVQ J;  3A01 B;  5FRN A;  2QEX I;  2DN0 A;  3BP8 A;  4EJO A;  5FD6 A;  1T2K A;  2JSP A;  1UZC A;  4GYG A;  3BPV A;  2LR8 A;  2IT0 A;  2STT A;  1F1Z A;  3BZC A;  1PDN C;  1A6I A;  1SD4 A;  4OAY A;  1YRN A;  3HIF A;  1W5T A;  5CVV A;  4MEX F;  1TW3 A;  2LFB A;  5J1Y A;  3H3V K;  2BHZ A;  1MND A;  3FXO A;  1OYW A;  1P9Q C;  3KP6 A;  1EJ9 A;  1X3Z B;  1LNW A;  4YEL A;  4HEA 2;  1IXR C;  5K7F A;  4G7H F;  4A3D J;  2WB1 N;  4YFX F;  3VOE A;  2K9S A;  3X2Q H;  1TTY A;  2CFO A;  4M9S A;  1SFK A;  1XTA A;  4ZJZ A;  4ENJ A;  2JWT A;  2A61 A;  4IOA F;  2FD5 A;  2QM3 A;  1R4M B;  3CLO A;  3S17 J;  4GFB A;  2ZXJ A;  1R49 A;  3GBG A;  4PFP A;  1L3L A;  2FBH A;  5F64 A;  5ILU A;  2NNY A;  2COB A;  5DS9 A;  5F0F A;  5K5R A;  4ZTJ A;  1ON1 A;  1X3U A;  4EQQ A;  1APL C;  2CQ7 A;  2A3S A;  2K4J A;  2E1M C;  4IX7 A;  5K5O A;  2KRF A;  4Y17 A;  2QQB A;  4AVZ A;  5FLM J;  3LAJ A;  5BPD A;  5CKT A;  1S7O A;  1ZGA A;  2HPM A;  2V9V A;  4A3F J;  1YX5 A;  2VN2 A;  1MSE C;  1TT5 B;  3FZV A;  5DTD A;  4E7H A;  3HDD A;  3DXJ F;  4X1E A;  2FQ3 A;  3DPL C;  5GTI C;  1XGM A;  1I6X A;  2RNJ A;  4CO8 A;  5L3E A;  4RB1 A;  1DDN A;  4O3M A;  1JUP A;  4CYC B;  1D1C A;  5F1R A;  2JVG A;  4NUB A;  2L2O A;  2X48 A;  1ZN2 A;  1G6N A;  1RR8 C;  2P5K A;  3PIO F;  4G7Z F;  4HNV A;  2LP0 A;  1Z7L A;  1WJB A;  3TDU C;  3OYK A;  2EH3 A;  3KEY A;  2X0L A;  3GTG J;  5FGM A;  1YHQ I;  2K5C A;  3AL0 B;  3W6J B;  1U5T C;  3HZJ A;  3SYT A;  2P81 A;  5J4V A;  3QOP A;  3TMO A;  4Y52 J;  2DMN A;  4FT8 A;  1A6Q A;  2A6E F;  3LSK A;  2ZME B;  2E60 A;  4U88 A;  4QPO A;  4DIQ A;  3EUA A;  4PCQ A;  1O4X A;  5L3D A;  2RN7 A;  2MW8 A;  1LUJ B;  5B1A H;  1JKP C;  2E35 A;  1U8B A;  3NWS A;  1I1S A;  3E97 A;  4J00 A;  4E7J A;  1T6S A;  2HXO A;  3MKL A;  1RI7 A;  3MZ8 A;  1RNL A;  4HG2 A;  1CF7 B;  3H1C A;  3O8G A;  2DK5 A;  5EEG A;  1JKQ C;  4HDV A;  1GXQ A;  1X58 A;  2K86 A;  5J8F A;  1D0Z A;  5ERI A;  3WTS C;  3H92 A;  1W7P A;  4HV6 A;  3KP3 A;  4KT5 C;  4XKW A;  2VOD A;  1SC7 A;  2PN6 A;  4AIK A;  5HDK A;  4XON A;  4RDU A;  5J8C A;  3RKY A;  4IHS A;  2CGP A;  1VQP I;  2L9N A;  3K10 A;  2FOK A;  3CDH A;  3GO5 A;  1E17 A;  4R1H A;  2EFQ A;  1SFU A;  5F1J A;  1LVA A;  1MJA A;  4MHG A;  4NHJ A;  1BW5 A;  4UB8 C;  1FEX A;  3VSK A;  3BTI A;  3HG9 A;  3D5L A;  1WJC A;  1R71 A;  1C0W A;  5J47 A;  4GGG A;  1YO5 C;  4ZDP A;  1LDK B;  1BJA A;  1I27 A;  3ZQF A;  4XKB A;  2ME0 A;  3K0L A;  4Y33 A;  2DA4 A;  4HX8 A;  2F5C A;  4A3J J;  5BOX A;  4HLY A;  3RSN A;  3ZMD A;  4LMY A;  2I8D A;  1Z6R A;  3E0J B;  2Z9O A;  4I02 A;  1G3S A;  1HW5 A;  2Y0S A;  2O7O A;  4ZYG A;  4G6Q A;  1ZRD A;  1MZB A;  3I59 B;  3CF5 F;  1RC9 A;  3LSG A;  2R4G A;  2NVY J;  2RC4 A;  2BY2 A;  2OU2 A;  4BE0 A;  1U78 A;  1CQT A;  4HLX A;  3BJA A;  3FK6 A;  3MQ0 A;  2IPQ X;  1Q1H A;  3QP6 A;  3A1Y A;  1XX5 A;  1T33 A;  4NBQ A;  1MNE A;  5D5W B;  3L9F A;  1JKR C;  4B47 A;  2TDX A;  4HA8 A;  4XKV A;  2R7S A;  3WGH A;  5DM7 F;  1IJW C;  2EBI A;  2GXG A;  2FE3 A;  2DTR A;  4U7B A;  4IXA A;  1FBQ A;  2BY1 A;  2R7D A;  4ZYE A;  4DNC A;  2K7L A;  1WH7 A;  3LSR A;  2DO7 A;  1P6R A;  3K69 A;  3GXO A;  1Z67 A;  2W84 A;  3E6C C;  2FBI A;  2NNN A;  5EYR A;  2DT5 A;  3ABL H;  2UWM A;  3KP7 A;  4BBR J;  2QF7 A;  1XC5 A;  2KJC A;  3WGI A;  1B72 B;  2OA4 A;  5DCM A;  2K02 A;  3LMM A;  3AFH A;  2L9V A;  2AO9 A;  4JYK A;  3NAR A;  2WV0 A;  4DGW B;  2HQR A;  3OIP A;  2L5Q A;  3DTI A;  3ASN H;  4B8X A;  2LVS A;  1OCO H;  1ETW A;  3FMR A;  2CW0 F;  5LFA A;  5D4S A;  2ID3 A;  2N8G A;  2FQ4 A;  2KIF A;  3BY6 A;  2QQ9 A;  3F3X A;  4GYI A;  4NQW B;  2VBW A;  2JTV A;  2KIQ A;  2GA2 A;  4G12 A;  2GLO A;  3L1P A;  1WJF A;  1O3T A;  5HS8 A;  2CWE A;  3FM5 A;  4QSH A;  4TV7 A;  1ZAR A;  3K70 D;  5EGO A;  1J2X A;  5F27 A;  1SFO J;  3T8R A;  2BY0 A;  3ZMZ A;  1K7A A;  2HTS A;  1TQI A;  1HST A;  3QU3 A;  3SDB A;  2WB1 A;  1YIT I;  4CCJ A;  2FMY A;  2IA2 A;  2Z3Y A;  4DZJ A;  3HEF A;  2IA1 A;  3I53 A;  2ECB A;  3OYM A;  3SZP A;  3ZQQ A;  4AID A;  1FMV A;  4B43 A;  1EV7 A;  3ISP A;  1G4D A;  5JLW A;  1H0M A;  2K9M A;  2R5Z A;  3TO6 A;  1WI9 A;  3PM1 A;  3CP2 A;  3G73 A;  1PP7 U;  3AG1 H;  1FSE A;  4RBO A;  4UNO A;  4KNY A;  4ANJ A;  4A3C J;  1W36 C;  4AIJ A;  2YSR A;  2FOW A;  3QRF F;  1OKR A;  5LBQ A;  3HTS B;  1BOB A;  2YX4 A;  5FJ8 J;  3ECH A;  3F21 A;  1MH3 A;  1UAA A;  1L0O C;  3OOU A;  2P6T A;  2VOP A;  2H8W A;  3GFJ A;  3LWF A;  3KFW X;  2I10 A;  2R92 J;  1OCC H;  2JJ7 A;  2HU9 A;  1ZEL A;  3QPS A;  2BXY A;  1ODD A;  4CHU A;  1MMS A;  2ID6 A;  3HSE A;  3WU0 A;  2JA2 A;  4Z6Y A;  1XB4 A;  1IW7 F;  2BEO A;  3FIW A;  2FF4 A;  3Q3S A;  4DJA A;  2P4W A;  3KYL A;  1FLI A;  4C3H J;  1IXS B;  3HOW J;  3C18 A;  3DEU A;  3TED A;  2KKO A;  1LDD A;  2OCE A;  4G94 A;  3ZR8 X;  4RA2 A;  4EJW A;  2QA4 I;  5M5X J;  3MKY B;  2E7W A;  2XGX A;  1MSF C;  1G59 A;  2P5L C;  2OPT A;  2HGC A;  1F4K A;  3SFZ A;  1KU9 A;  5HNF A;  4P9U A;  2P7C B;  3OYB A;  4CYD A;  1N25 A;  3J7Y J;  2LC2 A;  1YX3 A;  2MH9 A;  3QP5 A;  2M5W A;  4NC7 A;  2QSF X;  1HKQ A;  2LY9 A;  1EA3 A;  4FX0 A;  4MFD A;  2I5U A;  3N4M A;  4UY8 I;  2BXZ A;  4A69 C;  1V55 H;  5J6X A;  5FFX A;  5FO5 A;  3F8M A;  1Z21 A;  4X6A J;  3GFL A;  5E79 C;  4FE4 A;  1HKT A;  1PUF B;  2PFB A;  2PMU A;  1FYM A;  3H35 A;  2MSY A;  3TP0 A;  3CP8 A;  4UVA A;  3WG9 A;  2PX9 A;  3FBI B;  2R7R A;  2MLK A;  4C3I J;  3MFK A;  3R61 A;  2LBF B;  2MC4 A;  1J9I A;  4KFC A;  4LFU A;  4DYQ A;  5TRD A;  2YR2 A;  5FLX K;  3DF8 A;  2FNP A;  1OCT C;  5E17 F;  3P5J A;  3M1E A;  2CU7 A;  2BW3 A;  3CC7 I;  3B6C A;  3P9I A;  1U6G A;  4WK8 F;  2EFW A;  3OSG A;  1BIB A;  3V4G A;  2EJR A;  3JTH A;  3RTR A;  1J7K A;  2HWV A;  1V3F A;  4M3E A;  3S2D J;  3OOP A;  2QUF A;  1IGN A;  2M1B A;  2IVM A;  3FIS A;  4XOR A;  3CD6 I;  3A0B C;  3KEO A;  2CG4 A;  3CCR I;  4M6Y A;  1DP3 A;  2ZNY A;  1FSH A;  2O6G E;  4HX7 A;  3QPH A;  1D0Y A;  1VF9 A;  2O3F A;  3MVP A;  5L3G A;  1HDD C;  1Y8R B;  3U1D A;  4EM2 A;  4IPA A;  2DMQ A;  1D0X A;  4BAC A;  4LIU A;  3H0D A;  1FBS A;  3HHG A;  1FP1 D;  1DGR M;  1IZ1 A;  1LQ1 A;  2WTE A;  2M0C A;  3SFI A;  3ZP5 A;  4Q48 A;  4BKX A;  1B1B A;  1BW6 A;  1NG7 A;  2KL4 A;  1OCZ H;  2MBF A;  4V2G A;  4XLC A;  3L2V A;  3CCQ I;  4A3M J;  1D5Y A;  3BTL A;  1BR4 A;  2DQR A;  1QZE A;  1MMA A;  2HFH A;  4A6D A;  5K1Y A;  3HL2 A;  2STW A;  2RRE A;  2XRO A;  1R6R A;  2CS3 A;  1FIA A;  1P4A A;  2RQQ A;  3HRS A;  2X4H A;  2O9L A;  5EG0 A;  2ESH A;  1W0U A;  1IF1 A;  1G3Y A;  4Y4R A;  5CJ9 A;  5J3L A;  4ENK A;  6PAX A;  4EJV A;  1ETK A;  2L4M A;  4A3L J;  3DLA A;  2CUE A;  2OV7 A;  3S93 A;  3S1Q J;  3S15 J;  4ESF A;  1ACI A;  1WI3 A;  1ZQ3 P;  2DA1 A;  2ESN A;  2HNH A;  3JAM K;  2NOJ B;  2JA8 J;  2IRF G;  1MMN A;  4IO9 F;  1DU0 A;  1ZR4 A;  3BJO A;  1KU7 A;  4DYC A;  2QSG X;  2GQQ A;  4G7O F;  3HJE A;  2CW8 A;  4D7M A;  1FOK A;  4Z2Y A;  4KDP A;  1WFX A;  2KDO A;  2HXI A;  3J7A Y;  2DT6 A;  2FA5 A;  1XDU A;  4XSZ F;  1G8X A;  3T5X A;  4A3K J;  3U21 A;  4R79 A;  1B59 A;  5EZH A;  4X0G A;  1XG1 A;  4EM0 B;  3F23 A;  3JRH A;  3EDP A;  2ZJR F;  1S9H A;  2MFZ A;  3ZQC A;  2GA1 A;  2Y9Y A;  2DA6 A;  2E1C A;  3EUK L;  4XLE A;  1I6H J;  2D5V A;  5E1Z B;  2B9S A;  4JX5 A;  3C3W A;  1S7A A;  1XMK A;  2MD0 A;  2O8X A;  4P96 A;  1HQC A;  2EV0 A;  4XRM A;  2E2J J;  2OUM A;  2VON A;  3JR9 A;  2XRN A;  3OIO A;  2XAG A;  1VQK I;  3S3N A;  3GME A;  4BEH B;  4A5M A;  1N75 A;  2XAF A;  4WF2 A;  1VQL I;  2CH0 A;  3CMY A;  2VKH A;  3DKW A;  3BDD A;  4CDG A;  3D1N I;  2IS1 A;  5IOZ A;  3H3U A;  3BOQ A;  4PJN A;  3L7W A;  2LTP A;  5TJJ A;  3VDX A;  5AON A;  1DUX C;  3NAU A;  1WVR A;  2XSD C;  1JJ8 C;  1T56 A;  3LSI A;  1X4P A;  4ZDL A;  3V7R A;  1VQO I;  3I0T A;  3UNG C;  4UUS A;  1UHW A;  4BXX J;  2KMU A;  1JTY A;  5B1B H;  3ZQH A;  2OZU A;  2L0K A;  2PJR A;  2WAE A;  2IBD A;  3K1P A;  1PP8 F;  3TP3 A;  4FQG A;  1BI2 A;  2GM4 A;  1T98 A;  2VIX A;  1MH4 A;  2VQH A;  4G9Y A;  2IA0 A;  3S1M J;  3CTA A;  3VYU B;  2VPL A;  5D5U B;  4QPQ A;  3RIR A;  2V1U A;  2HOA A;  3Q0W A;  1EH8 A;  2A69 F;  2DFH A;  4FTH A;  3KZZ A;  2LG4 A;  1K83 J;  4MLO A;  2DAO A;  3LSH A;  3BJ6 A;  4BAY A;  3OL4 A;  5C3E J;  4LIV A;  1J59 A;  2DPU A;  4I2O A;  4F91 B;  1TC3 C;  2OTJ I;  4AM3 A;  1ZGW A;  1QPI A;  2R5Y B;  2W1O A;  3GZ6 A;  2KIS A;  4PJ0 C;  5M3M J;  4C2U A;  4IQJ A;  4IEJ A;  2QQA A;  2AHQ A;  2E5N A;  2QWW A;  2LLK A;  5ICE A;  3H9Q A;  4JOM A;  2ZFU A;  3EYI A;  3FXJ A;  4UVC A;  4B3X A;  2X1E A; 
#chains in the Genus database with same CATH homology
 5DCF A;  1BC8 C;  4OMY A;  1SAX A;  2GIV A;  2BE5 F;  3M9A A;  4BQA A;  4ZZD A;  1ZGJ A;  5LLQ A;  5BS6 A;  1YIO A;  4ON0 A;  1BN5 A;  4ZYH A;  3HOS A;  4HDU A;  1PUE E;  2GZW A;  3GVA A;  1B6A A;  1O7F A;  2V6C A;  1ZH5 A;  3U2R A;  3P7N A;  3ABT A;  5DV5 A;  4JK1 X;  2JZY A;  4UHT A;  2QZ8 A;  1GVJ A;  2E7X A;  3I4P A;  2A5Y B;  4RAZ A;  4K2E A;  2MLG A;  1ZG5 A;  2EWN A;  3MZH A;  2RVC A;  3KP2 A;  4IF4 A;  1TQP A;  2HOE A;  3HSR A;  1MJ9 A;  5D5V B;  3DQV C;  3CO6 C;  2Z5U A;  4LJZ F;  4M71 A;  4HF2 A;  3T1B A;  3BPX A;  3V8J A;  1MDM A;  3TOA A;  2B0L A;  2KIM A;  1D3Y A;  2NAZ A;  3R0J A;  4EVI A;  4A12 A;  5CLS A;  1SFE A;  4Y13 A;  1J0R A;  1E2X A;  3MCZ A;  1QPM A;  4PGG A;  4CZZ A;  2JT1 A;  4U0Y A;  1YG2 A;  2EV6 A;  5D6E A;  2EK5 A;  5LRR A;  5HLG A;  5ILV A;  5JFR A;  4EV0 A;  2W24 A;  2PI0 A;  5HDN A;  4ETS A;  4OIQ F;  1XSD A;  4UV8 A;  3G3Z A;  1FY7 A;  1YS7 A;  2MD5 A;  3I58 A;  4WXD A;  1R5G A;  3CUQ A;  5A2Q Z;  2Y0M A;  3NRV A;  2NYX A;  3GLX A;  3SHF A;  4XLP F;  1KQ8 A;  4I0A A;  1HKS A;  3K1M A;  3MWM A;  2LKP A;  3F8N A;  1S6L A;  2EB7 A;  3F8B A;  3L09 A;  3GFM A;  5DDG A;  3GYH X;  1Z9C A;  3GX4 X;  5CVJ A;  2Z33 A;  2UXX A;  4PGH A;  2JPC A;  1K6O A;  2IJL A;  5FLX Z;  5H20 A;  2C6Y A;  2L02 A;  1HSJ A;  1ZG3 A;  1BOA A;  2QVO A;  2DPD A;  5D8L B;  4MQV A;  1R36 A;  4UXN A;  2LF8 A;  2ZBK A;  1ZRF A;  4ENM A;  4P55 A;  1H9G A;  4LD5 A;  3D0S A;  1K78 B;  4ESB A;  3VEP A;  1B9N A;  1W7P D;  2ZCW A;  5L3C A;  4M74 A;  1ULY A;  3AAF A;  3TQN A;  3F22 A;  3GUD A;  3ULQ B;  3KCC A;  1R1T A;  3C1D A;  2XAQ A;  3B73 A;  3JAM Z;  2LF7 A;  3T0Y A;  2ISY A;  3IKT A;  2FBK A;  5LEJ A;  4LB6 B;  1HXD A;  1SFX A;  4L5J A;  5DUI A;  1XSV A;  1BIA A;  4WWC A;  1WSU A;  2QBY A;  3FWE A;  4OOI A;  4B09 A;  4ESJ A;  4YFK F;  1QNT A;  3H3Z A;  4YFN F;  1UHM A;  2EA2 A;  3ABU A;  3LA3 A;  5D8K B;  3SXY A;  2RGV A;  3J80 K;  1Z6T A;  1RUO A;  4HF1 A;  1VTN C;  4Q5S F;  2GAU A;  4I98 B;  3RPU A;  3I54 A;  2VBY A;  2CSO A;  5ICF A;  1IAW A;  3JTG A;  4LK1 F;  3Q9V A;  1AOY A;  5CVU A;  3FMQ A;  1UCR A;  2ZKZ A;  1R22 A;  4E70 A;  1UFM A;  4AD9 A;  3M8E A;  1OPC A;  4HAM A;  4ENN A;  2BBY A;  2LNB A;  3V8K A;  1D5V A;  1SD6 A;  2L01 A;  2VC1 A;  3CUQ C;  2EFN A;  4R8H A;  1ZRC A;  2R7F A;  3V8L A;  1O3S A;  3I71 A;  3W6K B;  3PFI A;  2Y75 A;  3MEX A;  1WKM A;  4H0E A;  1U2W A;  4BYY A;  5ILS A;  2OZ6 A;  2PG4 A;  2DLL A;  3N97 A;  2V1D A;  2W25 A;  1NHA A;  4HF0 A;  1G3W A;  1TBX A;  3KLN A;  2D2W A;  1QQI A;  4XLN F;  3EET A;  3EYY A;  1XMA A;  4LLG F;  4ASN A;  1SMY F;  2EA4 A;  4A2U A;  2DW4 A;  3ZMS A;  2V1X A;  1R23 A;  2HQN A;  3PQJ A;  1BI1 A;  1XN7 A;  3TO9 A;  4YIF A;  3COA C;  1U5T B;  3RYR A;  2ZME A;  1FC3 A;  3WGG A;  1IN5 A;  3E6M A;  2DI3 A;  3KZY A;  3R6S A;  3WE3 A;  5F6F A;  2M30 A;  1GHC A;  1SD5 A;  2G7U A;  3RI4 A;  1B4A A;  1CF7 A;  3VFZ A;  1IN4 A;  3QAH A;  4KYW A;  5KVR A;  3NEU A;  2BGC A;  3FF5 A;  5D6F A;  1ZLJ A;  4IVN A;  2OQG A;  4RB2 C;  4HBL A;  1FP2 A;  4S05 A;  3FXR A;  1B9M A;  3MAJ A;  3KP4 A;  4LG0 B;  2EV5 A;  4M72 A;  1MD0 A;  2ZNZ A;  5D4R A;  1JE8 A;  1FZP B;  1R5H A;  2JPB A;  4U0V A;  3KLO A;  4WCG A;  2L4A A;  4FX4 A;  3ZMV A;  3I59 A;  5AIP A;  5JHU A;  4YII A;  3MZY A;  4A5N A;  1EH7 A;  3HOT A;  4I01 A;  5LHI A;  3HSF A;  4CIC A;  2ADU A;  4BNC A;  1HW2 A;  1KYZ A;  1QO0 D;  4GXO A;  2O03 A;  1I5Z A;  1P4W A;  4OU0 A;  4OIR F;  3OV8 A;  5ICC A;  2VE8 A;  1F5T A;  5D5X B;  2EFO A;  3DV8 A;  2P5V A;  3RPQ A;  1O3Q A;  2O61 A;  3JSO A;  2HS5 A;  3GEZ A;  3LFK A;  1CGP A;  1EH6 A;  3WTU C;  1J5Y A;  1XGS A;  2QYO A;  5HS9 A;  1LJ9 A;  2D45 A;  1MGT A;  4F7Z A;  1KU2 A;  2FEZ A;  1R58 A;  3I64 A;  4EGY A;  1OR7 A;  1J75 A;  4KMU X;  3CO7 C;  1P2F A;  2BYV E;  1ONV A;  1O57 A;  2H6C A;  3FM3 A;  2ELH A;  2OBP A;  5FFZ A;  4NQW A;  3K2Z A;  4L9V A;  1S29 A;  4JQF A;  1RZ4 A;  4P5O A;  3K1N A;  1TNS A;  4Y15 A;  4XSX F;  1DPR A;  2A6H F;  1IRF A;  1KGS A;  1T0F A;  2KJB A;  2VBX A;  4KN4 X;  1IRG A;  4A0Y A;  4OIN F;  1FT9 A;  3WTW C;  1K79 A;  3VOD A;  5DEQ A;  1XCB A;  2F2E A;  3E5Q A;  4RAY A;  4QWQ A;  5DYM A;  1ZLK A;  3HTU A;  3Q5F A;  1KU3 A;  2OQR A;  1XD7 A;  1QZY A;  4LB5 A;  2OD5 A;  4M9Z A;  5LRS A;  1SD7 A;  1FYK A;  2AXL A;  2ZJ2 A;  3QU6 A;  4A0Z A;  3J80 Z;  1ZRE A;  4I0B A;  4PDK A;  3LQR A;  1YW7 A;  2A07 F;  2RKH A;  2ETH A;  4L18 B;  5E8I A;  2HR3 A;  3KP5 A;  1XSX A;  4LK0 F;  1W7P B;  4RB3 C;  4OIO F;  4KMF A;  2MC3 A;  5EEH A;  1IXC A;  1XGN A;  2HKX A;  1R00 A;  3HYI A;  2H6B A;  1KQ0 A;  2J5O A;  2FU4 A;  4HW0 A;  3IWZ A;  2UXN A;  4O5V A;  1FBU A;  3M8F A;  3KET A;  1S3J A;  1XCV A;  3WTZ A;  4MTE A;  2J5P A;  3F6V A;  2LSO A;  5IT3 A;  2PBI A;  1ZHF A;  1FX7 A;  1HW1 A;  2ZFW A;  3R4K A;  2PEX A;  2KIU A;  4WX9 A;  2CO5 A;  3CUO A;  1KQ9 A;  1F9N A;  2HTJ A;  2PMH A;  3GFI A;  1SMT A;  2E1N A;  3TKY A;  3QPT A;  3ELK A;  3O6B B;  1MKM A;  3LAP A;  5LEK A;  2WWY A;  5DCM B;  3LA7 A;  3GWZ A;  3P9K A;  1YTY A;  3SQN A;  4RGS A;  5E8G A;  2AS5 F;  4XRF A;  2VT2 A;  4LGW A;  5JVT A;  3Q9S A;  2GWR A;  4HX4 A;  3ZQ7 A;  1LB2 A;  3TDZ C;  4KIG A;  3RJP A;  3BZ6 A;  3WE2 A;  3F8F A;  1D8K A;  1USS A;  4EGZ A;  4MGR A;  1AWC A;  3WOD F;  4BHP A;  4AVP A;  2VBZ A;  3REO A;  4BH9 A;  4RB0 A;  2HKO A;  4ZH4 F;  5LGT A;  2H09 A;  2CFX A;  2YPR A;  1TQM A;  2XAS A;  1YLF A;  1KA8 A;  1TNT A;  3ZMU A;  4HQE A;  4ZZL A;  1GXP A;  3R60 A;  2NS0 A;  1IUY A;  4G8X A;  5HLI A;  1JXS A;  2V79 A;  4U0W A;  4N0B A;  4FHT A;  3TO7 A;  2DQL A;  2XIG A;  5H6R A;  1QGP A;  3RYP A;  3BWG A;  2HEO A;  3E6B A;  3LST A;  1U3E M;  5HS7 A;  1Y0U A;  1UST A;  2VE9 A;  4U7D A;  3P9C A;  3FX3 A;  1STZ A;  2R3S A;  4EJT A;  3RKX A;  1WRJ A;  5LHG A;  5L3F A;  2CQK A;  3T8T A;  5IT9 K;  4LLN A;  4RGU A;  1RIO H;  2VC0 A;  2L54 A;  2XKO A;  4LLL A;  3BRO A;  5HDG A;  4M73 A;  4KIB A;  1DPU A;  1XDS A;  3KE2 A;  2COM A;  5JR3 A;  2M45 A;  3RDI A;  3J81 K;  4AWX B;  3FMS A;  2P6S A;  4GO1 A;  2DU9 A;  1YYV A;  4GCV A;  3F72 A;  2O0Y A;  5BPI A;  3ML6 A;  1DP7 P;  4I7H A;  4WXC A;  5ICG A;  4Q4Z F;  3LA2 A;  4QLC U;  1IN7 A;  1YFH A;  1A04 A;  2D1V A;  2CYY A;  2GXB A;  2L3D A;  5BQT A;  1BC7 C;  3F8C A;  4N9I A;  3ZMT A;  2ACJ A;  1W5S A;  1P92 A;  4OIP F;  1Z7U A;  4KIC A;  1YW8 A;  2HYF A;  2RDP A;  3ZPL A;  2XAH A;  4MNU A;  3O2P E;  4IRI A;  2NRA C;  4L9N A;  1Z91 A;  5K5Q A;  1YQA A;  3E6D A;  3GZ5 A;  2PJP A;  3TGN A;  2DBB A;  2P8T A;  4YG2 F;  1RUN A;  2XV4 S;  1LDJ A;  4HYE A;  3KEQ A;  5E18 F;  2HDC A;  4RGX A;  4HQM A;  2JSC A;  3FXQ A;  2G7H A;  3EUH A;  3CJN A;  4WXH A;  4RGR A;  1ZG1 A;  2W85 A;  1H9T A;  3GW2 A;  3R0A A;  4KA4 A;  3EQL F;  3SZT A;  4L5I A;  4UUV A;  2UZK A;  3E5X A;  1BM9 A;  1R1V A;  4IRH A;  2IP2 A;  4NB5 A;  4BHC A;  2XUB A;  3WU1 B;  2Z99 A;  3IHU A;  2G9W A;  3E3V A;  4P9F A;  2HYG D;  3WTX C;  3TOB A;  1FPQ A;  3V7C A;  3B02 A;  2Q8K A;  2EFP A;  4CGZ A;  3JW4 A;  1T39 A;  3C7J A;  3F6O A;  2LDU A;  2PLY A;  1S8N A;  1QBJ A;  3M7G A;  4HZF A;  5HVQ C;  4N9H A;  2XHK A;  1K78 A;  2PQ8 A;  5A2Q K;  1YW9 A;  2FML A;  3E5U A;  2FXA A;  4I09 A;  1O3R A;  2DK8 A;  2F5F A;  5ED4 A;  1R1U A;  5E20 A;  2W57 A;  4EMS A;  3L2C A;  2Q0O A;  4IHT A;  4UV9 A;  3V7S A;  3DP7 A;  4A6E A;  2XKP A;  1FYL A;  4L0Y B;  2ZO4 A;  4M6X A;  1P4X A;  1OMI A;  5AIQ A;  2F5E A;  2XVC A;  4EJU A;  5FD5 A;  5DUK A;  4S04 A;  1ZYR F;  1BBY A;  3JSP A;  4UVB A;  1JGS A;  2JRT A;  3HRT A;  1ON2 A;  3NQO A;  2MH2 A;  2YU3 A;  1KYW A;  2HZT A;  3WTY C;  3HHH A;  1U8R A;  1MDM B;  3IWF A;  3O3K A;  1XGO A;  2H27 A;  1O7L A;  2VT3 A;  5FB2 A;  1QZZ A;  2Y48 A;  4AIH A;  5E1X A;  1WWX A;  5DD4 A;  1FNN A;  2K27 A;  5CVR A;  1MJB A;  2M8E A;  3FHZ A;  4EM1 A;  2D1H A;  5H6Q A;  3WTV C;  1OYY A;  1OYI A;  4MEY F;  4A0X A;  3IKV A;  1REP C;  1Z05 A;  1WQ2 A;  3CUQ B;  4L9J A;  4L9T A;  4BHB A;  3DPT A;  1ZAO A;  1FWZ A;  1TLH B;  2F5D A;  4IJA A;  4L0Z B;  5HOO A;  2A68 F;  4MTD A;  3ZN1 A;  3L00 A;  4HOB A;  5IT9 Z;  5DD8 A;  2QLZ A;  1IN8 A;  5LGN A;  1UB9 A;  4CXF A;  2DFI A;  5CYV A;  2M87 A;  4D0P A;  3K9T A;  2MA3 A;  4Q47 A;  4RS8 A;  3U9G A;  3J7A O;  4G6D A;  3GF2 A;  3ROU A;  3PQK A;  4KUM A;  1D8J A;  2Q2E A;  5JI6 A;  1BI3 A;  3IRQ A;  2WC2 A;  1LEB A;  3IL2 A;  1W4M A;  4IRG A;  3VB2 A;  2H94 A;  5E1W A;  3J81 Z;  2ISZ A;  1U5T A;  4KN7 X;  2VOO A;  3ECO A;  2XAJ A;  2P7V B;  2RQP A;  2VXZ A;  3S2W A;  5KK1 A;  5HLH A;  3ERE D;  2BV6 A;  2FRH A;  3LQQ A;  3FXU A;  2K4B A;  1JHH A;  3WTT C;  2QEN A;  4O6J A;  1T38 A;  2YX7 A;  5LHH A;  1YS6 A;  1V4R A;  1I1G A;  4OMZ A;  3IC7 A;  3DFG A;  1HBX G;  4JBA A;  3IRR A;  1IN6 A;  4LG0 A;  2QBY B;  1R7J A;  5CVI A;  4BXU A;  5LGU A;  4M9X A;  3HRU A;  2OAZ A;  4KIF A;  5BMZ A;  3I5U A;  2FSW A;  4HV5 A;  3ZN0 A;  4PZJ A;  3HRM A;  5L3B A;  1BI0 A;  2FNA A;  1G3T A;  4MQ9 F;  4XBF A;  2IW5 A;  1JHF A;  3HUG A;  4DQ2 A;  3RKW A;  1Z1D A;  2RV8 A;  4ZYD A;  1TW2 A;  1LEA A;  3BP8 A;  4EJO A;  5FD6 A;  1T2K A;  4GYG A;  3BPV A;  2IT0 A;  2STT A;  1F1Z A;  1PDN C;  1SD4 A;  3HIF A;  1W5T A;  5CVV A;  4MEX F;  1TW3 A;  1OYW A;  3KP6 A;  1LNW A;  1IXR C;  4G7H F;  4YFX F;  3VOE A;  1TTY A;  4M9S A;  4ENJ A;  2A61 A;  2QM3 A;  3CLO A;  2ZXJ A;  1L3L A;  2FBH A;  5F64 A;  5ILU A;  2NNY A;  5K5R A;  1ON1 A;  1X3U A;  4EQQ A;  2A3S A;  2K4J A;  5K5O A;  2KRF A;  4Y17 A;  2QQB A;  3LAJ A;  5BPD A;  1S7O A;  1ZGA A;  2V9V A;  2VN2 A;  3FZV A;  3DXJ F;  2FQ3 A;  3DPL C;  1XGM A;  1I6X A;  2RNJ A;  4CO8 A;  5L3E A;  4RB1 A;  1DDN A;  4O3M A;  5F1R A;  1ZN2 A;  1G6N A;  2P5K A;  4G7Z F;  3TDU C;  2X0L A;  5FGM A;  3W6J B;  1U5T C;  3QOP A;  4FT8 A;  2A6E F;  2ZME B;  4U88 A;  4PCQ A;  5L3D A;  2RN7 A;  1I1S A;  3E97 A;  1T6S A;  1RI7 A;  1RNL A;  1CF7 B;  2DK5 A;  5EEG A;  4HDV A;  1GXQ A;  2K86 A;  5J8F A;  5ERI A;  3WTS C;  3H92 A;  1W7P A;  4HV6 A;  3KP3 A;  4KT5 C;  2VOD A;  2PN6 A;  4AIK A;  5HDK A;  5J8C A;  3RKY A;  4IHS A;  2CGP A;  2FOK A;  3CDH A;  3GO5 A;  1E17 A;  4R1H A;  2EFQ A;  1SFU A;  1LVA A;  1MJA A;  4MHG A;  4NHJ A;  3D5L A;  1C0W A;  4GGG A;  1YO5 C;  1LDK B;  1BJA A;  1I27 A;  3K0L A;  4HX8 A;  2F5C A;  5BOX A;  4HLY A;  3ZMD A;  4LMY A;  1Z6R A;  2Z9O A;  4I02 A;  1G3S A;  1HW5 A;  4ZYG A;  4G6Q A;  1ZRD A;  1MZB A;  3I59 B;  2RC4 A;  2OU2 A;  1U78 A;  4HLX A;  3BJA A;  3MQ0 A;  2IPQ X;  1Q1H A;  3QP6 A;  5D5W B;  3L9F A;  2TDX A;  4HA8 A;  3WGH A;  2GXG A;  2FE3 A;  2DTR A;  4U7B A;  4IXA A;  1FBQ A;  2R7D A;  4ZYE A;  4DNC A;  2K7L A;  2DO7 A;  1P6R A;  3K69 A;  3GXO A;  2W84 A;  3E6C C;  2FBI A;  2NNN A;  2DT5 A;  2UWM A;  3KP7 A;  2KJC A;  3WGI A;  2OA4 A;  5DCM A;  2K02 A;  2WV0 A;  2HQR A;  4B8X A;  3FMR A;  2CW0 F;  5D4S A;  2KIF A;  3BY6 A;  2QQ9 A;  3F3X A;  4GYI A;  2VBW A;  2JTV A;  2GA2 A;  1O3T A;  5HS8 A;  2CWE A;  3FM5 A;  4TV7 A;  1ZAR A;  1J2X A;  3T8R A;  3ZMZ A;  1K7A A;  2HTS A;  1TQI A;  1HST A;  3QU3 A;  2FMY A;  2IA2 A;  2Z3Y A;  2IA1 A;  3I53 A;  3SZP A;  1EV7 A;  3ISP A;  1G4D A;  1H0M A;  3TO6 A;  1WI9 A;  3G73 A;  1PP7 U;  1FSE A;  4UNO A;  4KNY A;  4AIJ A;  2YSR A;  3QRF F;  1OKR A;  5LBQ A;  3HTS B;  2YX4 A;  3F21 A;  3ECH A;  1L0O C;  2P6T A;  2VOP A;  3GFJ A;  3LWF A;  3KFW X;  1ODD A;  4CHU A;  3HSE A;  3WU0 A;  1XB4 A;  1IW7 F;  2BEO A;  2FF4 A;  2P4W A;  1FLI A;  1IXS B;  3C18 A;  3DEU A;  2KKO A;  1LDD A;  4G94 A;  4EJW A;  2E7W A;  2XGX A;  2P5L C;  2HGC A;  1F4K A;  3SFZ A;  1KU9 A;  4P9U A;  2P7C B;  4CYD A;  2MH9 A;  3QP5 A;  2M5W A;  1HKQ A;  4FX0 A;  3N4M A;  5J6X A;  5FFX A;  5FO5 A;  3F8M A;  3GFL A;  1HKT A;  2PFB A;  2PMU A;  1FYM A;  4UVA A;  3WG9 A;  2MLK A;  3MFK A;  3R61 A;  1J9I A;  4KFC A;  4LFU A;  5TRD A;  2YR2 A;  5FLX K;  3DF8 A;  2FNP A;  5E17 F;  3M1E A;  2EFW A;  3P9I A;  1U6G A;  4WK8 F;  1BIB A;  3V4G A;  2EJR A;  3JTH A;  3RTR A;  1J7K A;  2HWV A;  1V3F A;  3OOP A;  2QUF A;  2M1B A;  2IVM A;  3KEO A;  2CG4 A;  4M6Y A;  2ZNY A;  1FSH A;  2O6G E;  4HX7 A;  3QPH A;  2O3F A;  5L3G A;  3U1D A;  4EM2 A;  4IPA A;  1FBS A;  3HHG A;  1FP1 D;  1LQ1 A;  1IZ1 A;  2WTE A;  3ZP5 A;  4Q48 A;  1B1B A;  2MBF A;  2DQR A;  2HFH A;  4A6D A;  5K1Y A;  2STW A;  2XRO A;  3HRS A;  1P4A A;  2X4H A;  2ESH A;  1IF1 A;  1G3Y A;  5CJ9 A;  4ENK A;  6PAX A;  4EJV A;  2L4M A;  4ESF A;  2ESN A;  3JAM K;  2IRF G;  3BJO A;  1KU7 A;  2GQQ A;  4G7O F;  1FOK A;  4Z2Y A;  4KDP A;  2FA5 A;  1XDU A;  4XSZ F;  3T5X A;  4R79 A;  1B59 A;  4EM0 B;  3F23 A;  3EDP A;  2GA1 A;  2E1C A;  5E1Z B;  3C3W A;  1S7A A;  1XMK A;  2O8X A;  4P96 A;  1HQC A;  2EV0 A;  2VON A;  2XRN A;  2XAG A;  4A5M A;  2XAF A;  4WF2 A;  3DKW A;  3BDD A;  4CDG A;  3H3U A;  3BOQ A;  3L7W A;  5TJJ A;  5AON A;  1DUX C;  3V7R A;  3I0T A;  1UHW A;  2OZU A;  3K1P A;  1PP8 F;  1BI2 A;  1T98 A;  4G9Y A;  2IA0 A;  3CTA A;  5D5U B;  3RIR A;  2V1U A;  1EH8 A;  2A69 F;  3KZZ A;  2DAO A;  3BJ6 A;  4BAY A;  1J59 A;  2DPU A;  4I2O A;  3GZ6 A;  2QQA A;  2QWW A;  5ICE A;  3EYI A;  4UVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...