3M1EA

Crystal structure of benm_dbd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the unbound LysR-type transcriptional regulator BenM DNA binding domain
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator benM
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m1eA00
3TO9A 4UHTA 4MTEA 4EJWA 2VBZA 2XV4S 1R58A 3QP6A 1IN5A 1IAWA 4OU0A 2DT5A 4I98B 4AIHA 1ZGJA 4FX0A 3WGGA 1P4AA 1ULYA 5HDNA 1GHCA 2MA3A 2VN2A 2FOKA 2FBIA 3DPLC 1RUOA 3RPUA 2VE8A 1IXCA 5FFXA 4ENMA 5ILUA 1W7PA 2JSCA 1BI0A 4EJVA 2QENA 4I09A 1MZBA 2VC0A 2WWYA 4BQAA 2CO5A 4TV7A 1TQIA 2A5YB 3EETA 3I4PA 3W6KB 4ENKA 1XSDA 4WWCA 1LNWA 4M71A 4U7BA 3WE2A 5LEJA 3IWZA 5DUKA 4LB6B 4HLXA 4LJZF 3ZN1A 4WX9A 2E1CA 4N9IA 1JE8A 1PP8F 3D5LA 1SAXA 3TDZC 4QLCU 2YU3A 2XGXA 4L9NA 1YFHA 3HTUA 2E7WA 3V4GA 3FX3A 1IXRC 3MZYA 2XAFA 1T2KA 5LRRA 4A0ZA 3ZN0A 3ZMUA 2PG4A 4KFCA 1BOAA 4EJUA 1YW9A 3K0LA 1O3SA 2EFWA 2OAZA 1H9TA 2W85A 2CSOA 2FNPA 2VODA 2X4HA 1RZ4A 5LGTA 1UB9A 2STTA 1PP7U 5E1XA 1XGMA 1YO5C 1UCRA 3TQNA 2KIFA 3JW4A 1DPRA 1G3WA 5J6XA 2FEZA 1SD5A 3R61A 4LG0A 3E6CC 3GFLA 4HAMA 4HF2A 2JRTA 2GA2A 1F4KA 2K02A 1ZARA 2Y0MA 3WTUC 4UNOA 3QU6A 3WTTC 1HW5A 2ZBKA 3ROUA 5D5XB 4BXUA 3FM5A 2FSWA 4A0XA 2QBYA 5DEQA 5AIQA 4AIJA 4BHCA 3G73A 1W5SA 2EA2A 1BJAA 1UFMA 3DEUA 2L4AA 2XAQA 4EVIA 2R7FA 2MH2A 1YW7A 5LLQA 3O3KA 2WTEA 2HTJA 3LA2A 3HHGA 4N0BA 3MEXA 2W84A 1C0WA 3LWFA 3DKWA 2H94A 5K5QA 1OMIA 5CVJA 2BEOA 4L9TA 4FHTA 4WF2A 3COAC 4YFNF 2FE3A 4AWXB 5DCMA 2ZMEA 2NAZA 3LSTA 2IW5A 1HW1A 4RGXA 3ECHA 2Z5UA 2BGCA 1OYIA 1S29A 1YG2A 2FNAA 4G7HF 1R5HA 5FB2A 2QQ9A 2PBIA 5IT9Z 5KK1A 1GXPA 2W25A 1XMKA 2G7HA 3K1PA 4U7DA 1FPQA 1W5TA 1IW7F 2FA5A 3KLOA 2CFXA 3RIRA 1FOKA 2FRHA 2RC4A 1ZG1A 2HDCA 1O7FA 4G9YA 3GW2A 3HOTA 1D3YA 1IUYA 2YSRA 4IRHA 1J0RA 2Q0OA 3CUOA 1I6XA 3LA7A 2VOOA 1JHFA 1KA8A 2OQRA 2J5PA 4EGYA 4ZYEA 3EQLF 2LF7A 1IN7A 1D8JA 1ZGAA 1U8RA 1ON2A 2MD5A 3BY6A 4HF1A 1IRGA 3F3XA 2IP2A 4G6QA 3CJNA 1HBXG 3F21A 2V1UA 2W57A 1X3UA 1BC8C 4NHJA 4RAZA 1LB2A 3FM3A 2WV0A 2Q2EA 1USSA 2DLLA 4R79A 1XN7A 4U0YA 1BI3A 2HKXA 5E1ZB 3WU0A 2Z9OA 3LAPA 4HQEA 3KZYA 4R1HA 2LSOA 2ESHA 1KU9A 5HLGA 4MQ9F 2Q8KA 5AIPA 3FMSA 1S7AA 3C18A 4OIRF 2XUBA 2IRFG 5JI6A 5LBQA 4DNCA 1R7JA 4MQVA 4MTDA 4Q47A 2ETHA 2EB7A 2XVCA 3GFMA 3V7SA 5DDGA 2CQKA 4QWQA 1WQ2A 2HTSA 1U5TB 4KN4X 1BN5A 1ZH5A 2VXZA 2QBYB 2AXLA 2DBBA 3F6OA 5CVRA 4L18B 2IPQX 2YX7A 3Q9SA 2H09A 1O57A 4IHTA 3GO5A 3M9AA 4UVBA 4ZZDA 2QWWA 1Z1DA 3NQOA 1BI2A 1CF7B 3CUQB 2VBWA 1YTYA 2QYOA 3KEQA 4I02A 1LDJA 1MJBA 1O3QA 4LGWA 3HIFA 2JPBA 3R6SA 2M8EA 4PDKA 1ONVA 1HSJA 3F8MA 2ZO4A 1R5GA 1XGSA 2RNJA 5L3DA 3GZ6A 1QNTA 2GWRA 2P5LC 3DFGA 4AIKA 1T98A 2LKPA 4HF0A 2JTVA 3D0SA 1Z91A 3MFKA 5JFRA 4F7ZA 4HW0A 1R36A 3U1DA 2DPDA 3QAHA 3E6DA 2F5DA 3I59B 3RI4A 4HX7A 3OV8A 3IRRA 3CTAA 5J8FA 4KIFA 2J5OA 3SZTA 1R00A 3TKYA 4Q5SF 5E20A 3BROA 3P9CA 1FYLA 2M1BA 1ZLJA 3ZMTA 2P4WA 3JAMK 4G94A 4U0WA 3WTWC 2QUFA 1D5VA 1DPUA 5F1RA 2CWEA 1G3YA 3KEOA 1CF7A 5CVIA 2L3DA 2OA4A 1BI1A 3CDHA 5ICEA 3E3VA 1MJ9A 3I0TA 2XAHA 2FXAA 3S2WA 3L7WA 2HOEA 4DQ2A 4EJTA 3RKWA 4HQMA 3ULQB 3J80K 1OKRA 5FGMA 3GVAA 2PI0A 4U88A 2ISZA 4B09A 2IA2A 2D45A 2FQ3A 1DUXC 3M8FA 2M5WA 3V8KA 2ZFWA 3R0JA 4AD9A 4A6EA 3BWGA 3C1DA 1KGSA 5HDGA 1FZPB 4PCQA 4P9UA 1HW2A 4XLPF 4RAYA 1TNSA 1JGSA 3GFJA 3SXYA 1U5TC 4KIBA 3PQKA 3P7NA 4Z2YA 4I01A 1Z9CA 1J7KA 2KRFA 1Y0UA 2DK8A 1QPMA 1B4AA 2V9VA 2VC1A 3EDPA 5D6EA 2RDPA 3N4MA 1FBQA 2VONA 1R22A 5D5UB 4UUVA 1Z05A 2UZKA 3RYRA 1V4RA 4G8XA 3QPTA 3U9GA 3VB2A 1KU7A 3TO6A 4KNYA 2EV5A 4LG0B 2R3SA 1YS7A 4EM2A 1B9NA 3MQ0A 3V7CA 2HQNA 5CLSA 1MDMA 1YW8A 2EV0A 2ZJ2A 1RIOH 4ZYHA 1BIBA 1I1SA 1ZG5A 3QOPA 1KQ9A 3EUHA 1FT9A 3V8JA 1A04A 1XSXA 5ICFA 3RPQA 3FMQA 4MNUA 4NQWA 2OQGA 2GZWA 1TLHB 3VEPA 3HRSA 3KETA 4YG2F 2F5EA 3DXJF 1SMYF 2UWMA 2F5CA 3TDUC 1FWZA 2HQRA 1EH6A 2GIVA 4UV9A 1LDDA 2OD5A 4P96A 5DD8A 1R1UA 2OZUA 4M74A 5E17F 2P6TA 2HFHA 3FF5A 3I53A 2V1XA 3K9TA 4KT5C 4ZYDA 3WTVC 2XIGA 3KP3A 3K2ZA 1SD4A 1ZYRF 4EJOA 3O6BB 5FO5A 4G6DA 3JSOA 4HOBA 5FFZA 1DDNA 1B1BA 5LRSA 5HOOA 1FY7A 1CGPA 1S8NA 4HA8A 4JQFA 2P8TA 3ZP5A 4IRGA 1XDUA 3M1EA 3HRUA 4M9ZA 1K79A 1I1GA 2XRNA 1XMAA 2CG4A 3BJ6A 1XD7A 3SZPA 3R60A 1ZHFA 4L0YB 4LD5A 2EFNA 2YX4A 2FMLA 3I71A 2G7UA 2VBXA 2FU4A 4BAYA 2E1NA 2NRAC 3LA3A 1FBUA 1QGPA 5ILSA 3KFWX 3J80Z 5ICGA 4A6DA 4N9HA 3GWZA 3M8EA 3WODF 4S05A 3HRMA 2GAUA 3L00A 4HV6A 2XAGA 1D8KA 1KU3A 2COMA 2VE9A 1TNTA 3RDIA 3LQQA 1XGOA 2KKOA 1O7LA 2D1VA 2RKHA 2FBKA 4M73A 3BP8A 4KDPA 3JAMZ 5DD4A 5E1WA 4KN7X 1FP1D 3BOQA 1ZAOA 4LLNA 1HSTA 2A69F 1U78A 3RYPA 4UVCA 2MH9A 4RS8A 3K1MA 3WTZA 3T0YA 5L3CA 3B73A 4KUMA 1P2FA 1EH8A 3E5XA 1W7PB 4YIFA 3ISPA 5FD5A 1OR7A 2NS0A 2Y75A 4OOIA 3BJOA 4GYIA 1ZRFA 2OBPA 3FWEA 1FP2A 3LFKA 2K4JA 2ZMEB 1IRFA 2P7VB 1F9NA 5DYMA 2CYYA 1T6SA 1T39A 4PGGA 5ILVA 2D2WA 3BPXA 4GCVA 5EEGA 1AWCA 4L9JA 5CJ9A 1JXSA 3FXQA 3DP7A 3GUDA 1KQ0A 5AONA 5TRDA 5HS9A 4ON0A 4ENJA 1RI7A 1XCVA 4BH9A 3N97A 5TJJA 3WGIA 3O2PE 1OYYA 4M72A 3ECOA 4JBAA 4XSZF 5HS7A 1P4XA 2V79A 4LK0F 3J81Z 4IVNA 3C3WA 1ON1A 2K86A 3PFIA 2ZNZA 5K5RA 5BQTA 5FLXK 4O6JA 3IC7A 1OYWA 2NYXA 1YYVA 4RB3C 1J75A 5F6FA 1IXSB 1G6NA 4B8XA 1HKQA 3K1NA 2HKOA 5CVUA 4EGZA 1LQ1A 3DV8A 3Q5FA 2L4MA 4UV8A 4Y17A 3LQRA 2QQBA 1F5TA 1HXDA 2EA4A 1SMTA 3T8RA 1VTNC 3IL2A 1YLFA 4ESJA 5E8GA 2NNYA 2M30A 2BE5F 4UXNA 2ZCWA 2RV8A 1H0MA 1U3EM 2KIMA 5K5OA 5F64A 1MKMA 3DF8A 1LDKB 3ZPLA 3F8NA 4E70A 4RB1A 2B0LA 1E17A 2PN6A 1BBYA 2PQ8A 1XGNA 5KVRA 3F22A 5BPIA 5L3EA 1WWXA 3I5UA 2VT3A 1T38A 4PZJA 4OINF 4IRIA 3F23A 1WI9A 1OPCA 2PMUA 5E8IA 3HSFA 1J59A 2YR2A 4ESBA 2TDXA 1MDMB 4EV0A 4YFXF 5IT9K 5A2QK 1S7OA 1R23A 2RVCA 4I2OA 2RN7A 3IHUA 3GEZA 2P6SA 3ABUA 4I0AA 4ZYGA 1U5TA 4RGSA 2DPUA 3BPVA 3RJPA 4CXFA 4LK1F 1I5ZA 2E7XA 5JHUA 1FNNA 4IF4A 4ETSA 3GX4X 2ZNYA 3HUGA 4GO1A 1DP7P 4M6YA 3TGNA 2DFIA 2RQPA 2R7DA 4CYDA 3CLOA 4UVAA 4IXAA 1SD7A 4EM0B 4KIGA 3M7GA 1YQAA 3E6BA 1FC3A 4XLNF 1STZA 1TTYA 3BDDA 5DUIA 2IA1A 3V8LA 3IRQA 5DCFA 1B6AA 2GXBA 3B02A 5D5WB 4MHGA 3ABTA 1XSVA 1YS6A 4O3MA 2OU2A 4KICA 1FSEA 1G4DA 4MEXF 4Q48A 4HX8A 2Z99A 1GVJA 4OIPF 5LHIA 1HQCA 4RGUA 2MBFA 5BOXA 2EFQA 3G3ZA 1R1VA 5FD6A 3I59A 5L3BA 4ESFA 3WG9A 4O5VA 3HOSA 2HEOA 3SHFA 3SFZA 2QZ8A 3I58A 1AOYA 3L9FA 1I27A 4R8HA 5IT3A 1LEBA 2LDUA 3ELKA 1FLIA 3QRFF 3R0AA 4FX4A 2O8XA 1USTA 2IJLA 5D8LB 3EYYA 4XRFA 3WE3A 1BC7C 3FMRA 5D4SA 3P9IA 2KJCA 3DPTA 3KP4A 3DQVC 1BIAA 2Z33A 1UHWA 3ML6A 3J7AO 3QP5A 1HKTA 1XCBA 2K4BA 4M6XA 1PDNC 2DW4A 3GF2A 4IHSA 4HZFA 4ZZLA 1K78B 5HLHA 3EYIA 5HVQC 2BV6A 5LEKA 1LVAA 2L54A 4HLYA 2HR3A 2JT1A 2Y48A 4BHBA 1YIOA 1FYMA 5E18F 5L3FA 1WKMA 1V3FA 1MGTA 4ENNA 3KE2A 4LMYA 2NNNA 2L02A 3P9KA 2PMHA 4S04A 2M45A 1FBSA 3F72A 1S6LA 1KU2A 2HZTA 2V6CA 4AVPA 2A07F 2HGCA 3ZMSA 2PLYA 5ICCA 3GLXA 5ERIA 4CDGA 3H3ZA 4LFUA 3E5UA 6PAXA 3CUQC 3HSRA 1ZRDA 3KP5A 4XSXF 3H3UA 1B9MA 1SFUA 5HS8A 5FLXZ 1WSUA 4OMZA 3E97A 1P4WA 3GZ5A 2H6BA 4K2EA 2Z3YA 4YIIA 3KCCA 1L0OC 1TW3A 2O61A 3KZZA 4KMUX 3R4KA 4Y13A 3H92A 4L5IA 1SD6A 2ACJA 2XHKA 3NRVA 3CO6C 1H9GA 4Q4ZF 1KYWA 1QO0D 3T1BA 3VOEA 5L3GA 2GA1A 1FSHA 4P9FA 3IWFA 1IN4A 4L9VA 2DAOA 3F8FA 3HSEA 4NB5A 2MLKA 2ZKZA 2UXXA 3E5QA 1Q1HA 3BZ6A 2EWNA 3U2RA 2K27A 1IF1A 4A12A 2STWA 5BS6A 2GQQA 1HKSA 1LJ9A 4CZZA 1E2XA 3CUQA 1BM9A 2VOPA 3ERED 4G7OF 1B59A 3HTSB 1NHAA 3GYHX 5BPDA 5D6FA 2QVOA 4L5JA 1W4MA 1QZYA 2DQRA 4JK1X 3QU3A 1O3RA 1W7PD 5EEHA 4GGGA 2VBYA 3IKTA 1FX7A 2F2EA 2WC2A 3BJAA 1IZ1A 2BYVE 3GFIA 3FZVA 2XKPA 1TQMA 1REPC 3KP6A 2EFOA 4GYGA 2XAJA 1U2WA 2V1DA 4WCGA 3ZMVA 3SQNA 3E6MA 4M9SA 3RTRA 1EV7A 5D4RA 4OIOF 5JVTA 2F5FA 1K7AA 4D0PA 4EQQA 1ODDA 2EFPA 3HRTA 1R1TA 3KLNA 2PFBA 3T8TA 2FMYA 3F8CA 2QLZA 3FHZA 2L01A 2DU9A 5DCMB 5K1YA 2JPCA 2P5VA 4BNCA 1ZLKA 1P6RA 4EMSA 4FT8A 4RB2C 1SFEA 3MCZA 1QZZA 3F6VA 3VODA 3ZMZA 2O03A 2A6HF 4LLLA 2O6GE 3JTGA 4H0EA 1EH7A 4U0VA 4CGZA 2A68F 5CVVA 2H27A 3VFZA 1G3SA 2C6YA 2QM3A 3REOA 3WTSC 4LB5A 2W24A 5LHGA 2G9WA 2A61A 4CO8A 2IA0A 2JZYA 3L2CA 3WTYC 1XDSA 4A5NA 1ZN2A 1Z7UA 3WU1B 4KA4A 2UXNA 3Q9VA 1J2XA 2A6EF 4A5MA 2MLGA 4PGHA 1TBXA 4RB0A 4HYEA 4HBLA 1QQIA 4CICA 5A2QZ 3MWMA 2FF4A 1TW2A 4I0BA 2HWVA 2ELHA 2IT0A 3ZQ7A 4YFKF 5ED4A 3PQJA 4G7ZF 2ZXJA 3C7JA 3IKVA 1IN6A 4EM1A 2PEXA 2A3SA 1F1ZA 4ASNA 2GXGA 2P5KA 4P55A 2EJRA 1IN8A 4I7HA 1WRJA 3NEUA 5JR3A 3JTHA 3OOPA 1ZRCA 2KIUA 1KYZA 2VT2A 3AAFA 4A0YA 3T5XA 2DO7A 1PUEE 2CW0F 4GXOA 3FXRA 3WGHA 2BBYA 4WXHA 2X0LA 2DQLA 4OMYA 3I54A 4HDVA 2HYGD 4OIQF 5LGNA 3I64A 4RGRA 4BYYA 2ESNA 3ZMDA 2M87A 1MJAA 1L3LA 2YPRA 2LF8A 4WXCA 4XBFA 4A2UA 1G3TA 1QBJA 1RNLA 2XKOA 5H6RA 2DTRA 1K6OA 2D1HA 3KP7A 5LGUA 1J5YA 2ADUA 2P7CB 2PJPA 2HYFA 5CYVA 4BHPA 1LEAA 2K7LA 4KYWA 1Z6TA 3WTXC 3J81K 4WXDA 4HDUA 3TOAA 1KQ8A 5D5VB 3LAJA 2H6CA 1U6GA 1GXQA 3TOBA 4MEYF 2ISYA 1S3JA 1P92A 1MD0A 2AS5F 1ZREA 2OZ6A 4P5OA 3V7RA 1TQPA 3MAJA 5DV5A 2EK5A 1XB4A 3HHHA 2CGPA 5HDKA 2RGVA 1RUNA 2O0YA 3L09A 4IJAA 1ZG3A 5HLIA 3JSPA 4CHUA 4ZH4F 3HYIA 2EV6A 2MC3A 3KP2A 5BMZA 3TO7A 1J9IA 2DI3A 5LHHA 2XROA 1T0FA 1Z6RA 3QPHA 1K78A 5H20A 1O3TA 2O3FA 3MZHA 3W6JB 2DK5A 4LLGF 4MGRA 4M9XA 3CO7C 2QQAA 3K69A 4Y15A 1FYKA 1SFXA 3F8BA 5D8KB 3RKYA 2LNBA 4L0ZB 2IVMA 5H6QA 4KMFA 2KJBA 2XASA 3FXUA 2FBHA 2HS5A 5J8CA 4HV5A 1JHHA 3GXOA 4HX4A 4IPAA 1UHMA 3RKXA 4WK8F
chains in the Genus database with same CATH superfamily
3TO9A 4UHTA 4MTEA 2VUMJ 4EJWA 2VBZA 3ZCOA 2XV4S 5F0CA 3G1MA 1FIAA 3K70C 1R58A 3QPLA 3QP6A 1IN5A 1IAWA 2XF6A 2L9SA 2O7OA 1D1BA 2O9LA 1VNDA 4OU0A 1BW6A 2DT5A 4I98B 4AIHA 1ZGJA 4FX0A 1BL0A 3WGGA 1P4AA 1ULYA 2LVSA 5IYBJ 3RZOJ 5HDNA 2DODA 1GHCA 2MA3A 3ZQFA 5C3EJ 2VN2A 2VASA 2FOKA 2FBIA 2E1MC 2QEXI 3MN2A 4CZCA 3DPLC 1RUOA 3RPUA 2VE8A 4A3EJ 1V54H 1IXCA 3DBRB 2EH3A 3KPHA 2DOAA 5FFXA 4ENMA 5ILUA 2QSHX 1W7PA 2BZTA 2JSCA 1BI0A 4EJVA 2ZJQF 2QENA 4MLOA 5K7FA 2JQ7A 1ZQ3P 1JKRC 2X1DA 4I09A 3OYIA 3HOZJ 1MZBA 2HXOA 1X1BA 2VC0A 2A05A 2WWYA 4NC8A 4BQAA 4QIWN 3H5RA 2CO5A 4LOCA 3H0GJ 4TV7A 1TQIA 2AHQA 1JTYA 2A5YB 3EETA 3TMOA 1UJ8A 3SEQA 3I4PA 3ZQQA 1NH3A 1P7IA 1WJDA 3W6KB 4Y4RA 1GVDA 5F1JA 3HB9A 4ENKA 1XSDA 2HDWA 4WWCA 3L2QA 3AL0C 4BDZA 1LNWA 4M71A 4BBRJ 1W5CC 4U7BA 2HVSA 2E2HJ 3QYFA 2NOJB 3GTLJ 3WE2A 3S3OA 5LEJA 5F04A 2HYJA 2HOAA 3RZDJ 3IWZA 2GXAA 1ETOA 3B6CA 5DUKA 2EIJH 3LFUA 4LB6B 2CJJA 1KONA 4HLXA 4LJZF 3RQIA 3ZN1A 2M0MA 4WX9A 2E1CA 1JUSA 4N9IA 1JE8A 1VQLI 1PP8F 3D5LA 1RR8C 2HDDA 1BW5A 3LSKA 3HOWJ 1EJ9A 2ZXWH 1SAXA 1PYVA 2CUEA 3RCOA 3TDZC 3Q0VA 5EYRA 2V9PA 3IH4A 2OC6A 4QLCU 2DCEA 2YU3A 2XGXA 5M3FJ 3TW6A 1Y8QB 4MFEA 3M1CA 2M8GX 4L9NA 3BTLA 1YFHA 3S32A 4W1UA 3HTUA 3BC8A 3G4SI 2E7WA 3V4GA 3FX3A 3BG7A 1IXRC 1QA6A 4AU7A 3MZYA 2AO9A 1XPXA 3PO2J 2AQFA 3F9KA 2X6WA 2XAFA 3L1PA 1T2KA 3H5NA 5LRRA 3LSPA 4A0ZA 3ZN0A 3OYLA 4IHYA 4NQWB 3ZMUA 2PG4A 4KFCA 1BOAA 3N05A 1FOWA 2DDAA 4EJUA 2LC2A 1YW9A 5IYDJ 3HPGA 3K0LA 3KEYA 4A3MJ 2JA8J 5DM7F 1ZR2A 3OYJA 1O3SA 3BT9A 2OAZA 2EFWA 2W85A 1H9TA 1YHQI 2CSOA 1WJBA 2FNPA 2VODA 2MSYA 2X4HA 3CP8A 3A0BC 1LFBA 1RZ4A 2LOOA 5LGTA 1UB9A 2STTA 1PP7U 3ZQLA 2CFOA 5E1XA 1XGMA 2GM4A 3H0DA 4HNTA 1YO5C 1UCRA 2KIFA 3JW4A 3TQNA 5KHDA 1DPRA 4QPQA 1G3WA 1X19A 2ICWG 3IP4B 1MBHA 5J6XA 2FEZA 2WY8Q 4ZDLA 2R7SA 1SD5A 3R61A 4LG0A 4XICA 3E6CC 3GFLA 2LR8A 4HAMA 4HF2A 3OL4A 4A3IJ 2JRTA 2GA2A 1F4KA 2K02A 1ZARA 1LUJB 3J7ZI 2Y0MA 1MBJA 3WTUC 4UNOA 1K4TA 3AFHA 1IJWC 3QU6A 1NG7A 3UR3C 3WTTC 1VQMI 1HW5A 1XTAA 2ZBKA 4CCNA 3ROUA 5D5XB 2ELKA 2ZXIA 3H1CA 3A0HC 4BQOA 4BXUA 3FM5A 2K40A 2DN0A 2FSWA 4A0XA 2QBYA 3FXMA 5DEQA 3C2GA 5JLWA 5AIQA 4AIJA 3GTPJ 1DGRM 4BHCA 1S72I 3HZJA 3G73A 5EDNA 1W5SA 2EA2A 1BJAA 1UFMA 3DEUA 2CQNA 2L4AA 2XAQA 4EVIA 2R7FA 2MH2A 1YW7A 5LLQA 2K9NA 2E60A 3O3KA 2FD5A 2WTEA 2W7NA 4FASD 3WU2C 3S16J 2OCEA 3W3CA 5CKTA 2HTJA 3LA2A 3HHGA 4D7MA 4N0BA 5IY5H 3K7AJ 3DLAA 4HPQA 1QRYA 4L5EA 4UUTA 4Y33A 3MEXA 2W84A 1C0WA 1BOBA 3DKWA 3LWFA 2H94A 3BQYA 4B3XA 3OIOA 5K5QA 1OMIA 5CVJA 5EJCA 2N8GA 2BEOA 3K4BA 2KISA 1RPWA 2EQRA 4L9TA 3GBGA 1A6IA 4FHTA 2GBYA 4WF2A 3COAC 4RBOA 2PJRA 2JK3A 2PJRB 4YFNF 1TT5B 2CW8A 2FE3A 5DCMA 4AWXB 5HODA 2ZMEA 2NAZA 3PNTA 1FEXA 5FKNA 3LSTA 2DJIA 2IW5A 1HW1A 4RGXA 3ECHA 2Z5UA 2BGCA 1OYIA 4XNFA 1S29A 1YG2A 2FNAA 2EPFA 1FTZA 4G7HF 1R5HA 5FB2A 5M5WJ 3MMYB 1ETYA 2QQ9A 2PBIA 3PIOF 5IT9Z 3CD6I 1YE9A 5KK1A 1GXPA 2W25A 1E3PA 4BDYA 2Y69H 3V42A 1XMKA 2G7HA 3K1PA 4M3GA 4RA2A 2W48A 4U7DA 1VQ7I 1FPQA 1W5TA 2VPRA 1JKOC 1IW7F 2FA5A 1AA7A 2I8DA 3KLOA 2KLOA 2KFDA 4FCYA 2CFXA 3RIRA 3S2HJ 1FOKA 2FRHA 2RC4A 3AG4H 1ZG1A 1HDPA 2HDCA 2TCTA 4BY1J 5J4VA 2DT7B 3ZQCA 1X3ZB 2BY1A 5F27A 1O7FA 4G9YA 3GW2A 2YUSA 3HOTA 1D3YA 2FUG2 3HUGB 2IEKA 4RAFA 1IUYA 2NVYJ 3EUAA 1AU7A 2YSRA 4B48A 4IRHA 2X51A 3BLYA 1J0RA 2Q0OA 4DYRA 4U87A 5J1UA 3CUOA 4B44A 1I6XA 3J7AY 3GTGJ 3K4MA 3LA7A 4ZTJA 3JREA 2VOOA 1V5FA 1JHFA 1KA8A 2OQRA 3IUOA 2J5PA 5B1AH 5EG0B 4NDLA 2ZJRF 4DGWB 4ZC3A 4XRMA 2MC4A 1J09A 1WFXA 4EGYA 4ZYEA 4BEHA 3EQLF 2LF7A 4BU2A 1N75A 1IN7A 2H1LA 4KITB 1R49A 1JKQC 1D8JA 1G8XA 1ZGAA 1U8RA 1ON2A 2MD5A 3BY6A 4HF1A 4AYBN 2E1OA 4DOZA 1VQNI 2BY3A 3F3XA 1IRGA 2IP2A 3SYTA 4G6QA 1N77A 1HDDC 2K9SA 3CJNA 1HBXG 1VQ6I 5EZHA 3F21A 2V1UA 3CCYA 3PUBA 2W57A 1X3UA 4DZJA 1BC8C 4NHJA 2ELJA 3RSNA 5J40A 5GAHJ 4RAZA 1LB2A 3FM3A 2WV0A 4IEJA 2Q2EA 1EA3A 1USSA 2DLLA 4R79A 2BY0A 2DXIA 3ASNH 2LKSA 1XN7A 4U0YA 1Z77A 4UUSA 1BI3A 2HKXA 1UAAA 1ETWA 4PJJA 5E1ZB 3WU0A 2Z9OA 1NK2P 3LAPA 4HQEA 4Z6YA 2CQXA 3KZYA 3AG3H 1WVRA 4R1HA 2LSOA 1W0TA 1MBKA 2ESHA 1UG2A 4UB8C 4CCLA 1KU9A 4MQ9F 5HLGA 2Q8KA 5AIPA 5KAFC 3FMSA 3ESWB 4BBSJ 1S7AA 3C18A 2K3PA 3JRGA 4OIRF 3GTJJ 4E7JA 2XUBA 2IRFG 2Y31A 3AKZA 5JI6A 3GZNB 4CUGA 3OWTA 2M34A 2DOFA 5LBQA 3K4NA 2E71A 1ZR4A 1A31A 3CDLA 4DNCA 2XPVA 1VI0A 1D1AA 1R7JA 4MQVA 1JUPA 5J1RA 4MTDA 3DWLE 4Q47A 5HLTA 2MW8A 4D5FA 2ETHA 4AYBA 1HA8A 2R5ZB 3M07A 3PNVA 2EB7A 5TGTA 4A3JJ 1YIJI 4BY7J 2XVCA 3GFMA 3V7SA 5DDGA 2CQKA 1I3QJ 1WQ2A 4QWQA 2HTSA 1U5TB 1D0YA 1H8AC 2DMPA 1SANA 4PK4A 4XKBA 4KN4X 1BN5A 3S93A 3AG1H 1H88C 2VXZA 1MNMC 1ZH5A 2QBYB 2AXLA 3S1RJ 2DBBA 2K3FA 3F6OA 5CVRA 4L18B 4NNJA 2IPQX 1U9OA 2CRGA 1FOYA 1JJ8C 2YX7A 2ZB9A 3Q9SA 1YJ9I 1I6HJ 2H09A 1O57A 1QZEA 4IHTA 3GO5A 3M9AA 3HJEA 4UVBA 4ZZDA 2EZHA 2QWWA 2X85A 1Z1DA 2K9MA 3JCUC 3NQOA 1OCPA 3S1MJ 1BI2A 1CF7B 3CUQB 2VBWA 3H9JA 1YTYA 2QYOA 3HXLA 3KEQA 3ZXSA 3ASOH 4I02A 3RPUD 3MKWB 4AVZA 1LDJA 1MJBA 1DGWY 1O3QA 2P81A 4LGWA 3HIFA 3B6AA 2JPBA 2M8EA 3R6SA 4LIUA 1GV5A 4PDKA 4LIVA 1ONVA 1SEUA 1HSJA 3CMYA 2BXZA 4PJLA 3F8MA 2ZO4A 1JT0A 1R5GA 1XGSA 1T08B 2DA5A 1V55H 2FJ1A 1VF9A 2RNJA 5L3DA 3PO3J 3IAM2 2H1KA 4OAZA 3GZ6A 1U0JA 1QNTA 2GWRA 2P5LC 4C2MJ 4F52A 3DFGA 2UV1A 1WI3A 4AIKA 1IGNA 1T98A 1WJ5A 2RQQA 2LKPA 4HF0A 2JTVA 1WPKA 3D0SA 1Z91A 2GLOA 3MFKA 2MGQA 5JFRA 4F7ZA 4HW0A 1R36A 3U1DA 1JT6A 1JKPC 1ACIA 5J1YA 2DPDA 3ZOBA 5DM6F 1V5GA 3QAHA 3H35A 4C3JJ 2ZMEC 5K7HA 3E6DA 2F5DA 3I59B 3RI4A 4HX7A 3OV8A 1X4PA 3HBLA 3IRRA 1CQTA 3CTAA 3CCUI 2L7KA 2Z2SB 5J8FA 4KIFA 2J5OA 1Y39A 1MIJA 3SZTA 3ZRGA 4J01A 3DKXA 4BKXA 3K4LA 1R00A 3TKYA 2BHZA 3ZGKA 4Q5SF 5F08A 5E20A 3BROA 2WB1N 2R7RA 4UB6C 2LY2A 3CMEI 3P9CA 2L0KA 2G0EA 1FYLA 2M1BA 1ZLJA 3HG9A 3ZMTA 2P4WA 3ZQHA 3JAMK 4G94A 2LY1A 4U0WA 3WTWC 2QUFA 1D5VA 1DPUA 5F1RA 4DJAA 1BR2A 5DS9A 4B3AA 2CWEA 2NS7A 1YI2I 1G3YA 5KAIC 4XKWA 2CV0A 3KEOA 2DMTA 1CF7A 5CVIA 2L3DA 4Y3OA 2OA4A 1BI1A 3CDHA 2DMUA 3E3VA 5ICEA 3A1YA 5IP7J 2EINH 3OYFA 1X58A 3I4NJ 1MJ9A 3I0TA 2XAHA 2FXAA 4CYCB 1HCRA 3S2WA 3UKGA 3L7WA 4BE0A 2L7ZA 1AKHB 2HOEA 4N4NB 4DQ2A 4EJTA 3RKWA 4HQMA 1WJEA 3ULQB 2Q2EB 1DQUA 4W97A 3J80K 1OKRA 5FGMA 3GVAA 4CCJA 4DW6A 2PI0A 3DEWA 4U88A 1W1WE 2ISZA 4B09A 4B47A 1H89C 5FRNA 2IA2A 3VYRB 2D45A 3CJTB 1ETXA 3HKZN 1SVMA 2FQ3A 1IC8A 1DUXC 1TT0A 2LK2A 3M8FA 2M5WA 3V8KA 3C2BA 3I56I 3A2KA 2ZFWA 3R0JA 1D0ZA 4AD9A 4A6EA 3BWGA 2VIXA 2AQEA 4ITVA 2LBFA 3C1DA 1KGSA 2BVMA 5HDGA 4F93B 1FZPB 4IX7A 5GAGJ 1SAUA 4PCQA 3PSIA 1TZLA 5EG0A 4P9UA 1HW2A 4XLPF 4RAYA 1TNSA 1JGSA 3GFJA 3SXYA 1U5TC 2IGKA 4KIBA 2I10A 4HNUA 3AL0B 3H3VK 3PQKA 3P7NA 3OYNA 2K9QA 4Z2YA 4I01A 4E7KA 1Z9CA 3OR1C 5JHFA 2WAQN 2KHMA 1J7KA 4Y7NJ 3IV5A 2KRFA 1Y0UA 3K70D 4E7ZA 4CA0A 2DYRH 2DK8A 1QPMA 1B4AA 2V9VA 2VQHA 2XSJC 2NOGA 2VC1A 3EDPA 4C2UA 3DLLF 5D6EA 2RDPA 3TBIA 3K2AA 3N4MA 4M3FA 4B43A 2W4SA 1FBQA 2BXYA 3CLQA 5HNHA 3PM1A 2V1NA 5KNLA 2VONA 4A3DJ 1R22A 3NARA 1LKXA 2Y9ZA 5D5UB 4UUVA 1Z05A 2UZKA 2QSFX 3RYRA 5F0HA 1V4RA 1T95A 1ZKGA 4G8XA 1MH3A 5FKKA 3QPTA 3U9GA 3VB2A 1DU6A 1MMDA 1KU7A 3TO6A 4LG3A 4BE2A 4KNYA 1K83J 2CUJA 1QHGA 3OYMA 2EV5A 1X1DA 4LG0B 3QOEA 4XRSG 2R3SA 1YS7A 3D5SC 4EM2A 1B9NA 2IGOA 3M4OJ 4BEHB 3MQ0A 3LSHA 4RM3A 3V7CA 2HQNA 3FKIJ 4ZJZA 5CLSA 1MDMA 1YW8A 2EV0A 2ZJ2A 1RIOH 3OIQA 4ZYHA 1BIBA 2QSGX 1I1SA 2DFEA 2KRHA 1ZG5A 3QOPA 2XC7A 2OCCH 1KQ9A 2ID6A 5KCMA 3EUHA 1FT9A 2JA2A 2NS8A 3V8JA 3C2HA 1A04A 1XSXA 4IOCF 5ICFA 3RPQA 3FMQA 4MNUA 4NQWA 2OQGA 1I50J 3OR2C 2VLAA 2GZWA 2XRLA 3HEFA 1TLHB 3VEPA 1TWCJ 1BR1A 5J3LA 3BZCA 3HRSA 3KETA 4YG2F 2F5EA 3DXJF 2M0CA 4CH7A 1SMYF 3AG2H 2UWMA 2F5CA 4BUPA 3FK7A 3KYLA 1TP4A 4M3DA 3TDUC 1FWZA 2HQRA 2XGDA 1EH6A 2GIVA 4UV9A 1LDDA 1OLTA 3ERMA 4XLEA 4E4HA 2OD5A 4P96A 5DD8A 1R1UA 2DFFA 2HNHA 2OZUA 4M74A 5E17F 2P6TA 3DBHB 2HFHA 3FF5A 3I53A 2V1XA 5CPRB 3K9TA 3ABMH 4QTRA 4KT5C 2VQGA 2VQLA 4ZYDA 2VJIA 3WTVC 5IOYA 1YITI 3KIOA 4HG2A 3S17J 2XIGA 3KP3A 2KDZA 3K2ZA 3BR3A 4OWRB 1VQ4I 5IYCJ 2WBMA 1SD4A 5E3NA 1OCZH 2R5ZA 1ZYRF 2O8KA 2EZKA 4EJOA 3O6BB 5FO5A 1WZ2A 4G6DA 2DOEA 3PFYA 3JSOA 2JWTA 2RAEA 4HOBA 5FFZA 1NTCA 1OISA 4YELA 1GT0C 1U9NA 1DDNA 1B1BA 5LRSA 2HZDA 4KISA 5HOOA 1VQPI 1KZHA 4A3BJ 1FY7A 2L2OA 1CGPA 1S8NA 4HA8A 3MZ8A 4JQFA 1Y8RB 2VKEA 2P0WA 2P8TA 3ZP5A 2OPTA 4IRGA 1XDUA 3M1EA 3HRUA 2L9VA 4M9ZA 4UY8I 5C4XJ 1K79A 2DA1A 3H5AA 3K4JA 2B7EA 3VWBA 1I1GA 2XRNA 1XMAA 2CG4A 3BJ6A 4CSWA 1K61A 1XD7A 3SZPA 5E3LA 3ZR8X 2PX9A 1EKEA 3LMMA 3R60A 2E5ZA 1ZHFA 4L0YB 3BG9A 1D5YA 3OYBA 3FKJA 4QSHA 3CMAI 2OTLI 5J47A 1S9HA 3CMMA 2WB1A 5FKLA 4LD5A 2EFNA 4G6TB 2YX4A 1X2NA 2LY9A 4HSTA 2FMLA 3OYAA 1NG6A 2QKLB 2IAIA 5FLMJ 2M7AA 1V5EA 4F91B 3I71A 2G7UA 1T0FC 3QYBA 4BGDA 2VQCA 1OR7C 2VBXA 2FU4A 4BAYA 2KDOA 4C9YA 1UG0A 2E1NA 3NWSA 2FX0A 2LH9A 2NRAC 3KZIC 3LA3A 1FBUA 5DTDA 1QGPA 5ILSA 4UUSB 2JUCA 3KFWX 2IS4A 1VQ8I 3J80Z 2XF5A 3CCRI 5ICGA 4A6DA 2Y9YA 3FXOA 4N9HA 2HVQA 3GWZA 3M8EA 3WODF 4D5CA 3S15J 4XKCA 2XSDC 4S05A 2E19A 1WH5A 3HRMA 2GAUA 3L00A 2R7QA 2E1MB 2F48A 2V7FA 4II2A 4HV6A 1ETQA 5GTHC 2XAGA 1D8KA 1KU3A 2COMA 1LVKA 1RKTA 2VE9A 1TNTA 3CCEI 3RDIA 3LQQA 1XGOA 2KKOA 1O7LA 2D1VA 2JSPA 5GP9A 2RKHA 2FBKA 4M73A 3BP8A 2CS3A 4KDPA 3JAMZ 5DD4A 5E1WA 2K85A 4JOMA 4KN7X 1FP1D 3BOQA 1RR7A 2VKHA 1BR4A 1O4XA 1ZAOA 2CMPA 1HSTA 4DYCA 4LLNA 1DP3A 5EZGA 2A69F 2KIQA 3S1QJ 1I3AA 1U78A 3RYPA 4UVCA 2MH9A 4RS8A 3K1MA 3WTZA 3QPSA 2R93J 3T0YA 5L3CA 3DTEA 2HQAA 3B73A 4KUMA 1SC7A 3G1OA 4IL6C 1OCCH 1P2FA 4D7NA 1EH8A 1K4SA 3E5XA 1W7PB 4YIFA 2M7BA 1I39A 1OCTC 3ISPA 2ME6A 5FD5A 1OR7A 1Y6IA 2NS0A 3OYKA 4C3IJ 2Y75A 2VB6A 5LFAA 4OOIA 2WAEA 2Y30A 3CCMI 2JA7J 2OJED 1QHHD 1XS9A 3BJOA 1R5ID 4GYIA 3I3LA 1ZRFA 4E7HA 1Y0NA 2OBPA 3FWEA 1FP2A 1SVLA 3LFKA 1TWAJ 4KJZA 2K4JA 4MIMA 2OV7A 2ZMEB 1IRFA 2P7VB 1F9NA 5DYMA 2CYYA 2X6OA 1T6SA 2VKVA 1T39A 4PGGA 4X1EA 2HQ5A 5J4YA 5ILVA 3W2VA 2HPMA 2D2WA 3BPXA 2V4JC 3Q3SA 4GCVA 5M5XJ 4DBQA 5EEGA 5IOZA 3LOCA 3BR5A 1AWCA 4L9JA 3MD2A 3BQZA 5CJ9A 5GTIC 1JXSA 3FXQA 4AC0A 2FQ4A 3DP7A 1KQ0A 3GUDA 5AONA 5HS9A 4ON0A 4ENJA 5TRDA 2R0QC 1RI7A 1LE8B 1NK3P 1XCVA 4BH9A 2M4KA 3N97A 4PJNA 5TJJA 2X1CA 3WGIA 3CESA 1GLNA 3O2PE 1OYYA 4M72A 2B9SA 1GV2A 3ECOA 4JBAA 3EUKL 4XSZF 5HS7A 1FOXA 1P4XA 2V79A 2CV1A 3D1NI 2LD5A 2TRTA 4LK0F 3J81Z 2W82A 3C3WA 4IVNA 1ON1A 2K86A 3PFIA 3BTJA 2ZNZA 5K5RA 5FRMA 2VXDA 5BQTA 5FLXK 2LG4A 1B72B 4O6JA 4JYKA 4ZDPA 1QVUA 3IC7A 1AKHA 1OYWA 3S14J 1R6RA 3W2AA 2NYXA 1PUFA 2IS2A 1YYVA 4RB3C 4XKVA 3OS0A 4XK4A 1J75A 4XQFA 1RKWA 5F6FA 1IXSB 1G6NA 3VPRA 1W36D 4ANJA 1JGGA 1Z0XA 1R9TJ 4B8XA 1HKQA 3K1NA 1YX3A 2XGCA 2HKOA 5CVUA 4EGZA 2DA3A 2HPIA 1LQ1A 3ABKH 1FJLA 2I5UA 3DV8A 4IO9F 3Q5FA 1TWFJ 2L4MA 1DU0A 3LSMA 4UV8A 3OOUA 4Y17A 1E3OC 3A01B 2VI6A 1WJCA 4S0HB 2RNGA 5E3OA 3LQRA 2QQBA 1Q1VA 5EF6A 4XIDA 1F5TA 3LSJA 2KT0A 1YOVB 1HXDA 2EA4A 3CJRB 1SMTA 3EUHC 3T8RA 3K6GA 4BS9A 1VTNC 3IH2A 2OF7A 3IL2A 1YLFA 4ESJA 5E8GA 4IHWA 4X6AJ 2NNYA 2M30A 2BE5F 4UXNA 2KMUA 4XOPA 2ZCWA 2XB5A 1T56A 2RV8A 1QU3A 3LNQA 1R4MB 1H0MA 4XMYA 1U3EM 2KIMA 3QWLA 5K5OA 1S5LC 2MG4A 5F64A 1MKMA 3DF8A 1LDKB 1MBFA 3ZPLA 3F8NA 2Q1ZB 2IBDA 4DIQA 4E70A 4RB1A 2B0LA 4QPOA 4PSWA 1E17A 3QODA 2PN6A 1A6QA 3CP2A 3VSKA 1BBYA 2PQ8A 3WHBA 1XGNA 2DA2A 2PMZA 3I4MJ 1T8IA 2UUZA 2H8WA 5KVRA 3GTOJ 3BTCA 3F22A 5BPIA 3HOYJ 5L3EA 3BTIA 1WWXA 3I5UA 2VT3A 1T38A 2ZSHB 4PZJA 4FE7A 2WY7Q 3HM5A 4IQ4A 4E7IA 4OINF 4IRIA 4XR6A 1X2MA 3F23A 1WI9A 1OPCA 2PMUA 5E8IA 4YRVA 2DDBA 3HSFA 1J59A 2YR2A 4ABZA 4ESBA 1G59A 2XGEA 4EATA 3JRFA 3BCBA 2TDXA 3SDBA 1MDMB 1XG1A 3JRHA 4EV0A 4YFXF 5IT9K 2DA4A 5A2QK 1S7OA 1R23A 4MO7A 2BVLA 2RVCA 1ZTRA 2QCOA 3U21A 2RN7A 3IHUA 4I2OA 1WJFA 2L9NA 4MFDA 3TP3A 3ZQGA 4E6KG 3GEZA 1P7JA 2M3AA 2P6SA 3ABUA 4I0AA 4ZYGA 1U5TA 4RGSA 2DPUA 1FTTA 2M2EA 3BPVA 3RJPA 2R7UA 2VJ5A 4CXFA 4LK1F 2CUFA 1I5ZA 5F0FA 2NVTJ 2E7XA 5JHUA 4H4KC 3OSGA 2E5NA 1FNNA 4IF4A 4ETSA 3GX4X 1B8IB 2ZNYA 2WAFA 1W0UA 4AM3A 3HUGA 4GO1A 1DP7P 4M6YA 2LP0A 3FK6A 3TGNA 2DFIA 5TISC 1X1PA 1OCOH 2RQPA 4IKFA 2R7DA 4CYDA 3CLOA 1T33A 2AXTC 4UVAA 4IXAA 2VJ4A 2XB0X 3BR1A 1SD7A 1IDYA 5BNGA 4I99C 3CQZJ 5CQEA 4IQJA 4EM0B 3CC7I 2F4IA 4KIGA 3GTQJ 4F92B 3HDDA 3MKLA 3M7GA 1YQAA 1F43A 2JMWA 3E6BA 4CYCA 1FC3A 3VYSB 3SZGA 3CCSI 4XLNF 1STZA 1TTYA 2VJJA 3BDDA 1HLVA 2XPWA 2L9RA 1OQYA 2EIKH 1N25A 2IA1A 3V8LA 5DUIA 5DCFA 3IRQA 1B6AA 2GXBA 3B02A 4D9JA 3DBLB 2BW3A 5D5WB 4BXXJ 4MHGA 4J19A 3ABTA 1GUUA 1XSVA 4PJMA 4Y52J 2K5CA 3OYGA 2LBFB 3L2UA 1YS6A 4O3MA 2OU2A 4KICA 3MVPA 1FSEA 2KPMA 4XM3A 3BZKA 3WHCA 1G4DA 4MEXF 4Q48A 1QVTA 5M3MJ 3DPUA 4PUSA 3FHNA 3S2DJ 3J7YJ 4HX8A 2Z99A 4IHXA 1POGA 3S8PA 3TW7A 4BQQA 4CCMA 5EGOA 1GVJA 1MBEA 4OIPF 2DJNA 9ANTA 4ZYAA 5LHIA 1RETA 1HQCA 4RGUA 2MBFA 5BOXA 2EFQA 2GOXB 4RMNA 3A03A 3G3ZA 4I76A 4XOTA 1R1VA 1AHDP 1ETKA 4XN3A 2R5YA 1A35A 5FD6A 1Z3XA 1HOMA 3I59A 1X4OA 3PSFA 3WG9A 4ESFA 5L3BA 1B72A 1BA5A 1Z67A 4O5VA 3HOSA 2HEOA 3SHFA 2EZLA 3SFZA 1EF4A 2QZ8A 3O8HA 4A3GJ 3I58A 1R4NB 1K6YA 4IHVA 2NXNB 1AOYA 2IGMA 3L9FA 1I27A 4R8HA 2DT6A 1B8IA 5IT3A 1LEBA 2LDUA 3ELKA 1Z7LA 2IS1A 3BG5A 1FLIA 3QRFF 1YRNB 3R0AA 3BG3A 2HVRA 4FX4A 2L7MP 2O8XA 4HEA2 5CQGA 3TL4X 1USTA 2IJLA 3DCFA 5D8LB 2ZJPF 3EYYA 3JR9A 4FTHA 2QGUA 1MNDA 3DU5A 3LSIA 4XRFA 3WE3A 2DFHA 4A3FJ 4XL9A 1BC7C 3FMRA 5D4SA 3CF2A 3P9IA 2CQQA 2KJCA 3DPTA 2JA5J 1JJ6C 1VFCA 2EIMH 3E7LA 3KP4A 3DQVC 4DYQA 3HOXJ 2Y0SN 1BIAA 2Z33A 3OSFA 1UHWA 3ML6A 3J7AO 2KL4A 3QP5A 1HKTA 1MNEA 1XCBA 5EGOB 2K4BA 4M6XA 1PDNC 3H36A 2DW4A 3GF2A 4IHSA 3D5RC 2NVXJ 3A01A 4HZFA 2ZFUA 1OCRH 2EILH 3DEEA 1FIPA 4ZZLA 1K78B 2GIZA 5HLHA 3EYIA 2MD0A 3PNYA 4LITA 4FQGA 5HVQC 2BV6A 5LEKA 3HL2A 3OS2A 1LVAA 1SFKA 3DTKA 2L54A 4HLYA 2HR3A 1HC8A 2JT1A 2Y48A 3L2WA 2V9KA 3OYCA 2E36A 1IDZA 4BHBA 4RDUA 1YIOA 2R5YB 1FYMA 3JRIA 2CV2A 2ECCA 5E18F 5L3FA 2L7FP 1WKMA 1V3FA 2R7OA 1MGTA 4ENNA 3P5JA 3KE2A 4LMYA 3HC7A 4GDFA 2NNNA 2L02A 3P9KA 2PMHA 4S04A 3BR0A 2A6TA 2M45A 1FBSA 3FDYA 4FE4A 1VQ5I 3K10A 3F72A 4AIDA 1IV6A 1S6LA 3OS1A 4DZPA 2Y0SA 1KU2A 2X6XA 3MKZA 1IRZA 2HZTA 2V6CA 2X6YA 4AVPA 3M8JA 2EZIA 2JN6A 5JLXA 2A07F 2E2IJ 2HGCA 2NVUB 3ZMSA 2PLYA 2DYSH 3BR6A 5ICCA 1UZCA 2L5QA 3W2WA 3GLXA 5ERIA 1FMVA 4CDGA 4BJ6C 3H3ZA 1VZ0A 2JA6J 3A4CA 1RC9A 3JRDA 5GADJ 4LFUA 3E5UA 6PAXA 5FROA 4DBRA 3CUQC 3HSRA 3TEDA 2KQRA 1ZRDA 2YU9J 3KP5A 3QYEA 4XSXF 2XPUA 3H3UA 3JRAA 2X9DA 1MMGA 1B9MA 1IG7A 1SFUA 1G2HA 5HS8A 5FLXZ 1GDTA 1W36C 2R7TA 2ME0A 3L2RA 1WSUA 4F55A 4OMZA 1MMAA 5FKOA 3CZ6A 2R7XA 3E97A 3CDIA 4M3EA 3G6EI 2GOMA 1P4WA 4YEJA 3KX2A 3GZ5A 4II3A 2H6BA 4K2EA 2Z3YA 5B1BH 3KCCA 1L0OC 4YIIA 1TW3A 2O61A 3KZZA 4KMUX 3R4KA 4Y13A 3H92A 4L5IA 2V26A 3W6VA 1SD6A 2EBIA 2ACJA 2XHKA 3NRVA 3CO6C 1H9GA 4Q4ZF 1KYWA 1QO0D 3K4CA 3T1BA 2XDVA 1RESA 3FXLA 3CCVI 3HGYA 3VOEA 3VSLA 1VQOI 5L3GA 2QQ8A 3K4KA 1YRNA 2GA1A 1FSHA 4P9FA 2WADA 3IWFA 4M6VA 1IN4A 5IPAA 1ZK8A 2KP6A 1YJNI 2B63J 4BJTA 2KZVA 4L9VA 2DAOA 5FJ8J 3F8FA 4F3QA 3HSEA 4NB5A 2MLKA 2ZKZA 2UXXA 3E5QA 3CC2I 1IV8A 1Q1HA 3GTKJ 3BZ6A 3GLLA 5K7ZA 2CUZA 2MABA 2EWNA 1ETVA 3U2RA 2K27A 5B5EC 4BQNA 5GPAA 3ZQIA 1IF1A 4EEFG 3LL7A 4A12A 2STWA 4E7SA 2HU9A 1Z21A 2K9LA 5BS6A 2GQQA 1IO2A 1HKSA 4P1WA 1LJ9A 2XF7A 1WJAA 3OYHA 4CZZA 4A93J 4HSRA 1VQKI 1E2XA 3CUQA 1BM9A 4PFPA 3H9QA 1QPIA 2VOPA 3VYUB 3ERED 3ONQA 4G7OF 3UNGC 1B59A 3HTSB 1NHAA 3GYHX 2M4GA 2BW3B 2LRDA 3OY9A 5BPDA 5D6FA 2QVOA 4L5JA 1W4MA 1QZYA 2DQRA 2MYSA 4JK1X 3CCQI 3QU3A 3FBNB 3S1NJ 1O3RA 3DKYA 4BACA 1W7PD 5EEHA 4GGGA 3VDXA 4NC6A 2VBYA 3IKTA 1FX7A 2F2EA 2WC2A 3BJAA 2X48A 4GRIA 1IZ1A 2BYVE 3GFIA 1MSFC 3FZVA 1JUMA 3JRCA 2D5VA 2XKPA 1TQMA 2W1OA 1REPC 3KP6A 2EFOA 4GYGA 3I9V2 2XAJA 2Y2ZA 2BOLA 1U2WA 2V1DA 1MW7A 4JP0A 3X2QH 2DTZA 2JRMA 2R7ZJ 4WCGA 2W00A 3ZMVA 1TWHJ 3SQNA 2JVGA 3E6MA 4M9SA 4V2GA 1WHUA 3RTRA 1EV7A 4GFBA 3HPHA 5IP6A 5D4RA 5E79C 2CW7A 4OIOF 5JVTA 2PMZN 2F5FA 1TWGJ 1K7AA 1OJLA 3LSGA 4D0PA 1WH7A 2HXIA 1P9QC 4EQQA 1ODDA 2R7VA 2EFPA 3HRTA 4FISA 5GPCA 4JX5A 1R1TA 3ABLH 3KLNA 1LE8A 2ZXHA 5C4JJ 2ZC2A 4NBQA 4NUBA 2PFBA 3T8TA 4IZZA 1LFUP 3CC4I 2FMYA 3F8CA 2F5VA 3F0CA 2QLZA 3FHZA 1ZELA 2DU9A 2L01A 3MKYB 5DCMB 2JPCA 2P5VA 5K1YA 4BNCA 2IXSA 1ZLKA 4RM2A 2LYCA 3RQ4A 1P6RA 4EMSA 4FT8A 4BXFA 1JI8A 4RB2C 1SFEA 3MCZA 1QZZA 1XC5A 3F6VA 3VODA 3ZMZA 1MH4A 4KT6A 4PJ0C 2IS6A 4C3HJ 4M3BA 2V6EA 3BG6A 2O03A 2QKMB 3HOUJ 2DA6A 2E2JJ 2A6HF 4J00A 2IGNA 4LLLA 3M3YJ 2O6GE 5FKMA 3JTGA 4HRIA 4H0EA 2M9HA 4BE1A 1EH7A 1HF0A 4U0VA 5C44J 2A68F 5CVVA 4CGZA 4RLFA 2H27A 3VFZA 3E1SA 4CCOA 1G3SA 1Y56A 2C6YA 2QM3A 3REOA 3WTSC 4LB5A 2W24A 2BY2A 4XN0A 5LHGA 2G9WA 4PFOA 2A61A 4CO8A 2IA0A 1UMQA 2JZYA 2Z16A 3L2CA 3WTYC 3OIPA 3E0JB 1XDSA 4A5NA 1ZN2A 2CQ7A 3A02A 1MBGA 1Z7UA 3WU1B 2LTPA 4KA4A 2UXNA 3BR2A 1OFCX 3Q9VA 5HNFA 1F36A 4A69C 1J2XA 2VKDA 2NVQJ 2A6EF 4A5MA 1SFOJ 2MLGA 4BJ5C 1FMWA 3I55I 1XX5A 4PGHA 4RAGA 2R92J 1TBXA 4RB0A 1E0EA 4HYEA 4HBLA 5GAEJ 1QQIA 4CICA 5A2QZ 3MWMA 2F6CA 2HOSA 3G2BA 3GCMA 1S7EA 2FF4A 1TW2A 2KZGA 4I0BA 1YJWI 2HWVA 4N4OB 2X1EA 2JUGA 3RKQA 2ELHA 5B3SH 2IT0A 4HNVA 3S3MA 1X1CA 3ZQ7A 4YFKF 4A3CJ 5ED4A 4X0GA 1X3WB 3PQJA 1U8BA 5LD2C 4G7ZF 5M5YJ 2ZXJA 3C7JA 3IKVA 1IN6A 4EM1A 3FXJA 2PEXA 4ZTFA 2A3SA 4BL0B 1F1ZA 1MMNA 2FOWA 4ASNA 1WCMJ 3LSRA 2GXGA 5FLVA 2P5KA 4ZDOA 3IAS2 2HOTA 4XONA 3KYCB 2WV1A 4P55A 2EJRA 3Q0WA 1IN8A 4I7HA 3GTMJ 1WRJA 3NEUA 1BJZA 5JR3A 1LFPA 3O8GA 4XLCA 3JTHA 3OOPA 1ZRCA 2KIUA 1KYZA 3OYDA 1PVEA 2VT2A 3G1LA 4A0YA 3T5XA 3AAFA 2DO7A 1PUEE 1Y1VJ 2CW0F 5EEAA 4D1QA 4GXOA 3FXRA 3WGHA 3FIWA 2BBYA 4WXHA 1N78A 5B66C 1IUFA 4B4CA 4G12A 2X0LA 2ID3A 1ERDA 2DQLA 2LLKA 2WAQA 4RLQA 3U1KA 4OMYA 3I54A 2LREA 4HDVA 2HYGD 4OIQF 3NAUA 3CJQB 3JRBA 5LGNA 3G71I 3I64A 4RGRA 4BYYA 2ESNA 2VPLA 2R7WA 1LPQA 3ZMDA 3FISA 4FETA 2M87A 5E3MA 2DA7A 1MJAA 3EPZA 1L3LA 2YS9A 3L2VA 2YPRA 2LF8A 3GMEA 4WXCA 4XLFA 4XBFA 4A2UA 1G3TA 3OMYA 4PSXA 1XMXA 1QBJA 2LMDA 1RNLA 2XKOA 5H6RA 3HOVJ 3KYDB 2XAUA 2DTRA 1ORKA 2O5RA 1K6OA 2D1HA 2JVHA 2LFBA 3KP7A 2OTJI 5LGUA 3PJRA 1J5YA 2CU7A 4B1RA 4A3KJ 2ADUA 2P7CB 5IP9J 2PJPA 4JX4A 2HYFA 2QA4I 5CYVA 3CCLI 3QQAA 4BHPA 1LEAA 1UELB 2K7LA 4KYWA 1Z6TA 3TP0A 4CCKA 1VQ9I 1TL8A 3WTXC 3J81K 4WXDA 3PL8A 4C30A 1MSEC 4HDUA 4XLAA 3TOAA 1D0XA 1KQ8A 2DMQA 5D5VB 3VYTB 3LAJA 2H6CA 1TC3C 1U6GA 3DTIA 1GXQA 2WA0A 1MMSA 3TOBA 4MEYF 1WGXA 2ISYA 4YIRX 2RREA 1S3JA 1P92A 3SEZA 1MD0A 2AS5F 1ZREA 2OZ6A 4P5OA 2QF7A 3V7RA 1TQPA 3MAJA 5DV5A 1Z3YA 2EK5A 1XB4A 3HHHA 1UHSA 3SFIA 2CGPA 5HDKA 2RGVA 3S3NA 2E35A 1RUNA 4I6ZA 2O0YA 3Q0UA 3L09A 4IJAA 4NC7A 3BCAA 4A3LJ 1ZG3A 5HLIA 3JSPA 4CHUA 4ZH4F 4C2TA 4E7LA 2KRCA 3CF5F 3PIPF 2ECBA 3HYIA 2EV6A 1RRJA 2H8RA 2MC3A 2ZSIB 3KP2A 5BMZA 2Z1DA 2DMNA 2HI3A 3TO7A 3DU6A 3WG7H 1J9IA 2DI3A 1A36A 5LHHA 2XROA 1M1EB 2BHYA 1T0FA 1APLC 1X1AA 4OAYA 1Z6RA 3QPHA 4XLHA 4AUXA 1ENHA 1E3HA 2E34A 5JVGF 5H20A 3SDGA 1ZGWA 1O3TA 1K78A 2O3FA 3MZHA 3W6JB 2DK5A 4LLGF 1YX5A 2JJ7A 4MGRA 4V2FA 2LKXA 4M9XA 3CO7C 2QQAA 3K69A 4Y15A 3HGGA 2CH0A 3OL3A 1FYKA 3HKZA 1ITYA 1D1CA 1SFXA 3F8BA 1R71A 3FXKA 1SVOA 5D8KB 5H2FC 1Y1WJ 3RKYA 2LNBA 4L0ZB 2COBA 2IVMA 5H6QA 4KMFA 2MFZA 3OYEA 2KJBA 2R4GA 3H9GA 1PJRA 3CCJI 4XRSA 3IH3A 2XASA 1A5JA 3NWTA 3FXUA 2FBHA 2A5WA 1JTXA 2F4MB 2HS5A 5J8CA 4HV5A 1JHHA 4IOAF 4XORA 3FBIB 3GXOA 4HX4A 1IRXA 2F4OB 4IPAA 3PUFA 1PUFB 4V19K 2OUMA 2VL8A 3SJMA 4JX6A 1UHMA 3RKXA 4WK8F
chains in the Genus database with same CATH topology
3TO9A 4UHTA 4MTEA 4EJWA 2VBZA 2XV4S 1R58A 3QP6A 1IN5A 1IAWA 4OU0A 2DT5A 4I98B 4AIHA 1ZGJA 4FX0A 3WGGA 1P4AA 1ULYA 5HDNA 1GHCA 2MA3A 2VN2A 2FOKA 2FBIA 3DPLC 1RUOA 3RPUA 2VE8A 1IXCA 5FFXA 4ENMA 5ILUA 1W7PA 2JSCA 1BI0A 4EJVA 2QENA 4I09A 1MZBA 2VC0A 2WWYA 4BQAA 2CO5A 4TV7A 1TQIA 2A5YB 3EETA 3I4PA 3W6KB 4ENKA 1XSDA 4WWCA 1LNWA 4M71A 4U7BA 3WE2A 5LEJA 3IWZA 5DUKA 4LB6B 4HLXA 4LJZF 3ZN1A 4WX9A 2E1CA 4N9IA 1JE8A 1PP8F 3D5LA 1SAXA 3TDZC 4QLCU 2YU3A 2XGXA 4L9NA 1YFHA 3HTUA 2E7WA 3V4GA 3FX3A 1IXRC 3MZYA 2XAFA 1T2KA 5LRRA 4A0ZA 3ZN0A 3ZMUA 2PG4A 4KFCA 1BOAA 4EJUA 1YW9A 3K0LA 1O3SA 2EFWA 2OAZA 1H9TA 2W85A 2CSOA 2FNPA 2VODA 2X4HA 1RZ4A 5LGTA 1UB9A 2STTA 1PP7U 5E1XA 1XGMA 1YO5C 1UCRA 3TQNA 2KIFA 3JW4A 1DPRA 1G3WA 5J6XA 2FEZA 1SD5A 3R61A 4LG0A 3E6CC 3GFLA 4HAMA 4HF2A 2JRTA 2GA2A 1F4KA 2K02A 1ZARA 2Y0MA 3WTUC 4UNOA 3QU6A 3WTTC 1HW5A 2ZBKA 3ROUA 5D5XB 4BXUA 3FM5A 2FSWA 4A0XA 2QBYA 5DEQA 5AIQA 4AIJA 4BHCA 3G73A 1W5SA 2EA2A 1BJAA 1UFMA 3DEUA 2L4AA 2XAQA 4EVIA 2R7FA 2MH2A 1YW7A 5LLQA 3O3KA 2WTEA 2HTJA 3LA2A 3HHGA 4N0BA 3MEXA 2W84A 1C0WA 3LWFA 3DKWA 2H94A 5K5QA 1OMIA 5CVJA 2BEOA 4L9TA 4FHTA 4WF2A 3COAC 4YFNF 2FE3A 4AWXB 5DCMA 2ZMEA 2NAZA 3LSTA 2IW5A 1HW1A 4RGXA 3ECHA 2Z5UA 2BGCA 1OYIA 1S29A 1YG2A 2FNAA 4G7HF 1R5HA 5FB2A 2QQ9A 2PBIA 5IT9Z 5KK1A 1GXPA 2W25A 1XMKA 2G7HA 3K1PA 4U7DA 1FPQA 1W5TA 1IW7F 2FA5A 3KLOA 2CFXA 3RIRA 1FOKA 2FRHA 2RC4A 1ZG1A 2HDCA 1O7FA 4G9YA 3GW2A 3HOTA 1D3YA 1IUYA 2YSRA 4IRHA 1J0RA 2Q0OA 3CUOA 1I6XA 3LA7A 2VOOA 1JHFA 1KA8A 2OQRA 2J5PA 4EGYA 4ZYEA 3EQLF 2LF7A 1IN7A 1D8JA 1ZGAA 1U8RA 1ON2A 2MD5A 3BY6A 4HF1A 1IRGA 3F3XA 2IP2A 4G6QA 3CJNA 1HBXG 3F21A 2V1UA 2W57A 1X3UA 1BC8C 4NHJA 4RAZA 1LB2A 3FM3A 2WV0A 2Q2EA 1USSA 2DLLA 4R79A 1XN7A 4U0YA 1BI3A 2HKXA 5E1ZB 3WU0A 2Z9OA 3LAPA 4HQEA 3KZYA 4R1HA 2LSOA 2ESHA 1KU9A 5HLGA 4MQ9F 2Q8KA 5AIPA 3FMSA 1S7AA 3C18A 4OIRF 2XUBA 2IRFG 5JI6A 5LBQA 4DNCA 1R7JA 4MQVA 4MTDA 4Q47A 2ETHA 2EB7A 2XVCA 3GFMA 3V7SA 5DDGA 2CQKA 4QWQA 1WQ2A 2HTSA 1U5TB 4KN4X 1BN5A 1ZH5A 2VXZA 2QBYB 2AXLA 2DBBA 3F6OA 5CVRA 4L18B 2IPQX 2YX7A 3Q9SA 2H09A 1O57A 4IHTA 3GO5A 3M9AA 4UVBA 4ZZDA 2QWWA 1Z1DA 3NQOA 1BI2A 1CF7B 3CUQB 2VBWA 1YTYA 2QYOA 3KEQA 4I02A 1LDJA 1MJBA 1O3QA 4LGWA 3HIFA 2JPBA 3R6SA 2M8EA 4PDKA 1ONVA 1HSJA 3F8MA 2ZO4A 1R5GA 1XGSA 2RNJA 5L3DA 3GZ6A 1QNTA 2GWRA 2P5LC 3DFGA 4AIKA 1T98A 2LKPA 4HF0A 2JTVA 3D0SA 1Z91A 3MFKA 5JFRA 4F7ZA 4HW0A 1R36A 3U1DA 2DPDA 3QAHA 3E6DA 2F5DA 3I59B 3RI4A 4HX7A 3OV8A 3IRRA 3CTAA 5J8FA 4KIFA 2J5OA 3SZTA 1R00A 3TKYA 4Q5SF 5E20A 3BROA 3P9CA 1FYLA 2M1BA 1ZLJA 3ZMTA 2P4WA 3JAMK 4G94A 4U0WA 3WTWC 2QUFA 1D5VA 1DPUA 5F1RA 2CWEA 1G3YA 3KEOA 1CF7A 5CVIA 2L3DA 2OA4A 1BI1A 3CDHA 5ICEA 3E3VA 1MJ9A 3I0TA 2XAHA 2FXAA 3S2WA 3L7WA 2HOEA 4DQ2A 4EJTA 3RKWA 4HQMA 3ULQB 3J80K 1OKRA 5FGMA 3GVAA 2PI0A 4U88A 2ISZA 4B09A 2IA2A 2D45A 2FQ3A 1DUXC 3M8FA 2M5WA 3V8KA 2ZFWA 3R0JA 4AD9A 4A6EA 3BWGA 3C1DA 1KGSA 5HDGA 1FZPB 4PCQA 4P9UA 1HW2A 4XLPF 4RAYA 1TNSA 1JGSA 3GFJA 3SXYA 1U5TC 4KIBA 3PQKA 3P7NA 4Z2YA 4I01A 1Z9CA 1J7KA 2KRFA 1Y0UA 2DK8A 1QPMA 1B4AA 2V9VA 2VC1A 3EDPA 5D6EA 2RDPA 3N4MA 1FBQA 2VONA 1R22A 5D5UB 4UUVA 1Z05A 2UZKA 3RYRA 1V4RA 4G8XA 3QPTA 3U9GA 3VB2A 1KU7A 3TO6A 4KNYA 2EV5A 4LG0B 2R3SA 1YS7A 4EM2A 1B9NA 3MQ0A 3V7CA 2HQNA 5CLSA 1MDMA 1YW8A 2EV0A 2ZJ2A 1RIOH 4ZYHA 1BIBA 1I1SA 1ZG5A 3QOPA 1KQ9A 3EUHA 1FT9A 3V8JA 1A04A 1XSXA 5ICFA 3RPQA 3FMQA 4MNUA 4NQWA 2OQGA 2GZWA 1TLHB 3VEPA 3HRSA 3KETA 4YG2F 2F5EA 3DXJF 1SMYF 2UWMA 2F5CA 3TDUC 1FWZA 2HQRA 1EH6A 2GIVA 4UV9A 1LDDA 2OD5A 4P96A 5DD8A 1R1UA 2OZUA 4M74A 5E17F 2P6TA 2HFHA 3FF5A 3I53A 2V1XA 3K9TA 4KT5C 4ZYDA 3WTVC 2XIGA 3KP3A 3K2ZA 1SD4A 1ZYRF 4EJOA 3O6BB 5FO5A 4G6DA 3JSOA 4HOBA 5FFZA 1DDNA 1B1BA 5LRSA 5HOOA 1FY7A 1CGPA 1S8NA 4HA8A 4JQFA 2P8TA 3ZP5A 4IRGA 1XDUA 3M1EA 3HRUA 4M9ZA 1K79A 1I1GA 2XRNA 1XMAA 2CG4A 3BJ6A 1XD7A 3SZPA 3R60A 1ZHFA 4L0YB 4LD5A 2EFNA 2YX4A 2FMLA 3I71A 2G7UA 2VBXA 2FU4A 4BAYA 2E1NA 2NRAC 3LA3A 1FBUA 1QGPA 5ILSA 3KFWX 3J80Z 5ICGA 4A6DA 4N9HA 3GWZA 3M8EA 3WODF 4S05A 3HRMA 2GAUA 3L00A 4HV6A 2XAGA 1D8KA 1KU3A 2COMA 2VE9A 1TNTA 3RDIA 3LQQA 1XGOA 2KKOA 1O7LA 2D1VA 2RKHA 2FBKA 4M73A 3BP8A 4KDPA 3JAMZ 5DD4A 5E1WA 4KN7X 1FP1D 3BOQA 1ZAOA 4LLNA 1HSTA 2A69F 1U78A 3RYPA 4UVCA 2MH9A 4RS8A 3K1MA 3WTZA 3T0YA 5L3CA 3B73A 4KUMA 1P2FA 1EH8A 3E5XA 1W7PB 4YIFA 3ISPA 5FD5A 1OR7A 2NS0A 2Y75A 4OOIA 3BJOA 4GYIA 1ZRFA 2OBPA 3FWEA 1FP2A 3LFKA 2K4JA 2ZMEB 1IRFA 2P7VB 1F9NA 5DYMA 2CYYA 1T6SA 1T39A 4PGGA 5ILVA 2D2WA 3BPXA 4GCVA 5EEGA 1AWCA 4L9JA 5CJ9A 1JXSA 3FXQA 3DP7A 3GUDA 1KQ0A 5AONA 5TRDA 5HS9A 4ON0A 4ENJA 1RI7A 1XCVA 4BH9A 3N97A 5TJJA 3WGIA 3O2PE 1OYYA 4M72A 3ECOA 4JBAA 4XSZF 5HS7A 1P4XA 2V79A 4LK0F 3J81Z 4IVNA 3C3WA 1ON1A 2K86A 3PFIA 2ZNZA 5K5RA 5BQTA 5FLXK 4O6JA 3IC7A 1OYWA 2NYXA 1YYVA 4RB3C 1J75A 5F6FA 1IXSB 1G6NA 4B8XA 1HKQA 3K1NA 2HKOA 5CVUA 4EGZA 1LQ1A 3DV8A 3Q5FA 2L4MA 4UV8A 4Y17A 3LQRA 2QQBA 1F5TA 1HXDA 2EA4A 1SMTA 3T8RA 1VTNC 3IL2A 1YLFA 4ESJA 5E8GA 2NNYA 2M30A 2BE5F 4UXNA 2ZCWA 2RV8A 1H0MA 1U3EM 2KIMA 5K5OA 5F64A 1MKMA 3DF8A 1LDKB 3ZPLA 3F8NA 4E70A 4RB1A 2B0LA 1E17A 2PN6A 1BBYA 2PQ8A 1XGNA 5KVRA 3F22A 5BPIA 5L3EA 1WWXA 3I5UA 2VT3A 1T38A 4PZJA 4OINF 4IRIA 3F23A 1WI9A 1OPCA 2PMUA 5E8IA 3HSFA 1J59A 2YR2A 4ESBA 2TDXA 1MDMB 4EV0A 4YFXF 5IT9K 5A2QK 1S7OA 1R23A 2RVCA 4I2OA 2RN7A 3IHUA 3GEZA 2P6SA 3ABUA 4I0AA 4ZYGA 1U5TA 4RGSA 2DPUA 3BPVA 3RJPA 4CXFA 4LK1F 1I5ZA 2E7XA 5JHUA 1FNNA 4IF4A 4ETSA 3GX4X 2ZNYA 3HUGA 4GO1A 1DP7P 4M6YA 3TGNA 2DFIA 2RQPA 2R7DA 4CYDA 3CLOA 4UVAA 4IXAA 1SD7A 4EM0B 4KIGA 3M7GA 1YQAA 3E6BA 1FC3A 4XLNF 1STZA 1TTYA 3BDDA 5DUIA 2IA1A 3V8LA 3IRQA 5DCFA 1B6AA 2GXBA 3B02A 5D5WB 4MHGA 3ABTA 1XSVA 1YS6A 4O3MA 2OU2A 4KICA 1FSEA 1G4DA 4MEXF 4Q48A 4HX8A 2Z99A 1GVJA 4OIPF 5LHIA 1HQCA 4RGUA 2MBFA 5BOXA 2EFQA 3G3ZA 1R1VA 5FD6A 3I59A 5L3BA 4ESFA 3WG9A 4O5VA 3HOSA 2HEOA 3SHFA 3SFZA 2QZ8A 3I58A 1AOYA 3L9FA 1I27A 4R8HA 5IT3A 1LEBA 2LDUA 3ELKA 1FLIA 3QRFF 3R0AA 4FX4A 2O8XA 1USTA 2IJLA 5D8LB 3EYYA 4XRFA 3WE3A 1BC7C 3FMRA 5D4SA 3P9IA 2KJCA 3DPTA 3KP4A 3DQVC 1BIAA 2Z33A 1UHWA 3ML6A 3J7AO 3QP5A 1HKTA 1XCBA 2K4BA 4M6XA 1PDNC 2DW4A 3GF2A 4IHSA 4HZFA 4ZZLA 1K78B 5HLHA 3EYIA 5HVQC 2BV6A 5LEKA 1LVAA 2L54A 4HLYA 2HR3A 2JT1A 2Y48A 4BHBA 1YIOA 1FYMA 5E18F 5L3FA 1WKMA 1V3FA 1MGTA 4ENNA 3KE2A 4LMYA 2NNNA 2L02A 3P9KA 2PMHA 4S04A 2M45A 1FBSA 3F72A 1S6LA 1KU2A 2HZTA 2V6CA 4AVPA 2A07F 2HGCA 3ZMSA 2PLYA 5ICCA 3GLXA 5ERIA 4CDGA 3H3ZA 4LFUA 3E5UA 6PAXA 3CUQC 3HSRA 1ZRDA 3KP5A 4XSXF 3H3UA 1B9MA 1SFUA 5HS8A 5FLXZ 1WSUA 4OMZA 3E97A 1P4WA 3GZ5A 2H6BA 4K2EA 2Z3YA 4YIIA 3KCCA 1L0OC 1TW3A 2O61A 3KZZA 4KMUX 3R4KA 4Y13A 3H92A 4L5IA 1SD6A 2ACJA 2XHKA 3NRVA 3CO6C 1H9GA 4Q4ZF 1KYWA 1QO0D 3T1BA 3VOEA 5L3GA 2GA1A 1FSHA 4P9FA 3IWFA 1IN4A 4L9VA 2DAOA 3F8FA 3HSEA 4NB5A 2MLKA 2ZKZA 2UXXA 3E5QA 1Q1HA 3BZ6A 2EWNA 3U2RA 2K27A 1IF1A 4A12A 2STWA 5BS6A 2GQQA 1HKSA 1LJ9A 4CZZA 1E2XA 3CUQA 1BM9A 2VOPA 3ERED 4G7OF 1B59A 3HTSB 1NHAA 3GYHX 5BPDA 5D6FA 2QVOA 4L5JA 1W4MA 1QZYA 2DQRA 4JK1X 3QU3A 1O3RA 1W7PD 5EEHA 4GGGA 2VBYA 3IKTA 1FX7A 2F2EA 2WC2A 3BJAA 1IZ1A 2BYVE 3GFIA 3FZVA 2XKPA 1TQMA 1REPC 3KP6A 2EFOA 4GYGA 2XAJA 1U2WA 2V1DA 4WCGA 3ZMVA 3SQNA 3E6MA 4M9SA 3RTRA 1EV7A 5D4RA 4OIOF 5JVTA 2F5FA 1K7AA 4D0PA 4EQQA 1ODDA 2EFPA 3HRTA 1R1TA 3KLNA 2PFBA 3T8TA 2FMYA 3F8CA 2QLZA 3FHZA 2L01A 2DU9A 5DCMB 5K1YA 2JPCA 2P5VA 4BNCA 1ZLKA 1P6RA 4EMSA 4FT8A 4RB2C 1SFEA 3MCZA 1QZZA 3F6VA 3VODA 3ZMZA 2O03A 2A6HF 4LLLA 2O6GE 3JTGA 4H0EA 1EH7A 4U0VA 4CGZA 2A68F 5CVVA 2H27A 3VFZA 1G3SA 2C6YA 2QM3A 3REOA 3WTSC 4LB5A 2W24A 5LHGA 2G9WA 2A61A 4CO8A 2IA0A 2JZYA 3L2CA 3WTYC 1XDSA 4A5NA 1ZN2A 1Z7UA 3WU1B 4KA4A 2UXNA 3Q9VA 1J2XA 2A6EF 4A5MA 2MLGA 4PGHA 1TBXA 4RB0A 4HYEA 4HBLA 1QQIA 4CICA 5A2QZ 3MWMA 2FF4A 1TW2A 4I0BA 2HWVA 2ELHA 2IT0A 3ZQ7A 4YFKF 5ED4A 3PQJA 4G7ZF 2ZXJA 3C7JA 3IKVA 1IN6A 4EM1A 2PEXA 2A3SA 1F1ZA 4ASNA 2GXGA 2P5KA 4P55A 2EJRA 1IN8A 4I7HA 1WRJA 3NEUA 5JR3A 3JTHA 3OOPA 1ZRCA 2KIUA 1KYZA 2VT2A 3AAFA 4A0YA 3T5XA 2DO7A 1PUEE 2CW0F 4GXOA 3FXRA 3WGHA 2BBYA 4WXHA 2X0LA 2DQLA 4OMYA 3I54A 4HDVA 2HYGD 4OIQF 5LGNA 3I64A 4RGRA 4BYYA 2ESNA 3ZMDA 2M87A 1MJAA 1L3LA 2YPRA 2LF8A 4WXCA 4XBFA 4A2UA 1G3TA 1QBJA 1RNLA 2XKOA 5H6RA 2DTRA 1K6OA 2D1HA 3KP7A 5LGUA 1J5YA 2ADUA 2P7CB 2PJPA 2HYFA 5CYVA 4BHPA 1LEAA 2K7LA 4KYWA 1Z6TA 3WTXC 3J81K 4WXDA 4HDUA 3TOAA 1KQ8A 5D5VB 3LAJA 2H6CA 1U6GA 1GXQA 3TOBA 4MEYF 2ISYA 1S3JA 1P92A 1MD0A 2AS5F 1ZREA 2OZ6A 4P5OA 3V7RA 1TQPA 3MAJA 5DV5A 2EK5A 1XB4A 3HHHA 2CGPA 5HDKA 2RGVA 1RUNA 2O0YA 3L09A 4IJAA 1ZG3A 5HLIA 3JSPA 4CHUA 4ZH4F 3HYIA 2EV6A 2MC3A 3KP2A 5BMZA 3TO7A 1J9IA 2DI3A 5LHHA 2XROA 1T0FA 1Z6RA 3QPHA 1K78A 5H20A 1O3TA 2O3FA 3MZHA 3W6JB 2DK5A 4LLGF 4MGRA 4M9XA 3CO7C 2QQAA 3K69A 4Y15A 1FYKA 1SFXA 3F8BA 5D8KB 3RKYA 2LNBA 4L0ZB 2IVMA 5H6QA 4KMFA 2KJBA 2XASA 3FXUA 2FBHA 2HS5A 5J8CA 4HV5A 1JHHA 3GXOA 4HX4A 4IPAA 1UHMA 3RKXA 4WK8F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO9 A;  4UHT A;  4MTE A;  4EJW A;  2VBZ A;  2XV4 S;  1R58 A;  3QP6 A;  1IN5 A;  1IAW A;  4OU0 A;  2DT5 A;  4I98 B;  4AIH A;  1ZGJ A;  4FX0 A;  3WGG A;  1P4A A;  1ULY A;  5HDN A;  1GHC A;  2MA3 A;  2VN2 A;  2FOK A;  2FBI A;  3DPL C;  1RUO A;  3RPU A;  2VE8 A;  1IXC A;  5FFX A;  4ENM A;  5ILU A;  1W7P A;  2JSC A;  1BI0 A;  4EJV A;  2QEN A;  4I09 A;  1MZB A;  2VC0 A;  2WWY A;  4BQA A;  2CO5 A;  4TV7 A;  1TQI A;  2A5Y B;  3EET A;  3I4P A;  3W6K B;  4ENK A;  1XSD A;  4WWC A;  1LNW A;  4M71 A;  4U7B A;  3WE2 A;  5LEJ A;  3IWZ A;  5DUK A;  4LB6 B;  4HLX A;  4LJZ F;  3ZN1 A;  4WX9 A;  2E1C A;  4N9I A;  1JE8 A;  1PP8 F;  3D5L A;  1SAX A;  3TDZ C;  4QLC U;  2YU3 A;  2XGX A;  4L9N A;  1YFH A;  3HTU A;  2E7W A;  3V4G A;  3FX3 A;  1IXR C;  3MZY A;  2XAF A;  1T2K A;  5LRR A;  4A0Z A;  3ZN0 A;  3ZMU A;  2PG4 A;  4KFC A;  1BOA A;  4EJU A;  1YW9 A;  3K0L A;  1O3S A;  2EFW A;  2OAZ A;  1H9T A;  2W85 A;  2CSO A;  2FNP A;  2VOD A;  2X4H A;  1RZ4 A;  5LGT A;  1UB9 A;  2STT A;  1PP7 U;  5E1X A;  1XGM A;  1YO5 C;  1UCR A;  3TQN A;  2KIF A;  3JW4 A;  1DPR A;  1G3W A;  5J6X A;  2FEZ A;  1SD5 A;  3R61 A;  4LG0 A;  3E6C C;  3GFL A;  4HAM A;  4HF2 A;  2JRT A;  2GA2 A;  1F4K A;  2K02 A;  1ZAR A;  2Y0M A;  3WTU C;  4UNO A;  3QU6 A;  3WTT C;  1HW5 A;  2ZBK A;  3ROU A;  5D5X B;  4BXU A;  3FM5 A;  2FSW A;  4A0X A;  2QBY A;  5DEQ A;  5AIQ A;  4AIJ A;  4BHC A;  3G73 A;  1W5S A;  2EA2 A;  1BJA A;  1UFM A;  3DEU A;  2L4A A;  2XAQ A;  4EVI A;  2R7F A;  2MH2 A;  1YW7 A;  5LLQ A;  3O3K A;  2WTE A;  2HTJ A;  3LA2 A;  3HHG A;  4N0B A;  3MEX A;  2W84 A;  1C0W A;  3LWF A;  3DKW A;  2H94 A;  5K5Q A;  1OMI A;  5CVJ A;  2BEO A;  4L9T A;  4FHT A;  4WF2 A;  3COA C;  4YFN F;  2FE3 A;  4AWX B;  5DCM A;  2ZME A;  2NAZ A;  3LST A;  2IW5 A;  1HW1 A;  4RGX A;  3ECH A;  2Z5U A;  2BGC A;  1OYI A;  1S29 A;  1YG2 A;  2FNA A;  4G7H F;  1R5H A;  5FB2 A;  2QQ9 A;  2PBI A;  5IT9 Z;  5KK1 A;  1GXP A;  2W25 A;  1XMK A;  2G7H A;  3K1P A;  4U7D A;  1FPQ A;  1W5T A;  1IW7 F;  2FA5 A;  3KLO A;  2CFX A;  3RIR A;  1FOK A;  2FRH A;  2RC4 A;  1ZG1 A;  2HDC A;  1O7F A;  4G9Y A;  3GW2 A;  3HOT A;  1D3Y A;  1IUY A;  2YSR A;  4IRH A;  1J0R A;  2Q0O A;  3CUO A;  1I6X A;  3LA7 A;  2VOO A;  1JHF A;  1KA8 A;  2OQR A;  2J5P A;  4EGY A;  4ZYE A;  3EQL F;  2LF7 A;  1IN7 A;  1D8J A;  1ZGA A;  1U8R A;  1ON2 A;  2MD5 A;  3BY6 A;  4HF1 A;  1IRG A;  3F3X A;  2IP2 A;  4G6Q A;  3CJN A;  1HBX G;  3F21 A;  2V1U A;  2W57 A;  1X3U A;  1BC8 C;  4NHJ A;  4RAZ A;  1LB2 A;  3FM3 A;  2WV0 A;  2Q2E A;  1USS A;  2DLL A;  4R79 A;  1XN7 A;  4U0Y A;  1BI3 A;  2HKX A;  5E1Z B;  3WU0 A;  2Z9O A;  3LAP A;  4HQE A;  3KZY A;  4R1H A;  2LSO A;  2ESH A;  1KU9 A;  5HLG A;  4MQ9 F;  2Q8K A;  5AIP A;  3FMS A;  1S7A A;  3C18 A;  4OIR F;  2XUB A;  2IRF G;  5JI6 A;  5LBQ A;  4DNC A;  1R7J A;  4MQV A;  4MTD A;  4Q47 A;  2ETH A;  2EB7 A;  2XVC A;  3GFM A;  3V7S A;  5DDG A;  2CQK A;  4QWQ A;  1WQ2 A;  2HTS A;  1U5T B;  4KN4 X;  1BN5 A;  1ZH5 A;  2VXZ A;  2QBY B;  2AXL A;  2DBB A;  3F6O A;  5CVR A;  4L18 B;  2IPQ X;  2YX7 A;  3Q9S A;  2H09 A;  1O57 A;  4IHT A;  3GO5 A;  3M9A A;  4UVB A;  4ZZD A;  2QWW A;  1Z1D A;  3NQO A;  1BI2 A;  1CF7 B;  3CUQ B;  2VBW A;  1YTY A;  2QYO A;  3KEQ A;  4I02 A;  1LDJ A;  1MJB A;  1O3Q A;  4LGW A;  3HIF A;  2JPB A;  3R6S A;  2M8E A;  4PDK A;  1ONV A;  1HSJ A;  3F8M A;  2ZO4 A;  1R5G A;  1XGS A;  2RNJ A;  5L3D A;  3GZ6 A;  1QNT A;  2GWR A;  2P5L C;  3DFG A;  4AIK A;  1T98 A;  2LKP A;  4HF0 A;  2JTV A;  3D0S A;  1Z91 A;  3MFK A;  5JFR A;  4F7Z A;  4HW0 A;  1R36 A;  3U1D A;  2DPD A;  3QAH A;  3E6D A;  2F5D A;  3I59 B;  3RI4 A;  4HX7 A;  3OV8 A;  3IRR A;  3CTA A;  5J8F A;  4KIF A;  2J5O A;  3SZT A;  1R00 A;  3TKY A;  4Q5S F;  5E20 A;  3BRO A;  3P9C A;  1FYL A;  2M1B A;  1ZLJ A;  3ZMT A;  2P4W A;  3JAM K;  4G94 A;  4U0W A;  3WTW C;  2QUF A;  1D5V A;  1DPU A;  5F1R A;  2CWE A;  1G3Y A;  3KEO A;  1CF7 A;  5CVI A;  2L3D A;  2OA4 A;  1BI1 A;  3CDH A;  5ICE A;  3E3V A;  1MJ9 A;  3I0T A;  2XAH A;  2FXA A;  3S2W A;  3L7W A;  2HOE A;  4DQ2 A;  4EJT A;  3RKW A;  4HQM A;  3ULQ B;  3J80 K;  1OKR A;  5FGM A;  3GVA A;  2PI0 A;  4U88 A;  2ISZ A;  4B09 A;  2IA2 A;  2D45 A;  2FQ3 A;  1DUX C;  3M8F A;  2M5W A;  3V8K A;  2ZFW A;  3R0J A;  4AD9 A;  4A6E A;  3BWG A;  3C1D A;  1KGS A;  5HDG A;  1FZP B;  4PCQ A;  4P9U A;  1HW2 A;  4XLP F;  4RAY A;  1TNS A;  1JGS A;  3GFJ A;  3SXY A;  1U5T C;  4KIB A;  3PQK A;  3P7N A;  4Z2Y A;  4I01 A;  1Z9C A;  1J7K A;  2KRF A;  1Y0U A;  2DK8 A;  1QPM A;  1B4A A;  2V9V A;  2VC1 A;  3EDP A;  5D6E A;  2RDP A;  3N4M A;  1FBQ A;  2VON A;  1R22 A;  5D5U B;  4UUV A;  1Z05 A;  2UZK A;  3RYR A;  1V4R A;  4G8X A;  3QPT A;  3U9G A;  3VB2 A;  1KU7 A;  3TO6 A;  4KNY A;  2EV5 A;  4LG0 B;  2R3S A;  1YS7 A;  4EM2 A;  1B9N A;  3MQ0 A;  3V7C A;  2HQN A;  5CLS A;  1MDM A;  1YW8 A;  2EV0 A;  2ZJ2 A;  1RIO H;  4ZYH A;  1BIB A;  1I1S A;  1ZG5 A;  3QOP A;  1KQ9 A;  3EUH A;  1FT9 A;  3V8J A;  1A04 A;  1XSX A;  5ICF A;  3RPQ A;  3FMQ A;  4MNU A;  4NQW A;  2OQG A;  2GZW A;  1TLH B;  3VEP A;  3HRS A;  3KET A;  4YG2 F;  2F5E A;  3DXJ F;  1SMY F;  2UWM A;  2F5C A;  3TDU C;  1FWZ A;  2HQR A;  1EH6 A;  2GIV A;  4UV9 A;  1LDD A;  2OD5 A;  4P96 A;  5DD8 A;  1R1U A;  2OZU A;  4M74 A;  5E17 F;  2P6T A;  2HFH A;  3FF5 A;  3I53 A;  2V1X A;  3K9T A;  4KT5 C;  4ZYD A;  3WTV C;  2XIG A;  3KP3 A;  3K2Z A;  1SD4 A;  1ZYR F;  4EJO A;  3O6B B;  5FO5 A;  4G6D A;  3JSO A;  4HOB A;  5FFZ A;  1DDN A;  1B1B A;  5LRS A;  5HOO A;  1FY7 A;  1CGP A;  1S8N A;  4HA8 A;  4JQF A;  2P8T A;  3ZP5 A;  4IRG A;  1XDU A;  3M1E A;  3HRU A;  4M9Z A;  1K79 A;  1I1G A;  2XRN A;  1XMA A;  2CG4 A;  3BJ6 A;  1XD7 A;  3SZP A;  3R60 A;  1ZHF A;  4L0Y B;  4LD5 A;  2EFN A;  2YX4 A;  2FML A;  3I71 A;  2G7U A;  2VBX A;  2FU4 A;  4BAY A;  2E1N A;  2NRA C;  3LA3 A;  1FBU A;  1QGP A;  5ILS A;  3KFW X;  3J80 Z;  5ICG A;  4A6D A;  4N9H A;  3GWZ A;  3M8E A;  3WOD F;  4S05 A;  3HRM A;  2GAU A;  3L00 A;  4HV6 A;  2XAG A;  1D8K A;  1KU3 A;  2COM A;  2VE9 A;  1TNT A;  3RDI A;  3LQQ A;  1XGO A;  2KKO A;  1O7L A;  2D1V A;  2RKH A;  2FBK A;  4M73 A;  3BP8 A;  4KDP A;  3JAM Z;  5DD4 A;  5E1W A;  4KN7 X;  1FP1 D;  3BOQ A;  1ZAO A;  4LLN A;  1HST A;  2A69 F;  1U78 A;  3RYP A;  4UVC A;  2MH9 A;  4RS8 A;  3K1M A;  3WTZ A;  3T0Y A;  5L3C A;  3B73 A;  4KUM A;  1P2F A;  1EH8 A;  3E5X A;  1W7P B;  4YIF A;  3ISP A;  5FD5 A;  1OR7 A;  2NS0 A;  2Y75 A;  4OOI A;  3BJO A;  4GYI A;  1ZRF A;  2OBP A;  3FWE A;  1FP2 A;  3LFK A;  2K4J A;  2ZME B;  1IRF A;  2P7V B;  1F9N A;  5DYM A;  2CYY A;  1T6S A;  1T39 A;  4PGG A;  5ILV A;  2D2W A;  3BPX A;  4GCV A;  5EEG A;  1AWC A;  4L9J A;  5CJ9 A;  1JXS A;  3FXQ A;  3DP7 A;  3GUD A;  1KQ0 A;  5AON A;  5TRD A;  5HS9 A;  4ON0 A;  4ENJ A;  1RI7 A;  1XCV A;  4BH9 A;  3N97 A;  5TJJ A;  3WGI A;  3O2P E;  1OYY A;  4M72 A;  3ECO A;  4JBA A;  4XSZ F;  5HS7 A;  1P4X A;  2V79 A;  4LK0 F;  3J81 Z;  4IVN A;  3C3W A;  1ON1 A;  2K86 A;  3PFI A;  2ZNZ A;  5K5R A;  5BQT A;  5FLX K;  4O6J A;  3IC7 A;  1OYW A;  2NYX A;  1YYV A;  4RB3 C;  1J75 A;  5F6F A;  1IXS B;  1G6N A;  4B8X A;  1HKQ A;  3K1N A;  2HKO A;  5CVU A;  4EGZ A;  1LQ1 A;  3DV8 A;  3Q5F A;  2L4M A;  4UV8 A;  4Y17 A;  3LQR A;  2QQB A;  1F5T A;  1HXD A;  2EA4 A;  1SMT A;  3T8R A;  1VTN C;  3IL2 A;  1YLF A;  4ESJ A;  5E8G A;  2NNY A;  2M30 A;  2BE5 F;  4UXN A;  2ZCW A;  2RV8 A;  1H0M A;  1U3E M;  2KIM A;  5K5O A;  5F64 A;  1MKM A;  3DF8 A;  1LDK B;  3ZPL A;  3F8N A;  4E70 A;  4RB1 A;  2B0L A;  1E17 A;  2PN6 A;  1BBY A;  2PQ8 A;  1XGN A;  5KVR A;  3F22 A;  5BPI A;  5L3E A;  1WWX A;  3I5U A;  2VT3 A;  1T38 A;  4PZJ A;  4OIN F;  4IRI A;  3F23 A;  1WI9 A;  1OPC A;  2PMU A;  5E8I A;  3HSF A;  1J59 A;  2YR2 A;  4ESB A;  2TDX A;  1MDM B;  4EV0 A;  4YFX F;  5IT9 K;  5A2Q K;  1S7O A;  1R23 A;  2RVC A;  4I2O A;  2RN7 A;  3IHU A;  3GEZ A;  2P6S A;  3ABU A;  4I0A A;  4ZYG A;  1U5T A;  4RGS A;  2DPU A;  3BPV A;  3RJP A;  4CXF A;  4LK1 F;  1I5Z A;  2E7X A;  5JHU A;  1FNN A;  4IF4 A;  4ETS A;  3GX4 X;  2ZNY A;  3HUG A;  4GO1 A;  1DP7 P;  4M6Y A;  3TGN A;  2DFI A;  2RQP A;  2R7D A;  4CYD A;  3CLO A;  4UVA A;  4IXA A;  1SD7 A;  4EM0 B;  4KIG A;  3M7G A;  1YQA A;  3E6B A;  1FC3 A;  4XLN F;  1STZ A;  1TTY A;  3BDD A;  5DUI A;  2IA1 A;  3V8L A;  3IRQ A;  5DCF A;  1B6A A;  2GXB A;  3B02 A;  5D5W B;  4MHG A;  3ABT A;  1XSV A;  1YS6 A;  4O3M A;  2OU2 A;  4KIC A;  1FSE A;  1G4D A;  4MEX F;  4Q48 A;  4HX8 A;  2Z99 A;  1GVJ A;  4OIP F;  5LHI A;  1HQC A;  4RGU A;  2MBF A;  5BOX A;  2EFQ A;  3G3Z A;  1R1V A;  5FD6 A;  3I59 A;  5L3B A;  4ESF A;  3WG9 A;  4O5V A;  3HOS A;  2HEO A;  3SHF A;  3SFZ A;  2QZ8 A;  3I58 A;  1AOY A;  3L9F A;  1I27 A;  4R8H A;  5IT3 A;  1LEB A;  2LDU A;  3ELK A;  1FLI A;  3QRF F;  3R0A A;  4FX4 A;  2O8X A;  1UST A;  2IJL A;  5D8L B;  3EYY A;  4XRF A;  3WE3 A;  1BC7 C;  3FMR A;  5D4S A;  3P9I A;  2KJC A;  3DPT A;  3KP4 A;  3DQV C;  1BIA A;  2Z33 A;  1UHW A;  3ML6 A;  3J7A O;  3QP5 A;  1HKT A;  1XCB A;  2K4B A;  4M6X A;  1PDN C;  2DW4 A;  3GF2 A;  4IHS A;  4HZF A;  4ZZL A;  1K78 B;  5HLH A;  3EYI A;  5HVQ C;  2BV6 A;  5LEK A;  1LVA A;  2L54 A;  4HLY A;  2HR3 A;  2JT1 A;  2Y48 A;  4BHB A;  1YIO A;  1FYM A;  5E18 F;  5L3F A;  1WKM A;  1V3F A;  1MGT A;  4ENN A;  3KE2 A;  4LMY A;  2NNN A;  2L02 A;  3P9K A;  2PMH A;  4S04 A;  2M45 A;  1FBS A;  3F72 A;  1S6L A;  1KU2 A;  2HZT A;  2V6C A;  4AVP A;  2A07 F;  2HGC A;  3ZMS A;  2PLY A;  5ICC A;  3GLX A;  5ERI A;  4CDG A;  3H3Z A;  4LFU A;  3E5U A;  6PAX A;  3CUQ C;  3HSR A;  1ZRD A;  3KP5 A;  4XSX F;  3H3U A;  1B9M A;  1SFU A;  5HS8 A;  5FLX Z;  1WSU A;  4OMZ A;  3E97 A;  1P4W A;  3GZ5 A;  2H6B A;  4K2E A;  2Z3Y A;  4YII A;  3KCC A;  1L0O C;  1TW3 A;  2O61 A;  3KZZ A;  4KMU X;  3R4K A;  4Y13 A;  3H92 A;  4L5I A;  1SD6 A;  2ACJ A;  2XHK A;  3NRV A;  3CO6 C;  1H9G A;  4Q4Z F;  1KYW A;  1QO0 D;  3T1B A;  3VOE A;  5L3G A;  2GA1 A;  1FSH A;  4P9F A;  3IWF A;  1IN4 A;  4L9V A;  2DAO A;  3F8F A;  3HSE A;  4NB5 A;  2MLK A;  2ZKZ A;  2UXX A;  3E5Q A;  1Q1H A;  3BZ6 A;  2EWN A;  3U2R A;  2K27 A;  1IF1 A;  4A12 A;  2STW A;  5BS6 A;  2GQQ A;  1HKS A;  1LJ9 A;  4CZZ A;  1E2X A;  3CUQ A;  1BM9 A;  2VOP A;  3ERE D;  4G7O F;  1B59 A;  3HTS B;  1NHA A;  3GYH X;  5BPD A;  5D6F A;  2QVO A;  4L5J A;  1W4M A;  1QZY A;  2DQR A;  4JK1 X;  3QU3 A;  1O3R A;  1W7P D;  5EEH A;  4GGG A;  2VBY A;  3IKT A;  1FX7 A;  2F2E A;  2WC2 A;  3BJA A;  1IZ1 A;  2BYV E;  3GFI A;  3FZV A;  2XKP A;  1TQM A;  1REP C;  3KP6 A;  2EFO A;  4GYG A;  2XAJ A;  1U2W A;  2V1D A;  4WCG A;  3ZMV A;  3SQN A;  3E6M A;  4M9S A;  3RTR A;  1EV7 A;  5D4R A;  4OIO F;  5JVT A;  2F5F A;  1K7A A;  4D0P A;  4EQQ A;  1ODD A;  2EFP A;  3HRT A;  1R1T A;  3KLN A;  2PFB A;  3T8T A;  2FMY A;  3F8C A;  2QLZ A;  3FHZ A;  2L01 A;  2DU9 A;  5DCM B;  5K1Y A;  2JPC A;  2P5V A;  4BNC A;  1ZLK A;  1P6R A;  4EMS A;  4FT8 A;  4RB2 C;  1SFE A;  3MCZ A;  1QZZ A;  3F6V A;  3VOD A;  3ZMZ A;  2O03 A;  2A6H F;  4LLL A;  2O6G E;  3JTG A;  4H0E A;  1EH7 A;  4U0V A;  4CGZ A;  2A68 F;  5CVV A;  2H27 A;  3VFZ A;  1G3S A;  2C6Y A;  2QM3 A;  3REO A;  3WTS C;  4LB5 A;  2W24 A;  5LHG A;  2G9W A;  2A61 A;  4CO8 A;  2IA0 A;  2JZY A;  3L2C A;  3WTY C;  1XDS A;  4A5N A;  1ZN2 A;  1Z7U A;  3WU1 B;  4KA4 A;  2UXN A;  3Q9V A;  1J2X A;  2A6E F;  4A5M A;  2MLG A;  4PGH A;  1TBX A;  4RB0 A;  4HYE A;  4HBL A;  1QQI A;  4CIC A;  5A2Q Z;  3MWM A;  2FF4 A;  1TW2 A;  4I0B A;  2HWV A;  2ELH A;  2IT0 A;  3ZQ7 A;  4YFK F;  5ED4 A;  3PQJ A;  4G7Z F;  2ZXJ A;  3C7J A;  3IKV A;  1IN6 A;  4EM1 A;  2PEX A;  2A3S A;  1F1Z A;  4ASN A;  2GXG A;  2P5K A;  4P55 A;  2EJR A;  1IN8 A;  4I7H A;  1WRJ A;  3NEU A;  5JR3 A;  3JTH A;  3OOP A;  1ZRC A;  2KIU A;  1KYZ A;  2VT2 A;  3AAF A;  4A0Y A;  3T5X A;  2DO7 A;  1PUE E;  2CW0 F;  4GXO A;  3FXR A;  3WGH A;  2BBY A;  4WXH A;  2X0L A;  2DQL A;  4OMY A;  3I54 A;  4HDV A;  2HYG D;  4OIQ F;  5LGN A;  3I64 A;  4RGR A;  4BYY A;  2ESN A;  3ZMD A;  2M87 A;  1MJA A;  1L3L A;  2YPR A;  2LF8 A;  4WXC A;  4XBF A;  4A2U A;  1G3T A;  1QBJ A;  1RNL A;  2XKO A;  5H6R A;  2DTR A;  1K6O A;  2D1H A;  3KP7 A;  5LGU A;  1J5Y A;  2ADU A;  2P7C B;  2PJP A;  2HYF A;  5CYV A;  4BHP A;  1LEA A;  2K7L A;  4KYW A;  1Z6T A;  3WTX C;  3J81 K;  4WXD A;  4HDU A;  3TOA A;  1KQ8 A;  5D5V B;  3LAJ A;  2H6C A;  1U6G A;  1GXQ A;  3TOB A;  4MEY F;  2ISY A;  1S3J A;  1P92 A;  1MD0 A;  2AS5 F;  1ZRE A;  2OZ6 A;  4P5O A;  3V7R A;  1TQP A;  3MAJ A;  5DV5 A;  2EK5 A;  1XB4 A;  3HHH A;  2CGP A;  5HDK A;  2RGV A;  1RUN A;  2O0Y A;  3L09 A;  4IJA A;  1ZG3 A;  5HLI A;  3JSP A;  4CHU A;  4ZH4 F;  3HYI A;  2EV6 A;  2MC3 A;  3KP2 A;  5BMZ A;  3TO7 A;  1J9I A;  2DI3 A;  5LHH A;  2XRO A;  1T0F A;  1Z6R A;  3QPH A;  1K78 A;  5H20 A;  1O3T A;  2O3F A;  3MZH A;  3W6J B;  2DK5 A;  4LLG F;  4MGR A;  4M9X A;  3CO7 C;  2QQA A;  3K69 A;  4Y15 A;  1FYK A;  1SFX A;  3F8B A;  5D8K B;  3RKY A;  2LNB A;  4L0Z B;  2IVM A;  5H6Q A;  4KMF A;  2KJB A;  2XAS A;  3FXU A;  2FBH A;  2HS5 A;  5J8C A;  4HV5 A;  1JHH A;  3GXO A;  4HX4 A;  4IPA A;  1UHM A;  3RKX A;  4WK8 F; 
#chains in the Genus database with same CATH topology
 3TO9 A;  4UHT A;  4MTE A;  2VUM J;  4EJW A;  2VBZ A;  3ZCO A;  2XV4 S;  5F0C A;  3G1M A;  1FIA A;  3K70 C;  1R58 A;  3QPL A;  3QP6 A;  1IN5 A;  1IAW A;  2XF6 A;  2L9S A;  2O7O A;  1D1B A;  2O9L A;  1VND A;  4OU0 A;  1BW6 A;  2DT5 A;  4I98 B;  4AIH A;  1ZGJ A;  4FX0 A;  1BL0 A;  3WGG A;  1P4A A;  1ULY A;  2LVS A;  5IYB J;  3RZO J;  5HDN A;  2DOD A;  1GHC A;  2MA3 A;  3ZQF A;  5C3E J;  2VN2 A;  2VAS A;  2FOK A;  2FBI A;  2E1M C;  2QEX I;  3MN2 A;  4CZC A;  3DPL C;  1RUO A;  3RPU A;  2VE8 A;  4A3E J;  1V54 H;  1IXC A;  3DBR B;  2EH3 A;  3KPH A;  2DOA A;  5FFX A;  4ENM A;  5ILU A;  2QSH X;  1W7P A;  2BZT A;  2JSC A;  1BI0 A;  4EJV A;  2ZJQ F;  2QEN A;  4MLO A;  5K7F A;  2JQ7 A;  1ZQ3 P;  1JKR C;  2X1D A;  4I09 A;  3OYI A;  3HOZ J;  1MZB A;  2HXO A;  1X1B A;  2VC0 A;  2A05 A;  2WWY A;  4NC8 A;  4BQA A;  4QIW N;  3H5R A;  2CO5 A;  4LOC A;  3H0G J;  4TV7 A;  1TQI A;  2AHQ A;  1JTY A;  2A5Y B;  3EET A;  3TMO A;  1UJ8 A;  3SEQ A;  3I4P A;  3ZQQ A;  1NH3 A;  1P7I A;  1WJD A;  3W6K B;  4Y4R A;  1GVD A;  5F1J A;  3HB9 A;  4ENK A;  1XSD A;  2HDW A;  4WWC A;  3L2Q A;  3AL0 C;  4BDZ A;  1LNW A;  4M71 A;  4BBR J;  1W5C C;  4U7B A;  2HVS A;  2E2H J;  3QYF A;  2NOJ B;  3GTL J;  3WE2 A;  3S3O A;  5LEJ A;  5F04 A;  2HYJ A;  2HOA A;  3RZD J;  3IWZ A;  2GXA A;  1ETO A;  3B6C A;  5DUK A;  2EIJ H;  3LFU A;  4LB6 B;  2CJJ A;  1KON A;  4HLX A;  4LJZ F;  3RQI A;  3ZN1 A;  2M0M A;  4WX9 A;  2E1C A;  1JUS A;  4N9I A;  1JE8 A;  1VQL I;  1PP8 F;  3D5L A;  1RR8 C;  2HDD A;  1BW5 A;  3LSK A;  3HOW J;  1EJ9 A;  2ZXW H;  1SAX A;  1PYV A;  2CUE A;  3RCO A;  3TDZ C;  3Q0V A;  5EYR A;  2V9P A;  3IH4 A;  2OC6 A;  4QLC U;  2DCE A;  2YU3 A;  2XGX A;  5M3F J;  3TW6 A;  1Y8Q B;  4MFE A;  3M1C A;  2M8G X;  4L9N A;  3BTL A;  1YFH A;  3S32 A;  4W1U A;  3HTU A;  3BC8 A;  3G4S I;  2E7W A;  3V4G A;  3FX3 A;  3BG7 A;  1IXR C;  1QA6 A;  4AU7 A;  3MZY A;  2AO9 A;  1XPX A;  3PO2 J;  2AQF A;  3F9K A;  2X6W A;  2XAF A;  3L1P A;  1T2K A;  3H5N A;  5LRR A;  3LSP A;  4A0Z A;  3ZN0 A;  3OYL A;  4IHY A;  4NQW B;  3ZMU A;  2PG4 A;  4KFC A;  1BOA A;  3N05 A;  1FOW A;  2DDA A;  4EJU A;  2LC2 A;  1YW9 A;  5IYD J;  3HPG A;  3K0L A;  3KEY A;  4A3M J;  2JA8 J;  5DM7 F;  1ZR2 A;  3OYJ A;  1O3S A;  3BT9 A;  2OAZ A;  2EFW A;  2W85 A;  1H9T A;  1YHQ I;  2CSO A;  1WJB A;  2FNP A;  2VOD A;  2MSY A;  2X4H A;  3CP8 A;  3A0B C;  1LFB A;  1RZ4 A;  2LOO A;  5LGT A;  1UB9 A;  2STT A;  1PP7 U;  3ZQL A;  2CFO A;  5E1X A;  1XGM A;  2GM4 A;  3H0D A;  4HNT A;  1YO5 C;  1UCR A;  2KIF A;  3JW4 A;  3TQN A;  5KHD A;  1DPR A;  4QPQ A;  1G3W A;  1X19 A;  2ICW G;  3IP4 B;  1MBH A;  5J6X A;  2FEZ A;  2WY8 Q;  4ZDL A;  2R7S A;  1SD5 A;  3R61 A;  4LG0 A;  4XIC A;  3E6C C;  3GFL A;  2LR8 A;  4HAM A;  4HF2 A;  3OL4 A;  4A3I J;  2JRT A;  2GA2 A;  1F4K A;  2K02 A;  1ZAR A;  1LUJ B;  3J7Z I;  2Y0M A;  1MBJ A;  3WTU C;  4UNO A;  1K4T A;  3AFH A;  1IJW C;  3QU6 A;  1NG7 A;  3UR3 C;  3WTT C;  1VQM I;  1HW5 A;  1XTA A;  2ZBK A;  4CCN A;  3ROU A;  5D5X B;  2ELK A;  2ZXI A;  3H1C A;  3A0H C;  4BQO A;  4BXU A;  3FM5 A;  2K40 A;  2DN0 A;  2FSW A;  4A0X A;  2QBY A;  3FXM A;  5DEQ A;  3C2G A;  5JLW A;  5AIQ A;  4AIJ A;  3GTP J;  1DGR M;  4BHC A;  1S72 I;  3HZJ A;  3G73 A;  5EDN A;  1W5S A;  2EA2 A;  1BJA A;  1UFM A;  3DEU A;  2CQN A;  2L4A A;  2XAQ A;  4EVI A;  2R7F A;  2MH2 A;  1YW7 A;  5LLQ A;  2K9N A;  2E60 A;  3O3K A;  2FD5 A;  2WTE A;  2W7N A;  4FAS D;  3WU2 C;  3S16 J;  2OCE A;  3W3C A;  5CKT A;  2HTJ A;  3LA2 A;  3HHG A;  4D7M A;  4N0B A;  5IY5 H;  3K7A J;  3DLA A;  4HPQ A;  1QRY A;  4L5E A;  4UUT A;  4Y33 A;  3MEX A;  2W84 A;  1C0W A;  1BOB A;  3DKW A;  3LWF A;  2H94 A;  3BQY A;  4B3X A;  3OIO A;  5K5Q A;  1OMI A;  5CVJ A;  5EJC A;  2N8G A;  2BEO A;  3K4B A;  2KIS A;  1RPW A;  2EQR A;  4L9T A;  3GBG A;  1A6I A;  4FHT A;  2GBY A;  4WF2 A;  3COA C;  4RBO A;  2PJR A;  2JK3 A;  2PJR B;  4YFN F;  1TT5 B;  2CW8 A;  2FE3 A;  5DCM A;  4AWX B;  5HOD A;  2ZME A;  2NAZ A;  3PNT A;  1FEX A;  5FKN A;  3LST A;  2DJI A;  2IW5 A;  1HW1 A;  4RGX A;  3ECH A;  2Z5U A;  2BGC A;  1OYI A;  4XNF A;  1S29 A;  1YG2 A;  2FNA A;  2EPF A;  1FTZ A;  4G7H F;  1R5H A;  5FB2 A;  5M5W J;  3MMY B;  1ETY A;  2QQ9 A;  2PBI A;  3PIO F;  5IT9 Z;  3CD6 I;  1YE9 A;  5KK1 A;  1GXP A;  2W25 A;  1E3P A;  4BDY A;  2Y69 H;  3V42 A;  1XMK A;  2G7H A;  3K1P A;  4M3G A;  4RA2 A;  2W48 A;  4U7D A;  1VQ7 I;  1FPQ A;  1W5T A;  2VPR A;  1JKO C;  1IW7 F;  2FA5 A;  1AA7 A;  2I8D A;  3KLO A;  2KLO A;  2KFD A;  4FCY A;  2CFX A;  3RIR A;  3S2H J;  1FOK A;  2FRH A;  2RC4 A;  3AG4 H;  1ZG1 A;  1HDP A;  2HDC A;  2TCT A;  4BY1 J;  5J4V A;  2DT7 B;  3ZQC A;  1X3Z B;  2BY1 A;  5F27 A;  1O7F A;  4G9Y A;  3GW2 A;  2YUS A;  3HOT A;  1D3Y A;  2FUG 2;  3HUG B;  2IEK A;  4RAF A;  1IUY A;  2NVY J;  3EUA A;  1AU7 A;  2YSR A;  4B48 A;  4IRH A;  2X51 A;  3BLY A;  1J0R A;  2Q0O A;  4DYR A;  4U87 A;  5J1U A;  3CUO A;  4B44 A;  1I6X A;  3J7A Y;  3GTG J;  3K4M A;  3LA7 A;  4ZTJ A;  3JRE A;  2VOO A;  1V5F A;  1JHF A;  1KA8 A;  2OQR A;  3IUO A;  2J5P A;  5B1A H;  5EG0 B;  4NDL A;  2ZJR F;  4DGW B;  4ZC3 A;  4XRM A;  2MC4 A;  1J09 A;  1WFX A;  4EGY A;  4ZYE A;  4BEH A;  3EQL F;  2LF7 A;  4BU2 A;  1N75 A;  1IN7 A;  2H1L A;  4KIT B;  1R49 A;  1JKQ C;  1D8J A;  1G8X A;  1ZGA A;  1U8R A;  1ON2 A;  2MD5 A;  3BY6 A;  4HF1 A;  4AYB N;  2E1O A;  4DOZ A;  1VQN I;  2BY3 A;  3F3X A;  1IRG A;  2IP2 A;  3SYT A;  4G6Q A;  1N77 A;  1HDD C;  2K9S A;  3CJN A;  1HBX G;  1VQ6 I;  5EZH A;  3F21 A;  2V1U A;  3CCY A;  3PUB A;  2W57 A;  1X3U A;  4DZJ A;  1BC8 C;  4NHJ A;  2ELJ A;  3RSN A;  5J40 A;  5GAH J;  4RAZ A;  1LB2 A;  3FM3 A;  2WV0 A;  4IEJ A;  2Q2E A;  1EA3 A;  1USS A;  2DLL A;  4R79 A;  2BY0 A;  2DXI A;  3ASN H;  2LKS A;  1XN7 A;  4U0Y A;  1Z77 A;  4UUS A;  1BI3 A;  2HKX A;  1UAA A;  1ETW A;  4PJJ A;  5E1Z B;  3WU0 A;  2Z9O A;  1NK2 P;  3LAP A;  4HQE A;  4Z6Y A;  2CQX A;  3KZY A;  3AG3 H;  1WVR A;  4R1H A;  2LSO A;  1W0T A;  1MBK A;  2ESH A;  1UG2 A;  4UB8 C;  4CCL A;  1KU9 A;  4MQ9 F;  5HLG A;  2Q8K A;  5AIP A;  5KAF C;  3FMS A;  3ESW B;  4BBS J;  1S7A A;  3C18 A;  2K3P A;  3JRG A;  4OIR F;  3GTJ J;  4E7J A;  2XUB A;  2IRF G;  2Y31 A;  3AKZ A;  5JI6 A;  3GZN B;  4CUG A;  3OWT A;  2M34 A;  2DOF A;  5LBQ A;  3K4N A;  2E71 A;  1ZR4 A;  1A31 A;  3CDL A;  4DNC A;  2XPV A;  1VI0 A;  1D1A A;  1R7J A;  4MQV A;  1JUP A;  5J1R A;  4MTD A;  3DWL E;  4Q47 A;  5HLT A;  2MW8 A;  4D5F A;  2ETH A;  4AYB A;  1HA8 A;  2R5Z B;  3M07 A;  3PNV A;  2EB7 A;  5TGT A;  4A3J J;  1YIJ I;  4BY7 J;  2XVC A;  3GFM A;  3V7S A;  5DDG A;  2CQK A;  1I3Q J;  1WQ2 A;  4QWQ A;  2HTS A;  1U5T B;  1D0Y A;  1H8A C;  2DMP A;  1SAN A;  4PK4 A;  4XKB A;  4KN4 X;  1BN5 A;  3S93 A;  3AG1 H;  1H88 C;  2VXZ A;  1MNM C;  1ZH5 A;  2QBY B;  2AXL A;  3S1R J;  2DBB A;  2K3F A;  3F6O A;  5CVR A;  4L18 B;  4NNJ A;  2IPQ X;  1U9O A;  2CRG A;  1FOY A;  1JJ8 C;  2YX7 A;  2ZB9 A;  3Q9S A;  1YJ9 I;  1I6H J;  2H09 A;  1O57 A;  1QZE A;  4IHT A;  3GO5 A;  3M9A A;  3HJE A;  4UVB A;  4ZZD A;  2EZH A;  2QWW A;  2X85 A;  1Z1D A;  2K9M A;  3JCU C;  3NQO A;  1OCP A;  3S1M J;  1BI2 A;  1CF7 B;  3CUQ B;  2VBW A;  3H9J A;  1YTY A;  2QYO A;  3HXL A;  3KEQ A;  3ZXS A;  3ASO H;  4I02 A;  3RPU D;  3MKW B;  4AVZ A;  1LDJ A;  1MJB A;  1DGW Y;  1O3Q A;  2P81 A;  4LGW A;  3HIF A;  3B6A A;  2JPB A;  2M8E A;  3R6S A;  4LIU A;  1GV5 A;  4PDK A;  4LIV A;  1ONV A;  1SEU A;  1HSJ A;  3CMY A;  2BXZ A;  4PJL A;  3F8M A;  2ZO4 A;  1JT0 A;  1R5G A;  1XGS A;  1T08 B;  2DA5 A;  1V55 H;  2FJ1 A;  1VF9 A;  2RNJ A;  5L3D A;  3PO3 J;  3IAM 2;  2H1K A;  4OAZ A;  3GZ6 A;  1U0J A;  1QNT A;  2GWR A;  2P5L C;  4C2M J;  4F52 A;  3DFG A;  2UV1 A;  1WI3 A;  4AIK A;  1IGN A;  1T98 A;  1WJ5 A;  2RQQ A;  2LKP A;  4HF0 A;  2JTV A;  1WPK A;  3D0S A;  1Z91 A;  2GLO A;  3MFK A;  2MGQ A;  5JFR A;  4F7Z A;  4HW0 A;  1R36 A;  3U1D A;  1JT6 A;  1JKP C;  1ACI A;  5J1Y A;  2DPD A;  3ZOB A;  5DM6 F;  1V5G A;  3QAH A;  3H35 A;  4C3J J;  2ZME C;  5K7H A;  3E6D A;  2F5D A;  3I59 B;  3RI4 A;  4HX7 A;  3OV8 A;  1X4P A;  3HBL A;  3IRR A;  1CQT A;  3CTA A;  3CCU I;  2L7K A;  2Z2S B;  5J8F A;  4KIF A;  2J5O A;  1Y39 A;  1MIJ A;  3SZT A;  3ZRG A;  4J01 A;  3DKX A;  4BKX A;  3K4L A;  1R00 A;  3TKY A;  2BHZ A;  3ZGK A;  4Q5S F;  5F08 A;  5E20 A;  3BRO A;  2WB1 N;  2R7R A;  4UB6 C;  2LY2 A;  3CME I;  3P9C A;  2L0K A;  2G0E A;  1FYL A;  2M1B A;  1ZLJ A;  3HG9 A;  3ZMT A;  2P4W A;  3ZQH A;  3JAM K;  4G94 A;  2LY1 A;  4U0W A;  3WTW C;  2QUF A;  1D5V A;  1DPU A;  5F1R A;  4DJA A;  1BR2 A;  5DS9 A;  4B3A A;  2CWE A;  2NS7 A;  1YI2 I;  1G3Y A;  5KAI C;  4XKW A;  2CV0 A;  3KEO A;  2DMT A;  1CF7 A;  5CVI A;  2L3D A;  4Y3O A;  2OA4 A;  1BI1 A;  3CDH A;  2DMU A;  3E3V A;  5ICE A;  3A1Y A;  5IP7 J;  2EIN H;  3OYF A;  1X58 A;  3I4N J;  1MJ9 A;  3I0T A;  2XAH A;  2FXA A;  4CYC B;  1HCR A;  3S2W A;  3UKG A;  3L7W A;  4BE0 A;  2L7Z A;  1AKH B;  2HOE A;  4N4N B;  4DQ2 A;  4EJT A;  3RKW A;  4HQM A;  1WJE A;  3ULQ B;  2Q2E B;  1DQU A;  4W97 A;  3J80 K;  1OKR A;  5FGM A;  3GVA A;  4CCJ A;  4DW6 A;  2PI0 A;  3DEW A;  4U88 A;  1W1W E;  2ISZ A;  4B09 A;  4B47 A;  1H89 C;  5FRN A;  2IA2 A;  3VYR B;  2D45 A;  3CJT B;  1ETX A;  3HKZ N;  1SVM A;  2FQ3 A;  1IC8 A;  1DUX C;  1TT0 A;  2LK2 A;  3M8F A;  2M5W A;  3V8K A;  3C2B A;  3I56 I;  3A2K A;  2ZFW A;  3R0J A;  1D0Z A;  4AD9 A;  4A6E A;  3BWG A;  2VIX A;  2AQE A;  4ITV A;  2LBF A;  3C1D A;  1KGS A;  2BVM A;  5HDG A;  4F93 B;  1FZP B;  4IX7 A;  5GAG J;  1SAU A;  4PCQ A;  3PSI A;  1TZL A;  5EG0 A;  4P9U A;  1HW2 A;  4XLP F;  4RAY A;  1TNS A;  1JGS A;  3GFJ A;  3SXY A;  1U5T C;  2IGK A;  4KIB A;  2I10 A;  4HNU A;  3AL0 B;  3H3V K;  3PQK A;  3P7N A;  3OYN A;  2K9Q A;  4Z2Y A;  4I01 A;  4E7K A;  1Z9C A;  3OR1 C;  5JHF A;  2WAQ N;  2KHM A;  1J7K A;  4Y7N J;  3IV5 A;  2KRF A;  1Y0U A;  3K70 D;  4E7Z A;  4CA0 A;  2DYR H;  2DK8 A;  1QPM A;  1B4A A;  2V9V A;  2VQH A;  2XSJ C;  2NOG A;  2VC1 A;  3EDP A;  4C2U A;  3DLL F;  5D6E A;  2RDP A;  3TBI A;  3K2A A;  3N4M A;  4M3F A;  4B43 A;  2W4S A;  1FBQ A;  2BXY A;  3CLQ A;  5HNH A;  3PM1 A;  2V1N A;  5KNL A;  2VON A;  4A3D J;  1R22 A;  3NAR A;  1LKX A;  2Y9Z A;  5D5U B;  4UUV A;  1Z05 A;  2UZK A;  2QSF X;  3RYR A;  5F0H A;  1V4R A;  1T95 A;  1ZKG A;  4G8X A;  1MH3 A;  5FKK A;  3QPT A;  3U9G A;  3VB2 A;  1DU6 A;  1MMD A;  1KU7 A;  3TO6 A;  4LG3 A;  4BE2 A;  4KNY A;  1K83 J;  2CUJ A;  1QHG A;  3OYM A;  2EV5 A;  1X1D A;  4LG0 B;  3QOE A;  4XRS G;  2R3S A;  1YS7 A;  3D5S C;  4EM2 A;  1B9N A;  2IGO A;  3M4O J;  4BEH B;  3MQ0 A;  3LSH A;  4RM3 A;  3V7C A;  2HQN A;  3FKI J;  4ZJZ A;  5CLS A;  1MDM A;  1YW8 A;  2EV0 A;  2ZJ2 A;  1RIO H;  3OIQ A;  4ZYH A;  1BIB A;  2QSG X;  1I1S A;  2DFE A;  2KRH A;  1ZG5 A;  3QOP A;  2XC7 A;  2OCC H;  1KQ9 A;  2ID6 A;  5KCM A;  3EUH A;  1FT9 A;  2JA2 A;  2NS8 A;  3V8J A;  3C2H A;  1A04 A;  1XSX A;  4IOC F;  5ICF A;  3RPQ A;  3FMQ A;  4MNU A;  4NQW A;  2OQG A;  1I50 J;  3OR2 C;  2VLA A;  2GZW A;  2XRL A;  3HEF A;  1TLH B;  3VEP A;  1TWC J;  1BR1 A;  5J3L A;  3BZC A;  3HRS A;  3KET A;  4YG2 F;  2F5E A;  3DXJ F;  2M0C A;  4CH7 A;  1SMY F;  3AG2 H;  2UWM A;  2F5C A;  4BUP A;  3FK7 A;  3KYL A;  1TP4 A;  4M3D A;  3TDU C;  1FWZ A;  2HQR A;  2XGD A;  1EH6 A;  2GIV A;  4UV9 A;  1LDD A;  1OLT A;  3ERM A;  4XLE A;  4E4H A;  2OD5 A;  4P96 A;  5DD8 A;  1R1U A;  2DFF A;  2HNH A;  2OZU A;  4M74 A;  5E17 F;  2P6T A;  3DBH B;  2HFH A;  3FF5 A;  3I53 A;  2V1X A;  5CPR B;  3K9T A;  3ABM H;  4QTR A;  4KT5 C;  2VQG A;  2VQL A;  4ZYD A;  2VJI A;  3WTV C;  5IOY A;  1YIT I;  3KIO A;  4HG2 A;  3S17 J;  2XIG A;  3KP3 A;  2KDZ A;  3K2Z A;  3BR3 A;  4OWR B;  1VQ4 I;  5IYC J;  2WBM A;  1SD4 A;  5E3N A;  1OCZ H;  2R5Z A;  1ZYR F;  2O8K A;  2EZK A;  4EJO A;  3O6B B;  5FO5 A;  1WZ2 A;  4G6D A;  2DOE A;  3PFY A;  3JSO A;  2JWT A;  2RAE A;  4HOB A;  5FFZ A;  1NTC A;  1OIS A;  4YEL A;  1GT0 C;  1U9N A;  1DDN A;  1B1B A;  5LRS A;  2HZD A;  4KIS A;  5HOO A;  1VQP I;  1KZH A;  4A3B J;  1FY7 A;  2L2O A;  1CGP A;  1S8N A;  4HA8 A;  3MZ8 A;  4JQF A;  1Y8R B;  2VKE A;  2P0W A;  2P8T A;  3ZP5 A;  2OPT A;  4IRG A;  1XDU A;  3M1E A;  3HRU A;  2L9V A;  4M9Z A;  4UY8 I;  5C4X J;  1K79 A;  2DA1 A;  3H5A A;  3K4J A;  2B7E A;  3VWB A;  1I1G A;  2XRN A;  1XMA A;  2CG4 A;  3BJ6 A;  4CSW A;  1K61 A;  1XD7 A;  3SZP A;  5E3L A;  3ZR8 X;  2PX9 A;  1EKE A;  3LMM A;  3R60 A;  2E5Z A;  1ZHF A;  4L0Y B;  3BG9 A;  1D5Y A;  3OYB A;  3FKJ A;  4QSH A;  3CMA I;  2OTL I;  5J47 A;  1S9H A;  3CMM A;  2WB1 A;  5FKL A;  4LD5 A;  2EFN A;  4G6T B;  2YX4 A;  1X2N A;  2LY9 A;  4HST A;  2FML A;  3OYA A;  1NG6 A;  2QKL B;  2IAI A;  5FLM J;  2M7A A;  1V5E A;  4F91 B;  3I71 A;  2G7U A;  1T0F C;  3QYB A;  4BGD A;  2VQC A;  1OR7 C;  2VBX A;  2FU4 A;  4BAY A;  2KDO A;  4C9Y A;  1UG0 A;  2E1N A;  3NWS A;  2FX0 A;  2LH9 A;  2NRA C;  3KZI C;  3LA3 A;  1FBU A;  5DTD A;  1QGP A;  5ILS A;  4UUS B;  2JUC A;  3KFW X;  2IS4 A;  1VQ8 I;  3J80 Z;  2XF5 A;  3CCR I;  5ICG A;  4A6D A;  2Y9Y A;  3FXO A;  4N9H A;  2HVQ A;  3GWZ A;  3M8E A;  3WOD F;  4D5C A;  3S15 J;  4XKC A;  2XSD C;  4S05 A;  2E19 A;  1WH5 A;  3HRM A;  2GAU A;  3L00 A;  2R7Q A;  2E1M B;  2F48 A;  2V7F A;  4II2 A;  4HV6 A;  1ETQ A;  5GTH C;  2XAG A;  1D8K A;  1KU3 A;  2COM A;  1LVK A;  1RKT A;  2VE9 A;  1TNT A;  3CCE I;  3RDI A;  3LQQ A;  1XGO A;  2KKO A;  1O7L A;  2D1V A;  2JSP A;  5GP9 A;  2RKH A;  2FBK A;  4M73 A;  3BP8 A;  2CS3 A;  4KDP A;  3JAM Z;  5DD4 A;  5E1W A;  2K85 A;  4JOM A;  4KN7 X;  1FP1 D;  3BOQ A;  1RR7 A;  2VKH A;  1BR4 A;  1O4X A;  1ZAO A;  2CMP A;  1HST A;  4DYC A;  4LLN A;  1DP3 A;  5EZG A;  2A69 F;  2KIQ A;  3S1Q J;  1I3A A;  1U78 A;  3RYP A;  4UVC A;  2MH9 A;  4RS8 A;  3K1M A;  3WTZ A;  3QPS A;  2R93 J;  3T0Y A;  5L3C A;  3DTE A;  2HQA A;  3B73 A;  4KUM A;  1SC7 A;  3G1O A;  4IL6 C;  1OCC H;  1P2F A;  4D7N A;  1EH8 A;  1K4S A;  3E5X A;  1W7P B;  4YIF A;  2M7B A;  1I39 A;  1OCT C;  3ISP A;  2ME6 A;  5FD5 A;  1OR7 A;  1Y6I A;  2NS0 A;  3OYK A;  4C3I J;  2Y75 A;  2VB6 A;  5LFA A;  4OOI A;  2WAE A;  2Y30 A;  3CCM I;  2JA7 J;  2OJE D;  1QHH D;  1XS9 A;  3BJO A;  1R5I D;  4GYI A;  3I3L A;  1ZRF A;  4E7H A;  1Y0N A;  2OBP A;  3FWE A;  1FP2 A;  1SVL A;  3LFK A;  1TWA J;  4KJZ A;  2K4J A;  4MIM A;  2OV7 A;  2ZME B;  1IRF A;  2P7V B;  1F9N A;  5DYM A;  2CYY A;  2X6O A;  1T6S A;  2VKV A;  1T39 A;  4PGG A;  4X1E A;  2HQ5 A;  5J4Y A;  5ILV A;  3W2V A;  2HPM A;  2D2W A;  3BPX A;  2V4J C;  3Q3S A;  4GCV A;  5M5X J;  4DBQ A;  5EEG A;  5IOZ A;  3LOC A;  3BR5 A;  1AWC A;  4L9J A;  3MD2 A;  3BQZ A;  5CJ9 A;  5GTI C;  1JXS A;  3FXQ A;  4AC0 A;  2FQ4 A;  3DP7 A;  1KQ0 A;  3GUD A;  5AON A;  5HS9 A;  4ON0 A;  4ENJ A;  5TRD A;  2R0Q C;  1RI7 A;  1LE8 B;  1NK3 P;  1XCV A;  4BH9 A;  2M4K A;  3N97 A;  4PJN A;  5TJJ A;  2X1C A;  3WGI A;  3CES A;  1GLN A;  3O2P E;  1OYY A;  4M72 A;  2B9S A;  1GV2 A;  3ECO A;  4JBA A;  3EUK L;  4XSZ F;  5HS7 A;  1FOX A;  1P4X A;  2V79 A;  2CV1 A;  3D1N I;  2LD5 A;  2TRT A;  4LK0 F;  3J81 Z;  2W82 A;  3C3W A;  4IVN A;  1ON1 A;  2K86 A;  3PFI A;  3BTJ A;  2ZNZ A;  5K5R A;  5FRM A;  2VXD A;  5BQT A;  5FLX K;  2LG4 A;  1B72 B;  4O6J A;  4JYK A;  4ZDP A;  1QVU A;  3IC7 A;  1AKH A;  1OYW A;  3S14 J;  1R6R A;  3W2A A;  2NYX A;  1PUF A;  2IS2 A;  1YYV A;  4RB3 C;  4XKV A;  3OS0 A;  4XK4 A;  1J75 A;  4XQF A;  1RKW A;  5F6F A;  1IXS B;  1G6N A;  3VPR A;  1W36 D;  4ANJ A;  1JGG A;  1Z0X A;  1R9T J;  4B8X A;  1HKQ A;  3K1N A;  1YX3 A;  2XGC A;  2HKO A;  5CVU A;  4EGZ A;  2DA3 A;  2HPI A;  1LQ1 A;  3ABK H;  1FJL A;  2I5U A;  3DV8 A;  4IO9 F;  3Q5F A;  1TWF J;  2L4M A;  1DU0 A;  3LSM A;  4UV8 A;  3OOU A;  4Y17 A;  1E3O C;  3A01 B;  2VI6 A;  1WJC A;  4S0H B;  2RNG A;  5E3O A;  3LQR A;  2QQB A;  1Q1V A;  5EF6 A;  4XID A;  1F5T A;  3LSJ A;  2KT0 A;  1YOV B;  1HXD A;  2EA4 A;  3CJR B;  1SMT A;  3EUH C;  3T8R A;  3K6G A;  4BS9 A;  1VTN C;  3IH2 A;  2OF7 A;  3IL2 A;  1YLF A;  4ESJ A;  5E8G A;  4IHW A;  4X6A J;  2NNY A;  2M30 A;  2BE5 F;  4UXN A;  2KMU A;  4XOP A;  2ZCW A;  2XB5 A;  1T56 A;  2RV8 A;  1QU3 A;  3LNQ A;  1R4M B;  1H0M A;  4XMY A;  1U3E M;  2KIM A;  3QWL A;  5K5O A;  1S5L C;  2MG4 A;  5F64 A;  1MKM A;  3DF8 A;  1LDK B;  1MBF A;  3ZPL A;  3F8N A;  2Q1Z B;  2IBD A;  4DIQ A;  4E70 A;  4RB1 A;  2B0L A;  4QPO A;  4PSW A;  1E17 A;  3QOD A;  2PN6 A;  1A6Q A;  3CP2 A;  3VSK A;  1BBY A;  2PQ8 A;  3WHB A;  1XGN A;  2DA2 A;  2PMZ A;  3I4M J;  1T8I A;  2UUZ A;  2H8W A;  5KVR A;  3GTO J;  3BTC A;  3F22 A;  5BPI A;  3HOY J;  5L3E A;  3BTI A;  1WWX A;  3I5U A;  2VT3 A;  1T38 A;  2ZSH B;  4PZJ A;  4FE7 A;  2WY7 Q;  3HM5 A;  4IQ4 A;  4E7I A;  4OIN F;  4IRI A;  4XR6 A;  1X2M A;  3F23 A;  1WI9 A;  1OPC A;  2PMU A;  5E8I A;  4YRV A;  2DDB A;  3HSF A;  1J59 A;  2YR2 A;  4ABZ A;  4ESB A;  1G59 A;  2XGE A;  4EAT A;  3JRF A;  3BCB A;  2TDX A;  3SDB A;  1MDM B;  1XG1 A;  3JRH A;  4EV0 A;  4YFX F;  5IT9 K;  2DA4 A;  5A2Q K;  1S7O A;  1R23 A;  4MO7 A;  2BVL A;  2RVC A;  1ZTR A;  2QCO A;  3U21 A;  2RN7 A;  3IHU A;  4I2O A;  1WJF A;  2L9N A;  4MFD A;  3TP3 A;  3ZQG A;  4E6K G;  3GEZ A;  1P7J A;  2M3A A;  2P6S A;  3ABU A;  4I0A A;  4ZYG A;  1U5T A;  4RGS A;  2DPU A;  1FTT A;  2M2E A;  3BPV A;  3RJP A;  2R7U A;  2VJ5 A;  4CXF A;  4LK1 F;  2CUF A;  1I5Z A;  5F0F A;  2NVT J;  2E7X A;  5JHU A;  4H4K C;  3OSG A;  2E5N A;  1FNN A;  4IF4 A;  4ETS A;  3GX4 X;  1B8I B;  2ZNY A;  2WAF A;  1W0U A;  4AM3 A;  3HUG A;  4GO1 A;  1DP7 P;  4M6Y A;  2LP0 A;  3FK6 A;  3TGN A;  2DFI A;  5TIS C;  1X1P A;  1OCO H;  2RQP A;  4IKF A;  2R7D A;  4CYD A;  3CLO A;  1T33 A;  2AXT C;  4UVA A;  4IXA A;  2VJ4 A;  2XB0 X;  3BR1 A;  1SD7 A;  1IDY A;  5BNG A;  4I99 C;  3CQZ J;  5CQE A;  4IQJ A;  4EM0 B;  3CC7 I;  2F4I A;  4KIG A;  3GTQ J;  4F92 B;  3HDD A;  3MKL A;  3M7G A;  1YQA A;  1F43 A;  2JMW A;  3E6B A;  4CYC A;  1FC3 A;  3VYS B;  3SZG A;  3CCS I;  4XLN F;  1STZ A;  1TTY A;  2VJJ A;  3BDD A;  1HLV A;  2XPW A;  2L9R A;  1OQY A;  2EIK H;  1N25 A;  2IA1 A;  3V8L A;  5DUI A;  5DCF A;  3IRQ A;  1B6A A;  2GXB A;  3B02 A;  4D9J A;  3DBL B;  2BW3 A;  5D5W B;  4BXX J;  4MHG A;  4J19 A;  3ABT A;  1GUU A;  1XSV A;  4PJM A;  4Y52 J;  2K5C A;  3OYG A;  2LBF B;  3L2U A;  1YS6 A;  4O3M A;  2OU2 A;  4KIC A;  3MVP A;  1FSE A;  2KPM A;  4XM3 A;  3BZK A;  3WHC A;  1G4D A;  4MEX F;  4Q48 A;  1QVT A;  5M3M J;  3DPU A;  4PUS A;  3FHN A;  3S2D J;  3J7Y J;  4HX8 A;  2Z99 A;  4IHX A;  1POG A;  3S8P A;  3TW7 A;  4BQQ A;  4CCM A;  5EGO A;  1GVJ A;  1MBE A;  4OIP F;  2DJN A;  9ANT A;  4ZYA A;  5LHI A;  1RET A;  1HQC A;  4RGU A;  2MBF A;  5BOX A;  2EFQ A;  2GOX B;  4RMN A;  3A03 A;  3G3Z A;  4I76 A;  4XOT A;  1R1V A;  1AHD P;  1ETK A;  4XN3 A;  2R5Y A;  1A35 A;  5FD6 A;  1Z3X A;  1HOM A;  3I59 A;  1X4O A;  3PSF A;  3WG9 A;  4ESF A;  5L3B A;  1B72 A;  1BA5 A;  1Z67 A;  4O5V A;  3HOS A;  2HEO A;  3SHF A;  2EZL A;  3SFZ A;  1EF4 A;  2QZ8 A;  3O8H A;  4A3G J;  3I58 A;  1R4N B;  1K6Y A;  4IHV A;  2NXN B;  1AOY A;  2IGM A;  3L9F A;  1I27 A;  4R8H A;  2DT6 A;  1B8I A;  5IT3 A;  1LEB A;  2LDU A;  3ELK A;  1Z7L A;  2IS1 A;  3BG5 A;  1FLI A;  3QRF F;  1YRN B;  3R0A A;  3BG3 A;  2HVR A;  4FX4 A;  2L7M P;  2O8X A;  4HEA 2;  5CQG A;  3TL4 X;  1UST A;  2IJL A;  3DCF A;  5D8L B;  2ZJP F;  3EYY A;  3JR9 A;  4FTH A;  2QGU A;  1MND A;  3DU5 A;  3LSI A;  4XRF A;  3WE3 A;  2DFH A;  4A3F J;  4XL9 A;  1BC7 C;  3FMR A;  5D4S A;  3CF2 A;  3P9I A;  2CQQ A;  2KJC A;  3DPT A;  2JA5 J;  1JJ6 C;  1VFC A;  2EIM H;  3E7L A;  3KP4 A;  3DQV C;  4DYQ A;  3HOX J;  2Y0S N;  1BIA A;  2Z33 A;  3OSF A;  1UHW A;  3ML6 A;  3J7A O;  2KL4 A;  3QP5 A;  1HKT A;  1MNE A;  1XCB A;  5EGO B;  2K4B A;  4M6X A;  1PDN C;  3H36 A;  2DW4 A;  3GF2 A;  4IHS A;  3D5R C;  2NVX J;  3A01 A;  4HZF A;  2ZFU A;  1OCR H;  2EIL H;  3DEE A;  1FIP A;  4ZZL A;  1K78 B;  2GIZ A;  5HLH A;  3EYI A;  2MD0 A;  3PNY A;  4LIT A;  4FQG A;  5HVQ C;  2BV6 A;  5LEK A;  3HL2 A;  3OS2 A;  1LVA A;  1SFK A;  3DTK A;  2L54 A;  4HLY A;  2HR3 A;  1HC8 A;  2JT1 A;  2Y48 A;  3L2W A;  2V9K A;  3OYC A;  2E36 A;  1IDZ A;  4BHB A;  4RDU A;  1YIO A;  2R5Y B;  1FYM A;  3JRI A;  2CV2 A;  2ECC A;  5E18 F;  5L3F A;  2L7F P;  1WKM A;  1V3F A;  2R7O A;  1MGT A;  4ENN A;  3P5J A;  3KE2 A;  4LMY A;  3HC7 A;  4GDF A;  2NNN A;  2L02 A;  3P9K A;  2PMH A;  4S04 A;  3BR0 A;  2A6T A;  2M45 A;  1FBS A;  3FDY A;  4FE4 A;  1VQ5 I;  3K10 A;  3F72 A;  4AID A;  1IV6 A;  1S6L A;  3OS1 A;  4DZP A;  2Y0S A;  1KU2 A;  2X6X A;  3MKZ A;  1IRZ A;  2HZT A;  2V6C A;  2X6Y A;  4AVP A;  3M8J A;  2EZI A;  2JN6 A;  5JLX A;  2A07 F;  2E2I J;  2HGC A;  2NVU B;  3ZMS A;  2PLY A;  2DYS H;  3BR6 A;  5ICC A;  1UZC A;  2L5Q A;  3W2W A;  3GLX A;  5ERI A;  1FMV A;  4CDG A;  4BJ6 C;  3H3Z A;  1VZ0 A;  2JA6 J;  3A4C A;  1RC9 A;  3JRD A;  5GAD J;  4LFU A;  3E5U A;  6PAX A;  5FRO A;  4DBR A;  3CUQ C;  3HSR A;  3TED A;  2KQR A;  1ZRD A;  2YU9 J;  3KP5 A;  3QYE A;  4XSX F;  2XPU A;  3H3U A;  3JRA A;  2X9D A;  1MMG A;  1B9M A;  1IG7 A;  1SFU A;  1G2H A;  5HS8 A;  5FLX Z;  1GDT A;  1W36 C;  2R7T A;  2ME0 A;  3L2R A;  1WSU A;  4F55 A;  4OMZ A;  1MMA A;  5FKO A;  3CZ6 A;  2R7X A;  3E97 A;  3CDI A;  4M3E A;  3G6E I;  2GOM A;  1P4W A;  4YEJ A;  3KX2 A;  3GZ5 A;  4II3 A;  2H6B A;  4K2E A;  2Z3Y A;  5B1B H;  3KCC A;  1L0O C;  4YII A;  1TW3 A;  2O61 A;  3KZZ A;  4KMU X;  3R4K A;  4Y13 A;  3H92 A;  4L5I A;  2V26 A;  3W6V A;  1SD6 A;  2EBI A;  2ACJ A;  2XHK A;  3NRV A;  3CO6 C;  1H9G A;  4Q4Z F;  1KYW A;  1QO0 D;  3K4C A;  3T1B A;  2XDV A;  1RES A;  3FXL A;  3CCV I;  3HGY A;  3VOE A;  3VSL A;  1VQO I;  5L3G A;  2QQ8 A;  3K4K A;  1YRN A;  2GA1 A;  1FSH A;  4P9F A;  2WAD A;  3IWF A;  4M6V A;  1IN4 A;  5IPA A;  1ZK8 A;  2KP6 A;  1YJN I;  2B63 J;  4BJT A;  2KZV A;  4L9V A;  2DAO A;  5FJ8 J;  3F8F A;  4F3Q A;  3HSE A;  4NB5 A;  2MLK A;  2ZKZ A;  2UXX A;  3E5Q A;  3CC2 I;  1IV8 A;  1Q1H A;  3GTK J;  3BZ6 A;  3GLL A;  5K7Z A;  2CUZ A;  2MAB A;  2EWN A;  1ETV A;  3U2R A;  2K27 A;  5B5E C;  4BQN A;  5GPA A;  3ZQI A;  1IF1 A;  4EEF G;  3LL7 A;  4A12 A;  2STW A;  4E7S A;  2HU9 A;  1Z21 A;  2K9L A;  5BS6 A;  2GQQ A;  1IO2 A;  1HKS A;  4P1W A;  1LJ9 A;  2XF7 A;  1WJA A;  3OYH A;  4CZZ A;  4A93 J;  4HSR A;  1VQK I;  1E2X A;  3CUQ A;  1BM9 A;  4PFP A;  3H9Q A;  1QPI A;  2VOP A;  3VYU B;  3ERE D;  3ONQ A;  4G7O F;  3UNG C;  1B59 A;  3HTS B;  1NHA A;  3GYH X;  2M4G A;  2BW3 B;  2LRD A;  3OY9 A;  5BPD A;  5D6F A;  2QVO A;  4L5J A;  1W4M A;  1QZY A;  2DQR A;  2MYS A;  4JK1 X;  3CCQ I;  3QU3 A;  3FBN B;  3S1N J;  1O3R A;  3DKY A;  4BAC A;  1W7P D;  5EEH A;  4GGG A;  3VDX A;  4NC6 A;  2VBY A;  3IKT A;  1FX7 A;  2F2E A;  2WC2 A;  3BJA A;  2X48 A;  4GRI A;  1IZ1 A;  2BYV E;  3GFI A;  1MSF C;  3FZV A;  1JUM A;  3JRC A;  2D5V A;  2XKP A;  1TQM A;  2W1O A;  1REP C;  3KP6 A;  2EFO A;  4GYG A;  3I9V 2;  2XAJ A;  2Y2Z A;  2BOL A;  1U2W A;  2V1D A;  1MW7 A;  4JP0 A;  3X2Q H;  2DTZ A;  2JRM A;  2R7Z J;  4WCG A;  2W00 A;  3ZMV A;  1TWH J;  3SQN A;  2JVG A;  3E6M A;  4M9S A;  4V2G A;  1WHU A;  3RTR A;  1EV7 A;  4GFB A;  3HPH A;  5IP6 A;  5D4R A;  5E79 C;  2CW7 A;  4OIO F;  5JVT A;  2PMZ N;  2F5F A;  1TWG J;  1K7A A;  1OJL A;  3LSG A;  4D0P A;  1WH7 A;  2HXI A;  1P9Q C;  4EQQ A;  1ODD A;  2R7V A;  2EFP A;  3HRT A;  4FIS A;  5GPC A;  4JX5 A;  1R1T A;  3ABL H;  3KLN A;  1LE8 A;  2ZXH A;  5C4J J;  2ZC2 A;  4NBQ A;  4NUB A;  2PFB A;  3T8T A;  4IZZ A;  1LFU P;  3CC4 I;  2FMY A;  3F8C A;  2F5V A;  3F0C A;  2QLZ A;  3FHZ A;  1ZEL A;  2DU9 A;  2L01 A;  3MKY B;  5DCM B;  2JPC A;  2P5V A;  5K1Y A;  4BNC A;  2IXS A;  1ZLK A;  4RM2 A;  2LYC A;  3RQ4 A;  1P6R A;  4EMS A;  4FT8 A;  4BXF A;  1JI8 A;  4RB2 C;  1SFE A;  3MCZ A;  1QZZ A;  1XC5 A;  3F6V A;  3VOD A;  3ZMZ A;  1MH4 A;  4KT6 A;  4PJ0 C;  2IS6 A;  4C3H J;  4M3B A;  2V6E A;  3BG6 A;  2O03 A;  2QKM B;  3HOU J;  2DA6 A;  2E2J J;  2A6H F;  4J00 A;  2IGN A;  4LLL A;  3M3Y J;  2O6G E;  5FKM A;  3JTG A;  4HRI A;  4H0E A;  2M9H A;  4BE1 A;  1EH7 A;  1HF0 A;  4U0V A;  5C44 J;  2A68 F;  5CVV A;  4CGZ A;  4RLF A;  2H27 A;  3VFZ A;  3E1S A;  4CCO A;  1G3S A;  1Y56 A;  2C6Y A;  2QM3 A;  3REO A;  3WTS C;  4LB5 A;  2W24 A;  2BY2 A;  4XN0 A;  5LHG A;  2G9W A;  4PFO A;  2A61 A;  4CO8 A;  2IA0 A;  1UMQ A;  2JZY A;  2Z16 A;  3L2C A;  3WTY C;  3OIP A;  3E0J B;  1XDS A;  4A5N A;  1ZN2 A;  2CQ7 A;  3A02 A;  1MBG A;  1Z7U A;  3WU1 B;  2LTP A;  4KA4 A;  2UXN A;  3BR2 A;  1OFC X;  3Q9V A;  5HNF A;  1F36 A;  4A69 C;  1J2X A;  2VKD A;  2NVQ J;  2A6E F;  4A5M A;  1SFO J;  2MLG A;  4BJ5 C;  1FMW A;  3I55 I;  1XX5 A;  4PGH A;  4RAG A;  2R92 J;  1TBX A;  4RB0 A;  1E0E A;  4HYE A;  4HBL A;  5GAE J;  1QQI A;  4CIC A;  5A2Q Z;  3MWM A;  2F6C A;  2HOS A;  3G2B A;  3GCM A;  1S7E A;  2FF4 A;  1TW2 A;  2KZG A;  4I0B A;  1YJW I;  2HWV A;  4N4O B;  2X1E A;  2JUG A;  3RKQ A;  2ELH A;  5B3S H;  2IT0 A;  4HNV A;  3S3M A;  1X1C A;  3ZQ7 A;  4YFK F;  4A3C J;  5ED4 A;  4X0G A;  1X3W B;  3PQJ A;  1U8B A;  5LD2 C;  4G7Z F;  5M5Y J;  2ZXJ A;  3C7J A;  3IKV A;  1IN6 A;  4EM1 A;  3FXJ A;  2PEX A;  4ZTF A;  2A3S A;  4BL0 B;  1F1Z A;  1MMN A;  2FOW A;  4ASN A;  1WCM J;  3LSR A;  2GXG A;  5FLV A;  2P5K A;  4ZDO A;  3IAS 2;  2HOT A;  4XON A;  3KYC B;  2WV1 A;  4P55 A;  2EJR A;  3Q0W A;  1IN8 A;  4I7H A;  3GTM J;  1WRJ A;  3NEU A;  1BJZ A;  5JR3 A;  1LFP A;  3O8G A;  4XLC A;  3JTH A;  3OOP A;  1ZRC A;  2KIU A;  1KYZ A;  3OYD A;  1PVE A;  2VT2 A;  3G1L A;  4A0Y A;  3T5X A;  3AAF A;  2DO7 A;  1PUE E;  1Y1V J;  2CW0 F;  5EEA A;  4D1Q A;  4GXO A;  3FXR A;  3WGH A;  3FIW A;  2BBY A;  4WXH A;  1N78 A;  5B66 C;  1IUF A;  4B4C A;  4G12 A;  2X0L A;  2ID3 A;  1ERD A;  2DQL A;  2LLK A;  2WAQ A;  4RLQ A;  3U1K A;  4OMY A;  3I54 A;  2LRE A;  4HDV A;  2HYG D;  4OIQ F;  3NAU A;  3CJQ B;  3JRB A;  5LGN A;  3G71 I;  3I64 A;  4RGR A;  4BYY A;  2ESN A;  2VPL A;  2R7W A;  1LPQ A;  3ZMD A;  3FIS A;  4FET A;  2M87 A;  5E3M A;  2DA7 A;  1MJA A;  3EPZ A;  1L3L A;  2YS9 A;  3L2V A;  2YPR A;  2LF8 A;  3GME A;  4WXC A;  4XLF A;  4XBF A;  4A2U A;  1G3T A;  3OMY A;  4PSX A;  1XMX A;  1QBJ A;  2LMD A;  1RNL A;  2XKO A;  5H6R A;  3HOV J;  3KYD B;  2XAU A;  2DTR A;  1ORK A;  2O5R A;  1K6O A;  2D1H A;  2JVH A;  2LFB A;  3KP7 A;  2OTJ I;  5LGU A;  3PJR A;  1J5Y A;  2CU7 A;  4B1R A;  4A3K J;  2ADU A;  2P7C B;  5IP9 J;  2PJP A;  4JX4 A;  2HYF A;  2QA4 I;  5CYV A;  3CCL I;  3QQA A;  4BHP A;  1LEA A;  1UEL B;  2K7L A;  4KYW A;  1Z6T A;  3TP0 A;  4CCK A;  1VQ9 I;  1TL8 A;  3WTX C;  3J81 K;  4WXD A;  3PL8 A;  4C30 A;  1MSE C;  4HDU A;  4XLA A;  3TOA A;  1D0X A;  1KQ8 A;  2DMQ A;  5D5V B;  3VYT B;  3LAJ A;  2H6C A;  1TC3 C;  1U6G A;  3DTI A;  1GXQ A;  2WA0 A;  1MMS A;  3TOB A;  4MEY F;  1WGX A;  2ISY A;  4YIR X;  2RRE A;  1S3J A;  1P92 A;  3SEZ A;  1MD0 A;  2AS5 F;  1ZRE A;  2OZ6 A;  4P5O A;  2QF7 A;  3V7R A;  1TQP A;  3MAJ A;  5DV5 A;  1Z3Y A;  2EK5 A;  1XB4 A;  3HHH A;  1UHS A;  3SFI A;  2CGP A;  5HDK A;  2RGV A;  3S3N A;  2E35 A;  1RUN A;  4I6Z A;  2O0Y A;  3Q0U A;  3L09 A;  4IJA A;  4NC7 A;  3BCA A;  4A3L J;  1ZG3 A;  5HLI A;  3JSP A;  4CHU A;  4ZH4 F;  4C2T A;  4E7L A;  2KRC A;  3CF5 F;  3PIP F;  2ECB A;  3HYI A;  2EV6 A;  1RRJ A;  2H8R A;  2MC3 A;  2ZSI B;  3KP2 A;  5BMZ A;  2Z1D A;  2DMN A;  2HI3 A;  3TO7 A;  3DU6 A;  3WG7 H;  1J9I A;  2DI3 A;  1A36 A;  5LHH A;  2XRO A;  1M1E B;  2BHY A;  1T0F A;  1APL C;  1X1A A;  4OAY A;  1Z6R A;  3QPH A;  4XLH A;  4AUX A;  1ENH A;  1E3H A;  2E34 A;  5JVG F;  5H20 A;  3SDG A;  1ZGW A;  1O3T A;  1K78 A;  2O3F A;  3MZH A;  3W6J B;  2DK5 A;  4LLG F;  1YX5 A;  2JJ7 A;  4MGR A;  4V2F A;  2LKX A;  4M9X A;  3CO7 C;  2QQA A;  3K69 A;  4Y15 A;  3HGG A;  2CH0 A;  3OL3 A;  1FYK A;  3HKZ A;  1ITY A;  1D1C A;  1SFX A;  3F8B A;  1R71 A;  3FXK A;  1SVO A;  5D8K B;  5H2F C;  1Y1W J;  3RKY A;  2LNB A;  4L0Z B;  2COB A;  2IVM A;  5H6Q A;  4KMF A;  2MFZ A;  3OYE A;  2KJB A;  2R4G A;  3H9G A;  1PJR A;  3CCJ I;  4XRS A;  3IH3 A;  2XAS A;  1A5J A;  3NWT A;  3FXU A;  2FBH A;  2A5W A;  1JTX A;  2F4M B;  2HS5 A;  5J8C A;  4HV5 A;  1JHH A;  4IOA F;  4XOR A;  3FBI B;  3GXO A;  4HX4 A;  1IRX A;  2F4O B;  4IPA A;  3PUF A;  1PUF B;  4V19 K;  2OUM A;  2VL8 A;  3SJM A;  4JX6 A;  1UHM A;  3RKX A;  4WK8 F; 
#chains in the Genus database with same CATH homology
 3TO9 A;  4UHT A;  4MTE A;  4EJW A;  2VBZ A;  2XV4 S;  1R58 A;  3QP6 A;  1IN5 A;  1IAW A;  4OU0 A;  2DT5 A;  4I98 B;  4AIH A;  1ZGJ A;  4FX0 A;  3WGG A;  1P4A A;  1ULY A;  5HDN A;  1GHC A;  2MA3 A;  2VN2 A;  2FOK A;  2FBI A;  3DPL C;  1RUO A;  3RPU A;  2VE8 A;  1IXC A;  5FFX A;  4ENM A;  5ILU A;  1W7P A;  2JSC A;  1BI0 A;  4EJV A;  2QEN A;  4I09 A;  1MZB A;  2VC0 A;  2WWY A;  4BQA A;  2CO5 A;  4TV7 A;  1TQI A;  2A5Y B;  3EET A;  3I4P A;  3W6K B;  4ENK A;  1XSD A;  4WWC A;  1LNW A;  4M71 A;  4U7B A;  3WE2 A;  5LEJ A;  3IWZ A;  5DUK A;  4LB6 B;  4HLX A;  4LJZ F;  3ZN1 A;  4WX9 A;  2E1C A;  4N9I A;  1JE8 A;  1PP8 F;  3D5L A;  1SAX A;  3TDZ C;  4QLC U;  2YU3 A;  2XGX A;  4L9N A;  1YFH A;  3HTU A;  2E7W A;  3V4G A;  3FX3 A;  1IXR C;  3MZY A;  2XAF A;  1T2K A;  5LRR A;  4A0Z A;  3ZN0 A;  3ZMU A;  2PG4 A;  4KFC A;  1BOA A;  4EJU A;  1YW9 A;  3K0L A;  1O3S A;  2EFW A;  2OAZ A;  1H9T A;  2W85 A;  2CSO A;  2FNP A;  2VOD A;  2X4H A;  1RZ4 A;  5LGT A;  1UB9 A;  2STT A;  1PP7 U;  5E1X A;  1XGM A;  1YO5 C;  1UCR A;  3TQN A;  2KIF A;  3JW4 A;  1DPR A;  1G3W A;  5J6X A;  2FEZ A;  1SD5 A;  3R61 A;  4LG0 A;  3E6C C;  3GFL A;  4HAM A;  4HF2 A;  2JRT A;  2GA2 A;  1F4K A;  2K02 A;  1ZAR A;  2Y0M A;  3WTU C;  4UNO A;  3QU6 A;  3WTT C;  1HW5 A;  2ZBK A;  3ROU A;  5D5X B;  4BXU A;  3FM5 A;  2FSW A;  4A0X A;  2QBY A;  5DEQ A;  5AIQ A;  4AIJ A;  4BHC A;  3G73 A;  1W5S A;  2EA2 A;  1BJA A;  1UFM A;  3DEU A;  2L4A A;  2XAQ A;  4EVI A;  2R7F A;  2MH2 A;  1YW7 A;  5LLQ A;  3O3K A;  2WTE A;  2HTJ A;  3LA2 A;  3HHG A;  4N0B A;  3MEX A;  2W84 A;  1C0W A;  3LWF A;  3DKW A;  2H94 A;  5K5Q A;  1OMI A;  5CVJ A;  2BEO A;  4L9T A;  4FHT A;  4WF2 A;  3COA C;  4YFN F;  2FE3 A;  4AWX B;  5DCM A;  2ZME A;  2NAZ A;  3LST A;  2IW5 A;  1HW1 A;  4RGX A;  3ECH A;  2Z5U A;  2BGC A;  1OYI A;  1S29 A;  1YG2 A;  2FNA A;  4G7H F;  1R5H A;  5FB2 A;  2QQ9 A;  2PBI A;  5IT9 Z;  5KK1 A;  1GXP A;  2W25 A;  1XMK A;  2G7H A;  3K1P A;  4U7D A;  1FPQ A;  1W5T A;  1IW7 F;  2FA5 A;  3KLO A;  2CFX A;  3RIR A;  1FOK A;  2FRH A;  2RC4 A;  1ZG1 A;  2HDC A;  1O7F A;  4G9Y A;  3GW2 A;  3HOT A;  1D3Y A;  1IUY A;  2YSR A;  4IRH A;  1J0R A;  2Q0O A;  3CUO A;  1I6X A;  3LA7 A;  2VOO A;  1JHF A;  1KA8 A;  2OQR A;  2J5P A;  4EGY A;  4ZYE A;  3EQL F;  2LF7 A;  1IN7 A;  1D8J A;  1ZGA A;  1U8R A;  1ON2 A;  2MD5 A;  3BY6 A;  4HF1 A;  1IRG A;  3F3X A;  2IP2 A;  4G6Q A;  3CJN A;  1HBX G;  3F21 A;  2V1U A;  2W57 A;  1X3U A;  1BC8 C;  4NHJ A;  4RAZ A;  1LB2 A;  3FM3 A;  2WV0 A;  2Q2E A;  1USS A;  2DLL A;  4R79 A;  1XN7 A;  4U0Y A;  1BI3 A;  2HKX A;  5E1Z B;  3WU0 A;  2Z9O A;  3LAP A;  4HQE A;  3KZY A;  4R1H A;  2LSO A;  2ESH A;  1KU9 A;  5HLG A;  4MQ9 F;  2Q8K A;  5AIP A;  3FMS A;  1S7A A;  3C18 A;  4OIR F;  2XUB A;  2IRF G;  5JI6 A;  5LBQ A;  4DNC A;  1R7J A;  4MQV A;  4MTD A;  4Q47 A;  2ETH A;  2EB7 A;  2XVC A;  3GFM A;  3V7S A;  5DDG A;  2CQK A;  4QWQ A;  1WQ2 A;  2HTS A;  1U5T B;  4KN4 X;  1BN5 A;  1ZH5 A;  2VXZ A;  2QBY B;  2AXL A;  2DBB A;  3F6O A;  5CVR A;  4L18 B;  2IPQ X;  2YX7 A;  3Q9S A;  2H09 A;  1O57 A;  4IHT A;  3GO5 A;  3M9A A;  4UVB A;  4ZZD A;  2QWW A;  1Z1D A;  3NQO A;  1BI2 A;  1CF7 B;  3CUQ B;  2VBW A;  1YTY A;  2QYO A;  3KEQ A;  4I02 A;  1LDJ A;  1MJB A;  1O3Q A;  4LGW A;  3HIF A;  2JPB A;  3R6S A;  2M8E A;  4PDK A;  1ONV A;  1HSJ A;  3F8M A;  2ZO4 A;  1R5G A;  1XGS A;  2RNJ A;  5L3D A;  3GZ6 A;  1QNT A;  2GWR A;  2P5L C;  3DFG A;  4AIK A;  1T98 A;  2LKP A;  4HF0 A;  2JTV A;  3D0S A;  1Z91 A;  3MFK A;  5JFR A;  4F7Z A;  4HW0 A;  1R36 A;  3U1D A;  2DPD A;  3QAH A;  3E6D A;  2F5D A;  3I59 B;  3RI4 A;  4HX7 A;  3OV8 A;  3IRR A;  3CTA A;  5J8F A;  4KIF A;  2J5O A;  3SZT A;  1R00 A;  3TKY A;  4Q5S F;  5E20 A;  3BRO A;  3P9C A;  1FYL A;  2M1B A;  1ZLJ A;  3ZMT A;  2P4W A;  3JAM K;  4G94 A;  4U0W A;  3WTW C;  2QUF A;  1D5V A;  1DPU A;  5F1R A;  2CWE A;  1G3Y A;  3KEO A;  1CF7 A;  5CVI A;  2L3D A;  2OA4 A;  1BI1 A;  3CDH A;  5ICE A;  3E3V A;  1MJ9 A;  3I0T A;  2XAH A;  2FXA A;  3S2W A;  3L7W A;  2HOE A;  4DQ2 A;  4EJT A;  3RKW A;  4HQM A;  3ULQ B;  3J80 K;  1OKR A;  5FGM A;  3GVA A;  2PI0 A;  4U88 A;  2ISZ A;  4B09 A;  2IA2 A;  2D45 A;  2FQ3 A;  1DUX C;  3M8F A;  2M5W A;  3V8K A;  2ZFW A;  3R0J A;  4AD9 A;  4A6E A;  3BWG A;  3C1D A;  1KGS A;  5HDG A;  1FZP B;  4PCQ A;  4P9U A;  1HW2 A;  4XLP F;  4RAY A;  1TNS A;  1JGS A;  3GFJ A;  3SXY A;  1U5T C;  4KIB A;  3PQK A;  3P7N A;  4Z2Y A;  4I01 A;  1Z9C A;  1J7K A;  2KRF A;  1Y0U A;  2DK8 A;  1QPM A;  1B4A A;  2V9V A;  2VC1 A;  3EDP A;  5D6E A;  2RDP A;  3N4M A;  1FBQ A;  2VON A;  1R22 A;  5D5U B;  4UUV A;  1Z05 A;  2UZK A;  3RYR A;  1V4R A;  4G8X A;  3QPT A;  3U9G A;  3VB2 A;  1KU7 A;  3TO6 A;  4KNY A;  2EV5 A;  4LG0 B;  2R3S A;  1YS7 A;  4EM2 A;  1B9N A;  3MQ0 A;  3V7C A;  2HQN A;  5CLS A;  1MDM A;  1YW8 A;  2EV0 A;  2ZJ2 A;  1RIO H;  4ZYH A;  1BIB A;  1I1S A;  1ZG5 A;  3QOP A;  1KQ9 A;  3EUH A;  1FT9 A;  3V8J A;  1A04 A;  1XSX A;  5ICF A;  3RPQ A;  3FMQ A;  4MNU A;  4NQW A;  2OQG A;  2GZW A;  1TLH B;  3VEP A;  3HRS A;  3KET A;  4YG2 F;  2F5E A;  3DXJ F;  1SMY F;  2UWM A;  2F5C A;  3TDU C;  1FWZ A;  2HQR A;  1EH6 A;  2GIV A;  4UV9 A;  1LDD A;  2OD5 A;  4P96 A;  5DD8 A;  1R1U A;  2OZU A;  4M74 A;  5E17 F;  2P6T A;  2HFH A;  3FF5 A;  3I53 A;  2V1X A;  3K9T A;  4KT5 C;  4ZYD A;  3WTV C;  2XIG A;  3KP3 A;  3K2Z A;  1SD4 A;  1ZYR F;  4EJO A;  3O6B B;  5FO5 A;  4G6D A;  3JSO A;  4HOB A;  5FFZ A;  1DDN A;  1B1B A;  5LRS A;  5HOO A;  1FY7 A;  1CGP A;  1S8N A;  4HA8 A;  4JQF A;  2P8T A;  3ZP5 A;  4IRG A;  1XDU A;  3M1E A;  3HRU A;  4M9Z A;  1K79 A;  1I1G A;  2XRN A;  1XMA A;  2CG4 A;  3BJ6 A;  1XD7 A;  3SZP A;  3R60 A;  1ZHF A;  4L0Y B;  4LD5 A;  2EFN A;  2YX4 A;  2FML A;  3I71 A;  2G7U A;  2VBX A;  2FU4 A;  4BAY A;  2E1N A;  2NRA C;  3LA3 A;  1FBU A;  1QGP A;  5ILS A;  3KFW X;  3J80 Z;  5ICG A;  4A6D A;  4N9H A;  3GWZ A;  3M8E A;  3WOD F;  4S05 A;  3HRM A;  2GAU A;  3L00 A;  4HV6 A;  2XAG A;  1D8K A;  1KU3 A;  2COM A;  2VE9 A;  1TNT A;  3RDI A;  3LQQ A;  1XGO A;  2KKO A;  1O7L A;  2D1V A;  2RKH A;  2FBK A;  4M73 A;  3BP8 A;  4KDP A;  3JAM Z;  5DD4 A;  5E1W A;  4KN7 X;  1FP1 D;  3BOQ A;  1ZAO A;  4LLN A;  1HST A;  2A69 F;  1U78 A;  3RYP A;  4UVC A;  2MH9 A;  4RS8 A;  3K1M A;  3WTZ A;  3T0Y A;  5L3C A;  3B73 A;  4KUM A;  1P2F A;  1EH8 A;  3E5X A;  1W7P B;  4YIF A;  3ISP A;  5FD5 A;  1OR7 A;  2NS0 A;  2Y75 A;  4OOI A;  3BJO A;  4GYI A;  1ZRF A;  2OBP A;  3FWE A;  1FP2 A;  3LFK A;  2K4J A;  2ZME B;  1IRF A;  2P7V B;  1F9N A;  5DYM A;  2CYY A;  1T6S A;  1T39 A;  4PGG A;  5ILV A;  2D2W A;  3BPX A;  4GCV A;  5EEG A;  1AWC A;  4L9J A;  5CJ9 A;  1JXS A;  3FXQ A;  3DP7 A;  3GUD A;  1KQ0 A;  5AON A;  5TRD A;  5HS9 A;  4ON0 A;  4ENJ A;  1RI7 A;  1XCV A;  4BH9 A;  3N97 A;  5TJJ A;  3WGI A;  3O2P E;  1OYY A;  4M72 A;  3ECO A;  4JBA A;  4XSZ F;  5HS7 A;  1P4X A;  2V79 A;  4LK0 F;  3J81 Z;  4IVN A;  3C3W A;  1ON1 A;  2K86 A;  3PFI A;  2ZNZ A;  5K5R A;  5BQT A;  5FLX K;  4O6J A;  3IC7 A;  1OYW A;  2NYX A;  1YYV A;  4RB3 C;  1J75 A;  5F6F A;  1IXS B;  1G6N A;  4B8X A;  1HKQ A;  3K1N A;  2HKO A;  5CVU A;  4EGZ A;  1LQ1 A;  3DV8 A;  3Q5F A;  2L4M A;  4UV8 A;  4Y17 A;  3LQR A;  2QQB A;  1F5T A;  1HXD A;  2EA4 A;  1SMT A;  3T8R A;  1VTN C;  3IL2 A;  1YLF A;  4ESJ A;  5E8G A;  2NNY A;  2M30 A;  2BE5 F;  4UXN A;  2ZCW A;  2RV8 A;  1H0M A;  1U3E M;  2KIM A;  5K5O A;  5F64 A;  1MKM A;  3DF8 A;  1LDK B;  3ZPL A;  3F8N A;  4E70 A;  4RB1 A;  2B0L A;  1E17 A;  2PN6 A;  1BBY A;  2PQ8 A;  1XGN A;  5KVR A;  3F22 A;  5BPI A;  5L3E A;  1WWX A;  3I5U A;  2VT3 A;  1T38 A;  4PZJ A;  4OIN F;  4IRI A;  3F23 A;  1WI9 A;  1OPC A;  2PMU A;  5E8I A;  3HSF A;  1J59 A;  2YR2 A;  4ESB A;  2TDX A;  1MDM B;  4EV0 A;  4YFX F;  5IT9 K;  5A2Q K;  1S7O A;  1R23 A;  2RVC A;  4I2O A;  2RN7 A;  3IHU A;  3GEZ A;  2P6S A;  3ABU A;  4I0A A;  4ZYG A;  1U5T A;  4RGS A;  2DPU A;  3BPV A;  3RJP A;  4CXF A;  4LK1 F;  1I5Z A;  2E7X A;  5JHU A;  1FNN A;  4IF4 A;  4ETS A;  3GX4 X;  2ZNY A;  3HUG A;  4GO1 A;  1DP7 P;  4M6Y A;  3TGN A;  2DFI A;  2RQP A;  2R7D A;  4CYD A;  3CLO A;  4UVA A;  4IXA A;  1SD7 A;  4EM0 B;  4KIG A;  3M7G A;  1YQA A;  3E6B A;  1FC3 A;  4XLN F;  1STZ A;  1TTY A;  3BDD A;  5DUI A;  2IA1 A;  3V8L A;  3IRQ A;  5DCF A;  1B6A A;  2GXB A;  3B02 A;  5D5W B;  4MHG A;  3ABT A;  1XSV A;  1YS6 A;  4O3M A;  2OU2 A;  4KIC A;  1FSE A;  1G4D A;  4MEX F;  4Q48 A;  4HX8 A;  2Z99 A;  1GVJ A;  4OIP F;  5LHI A;  1HQC A;  4RGU A;  2MBF A;  5BOX A;  2EFQ A;  3G3Z A;  1R1V A;  5FD6 A;  3I59 A;  5L3B A;  4ESF A;  3WG9 A;  4O5V A;  3HOS A;  2HEO A;  3SHF A;  3SFZ A;  2QZ8 A;  3I58 A;  1AOY A;  3L9F A;  1I27 A;  4R8H A;  5IT3 A;  1LEB A;  2LDU A;  3ELK A;  1FLI A;  3QRF F;  3R0A A;  4FX4 A;  2O8X A;  1UST A;  2IJL A;  5D8L B;  3EYY A;  4XRF A;  3WE3 A;  1BC7 C;  3FMR A;  5D4S A;  3P9I A;  2KJC A;  3DPT A;  3KP4 A;  3DQV C;  1BIA A;  2Z33 A;  1UHW A;  3ML6 A;  3J7A O;  3QP5 A;  1HKT A;  1XCB A;  2K4B A;  4M6X A;  1PDN C;  2DW4 A;  3GF2 A;  4IHS A;  4HZF A;  4ZZL A;  1K78 B;  5HLH A;  3EYI A;  5HVQ C;  2BV6 A;  5LEK A;  1LVA A;  2L54 A;  4HLY A;  2HR3 A;  2JT1 A;  2Y48 A;  4BHB A;  1YIO A;  1FYM A;  5E18 F;  5L3F A;  1WKM A;  1V3F A;  1MGT A;  4ENN A;  3KE2 A;  4LMY A;  2NNN A;  2L02 A;  3P9K A;  2PMH A;  4S04 A;  2M45 A;  1FBS A;  3F72 A;  1S6L A;  1KU2 A;  2HZT A;  2V6C A;  4AVP A;  2A07 F;  2HGC A;  3ZMS A;  2PLY A;  5ICC A;  3GLX A;  5ERI A;  4CDG A;  3H3Z A;  4LFU A;  3E5U A;  6PAX A;  3CUQ C;  3HSR A;  1ZRD A;  3KP5 A;  4XSX F;  3H3U A;  1B9M A;  1SFU A;  5HS8 A;  5FLX Z;  1WSU A;  4OMZ A;  3E97 A;  1P4W A;  3GZ5 A;  2H6B A;  4K2E A;  2Z3Y A;  4YII A;  3KCC A;  1L0O C;  1TW3 A;  2O61 A;  3KZZ A;  4KMU X;  3R4K A;  4Y13 A;  3H92 A;  4L5I A;  1SD6 A;  2ACJ A;  2XHK A;  3NRV A;  3CO6 C;  1H9G A;  4Q4Z F;  1KYW A;  1QO0 D;  3T1B A;  3VOE A;  5L3G A;  2GA1 A;  1FSH A;  4P9F A;  3IWF A;  1IN4 A;  4L9V A;  2DAO A;  3F8F A;  3HSE A;  4NB5 A;  2MLK A;  2ZKZ A;  2UXX A;  3E5Q A;  1Q1H A;  3BZ6 A;  2EWN A;  3U2R A;  2K27 A;  1IF1 A;  4A12 A;  2STW A;  5BS6 A;  2GQQ A;  1HKS A;  1LJ9 A;  4CZZ A;  1E2X A;  3CUQ A;  1BM9 A;  2VOP A;  3ERE D;  4G7O F;  1B59 A;  3HTS B;  1NHA A;  3GYH X;  5BPD A;  5D6F A;  2QVO A;  4L5J A;  1W4M A;  1QZY A;  2DQR A;  4JK1 X;  3QU3 A;  1O3R A;  1W7P D;  5EEH A;  4GGG A;  2VBY A;  3IKT A;  1FX7 A;  2F2E A;  2WC2 A;  3BJA A;  1IZ1 A;  2BYV E;  3GFI A;  3FZV A;  2XKP A;  1TQM A;  1REP C;  3KP6 A;  2EFO A;  4GYG A;  2XAJ A;  1U2W A;  2V1D A;  4WCG A;  3ZMV A;  3SQN A;  3E6M A;  4M9S A;  3RTR A;  1EV7 A;  5D4R A;  4OIO F;  5JVT A;  2F5F A;  1K7A A;  4D0P A;  4EQQ A;  1ODD A;  2EFP A;  3HRT A;  1R1T A;  3KLN A;  2PFB A;  3T8T A;  2FMY A;  3F8C A;  2QLZ A;  3FHZ A;  2L01 A;  2DU9 A;  5DCM B;  5K1Y A;  2JPC A;  2P5V A;  4BNC A;  1ZLK A;  1P6R A;  4EMS A;  4FT8 A;  4RB2 C;  1SFE A;  3MCZ A;  1QZZ A;  3F6V A;  3VOD A;  3ZMZ A;  2O03 A;  2A6H F;  4LLL A;  2O6G E;  3JTG A;  4H0E A;  1EH7 A;  4U0V A;  4CGZ A;  2A68 F;  5CVV A;  2H27 A;  3VFZ A;  1G3S A;  2C6Y A;  2QM3 A;  3REO A;  3WTS C;  4LB5 A;  2W24 A;  5LHG A;  2G9W A;  2A61 A;  4CO8 A;  2IA0 A;  2JZY A;  3L2C A;  3WTY C;  1XDS A;  4A5N A;  1ZN2 A;  1Z7U A;  3WU1 B;  4KA4 A;  2UXN A;  3Q9V A;  1J2X A;  2A6E F;  4A5M A;  2MLG A;  4PGH A;  1TBX A;  4RB0 A;  4HYE A;  4HBL A;  1QQI A;  4CIC A;  5A2Q Z;  3MWM A;  2FF4 A;  1TW2 A;  4I0B A;  2HWV A;  2ELH A;  2IT0 A;  3ZQ7 A;  4YFK F;  5ED4 A;  3PQJ A;  4G7Z F;  2ZXJ A;  3C7J A;  3IKV A;  1IN6 A;  4EM1 A;  2PEX A;  2A3S A;  1F1Z A;  4ASN A;  2GXG A;  2P5K A;  4P55 A;  2EJR A;  1IN8 A;  4I7H A;  1WRJ A;  3NEU A;  5JR3 A;  3JTH A;  3OOP A;  1ZRC A;  2KIU A;  1KYZ A;  2VT2 A;  3AAF A;  4A0Y A;  3T5X A;  2DO7 A;  1PUE E;  2CW0 F;  4GXO A;  3FXR A;  3WGH A;  2BBY A;  4WXH A;  2X0L A;  2DQL A;  4OMY A;  3I54 A;  4HDV A;  2HYG D;  4OIQ F;  5LGN A;  3I64 A;  4RGR A;  4BYY A;  2ESN A;  3ZMD A;  2M87 A;  1MJA A;  1L3L A;  2YPR A;  2LF8 A;  4WXC A;  4XBF A;  4A2U A;  1G3T A;  1QBJ A;  1RNL A;  2XKO A;  5H6R A;  2DTR A;  1K6O A;  2D1H A;  3KP7 A;  5LGU A;  1J5Y A;  2ADU A;  2P7C B;  2PJP A;  2HYF A;  5CYV A;  4BHP A;  1LEA A;  2K7L A;  4KYW A;  1Z6T A;  3WTX C;  3J81 K;  4WXD A;  4HDU A;  3TOA A;  1KQ8 A;  5D5V B;  3LAJ A;  2H6C A;  1U6G A;  1GXQ A;  3TOB A;  4MEY F;  2ISY A;  1S3J A;  1P92 A;  1MD0 A;  2AS5 F;  1ZRE A;  2OZ6 A;  4P5O A;  3V7R A;  1TQP A;  3MAJ A;  5DV5 A;  2EK5 A;  1XB4 A;  3HHH A;  2CGP A;  5HDK A;  2RGV A;  1RUN A;  2O0Y A;  3L09 A;  4IJA A;  1ZG3 A;  5HLI A;  3JSP A;  4CHU A;  4ZH4 F;  3HYI A;  2EV6 A;  2MC3 A;  3KP2 A;  5BMZ A;  3TO7 A;  1J9I A;  2DI3 A;  5LHH A;  2XRO A;  1T0F A;  1Z6R A;  3QPH A;  1K78 A;  5H20 A;  1O3T A;  2O3F A;  3MZH A;  3W6J B;  2DK5 A;  4LLG F;  4MGR A;  4M9X A;  3CO7 C;  2QQA A;  3K69 A;  4Y15 A;  1FYK A;  1SFX A;  3F8B A;  5D8K B;  3RKY A;  2LNB A;  4L0Z B;  2IVM A;  5H6Q A;  4KMF A;  2KJB A;  2XAS A;  3FXU A;  2FBH A;  2HS5 A;  5J8C A;  4HV5 A;  1JHH A;  3GXO A;  4HX4 A;  4IPA A;  1UHM A;  3RKX A;  4WK8 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...