1FSEA

Crystal structure of the bacillus subtilis regulatory protein gere
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GerE, the ultimate transcriptional regulator of spore formation in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords GERE
total genus 23
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fseA00
4IVNA 3WTXC 5AIPA 4HZFA 4WXCA 2W24A 2V1XA 2A6HF 3ZMVA 4GCVA 4PDKA 2QLZA 2LKPA 4HX7A 2XASA 5HDGA 3ZPLA 1XGMA 2RV8A 3E6BA 1IW7F 4BAYA 5D5UB 4I09A 3FHZA 1G3WA 1EH8A 4HLYA 1HSTA 2IA1A 5FFZA 1MGTA 3W6JB 2HEOA 5DYMA 3RPUA 4CO8A 1DPUA 2KRFA 3LA2A 5F64A 3WTWC 4UVAA 3Q5FA 3TKYA 1TQMA 4H0EA 1T38A 2ACJA 4FX4A 5DEQA 3E6CC 4YIFA 3HRUA 2W85A 1KU3A 4KYWA 4WXDA 2H27A 3DXJF 1USSA 3IKTA 1SFUA 1MJBA 2OD5A 2GAUA 1VTNC 3J81K 3IL2A 1BIAA 5E17F 3KZZA 1S7OA 2JT1A 4N9IA 1FNNA 1ZYRF 3ULQB 3FX3A 4UVCA 3M8EA 3RKXA 3ERED 4KIBA 4WX9A 2EA4A 1TQPA 4M6YA 3I54A 5J8CA 1Z6TA 3ZP5A 1PP8F 2EV0A 3MWMA 2RQPA 3JW4A 5ICEA 5LRRA 3E3VA 3O3KA 3HUGA 3GWZA 3EQLF 3GFJA 3JAMK 2EFPA 2D1HA 3F8BA 1BIBA 1FSHA 1EH7A 2EWNA 2FF4A 1D8JA 4RS8A 3R4KA 1E2XA 3U1DA 5L3EA 4BYYA 2RKHA 4EM0B 1P4XA 4A12A 3KETA 1RNLA 3C3WA 3GEZA 1FYKA 4WWCA 1SMYF 2ZBKA 1NHAA 4U0VA 2COMA 1YW8A 4I0AA 4HLXA 4LK0F 3GUDA 4YFKF 5LGTA 4R8HA 4MEXF 3HSEA 3J80Z 3JAMZ 2EFQA 3E5UA 1T6SA 3QPTA 3CUQB 3E97A 4LLLA 3LSTA 3HSRA 2JTVA 2KJCA 4KA4A 1J5YA 4HF1A 2GA2A 4O5VA 3SFZA 4CHUA 3FXQA 1LEBA 2DK8A 4NQWA 4BXUA 2YSRA 4OMZA 3HYIA 2JZYA 2F2EA 1YTYA 2K7LA 2ZKZA 5LBQA 2DW4A 2BGCA 5K5RA 1BI2A 3NQOA 5LEKA 2L02A 1I1SA 5JVTA 1D3YA 2HR3A 2PJPA 3KP5A 3I5UA 2XAHA 4I0BA 2XRNA 5HDNA 2HQNA 3C18A 3KZYA 2H6CA 2NRAC 2UWMA 1S7AA 2QYOA 2XV4S 4MGRA 4A0ZA 3ECOA 4HX4A 2E1NA 4KIFA 2ZFWA 2KKOA 5LGNA 1ZREA 2RNJA 1WQ2A 1XMKA 3H3ZA 5K5OA 5FGMA 3VFZA 5CVUA 3GW2A 1R36A 2HTSA 5BMZA 2K86A 2H94A 3MZYA 3E6DA 3BJ6A 1O57A 4FHTA 2HZTA 1O3QA 5DUKA 2UZKA 3REOA 1BI0A 1FY7A 1HW5A 2IVMA 1UHWA 4L0YB 1FP2A 5A2QZ 2IA2A 1S3JA 3O6BB 5JHUA 1FBSA 2Y0MA 2P4WA 2VT3A 5L3CA 3FMQA 1ONVA 2O8XA 1MD0A 3WTVC 1U5TA 3TOBA 3HSFA 2ZO4A 2Z33A 2BE5F 2HKXA 1QNTA 1YS6A 1ZLJA 2DTRA 3R0AA 2MC3A 4ZYEA 4AIHA 4MTDA 1OR7A 3E5XA 5E8IA 1K78A 4L5JA 3L00A 1W4MA 1L3LA 2QWWA 2W57A 3IWFA 2STWA 5HLIA 2PLYA 4HF0A 1FYLA 4G94A 1DDNA 3WU1B 4ZZDA 1KU2A 1UCRA 2A3SA 4RGUA 3I0TA 5H6QA 1LEAA 1R58A 3DQVC 4G6QA 2VBWA 2K27A 3IC7A 3BOQA 2XKPA 2D1VA 3F6OA 4HX8A 2F5FA 2ZCWA 1T98A 1XGSA 4MQ9F 4UXNA 1MZBA 3NRVA 5LHGA 1R22A 4G7ZF 5BQTA 2XUBA 1QQIA 2P6SA 4P9UA 2PN6A 3GZ5A 4JQFA 4GO1A 1ZGJA 1U6GA 1YYVA 5HOOA 3MFKA 2FA5A 3ELKA 1AOYA 1USTA 2Z3YA 5FLXZ 1TW3A 2M30A 4HDVA 5CVRA 3U2RA 3I58A 3HIFA 2HOEA 4A0XA 5EEGA 4ZZLA 1FBQA 4ENMA 1Y0UA 4I98B 2K4JA 2FBHA 3M9AA 5ICGA 1STZA 1WWXA 4M9SA 4IJAA 3C7JA 1YS7A 3BP8A 1ZLKA 3N97A 2V1UA 2GXBA 4Z2YA 1IZ1A 1JXSA 4WF2A 2DAOA 3IRQA 2OU2A 3QPHA 1J75A 1FSEA 5HS9A 1MKMA 2GWRA 3TO9A 5D5WB 3WGIA 2IA0A 4B8XA 1A04A 5LHHA 4EMSA 1R5HA 3AAFA 5K5QA 5HVQC 3T1BA 4YFXF 1FT9A 1LDKB 1V3FA 1ZG1A 3F8FA 1SMTA 1KQ8A 1LDJA 3LA7A 4XLPF 3ML6A 1YFHA 1GXPA 4EGYA 2OAZA 2ZNZA 1G3YA 2G7HA 3V8LA 3C1DA 1TTYA 1BJAA 4BHCA 1XB4A 2F5EA 4AIKA 1YW7A 4CZZA 2OQGA 2ZMEB 1LQ1A 1T0FA 1L0OC 4AIJA 1HXDA 3ZMZA 1RZ4A 2RC4A 2WC2A 2PMUA 4S04A 3DV8A 3GFLA 3DFGA 3ISPA 1F4KA 4Q48A 3L2CA 2XIGA 1D5VA 1LJ9A 2E1CA 4XSXF 1Q1HA 4FX0A 3ABUA 3TGNA 1UFMA 4L9TA 2L4AA 3F8MA 4R1HA 5FFXA 3CO6C 4PGGA 4IRGA 1LNWA 2FE3A 2AXLA 3G73A 3BPXA 1XMAA 1J2XA 1O3SA 1PDNC 5DDGA 1IXSB 1HQCA 1J0RA 5D8LB 3L09A 2L01A 2Z5UA 3SZPA 3LQRA 1J59A 1O7LA 1F9NA 1IRFA 3BROA 3IWZA 2CW0F 3FM5A 4MNUA 2YR2A 5D6FA 1G3TA 3COAC 1EH6A 1ZAOA 4XRFA 1V4RA 5CVIA 3EDPA 1HW1A 1WI9A 1DP7P 3WG9A 3GFIA 3EYYA 4LG0B 3QRFF 1XDSA 3WE3A 2Z99A 2O61A 1MJ9A 5DD8A 3V7RA 1ZH5A 1H9TA 3F22A 2VOOA 2PG4A 3DPLC 1SD7A 5JI6A 1SAXA 4OIPF 3D0SA 2P7VB 4GYIA 4ZYHA 2E7WA 3DEUA 4P96A 5LEJA 3RPQA 1C0WA 1IN6A 2CQKA 4S05A 1KQ9A 1FPQA 1XN7A 2DK5A 1KGSA 4L9JA 3BPVA 5IT3A 4MEYF 3MQ0A 5F6FA 2P7CB 4P5OA 3W6KB 3QAHA 1IN4A 4OIOF 2VOPA 1R1UA 5DV5A 4RB1A 3IHUA 3ROUA 3RYRA 1YG2A 2ESNA 1KYWA 1XCBA 2L3DA 4CICA 1EV7A 3OV8A 1QO0D 3HTUA 5D8KB 2AS5F 5IT9Z 2VXZA 3F6VA 2A69F 3I59A 5CVJA 5FLXK 3WGHA 4HV5A 4MQVA 4YFNF 1QPMA 3EUHA 4IF4A 4M9XA 2FRHA 2RDPA 3GXOA 1XCVA 2QM3A 1B59A 5ILVA 2ESHA 4EV0A 1Z6RA 2PFBA 1R23A 2MLGA 3B73A 4KMUX 4RGSA 3VODA 2PMHA 2QQAA 2V6CA 2EB7A 3CTAA 2XAFA 1CF7B 4U0YA 5HLHA 3P7NA 3KP6A 3H92A 1CF7A 1R1VA 4U0WA 3FWEA 2Z9OA 1ZG5A 2P5LC 4QLCU 2LF7A 3CUQA 3L9FA 5DCMA 2FNPA 1HKSA 5L3FA 1U5TB 3K0LA 3ABTA 3R61A 2M8EA 3T5XA 3JSPA 3CLOA 5L3GA 1HSJA 4N0BA 4KMFA 1FWZA 4G8XA 5F1RA 5KK1A 2F5CA 2D2WA 4RAYA 4U88A 2G9WA 3PQKA 2V9VA 3TO7A 5BPIA 2FSWA 4RAZA 3FMRA 3K1NA 1P4WA 2EJRA 2WWYA 5D5VB 3IKVA 2CSOA 1KU9A 2O03A 3DF8A 1LVAA 2H6BA 4YG2F 1B4AA 3BZ6A 3GF2A 1TNTA 4M73A 4MTEA 2E7XA 2STTA 1YO5C 2CGPA 3RJPA 2FMLA 5D6EA 5JR3A 2VE8A 1O3RA 4XBFA 2FQ3A 1ZRFA 2M1BA 1O7FA 3BDDA 4L9NA 1FX7A 4BNCA 3S2WA 1XDUA 3V8JA 2R7DA 4RB2C 2LF8A 1T39A 3F8NA 4KUMA 4LD5A 4AD9A 3GVAA 2VN2A 3M7GA 3BWGA 2OA4A 2FEZA 3TO6A 2YPRA 2J5PA 2O3FA 1PP7U 2IJLA 1K6OA 1Z05A 3DP7A 1G6NA 1XSXA 4AVPA 4P55A 4K2EA 1JHFA 1H9GA 3GLXA 2BYVE 3ZMUA 3T0YA 4DNCA 5FD6A 1Z91A 5KVRA 2V1DA 3RKYA 3EYIA 2A5YB 4XSZF 2FBIA 1YIOA 4FT8A 4O3MA 4O6JA 3RYPA 4KNYA 1FZPB 3WODF 3J80K 1OYWA 1MJAA 3KEQA 4IHSA 4Q4ZF 2JPBA 3HOSA 2PEXA 4RB3C 4YIIA 3LQQA 5HLGA 3I71A 3LAPA 1MDMA 2H09A 1Z1DA 2G7UA 1IXCA 3K69A 1R1TA 1ODDA 1J9IA 3KLOA 1ULYA 1W5SA 2XVCA 3J81Z 1GXQA 2FNAA 5DUIA 3HRTA 3R0JA 1IXRC 1IAWA 2A07F 2HKOA 2IT0A 2W84A 2QQBA 2EFOA 5EEHA 5ERIA 5D4RA 2HGCA 2DLLA 1UHMA 2XAQA 3JTGA 1QBJA 4L0ZB 1FBUA 3V8KA 1HW2A 4HV6A 2ZMEA 2QBYA 1W7PA 4D0PA 1U5TC 4EJTA 3GYHX 5E1ZB 1FC3A 5CLSA 5K1YA 4IRHA 1Z7UA 3B02A 3GFMA 4ZH4F 2DPUA 2XKOA 2UXNA 4HF2A 5LRSA 2EA2A 2GQQA 1K79A 3HOTA 1REPC 3R6SA 5JFRA 2VT2A 1SFEA 2QZ8A 3SQNA 5D4SA 5E18F 2CO5A 4EJUA 1W5TA 1F1ZA 3M1EA 1U78A 3FMSA 2O6GE 2R7FA 3LFKA 2IP2A 5E20A 4G7OF 2DT5A 1TNSA 2PQ8A 1IN5A 4UHTA 1K78B 2QENA 3JSOA 1I27A 2VODA 4L5IA 2LSOA 1DUXC 2L4MA 2MH9A 2JPCA 1HKQA 3QP5A 4ENJA 4TV7A 4ON0A 2OZ6A 3M8FA 3PQJA 4G9YA 1SD5A 2KJBA 4EM2A 2ELHA 1RUNA 3WE2A 5HS7A 2ISYA 5DCMB 2OBPA 4NB5A 1W7PB 4XLNF 4ASNA 4Y17A 2XAGA 1P2FA 1OMIA 2XAJA 4E70A 2HYFA 4ESJA 2WTEA 3R60A 5LHIA 1YLFA 5FO5A 4RGXA 3HRSA 3VOEA 3D5LA 1R00A 4M74A 4UVBA 5FD5A 3WGGA 2P5VA 2EFWA 4BH9A 1B6AA 3ZN0A 1XGOA 1QZYA 4DQ2A 1ZN2A 2A61A 1JHHA 5DD4A 2NNNA 3K1PA 5E1XA 1BI1A 4EM1A 3K9TA 2J5OA 3U9GA 4EGZA 5HDKA 6PAXA 4I7HA 4I01A 2L54A 2YX7A 1TLHB 2DBBA 3MAJA 3CJNA 1U8RA 2Y48A 2ZNYA 2F5DA 3LA3A 1BM9A 3BY6A 1PUEE 3TDUC 3MEXA 3CDHA 2GA1A 1WSUA 1IF1A 3ZMDA 4A0YA 4R79A 2M5WA 1RI7A 2IRFG 3TOAA 4LJZF 1CGPA 2Q0OA 1ZARA 1XSDA 4BHBA 5LLQA 5D5XB 4N9HA 3KP3A 5FB2A 3RIRA 1LB2A 2GXGA 4A5NA 2M45A 1P4AA 3KEOA 2R3SA 2Y75A 5ICFA 4HOBA 3RI4A 2GZWA 4UV9A 2ZJ2A 5ILSA 1JGSA 2EFNA 4ETSA 2XROA 5L3BA 1HKTA 5J6XA 3V7SA 3OOPA 1RIOH 3DKWA 1OYYA 2YX4A 4JK1X 3WTSC 4A6DA 1OYIA 1QZZA 4LB5A 1BBYA 1TW2A 5HS8A 5TRDA 3QOPA 3F21A 2W25A 4OU0A 4PZJA 1WRJA 2Q2EA 4LLNA 1BI3A 1KA8A 2X0LA 4WK8F 3WTTC 3BJAA 4I2OA 1QGPA 3QU6A 1ZGAA 4LLGF 3KLNA 2P8TA 4G6DA 2DU9A 2A68F 3RDIA 1S8NA 4LFUA 4KFCA 3FZVA 4LB6B 1KQ0A 4L9VA 1OKRA 3LAJA 3FM3A 2PI0A 4OINF 5DCFA 2VBZA 4I02A 1I5ZA 1UB9A 2OZUA 4WCGA 1IRGA 3WTUC 2HWVA 2VBXA 4CXFA 3T8TA 4LMYA 2CG4A 3FXUA 3FXRA 3KE2A 3ZMTA 4Q5SF 4HYEA 2UXXA 4UV8A 4HQEA 4OIRF 5ED4A 3HTSB 3BJOA 3QU3A 3NEUA 3P9IA 1SFXA 2YU3A 3ZN1A 2BEOA 3P9KA 4CGZA 4KT5C 1HBXG 2KIFA 2O0YA 2DQLA 2IW5A 3EETA 2KIMA 2DPDA 2EV6A 1GVJA 4HDUA 3KP2A 1G4DA 5BPDA 1BN5A 3GX4X 2EK5A 3I53A 2K4BA 5E8GA 2D45A 3V4GA 2QUFA 1SD6A 1IUYA 5AONA 3CO7C 5H20A 2HYGD 2VONA 3FF5A 1LDDA 2Q8KA 4LK1F 2MA3A 4M71A 4HAMA 4PGHA 1J7KA 3HHGA 1P92A 3KP4A 3CUOA 2CFXA 1YW9A 1KU7A 1B9NA 2FBKA 1FLIA 3E5QA 3F72A 4KDPA 2DI3A 1ON1A 3G3ZA 4AWXB 2RVCA 3ECHA 2NAZA 2HQRA 5BS6A 1R5GA 1IN8A 2ADUA 2B0LA 1FYMA 4F7ZA 1ZRCA 4UUVA 2FOKA 3WU0A 1GHCA 3DPTA 3O2PE 1MDMB 3SZTA 2A6EF 3TQNA 1ZRDA 2NYXA 5LGUA 4HQMA 4KN7X 4CYDA 4IHTA 3L7WA 4ESFA 3MCZA 4EJWA 5IT9K 2VC1A 2MLKA 1ZG3A 2P6TA 4ENNA 4EJVA 1YQAA 4GGGA 1XGNA 4OMYA 1F5TA 2XGXA 5ICCA 4OIQF 2CWEA 4MHGA 1OPCA 5L3DA 1B1BA 2MH2A 3KCCA 4NHJA 4Y13A 2ISZA 4EQQA 3Q9VA 1P6RA 3F8CA 4A5MA 3IRRA 1G3SA 4M72A 2DO7A 4GYGA 1E17A 4LGWA 4G7HF 1H0MA 2HDCA 2DFIA 4HA8A 3GO5A 4L18B 2TDXA 2RN7A 4IRIA 3WTZA 1B9MA 2LDUA 2QVOA 1WKMA 4PCQA 5H6RA 2FU4A 1T2KA 2VBYA 4HBLA 2FXAA 4LG0A 4OOIA 4M9ZA 1BC7C 2X4HA 3SXYA 3JTHA 1JE8A 3ZMSA 1FOKA 1FP1D 4RGRA 1XD7A 3HHHA 3RTRA 3K2ZA 3TDZC 2OQRA 4BQAA 4GXOA 2ZXJA 1XSVA 1K7AA 1R7JA 3RKWA 5J8FA 4P9FA 4KICA 3MZHA 1I1GA 1U2WA 4WXHA 3I59B 3I64A 4ZYDA 2HTJA 4KIGA 5CJ9A 1I6XA 5CVVA 1DPRA 5ILUA 1BC8C 3ZQ7A 4Q47A 2LNBA 2NNYA 4QWQA 1BOAA 4U7DA 2M87A 3P9CA 1RUOA 2MBFA 2HS5A 4Y15A 2K02A 3J7AO 4M6XA 2JSCA 3I4PA 2EV5A 3VB2A 2DQRA 4EJOA 3GZ6A 2BV6A 5BOXA 2VC0A 4UNOA 4ENKA 3SHFA 3HRMA 3F23A 1X3UA 5CYVA 2QQ9A 4RB0A 3KFWX 2MD5A 3F3XA 2HFHA 4HW0A 3T8RA 2ETHA 2P5KA 3QP6A 2KIUA 2VE9A 2C6YA 2BBYA 3VEPA 1ZHFA 4IPAA 2QBYB 4KN4X 1SD4A 1Z9CA 2RGVA 1ON2A 1U3EM 2CYYA 4ESBA 4IXAA 2V79A 2JRTA 4BHPA 4CDGA 1IN7A 1AWCA 3H3UA 3LWFA 4B09A 4JBAA 3PFIA 2FMYA 1D8KA 4EVIA 5A2QK 5TJJA 3Q9SA 2NS0A 3V7CA 5E1WA 1S29A 1TQIA 3CUQC 3E6MA 2XHKA 3WTYC 2GIVA 3KP7A 4ZYGA 1O3TA 3N4MA 1KYZA 1W7PD 2IPQX 4A2UA 2WV0A 5AIQA 2PBIA 4A6EA 3K1MA 1TBXA 4U7BA 1S6LA
chains in the Genus database with same CATH superfamily
4IVNA 5B1AH 3WTXC 3E0JB 2DA3A 3OS0A 5AIPA 4V2FA 4HZFA 1Y56A 1GV5A 4WXCA 2W24A 2VLAA 2FJ1A 2V1XA 2A6HF 2DMTA 3ZMVA 4GCVA 4PDKA 1HF0A 5IYDJ 4Y4RA 2QLZA 2LKPA 4XNFA 4HX7A 1WCMJ 2XASA 4DGWB 4KISA 4IQ4A 5HDGA 4C30A 3ZPLA 1P9QC 5M3FJ 4NQWB 1XGMA 2RV8A 3E6BA 1IW7F 4BAYA 1ORKA 2EIJH 5D5UB 2L7KA 1ETXA 3DCFA 1WJ5A 4I09A 3VYTB 3FHZA 4J00A 1G3WA 5HNHA 3NAUA 2E60A 2DA5A 3BG3A 4NC6A 1B8IB 1EH8A 4HLYA 1QHHD 1HSTA 2IA1A 5FFZA 1MSFC 3DKXA 1MGTA 3W6JB 4BJ5C 2HEOA 5DYMA 3RPUA 4CO8A 1R6RA 1DPUA 2KRFA 3LA2A 2R7RA 2E1MC 1ACIA 5F64A 1EJ9A 3WTWC 1K6YA 1UELB 4UVAA 2IS4A 1ETOA 2XF6A 3DLAA 4MO7A 3Q5FA 1F36A 3TKYA 1FIAA 1TQMA 4H0EA 1T38A 3M3YJ 2ACJA 1VF9A 2X85A 4FX4A 5DEQA 2LH9A 3MKWB 1VNDA 2Y2ZA 4M3FA 3E6CC 3W3CA 1WHUA 2ZMEC 4LIVA 4YIFA 1U0JA 3HRUA 2W85A 1KU3A 4KYWA 4WXDA 2H27A 3S1RJ 3DXJF 1USSA 3IKTA 1SFUA 1MJBA 3ZXSA 2ZJPF 2OD5A 1ENHA 2GAUA 2L7ZA 1UMQA 1VTNC 3CC4I 3J81K 3IL2A 2K40A 2X6XA 3DPUA 1BIAA 2HZDA 5E17F 1IDYA 3KZZA 1S7OA 1X3ZB 1FJLA 2QSHX 4II2A 2LR8A 2JT1A 1MH4A 3KEYA 1A31A 3GTLJ 4N9IA 1FNNA 4FISA 1ZYRF 2XPVA 3ULQB 4A3BJ 1X4OA 3FX3A 2GLOA 3OS1A 2OJED 4EEFG 2GOXB 4UVCA 3M8EA 1W1WE 2ZSIB 3RKXA 2FD5A 4KIBA 3ERED 1BW6A 3JRGA 1RETA 4WX9A 5EG0B 3BZCA 2EA4A 1TQPA 2WB1N 4M6YA 3I54A 5J8CA 1Z6TA 3ZP5A 1PP8F 4BDYA 2EV0A 3MWMA 2RQPA 1LFUP 2L9NA 2MG4A 3OIPA 3JW4A 4UUSB 2ZFUA 5ICEA 5LRRA 3E3VA 3O3KA 3HUGA 3GWZA 3EQLF 4E7HA 3HDDA 3GFJA 3JAMK 5FRMA 2EFPA 1T56A 5LFAA 5EEAA 2D1HA 3F8BA 2WAFA 3LSGA 1BIBA 2W82A 2Z2SB 3CJQB 1YX3A 3J7AY 1FSHA 3IAS2 1EH7A 2EWNA 2FF4A 4B47A 5JHFA 1FMVA 3BR3A 3LSHA 4RS8A 1D8JA 3R4KA 1E2XA 3U1DA 5L3EA 4YELA 2R7OA 4BYYA 1BA5A 2G0EA 4FETA 3SFIA 1DU6A 2HDWA 2R4GA 2RKHA 2EZIA 3A03A 2DJIA 1YRNA 4EM0B 1P4XA 4Y3OA 3CCLI 4ZDOA 3KETA 4A12A 1RNLA 3C3WA 3GEZA 1FYKA 4WWCA 1IDZA 1SMYF 2ZBKA 3CCUI 2ZC2A 3DEEA 4AU7A 3ABKH 1MSEC 3UKGA 2YUSA 1NHAA 4U0VA 2COMA 1YW8A 4I0AA 4E4HA 2CV1A 4YEJA 2OCEA 1O4XA 3BTLA 1FOWA 1QHGA 2FUG2 1IC8A 4HLXA 3HL2A 4LK0F 2K9QA 3GUDA 4YFKF 4R8HA 5LGTA 4MEXF 2X1CA 5EGOB 3HSEA 3J80Z 3L2UA 3JAMZ 1FTTA 3K4BA 4BQQA 2EFQA 3E5UA 1T6SA 3QPTA 4D1QA 3CUQB 2LBFB 3CMEI 3E97A 4LLLA 3LSTA 2E34A 3HSRA 3HBLA 2F6CA 2JTVA 2KJCA 4KA4A 1J5YA 1XX5A 3OL4A 4HF1A 2Y69H 1A5JA 2X6YA 2GA2A 4XL9A 4M3DA 4O5VA 2X9DA 3PNYA 4RLFA 3SFZA 1X1BA 1RC9A 4BXXJ 4CHUA 3HGGA 3JRHA 3FXQA 1LEBA 4CCOA 3G4SI 2DK8A 4BUPA 1K83J 4NQWA 4BXUA 3PO3J 1N78A 1VQKI 1R9TJ 2I5UA 4CCKA 4Y7NJ 2YSRA 4OMZA 3HG9A 2IXSA 2XSJC 3HYIA 3AL0C 2JZYA 2F2EA 2HNHA 4KJZA 1YTYA 4XRMA 4DYQA 1R4MB 2K7LA 2ZKZA 5LBQA 2BGCA 2DW4A 1T8IA 3H9GA 5K5RA 1BI2A 2CW7A 3NQOA 3W6VA 1WJFA 5B1BH 5LEKA 2L02A 1I1SA 5JVTA 4F91B 4A3MJ 4ZC3A 1D3YA 1VI0A 2HR3A 2CUFA 2PJPA 3KP5A 4MFEA 3I5UA 2XAHA 4I0BA 2ID6A 3KIOA 2XRNA 3PUBA 3QPSA 5HDNA 4HSRA 2HQNA 2VUMJ 3C18A 3KZYA 2H6CA 1TC3C 2NRAC 2UWMA 4PJ0C 1S7AA 1IGNA 2QYOA 2XV4S 4D7MA 4MGRA 4A0ZA 3L2VA 3ECOA 4HX4A 1U8BA 2E1NA 4KIFA 4JX4A 2ZFWA 4D5FA 2ME0A 2W48A 1HOMA 3ASOH 2KKOA 2M7AA 5LGNA 1ZREA 1H89C 5LD2C 4C3HJ 3S16J 4PFOA 2DA7A 2RNJA 1WQ2A 3LNQA 3CC2I 3AL0B 4U87A 1XMKA 2PMZN 3H3ZA 2R7UA 5K5OA 2ZXWH 5FGMA 3S3NA 2DMNA 4F55A 3VFZA 4DYRA 3SJMA 3PUFA 3DEWA 1U9NA 2YU9J 1X4PA 4HSTA 5CVUA 3GW2A 1R36A 2HTSA 5BMZA 2K86A 5K7FA 2H94A 3MZYA 3GTGJ 1Y8QB 4B44A 1QA6A 3E6DA 3BJ6A 3S32A 3I4MJ 1O57A 4FHTA 2HZTA 3TMOA 1O3QA 5DUKA 2F4MB 2UZKA 4F3QA 5C3EJ 3REOA 2GBYA 1QZEA 3B6CA 1R5ID 2R7TA 2KPMA 1BI0A 1FY7A 1HW5A 2IVMA 3KYDB 1MNDA 3TP3A 3VSLA 1UHWA 3SYTA 2OV7A 4L0YB 1FP2A 5A2QZ 4JOMA 3O8GA 1IG7A 2IA2A 9ANTA 4EATA 3L2QA 1S3JA 2H8RA 1J09A 3O6BB 5JHUA 1FBSA 5E3OA 2Y0MA 2P4WA 2VT3A 2DOAA 3LSKA 2R5ZA 2CQQA 5CKTA 5L3CA 3FMQA 1ONVA 3OYDA 1RKWA 2LC2A 3AG4H 1X19A 3ZQLA 2JA5J 2MC4A 2O8XA 5F0CA 3G1MA 1MD0A 1ZTRA 3F0CA 3WTVC 3OYNA 1U5TA 1YIJI 4QPQA 5H2FC 4N4OB 3TOBA 3HSFA 2ZO4A 3HXLA 1Y0NA 2HDDA 2Z33A 4XLFA 4QTRA 2BE5F 1MBFA 2HKXA 3VSKA 1QNTA 1YS6A 1TP4A 1ZLJA 2DTRA 3R0AA 3HUGB 4C2UA 1UZCA 2MC3A 2VQCA 5BNGA 4ZYEA 2E2HJ 4AIHA 4MTDA 1WJAA 1OR7A 3E5XA 5E8IA 1JUSA 1K78A 4L5JA 1ZK8A 2CQ7A 2VKDA 3L00A 3HOXJ 4PSXA 1W4MA 1L3LA 1WPKA 2QWWA 2W57A 3A0HC 3IWFA 2STWA 1MNMC 3H5RA 3JRDA 5HLIA 2PLYA 4HF0A 4XIDA 4G94A 1FYLA 2IEKA 1DDNA 3CESA 2LVSA 3WU1B 4ZZDA 1NK2P 1KU2A 1SVOA 3B6AA 1UCRA 2A3SA 4RGUA 2HVSA 3WG7H 3BG9A 3I0TA 5KHDA 5H6QA 3GCMA 2M8GX 1LEAA 2F5VA 4E7IA 4X6AJ 1R58A 1VQLI 2JMWA 2O9LA 1S7EA 2HQ5A 3DQVC 4G6QA 2VBWA 2K27A 2WBMA 1YX5A 3D5RC 3IC7A 3BOQA 2DODA 2GOMA 4S0HB 2XKPA 1TZLA 2D1VA 3F6OA 4HX8A 3BT9A 2F5FA 2ZCWA 1T98A 2VJJA 1XGSA 3GLLA 4MQ9F 4IO9F 4UXNA 3RPUD 1MZBA 2R5YB 3NRVA 5LHGA 1R22A 4G7ZF 4A3JJ 2XUBA 1QQIA 2P6SA 3SDGA 5BQTA 2VL8A 1R49A 3GTMJ 3CCQI 2IS1A 2FX0A 2COBA 4P9UA 2PN6A 3GZ5A 2K3PA 1TWGJ 4JQFA 5GTHC 4GO1A 1I6HJ 1BOBA 4KITB 2RNGA 2WAEA 3OYEA 2QA4I 1B72A 4E7LA 2KHMA 1ZGJA 4JX5A 2VPLA 1U6GA 1YYVA 3D5SC 2K9MA 5HOOA 2FA5A 3MFKA 3ELKA 1AOYA 1Z3YA 2RAEA 1SAUA 1USTA 2Z3YA 5FLXZ 1TW3A 2M30A 4HDVA 4A93J 1E3OC 3K70C 5CVRA 5F0FA 3U2RA 3I58A 2QKLB 4PJNA 3HIFA 2HOEA 4UB8C 2M4KA 4A0XA 5EEGA 2VPRA 2DYSH 1VQ9I 1I3AA 3CMYA 4ZZLA 4HG2A 3OYKA 1FBQA 4ENMA 1Y0UA 4I98B 2K4JA 5M5XJ 2DT7B 2ZB9A 5C4XJ 3PO2J 4XQFA 4ZJZA 4XICA 4BQNA 2FBHA 2DCEA 3M9AA 1M1EB 3FBNB 5ICGA 1STZA 3L2WA 2R7QA 1WWXA 5EF6A 1MNEA 3S15J 4M9SA 4IJAA 3C7JA 1KZHA 5E3LA 1YS7A 3BP8A 3MD2A 5KAFC 2XSDC 3QOEA 1ZLKA 3N97A 2X1DA 5EDNA 2GM4A 2V1UA 2GXBA 3K4KA 5EZGA 2K85A 2KISA 4Z2YA 5M5YJ 1IZ1A 1JXSA 3ASNH 3SEZA 3HM5A 4ZTFA 1SEUA 4WF2A 2DAOA 3IRQA 1EA3A 2OU2A 2EIMH 3QPHA 2HYJA 1FSEA 1J75A 1FEXA 5HS9A 1MKMA 2GWRA 3TO9A 5D5WB 3WGIA 2IA0A 4NBQA 5E3MA 4B8XA 1A04A 5LHHA 2CV0A 4EMSA 1R5HA 3AAFA 1QU3A 1UJ8A 2M0CA 4DYCA 5K5QA 5HVQC 2E5ZA 3T1BA 1N75A 4DOZA 1DGRM 4YFXF 1T95A 5F0HA 2P0WA 1FT9A 1LDKB 2DA2A 3S17J 1V3FA 1ZG1A 3F8FA 1PUFB 1SMTA 2L0KA 2L7FP 1KQ8A 1LDJA 3CQZJ 3LA7A 4XLPF 3BG7A 3ML6A 3CMMA 3Q0UA 1YFHA 2O8KA 1GXPA 4EGYA 4BBSJ 2OAZA 4C2MJ 2ZNZA 1G3YA 1V5EA 2G7HA 5FROA 3V8LA 3C1DA 2LD5A 2EINH 1RRJA 1TTYA 2XGEA 1BJAA 4BHCA 1XB4A 2IGOA 1TL8A 2F5EA 5J1RA 4AIKA 3PIPF 3JCUC 1YW7A 1ETWA 4CZZA 3S3OA 2OQGA 1Z7LA 2ZMEB 1LQ1A 3SEQA 3HOVJ 1T0FA 1L0OC 4AIJA 1HXDA 4BDZA 2OC6A 1R71A 1W36C 3IH2A 2NVTJ 3CMAI 2V1NA 4JX6A 3ZMZA 1RZ4A 1X58A 2RC4A 4W97A 2WC2A 2PMUA 4S04A 1LE8A 2M34A 3DV8A 4BKXA 1ZR2A 3GFLA 2R0QC 1IV6A 3DFGA 3ISPA 4YRVA 2EZHA 2XB0X 2LKSA 1F4KA 2Y0SA 4Q48A 5C4JJ 3L2CA 4BEHA 2XIGA 1VFCA 1D5VA 1LJ9A 3CDLA 4LIUA 3M4OJ 2E1CA 4XSXF 3HC7A 1Q1HA 4FX0A 2XF7A 3ABUA 3TGNA 4MFDA 3QPLA 1MIJA 1UFMA 1RPWA 3FXLA 3G1LA 4L9TA 1AKHA 2L4AA 1GUUA 3F8MA 1DQUA 4R1HA 5FFXA 3CO6C 3BR5A 3ZQFA 2R5ZB 4PGGA 3MN2A 4IRGA 1LNWA 2FE3A 2AXLA 3G73A 3BPXA 1XMAA 1J2XA 5IOYA 1O3SA 3E7LA 1PDNC 4YIRX 1NH3A 5DDGA 1IXSB 1HQCA 1J0RA 5D8LB 3L09A 2L01A 2Z5UA 3SZPA 3LQRA 1J59A 5J40A 1HLVA 1O7LA 1IO2A 1F9NA 1IRFA 2IAIA 3BROA 3IWZA 5FLVA 4RM3A 2VB6A 3LSIA 4CSWA 2E2JJ 2CW0F 3FM5A 4MNUA 2D5VA 1IJWC 1BW5A 1GV2A 2YR2A 5D6FA 5FRNA 1G3TA 2OUMA 3COAC 4XN3A 1EH6A 4M3GA 4LITA 1RR8C 1ZAOA 4ZTJA 4XRFA 3CD6I 1V4RA 5CVIA 3EDPA 1HW1A 1WI9A 1DP7P 2KL4A 1D0YA 3PFYA 3AG3H 2VKVA 3WG9A 1SANA 3GFIA 2Y0SN 3EYYA 3ZR8X 4LG0B 3QRFF 2WA0A 1SVMA 4DW6A 3OL3A 1XDSA 2IBDA 3WE3A 2Z99A 3S1MJ 2O61A 1MJ9A 5DD8A 1BR2A 2LMDA 2XAUA 3KX2A 5J1UA 3V7RA 2NVQJ 4RA2A 4XLEA 5GPCA 1ZH5A 1H9TA 3F22A 2VOOA 3OMYA 3ZQGA 2PG4A 2M7BA 3G71I 3DPLC 1SD7A 2KDOA 5JI6A 4G12A 3HOWJ 1SAXA 2ZXHA 4OIPF 3D0SA 2P7VB 3PNVA 4GYIA 3IUOA 4ZYHA 2E7WA 3DEUA 4P96A 5LEJA 4ABZA 1JJ8C 3RPQA 2KFDA 1C0WA 5IYCJ 1IN6A 2CQKA 2CQXA 4S05A 3ZRGA 1KQ9A 1FPQA 4NDLA 4RAGA 3MMYB 1XN7A 2DK5A 2DMQA 1KGSA 3CZ6A 3IV5A 3N05A 3S2HJ 4V2GA 3OYAA 4AVZA 4L9JA 1D0ZA 3BPVA 5IT3A 4MEYF 3K7AJ 3MQ0A 4I99C 5F6FA 2P7CB 3OYFA 4P5OA 3W6KB 3DTIA 3QAHA 1IN4A 3VDXA 2ECBA 1APLC 4BGDA 4OIOF 2VOPA 1R1UA 2JA6J 1X1DA 5DV5A 2QKMB 4AYBA 4RB1A 3IHUA 3ROUA 4OAYA 3BR0A 3RYRA 2K9NA 1A36A 1B8IA 1QRYA 1YG2A 5IPAA 1IRZA 2DA1A 2MD0A 2OPTA 4HNVA 2ESNA 1KYWA 2HVRA 1XCBA 2L3DA 4CICA 3HOUJ 3LSMA 1EV7A 2V26A 1GDTA 3LL7A 3OV8A 4D7NA 1QO0D 3HTUA 2H1KA 1HDPA 2EZKA 5D8KB 2AS5F 5IT9Z 2VXZA 2X6WA 1V55H 2A69F 3F6VA 2NVXJ 2EZLA 3I59A 3BQZA 3EUAA 5CVJA 5FLXK 3WGHA 4HV5A 2R93J 4MQVA 4YFNF 2LOOA 1DP3A 3OS2A 1QPMA 4L5EA 3CDIA 3EUHA 1WJEA 4IF4A 4M9XA 2FRHA 2RDPA 3GXOA 1XCVA 2BVMA 1JJ6C 2TRTA 3OWTA 2QM3A 1AKHB 1B59A 2Q2EB 4XLHA 1XS9A 5ILVA 2ESHA 2Y31A 2V6EA 4EV0A 1Z6RA 2QGUA 2PMZA 2PFBA 3PNTA 1R23A 1JTYA 1OISA 2MLGA 3B73A 4KMUX 4RGSA 4FE7A 5GAHJ 3S1NJ 3VODA 1VQ7I 2PMHA 2QQAA 2V6CA 4ZDLA 2EB7A 2KP6A 3QWLA 2R5YA 1OCZH 3CTAA 2XAFA 1CF7B 4U0YA 5HLHA 3P7NA 3OSFA 2DFFA 2JVHA 4A3IJ 1VQOI 3HPHA 3KP6A 3H92A 2I10A 3PJRA 2VJ4A 1CF7A 1R1VA 2BXYA 4U0WA 3FWEA 3IH4A 2Z9OA 2HOSA 3DU5A 2VKHA 3CF5F 2XB5A 1PYVA 2KRCA 1LPQA 1ZG5A 2P5LC 4QLCU 2LF7A 3CUQA 3L9FA 5DCMA 2FNPA 3C2HA 3GTOJ 1HKSA 5L3FA 2LKXA 1U5TB 3K0LA 2DDBA 2KIQA 4UY8I 1E3HA 3ABTA 1V5GA 3R61A 2M8EA 3T5XA 2MYSA 3SDBA 3CLOA 3JSPA 5L3GA 1HSJA 2ID3A 4N0BA 1YHQI 3TBIA 4KMFA 2R7SA 1FWZA 4G8XA 1X1PA 5F1RA 5KK1A 2F5CA 2D2WA 3BTIA 1EKEA 2OF7A 4RAYA 3PSIA 3VYSB 4BE1A 4U88A 2G9WA 3PQKA 2V9VA 4FASD 3TO7A 3HJEA 5GAGJ 5BPIA 1WGXA 2FSWA 4RAZA 3FMRA 5EG0A 2JN6A 2L9SA 3K1NA 1P4WA 4G6TB 2EJRA 2WWYA 5D5VB 3H0DA 1HCRA 3IKVA 2DDAA 2CSOA 1KU9A 3MVPA 1A35A 2HOTA 5TISC 1Y6IA 1WJCA 4F93B 3BTCA 2O03A 4B3XA 5GAEJ 3DF8A 1X1CA 1LVAA 2H6BA 3HOYJ 2WV1A 2KZVA 4YG2F 1ZQ3P 2CV2A 1XTAA 1B4AA 3BZ6A 3GF2A 1TNTA 4M73A 4MTEA 2E7XA 2AO9A 1SC7A 2STTA 1YO5C 2CGPA 4C3JJ 1RR7A 1OCPA 1WZ2A 3RJPA 2FMLA 2BOLA 5D6EA 5JR3A 3LMMA 1SVLA 2E35A 2VE8A 3OYGA 1O3RA 1UG0A 1Q1VA 2BVLA 4XBFA 2FQ3A 1ZRFA 2M1BA 1O7FA 4HEA2 4NUBA 1OCRH 3BDDA 4L9NA 2X6OA 1FX7A 3GTKJ 4BNCA 3S2WA 1XDUA 3OYMA 1YJWI 3V8JA 2R7DA 2YS9A 4RB2C 1K61A 2LF8A 1JKOC 1T39A 2P81A 3K6GA 4E7SA 3JRIA 1GVDA 2JA7J 3F8NA 2NXNB 4IHYA 4KUMA 2ZXIA 4LD5A 1V5FA 4AD9A 3GVAA 2E19A 2V4JC 1ETQA 2VN2A 3M7GA 3BWGA 2OA4A 4Z6YA 2M0MA 2FEZA 3TO6A 1FMWA 2YPRA 4XKBA 2J5PA 2JRMA 1LVKA 4CZCA 2O3FA 1PP7U 2IJLA 3HKZN 3BCBA 2LLKA 1K6OA 3JRAA 3Q0VA 4CH7A 2DMUA 1Z05A 3DP7A 1G6NA 1XSXA 3X2QH 4AVPA 4P55A 3TW6A 4K2EA 2XGCA 1JHFA 1H9GA 3JR9A 3BC8A 5FKMA 4PK4A 3GLXA 5F1JA 2BYVE 3ZMUA 2HXIA 4A3EJ 2JJ7A 3T0YA 4DNCA 5FD6A 1Z91A 5KVRA 3CCJI 3A2KA 2V1DA 3BCAA 4F52A 3C2GA 3RKYA 4BJ6C 3EYIA 2A5YB 3IAM2 4XSZF 1MW7A 2FBIA 5FJ8J 2CFOA 1YIOA 4FT8A 4O3MA 4O6JA 3RYPA 5JVGF 4KNYA 2CMPA 1FZPB 1VQMI 1RESA 3WODF 3ZQIA 3J80K 1FTZA 3I56I 5J1YA 1OYWA 5CPRB 5FKOA 3W2AA 1XPXA 2NS7A 1MJAA 2KRHA 3SZGA 3KEQA 4IHSA 1LFBA 2LREA 2JPBA 4Q4ZF 4J01A 2BW3B 3HOSA 2PEXA 2VIXA 2Z16A 4RB3C 3S3MA 4YIIA 4HPQA 3LQQA 5HLGA 3I71A 3H9JA 3BTJA 1CQTA 2K5CA 3LAPA 2F4IA 1MDMA 4JP0A 1H88C 2H09A 1Z1DA 3S1QJ 1D0XA 1I3QJ 1VQ5I 1POGA 3BQYA 3M1CA 2G7UA 4F92B 1IXCA 3K69A 1R1TA 1ODDA 1B72B 1J9IA 3KLOA 1ULYA 1W5SA 2XVCA 1MH3A 5DTDA 5HNFA 3J81Z 5M5WJ 3QODA 4XORA 4XRSG 1GXQA 4FTHA 2FNAA 5DUIA 1G2HA 3WU2C 5M3MJ 1E3PA 1X2MA 3HRTA 3DLLF 3R0JA 1BL0A 1IXRC 2VXDA 1IAWA 4CYCA 2VQLA 2A07F 2L9VA 2HKOA 3A1YA 5B5EC 3I4NJ 4B43A 3MKYB 2IT0A 2CUEA 2W84A 2QQBA 1EF4A 2EFOA 5EEHA 5ERIA 3NWSA 5D4RA 2HGCA 1ETYA 2DLLA 1UHMA 2R7VA 3DWLE 4RDUA 2XAQA 3JTGA 1LKXA 2I8DA 1A6QA 1QBJA 4XOTA 4XKVA 3W2VA 1FBUA 4L0ZB 4IL6C 3V8KA 3DBRB 2CRGA 3UNGC 1HW2A 1U9OA 3PSFA 2AXTC 3K4LA 4HV6A 3OYIA 2ZMEA 1VQPI 2QBYA 4DIQA 1W7PA 4NC8A 4D0PA 1IUFA 1U5TC 3D1NI 3K4JA 4EJTA 1BJZA 2M3AA 5E79C 1XMXA 3GYHX 1MBGA 5E1ZB 1FC3A 2DXIA 5CLSA 1JUMA 4BE0A 5K1YA 2EIKH 4DZJA 4IRHA 1Z7UA 2VJ5A 4IX7A 4B3AA 1BR1A 2HOAA 4NC7A 3B02A 1D1AA 3GFMA 4BY7J 4ZH4F 2DPUA 2LY9A 2MGQA 2XKOA 2WY7Q 2UXNA 2VKEA 3BLYA 4UUSA 1Y39A 4HF2A 4XLAA 4BS9A 1WVRA 5LRSA 2EA2A 2GQQA 2CW8A 2KQRA 2ME6A 3CCEI 3OY9A 1K79A 3HOTA 3PIOF 1REPC 3R6SA 5JFRA 2VT2A 1SFEA 2XDVA 2QZ8A 3SQNA 3FKIJ 5D4SA 1YOVB 3DBHB 5E18F 2NVUB 2CO5A 4EJUA 1W5TA 1FOYA 1F1ZA 3M1EA 1U78A 3ESWB 1R4NB 3FMSA 3S8PA 2O6GE 1VQ6I 2R7FA 3LFKA 3S93A 2LY2A 2IP2A 4D9JA 1HA8A 4HNUA 3HOZJ 5E20A 4XK4A 4G7OF 2DT5A 1TNSA 2PQ8A 1IN5A 4UHTA 1K78B 1YRNB 2QENA 2ZSHB 3JSOA 1I27A 2VODA 1S5LC 2TCTA 2LSOA 4L5IA 1DUXC 2L4MA 2MH9A 4W1UA 4IHWA 4XMYA 2JPCA 1T33A 1HKQA 3QP5A 4ENJA 4TV7A 4ON0A 2OZ6A 3M8FA 3PQJA 2XC7A 2VI6A 1SD5A 2KJBA 4G9YA 2ELHA 4EM2A 1RUNA 2LY1A 2B7EA 2MW8A 3HPGA 4E7ZA 2HPIA 3WE2A 5HS7A 2ISYA 4BY1J 1VZ0A 5DCMB 2GXAA 2OBPA 1T0FC 4NB5A 1W7PB 2WAQN 1BR4A 4XLNF 3RZOJ 3RKQA 4ASNA 4Y17A 2XAGA 3DBLB 1P2FA 1XG1A 5GPAA 1OMIA 2XAJA 4E70A 2HQAA 2HYFA 2QSFX 4ESJA 2WTEA 3R60A 5LHIA 1YLFA 5FO5A 2BW3A 4RGXA 1D1CA 4A3LJ 3F9KA 3HRSA 5CQGA 5CQEA 2EH3A 3VOEA 3D5LA 4CYCB 2DFEA 2V9KA 1K4TA 1R00A 4M74A 4UVBA 3V42A 5FD5A 3WGGA 3RCOA 2P5VA 1X2NA 3ZGKA 4LG3A 3I3LA 2EFWA 4BH9A 1MBHA 1B6AA 2L2OA 3ZN0A 1XGOA 4DZPA 1QZYA 4D5CA 4DQ2A 1ZN2A 2A61A 5IOZA 2LBFA 1JHHA 5DD4A 3G1OA 2NNNA 2KDZA 4CCJA 1X1AA 2DN0A 3OYJA 1NG6A 3RSNA 5B66C 2CUJA 3K1PA 5E1XA 1OFCX 2OTLI 1BI1A 1DGWY 4HRIA 1Y1VJ 2QQ8A 3O8HA 3BZKA 4EM1A 1JKPC 3K9TA 4C3IJ 2JWTA 4X1EA 2J5OA 1SFOJ 3U9GA 1OQYA 4EGZA 3MKZA 5HDKA 2AHQA 6PAXA 4I7HA 1I39A 4I01A 2L54A 3K2AA 3CCSI 2YX7A 2V7FA 1OCTC 4XR6A 2XF5A 2LG4A 5HODA 5HLTA 1TLHB 2DBBA 3MAJA 4B48A 1JT0A 3CJNA 1U8RA 2KT0A 2QCOA 2Y48A 2ZNYA 2NVYJ 2F5DA 3LA3A 1ZR4A 5TGTA 1BM9A 1TWHJ 3BY6A 1PUEE 2XPUA 3AFHA 5KAIC 3TDUC 3MEXA 1OCCH 3RZDJ 3CDHA 3LSPA 2GA1A 1YE9A 3H35A 1WSUA 2JVGA 1IF1A 3ZMDA 4A0YA 4R79A 4A3FJ 2M5WA 2AQFA 4N4NB 2VJIA 3TW7A 1RI7A 2NOJB 2IRFG 4GFBA 3TOAA 4KT6A 4LJZF 1CGPA 2Q0OA 4XOPA 1ZARA 1XSDA 2EQRA 1E0EA 4BHBA 2DMPA 2MABA 5LLQA 5D5XB 4N9HA 3OYBA 2KZGA 2WY8Q 3KP3A 5FB2A 3LSRA 2WADA 3RIRA 1Z67A 1T08B 2CUZA 1LB2A 2GXGA 4A5NA 2M45A 1P4AA 3GMEA 1JGGA 3KEOA 2A5WA 2R3SA 2Y75A 5ICFA 3OYLA 4HOBA 3RI4A 2GZWA 1TWAJ 1W36D 3DTEA 4UV9A 4RBOA 2ZJ2A 5ILSA 1JGSA 2EFNA 4M6VA 1ETVA 2M4GA 4ETSA 2XROA 5L3BA 1HKTA 5J6XA 4DBQA 2R7ZJ 1P7IA 2K3FA 3V7SA 2JA2A 4Y33A 4BU2A 3OOPA 4BE2A 1RIOH 3DKWA 1OYYA 2WB1A 2YX4A 4JK1X 4ITVA 3WTSC 4A6DA 4PJLA 1OYIA 4MIMA 4GDFA 1QZZA 2GIZA 3EUKL 1TT5B 3H1CA 4LB5A 2VQHA 1BBYA 4UB6C 3A02A 1TW2A 3J7ZI 3VYRB 3I9V2 1ERDA 4BXFA 5HS8A 3K4NA 1W0TA 3CCRI 5TRDA 1UAAA 3HEFA 3QOPA 3S14J 3F21A 2W25A 4OU0A 3H36A 2CQNA 5EYRA 4PJMA 2K9SA 4PZJA 1WRJA 2Q2EA 4LLNA 3C2BA 1BI3A 1S9HA 1KA8A 2X0LA 3PM1A 5FKLA 4CCLA 4WK8F 3WTTC 2W7NA 3BJAA 5EZHA 4IHXA 4I2OA 3FISA 1QGPA 1D1BA 3G2BA 3QU6A 2HI3A 1I50J 1ZGAA 3EUHC 1UG2A 2RREA 4LLGF 3KLNA 4IOAF 3CJTB 2P8TA 4G6DA 4C2TA 2OTJI 2DU9A 1MMNA 2A68F 3OR2C 1XC5A 3QYFA 3RDIA 3FDYA 4IHVA 2JA8J 1S8NA 4LFUA 4KFCA 1FOXA 3FZVA 2F4OB 4LB6B 4CCMA 1NG7A 3VYUB 2E1MB 2HVQA 4RMNA 1KQ0A 4L9VA 5FLMJ 3A0BC 3ZQHA 1OKRA 2NS8A 1N25A 4ZDPA 3LAJA 3FM3A 2PI0A 2BZTA 4OINF 1AA7A 5DCFA 1G59A 1QVTA 2KMUA 4QIWN 1ZGWA 2DTZA 2VBZA 4I02A 1PUFA 1ETKA 4IQJA 1I5ZA 3A4CA 1UB9A 2OZUA 3ZCOA 4WCGA 3FIWA 1LE8B 4OAZA 1IRGA 3WTUC 2HWVA 5C44J 2VBXA 3FK7A 4FCYA 4BQOA 2F48A 2E5NA 3TP0A 2ELJA 4CXFA 4BACA 3IP4B 4A3KJ 3T8TA 4LMYA 2CG4A 3FXUA 3KZIC 1OCOH 3FXRA 5IP9J 3A01A 3KE2A 3G6EI 3MZ8A 3ZMTA 4Q5SF 4HYEA 3GTPJ 2X1EA 2UXXA 4UV8A 4XKCA 4ANJA 4HQEA 3VWBA 3S2DJ 3CP2A 3K70D 2HPMA 2DYRH 2LTPA 5F04A 4OIRF 5ED4A 2XPWA 3MKLA 1JKQC 4XKWA 1RKTA 1MBJA 3HTSB 3FXMA 3BJOA 3QU3A 3NEUA 3P9IA 3OIQA 1SFXA 1WJBA 2YU3A 2PX9A 3ZN1A 3OSGA 3HKZA 4B1RA 5K7ZA 2BEOA 3P9KA 1HBXG 4KT5C 4CGZA 2Y9YA 2KIFA 1TWCJ 3IH3A 2O0YA 2E1OA 2DQLA 2A6TA 2IW5A 2LYCA 5GP9A 1WFXA 3EETA 2QF7A 3ABMH 2KIMA 2DPDA 1IV8A 2EV6A 3VPRA 4ZYAA 1GVJA 4HDUA 3KP2A 1G4DA 2QEXI 2W1OA 5BPDA 1BN5A 3GX4X 2EK5A 2JQ7A 2BY2A 4AUXA 2QSGX 3I53A 4II3A 3GBGA 2K4BA 3QYBA 5E8GA 3BR1A 5IY5H 2OCCH 4A69C 2D45A 1OR7C 1S72I 5FKKA 3V4GA 2QUFA 3FBIB 1SD6A 2EPFA 1IUYA 5AONA 3CO7C 5H20A 3H5NA 2HYGD 3ZQQA 2VONA 3FF5A 4FQGA 2EILH 5J4VA 1GLNA 3BG5A 1LDDA 2Q8KA 4LK1F 2MA3A 4M71A 4HAMA 4PGHA 1J7KA 3OOUA 3HHGA 4BJTA 1OJLA 1P7JA 1P92A 3KP4A 3CUOA 2CFXA 1YW9A 3UR3C 1KU7A 1B9NA 2FBKA 5IP6A 1IRXA 3RQIA 1FLIA 5DM7F 3E5QA 2ZJQF 3F72A 3CCYA 2JK3A 2Z1DA 3AG1H 3K4CA 4KDPA 3CCVI 2DI3A 2N8GA 1ON1A 2IGMA 3G3ZA 4AWXB 1F43A 2RVCA 5F08A 3ECHA 2BXZA 2IGNA 2NAZA 2HQRA 5BS6A 1R5GA 1IN8A 2KLOA 1AU7A 1AHDP 2ADUA 1JKRC 2WAQA 3LFUA 5E3NA 2DJNA 2B0LA 1GT0C 4A3CJ 4OWRB 1FYMA 3DTKA 1SFKA 4XONA 4E7JA 2V9PA 3FHNA 4F7ZA 4BBRJ 1DU0A 1ZRCA 4QPOA 4UUVA 2R7WA 1WJDA 5GTIC 2FOKA 3WU0A 1GHCA 3DPTA 3FXKA 3O2PE 3TEDA 1QPIA 2VASA 1MDMB 5DS9A 3FXOA 1MMDA 3HB9A 3SZTA 1N77A 2JUGA 2A6EF 3TQNA 1D5YA 2NYXA 5LGUA 4HQMA 2LK2A 1ZRDA 4KN7X 5EJCA 4CYDA 2BHYA 4IHTA 3L7WA 1MMAA 4ESFA 3MCZA 3ERMA 3H0GJ 4EJWA 3I55I 5IT9K 3ZOBA 2VC1A 1MMGA 2BHZA 2R92J 5K7HA 2MLKA 3Q3SA 5B3SH 1ZG3A 2P6TA 2Q1ZB 4X0GA 4ENNA 3DKYA 4EJVA 3L1PA 1MBEA 1YQAA 4GGGA 4B4CA 4H4KC 4RM2A 1XGNA 4NNJA 4OMYA 1F5TA 2ELKA 1JI8A 3RQ4A 2XGXA 5ICCA 4OIQF 4PSWA 2CWEA 2X48A 1OPCA 2BY1A 4MHGA 5EGOA 1Y1WJ 1YITI 4AC0A 5L3DA 4AYBN 2H8WA 2L7MP 4BEHB 3AG2H 5FKNA 1B1BA 2MH2A 3KPHA 3QYEA 5JLXA 3OR1C 3KCCA 4NHJA 3KYCB 4XRSA 4Y13A 1V54H 2ISZA 4EQQA 3JRBA 2IGKA 3Q9VA 3CLQA 1P6RA 1YJNI 3F8CA 4A5MA 3IRRA 2B9SA 1G3SA 4GRIA 3K4MA 4M72A 1X3WB 2FQ4A 2L5QA 2DO7A 4GYGA 1KONA 1E17A 3ABLH 4LGWA 4G7HF 1H0MA 1K4SA 2HDCA 1PJRA 2DFIA 3FKJA 4HA8A 3GO5A 4L18B 3HZJA 4QSHA 5KNLA 2TDXA 1Z3XA 1QVUA 2RN7A 1TWFJ 2RQQA 2FOWA 2LRDA 4FE4A 3H3VK 3Q0WA 2K9LA 4IRIA 3WTZA 4LOCA 4XM3A 4PUSA 1B9MA 2LDUA 2QVOA 1WKMA 2W4SA 4XN0A 2IS6A 4PCQA 4RLQA 2R7XA 4A3GJ 3M8JA 2BY3A 1FIPA 5H6RA 2CU7A 2FU4A 2Y30A 1T2KA 2VBYA 3OIOA 4A3DJ 4HBLA 2FXAA 4LG0A 4OOIA 1WI3A 2A05A 4M9ZA 2ECCA 1BC7C 2X4HA 3SXYA 3JTHA 2DT6A 2PJRB 4AM3A 4PJJA 1JUPA 2XRLA 1JE8A 3ZMSA 1FOKA 2H1LA 1FP1D 3OYCA 1NTCA 4AIDA 2VQGA 3QQAA 3FK6A 1LUJB 4RGRA 1XD7A 3ZQCA 4PFPA 3HGYA 3HHHA 3RTRA 3K2ZA 3TDZC 5J47A 2OQRA 5GADJ 3ONQA 4BQAA 4GXOA 2ZXJA 1XSVA 2M2EA 1K7AA 1W5CC 1R7JA 4RAFA 3RKWA 5J8FA 2PJRA 4P9FA 4KICA 3MZHA 3WHCA 1I1GA 1U2WA 2DOEA 4WXHA 3I59B 3I64A 3NWTA 4ZYDA 2BY0A 3U21A 2HTJA 2DFHA 3LSJA 1MMSA 4KIGA 5CJ9A 2ZJRF 2JUCA 1VQ4I 3H9QA 1I6XA 4J19A 5CVVA 1DPRA 5ILUA 2DA6A 4P1WA 1JTXA 4IOCF 1BC8C 3GTJJ 3ZQ7A 2UV1A 4V19K 4Q47A 3J7YJ 2LNBA 2CS3A 2NNYA 3BR2A 4QWQA 2Y9ZA 5IP7J 1BOAA 4U7DA 3GTQJ 2M87A 3P9CA 1RUOA 2MBFA 2HS5A 4Y15A 1ZELA 3M07A 2K02A 3J7AO 4M6XA 2JSCA 2UUZA 3I4PA 2EV5A 3CC7I 3VB2A 2DQRA 4EJOA 3GZ6A 4DBRA 2X51A 3WHBA 2BV6A 5BOXA 3FXJA 2VC0A 3P5JA 2MFZA 4UNOA 4ENKA 4E6KG 4IKFA 1H8AC 3SHFA 3HRMA 3F23A 2HXOA 4IEJA 1YI2I 1X3UA 2DOFA 5CYVA 3U1KA 2QQ9A 4RB0A 3KFWX 2MD5A 4IZZA 3TL4X 3F3XA 2HFHA 4HW0A 3T8RA 4DJAA 2ETHA 2P5KA 3QP6A 2KIUA 5KCMA 3OYHA 2VE9A 3BG6A 2C6YA 2EBIA 4E7KA 2BBYA 3VEPA 1ZHFA 4IPAA 4CUGA 3KYLA 2QBYB 4KN4X 1Z0XA 1W0UA 4MLOA 2LP0A 1SD4A 2M9HA 1OLTA 5J3LA 2JSPA 1MBKA 1LFPA 1Z9CA 2W00A 2RGVA 3NARA 4M3BA 4CA0A 4I6ZA 2MSYA 5F27A 1ON2A 2B63J 1U3EM 4XLCA 2O7OA 3CJRB 3AKZA 2E2IJ 3EPZA 2CYYA 1NK3P 4BL0B 4UUTA 2E71A 3H5AA 1YJ9I 1Z21A 4ESBA 4IXAA 2V79A 2JRTA 4BHPA 3CF2A 1ZKGA 4CDGA 2CJJA 1WH7A 1IN7A 4HNTA 2E36A 1AWCA 3H3UA 1WH5A 1Y8RB 3LWFA 4Y52J 4B09A 2L9RA 2O5RA 1JT6A 4JBAA 3PFIA 2FMYA 1D8KA 3GZNB 4EVIA 3BR6A 1A6IA 5A2QK 5TJJA 3Q9SA 3CCMI 1VQNI 3JREA 2ICWG 2NS0A 2NOGA 4M3EA 4I76A 3V7CA 1HDDC 2IS2A 5E1WA 1S29A 1TQIA 3CUQC 3E1SA 3E6MA 2XHKA 3WTYC 3A01B 2AQEA 3PL8A 3DU6A 2GIVA 3JRCA 4JYKA 1ITYA 3KP7A 4ZYGA 1O3TA 2DA4A 3N4MA 1VQ8I 1G8XA 1KYZA 1W7PD 5JLWA 1PVEA 2CH0A 2IPQX 4A2UA 3LOCA 3W2WA 5J4YA 2HU9A 4CCNA 1UHSA 3CP8A 3JRFA 2WV0A 5AIQA 2PBIA 5IYBJ 4A6EA 5DM6F 1Z77A 3L2RA 3K1MA 1TBXA 4C9YA 2LFBA 2XGDA 4U7BA 3K10A 1HC8A 1S6LA 1TT0A
chains in the Genus database with same CATH topology
4IVNA 3WTXC 5AIPA 4HZFA 4WXCA 2W24A 2V1XA 2A6HF 3ZMVA 4GCVA 4PDKA 2QLZA 2LKPA 4HX7A 2XASA 5HDGA 3ZPLA 1XGMA 2RV8A 3E6BA 1IW7F 4BAYA 5D5UB 4I09A 3FHZA 1G3WA 1EH8A 4HLYA 1HSTA 2IA1A 5FFZA 1MGTA 3W6JB 2HEOA 5DYMA 3RPUA 4CO8A 1DPUA 2KRFA 3LA2A 5F64A 3WTWC 4UVAA 3Q5FA 3TKYA 1TQMA 4H0EA 1T38A 2ACJA 4FX4A 5DEQA 3E6CC 4YIFA 3HRUA 2W85A 1KU3A 4KYWA 4WXDA 2H27A 3DXJF 1USSA 3IKTA 1SFUA 1MJBA 2OD5A 2GAUA 1VTNC 3J81K 3IL2A 1BIAA 5E17F 3KZZA 1S7OA 2JT1A 4N9IA 1FNNA 1ZYRF 3ULQB 3FX3A 4UVCA 3M8EA 3RKXA 3ERED 4KIBA 4WX9A 2EA4A 1TQPA 4M6YA 3I54A 5J8CA 1Z6TA 3ZP5A 1PP8F 2EV0A 3MWMA 2RQPA 3JW4A 5ICEA 5LRRA 3E3VA 3O3KA 3HUGA 3GWZA 3EQLF 3GFJA 3JAMK 2EFPA 2D1HA 3F8BA 1BIBA 1FSHA 1EH7A 2EWNA 2FF4A 1D8JA 4RS8A 3R4KA 1E2XA 3U1DA 5L3EA 4BYYA 2RKHA 4EM0B 1P4XA 4A12A 3KETA 1RNLA 3C3WA 3GEZA 1FYKA 4WWCA 1SMYF 2ZBKA 1NHAA 4U0VA 2COMA 1YW8A 4I0AA 4HLXA 4LK0F 3GUDA 4YFKF 5LGTA 4R8HA 4MEXF 3HSEA 3J80Z 3JAMZ 2EFQA 3E5UA 1T6SA 3QPTA 3CUQB 3E97A 4LLLA 3LSTA 3HSRA 2JTVA 2KJCA 4KA4A 1J5YA 4HF1A 2GA2A 4O5VA 3SFZA 4CHUA 3FXQA 1LEBA 2DK8A 4NQWA 4BXUA 2YSRA 4OMZA 3HYIA 2JZYA 2F2EA 1YTYA 2K7LA 2ZKZA 5LBQA 2DW4A 2BGCA 5K5RA 1BI2A 3NQOA 5LEKA 2L02A 1I1SA 5JVTA 1D3YA 2HR3A 2PJPA 3KP5A 3I5UA 2XAHA 4I0BA 2XRNA 5HDNA 2HQNA 3C18A 3KZYA 2H6CA 2NRAC 2UWMA 1S7AA 2QYOA 2XV4S 4MGRA 4A0ZA 3ECOA 4HX4A 2E1NA 4KIFA 2ZFWA 2KKOA 5LGNA 1ZREA 2RNJA 1WQ2A 1XMKA 3H3ZA 5K5OA 5FGMA 3VFZA 5CVUA 3GW2A 1R36A 2HTSA 5BMZA 2K86A 2H94A 3MZYA 3E6DA 3BJ6A 1O57A 4FHTA 2HZTA 1O3QA 5DUKA 2UZKA 3REOA 1BI0A 1FY7A 1HW5A 2IVMA 1UHWA 4L0YB 1FP2A 5A2QZ 2IA2A 1S3JA 3O6BB 5JHUA 1FBSA 2Y0MA 2P4WA 2VT3A 5L3CA 3FMQA 1ONVA 2O8XA 1MD0A 3WTVC 1U5TA 3TOBA 3HSFA 2ZO4A 2Z33A 2BE5F 2HKXA 1QNTA 1YS6A 1ZLJA 2DTRA 3R0AA 2MC3A 4ZYEA 4AIHA 4MTDA 1OR7A 3E5XA 5E8IA 1K78A 4L5JA 3L00A 1W4MA 1L3LA 2QWWA 2W57A 3IWFA 2STWA 5HLIA 2PLYA 4HF0A 1FYLA 4G94A 1DDNA 3WU1B 4ZZDA 1KU2A 1UCRA 2A3SA 4RGUA 3I0TA 5H6QA 1LEAA 1R58A 3DQVC 4G6QA 2VBWA 2K27A 3IC7A 3BOQA 2XKPA 2D1VA 3F6OA 4HX8A 2F5FA 2ZCWA 1T98A 1XGSA 4MQ9F 4UXNA 1MZBA 3NRVA 5LHGA 1R22A 4G7ZF 5BQTA 2XUBA 1QQIA 2P6SA 4P9UA 2PN6A 3GZ5A 4JQFA 4GO1A 1ZGJA 1U6GA 1YYVA 5HOOA 3MFKA 2FA5A 3ELKA 1AOYA 1USTA 2Z3YA 5FLXZ 1TW3A 2M30A 4HDVA 5CVRA 3U2RA 3I58A 3HIFA 2HOEA 4A0XA 5EEGA 4ZZLA 1FBQA 4ENMA 1Y0UA 4I98B 2K4JA 2FBHA 3M9AA 5ICGA 1STZA 1WWXA 4M9SA 4IJAA 3C7JA 1YS7A 3BP8A 1ZLKA 3N97A 2V1UA 2GXBA 4Z2YA 1IZ1A 1JXSA 4WF2A 2DAOA 3IRQA 2OU2A 3QPHA 1J75A 1FSEA 5HS9A 1MKMA 2GWRA 3TO9A 5D5WB 3WGIA 2IA0A 4B8XA 1A04A 5LHHA 4EMSA 1R5HA 3AAFA 5K5QA 5HVQC 3T1BA 4YFXF 1FT9A 1LDKB 1V3FA 1ZG1A 3F8FA 1SMTA 1KQ8A 1LDJA 3LA7A 4XLPF 3ML6A 1YFHA 1GXPA 4EGYA 2OAZA 2ZNZA 1G3YA 2G7HA 3V8LA 3C1DA 1TTYA 1BJAA 4BHCA 1XB4A 2F5EA 4AIKA 1YW7A 4CZZA 2OQGA 2ZMEB 1LQ1A 1T0FA 1L0OC 4AIJA 1HXDA 3ZMZA 1RZ4A 2RC4A 2WC2A 2PMUA 4S04A 3DV8A 3GFLA 3DFGA 3ISPA 1F4KA 4Q48A 3L2CA 2XIGA 1D5VA 1LJ9A 2E1CA 4XSXF 1Q1HA 4FX0A 3ABUA 3TGNA 1UFMA 4L9TA 2L4AA 3F8MA 4R1HA 5FFXA 3CO6C 4PGGA 4IRGA 1LNWA 2FE3A 2AXLA 3G73A 3BPXA 1XMAA 1J2XA 1O3SA 1PDNC 5DDGA 1IXSB 1HQCA 1J0RA 5D8LB 3L09A 2L01A 2Z5UA 3SZPA 3LQRA 1J59A 1O7LA 1F9NA 1IRFA 3BROA 3IWZA 2CW0F 3FM5A 4MNUA 2YR2A 5D6FA 1G3TA 3COAC 1EH6A 1ZAOA 4XRFA 1V4RA 5CVIA 3EDPA 1HW1A 1WI9A 1DP7P 3WG9A 3GFIA 3EYYA 4LG0B 3QRFF 1XDSA 3WE3A 2Z99A 2O61A 1MJ9A 5DD8A 3V7RA 1ZH5A 1H9TA 3F22A 2VOOA 2PG4A 3DPLC 1SD7A 5JI6A 1SAXA 4OIPF 3D0SA 2P7VB 4GYIA 4ZYHA 2E7WA 3DEUA 4P96A 5LEJA 3RPQA 1C0WA 1IN6A 2CQKA 4S05A 1KQ9A 1FPQA 1XN7A 2DK5A 1KGSA 4L9JA 3BPVA 5IT3A 4MEYF 3MQ0A 5F6FA 2P7CB 4P5OA 3W6KB 3QAHA 1IN4A 4OIOF 2VOPA 1R1UA 5DV5A 4RB1A 3IHUA 3ROUA 3RYRA 1YG2A 2ESNA 1KYWA 1XCBA 2L3DA 4CICA 1EV7A 3OV8A 1QO0D 3HTUA 5D8KB 2AS5F 5IT9Z 2VXZA 3F6VA 2A69F 3I59A 5CVJA 5FLXK 3WGHA 4HV5A 4MQVA 4YFNF 1QPMA 3EUHA 4IF4A 4M9XA 2FRHA 2RDPA 3GXOA 1XCVA 2QM3A 1B59A 5ILVA 2ESHA 4EV0A 1Z6RA 2PFBA 1R23A 2MLGA 3B73A 4KMUX 4RGSA 3VODA 2PMHA 2QQAA 2V6CA 2EB7A 3CTAA 2XAFA 1CF7B 4U0YA 5HLHA 3P7NA 3KP6A 3H92A 1CF7A 1R1VA 4U0WA 3FWEA 2Z9OA 1ZG5A 2P5LC 4QLCU 2LF7A 3CUQA 3L9FA 5DCMA 2FNPA 1HKSA 5L3FA 1U5TB 3K0LA 3ABTA 3R61A 2M8EA 3T5XA 3JSPA 3CLOA 5L3GA 1HSJA 4N0BA 4KMFA 1FWZA 4G8XA 5F1RA 5KK1A 2F5CA 2D2WA 4RAYA 4U88A 2G9WA 3PQKA 2V9VA 3TO7A 5BPIA 2FSWA 4RAZA 3FMRA 3K1NA 1P4WA 2EJRA 2WWYA 5D5VB 3IKVA 2CSOA 1KU9A 2O03A 3DF8A 1LVAA 2H6BA 4YG2F 1B4AA 3BZ6A 3GF2A 1TNTA 4M73A 4MTEA 2E7XA 2STTA 1YO5C 2CGPA 3RJPA 2FMLA 5D6EA 5JR3A 2VE8A 1O3RA 4XBFA 2FQ3A 1ZRFA 2M1BA 1O7FA 3BDDA 4L9NA 1FX7A 4BNCA 3S2WA 1XDUA 3V8JA 2R7DA 4RB2C 2LF8A 1T39A 3F8NA 4KUMA 4LD5A 4AD9A 3GVAA 2VN2A 3M7GA 3BWGA 2OA4A 2FEZA 3TO6A 2YPRA 2J5PA 2O3FA 1PP7U 2IJLA 1K6OA 1Z05A 3DP7A 1G6NA 1XSXA 4AVPA 4P55A 4K2EA 1JHFA 1H9GA 3GLXA 2BYVE 3ZMUA 3T0YA 4DNCA 5FD6A 1Z91A 5KVRA 2V1DA 3RKYA 3EYIA 2A5YB 4XSZF 2FBIA 1YIOA 4FT8A 4O3MA 4O6JA 3RYPA 4KNYA 1FZPB 3WODF 3J80K 1OYWA 1MJAA 3KEQA 4IHSA 4Q4ZF 2JPBA 3HOSA 2PEXA 4RB3C 4YIIA 3LQQA 5HLGA 3I71A 3LAPA 1MDMA 2H09A 1Z1DA 2G7UA 1IXCA 3K69A 1R1TA 1ODDA 1J9IA 3KLOA 1ULYA 1W5SA 2XVCA 3J81Z 1GXQA 2FNAA 5DUIA 3HRTA 3R0JA 1IXRC 1IAWA 2A07F 2HKOA 2IT0A 2W84A 2QQBA 2EFOA 5EEHA 5ERIA 5D4RA 2HGCA 2DLLA 1UHMA 2XAQA 3JTGA 1QBJA 4L0ZB 1FBUA 3V8KA 1HW2A 4HV6A 2ZMEA 2QBYA 1W7PA 4D0PA 1U5TC 4EJTA 3GYHX 5E1ZB 1FC3A 5CLSA 5K1YA 4IRHA 1Z7UA 3B02A 3GFMA 4ZH4F 2DPUA 2XKOA 2UXNA 4HF2A 5LRSA 2EA2A 2GQQA 1K79A 3HOTA 1REPC 3R6SA 5JFRA 2VT2A 1SFEA 2QZ8A 3SQNA 5D4SA 5E18F 2CO5A 4EJUA 1W5TA 1F1ZA 3M1EA 1U78A 3FMSA 2O6GE 2R7FA 3LFKA 2IP2A 5E20A 4G7OF 2DT5A 1TNSA 2PQ8A 1IN5A 4UHTA 1K78B 2QENA 3JSOA 1I27A 2VODA 4L5IA 2LSOA 1DUXC 2L4MA 2MH9A 2JPCA 1HKQA 3QP5A 4ENJA 4TV7A 4ON0A 2OZ6A 3M8FA 3PQJA 4G9YA 1SD5A 2KJBA 4EM2A 2ELHA 1RUNA 3WE2A 5HS7A 2ISYA 5DCMB 2OBPA 4NB5A 1W7PB 4XLNF 4ASNA 4Y17A 2XAGA 1P2FA 1OMIA 2XAJA 4E70A 2HYFA 4ESJA 2WTEA 3R60A 5LHIA 1YLFA 5FO5A 4RGXA 3HRSA 3VOEA 3D5LA 1R00A 4M74A 4UVBA 5FD5A 3WGGA 2P5VA 2EFWA 4BH9A 1B6AA 3ZN0A 1XGOA 1QZYA 4DQ2A 1ZN2A 2A61A 1JHHA 5DD4A 2NNNA 3K1PA 5E1XA 1BI1A 4EM1A 3K9TA 2J5OA 3U9GA 4EGZA 5HDKA 6PAXA 4I7HA 4I01A 2L54A 2YX7A 1TLHB 2DBBA 3MAJA 3CJNA 1U8RA 2Y48A 2ZNYA 2F5DA 3LA3A 1BM9A 3BY6A 1PUEE 3TDUC 3MEXA 3CDHA 2GA1A 1WSUA 1IF1A 3ZMDA 4A0YA 4R79A 2M5WA 1RI7A 2IRFG 3TOAA 4LJZF 1CGPA 2Q0OA 1ZARA 1XSDA 4BHBA 5LLQA 5D5XB 4N9HA 3KP3A 5FB2A 3RIRA 1LB2A 2GXGA 4A5NA 2M45A 1P4AA 3KEOA 2R3SA 2Y75A 5ICFA 4HOBA 3RI4A 2GZWA 4UV9A 2ZJ2A 5ILSA 1JGSA 2EFNA 4ETSA 2XROA 5L3BA 1HKTA 5J6XA 3V7SA 3OOPA 1RIOH 3DKWA 1OYYA 2YX4A 4JK1X 3WTSC 4A6DA 1OYIA 1QZZA 4LB5A 1BBYA 1TW2A 5HS8A 5TRDA 3QOPA 3F21A 2W25A 4OU0A 4PZJA 1WRJA 2Q2EA 4LLNA 1BI3A 1KA8A 2X0LA 4WK8F 3WTTC 3BJAA 4I2OA 1QGPA 3QU6A 1ZGAA 4LLGF 3KLNA 2P8TA 4G6DA 2DU9A 2A68F 3RDIA 1S8NA 4LFUA 4KFCA 3FZVA 4LB6B 1KQ0A 4L9VA 1OKRA 3LAJA 3FM3A 2PI0A 4OINF 5DCFA 2VBZA 4I02A 1I5ZA 1UB9A 2OZUA 4WCGA 1IRGA 3WTUC 2HWVA 2VBXA 4CXFA 3T8TA 4LMYA 2CG4A 3FXUA 3FXRA 3KE2A 3ZMTA 4Q5SF 4HYEA 2UXXA 4UV8A 4HQEA 4OIRF 5ED4A 3HTSB 3BJOA 3QU3A 3NEUA 3P9IA 1SFXA 2YU3A 3ZN1A 2BEOA 3P9KA 4CGZA 4KT5C 1HBXG 2KIFA 2O0YA 2DQLA 2IW5A 3EETA 2KIMA 2DPDA 2EV6A 1GVJA 4HDUA 3KP2A 1G4DA 5BPDA 1BN5A 3GX4X 2EK5A 3I53A 2K4BA 5E8GA 2D45A 3V4GA 2QUFA 1SD6A 1IUYA 5AONA 3CO7C 5H20A 2HYGD 2VONA 3FF5A 1LDDA 2Q8KA 4LK1F 2MA3A 4M71A 4HAMA 4PGHA 1J7KA 3HHGA 1P92A 3KP4A 3CUOA 2CFXA 1YW9A 1KU7A 1B9NA 2FBKA 1FLIA 3E5QA 3F72A 4KDPA 2DI3A 1ON1A 3G3ZA 4AWXB 2RVCA 3ECHA 2NAZA 2HQRA 5BS6A 1R5GA 1IN8A 2ADUA 2B0LA 1FYMA 4F7ZA 1ZRCA 4UUVA 2FOKA 3WU0A 1GHCA 3DPTA 3O2PE 1MDMB 3SZTA 2A6EF 3TQNA 1ZRDA 2NYXA 5LGUA 4HQMA 4KN7X 4CYDA 4IHTA 3L7WA 4ESFA 3MCZA 4EJWA 5IT9K 2VC1A 2MLKA 1ZG3A 2P6TA 4ENNA 4EJVA 1YQAA 4GGGA 1XGNA 4OMYA 1F5TA 2XGXA 5ICCA 4OIQF 2CWEA 4MHGA 1OPCA 5L3DA 1B1BA 2MH2A 3KCCA 4NHJA 4Y13A 2ISZA 4EQQA 3Q9VA 1P6RA 3F8CA 4A5MA 3IRRA 1G3SA 4M72A 2DO7A 4GYGA 1E17A 4LGWA 4G7HF 1H0MA 2HDCA 2DFIA 4HA8A 3GO5A 4L18B 2TDXA 2RN7A 4IRIA 3WTZA 1B9MA 2LDUA 2QVOA 1WKMA 4PCQA 5H6RA 2FU4A 1T2KA 2VBYA 4HBLA 2FXAA 4LG0A 4OOIA 4M9ZA 1BC7C 2X4HA 3SXYA 3JTHA 1JE8A 3ZMSA 1FOKA 1FP1D 4RGRA 1XD7A 3HHHA 3RTRA 3K2ZA 3TDZC 2OQRA 4BQAA 4GXOA 2ZXJA 1XSVA 1K7AA 1R7JA 3RKWA 5J8FA 4P9FA 4KICA 3MZHA 1I1GA 1U2WA 4WXHA 3I59B 3I64A 4ZYDA 2HTJA 4KIGA 5CJ9A 1I6XA 5CVVA 1DPRA 5ILUA 1BC8C 3ZQ7A 4Q47A 2LNBA 2NNYA 4QWQA 1BOAA 4U7DA 2M87A 3P9CA 1RUOA 2MBFA 2HS5A 4Y15A 2K02A 3J7AO 4M6XA 2JSCA 3I4PA 2EV5A 3VB2A 2DQRA 4EJOA 3GZ6A 2BV6A 5BOXA 2VC0A 4UNOA 4ENKA 3SHFA 3HRMA 3F23A 1X3UA 5CYVA 2QQ9A 4RB0A 3KFWX 2MD5A 3F3XA 2HFHA 4HW0A 3T8RA 2ETHA 2P5KA 3QP6A 2KIUA 2VE9A 2C6YA 2BBYA 3VEPA 1ZHFA 4IPAA 2QBYB 4KN4X 1SD4A 1Z9CA 2RGVA 1ON2A 1U3EM 2CYYA 4ESBA 4IXAA 2V79A 2JRTA 4BHPA 4CDGA 1IN7A 1AWCA 3H3UA 3LWFA 4B09A 4JBAA 3PFIA 2FMYA 1D8KA 4EVIA 5A2QK 5TJJA 3Q9SA 2NS0A 3V7CA 5E1WA 1S29A 1TQIA 3CUQC 3E6MA 2XHKA 3WTYC 2GIVA 3KP7A 4ZYGA 1O3TA 3N4MA 1KYZA 1W7PD 2IPQX 4A2UA 2WV0A 5AIQA 2PBIA 4A6EA 3K1MA 1TBXA 4U7BA 1S6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IVN A;  3WTX C;  5AIP A;  4HZF A;  4WXC A;  2W24 A;  2V1X A;  2A6H F;  3ZMV A;  4GCV A;  4PDK A;  2QLZ A;  2LKP A;  4HX7 A;  2XAS A;  5HDG A;  3ZPL A;  1XGM A;  2RV8 A;  3E6B A;  1IW7 F;  4BAY A;  5D5U B;  4I09 A;  3FHZ A;  1G3W A;  1EH8 A;  4HLY A;  1HST A;  2IA1 A;  5FFZ A;  1MGT A;  3W6J B;  2HEO A;  5DYM A;  3RPU A;  4CO8 A;  1DPU A;  2KRF A;  3LA2 A;  5F64 A;  3WTW C;  4UVA A;  3Q5F A;  3TKY A;  1TQM A;  4H0E A;  1T38 A;  2ACJ A;  4FX4 A;  5DEQ A;  3E6C C;  4YIF A;  3HRU A;  2W85 A;  1KU3 A;  4KYW A;  4WXD A;  2H27 A;  3DXJ F;  1USS A;  3IKT A;  1SFU A;  1MJB A;  2OD5 A;  2GAU A;  1VTN C;  3J81 K;  3IL2 A;  1BIA A;  5E17 F;  3KZZ A;  1S7O A;  2JT1 A;  4N9I A;  1FNN A;  1ZYR F;  3ULQ B;  3FX3 A;  4UVC A;  3M8E A;  3RKX A;  3ERE D;  4KIB A;  4WX9 A;  2EA4 A;  1TQP A;  4M6Y A;  3I54 A;  5J8C A;  1Z6T A;  3ZP5 A;  1PP8 F;  2EV0 A;  3MWM A;  2RQP A;  3JW4 A;  5ICE A;  5LRR A;  3E3V A;  3O3K A;  3HUG A;  3GWZ A;  3EQL F;  3GFJ A;  3JAM K;  2EFP A;  2D1H A;  3F8B A;  1BIB A;  1FSH A;  1EH7 A;  2EWN A;  2FF4 A;  1D8J A;  4RS8 A;  3R4K A;  1E2X A;  3U1D A;  5L3E A;  4BYY A;  2RKH A;  4EM0 B;  1P4X A;  4A12 A;  3KET A;  1RNL A;  3C3W A;  3GEZ A;  1FYK A;  4WWC A;  1SMY F;  2ZBK A;  1NHA A;  4U0V A;  2COM A;  1YW8 A;  4I0A A;  4HLX A;  4LK0 F;  3GUD A;  4YFK F;  5LGT A;  4R8H A;  4MEX F;  3HSE A;  3J80 Z;  3JAM Z;  2EFQ A;  3E5U A;  1T6S A;  3QPT A;  3CUQ B;  3E97 A;  4LLL A;  3LST A;  3HSR A;  2JTV A;  2KJC A;  4KA4 A;  1J5Y A;  4HF1 A;  2GA2 A;  4O5V A;  3SFZ A;  4CHU A;  3FXQ A;  1LEB A;  2DK8 A;  4NQW A;  4BXU A;  2YSR A;  4OMZ A;  3HYI A;  2JZY A;  2F2E A;  1YTY A;  2K7L A;  2ZKZ A;  5LBQ A;  2DW4 A;  2BGC A;  5K5R A;  1BI2 A;  3NQO A;  5LEK A;  2L02 A;  1I1S A;  5JVT A;  1D3Y A;  2HR3 A;  2PJP A;  3KP5 A;  3I5U A;  2XAH A;  4I0B A;  2XRN A;  5HDN A;  2HQN A;  3C18 A;  3KZY A;  2H6C A;  2NRA C;  2UWM A;  1S7A A;  2QYO A;  2XV4 S;  4MGR A;  4A0Z A;  3ECO A;  4HX4 A;  2E1N A;  4KIF A;  2ZFW A;  2KKO A;  5LGN A;  1ZRE A;  2RNJ A;  1WQ2 A;  1XMK A;  3H3Z A;  5K5O A;  5FGM A;  3VFZ A;  5CVU A;  3GW2 A;  1R36 A;  2HTS A;  5BMZ A;  2K86 A;  2H94 A;  3MZY A;  3E6D A;  3BJ6 A;  1O57 A;  4FHT A;  2HZT A;  1O3Q A;  5DUK A;  2UZK A;  3REO A;  1BI0 A;  1FY7 A;  1HW5 A;  2IVM A;  1UHW A;  4L0Y B;  1FP2 A;  5A2Q Z;  2IA2 A;  1S3J A;  3O6B B;  5JHU A;  1FBS A;  2Y0M A;  2P4W A;  2VT3 A;  5L3C A;  3FMQ A;  1ONV A;  2O8X A;  1MD0 A;  3WTV C;  1U5T A;  3TOB A;  3HSF A;  2ZO4 A;  2Z33 A;  2BE5 F;  2HKX A;  1QNT A;  1YS6 A;  1ZLJ A;  2DTR A;  3R0A A;  2MC3 A;  4ZYE A;  4AIH A;  4MTD A;  1OR7 A;  3E5X A;  5E8I A;  1K78 A;  4L5J A;  3L00 A;  1W4M A;  1L3L A;  2QWW A;  2W57 A;  3IWF A;  2STW A;  5HLI A;  2PLY A;  4HF0 A;  1FYL A;  4G94 A;  1DDN A;  3WU1 B;  4ZZD A;  1KU2 A;  1UCR A;  2A3S A;  4RGU A;  3I0T A;  5H6Q A;  1LEA A;  1R58 A;  3DQV C;  4G6Q A;  2VBW A;  2K27 A;  3IC7 A;  3BOQ A;  2XKP A;  2D1V A;  3F6O A;  4HX8 A;  2F5F A;  2ZCW A;  1T98 A;  1XGS A;  4MQ9 F;  4UXN A;  1MZB A;  3NRV A;  5LHG A;  1R22 A;  4G7Z F;  5BQT A;  2XUB A;  1QQI A;  2P6S A;  4P9U A;  2PN6 A;  3GZ5 A;  4JQF A;  4GO1 A;  1ZGJ A;  1U6G A;  1YYV A;  5HOO A;  3MFK A;  2FA5 A;  3ELK A;  1AOY A;  1UST A;  2Z3Y A;  5FLX Z;  1TW3 A;  2M30 A;  4HDV A;  5CVR A;  3U2R A;  3I58 A;  3HIF A;  2HOE A;  4A0X A;  5EEG A;  4ZZL A;  1FBQ A;  4ENM A;  1Y0U A;  4I98 B;  2K4J A;  2FBH A;  3M9A A;  5ICG A;  1STZ A;  1WWX A;  4M9S A;  4IJA A;  3C7J A;  1YS7 A;  3BP8 A;  1ZLK A;  3N97 A;  2V1U A;  2GXB A;  4Z2Y A;  1IZ1 A;  1JXS A;  4WF2 A;  2DAO A;  3IRQ A;  2OU2 A;  3QPH A;  1J75 A;  1FSE A;  5HS9 A;  1MKM A;  2GWR A;  3TO9 A;  5D5W B;  3WGI A;  2IA0 A;  4B8X A;  1A04 A;  5LHH A;  4EMS A;  1R5H A;  3AAF A;  5K5Q A;  5HVQ C;  3T1B A;  4YFX F;  1FT9 A;  1LDK B;  1V3F A;  1ZG1 A;  3F8F A;  1SMT A;  1KQ8 A;  1LDJ A;  3LA7 A;  4XLP F;  3ML6 A;  1YFH A;  1GXP A;  4EGY A;  2OAZ A;  2ZNZ A;  1G3Y A;  2G7H A;  3V8L A;  3C1D A;  1TTY A;  1BJA A;  4BHC A;  1XB4 A;  2F5E A;  4AIK A;  1YW7 A;  4CZZ A;  2OQG A;  2ZME B;  1LQ1 A;  1T0F A;  1L0O C;  4AIJ A;  1HXD A;  3ZMZ A;  1RZ4 A;  2RC4 A;  2WC2 A;  2PMU A;  4S04 A;  3DV8 A;  3GFL A;  3DFG A;  3ISP A;  1F4K A;  4Q48 A;  3L2C A;  2XIG A;  1D5V A;  1LJ9 A;  2E1C A;  4XSX F;  1Q1H A;  4FX0 A;  3ABU A;  3TGN A;  1UFM A;  4L9T A;  2L4A A;  3F8M A;  4R1H A;  5FFX A;  3CO6 C;  4PGG A;  4IRG A;  1LNW A;  2FE3 A;  2AXL A;  3G73 A;  3BPX A;  1XMA A;  1J2X A;  1O3S A;  1PDN C;  5DDG A;  1IXS B;  1HQC A;  1J0R A;  5D8L B;  3L09 A;  2L01 A;  2Z5U A;  3SZP A;  3LQR A;  1J59 A;  1O7L A;  1F9N A;  1IRF A;  3BRO A;  3IWZ A;  2CW0 F;  3FM5 A;  4MNU A;  2YR2 A;  5D6F A;  1G3T A;  3COA C;  1EH6 A;  1ZAO A;  4XRF A;  1V4R A;  5CVI A;  3EDP A;  1HW1 A;  1WI9 A;  1DP7 P;  3WG9 A;  3GFI A;  3EYY A;  4LG0 B;  3QRF F;  1XDS A;  3WE3 A;  2Z99 A;  2O61 A;  1MJ9 A;  5DD8 A;  3V7R A;  1ZH5 A;  1H9T A;  3F22 A;  2VOO A;  2PG4 A;  3DPL C;  1SD7 A;  5JI6 A;  1SAX A;  4OIP F;  3D0S A;  2P7V B;  4GYI A;  4ZYH A;  2E7W A;  3DEU A;  4P96 A;  5LEJ A;  3RPQ A;  1C0W A;  1IN6 A;  2CQK A;  4S05 A;  1KQ9 A;  1FPQ A;  1XN7 A;  2DK5 A;  1KGS A;  4L9J A;  3BPV A;  5IT3 A;  4MEY F;  3MQ0 A;  5F6F A;  2P7C B;  4P5O A;  3W6K B;  3QAH A;  1IN4 A;  4OIO F;  2VOP A;  1R1U A;  5DV5 A;  4RB1 A;  3IHU A;  3ROU A;  3RYR A;  1YG2 A;  2ESN A;  1KYW A;  1XCB A;  2L3D A;  4CIC A;  1EV7 A;  3OV8 A;  1QO0 D;  3HTU A;  5D8K B;  2AS5 F;  5IT9 Z;  2VXZ A;  3F6V A;  2A69 F;  3I59 A;  5CVJ A;  5FLX K;  3WGH A;  4HV5 A;  4MQV A;  4YFN F;  1QPM A;  3EUH A;  4IF4 A;  4M9X A;  2FRH A;  2RDP A;  3GXO A;  1XCV A;  2QM3 A;  1B59 A;  5ILV A;  2ESH A;  4EV0 A;  1Z6R A;  2PFB A;  1R23 A;  2MLG A;  3B73 A;  4KMU X;  4RGS A;  3VOD A;  2PMH A;  2QQA A;  2V6C A;  2EB7 A;  3CTA A;  2XAF A;  1CF7 B;  4U0Y A;  5HLH A;  3P7N A;  3KP6 A;  3H92 A;  1CF7 A;  1R1V A;  4U0W A;  3FWE A;  2Z9O A;  1ZG5 A;  2P5L C;  4QLC U;  2LF7 A;  3CUQ A;  3L9F A;  5DCM A;  2FNP A;  1HKS A;  5L3F A;  1U5T B;  3K0L A;  3ABT A;  3R61 A;  2M8E A;  3T5X A;  3JSP A;  3CLO A;  5L3G A;  1HSJ A;  4N0B A;  4KMF A;  1FWZ A;  4G8X A;  5F1R A;  5KK1 A;  2F5C A;  2D2W A;  4RAY A;  4U88 A;  2G9W A;  3PQK A;  2V9V A;  3TO7 A;  5BPI A;  2FSW A;  4RAZ A;  3FMR A;  3K1N A;  1P4W A;  2EJR A;  2WWY A;  5D5V B;  3IKV A;  2CSO A;  1KU9 A;  2O03 A;  3DF8 A;  1LVA A;  2H6B A;  4YG2 F;  1B4A A;  3BZ6 A;  3GF2 A;  1TNT A;  4M73 A;  4MTE A;  2E7X A;  2STT A;  1YO5 C;  2CGP A;  3RJP A;  2FML A;  5D6E A;  5JR3 A;  2VE8 A;  1O3R A;  4XBF A;  2FQ3 A;  1ZRF A;  2M1B A;  1O7F A;  3BDD A;  4L9N A;  1FX7 A;  4BNC A;  3S2W A;  1XDU A;  3V8J A;  2R7D A;  4RB2 C;  2LF8 A;  1T39 A;  3F8N A;  4KUM A;  4LD5 A;  4AD9 A;  3GVA A;  2VN2 A;  3M7G A;  3BWG A;  2OA4 A;  2FEZ A;  3TO6 A;  2YPR A;  2J5P A;  2O3F A;  1PP7 U;  2IJL A;  1K6O A;  1Z05 A;  3DP7 A;  1G6N A;  1XSX A;  4AVP A;  4P55 A;  4K2E A;  1JHF A;  1H9G A;  3GLX A;  2BYV E;  3ZMU A;  3T0Y A;  4DNC A;  5FD6 A;  1Z91 A;  5KVR A;  2V1D A;  3RKY A;  3EYI A;  2A5Y B;  4XSZ F;  2FBI A;  1YIO A;  4FT8 A;  4O3M A;  4O6J A;  3RYP A;  4KNY A;  1FZP B;  3WOD F;  3J80 K;  1OYW A;  1MJA A;  3KEQ A;  4IHS A;  4Q4Z F;  2JPB A;  3HOS A;  2PEX A;  4RB3 C;  4YII A;  3LQQ A;  5HLG A;  3I71 A;  3LAP A;  1MDM A;  2H09 A;  1Z1D A;  2G7U A;  1IXC A;  3K69 A;  1R1T A;  1ODD A;  1J9I A;  3KLO A;  1ULY A;  1W5S A;  2XVC A;  3J81 Z;  1GXQ A;  2FNA A;  5DUI A;  3HRT A;  3R0J A;  1IXR C;  1IAW A;  2A07 F;  2HKO A;  2IT0 A;  2W84 A;  2QQB A;  2EFO A;  5EEH A;  5ERI A;  5D4R A;  2HGC A;  2DLL A;  1UHM A;  2XAQ A;  3JTG A;  1QBJ A;  4L0Z B;  1FBU A;  3V8K A;  1HW2 A;  4HV6 A;  2ZME A;  2QBY A;  1W7P A;  4D0P A;  1U5T C;  4EJT A;  3GYH X;  5E1Z B;  1FC3 A;  5CLS A;  5K1Y A;  4IRH A;  1Z7U A;  3B02 A;  3GFM A;  4ZH4 F;  2DPU A;  2XKO A;  2UXN A;  4HF2 A;  5LRS A;  2EA2 A;  2GQQ A;  1K79 A;  3HOT A;  1REP C;  3R6S A;  5JFR A;  2VT2 A;  1SFE A;  2QZ8 A;  3SQN A;  5D4S A;  5E18 F;  2CO5 A;  4EJU A;  1W5T A;  1F1Z A;  3M1E A;  1U78 A;  3FMS A;  2O6G E;  2R7F A;  3LFK A;  2IP2 A;  5E20 A;  4G7O F;  2DT5 A;  1TNS A;  2PQ8 A;  1IN5 A;  4UHT A;  1K78 B;  2QEN A;  3JSO A;  1I27 A;  2VOD A;  4L5I A;  2LSO A;  1DUX C;  2L4M A;  2MH9 A;  2JPC A;  1HKQ A;  3QP5 A;  4ENJ A;  4TV7 A;  4ON0 A;  2OZ6 A;  3M8F A;  3PQJ A;  4G9Y A;  1SD5 A;  2KJB A;  4EM2 A;  2ELH A;  1RUN A;  3WE2 A;  5HS7 A;  2ISY A;  5DCM B;  2OBP A;  4NB5 A;  1W7P B;  4XLN F;  4ASN A;  4Y17 A;  2XAG A;  1P2F A;  1OMI A;  2XAJ A;  4E70 A;  2HYF A;  4ESJ A;  2WTE A;  3R60 A;  5LHI A;  1YLF A;  5FO5 A;  4RGX A;  3HRS A;  3VOE A;  3D5L A;  1R00 A;  4M74 A;  4UVB A;  5FD5 A;  3WGG A;  2P5V A;  2EFW A;  4BH9 A;  1B6A A;  3ZN0 A;  1XGO A;  1QZY A;  4DQ2 A;  1ZN2 A;  2A61 A;  1JHH A;  5DD4 A;  2NNN A;  3K1P A;  5E1X A;  1BI1 A;  4EM1 A;  3K9T A;  2J5O A;  3U9G A;  4EGZ A;  5HDK A;  6PAX A;  4I7H A;  4I01 A;  2L54 A;  2YX7 A;  1TLH B;  2DBB A;  3MAJ A;  3CJN A;  1U8R A;  2Y48 A;  2ZNY A;  2F5D A;  3LA3 A;  1BM9 A;  3BY6 A;  1PUE E;  3TDU C;  3MEX A;  3CDH A;  2GA1 A;  1WSU A;  1IF1 A;  3ZMD A;  4A0Y A;  4R79 A;  2M5W A;  1RI7 A;  2IRF G;  3TOA A;  4LJZ F;  1CGP A;  2Q0O A;  1ZAR A;  1XSD A;  4BHB A;  5LLQ A;  5D5X B;  4N9H A;  3KP3 A;  5FB2 A;  3RIR A;  1LB2 A;  2GXG A;  4A5N A;  2M45 A;  1P4A A;  3KEO A;  2R3S A;  2Y75 A;  5ICF A;  4HOB A;  3RI4 A;  2GZW A;  4UV9 A;  2ZJ2 A;  5ILS A;  1JGS A;  2EFN A;  4ETS A;  2XRO A;  5L3B A;  1HKT A;  5J6X A;  3V7S A;  3OOP A;  1RIO H;  3DKW A;  1OYY A;  2YX4 A;  4JK1 X;  3WTS C;  4A6D A;  1OYI A;  1QZZ A;  4LB5 A;  1BBY A;  1TW2 A;  5HS8 A;  5TRD A;  3QOP A;  3F21 A;  2W25 A;  4OU0 A;  4PZJ A;  1WRJ A;  2Q2E A;  4LLN A;  1BI3 A;  1KA8 A;  2X0L A;  4WK8 F;  3WTT C;  3BJA A;  4I2O A;  1QGP A;  3QU6 A;  1ZGA A;  4LLG F;  3KLN A;  2P8T A;  4G6D A;  2DU9 A;  2A68 F;  3RDI A;  1S8N A;  4LFU A;  4KFC A;  3FZV A;  4LB6 B;  1KQ0 A;  4L9V A;  1OKR A;  3LAJ A;  3FM3 A;  2PI0 A;  4OIN F;  5DCF A;  2VBZ A;  4I02 A;  1I5Z A;  1UB9 A;  2OZU A;  4WCG A;  1IRG A;  3WTU C;  2HWV A;  2VBX A;  4CXF A;  3T8T A;  4LMY A;  2CG4 A;  3FXU A;  3FXR A;  3KE2 A;  3ZMT A;  4Q5S F;  4HYE A;  2UXX A;  4UV8 A;  4HQE A;  4OIR F;  5ED4 A;  3HTS B;  3BJO A;  3QU3 A;  3NEU A;  3P9I A;  1SFX A;  2YU3 A;  3ZN1 A;  2BEO A;  3P9K A;  4CGZ A;  4KT5 C;  1HBX G;  2KIF A;  2O0Y A;  2DQL A;  2IW5 A;  3EET A;  2KIM A;  2DPD A;  2EV6 A;  1GVJ A;  4HDU A;  3KP2 A;  1G4D A;  5BPD A;  1BN5 A;  3GX4 X;  2EK5 A;  3I53 A;  2K4B A;  5E8G A;  2D45 A;  3V4G A;  2QUF A;  1SD6 A;  1IUY A;  5AON A;  3CO7 C;  5H20 A;  2HYG D;  2VON A;  3FF5 A;  1LDD A;  2Q8K A;  4LK1 F;  2MA3 A;  4M71 A;  4HAM A;  4PGH A;  1J7K A;  3HHG A;  1P92 A;  3KP4 A;  3CUO A;  2CFX A;  1YW9 A;  1KU7 A;  1B9N A;  2FBK A;  1FLI A;  3E5Q A;  3F72 A;  4KDP A;  2DI3 A;  1ON1 A;  3G3Z A;  4AWX B;  2RVC A;  3ECH A;  2NAZ A;  2HQR A;  5BS6 A;  1R5G A;  1IN8 A;  2ADU A;  2B0L A;  1FYM A;  4F7Z A;  1ZRC A;  4UUV A;  2FOK A;  3WU0 A;  1GHC A;  3DPT A;  3O2P E;  1MDM B;  3SZT A;  2A6E F;  3TQN A;  1ZRD A;  2NYX A;  5LGU A;  4HQM A;  4KN7 X;  4CYD A;  4IHT A;  3L7W A;  4ESF A;  3MCZ A;  4EJW A;  5IT9 K;  2VC1 A;  2MLK A;  1ZG3 A;  2P6T A;  4ENN A;  4EJV A;  1YQA A;  4GGG A;  1XGN A;  4OMY A;  1F5T A;  2XGX A;  5ICC A;  4OIQ F;  2CWE A;  4MHG A;  1OPC A;  5L3D A;  1B1B A;  2MH2 A;  3KCC A;  4NHJ A;  4Y13 A;  2ISZ A;  4EQQ A;  3Q9V A;  1P6R A;  3F8C A;  4A5M A;  3IRR A;  1G3S A;  4M72 A;  2DO7 A;  4GYG A;  1E17 A;  4LGW A;  4G7H F;  1H0M A;  2HDC A;  2DFI A;  4HA8 A;  3GO5 A;  4L18 B;  2TDX A;  2RN7 A;  4IRI A;  3WTZ A;  1B9M A;  2LDU A;  2QVO A;  1WKM A;  4PCQ A;  5H6R A;  2FU4 A;  1T2K A;  2VBY A;  4HBL A;  2FXA A;  4LG0 A;  4OOI A;  4M9Z A;  1BC7 C;  2X4H A;  3SXY A;  3JTH A;  1JE8 A;  3ZMS A;  1FOK A;  1FP1 D;  4RGR A;  1XD7 A;  3HHH A;  3RTR A;  3K2Z A;  3TDZ C;  2OQR A;  4BQA A;  4GXO A;  2ZXJ A;  1XSV A;  1K7A A;  1R7J A;  3RKW A;  5J8F A;  4P9F A;  4KIC A;  3MZH A;  1I1G A;  1U2W A;  4WXH A;  3I59 B;  3I64 A;  4ZYD A;  2HTJ A;  4KIG A;  5CJ9 A;  1I6X A;  5CVV A;  1DPR A;  5ILU A;  1BC8 C;  3ZQ7 A;  4Q47 A;  2LNB A;  2NNY A;  4QWQ A;  1BOA A;  4U7D A;  2M87 A;  3P9C A;  1RUO A;  2MBF A;  2HS5 A;  4Y15 A;  2K02 A;  3J7A O;  4M6X A;  2JSC A;  3I4P A;  2EV5 A;  3VB2 A;  2DQR A;  4EJO A;  3GZ6 A;  2BV6 A;  5BOX A;  2VC0 A;  4UNO A;  4ENK A;  3SHF A;  3HRM A;  3F23 A;  1X3U A;  5CYV A;  2QQ9 A;  4RB0 A;  3KFW X;  2MD5 A;  3F3X A;  2HFH A;  4HW0 A;  3T8R A;  2ETH A;  2P5K A;  3QP6 A;  2KIU A;  2VE9 A;  2C6Y A;  2BBY A;  3VEP A;  1ZHF A;  4IPA A;  2QBY B;  4KN4 X;  1SD4 A;  1Z9C A;  2RGV A;  1ON2 A;  1U3E M;  2CYY A;  4ESB A;  4IXA A;  2V79 A;  2JRT A;  4BHP A;  4CDG A;  1IN7 A;  1AWC A;  3H3U A;  3LWF A;  4B09 A;  4JBA A;  3PFI A;  2FMY A;  1D8K A;  4EVI A;  5A2Q K;  5TJJ A;  3Q9S A;  2NS0 A;  3V7C A;  5E1W A;  1S29 A;  1TQI A;  3CUQ C;  3E6M A;  2XHK A;  3WTY C;  2GIV A;  3KP7 A;  4ZYG A;  1O3T A;  3N4M A;  1KYZ A;  1W7P D;  2IPQ X;  4A2U A;  2WV0 A;  5AIQ A;  2PBI A;  4A6E A;  3K1M A;  1TBX A;  4U7B A;  1S6L A; 
#chains in the Genus database with same CATH topology
 4IVN A;  5B1A H;  3WTX C;  3E0J B;  2DA3 A;  3OS0 A;  5AIP A;  4V2F A;  4HZF A;  1Y56 A;  1GV5 A;  4WXC A;  2W24 A;  2VLA A;  2FJ1 A;  2V1X A;  2A6H F;  2DMT A;  3ZMV A;  4GCV A;  4PDK A;  1HF0 A;  5IYD J;  4Y4R A;  2QLZ A;  2LKP A;  4XNF A;  4HX7 A;  1WCM J;  2XAS A;  4DGW B;  4KIS A;  4IQ4 A;  5HDG A;  4C30 A;  3ZPL A;  1P9Q C;  5M3F J;  4NQW B;  1XGM A;  2RV8 A;  3E6B A;  1IW7 F;  4BAY A;  1ORK A;  2EIJ H;  5D5U B;  2L7K A;  1ETX A;  3DCF A;  1WJ5 A;  4I09 A;  3VYT B;  3FHZ A;  4J00 A;  1G3W A;  5HNH A;  3NAU A;  2E60 A;  2DA5 A;  3BG3 A;  4NC6 A;  1B8I B;  1EH8 A;  4HLY A;  1QHH D;  1HST A;  2IA1 A;  5FFZ A;  1MSF C;  3DKX A;  1MGT A;  3W6J B;  4BJ5 C;  2HEO A;  5DYM A;  3RPU A;  4CO8 A;  1R6R A;  1DPU A;  2KRF A;  3LA2 A;  2R7R A;  2E1M C;  1ACI A;  5F64 A;  1EJ9 A;  3WTW C;  1K6Y A;  1UEL B;  4UVA A;  2IS4 A;  1ETO A;  2XF6 A;  3DLA A;  4MO7 A;  3Q5F A;  1F36 A;  3TKY A;  1FIA A;  1TQM A;  4H0E A;  1T38 A;  3M3Y J;  2ACJ A;  1VF9 A;  2X85 A;  4FX4 A;  5DEQ A;  2LH9 A;  3MKW B;  1VND A;  2Y2Z A;  4M3F A;  3E6C C;  3W3C A;  1WHU A;  2ZME C;  4LIV A;  4YIF A;  1U0J A;  3HRU A;  2W85 A;  1KU3 A;  4KYW A;  4WXD A;  2H27 A;  3S1R J;  3DXJ F;  1USS A;  3IKT A;  1SFU A;  1MJB A;  3ZXS A;  2ZJP F;  2OD5 A;  1ENH A;  2GAU A;  2L7Z A;  1UMQ A;  1VTN C;  3CC4 I;  3J81 K;  3IL2 A;  2K40 A;  2X6X A;  3DPU A;  1BIA A;  2HZD A;  5E17 F;  1IDY A;  3KZZ A;  1S7O A;  1X3Z B;  1FJL A;  2QSH X;  4II2 A;  2LR8 A;  2JT1 A;  1MH4 A;  3KEY A;  1A31 A;  3GTL J;  4N9I A;  1FNN A;  4FIS A;  1ZYR F;  2XPV A;  3ULQ B;  4A3B J;  1X4O A;  3FX3 A;  2GLO A;  3OS1 A;  2OJE D;  4EEF G;  2GOX B;  4UVC A;  3M8E A;  1W1W E;  2ZSI B;  3RKX A;  2FD5 A;  4KIB A;  3ERE D;  1BW6 A;  3JRG A;  1RET A;  4WX9 A;  5EG0 B;  3BZC A;  2EA4 A;  1TQP A;  2WB1 N;  4M6Y A;  3I54 A;  5J8C A;  1Z6T A;  3ZP5 A;  1PP8 F;  4BDY A;  2EV0 A;  3MWM A;  2RQP A;  1LFU P;  2L9N A;  2MG4 A;  3OIP A;  3JW4 A;  4UUS B;  2ZFU A;  5ICE A;  5LRR A;  3E3V A;  3O3K A;  3HUG A;  3GWZ A;  3EQL F;  4E7H A;  3HDD A;  3GFJ A;  3JAM K;  5FRM A;  2EFP A;  1T56 A;  5LFA A;  5EEA A;  2D1H A;  3F8B A;  2WAF A;  3LSG A;  1BIB A;  2W82 A;  2Z2S B;  3CJQ B;  1YX3 A;  3J7A Y;  1FSH A;  3IAS 2;  1EH7 A;  2EWN A;  2FF4 A;  4B47 A;  5JHF A;  1FMV A;  3BR3 A;  3LSH A;  4RS8 A;  1D8J A;  3R4K A;  1E2X A;  3U1D A;  5L3E A;  4YEL A;  2R7O A;  4BYY A;  1BA5 A;  2G0E A;  4FET A;  3SFI A;  1DU6 A;  2HDW A;  2R4G A;  2RKH A;  2EZI A;  3A03 A;  2DJI A;  1YRN A;  4EM0 B;  1P4X A;  4Y3O A;  3CCL I;  4ZDO A;  3KET A;  4A12 A;  1RNL A;  3C3W A;  3GEZ A;  1FYK A;  4WWC A;  1IDZ A;  1SMY F;  2ZBK A;  3CCU I;  2ZC2 A;  3DEE A;  4AU7 A;  3ABK H;  1MSE C;  3UKG A;  2YUS A;  1NHA A;  4U0V A;  2COM A;  1YW8 A;  4I0A A;  4E4H A;  2CV1 A;  4YEJ A;  2OCE A;  1O4X A;  3BTL A;  1FOW A;  1QHG A;  2FUG 2;  1IC8 A;  4HLX A;  3HL2 A;  4LK0 F;  2K9Q A;  3GUD A;  4YFK F;  4R8H A;  5LGT A;  4MEX F;  2X1C A;  5EGO B;  3HSE A;  3J80 Z;  3L2U A;  3JAM Z;  1FTT A;  3K4B A;  4BQQ A;  2EFQ A;  3E5U A;  1T6S A;  3QPT A;  4D1Q A;  3CUQ B;  2LBF B;  3CME I;  3E97 A;  4LLL A;  3LST A;  2E34 A;  3HSR A;  3HBL A;  2F6C A;  2JTV A;  2KJC A;  4KA4 A;  1J5Y A;  1XX5 A;  3OL4 A;  4HF1 A;  2Y69 H;  1A5J A;  2X6Y A;  2GA2 A;  4XL9 A;  4M3D A;  4O5V A;  2X9D A;  3PNY A;  4RLF A;  3SFZ A;  1X1B A;  1RC9 A;  4BXX J;  4CHU A;  3HGG A;  3JRH A;  3FXQ A;  1LEB A;  4CCO A;  3G4S I;  2DK8 A;  4BUP A;  1K83 J;  4NQW A;  4BXU A;  3PO3 J;  1N78 A;  1VQK I;  1R9T J;  2I5U A;  4CCK A;  4Y7N J;  2YSR A;  4OMZ A;  3HG9 A;  2IXS A;  2XSJ C;  3HYI A;  3AL0 C;  2JZY A;  2F2E A;  2HNH A;  4KJZ A;  1YTY A;  4XRM A;  4DYQ A;  1R4M B;  2K7L A;  2ZKZ A;  5LBQ A;  2BGC A;  2DW4 A;  1T8I A;  3H9G A;  5K5R A;  1BI2 A;  2CW7 A;  3NQO A;  3W6V A;  1WJF A;  5B1B H;  5LEK A;  2L02 A;  1I1S A;  5JVT A;  4F91 B;  4A3M J;  4ZC3 A;  1D3Y A;  1VI0 A;  2HR3 A;  2CUF A;  2PJP A;  3KP5 A;  4MFE A;  3I5U A;  2XAH A;  4I0B A;  2ID6 A;  3KIO A;  2XRN A;  3PUB A;  3QPS A;  5HDN A;  4HSR A;  2HQN A;  2VUM J;  3C18 A;  3KZY A;  2H6C A;  1TC3 C;  2NRA C;  2UWM A;  4PJ0 C;  1S7A A;  1IGN A;  2QYO A;  2XV4 S;  4D7M A;  4MGR A;  4A0Z A;  3L2V A;  3ECO A;  4HX4 A;  1U8B A;  2E1N A;  4KIF A;  4JX4 A;  2ZFW A;  4D5F A;  2ME0 A;  2W48 A;  1HOM A;  3ASO H;  2KKO A;  2M7A A;  5LGN A;  1ZRE A;  1H89 C;  5LD2 C;  4C3H J;  3S16 J;  4PFO A;  2DA7 A;  2RNJ A;  1WQ2 A;  3LNQ A;  3CC2 I;  3AL0 B;  4U87 A;  1XMK A;  2PMZ N;  3H3Z A;  2R7U A;  5K5O A;  2ZXW H;  5FGM A;  3S3N A;  2DMN A;  4F55 A;  3VFZ A;  4DYR A;  3SJM A;  3PUF A;  3DEW A;  1U9N A;  2YU9 J;  1X4P A;  4HST A;  5CVU A;  3GW2 A;  1R36 A;  2HTS A;  5BMZ A;  2K86 A;  5K7F A;  2H94 A;  3MZY A;  3GTG J;  1Y8Q B;  4B44 A;  1QA6 A;  3E6D A;  3BJ6 A;  3S32 A;  3I4M J;  1O57 A;  4FHT A;  2HZT A;  3TMO A;  1O3Q A;  5DUK A;  2F4M B;  2UZK A;  4F3Q A;  5C3E J;  3REO A;  2GBY A;  1QZE A;  3B6C A;  1R5I D;  2R7T A;  2KPM A;  1BI0 A;  1FY7 A;  1HW5 A;  2IVM A;  3KYD B;  1MND A;  3TP3 A;  3VSL A;  1UHW A;  3SYT A;  2OV7 A;  4L0Y B;  1FP2 A;  5A2Q Z;  4JOM A;  3O8G A;  1IG7 A;  2IA2 A;  9ANT A;  4EAT A;  3L2Q A;  1S3J A;  2H8R A;  1J09 A;  3O6B B;  5JHU A;  1FBS A;  5E3O A;  2Y0M A;  2P4W A;  2VT3 A;  2DOA A;  3LSK A;  2R5Z A;  2CQQ A;  5CKT A;  5L3C A;  3FMQ A;  1ONV A;  3OYD A;  1RKW A;  2LC2 A;  3AG4 H;  1X19 A;  3ZQL A;  2JA5 J;  2MC4 A;  2O8X A;  5F0C A;  3G1M A;  1MD0 A;  1ZTR A;  3F0C A;  3WTV C;  3OYN A;  1U5T A;  1YIJ I;  4QPQ A;  5H2F C;  4N4O B;  3TOB A;  3HSF A;  2ZO4 A;  3HXL A;  1Y0N A;  2HDD A;  2Z33 A;  4XLF A;  4QTR A;  2BE5 F;  1MBF A;  2HKX A;  3VSK A;  1QNT A;  1YS6 A;  1TP4 A;  1ZLJ A;  2DTR A;  3R0A A;  3HUG B;  4C2U A;  1UZC A;  2MC3 A;  2VQC A;  5BNG A;  4ZYE A;  2E2H J;  4AIH A;  4MTD A;  1WJA A;  1OR7 A;  3E5X A;  5E8I A;  1JUS A;  1K78 A;  4L5J A;  1ZK8 A;  2CQ7 A;  2VKD A;  3L00 A;  3HOX J;  4PSX A;  1W4M A;  1L3L A;  1WPK A;  2QWW A;  2W57 A;  3A0H C;  3IWF A;  2STW A;  1MNM C;  3H5R A;  3JRD A;  5HLI A;  2PLY A;  4HF0 A;  4XID A;  4G94 A;  1FYL A;  2IEK A;  1DDN A;  3CES A;  2LVS A;  3WU1 B;  4ZZD A;  1NK2 P;  1KU2 A;  1SVO A;  3B6A A;  1UCR A;  2A3S A;  4RGU A;  2HVS A;  3WG7 H;  3BG9 A;  3I0T A;  5KHD A;  5H6Q A;  3GCM A;  2M8G X;  1LEA A;  2F5V A;  4E7I A;  4X6A J;  1R58 A;  1VQL I;  2JMW A;  2O9L A;  1S7E A;  2HQ5 A;  3DQV C;  4G6Q A;  2VBW A;  2K27 A;  2WBM A;  1YX5 A;  3D5R C;  3IC7 A;  3BOQ A;  2DOD A;  2GOM A;  4S0H B;  2XKP A;  1TZL A;  2D1V A;  3F6O A;  4HX8 A;  3BT9 A;  2F5F A;  2ZCW A;  1T98 A;  2VJJ A;  1XGS A;  3GLL A;  4MQ9 F;  4IO9 F;  4UXN A;  3RPU D;  1MZB A;  2R5Y B;  3NRV A;  5LHG A;  1R22 A;  4G7Z F;  4A3J J;  2XUB A;  1QQI A;  2P6S A;  3SDG A;  5BQT A;  2VL8 A;  1R49 A;  3GTM J;  3CCQ I;  2IS1 A;  2FX0 A;  2COB A;  4P9U A;  2PN6 A;  3GZ5 A;  2K3P A;  1TWG J;  4JQF A;  5GTH C;  4GO1 A;  1I6H J;  1BOB A;  4KIT B;  2RNG A;  2WAE A;  3OYE A;  2QA4 I;  1B72 A;  4E7L A;  2KHM A;  1ZGJ A;  4JX5 A;  2VPL A;  1U6G A;  1YYV A;  3D5S C;  2K9M A;  5HOO A;  2FA5 A;  3MFK A;  3ELK A;  1AOY A;  1Z3Y A;  2RAE A;  1SAU A;  1UST A;  2Z3Y A;  5FLX Z;  1TW3 A;  2M30 A;  4HDV A;  4A93 J;  1E3O C;  3K70 C;  5CVR A;  5F0F A;  3U2R A;  3I58 A;  2QKL B;  4PJN A;  3HIF A;  2HOE A;  4UB8 C;  2M4K A;  4A0X A;  5EEG A;  2VPR A;  2DYS H;  1VQ9 I;  1I3A A;  3CMY A;  4ZZL A;  4HG2 A;  3OYK A;  1FBQ A;  4ENM A;  1Y0U A;  4I98 B;  2K4J A;  5M5X J;  2DT7 B;  2ZB9 A;  5C4X J;  3PO2 J;  4XQF A;  4ZJZ A;  4XIC A;  4BQN A;  2FBH A;  2DCE A;  3M9A A;  1M1E B;  3FBN B;  5ICG A;  1STZ A;  3L2W A;  2R7Q A;  1WWX A;  5EF6 A;  1MNE A;  3S15 J;  4M9S A;  4IJA A;  3C7J A;  1KZH A;  5E3L A;  1YS7 A;  3BP8 A;  3MD2 A;  5KAF C;  2XSD C;  3QOE A;  1ZLK A;  3N97 A;  2X1D A;  5EDN A;  2GM4 A;  2V1U A;  2GXB A;  3K4K A;  5EZG A;  2K85 A;  2KIS A;  4Z2Y A;  5M5Y J;  1IZ1 A;  1JXS A;  3ASN H;  3SEZ A;  3HM5 A;  4ZTF A;  1SEU A;  4WF2 A;  2DAO A;  3IRQ A;  1EA3 A;  2OU2 A;  2EIM H;  3QPH A;  2HYJ A;  1FSE A;  1J75 A;  1FEX A;  5HS9 A;  1MKM A;  2GWR A;  3TO9 A;  5D5W B;  3WGI A;  2IA0 A;  4NBQ A;  5E3M A;  4B8X A;  1A04 A;  5LHH A;  2CV0 A;  4EMS A;  1R5H A;  3AAF A;  1QU3 A;  1UJ8 A;  2M0C A;  4DYC A;  5K5Q A;  5HVQ C;  2E5Z A;  3T1B A;  1N75 A;  4DOZ A;  1DGR M;  4YFX F;  1T95 A;  5F0H A;  2P0W A;  1FT9 A;  1LDK B;  2DA2 A;  3S17 J;  1V3F A;  1ZG1 A;  3F8F A;  1PUF B;  1SMT A;  2L0K A;  2L7F P;  1KQ8 A;  1LDJ A;  3CQZ J;  3LA7 A;  4XLP F;  3BG7 A;  3ML6 A;  3CMM A;  3Q0U A;  1YFH A;  2O8K A;  1GXP A;  4EGY A;  4BBS J;  2OAZ A;  4C2M J;  2ZNZ A;  1G3Y A;  1V5E A;  2G7H A;  5FRO A;  3V8L A;  3C1D A;  2LD5 A;  2EIN H;  1RRJ A;  1TTY A;  2XGE A;  1BJA A;  4BHC A;  1XB4 A;  2IGO A;  1TL8 A;  2F5E A;  5J1R A;  4AIK A;  3PIP F;  3JCU C;  1YW7 A;  1ETW A;  4CZZ A;  3S3O A;  2OQG A;  1Z7L A;  2ZME B;  1LQ1 A;  3SEQ A;  3HOV J;  1T0F A;  1L0O C;  4AIJ A;  1HXD A;  4BDZ A;  2OC6 A;  1R71 A;  1W36 C;  3IH2 A;  2NVT J;  3CMA I;  2V1N A;  4JX6 A;  3ZMZ A;  1RZ4 A;  1X58 A;  2RC4 A;  4W97 A;  2WC2 A;  2PMU A;  4S04 A;  1LE8 A;  2M34 A;  3DV8 A;  4BKX A;  1ZR2 A;  3GFL A;  2R0Q C;  1IV6 A;  3DFG A;  3ISP A;  4YRV A;  2EZH A;  2XB0 X;  2LKS A;  1F4K A;  2Y0S A;  4Q48 A;  5C4J J;  3L2C A;  4BEH A;  2XIG A;  1VFC A;  1D5V A;  1LJ9 A;  3CDL A;  4LIU A;  3M4O J;  2E1C A;  4XSX F;  3HC7 A;  1Q1H A;  4FX0 A;  2XF7 A;  3ABU A;  3TGN A;  4MFD A;  3QPL A;  1MIJ A;  1UFM A;  1RPW A;  3FXL A;  3G1L A;  4L9T A;  1AKH A;  2L4A A;  1GUU A;  3F8M A;  1DQU A;  4R1H A;  5FFX A;  3CO6 C;  3BR5 A;  3ZQF A;  2R5Z B;  4PGG A;  3MN2 A;  4IRG A;  1LNW A;  2FE3 A;  2AXL A;  3G73 A;  3BPX A;  1XMA A;  1J2X A;  5IOY A;  1O3S A;  3E7L A;  1PDN C;  4YIR X;  1NH3 A;  5DDG A;  1IXS B;  1HQC A;  1J0R A;  5D8L B;  3L09 A;  2L01 A;  2Z5U A;  3SZP A;  3LQR A;  1J59 A;  5J40 A;  1HLV A;  1O7L A;  1IO2 A;  1F9N A;  1IRF A;  2IAI A;  3BRO A;  3IWZ A;  5FLV A;  4RM3 A;  2VB6 A;  3LSI A;  4CSW A;  2E2J J;  2CW0 F;  3FM5 A;  4MNU A;  2D5V A;  1IJW C;  1BW5 A;  1GV2 A;  2YR2 A;  5D6F A;  5FRN A;  1G3T A;  2OUM A;  3COA C;  4XN3 A;  1EH6 A;  4M3G A;  4LIT A;  1RR8 C;  1ZAO A;  4ZTJ A;  4XRF A;  3CD6 I;  1V4R A;  5CVI A;  3EDP A;  1HW1 A;  1WI9 A;  1DP7 P;  2KL4 A;  1D0Y A;  3PFY A;  3AG3 H;  2VKV A;  3WG9 A;  1SAN A;  3GFI A;  2Y0S N;  3EYY A;  3ZR8 X;  4LG0 B;  3QRF F;  2WA0 A;  1SVM A;  4DW6 A;  3OL3 A;  1XDS A;  2IBD A;  3WE3 A;  2Z99 A;  3S1M J;  2O61 A;  1MJ9 A;  5DD8 A;  1BR2 A;  2LMD A;  2XAU A;  3KX2 A;  5J1U A;  3V7R A;  2NVQ J;  4RA2 A;  4XLE A;  5GPC A;  1ZH5 A;  1H9T A;  3F22 A;  2VOO A;  3OMY A;  3ZQG A;  2PG4 A;  2M7B A;  3G71 I;  3DPL C;  1SD7 A;  2KDO A;  5JI6 A;  4G12 A;  3HOW J;  1SAX A;  2ZXH A;  4OIP F;  3D0S A;  2P7V B;  3PNV A;  4GYI A;  3IUO A;  4ZYH A;  2E7W A;  3DEU A;  4P96 A;  5LEJ A;  4ABZ A;  1JJ8 C;  3RPQ A;  2KFD A;  1C0W A;  5IYC J;  1IN6 A;  2CQK A;  2CQX A;  4S05 A;  3ZRG A;  1KQ9 A;  1FPQ A;  4NDL A;  4RAG A;  3MMY B;  1XN7 A;  2DK5 A;  2DMQ A;  1KGS A;  3CZ6 A;  3IV5 A;  3N05 A;  3S2H J;  4V2G A;  3OYA A;  4AVZ A;  4L9J A;  1D0Z A;  3BPV A;  5IT3 A;  4MEY F;  3K7A J;  3MQ0 A;  4I99 C;  5F6F A;  2P7C B;  3OYF A;  4P5O A;  3W6K B;  3DTI A;  3QAH A;  1IN4 A;  3VDX A;  2ECB A;  1APL C;  4BGD A;  4OIO F;  2VOP A;  1R1U A;  2JA6 J;  1X1D A;  5DV5 A;  2QKM B;  4AYB A;  4RB1 A;  3IHU A;  3ROU A;  4OAY A;  3BR0 A;  3RYR A;  2K9N A;  1A36 A;  1B8I A;  1QRY A;  1YG2 A;  5IPA A;  1IRZ A;  2DA1 A;  2MD0 A;  2OPT A;  4HNV A;  2ESN A;  1KYW A;  2HVR A;  1XCB A;  2L3D A;  4CIC A;  3HOU J;  3LSM A;  1EV7 A;  2V26 A;  1GDT A;  3LL7 A;  3OV8 A;  4D7N A;  1QO0 D;  3HTU A;  2H1K A;  1HDP A;  2EZK A;  5D8K B;  2AS5 F;  5IT9 Z;  2VXZ A;  2X6W A;  1V55 H;  2A69 F;  3F6V A;  2NVX J;  2EZL A;  3I59 A;  3BQZ A;  3EUA A;  5CVJ A;  5FLX K;  3WGH A;  4HV5 A;  2R93 J;  4MQV A;  4YFN F;  2LOO A;  1DP3 A;  3OS2 A;  1QPM A;  4L5E A;  3CDI A;  3EUH A;  1WJE A;  4IF4 A;  4M9X A;  2FRH A;  2RDP A;  3GXO A;  1XCV A;  2BVM A;  1JJ6 C;  2TRT A;  3OWT A;  2QM3 A;  1AKH B;  1B59 A;  2Q2E B;  4XLH A;  1XS9 A;  5ILV A;  2ESH A;  2Y31 A;  2V6E A;  4EV0 A;  1Z6R A;  2QGU A;  2PMZ A;  2PFB A;  3PNT A;  1R23 A;  1JTY A;  1OIS A;  2MLG A;  3B73 A;  4KMU X;  4RGS A;  4FE7 A;  5GAH J;  3S1N J;  3VOD A;  1VQ7 I;  2PMH A;  2QQA A;  2V6C A;  4ZDL A;  2EB7 A;  2KP6 A;  3QWL A;  2R5Y A;  1OCZ H;  3CTA A;  2XAF A;  1CF7 B;  4U0Y A;  5HLH A;  3P7N A;  3OSF A;  2DFF A;  2JVH A;  4A3I J;  1VQO I;  3HPH A;  3KP6 A;  3H92 A;  2I10 A;  3PJR A;  2VJ4 A;  1CF7 A;  1R1V A;  2BXY A;  4U0W A;  3FWE A;  3IH4 A;  2Z9O A;  2HOS A;  3DU5 A;  2VKH A;  3CF5 F;  2XB5 A;  1PYV A;  2KRC A;  1LPQ A;  1ZG5 A;  2P5L C;  4QLC U;  2LF7 A;  3CUQ A;  3L9F A;  5DCM A;  2FNP A;  3C2H A;  3GTO J;  1HKS A;  5L3F A;  2LKX A;  1U5T B;  3K0L A;  2DDB A;  2KIQ A;  4UY8 I;  1E3H A;  3ABT A;  1V5G A;  3R61 A;  2M8E A;  3T5X A;  2MYS A;  3SDB A;  3CLO A;  3JSP A;  5L3G A;  1HSJ A;  2ID3 A;  4N0B A;  1YHQ I;  3TBI A;  4KMF A;  2R7S A;  1FWZ A;  4G8X A;  1X1P A;  5F1R A;  5KK1 A;  2F5C A;  2D2W A;  3BTI A;  1EKE A;  2OF7 A;  4RAY A;  3PSI A;  3VYS B;  4BE1 A;  4U88 A;  2G9W A;  3PQK A;  2V9V A;  4FAS D;  3TO7 A;  3HJE A;  5GAG J;  5BPI A;  1WGX A;  2FSW A;  4RAZ A;  3FMR A;  5EG0 A;  2JN6 A;  2L9S A;  3K1N A;  1P4W A;  4G6T B;  2EJR A;  2WWY A;  5D5V B;  3H0D A;  1HCR A;  3IKV A;  2DDA A;  2CSO A;  1KU9 A;  3MVP A;  1A35 A;  2HOT A;  5TIS C;  1Y6I A;  1WJC A;  4F93 B;  3BTC A;  2O03 A;  4B3X A;  5GAE J;  3DF8 A;  1X1C A;  1LVA A;  2H6B A;  3HOY J;  2WV1 A;  2KZV A;  4YG2 F;  1ZQ3 P;  2CV2 A;  1XTA A;  1B4A A;  3BZ6 A;  3GF2 A;  1TNT A;  4M73 A;  4MTE A;  2E7X A;  2AO9 A;  1SC7 A;  2STT A;  1YO5 C;  2CGP A;  4C3J J;  1RR7 A;  1OCP A;  1WZ2 A;  3RJP A;  2FML A;  2BOL A;  5D6E A;  5JR3 A;  3LMM A;  1SVL A;  2E35 A;  2VE8 A;  3OYG A;  1O3R A;  1UG0 A;  1Q1V A;  2BVL A;  4XBF A;  2FQ3 A;  1ZRF A;  2M1B A;  1O7F A;  4HEA 2;  4NUB A;  1OCR H;  3BDD A;  4L9N A;  2X6O A;  1FX7 A;  3GTK J;  4BNC A;  3S2W A;  1XDU A;  3OYM A;  1YJW I;  3V8J A;  2R7D A;  2YS9 A;  4RB2 C;  1K61 A;  2LF8 A;  1JKO C;  1T39 A;  2P81 A;  3K6G A;  4E7S A;  3JRI A;  1GVD A;  2JA7 J;  3F8N A;  2NXN B;  4IHY A;  4KUM A;  2ZXI A;  4LD5 A;  1V5F A;  4AD9 A;  3GVA A;  2E19 A;  2V4J C;  1ETQ A;  2VN2 A;  3M7G A;  3BWG A;  2OA4 A;  4Z6Y A;  2M0M A;  2FEZ A;  3TO6 A;  1FMW A;  2YPR A;  4XKB A;  2J5P A;  2JRM A;  1LVK A;  4CZC A;  2O3F A;  1PP7 U;  2IJL A;  3HKZ N;  3BCB A;  2LLK A;  1K6O A;  3JRA A;  3Q0V A;  4CH7 A;  2DMU A;  1Z05 A;  3DP7 A;  1G6N A;  1XSX A;  3X2Q H;  4AVP A;  4P55 A;  3TW6 A;  4K2E A;  2XGC A;  1JHF A;  1H9G A;  3JR9 A;  3BC8 A;  5FKM A;  4PK4 A;  3GLX A;  5F1J A;  2BYV E;  3ZMU A;  2HXI A;  4A3E J;  2JJ7 A;  3T0Y A;  4DNC A;  5FD6 A;  1Z91 A;  5KVR A;  3CCJ I;  3A2K A;  2V1D A;  3BCA A;  4F52 A;  3C2G A;  3RKY A;  4BJ6 C;  3EYI A;  2A5Y B;  3IAM 2;  4XSZ F;  1MW7 A;  2FBI A;  5FJ8 J;  2CFO A;  1YIO A;  4FT8 A;  4O3M A;  4O6J A;  3RYP A;  5JVG F;  4KNY A;  2CMP A;  1FZP B;  1VQM I;  1RES A;  3WOD F;  3ZQI A;  3J80 K;  1FTZ A;  3I56 I;  5J1Y A;  1OYW A;  5CPR B;  5FKO A;  3W2A A;  1XPX A;  2NS7 A;  1MJA A;  2KRH A;  3SZG A;  3KEQ A;  4IHS A;  1LFB A;  2LRE A;  2JPB A;  4Q4Z F;  4J01 A;  2BW3 B;  3HOS A;  2PEX A;  2VIX A;  2Z16 A;  4RB3 C;  3S3M A;  4YII A;  4HPQ A;  3LQQ A;  5HLG A;  3I71 A;  3H9J A;  3BTJ A;  1CQT A;  2K5C A;  3LAP A;  2F4I A;  1MDM A;  4JP0 A;  1H88 C;  2H09 A;  1Z1D A;  3S1Q J;  1D0X A;  1I3Q J;  1VQ5 I;  1POG A;  3BQY A;  3M1C A;  2G7U A;  4F92 B;  1IXC A;  3K69 A;  1R1T A;  1ODD A;  1B72 B;  1J9I A;  3KLO A;  1ULY A;  1W5S A;  2XVC A;  1MH3 A;  5DTD A;  5HNF A;  3J81 Z;  5M5W J;  3QOD A;  4XOR A;  4XRS G;  1GXQ A;  4FTH A;  2FNA A;  5DUI A;  1G2H A;  3WU2 C;  5M3M J;  1E3P A;  1X2M A;  3HRT A;  3DLL F;  3R0J A;  1BL0 A;  1IXR C;  2VXD A;  1IAW A;  4CYC A;  2VQL A;  2A07 F;  2L9V A;  2HKO A;  3A1Y A;  5B5E C;  3I4N J;  4B43 A;  3MKY B;  2IT0 A;  2CUE A;  2W84 A;  2QQB A;  1EF4 A;  2EFO A;  5EEH A;  5ERI A;  3NWS A;  5D4R A;  2HGC A;  1ETY A;  2DLL A;  1UHM A;  2R7V A;  3DWL E;  4RDU A;  2XAQ A;  3JTG A;  1LKX A;  2I8D A;  1A6Q A;  1QBJ A;  4XOT A;  4XKV A;  3W2V A;  1FBU A;  4L0Z B;  4IL6 C;  3V8K A;  3DBR B;  2CRG A;  3UNG C;  1HW2 A;  1U9O A;  3PSF A;  2AXT C;  3K4L A;  4HV6 A;  3OYI A;  2ZME A;  1VQP I;  2QBY A;  4DIQ A;  1W7P A;  4NC8 A;  4D0P A;  1IUF A;  1U5T C;  3D1N I;  3K4J A;  4EJT A;  1BJZ A;  2M3A A;  5E79 C;  1XMX A;  3GYH X;  1MBG A;  5E1Z B;  1FC3 A;  2DXI A;  5CLS A;  1JUM A;  4BE0 A;  5K1Y A;  2EIK H;  4DZJ A;  4IRH A;  1Z7U A;  2VJ5 A;  4IX7 A;  4B3A A;  1BR1 A;  2HOA A;  4NC7 A;  3B02 A;  1D1A A;  3GFM A;  4BY7 J;  4ZH4 F;  2DPU A;  2LY9 A;  2MGQ A;  2XKO A;  2WY7 Q;  2UXN A;  2VKE A;  3BLY A;  4UUS A;  1Y39 A;  4HF2 A;  4XLA A;  4BS9 A;  1WVR A;  5LRS A;  2EA2 A;  2GQQ A;  2CW8 A;  2KQR A;  2ME6 A;  3CCE I;  3OY9 A;  1K79 A;  3HOT A;  3PIO F;  1REP C;  3R6S A;  5JFR A;  2VT2 A;  1SFE A;  2XDV A;  2QZ8 A;  3SQN A;  3FKI J;  5D4S A;  1YOV B;  3DBH B;  5E18 F;  2NVU B;  2CO5 A;  4EJU A;  1W5T A;  1FOY A;  1F1Z A;  3M1E A;  1U78 A;  3ESW B;  1R4N B;  3FMS A;  3S8P A;  2O6G E;  1VQ6 I;  2R7F A;  3LFK A;  3S93 A;  2LY2 A;  2IP2 A;  4D9J A;  1HA8 A;  4HNU A;  3HOZ J;  5E20 A;  4XK4 A;  4G7O F;  2DT5 A;  1TNS A;  2PQ8 A;  1IN5 A;  4UHT A;  1K78 B;  1YRN B;  2QEN A;  2ZSH B;  3JSO A;  1I27 A;  2VOD A;  1S5L C;  2TCT A;  2LSO A;  4L5I A;  1DUX C;  2L4M A;  2MH9 A;  4W1U A;  4IHW A;  4XMY A;  2JPC A;  1T33 A;  1HKQ A;  3QP5 A;  4ENJ A;  4TV7 A;  4ON0 A;  2OZ6 A;  3M8F A;  3PQJ A;  2XC7 A;  2VI6 A;  1SD5 A;  2KJB A;  4G9Y A;  2ELH A;  4EM2 A;  1RUN A;  2LY1 A;  2B7E A;  2MW8 A;  3HPG A;  4E7Z A;  2HPI A;  3WE2 A;  5HS7 A;  2ISY A;  4BY1 J;  1VZ0 A;  5DCM B;  2GXA A;  2OBP A;  1T0F C;  4NB5 A;  1W7P B;  2WAQ N;  1BR4 A;  4XLN F;  3RZO J;  3RKQ A;  4ASN A;  4Y17 A;  2XAG A;  3DBL B;  1P2F A;  1XG1 A;  5GPA A;  1OMI A;  2XAJ A;  4E70 A;  2HQA A;  2HYF A;  2QSF X;  4ESJ A;  2WTE A;  3R60 A;  5LHI A;  1YLF A;  5FO5 A;  2BW3 A;  4RGX A;  1D1C A;  4A3L J;  3F9K A;  3HRS A;  5CQG A;  5CQE A;  2EH3 A;  3VOE A;  3D5L A;  4CYC B;  2DFE A;  2V9K A;  1K4T A;  1R00 A;  4M74 A;  4UVB A;  3V42 A;  5FD5 A;  3WGG A;  3RCO A;  2P5V A;  1X2N A;  3ZGK A;  4LG3 A;  3I3L A;  2EFW A;  4BH9 A;  1MBH A;  1B6A A;  2L2O A;  3ZN0 A;  1XGO A;  4DZP A;  1QZY A;  4D5C A;  4DQ2 A;  1ZN2 A;  2A61 A;  5IOZ A;  2LBF A;  1JHH A;  5DD4 A;  3G1O A;  2NNN A;  2KDZ A;  4CCJ A;  1X1A A;  2DN0 A;  3OYJ A;  1NG6 A;  3RSN A;  5B66 C;  2CUJ A;  3K1P A;  5E1X A;  1OFC X;  2OTL I;  1BI1 A;  1DGW Y;  4HRI A;  1Y1V J;  2QQ8 A;  3O8H A;  3BZK A;  4EM1 A;  1JKP C;  3K9T A;  4C3I J;  2JWT A;  4X1E A;  2J5O A;  1SFO J;  3U9G A;  1OQY A;  4EGZ A;  3MKZ A;  5HDK A;  2AHQ A;  6PAX A;  4I7H A;  1I39 A;  4I01 A;  2L54 A;  3K2A A;  3CCS I;  2YX7 A;  2V7F A;  1OCT C;  4XR6 A;  2XF5 A;  2LG4 A;  5HOD A;  5HLT A;  1TLH B;  2DBB A;  3MAJ A;  4B48 A;  1JT0 A;  3CJN A;  1U8R A;  2KT0 A;  2QCO A;  2Y48 A;  2ZNY A;  2NVY J;  2F5D A;  3LA3 A;  1ZR4 A;  5TGT A;  1BM9 A;  1TWH J;  3BY6 A;  1PUE E;  2XPU A;  3AFH A;  5KAI C;  3TDU C;  3MEX A;  1OCC H;  3RZD J;  3CDH A;  3LSP A;  2GA1 A;  1YE9 A;  3H35 A;  1WSU A;  2JVG A;  1IF1 A;  3ZMD A;  4A0Y A;  4R79 A;  4A3F J;  2M5W A;  2AQF A;  4N4N B;  2VJI A;  3TW7 A;  1RI7 A;  2NOJ B;  2IRF G;  4GFB A;  3TOA A;  4KT6 A;  4LJZ F;  1CGP A;  2Q0O A;  4XOP A;  1ZAR A;  1XSD A;  2EQR A;  1E0E A;  4BHB A;  2DMP A;  2MAB A;  5LLQ A;  5D5X B;  4N9H A;  3OYB A;  2KZG A;  2WY8 Q;  3KP3 A;  5FB2 A;  3LSR A;  2WAD A;  3RIR A;  1Z67 A;  1T08 B;  2CUZ A;  1LB2 A;  2GXG A;  4A5N A;  2M45 A;  1P4A A;  3GME A;  1JGG A;  3KEO A;  2A5W A;  2R3S A;  2Y75 A;  5ICF A;  3OYL A;  4HOB A;  3RI4 A;  2GZW A;  1TWA J;  1W36 D;  3DTE A;  4UV9 A;  4RBO A;  2ZJ2 A;  5ILS A;  1JGS A;  2EFN A;  4M6V A;  1ETV A;  2M4G A;  4ETS A;  2XRO A;  5L3B A;  1HKT A;  5J6X A;  4DBQ A;  2R7Z J;  1P7I A;  2K3F A;  3V7S A;  2JA2 A;  4Y33 A;  4BU2 A;  3OOP A;  4BE2 A;  1RIO H;  3DKW A;  1OYY A;  2WB1 A;  2YX4 A;  4JK1 X;  4ITV A;  3WTS C;  4A6D A;  4PJL A;  1OYI A;  4MIM A;  4GDF A;  1QZZ A;  2GIZ A;  3EUK L;  1TT5 B;  3H1C A;  4LB5 A;  2VQH A;  1BBY A;  4UB6 C;  3A02 A;  1TW2 A;  3J7Z I;  3VYR B;  3I9V 2;  1ERD A;  4BXF A;  5HS8 A;  3K4N A;  1W0T A;  3CCR I;  5TRD A;  1UAA A;  3HEF A;  3QOP A;  3S14 J;  3F21 A;  2W25 A;  4OU0 A;  3H36 A;  2CQN A;  5EYR A;  4PJM A;  2K9S A;  4PZJ A;  1WRJ A;  2Q2E A;  4LLN A;  3C2B A;  1BI3 A;  1S9H A;  1KA8 A;  2X0L A;  3PM1 A;  5FKL A;  4CCL A;  4WK8 F;  3WTT C;  2W7N A;  3BJA A;  5EZH A;  4IHX A;  4I2O A;  3FIS A;  1QGP A;  1D1B A;  3G2B A;  3QU6 A;  2HI3 A;  1I50 J;  1ZGA A;  3EUH C;  1UG2 A;  2RRE A;  4LLG F;  3KLN A;  4IOA F;  3CJT B;  2P8T A;  4G6D A;  4C2T A;  2OTJ I;  2DU9 A;  1MMN A;  2A68 F;  3OR2 C;  1XC5 A;  3QYF A;  3RDI A;  3FDY A;  4IHV A;  2JA8 J;  1S8N A;  4LFU A;  4KFC A;  1FOX A;  3FZV A;  2F4O B;  4LB6 B;  4CCM A;  1NG7 A;  3VYU B;  2E1M B;  2HVQ A;  4RMN A;  1KQ0 A;  4L9V A;  5FLM J;  3A0B C;  3ZQH A;  1OKR A;  2NS8 A;  1N25 A;  4ZDP A;  3LAJ A;  3FM3 A;  2PI0 A;  2BZT A;  4OIN F;  1AA7 A;  5DCF A;  1G59 A;  1QVT A;  2KMU A;  4QIW N;  1ZGW A;  2DTZ A;  2VBZ A;  4I02 A;  1PUF A;  1ETK A;  4IQJ A;  1I5Z A;  3A4C A;  1UB9 A;  2OZU A;  3ZCO A;  4WCG A;  3FIW A;  1LE8 B;  4OAZ A;  1IRG A;  3WTU C;  2HWV A;  5C44 J;  2VBX A;  3FK7 A;  4FCY A;  4BQO A;  2F48 A;  2E5N A;  3TP0 A;  2ELJ A;  4CXF A;  4BAC A;  3IP4 B;  4A3K J;  3T8T A;  4LMY A;  2CG4 A;  3FXU A;  3KZI C;  1OCO H;  3FXR A;  5IP9 J;  3A01 A;  3KE2 A;  3G6E I;  3MZ8 A;  3ZMT A;  4Q5S F;  4HYE A;  3GTP J;  2X1E A;  2UXX A;  4UV8 A;  4XKC A;  4ANJ A;  4HQE A;  3VWB A;  3S2D J;  3CP2 A;  3K70 D;  2HPM A;  2DYR H;  2LTP A;  5F04 A;  4OIR F;  5ED4 A;  2XPW A;  3MKL A;  1JKQ C;  4XKW A;  1RKT A;  1MBJ A;  3HTS B;  3FXM A;  3BJO A;  3QU3 A;  3NEU A;  3P9I A;  3OIQ A;  1SFX A;  1WJB A;  2YU3 A;  2PX9 A;  3ZN1 A;  3OSG A;  3HKZ A;  4B1R A;  5K7Z A;  2BEO A;  3P9K A;  1HBX G;  4KT5 C;  4CGZ A;  2Y9Y A;  2KIF A;  1TWC J;  3IH3 A;  2O0Y A;  2E1O A;  2DQL A;  2A6T A;  2IW5 A;  2LYC A;  5GP9 A;  1WFX A;  3EET A;  2QF7 A;  3ABM H;  2KIM A;  2DPD A;  1IV8 A;  2EV6 A;  3VPR A;  4ZYA A;  1GVJ A;  4HDU A;  3KP2 A;  1G4D A;  2QEX I;  2W1O A;  5BPD A;  1BN5 A;  3GX4 X;  2EK5 A;  2JQ7 A;  2BY2 A;  4AUX A;  2QSG X;  3I53 A;  4II3 A;  3GBG A;  2K4B A;  3QYB A;  5E8G A;  3BR1 A;  5IY5 H;  2OCC H;  4A69 C;  2D45 A;  1OR7 C;  1S72 I;  5FKK A;  3V4G A;  2QUF A;  3FBI B;  1SD6 A;  2EPF A;  1IUY A;  5AON A;  3CO7 C;  5H20 A;  3H5N A;  2HYG D;  3ZQQ A;  2VON A;  3FF5 A;  4FQG A;  2EIL H;  5J4V A;  1GLN A;  3BG5 A;  1LDD A;  2Q8K A;  4LK1 F;  2MA3 A;  4M71 A;  4HAM A;  4PGH A;  1J7K A;  3OOU A;  3HHG A;  4BJT A;  1OJL A;  1P7J A;  1P92 A;  3KP4 A;  3CUO A;  2CFX A;  1YW9 A;  3UR3 C;  1KU7 A;  1B9N A;  2FBK A;  5IP6 A;  1IRX A;  3RQI A;  1FLI A;  5DM7 F;  3E5Q A;  2ZJQ F;  3F72 A;  3CCY A;  2JK3 A;  2Z1D A;  3AG1 H;  3K4C A;  4KDP A;  3CCV I;  2DI3 A;  2N8G A;  1ON1 A;  2IGM A;  3G3Z A;  4AWX B;  1F43 A;  2RVC A;  5F08 A;  3ECH A;  2BXZ A;  2IGN A;  2NAZ A;  2HQR A;  5BS6 A;  1R5G A;  1IN8 A;  2KLO A;  1AU7 A;  1AHD P;  2ADU A;  1JKR C;  2WAQ A;  3LFU A;  5E3N A;  2DJN A;  2B0L A;  1GT0 C;  4A3C J;  4OWR B;  1FYM A;  3DTK A;  1SFK A;  4XON A;  4E7J A;  2V9P A;  3FHN A;  4F7Z A;  4BBR J;  1DU0 A;  1ZRC A;  4QPO A;  4UUV A;  2R7W A;  1WJD A;  5GTI C;  2FOK A;  3WU0 A;  1GHC A;  3DPT A;  3FXK A;  3O2P E;  3TED A;  1QPI A;  2VAS A;  1MDM B;  5DS9 A;  3FXO A;  1MMD A;  3HB9 A;  3SZT A;  1N77 A;  2JUG A;  2A6E F;  3TQN A;  1D5Y A;  2NYX A;  5LGU A;  4HQM A;  2LK2 A;  1ZRD A;  4KN7 X;  5EJC A;  4CYD A;  2BHY A;  4IHT A;  3L7W A;  1MMA A;  4ESF A;  3MCZ A;  3ERM A;  3H0G J;  4EJW A;  3I55 I;  5IT9 K;  3ZOB A;  2VC1 A;  1MMG A;  2BHZ A;  2R92 J;  5K7H A;  2MLK A;  3Q3S A;  5B3S H;  1ZG3 A;  2P6T A;  2Q1Z B;  4X0G A;  4ENN A;  3DKY A;  4EJV A;  3L1P A;  1MBE A;  1YQA A;  4GGG A;  4B4C A;  4H4K C;  4RM2 A;  1XGN A;  4NNJ A;  4OMY A;  1F5T A;  2ELK A;  1JI8 A;  3RQ4 A;  2XGX A;  5ICC A;  4OIQ F;  4PSW A;  2CWE A;  2X48 A;  1OPC A;  2BY1 A;  4MHG A;  5EGO A;  1Y1W J;  1YIT I;  4AC0 A;  5L3D A;  4AYB N;  2H8W A;  2L7M P;  4BEH B;  3AG2 H;  5FKN A;  1B1B A;  2MH2 A;  3KPH A;  3QYE A;  5JLX A;  3OR1 C;  3KCC A;  4NHJ A;  3KYC B;  4XRS A;  4Y13 A;  1V54 H;  2ISZ A;  4EQQ A;  3JRB A;  2IGK A;  3Q9V A;  3CLQ A;  1P6R A;  1YJN I;  3F8C A;  4A5M A;  3IRR A;  2B9S A;  1G3S A;  4GRI A;  3K4M A;  4M72 A;  1X3W B;  2FQ4 A;  2L5Q A;  2DO7 A;  4GYG A;  1KON A;  1E17 A;  3ABL H;  4LGW A;  4G7H F;  1H0M A;  1K4S A;  2HDC A;  1PJR A;  2DFI A;  3FKJ A;  4HA8 A;  3GO5 A;  4L18 B;  3HZJ A;  4QSH A;  5KNL A;  2TDX A;  1Z3X A;  1QVU A;  2RN7 A;  1TWF J;  2RQQ A;  2FOW A;  2LRD A;  4FE4 A;  3H3V K;  3Q0W A;  2K9L A;  4IRI A;  3WTZ A;  4LOC A;  4XM3 A;  4PUS A;  1B9M A;  2LDU A;  2QVO A;  1WKM A;  2W4S A;  4XN0 A;  2IS6 A;  4PCQ A;  4RLQ A;  2R7X A;  4A3G J;  3M8J A;  2BY3 A;  1FIP A;  5H6R A;  2CU7 A;  2FU4 A;  2Y30 A;  1T2K A;  2VBY A;  3OIO A;  4A3D J;  4HBL A;  2FXA A;  4LG0 A;  4OOI A;  1WI3 A;  2A05 A;  4M9Z A;  2ECC A;  1BC7 C;  2X4H A;  3SXY A;  3JTH A;  2DT6 A;  2PJR B;  4AM3 A;  4PJJ A;  1JUP A;  2XRL A;  1JE8 A;  3ZMS A;  1FOK A;  2H1L A;  1FP1 D;  3OYC A;  1NTC A;  4AID A;  2VQG A;  3QQA A;  3FK6 A;  1LUJ B;  4RGR A;  1XD7 A;  3ZQC A;  4PFP A;  3HGY A;  3HHH A;  3RTR A;  3K2Z A;  3TDZ C;  5J47 A;  2OQR A;  5GAD J;  3ONQ A;  4BQA A;  4GXO A;  2ZXJ A;  1XSV A;  2M2E A;  1K7A A;  1W5C C;  1R7J A;  4RAF A;  3RKW A;  5J8F A;  2PJR A;  4P9F A;  4KIC A;  3MZH A;  3WHC A;  1I1G A;  1U2W A;  2DOE A;  4WXH A;  3I59 B;  3I64 A;  3NWT A;  4ZYD A;  2BY0 A;  3U21 A;  2HTJ A;  2DFH A;  3LSJ A;  1MMS A;  4KIG A;  5CJ9 A;  2ZJR F;  2JUC A;  1VQ4 I;  3H9Q A;  1I6X A;  4J19 A;  5CVV A;  1DPR A;  5ILU A;  2DA6 A;  4P1W A;  1JTX A;  4IOC F;  1BC8 C;  3GTJ J;  3ZQ7 A;  2UV1 A;  4V19 K;  4Q47 A;  3J7Y J;  2LNB A;  2CS3 A;  2NNY A;  3BR2 A;  4QWQ A;  2Y9Z A;  5IP7 J;  1BOA A;  4U7D A;  3GTQ J;  2M87 A;  3P9C A;  1RUO A;  2MBF A;  2HS5 A;  4Y15 A;  1ZEL A;  3M07 A;  2K02 A;  3J7A O;  4M6X A;  2JSC A;  2UUZ A;  3I4P A;  2EV5 A;  3CC7 I;  3VB2 A;  2DQR A;  4EJO A;  3GZ6 A;  4DBR A;  2X51 A;  3WHB A;  2BV6 A;  5BOX A;  3FXJ A;  2VC0 A;  3P5J A;  2MFZ A;  4UNO A;  4ENK A;  4E6K G;  4IKF A;  1H8A C;  3SHF A;  3HRM A;  3F23 A;  2HXO A;  4IEJ A;  1YI2 I;  1X3U A;  2DOF A;  5CYV A;  3U1K A;  2QQ9 A;  4RB0 A;  3KFW X;  2MD5 A;  4IZZ A;  3TL4 X;  3F3X A;  2HFH A;  4HW0 A;  3T8R A;  4DJA A;  2ETH A;  2P5K A;  3QP6 A;  2KIU A;  5KCM A;  3OYH A;  2VE9 A;  3BG6 A;  2C6Y A;  2EBI A;  4E7K A;  2BBY A;  3VEP A;  1ZHF A;  4IPA A;  4CUG A;  3KYL A;  2QBY B;  4KN4 X;  1Z0X A;  1W0U A;  4MLO A;  2LP0 A;  1SD4 A;  2M9H A;  1OLT A;  5J3L A;  2JSP A;  1MBK A;  1LFP A;  1Z9C A;  2W00 A;  2RGV A;  3NAR A;  4M3B A;  4CA0 A;  4I6Z A;  2MSY A;  5F27 A;  1ON2 A;  2B63 J;  1U3E M;  4XLC A;  2O7O A;  3CJR B;  3AKZ A;  2E2I J;  3EPZ A;  2CYY A;  1NK3 P;  4BL0 B;  4UUT A;  2E71 A;  3H5A A;  1YJ9 I;  1Z21 A;  4ESB A;  4IXA A;  2V79 A;  2JRT A;  4BHP A;  3CF2 A;  1ZKG A;  4CDG A;  2CJJ A;  1WH7 A;  1IN7 A;  4HNT A;  2E36 A;  1AWC A;  3H3U A;  1WH5 A;  1Y8R B;  3LWF A;  4Y52 J;  4B09 A;  2L9R A;  2O5R A;  1JT6 A;  4JBA A;  3PFI A;  2FMY A;  1D8K A;  3GZN B;  4EVI A;  3BR6 A;  1A6I A;  5A2Q K;  5TJJ A;  3Q9S A;  3CCM I;  1VQN I;  3JRE A;  2ICW G;  2NS0 A;  2NOG A;  4M3E A;  4I76 A;  3V7C A;  1HDD C;  2IS2 A;  5E1W A;  1S29 A;  1TQI A;  3CUQ C;  3E1S A;  3E6M A;  2XHK A;  3WTY C;  3A01 B;  2AQE A;  3PL8 A;  3DU6 A;  2GIV A;  3JRC A;  4JYK A;  1ITY A;  3KP7 A;  4ZYG A;  1O3T A;  2DA4 A;  3N4M A;  1VQ8 I;  1G8X A;  1KYZ A;  1W7P D;  5JLW A;  1PVE A;  2CH0 A;  2IPQ X;  4A2U A;  3LOC A;  3W2W A;  5J4Y A;  2HU9 A;  4CCN A;  1UHS A;  3CP8 A;  3JRF A;  2WV0 A;  5AIQ A;  2PBI A;  5IYB J;  4A6E A;  5DM6 F;  1Z77 A;  3L2R A;  3K1M A;  1TBX A;  4C9Y A;  2LFB A;  2XGD A;  4U7B A;  3K10 A;  1HC8 A;  1S6L A;  1TT0 A; 
#chains in the Genus database with same CATH homology
 4IVN A;  3WTX C;  5AIP A;  4HZF A;  4WXC A;  2W24 A;  2V1X A;  2A6H F;  3ZMV A;  4GCV A;  4PDK A;  2QLZ A;  2LKP A;  4HX7 A;  2XAS A;  5HDG A;  3ZPL A;  1XGM A;  2RV8 A;  3E6B A;  1IW7 F;  4BAY A;  5D5U B;  4I09 A;  3FHZ A;  1G3W A;  1EH8 A;  4HLY A;  1HST A;  2IA1 A;  5FFZ A;  1MGT A;  3W6J B;  2HEO A;  5DYM A;  3RPU A;  4CO8 A;  1DPU A;  2KRF A;  3LA2 A;  5F64 A;  3WTW C;  4UVA A;  3Q5F A;  3TKY A;  1TQM A;  4H0E A;  1T38 A;  2ACJ A;  4FX4 A;  5DEQ A;  3E6C C;  4YIF A;  3HRU A;  2W85 A;  1KU3 A;  4KYW A;  4WXD A;  2H27 A;  3DXJ F;  1USS A;  3IKT A;  1SFU A;  1MJB A;  2OD5 A;  2GAU A;  1VTN C;  3J81 K;  3IL2 A;  1BIA A;  5E17 F;  3KZZ A;  1S7O A;  2JT1 A;  4N9I A;  1FNN A;  1ZYR F;  3ULQ B;  3FX3 A;  4UVC A;  3M8E A;  3RKX A;  3ERE D;  4KIB A;  4WX9 A;  2EA4 A;  1TQP A;  4M6Y A;  3I54 A;  5J8C A;  1Z6T A;  3ZP5 A;  1PP8 F;  2EV0 A;  3MWM A;  2RQP A;  3JW4 A;  5ICE A;  5LRR A;  3E3V A;  3O3K A;  3HUG A;  3GWZ A;  3EQL F;  3GFJ A;  3JAM K;  2EFP A;  2D1H A;  3F8B A;  1BIB A;  1FSH A;  1EH7 A;  2EWN A;  2FF4 A;  1D8J A;  4RS8 A;  3R4K A;  1E2X A;  3U1D A;  5L3E A;  4BYY A;  2RKH A;  4EM0 B;  1P4X A;  4A12 A;  3KET A;  1RNL A;  3C3W A;  3GEZ A;  1FYK A;  4WWC A;  1SMY F;  2ZBK A;  1NHA A;  4U0V A;  2COM A;  1YW8 A;  4I0A A;  4HLX A;  4LK0 F;  3GUD A;  4YFK F;  5LGT A;  4R8H A;  4MEX F;  3HSE A;  3J80 Z;  3JAM Z;  2EFQ A;  3E5U A;  1T6S A;  3QPT A;  3CUQ B;  3E97 A;  4LLL A;  3LST A;  3HSR A;  2JTV A;  2KJC A;  4KA4 A;  1J5Y A;  4HF1 A;  2GA2 A;  4O5V A;  3SFZ A;  4CHU A;  3FXQ A;  1LEB A;  2DK8 A;  4NQW A;  4BXU A;  2YSR A;  4OMZ A;  3HYI A;  2JZY A;  2F2E A;  1YTY A;  2K7L A;  2ZKZ A;  5LBQ A;  2DW4 A;  2BGC A;  5K5R A;  1BI2 A;  3NQO A;  5LEK A;  2L02 A;  1I1S A;  5JVT A;  1D3Y A;  2HR3 A;  2PJP A;  3KP5 A;  3I5U A;  2XAH A;  4I0B A;  2XRN A;  5HDN A;  2HQN A;  3C18 A;  3KZY A;  2H6C A;  2NRA C;  2UWM A;  1S7A A;  2QYO A;  2XV4 S;  4MGR A;  4A0Z A;  3ECO A;  4HX4 A;  2E1N A;  4KIF A;  2ZFW A;  2KKO A;  5LGN A;  1ZRE A;  2RNJ A;  1WQ2 A;  1XMK A;  3H3Z A;  5K5O A;  5FGM A;  3VFZ A;  5CVU A;  3GW2 A;  1R36 A;  2HTS A;  5BMZ A;  2K86 A;  2H94 A;  3MZY A;  3E6D A;  3BJ6 A;  1O57 A;  4FHT A;  2HZT A;  1O3Q A;  5DUK A;  2UZK A;  3REO A;  1BI0 A;  1FY7 A;  1HW5 A;  2IVM A;  1UHW A;  4L0Y B;  1FP2 A;  5A2Q Z;  2IA2 A;  1S3J A;  3O6B B;  5JHU A;  1FBS A;  2Y0M A;  2P4W A;  2VT3 A;  5L3C A;  3FMQ A;  1ONV A;  2O8X A;  1MD0 A;  3WTV C;  1U5T A;  3TOB A;  3HSF A;  2ZO4 A;  2Z33 A;  2BE5 F;  2HKX A;  1QNT A;  1YS6 A;  1ZLJ A;  2DTR A;  3R0A A;  2MC3 A;  4ZYE A;  4AIH A;  4MTD A;  1OR7 A;  3E5X A;  5E8I A;  1K78 A;  4L5J A;  3L00 A;  1W4M A;  1L3L A;  2QWW A;  2W57 A;  3IWF A;  2STW A;  5HLI A;  2PLY A;  4HF0 A;  1FYL A;  4G94 A;  1DDN A;  3WU1 B;  4ZZD A;  1KU2 A;  1UCR A;  2A3S A;  4RGU A;  3I0T A;  5H6Q A;  1LEA A;  1R58 A;  3DQV C;  4G6Q A;  2VBW A;  2K27 A;  3IC7 A;  3BOQ A;  2XKP A;  2D1V A;  3F6O A;  4HX8 A;  2F5F A;  2ZCW A;  1T98 A;  1XGS A;  4MQ9 F;  4UXN A;  1MZB A;  3NRV A;  5LHG A;  1R22 A;  4G7Z F;  5BQT A;  2XUB A;  1QQI A;  2P6S A;  4P9U A;  2PN6 A;  3GZ5 A;  4JQF A;  4GO1 A;  1ZGJ A;  1U6G A;  1YYV A;  5HOO A;  3MFK A;  2FA5 A;  3ELK A;  1AOY A;  1UST A;  2Z3Y A;  5FLX Z;  1TW3 A;  2M30 A;  4HDV A;  5CVR A;  3U2R A;  3I58 A;  3HIF A;  2HOE A;  4A0X A;  5EEG A;  4ZZL A;  1FBQ A;  4ENM A;  1Y0U A;  4I98 B;  2K4J A;  2FBH A;  3M9A A;  5ICG A;  1STZ A;  1WWX A;  4M9S A;  4IJA A;  3C7J A;  1YS7 A;  3BP8 A;  1ZLK A;  3N97 A;  2V1U A;  2GXB A;  4Z2Y A;  1IZ1 A;  1JXS A;  4WF2 A;  2DAO A;  3IRQ A;  2OU2 A;  3QPH A;  1J75 A;  1FSE A;  5HS9 A;  1MKM A;  2GWR A;  3TO9 A;  5D5W B;  3WGI A;  2IA0 A;  4B8X A;  1A04 A;  5LHH A;  4EMS A;  1R5H A;  3AAF A;  5K5Q A;  5HVQ C;  3T1B A;  4YFX F;  1FT9 A;  1LDK B;  1V3F A;  1ZG1 A;  3F8F A;  1SMT A;  1KQ8 A;  1LDJ A;  3LA7 A;  4XLP F;  3ML6 A;  1YFH A;  1GXP A;  4EGY A;  2OAZ A;  2ZNZ A;  1G3Y A;  2G7H A;  3V8L A;  3C1D A;  1TTY A;  1BJA A;  4BHC A;  1XB4 A;  2F5E A;  4AIK A;  1YW7 A;  4CZZ A;  2OQG A;  2ZME B;  1LQ1 A;  1T0F A;  1L0O C;  4AIJ A;  1HXD A;  3ZMZ A;  1RZ4 A;  2RC4 A;  2WC2 A;  2PMU A;  4S04 A;  3DV8 A;  3GFL A;  3DFG A;  3ISP A;  1F4K A;  4Q48 A;  3L2C A;  2XIG A;  1D5V A;  1LJ9 A;  2E1C A;  4XSX F;  1Q1H A;  4FX0 A;  3ABU A;  3TGN A;  1UFM A;  4L9T A;  2L4A A;  3F8M A;  4R1H A;  5FFX A;  3CO6 C;  4PGG A;  4IRG A;  1LNW A;  2FE3 A;  2AXL A;  3G73 A;  3BPX A;  1XMA A;  1J2X A;  1O3S A;  1PDN C;  5DDG A;  1IXS B;  1HQC A;  1J0R A;  5D8L B;  3L09 A;  2L01 A;  2Z5U A;  3SZP A;  3LQR A;  1J59 A;  1O7L A;  1F9N A;  1IRF A;  3BRO A;  3IWZ A;  2CW0 F;  3FM5 A;  4MNU A;  2YR2 A;  5D6F A;  1G3T A;  3COA C;  1EH6 A;  1ZAO A;  4XRF A;  1V4R A;  5CVI A;  3EDP A;  1HW1 A;  1WI9 A;  1DP7 P;  3WG9 A;  3GFI A;  3EYY A;  4LG0 B;  3QRF F;  1XDS A;  3WE3 A;  2Z99 A;  2O61 A;  1MJ9 A;  5DD8 A;  3V7R A;  1ZH5 A;  1H9T A;  3F22 A;  2VOO A;  2PG4 A;  3DPL C;  1SD7 A;  5JI6 A;  1SAX A;  4OIP F;  3D0S A;  2P7V B;  4GYI A;  4ZYH A;  2E7W A;  3DEU A;  4P96 A;  5LEJ A;  3RPQ A;  1C0W A;  1IN6 A;  2CQK A;  4S05 A;  1KQ9 A;  1FPQ A;  1XN7 A;  2DK5 A;  1KGS A;  4L9J A;  3BPV A;  5IT3 A;  4MEY F;  3MQ0 A;  5F6F A;  2P7C B;  4P5O A;  3W6K B;  3QAH A;  1IN4 A;  4OIO F;  2VOP A;  1R1U A;  5DV5 A;  4RB1 A;  3IHU A;  3ROU A;  3RYR A;  1YG2 A;  2ESN A;  1KYW A;  1XCB A;  2L3D A;  4CIC A;  1EV7 A;  3OV8 A;  1QO0 D;  3HTU A;  5D8K B;  2AS5 F;  5IT9 Z;  2VXZ A;  3F6V A;  2A69 F;  3I59 A;  5CVJ A;  5FLX K;  3WGH A;  4HV5 A;  4MQV A;  4YFN F;  1QPM A;  3EUH A;  4IF4 A;  4M9X A;  2FRH A;  2RDP A;  3GXO A;  1XCV A;  2QM3 A;  1B59 A;  5ILV A;  2ESH A;  4EV0 A;  1Z6R A;  2PFB A;  1R23 A;  2MLG A;  3B73 A;  4KMU X;  4RGS A;  3VOD A;  2PMH A;  2QQA A;  2V6C A;  2EB7 A;  3CTA A;  2XAF A;  1CF7 B;  4U0Y A;  5HLH A;  3P7N A;  3KP6 A;  3H92 A;  1CF7 A;  1R1V A;  4U0W A;  3FWE A;  2Z9O A;  1ZG5 A;  2P5L C;  4QLC U;  2LF7 A;  3CUQ A;  3L9F A;  5DCM A;  2FNP A;  1HKS A;  5L3F A;  1U5T B;  3K0L A;  3ABT A;  3R61 A;  2M8E A;  3T5X A;  3JSP A;  3CLO A;  5L3G A;  1HSJ A;  4N0B A;  4KMF A;  1FWZ A;  4G8X A;  5F1R A;  5KK1 A;  2F5C A;  2D2W A;  4RAY A;  4U88 A;  2G9W A;  3PQK A;  2V9V A;  3TO7 A;  5BPI A;  2FSW A;  4RAZ A;  3FMR A;  3K1N A;  1P4W A;  2EJR A;  2WWY A;  5D5V B;  3IKV A;  2CSO A;  1KU9 A;  2O03 A;  3DF8 A;  1LVA A;  2H6B A;  4YG2 F;  1B4A A;  3BZ6 A;  3GF2 A;  1TNT A;  4M73 A;  4MTE A;  2E7X A;  2STT A;  1YO5 C;  2CGP A;  3RJP A;  2FML A;  5D6E A;  5JR3 A;  2VE8 A;  1O3R A;  4XBF A;  2FQ3 A;  1ZRF A;  2M1B A;  1O7F A;  3BDD A;  4L9N A;  1FX7 A;  4BNC A;  3S2W A;  1XDU A;  3V8J A;  2R7D A;  4RB2 C;  2LF8 A;  1T39 A;  3F8N A;  4KUM A;  4LD5 A;  4AD9 A;  3GVA A;  2VN2 A;  3M7G A;  3BWG A;  2OA4 A;  2FEZ A;  3TO6 A;  2YPR A;  2J5P A;  2O3F A;  1PP7 U;  2IJL A;  1K6O A;  1Z05 A;  3DP7 A;  1G6N A;  1XSX A;  4AVP A;  4P55 A;  4K2E A;  1JHF A;  1H9G A;  3GLX A;  2BYV E;  3ZMU A;  3T0Y A;  4DNC A;  5FD6 A;  1Z91 A;  5KVR A;  2V1D A;  3RKY A;  3EYI A;  2A5Y B;  4XSZ F;  2FBI A;  1YIO A;  4FT8 A;  4O3M A;  4O6J A;  3RYP A;  4KNY A;  1FZP B;  3WOD F;  3J80 K;  1OYW A;  1MJA A;  3KEQ A;  4IHS A;  4Q4Z F;  2JPB A;  3HOS A;  2PEX A;  4RB3 C;  4YII A;  3LQQ A;  5HLG A;  3I71 A;  3LAP A;  1MDM A;  2H09 A;  1Z1D A;  2G7U A;  1IXC A;  3K69 A;  1R1T A;  1ODD A;  1J9I A;  3KLO A;  1ULY A;  1W5S A;  2XVC A;  3J81 Z;  1GXQ A;  2FNA A;  5DUI A;  3HRT A;  3R0J A;  1IXR C;  1IAW A;  2A07 F;  2HKO A;  2IT0 A;  2W84 A;  2QQB A;  2EFO A;  5EEH A;  5ERI A;  5D4R A;  2HGC A;  2DLL A;  1UHM A;  2XAQ A;  3JTG A;  1QBJ A;  4L0Z B;  1FBU A;  3V8K A;  1HW2 A;  4HV6 A;  2ZME A;  2QBY A;  1W7P A;  4D0P A;  1U5T C;  4EJT A;  3GYH X;  5E1Z B;  1FC3 A;  5CLS A;  5K1Y A;  4IRH A;  1Z7U A;  3B02 A;  3GFM A;  4ZH4 F;  2DPU A;  2XKO A;  2UXN A;  4HF2 A;  5LRS A;  2EA2 A;  2GQQ A;  1K79 A;  3HOT A;  1REP C;  3R6S A;  5JFR A;  2VT2 A;  1SFE A;  2QZ8 A;  3SQN A;  5D4S A;  5E18 F;  2CO5 A;  4EJU A;  1W5T A;  1F1Z A;  3M1E A;  1U78 A;  3FMS A;  2O6G E;  2R7F A;  3LFK A;  2IP2 A;  5E20 A;  4G7O F;  2DT5 A;  1TNS A;  2PQ8 A;  1IN5 A;  4UHT A;  1K78 B;  2QEN A;  3JSO A;  1I27 A;  2VOD A;  4L5I A;  2LSO A;  1DUX C;  2L4M A;  2MH9 A;  2JPC A;  1HKQ A;  3QP5 A;  4ENJ A;  4TV7 A;  4ON0 A;  2OZ6 A;  3M8F A;  3PQJ A;  4G9Y A;  1SD5 A;  2KJB A;  4EM2 A;  2ELH A;  1RUN A;  3WE2 A;  5HS7 A;  2ISY A;  5DCM B;  2OBP A;  4NB5 A;  1W7P B;  4XLN F;  4ASN A;  4Y17 A;  2XAG A;  1P2F A;  1OMI A;  2XAJ A;  4E70 A;  2HYF A;  4ESJ A;  2WTE A;  3R60 A;  5LHI A;  1YLF A;  5FO5 A;  4RGX A;  3HRS A;  3VOE A;  3D5L A;  1R00 A;  4M74 A;  4UVB A;  5FD5 A;  3WGG A;  2P5V A;  2EFW A;  4BH9 A;  1B6A A;  3ZN0 A;  1XGO A;  1QZY A;  4DQ2 A;  1ZN2 A;  2A61 A;  1JHH A;  5DD4 A;  2NNN A;  3K1P A;  5E1X A;  1BI1 A;  4EM1 A;  3K9T A;  2J5O A;  3U9G A;  4EGZ A;  5HDK A;  6PAX A;  4I7H A;  4I01 A;  2L54 A;  2YX7 A;  1TLH B;  2DBB A;  3MAJ A;  3CJN A;  1U8R A;  2Y48 A;  2ZNY A;  2F5D A;  3LA3 A;  1BM9 A;  3BY6 A;  1PUE E;  3TDU C;  3MEX A;  3CDH A;  2GA1 A;  1WSU A;  1IF1 A;  3ZMD A;  4A0Y A;  4R79 A;  2M5W A;  1RI7 A;  2IRF G;  3TOA A;  4LJZ F;  1CGP A;  2Q0O A;  1ZAR A;  1XSD A;  4BHB A;  5LLQ A;  5D5X B;  4N9H A;  3KP3 A;  5FB2 A;  3RIR A;  1LB2 A;  2GXG A;  4A5N A;  2M45 A;  1P4A A;  3KEO A;  2R3S A;  2Y75 A;  5ICF A;  4HOB A;  3RI4 A;  2GZW A;  4UV9 A;  2ZJ2 A;  5ILS A;  1JGS A;  2EFN A;  4ETS A;  2XRO A;  5L3B A;  1HKT A;  5J6X A;  3V7S A;  3OOP A;  1RIO H;  3DKW A;  1OYY A;  2YX4 A;  4JK1 X;  3WTS C;  4A6D A;  1OYI A;  1QZZ A;  4LB5 A;  1BBY A;  1TW2 A;  5HS8 A;  5TRD A;  3QOP A;  3F21 A;  2W25 A;  4OU0 A;  4PZJ A;  1WRJ A;  2Q2E A;  4LLN A;  1BI3 A;  1KA8 A;  2X0L A;  4WK8 F;  3WTT C;  3BJA A;  4I2O A;  1QGP A;  3QU6 A;  1ZGA A;  4LLG F;  3KLN A;  2P8T A;  4G6D A;  2DU9 A;  2A68 F;  3RDI A;  1S8N A;  4LFU A;  4KFC A;  3FZV A;  4LB6 B;  1KQ0 A;  4L9V A;  1OKR A;  3LAJ A;  3FM3 A;  2PI0 A;  4OIN F;  5DCF A;  2VBZ A;  4I02 A;  1I5Z A;  1UB9 A;  2OZU A;  4WCG A;  1IRG A;  3WTU C;  2HWV A;  2VBX A;  4CXF A;  3T8T A;  4LMY A;  2CG4 A;  3FXU A;  3FXR A;  3KE2 A;  3ZMT A;  4Q5S F;  4HYE A;  2UXX A;  4UV8 A;  4HQE A;  4OIR F;  5ED4 A;  3HTS B;  3BJO A;  3QU3 A;  3NEU A;  3P9I A;  1SFX A;  2YU3 A;  3ZN1 A;  2BEO A;  3P9K A;  4CGZ A;  4KT5 C;  1HBX G;  2KIF A;  2O0Y A;  2DQL A;  2IW5 A;  3EET A;  2KIM A;  2DPD A;  2EV6 A;  1GVJ A;  4HDU A;  3KP2 A;  1G4D A;  5BPD A;  1BN5 A;  3GX4 X;  2EK5 A;  3I53 A;  2K4B A;  5E8G A;  2D45 A;  3V4G A;  2QUF A;  1SD6 A;  1IUY A;  5AON A;  3CO7 C;  5H20 A;  2HYG D;  2VON A;  3FF5 A;  1LDD A;  2Q8K A;  4LK1 F;  2MA3 A;  4M71 A;  4HAM A;  4PGH A;  1J7K A;  3HHG A;  1P92 A;  3KP4 A;  3CUO A;  2CFX A;  1YW9 A;  1KU7 A;  1B9N A;  2FBK A;  1FLI A;  3E5Q A;  3F72 A;  4KDP A;  2DI3 A;  1ON1 A;  3G3Z A;  4AWX B;  2RVC A;  3ECH A;  2NAZ A;  2HQR A;  5BS6 A;  1R5G A;  1IN8 A;  2ADU A;  2B0L A;  1FYM A;  4F7Z A;  1ZRC A;  4UUV A;  2FOK A;  3WU0 A;  1GHC A;  3DPT A;  3O2P E;  1MDM B;  3SZT A;  2A6E F;  3TQN A;  1ZRD A;  2NYX A;  5LGU A;  4HQM A;  4KN7 X;  4CYD A;  4IHT A;  3L7W A;  4ESF A;  3MCZ A;  4EJW A;  5IT9 K;  2VC1 A;  2MLK A;  1ZG3 A;  2P6T A;  4ENN A;  4EJV A;  1YQA A;  4GGG A;  1XGN A;  4OMY A;  1F5T A;  2XGX A;  5ICC A;  4OIQ F;  2CWE A;  4MHG A;  1OPC A;  5L3D A;  1B1B A;  2MH2 A;  3KCC A;  4NHJ A;  4Y13 A;  2ISZ A;  4EQQ A;  3Q9V A;  1P6R A;  3F8C A;  4A5M A;  3IRR A;  1G3S A;  4M72 A;  2DO7 A;  4GYG A;  1E17 A;  4LGW A;  4G7H F;  1H0M A;  2HDC A;  2DFI A;  4HA8 A;  3GO5 A;  4L18 B;  2TDX A;  2RN7 A;  4IRI A;  3WTZ A;  1B9M A;  2LDU A;  2QVO A;  1WKM A;  4PCQ A;  5H6R A;  2FU4 A;  1T2K A;  2VBY A;  4HBL A;  2FXA A;  4LG0 A;  4OOI A;  4M9Z A;  1BC7 C;  2X4H A;  3SXY A;  3JTH A;  1JE8 A;  3ZMS A;  1FOK A;  1FP1 D;  4RGR A;  1XD7 A;  3HHH A;  3RTR A;  3K2Z A;  3TDZ C;  2OQR A;  4BQA A;  4GXO A;  2ZXJ A;  1XSV A;  1K7A A;  1R7J A;  3RKW A;  5J8F A;  4P9F A;  4KIC A;  3MZH A;  1I1G A;  1U2W A;  4WXH A;  3I59 B;  3I64 A;  4ZYD A;  2HTJ A;  4KIG A;  5CJ9 A;  1I6X A;  5CVV A;  1DPR A;  5ILU A;  1BC8 C;  3ZQ7 A;  4Q47 A;  2LNB A;  2NNY A;  4QWQ A;  1BOA A;  4U7D A;  2M87 A;  3P9C A;  1RUO A;  2MBF A;  2HS5 A;  4Y15 A;  2K02 A;  3J7A O;  4M6X A;  2JSC A;  3I4P A;  2EV5 A;  3VB2 A;  2DQR A;  4EJO A;  3GZ6 A;  2BV6 A;  5BOX A;  2VC0 A;  4UNO A;  4ENK A;  3SHF A;  3HRM A;  3F23 A;  1X3U A;  5CYV A;  2QQ9 A;  4RB0 A;  3KFW X;  2MD5 A;  3F3X A;  2HFH A;  4HW0 A;  3T8R A;  2ETH A;  2P5K A;  3QP6 A;  2KIU A;  2VE9 A;  2C6Y A;  2BBY A;  3VEP A;  1ZHF A;  4IPA A;  2QBY B;  4KN4 X;  1SD4 A;  1Z9C A;  2RGV A;  1ON2 A;  1U3E M;  2CYY A;  4ESB A;  4IXA A;  2V79 A;  2JRT A;  4BHP A;  4CDG A;  1IN7 A;  1AWC A;  3H3U A;  3LWF A;  4B09 A;  4JBA A;  3PFI A;  2FMY A;  1D8K A;  4EVI A;  5A2Q K;  5TJJ A;  3Q9S A;  2NS0 A;  3V7C A;  5E1W A;  1S29 A;  1TQI A;  3CUQ C;  3E6M A;  2XHK A;  3WTY C;  2GIV A;  3KP7 A;  4ZYG A;  1O3T A;  3N4M A;  1KYZ A;  1W7P D;  2IPQ X;  4A2U A;  2WV0 A;  5AIQ A;  2PBI A;  4A6E A;  3K1M A;  1TBX A;  4U7B A;  1S6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...