5EDNA

Structure of hoxb13-dna(tcg) complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Homeobox protein Hox-B13
publication title Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 60
sequence length 60
chains with identical sequence B, G, J
ec nomenclature
pdb deposition date 2015-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ednA00
5GPCA 1ZGWA 4S0HB 4M3BA 5M5XJ 1ZQ3P 2NS7A 3JRCA 1ETWA 2OF7A 2EZIA 1SFOJ 2XPVA 2YUSA 2Y9YA 4FE7A 2R5ZA 4A3EJ 2JWTA 3B6AA 1LE8A 4XIDA 3GBGA 2JJ7A 1ETXA 5IYDJ 1R9TJ 1I3QJ 1QVUA 2EBIA 5J3LA 5JLWA 3FK6A 3RQIA 1IRZA 3JRAA 2K9SA 2LKXA 2QF7A 4DW6A 2VUMJ 4DYCA 4JP0A 3VPRA 1YRNB 2HDDA 4IHYA 2X48A 3M4OJ 1G2HA 2NVXJ 2EQRA 2EH3A 3HGYA 1T33A 2E1OA 2HXOA 1FTZA 1RESA 3QPSA 2ZB9A 3HB9A 2IBDA 1IV6A 3A01A 4C2MJ 2R0QC 4RBOA 2DMNA 3BQYA 3JR9A 4M3DA 4DZPA 2R5YB 1GVDA 3LSJA 1EF4A 1K61A 2MGQA 4A3BJ 5IP7J 3JRFA 1DU6A 2VKEA 5K7HA 1IG7A 2EZLA 2DA1A 5FLMJ 2XRLA 4QIWN 3Q0VA 5DTDA 3RKQA 2Y30A 3L1PA 2E2HJ 1MBJA 3DCFA 2G0EA 1MBHA 5EG0A 5DS9A 1NK2P 1MSFC 1BW5A 1TWHJ 3GTMJ 4BBSJ 3SFIA 1ETOA 2YU9J 2X6OA 2NOGA 4M6VA 1HCRA 3D1NI 4QSHA 2VPRA 1BA5A 2XPWA 1WGXA 4MIMA 5J1UA 2HXIA 2LD5A 3TP0A 3S14J 1MSEC 2EZHA 2XGDA 3HDDA 1ITYA 2W48A 1XS9A 3FISA 2E2IJ 4J19A 2R7ZJ 4JX4A 4LOCA 2DMPA 1IUFA 2VKVA 1IGNA 5EGOA 3A01B 3M3YJ 1FTTA 2WAQN 4A3CJ 1OFCX 5EZGA 4XICA 4MFDA 2H8RA 4QTRA 3O8GA 1JT0A 4GFBA 2AHQA 4UUTA 2JA7J 3K7AJ 5FKLA 1JTXA 3BTIA 3H0GJ 3PM1A 1ETQA 1LFUP 4BY1J 5K7FA 1X2NA 2COBA 1D5YA 5M3FJ 2CQXA 4MO7A 4AC0A 2FX0A 4CYCA 5IYBJ 3QPLA 5FKKA 2HOAA 3ZQHA 5M5WJ 1OCPA 3MVPA 2E2JJ 2FJ1A 1ORKA 4C3IJ 4A3MJ 1HLVA 4XRMA 1I50J 4L5EA 1Q1VA 1JUSA 1X58A 3PO2J 4FCYA 1H88C 1ETVA 1P7IA 4A3JJ 3A02A 3JRIA 3BQZA 4G12A 3S1QJ 3S2DJ 1T56A 5BNGA 4XRSA 3C2BA 3ZQLA 3OOUA 2CUEA 2DN0A 2P81A 3O8HA 5EDNA 3HKZN 1Y1WJ 5HODA 1WI3A 1UHSA 2XB5A 1AU7A 4MLOA 1AKHA 2XPUA 5M5YJ 1TWCJ 1QRYA 3HOUJ 1MBEA 2LTPA 2L0KA 4FISA 4JX6A 1O4XA 4ABZA 3BTCA 3TP3A 1ENHA 2ECCA 2IAIA 2L7MP 3I4NJ 2TRTA 1TC3C 2DTZA 3G1OA 5F1JA 4D5FA 2N8GA 1IJWC 4IEJA 3MKLA 1POGA 3TW6A 4C3HJ 2MG4A 3ZQIA 3IV5A 4V2GA 1GUUA 2ID6A 4A3KJ 2NVYJ 1ZTRA 2LP0A 1RKWA 1DU0A 2MSYA 1U8BA 3HOWJ 1XC5A 1XG1A 1BJZA 4D7MA 5E3MA 2XB0X 5E3OA 2Y9ZA 1MH3A 1LFBA 1K83J 3LSGA 4A69C 1BL0A 1B8IA 1WH7A 3BG9A 3K2AA 1B72A 4JYKA 3ZOBA 3QQAA 1VNDA 2R5ZB 5GPAA 3TEDA 2CRGA 1F36A 1LE8B 5FKMA 3LOCA 2X9DA 5F0FA 4XRSG 3JRGA 3SJMA 3GTKJ 1FIAA 3S16J 1FIPA 2JA8J 1JT6A 4Y7NJ 5F27A 3BR3A 2DA3A 4EEFG 1FJLA 1HDDC 3W6VA 2FD5A 2DJNA 2L7ZA 1GT0C 2HQ5A 3WHCA 2XGEA 1HOMA 1ZK8A 5JLXA 1U9NA 1PUFA 3PO3J 1RKTA 4A3FJ 2JA5J 3GTQJ 1IDYA 2DA7A 1MBKA 3RZOJ 2CUFA 1H89C 4A93J 4AUXA 4B4CA 4UUSA 4FTHA 2WV1A 5EZHA 3UKGA 1NK3P 2K9QA 1ZR2A 1F43A 2VI6A 1ETYA 1JKOC 1BW6A 2JK3A 3SDGA 4C3JJ 5E3NA 4IHWA 3GTJJ 3GTPJ 5IP6A 5EEAA 2ME6A 4V2FA 3F0CA 5C3EJ 2LLKA 2RAEA 1NTCA 2DMUA 4A3LJ 1JGGA 3LSPA 1JUMA 1WCMJ 2LR8A 1ZR4A 4W97A 3GTLJ 2LVSA 2M34A 3LSRA 1W0UA 3HOVJ 5C4JJ 5EG0B 3CMYA 2XGCA 1GDTA 2DA2A 5F08A 4A3GJ 3Q3SA 2AO9A 3TW7A 3S1NJ 4RDUA 3BR2A 3HBLA 1MH4A 1YRNA 5FJ8J 3B6CA 3BR5A 1VF9A 1JKPC 1QPIA 2M0CA 2Y2ZA 1Z0XA 3BG3A 3BTJA 2KDZA 2DMQA 1JJ6C 2DMTA 3DEWA 2Y0SN 2LFBA 1TWGJ 2GLOA 5FLVA 1U9OA 2R5YA 1RR7A 3FKIJ 2R93J 5EGOB 1HF0A 2O9LA 3HOXJ 2EZKA 2L9RA 4M3EA 3S1MJ 2L7FP 1IC8A 3JRBA 3I4MJ 3HM5A 1A6IA 5EF6A 4M3FA 3GTGJ 2LK2A 3A03A 4FE4A 1SANA 1P7JA 2CQQA 5F0HA 2ECBA 1IDZA 3S1RJ 3LNQA 2R92J 2HOTA 4CYCB 4BY7J 3IH4A 2HI3A 1JUPA 1UG2A 2PMZN 3NARA 2E19A 4D7NA 4BKXA 3Q0UA 4DYQA 5IOZA 2D5VA 2O7OA 5IYCJ 2ME0A 1Z77A 2K9NA 1HDPA 5E3LA 1S7EA 4M3GA 1WH5A 4X1EA 4DZJA 3ZQGA 3MN2A 1E3OC 3BG5A 2HYJA 1GV5A 3HEFA 2OPTA 2JMWA 3BTLA 3Q0WA 1UMQA 2DA4A 4B3AA 2HOSA 3OSFA 2JN6A 3NAUA 5M3MJ 4Y52J 2FQ4A 5J1RA 4I76A 3BR6A 2NVTJ 2ID3A 2QCOA 1CQTA 2M2EA 1AKHB 3S15J 3BT9A 4DYRA 4MFEA 5IOYA 5C44J 1U78A 2M8GX 1RETA 1TWAJ 1W0TA 5K7ZA 2M9HA 4JX5A 1JKRC 1MBFA 5C4XJ 3ZQFA 4AYBN 5IPAA 4XK4A 5EYRA 3HOYJ 2DA5A 2GBYA 2IEKA 1ZKGA 1MBGA 3IH2A 2TCTA 1X2MA 3G1MA 3E7LA 1AHDP 4D5CA 1OCTC 3JRHA 1APLC 4B1RA 1GV2A 1JTYA 4IHVA 2JA6J 4I6ZA 3RZDJ 2DA6A 5FKOA 3ZQCA 4W1UA 5F0CA 1B8IB 3FIWA 1B72B 3WHBA 5IP9J 3S2HJ 4BBRJ 1MNMC 1Y1VJ 2B63J 3JRDA 1ETKA 2WB1N 1H8AC 3CQZJ 3H3VK 1OJLA 2H1KA 4NDLA 2LY9A 4HNVA 3G1LA 5FKNA 5GP9A 3GTOJ 5J1YA 9ANTA 2KT0A 3BR1A 1WPKA 3FK7A 2GM4A 3S17J 5F04A 1QVTA 1JKQC 2ELKA 3HOZJ 3JREA 2XSDC 4A3IJ 4BXXJ 1PUFB 2O8KA 1FEXA 3BR0A 3IH3A 2MW8A 1TWFJ 2YS9A 4A3DJ 1JJ8C 2NS8A 1I6HJ 2CU7A 4X6AJ 1VFCA 3CCYA 3OSGA 4UUSB 3HGGA 1VI0A 2K40A 2CJJA 2Y31A 1A5JA 3OIOA 2I10A 2NVQJ 1RPWA 3CDLA 4IHXA
chains in the Genus database with same CATH superfamily
5TGTA 1ZGWA 4RM2A 1D8JA 1G3TA 2E60A 5M5XJ 1QHGA 4L0YB 2NS7A 2RGVA 1NHAA 3FBIB 1B4AA 1SFOJ 3CJRB 4B48A 3VWBA 2XPVA 3OR2C 3I56I 3LQQA 1J75A 2OQRA 2JWTA 1FX7A 3CD6I 5EJCA 2AQFA 4XIDA 4B8XA 4S05A 2HS5A 1XD7A 3DPTA 1HW2A 5F6FA 5IYDJ 3PUBA 3ABMH 3OYDA 3KX2A 3LWFA 1I3QJ 4IQJA 1QVUA 5J3LA 3WTWC 4C9YA 3ERED 3L2CA 2KRHA 4KN4X 1OCZH 3NRVA 4UVBA 1I27A 4DYCA 2B9SA 4V19K 3VEPA 4IHYA 1G3YA 1DPRA 2ELHA 4D0PA 3SZTA 3K4KA 1SVOA 1XDUA 4A6DA 1D8KA 5E17F 2EH3A 3HSFA 3HGYA 4BXUA 2QLZA 1IRGA 3AG4H 3DU5A 5D6FA 4Z6YA 1XTAA 2V9VA 4OINF 2EK5A 2DFFA 2ZB9A 3HB9A 2L5QA 4NB5A 4P1WA 3A01A 4XR6A 1IV6A 4A12A 3BQYA 3A4CA 3LSJA 3ZP5A 3AG2H 3MMYB 4ZYDA 2W7NA 3JRFA 2KJBA 2L3DA 3BJOA 1Z6TA 1IG7A 3B02A 3JTGA 2DA1A 3DXJF 3CLOA 3KFWX 3QYFA 1DGRM 2Y75A 3RKQA 1RRJA 2QVOA 1ZH5A 1MBHA 1D1BA 2E71A 2M8EA 2VL8A 5EG0A 1BW5A 4KICA 2ZNZA 5GTIC 1VQ7I 2FOKA 2DI3A 3P5JA 4XLCA 3DV8A 5B1BH 2M4KA 3H3UA 3OS0A 1BA5A 1HKQA 1WGXA 2VBXA 1XN7A 4A5MA 3S14J 1MSEC 4NC8A 5JR3A 1FBQA 2LKSA 2W48A 2QUFA 4F7ZA 1XS9A 1IUYA 3FISA 3VYRB 4LOCA 2W00A 3CESA 2HNHA 3CUQB 2VC1A 2L01A 3IC7A 2VKVA 4YFKF 3MKZA 1KU7A 1IGNA 2QQ8A 1FTTA 2YSRA 3ELKA 2E35A 4XLHA 2XF6A 4R8HA 2IVMA 2JPCA 3O8GA 3I54A 2BVLA 4UUTA 2DPDA 3X2QH 1P6RA 4KN7X 5KAIC 1STZA 3PM1A 1ETQA 4BXFA 1IRXA 5K7FA 1X2NA 4HBLA 2H27A 2COBA 3TO6A 2FA5A 5M3FJ 3KEYA 2OQGA 1TW2A 2M3AA 1E0EA 3HIFA 3CZ6A 4NHJA 4MO7A 2FX0A 2MA3A 1DGWY 5LHHA 5CPRB 4IL6C 4G6TB 4LLLA 5FKKA 2HOAA 3LFKA 1OCPA 3MVPA 2FJ1A 4C3IJ 5EEGA 5DUIA 3EYIA 1BM9A 1LKXA 2FUG2 4HX8A 2WA0A 2EFPA 4GDFA 1UJ8A 5E1XA 5H20A 2NOJB 2HVRA 4LLGF 4IRGA 3BLYA 3JRIA 3OS1A 4O5VA 4G12A 4EQQA 3C18A 1T56A 3LA3A 4HLYA 1LVKA 2FSWA 5L3EA 2M45A 3ZQLA 1E3PA 5DCFA 4QLCU 2P81A 3R0JA 2FMYA 2CFOA 3HKZN 1Y1WJ 4HF1A 3GF2A 1UHSA 1S7AA 3HJEA 4MGRA 2XC7A 2DXIA 3E97A 1YE9A 1AKHA 2XPUA 2G7UA 3TQNA 4AD9A 3L7WA 2DW4A 1QRYA 2IGOA 2F4IA 4Y17A 2STTA 2KIUA 2LTPA 4FISA 3KZZA 3WE2A 4JX6A 3KLOA 1ON1A 1D1AA 2MFZA 4CCOA 4CCMA 3TP3A 3KIOA 2ESHA 2TRTA 1ZARA 3I0TA 1YW8A 4IRHA 4FT8A 4IEJA 4I7HA 4WWCA 4UUVA 2D1HA 2GIVA 3Q9SA 3IV5A 2LBFB 3G3ZA 4BQAA 1RKWA 1U8RA 2VKDA 4XLAA 4N4OB 5GADJ 3A0BC 1HBXG 5E3OA 5JFRA 4U0VA 4PSWA 1S8NA 2HVSA 3ONQA 3OYCA 3BG9A 5GAEJ 3JAMK 5FRNA 3W6KB 4UNOA 2CH0A 3TBIA 4BDYA 3TEDA 4Y13A 1YJ9I 5FKMA 3LOCA 5F0FA 2WADA 4IOCF 3HRTA 2JUGA 3GTKJ 3S16J 1C0WA 2G9WA 1JT6A 3BR3A 2DA3A 3FBNB 3TGNA 1EH6A 5K5QA 4RB1A 2FD5A 2M30A 2HQ5A 1UCRA 3QU3A 3ZGKA 1YYVA 1U0JA 3WGIA 1RKTA 4A3FJ 2JA5J 3GTQJ 3H3ZA 2NS0A 1O7LA 1MBKA 1ZG1A 4BE0A 2K9MA 2PLYA 4UUSA 4EV0A 4FTHA 3FXLA 2CV1A 3VYTB 2EB7A 3UKGA 2K9QA 1HQCA 2VI6A 3NQOA 1FMVA 3MZYA 3QU6A 4DBRA 2W1OA 4IHWA 3QOPA 2VODA 5IP6A 3OV8A 3TO7A 2CW7A 1QGPA 5C3EJ 5DDGA 4ZDOA 3M7GA 3N97A 1JUMA 1UZCA 2LVSA 2FRHA 1VQ5I 2F5DA 5J4YA 1BBYA 5EG0B 1G6NA 4IPAA 5LRSA 3VDXA 3J7ZI 2JA2A 3CMYA 4A3GJ 2UZKA 2KIMA 1IXSB 1VQMI 1XB4A 5D6EA 4J00A 2AO9A 1SFEA 3WTXC 3M9AA 2L54A 3HBLA 2RVCA 4K2EA 3W6JB 1YX3A 1YRNA 2DODA 2F5VA 3FM5A 3CDIA 1VF9A 3PNYA 4N9IA 1R1TA 2M0CA 1N75A 2LF8A 4KIFA 1YJWI 1PVEA 3GCMA 4KJZA 2KDZA 5CVJA 1RIOH 1JJ6C 2MLGA 2X51A 1GLNA 4BDZA 3DEWA 4BQOA 5KCMA 3CJNA 3BOQA 2DO7A 2E34A 4OMZA 2R5YA 1X3UA 4O6JA 4E7ZA 4EJWA 2O9LA 1R5HA 2EZKA 4MNUA 1KU9A 2FBHA 4KT6A 3KPHA 2RQQA 4FX0A 1P2FA 3JRBA 1N78A 1JHHA 4UB6C 3HM5A 5EF6A 4M3FA 4CCLA 4ZH4F 5LEJA 3GTGJ 2E1MB 1TP4A 3J7AO 5LGTA 1YW7A 3ZMTA 3NWTA 2R92J 5BOXA 3RPQA 3AFHA 2XSJC 3V7RA 2MH2A 3CF5F 4EJVA 4BNCA 2QKMB 2PMZN 4MTDA 4RS8A 2BVMA 2JZYA 4JK1X 2M87A 5AONA 3M1CA 2QQ9A 3OYEA 2JRTA 2CG4A 2D5VA 4BHPA 2W85A 2R7TA 2D1VA 3J81Z 3RPUA 1MNEA 4R79A 5D4RA 3LSIA 1YW9A 2C6YA 5K1YA 2RNGA 5H6QA 3SYTA 2MABA 1WWXA 2BY1A 1VQLI 1Z3YA 3UR3C 4X1EA 4DZJA 3H1CA 2ZFUA 3MN2A 3WTVC 2FNAA 1FOKA 3KP4A 5DCMB 2H1LA 2F48A 3DPUA 5E8GA 4IJAA 3U1DA 1VQ9I 2VOPA 3TDZC 2BW3A 3OYKA 4B3AA 4EVIA 1OKRA 3F3XA 1YITI 1YO5C 2FQ4A 3BR6A 2NVTJ 2ID3A 4HZFA 1AKHB 3MD2A 4ZYEA 1HSTA 4YRVA 4G6DA 1FMWA 5A2QZ 1W0TA 3SHFA 5KNLA 4BE1A 1T2KA 3J7AY 2K02A 2EV5A 3CP2A 3EDPA 3ZPLA 4I01A 3CCUI 5J40A 2BE5F 3VFZA 2F2EA 4AYBN 5IPAA 4E7HA 1PP7U 4P5OA 1BI2A 1SVLA 2GBYA 3OY9A 4Q47A 1WJAA 3K1MA 1HSJA 3IH2A 2TCTA 2ESNA 1O3TA 1AHDP 2STWA 4D5CA 2F6CA 3CCEI 1OYYA 4G7HF 1ERDA 3E1SA 1VQPI 1ZELA 2AXTC 2K85A 2DFIA 4B44A 2DA6A 3ZQCA 5F0CA 1AA7A 3LA7A 1J09A 3WHBA 3MEXA 5IP9J 4ENMA 4O3MA 1P4WA 1RC9A 3HUGA 1T98A 5FO5A 1WSUA 3QP6A 4LG0A 3HC7A 3G1LA 5FKNA 3GTOJ 3OYIA 9ANTA 3BR1A 5AIPA 2QA4I 4H4KC 2OTLI 3F8FA 2UWMA 1K79A 5F04A 2DCEA 2K4BA 2DTRA 2L2OA 4PJMA 3CCLI 1GHCA 3E6CC 2M7BA 3V7SA 4HDVA 1LEBA 4A3IJ 3BR0A 1FP2A 4RB3C 3C3WA 2YS9A 1S9HA 1JJ8C 1I6HJ 2CU7A 4XOTA 3RDIA 4L5JA 4YIRX 3L00A 1UG0A 2XKOA 4UUSB 1VI0A 1H9GA 2K40A 2Y31A 3ISPA 3N05A 3OIOA 3FXJA 2LSOA 1JE8A 3BY6A 1FSEA 3QOEA 2OUMA 2Y0SN 1Z05A 4IHXA 2QYOA 3GZ6A 2JVHA 2VC0A 3VOEA 1ZQ3P 3QAHA 3DP7A 3D5RC 3JRCA 2OF7A 2EZIA 1R1VA 3GFIA 3BG6A 2OD5A 2Y9YA 2IJLA 1RI7A 2R7WA 4A3EJ 2R5ZA 3EYYA 1LE8A 2M7AA 3BZCA 3GBGA 3I4PA 1SFKA 3FXOA 4I02A 1R9TJ 3DBHB 1ZLKA 2CW8A 1BOBA 3FK6A 2JSPA 3RQIA 4AYBA 5BMZA 3DLLF 4DOZA 3ECHA 3OYMA 3JRAA 1P9QC 3ASNH 2O61A 4DW6A 2YX7A 5FLXK 2Z5UA 2M5WA 1YRNB 1LEAA 4PJ0C 1FWZA 1U5TC 3M4OJ 3EUKL 1ZGJA 4L5IA 2HTJA 3FMRA 3HSRA 2VBWA 1DP7P 2ZJPF 1P4AA 2E1OA 2ICWG 3K4CA 2IA2A 4E6KG 1FTZA 3CCMI 1RESA 2FXAA 2E5NA 4QPQA 3L2QA 3BC8A 3IWFA 1O7FA 2R0QC 4NBQA 1MJBA 1REPC 4M3DA 4F92B 2R5YB 3DTKA 2PI0A 3KP5A 1K61A 2EIJH 1EF4A 1VQKI 2CFXA 2VKEA 3GUDA 4ENNA 2O6GE 2MYSA 3DWLE 4ZZLA 2V1DA 3DU6A 2KZVA 5DTDA 2IS1A 3DCFA 4IF4A 1Z7LA 2IGKA 4HQMA 1SC7A 1MGTA 5DS9A 1NK2P 4XORA 4PCQA 3GTMJ 5FGMA 1ETOA 2NOGA 4KA4A 2PQ8A 4ANJA 1K4TA 3I64A 3D1NI 4ON0A 2IPQX 2HQRA 2KL4A 1IAWA 2XPWA 2X6XA 1L0OC 2IS4A 2QQBA 2QSFX 4MIMA 5CLSA 2HXIA 3K10A 1XMKA 4LK0F 5GAHJ 1A6QA 2X85A 3QRFF 3HPGA 2NYXA 3HDDA 5HLTA 1ODDA 3GWZA 4KFCA 1OMIA 2WAEA 1FOYA 1ZRDA 1EH7A 2F4MB 2YX4A 4RGUA 1XSXA 2HDWA 3G6EI 1Z21A 2WAQN 4UV9A 4HSRA 2VLAA 1WJEA 1OFCX 2LRDA 1FPQA 1R23A 3K4MA 5AIQA 5D8LB 4KIBA 4WXHA 2BW3B 2ZJ2A 3QP5A 4QTRA 2H8RA 2UXNA 3QODA 2JPBA 3I59A 1JTXA 3BTIA 4YEJA 3BZ6A 4GXOA 2F4OB 3EETA 1Z1DA 1ZHFA 4MHGA 3A2KA 1OR7C 3KEQA 1WZ2A 3F22A 1D5YA 1LJ9A 3JW4A 2R7OA 4GCVA 1J59A 5IYBJ 1G3WA 1XGMA 2XKPA 4Q48A 4P96A 3U1KA 3ZQHA 2OCCH 5M5WJ 3IUOA 3CCVI 2HPMA 4YIIA 4I0BA 4BHBA 3H5AA 1JUSA 4N9HA 1X58A 2XAUA 1TT0A 1P7IA 5D5UB 3P9IA 2YU3A 1PUEE 4BQNA 3BQZA 4KITB 4PGGA 2O5RA 4X0GA 2JUCA 2BXZA 1S3JA 2A05A 4M6YA 1UAAA 3O8HA 1T95A 4WXDA 3HUGB 3AG1H 5EDNA 3F8MA 2RREA 2DK8A 1Z91A 1WI3A 4KT5C 3LQRA 3ZQ7A 4R1HA 3AG3H 4QPOA 2CUJA 3CCSI 3EUHC 3BP8A 4LG0B 3V7CA 5DYMA 3C1DA 3HTSB 2KISA 3T8RA 1YTYA 2GA1A 2R7UA 3TL4X 2VASA 4CSWA 5CVRA 3AL0C 1JHFA 2L7MP 5BS6A 1ONVA 2X1EA 2DTZA 3HOSA 5CQEA 3VB2A 3MKLA 2IXSA 2LNBA 2VBYA 3TW6A 3EPZA 2Q8KA 1IW7F 2VT2A 5J4VA 2O3FA 1EV7A 4V2GA 1GUUA 2ID6A 1T08B 5FFXA 2MLKA 2NVYJ 1ZTRA 2DAOA 3RYRA 4YG2F 2MD5A 2O03A 3GEZA 4HF2A 1ZG5A 5E3MA 1A04A 2XB0X 3U2RA 1MH3A 5KVRA 3JAMZ 5LGNA 1LQ1A 1BC7C 2QKLB 4J01A 4A69C 3BCBA 3IAM2 4EM2A 4ETSA 2DT7B 2A61A 1B72A 1A31A 4JYKA 3ZOBA 5FB2A 5DD8A 2R5ZB 4MTEA 3G2BA 1SAUA 2ZXJA 3IP4B 1BR4A 4C2UA 1LE8B 1F36A 4OIPF 1SFUA 3I58A 3AKZA 4NC7A 2WTEA 4CCJA 3SJMA 4NUBA 3VYSB 4BH9A 3U9GA 1H0MA 2JA8J 4Y7NJ 3G71I 5F27A 2EINH 5CKTA 4EEFG 2XRNA 1X1PA 1FJLA 2PG4A 3W6VA 2HR3A 4L18B 2L7ZA 2DJNA 1LDDA 3PSFA 1GT0C 3RQ4A 3WHCA 2XGEA 1HC8A 1R36A 2P7VB 3FXQA 1HOMA 2KLOA 2P5LC 2BEOA 1PUFA 3PO3J 4C2TA 2QEXI 4ZDPA 3PFIA 3RZOJ 3OYBA 2L9VA 3RIRA 4A0ZA 4HYEA 2Q2EA 3DKYA 3FX3A 1FBUA 4AUXA 2OZ6A 4B4CA 5DM6F 3IRQA 2KRFA 3M8JA 2PN6A 3L2RA 3RYPA 4LLNA 4LITA 1DPUA 4PDKA 2WV1A 1TL8A 1NK3P 2B7EA 3BJAA 1JKOC 2ZBKA 1BW6A 2JK3A 3CJQB 3CP8A 4C3JJ 5E3NA 3G73A 3LSHA 3GTPJ 1BR2A 2GZWA 4HSTA 4EM1A 5EEAA 2ME6A 4V2FA 1MMDA 1QPMA 1Y8RB 3F0CA 4AWXB 4BJTA 2Z33A 1NTCA 4A3LJ 4IHTA 1JGGA 3OL4A 4W97A 3ZN1A 3S3OA 5FRMA 4PJJA 2OCEA 5C4JJ 2ZCWA 2BY0A 3I71A 5F08A 4IQ4A 2DJIA 1AOYA 1YQAA 2EPFA 2IGMA 5DUKA 1KA8A 2GXGA 2YR2A 3TW7A 1MMGA 2ZKZA 3QYBA 4BE2A 3WG9A 3IKVA 3DPLC 2WY7Q 2W84A 4KDPA 3DF8A 3OIPA 4FQGA 3WTTC 4XLEA 2WBMA 1B9NA 4BYYA 2KHMA 5LHGA 2KP6A 4PFOA 2CUZA 2LOOA 5HDKA 2EA2A 3ABKH 1U9OA 3CC7I 3H35A 4ESFA 3T0YA 2ZXIA 5DCMA 1RR7A 3R4KA 1XCBA 3HOXJ 2V1NA 4RB0A 2M1BA 1IO2A 3OIQA 3S1MJ 1LNWA 2L7FP 1OCRH 5HS9A 4OU0A 2DQLA 2BHYA 4XN3A 3CCRI 2L4AA 1T39A 4KYWA 2E5ZA 5E18F 3I59B 1A6IA 3P7NA 2LK2A 4FE4A 3M8EA 1SANA 2CQQA 2ECBA 1IDZA 2R7FA 4N4NB 2BOLA 1FT9A 5BPIA 2A6HF 5TRDA 3IH4A 5KAFC 2HI3A 2D2WA 1JUPA 1UG2A 4HV6A 3WG7H 5L3FA 4MEXF 1V4RA 1FZPB 1V54H 2VE8A 4D7NA 2DOFA 1IF1A 3E6MA 3OYAA 5IOZA 2O7OA 3DKWA 1G8XA 1Z77A 1D3YA 2K9NA 2IRFG 1S7EA 1U3EM 3WGGA 4UXNA 2XV4S 1YS7A 3J80K 1R4MB 1W5TA 2PMHA 1E3OC 2ZFWA 3P9CA 3BG5A 2HYJA 4HX4A 3HEFA 4UB8C 3BTLA 2BBYA 4UVCA 2DA4A 5HLGA 2R7SA 2L9NA 1QZYA 5TJJA 2HYFA 5M3MJ 2P0WA 2EV0A 2FQ3A 2QCOA 1BC8C 1WQ2A 1LPQA 3M8FA 2RKHA 2KIFA 4LIVA 3BT9A 4MFEA 5C44J 4PZJA 1RETA 4HNUA 1QBJA 3ZMUA 5K7ZA 4XMYA 1LUJB 4ITVA 1RUNA 1JKRC 1CGPA 1MBFA 3I5UA 5C4XJ 3KYDB 3PNVA 3W2AA 6PAXA 2DQRA 3HOYJ 2DA5A 2GXAA 4AVPA 2IEKA 1ZKGA 2DDBA 1ZN2A 4CGZA 3E7LA 2JSCA 3HKZA 4XBFA 3ML6A 3ZMZA 4YELA 3EQLF 4U87A 1YI2I 3WGHA 4L9NA 2X1DA 4IHVA 2DBBA 3HL2A 3A1YA 5B1AH 4G8XA 5FKOA 3CO6C 4W1UA 1QQIA 2AS5F 2VN2A 1B72B 2L9SA 1ZYRF 3MFKA 1XPXA 1TQMA 4BBRJ 4OWRB 1MNMC 4DBQA 1YIJI 2ZSHB 2AQEA 2VJ5A 2WB1N 3JSPA 3WU1B 3CQZJ 3H3VK 2QWWA 1OJLA 2H1KA 4MQVA 1I1SA 2LY9A 4HNVA 4E7LA 5GP9A 2QGUA 4CA0A 5J1YA 3KP7A 1VQ8I 1QZZA 3ZRGA 3FK7A 4G7ZF 4HEA2 2ELKA 4IHSA 3KYCB 2O8XA 3Q5FA 3HHGA 2PX9A 3ASOH 2JT1A 3HRMA 5D5WB 5JVTA 4KISA 1PUFB 3S93A 3GXOA 2HEOA 2H09A 4A0XA 1VZ0A 3LL7A 1TQIA 1FBSA 2Q2EB 1J9IA 2FE3A 3RSNA 3CCYA 1MIJA 2CJJA 3CMMA 1A5JA 1IV8A 4ZYHA 2NVQJ 1BI0A 3FWEA 2K7LA 3LAPA 3CDLA 3S32A 5GPCA 2ISZA 2XGXA 4S0HB 5FROA 4FX4A 2VOOA 1S6LA 4LJZF 5ICGA 2YUSA 3HYIA 3RKWA 4FE7A 2UV1A 3F72A 3E3VA 5HDGA 3W3CA 1R71A 4CZCA 5FLXZ 1MMSA 3GMEA 1IRZA 2KRCA 1S5LC 3OYGA 2HFHA 4ZDLA 4XSXF 5HVQC 2XIGA 2VUMJ 3OYJA 4JP0A 2EIKH 3VPRA 4HOBA 2HDDA 3E5XA 1R22A 2X48A 2BY3A 2Z16A 3LSMA 4II3A 1T0FC 2DFHA 3CC4I 3ZR8X 2PFBA 4U0YA 2LG4A 4Y33A 4IO9F 1VQ4I 3V8KA 1L3LA 3CC2I 2IBDA 1PP8F 5FFZA 4RBOA 1QZEA 2W24A 2DMNA 3V4GA 1FC3A 5IP7J 4UHTA 2WB1A 4CICA 1Z9CA 3RI4A 1R1UA 5K7HA 2EZLA 2PEXA 1YLFA 3S3NA 5FLMJ 3WTSC 4QIWN 2ETHA 2I5UA 2P5VA 2R7QA 1ACIA 2Y30A 1MZBA 3MAJA 1ON2A 4GYGA 2KDOA 3T1BA 1MSFC 1BIAA 1OCCH 4BBSJ 3GFJA 4XKCA 3SFIA 1FYKA 3OMYA 2IP2A 2YU9J 4IZZA 1T38A 2ADUA 4M6VA 2A07F 2EV6A 4LFUA 4Y4RA 4E7KA 2M0MA 2NVUB 1FNNA 2COMA 1UB9A 2FEZA 4KNYA 3DFGA 3HRSA 1DP3A 2OZUA 2LD5A 1BI1A 2HPIA 1Y56A 2ELJA 3SFZA 2OC6A 4RAYA 2XGDA 1A36A 1G3SA 2EFQA 4DGWB 1ITYA 2ZO4A 4BL0B 1EH8A 1SAXA 2BYVE 3QPTA 4OAYA 2XAHA 2E2IJ 1MJ9A 3H9GA 4JX4A 2CQ7A 4L9VA 3I3LA 5ICFA 2DMPA 3E5QA 2BGCA 1IUFA 2Z3YA 3KETA 3M3YJ 4B3XA 3ZMDA 1TZLA 4PSXA 5EZGA 5HNFA 4MFDA 2G7HA 3T8TA 2HWVA 4GFBA 1QU3A 2OAZA 2FNPA 4XSZF 3K7AJ 1R5ID 3K0LA 2PMZA 4AVZA 2QQAA 4B43A 1M1EB 2EA4A 1T6SA 1U6GA 3RCOA 5CJ9A 1O3RA 3F6VA 3LFUA 4Q4ZF 4BY1J 1R7JA 3ZXSA 3RPUD 5J47A 1N77A 2CV2A 1R00A 3MCZA 4LMYA 2DPUA 1V3FA 1E17A 2FMLA 3KEOA 4CYCA 3CMAI 1BOAA 4JQFA 1TBXA 3QPLA 4RM3A 3F21A 4L9JA 1OISA 4F93B 4IVNA 4XM3A 4A3MJ 2KFDA 2FU4A 4XNFA 5JI6A 2RQPA 1I50J 1W7PA 2KQRA 4L5EA 1X19A 3PO2J 2P7CB 1H88C 1ETVA 5GAGJ 2K3FA 5ILUA 4A3JJ 2NAZA 2R7VA 2CWEA 3A02A 4CXFA 3FXMA 4HPQA 3KYLA 3LMMA 4XRSA 1Z7UA 3C2BA 3HPHA 1Y39A 1MMAA 4BEHA 3FXRA 1T0FA 4F55A 3F9KA 2XB5A 1AU7A 4IOAF 3WTZA 4MLOA 1HKSA 1WHUA 2VKHA 3K4NA 5M5YJ 1TWCJ 3HOUJ 2KMUA 5E8IA 5DM7F 4EGZA 3W2VA 4E7IA 1BR1A 3F8CA 4BHCA 3ZMVA 4ABZA 2ZJRF 4RMNA 3SXYA 1FYMA 1K6YA 3BTCA 4RAFA 3WTYC 2HGCA 3I4NJ 3NEUA 3FXKA 3BCAA 4L9TA 1IJWC 4MQ9F 2VJJA 4M6XA 4M71A 1POGA 3FHNA 2MG4A 3ZQIA 5B5EC 3K2ZA 3PIPF 1MD0A 3KLNA 3JSOA 1OPCA 1JGSA 2LP0A 4I98B 2MSYA 4ENJA 1U8BA 1XG1A 1BJZA 3DTEA 3LSTA 4E4HA 5JVGF 3BPVA 4LG3A 5KHDA 3PQKA 2X1CA 3FF5A 2VXDA 3K2AA 2XROA 3QQAA 3KE2A 4NNJA 1TNSA 2NNNA 3TOAA 4WXCA 5GPAA 3HXLA 3TMOA 2Y0MA 2DFEA 2LMDA 2X9DA 2HVQA 4XRSG 1DUXC 4OIOF 4OOIA 1VQOI 1F5TA 2BY2A 3PQJA 3M07A 2UUZA 2L7KA 5J8FA 4E7JA 1XSDA 1HDDC 4ZC3A 4MEYF 3GX4X 1RR8C 1LDJA 1VTNC 1RNLA 1WJCA 2Q1ZB 4M9SA 2Y0SA 2P6SA 4XRFA 3E0JB 2GIZA 1O3SA 1IDYA 4C30A 1W1WE 4KIGA 2GOMA 3GW2A 3R0AA 2V6EA 2JQ7A 3H5NA 4NC6A 3CTAA 2ZMEC 2XAFA 2LREA 5LHIA 3WTUC 2NNYA 3FMQA 4HW0A 2CV0A 4E7SA 1G4DA 2TDXA 1BIBA 1ZR2A 3P9KA 1SMTA 1YS6A 3SDGA 1EKEA 2CW0F 1AWCA 3ZMSA 1HKTA 5FD5A 2DT6A 4XKVA 2E1CA 1H9TA 2R3SA 3LSPA 1ZR4A 1WCMJ 2LR8A 3IAS2 3F23A 1TQPA 1TLHB 1U2WA 2M34A 2RC4A 3EUAA 4DNCA 3LSRA 3FHZA 1W0UA 2IS6A 2E7XA 1J2XA 2IT0A 2XGCA 4TV7A 2Y48A 1GDTA 3K70D 3Q3SA 3F8BA 2K5CA 5LD2C 2KZGA 4RDUA 1MH4A 1E2XA 1YG2A 1WJ5A 2DYSH 2GAUA 2R7DA 3B6CA 1JKPC 1F1ZA 1QPIA 3BZKA 2GOXB 2Y2ZA 5ERIA 4I09A 4M9XA 4WK8F 3V8JA 2DMQA 4XKBA 2CO5A 2IW5A 2CYYA 2DMTA 3T5XA 3I53A 3OOPA 2QBYA 3PL8A 2LFBA 3IHUA 3ZCOA 3S3MA 1TWGJ 1FYLA 1LVAA 2CQNA 5K5RA 3MKWB 1YHQI 4KMUX 1U5TA 3CMEI 1IN8A 2E1MC 3FKIJ 3S2WA 2R93J 3FMSA 1HF0A 4OMYA 2L9RA 1B1BA 1IC8A 5LEKA 3TOBA 2X4HA 3M1EA 2MD0A 3I4MJ 2HTSA 2JTVA 2GXBA 5IT9K 1P92A 3FXUA 1HXDA 2FBIA 1ZAOA 3A03A 5H2FC 1NH3A 1P7JA 2LYCA 5F0HA 1SFXA 2ZNYA 2KIQA 4M74A 1Z3XA 3LNQA 5LBQA 3MKYB 4CYCB 4BY7J 4Y15A 1JI8A 1MMNA 3FKJA 3H92A 4B47A 3PFYA 4JBAA 2K3PA 3NARA 4GO1A 1OQYA 3V42A 1KYWA 2K9LA 4LD5A 2WAQA 1K78A 4P9FA 4XOPA 4BKXA 4BQQA 1W7PB 1OYIA 1XGNA 2Z1DA 3RJPA 2DDAA 4XQFA 2KPMA 1T8IA 1WJFA 4HAMA 1IN4A 3J80Z 5IYCJ 3OYLA 2ME0A 1HDPA 4XKWA 4RGSA 3LAJA 2E7WA 1OYWA 1X3ZB 3ECOA 3SZPA 2J5OA 1N25A 2Y69H 3ZQGA 2H6CA 3LA2A 1UHWA 4BEHB 4E70A 5H6RA 2OPTA 3OS2A 2JMWA 2MC4A 4P55A 4ZYAA 4ASNA 2HOSA 3OSFA 2M4GA 2GA2A 2JN6A 4RGRA 2LKPA 3K1PA 4WF2A 2XUBA 5J1RA 4EMSA 5J6XA 1K4SA 3GO5A 3PUFA 1CF7A 1ZLJA 4LB6B 2ZMEA 1G59A 3CDHA 3N4MA 4DYRA 1U78A 1X1CA 2HKXA 2WY8Q 1LB2A 2M8GX 1TWAJ 2VB6A 5HNHA 2VXZA 4BJ6C 1W36D 4U0WA 2BXYA 4U88A 4EJOA 4U7DA 1XMAA 4GRIA 4ENKA 5HLIA 3ZQFA 1UELB 1HA8A 4XK4A 5EYRA 2ACJA 3E6DA 4DIQA 4ZYGA 4DQ2A 1X2MA 5JHFA 1FP1D 4RAGA 1SD4A 1KZHA 1OR7A 3F6OA 2A5WA 1EJ9A 4XLFA 1WFXA 5JHUA 2OTJI 1JTYA 4EJUA 1Y8QB 1WVRA 2F5CA 2H6BA 5EEHA 5K5OA 4I6ZA 4ESJA 2VE9A 4AIHA 3O6BB 5HOOA 4L0ZB 5ICEA 3QWLA 2L02A 2B63J 4G7OF 3JRDA 1ETKA 2CSOA 4M9ZA 3RTRA 1SD7A 1UHMA 2P4WA 1QO0D 4NDLA 2V79A 4CCNA 3OWTA 1IN6A 4N0BA 4PJNA 1QVTA 1Y0NA 3CJTB 3Q9VA 5E1WA 5D8KB 3SDBA 2ZC2A 2PJRA 1IXCA 3JREA 3DEEA 3COAC 1LDKB 5GTHC 4BXXJ 4RAZA 2O8KA 3WODF 4CO8A 1FEXA 5ILSA 2EJRA 4WCGA 3EUHA 2NS8A 5L3BA 2MBFA 1ZG3A 2ZXWH 3GTLJ 5DEQA 3OSGA 1RZ4A 3HGGA 2XDVA 3K6GA 4BGDA 4OIQF 2I10A 2VBZA 5E1ZB 3IWZA 1PDNC 1RPWA 5E20A 5TISC 1KONA 4M3BA 2HZDA 3E6BA 3R60A 1ETWA 3GFLA 3KZYA 2WAFA 2DK5A 3ABUA 1WJBA 3DLAA 5J8CA 4I99C 1WI9A 2EFOA 3B6AA 5ICCA 1JXSA 2JJ7A 4PFPA 1ETXA 2LY2A 3C7JA 1SD5A 3GVAA 2EBIA 5JLWA 2UXXA 3ZQQA 4EATA 5KK1A 2K9SA 1B59A 2QF7A 4NQWA 5F64A 2LKXA 1TTYA 3IRRA 3SQNA 3VODA 2W57A 2FBKA 2R7XA 4RGXA 3JCUC 5B66C 1I6XA 1G2HA 2NVXJ 2EQRA 2CMPA 1WKMA 3W2WA 2F5EA 1J7KA 3BDDA 2VJIA 1T33A 5D5XB 3O2PE 4P9UA 2HXOA 2QBYB 3DKXA 4FETA 2HOEA 3QPSA 4C2MJ 3S8PA 1U5TB 4A2UA 3JR9A 4DZPA 1GVDA 2MGQA 4A3BJ 1KGSA 1DU6A 3E5UA 2XVCA 5CVIA 2P5KA 3L9FA 1ZRFA 4F52A 1SEUA 4YFNF 3ABTA 2XRLA 1VQ6I 3Q0VA 2E2HJ 3L1PA 2X6WA 4OAZA 1W5CC 1MBJA 1YOVB 3L2VA 2G0EA 5CYVA 2XF5A 2DOAA 2RV8A 5HLHA 1A35A 5BPDA 3D5SC 1IN5A 2LH9A 3I55I 3H0DA 1TWHJ 1R49A 3BWGA 4A0YA 1NG6A 1KU2A 4HF0A 3K69A 1OCOH 1XGSA 2OJED 5HDNA 2EILH 2X6OA 1FY7A 1PYVA 4BU2A 2P6TA 3HTUA 1HCRA 1EA3A 1YIOA 4QSHA 2A6TA 2VPRA 1V5FA 3RKXA 1KQ8A 1I5ZA 2WWYA 5J1UA 2XHKA 3H9JA 3MQ0A 3TP0A 3NWSA 3TKYA 2LDUA 1K78B 3WE3A 1YFHA 2EZHA 4U7BA 4CCKA 2HZTA 1X1DA 2CGPA 1F4KA 5CVUA 1X4OA 4J19A 1X1AA 2R7ZJ 1BJAA 2PJPA 4G94A 5IY5H 5EGOA 3A01B 4Z2YA 2VT3A 4A3CJ 4XICA 4CYDA 3AAFA 1JT0A 2EIMH 2AHQA 3UNGC 2JA7J 2IA0A 3JTHA 3LSKA 5FKLA 3H0GJ 1CF7B 3HSEA 4FHTA 1XMXA 1HW1A 2ZMEB 1LFUP 4G9YA 4GYIA 2B0LA 2DT5A 4Y3OA 3REOA 3V8LA 3MWMA 4XN0A 1KU3A 2VONA 3SEZA 2CQXA 4AC0A 2QSHX 3WU0A 2W4SA 4M72A 1USTA 4AU7A 3A0HC 4AIKA 2E2JJ 1ORKA 1UFMA 3DBRB 5F1RA 1HLVA 4YFXF 3VYUB 1HW5A 3VSKA 4B09A 4XRMA 1Q1VA 1ZREA 1YJNI 2V1XA 4FCYA 5DD4A 3KP6A 2DU9A 2VIXA 1V5EA 2K4JA 1GVJA 1RUOA 3S1QJ 2BHZA 2V4JC 3S2DJ 5BNGA 1FSHA 1GXPA 1IRFA 4HNTA 1Z6RA 2L4MA 3OOUA 2CUEA 2DN0A 3PSIA 2NXNB 3VSLA 2Z9OA 1BN5A 2XAJA 1Y6IA 2PBIA 1S29A 4HX7A 2HKOA 5HODA 1VQNI 4RA2A 1V5GA 4GGGA 2BV6A 1TW3A 2R4GA 2DLLA 2VQCA 2FOWA 2FF4A 1X3WB 4XLPF 3GZ5A 3QPHA 5LGUA 3DEUA 1MBEA 3D0SA 2L0KA 1FOXA 4EM0B 1O4XA 4BUPA 2I8DA 1ENHA 2ECCA 2IAIA 4UVAA 2PJRB 1I3AA 1TC3C 3G1OA 5F1JA 2HQNA 2N8GA 3GFMA 4D5FA 2LY1A 1O57A 2GWRA 3FDYA 1KQ9A 1KQ0A 4C3HJ 1WJDA 5IT3A 2LC2A 2QZ8A 3H36A 5E79C 2MH9A 4A3KJ 2ZSIB 1DDNA 3HOWJ 1DU0A 3CF2A 1XC5A 3AL0B 3OYNA 4D7MA 5FD6A 4F3QA 2R7RA 3C2GA 2Y9ZA 1LFBA 3FZVA 1K83J 1XSVA 3LSGA 4PK4A 4II2A 4D9JA 3J7YJ 1BL0A 1B8IA 1WH7A 4D1QA 4IX7A 3DTIA 1D0XA 1ZGAA 1PJRA 1VNDA 3CCJI 1S7OA 2CRGA 3OYHA 1TT5B 3QYEA 1IN7A 3JRGA 1QHHD 1Z67A 4BS9A 4HA8A 1FIAA 1R6RA 3K4LA 1FIPA 2A3SA 2DYRH 1XGOA 4NQWB 3CUQC 3K70C 3HOTA 3SZGA 1LFPA 4ZTJA 1MDMA 3O3KA 4HG2A 1ZK8A 5JLXA 1U9NA 2OU2A 2JVGA 1TNTA 2VQHA 3GLLA 2XAQA 2ZXHA 2DA7A 1F9NA 2WV0A 1D5VA 2CUFA 1H89C 3IKTA 4A93J 4AIJA 2X0LA 2BZTA 1FOWA 3ERMA 2LF7A 2Z99A 4XL9A 5EZHA 3K9TA 1F43A 1ETYA 2O0YA 2F5FA 3PNTA 3GTJJ 1D0YA 3K4JA 1BI3A 2PMUA 3HZJA 4DJAA 2LLKA 2RAEA 2DMUA 3TDUC 3I9V2 4CHUA 3KZIC 1Y0UA 3HOVJ 4ESBA 1ULYA 2KKOA 2DA2A 4JOMA 1QA6A 4BJ5C 3BG7A 4BACA 4XONA 3GYHX 2KJCA 4AM3A 1OLTA 3S1NJ 4RLFA 4UV8A 3C2HA 3BR2A 3R6SA 1V55H 3H9QA 4EJTA 2A69F 5FJ8J 2HDCA 3BR5A 3CCQI 3OL3A 2ISYA 3RKYA 1YX5A 1Z0XA 3BG3A 3BTJA 4AIDA 3K4BA 2IGNA 4HDUA 3MZ8A 4OIRF 4RB2C 5L3GA 4Q5SF 1ZRCA 1B9MA 2V7FA 4LK1F 3CUOA 1W4MA 4A5NA 2DOEA 2VQGA 2CQKA 2GLOA 5FLVA 4G6QA 3KP2A 4HV5A 1NG7A 4KMFA 3ROUA 4UY8I 2VQLA 5EGOB 1KYZA 5LRRA 1X1BA 4M3EA 1D1CA 5IT9Z 2V6CA 2QM3A 4BAYA 5L3DA 4IKFA 1XDSA 5D5VB 1DQUA 3KP3A 2QENA 2J5PA 3L2WA 2X6YA 3GZNB 4M73A 2V9PA 1K6OA 3S1RJ 2K86A 5HS8A 2HOTA 1W36C 3BJ6A 3F8NA 3L09A 3D5LA 3ABLH 3MZHA 4LIUA 2E19A 1IZ1A 2VPLA 1R58A 2HQAA 3K1NA 1X4PA 2RNJA 2OV7A 3Q0UA 4DYQA 2IA1A 3ESWB 2Q0OA 1MNDA 5E3LA 1MKMA 2XAGA 3H5RA 3OR1C 3WU2C 4M3GA 4RLQA 5ED4A 1S72I 4ZJZA 3CUQA 2QSGX 1WH5A 1SD6A 3J81K 2AXLA 2RN7A 3TO9A 1D0ZA 3HHHA 4HRIA 1GV5A 1E3HA 3B73A 1I1GA 5L3CA 3Q0WA 4IXAA 1UMQA 4S04A 2K27A 3GLXA 3NAUA 2V26A 2A6EF 4Y52J 2OA4A 2D45A 1IXRC 1W5SA 2JRMA 4I76A 2H94A 4CUGA 1W7PD 2M2EA 3BPXA 1CQTA 5LLQA 2XF7A 2A5YB 4PGHA 3S15J 5ILVA 1MJAA 5IOYA 2W82A 1XCVA 2IS2A 4LB5A 4XLNF 2HU9A 3PJRA 1SMYF 3CO7C 1O3QA 4I0AA 2M9HA 4JX5A 3ZN0A 5BQTA 5A2QK 4F91B 4I2OA 1B6AA 2V1UA 5DV5A 1MBGA 3ULQB 3G1MA 1P4XA 1SVMA 1OCTC 3JRHA 1FLIA 4A6EA 3G4SI 3BROA 1MW7A 1APLC 2W25A 1J0RA 2RDPA 4B1RA 1GV2A 3IL2A 2ZJQF 2P8TA 4ZTFA 3DQVC 4HQEA 2JA6J 3RZDJ 2YPRA 4CZZA 1B8IB 2HYGD 3FIWA 5D4SA 1I39A 3S2HJ 4YIFA 3OYFA 5LFAA 1Y1VJ 4HLXA 3FM3A 3PIOF 1H8AC 3R61A 3KCCA 1GXQA 4H0EA 2H8WA 5B3SH 2GQQA 2Z2SB 2OBPA 2VJ4A 2CS3A 1R5GA 2E1NA 2KT0A 5CVVA 1WPKA 3U21A 4PUSA 4CDGA 4WX9A 2EWNA 5HS7A 2GM4A 1J5YA 4ZZDA 4IRIA 3S17J 3CLQA 1JKQC 1R4NB 4QWQA 2V9KA 3HOZJ 4KUMA 5CQGA 2EFNA 1MDMB 2MC3A 4CH7A 2XSDC 3IH3A 2MW8A 1Q1HA 1TWFJ 4LGWA 4A3DJ 1XX5A 4X6AJ 2LBFA 4FASD 2E36A 3SEQA 1VFCA 2NRAC 3HG9A 3HRUA 1WRJA 3L2UA 1QNTA 4PJLA 1K7AA 2XASA 2EFWA 3DBLB 1USSA 2A68F 2WC2A 4EGYA
chains in the Genus database with same CATH topology
5GPCA 1ZGWA 4S0HB 4M3BA 5M5XJ 1ZQ3P 2NS7A 3JRCA 1ETWA 2OF7A 2EZIA 1SFOJ 2XPVA 2YUSA 2Y9YA 4FE7A 2R5ZA 4A3EJ 2JWTA 3B6AA 1LE8A 4XIDA 3GBGA 2JJ7A 1ETXA 5IYDJ 1R9TJ 1I3QJ 1QVUA 2EBIA 5J3LA 5JLWA 3FK6A 3RQIA 1IRZA 3JRAA 2K9SA 2LKXA 2QF7A 4DW6A 2VUMJ 4DYCA 4JP0A 3VPRA 1YRNB 2HDDA 4IHYA 2X48A 3M4OJ 1G2HA 2NVXJ 2EQRA 2EH3A 3HGYA 1T33A 2E1OA 2HXOA 1FTZA 1RESA 3QPSA 2ZB9A 3HB9A 2IBDA 1IV6A 3A01A 4C2MJ 2R0QC 4RBOA 2DMNA 3BQYA 3JR9A 4M3DA 4DZPA 2R5YB 1GVDA 3LSJA 1EF4A 1K61A 2MGQA 4A3BJ 5IP7J 3JRFA 1DU6A 2VKEA 5K7HA 1IG7A 2EZLA 2DA1A 5FLMJ 2XRLA 4QIWN 3Q0VA 5DTDA 3RKQA 2Y30A 3L1PA 2E2HJ 1MBJA 3DCFA 2G0EA 1MBHA 5EG0A 5DS9A 1NK2P 1MSFC 1BW5A 1TWHJ 3GTMJ 4BBSJ 3SFIA 1ETOA 2YU9J 2X6OA 2NOGA 4M6VA 1HCRA 3D1NI 4QSHA 2VPRA 1BA5A 2XPWA 1WGXA 4MIMA 5J1UA 2HXIA 2LD5A 3TP0A 3S14J 1MSEC 2EZHA 2XGDA 3HDDA 1ITYA 2W48A 1XS9A 3FISA 2E2IJ 4J19A 2R7ZJ 4JX4A 4LOCA 2DMPA 1IUFA 2VKVA 1IGNA 5EGOA 3A01B 3M3YJ 1FTTA 2WAQN 4A3CJ 1OFCX 5EZGA 4XICA 4MFDA 2H8RA 4QTRA 3O8GA 1JT0A 4GFBA 2AHQA 4UUTA 2JA7J 3K7AJ 5FKLA 1JTXA 3BTIA 3H0GJ 3PM1A 1ETQA 1LFUP 4BY1J 5K7FA 1X2NA 2COBA 1D5YA 5M3FJ 2CQXA 4MO7A 4AC0A 2FX0A 4CYCA 5IYBJ 3QPLA 5FKKA 2HOAA 3ZQHA 5M5WJ 1OCPA 3MVPA 2E2JJ 2FJ1A 1ORKA 4C3IJ 4A3MJ 1HLVA 4XRMA 1I50J 4L5EA 1Q1VA 1JUSA 1X58A 3PO2J 4FCYA 1H88C 1ETVA 1P7IA 4A3JJ 3A02A 3JRIA 3BQZA 4G12A 3S1QJ 3S2DJ 1T56A 5BNGA 4XRSA 3C2BA 3ZQLA 3OOUA 2CUEA 2DN0A 2P81A 3O8HA 5EDNA 3HKZN 1Y1WJ 5HODA 1WI3A 1UHSA 2XB5A 1AU7A 4MLOA 1AKHA 2XPUA 5M5YJ 1TWCJ 1QRYA 3HOUJ 1MBEA 2LTPA 2L0KA 4FISA 4JX6A 1O4XA 4ABZA 3BTCA 3TP3A 1ENHA 2ECCA 2IAIA 2L7MP 3I4NJ 2TRTA 1TC3C 2DTZA 3G1OA 5F1JA 4D5FA 2N8GA 1IJWC 4IEJA 3MKLA 1POGA 3TW6A 4C3HJ 2MG4A 3ZQIA 3IV5A 4V2GA 1GUUA 2ID6A 4A3KJ 2NVYJ 1ZTRA 2LP0A 1RKWA 1DU0A 2MSYA 1U8BA 3HOWJ 1XC5A 1XG1A 1BJZA 4D7MA 5E3MA 2XB0X 5E3OA 2Y9ZA 1MH3A 1LFBA 1K83J 3LSGA 4A69C 1BL0A 1B8IA 1WH7A 3BG9A 3K2AA 1B72A 4JYKA 3ZOBA 3QQAA 1VNDA 2R5ZB 5GPAA 3TEDA 2CRGA 1F36A 1LE8B 5FKMA 3LOCA 2X9DA 5F0FA 4XRSG 3JRGA 3SJMA 3GTKJ 1FIAA 3S16J 1FIPA 2JA8J 1JT6A 4Y7NJ 5F27A 3BR3A 2DA3A 4EEFG 1FJLA 1HDDC 3W6VA 2FD5A 2DJNA 2L7ZA 1GT0C 2HQ5A 3WHCA 2XGEA 1HOMA 1ZK8A 5JLXA 1U9NA 1PUFA 3PO3J 1RKTA 4A3FJ 2JA5J 3GTQJ 1IDYA 2DA7A 1MBKA 3RZOJ 2CUFA 1H89C 4A93J 4AUXA 4B4CA 4UUSA 4FTHA 2WV1A 5EZHA 3UKGA 1NK3P 2K9QA 1ZR2A 1F43A 2VI6A 1ETYA 1JKOC 1BW6A 2JK3A 3SDGA 4C3JJ 5E3NA 4IHWA 3GTJJ 3GTPJ 5IP6A 5EEAA 2ME6A 4V2FA 3F0CA 5C3EJ 2LLKA 2RAEA 1NTCA 2DMUA 4A3LJ 1JGGA 3LSPA 1JUMA 1WCMJ 2LR8A 1ZR4A 4W97A 3GTLJ 2LVSA 2M34A 3LSRA 1W0UA 3HOVJ 5C4JJ 5EG0B 3CMYA 2XGCA 1GDTA 2DA2A 5F08A 4A3GJ 3Q3SA 2AO9A 3TW7A 3S1NJ 4RDUA 3BR2A 3HBLA 1MH4A 1YRNA 5FJ8J 3B6CA 3BR5A 1VF9A 1JKPC 1QPIA 2M0CA 2Y2ZA 1Z0XA 3BG3A 3BTJA 2KDZA 2DMQA 1JJ6C 2DMTA 3DEWA 2Y0SN 2LFBA 1TWGJ 2GLOA 5FLVA 1U9OA 2R5YA 1RR7A 3FKIJ 2R93J 5EGOB 1HF0A 2O9LA 3HOXJ 2EZKA 2L9RA 4M3EA 3S1MJ 2L7FP 1IC8A 3JRBA 3I4MJ 3HM5A 1A6IA 5EF6A 4M3FA 3GTGJ 2LK2A 3A03A 4FE4A 1SANA 1P7JA 2CQQA 5F0HA 2ECBA 1IDZA 3S1RJ 3LNQA 2R92J 2HOTA 4CYCB 4BY7J 3IH4A 2HI3A 1JUPA 1UG2A 2PMZN 3NARA 2E19A 4D7NA 4BKXA 3Q0UA 4DYQA 5IOZA 2D5VA 2O7OA 5IYCJ 2ME0A 1Z77A 2K9NA 1HDPA 5E3LA 1S7EA 4M3GA 1WH5A 4X1EA 4DZJA 3ZQGA 3MN2A 1E3OC 3BG5A 2HYJA 1GV5A 3HEFA 2OPTA 2JMWA 3BTLA 3Q0WA 1UMQA 2DA4A 4B3AA 2HOSA 3OSFA 2JN6A 3NAUA 5M3MJ 4Y52J 2FQ4A 5J1RA 4I76A 3BR6A 2NVTJ 2ID3A 2QCOA 1CQTA 2M2EA 1AKHB 3S15J 3BT9A 4DYRA 4MFEA 5IOYA 5C44J 1U78A 2M8GX 1RETA 1TWAJ 1W0TA 5K7ZA 2M9HA 4JX5A 1JKRC 1MBFA 5C4XJ 3ZQFA 4AYBN 5IPAA 4XK4A 5EYRA 3HOYJ 2DA5A 2GBYA 2IEKA 1ZKGA 1MBGA 3IH2A 2TCTA 1X2MA 3G1MA 3E7LA 1AHDP 4D5CA 1OCTC 3JRHA 1APLC 4B1RA 1GV2A 1JTYA 4IHVA 2JA6J 4I6ZA 3RZDJ 2DA6A 5FKOA 3ZQCA 4W1UA 5F0CA 1B8IB 3FIWA 1B72B 3WHBA 5IP9J 3S2HJ 4BBRJ 1MNMC 1Y1VJ 2B63J 3JRDA 1ETKA 2WB1N 1H8AC 3CQZJ 3H3VK 1OJLA 2H1KA 4NDLA 2LY9A 4HNVA 3G1LA 5FKNA 5GP9A 3GTOJ 5J1YA 9ANTA 2KT0A 3BR1A 1WPKA 3FK7A 2GM4A 3S17J 5F04A 1QVTA 1JKQC 2ELKA 3HOZJ 3JREA 2XSDC 4A3IJ 4BXXJ 1PUFB 2O8KA 1FEXA 3BR0A 3IH3A 2MW8A 1TWFJ 2YS9A 4A3DJ 1JJ8C 2NS8A 1I6HJ 2CU7A 4X6AJ 1VFCA 3CCYA 3OSGA 4UUSB 3HGGA 1VI0A 2K40A 2CJJA 2Y31A 1A5JA 3OIOA 2I10A 2NVQJ 1RPWA 3CDLA 4IHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GPC A;  1ZGW A;  4S0H B;  4M3B A;  5M5X J;  1ZQ3 P;  2NS7 A;  3JRC A;  1ETW A;  2OF7 A;  2EZI A;  1SFO J;  2XPV A;  2YUS A;  2Y9Y A;  4FE7 A;  2R5Z A;  4A3E J;  2JWT A;  3B6A A;  1LE8 A;  4XID A;  3GBG A;  2JJ7 A;  1ETX A;  5IYD J;  1R9T J;  1I3Q J;  1QVU A;  2EBI A;  5J3L A;  5JLW A;  3FK6 A;  3RQI A;  1IRZ A;  3JRA A;  2K9S A;  2LKX A;  2QF7 A;  4DW6 A;  2VUM J;  4DYC A;  4JP0 A;  3VPR A;  1YRN B;  2HDD A;  4IHY A;  2X48 A;  3M4O J;  1G2H A;  2NVX J;  2EQR A;  2EH3 A;  3HGY A;  1T33 A;  2E1O A;  2HXO A;  1FTZ A;  1RES A;  3QPS A;  2ZB9 A;  3HB9 A;  2IBD A;  1IV6 A;  3A01 A;  4C2M J;  2R0Q C;  4RBO A;  2DMN A;  3BQY A;  3JR9 A;  4M3D A;  4DZP A;  2R5Y B;  1GVD A;  3LSJ A;  1EF4 A;  1K61 A;  2MGQ A;  4A3B J;  5IP7 J;  3JRF A;  1DU6 A;  2VKE A;  5K7H A;  1IG7 A;  2EZL A;  2DA1 A;  5FLM J;  2XRL A;  4QIW N;  3Q0V A;  5DTD A;  3RKQ A;  2Y30 A;  3L1P A;  2E2H J;  1MBJ A;  3DCF A;  2G0E A;  1MBH A;  5EG0 A;  5DS9 A;  1NK2 P;  1MSF C;  1BW5 A;  1TWH J;  3GTM J;  4BBS J;  3SFI A;  1ETO A;  2YU9 J;  2X6O A;  2NOG A;  4M6V A;  1HCR A;  3D1N I;  4QSH A;  2VPR A;  1BA5 A;  2XPW A;  1WGX A;  4MIM A;  5J1U A;  2HXI A;  2LD5 A;  3TP0 A;  3S14 J;  1MSE C;  2EZH A;  2XGD A;  3HDD A;  1ITY A;  2W48 A;  1XS9 A;  3FIS A;  2E2I J;  4J19 A;  2R7Z J;  4JX4 A;  4LOC A;  2DMP A;  1IUF A;  2VKV A;  1IGN A;  5EGO A;  3A01 B;  3M3Y J;  1FTT A;  2WAQ N;  4A3C J;  1OFC X;  5EZG A;  4XIC A;  4MFD A;  2H8R A;  4QTR A;  3O8G A;  1JT0 A;  4GFB A;  2AHQ A;  4UUT A;  2JA7 J;  3K7A J;  5FKL A;  1JTX A;  3BTI A;  3H0G J;  3PM1 A;  1ETQ A;  1LFU P;  4BY1 J;  5K7F A;  1X2N A;  2COB A;  1D5Y A;  5M3F J;  2CQX A;  4MO7 A;  4AC0 A;  2FX0 A;  4CYC A;  5IYB J;  3QPL A;  5FKK A;  2HOA A;  3ZQH A;  5M5W J;  1OCP A;  3MVP A;  2E2J J;  2FJ1 A;  1ORK A;  4C3I J;  4A3M J;  1HLV A;  4XRM A;  1I50 J;  4L5E A;  1Q1V A;  1JUS A;  1X58 A;  3PO2 J;  4FCY A;  1H88 C;  1ETV A;  1P7I A;  4A3J J;  3A02 A;  3JRI A;  3BQZ A;  4G12 A;  3S1Q J;  3S2D J;  1T56 A;  5BNG A;  4XRS A;  3C2B A;  3ZQL A;  3OOU A;  2CUE A;  2DN0 A;  2P81 A;  3O8H A;  5EDN A;  3HKZ N;  1Y1W J;  5HOD A;  1WI3 A;  1UHS A;  2XB5 A;  1AU7 A;  4MLO A;  1AKH A;  2XPU A;  5M5Y J;  1TWC J;  1QRY A;  3HOU J;  1MBE A;  2LTP A;  2L0K A;  4FIS A;  4JX6 A;  1O4X A;  4ABZ A;  3BTC A;  3TP3 A;  1ENH A;  2ECC A;  2IAI A;  2L7M P;  3I4N J;  2TRT A;  1TC3 C;  2DTZ A;  3G1O A;  5F1J A;  4D5F A;  2N8G A;  1IJW C;  4IEJ A;  3MKL A;  1POG A;  3TW6 A;  4C3H J;  2MG4 A;  3ZQI A;  3IV5 A;  4V2G A;  1GUU A;  2ID6 A;  4A3K J;  2NVY J;  1ZTR A;  2LP0 A;  1RKW A;  1DU0 A;  2MSY A;  1U8B A;  3HOW J;  1XC5 A;  1XG1 A;  1BJZ A;  4D7M A;  5E3M A;  2XB0 X;  5E3O A;  2Y9Z A;  1MH3 A;  1LFB A;  1K83 J;  3LSG A;  4A69 C;  1BL0 A;  1B8I A;  1WH7 A;  3BG9 A;  3K2A A;  1B72 A;  4JYK A;  3ZOB A;  3QQA A;  1VND A;  2R5Z B;  5GPA A;  3TED A;  2CRG A;  1F36 A;  1LE8 B;  5FKM A;  3LOC A;  2X9D A;  5F0F A;  4XRS G;  3JRG A;  3SJM A;  3GTK J;  1FIA A;  3S16 J;  1FIP A;  2JA8 J;  1JT6 A;  4Y7N J;  5F27 A;  3BR3 A;  2DA3 A;  4EEF G;  1FJL A;  1HDD C;  3W6V A;  2FD5 A;  2DJN A;  2L7Z A;  1GT0 C;  2HQ5 A;  3WHC A;  2XGE A;  1HOM A;  1ZK8 A;  5JLX A;  1U9N A;  1PUF A;  3PO3 J;  1RKT A;  4A3F J;  2JA5 J;  3GTQ J;  1IDY A;  2DA7 A;  1MBK A;  3RZO J;  2CUF A;  1H89 C;  4A93 J;  4AUX A;  4B4C A;  4UUS A;  4FTH A;  2WV1 A;  5EZH A;  3UKG A;  1NK3 P;  2K9Q A;  1ZR2 A;  1F43 A;  2VI6 A;  1ETY A;  1JKO C;  1BW6 A;  2JK3 A;  3SDG A;  4C3J J;  5E3N A;  4IHW A;  3GTJ J;  3GTP J;  5IP6 A;  5EEA A;  2ME6 A;  4V2F A;  3F0C A;  5C3E J;  2LLK A;  2RAE A;  1NTC A;  2DMU A;  4A3L J;  1JGG A;  3LSP A;  1JUM A;  1WCM J;  2LR8 A;  1ZR4 A;  4W97 A;  3GTL J;  2LVS A;  2M34 A;  3LSR A;  1W0U A;  3HOV J;  5C4J J;  5EG0 B;  3CMY A;  2XGC A;  1GDT A;  2DA2 A;  5F08 A;  4A3G J;  3Q3S A;  2AO9 A;  3TW7 A;  3S1N J;  4RDU A;  3BR2 A;  3HBL A;  1MH4 A;  1YRN A;  5FJ8 J;  3B6C A;  3BR5 A;  1VF9 A;  1JKP C;  1QPI A;  2M0C A;  2Y2Z A;  1Z0X A;  3BG3 A;  3BTJ A;  2KDZ A;  2DMQ A;  1JJ6 C;  2DMT A;  3DEW A;  2Y0S N;  2LFB A;  1TWG J;  2GLO A;  5FLV A;  1U9O A;  2R5Y A;  1RR7 A;  3FKI J;  2R93 J;  5EGO B;  1HF0 A;  2O9L A;  3HOX J;  2EZK A;  2L9R A;  4M3E A;  3S1M J;  2L7F P;  1IC8 A;  3JRB A;  3I4M J;  3HM5 A;  1A6I A;  5EF6 A;  4M3F A;  3GTG J;  2LK2 A;  3A03 A;  4FE4 A;  1SAN A;  1P7J A;  2CQQ A;  5F0H A;  2ECB A;  1IDZ A;  3S1R J;  3LNQ A;  2R92 J;  2HOT A;  4CYC B;  4BY7 J;  3IH4 A;  2HI3 A;  1JUP A;  1UG2 A;  2PMZ N;  3NAR A;  2E19 A;  4D7N A;  4BKX A;  3Q0U A;  4DYQ A;  5IOZ A;  2D5V A;  2O7O A;  5IYC J;  2ME0 A;  1Z77 A;  2K9N A;  1HDP A;  5E3L A;  1S7E A;  4M3G A;  1WH5 A;  4X1E A;  4DZJ A;  3ZQG A;  3MN2 A;  1E3O C;  3BG5 A;  2HYJ A;  1GV5 A;  3HEF A;  2OPT A;  2JMW A;  3BTL A;  3Q0W A;  1UMQ A;  2DA4 A;  4B3A A;  2HOS A;  3OSF A;  2JN6 A;  3NAU A;  5M3M J;  4Y52 J;  2FQ4 A;  5J1R A;  4I76 A;  3BR6 A;  2NVT J;  2ID3 A;  2QCO A;  1CQT A;  2M2E A;  1AKH B;  3S15 J;  3BT9 A;  4DYR A;  4MFE A;  5IOY A;  5C44 J;  1U78 A;  2M8G X;  1RET A;  1TWA J;  1W0T A;  5K7Z A;  2M9H A;  4JX5 A;  1JKR C;  1MBF A;  5C4X J;  3ZQF A;  4AYB N;  5IPA A;  4XK4 A;  5EYR A;  3HOY J;  2DA5 A;  2GBY A;  2IEK A;  1ZKG A;  1MBG A;  3IH2 A;  2TCT A;  1X2M A;  3G1M A;  3E7L A;  1AHD P;  4D5C A;  1OCT C;  3JRH A;  1APL C;  4B1R A;  1GV2 A;  1JTY A;  4IHV A;  2JA6 J;  4I6Z A;  3RZD J;  2DA6 A;  5FKO A;  3ZQC A;  4W1U A;  5F0C A;  1B8I B;  3FIW A;  1B72 B;  3WHB A;  5IP9 J;  3S2H J;  4BBR J;  1MNM C;  1Y1V J;  2B63 J;  3JRD A;  1ETK A;  2WB1 N;  1H8A C;  3CQZ J;  3H3V K;  1OJL A;  2H1K A;  4NDL A;  2LY9 A;  4HNV A;  3G1L A;  5FKN A;  5GP9 A;  3GTO J;  5J1Y A;  9ANT A;  2KT0 A;  3BR1 A;  1WPK A;  3FK7 A;  2GM4 A;  3S17 J;  5F04 A;  1QVT A;  1JKQ C;  2ELK A;  3HOZ J;  3JRE A;  2XSD C;  4A3I J;  4BXX J;  1PUF B;  2O8K A;  1FEX A;  3BR0 A;  3IH3 A;  2MW8 A;  1TWF J;  2YS9 A;  4A3D J;  1JJ8 C;  2NS8 A;  1I6H J;  2CU7 A;  4X6A J;  1VFC A;  3CCY A;  3OSG A;  4UUS B;  3HGG A;  1VI0 A;  2K40 A;  2CJJ A;  2Y31 A;  1A5J A;  3OIO A;  2I10 A;  2NVQ J;  1RPW A;  3CDL A;  4IHX A; 
#chains in the Genus database with same CATH topology
 5TGT A;  1ZGW A;  4RM2 A;  1D8J A;  1G3T A;  2E60 A;  5M5X J;  1QHG A;  4L0Y B;  2NS7 A;  2RGV A;  1NHA A;  3FBI B;  1B4A A;  1SFO J;  3CJR B;  4B48 A;  3VWB A;  2XPV A;  3OR2 C;  3I56 I;  3LQQ A;  1J75 A;  2OQR A;  2JWT A;  1FX7 A;  3CD6 I;  5EJC A;  2AQF A;  4XID A;  4B8X A;  4S05 A;  2HS5 A;  1XD7 A;  3DPT A;  1HW2 A;  5F6F A;  5IYD J;  3PUB A;  3ABM H;  3OYD A;  3KX2 A;  3LWF A;  1I3Q J;  4IQJ A;  1QVU A;  5J3L A;  3WTW C;  4C9Y A;  3ERE D;  3L2C A;  2KRH A;  4KN4 X;  1OCZ H;  3NRV A;  4UVB A;  1I27 A;  4DYC A;  2B9S A;  4V19 K;  3VEP A;  4IHY A;  1G3Y A;  1DPR A;  2ELH A;  4D0P A;  3SZT A;  3K4K A;  1SVO A;  1XDU A;  4A6D A;  1D8K A;  5E17 F;  2EH3 A;  3HSF A;  3HGY A;  4BXU A;  2QLZ A;  1IRG A;  3AG4 H;  3DU5 A;  5D6F A;  4Z6Y A;  1XTA A;  2V9V A;  4OIN F;  2EK5 A;  2DFF A;  2ZB9 A;  3HB9 A;  2L5Q A;  4NB5 A;  4P1W A;  3A01 A;  4XR6 A;  1IV6 A;  4A12 A;  3BQY A;  3A4C A;  3LSJ A;  3ZP5 A;  3AG2 H;  3MMY B;  4ZYD A;  2W7N A;  3JRF A;  2KJB A;  2L3D A;  3BJO A;  1Z6T A;  1IG7 A;  3B02 A;  3JTG A;  2DA1 A;  3DXJ F;  3CLO A;  3KFW X;  3QYF A;  1DGR M;  2Y75 A;  3RKQ A;  1RRJ A;  2QVO A;  1ZH5 A;  1MBH A;  1D1B A;  2E71 A;  2M8E A;  2VL8 A;  5EG0 A;  1BW5 A;  4KIC A;  2ZNZ A;  5GTI C;  1VQ7 I;  2FOK A;  2DI3 A;  3P5J A;  4XLC A;  3DV8 A;  5B1B H;  2M4K A;  3H3U A;  3OS0 A;  1BA5 A;  1HKQ A;  1WGX A;  2VBX A;  1XN7 A;  4A5M A;  3S14 J;  1MSE C;  4NC8 A;  5JR3 A;  1FBQ A;  2LKS A;  2W48 A;  2QUF A;  4F7Z A;  1XS9 A;  1IUY A;  3FIS A;  3VYR B;  4LOC A;  2W00 A;  3CES A;  2HNH A;  3CUQ B;  2VC1 A;  2L01 A;  3IC7 A;  2VKV A;  4YFK F;  3MKZ A;  1KU7 A;  1IGN A;  2QQ8 A;  1FTT A;  2YSR A;  3ELK A;  2E35 A;  4XLH A;  2XF6 A;  4R8H A;  2IVM A;  2JPC A;  3O8G A;  3I54 A;  2BVL A;  4UUT A;  2DPD A;  3X2Q H;  1P6R A;  4KN7 X;  5KAI C;  1STZ A;  3PM1 A;  1ETQ A;  4BXF A;  1IRX A;  5K7F A;  1X2N A;  4HBL A;  2H27 A;  2COB A;  3TO6 A;  2FA5 A;  5M3F J;  3KEY A;  2OQG A;  1TW2 A;  2M3A A;  1E0E A;  3HIF A;  3CZ6 A;  4NHJ A;  4MO7 A;  2FX0 A;  2MA3 A;  1DGW Y;  5LHH A;  5CPR B;  4IL6 C;  4G6T B;  4LLL A;  5FKK A;  2HOA A;  3LFK A;  1OCP A;  3MVP A;  2FJ1 A;  4C3I J;  5EEG A;  5DUI A;  3EYI A;  1BM9 A;  1LKX A;  2FUG 2;  4HX8 A;  2WA0 A;  2EFP A;  4GDF A;  1UJ8 A;  5E1X A;  5H20 A;  2NOJ B;  2HVR A;  4LLG F;  4IRG A;  3BLY A;  3JRI A;  3OS1 A;  4O5V A;  4G12 A;  4EQQ A;  3C18 A;  1T56 A;  3LA3 A;  4HLY A;  1LVK A;  2FSW A;  5L3E A;  2M45 A;  3ZQL A;  1E3P A;  5DCF A;  4QLC U;  2P81 A;  3R0J A;  2FMY A;  2CFO A;  3HKZ N;  1Y1W J;  4HF1 A;  3GF2 A;  1UHS A;  1S7A A;  3HJE A;  4MGR A;  2XC7 A;  2DXI A;  3E97 A;  1YE9 A;  1AKH A;  2XPU A;  2G7U A;  3TQN A;  4AD9 A;  3L7W A;  2DW4 A;  1QRY A;  2IGO A;  2F4I A;  4Y17 A;  2STT A;  2KIU A;  2LTP A;  4FIS A;  3KZZ A;  3WE2 A;  4JX6 A;  3KLO A;  1ON1 A;  1D1A A;  2MFZ A;  4CCO A;  4CCM A;  3TP3 A;  3KIO A;  2ESH A;  2TRT A;  1ZAR A;  3I0T A;  1YW8 A;  4IRH A;  4FT8 A;  4IEJ A;  4I7H A;  4WWC A;  4UUV A;  2D1H A;  2GIV A;  3Q9S A;  3IV5 A;  2LBF B;  3G3Z A;  4BQA A;  1RKW A;  1U8R A;  2VKD A;  4XLA A;  4N4O B;  5GAD J;  3A0B C;  1HBX G;  5E3O A;  5JFR A;  4U0V A;  4PSW A;  1S8N A;  2HVS A;  3ONQ A;  3OYC A;  3BG9 A;  5GAE J;  3JAM K;  5FRN A;  3W6K B;  4UNO A;  2CH0 A;  3TBI A;  4BDY A;  3TED A;  4Y13 A;  1YJ9 I;  5FKM A;  3LOC A;  5F0F A;  2WAD A;  4IOC F;  3HRT A;  2JUG A;  3GTK J;  3S16 J;  1C0W A;  2G9W A;  1JT6 A;  3BR3 A;  2DA3 A;  3FBN B;  3TGN A;  1EH6 A;  5K5Q A;  4RB1 A;  2FD5 A;  2M30 A;  2HQ5 A;  1UCR A;  3QU3 A;  3ZGK A;  1YYV A;  1U0J A;  3WGI A;  1RKT A;  4A3F J;  2JA5 J;  3GTQ J;  3H3Z A;  2NS0 A;  1O7L A;  1MBK A;  1ZG1 A;  4BE0 A;  2K9M A;  2PLY A;  4UUS A;  4EV0 A;  4FTH A;  3FXL A;  2CV1 A;  3VYT B;  2EB7 A;  3UKG A;  2K9Q A;  1HQC A;  2VI6 A;  3NQO A;  1FMV A;  3MZY A;  3QU6 A;  4DBR A;  2W1O A;  4IHW A;  3QOP A;  2VOD A;  5IP6 A;  3OV8 A;  3TO7 A;  2CW7 A;  1QGP A;  5C3E J;  5DDG A;  4ZDO A;  3M7G A;  3N97 A;  1JUM A;  1UZC A;  2LVS A;  2FRH A;  1VQ5 I;  2F5D A;  5J4Y A;  1BBY A;  5EG0 B;  1G6N A;  4IPA A;  5LRS A;  3VDX A;  3J7Z I;  2JA2 A;  3CMY A;  4A3G J;  2UZK A;  2KIM A;  1IXS B;  1VQM I;  1XB4 A;  5D6E A;  4J00 A;  2AO9 A;  1SFE A;  3WTX C;  3M9A A;  2L54 A;  3HBL A;  2RVC A;  4K2E A;  3W6J B;  1YX3 A;  1YRN A;  2DOD A;  2F5V A;  3FM5 A;  3CDI A;  1VF9 A;  3PNY A;  4N9I A;  1R1T A;  2M0C A;  1N75 A;  2LF8 A;  4KIF A;  1YJW I;  1PVE A;  3GCM A;  4KJZ A;  2KDZ A;  5CVJ A;  1RIO H;  1JJ6 C;  2MLG A;  2X51 A;  1GLN A;  4BDZ A;  3DEW A;  4BQO A;  5KCM A;  3CJN A;  3BOQ A;  2DO7 A;  2E34 A;  4OMZ A;  2R5Y A;  1X3U A;  4O6J A;  4E7Z A;  4EJW A;  2O9L A;  1R5H A;  2EZK A;  4MNU A;  1KU9 A;  2FBH A;  4KT6 A;  3KPH A;  2RQQ A;  4FX0 A;  1P2F A;  3JRB A;  1N78 A;  1JHH A;  4UB6 C;  3HM5 A;  5EF6 A;  4M3F A;  4CCL A;  4ZH4 F;  5LEJ A;  3GTG J;  2E1M B;  1TP4 A;  3J7A O;  5LGT A;  1YW7 A;  3ZMT A;  3NWT A;  2R92 J;  5BOX A;  3RPQ A;  3AFH A;  2XSJ C;  3V7R A;  2MH2 A;  3CF5 F;  4EJV A;  4BNC A;  2QKM B;  2PMZ N;  4MTD A;  4RS8 A;  2BVM A;  2JZY A;  4JK1 X;  2M87 A;  5AON A;  3M1C A;  2QQ9 A;  3OYE A;  2JRT A;  2CG4 A;  2D5V A;  4BHP A;  2W85 A;  2R7T A;  2D1V A;  3J81 Z;  3RPU A;  1MNE A;  4R79 A;  5D4R A;  3LSI A;  1YW9 A;  2C6Y A;  5K1Y A;  2RNG A;  5H6Q A;  3SYT A;  2MAB A;  1WWX A;  2BY1 A;  1VQL I;  1Z3Y A;  3UR3 C;  4X1E A;  4DZJ A;  3H1C A;  2ZFU A;  3MN2 A;  3WTV C;  2FNA A;  1FOK A;  3KP4 A;  5DCM B;  2H1L A;  2F48 A;  3DPU A;  5E8G A;  4IJA A;  3U1D A;  1VQ9 I;  2VOP A;  3TDZ C;  2BW3 A;  3OYK A;  4B3A A;  4EVI A;  1OKR A;  3F3X A;  1YIT I;  1YO5 C;  2FQ4 A;  3BR6 A;  2NVT J;  2ID3 A;  4HZF A;  1AKH B;  3MD2 A;  4ZYE A;  1HST A;  4YRV A;  4G6D A;  1FMW A;  5A2Q Z;  1W0T A;  3SHF A;  5KNL A;  4BE1 A;  1T2K A;  3J7A Y;  2K02 A;  2EV5 A;  3CP2 A;  3EDP A;  3ZPL A;  4I01 A;  3CCU I;  5J40 A;  2BE5 F;  3VFZ A;  2F2E A;  4AYB N;  5IPA A;  4E7H A;  1PP7 U;  4P5O A;  1BI2 A;  1SVL A;  2GBY A;  3OY9 A;  4Q47 A;  1WJA A;  3K1M A;  1HSJ A;  3IH2 A;  2TCT A;  2ESN A;  1O3T A;  1AHD P;  2STW A;  4D5C A;  2F6C A;  3CCE I;  1OYY A;  4G7H F;  1ERD A;  3E1S A;  1VQP I;  1ZEL A;  2AXT C;  2K85 A;  2DFI A;  4B44 A;  2DA6 A;  3ZQC A;  5F0C A;  1AA7 A;  3LA7 A;  1J09 A;  3WHB A;  3MEX A;  5IP9 J;  4ENM A;  4O3M A;  1P4W A;  1RC9 A;  3HUG A;  1T98 A;  5FO5 A;  1WSU A;  3QP6 A;  4LG0 A;  3HC7 A;  3G1L A;  5FKN A;  3GTO J;  3OYI A;  9ANT A;  3BR1 A;  5AIP A;  2QA4 I;  4H4K C;  2OTL I;  3F8F A;  2UWM A;  1K79 A;  5F04 A;  2DCE A;  2K4B A;  2DTR A;  2L2O A;  4PJM A;  3CCL I;  1GHC A;  3E6C C;  2M7B A;  3V7S A;  4HDV A;  1LEB A;  4A3I J;  3BR0 A;  1FP2 A;  4RB3 C;  3C3W A;  2YS9 A;  1S9H A;  1JJ8 C;  1I6H J;  2CU7 A;  4XOT A;  3RDI A;  4L5J A;  4YIR X;  3L00 A;  1UG0 A;  2XKO A;  4UUS B;  1VI0 A;  1H9G A;  2K40 A;  2Y31 A;  3ISP A;  3N05 A;  3OIO A;  3FXJ A;  2LSO A;  1JE8 A;  3BY6 A;  1FSE A;  3QOE A;  2OUM A;  2Y0S N;  1Z05 A;  4IHX A;  2QYO A;  3GZ6 A;  2JVH A;  2VC0 A;  3VOE A;  1ZQ3 P;  3QAH A;  3DP7 A;  3D5R C;  3JRC A;  2OF7 A;  2EZI A;  1R1V A;  3GFI A;  3BG6 A;  2OD5 A;  2Y9Y A;  2IJL A;  1RI7 A;  2R7W A;  4A3E J;  2R5Z A;  3EYY A;  1LE8 A;  2M7A A;  3BZC A;  3GBG A;  3I4P A;  1SFK A;  3FXO A;  4I02 A;  1R9T J;  3DBH B;  1ZLK A;  2CW8 A;  1BOB A;  3FK6 A;  2JSP A;  3RQI A;  4AYB A;  5BMZ A;  3DLL F;  4DOZ A;  3ECH A;  3OYM A;  3JRA A;  1P9Q C;  3ASN H;  2O61 A;  4DW6 A;  2YX7 A;  5FLX K;  2Z5U A;  2M5W A;  1YRN B;  1LEA A;  4PJ0 C;  1FWZ A;  1U5T C;  3M4O J;  3EUK L;  1ZGJ A;  4L5I A;  2HTJ A;  3FMR A;  3HSR A;  2VBW A;  1DP7 P;  2ZJP F;  1P4A A;  2E1O A;  2ICW G;  3K4C A;  2IA2 A;  4E6K G;  1FTZ A;  3CCM I;  1RES A;  2FXA A;  2E5N A;  4QPQ A;  3L2Q A;  3BC8 A;  3IWF A;  1O7F A;  2R0Q C;  4NBQ A;  1MJB A;  1REP C;  4M3D A;  4F92 B;  2R5Y B;  3DTK A;  2PI0 A;  3KP5 A;  1K61 A;  2EIJ H;  1EF4 A;  1VQK I;  2CFX A;  2VKE A;  3GUD A;  4ENN A;  2O6G E;  2MYS A;  3DWL E;  4ZZL A;  2V1D A;  3DU6 A;  2KZV A;  5DTD A;  2IS1 A;  3DCF A;  4IF4 A;  1Z7L A;  2IGK A;  4HQM A;  1SC7 A;  1MGT A;  5DS9 A;  1NK2 P;  4XOR A;  4PCQ A;  3GTM J;  5FGM A;  1ETO A;  2NOG A;  4KA4 A;  2PQ8 A;  4ANJ A;  1K4T A;  3I64 A;  3D1N I;  4ON0 A;  2IPQ X;  2HQR A;  2KL4 A;  1IAW A;  2XPW A;  2X6X A;  1L0O C;  2IS4 A;  2QQB A;  2QSF X;  4MIM A;  5CLS A;  2HXI A;  3K10 A;  1XMK A;  4LK0 F;  5GAH J;  1A6Q A;  2X85 A;  3QRF F;  3HPG A;  2NYX A;  3HDD A;  5HLT A;  1ODD A;  3GWZ A;  4KFC A;  1OMI A;  2WAE A;  1FOY A;  1ZRD A;  1EH7 A;  2F4M B;  2YX4 A;  4RGU A;  1XSX A;  2HDW A;  3G6E I;  1Z21 A;  2WAQ N;  4UV9 A;  4HSR A;  2VLA A;  1WJE A;  1OFC X;  2LRD A;  1FPQ A;  1R23 A;  3K4M A;  5AIQ A;  5D8L B;  4KIB A;  4WXH A;  2BW3 B;  2ZJ2 A;  3QP5 A;  4QTR A;  2H8R A;  2UXN A;  3QOD A;  2JPB A;  3I59 A;  1JTX A;  3BTI A;  4YEJ A;  3BZ6 A;  4GXO A;  2F4O B;  3EET A;  1Z1D A;  1ZHF A;  4MHG A;  3A2K A;  1OR7 C;  3KEQ A;  1WZ2 A;  3F22 A;  1D5Y A;  1LJ9 A;  3JW4 A;  2R7O A;  4GCV A;  1J59 A;  5IYB J;  1G3W A;  1XGM A;  2XKP A;  4Q48 A;  4P96 A;  3U1K A;  3ZQH A;  2OCC H;  5M5W J;  3IUO A;  3CCV I;  2HPM A;  4YII A;  4I0B A;  4BHB A;  3H5A A;  1JUS A;  4N9H A;  1X58 A;  2XAU A;  1TT0 A;  1P7I A;  5D5U B;  3P9I A;  2YU3 A;  1PUE E;  4BQN A;  3BQZ A;  4KIT B;  4PGG A;  2O5R A;  4X0G A;  2JUC A;  2BXZ A;  1S3J A;  2A05 A;  4M6Y A;  1UAA A;  3O8H A;  1T95 A;  4WXD A;  3HUG B;  3AG1 H;  5EDN A;  3F8M A;  2RRE A;  2DK8 A;  1Z91 A;  1WI3 A;  4KT5 C;  3LQR A;  3ZQ7 A;  4R1H A;  3AG3 H;  4QPO A;  2CUJ A;  3CCS I;  3EUH C;  3BP8 A;  4LG0 B;  3V7C A;  5DYM A;  3C1D A;  3HTS B;  2KIS A;  3T8R A;  1YTY A;  2GA1 A;  2R7U A;  3TL4 X;  2VAS A;  4CSW A;  5CVR A;  3AL0 C;  1JHF A;  2L7M P;  5BS6 A;  1ONV A;  2X1E A;  2DTZ A;  3HOS A;  5CQE A;  3VB2 A;  3MKL A;  2IXS A;  2LNB A;  2VBY A;  3TW6 A;  3EPZ A;  2Q8K A;  1IW7 F;  2VT2 A;  5J4V A;  2O3F A;  1EV7 A;  4V2G A;  1GUU A;  2ID6 A;  1T08 B;  5FFX A;  2MLK A;  2NVY J;  1ZTR A;  2DAO A;  3RYR A;  4YG2 F;  2MD5 A;  2O03 A;  3GEZ A;  4HF2 A;  1ZG5 A;  5E3M A;  1A04 A;  2XB0 X;  3U2R A;  1MH3 A;  5KVR A;  3JAM Z;  5LGN A;  1LQ1 A;  1BC7 C;  2QKL B;  4J01 A;  4A69 C;  3BCB A;  3IAM 2;  4EM2 A;  4ETS A;  2DT7 B;  2A61 A;  1B72 A;  1A31 A;  4JYK A;  3ZOB A;  5FB2 A;  5DD8 A;  2R5Z B;  4MTE A;  3G2B A;  1SAU A;  2ZXJ A;  3IP4 B;  1BR4 A;  4C2U A;  1LE8 B;  1F36 A;  4OIP F;  1SFU A;  3I58 A;  3AKZ A;  4NC7 A;  2WTE A;  4CCJ A;  3SJM A;  4NUB A;  3VYS B;  4BH9 A;  3U9G A;  1H0M A;  2JA8 J;  4Y7N J;  3G71 I;  5F27 A;  2EIN H;  5CKT A;  4EEF G;  2XRN A;  1X1P A;  1FJL A;  2PG4 A;  3W6V A;  2HR3 A;  4L18 B;  2L7Z A;  2DJN A;  1LDD A;  3PSF A;  1GT0 C;  3RQ4 A;  3WHC A;  2XGE A;  1HC8 A;  1R36 A;  2P7V B;  3FXQ A;  1HOM A;  2KLO A;  2P5L C;  2BEO A;  1PUF A;  3PO3 J;  4C2T A;  2QEX I;  4ZDP A;  3PFI A;  3RZO J;  3OYB A;  2L9V A;  3RIR A;  4A0Z A;  4HYE A;  2Q2E A;  3DKY A;  3FX3 A;  1FBU A;  4AUX A;  2OZ6 A;  4B4C A;  5DM6 F;  3IRQ A;  2KRF A;  3M8J A;  2PN6 A;  3L2R A;  3RYP A;  4LLN A;  4LIT A;  1DPU A;  4PDK A;  2WV1 A;  1TL8 A;  1NK3 P;  2B7E A;  3BJA A;  1JKO C;  2ZBK A;  1BW6 A;  2JK3 A;  3CJQ B;  3CP8 A;  4C3J J;  5E3N A;  3G73 A;  3LSH A;  3GTP J;  1BR2 A;  2GZW A;  4HST A;  4EM1 A;  5EEA A;  2ME6 A;  4V2F A;  1MMD A;  1QPM A;  1Y8R B;  3F0C A;  4AWX B;  4BJT A;  2Z33 A;  1NTC A;  4A3L J;  4IHT A;  1JGG A;  3OL4 A;  4W97 A;  3ZN1 A;  3S3O A;  5FRM A;  4PJJ A;  2OCE A;  5C4J J;  2ZCW A;  2BY0 A;  3I71 A;  5F08 A;  4IQ4 A;  2DJI A;  1AOY A;  1YQA A;  2EPF A;  2IGM A;  5DUK A;  1KA8 A;  2GXG A;  2YR2 A;  3TW7 A;  1MMG A;  2ZKZ A;  3QYB A;  4BE2 A;  3WG9 A;  3IKV A;  3DPL C;  2WY7 Q;  2W84 A;  4KDP A;  3DF8 A;  3OIP A;  4FQG A;  3WTT C;  4XLE A;  2WBM A;  1B9N A;  4BYY A;  2KHM A;  5LHG A;  2KP6 A;  4PFO A;  2CUZ A;  2LOO A;  5HDK A;  2EA2 A;  3ABK H;  1U9O A;  3CC7 I;  3H35 A;  4ESF A;  3T0Y A;  2ZXI A;  5DCM A;  1RR7 A;  3R4K A;  1XCB A;  3HOX J;  2V1N A;  4RB0 A;  2M1B A;  1IO2 A;  3OIQ A;  3S1M J;  1LNW A;  2L7F P;  1OCR H;  5HS9 A;  4OU0 A;  2DQL A;  2BHY A;  4XN3 A;  3CCR I;  2L4A A;  1T39 A;  4KYW A;  2E5Z A;  5E18 F;  3I59 B;  1A6I A;  3P7N A;  2LK2 A;  4FE4 A;  3M8E A;  1SAN A;  2CQQ A;  2ECB A;  1IDZ A;  2R7F A;  4N4N B;  2BOL A;  1FT9 A;  5BPI A;  2A6H F;  5TRD A;  3IH4 A;  5KAF C;  2HI3 A;  2D2W A;  1JUP A;  1UG2 A;  4HV6 A;  3WG7 H;  5L3F A;  4MEX F;  1V4R A;  1FZP B;  1V54 H;  2VE8 A;  4D7N A;  2DOF A;  1IF1 A;  3E6M A;  3OYA A;  5IOZ A;  2O7O A;  3DKW A;  1G8X A;  1Z77 A;  1D3Y A;  2K9N A;  2IRF G;  1S7E A;  1U3E M;  3WGG A;  4UXN A;  2XV4 S;  1YS7 A;  3J80 K;  1R4M B;  1W5T A;  2PMH A;  1E3O C;  2ZFW A;  3P9C A;  3BG5 A;  2HYJ A;  4HX4 A;  3HEF A;  4UB8 C;  3BTL A;  2BBY A;  4UVC A;  2DA4 A;  5HLG A;  2R7S A;  2L9N A;  1QZY A;  5TJJ A;  2HYF A;  5M3M J;  2P0W A;  2EV0 A;  2FQ3 A;  2QCO A;  1BC8 C;  1WQ2 A;  1LPQ A;  3M8F A;  2RKH A;  2KIF A;  4LIV A;  3BT9 A;  4MFE A;  5C44 J;  4PZJ A;  1RET A;  4HNU A;  1QBJ A;  3ZMU A;  5K7Z A;  4XMY A;  1LUJ B;  4ITV A;  1RUN A;  1JKR C;  1CGP A;  1MBF A;  3I5U A;  5C4X J;  3KYD B;  3PNV A;  3W2A A;  6PAX A;  2DQR A;  3HOY J;  2DA5 A;  2GXA A;  4AVP A;  2IEK A;  1ZKG A;  2DDB A;  1ZN2 A;  4CGZ A;  3E7L A;  2JSC A;  3HKZ A;  4XBF A;  3ML6 A;  3ZMZ A;  4YEL A;  3EQL F;  4U87 A;  1YI2 I;  3WGH A;  4L9N A;  2X1D A;  4IHV A;  2DBB A;  3HL2 A;  3A1Y A;  5B1A H;  4G8X A;  5FKO A;  3CO6 C;  4W1U A;  1QQI A;  2AS5 F;  2VN2 A;  1B72 B;  2L9S A;  1ZYR F;  3MFK A;  1XPX A;  1TQM A;  4BBR J;  4OWR B;  1MNM C;  4DBQ A;  1YIJ I;  2ZSH B;  2AQE A;  2VJ5 A;  2WB1 N;  3JSP A;  3WU1 B;  3CQZ J;  3H3V K;  2QWW A;  1OJL A;  2H1K A;  4MQV A;  1I1S A;  2LY9 A;  4HNV A;  4E7L A;  5GP9 A;  2QGU A;  4CA0 A;  5J1Y A;  3KP7 A;  1VQ8 I;  1QZZ A;  3ZRG A;  3FK7 A;  4G7Z F;  4HEA 2;  2ELK A;  4IHS A;  3KYC B;  2O8X A;  3Q5F A;  3HHG A;  2PX9 A;  3ASO H;  2JT1 A;  3HRM A;  5D5W B;  5JVT A;  4KIS A;  1PUF B;  3S93 A;  3GXO A;  2HEO A;  2H09 A;  4A0X A;  1VZ0 A;  3LL7 A;  1TQI A;  1FBS A;  2Q2E B;  1J9I A;  2FE3 A;  3RSN A;  3CCY A;  1MIJ A;  2CJJ A;  3CMM A;  1A5J A;  1IV8 A;  4ZYH A;  2NVQ J;  1BI0 A;  3FWE A;  2K7L A;  3LAP A;  3CDL A;  3S32 A;  5GPC A;  2ISZ A;  2XGX A;  4S0H B;  5FRO A;  4FX4 A;  2VOO A;  1S6L A;  4LJZ F;  5ICG A;  2YUS A;  3HYI A;  3RKW A;  4FE7 A;  2UV1 A;  3F72 A;  3E3V A;  5HDG A;  3W3C A;  1R71 A;  4CZC A;  5FLX Z;  1MMS A;  3GME A;  1IRZ A;  2KRC A;  1S5L C;  3OYG A;  2HFH A;  4ZDL A;  4XSX F;  5HVQ C;  2XIG A;  2VUM J;  3OYJ A;  4JP0 A;  2EIK H;  3VPR A;  4HOB A;  2HDD A;  3E5X A;  1R22 A;  2X48 A;  2BY3 A;  2Z16 A;  3LSM A;  4II3 A;  1T0F C;  2DFH A;  3CC4 I;  3ZR8 X;  2PFB A;  4U0Y A;  2LG4 A;  4Y33 A;  4IO9 F;  1VQ4 I;  3V8K A;  1L3L A;  3CC2 I;  2IBD A;  1PP8 F;  5FFZ A;  4RBO A;  1QZE A;  2W24 A;  2DMN A;  3V4G A;  1FC3 A;  5IP7 J;  4UHT A;  2WB1 A;  4CIC A;  1Z9C A;  3RI4 A;  1R1U A;  5K7H A;  2EZL A;  2PEX A;  1YLF A;  3S3N A;  5FLM J;  3WTS C;  4QIW N;  2ETH A;  2I5U A;  2P5V A;  2R7Q A;  1ACI A;  2Y30 A;  1MZB A;  3MAJ A;  1ON2 A;  4GYG A;  2KDO A;  3T1B A;  1MSF C;  1BIA A;  1OCC H;  4BBS J;  3GFJ A;  4XKC A;  3SFI A;  1FYK A;  3OMY A;  2IP2 A;  2YU9 J;  4IZZ A;  1T38 A;  2ADU A;  4M6V A;  2A07 F;  2EV6 A;  4LFU A;  4Y4R A;  4E7K A;  2M0M A;  2NVU B;  1FNN A;  2COM A;  1UB9 A;  2FEZ A;  4KNY A;  3DFG A;  3HRS A;  1DP3 A;  2OZU A;  2LD5 A;  1BI1 A;  2HPI A;  1Y56 A;  2ELJ A;  3SFZ A;  2OC6 A;  4RAY A;  2XGD A;  1A36 A;  1G3S A;  2EFQ A;  4DGW B;  1ITY A;  2ZO4 A;  4BL0 B;  1EH8 A;  1SAX A;  2BYV E;  3QPT A;  4OAY A;  2XAH A;  2E2I J;  1MJ9 A;  3H9G A;  4JX4 A;  2CQ7 A;  4L9V A;  3I3L A;  5ICF A;  2DMP A;  3E5Q A;  2BGC A;  1IUF A;  2Z3Y A;  3KET A;  3M3Y J;  4B3X A;  3ZMD A;  1TZL A;  4PSX A;  5EZG A;  5HNF A;  4MFD A;  2G7H A;  3T8T A;  2HWV A;  4GFB A;  1QU3 A;  2OAZ A;  2FNP A;  4XSZ F;  3K7A J;  1R5I D;  3K0L A;  2PMZ A;  4AVZ A;  2QQA A;  4B43 A;  1M1E B;  2EA4 A;  1T6S A;  1U6G A;  3RCO A;  5CJ9 A;  1O3R A;  3F6V A;  3LFU A;  4Q4Z F;  4BY1 J;  1R7J A;  3ZXS A;  3RPU D;  5J47 A;  1N77 A;  2CV2 A;  1R00 A;  3MCZ A;  4LMY A;  2DPU A;  1V3F A;  1E17 A;  2FML A;  3KEO A;  4CYC A;  3CMA I;  1BOA A;  4JQF A;  1TBX A;  3QPL A;  4RM3 A;  3F21 A;  4L9J A;  1OIS A;  4F93 B;  4IVN A;  4XM3 A;  4A3M J;  2KFD A;  2FU4 A;  4XNF A;  5JI6 A;  2RQP A;  1I50 J;  1W7P A;  2KQR A;  4L5E A;  1X19 A;  3PO2 J;  2P7C B;  1H88 C;  1ETV A;  5GAG J;  2K3F A;  5ILU A;  4A3J J;  2NAZ A;  2R7V A;  2CWE A;  3A02 A;  4CXF A;  3FXM A;  4HPQ A;  3KYL A;  3LMM A;  4XRS A;  1Z7U A;  3C2B A;  3HPH A;  1Y39 A;  1MMA A;  4BEH A;  3FXR A;  1T0F A;  4F55 A;  3F9K A;  2XB5 A;  1AU7 A;  4IOA F;  3WTZ A;  4MLO A;  1HKS A;  1WHU A;  2VKH A;  3K4N A;  5M5Y J;  1TWC J;  3HOU J;  2KMU A;  5E8I A;  5DM7 F;  4EGZ A;  3W2V A;  4E7I A;  1BR1 A;  3F8C A;  4BHC A;  3ZMV A;  4ABZ A;  2ZJR F;  4RMN A;  3SXY A;  1FYM A;  1K6Y A;  3BTC A;  4RAF A;  3WTY C;  2HGC A;  3I4N J;  3NEU A;  3FXK A;  3BCA A;  4L9T A;  1IJW C;  4MQ9 F;  2VJJ A;  4M6X A;  4M71 A;  1POG A;  3FHN A;  2MG4 A;  3ZQI A;  5B5E C;  3K2Z A;  3PIP F;  1MD0 A;  3KLN A;  3JSO A;  1OPC A;  1JGS A;  2LP0 A;  4I98 B;  2MSY A;  4ENJ A;  1U8B A;  1XG1 A;  1BJZ A;  3DTE A;  3LST A;  4E4H A;  5JVG F;  3BPV A;  4LG3 A;  5KHD A;  3PQK A;  2X1C A;  3FF5 A;  2VXD A;  3K2A A;  2XRO A;  3QQA A;  3KE2 A;  4NNJ A;  1TNS A;  2NNN A;  3TOA A;  4WXC A;  5GPA A;  3HXL A;  3TMO A;  2Y0M A;  2DFE A;  2LMD A;  2X9D A;  2HVQ A;  4XRS G;  1DUX C;  4OIO F;  4OOI A;  1VQO I;  1F5T A;  2BY2 A;  3PQJ A;  3M07 A;  2UUZ A;  2L7K A;  5J8F A;  4E7J A;  1XSD A;  1HDD C;  4ZC3 A;  4MEY F;  3GX4 X;  1RR8 C;  1LDJ A;  1VTN C;  1RNL A;  1WJC A;  2Q1Z B;  4M9S A;  2Y0S A;  2P6S A;  4XRF A;  3E0J B;  2GIZ A;  1O3S A;  1IDY A;  4C30 A;  1W1W E;  4KIG A;  2GOM A;  3GW2 A;  3R0A A;  2V6E A;  2JQ7 A;  3H5N A;  4NC6 A;  3CTA A;  2ZME C;  2XAF A;  2LRE A;  5LHI A;  3WTU C;  2NNY A;  3FMQ A;  4HW0 A;  2CV0 A;  4E7S A;  1G4D A;  2TDX A;  1BIB A;  1ZR2 A;  3P9K A;  1SMT A;  1YS6 A;  3SDG A;  1EKE A;  2CW0 F;  1AWC A;  3ZMS A;  1HKT A;  5FD5 A;  2DT6 A;  4XKV A;  2E1C A;  1H9T A;  2R3S A;  3LSP A;  1ZR4 A;  1WCM J;  2LR8 A;  3IAS 2;  3F23 A;  1TQP A;  1TLH B;  1U2W A;  2M34 A;  2RC4 A;  3EUA A;  4DNC A;  3LSR A;  3FHZ A;  1W0U A;  2IS6 A;  2E7X A;  1J2X A;  2IT0 A;  2XGC A;  4TV7 A;  2Y48 A;  1GDT A;  3K70 D;  3Q3S A;  3F8B A;  2K5C A;  5LD2 C;  2KZG A;  4RDU A;  1MH4 A;  1E2X A;  1YG2 A;  1WJ5 A;  2DYS H;  2GAU A;  2R7D A;  3B6C A;  1JKP C;  1F1Z A;  1QPI A;  3BZK A;  2GOX B;  2Y2Z A;  5ERI A;  4I09 A;  4M9X A;  4WK8 F;  3V8J A;  2DMQ A;  4XKB A;  2CO5 A;  2IW5 A;  2CYY A;  2DMT A;  3T5X A;  3I53 A;  3OOP A;  2QBY A;  3PL8 A;  2LFB A;  3IHU A;  3ZCO A;  3S3M A;  1TWG J;  1FYL A;  1LVA A;  2CQN A;  5K5R A;  3MKW B;  1YHQ I;  4KMU X;  1U5T A;  3CME I;  1IN8 A;  2E1M C;  3FKI J;  3S2W A;  2R93 J;  3FMS A;  1HF0 A;  4OMY A;  2L9R A;  1B1B A;  1IC8 A;  5LEK A;  3TOB A;  2X4H A;  3M1E A;  2MD0 A;  3I4M J;  2HTS A;  2JTV A;  2GXB A;  5IT9 K;  1P92 A;  3FXU A;  1HXD A;  2FBI A;  1ZAO A;  3A03 A;  5H2F C;  1NH3 A;  1P7J A;  2LYC A;  5F0H A;  1SFX A;  2ZNY A;  2KIQ A;  4M74 A;  1Z3X A;  3LNQ A;  5LBQ A;  3MKY B;  4CYC B;  4BY7 J;  4Y15 A;  1JI8 A;  1MMN A;  3FKJ A;  3H92 A;  4B47 A;  3PFY A;  4JBA A;  2K3P A;  3NAR A;  4GO1 A;  1OQY A;  3V42 A;  1KYW A;  2K9L A;  4LD5 A;  2WAQ A;  1K78 A;  4P9F A;  4XOP A;  4BKX A;  4BQQ A;  1W7P B;  1OYI A;  1XGN A;  2Z1D A;  3RJP A;  2DDA A;  4XQF A;  2KPM A;  1T8I A;  1WJF A;  4HAM A;  1IN4 A;  3J80 Z;  5IYC J;  3OYL A;  2ME0 A;  1HDP A;  4XKW A;  4RGS A;  3LAJ A;  2E7W A;  1OYW A;  1X3Z B;  3ECO A;  3SZP A;  2J5O A;  1N25 A;  2Y69 H;  3ZQG A;  2H6C A;  3LA2 A;  1UHW A;  4BEH B;  4E70 A;  5H6R A;  2OPT A;  3OS2 A;  2JMW A;  2MC4 A;  4P55 A;  4ZYA A;  4ASN A;  2HOS A;  3OSF A;  2M4G A;  2GA2 A;  2JN6 A;  4RGR A;  2LKP A;  3K1P A;  4WF2 A;  2XUB A;  5J1R A;  4EMS A;  5J6X A;  1K4S A;  3GO5 A;  3PUF A;  1CF7 A;  1ZLJ A;  4LB6 B;  2ZME A;  1G59 A;  3CDH A;  3N4M A;  4DYR A;  1U78 A;  1X1C A;  2HKX A;  2WY8 Q;  1LB2 A;  2M8G X;  1TWA J;  2VB6 A;  5HNH A;  2VXZ A;  4BJ6 C;  1W36 D;  4U0W A;  2BXY A;  4U88 A;  4EJO A;  4U7D A;  1XMA A;  4GRI A;  4ENK A;  5HLI A;  3ZQF A;  1UEL B;  1HA8 A;  4XK4 A;  5EYR A;  2ACJ A;  3E6D A;  4DIQ A;  4ZYG A;  4DQ2 A;  1X2M A;  5JHF A;  1FP1 D;  4RAG A;  1SD4 A;  1KZH A;  1OR7 A;  3F6O A;  2A5W A;  1EJ9 A;  4XLF A;  1WFX A;  5JHU A;  2OTJ I;  1JTY A;  4EJU A;  1Y8Q B;  1WVR A;  2F5C A;  2H6B A;  5EEH A;  5K5O A;  4I6Z A;  4ESJ A;  2VE9 A;  4AIH A;  3O6B B;  5HOO A;  4L0Z B;  5ICE A;  3QWL A;  2L02 A;  2B63 J;  4G7O F;  3JRD A;  1ETK A;  2CSO A;  4M9Z A;  3RTR A;  1SD7 A;  1UHM A;  2P4W A;  1QO0 D;  4NDL A;  2V79 A;  4CCN A;  3OWT A;  1IN6 A;  4N0B A;  4PJN A;  1QVT A;  1Y0N A;  3CJT B;  3Q9V A;  5E1W A;  5D8K B;  3SDB A;  2ZC2 A;  2PJR A;  1IXC A;  3JRE A;  3DEE A;  3COA C;  1LDK B;  5GTH C;  4BXX J;  4RAZ A;  2O8K A;  3WOD F;  4CO8 A;  1FEX A;  5ILS A;  2EJR A;  4WCG A;  3EUH A;  2NS8 A;  5L3B A;  2MBF A;  1ZG3 A;  2ZXW H;  3GTL J;  5DEQ A;  3OSG A;  1RZ4 A;  3HGG A;  2XDV A;  3K6G A;  4BGD A;  4OIQ F;  2I10 A;  2VBZ A;  5E1Z B;  3IWZ A;  1PDN C;  1RPW A;  5E20 A;  5TIS C;  1KON A;  4M3B A;  2HZD A;  3E6B A;  3R60 A;  1ETW A;  3GFL A;  3KZY A;  2WAF A;  2DK5 A;  3ABU A;  1WJB A;  3DLA A;  5J8C A;  4I99 C;  1WI9 A;  2EFO A;  3B6A A;  5ICC A;  1JXS A;  2JJ7 A;  4PFP A;  1ETX A;  2LY2 A;  3C7J A;  1SD5 A;  3GVA A;  2EBI A;  5JLW A;  2UXX A;  3ZQQ A;  4EAT A;  5KK1 A;  2K9S A;  1B59 A;  2QF7 A;  4NQW A;  5F64 A;  2LKX A;  1TTY A;  3IRR A;  3SQN A;  3VOD A;  2W57 A;  2FBK A;  2R7X A;  4RGX A;  3JCU C;  5B66 C;  1I6X A;  1G2H A;  2NVX J;  2EQR A;  2CMP A;  1WKM A;  3W2W A;  2F5E A;  1J7K A;  3BDD A;  2VJI A;  1T33 A;  5D5X B;  3O2P E;  4P9U A;  2HXO A;  2QBY B;  3DKX A;  4FET A;  2HOE A;  3QPS A;  4C2M J;  3S8P A;  1U5T B;  4A2U A;  3JR9 A;  4DZP A;  1GVD A;  2MGQ A;  4A3B J;  1KGS A;  1DU6 A;  3E5U A;  2XVC A;  5CVI A;  2P5K A;  3L9F A;  1ZRF A;  4F52 A;  1SEU A;  4YFN F;  3ABT A;  2XRL A;  1VQ6 I;  3Q0V A;  2E2H J;  3L1P A;  2X6W A;  4OAZ A;  1W5C C;  1MBJ A;  1YOV B;  3L2V A;  2G0E A;  5CYV A;  2XF5 A;  2DOA A;  2RV8 A;  5HLH A;  1A35 A;  5BPD A;  3D5S C;  1IN5 A;  2LH9 A;  3I55 I;  3H0D A;  1TWH J;  1R49 A;  3BWG A;  4A0Y A;  1NG6 A;  1KU2 A;  4HF0 A;  3K69 A;  1OCO H;  1XGS A;  2OJE D;  5HDN A;  2EIL H;  2X6O A;  1FY7 A;  1PYV A;  4BU2 A;  2P6T A;  3HTU A;  1HCR A;  1EA3 A;  1YIO A;  4QSH A;  2A6T A;  2VPR A;  1V5F A;  3RKX A;  1KQ8 A;  1I5Z A;  2WWY A;  5J1U A;  2XHK A;  3H9J A;  3MQ0 A;  3TP0 A;  3NWS A;  3TKY A;  2LDU A;  1K78 B;  3WE3 A;  1YFH A;  2EZH A;  4U7B A;  4CCK A;  2HZT A;  1X1D A;  2CGP A;  1F4K A;  5CVU A;  1X4O A;  4J19 A;  1X1A A;  2R7Z J;  1BJA A;  2PJP A;  4G94 A;  5IY5 H;  5EGO A;  3A01 B;  4Z2Y A;  2VT3 A;  4A3C J;  4XIC A;  4CYD A;  3AAF A;  1JT0 A;  2EIM H;  2AHQ A;  3UNG C;  2JA7 J;  2IA0 A;  3JTH A;  3LSK A;  5FKL A;  3H0G J;  1CF7 B;  3HSE A;  4FHT A;  1XMX A;  1HW1 A;  2ZME B;  1LFU P;  4G9Y A;  4GYI A;  2B0L A;  2DT5 A;  4Y3O A;  3REO A;  3V8L A;  3MWM A;  4XN0 A;  1KU3 A;  2VON A;  3SEZ A;  2CQX A;  4AC0 A;  2QSH X;  3WU0 A;  2W4S A;  4M72 A;  1UST A;  4AU7 A;  3A0H C;  4AIK A;  2E2J J;  1ORK A;  1UFM A;  3DBR B;  5F1R A;  1HLV A;  4YFX F;  3VYU B;  1HW5 A;  3VSK A;  4B09 A;  4XRM A;  1Q1V A;  1ZRE A;  1YJN I;  2V1X A;  4FCY A;  5DD4 A;  3KP6 A;  2DU9 A;  2VIX A;  1V5E A;  2K4J A;  1GVJ A;  1RUO A;  3S1Q J;  2BHZ A;  2V4J C;  3S2D J;  5BNG A;  1FSH A;  1GXP A;  1IRF A;  4HNT A;  1Z6R A;  2L4M A;  3OOU A;  2CUE A;  2DN0 A;  3PSI A;  2NXN B;  3VSL A;  2Z9O A;  1BN5 A;  2XAJ A;  1Y6I A;  2PBI A;  1S29 A;  4HX7 A;  2HKO A;  5HOD A;  1VQN I;  4RA2 A;  1V5G A;  4GGG A;  2BV6 A;  1TW3 A;  2R4G A;  2DLL A;  2VQC A;  2FOW A;  2FF4 A;  1X3W B;  4XLP F;  3GZ5 A;  3QPH A;  5LGU A;  3DEU A;  1MBE A;  3D0S A;  2L0K A;  1FOX A;  4EM0 B;  1O4X A;  4BUP A;  2I8D A;  1ENH A;  2ECC A;  2IAI A;  4UVA A;  2PJR B;  1I3A A;  1TC3 C;  3G1O A;  5F1J A;  2HQN A;  2N8G A;  3GFM A;  4D5F A;  2LY1 A;  1O57 A;  2GWR A;  3FDY A;  1KQ9 A;  1KQ0 A;  4C3H J;  1WJD A;  5IT3 A;  2LC2 A;  2QZ8 A;  3H36 A;  5E79 C;  2MH9 A;  4A3K J;  2ZSI B;  1DDN A;  3HOW J;  1DU0 A;  3CF2 A;  1XC5 A;  3AL0 B;  3OYN A;  4D7M A;  5FD6 A;  4F3Q A;  2R7R A;  3C2G A;  2Y9Z A;  1LFB A;  3FZV A;  1K83 J;  1XSV A;  3LSG A;  4PK4 A;  4II2 A;  4D9J A;  3J7Y J;  1BL0 A;  1B8I A;  1WH7 A;  4D1Q A;  4IX7 A;  3DTI A;  1D0X A;  1ZGA A;  1PJR A;  1VND A;  3CCJ I;  1S7O A;  2CRG A;  3OYH A;  1TT5 B;  3QYE A;  1IN7 A;  3JRG A;  1QHH D;  1Z67 A;  4BS9 A;  4HA8 A;  1FIA A;  1R6R A;  3K4L A;  1FIP A;  2A3S A;  2DYR H;  1XGO A;  4NQW B;  3CUQ C;  3K70 C;  3HOT A;  3SZG A;  1LFP A;  4ZTJ A;  1MDM A;  3O3K A;  4HG2 A;  1ZK8 A;  5JLX A;  1U9N A;  2OU2 A;  2JVG A;  1TNT A;  2VQH A;  3GLL A;  2XAQ A;  2ZXH A;  2DA7 A;  1F9N A;  2WV0 A;  1D5V A;  2CUF A;  1H89 C;  3IKT A;  4A93 J;  4AIJ A;  2X0L A;  2BZT A;  1FOW A;  3ERM A;  2LF7 A;  2Z99 A;  4XL9 A;  5EZH A;  3K9T A;  1F43 A;  1ETY A;  2O0Y A;  2F5F A;  3PNT A;  3GTJ J;  1D0Y A;  3K4J A;  1BI3 A;  2PMU A;  3HZJ A;  4DJA A;  2LLK A;  2RAE A;  2DMU A;  3TDU C;  3I9V 2;  4CHU A;  3KZI C;  1Y0U A;  3HOV J;  4ESB A;  1ULY A;  2KKO A;  2DA2 A;  4JOM A;  1QA6 A;  4BJ5 C;  3BG7 A;  4BAC A;  4XON A;  3GYH X;  2KJC A;  4AM3 A;  1OLT A;  3S1N J;  4RLF A;  4UV8 A;  3C2H A;  3BR2 A;  3R6S A;  1V55 H;  3H9Q A;  4EJT A;  2A69 F;  5FJ8 J;  2HDC A;  3BR5 A;  3CCQ I;  3OL3 A;  2ISY A;  3RKY A;  1YX5 A;  1Z0X A;  3BG3 A;  3BTJ A;  4AID A;  3K4B A;  2IGN A;  4HDU A;  3MZ8 A;  4OIR F;  4RB2 C;  5L3G A;  4Q5S F;  1ZRC A;  1B9M A;  2V7F A;  4LK1 F;  3CUO A;  1W4M A;  4A5N A;  2DOE A;  2VQG A;  2CQK A;  2GLO A;  5FLV A;  4G6Q A;  3KP2 A;  4HV5 A;  1NG7 A;  4KMF A;  3ROU A;  4UY8 I;  2VQL A;  5EGO B;  1KYZ A;  5LRR A;  1X1B A;  4M3E A;  1D1C A;  5IT9 Z;  2V6C A;  2QM3 A;  4BAY A;  5L3D A;  4IKF A;  1XDS A;  5D5V B;  1DQU A;  3KP3 A;  2QEN A;  2J5P A;  3L2W A;  2X6Y A;  3GZN B;  4M73 A;  2V9P A;  1K6O A;  3S1R J;  2K86 A;  5HS8 A;  2HOT A;  1W36 C;  3BJ6 A;  3F8N A;  3L09 A;  3D5L A;  3ABL H;  3MZH A;  4LIU A;  2E19 A;  1IZ1 A;  2VPL A;  1R58 A;  2HQA A;  3K1N A;  1X4P A;  2RNJ A;  2OV7 A;  3Q0U A;  4DYQ A;  2IA1 A;  3ESW B;  2Q0O A;  1MND A;  5E3L A;  1MKM A;  2XAG A;  3H5R A;  3OR1 C;  3WU2 C;  4M3G A;  4RLQ A;  5ED4 A;  1S72 I;  4ZJZ A;  3CUQ A;  2QSG X;  1WH5 A;  1SD6 A;  3J81 K;  2AXL A;  2RN7 A;  3TO9 A;  1D0Z A;  3HHH A;  4HRI A;  1GV5 A;  1E3H A;  3B73 A;  1I1G A;  5L3C A;  3Q0W A;  4IXA A;  1UMQ A;  4S04 A;  2K27 A;  3GLX A;  3NAU A;  2V26 A;  2A6E F;  4Y52 J;  2OA4 A;  2D45 A;  1IXR C;  1W5S A;  2JRM A;  4I76 A;  2H94 A;  4CUG A;  1W7P D;  2M2E A;  3BPX A;  1CQT A;  5LLQ A;  2XF7 A;  2A5Y B;  4PGH A;  3S15 J;  5ILV A;  1MJA A;  5IOY A;  2W82 A;  1XCV A;  2IS2 A;  4LB5 A;  4XLN F;  2HU9 A;  3PJR A;  1SMY F;  3CO7 C;  1O3Q A;  4I0A A;  2M9H A;  4JX5 A;  3ZN0 A;  5BQT A;  5A2Q K;  4F91 B;  4I2O A;  1B6A A;  2V1U A;  5DV5 A;  1MBG A;  3ULQ B;  3G1M A;  1P4X A;  1SVM A;  1OCT C;  3JRH A;  1FLI A;  4A6E A;  3G4S I;  3BRO A;  1MW7 A;  1APL C;  2W25 A;  1J0R A;  2RDP A;  4B1R A;  1GV2 A;  3IL2 A;  2ZJQ F;  2P8T A;  4ZTF A;  3DQV C;  4HQE A;  2JA6 J;  3RZD J;  2YPR A;  4CZZ A;  1B8I B;  2HYG D;  3FIW A;  5D4S A;  1I39 A;  3S2H J;  4YIF A;  3OYF A;  5LFA A;  1Y1V J;  4HLX A;  3FM3 A;  3PIO F;  1H8A C;  3R61 A;  3KCC A;  1GXQ A;  4H0E A;  2H8W A;  5B3S H;  2GQQ A;  2Z2S B;  2OBP A;  2VJ4 A;  2CS3 A;  1R5G A;  2E1N A;  2KT0 A;  5CVV A;  1WPK A;  3U21 A;  4PUS A;  4CDG A;  4WX9 A;  2EWN A;  5HS7 A;  2GM4 A;  1J5Y A;  4ZZD A;  4IRI A;  3S17 J;  3CLQ A;  1JKQ C;  1R4N B;  4QWQ A;  2V9K A;  3HOZ J;  4KUM A;  5CQG A;  2EFN A;  1MDM B;  2MC3 A;  4CH7 A;  2XSD C;  3IH3 A;  2MW8 A;  1Q1H A;  1TWF J;  4LGW A;  4A3D J;  1XX5 A;  4X6A J;  2LBF A;  4FAS D;  2E36 A;  3SEQ A;  1VFC A;  2NRA C;  3HG9 A;  3HRU A;  1WRJ A;  3L2U A;  1QNT A;  4PJL A;  1K7A A;  2XAS A;  2EFW A;  3DBL B;  1USS A;  2A68 F;  2WC2 A;  4EGY A; 
#chains in the Genus database with same CATH homology
 5GPC A;  1ZGW A;  4S0H B;  4M3B A;  5M5X J;  1ZQ3 P;  2NS7 A;  3JRC A;  1ETW A;  2OF7 A;  2EZI A;  1SFO J;  2XPV A;  2YUS A;  2Y9Y A;  4FE7 A;  2R5Z A;  4A3E J;  2JWT A;  3B6A A;  1LE8 A;  4XID A;  3GBG A;  2JJ7 A;  1ETX A;  5IYD J;  1R9T J;  1I3Q J;  1QVU A;  2EBI A;  5J3L A;  5JLW A;  3FK6 A;  3RQI A;  1IRZ A;  3JRA A;  2K9S A;  2LKX A;  2QF7 A;  4DW6 A;  2VUM J;  4DYC A;  4JP0 A;  3VPR A;  1YRN B;  2HDD A;  4IHY A;  2X48 A;  3M4O J;  1G2H A;  2NVX J;  2EQR A;  2EH3 A;  3HGY A;  1T33 A;  2E1O A;  2HXO A;  1FTZ A;  1RES A;  3QPS A;  2ZB9 A;  3HB9 A;  2IBD A;  1IV6 A;  3A01 A;  4C2M J;  2R0Q C;  4RBO A;  2DMN A;  3BQY A;  3JR9 A;  4M3D A;  4DZP A;  2R5Y B;  1GVD A;  3LSJ A;  1EF4 A;  1K61 A;  2MGQ A;  4A3B J;  5IP7 J;  3JRF A;  1DU6 A;  2VKE A;  5K7H A;  1IG7 A;  2EZL A;  2DA1 A;  5FLM J;  2XRL A;  4QIW N;  3Q0V A;  5DTD A;  3RKQ A;  2Y30 A;  3L1P A;  2E2H J;  1MBJ A;  3DCF A;  2G0E A;  1MBH A;  5EG0 A;  5DS9 A;  1NK2 P;  1MSF C;  1BW5 A;  1TWH J;  3GTM J;  4BBS J;  3SFI A;  1ETO A;  2YU9 J;  2X6O A;  2NOG A;  4M6V A;  1HCR A;  3D1N I;  4QSH A;  2VPR A;  1BA5 A;  2XPW A;  1WGX A;  4MIM A;  5J1U A;  2HXI A;  2LD5 A;  3TP0 A;  3S14 J;  1MSE C;  2EZH A;  2XGD A;  3HDD A;  1ITY A;  2W48 A;  1XS9 A;  3FIS A;  2E2I J;  4J19 A;  2R7Z J;  4JX4 A;  4LOC A;  2DMP A;  1IUF A;  2VKV A;  1IGN A;  5EGO A;  3A01 B;  3M3Y J;  1FTT A;  2WAQ N;  4A3C J;  1OFC X;  5EZG A;  4XIC A;  4MFD A;  2H8R A;  4QTR A;  3O8G A;  1JT0 A;  4GFB A;  2AHQ A;  4UUT A;  2JA7 J;  3K7A J;  5FKL A;  1JTX A;  3BTI A;  3H0G J;  3PM1 A;  1ETQ A;  1LFU P;  4BY1 J;  5K7F A;  1X2N A;  2COB A;  1D5Y A;  5M3F J;  2CQX A;  4MO7 A;  4AC0 A;  2FX0 A;  4CYC A;  5IYB J;  3QPL A;  5FKK A;  2HOA A;  3ZQH A;  5M5W J;  1OCP A;  3MVP A;  2E2J J;  2FJ1 A;  1ORK A;  4C3I J;  4A3M J;  1HLV A;  4XRM A;  1I50 J;  4L5E A;  1Q1V A;  1JUS A;  1X58 A;  3PO2 J;  4FCY A;  1H88 C;  1ETV A;  1P7I A;  4A3J J;  3A02 A;  3JRI A;  3BQZ A;  4G12 A;  3S1Q J;  3S2D J;  1T56 A;  5BNG A;  4XRS A;  3C2B A;  3ZQL A;  3OOU A;  2CUE A;  2DN0 A;  2P81 A;  3O8H A;  5EDN A;  3HKZ N;  1Y1W J;  5HOD A;  1WI3 A;  1UHS A;  2XB5 A;  1AU7 A;  4MLO A;  1AKH A;  2XPU A;  5M5Y J;  1TWC J;  1QRY A;  3HOU J;  1MBE A;  2LTP A;  2L0K A;  4FIS A;  4JX6 A;  1O4X A;  4ABZ A;  3BTC A;  3TP3 A;  1ENH A;  2ECC A;  2IAI A;  2L7M P;  3I4N J;  2TRT A;  1TC3 C;  2DTZ A;  3G1O A;  5F1J A;  4D5F A;  2N8G A;  1IJW C;  4IEJ A;  3MKL A;  1POG A;  3TW6 A;  4C3H J;  2MG4 A;  3ZQI A;  3IV5 A;  4V2G A;  1GUU A;  2ID6 A;  4A3K J;  2NVY J;  1ZTR A;  2LP0 A;  1RKW A;  1DU0 A;  2MSY A;  1U8B A;  3HOW J;  1XC5 A;  1XG1 A;  1BJZ A;  4D7M A;  5E3M A;  2XB0 X;  5E3O A;  2Y9Z A;  1MH3 A;  1LFB A;  1K83 J;  3LSG A;  4A69 C;  1BL0 A;  1B8I A;  1WH7 A;  3BG9 A;  3K2A A;  1B72 A;  4JYK A;  3ZOB A;  3QQA A;  1VND A;  2R5Z B;  5GPA A;  3TED A;  2CRG A;  1F36 A;  1LE8 B;  5FKM A;  3LOC A;  2X9D A;  5F0F A;  4XRS G;  3JRG A;  3SJM A;  3GTK J;  1FIA A;  3S16 J;  1FIP A;  2JA8 J;  1JT6 A;  4Y7N J;  5F27 A;  3BR3 A;  2DA3 A;  4EEF G;  1FJL A;  1HDD C;  3W6V A;  2FD5 A;  2DJN A;  2L7Z A;  1GT0 C;  2HQ5 A;  3WHC A;  2XGE A;  1HOM A;  1ZK8 A;  5JLX A;  1U9N A;  1PUF A;  3PO3 J;  1RKT A;  4A3F J;  2JA5 J;  3GTQ J;  1IDY A;  2DA7 A;  1MBK A;  3RZO J;  2CUF A;  1H89 C;  4A93 J;  4AUX A;  4B4C A;  4UUS A;  4FTH A;  2WV1 A;  5EZH A;  3UKG A;  1NK3 P;  2K9Q A;  1ZR2 A;  1F43 A;  2VI6 A;  1ETY A;  1JKO C;  1BW6 A;  2JK3 A;  3SDG A;  4C3J J;  5E3N A;  4IHW A;  3GTJ J;  3GTP J;  5IP6 A;  5EEA A;  2ME6 A;  4V2F A;  3F0C A;  5C3E J;  2LLK A;  2RAE A;  1NTC A;  2DMU A;  4A3L J;  1JGG A;  3LSP A;  1JUM A;  1WCM J;  2LR8 A;  1ZR4 A;  4W97 A;  3GTL J;  2LVS A;  2M34 A;  3LSR A;  1W0U A;  3HOV J;  5C4J J;  5EG0 B;  3CMY A;  2XGC A;  1GDT A;  2DA2 A;  5F08 A;  4A3G J;  3Q3S A;  2AO9 A;  3TW7 A;  3S1N J;  4RDU A;  3BR2 A;  3HBL A;  1MH4 A;  1YRN A;  5FJ8 J;  3B6C A;  3BR5 A;  1VF9 A;  1JKP C;  1QPI A;  2M0C A;  2Y2Z A;  1Z0X A;  3BG3 A;  3BTJ A;  2KDZ A;  2DMQ A;  1JJ6 C;  2DMT A;  3DEW A;  2Y0S N;  2LFB A;  1TWG J;  2GLO A;  5FLV A;  1U9O A;  2R5Y A;  1RR7 A;  3FKI J;  2R93 J;  5EGO B;  1HF0 A;  2O9L A;  3HOX J;  2EZK A;  2L9R A;  4M3E A;  3S1M J;  2L7F P;  1IC8 A;  3JRB A;  3I4M J;  3HM5 A;  1A6I A;  5EF6 A;  4M3F A;  3GTG J;  2LK2 A;  3A03 A;  4FE4 A;  1SAN A;  1P7J A;  2CQQ A;  5F0H A;  2ECB A;  1IDZ A;  3S1R J;  3LNQ A;  2R92 J;  2HOT A;  4CYC B;  4BY7 J;  3IH4 A;  2HI3 A;  1JUP A;  1UG2 A;  2PMZ N;  3NAR A;  2E19 A;  4D7N A;  4BKX A;  3Q0U A;  4DYQ A;  5IOZ A;  2D5V A;  2O7O A;  5IYC J;  2ME0 A;  1Z77 A;  2K9N A;  1HDP A;  5E3L A;  1S7E A;  4M3G A;  1WH5 A;  4X1E A;  4DZJ A;  3ZQG A;  3MN2 A;  1E3O C;  3BG5 A;  2HYJ A;  1GV5 A;  3HEF A;  2OPT A;  2JMW A;  3BTL A;  3Q0W A;  1UMQ A;  2DA4 A;  4B3A A;  2HOS A;  3OSF A;  2JN6 A;  3NAU A;  5M3M J;  4Y52 J;  2FQ4 A;  5J1R A;  4I76 A;  3BR6 A;  2NVT J;  2ID3 A;  2QCO A;  1CQT A;  2M2E A;  1AKH B;  3S15 J;  3BT9 A;  4DYR A;  4MFE A;  5IOY A;  5C44 J;  1U78 A;  2M8G X;  1RET A;  1TWA J;  1W0T A;  5K7Z A;  2M9H A;  4JX5 A;  1JKR C;  1MBF A;  5C4X J;  3ZQF A;  4AYB N;  5IPA A;  4XK4 A;  5EYR A;  3HOY J;  2DA5 A;  2GBY A;  2IEK A;  1ZKG A;  1MBG A;  3IH2 A;  2TCT A;  1X2M A;  3G1M A;  3E7L A;  1AHD P;  4D5C A;  1OCT C;  3JRH A;  1APL C;  4B1R A;  1GV2 A;  1JTY A;  4IHV A;  2JA6 J;  4I6Z A;  3RZD J;  2DA6 A;  5FKO A;  3ZQC A;  4W1U A;  5F0C A;  1B8I B;  3FIW A;  1B72 B;  3WHB A;  5IP9 J;  3S2H J;  4BBR J;  1MNM C;  1Y1V J;  2B63 J;  3JRD A;  1ETK A;  2WB1 N;  1H8A C;  3CQZ J;  3H3V K;  1OJL A;  2H1K A;  4NDL A;  2LY9 A;  4HNV A;  3G1L A;  5FKN A;  5GP9 A;  3GTO J;  5J1Y A;  9ANT A;  2KT0 A;  3BR1 A;  1WPK A;  3FK7 A;  2GM4 A;  3S17 J;  5F04 A;  1QVT A;  1JKQ C;  2ELK A;  3HOZ J;  3JRE A;  2XSD C;  4A3I J;  4BXX J;  1PUF B;  2O8K A;  1FEX A;  3BR0 A;  3IH3 A;  2MW8 A;  1TWF J;  2YS9 A;  4A3D J;  1JJ8 C;  2NS8 A;  1I6H J;  2CU7 A;  4X6A J;  1VFC A;  3CCY A;  3OSG A;  4UUS B;  3HGG A;  1VI0 A;  2K40 A;  2CJJ A;  2Y31 A;  1A5J A;  3OIO A;  2I10 A;  2NVQ J;  1RPW A;  3CDL A;  4IHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...