1FSEA

Crystal structure of the bacillus subtilis regulatory protein gere
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GERE
publication title Crystal structure of GerE, the ultimate transcriptional regulator of spore formation in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 23
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fseA00
2ADUA 2ESHA 3PFIA 4I0AA 2GXBA 4AIKA 1GHCA 1K79A 2PBIA 1FP2A 1T0FA 2HZTA 2MD5A 4AIJA 1T6SA 1XMKA 3WTWC 2FNPA 2FXAA 3L00A 5HS8A 1B1BA 1OMIA 3CDHA 1G6NA 2XV4S 4P55A 3KP5A 3Q9VA 1QBJA 1ZH5A 4YG2F 4GXOA 4M9SA 4P9FA 5ED4A 3DV8A 4MTDA 2FNAA 2MH2A 2IVMA 5FFXA 4LGWA 2FRHA 2COMA 2P4WA 3IRRA 5LBQA 1IXCA 1WQ2A 3Q5FA 2QQ9A 2K86A 1TQPA 2VXZA 4HBLA 2ZBKA 5DCMA 4KICA 1L0OC 1J75A 3QRFF 2VC1A 2QQAA 1LNWA 2JRTA 3DF8A 3DQVC 3ZP5A 2RDPA 5DV5A 1BI1A 3FXUA 3LFKA 5L3FA 1Y0UA 4EGZA 5DDGA 3MCZA 2EB7A 2FQ3A 5L3CA 1ONVA 2NYXA 4WXCA 4L5JA 1Z6RA 1FNNA 2FMYA 2L4AA 1OYWA 3E97A 3GX4X 4HF2A 4I09A 1MKMA 4OINF 4JBAA 4HF1A 3ZMDA 2DAOA 4MQ9F 2ZNZA 1O3RA 4KN4X 1YYVA 3JW4A 4I01A 4HV6A 1U78A 3K1PA 2P5VA 3HOSA 2DK5A 3BJOA 3E5QA 2PFBA 3E5UA 2K7LA 3RJPA 1GVJA 1MD0A 1PP7U 1HW5A 4MEXF 4BYYA 2NNNA 2CSOA 3ECOA 2GA2A 5HLIA 2G9WA 4KFCA 1V4RA 1QQIA 4CICA 2PEXA 4Y13A 2QUFA 3HHGA 1UB9A 1J59A 2M30A 4IVNA 2Z5UA 3I5UA 2PI0A 5HDGA 3JSOA 4A2UA 5L3DA 3L2CA 3QPTA 3E6CC 5FGMA 3VB2A 4AD9A 4ESFA 2MLGA 3RKYA 3PQJA 2UZKA 2IP2A 2R7DA 5D6FA 4L0YB 4HLYA 2XRNA 1W7PD 2FF4A 4M73A 1BN5A 4RB1A 1ZAOA 4CHUA 1XGOA 3LA2A 1EH6A 4XLPF 4CXFA 3GFJA 4EJUA 4RGSA 5LHIA 1FT9A 2EFQA 4AVPA 3WG9A 1ZRFA 2STTA 4LLGF 4RAZA 5FFZA 1LDJA 1YW8A 3CUQB 4KA4A 4TV7A 1DDNA 4LFUA 4AIHA 2UWMA 2H09A 5DUKA 1HW2A 3BP8A 3HRSA 5ILUA 2DFIA 4RGUA 3GW2A 4EJWA 3H92A 4G9YA 3SQNA 4HZFA 1G3WA 3GXOA 4IJAA 3GUDA 1Z7UA 2A69F 1ZRCA 5L3BA 2IA2A 2HWVA 4N0BA 1CF7B 2E7WA 3MEXA 1WI9A 4XLNF 4HW0A 5ICEA 1KYWA 3GWZA 3JTHA 2GWRA 4N9HA 3D5LA 2VBXA 1YO5C 2EA4A 2RN7A 4P96A 3VFZA 2J5PA 3CJNA 3I53A 2QZ8A 1LVAA 1FY7A 3MZHA 1B59A 4DNCA 2FEZA 4GCVA 4G6QA 1KU3A 2H6BA 1JGSA 1BI3A 1MZBA 3FZVA 3H3UA 2ZMEB 4KUMA 5BQTA 3HRUA 3R0AA 5HDNA 2D45A 4OMZA 1ZG5A 3GLXA 4LB5A 4HX8A 2STWA 3CUQC 1ZHFA 1H9GA 2XAGA 2QM3A 1G3YA 1STZA 3DP7A 3U1DA 3SFZA 3KP4A 2JTVA 2XAFA 3I54A 5IT3A 3DEUA 3CUQA 2BV6A 3EQLF 2VOOA 1YLFA 2NAZA 4EJOA 1FBUA 2Z33A 3GVAA 4EMSA 4M71A 4PGGA 3WGHA 3HOTA 1HKTA 1KQ8A 4HA8A 1XMAA 3FMRA 2L01A 3K2ZA 3T8RA 1ZARA 1TNSA 1S8NA 4U88A 2M1BA 1UCRA 4O3MA 5LHHA 3HRMA 2IJLA 4M74A 3SXYA 4YIFA 4IRHA 4M6XA 5LGNA 3QOPA 1YS7A 4FX4A 2EFNA 3WGGA 2ELHA 2BBYA 2LF7A 4R79A 1LEBA 2XHKA 1IN5A 2VN2A 1TNTA 1E2XA 3C1DA 2L02A 4ENNA 1Z1DA 4S04A 3HSRA 4Q4ZF 2IPQX 2F5DA 4U0WA 4OIQF 5BPDA 3N97A 5CVUA 1S29A 1SMYF 3TDZC 3KP3A 4OOIA 1OYIA 2DTRA 4HF0A 1FOKA 1SD6A 4UXNA 1HKQA 2EFPA 1HKSA 1I1SA 1R5GA 3RPQA 2ZMEA 2JZYA 2RQPA 3TGNA 3KLOA 2BE5F 4G94A 4Y17A 5H6RA 3ISPA 1FSHA 5HS9A 3FM5A 5E20A 3OOPA 1R7JA 1BI2A 4N9IA 3C7JA 5DCFA 2KIMA 2QVOA 2DPUA 4M6YA 5ICFA 1RNLA 1CGPA 3JAMZ 2O6GE 3RI4A 4AWXB 4KIBA 3DPLC 1SFUA 3O3KA 1FLIA 2CYYA 1BIAA 1ZGJA 3JTGA 1IF1A 5KK1A 1RUOA 5DYMA 3E6MA 1F4KA 1F5TA 2UXNA 2LKPA 5D5WB 1G3SA 3V8JA 3O6BB 3QPHA 3FXRA 3FXQA 3KLNA 3GZ5A 5K5RA 2QENA 2W25A 5HDKA 3LWFA 3ZQ7A 4P9UA 4LLLA 2ZFWA 2VC0A 3WE3A 4BAYA 2QWWA 1R1VA 1HXDA 1QZZA 5K5OA 3I4PA 5HOOA 2QLZA 4LMYA 1PP8F 1T98A 2V1UA 5H20A 2W24A 5ILVA 2DQRA 5DUIA 4IHSA 1YW7A 1T39A 1MDMB 3ZMZA 4F7ZA 3I59B 1R00A 2FMLA 1O3TA 1LQ1A 1R5HA 2IA0A 2HS5A 5LEJA 1IN8A 1P2FA 2FU4A 2P5LC 3MZYA 1IRFA 1C0WA 3EYYA 2CO5A 2B0LA 4Q48A 4XSXF 1SFXA 2MA3A 5DD8A 2DI3A 1BI0A 3JSPA 1ZRDA 2HTJA 3BY6A 4LK0F 4KYWA 4GYIA 2ZJ2A 2OQGA 3L9FA 2G7UA 2A3SA 1FWZA 1P92A 2H6CA 1JHFA 1U5TB 1IUYA 1R1UA 3W6KB 1EH7A 1XSDA 5D5VB 1QNTA 4G8XA 3DPTA 2XVCA 1EV7A 3ABTA 1LJ9A 4XSZF 4XRFA 4ETSA 1RIOH 5K1YA 2F5EA 2FOKA 5E1WA 1R58A 4IF4A 1XN7A 2A6HF 4A0YA 3BPXA 4B09A 4Z2YA 3R61A 2VE9A 4QLCU 3NEUA 2EV5A 2VBYA 1EH8A 2ZKZA 1USTA 1SFEA 2CG4A 1XSVA 4L0ZB 2EV6A 3M8FA 5H6QA 2GIVA 3HYIA 5TJJA 1QGPA 4WCGA 3LAJA 1S6LA 4YFNF 2QQBA 2OZUA 3RTRA 2C6YA 1MDMA 3ELKA 1J9IA 3F3XA 3I59A 1K78B 3EETA 1YG2A 3ZMSA 4M9ZA 2XIGA 2AXLA 2K4BA 1DPUA 5EEHA 2W57A 3QAHA 4RAYA 5BS6A 1X3UA 4CYDA 4KMFA 2VODA 2OA4A 3NRVA 2D1VA 3HUGA 4U0VA 4ENMA 2A68F 3KZYA 3FF5A 1U5TC 1BC7C 1FYMA 4D0PA 3RKXA 4OIPF 3FHZA 2Y48A 1BIBA 4G6DA 2ISYA 2LDUA 2F5FA 1JHHA 1U5TA 4S05A 5J6XA 3OV8A 2L3DA 3F8MA 1G3TA 3J7AO 4L5IA 3M8EA 2EK5A 3WTSC 3MFKA 2O8XA 1Z6TA 3HRTA 4ZYEA 1Q1HA 5E8GA 2GXGA 5CVJA 5CVIA 5D6EA 4ZYDA 3B73A 1SMTA 1AWCA 1RI7A 1HW1A 2RV8A 2VT3A 5E1ZB 1FSEA 4UVCA 5J8FA 3GEZA 4WWCA 1J2XA 2Y0MA 2ZO4A 1O7FA 2RVCA 4UUVA 4L9VA 1K78A 4IXAA 4L18B 1ZYRF 1G4DA 1MJAA 6PAXA 4WF2A 1F1ZA 1YFHA 5D8LB 3IRQA 3F8FA 3ZN1A 1ZLJA 1XCBA 4GYGA 1KQ9A 2K02A 3QU6A 4HV5A 3EYIA 4EGYA 1XCVA 4CDGA 5JFRA 2PQ8A 1WRJA 3MAJA 3IHUA 5DEQA 1UHMA 5HLHA 1KU9A 3CLOA 1H0MA 4P5OA 4FHTA 1DP7P 5ERIA 4OU0A 5LGTA 3IC7A 2HKXA 2BEOA 2GA1A 1XGNA 2JPCA 3ECHA 3I0TA 4KMUX 4MQVA 1ULYA 2VONA 1L3LA 3I58A 2XGXA 1DPRA 4CZZA 3G73A 3MWMA 1RZ4A 4R8HA 4ZZDA 3I64A 3K69A 3C3WA 3J81Z 2A6EF 1ODDA 4H0EA 3ABUA 4ESBA 4OIOF 1P4AA 3SZTA 3WTZA 4O5VA 2V79A 4ENJA 3BPVA 2A07F 3W6JB 2IRFG 2M87A 4G7OF 4BHBA 2K27A 2ISZA 1SD5A 4EJVA 3WTXC 1ZG3A 5F64A 1XDSA 3RIRA 4RS8A 1O3QA 1Z05A 2M5WA 3LQRA 3KETA 1SD4A 4JQFA 2JPBA 3ML6A 2W85A 2Z99A 3DFGA 1KU7A 2DPDA 4HX4A 4XBFA 3WGIA 3P9KA 4PCQA 1D5VA 3RDIA 3S2WA 5F1RA 4IHTA 3TOBA 1MJ9A 3BDDA 4EQQA 2IT0A 1OR7A 5FB2A 1OPCA 1AOYA 3VODA 3K1NA 1IN6A 2ZXJA 2CQKA 1JXSA 3BZ6A 5CVRA 3C18A 4IPAA 2M45A 2CGPA 3P9IA 3H3ZA 5AIQA 2DO7A 2PMUA 2OAZA 3E6DA 4RB3C 1FYKA 1TW3A 1KQ0A 5E1XA 2OQRA 3B02A 2YSRA 2P5KA 1F9NA 3COAC 2DBBA 3FM3A 4G7ZF 2E1NA 3QP6A 1IRGA 3WTVC 2YR2A 3MQ0A 4EVIA 4U7BA 5JI6A 3J80Z 3WE2A 2ZNYA 2DLLA 2UXXA 2HKOA 2WV0A 3IKVA 1U8RA 2O0YA 1IAWA 3GFIA 5ICGA 1KU2A 2VBWA 2OD5A 1T2KA 2RGVA 1GXQA 1XD7A 2LNBA 1HSJA 1YQAA 1TW2A 2E1CA 1K6OA 1OYYA 3U9GA 1FBQA 3K0LA 2BYVE 3F6VA 3DXJF 1O7LA 2GAUA 3R6SA 5ILSA 3M1EA 3KEQA 2HOEA 1TTYA 3WTTC 5JR3A 1QPMA 4KIFA 3O2PE 2HEOA 1ZLKA 4GO1A 3ZPLA 2KJBA 2PLYA 2VE8A 4HOBA 2A5YB 4HQMA 1TLHB 3R4KA 3N4MA 3REOA 4ESJA 1IW7F 4OMYA 3BJ6A 1ON1A 3FMSA 2DQLA 4HX7A 3IL2A 5BOXA 5L3EA 3F23A 3KP6A 1T38A 4KNYA 1U2WA 3TO6A 3ZMTA 5CLSA 1O57A 2CWEA 1ZG1A 1DUXC 5LRRA 2P7VB 4MGRA 4EM1A 1GXPA 2ACJA 4DQ2A 2MLKA 5D4RA 2J5OA 1NHAA 1QO0D 5LRSA 4QWQA 2NNYA 4U0YA 1I6XA 2KRFA 1VTNC 4MHGA 2F5CA 3F8NA 4RB2C 2TDXA 3F6OA 4LJZF 2G7HA 1HQCA 1I27A 3E5XA 1BC8C 3HTUA 4MTEA 3AAFA 3D0SA 1J5YA 3V8LA 2HYFA 3BWGA 3GO5A 2DU9A 5D5XB 2Z3YA 1R22A 1RUNA 4B8XA 3RPUA 5BPIA 3QU3A 1IN4A 1B9NA 1TBXA 2XAHA 1D8KA 3JAMK 4WXDA 1P6RA 2DW4A 2XROA 2KKOA 3TDUC 1P4WA 2YU3A 4JK1X 2NS0A 5BMZA 2GZWA 2EWNA 1S7AA 5TRDA 3J80K 3TO7A 2P6TA 2HDCA 3KP2A 2CFXA 4LG0A 1B9MA 1IZ1A 5F6FA 4ASNA 4A12A 4Y15A 3WU0A 2X4HA 1J7KA 2FE3A 1ZN2A 5ICCA 2V6CA 4Q5SF 1TQIA 2V1DA 1WKMA 3WU1B 5AONA 4I0BA 5LGUA 3RYPA 5HLGA 3HHHA 5FLXZ 2EV0A 1YW9A 1HSTA 1FP1D 2FSWA 2HFHA 4A0XA 2IA1A 3EDPA 4A6EA 1LDDA 2P8TA 2EA2A 1ON2A 1Z9CA 2L54A 4KDPA 2YX7A 1IXSB 5FD6A 3F22A 3ERED 4EV0A 1XDUA 2CW0F 1FPQA 5AIPA 2L4MA 1P4XA 4ENKA 2WTEA 4HAMA 3IKTA 3EUHA 4ON0A 3BJAA 5E8IA 1WSUA 4BQAA 2E7XA 5DD4A 5IT9Z 5JVTA 1SD7A 2OZ6A 4I7HA 1S3JA 1A04A 2LSOA 4GGGA 4U7DA 1BM9A 4RGRA 3FX3A 4YIIA 2XAJA 3BROA 3T5XA 3SZPA 2H94A 4IRGA 3T0YA 2O03A 4BXUA 3TQNA 2H27A 4KIGA 4MEYF 1BJAA 1Z91A 4A5MA 1H9TA 2OU2A 3E6BA 4WX9A 2WC2A 3F72A 4Q47A 5CVVA 3LA7A 4KT5C 4WXHA 2XASA 2A61A 2R3SA 1U3EM 3KFWX 1W5TA 4R1HA 4HYEA 3R60A 5A2QZ 2MC3A 2BGCA 1D3YA 5D5UB 4ZYGA 2KIFA 2FBHA 4WK8F 3F21A 5EEGA 4G7HF 2XUBA 4UV8A 2OBPA 2MH9A 2HQRA 3K1MA 3KP7A 3M9AA 2RKHA 2YX4A 5E18F 1YIOA 1FC3A 5CJ9A 3CO7C 2M8EA 3GZ6A 5FD5A 3Q9SA 3KEOA 2Q8KA 1KYZA 4YFXF 2HYGD 2FBKA 2ETHA 4CO8A 2W84A 3F8CA 1U6GA 4M9XA 1ZREA 4A0ZA 5FLXK 1B6AA 2KJCA 4YFKF 3WODF 4UHTA 3U2RA 1W4MA 1V3FA 2Q2EA 4IRIA 4EM2A 1FX7A 4BNCA 3GF2A 3HTSB 3T1BA 2EJRA 1PDNC 4UV9A 3P9CA 3V7CA 4NHJA 2YPRA 4NB5A 4BHPA 3I71A 4A5NA 3G3ZA 2P6SA 3F8BA 2AS5F 4ZH4F 1XB4A 3CTAA 4I2OA 4HDVA 5L3GA 1REPC 3KE2A 1YTYA 3BOQA 4A6DA 1SAXA 5IT9K 3RKWA 3HSFA 3HSEA 2DT5A 2Q0OA 5HVQC 2QBYB 2Y75A 1IXRC 4O6JA 4ZYHA 3V7SA 4E70A 3TO9A 3WTYC 3GFLA 3GFMA 1PUEE 1W7PB 2DK8A 1D8JA 2MBFA 2QYOA 3V7RA 4L9NA 1E17A 2XAQA 2V9VA 3VEPA 2HR3A 4ZZLA 4PGHA 3IWZA 1XGMA 2HTSA 2VT2A 2ZCWA 5KVRA 3ROUA 1R23A 5A2QK 5CYVA 3FMQA 5FO5A 2EFOA 2O61A 4FX0A 3RYRA 2O3FA 2KIUA 3WTUC 4PDKA 1S7OA 2ESNA 2R7FA 2Z9OA 4EM0B 5HS7A 1QZYA 2HQNA 5JHUA 4NQWA 2PJPA 1CF7A 4K2EA 3K9TA 3T8TA 3TOAA 3GYHX 2V1XA 5LEKA 4L9TA 2PG4A 3PQKA 4M72A 3ULQB 3LA3A 5J8CA 1OKRA 2NRAC 3LAPA 3KZZA 3VOEA 4KN7X 3P7NA 3V8KA 1YS6A 2WWYA 3NQOA 1FBSA 3KCCA 1UHWA 2K4JA 2PMHA 2RC4A 2D1HA 3HIFA 2QBYA 3CUOA 4FT8A 5D8KB 1HBXG 1W5SA 3L7WA 4EJTA 1FZPB 3QP5A 4RB0A 1W7PA 4CGZA 4LLNA 4HLXA 3FWEA 1KA8A 1TQMA 1XGSA 2FA5A 3SHFA 3M7GA 3ZMVA 1LDKB 1LB2A 1BBYA 1R1TA 1XSXA 4I02A 2JT1A 4UNOA 4RGXA 2XKOA 4BHCA 1FYLA 2VOPA 2LF8A 4HQEA 4I98B 4HDUA 3J81K 3L09A 2HGCA 2D2WA 1MGTA 1R36A 3TKYA 3DKWA 4LK1F 3ZMUA 2RNJA 3V4GA 4LG0B 2VBZA 4PZJA 4OIRF 2PN6A 2X0LA 5DCMB 1USSA 3ZN0A 1IN7A 2P7CB 1JE8A 4L9JA 1K7AA 1I1GA 4LB6B 5LLQA 3LQQA 1ZGAA 3E3VA 5K5QA 2JSCA 1O3SA 5D4SA 1WWXA 1MJBA 3IWFA 2F2EA 2EFWA 2FBIA 4MNUA 4LD5A 3LSTA 1UFMA 3R0JA 1I5ZA 2IW5A 4UVAA 5E17F 1BOAA 5LHGA 1B4AA 1J0RA 4UVBA 4BH9A 3CO6C 2GQQA 1LEAA 1KGSA 2XKPA
chains in the Genus database with same CATH superfamily
1UHSA 2ADUA 2ESHA 2W82A 3PFIA 4I0AA 5IYBJ 5B3SH 2GXBA 2DFHA 2GXAA 4AIKA 1GHCA 2FQ4A 4RMNA 1K79A 4IZZA 2PBIA 1FP2A 3PJRA 1PUFA 2R7TA 1T0FA 2DCEA 2HZTA 2MD5A 1FTZA 4AIJA 3DWLE 1T6SA 4PJMA 3BR0A 3BR2A 1BA5A 4BUPA 1XMKA 3WTWC 2FNPA 2KT0A 2FXAA 2JJ7A 3IAS2 3QQAA 1X1DA 2ZC2A 1SEUA 3L00A 5HS8A 1ZELA 1B1BA 1Z77A 1OMIA 2Y31A 1MMGA 3CDHA 1G6NA 2LLKA 2XV4S 4E7HA 4P55A 3KP5A 1TP4A 3Q9VA 1QBJA 1ZH5A 4XLHA 1Y1VJ 3S3MA 4YG2F 4GXOA 2DN0A 4IL6C 5FKNA 4M9SA 4XOTA 4AC0A 1QRYA 4P9FA 5ED4A 1JKQC 2IS1A 4XK4A 3DV8A 1X2MA 2QSFX 3WHCA 1K6YA 4MTDA 2FNAA 2I5UA 2MH2A 2IVMA 5FFXA 4LGWA 3D5SC 4C3IJ 2FRHA 2COMA 1ITYA 2P4WA 2PJRB 3IRRA 3ZGKA 5LBQA 1MMDA 5BNGA 1IXCA 1WQ2A 3OYNA 3Q5FA 1MIJA 1TZLA 4CCMA 2QQ9A 2K86A 2PMZA 1TQPA 3S3OA 4LOCA 3RZOJ 2VXZA 4HBLA 4CCKA 3W2AA 1TWAJ 1QA6A 5H2FC 2ZBKA 5KCMA 5DCMA 3OOUA 2UUZA 3HZJA 3OYEA 1U9OA 1IV8A 1L0OC 4KICA 2IS4A 1FOYA 2QCOA 3I9V2 3IH3A 4A3EJ 1J75A 3QRFF 2L7FP 2VC1A 2QQAA 2M3AA 1LNWA 2JRTA 3DF8A 1Z21A 3HL2A 3DQVC 3O8HA 4P1WA 2RDPA 3ZP5A 5DV5A 1BI1A 2XPVA 3FXUA 4X0GA 3LFKA 3IV5A 5L3FA 1QVUA 3HKZN 1Y0UA 3K4BA 4EGZA 2W00A 5DDGA 1A6IA 1R4NB 3MCZA 1ZKGA 2EB7A 1NTCA 1ONVA 2FQ3A 2NYXA 4II2A 4XN3A 4WXCA 2DFEA 1X4OA 5L3CA 4L5JA 1Z6RA 1N77A 1FNNA 2QSGX 2FMYA 2L4AA 1OYWA 3E97A 3GTLJ 3GX4X 4HF2A 4I09A 1MKMA 1Z0XA 1RKWA 4BJ6C 4A3GJ 4OINF 3SZGA 4JBAA 4HF1A 3CQZJ 3ZMDA 4A3KJ 2DAOA 4MQ9F 2UV1A 2ZNZA 4BY1J 2CRGA 2LRDA 2EIJH 4KN4X 1O3RA 1YYVA 3JW4A 4I01A 4HV6A 4XLEA 1U78A 2K9QA 3K1PA 2QKMB 2P5VA 3HOSA 2DK5A 3KZIC 4M3FA 3BJOA 1D0YA 2ELJA 3CP8A 3E5QA 1D0XA 1QHGA 2PFBA 1YIJI 3E5UA 2K7LA 3RJPA 1GVJA 1IGNA 1MD0A 1PP7U 1HW5A 3A0HC 4MEXF 2JK3A 3GBGA 4BYYA 3DBHB 2NNNA 4GRIA 2CSOA 3ECOA 2GA2A 4G12A 1MMAA 4PJNA 4AM3A 5HLIA 2Z1DA 3DCFA 5IYDJ 2CFOA 2G9WA 4KFCA 3H0DA 1V4RA 2DA4A 1QQIA 3OR1C 4BDYA 4CICA 1IJWC 2PEXA 4Y13A 4BACA 2QUFA 3HHGA 1R4MB 4XRSG 5K7ZA 1UB9A 3OYBA 1J59A 1EF4A 3ZCOA 3V42A 2M30A 2VB6A 2FOWA 3ASNH 2VJJA 4IVNA 2Z5UA 3I5UA 2PI0A 1VQNI 2YU9J 5HDGA 3JSOA 4A2UA 5L3DA 1ZTRA 1UAAA 3ABKH 3L2CA 2ZXWH 3QPTA 4PSWA 3E6CC 5FGMA 3VB2A 4HNVA 1BW5A 2V1NA 4AD9A 2X6XA 2R7QA 3C2BA 5JHFA 2HXIA 4ESFA 1ETKA 2IEKA 2MLGA 3PQJA 3RKYA 2UZKA 2PJRA 1YE9A 1HDDC 2IP2A 2R7DA 5D6FA 3FBNB 3HGYA 4L0YB 4HLYA 2X85A 2XRNA 3BTIA 1W7PD 2FF4A 4M73A 4PFPA 3TW6A 1BN5A 3W2WA 3OYMA 5IYCJ 1OCRH 4RB1A 1ZAOA 4CHUA 2DXIA 3FK7A 1XGOA 5M3FJ 3LA2A 1EH6A 4XLPF 4CXFA 3GFJA 4EJUA 4RGSA 2MD0A 2DMNA 4XICA 5LHIA 3CDLA 4RM3A 4XM3A 1FT9A 4M3DA 5IPAA 2GIZA 3PO3J 4KITB 2EFQA 3S8PA 2P81A 4AVPA 3FXLA 3KYDB 2B63J 3WG9A 1ZRFA 3MKLA 1MNMC 2STTA 3J7AY 4LLGF 4RAZA 5FFZA 1LDJA 1YW8A 3CUQB 4PFOA 4KA4A 3CMMA 4TV7A 4UY8I 1DDNA 3RKQA 4HEA2 1YJ9I 4LFUA 3OIOA 2WB1A 4AIHA 1VQ4I 2H09A 4A3CJ 5DUKA 2UWMA 2E1MC 2JQ7A 3FDYA 2XB5A 4IQJA 3OMYA 2KRHA 3NWSA 2LK2A 1HW2A 4XLCA 3BP8A 1G59A 3HC7A 2DMTA 3HRSA 2JWTA 1JT0A 1FIPA 5ILUA 4XOPA 2RREA 2CJJA 2WB1N 2F4OB 2M4KA 2CQXA 3C2GA 4I6ZA 2DFIA 2XSDC 4RGUA 3GW2A 4OWRB 3BCAA 4EJWA 4B44A 3H92A 3BT9A 1B72A 4G9YA 3SQNA 4I76A 4HZFA 2E1OA 1G3WA 3GXOA 4IJAA 5KHDA 2KDOA 2BZTA 4OAYA 3GUDA 1Z7UA 2A69F 3FXMA 1ZRCA 3K4JA 5L3BA 2IA2A 2HWVA 3K4MA 3ZOBA 2WAQA 4N0BA 4NQWB 1CF7B 2E7WA 3MEXA 1WI9A 4XLNF 4HW0A 2EH3A 5GP9A 5ICEA 4NUBA 2R93J 1KYWA 3GWZA 3JTHA 5GTIC 4E7KA 2GWRA 2OV7A 2WAQN 4N9HA 3D5LA 2VBXA 4A3DJ 1YO5C 4HG2A 2Y30A 2EA4A 2RN7A 3FKJA 4J01A 4P96A 2E35A 2OJED 2L7MP 3VFZA 2BHYA 2J5PA 3OS2A 3CJNA 3I53A 1T08B 1KONA 2QZ8A 1LVAA 2BY2A 1FY7A 3MZHA 1B59A 2DOAA 3MN2A 2IBDA 3GCMA 1S5LC 3HB9A 4DNCA 1H89C 2FEZA 1X1CA 4GCVA 3H9GA 4AYBA 4E7IA 4G6QA 1KU3A 2H6BA 4S0HB 3M07A 2VJ4A 1JGSA 5IP6A 1BI3A 1MZBA 3FZVA 3H3UA 1WGXA 3S15J 2ZMEB 4AYBN 1N78A 4KUMA 5BQTA 3HRUA 3R0AA 2IXSA 3K7AJ 1R9TJ 2CQNA 2ZJRF 3BCBA 2KMUA 4B4CA 4KT6A 3MKYB 4IEJA 5HDNA 2D45A 3M4OJ 4OMZA 2DDAA 1ZG5A 3SEZA 3S1QJ 3GLXA 4LB5A 4HX8A 2STWA 2EZLA 3CUQC 2JA5J 1ZHFA 2RNGA 3S1MJ 1H9GA 2XAGA 5C3EJ 2QM3A 1G3YA 1STZA 3DP7A 3U1DA 4RDUA 4FE7A 3SFZA 2DOFA 4ZTJA 2E36A 5CPRB 3RCOA 3KP4A 1X58A 2JTVA 1OCOH 3UKGA 4BE0A 4BS9A 3ZQLA 2XAFA 4CUGA 2B7EA 4FISA 3I54A 5IT3A 3DEUA 2LD5A 3CUQA 5IOYA 2BV6A 3EQLF 2VOOA 5IY5H 1YLFA 4UB6C 1ORKA 2NAZA 4HSRA 4A3BJ 1FEXA 4EJOA 1FBUA 2Z33A 2LH9A 2ME6A 3GVAA 2KL4A 5EEAA 4EMSA 4M71A 4PGGA 3WGHA 3HOTA 2R7RA 5FLVA 1HKTA 2ZJQF 1KQ8A 4HA8A 5FRMA 1NG7A 1XMAA 4AVZA 3FMRA 3CF5F 1W0UA 2L01A 3K2ZA 3ZQFA 3T8RA 1ZARA 3BR1A 1TNSA 4CCJA 2MGQA 3MKZA 1S8NA 3TBIA 4U88A 1NH3A 2CV2A 2M1BA 4FCYA 3EPZA 4CYCB 1UCRA 2M0CA 4O3MA 5LHHA 3HRMA 2XPUA 2IJLA 4M74A 3SXYA 4LG3A 3HOXJ 4XLAA 4YIFA 2O5RA 4IRHA 4RAFA 4M6XA 3OYCA 5LGNA 3QOPA 4F91B 2F6CA 1YS7A 2CUJA 2EFNA 4FX4A 3WGGA 2ELHA 2BBYA 4XKVA 2HNHA 2LF7A 4R79A 1LEBA 4RA2A 2XHKA 1IN5A 2E2HJ 2VN2A 1TNTA 1E2XA 3C1DA 2L02A 1FIAA 1X2NA 2DA1A 4ENNA 2V26A 1Z1DA 3B6CA 3BG5A 3DEEA 4S04A 2AHQA 3L2RA 4W1UA 3M1CA 3HSRA 4Q4ZF 2IPQX 1BR4A 2F5DA 4U0WA 3CC7I 4IHWA 4OIQF 5BPDA 2KZGA 2ZMEC 3N97A 5CVUA 3U1KA 1OJLA 3LSIA 2LFBA 1S29A 1SMYF 3TDZC 2X1CA 5KNLA 3KP3A 2BXYA 4OOIA 1B8IB 1OYIA 2DTRA 5F0HA 4HF0A 1FOKA 2O9LA 1ETOA 3AG1H 1Z3YA 3GLLA 1SD6A 1LUJB 3H36A 4UXNA 5C44J 2A5WA 1HKQA 2EFPA 4MO7A 1HKSA 2W4SA 1I1SA 1R5GA 3RPQA 2OTJI 4NDLA 4E7ZA 2ZMEA 3M3YJ 2JZYA 2IGMA 2RQPA 1MMSA 4BXFA 2KDZA 2DFFA 2KP6A 2DMPA 3OYLA 2I8DA 3TGNA 3KLOA 2BE5F 4G94A 3SJMA 4Y17A 4BY7J 4IOCF 1I3QJ 2R92J 3OWTA 5H6RA 3ISPA 4B48A 1FSHA 4E4HA 2R5ZB 1OFCX 3GTGJ 4KISA 5HS9A 3FM5A 5E20A 3KYCB 3OOPA 1R7JA 1BI2A 3MVPA 1TWGJ 4N9IA 4DBRA 2HOSA 1J09A 3C7JA 2CQ7A 5DCFA 2KIMA 1UG0A 2QVOA 2DPUA 2ZJPF 4M6YA 5ICFA 1RNLA 2ECBA 5GAGJ 3M8JA 1CGPA 3HG9A 2E34A 4D9JA 2M9HA 3ABLH 3JAMZ 4IOAF 2Y2ZA 2O6GE 3RI4A 4AWXB 1GLNA 1F36A 4KIBA 3DPLC 1SFUA 1UZCA 3O3KA 3X2QH 1FLIA 3MZ8A 2CYYA 1WJFA 2FX0A 4A3MJ 1U0JA 1QHHD 1LPQA 5J1RA 1BIAA 1ZGJA 2EZHA 2VUMJ 1KZHA 3FKIJ 3SFIA 3JTGA 3LOCA 1U8BA 1IF1A 5KK1A 4B3AA 4BGDA 3L2UA 1RUOA 1VQ9I 3L2WA 2F4IA 5DYMA 2O8KA 2ID3A 3E6MA 3PSIA 4ZTFA 1F4KA 2R7ZJ 1F5TA 4BJTA 2UXNA 5CKTA 2LKPA 5D5WB 2DT7B 1N75A 1G3SA 3V8JA 3O6BB 3QPHA 3FXRA 2ZFUA 2BHZA 3FXQA 2BY0A 3H5RA 3KLNA 4ZC3A 3GZ5A 5K5RA 2QENA 2W25A 5HDKA 3LWFA 5M5WJ 1X1PA 5FJ8J 1RRJA 1WFXA 1XMXA 3ZQ7A 4P9UA 4LLLA 1T33A 2VC0A 2ZFWA 3WE3A 4BAYA 2QWWA 1R1VA 1HXDA 2A6TA 1X4PA 1XPXA 1QZZA 2XDVA 2M7BA 3RQIA 2OUMA 5K5OA 1OISA 2ZSIB 3I4PA 5HOOA 5FKMA 3JRAA 1RETA 3QYEA 2L9VA 2QLZA 4LMYA 4XIDA 1T98A 1PP8F 2V1UA 3BQYA 3DKXA 3JRCA 2CMPA 4QSHA 5H20A 2W24A 5ILVA 2DQRA 2M8GX 1T56A 4M3GA 5DUIA 1Y39A 4IHSA 1YW7A 1T39A 1MDMB 3ZMZA 2DODA 2V9PA 1DGWY 2DA2A 4F7ZA 3OL3A 1V5GA 3I59B 1R00A 3K70C 2FMLA 1UMQA 1O3TA 2L2OA 2WAEA 2BW3B 1LQ1A 1SFKA 3H3VK 1R5HA 3JR9A 2IA0A 2HS5A 2X6YA 2H1KA 1HDPA 5LEJA 1D1AA 1IN8A 1Z7LA 2H8RA 1P2FA 4RAGA 4NC6A 2CQQA 2FU4A 3K4CA 1P9QC 2P5LC 2P0WA 3MZYA 4JX5A 1IRFA 1WJBA 1C0WA 2R5ZA 1K83J 4DIQA 3EYYA 2CO5A 1X1AA 2B0LA 4Q48A 4XSXF 1SFXA 2MA3A 3PSFA 5GPCA 2K9SA 5DD8A 2VQCA 2DI3A 1BI0A 3JSPA 1ZRDA 2LR8A 4UB8C 3HUGB 2VKEA 4IHXA 2KRCA 2HTJA 4DBQA 3BY6A 4LK0F 1LFPA 2ME0A 2VQHA 4KYWA 2W1OA 4GYIA 3VYSB 2ZJ2A 2OQGA 2X6OA 2EILH 3NARA 1VI0A 3EUAA 3W6VA 1AKHB 3G1MA 3L9FA 2G7UA 2A3SA 1FWZA 1P92A 1VQLI 2H6CA 1JHFA 1U5TB 1E3PA 1IUYA 1R1UA 2K3PA 2LTPA 3CCYA 2M7AA 3W6KB 3GTMJ 2RAEA 3OS0A 1EH7A 1XSDA 5D5VB 1QNTA 4C3HJ 4G8XA 3DPTA 2XVCA 5DTDA 4F52A 1EV7A 3ABTA 3JRFA 3DU5A 3JRIA 5GPAA 1MBJA 2L9NA 1A31A 2NXNB 1LJ9A 3AL0B 4XSZF 2PMZN 2LC2A 4XRFA 1Y8QB 4ETSA 5DM7F 1RIOH 5K1YA 3S17J 2F5EA 4BKXA 4IHYA 1WHUA 2FOKA 5E1WA 2VL8A 3UR3C 1R58A 2E19A 4IF4A 2ZXIA 1XN7A 4D5CA 2A6HF 3H0GJ 4A0YA 1T8IA 3BPXA 4B09A 4Z2YA 3DU6A 3A4CA 3CD6I 3R61A 5E3OA 2VE9A 4QLCU 3NEUA 4JX4A 3OSFA 3ZQQA 2EV5A 4DJAA 2KIQA 3WU2C 3JRHA 4E6KG 2VBYA 1EH8A 1SVMA 2ZKZA 1MW7A 1USTA 1SFEA 1MNDA 2V4JC 4DGWB 3IP4B 3OYGA 2CG4A 4J00A 2LYCA 1XSVA 1AU7A 3PNYA 1RR8C 4L0ZB 3BTCA 2EV6A 3M8FA 5F0FA 5H6QA 2GIVA 1UJ8A 3HYIA 3CJRB 4Y4RA 5TJJA 1QGPA 1D1BA 1S9HA 4WCGA 3LAJA 4ANJA 1S6LA 1VFCA 1NG6A 4QPQA 4YFNF 2QSHX 2QQBA 2OZUA 3TL4X 3KPHA 3RTRA 3HGGA 2R0QC 2C6YA 5EJCA 1B72B 1D5YA 2E1MB 1MDMA 3ELKA 4XNFA 1J9IA 3F3XA 5HODA 1QU3A 1NK3P 4QTRA 3I59A 1K78B 2CW7A 3FIWA 3JRGA 3D1NI 3EETA 3PM1A 1D1CA 2VIXA 4IHVA 1YG2A 3ZMSA 1IO2A 2BW3A 2XIGA 4M9ZA 4B1RA 5GADJ 4Y7NJ 1F43A 2AXLA 2R4GA 2QKLB 2K4BA 3QOEA 1DPUA 4J19A 5EEHA 4XRSA 2W57A 5FKKA 4XORA 3VYUB 3QAHA 1UG2A 3K6GA 2AQFA 2OCCH 4RAYA 5BS6A 2CUZA 1AA7A 1GDTA 1X3UA 5KAIC 4CYDA 1VQ5I 3PUBA 5FLMJ 4CH7A 4KMFA 1YOVB 3W2VA 2VODA 4XLFA 2OA4A 3NRVA 2D1VA 3HUGA 1M1EB 2QGUA 2E71A 4U0VA 4ENMA 4FETA 2A68F 2Y9ZA 2VI6A 3KZYA 3FF5A 1U5TC 1BC7C 1FMVA 3Q3SA 2B9SA 1FYMA 1I3AA 5TGTA 1A6QA 3A2KA 1IDYA 4D0PA 3RKXA 3SDBA 4OIPF 4BQOA 3FHZA 4YRVA 1AKHA 1ZR4A 1JI8A 4F93B 1MBHA 2Y48A 3MKWB 1BIBA 4G6DA 1JUPA 2ISYA 5F1JA 3AL0C 3VSLA 3LNQA 1R71A 2LDUA 2XF6A 1E3HA 1JHHA 2F5FA 2CUFA 1U5TA 1WI3A 5GAEJ 4S05A 1Y6IA 5J6XA 4DW6A 5M5XJ 2XB0X 2HXOA 3OSGA 1ERDA 2JUCA 2LREA 1APLC 1O4XA 3OV8A 2L3DA 3QYFA 3S32A 3IAM2 3F8MA 1G3TA 2BVMA 1ETYA 4EEFG 2MC4A 3SYTA 3J7AO 3G71I 4L5IA 1X1BA 2XGEA 3M8EA 3G6EI 2AQEA 4XL9A 2EQRA 1Z3XA 1VQKI 2EK5A 3WTSC 3MFKA 2I10A 2O8XA 1JJ6C 1SANA 3B6AA 4UUTA 3VWBA 1Z6TA 1JJ8C 3A1YA 3HRTA 3OIQA 1EJ9A 5EDNA 4ZYEA 1Q1HA 3PUFA 1BOBA 4M6VA 5E8GA 5M5YJ 2NOGA 2GXGA 5CVJA 5CVIA 5D6EA 4ZYDA 3B73A 4NBQA 1SMTA 5HLTA 4LIUA 1AWCA 1ENHA 1G2HA 5J40A 4Y52J 1BR2A 1HW1A 1RI7A 2RV8A 2VT3A 2Y0SA 2W7NA 2DA6A 3PFYA 2HQ5A 5E1ZB 1PJRA 1FSEA 1OCZH 4UVCA 5J8FA 3GEZA 3OYAA 2XF5A 4OAZA 1TL8A 4WWCA 1VQ6I 1PYVA 3DTEA 1J2XA 2WADA 1WCMJ 2NS8A 3JREA 1JKOC 2Y0MA 2ZO4A 5E79C 2MSYA 1O7FA 1YHQI 2NS7A 5EF6A 2RVCA 4UUVA 3OR2C 4L9VA 2K85A 1K78A 3E0JB 1P7JA 4IXAA 4XKWA 5EZHA 5EYRA 4L18B 3CCMI 1ZYRF 5DM6F 1G4DA 1MJAA 2OF7A 6PAXA 4WF2A 1F1ZA 1YFHA 5D8LB 3BR5A 5EG0A 3IRQA 3F8FA 3BZCA 3BG6A 1MH3A 4Y33A 3CLQA 5FROA 3ZN1A 4ZJZA 1ZLJA 3ABMH 1XCBA 3HBLA 2IGKA 4GYGA 1KQ9A 2K02A 1BJZA 3ASOH 3ESWB 3QU6A 3DLAA 2HDWA 4HV5A 3EYIA 2DJIA 4EGYA 1XCVA 1VQOI 4CDGA 5JFRA 2PQ8A 3S3NA 4KJZA 3Q0UA 1WRJA 2Y9YA 1PVEA 3MAJA 3ONQA 3IHUA 5DEQA 3BTLA 4B43A 1OCTC 1UHMA 5HLHA 1KU9A 1GUUA 3CLOA 5FKOA 1JKPC 3J7YJ 1QPIA 3HOVJ 3FHNA 4P5OA 1H0MA 4XMYA 4FHTA 2EIMH 1DP7P 5ERIA 4OU0A 1Y56A 2VLAA 1MNEA 3IC7A 5LGTA 3CJQB 2L7ZA 1ZK8A 2BEOA 2GA1A 2HKXA 3BQZA 1ACIA 1XGNA 3PNTA 2JPCA 3ECHA 3I0TA 4KMUX 4MQVA 2HOTA 3VDXA 3GTQJ 2VQGA 4I99C 4BL0B 1ULYA 1WJAA 2VONA 2LVSA 3OYKA 1L3LA 5GTHC 4CA0A 3I58A 4ZYAA 3DKYA 1RR7A 3K70D 2JVHA 2XGXA 1DPRA 4CZZA 3KX2A 3G73A 2E5ZA 3MWMA 1RZ4A 1ETXA 4R8HA 5B5EC 3D5RC 1TWFJ 4NC7A 2VJIA 4ZZDA 3I64A 2L5QA 3K69A 3C3WA 4CSWA 4DYQA 3J81Z 2A6EF 4V2FA 1ODDA 4BE1A 4H0EA 4F92B 3ABUA 4ESBA 2ZSHB 4OIOF 3F9KA 3HOUJ 1P4AA 5E3LA 4N4NB 3SZTA 1WPKA 3I3LA 1ZGWA 1N25A 3WTZA 4O5VA 2V79A 5DS9A 3TW7A 4ENJA 3BPVA 2A07F 3W6JB 2IRFG 2M87A 3K4LA 3AG4H 3RPUD 4G7OF 4CZCA 4BHBA 2CS3A 2E2JJ 1EA3A 2K27A 2ZB9A 1Y1WJ 2JA7J 2ISZA 3HEFA 1SD5A 4EJVA 3WTXC 2DT6A 1ZG3A 5F64A 1XDSA 3RIRA 3HDDA 4RS8A 1GT0C 1O3QA 5F27A 1Z05A 2M5WA 3LQRA 3KETA 1SD4A 2COBA 4PJ0C 3IH2A 4JQFA 3S1RJ 5E3MA 2Z2SB 3LMMA 2JPBA 4RLFA 4FASD 3ML6A 3AKZA 2WV1A 5EGOA 2W85A 2Z99A 1GV2A 3DFGA 1KU7A 3I4NJ 2DPDA 4C2TA 4HX4A 2WY8Q 2NVXJ 1OR7C 4XBFA 3CDIA 4C30A 3WGIA 3P9KA 1K61A 4PCQA 3OYIA 2V6EA 1BR1A 1D5VA 1BW6A 3MMYB 3RDIA 2LY2A 3H5NA 3S2WA 5F1RA 4BEHB 2OC6A 4IHTA 3TOBA 1MJ9A 2XGDA 3NWTA 3BDDA 4EQQA 4M3BA 4BE2A 2X6WA 2E60A 2IT0A 1RESA 2W48A 1OR7A 3DPUA 2XRLA 5FB2A 1OPCA 1AOYA 2HDDA 3UNGC 4AUXA 3VODA 3K1NA 1IN6A 2ZXJA 4PUSA 1S72I 2CQKA 2Z16A 4LIVA 1JXSA 3BZ6A 1SVOA 1FOWA 3CF2A 4YIRX 4ABZA 5CVRA 2GOMA 1H8AC 3C18A 4IPAA 2M45A 3CCJI 2CGPA 5F0CA 3P9IA 1K4TA 5KAFC 3PO2J 1Y0NA 3H3ZA 5AIQA 2E5NA 3E1SA 2DO7A 2CUEA 4D1QA 2KISA 2PMUA 2X1EA 2HVRA 2OAZA 3E6DA 5F08A 4RB3C 3DBRB 1FYKA 1TW3A 1KQ0A 5E1XA 2HVQA 4Y3OA 2OQRA 2X48A 3OS1A 1JTYA 3B02A 2YSRA 3HPHA 5K7HA 2P5KA 1F9NA 4RBOA 3COAC 2DBBA 3QWLA 2CV1A 5J4YA 3FM3A 4G7ZF 3GTKJ 2E1NA 3QP6A 1IRGA 3WTVC 2YR2A 3MQ0A 4EVIA 4U7BA 5JI6A 3J80Z 3S14J 3WE2A 1WJ5A 2ZNYA 1JUSA 2DLLA 2UXXA 4XKBA 1DU0A 2HKOA 3OYDA 2WV0A 3IKVA 1U8RA 2O0YA 2K9LA 1IAWA 3GFIA 4FQGA 1MMNA 3LSGA 4C2UA 2IGNA 5ICGA 1KU2A 2VBWA 3LL7A 2OD5A 1WJEA 1T2KA 4MIMA 2RGVA 1GXQA 1XD7A 2Y69H 2LNBA 1HSJA 1YQAA 2XSJC 1TW2A 2E1CA 1YX3A 1K6OA 1FJLA 2RQQA 2LOOA 4A3IJ 1OYYA 3U9GA 3CC4I 1FBQA 3K0LA 3FISA 2VJ5A 3OY9A 2BYVE 3F6VA 1YJNI 3AFHA 4XONA 3DXJF 1O7LA 3QODA 2GAUA 2DMUA 1TWCJ 3R6SA 1HC8A 5LFAA 3CMYA 2OPTA 3HOWJ 5ILSA 2KQRA 2MYSA 3CCVI 3M1EA 3KEQA 2HOEA 2HZDA 1TTYA 3WTTC 5JR3A 3PIOF 1QPMA 4KIFA 3O2PE 2HEOA 2JVGA 1OQYA 4DOZA 1ZLKA 2Q1ZB 4HNTA 2MW8A 3GZNB 4GO1A 3ZPLA 4BEHA 2KJBA 2OTLI 2PLYA 2VE8A 4HOBA 1V5FA 3A01B 2A5YB 4HQMA 1TLHB 1LFUP 3HOZJ 1YI2I 3R4KA 3N4MA 1IC8A 3REOA 2VKHA 4ESJA 4G6TB 1IW7F 4OMYA 3BJ6A 1ON1A 3FMSA 3HJEA 2DQLA 4HX7A 3IL2A 5BOXA 5L3EA 3F23A 3KP6A 1T38A 4KNYA 1U2WA 3TO6A 3ZMTA 5CLSA 1O57A 2CWEA 1ZG1A 2FD5A 1DUXC 1W1WE 5LRRA 2P7VB 4MGRA 4EM1A 4X1EA 1GXPA 1HOMA 4BJ5C 2ACJA 1ZQ3P 3LSMA 4DQ2A 2MLKA 2DMQA 1TT0A 5D4RA 2J5OA 1NHAA 1QO0D 1ETWA 5LRSA 4QWQA 2HVSA 2NNYA 4U0YA 3S2HJ 1I6XA 2KRFA 1VTNC 4MHGA 4HNUA 3I4MJ 2F5CA 3DTKA 3F8NA 4RB2C 2WA0A 3WHBA 4ZDOA 4XN0A 2EZIA 5J47A 3H9JA 2TDXA 3S1NJ 1RKTA 5J1UA 2IGOA 5GAHJ 4JP0A 3F6OA 5CQEA 3HPGA 3AG2H 4LJZF 2G7HA 3G4SI 3ZXSA 1HQCA 1I27A 3E5XA 1BC8C 3HTUA 4MTEA 3GTJJ 3AAFA 2FJ1A 3ZQCA 3D0SA 3CCLI 2HU9A 1K4SA 1J5YA 3V8LA 3BC8A 5LD2C 2HYFA 3BWGA 2R5YA 3GO5A 3SDGA 3S16J 3BG7A 2DU9A 5D5XB 1ZR2A 2R7XA 2Z3YA 2GBYA 1R22A 2DA7A 1RUNA 4B8XA 3RPUA 5BPIA 3CJTB 3QU3A 5IP7J 3DEWA 1IN4A 4BQNA 1B9NA 2R7OA 3VPRA 1TBXA 2XAHA 1D8KA 3JAMK 4WXDA 1P6RA 2F5VA 5CQGA 2DW4A 2XROA 3H5AA 2KKOA 3TDUC 3GTOJ 1P4WA 2YU3A 4JK1X 2NS0A 1JUMA 5BMZA 3VYRB 5FRNA 1OLTA 1CQTA 2GZWA 3H9QA 2EWNA 1S7AA 5TRDA 2NVTJ 3J80K 3TO7A 2EIKH 2P6TA 2HDCA 3KP2A 2EZKA 3S2DJ 3ZR8X 1R6RA 1GV5A 2R7SA 2CFXA 4LG0A 1B9MA 1IZ1A 5F6FA 1WJCA 4ASNA 4A12A 4Y15A 3WU0A 1NK2P 2X4HA 1J7KA 2FE3A 2N8GA 1ZN2A 3QPLA 1RPWA 5ICCA 2WBMA 2V6CA 4Q5SF 1D0ZA 2VASA 2DTZA 1TQIA 2L0KA 1T95A 2V1DA 2MG4A 1WKMA 3WU1B 3HKZA 4A3FJ 5AONA 4I0BA 2DOEA 4C2MJ 2BY3A 1OCPA 5LGUA 3RYPA 5HLGA 3HHHA 1Z67A 2JN6A 5FLXZ 2EV0A 3A01A 3IUOA 3QPSA 1QZEA 1H88C 1YW9A 4IX7A 1HSTA 1FP1D 2FSWA 1MH4A 1MBGA 4XKCA 1SAUA 2HFHA 4A0XA 2IA1A 4CCLA 1XG1A 3EDPA 4A6EA 1LDDA 2PX9A 3GTPJ 4IO9F 4E7JA 2P8TA 2IS2A 2EA2A 1ON2A 4GDFA 1Z9CA 3EUHC 2YS9A 2L54A 1HCRA 3ZRGA 4KDPA 2YX7A 1IXSB 5FD6A 3F22A 3ERED 1A5JA 4EV0A 1JTXA 1XDUA 1GVDA 2JA2A 2CW0F 1FPQA 1SFOJ 5AIPA 2LBFB 2L4MA 5EG0B 1P4XA 3FXOA 3VYTB 2VKVA 3LFUA 4ENKA 2WTEA 5TISC 4HAMA 2KHMA 5HNHA 3IKTA 3EUHA 4ON0A 4X6AJ 3BJAA 2Q2EB 5E8IA 1ETQA 1WSUA 4BQAA 2E7XA 5DD4A 3JCUC 1MBKA 2R7VA 5IT9Z 5JVTA 5J1YA 3N05A 1TC3C 1X3ZB 1SD7A 2OZ6A 4E7LA 1MBEA 4I7HA 1S3JA 1A04A 2LSOA 3PL8A 4GGGA 4U7DA 1BM9A 1VQMI 3A0BC 4RGRA 2ELKA 3FX3A 4YIIA 2XAJA 2XAUA 2H8WA 3H35A 1YRNB 1QVTA 1POGA 3BROA 4DZJA 4XR6A 3L2VA 2K3FA 3T5XA 1JKRC 3SZPA 2H94A 3A03A 4IRGA 3T0YA 4V19K 2O03A 2DYRH 4BDZA 4BU2A 3CCEI 3LSRA 4BXUA 3TQNA 2H27A 4FE4A 4KIGA 3NAUA 4MEYF 2X1DA 3C2HA 1BJAA 1Z91A 4W97A 4A5MA 2OU2A 1RC9A 3E6BA 2WC2A 3F72A 3H1CA 4WX9A 1H9TA 4Q47A 5CVVA 3ERMA 3LA7A 4KT5C 2ICWG 4WXHA 2XASA 2A61A 2H1LA 2R3SA 4HRIA 3HM5A 4A3JJ 1U3EM 3KFWX 2JRMA 2AO9A 1W5TA 2LG4A 4R1HA 1I6HJ 5B1AH 4MLOA 4HYEA 3Q0WA 1VQ7I 3R60A 5A2QZ 2MC3A 2BGCA 2G0EA 2ECCA 1D3YA 2V9KA 5D5UB 4ZYGA 2KIFA 2FBHA 4ITVA 4WK8F 2VPRA 3F21A 1A35A 3L1PA 2K40A 3BG3A 3LSHA 5EEGA 2DDBA 4G7HF 3CZ6A 2XUBA 3K4KA 3QYBA 2OBPA 2MH9A 4UV8A 4YELA 4E7SA 3S93A 2HQRA 3K1MA 2M4GA 4BQQA 5C4XJ 3KP7A 3M9AA 2HI3A 3LSPA 2RKHA 4H4KC 2YX4A 2K9MA 2Y0SN 5E18F 1YIOA 4MFDA 2EPFA 3KEYA 3F0CA 2VXDA 5J3LA 3A02A 2MABA 2JA6J 1FC3A 5CJ9A 3CO7C 2M0MA 2MFZA 2M8EA 3AG3H 3ZQHA 2KPMA 5FD5A 3Q9SA 3GZ6A 2F48A 3KEOA 2L9RA 1VQPI 3U21A 2Q8KA 1KYZA 4YFXF 4DYCA 2HYGD 2FBKA 2ETHA 3K10A 4N4OB 1XS9A 1TT5B 4D7MA 3HXLA 4CO8A 1VF9A 1W36D 2W84A 3F8CA 1U6GA 4M9XA 1ZREA 4A0ZA 5FLXK 5M3MJ 2LBFA 1IRXA 1B6AA 5EGOB 2KJCA 4YFKF 3WODF 2VPLA 4JOMA 4UHTA 3U2RA 1V5EA 1W4MA 4PK4A 1V3FA 1WVRA 2Q2EA 4IRIA 3TP3A 1DQUA 4EM2A 1FX7A 2LKSA 4BNCA 3BTJA 1S7EA 2TCTA 4U87A 4UUSB 3OYFA 3GF2A 1WH5A 2DA5A 3HTSB 2GM4A 3T1BA 2EJRA 1G8XA 1LVKA 1PDNC 2BXZA 4L5EA 3P9CA 4UV9A 3V7CA 2KFDA 4RM2A 3WG7H 4NHJA 2YPRA 1SVLA 4NB5A 4BHPA 4JX6A 3I71A 3OYJA 4A5NA 1I39A 3G3ZA 3TP0A 2P6SA 2NOJB 4PJJA 3F8BA 2AS5F 4ZH4F 3FK6A 3OYHA 4DZPA 4YEJA 3CCRI 3HOYJ 1XB4A 2XGCA 1X3WB 3CTAA 1YRNA 3CCSI 2TRTA 4I2OA 2M2EA 4HDVA 1A36A 5L3GA 1REPC 3KE2A 1XX5A 2EINH 3LSJA 1Y8RB 3LSKA 1JGGA 1YTYA 3BOQA 1TWHJ 4A6DA 1E0EA 1SAXA 5IT9K 3RKWA 4M3EA 3HSFA 5F04A 1YX5A 5K7FA 2ZXHA 3HSEA 2DT5A 2Q0OA 1VNDA 4B3XA 5HVQC 5B1BH 2QBYB 2Y75A 1IXRC 4O6JA 4ZYHA 2QA4I 3V7SA 2BY1A 3TO9A 4E70A 3WTYC 2L7KA 4BXXJ 3O8GA 3GFLA 3GFMA 1PUEE 1WH7A 1W7PB 2LY1A 3TMOA 1YJWI 2DK8A 2DA3A 1FMWA 3E7LA 1D8JA 2MBFA 2LMDA 2QYOA 2CU7A 3MD2A 3V7RA 5HNFA 4RLQA 4L9NA 1DU6A 1P7IA 1E17A 2CV0A 1OCCH 1ETVA 4ZDPA 1XTAA 2XAQA 3KYLA 2V9VA 3VEPA 4D5FA 4CCNA 3CCUI 4IKFA 2HR3A 1LFBA 2O7OA 4ZZLA 2KLOA 4PGHA 3IWZA 2V7FA 1XGMA 4AU7A 2BOLA 2HTSA 4A93J 3BG9A 2VT2A 3PIPF 1IDZA 3GMEA 3P5JA 3VSKA 4XRMA 2ZCWA 3RQ4A 4Z6YA 5KVRA 3ROUA 1R23A 2HYJA 5A2QK 2ID6A 1R49A 5CYVA 2HOAA 3FMQA 5FO5A 2EFOA 2A05A 4FX0A 2O61A 4A3LJ 4NNJA 4MFEA 3RYRA 1V54H 2O3FA 2JMWA 4D7NA 4XQFA 2KIUA 2CW8A 3WTUC 5JLXA 2KZVA 4PDKA 2XPWA 4BBSJ 2NVYJ 1VQ8I 1S7OA 3JRBA 2ESNA 2QQ8A 3DBLB 4F55A 4C9YA 2R7FA 2XC7A 2IS6A 2Z9OA 4EM0B 2LP0A 5HS7A 1HF0A 1W5CC 3BR6A 1R5ID 1Q1VA 3CMAI 1QZYA 1IUFA 1LKXA 2HQNA 2QEXI 3L2QA 5JHUA 4UUSA 2LY9A 1VZ0A 4NQWA 2PJPA 1CF7A 3PNVA 4K2EA 3G2BA 3K9TA 3T8TA 3TOAA 2M34A 3GYHX 2K9NA 2V1XA 5JVGF 4BBRJ 2XF7A 5LEKA 4L9TA 2PG4A 3PQKA 4M72A 3ULQB 1IV6A 4JYKA 3LA3A 5J8CA 4V2GA 1MSFC 1OKRA 5B66C 4EATA 3J7ZI 2NRAC 1U9NA 2VQLA 2WY7Q 3LAPA 3KZZA 3VOEA 4KN7X 4C3JJ 2F4MB 2YUSA 1IRZA 3P7NA 2OCEA 3V8KA 1YS6A 2EBIA 2L9SA 2GOXB 5E3NA 1FOXA 2WWYA 4FTHA 3NQOA 1FBSA 1WJDA 3I55I 1AHDP 3KCCA 1UHWA 3BZKA 3DLLF 2K4JA 2PMHA 2JA8J 2RC4A 2K5CA 3OL4A 1LE8B 2WAFA 2D1HA 3HIFA 5FKLA 2QBYA 4QPOA 3CUOA 4FT8A 1WZ2A 5D8KB 3JRDA 2BVLA 1HBXG 1W5SA 3L7WA 4EJTA 1FZPB 2NVQJ 1XC5A 1JT6A 3QP5A 3CP2A 4RB0A 1W7PA 3W3CA 5J4VA 4CGZA 4DYRA 4LLNA 3KIOA 4HLXA 1MSEC 3FWEA 5EZGA 1KA8A 2GLOA 1TQMA 1PUFB 5JLWA 1SC7A 1XGSA 3OIPA 2FA5A 3SHFA 3G1LA 3M7GA 3BLYA 3BR3A 3ZMVA 1EKEA 1LDKB 1LB2A 3IH4A 1BBYA 1R1TA 1XSXA 2DJNA 3CCQI 2R5YB 4I02A 5IOZA 2JT1A 3RSNA 4RGXA 4UNOA 2XKOA 1W36C 4BHCA 1E3OC 3ZQGA 3TEDA 1FYLA 3CESA 4HPQA 4QIWN 2R7UA 2VOPA 2JSPA 1HA8A 4B47A 2LF8A 1IG7A 4HQEA 4I98B 1DGRM 4AIDA 4HDUA 3J81K 3L09A 2D5VA 2HGCA 2D2WA 4A69C 1MGTA 2JUGA 1YITI 3EUKL 1R36A 3TKYA 4NC8A 2QF7A 3DKWA 4CCOA 3I56I 4LK1F 2HPMA 2NVUB 3ZMUA 2RNJA 3V4GA 4LG0B 2DYSH 2VBZA 4LITA 1FTTA 1I50J 4PZJA 2AXTC 3CMEI 4OIRF 5IP9J 2PN6A 2X0LA 5DCMB 4CYCA 1USSA 2HPIA 3ZN0A 2X51A 1IN7A 4F3QA 5C4JJ 2P7CB 1JE8A 2FUG2 4PSXA 2R7WA 4L9JA 3FXKA 1K7AA 3Q0VA 4ZDLA 1V55H 1I1GA 4LB6B 5LLQA 1UELB 3LQQA 1ZGAA 2VKDA 2HQAA 1MBFA 3E3VA 5K5QA 3FXJA 2JSCA 4PJLA 3K4NA 3DTIA 4GFBA 1DP3A 1O3SA 2X9DA 2CH0A 5D4SA 3CC2I 2E2IJ 1WWXA 1X19A 1MJBA 3IWFA 2F2EA 3SEQA 2EFWA 1W0TA 3G1OA 2FBIA 4MNUA 4LD5A 3LSTA 4IQ4A 3FBIB 1UFMA 2LKXA 3R0JA 3K2AA 2IAIA 1I5ZA 2IW5A 4II3A 3RZDJ 4UVAA 5E17F 4HSTA 1B8IA 1BOAA 5LHGA 1B4AA 1J0RA 4UVBA 4BH9A 1BL0A 3CO6C 2GQQA 1LE8A 1LEAA 1KGSA 1T0FC 9ANTA 3ZQIA 2XKPA 1HLVA
chains in the Genus database with same CATH topology
2ADUA 2ESHA 3PFIA 4I0AA 2GXBA 4AIKA 1GHCA 1K79A 2PBIA 1FP2A 1T0FA 2HZTA 2MD5A 4AIJA 1T6SA 1XMKA 3WTWC 2FNPA 2FXAA 3L00A 5HS8A 1B1BA 1OMIA 3CDHA 1G6NA 2XV4S 4P55A 3KP5A 3Q9VA 1QBJA 1ZH5A 4YG2F 4GXOA 4M9SA 4P9FA 5ED4A 3DV8A 4MTDA 2FNAA 2MH2A 2IVMA 5FFXA 4LGWA 2FRHA 2COMA 2P4WA 3IRRA 5LBQA 1IXCA 1WQ2A 3Q5FA 2QQ9A 2K86A 1TQPA 2VXZA 4HBLA 2ZBKA 5DCMA 4KICA 1L0OC 1J75A 3QRFF 2VC1A 2QQAA 1LNWA 2JRTA 3DF8A 3DQVC 3ZP5A 2RDPA 5DV5A 1BI1A 3FXUA 3LFKA 5L3FA 1Y0UA 4EGZA 5DDGA 3MCZA 2EB7A 2FQ3A 5L3CA 1ONVA 2NYXA 4WXCA 4L5JA 1Z6RA 1FNNA 2FMYA 2L4AA 1OYWA 3E97A 3GX4X 4HF2A 4I09A 1MKMA 4OINF 4JBAA 4HF1A 3ZMDA 2DAOA 4MQ9F 2ZNZA 1O3RA 4KN4X 1YYVA 3JW4A 4I01A 4HV6A 1U78A 3K1PA 2P5VA 3HOSA 2DK5A 3BJOA 3E5QA 2PFBA 3E5UA 2K7LA 3RJPA 1GVJA 1MD0A 1PP7U 1HW5A 4MEXF 4BYYA 2NNNA 2CSOA 3ECOA 2GA2A 5HLIA 2G9WA 4KFCA 1V4RA 1QQIA 4CICA 2PEXA 4Y13A 2QUFA 3HHGA 1UB9A 1J59A 2M30A 4IVNA 2Z5UA 3I5UA 2PI0A 5HDGA 3JSOA 4A2UA 5L3DA 3L2CA 3QPTA 3E6CC 5FGMA 3VB2A 4AD9A 4ESFA 2MLGA 3RKYA 3PQJA 2UZKA 2IP2A 2R7DA 5D6FA 4L0YB 4HLYA 2XRNA 1W7PD 2FF4A 4M73A 1BN5A 4RB1A 1ZAOA 4CHUA 1XGOA 3LA2A 1EH6A 4XLPF 4CXFA 3GFJA 4EJUA 4RGSA 5LHIA 1FT9A 2EFQA 4AVPA 3WG9A 1ZRFA 2STTA 4LLGF 4RAZA 5FFZA 1LDJA 1YW8A 3CUQB 4KA4A 4TV7A 1DDNA 4LFUA 4AIHA 2UWMA 2H09A 5DUKA 1HW2A 3BP8A 3HRSA 5ILUA 2DFIA 4RGUA 3GW2A 4EJWA 3H92A 4G9YA 3SQNA 4HZFA 1G3WA 3GXOA 4IJAA 3GUDA 1Z7UA 2A69F 1ZRCA 5L3BA 2IA2A 2HWVA 4N0BA 1CF7B 2E7WA 3MEXA 1WI9A 4XLNF 4HW0A 5ICEA 1KYWA 3GWZA 3JTHA 2GWRA 4N9HA 3D5LA 2VBXA 1YO5C 2EA4A 2RN7A 4P96A 3VFZA 2J5PA 3CJNA 3I53A 2QZ8A 1LVAA 1FY7A 3MZHA 1B59A 4DNCA 2FEZA 4GCVA 4G6QA 1KU3A 2H6BA 1JGSA 1BI3A 1MZBA 3FZVA 3H3UA 2ZMEB 4KUMA 5BQTA 3HRUA 3R0AA 5HDNA 2D45A 4OMZA 1ZG5A 3GLXA 4LB5A 4HX8A 2STWA 3CUQC 1ZHFA 1H9GA 2XAGA 2QM3A 1G3YA 1STZA 3DP7A 3U1DA 3SFZA 3KP4A 2JTVA 2XAFA 3I54A 5IT3A 3DEUA 3CUQA 2BV6A 3EQLF 2VOOA 1YLFA 2NAZA 4EJOA 1FBUA 2Z33A 3GVAA 4EMSA 4M71A 4PGGA 3WGHA 3HOTA 1HKTA 1KQ8A 4HA8A 1XMAA 3FMRA 2L01A 3K2ZA 3T8RA 1ZARA 1TNSA 1S8NA 4U88A 2M1BA 1UCRA 4O3MA 5LHHA 3HRMA 2IJLA 4M74A 3SXYA 4YIFA 4IRHA 4M6XA 5LGNA 3QOPA 1YS7A 4FX4A 2EFNA 3WGGA 2ELHA 2BBYA 2LF7A 4R79A 1LEBA 2XHKA 1IN5A 2VN2A 1TNTA 1E2XA 3C1DA 2L02A 4ENNA 1Z1DA 4S04A 3HSRA 4Q4ZF 2IPQX 2F5DA 4U0WA 4OIQF 5BPDA 3N97A 5CVUA 1S29A 1SMYF 3TDZC 3KP3A 4OOIA 1OYIA 2DTRA 4HF0A 1FOKA 1SD6A 4UXNA 1HKQA 2EFPA 1HKSA 1I1SA 1R5GA 3RPQA 2ZMEA 2JZYA 2RQPA 3TGNA 3KLOA 2BE5F 4G94A 4Y17A 5H6RA 3ISPA 1FSHA 5HS9A 3FM5A 5E20A 3OOPA 1R7JA 1BI2A 4N9IA 3C7JA 5DCFA 2KIMA 2QVOA 2DPUA 4M6YA 5ICFA 1RNLA 1CGPA 3JAMZ 2O6GE 3RI4A 4AWXB 4KIBA 3DPLC 1SFUA 3O3KA 1FLIA 2CYYA 1BIAA 1ZGJA 3JTGA 1IF1A 5KK1A 1RUOA 5DYMA 3E6MA 1F4KA 1F5TA 2UXNA 2LKPA 5D5WB 1G3SA 3V8JA 3O6BB 3QPHA 3FXRA 3FXQA 3KLNA 3GZ5A 5K5RA 2QENA 2W25A 5HDKA 3LWFA 3ZQ7A 4P9UA 4LLLA 2ZFWA 2VC0A 3WE3A 4BAYA 2QWWA 1R1VA 1HXDA 1QZZA 5K5OA 3I4PA 5HOOA 2QLZA 4LMYA 1PP8F 1T98A 2V1UA 5H20A 2W24A 5ILVA 2DQRA 5DUIA 4IHSA 1YW7A 1T39A 1MDMB 3ZMZA 4F7ZA 3I59B 1R00A 2FMLA 1O3TA 1LQ1A 1R5HA 2IA0A 2HS5A 5LEJA 1IN8A 1P2FA 2FU4A 2P5LC 3MZYA 1IRFA 1C0WA 3EYYA 2CO5A 2B0LA 4Q48A 4XSXF 1SFXA 2MA3A 5DD8A 2DI3A 1BI0A 3JSPA 1ZRDA 2HTJA 3BY6A 4LK0F 4KYWA 4GYIA 2ZJ2A 2OQGA 3L9FA 2G7UA 2A3SA 1FWZA 1P92A 2H6CA 1JHFA 1U5TB 1IUYA 1R1UA 3W6KB 1EH7A 1XSDA 5D5VB 1QNTA 4G8XA 3DPTA 2XVCA 1EV7A 3ABTA 1LJ9A 4XSZF 4XRFA 4ETSA 1RIOH 5K1YA 2F5EA 2FOKA 5E1WA 1R58A 4IF4A 1XN7A 2A6HF 4A0YA 3BPXA 4B09A 4Z2YA 3R61A 2VE9A 4QLCU 3NEUA 2EV5A 2VBYA 1EH8A 2ZKZA 1USTA 1SFEA 2CG4A 1XSVA 4L0ZB 2EV6A 3M8FA 5H6QA 2GIVA 3HYIA 5TJJA 1QGPA 4WCGA 3LAJA 1S6LA 4YFNF 2QQBA 2OZUA 3RTRA 2C6YA 1MDMA 3ELKA 1J9IA 3F3XA 3I59A 1K78B 3EETA 1YG2A 3ZMSA 4M9ZA 2XIGA 2AXLA 2K4BA 1DPUA 5EEHA 2W57A 3QAHA 4RAYA 5BS6A 1X3UA 4CYDA 4KMFA 2VODA 2OA4A 3NRVA 2D1VA 3HUGA 4U0VA 4ENMA 2A68F 3KZYA 3FF5A 1U5TC 1BC7C 1FYMA 4D0PA 3RKXA 4OIPF 3FHZA 2Y48A 1BIBA 4G6DA 2ISYA 2LDUA 2F5FA 1JHHA 1U5TA 4S05A 5J6XA 3OV8A 2L3DA 3F8MA 1G3TA 3J7AO 4L5IA 3M8EA 2EK5A 3WTSC 3MFKA 2O8XA 1Z6TA 3HRTA 4ZYEA 1Q1HA 5E8GA 2GXGA 5CVJA 5CVIA 5D6EA 4ZYDA 3B73A 1SMTA 1AWCA 1RI7A 1HW1A 2RV8A 2VT3A 5E1ZB 1FSEA 4UVCA 5J8FA 3GEZA 4WWCA 1J2XA 2Y0MA 2ZO4A 1O7FA 2RVCA 4UUVA 4L9VA 1K78A 4IXAA 4L18B 1ZYRF 1G4DA 1MJAA 6PAXA 4WF2A 1F1ZA 1YFHA 5D8LB 3IRQA 3F8FA 3ZN1A 1ZLJA 1XCBA 4GYGA 1KQ9A 2K02A 3QU6A 4HV5A 3EYIA 4EGYA 1XCVA 4CDGA 5JFRA 2PQ8A 1WRJA 3MAJA 3IHUA 5DEQA 1UHMA 5HLHA 1KU9A 3CLOA 1H0MA 4P5OA 4FHTA 1DP7P 5ERIA 4OU0A 5LGTA 3IC7A 2HKXA 2BEOA 2GA1A 1XGNA 2JPCA 3ECHA 3I0TA 4KMUX 4MQVA 1ULYA 2VONA 1L3LA 3I58A 2XGXA 1DPRA 4CZZA 3G73A 3MWMA 1RZ4A 4R8HA 4ZZDA 3I64A 3K69A 3C3WA 3J81Z 2A6EF 1ODDA 4H0EA 3ABUA 4ESBA 4OIOF 1P4AA 3SZTA 3WTZA 4O5VA 2V79A 4ENJA 3BPVA 2A07F 3W6JB 2IRFG 2M87A 4G7OF 4BHBA 2K27A 2ISZA 1SD5A 4EJVA 3WTXC 1ZG3A 5F64A 1XDSA 3RIRA 4RS8A 1O3QA 1Z05A 2M5WA 3LQRA 3KETA 1SD4A 4JQFA 2JPBA 3ML6A 2W85A 2Z99A 3DFGA 1KU7A 2DPDA 4HX4A 4XBFA 3WGIA 3P9KA 4PCQA 1D5VA 3RDIA 3S2WA 5F1RA 4IHTA 3TOBA 1MJ9A 3BDDA 4EQQA 2IT0A 1OR7A 5FB2A 1OPCA 1AOYA 3VODA 3K1NA 1IN6A 2ZXJA 2CQKA 1JXSA 3BZ6A 5CVRA 3C18A 4IPAA 2M45A 2CGPA 3P9IA 3H3ZA 5AIQA 2DO7A 2PMUA 2OAZA 3E6DA 4RB3C 1FYKA 1TW3A 1KQ0A 5E1XA 2OQRA 3B02A 2YSRA 2P5KA 1F9NA 3COAC 2DBBA 3FM3A 4G7ZF 2E1NA 3QP6A 1IRGA 3WTVC 2YR2A 3MQ0A 4EVIA 4U7BA 5JI6A 3J80Z 3WE2A 2ZNYA 2DLLA 2UXXA 2HKOA 2WV0A 3IKVA 1U8RA 2O0YA 1IAWA 3GFIA 5ICGA 1KU2A 2VBWA 2OD5A 1T2KA 2RGVA 1GXQA 1XD7A 2LNBA 1HSJA 1YQAA 1TW2A 2E1CA 1K6OA 1OYYA 3U9GA 1FBQA 3K0LA 2BYVE 3F6VA 3DXJF 1O7LA 2GAUA 3R6SA 5ILSA 3M1EA 3KEQA 2HOEA 1TTYA 3WTTC 5JR3A 1QPMA 4KIFA 3O2PE 2HEOA 1ZLKA 4GO1A 3ZPLA 2KJBA 2PLYA 2VE8A 4HOBA 2A5YB 4HQMA 1TLHB 3R4KA 3N4MA 3REOA 4ESJA 1IW7F 4OMYA 3BJ6A 1ON1A 3FMSA 2DQLA 4HX7A 3IL2A 5BOXA 5L3EA 3F23A 3KP6A 1T38A 4KNYA 1U2WA 3TO6A 3ZMTA 5CLSA 1O57A 2CWEA 1ZG1A 1DUXC 5LRRA 2P7VB 4MGRA 4EM1A 1GXPA 2ACJA 4DQ2A 2MLKA 5D4RA 2J5OA 1NHAA 1QO0D 5LRSA 4QWQA 2NNYA 4U0YA 1I6XA 2KRFA 1VTNC 4MHGA 2F5CA 3F8NA 4RB2C 2TDXA 3F6OA 4LJZF 2G7HA 1HQCA 1I27A 3E5XA 1BC8C 3HTUA 4MTEA 3AAFA 3D0SA 1J5YA 3V8LA 2HYFA 3BWGA 3GO5A 2DU9A 5D5XB 2Z3YA 1R22A 1RUNA 4B8XA 3RPUA 5BPIA 3QU3A 1IN4A 1B9NA 1TBXA 2XAHA 1D8KA 3JAMK 4WXDA 1P6RA 2DW4A 2XROA 2KKOA 3TDUC 1P4WA 2YU3A 4JK1X 2NS0A 5BMZA 2GZWA 2EWNA 1S7AA 5TRDA 3J80K 3TO7A 2P6TA 2HDCA 3KP2A 2CFXA 4LG0A 1B9MA 1IZ1A 5F6FA 4ASNA 4A12A 4Y15A 3WU0A 2X4HA 1J7KA 2FE3A 1ZN2A 5ICCA 2V6CA 4Q5SF 1TQIA 2V1DA 1WKMA 3WU1B 5AONA 4I0BA 5LGUA 3RYPA 5HLGA 3HHHA 5FLXZ 2EV0A 1YW9A 1HSTA 1FP1D 2FSWA 2HFHA 4A0XA 2IA1A 3EDPA 4A6EA 1LDDA 2P8TA 2EA2A 1ON2A 1Z9CA 2L54A 4KDPA 2YX7A 1IXSB 5FD6A 3F22A 3ERED 4EV0A 1XDUA 2CW0F 1FPQA 5AIPA 2L4MA 1P4XA 4ENKA 2WTEA 4HAMA 3IKTA 3EUHA 4ON0A 3BJAA 5E8IA 1WSUA 4BQAA 2E7XA 5DD4A 5IT9Z 5JVTA 1SD7A 2OZ6A 4I7HA 1S3JA 1A04A 2LSOA 4GGGA 4U7DA 1BM9A 4RGRA 3FX3A 4YIIA 2XAJA 3BROA 3T5XA 3SZPA 2H94A 4IRGA 3T0YA 2O03A 4BXUA 3TQNA 2H27A 4KIGA 4MEYF 1BJAA 1Z91A 4A5MA 1H9TA 2OU2A 3E6BA 4WX9A 2WC2A 3F72A 4Q47A 5CVVA 3LA7A 4KT5C 4WXHA 2XASA 2A61A 2R3SA 1U3EM 3KFWX 1W5TA 4R1HA 4HYEA 3R60A 5A2QZ 2MC3A 2BGCA 1D3YA 5D5UB 4ZYGA 2KIFA 2FBHA 4WK8F 3F21A 5EEGA 4G7HF 2XUBA 4UV8A 2OBPA 2MH9A 2HQRA 3K1MA 3KP7A 3M9AA 2RKHA 2YX4A 5E18F 1YIOA 1FC3A 5CJ9A 3CO7C 2M8EA 3GZ6A 5FD5A 3Q9SA 3KEOA 2Q8KA 1KYZA 4YFXF 2HYGD 2FBKA 2ETHA 4CO8A 2W84A 3F8CA 1U6GA 4M9XA 1ZREA 4A0ZA 5FLXK 1B6AA 2KJCA 4YFKF 3WODF 4UHTA 3U2RA 1W4MA 1V3FA 2Q2EA 4IRIA 4EM2A 1FX7A 4BNCA 3GF2A 3HTSB 3T1BA 2EJRA 1PDNC 4UV9A 3P9CA 3V7CA 4NHJA 2YPRA 4NB5A 4BHPA 3I71A 4A5NA 3G3ZA 2P6SA 3F8BA 2AS5F 4ZH4F 1XB4A 3CTAA 4I2OA 4HDVA 5L3GA 1REPC 3KE2A 1YTYA 3BOQA 4A6DA 1SAXA 5IT9K 3RKWA 3HSFA 3HSEA 2DT5A 2Q0OA 5HVQC 2QBYB 2Y75A 1IXRC 4O6JA 4ZYHA 3V7SA 4E70A 3TO9A 3WTYC 3GFLA 3GFMA 1PUEE 1W7PB 2DK8A 1D8JA 2MBFA 2QYOA 3V7RA 4L9NA 1E17A 2XAQA 2V9VA 3VEPA 2HR3A 4ZZLA 4PGHA 3IWZA 1XGMA 2HTSA 2VT2A 2ZCWA 5KVRA 3ROUA 1R23A 5A2QK 5CYVA 3FMQA 5FO5A 2EFOA 2O61A 4FX0A 3RYRA 2O3FA 2KIUA 3WTUC 4PDKA 1S7OA 2ESNA 2R7FA 2Z9OA 4EM0B 5HS7A 1QZYA 2HQNA 5JHUA 4NQWA 2PJPA 1CF7A 4K2EA 3K9TA 3T8TA 3TOAA 3GYHX 2V1XA 5LEKA 4L9TA 2PG4A 3PQKA 4M72A 3ULQB 3LA3A 5J8CA 1OKRA 2NRAC 3LAPA 3KZZA 3VOEA 4KN7X 3P7NA 3V8KA 1YS6A 2WWYA 3NQOA 1FBSA 3KCCA 1UHWA 2K4JA 2PMHA 2RC4A 2D1HA 3HIFA 2QBYA 3CUOA 4FT8A 5D8KB 1HBXG 1W5SA 3L7WA 4EJTA 1FZPB 3QP5A 4RB0A 1W7PA 4CGZA 4LLNA 4HLXA 3FWEA 1KA8A 1TQMA 1XGSA 2FA5A 3SHFA 3M7GA 3ZMVA 1LDKB 1LB2A 1BBYA 1R1TA 1XSXA 4I02A 2JT1A 4UNOA 4RGXA 2XKOA 4BHCA 1FYLA 2VOPA 2LF8A 4HQEA 4I98B 4HDUA 3J81K 3L09A 2HGCA 2D2WA 1MGTA 1R36A 3TKYA 3DKWA 4LK1F 3ZMUA 2RNJA 3V4GA 4LG0B 2VBZA 4PZJA 4OIRF 2PN6A 2X0LA 5DCMB 1USSA 3ZN0A 1IN7A 2P7CB 1JE8A 4L9JA 1K7AA 1I1GA 4LB6B 5LLQA 3LQQA 1ZGAA 3E3VA 5K5QA 2JSCA 1O3SA 5D4SA 1WWXA 1MJBA 3IWFA 2F2EA 2EFWA 2FBIA 4MNUA 4LD5A 3LSTA 1UFMA 3R0JA 1I5ZA 2IW5A 4UVAA 5E17F 1BOAA 5LHGA 1B4AA 1J0RA 4UVBA 4BH9A 3CO6C 2GQQA 1LEAA 1KGSA 2XKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADU A;  2ESH A;  3PFI A;  4I0A A;  2GXB A;  4AIK A;  1GHC A;  1K79 A;  2PBI A;  1FP2 A;  1T0F A;  2HZT A;  2MD5 A;  4AIJ A;  1T6S A;  1XMK A;  3WTW C;  2FNP A;  2FXA A;  3L00 A;  5HS8 A;  1B1B A;  1OMI A;  3CDH A;  1G6N A;  2XV4 S;  4P55 A;  3KP5 A;  3Q9V A;  1QBJ A;  1ZH5 A;  4YG2 F;  4GXO A;  4M9S A;  4P9F A;  5ED4 A;  3DV8 A;  4MTD A;  2FNA A;  2MH2 A;  2IVM A;  5FFX A;  4LGW A;  2FRH A;  2COM A;  2P4W A;  3IRR A;  5LBQ A;  1IXC A;  1WQ2 A;  3Q5F A;  2QQ9 A;  2K86 A;  1TQP A;  2VXZ A;  4HBL A;  2ZBK A;  5DCM A;  4KIC A;  1L0O C;  1J75 A;  3QRF F;  2VC1 A;  2QQA A;  1LNW A;  2JRT A;  3DF8 A;  3DQV C;  3ZP5 A;  2RDP A;  5DV5 A;  1BI1 A;  3FXU A;  3LFK A;  5L3F A;  1Y0U A;  4EGZ A;  5DDG A;  3MCZ A;  2EB7 A;  2FQ3 A;  5L3C A;  1ONV A;  2NYX A;  4WXC A;  4L5J A;  1Z6R A;  1FNN A;  2FMY A;  2L4A A;  1OYW A;  3E97 A;  3GX4 X;  4HF2 A;  4I09 A;  1MKM A;  4OIN F;  4JBA A;  4HF1 A;  3ZMD A;  2DAO A;  4MQ9 F;  2ZNZ A;  1O3R A;  4KN4 X;  1YYV A;  3JW4 A;  4I01 A;  4HV6 A;  1U78 A;  3K1P A;  2P5V A;  3HOS A;  2DK5 A;  3BJO A;  3E5Q A;  2PFB A;  3E5U A;  2K7L A;  3RJP A;  1GVJ A;  1MD0 A;  1PP7 U;  1HW5 A;  4MEX F;  4BYY A;  2NNN A;  2CSO A;  3ECO A;  2GA2 A;  5HLI A;  2G9W A;  4KFC A;  1V4R A;  1QQI A;  4CIC A;  2PEX A;  4Y13 A;  2QUF A;  3HHG A;  1UB9 A;  1J59 A;  2M30 A;  4IVN A;  2Z5U A;  3I5U A;  2PI0 A;  5HDG A;  3JSO A;  4A2U A;  5L3D A;  3L2C A;  3QPT A;  3E6C C;  5FGM A;  3VB2 A;  4AD9 A;  4ESF A;  2MLG A;  3RKY A;  3PQJ A;  2UZK A;  2IP2 A;  2R7D A;  5D6F A;  4L0Y B;  4HLY A;  2XRN A;  1W7P D;  2FF4 A;  4M73 A;  1BN5 A;  4RB1 A;  1ZAO A;  4CHU A;  1XGO A;  3LA2 A;  1EH6 A;  4XLP F;  4CXF A;  3GFJ A;  4EJU A;  4RGS A;  5LHI A;  1FT9 A;  2EFQ A;  4AVP A;  3WG9 A;  1ZRF A;  2STT A;  4LLG F;  4RAZ A;  5FFZ A;  1LDJ A;  1YW8 A;  3CUQ B;  4KA4 A;  4TV7 A;  1DDN A;  4LFU A;  4AIH A;  2UWM A;  2H09 A;  5DUK A;  1HW2 A;  3BP8 A;  3HRS A;  5ILU A;  2DFI A;  4RGU A;  3GW2 A;  4EJW A;  3H92 A;  4G9Y A;  3SQN A;  4HZF A;  1G3W A;  3GXO A;  4IJA A;  3GUD A;  1Z7U A;  2A69 F;  1ZRC A;  5L3B A;  2IA2 A;  2HWV A;  4N0B A;  1CF7 B;  2E7W A;  3MEX A;  1WI9 A;  4XLN F;  4HW0 A;  5ICE A;  1KYW A;  3GWZ A;  3JTH A;  2GWR A;  4N9H A;  3D5L A;  2VBX A;  1YO5 C;  2EA4 A;  2RN7 A;  4P96 A;  3VFZ A;  2J5P A;  3CJN A;  3I53 A;  2QZ8 A;  1LVA A;  1FY7 A;  3MZH A;  1B59 A;  4DNC A;  2FEZ A;  4GCV A;  4G6Q A;  1KU3 A;  2H6B A;  1JGS A;  1BI3 A;  1MZB A;  3FZV A;  3H3U A;  2ZME B;  4KUM A;  5BQT A;  3HRU A;  3R0A A;  5HDN A;  2D45 A;  4OMZ A;  1ZG5 A;  3GLX A;  4LB5 A;  4HX8 A;  2STW A;  3CUQ C;  1ZHF A;  1H9G A;  2XAG A;  2QM3 A;  1G3Y A;  1STZ A;  3DP7 A;  3U1D A;  3SFZ A;  3KP4 A;  2JTV A;  2XAF A;  3I54 A;  5IT3 A;  3DEU A;  3CUQ A;  2BV6 A;  3EQL F;  2VOO A;  1YLF A;  2NAZ A;  4EJO A;  1FBU A;  2Z33 A;  3GVA A;  4EMS A;  4M71 A;  4PGG A;  3WGH A;  3HOT A;  1HKT A;  1KQ8 A;  4HA8 A;  1XMA A;  3FMR A;  2L01 A;  3K2Z A;  3T8R A;  1ZAR A;  1TNS A;  1S8N A;  4U88 A;  2M1B A;  1UCR A;  4O3M A;  5LHH A;  3HRM A;  2IJL A;  4M74 A;  3SXY A;  4YIF A;  4IRH A;  4M6X A;  5LGN A;  3QOP A;  1YS7 A;  4FX4 A;  2EFN A;  3WGG A;  2ELH A;  2BBY A;  2LF7 A;  4R79 A;  1LEB A;  2XHK A;  1IN5 A;  2VN2 A;  1TNT A;  1E2X A;  3C1D A;  2L02 A;  4ENN A;  1Z1D A;  4S04 A;  3HSR A;  4Q4Z F;  2IPQ X;  2F5D A;  4U0W A;  4OIQ F;  5BPD A;  3N97 A;  5CVU A;  1S29 A;  1SMY F;  3TDZ C;  3KP3 A;  4OOI A;  1OYI A;  2DTR A;  4HF0 A;  1FOK A;  1SD6 A;  4UXN A;  1HKQ A;  2EFP A;  1HKS A;  1I1S A;  1R5G A;  3RPQ A;  2ZME A;  2JZY A;  2RQP A;  3TGN A;  3KLO A;  2BE5 F;  4G94 A;  4Y17 A;  5H6R A;  3ISP A;  1FSH A;  5HS9 A;  3FM5 A;  5E20 A;  3OOP A;  1R7J A;  1BI2 A;  4N9I A;  3C7J A;  5DCF A;  2KIM A;  2QVO A;  2DPU A;  4M6Y A;  5ICF A;  1RNL A;  1CGP A;  3JAM Z;  2O6G E;  3RI4 A;  4AWX B;  4KIB A;  3DPL C;  1SFU A;  3O3K A;  1FLI A;  2CYY A;  1BIA A;  1ZGJ A;  3JTG A;  1IF1 A;  5KK1 A;  1RUO A;  5DYM A;  3E6M A;  1F4K A;  1F5T A;  2UXN A;  2LKP A;  5D5W B;  1G3S A;  3V8J A;  3O6B B;  3QPH A;  3FXR A;  3FXQ A;  3KLN A;  3GZ5 A;  5K5R A;  2QEN A;  2W25 A;  5HDK A;  3LWF A;  3ZQ7 A;  4P9U A;  4LLL A;  2ZFW A;  2VC0 A;  3WE3 A;  4BAY A;  2QWW A;  1R1V A;  1HXD A;  1QZZ A;  5K5O A;  3I4P A;  5HOO A;  2QLZ A;  4LMY A;  1PP8 F;  1T98 A;  2V1U A;  5H20 A;  2W24 A;  5ILV A;  2DQR A;  5DUI A;  4IHS A;  1YW7 A;  1T39 A;  1MDM B;  3ZMZ A;  4F7Z A;  3I59 B;  1R00 A;  2FML A;  1O3T A;  1LQ1 A;  1R5H A;  2IA0 A;  2HS5 A;  5LEJ A;  1IN8 A;  1P2F A;  2FU4 A;  2P5L C;  3MZY A;  1IRF A;  1C0W A;  3EYY A;  2CO5 A;  2B0L A;  4Q48 A;  4XSX F;  1SFX A;  2MA3 A;  5DD8 A;  2DI3 A;  1BI0 A;  3JSP A;  1ZRD A;  2HTJ A;  3BY6 A;  4LK0 F;  4KYW A;  4GYI A;  2ZJ2 A;  2OQG A;  3L9F A;  2G7U A;  2A3S A;  1FWZ A;  1P92 A;  2H6C A;  1JHF A;  1U5T B;  1IUY A;  1R1U A;  3W6K B;  1EH7 A;  1XSD A;  5D5V B;  1QNT A;  4G8X A;  3DPT A;  2XVC A;  1EV7 A;  3ABT A;  1LJ9 A;  4XSZ F;  4XRF A;  4ETS A;  1RIO H;  5K1Y A;  2F5E A;  2FOK A;  5E1W A;  1R58 A;  4IF4 A;  1XN7 A;  2A6H F;  4A0Y A;  3BPX A;  4B09 A;  4Z2Y A;  3R61 A;  2VE9 A;  4QLC U;  3NEU A;  2EV5 A;  2VBY A;  1EH8 A;  2ZKZ A;  1UST A;  1SFE A;  2CG4 A;  1XSV A;  4L0Z B;  2EV6 A;  3M8F A;  5H6Q A;  2GIV A;  3HYI A;  5TJJ A;  1QGP A;  4WCG A;  3LAJ A;  1S6L A;  4YFN F;  2QQB A;  2OZU A;  3RTR A;  2C6Y A;  1MDM A;  3ELK A;  1J9I A;  3F3X A;  3I59 A;  1K78 B;  3EET A;  1YG2 A;  3ZMS A;  4M9Z A;  2XIG A;  2AXL A;  2K4B A;  1DPU A;  5EEH A;  2W57 A;  3QAH A;  4RAY A;  5BS6 A;  1X3U A;  4CYD A;  4KMF A;  2VOD A;  2OA4 A;  3NRV A;  2D1V A;  3HUG A;  4U0V A;  4ENM A;  2A68 F;  3KZY A;  3FF5 A;  1U5T C;  1BC7 C;  1FYM A;  4D0P A;  3RKX A;  4OIP F;  3FHZ A;  2Y48 A;  1BIB A;  4G6D A;  2ISY A;  2LDU A;  2F5F A;  1JHH A;  1U5T A;  4S05 A;  5J6X A;  3OV8 A;  2L3D A;  3F8M A;  1G3T A;  3J7A O;  4L5I A;  3M8E A;  2EK5 A;  3WTS C;  3MFK A;  2O8X A;  1Z6T A;  3HRT A;  4ZYE A;  1Q1H A;  5E8G A;  2GXG A;  5CVJ A;  5CVI A;  5D6E A;  4ZYD A;  3B73 A;  1SMT A;  1AWC A;  1RI7 A;  1HW1 A;  2RV8 A;  2VT3 A;  5E1Z B;  1FSE A;  4UVC A;  5J8F A;  3GEZ A;  4WWC A;  1J2X A;  2Y0M A;  2ZO4 A;  1O7F A;  2RVC A;  4UUV A;  4L9V A;  1K78 A;  4IXA A;  4L18 B;  1ZYR F;  1G4D A;  1MJA A;  6PAX A;  4WF2 A;  1F1Z A;  1YFH A;  5D8L B;  3IRQ A;  3F8F A;  3ZN1 A;  1ZLJ A;  1XCB A;  4GYG A;  1KQ9 A;  2K02 A;  3QU6 A;  4HV5 A;  3EYI A;  4EGY A;  1XCV A;  4CDG A;  5JFR A;  2PQ8 A;  1WRJ A;  3MAJ A;  3IHU A;  5DEQ A;  1UHM A;  5HLH A;  1KU9 A;  3CLO A;  1H0M A;  4P5O A;  4FHT A;  1DP7 P;  5ERI A;  4OU0 A;  5LGT A;  3IC7 A;  2HKX A;  2BEO A;  2GA1 A;  1XGN A;  2JPC A;  3ECH A;  3I0T A;  4KMU X;  4MQV A;  1ULY A;  2VON A;  1L3L A;  3I58 A;  2XGX A;  1DPR A;  4CZZ A;  3G73 A;  3MWM A;  1RZ4 A;  4R8H A;  4ZZD A;  3I64 A;  3K69 A;  3C3W A;  3J81 Z;  2A6E F;  1ODD A;  4H0E A;  3ABU A;  4ESB A;  4OIO F;  1P4A A;  3SZT A;  3WTZ A;  4O5V A;  2V79 A;  4ENJ A;  3BPV A;  2A07 F;  3W6J B;  2IRF G;  2M87 A;  4G7O F;  4BHB A;  2K27 A;  2ISZ A;  1SD5 A;  4EJV A;  3WTX C;  1ZG3 A;  5F64 A;  1XDS A;  3RIR A;  4RS8 A;  1O3Q A;  1Z05 A;  2M5W A;  3LQR A;  3KET A;  1SD4 A;  4JQF A;  2JPB A;  3ML6 A;  2W85 A;  2Z99 A;  3DFG A;  1KU7 A;  2DPD A;  4HX4 A;  4XBF A;  3WGI A;  3P9K A;  4PCQ A;  1D5V A;  3RDI A;  3S2W A;  5F1R A;  4IHT A;  3TOB A;  1MJ9 A;  3BDD A;  4EQQ A;  2IT0 A;  1OR7 A;  5FB2 A;  1OPC A;  1AOY A;  3VOD A;  3K1N A;  1IN6 A;  2ZXJ A;  2CQK A;  1JXS A;  3BZ6 A;  5CVR A;  3C18 A;  4IPA A;  2M45 A;  2CGP A;  3P9I A;  3H3Z A;  5AIQ A;  2DO7 A;  2PMU A;  2OAZ A;  3E6D A;  4RB3 C;  1FYK A;  1TW3 A;  1KQ0 A;  5E1X A;  2OQR A;  3B02 A;  2YSR A;  2P5K A;  1F9N A;  3COA C;  2DBB A;  3FM3 A;  4G7Z F;  2E1N A;  3QP6 A;  1IRG A;  3WTV C;  2YR2 A;  3MQ0 A;  4EVI A;  4U7B A;  5JI6 A;  3J80 Z;  3WE2 A;  2ZNY A;  2DLL A;  2UXX A;  2HKO A;  2WV0 A;  3IKV A;  1U8R A;  2O0Y A;  1IAW A;  3GFI A;  5ICG A;  1KU2 A;  2VBW A;  2OD5 A;  1T2K A;  2RGV A;  1GXQ A;  1XD7 A;  2LNB A;  1HSJ A;  1YQA A;  1TW2 A;  2E1C A;  1K6O A;  1OYY A;  3U9G A;  1FBQ A;  3K0L A;  2BYV E;  3F6V A;  3DXJ F;  1O7L A;  2GAU A;  3R6S A;  5ILS A;  3M1E A;  3KEQ A;  2HOE A;  1TTY A;  3WTT C;  5JR3 A;  1QPM A;  4KIF A;  3O2P E;  2HEO A;  1ZLK A;  4GO1 A;  3ZPL A;  2KJB A;  2PLY A;  2VE8 A;  4HOB A;  2A5Y B;  4HQM A;  1TLH B;  3R4K A;  3N4M A;  3REO A;  4ESJ A;  1IW7 F;  4OMY A;  3BJ6 A;  1ON1 A;  3FMS A;  2DQL A;  4HX7 A;  3IL2 A;  5BOX A;  5L3E A;  3F23 A;  3KP6 A;  1T38 A;  4KNY A;  1U2W A;  3TO6 A;  3ZMT A;  5CLS A;  1O57 A;  2CWE A;  1ZG1 A;  1DUX C;  5LRR A;  2P7V B;  4MGR A;  4EM1 A;  1GXP A;  2ACJ A;  4DQ2 A;  2MLK A;  5D4R A;  2J5O A;  1NHA A;  1QO0 D;  5LRS A;  4QWQ A;  2NNY A;  4U0Y A;  1I6X A;  2KRF A;  1VTN C;  4MHG A;  2F5C A;  3F8N A;  4RB2 C;  2TDX A;  3F6O A;  4LJZ F;  2G7H A;  1HQC A;  1I27 A;  3E5X A;  1BC8 C;  3HTU A;  4MTE A;  3AAF A;  3D0S A;  1J5Y A;  3V8L A;  2HYF A;  3BWG A;  3GO5 A;  2DU9 A;  5D5X B;  2Z3Y A;  1R22 A;  1RUN A;  4B8X A;  3RPU A;  5BPI A;  3QU3 A;  1IN4 A;  1B9N A;  1TBX A;  2XAH A;  1D8K A;  3JAM K;  4WXD A;  1P6R A;  2DW4 A;  2XRO A;  2KKO A;  3TDU C;  1P4W A;  2YU3 A;  4JK1 X;  2NS0 A;  5BMZ A;  2GZW A;  2EWN A;  1S7A A;  5TRD A;  3J80 K;  3TO7 A;  2P6T A;  2HDC A;  3KP2 A;  2CFX A;  4LG0 A;  1B9M A;  1IZ1 A;  5F6F A;  4ASN A;  4A12 A;  4Y15 A;  3WU0 A;  2X4H A;  1J7K A;  2FE3 A;  1ZN2 A;  5ICC A;  2V6C A;  4Q5S F;  1TQI A;  2V1D A;  1WKM A;  3WU1 B;  5AON A;  4I0B A;  5LGU A;  3RYP A;  5HLG A;  3HHH A;  5FLX Z;  2EV0 A;  1YW9 A;  1HST A;  1FP1 D;  2FSW A;  2HFH A;  4A0X A;  2IA1 A;  3EDP A;  4A6E A;  1LDD A;  2P8T A;  2EA2 A;  1ON2 A;  1Z9C A;  2L54 A;  4KDP A;  2YX7 A;  1IXS B;  5FD6 A;  3F22 A;  3ERE D;  4EV0 A;  1XDU A;  2CW0 F;  1FPQ A;  5AIP A;  2L4M A;  1P4X A;  4ENK A;  2WTE A;  4HAM A;  3IKT A;  3EUH A;  4ON0 A;  3BJA A;  5E8I A;  1WSU A;  4BQA A;  2E7X A;  5DD4 A;  5IT9 Z;  5JVT A;  1SD7 A;  2OZ6 A;  4I7H A;  1S3J A;  1A04 A;  2LSO A;  4GGG A;  4U7D A;  1BM9 A;  4RGR A;  3FX3 A;  4YII A;  2XAJ A;  3BRO A;  3T5X A;  3SZP A;  2H94 A;  4IRG A;  3T0Y A;  2O03 A;  4BXU A;  3TQN A;  2H27 A;  4KIG A;  4MEY F;  1BJA A;  1Z91 A;  4A5M A;  1H9T A;  2OU2 A;  3E6B A;  4WX9 A;  2WC2 A;  3F72 A;  4Q47 A;  5CVV A;  3LA7 A;  4KT5 C;  4WXH A;  2XAS A;  2A61 A;  2R3S A;  1U3E M;  3KFW X;  1W5T A;  4R1H A;  4HYE A;  3R60 A;  5A2Q Z;  2MC3 A;  2BGC A;  1D3Y A;  5D5U B;  4ZYG A;  2KIF A;  2FBH A;  4WK8 F;  3F21 A;  5EEG A;  4G7H F;  2XUB A;  4UV8 A;  2OBP A;  2MH9 A;  2HQR A;  3K1M A;  3KP7 A;  3M9A A;  2RKH A;  2YX4 A;  5E18 F;  1YIO A;  1FC3 A;  5CJ9 A;  3CO7 C;  2M8E A;  3GZ6 A;  5FD5 A;  3Q9S A;  3KEO A;  2Q8K A;  1KYZ A;  4YFX F;  2HYG D;  2FBK A;  2ETH A;  4CO8 A;  2W84 A;  3F8C A;  1U6G A;  4M9X A;  1ZRE A;  4A0Z A;  5FLX K;  1B6A A;  2KJC A;  4YFK F;  3WOD F;  4UHT A;  3U2R A;  1W4M A;  1V3F A;  2Q2E A;  4IRI A;  4EM2 A;  1FX7 A;  4BNC A;  3GF2 A;  3HTS B;  3T1B A;  2EJR A;  1PDN C;  4UV9 A;  3P9C A;  3V7C A;  4NHJ A;  2YPR A;  4NB5 A;  4BHP A;  3I71 A;  4A5N A;  3G3Z A;  2P6S A;  3F8B A;  2AS5 F;  4ZH4 F;  1XB4 A;  3CTA A;  4I2O A;  4HDV A;  5L3G A;  1REP C;  3KE2 A;  1YTY A;  3BOQ A;  4A6D A;  1SAX A;  5IT9 K;  3RKW A;  3HSF A;  3HSE A;  2DT5 A;  2Q0O A;  5HVQ C;  2QBY B;  2Y75 A;  1IXR C;  4O6J A;  4ZYH A;  3V7S A;  4E70 A;  3TO9 A;  3WTY C;  3GFL A;  3GFM A;  1PUE E;  1W7P B;  2DK8 A;  1D8J A;  2MBF A;  2QYO A;  3V7R A;  4L9N A;  1E17 A;  2XAQ A;  2V9V A;  3VEP A;  2HR3 A;  4ZZL A;  4PGH A;  3IWZ A;  1XGM A;  2HTS A;  2VT2 A;  2ZCW A;  5KVR A;  3ROU A;  1R23 A;  5A2Q K;  5CYV A;  3FMQ A;  5FO5 A;  2EFO A;  2O61 A;  4FX0 A;  3RYR A;  2O3F A;  2KIU A;  3WTU C;  4PDK A;  1S7O A;  2ESN A;  2R7F A;  2Z9O A;  4EM0 B;  5HS7 A;  1QZY A;  2HQN A;  5JHU A;  4NQW A;  2PJP A;  1CF7 A;  4K2E A;  3K9T A;  3T8T A;  3TOA A;  3GYH X;  2V1X A;  5LEK A;  4L9T A;  2PG4 A;  3PQK A;  4M72 A;  3ULQ B;  3LA3 A;  5J8C A;  1OKR A;  2NRA C;  3LAP A;  3KZZ A;  3VOE A;  4KN7 X;  3P7N A;  3V8K A;  1YS6 A;  2WWY A;  3NQO A;  1FBS A;  3KCC A;  1UHW A;  2K4J A;  2PMH A;  2RC4 A;  2D1H A;  3HIF A;  2QBY A;  3CUO A;  4FT8 A;  5D8K B;  1HBX G;  1W5S A;  3L7W A;  4EJT A;  1FZP B;  3QP5 A;  4RB0 A;  1W7P A;  4CGZ A;  4LLN A;  4HLX A;  3FWE A;  1KA8 A;  1TQM A;  1XGS A;  2FA5 A;  3SHF A;  3M7G A;  3ZMV A;  1LDK B;  1LB2 A;  1BBY A;  1R1T A;  1XSX A;  4I02 A;  2JT1 A;  4UNO A;  4RGX A;  2XKO A;  4BHC A;  1FYL A;  2VOP A;  2LF8 A;  4HQE A;  4I98 B;  4HDU A;  3J81 K;  3L09 A;  2HGC A;  2D2W A;  1MGT A;  1R36 A;  3TKY A;  3DKW A;  4LK1 F;  3ZMU A;  2RNJ A;  3V4G A;  4LG0 B;  2VBZ A;  4PZJ A;  4OIR F;  2PN6 A;  2X0L A;  5DCM B;  1USS A;  3ZN0 A;  1IN7 A;  2P7C B;  1JE8 A;  4L9J A;  1K7A A;  1I1G A;  4LB6 B;  5LLQ A;  3LQQ A;  1ZGA A;  3E3V A;  5K5Q A;  2JSC A;  1O3S A;  5D4S A;  1WWX A;  1MJB A;  3IWF A;  2F2E A;  2EFW A;  2FBI A;  4MNU A;  4LD5 A;  3LST A;  1UFM A;  3R0J A;  1I5Z A;  2IW5 A;  4UVA A;  5E17 F;  1BOA A;  5LHG A;  1B4A A;  1J0R A;  4UVB A;  4BH9 A;  3CO6 C;  2GQQ A;  1LEA A;  1KGS A;  2XKP A; 
#chains in the Genus database with same CATH topology
 1UHS A;  2ADU A;  2ESH A;  2W82 A;  3PFI A;  4I0A A;  5IYB J;  5B3S H;  2GXB A;  2DFH A;  2GXA A;  4AIK A;  1GHC A;  2FQ4 A;  4RMN A;  1K79 A;  4IZZ A;  2PBI A;  1FP2 A;  3PJR A;  1PUF A;  2R7T A;  1T0F A;  2DCE A;  2HZT A;  2MD5 A;  1FTZ A;  4AIJ A;  3DWL E;  1T6S A;  4PJM A;  3BR0 A;  3BR2 A;  1BA5 A;  4BUP A;  1XMK A;  3WTW C;  2FNP A;  2KT0 A;  2FXA A;  2JJ7 A;  3IAS 2;  3QQA A;  1X1D A;  2ZC2 A;  1SEU A;  3L00 A;  5HS8 A;  1ZEL A;  1B1B A;  1Z77 A;  1OMI A;  2Y31 A;  1MMG A;  3CDH A;  1G6N A;  2LLK A;  2XV4 S;  4E7H A;  4P55 A;  3KP5 A;  1TP4 A;  3Q9V A;  1QBJ A;  1ZH5 A;  4XLH A;  1Y1V J;  3S3M A;  4YG2 F;  4GXO A;  2DN0 A;  4IL6 C;  5FKN A;  4M9S A;  4XOT A;  4AC0 A;  1QRY A;  4P9F A;  5ED4 A;  1JKQ C;  2IS1 A;  4XK4 A;  3DV8 A;  1X2M A;  2QSF X;  3WHC A;  1K6Y A;  4MTD A;  2FNA A;  2I5U A;  2MH2 A;  2IVM A;  5FFX A;  4LGW A;  3D5S C;  4C3I J;  2FRH A;  2COM A;  1ITY A;  2P4W A;  2PJR B;  3IRR A;  3ZGK A;  5LBQ A;  1MMD A;  5BNG A;  1IXC A;  1WQ2 A;  3OYN A;  3Q5F A;  1MIJ A;  1TZL A;  4CCM A;  2QQ9 A;  2K86 A;  2PMZ A;  1TQP A;  3S3O A;  4LOC A;  3RZO J;  2VXZ A;  4HBL A;  4CCK A;  3W2A A;  1TWA J;  1QA6 A;  5H2F C;  2ZBK A;  5KCM A;  5DCM A;  3OOU A;  2UUZ A;  3HZJ A;  3OYE A;  1U9O A;  1IV8 A;  1L0O C;  4KIC A;  2IS4 A;  1FOY A;  2QCO A;  3I9V 2;  3IH3 A;  4A3E J;  1J75 A;  3QRF F;  2L7F P;  2VC1 A;  2QQA A;  2M3A A;  1LNW A;  2JRT A;  3DF8 A;  1Z21 A;  3HL2 A;  3DQV C;  3O8H A;  4P1W A;  2RDP A;  3ZP5 A;  5DV5 A;  1BI1 A;  2XPV A;  3FXU A;  4X0G A;  3LFK A;  3IV5 A;  5L3F A;  1QVU A;  3HKZ N;  1Y0U A;  3K4B A;  4EGZ A;  2W00 A;  5DDG A;  1A6I A;  1R4N B;  3MCZ A;  1ZKG A;  2EB7 A;  1NTC A;  1ONV A;  2FQ3 A;  2NYX A;  4II2 A;  4XN3 A;  4WXC A;  2DFE A;  1X4O A;  5L3C A;  4L5J A;  1Z6R A;  1N77 A;  1FNN A;  2QSG X;  2FMY A;  2L4A A;  1OYW A;  3E97 A;  3GTL J;  3GX4 X;  4HF2 A;  4I09 A;  1MKM A;  1Z0X A;  1RKW A;  4BJ6 C;  4A3G J;  4OIN F;  3SZG A;  4JBA A;  4HF1 A;  3CQZ J;  3ZMD A;  4A3K J;  2DAO A;  4MQ9 F;  2UV1 A;  2ZNZ A;  4BY1 J;  2CRG A;  2LRD A;  2EIJ H;  4KN4 X;  1O3R A;  1YYV A;  3JW4 A;  4I01 A;  4HV6 A;  4XLE A;  1U78 A;  2K9Q A;  3K1P A;  2QKM B;  2P5V A;  3HOS A;  2DK5 A;  3KZI C;  4M3F A;  3BJO A;  1D0Y A;  2ELJ A;  3CP8 A;  3E5Q A;  1D0X A;  1QHG A;  2PFB A;  1YIJ I;  3E5U A;  2K7L A;  3RJP A;  1GVJ A;  1IGN A;  1MD0 A;  1PP7 U;  1HW5 A;  3A0H C;  4MEX F;  2JK3 A;  3GBG A;  4BYY A;  3DBH B;  2NNN A;  4GRI A;  2CSO A;  3ECO A;  2GA2 A;  4G12 A;  1MMA A;  4PJN A;  4AM3 A;  5HLI A;  2Z1D A;  3DCF A;  5IYD J;  2CFO A;  2G9W A;  4KFC A;  3H0D A;  1V4R A;  2DA4 A;  1QQI A;  3OR1 C;  4BDY A;  4CIC A;  1IJW C;  2PEX A;  4Y13 A;  4BAC A;  2QUF A;  3HHG A;  1R4M B;  4XRS G;  5K7Z A;  1UB9 A;  3OYB A;  1J59 A;  1EF4 A;  3ZCO A;  3V42 A;  2M30 A;  2VB6 A;  2FOW A;  3ASN H;  2VJJ A;  4IVN A;  2Z5U A;  3I5U A;  2PI0 A;  1VQN I;  2YU9 J;  5HDG A;  3JSO A;  4A2U A;  5L3D A;  1ZTR A;  1UAA A;  3ABK H;  3L2C A;  2ZXW H;  3QPT A;  4PSW A;  3E6C C;  5FGM A;  3VB2 A;  4HNV A;  1BW5 A;  2V1N A;  4AD9 A;  2X6X A;  2R7Q A;  3C2B A;  5JHF A;  2HXI A;  4ESF A;  1ETK A;  2IEK A;  2MLG A;  3PQJ A;  3RKY A;  2UZK A;  2PJR A;  1YE9 A;  1HDD C;  2IP2 A;  2R7D A;  5D6F A;  3FBN B;  3HGY A;  4L0Y B;  4HLY A;  2X85 A;  2XRN A;  3BTI A;  1W7P D;  2FF4 A;  4M73 A;  4PFP A;  3TW6 A;  1BN5 A;  3W2W A;  3OYM A;  5IYC J;  1OCR H;  4RB1 A;  1ZAO A;  4CHU A;  2DXI A;  3FK7 A;  1XGO A;  5M3F J;  3LA2 A;  1EH6 A;  4XLP F;  4CXF A;  3GFJ A;  4EJU A;  4RGS A;  2MD0 A;  2DMN A;  4XIC A;  5LHI A;  3CDL A;  4RM3 A;  4XM3 A;  1FT9 A;  4M3D A;  5IPA A;  2GIZ A;  3PO3 J;  4KIT B;  2EFQ A;  3S8P A;  2P81 A;  4AVP A;  3FXL A;  3KYD B;  2B63 J;  3WG9 A;  1ZRF A;  3MKL A;  1MNM C;  2STT A;  3J7A Y;  4LLG F;  4RAZ A;  5FFZ A;  1LDJ A;  1YW8 A;  3CUQ B;  4PFO A;  4KA4 A;  3CMM A;  4TV7 A;  4UY8 I;  1DDN A;  3RKQ A;  4HEA 2;  1YJ9 I;  4LFU A;  3OIO A;  2WB1 A;  4AIH A;  1VQ4 I;  2H09 A;  4A3C J;  5DUK A;  2UWM A;  2E1M C;  2JQ7 A;  3FDY A;  2XB5 A;  4IQJ A;  3OMY A;  2KRH A;  3NWS A;  2LK2 A;  1HW2 A;  4XLC A;  3BP8 A;  1G59 A;  3HC7 A;  2DMT A;  3HRS A;  2JWT A;  1JT0 A;  1FIP A;  5ILU A;  4XOP A;  2RRE A;  2CJJ A;  2WB1 N;  2F4O B;  2M4K A;  2CQX A;  3C2G A;  4I6Z A;  2DFI A;  2XSD C;  4RGU A;  3GW2 A;  4OWR B;  3BCA A;  4EJW A;  4B44 A;  3H92 A;  3BT9 A;  1B72 A;  4G9Y A;  3SQN A;  4I76 A;  4HZF A;  2E1O A;  1G3W A;  3GXO A;  4IJA A;  5KHD A;  2KDO A;  2BZT A;  4OAY A;  3GUD A;  1Z7U A;  2A69 F;  3FXM A;  1ZRC A;  3K4J A;  5L3B A;  2IA2 A;  2HWV A;  3K4M A;  3ZOB A;  2WAQ A;  4N0B A;  4NQW B;  1CF7 B;  2E7W A;  3MEX A;  1WI9 A;  4XLN F;  4HW0 A;  2EH3 A;  5GP9 A;  5ICE A;  4NUB A;  2R93 J;  1KYW A;  3GWZ A;  3JTH A;  5GTI C;  4E7K A;  2GWR A;  2OV7 A;  2WAQ N;  4N9H A;  3D5L A;  2VBX A;  4A3D J;  1YO5 C;  4HG2 A;  2Y30 A;  2EA4 A;  2RN7 A;  3FKJ A;  4J01 A;  4P96 A;  2E35 A;  2OJE D;  2L7M P;  3VFZ A;  2BHY A;  2J5P A;  3OS2 A;  3CJN A;  3I53 A;  1T08 B;  1KON A;  2QZ8 A;  1LVA A;  2BY2 A;  1FY7 A;  3MZH A;  1B59 A;  2DOA A;  3MN2 A;  2IBD A;  3GCM A;  1S5L C;  3HB9 A;  4DNC A;  1H89 C;  2FEZ A;  1X1C A;  4GCV A;  3H9G A;  4AYB A;  4E7I A;  4G6Q A;  1KU3 A;  2H6B A;  4S0H B;  3M07 A;  2VJ4 A;  1JGS A;  5IP6 A;  1BI3 A;  1MZB A;  3FZV A;  3H3U A;  1WGX A;  3S15 J;  2ZME B;  4AYB N;  1N78 A;  4KUM A;  5BQT A;  3HRU A;  3R0A A;  2IXS A;  3K7A J;  1R9T J;  2CQN A;  2ZJR F;  3BCB A;  2KMU A;  4B4C A;  4KT6 A;  3MKY B;  4IEJ A;  5HDN A;  2D45 A;  3M4O J;  4OMZ A;  2DDA A;  1ZG5 A;  3SEZ A;  3S1Q J;  3GLX A;  4LB5 A;  4HX8 A;  2STW A;  2EZL A;  3CUQ C;  2JA5 J;  1ZHF A;  2RNG A;  3S1M J;  1H9G A;  2XAG A;  5C3E J;  2QM3 A;  1G3Y A;  1STZ A;  3DP7 A;  3U1D A;  4RDU A;  4FE7 A;  3SFZ A;  2DOF A;  4ZTJ A;  2E36 A;  5CPR B;  3RCO A;  3KP4 A;  1X58 A;  2JTV A;  1OCO H;  3UKG A;  4BE0 A;  4BS9 A;  3ZQL A;  2XAF A;  4CUG A;  2B7E A;  4FIS A;  3I54 A;  5IT3 A;  3DEU A;  2LD5 A;  3CUQ A;  5IOY A;  2BV6 A;  3EQL F;  2VOO A;  5IY5 H;  1YLF A;  4UB6 C;  1ORK A;  2NAZ A;  4HSR A;  4A3B J;  1FEX A;  4EJO A;  1FBU A;  2Z33 A;  2LH9 A;  2ME6 A;  3GVA A;  2KL4 A;  5EEA A;  4EMS A;  4M71 A;  4PGG A;  3WGH A;  3HOT A;  2R7R A;  5FLV A;  1HKT A;  2ZJQ F;  1KQ8 A;  4HA8 A;  5FRM A;  1NG7 A;  1XMA A;  4AVZ A;  3FMR A;  3CF5 F;  1W0U A;  2L01 A;  3K2Z A;  3ZQF A;  3T8R A;  1ZAR A;  3BR1 A;  1TNS A;  4CCJ A;  2MGQ A;  3MKZ A;  1S8N A;  3TBI A;  4U88 A;  1NH3 A;  2CV2 A;  2M1B A;  4FCY A;  3EPZ A;  4CYC B;  1UCR A;  2M0C A;  4O3M A;  5LHH A;  3HRM A;  2XPU A;  2IJL A;  4M74 A;  3SXY A;  4LG3 A;  3HOX J;  4XLA A;  4YIF A;  2O5R A;  4IRH A;  4RAF A;  4M6X A;  3OYC A;  5LGN A;  3QOP A;  4F91 B;  2F6C A;  1YS7 A;  2CUJ A;  2EFN A;  4FX4 A;  3WGG A;  2ELH A;  2BBY A;  4XKV A;  2HNH A;  2LF7 A;  4R79 A;  1LEB A;  4RA2 A;  2XHK A;  1IN5 A;  2E2H J;  2VN2 A;  1TNT A;  1E2X A;  3C1D A;  2L02 A;  1FIA A;  1X2N A;  2DA1 A;  4ENN A;  2V26 A;  1Z1D A;  3B6C A;  3BG5 A;  3DEE A;  4S04 A;  2AHQ A;  3L2R A;  4W1U A;  3M1C A;  3HSR A;  4Q4Z F;  2IPQ X;  1BR4 A;  2F5D A;  4U0W A;  3CC7 I;  4IHW A;  4OIQ F;  5BPD A;  2KZG A;  2ZME C;  3N97 A;  5CVU A;  3U1K A;  1OJL A;  3LSI A;  2LFB A;  1S29 A;  1SMY F;  3TDZ C;  2X1C A;  5KNL A;  3KP3 A;  2BXY A;  4OOI A;  1B8I B;  1OYI A;  2DTR A;  5F0H A;  4HF0 A;  1FOK A;  2O9L A;  1ETO A;  3AG1 H;  1Z3Y A;  3GLL A;  1SD6 A;  1LUJ B;  3H36 A;  4UXN A;  5C44 J;  2A5W A;  1HKQ A;  2EFP A;  4MO7 A;  1HKS A;  2W4S A;  1I1S A;  1R5G A;  3RPQ A;  2OTJ I;  4NDL A;  4E7Z A;  2ZME A;  3M3Y J;  2JZY A;  2IGM A;  2RQP A;  1MMS A;  4BXF A;  2KDZ A;  2DFF A;  2KP6 A;  2DMP A;  3OYL A;  2I8D A;  3TGN A;  3KLO A;  2BE5 F;  4G94 A;  3SJM A;  4Y17 A;  4BY7 J;  4IOC F;  1I3Q J;  2R92 J;  3OWT A;  5H6R A;  3ISP A;  4B48 A;  1FSH A;  4E4H A;  2R5Z B;  1OFC X;  3GTG J;  4KIS A;  5HS9 A;  3FM5 A;  5E20 A;  3KYC B;  3OOP A;  1R7J A;  1BI2 A;  3MVP A;  1TWG J;  4N9I A;  4DBR A;  2HOS A;  1J09 A;  3C7J A;  2CQ7 A;  5DCF A;  2KIM A;  1UG0 A;  2QVO A;  2DPU A;  2ZJP F;  4M6Y A;  5ICF A;  1RNL A;  2ECB A;  5GAG J;  3M8J A;  1CGP A;  3HG9 A;  2E34 A;  4D9J A;  2M9H A;  3ABL H;  3JAM Z;  4IOA F;  2Y2Z A;  2O6G E;  3RI4 A;  4AWX B;  1GLN A;  1F36 A;  4KIB A;  3DPL C;  1SFU A;  1UZC A;  3O3K A;  3X2Q H;  1FLI A;  3MZ8 A;  2CYY A;  1WJF A;  2FX0 A;  4A3M J;  1U0J A;  1QHH D;  1LPQ A;  5J1R A;  1BIA A;  1ZGJ A;  2EZH A;  2VUM J;  1KZH A;  3FKI J;  3SFI A;  3JTG A;  3LOC A;  1U8B A;  1IF1 A;  5KK1 A;  4B3A A;  4BGD A;  3L2U A;  1RUO A;  1VQ9 I;  3L2W A;  2F4I A;  5DYM A;  2O8K A;  2ID3 A;  3E6M A;  3PSI A;  4ZTF A;  1F4K A;  2R7Z J;  1F5T A;  4BJT A;  2UXN A;  5CKT A;  2LKP A;  5D5W B;  2DT7 B;  1N75 A;  1G3S A;  3V8J A;  3O6B B;  3QPH A;  3FXR A;  2ZFU A;  2BHZ A;  3FXQ A;  2BY0 A;  3H5R A;  3KLN A;  4ZC3 A;  3GZ5 A;  5K5R A;  2QEN A;  2W25 A;  5HDK A;  3LWF A;  5M5W J;  1X1P A;  5FJ8 J;  1RRJ A;  1WFX A;  1XMX A;  3ZQ7 A;  4P9U A;  4LLL A;  1T33 A;  2VC0 A;  2ZFW A;  3WE3 A;  4BAY A;  2QWW A;  1R1V A;  1HXD A;  2A6T A;  1X4P A;  1XPX A;  1QZZ A;  2XDV A;  2M7B A;  3RQI A;  2OUM A;  5K5O A;  1OIS A;  2ZSI B;  3I4P A;  5HOO A;  5FKM A;  3JRA A;  1RET A;  3QYE A;  2L9V A;  2QLZ A;  4LMY A;  4XID A;  1T98 A;  1PP8 F;  2V1U A;  3BQY A;  3DKX A;  3JRC A;  2CMP A;  4QSH A;  5H20 A;  2W24 A;  5ILV A;  2DQR A;  2M8G X;  1T56 A;  4M3G A;  5DUI A;  1Y39 A;  4IHS A;  1YW7 A;  1T39 A;  1MDM B;  3ZMZ A;  2DOD A;  2V9P A;  1DGW Y;  2DA2 A;  4F7Z A;  3OL3 A;  1V5G A;  3I59 B;  1R00 A;  3K70 C;  2FML A;  1UMQ A;  1O3T A;  2L2O A;  2WAE A;  2BW3 B;  1LQ1 A;  1SFK A;  3H3V K;  1R5H A;  3JR9 A;  2IA0 A;  2HS5 A;  2X6Y A;  2H1K A;  1HDP A;  5LEJ A;  1D1A A;  1IN8 A;  1Z7L A;  2H8R A;  1P2F A;  4RAG A;  4NC6 A;  2CQQ A;  2FU4 A;  3K4C A;  1P9Q C;  2P5L C;  2P0W A;  3MZY A;  4JX5 A;  1IRF A;  1WJB A;  1C0W A;  2R5Z A;  1K83 J;  4DIQ A;  3EYY A;  2CO5 A;  1X1A A;  2B0L A;  4Q48 A;  4XSX F;  1SFX A;  2MA3 A;  3PSF A;  5GPC A;  2K9S A;  5DD8 A;  2VQC A;  2DI3 A;  1BI0 A;  3JSP A;  1ZRD A;  2LR8 A;  4UB8 C;  3HUG B;  2VKE A;  4IHX A;  2KRC A;  2HTJ A;  4DBQ A;  3BY6 A;  4LK0 F;  1LFP A;  2ME0 A;  2VQH A;  4KYW A;  2W1O A;  4GYI A;  3VYS B;  2ZJ2 A;  2OQG A;  2X6O A;  2EIL H;  3NAR A;  1VI0 A;  3EUA A;  3W6V A;  1AKH B;  3G1M A;  3L9F A;  2G7U A;  2A3S A;  1FWZ A;  1P92 A;  1VQL I;  2H6C A;  1JHF A;  1U5T B;  1E3P A;  1IUY A;  1R1U A;  2K3P A;  2LTP A;  3CCY A;  2M7A A;  3W6K B;  3GTM J;  2RAE A;  3OS0 A;  1EH7 A;  1XSD A;  5D5V B;  1QNT A;  4C3H J;  4G8X A;  3DPT A;  2XVC A;  5DTD A;  4F52 A;  1EV7 A;  3ABT A;  3JRF A;  3DU5 A;  3JRI A;  5GPA A;  1MBJ A;  2L9N A;  1A31 A;  2NXN B;  1LJ9 A;  3AL0 B;  4XSZ F;  2PMZ N;  2LC2 A;  4XRF A;  1Y8Q B;  4ETS A;  5DM7 F;  1RIO H;  5K1Y A;  3S17 J;  2F5E A;  4BKX A;  4IHY A;  1WHU A;  2FOK A;  5E1W A;  2VL8 A;  3UR3 C;  1R58 A;  2E19 A;  4IF4 A;  2ZXI A;  1XN7 A;  4D5C A;  2A6H F;  3H0G J;  4A0Y A;  1T8I A;  3BPX A;  4B09 A;  4Z2Y A;  3DU6 A;  3A4C A;  3CD6 I;  3R61 A;  5E3O A;  2VE9 A;  4QLC U;  3NEU A;  4JX4 A;  3OSF A;  3ZQQ A;  2EV5 A;  4DJA A;  2KIQ A;  3WU2 C;  3JRH A;  4E6K G;  2VBY A;  1EH8 A;  1SVM A;  2ZKZ A;  1MW7 A;  1UST A;  1SFE A;  1MND A;  2V4J C;  4DGW B;  3IP4 B;  3OYG A;  2CG4 A;  4J00 A;  2LYC A;  1XSV A;  1AU7 A;  3PNY A;  1RR8 C;  4L0Z B;  3BTC A;  2EV6 A;  3M8F A;  5F0F A;  5H6Q A;  2GIV A;  1UJ8 A;  3HYI A;  3CJR B;  4Y4R A;  5TJJ A;  1QGP A;  1D1B A;  1S9H A;  4WCG A;  3LAJ A;  4ANJ A;  1S6L A;  1VFC A;  1NG6 A;  4QPQ A;  4YFN F;  2QSH X;  2QQB A;  2OZU A;  3TL4 X;  3KPH A;  3RTR A;  3HGG A;  2R0Q C;  2C6Y A;  5EJC A;  1B72 B;  1D5Y A;  2E1M B;  1MDM A;  3ELK A;  4XNF A;  1J9I A;  3F3X A;  5HOD A;  1QU3 A;  1NK3 P;  4QTR A;  3I59 A;  1K78 B;  2CW7 A;  3FIW A;  3JRG A;  3D1N I;  3EET A;  3PM1 A;  1D1C A;  2VIX A;  4IHV A;  1YG2 A;  3ZMS A;  1IO2 A;  2BW3 A;  2XIG A;  4M9Z A;  4B1R A;  5GAD J;  4Y7N J;  1F43 A;  2AXL A;  2R4G A;  2QKL B;  2K4B A;  3QOE A;  1DPU A;  4J19 A;  5EEH A;  4XRS A;  2W57 A;  5FKK A;  4XOR A;  3VYU B;  3QAH A;  1UG2 A;  3K6G A;  2AQF A;  2OCC H;  4RAY A;  5BS6 A;  2CUZ A;  1AA7 A;  1GDT A;  1X3U A;  5KAI C;  4CYD A;  1VQ5 I;  3PUB A;  5FLM J;  4CH7 A;  4KMF A;  1YOV B;  3W2V A;  2VOD A;  4XLF A;  2OA4 A;  3NRV A;  2D1V A;  3HUG A;  1M1E B;  2QGU A;  2E71 A;  4U0V A;  4ENM A;  4FET A;  2A68 F;  2Y9Z A;  2VI6 A;  3KZY A;  3FF5 A;  1U5T C;  1BC7 C;  1FMV A;  3Q3S A;  2B9S A;  1FYM A;  1I3A A;  5TGT A;  1A6Q A;  3A2K A;  1IDY A;  4D0P A;  3RKX A;  3SDB A;  4OIP F;  4BQO A;  3FHZ A;  4YRV A;  1AKH A;  1ZR4 A;  1JI8 A;  4F93 B;  1MBH A;  2Y48 A;  3MKW B;  1BIB A;  4G6D A;  1JUP A;  2ISY A;  5F1J A;  3AL0 C;  3VSL A;  3LNQ A;  1R71 A;  2LDU A;  2XF6 A;  1E3H A;  1JHH A;  2F5F A;  2CUF A;  1U5T A;  1WI3 A;  5GAE J;  4S05 A;  1Y6I A;  5J6X A;  4DW6 A;  5M5X J;  2XB0 X;  2HXO A;  3OSG A;  1ERD A;  2JUC A;  2LRE A;  1APL C;  1O4X A;  3OV8 A;  2L3D A;  3QYF A;  3S32 A;  3IAM 2;  3F8M A;  1G3T A;  2BVM A;  1ETY A;  4EEF G;  2MC4 A;  3SYT A;  3J7A O;  3G71 I;  4L5I A;  1X1B A;  2XGE A;  3M8E A;  3G6E I;  2AQE A;  4XL9 A;  2EQR A;  1Z3X A;  1VQK I;  2EK5 A;  3WTS C;  3MFK A;  2I10 A;  2O8X A;  1JJ6 C;  1SAN A;  3B6A A;  4UUT A;  3VWB A;  1Z6T A;  1JJ8 C;  3A1Y A;  3HRT A;  3OIQ A;  1EJ9 A;  5EDN A;  4ZYE A;  1Q1H A;  3PUF A;  1BOB A;  4M6V A;  5E8G A;  5M5Y J;  2NOG A;  2GXG A;  5CVJ A;  5CVI A;  5D6E A;  4ZYD A;  3B73 A;  4NBQ A;  1SMT A;  5HLT A;  4LIU A;  1AWC A;  1ENH A;  1G2H A;  5J40 A;  4Y52 J;  1BR2 A;  1HW1 A;  1RI7 A;  2RV8 A;  2VT3 A;  2Y0S A;  2W7N A;  2DA6 A;  3PFY A;  2HQ5 A;  5E1Z B;  1PJR A;  1FSE A;  1OCZ H;  4UVC A;  5J8F A;  3GEZ A;  3OYA A;  2XF5 A;  4OAZ A;  1TL8 A;  4WWC A;  1VQ6 I;  1PYV A;  3DTE A;  1J2X A;  2WAD A;  1WCM J;  2NS8 A;  3JRE A;  1JKO C;  2Y0M A;  2ZO4 A;  5E79 C;  2MSY A;  1O7F A;  1YHQ I;  2NS7 A;  5EF6 A;  2RVC A;  4UUV A;  3OR2 C;  4L9V A;  2K85 A;  1K78 A;  3E0J B;  1P7J A;  4IXA A;  4XKW A;  5EZH A;  5EYR A;  4L18 B;  3CCM I;  1ZYR F;  5DM6 F;  1G4D A;  1MJA A;  2OF7 A;  6PAX A;  4WF2 A;  1F1Z A;  1YFH A;  5D8L B;  3BR5 A;  5EG0 A;  3IRQ A;  3F8F A;  3BZC A;  3BG6 A;  1MH3 A;  4Y33 A;  3CLQ A;  5FRO A;  3ZN1 A;  4ZJZ A;  1ZLJ A;  3ABM H;  1XCB A;  3HBL A;  2IGK A;  4GYG A;  1KQ9 A;  2K02 A;  1BJZ A;  3ASO H;  3ESW B;  3QU6 A;  3DLA A;  2HDW A;  4HV5 A;  3EYI A;  2DJI A;  4EGY A;  1XCV A;  1VQO I;  4CDG A;  5JFR A;  2PQ8 A;  3S3N A;  4KJZ A;  3Q0U A;  1WRJ A;  2Y9Y A;  1PVE A;  3MAJ A;  3ONQ A;  3IHU A;  5DEQ A;  3BTL A;  4B43 A;  1OCT C;  1UHM A;  5HLH A;  1KU9 A;  1GUU A;  3CLO A;  5FKO A;  1JKP C;  3J7Y J;  1QPI A;  3HOV J;  3FHN A;  4P5O A;  1H0M A;  4XMY A;  4FHT A;  2EIM H;  1DP7 P;  5ERI A;  4OU0 A;  1Y56 A;  2VLA A;  1MNE A;  3IC7 A;  5LGT A;  3CJQ B;  2L7Z A;  1ZK8 A;  2BEO A;  2GA1 A;  2HKX A;  3BQZ A;  1ACI A;  1XGN A;  3PNT A;  2JPC A;  3ECH A;  3I0T A;  4KMU X;  4MQV A;  2HOT A;  3VDX A;  3GTQ J;  2VQG A;  4I99 C;  4BL0 B;  1ULY A;  1WJA A;  2VON A;  2LVS A;  3OYK A;  1L3L A;  5GTH C;  4CA0 A;  3I58 A;  4ZYA A;  3DKY A;  1RR7 A;  3K70 D;  2JVH A;  2XGX A;  1DPR A;  4CZZ A;  3KX2 A;  3G73 A;  2E5Z A;  3MWM A;  1RZ4 A;  1ETX A;  4R8H A;  5B5E C;  3D5R C;  1TWF J;  4NC7 A;  2VJI A;  4ZZD A;  3I64 A;  2L5Q A;  3K69 A;  3C3W A;  4CSW A;  4DYQ A;  3J81 Z;  2A6E F;  4V2F A;  1ODD A;  4BE1 A;  4H0E A;  4F92 B;  3ABU A;  4ESB A;  2ZSH B;  4OIO F;  3F9K A;  3HOU J;  1P4A A;  5E3L A;  4N4N B;  3SZT A;  1WPK A;  3I3L A;  1ZGW A;  1N25 A;  3WTZ A;  4O5V A;  2V79 A;  5DS9 A;  3TW7 A;  4ENJ A;  3BPV A;  2A07 F;  3W6J B;  2IRF G;  2M87 A;  3K4L A;  3AG4 H;  3RPU D;  4G7O F;  4CZC A;  4BHB A;  2CS3 A;  2E2J J;  1EA3 A;  2K27 A;  2ZB9 A;  1Y1W J;  2JA7 J;  2ISZ A;  3HEF A;  1SD5 A;  4EJV A;  3WTX C;  2DT6 A;  1ZG3 A;  5F64 A;  1XDS A;  3RIR A;  3HDD A;  4RS8 A;  1GT0 C;  1O3Q A;  5F27 A;  1Z05 A;  2M5W A;  3LQR A;  3KET A;  1SD4 A;  2COB A;  4PJ0 C;  3IH2 A;  4JQF A;  3S1R J;  5E3M A;  2Z2S B;  3LMM A;  2JPB A;  4RLF A;  4FAS D;  3ML6 A;  3AKZ A;  2WV1 A;  5EGO A;  2W85 A;  2Z99 A;  1GV2 A;  3DFG A;  1KU7 A;  3I4N J;  2DPD A;  4C2T A;  4HX4 A;  2WY8 Q;  2NVX J;  1OR7 C;  4XBF A;  3CDI A;  4C30 A;  3WGI A;  3P9K A;  1K61 A;  4PCQ A;  3OYI A;  2V6E A;  1BR1 A;  1D5V A;  1BW6 A;  3MMY B;  3RDI A;  2LY2 A;  3H5N A;  3S2W A;  5F1R A;  4BEH B;  2OC6 A;  4IHT A;  3TOB A;  1MJ9 A;  2XGD A;  3NWT A;  3BDD A;  4EQQ A;  4M3B A;  4BE2 A;  2X6W A;  2E60 A;  2IT0 A;  1RES A;  2W48 A;  1OR7 A;  3DPU A;  2XRL A;  5FB2 A;  1OPC A;  1AOY A;  2HDD A;  3UNG C;  4AUX A;  3VOD A;  3K1N A;  1IN6 A;  2ZXJ A;  4PUS A;  1S72 I;  2CQK A;  2Z16 A;  4LIV A;  1JXS A;  3BZ6 A;  1SVO A;  1FOW A;  3CF2 A;  4YIR X;  4ABZ A;  5CVR A;  2GOM A;  1H8A C;  3C18 A;  4IPA A;  2M45 A;  3CCJ I;  2CGP A;  5F0C A;  3P9I A;  1K4T A;  5KAF C;  3PO2 J;  1Y0N A;  3H3Z A;  5AIQ A;  2E5N A;  3E1S A;  2DO7 A;  2CUE A;  4D1Q A;  2KIS A;  2PMU A;  2X1E A;  2HVR A;  2OAZ A;  3E6D A;  5F08 A;  4RB3 C;  3DBR B;  1FYK A;  1TW3 A;  1KQ0 A;  5E1X A;  2HVQ A;  4Y3O A;  2OQR A;  2X48 A;  3OS1 A;  1JTY A;  3B02 A;  2YSR A;  3HPH A;  5K7H A;  2P5K A;  1F9N A;  4RBO A;  3COA C;  2DBB A;  3QWL A;  2CV1 A;  5J4Y A;  3FM3 A;  4G7Z F;  3GTK J;  2E1N A;  3QP6 A;  1IRG A;  3WTV C;  2YR2 A;  3MQ0 A;  4EVI A;  4U7B A;  5JI6 A;  3J80 Z;  3S14 J;  3WE2 A;  1WJ5 A;  2ZNY A;  1JUS A;  2DLL A;  2UXX A;  4XKB A;  1DU0 A;  2HKO A;  3OYD A;  2WV0 A;  3IKV A;  1U8R A;  2O0Y A;  2K9L A;  1IAW A;  3GFI A;  4FQG A;  1MMN A;  3LSG A;  4C2U A;  2IGN A;  5ICG A;  1KU2 A;  2VBW A;  3LL7 A;  2OD5 A;  1WJE A;  1T2K A;  4MIM A;  2RGV A;  1GXQ A;  1XD7 A;  2Y69 H;  2LNB A;  1HSJ A;  1YQA A;  2XSJ C;  1TW2 A;  2E1C A;  1YX3 A;  1K6O A;  1FJL A;  2RQQ A;  2LOO A;  4A3I J;  1OYY A;  3U9G A;  3CC4 I;  1FBQ A;  3K0L A;  3FIS A;  2VJ5 A;  3OY9 A;  2BYV E;  3F6V A;  1YJN I;  3AFH A;  4XON A;  3DXJ F;  1O7L A;  3QOD A;  2GAU A;  2DMU A;  1TWC J;  3R6S A;  1HC8 A;  5LFA A;  3CMY A;  2OPT A;  3HOW J;  5ILS A;  2KQR A;  2MYS A;  3CCV I;  3M1E A;  3KEQ A;  2HOE A;  2HZD A;  1TTY A;  3WTT C;  5JR3 A;  3PIO F;  1QPM A;  4KIF A;  3O2P E;  2HEO A;  2JVG A;  1OQY A;  4DOZ A;  1ZLK A;  2Q1Z B;  4HNT A;  2MW8 A;  3GZN B;  4GO1 A;  3ZPL A;  4BEH A;  2KJB A;  2OTL I;  2PLY A;  2VE8 A;  4HOB A;  1V5F A;  3A01 B;  2A5Y B;  4HQM A;  1TLH B;  1LFU P;  3HOZ J;  1YI2 I;  3R4K A;  3N4M A;  1IC8 A;  3REO A;  2VKH A;  4ESJ A;  4G6T B;  1IW7 F;  4OMY A;  3BJ6 A;  1ON1 A;  3FMS A;  3HJE A;  2DQL A;  4HX7 A;  3IL2 A;  5BOX A;  5L3E A;  3F23 A;  3KP6 A;  1T38 A;  4KNY A;  1U2W A;  3TO6 A;  3ZMT A;  5CLS A;  1O57 A;  2CWE A;  1ZG1 A;  2FD5 A;  1DUX C;  1W1W E;  5LRR A;  2P7V B;  4MGR A;  4EM1 A;  4X1E A;  1GXP A;  1HOM A;  4BJ5 C;  2ACJ A;  1ZQ3 P;  3LSM A;  4DQ2 A;  2MLK A;  2DMQ A;  1TT0 A;  5D4R A;  2J5O A;  1NHA A;  1QO0 D;  1ETW A;  5LRS A;  4QWQ A;  2HVS A;  2NNY A;  4U0Y A;  3S2H J;  1I6X A;  2KRF A;  1VTN C;  4MHG A;  4HNU A;  3I4M J;  2F5C A;  3DTK A;  3F8N A;  4RB2 C;  2WA0 A;  3WHB A;  4ZDO A;  4XN0 A;  2EZI A;  5J47 A;  3H9J A;  2TDX A;  3S1N J;  1RKT A;  5J1U A;  2IGO A;  5GAH J;  4JP0 A;  3F6O A;  5CQE A;  3HPG A;  3AG2 H;  4LJZ F;  2G7H A;  3G4S I;  3ZXS A;  1HQC A;  1I27 A;  3E5X A;  1BC8 C;  3HTU A;  4MTE A;  3GTJ J;  3AAF A;  2FJ1 A;  3ZQC A;  3D0S A;  3CCL I;  2HU9 A;  1K4S A;  1J5Y A;  3V8L A;  3BC8 A;  5LD2 C;  2HYF A;  3BWG A;  2R5Y A;  3GO5 A;  3SDG A;  3S16 J;  3BG7 A;  2DU9 A;  5D5X B;  1ZR2 A;  2R7X A;  2Z3Y A;  2GBY A;  1R22 A;  2DA7 A;  1RUN A;  4B8X A;  3RPU A;  5BPI A;  3CJT B;  3QU3 A;  5IP7 J;  3DEW A;  1IN4 A;  4BQN A;  1B9N A;  2R7O A;  3VPR A;  1TBX A;  2XAH A;  1D8K A;  3JAM K;  4WXD A;  1P6R A;  2F5V A;  5CQG A;  2DW4 A;  2XRO A;  3H5A A;  2KKO A;  3TDU C;  3GTO J;  1P4W A;  2YU3 A;  4JK1 X;  2NS0 A;  1JUM A;  5BMZ A;  3VYR B;  5FRN A;  1OLT A;  1CQT A;  2GZW A;  3H9Q A;  2EWN A;  1S7A A;  5TRD A;  2NVT J;  3J80 K;  3TO7 A;  2EIK H;  2P6T A;  2HDC A;  3KP2 A;  2EZK A;  3S2D J;  3ZR8 X;  1R6R A;  1GV5 A;  2R7S A;  2CFX A;  4LG0 A;  1B9M A;  1IZ1 A;  5F6F A;  1WJC A;  4ASN A;  4A12 A;  4Y15 A;  3WU0 A;  1NK2 P;  2X4H A;  1J7K A;  2FE3 A;  2N8G A;  1ZN2 A;  3QPL A;  1RPW A;  5ICC A;  2WBM A;  2V6C A;  4Q5S F;  1D0Z A;  2VAS A;  2DTZ A;  1TQI A;  2L0K A;  1T95 A;  2V1D A;  2MG4 A;  1WKM A;  3WU1 B;  3HKZ A;  4A3F J;  5AON A;  4I0B A;  2DOE A;  4C2M J;  2BY3 A;  1OCP A;  5LGU A;  3RYP A;  5HLG A;  3HHH A;  1Z67 A;  2JN6 A;  5FLX Z;  2EV0 A;  3A01 A;  3IUO A;  3QPS A;  1QZE A;  1H88 C;  1YW9 A;  4IX7 A;  1HST A;  1FP1 D;  2FSW A;  1MH4 A;  1MBG A;  4XKC A;  1SAU A;  2HFH A;  4A0X A;  2IA1 A;  4CCL A;  1XG1 A;  3EDP A;  4A6E A;  1LDD A;  2PX9 A;  3GTP J;  4IO9 F;  4E7J A;  2P8T A;  2IS2 A;  2EA2 A;  1ON2 A;  4GDF A;  1Z9C A;  3EUH C;  2YS9 A;  2L54 A;  1HCR A;  3ZRG A;  4KDP A;  2YX7 A;  1IXS B;  5FD6 A;  3F22 A;  3ERE D;  1A5J A;  4EV0 A;  1JTX A;  1XDU A;  1GVD A;  2JA2 A;  2CW0 F;  1FPQ A;  1SFO J;  5AIP A;  2LBF B;  2L4M A;  5EG0 B;  1P4X A;  3FXO A;  3VYT B;  2VKV A;  3LFU A;  4ENK A;  2WTE A;  5TIS C;  4HAM A;  2KHM A;  5HNH A;  3IKT A;  3EUH A;  4ON0 A;  4X6A J;  3BJA A;  2Q2E B;  5E8I A;  1ETQ A;  1WSU A;  4BQA A;  2E7X A;  5DD4 A;  3JCU C;  1MBK A;  2R7V A;  5IT9 Z;  5JVT A;  5J1Y A;  3N05 A;  1TC3 C;  1X3Z B;  1SD7 A;  2OZ6 A;  4E7L A;  1MBE A;  4I7H A;  1S3J A;  1A04 A;  2LSO A;  3PL8 A;  4GGG A;  4U7D A;  1BM9 A;  1VQM I;  3A0B C;  4RGR A;  2ELK A;  3FX3 A;  4YII A;  2XAJ A;  2XAU A;  2H8W A;  3H35 A;  1YRN B;  1QVT A;  1POG A;  3BRO A;  4DZJ A;  4XR6 A;  3L2V A;  2K3F A;  3T5X A;  1JKR C;  3SZP A;  2H94 A;  3A03 A;  4IRG A;  3T0Y A;  4V19 K;  2O03 A;  2DYR H;  4BDZ A;  4BU2 A;  3CCE I;  3LSR A;  4BXU A;  3TQN A;  2H27 A;  4FE4 A;  4KIG A;  3NAU A;  4MEY F;  2X1D A;  3C2H A;  1BJA A;  1Z91 A;  4W97 A;  4A5M A;  2OU2 A;  1RC9 A;  3E6B A;  2WC2 A;  3F72 A;  3H1C A;  4WX9 A;  1H9T A;  4Q47 A;  5CVV A;  3ERM A;  3LA7 A;  4KT5 C;  2ICW G;  4WXH A;  2XAS A;  2A61 A;  2H1L A;  2R3S A;  4HRI A;  3HM5 A;  4A3J J;  1U3E M;  3KFW X;  2JRM A;  2AO9 A;  1W5T A;  2LG4 A;  4R1H A;  1I6H J;  5B1A H;  4MLO A;  4HYE A;  3Q0W A;  1VQ7 I;  3R60 A;  5A2Q Z;  2MC3 A;  2BGC A;  2G0E A;  2ECC A;  1D3Y A;  2V9K A;  5D5U B;  4ZYG A;  2KIF A;  2FBH A;  4ITV A;  4WK8 F;  2VPR A;  3F21 A;  1A35 A;  3L1P A;  2K40 A;  3BG3 A;  3LSH A;  5EEG A;  2DDB A;  4G7H F;  3CZ6 A;  2XUB A;  3K4K A;  3QYB A;  2OBP A;  2MH9 A;  4UV8 A;  4YEL A;  4E7S A;  3S93 A;  2HQR A;  3K1M A;  2M4G A;  4BQQ A;  5C4X J;  3KP7 A;  3M9A A;  2HI3 A;  3LSP A;  2RKH A;  4H4K C;  2YX4 A;  2K9M A;  2Y0S N;  5E18 F;  1YIO A;  4MFD A;  2EPF A;  3KEY A;  3F0C A;  2VXD A;  5J3L A;  3A02 A;  2MAB A;  2JA6 J;  1FC3 A;  5CJ9 A;  3CO7 C;  2M0M A;  2MFZ A;  2M8E A;  3AG3 H;  3ZQH A;  2KPM A;  5FD5 A;  3Q9S A;  3GZ6 A;  2F48 A;  3KEO A;  2L9R A;  1VQP I;  3U21 A;  2Q8K A;  1KYZ A;  4YFX F;  4DYC A;  2HYG D;  2FBK A;  2ETH A;  3K10 A;  4N4O B;  1XS9 A;  1TT5 B;  4D7M A;  3HXL A;  4CO8 A;  1VF9 A;  1W36 D;  2W84 A;  3F8C A;  1U6G A;  4M9X A;  1ZRE A;  4A0Z A;  5FLX K;  5M3M J;  2LBF A;  1IRX A;  1B6A A;  5EGO B;  2KJC A;  4YFK F;  3WOD F;  2VPL A;  4JOM A;  4UHT A;  3U2R A;  1V5E A;  1W4M A;  4PK4 A;  1V3F A;  1WVR A;  2Q2E A;  4IRI A;  3TP3 A;  1DQU A;  4EM2 A;  1FX7 A;  2LKS A;  4BNC A;  3BTJ A;  1S7E A;  2TCT A;  4U87 A;  4UUS B;  3OYF A;  3GF2 A;  1WH5 A;  2DA5 A;  3HTS B;  2GM4 A;  3T1B A;  2EJR A;  1G8X A;  1LVK A;  1PDN C;  2BXZ A;  4L5E A;  3P9C A;  4UV9 A;  3V7C A;  2KFD A;  4RM2 A;  3WG7 H;  4NHJ A;  2YPR A;  1SVL A;  4NB5 A;  4BHP A;  4JX6 A;  3I71 A;  3OYJ A;  4A5N A;  1I39 A;  3G3Z A;  3TP0 A;  2P6S A;  2NOJ B;  4PJJ A;  3F8B A;  2AS5 F;  4ZH4 F;  3FK6 A;  3OYH A;  4DZP A;  4YEJ A;  3CCR I;  3HOY J;  1XB4 A;  2XGC A;  1X3W B;  3CTA A;  1YRN A;  3CCS I;  2TRT A;  4I2O A;  2M2E A;  4HDV A;  1A36 A;  5L3G A;  1REP C;  3KE2 A;  1XX5 A;  2EIN H;  3LSJ A;  1Y8R B;  3LSK A;  1JGG A;  1YTY A;  3BOQ A;  1TWH J;  4A6D A;  1E0E A;  1SAX A;  5IT9 K;  3RKW A;  4M3E A;  3HSF A;  5F04 A;  1YX5 A;  5K7F A;  2ZXH A;  3HSE A;  2DT5 A;  2Q0O A;  1VND A;  4B3X A;  5HVQ C;  5B1B H;  2QBY B;  2Y75 A;  1IXR C;  4O6J A;  4ZYH A;  2QA4 I;  3V7S A;  2BY1 A;  3TO9 A;  4E70 A;  3WTY C;  2L7K A;  4BXX J;  3O8G A;  3GFL A;  3GFM A;  1PUE E;  1WH7 A;  1W7P B;  2LY1 A;  3TMO A;  1YJW I;  2DK8 A;  2DA3 A;  1FMW A;  3E7L A;  1D8J A;  2MBF A;  2LMD A;  2QYO A;  2CU7 A;  3MD2 A;  3V7R A;  5HNF A;  4RLQ A;  4L9N A;  1DU6 A;  1P7I A;  1E17 A;  2CV0 A;  1OCC H;  1ETV A;  4ZDP A;  1XTA A;  2XAQ A;  3KYL A;  2V9V A;  3VEP A;  4D5F A;  4CCN A;  3CCU I;  4IKF A;  2HR3 A;  1LFB A;  2O7O A;  4ZZL A;  2KLO A;  4PGH A;  3IWZ A;  2V7F A;  1XGM A;  4AU7 A;  2BOL A;  2HTS A;  4A93 J;  3BG9 A;  2VT2 A;  3PIP F;  1IDZ A;  3GME A;  3P5J A;  3VSK A;  4XRM A;  2ZCW A;  3RQ4 A;  4Z6Y A;  5KVR A;  3ROU A;  1R23 A;  2HYJ A;  5A2Q K;  2ID6 A;  1R49 A;  5CYV A;  2HOA A;  3FMQ A;  5FO5 A;  2EFO A;  2A05 A;  4FX0 A;  2O61 A;  4A3L J;  4NNJ A;  4MFE A;  3RYR A;  1V54 H;  2O3F A;  2JMW A;  4D7N A;  4XQF A;  2KIU A;  2CW8 A;  3WTU C;  5JLX A;  2KZV A;  4PDK A;  2XPW A;  4BBS J;  2NVY J;  1VQ8 I;  1S7O A;  3JRB A;  2ESN A;  2QQ8 A;  3DBL B;  4F55 A;  4C9Y A;  2R7F A;  2XC7 A;  2IS6 A;  2Z9O A;  4EM0 B;  2LP0 A;  5HS7 A;  1HF0 A;  1W5C C;  3BR6 A;  1R5I D;  1Q1V A;  3CMA I;  1QZY A;  1IUF A;  1LKX A;  2HQN A;  2QEX I;  3L2Q A;  5JHU A;  4UUS A;  2LY9 A;  1VZ0 A;  4NQW A;  2PJP A;  1CF7 A;  3PNV A;  4K2E A;  3G2B A;  3K9T A;  3T8T A;  3TOA A;  2M34 A;  3GYH X;  2K9N A;  2V1X A;  5JVG F;  4BBR J;  2XF7 A;  5LEK A;  4L9T A;  2PG4 A;  3PQK A;  4M72 A;  3ULQ B;  1IV6 A;  4JYK A;  3LA3 A;  5J8C A;  4V2G A;  1MSF C;  1OKR A;  5B66 C;  4EAT A;  3J7Z I;  2NRA C;  1U9N A;  2VQL A;  2WY7 Q;  3LAP A;  3KZZ A;  3VOE A;  4KN7 X;  4C3J J;  2F4M B;  2YUS A;  1IRZ A;  3P7N A;  2OCE A;  3V8K A;  1YS6 A;  2EBI A;  2L9S A;  2GOX B;  5E3N A;  1FOX A;  2WWY A;  4FTH A;  3NQO A;  1FBS A;  1WJD A;  3I55 I;  1AHD P;  3KCC A;  1UHW A;  3BZK A;  3DLL F;  2K4J A;  2PMH A;  2JA8 J;  2RC4 A;  2K5C A;  3OL4 A;  1LE8 B;  2WAF A;  2D1H A;  3HIF A;  5FKL A;  2QBY A;  4QPO A;  3CUO A;  4FT8 A;  1WZ2 A;  5D8K B;  3JRD A;  2BVL A;  1HBX G;  1W5S A;  3L7W A;  4EJT A;  1FZP B;  2NVQ J;  1XC5 A;  1JT6 A;  3QP5 A;  3CP2 A;  4RB0 A;  1W7P A;  3W3C A;  5J4V A;  4CGZ A;  4DYR A;  4LLN A;  3KIO A;  4HLX A;  1MSE C;  3FWE A;  5EZG A;  1KA8 A;  2GLO A;  1TQM A;  1PUF B;  5JLW A;  1SC7 A;  1XGS A;  3OIP A;  2FA5 A;  3SHF A;  3G1L A;  3M7G A;  3BLY A;  3BR3 A;  3ZMV A;  1EKE A;  1LDK B;  1LB2 A;  3IH4 A;  1BBY A;  1R1T A;  1XSX A;  2DJN A;  3CCQ I;  2R5Y B;  4I02 A;  5IOZ A;  2JT1 A;  3RSN A;  4RGX A;  4UNO A;  2XKO A;  1W36 C;  4BHC A;  1E3O C;  3ZQG A;  3TED A;  1FYL A;  3CES A;  4HPQ A;  4QIW N;  2R7U A;  2VOP A;  2JSP A;  1HA8 A;  4B47 A;  2LF8 A;  1IG7 A;  4HQE A;  4I98 B;  1DGR M;  4AID A;  4HDU A;  3J81 K;  3L09 A;  2D5V A;  2HGC A;  2D2W A;  4A69 C;  1MGT A;  2JUG A;  1YIT I;  3EUK L;  1R36 A;  3TKY A;  4NC8 A;  2QF7 A;  3DKW A;  4CCO A;  3I56 I;  4LK1 F;  2HPM A;  2NVU B;  3ZMU A;  2RNJ A;  3V4G A;  4LG0 B;  2DYS H;  2VBZ A;  4LIT A;  1FTT A;  1I50 J;  4PZJ A;  2AXT C;  3CME I;  4OIR F;  5IP9 J;  2PN6 A;  2X0L A;  5DCM B;  4CYC A;  1USS A;  2HPI A;  3ZN0 A;  2X51 A;  1IN7 A;  4F3Q A;  5C4J J;  2P7C B;  1JE8 A;  2FUG 2;  4PSX A;  2R7W A;  4L9J A;  3FXK A;  1K7A A;  3Q0V A;  4ZDL A;  1V55 H;  1I1G A;  4LB6 B;  5LLQ A;  1UEL B;  3LQQ A;  1ZGA A;  2VKD A;  2HQA A;  1MBF A;  3E3V A;  5K5Q A;  3FXJ A;  2JSC A;  4PJL A;  3K4N A;  3DTI A;  4GFB A;  1DP3 A;  1O3S A;  2X9D A;  2CH0 A;  5D4S A;  3CC2 I;  2E2I J;  1WWX A;  1X19 A;  1MJB A;  3IWF A;  2F2E A;  3SEQ A;  2EFW A;  1W0T A;  3G1O A;  2FBI A;  4MNU A;  4LD5 A;  3LST A;  4IQ4 A;  3FBI B;  1UFM A;  2LKX A;  3R0J A;  3K2A A;  2IAI A;  1I5Z A;  2IW5 A;  4II3 A;  3RZD J;  4UVA A;  5E17 F;  4HST A;  1B8I A;  1BOA A;  5LHG A;  1B4A A;  1J0R A;  4UVB A;  4BH9 A;  1BL0 A;  3CO6 C;  2GQQ A;  1LE8 A;  1LEA A;  1KGS A;  1T0F C;  9ANT A;  3ZQI A;  2XKP A;  1HLV A; 
#chains in the Genus database with same CATH homology
 2ADU A;  2ESH A;  3PFI A;  4I0A A;  2GXB A;  4AIK A;  1GHC A;  1K79 A;  2PBI A;  1FP2 A;  1T0F A;  2HZT A;  2MD5 A;  4AIJ A;  1T6S A;  1XMK A;  3WTW C;  2FNP A;  2FXA A;  3L00 A;  5HS8 A;  1B1B A;  1OMI A;  3CDH A;  1G6N A;  2XV4 S;  4P55 A;  3KP5 A;  3Q9V A;  1QBJ A;  1ZH5 A;  4YG2 F;  4GXO A;  4M9S A;  4P9F A;  5ED4 A;  3DV8 A;  4MTD A;  2FNA A;  2MH2 A;  2IVM A;  5FFX A;  4LGW A;  2FRH A;  2COM A;  2P4W A;  3IRR A;  5LBQ A;  1IXC A;  1WQ2 A;  3Q5F A;  2QQ9 A;  2K86 A;  1TQP A;  2VXZ A;  4HBL A;  2ZBK A;  5DCM A;  4KIC A;  1L0O C;  1J75 A;  3QRF F;  2VC1 A;  2QQA A;  1LNW A;  2JRT A;  3DF8 A;  3DQV C;  3ZP5 A;  2RDP A;  5DV5 A;  1BI1 A;  3FXU A;  3LFK A;  5L3F A;  1Y0U A;  4EGZ A;  5DDG A;  3MCZ A;  2EB7 A;  2FQ3 A;  5L3C A;  1ONV A;  2NYX A;  4WXC A;  4L5J A;  1Z6R A;  1FNN A;  2FMY A;  2L4A A;  1OYW A;  3E97 A;  3GX4 X;  4HF2 A;  4I09 A;  1MKM A;  4OIN F;  4JBA A;  4HF1 A;  3ZMD A;  2DAO A;  4MQ9 F;  2ZNZ A;  1O3R A;  4KN4 X;  1YYV A;  3JW4 A;  4I01 A;  4HV6 A;  1U78 A;  3K1P A;  2P5V A;  3HOS A;  2DK5 A;  3BJO A;  3E5Q A;  2PFB A;  3E5U A;  2K7L A;  3RJP A;  1GVJ A;  1MD0 A;  1PP7 U;  1HW5 A;  4MEX F;  4BYY A;  2NNN A;  2CSO A;  3ECO A;  2GA2 A;  5HLI A;  2G9W A;  4KFC A;  1V4R A;  1QQI A;  4CIC A;  2PEX A;  4Y13 A;  2QUF A;  3HHG A;  1UB9 A;  1J59 A;  2M30 A;  4IVN A;  2Z5U A;  3I5U A;  2PI0 A;  5HDG A;  3JSO A;  4A2U A;  5L3D A;  3L2C A;  3QPT A;  3E6C C;  5FGM A;  3VB2 A;  4AD9 A;  4ESF A;  2MLG A;  3RKY A;  3PQJ A;  2UZK A;  2IP2 A;  2R7D A;  5D6F A;  4L0Y B;  4HLY A;  2XRN A;  1W7P D;  2FF4 A;  4M73 A;  1BN5 A;  4RB1 A;  1ZAO A;  4CHU A;  1XGO A;  3LA2 A;  1EH6 A;  4XLP F;  4CXF A;  3GFJ A;  4EJU A;  4RGS A;  5LHI A;  1FT9 A;  2EFQ A;  4AVP A;  3WG9 A;  1ZRF A;  2STT A;  4LLG F;  4RAZ A;  5FFZ A;  1LDJ A;  1YW8 A;  3CUQ B;  4KA4 A;  4TV7 A;  1DDN A;  4LFU A;  4AIH A;  2UWM A;  2H09 A;  5DUK A;  1HW2 A;  3BP8 A;  3HRS A;  5ILU A;  2DFI A;  4RGU A;  3GW2 A;  4EJW A;  3H92 A;  4G9Y A;  3SQN A;  4HZF A;  1G3W A;  3GXO A;  4IJA A;  3GUD A;  1Z7U A;  2A69 F;  1ZRC A;  5L3B A;  2IA2 A;  2HWV A;  4N0B A;  1CF7 B;  2E7W A;  3MEX A;  1WI9 A;  4XLN F;  4HW0 A;  5ICE A;  1KYW A;  3GWZ A;  3JTH A;  2GWR A;  4N9H A;  3D5L A;  2VBX A;  1YO5 C;  2EA4 A;  2RN7 A;  4P96 A;  3VFZ A;  2J5P A;  3CJN A;  3I53 A;  2QZ8 A;  1LVA A;  1FY7 A;  3MZH A;  1B59 A;  4DNC A;  2FEZ A;  4GCV A;  4G6Q A;  1KU3 A;  2H6B A;  1JGS A;  1BI3 A;  1MZB A;  3FZV A;  3H3U A;  2ZME B;  4KUM A;  5BQT A;  3HRU A;  3R0A A;  5HDN A;  2D45 A;  4OMZ A;  1ZG5 A;  3GLX A;  4LB5 A;  4HX8 A;  2STW A;  3CUQ C;  1ZHF A;  1H9G A;  2XAG A;  2QM3 A;  1G3Y A;  1STZ A;  3DP7 A;  3U1D A;  3SFZ A;  3KP4 A;  2JTV A;  2XAF A;  3I54 A;  5IT3 A;  3DEU A;  3CUQ A;  2BV6 A;  3EQL F;  2VOO A;  1YLF A;  2NAZ A;  4EJO A;  1FBU A;  2Z33 A;  3GVA A;  4EMS A;  4M71 A;  4PGG A;  3WGH A;  3HOT A;  1HKT A;  1KQ8 A;  4HA8 A;  1XMA A;  3FMR A;  2L01 A;  3K2Z A;  3T8R A;  1ZAR A;  1TNS A;  1S8N A;  4U88 A;  2M1B A;  1UCR A;  4O3M A;  5LHH A;  3HRM A;  2IJL A;  4M74 A;  3SXY A;  4YIF A;  4IRH A;  4M6X A;  5LGN A;  3QOP A;  1YS7 A;  4FX4 A;  2EFN A;  3WGG A;  2ELH A;  2BBY A;  2LF7 A;  4R79 A;  1LEB A;  2XHK A;  1IN5 A;  2VN2 A;  1TNT A;  1E2X A;  3C1D A;  2L02 A;  4ENN A;  1Z1D A;  4S04 A;  3HSR A;  4Q4Z F;  2IPQ X;  2F5D A;  4U0W A;  4OIQ F;  5BPD A;  3N97 A;  5CVU A;  1S29 A;  1SMY F;  3TDZ C;  3KP3 A;  4OOI A;  1OYI A;  2DTR A;  4HF0 A;  1FOK A;  1SD6 A;  4UXN A;  1HKQ A;  2EFP A;  1HKS A;  1I1S A;  1R5G A;  3RPQ A;  2ZME A;  2JZY A;  2RQP A;  3TGN A;  3KLO A;  2BE5 F;  4G94 A;  4Y17 A;  5H6R A;  3ISP A;  1FSH A;  5HS9 A;  3FM5 A;  5E20 A;  3OOP A;  1R7J A;  1BI2 A;  4N9I A;  3C7J A;  5DCF A;  2KIM A;  2QVO A;  2DPU A;  4M6Y A;  5ICF A;  1RNL A;  1CGP A;  3JAM Z;  2O6G E;  3RI4 A;  4AWX B;  4KIB A;  3DPL C;  1SFU A;  3O3K A;  1FLI A;  2CYY A;  1BIA A;  1ZGJ A;  3JTG A;  1IF1 A;  5KK1 A;  1RUO A;  5DYM A;  3E6M A;  1F4K A;  1F5T A;  2UXN A;  2LKP A;  5D5W B;  1G3S A;  3V8J A;  3O6B B;  3QPH A;  3FXR A;  3FXQ A;  3KLN A;  3GZ5 A;  5K5R A;  2QEN A;  2W25 A;  5HDK A;  3LWF A;  3ZQ7 A;  4P9U A;  4LLL A;  2ZFW A;  2VC0 A;  3WE3 A;  4BAY A;  2QWW A;  1R1V A;  1HXD A;  1QZZ A;  5K5O A;  3I4P A;  5HOO A;  2QLZ A;  4LMY A;  1PP8 F;  1T98 A;  2V1U A;  5H20 A;  2W24 A;  5ILV A;  2DQR A;  5DUI A;  4IHS A;  1YW7 A;  1T39 A;  1MDM B;  3ZMZ A;  4F7Z A;  3I59 B;  1R00 A;  2FML A;  1O3T A;  1LQ1 A;  1R5H A;  2IA0 A;  2HS5 A;  5LEJ A;  1IN8 A;  1P2F A;  2FU4 A;  2P5L C;  3MZY A;  1IRF A;  1C0W A;  3EYY A;  2CO5 A;  2B0L A;  4Q48 A;  4XSX F;  1SFX A;  2MA3 A;  5DD8 A;  2DI3 A;  1BI0 A;  3JSP A;  1ZRD A;  2HTJ A;  3BY6 A;  4LK0 F;  4KYW A;  4GYI A;  2ZJ2 A;  2OQG A;  3L9F A;  2G7U A;  2A3S A;  1FWZ A;  1P92 A;  2H6C A;  1JHF A;  1U5T B;  1IUY A;  1R1U A;  3W6K B;  1EH7 A;  1XSD A;  5D5V B;  1QNT A;  4G8X A;  3DPT A;  2XVC A;  1EV7 A;  3ABT A;  1LJ9 A;  4XSZ F;  4XRF A;  4ETS A;  1RIO H;  5K1Y A;  2F5E A;  2FOK A;  5E1W A;  1R58 A;  4IF4 A;  1XN7 A;  2A6H F;  4A0Y A;  3BPX A;  4B09 A;  4Z2Y A;  3R61 A;  2VE9 A;  4QLC U;  3NEU A;  2EV5 A;  2VBY A;  1EH8 A;  2ZKZ A;  1UST A;  1SFE A;  2CG4 A;  1XSV A;  4L0Z B;  2EV6 A;  3M8F A;  5H6Q A;  2GIV A;  3HYI A;  5TJJ A;  1QGP A;  4WCG A;  3LAJ A;  1S6L A;  4YFN F;  2QQB A;  2OZU A;  3RTR A;  2C6Y A;  1MDM A;  3ELK A;  1J9I A;  3F3X A;  3I59 A;  1K78 B;  3EET A;  1YG2 A;  3ZMS A;  4M9Z A;  2XIG A;  2AXL A;  2K4B A;  1DPU A;  5EEH A;  2W57 A;  3QAH A;  4RAY A;  5BS6 A;  1X3U A;  4CYD A;  4KMF A;  2VOD A;  2OA4 A;  3NRV A;  2D1V A;  3HUG A;  4U0V A;  4ENM A;  2A68 F;  3KZY A;  3FF5 A;  1U5T C;  1BC7 C;  1FYM A;  4D0P A;  3RKX A;  4OIP F;  3FHZ A;  2Y48 A;  1BIB A;  4G6D A;  2ISY A;  2LDU A;  2F5F A;  1JHH A;  1U5T A;  4S05 A;  5J6X A;  3OV8 A;  2L3D A;  3F8M A;  1G3T A;  3J7A O;  4L5I A;  3M8E A;  2EK5 A;  3WTS C;  3MFK A;  2O8X A;  1Z6T A;  3HRT A;  4ZYE A;  1Q1H A;  5E8G A;  2GXG A;  5CVJ A;  5CVI A;  5D6E A;  4ZYD A;  3B73 A;  1SMT A;  1AWC A;  1RI7 A;  1HW1 A;  2RV8 A;  2VT3 A;  5E1Z B;  1FSE A;  4UVC A;  5J8F A;  3GEZ A;  4WWC A;  1J2X A;  2Y0M A;  2ZO4 A;  1O7F A;  2RVC A;  4UUV A;  4L9V A;  1K78 A;  4IXA A;  4L18 B;  1ZYR F;  1G4D A;  1MJA A;  6PAX A;  4WF2 A;  1F1Z A;  1YFH A;  5D8L B;  3IRQ A;  3F8F A;  3ZN1 A;  1ZLJ A;  1XCB A;  4GYG A;  1KQ9 A;  2K02 A;  3QU6 A;  4HV5 A;  3EYI A;  4EGY A;  1XCV A;  4CDG A;  5JFR A;  2PQ8 A;  1WRJ A;  3MAJ A;  3IHU A;  5DEQ A;  1UHM A;  5HLH A;  1KU9 A;  3CLO A;  1H0M A;  4P5O A;  4FHT A;  1DP7 P;  5ERI A;  4OU0 A;  5LGT A;  3IC7 A;  2HKX A;  2BEO A;  2GA1 A;  1XGN A;  2JPC A;  3ECH A;  3I0T A;  4KMU X;  4MQV A;  1ULY A;  2VON A;  1L3L A;  3I58 A;  2XGX A;  1DPR A;  4CZZ A;  3G73 A;  3MWM A;  1RZ4 A;  4R8H A;  4ZZD A;  3I64 A;  3K69 A;  3C3W A;  3J81 Z;  2A6E F;  1ODD A;  4H0E A;  3ABU A;  4ESB A;  4OIO F;  1P4A A;  3SZT A;  3WTZ A;  4O5V A;  2V79 A;  4ENJ A;  3BPV A;  2A07 F;  3W6J B;  2IRF G;  2M87 A;  4G7O F;  4BHB A;  2K27 A;  2ISZ A;  1SD5 A;  4EJV A;  3WTX C;  1ZG3 A;  5F64 A;  1XDS A;  3RIR A;  4RS8 A;  1O3Q A;  1Z05 A;  2M5W A;  3LQR A;  3KET A;  1SD4 A;  4JQF A;  2JPB A;  3ML6 A;  2W85 A;  2Z99 A;  3DFG A;  1KU7 A;  2DPD A;  4HX4 A;  4XBF A;  3WGI A;  3P9K A;  4PCQ A;  1D5V A;  3RDI A;  3S2W A;  5F1R A;  4IHT A;  3TOB A;  1MJ9 A;  3BDD A;  4EQQ A;  2IT0 A;  1OR7 A;  5FB2 A;  1OPC A;  1AOY A;  3VOD A;  3K1N A;  1IN6 A;  2ZXJ A;  2CQK A;  1JXS A;  3BZ6 A;  5CVR A;  3C18 A;  4IPA A;  2M45 A;  2CGP A;  3P9I A;  3H3Z A;  5AIQ A;  2DO7 A;  2PMU A;  2OAZ A;  3E6D A;  4RB3 C;  1FYK A;  1TW3 A;  1KQ0 A;  5E1X A;  2OQR A;  3B02 A;  2YSR A;  2P5K A;  1F9N A;  3COA C;  2DBB A;  3FM3 A;  4G7Z F;  2E1N A;  3QP6 A;  1IRG A;  3WTV C;  2YR2 A;  3MQ0 A;  4EVI A;  4U7B A;  5JI6 A;  3J80 Z;  3WE2 A;  2ZNY A;  2DLL A;  2UXX A;  2HKO A;  2WV0 A;  3IKV A;  1U8R A;  2O0Y A;  1IAW A;  3GFI A;  5ICG A;  1KU2 A;  2VBW A;  2OD5 A;  1T2K A;  2RGV A;  1GXQ A;  1XD7 A;  2LNB A;  1HSJ A;  1YQA A;  1TW2 A;  2E1C A;  1K6O A;  1OYY A;  3U9G A;  1FBQ A;  3K0L A;  2BYV E;  3F6V A;  3DXJ F;  1O7L A;  2GAU A;  3R6S A;  5ILS A;  3M1E A;  3KEQ A;  2HOE A;  1TTY A;  3WTT C;  5JR3 A;  1QPM A;  4KIF A;  3O2P E;  2HEO A;  1ZLK A;  4GO1 A;  3ZPL A;  2KJB A;  2PLY A;  2VE8 A;  4HOB A;  2A5Y B;  4HQM A;  1TLH B;  3R4K A;  3N4M A;  3REO A;  4ESJ A;  1IW7 F;  4OMY A;  3BJ6 A;  1ON1 A;  3FMS A;  2DQL A;  4HX7 A;  3IL2 A;  5BOX A;  5L3E A;  3F23 A;  3KP6 A;  1T38 A;  4KNY A;  1U2W A;  3TO6 A;  3ZMT A;  5CLS A;  1O57 A;  2CWE A;  1ZG1 A;  1DUX C;  5LRR A;  2P7V B;  4MGR A;  4EM1 A;  1GXP A;  2ACJ A;  4DQ2 A;  2MLK A;  5D4R A;  2J5O A;  1NHA A;  1QO0 D;  5LRS A;  4QWQ A;  2NNY A;  4U0Y A;  1I6X A;  2KRF A;  1VTN C;  4MHG A;  2F5C A;  3F8N A;  4RB2 C;  2TDX A;  3F6O A;  4LJZ F;  2G7H A;  1HQC A;  1I27 A;  3E5X A;  1BC8 C;  3HTU A;  4MTE A;  3AAF A;  3D0S A;  1J5Y A;  3V8L A;  2HYF A;  3BWG A;  3GO5 A;  2DU9 A;  5D5X B;  2Z3Y A;  1R22 A;  1RUN A;  4B8X A;  3RPU A;  5BPI A;  3QU3 A;  1IN4 A;  1B9N A;  1TBX A;  2XAH A;  1D8K A;  3JAM K;  4WXD A;  1P6R A;  2DW4 A;  2XRO A;  2KKO A;  3TDU C;  1P4W A;  2YU3 A;  4JK1 X;  2NS0 A;  5BMZ A;  2GZW A;  2EWN A;  1S7A A;  5TRD A;  3J80 K;  3TO7 A;  2P6T A;  2HDC A;  3KP2 A;  2CFX A;  4LG0 A;  1B9M A;  1IZ1 A;  5F6F A;  4ASN A;  4A12 A;  4Y15 A;  3WU0 A;  2X4H A;  1J7K A;  2FE3 A;  1ZN2 A;  5ICC A;  2V6C A;  4Q5S F;  1TQI A;  2V1D A;  1WKM A;  3WU1 B;  5AON A;  4I0B A;  5LGU A;  3RYP A;  5HLG A;  3HHH A;  5FLX Z;  2EV0 A;  1YW9 A;  1HST A;  1FP1 D;  2FSW A;  2HFH A;  4A0X A;  2IA1 A;  3EDP A;  4A6E A;  1LDD A;  2P8T A;  2EA2 A;  1ON2 A;  1Z9C A;  2L54 A;  4KDP A;  2YX7 A;  1IXS B;  5FD6 A;  3F22 A;  3ERE D;  4EV0 A;  1XDU A;  2CW0 F;  1FPQ A;  5AIP A;  2L4M A;  1P4X A;  4ENK A;  2WTE A;  4HAM A;  3IKT A;  3EUH A;  4ON0 A;  3BJA A;  5E8I A;  1WSU A;  4BQA A;  2E7X A;  5DD4 A;  5IT9 Z;  5JVT A;  1SD7 A;  2OZ6 A;  4I7H A;  1S3J A;  1A04 A;  2LSO A;  4GGG A;  4U7D A;  1BM9 A;  4RGR A;  3FX3 A;  4YII A;  2XAJ A;  3BRO A;  3T5X A;  3SZP A;  2H94 A;  4IRG A;  3T0Y A;  2O03 A;  4BXU A;  3TQN A;  2H27 A;  4KIG A;  4MEY F;  1BJA A;  1Z91 A;  4A5M A;  1H9T A;  2OU2 A;  3E6B A;  4WX9 A;  2WC2 A;  3F72 A;  4Q47 A;  5CVV A;  3LA7 A;  4KT5 C;  4WXH A;  2XAS A;  2A61 A;  2R3S A;  1U3E M;  3KFW X;  1W5T A;  4R1H A;  4HYE A;  3R60 A;  5A2Q Z;  2MC3 A;  2BGC A;  1D3Y A;  5D5U B;  4ZYG A;  2KIF A;  2FBH A;  4WK8 F;  3F21 A;  5EEG A;  4G7H F;  2XUB A;  4UV8 A;  2OBP A;  2MH9 A;  2HQR A;  3K1M A;  3KP7 A;  3M9A A;  2RKH A;  2YX4 A;  5E18 F;  1YIO A;  1FC3 A;  5CJ9 A;  3CO7 C;  2M8E A;  3GZ6 A;  5FD5 A;  3Q9S A;  3KEO A;  2Q8K A;  1KYZ A;  4YFX F;  2HYG D;  2FBK A;  2ETH A;  4CO8 A;  2W84 A;  3F8C A;  1U6G A;  4M9X A;  1ZRE A;  4A0Z A;  5FLX K;  1B6A A;  2KJC A;  4YFK F;  3WOD F;  4UHT A;  3U2R A;  1W4M A;  1V3F A;  2Q2E A;  4IRI A;  4EM2 A;  1FX7 A;  4BNC A;  3GF2 A;  3HTS B;  3T1B A;  2EJR A;  1PDN C;  4UV9 A;  3P9C A;  3V7C A;  4NHJ A;  2YPR A;  4NB5 A;  4BHP A;  3I71 A;  4A5N A;  3G3Z A;  2P6S A;  3F8B A;  2AS5 F;  4ZH4 F;  1XB4 A;  3CTA A;  4I2O A;  4HDV A;  5L3G A;  1REP C;  3KE2 A;  1YTY A;  3BOQ A;  4A6D A;  1SAX A;  5IT9 K;  3RKW A;  3HSF A;  3HSE A;  2DT5 A;  2Q0O A;  5HVQ C;  2QBY B;  2Y75 A;  1IXR C;  4O6J A;  4ZYH A;  3V7S A;  4E70 A;  3TO9 A;  3WTY C;  3GFL A;  3GFM A;  1PUE E;  1W7P B;  2DK8 A;  1D8J A;  2MBF A;  2QYO A;  3V7R A;  4L9N A;  1E17 A;  2XAQ A;  2V9V A;  3VEP A;  2HR3 A;  4ZZL A;  4PGH A;  3IWZ A;  1XGM A;  2HTS A;  2VT2 A;  2ZCW A;  5KVR A;  3ROU A;  1R23 A;  5A2Q K;  5CYV A;  3FMQ A;  5FO5 A;  2EFO A;  2O61 A;  4FX0 A;  3RYR A;  2O3F A;  2KIU A;  3WTU C;  4PDK A;  1S7O A;  2ESN A;  2R7F A;  2Z9O A;  4EM0 B;  5HS7 A;  1QZY A;  2HQN A;  5JHU A;  4NQW A;  2PJP A;  1CF7 A;  4K2E A;  3K9T A;  3T8T A;  3TOA A;  3GYH X;  2V1X A;  5LEK A;  4L9T A;  2PG4 A;  3PQK A;  4M72 A;  3ULQ B;  3LA3 A;  5J8C A;  1OKR A;  2NRA C;  3LAP A;  3KZZ A;  3VOE A;  4KN7 X;  3P7N A;  3V8K A;  1YS6 A;  2WWY A;  3NQO A;  1FBS A;  3KCC A;  1UHW A;  2K4J A;  2PMH A;  2RC4 A;  2D1H A;  3HIF A;  2QBY A;  3CUO A;  4FT8 A;  5D8K B;  1HBX G;  1W5S A;  3L7W A;  4EJT A;  1FZP B;  3QP5 A;  4RB0 A;  1W7P A;  4CGZ A;  4LLN A;  4HLX A;  3FWE A;  1KA8 A;  1TQM A;  1XGS A;  2FA5 A;  3SHF A;  3M7G A;  3ZMV A;  1LDK B;  1LB2 A;  1BBY A;  1R1T A;  1XSX A;  4I02 A;  2JT1 A;  4UNO A;  4RGX A;  2XKO A;  4BHC A;  1FYL A;  2VOP A;  2LF8 A;  4HQE A;  4I98 B;  4HDU A;  3J81 K;  3L09 A;  2HGC A;  2D2W A;  1MGT A;  1R36 A;  3TKY A;  3DKW A;  4LK1 F;  3ZMU A;  2RNJ A;  3V4G A;  4LG0 B;  2VBZ A;  4PZJ A;  4OIR F;  2PN6 A;  2X0L A;  5DCM B;  1USS A;  3ZN0 A;  1IN7 A;  2P7C B;  1JE8 A;  4L9J A;  1K7A A;  1I1G A;  4LB6 B;  5LLQ A;  3LQQ A;  1ZGA A;  3E3V A;  5K5Q A;  2JSC A;  1O3S A;  5D4S A;  1WWX A;  1MJB A;  3IWF A;  2F2E A;  2EFW A;  2FBI A;  4MNU A;  4LD5 A;  3LST A;  1UFM A;  3R0J A;  1I5Z A;  2IW5 A;  4UVA A;  5E17 F;  1BOA A;  5LHG A;  1B4A A;  1J0R A;  4UVB A;  4BH9 A;  3CO6 C;  2GQQ A;  1LEA A;  1KGS A;  2XKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...