1FSEA

Crystal structure of the bacillus subtilis regulatory protein gere
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GerE, the ultimate transcriptional regulator of spore formation in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords GERE
total genus 23
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fseA00
2A68F 2IW5A 5DD8A 4EM2A 2VOOA 2HZTA 2RQPA 1F9NA 5IT3A 4RAZA 3CUQA 3EUHA 2XAJA 3E97A 3F72A 3KZZA 3K2ZA 1STZA 2XAQA 2FF4A 3F23A 2GZWA 4PCQA 1Z7UA 4ON0A 2HFHA 2KIMA 2EFNA 3VEPA 4ZYEA 1R5HA 5HOOA 4I7HA 5EEHA 2Z9OA 1HKQA 4UVCA 1HW1A 1DPRA 1PP8F 3KZYA 3KLOA 2Y48A 1ON1A 2FSWA 3HRTA 2WC2A 2Q2EA 4RB0A 1I6XA 3VODA 1F5TA 3U2RA 4R79A 3GX4X 1B1BA 5IT9K 1ZREA 2KIUA 3EYYA 2DAOA 4YFXF 3GO5A 2M8EA 4BHPA 5HDKA 3H92A 2PLYA 5ICCA 4PZJA 2VT2A 3LFKA 1JXSA 4EJVA 2FXAA 3BJAA 1DP7P 1ZG3A 3LA2A 1IUYA 1FC3A 5D8LB 1BN5A 3L7WA 3SXYA 1QPMA 2EFQA 5KVRA 3SFZA 4PGGA 4LK0F 3MEXA 1XSVA 1RZ4A 1SFEA 5LGNA 1WRJA 2DU9A 4BYYA 4HDVA 2FQ3A 4HX4A 4M6YA 6PAXA 4WXHA 3F6OA 1HSJA 1BI3A 2FOKA 2Q8KA 2DPUA 4A6EA 2L4MA 2NAZA 1TNSA 3C3WA 2O8XA 1IXSB 2QM3A 3CLOA 2PBIA 2K86A 5F1RA 5TJJA 2FU4A 3FMQA 1LJ9A 4RGXA 1ZYRF 2Q0OA 5HS8A 3BP8A 4G7OF 5AONA 1XMAA 4XSZF 3KP6A 2EA4A 4N9IA 2O0YA 1FBUA 5AIQA 1XSXA 2QQAA 2YPRA 4OMZA 5ICGA 3COAC 3P7NA 4MGRA 2FMLA 4HQEA 2MLKA 5HLHA 4RAYA 2UXNA 3O2PE 3HHGA 2GAUA 2E7XA 1PDNC 2QLZA 3IWFA 5CVUA 2ZJ2A 4IXAA 1L3LA 2E1CA 3IRRA 1AOYA 2ZCWA 2MH2A 2IRFG 4LLLA 3O6BB 4BQAA 1CGPA 5TRDA 2DTRA 4L0ZB 1R1UA 4CO8A 4KT5C 4A0XA 1XGSA 4M9XA 3ZPLA 1W4MA 3GLXA 3L9FA 3CO6C 1P4AA 5HLGA 5LHHA 3WTZA 3KETA 5D5VB 3BJOA 3KP5A 5HS7A 2FBIA 4HX7A 3DPLC 3WG9A 2BE5F 3DKWA 3Q9VA 3K1NA 1BI0A 1XCBA 3HOSA 1D3YA 3V4GA 5ILSA 4G94A 2H94A 4G6DA 1UHWA 3ERED 4I0AA 3DF8A 4KMFA 4L5IA 2XKPA 4KN4X 5ILVA 1U3EM 2MA3A 4MNUA 2HS5A 1LDJA 3F8FA 5CVJA 2ZNYA 3HTUA 4LG0B 2E7WA 1QNTA 2R7DA 2A5YB 1MDMA 2XUBA 3BY6A 4YIFA 2CGPA 1Z6TA 2RGVA 2RVCA 3RJPA 3V7CA 2HTSA 4CDGA 3BPVA 2JRTA 1BC7C 5ICFA 3LSTA 3GWZA 3J81K 3ZN1A 3KP3A 1SD7A 4D0PA 4IRHA 3M8FA 2CG4A 3QAHA 5D4SA 1TTYA 1FNNA 4ZZLA 2RKHA 4FX0A 1WSUA 4P96A 2A6HF 2XAFA 2ZXJA 1CF7B 4M72A 2ACJA 2OQRA 2J5OA 2VE8A 4Q5SF 4YFKF 3BJ6A 1O3TA 2P5VA 1QZZA 3FZVA 2CYYA 3J80K 1JGSA 4Q47A 1EV7A 1ZRCA 2A6EF 3ROUA 4G7HF 4UHTA 3OV8A 2M5WA 4HF2A 4RGUA 1T0FA 2DPDA 2QQBA 3PFIA 2H6CA 5H6RA 1RUNA 3TKYA 1I27A 1V3FA 4BHCA 2V1XA 3R0AA 3V7RA 4YIIA 1FSEA 2K7LA 2MC3A 4GYIA 4S04A 2BBYA 2Z3YA 2UZKA 4HZFA 3FXUA 3I59B 1WI9A 3PQJA 1USTA 4OINF 4HOBA 4KNYA 3ZMSA 1ZARA 1IN6A 2JSCA 1TLHB 5CLSA 1UCRA 1XMKA 2B0LA 3CUOA 5LEKA 2P7CB 3N4MA 1QQIA 2DW4A 2A07F 2RNJA 2AS5F 1XGNA 1MJAA 1OKRA 3ABUA 1S6LA 2P5KA 1XN7A 4WXCA 4LMYA 2ZBKA 3QU3A 2D1VA 1J75A 1B6AA 3QP5A 5E8GA 1O3SA 1FWZA 4IHTA 4EJUA 4E70A 1XD7A 2VOPA 3FWEA 2CW0F 5BOXA 1R1VA 2EV0A 3TO6A 2XHKA 1NHAA 5KK1A 1IN4A 1GHCA 1RI7A 2XAHA 1YW9A 3BWGA 4MEYF 2BYVE 5BQTA 2HEOA 2EFOA 2F5DA 5E1ZB 1HKTA 4YG2F 3HSFA 2STTA 3JAMZ 2Z99A 3B02A 2QWWA 3C7JA 3R4KA 2O61A 5JHUA 5CVIA 4KA4A 3R61A 3M9AA 3IHUA 3E6MA 2JT1A 4RB1A 2IA0A 3I54A 2LF7A 5K5RA 1ZLJA 2L3DA 1I1GA 2Z33A 1R58A 3CUQB 1G3YA 4WXDA 2GXBA 3S2WA 3ZMUA 3D5LA 5D6FA 5D4RA 3GF2A 4B8XA 2KJCA 2EV6A 1U5TB 1PUEE 1GVJA 2KJBA 3I0TA 3GZ6A 3I64A 1R36A 5F64A 2X0LA 1R23A 4ENKA 4LD5A 4U7DA 4XLNF 1J0RA 1DDNA 2F5CA 3CJNA 5LBQA 2QQ9A 4A12A 2K4JA 3MFKA 2MBFA 5CVRA 1DPUA 1REPC 3RTRA 3WU0A 1F1ZA 2FMYA 5DCFA 4KIFA 1J59A 1ULYA 2VODA 1ZH5A 1QGPA 2Y75A 1C0WA 5CYVA 3F8CA 3R6SA 4CGZA 2AXLA 1T98A 3I71A 4L18B 2FE3A 4OIPF 4R1HA 2JPCA 3SHFA 5H20A 1YYVA 2W25A 2WWYA 3N97A 3CO7C 3FMSA 3QU6A 1G3SA 3HSRA 3HTSB 4HF0A 1SD6A 4DQ2A 4OU0A 1E17A 2WV0A 2NS0A 4CYDA 1ZRFA 2YSRA 4HV5A 4LG0A 2PFBA 4NHJA 3P9KA 1R5GA 1IN7A 5L3GA 2ZFWA 2HDCA 1IN8A 5DDGA 2OD5A 1K78B 5FLXZ 1BOAA 1ODDA 2CO5A 2COMA 4QLCU 5F6FA 2NYXA 1LEAA 5DEQA 1I5ZA 4JBAA 2PMHA 2ETHA 4BXUA 2G7UA 3SZPA 1W7PD 1ZGAA 2V1UA 1HW2A 4OIQF 5LLQA 3U1DA 1O7FA 1F4KA 2GWRA 4WK8F 3F22A 1LDDA 1H9GA 2DK8A 4XBFA 4QWQA 1KA8A 3DV8A 5A2QZ 2ZMEA 4EV0A 3I53A 1RUOA 2RV8A 1FYMA 3KLNA 3WGGA 2OQGA 3ZN0A 1SD5A 5H6QA 4RS8A 2RDPA 3H3UA 5HDNA 1EH6A 1RIOH 5DCMB 3CDHA 4LLNA 2DK5A 3LQRA 5JFRA 3RDIA 2YX4A 3GUDA 2ISZA 2BGCA 2DFIA 3ECOA 2CWEA 1TQIA 1YLFA 4IVNA 5L3CA 2NNNA 4P9UA 3WE3A 4EM1A 2EWNA 5HS9A 2IJLA 1T6SA 2FNAA 3MZHA 1O57A 1U8RA 2QVOA 5AIPA 1QZYA 3DXJF 4P55A 3E6CC 4I98B 2FRHA 4Q48A 3M1EA 1HW5A 3TO7A 1CF7A 1MDMB 2F5FA 1LQ1A 3WODF 4HYEA 2C6YA 1W7PB 1FOKA 1EH8A 1XDSA 4Z2YA 2UWMA 1D8JA 1U2WA 1MZBA 1K6OA 5HDGA 3WTWC 2H27A 5BMZA 2NNYA 3KE2A 1YIOA 2PEXA 4HQMA 4I0BA 4CHUA 3E6BA 2HKOA 3RKWA 2QENA 2V1DA 1P6RA 2YU3A 4BNCA 3L00A 1TQMA 2BEOA 3KFWX 4AIKA 4M9ZA 4YFNF 1BIAA 3V8JA 3DPTA 3FMRA 3RKYA 4WWCA 5LGTA 4I01A 2VC1A 2K4BA 3GFMA 2YR2A 3HIFA 3R0JA 4BH9A 2P5LC 4EVIA 1QO0D 5L3BA 3L09A 1FP1D 4A0YA 3GXOA 1SD4A 2GA2A 2FA5A 3HRSA 1Y0UA 2OBPA 5FGMA 4A2UA 3T0YA 4A6DA 2V6CA 3K1MA 4HAMA 2EFWA 2VXZA 1A04A 1TNTA 4UNOA 2FNPA 2VT3A 4LGWA 5L3DA 4KMUX 1T2KA 2XRNA 3KCCA 4BAYA 2W84A 5FD6A 2J5PA 2PJPA 1Z9CA 1W5TA 3HRUA 3GFIA 2JTVA 2P6TA 3JTHA 1G4DA 1BI1A 1SFXA 3NEUA 5ILUA 3OOPA 1YG2A 3Q5FA 1JHFA 3W6JB 2IT0A 3WTUC 2Z5UA 2TDXA 3FXQA 4KIGA 1GXQA 4HW0A 4XRFA 2QBYA 2XKOA 4HX8A 4AIHA 4GYGA 4M71A 4R8HA 4WF2A 1B4AA 2BV6A 3TDZC 4ZYGA 4F7ZA 1YW7A 4LFUA 5J6XA 5LGUA 2DBBA 5D6EA 2GQQA 5D5UB 3HUGA 4GCVA 3VFZA 5A2QK 1J9IA 1IXRC 4LK1F 1IF1A 1VTNC 1ZHFA 1ON2A 2D45A 3IKTA 1Q1HA 3LQQA 1FLIA 4ASNA 4U7BA 2P8TA 3MQ0A 1YO5C 2O3FA 3REOA 2P4WA 1FY7A 3WTXC 3ZP5A 4P9FA 1BI2A 3HSEA 1KQ0A 1U5TC 4I2OA 2WTEA 4PGHA 2G9WA 4AD9A 4EJTA 2RN7A 1MJ9A 1O7LA 4ENNA 1KYWA 4MQ9F 3ZMZA 5E1WA 2HOEA 4AWXB 1G3TA 4WCGA 1LVAA 2K27A 2E1NA 4FHTA 1LNWA 1KGSA 2QZ8A 4ESBA 1D5VA 1IXCA 1W5SA 3GFJA 1YW8A 3E5XA 3WTVC 4O5VA 1BC8C 3TOBA 5LEJA 1MGTA 3ZMVA 3CUQC 2W57A 3I5UA 1ZN2A 4KDPA 3O3KA 3RIRA 2D2WA 1DUXC 4ZZDA 1HXDA 4KICA 1UFMA 4L9VA 2XIGA 2IA2A 3F8NA 4UUVA 2KKOA 4K2EA 2FBHA 1QBJA 4A5NA 4L0YB 1OYWA 2YX7A 3Q9SA 2L01A 3KP4A 2FBKA 5E20A 3TDUC 2H09A 1AWCA 4L9NA 1S7OA 2VN2A 4NQWA 5ERIA 5BPIA 2MLGA 4LJZF 4I09A 3K1PA 2VC0A 3JSOA 4MEXF 3LA3A 3AAFA 4M6XA 2CQKA 1U6GA 4EJWA 3ABTA 4BHBA 3ZQ7A 3H3ZA 4H0EA 4FT8A 2HKXA 3PQKA 4N9HA 5JVTA 4CXFA 4KIBA 1EH7A 2DO7A 3RPUA 2A61A 2QBYB 3NRVA 5LRRA 2KRFA 2F2EA 3ULQB 2UXXA 1R00A 4A0ZA 2RC4A 2HQNA 1G3WA 2QUFA 3GYHX 3C18A 2EJRA 3CTAA 2LNBA 1U78A 1K78A 3EQLF 4L9JA 2W24A 2L54A 5D8KB 1OR7A 3LAPA 1D8KA 1V4RA 2XVCA 1JE8A 2LF8A 2HR3A 2JZYA 1HQCA 4OMYA 2HTJA 3K0LA 1YQAA 1HKSA 1XGMA 3KEQA 1P92A 5J8FA 2XROA 2DQRA 1FZPB 2R3SA 4KFCA 4KUMA 5HVQC 3FF5A 4TV7A 1Z05A 1OYIA 2O6GE 3T8TA 3EETA 1J5YA 3QRFF 3TQNA 2GA1A 4HA8A 5FFXA 4JK1X 3MCZA 1W7PA 3GW2A 1I1SA 2KIFA 4RGRA 4OOIA 4EJOA 3K9TA 2NRAC 1FBQA 3WU1B 3FX3A 2XASA 4EMSA 1KU2A 4ESJA 4RB2C 2VBZA 4UXNA 3F6VA 3TGNA 1O3QA 3DQVC 1B59A 5K5QA 4GGGA 2XAGA 2DT5A 5ED4A 3KP2A 3HOTA 3J7AO 4OIOF 4MTEA 1YS7A 2IP2A 4UVAA 1XB4A 1ZRDA 3LAJA 1BM9A 2LDUA 1YTYA 2Y0MA 3BDDA 4M74A 5CJ9A 1Z91A 3V7SA 1KU3A 4NB5A 1USSA 1J2XA 1WWXA 3F8BA 3V8LA 1ZGJA 2IA1A 5E1XA 4U88A 4HLYA 3WTSC 4MTDA 4LLGF 1LB2A 1SMYF 1P4XA 3E5QA 2R7FA 4IHSA 5BPDA 2DQLA 1TW2A 1K7AA 2VBWA 2ESNA 4U0WA 2EB7A 3RI4A 3TO9A 2OZ6A 1FT9A 3DEUA 3J80Z 3RYRA 1H9TA 3ML6A 3V8KA 1FPQA 1P4WA 4XSXF 4UVBA 2L4AA 2HWVA 3WTTC 5DUKA 3IL2A 3JW4A 4Y17A 4ETSA 2ZO4A 4HDUA 1PP7U 5HLIA 3BOQA 3F3XA 1T39A 1MJBA 1FP2A 3HRMA 4DNCA 1OPCA 3ISPA 3SZTA 1XGOA 4IF4A 2OU2A 4Y15A 2V79A 3WGHA 1XSDA 5J8CA 3RPQA 4UV8A 3DFGA 2XV4S 2MH9A 3ECHA 1S8NA 1S3JA 3VB2A 5BS6A 1BBYA 2H6BA 5FO5A 3FM5A 1SMTA 2GXGA 1L0OC 2L02A 2HGCA 2VBXA 1KU7A 1FX7A 3IC7A 4EQQA 2DI3A 1LEBA 1OYYA 3GEZA 4CZZA 4EGZA 4L5JA 5LRSA 2CFXA 1ONVA 1KQ9A 1O3RA 3QOPA 1UB9A 3IWZA 4OIRF 3G3ZA 2VE9A 1FSHA 5FD5A 3HHHA 1HSTA 5FFZA 5JI6A 4ZH4F 4ENMA 3E3VA 1XCVA 5DUIA 2HYFA 2X4HA 4N0BA 3G73A 5DV5A 4GXOA 2G7HA 3E6DA 5IT9Z 2VONA 4JQFA 5K5OA 4S05A 3F8MA 3GFLA 1SFUA 1J7KA 4MHGA 2PG4A 5FLXK 1BJAA 1ZAOA 2PMUA 3KP7A 3WTYC 1Z1DA 4G6QA 1GXPA 4M73A 2LSOA 2F5EA 2XGXA 4IRIA 3D0SA 2EV5A 5JR3A 3BPXA 3I4PA 4KN7X 4HV6A 2P7VB 2ZNZA 3B73A 1TW3A 4XLPF 2D1HA 1S7AA 3GZ5A 3JSPA 2K02A 4AVPA 3T5XA 2PQ8A 1IW7F 3SQNA 2VBYA 2ELHA 1S29A 1FYLA 4L9TA 5E8IA 4M9SA 5LHIA 3ZMDA 1R22A 1IAWA 2HQRA 4LB6B 2EFPA 3FM3A 2HYGD 3I59A 2EA2A 4GO1A 3WE2A 4MQVA 2ISYA 4ZYHA 5ICEA 5E18F 2O03A 1SAXA 1TQPA 1ZLKA 1RNLA 4EM0B 3F21A 3M7GA 5L3FA 1YFHA 5EEGA 4UV9A 3QPHA 1JHHA 3RKXA 3HYIA 1Z6RA 1BIBA 3RYPA 1G6NA 4P5OA 3ZMTA 3BROA 2A69F 4IRGA 1ZG5A 2P6SA 5D5XB 4RB3C 3W6KB 3QP6A 3J81Z 3U9GA 2DLLA 2W85A 1FBSA 3K69A 2EK5A 5FB2A 2M45A 3FXRA 2QYOA 3EDPA 4ZYDA 2ZMEB 3MAJA 1YS6A 5E17F 1P2FA 3KEOA 2V9VA 4O3MA 2M30A 3EYIA 1KU9A 2JPBA 5DCMA 2ZKZA 1KYZA 2IPQX 3DP7A 3R60A 5DD4A 3WGIA 3VOEA 3I58A 3JAMK 3ELKA 3QPTA 3P9IA 4ENJA 1E2XA 1KQ8A 2A3SA 4Y13A 1H0MA 3BZ6A 4PDKA 2CSOA 3IRQA 3T1BA 1IRFA 1WQ2A 4ESFA 1K79A 4WX9A 4HF1A 4LB5A 1ZG1A 3LA7A 4IJAA 1IZ1A 5LHGA 2OZUA 2PN6A 4Q4ZF 3JTGA 3T8RA 1OMIA 4B09A 1HBXG 1B9MA 4A5MA 4G7ZF 2MD5A 4HBLA 3E5UA 1X3UA 5D5WB 2ADUA 4G9YA 1T38A 1TBXA 4I02A 5L3EA 4RGSA 1XDUA 4U0YA 4FX4A 2OAZA 2STWA 1B9NA 3P9CA 2LKPA 4AIJA 3NQOA 2FEZA 1R1TA 3MWMA 1IN5A 3C1DA 2M1BA 5K1YA 2IVMA 4O6JA 1WKMA 3FHZA 1MD0A 4CICA 2ESHA 1U5TA 3GVAA 5CVVA 1UHMA 2PI0A 1FYKA 4IPAA 4G8XA 3L2CA 3IKVA 3LWFA 2GIVA 4HLXA 1IRGA 2M87A 3TOAA 2OA4A 1R7JA 3MZYA 4KYWA 3M8EA 4EGYA 1MKMA 4U0VA 5DYMA 1LDKB
chains in the Genus database with same CATH superfamily
2A68F 4E7ZA 2A6TA 4U87A 1BA5A 2IW5A 5KHDA 4I76A 3A02A 4XOTA 5DD8A 4EM2A 2E2JJ 2VOOA 3MKWB 2HZTA 2K9SA 2RQPA 1F9NA 2HDDA 1X1CA 3TMOA 5IT3A 4RAZA 1U0JA 3CUQA 2E2HJ 3EUHA 1T33A 2XAJA 3FXKA 3E97A 3F72A 3KZZA 4D7MA 3K2ZA 1STZA 2XAQA 2FF4A 2JUCA 1NK2P 3F23A 2GZWA 3SZGA 4BBSJ 4PCQA 1D5YA 4DW6A 1Z7UA 2DYSH 4ON0A 3ABLH 2ME6A 1AKHB 4IEJA 2HFHA 1WPKA 2KIMA 2EFNA 2NVTJ 3HOWJ 3VEPA 2E5ZA 2ZFUA 2XF5A 4ZYEA 3RZOJ 1R5HA 2ZSIB 5HOOA 1J09A 4I7HA 5EEHA 2Z9OA 1HKQA 1X4PA 4UVCA 1HW1A 1DPRA 1PP8F 3KZYA 3F0CA 3KLOA 2Y48A 3GZNB 2VQHA 1ON1A 5E3OA 5IYDJ 2W4SA 2FSWA 3HRTA 2WC2A 3HL2A 2Q2EA 4RB0A 2MC4A 5EYRA 5E3NA 1S5LC 1I6XA 2VKEA 3VODA 2JK3A 1F5TA 3U2RA 2JJ7A 1ETOA 4R79A 1Z0XA 2F4OB 3GX4X 2DA2A 4RAFA 1MH4A 4HSTA 4BE2A 1MBGA 2H8RA 3H5NA 4A93J 1B1BA 3IH2A 3HOZJ 4NDLA 5IT9K 4E4HA 1ZREA 2KIUA 3EYYA 2DAOA 4YFXF 2KL4A 1U9OA 3GO5A 5F04A 3OYJA 2M8EA 4BHPA 2JVGA 3ABMH 5HDKA 3H92A 5B3SH 2PLYA 2CQXA 2X6WA 3DTKA 5ICCA 1MIJA 2VT2A 4PZJA 3LFKA 1JXSA 4EJVA 3DBRB 2FXAA 3BJAA 3JRAA 1DP7P 3OS0A 1ZG3A 2JRMA 3LA2A 1IUYA 5CQEA 1FC3A 5FKNA 5D8LB 4FCYA 1BN5A 3L7WA 1X1AA 1MMNA 4C9YA 1A5JA 3SXYA 1QPMA 3OMYA 3DEWA 3IP4B 2EFQA 5EG0A 5KVRA 4OWRB 2WAFA 3ESWB 3SFZA 4PGGA 2KDZA 2YU9J 4LK0F 3MEXA 2EZIA 3FKJA 1XSVA 2O5RA 5GTHC 1RZ4A 1SFEA 1RR8C 5LGNA 1WRJA 2DU9A 4BYYA 5JHFA 4HDVA 2FQ3A 4HX4A 4M6YA 6PAXA 4WXHA 1T56A 3F6OA 3E7LA 1POGA 1HSJA 1BI3A 3C2BA 5GPAA 5IOYA 2FOKA 2M0MA 3S3NA 2Q8KA 2DPUA 5IOZA 4A6EA 4IOCF 3DBLB 1FJLA 1BW6A 1JJ8C 2L4MA 2M9HA 2NAZA 2VLAA 1TNSA 1P7JA 3C3WA 2O8XA 2HVSA 3RPUD 2HOAA 1N77A 1IXSB 2QM3A 4BJ6C 1YX5A 2RREA 2WBMA 2M7BA 3CLOA 2PBIA 3TL4X 2K86A 5F1RA 2KQRA 3GBGA 5J40A 5FLMJ 5TJJA 1H8AC 2LBFA 2FU4A 5J4YA 3FMQA 1LJ9A 2K5CA 1ZYRF 3LSJA 2Q0OA 4NUBA 4RGXA 4S0HB 4B44A 1FIAA 5HS8A 3F9KA 2WA0A 3BP8A 4G7OF 5C3EJ 5AONA 3L1PA 1D1CA 2WY8Q 5K7HA 1XMAA 2O8KA 4XSZF 1F36A 3KP6A 1DGWY 2EA4A 1FBUA 1XSXA 2O0YA 2QQAA 2YPRA 4II2A 4N9IA 4OMZA 5AIQA 3CJQB 3P7NA 3COAC 4MGRA 3CCUI 2LY1A 2FMLA 4HQEA 1JTXA 2XB5A 2MLKA 2NXNB 2L7FP 4FASD 5HLHA 5HODA 2EQRA 4RAYA 2AQFA 2UXNA 2CV2A 3CCJI 3NWTA 3O2PE 1UAAA 3HHGA 3HDDA 2GAUA 2E7XA 1PDNC 2QLZA 2F48A 3IUOA 2HU9A 3IWFA 5CVUA 2ZJ2A 4IXAA 1ZGWA 1L3LA 2WAEA 2E1CA 1U9NA 3IRRA 2OF7A 1AOYA 2P81A 3HPGA 2ZCWA 2MH2A 2IRFG 4LLLA 4II3A 2MSYA 2IEKA 1DP3A 3D5SC 1P7IA 3O6BB 4BQAA 2W1OA 2LREA 1CGPA 5TRDA 2B9SA 2DTRA 3W2AA 2LG4A 2DFEA 4DYQA 4L0ZB 1R1UA 4CO8A 2HNHA 4KT5C 4F93B 2YS9A 4A0XA 4C2MJ 1XGSA 3OL4A 4M9XA 3BZKA 3ZPLA 2RNGA 1W4MA 3GLXA 3L9FA 1XC5A 1FOYA 3CO6C 1P4AA 5EDNA 1PJRA 2QSFX 4YRVA 5HLGA 2KT0A 1CQTA 5LHHA 3CP2A 4RM2A 3WTZA 3AL0B 3KETA 3WHCA 4CCMA 5D5VB 1SFOJ 3BJOA 2VJJA 4N4OB 3KP5A 3H36A 5HS7A 3GCMA 1Q1VA 2FBIA 4HX7A 3DPLC 3WG9A 2BE5F 2PJRA 3DKWA 1VQKI 1WGXA 3Q9VA 3JRGA 4CCNA 1MSEC 3K1NA 3OS2A 1BI0A 3BTLA 1Y1WJ 4IQ4A 1XCBA 1XG1A 3HOSA 1D3YA 3L2UA 3V4GA 5ILSA 4G94A 2H94A 2KDOA 2HVRA 4EEFG 4CSWA 4G6DA 4LIUA 1UHWA 3ERED 4I0AA 3DF8A 4KMFA 1WJAA 3HC7A 3Q3SA 2IAIA 4L5IA 2XKPA 4KN4X 3BQZA 5ILVA 1U3EM 2MA3A 3CLQA 5DM6F 1IG7A 2H1LA 4MNUA 2HS5A 3W6VA 1LDJA 1VF9A 3F8FA 2DMTA 1VQ5I 3HEFA 5CVJA 1U8BA 2ZNYA 3HTUA 4AIDA 3CMAI 1XS9A 3A03A 4LG0B 4NC6A 2M4GA 2HZDA 2E7WA 1QNTA 2R7DA 1JJ6C 2X6XA 1FMWA 2AQEA 4OAZA 2AHQA 2A5YB 1MDMA 2XUBA 3BY6A 4DOZA 4YIFA 5IP7J 4A3GJ 2CGPA 4KISA 1Z6TA 2RGVA 2RVCA 3RJPA 3V7CA 2HTSA 4CDGA 3BPVA 2JRTA 3FBIB 5ICFA 3ZGKA 1BC7C 3LSTA 5B66C 1YE9A 1G2HA 3LSKA 3GWZA 3J81K 2DMNA 3ZN1A 3KP3A 2LC2A 1MNDA 1XMXA 1SD7A 4D0PA 5EG0B 3HB9A 4F3QA 4IRHA 1BR2A 2KMUA 1W0TA 3M8FA 2CG4A 3QAHA 5D4SA 2ECCA 1TTYA 1FNNA 2XDVA 3OOUA 4ZZLA 5IP6A 2RKHA 2BXZA 4FX0A 1WSUA 1W1WE 4P96A 1BL0A 2A6HF 3BZCA 3LSRA 2XAFA 2ZXJA 3MD2A 1A6IA 3DU6A 4E7IA 1CF7B 3DU5A 4M72A 2ACJA 4PJLA 2OQRA 3I4NJ 2XSJC 2J5OA 2VE8A 4A3CJ 3CD6I 4Q5SF 3KEYA 5TGTA 3S2DJ 1NK3P 2H8WA 3PFYA 1HLVA 3CCQI 4YFKF 3BJ6A 1O3TA 2P5VA 1QZZA 4N4NB 3FZVA 2CYYA 4AVZA 3J80K 2JN6A 4HNTA 5DTDA 1JGSA 1EA3A 4Q47A 4PK4A 1EV7A 1ZRCA 2A6EF 1A31A 3CP8A 1TC3C 4BEHA 1E0EA 1SVMA 3ROUA 4Y3OA 4IQJA 2HOTA 5FKKA 4G7HF 4CCJA 4UHTA 3A2KA 3OV8A 4XLCA 2M5WA 1R4MB 4HF2A 2IS2A 4RGUA 1T0FA 2DPDA 2FQ4A 1QVUA 2QQBA 3PFIA 3OYNA 2H6CA 5H6RA 3I56I 1RUNA 3TKYA 1I27A 1MH3A 1V3FA 2V9KA 2V1XA 4BHCA 3R0AA 4BY7J 1YOVB 3V7RA 4G12A 3ZXSA 4YIIA 1FSEA 5HNHA 5IPAA 2K7LA 2MC3A 1VQLI 2I10A 3QODA 4GYIA 4XKBA 2ZJPF 4S04A 4JX5A 2BBYA 2Z3YA 1JTYA 4DIQA 2UZKA 3L2WA 4HZFA 5EZHA 3S3MA 1IO2A 3FXUA 1LFUP 3I59B 1WI9A 3BR1A 3PQJA 1USTA 5K7ZA 2DA1A 1FOWA 4OINF 4HOBA 2L7ZA 4KNYA 3ZMSA 1ZARA 1IN6A 2JSCA 1TLHB 3KPHA 3WG7H 5CLSA 1UCRA 1XMKA 2B0LA 2XGEA 3CUOA 5LEKA 1X2NA 2P7CB 3N4MA 4DYCA 1QQIA 2TRTA 2MYSA 2DW4A 2A07F 4B4CA 2RNJA 2AS5F 1XGNA 1BR1A 1MJAA 1OKRA 3SFIA 3OYLA 1IC8A 1V54H 3CESA 3ABUA 1S6LA 2DA7A 3SEZA 2P5KA 2ZMEC 2LVSA 4UB8C 3GTKJ 4IO9F 2LP0A 3W2VA 1XN7A 4XIDA 5EGOA 4WXCA 4LMYA 3DCFA 2I8DA 2ZBKA 3QU3A 2D1VA 1J75A 2X6YA 2IXSA 1B6AA 1OR7C 4RMNA 2BVLA 1XPXA 3QP5A 1B8IB 5E8GA 1O3SA 2ECBA 1FWZA 2E34A 4IHTA 4EJUA 4E70A 1XD7A 2VOPA 2VL8A 3FWEA 3PL8A 2CW0F 4NQWB 5BOXA 3OIOA 3BR6A 1JI8A 1OLTA 1R1VA 1WH5A 2EV0A 3TO6A 2XHKA 1NHAA 5KK1A 1IN4A 1GHCA 1RESA 2CW8A 1RI7A 1TT0A 1YHQI 2XAHA 1YW9A 3BWGA 2XGCA 4MEYF 2BYVE 5BQTA 1PUFB 1ETYA 2HEOA 1X1BA 1VQ7I 3ZR8X 2EFOA 1AA7A 4AUXA 2OCEA 2F5DA 1LFPA 3CDLA 1IV8A 3CJRB 5E1ZB 3K7AJ 1HKTA 2LTPA 3UNGC 5E3MA 4YG2F 2R7OA 3HSFA 2STTA 4XKWA 4F55A 4HEA2 3JAMZ 2Z99A 5B1AH 3B02A 1KZHA 2R7XA 2QWWA 4ABZA 1VQNI 4BDZA 3C7JA 3R4KA 3LSMA 4EATA 2O61A 1YJWI 3BG6A 5JHUA 5CVIA 4KA4A 4BACA 3R61A 4B3XA 2K9MA 3M9AA 5DS9A 1VQMI 3IHUA 3E6MA 2JT1A 3BCBA 1YITI 4XN0A 3LNQA 2DOEA 4PSXA 2IA0A 4RB1A 1OJLA 3I54A 2LF7A 4C30A 5K5RA 1BOBA 5F0HA 1ZLJA 2L3DA 2NVUB 1MSFC 4ZTJA 1I1GA 2Z33A 1R58A 3CUQB 1G3YA 4WXDA 4B48A 2GXBA 3CF2A 3S2WA 3TW7A 3JR9A 3ZMUA 3K4BA 1GUUA 3D5LA 2MFZA 2KRCA 5D6FA 5D4RA 1P9QC 3GF2A 4B8XA 1VI0A 1Y0NA 1UG0A 3LSIA 3TW6A 3S17J 3BT9A 1OCRH 2KJCA 2EV6A 1TP4A 3AG4H 2CV0A 1U5TB 1WFXA 1GVJA 4J19A 1PUEE 2KJBA 1I6HJ 3I0TA 3GZ6A 3I64A 1R36A 5F64A 4XR6A 3S15J 1MMDA 2X0LA 1R23A 2EPFA 4HPQA 3UKGA 4KITB 4ENKA 3G1OA 4LD5A 1W0UA 2CUEA 4GRIA 4U7DA 4XLNF 1J0RA 1DDNA 4ZDOA 2Z1DA 3P5JA 2F5CA 3CJNA 5LBQA 4DBRA 2X1CA 2QQ9A 3NWSA 1Y8RB 4A12A 1V5EA 3S3OA 3FXMA 2K4JA 4ANJA 4IHYA 3MFKA 3PO2J 2MBFA 5CVRA 1BJZA 1DPUA 1REPC 3RTRA 3WU0A 1F1ZA 2FMYA 4UUSA 5DCFA 1IRXA 2EBIA 3CMMA 2HQ5A 4KIFA 1J59A 1ULYA 1NTCA 2VODA 1ZH5A 1QGPA 1A6QA 1N25A 2Y75A 4MFDA 1C0WA 3RZDJ 3CCVI 5CYVA 3GTOJ 3F8CA 3R6SA 4CGZA 2AXLA 1T98A 3FBNB 3VSLA 2IS1A 3I71A 3DBHB 4L18B 5EEAA 2FE3A 4OIPF 3CQZJ 1FTTA 4R1HA 3GTGJ 2JPCA 3SHFA 1JT6A 5H20A 1YYVA 5IP9J 2W25A 3I4MJ 3I55I 2L2OA 2WWYA 3QPSA 1RR7A 3N97A 3CO7C 5IYBJ 5HLTA 3FMSA 3QU6A 1EJ9A 3PIOF 1G3SA 3AKZA 2X6OA 2X9DA 1KONA 4CH7A 1I39A 3HSRA 3PJRA 4LG3A 4XQFA 1ETQA 3HTSB 2DA6A 5M3MJ 2DDAA 4HF0A 1SD6A 3PO3J 1LUJB 2BZTA 4DQ2A 3E0JB 3IAM2 3BG3A 5LD2C 4P1WA 3B6CA 4OU0A 1IGNA 1E17A 1X1DA 2WV0A 1BW5A 2Y9YA 5KAIC 2NS0A 2VJIA 4E7LA 2E36A 4CYDA 2E1MB 4E7HA 3PSFA 1ZRFA 2YSRA 2BW3A 1NH3A 4HV5A 4LG0A 4DBQA 2BOLA 2LFBA 2M0CA 2PFBA 4NHJA 3HGYA 5M5YJ 3P9KA 1R5GA 2CMPA 3BLYA 1QA6A 1IN7A 1IDYA 5L3GA 2ZFWA 1ERDA 2HDCA 1IN8A 4A3IJ 2XC7A 1VQOI 2JVHA 5DDGA 3CMYA 2VXDA 3KYLA 1S7EA 2OD5A 1K78B 2BY0A 5FLXZ 1BOAA 1JUSA 1D0YA 4PFPA 1SVLA 1ODDA 2UV1A 2CO5A 1ZTRA 2COMA 4QLCU 4J01A 5F6FA 2WB1A 2NYXA 3LMMA 4BKXA 1LEAA 2CQQA 5DEQA 1I5ZA 4JBAA 3K6GA 2PMHA 2ETHA 5EGOB 4BXUA 2G7UA 3CF5F 1WJFA 4ZYAA 3OYCA 3SZPA 1W7PD 1ZGAA 2M3AA 2KHMA 2V1UA 3VYTB 1HW2A 4OIQF 5LLQA 3U1DA 1O7FA 1F4KA 2IS4A 4PJNA 4CZCA 4XLFA 3LSPA 2GWRA 5J4VA 4WK8F 2KIQA 3F22A 3JRFA 4J00A 2VUMJ 1LDDA 2XF7A 2WV1A 3K70C 2DTZA 4C3HJ 1H9GA 2DK8A 4XBFA 3JRIA 4QWQA 1KA8A 3DV8A 2KPMA 2PJRB 5A2QZ 2ZMEA 4EV0A 3I53A 1RUOA 4IHVA 2KFDA 2RV8A 3KLNA 1FYMA 3WGGA 1VQPI 2E2IJ 3K4CA 3S8PA 3Q0UA 1TWAJ 1D1BA 2OQGA 3ZN0A 1SD5A 2KP6A 4M3DA 3HOVJ 5H6QA 3ABKH 1SFKA 3A0BC 4RS8A 3LOCA 2RDPA 2VASA 3H3UA 5HNFA 2CQNA 3S93A 5HDNA 1EH6A 1RIOH 4DYRA 5DCMB 2LLKA 2E35A 3CDHA 2OPTA 4LLNA 2DK5A 3LQRA 5JFRA 1Z7LA 3RDIA 3IH4A 3GUDA 2DFHA 2YX4A 2GOXB 5J1RA 1ETXA 5FLVA 3J7AY 2ISZA 2BGCA 2DFIA 4X1EA 4BDYA 3ECOA 3U21A 2CWEA 1TQIA 1YLFA 4IVNA 5L3CA 2NNNA 4P9UA 3S32A 3WE3A 3SJMA 4EM1A 2DJIA 2EWNA 5HS9A 1X1PA 1Z77A 2LR8A 2IJLA 1T6SA 3D1NI 2FNAA 1RKWA 3JRDA 4LOCA 2CW7A 3MZHA 1O57A 2QVOA 3QQAA 5AIPA 3A01A 1QZYA 3JRHA 1U8RA 3DXJF 1IDZA 2DN0A 4P55A 4NC7A 3E6CC 3DTEA 1SC7A 4I98B 1MNEA 3TP3A 4DZJA 4XKCA 2FRHA 4Q48A 3RSNA 3M1EA 4IZZA 2IGNA 1HW5A 2HXIA 3TO7A 3J7ZI 1CF7A 1UMQA 1MDMB 5M3FJ 5CKTA 2F5FA 1LQ1A 1LE8B 2VB6A 1A35A 3WODF 2XPUA 4HYEA 4HNUA 2C6YA 3S1MJ 1W7PB 2CUJA 1W5CC 4RLQA 1EH8A 1XDSA 4Z2YA 3SDGA 1FOKA 2UWMA 1D8JA 1U2WA 1MZBA 1K6OA 3QYEA 5HDGA 2HPMA 4ZTFA 2NVYJ 2OTJI 2DODA 3WTWC 2H27A 2M2EA 5BMZA 2NNYA 3BG5A 1JKQC 3MVPA 3KE2A 1YIOA 2PEXA 4HQMA 4I0BA 4CHUA 4KJZA 3E6BA 4FISA 2OTLI 2HKOA 2DT7B 3RKWA 2QENA 2V1DA 3M3YJ 4I6ZA 4XORA 2LMDA 3H0GJ 1QHGA 1P6RA 3EPZA 5JVGF 4A3EJ 2YU3A 1H89C 1T8IA 4BNCA 3L00A 3M4OJ 1LFBA 4QSHA 3GTPJ 3S1RJ 5BNGA 1TQMA 2BEOA 3KFWX 1ZK8A 2BY2A 2DOFA 4AIKA 4M9ZA 2ZB9A 1MBEA 4YFNF 2DMUA 1WJ5A 1BIAA 3V8JA 3DPTA 3FMRA 1HF0A 2QSGX 3RKYA 2WADA 3VPRA 4WWCA 5LGTA 4YEJA 4AYBA 2EINH 4QPQA 1AKHA 3CCLI 4I01A 2R5YA 4PFOA 1VQ4I 2VC1A 1FMVA 2K4BA 4HRIA 3GFMA 1R9TJ 1FEXA 2K9QA 2YR2A 3HIFA 3R0JA 4D5CA 5C44J 4BH9A 3ZQLA 3OYBA 4XLEA 5GAGJ 2V9PA 4BE0A 3JRCA 2P5LC 4EVIA 1QO0D 2R4GA 2VKVA 3S14J 5L3BA 3L09A 1FP1D 2X51A 3FISA 4A0YA 3GXOA 2XSDC 5GP9A 2R5ZB 3MKLA 3FK6A 1SD4A 2GA2A 2FA5A 3HRSA 3K10A 1Y0UA 2OBPA 3PSIA 1VQ8I 1TWHJ 2L9NA 4IKFA 5FGMA 2X1DA 3H9QA 4A2UA 3BC8A 2I5UA 1WJCA 3T0YA 4RDUA 1RETA 1Y6IA 3I9V2 4A6DA 5FRNA 2V6CA 3K1MA 4B43A 4HAMA 2EFWA 1ITYA 2VXZA 1A04A 1TNTA 1T0FC 4UNOA 3HOXJ 2FNPA 2VT3A 3ASNH 4LGWA 5L3DA 2R7VA 2DA3A 3BR0A 3OYHA 4KMUX 3IH3A 1T2KA 2XRNA 3ZQHA 2V6EA 3K4KA 3KCCA 3BCAA 3QYBA 4BAYA 2W84A 3KZIC 5FD6A 4BL0B 2J5PA 2MW8A 5FKOA 3M1CA 2PJPA 4UUTA 5B5EC 1MMSA 3OIPA 1R6RA 3VYSB 1Z9CA 2X48A 1W5TA 3LL7A 3HRUA 3GFIA 2JTVA 2P6TA 3JTHA 2JUGA 2Z16A 1EKEA 3FXJA 1D1AA 1G4DA 1BI1A 1SFXA 5F27A 3NEUA 2COBA 2V7FA 5ILUA 3OOPA 3CCSI 3S1QJ 4PJJA 2L7KA 2Y30A 1YG2A 1QZEA 1SVOA 2QQ8A 3Q5FA 1A36A 1JHFA 1WJEA 3W6JB 2VQGA 1Y1VJ 2IT0A 3H9GA 2M8GX 4RAGA 4Z6YA 3WTUC 2Z5UA 2TDXA 3FXQA 2VQCA 1QHHD 1MW7A 2DFFA 4JP0A 3CC2I 2DA5A 4KIGA 4YELA 1GXQA 5GTIC 4HW0A 4XRFA 2QBYA 2R7QA 2XKOA 1DQUA 4HX8A 3TBIA 2MD0A 4AIHA 4GYGA 3ONQA 4M71A 4R8HA 4WF2A 2M7AA 1B4AA 2BV6A 2L9RA 2K9LA 3TDZC 2K3FA 4ZYGA 4F7ZA 1YW7A 3EUAA 4LFUA 5J6XA 2DBBA 5LGUA 5JLWA 3AFHA 3G1LA 2L5QA 5D6EA 4W1UA 2EIMH 2GQQA 5D5UB 3HUGA 2OV7A 2QSHX 3OS1A 2Y2ZA 3ZQCA 4GCVA 5TISC 3S1NJ 3BTCA 3EUHC 3VFZA 1PVEA 2XRLA 5A2QK 1J9IA 1IXRC 4Y7NJ 4LK1F 1IF1A 1VTNC 1ZHFA 1ON2A 2D45A 1N78A 3IKTA 4A3BJ 1Q1HA 3HGGA 4BQQA 3LQQA 1FLIA 1UHSA 2CUFA 4ASNA 4B3AA 4U7BA 1N75A 2P8TA 3MQ0A 1YO5C 2O3FA 3REOA 2HXOA 4MFEA 2P4WA 1FY7A 3A01B 3WTXC 3ZP5A 4CCKA 2VKDA 2JA7J 1DU6A 4P9FA 1BI2A 3HSEA 1HDPA 3DKYA 1QRYA 1KQ0A 1U5TC 3GTJJ 4I2OA 2WTEA 2Q1ZB 2G9WA 4PGHA 4AD9A 3OYKA 4XN3A 4EJTA 2E1MC 2RN7A 1MJ9A 1O7LA 5DM7F 4ENNA 1KYWA 2VKHA 1OISA 4PJMA 4D7NA 4MQ9F 2XGDA 1QU3A 3ZMZA 4A3KJ 1XTAA 1WH7A 5E1WA 2HOEA 4AWXB 1G3TA 4WCGA 1RRJA 3CCEI 1LVAA 2K27A 2E1NA 1FTZA 4FHTA 1YI2I 1LNWA 2R7UA 4BE1A 3L2VA 3QYFA 3H9JA 4HSRA 3HJEA 3JCUC 1KGSA 2QZ8A 4CCOA 4XLAA 4ESBA 1D5VA 1IXCA 1VQ6I 1W5SA 3GFJA 2DT6A 4FTHA 1FOXA 2PMZN 2N8GA 1YW8A 3E5XA 3WTVC 4O5VA 2B63J 1R71A 3K70D 1BC8C 3K4MA 3TOBA 5LEJA 2HI3A 1OQYA 1MGTA 3H5RA 1ACIA 1T95A 4XM3A 3ZMVA 3CUQC 2W57A 1YX3A 4D5FA 3I5UA 1ZN2A 3H3VK 3RQ4A 3O3KA 3RIRA 3O8GA 4KDPA 2D2WA 2DCEA 3FIWA 1HXDA 2JMWA 4ZZDA 1DUXC 4KICA 1UFMA 2JWTA 4L9VA 2CS3A 3WU2C 4DGWB 2KISA 3OSGA 2NVXJ 2XIGA 3PNYA 5J1UA 1GDTA 3RQIA 1W36C 1B72B 2IA2A 3F8NA 4BBRJ 4UUVA 2ICWG 2KKOA 2LK2A 4K2EA 2FBHA 2OUMA 2R5YB 1HCRA 1QBJA 4A5NA 3CCYA 2JQ7A 4L0YB 1OYWA 2YX7A 2LRDA 3Q9SA 3DLAA 2L01A 3KP4A 2FBKA 4V2FA 4YIRX 2R7WA 1VFCA 5E20A 3TDUC 2G0EA 3DTIA 2DJNA 2H09A 1AWCA 4L9NA 1S7OA 2L0KA 2VN2A 4NQWA 5ERIA 4XK4A 1K61A 1WJBA 5BPIA 1I3QJ 2MLGA 2LY2A 2E71A 4LJZF 4I09A 2X1EA 3K1PA 2VC0A 2LKSA 1ZR4A 3JSOA 1XX5A 3OR2C 4A3LJ 2LOOA 3ZCOA 4MEXF 4M3FA 4Y52J 3LA3A 3AAFA 4M6XA 2CQKA 3OYFA 2ZJRF 1D0XA 1U6GA 4EJWA 3CC4I 1ENHA 2AXTC 3ABTA 5FKLA 4BHBA 2ZC2A 2F6CA 3MZ8A 5FJ8J 2QKLB 3ZQ7A 3H3ZA 1R49A 2R7SA 4H0EA 1LKXA 4FT8A 2HKXA 4BQNA 3PQKA 4D9JA 4JOMA 3L2RA 4AC0A 3KYDB 4N9HA 2BXYA 4CXFA 5JVTA 4QTRA 2XPWA 3U1KA 4FETA 2RQQA 1APLC 3GMEA 4KIBA 1EH7A 2DO7A 1VQ9I 1ETVA 3RPUA 2A61A 2QBYB 3NRVA 2ELKA 4BUPA 2WB1N 2LD5A 4L5EA 1ZQ3P 5LRRA 2KRFA 2F2EA 3ULQB 2UXXA 3WHBA 5E3LA 4ZC3A 2Y0SN 1R4NB 2EZHA 1IV6A 1R00A 2VI6A 3LSGA 4A0ZA 2RC4A 2HQNA 3BG7A 1G3WA 2QUFA 3HPHA 1R5ID 1MMAA 3C18A 4XONA 3GYHX 2EJRA 3CTAA 2LNBA 4UB6C 4RA2A 1U78A 1K78A 3EQLF 4M3BA 3A0HC 4L9JA 2W24A 2L54A 9ANTA 5D8KB 1OR7A 4UUSB 2NOGA 5KAFC 3LAPA 3MKZA 4E7KA 1O4XA 1VNDA 1MBFA 4C2UA 1D8KA 1V4RA 2JA6J 2XVCA 4B47A 1X58A 4NNJA 1JE8A 2JA5J 2HPIA 2LF8A 3SDBA 2HR3A 2JZYA 1HQCA 4OMYA 2FD5A 2HTJA 3K0LA 3TEDA 1YQAA 1HKSA 3NAUA 1XGMA 1ETWA 3KEQA 1P92A 3M07A 5J8FA 3CC7I 2XROA 2LKXA 1E3PA 2OCCH 1WCMJ 2DQRA 4RBOA 4I99C 2R3SA 1FZPB 4KFCA 4IHXA 4KUMA 3DPUA 5HVQC 3FF5A 4TV7A 1Z05A 1K4SA 1OYIA 2K40A 2O6GE 3T8TA 1T08B 1H88C 3HOUJ 4BXXJ 3EETA 2QEXI 3HBLA 1TWCJ 4F92B 1J5YA 3N05A 2EZKA 3PM1A 3QRFF 1HA8A 4BJTA 3TQNA 2GA1A 1OCZH 5F08A 3E1SA 4HA8A 5FFXA 3G1MA 4JK1X 3MCZA 1W7PA 2MABA 3GW2A 3OSFA 1I1SA 2KIFA 2ID6A 1GV5A 1UELB 4RGRA 1E3HA 4OOIA 4EJOA 1Y8QB 3OIQA 2F5VA 3K9TA 2ZSHB 1YJNI 2GLOA 4ZDPA 1GT0C 1FBQA 2NRAC 3Q0VA 2W7NA 3WU1B 4M3GA 3FX3A 2XASA 4EMSA 1IUFA 2HOSA 1KU2A 3I3LA 3QOEA 2L9SA 1YIJI 4ESJA 1JKRC 4RB2C 1HC8A 2DOAA 2VBZA 4UXNA 3OYIA 2ZXWH 3F6VA 3TGNA 1O3QA 1G8XA 1MNMC 4MIMA 3DQVC 1B59A 4CUGA 2EIKH 1X19A 2HYJA 2KZVA 1OCTC 1SEUA 2R92J 2LBFB 2E5NA 5K5QA 1OCCH 1S72I 4GGGA 3W3CA 2XAGA 3KYCB 1I50J 3SYTA 2DT5A 4H4KC 3IV5A 4DZPA 5ED4A 5KNLA 3ZQQA 3KP2A 3HOTA 3AG1H 3J7AO 2LYCA 4B1RA 1YS7A 4MTEA 4OIOF 2XPVA 2IP2A 1G59A 4UVAA 1XB4A 1ZRDA 4BU2A 3LAJA 3L2QA 2BVMA 2VJ4A 1BM9A 4E6KG 2LDUA 1YTYA 2Y0MA 4IX7A 1V55H 1FIPA 3BDDA 4M74A 2NS7A 1ORKA 1OCOH 1YRNB 5CJ9A 1Z91A 2EILH 2V26A 3V7SA 4KT6A 1KU3A 4NB5A 1USSA 3OWTA 2WAQA 1X3ZB 1J2XA 2W00A 2Y69H 3RCOA 2MGQA 1LVKA 4V2GA 5FROA 1W36D 1WWXA 3F8BA 3V8LA 1ZGJA 2D5VA 1Z3XA 2IA1A 1X3WB 2MG4A 5E1XA 3O8HA 2EZLA 3ASOH 4U88A 4HLYA 3KIOA 1E3OC 4XL9A 3WTSC 4MTDA 3CCRI 3FXOA 3ZQFA 2DMQA 3AG3H 4XRSA 4ZDLA 4LLGF 1LB2A 1SMYF 2M4KA 2QA4I 1SAUA 1P4XA 2O7OA 3E5QA 2R7FA 4IHSA 3MN2A 3BTIA 5BPDA 2DQLA 3GTLJ 3K4NA 3OYDA 2PMZA 1TW2A 1Z21A 2JA8J 1K7AA 2ZJQF 3JREA 2VBWA 2ESNA 4U0WA 3H0DA 1V5FA 2EB7A 3HXLA 3HG9A 3RI4A 1TWGJ 4X6AJ 1AHDP 3TO9A 2OZ6A 1FT9A 3DEUA 1MMGA 2P0WA 3J80Z 3RKQA 3D5RC 3DEEA 3RYRA 1H9TA 3HOYJ 3ML6A 3V8KA 1FPQA 2QKMB 3DLLF 1P4WA 4XSXF 4UVBA 2L4AA 2HWVA 3WTTC 4Y33A 5DUKA 3IL2A 3JW4A 2A5WA 4Y17A 4ETSA 5H2FC 2ZO4A 1B8IA 3CCMI 4HDUA 4IHWA 2Q2EB 1I3AA 2KLOA 4PSWA 5HLIA 3BOQA 1PP7U 5JLXA 3VWBA 1JKPC 4G6TB 3F3XA 4QPOA 1HOMA 1ZR2A 2VPLA 1GLNA 1T39A 3BR3A 4E7SA 1MJBA 1FP2A 3HRMA 4A3FJ 4DNCA 1OPCA 3ISPA 3SZTA 1XGOA 4IF4A 2OU2A 4Y15A 2V79A 3WGHA 4A3MJ 4BY1J 1XSDA 1WJDA 1UG2A 5J8CA 2Z2SB 3RPQA 4UV8A 3DFGA 4ZJZA 2XV4S 2MH9A 2AO9A 4BQOA 3PNVA 2BHYA 2CRGA 3ECHA 4D1QA 3QPLA 5J47A 2Y0SA 2BY1A 1WHUA 2UUZA 1S8NA 1EF4A 2EH3A 1NG6A 4BXFA 1S3JA 3VB2A 1LE8A 5BS6A 3BQYA 1BBYA 2H6BA 4AU7A 1HDDC 5FO5A 4XRSG 1UJ8A 1ETKA 1GVDA 3FM5A 3CJTB 1SMTA 2GXGA 1L0OC 1DGRM 4IL6C 1K6YA 2F4MB 2L02A 2HGCA 2VBXA 5EF6A 1ZKGA 1KU7A 2WAQN 4V19K 1MBJA 3VDXA 2BHZA 2XB0X 1FX7A 3IC7A 4EQQA 2DI3A 2DA4A 1LEBA 5CQGA 2W48A 4FE4A 1OYYA 3GEZA 5KCMA 1SANA 2DDBA 3BR5A 4CZZA 4EGZA 2OC6A 4L5JA 5LRSA 3PNTA 5C4JJ 2CFXA 1ONVA 1KQ9A 3J7YJ 1O3RA 4NBQA 3QOPA 1UB9A 3IWZA 4UY8I 2VPRA 4OIRF 3G3ZA 2YUSA 3DWLE 3K2AA 2VE9A 2CJJA 5FD5A 1FSHA 3HHHA 1HSTA 5FFZA 5JI6A 3BR2A 4BEHB 4ZH4F 4ENMA 1JUMA 1XCVA 2FX0A 2HYFA 3E3VA 5DUIA 3G6EI 3OYMA 2X4HA 4N0BA 3G73A 1YJ9I 5DV5A 4GXOA 3OYEA 1S9HA 2G7HA 1GV2A 3E6DA 5IT9Z 2VONA 4JQFA 5K5OA 4S05A 3F8MA 5GPCA 3GFLA 2V4JC 1SFUA 1J7KA 4MHGA 5F1JA 2PG4A 2LH9A 3LFUA 5FLXK 4GFBA 1BJAA 2XAUA 5IY5H 1ZAOA 2PMUA 3KP7A 4BGDA 2ZXIA 3WTYC 1Z1DA 2K9NA 4G6QA 4M73A 1GXPA 2GM4A 2LSOA 4PUSA 1UZCA 3PUBA 2F5EA 2XGXA 4IRIA 2R7TA 1RKTA 2IGKA 2OJED 1JGGA 3D0SA 2EV5A 5EZGA 3PIPF 5JR3A 3BPXA 3I4PA 4KN7X 2DYRH 3DKXA 2JA2A 1IRZA 3HZJA 4HV6A 1VZ0A 2P7VB 2ZNZA 1D0ZA 3B73A 1TW3A 1TWFJ 3ZRGA 4XLPF 5C4XJ 2DMPA 2D1HA 4E7JA 1S7AA 4MO7A 1Z3YA 3GZ5A 4NC8A 5GAEJ 3JSPA 2VIXA 3ZQGA 2K02A 4AVPA 3T5XA 1WVRA 2PQ8A 2KZGA 1IW7F 2IBDA 1QVTA 3SQNA 3ERMA 2VBYA 2ELHA 1S29A 4QIWN 1FYLA 4L9TA 5E8IA 3FKIJ 4M9SA 4HNVA 3G4SI 5LHIA 2Y31A 5ICGA 3LSHA 4FQGA 1R22A 4XLHA 3ZMDA 1IAWA 2GOMA 2HQRA 4LB6B 3CMEI 4AM3A 2FOWA 2EFPA 3FM3A 2HYGD 4M6VA 3I59A 2E19A 4OAYA 2EA2A 4GO1A 3WE2A 4MQVA 2LY9A 5F0CA 1LPQA 5B1BH 2ISYA 3PUFA 5J1YA 1B72A 1IJWC 4ZYHA 5ICEA 3H35A 3HKZA 3VYRB 5E18F 2L7MP 4XNFA 2O03A 3K4LA 2BW3B 1SAXA 1TQPA 4HG2A 2B7EA 4F52A 1ZLKA 3C2HA 3HM5A 1RNLA 4EM0B 1WI3A 2CH0A 2JSPA 3OYAA 4RLFA 3F21A 5LFAA 1K4TA 2FUG2 1BR4A 1V5GA 3ZQIA 3M7GA 2Y9ZA 5L3FA 1YFHA 5EEGA 4UV9A 2IGMA 2NOJB 2CQ7A 3QPHA 3W2WA 1JHHA 3RKXA 4JX6A 3HYIA 1Z6RA 1X4OA 5M5XJ 4F91B 1JT0A 1DU0A 1BIBA 3RYPA 1G6NA 1YRNA 2DXIA 4P5OA 3ZMTA 2HVQA 3A4CA 3BROA 3IAS2 2R7RA 4XMYA 1RPWA 2EIJH 1Y56A 2L9VA 2A69F 3VSKA 1RC9A 4IRGA 1ZG5A 3S2HJ 2P6SA 3OYGA 5D5XB 4RB3C 4XOPA 3W6KB 3QP6A 3J81Z 3U9GA 3OY9A 1F43A 2DLLA 4A3JJ 2W85A 3BG9A 1FBSA 3X2QH 3GTMJ 3K69A 2EK5A 2ELJA 4AYBN 2M45A 3FXRA 5FB2A 2VQLA 2QYOA 3EDPA 4ZYDA 2ZMEB 3MAJA 1YS6A 4C3IJ 5E17F 2QF7A 1P2FA 3KEOA 2ID3A 2ME0A 1PUFA 2V9VA 4O3MA 2M30A 1OCPA 3EYIA 1KU9A 2JPBA 4XICA 3OL3A 5DCMA 2ZKZA 3MKYB 4Y4RA 1KYZA 2TCTA 1JUPA 2IPQX 3DP7A 2X85A 1PYVA 3R60A 2NS8A 5DD4A 1WZ2A 5GAHJ 3TP0A 3BTJA 3WGIA 4XRMA 2XF6A 3VOEA 3I58A 3JAMK 3ELKA 5EJCA 4C3JJ 3M8JA 4MLOA 3QPTA 1K83J 4RM3A 3P9IA 4ENJA 1E2XA 1KQ8A 2A3SA 4Y13A 3G2BA 5M5WJ 3UR3C 2F4IA 2GBYA 2R0QC 1H0MA 5FRMA 3BZ6A 4FE7A 4PDKA 3JRBA 4A69C 2CSOA 3IRQA 2GIZA 4CCLA 3T1BA 4JYKA 4CYCB 3AL0C 1IRFA 1WQ2A 4ESFA 2V1NA 1K79A 4WX9A 4C2TA 4CA0A 4HF1A 2PX9A 4LB5A 4XKVA 2HDWA 4JX4A 3FHNA 1ZG1A 3GLLA 3LA7A 5CPRB 4IJAA 1IZ1A 5LHGA 4LITA 5FKMA 2H1KA 2OZUA 3H1CA 2PN6A 4Q4ZF 3V42A 3JTGA 3SEQA 3T8RA 2ZXHA 1OMIA 4A3DJ 2E60A 2R7ZJ 2A05A 4B09A 1HBXG 1B9MA 4A5MA 3C2GA 4G7ZF 2MD5A 5K7FA 4GDFA 1NG7A 4HBLA 3E5UA 1TZLA 1X3UA 5D5WB 2NVQJ 1Z67A 4X0GA 3EUKL 2CFOA 3G71I 2ADUA 3KX2A 4G9YA 2IGOA 1TBXA 1T38A 4I02A 1MBHA 5L3EA 2QCOA 1Y39A 2FJ1A 2M34A 4RGSA 1XDUA 4U0YA 4FX4A 2OAZA 2STWA 3Q0WA 1B9NA 1ZELA 3P9CA 3S16J 2LKPA 3HKZN 3NQOA 4AIJA 2GXAA 2CU7A 2FEZA 3CZ6A 1R1TA 1MBKA 3C1DA 1IN5A 3K4JA 3MWMA 2M1BA 1AU7A 5K1YA 2IVMA 2RAEA 1JKOC 3AG2H 2CV1A 4CYCA 5E79C 3B6AA 4O6JA 4BS9A 3H5AA 2K85A 3FK7A 4W97A 1WKMA 5GADJ 3FHZA 2BY3A 1MD0A 4CICA 3QWLA 2ESHA 5IYCJ 3A1YA 2W82A 3FXLA 1U5TA 2IS6A 2QGUA 3GVAA 5CVVA 3GTQJ 4DJAA 1UHMA 2HQAA 3NARA 2O9LA 5F0FA 1TT5B 2PI0A 3ZOBA 1FYKA 4IPAA 2R93J 2E1OA 3HUGB 4G8XA 4LIVA 4PJ0C 4BJ5C 1M1EB 3L2CA 3IKVA 3LWFA 3FDYA 1X2MA 2GIVA 4HLXA 2R5ZA 1IRGA 1QPIA 2KRHA 3MMYB 2VJ5A 2M87A 3OR1C 3VYUB 3TOAA 2OA4A 1R7JA 3MZYA 2WY7Q 2K3PA 4KYWA 3M8EA 4EGYA 1TL8A 3CDIA 2CUZA 1OFCX 4IOAF 1MKMA 5J3LA 4M3EA 4U0VA 4ITVA 5DYMA 1LDKB
chains in the Genus database with same CATH topology
2A68F 2IW5A 5DD8A 4EM2A 2VOOA 2HZTA 2RQPA 1F9NA 5IT3A 4RAZA 3CUQA 3EUHA 2XAJA 3E97A 3F72A 3KZZA 3K2ZA 1STZA 2XAQA 2FF4A 3F23A 2GZWA 4PCQA 1Z7UA 4ON0A 2HFHA 2KIMA 2EFNA 3VEPA 4ZYEA 1R5HA 5HOOA 4I7HA 5EEHA 2Z9OA 1HKQA 4UVCA 1HW1A 1DPRA 1PP8F 3KZYA 3KLOA 2Y48A 1ON1A 2FSWA 3HRTA 2WC2A 2Q2EA 4RB0A 1I6XA 3VODA 1F5TA 3U2RA 4R79A 3GX4X 1B1BA 5IT9K 1ZREA 2KIUA 3EYYA 2DAOA 4YFXF 3GO5A 2M8EA 4BHPA 5HDKA 3H92A 2PLYA 5ICCA 4PZJA 2VT2A 3LFKA 1JXSA 4EJVA 2FXAA 3BJAA 1DP7P 1ZG3A 3LA2A 1IUYA 1FC3A 5D8LB 1BN5A 3L7WA 3SXYA 1QPMA 2EFQA 5KVRA 3SFZA 4PGGA 4LK0F 3MEXA 1XSVA 1RZ4A 1SFEA 5LGNA 1WRJA 2DU9A 4BYYA 4HDVA 2FQ3A 4HX4A 4M6YA 6PAXA 4WXHA 3F6OA 1HSJA 1BI3A 2FOKA 2Q8KA 2DPUA 4A6EA 2L4MA 2NAZA 1TNSA 3C3WA 2O8XA 1IXSB 2QM3A 3CLOA 2PBIA 2K86A 5F1RA 5TJJA 2FU4A 3FMQA 1LJ9A 4RGXA 1ZYRF 2Q0OA 5HS8A 3BP8A 4G7OF 5AONA 1XMAA 4XSZF 3KP6A 2EA4A 4N9IA 2O0YA 1FBUA 5AIQA 1XSXA 2QQAA 2YPRA 4OMZA 5ICGA 3COAC 3P7NA 4MGRA 2FMLA 4HQEA 2MLKA 5HLHA 4RAYA 2UXNA 3O2PE 3HHGA 2GAUA 2E7XA 1PDNC 2QLZA 3IWFA 5CVUA 2ZJ2A 4IXAA 1L3LA 2E1CA 3IRRA 1AOYA 2ZCWA 2MH2A 2IRFG 4LLLA 3O6BB 4BQAA 1CGPA 5TRDA 2DTRA 4L0ZB 1R1UA 4CO8A 4KT5C 4A0XA 1XGSA 4M9XA 3ZPLA 1W4MA 3GLXA 3L9FA 3CO6C 1P4AA 5HLGA 5LHHA 3WTZA 3KETA 5D5VB 3BJOA 3KP5A 5HS7A 2FBIA 4HX7A 3DPLC 3WG9A 2BE5F 3DKWA 3Q9VA 3K1NA 1BI0A 1XCBA 3HOSA 1D3YA 3V4GA 5ILSA 4G94A 2H94A 4G6DA 1UHWA 3ERED 4I0AA 3DF8A 4KMFA 4L5IA 2XKPA 4KN4X 5ILVA 1U3EM 2MA3A 4MNUA 2HS5A 1LDJA 3F8FA 5CVJA 2ZNYA 3HTUA 4LG0B 2E7WA 1QNTA 2R7DA 2A5YB 1MDMA 2XUBA 3BY6A 4YIFA 2CGPA 1Z6TA 2RGVA 2RVCA 3RJPA 3V7CA 2HTSA 4CDGA 3BPVA 2JRTA 1BC7C 5ICFA 3LSTA 3GWZA 3J81K 3ZN1A 3KP3A 1SD7A 4D0PA 4IRHA 3M8FA 2CG4A 3QAHA 5D4SA 1TTYA 1FNNA 4ZZLA 2RKHA 4FX0A 1WSUA 4P96A 2A6HF 2XAFA 2ZXJA 1CF7B 4M72A 2ACJA 2OQRA 2J5OA 2VE8A 4Q5SF 4YFKF 3BJ6A 1O3TA 2P5VA 1QZZA 3FZVA 2CYYA 3J80K 1JGSA 4Q47A 1EV7A 1ZRCA 2A6EF 3ROUA 4G7HF 4UHTA 3OV8A 2M5WA 4HF2A 4RGUA 1T0FA 2DPDA 2QQBA 3PFIA 2H6CA 5H6RA 1RUNA 3TKYA 1I27A 1V3FA 4BHCA 2V1XA 3R0AA 3V7RA 4YIIA 1FSEA 2K7LA 2MC3A 4GYIA 4S04A 2BBYA 2Z3YA 2UZKA 4HZFA 3FXUA 3I59B 1WI9A 3PQJA 1USTA 4OINF 4HOBA 4KNYA 3ZMSA 1ZARA 1IN6A 2JSCA 1TLHB 5CLSA 1UCRA 1XMKA 2B0LA 3CUOA 5LEKA 2P7CB 3N4MA 1QQIA 2DW4A 2A07F 2RNJA 2AS5F 1XGNA 1MJAA 1OKRA 3ABUA 1S6LA 2P5KA 1XN7A 4WXCA 4LMYA 2ZBKA 3QU3A 2D1VA 1J75A 1B6AA 3QP5A 5E8GA 1O3SA 1FWZA 4IHTA 4EJUA 4E70A 1XD7A 2VOPA 3FWEA 2CW0F 5BOXA 1R1VA 2EV0A 3TO6A 2XHKA 1NHAA 5KK1A 1IN4A 1GHCA 1RI7A 2XAHA 1YW9A 3BWGA 4MEYF 2BYVE 5BQTA 2HEOA 2EFOA 2F5DA 5E1ZB 1HKTA 4YG2F 3HSFA 2STTA 3JAMZ 2Z99A 3B02A 2QWWA 3C7JA 3R4KA 2O61A 5JHUA 5CVIA 4KA4A 3R61A 3M9AA 3IHUA 3E6MA 2JT1A 4RB1A 2IA0A 3I54A 2LF7A 5K5RA 1ZLJA 2L3DA 1I1GA 2Z33A 1R58A 3CUQB 1G3YA 4WXDA 2GXBA 3S2WA 3ZMUA 3D5LA 5D6FA 5D4RA 3GF2A 4B8XA 2KJCA 2EV6A 1U5TB 1PUEE 1GVJA 2KJBA 3I0TA 3GZ6A 3I64A 1R36A 5F64A 2X0LA 1R23A 4ENKA 4LD5A 4U7DA 4XLNF 1J0RA 1DDNA 2F5CA 3CJNA 5LBQA 2QQ9A 4A12A 2K4JA 3MFKA 2MBFA 5CVRA 1DPUA 1REPC 3RTRA 3WU0A 1F1ZA 2FMYA 5DCFA 4KIFA 1J59A 1ULYA 2VODA 1ZH5A 1QGPA 2Y75A 1C0WA 5CYVA 3F8CA 3R6SA 4CGZA 2AXLA 1T98A 3I71A 4L18B 2FE3A 4OIPF 4R1HA 2JPCA 3SHFA 5H20A 1YYVA 2W25A 2WWYA 3N97A 3CO7C 3FMSA 3QU6A 1G3SA 3HSRA 3HTSB 4HF0A 1SD6A 4DQ2A 4OU0A 1E17A 2WV0A 2NS0A 4CYDA 1ZRFA 2YSRA 4HV5A 4LG0A 2PFBA 4NHJA 3P9KA 1R5GA 1IN7A 5L3GA 2ZFWA 2HDCA 1IN8A 5DDGA 2OD5A 1K78B 5FLXZ 1BOAA 1ODDA 2CO5A 2COMA 4QLCU 5F6FA 2NYXA 1LEAA 5DEQA 1I5ZA 4JBAA 2PMHA 2ETHA 4BXUA 2G7UA 3SZPA 1W7PD 1ZGAA 2V1UA 1HW2A 4OIQF 5LLQA 3U1DA 1O7FA 1F4KA 2GWRA 4WK8F 3F22A 1LDDA 1H9GA 2DK8A 4XBFA 4QWQA 1KA8A 3DV8A 5A2QZ 2ZMEA 4EV0A 3I53A 1RUOA 2RV8A 1FYMA 3KLNA 3WGGA 2OQGA 3ZN0A 1SD5A 5H6QA 4RS8A 2RDPA 3H3UA 5HDNA 1EH6A 1RIOH 5DCMB 3CDHA 4LLNA 2DK5A 3LQRA 5JFRA 3RDIA 2YX4A 3GUDA 2ISZA 2BGCA 2DFIA 3ECOA 2CWEA 1TQIA 1YLFA 4IVNA 5L3CA 2NNNA 4P9UA 3WE3A 4EM1A 2EWNA 5HS9A 2IJLA 1T6SA 2FNAA 3MZHA 1O57A 1U8RA 2QVOA 5AIPA 1QZYA 3DXJF 4P55A 3E6CC 4I98B 2FRHA 4Q48A 3M1EA 1HW5A 3TO7A 1CF7A 1MDMB 2F5FA 1LQ1A 3WODF 4HYEA 2C6YA 1W7PB 1FOKA 1EH8A 1XDSA 4Z2YA 2UWMA 1D8JA 1U2WA 1MZBA 1K6OA 5HDGA 3WTWC 2H27A 5BMZA 2NNYA 3KE2A 1YIOA 2PEXA 4HQMA 4I0BA 4CHUA 3E6BA 2HKOA 3RKWA 2QENA 2V1DA 1P6RA 2YU3A 4BNCA 3L00A 1TQMA 2BEOA 3KFWX 4AIKA 4M9ZA 4YFNF 1BIAA 3V8JA 3DPTA 3FMRA 3RKYA 4WWCA 5LGTA 4I01A 2VC1A 2K4BA 3GFMA 2YR2A 3HIFA 3R0JA 4BH9A 2P5LC 4EVIA 1QO0D 5L3BA 3L09A 1FP1D 4A0YA 3GXOA 1SD4A 2GA2A 2FA5A 3HRSA 1Y0UA 2OBPA 5FGMA 4A2UA 3T0YA 4A6DA 2V6CA 3K1MA 4HAMA 2EFWA 2VXZA 1A04A 1TNTA 4UNOA 2FNPA 2VT3A 4LGWA 5L3DA 4KMUX 1T2KA 2XRNA 3KCCA 4BAYA 2W84A 5FD6A 2J5PA 2PJPA 1Z9CA 1W5TA 3HRUA 3GFIA 2JTVA 2P6TA 3JTHA 1G4DA 1BI1A 1SFXA 3NEUA 5ILUA 3OOPA 1YG2A 3Q5FA 1JHFA 3W6JB 2IT0A 3WTUC 2Z5UA 2TDXA 3FXQA 4KIGA 1GXQA 4HW0A 4XRFA 2QBYA 2XKOA 4HX8A 4AIHA 4GYGA 4M71A 4R8HA 4WF2A 1B4AA 2BV6A 3TDZC 4ZYGA 4F7ZA 1YW7A 4LFUA 5J6XA 5LGUA 2DBBA 5D6EA 2GQQA 5D5UB 3HUGA 4GCVA 3VFZA 5A2QK 1J9IA 1IXRC 4LK1F 1IF1A 1VTNC 1ZHFA 1ON2A 2D45A 3IKTA 1Q1HA 3LQQA 1FLIA 4ASNA 4U7BA 2P8TA 3MQ0A 1YO5C 2O3FA 3REOA 2P4WA 1FY7A 3WTXC 3ZP5A 4P9FA 1BI2A 3HSEA 1KQ0A 1U5TC 4I2OA 2WTEA 4PGHA 2G9WA 4AD9A 4EJTA 2RN7A 1MJ9A 1O7LA 4ENNA 1KYWA 4MQ9F 3ZMZA 5E1WA 2HOEA 4AWXB 1G3TA 4WCGA 1LVAA 2K27A 2E1NA 4FHTA 1LNWA 1KGSA 2QZ8A 4ESBA 1D5VA 1IXCA 1W5SA 3GFJA 1YW8A 3E5XA 3WTVC 4O5VA 1BC8C 3TOBA 5LEJA 1MGTA 3ZMVA 3CUQC 2W57A 3I5UA 1ZN2A 4KDPA 3O3KA 3RIRA 2D2WA 1DUXC 4ZZDA 1HXDA 4KICA 1UFMA 4L9VA 2XIGA 2IA2A 3F8NA 4UUVA 2KKOA 4K2EA 2FBHA 1QBJA 4A5NA 4L0YB 1OYWA 2YX7A 3Q9SA 2L01A 3KP4A 2FBKA 5E20A 3TDUC 2H09A 1AWCA 4L9NA 1S7OA 2VN2A 4NQWA 5ERIA 5BPIA 2MLGA 4LJZF 4I09A 3K1PA 2VC0A 3JSOA 4MEXF 3LA3A 3AAFA 4M6XA 2CQKA 1U6GA 4EJWA 3ABTA 4BHBA 3ZQ7A 3H3ZA 4H0EA 4FT8A 2HKXA 3PQKA 4N9HA 5JVTA 4CXFA 4KIBA 1EH7A 2DO7A 3RPUA 2A61A 2QBYB 3NRVA 5LRRA 2KRFA 2F2EA 3ULQB 2UXXA 1R00A 4A0ZA 2RC4A 2HQNA 1G3WA 2QUFA 3GYHX 3C18A 2EJRA 3CTAA 2LNBA 1U78A 1K78A 3EQLF 4L9JA 2W24A 2L54A 5D8KB 1OR7A 3LAPA 1D8KA 1V4RA 2XVCA 1JE8A 2LF8A 2HR3A 2JZYA 1HQCA 4OMYA 2HTJA 3K0LA 1YQAA 1HKSA 1XGMA 3KEQA 1P92A 5J8FA 2XROA 2DQRA 1FZPB 2R3SA 4KFCA 4KUMA 5HVQC 3FF5A 4TV7A 1Z05A 1OYIA 2O6GE 3T8TA 3EETA 1J5YA 3QRFF 3TQNA 2GA1A 4HA8A 5FFXA 4JK1X 3MCZA 1W7PA 3GW2A 1I1SA 2KIFA 4RGRA 4OOIA 4EJOA 3K9TA 2NRAC 1FBQA 3WU1B 3FX3A 2XASA 4EMSA 1KU2A 4ESJA 4RB2C 2VBZA 4UXNA 3F6VA 3TGNA 1O3QA 3DQVC 1B59A 5K5QA 4GGGA 2XAGA 2DT5A 5ED4A 3KP2A 3HOTA 3J7AO 4OIOF 4MTEA 1YS7A 2IP2A 4UVAA 1XB4A 1ZRDA 3LAJA 1BM9A 2LDUA 1YTYA 2Y0MA 3BDDA 4M74A 5CJ9A 1Z91A 3V7SA 1KU3A 4NB5A 1USSA 1J2XA 1WWXA 3F8BA 3V8LA 1ZGJA 2IA1A 5E1XA 4U88A 4HLYA 3WTSC 4MTDA 4LLGF 1LB2A 1SMYF 1P4XA 3E5QA 2R7FA 4IHSA 5BPDA 2DQLA 1TW2A 1K7AA 2VBWA 2ESNA 4U0WA 2EB7A 3RI4A 3TO9A 2OZ6A 1FT9A 3DEUA 3J80Z 3RYRA 1H9TA 3ML6A 3V8KA 1FPQA 1P4WA 4XSXF 4UVBA 2L4AA 2HWVA 3WTTC 5DUKA 3IL2A 3JW4A 4Y17A 4ETSA 2ZO4A 4HDUA 1PP7U 5HLIA 3BOQA 3F3XA 1T39A 1MJBA 1FP2A 3HRMA 4DNCA 1OPCA 3ISPA 3SZTA 1XGOA 4IF4A 2OU2A 4Y15A 2V79A 3WGHA 1XSDA 5J8CA 3RPQA 4UV8A 3DFGA 2XV4S 2MH9A 3ECHA 1S8NA 1S3JA 3VB2A 5BS6A 1BBYA 2H6BA 5FO5A 3FM5A 1SMTA 2GXGA 1L0OC 2L02A 2HGCA 2VBXA 1KU7A 1FX7A 3IC7A 4EQQA 2DI3A 1LEBA 1OYYA 3GEZA 4CZZA 4EGZA 4L5JA 5LRSA 2CFXA 1ONVA 1KQ9A 1O3RA 3QOPA 1UB9A 3IWZA 4OIRF 3G3ZA 2VE9A 1FSHA 5FD5A 3HHHA 1HSTA 5FFZA 5JI6A 4ZH4F 4ENMA 3E3VA 1XCVA 5DUIA 2HYFA 2X4HA 4N0BA 3G73A 5DV5A 4GXOA 2G7HA 3E6DA 5IT9Z 2VONA 4JQFA 5K5OA 4S05A 3F8MA 3GFLA 1SFUA 1J7KA 4MHGA 2PG4A 5FLXK 1BJAA 1ZAOA 2PMUA 3KP7A 3WTYC 1Z1DA 4G6QA 1GXPA 4M73A 2LSOA 2F5EA 2XGXA 4IRIA 3D0SA 2EV5A 5JR3A 3BPXA 3I4PA 4KN7X 4HV6A 2P7VB 2ZNZA 3B73A 1TW3A 4XLPF 2D1HA 1S7AA 3GZ5A 3JSPA 2K02A 4AVPA 3T5XA 2PQ8A 1IW7F 3SQNA 2VBYA 2ELHA 1S29A 1FYLA 4L9TA 5E8IA 4M9SA 5LHIA 3ZMDA 1R22A 1IAWA 2HQRA 4LB6B 2EFPA 3FM3A 2HYGD 3I59A 2EA2A 4GO1A 3WE2A 4MQVA 2ISYA 4ZYHA 5ICEA 5E18F 2O03A 1SAXA 1TQPA 1ZLKA 1RNLA 4EM0B 3F21A 3M7GA 5L3FA 1YFHA 5EEGA 4UV9A 3QPHA 1JHHA 3RKXA 3HYIA 1Z6RA 1BIBA 3RYPA 1G6NA 4P5OA 3ZMTA 3BROA 2A69F 4IRGA 1ZG5A 2P6SA 5D5XB 4RB3C 3W6KB 3QP6A 3J81Z 3U9GA 2DLLA 2W85A 1FBSA 3K69A 2EK5A 5FB2A 2M45A 3FXRA 2QYOA 3EDPA 4ZYDA 2ZMEB 3MAJA 1YS6A 5E17F 1P2FA 3KEOA 2V9VA 4O3MA 2M30A 3EYIA 1KU9A 2JPBA 5DCMA 2ZKZA 1KYZA 2IPQX 3DP7A 3R60A 5DD4A 3WGIA 3VOEA 3I58A 3JAMK 3ELKA 3QPTA 3P9IA 4ENJA 1E2XA 1KQ8A 2A3SA 4Y13A 1H0MA 3BZ6A 4PDKA 2CSOA 3IRQA 3T1BA 1IRFA 1WQ2A 4ESFA 1K79A 4WX9A 4HF1A 4LB5A 1ZG1A 3LA7A 4IJAA 1IZ1A 5LHGA 2OZUA 2PN6A 4Q4ZF 3JTGA 3T8RA 1OMIA 4B09A 1HBXG 1B9MA 4A5MA 4G7ZF 2MD5A 4HBLA 3E5UA 1X3UA 5D5WB 2ADUA 4G9YA 1T38A 1TBXA 4I02A 5L3EA 4RGSA 1XDUA 4U0YA 4FX4A 2OAZA 2STWA 1B9NA 3P9CA 2LKPA 4AIJA 3NQOA 2FEZA 1R1TA 3MWMA 1IN5A 3C1DA 2M1BA 5K1YA 2IVMA 4O6JA 1WKMA 3FHZA 1MD0A 4CICA 2ESHA 1U5TA 3GVAA 5CVVA 1UHMA 2PI0A 1FYKA 4IPAA 4G8XA 3L2CA 3IKVA 3LWFA 2GIVA 4HLXA 1IRGA 2M87A 3TOAA 2OA4A 1R7JA 3MZYA 4KYWA 3M8EA 4EGYA 1MKMA 4U0VA 5DYMA 1LDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 F;  2IW5 A;  5DD8 A;  4EM2 A;  2VOO A;  2HZT A;  2RQP A;  1F9N A;  5IT3 A;  4RAZ A;  3CUQ A;  3EUH A;  2XAJ A;  3E97 A;  3F72 A;  3KZZ A;  3K2Z A;  1STZ A;  2XAQ A;  2FF4 A;  3F23 A;  2GZW A;  4PCQ A;  1Z7U A;  4ON0 A;  2HFH A;  2KIM A;  2EFN A;  3VEP A;  4ZYE A;  1R5H A;  5HOO A;  4I7H A;  5EEH A;  2Z9O A;  1HKQ A;  4UVC A;  1HW1 A;  1DPR A;  1PP8 F;  3KZY A;  3KLO A;  2Y48 A;  1ON1 A;  2FSW A;  3HRT A;  2WC2 A;  2Q2E A;  4RB0 A;  1I6X A;  3VOD A;  1F5T A;  3U2R A;  4R79 A;  3GX4 X;  1B1B A;  5IT9 K;  1ZRE A;  2KIU A;  3EYY A;  2DAO A;  4YFX F;  3GO5 A;  2M8E A;  4BHP A;  5HDK A;  3H92 A;  2PLY A;  5ICC A;  4PZJ A;  2VT2 A;  3LFK A;  1JXS A;  4EJV A;  2FXA A;  3BJA A;  1DP7 P;  1ZG3 A;  3LA2 A;  1IUY A;  1FC3 A;  5D8L B;  1BN5 A;  3L7W A;  3SXY A;  1QPM A;  2EFQ A;  5KVR A;  3SFZ A;  4PGG A;  4LK0 F;  3MEX A;  1XSV A;  1RZ4 A;  1SFE A;  5LGN A;  1WRJ A;  2DU9 A;  4BYY A;  4HDV A;  2FQ3 A;  4HX4 A;  4M6Y A;  6PAX A;  4WXH A;  3F6O A;  1HSJ A;  1BI3 A;  2FOK A;  2Q8K A;  2DPU A;  4A6E A;  2L4M A;  2NAZ A;  1TNS A;  3C3W A;  2O8X A;  1IXS B;  2QM3 A;  3CLO A;  2PBI A;  2K86 A;  5F1R A;  5TJJ A;  2FU4 A;  3FMQ A;  1LJ9 A;  4RGX A;  1ZYR F;  2Q0O A;  5HS8 A;  3BP8 A;  4G7O F;  5AON A;  1XMA A;  4XSZ F;  3KP6 A;  2EA4 A;  4N9I A;  2O0Y A;  1FBU A;  5AIQ A;  1XSX A;  2QQA A;  2YPR A;  4OMZ A;  5ICG A;  3COA C;  3P7N A;  4MGR A;  2FML A;  4HQE A;  2MLK A;  5HLH A;  4RAY A;  2UXN A;  3O2P E;  3HHG A;  2GAU A;  2E7X A;  1PDN C;  2QLZ A;  3IWF A;  5CVU A;  2ZJ2 A;  4IXA A;  1L3L A;  2E1C A;  3IRR A;  1AOY A;  2ZCW A;  2MH2 A;  2IRF G;  4LLL A;  3O6B B;  4BQA A;  1CGP A;  5TRD A;  2DTR A;  4L0Z B;  1R1U A;  4CO8 A;  4KT5 C;  4A0X A;  1XGS A;  4M9X A;  3ZPL A;  1W4M A;  3GLX A;  3L9F A;  3CO6 C;  1P4A A;  5HLG A;  5LHH A;  3WTZ A;  3KET A;  5D5V B;  3BJO A;  3KP5 A;  5HS7 A;  2FBI A;  4HX7 A;  3DPL C;  3WG9 A;  2BE5 F;  3DKW A;  3Q9V A;  3K1N A;  1BI0 A;  1XCB A;  3HOS A;  1D3Y A;  3V4G A;  5ILS A;  4G94 A;  2H94 A;  4G6D A;  1UHW A;  3ERE D;  4I0A A;  3DF8 A;  4KMF A;  4L5I A;  2XKP A;  4KN4 X;  5ILV A;  1U3E M;  2MA3 A;  4MNU A;  2HS5 A;  1LDJ A;  3F8F A;  5CVJ A;  2ZNY A;  3HTU A;  4LG0 B;  2E7W A;  1QNT A;  2R7D A;  2A5Y B;  1MDM A;  2XUB A;  3BY6 A;  4YIF A;  2CGP A;  1Z6T A;  2RGV A;  2RVC A;  3RJP A;  3V7C A;  2HTS A;  4CDG A;  3BPV A;  2JRT A;  1BC7 C;  5ICF A;  3LST A;  3GWZ A;  3J81 K;  3ZN1 A;  3KP3 A;  1SD7 A;  4D0P A;  4IRH A;  3M8F A;  2CG4 A;  3QAH A;  5D4S A;  1TTY A;  1FNN A;  4ZZL A;  2RKH A;  4FX0 A;  1WSU A;  4P96 A;  2A6H F;  2XAF A;  2ZXJ A;  1CF7 B;  4M72 A;  2ACJ A;  2OQR A;  2J5O A;  2VE8 A;  4Q5S F;  4YFK F;  3BJ6 A;  1O3T A;  2P5V A;  1QZZ A;  3FZV A;  2CYY A;  3J80 K;  1JGS A;  4Q47 A;  1EV7 A;  1ZRC A;  2A6E F;  3ROU A;  4G7H F;  4UHT A;  3OV8 A;  2M5W A;  4HF2 A;  4RGU A;  1T0F A;  2DPD A;  2QQB A;  3PFI A;  2H6C A;  5H6R A;  1RUN A;  3TKY A;  1I27 A;  1V3F A;  4BHC A;  2V1X A;  3R0A A;  3V7R A;  4YII A;  1FSE A;  2K7L A;  2MC3 A;  4GYI A;  4S04 A;  2BBY A;  2Z3Y A;  2UZK A;  4HZF A;  3FXU A;  3I59 B;  1WI9 A;  3PQJ A;  1UST A;  4OIN F;  4HOB A;  4KNY A;  3ZMS A;  1ZAR A;  1IN6 A;  2JSC A;  1TLH B;  5CLS A;  1UCR A;  1XMK A;  2B0L A;  3CUO A;  5LEK A;  2P7C B;  3N4M A;  1QQI A;  2DW4 A;  2A07 F;  2RNJ A;  2AS5 F;  1XGN A;  1MJA A;  1OKR A;  3ABU A;  1S6L A;  2P5K A;  1XN7 A;  4WXC A;  4LMY A;  2ZBK A;  3QU3 A;  2D1V A;  1J75 A;  1B6A A;  3QP5 A;  5E8G A;  1O3S A;  1FWZ A;  4IHT A;  4EJU A;  4E70 A;  1XD7 A;  2VOP A;  3FWE A;  2CW0 F;  5BOX A;  1R1V A;  2EV0 A;  3TO6 A;  2XHK A;  1NHA A;  5KK1 A;  1IN4 A;  1GHC A;  1RI7 A;  2XAH A;  1YW9 A;  3BWG A;  4MEY F;  2BYV E;  5BQT A;  2HEO A;  2EFO A;  2F5D A;  5E1Z B;  1HKT A;  4YG2 F;  3HSF A;  2STT A;  3JAM Z;  2Z99 A;  3B02 A;  2QWW A;  3C7J A;  3R4K A;  2O61 A;  5JHU A;  5CVI A;  4KA4 A;  3R61 A;  3M9A A;  3IHU A;  3E6M A;  2JT1 A;  4RB1 A;  2IA0 A;  3I54 A;  2LF7 A;  5K5R A;  1ZLJ A;  2L3D A;  1I1G A;  2Z33 A;  1R58 A;  3CUQ B;  1G3Y A;  4WXD A;  2GXB A;  3S2W A;  3ZMU A;  3D5L A;  5D6F A;  5D4R A;  3GF2 A;  4B8X A;  2KJC A;  2EV6 A;  1U5T B;  1PUE E;  1GVJ A;  2KJB A;  3I0T A;  3GZ6 A;  3I64 A;  1R36 A;  5F64 A;  2X0L A;  1R23 A;  4ENK A;  4LD5 A;  4U7D A;  4XLN F;  1J0R A;  1DDN A;  2F5C A;  3CJN A;  5LBQ A;  2QQ9 A;  4A12 A;  2K4J A;  3MFK A;  2MBF A;  5CVR A;  1DPU A;  1REP C;  3RTR A;  3WU0 A;  1F1Z A;  2FMY A;  5DCF A;  4KIF A;  1J59 A;  1ULY A;  2VOD A;  1ZH5 A;  1QGP A;  2Y75 A;  1C0W A;  5CYV A;  3F8C A;  3R6S A;  4CGZ A;  2AXL A;  1T98 A;  3I71 A;  4L18 B;  2FE3 A;  4OIP F;  4R1H A;  2JPC A;  3SHF A;  5H20 A;  1YYV A;  2W25 A;  2WWY A;  3N97 A;  3CO7 C;  3FMS A;  3QU6 A;  1G3S A;  3HSR A;  3HTS B;  4HF0 A;  1SD6 A;  4DQ2 A;  4OU0 A;  1E17 A;  2WV0 A;  2NS0 A;  4CYD A;  1ZRF A;  2YSR A;  4HV5 A;  4LG0 A;  2PFB A;  4NHJ A;  3P9K A;  1R5G A;  1IN7 A;  5L3G A;  2ZFW A;  2HDC A;  1IN8 A;  5DDG A;  2OD5 A;  1K78 B;  5FLX Z;  1BOA A;  1ODD A;  2CO5 A;  2COM A;  4QLC U;  5F6F A;  2NYX A;  1LEA A;  5DEQ A;  1I5Z A;  4JBA A;  2PMH A;  2ETH A;  4BXU A;  2G7U A;  3SZP A;  1W7P D;  1ZGA A;  2V1U A;  1HW2 A;  4OIQ F;  5LLQ A;  3U1D A;  1O7F A;  1F4K A;  2GWR A;  4WK8 F;  3F22 A;  1LDD A;  1H9G A;  2DK8 A;  4XBF A;  4QWQ A;  1KA8 A;  3DV8 A;  5A2Q Z;  2ZME A;  4EV0 A;  3I53 A;  1RUO A;  2RV8 A;  1FYM A;  3KLN A;  3WGG A;  2OQG A;  3ZN0 A;  1SD5 A;  5H6Q A;  4RS8 A;  2RDP A;  3H3U A;  5HDN A;  1EH6 A;  1RIO H;  5DCM B;  3CDH A;  4LLN A;  2DK5 A;  3LQR A;  5JFR A;  3RDI A;  2YX4 A;  3GUD A;  2ISZ A;  2BGC A;  2DFI A;  3ECO A;  2CWE A;  1TQI A;  1YLF A;  4IVN A;  5L3C A;  2NNN A;  4P9U A;  3WE3 A;  4EM1 A;  2EWN A;  5HS9 A;  2IJL A;  1T6S A;  2FNA A;  3MZH A;  1O57 A;  1U8R A;  2QVO A;  5AIP A;  1QZY A;  3DXJ F;  4P55 A;  3E6C C;  4I98 B;  2FRH A;  4Q48 A;  3M1E A;  1HW5 A;  3TO7 A;  1CF7 A;  1MDM B;  2F5F A;  1LQ1 A;  3WOD F;  4HYE A;  2C6Y A;  1W7P B;  1FOK A;  1EH8 A;  1XDS A;  4Z2Y A;  2UWM A;  1D8J A;  1U2W A;  1MZB A;  1K6O A;  5HDG A;  3WTW C;  2H27 A;  5BMZ A;  2NNY A;  3KE2 A;  1YIO A;  2PEX A;  4HQM A;  4I0B A;  4CHU A;  3E6B A;  2HKO A;  3RKW A;  2QEN A;  2V1D A;  1P6R A;  2YU3 A;  4BNC A;  3L00 A;  1TQM A;  2BEO A;  3KFW X;  4AIK A;  4M9Z A;  4YFN F;  1BIA A;  3V8J A;  3DPT A;  3FMR A;  3RKY A;  4WWC A;  5LGT A;  4I01 A;  2VC1 A;  2K4B A;  3GFM A;  2YR2 A;  3HIF A;  3R0J A;  4BH9 A;  2P5L C;  4EVI A;  1QO0 D;  5L3B A;  3L09 A;  1FP1 D;  4A0Y A;  3GXO A;  1SD4 A;  2GA2 A;  2FA5 A;  3HRS A;  1Y0U A;  2OBP A;  5FGM A;  4A2U A;  3T0Y A;  4A6D A;  2V6C A;  3K1M A;  4HAM A;  2EFW A;  2VXZ A;  1A04 A;  1TNT A;  4UNO A;  2FNP A;  2VT3 A;  4LGW A;  5L3D A;  4KMU X;  1T2K A;  2XRN A;  3KCC A;  4BAY A;  2W84 A;  5FD6 A;  2J5P A;  2PJP A;  1Z9C A;  1W5T A;  3HRU A;  3GFI A;  2JTV A;  2P6T A;  3JTH A;  1G4D A;  1BI1 A;  1SFX A;  3NEU A;  5ILU A;  3OOP A;  1YG2 A;  3Q5F A;  1JHF A;  3W6J B;  2IT0 A;  3WTU C;  2Z5U A;  2TDX A;  3FXQ A;  4KIG A;  1GXQ A;  4HW0 A;  4XRF A;  2QBY A;  2XKO A;  4HX8 A;  4AIH A;  4GYG A;  4M71 A;  4R8H A;  4WF2 A;  1B4A A;  2BV6 A;  3TDZ C;  4ZYG A;  4F7Z A;  1YW7 A;  4LFU A;  5J6X A;  5LGU A;  2DBB A;  5D6E A;  2GQQ A;  5D5U B;  3HUG A;  4GCV A;  3VFZ A;  5A2Q K;  1J9I A;  1IXR C;  4LK1 F;  1IF1 A;  1VTN C;  1ZHF A;  1ON2 A;  2D45 A;  3IKT A;  1Q1H A;  3LQQ A;  1FLI A;  4ASN A;  4U7B A;  2P8T A;  3MQ0 A;  1YO5 C;  2O3F A;  3REO A;  2P4W A;  1FY7 A;  3WTX C;  3ZP5 A;  4P9F A;  1BI2 A;  3HSE A;  1KQ0 A;  1U5T C;  4I2O A;  2WTE A;  4PGH A;  2G9W A;  4AD9 A;  4EJT A;  2RN7 A;  1MJ9 A;  1O7L A;  4ENN A;  1KYW A;  4MQ9 F;  3ZMZ A;  5E1W A;  2HOE A;  4AWX B;  1G3T A;  4WCG A;  1LVA A;  2K27 A;  2E1N A;  4FHT A;  1LNW A;  1KGS A;  2QZ8 A;  4ESB A;  1D5V A;  1IXC A;  1W5S A;  3GFJ A;  1YW8 A;  3E5X A;  3WTV C;  4O5V A;  1BC8 C;  3TOB A;  5LEJ A;  1MGT A;  3ZMV A;  3CUQ C;  2W57 A;  3I5U A;  1ZN2 A;  4KDP A;  3O3K A;  3RIR A;  2D2W A;  1DUX C;  4ZZD A;  1HXD A;  4KIC A;  1UFM A;  4L9V A;  2XIG A;  2IA2 A;  3F8N A;  4UUV A;  2KKO A;  4K2E A;  2FBH A;  1QBJ A;  4A5N A;  4L0Y B;  1OYW A;  2YX7 A;  3Q9S A;  2L01 A;  3KP4 A;  2FBK A;  5E20 A;  3TDU C;  2H09 A;  1AWC A;  4L9N A;  1S7O A;  2VN2 A;  4NQW A;  5ERI A;  5BPI A;  2MLG A;  4LJZ F;  4I09 A;  3K1P A;  2VC0 A;  3JSO A;  4MEX F;  3LA3 A;  3AAF A;  4M6X A;  2CQK A;  1U6G A;  4EJW A;  3ABT A;  4BHB A;  3ZQ7 A;  3H3Z A;  4H0E A;  4FT8 A;  2HKX A;  3PQK A;  4N9H A;  5JVT A;  4CXF A;  4KIB A;  1EH7 A;  2DO7 A;  3RPU A;  2A61 A;  2QBY B;  3NRV A;  5LRR A;  2KRF A;  2F2E A;  3ULQ B;  2UXX A;  1R00 A;  4A0Z A;  2RC4 A;  2HQN A;  1G3W A;  2QUF A;  3GYH X;  3C18 A;  2EJR A;  3CTA A;  2LNB A;  1U78 A;  1K78 A;  3EQL F;  4L9J A;  2W24 A;  2L54 A;  5D8K B;  1OR7 A;  3LAP A;  1D8K A;  1V4R A;  2XVC A;  1JE8 A;  2LF8 A;  2HR3 A;  2JZY A;  1HQC A;  4OMY A;  2HTJ A;  3K0L A;  1YQA A;  1HKS A;  1XGM A;  3KEQ A;  1P92 A;  5J8F A;  2XRO A;  2DQR A;  1FZP B;  2R3S A;  4KFC A;  4KUM A;  5HVQ C;  3FF5 A;  4TV7 A;  1Z05 A;  1OYI A;  2O6G E;  3T8T A;  3EET A;  1J5Y A;  3QRF F;  3TQN A;  2GA1 A;  4HA8 A;  5FFX A;  4JK1 X;  3MCZ A;  1W7P A;  3GW2 A;  1I1S A;  2KIF A;  4RGR A;  4OOI A;  4EJO A;  3K9T A;  2NRA C;  1FBQ A;  3WU1 B;  3FX3 A;  2XAS A;  4EMS A;  1KU2 A;  4ESJ A;  4RB2 C;  2VBZ A;  4UXN A;  3F6V A;  3TGN A;  1O3Q A;  3DQV C;  1B59 A;  5K5Q A;  4GGG A;  2XAG A;  2DT5 A;  5ED4 A;  3KP2 A;  3HOT A;  3J7A O;  4OIO F;  4MTE A;  1YS7 A;  2IP2 A;  4UVA A;  1XB4 A;  1ZRD A;  3LAJ A;  1BM9 A;  2LDU A;  1YTY A;  2Y0M A;  3BDD A;  4M74 A;  5CJ9 A;  1Z91 A;  3V7S A;  1KU3 A;  4NB5 A;  1USS A;  1J2X A;  1WWX A;  3F8B A;  3V8L A;  1ZGJ A;  2IA1 A;  5E1X A;  4U88 A;  4HLY A;  3WTS C;  4MTD A;  4LLG F;  1LB2 A;  1SMY F;  1P4X A;  3E5Q A;  2R7F A;  4IHS A;  5BPD A;  2DQL A;  1TW2 A;  1K7A A;  2VBW A;  2ESN A;  4U0W A;  2EB7 A;  3RI4 A;  3TO9 A;  2OZ6 A;  1FT9 A;  3DEU A;  3J80 Z;  3RYR A;  1H9T A;  3ML6 A;  3V8K A;  1FPQ A;  1P4W A;  4XSX F;  4UVB A;  2L4A A;  2HWV A;  3WTT C;  5DUK A;  3IL2 A;  3JW4 A;  4Y17 A;  4ETS A;  2ZO4 A;  4HDU A;  1PP7 U;  5HLI A;  3BOQ A;  3F3X A;  1T39 A;  1MJB A;  1FP2 A;  3HRM A;  4DNC A;  1OPC A;  3ISP A;  3SZT A;  1XGO A;  4IF4 A;  2OU2 A;  4Y15 A;  2V79 A;  3WGH A;  1XSD A;  5J8C A;  3RPQ A;  4UV8 A;  3DFG A;  2XV4 S;  2MH9 A;  3ECH A;  1S8N A;  1S3J A;  3VB2 A;  5BS6 A;  1BBY A;  2H6B A;  5FO5 A;  3FM5 A;  1SMT A;  2GXG A;  1L0O C;  2L02 A;  2HGC A;  2VBX A;  1KU7 A;  1FX7 A;  3IC7 A;  4EQQ A;  2DI3 A;  1LEB A;  1OYY A;  3GEZ A;  4CZZ A;  4EGZ A;  4L5J A;  5LRS A;  2CFX A;  1ONV A;  1KQ9 A;  1O3R A;  3QOP A;  1UB9 A;  3IWZ A;  4OIR F;  3G3Z A;  2VE9 A;  1FSH A;  5FD5 A;  3HHH A;  1HST A;  5FFZ A;  5JI6 A;  4ZH4 F;  4ENM A;  3E3V A;  1XCV A;  5DUI A;  2HYF A;  2X4H A;  4N0B A;  3G73 A;  5DV5 A;  4GXO A;  2G7H A;  3E6D A;  5IT9 Z;  2VON A;  4JQF A;  5K5O A;  4S05 A;  3F8M A;  3GFL A;  1SFU A;  1J7K A;  4MHG A;  2PG4 A;  5FLX K;  1BJA A;  1ZAO A;  2PMU A;  3KP7 A;  3WTY C;  1Z1D A;  4G6Q A;  1GXP A;  4M73 A;  2LSO A;  2F5E A;  2XGX A;  4IRI A;  3D0S A;  2EV5 A;  5JR3 A;  3BPX A;  3I4P A;  4KN7 X;  4HV6 A;  2P7V B;  2ZNZ A;  3B73 A;  1TW3 A;  4XLP F;  2D1H A;  1S7A A;  3GZ5 A;  3JSP A;  2K02 A;  4AVP A;  3T5X A;  2PQ8 A;  1IW7 F;  3SQN A;  2VBY A;  2ELH A;  1S29 A;  1FYL A;  4L9T A;  5E8I A;  4M9S A;  5LHI A;  3ZMD A;  1R22 A;  1IAW A;  2HQR A;  4LB6 B;  2EFP A;  3FM3 A;  2HYG D;  3I59 A;  2EA2 A;  4GO1 A;  3WE2 A;  4MQV A;  2ISY A;  4ZYH A;  5ICE A;  5E18 F;  2O03 A;  1SAX A;  1TQP A;  1ZLK A;  1RNL A;  4EM0 B;  3F21 A;  3M7G A;  5L3F A;  1YFH A;  5EEG A;  4UV9 A;  3QPH A;  1JHH A;  3RKX A;  3HYI A;  1Z6R A;  1BIB A;  3RYP A;  1G6N A;  4P5O A;  3ZMT A;  3BRO A;  2A69 F;  4IRG A;  1ZG5 A;  2P6S A;  5D5X B;  4RB3 C;  3W6K B;  3QP6 A;  3J81 Z;  3U9G A;  2DLL A;  2W85 A;  1FBS A;  3K69 A;  2EK5 A;  5FB2 A;  2M45 A;  3FXR A;  2QYO A;  3EDP A;  4ZYD A;  2ZME B;  3MAJ A;  1YS6 A;  5E17 F;  1P2F A;  3KEO A;  2V9V A;  4O3M A;  2M30 A;  3EYI A;  1KU9 A;  2JPB A;  5DCM A;  2ZKZ A;  1KYZ A;  2IPQ X;  3DP7 A;  3R60 A;  5DD4 A;  3WGI A;  3VOE A;  3I58 A;  3JAM K;  3ELK A;  3QPT A;  3P9I A;  4ENJ A;  1E2X A;  1KQ8 A;  2A3S A;  4Y13 A;  1H0M A;  3BZ6 A;  4PDK A;  2CSO A;  3IRQ A;  3T1B A;  1IRF A;  1WQ2 A;  4ESF A;  1K79 A;  4WX9 A;  4HF1 A;  4LB5 A;  1ZG1 A;  3LA7 A;  4IJA A;  1IZ1 A;  5LHG A;  2OZU A;  2PN6 A;  4Q4Z F;  3JTG A;  3T8R A;  1OMI A;  4B09 A;  1HBX G;  1B9M A;  4A5M A;  4G7Z F;  2MD5 A;  4HBL A;  3E5U A;  1X3U A;  5D5W B;  2ADU A;  4G9Y A;  1T38 A;  1TBX A;  4I02 A;  5L3E A;  4RGS A;  1XDU A;  4U0Y A;  4FX4 A;  2OAZ A;  2STW A;  1B9N A;  3P9C A;  2LKP A;  4AIJ A;  3NQO A;  2FEZ A;  1R1T A;  3MWM A;  1IN5 A;  3C1D A;  2M1B A;  5K1Y A;  2IVM A;  4O6J A;  1WKM A;  3FHZ A;  1MD0 A;  4CIC A;  2ESH A;  1U5T A;  3GVA A;  5CVV A;  1UHM A;  2PI0 A;  1FYK A;  4IPA A;  4G8X A;  3L2C A;  3IKV A;  3LWF A;  2GIV A;  4HLX A;  1IRG A;  2M87 A;  3TOA A;  2OA4 A;  1R7J A;  3MZY A;  4KYW A;  3M8E A;  4EGY A;  1MKM A;  4U0V A;  5DYM A;  1LDK B; 
#chains in the Genus database with same CATH topology
 2A68 F;  4E7Z A;  2A6T A;  4U87 A;  1BA5 A;  2IW5 A;  5KHD A;  4I76 A;  3A02 A;  4XOT A;  5DD8 A;  4EM2 A;  2E2J J;  2VOO A;  3MKW B;  2HZT A;  2K9S A;  2RQP A;  1F9N A;  2HDD A;  1X1C A;  3TMO A;  5IT3 A;  4RAZ A;  1U0J A;  3CUQ A;  2E2H J;  3EUH A;  1T33 A;  2XAJ A;  3FXK A;  3E97 A;  3F72 A;  3KZZ A;  4D7M A;  3K2Z A;  1STZ A;  2XAQ A;  2FF4 A;  2JUC A;  1NK2 P;  3F23 A;  2GZW A;  3SZG A;  4BBS J;  4PCQ A;  1D5Y A;  4DW6 A;  1Z7U A;  2DYS H;  4ON0 A;  3ABL H;  2ME6 A;  1AKH B;  4IEJ A;  2HFH A;  1WPK A;  2KIM A;  2EFN A;  2NVT J;  3HOW J;  3VEP A;  2E5Z A;  2ZFU A;  2XF5 A;  4ZYE A;  3RZO J;  1R5H A;  2ZSI B;  5HOO A;  1J09 A;  4I7H A;  5EEH A;  2Z9O A;  1HKQ A;  1X4P A;  4UVC A;  1HW1 A;  1DPR A;  1PP8 F;  3KZY A;  3F0C A;  3KLO A;  2Y48 A;  3GZN B;  2VQH A;  1ON1 A;  5E3O A;  5IYD J;  2W4S A;  2FSW A;  3HRT A;  2WC2 A;  3HL2 A;  2Q2E A;  4RB0 A;  2MC4 A;  5EYR A;  5E3N A;  1S5L C;  1I6X A;  2VKE A;  3VOD A;  2JK3 A;  1F5T A;  3U2R A;  2JJ7 A;  1ETO A;  4R79 A;  1Z0X A;  2F4O B;  3GX4 X;  2DA2 A;  4RAF A;  1MH4 A;  4HST A;  4BE2 A;  1MBG A;  2H8R A;  3H5N A;  4A93 J;  1B1B A;  3IH2 A;  3HOZ J;  4NDL A;  5IT9 K;  4E4H A;  1ZRE A;  2KIU A;  3EYY A;  2DAO A;  4YFX F;  2KL4 A;  1U9O A;  3GO5 A;  5F04 A;  3OYJ A;  2M8E A;  4BHP A;  2JVG A;  3ABM H;  5HDK A;  3H92 A;  5B3S H;  2PLY A;  2CQX A;  2X6W A;  3DTK A;  5ICC A;  1MIJ A;  2VT2 A;  4PZJ A;  3LFK A;  1JXS A;  4EJV A;  3DBR B;  2FXA A;  3BJA A;  3JRA A;  1DP7 P;  3OS0 A;  1ZG3 A;  2JRM A;  3LA2 A;  1IUY A;  5CQE A;  1FC3 A;  5FKN A;  5D8L B;  4FCY A;  1BN5 A;  3L7W A;  1X1A A;  1MMN A;  4C9Y A;  1A5J A;  3SXY A;  1QPM A;  3OMY A;  3DEW A;  3IP4 B;  2EFQ A;  5EG0 A;  5KVR A;  4OWR B;  2WAF A;  3ESW B;  3SFZ A;  4PGG A;  2KDZ A;  2YU9 J;  4LK0 F;  3MEX A;  2EZI A;  3FKJ A;  1XSV A;  2O5R A;  5GTH C;  1RZ4 A;  1SFE A;  1RR8 C;  5LGN A;  1WRJ A;  2DU9 A;  4BYY A;  5JHF A;  4HDV A;  2FQ3 A;  4HX4 A;  4M6Y A;  6PAX A;  4WXH A;  1T56 A;  3F6O A;  3E7L A;  1POG A;  1HSJ A;  1BI3 A;  3C2B A;  5GPA A;  5IOY A;  2FOK A;  2M0M A;  3S3N A;  2Q8K A;  2DPU A;  5IOZ A;  4A6E A;  4IOC F;  3DBL B;  1FJL A;  1BW6 A;  1JJ8 C;  2L4M A;  2M9H A;  2NAZ A;  2VLA A;  1TNS A;  1P7J A;  3C3W A;  2O8X A;  2HVS A;  3RPU D;  2HOA A;  1N77 A;  1IXS B;  2QM3 A;  4BJ6 C;  1YX5 A;  2RRE A;  2WBM A;  2M7B A;  3CLO A;  2PBI A;  3TL4 X;  2K86 A;  5F1R A;  2KQR A;  3GBG A;  5J40 A;  5FLM J;  5TJJ A;  1H8A C;  2LBF A;  2FU4 A;  5J4Y A;  3FMQ A;  1LJ9 A;  2K5C A;  1ZYR F;  3LSJ A;  2Q0O A;  4NUB A;  4RGX A;  4S0H B;  4B44 A;  1FIA A;  5HS8 A;  3F9K A;  2WA0 A;  3BP8 A;  4G7O F;  5C3E J;  5AON A;  3L1P A;  1D1C A;  2WY8 Q;  5K7H A;  1XMA A;  2O8K A;  4XSZ F;  1F36 A;  3KP6 A;  1DGW Y;  2EA4 A;  1FBU A;  1XSX A;  2O0Y A;  2QQA A;  2YPR A;  4II2 A;  4N9I A;  4OMZ A;  5AIQ A;  3CJQ B;  3P7N A;  3COA C;  4MGR A;  3CCU I;  2LY1 A;  2FML A;  4HQE A;  1JTX A;  2XB5 A;  2MLK A;  2NXN B;  2L7F P;  4FAS D;  5HLH A;  5HOD A;  2EQR A;  4RAY A;  2AQF A;  2UXN A;  2CV2 A;  3CCJ I;  3NWT A;  3O2P E;  1UAA A;  3HHG A;  3HDD A;  2GAU A;  2E7X A;  1PDN C;  2QLZ A;  2F48 A;  3IUO A;  2HU9 A;  3IWF A;  5CVU A;  2ZJ2 A;  4IXA A;  1ZGW A;  1L3L A;  2WAE A;  2E1C A;  1U9N A;  3IRR A;  2OF7 A;  1AOY A;  2P81 A;  3HPG A;  2ZCW A;  2MH2 A;  2IRF G;  4LLL A;  4II3 A;  2MSY A;  2IEK A;  1DP3 A;  3D5S C;  1P7I A;  3O6B B;  4BQA A;  2W1O A;  2LRE A;  1CGP A;  5TRD A;  2B9S A;  2DTR A;  3W2A A;  2LG4 A;  2DFE A;  4DYQ A;  4L0Z B;  1R1U A;  4CO8 A;  2HNH A;  4KT5 C;  4F93 B;  2YS9 A;  4A0X A;  4C2M J;  1XGS A;  3OL4 A;  4M9X A;  3BZK A;  3ZPL A;  2RNG A;  1W4M A;  3GLX A;  3L9F A;  1XC5 A;  1FOY A;  3CO6 C;  1P4A A;  5EDN A;  1PJR A;  2QSF X;  4YRV A;  5HLG A;  2KT0 A;  1CQT A;  5LHH A;  3CP2 A;  4RM2 A;  3WTZ A;  3AL0 B;  3KET A;  3WHC A;  4CCM A;  5D5V B;  1SFO J;  3BJO A;  2VJJ A;  4N4O B;  3KP5 A;  3H36 A;  5HS7 A;  3GCM A;  1Q1V A;  2FBI A;  4HX7 A;  3DPL C;  3WG9 A;  2BE5 F;  2PJR A;  3DKW A;  1VQK I;  1WGX A;  3Q9V A;  3JRG A;  4CCN A;  1MSE C;  3K1N A;  3OS2 A;  1BI0 A;  3BTL A;  1Y1W J;  4IQ4 A;  1XCB A;  1XG1 A;  3HOS A;  1D3Y A;  3L2U A;  3V4G A;  5ILS A;  4G94 A;  2H94 A;  2KDO A;  2HVR A;  4EEF G;  4CSW A;  4G6D A;  4LIU A;  1UHW A;  3ERE D;  4I0A A;  3DF8 A;  4KMF A;  1WJA A;  3HC7 A;  3Q3S A;  2IAI A;  4L5I A;  2XKP A;  4KN4 X;  3BQZ A;  5ILV A;  1U3E M;  2MA3 A;  3CLQ A;  5DM6 F;  1IG7 A;  2H1L A;  4MNU A;  2HS5 A;  3W6V A;  1LDJ A;  1VF9 A;  3F8F A;  2DMT A;  1VQ5 I;  3HEF A;  5CVJ A;  1U8B A;  2ZNY A;  3HTU A;  4AID A;  3CMA I;  1XS9 A;  3A03 A;  4LG0 B;  4NC6 A;  2M4G A;  2HZD A;  2E7W A;  1QNT A;  2R7D A;  1JJ6 C;  2X6X A;  1FMW A;  2AQE A;  4OAZ A;  2AHQ A;  2A5Y B;  1MDM A;  2XUB A;  3BY6 A;  4DOZ A;  4YIF A;  5IP7 J;  4A3G J;  2CGP A;  4KIS A;  1Z6T A;  2RGV A;  2RVC A;  3RJP A;  3V7C A;  2HTS A;  4CDG A;  3BPV A;  2JRT A;  3FBI B;  5ICF A;  3ZGK A;  1BC7 C;  3LST A;  5B66 C;  1YE9 A;  1G2H A;  3LSK A;  3GWZ A;  3J81 K;  2DMN A;  3ZN1 A;  3KP3 A;  2LC2 A;  1MND A;  1XMX A;  1SD7 A;  4D0P A;  5EG0 B;  3HB9 A;  4F3Q A;  4IRH A;  1BR2 A;  2KMU A;  1W0T A;  3M8F A;  2CG4 A;  3QAH A;  5D4S A;  2ECC A;  1TTY A;  1FNN A;  2XDV A;  3OOU A;  4ZZL A;  5IP6 A;  2RKH A;  2BXZ A;  4FX0 A;  1WSU A;  1W1W E;  4P96 A;  1BL0 A;  2A6H F;  3BZC A;  3LSR A;  2XAF A;  2ZXJ A;  3MD2 A;  1A6I A;  3DU6 A;  4E7I A;  1CF7 B;  3DU5 A;  4M72 A;  2ACJ A;  4PJL A;  2OQR A;  3I4N J;  2XSJ C;  2J5O A;  2VE8 A;  4A3C J;  3CD6 I;  4Q5S F;  3KEY A;  5TGT A;  3S2D J;  1NK3 P;  2H8W A;  3PFY A;  1HLV A;  3CCQ I;  4YFK F;  3BJ6 A;  1O3T A;  2P5V A;  1QZZ A;  4N4N B;  3FZV A;  2CYY A;  4AVZ A;  3J80 K;  2JN6 A;  4HNT A;  5DTD A;  1JGS A;  1EA3 A;  4Q47 A;  4PK4 A;  1EV7 A;  1ZRC A;  2A6E F;  1A31 A;  3CP8 A;  1TC3 C;  4BEH A;  1E0E A;  1SVM A;  3ROU A;  4Y3O A;  4IQJ A;  2HOT A;  5FKK A;  4G7H F;  4CCJ A;  4UHT A;  3A2K A;  3OV8 A;  4XLC A;  2M5W A;  1R4M B;  4HF2 A;  2IS2 A;  4RGU A;  1T0F A;  2DPD A;  2FQ4 A;  1QVU A;  2QQB A;  3PFI A;  3OYN A;  2H6C A;  5H6R A;  3I56 I;  1RUN A;  3TKY A;  1I27 A;  1MH3 A;  1V3F A;  2V9K A;  2V1X A;  4BHC A;  3R0A A;  4BY7 J;  1YOV B;  3V7R A;  4G12 A;  3ZXS A;  4YII A;  1FSE A;  5HNH A;  5IPA A;  2K7L A;  2MC3 A;  1VQL I;  2I10 A;  3QOD A;  4GYI A;  4XKB A;  2ZJP F;  4S04 A;  4JX5 A;  2BBY A;  2Z3Y A;  1JTY A;  4DIQ A;  2UZK A;  3L2W A;  4HZF A;  5EZH A;  3S3M A;  1IO2 A;  3FXU A;  1LFU P;  3I59 B;  1WI9 A;  3BR1 A;  3PQJ A;  1UST A;  5K7Z A;  2DA1 A;  1FOW A;  4OIN F;  4HOB A;  2L7Z A;  4KNY A;  3ZMS A;  1ZAR A;  1IN6 A;  2JSC A;  1TLH B;  3KPH A;  3WG7 H;  5CLS A;  1UCR A;  1XMK A;  2B0L A;  2XGE A;  3CUO A;  5LEK A;  1X2N A;  2P7C B;  3N4M A;  4DYC A;  1QQI A;  2TRT A;  2MYS A;  2DW4 A;  2A07 F;  4B4C A;  2RNJ A;  2AS5 F;  1XGN A;  1BR1 A;  1MJA A;  1OKR A;  3SFI A;  3OYL A;  1IC8 A;  1V54 H;  3CES A;  3ABU A;  1S6L A;  2DA7 A;  3SEZ A;  2P5K A;  2ZME C;  2LVS A;  4UB8 C;  3GTK J;  4IO9 F;  2LP0 A;  3W2V A;  1XN7 A;  4XID A;  5EGO A;  4WXC A;  4LMY A;  3DCF A;  2I8D A;  2ZBK A;  3QU3 A;  2D1V A;  1J75 A;  2X6Y A;  2IXS A;  1B6A A;  1OR7 C;  4RMN A;  2BVL A;  1XPX A;  3QP5 A;  1B8I B;  5E8G A;  1O3S A;  2ECB A;  1FWZ A;  2E34 A;  4IHT A;  4EJU A;  4E70 A;  1XD7 A;  2VOP A;  2VL8 A;  3FWE A;  3PL8 A;  2CW0 F;  4NQW B;  5BOX A;  3OIO A;  3BR6 A;  1JI8 A;  1OLT A;  1R1V A;  1WH5 A;  2EV0 A;  3TO6 A;  2XHK A;  1NHA A;  5KK1 A;  1IN4 A;  1GHC A;  1RES A;  2CW8 A;  1RI7 A;  1TT0 A;  1YHQ I;  2XAH A;  1YW9 A;  3BWG A;  2XGC A;  4MEY F;  2BYV E;  5BQT A;  1PUF B;  1ETY A;  2HEO A;  1X1B A;  1VQ7 I;  3ZR8 X;  2EFO A;  1AA7 A;  4AUX A;  2OCE A;  2F5D A;  1LFP A;  3CDL A;  1IV8 A;  3CJR B;  5E1Z B;  3K7A J;  1HKT A;  2LTP A;  3UNG C;  5E3M A;  4YG2 F;  2R7O A;  3HSF A;  2STT A;  4XKW A;  4F55 A;  4HEA 2;  3JAM Z;  2Z99 A;  5B1A H;  3B02 A;  1KZH A;  2R7X A;  2QWW A;  4ABZ A;  1VQN I;  4BDZ A;  3C7J A;  3R4K A;  3LSM A;  4EAT A;  2O61 A;  1YJW I;  3BG6 A;  5JHU A;  5CVI A;  4KA4 A;  4BAC A;  3R61 A;  4B3X A;  2K9M A;  3M9A A;  5DS9 A;  1VQM I;  3IHU A;  3E6M A;  2JT1 A;  3BCB A;  1YIT I;  4XN0 A;  3LNQ A;  2DOE A;  4PSX A;  2IA0 A;  4RB1 A;  1OJL A;  3I54 A;  2LF7 A;  4C30 A;  5K5R A;  1BOB A;  5F0H A;  1ZLJ A;  2L3D A;  2NVU B;  1MSF C;  4ZTJ A;  1I1G A;  2Z33 A;  1R58 A;  3CUQ B;  1G3Y A;  4WXD A;  4B48 A;  2GXB A;  3CF2 A;  3S2W A;  3TW7 A;  3JR9 A;  3ZMU A;  3K4B A;  1GUU A;  3D5L A;  2MFZ A;  2KRC A;  5D6F A;  5D4R A;  1P9Q C;  3GF2 A;  4B8X A;  1VI0 A;  1Y0N A;  1UG0 A;  3LSI A;  3TW6 A;  3S17 J;  3BT9 A;  1OCR H;  2KJC A;  2EV6 A;  1TP4 A;  3AG4 H;  2CV0 A;  1U5T B;  1WFX A;  1GVJ A;  4J19 A;  1PUE E;  2KJB A;  1I6H J;  3I0T A;  3GZ6 A;  3I64 A;  1R36 A;  5F64 A;  4XR6 A;  3S15 J;  1MMD A;  2X0L A;  1R23 A;  2EPF A;  4HPQ A;  3UKG A;  4KIT B;  4ENK A;  3G1O A;  4LD5 A;  1W0U A;  2CUE A;  4GRI A;  4U7D A;  4XLN F;  1J0R A;  1DDN A;  4ZDO A;  2Z1D A;  3P5J A;  2F5C A;  3CJN A;  5LBQ A;  4DBR A;  2X1C A;  2QQ9 A;  3NWS A;  1Y8R B;  4A12 A;  1V5E A;  3S3O A;  3FXM A;  2K4J A;  4ANJ A;  4IHY A;  3MFK A;  3PO2 J;  2MBF A;  5CVR A;  1BJZ A;  1DPU A;  1REP C;  3RTR A;  3WU0 A;  1F1Z A;  2FMY A;  4UUS A;  5DCF A;  1IRX A;  2EBI A;  3CMM A;  2HQ5 A;  4KIF A;  1J59 A;  1ULY A;  1NTC A;  2VOD A;  1ZH5 A;  1QGP A;  1A6Q A;  1N25 A;  2Y75 A;  4MFD A;  1C0W A;  3RZD J;  3CCV I;  5CYV A;  3GTO J;  3F8C A;  3R6S A;  4CGZ A;  2AXL A;  1T98 A;  3FBN B;  3VSL A;  2IS1 A;  3I71 A;  3DBH B;  4L18 B;  5EEA A;  2FE3 A;  4OIP F;  3CQZ J;  1FTT A;  4R1H A;  3GTG J;  2JPC A;  3SHF A;  1JT6 A;  5H20 A;  1YYV A;  5IP9 J;  2W25 A;  3I4M J;  3I55 I;  2L2O A;  2WWY A;  3QPS A;  1RR7 A;  3N97 A;  3CO7 C;  5IYB J;  5HLT A;  3FMS A;  3QU6 A;  1EJ9 A;  3PIO F;  1G3S A;  3AKZ A;  2X6O A;  2X9D A;  1KON A;  4CH7 A;  1I39 A;  3HSR A;  3PJR A;  4LG3 A;  4XQF A;  1ETQ A;  3HTS B;  2DA6 A;  5M3M J;  2DDA A;  4HF0 A;  1SD6 A;  3PO3 J;  1LUJ B;  2BZT A;  4DQ2 A;  3E0J B;  3IAM 2;  3BG3 A;  5LD2 C;  4P1W A;  3B6C A;  4OU0 A;  1IGN A;  1E17 A;  1X1D A;  2WV0 A;  1BW5 A;  2Y9Y A;  5KAI C;  2NS0 A;  2VJI A;  4E7L A;  2E36 A;  4CYD A;  2E1M B;  4E7H A;  3PSF A;  1ZRF A;  2YSR A;  2BW3 A;  1NH3 A;  4HV5 A;  4LG0 A;  4DBQ A;  2BOL A;  2LFB A;  2M0C A;  2PFB A;  4NHJ A;  3HGY A;  5M5Y J;  3P9K A;  1R5G A;  2CMP A;  3BLY A;  1QA6 A;  1IN7 A;  1IDY A;  5L3G A;  2ZFW A;  1ERD A;  2HDC A;  1IN8 A;  4A3I J;  2XC7 A;  1VQO I;  2JVH A;  5DDG A;  3CMY A;  2VXD A;  3KYL A;  1S7E A;  2OD5 A;  1K78 B;  2BY0 A;  5FLX Z;  1BOA A;  1JUS A;  1D0Y A;  4PFP A;  1SVL A;  1ODD A;  2UV1 A;  2CO5 A;  1ZTR A;  2COM A;  4QLC U;  4J01 A;  5F6F A;  2WB1 A;  2NYX A;  3LMM A;  4BKX A;  1LEA A;  2CQQ A;  5DEQ A;  1I5Z A;  4JBA A;  3K6G A;  2PMH A;  2ETH A;  5EGO B;  4BXU A;  2G7U A;  3CF5 F;  1WJF A;  4ZYA A;  3OYC A;  3SZP A;  1W7P D;  1ZGA A;  2M3A A;  2KHM A;  2V1U A;  3VYT B;  1HW2 A;  4OIQ F;  5LLQ A;  3U1D A;  1O7F A;  1F4K A;  2IS4 A;  4PJN A;  4CZC A;  4XLF A;  3LSP A;  2GWR A;  5J4V A;  4WK8 F;  2KIQ A;  3F22 A;  3JRF A;  4J00 A;  2VUM J;  1LDD A;  2XF7 A;  2WV1 A;  3K70 C;  2DTZ A;  4C3H J;  1H9G A;  2DK8 A;  4XBF A;  3JRI A;  4QWQ A;  1KA8 A;  3DV8 A;  2KPM A;  2PJR B;  5A2Q Z;  2ZME A;  4EV0 A;  3I53 A;  1RUO A;  4IHV A;  2KFD A;  2RV8 A;  3KLN A;  1FYM A;  3WGG A;  1VQP I;  2E2I J;  3K4C A;  3S8P A;  3Q0U A;  1TWA J;  1D1B A;  2OQG A;  3ZN0 A;  1SD5 A;  2KP6 A;  4M3D A;  3HOV J;  5H6Q A;  3ABK H;  1SFK A;  3A0B C;  4RS8 A;  3LOC A;  2RDP A;  2VAS A;  3H3U A;  5HNF A;  2CQN A;  3S93 A;  5HDN A;  1EH6 A;  1RIO H;  4DYR A;  5DCM B;  2LLK A;  2E35 A;  3CDH A;  2OPT A;  4LLN A;  2DK5 A;  3LQR A;  5JFR A;  1Z7L A;  3RDI A;  3IH4 A;  3GUD A;  2DFH A;  2YX4 A;  2GOX B;  5J1R A;  1ETX A;  5FLV A;  3J7A Y;  2ISZ A;  2BGC A;  2DFI A;  4X1E A;  4BDY A;  3ECO A;  3U21 A;  2CWE A;  1TQI A;  1YLF A;  4IVN A;  5L3C A;  2NNN A;  4P9U A;  3S32 A;  3WE3 A;  3SJM A;  4EM1 A;  2DJI A;  2EWN A;  5HS9 A;  1X1P A;  1Z77 A;  2LR8 A;  2IJL A;  1T6S A;  3D1N I;  2FNA A;  1RKW A;  3JRD A;  4LOC A;  2CW7 A;  3MZH A;  1O57 A;  2QVO A;  3QQA A;  5AIP A;  3A01 A;  1QZY A;  3JRH A;  1U8R A;  3DXJ F;  1IDZ A;  2DN0 A;  4P55 A;  4NC7 A;  3E6C C;  3DTE A;  1SC7 A;  4I98 B;  1MNE A;  3TP3 A;  4DZJ A;  4XKC A;  2FRH A;  4Q48 A;  3RSN A;  3M1E A;  4IZZ A;  2IGN A;  1HW5 A;  2HXI A;  3TO7 A;  3J7Z I;  1CF7 A;  1UMQ A;  1MDM B;  5M3F J;  5CKT A;  2F5F A;  1LQ1 A;  1LE8 B;  2VB6 A;  1A35 A;  3WOD F;  2XPU A;  4HYE A;  4HNU A;  2C6Y A;  3S1M J;  1W7P B;  2CUJ A;  1W5C C;  4RLQ A;  1EH8 A;  1XDS A;  4Z2Y A;  3SDG A;  1FOK A;  2UWM A;  1D8J A;  1U2W A;  1MZB A;  1K6O A;  3QYE A;  5HDG A;  2HPM A;  4ZTF A;  2NVY J;  2OTJ I;  2DOD A;  3WTW C;  2H27 A;  2M2E A;  5BMZ A;  2NNY A;  3BG5 A;  1JKQ C;  3MVP A;  3KE2 A;  1YIO A;  2PEX A;  4HQM A;  4I0B A;  4CHU A;  4KJZ A;  3E6B A;  4FIS A;  2OTL I;  2HKO A;  2DT7 B;  3RKW A;  2QEN A;  2V1D A;  3M3Y J;  4I6Z A;  4XOR A;  2LMD A;  3H0G J;  1QHG A;  1P6R A;  3EPZ A;  5JVG F;  4A3E J;  2YU3 A;  1H89 C;  1T8I A;  4BNC A;  3L00 A;  3M4O J;  1LFB A;  4QSH A;  3GTP J;  3S1R J;  5BNG A;  1TQM A;  2BEO A;  3KFW X;  1ZK8 A;  2BY2 A;  2DOF A;  4AIK A;  4M9Z A;  2ZB9 A;  1MBE A;  4YFN F;  2DMU A;  1WJ5 A;  1BIA A;  3V8J A;  3DPT A;  3FMR A;  1HF0 A;  2QSG X;  3RKY A;  2WAD A;  3VPR A;  4WWC A;  5LGT A;  4YEJ A;  4AYB A;  2EIN H;  4QPQ A;  1AKH A;  3CCL I;  4I01 A;  2R5Y A;  4PFO A;  1VQ4 I;  2VC1 A;  1FMV A;  2K4B A;  4HRI A;  3GFM A;  1R9T J;  1FEX A;  2K9Q A;  2YR2 A;  3HIF A;  3R0J A;  4D5C A;  5C44 J;  4BH9 A;  3ZQL A;  3OYB A;  4XLE A;  5GAG J;  2V9P A;  4BE0 A;  3JRC A;  2P5L C;  4EVI A;  1QO0 D;  2R4G A;  2VKV A;  3S14 J;  5L3B A;  3L09 A;  1FP1 D;  2X51 A;  3FIS A;  4A0Y A;  3GXO A;  2XSD C;  5GP9 A;  2R5Z B;  3MKL A;  3FK6 A;  1SD4 A;  2GA2 A;  2FA5 A;  3HRS A;  3K10 A;  1Y0U A;  2OBP A;  3PSI A;  1VQ8 I;  1TWH J;  2L9N A;  4IKF A;  5FGM A;  2X1D A;  3H9Q A;  4A2U A;  3BC8 A;  2I5U A;  1WJC A;  3T0Y A;  4RDU A;  1RET A;  1Y6I A;  3I9V 2;  4A6D A;  5FRN A;  2V6C A;  3K1M A;  4B43 A;  4HAM A;  2EFW A;  1ITY A;  2VXZ A;  1A04 A;  1TNT A;  1T0F C;  4UNO A;  3HOX J;  2FNP A;  2VT3 A;  3ASN H;  4LGW A;  5L3D A;  2R7V A;  2DA3 A;  3BR0 A;  3OYH A;  4KMU X;  3IH3 A;  1T2K A;  2XRN A;  3ZQH A;  2V6E A;  3K4K A;  3KCC A;  3BCA A;  3QYB A;  4BAY A;  2W84 A;  3KZI C;  5FD6 A;  4BL0 B;  2J5P A;  2MW8 A;  5FKO A;  3M1C A;  2PJP A;  4UUT A;  5B5E C;  1MMS A;  3OIP A;  1R6R A;  3VYS B;  1Z9C A;  2X48 A;  1W5T A;  3LL7 A;  3HRU A;  3GFI A;  2JTV A;  2P6T A;  3JTH A;  2JUG A;  2Z16 A;  1EKE A;  3FXJ A;  1D1A A;  1G4D A;  1BI1 A;  1SFX A;  5F27 A;  3NEU A;  2COB A;  2V7F A;  5ILU A;  3OOP A;  3CCS I;  3S1Q J;  4PJJ A;  2L7K A;  2Y30 A;  1YG2 A;  1QZE A;  1SVO A;  2QQ8 A;  3Q5F A;  1A36 A;  1JHF A;  1WJE A;  3W6J B;  2VQG A;  1Y1V J;  2IT0 A;  3H9G A;  2M8G X;  4RAG A;  4Z6Y A;  3WTU C;  2Z5U A;  2TDX A;  3FXQ A;  2VQC A;  1QHH D;  1MW7 A;  2DFF A;  4JP0 A;  3CC2 I;  2DA5 A;  4KIG A;  4YEL A;  1GXQ A;  5GTI C;  4HW0 A;  4XRF A;  2QBY A;  2R7Q A;  2XKO A;  1DQU A;  4HX8 A;  3TBI A;  2MD0 A;  4AIH A;  4GYG A;  3ONQ A;  4M71 A;  4R8H A;  4WF2 A;  2M7A A;  1B4A A;  2BV6 A;  2L9R A;  2K9L A;  3TDZ C;  2K3F A;  4ZYG A;  4F7Z A;  1YW7 A;  3EUA A;  4LFU A;  5J6X A;  2DBB A;  5LGU A;  5JLW A;  3AFH A;  3G1L A;  2L5Q A;  5D6E A;  4W1U A;  2EIM H;  2GQQ A;  5D5U B;  3HUG A;  2OV7 A;  2QSH X;  3OS1 A;  2Y2Z A;  3ZQC A;  4GCV A;  5TIS C;  3S1N J;  3BTC A;  3EUH C;  3VFZ A;  1PVE A;  2XRL A;  5A2Q K;  1J9I A;  1IXR C;  4Y7N J;  4LK1 F;  1IF1 A;  1VTN C;  1ZHF A;  1ON2 A;  2D45 A;  1N78 A;  3IKT A;  4A3B J;  1Q1H A;  3HGG A;  4BQQ A;  3LQQ A;  1FLI A;  1UHS A;  2CUF A;  4ASN A;  4B3A A;  4U7B A;  1N75 A;  2P8T A;  3MQ0 A;  1YO5 C;  2O3F A;  3REO A;  2HXO A;  4MFE A;  2P4W A;  1FY7 A;  3A01 B;  3WTX C;  3ZP5 A;  4CCK A;  2VKD A;  2JA7 J;  1DU6 A;  4P9F A;  1BI2 A;  3HSE A;  1HDP A;  3DKY A;  1QRY A;  1KQ0 A;  1U5T C;  3GTJ J;  4I2O A;  2WTE A;  2Q1Z B;  2G9W A;  4PGH A;  4AD9 A;  3OYK A;  4XN3 A;  4EJT A;  2E1M C;  2RN7 A;  1MJ9 A;  1O7L A;  5DM7 F;  4ENN A;  1KYW A;  2VKH A;  1OIS A;  4PJM A;  4D7N A;  4MQ9 F;  2XGD A;  1QU3 A;  3ZMZ A;  4A3K J;  1XTA A;  1WH7 A;  5E1W A;  2HOE A;  4AWX B;  1G3T A;  4WCG A;  1RRJ A;  3CCE I;  1LVA A;  2K27 A;  2E1N A;  1FTZ A;  4FHT A;  1YI2 I;  1LNW A;  2R7U A;  4BE1 A;  3L2V A;  3QYF A;  3H9J A;  4HSR A;  3HJE A;  3JCU C;  1KGS A;  2QZ8 A;  4CCO A;  4XLA A;  4ESB A;  1D5V A;  1IXC A;  1VQ6 I;  1W5S A;  3GFJ A;  2DT6 A;  4FTH A;  1FOX A;  2PMZ N;  2N8G A;  1YW8 A;  3E5X A;  3WTV C;  4O5V A;  2B63 J;  1R71 A;  3K70 D;  1BC8 C;  3K4M A;  3TOB A;  5LEJ A;  2HI3 A;  1OQY A;  1MGT A;  3H5R A;  1ACI A;  1T95 A;  4XM3 A;  3ZMV A;  3CUQ C;  2W57 A;  1YX3 A;  4D5F A;  3I5U A;  1ZN2 A;  3H3V K;  3RQ4 A;  3O3K A;  3RIR A;  3O8G A;  4KDP A;  2D2W A;  2DCE A;  3FIW A;  1HXD A;  2JMW A;  4ZZD A;  1DUX C;  4KIC A;  1UFM A;  2JWT A;  4L9V A;  2CS3 A;  3WU2 C;  4DGW B;  2KIS A;  3OSG A;  2NVX J;  2XIG A;  3PNY A;  5J1U A;  1GDT A;  3RQI A;  1W36 C;  1B72 B;  2IA2 A;  3F8N A;  4BBR J;  4UUV A;  2ICW G;  2KKO A;  2LK2 A;  4K2E A;  2FBH A;  2OUM A;  2R5Y B;  1HCR A;  1QBJ A;  4A5N A;  3CCY A;  2JQ7 A;  4L0Y B;  1OYW A;  2YX7 A;  2LRD A;  3Q9S A;  3DLA A;  2L01 A;  3KP4 A;  2FBK A;  4V2F A;  4YIR X;  2R7W A;  1VFC A;  5E20 A;  3TDU C;  2G0E A;  3DTI A;  2DJN A;  2H09 A;  1AWC A;  4L9N A;  1S7O A;  2L0K A;  2VN2 A;  4NQW A;  5ERI A;  4XK4 A;  1K61 A;  1WJB A;  5BPI A;  1I3Q J;  2MLG A;  2LY2 A;  2E71 A;  4LJZ F;  4I09 A;  2X1E A;  3K1P A;  2VC0 A;  2LKS A;  1ZR4 A;  3JSO A;  1XX5 A;  3OR2 C;  4A3L J;  2LOO A;  3ZCO A;  4MEX F;  4M3F A;  4Y52 J;  3LA3 A;  3AAF A;  4M6X A;  2CQK A;  3OYF A;  2ZJR F;  1D0X A;  1U6G A;  4EJW A;  3CC4 I;  1ENH A;  2AXT C;  3ABT A;  5FKL A;  4BHB A;  2ZC2 A;  2F6C A;  3MZ8 A;  5FJ8 J;  2QKL B;  3ZQ7 A;  3H3Z A;  1R49 A;  2R7S A;  4H0E A;  1LKX A;  4FT8 A;  2HKX A;  4BQN A;  3PQK A;  4D9J A;  4JOM A;  3L2R A;  4AC0 A;  3KYD B;  4N9H A;  2BXY A;  4CXF A;  5JVT A;  4QTR A;  2XPW A;  3U1K A;  4FET A;  2RQQ A;  1APL C;  3GME A;  4KIB A;  1EH7 A;  2DO7 A;  1VQ9 I;  1ETV A;  3RPU A;  2A61 A;  2QBY B;  3NRV A;  2ELK A;  4BUP A;  2WB1 N;  2LD5 A;  4L5E A;  1ZQ3 P;  5LRR A;  2KRF A;  2F2E A;  3ULQ B;  2UXX A;  3WHB A;  5E3L A;  4ZC3 A;  2Y0S N;  1R4N B;  2EZH A;  1IV6 A;  1R00 A;  2VI6 A;  3LSG A;  4A0Z A;  2RC4 A;  2HQN A;  3BG7 A;  1G3W A;  2QUF A;  3HPH A;  1R5I D;  1MMA A;  3C18 A;  4XON A;  3GYH X;  2EJR A;  3CTA A;  2LNB A;  4UB6 C;  4RA2 A;  1U78 A;  1K78 A;  3EQL F;  4M3B A;  3A0H C;  4L9J A;  2W24 A;  2L54 A;  9ANT A;  5D8K B;  1OR7 A;  4UUS B;  2NOG A;  5KAF C;  3LAP A;  3MKZ A;  4E7K A;  1O4X A;  1VND A;  1MBF A;  4C2U A;  1D8K A;  1V4R A;  2JA6 J;  2XVC A;  4B47 A;  1X58 A;  4NNJ A;  1JE8 A;  2JA5 J;  2HPI A;  2LF8 A;  3SDB A;  2HR3 A;  2JZY A;  1HQC A;  4OMY A;  2FD5 A;  2HTJ A;  3K0L A;  3TED A;  1YQA A;  1HKS A;  3NAU A;  1XGM A;  1ETW A;  3KEQ A;  1P92 A;  3M07 A;  5J8F A;  3CC7 I;  2XRO A;  2LKX A;  1E3P A;  2OCC H;  1WCM J;  2DQR A;  4RBO A;  4I99 C;  2R3S A;  1FZP B;  4KFC A;  4IHX A;  4KUM A;  3DPU A;  5HVQ C;  3FF5 A;  4TV7 A;  1Z05 A;  1K4S A;  1OYI A;  2K40 A;  2O6G E;  3T8T A;  1T08 B;  1H88 C;  3HOU J;  4BXX J;  3EET A;  2QEX I;  3HBL A;  1TWC J;  4F92 B;  1J5Y A;  3N05 A;  2EZK A;  3PM1 A;  3QRF F;  1HA8 A;  4BJT A;  3TQN A;  2GA1 A;  1OCZ H;  5F08 A;  3E1S A;  4HA8 A;  5FFX A;  3G1M A;  4JK1 X;  3MCZ A;  1W7P A;  2MAB A;  3GW2 A;  3OSF A;  1I1S A;  2KIF A;  2ID6 A;  1GV5 A;  1UEL B;  4RGR A;  1E3H A;  4OOI A;  4EJO A;  1Y8Q B;  3OIQ A;  2F5V A;  3K9T A;  2ZSH B;  1YJN I;  2GLO A;  4ZDP A;  1GT0 C;  1FBQ A;  2NRA C;  3Q0V A;  2W7N A;  3WU1 B;  4M3G A;  3FX3 A;  2XAS A;  4EMS A;  1IUF A;  2HOS A;  1KU2 A;  3I3L A;  3QOE A;  2L9S A;  1YIJ I;  4ESJ A;  1JKR C;  4RB2 C;  1HC8 A;  2DOA A;  2VBZ A;  4UXN A;  3OYI A;  2ZXW H;  3F6V A;  3TGN A;  1O3Q A;  1G8X A;  1MNM C;  4MIM A;  3DQV C;  1B59 A;  4CUG A;  2EIK H;  1X19 A;  2HYJ A;  2KZV A;  1OCT C;  1SEU A;  2R92 J;  2LBF B;  2E5N A;  5K5Q A;  1OCC H;  1S72 I;  4GGG A;  3W3C A;  2XAG A;  3KYC B;  1I50 J;  3SYT A;  2DT5 A;  4H4K C;  3IV5 A;  4DZP A;  5ED4 A;  5KNL A;  3ZQQ A;  3KP2 A;  3HOT A;  3AG1 H;  3J7A O;  2LYC A;  4B1R A;  1YS7 A;  4MTE A;  4OIO F;  2XPV A;  2IP2 A;  1G59 A;  4UVA A;  1XB4 A;  1ZRD A;  4BU2 A;  3LAJ A;  3L2Q A;  2BVM A;  2VJ4 A;  1BM9 A;  4E6K G;  2LDU A;  1YTY A;  2Y0M A;  4IX7 A;  1V55 H;  1FIP A;  3BDD A;  4M74 A;  2NS7 A;  1ORK A;  1OCO H;  1YRN B;  5CJ9 A;  1Z91 A;  2EIL H;  2V26 A;  3V7S A;  4KT6 A;  1KU3 A;  4NB5 A;  1USS A;  3OWT A;  2WAQ A;  1X3Z B;  1J2X A;  2W00 A;  2Y69 H;  3RCO A;  2MGQ A;  1LVK A;  4V2G A;  5FRO A;  1W36 D;  1WWX A;  3F8B A;  3V8L A;  1ZGJ A;  2D5V A;  1Z3X A;  2IA1 A;  1X3W B;  2MG4 A;  5E1X A;  3O8H A;  2EZL A;  3ASO H;  4U88 A;  4HLY A;  3KIO A;  1E3O C;  4XL9 A;  3WTS C;  4MTD A;  3CCR I;  3FXO A;  3ZQF A;  2DMQ A;  3AG3 H;  4XRS A;  4ZDL A;  4LLG F;  1LB2 A;  1SMY F;  2M4K A;  2QA4 I;  1SAU A;  1P4X A;  2O7O A;  3E5Q A;  2R7F A;  4IHS A;  3MN2 A;  3BTI A;  5BPD A;  2DQL A;  3GTL J;  3K4N A;  3OYD A;  2PMZ A;  1TW2 A;  1Z21 A;  2JA8 J;  1K7A A;  2ZJQ F;  3JRE A;  2VBW A;  2ESN A;  4U0W A;  3H0D A;  1V5F A;  2EB7 A;  3HXL A;  3HG9 A;  3RI4 A;  1TWG J;  4X6A J;  1AHD P;  3TO9 A;  2OZ6 A;  1FT9 A;  3DEU A;  1MMG A;  2P0W A;  3J80 Z;  3RKQ A;  3D5R C;  3DEE A;  3RYR A;  1H9T A;  3HOY J;  3ML6 A;  3V8K A;  1FPQ A;  2QKM B;  3DLL F;  1P4W A;  4XSX F;  4UVB A;  2L4A A;  2HWV A;  3WTT C;  4Y33 A;  5DUK A;  3IL2 A;  3JW4 A;  2A5W A;  4Y17 A;  4ETS A;  5H2F C;  2ZO4 A;  1B8I A;  3CCM I;  4HDU A;  4IHW A;  2Q2E B;  1I3A A;  2KLO A;  4PSW A;  5HLI A;  3BOQ A;  1PP7 U;  5JLX A;  3VWB A;  1JKP C;  4G6T B;  3F3X A;  4QPO A;  1HOM A;  1ZR2 A;  2VPL A;  1GLN A;  1T39 A;  3BR3 A;  4E7S A;  1MJB A;  1FP2 A;  3HRM A;  4A3F J;  4DNC A;  1OPC A;  3ISP A;  3SZT A;  1XGO A;  4IF4 A;  2OU2 A;  4Y15 A;  2V79 A;  3WGH A;  4A3M J;  4BY1 J;  1XSD A;  1WJD A;  1UG2 A;  5J8C A;  2Z2S B;  3RPQ A;  4UV8 A;  3DFG A;  4ZJZ A;  2XV4 S;  2MH9 A;  2AO9 A;  4BQO A;  3PNV A;  2BHY A;  2CRG A;  3ECH A;  4D1Q A;  3QPL A;  5J47 A;  2Y0S A;  2BY1 A;  1WHU A;  2UUZ A;  1S8N A;  1EF4 A;  2EH3 A;  1NG6 A;  4BXF A;  1S3J A;  3VB2 A;  1LE8 A;  5BS6 A;  3BQY A;  1BBY A;  2H6B A;  4AU7 A;  1HDD C;  5FO5 A;  4XRS G;  1UJ8 A;  1ETK A;  1GVD A;  3FM5 A;  3CJT B;  1SMT A;  2GXG A;  1L0O C;  1DGR M;  4IL6 C;  1K6Y A;  2F4M B;  2L02 A;  2HGC A;  2VBX A;  5EF6 A;  1ZKG A;  1KU7 A;  2WAQ N;  4V19 K;  1MBJ A;  3VDX A;  2BHZ A;  2XB0 X;  1FX7 A;  3IC7 A;  4EQQ A;  2DI3 A;  2DA4 A;  1LEB A;  5CQG A;  2W48 A;  4FE4 A;  1OYY A;  3GEZ A;  5KCM A;  1SAN A;  2DDB A;  3BR5 A;  4CZZ A;  4EGZ A;  2OC6 A;  4L5J A;  5LRS A;  3PNT A;  5C4J J;  2CFX A;  1ONV A;  1KQ9 A;  3J7Y J;  1O3R A;  4NBQ A;  3QOP A;  1UB9 A;  3IWZ A;  4UY8 I;  2VPR A;  4OIR F;  3G3Z A;  2YUS A;  3DWL E;  3K2A A;  2VE9 A;  2CJJ A;  5FD5 A;  1FSH A;  3HHH A;  1HST A;  5FFZ A;  5JI6 A;  3BR2 A;  4BEH B;  4ZH4 F;  4ENM A;  1JUM A;  1XCV A;  2FX0 A;  2HYF A;  3E3V A;  5DUI A;  3G6E I;  3OYM A;  2X4H A;  4N0B A;  3G73 A;  1YJ9 I;  5DV5 A;  4GXO A;  3OYE A;  1S9H A;  2G7H A;  1GV2 A;  3E6D A;  5IT9 Z;  2VON A;  4JQF A;  5K5O A;  4S05 A;  3F8M A;  5GPC A;  3GFL A;  2V4J C;  1SFU A;  1J7K A;  4MHG A;  5F1J A;  2PG4 A;  2LH9 A;  3LFU A;  5FLX K;  4GFB A;  1BJA A;  2XAU A;  5IY5 H;  1ZAO A;  2PMU A;  3KP7 A;  4BGD A;  2ZXI A;  3WTY C;  1Z1D A;  2K9N A;  4G6Q A;  4M73 A;  1GXP A;  2GM4 A;  2LSO A;  4PUS A;  1UZC A;  3PUB A;  2F5E A;  2XGX A;  4IRI A;  2R7T A;  1RKT A;  2IGK A;  2OJE D;  1JGG A;  3D0S A;  2EV5 A;  5EZG A;  3PIP F;  5JR3 A;  3BPX A;  3I4P A;  4KN7 X;  2DYR H;  3DKX A;  2JA2 A;  1IRZ A;  3HZJ A;  4HV6 A;  1VZ0 A;  2P7V B;  2ZNZ A;  1D0Z A;  3B73 A;  1TW3 A;  1TWF J;  3ZRG A;  4XLP F;  5C4X J;  2DMP A;  2D1H A;  4E7J A;  1S7A A;  4MO7 A;  1Z3Y A;  3GZ5 A;  4NC8 A;  5GAE J;  3JSP A;  2VIX A;  3ZQG A;  2K02 A;  4AVP A;  3T5X A;  1WVR A;  2PQ8 A;  2KZG A;  1IW7 F;  2IBD A;  1QVT A;  3SQN A;  3ERM A;  2VBY A;  2ELH A;  1S29 A;  4QIW N;  1FYL A;  4L9T A;  5E8I A;  3FKI J;  4M9S A;  4HNV A;  3G4S I;  5LHI A;  2Y31 A;  5ICG A;  3LSH A;  4FQG A;  1R22 A;  4XLH A;  3ZMD A;  1IAW A;  2GOM A;  2HQR A;  4LB6 B;  3CME I;  4AM3 A;  2FOW A;  2EFP A;  3FM3 A;  2HYG D;  4M6V A;  3I59 A;  2E19 A;  4OAY A;  2EA2 A;  4GO1 A;  3WE2 A;  4MQV A;  2LY9 A;  5F0C A;  1LPQ A;  5B1B H;  2ISY A;  3PUF A;  5J1Y A;  1B72 A;  1IJW C;  4ZYH A;  5ICE A;  3H35 A;  3HKZ A;  3VYR B;  5E18 F;  2L7M P;  4XNF A;  2O03 A;  3K4L A;  2BW3 B;  1SAX A;  1TQP A;  4HG2 A;  2B7E A;  4F52 A;  1ZLK A;  3C2H A;  3HM5 A;  1RNL A;  4EM0 B;  1WI3 A;  2CH0 A;  2JSP A;  3OYA A;  4RLF A;  3F21 A;  5LFA A;  1K4T A;  2FUG 2;  1BR4 A;  1V5G A;  3ZQI A;  3M7G A;  2Y9Z A;  5L3F A;  1YFH A;  5EEG A;  4UV9 A;  2IGM A;  2NOJ B;  2CQ7 A;  3QPH A;  3W2W A;  1JHH A;  3RKX A;  4JX6 A;  3HYI A;  1Z6R A;  1X4O A;  5M5X J;  4F91 B;  1JT0 A;  1DU0 A;  1BIB A;  3RYP A;  1G6N A;  1YRN A;  2DXI A;  4P5O A;  3ZMT A;  2HVQ A;  3A4C A;  3BRO A;  3IAS 2;  2R7R A;  4XMY A;  1RPW A;  2EIJ H;  1Y56 A;  2L9V A;  2A69 F;  3VSK A;  1RC9 A;  4IRG A;  1ZG5 A;  3S2H J;  2P6S A;  3OYG A;  5D5X B;  4RB3 C;  4XOP A;  3W6K B;  3QP6 A;  3J81 Z;  3U9G A;  3OY9 A;  1F43 A;  2DLL A;  4A3J J;  2W85 A;  3BG9 A;  1FBS A;  3X2Q H;  3GTM J;  3K69 A;  2EK5 A;  2ELJ A;  4AYB N;  2M45 A;  3FXR A;  5FB2 A;  2VQL A;  2QYO A;  3EDP A;  4ZYD A;  2ZME B;  3MAJ A;  1YS6 A;  4C3I J;  5E17 F;  2QF7 A;  1P2F A;  3KEO A;  2ID3 A;  2ME0 A;  1PUF A;  2V9V A;  4O3M A;  2M30 A;  1OCP A;  3EYI A;  1KU9 A;  2JPB A;  4XIC A;  3OL3 A;  5DCM A;  2ZKZ A;  3MKY B;  4Y4R A;  1KYZ A;  2TCT A;  1JUP A;  2IPQ X;  3DP7 A;  2X85 A;  1PYV A;  3R60 A;  2NS8 A;  5DD4 A;  1WZ2 A;  5GAH J;  3TP0 A;  3BTJ A;  3WGI A;  4XRM A;  2XF6 A;  3VOE A;  3I58 A;  3JAM K;  3ELK A;  5EJC A;  4C3J J;  3M8J A;  4MLO A;  3QPT A;  1K83 J;  4RM3 A;  3P9I A;  4ENJ A;  1E2X A;  1KQ8 A;  2A3S A;  4Y13 A;  3G2B A;  5M5W J;  3UR3 C;  2F4I A;  2GBY A;  2R0Q C;  1H0M A;  5FRM A;  3BZ6 A;  4FE7 A;  4PDK A;  3JRB A;  4A69 C;  2CSO A;  3IRQ A;  2GIZ A;  4CCL A;  3T1B A;  4JYK A;  4CYC B;  3AL0 C;  1IRF A;  1WQ2 A;  4ESF A;  2V1N A;  1K79 A;  4WX9 A;  4C2T A;  4CA0 A;  4HF1 A;  2PX9 A;  4LB5 A;  4XKV A;  2HDW A;  4JX4 A;  3FHN A;  1ZG1 A;  3GLL A;  3LA7 A;  5CPR B;  4IJA A;  1IZ1 A;  5LHG A;  4LIT A;  5FKM A;  2H1K A;  2OZU A;  3H1C A;  2PN6 A;  4Q4Z F;  3V42 A;  3JTG A;  3SEQ A;  3T8R A;  2ZXH A;  1OMI A;  4A3D J;  2E60 A;  2R7Z J;  2A05 A;  4B09 A;  1HBX G;  1B9M A;  4A5M A;  3C2G A;  4G7Z F;  2MD5 A;  5K7F A;  4GDF A;  1NG7 A;  4HBL A;  3E5U A;  1TZL A;  1X3U A;  5D5W B;  2NVQ J;  1Z67 A;  4X0G A;  3EUK L;  2CFO A;  3G71 I;  2ADU A;  3KX2 A;  4G9Y A;  2IGO A;  1TBX A;  1T38 A;  4I02 A;  1MBH A;  5L3E A;  2QCO A;  1Y39 A;  2FJ1 A;  2M34 A;  4RGS A;  1XDU A;  4U0Y A;  4FX4 A;  2OAZ A;  2STW A;  3Q0W A;  1B9N A;  1ZEL A;  3P9C A;  3S16 J;  2LKP A;  3HKZ N;  3NQO A;  4AIJ A;  2GXA A;  2CU7 A;  2FEZ A;  3CZ6 A;  1R1T A;  1MBK A;  3C1D A;  1IN5 A;  3K4J A;  3MWM A;  2M1B A;  1AU7 A;  5K1Y A;  2IVM A;  2RAE A;  1JKO C;  3AG2 H;  2CV1 A;  4CYC A;  5E79 C;  3B6A A;  4O6J A;  4BS9 A;  3H5A A;  2K85 A;  3FK7 A;  4W97 A;  1WKM A;  5GAD J;  3FHZ A;  2BY3 A;  1MD0 A;  4CIC A;  3QWL A;  2ESH A;  5IYC J;  3A1Y A;  2W82 A;  3FXL A;  1U5T A;  2IS6 A;  2QGU A;  3GVA A;  5CVV A;  3GTQ J;  4DJA A;  1UHM A;  2HQA A;  3NAR A;  2O9L A;  5F0F A;  1TT5 B;  2PI0 A;  3ZOB A;  1FYK A;  4IPA A;  2R93 J;  2E1O A;  3HUG B;  4G8X A;  4LIV A;  4PJ0 C;  4BJ5 C;  1M1E B;  3L2C A;  3IKV A;  3LWF A;  3FDY A;  1X2M A;  2GIV A;  4HLX A;  2R5Z A;  1IRG A;  1QPI A;  2KRH A;  3MMY B;  2VJ5 A;  2M87 A;  3OR1 C;  3VYU B;  3TOA A;  2OA4 A;  1R7J A;  3MZY A;  2WY7 Q;  2K3P A;  4KYW A;  3M8E A;  4EGY A;  1TL8 A;  3CDI A;  2CUZ A;  1OFC X;  4IOA F;  1MKM A;  5J3L A;  4M3E A;  4U0V A;  4ITV A;  5DYM A;  1LDK B; 
#chains in the Genus database with same CATH homology
 2A68 F;  2IW5 A;  5DD8 A;  4EM2 A;  2VOO A;  2HZT A;  2RQP A;  1F9N A;  5IT3 A;  4RAZ A;  3CUQ A;  3EUH A;  2XAJ A;  3E97 A;  3F72 A;  3KZZ A;  3K2Z A;  1STZ A;  2XAQ A;  2FF4 A;  3F23 A;  2GZW A;  4PCQ A;  1Z7U A;  4ON0 A;  2HFH A;  2KIM A;  2EFN A;  3VEP A;  4ZYE A;  1R5H A;  5HOO A;  4I7H A;  5EEH A;  2Z9O A;  1HKQ A;  4UVC A;  1HW1 A;  1DPR A;  1PP8 F;  3KZY A;  3KLO A;  2Y48 A;  1ON1 A;  2FSW A;  3HRT A;  2WC2 A;  2Q2E A;  4RB0 A;  1I6X A;  3VOD A;  1F5T A;  3U2R A;  4R79 A;  3GX4 X;  1B1B A;  5IT9 K;  1ZRE A;  2KIU A;  3EYY A;  2DAO A;  4YFX F;  3GO5 A;  2M8E A;  4BHP A;  5HDK A;  3H92 A;  2PLY A;  5ICC A;  4PZJ A;  2VT2 A;  3LFK A;  1JXS A;  4EJV A;  2FXA A;  3BJA A;  1DP7 P;  1ZG3 A;  3LA2 A;  1IUY A;  1FC3 A;  5D8L B;  1BN5 A;  3L7W A;  3SXY A;  1QPM A;  2EFQ A;  5KVR A;  3SFZ A;  4PGG A;  4LK0 F;  3MEX A;  1XSV A;  1RZ4 A;  1SFE A;  5LGN A;  1WRJ A;  2DU9 A;  4BYY A;  4HDV A;  2FQ3 A;  4HX4 A;  4M6Y A;  6PAX A;  4WXH A;  3F6O A;  1HSJ A;  1BI3 A;  2FOK A;  2Q8K A;  2DPU A;  4A6E A;  2L4M A;  2NAZ A;  1TNS A;  3C3W A;  2O8X A;  1IXS B;  2QM3 A;  3CLO A;  2PBI A;  2K86 A;  5F1R A;  5TJJ A;  2FU4 A;  3FMQ A;  1LJ9 A;  4RGX A;  1ZYR F;  2Q0O A;  5HS8 A;  3BP8 A;  4G7O F;  5AON A;  1XMA A;  4XSZ F;  3KP6 A;  2EA4 A;  4N9I A;  2O0Y A;  1FBU A;  5AIQ A;  1XSX A;  2QQA A;  2YPR A;  4OMZ A;  5ICG A;  3COA C;  3P7N A;  4MGR A;  2FML A;  4HQE A;  2MLK A;  5HLH A;  4RAY A;  2UXN A;  3O2P E;  3HHG A;  2GAU A;  2E7X A;  1PDN C;  2QLZ A;  3IWF A;  5CVU A;  2ZJ2 A;  4IXA A;  1L3L A;  2E1C A;  3IRR A;  1AOY A;  2ZCW A;  2MH2 A;  2IRF G;  4LLL A;  3O6B B;  4BQA A;  1CGP A;  5TRD A;  2DTR A;  4L0Z B;  1R1U A;  4CO8 A;  4KT5 C;  4A0X A;  1XGS A;  4M9X A;  3ZPL A;  1W4M A;  3GLX A;  3L9F A;  3CO6 C;  1P4A A;  5HLG A;  5LHH A;  3WTZ A;  3KET A;  5D5V B;  3BJO A;  3KP5 A;  5HS7 A;  2FBI A;  4HX7 A;  3DPL C;  3WG9 A;  2BE5 F;  3DKW A;  3Q9V A;  3K1N A;  1BI0 A;  1XCB A;  3HOS A;  1D3Y A;  3V4G A;  5ILS A;  4G94 A;  2H94 A;  4G6D A;  1UHW A;  3ERE D;  4I0A A;  3DF8 A;  4KMF A;  4L5I A;  2XKP A;  4KN4 X;  5ILV A;  1U3E M;  2MA3 A;  4MNU A;  2HS5 A;  1LDJ A;  3F8F A;  5CVJ A;  2ZNY A;  3HTU A;  4LG0 B;  2E7W A;  1QNT A;  2R7D A;  2A5Y B;  1MDM A;  2XUB A;  3BY6 A;  4YIF A;  2CGP A;  1Z6T A;  2RGV A;  2RVC A;  3RJP A;  3V7C A;  2HTS A;  4CDG A;  3BPV A;  2JRT A;  1BC7 C;  5ICF A;  3LST A;  3GWZ A;  3J81 K;  3ZN1 A;  3KP3 A;  1SD7 A;  4D0P A;  4IRH A;  3M8F A;  2CG4 A;  3QAH A;  5D4S A;  1TTY A;  1FNN A;  4ZZL A;  2RKH A;  4FX0 A;  1WSU A;  4P96 A;  2A6H F;  2XAF A;  2ZXJ A;  1CF7 B;  4M72 A;  2ACJ A;  2OQR A;  2J5O A;  2VE8 A;  4Q5S F;  4YFK F;  3BJ6 A;  1O3T A;  2P5V A;  1QZZ A;  3FZV A;  2CYY A;  3J80 K;  1JGS A;  4Q47 A;  1EV7 A;  1ZRC A;  2A6E F;  3ROU A;  4G7H F;  4UHT A;  3OV8 A;  2M5W A;  4HF2 A;  4RGU A;  1T0F A;  2DPD A;  2QQB A;  3PFI A;  2H6C A;  5H6R A;  1RUN A;  3TKY A;  1I27 A;  1V3F A;  4BHC A;  2V1X A;  3R0A A;  3V7R A;  4YII A;  1FSE A;  2K7L A;  2MC3 A;  4GYI A;  4S04 A;  2BBY A;  2Z3Y A;  2UZK A;  4HZF A;  3FXU A;  3I59 B;  1WI9 A;  3PQJ A;  1UST A;  4OIN F;  4HOB A;  4KNY A;  3ZMS A;  1ZAR A;  1IN6 A;  2JSC A;  1TLH B;  5CLS A;  1UCR A;  1XMK A;  2B0L A;  3CUO A;  5LEK A;  2P7C B;  3N4M A;  1QQI A;  2DW4 A;  2A07 F;  2RNJ A;  2AS5 F;  1XGN A;  1MJA A;  1OKR A;  3ABU A;  1S6L A;  2P5K A;  1XN7 A;  4WXC A;  4LMY A;  2ZBK A;  3QU3 A;  2D1V A;  1J75 A;  1B6A A;  3QP5 A;  5E8G A;  1O3S A;  1FWZ A;  4IHT A;  4EJU A;  4E70 A;  1XD7 A;  2VOP A;  3FWE A;  2CW0 F;  5BOX A;  1R1V A;  2EV0 A;  3TO6 A;  2XHK A;  1NHA A;  5KK1 A;  1IN4 A;  1GHC A;  1RI7 A;  2XAH A;  1YW9 A;  3BWG A;  4MEY F;  2BYV E;  5BQT A;  2HEO A;  2EFO A;  2F5D A;  5E1Z B;  1HKT A;  4YG2 F;  3HSF A;  2STT A;  3JAM Z;  2Z99 A;  3B02 A;  2QWW A;  3C7J A;  3R4K A;  2O61 A;  5JHU A;  5CVI A;  4KA4 A;  3R61 A;  3M9A A;  3IHU A;  3E6M A;  2JT1 A;  4RB1 A;  2IA0 A;  3I54 A;  2LF7 A;  5K5R A;  1ZLJ A;  2L3D A;  1I1G A;  2Z33 A;  1R58 A;  3CUQ B;  1G3Y A;  4WXD A;  2GXB A;  3S2W A;  3ZMU A;  3D5L A;  5D6F A;  5D4R A;  3GF2 A;  4B8X A;  2KJC A;  2EV6 A;  1U5T B;  1PUE E;  1GVJ A;  2KJB A;  3I0T A;  3GZ6 A;  3I64 A;  1R36 A;  5F64 A;  2X0L A;  1R23 A;  4ENK A;  4LD5 A;  4U7D A;  4XLN F;  1J0R A;  1DDN A;  2F5C A;  3CJN A;  5LBQ A;  2QQ9 A;  4A12 A;  2K4J A;  3MFK A;  2MBF A;  5CVR A;  1DPU A;  1REP C;  3RTR A;  3WU0 A;  1F1Z A;  2FMY A;  5DCF A;  4KIF A;  1J59 A;  1ULY A;  2VOD A;  1ZH5 A;  1QGP A;  2Y75 A;  1C0W A;  5CYV A;  3F8C A;  3R6S A;  4CGZ A;  2AXL A;  1T98 A;  3I71 A;  4L18 B;  2FE3 A;  4OIP F;  4R1H A;  2JPC A;  3SHF A;  5H20 A;  1YYV A;  2W25 A;  2WWY A;  3N97 A;  3CO7 C;  3FMS A;  3QU6 A;  1G3S A;  3HSR A;  3HTS B;  4HF0 A;  1SD6 A;  4DQ2 A;  4OU0 A;  1E17 A;  2WV0 A;  2NS0 A;  4CYD A;  1ZRF A;  2YSR A;  4HV5 A;  4LG0 A;  2PFB A;  4NHJ A;  3P9K A;  1R5G A;  1IN7 A;  5L3G A;  2ZFW A;  2HDC A;  1IN8 A;  5DDG A;  2OD5 A;  1K78 B;  5FLX Z;  1BOA A;  1ODD A;  2CO5 A;  2COM A;  4QLC U;  5F6F A;  2NYX A;  1LEA A;  5DEQ A;  1I5Z A;  4JBA A;  2PMH A;  2ETH A;  4BXU A;  2G7U A;  3SZP A;  1W7P D;  1ZGA A;  2V1U A;  1HW2 A;  4OIQ F;  5LLQ A;  3U1D A;  1O7F A;  1F4K A;  2GWR A;  4WK8 F;  3F22 A;  1LDD A;  1H9G A;  2DK8 A;  4XBF A;  4QWQ A;  1KA8 A;  3DV8 A;  5A2Q Z;  2ZME A;  4EV0 A;  3I53 A;  1RUO A;  2RV8 A;  1FYM A;  3KLN A;  3WGG A;  2OQG A;  3ZN0 A;  1SD5 A;  5H6Q A;  4RS8 A;  2RDP A;  3H3U A;  5HDN A;  1EH6 A;  1RIO H;  5DCM B;  3CDH A;  4LLN A;  2DK5 A;  3LQR A;  5JFR A;  3RDI A;  2YX4 A;  3GUD A;  2ISZ A;  2BGC A;  2DFI A;  3ECO A;  2CWE A;  1TQI A;  1YLF A;  4IVN A;  5L3C A;  2NNN A;  4P9U A;  3WE3 A;  4EM1 A;  2EWN A;  5HS9 A;  2IJL A;  1T6S A;  2FNA A;  3MZH A;  1O57 A;  1U8R A;  2QVO A;  5AIP A;  1QZY A;  3DXJ F;  4P55 A;  3E6C C;  4I98 B;  2FRH A;  4Q48 A;  3M1E A;  1HW5 A;  3TO7 A;  1CF7 A;  1MDM B;  2F5F A;  1LQ1 A;  3WOD F;  4HYE A;  2C6Y A;  1W7P B;  1FOK A;  1EH8 A;  1XDS A;  4Z2Y A;  2UWM A;  1D8J A;  1U2W A;  1MZB A;  1K6O A;  5HDG A;  3WTW C;  2H27 A;  5BMZ A;  2NNY A;  3KE2 A;  1YIO A;  2PEX A;  4HQM A;  4I0B A;  4CHU A;  3E6B A;  2HKO A;  3RKW A;  2QEN A;  2V1D A;  1P6R A;  2YU3 A;  4BNC A;  3L00 A;  1TQM A;  2BEO A;  3KFW X;  4AIK A;  4M9Z A;  4YFN F;  1BIA A;  3V8J A;  3DPT A;  3FMR A;  3RKY A;  4WWC A;  5LGT A;  4I01 A;  2VC1 A;  2K4B A;  3GFM A;  2YR2 A;  3HIF A;  3R0J A;  4BH9 A;  2P5L C;  4EVI A;  1QO0 D;  5L3B A;  3L09 A;  1FP1 D;  4A0Y A;  3GXO A;  1SD4 A;  2GA2 A;  2FA5 A;  3HRS A;  1Y0U A;  2OBP A;  5FGM A;  4A2U A;  3T0Y A;  4A6D A;  2V6C A;  3K1M A;  4HAM A;  2EFW A;  2VXZ A;  1A04 A;  1TNT A;  4UNO A;  2FNP A;  2VT3 A;  4LGW A;  5L3D A;  4KMU X;  1T2K A;  2XRN A;  3KCC A;  4BAY A;  2W84 A;  5FD6 A;  2J5P A;  2PJP A;  1Z9C A;  1W5T A;  3HRU A;  3GFI A;  2JTV A;  2P6T A;  3JTH A;  1G4D A;  1BI1 A;  1SFX A;  3NEU A;  5ILU A;  3OOP A;  1YG2 A;  3Q5F A;  1JHF A;  3W6J B;  2IT0 A;  3WTU C;  2Z5U A;  2TDX A;  3FXQ A;  4KIG A;  1GXQ A;  4HW0 A;  4XRF A;  2QBY A;  2XKO A;  4HX8 A;  4AIH A;  4GYG A;  4M71 A;  4R8H A;  4WF2 A;  1B4A A;  2BV6 A;  3TDZ C;  4ZYG A;  4F7Z A;  1YW7 A;  4LFU A;  5J6X A;  5LGU A;  2DBB A;  5D6E A;  2GQQ A;  5D5U B;  3HUG A;  4GCV A;  3VFZ A;  5A2Q K;  1J9I A;  1IXR C;  4LK1 F;  1IF1 A;  1VTN C;  1ZHF A;  1ON2 A;  2D45 A;  3IKT A;  1Q1H A;  3LQQ A;  1FLI A;  4ASN A;  4U7B A;  2P8T A;  3MQ0 A;  1YO5 C;  2O3F A;  3REO A;  2P4W A;  1FY7 A;  3WTX C;  3ZP5 A;  4P9F A;  1BI2 A;  3HSE A;  1KQ0 A;  1U5T C;  4I2O A;  2WTE A;  4PGH A;  2G9W A;  4AD9 A;  4EJT A;  2RN7 A;  1MJ9 A;  1O7L A;  4ENN A;  1KYW A;  4MQ9 F;  3ZMZ A;  5E1W A;  2HOE A;  4AWX B;  1G3T A;  4WCG A;  1LVA A;  2K27 A;  2E1N A;  4FHT A;  1LNW A;  1KGS A;  2QZ8 A;  4ESB A;  1D5V A;  1IXC A;  1W5S A;  3GFJ A;  1YW8 A;  3E5X A;  3WTV C;  4O5V A;  1BC8 C;  3TOB A;  5LEJ A;  1MGT A;  3ZMV A;  3CUQ C;  2W57 A;  3I5U A;  1ZN2 A;  4KDP A;  3O3K A;  3RIR A;  2D2W A;  1DUX C;  4ZZD A;  1HXD A;  4KIC A;  1UFM A;  4L9V A;  2XIG A;  2IA2 A;  3F8N A;  4UUV A;  2KKO A;  4K2E A;  2FBH A;  1QBJ A;  4A5N A;  4L0Y B;  1OYW A;  2YX7 A;  3Q9S A;  2L01 A;  3KP4 A;  2FBK A;  5E20 A;  3TDU C;  2H09 A;  1AWC A;  4L9N A;  1S7O A;  2VN2 A;  4NQW A;  5ERI A;  5BPI A;  2MLG A;  4LJZ F;  4I09 A;  3K1P A;  2VC0 A;  3JSO A;  4MEX F;  3LA3 A;  3AAF A;  4M6X A;  2CQK A;  1U6G A;  4EJW A;  3ABT A;  4BHB A;  3ZQ7 A;  3H3Z A;  4H0E A;  4FT8 A;  2HKX A;  3PQK A;  4N9H A;  5JVT A;  4CXF A;  4KIB A;  1EH7 A;  2DO7 A;  3RPU A;  2A61 A;  2QBY B;  3NRV A;  5LRR A;  2KRF A;  2F2E A;  3ULQ B;  2UXX A;  1R00 A;  4A0Z A;  2RC4 A;  2HQN A;  1G3W A;  2QUF A;  3GYH X;  3C18 A;  2EJR A;  3CTA A;  2LNB A;  1U78 A;  1K78 A;  3EQL F;  4L9J A;  2W24 A;  2L54 A;  5D8K B;  1OR7 A;  3LAP A;  1D8K A;  1V4R A;  2XVC A;  1JE8 A;  2LF8 A;  2HR3 A;  2JZY A;  1HQC A;  4OMY A;  2HTJ A;  3K0L A;  1YQA A;  1HKS A;  1XGM A;  3KEQ A;  1P92 A;  5J8F A;  2XRO A;  2DQR A;  1FZP B;  2R3S A;  4KFC A;  4KUM A;  5HVQ C;  3FF5 A;  4TV7 A;  1Z05 A;  1OYI A;  2O6G E;  3T8T A;  3EET A;  1J5Y A;  3QRF F;  3TQN A;  2GA1 A;  4HA8 A;  5FFX A;  4JK1 X;  3MCZ A;  1W7P A;  3GW2 A;  1I1S A;  2KIF A;  4RGR A;  4OOI A;  4EJO A;  3K9T A;  2NRA C;  1FBQ A;  3WU1 B;  3FX3 A;  2XAS A;  4EMS A;  1KU2 A;  4ESJ A;  4RB2 C;  2VBZ A;  4UXN A;  3F6V A;  3TGN A;  1O3Q A;  3DQV C;  1B59 A;  5K5Q A;  4GGG A;  2XAG A;  2DT5 A;  5ED4 A;  3KP2 A;  3HOT A;  3J7A O;  4OIO F;  4MTE A;  1YS7 A;  2IP2 A;  4UVA A;  1XB4 A;  1ZRD A;  3LAJ A;  1BM9 A;  2LDU A;  1YTY A;  2Y0M A;  3BDD A;  4M74 A;  5CJ9 A;  1Z91 A;  3V7S A;  1KU3 A;  4NB5 A;  1USS A;  1J2X A;  1WWX A;  3F8B A;  3V8L A;  1ZGJ A;  2IA1 A;  5E1X A;  4U88 A;  4HLY A;  3WTS C;  4MTD A;  4LLG F;  1LB2 A;  1SMY F;  1P4X A;  3E5Q A;  2R7F A;  4IHS A;  5BPD A;  2DQL A;  1TW2 A;  1K7A A;  2VBW A;  2ESN A;  4U0W A;  2EB7 A;  3RI4 A;  3TO9 A;  2OZ6 A;  1FT9 A;  3DEU A;  3J80 Z;  3RYR A;  1H9T A;  3ML6 A;  3V8K A;  1FPQ A;  1P4W A;  4XSX F;  4UVB A;  2L4A A;  2HWV A;  3WTT C;  5DUK A;  3IL2 A;  3JW4 A;  4Y17 A;  4ETS A;  2ZO4 A;  4HDU A;  1PP7 U;  5HLI A;  3BOQ A;  3F3X A;  1T39 A;  1MJB A;  1FP2 A;  3HRM A;  4DNC A;  1OPC A;  3ISP A;  3SZT A;  1XGO A;  4IF4 A;  2OU2 A;  4Y15 A;  2V79 A;  3WGH A;  1XSD A;  5J8C A;  3RPQ A;  4UV8 A;  3DFG A;  2XV4 S;  2MH9 A;  3ECH A;  1S8N A;  1S3J A;  3VB2 A;  5BS6 A;  1BBY A;  2H6B A;  5FO5 A;  3FM5 A;  1SMT A;  2GXG A;  1L0O C;  2L02 A;  2HGC A;  2VBX A;  1KU7 A;  1FX7 A;  3IC7 A;  4EQQ A;  2DI3 A;  1LEB A;  1OYY A;  3GEZ A;  4CZZ A;  4EGZ A;  4L5J A;  5LRS A;  2CFX A;  1ONV A;  1KQ9 A;  1O3R A;  3QOP A;  1UB9 A;  3IWZ A;  4OIR F;  3G3Z A;  2VE9 A;  1FSH A;  5FD5 A;  3HHH A;  1HST A;  5FFZ A;  5JI6 A;  4ZH4 F;  4ENM A;  3E3V A;  1XCV A;  5DUI A;  2HYF A;  2X4H A;  4N0B A;  3G73 A;  5DV5 A;  4GXO A;  2G7H A;  3E6D A;  5IT9 Z;  2VON A;  4JQF A;  5K5O A;  4S05 A;  3F8M A;  3GFL A;  1SFU A;  1J7K A;  4MHG A;  2PG4 A;  5FLX K;  1BJA A;  1ZAO A;  2PMU A;  3KP7 A;  3WTY C;  1Z1D A;  4G6Q A;  1GXP A;  4M73 A;  2LSO A;  2F5E A;  2XGX A;  4IRI A;  3D0S A;  2EV5 A;  5JR3 A;  3BPX A;  3I4P A;  4KN7 X;  4HV6 A;  2P7V B;  2ZNZ A;  3B73 A;  1TW3 A;  4XLP F;  2D1H A;  1S7A A;  3GZ5 A;  3JSP A;  2K02 A;  4AVP A;  3T5X A;  2PQ8 A;  1IW7 F;  3SQN A;  2VBY A;  2ELH A;  1S29 A;  1FYL A;  4L9T A;  5E8I A;  4M9S A;  5LHI A;  3ZMD A;  1R22 A;  1IAW A;  2HQR A;  4LB6 B;  2EFP A;  3FM3 A;  2HYG D;  3I59 A;  2EA2 A;  4GO1 A;  3WE2 A;  4MQV A;  2ISY A;  4ZYH A;  5ICE A;  5E18 F;  2O03 A;  1SAX A;  1TQP A;  1ZLK A;  1RNL A;  4EM0 B;  3F21 A;  3M7G A;  5L3F A;  1YFH A;  5EEG A;  4UV9 A;  3QPH A;  1JHH A;  3RKX A;  3HYI A;  1Z6R A;  1BIB A;  3RYP A;  1G6N A;  4P5O A;  3ZMT A;  3BRO A;  2A69 F;  4IRG A;  1ZG5 A;  2P6S A;  5D5X B;  4RB3 C;  3W6K B;  3QP6 A;  3J81 Z;  3U9G A;  2DLL A;  2W85 A;  1FBS A;  3K69 A;  2EK5 A;  5FB2 A;  2M45 A;  3FXR A;  2QYO A;  3EDP A;  4ZYD A;  2ZME B;  3MAJ A;  1YS6 A;  5E17 F;  1P2F A;  3KEO A;  2V9V A;  4O3M A;  2M30 A;  3EYI A;  1KU9 A;  2JPB A;  5DCM A;  2ZKZ A;  1KYZ A;  2IPQ X;  3DP7 A;  3R60 A;  5DD4 A;  3WGI A;  3VOE A;  3I58 A;  3JAM K;  3ELK A;  3QPT A;  3P9I A;  4ENJ A;  1E2X A;  1KQ8 A;  2A3S A;  4Y13 A;  1H0M A;  3BZ6 A;  4PDK A;  2CSO A;  3IRQ A;  3T1B A;  1IRF A;  1WQ2 A;  4ESF A;  1K79 A;  4WX9 A;  4HF1 A;  4LB5 A;  1ZG1 A;  3LA7 A;  4IJA A;  1IZ1 A;  5LHG A;  2OZU A;  2PN6 A;  4Q4Z F;  3JTG A;  3T8R A;  1OMI A;  4B09 A;  1HBX G;  1B9M A;  4A5M A;  4G7Z F;  2MD5 A;  4HBL A;  3E5U A;  1X3U A;  5D5W B;  2ADU A;  4G9Y A;  1T38 A;  1TBX A;  4I02 A;  5L3E A;  4RGS A;  1XDU A;  4U0Y A;  4FX4 A;  2OAZ A;  2STW A;  1B9N A;  3P9C A;  2LKP A;  4AIJ A;  3NQO A;  2FEZ A;  1R1T A;  3MWM A;  1IN5 A;  3C1D A;  2M1B A;  5K1Y A;  2IVM A;  4O6J A;  1WKM A;  3FHZ A;  1MD0 A;  4CIC A;  2ESH A;  1U5T A;  3GVA A;  5CVV A;  1UHM A;  2PI0 A;  1FYK A;  4IPA A;  4G8X A;  3L2C A;  3IKV A;  3LWF A;  2GIV A;  4HLX A;  1IRG A;  2M87 A;  3TOA A;  2OA4 A;  1R7J A;  3MZY A;  4KYW A;  3M8E A;  4EGY A;  1MKM A;  4U0V A;  5DYM A;  1LDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...