5EDNA

Structure of hoxb13-dna(tcg) complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
60
structure length
60
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Hox-B13
publication title Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 60
sequence length 60
chains with identical sequence B, G, J
ec nomenclature
pdb deposition date 2015-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ednA00
3BR2A 2PMZN 3QPSA 3JRFA 3HGYA 3BG3A 3BR5A 4LOCA 1MBGA 1ETKA 2JA8J 2LLKA 2P81A 2XB5A 5IP6A 4XICA 1IV6A 5F27A 1WCMJ 1RKTA 3LOCA 2XGEA 3A01B 3BTIA 2GBYA 4IHYA 2LD5A 2JA7J 4RDUA 2TCTA 1TWHJ 2MG4A 5EYRA 4C3JJ 2ELKA 3S17J 5M5WJ 2JA5J 2JJ7A 2ID3A 4A3EJ 1ZR4A 3OOUA 3ZQFA 4IHXA 2XGDA 3I4NJ 1FIAA 1R9TJ 2CU7A 4RBOA 3MKLA 1FJLA 2DA6A 1OFCX 3BTJA 2FQ4A 3H0GJ 2XSDC 2WB1N 3DCFA 2D5VA 2HXIA 1BA5A 3FISA 1WI3A 2YS9A 5EGOA 2GLOA 3BR6A 3C2BA 4D7MA 2H8RA 1ZTRA 3JRGA 2EZLA 1YRNA 2IEKA 4X1EA 1MBEA 2CUEA 1ZGWA 3I4MJ 1JUSA 1TWAJ 4AYBN 3Q3SA 5M5YJ 2R5ZA 1IDZA 1B72A 3HEFA 1MBFA 2LP0A 1ZQ3P 3BG9A 2VPRA 1GVDA 5IPAA 3HB9A 3GBGA 5IYCJ 2EBIA 4AC0A 4A3LJ 4CYCA 1ETYA 2ID6A 4Y7NJ 3LSPA 3MVPA 3OIOA 2DA5A 1U8BA 2FD5A 3S16J 3LNQA 3G1MA 4JYKA 1MBHA 2EQRA 1FEXA 5F08A 2LR8A 3WHBA 3E7LA 3FK7A 4M3EA 1F43A 1JT6A 3M4OJ 4DW6A 2CRGA 1IUFA 4A3BJ 3D1NI 1ENHA 2Y0SN 1AKHA 1EF4A 1Z0XA 4B1RA 3PO2J 2K9QA 1B8IA 3BG5A 1IDYA 4M3GA 1K61A 2CUFA 3JRAA 1MH3A 4DYQA 2K9NA 1MBJA 4FE4A 5K7ZA 1RR7A 5FJ8J 2JK3A 2YUSA 1OCTC 1XS9A 3K2AA 5JLWA 1JT0A 2X9DA 3TP0A 3JRCA 3FK6A 5FKLA 2HXOA 4JX4A 1O4XA 2DA7A 4QIWN 1NK2P 3O8GA 3Q0UA 5EEAA 4JX6A 5F04A 3A01A 2E2IJ 3UKGA 3BQYA 2COBA 1A6IA 3SJMA 5FLMJ 3GTLJ 2VUMJ 2MW8A 1FTTA 1QVTA 2LY9A 1Y1VJ 3HBLA 1X2NA 2HOAA 2KDZA 5F0CA 1JTXA 3QPLA 3TW6A 5GP9A 5J1YA 2NS7A 3HOXJ 5C44J 2LK2A 3HOUJ 3BTCA 3JRBA 2NS8A 3DEWA 2O9LA 1TWFJ 9ANTA 2I10A 1JGGA 1GUUA 1LFUP 3FKIJ 2L7ZA 3K7AJ 1GDTA 2E2HJ 2XB0X 5IOZA 4FISA 5IP7J 1X58A 4UUSB 2IBDA 1BW6A 1U9OA 1LE8B 1WGXA 4FTHA 3A02A 3A03A 1U78A 2HYJA 1IJWC 3ZQGA 3ZQLA 3HOZJ 3GTOJ 1UG2A 2M0CA 5M3MJ 2JN6A 2ZB9A 5HODA 1HF0A 1IG7A 1APLC 1JKQC 4B4CA 3CDLA 1POGA 2XPVA 2QCOA 2HOTA 4I76A 5F0HA 2JA6J 2HDDA 3CCYA 2JMWA 2H1KA 3GTMJ 1D5YA 1IRZA 3JRDA 3QQAA 5JLXA 5FLVA 4W1UA 2JWTA 2CQQA 4DZJA 3BQZA 3LSJA 2ECBA 3OSGA 1HCRA 3JRIA 2LTPA 4BKXA 1VF9A 2R92J 4DYCA 1E3OC 2DMNA 4M3BA 2Y9YA 4M3DA 5K7HA 4M6VA 3BR1A 3S1QJ 4UUTA 4A3MJ 4A3KJ 3BTLA 1UHSA 2FJ1A 2G0EA 1HLVA 2M9HA 4MLOA 1T56A 4JX5A 5IYBJ 4A3FJ 5C3EJ 5IOYA 4XRMA 4BBRJ 2FX0A 1RETA 1RPWA 3GTQJ 4S0HB 2WV1A 5FKNA 5J3LA 5DS9A 2L9RA 2MSYA 2Y31A 3LSGA 2OPTA 3JREA 1ETOA 2OF7A 4MIMA 4V2FA 3TW7A 3M3YJ 3PM1A 2DA2A 1GT0C 1ETQA 2O8KA 1BJZA 3HOYJ 4MFDA 4MFEA 5EDNA 5FKMA 2HI3A 4BBSJ 4UUSA 1ITYA 4V2GA 4BXXJ 3NAUA 1LE8A 4GFBA 2RAEA 1I50J 1RKWA 3H3VK 2VKEA 3HGGA 4BY7J 1P7IA 5K7FA 3HM5A 1DU6A 4XIDA 2DA1A 4XRSG 1CQTA 5EG0B 1WPKA 4ABZA 1SANA 1MSFC 3G1LA 1QPIA 1HDPA 3S14J 3HOVJ 1FTZA 1XG1A 3WHCA 3F0CA 2R5YB 3CMYA 1AHDP 2EZIA 5IP9J 2XPWA 1H89C 2DTZA 3JRHA 4I6ZA 2WAQN 4MO7A 2M8GX 1K83J 3S1NJ 3NARA 2LVSA 1ETVA 3S1MJ 1MH4A 2VI6A 1A5JA 1TWGJ 1VI0A 1JJ6C 4BY1J 4D5FA 2AO9A 4IEJA 3S2DJ 1JTYA 5EZGA 2HOSA 4DZPA 2L0KA 4C3IJ 2R0QC 3OSFA 4X6AJ 3LSRA 1JUPA 3JR9A 2R93J 1H8AC 1F36A 3IH4A 2NVTJ 1JKOC 1OJLA 2XPUA 2K40A 2NVXJ 1JKRC 4EEFG 1JUMA 1RESA 4A93J 2MGQA 1MNMC 2DA3A 5E3OA 1JKPC 3SDGA 4A3DJ 4NDLA 5E3NA 1OCPA 3TP3A 5E3MA 4A3JJ 3PO3J 2NOGA 1PUFB 1GV2A 4A3CJ 3L1PA 2LFBA 4B3AA 2N8GA 3GTGJ 1BW5A 1FIPA 2M34A 3ZQHA 2L7MP 1I3QJ 4L5EA 1GV5A 3VPRA 2ECCA 2EZHA 2ME6A 2B63J 3MN2A 2X6OA 4IHVA 3HKZN 4QTRA 1HOMA 5F1JA 2EZKA 3IV5A 1TC3C 1NK3P 1UMQA 3W6VA 1Q1VA 2R7ZJ 5EZHA 2IAIA 1DU0A 3S2HJ 3IH3A 2X48A 5EG0A 2XGCA 2CJJA 2K9SA 1AU7A 1SFOJ 3B6CA 2O7OA 4J19A 3O8HA 5FKOA 1NTCA 5GPCA 4M3FA 5M5XJ 2R5YA 2Y9ZA 4QSHA 1HDDC 1LFBA 1TWCJ 4FCYA 3Q0VA 4IHWA 1MSEC 1XC5A 3SFIA 2E2JJ 1VFCA 2DJNA 4A3GJ 2E19A 3ZQIA 3HDDA 3RZOJ 4JP0A 3RKQA 5M3FJ 1ETWA 2Y2ZA 5C4XJ 5F0FA 2DMQA 3RQIA 1IGNA 3G1OA 2DA4A 1ORKA 3FIWA 2TRTA 4XK4A 2ME0A 3BR3A 2HQ5A 1BL0A 5GPAA 2CQXA 1ZR2A 1Y1WJ 2GM4A 4HNVA 2M2EA 4G12A 2YU9J 2DMPA 1IC8A 3TEDA 2EH3A 3BT9A 4D7NA 2NVQJ 1I6HJ 4D5CA 1QRYA 3GTKJ 1H88C 3RZDJ 5C4JJ 3S1RJ 2DMTA 5EGOB 1PUFA 1MBKA 1YRNB 5DTDA 3CQZJ 5BNGA 5IYDJ 3ZOBA 5J1RA 4FE7A 2LKXA 3B6AA 2R5ZB 2QF7A 4C3HJ 2Y30A 4DYRA 1W0UA 1B72B 5FKKA 2E1OA 3S15J 4Y52J 1T33A 3ZQCA 1Z77A 2DMUA 2XRLA 2L7FP 4A3IJ 3GTJJ 2KT0A 2DN0A 4CYCB 1S7EA 3HOWJ 1G2HA 1P7JA 4W97A 4A69C 1U9NA 5J1UA 2W48A 1ZK8A 1X2MA 4XRSA 1VNDA 1WH7A 1ZKGA 1AKHB 3IH2A 1JJ8C 1B8IB 5E3LA 4AUXA 2VKVA 4C2MJ 1W0TA 1WH5A 2AHQA 3BR0A 1QVUA 5EF6A 2NVYJ 3Q0WA 3GTPJ 1ETXA
chains in the Genus database with same CATH superfamily
3BR2A 2PMZN 4ZYAA 4BE0A 4Z2YA 3BR5A 5FD6A 3FF5A 2CV1A 1ETKA 2EIJH 1XGOA 3J81K 4ZDOA 2XB5A 1SVOA 4OAYA 3LOCA 3DPUA 2XGEA 4IHYA 5EJCA 1IN4A 2W57A 2ELHA 3U1DA 3EUKL 2P5LC 3S17J 5M5WJ 1OCCH 2ID3A 2WAEA 3OOUA 3CUQB 3HRUA 3I4NJ 4YFNF 3PFYA 1R9TJ 3MKLA 4QPOA 2K3PA 3H5AA 3SDBA 2DA6A 3J7YJ 1VZ0A 2K3FA 2WB1N 3KP6A 3GYHX 3L2QA 3RKXA 4YIRX 4IF4A 3ROUA 3EQLF 1YI2I 1BIAA 1WI3A 3MD2A 3S32A 2CUJA 2YS9A 4A5NA 5KAIC 3WTTC 1F9NA 5FB2A 2GXGA 2PJPA 1ZGJA 1KU2A 2IEKA 1WSUA 4G7ZF 1KU7A 3I3LA 1WJAA 3LL7A 1JUSA 1TWAJ 4AYBN 1PP7U 3Q3SA 1YW8A 2KL4A 1BC7C 1B72A 1IXSB 2HGCA 2VPRA 4MQVA 2O0YA 1S8NA 2AQEA 2LKSA 1YIOA 2ISZA 4A3LJ 1ETYA 2B9SA 5D8KB 4Y7NJ 3LSPA 1U8BA 5DD8A 4JYKA 1K7AA 1YO5C 1FEXA 3GLXA 3F8FA 4UHTA 3BP8A 4N4OB 4OIOF 2YX4A 1LPQA 1XSXA 2R7RA 2OTJI 4IOCF 2Q8KA 4RM3A 3M4OJ 2VLAA 2F4IA 3D1NI 1IF1A 1FX7A 5ICFA 2CFOA 1Z0XA 2JRTA 3LSHA 3CDHA 3TDUC 1K61A 5HLGA 3FDYA 2RC4A 2DBBA 4ZJZA 1ZLKA 2EFWA 2BVMA 2XSJC 5IY5H 2ZNYA 4KYWA 4EJWA 2K9NA 5J8FA 4IX7A 2ZXJA 1KU9A 3V42A 2GOMA 1RR7A 4RGSA 2QGUA 2RV8A 3TDZC 1OCTC 3ZR8X 3K2AA 2WAFA 4BE1A 3F22A 4FQGA 1R22A 1KU3A 4QIWN 5HS8A 3A01A 3L2RA 3ONQA 2COBA 5CVUA 3SJMA 1I5ZA 3G2BA 5FLMJ 3GUDA 2QENA 3GTLJ 1IUYA 2VUMJ 2CSOA 3QODA 2FU4A 3WTUC 2LY9A 4G6DA 2Z16A 1PDNC 3HBLA 2ESHA 5ILUA 2Z33A 2IS2A 2HOAA 3HPHA 4BJ6C 1R00A 2LNBA 4KJZA 3V8LA 3OYKA 1I1GA 4JBAA 1UJ8A 1JGSA 5J1YA 5L3GA 2NS7A 4BHCA 3HOXJ 5E79C 2YR2A 2LK2A 4RM2A 3JRBA 4UVAA 2KHMA 2V6EA 2O9LA 4OIRF 2VC1A 1TWFJ 4CXFA 2EINH 2ADUA 1S7OA 1W5SA 1X1CA 1XMKA 1F5TA 1G3WA 5IOZA 4FISA 2H6CA 3L2UA 4HSRA 2R3SA 3SZGA 1X58A 4C9YA 1V3FA 4I0AA 5LEKA 5K1YA 1SAUA 1G3YA 1ZGAA 3A02A 4H0EA 1V4RA 2FSWA 2OJED 1X3UA 2L9VA 3W2VA 1UG2A 1RRJA 2M0CA 5M3MJ 1R36A 1IG7A 4ZDLA 1HF0A 4KDPA 4GYGA 3GZ6A 3TMOA 2HOTA 4B4CA 3CDLA 2XPVA 3K0LA 4AU7A 1Y0NA 4I76A 4HOBA 5F0HA 3T0YA 4I2OA 3M9AA 2HDDA 2UXNA 3CCYA 2KRHA 3PIOF 4AIKA 1XB4A 2F4OB 1IV8A 2H1KA 1VQ8I 3FM5A 3GTMJ 1IRZA 2MABA 2ZJPF 1FBSA 3QQAA 5JLXA 3S3MA 2NVUB 2HOEA 3MZYA 2M4GA 3R0JA 1D0XA 4BNCA 3CUQC 2XC7A 1HCRA 3ESWB 1Q1HA 4UUVA 1U5TC 1P2FA 2VQCA 4G8XA 5JVGF 3OS0A 3OR1C 4M3DA 5K7HA 2E1CA 4RMNA 5HVQC 3FXOA 1FOKA 3CCRI 3BTLA 3CLQA 1XN7A 2VJJA 1IRXA 1T6SA 4II3A 4OMZA 3K1PA 1A04A 5LRRA 5IYBJ 5JHFA 4ZTFA 1QU3A 3ZXSA 2V26A 3MKZA 1JI8A 2EV6A 3HHGA 1SAXA 4PGGA 5B1BH 1RPWA 2YPRA 3QYBA 4DBQA 2VE9A 1LQ1A 3PSFA 2DPDA 4BXFA 2M1BA 5FKNA 5K5RA 3FWEA 4XNFA 1E17A 2OTLI 4MTDA 2Y31A 5B3SH 3HSEA 1ETOA 3TW7A 3T8TA 1ODDA 3PM1A 5LHHA 4E7JA 4UB6C 4OU0A 1J09A 5CLSA 1SMYF 1YX5A 2GQQA 2XV4S 1FYLA 2O8KA 1VQNI 2JQ7A 2P4WA 2FBHA 1KQ9A 3WODF 3C1DA 3JSPA 2HI3A 3FBNB 5ICGA 4V2GA 2JUCA 1CGPA 4BXXJ 3CJRB 1D5VA 4ASNA 1SD5A 3K10A 4BACA 1I50J 3EYYA 1RKWA 3H3VK 3KCCA 1MKMA 3HGGA 4BY7J 1DDNA 2QQ9A 5K7FA 3H92A 1CQTA 5EG0B 1WPKA 3VDXA 4ABZA 5ICEA 3DU5A 1SANA 4EQQA 4BQOA 2OZ6A 4M9ZA 4F93B 4BU2A 3CO6C 5JHUA 1XG1A 3JSOA 2ZFWA 3F8CA 1Z1DA 3GFIA 4O3MA 1UHMA 2XPWA 2L4AA 5D5VB 5GTHC 4I6ZA 3MWMA 2DOAA 4DNCA 3BZCA 1ZREA 5E1WA 4Q5SF 3K70D 4I0BA 1U0JA 3FXQA 3S1MJ 5KK1A 5KAFC 4FHTA 2VXZA 3DXJF 1DGRM 2AO9A 4IEJA 1YYVA 1JTYA 2H27A 3H5NA 2L0KA 5H6QA 4NHJA 5DCMB 2OZUA 1ZARA 2OA4A 2V9PA 4F92B 1N25A 2DOFA 4IKFA 1TQMA 3G4SI 1W7PD 4EV0A 2P5VA 5B5EC 4RGUA 1JKPC 3HZJA 2ISYA 2PX9A 2M5WA 1P9QC 2KJCA 4PJJA 3GF2A 1C0WA 4CCJA 3VYTB 2NOGA 1QO0D 4UNOA 4A3CJ 2PLYA 3L1PA 1R6RA 3OMYA 1PYVA 3CZ6A 5CVJA 4HA8A 1FIPA 4YFKF 1XGNA 1Y0UA 2DQLA 2L7MP 4RGRA 2IJLA 2ECCA 2EZHA 2L4MA 1BI0A 1D8KA 4MHGA 4G94A 3L2CA 5FGMA 3CDIA 3HYIA 4CUGA 5F1JA 2ZO4A 4OAZA 5CVIA 2EZKA 3RYRA 2HVQA 5H2FC 1SFUA 1Q1VA 4EJTA 1K6OA 1T39A 2WAQA 4N9HA 2IAIA 5FFXA 1DU0A 2EA2A 3IH3A 3S2HJ 2GA1A 2E35A 2H1LA 2XGCA 4BXUA 4ZZLA 3FXRA 4CCOA 5J47A 4IPAA 5LHIA 5K5OA 1BJAA 1AU7A 5FKOA 4LITA 4CGZA 4IQ4A 1ZG5A 4G7HF 5M5XJ 2DFHA 3H9QA 2IS1A 1FOYA 1TWCJ 2P6SA 4O5VA 2W24A 2FQ3A 1VFCA 3AFHA 2OD5A 3QOEA 1WJ5A 4A3GJ 2E19A 4D0PA 3HDDA 4Y4RA 2E1MC 3BCAA 2BEOA 1DPUA 2FMLA 3BJOA 5B1AH 4KFCA 1D0ZA 2DMQA 2KLOA 3RQIA 5JVTA 3FIWA 2DTRA 2R7VA 4LLLA 4XK4A 1V5GA 5J4YA 2ME0A 2KP6A 3GFJA 2HQ5A 3F8MA 1ZR2A 2P6TA 3I9V2 2RREA 4XLAA 2X4HA 2ZSHB 2M2EA 3HC7A 4HNVA 3J81Z 3WGIA 1LB2A 3CCQI 3CCLI 4LIVA 1HKQA 3TEDA 4LB5A 4S05A 3FXUA 4L18B 2IGKA 4XSXF 3S2WA 3ZP5A 2NVQJ 3GTKJ 1QRYA 2EK5A 2ZJ2A 4LG0A 3RYPA 2BBYA 3W2WA 2E7XA 2IA0A 5EGOB 1PUFA 3OIPA 3EDPA 5H20A 3X2QH 1K4TA 1QBJA 5AIPA 4A6EA 3CO7C 2LKXA 4XBFA 5GTIC 3KLNA 4LJZF 2BVLA 1IRFA 1W1WE 3ZQCA 1Z77A 2GXAA 5BS6A 2KT0A 1GVJA 2TDXA 2K85A 3F21A 3QRFF 4PK4A 2XF7A 3D0SA 5LFAA 3RPUD 3SQNA 3DF8A 2MLKA 3E97A 4WXCA 1U9NA 1ZAOA 2K9LA 3GW2A 4ENNA 2MD0A 3TKYA 2ZNZA 4CSWA 1VNDA 2MC3A 2LY1A 3IH2A 3OYNA 2BHYA 4KN4X 1OR7A 1XGSA 2X1DA 1ON2A 1ZN2A 1QZEA 1V5FA 3F6VA 3U9GA 1J0RA 1ETXA 1IZ1A 4GDFA 3ABUA 1YE9A 1MBGA 2ZBKA 2JA8J 1P6RA 1MJ9A 1PVEA 3G73A 1FWZA 1WCMJ 2EPFA 3PJRA 2DU9A 2TCTA 3GEZA 2MG4A 5EYRA 2ELKA 3M1EA 2JJ7A 2KISA 4LB6B 1ZR4A 3ASNH 3ZQFA 1FOXA 3QPTA 2IP2A 4GYIA 5F1RA 3FXKA 1D8JA 4LD5A 4KNYA 4L9JA 2FE3A 1OFCX 2RQPA 1FP1D 1ZYRF 3CC4I 2XSDC 2DQRA 2ESNA 2QQAA 2Q1ZB 2HXIA 4ZC3A 4DOZA 4V19K 1SFKA 3WE2A 2HPIA 4HZFA 1DUXC 5E18F 2KIMA 3PUBA 3BDDA 4RLFA 1FY7A 5L3CA 4F52A 4AWXB 2EZLA 1MZBA 1MBEA 2Q2EA 1OMIA 1R4NB 1BR2A 2QSFX 2RDPA 1IDZA 4ZDPA 2Z9OA 3HEFA 1W7PB 1ZQ3P 3BG9A 2O5RA 1MNEA 2WADA 5IPAA 4MEYF 3K2ZA 4L9VA 3I58A 5FD5A 4AC0A 3K1MA 1SVLA 1UG0A 1ULYA 1WJDA 3CD6I 3DQVC 3N05A 4XLNF 3S16J 3LNQA 3G1MA 4WXHA 1MBHA 2FOKA 4CDGA 3DPLC 4U0YA 2DT5A 2STTA 2X1EA 4XLPF 1F43A 2PMZA 1X4OA 5E1XA 3PQKA 2FEZA 4CICA 2CRGA 1IUFA 4A3BJ 1VQLI 1ENHA 2Y0SN 3E0JB 1EF4A 4A12A 2X1CA 1YOVB 2EFPA 3PO2J 2ZXWH 1IDYA 1IO2A 4U88A 2GA2A 4YIIA 2CUFA 3ZRGA 2HU9A 5HS7A 1R7JA 2K4BA 1WJBA 1HSJA 2FBKA 3CMMA 5HLHA 5K7ZA 1TT5B 3BROA 5AONA 4ESBA 4B44A 1XS9A 2KIUA 5JLWA 1OYWA 3TP0A 3ABMH 3CTAA 5FKLA 2HXOA 4HX8A 4R1HA 4XOTA 2F48A 1O4XA 3O8GA 1FYKA 2CUZA 4JX6A 3I64A 2DODA 2E2IJ 2FBIA 4KUMA 4C2UA 4M6YA 1HW5A 1E0EA 1UHWA 3NRVA 1QGPA 4WXDA 2X51A 2KJBA 1MJAA 4HX7A 3CUQA 2A5WA 2MW8A 3ZMVA 4AYBA 1MNDA 3TGNA 4IO9F 1FTTA 5BPIA 1Y1VJ 1X2NA 1BI2A 2KDZA 4G6TB 5F0CA 1JTXA 2XAHA 2DXIA 3QPLA 5GP9A 3R61A 3L9FA 3OYGA 1ZHFA 2NYXA 3KP7A 2HDCA 3BTCA 1XCVA 2A6EF 1FNNA 1Z6RA 1ZRFA 1MW7A 1YS6A 1Z6TA 2I10A 4DJAA 4HEA2 1GUUA 2A61A 1MMDA 1LFUP 4XONA 3KP2A 3C3WA 3FKIJ 3WG9A 2L7ZA 2XB0X 1I3AA 3FZVA 2NAZA 5B66C 4UUSB 2EIKH 1BW6A 3H1CA 2KFDA 4HV6A 3I56I 3WTSC 2PI0A 1N77A 3GMEA 2CGPA 1UCRA 4AVPA 1FZPB 2V1NA 1HA8A 3ZQGA 3HOZJ 1ACIA 1H0MA 2JN6A 2ZB9A 4E4HA 4WF2A 5HODA 4ZTJA 5J6XA 4AIDA 4AM3A 1FOWA 4A0XA 2CW0F 2OC6A 2JA6J 4C2TA 3V4GA 1HC8A 4HG2A 2JMWA 4E7KA 3F23A 2V7FA 2R7WA 3S3OA 3JRDA 2XUBA 5FLVA 2JWTA 2CQQA 2VODA 3N97A 2ECBA 4I09A 2LTPA 4BKXA 1J7KA 4HLYA 3MAJA 1VF9A 4DYCA 2HQNA 3P5JA 1E3OC 4M3BA 4PFPA 3TO7A 2BXYA 4G7OF 2G7UA 4UUTA 3FBIB 4AIJA 4A3KJ 1UHSA 1N78A 2FJ1A 3GVAA 3VWBA 5FLXK 4GGGA 2IGMA 2M9HA 1T0FC 3EUHC 1T56A 1EH7A 1OR7C 5CJ9A 3Q9SA 2HNHA 1DPRA 4JX5A 3CJQB 2L54A 3DKXA 4BBRJ 1KQ8A 2E60A 3DEUA 1O3SA 4PCQA 4RB2C 2QKLB 4Y33A 2Y48A 2WV1A 1X3ZB 1D1AA 2ZC2A 2OAZA 3E6CC 4N0BA 2COMA 1WHUA 3TOBA 1FSEA 1G3TA 3LSGA 2OPTA 3JREA 1J9IA 4MIMA 3K4CA 4HAMA 4CZZA 1GT0C 2J5OA 1BC8C 1BR4A 2P7CB 1E3HA 3FHNA 1ETQA 3J80K 3G6EI 1BJZA 3I59A 4KA4A 1R58A 1QZYA 3IC7A 2Z1DA 2JRMA 3BJAA 4E7LA 1O3TA 3VSLA 3CF5F 4E7ZA 1VQMI 4KICA 4EMSA 1P7IA 2GIZA 1G6NA 3MQ0A 4XIDA 2PJRB 4LG3A 3HPGA 3HKZA 4KITB 3RIRA 4XORA 3EETA 2IPQX 1MSFC 2XF5A 1HDPA 1YLFA 4PJMA 4ESFA 3HOVJ 2IT0A 3S14J 1EKEA 1SD7A 5LGTA 1FTZA 1GHCA 3F0CA 3JW4A 1V55H 2PG4A 3CMYA 2BXZA 2NXNB 2DLLA 2EZIA 2OQGA 1H89C 2BZTA 4F55A 5FRMA 2K4JA 4HV5A 3OL3A 5D5XB 1E3PA 3SFZA 2DPUA 3O3KA 4E7HA 3MZ8A 4A5MA 2V9KA 1IRGA 1IW7F 2DJIA 2FMYA 3BOQA 4MQ9F 4BJTA 4GRIA 1A5JA 1JJ6C 4BY1J 4D5FA 4M71A 5EZGA 4BL0B 2HOSA 1Z67A 4DZPA 3I59B 3K4BA 4C3IJ 3T1BA 5J40A 3LSRA 1OLTA 3JR9A 3OYDA 3KYDB 2R93J 1H8AC 4N9IA 3IH4A 4IZZA 2NVXJ 3H35A 1JUMA 2W00A 2K9MA 1KONA 4A93J 2MGQA 2M87A 1J2XA 1BI3A 5CQGA 3D5SC 4NDLA 5E3NA 4RLQA 1QZZA 5E3MA 3OYLA 3PO3J 1EV7A 2DDBA 1GV2A 1MIJA 3C7JA 2LFBA 2CQ7A 2H6BA 2K27A 3AL0B 3V7SA 4BH9A 2LH9A 5FO5A 2B63J 4PDKA 4Y15A 3HKZN 3F72A 1B9NA 1Z3XA 3DKWA 4IRIA 2Z99A 2GOXB 5E20A 1UELB 1YW7A 1QNTA 3HTSB 1TBXA 2BV6A 3IL2A 2XKPA 1L3LA 3CMEI 4HNTA 5HDNA 5ED4A 2H8WA 3ZMUA 1O3QA 2L02A 2HZDA 3A0BC 4Q47A 1YW9A 5EG0A 5BQTA 3ML6A 5CKTA 2K9SA 3E6BA 2XKOA 2LREA 2DK5A 4Y17A 5F64A 2UZKA 1S72I 2OQRA 1NTCA 4MEXF 1YJNI 4L9NA 4HX4A 1RUNA 4M3FA 3L2WA 2WA0A 1HDDC 3HSFA 2M7AA 4P9FA 2X0LA 4BQNA 3K4NA 1CF7B 3Q0VA 2ZXIA 3H9JA 2UWMA 4AVZA 2JPCA 2E2JJ 2XGXA 3LQRA 1MMGA 1ZELA 4MNUA 4UY8I 4U7DA 4CCLA 3RKQA 3M8JA 2ZCWA 2VONA 5C4XJ 5L3BA 1D1CA 5KHDA 4G9YA 4ESJA 2DA4A 2DT7B 1I39A 2QUFA 4XKCA 4HQEA 4U87A 5DCMA 6PAXA 2HTSA 3IHUA 3BJ6A 3HUGB 4LLGF 5LLQA 3TL4X 1IC8A 3QU6A 2IA2A 2UV1A 4IXAA 4D7NA 2QLZA 4P9UA 4EJUA 4D5CA 4IHTA 1I6HJ 1WI9A 1KQ0A 1VQOI 1HBXG 5DUKA 3ABLH 2CW8A 4CZCA 3AG2H 2DMTA 2CQNA 1WZ2A 2IA1A 2J5PA 1MMSA 3BPVA 3LAJA 1R49A 1IN6A 1YRNB 1QHHD 2P8TA 2EFQA 5D5UB 4P55A 1HXDA 2HYFA 5BNGA 1B9MA 2QQBA 3VEPA 5J1RA 1R1UA 3VYRB 3B6AA 1SD6A 3O2PE 2R5ZB 2DAOA 2MLGA 3M1CA 5CQEA 4B09A 3QYEA 2VOOA 2M4KA 3O6BB 5FKKA 2CV2A 1A35A 3S15J 2E7WA 1T33A 1ZG3A 1S9HA 2DMUA 2X85A 4HSTA 1LEBA 2FUG2 2DN0A 2FOWA 3D5LA 5BOXA 3WTYC 4CYCB 1OISA 3OS2A 2AS5F 1P7JA 1OPCA 1X1DA 5J1UA 4KT5C 2W48A 3I53A 3W3CA 1ZK8A 1VQPI 2VL8A 5E17F 2VJIA 3L2VA 3L09A 3BY6A 1UZCA 4ZYDA 3SHFA 2BW3B 4E7SA 3DTIA 2JT1A 1IN8A 1ZKGA 1AKHB 4UB8C 1JJ8C 2R7QA 1B8IB 3IP4B 3DP7A 3QAHA 1LKXA 4KN7X 1EA3A 2L7KA 2NOJB 2AHQA 1K78B 2OCCH 1USSA 2E71A 3QPSA 1PUEE 3HGYA 2IVMA 4M6XA 1I6XA 3QYFA 2BY1A 2VB6A 1B4AA 2LLKA 4QPQA 2CMPA 2HR3A 4BDYA 2QSGX 2W85A 3I54A 2M45A 5IP6A 4XICA 1IV6A 2JVGA 2OCEA 4HQMA 3BG6A 3OYFA 1EH6A 3BTIA 2DFIA 2LD5A 4RDUA 1WKMA 4XLFA 1BBYA 4C3JJ 3AL0C 3ZMTA 4A3EJ 1ON1A 2VJ4A 3NQOA 4IHXA 1FIAA 1TQIA 2CU7A 1FJLA 2LY2A 3BTJA 5DD4A 2FQ4A 3FXJA 2KRFA 3H0GJ 4PFOA 2KIQA 3ZQ7A 3ZMDA 2D5VA 3DBLB 1BA5A 3FISA 3Q5FA 5EGOA 3JCUC 2LRDA 2GLOA 3BR6A 1R4MB 3C2BA 2H8RA 2DCEA 2OUMA 1R5GA 3JRGA 5GAHJ 4ENKA 1ZGWA 1W36D 3KPHA 5TRDA 4RB0A 4KMUX 3LMMA 2UUZA 1Y8RB 2LP0A 4YELA 1R5HA 3GTPJ 3DFGA 3R6SA 3A4CA 3EYIA 1Y8QB 3GBGA 5IYCJ 2E5NA 1OCZH 3E5UA 3ABKH 2XHKA 2E36A 2ID6A 1R71A 1VQ9I 2FD5A 3GXOA 1OCRH 1BIBA 1S7AA 2LR8A 1Z7LA 3QU3A 1LDKB 1JE8A 1R1VA 2P7VB 3BPXA 1JT6A 3GX4X 1L0OC 3H3ZA 4E6KG 4HF1A 2UXXA 4OINF 2KMUA 5LEJA 4XKVA 4ON0A 2WWYA 2XAJA 2LSOA 3M8FA 3JRAA 1YJWI 1T8IA 5L3DA 2V1XA 2EA4A 4FE4A 4NQWB 4EGZA 5FJ8J 2JK3A 2O3FA 2YUSA 4XSZF 3HOSA 4IJAA 4XKBA 4IL6C 1A36A 1JT0A 2KRCA 2W7NA 4XQFA 3JRCA 1JXSA 3FK6A 3R60A 5EEAA 1N75A 4HBLA 3CJNA 2DK8A 4RB3C 1ONVA 3WU1B 1R5ID 4F91B 3HOTA 3UKGA 3BQYA 3ULQB 3N4MA 2E5ZA 1A6IA 2V79A 4NC8A 4OOIA 3CCJI 2BHZA 3OR2C 1QVTA 2WTEA 2D1HA 2V9VA 5LD2C 1P4WA 5FLXZ 2M3AA 4LMYA 3C2HA 2X6WA 5GAEJ 3UR3C 3OV8A 3ABTA 4U0WA 3HG9A 5D4RA 5C44J 2A69F 4ENJA 2JA2A 3EUHA 2NS8A 1T0FA 1O3RA 4NB5A 1RC9A 3H9GA 4RAYA 4OMYA 3M7GA 4M74A 9ANTA 1JGGA 2KPMA 2LOOA 4XOPA 1W7PA 3CESA 4BQQA 5IP7J 1WQ2A 2Y0SA 4P5OA 2IBDA 2KDOA 5CVVA 4LK0F 2VOPA 4KT6A 1LE8B 3J80Z 1WGXA 4HW0A 3A03A 1P4AA 4HLXA 1U78A 2HYJA 2D2WA 2F5FA 3ZQLA 1XX5A 3GTOJ 1K79A 3NWTA 4XL9A 1I27A 3ELKA 3MKYB 4ENMA 4HF0A 3IWFA 3ISPA 4M72A 1H9GA 2QCOA 1O7LA 2QYOA 3G71I 4XRFA 3ZCOA 2XDVA 4BJ5C 2EFOA 3HXLA 4P96A 1TW2A 2LYCA 1YQAA 2JZYA 3BZKA 3CF2A 3G3ZA 3DKYA 1LNWA 5LHGA 4XLHA 3F8NA 3MZHA 4DZJA 3BQZA 3AG3H 3LSJA 3HHHA 3KE2A 1T98A 1J5YA 4A6DA 4II2A 3DBHB 3LA3A 3EPZA 1OYIA 3PFIA 2R92J 3E6MA 4BEHB 1X4PA 2M8EA 5TISC 3KLOA 2DMNA 3WTZA 2Y9YA 1DP7P 4M6VA 3LA7A 3S1QJ 5BPDA 1WRJA 3OS1A 4A3MJ 4H4KC 3RSNA 4BS9A 1MDMB 1MD0A 2DFEA 2CG4A 2XRNA 4IRHA 1YG2A 4OIQF 2G0EA 2Q0OA 5ERIA 4MLOA 2FNAA 3ASOH 5C3EJ 4XLCA 2QBYB 2P0WA 4JOMA 5IOYA 2L2OA 2F2EA 1RETA 2BGCA 2F5EA 4OIPF 3GTQJ 1WJFA 4UV9A 5HLTA 3HRTA 2VQGA 1S6LA 2V1UA 5J3LA 3ZQQA 2JSPA 5DS9A 3V7RA 3QP5A 2L9RA 2OV7A 3D5RC 5EEHA 3P9CA 4Z6YA 2K7LA 5A2QK 1SFXA 2A3SA 4V2FA 3M3YJ 3I55I 4BUPA 4ETSA 2QSHX 4CCMA 1T95A 2IW5A 4Y3OA 3LSIA 1LVAA 3CCSI 2Y75A 4QLCU 3HOYJ 3HSRA 3DEEA 1WJEA 5EDNA 3CCUI 3ERMA 2EJRA 2VT3A 1BI1A 5E8IA 4XR6A 2WY8Q 3CP2A 4BBSJ 4UUSA 1ITYA 3DU6A 4QWQA 3CJTB 2DI3A 3KEOA 3OOPA 3S3NA 1XGMA 2L01A 4XM3A 2R7SA 5CVRA 2RNJA 4N4NB 3CUOA 3OL4A 4EM0B 1HKTA 3H36A 3WGGA 3C18A 2PQ8A 4FX0A 3WHCA 1HKSA 3E5QA 2R5YB 2VASA 3I4PA 1HW2A 1X1BA 4HDUA 4D9JA 3JRHA 1G3SA 3CCVI 2DT6A 2PEXA 3V7CA 3I71A 3RPUA 2VKDA 2WY7Q 2M8GX 5L3FA 1K83J 1X3WB 2L9NA 1MGTA 2RNGA 1T2KA 3NARA 1TP4A 3S1NJ 1W4MA 3NWSA 1FT9A 1KYZA 2LVSA 4M9XA 4UXNA 4ZZDA 1MH4A 2ZMEB 2VI6A 4LGWA 1B6AA 4EM1A 1TWGJ 1VI0A 2DW4A 1FBQA 2V6CA 2W82A 2MYSA 4RB1A 2R0QC 1VQKI 4X6AJ 3VB2A 3OYMA 2R7OA 1XSVA 3SEZA 1F36A 1DGWY 2NVTJ 1V5EA 1JKOC 1OJLA 1E2XA 2K40A 3F9KA 2MA3A 1JKRC 2CO5A 1RESA 4BE2A 4RAZA 4L5IA 4BHBA 5LRSA 1TL8A 3IKTA 3K4KA 2BE5F 2BY0A 3SDGA 4XN0A 1EH8A 4HPQA 2OU2A 3TBIA 1OCPA 4M73A 1D0YA 4PUSA 1S5LC 2BY2A 2P5KA 2A07F 2CYYA 1UAAA 3KETA 2N8GA 2LBFB 2ACJA 1B1BA 1T38A 2M34A 3ZQHA 1BW5A 2K5CA 1I3QJ 2MC4A 3VPRA 2ME6A 4PGHA 5LBQA 3OYIA 3AKZA 4PZJA 3MN2A 2W25A 5IT9K 3FXMA 5D6FA 4IHVA 4RAFA 3F6OA 1HOMA 1ERDA 3K70C 2QQ8A 5J8CA 3M07A 4L0ZB 1EJ9A 3IV5A 3E1SA 3RQ4A 2NRAC 1UMQA 2BYVE 2R7ZJ 2QZ8A 3BG7A 4KIFA 1SVMA 1U5TB 4ZYHA 2PJRA 5LGUA 3GFMA 3H0DA 3OYAA 4JQFA 1Z3YA 2FNPA 2XIGA 1DQUA 3A2KA 2CJJA 5J4VA 5ILVA 1VQ4I 2O7OA 4J19A 3O8HA 2XAGA 3RKWA 5DV5A 3IRQA 1UB9A 4XMYA 4QSHA 1MMAA 2QVOA 1LFBA 2FA5A 3A0HC 1XC5A 3VODA 3K4JA 2NS0A 3C2GA 2H94A 3ZQIA 1XSDA 1F4KA 4PJLA 3MKWB 3RZOJ 4JP0A 3U21A 4NNJA 3W6KB 2Y2ZA 4GO1A 3G1OA 3BLYA 1BOBA 1ORKA 2TRTA 4NC7A 3BR3A 3CC2I 1R23A 1BL0A 2CQXA 1Y1WJ 2GM4A 3QWLA 2DYSH 5IT3A 2WC2A 4G12A 2YU9J 2DMPA 1WFXA 3QPHA 4CH7A 3HL2A 3BT9A 4M9SA 3B02A 3AAFA 1H88C 2DFFA 1P92A 1B59A 3ZMZA 3HRMA 2L9SA 5D5WB 4WWCA 3AG1H 4LK1F 1A31A 1Z21A 1MBKA 1MJBA 5HDGA 4B48A 3LSKA 4G6QA 2X6YA 3P9KA 5DTDA 4EJVA 1VQ5I 1TZLA 1M1EB 5K5QA 5IYDJ 2VKHA 4FE7A 3F3XA 4C3HJ 2Y30A 4CA0A 4DYRA 1W0UA 1W36C 1B72B 2GZWA 3BZ6A 2E1OA 4Y52J 3EUAA 1WJCA 1V54H 2XRLA 2L7FP 3IWZA 3RCOA 1FMVA 3GTJJ 5FROA 2EV5A 3JTHA 4I01A 5D4SA 2OBPA 3K6GA 4XKWA 2GAUA 3IAS2 3HOWJ 2KQRA 1G2HA 4W97A 5HDKA 3RPQA 4A69C 1P4XA 4XN3A 1OCOH 1TNSA 3KP3A 1X2MA 3ECHA 3VSKA 4DQ2A 4XRSA 2IRFG 3ECOA 2LDUA 2HDWA 2IS4A 3ZPLA 2ZMEC 5ILSA 5DYMA 2R7UA 3LQQA 2F5VA 1WH7A 2QWWA 1W5CC 5KNLA 1LEAA 4AUXA 2A6TA 1S29A 4XLEA 1SFEA 3RDIA 2VKVA 2V4JC 4YG2F 1W0TA 2VBWA 1XCBA 1CF7A 1WH5A 3BR0A 5EF6A 1OQYA 2NVYJ 3Q0WA 5CYVA 4R8HA 1W5TA 5FFZA 3JRFA 3BG3A 4LOCA 4LIUA 4NBQA 4OWRB 1Z9CA 2FXAA 2P81A 3PNVA 1FC3A 4UVBA 2CV0A 2K02A 1MMNA 3W6JB 5F27A 1FMWA 1RKTA 2YSRA 3A01B 4AD9A 2GBYA 2JA7J 4MGRA 1FPQA 3KYCB 1TWHJ 2HWVA 3IRRA 1REPC 3HUGA 4MTEA 1K4SA 5ICCA 2HVRA 2JA5J 3QOPA 2M7BA 2XGDA 4RBOA 1NHAA 3WTVC 3LWFA 1XD7A 3DCFA 4IOAF 2ZJQF 1TTYA 2YU3A 4BHPA 1KZHA 1XPXA 4EJOA 1FLIA 2EB7A 3VFZA 2XF6A 4D7MA 1ZTRA 1IN5A 2QM3A 3ZMSA 4ZYEA 1YRNA 1Y39A 4X1EA 1X19A 2CUEA 2O8XA 3SZTA 3I4MJ 2W1OA 3I0TA 4YRVA 2Z3YA 1VTNC 4I98B 5M5YJ 1T08B 2R5ZA 4J01A 2D1VA 2QKMB 1MBFA 2R7DA 1QQIA 1LDDA 3FXLA 2I5UA 2XAUA 1GVDA 2STWA 2IS6A 3WU0A 3HB9A 1LFPA 3K4MA 1KA8A 2FRHA 1TQPA 2R7XA 3P7NA 2EBIA 3R0AA 4CYCA 4ZH4F 3MVPA 3PNYA 3OIOA 2DA5A 2HEOA 1I1SA 2W4SA 4RA2A 2E1MB 2EQRA 1RI7A 5F08A 2DDAA 2RN7A 5TGTA 3KZIC 3WHBA 2VBYA 3E7LA 2VXDA 3FK7A 4M3EA 1RZ4A 3PIPF 1VQ6I 1BN5A 3KEYA 4KIGA 2LG4A 4DW6A 3Q9VA 2BW3A 3OYBA 1YITI 1A6QA 3VYUB 1AKHA 4B1RA 2A5YB 2K9QA 1B8IA 4K2EA 5JI6A 3BG5A 1LVKA 4M3GA 1G8XA 3COAC 2R4GA 2AXTC 3DPTA 1O57A 2NNYA 3LAPA 1OYYA 1U8RA 1JHFA 3BWGA 5E8GA 1MH3A 3KIOA 2ICWG 4DYQA 1K78A 2VN2A 1MBJA 3T5XA 2ZXHA 1YJ9I 2MBFA 2Y69H 1AWCA 1RNLA 3I5UA 2G7HA 3T8RA 2ELJA 3L00A 3BCBA 2X9DA 1JHHA 4PJNA 4KIBA 3E6DA 1WVRA 4JX4A 3DLLF 2DA7A 3FM3A 1NK2P 3CC7I 3Q0UA 3MCZA 2RVCA 5F04A 4NC6A 1GXPA 3RJPA 2F5DA 3HJEA 2AQFA 2CQKA 3FHZA 2F5CA 2LC2A 3DV8A 2DO7A 3IAM2 4BYYA 2NNNA 4LFUA 3K69A 1FSHA 3RKYA 1RIOH 5F6FA 3KP5A 3TW6A 2HPMA 3U1KA 3MFKA 2F4MB 2X6XA 1G59A 3HOUJ 1YX3A 2HFHA 4KISA 3GLLA 4IHSA 1U3EM 1D3YA 3DEWA 4ANJA 1QPMA 2R7FA 2Z2SB 1HSTA 3KZZA 1NH3A 2PN6A 4YIFA 1TT0A 5A2QZ 2WV0A 3K7AJ 2VQHA 2EFNA 1GDTA 3LFUA 2E2HJ 3S93A 3JAMZ 3J7ZI 2M0MA 1U9OA 1Z7UA 5CPRB 2Z5UA 2EV0A 3DWLE 4FTHA 3LSMA 1X1AA 1IJWC 3GZNB 5L3EA 3CP8A 1TNTA 3KP4A 4F3QA 3FKJA 3QP6A 3MMYB 1APLC 1WWXA 4IVNA 1JKQC 1POGA 2FF4A 2PMUA 3KYLA 2ETHA 4E70A 4O6JA 4CCNA 2IGNA 2XASA 2A05A 3GO5A 4FX4A 1G4DA 2VE8A 2F6CA 1D5YA 1GXQA 1IXCA 2D45A 4KMFA 1FYMA 3TO6A 4DIQA 2O61A 4LLNA 2DOEA 4L9TA 4W1UA 3WG7H 4U0VA 3OSGA 4NQWA 2WBMA 3RI4A 3JRIA 2O03A 3DBRB 2LF8A 3BC8A 2CH0A 2CW7A 3BR1A 1IAWA 3J7AY 4EATA 1K6YA 2HZTA 1F1ZA 5HS9A 2ZJRF 2JTVA 1ZG1A 3K9TA 3FMRA 2YX7A 2VT2A 1SMTA 2HKXA 1YTYA 1HLVA 2O6GE 2MH9A 1LUJB 4HNUA 4D1QA 4A3FJ 1R1TA 2RGVA 3DTKA 1SC7A 3RTRA 4XRMA 2FX0A 2HTJA 4TV7A 4YEJA 4S0HB 1OKRA 5BMZA 3GZ5A 4HRIA 2GWRA 5HNHA 1FP2A 2MSYA 4UV8A 2LF7A 2HQRA 2OF7A 2L5QA 2ZKZA 5DDGA 5DUIA 2VIXA 2RQQA 3PSIA 2DA2A 5H6RA 3TO9A 4AIHA 1ZRCA 2CS3A 2VQLA 3OWTA 5GADJ 4CO8A 2Y0MA 3FX3A 3V8KA 5KVRA 4MFDA 2JVHA 4HYEA 4MFEA 2ZFUA 1YS7A 1RUOA 5FKMA 3SZPA 3WE3A 2IGOA 4ITVA 3ZN0A 1PP8F 2VBZA 3LFKA 4L5JA 2C6YA 3NAUA 2LKPA 2B7EA 4IRGA 1LE8A 4GFBA 5IT9Z 3WTXC 2RAEA 1HQCA 3NEUA 2VC0A 2VKEA 2BY3A 4L0YB 1J75A 3WGHA 1ZLJA 3HM5A 1DU6A 4B8XA 2DA1A 4XRSG 2QA4I 3OYEA 2VPLA 3PUFA 5JFRA 2I8DA 1XTAA 2H09A 4FT8A 3CLOA 3G1LA 1QPIA 5D8LB 1UFMA 4WCGA 1X1PA 3DLAA 4Q4ZF 4A2UA 1TW3A 1AA7A 4UVCA 1BM9A 1AHDP 4CHUA 2MH2A 5IP9J 2DTZA 4DBRA 4U7BA 4PSWA 2G9WA 1Y56A 2WAQN 4MO7A 3SYTA 3K1NA 3WU2C 3A1YA 2EWNA 3AG4H 3HRSA 4PSXA 1ETVA 4B43A 1SD4A 1LDJA 2LMDA 3CCEI 2KZGA 4Q48A 1HW1A 3S2DJ 4BEHA 2E34A 4ZYGA 1BR1A 1BOAA 3OSFA 1JUPA 2A6HF 2JUGA 4X0GA 2L3DA 1MDMA 3ZGKA 3H3UA 2XPUA 3KX2A 3GCMA 3H5RA 5DM6F 2HVSA 4EEFG 4WX9A 1MNMC 3P9IA 2QBYA 2DA3A 5E3OA 2EILH 3LA2A 3R4KA 3CCMI 4LG0B 2KKOA 4GXOA 2HQAA 2RKHA 4A3DJ 4A3JJ 3TP3A 1QHGA 2GIVA 1YHQI 1XMXA 1PUFB 3DTEA 1AOYA 2V1DA 3MEXA 2AXLA 3TOAA 4B3AA 2XVCA 3IUOA 2MFZA 3GTGJ 1DP3A 1SEUA 4L5EA 1GV5A 4A0ZA 1TLHB 2MD5A 4HF2A 4I02A 3K4LA 2QEXI 2EIMH 4RS8A 4A0YA 4WK8F 4CYDA 1ZRDA 2W84A 2X6OA 3ZN1A 4BQAA 4B3XA 4QTRA 3GWZA 3W2AA 2BOLA 5HNFA 3E3VA 1GLNA 2VJ5A 2A68F 1TC3C 4J00A 4HDVA 1NK3P 3W6VA 1IXRC 1YIJI 5DEQA 2KIFA 3VOEA 1NG6A 2PMHA 2HKOA 5EZHA 3CMAI 4BGDA 2XROA 3ERED 2X48A 1J59A 2B0LA 5KCMA 4RGXA 1QA6A 4GCVA 3B6CA 1SFOJ 3FMQA 5FRNA 4YFXF 5GPCA 3S8PA 2R5YA 2Y9ZA 1USTA 4C30A 4Y13A 1O7FA 3PQJA 3UNGC 4DGWB 4FCYA 1FBUA 1MSEC 4IHWA 5AIQA 1NG7A 3SFIA 3U2RA 4NUBA 3V8JA 4B47A 2DJNA 3KZYA 3L7WA 3OIQA 4E7IA 3OY9A 2PBIA 5M3FJ 1ETWA 2ZMEA 1U6GA 4I7HA 5GAGJ 2KZVA 5F0FA 4JK1X 3JAMK 2VBXA 1IGNA 3HIFA 2JSCA 1XMAA 2ZSIB 2JPBA 1VQ7I 3TQNA 1XDSA 5GPAA 5TJJA 3SEQA 5E1ZB 1RR8C 4P1WA 2HYGD 2XAFA 1PJRA 3E5XA 2EH3A 2CWEA 3KEQA 3VYSB 1KYWA 4BAYA 3OYJA 4RAGA 1KGSA 2XAQA 1S3JA 4FETA 3RZDJ 1Z91A 5C4JJ 3IKVA 3S1RJ 5DM7F 3F8BA 4I99C 2M30A 4PJ0C 3KFWX 2IXSA 1YFHA 2R7TA 5HLIA 3M8EA 2LBFA 2Q2EB 3CQZJ 3WTWC 1Z05A 2DYRH 2PFBA 3ZOBA 2GXBA 3J7AO 2QF7A 3OYHA 2WB1A 5D6EA 3JTGA 3LSTA 1H9TA 3PNTA 4BDZA 3B73A 3SXYA 3FMSA 4A3IJ 5LGNA 2E1NA 1S7EA 1IN7A 3REOA 1U2WA 4R79A 5HOOA 5JR3A 4EGYA 2CFXA 1U5TA 1ZH5A 5EEGA 4CCKA 1Y6IA 4EVIA 4S04A 4F7ZA 2K86A 4EM2A 1D1BA 5DCFA 5E3LA 3HTUA 1LJ9A 4C2MJ 4IQJA 3GFLA 3OYCA 1XDUA 4FASD 1QVUA 3PL8A 1STZA 2HS5A
chains in the Genus database with same CATH topology
3BR2A 2PMZN 3QPSA 3JRFA 3HGYA 3BG3A 3BR5A 4LOCA 1MBGA 1ETKA 2JA8J 2LLKA 2P81A 2XB5A 5IP6A 4XICA 1IV6A 5F27A 1WCMJ 1RKTA 3LOCA 2XGEA 3A01B 3BTIA 2GBYA 4IHYA 2LD5A 2JA7J 4RDUA 2TCTA 1TWHJ 2MG4A 5EYRA 4C3JJ 2ELKA 3S17J 5M5WJ 2JA5J 2JJ7A 2ID3A 4A3EJ 1ZR4A 3OOUA 3ZQFA 4IHXA 2XGDA 3I4NJ 1FIAA 1R9TJ 2CU7A 4RBOA 3MKLA 1FJLA 2DA6A 1OFCX 3BTJA 2FQ4A 3H0GJ 2XSDC 2WB1N 3DCFA 2D5VA 2HXIA 1BA5A 3FISA 1WI3A 2YS9A 5EGOA 2GLOA 3BR6A 3C2BA 4D7MA 2H8RA 1ZTRA 3JRGA 2EZLA 1YRNA 2IEKA 4X1EA 1MBEA 2CUEA 1ZGWA 3I4MJ 1JUSA 1TWAJ 4AYBN 3Q3SA 5M5YJ 2R5ZA 1IDZA 1B72A 3HEFA 1MBFA 2LP0A 1ZQ3P 3BG9A 2VPRA 1GVDA 5IPAA 3HB9A 3GBGA 5IYCJ 2EBIA 4AC0A 4A3LJ 4CYCA 1ETYA 2ID6A 4Y7NJ 3LSPA 3MVPA 3OIOA 2DA5A 1U8BA 2FD5A 3S16J 3LNQA 3G1MA 4JYKA 1MBHA 2EQRA 1FEXA 5F08A 2LR8A 3WHBA 3E7LA 3FK7A 4M3EA 1F43A 1JT6A 3M4OJ 4DW6A 2CRGA 1IUFA 4A3BJ 3D1NI 1ENHA 2Y0SN 1AKHA 1EF4A 1Z0XA 4B1RA 3PO2J 2K9QA 1B8IA 3BG5A 1IDYA 4M3GA 1K61A 2CUFA 3JRAA 1MH3A 4DYQA 2K9NA 1MBJA 4FE4A 5K7ZA 1RR7A 5FJ8J 2JK3A 2YUSA 1OCTC 1XS9A 3K2AA 5JLWA 1JT0A 2X9DA 3TP0A 3JRCA 3FK6A 5FKLA 2HXOA 4JX4A 1O4XA 2DA7A 4QIWN 1NK2P 3O8GA 3Q0UA 5EEAA 4JX6A 5F04A 3A01A 2E2IJ 3UKGA 3BQYA 2COBA 1A6IA 3SJMA 5FLMJ 3GTLJ 2VUMJ 2MW8A 1FTTA 1QVTA 2LY9A 1Y1VJ 3HBLA 1X2NA 2HOAA 2KDZA 5F0CA 1JTXA 3QPLA 3TW6A 5GP9A 5J1YA 2NS7A 3HOXJ 5C44J 2LK2A 3HOUJ 3BTCA 3JRBA 2NS8A 3DEWA 2O9LA 1TWFJ 9ANTA 2I10A 1JGGA 1GUUA 1LFUP 3FKIJ 2L7ZA 3K7AJ 1GDTA 2E2HJ 2XB0X 5IOZA 4FISA 5IP7J 1X58A 4UUSB 2IBDA 1BW6A 1U9OA 1LE8B 1WGXA 4FTHA 3A02A 3A03A 1U78A 2HYJA 1IJWC 3ZQGA 3ZQLA 3HOZJ 3GTOJ 1UG2A 2M0CA 5M3MJ 2JN6A 2ZB9A 5HODA 1HF0A 1IG7A 1APLC 1JKQC 4B4CA 3CDLA 1POGA 2XPVA 2QCOA 2HOTA 4I76A 5F0HA 2JA6J 2HDDA 3CCYA 2JMWA 2H1KA 3GTMJ 1D5YA 1IRZA 3JRDA 3QQAA 5JLXA 5FLVA 4W1UA 2JWTA 2CQQA 4DZJA 3BQZA 3LSJA 2ECBA 3OSGA 1HCRA 3JRIA 2LTPA 4BKXA 1VF9A 2R92J 4DYCA 1E3OC 2DMNA 4M3BA 2Y9YA 4M3DA 5K7HA 4M6VA 3BR1A 3S1QJ 4UUTA 4A3MJ 4A3KJ 3BTLA 1UHSA 2FJ1A 2G0EA 1HLVA 2M9HA 4MLOA 1T56A 4JX5A 5IYBJ 4A3FJ 5C3EJ 5IOYA 4XRMA 4BBRJ 2FX0A 1RETA 1RPWA 3GTQJ 4S0HB 2WV1A 5FKNA 5J3LA 5DS9A 2L9RA 2MSYA 2Y31A 3LSGA 2OPTA 3JREA 1ETOA 2OF7A 4MIMA 4V2FA 3TW7A 3M3YJ 3PM1A 2DA2A 1GT0C 1ETQA 2O8KA 1BJZA 3HOYJ 4MFDA 4MFEA 5EDNA 5FKMA 2HI3A 4BBSJ 4UUSA 1ITYA 4V2GA 4BXXJ 3NAUA 1LE8A 4GFBA 2RAEA 1I50J 1RKWA 3H3VK 2VKEA 3HGGA 4BY7J 1P7IA 5K7FA 3HM5A 1DU6A 4XIDA 2DA1A 4XRSG 1CQTA 5EG0B 1WPKA 4ABZA 1SANA 1MSFC 3G1LA 1QPIA 1HDPA 3S14J 3HOVJ 1FTZA 1XG1A 3WHCA 3F0CA 2R5YB 3CMYA 1AHDP 2EZIA 5IP9J 2XPWA 1H89C 2DTZA 3JRHA 4I6ZA 2WAQN 4MO7A 2M8GX 1K83J 3S1NJ 3NARA 2LVSA 1ETVA 3S1MJ 1MH4A 2VI6A 1A5JA 1TWGJ 1VI0A 1JJ6C 4BY1J 4D5FA 2AO9A 4IEJA 3S2DJ 1JTYA 5EZGA 2HOSA 4DZPA 2L0KA 4C3IJ 2R0QC 3OSFA 4X6AJ 3LSRA 1JUPA 3JR9A 2R93J 1H8AC 1F36A 3IH4A 2NVTJ 1JKOC 1OJLA 2XPUA 2K40A 2NVXJ 1JKRC 4EEFG 1JUMA 1RESA 4A93J 2MGQA 1MNMC 2DA3A 5E3OA 1JKPC 3SDGA 4A3DJ 4NDLA 5E3NA 1OCPA 3TP3A 5E3MA 4A3JJ 3PO3J 2NOGA 1PUFB 1GV2A 4A3CJ 3L1PA 2LFBA 4B3AA 2N8GA 3GTGJ 1BW5A 1FIPA 2M34A 3ZQHA 2L7MP 1I3QJ 4L5EA 1GV5A 3VPRA 2ECCA 2EZHA 2ME6A 2B63J 3MN2A 2X6OA 4IHVA 3HKZN 4QTRA 1HOMA 5F1JA 2EZKA 3IV5A 1TC3C 1NK3P 1UMQA 3W6VA 1Q1VA 2R7ZJ 5EZHA 2IAIA 1DU0A 3S2HJ 3IH3A 2X48A 5EG0A 2XGCA 2CJJA 2K9SA 1AU7A 1SFOJ 3B6CA 2O7OA 4J19A 3O8HA 5FKOA 1NTCA 5GPCA 4M3FA 5M5XJ 2R5YA 2Y9ZA 4QSHA 1HDDC 1LFBA 1TWCJ 4FCYA 3Q0VA 4IHWA 1MSEC 1XC5A 3SFIA 2E2JJ 1VFCA 2DJNA 4A3GJ 2E19A 3ZQIA 3HDDA 3RZOJ 4JP0A 3RKQA 5M3FJ 1ETWA 2Y2ZA 5C4XJ 5F0FA 2DMQA 3RQIA 1IGNA 3G1OA 2DA4A 1ORKA 3FIWA 2TRTA 4XK4A 2ME0A 3BR3A 2HQ5A 1BL0A 5GPAA 2CQXA 1ZR2A 1Y1WJ 2GM4A 4HNVA 2M2EA 4G12A 2YU9J 2DMPA 1IC8A 3TEDA 2EH3A 3BT9A 4D7NA 2NVQJ 1I6HJ 4D5CA 1QRYA 3GTKJ 1H88C 3RZDJ 5C4JJ 3S1RJ 2DMTA 5EGOB 1PUFA 1MBKA 1YRNB 5DTDA 3CQZJ 5BNGA 5IYDJ 3ZOBA 5J1RA 4FE7A 2LKXA 3B6AA 2R5ZB 2QF7A 4C3HJ 2Y30A 4DYRA 1W0UA 1B72B 5FKKA 2E1OA 3S15J 4Y52J 1T33A 3ZQCA 1Z77A 2DMUA 2XRLA 2L7FP 4A3IJ 3GTJJ 2KT0A 2DN0A 4CYCB 1S7EA 3HOWJ 1G2HA 1P7JA 4W97A 4A69C 1U9NA 5J1UA 2W48A 1ZK8A 1X2MA 4XRSA 1VNDA 1WH7A 1ZKGA 1AKHB 3IH2A 1JJ8C 1B8IB 5E3LA 4AUXA 2VKVA 4C2MJ 1W0TA 1WH5A 2AHQA 3BR0A 1QVUA 5EF6A 2NVYJ 3Q0WA 3GTPJ 1ETXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR2 A;  2PMZ N;  3QPS A;  3JRF A;  3HGY A;  3BG3 A;  3BR5 A;  4LOC A;  1MBG A;  1ETK A;  2JA8 J;  2LLK A;  2P81 A;  2XB5 A;  5IP6 A;  4XIC A;  1IV6 A;  5F27 A;  1WCM J;  1RKT A;  3LOC A;  2XGE A;  3A01 B;  3BTI A;  2GBY A;  4IHY A;  2LD5 A;  2JA7 J;  4RDU A;  2TCT A;  1TWH J;  2MG4 A;  5EYR A;  4C3J J;  2ELK A;  3S17 J;  5M5W J;  2JA5 J;  2JJ7 A;  2ID3 A;  4A3E J;  1ZR4 A;  3OOU A;  3ZQF A;  4IHX A;  2XGD A;  3I4N J;  1FIA A;  1R9T J;  2CU7 A;  4RBO A;  3MKL A;  1FJL A;  2DA6 A;  1OFC X;  3BTJ A;  2FQ4 A;  3H0G J;  2XSD C;  2WB1 N;  3DCF A;  2D5V A;  2HXI A;  1BA5 A;  3FIS A;  1WI3 A;  2YS9 A;  5EGO A;  2GLO A;  3BR6 A;  3C2B A;  4D7M A;  2H8R A;  1ZTR A;  3JRG A;  2EZL A;  1YRN A;  2IEK A;  4X1E A;  1MBE A;  2CUE A;  1ZGW A;  3I4M J;  1JUS A;  1TWA J;  4AYB N;  3Q3S A;  5M5Y J;  2R5Z A;  1IDZ A;  1B72 A;  3HEF A;  1MBF A;  2LP0 A;  1ZQ3 P;  3BG9 A;  2VPR A;  1GVD A;  5IPA A;  3HB9 A;  3GBG A;  5IYC J;  2EBI A;  4AC0 A;  4A3L J;  4CYC A;  1ETY A;  2ID6 A;  4Y7N J;  3LSP A;  3MVP A;  3OIO A;  2DA5 A;  1U8B A;  2FD5 A;  3S16 J;  3LNQ A;  3G1M A;  4JYK A;  1MBH A;  2EQR A;  1FEX A;  5F08 A;  2LR8 A;  3WHB A;  3E7L A;  3FK7 A;  4M3E A;  1F43 A;  1JT6 A;  3M4O J;  4DW6 A;  2CRG A;  1IUF A;  4A3B J;  3D1N I;  1ENH A;  2Y0S N;  1AKH A;  1EF4 A;  1Z0X A;  4B1R A;  3PO2 J;  2K9Q A;  1B8I A;  3BG5 A;  1IDY A;  4M3G A;  1K61 A;  2CUF A;  3JRA A;  1MH3 A;  4DYQ A;  2K9N A;  1MBJ A;  4FE4 A;  5K7Z A;  1RR7 A;  5FJ8 J;  2JK3 A;  2YUS A;  1OCT C;  1XS9 A;  3K2A A;  5JLW A;  1JT0 A;  2X9D A;  3TP0 A;  3JRC A;  3FK6 A;  5FKL A;  2HXO A;  4JX4 A;  1O4X A;  2DA7 A;  4QIW N;  1NK2 P;  3O8G A;  3Q0U A;  5EEA A;  4JX6 A;  5F04 A;  3A01 A;  2E2I J;  3UKG A;  3BQY A;  2COB A;  1A6I A;  3SJM A;  5FLM J;  3GTL J;  2VUM J;  2MW8 A;  1FTT A;  1QVT A;  2LY9 A;  1Y1V J;  3HBL A;  1X2N A;  2HOA A;  2KDZ A;  5F0C A;  1JTX A;  3QPL A;  3TW6 A;  5GP9 A;  5J1Y A;  2NS7 A;  3HOX J;  5C44 J;  2LK2 A;  3HOU J;  3BTC A;  3JRB A;  2NS8 A;  3DEW A;  2O9L A;  1TWF J;  9ANT A;  2I10 A;  1JGG A;  1GUU A;  1LFU P;  3FKI J;  2L7Z A;  3K7A J;  1GDT A;  2E2H J;  2XB0 X;  5IOZ A;  4FIS A;  5IP7 J;  1X58 A;  4UUS B;  2IBD A;  1BW6 A;  1U9O A;  1LE8 B;  1WGX A;  4FTH A;  3A02 A;  3A03 A;  1U78 A;  2HYJ A;  1IJW C;  3ZQG A;  3ZQL A;  3HOZ J;  3GTO J;  1UG2 A;  2M0C A;  5M3M J;  2JN6 A;  2ZB9 A;  5HOD A;  1HF0 A;  1IG7 A;  1APL C;  1JKQ C;  4B4C A;  3CDL A;  1POG A;  2XPV A;  2QCO A;  2HOT A;  4I76 A;  5F0H A;  2JA6 J;  2HDD A;  3CCY A;  2JMW A;  2H1K A;  3GTM J;  1D5Y A;  1IRZ A;  3JRD A;  3QQA A;  5JLX A;  5FLV A;  4W1U A;  2JWT A;  2CQQ A;  4DZJ A;  3BQZ A;  3LSJ A;  2ECB A;  3OSG A;  1HCR A;  3JRI A;  2LTP A;  4BKX A;  1VF9 A;  2R92 J;  4DYC A;  1E3O C;  2DMN A;  4M3B A;  2Y9Y A;  4M3D A;  5K7H A;  4M6V A;  3BR1 A;  3S1Q J;  4UUT A;  4A3M J;  4A3K J;  3BTL A;  1UHS A;  2FJ1 A;  2G0E A;  1HLV A;  2M9H A;  4MLO A;  1T56 A;  4JX5 A;  5IYB J;  4A3F J;  5C3E J;  5IOY A;  4XRM A;  4BBR J;  2FX0 A;  1RET A;  1RPW A;  3GTQ J;  4S0H B;  2WV1 A;  5FKN A;  5J3L A;  5DS9 A;  2L9R A;  2MSY A;  2Y31 A;  3LSG A;  2OPT A;  3JRE A;  1ETO A;  2OF7 A;  4MIM A;  4V2F A;  3TW7 A;  3M3Y J;  3PM1 A;  2DA2 A;  1GT0 C;  1ETQ A;  2O8K A;  1BJZ A;  3HOY J;  4MFD A;  4MFE A;  5EDN A;  5FKM A;  2HI3 A;  4BBS J;  4UUS A;  1ITY A;  4V2G A;  4BXX J;  3NAU A;  1LE8 A;  4GFB A;  2RAE A;  1I50 J;  1RKW A;  3H3V K;  2VKE A;  3HGG A;  4BY7 J;  1P7I A;  5K7F A;  3HM5 A;  1DU6 A;  4XID A;  2DA1 A;  4XRS G;  1CQT A;  5EG0 B;  1WPK A;  4ABZ A;  1SAN A;  1MSF C;  3G1L A;  1QPI A;  1HDP A;  3S14 J;  3HOV J;  1FTZ A;  1XG1 A;  3WHC A;  3F0C A;  2R5Y B;  3CMY A;  1AHD P;  2EZI A;  5IP9 J;  2XPW A;  1H89 C;  2DTZ A;  3JRH A;  4I6Z A;  2WAQ N;  4MO7 A;  2M8G X;  1K83 J;  3S1N J;  3NAR A;  2LVS A;  1ETV A;  3S1M J;  1MH4 A;  2VI6 A;  1A5J A;  1TWG J;  1VI0 A;  1JJ6 C;  4BY1 J;  4D5F A;  2AO9 A;  4IEJ A;  3S2D J;  1JTY A;  5EZG A;  2HOS A;  4DZP A;  2L0K A;  4C3I J;  2R0Q C;  3OSF A;  4X6A J;  3LSR A;  1JUP A;  3JR9 A;  2R93 J;  1H8A C;  1F36 A;  3IH4 A;  2NVT J;  1JKO C;  1OJL A;  2XPU A;  2K40 A;  2NVX J;  1JKR C;  4EEF G;  1JUM A;  1RES A;  4A93 J;  2MGQ A;  1MNM C;  2DA3 A;  5E3O A;  1JKP C;  3SDG A;  4A3D J;  4NDL A;  5E3N A;  1OCP A;  3TP3 A;  5E3M A;  4A3J J;  3PO3 J;  2NOG A;  1PUF B;  1GV2 A;  4A3C J;  3L1P A;  2LFB A;  4B3A A;  2N8G A;  3GTG J;  1BW5 A;  1FIP A;  2M34 A;  3ZQH A;  2L7M P;  1I3Q J;  4L5E A;  1GV5 A;  3VPR A;  2ECC A;  2EZH A;  2ME6 A;  2B63 J;  3MN2 A;  2X6O A;  4IHV A;  3HKZ N;  4QTR A;  1HOM A;  5F1J A;  2EZK A;  3IV5 A;  1TC3 C;  1NK3 P;  1UMQ A;  3W6V A;  1Q1V A;  2R7Z J;  5EZH A;  2IAI A;  1DU0 A;  3S2H J;  3IH3 A;  2X48 A;  5EG0 A;  2XGC A;  2CJJ A;  2K9S A;  1AU7 A;  1SFO J;  3B6C A;  2O7O A;  4J19 A;  3O8H A;  5FKO A;  1NTC A;  5GPC A;  4M3F A;  5M5X J;  2R5Y A;  2Y9Z A;  4QSH A;  1HDD C;  1LFB A;  1TWC J;  4FCY A;  3Q0V A;  4IHW A;  1MSE C;  1XC5 A;  3SFI A;  2E2J J;  1VFC A;  2DJN A;  4A3G J;  2E19 A;  3ZQI A;  3HDD A;  3RZO J;  4JP0 A;  3RKQ A;  5M3F J;  1ETW A;  2Y2Z A;  5C4X J;  5F0F A;  2DMQ A;  3RQI A;  1IGN A;  3G1O A;  2DA4 A;  1ORK A;  3FIW A;  2TRT A;  4XK4 A;  2ME0 A;  3BR3 A;  2HQ5 A;  1BL0 A;  5GPA A;  2CQX A;  1ZR2 A;  1Y1W J;  2GM4 A;  4HNV A;  2M2E A;  4G12 A;  2YU9 J;  2DMP A;  1IC8 A;  3TED A;  2EH3 A;  3BT9 A;  4D7N A;  2NVQ J;  1I6H J;  4D5C A;  1QRY A;  3GTK J;  1H88 C;  3RZD J;  5C4J J;  3S1R J;  2DMT A;  5EGO B;  1PUF A;  1MBK A;  1YRN B;  5DTD A;  3CQZ J;  5BNG A;  5IYD J;  3ZOB A;  5J1R A;  4FE7 A;  2LKX A;  3B6A A;  2R5Z B;  2QF7 A;  4C3H J;  2Y30 A;  4DYR A;  1W0U A;  1B72 B;  5FKK A;  2E1O A;  3S15 J;  4Y52 J;  1T33 A;  3ZQC A;  1Z77 A;  2DMU A;  2XRL A;  2L7F P;  4A3I J;  3GTJ J;  2KT0 A;  2DN0 A;  4CYC B;  1S7E A;  3HOW J;  1G2H A;  1P7J A;  4W97 A;  4A69 C;  1U9N A;  5J1U A;  2W48 A;  1ZK8 A;  1X2M A;  4XRS A;  1VND A;  1WH7 A;  1ZKG A;  1AKH B;  3IH2 A;  1JJ8 C;  1B8I B;  5E3L A;  4AUX A;  2VKV A;  4C2M J;  1W0T A;  1WH5 A;  2AHQ A;  3BR0 A;  1QVU A;  5EF6 A;  2NVY J;  3Q0W A;  3GTP J;  1ETX A; 
#chains in the Genus database with same CATH topology
 3BR2 A;  2PMZ N;  4ZYA A;  4BE0 A;  4Z2Y A;  3BR5 A;  5FD6 A;  3FF5 A;  2CV1 A;  1ETK A;  2EIJ H;  1XGO A;  3J81 K;  4ZDO A;  2XB5 A;  1SVO A;  4OAY A;  3LOC A;  3DPU A;  2XGE A;  4IHY A;  5EJC A;  1IN4 A;  2W57 A;  2ELH A;  3U1D A;  3EUK L;  2P5L C;  3S17 J;  5M5W J;  1OCC H;  2ID3 A;  2WAE A;  3OOU A;  3CUQ B;  3HRU A;  3I4N J;  4YFN F;  3PFY A;  1R9T J;  3MKL A;  4QPO A;  2K3P A;  3H5A A;  3SDB A;  2DA6 A;  3J7Y J;  1VZ0 A;  2K3F A;  2WB1 N;  3KP6 A;  3GYH X;  3L2Q A;  3RKX A;  4YIR X;  4IF4 A;  3ROU A;  3EQL F;  1YI2 I;  1BIA A;  1WI3 A;  3MD2 A;  3S32 A;  2CUJ A;  2YS9 A;  4A5N A;  5KAI C;  3WTT C;  1F9N A;  5FB2 A;  2GXG A;  2PJP A;  1ZGJ A;  1KU2 A;  2IEK A;  1WSU A;  4G7Z F;  1KU7 A;  3I3L A;  1WJA A;  3LL7 A;  1JUS A;  1TWA J;  4AYB N;  1PP7 U;  3Q3S A;  1YW8 A;  2KL4 A;  1BC7 C;  1B72 A;  1IXS B;  2HGC A;  2VPR A;  4MQV A;  2O0Y A;  1S8N A;  2AQE A;  2LKS A;  1YIO A;  2ISZ A;  4A3L J;  1ETY A;  2B9S A;  5D8K B;  4Y7N J;  3LSP A;  1U8B A;  5DD8 A;  4JYK A;  1K7A A;  1YO5 C;  1FEX A;  3GLX A;  3F8F A;  4UHT A;  3BP8 A;  4N4O B;  4OIO F;  2YX4 A;  1LPQ A;  1XSX A;  2R7R A;  2OTJ I;  4IOC F;  2Q8K A;  4RM3 A;  3M4O J;  2VLA A;  2F4I A;  3D1N I;  1IF1 A;  1FX7 A;  5ICF A;  2CFO A;  1Z0X A;  2JRT A;  3LSH A;  3CDH A;  3TDU C;  1K61 A;  5HLG A;  3FDY A;  2RC4 A;  2DBB A;  4ZJZ A;  1ZLK A;  2EFW A;  2BVM A;  2XSJ C;  5IY5 H;  2ZNY A;  4KYW A;  4EJW A;  2K9N A;  5J8F A;  4IX7 A;  2ZXJ A;  1KU9 A;  3V42 A;  2GOM A;  1RR7 A;  4RGS A;  2QGU A;  2RV8 A;  3TDZ C;  1OCT C;  3ZR8 X;  3K2A A;  2WAF A;  4BE1 A;  3F22 A;  4FQG A;  1R22 A;  1KU3 A;  4QIW N;  5HS8 A;  3A01 A;  3L2R A;  3ONQ A;  2COB A;  5CVU A;  3SJM A;  1I5Z A;  3G2B A;  5FLM J;  3GUD A;  2QEN A;  3GTL J;  1IUY A;  2VUM J;  2CSO A;  3QOD A;  2FU4 A;  3WTU C;  2LY9 A;  4G6D A;  2Z16 A;  1PDN C;  3HBL A;  2ESH A;  5ILU A;  2Z33 A;  2IS2 A;  2HOA A;  3HPH A;  4BJ6 C;  1R00 A;  2LNB A;  4KJZ A;  3V8L A;  3OYK A;  1I1G A;  4JBA A;  1UJ8 A;  1JGS A;  5J1Y A;  5L3G A;  2NS7 A;  4BHC A;  3HOX J;  5E79 C;  2YR2 A;  2LK2 A;  4RM2 A;  3JRB A;  4UVA A;  2KHM A;  2V6E A;  2O9L A;  4OIR F;  2VC1 A;  1TWF J;  4CXF A;  2EIN H;  2ADU A;  1S7O A;  1W5S A;  1X1C A;  1XMK A;  1F5T A;  1G3W A;  5IOZ A;  4FIS A;  2H6C A;  3L2U A;  4HSR A;  2R3S A;  3SZG A;  1X58 A;  4C9Y A;  1V3F A;  4I0A A;  5LEK A;  5K1Y A;  1SAU A;  1G3Y A;  1ZGA A;  3A02 A;  4H0E A;  1V4R A;  2FSW A;  2OJE D;  1X3U A;  2L9V A;  3W2V A;  1UG2 A;  1RRJ A;  2M0C A;  5M3M J;  1R36 A;  1IG7 A;  4ZDL A;  1HF0 A;  4KDP A;  4GYG A;  3GZ6 A;  3TMO A;  2HOT A;  4B4C A;  3CDL A;  2XPV A;  3K0L A;  4AU7 A;  1Y0N A;  4I76 A;  4HOB A;  5F0H A;  3T0Y A;  4I2O A;  3M9A A;  2HDD A;  2UXN A;  3CCY A;  2KRH A;  3PIO F;  4AIK A;  1XB4 A;  2F4O B;  1IV8 A;  2H1K A;  1VQ8 I;  3FM5 A;  3GTM J;  1IRZ A;  2MAB A;  2ZJP F;  1FBS A;  3QQA A;  5JLX A;  3S3M A;  2NVU B;  2HOE A;  3MZY A;  2M4G A;  3R0J A;  1D0X A;  4BNC A;  3CUQ C;  2XC7 A;  1HCR A;  3ESW B;  1Q1H A;  4UUV A;  1U5T C;  1P2F A;  2VQC A;  4G8X A;  5JVG F;  3OS0 A;  3OR1 C;  4M3D A;  5K7H A;  2E1C A;  4RMN A;  5HVQ C;  3FXO A;  1FOK A;  3CCR I;  3BTL A;  3CLQ A;  1XN7 A;  2VJJ A;  1IRX A;  1T6S A;  4II3 A;  4OMZ A;  3K1P A;  1A04 A;  5LRR A;  5IYB J;  5JHF A;  4ZTF A;  1QU3 A;  3ZXS A;  2V26 A;  3MKZ A;  1JI8 A;  2EV6 A;  3HHG A;  1SAX A;  4PGG A;  5B1B H;  1RPW A;  2YPR A;  3QYB A;  4DBQ A;  2VE9 A;  1LQ1 A;  3PSF A;  2DPD A;  4BXF A;  2M1B A;  5FKN A;  5K5R A;  3FWE A;  4XNF A;  1E17 A;  2OTL I;  4MTD A;  2Y31 A;  5B3S H;  3HSE A;  1ETO A;  3TW7 A;  3T8T A;  1ODD A;  3PM1 A;  5LHH A;  4E7J A;  4UB6 C;  4OU0 A;  1J09 A;  5CLS A;  1SMY F;  1YX5 A;  2GQQ A;  2XV4 S;  1FYL A;  2O8K A;  1VQN I;  2JQ7 A;  2P4W A;  2FBH A;  1KQ9 A;  3WOD F;  3C1D A;  3JSP A;  2HI3 A;  3FBN B;  5ICG A;  4V2G A;  2JUC A;  1CGP A;  4BXX J;  3CJR B;  1D5V A;  4ASN A;  1SD5 A;  3K10 A;  4BAC A;  1I50 J;  3EYY A;  1RKW A;  3H3V K;  3KCC A;  1MKM A;  3HGG A;  4BY7 J;  1DDN A;  2QQ9 A;  5K7F A;  3H92 A;  1CQT A;  5EG0 B;  1WPK A;  3VDX A;  4ABZ A;  5ICE A;  3DU5 A;  1SAN A;  4EQQ A;  4BQO A;  2OZ6 A;  4M9Z A;  4F93 B;  4BU2 A;  3CO6 C;  5JHU A;  1XG1 A;  3JSO A;  2ZFW A;  3F8C A;  1Z1D A;  3GFI A;  4O3M A;  1UHM A;  2XPW A;  2L4A A;  5D5V B;  5GTH C;  4I6Z A;  3MWM A;  2DOA A;  4DNC A;  3BZC A;  1ZRE A;  5E1W A;  4Q5S F;  3K70 D;  4I0B A;  1U0J A;  3FXQ A;  3S1M J;  5KK1 A;  5KAF C;  4FHT A;  2VXZ A;  3DXJ F;  1DGR M;  2AO9 A;  4IEJ A;  1YYV A;  1JTY A;  2H27 A;  3H5N A;  2L0K A;  5H6Q A;  4NHJ A;  5DCM B;  2OZU A;  1ZAR A;  2OA4 A;  2V9P A;  4F92 B;  1N25 A;  2DOF A;  4IKF A;  1TQM A;  3G4S I;  1W7P D;  4EV0 A;  2P5V A;  5B5E C;  4RGU A;  1JKP C;  3HZJ A;  2ISY A;  2PX9 A;  2M5W A;  1P9Q C;  2KJC A;  4PJJ A;  3GF2 A;  1C0W A;  4CCJ A;  3VYT B;  2NOG A;  1QO0 D;  4UNO A;  4A3C J;  2PLY A;  3L1P A;  1R6R A;  3OMY A;  1PYV A;  3CZ6 A;  5CVJ A;  4HA8 A;  1FIP A;  4YFK F;  1XGN A;  1Y0U A;  2DQL A;  2L7M P;  4RGR A;  2IJL A;  2ECC A;  2EZH A;  2L4M A;  1BI0 A;  1D8K A;  4MHG A;  4G94 A;  3L2C A;  5FGM A;  3CDI A;  3HYI A;  4CUG A;  5F1J A;  2ZO4 A;  4OAZ A;  5CVI A;  2EZK A;  3RYR A;  2HVQ A;  5H2F C;  1SFU A;  1Q1V A;  4EJT A;  1K6O A;  1T39 A;  2WAQ A;  4N9H A;  2IAI A;  5FFX A;  1DU0 A;  2EA2 A;  3IH3 A;  3S2H J;  2GA1 A;  2E35 A;  2H1L A;  2XGC A;  4BXU A;  4ZZL A;  3FXR A;  4CCO A;  5J47 A;  4IPA A;  5LHI A;  5K5O A;  1BJA A;  1AU7 A;  5FKO A;  4LIT A;  4CGZ A;  4IQ4 A;  1ZG5 A;  4G7H F;  5M5X J;  2DFH A;  3H9Q A;  2IS1 A;  1FOY A;  1TWC J;  2P6S A;  4O5V A;  2W24 A;  2FQ3 A;  1VFC A;  3AFH A;  2OD5 A;  3QOE A;  1WJ5 A;  4A3G J;  2E19 A;  4D0P A;  3HDD A;  4Y4R A;  2E1M C;  3BCA A;  2BEO A;  1DPU A;  2FML A;  3BJO A;  5B1A H;  4KFC A;  1D0Z A;  2DMQ A;  2KLO A;  3RQI A;  5JVT A;  3FIW A;  2DTR A;  2R7V A;  4LLL A;  4XK4 A;  1V5G A;  5J4Y A;  2ME0 A;  2KP6 A;  3GFJ A;  2HQ5 A;  3F8M A;  1ZR2 A;  2P6T A;  3I9V 2;  2RRE A;  4XLA A;  2X4H A;  2ZSH B;  2M2E A;  3HC7 A;  4HNV A;  3J81 Z;  3WGI A;  1LB2 A;  3CCQ I;  3CCL I;  4LIV A;  1HKQ A;  3TED A;  4LB5 A;  4S05 A;  3FXU A;  4L18 B;  2IGK A;  4XSX F;  3S2W A;  3ZP5 A;  2NVQ J;  3GTK J;  1QRY A;  2EK5 A;  2ZJ2 A;  4LG0 A;  3RYP A;  2BBY A;  3W2W A;  2E7X A;  2IA0 A;  5EGO B;  1PUF A;  3OIP A;  3EDP A;  5H20 A;  3X2Q H;  1K4T A;  1QBJ A;  5AIP A;  4A6E A;  3CO7 C;  2LKX A;  4XBF A;  5GTI C;  3KLN A;  4LJZ F;  2BVL A;  1IRF A;  1W1W E;  3ZQC A;  1Z77 A;  2GXA A;  5BS6 A;  2KT0 A;  1GVJ A;  2TDX A;  2K85 A;  3F21 A;  3QRF F;  4PK4 A;  2XF7 A;  3D0S A;  5LFA A;  3RPU D;  3SQN A;  3DF8 A;  2MLK A;  3E97 A;  4WXC A;  1U9N A;  1ZAO A;  2K9L A;  3GW2 A;  4ENN A;  2MD0 A;  3TKY A;  2ZNZ A;  4CSW A;  1VND A;  2MC3 A;  2LY1 A;  3IH2 A;  3OYN A;  2BHY A;  4KN4 X;  1OR7 A;  1XGS A;  2X1D A;  1ON2 A;  1ZN2 A;  1QZE A;  1V5F A;  3F6V A;  3U9G A;  1J0R A;  1ETX A;  1IZ1 A;  4GDF A;  3ABU A;  1YE9 A;  1MBG A;  2ZBK A;  2JA8 J;  1P6R A;  1MJ9 A;  1PVE A;  3G73 A;  1FWZ A;  1WCM J;  2EPF A;  3PJR A;  2DU9 A;  2TCT A;  3GEZ A;  2MG4 A;  5EYR A;  2ELK A;  3M1E A;  2JJ7 A;  2KIS A;  4LB6 B;  1ZR4 A;  3ASN H;  3ZQF A;  1FOX A;  3QPT A;  2IP2 A;  4GYI A;  5F1R A;  3FXK A;  1D8J A;  4LD5 A;  4KNY A;  4L9J A;  2FE3 A;  1OFC X;  2RQP A;  1FP1 D;  1ZYR F;  3CC4 I;  2XSD C;  2DQR A;  2ESN A;  2QQA A;  2Q1Z B;  2HXI A;  4ZC3 A;  4DOZ A;  4V19 K;  1SFK A;  3WE2 A;  2HPI A;  4HZF A;  1DUX C;  5E18 F;  2KIM A;  3PUB A;  3BDD A;  4RLF A;  1FY7 A;  5L3C A;  4F52 A;  4AWX B;  2EZL A;  1MZB A;  1MBE A;  2Q2E A;  1OMI A;  1R4N B;  1BR2 A;  2QSF X;  2RDP A;  1IDZ A;  4ZDP A;  2Z9O A;  3HEF A;  1W7P B;  1ZQ3 P;  3BG9 A;  2O5R A;  1MNE A;  2WAD A;  5IPA A;  4MEY F;  3K2Z A;  4L9V A;  3I58 A;  5FD5 A;  4AC0 A;  3K1M A;  1SVL A;  1UG0 A;  1ULY A;  1WJD A;  3CD6 I;  3DQV C;  3N05 A;  4XLN F;  3S16 J;  3LNQ A;  3G1M A;  4WXH A;  1MBH A;  2FOK A;  4CDG A;  3DPL C;  4U0Y A;  2DT5 A;  2STT A;  2X1E A;  4XLP F;  1F43 A;  2PMZ A;  1X4O A;  5E1X A;  3PQK A;  2FEZ A;  4CIC A;  2CRG A;  1IUF A;  4A3B J;  1VQL I;  1ENH A;  2Y0S N;  3E0J B;  1EF4 A;  4A12 A;  2X1C A;  1YOV B;  2EFP A;  3PO2 J;  2ZXW H;  1IDY A;  1IO2 A;  4U88 A;  2GA2 A;  4YII A;  2CUF A;  3ZRG A;  2HU9 A;  5HS7 A;  1R7J A;  2K4B A;  1WJB A;  1HSJ A;  2FBK A;  3CMM A;  5HLH A;  5K7Z A;  1TT5 B;  3BRO A;  5AON A;  4ESB A;  4B44 A;  1XS9 A;  2KIU A;  5JLW A;  1OYW A;  3TP0 A;  3ABM H;  3CTA A;  5FKL A;  2HXO A;  4HX8 A;  4R1H A;  4XOT A;  2F48 A;  1O4X A;  3O8G A;  1FYK A;  2CUZ A;  4JX6 A;  3I64 A;  2DOD A;  2E2I J;  2FBI A;  4KUM A;  4C2U A;  4M6Y A;  1HW5 A;  1E0E A;  1UHW A;  3NRV A;  1QGP A;  4WXD A;  2X51 A;  2KJB A;  1MJA A;  4HX7 A;  3CUQ A;  2A5W A;  2MW8 A;  3ZMV A;  4AYB A;  1MND A;  3TGN A;  4IO9 F;  1FTT A;  5BPI A;  1Y1V J;  1X2N A;  1BI2 A;  2KDZ A;  4G6T B;  5F0C A;  1JTX A;  2XAH A;  2DXI A;  3QPL A;  5GP9 A;  3R61 A;  3L9F A;  3OYG A;  1ZHF A;  2NYX A;  3KP7 A;  2HDC A;  3BTC A;  1XCV A;  2A6E F;  1FNN A;  1Z6R A;  1ZRF A;  1MW7 A;  1YS6 A;  1Z6T A;  2I10 A;  4DJA A;  4HEA 2;  1GUU A;  2A61 A;  1MMD A;  1LFU P;  4XON A;  3KP2 A;  3C3W A;  3FKI J;  3WG9 A;  2L7Z A;  2XB0 X;  1I3A A;  3FZV A;  2NAZ A;  5B66 C;  4UUS B;  2EIK H;  1BW6 A;  3H1C A;  2KFD A;  4HV6 A;  3I56 I;  3WTS C;  2PI0 A;  1N77 A;  3GME A;  2CGP A;  1UCR A;  4AVP A;  1FZP B;  2V1N A;  1HA8 A;  3ZQG A;  3HOZ J;  1ACI A;  1H0M A;  2JN6 A;  2ZB9 A;  4E4H A;  4WF2 A;  5HOD A;  4ZTJ A;  5J6X A;  4AID A;  4AM3 A;  1FOW A;  4A0X A;  2CW0 F;  2OC6 A;  2JA6 J;  4C2T A;  3V4G A;  1HC8 A;  4HG2 A;  2JMW A;  4E7K A;  3F23 A;  2V7F A;  2R7W A;  3S3O A;  3JRD A;  2XUB A;  5FLV A;  2JWT A;  2CQQ A;  2VOD A;  3N97 A;  2ECB A;  4I09 A;  2LTP A;  4BKX A;  1J7K A;  4HLY A;  3MAJ A;  1VF9 A;  4DYC A;  2HQN A;  3P5J A;  1E3O C;  4M3B A;  4PFP A;  3TO7 A;  2BXY A;  4G7O F;  2G7U A;  4UUT A;  3FBI B;  4AIJ A;  4A3K J;  1UHS A;  1N78 A;  2FJ1 A;  3GVA A;  3VWB A;  5FLX K;  4GGG A;  2IGM A;  2M9H A;  1T0F C;  3EUH C;  1T56 A;  1EH7 A;  1OR7 C;  5CJ9 A;  3Q9S A;  2HNH A;  1DPR A;  4JX5 A;  3CJQ B;  2L54 A;  3DKX A;  4BBR J;  1KQ8 A;  2E60 A;  3DEU A;  1O3S A;  4PCQ A;  4RB2 C;  2QKL B;  4Y33 A;  2Y48 A;  2WV1 A;  1X3Z B;  1D1A A;  2ZC2 A;  2OAZ A;  3E6C C;  4N0B A;  2COM A;  1WHU A;  3TOB A;  1FSE A;  1G3T A;  3LSG A;  2OPT A;  3JRE A;  1J9I A;  4MIM A;  3K4C A;  4HAM A;  4CZZ A;  1GT0 C;  2J5O A;  1BC8 C;  1BR4 A;  2P7C B;  1E3H A;  3FHN A;  1ETQ A;  3J80 K;  3G6E I;  1BJZ A;  3I59 A;  4KA4 A;  1R58 A;  1QZY A;  3IC7 A;  2Z1D A;  2JRM A;  3BJA A;  4E7L A;  1O3T A;  3VSL A;  3CF5 F;  4E7Z A;  1VQM I;  4KIC A;  4EMS A;  1P7I A;  2GIZ A;  1G6N A;  3MQ0 A;  4XID A;  2PJR B;  4LG3 A;  3HPG A;  3HKZ A;  4KIT B;  3RIR A;  4XOR A;  3EET A;  2IPQ X;  1MSF C;  2XF5 A;  1HDP A;  1YLF A;  4PJM A;  4ESF A;  3HOV J;  2IT0 A;  3S14 J;  1EKE A;  1SD7 A;  5LGT A;  1FTZ A;  1GHC A;  3F0C A;  3JW4 A;  1V55 H;  2PG4 A;  3CMY A;  2BXZ A;  2NXN B;  2DLL A;  2EZI A;  2OQG A;  1H89 C;  2BZT A;  4F55 A;  5FRM A;  2K4J A;  4HV5 A;  3OL3 A;  5D5X B;  1E3P A;  3SFZ A;  2DPU A;  3O3K A;  4E7H A;  3MZ8 A;  4A5M A;  2V9K A;  1IRG A;  1IW7 F;  2DJI A;  2FMY A;  3BOQ A;  4MQ9 F;  4BJT A;  4GRI A;  1A5J A;  1JJ6 C;  4BY1 J;  4D5F A;  4M71 A;  5EZG A;  4BL0 B;  2HOS A;  1Z67 A;  4DZP A;  3I59 B;  3K4B A;  4C3I J;  3T1B A;  5J40 A;  3LSR A;  1OLT A;  3JR9 A;  3OYD A;  3KYD B;  2R93 J;  1H8A C;  4N9I A;  3IH4 A;  4IZZ A;  2NVX J;  3H35 A;  1JUM A;  2W00 A;  2K9M A;  1KON A;  4A93 J;  2MGQ A;  2M87 A;  1J2X A;  1BI3 A;  5CQG A;  3D5S C;  4NDL A;  5E3N A;  4RLQ A;  1QZZ A;  5E3M A;  3OYL A;  3PO3 J;  1EV7 A;  2DDB A;  1GV2 A;  1MIJ A;  3C7J A;  2LFB A;  2CQ7 A;  2H6B A;  2K27 A;  3AL0 B;  3V7S A;  4BH9 A;  2LH9 A;  5FO5 A;  2B63 J;  4PDK A;  4Y15 A;  3HKZ N;  3F72 A;  1B9N A;  1Z3X A;  3DKW A;  4IRI A;  2Z99 A;  2GOX B;  5E20 A;  1UEL B;  1YW7 A;  1QNT A;  3HTS B;  1TBX A;  2BV6 A;  3IL2 A;  2XKP A;  1L3L A;  3CME I;  4HNT A;  5HDN A;  5ED4 A;  2H8W A;  3ZMU A;  1O3Q A;  2L02 A;  2HZD A;  3A0B C;  4Q47 A;  1YW9 A;  5EG0 A;  5BQT A;  3ML6 A;  5CKT A;  2K9S A;  3E6B A;  2XKO A;  2LRE A;  2DK5 A;  4Y17 A;  5F64 A;  2UZK A;  1S72 I;  2OQR A;  1NTC A;  4MEX F;  1YJN I;  4L9N A;  4HX4 A;  1RUN A;  4M3F A;  3L2W A;  2WA0 A;  1HDD C;  3HSF A;  2M7A A;  4P9F A;  2X0L A;  4BQN A;  3K4N A;  1CF7 B;  3Q0V A;  2ZXI A;  3H9J A;  2UWM A;  4AVZ A;  2JPC A;  2E2J J;  2XGX A;  3LQR A;  1MMG A;  1ZEL A;  4MNU A;  4UY8 I;  4U7D A;  4CCL A;  3RKQ A;  3M8J A;  2ZCW A;  2VON A;  5C4X J;  5L3B A;  1D1C A;  5KHD A;  4G9Y A;  4ESJ A;  2DA4 A;  2DT7 B;  1I39 A;  2QUF A;  4XKC A;  4HQE A;  4U87 A;  5DCM A;  6PAX A;  2HTS A;  3IHU A;  3BJ6 A;  3HUG B;  4LLG F;  5LLQ A;  3TL4 X;  1IC8 A;  3QU6 A;  2IA2 A;  2UV1 A;  4IXA A;  4D7N A;  2QLZ A;  4P9U A;  4EJU A;  4D5C A;  4IHT A;  1I6H J;  1WI9 A;  1KQ0 A;  1VQO I;  1HBX G;  5DUK A;  3ABL H;  2CW8 A;  4CZC A;  3AG2 H;  2DMT A;  2CQN A;  1WZ2 A;  2IA1 A;  2J5P A;  1MMS A;  3BPV A;  3LAJ A;  1R49 A;  1IN6 A;  1YRN B;  1QHH D;  2P8T A;  2EFQ A;  5D5U B;  4P55 A;  1HXD A;  2HYF A;  5BNG A;  1B9M A;  2QQB A;  3VEP A;  5J1R A;  1R1U A;  3VYR B;  3B6A A;  1SD6 A;  3O2P E;  2R5Z B;  2DAO A;  2MLG A;  3M1C A;  5CQE A;  4B09 A;  3QYE A;  2VOO A;  2M4K A;  3O6B B;  5FKK A;  2CV2 A;  1A35 A;  3S15 J;  2E7W A;  1T33 A;  1ZG3 A;  1S9H A;  2DMU A;  2X85 A;  4HST A;  1LEB A;  2FUG 2;  2DN0 A;  2FOW A;  3D5L A;  5BOX A;  3WTY C;  4CYC B;  1OIS A;  3OS2 A;  2AS5 F;  1P7J A;  1OPC A;  1X1D A;  5J1U A;  4KT5 C;  2W48 A;  3I53 A;  3W3C A;  1ZK8 A;  1VQP I;  2VL8 A;  5E17 F;  2VJI A;  3L2V A;  3L09 A;  3BY6 A;  1UZC A;  4ZYD A;  3SHF A;  2BW3 B;  4E7S A;  3DTI A;  2JT1 A;  1IN8 A;  1ZKG A;  1AKH B;  4UB8 C;  1JJ8 C;  2R7Q A;  1B8I B;  3IP4 B;  3DP7 A;  3QAH A;  1LKX A;  4KN7 X;  1EA3 A;  2L7K A;  2NOJ B;  2AHQ A;  1K78 B;  2OCC H;  1USS A;  2E71 A;  3QPS A;  1PUE E;  3HGY A;  2IVM A;  4M6X A;  1I6X A;  3QYF A;  2BY1 A;  2VB6 A;  1B4A A;  2LLK A;  4QPQ A;  2CMP A;  2HR3 A;  4BDY A;  2QSG X;  2W85 A;  3I54 A;  2M45 A;  5IP6 A;  4XIC A;  1IV6 A;  2JVG A;  2OCE A;  4HQM A;  3BG6 A;  3OYF A;  1EH6 A;  3BTI A;  2DFI A;  2LD5 A;  4RDU A;  1WKM A;  4XLF A;  1BBY A;  4C3J J;  3AL0 C;  3ZMT A;  4A3E J;  1ON1 A;  2VJ4 A;  3NQO A;  4IHX A;  1FIA A;  1TQI A;  2CU7 A;  1FJL A;  2LY2 A;  3BTJ A;  5DD4 A;  2FQ4 A;  3FXJ A;  2KRF A;  3H0G J;  4PFO A;  2KIQ A;  3ZQ7 A;  3ZMD A;  2D5V A;  3DBL B;  1BA5 A;  3FIS A;  3Q5F A;  5EGO A;  3JCU C;  2LRD A;  2GLO A;  3BR6 A;  1R4M B;  3C2B A;  2H8R A;  2DCE A;  2OUM A;  1R5G A;  3JRG A;  5GAH J;  4ENK A;  1ZGW A;  1W36 D;  3KPH A;  5TRD A;  4RB0 A;  4KMU X;  3LMM A;  2UUZ A;  1Y8R B;  2LP0 A;  4YEL A;  1R5H A;  3GTP J;  3DFG A;  3R6S A;  3A4C A;  3EYI A;  1Y8Q B;  3GBG A;  5IYC J;  2E5N A;  1OCZ H;  3E5U A;  3ABK H;  2XHK A;  2E36 A;  2ID6 A;  1R71 A;  1VQ9 I;  2FD5 A;  3GXO A;  1OCR H;  1BIB A;  1S7A A;  2LR8 A;  1Z7L A;  3QU3 A;  1LDK B;  1JE8 A;  1R1V A;  2P7V B;  3BPX A;  1JT6 A;  3GX4 X;  1L0O C;  3H3Z A;  4E6K G;  4HF1 A;  2UXX A;  4OIN F;  2KMU A;  5LEJ A;  4XKV A;  4ON0 A;  2WWY A;  2XAJ A;  2LSO A;  3M8F A;  3JRA A;  1YJW I;  1T8I A;  5L3D A;  2V1X A;  2EA4 A;  4FE4 A;  4NQW B;  4EGZ A;  5FJ8 J;  2JK3 A;  2O3F A;  2YUS A;  4XSZ F;  3HOS A;  4IJA A;  4XKB A;  4IL6 C;  1A36 A;  1JT0 A;  2KRC A;  2W7N A;  4XQF A;  3JRC A;  1JXS A;  3FK6 A;  3R60 A;  5EEA A;  1N75 A;  4HBL A;  3CJN A;  2DK8 A;  4RB3 C;  1ONV A;  3WU1 B;  1R5I D;  4F91 B;  3HOT A;  3UKG A;  3BQY A;  3ULQ B;  3N4M A;  2E5Z A;  1A6I A;  2V79 A;  4NC8 A;  4OOI A;  3CCJ I;  2BHZ A;  3OR2 C;  1QVT A;  2WTE A;  2D1H A;  2V9V A;  5LD2 C;  1P4W A;  5FLX Z;  2M3A A;  4LMY A;  3C2H A;  2X6W A;  5GAE J;  3UR3 C;  3OV8 A;  3ABT A;  4U0W A;  3HG9 A;  5D4R A;  5C44 J;  2A69 F;  4ENJ A;  2JA2 A;  3EUH A;  2NS8 A;  1T0F A;  1O3R A;  4NB5 A;  1RC9 A;  3H9G A;  4RAY A;  4OMY A;  3M7G A;  4M74 A;  9ANT A;  1JGG A;  2KPM A;  2LOO A;  4XOP A;  1W7P A;  3CES A;  4BQQ A;  5IP7 J;  1WQ2 A;  2Y0S A;  4P5O A;  2IBD A;  2KDO A;  5CVV A;  4LK0 F;  2VOP A;  4KT6 A;  1LE8 B;  3J80 Z;  1WGX A;  4HW0 A;  3A03 A;  1P4A A;  4HLX A;  1U78 A;  2HYJ A;  2D2W A;  2F5F A;  3ZQL A;  1XX5 A;  3GTO J;  1K79 A;  3NWT A;  4XL9 A;  1I27 A;  3ELK A;  3MKY B;  4ENM A;  4HF0 A;  3IWF A;  3ISP A;  4M72 A;  1H9G A;  2QCO A;  1O7L A;  2QYO A;  3G71 I;  4XRF A;  3ZCO A;  2XDV A;  4BJ5 C;  2EFO A;  3HXL A;  4P96 A;  1TW2 A;  2LYC A;  1YQA A;  2JZY A;  3BZK A;  3CF2 A;  3G3Z A;  3DKY A;  1LNW A;  5LHG A;  4XLH A;  3F8N A;  3MZH A;  4DZJ A;  3BQZ A;  3AG3 H;  3LSJ A;  3HHH A;  3KE2 A;  1T98 A;  1J5Y A;  4A6D A;  4II2 A;  3DBH B;  3LA3 A;  3EPZ A;  1OYI A;  3PFI A;  2R92 J;  3E6M A;  4BEH B;  1X4P A;  2M8E A;  5TIS C;  3KLO A;  2DMN A;  3WTZ A;  2Y9Y A;  1DP7 P;  4M6V A;  3LA7 A;  3S1Q J;  5BPD A;  1WRJ A;  3OS1 A;  4A3M J;  4H4K C;  3RSN A;  4BS9 A;  1MDM B;  1MD0 A;  2DFE A;  2CG4 A;  2XRN A;  4IRH A;  1YG2 A;  4OIQ F;  2G0E A;  2Q0O A;  5ERI A;  4MLO A;  2FNA A;  3ASO H;  5C3E J;  4XLC A;  2QBY B;  2P0W A;  4JOM A;  5IOY A;  2L2O A;  2F2E A;  1RET A;  2BGC A;  2F5E A;  4OIP F;  3GTQ J;  1WJF A;  4UV9 A;  5HLT A;  3HRT A;  2VQG A;  1S6L A;  2V1U A;  5J3L A;  3ZQQ A;  2JSP A;  5DS9 A;  3V7R A;  3QP5 A;  2L9R A;  2OV7 A;  3D5R C;  5EEH A;  3P9C A;  4Z6Y A;  2K7L A;  5A2Q K;  1SFX A;  2A3S A;  4V2F A;  3M3Y J;  3I55 I;  4BUP A;  4ETS A;  2QSH X;  4CCM A;  1T95 A;  2IW5 A;  4Y3O A;  3LSI A;  1LVA A;  3CCS I;  2Y75 A;  4QLC U;  3HOY J;  3HSR A;  3DEE A;  1WJE A;  5EDN A;  3CCU I;  3ERM A;  2EJR A;  2VT3 A;  1BI1 A;  5E8I A;  4XR6 A;  2WY8 Q;  3CP2 A;  4BBS J;  4UUS A;  1ITY A;  3DU6 A;  4QWQ A;  3CJT B;  2DI3 A;  3KEO A;  3OOP A;  3S3N A;  1XGM A;  2L01 A;  4XM3 A;  2R7S A;  5CVR A;  2RNJ A;  4N4N B;  3CUO A;  3OL4 A;  4EM0 B;  1HKT A;  3H36 A;  3WGG A;  3C18 A;  2PQ8 A;  4FX0 A;  3WHC A;  1HKS A;  3E5Q A;  2R5Y B;  2VAS A;  3I4P A;  1HW2 A;  1X1B A;  4HDU A;  4D9J A;  3JRH A;  1G3S A;  3CCV I;  2DT6 A;  2PEX A;  3V7C A;  3I71 A;  3RPU A;  2VKD A;  2WY7 Q;  2M8G X;  5L3F A;  1K83 J;  1X3W B;  2L9N A;  1MGT A;  2RNG A;  1T2K A;  3NAR A;  1TP4 A;  3S1N J;  1W4M A;  3NWS A;  1FT9 A;  1KYZ A;  2LVS A;  4M9X A;  4UXN A;  4ZZD A;  1MH4 A;  2ZME B;  2VI6 A;  4LGW A;  1B6A A;  4EM1 A;  1TWG J;  1VI0 A;  2DW4 A;  1FBQ A;  2V6C A;  2W82 A;  2MYS A;  4RB1 A;  2R0Q C;  1VQK I;  4X6A J;  3VB2 A;  3OYM A;  2R7O A;  1XSV A;  3SEZ A;  1F36 A;  1DGW Y;  2NVT J;  1V5E A;  1JKO C;  1OJL A;  1E2X A;  2K40 A;  3F9K A;  2MA3 A;  1JKR C;  2CO5 A;  1RES A;  4BE2 A;  4RAZ A;  4L5I A;  4BHB A;  5LRS A;  1TL8 A;  3IKT A;  3K4K A;  2BE5 F;  2BY0 A;  3SDG A;  4XN0 A;  1EH8 A;  4HPQ A;  2OU2 A;  3TBI A;  1OCP A;  4M73 A;  1D0Y A;  4PUS A;  1S5L C;  2BY2 A;  2P5K A;  2A07 F;  2CYY A;  1UAA A;  3KET A;  2N8G A;  2LBF B;  2ACJ A;  1B1B A;  1T38 A;  2M34 A;  3ZQH A;  1BW5 A;  2K5C A;  1I3Q J;  2MC4 A;  3VPR A;  2ME6 A;  4PGH A;  5LBQ A;  3OYI A;  3AKZ A;  4PZJ A;  3MN2 A;  2W25 A;  5IT9 K;  3FXM A;  5D6F A;  4IHV A;  4RAF A;  3F6O A;  1HOM A;  1ERD A;  3K70 C;  2QQ8 A;  5J8C A;  3M07 A;  4L0Z B;  1EJ9 A;  3IV5 A;  3E1S A;  3RQ4 A;  2NRA C;  1UMQ A;  2BYV E;  2R7Z J;  2QZ8 A;  3BG7 A;  4KIF A;  1SVM A;  1U5T B;  4ZYH A;  2PJR A;  5LGU A;  3GFM A;  3H0D A;  3OYA A;  4JQF A;  1Z3Y A;  2FNP A;  2XIG A;  1DQU A;  3A2K A;  2CJJ A;  5J4V A;  5ILV A;  1VQ4 I;  2O7O A;  4J19 A;  3O8H A;  2XAG A;  3RKW A;  5DV5 A;  3IRQ A;  1UB9 A;  4XMY A;  4QSH A;  1MMA A;  2QVO A;  1LFB A;  2FA5 A;  3A0H C;  1XC5 A;  3VOD A;  3K4J A;  2NS0 A;  3C2G A;  2H94 A;  3ZQI A;  1XSD A;  1F4K A;  4PJL A;  3MKW B;  3RZO J;  4JP0 A;  3U21 A;  4NNJ A;  3W6K B;  2Y2Z A;  4GO1 A;  3G1O A;  3BLY A;  1BOB A;  1ORK A;  2TRT A;  4NC7 A;  3BR3 A;  3CC2 I;  1R23 A;  1BL0 A;  2CQX A;  1Y1W J;  2GM4 A;  3QWL A;  2DYS H;  5IT3 A;  2WC2 A;  4G12 A;  2YU9 J;  2DMP A;  1WFX A;  3QPH A;  4CH7 A;  3HL2 A;  3BT9 A;  4M9S A;  3B02 A;  3AAF A;  1H88 C;  2DFF A;  1P92 A;  1B59 A;  3ZMZ A;  3HRM A;  2L9S A;  5D5W B;  4WWC A;  3AG1 H;  4LK1 F;  1A31 A;  1Z21 A;  1MBK A;  1MJB A;  5HDG A;  4B48 A;  3LSK A;  4G6Q A;  2X6Y A;  3P9K A;  5DTD A;  4EJV A;  1VQ5 I;  1TZL A;  1M1E B;  5K5Q A;  5IYD J;  2VKH A;  4FE7 A;  3F3X A;  4C3H J;  2Y30 A;  4CA0 A;  4DYR A;  1W0U A;  1W36 C;  1B72 B;  2GZW A;  3BZ6 A;  2E1O A;  4Y52 J;  3EUA A;  1WJC A;  1V54 H;  2XRL A;  2L7F P;  3IWZ A;  3RCO A;  1FMV A;  3GTJ J;  5FRO A;  2EV5 A;  3JTH A;  4I01 A;  5D4S A;  2OBP A;  3K6G A;  4XKW A;  2GAU A;  3IAS 2;  3HOW J;  2KQR A;  1G2H A;  4W97 A;  5HDK A;  3RPQ A;  4A69 C;  1P4X A;  4XN3 A;  1OCO H;  1TNS A;  3KP3 A;  1X2M A;  3ECH A;  3VSK A;  4DQ2 A;  4XRS A;  2IRF G;  3ECO A;  2LDU A;  2HDW A;  2IS4 A;  3ZPL A;  2ZME C;  5ILS A;  5DYM A;  2R7U A;  3LQQ A;  2F5V A;  1WH7 A;  2QWW A;  1W5C C;  5KNL A;  1LEA A;  4AUX A;  2A6T A;  1S29 A;  4XLE A;  1SFE A;  3RDI A;  2VKV A;  2V4J C;  4YG2 F;  1W0T A;  2VBW A;  1XCB A;  1CF7 A;  1WH5 A;  3BR0 A;  5EF6 A;  1OQY A;  2NVY J;  3Q0W A;  5CYV A;  4R8H A;  1W5T A;  5FFZ A;  3JRF A;  3BG3 A;  4LOC A;  4LIU A;  4NBQ A;  4OWR B;  1Z9C A;  2FXA A;  2P81 A;  3PNV A;  1FC3 A;  4UVB A;  2CV0 A;  2K02 A;  1MMN A;  3W6J B;  5F27 A;  1FMW A;  1RKT A;  2YSR A;  3A01 B;  4AD9 A;  2GBY A;  2JA7 J;  4MGR A;  1FPQ A;  3KYC B;  1TWH J;  2HWV A;  3IRR A;  1REP C;  3HUG A;  4MTE A;  1K4S A;  5ICC A;  2HVR A;  2JA5 J;  3QOP A;  2M7B A;  2XGD A;  4RBO A;  1NHA A;  3WTV C;  3LWF A;  1XD7 A;  3DCF A;  4IOA F;  2ZJQ F;  1TTY A;  2YU3 A;  4BHP A;  1KZH A;  1XPX A;  4EJO A;  1FLI A;  2EB7 A;  3VFZ A;  2XF6 A;  4D7M A;  1ZTR A;  1IN5 A;  2QM3 A;  3ZMS A;  4ZYE A;  1YRN A;  1Y39 A;  4X1E A;  1X19 A;  2CUE A;  2O8X A;  3SZT A;  3I4M J;  2W1O A;  3I0T A;  4YRV A;  2Z3Y A;  1VTN C;  4I98 B;  5M5Y J;  1T08 B;  2R5Z A;  4J01 A;  2D1V A;  2QKM B;  1MBF A;  2R7D A;  1QQI A;  1LDD A;  3FXL A;  2I5U A;  2XAU A;  1GVD A;  2STW A;  2IS6 A;  3WU0 A;  3HB9 A;  1LFP A;  3K4M A;  1KA8 A;  2FRH A;  1TQP A;  2R7X A;  3P7N A;  2EBI A;  3R0A A;  4CYC A;  4ZH4 F;  3MVP A;  3PNY A;  3OIO A;  2DA5 A;  2HEO A;  1I1S A;  2W4S A;  4RA2 A;  2E1M B;  2EQR A;  1RI7 A;  5F08 A;  2DDA A;  2RN7 A;  5TGT A;  3KZI C;  3WHB A;  2VBY A;  3E7L A;  2VXD A;  3FK7 A;  4M3E A;  1RZ4 A;  3PIP F;  1VQ6 I;  1BN5 A;  3KEY A;  4KIG A;  2LG4 A;  4DW6 A;  3Q9V A;  2BW3 A;  3OYB A;  1YIT I;  1A6Q A;  3VYU B;  1AKH A;  4B1R A;  2A5Y B;  2K9Q A;  1B8I A;  4K2E A;  5JI6 A;  3BG5 A;  1LVK A;  4M3G A;  1G8X A;  3COA C;  2R4G A;  2AXT C;  3DPT A;  1O57 A;  2NNY A;  3LAP A;  1OYY A;  1U8R A;  1JHF A;  3BWG A;  5E8G A;  1MH3 A;  3KIO A;  2ICW G;  4DYQ A;  1K78 A;  2VN2 A;  1MBJ A;  3T5X A;  2ZXH A;  1YJ9 I;  2MBF A;  2Y69 H;  1AWC A;  1RNL A;  3I5U A;  2G7H A;  3T8R A;  2ELJ A;  3L00 A;  3BCB A;  2X9D A;  1JHH A;  4PJN A;  4KIB A;  3E6D A;  1WVR A;  4JX4 A;  3DLL F;  2DA7 A;  3FM3 A;  1NK2 P;  3CC7 I;  3Q0U A;  3MCZ A;  2RVC A;  5F04 A;  4NC6 A;  1GXP A;  3RJP A;  2F5D A;  3HJE A;  2AQF A;  2CQK A;  3FHZ A;  2F5C A;  2LC2 A;  3DV8 A;  2DO7 A;  3IAM 2;  4BYY A;  2NNN A;  4LFU A;  3K69 A;  1FSH A;  3RKY A;  1RIO H;  5F6F A;  3KP5 A;  3TW6 A;  2HPM A;  3U1K A;  3MFK A;  2F4M B;  2X6X A;  1G59 A;  3HOU J;  1YX3 A;  2HFH A;  4KIS A;  3GLL A;  4IHS A;  1U3E M;  1D3Y A;  3DEW A;  4ANJ A;  1QPM A;  2R7F A;  2Z2S B;  1HST A;  3KZZ A;  1NH3 A;  2PN6 A;  4YIF A;  1TT0 A;  5A2Q Z;  2WV0 A;  3K7A J;  2VQH A;  2EFN A;  1GDT A;  3LFU A;  2E2H J;  3S93 A;  3JAM Z;  3J7Z I;  2M0M A;  1U9O A;  1Z7U A;  5CPR B;  2Z5U A;  2EV0 A;  3DWL E;  4FTH A;  3LSM A;  1X1A A;  1IJW C;  3GZN B;  5L3E A;  3CP8 A;  1TNT A;  3KP4 A;  4F3Q A;  3FKJ A;  3QP6 A;  3MMY B;  1APL C;  1WWX A;  4IVN A;  1JKQ C;  1POG A;  2FF4 A;  2PMU A;  3KYL A;  2ETH A;  4E70 A;  4O6J A;  4CCN A;  2IGN A;  2XAS A;  2A05 A;  3GO5 A;  4FX4 A;  1G4D A;  2VE8 A;  2F6C A;  1D5Y A;  1GXQ A;  1IXC A;  2D45 A;  4KMF A;  1FYM A;  3TO6 A;  4DIQ A;  2O61 A;  4LLN A;  2DOE A;  4L9T A;  4W1U A;  3WG7 H;  4U0V A;  3OSG A;  4NQW A;  2WBM A;  3RI4 A;  3JRI A;  2O03 A;  3DBR B;  2LF8 A;  3BC8 A;  2CH0 A;  2CW7 A;  3BR1 A;  1IAW A;  3J7A Y;  4EAT A;  1K6Y A;  2HZT A;  1F1Z A;  5HS9 A;  2ZJR F;  2JTV A;  1ZG1 A;  3K9T A;  3FMR A;  2YX7 A;  2VT2 A;  1SMT A;  2HKX A;  1YTY A;  1HLV A;  2O6G E;  2MH9 A;  1LUJ B;  4HNU A;  4D1Q A;  4A3F J;  1R1T A;  2RGV A;  3DTK A;  1SC7 A;  3RTR A;  4XRM A;  2FX0 A;  2HTJ A;  4TV7 A;  4YEJ A;  4S0H B;  1OKR A;  5BMZ A;  3GZ5 A;  4HRI A;  2GWR A;  5HNH A;  1FP2 A;  2MSY A;  4UV8 A;  2LF7 A;  2HQR A;  2OF7 A;  2L5Q A;  2ZKZ A;  5DDG A;  5DUI A;  2VIX A;  2RQQ A;  3PSI A;  2DA2 A;  5H6R A;  3TO9 A;  4AIH A;  1ZRC A;  2CS3 A;  2VQL A;  3OWT A;  5GAD J;  4CO8 A;  2Y0M A;  3FX3 A;  3V8K A;  5KVR A;  4MFD A;  2JVH A;  4HYE A;  4MFE A;  2ZFU A;  1YS7 A;  1RUO A;  5FKM A;  3SZP A;  3WE3 A;  2IGO A;  4ITV A;  3ZN0 A;  1PP8 F;  2VBZ A;  3LFK A;  4L5J A;  2C6Y A;  3NAU A;  2LKP A;  2B7E A;  4IRG A;  1LE8 A;  4GFB A;  5IT9 Z;  3WTX C;  2RAE A;  1HQC A;  3NEU A;  2VC0 A;  2VKE A;  2BY3 A;  4L0Y B;  1J75 A;  3WGH A;  1ZLJ A;  3HM5 A;  1DU6 A;  4B8X A;  2DA1 A;  4XRS G;  2QA4 I;  3OYE A;  2VPL A;  3PUF A;  5JFR A;  2I8D A;  1XTA A;  2H09 A;  4FT8 A;  3CLO A;  3G1L A;  1QPI A;  5D8L B;  1UFM A;  4WCG A;  1X1P A;  3DLA A;  4Q4Z F;  4A2U A;  1TW3 A;  1AA7 A;  4UVC A;  1BM9 A;  1AHD P;  4CHU A;  2MH2 A;  5IP9 J;  2DTZ A;  4DBR A;  4U7B A;  4PSW A;  2G9W A;  1Y56 A;  2WAQ N;  4MO7 A;  3SYT A;  3K1N A;  3WU2 C;  3A1Y A;  2EWN A;  3AG4 H;  3HRS A;  4PSX A;  1ETV A;  4B43 A;  1SD4 A;  1LDJ A;  2LMD A;  3CCE I;  2KZG A;  4Q48 A;  1HW1 A;  3S2D J;  4BEH A;  2E34 A;  4ZYG A;  1BR1 A;  1BOA A;  3OSF A;  1JUP A;  2A6H F;  2JUG A;  4X0G A;  2L3D A;  1MDM A;  3ZGK A;  3H3U A;  2XPU A;  3KX2 A;  3GCM A;  3H5R A;  5DM6 F;  2HVS A;  4EEF G;  4WX9 A;  1MNM C;  3P9I A;  2QBY A;  2DA3 A;  5E3O A;  2EIL H;  3LA2 A;  3R4K A;  3CCM I;  4LG0 B;  2KKO A;  4GXO A;  2HQA A;  2RKH A;  4A3D J;  4A3J J;  3TP3 A;  1QHG A;  2GIV A;  1YHQ I;  1XMX A;  1PUF B;  3DTE A;  1AOY A;  2V1D A;  3MEX A;  2AXL A;  3TOA A;  4B3A A;  2XVC A;  3IUO A;  2MFZ A;  3GTG J;  1DP3 A;  1SEU A;  4L5E A;  1GV5 A;  4A0Z A;  1TLH B;  2MD5 A;  4HF2 A;  4I02 A;  3K4L A;  2QEX I;  2EIM H;  4RS8 A;  4A0Y A;  4WK8 F;  4CYD A;  1ZRD A;  2W84 A;  2X6O A;  3ZN1 A;  4BQA A;  4B3X A;  4QTR A;  3GWZ A;  3W2A A;  2BOL A;  5HNF A;  3E3V A;  1GLN A;  2VJ5 A;  2A68 F;  1TC3 C;  4J00 A;  4HDV A;  1NK3 P;  3W6V A;  1IXR C;  1YIJ I;  5DEQ A;  2KIF A;  3VOE A;  1NG6 A;  2PMH A;  2HKO A;  5EZH A;  3CMA I;  4BGD A;  2XRO A;  3ERE D;  2X48 A;  1J59 A;  2B0L A;  5KCM A;  4RGX A;  1QA6 A;  4GCV A;  3B6C A;  1SFO J;  3FMQ A;  5FRN A;  4YFX F;  5GPC A;  3S8P A;  2R5Y A;  2Y9Z A;  1UST A;  4C30 A;  4Y13 A;  1O7F A;  3PQJ A;  3UNG C;  4DGW B;  4FCY A;  1FBU A;  1MSE C;  4IHW A;  5AIQ A;  1NG7 A;  3SFI A;  3U2R A;  4NUB A;  3V8J A;  4B47 A;  2DJN A;  3KZY A;  3L7W A;  3OIQ A;  4E7I A;  3OY9 A;  2PBI A;  5M3F J;  1ETW A;  2ZME A;  1U6G A;  4I7H A;  5GAG J;  2KZV A;  5F0F A;  4JK1 X;  3JAM K;  2VBX A;  1IGN A;  3HIF A;  2JSC A;  1XMA A;  2ZSI B;  2JPB A;  1VQ7 I;  3TQN A;  1XDS A;  5GPA A;  5TJJ A;  3SEQ A;  5E1Z B;  1RR8 C;  4P1W A;  2HYG D;  2XAF A;  1PJR A;  3E5X A;  2EH3 A;  2CWE A;  3KEQ A;  3VYS B;  1KYW A;  4BAY A;  3OYJ A;  4RAG A;  1KGS A;  2XAQ A;  1S3J A;  4FET A;  3RZD J;  1Z91 A;  5C4J J;  3IKV A;  3S1R J;  5DM7 F;  3F8B A;  4I99 C;  2M30 A;  4PJ0 C;  3KFW X;  2IXS A;  1YFH A;  2R7T A;  5HLI A;  3M8E A;  2LBF A;  2Q2E B;  3CQZ J;  3WTW C;  1Z05 A;  2DYR H;  2PFB A;  3ZOB A;  2GXB A;  3J7A O;  2QF7 A;  3OYH A;  2WB1 A;  5D6E A;  3JTG A;  3LST A;  1H9T A;  3PNT A;  4BDZ A;  3B73 A;  3SXY A;  3FMS A;  4A3I J;  5LGN A;  2E1N A;  1S7E A;  1IN7 A;  3REO A;  1U2W A;  4R79 A;  5HOO A;  5JR3 A;  4EGY A;  2CFX A;  1U5T A;  1ZH5 A;  5EEG A;  4CCK A;  1Y6I A;  4EVI A;  4S04 A;  4F7Z A;  2K86 A;  4EM2 A;  1D1B A;  5DCF A;  5E3L A;  3HTU A;  1LJ9 A;  4C2M J;  4IQJ A;  3GFL A;  3OYC A;  1XDU A;  4FAS D;  1QVU A;  3PL8 A;  1STZ A;  2HS5 A; 
#chains in the Genus database with same CATH homology
 3BR2 A;  2PMZ N;  3QPS A;  3JRF A;  3HGY A;  3BG3 A;  3BR5 A;  4LOC A;  1MBG A;  1ETK A;  2JA8 J;  2LLK A;  2P81 A;  2XB5 A;  5IP6 A;  4XIC A;  1IV6 A;  5F27 A;  1WCM J;  1RKT A;  3LOC A;  2XGE A;  3A01 B;  3BTI A;  2GBY A;  4IHY A;  2LD5 A;  2JA7 J;  4RDU A;  2TCT A;  1TWH J;  2MG4 A;  5EYR A;  4C3J J;  2ELK A;  3S17 J;  5M5W J;  2JA5 J;  2JJ7 A;  2ID3 A;  4A3E J;  1ZR4 A;  3OOU A;  3ZQF A;  4IHX A;  2XGD A;  3I4N J;  1FIA A;  1R9T J;  2CU7 A;  4RBO A;  3MKL A;  1FJL A;  2DA6 A;  1OFC X;  3BTJ A;  2FQ4 A;  3H0G J;  2XSD C;  2WB1 N;  3DCF A;  2D5V A;  2HXI A;  1BA5 A;  3FIS A;  1WI3 A;  2YS9 A;  5EGO A;  2GLO A;  3BR6 A;  3C2B A;  4D7M A;  2H8R A;  1ZTR A;  3JRG A;  2EZL A;  1YRN A;  2IEK A;  4X1E A;  1MBE A;  2CUE A;  1ZGW A;  3I4M J;  1JUS A;  1TWA J;  4AYB N;  3Q3S A;  5M5Y J;  2R5Z A;  1IDZ A;  1B72 A;  3HEF A;  1MBF A;  2LP0 A;  1ZQ3 P;  3BG9 A;  2VPR A;  1GVD A;  5IPA A;  3HB9 A;  3GBG A;  5IYC J;  2EBI A;  4AC0 A;  4A3L J;  4CYC A;  1ETY A;  2ID6 A;  4Y7N J;  3LSP A;  3MVP A;  3OIO A;  2DA5 A;  1U8B A;  2FD5 A;  3S16 J;  3LNQ A;  3G1M A;  4JYK A;  1MBH A;  2EQR A;  1FEX A;  5F08 A;  2LR8 A;  3WHB A;  3E7L A;  3FK7 A;  4M3E A;  1F43 A;  1JT6 A;  3M4O J;  4DW6 A;  2CRG A;  1IUF A;  4A3B J;  3D1N I;  1ENH A;  2Y0S N;  1AKH A;  1EF4 A;  1Z0X A;  4B1R A;  3PO2 J;  2K9Q A;  1B8I A;  3BG5 A;  1IDY A;  4M3G A;  1K61 A;  2CUF A;  3JRA A;  1MH3 A;  4DYQ A;  2K9N A;  1MBJ A;  4FE4 A;  5K7Z A;  1RR7 A;  5FJ8 J;  2JK3 A;  2YUS A;  1OCT C;  1XS9 A;  3K2A A;  5JLW A;  1JT0 A;  2X9D A;  3TP0 A;  3JRC A;  3FK6 A;  5FKL A;  2HXO A;  4JX4 A;  1O4X A;  2DA7 A;  4QIW N;  1NK2 P;  3O8G A;  3Q0U A;  5EEA A;  4JX6 A;  5F04 A;  3A01 A;  2E2I J;  3UKG A;  3BQY A;  2COB A;  1A6I A;  3SJM A;  5FLM J;  3GTL J;  2VUM J;  2MW8 A;  1FTT A;  1QVT A;  2LY9 A;  1Y1V J;  3HBL A;  1X2N A;  2HOA A;  2KDZ A;  5F0C A;  1JTX A;  3QPL A;  3TW6 A;  5GP9 A;  5J1Y A;  2NS7 A;  3HOX J;  5C44 J;  2LK2 A;  3HOU J;  3BTC A;  3JRB A;  2NS8 A;  3DEW A;  2O9L A;  1TWF J;  9ANT A;  2I10 A;  1JGG A;  1GUU A;  1LFU P;  3FKI J;  2L7Z A;  3K7A J;  1GDT A;  2E2H J;  2XB0 X;  5IOZ A;  4FIS A;  5IP7 J;  1X58 A;  4UUS B;  2IBD A;  1BW6 A;  1U9O A;  1LE8 B;  1WGX A;  4FTH A;  3A02 A;  3A03 A;  1U78 A;  2HYJ A;  1IJW C;  3ZQG A;  3ZQL A;  3HOZ J;  3GTO J;  1UG2 A;  2M0C A;  5M3M J;  2JN6 A;  2ZB9 A;  5HOD A;  1HF0 A;  1IG7 A;  1APL C;  1JKQ C;  4B4C A;  3CDL A;  1POG A;  2XPV A;  2QCO A;  2HOT A;  4I76 A;  5F0H A;  2JA6 J;  2HDD A;  3CCY A;  2JMW A;  2H1K A;  3GTM J;  1D5Y A;  1IRZ A;  3JRD A;  3QQA A;  5JLX A;  5FLV A;  4W1U A;  2JWT A;  2CQQ A;  4DZJ A;  3BQZ A;  3LSJ A;  2ECB A;  3OSG A;  1HCR A;  3JRI A;  2LTP A;  4BKX A;  1VF9 A;  2R92 J;  4DYC A;  1E3O C;  2DMN A;  4M3B A;  2Y9Y A;  4M3D A;  5K7H A;  4M6V A;  3BR1 A;  3S1Q J;  4UUT A;  4A3M J;  4A3K J;  3BTL A;  1UHS A;  2FJ1 A;  2G0E A;  1HLV A;  2M9H A;  4MLO A;  1T56 A;  4JX5 A;  5IYB J;  4A3F J;  5C3E J;  5IOY A;  4XRM A;  4BBR J;  2FX0 A;  1RET A;  1RPW A;  3GTQ J;  4S0H B;  2WV1 A;  5FKN A;  5J3L A;  5DS9 A;  2L9R A;  2MSY A;  2Y31 A;  3LSG A;  2OPT A;  3JRE A;  1ETO A;  2OF7 A;  4MIM A;  4V2F A;  3TW7 A;  3M3Y J;  3PM1 A;  2DA2 A;  1GT0 C;  1ETQ A;  2O8K A;  1BJZ A;  3HOY J;  4MFD A;  4MFE A;  5EDN A;  5FKM A;  2HI3 A;  4BBS J;  4UUS A;  1ITY A;  4V2G A;  4BXX J;  3NAU A;  1LE8 A;  4GFB A;  2RAE A;  1I50 J;  1RKW A;  3H3V K;  2VKE A;  3HGG A;  4BY7 J;  1P7I A;  5K7F A;  3HM5 A;  1DU6 A;  4XID A;  2DA1 A;  4XRS G;  1CQT A;  5EG0 B;  1WPK A;  4ABZ A;  1SAN A;  1MSF C;  3G1L A;  1QPI A;  1HDP A;  3S14 J;  3HOV J;  1FTZ A;  1XG1 A;  3WHC A;  3F0C A;  2R5Y B;  3CMY A;  1AHD P;  2EZI A;  5IP9 J;  2XPW A;  1H89 C;  2DTZ A;  3JRH A;  4I6Z A;  2WAQ N;  4MO7 A;  2M8G X;  1K83 J;  3S1N J;  3NAR A;  2LVS A;  1ETV A;  3S1M J;  1MH4 A;  2VI6 A;  1A5J A;  1TWG J;  1VI0 A;  1JJ6 C;  4BY1 J;  4D5F A;  2AO9 A;  4IEJ A;  3S2D J;  1JTY A;  5EZG A;  2HOS A;  4DZP A;  2L0K A;  4C3I J;  2R0Q C;  3OSF A;  4X6A J;  3LSR A;  1JUP A;  3JR9 A;  2R93 J;  1H8A C;  1F36 A;  3IH4 A;  2NVT J;  1JKO C;  1OJL A;  2XPU A;  2K40 A;  2NVX J;  1JKR C;  4EEF G;  1JUM A;  1RES A;  4A93 J;  2MGQ A;  1MNM C;  2DA3 A;  5E3O A;  1JKP C;  3SDG A;  4A3D J;  4NDL A;  5E3N A;  1OCP A;  3TP3 A;  5E3M A;  4A3J J;  3PO3 J;  2NOG A;  1PUF B;  1GV2 A;  4A3C J;  3L1P A;  2LFB A;  4B3A A;  2N8G A;  3GTG J;  1BW5 A;  1FIP A;  2M34 A;  3ZQH A;  2L7M P;  1I3Q J;  4L5E A;  1GV5 A;  3VPR A;  2ECC A;  2EZH A;  2ME6 A;  2B63 J;  3MN2 A;  2X6O A;  4IHV A;  3HKZ N;  4QTR A;  1HOM A;  5F1J A;  2EZK A;  3IV5 A;  1TC3 C;  1NK3 P;  1UMQ A;  3W6V A;  1Q1V A;  2R7Z J;  5EZH A;  2IAI A;  1DU0 A;  3S2H J;  3IH3 A;  2X48 A;  5EG0 A;  2XGC A;  2CJJ A;  2K9S A;  1AU7 A;  1SFO J;  3B6C A;  2O7O A;  4J19 A;  3O8H A;  5FKO A;  1NTC A;  5GPC A;  4M3F A;  5M5X J;  2R5Y A;  2Y9Z A;  4QSH A;  1HDD C;  1LFB A;  1TWC J;  4FCY A;  3Q0V A;  4IHW A;  1MSE C;  1XC5 A;  3SFI A;  2E2J J;  1VFC A;  2DJN A;  4A3G J;  2E19 A;  3ZQI A;  3HDD A;  3RZO J;  4JP0 A;  3RKQ A;  5M3F J;  1ETW A;  2Y2Z A;  5C4X J;  5F0F A;  2DMQ A;  3RQI A;  1IGN A;  3G1O A;  2DA4 A;  1ORK A;  3FIW A;  2TRT A;  4XK4 A;  2ME0 A;  3BR3 A;  2HQ5 A;  1BL0 A;  5GPA A;  2CQX A;  1ZR2 A;  1Y1W J;  2GM4 A;  4HNV A;  2M2E A;  4G12 A;  2YU9 J;  2DMP A;  1IC8 A;  3TED A;  2EH3 A;  3BT9 A;  4D7N A;  2NVQ J;  1I6H J;  4D5C A;  1QRY A;  3GTK J;  1H88 C;  3RZD J;  5C4J J;  3S1R J;  2DMT A;  5EGO B;  1PUF A;  1MBK A;  1YRN B;  5DTD A;  3CQZ J;  5BNG A;  5IYD J;  3ZOB A;  5J1R A;  4FE7 A;  2LKX A;  3B6A A;  2R5Z B;  2QF7 A;  4C3H J;  2Y30 A;  4DYR A;  1W0U A;  1B72 B;  5FKK A;  2E1O A;  3S15 J;  4Y52 J;  1T33 A;  3ZQC A;  1Z77 A;  2DMU A;  2XRL A;  2L7F P;  4A3I J;  3GTJ J;  2KT0 A;  2DN0 A;  4CYC B;  1S7E A;  3HOW J;  1G2H A;  1P7J A;  4W97 A;  4A69 C;  1U9N A;  5J1U A;  2W48 A;  1ZK8 A;  1X2M A;  4XRS A;  1VND A;  1WH7 A;  1ZKG A;  1AKH B;  3IH2 A;  1JJ8 C;  1B8I B;  5E3L A;  4AUX A;  2VKV A;  4C2M J;  1W0T A;  1WH5 A;  2AHQ A;  3BR0 A;  1QVU A;  5EF6 A;  2NVY J;  3Q0W A;  3GTP J;  1ETX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...