1FSEA

Crystal structure of the bacillus subtilis regulatory protein gere
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords GERE
publication title Crystal structure of GerE, the ultimate transcriptional regulator of spore formation in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 23
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fseA00
4A12A 4MGRA 3JSOA 5E1XA 2X0LA 1LEAA 2MLGA 5D5UB 1XD7A 3DF8A 1U8RA 3DV8A 5J8CA 3KEOA 2ZMEA 3W6JB 2R7DA 4ZYGA 1IN5A 5ERIA 3M9AA 2STTA 4P96A 2HYGD 1MJBA 4WX9A 3VODA 1ZRCA 1S7AA 3TDUC 4N9IA 2AS5F 4BHCA 1U5TC 5HS8A 6PAXA 1HBXG 4KYWA 3V4GA 4A5NA 1BI2A 2E7XA 5AIQA 2CFXA 3WTSC 1W7PD 5LLQA 2FE3A 5K5RA 4P9UA 2P4WA 2PI0A 3D0SA 4M6YA 2QENA 1H0MA 3D5LA 2NS0A 4DNCA 4Y15A 5LEJA 1FOKA 2OAZA 3K69A 2GQQA 1MGTA 4KMFA 5K5QA 4YFNF 4IXAA 2E7WA 2W57A 3SZPA 2K7LA 4MEYF 4I98B 2YX4A 1S3JA 4DQ2A 4KNYA 2AXLA 2EV6A 1WWXA 3ZMSA 4Z2YA 2KJCA 2G9WA 4GGGA 2CW0F 4EJTA 2ZFWA 1I5ZA 5F64A 2H6BA 4LB6B 3KCCA 3BROA 5AIPA 1DP7P 1X3UA 2VXZA 2PFBA 3GX4X 1ZH5A 1KGSA 3WODF 3LWFA 3BWGA 5F6FA 3V8LA 2J5PA 4IJAA 4LD5A 2L02A 5EEHA 2KIMA 3OV8A 2GA1A 3S2WA 3PQKA 1Q1HA 4MTDA 4HQEA 2EWNA 2QZ8A 1ZN2A 1D3YA 4IVNA 2KIUA 4I0BA 3GEZA 1Z6TA 2KRFA 3R0AA 1K7AA 1MD0A 2IT0A 4L18B 2MBFA 2RC4A 3RKYA 2Y48A 3TO6A 4ENMA 4E70A 2L4MA 2A6HF 2GXGA 4CICA 3EYIA 4H0EA 2HTJA 2EFQA 1F1ZA 5HLIA 1IXCA 3RPQA 4UV8A 1ODDA 2Q0OA 2IRFG 2FU4A 4OOIA 3F8CA 3NRVA 2G7HA 2W85A 2H6CA 3RYRA 2JTVA 4LG0A 3F8NA 3K1NA 2RDPA 2OQRA 4PGHA 2ZMEB 1P4AA 3I59A 4A5MA 3B02A 2EV0A 4KT5C 1O3SA 2JZYA 3MAJA 3M7GA 1L3LA 2ZNZA 4BH9A 2P5VA 3CUQA 1UB9A 4KIGA 3HOSA 3TQNA 2CO5A 5BPDA 1B1BA 4U7BA 5FFXA 4I01A 2MC3A 4Q48A 1D8KA 2L3DA 1H9GA 2DQLA 3MCZA 2O8XA 1ZARA 4RAYA 1LDDA 1XGOA 5AONA 3C7JA 3QPHA 1JE8A 4I2OA 3V8KA 2STWA 1YS7A 4L9VA 2ZKZA 4U0YA 3RPUA 5ED4A 1RIOH 3TGNA 1HW1A 5HDNA 2FNAA 2J5OA 2H09A 3Q5FA 1CGPA 2CSOA 2OD5A 2OBPA 3F23A 4A6DA 3WGIA 1U2WA 3KLOA 3ML6A 1IW7F 3TOAA 5D8KB 5LGTA 1FSEA 2L4AA 3E6CC 1BBYA 4CHUA 4BXUA 1P92A 3P9IA 4IF4A 2IVMA 1RI7A 4BNCA 5BMZA 1G3TA 5TJJA 3R0JA 3QOPA 4EGZA 3PFIA 1P6RA 1Y0UA 4CGZA 2D1VA 3EYYA 3F6VA 3VFZA 5BOXA 1QNTA 2VOPA 2HWVA 2WWYA 2PEXA 3HSRA 1K78A 3R60A 4M9SA 2F5EA 2PG4A 1J7KA 2L54A 2XKOA 4KIBA 4LGWA 3SFZA 4I09A 2EB7A 2NNYA 1HSTA 1D8JA 1FSHA 2K02A 3GUDA 1ZAOA 4AWXB 1FYMA 1BIBA 5E1WA 3E6DA 3L9FA 4MHGA 2Z5UA 4OU0A 5KVRA 5LHGA 4MNUA 4LG0B 3LQRA 2P7CB 4Q5SF 1Z7UA 1QGPA 5K5OA 3GLXA 1JHHA 1YLFA 1RZ4A 3I53A 3I59B 5ILSA 1BI3A 1S7OA 2EA4A 3L09A 4KDPA 3FXUA 3CUQB 1ON2A 2F5CA 3WTWC 2V9VA 3PQJA 2DAOA 1J0RA 2OU2A 2VBZA 3VEPA 2HR3A 1VTNC 4N9HA 1R1UA 1ULYA 4M72A 3GO5A 2F2EA 5DUKA 3MQ0A 2G7UA 2PMUA 3V8JA 5ICFA 2FMLA 2RNJA 4OIOF 3K0LA 5J8FA 2YU3A 4FX0A 4KN4X 4EMSA 4I7HA 3IWZA 5TRDA 1SFUA 2VODA 3GXOA 2WTEA 1FBSA 1TNTA 2GAUA 2RV8A 3I64A 2YSRA 4HLXA 4NHJA 3L00A 4BQAA 2R7FA 3H92A 1FC3A 3DPTA 3O2PE 4IRGA 4UUVA 1ZYRF 4P5OA 1KQ0A 3CUQC 4EJWA 2P5LC 1BN5A 1CF7A 2VT2A 4U88A 1HSJA 3T1BA 4GO1A 2Z3YA 3G3ZA 1STZA 3TDZC 1T0FA 4QLCU 3I71A 5LGNA 2D2WA 2CWEA 2DO7A 1O57A 2BV6A 4XLNF 5DCFA 4OINF 2M1BA 2FBIA 5CVJA 1HW5A 3LA7A 2KKOA 2YX7A 4ZYHA 4GXOA 4LLLA 1YW7A 5DUIA 3GFJA 3KP2A 3RTRA 1LB2A 4HDUA 3R4KA 3HSEA 2MD5A 2IPQX 3FWEA 1K78B 2HQRA 4FHTA 1R58A 4I0AA 2HGCA 2D45A 1SD7A 1RNLA 3IKVA 5DV5A 4YIFA 3CO6C 4KN7X 5BQTA 1LEBA 4Q47A 5IT9Z 4PCQA 5FFZA 4YFXF 2K86A 3W6KB 1D5VA 2IA1A 3I58A 3E5UA 5FD5A 1XGNA 4LK0F 5H20A 3DXJF 4EGYA 4KICA 3V7RA 5L3DA 2PLYA 5HLHA 1XGMA 4HQMA 3RYPA 1ZGAA 3SXYA 5LHHA 2WV0A 2HKXA 3FHZA 1U5TB 5IT9K 1I6XA 1P2FA 2PQ8A 4L5JA 1E17A 2A68F 2XKPA 4RB1A 3J81K 3BPXA 3KFWX 5HS9A 2HQNA 3KLNA 3WE2A 3ULQB 2M30A 3EETA 2F5FA 1XDUA 1PP8F 2M87A 4YIIA 1A04A 1T6SA 1U6GA 4A6EA 5DD4A 4ON0A 2NYXA 3MFKA 4RGRA 2IJLA 4UXNA 4ENNA 1FWZA 2TDXA 2FEZA 2OA4A 1F4KA 1B59A 3GZ5A 1QPMA 2PJPA 4L0YB 4RAZA 1RUNA 1SD5A 1JGSA 2IW5A 3HTSB 2BYVE 4U7DA 4HF2A 3HIFA 1KU7A 4B09A 4QWQA 1YO5C 3GFLA 2LKPA 5D4SA 2VC1A 2LDUA 1CF7B 1T98A 3ZPLA 2HOEA 1IN4A 2OZ6A 3WU0A 3C18A 5LRSA 4HV6A 3T8TA 1FYLA 4WXCA 4RS8A 2JRTA 2P5KA 1USTA 1NHAA 1FPQA 1YW8A 1PDNC 5L3GA 3REOA 4EJUA 3TKYA 4M73A 1P4XA 3WTZA 3KP5A 3BDDA 1Z6RA 3T5XA 4YG2F 3O6BB 2EA2A 2JSCA 2GZWA 2MH2A 1XGSA 1SMYF 3H3UA 3KEQA 2BEOA 5HOOA 1BI0A 1WQ2A 5ILUA 3CO7C 1R1VA 4LFUA 2COMA 3ELKA 1YYVA 1QZZA 4I02A 2VONA 1FP1D 4IHSA 1IRFA 4NB5A 1U78A 4HLYA 2MLKA 1O7FA 1ON1A 2O03A 4B8XA 3E5QA 3WU1B 2Z33A 4EM0B 1MJ9A 1HQCA 3P9CA 4HAMA 2RKHA 2CG4A 1XMAA 5CLSA 5CVIA 2X4HA 1U3EM 5DCMA 4YFKF 2F5DA 1XDSA 4LMYA 4IHTA 4N0BA 3MEXA 2QBYA 2DFIA 3Q9VA 2MA3A 1IAWA 5CVUA 4G7ZF 2R3SA 1R1TA 5ICCA 5D5WB 4IRIA 3M8FA 3MZHA 3F22A 3R6SA 2RGVA 1J5YA 2Z9OA 1BJAA 3SZTA 3ZMVA 2LF8A 2O3FA 1OYWA 3ZMUA 1FNNA 4TV7A 3L2CA 2QQAA 5LEKA 1UHWA 2E1CA 1XSVA 3NQOA 2QUFA 2V1DA 2VC0A 4L9NA 1FYKA 1FBUA 3RKXA 2FMYA 2ADUA 5EEGA 2VE9A 3I54A 1TQMA 4ZZLA 5D4RA 4UHTA 2VT3A 3RI4A 2XAQA 3F6OA 1ZLKA 1LDKB 1OPCA 2VOOA 3HUGA 2QYOA 3EUHA 1ZRFA 4KUMA 5FO5A 2XGXA 1KU3A 1DDNA 2HFHA 4CYDA 2K4BA 1R36A 3JW4A 1Z9CA 2BBYA 3RJPA 4HZFA 2DBBA 5J6XA 1XCBA 2XROA 1YFHA 4JK1X 2DLLA 3ISPA 1BC8C 1BM9A 1YW9A 1O3QA 1V3FA 1EH8A 5DEQA 3COAC 3P7NA 1TNSA 2DPUA 3QP5A 4UVBA 5K1YA 4U0VA 4WK8F 1FBQA 3IRRA 4ENKA 2KIFA 1W7PA 1S6LA 1O7LA 1G3YA 4S05A 2GIVA 4OMYA 5E1ZB 1MJAA 1WKMA 1IXRC 4HW0A 1G4DA 4UNOA 3FXQA 4G6QA 1I1SA 2Z99A 2KJBA 3IL2A 2QWWA 2ACJA 3HRSA 1W5SA 2EK5A 3KE2A 3U1DA 5CJ9A 3E3VA 2HDCA 3GF2A 1ZREA 4WCGA 5A2QZ 5HDGA 2XV4S 1K79A 3QU6A 1Z1DA 4HA8A 5F1RA 3QU3A 4ZZDA 1XSXA 4UV9A 3DKWA 4M9XA 4F7ZA 4L0ZB 4HV5A 4GYGA 4Y13A 1OMIA 3FF5A 5LRRA 2DT5A 5JR3A 1EH7A 4LLNA 4XLPF 2M8EA 2FQ3A 2ZCWA 1IZ1A 3BPVA 4WF2A 1JXSA 3TO9A 4MTEA 2XUBA 3HHGA 4R8HA 4RGSA 2IP2A 2ESNA 3ECHA 2UXNA 2EV5A 2DI3A 4BYYA 3NEUA 3FMQA 3FXRA 2ZNYA 2A61A 1WI9A 4KIFA 4UVAA 3GFMA 1B6AA 3O3KA 3GZ6A 3RIRA 4EVIA 3ZMZA 1FT9A 3VOEA 4HX8A 5L3FA 1XN7A 3BOQA 1RUOA 4KA4A 2A5YB 4K2EA 1IUYA 1FP2A 3RDIA 1BIAA 3G73A 2ETHA 2H27A 2Y75A 3CUOA 1LVAA 3N97A 3BY6A 4EJVA 2FRHA 5LBQA 4GCVA 5L3BA 3U9GA 4CDGA 2O6GE 2FBHA 2EFWA 3E6MA 2K4JA 1W7PB 5JI6A 4Q4ZF 1LNWA 3N4MA 1HKSA 3IKTA 1KU9A 3FX3A 4XBFA 1YIOA 3CLOA 5JHUA 2IA0A 2A3SA 2ESHA 1R00A 5HS7A 3ABUA 4ZYDA 2BE5F 3U2RA 1GVJA 3V7SA 3ERED 2RQPA 3GW2A 3DEUA 3EDPA 1TQIA 4A0ZA 3SHFA 4MEXF 2XAHA 2W25A 3Q9SA 4L9JA 1ZG3A 4RB2C 1KA8A 3L7WA 3J80Z 4ENJA 2UWMA 2V79A 1IRGA 1GHCA 5D5XB 3HHHA 2ZO4A 4JQFA 4FT8A 1KQ9A 3JSPA 1FX7A 1OYIA 2H94A 3K2ZA 5CYVA 2A69F 3QPTA 5LHIA 5DYMA 4A0YA 1KU2A 2O0YA 4HX4A 1QBJA 3WGGA 4D0PA 2FXAA 2MH9A 2DW4A 1S8NA 2NAZA 3K1PA 1SMTA 1KYZA 2HYFA 3LFKA 3VB2A 2FOKA 2FNPA 2A07F 5DDGA 2ELHA 4KMUX 3FM5A 1F9NA 1OYYA 4EV0A 3CTAA 3V7CA 1O3TA 4XSZF 1XSDA 2OZUA 5E8GA 1WSUA 3ZN0A 4R1HA 3HYIA 2LF7A 1DPUA 1B9MA 1KQ8A 1T38A 1SD6A 4M71A 5FLXZ 1J2XA 4ESJA 5CVVA 4IPAA 4M74A 1XB4A 3E6BA 3ZP5A 4LK1F 2D1HA 1HW2A 3FZVA 2CQKA 5H6RA 4U0WA 4HYEA 4MQ9F 3E97A 2EFNA 5FLXK 1IN6A 1DUXC 3WGHA 1ZHFA 3KP3A 1MDMA 4EM2A 3I0TA 4HF0A 3MWMA 4M9ZA 4OMZA 2ISYA 3ECOA 2W24A 3RKWA 2QQ9A 2XASA 3P9KA 5ILVA 1QO0D 3DPLC 2E1NA 4ZYEA 3ZMTA 2B0LA 3KP4A 3TOBA 3F21A 2JPBA 2HEOA 1MKMA 5E20A 4AIHA 2XRNA 3T0YA 3K1MA 1GXPA 2P6SA 2GXBA 4ESFA 1IXSB 4WWCA 2XHKA 4EM1A 5LGUA 2DK8A 2IA2A 3DQVC 4BAYA 2YR2A 2RVCA 1BI1A 4EJOA 4ETSA 3BJAA 3F72A 4RB0A 4GYIA 4MQVA 1AOYA 5HVQC 5FD6A 3FMRA 1ZLJA 1KYWA 5BPIA 4G9YA 3WTYC 1GXQA 1TBXA 1B9NA 2P7VB 1MZBA 4PDKA 1J9IA 2L01A 3QAHA 1YQAA 3WTVC 5H6QA 1UCRA 4HX7A 4FX4A 2DTRA 2EJRA 2Y0MA 3I4PA 1SD4A 2A6EF 4M6XA 3ZN1A 2XAJA 5L3CA 1USSA 3LAJA 1XMKA 1R7JA 2QLZA 1FY7A 5JVTA 1T2KA 4LB5A 5BS6A 3LAPA 4RB3C 5CVRA 4AIKA 4O5VA 4R79A 4LLGF 4IRHA 3J7AO 2XAFA 3T8RA 4HDVA 5FGMA 3ZMDA 2DPDA 2FBKA 2ZJ2A 3WE3A 3AAFA 4WXDA 1UFMA 3HRUA 4AIJA 4ASNA 4RGUA 4RGXA 2M5WA 5HLGA 1SAXA 2JT1A 1LDJA 5D8LB 1P4WA 3KZZA 2CYYA 5D6EA 5DD8A 5E8IA 2QM3A 1MDMB 2ISZA 1K6OA 3K9TA 3DP7A 3GWZA 2DQRA 1LJ9A 3KETA 2VE8A 2QVOA 2QQBA 1B4AA 2XVCA 5L3EA 4JBAA 3IHUA 3HSFA 3C3WA 1J75A 4ESBA 2HTSA 3R61A 1G3WA 2ZXJA 2HKOA 2HZTA 4OIPF 4G7HF 4L9TA 2DU9A 5HDKA 4BHBA 2PMHA 3B73A 1IN8A 2FF4A 2FA5A 5ICGA 1R23A 2V1UA 1G6NA 3SQNA 1Z05A 3WTUC 3ROUA 2C6YA 4UVCA 5D6FA 3CDHA 3EQLF 5E17F 5FB2A 2P6TA 2O61A 1OR7A 3LQQA 1YTYA 2V6CA 1T39A 1I27A 2YPRA 4NQWA 1TQPA 1Z91A 1ZG5A 1HKTA 1XCVA 1C0WA 3M8EA 5DCMB 3F8BA 2QBYB 1BC7C 1ZG1A 5JFRA 3GVAA 2GA2A 1HXDA 4G6DA 4O3MA 1EH6A 2VBXA 2HS5A 4A0XA 3TO7A 2XAGA 4L5IA 4Y17A 3HRMA 3E5XA 1UHMA 2V1XA 1YS6A 2NNNA 3HTUA 1FZPB 1W5TA 2GWRA 1R5GA 1WRJA 4PZJA 4HBLA 3GYHX 4CXFA 1U5TA 1YG2A 5A2QK 3F8MA 3JAMZ 3BP8A 3JTHA 4S04A 1ZRDA 2VBYA 1R22A 3BJ6A 4OIRF 4EQQA 2OQGA 3LA3A 2LNBA 4CZZA 1ZGJA 3CJNA 3GFIA 4P55A 5E18F 3WTXC 3WTTC 3KP6A 3JAMK 3KZYA 4P9FA 1TW2A 2Q2EA 2EFOA 1W4MA 3IRQA 1PUEE 3DFGA 1S29A 1JHFA 1E2XA 3ABTA 3WG9A 3F3XA 2BGCA 1SFXA 4WXHA 1FLIA 2JPCA 3BZ6A 3QRFF 3JTGA 2XIGA 3MZYA 1TW3A 3BJOA 4KFCA 4ZH4F 2W84A 2K27A 2P8TA 1H9TA 4XSXF 2VN2A 4LJZF 4AD9A 1TTYA 1L0OC 2ZBKA 5D5VB 1PP7U 1LQ1A 3KP7A 2FSWA 1DPRA 1R5HA 4PGGA 1J59A 3FM3A 4G7OF 2CGPA 2Q8KA 2VBWA 1QQIA 4HOBA 1V4RA 3FMSA 3F8FA 2UZKA 1G3SA 3H3ZA 2RN7A 2PN6A 3LSTA 1F5TA 4G8XA 4XRFA 4AVPA 1AWCA 1I1GA 4A2UA 2WC2A 1HKQA 2LSOA 1IF1A 4G94A 2M45A 3HRTA 3OOPA 3ZQ7A 5ICEA 3J81Z 1O3RA 1IN7A 1ONVA 3J80K 2PBIA 3IC7A 3HOTA 2EFPA 1BOAA 4BHPA 3LA2A 2DK5A 4HF1A 4CO8A 3IWFA 2UXXA 1REPC 2NRAC 3QP6A 3C1DA 3I5UA 4OIQF 4O6JA 1SFEA 1TLHB 5KK1A 3M1EA 1EV7A 1OKRA 1QZYA 5IT3A
chains in the Genus database with same CATH superfamily
4A12A 4MGRA 1X4PA 3I4NJ 3JSOA 5E1XA 4C30A 4BACA 2X0LA 5C44J 3QPLA 2X6WA 1LFBA 1LEAA 2AO9A 3JRHA 1JT6A 2MLGA 5D5UB 1XD7A 3DF8A 1U8RA 3DV8A 1RETA 5J8CA 3KEOA 1LPQA 2ZMEA 3W6JB 2R7DA 2Q2EB 1IN5A 4ZYGA 2QA4I 2VPRA 5ERIA 5FJ8J 3S1MJ 3M9AA 1SEUA 2STTA 4P96A 2HYGD 5F0CA 5F1JA 1MJBA 4WX9A 2X6XA 3MKLA 4CYCB 3VODA 2WV1A 3MD2A 1QHHD 5HNHA 3IH3A 1ZRCA 1S7AA 3OOUA 3PNYA 4B3XA 4DYQA 3TDUC 4N9IA 3MN2A 4HSRA 3HEFA 1VQ8I 2AS5F 3UKGA 2XPUA 4BHCA 1U5TC 4JX5A 5HS8A 3GTMJ 3TP3A 4AC0A 6PAXA 1HBXG 2IS2A 1ZTRA 4KYWA 3V4GA 3QPSA 3L2WA 4A5NA 1BI2A 2E7XA 5AIQA 1GDTA 2CFXA 3WTSC 1W7PD 2FUG2 5LLQA 4OWRB 2FE3A 5K5RA 2ZJRF 3QODA 4P9UA 2P4WA 4BJ5C 2PI0A 3D0SA 1I6HJ 4M6YA 2JQ7A 2QENA 1H0MA 3D5LA 2NS0A 4DNCA 4Y15A 4XLAA 1TL8A 5LEJA 1FOKA 2OAZA 3MZ8A 3K69A 2GQQA 1QPIA 1ZR4A 1MGTA 2GIZA 1CQTA 2XPWA 4KMFA 3TL4X 1K83J 3G4SI 5K5QA 4YFNF 4DZJA 4IXAA 1SANA 2E7WA 3CF5F 1BOBA 1PYVA 2L9NA 2W57A 3IUOA 3SZPA 1VQKI 2K7LA 4MEYF 3AFHA 1J09A 3K4LA 4I98B 2YX4A 1WVRA 3K4JA 1N75A 1S3JA 4DQ2A 4KNYA 5IYDJ 3HBLA 2V4JC 2H1LA 2AXLA 2EV6A 4FISA 1WWXA 3ZMSA 4Z2YA 2KJCA 2G9WA 3KZIC 2NOJB 1R6RA 4XN3A 4GGGA 1YI2I 4FE7A 2CW0F 4EJTA 2ZFWA 1I5ZA 1JTYA 5F64A 3DTIA 1APLC 2H6BA 4LB6B 1ETXA 2H8WA 3KCCA 4XLEA 1JUSA 3BROA 5AIPA 1DP7P 1X3UA 3CCQI 2VXZA 1ZELA 2PFBA 3GX4X 3B6CA 1JKOC 1BW6A 5KAFC 1ZH5A 5F0FA 1KGSA 3PSFA 2E1OA 3WODF 4DBQA 3LWFA 4A69C 2KLOA 4YEJA 1X58A 3BWGA 1QRYA 3LOCA 3DU6A 5F6FA 3V8LA 2K9NA 2J5PA 1R4NB 4IJAA 4LD5A 2L02A 5EEHA 2KIMA 2E71A 3OV8A 2GA1A 3S2WA 4Y7NJ 3PQKA 2L7FP 1Q1HA 4MTDA 4HQEA 1LVKA 5K7HA 2EWNA 4HNTA 2QZ8A 3ZQCA 1ZN2A 1D3YA 3VYSB 2CUFA 4IVNA 2KIUA 4I0BA 3GEZA 1HOMA 3PO3J 1Z6TA 2KRFA 3R0AA 1K7AA 1MD0A 3PFYA 3SDGA 1FJLA 2IT0A 4L18B 2MBFA 2RC4A 3RKYA 3NAUA 1GVDA 2Y48A 3TO6A 4ENMA 4E70A 3DBLB 2L4MA 5EGOA 1ETVA 4X6AJ 2A6HF 1QU3A 2W82A 2GXGA 5FKLA 4CICA 4FE4A 3VYRB 2R5YB 3FXKA 4CSWA 3EYIA 4H0EA 4FETA 2HTJA 2EFQA 2H8RA 3GBGA 1I3AA 1F1ZA 1H89C 3H36A 5HLIA 1IXCA 2JVHA 4UV8A 3RPQA 1QVTA 1RESA 1ODDA 2Q0OA 2IRFG 4JX6A 3LSJA 2FU4A 3H5AA 2DXIA 3OYIA 4OOIA 2K85A 3F8CA 3NRVA 3HOYJ 2G7HA 2W85A 2H6CA 3BQZA 3PSIA 3RYRA 2JTVA 4LG0A 4A3KJ 1HF0A 3F8NA 3K1NA 2RDPA 3I9V2 2MSYA 2OQRA 4PGHA 2ZMEB 1P4AA 1Y6IA 3I4MJ 3SDBA 3I59A 3S3OA 4A5MA 1E3PA 3N05A 3B02A 2NOGA 5HLTA 2EV0A 4KT5C 1O3SA 3OY9A 2JZYA 3MAJA 3M7GA 1L3LA 2V26A 2ZNZA 3GTGJ 4BH9A 4XKWA 2P5VA 3CP2A 3CUQA 1UB9A 4KIGA 2XDVA 2IGKA 3A02A 2WA0A 3HOSA 3TQNA 5F04A 2CO5A 2R5ZA 2HOTA 2DA6A 1FEXA 1YJNI 1EJ9A 5BPDA 1B1BA 2EIMH 2EH3A 3MKYB 1Y1VJ 4U7BA 1W36D 1G8XA 5FFXA 2K9MA 5F08A 4KISA 3BC8A 4I01A 9ANTA 1MBEA 2MC3A 2JN6A 4Q48A 5CQGA 3FDYA 1D8KA 2DODA 2L3DA 4G6TB 3OS0A 4I99C 4DJAA 1H9GA 2DQLA 3MCZA 2A05A 3I3LA 4XICA 2VPLA 2O8XA 4BUPA 1ZARA 1FTZA 2CV0A 4RAYA 1LDDA 1XGOA 5AONA 3C7JA 4A3DJ 3B6AA 3QPHA 1VQOI 1JE8A 3V8KA 4I2OA 1V5FA 4LITA 2ZXHA 3ZQIA 4KT6A 4S0HB 2STWA 4QPOA 1YS7A 4L9VA 2MFZA 2ZKZA 4U0YA 4C2UA 3RPUA 5ED4A 2VLAA 1RIOH 4HSTA 2BY3A 2ZMEC 1HW1A 4NUBA 2FD5A 2AHQA 2L2OA 2VQHA 3TGNA 2D5VA 5HDNA 2FNAA 2J5OA 2LRDA 2H09A 3VSLA 2E2JJ 4FASD 3Q5FA 3S3MA 1CGPA 2CSOA 2O5RA 2OD5A 2OBPA 3F23A 1MBFA 1SVMA 2OTLI 4A6DA 2CQNA 4YELA 3DEWA 2DA7A 3WGIA 3CCUI 1U2WA 4BE0A 3I55I 4E7KA 3KLOA 2HVSA 3ML6A 1IW7F 3UNGC 4A93J 3TOAA 5D8KB 5LGTA 2AQFA 1FSEA 1ZQ3P 2L4AA 2BY0A 3E6CC 1A6QA 3CMAI 1BBYA 4BEHA 4CHUA 3W3CA 4DW6A 4XN0A 4BXUA 1P92A 3M8JA 3P9IA 3OYKA 4IF4A 1E0EA 2IVMA 2HXOA 2Y9YA 5IY5H 4DYRA 2LY1A 1RI7A 2CQQA 3CLQA 4UB8C 3BCBA 4BNCA 1XG1A 5BMZA 2PJRA 1G3TA 3VDXA 5TJJA 3KYLA 1MNDA 1SVOA 3LL7A 3R0JA 3K70D 2PMZN 2KT0A 3QOPA 3ZXSA 1X3ZB 5B1AH 4EGZA 2HNHA 3PFIA 1P6RA 2F4OB 1Y0UA 4CGZA 2D1VA 3EYYA 3F6VA 3VFZA 3K4KA 5BOXA 2M7AA 1QNTA 3DU5A 4II2A 4XIDA 1K6YA 3BG5A 2VOPA 2L5QA 2HWVA 1V5EA 2WWYA 3CC7I 4XK4A 2PEXA 3HSRA 3SEZA 3ZCOA 1K78A 3R60A 3X2QH 1BL0A 4RLFA 4JYKA 4M9SA 2F5EA 4RM3A 2PG4A 3RCOA 2L9VA 1J7KA 4YIRX 5EGOB 2IGNA 2ZB9A 2L54A 2XKOA 4KIBA 4LGWA 3SFZA 5C4JJ 3QYFA 4I09A 4F92B 5FKKA 4DZPA 2EB7A 4B48A 1HSTA 2NNYA 1D8JA 1FSHA 4F91B 2B63J 1KZHA 2R93J 2K02A 1W1WE 3GUDA 1ZAOA 3F9KA 4XRMA 4AWXB 2ICWG 2QQ8A 3DLLF 5JLWA 3A0BC 1FYMA 1BIBA 5E1WA 2LC2A 4XORA 3E6DA 3L9FA 3OWTA 3LSKA 4MHGA 3HOXJ 2Z5UA 4OU0A 5KVRA 1VI0A 1HLVA 5LHGA 4MNUA 2ZXWH 4LG0B 3LQRA 2P7CB 4Q5SF 4V2FA 4IHYA 1R4MB 1Z7UA 1N25A 2R7VA 1QGPA 3GLXA 5K5OA 1JHHA 1YLFA 3PUBA 4H4KC 3FK6A 1RZ4A 1TWAJ 2HZDA 3I59B 3I53A 2ZJQF 3CCYA 5ILSA 3GTLJ 1BI3A 1S7OA 2EA4A 3L09A 4ZTJA 4KDPA 3FXUA 2M0CA 3CUQB 1ON2A 2EZLA 2F5CA 1ZK8A 2V9VA 3WTWC 3PQJA 2PMZA 3BR1A 1A35A 2DAOA 2K3FA 1J0RA 2OU2A 2VBZA 3L1PA 3VEPA 2HR3A 1VTNC 2DJIA 4N9HA 2JK3A 3ZQLA 1R1UA 1DQUA 1ULYA 5JLXA 3RZOJ 3J7AY 2XB5A 2RNGA 4PJLA 2DOAA 4M72A 2EINH 3GO5A 2F2EA 2XC7A 5DUKA 1TWFJ 3MQ0A 2G7UA 4LIVA 2O9LA 1UZCA 2PMUA 1PJRA 3DBRB 3V8JA 5ICFA 2ZFUA 3CZ6A 2FMLA 2RNJA 1I39A 4OIOF 4RAGA 5FKMA 2LR8A 2L7ZA 3K0LA 2YS9A 4NC6A 5J8FA 1MNMC 2YU3A 4FX0A 4KN4X 4AIDA 4BKXA 4I7HA 3IWZA 4EMSA 5TRDA 4IQJA 1SFUA 2VODA 3GXOA 1O4XA 2WBMA 2WTEA 1M1EB 1FBSA 1TNTA 2WAFA 2CUEA 2KFDA 2GAUA 2OCEA 3AKZA 3ABLH 1BR2A 1Z77A 2RV8A 3I64A 4XOPA 2YSRA 4HLXA 2R7UA 1HDPA 1MNEA 3PNTA 4LG3A 1SAUA 4NHJA 3L00A 3OYEA 2R7FA 4BQAA 3H92A 1FC3A 1WJBA 2XRLA 3DPTA 4L5EA 4W97A 2NVQJ 3O2PE 4IRGA 2IGMA 4UUVA 1ZYRF 4P5OA 4ABZA 4C3JJ 2HDDA 1KQ0A 1Y56A 4Y52J 3CUQC 4EJWA 1YE9A 2P5LC 2I10A 3HDDA 4DGWB 1BN5A 1CF7A 2VT2A 4U88A 1HSJA 3T1BA 3U1KA 3S16J 4GO1A 3S1RJ 5LFAA 2Z3YA 2LFBA 3G3ZA 2Y30A 1STZA 3H9JA 3TDZC 4B4CA 3D1NI 2RAEA 1UG2A 1UMQA 1T0FA 4QLCU 2F5VA 4XMYA 2LH9A 3I71A 5LGNA 2D2WA 2CWEA 2DMTA 2DO7A 1P7JA 2CH0A 2PJRB 2K9LA 1O57A 5J1UA 1TT5B 1PUFA 2BV6A 5M5WJ 1WJDA 3FBNB 4XLNF 5DCFA 1IDZA 4OINF 2M1BA 3DTKA 2FBIA 1Z7LA 5CVJA 3BR6A 1R71A 3OYGA 2GM4A 1HW5A 3BTIA 3LA7A 2KKOA 2YX7A 4ZYHA 4GXOA 5IP6A 2JUCA 4LLLA 1YW7A 5DUIA 3BTJA 1S5LC 3GFJA 3KP2A 3RTRA 1LB2A 1HCRA 2X1EA 4HDUA 3HGYA 3R4KA 3EUHC 3V42A 3HSEA 3PNVA 2MD5A 1RRJA 3A2KA 2IPQX 3FWEA 3M1CA 1K78B 2HQRA 2LP0A 2DDAA 2GLOA 1VQNI 4FHTA 1R58A 4I0AA 4CCMA 2HGCA 1JJ6C 2D45A 1TT0A 1YRNA 1SD7A 4XLHA 1RNLA 3IKVA 5DV5A 1K4TA 4YIFA 2DCEA 2FQ4A 3HB9A 3CO6C 4KN7X 5BQTA 1LEBA 4Q47A 4F55A 2YU9J 4BGDA 5IT9Z 4PCQA 5FFZA 2CW7A 2K86A 4NDLA 3HZJA 3W6KB 4YFXF 1R5ID 2IA1A 2W48A 1VQLI 5EF6A 1TWGJ 2MGQA 1D5VA 3I58A 2E19A 1D0XA 3E5UA 3JRIA 5FD5A 1XGNA 4LK0F 5H20A 3RKQA 3DXJF 4EGYA 4C3IJ 4KICA 3V7RA 5L3DA 2PLYA 2XGEA 5HLHA 2DT7B 1XGMA 4M3FA 2HYJA 4HQMA 3RYPA 5KHDA 1ZGAA 3SXYA 3EPZA 4KITB 2R4GA 5LHHA 2WV0A 2HKXA 2E1MC 3BG9A 3FHZA 2F48A 1U5TB 1AKHA 5IT9K 3WG7H 1I6XA 2DN0A 1P2FA 5LD2C 2PQ8A 1LKXA 4L5JA 1E17A 2A68F 2LTPA 5EZGA 2VKVA 4LIUA 2XKPA 5K7FA 4RB1A 3RSNA 3J81K 3BPXA 3KFWX 5HS9A 2ID3A 3AL0B 5JVGF 2HQNA 3KLNA 5B3SH 3WE2A 3ULQB 2M30A 3EETA 2F5FA 1XDUA 4J19A 2M87A 2NXNB 1V55H 1PP8F 4YIIA 1A04A 1YJWI 2R7ZJ 1T6SA 3TBIA 1U6GA 3CCEI 5F27A 4A6EA 5DD4A 2HVQA 4ON0A 1F43A 1X1PA 3ABMH 2EZIA 1W5CC 2NYXA 3MFKA 1Y39A 4RGRA 3U21A 2IJLA 4UXNA 4ENNA 1FWZA 2TDXA 2JSPA 3LSMA 3WU2C 2FEZA 2OA4A 2KIQA 1F4KA 1DU6A 1B59A 3GZ5A 1QPMA 1D5YA 2PJPA 2K3PA 2M9HA 4BJ6C 1HA8A 4L0YB 1RKWA 4RAZA 1RUNA 1SD5A 1MH3A 1JGSA 2IW5A 1WHUA 3D5RC 2ZSIB 1XMXA 2BYVE 4U7DA 4BE2A 2HPMA 3HTSB 4HF2A 3HIFA 3IP4B 1DP3A 2JRMA 4MFEA 2LREA 1KU7A 4IOAF 4XRSA 5FLVA 4B09A 4QWQA 1YO5C 4YRVA 4AYBN 3GFLA 3BCAA 2LKPA 1VQ9I 3AL0C 5D4SA 1ZKGA 2VC1A 1IDYA 2LDUA 5GP9A 2VJIA 1CF7B 1X1DA 2HI3A 1Y8QB 1T98A 3ZPLA 1A36A 2HOEA 1IN4A 3OS1A 2OZ6A 3DWLE 2DMUA 3OS2A 3WU0A 3C18A 5LRSA 1N77A 4HV6A 1HC8A 3T8TA 1FYLA 1WPKA 1JUMA 4WXCA 4RS8A 3HOVJ 5CQEA 2JRTA 2P5KA 1NHAA 1FPQA 1USTA 3KYDB 5C3EJ 1YW8A 1PDNC 5L3GA 3H3VK 3REOA 2VKEA 3SYTA 3TKYA 4EJUA 2E2HJ 4M73A 4D1QA 1PUFB 2LYCA 1P4XA 3WTZA 3MMYB 3KP5A 3BDDA 1MSFC 1Z6RA 3T5XA 2RREA 1FOXA 2X1DA 2KDOA 4YG2F 3O6BB 1RKTA 2EA2A 2LG4A 1IRXA 2JSCA 2GZWA 2MH2A 3PO2J 1XGSA 2EPFA 3LNQA 4IHWA 1E3HA 1SMYF 3OYCA 3H3UA 3KEQA 2BEOA 2MW8A 5HOOA 4MIMA 2OTJI 1BI0A 1WQ2A 2L0KA 5ILUA 4M3GA 3CO7C 1R1VA 3CP8A 4LFUA 4CH7A 2COMA 3AG3H 3ELKA 2LVSA 1SVLA 2G0EA 3OYHA 1YYVA 1QZZA 2F6CA 1YRNB 4I02A 1YJ9I 2VONA 2KL4A 1FP1D 5IP9J 4IHSA 1IRFA 1JTXA 4NB5A 1U78A 4ZDOA 2JA5J 4HLYA 2MLKA 1O7FA 1ON1A 2O03A 4B8XA 4RM2A 3E5QA 3WU1B 3LSRA 1VF9A 1MBJA 1IGNA 1QVUA 5GTIC 4AYBA 1T0FC 4C3HJ 2Z33A 2VIXA 2LLKA 1D0ZA 4IO9F 4EM0B 2LD5A 3M4OJ 4FTHA 1MJ9A 1HQCA 2WAQN 1W0TA 1EA3A 2VKDA 3P9CA 1U9OA 4NC8A 4HAMA 2RKHA 2QKLB 4CCJA 2CG4A 2O7OA 4IL6C 1XMAA 4V19K 5CLSA 3CCLI 3BR2A 1WCMJ 4D5CA 5CVIA 3NARA 4PJNA 1AKHB 2X4HA 1OFCX 4HG2A 1NK2P 1U3EM 3JRGA 1TC3C 1PVEA 5J4YA 1P9QC 2ME0A 5DCMA 4B44A 4YFKF 2F5DA 1XDSA 4LMYA 4IHTA 4N0BA 1OCTC 3MEXA 2QBYA 3FXJA 3JRFA 3FXLA 3ZQQA 4D7MA 1NG6A 2DFIA 3Q9VA 3HM5A 4NBQA 2MA3A 1IAWA 5CVUA 4ANJA 1OLTA 2DOEA 2OUMA 4G7ZF 2R3SA 3CESA 1UJ8A 1R1TA 5ICCA 1Z3XA 5D5WB 4IRIA 5DS9A 3M8FA 3MZHA 1POGA 3F22A 3R6SA 2LBFA 4XR6A 2RGVA 1J5YA 4N4NB 2Z9OA 1P7IA 1BJAA 2R7OA 4A3LJ 3CMYA 1XS9A 3SZTA 3ZMVA 2KQRA 3PIOF 2LF8A 2DYSH 2O3FA 4W1UA 3J7ZI 1BW5A 3S32A 1OYWA 5DM7F 4RMNA 3J7YJ 1DU0A 4IHVA 3ZMUA 1FNNA 4E7ZA 2MC4A 4TV7A 1BR4A 1WFXA 3L2CA 2QQAA 1ZGWA 4D9JA 5LEKA 2Q1ZB 1UHWA 4Y4RA 2E1CA 1S72I 1XSVA 3NQOA 4FCYA 3K70C 1IRZA 2QUFA 2WAQA 4BY1J 2V1DA 2VC0A 2HDWA 4L9NA 1FYKA 1FBUA 4PJJA 3RKXA 3RQIA 4E7SA 3E7LA 2FMYA 2ADUA 5GAEJ 5EEGA 2VE9A 1B8IA 2E5NA 3I54A 1X3WB 1TQMA 3EUAA 4ZZLA 5D4RA 4BU2A 4JP0A 4HNVA 4IOCF 4UHTA 4B1RA 2VT3A 3RI4A 2XAQA 2LOOA 5KNLA 3F6OA 3K2AA 1ZLKA 5CKTA 2IXSA 1FIPA 2FJ1A 3TEDA 2NVXJ 1LDKB 2DA5A 4C2TA 2XF6A 1OPCA 1A6IA 2Y31A 1Y1WJ 2Z1DA 1XC5A 2XSJC 1H88C 3HUGA 2VOOA 2QYOA 3EUHA 4JX4A 2LK2A 2R7TA 2IS6A 1ZRFA 4KUMA 5FO5A 2XGXA 3S1QJ 4G12A 1D1CA 1KU3A 1VQ6I 1VFCA 2HFHA 1DDNA 2VKHA 4CYDA 2K4BA 1JT0A 5EYRA 4CA0A 1R36A 3CCSI 3JW4A 4BDZA 1Z9CA 2BBYA 3WHCA 3RJPA 4HZFA 2Z16A 2DBBA 4XNFA 3E1SA 5J6XA 4EEFG 1XCBA 2XROA 1YFHA 4JK1X 4BDYA 2DLLA 3ISPA 4X0GA 1OCPA 1BC8C 3C2GA 3WHBA 1BM9A 2F4MB 1YW9A 3TW7A 1O3QA 3HOUJ 1V3FA 1EH8A 2BOLA 3F0CA 4PJMA 5DEQA 3S8PA 4ZTFA 1MMSA 3COAC 3P7NA 1TNSA 1XTAA 2DPUA 1ETWA 3QP5A 4UVBA 2DYRH 2IEKA 5K1YA 3LSPA 2KP6A 4U0VA 3K4MA 2OC6A 4WK8F 3VYTB 1FBQA 4C9YA 2R7SA 1Z67A 2VASA 3IRRA 2EILH 4ENKA 2KIFA 5J47A 1W7PA 1IG7A 2V1NA 2DFHA 1S6LA 1O7LA 4UUSA 4GFBA 3W6VA 1G3YA 2R7QA 4S05A 2GIVA 1IJWC 4E7HA 4OMYA 5E1ZB 1MJAA 1WKMA 1IXRC 4HW0A 1G4DA 4UNOA 3BG6A 1IO2A 3FXQA 2NS7A 4G6QA 3W2WA 1I1SA 2Z99A 4ZC3A 2KJBA 3IL2A 3JRDA 2QWWA 2ACJA 3IAM2 3HRSA 1T56A 1W5SA 2EK5A 3BR5A 5B5EC 3KE2A 2DFEA 4A3IJ 3U1DA 3ZRGA 5CJ9A 1OCCH 3E3VA 2HDCA 1X2NA 3GF2A 1ZREA 4KJZA 2VQLA 1TP4A 4WCGA 5A2QZ 5HDGA 1KONA 2XV4S 1K79A 3QU6A 1Z1DA 3BTCA 4HA8A 1VQ4I 5F1RA 3QU3A 4ZZDA 2HXIA 4A3JJ 1XSXA 4UV9A 5DTDA 3DKWA 2HQAA 3TMOA 2LBFB 4M9XA 4IZZA 4F7ZA 2BHYA 4L0ZB 4HV5A 1Q1VA 2DDBA 4GYGA 2KZGA 2V9KA 4Y13A 2QEXI 4DIQA 1OMIA 3FF5A 5LRRA 2DT5A 2M34A 5JR3A 1EH7A 4XM3A 4LLNA 1OISA 1SFKA 3QQAA 5EJCA 4XLPF 2R5ZB 5M5XJ 2M8EA 3MKZA 2FQ3A 2ZCWA 4CCKA 1IZ1A 1Z0XA 3BPVA 3Q0WA 4WF2A 1JXSA 1WJEA 3TO9A 4BL0B 2JUGA 2JVGA 2VB6A 5KAIC 4MTEA 4J00A 4V2GA 1D1BA 2KHMA 2XUBA 3ERMA 3G1OA 2LKXA 3HHGA 4R8HA 3LMMA 4RGSA 2IP2A 2ESNA 3ECHA 2MG4A 1ETKA 2UXNA 3CJQB 1GT0C 2EV5A 2DI3A 3AG2H 4JOMA 3PIPF 2OF7A 3NEUA 4BYYA 3AG4H 3FMQA 3FXRA 1A31A 2ZNYA 3IAS2 1TWHJ 2A61A 1WI9A 4KIFA 4UVAA 3RQ4A 1B8IB 3GFMA 3H35A 4HPQA 1B6AA 3O3KA 3GZ6A 3RIRA 4EVIA 3ZMZA 1WJCA 1FT9A 2KPMA 1RR8C 3VOEA 4HX8A 5L3FA 1XN7A 1IV6A 1XPXA 4LOCA 2BXYA 3BOQA 1RUOA 4B43A 4KA4A 3HUGB 2KDZA 5DM6F 2UV1A 2JWTA 3JREA 3OYFA 2A5YB 4K2EA 1NG7A 1WH5A 2ELJA 2QSHX 3M07A 5FRNA 1IUYA 2KRHA 1BA5A 3S17J 1BR1A 1FP2A 3RDIA 3HXLA 2Y9ZA 1MBKA 1BIAA 4QTRA 4BXFA 4IEJA 3G73A 3OIQA 3HPGA 3LSIA 2X48A 2ETHA 2H27A 5GTHC 2Y75A 1SFOJ 3CUOA 1LVAA 3N97A 4BEHB 3BY6A 2XGCA 4EJVA 3Q0UA 2FRHA 5LBQA 4GCVA 5L3BA 1H8AC 3U9GA 3HG9A 3ZOBA 1ETYA 2AQEA 5B1BH 4CDGA 3JRAA 2O6GE 2FBHA 2EFWA 3A01A 3E6MA 3KEYA 3FXOA 3O8HA 1FOYA 2E1MB 1W7PB 2K4JA 1MMAA 2W4SA 3FKJA 5JI6A 4Q4ZF 3S15J 1LNWA 3N4MA 5EEAA 1HKSA 3CC2I 2E2IJ 5M3FJ 2QSGX 4UUSB 3IKTA 1KU9A 3FX3A 2E35A 4XBFA 3CLOA 1YIOA 5JHUA 4A3GJ 1T08B 1MIJA 2BY2A 3OR1C 1R49A 4BBSJ 3FISA 2GOMA 2IA0A 2CQXA 4EATA 3L2RA 2BZTA 2A3SA 2ESHA 1R00A 5HS7A 1WJ5A 3ABUA 2L9SA 4ZYDA 2Y69H 2CU7A 2BE5F 3U2RA 1GVJA 3KX2A 2F4IA 3HC7A 3V7SA 2OPTA 3ERED 2RQPA 3GW2A 3DEUA 4MLOA 3EDPA 1TQIA 3SHFA 4A0ZA 4MEXF 2E5ZA 3CMEI 1E3OC 2XAHA 3QYEA 2W25A 4ZDPA 2OV7A 3Q9SA 4L9JA 3OYLA 3PL8A 1ZG3A 1U8BA 5IPAA 1OQYA 2TCTA 4RB2C 2BVLA 1KA8A 3K4CA 3L7WA 3J80Z 4XRSG 3ASNH 4OAZA 1U0JA 2GOXB 1S7EA 4ENJA 2UWMA 2V79A 2IGOA 1IRGA 1GHCA 5D5XB 4AM3A 3HHHA 2B9SA 2E36A 3OL4A 2ZO4A 2GBYA 4JQFA 4FT8A 1KQ9A 3JSPA 4E6KG 1Y8RB 1FX7A 1OYIA 4BE1A 3VWBA 1X1AA 2H94A 3K2ZA 2A5WA 1U9NA 5CYVA 2A69F 3CDLA 3G6EI 3QPTA 3CD6I 5LHIA 5DYMA 4A0YA 1KU2A 2O0YA 2H1KA 4HX4A 1Z21A 2DMPA 1QBJA 3WGGA 4D0PA 2FXAA 1LE8A 2MH9A 2M3AA 2DW4A 2R0QC 1S8NA 2NAZA 3K1PA 5CPRB 1SMTA 3S2HJ 1LFPA 1KYZA 3S3NA 4X1EA 3ZR8X 2HYFA 5BNGA 3LFKA 4XKCA 3VB2A 2FOKA 2FNPA 2A07F 2JA8J 2VI6A 5DDGA 1X19A 4CCOA 5E3LA 4XL9A 2ELHA 5E3NA 1VQ7I 3NWSA 4D7NA 4KMUX 3FM5A 1OYYA 1F9NA 4XLCA 4EV0A 2EZHA 3ESWB 3CTAA 3V7CA 4DYCA 4IKFA 1O3TA 4XSZF 1XSDA 2OZUA 5E8GA 4A3CJ 1Y0NA 1WSUA 4E7IA 3ZN0A 2CFOA 2W1OA 4R1HA 3GMEA 2NVYJ 3HYIA 2LF7A 2R7XA 1DPUA 1B9MA 5HNFA 3HOWJ 1KQ8A 2DOFA 1T38A 1SD6A 1V54H 3M3YJ 3FKIJ 4M71A 5FLXZ 1J2XA 2VQCA 2BHZA 3FK7A 3G1LA 4ESJA 3K4BA 5CVVA 4F93B 1JGGA 4IPAA 1FIAA 1VQPI 2KRCA 4M74A 1XB4A 2HQ5A 2WY7Q 1UELB 1FTTA 3E6BA 3KPHA 5M5YJ 3TW6A 2VJ4A 3ASOH 3ZP5A 3S2DJ 4LK1F 1R9TJ 2QKMB 2JMWA 2D1HA 1HW2A 3OYDA 3FZVA 4A3BJ 2CQKA 5H6RA 4U0WA 4HYEA 4MQ9F 4A3MJ 3E97A 4I76A 2EFNA 3GTPJ 5FLXK 1IN6A 1DUXC 2VQGA 4CZCA 4BY7J 3GCMA 3IH2A 3WGHA 1ZHFA 2LY2A 3H9QA 3KP3A 3GTQJ 1MDMA 4EM2A 3I0TA 4HF0A 5FROA 3MWMA 4M9ZA 4OMZA 5FKOA 2ISYA 4B3AA 2X6OA 2ME6A 3ECOA 2W24A 5E3OA 3DEEA 3RKWA 2QQ9A 2XASA 3P9KA 1WI3A 5ILVA 3S1NJ 1GV2A 1QO0D 3DPLC 1OJLA 1OCOH 2E1NA 3ZGKA 4ZYEA 3ZMTA 2W7NA 2B0LA 3A01B 2Y0SN 1QHGA 3KP4A 5E3MA 3TOBA 3F21A 2JPBA 2XF5A 2HEOA 2K40A 1GV5A 1MKMA 1YIJI 3HPHA 5E20A 3JCUC 4P1WA 4AIHA 2XRNA 1QZEA 3T0YA 3G2BA 3GTOJ 3K1MA 2M4GA 1GXPA 2P6SA 4A3FJ 2GXBA 4BQNA 2ID6A 1MSEC 4ESFA 2B7EA 1NH3A 1IXSB 2X9DA 3IH4A 4BJTA 4WWCA 2XHKA 4XKBA 4EM1A 5LGUA 2DK8A 2IA2A 3DQVC 4BAYA 2YR2A 1FMWA 2RVCA 3K7AJ 3KIOA 3FXMA 3CCVI 1BI1A 3HKZN 4EJOA 2DFFA 4ETSA 2HVRA 3ZQHA 1SC7A 1VNDA 2YUSA 3BJAA 3F72A 4OAYA 4RB0A 4GYIA 4MQVA 2IS4A 5JHFA 1AOYA 5HVQC 5FD6A 1MMDA 1MMGA 3FMRA 2DT6A 4I6ZA 3VYUB 4ITVA 5KCMA 4BQQA 1W36C 2X85A 1IUFA 3W2AA 1N78A 1ZLJA 3OIPA 1KYWA 5BPIA 4DOZA 1JJ8C 5IOYA 4G9YA 2JJ7A 1S9HA 4II3A 3WTYC 1GXQA 1TBXA 4PFOA 1B9NA 2P7VB 3OL3A 3OYJA 1UHSA 1JKRC 1K4SA 1MZBA 5J1RA 4PDKA 1J9IA 4M6VA 2L01A 3QAHA 3OSGA 1V5GA 3E0JB 1LE8B 1YQAA 2I5UA 3WTVC 1TZLA 1WJAA 5H6QA 2ZJPF 4UUTA 1UCRA 4UB6C 1T8IA 4BQOA 2OJED 2M2EA 4HX7A 2Y0SA 2AXTC 1G2HA 4BXXJ 2P0WA 4FX4A 2DTRA 2EJRA 3Q0VA 2Y0MA 3I4PA 4HRIA 2BVMA 1SD4A 2ELKA 3L2UA 2V7FA 2A6EF 2NS8A 4M6XA 3ZN1A 1WH7A 2XAJA 3K10A 2VL8A 1USSA 3FBIB 4XLFA 5L3CA 3LAJA 1MMNA 3K4NA 1XMKA 1R7JA 2BW3A 1FY7A 2QLZA 2ZC2A 5JVTA 1T2KA 1ACIA 5J3LA 3H5NA 3OR2C 4LB5A 5BS6A 2ZXIA 3VSKA 2P81A 3LAPA 4RB3C 5CVRA 4AIKA 1K61A 4O5VA 1T33A 3HKZA 3OIOA 3QOEA 5E79C 4R79A 4LLGF 4D5FA 1F36A 3PM1A 4IRHA 3J7AO 1AA7A 2XAFA 1QA6A 3T8RA 5IP7J 4HDVA 2GXAA 5FGMA 3ZMDA 2KISA 5IOZA 2DPDA 2FBKA 3BLYA 1NK3P 4ZJZA 2QGUA 2M4KA 4J01A 3P5JA 2ZJ2A 2A6TA 2CS3A 3K6GA 3QWLA 3WE3A 3AAFA 4QIWN 2MD0A 4WXDA 1ETOA 1UFMA 3ZQGA 2R7WA 2R7RA 3HRUA 3GTKJ 4AIJA 4ASNA 2IAIA 4RGUA 4RGXA 2M5WA 3DKYA 5HLGA 1JI8A 1SAXA 2K9SA 3BQYA 2JT1A 1LDJA 2X1CA 2CUJA 3GZNB 5D8LB 4PFPA 1WZ2A 1P4WA 3HL2A 3KZZA 1ERDA 1DGWY 4GDFA 2CYYA 5D6EA 3G71I 5DD8A 1G59A 5E8IA 2QM3A 1MDMB 4F52A 3FIWA 2MYSA 3I56I 2ISZA 3CCRI 2O8KA 3BT9A 1K6OA 1GUUA 2N8GA 3K9TA 3MVPA 3DP7A 3QYBA 1D0YA 3JR9A 3GWZA 2DQRA 1LJ9A 3KETA 1ITYA 2VE8A 2QVOA 2QQBA 2DA1A 1B4AA 2XVCA 3GLLA 3OYMA 5L3EA 1B72A 2X6YA 2ECBA 4JBAA 4RAFA 1RPWA 1VQ5I 3IHUA 1FMVA 3HSFA 3C3WA 2CV1A 1J75A 2VXDA 3O8GA 4ESBA 1UAAA 2HTSA 3R61A 1G3WA 2DJNA 5IYBJ 4HNUA 2CQ7A 5F0HA 2ZXJA 3AG1H 2TRTA 4C2MJ 3CJRB 5FLMJ 2HKOA 2HZTA 4N4OB 4OIPF 4G7HF 2XPVA 4XQFA 3S14J 1BJZA 4QSHA 4L9TA 1DGRM 2DU9A 1X1BA 4M3BA 5EDNA 3CMMA 3C2HA 3PJRA 3L2QA 2WAEA 3HGGA 5HDKA 4BHBA 2ZSHB 2PMHA 3B73A 1IN8A 2FF4A 2FA5A 5ICGA 3H0GJ 3H5RA 1R23A 5GPCA 3HOZJ 3CJTB 1JKPC 3UR3C 2V1UA 1G6NA 3SQNA 3BZCA 1WGXA 1YX5A 1Z05A 2XF7A 4DBRA 3WTUC 4IX7A 3ROUA 2C6YA 4PSXA 1YX3A 4UVCA 2WY8Q 3CDIA 5D6FA 5B66C 3CDHA 3EQLF 3VPRA 1IC8A 5E17F 5FB2A 2VUMJ 3MKWB 2P6TA 2O61A 3ABKH 4FQGA 3SZGA 1OR7A 3LQQA 1YTYA 2V6CA 1T39A 3BTLA 1I27A 2K5CA 3DBHB 2YPRA 4IHXA 1LFUP 4NQWA 1TQPA 5GAGJ 1Z91A 1ZG5A 1HKTA 3ONQA 1XCVA 1C0WA 3M8EA 5DCMB 3F8BA 2HU9A 4CUGA 3OMYA 2QBYB 1BC7C 1ZG1A 2DMQA 5JFRA 1ENHA 3GVAA 2GA2A 1I50J 1HXDA 3HJEA 1Z3YA 5EG0A 4G6DA 3PUFA 4M3EA 4O3MA 1EH6A 2E60A 2VBXA 2HS5A 3LSHA 3FHNA 4AU7A 2FOWA 4A0XA 3TO7A 4M3DA 4Y3OA 1YITI 2XAGA 4L5IA 4XKVA 4Y17A 3HRMA 2NVTJ 1YHQI 3E5XA 1VQMI 2BW3B 1UHMA 2V1XA 4RLQA 1YS6A 3G1MA 4E7LA 2NNNA 3HTUA 1FZPB 1W5TA 4RA2A 2GWRA 1T95A 1R5GA 1WRJA 3CCJI 2DTZA 4PZJA 1EKEA 4HBLA 3A03A 4PK4A 3GYHX 4CXFA 1U5TA 2BXZA 1YG2A 5A2QK 3EUKL 1YOVB 1LUJB 3F8MA 5IYCJ 4CCNA 3JAMZ 1FOWA 2EIJH 5H2FC 3CC4I 2EQRA 1RR7A 3LFUA 3BP8A 4MFDA 2QF7A 3JTHA 4S04A 2Z2SB 2WB1N 2X51A 1ZRDA 3DLAA 2VBYA 1R22A 3RZDJ 3BJ6A 4OIRF 4EQQA 1X1CA 2MABA 2OQGA 3H0DA 3LA3A 2LNBA 4CZZA 2DMNA 2CV2A 1ZGJA 3CJNA 3Q3SA 4ZYAA 3GFIA 4P55A 1EF4A 2RQQA 5E18F 3H1CA 3WTXC 3WTTC 3KP6A 2K9QA 2FX0A 1OCRH 3JAMK 3KZYA 4P9FA 1TW2A 2Q2EA 3C2BA 3OYAA 2UUZA 2XGDA 2HOSA 2EFOA 1W4MA 2KZVA 4AVZA 3IRQA 5M3MJ 1PUEE 4CYCA 4Y33A 1X2MA 3DFGA 3CCMI 1S29A 1NTCA 3OYNA 1JHFA 1E2XA 2CW8A 3SEQA 3ABTA 2COBA 3D5SC 1B72B 4BS9A 3WG9A 1I3QJ 1XX5A 3JRBA 2NVUB 3A0HC 2CMPA 3F3XA 1JUPA 2BGCA 1SFXA 2DA2A 2QCOA 5FRMA 1VZ0A 4CCLA 1RC9A 1ETQA 2HPIA 2V9PA 4WXHA 1FLIA 4HEA2 2JPCA 4Z6YA 2M8GX 1MBHA 2PX9A 5GPAA 2L9RA 2LMDA 3BZ6A 1OCZH 1MH4A 1IV8A 2OCCH 4NNJA 2CUZA 3QRFF 3JTGA 2DA3A 3DKXA 4U87A 3SFIA 2XIGA 5FKNA 3BG3A 3MZYA 1TW3A 3BJOA 3DTEA 1X4OA 4KFCA 1HDDC 1ZR2A 4ZH4F 2QSFX 5J4VA 2W84A 3CF2A 2EIKH 2XAUA 2K27A 2L7MP 2WB1A 2P8TA 2W00A 4QPQA 1H9TA 4XSXF 2JA7J 2VN2A 4LJZF 3TP0A 4AD9A 1TTYA 1L0OC 3OYBA 2CJJA 1AHDP 2ZBKA 2IBDA 4PSWA 3CQZJ 5D5VB 3SJMA 1PP7U 1LQ1A 3LSGA 5TGTA 2L7KA 5EZHA 3KP7A 5GADJ 2FSWA 3BG7A 1DPRA 1A5JA 4E7JA 1R5HA 4PGGA 2M7BA 1J59A 2V6EA 4A3EJ 4RDUA 3FM3A 4G7OF 2CGPA 2Q8KA 3A1YA 2VBWA 3BZKA 4NQWB 4RBOA 2JA2A 1QQIA 2HOAA 3DPUA 2EBIA 2JA6J 4HOBA 3JRCA 5C4XJ 1V4RA 3FMSA 4E4HA 3F8FA 4MO7A 2UZKA 1G3SA 1AU7A 3H3ZA 5J1YA 2RN7A 2PN6A 2M0MA 3LSTA 5HODA 2XSDC 1F5TA 1D1AA 3H9GA 4G8XA 3GTJJ 4XRFA 4AVPA 4PUSA 1AWCA 4AUXA 4UY8I 3A4CA 5EG0B 2XB0X 2EZKA 1I1GA 1UG0A 4A2UA 2WC2A 1HKQA 2LSOA 1IF1A 1MBGA 2BY1A 4G94A 2WADA 2M45A 3BR0A 2DA4A 3HRTA 4XONA 3OOPA 3DCFA 1ORKA 3ZQ7A 5ICEA 3J81Z 2VJJA 4PJ0C 1O3RA 1IN7A 2E34A 1ONVA 3J80K 2ECCA 2PBIA 2Y2ZA 3IC7A 3HOTA 1WJFA 1W0UA 2EFPA 1BOAA 4BHPA 2R92J 3LA2A 2KMUA 2LY9A 4GRIA 2DK5A 2LKSA 2VJ5A 1JKQC 4HF1A 2I8DA 4CO8A 1GLNA 4F3QA 5GAHJ 3IWFA 5TISC 5J40A 4BBRJ 1TWCJ 4XOTA 5K7ZA 1OR7C 1MW7A 4NC7A 4IQ4A 3OSFA 2UXXA 2R5YA 1REPC 3L2VA 2NRAC 3IV5A 3ZQFA 3QP6A 4B47A 3BR3A 3C1DA 3I5UA 4OIQF 4O6JA 1SFEA 3NWTA 3W2VA 1TLHB 5KK1A 3M1EA 1EV7A 3KYCB 4ZDLA 1OKRA 3RPUD 2IS1A 1QZYA 5IT3A 3S93A 2CRGA
chains in the Genus database with same CATH topology
4A12A 4MGRA 3JSOA 5E1XA 2X0LA 1LEAA 2MLGA 5D5UB 1XD7A 3DF8A 1U8RA 3DV8A 5J8CA 3KEOA 2ZMEA 3W6JB 2R7DA 4ZYGA 1IN5A 5ERIA 3M9AA 2STTA 4P96A 2HYGD 1MJBA 4WX9A 3VODA 1ZRCA 1S7AA 3TDUC 4N9IA 2AS5F 4BHCA 1U5TC 5HS8A 6PAXA 1HBXG 4KYWA 3V4GA 4A5NA 1BI2A 2E7XA 5AIQA 2CFXA 3WTSC 1W7PD 5LLQA 2FE3A 5K5RA 4P9UA 2P4WA 2PI0A 3D0SA 4M6YA 2QENA 1H0MA 3D5LA 2NS0A 4DNCA 4Y15A 5LEJA 1FOKA 2OAZA 3K69A 2GQQA 1MGTA 4KMFA 5K5QA 4YFNF 4IXAA 2E7WA 2W57A 3SZPA 2K7LA 4MEYF 4I98B 2YX4A 1S3JA 4DQ2A 4KNYA 2AXLA 2EV6A 1WWXA 3ZMSA 4Z2YA 2KJCA 2G9WA 4GGGA 2CW0F 4EJTA 2ZFWA 1I5ZA 5F64A 2H6BA 4LB6B 3KCCA 3BROA 5AIPA 1DP7P 1X3UA 2VXZA 2PFBA 3GX4X 1ZH5A 1KGSA 3WODF 3LWFA 3BWGA 5F6FA 3V8LA 2J5PA 4IJAA 4LD5A 2L02A 5EEHA 2KIMA 3OV8A 2GA1A 3S2WA 3PQKA 1Q1HA 4MTDA 4HQEA 2EWNA 2QZ8A 1ZN2A 1D3YA 4IVNA 2KIUA 4I0BA 3GEZA 1Z6TA 2KRFA 3R0AA 1K7AA 1MD0A 2IT0A 4L18B 2MBFA 2RC4A 3RKYA 2Y48A 3TO6A 4ENMA 4E70A 2L4MA 2A6HF 2GXGA 4CICA 3EYIA 4H0EA 2HTJA 2EFQA 1F1ZA 5HLIA 1IXCA 3RPQA 4UV8A 1ODDA 2Q0OA 2IRFG 2FU4A 4OOIA 3F8CA 3NRVA 2G7HA 2W85A 2H6CA 3RYRA 2JTVA 4LG0A 3F8NA 3K1NA 2RDPA 2OQRA 4PGHA 2ZMEB 1P4AA 3I59A 4A5MA 3B02A 2EV0A 4KT5C 1O3SA 2JZYA 3MAJA 3M7GA 1L3LA 2ZNZA 4BH9A 2P5VA 3CUQA 1UB9A 4KIGA 3HOSA 3TQNA 2CO5A 5BPDA 1B1BA 4U7BA 5FFXA 4I01A 2MC3A 4Q48A 1D8KA 2L3DA 1H9GA 2DQLA 3MCZA 2O8XA 1ZARA 4RAYA 1LDDA 1XGOA 5AONA 3C7JA 3QPHA 1JE8A 4I2OA 3V8KA 2STWA 1YS7A 4L9VA 2ZKZA 4U0YA 3RPUA 5ED4A 1RIOH 3TGNA 1HW1A 5HDNA 2FNAA 2J5OA 2H09A 3Q5FA 1CGPA 2CSOA 2OD5A 2OBPA 3F23A 4A6DA 3WGIA 1U2WA 3KLOA 3ML6A 1IW7F 3TOAA 5D8KB 5LGTA 1FSEA 2L4AA 3E6CC 1BBYA 4CHUA 4BXUA 1P92A 3P9IA 4IF4A 2IVMA 1RI7A 4BNCA 5BMZA 1G3TA 5TJJA 3R0JA 3QOPA 4EGZA 3PFIA 1P6RA 1Y0UA 4CGZA 2D1VA 3EYYA 3F6VA 3VFZA 5BOXA 1QNTA 2VOPA 2HWVA 2WWYA 2PEXA 3HSRA 1K78A 3R60A 4M9SA 2F5EA 2PG4A 1J7KA 2L54A 2XKOA 4KIBA 4LGWA 3SFZA 4I09A 2EB7A 2NNYA 1HSTA 1D8JA 1FSHA 2K02A 3GUDA 1ZAOA 4AWXB 1FYMA 1BIBA 5E1WA 3E6DA 3L9FA 4MHGA 2Z5UA 4OU0A 5KVRA 5LHGA 4MNUA 4LG0B 3LQRA 2P7CB 4Q5SF 1Z7UA 1QGPA 5K5OA 3GLXA 1JHHA 1YLFA 1RZ4A 3I53A 3I59B 5ILSA 1BI3A 1S7OA 2EA4A 3L09A 4KDPA 3FXUA 3CUQB 1ON2A 2F5CA 3WTWC 2V9VA 3PQJA 2DAOA 1J0RA 2OU2A 2VBZA 3VEPA 2HR3A 1VTNC 4N9HA 1R1UA 1ULYA 4M72A 3GO5A 2F2EA 5DUKA 3MQ0A 2G7UA 2PMUA 3V8JA 5ICFA 2FMLA 2RNJA 4OIOF 3K0LA 5J8FA 2YU3A 4FX0A 4KN4X 4EMSA 4I7HA 3IWZA 5TRDA 1SFUA 2VODA 3GXOA 2WTEA 1FBSA 1TNTA 2GAUA 2RV8A 3I64A 2YSRA 4HLXA 4NHJA 3L00A 4BQAA 2R7FA 3H92A 1FC3A 3DPTA 3O2PE 4IRGA 4UUVA 1ZYRF 4P5OA 1KQ0A 3CUQC 4EJWA 2P5LC 1BN5A 1CF7A 2VT2A 4U88A 1HSJA 3T1BA 4GO1A 2Z3YA 3G3ZA 1STZA 3TDZC 1T0FA 4QLCU 3I71A 5LGNA 2D2WA 2CWEA 2DO7A 1O57A 2BV6A 4XLNF 5DCFA 4OINF 2M1BA 2FBIA 5CVJA 1HW5A 3LA7A 2KKOA 2YX7A 4ZYHA 4GXOA 4LLLA 1YW7A 5DUIA 3GFJA 3KP2A 3RTRA 1LB2A 4HDUA 3R4KA 3HSEA 2MD5A 2IPQX 3FWEA 1K78B 2HQRA 4FHTA 1R58A 4I0AA 2HGCA 2D45A 1SD7A 1RNLA 3IKVA 5DV5A 4YIFA 3CO6C 4KN7X 5BQTA 1LEBA 4Q47A 5IT9Z 4PCQA 5FFZA 4YFXF 2K86A 3W6KB 1D5VA 2IA1A 3I58A 3E5UA 5FD5A 1XGNA 4LK0F 5H20A 3DXJF 4EGYA 4KICA 3V7RA 5L3DA 2PLYA 5HLHA 1XGMA 4HQMA 3RYPA 1ZGAA 3SXYA 5LHHA 2WV0A 2HKXA 3FHZA 1U5TB 5IT9K 1I6XA 1P2FA 2PQ8A 4L5JA 1E17A 2A68F 2XKPA 4RB1A 3J81K 3BPXA 3KFWX 5HS9A 2HQNA 3KLNA 3WE2A 3ULQB 2M30A 3EETA 2F5FA 1XDUA 1PP8F 2M87A 4YIIA 1A04A 1T6SA 1U6GA 4A6EA 5DD4A 4ON0A 2NYXA 3MFKA 4RGRA 2IJLA 4UXNA 4ENNA 1FWZA 2TDXA 2FEZA 2OA4A 1F4KA 1B59A 3GZ5A 1QPMA 2PJPA 4L0YB 4RAZA 1RUNA 1SD5A 1JGSA 2IW5A 3HTSB 2BYVE 4U7DA 4HF2A 3HIFA 1KU7A 4B09A 4QWQA 1YO5C 3GFLA 2LKPA 5D4SA 2VC1A 2LDUA 1CF7B 1T98A 3ZPLA 2HOEA 1IN4A 2OZ6A 3WU0A 3C18A 5LRSA 4HV6A 3T8TA 1FYLA 4WXCA 4RS8A 2JRTA 2P5KA 1USTA 1NHAA 1FPQA 1YW8A 1PDNC 5L3GA 3REOA 4EJUA 3TKYA 4M73A 1P4XA 3WTZA 3KP5A 3BDDA 1Z6RA 3T5XA 4YG2F 3O6BB 2EA2A 2JSCA 2GZWA 2MH2A 1XGSA 1SMYF 3H3UA 3KEQA 2BEOA 5HOOA 1BI0A 1WQ2A 5ILUA 3CO7C 1R1VA 4LFUA 2COMA 3ELKA 1YYVA 1QZZA 4I02A 2VONA 1FP1D 4IHSA 1IRFA 4NB5A 1U78A 4HLYA 2MLKA 1O7FA 1ON1A 2O03A 4B8XA 3E5QA 3WU1B 2Z33A 4EM0B 1MJ9A 1HQCA 3P9CA 4HAMA 2RKHA 2CG4A 1XMAA 5CLSA 5CVIA 2X4HA 1U3EM 5DCMA 4YFKF 2F5DA 1XDSA 4LMYA 4IHTA 4N0BA 3MEXA 2QBYA 2DFIA 3Q9VA 2MA3A 1IAWA 5CVUA 4G7ZF 2R3SA 1R1TA 5ICCA 5D5WB 4IRIA 3M8FA 3MZHA 3F22A 3R6SA 2RGVA 1J5YA 2Z9OA 1BJAA 3SZTA 3ZMVA 2LF8A 2O3FA 1OYWA 3ZMUA 1FNNA 4TV7A 3L2CA 2QQAA 5LEKA 1UHWA 2E1CA 1XSVA 3NQOA 2QUFA 2V1DA 2VC0A 4L9NA 1FYKA 1FBUA 3RKXA 2FMYA 2ADUA 5EEGA 2VE9A 3I54A 1TQMA 4ZZLA 5D4RA 4UHTA 2VT3A 3RI4A 2XAQA 3F6OA 1ZLKA 1LDKB 1OPCA 2VOOA 3HUGA 2QYOA 3EUHA 1ZRFA 4KUMA 5FO5A 2XGXA 1KU3A 1DDNA 2HFHA 4CYDA 2K4BA 1R36A 3JW4A 1Z9CA 2BBYA 3RJPA 4HZFA 2DBBA 5J6XA 1XCBA 2XROA 1YFHA 4JK1X 2DLLA 3ISPA 1BC8C 1BM9A 1YW9A 1O3QA 1V3FA 1EH8A 5DEQA 3COAC 3P7NA 1TNSA 2DPUA 3QP5A 4UVBA 5K1YA 4U0VA 4WK8F 1FBQA 3IRRA 4ENKA 2KIFA 1W7PA 1S6LA 1O7LA 1G3YA 4S05A 2GIVA 4OMYA 5E1ZB 1MJAA 1WKMA 1IXRC 4HW0A 1G4DA 4UNOA 3FXQA 4G6QA 1I1SA 2Z99A 2KJBA 3IL2A 2QWWA 2ACJA 3HRSA 1W5SA 2EK5A 3KE2A 3U1DA 5CJ9A 3E3VA 2HDCA 3GF2A 1ZREA 4WCGA 5A2QZ 5HDGA 2XV4S 1K79A 3QU6A 1Z1DA 4HA8A 5F1RA 3QU3A 4ZZDA 1XSXA 4UV9A 3DKWA 4M9XA 4F7ZA 4L0ZB 4HV5A 4GYGA 4Y13A 1OMIA 3FF5A 5LRRA 2DT5A 5JR3A 1EH7A 4LLNA 4XLPF 2M8EA 2FQ3A 2ZCWA 1IZ1A 3BPVA 4WF2A 1JXSA 3TO9A 4MTEA 2XUBA 3HHGA 4R8HA 4RGSA 2IP2A 2ESNA 3ECHA 2UXNA 2EV5A 2DI3A 4BYYA 3NEUA 3FMQA 3FXRA 2ZNYA 2A61A 1WI9A 4KIFA 4UVAA 3GFMA 1B6AA 3O3KA 3GZ6A 3RIRA 4EVIA 3ZMZA 1FT9A 3VOEA 4HX8A 5L3FA 1XN7A 3BOQA 1RUOA 4KA4A 2A5YB 4K2EA 1IUYA 1FP2A 3RDIA 1BIAA 3G73A 2ETHA 2H27A 2Y75A 3CUOA 1LVAA 3N97A 3BY6A 4EJVA 2FRHA 5LBQA 4GCVA 5L3BA 3U9GA 4CDGA 2O6GE 2FBHA 2EFWA 3E6MA 2K4JA 1W7PB 5JI6A 4Q4ZF 1LNWA 3N4MA 1HKSA 3IKTA 1KU9A 3FX3A 4XBFA 1YIOA 3CLOA 5JHUA 2IA0A 2A3SA 2ESHA 1R00A 5HS7A 3ABUA 4ZYDA 2BE5F 3U2RA 1GVJA 3V7SA 3ERED 2RQPA 3GW2A 3DEUA 3EDPA 1TQIA 4A0ZA 3SHFA 4MEXF 2XAHA 2W25A 3Q9SA 4L9JA 1ZG3A 4RB2C 1KA8A 3L7WA 3J80Z 4ENJA 2UWMA 2V79A 1IRGA 1GHCA 5D5XB 3HHHA 2ZO4A 4JQFA 4FT8A 1KQ9A 3JSPA 1FX7A 1OYIA 2H94A 3K2ZA 5CYVA 2A69F 3QPTA 5LHIA 5DYMA 4A0YA 1KU2A 2O0YA 4HX4A 1QBJA 3WGGA 4D0PA 2FXAA 2MH9A 2DW4A 1S8NA 2NAZA 3K1PA 1SMTA 1KYZA 2HYFA 3LFKA 3VB2A 2FOKA 2FNPA 2A07F 5DDGA 2ELHA 4KMUX 3FM5A 1F9NA 1OYYA 4EV0A 3CTAA 3V7CA 1O3TA 4XSZF 1XSDA 2OZUA 5E8GA 1WSUA 3ZN0A 4R1HA 3HYIA 2LF7A 1DPUA 1B9MA 1KQ8A 1T38A 1SD6A 4M71A 5FLXZ 1J2XA 4ESJA 5CVVA 4IPAA 4M74A 1XB4A 3E6BA 3ZP5A 4LK1F 2D1HA 1HW2A 3FZVA 2CQKA 5H6RA 4U0WA 4HYEA 4MQ9F 3E97A 2EFNA 5FLXK 1IN6A 1DUXC 3WGHA 1ZHFA 3KP3A 1MDMA 4EM2A 3I0TA 4HF0A 3MWMA 4M9ZA 4OMZA 2ISYA 3ECOA 2W24A 3RKWA 2QQ9A 2XASA 3P9KA 5ILVA 1QO0D 3DPLC 2E1NA 4ZYEA 3ZMTA 2B0LA 3KP4A 3TOBA 3F21A 2JPBA 2HEOA 1MKMA 5E20A 4AIHA 2XRNA 3T0YA 3K1MA 1GXPA 2P6SA 2GXBA 4ESFA 1IXSB 4WWCA 2XHKA 4EM1A 5LGUA 2DK8A 2IA2A 3DQVC 4BAYA 2YR2A 2RVCA 1BI1A 4EJOA 4ETSA 3BJAA 3F72A 4RB0A 4GYIA 4MQVA 1AOYA 5HVQC 5FD6A 3FMRA 1ZLJA 1KYWA 5BPIA 4G9YA 3WTYC 1GXQA 1TBXA 1B9NA 2P7VB 1MZBA 4PDKA 1J9IA 2L01A 3QAHA 1YQAA 3WTVC 5H6QA 1UCRA 4HX7A 4FX4A 2DTRA 2EJRA 2Y0MA 3I4PA 1SD4A 2A6EF 4M6XA 3ZN1A 2XAJA 5L3CA 1USSA 3LAJA 1XMKA 1R7JA 2QLZA 1FY7A 5JVTA 1T2KA 4LB5A 5BS6A 3LAPA 4RB3C 5CVRA 4AIKA 4O5VA 4R79A 4LLGF 4IRHA 3J7AO 2XAFA 3T8RA 4HDVA 5FGMA 3ZMDA 2DPDA 2FBKA 2ZJ2A 3WE3A 3AAFA 4WXDA 1UFMA 3HRUA 4AIJA 4ASNA 4RGUA 4RGXA 2M5WA 5HLGA 1SAXA 2JT1A 1LDJA 5D8LB 1P4WA 3KZZA 2CYYA 5D6EA 5DD8A 5E8IA 2QM3A 1MDMB 2ISZA 1K6OA 3K9TA 3DP7A 3GWZA 2DQRA 1LJ9A 3KETA 2VE8A 2QVOA 2QQBA 1B4AA 2XVCA 5L3EA 4JBAA 3IHUA 3HSFA 3C3WA 1J75A 4ESBA 2HTSA 3R61A 1G3WA 2ZXJA 2HKOA 2HZTA 4OIPF 4G7HF 4L9TA 2DU9A 5HDKA 4BHBA 2PMHA 3B73A 1IN8A 2FF4A 2FA5A 5ICGA 1R23A 2V1UA 1G6NA 3SQNA 1Z05A 3WTUC 3ROUA 2C6YA 4UVCA 5D6FA 3CDHA 3EQLF 5E17F 5FB2A 2P6TA 2O61A 1OR7A 3LQQA 1YTYA 2V6CA 1T39A 1I27A 2YPRA 4NQWA 1TQPA 1Z91A 1ZG5A 1HKTA 1XCVA 1C0WA 3M8EA 5DCMB 3F8BA 2QBYB 1BC7C 1ZG1A 5JFRA 3GVAA 2GA2A 1HXDA 4G6DA 4O3MA 1EH6A 2VBXA 2HS5A 4A0XA 3TO7A 2XAGA 4L5IA 4Y17A 3HRMA 3E5XA 1UHMA 2V1XA 1YS6A 2NNNA 3HTUA 1FZPB 1W5TA 2GWRA 1R5GA 1WRJA 4PZJA 4HBLA 3GYHX 4CXFA 1U5TA 1YG2A 5A2QK 3F8MA 3JAMZ 3BP8A 3JTHA 4S04A 1ZRDA 2VBYA 1R22A 3BJ6A 4OIRF 4EQQA 2OQGA 3LA3A 2LNBA 4CZZA 1ZGJA 3CJNA 3GFIA 4P55A 5E18F 3WTXC 3WTTC 3KP6A 3JAMK 3KZYA 4P9FA 1TW2A 2Q2EA 2EFOA 1W4MA 3IRQA 1PUEE 3DFGA 1S29A 1JHFA 1E2XA 3ABTA 3WG9A 3F3XA 2BGCA 1SFXA 4WXHA 1FLIA 2JPCA 3BZ6A 3QRFF 3JTGA 2XIGA 3MZYA 1TW3A 3BJOA 4KFCA 4ZH4F 2W84A 2K27A 2P8TA 1H9TA 4XSXF 2VN2A 4LJZF 4AD9A 1TTYA 1L0OC 2ZBKA 5D5VB 1PP7U 1LQ1A 3KP7A 2FSWA 1DPRA 1R5HA 4PGGA 1J59A 3FM3A 4G7OF 2CGPA 2Q8KA 2VBWA 1QQIA 4HOBA 1V4RA 3FMSA 3F8FA 2UZKA 1G3SA 3H3ZA 2RN7A 2PN6A 3LSTA 1F5TA 4G8XA 4XRFA 4AVPA 1AWCA 1I1GA 4A2UA 2WC2A 1HKQA 2LSOA 1IF1A 4G94A 2M45A 3HRTA 3OOPA 3ZQ7A 5ICEA 3J81Z 1O3RA 1IN7A 1ONVA 3J80K 2PBIA 3IC7A 3HOTA 2EFPA 1BOAA 4BHPA 3LA2A 2DK5A 4HF1A 4CO8A 3IWFA 2UXXA 1REPC 2NRAC 3QP6A 3C1DA 3I5UA 4OIQF 4O6JA 1SFEA 1TLHB 5KK1A 3M1EA 1EV7A 1OKRA 1QZYA 5IT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A12 A;  4MGR A;  3JSO A;  5E1X A;  2X0L A;  1LEA A;  2MLG A;  5D5U B;  1XD7 A;  3DF8 A;  1U8R A;  3DV8 A;  5J8C A;  3KEO A;  2ZME A;  3W6J B;  2R7D A;  4ZYG A;  1IN5 A;  5ERI A;  3M9A A;  2STT A;  4P96 A;  2HYG D;  1MJB A;  4WX9 A;  3VOD A;  1ZRC A;  1S7A A;  3TDU C;  4N9I A;  2AS5 F;  4BHC A;  1U5T C;  5HS8 A;  6PAX A;  1HBX G;  4KYW A;  3V4G A;  4A5N A;  1BI2 A;  2E7X A;  5AIQ A;  2CFX A;  3WTS C;  1W7P D;  5LLQ A;  2FE3 A;  5K5R A;  4P9U A;  2P4W A;  2PI0 A;  3D0S A;  4M6Y A;  2QEN A;  1H0M A;  3D5L A;  2NS0 A;  4DNC A;  4Y15 A;  5LEJ A;  1FOK A;  2OAZ A;  3K69 A;  2GQQ A;  1MGT A;  4KMF A;  5K5Q A;  4YFN F;  4IXA A;  2E7W A;  2W57 A;  3SZP A;  2K7L A;  4MEY F;  4I98 B;  2YX4 A;  1S3J A;  4DQ2 A;  4KNY A;  2AXL A;  2EV6 A;  1WWX A;  3ZMS A;  4Z2Y A;  2KJC A;  2G9W A;  4GGG A;  2CW0 F;  4EJT A;  2ZFW A;  1I5Z A;  5F64 A;  2H6B A;  4LB6 B;  3KCC A;  3BRO A;  5AIP A;  1DP7 P;  1X3U A;  2VXZ A;  2PFB A;  3GX4 X;  1ZH5 A;  1KGS A;  3WOD F;  3LWF A;  3BWG A;  5F6F A;  3V8L A;  2J5P A;  4IJA A;  4LD5 A;  2L02 A;  5EEH A;  2KIM A;  3OV8 A;  2GA1 A;  3S2W A;  3PQK A;  1Q1H A;  4MTD A;  4HQE A;  2EWN A;  2QZ8 A;  1ZN2 A;  1D3Y A;  4IVN A;  2KIU A;  4I0B A;  3GEZ A;  1Z6T A;  2KRF A;  3R0A A;  1K7A A;  1MD0 A;  2IT0 A;  4L18 B;  2MBF A;  2RC4 A;  3RKY A;  2Y48 A;  3TO6 A;  4ENM A;  4E70 A;  2L4M A;  2A6H F;  2GXG A;  4CIC A;  3EYI A;  4H0E A;  2HTJ A;  2EFQ A;  1F1Z A;  5HLI A;  1IXC A;  3RPQ A;  4UV8 A;  1ODD A;  2Q0O A;  2IRF G;  2FU4 A;  4OOI A;  3F8C A;  3NRV A;  2G7H A;  2W85 A;  2H6C A;  3RYR A;  2JTV A;  4LG0 A;  3F8N A;  3K1N A;  2RDP A;  2OQR A;  4PGH A;  2ZME B;  1P4A A;  3I59 A;  4A5M A;  3B02 A;  2EV0 A;  4KT5 C;  1O3S A;  2JZY A;  3MAJ A;  3M7G A;  1L3L A;  2ZNZ A;  4BH9 A;  2P5V A;  3CUQ A;  1UB9 A;  4KIG A;  3HOS A;  3TQN A;  2CO5 A;  5BPD A;  1B1B A;  4U7B A;  5FFX A;  4I01 A;  2MC3 A;  4Q48 A;  1D8K A;  2L3D A;  1H9G A;  2DQL A;  3MCZ A;  2O8X A;  1ZAR A;  4RAY A;  1LDD A;  1XGO A;  5AON A;  3C7J A;  3QPH A;  1JE8 A;  4I2O A;  3V8K A;  2STW A;  1YS7 A;  4L9V A;  2ZKZ A;  4U0Y A;  3RPU A;  5ED4 A;  1RIO H;  3TGN A;  1HW1 A;  5HDN A;  2FNA A;  2J5O A;  2H09 A;  3Q5F A;  1CGP A;  2CSO A;  2OD5 A;  2OBP A;  3F23 A;  4A6D A;  3WGI A;  1U2W A;  3KLO A;  3ML6 A;  1IW7 F;  3TOA A;  5D8K B;  5LGT A;  1FSE A;  2L4A A;  3E6C C;  1BBY A;  4CHU A;  4BXU A;  1P92 A;  3P9I A;  4IF4 A;  2IVM A;  1RI7 A;  4BNC A;  5BMZ A;  1G3T A;  5TJJ A;  3R0J A;  3QOP A;  4EGZ A;  3PFI A;  1P6R A;  1Y0U A;  4CGZ A;  2D1V A;  3EYY A;  3F6V A;  3VFZ A;  5BOX A;  1QNT A;  2VOP A;  2HWV A;  2WWY A;  2PEX A;  3HSR A;  1K78 A;  3R60 A;  4M9S A;  2F5E A;  2PG4 A;  1J7K A;  2L54 A;  2XKO A;  4KIB A;  4LGW A;  3SFZ A;  4I09 A;  2EB7 A;  2NNY A;  1HST A;  1D8J A;  1FSH A;  2K02 A;  3GUD A;  1ZAO A;  4AWX B;  1FYM A;  1BIB A;  5E1W A;  3E6D A;  3L9F A;  4MHG A;  2Z5U A;  4OU0 A;  5KVR A;  5LHG A;  4MNU A;  4LG0 B;  3LQR A;  2P7C B;  4Q5S F;  1Z7U A;  1QGP A;  5K5O A;  3GLX A;  1JHH A;  1YLF A;  1RZ4 A;  3I53 A;  3I59 B;  5ILS A;  1BI3 A;  1S7O A;  2EA4 A;  3L09 A;  4KDP A;  3FXU A;  3CUQ B;  1ON2 A;  2F5C A;  3WTW C;  2V9V A;  3PQJ A;  2DAO A;  1J0R A;  2OU2 A;  2VBZ A;  3VEP A;  2HR3 A;  1VTN C;  4N9H A;  1R1U A;  1ULY A;  4M72 A;  3GO5 A;  2F2E A;  5DUK A;  3MQ0 A;  2G7U A;  2PMU A;  3V8J A;  5ICF A;  2FML A;  2RNJ A;  4OIO F;  3K0L A;  5J8F A;  2YU3 A;  4FX0 A;  4KN4 X;  4EMS A;  4I7H A;  3IWZ A;  5TRD A;  1SFU A;  2VOD A;  3GXO A;  2WTE A;  1FBS A;  1TNT A;  2GAU A;  2RV8 A;  3I64 A;  2YSR A;  4HLX A;  4NHJ A;  3L00 A;  4BQA A;  2R7F A;  3H92 A;  1FC3 A;  3DPT A;  3O2P E;  4IRG A;  4UUV A;  1ZYR F;  4P5O A;  1KQ0 A;  3CUQ C;  4EJW A;  2P5L C;  1BN5 A;  1CF7 A;  2VT2 A;  4U88 A;  1HSJ A;  3T1B A;  4GO1 A;  2Z3Y A;  3G3Z A;  1STZ A;  3TDZ C;  1T0F A;  4QLC U;  3I71 A;  5LGN A;  2D2W A;  2CWE A;  2DO7 A;  1O57 A;  2BV6 A;  4XLN F;  5DCF A;  4OIN F;  2M1B A;  2FBI A;  5CVJ A;  1HW5 A;  3LA7 A;  2KKO A;  2YX7 A;  4ZYH A;  4GXO A;  4LLL A;  1YW7 A;  5DUI A;  3GFJ A;  3KP2 A;  3RTR A;  1LB2 A;  4HDU A;  3R4K A;  3HSE A;  2MD5 A;  2IPQ X;  3FWE A;  1K78 B;  2HQR A;  4FHT A;  1R58 A;  4I0A A;  2HGC A;  2D45 A;  1SD7 A;  1RNL A;  3IKV A;  5DV5 A;  4YIF A;  3CO6 C;  4KN7 X;  5BQT A;  1LEB A;  4Q47 A;  5IT9 Z;  4PCQ A;  5FFZ A;  4YFX F;  2K86 A;  3W6K B;  1D5V A;  2IA1 A;  3I58 A;  3E5U A;  5FD5 A;  1XGN A;  4LK0 F;  5H20 A;  3DXJ F;  4EGY A;  4KIC A;  3V7R A;  5L3D A;  2PLY A;  5HLH A;  1XGM A;  4HQM A;  3RYP A;  1ZGA A;  3SXY A;  5LHH A;  2WV0 A;  2HKX A;  3FHZ A;  1U5T B;  5IT9 K;  1I6X A;  1P2F A;  2PQ8 A;  4L5J A;  1E17 A;  2A68 F;  2XKP A;  4RB1 A;  3J81 K;  3BPX A;  3KFW X;  5HS9 A;  2HQN A;  3KLN A;  3WE2 A;  3ULQ B;  2M30 A;  3EET A;  2F5F A;  1XDU A;  1PP8 F;  2M87 A;  4YII A;  1A04 A;  1T6S A;  1U6G A;  4A6E A;  5DD4 A;  4ON0 A;  2NYX A;  3MFK A;  4RGR A;  2IJL A;  4UXN A;  4ENN A;  1FWZ A;  2TDX A;  2FEZ A;  2OA4 A;  1F4K A;  1B59 A;  3GZ5 A;  1QPM A;  2PJP A;  4L0Y B;  4RAZ A;  1RUN A;  1SD5 A;  1JGS A;  2IW5 A;  3HTS B;  2BYV E;  4U7D A;  4HF2 A;  3HIF A;  1KU7 A;  4B09 A;  4QWQ A;  1YO5 C;  3GFL A;  2LKP A;  5D4S A;  2VC1 A;  2LDU A;  1CF7 B;  1T98 A;  3ZPL A;  2HOE A;  1IN4 A;  2OZ6 A;  3WU0 A;  3C18 A;  5LRS A;  4HV6 A;  3T8T A;  1FYL A;  4WXC A;  4RS8 A;  2JRT A;  2P5K A;  1UST A;  1NHA A;  1FPQ A;  1YW8 A;  1PDN C;  5L3G A;  3REO A;  4EJU A;  3TKY A;  4M73 A;  1P4X A;  3WTZ A;  3KP5 A;  3BDD A;  1Z6R A;  3T5X A;  4YG2 F;  3O6B B;  2EA2 A;  2JSC A;  2GZW A;  2MH2 A;  1XGS A;  1SMY F;  3H3U A;  3KEQ A;  2BEO A;  5HOO A;  1BI0 A;  1WQ2 A;  5ILU A;  3CO7 C;  1R1V A;  4LFU A;  2COM A;  3ELK A;  1YYV A;  1QZZ A;  4I02 A;  2VON A;  1FP1 D;  4IHS A;  1IRF A;  4NB5 A;  1U78 A;  4HLY A;  2MLK A;  1O7F A;  1ON1 A;  2O03 A;  4B8X A;  3E5Q A;  3WU1 B;  2Z33 A;  4EM0 B;  1MJ9 A;  1HQC A;  3P9C A;  4HAM A;  2RKH A;  2CG4 A;  1XMA A;  5CLS A;  5CVI A;  2X4H A;  1U3E M;  5DCM A;  4YFK F;  2F5D A;  1XDS A;  4LMY A;  4IHT A;  4N0B A;  3MEX A;  2QBY A;  2DFI A;  3Q9V A;  2MA3 A;  1IAW A;  5CVU A;  4G7Z F;  2R3S A;  1R1T A;  5ICC A;  5D5W B;  4IRI A;  3M8F A;  3MZH A;  3F22 A;  3R6S A;  2RGV A;  1J5Y A;  2Z9O A;  1BJA A;  3SZT A;  3ZMV A;  2LF8 A;  2O3F A;  1OYW A;  3ZMU A;  1FNN A;  4TV7 A;  3L2C A;  2QQA A;  5LEK A;  1UHW A;  2E1C A;  1XSV A;  3NQO A;  2QUF A;  2V1D A;  2VC0 A;  4L9N A;  1FYK A;  1FBU A;  3RKX A;  2FMY A;  2ADU A;  5EEG A;  2VE9 A;  3I54 A;  1TQM A;  4ZZL A;  5D4R A;  4UHT A;  2VT3 A;  3RI4 A;  2XAQ A;  3F6O A;  1ZLK A;  1LDK B;  1OPC A;  2VOO A;  3HUG A;  2QYO A;  3EUH A;  1ZRF A;  4KUM A;  5FO5 A;  2XGX A;  1KU3 A;  1DDN A;  2HFH A;  4CYD A;  2K4B A;  1R36 A;  3JW4 A;  1Z9C A;  2BBY A;  3RJP A;  4HZF A;  2DBB A;  5J6X A;  1XCB A;  2XRO A;  1YFH A;  4JK1 X;  2DLL A;  3ISP A;  1BC8 C;  1BM9 A;  1YW9 A;  1O3Q A;  1V3F A;  1EH8 A;  5DEQ A;  3COA C;  3P7N A;  1TNS A;  2DPU A;  3QP5 A;  4UVB A;  5K1Y A;  4U0V A;  4WK8 F;  1FBQ A;  3IRR A;  4ENK A;  2KIF A;  1W7P A;  1S6L A;  1O7L A;  1G3Y A;  4S05 A;  2GIV A;  4OMY A;  5E1Z B;  1MJA A;  1WKM A;  1IXR C;  4HW0 A;  1G4D A;  4UNO A;  3FXQ A;  4G6Q A;  1I1S A;  2Z99 A;  2KJB A;  3IL2 A;  2QWW A;  2ACJ A;  3HRS A;  1W5S A;  2EK5 A;  3KE2 A;  3U1D A;  5CJ9 A;  3E3V A;  2HDC A;  3GF2 A;  1ZRE A;  4WCG A;  5A2Q Z;  5HDG A;  2XV4 S;  1K79 A;  3QU6 A;  1Z1D A;  4HA8 A;  5F1R A;  3QU3 A;  4ZZD A;  1XSX A;  4UV9 A;  3DKW A;  4M9X A;  4F7Z A;  4L0Z B;  4HV5 A;  4GYG A;  4Y13 A;  1OMI A;  3FF5 A;  5LRR A;  2DT5 A;  5JR3 A;  1EH7 A;  4LLN A;  4XLP F;  2M8E A;  2FQ3 A;  2ZCW A;  1IZ1 A;  3BPV A;  4WF2 A;  1JXS A;  3TO9 A;  4MTE A;  2XUB A;  3HHG A;  4R8H A;  4RGS A;  2IP2 A;  2ESN A;  3ECH A;  2UXN A;  2EV5 A;  2DI3 A;  4BYY A;  3NEU A;  3FMQ A;  3FXR A;  2ZNY A;  2A61 A;  1WI9 A;  4KIF A;  4UVA A;  3GFM A;  1B6A A;  3O3K A;  3GZ6 A;  3RIR A;  4EVI A;  3ZMZ A;  1FT9 A;  3VOE A;  4HX8 A;  5L3F A;  1XN7 A;  3BOQ A;  1RUO A;  4KA4 A;  2A5Y B;  4K2E A;  1IUY A;  1FP2 A;  3RDI A;  1BIA A;  3G73 A;  2ETH A;  2H27 A;  2Y75 A;  3CUO A;  1LVA A;  3N97 A;  3BY6 A;  4EJV A;  2FRH A;  5LBQ A;  4GCV A;  5L3B A;  3U9G A;  4CDG A;  2O6G E;  2FBH A;  2EFW A;  3E6M A;  2K4J A;  1W7P B;  5JI6 A;  4Q4Z F;  1LNW A;  3N4M A;  1HKS A;  3IKT A;  1KU9 A;  3FX3 A;  4XBF A;  1YIO A;  3CLO A;  5JHU A;  2IA0 A;  2A3S A;  2ESH A;  1R00 A;  5HS7 A;  3ABU A;  4ZYD A;  2BE5 F;  3U2R A;  1GVJ A;  3V7S A;  3ERE D;  2RQP A;  3GW2 A;  3DEU A;  3EDP A;  1TQI A;  4A0Z A;  3SHF A;  4MEX F;  2XAH A;  2W25 A;  3Q9S A;  4L9J A;  1ZG3 A;  4RB2 C;  1KA8 A;  3L7W A;  3J80 Z;  4ENJ A;  2UWM A;  2V79 A;  1IRG A;  1GHC A;  5D5X B;  3HHH A;  2ZO4 A;  4JQF A;  4FT8 A;  1KQ9 A;  3JSP A;  1FX7 A;  1OYI A;  2H94 A;  3K2Z A;  5CYV A;  2A69 F;  3QPT A;  5LHI A;  5DYM A;  4A0Y A;  1KU2 A;  2O0Y A;  4HX4 A;  1QBJ A;  3WGG A;  4D0P A;  2FXA A;  2MH9 A;  2DW4 A;  1S8N A;  2NAZ A;  3K1P A;  1SMT A;  1KYZ A;  2HYF A;  3LFK A;  3VB2 A;  2FOK A;  2FNP A;  2A07 F;  5DDG A;  2ELH A;  4KMU X;  3FM5 A;  1F9N A;  1OYY A;  4EV0 A;  3CTA A;  3V7C A;  1O3T A;  4XSZ F;  1XSD A;  2OZU A;  5E8G A;  1WSU A;  3ZN0 A;  4R1H A;  3HYI A;  2LF7 A;  1DPU A;  1B9M A;  1KQ8 A;  1T38 A;  1SD6 A;  4M71 A;  5FLX Z;  1J2X A;  4ESJ A;  5CVV A;  4IPA A;  4M74 A;  1XB4 A;  3E6B A;  3ZP5 A;  4LK1 F;  2D1H A;  1HW2 A;  3FZV A;  2CQK A;  5H6R A;  4U0W A;  4HYE A;  4MQ9 F;  3E97 A;  2EFN A;  5FLX K;  1IN6 A;  1DUX C;  3WGH A;  1ZHF A;  3KP3 A;  1MDM A;  4EM2 A;  3I0T A;  4HF0 A;  3MWM A;  4M9Z A;  4OMZ A;  2ISY A;  3ECO A;  2W24 A;  3RKW A;  2QQ9 A;  2XAS A;  3P9K A;  5ILV A;  1QO0 D;  3DPL C;  2E1N A;  4ZYE A;  3ZMT A;  2B0L A;  3KP4 A;  3TOB A;  3F21 A;  2JPB A;  2HEO A;  1MKM A;  5E20 A;  4AIH A;  2XRN A;  3T0Y A;  3K1M A;  1GXP A;  2P6S A;  2GXB A;  4ESF A;  1IXS B;  4WWC A;  2XHK A;  4EM1 A;  5LGU A;  2DK8 A;  2IA2 A;  3DQV C;  4BAY A;  2YR2 A;  2RVC A;  1BI1 A;  4EJO A;  4ETS A;  3BJA A;  3F72 A;  4RB0 A;  4GYI A;  4MQV A;  1AOY A;  5HVQ C;  5FD6 A;  3FMR A;  1ZLJ A;  1KYW A;  5BPI A;  4G9Y A;  3WTY C;  1GXQ A;  1TBX A;  1B9N A;  2P7V B;  1MZB A;  4PDK A;  1J9I A;  2L01 A;  3QAH A;  1YQA A;  3WTV C;  5H6Q A;  1UCR A;  4HX7 A;  4FX4 A;  2DTR A;  2EJR A;  2Y0M A;  3I4P A;  1SD4 A;  2A6E F;  4M6X A;  3ZN1 A;  2XAJ A;  5L3C A;  1USS A;  3LAJ A;  1XMK A;  1R7J A;  2QLZ A;  1FY7 A;  5JVT A;  1T2K A;  4LB5 A;  5BS6 A;  3LAP A;  4RB3 C;  5CVR A;  4AIK A;  4O5V A;  4R79 A;  4LLG F;  4IRH A;  3J7A O;  2XAF A;  3T8R A;  4HDV A;  5FGM A;  3ZMD A;  2DPD A;  2FBK A;  2ZJ2 A;  3WE3 A;  3AAF A;  4WXD A;  1UFM A;  3HRU A;  4AIJ A;  4ASN A;  4RGU A;  4RGX A;  2M5W A;  5HLG A;  1SAX A;  2JT1 A;  1LDJ A;  5D8L B;  1P4W A;  3KZZ A;  2CYY A;  5D6E A;  5DD8 A;  5E8I A;  2QM3 A;  1MDM B;  2ISZ A;  1K6O A;  3K9T A;  3DP7 A;  3GWZ A;  2DQR A;  1LJ9 A;  3KET A;  2VE8 A;  2QVO A;  2QQB A;  1B4A A;  2XVC A;  5L3E A;  4JBA A;  3IHU A;  3HSF A;  3C3W A;  1J75 A;  4ESB A;  2HTS A;  3R61 A;  1G3W A;  2ZXJ A;  2HKO A;  2HZT A;  4OIP F;  4G7H F;  4L9T A;  2DU9 A;  5HDK A;  4BHB A;  2PMH A;  3B73 A;  1IN8 A;  2FF4 A;  2FA5 A;  5ICG A;  1R23 A;  2V1U A;  1G6N A;  3SQN A;  1Z05 A;  3WTU C;  3ROU A;  2C6Y A;  4UVC A;  5D6F A;  3CDH A;  3EQL F;  5E17 F;  5FB2 A;  2P6T A;  2O61 A;  1OR7 A;  3LQQ A;  1YTY A;  2V6C A;  1T39 A;  1I27 A;  2YPR A;  4NQW A;  1TQP A;  1Z91 A;  1ZG5 A;  1HKT A;  1XCV A;  1C0W A;  3M8E A;  5DCM B;  3F8B A;  2QBY B;  1BC7 C;  1ZG1 A;  5JFR A;  3GVA A;  2GA2 A;  1HXD A;  4G6D A;  4O3M A;  1EH6 A;  2VBX A;  2HS5 A;  4A0X A;  3TO7 A;  2XAG A;  4L5I A;  4Y17 A;  3HRM A;  3E5X A;  1UHM A;  2V1X A;  1YS6 A;  2NNN A;  3HTU A;  1FZP B;  1W5T A;  2GWR A;  1R5G A;  1WRJ A;  4PZJ A;  4HBL A;  3GYH X;  4CXF A;  1U5T A;  1YG2 A;  5A2Q K;  3F8M A;  3JAM Z;  3BP8 A;  3JTH A;  4S04 A;  1ZRD A;  2VBY A;  1R22 A;  3BJ6 A;  4OIR F;  4EQQ A;  2OQG A;  3LA3 A;  2LNB A;  4CZZ A;  1ZGJ A;  3CJN A;  3GFI A;  4P55 A;  5E18 F;  3WTX C;  3WTT C;  3KP6 A;  3JAM K;  3KZY A;  4P9F A;  1TW2 A;  2Q2E A;  2EFO A;  1W4M A;  3IRQ A;  1PUE E;  3DFG A;  1S29 A;  1JHF A;  1E2X A;  3ABT A;  3WG9 A;  3F3X A;  2BGC A;  1SFX A;  4WXH A;  1FLI A;  2JPC A;  3BZ6 A;  3QRF F;  3JTG A;  2XIG A;  3MZY A;  1TW3 A;  3BJO A;  4KFC A;  4ZH4 F;  2W84 A;  2K27 A;  2P8T A;  1H9T A;  4XSX F;  2VN2 A;  4LJZ F;  4AD9 A;  1TTY A;  1L0O C;  2ZBK A;  5D5V B;  1PP7 U;  1LQ1 A;  3KP7 A;  2FSW A;  1DPR A;  1R5H A;  4PGG A;  1J59 A;  3FM3 A;  4G7O F;  2CGP A;  2Q8K A;  2VBW A;  1QQI A;  4HOB A;  1V4R A;  3FMS A;  3F8F A;  2UZK A;  1G3S A;  3H3Z A;  2RN7 A;  2PN6 A;  3LST A;  1F5T A;  4G8X A;  4XRF A;  4AVP A;  1AWC A;  1I1G A;  4A2U A;  2WC2 A;  1HKQ A;  2LSO A;  1IF1 A;  4G94 A;  2M45 A;  3HRT A;  3OOP A;  3ZQ7 A;  5ICE A;  3J81 Z;  1O3R A;  1IN7 A;  1ONV A;  3J80 K;  2PBI A;  3IC7 A;  3HOT A;  2EFP A;  1BOA A;  4BHP A;  3LA2 A;  2DK5 A;  4HF1 A;  4CO8 A;  3IWF A;  2UXX A;  1REP C;  2NRA C;  3QP6 A;  3C1D A;  3I5U A;  4OIQ F;  4O6J A;  1SFE A;  1TLH B;  5KK1 A;  3M1E A;  1EV7 A;  1OKR A;  1QZY A;  5IT3 A; 
#chains in the Genus database with same CATH topology
 4A12 A;  4MGR A;  1X4P A;  3I4N J;  3JSO A;  5E1X A;  4C30 A;  4BAC A;  2X0L A;  5C44 J;  3QPL A;  2X6W A;  1LFB A;  1LEA A;  2AO9 A;  3JRH A;  1JT6 A;  2MLG A;  5D5U B;  1XD7 A;  3DF8 A;  1U8R A;  3DV8 A;  1RET A;  5J8C A;  3KEO A;  1LPQ A;  2ZME A;  3W6J B;  2R7D A;  2Q2E B;  1IN5 A;  4ZYG A;  2QA4 I;  2VPR A;  5ERI A;  5FJ8 J;  3S1M J;  3M9A A;  1SEU A;  2STT A;  4P96 A;  2HYG D;  5F0C A;  5F1J A;  1MJB A;  4WX9 A;  2X6X A;  3MKL A;  4CYC B;  3VOD A;  2WV1 A;  3MD2 A;  1QHH D;  5HNH A;  3IH3 A;  1ZRC A;  1S7A A;  3OOU A;  3PNY A;  4B3X A;  4DYQ A;  3TDU C;  4N9I A;  3MN2 A;  4HSR A;  3HEF A;  1VQ8 I;  2AS5 F;  3UKG A;  2XPU A;  4BHC A;  1U5T C;  4JX5 A;  5HS8 A;  3GTM J;  3TP3 A;  4AC0 A;  6PAX A;  1HBX G;  2IS2 A;  1ZTR A;  4KYW A;  3V4G A;  3QPS A;  3L2W A;  4A5N A;  1BI2 A;  2E7X A;  5AIQ A;  1GDT A;  2CFX A;  3WTS C;  1W7P D;  2FUG 2;  5LLQ A;  4OWR B;  2FE3 A;  5K5R A;  2ZJR F;  3QOD A;  4P9U A;  2P4W A;  4BJ5 C;  2PI0 A;  3D0S A;  1I6H J;  4M6Y A;  2JQ7 A;  2QEN A;  1H0M A;  3D5L A;  2NS0 A;  4DNC A;  4Y15 A;  4XLA A;  1TL8 A;  5LEJ A;  1FOK A;  2OAZ A;  3MZ8 A;  3K69 A;  2GQQ A;  1QPI A;  1ZR4 A;  1MGT A;  2GIZ A;  1CQT A;  2XPW A;  4KMF A;  3TL4 X;  1K83 J;  3G4S I;  5K5Q A;  4YFN F;  4DZJ A;  4IXA A;  1SAN A;  2E7W A;  3CF5 F;  1BOB A;  1PYV A;  2L9N A;  2W57 A;  3IUO A;  3SZP A;  1VQK I;  2K7L A;  4MEY F;  3AFH A;  1J09 A;  3K4L A;  4I98 B;  2YX4 A;  1WVR A;  3K4J A;  1N75 A;  1S3J A;  4DQ2 A;  4KNY A;  5IYD J;  3HBL A;  2V4J C;  2H1L A;  2AXL A;  2EV6 A;  4FIS A;  1WWX A;  3ZMS A;  4Z2Y A;  2KJC A;  2G9W A;  3KZI C;  2NOJ B;  1R6R A;  4XN3 A;  4GGG A;  1YI2 I;  4FE7 A;  2CW0 F;  4EJT A;  2ZFW A;  1I5Z A;  1JTY A;  5F64 A;  3DTI A;  1APL C;  2H6B A;  4LB6 B;  1ETX A;  2H8W A;  3KCC A;  4XLE A;  1JUS A;  3BRO A;  5AIP A;  1DP7 P;  1X3U A;  3CCQ I;  2VXZ A;  1ZEL A;  2PFB A;  3GX4 X;  3B6C A;  1JKO C;  1BW6 A;  5KAF C;  1ZH5 A;  5F0F A;  1KGS A;  3PSF A;  2E1O A;  3WOD F;  4DBQ A;  3LWF A;  4A69 C;  2KLO A;  4YEJ A;  1X58 A;  3BWG A;  1QRY A;  3LOC A;  3DU6 A;  5F6F A;  3V8L A;  2K9N A;  2J5P A;  1R4N B;  4IJA A;  4LD5 A;  2L02 A;  5EEH A;  2KIM A;  2E71 A;  3OV8 A;  2GA1 A;  3S2W A;  4Y7N J;  3PQK A;  2L7F P;  1Q1H A;  4MTD A;  4HQE A;  1LVK A;  5K7H A;  2EWN A;  4HNT A;  2QZ8 A;  3ZQC A;  1ZN2 A;  1D3Y A;  3VYS B;  2CUF A;  4IVN A;  2KIU A;  4I0B A;  3GEZ A;  1HOM A;  3PO3 J;  1Z6T A;  2KRF A;  3R0A A;  1K7A A;  1MD0 A;  3PFY A;  3SDG A;  1FJL A;  2IT0 A;  4L18 B;  2MBF A;  2RC4 A;  3RKY A;  3NAU A;  1GVD A;  2Y48 A;  3TO6 A;  4ENM A;  4E70 A;  3DBL B;  2L4M A;  5EGO A;  1ETV A;  4X6A J;  2A6H F;  1QU3 A;  2W82 A;  2GXG A;  5FKL A;  4CIC A;  4FE4 A;  3VYR B;  2R5Y B;  3FXK A;  4CSW A;  3EYI A;  4H0E A;  4FET A;  2HTJ A;  2EFQ A;  2H8R A;  3GBG A;  1I3A A;  1F1Z A;  1H89 C;  3H36 A;  5HLI A;  1IXC A;  2JVH A;  4UV8 A;  3RPQ A;  1QVT A;  1RES A;  1ODD A;  2Q0O A;  2IRF G;  4JX6 A;  3LSJ A;  2FU4 A;  3H5A A;  2DXI A;  3OYI A;  4OOI A;  2K85 A;  3F8C A;  3NRV A;  3HOY J;  2G7H A;  2W85 A;  2H6C A;  3BQZ A;  3PSI A;  3RYR A;  2JTV A;  4LG0 A;  4A3K J;  1HF0 A;  3F8N A;  3K1N A;  2RDP A;  3I9V 2;  2MSY A;  2OQR A;  4PGH A;  2ZME B;  1P4A A;  1Y6I A;  3I4M J;  3SDB A;  3I59 A;  3S3O A;  4A5M A;  1E3P A;  3N05 A;  3B02 A;  2NOG A;  5HLT A;  2EV0 A;  4KT5 C;  1O3S A;  3OY9 A;  2JZY A;  3MAJ A;  3M7G A;  1L3L A;  2V26 A;  2ZNZ A;  3GTG J;  4BH9 A;  4XKW A;  2P5V A;  3CP2 A;  3CUQ A;  1UB9 A;  4KIG A;  2XDV A;  2IGK A;  3A02 A;  2WA0 A;  3HOS A;  3TQN A;  5F04 A;  2CO5 A;  2R5Z A;  2HOT A;  2DA6 A;  1FEX A;  1YJN I;  1EJ9 A;  5BPD A;  1B1B A;  2EIM H;  2EH3 A;  3MKY B;  1Y1V J;  4U7B A;  1W36 D;  1G8X A;  5FFX A;  2K9M A;  5F08 A;  4KIS A;  3BC8 A;  4I01 A;  9ANT A;  1MBE A;  2MC3 A;  2JN6 A;  4Q48 A;  5CQG A;  3FDY A;  1D8K A;  2DOD A;  2L3D A;  4G6T B;  3OS0 A;  4I99 C;  4DJA A;  1H9G A;  2DQL A;  3MCZ A;  2A05 A;  3I3L A;  4XIC A;  2VPL A;  2O8X A;  4BUP A;  1ZAR A;  1FTZ A;  2CV0 A;  4RAY A;  1LDD A;  1XGO A;  5AON A;  3C7J A;  4A3D J;  3B6A A;  3QPH A;  1VQO I;  1JE8 A;  3V8K A;  4I2O A;  1V5F A;  4LIT A;  2ZXH A;  3ZQI A;  4KT6 A;  4S0H B;  2STW A;  4QPO A;  1YS7 A;  4L9V A;  2MFZ A;  2ZKZ A;  4U0Y A;  4C2U A;  3RPU A;  5ED4 A;  2VLA A;  1RIO H;  4HST A;  2BY3 A;  2ZME C;  1HW1 A;  4NUB A;  2FD5 A;  2AHQ A;  2L2O A;  2VQH A;  3TGN A;  2D5V A;  5HDN A;  2FNA A;  2J5O A;  2LRD A;  2H09 A;  3VSL A;  2E2J J;  4FAS D;  3Q5F A;  3S3M A;  1CGP A;  2CSO A;  2O5R A;  2OD5 A;  2OBP A;  3F23 A;  1MBF A;  1SVM A;  2OTL I;  4A6D A;  2CQN A;  4YEL A;  3DEW A;  2DA7 A;  3WGI A;  3CCU I;  1U2W A;  4BE0 A;  3I55 I;  4E7K A;  3KLO A;  2HVS A;  3ML6 A;  1IW7 F;  3UNG C;  4A93 J;  3TOA A;  5D8K B;  5LGT A;  2AQF A;  1FSE A;  1ZQ3 P;  2L4A A;  2BY0 A;  3E6C C;  1A6Q A;  3CMA I;  1BBY A;  4BEH A;  4CHU A;  3W3C A;  4DW6 A;  4XN0 A;  4BXU A;  1P92 A;  3M8J A;  3P9I A;  3OYK A;  4IF4 A;  1E0E A;  2IVM A;  2HXO A;  2Y9Y A;  5IY5 H;  4DYR A;  2LY1 A;  1RI7 A;  2CQQ A;  3CLQ A;  4UB8 C;  3BCB A;  4BNC A;  1XG1 A;  5BMZ A;  2PJR A;  1G3T A;  3VDX A;  5TJJ A;  3KYL A;  1MND A;  1SVO A;  3LL7 A;  3R0J A;  3K70 D;  2PMZ N;  2KT0 A;  3QOP A;  3ZXS A;  1X3Z B;  5B1A H;  4EGZ A;  2HNH A;  3PFI A;  1P6R A;  2F4O B;  1Y0U A;  4CGZ A;  2D1V A;  3EYY A;  3F6V A;  3VFZ A;  3K4K A;  5BOX A;  2M7A A;  1QNT A;  3DU5 A;  4II2 A;  4XID A;  1K6Y A;  3BG5 A;  2VOP A;  2L5Q A;  2HWV A;  1V5E A;  2WWY A;  3CC7 I;  4XK4 A;  2PEX A;  3HSR A;  3SEZ A;  3ZCO A;  1K78 A;  3R60 A;  3X2Q H;  1BL0 A;  4RLF A;  4JYK A;  4M9S A;  2F5E A;  4RM3 A;  2PG4 A;  3RCO A;  2L9V A;  1J7K A;  4YIR X;  5EGO B;  2IGN A;  2ZB9 A;  2L54 A;  2XKO A;  4KIB A;  4LGW A;  3SFZ A;  5C4J J;  3QYF A;  4I09 A;  4F92 B;  5FKK A;  4DZP A;  2EB7 A;  4B48 A;  1HST A;  2NNY A;  1D8J A;  1FSH A;  4F91 B;  2B63 J;  1KZH A;  2R93 J;  2K02 A;  1W1W E;  3GUD A;  1ZAO A;  3F9K A;  4XRM A;  4AWX B;  2ICW G;  2QQ8 A;  3DLL F;  5JLW A;  3A0B C;  1FYM A;  1BIB A;  5E1W A;  2LC2 A;  4XOR A;  3E6D A;  3L9F A;  3OWT A;  3LSK A;  4MHG A;  3HOX J;  2Z5U A;  4OU0 A;  5KVR A;  1VI0 A;  1HLV A;  5LHG A;  4MNU A;  2ZXW H;  4LG0 B;  3LQR A;  2P7C B;  4Q5S F;  4V2F A;  4IHY A;  1R4M B;  1Z7U A;  1N25 A;  2R7V A;  1QGP A;  3GLX A;  5K5O A;  1JHH A;  1YLF A;  3PUB A;  4H4K C;  3FK6 A;  1RZ4 A;  1TWA J;  2HZD A;  3I59 B;  3I53 A;  2ZJQ F;  3CCY A;  5ILS A;  3GTL J;  1BI3 A;  1S7O A;  2EA4 A;  3L09 A;  4ZTJ A;  4KDP A;  3FXU A;  2M0C A;  3CUQ B;  1ON2 A;  2EZL A;  2F5C A;  1ZK8 A;  2V9V A;  3WTW C;  3PQJ A;  2PMZ A;  3BR1 A;  1A35 A;  2DAO A;  2K3F A;  1J0R A;  2OU2 A;  2VBZ A;  3L1P A;  3VEP A;  2HR3 A;  1VTN C;  2DJI A;  4N9H A;  2JK3 A;  3ZQL A;  1R1U A;  1DQU A;  1ULY A;  5JLX A;  3RZO J;  3J7A Y;  2XB5 A;  2RNG A;  4PJL A;  2DOA A;  4M72 A;  2EIN H;  3GO5 A;  2F2E A;  2XC7 A;  5DUK A;  1TWF J;  3MQ0 A;  2G7U A;  4LIV A;  2O9L A;  1UZC A;  2PMU A;  1PJR A;  3DBR B;  3V8J A;  5ICF A;  2ZFU A;  3CZ6 A;  2FML A;  2RNJ A;  1I39 A;  4OIO F;  4RAG A;  5FKM A;  2LR8 A;  2L7Z A;  3K0L A;  2YS9 A;  4NC6 A;  5J8F A;  1MNM C;  2YU3 A;  4FX0 A;  4KN4 X;  4AID A;  4BKX A;  4I7H A;  3IWZ A;  4EMS A;  5TRD A;  4IQJ A;  1SFU A;  2VOD A;  3GXO A;  1O4X A;  2WBM A;  2WTE A;  1M1E B;  1FBS A;  1TNT A;  2WAF A;  2CUE A;  2KFD A;  2GAU A;  2OCE A;  3AKZ A;  3ABL H;  1BR2 A;  1Z77 A;  2RV8 A;  3I64 A;  4XOP A;  2YSR A;  4HLX A;  2R7U A;  1HDP A;  1MNE A;  3PNT A;  4LG3 A;  1SAU A;  4NHJ A;  3L00 A;  3OYE A;  2R7F A;  4BQA A;  3H92 A;  1FC3 A;  1WJB A;  2XRL A;  3DPT A;  4L5E A;  4W97 A;  2NVQ J;  3O2P E;  4IRG A;  2IGM A;  4UUV A;  1ZYR F;  4P5O A;  4ABZ A;  4C3J J;  2HDD A;  1KQ0 A;  1Y56 A;  4Y52 J;  3CUQ C;  4EJW A;  1YE9 A;  2P5L C;  2I10 A;  3HDD A;  4DGW B;  1BN5 A;  1CF7 A;  2VT2 A;  4U88 A;  1HSJ A;  3T1B A;  3U1K A;  3S16 J;  4GO1 A;  3S1R J;  5LFA A;  2Z3Y A;  2LFB A;  3G3Z A;  2Y30 A;  1STZ A;  3H9J A;  3TDZ C;  4B4C A;  3D1N I;  2RAE A;  1UG2 A;  1UMQ A;  1T0F A;  4QLC U;  2F5V A;  4XMY A;  2LH9 A;  3I71 A;  5LGN A;  2D2W A;  2CWE A;  2DMT A;  2DO7 A;  1P7J A;  2CH0 A;  2PJR B;  2K9L A;  1O57 A;  5J1U A;  1TT5 B;  1PUF A;  2BV6 A;  5M5W J;  1WJD A;  3FBN B;  4XLN F;  5DCF A;  1IDZ A;  4OIN F;  2M1B A;  3DTK A;  2FBI A;  1Z7L A;  5CVJ A;  3BR6 A;  1R71 A;  3OYG A;  2GM4 A;  1HW5 A;  3BTI A;  3LA7 A;  2KKO A;  2YX7 A;  4ZYH A;  4GXO A;  5IP6 A;  2JUC A;  4LLL A;  1YW7 A;  5DUI A;  3BTJ A;  1S5L C;  3GFJ A;  3KP2 A;  3RTR A;  1LB2 A;  1HCR A;  2X1E A;  4HDU A;  3HGY A;  3R4K A;  3EUH C;  3V42 A;  3HSE A;  3PNV A;  2MD5 A;  1RRJ A;  3A2K A;  2IPQ X;  3FWE A;  3M1C A;  1K78 B;  2HQR A;  2LP0 A;  2DDA A;  2GLO A;  1VQN I;  4FHT A;  1R58 A;  4I0A A;  4CCM A;  2HGC A;  1JJ6 C;  2D45 A;  1TT0 A;  1YRN A;  1SD7 A;  4XLH A;  1RNL A;  3IKV A;  5DV5 A;  1K4T A;  4YIF A;  2DCE A;  2FQ4 A;  3HB9 A;  3CO6 C;  4KN7 X;  5BQT A;  1LEB A;  4Q47 A;  4F55 A;  2YU9 J;  4BGD A;  5IT9 Z;  4PCQ A;  5FFZ A;  2CW7 A;  2K86 A;  4NDL A;  3HZJ A;  3W6K B;  4YFX F;  1R5I D;  2IA1 A;  2W48 A;  1VQL I;  5EF6 A;  1TWG J;  2MGQ A;  1D5V A;  3I58 A;  2E19 A;  1D0X A;  3E5U A;  3JRI A;  5FD5 A;  1XGN A;  4LK0 F;  5H20 A;  3RKQ A;  3DXJ F;  4EGY A;  4C3I J;  4KIC A;  3V7R A;  5L3D A;  2PLY A;  2XGE A;  5HLH A;  2DT7 B;  1XGM A;  4M3F A;  2HYJ A;  4HQM A;  3RYP A;  5KHD A;  1ZGA A;  3SXY A;  3EPZ A;  4KIT B;  2R4G A;  5LHH A;  2WV0 A;  2HKX A;  2E1M C;  3BG9 A;  3FHZ A;  2F48 A;  1U5T B;  1AKH A;  5IT9 K;  3WG7 H;  1I6X A;  2DN0 A;  1P2F A;  5LD2 C;  2PQ8 A;  1LKX A;  4L5J A;  1E17 A;  2A68 F;  2LTP A;  5EZG A;  2VKV A;  4LIU A;  2XKP A;  5K7F A;  4RB1 A;  3RSN A;  3J81 K;  3BPX A;  3KFW X;  5HS9 A;  2ID3 A;  3AL0 B;  5JVG F;  2HQN A;  3KLN A;  5B3S H;  3WE2 A;  3ULQ B;  2M30 A;  3EET A;  2F5F A;  1XDU A;  4J19 A;  2M87 A;  2NXN B;  1V55 H;  1PP8 F;  4YII A;  1A04 A;  1YJW I;  2R7Z J;  1T6S A;  3TBI A;  1U6G A;  3CCE I;  5F27 A;  4A6E A;  5DD4 A;  2HVQ A;  4ON0 A;  1F43 A;  1X1P A;  3ABM H;  2EZI A;  1W5C C;  2NYX A;  3MFK A;  1Y39 A;  4RGR A;  3U21 A;  2IJL A;  4UXN A;  4ENN A;  1FWZ A;  2TDX A;  2JSP A;  3LSM A;  3WU2 C;  2FEZ A;  2OA4 A;  2KIQ A;  1F4K A;  1DU6 A;  1B59 A;  3GZ5 A;  1QPM A;  1D5Y A;  2PJP A;  2K3P A;  2M9H A;  4BJ6 C;  1HA8 A;  4L0Y B;  1RKW A;  4RAZ A;  1RUN A;  1SD5 A;  1MH3 A;  1JGS A;  2IW5 A;  1WHU A;  3D5R C;  2ZSI B;  1XMX A;  2BYV E;  4U7D A;  4BE2 A;  2HPM A;  3HTS B;  4HF2 A;  3HIF A;  3IP4 B;  1DP3 A;  2JRM A;  4MFE A;  2LRE A;  1KU7 A;  4IOA F;  4XRS A;  5FLV A;  4B09 A;  4QWQ A;  1YO5 C;  4YRV A;  4AYB N;  3GFL A;  3BCA A;  2LKP A;  1VQ9 I;  3AL0 C;  5D4S A;  1ZKG A;  2VC1 A;  1IDY A;  2LDU A;  5GP9 A;  2VJI A;  1CF7 B;  1X1D A;  2HI3 A;  1Y8Q B;  1T98 A;  3ZPL A;  1A36 A;  2HOE A;  1IN4 A;  3OS1 A;  2OZ6 A;  3DWL E;  2DMU A;  3OS2 A;  3WU0 A;  3C18 A;  5LRS A;  1N77 A;  4HV6 A;  1HC8 A;  3T8T A;  1FYL A;  1WPK A;  1JUM A;  4WXC A;  4RS8 A;  3HOV J;  5CQE A;  2JRT A;  2P5K A;  1NHA A;  1FPQ A;  1UST A;  3KYD B;  5C3E J;  1YW8 A;  1PDN C;  5L3G A;  3H3V K;  3REO A;  2VKE A;  3SYT A;  3TKY A;  4EJU A;  2E2H J;  4M73 A;  4D1Q A;  1PUF B;  2LYC A;  1P4X A;  3WTZ A;  3MMY B;  3KP5 A;  3BDD A;  1MSF C;  1Z6R A;  3T5X A;  2RRE A;  1FOX A;  2X1D A;  2KDO A;  4YG2 F;  3O6B B;  1RKT A;  2EA2 A;  2LG4 A;  1IRX A;  2JSC A;  2GZW A;  2MH2 A;  3PO2 J;  1XGS A;  2EPF A;  3LNQ A;  4IHW A;  1E3H A;  1SMY F;  3OYC A;  3H3U A;  3KEQ A;  2BEO A;  2MW8 A;  5HOO A;  4MIM A;  2OTJ I;  1BI0 A;  1WQ2 A;  2L0K A;  5ILU A;  4M3G A;  3CO7 C;  1R1V A;  3CP8 A;  4LFU A;  4CH7 A;  2COM A;  3AG3 H;  3ELK A;  2LVS A;  1SVL A;  2G0E A;  3OYH A;  1YYV A;  1QZZ A;  2F6C A;  1YRN B;  4I02 A;  1YJ9 I;  2VON A;  2KL4 A;  1FP1 D;  5IP9 J;  4IHS A;  1IRF A;  1JTX A;  4NB5 A;  1U78 A;  4ZDO A;  2JA5 J;  4HLY A;  2MLK A;  1O7F A;  1ON1 A;  2O03 A;  4B8X A;  4RM2 A;  3E5Q A;  3WU1 B;  3LSR A;  1VF9 A;  1MBJ A;  1IGN A;  1QVU A;  5GTI C;  4AYB A;  1T0F C;  4C3H J;  2Z33 A;  2VIX A;  2LLK A;  1D0Z A;  4IO9 F;  4EM0 B;  2LD5 A;  3M4O J;  4FTH A;  1MJ9 A;  1HQC A;  2WAQ N;  1W0T A;  1EA3 A;  2VKD A;  3P9C A;  1U9O A;  4NC8 A;  4HAM A;  2RKH A;  2QKL B;  4CCJ A;  2CG4 A;  2O7O A;  4IL6 C;  1XMA A;  4V19 K;  5CLS A;  3CCL I;  3BR2 A;  1WCM J;  4D5C A;  5CVI A;  3NAR A;  4PJN A;  1AKH B;  2X4H A;  1OFC X;  4HG2 A;  1NK2 P;  1U3E M;  3JRG A;  1TC3 C;  1PVE A;  5J4Y A;  1P9Q C;  2ME0 A;  5DCM A;  4B44 A;  4YFK F;  2F5D A;  1XDS A;  4LMY A;  4IHT A;  4N0B A;  1OCT C;  3MEX A;  2QBY A;  3FXJ A;  3JRF A;  3FXL A;  3ZQQ A;  4D7M A;  1NG6 A;  2DFI A;  3Q9V A;  3HM5 A;  4NBQ A;  2MA3 A;  1IAW A;  5CVU A;  4ANJ A;  1OLT A;  2DOE A;  2OUM A;  4G7Z F;  2R3S A;  3CES A;  1UJ8 A;  1R1T A;  5ICC A;  1Z3X A;  5D5W B;  4IRI A;  5DS9 A;  3M8F A;  3MZH A;  1POG A;  3F22 A;  3R6S A;  2LBF A;  4XR6 A;  2RGV A;  1J5Y A;  4N4N B;  2Z9O A;  1P7I A;  1BJA A;  2R7O A;  4A3L J;  3CMY A;  1XS9 A;  3SZT A;  3ZMV A;  2KQR A;  3PIO F;  2LF8 A;  2DYS H;  2O3F A;  4W1U A;  3J7Z I;  1BW5 A;  3S32 A;  1OYW A;  5DM7 F;  4RMN A;  3J7Y J;  1DU0 A;  4IHV A;  3ZMU A;  1FNN A;  4E7Z A;  2MC4 A;  4TV7 A;  1BR4 A;  1WFX A;  3L2C A;  2QQA A;  1ZGW A;  4D9J A;  5LEK A;  2Q1Z B;  1UHW A;  4Y4R A;  2E1C A;  1S72 I;  1XSV A;  3NQO A;  4FCY A;  3K70 C;  1IRZ A;  2QUF A;  2WAQ A;  4BY1 J;  2V1D A;  2VC0 A;  2HDW A;  4L9N A;  1FYK A;  1FBU A;  4PJJ A;  3RKX A;  3RQI A;  4E7S A;  3E7L A;  2FMY A;  2ADU A;  5GAE J;  5EEG A;  2VE9 A;  1B8I A;  2E5N A;  3I54 A;  1X3W B;  1TQM A;  3EUA A;  4ZZL A;  5D4R A;  4BU2 A;  4JP0 A;  4HNV A;  4IOC F;  4UHT A;  4B1R A;  2VT3 A;  3RI4 A;  2XAQ A;  2LOO A;  5KNL A;  3F6O A;  3K2A A;  1ZLK A;  5CKT A;  2IXS A;  1FIP A;  2FJ1 A;  3TED A;  2NVX J;  1LDK B;  2DA5 A;  4C2T A;  2XF6 A;  1OPC A;  1A6I A;  2Y31 A;  1Y1W J;  2Z1D A;  1XC5 A;  2XSJ C;  1H88 C;  3HUG A;  2VOO A;  2QYO A;  3EUH A;  4JX4 A;  2LK2 A;  2R7T A;  2IS6 A;  1ZRF A;  4KUM A;  5FO5 A;  2XGX A;  3S1Q J;  4G12 A;  1D1C A;  1KU3 A;  1VQ6 I;  1VFC A;  2HFH A;  1DDN A;  2VKH A;  4CYD A;  2K4B A;  1JT0 A;  5EYR A;  4CA0 A;  1R36 A;  3CCS I;  3JW4 A;  4BDZ A;  1Z9C A;  2BBY A;  3WHC A;  3RJP A;  4HZF A;  2Z16 A;  2DBB A;  4XNF A;  3E1S A;  5J6X A;  4EEF G;  1XCB A;  2XRO A;  1YFH A;  4JK1 X;  4BDY A;  2DLL A;  3ISP A;  4X0G A;  1OCP A;  1BC8 C;  3C2G A;  3WHB A;  1BM9 A;  2F4M B;  1YW9 A;  3TW7 A;  1O3Q A;  3HOU J;  1V3F A;  1EH8 A;  2BOL A;  3F0C A;  4PJM A;  5DEQ A;  3S8P A;  4ZTF A;  1MMS A;  3COA C;  3P7N A;  1TNS A;  1XTA A;  2DPU A;  1ETW A;  3QP5 A;  4UVB A;  2DYR H;  2IEK A;  5K1Y A;  3LSP A;  2KP6 A;  4U0V A;  3K4M A;  2OC6 A;  4WK8 F;  3VYT B;  1FBQ A;  4C9Y A;  2R7S A;  1Z67 A;  2VAS A;  3IRR A;  2EIL H;  4ENK A;  2KIF A;  5J47 A;  1W7P A;  1IG7 A;  2V1N A;  2DFH A;  1S6L A;  1O7L A;  4UUS A;  4GFB A;  3W6V A;  1G3Y A;  2R7Q A;  4S05 A;  2GIV A;  1IJW C;  4E7H A;  4OMY A;  5E1Z B;  1MJA A;  1WKM A;  1IXR C;  4HW0 A;  1G4D A;  4UNO A;  3BG6 A;  1IO2 A;  3FXQ A;  2NS7 A;  4G6Q A;  3W2W A;  1I1S A;  2Z99 A;  4ZC3 A;  2KJB A;  3IL2 A;  3JRD A;  2QWW A;  2ACJ A;  3IAM 2;  3HRS A;  1T56 A;  1W5S A;  2EK5 A;  3BR5 A;  5B5E C;  3KE2 A;  2DFE A;  4A3I J;  3U1D A;  3ZRG A;  5CJ9 A;  1OCC H;  3E3V A;  2HDC A;  1X2N A;  3GF2 A;  1ZRE A;  4KJZ A;  2VQL A;  1TP4 A;  4WCG A;  5A2Q Z;  5HDG A;  1KON A;  2XV4 S;  1K79 A;  3QU6 A;  1Z1D A;  3BTC A;  4HA8 A;  1VQ4 I;  5F1R A;  3QU3 A;  4ZZD A;  2HXI A;  4A3J J;  1XSX A;  4UV9 A;  5DTD A;  3DKW A;  2HQA A;  3TMO A;  2LBF B;  4M9X A;  4IZZ A;  4F7Z A;  2BHY A;  4L0Z B;  4HV5 A;  1Q1V A;  2DDB A;  4GYG A;  2KZG A;  2V9K A;  4Y13 A;  2QEX I;  4DIQ A;  1OMI A;  3FF5 A;  5LRR A;  2DT5 A;  2M34 A;  5JR3 A;  1EH7 A;  4XM3 A;  4LLN A;  1OIS A;  1SFK A;  3QQA A;  5EJC A;  4XLP F;  2R5Z B;  5M5X J;  2M8E A;  3MKZ A;  2FQ3 A;  2ZCW A;  4CCK A;  1IZ1 A;  1Z0X A;  3BPV A;  3Q0W A;  4WF2 A;  1JXS A;  1WJE A;  3TO9 A;  4BL0 B;  2JUG A;  2JVG A;  2VB6 A;  5KAI C;  4MTE A;  4J00 A;  4V2G A;  1D1B A;  2KHM A;  2XUB A;  3ERM A;  3G1O A;  2LKX A;  3HHG A;  4R8H A;  3LMM A;  4RGS A;  2IP2 A;  2ESN A;  3ECH A;  2MG4 A;  1ETK A;  2UXN A;  3CJQ B;  1GT0 C;  2EV5 A;  2DI3 A;  3AG2 H;  4JOM A;  3PIP F;  2OF7 A;  3NEU A;  4BYY A;  3AG4 H;  3FMQ A;  3FXR A;  1A31 A;  2ZNY A;  3IAS 2;  1TWH J;  2A61 A;  1WI9 A;  4KIF A;  4UVA A;  3RQ4 A;  1B8I B;  3GFM A;  3H35 A;  4HPQ A;  1B6A A;  3O3K A;  3GZ6 A;  3RIR A;  4EVI A;  3ZMZ A;  1WJC A;  1FT9 A;  2KPM A;  1RR8 C;  3VOE A;  4HX8 A;  5L3F A;  1XN7 A;  1IV6 A;  1XPX A;  4LOC A;  2BXY A;  3BOQ A;  1RUO A;  4B43 A;  4KA4 A;  3HUG B;  2KDZ A;  5DM6 F;  2UV1 A;  2JWT A;  3JRE A;  3OYF A;  2A5Y B;  4K2E A;  1NG7 A;  1WH5 A;  2ELJ A;  2QSH X;  3M07 A;  5FRN A;  1IUY A;  2KRH A;  1BA5 A;  3S17 J;  1BR1 A;  1FP2 A;  3RDI A;  3HXL A;  2Y9Z A;  1MBK A;  1BIA A;  4QTR A;  4BXF A;  4IEJ A;  3G73 A;  3OIQ A;  3HPG A;  3LSI A;  2X48 A;  2ETH A;  2H27 A;  5GTH C;  2Y75 A;  1SFO J;  3CUO A;  1LVA A;  3N97 A;  4BEH B;  3BY6 A;  2XGC A;  4EJV A;  3Q0U A;  2FRH A;  5LBQ A;  4GCV A;  5L3B A;  1H8A C;  3U9G A;  3HG9 A;  3ZOB A;  1ETY A;  2AQE A;  5B1B H;  4CDG A;  3JRA A;  2O6G E;  2FBH A;  2EFW A;  3A01 A;  3E6M A;  3KEY A;  3FXO A;  3O8H A;  1FOY A;  2E1M B;  1W7P B;  2K4J A;  1MMA A;  2W4S A;  3FKJ A;  5JI6 A;  4Q4Z F;  3S15 J;  1LNW A;  3N4M A;  5EEA A;  1HKS A;  3CC2 I;  2E2I J;  5M3F J;  2QSG X;  4UUS B;  3IKT A;  1KU9 A;  3FX3 A;  2E35 A;  4XBF A;  3CLO A;  1YIO A;  5JHU A;  4A3G J;  1T08 B;  1MIJ A;  2BY2 A;  3OR1 C;  1R49 A;  4BBS J;  3FIS A;  2GOM A;  2IA0 A;  2CQX A;  4EAT A;  3L2R A;  2BZT A;  2A3S A;  2ESH A;  1R00 A;  5HS7 A;  1WJ5 A;  3ABU A;  2L9S A;  4ZYD A;  2Y69 H;  2CU7 A;  2BE5 F;  3U2R A;  1GVJ A;  3KX2 A;  2F4I A;  3HC7 A;  3V7S A;  2OPT A;  3ERE D;  2RQP A;  3GW2 A;  3DEU A;  4MLO A;  3EDP A;  1TQI A;  3SHF A;  4A0Z A;  4MEX F;  2E5Z A;  3CME I;  1E3O C;  2XAH A;  3QYE A;  2W25 A;  4ZDP A;  2OV7 A;  3Q9S A;  4L9J A;  3OYL A;  3PL8 A;  1ZG3 A;  1U8B A;  5IPA A;  1OQY A;  2TCT A;  4RB2 C;  2BVL A;  1KA8 A;  3K4C A;  3L7W A;  3J80 Z;  4XRS G;  3ASN H;  4OAZ A;  1U0J A;  2GOX B;  1S7E A;  4ENJ A;  2UWM A;  2V79 A;  2IGO A;  1IRG A;  1GHC A;  5D5X B;  4AM3 A;  3HHH A;  2B9S A;  2E36 A;  3OL4 A;  2ZO4 A;  2GBY A;  4JQF A;  4FT8 A;  1KQ9 A;  3JSP A;  4E6K G;  1Y8R B;  1FX7 A;  1OYI A;  4BE1 A;  3VWB A;  1X1A A;  2H94 A;  3K2Z A;  2A5W A;  1U9N A;  5CYV A;  2A69 F;  3CDL A;  3G6E I;  3QPT A;  3CD6 I;  5LHI A;  5DYM A;  4A0Y A;  1KU2 A;  2O0Y A;  2H1K A;  4HX4 A;  1Z21 A;  2DMP A;  1QBJ A;  3WGG A;  4D0P A;  2FXA A;  1LE8 A;  2MH9 A;  2M3A A;  2DW4 A;  2R0Q C;  1S8N A;  2NAZ A;  3K1P A;  5CPR B;  1SMT A;  3S2H J;  1LFP A;  1KYZ A;  3S3N A;  4X1E A;  3ZR8 X;  2HYF A;  5BNG A;  3LFK A;  4XKC A;  3VB2 A;  2FOK A;  2FNP A;  2A07 F;  2JA8 J;  2VI6 A;  5DDG A;  1X19 A;  4CCO A;  5E3L A;  4XL9 A;  2ELH A;  5E3N A;  1VQ7 I;  3NWS A;  4D7N A;  4KMU X;  3FM5 A;  1OYY A;  1F9N A;  4XLC A;  4EV0 A;  2EZH A;  3ESW B;  3CTA A;  3V7C A;  4DYC A;  4IKF A;  1O3T A;  4XSZ F;  1XSD A;  2OZU A;  5E8G A;  4A3C J;  1Y0N A;  1WSU A;  4E7I A;  3ZN0 A;  2CFO A;  2W1O A;  4R1H A;  3GME A;  2NVY J;  3HYI A;  2LF7 A;  2R7X A;  1DPU A;  1B9M A;  5HNF A;  3HOW J;  1KQ8 A;  2DOF A;  1T38 A;  1SD6 A;  1V54 H;  3M3Y J;  3FKI J;  4M71 A;  5FLX Z;  1J2X A;  2VQC A;  2BHZ A;  3FK7 A;  3G1L A;  4ESJ A;  3K4B A;  5CVV A;  4F93 B;  1JGG A;  4IPA A;  1FIA A;  1VQP I;  2KRC A;  4M74 A;  1XB4 A;  2HQ5 A;  2WY7 Q;  1UEL B;  1FTT A;  3E6B A;  3KPH A;  5M5Y J;  3TW6 A;  2VJ4 A;  3ASO H;  3ZP5 A;  3S2D J;  4LK1 F;  1R9T J;  2QKM B;  2JMW A;  2D1H A;  1HW2 A;  3OYD A;  3FZV A;  4A3B J;  2CQK A;  5H6R A;  4U0W A;  4HYE A;  4MQ9 F;  4A3M J;  3E97 A;  4I76 A;  2EFN A;  3GTP J;  5FLX K;  1IN6 A;  1DUX C;  2VQG A;  4CZC A;  4BY7 J;  3GCM A;  3IH2 A;  3WGH A;  1ZHF A;  2LY2 A;  3H9Q A;  3KP3 A;  3GTQ J;  1MDM A;  4EM2 A;  3I0T A;  4HF0 A;  5FRO A;  3MWM A;  4M9Z A;  4OMZ A;  5FKO A;  2ISY A;  4B3A A;  2X6O A;  2ME6 A;  3ECO A;  2W24 A;  5E3O A;  3DEE A;  3RKW A;  2QQ9 A;  2XAS A;  3P9K A;  1WI3 A;  5ILV A;  3S1N J;  1GV2 A;  1QO0 D;  3DPL C;  1OJL A;  1OCO H;  2E1N A;  3ZGK A;  4ZYE A;  3ZMT A;  2W7N A;  2B0L A;  3A01 B;  2Y0S N;  1QHG A;  3KP4 A;  5E3M A;  3TOB A;  3F21 A;  2JPB A;  2XF5 A;  2HEO A;  2K40 A;  1GV5 A;  1MKM A;  1YIJ I;  3HPH A;  5E20 A;  3JCU C;  4P1W A;  4AIH A;  2XRN A;  1QZE A;  3T0Y A;  3G2B A;  3GTO J;  3K1M A;  2M4G A;  1GXP A;  2P6S A;  4A3F J;  2GXB A;  4BQN A;  2ID6 A;  1MSE C;  4ESF A;  2B7E A;  1NH3 A;  1IXS B;  2X9D A;  3IH4 A;  4BJT A;  4WWC A;  2XHK A;  4XKB A;  4EM1 A;  5LGU A;  2DK8 A;  2IA2 A;  3DQV C;  4BAY A;  2YR2 A;  1FMW A;  2RVC A;  3K7A J;  3KIO A;  3FXM A;  3CCV I;  1BI1 A;  3HKZ N;  4EJO A;  2DFF A;  4ETS A;  2HVR A;  3ZQH A;  1SC7 A;  1VND A;  2YUS A;  3BJA A;  3F72 A;  4OAY A;  4RB0 A;  4GYI A;  4MQV A;  2IS4 A;  5JHF A;  1AOY A;  5HVQ C;  5FD6 A;  1MMD A;  1MMG A;  3FMR A;  2DT6 A;  4I6Z A;  3VYU B;  4ITV A;  5KCM A;  4BQQ A;  1W36 C;  2X85 A;  1IUF A;  3W2A A;  1N78 A;  1ZLJ A;  3OIP A;  1KYW A;  5BPI A;  4DOZ A;  1JJ8 C;  5IOY A;  4G9Y A;  2JJ7 A;  1S9H A;  4II3 A;  3WTY C;  1GXQ A;  1TBX A;  4PFO A;  1B9N A;  2P7V B;  3OL3 A;  3OYJ A;  1UHS A;  1JKR C;  1K4S A;  1MZB A;  5J1R A;  4PDK A;  1J9I A;  4M6V A;  2L01 A;  3QAH A;  3OSG A;  1V5G A;  3E0J B;  1LE8 B;  1YQA A;  2I5U A;  3WTV C;  1TZL A;  1WJA A;  5H6Q A;  2ZJP F;  4UUT A;  1UCR A;  4UB6 C;  1T8I A;  4BQO A;  2OJE D;  2M2E A;  4HX7 A;  2Y0S A;  2AXT C;  1G2H A;  4BXX J;  2P0W A;  4FX4 A;  2DTR A;  2EJR A;  3Q0V A;  2Y0M A;  3I4P A;  4HRI A;  2BVM A;  1SD4 A;  2ELK A;  3L2U A;  2V7F A;  2A6E F;  2NS8 A;  4M6X A;  3ZN1 A;  1WH7 A;  2XAJ A;  3K10 A;  2VL8 A;  1USS A;  3FBI B;  4XLF A;  5L3C A;  3LAJ A;  1MMN A;  3K4N A;  1XMK A;  1R7J A;  2BW3 A;  1FY7 A;  2QLZ A;  2ZC2 A;  5JVT A;  1T2K A;  1ACI A;  5J3L A;  3H5N A;  3OR2 C;  4LB5 A;  5BS6 A;  2ZXI A;  3VSK A;  2P81 A;  3LAP A;  4RB3 C;  5CVR A;  4AIK A;  1K61 A;  4O5V A;  1T33 A;  3HKZ A;  3OIO A;  3QOE A;  5E79 C;  4R79 A;  4LLG F;  4D5F A;  1F36 A;  3PM1 A;  4IRH A;  3J7A O;  1AA7 A;  2XAF A;  1QA6 A;  3T8R A;  5IP7 J;  4HDV A;  2GXA A;  5FGM A;  3ZMD A;  2KIS A;  5IOZ A;  2DPD A;  2FBK A;  3BLY A;  1NK3 P;  4ZJZ A;  2QGU A;  2M4K A;  4J01 A;  3P5J A;  2ZJ2 A;  2A6T A;  2CS3 A;  3K6G A;  3QWL A;  3WE3 A;  3AAF A;  4QIW N;  2MD0 A;  4WXD A;  1ETO A;  1UFM A;  3ZQG A;  2R7W A;  2R7R A;  3HRU A;  3GTK J;  4AIJ A;  4ASN A;  2IAI A;  4RGU A;  4RGX A;  2M5W A;  3DKY A;  5HLG A;  1JI8 A;  1SAX A;  2K9S A;  3BQY A;  2JT1 A;  1LDJ A;  2X1C A;  2CUJ A;  3GZN B;  5D8L B;  4PFP A;  1WZ2 A;  1P4W A;  3HL2 A;  3KZZ A;  1ERD A;  1DGW Y;  4GDF A;  2CYY A;  5D6E A;  3G71 I;  5DD8 A;  1G59 A;  5E8I A;  2QM3 A;  1MDM B;  4F52 A;  3FIW A;  2MYS A;  3I56 I;  2ISZ A;  3CCR I;  2O8K A;  3BT9 A;  1K6O A;  1GUU A;  2N8G A;  3K9T A;  3MVP A;  3DP7 A;  3QYB A;  1D0Y A;  3JR9 A;  3GWZ A;  2DQR A;  1LJ9 A;  3KET A;  1ITY A;  2VE8 A;  2QVO A;  2QQB A;  2DA1 A;  1B4A A;  2XVC A;  3GLL A;  3OYM A;  5L3E A;  1B72 A;  2X6Y A;  2ECB A;  4JBA A;  4RAF A;  1RPW A;  1VQ5 I;  3IHU A;  1FMV A;  3HSF A;  3C3W A;  2CV1 A;  1J75 A;  2VXD A;  3O8G A;  4ESB A;  1UAA A;  2HTS A;  3R61 A;  1G3W A;  2DJN A;  5IYB J;  4HNU A;  2CQ7 A;  5F0H A;  2ZXJ A;  3AG1 H;  2TRT A;  4C2M J;  3CJR B;  5FLM J;  2HKO A;  2HZT A;  4N4O B;  4OIP F;  4G7H F;  2XPV A;  4XQF A;  3S14 J;  1BJZ A;  4QSH A;  4L9T A;  1DGR M;  2DU9 A;  1X1B A;  4M3B A;  5EDN A;  3CMM A;  3C2H A;  3PJR A;  3L2Q A;  2WAE A;  3HGG A;  5HDK A;  4BHB A;  2ZSH B;  2PMH A;  3B73 A;  1IN8 A;  2FF4 A;  2FA5 A;  5ICG A;  3H0G J;  3H5R A;  1R23 A;  5GPC A;  3HOZ J;  3CJT B;  1JKP C;  3UR3 C;  2V1U A;  1G6N A;  3SQN A;  3BZC A;  1WGX A;  1YX5 A;  1Z05 A;  2XF7 A;  4DBR A;  3WTU C;  4IX7 A;  3ROU A;  2C6Y A;  4PSX A;  1YX3 A;  4UVC A;  2WY8 Q;  3CDI A;  5D6F A;  5B66 C;  3CDH A;  3EQL F;  3VPR A;  1IC8 A;  5E17 F;  5FB2 A;  2VUM J;  3MKW B;  2P6T A;  2O61 A;  3ABK H;  4FQG A;  3SZG A;  1OR7 A;  3LQQ A;  1YTY A;  2V6C A;  1T39 A;  3BTL A;  1I27 A;  2K5C A;  3DBH B;  2YPR A;  4IHX A;  1LFU P;  4NQW A;  1TQP A;  5GAG J;  1Z91 A;  1ZG5 A;  1HKT A;  3ONQ A;  1XCV A;  1C0W A;  3M8E A;  5DCM B;  3F8B A;  2HU9 A;  4CUG A;  3OMY A;  2QBY B;  1BC7 C;  1ZG1 A;  2DMQ A;  5JFR A;  1ENH A;  3GVA A;  2GA2 A;  1I50 J;  1HXD A;  3HJE A;  1Z3Y A;  5EG0 A;  4G6D A;  3PUF A;  4M3E A;  4O3M A;  1EH6 A;  2E60 A;  2VBX A;  2HS5 A;  3LSH A;  3FHN A;  4AU7 A;  2FOW A;  4A0X A;  3TO7 A;  4M3D A;  4Y3O A;  1YIT I;  2XAG A;  4L5I A;  4XKV A;  4Y17 A;  3HRM A;  2NVT J;  1YHQ I;  3E5X A;  1VQM I;  2BW3 B;  1UHM A;  2V1X A;  4RLQ A;  1YS6 A;  3G1M A;  4E7L A;  2NNN A;  3HTU A;  1FZP B;  1W5T A;  4RA2 A;  2GWR A;  1T95 A;  1R5G A;  1WRJ A;  3CCJ I;  2DTZ A;  4PZJ A;  1EKE A;  4HBL A;  3A03 A;  4PK4 A;  3GYH X;  4CXF A;  1U5T A;  2BXZ A;  1YG2 A;  5A2Q K;  3EUK L;  1YOV B;  1LUJ B;  3F8M A;  5IYC J;  4CCN A;  3JAM Z;  1FOW A;  2EIJ H;  5H2F C;  3CC4 I;  2EQR A;  1RR7 A;  3LFU A;  3BP8 A;  4MFD A;  2QF7 A;  3JTH A;  4S04 A;  2Z2S B;  2WB1 N;  2X51 A;  1ZRD A;  3DLA A;  2VBY A;  1R22 A;  3RZD J;  3BJ6 A;  4OIR F;  4EQQ A;  1X1C A;  2MAB A;  2OQG A;  3H0D A;  3LA3 A;  2LNB A;  4CZZ A;  2DMN A;  2CV2 A;  1ZGJ A;  3CJN A;  3Q3S A;  4ZYA A;  3GFI A;  4P55 A;  1EF4 A;  2RQQ A;  5E18 F;  3H1C A;  3WTX C;  3WTT C;  3KP6 A;  2K9Q A;  2FX0 A;  1OCR H;  3JAM K;  3KZY A;  4P9F A;  1TW2 A;  2Q2E A;  3C2B A;  3OYA A;  2UUZ A;  2XGD A;  2HOS A;  2EFO A;  1W4M A;  2KZV A;  4AVZ A;  3IRQ A;  5M3M J;  1PUE E;  4CYC A;  4Y33 A;  1X2M A;  3DFG A;  3CCM I;  1S29 A;  1NTC A;  3OYN A;  1JHF A;  1E2X A;  2CW8 A;  3SEQ A;  3ABT A;  2COB A;  3D5S C;  1B72 B;  4BS9 A;  3WG9 A;  1I3Q J;  1XX5 A;  3JRB A;  2NVU B;  3A0H C;  2CMP A;  3F3X A;  1JUP A;  2BGC A;  1SFX A;  2DA2 A;  2QCO A;  5FRM A;  1VZ0 A;  4CCL A;  1RC9 A;  1ETQ A;  2HPI A;  2V9P A;  4WXH A;  1FLI A;  4HEA 2;  2JPC A;  4Z6Y A;  2M8G X;  1MBH A;  2PX9 A;  5GPA A;  2L9R A;  2LMD A;  3BZ6 A;  1OCZ H;  1MH4 A;  1IV8 A;  2OCC H;  4NNJ A;  2CUZ A;  3QRF F;  3JTG A;  2DA3 A;  3DKX A;  4U87 A;  3SFI A;  2XIG A;  5FKN A;  3BG3 A;  3MZY A;  1TW3 A;  3BJO A;  3DTE A;  1X4O A;  4KFC A;  1HDD C;  1ZR2 A;  4ZH4 F;  2QSF X;  5J4V A;  2W84 A;  3CF2 A;  2EIK H;  2XAU A;  2K27 A;  2L7M P;  2WB1 A;  2P8T A;  2W00 A;  4QPQ A;  1H9T A;  4XSX F;  2JA7 J;  2VN2 A;  4LJZ F;  3TP0 A;  4AD9 A;  1TTY A;  1L0O C;  3OYB A;  2CJJ A;  1AHD P;  2ZBK A;  2IBD A;  4PSW A;  3CQZ J;  5D5V B;  3SJM A;  1PP7 U;  1LQ1 A;  3LSG A;  5TGT A;  2L7K A;  5EZH A;  3KP7 A;  5GAD J;  2FSW A;  3BG7 A;  1DPR A;  1A5J A;  4E7J A;  1R5H A;  4PGG A;  2M7B A;  1J59 A;  2V6E A;  4A3E J;  4RDU A;  3FM3 A;  4G7O F;  2CGP A;  2Q8K A;  3A1Y A;  2VBW A;  3BZK A;  4NQW B;  4RBO A;  2JA2 A;  1QQI A;  2HOA A;  3DPU A;  2EBI A;  2JA6 J;  4HOB A;  3JRC A;  5C4X J;  1V4R A;  3FMS A;  4E4H A;  3F8F A;  4MO7 A;  2UZK A;  1G3S A;  1AU7 A;  3H3Z A;  5J1Y A;  2RN7 A;  2PN6 A;  2M0M A;  3LST A;  5HOD A;  2XSD C;  1F5T A;  1D1A A;  3H9G A;  4G8X A;  3GTJ J;  4XRF A;  4AVP A;  4PUS A;  1AWC A;  4AUX A;  4UY8 I;  3A4C A;  5EG0 B;  2XB0 X;  2EZK A;  1I1G A;  1UG0 A;  4A2U A;  2WC2 A;  1HKQ A;  2LSO A;  1IF1 A;  1MBG A;  2BY1 A;  4G94 A;  2WAD A;  2M45 A;  3BR0 A;  2DA4 A;  3HRT A;  4XON A;  3OOP A;  3DCF A;  1ORK A;  3ZQ7 A;  5ICE A;  3J81 Z;  2VJJ A;  4PJ0 C;  1O3R A;  1IN7 A;  2E34 A;  1ONV A;  3J80 K;  2ECC A;  2PBI A;  2Y2Z A;  3IC7 A;  3HOT A;  1WJF A;  1W0U A;  2EFP A;  1BOA A;  4BHP A;  2R92 J;  3LA2 A;  2KMU A;  2LY9 A;  4GRI A;  2DK5 A;  2LKS A;  2VJ5 A;  1JKQ C;  4HF1 A;  2I8D A;  4CO8 A;  1GLN A;  4F3Q A;  5GAH J;  3IWF A;  5TIS C;  5J40 A;  4BBR J;  1TWC J;  4XOT A;  5K7Z A;  1OR7 C;  1MW7 A;  4NC7 A;  4IQ4 A;  3OSF A;  2UXX A;  2R5Y A;  1REP C;  3L2V A;  2NRA C;  3IV5 A;  3ZQF A;  3QP6 A;  4B47 A;  3BR3 A;  3C1D A;  3I5U A;  4OIQ F;  4O6J A;  1SFE A;  3NWT A;  3W2V A;  1TLH B;  5KK1 A;  3M1E A;  1EV7 A;  3KYC B;  4ZDL A;  1OKR A;  3RPU D;  2IS1 A;  1QZY A;  5IT3 A;  3S93 A;  2CRG A; 
#chains in the Genus database with same CATH homology
 4A12 A;  4MGR A;  3JSO A;  5E1X A;  2X0L A;  1LEA A;  2MLG A;  5D5U B;  1XD7 A;  3DF8 A;  1U8R A;  3DV8 A;  5J8C A;  3KEO A;  2ZME A;  3W6J B;  2R7D A;  4ZYG A;  1IN5 A;  5ERI A;  3M9A A;  2STT A;  4P96 A;  2HYG D;  1MJB A;  4WX9 A;  3VOD A;  1ZRC A;  1S7A A;  3TDU C;  4N9I A;  2AS5 F;  4BHC A;  1U5T C;  5HS8 A;  6PAX A;  1HBX G;  4KYW A;  3V4G A;  4A5N A;  1BI2 A;  2E7X A;  5AIQ A;  2CFX A;  3WTS C;  1W7P D;  5LLQ A;  2FE3 A;  5K5R A;  4P9U A;  2P4W A;  2PI0 A;  3D0S A;  4M6Y A;  2QEN A;  1H0M A;  3D5L A;  2NS0 A;  4DNC A;  4Y15 A;  5LEJ A;  1FOK A;  2OAZ A;  3K69 A;  2GQQ A;  1MGT A;  4KMF A;  5K5Q A;  4YFN F;  4IXA A;  2E7W A;  2W57 A;  3SZP A;  2K7L A;  4MEY F;  4I98 B;  2YX4 A;  1S3J A;  4DQ2 A;  4KNY A;  2AXL A;  2EV6 A;  1WWX A;  3ZMS A;  4Z2Y A;  2KJC A;  2G9W A;  4GGG A;  2CW0 F;  4EJT A;  2ZFW A;  1I5Z A;  5F64 A;  2H6B A;  4LB6 B;  3KCC A;  3BRO A;  5AIP A;  1DP7 P;  1X3U A;  2VXZ A;  2PFB A;  3GX4 X;  1ZH5 A;  1KGS A;  3WOD F;  3LWF A;  3BWG A;  5F6F A;  3V8L A;  2J5P A;  4IJA A;  4LD5 A;  2L02 A;  5EEH A;  2KIM A;  3OV8 A;  2GA1 A;  3S2W A;  3PQK A;  1Q1H A;  4MTD A;  4HQE A;  2EWN A;  2QZ8 A;  1ZN2 A;  1D3Y A;  4IVN A;  2KIU A;  4I0B A;  3GEZ A;  1Z6T A;  2KRF A;  3R0A A;  1K7A A;  1MD0 A;  2IT0 A;  4L18 B;  2MBF A;  2RC4 A;  3RKY A;  2Y48 A;  3TO6 A;  4ENM A;  4E70 A;  2L4M A;  2A6H F;  2GXG A;  4CIC A;  3EYI A;  4H0E A;  2HTJ A;  2EFQ A;  1F1Z A;  5HLI A;  1IXC A;  3RPQ A;  4UV8 A;  1ODD A;  2Q0O A;  2IRF G;  2FU4 A;  4OOI A;  3F8C A;  3NRV A;  2G7H A;  2W85 A;  2H6C A;  3RYR A;  2JTV A;  4LG0 A;  3F8N A;  3K1N A;  2RDP A;  2OQR A;  4PGH A;  2ZME B;  1P4A A;  3I59 A;  4A5M A;  3B02 A;  2EV0 A;  4KT5 C;  1O3S A;  2JZY A;  3MAJ A;  3M7G A;  1L3L A;  2ZNZ A;  4BH9 A;  2P5V A;  3CUQ A;  1UB9 A;  4KIG A;  3HOS A;  3TQN A;  2CO5 A;  5BPD A;  1B1B A;  4U7B A;  5FFX A;  4I01 A;  2MC3 A;  4Q48 A;  1D8K A;  2L3D A;  1H9G A;  2DQL A;  3MCZ A;  2O8X A;  1ZAR A;  4RAY A;  1LDD A;  1XGO A;  5AON A;  3C7J A;  3QPH A;  1JE8 A;  4I2O A;  3V8K A;  2STW A;  1YS7 A;  4L9V A;  2ZKZ A;  4U0Y A;  3RPU A;  5ED4 A;  1RIO H;  3TGN A;  1HW1 A;  5HDN A;  2FNA A;  2J5O A;  2H09 A;  3Q5F A;  1CGP A;  2CSO A;  2OD5 A;  2OBP A;  3F23 A;  4A6D A;  3WGI A;  1U2W A;  3KLO A;  3ML6 A;  1IW7 F;  3TOA A;  5D8K B;  5LGT A;  1FSE A;  2L4A A;  3E6C C;  1BBY A;  4CHU A;  4BXU A;  1P92 A;  3P9I A;  4IF4 A;  2IVM A;  1RI7 A;  4BNC A;  5BMZ A;  1G3T A;  5TJJ A;  3R0J A;  3QOP A;  4EGZ A;  3PFI A;  1P6R A;  1Y0U A;  4CGZ A;  2D1V A;  3EYY A;  3F6V A;  3VFZ A;  5BOX A;  1QNT A;  2VOP A;  2HWV A;  2WWY A;  2PEX A;  3HSR A;  1K78 A;  3R60 A;  4M9S A;  2F5E A;  2PG4 A;  1J7K A;  2L54 A;  2XKO A;  4KIB A;  4LGW A;  3SFZ A;  4I09 A;  2EB7 A;  2NNY A;  1HST A;  1D8J A;  1FSH A;  2K02 A;  3GUD A;  1ZAO A;  4AWX B;  1FYM A;  1BIB A;  5E1W A;  3E6D A;  3L9F A;  4MHG A;  2Z5U A;  4OU0 A;  5KVR A;  5LHG A;  4MNU A;  4LG0 B;  3LQR A;  2P7C B;  4Q5S F;  1Z7U A;  1QGP A;  5K5O A;  3GLX A;  1JHH A;  1YLF A;  1RZ4 A;  3I53 A;  3I59 B;  5ILS A;  1BI3 A;  1S7O A;  2EA4 A;  3L09 A;  4KDP A;  3FXU A;  3CUQ B;  1ON2 A;  2F5C A;  3WTW C;  2V9V A;  3PQJ A;  2DAO A;  1J0R A;  2OU2 A;  2VBZ A;  3VEP A;  2HR3 A;  1VTN C;  4N9H A;  1R1U A;  1ULY A;  4M72 A;  3GO5 A;  2F2E A;  5DUK A;  3MQ0 A;  2G7U A;  2PMU A;  3V8J A;  5ICF A;  2FML A;  2RNJ A;  4OIO F;  3K0L A;  5J8F A;  2YU3 A;  4FX0 A;  4KN4 X;  4EMS A;  4I7H A;  3IWZ A;  5TRD A;  1SFU A;  2VOD A;  3GXO A;  2WTE A;  1FBS A;  1TNT A;  2GAU A;  2RV8 A;  3I64 A;  2YSR A;  4HLX A;  4NHJ A;  3L00 A;  4BQA A;  2R7F A;  3H92 A;  1FC3 A;  3DPT A;  3O2P E;  4IRG A;  4UUV A;  1ZYR F;  4P5O A;  1KQ0 A;  3CUQ C;  4EJW A;  2P5L C;  1BN5 A;  1CF7 A;  2VT2 A;  4U88 A;  1HSJ A;  3T1B A;  4GO1 A;  2Z3Y A;  3G3Z A;  1STZ A;  3TDZ C;  1T0F A;  4QLC U;  3I71 A;  5LGN A;  2D2W A;  2CWE A;  2DO7 A;  1O57 A;  2BV6 A;  4XLN F;  5DCF A;  4OIN F;  2M1B A;  2FBI A;  5CVJ A;  1HW5 A;  3LA7 A;  2KKO A;  2YX7 A;  4ZYH A;  4GXO A;  4LLL A;  1YW7 A;  5DUI A;  3GFJ A;  3KP2 A;  3RTR A;  1LB2 A;  4HDU A;  3R4K A;  3HSE A;  2MD5 A;  2IPQ X;  3FWE A;  1K78 B;  2HQR A;  4FHT A;  1R58 A;  4I0A A;  2HGC A;  2D45 A;  1SD7 A;  1RNL A;  3IKV A;  5DV5 A;  4YIF A;  3CO6 C;  4KN7 X;  5BQT A;  1LEB A;  4Q47 A;  5IT9 Z;  4PCQ A;  5FFZ A;  4YFX F;  2K86 A;  3W6K B;  1D5V A;  2IA1 A;  3I58 A;  3E5U A;  5FD5 A;  1XGN A;  4LK0 F;  5H20 A;  3DXJ F;  4EGY A;  4KIC A;  3V7R A;  5L3D A;  2PLY A;  5HLH A;  1XGM A;  4HQM A;  3RYP A;  1ZGA A;  3SXY A;  5LHH A;  2WV0 A;  2HKX A;  3FHZ A;  1U5T B;  5IT9 K;  1I6X A;  1P2F A;  2PQ8 A;  4L5J A;  1E17 A;  2A68 F;  2XKP A;  4RB1 A;  3J81 K;  3BPX A;  3KFW X;  5HS9 A;  2HQN A;  3KLN A;  3WE2 A;  3ULQ B;  2M30 A;  3EET A;  2F5F A;  1XDU A;  1PP8 F;  2M87 A;  4YII A;  1A04 A;  1T6S A;  1U6G A;  4A6E A;  5DD4 A;  4ON0 A;  2NYX A;  3MFK A;  4RGR A;  2IJL A;  4UXN A;  4ENN A;  1FWZ A;  2TDX A;  2FEZ A;  2OA4 A;  1F4K A;  1B59 A;  3GZ5 A;  1QPM A;  2PJP A;  4L0Y B;  4RAZ A;  1RUN A;  1SD5 A;  1JGS A;  2IW5 A;  3HTS B;  2BYV E;  4U7D A;  4HF2 A;  3HIF A;  1KU7 A;  4B09 A;  4QWQ A;  1YO5 C;  3GFL A;  2LKP A;  5D4S A;  2VC1 A;  2LDU A;  1CF7 B;  1T98 A;  3ZPL A;  2HOE A;  1IN4 A;  2OZ6 A;  3WU0 A;  3C18 A;  5LRS A;  4HV6 A;  3T8T A;  1FYL A;  4WXC A;  4RS8 A;  2JRT A;  2P5K A;  1UST A;  1NHA A;  1FPQ A;  1YW8 A;  1PDN C;  5L3G A;  3REO A;  4EJU A;  3TKY A;  4M73 A;  1P4X A;  3WTZ A;  3KP5 A;  3BDD A;  1Z6R A;  3T5X A;  4YG2 F;  3O6B B;  2EA2 A;  2JSC A;  2GZW A;  2MH2 A;  1XGS A;  1SMY F;  3H3U A;  3KEQ A;  2BEO A;  5HOO A;  1BI0 A;  1WQ2 A;  5ILU A;  3CO7 C;  1R1V A;  4LFU A;  2COM A;  3ELK A;  1YYV A;  1QZZ A;  4I02 A;  2VON A;  1FP1 D;  4IHS A;  1IRF A;  4NB5 A;  1U78 A;  4HLY A;  2MLK A;  1O7F A;  1ON1 A;  2O03 A;  4B8X A;  3E5Q A;  3WU1 B;  2Z33 A;  4EM0 B;  1MJ9 A;  1HQC A;  3P9C A;  4HAM A;  2RKH A;  2CG4 A;  1XMA A;  5CLS A;  5CVI A;  2X4H A;  1U3E M;  5DCM A;  4YFK F;  2F5D A;  1XDS A;  4LMY A;  4IHT A;  4N0B A;  3MEX A;  2QBY A;  2DFI A;  3Q9V A;  2MA3 A;  1IAW A;  5CVU A;  4G7Z F;  2R3S A;  1R1T A;  5ICC A;  5D5W B;  4IRI A;  3M8F A;  3MZH A;  3F22 A;  3R6S A;  2RGV A;  1J5Y A;  2Z9O A;  1BJA A;  3SZT A;  3ZMV A;  2LF8 A;  2O3F A;  1OYW A;  3ZMU A;  1FNN A;  4TV7 A;  3L2C A;  2QQA A;  5LEK A;  1UHW A;  2E1C A;  1XSV A;  3NQO A;  2QUF A;  2V1D A;  2VC0 A;  4L9N A;  1FYK A;  1FBU A;  3RKX A;  2FMY A;  2ADU A;  5EEG A;  2VE9 A;  3I54 A;  1TQM A;  4ZZL A;  5D4R A;  4UHT A;  2VT3 A;  3RI4 A;  2XAQ A;  3F6O A;  1ZLK A;  1LDK B;  1OPC A;  2VOO A;  3HUG A;  2QYO A;  3EUH A;  1ZRF A;  4KUM A;  5FO5 A;  2XGX A;  1KU3 A;  1DDN A;  2HFH A;  4CYD A;  2K4B A;  1R36 A;  3JW4 A;  1Z9C A;  2BBY A;  3RJP A;  4HZF A;  2DBB A;  5J6X A;  1XCB A;  2XRO A;  1YFH A;  4JK1 X;  2DLL A;  3ISP A;  1BC8 C;  1BM9 A;  1YW9 A;  1O3Q A;  1V3F A;  1EH8 A;  5DEQ A;  3COA C;  3P7N A;  1TNS A;  2DPU A;  3QP5 A;  4UVB A;  5K1Y A;  4U0V A;  4WK8 F;  1FBQ A;  3IRR A;  4ENK A;  2KIF A;  1W7P A;  1S6L A;  1O7L A;  1G3Y A;  4S05 A;  2GIV A;  4OMY A;  5E1Z B;  1MJA A;  1WKM A;  1IXR C;  4HW0 A;  1G4D A;  4UNO A;  3FXQ A;  4G6Q A;  1I1S A;  2Z99 A;  2KJB A;  3IL2 A;  2QWW A;  2ACJ A;  3HRS A;  1W5S A;  2EK5 A;  3KE2 A;  3U1D A;  5CJ9 A;  3E3V A;  2HDC A;  3GF2 A;  1ZRE A;  4WCG A;  5A2Q Z;  5HDG A;  2XV4 S;  1K79 A;  3QU6 A;  1Z1D A;  4HA8 A;  5F1R A;  3QU3 A;  4ZZD A;  1XSX A;  4UV9 A;  3DKW A;  4M9X A;  4F7Z A;  4L0Z B;  4HV5 A;  4GYG A;  4Y13 A;  1OMI A;  3FF5 A;  5LRR A;  2DT5 A;  5JR3 A;  1EH7 A;  4LLN A;  4XLP F;  2M8E A;  2FQ3 A;  2ZCW A;  1IZ1 A;  3BPV A;  4WF2 A;  1JXS A;  3TO9 A;  4MTE A;  2XUB A;  3HHG A;  4R8H A;  4RGS A;  2IP2 A;  2ESN A;  3ECH A;  2UXN A;  2EV5 A;  2DI3 A;  4BYY A;  3NEU A;  3FMQ A;  3FXR A;  2ZNY A;  2A61 A;  1WI9 A;  4KIF A;  4UVA A;  3GFM A;  1B6A A;  3O3K A;  3GZ6 A;  3RIR A;  4EVI A;  3ZMZ A;  1FT9 A;  3VOE A;  4HX8 A;  5L3F A;  1XN7 A;  3BOQ A;  1RUO A;  4KA4 A;  2A5Y B;  4K2E A;  1IUY A;  1FP2 A;  3RDI A;  1BIA A;  3G73 A;  2ETH A;  2H27 A;  2Y75 A;  3CUO A;  1LVA A;  3N97 A;  3BY6 A;  4EJV A;  2FRH A;  5LBQ A;  4GCV A;  5L3B A;  3U9G A;  4CDG A;  2O6G E;  2FBH A;  2EFW A;  3E6M A;  2K4J A;  1W7P B;  5JI6 A;  4Q4Z F;  1LNW A;  3N4M A;  1HKS A;  3IKT A;  1KU9 A;  3FX3 A;  4XBF A;  1YIO A;  3CLO A;  5JHU A;  2IA0 A;  2A3S A;  2ESH A;  1R00 A;  5HS7 A;  3ABU A;  4ZYD A;  2BE5 F;  3U2R A;  1GVJ A;  3V7S A;  3ERE D;  2RQP A;  3GW2 A;  3DEU A;  3EDP A;  1TQI A;  4A0Z A;  3SHF A;  4MEX F;  2XAH A;  2W25 A;  3Q9S A;  4L9J A;  1ZG3 A;  4RB2 C;  1KA8 A;  3L7W A;  3J80 Z;  4ENJ A;  2UWM A;  2V79 A;  1IRG A;  1GHC A;  5D5X B;  3HHH A;  2ZO4 A;  4JQF A;  4FT8 A;  1KQ9 A;  3JSP A;  1FX7 A;  1OYI A;  2H94 A;  3K2Z A;  5CYV A;  2A69 F;  3QPT A;  5LHI A;  5DYM A;  4A0Y A;  1KU2 A;  2O0Y A;  4HX4 A;  1QBJ A;  3WGG A;  4D0P A;  2FXA A;  2MH9 A;  2DW4 A;  1S8N A;  2NAZ A;  3K1P A;  1SMT A;  1KYZ A;  2HYF A;  3LFK A;  3VB2 A;  2FOK A;  2FNP A;  2A07 F;  5DDG A;  2ELH A;  4KMU X;  3FM5 A;  1F9N A;  1OYY A;  4EV0 A;  3CTA A;  3V7C A;  1O3T A;  4XSZ F;  1XSD A;  2OZU A;  5E8G A;  1WSU A;  3ZN0 A;  4R1H A;  3HYI A;  2LF7 A;  1DPU A;  1B9M A;  1KQ8 A;  1T38 A;  1SD6 A;  4M71 A;  5FLX Z;  1J2X A;  4ESJ A;  5CVV A;  4IPA A;  4M74 A;  1XB4 A;  3E6B A;  3ZP5 A;  4LK1 F;  2D1H A;  1HW2 A;  3FZV A;  2CQK A;  5H6R A;  4U0W A;  4HYE A;  4MQ9 F;  3E97 A;  2EFN A;  5FLX K;  1IN6 A;  1DUX C;  3WGH A;  1ZHF A;  3KP3 A;  1MDM A;  4EM2 A;  3I0T A;  4HF0 A;  3MWM A;  4M9Z A;  4OMZ A;  2ISY A;  3ECO A;  2W24 A;  3RKW A;  2QQ9 A;  2XAS A;  3P9K A;  5ILV A;  1QO0 D;  3DPL C;  2E1N A;  4ZYE A;  3ZMT A;  2B0L A;  3KP4 A;  3TOB A;  3F21 A;  2JPB A;  2HEO A;  1MKM A;  5E20 A;  4AIH A;  2XRN A;  3T0Y A;  3K1M A;  1GXP A;  2P6S A;  2GXB A;  4ESF A;  1IXS B;  4WWC A;  2XHK A;  4EM1 A;  5LGU A;  2DK8 A;  2IA2 A;  3DQV C;  4BAY A;  2YR2 A;  2RVC A;  1BI1 A;  4EJO A;  4ETS A;  3BJA A;  3F72 A;  4RB0 A;  4GYI A;  4MQV A;  1AOY A;  5HVQ C;  5FD6 A;  3FMR A;  1ZLJ A;  1KYW A;  5BPI A;  4G9Y A;  3WTY C;  1GXQ A;  1TBX A;  1B9N A;  2P7V B;  1MZB A;  4PDK A;  1J9I A;  2L01 A;  3QAH A;  1YQA A;  3WTV C;  5H6Q A;  1UCR A;  4HX7 A;  4FX4 A;  2DTR A;  2EJR A;  2Y0M A;  3I4P A;  1SD4 A;  2A6E F;  4M6X A;  3ZN1 A;  2XAJ A;  5L3C A;  1USS A;  3LAJ A;  1XMK A;  1R7J A;  2QLZ A;  1FY7 A;  5JVT A;  1T2K A;  4LB5 A;  5BS6 A;  3LAP A;  4RB3 C;  5CVR A;  4AIK A;  4O5V A;  4R79 A;  4LLG F;  4IRH A;  3J7A O;  2XAF A;  3T8R A;  4HDV A;  5FGM A;  3ZMD A;  2DPD A;  2FBK A;  2ZJ2 A;  3WE3 A;  3AAF A;  4WXD A;  1UFM A;  3HRU A;  4AIJ A;  4ASN A;  4RGU A;  4RGX A;  2M5W A;  5HLG A;  1SAX A;  2JT1 A;  1LDJ A;  5D8L B;  1P4W A;  3KZZ A;  2CYY A;  5D6E A;  5DD8 A;  5E8I A;  2QM3 A;  1MDM B;  2ISZ A;  1K6O A;  3K9T A;  3DP7 A;  3GWZ A;  2DQR A;  1LJ9 A;  3KET A;  2VE8 A;  2QVO A;  2QQB A;  1B4A A;  2XVC A;  5L3E A;  4JBA A;  3IHU A;  3HSF A;  3C3W A;  1J75 A;  4ESB A;  2HTS A;  3R61 A;  1G3W A;  2ZXJ A;  2HKO A;  2HZT A;  4OIP F;  4G7H F;  4L9T A;  2DU9 A;  5HDK A;  4BHB A;  2PMH A;  3B73 A;  1IN8 A;  2FF4 A;  2FA5 A;  5ICG A;  1R23 A;  2V1U A;  1G6N A;  3SQN A;  1Z05 A;  3WTU C;  3ROU A;  2C6Y A;  4UVC A;  5D6F A;  3CDH A;  3EQL F;  5E17 F;  5FB2 A;  2P6T A;  2O61 A;  1OR7 A;  3LQQ A;  1YTY A;  2V6C A;  1T39 A;  1I27 A;  2YPR A;  4NQW A;  1TQP A;  1Z91 A;  1ZG5 A;  1HKT A;  1XCV A;  1C0W A;  3M8E A;  5DCM B;  3F8B A;  2QBY B;  1BC7 C;  1ZG1 A;  5JFR A;  3GVA A;  2GA2 A;  1HXD A;  4G6D A;  4O3M A;  1EH6 A;  2VBX A;  2HS5 A;  4A0X A;  3TO7 A;  2XAG A;  4L5I A;  4Y17 A;  3HRM A;  3E5X A;  1UHM A;  2V1X A;  1YS6 A;  2NNN A;  3HTU A;  1FZP B;  1W5T A;  2GWR A;  1R5G A;  1WRJ A;  4PZJ A;  4HBL A;  3GYH X;  4CXF A;  1U5T A;  1YG2 A;  5A2Q K;  3F8M A;  3JAM Z;  3BP8 A;  3JTH A;  4S04 A;  1ZRD A;  2VBY A;  1R22 A;  3BJ6 A;  4OIR F;  4EQQ A;  2OQG A;  3LA3 A;  2LNB A;  4CZZ A;  1ZGJ A;  3CJN A;  3GFI A;  4P55 A;  5E18 F;  3WTX C;  3WTT C;  3KP6 A;  3JAM K;  3KZY A;  4P9F A;  1TW2 A;  2Q2E A;  2EFO A;  1W4M A;  3IRQ A;  1PUE E;  3DFG A;  1S29 A;  1JHF A;  1E2X A;  3ABT A;  3WG9 A;  3F3X A;  2BGC A;  1SFX A;  4WXH A;  1FLI A;  2JPC A;  3BZ6 A;  3QRF F;  3JTG A;  2XIG A;  3MZY A;  1TW3 A;  3BJO A;  4KFC A;  4ZH4 F;  2W84 A;  2K27 A;  2P8T A;  1H9T A;  4XSX F;  2VN2 A;  4LJZ F;  4AD9 A;  1TTY A;  1L0O C;  2ZBK A;  5D5V B;  1PP7 U;  1LQ1 A;  3KP7 A;  2FSW A;  1DPR A;  1R5H A;  4PGG A;  1J59 A;  3FM3 A;  4G7O F;  2CGP A;  2Q8K A;  2VBW A;  1QQI A;  4HOB A;  1V4R A;  3FMS A;  3F8F A;  2UZK A;  1G3S A;  3H3Z A;  2RN7 A;  2PN6 A;  3LST A;  1F5T A;  4G8X A;  4XRF A;  4AVP A;  1AWC A;  1I1G A;  4A2U A;  2WC2 A;  1HKQ A;  2LSO A;  1IF1 A;  4G94 A;  2M45 A;  3HRT A;  3OOP A;  3ZQ7 A;  5ICE A;  3J81 Z;  1O3R A;  1IN7 A;  1ONV A;  3J80 K;  2PBI A;  3IC7 A;  3HOT A;  2EFP A;  1BOA A;  4BHP A;  3LA2 A;  2DK5 A;  4HF1 A;  4CO8 A;  3IWF A;  2UXX A;  1REP C;  2NRA C;  3QP6 A;  3C1D A;  3I5U A;  4OIQ F;  4O6J A;  1SFE A;  1TLH B;  5KK1 A;  3M1E A;  1EV7 A;  1OKR A;  1QZY A;  5IT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...