5EDNA

Structure of hoxb13-dna(tcg) complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
b'RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Hox-B13
publication title Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 60
sequence length 60
chains with identical sequence B, G, J
ec nomenclature
pdb deposition date 2015-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ednA00
1DU6A 1JKQC 1Z0XA 3SJMA 4V2FA 1X58A 3TW7A 4FCYA 3BR6A 2EQRA 2JN6A 3L1PA 3TP0A 3E7LA 4CYCB 2ELKA 3DEWA 3S1RJ 2H1KA 2XRLA 3SDGA 3S1NJ 1IJWC 1JT6A 1ZGWA 2L7FP 1LE8B 2VUMJ 3W6VA 4ABZA 5FJ8J 4A3EJ 1H89C 1TWGJ 5FKMA 4HNVA 3BTLA 3ZQCA 2VKVA 4FISA 2QCOA 3ZQLA 3K2AA 3JRFA 1WH7A 2JK3A 4BY7J 1K61A 4BY1J 2K40A 3S1QJ 5IYCJ 4A3IJ 3HEFA 3IV5A 4B4CA 3G1LA 4A3FJ 3QQAA 2ZB9A 1I6HJ 4A3CJ 2HQ5A 1AU7A 5EDNA 2L7ZA 2GBYA 1QPIA 1D5YA 3GTLJ 5IYDJ 1JJ6C 2DA4A 2IBDA 5K7HA 1MBEA 3ZQHA 2XPUA 1ZK8A 1IGNA 2E2JJ 1MBKA 2LFBA 3FIWA 3QPLA 2R5YA 2JJ7A 2Y9ZA 3HGYA 4JYKA 2E2IJ 1Z77A 1HCRA 1IDZA 2ECBA 1IUFA 2XGEA 1B8IA 2AHQA 2K9NA 2LY9A 4BBSJ 3BTIA 2N8GA 3CCYA 3S14J 3G1OA 1PUFB 3BR3A 2DA7A 1U78A 2Y9YA 3LSPA 3A01A 3NAUA 5FLMJ 1F36A 2JWTA 2ME0A 2VKEA 5M3MJ 4UUSB 3OOUA 3LSJA 2ME6A 5IP6A 4C3JJ 2CQQA 2JA6J 5EEAA 4XRSG 1GUUA 1OCPA 3BQZA 5EZGA 3F0CA 3PO3J 1X2MA 4C2MJ 2R93J 2ID6A 4V2GA 2TCTA 3HBLA 5EF6A 1APLC 2MSYA 2AO9A 4LOCA 4CYCA 1TWAJ 4W97A 5EG0B 3O8GA 3HOUJ 5IP9J 1JTXA 2P81A 2NS7A 1LE8A 1AHDP 2JMWA 3TEDA 2M8GX 2Y2ZA 2JA7J 4EEFG 1GVDA 4AUXA 5F0CA 3BG5A 2Y31A 2R0QC 4RBOA 2COBA 3RZOJ 4A3GJ 3BR1A 2R5ZB 1A6IA 3WHCA 1ETKA 2EZLA 1JT0A 4MLOA 1A5JA 4M3BA 2HI3A 1IV6A 3MN2A 1P7JA 1Y1WJ 2OPTA 2DJNA 1WGXA 1U8BA 4A3BJ 3A02A 2ID3A 2YS9A 4QTRA 1FTTA 3LSGA 2ECCA 4MO7A 4XIDA 4XRSA 2XPWA 3JRBA 4X1EA 2FJ1A 5F1JA 4BXXJ 1VI0A 1MBHA 5E3MA 3GTGJ 2DA3A 2O7OA 2HXIA 2VPRA 3FK6A 4M3FA 5J1RA 2GM4A 3K7AJ 1T56A 1YRNB 1MH4A 2K9QA 2RAEA 5EYRA 4BBRJ 3FK7A 5E3LA 1WPKA 3FISA 3JRGA 1FEXA 3S17J 1ITYA 3FKIJ 1HDDC 4Y52J 1U9OA 1RPWA 2D5VA 3Q0WA 5JLWA 9ANTA 2HOSA 3BQYA 3GTJJ 3M3YJ 2IEKA 1ETVA 4MFEA 4DZPA 1Q1VA 4XICA 4MIMA 1UHSA 3HGGA 3HOZJ 1OFCX 3A03A 1NK3P 1ETQA 1BJZA 1MBGA 3LNQA 1ORKA 1ETXA 4S0HB 3BG9A 2M9HA 5F0HA 1LFBA 1B72B 2GLOA 2W48A 1HLVA 4DW6A 1FTZA 5EG0A 2EBIA 3JRIA 1WCMJ 3OSFA 1ZTRA 2E2HJ 3GTOJ 1X2NA 1I3QJ 3HOVJ 2DMNA 2DTZA 2YUSA 2LD5A 2OF7A 3IH4A 2X48A 3RZDJ 4JX5A 3S2HJ 4AYBN 1FJLA 3H3VK 1XC5A 4FE4A 1IRZA 3MKLA 5IYBJ 4D5CA 4D7MA 5M3FJ 3BR5A 1VFCA 4M3EA 4JX4A 3ZQFA 1NTCA 1HOMA 3BTCA 1GV2A 2CJJA 5IOZA 2VI6A 1IC8A 2XGDA 5GP9A 2WV1A 3UKGA 1QRYA 4A3KJ 3Q0UA 4UUTA 5FKKA 1P7IA 1IDYA 4A69C 1RKWA 1I50J 3S15J 2DA1A 1ENHA 3O8HA 3NARA 4D7NA 5K7FA 2KT0A 4JP0A 5E3OA 5M5WJ 4JX6A 3BR2A 2YU9J 2EZIA 1W0UA 5EGOB 2DA2A 3VPRA 1GT0C 1YRNA 1H8AC 4IHWA 2NVQJ 1RKTA 3B6CA 4BKXA 2R92J 5FKNA 2EZHA 3BR0A 3I4MJ 1BA5A 2DA6A 1MBJA 1U9NA 1E3OC 3H0GJ 3ZOBA 1SFOJ 2R7ZJ 2XSDC 1FIPA 3LOCA 2E19A 4C3HJ 2EH3A 1BL0A 1CQTA 2LKXA 5E3NA 5GPCA 2LLKA 4XRMA 1JKRC 5FKLA 2O8KA 3HKZN 4B3AA 1W0TA 2CRGA 1DU0A 3LSRA 1F43A 2G0EA 3ZQIA 1WH5A 2XGCA 3D1NI 1O4XA 3PO2J 4M6VA 1ETOA 2CUFA 1B72A 3HB9A 4A93J 3RKQA 2HDDA 2LR8A 5DS9A 4A3MJ 2LVSA 1ZR4A 1ETYA 2NS8A 4B1RA 4I6ZA 2CQXA 2DA5A 1ZQ3P 5BNGA 1JKPC 5J1UA 1QVTA 4M3GA 5F04A 2MGQA 3ZQGA 5GPAA 5EZHA 5DTDA 1WI3A 2M0CA 2LTPA 1PUFA 4IHYA 1MSFC 3GTQJ 1AKHB 4IHXA 2NVTJ 1VNDA 3SFIA 2M34A 2JA5J 2NOGA 1RESA 2WB1N 1GDTA 2DN0A 2PMZN 2DMTA 2WAQN 4C3IJ 3RQIA 2LP0A 1LFUP 4UUSA 3DCFA 2TRTA 1UG2A 1UMQA 1HF0A 1K83J 2O9LA 3IH3A 3HM5A 1MBFA 3PM1A 3Q0VA 1BW5A 4RDUA 3JRCA 2E1OA 4D5FA 2M2EA 4MFDA 1NK2P 1R9TJ 1OJLA 2LK2A 2CUEA 2DMPA 3C2BA 4NDLA 2HOTA 1BW6A 3Q3SA 3I4NJ 4M3DA 1Y1VJ 5C4JJ 5EGOA 1JJ8C 1MH3A 2MW8A 3HOYJ 3OIOA 1TWHJ 2MG4A 1POGA 2HYJA 1H88C 3IH2A 2H8RA 4I76A 2HXOA 2DMUA 1JTYA 4Y7NJ 4J19A 3GTKJ 4A3LJ 4W1UA 3MVPA 3HDDA 5JLXA 2R5ZA 2FQ4A 2XB0X 4L5EA 4QSHA 1VF9A 1TWFJ 2I10A 2QF7A 3QPSA 2HOAA 4IEJA 4AC0A 3JRDA 3GTMJ 1ETWA 1ZKGA 1RETA 2NVYJ 1SANA 2Y30A 2L0KA 1MNMC 3GTPJ 2L9RA 2B63J 4A3JJ 2CU7A 3CMYA 4A3DJ 5K7ZA 5C4XJ 2FX0A 3GBGA 3TW6A 2JA8J 3BTJA 3M4OJ 1JUSA 2K9SA 3G1MA 2X6OA 5J1YA 1JKOC 3TP3A 1QVUA 1TWCJ 5M5XJ 4G12A 3HOXJ 3OSGA 3S2DJ 1AKHA 4FTHA 1EF4A 5FLVA 4DZJA 2IAIA 2XB5A 5M5YJ 1FIAA 1JGGA 1XS9A 3S16J 1S7EA 2KDZA 2R5YB 3JREA 3BG3A 5C44J 3CQZJ 1XG1A 4FE7A 1MSEC 2EZKA 2X9DA 1IG7A 3JR9A 5F08A 1HDPA 1TC3C 5IP7J 5IPAA 1B8IB 1GV5A 5IOYA 1JUPA 3HOWJ 2DMQA 4DYCA 1OCTC 4QIWN 4GFBA 2L7MP 1RR7A 3BT9A 4DYRA 4DYQA 3WHBA 3A01B 2Y0SN 3JRHA 2FD5A 4XK4A 4IHVA 2NVXJ 1G2HA 1JUMA 1T33A 3CDLA 5F27A 3JRAA 3B6AA 4X6AJ 1ZR2A 2XPVA 5F0FA 5J3LA 5FKOA 3S1MJ 5HODA 5C3EJ
chains in the Genus database with same CATH superfamily
1T2KA 1DU6A 1K4TA 3F72A 4L9TA 4XORA 4RAZA 2Y0MA 5BS6A 1WJAA 2QKLB 1X58A 2P7VB 3WTYC 3CDHA 4IX7A 1F9NA 4B09A 4OMZA 2EQRA 4BQQA 3CCSI 2CG4A 2DFEA 1ZYRF 5FRMA 2ZJPF 3E1SA 2H1KA 2EIJH 1IF1A 3GW2A 3CC7I 2Z2SB 1BR2A 2ZXJA 1IJWC 1K6OA 3PIPF 4Y4RA 2VKDA 2UXXA 2VUMJ 1PDNC 2A6HF 1B1BA 1H89C 2V1XA 1TWGJ 4OIRF 5FKMA 4HNVA 3SEQA 1YITI 3AKZA 3ZQCA 4PJJA 3KP3A 2O8XA 2K3FA 4KUMA 2ELJA 3GYHX 3JRFA 4IRGA 1WJEA 5LBQA 2JK3A 1R1VA 4NUBA 4HW0A 1BBYA 3I5UA 3R60A 3IV5A 2DCEA 1J2XA 2ZB9A 3QQAA 1HXDA 1R49A 4IVNA 2LKSA 2L7ZA 2GBYA 4L9JA 2DT7B 2DA4A 4HAMA 1R7JA 1ZK8A 1MIJA 5F64A 4XMYA 1IGNA 4IHTA 1FBQA 4IPAA 1Z91A 4MQVA 5E79C 4FASD 3J80Z 3FIWA 3QPLA 2JJ7A 3DBLB 5HS8A 3FHZA 2LF7A 4UVCA 5LD2C 1F1ZA 2EV6A 1IUFA 3EYIA 2WAFA 2LY9A 3BTIA 1X4PA 2KRHA 4J01A 2L5QA 3BR3A 2ETHA 1WJBA 5CLSA 3FM5A 4NC7A 1U78A 1WJ5A 1XGSA 1RC9A 4I01A 2KJCA 2BY0A 5FB2A 3OYMA 2WTEA 1FOYA 4LLNA 3ZN0A 4UUSB 3S32A 1D1AA 4WWCA 3OS1A 1DGRM 5AIPA 5IP6A 3MKZA 2HGCA 1IN7A 3PJRA 1GUUA 1N75A 1P92A 1T8IA 2OCEA 2X1CA 1HKSA 2PBIA 4CO8A 3LAJA 2B7EA 3LFKA 5DCMA 3KEQA 2V9VA 5ILVA 3DLAA 2R93J 3ZMDA 4XLFA 4KJZA 3HBLA 5FGMA 4CSWA 5EF6A 3DXJF 2MSYA 1R4MB 2L2OA 1WHUA 3ERED 1MJAA 3BDDA 4XRFA 2QBYB 2PFBA 3OOPA 1FY7A 1WKMA 4PJ0C 2H94A 5IP9J 1BI1A 1JTXA 3L2RA 2JVGA 3IWFA 2CMPA 1ZRFA 4BE0A 4ZYEA 4EJUA 2XC7A 1Y6IA 2Y2ZA 2HKXA 3B73A 4EEFG 2BZTA 3DKXA 1G4DA 4J00A 4AUXA 4ZDOA 2Y31A 4C2UA 4HNTA 4RBOA 5FFXA 4AIDA 1TP4A 2IVMA 2W25A 3K0LA 3ULQB 3RZOJ 2M7BA 2R5ZB 2ZNZA 1PUEE 1MMGA 4A12A 2H6CA 2VQHA 3HYIA 2HI3A 4QLCU 4ZYDA 1IV6A 3MN2A 1V55H 3OR2C 1P7JA 3FDYA 1N25A 2DJNA 3HC7A 3BY6A 1HQCA 4HSTA 1GHCA 4A3BJ 4A0XA 3VODA 2ECCA 4M74A 4UVAA 4CICA 4RB1A 3DEUA 3FWEA 2NYXA 4AVPA 1HW2A 4IQ4A 4YIFA 1J09A 5B3SH 1QBJA 5TJJA 5E3MA 3F8BA 2AQFA 3GTGJ 1TT0A 2VPRA 2G9WA 3HTUA 2E1CA 3K7AJ 2R7OA 1ZG3A 4R8HA 4ZYHA 2UUZA 3FISA 3W2VA 2KDOA 2O5RA 3F8CA 3FKIJ 3O3KA 4EGYA 1YI2I 2V6EA 4Y52J 1ITYA 1U9OA 4M72A 1RPWA 3I56I 4XLAA 4HRIA 2V79A 3HPGA 3U21A 4MFEA 3U1DA 3ROUA 1UELB 2HKOA 4XICA 2HYGD 3HRUA 3EETA 1OFCX 1ETQA 3OIPA 5B1AH 4PDKA 4HF2A 1H9GA 2XAGA 4RGRA 2JPBA 1STZA 2JUGA 1BC8C 3IWZA 2M9HA 4CCMA 4PFOA 5FLXZ 5F0HA 2KIUA 4RM3A 1R4NB 3ABKH 2LC2A 3UNGC 3ZN1A 3HIFA 1KONA 4P1WA 2DODA 2QKMB 3K4JA 2ESHA 3P9CA 4U7DA 1ZTRA 2X1DA 4U0WA 1FNNA 4IQJA 3PNVA 2DK8A 4G6TB 2J5OA 1ZGJA 2YUSA 3E5XA 3J80K 4BXFA 2OF7A 2DAOA 3S2WA 1WZ2A 3OL3A 4B3XA 4BGDA 3SZPA 3G6EI 3QU3A 2PMHA 2BV6A 2Y69H 2ISZA 2B0LA 4AYBN 3H3VK 4O3MA 3S2HJ 2HVQA 3GZ5A 2LMDA 1IRZA 1D3YA 1IN5A 4FQGA 2LKPA 4D7MA 1K7AA 1ZLKA 3WU0A 1EH7A 3C2GA 4JX4A 3CLQA 3JTHA 2X4HA 3BJAA 5DDGA 4PK4A 2O3FA 1SAUA 3UKGA 4UUTA 3PFYA 1OYYA 2PJPA 2CW8A 1ZHFA 3V7SA 2RDPA 1DP3A 1IDYA 1F5TA 4A69C 1RKWA 1I50J 5D5WB 3KP7A 3NARA 2H6BA 1MGTA 2NVUB 4PZJA 3AFHA 3IRRA 2EZIA 5EGOB 2P7CB 2DA2A 3J7YJ 1Y8QB 4MHGA 5B66C 1YRNA 4RM2A 2XROA 1X1PA 2FRHA 3MKWB 4BKXA 3M8JA 3D5LA 2C6YA 2R92J 1D1CA 4GO1A 1MMSA 4UY8I 3QWLA 3PIOF 5F6FA 3L00A 2V1DA 1U3EM 3CD6I 3EUHA 3ZXSA 4MQ9F 4ASNA 5E3NA 1ZG1A 4L0YB 3ELKA 3E6MA 4YFKF 2CFOA 4RGUA 2FEZA 3CC2I 4D0PA 2O8KA 1QO0D 4NBQA 1BIBA 3ZMTA 3LSRA 4KN7X 1OYIA 4LG0A 3D1NI 2W00A 3TBIA 2A69F 3HB9A 4K2EA 2MYSA 2JZYA 5DS9A 2VN2A 3OL4A 4NQWA 1ETYA 2ZC2A 5ILSA 2DA5A 2E60A 3I71A 1SVMA 3BP8A 5BNGA 1QVTA 3OYIA 1GLNA 3K2ZA 2K4BA 2CWEA 2OV7A 2JRTA 3M8EA 3J81Z 4ENNA 2M4KA 1WI3A 2M0CA 2GWRA 1EA3A 4DBQA 4KA4A 5L3EA 3FMQA 1GDTA 2D45A 4HX4A 3RQIA 2LP0A 2HTJA 2DYSH 3BC8A 2JPCA 3DCFA 1UG2A 1RI7A 1XPXA 1UMQA 4F55A 1UFMA 4EQQA 3IH3A 1GXQA 3HM5A 3C7JA 1MBFA 3PM1A 1ZG5A 1BW5A 4U88A 5HLHA 4RDUA 2EIMH 4RB0A 3JRCA 2M2EA 4MFDA 4CUGA 1IRGA 2FUG2 2LK2A 2QZ8A 2DMPA 4OINF 1OCZH 4KT6A 4NDLA 3OS2A 3OV8A 1BW6A 2XF7A 2STWA 5E8GA 1GXPA 5J47A 4M3DA 3U2RA 3P9IA 4ENKA 5H2FC 3CF2A 2MW8A 4YELA 4Q4ZF 3OIOA 1WSUA 3RJPA 5FLXK 3KP5A 1YS7A 1LEBA 3MZYA 4AIHA 3ZCOA 5DCFA 1RRJA 3G3ZA 1JXSA 5J8CA 3IH2A 4I76A 3ZGKA 1UAAA 2GIVA 2GOXB 4W1UA 3SDBA 4XNFA 3DPTA 2VOOA 2DLLA 4HZFA 2VT2A 4L5EA 2FE3A 2H09A 2E1NA 1SEUA 2L4AA 2D1HA 1W36D 1T0FA 2JUCA 4IKFA 2F4MB 3JRDA 3GTMJ 1ETWA 3BPVA 2NVYJ 2IT0A 2HFHA 4I2OA 2Y30A 2L0KA 1MNMC 2L9RA 3VYRB 4YFXF 4A3JJ 1D8KA 2R7TA 3CMMA 3GUDA 4ZZDA 3ESWB 1K4SA 2LSOA 3FXRA 2E34A 1KQ8A 5ILUA 2RQQA 1O57A 3GBGA 1FZPB 1LFPA 2JA8J 3F8FA 3M4OJ 3KEOA 2ZNYA 4HLYA 3G1MA 4GXOA 4G12A 2CUZA 1AKHA 2QWWA 3AL0B 1YO5C 3P9KA 4I09A 2R7QA 1FIAA 1RUOA 3S16J 1S7EA 3H5AA 3MWMA 2KDZA 2R5YB 4ESJA 3E5QA 3V7CA 5B5EC 3TQNA 1R6RA 4QWQA 1DPUA 2RREA 3CQZJ 1XG1A 1Y56A 2XHKA 3V42A 2X9DA 4RAFA 3J7AO 2W1OA 1GV5A 1L0OC 2ZMEA 4FETA 3DU6A 1BR1A 2BHZA 5E20A 1WRJA 1G8XA 3WHBA 3F23A 3OYLA 3JRHA 4IHVA 2PMZA 2WAQA 3I59B 1Y0NA 3SQNA 3SYTA 1T33A 2VC1A 3JRAA 2BYVE 1D0ZA 1LJ9A 3IRQA 1KGSA 2OAZA 2X0LA 3DF8A 5GAHJ 1IN8A 2AS5F 2L9VA 1P6RA 2A3SA 1XDUA 1JKQC 2O6GE 2YU3A 3K4MA 3KLNA 2FOWA 3TW7A 3K70D 4XOPA 1FSEA 4IRIA 2HQAA 2MLGA 4Z6YA 1AWCA 2XF5A 2R7FA 3E6BA 2JN6A 3RDIA 3J81K 1E3PA 2A05A 4UV9A 3DBHB 3L1PA 3N4MA 5CQEA 2EFPA 1VQOI 1FBUA 3DLLF 2OTLI 1NG6A 2QENA 2IGNA 2XRLA 4L0ZB 3WU2C 1JT6A 3K1PA 1ZGWA 2L7FP 1LE8B 3AG4H 3W6VA 4ABZA 2XSJC 4C9YA 3GLLA 5FJ8J 2L4MA 3ZRGA 1T0FC 3V7RA 3BTLA 2CV0A 3FKJA 1BOBA 1MZBA 1OCOH 2QCOA 4FISA 3K2AA 3ZQLA 1ON2A 5LLQA 4XQFA 2VBXA 3BOQA 2QVOA 4M73A 2DT6A 3MMYB 5IYCJ 1WJFA 4A3IJ 4E7JA 3G1LA 1OCCH 1P4AA 3JSOA 3WTWC 2HQ5A 2VL8A 1QPIA 2DYRH 1D5YA 2CV2A 1YFHA 3GTLJ 3VB2A 2F2EA 1JJ6C 4LG3A 1J0RA 2XPUA 5HVQC 4XKBA 2WY7Q 4G6DA 2STTA 3H5NA 1MBKA 3QODA 2LFBA 3E6DA 4RGSA 5CJ9A 2E2IJ 1R5HA 3GFJA 2OU2A 4PJNA 2ISYA 1HCRA 2HVRA 2ECBA 3OYJA 2GXAA 1JI8A 1B8IA 1MMDA 2K9NA 5KAIC 5LHHA 1QHHD 3LL7A 2GXBA 3F6VA 2BGCA 4H4KC 4IF4A 3LSPA 3DFGA 5DYMA 1A36A 4KYWA 2L9SA 3OWTA 1XMKA 1F36A 5L3FA 1MMNA 2KLOA 3Q5FA 2VKEA 4EM2A 2F48A 4ITVA 3LSJA 1R36A 1T98A 2IS2A 3L2VA 1IXRC 4C3JJ 1T08B 5EEAA 2ZCWA 2ZXWH 2K27A 4M6XA 1IZ1A 2F4OB 5LGTA 1X2MA 2ID6A 3WG7H 4V2GA 4A2UA 3MCZA 1VQLI 4N9HA 1APLC 1K78A 4CYCA 4D9JA 1TWAJ 2QEXI 1SD5A 5EG0B 2W84A 3E6CC 3G2BA 2KFDA 3O8GA 3HOUJ 2R4GA 2P81A 3WE3A 3PUBA 2XIGA 2X6YA 3ASNH 5KHDA 2JMWA 3ABMH 1QA6A 2XAFA 1DDNA 1GVDA 3KP2A 4GGGA 2IGOA 4TV7A 3F6OA 5F0CA 2R0QC 2RQPA 4AVZA 2COBA 1BJAA 1LPQA 1ZLJA 1PJRA 4GRIA 1DPRA 3FMSA 3KZZA 4MLOA 2W85A 3K4LA 4P96A 3FBIB 1A5JA 4M3BA 1V5GA 2DXIA 4PFPA 2GXGA 1Y1WJ 1O3SA 4EJTA 1WGXA 1U8BA 4UB8C 2DDBA 4PGGA 1TBXA 2H8WA 1FTTA 5ED4A 1XSDA 3LSGA 1JGSA 4MO7A 2XPWA 1IXSB 4KICA 4LGWA 4BXXJ 1N77A 1MBHA 1HC8A 3OYBA 2O7OA 2EPFA 2HXIA 3FK6A 2JT1A 4M3FA 2VONA 1FYLA 2PMUA 1MH4A 3M07A 5EYRA 2CW0F 3WGGA 3JCUC 3FK7A 3R61A 2LF8A 1AOYA 5E17F 2OCCH 2ZFWA 4E6KG 2V4JC 4CCOA 5GADJ 4HPQA 1TW3A 4BJ6C 2DPDA 3RPQA 2W57A 2D5VA 3FMRA 3H5RA 1Y39A 2HOSA 1S5LC 3BQYA 1S29A 2IEKA 2FNPA 3O6BB 5GAEJ 1BOAA 1E3HA 3DU5A 2K3PA 1UHSA 1EH8A 4R1HA 1U0JA 2VXDA 3H9GA 1YW8A 3KE2A 1ORKA 2NRAC 1USSA 3BG9A 3K6GA 3MAJA 3S3NA 1O3RA 3CUQA 3IUOA 2ZMEB 4G9YA 1FLIA 5HS9A 4I7HA 5KAFC 3QAHA 2X85A 1CF7B 1B72B 4AYBA 2W48A 5LEJA 1HLVA 1OKRA 2Y48A 4DW6A 3I55I 1VQ7I 3RPUD 3I4PA 2KRCA 1MD0A 2KQRA 5L3DA 2EBIA 1TQPA 5JHUA 3RQ4A 4AU7A 1WCMJ 1F4KA 3OSFA 1U5TA 1IW7F 4E7LA 1R5ID 3CMEI 2XVCA 2FNAA 1SVOA 2F5VA 1I3QJ 3HOVJ 4L5IA 2DMNA 1TLHB 3CCEI 2EFNA 2DTZA 4HYEA 5L3BA 4XN3A 4AM3A 3WTXC 2W4SA 3HZJA 3E97A 1KYWA 3D0SA 2K86A 4KIBA 1FJLA 3K9TA 2RC4A 1XC5A 4FE4A 3V8JA 3MKLA 3N97A 3C3WA 4EJOA 4BXUA 5M3FJ 2BXYA 1SFXA 1HOMA 3AG3H 4BEHA 3BTCA 4C30A 1GV2A 3GFMA 5IOZA 2Z99A 2OZ6A 1Y8RB 2WV1A 1QRYA 3Q0UA 5FKKA 2YX4A 1RNLA 1UB9A 1FMVA 1A6QA 4RB3C 3IL2A 2DA1A 5K7FA 4JP0A 1VQ4I 3HUGB 4CCJA 4MEXF 1A04A 2XAUA 1GT0C 5E18F 3F8NA 1RKTA 3B6CA 3E0JB 2VB6A 3CCUI 4A5NA 3G4SI 3VOEA 2FA5A 1U9NA 3FM3A 4O6JA 2UXNA 3KX2A 1SFOJ 2XSDC 1FIPA 4IZZA 4Q47A 2E19A 4U7BA 3LMMA 3O2PE 4E7HA 1CQTA 1R71A 4G7OF 2KIFA 3I0TA 1XX5A 3KYLA 5GPCA 2LLKA 5CYVA 3OS0A 4PJLA 3S8PA 4G7HF 4WK8F 2HDWA 5HNHA 2IGMA 3U1KA 2L01A 4S04A 1XSXA 1H0MA 2VOPA 5BQTA 4M6VA 1YJNI 3A4CA 1W5SA 4XN0A 5FD5A 2DPUA 2CV1A 2HDDA 3CCVI 3T5XA 3KLOA 3CUQC 3LFUA 5BOXA 4L5JA 2Q2EA 3VSLA 1JKPC 2EK5A 4IOAF 3MFKA 2HS5A 1VQMI 1IO2A 2MGQA 2IGKA 4EVIA 3CUOA 5GPAA 2W7NA 2MABA 3PNYA 3GTQJ 1U5TC 2W24A 3UR3C 4LK1F 1VNDA 1ZARA 3SFIA 4LLGF 2JA5J 2YX7A 2NOGA 3ERMA 4OWRB 1RESA 2WB1N 5KK1A 2XASA 4F3QA 3KETA 2DN0A 4ZZLA 4C3IJ 2MD5A 1IAWA 4ESFA 2FMYA 4U0YA 4XLHA 2P6TA 2XKOA 5DD4A 2VQCA 2K4JA 1TNTA 3I54A 2X6XA 3NWSA 2M7AA 3J7AY 3RKXA 4D5FA 1LNWA 2P0WA 3GZNB 3VSKA 2CUEA 3CJRB 2R7XA 1IXCA 1X1DA 2OQGA 3PL8A 5LRRA 2PI0A 2P6SA 2KIMA 2KHMA 2EB7A 2WBMA 2HTSA 3RYRA 4F92B 1POGA 4CCKA 3BROA 2OD5A 5BMZA 4Y3OA 2K7LA 1OCRH 3F3XA 1JTYA 4A3LJ 4J19A 3GTKJ 1MKMA 3RKYA 3CZ6A 4E4HA 4YIIA 3P7NA 3HDDA 4CGZA 4BQNA 1XSVA 2FQ4A 1REPC 1YX5A 1J9IA 4QSHA 5L3CA 2BW3A 5JVTA 2I10A 5GAGJ 3QPSA 2HOAA 2W82A 4N9IA 1DUXC 1ZELA 4GCVA 1L3LA 2FBKA 3M7GA 1X3WB 1SANA 1BM9A 1KZHA 5DUIA 2Z1DA 3CMYA 3COAC 5K7ZA 2J5PA 5JI6A 2KRFA 2VQLA 4HQMA 3PQKA 3TW6A 1O7FA 4ZDPA 2V7FA 4RS8A 4M9XA 1W7PA 4P5OA 2LRDA 1DGWY 4KN4X 5GTIC 1JKOC 1WFXA 3TP3A 1LVKA 2VC0A 2VJJA 2QSGX 1QVUA 1TTYA 4OAZA 3OSGA 5B1BH 1BR4A 4Z2YA 1D0XA 3HG9A 2DI3A 4LFUA 4FTHA 2BVLA 2KMUA 2AXLA 2HNHA 3QYBA 2XB5A 2P5KA 2PJRA 4EMSA 1JGGA 3EQLF 4C2TA 2CQNA 4A6DA 1H9TA 2MLKA 2IS6A 3JREA 1A31A 5CQGA 4FE7A 3VWBA 2AXTC 3ZQQA 1IG7A 1TC3C 4UNOA 3F21A 2AQEA 2LOOA 3AG2H 4G6QA 2DMQA 4UXNA 1OCTC 2MD0A 3KCCA 4LLLA 3CO7C 2VODA 3ECOA 1VQ9I 3QOEA 5BPDA 2F5EA 3J7ZI 1V3FA 4E70A 4DYQA 1FOKA 5BPIA 2KPMA 2Y0SN 4XK4A 1FOWA 2RN7A 1W4MA 1WQ2A 2M45A 4XLEA 2VPLA 4MGRA 3LSMA 1S7AA 3OYAA 1VTNC 1CGPA 2E7WA 2K9MA 4G94A 5H6QA 5FKOA 2DU9A 1I39A 4BACA 3HL2A 5HODA 5C3EJ 3KPHA 4YG2F 5DM6F 2QQAA 5DCMB 4NNJA 3DP7A 4V2FA 4OAYA 5ERIA 5A2QZ 4KNYA 3EPZA 4FCYA 2LG4A 2QLZA 3BR6A 2KIQA 4EJVA 2G7HA 2LBFA 3DPUA 2OBPA 1PP8F 2LDUA 3AL0C 3LQRA 4A5MA 3S93A 2O0YA 1SFUA 3H9JA 1MDMA 1QZYA 2RNGA 1J7KA 5HDGA 3PSIA 1TZLA 3S3MA 1KU9A 2HWVA 2V1NA 4UHTA 2LYCA 4BH9A 4V19K 4A3EJ 1LVAA 4KDPA 1XB4A 2VLAA 2MC3A 4DJAA 2VBYA 4G8XA 4M9SA 3V8KA 1W5TA 3TO6A 1G3TA 1K61A 2K40A 2VJIA 3S1QJ 1ZRDA 3HEFA 4F91B 2GAUA 3FX3A 1I6HJ 1EH6A 4BL0B 2G7UA 1ACIA 4A3CJ 3IC7A 1W1WE 1R22A 1AU7A 3RYPA 4N4NB 2IBDA 2GQQA 2Z3YA 5K7HA 3ZQHA 3CCRI 2HR3A 4BE1A 2E2JJ 4O5VA 4U0VA 3A0BC 2M87A 1I3AA 2P8TA 3WTTC 1Z77A 4NB5A 1D8JA 2D1VA 2DDAA 3FHNA 2XGEA 2NS0A 4NHJA 3H92A 2GIZA 2N8GA 2HPIA 3G73A 2R7WA 3S14J 2BHYA 3G1OA 3H35A 5D5XB 5HDKA 4XONA 2A6EF 2EFQA 3EUAA 4F93B 2V6CA 2Y9YA 3A01A 1WI9A 5FLMJ 2WWYA 2XGXA 1X3UA 2JWTA 2ME0A 1W36C 1YLFA 4M71A 3OOUA 4HX7A 2ME6A 1X3ZB 2CQQA 2JA6J 2NAZA 1Z05A 2PLYA 3BQZA 5EZGA 4QPQA 2ZSHB 3I3LA 5DUKA 3TDZC 4LB5A 3HSRA 3PO3J 1VZ0A 1QNTA 4HG2A 3LA2A 2ZJRF 2TCTA 3LSIA 4XKWA 3VYTB 2AO9A 3GXOA 2FBIA 3FF5A 1WJCA 4WCGA 2CO5A 3BG6A 5TRDA 2VIXA 2NS7A 4DBRA 1YG2A 2IS4A 1QHGA 1AHDP 2VE8A 3CJTB 4IO9F 3LA7A 1E2XA 4YEJA 2M8GX 3TEDA 2JA7J 2FMLA 3K1NA 3M8FA 2IA2A 3QPHA 1LKXA 1KYZA 1Z6TA 3BG5A 3QRFF 4RLQA 1OPCA 4N0BA 4A3GJ 3S3OA 3BR1A 1D5VA 3HRSA 1A6IA 1D0YA 3NEUA 1ETKA 2EZLA 2BY2A 2QYOA 2ZXIA 5TGTA 3DBRB 2CFXA 1HSJA 4BHPA 3OY9A 5E1ZB 1YIJI 3ZR8X 1IUYA 1R00A 2V9PA 3NQOA 3A02A 4E7IA 4GYGA 2TDXA 2YS9A 4XIDA 4XRSA 2KZGA 2MBFA 2PX9A 1BI2A 1XGMA 1Z7UA 2FJ1A 2M0MA 3QYFA 3OYKA 2DW4A 5F1JA 3CF5F 1KU7A 3BWGA 1VI0A 3W2AA 2FF4A 1JHHA 1T95A 2NOJB 4HOBA 2JVHA 5J1RA 2GM4A 5A2QK 2EV5A 1NG7A 1X1BA 1YRNB 2DFFA 2RAEA 4XL9A 4BBRJ 3L2CA 5E3LA 3TMOA 2YSRA 1WPKA 4N4OB 3JRGA 1FEXA 3K70C 1Y0UA 2OC6A 2K9LA 1HDDC 2MC4A 1V4RA 2CUJA 2Y75A 3KP6A 2PQ8A 3Q0WA 3GTJJ 3KYDB 4DZPA 2I5UA 4LK0F 2HOEA 1LDKB 1Q1VA 4MIMA 4BJ5C 3HOZJ 3H3ZA 3WU1B 3KEYA 4BDZA 4HX8A 3EUKL 1FYKA 4D1QA 1BJZA 2EIKH 2DQRA 1MBGA 3LNQA 1B4AA 3M9AA 4F52A 4LG0B 5DEQA 1IN6A 3ASOH 1SMYF 1LFBA 4KIFA 4DOZA 2I8DA 3HRMA 3TOAA 2GLOA 1MNDA 4EM1A 5FFZA 4EGZA 2EWNA 3WG9A 4WF2A 2QBYA 1ULYA 4L18B 1LQ1A 3WTVC 2HYFA 1QZEA 4NQWB 2XAQA 1VQNI 1MJ9A 1OISA 3TO7A 2F4IA 2JSCA 3VYUB 3CCLI 2E2HJ 1VQ5I 3E5UA 3SFZA 1I1SA 1I27A 1OMIA 3F9KA 5L3GA 5DM7F 2LD5A 2A61A 3ZMUA 3NRVA 4HSRA 3CO6C 3IH4A 2X48A 2EV0A 1FPQA 4JX5A 3ABUA 1UCRA 2VKHA 5LGNA 3B02A 2BXZA 4WXHA 2DQLA 4I02A 2JQ7A 1VQKI 4D5CA 2F5DA 2DT5A 3BR5A 4M3EA 2M3AA 3WGHA 1MDMB 3IKVA 4BNCA 1V5EA 4MNUA 1J5YA 3NWTA 4A6EA 2CJJA 4DIQA 2VI6A 2XGDA 5GP9A 4HDUA 3SEZA 1RR8C 3GZ6A 2MH2A 1P7IA 5CVRA 1N78A 5IT9Z 3BJOA 4HV5A 1ZN2A 1ENHA 3O8HA 4D7NA 2KT0A 1R58A 5E3OA 3DKYA 3OMYA 2RVCA 3BZ6A 3GLXA 1FYMA 3VPRA 1XMAA 3OYCA 5ICFA 4IHWA 1S8NA 2MA3A 2R3SA 3KIOA 4Y17A 5FRNA 2VJ5A 4FT8A 4RLFA 1HKQA 2FQ3A 4KITB 1BA5A 3W6JB 3RCOA 1YJWI 1XGNA 3ZOBA 1M1EB 4OIOF 4IXAA 2R7ZJ 2K5CA 3I9V2 1UJ8A 4HBLA 1G59A 2QQ9A 2F5CA 4C3HJ 2EH3A 1YE9A 3VEPA 4ANJA 1VQ8I 2X1EA 4XRMA 2NNNA 4IL6C 1JKRC 2QQ8A 4LMYA 1ZREA 4FX0A 3F8MA 5FKLA 1DP7P 3HKZN 3TO9A 1W0TA 2R7SA 1KQ9A 2DK5A 1DU0A 3CDIA 3HHHA 2Z5UA 2G0EA 2XGCA 3BJ6A 4H0EA 3HTSB 1O4XA 3ZMVA 3PO2J 1ETOA 1USTA 2CUFA 4RAGA 4AIJA 3MEXA 4Q5SF 2FOKA 1Q1HA 3V4GA 3FXQA 5LFAA 4A3MJ 2QA4I 1ZR4A 4B1RA 4I6ZA 2HDCA 1FP1D 2CQXA 1ZQ3P 3SZGA 4PCQA 2LY2A 5J1UA 4KMUX 3JTGA 5HS7A 3ZQGA 2VJ4A 2DOAA 5EZHA 1FWZA 5DTDA 2Z33A 2LTPA 1PUFA 1XCBA 1XGOA 3DKWA 1MSFC 4IHYA 1AKHB 1MMAA 5K1YA 1S6LA 1W5CC 2IXSA 2NVTJ 2XAHA 3VYSB 2COMA 1T6SA 4RA2A 2EFWA 3DTEA 2PMZN 2RNJA 2DMTA 2WAQN 3ISPA 2O03A 5LRSA 2TRTA 3L09A 5K5RA 3HHGA 1HF0A 1K83J 1R23A 2DTRA 2ESNA 5D8LB 5D4SA 1LDJA 1WVRA 2IRFG 2E1OA 4UVBA 1NK2P 1OJLA 4BUPA 4EM0B 4BYYA 3GWZA 2V9KA 2DFIA 5DD8A 4ETSA 1WJDA 4BQAA 1IN4A 1Y1VJ 5C4JJ 5LEKA 5LHIA 5EGOA 4GDFA 3OYFA 4IHSA 1MH3A 3ZPLA 2YR2A 3IHUA 6PAXA 1O3TA 2A6TA 3HOYJ 2H27A 1FX7A 2PEXA 4KIGA 4Q48A 3L2WA 1TWHJ 2EFOA 4M9ZA 4UUVA 2EINH 2HVSA 4GYIA 5HLTA 2HYJA 2ZO4A 1ONVA 4XOTA 1LB2A 1H88C 2H8RA 3H36A 2E5ZA 2NXNB 4Y7NJ 1BIAA 1RZ4A 1V5FA 3MVPA 2E35A 5JR3A 1Z6RA 3DPLC 2Z9OA 2PN6A 2XRNA 5DV5A 1FP2A 2LY1A 2X6WA 3I58A 4LIUA 1QQIA 1Z1DA 1VF9A 1TWFJ 3L9FA 2QF7A 4IEJA 4AC0A 4A0YA 1SFKA 3ECHA 1ZKGA 4L9NA 3BCAA 2L9NA 3A1YA 4MTDA 4XM3A 3T8TA 1T38A 2LREA 2RKHA 2B63J 4R79A 3GTPJ 1ZRCA 2VE9A 4LJZF 1FC3A 4A3DJ 2E1MB 5C4XJ 2FXAA 3KYCB 2FX0A 2CQKA 4JQFA 2MH9A 4AIKA 3R0AA 1Z3YA 1JUSA 2K9SA 2F5FA 5LHGA 5IT9K 1DQUA 1TWCJ 3S2DJ 4FX4A 2ZBKA 2FU4A 1LUJB 2B9SA 3HJEA 5FLVA 2IAIA 3LA3A 1TL8A 4QPOA 2Y0SA 2ZXHA 4ON0A 2GOMA 5HOOA 2F6CA 1SAXA 2CSOA 4BHCA 5C44J 3ZMSA 3HRTA 4EATA 2BVMA 2WA0A 1TQMA 5F08A 1HDPA 1HSTA 3QP5A 5CVVA 5IPAA 3RI4A 1B8IB 5D6FA 1E0EA 1XD7A 4DYCA 4ZTJA 1GVJA 3QU6A 5KVRA 3H0DA 3MQ0A 4GFBA 2L7MP 3BLYA 4DYRA 2FD5A 2XDVA 1ZH5A 3CCQI 5FD6A 5CVUA 3PUFA 3K4BA 1G2HA 3R6SA 3CDLA 2JSPA 3B6AA 3CJQB 3KP4A 3U9GA 1S72I 1TW2A 2XPVA 5F0FA 2QGUA 5J3LA 4E7ZA 1S9HA 3S1MJ 1HKTA 1MJBA 2HPMA 1Z0XA 2GA2A 3SJMA 3R4KA 5E1WA 4XLPF 4BAYA 3CC4I 4YIRX 2M8EA 2VBZA 2XUBA 2OZUA 4I0AA 4Y15A 2ZFUA 2M1BA 3PQJA 1B9NA 3E7LA 3TP0A 4HV6A 3CCJI 2P5VA 4CYCB 1K78B 2UWMA 2ELKA 3DEWA 3ZQ7A 3S1RJ 1P4XA 1YHQI 3VFZA 2DOFA 3SDGA 3HSEA 3S1NJ 5ICEA 4HDVA 3LWFA 3T0YA 1P4WA 3Q9SA 1RUNA 4XSZF 2CQ7A 1ON1A 2VKVA 3HOTA 5JFRA 4CYDA 1SD7A 4OU0A 1C0WA 1WH7A 2VQGA 4XLNF 4BY7J 4CCLA 3JAMZ 3TDUC 3WTSC 3OYGA 4ENMA 2Q1ZB 2A5WA 4BY1J 2XV4S 4BE2A 2ZSIB 4B4CA 4A3FJ 2XKPA 3DEEA 1TNSA 4S05A 1Z3XA 3BZKA 5EDNA 1BN5A 3ML6A 1OQYA 3FXLA 5IYDJ 4XBFA 3SZTA 5JVGF 3ABLH 2JTVA 1MBEA 1G6NA 2DOEA 5E1XA 5J4VA 2GA1A 2IJLA 1KQ0A 1XN7A 3K10A 2R5YA 1R1TA 5D5UB 2Y9ZA 3HGYA 4JYKA 3CCMI 2FBHA 3A2KA 1IDZA 2IPQX 1K6YA 2AHQA 4BBSJ 3CCYA 4UV8A 3JW4A 3OYNA 5HLIA 3KZIC 2GZWA 1PUFB 4XSXF 3GCMA 2DA7A 4NC6A 3W3CA 5D4RA 2WAEA 1BI3A 1WWXA 3NAUA 2IS1A 3I59A 1OYWA 2BE5F 1XDSA 2A68F 1YW7A 2XAJA 4ZH4F 5M3MJ 1YW9A 3WODF 1KU2A 3K4KA 4XRSG 4WX9A 1OCPA 1Z67A 5CVJA 2Q0OA 3F0CA 3FXMA 3P5JA 5HLGA 2LH9A 4KT5C 4C2MJ 1B59A 2WADA 3CUQB 1AA7A 3K4CA 4BJTA 1ERDA 2KP6A 4LOCA 3FXKA 3OIQA 5TISC 1MW7A 4W97A 2ZJQF 2DO7A 3WGIA 1U5TB 4CXFA 4ENJA 2HEOA 4WXCA 3W2WA 3AG1H 5K5OA 1LE8A 1HW5A 5AONA 2VBWA 4WXDA 2OTJI 1LDDA 2M30A 1UG0A 5JHFA 1YOVB 3FXJA 1FMWA 5HDNA 2LNBA 1QGPA 4AWXB 3REOA 4HEA2 1NHAA 3WHCA 2XF6A 1JT0A 4M6YA 1I5ZA 2CGPA 1KA8A 4LD5A 4PSXA 3GVAA 5F1RA 5LGUA 3GFIA 4BEHB 3FXOA 2X51A 3H3UA 3C18A 2OPTA 2P4WA 5EEHA 3N05A 2ID3A 3HOSA 4QTRA 2R7UA 3CP2A 1O3QA 1YJ9I 3IKTA 3JRBA 4X1EA 3E3VA 1FBSA 5CKTA 1YIOA 4DNCA 2QUFA 2Q8KA 4I99C 1Z9CA 2NNYA 1I1GA 2DA3A 3T1BA 2A5YB 1T39A 3DTKA 2V1UA 3TL4X 4CA0A 1T56A 4AD9A 2HQRA 4E7SA 3IP4B 2K9QA 4PSWA 4Y33A 4I98B 3MD2A 4IRHA 1S3JA 3BG7A 1B9MA 2Z16A 2CS3A 1NH3A 3S17J 1TQIA 3M1CA 4B44A 2QSFX 4ZDLA 3C2HA 1PVEA 5JLWA 9ANTA 3M3YJ 1EV7A 1ETVA 3R0JA 5H6RA 3KZYA 4ESBA 3OYHA 3HGGA 2R7DA 4CZCA 1SVLA 2CH0A 5IT3A 2IP2A 2HZDA 3A03A 1NK3P 4ZC3A 3VDXA 3LSTA 2E71A 1X1AA 4RB2C 3BPXA 1XCVA 1ETXA 4S0HB 3JAMK 2EJRA 4CCNA 3F22A 4LIVA 3KFWX 3G71I 4CDGA 3RSNA 1W7PD 1P9QC 4CZZA 3H9QA 1VQPI 2WV0A 5E8IA 1FTZA 1QZZA 2KKOA 5EG0A 3JRIA 2BY1A 1X4OA 1BC7C 5K5QA 3MZ8A 3OYEA 1OLTA 4XLCA 2D2WA 2Q2EB 2P5LC 4B43A 3GTOJ 1X2NA 5CVIA 3CTAA 5EEGA 3LSKA 4HF1A 2HU9A 2L7KA 2OUMA 2ZJ2A 3RZDJ 3MZHA 1SC7A 2R7VA 3DTIA 1EKEA 3DWLE 1P2FA 1G3YA 3GFLA 5IYBJ 5HNFA 3EDPA 1VFCA 4BS9A 4YFNF 3WE2A 3ZQFA 1NTCA 4II2A 2QM3A 3C1DA 1IC8A 5D8KB 2KJBA 4A3KJ 2IA1A 3EUHC 4PUSA 3JSPA 2OQRA 1JHFA 3L7WA 1BI0A 3RIRA 2IA0A 3S15J 1K79A 2A07F 4B48A 5CPRB 5M5WJ 2O61A 1MNEA 4L9VA 4JX6A 3BR2A 2YU9J 4ZTFA 4OOIA 3GX4X 4LB6B 5ICGA 3IAM2 4ZYGA 3A0HC 1W0UA 3M1EA 3LAPA 3DQVC 4JK1X 4P55A 1H8AC 3HKZA 4MTEA 5D5VB 2NVQJ 5D6EA 2E36A 1ODDA 2OA4A 5FKNA 2EZHA 1QPMA 3BR0A 3HSFA 3PNTA 3I4MJ 3WTZA 2DA6A 1MBJA 1U8RA 1E3OC 3H0GJ 2ICWG 4OMYA 2M5WA 1EJ9A 3PSFA 2JA2A 4A0ZA 3LOCA 1KU3A 4HF0A 1BL0A 2V26A 1R5GA 2LKXA 4RAYA 3ONQA 2BEOA 2BW3B 3LQQA 1D1BA 3ABTA 3DV8A 3K69A 3HPHA 4B3AA 3RTRA 2CRGA 3D5RC 4UB6C 1F43A 3ZQIA 4HNUA 1WH5A 4Y13A 2HQNA 3H1CA 4JBAA 1CF7A 1B72A 4A93J 3RKQA 2K02A 2JRMA 4CH7A 3L2QA 2LR8A 3TGNA 3CMAI 2E5NA 2LVSA 5J6XA 5J4YA 3ZMZA 2NS8A 4KMFA 1W7PB 3ZP5A 3FXUA 4LITA 4EV0A 1Z7LA 1J75A 1Z21A 4M3GA 2CW7A 1O7LA 3GO5A 3LSHA 4FHTA 5F04A 4IJAA 4II3A 4YRVA 1UZCA 4IHXA 1VQ6I 1LEAA 2M34A 4XR6A 5AIQA 3EYYA 4MEYF 4EJWA 2WY8Q 2WC2A 3W6KB 2PJRB 1HA8A 1LFUP 3MKYB 1U6GA 1YYVA 4UUSA 2EILH 3CJNA 3SXYA 3OYDA 3K1MA 2L02A 2H1LA 2O9LA 2KZVA 2ADUA 1YQAA 3Q0VA 1J59A 1OR7A 2EA4A 1ZGAA 2E7XA 4I0BA 4HQEA 3SHFA 1R9TJ 1FSHA 3C2BA 2HOTA 3FZVA 3PFIA 2UV1A 4HA8A 3HUGA 2OJED 3Q3SA 1A35A 3CP8A 2KISA 2VXZA 3I4NJ 2R7RA 1QU3A 1I6XA 2ELHA 3TKYA 3GEZA 1XTAA 4F7ZA 1JJ8C 3Q9VA 1B6AA 2ACJA 1IV8A 3RKWA 4PGHA 2DJIA 5H20A 2YPRA 1PP7U 3GF2A 3QP6A 2MG4A 4BDYA 4KFCA 1G3SA 1SMTA 1XMXA 4U87A 1R1UA 3CLOA 3QYEA 2HXOA 2DMUA 2QSHX 1G3WA 2LBFB 4B8XA 4KISA 5JLXA 2R5ZA 3L2UA 2XB0X 2DFHA 4DGWB 5ICCA 3AAFA 1E17A 3BZCA 2EA2A 5EJCA 4PJMA 1RETA 1UHMA 4P9FA 1UHWA 2BY3A 4XKVA 2BOLA 3WTUC 2MFZA 1X1CA 2CU7A 2L54A 2RV8A 1S7OA 4IOCF 3BCBA 2VASA 4G7ZF 1HW1A 4BU2A 3I64A 2ZMEC 3BTJA 2QQBA 2RGVA 2DBBA 5GTHC 2IW5A 2X6OA 1PYVA 5J1YA 3K4NA 3TOBA 3V8LA 1YX3A 1U2WA 3RPUA 3HOXJ 3QOPA 5M5XJ 4X0GA 2KL4A 3X2QH 2PG4A 4HLXA 2VT3A 3T8RA 1SD4A 2CYYA 5FO5A 1EF4A 5J40A 3OR1C 5KCMA 1X19A 4DZJA 4E7KA 4JOMA 1SFEA 5M5YJ 2UZKA 1FOXA 4BHBA 1XS9A 1YS6A 4RMNA 5J8FA 3BG3A 5IY5H 1IRXA 1SD6A 2L3DA 1MSEC 2EZKA 5FROA 4ZJZA 3JR9A 5IP7J 4OIPF 1RIOH 4P9UA 5IOYA 1JUPA 4B47A 3HOWJ 4BQOA 4ZYAA 1YTYA 3FBNB 3HXLA 1JE8A 4NC8A 4QIWN 3CESA 1RR7A 1TT5B 3BT9A 3QPTA 2BBYA 1IRFA 3IAS2 3A01B 2WB1A 2HZTA 1OR7C 4DQ2A 1V54H 5KNLA 2NVXJ 1JUMA 4XKCA 3GMEA 5F27A 2ZKZA 1HBXG 1FT9A 3I53A 3D5SC 4CHUA 2E1MC 2M4GA 4X6AJ 2FSWA 2K85A 1ZR2A 4RGXA 1ZAOA 4OIQF
chains in the Genus database with same CATH topology
1DU6A 1JKQC 1Z0XA 3SJMA 4V2FA 1X58A 3TW7A 4FCYA 3BR6A 2EQRA 2JN6A 3L1PA 3TP0A 3E7LA 4CYCB 2ELKA 3DEWA 3S1RJ 2H1KA 2XRLA 3SDGA 3S1NJ 1IJWC 1JT6A 1ZGWA 2L7FP 1LE8B 2VUMJ 3W6VA 4ABZA 5FJ8J 4A3EJ 1H89C 1TWGJ 5FKMA 4HNVA 3BTLA 3ZQCA 2VKVA 4FISA 2QCOA 3ZQLA 3K2AA 3JRFA 1WH7A 2JK3A 4BY7J 1K61A 4BY1J 2K40A 3S1QJ 5IYCJ 4A3IJ 3HEFA 3IV5A 4B4CA 3G1LA 4A3FJ 3QQAA 2ZB9A 1I6HJ 4A3CJ 2HQ5A 1AU7A 5EDNA 2L7ZA 2GBYA 1QPIA 1D5YA 3GTLJ 5IYDJ 1JJ6C 2DA4A 2IBDA 5K7HA 1MBEA 3ZQHA 2XPUA 1ZK8A 1IGNA 2E2JJ 1MBKA 2LFBA 3FIWA 3QPLA 2R5YA 2JJ7A 2Y9ZA 3HGYA 4JYKA 2E2IJ 1Z77A 1HCRA 1IDZA 2ECBA 1IUFA 2XGEA 1B8IA 2AHQA 2K9NA 2LY9A 4BBSJ 3BTIA 2N8GA 3CCYA 3S14J 3G1OA 1PUFB 3BR3A 2DA7A 1U78A 2Y9YA 3LSPA 3A01A 3NAUA 5FLMJ 1F36A 2JWTA 2ME0A 2VKEA 5M3MJ 4UUSB 3OOUA 3LSJA 2ME6A 5IP6A 4C3JJ 2CQQA 2JA6J 5EEAA 4XRSG 1GUUA 1OCPA 3BQZA 5EZGA 3F0CA 3PO3J 1X2MA 4C2MJ 2R93J 2ID6A 4V2GA 2TCTA 3HBLA 5EF6A 1APLC 2MSYA 2AO9A 4LOCA 4CYCA 1TWAJ 4W97A 5EG0B 3O8GA 3HOUJ 5IP9J 1JTXA 2P81A 2NS7A 1LE8A 1AHDP 2JMWA 3TEDA 2M8GX 2Y2ZA 2JA7J 4EEFG 1GVDA 4AUXA 5F0CA 3BG5A 2Y31A 2R0QC 4RBOA 2COBA 3RZOJ 4A3GJ 3BR1A 2R5ZB 1A6IA 3WHCA 1ETKA 2EZLA 1JT0A 4MLOA 1A5JA 4M3BA 2HI3A 1IV6A 3MN2A 1P7JA 1Y1WJ 2OPTA 2DJNA 1WGXA 1U8BA 4A3BJ 3A02A 2ID3A 2YS9A 4QTRA 1FTTA 3LSGA 2ECCA 4MO7A 4XIDA 4XRSA 2XPWA 3JRBA 4X1EA 2FJ1A 5F1JA 4BXXJ 1VI0A 1MBHA 5E3MA 3GTGJ 2DA3A 2O7OA 2HXIA 2VPRA 3FK6A 4M3FA 5J1RA 2GM4A 3K7AJ 1T56A 1YRNB 1MH4A 2K9QA 2RAEA 5EYRA 4BBRJ 3FK7A 5E3LA 1WPKA 3FISA 3JRGA 1FEXA 3S17J 1ITYA 3FKIJ 1HDDC 4Y52J 1U9OA 1RPWA 2D5VA 3Q0WA 5JLWA 9ANTA 2HOSA 3BQYA 3GTJJ 3M3YJ 2IEKA 1ETVA 4MFEA 4DZPA 1Q1VA 4XICA 4MIMA 1UHSA 3HGGA 3HOZJ 1OFCX 3A03A 1NK3P 1ETQA 1BJZA 1MBGA 3LNQA 1ORKA 1ETXA 4S0HB 3BG9A 2M9HA 5F0HA 1LFBA 1B72B 2GLOA 2W48A 1HLVA 4DW6A 1FTZA 5EG0A 2EBIA 3JRIA 1WCMJ 3OSFA 1ZTRA 2E2HJ 3GTOJ 1X2NA 1I3QJ 3HOVJ 2DMNA 2DTZA 2YUSA 2LD5A 2OF7A 3IH4A 2X48A 3RZDJ 4JX5A 3S2HJ 4AYBN 1FJLA 3H3VK 1XC5A 4FE4A 1IRZA 3MKLA 5IYBJ 4D5CA 4D7MA 5M3FJ 3BR5A 1VFCA 4M3EA 4JX4A 3ZQFA 1NTCA 1HOMA 3BTCA 1GV2A 2CJJA 5IOZA 2VI6A 1IC8A 2XGDA 5GP9A 2WV1A 3UKGA 1QRYA 4A3KJ 3Q0UA 4UUTA 5FKKA 1P7IA 1IDYA 4A69C 1RKWA 1I50J 3S15J 2DA1A 1ENHA 3O8HA 3NARA 4D7NA 5K7FA 2KT0A 4JP0A 5E3OA 5M5WJ 4JX6A 3BR2A 2YU9J 2EZIA 1W0UA 5EGOB 2DA2A 3VPRA 1GT0C 1YRNA 1H8AC 4IHWA 2NVQJ 1RKTA 3B6CA 4BKXA 2R92J 5FKNA 2EZHA 3BR0A 3I4MJ 1BA5A 2DA6A 1MBJA 1U9NA 1E3OC 3H0GJ 3ZOBA 1SFOJ 2R7ZJ 2XSDC 1FIPA 3LOCA 2E19A 4C3HJ 2EH3A 1BL0A 1CQTA 2LKXA 5E3NA 5GPCA 2LLKA 4XRMA 1JKRC 5FKLA 2O8KA 3HKZN 4B3AA 1W0TA 2CRGA 1DU0A 3LSRA 1F43A 2G0EA 3ZQIA 1WH5A 2XGCA 3D1NI 1O4XA 3PO2J 4M6VA 1ETOA 2CUFA 1B72A 3HB9A 4A93J 3RKQA 2HDDA 2LR8A 5DS9A 4A3MJ 2LVSA 1ZR4A 1ETYA 2NS8A 4B1RA 4I6ZA 2CQXA 2DA5A 1ZQ3P 5BNGA 1JKPC 5J1UA 1QVTA 4M3GA 5F04A 2MGQA 3ZQGA 5GPAA 5EZHA 5DTDA 1WI3A 2M0CA 2LTPA 1PUFA 4IHYA 1MSFC 3GTQJ 1AKHB 4IHXA 2NVTJ 1VNDA 3SFIA 2M34A 2JA5J 2NOGA 1RESA 2WB1N 1GDTA 2DN0A 2PMZN 2DMTA 2WAQN 4C3IJ 3RQIA 2LP0A 1LFUP 4UUSA 3DCFA 2TRTA 1UG2A 1UMQA 1HF0A 1K83J 2O9LA 3IH3A 3HM5A 1MBFA 3PM1A 3Q0VA 1BW5A 4RDUA 3JRCA 2E1OA 4D5FA 2M2EA 4MFDA 1NK2P 1R9TJ 1OJLA 2LK2A 2CUEA 2DMPA 3C2BA 4NDLA 2HOTA 1BW6A 3Q3SA 3I4NJ 4M3DA 1Y1VJ 5C4JJ 5EGOA 1JJ8C 1MH3A 2MW8A 3HOYJ 3OIOA 1TWHJ 2MG4A 1POGA 2HYJA 1H88C 3IH2A 2H8RA 4I76A 2HXOA 2DMUA 1JTYA 4Y7NJ 4J19A 3GTKJ 4A3LJ 4W1UA 3MVPA 3HDDA 5JLXA 2R5ZA 2FQ4A 2XB0X 4L5EA 4QSHA 1VF9A 1TWFJ 2I10A 2QF7A 3QPSA 2HOAA 4IEJA 4AC0A 3JRDA 3GTMJ 1ETWA 1ZKGA 1RETA 2NVYJ 1SANA 2Y30A 2L0KA 1MNMC 3GTPJ 2L9RA 2B63J 4A3JJ 2CU7A 3CMYA 4A3DJ 5K7ZA 5C4XJ 2FX0A 3GBGA 3TW6A 2JA8J 3BTJA 3M4OJ 1JUSA 2K9SA 3G1MA 2X6OA 5J1YA 1JKOC 3TP3A 1QVUA 1TWCJ 5M5XJ 4G12A 3HOXJ 3OSGA 3S2DJ 1AKHA 4FTHA 1EF4A 5FLVA 4DZJA 2IAIA 2XB5A 5M5YJ 1FIAA 1JGGA 1XS9A 3S16J 1S7EA 2KDZA 2R5YB 3JREA 3BG3A 5C44J 3CQZJ 1XG1A 4FE7A 1MSEC 2EZKA 2X9DA 1IG7A 3JR9A 5F08A 1HDPA 1TC3C 5IP7J 5IPAA 1B8IB 1GV5A 5IOYA 1JUPA 3HOWJ 2DMQA 4DYCA 1OCTC 4QIWN 4GFBA 2L7MP 1RR7A 3BT9A 4DYRA 4DYQA 3WHBA 3A01B 2Y0SN 3JRHA 2FD5A 4XK4A 4IHVA 2NVXJ 1G2HA 1JUMA 1T33A 3CDLA 5F27A 3JRAA 3B6AA 4X6AJ 1ZR2A 2XPVA 5F0FA 5J3LA 5FKOA 3S1MJ 5HODA 5C3EJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DU6 A;  1JKQ C;  1Z0X A;  3SJM A;  4V2F A;  1X58 A;  3TW7 A;  4FCY A;  3BR6 A;  2EQR A;  2JN6 A;  3L1P A;  3TP0 A;  3E7L A;  4CYC B;  2ELK A;  3DEW A;  3S1R J;  2H1K A;  2XRL A;  3SDG A;  3S1N J;  1IJW C;  1JT6 A;  1ZGW A;  2L7F P;  1LE8 B;  2VUM J;  3W6V A;  4ABZ A;  5FJ8 J;  4A3E J;  1H89 C;  1TWG J;  5FKM A;  4HNV A;  3BTL A;  3ZQC A;  2VKV A;  4FIS A;  2QCO A;  3ZQL A;  3K2A A;  3JRF A;  1WH7 A;  2JK3 A;  4BY7 J;  1K61 A;  4BY1 J;  2K40 A;  3S1Q J;  5IYC J;  4A3I J;  3HEF A;  3IV5 A;  4B4C A;  3G1L A;  4A3F J;  3QQA A;  2ZB9 A;  1I6H J;  4A3C J;  2HQ5 A;  1AU7 A;  5EDN A;  2L7Z A;  2GBY A;  1QPI A;  1D5Y A;  3GTL J;  5IYD J;  1JJ6 C;  2DA4 A;  2IBD A;  5K7H A;  1MBE A;  3ZQH A;  2XPU A;  1ZK8 A;  1IGN A;  2E2J J;  1MBK A;  2LFB A;  3FIW A;  3QPL A;  2R5Y A;  2JJ7 A;  2Y9Z A;  3HGY A;  4JYK A;  2E2I J;  1Z77 A;  1HCR A;  1IDZ A;  2ECB A;  1IUF A;  2XGE A;  1B8I A;  2AHQ A;  2K9N A;  2LY9 A;  4BBS J;  3BTI A;  2N8G A;  3CCY A;  3S14 J;  3G1O A;  1PUF B;  3BR3 A;  2DA7 A;  1U78 A;  2Y9Y A;  3LSP A;  3A01 A;  3NAU A;  5FLM J;  1F36 A;  2JWT A;  2ME0 A;  2VKE A;  5M3M J;  4UUS B;  3OOU A;  3LSJ A;  2ME6 A;  5IP6 A;  4C3J J;  2CQQ A;  2JA6 J;  5EEA A;  4XRS G;  1GUU A;  1OCP A;  3BQZ A;  5EZG A;  3F0C A;  3PO3 J;  1X2M A;  4C2M J;  2R93 J;  2ID6 A;  4V2G A;  2TCT A;  3HBL A;  5EF6 A;  1APL C;  2MSY A;  2AO9 A;  4LOC A;  4CYC A;  1TWA J;  4W97 A;  5EG0 B;  3O8G A;  3HOU J;  5IP9 J;  1JTX A;  2P81 A;  2NS7 A;  1LE8 A;  1AHD P;  2JMW A;  3TED A;  2M8G X;  2Y2Z A;  2JA7 J;  4EEF G;  1GVD A;  4AUX A;  5F0C A;  3BG5 A;  2Y31 A;  2R0Q C;  4RBO A;  2COB A;  3RZO J;  4A3G J;  3BR1 A;  2R5Z B;  1A6I A;  3WHC A;  1ETK A;  2EZL A;  1JT0 A;  4MLO A;  1A5J A;  4M3B A;  2HI3 A;  1IV6 A;  3MN2 A;  1P7J A;  1Y1W J;  2OPT A;  2DJN A;  1WGX A;  1U8B A;  4A3B J;  3A02 A;  2ID3 A;  2YS9 A;  4QTR A;  1FTT A;  3LSG A;  2ECC A;  4MO7 A;  4XID A;  4XRS A;  2XPW A;  3JRB A;  4X1E A;  2FJ1 A;  5F1J A;  4BXX J;  1VI0 A;  1MBH A;  5E3M A;  3GTG J;  2DA3 A;  2O7O A;  2HXI A;  2VPR A;  3FK6 A;  4M3F A;  5J1R A;  2GM4 A;  3K7A J;  1T56 A;  1YRN B;  1MH4 A;  2K9Q A;  2RAE A;  5EYR A;  4BBR J;  3FK7 A;  5E3L A;  1WPK A;  3FIS A;  3JRG A;  1FEX A;  3S17 J;  1ITY A;  3FKI J;  1HDD C;  4Y52 J;  1U9O A;  1RPW A;  2D5V A;  3Q0W A;  5JLW A;  9ANT A;  2HOS A;  3BQY A;  3GTJ J;  3M3Y J;  2IEK A;  1ETV A;  4MFE A;  4DZP A;  1Q1V A;  4XIC A;  4MIM A;  1UHS A;  3HGG A;  3HOZ J;  1OFC X;  3A03 A;  1NK3 P;  1ETQ A;  1BJZ A;  1MBG A;  3LNQ A;  1ORK A;  1ETX A;  4S0H B;  3BG9 A;  2M9H A;  5F0H A;  1LFB A;  1B72 B;  2GLO A;  2W48 A;  1HLV A;  4DW6 A;  1FTZ A;  5EG0 A;  2EBI A;  3JRI A;  1WCM J;  3OSF A;  1ZTR A;  2E2H J;  3GTO J;  1X2N A;  1I3Q J;  3HOV J;  2DMN A;  2DTZ A;  2YUS A;  2LD5 A;  2OF7 A;  3IH4 A;  2X48 A;  3RZD J;  4JX5 A;  3S2H J;  4AYB N;  1FJL A;  3H3V K;  1XC5 A;  4FE4 A;  1IRZ A;  3MKL A;  5IYB J;  4D5C A;  4D7M A;  5M3F J;  3BR5 A;  1VFC A;  4M3E A;  4JX4 A;  3ZQF A;  1NTC A;  1HOM A;  3BTC A;  1GV2 A;  2CJJ A;  5IOZ A;  2VI6 A;  1IC8 A;  2XGD A;  5GP9 A;  2WV1 A;  3UKG A;  1QRY A;  4A3K J;  3Q0U A;  4UUT A;  5FKK A;  1P7I A;  1IDY A;  4A69 C;  1RKW A;  1I50 J;  3S15 J;  2DA1 A;  1ENH A;  3O8H A;  3NAR A;  4D7N A;  5K7F A;  2KT0 A;  4JP0 A;  5E3O A;  5M5W J;  4JX6 A;  3BR2 A;  2YU9 J;  2EZI A;  1W0U A;  5EGO B;  2DA2 A;  3VPR A;  1GT0 C;  1YRN A;  1H8A C;  4IHW A;  2NVQ J;  1RKT A;  3B6C A;  4BKX A;  2R92 J;  5FKN A;  2EZH A;  3BR0 A;  3I4M J;  1BA5 A;  2DA6 A;  1MBJ A;  1U9N A;  1E3O C;  3H0G J;  3ZOB A;  1SFO J;  2R7Z J;  2XSD C;  1FIP A;  3LOC A;  2E19 A;  4C3H J;  2EH3 A;  1BL0 A;  1CQT A;  2LKX A;  5E3N A;  5GPC A;  2LLK A;  4XRM A;  1JKR C;  5FKL A;  2O8K A;  3HKZ N;  4B3A A;  1W0T A;  2CRG A;  1DU0 A;  3LSR A;  1F43 A;  2G0E A;  3ZQI A;  1WH5 A;  2XGC A;  3D1N I;  1O4X A;  3PO2 J;  4M6V A;  1ETO A;  2CUF A;  1B72 A;  3HB9 A;  4A93 J;  3RKQ A;  2HDD A;  2LR8 A;  5DS9 A;  4A3M J;  2LVS A;  1ZR4 A;  1ETY A;  2NS8 A;  4B1R A;  4I6Z A;  2CQX A;  2DA5 A;  1ZQ3 P;  5BNG A;  1JKP C;  5J1U A;  1QVT A;  4M3G A;  5F04 A;  2MGQ A;  3ZQG A;  5GPA A;  5EZH A;  5DTD A;  1WI3 A;  2M0C A;  2LTP A;  1PUF A;  4IHY A;  1MSF C;  3GTQ J;  1AKH B;  4IHX A;  2NVT J;  1VND A;  3SFI A;  2M34 A;  2JA5 J;  2NOG A;  1RES A;  2WB1 N;  1GDT A;  2DN0 A;  2PMZ N;  2DMT A;  2WAQ N;  4C3I J;  3RQI A;  2LP0 A;  1LFU P;  4UUS A;  3DCF A;  2TRT A;  1UG2 A;  1UMQ A;  1HF0 A;  1K83 J;  2O9L A;  3IH3 A;  3HM5 A;  1MBF A;  3PM1 A;  3Q0V A;  1BW5 A;  4RDU A;  3JRC A;  2E1O A;  4D5F A;  2M2E A;  4MFD A;  1NK2 P;  1R9T J;  1OJL A;  2LK2 A;  2CUE A;  2DMP A;  3C2B A;  4NDL A;  2HOT A;  1BW6 A;  3Q3S A;  3I4N J;  4M3D A;  1Y1V J;  5C4J J;  5EGO A;  1JJ8 C;  1MH3 A;  2MW8 A;  3HOY J;  3OIO A;  1TWH J;  2MG4 A;  1POG A;  2HYJ A;  1H88 C;  3IH2 A;  2H8R A;  4I76 A;  2HXO A;  2DMU A;  1JTY A;  4Y7N J;  4J19 A;  3GTK J;  4A3L J;  4W1U A;  3MVP A;  3HDD A;  5JLX A;  2R5Z A;  2FQ4 A;  2XB0 X;  4L5E A;  4QSH A;  1VF9 A;  1TWF J;  2I10 A;  2QF7 A;  3QPS A;  2HOA A;  4IEJ A;  4AC0 A;  3JRD A;  3GTM J;  1ETW A;  1ZKG A;  1RET A;  2NVY J;  1SAN A;  2Y30 A;  2L0K A;  1MNM C;  3GTP J;  2L9R A;  2B63 J;  4A3J J;  2CU7 A;  3CMY A;  4A3D J;  5K7Z A;  5C4X J;  2FX0 A;  3GBG A;  3TW6 A;  2JA8 J;  3BTJ A;  3M4O J;  1JUS A;  2K9S A;  3G1M A;  2X6O A;  5J1Y A;  1JKO C;  3TP3 A;  1QVU A;  1TWC J;  5M5X J;  4G12 A;  3HOX J;  3OSG A;  3S2D J;  1AKH A;  4FTH A;  1EF4 A;  5FLV A;  4DZJ A;  2IAI A;  2XB5 A;  5M5Y J;  1FIA A;  1JGG A;  1XS9 A;  3S16 J;  1S7E A;  2KDZ A;  2R5Y B;  3JRE A;  3BG3 A;  5C44 J;  3CQZ J;  1XG1 A;  4FE7 A;  1MSE C;  2EZK A;  2X9D A;  1IG7 A;  3JR9 A;  5F08 A;  1HDP A;  1TC3 C;  5IP7 J;  5IPA A;  1B8I B;  1GV5 A;  5IOY A;  1JUP A;  3HOW J;  2DMQ A;  4DYC A;  1OCT C;  4QIW N;  4GFB A;  2L7M P;  1RR7 A;  3BT9 A;  4DYR A;  4DYQ A;  3WHB A;  3A01 B;  2Y0S N;  3JRH A;  2FD5 A;  4XK4 A;  4IHV A;  2NVX J;  1G2H A;  1JUM A;  1T33 A;  3CDL A;  5F27 A;  3JRA A;  3B6A A;  4X6A J;  1ZR2 A;  2XPV A;  5F0F A;  5J3L A;  5FKO A;  3S1M J;  5HOD A;  5C3E J; 
#chains in the Genus database with same CATH topology
 1T2K A;  1DU6 A;  1K4T A;  3F72 A;  4L9T A;  4XOR A;  4RAZ A;  2Y0M A;  5BS6 A;  1WJA A;  2QKL B;  1X58 A;  2P7V B;  3WTY C;  3CDH A;  4IX7 A;  1F9N A;  4B09 A;  4OMZ A;  2EQR A;  4BQQ A;  3CCS I;  2CG4 A;  2DFE A;  1ZYR F;  5FRM A;  2ZJP F;  3E1S A;  2H1K A;  2EIJ H;  1IF1 A;  3GW2 A;  3CC7 I;  2Z2S B;  1BR2 A;  2ZXJ A;  1IJW C;  1K6O A;  3PIP F;  4Y4R A;  2VKD A;  2UXX A;  2VUM J;  1PDN C;  2A6H F;  1B1B A;  1H89 C;  2V1X A;  1TWG J;  4OIR F;  5FKM A;  4HNV A;  3SEQ A;  1YIT I;  3AKZ A;  3ZQC A;  4PJJ A;  3KP3 A;  2O8X A;  2K3F A;  4KUM A;  2ELJ A;  3GYH X;  3JRF A;  4IRG A;  1WJE A;  5LBQ A;  2JK3 A;  1R1V A;  4NUB A;  4HW0 A;  1BBY A;  3I5U A;  3R60 A;  3IV5 A;  2DCE A;  1J2X A;  2ZB9 A;  3QQA A;  1HXD A;  1R49 A;  4IVN A;  2LKS A;  2L7Z A;  2GBY A;  4L9J A;  2DT7 B;  2DA4 A;  4HAM A;  1R7J A;  1ZK8 A;  1MIJ A;  5F64 A;  4XMY A;  1IGN A;  4IHT A;  1FBQ A;  4IPA A;  1Z91 A;  4MQV A;  5E79 C;  4FAS D;  3J80 Z;  3FIW A;  3QPL A;  2JJ7 A;  3DBL B;  5HS8 A;  3FHZ A;  2LF7 A;  4UVC A;  5LD2 C;  1F1Z A;  2EV6 A;  1IUF A;  3EYI A;  2WAF A;  2LY9 A;  3BTI A;  1X4P A;  2KRH A;  4J01 A;  2L5Q A;  3BR3 A;  2ETH A;  1WJB A;  5CLS A;  3FM5 A;  4NC7 A;  1U78 A;  1WJ5 A;  1XGS A;  1RC9 A;  4I01 A;  2KJC A;  2BY0 A;  5FB2 A;  3OYM A;  2WTE A;  1FOY A;  4LLN A;  3ZN0 A;  4UUS B;  3S32 A;  1D1A A;  4WWC A;  3OS1 A;  1DGR M;  5AIP A;  5IP6 A;  3MKZ A;  2HGC A;  1IN7 A;  3PJR A;  1GUU A;  1N75 A;  1P92 A;  1T8I A;  2OCE A;  2X1C A;  1HKS A;  2PBI A;  4CO8 A;  3LAJ A;  2B7E A;  3LFK A;  5DCM A;  3KEQ A;  2V9V A;  5ILV A;  3DLA A;  2R93 J;  3ZMD A;  4XLF A;  4KJZ A;  3HBL A;  5FGM A;  4CSW A;  5EF6 A;  3DXJ F;  2MSY A;  1R4M B;  2L2O A;  1WHU A;  3ERE D;  1MJA A;  3BDD A;  4XRF A;  2QBY B;  2PFB A;  3OOP A;  1FY7 A;  1WKM A;  4PJ0 C;  2H94 A;  5IP9 J;  1BI1 A;  1JTX A;  3L2R A;  2JVG A;  3IWF A;  2CMP A;  1ZRF A;  4BE0 A;  4ZYE A;  4EJU A;  2XC7 A;  1Y6I A;  2Y2Z A;  2HKX A;  3B73 A;  4EEF G;  2BZT A;  3DKX A;  1G4D A;  4J00 A;  4AUX A;  4ZDO A;  2Y31 A;  4C2U A;  4HNT A;  4RBO A;  5FFX A;  4AID A;  1TP4 A;  2IVM A;  2W25 A;  3K0L A;  3ULQ B;  3RZO J;  2M7B A;  2R5Z B;  2ZNZ A;  1PUE E;  1MMG A;  4A12 A;  2H6C A;  2VQH A;  3HYI A;  2HI3 A;  4QLC U;  4ZYD A;  1IV6 A;  3MN2 A;  1V55 H;  3OR2 C;  1P7J A;  3FDY A;  1N25 A;  2DJN A;  3HC7 A;  3BY6 A;  1HQC A;  4HST A;  1GHC A;  4A3B J;  4A0X A;  3VOD A;  2ECC A;  4M74 A;  4UVA A;  4CIC A;  4RB1 A;  3DEU A;  3FWE A;  2NYX A;  4AVP A;  1HW2 A;  4IQ4 A;  4YIF A;  1J09 A;  5B3S H;  1QBJ A;  5TJJ A;  5E3M A;  3F8B A;  2AQF A;  3GTG J;  1TT0 A;  2VPR A;  2G9W A;  3HTU A;  2E1C A;  3K7A J;  2R7O A;  1ZG3 A;  4R8H A;  4ZYH A;  2UUZ A;  3FIS A;  3W2V A;  2KDO A;  2O5R A;  3F8C A;  3FKI J;  3O3K A;  4EGY A;  1YI2 I;  2V6E A;  4Y52 J;  1ITY A;  1U9O A;  4M72 A;  1RPW A;  3I56 I;  4XLA A;  4HRI A;  2V79 A;  3HPG A;  3U21 A;  4MFE A;  3U1D A;  3ROU A;  1UEL B;  2HKO A;  4XIC A;  2HYG D;  3HRU A;  3EET A;  1OFC X;  1ETQ A;  3OIP A;  5B1A H;  4PDK A;  4HF2 A;  1H9G A;  2XAG A;  4RGR A;  2JPB A;  1STZ A;  2JUG A;  1BC8 C;  3IWZ A;  2M9H A;  4CCM A;  4PFO A;  5FLX Z;  5F0H A;  2KIU A;  4RM3 A;  1R4N B;  3ABK H;  2LC2 A;  3UNG C;  3ZN1 A;  3HIF A;  1KON A;  4P1W A;  2DOD A;  2QKM B;  3K4J A;  2ESH A;  3P9C A;  4U7D A;  1ZTR A;  2X1D A;  4U0W A;  1FNN A;  4IQJ A;  3PNV A;  2DK8 A;  4G6T B;  2J5O A;  1ZGJ A;  2YUS A;  3E5X A;  3J80 K;  4BXF A;  2OF7 A;  2DAO A;  3S2W A;  1WZ2 A;  3OL3 A;  4B3X A;  4BGD A;  3SZP A;  3G6E I;  3QU3 A;  2PMH A;  2BV6 A;  2Y69 H;  2ISZ A;  2B0L A;  4AYB N;  3H3V K;  4O3M A;  3S2H J;  2HVQ A;  3GZ5 A;  2LMD A;  1IRZ A;  1D3Y A;  1IN5 A;  4FQG A;  2LKP A;  4D7M A;  1K7A A;  1ZLK A;  3WU0 A;  1EH7 A;  3C2G A;  4JX4 A;  3CLQ A;  3JTH A;  2X4H A;  3BJA A;  5DDG A;  4PK4 A;  2O3F A;  1SAU A;  3UKG A;  4UUT A;  3PFY A;  1OYY A;  2PJP A;  2CW8 A;  1ZHF A;  3V7S A;  2RDP A;  1DP3 A;  1IDY A;  1F5T A;  4A69 C;  1RKW A;  1I50 J;  5D5W B;  3KP7 A;  3NAR A;  2H6B A;  1MGT A;  2NVU B;  4PZJ A;  3AFH A;  3IRR A;  2EZI A;  5EGO B;  2P7C B;  2DA2 A;  3J7Y J;  1Y8Q B;  4MHG A;  5B66 C;  1YRN A;  4RM2 A;  2XRO A;  1X1P A;  2FRH A;  3MKW B;  4BKX A;  3M8J A;  3D5L A;  2C6Y A;  2R92 J;  1D1C A;  4GO1 A;  1MMS A;  4UY8 I;  3QWL A;  3PIO F;  5F6F A;  3L00 A;  2V1D A;  1U3E M;  3CD6 I;  3EUH A;  3ZXS A;  4MQ9 F;  4ASN A;  5E3N A;  1ZG1 A;  4L0Y B;  3ELK A;  3E6M A;  4YFK F;  2CFO A;  4RGU A;  2FEZ A;  3CC2 I;  4D0P A;  2O8K A;  1QO0 D;  4NBQ A;  1BIB A;  3ZMT A;  3LSR A;  4KN7 X;  1OYI A;  4LG0 A;  3D1N I;  2W00 A;  3TBI A;  2A69 F;  3HB9 A;  4K2E A;  2MYS A;  2JZY A;  5DS9 A;  2VN2 A;  3OL4 A;  4NQW A;  1ETY A;  2ZC2 A;  5ILS A;  2DA5 A;  2E60 A;  3I71 A;  1SVM A;  3BP8 A;  5BNG A;  1QVT A;  3OYI A;  1GLN A;  3K2Z A;  2K4B A;  2CWE A;  2OV7 A;  2JRT A;  3M8E A;  3J81 Z;  4ENN A;  2M4K A;  1WI3 A;  2M0C A;  2GWR A;  1EA3 A;  4DBQ A;  4KA4 A;  5L3E A;  3FMQ A;  1GDT A;  2D45 A;  4HX4 A;  3RQI A;  2LP0 A;  2HTJ A;  2DYS H;  3BC8 A;  2JPC A;  3DCF A;  1UG2 A;  1RI7 A;  1XPX A;  1UMQ A;  4F55 A;  1UFM A;  4EQQ A;  3IH3 A;  1GXQ A;  3HM5 A;  3C7J A;  1MBF A;  3PM1 A;  1ZG5 A;  1BW5 A;  4U88 A;  5HLH A;  4RDU A;  2EIM H;  4RB0 A;  3JRC A;  2M2E A;  4MFD A;  4CUG A;  1IRG A;  2FUG 2;  2LK2 A;  2QZ8 A;  2DMP A;  4OIN F;  1OCZ H;  4KT6 A;  4NDL A;  3OS2 A;  3OV8 A;  1BW6 A;  2XF7 A;  2STW A;  5E8G A;  1GXP A;  5J47 A;  4M3D A;  3U2R A;  3P9I A;  4ENK A;  5H2F C;  3CF2 A;  2MW8 A;  4YEL A;  4Q4Z F;  3OIO A;  1WSU A;  3RJP A;  5FLX K;  3KP5 A;  1YS7 A;  1LEB A;  3MZY A;  4AIH A;  3ZCO A;  5DCF A;  1RRJ A;  3G3Z A;  1JXS A;  5J8C A;  3IH2 A;  4I76 A;  3ZGK A;  1UAA A;  2GIV A;  2GOX B;  4W1U A;  3SDB A;  4XNF A;  3DPT A;  2VOO A;  2DLL A;  4HZF A;  2VT2 A;  4L5E A;  2FE3 A;  2H09 A;  2E1N A;  1SEU A;  2L4A A;  2D1H A;  1W36 D;  1T0F A;  2JUC A;  4IKF A;  2F4M B;  3JRD A;  3GTM J;  1ETW A;  3BPV A;  2NVY J;  2IT0 A;  2HFH A;  4I2O A;  2Y30 A;  2L0K A;  1MNM C;  2L9R A;  3VYR B;  4YFX F;  4A3J J;  1D8K A;  2R7T A;  3CMM A;  3GUD A;  4ZZD A;  3ESW B;  1K4S A;  2LSO A;  3FXR A;  2E34 A;  1KQ8 A;  5ILU A;  2RQQ A;  1O57 A;  3GBG A;  1FZP B;  1LFP A;  2JA8 J;  3F8F A;  3M4O J;  3KEO A;  2ZNY A;  4HLY A;  3G1M A;  4GXO A;  4G12 A;  2CUZ A;  1AKH A;  2QWW A;  3AL0 B;  1YO5 C;  3P9K A;  4I09 A;  2R7Q A;  1FIA A;  1RUO A;  3S16 J;  1S7E A;  3H5A A;  3MWM A;  2KDZ A;  2R5Y B;  4ESJ A;  3E5Q A;  3V7C A;  5B5E C;  3TQN A;  1R6R A;  4QWQ A;  1DPU A;  2RRE A;  3CQZ J;  1XG1 A;  1Y56 A;  2XHK A;  3V42 A;  2X9D A;  4RAF A;  3J7A O;  2W1O A;  1GV5 A;  1L0O C;  2ZME A;  4FET A;  3DU6 A;  1BR1 A;  2BHZ A;  5E20 A;  1WRJ A;  1G8X A;  3WHB A;  3F23 A;  3OYL A;  3JRH A;  4IHV A;  2PMZ A;  2WAQ A;  3I59 B;  1Y0N A;  3SQN A;  3SYT A;  1T33 A;  2VC1 A;  3JRA A;  2BYV E;  1D0Z A;  1LJ9 A;  3IRQ A;  1KGS A;  2OAZ A;  2X0L A;  3DF8 A;  5GAH J;  1IN8 A;  2AS5 F;  2L9V A;  1P6R A;  2A3S A;  1XDU A;  1JKQ C;  2O6G E;  2YU3 A;  3K4M A;  3KLN A;  2FOW A;  3TW7 A;  3K70 D;  4XOP A;  1FSE A;  4IRI A;  2HQA A;  2MLG A;  4Z6Y A;  1AWC A;  2XF5 A;  2R7F A;  3E6B A;  2JN6 A;  3RDI A;  3J81 K;  1E3P A;  2A05 A;  4UV9 A;  3DBH B;  3L1P A;  3N4M A;  5CQE A;  2EFP A;  1VQO I;  1FBU A;  3DLL F;  2OTL I;  1NG6 A;  2QEN A;  2IGN A;  2XRL A;  4L0Z B;  3WU2 C;  1JT6 A;  3K1P A;  1ZGW A;  2L7F P;  1LE8 B;  3AG4 H;  3W6V A;  4ABZ A;  2XSJ C;  4C9Y A;  3GLL A;  5FJ8 J;  2L4M A;  3ZRG A;  1T0F C;  3V7R A;  3BTL A;  2CV0 A;  3FKJ A;  1BOB A;  1MZB A;  1OCO H;  2QCO A;  4FIS A;  3K2A A;  3ZQL A;  1ON2 A;  5LLQ A;  4XQF A;  2VBX A;  3BOQ A;  2QVO A;  4M73 A;  2DT6 A;  3MMY B;  5IYC J;  1WJF A;  4A3I J;  4E7J A;  3G1L A;  1OCC H;  1P4A A;  3JSO A;  3WTW C;  2HQ5 A;  2VL8 A;  1QPI A;  2DYR H;  1D5Y A;  2CV2 A;  1YFH A;  3GTL J;  3VB2 A;  2F2E A;  1JJ6 C;  4LG3 A;  1J0R A;  2XPU A;  5HVQ C;  4XKB A;  2WY7 Q;  4G6D A;  2STT A;  3H5N A;  1MBK A;  3QOD A;  2LFB A;  3E6D A;  4RGS A;  5CJ9 A;  2E2I J;  1R5H A;  3GFJ A;  2OU2 A;  4PJN A;  2ISY A;  1HCR A;  2HVR A;  2ECB A;  3OYJ A;  2GXA A;  1JI8 A;  1B8I A;  1MMD A;  2K9N A;  5KAI C;  5LHH A;  1QHH D;  3LL7 A;  2GXB A;  3F6V A;  2BGC A;  4H4K C;  4IF4 A;  3LSP A;  3DFG A;  5DYM A;  1A36 A;  4KYW A;  2L9S A;  3OWT A;  1XMK A;  1F36 A;  5L3F A;  1MMN A;  2KLO A;  3Q5F A;  2VKE A;  4EM2 A;  2F48 A;  4ITV A;  3LSJ A;  1R36 A;  1T98 A;  2IS2 A;  3L2V A;  1IXR C;  4C3J J;  1T08 B;  5EEA A;  2ZCW A;  2ZXW H;  2K27 A;  4M6X A;  1IZ1 A;  2F4O B;  5LGT A;  1X2M A;  2ID6 A;  3WG7 H;  4V2G A;  4A2U A;  3MCZ A;  1VQL I;  4N9H A;  1APL C;  1K78 A;  4CYC A;  4D9J A;  1TWA J;  2QEX I;  1SD5 A;  5EG0 B;  2W84 A;  3E6C C;  3G2B A;  2KFD A;  3O8G A;  3HOU J;  2R4G A;  2P81 A;  3WE3 A;  3PUB A;  2XIG A;  2X6Y A;  3ASN H;  5KHD A;  2JMW A;  3ABM H;  1QA6 A;  2XAF A;  1DDN A;  1GVD A;  3KP2 A;  4GGG A;  2IGO A;  4TV7 A;  3F6O A;  5F0C A;  2R0Q C;  2RQP A;  4AVZ A;  2COB A;  1BJA A;  1LPQ A;  1ZLJ A;  1PJR A;  4GRI A;  1DPR A;  3FMS A;  3KZZ A;  4MLO A;  2W85 A;  3K4L A;  4P96 A;  3FBI B;  1A5J A;  4M3B A;  1V5G A;  2DXI A;  4PFP A;  2GXG A;  1Y1W J;  1O3S A;  4EJT A;  1WGX A;  1U8B A;  4UB8 C;  2DDB A;  4PGG A;  1TBX A;  2H8W A;  1FTT A;  5ED4 A;  1XSD A;  3LSG A;  1JGS A;  4MO7 A;  2XPW A;  1IXS B;  4KIC A;  4LGW A;  4BXX J;  1N77 A;  1MBH A;  1HC8 A;  3OYB A;  2O7O A;  2EPF A;  2HXI A;  3FK6 A;  2JT1 A;  4M3F A;  2VON A;  1FYL A;  2PMU A;  1MH4 A;  3M07 A;  5EYR A;  2CW0 F;  3WGG A;  3JCU C;  3FK7 A;  3R61 A;  2LF8 A;  1AOY A;  5E17 F;  2OCC H;  2ZFW A;  4E6K G;  2V4J C;  4CCO A;  5GAD J;  4HPQ A;  1TW3 A;  4BJ6 C;  2DPD A;  3RPQ A;  2W57 A;  2D5V A;  3FMR A;  3H5R A;  1Y39 A;  2HOS A;  1S5L C;  3BQY A;  1S29 A;  2IEK A;  2FNP A;  3O6B B;  5GAE J;  1BOA A;  1E3H A;  3DU5 A;  2K3P A;  1UHS A;  1EH8 A;  4R1H A;  1U0J A;  2VXD A;  3H9G A;  1YW8 A;  3KE2 A;  1ORK A;  2NRA C;  1USS A;  3BG9 A;  3K6G A;  3MAJ A;  3S3N A;  1O3R A;  3CUQ A;  3IUO A;  2ZME B;  4G9Y A;  1FLI A;  5HS9 A;  4I7H A;  5KAF C;  3QAH A;  2X85 A;  1CF7 B;  1B72 B;  4AYB A;  2W48 A;  5LEJ A;  1HLV A;  1OKR A;  2Y48 A;  4DW6 A;  3I55 I;  1VQ7 I;  3RPU D;  3I4P A;  2KRC A;  1MD0 A;  2KQR A;  5L3D A;  2EBI A;  1TQP A;  5JHU A;  3RQ4 A;  4AU7 A;  1WCM J;  1F4K A;  3OSF A;  1U5T A;  1IW7 F;  4E7L A;  1R5I D;  3CME I;  2XVC A;  2FNA A;  1SVO A;  2F5V A;  1I3Q J;  3HOV J;  4L5I A;  2DMN A;  1TLH B;  3CCE I;  2EFN A;  2DTZ A;  4HYE A;  5L3B A;  4XN3 A;  4AM3 A;  3WTX C;  2W4S A;  3HZJ A;  3E97 A;  1KYW A;  3D0S A;  2K86 A;  4KIB A;  1FJL A;  3K9T A;  2RC4 A;  1XC5 A;  4FE4 A;  3V8J A;  3MKL A;  3N97 A;  3C3W A;  4EJO A;  4BXU A;  5M3F J;  2BXY A;  1SFX A;  1HOM A;  3AG3 H;  4BEH A;  3BTC A;  4C30 A;  1GV2 A;  3GFM A;  5IOZ A;  2Z99 A;  2OZ6 A;  1Y8R B;  2WV1 A;  1QRY A;  3Q0U A;  5FKK A;  2YX4 A;  1RNL A;  1UB9 A;  1FMV A;  1A6Q A;  4RB3 C;  3IL2 A;  2DA1 A;  5K7F A;  4JP0 A;  1VQ4 I;  3HUG B;  4CCJ A;  4MEX F;  1A04 A;  2XAU A;  1GT0 C;  5E18 F;  3F8N A;  1RKT A;  3B6C A;  3E0J B;  2VB6 A;  3CCU I;  4A5N A;  3G4S I;  3VOE A;  2FA5 A;  1U9N A;  3FM3 A;  4O6J A;  2UXN A;  3KX2 A;  1SFO J;  2XSD C;  1FIP A;  4IZZ A;  4Q47 A;  2E19 A;  4U7B A;  3LMM A;  3O2P E;  4E7H A;  1CQT A;  1R71 A;  4G7O F;  2KIF A;  3I0T A;  1XX5 A;  3KYL A;  5GPC A;  2LLK A;  5CYV A;  3OS0 A;  4PJL A;  3S8P A;  4G7H F;  4WK8 F;  2HDW A;  5HNH A;  2IGM A;  3U1K A;  2L01 A;  4S04 A;  1XSX A;  1H0M A;  2VOP A;  5BQT A;  4M6V A;  1YJN I;  3A4C A;  1W5S A;  4XN0 A;  5FD5 A;  2DPU A;  2CV1 A;  2HDD A;  3CCV I;  3T5X A;  3KLO A;  3CUQ C;  3LFU A;  5BOX A;  4L5J A;  2Q2E A;  3VSL A;  1JKP C;  2EK5 A;  4IOA F;  3MFK A;  2HS5 A;  1VQM I;  1IO2 A;  2MGQ A;  2IGK A;  4EVI A;  3CUO A;  5GPA A;  2W7N A;  2MAB A;  3PNY A;  3GTQ J;  1U5T C;  2W24 A;  3UR3 C;  4LK1 F;  1VND A;  1ZAR A;  3SFI A;  4LLG F;  2JA5 J;  2YX7 A;  2NOG A;  3ERM A;  4OWR B;  1RES A;  2WB1 N;  5KK1 A;  2XAS A;  4F3Q A;  3KET A;  2DN0 A;  4ZZL A;  4C3I J;  2MD5 A;  1IAW A;  4ESF A;  2FMY A;  4U0Y A;  4XLH A;  2P6T A;  2XKO A;  5DD4 A;  2VQC A;  2K4J A;  1TNT A;  3I54 A;  2X6X A;  3NWS A;  2M7A A;  3J7A Y;  3RKX A;  4D5F A;  1LNW A;  2P0W A;  3GZN B;  3VSK A;  2CUE A;  3CJR B;  2R7X A;  1IXC A;  1X1D A;  2OQG A;  3PL8 A;  5LRR A;  2PI0 A;  2P6S A;  2KIM A;  2KHM A;  2EB7 A;  2WBM A;  2HTS A;  3RYR A;  4F92 B;  1POG A;  4CCK A;  3BRO A;  2OD5 A;  5BMZ A;  4Y3O A;  2K7L A;  1OCR H;  3F3X A;  1JTY A;  4A3L J;  4J19 A;  3GTK J;  1MKM A;  3RKY A;  3CZ6 A;  4E4H A;  4YII A;  3P7N A;  3HDD A;  4CGZ A;  4BQN A;  1XSV A;  2FQ4 A;  1REP C;  1YX5 A;  1J9I A;  4QSH A;  5L3C A;  2BW3 A;  5JVT A;  2I10 A;  5GAG J;  3QPS A;  2HOA A;  2W82 A;  4N9I A;  1DUX C;  1ZEL A;  4GCV A;  1L3L A;  2FBK A;  3M7G A;  1X3W B;  1SAN A;  1BM9 A;  1KZH A;  5DUI A;  2Z1D A;  3CMY A;  3COA C;  5K7Z A;  2J5P A;  5JI6 A;  2KRF A;  2VQL A;  4HQM A;  3PQK A;  3TW6 A;  1O7F A;  4ZDP A;  2V7F A;  4RS8 A;  4M9X A;  1W7P A;  4P5O A;  2LRD A;  1DGW Y;  4KN4 X;  5GTI C;  1JKO C;  1WFX A;  3TP3 A;  1LVK A;  2VC0 A;  2VJJ A;  2QSG X;  1QVU A;  1TTY A;  4OAZ A;  3OSG A;  5B1B H;  1BR4 A;  4Z2Y A;  1D0X A;  3HG9 A;  2DI3 A;  4LFU A;  4FTH A;  2BVL A;  2KMU A;  2AXL A;  2HNH A;  3QYB A;  2XB5 A;  2P5K A;  2PJR A;  4EMS A;  1JGG A;  3EQL F;  4C2T A;  2CQN A;  4A6D A;  1H9T A;  2MLK A;  2IS6 A;  3JRE A;  1A31 A;  5CQG A;  4FE7 A;  3VWB A;  2AXT C;  3ZQQ A;  1IG7 A;  1TC3 C;  4UNO A;  3F21 A;  2AQE A;  2LOO A;  3AG2 H;  4G6Q A;  2DMQ A;  4UXN A;  1OCT C;  2MD0 A;  3KCC A;  4LLL A;  3CO7 C;  2VOD A;  3ECO A;  1VQ9 I;  3QOE A;  5BPD A;  2F5E A;  3J7Z I;  1V3F A;  4E70 A;  4DYQ A;  1FOK A;  5BPI A;  2KPM A;  2Y0S N;  4XK4 A;  1FOW A;  2RN7 A;  1W4M A;  1WQ2 A;  2M45 A;  4XLE A;  2VPL A;  4MGR A;  3LSM A;  1S7A A;  3OYA A;  1VTN C;  1CGP A;  2E7W A;  2K9M A;  4G94 A;  5H6Q A;  5FKO A;  2DU9 A;  1I39 A;  4BAC A;  3HL2 A;  5HOD A;  5C3E J;  3KPH A;  4YG2 F;  5DM6 F;  2QQA A;  5DCM B;  4NNJ A;  3DP7 A;  4V2F A;  4OAY A;  5ERI A;  5A2Q Z;  4KNY A;  3EPZ A;  4FCY A;  2LG4 A;  2QLZ A;  3BR6 A;  2KIQ A;  4EJV A;  2G7H A;  2LBF A;  3DPU A;  2OBP A;  1PP8 F;  2LDU A;  3AL0 C;  3LQR A;  4A5M A;  3S93 A;  2O0Y A;  1SFU A;  3H9J A;  1MDM A;  1QZY A;  2RNG A;  1J7K A;  5HDG A;  3PSI A;  1TZL A;  3S3M A;  1KU9 A;  2HWV A;  2V1N A;  4UHT A;  2LYC A;  4BH9 A;  4V19 K;  4A3E J;  1LVA A;  4KDP A;  1XB4 A;  2VLA A;  2MC3 A;  4DJA A;  2VBY A;  4G8X A;  4M9S A;  3V8K A;  1W5T A;  3TO6 A;  1G3T A;  1K61 A;  2K40 A;  2VJI A;  3S1Q J;  1ZRD A;  3HEF A;  4F91 B;  2GAU A;  3FX3 A;  1I6H J;  1EH6 A;  4BL0 B;  2G7U A;  1ACI A;  4A3C J;  3IC7 A;  1W1W E;  1R22 A;  1AU7 A;  3RYP A;  4N4N B;  2IBD A;  2GQQ A;  2Z3Y A;  5K7H A;  3ZQH A;  3CCR I;  2HR3 A;  4BE1 A;  2E2J J;  4O5V A;  4U0V A;  3A0B C;  2M87 A;  1I3A A;  2P8T A;  3WTT C;  1Z77 A;  4NB5 A;  1D8J A;  2D1V A;  2DDA A;  3FHN A;  2XGE A;  2NS0 A;  4NHJ A;  3H92 A;  2GIZ A;  2N8G A;  2HPI A;  3G73 A;  2R7W A;  3S14 J;  2BHY A;  3G1O A;  3H35 A;  5D5X B;  5HDK A;  4XON A;  2A6E F;  2EFQ A;  3EUA A;  4F93 B;  2V6C A;  2Y9Y A;  3A01 A;  1WI9 A;  5FLM J;  2WWY A;  2XGX A;  1X3U A;  2JWT A;  2ME0 A;  1W36 C;  1YLF A;  4M71 A;  3OOU A;  4HX7 A;  2ME6 A;  1X3Z B;  2CQQ A;  2JA6 J;  2NAZ A;  1Z05 A;  2PLY A;  3BQZ A;  5EZG A;  4QPQ A;  2ZSH B;  3I3L A;  5DUK A;  3TDZ C;  4LB5 A;  3HSR A;  3PO3 J;  1VZ0 A;  1QNT A;  4HG2 A;  3LA2 A;  2ZJR F;  2TCT A;  3LSI A;  4XKW A;  3VYT B;  2AO9 A;  3GXO A;  2FBI A;  3FF5 A;  1WJC A;  4WCG A;  2CO5 A;  3BG6 A;  5TRD A;  2VIX A;  2NS7 A;  4DBR A;  1YG2 A;  2IS4 A;  1QHG A;  1AHD P;  2VE8 A;  3CJT B;  4IO9 F;  3LA7 A;  1E2X A;  4YEJ A;  2M8G X;  3TED A;  2JA7 J;  2FML A;  3K1N A;  3M8F A;  2IA2 A;  3QPH A;  1LKX A;  1KYZ A;  1Z6T A;  3BG5 A;  3QRF F;  4RLQ A;  1OPC A;  4N0B A;  4A3G J;  3S3O A;  3BR1 A;  1D5V A;  3HRS A;  1A6I A;  1D0Y A;  3NEU A;  1ETK A;  2EZL A;  2BY2 A;  2QYO A;  2ZXI A;  5TGT A;  3DBR B;  2CFX A;  1HSJ A;  4BHP A;  3OY9 A;  5E1Z B;  1YIJ I;  3ZR8 X;  1IUY A;  1R00 A;  2V9P A;  3NQO A;  3A02 A;  4E7I A;  4GYG A;  2TDX A;  2YS9 A;  4XID A;  4XRS A;  2KZG A;  2MBF A;  2PX9 A;  1BI2 A;  1XGM A;  1Z7U A;  2FJ1 A;  2M0M A;  3QYF A;  3OYK A;  2DW4 A;  5F1J A;  3CF5 F;  1KU7 A;  3BWG A;  1VI0 A;  3W2A A;  2FF4 A;  1JHH A;  1T95 A;  2NOJ B;  4HOB A;  2JVH A;  5J1R A;  2GM4 A;  5A2Q K;  2EV5 A;  1NG7 A;  1X1B A;  1YRN B;  2DFF A;  2RAE A;  4XL9 A;  4BBR J;  3L2C A;  5E3L A;  3TMO A;  2YSR A;  1WPK A;  4N4O B;  3JRG A;  1FEX A;  3K70 C;  1Y0U A;  2OC6 A;  2K9L A;  1HDD C;  2MC4 A;  1V4R A;  2CUJ A;  2Y75 A;  3KP6 A;  2PQ8 A;  3Q0W A;  3GTJ J;  3KYD B;  4DZP A;  2I5U A;  4LK0 F;  2HOE A;  1LDK B;  1Q1V A;  4MIM A;  4BJ5 C;  3HOZ J;  3H3Z A;  3WU1 B;  3KEY A;  4BDZ A;  4HX8 A;  3EUK L;  1FYK A;  4D1Q A;  1BJZ A;  2EIK H;  2DQR A;  1MBG A;  3LNQ A;  1B4A A;  3M9A A;  4F52 A;  4LG0 B;  5DEQ A;  1IN6 A;  3ASO H;  1SMY F;  1LFB A;  4KIF A;  4DOZ A;  2I8D A;  3HRM A;  3TOA A;  2GLO A;  1MND A;  4EM1 A;  5FFZ A;  4EGZ A;  2EWN A;  3WG9 A;  4WF2 A;  2QBY A;  1ULY A;  4L18 B;  1LQ1 A;  3WTV C;  2HYF A;  1QZE A;  4NQW B;  2XAQ A;  1VQN I;  1MJ9 A;  1OIS A;  3TO7 A;  2F4I A;  2JSC A;  3VYU B;  3CCL I;  2E2H J;  1VQ5 I;  3E5U A;  3SFZ A;  1I1S A;  1I27 A;  1OMI A;  3F9K A;  5L3G A;  5DM7 F;  2LD5 A;  2A61 A;  3ZMU A;  3NRV A;  4HSR A;  3CO6 C;  3IH4 A;  2X48 A;  2EV0 A;  1FPQ A;  4JX5 A;  3ABU A;  1UCR A;  2VKH A;  5LGN A;  3B02 A;  2BXZ A;  4WXH A;  2DQL A;  4I02 A;  2JQ7 A;  1VQK I;  4D5C A;  2F5D A;  2DT5 A;  3BR5 A;  4M3E A;  2M3A A;  3WGH A;  1MDM B;  3IKV A;  4BNC A;  1V5E A;  4MNU A;  1J5Y A;  3NWT A;  4A6E A;  2CJJ A;  4DIQ A;  2VI6 A;  2XGD A;  5GP9 A;  4HDU A;  3SEZ A;  1RR8 C;  3GZ6 A;  2MH2 A;  1P7I A;  5CVR A;  1N78 A;  5IT9 Z;  3BJO A;  4HV5 A;  1ZN2 A;  1ENH A;  3O8H A;  4D7N A;  2KT0 A;  1R58 A;  5E3O A;  3DKY A;  3OMY A;  2RVC A;  3BZ6 A;  3GLX A;  1FYM A;  3VPR A;  1XMA A;  3OYC A;  5ICF A;  4IHW A;  1S8N A;  2MA3 A;  2R3S A;  3KIO A;  4Y17 A;  5FRN A;  2VJ5 A;  4FT8 A;  4RLF A;  1HKQ A;  2FQ3 A;  4KIT B;  1BA5 A;  3W6J B;  3RCO A;  1YJW I;  1XGN A;  3ZOB A;  1M1E B;  4OIO F;  4IXA A;  2R7Z J;  2K5C A;  3I9V 2;  1UJ8 A;  4HBL A;  1G59 A;  2QQ9 A;  2F5C A;  4C3H J;  2EH3 A;  1YE9 A;  3VEP A;  4ANJ A;  1VQ8 I;  2X1E A;  4XRM A;  2NNN A;  4IL6 C;  1JKR C;  2QQ8 A;  4LMY A;  1ZRE A;  4FX0 A;  3F8M A;  5FKL A;  1DP7 P;  3HKZ N;  3TO9 A;  1W0T A;  2R7S A;  1KQ9 A;  2DK5 A;  1DU0 A;  3CDI A;  3HHH A;  2Z5U A;  2G0E A;  2XGC A;  3BJ6 A;  4H0E A;  3HTS B;  1O4X A;  3ZMV A;  3PO2 J;  1ETO A;  1UST A;  2CUF A;  4RAG A;  4AIJ A;  3MEX A;  4Q5S F;  2FOK A;  1Q1H A;  3V4G A;  3FXQ A;  5LFA A;  4A3M J;  2QA4 I;  1ZR4 A;  4B1R A;  4I6Z A;  2HDC A;  1FP1 D;  2CQX A;  1ZQ3 P;  3SZG A;  4PCQ A;  2LY2 A;  5J1U A;  4KMU X;  3JTG A;  5HS7 A;  3ZQG A;  2VJ4 A;  2DOA A;  5EZH A;  1FWZ A;  5DTD A;  2Z33 A;  2LTP A;  1PUF A;  1XCB A;  1XGO A;  3DKW A;  1MSF C;  4IHY A;  1AKH B;  1MMA A;  5K1Y A;  1S6L A;  1W5C C;  2IXS A;  2NVT J;  2XAH A;  3VYS B;  2COM A;  1T6S A;  4RA2 A;  2EFW A;  3DTE A;  2PMZ N;  2RNJ A;  2DMT A;  2WAQ N;  3ISP A;  2O03 A;  5LRS A;  2TRT A;  3L09 A;  5K5R A;  3HHG A;  1HF0 A;  1K83 J;  1R23 A;  2DTR A;  2ESN A;  5D8L B;  5D4S A;  1LDJ A;  1WVR A;  2IRF G;  2E1O A;  4UVB A;  1NK2 P;  1OJL A;  4BUP A;  4EM0 B;  4BYY A;  3GWZ A;  2V9K A;  2DFI A;  5DD8 A;  4ETS A;  1WJD A;  4BQA A;  1IN4 A;  1Y1V J;  5C4J J;  5LEK A;  5LHI A;  5EGO A;  4GDF A;  3OYF A;  4IHS A;  1MH3 A;  3ZPL A;  2YR2 A;  3IHU A;  6PAX A;  1O3T A;  2A6T A;  3HOY J;  2H27 A;  1FX7 A;  2PEX A;  4KIG A;  4Q48 A;  3L2W A;  1TWH J;  2EFO A;  4M9Z A;  4UUV A;  2EIN H;  2HVS A;  4GYI A;  5HLT A;  2HYJ A;  2ZO4 A;  1ONV A;  4XOT A;  1LB2 A;  1H88 C;  2H8R A;  3H36 A;  2E5Z A;  2NXN B;  4Y7N J;  1BIA A;  1RZ4 A;  1V5F A;  3MVP A;  2E35 A;  5JR3 A;  1Z6R A;  3DPL C;  2Z9O A;  2PN6 A;  2XRN A;  5DV5 A;  1FP2 A;  2LY1 A;  2X6W A;  3I58 A;  4LIU A;  1QQI A;  1Z1D A;  1VF9 A;  1TWF J;  3L9F A;  2QF7 A;  4IEJ A;  4AC0 A;  4A0Y A;  1SFK A;  3ECH A;  1ZKG A;  4L9N A;  3BCA A;  2L9N A;  3A1Y A;  4MTD A;  4XM3 A;  3T8T A;  1T38 A;  2LRE A;  2RKH A;  2B63 J;  4R79 A;  3GTP J;  1ZRC A;  2VE9 A;  4LJZ F;  1FC3 A;  4A3D J;  2E1M B;  5C4X J;  2FXA A;  3KYC B;  2FX0 A;  2CQK A;  4JQF A;  2MH9 A;  4AIK A;  3R0A A;  1Z3Y A;  1JUS A;  2K9S A;  2F5F A;  5LHG A;  5IT9 K;  1DQU A;  1TWC J;  3S2D J;  4FX4 A;  2ZBK A;  2FU4 A;  1LUJ B;  2B9S A;  3HJE A;  5FLV A;  2IAI A;  3LA3 A;  1TL8 A;  4QPO A;  2Y0S A;  2ZXH A;  4ON0 A;  2GOM A;  5HOO A;  2F6C A;  1SAX A;  2CSO A;  4BHC A;  5C44 J;  3ZMS A;  3HRT A;  4EAT A;  2BVM A;  2WA0 A;  1TQM A;  5F08 A;  1HDP A;  1HST A;  3QP5 A;  5CVV A;  5IPA A;  3RI4 A;  1B8I B;  5D6F A;  1E0E A;  1XD7 A;  4DYC A;  4ZTJ A;  1GVJ A;  3QU6 A;  5KVR A;  3H0D A;  3MQ0 A;  4GFB A;  2L7M P;  3BLY A;  4DYR A;  2FD5 A;  2XDV A;  1ZH5 A;  3CCQ I;  5FD6 A;  5CVU A;  3PUF A;  3K4B A;  1G2H A;  3R6S A;  3CDL A;  2JSP A;  3B6A A;  3CJQ B;  3KP4 A;  3U9G A;  1S72 I;  1TW2 A;  2XPV A;  5F0F A;  2QGU A;  5J3L A;  4E7Z A;  1S9H A;  3S1M J;  1HKT A;  1MJB A;  2HPM A;  1Z0X A;  2GA2 A;  3SJM A;  3R4K A;  5E1W A;  4XLP F;  4BAY A;  3CC4 I;  4YIR X;  2M8E A;  2VBZ A;  2XUB A;  2OZU A;  4I0A A;  4Y15 A;  2ZFU A;  2M1B A;  3PQJ A;  1B9N A;  3E7L A;  3TP0 A;  4HV6 A;  3CCJ I;  2P5V A;  4CYC B;  1K78 B;  2UWM A;  2ELK A;  3DEW A;  3ZQ7 A;  3S1R J;  1P4X A;  1YHQ I;  3VFZ A;  2DOF A;  3SDG A;  3HSE A;  3S1N J;  5ICE A;  4HDV A;  3LWF A;  3T0Y A;  1P4W A;  3Q9S A;  1RUN A;  4XSZ F;  2CQ7 A;  1ON1 A;  2VKV A;  3HOT A;  5JFR A;  4CYD A;  1SD7 A;  4OU0 A;  1C0W A;  1WH7 A;  2VQG A;  4XLN F;  4BY7 J;  4CCL A;  3JAM Z;  3TDU C;  3WTS C;  3OYG A;  4ENM A;  2Q1Z B;  2A5W A;  4BY1 J;  2XV4 S;  4BE2 A;  2ZSI B;  4B4C A;  4A3F J;  2XKP A;  3DEE A;  1TNS A;  4S05 A;  1Z3X A;  3BZK A;  5EDN A;  1BN5 A;  3ML6 A;  1OQY A;  3FXL A;  5IYD J;  4XBF A;  3SZT A;  5JVG F;  3ABL H;  2JTV A;  1MBE A;  1G6N A;  2DOE A;  5E1X A;  5J4V A;  2GA1 A;  2IJL A;  1KQ0 A;  1XN7 A;  3K10 A;  2R5Y A;  1R1T A;  5D5U B;  2Y9Z A;  3HGY A;  4JYK A;  3CCM I;  2FBH A;  3A2K A;  1IDZ A;  2IPQ X;  1K6Y A;  2AHQ A;  4BBS J;  3CCY A;  4UV8 A;  3JW4 A;  3OYN A;  5HLI A;  3KZI C;  2GZW A;  1PUF B;  4XSX F;  3GCM A;  2DA7 A;  4NC6 A;  3W3C A;  5D4R A;  2WAE A;  1BI3 A;  1WWX A;  3NAU A;  2IS1 A;  3I59 A;  1OYW A;  2BE5 F;  1XDS A;  2A68 F;  1YW7 A;  2XAJ A;  4ZH4 F;  5M3M J;  1YW9 A;  3WOD F;  1KU2 A;  3K4K A;  4XRS G;  4WX9 A;  1OCP A;  1Z67 A;  5CVJ A;  2Q0O A;  3F0C A;  3FXM A;  3P5J A;  5HLG A;  2LH9 A;  4KT5 C;  4C2M J;  1B59 A;  2WAD A;  3CUQ B;  1AA7 A;  3K4C A;  4BJT A;  1ERD A;  2KP6 A;  4LOC A;  3FXK A;  3OIQ A;  5TIS C;  1MW7 A;  4W97 A;  2ZJQ F;  2DO7 A;  3WGI A;  1U5T B;  4CXF A;  4ENJ A;  2HEO A;  4WXC A;  3W2W A;  3AG1 H;  5K5O A;  1LE8 A;  1HW5 A;  5AON A;  2VBW A;  4WXD A;  2OTJ I;  1LDD A;  2M30 A;  1UG0 A;  5JHF A;  1YOV B;  3FXJ A;  1FMW A;  5HDN A;  2LNB A;  1QGP A;  4AWX B;  3REO A;  4HEA 2;  1NHA A;  3WHC A;  2XF6 A;  1JT0 A;  4M6Y A;  1I5Z A;  2CGP A;  1KA8 A;  4LD5 A;  4PSX A;  3GVA A;  5F1R A;  5LGU A;  3GFI A;  4BEH B;  3FXO A;  2X51 A;  3H3U A;  3C18 A;  2OPT A;  2P4W A;  5EEH A;  3N05 A;  2ID3 A;  3HOS A;  4QTR A;  2R7U A;  3CP2 A;  1O3Q A;  1YJ9 I;  3IKT A;  3JRB A;  4X1E A;  3E3V A;  1FBS A;  5CKT A;  1YIO A;  4DNC A;  2QUF A;  2Q8K A;  4I99 C;  1Z9C A;  2NNY A;  1I1G A;  2DA3 A;  3T1B A;  2A5Y B;  1T39 A;  3DTK A;  2V1U A;  3TL4 X;  4CA0 A;  1T56 A;  4AD9 A;  2HQR A;  4E7S A;  3IP4 B;  2K9Q A;  4PSW A;  4Y33 A;  4I98 B;  3MD2 A;  4IRH A;  1S3J A;  3BG7 A;  1B9M A;  2Z16 A;  2CS3 A;  1NH3 A;  3S17 J;  1TQI A;  3M1C A;  4B44 A;  2QSF X;  4ZDL A;  3C2H A;  1PVE A;  5JLW A;  9ANT A;  3M3Y J;  1EV7 A;  1ETV A;  3R0J A;  5H6R A;  3KZY A;  4ESB A;  3OYH A;  3HGG A;  2R7D A;  4CZC A;  1SVL A;  2CH0 A;  5IT3 A;  2IP2 A;  2HZD A;  3A03 A;  1NK3 P;  4ZC3 A;  3VDX A;  3LST A;  2E71 A;  1X1A A;  4RB2 C;  3BPX A;  1XCV A;  1ETX A;  4S0H B;  3JAM K;  2EJR A;  4CCN A;  3F22 A;  4LIV A;  3KFW X;  3G71 I;  4CDG A;  3RSN A;  1W7P D;  1P9Q C;  4CZZ A;  3H9Q A;  1VQP I;  2WV0 A;  5E8I A;  1FTZ A;  1QZZ A;  2KKO A;  5EG0 A;  3JRI A;  2BY1 A;  1X4O A;  1BC7 C;  5K5Q A;  3MZ8 A;  3OYE A;  1OLT A;  4XLC A;  2D2W A;  2Q2E B;  2P5L C;  4B43 A;  3GTO J;  1X2N A;  5CVI A;  3CTA A;  5EEG A;  3LSK A;  4HF1 A;  2HU9 A;  2L7K A;  2OUM A;  2ZJ2 A;  3RZD J;  3MZH A;  1SC7 A;  2R7V A;  3DTI A;  1EKE A;  3DWL E;  1P2F A;  1G3Y A;  3GFL A;  5IYB J;  5HNF A;  3EDP A;  1VFC A;  4BS9 A;  4YFN F;  3WE2 A;  3ZQF A;  1NTC A;  4II2 A;  2QM3 A;  3C1D A;  1IC8 A;  5D8K B;  2KJB A;  4A3K J;  2IA1 A;  3EUH C;  4PUS A;  3JSP A;  2OQR A;  1JHF A;  3L7W A;  1BI0 A;  3RIR A;  2IA0 A;  3S15 J;  1K79 A;  2A07 F;  4B48 A;  5CPR B;  5M5W J;  2O61 A;  1MNE A;  4L9V A;  4JX6 A;  3BR2 A;  2YU9 J;  4ZTF A;  4OOI A;  3GX4 X;  4LB6 B;  5ICG A;  3IAM 2;  4ZYG A;  3A0H C;  1W0U A;  3M1E A;  3LAP A;  3DQV C;  4JK1 X;  4P55 A;  1H8A C;  3HKZ A;  4MTE A;  5D5V B;  2NVQ J;  5D6E A;  2E36 A;  1ODD A;  2OA4 A;  5FKN A;  2EZH A;  1QPM A;  3BR0 A;  3HSF A;  3PNT A;  3I4M J;  3WTZ A;  2DA6 A;  1MBJ A;  1U8R A;  1E3O C;  3H0G J;  2ICW G;  4OMY A;  2M5W A;  1EJ9 A;  3PSF A;  2JA2 A;  4A0Z A;  3LOC A;  1KU3 A;  4HF0 A;  1BL0 A;  2V26 A;  1R5G A;  2LKX A;  4RAY A;  3ONQ A;  2BEO A;  2BW3 B;  3LQQ A;  1D1B A;  3ABT A;  3DV8 A;  3K69 A;  3HPH A;  4B3A A;  3RTR A;  2CRG A;  3D5R C;  4UB6 C;  1F43 A;  3ZQI A;  4HNU A;  1WH5 A;  4Y13 A;  2HQN A;  3H1C A;  4JBA A;  1CF7 A;  1B72 A;  4A93 J;  3RKQ A;  2K02 A;  2JRM A;  4CH7 A;  3L2Q A;  2LR8 A;  3TGN A;  3CMA I;  2E5N A;  2LVS A;  5J6X A;  5J4Y A;  3ZMZ A;  2NS8 A;  4KMF A;  1W7P B;  3ZP5 A;  3FXU A;  4LIT A;  4EV0 A;  1Z7L A;  1J75 A;  1Z21 A;  4M3G A;  2CW7 A;  1O7L A;  3GO5 A;  3LSH A;  4FHT A;  5F04 A;  4IJA A;  4II3 A;  4YRV A;  1UZC A;  4IHX A;  1VQ6 I;  1LEA A;  2M34 A;  4XR6 A;  5AIQ A;  3EYY A;  4MEY F;  4EJW A;  2WY8 Q;  2WC2 A;  3W6K B;  2PJR B;  1HA8 A;  1LFU P;  3MKY B;  1U6G A;  1YYV A;  4UUS A;  2EIL H;  3CJN A;  3SXY A;  3OYD A;  3K1M A;  2L02 A;  2H1L A;  2O9L A;  2KZV A;  2ADU A;  1YQA A;  3Q0V A;  1J59 A;  1OR7 A;  2EA4 A;  1ZGA A;  2E7X A;  4I0B A;  4HQE A;  3SHF A;  1R9T J;  1FSH A;  3C2B A;  2HOT A;  3FZV A;  3PFI A;  2UV1 A;  4HA8 A;  3HUG A;  2OJE D;  3Q3S A;  1A35 A;  3CP8 A;  2KIS A;  2VXZ A;  3I4N J;  2R7R A;  1QU3 A;  1I6X A;  2ELH A;  3TKY A;  3GEZ A;  1XTA A;  4F7Z A;  1JJ8 C;  3Q9V A;  1B6A A;  2ACJ A;  1IV8 A;  3RKW A;  4PGH A;  2DJI A;  5H20 A;  2YPR A;  1PP7 U;  3GF2 A;  3QP6 A;  2MG4 A;  4BDY A;  4KFC A;  1G3S A;  1SMT A;  1XMX A;  4U87 A;  1R1U A;  3CLO A;  3QYE A;  2HXO A;  2DMU A;  2QSH X;  1G3W A;  2LBF B;  4B8X A;  4KIS A;  5JLX A;  2R5Z A;  3L2U A;  2XB0 X;  2DFH A;  4DGW B;  5ICC A;  3AAF A;  1E17 A;  3BZC A;  2EA2 A;  5EJC A;  4PJM A;  1RET A;  1UHM A;  4P9F A;  1UHW A;  2BY3 A;  4XKV A;  2BOL A;  3WTU C;  2MFZ A;  1X1C A;  2CU7 A;  2L54 A;  2RV8 A;  1S7O A;  4IOC F;  3BCB A;  2VAS A;  4G7Z F;  1HW1 A;  4BU2 A;  3I64 A;  2ZME C;  3BTJ A;  2QQB A;  2RGV A;  2DBB A;  5GTH C;  2IW5 A;  2X6O A;  1PYV A;  5J1Y A;  3K4N A;  3TOB A;  3V8L A;  1YX3 A;  1U2W A;  3RPU A;  3HOX J;  3QOP A;  5M5X J;  4X0G A;  2KL4 A;  3X2Q H;  2PG4 A;  4HLX A;  2VT3 A;  3T8R A;  1SD4 A;  2CYY A;  5FO5 A;  1EF4 A;  5J40 A;  3OR1 C;  5KCM A;  1X19 A;  4DZJ A;  4E7K A;  4JOM A;  1SFE A;  5M5Y J;  2UZK A;  1FOX A;  4BHB A;  1XS9 A;  1YS6 A;  4RMN A;  5J8F A;  3BG3 A;  5IY5 H;  1IRX A;  1SD6 A;  2L3D A;  1MSE C;  2EZK A;  5FRO A;  4ZJZ A;  3JR9 A;  5IP7 J;  4OIP F;  1RIO H;  4P9U A;  5IOY A;  1JUP A;  4B47 A;  3HOW J;  4BQO A;  4ZYA A;  1YTY A;  3FBN B;  3HXL A;  1JE8 A;  4NC8 A;  4QIW N;  3CES A;  1RR7 A;  1TT5 B;  3BT9 A;  3QPT A;  2BBY A;  1IRF A;  3IAS 2;  3A01 B;  2WB1 A;  2HZT A;  1OR7 C;  4DQ2 A;  1V54 H;  5KNL A;  2NVX J;  1JUM A;  4XKC A;  3GME A;  5F27 A;  2ZKZ A;  1HBX G;  1FT9 A;  3I53 A;  3D5S C;  4CHU A;  2E1M C;  2M4G A;  4X6A J;  2FSW A;  2K85 A;  1ZR2 A;  4RGX A;  1ZAO A;  4OIQ F; 
#chains in the Genus database with same CATH homology
 1DU6 A;  1JKQ C;  1Z0X A;  3SJM A;  4V2F A;  1X58 A;  3TW7 A;  4FCY A;  3BR6 A;  2EQR A;  2JN6 A;  3L1P A;  3TP0 A;  3E7L A;  4CYC B;  2ELK A;  3DEW A;  3S1R J;  2H1K A;  2XRL A;  3SDG A;  3S1N J;  1IJW C;  1JT6 A;  1ZGW A;  2L7F P;  1LE8 B;  2VUM J;  3W6V A;  4ABZ A;  5FJ8 J;  4A3E J;  1H89 C;  1TWG J;  5FKM A;  4HNV A;  3BTL A;  3ZQC A;  2VKV A;  4FIS A;  2QCO A;  3ZQL A;  3K2A A;  3JRF A;  1WH7 A;  2JK3 A;  4BY7 J;  1K61 A;  4BY1 J;  2K40 A;  3S1Q J;  5IYC J;  4A3I J;  3HEF A;  3IV5 A;  4B4C A;  3G1L A;  4A3F J;  3QQA A;  2ZB9 A;  1I6H J;  4A3C J;  2HQ5 A;  1AU7 A;  5EDN A;  2L7Z A;  2GBY A;  1QPI A;  1D5Y A;  3GTL J;  5IYD J;  1JJ6 C;  2DA4 A;  2IBD A;  5K7H A;  1MBE A;  3ZQH A;  2XPU A;  1ZK8 A;  1IGN A;  2E2J J;  1MBK A;  2LFB A;  3FIW A;  3QPL A;  2R5Y A;  2JJ7 A;  2Y9Z A;  3HGY A;  4JYK A;  2E2I J;  1Z77 A;  1HCR A;  1IDZ A;  2ECB A;  1IUF A;  2XGE A;  1B8I A;  2AHQ A;  2K9N A;  2LY9 A;  4BBS J;  3BTI A;  2N8G A;  3CCY A;  3S14 J;  3G1O A;  1PUF B;  3BR3 A;  2DA7 A;  1U78 A;  2Y9Y A;  3LSP A;  3A01 A;  3NAU A;  5FLM J;  1F36 A;  2JWT A;  2ME0 A;  2VKE A;  5M3M J;  4UUS B;  3OOU A;  3LSJ A;  2ME6 A;  5IP6 A;  4C3J J;  2CQQ A;  2JA6 J;  5EEA A;  4XRS G;  1GUU A;  1OCP A;  3BQZ A;  5EZG A;  3F0C A;  3PO3 J;  1X2M A;  4C2M J;  2R93 J;  2ID6 A;  4V2G A;  2TCT A;  3HBL A;  5EF6 A;  1APL C;  2MSY A;  2AO9 A;  4LOC A;  4CYC A;  1TWA J;  4W97 A;  5EG0 B;  3O8G A;  3HOU J;  5IP9 J;  1JTX A;  2P81 A;  2NS7 A;  1LE8 A;  1AHD P;  2JMW A;  3TED A;  2M8G X;  2Y2Z A;  2JA7 J;  4EEF G;  1GVD A;  4AUX A;  5F0C A;  3BG5 A;  2Y31 A;  2R0Q C;  4RBO A;  2COB A;  3RZO J;  4A3G J;  3BR1 A;  2R5Z B;  1A6I A;  3WHC A;  1ETK A;  2EZL A;  1JT0 A;  4MLO A;  1A5J A;  4M3B A;  2HI3 A;  1IV6 A;  3MN2 A;  1P7J A;  1Y1W J;  2OPT A;  2DJN A;  1WGX A;  1U8B A;  4A3B J;  3A02 A;  2ID3 A;  2YS9 A;  4QTR A;  1FTT A;  3LSG A;  2ECC A;  4MO7 A;  4XID A;  4XRS A;  2XPW A;  3JRB A;  4X1E A;  2FJ1 A;  5F1J A;  4BXX J;  1VI0 A;  1MBH A;  5E3M A;  3GTG J;  2DA3 A;  2O7O A;  2HXI A;  2VPR A;  3FK6 A;  4M3F A;  5J1R A;  2GM4 A;  3K7A J;  1T56 A;  1YRN B;  1MH4 A;  2K9Q A;  2RAE A;  5EYR A;  4BBR J;  3FK7 A;  5E3L A;  1WPK A;  3FIS A;  3JRG A;  1FEX A;  3S17 J;  1ITY A;  3FKI J;  1HDD C;  4Y52 J;  1U9O A;  1RPW A;  2D5V A;  3Q0W A;  5JLW A;  9ANT A;  2HOS A;  3BQY A;  3GTJ J;  3M3Y J;  2IEK A;  1ETV A;  4MFE A;  4DZP A;  1Q1V A;  4XIC A;  4MIM A;  1UHS A;  3HGG A;  3HOZ J;  1OFC X;  3A03 A;  1NK3 P;  1ETQ A;  1BJZ A;  1MBG A;  3LNQ A;  1ORK A;  1ETX A;  4S0H B;  3BG9 A;  2M9H A;  5F0H A;  1LFB A;  1B72 B;  2GLO A;  2W48 A;  1HLV A;  4DW6 A;  1FTZ A;  5EG0 A;  2EBI A;  3JRI A;  1WCM J;  3OSF A;  1ZTR A;  2E2H J;  3GTO J;  1X2N A;  1I3Q J;  3HOV J;  2DMN A;  2DTZ A;  2YUS A;  2LD5 A;  2OF7 A;  3IH4 A;  2X48 A;  3RZD J;  4JX5 A;  3S2H J;  4AYB N;  1FJL A;  3H3V K;  1XC5 A;  4FE4 A;  1IRZ A;  3MKL A;  5IYB J;  4D5C A;  4D7M A;  5M3F J;  3BR5 A;  1VFC A;  4M3E A;  4JX4 A;  3ZQF A;  1NTC A;  1HOM A;  3BTC A;  1GV2 A;  2CJJ A;  5IOZ A;  2VI6 A;  1IC8 A;  2XGD A;  5GP9 A;  2WV1 A;  3UKG A;  1QRY A;  4A3K J;  3Q0U A;  4UUT A;  5FKK A;  1P7I A;  1IDY A;  4A69 C;  1RKW A;  1I50 J;  3S15 J;  2DA1 A;  1ENH A;  3O8H A;  3NAR A;  4D7N A;  5K7F A;  2KT0 A;  4JP0 A;  5E3O A;  5M5W J;  4JX6 A;  3BR2 A;  2YU9 J;  2EZI A;  1W0U A;  5EGO B;  2DA2 A;  3VPR A;  1GT0 C;  1YRN A;  1H8A C;  4IHW A;  2NVQ J;  1RKT A;  3B6C A;  4BKX A;  2R92 J;  5FKN A;  2EZH A;  3BR0 A;  3I4M J;  1BA5 A;  2DA6 A;  1MBJ A;  1U9N A;  1E3O C;  3H0G J;  3ZOB A;  1SFO J;  2R7Z J;  2XSD C;  1FIP A;  3LOC A;  2E19 A;  4C3H J;  2EH3 A;  1BL0 A;  1CQT A;  2LKX A;  5E3N A;  5GPC A;  2LLK A;  4XRM A;  1JKR C;  5FKL A;  2O8K A;  3HKZ N;  4B3A A;  1W0T A;  2CRG A;  1DU0 A;  3LSR A;  1F43 A;  2G0E A;  3ZQI A;  1WH5 A;  2XGC A;  3D1N I;  1O4X A;  3PO2 J;  4M6V A;  1ETO A;  2CUF A;  1B72 A;  3HB9 A;  4A93 J;  3RKQ A;  2HDD A;  2LR8 A;  5DS9 A;  4A3M J;  2LVS A;  1ZR4 A;  1ETY A;  2NS8 A;  4B1R A;  4I6Z A;  2CQX A;  2DA5 A;  1ZQ3 P;  5BNG A;  1JKP C;  5J1U A;  1QVT A;  4M3G A;  5F04 A;  2MGQ A;  3ZQG A;  5GPA A;  5EZH A;  5DTD A;  1WI3 A;  2M0C A;  2LTP A;  1PUF A;  4IHY A;  1MSF C;  3GTQ J;  1AKH B;  4IHX A;  2NVT J;  1VND A;  3SFI A;  2M34 A;  2JA5 J;  2NOG A;  1RES A;  2WB1 N;  1GDT A;  2DN0 A;  2PMZ N;  2DMT A;  2WAQ N;  4C3I J;  3RQI A;  2LP0 A;  1LFU P;  4UUS A;  3DCF A;  2TRT A;  1UG2 A;  1UMQ A;  1HF0 A;  1K83 J;  2O9L A;  3IH3 A;  3HM5 A;  1MBF A;  3PM1 A;  3Q0V A;  1BW5 A;  4RDU A;  3JRC A;  2E1O A;  4D5F A;  2M2E A;  4MFD A;  1NK2 P;  1R9T J;  1OJL A;  2LK2 A;  2CUE A;  2DMP A;  3C2B A;  4NDL A;  2HOT A;  1BW6 A;  3Q3S A;  3I4N J;  4M3D A;  1Y1V J;  5C4J J;  5EGO A;  1JJ8 C;  1MH3 A;  2MW8 A;  3HOY J;  3OIO A;  1TWH J;  2MG4 A;  1POG A;  2HYJ A;  1H88 C;  3IH2 A;  2H8R A;  4I76 A;  2HXO A;  2DMU A;  1JTY A;  4Y7N J;  4J19 A;  3GTK J;  4A3L J;  4W1U A;  3MVP A;  3HDD A;  5JLX A;  2R5Z A;  2FQ4 A;  2XB0 X;  4L5E A;  4QSH A;  1VF9 A;  1TWF J;  2I10 A;  2QF7 A;  3QPS A;  2HOA A;  4IEJ A;  4AC0 A;  3JRD A;  3GTM J;  1ETW A;  1ZKG A;  1RET A;  2NVY J;  1SAN A;  2Y30 A;  2L0K A;  1MNM C;  3GTP J;  2L9R A;  2B63 J;  4A3J J;  2CU7 A;  3CMY A;  4A3D J;  5K7Z A;  5C4X J;  2FX0 A;  3GBG A;  3TW6 A;  2JA8 J;  3BTJ A;  3M4O J;  1JUS A;  2K9S A;  3G1M A;  2X6O A;  5J1Y A;  1JKO C;  3TP3 A;  1QVU A;  1TWC J;  5M5X J;  4G12 A;  3HOX J;  3OSG A;  3S2D J;  1AKH A;  4FTH A;  1EF4 A;  5FLV A;  4DZJ A;  2IAI A;  2XB5 A;  5M5Y J;  1FIA A;  1JGG A;  1XS9 A;  3S16 J;  1S7E A;  2KDZ A;  2R5Y B;  3JRE A;  3BG3 A;  5C44 J;  3CQZ J;  1XG1 A;  4FE7 A;  1MSE C;  2EZK A;  2X9D A;  1IG7 A;  3JR9 A;  5F08 A;  1HDP A;  1TC3 C;  5IP7 J;  5IPA A;  1B8I B;  1GV5 A;  5IOY A;  1JUP A;  3HOW J;  2DMQ A;  4DYC A;  1OCT C;  4QIW N;  4GFB A;  2L7M P;  1RR7 A;  3BT9 A;  4DYR A;  4DYQ A;  3WHB A;  3A01 B;  2Y0S N;  3JRH A;  2FD5 A;  4XK4 A;  4IHV A;  2NVX J;  1G2H A;  1JUM A;  1T33 A;  3CDL A;  5F27 A;  3JRA A;  3B6A A;  4X6A J;  1ZR2 A;  2XPV A;  5F0F A;  5J3L A;  5FKO A;  3S1M J;  5HOD A;  5C3E J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...