1FSEA

Crystal structure of the bacillus subtilis regulatory protein gere
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
b'SKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GERE
publication title Crystal structure of GerE, the ultimate transcriptional regulator of spore formation in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 23
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fseA00
5DYMA 2IP2A 3IHUA 5IT3A 2JRTA 1EV7A 4L0YB 4WXCA 4AVPA 2NAZA 4ETSA 4WX9A 3BPXA 3JSOA 4EJTA 1ZG5A 2KIMA 1R23A 4O3MA 1V4RA 3R60A 2FXAA 2OZ6A 4A6EA 2MBFA 3R0AA 3RYRA 2EFQA 1W5SA 4KT5C 1WWXA 3SZPA 1FNNA 1BBYA 3RYPA 2LF7A 3E6CC 3PFIA 2OQGA 3HRMA 1P92A 3WG9A 3KE2A 1R5HA 4RB3C 1LDDA 2WV0A 1ZGJA 4HLXA 5FLXK 2RV8A 5E1XA 3WTWC 3GX4X 2DQRA 1XD7A 4XSZF 3FZVA 3FMSA 3G3ZA 3Q9SA 5L3CA 2Z3YA 2JTVA 3RI4A 1DPUA 4A2UA 5LBQA 2X0LA 1MJBA 5LLQA 1TLHB 2Q8KA 3FXQA 2GZWA 3IKVA 5BPIA 1GHCA 1ZGAA 3TOBA 2HR3A 1ZLKA 4HDUA 5D6FA 2DK8A 2O03A 3SZTA 1OYIA 4M72A 2QLZA 1I1SA 1XMKA 3HRSA 3LWFA 4CICA 2FNAA 4L9JA 1R36A 3HRTA 2QQAA 2FMYA 4IF4A 2PMHA 3ZMZA 2COMA 3FMQA 1BC7C 1ZRFA 1KU7A 5DCMB 1ZG3A 2EV6A 3RPUA 3F8BA 2EB7A 2Y0MA 1UCRA 5EEHA 4RB1A 5JVTA 4GYIA 2XRNA 4EM1A 4QWQA 1QNTA 5EEGA 2BV6A 2NNNA 5BQTA 1S7AA 5H6QA 2V1UA 1ZN2A 5DUIA 1ULYA 3ECHA 2DW4A 5K5RA 5LRSA 2DBBA 2VONA 1AWCA 5D4SA 3HRUA 5HS7A 3C7JA 1F4KA 2O3FA 2ZXJA 5BS6A 2DQLA 2LF8A 3R6SA 2BYVE 3L00A 5H6RA 4A0ZA 1OMIA 1ZARA 4HF0A 5AIQA 3K1PA 1I5ZA 3KP4A 3C1DA 3WTZA 4LG0B 1D8KA 2QBYB 1KA8A 2M30A 1FBSA 1XGMA 3GFJA 3KP2A 3MFKA 4Y17A 1XCVA 5F1RA 1RUNA 3RPQA 1Z6RA 2ESNA 1B4AA 3VODA 2Z9OA 2R3SA 3QU6A 4YFNF 1ZYRF 3DV8A 3I71A 4ENJA 2H27A 5ILUA 3D5LA 5LGNA 2PFBA 3KEOA 4KDPA 1RZ4A 3O2PE 5ED4A 2F5DA 2W85A 2FQ3A 3J80Z 1U5TB 3I4PA 3L7WA 1JHFA 3ZPLA 4MTDA 2LSOA 3REOA 1T39A 4HBLA 4EJWA 2A07F 3Q5FA 2LNBA 2STTA 3RJPA 1FSEA 1BI2A 1HKQA 5LHHA 2P7CB 2OA4A 2XAJA 2P5LC 1P2FA 1XDUA 3KZZA 4N9HA 3VFZA 1CF7A 4RGXA 2W24A 4RGUA 1W4MA 3FXRA 3NRVA 2RQPA 1RNLA 3HSEA 3ZN1A 2PEXA 4UVCA 2RNJA 4IRGA 1G3YA 3EDPA 2ZCWA 1SD5A 2W57A 2VODA 2CG4A 2OZUA 4RS8A 5HLHA 2V79A 1S8NA 1QZZA 4EM2A 1U2WA 1J75A 2LDUA 1HQCA 4KN4X 2VOOA 2Q2EA 4G7HF 3DPTA 5K5QA 3FF5A 3ROUA 3F3XA 2UWMA 5DDGA 2HEOA 4B09A 4CXFA 1MGTA 4OU0A 4ENMA 3RKXA 4ZZLA 2F5EA 2XAFA 3SHFA 3GFLA 1ON2A 4HDVA 2STWA 1J7KA 2YX4A 2XAHA 4OIQF 2VT3A 3WGHA 1TNSA 4HQMA 1WRJA 3BY6A 2WC2A 2W84A 3GWZA 4YIFA 1HW5A 3K2ZA 4OOIA 5FFXA 4P9UA 2VE8A 3EETA 4CYDA 4KIBA 3W6JB 2ELHA 4OMZA 4CDGA 2F5CA 5E20A 5LRRA 1C0WA 1TQIA 3WODF 3FM5A 3K69A 2ZNZA 1B6AA 3MAJA 1T6SA 1K78A 1MJ9A 2EFWA 2GA2A 3F8CA 3K1MA 1PUEE 3H3UA 3M8FA 1JE8A 5D8KB 3CUQC 3U9GA 1R58A 1BIBA 1TQMA 4MGRA 1P4AA 3HHGA 1BC8C 1DDNA 2JSCA 2KKOA 5D5XB 2M45A 4EJUA 1IN8A 3OOPA 4U88A 3F22A 2HKXA 2PN6A 4BHBA 2VC0A 4K2EA 3T8RA 3HIFA 2ZNYA 1BI0A 1YFHA 4ZH4F 2PJPA 1Y0UA 2E1NA 4LLGF 3WTYC 2MH2A 2JPCA 3TOAA 1SAXA 1H9TA 4I0AA 1KQ0A 4P5OA 5AONA 4ZYEA 4LB5A 5L3BA 2OD5A 3WTUC 4MHGA 3N4MA 2KJCA 5LGTA 2MLKA 3DPLC 4ZYHA 1IW7F 4EM0B 3M1EA 1RI7A 1T38A 1IF1A 2O6GE 3BP8A 5F6FA 3I0TA 1KQ8A 1TTYA 3QPHA 5H20A 3RIRA 5HDNA 4IVNA 1YTYA 4RGRA 2PI0A 3ML6A 1FP2A 2K4BA 4BHCA 1DPRA 2J5OA 3QP5A 1R1UA 5JR3A 1XGSA 1BJAA 1RUOA 5D5UB 3G73A 3GFMA 2GAUA 4G7OF 1D5VA 1SD4A 4P55A 4HV6A 3L9FA 1KU3A 3LA7A 3QP6A 3HSFA 2XKPA 4OIPF 1HW1A 1XSVA 4ZZDA 3V7SA 2J5PA 1YW9A 3ZMDA 4G6QA 1BI1A 2DTRA 2MC3A 4PZJA 2EA4A 1I6XA 2IA0A 1ONVA 3NEUA 3KLOA 2RC4A 3H3ZA 2G7UA 1Z7UA 3DXJF 1UB9A 4BH9A 4AIKA 1A04A 4A5NA 3ELKA 5LEKA 3TGNA 3WU1B 2L02A 5E8GA 1PP8F 1F5TA 4GGGA 4L5IA 1DP7P 4M6YA 1SD6A 4A0XA 2E7WA 3F23A 1CF7B 2VOPA 3J81Z 1IXSB 4L9NA 5E1ZB 1FX7A 1ZRDA 3BJOA 3IKTA 1REPC 4CZZA 1J2XA 2H6BA 4IHSA 2D1HA 1J9IA 4GCVA 4MQ9F 1BIAA 5D8LB 3E5QA 2G9WA 4WK8F 4KYWA 1G6NA 1QGPA 4I0BA 3ZQ7A 3ECOA 2HS5A 3U2RA 1B1BA 1K6OA 1XN7A 5E17F 1SMTA 4R8HA 3VEPA 5LEJA 2IW5A 4HA8A 3I54A 2D1VA 2MH9A 3I5UA 4G94A 2QZ8A 4HZFA 1BI3A 4KIGA 3H92A 4DQ2A 5D4RA 4JK1X 4I7HA 5CVIA 5CLSA 5ILSA 2IVMA 4DNCA 4M74A 2PQ8A 3ERED 2XROA 1XSXA 3GXOA 2CSOA 4KNYA 1T0FA 4E70A 1SMYF 4KICA 5ICEA 3WE2A 5FLXZ 1AOYA 2M8EA 5LHGA 4EJVA 3DEUA 2D45A 4BQAA 3E5XA 1LDKB 2XVCA 4Q5SF 1K78B 3L2CA 4GYGA 2FA5A 3DP7A 5HLIA 1QO0D 4EGYA 1FWZA 4PGGA 3FX3A 3TO7A 1U6GA 3DQVC 4YIIA 2Z33A 1GVJA 3NQOA 4GXOA 4JQFA 2L01A 3KP7A 3ABTA 1D8JA 1MZBA 4NQWA 1FC3A 3WTXC 3JAMZ 1S6LA 2RKHA 1B9MA 5HS8A 4WWCA 4EV0A 2BGCA 3V7RA 1IN5A 2PG4A 4R1HA 3MEXA 5CVVA 2PBIA 3FMRA 4LK0F 2ESHA 3T8TA 2L54A 1XGOA 2P6TA 4LLNA 2PLYA 4XBFA 1Q1HA 3KP6A 1EH7A 1Z9CA 3E6DA 4WCGA 3L09A 3JTGA 5KVRA 1NHAA 5LHIA 3ZMSA 1FOKA 3I64A 3LQQA 4LLLA 4B8XA 3KP5A 3SQNA 1J0RA 5KK1A 2HTSA 3V8LA 1E17A 2P5VA 4NHJA 2QVOA 1KU9A 3I58A 4OINF 3K0LA 1GXQA 4M6XA 2ZBKA 1ZH5A 2DI3A 4FHTA 2A61A 4IRIA 2YR2A 2UZKA 3ZMVA 2NS0A 3B02A 1IXRC 3V8JA 2P5KA 1XB4A 2RVCA 3ZP5A 2NRAC 1F9NA 3MWMA 3GZ5A 4N9IA 4KFCA 4YFXF 2ZJ2A 3JSPA 4PDKA 5FO5A 3GEZA 2VBXA 1CGPA 3KCCA 1F1ZA 2ETHA 3M7GA 3VB2A 5HDKA 1JXSA 4KA4A 4LFUA 4UVAA 2GXBA 4FX4A 1FT9A 3IWZA 1FP1D 3HYIA 3IWFA 4ESFA 3PQJA 4P9FA 1W7PA 1VTNC 1G4DA 4I09A 1U78A 2EK5A 5ERIA 4LK1F 4EVIA 4YG2F 3OV8A 5L3EA 5LGUA 1QPMA 1KU2A 5ILVA 2KIFA 3FHZA 3CUQA 3F72A 4TV7A 2HKOA 4LJZF 1WSUA 3HHHA 1FZPB 2IA2A 4JBAA 2F2EA 1LNWA 3LAPA 4BYYA 2IT0A 3I59A 3WGGA 1V3FA 1ZLJA 3HUGA 1WQ2A 4LGWA 3V8KA 3ULQB 5DCFA 3GLXA 4AD9A 3WTVC 2HWVA 3CLOA 1R22A 3K9TA 2V1XA 4U7BA 4U0YA 1Z05A 3BJ6A 4H0EA 5IT9K 1LB2A 2K27A 4MEXF 3LSTA 4QLCU 4Q4ZF 4M9SA 4IRHA 1IZ1A 5CJ9A 2PMUA 1EH8A 2GQQA 4HF2A 2HYGD 5A2QZ 3BJAA 3I53A 5E18F 4UHTA 1MD0A 2OBPA 2GWRA 1W7PD 2EFOA 4M71A 2KIUA 1R7JA 4BAYA 2ACJA 4L9TA 2L3DA 4Y13A 4BXUA 5JFRA 3F6VA 1B59A 5CYVA 2XGXA 1OYYA 2DPUA 2GXGA 3GYHX 3WE3A 2EJRA 4RGSA 2V9VA 1O57A 1ZG1A 3KEQA 1G3WA 4U7DA 5FGMA 1HKTA 3QAHA 4HOBA 2XKOA 4HX7A 1G3SA 2Z5UA 3RDIA 2CO5A 1FY7A 2A68F 2BBYA 1XGNA 2A5YB 1YS7A 3P7NA 2IPQX 2CYYA 1H9GA 3LA3A 1FSHA 2P8TA 3E6BA 4O5VA 5F64A 3KLNA 2Q0OA 2DK5A 1IUYA 4L9VA 3EYYA 2QENA 5HS9A 2EFNA 1EH6A 3BPVA 3SFZA 2M5WA 1B9NA 4ZYGA 3WTTC 2OQRA 5D6EA 4ASNA 2GIVA 2R7FA 2UXNA 1LEAA 2QUFA 5HVQC 2CWEA 4ON0A 2JPBA 3GO5A 4FX0A 4HX8A 2FBIA 3CO7C 3W6KB 1UHMA 5FFZA 2EA2A 2VE9A 2FEZA 2FBHA 2DU9A 4N0BA 1ZRCA 4KMFA 3TO6A 2F5FA 3COAC 1IN6A 1WKMA 2DO7A 1L0OC 2D2WA 2HGCA 2E1CA 2RDPA 4IHTA 3U1DA 2E7XA 3HTSB 1RIOH 1QBJA 1JHHA 2XV4S 2YU3A 3TKYA 1FYKA 3RKYA 1BM9A 3IRQA 1HXDA 2FMLA 3ABUA 3DKWA 5DD4A 1OR7A 1SFEA 2DFIA 3HOTA 4PCQA 4AIHA 4U0VA 1GXPA 2QQ9A 1O3RA 1LQ1A 4UUVA 1E2XA 1PDNC 2ISZA 2VBYA 4KUMA 3IRRA 4L18B 4XRFA 5JHUA 2ZFWA 5DUKA 1FYLA 2RGVA 2ADUA 1IN4A 4I98B 3EUHA 2HOEA 4RAZA 4HV5A 3P9IA 5E8IA 2VBZA 2JZYA 2M87A 2IRFG 4UV9A 4G6DA 3MQ0A 2VT2A 1YLFA 1P4WA 2HYFA 2FE3A 4HX4A 3V7CA 3PQKA 4OMYA 2HQRA 2A6EF 2QM3A 2X4HA 2B0LA 6PAXA 1MDMA 4R79A 4XSXF 4OIRF 2FOKA 2UXXA 1W7PB 3M8EA 4A12A 2CFXA 4OIOF 3FXUA 1YO5C 4U0WA 4RB0A 1JGSA 2XHKA 2Y75A 1U5TC 3CUQB 2HDCA 1P6RA 1LVAA 1FPQA 3TQNA 2ZO4A 5CVRA 5BMZA 1YW8A 2V1DA 3I59B 3P9KA 2XUBA 3SXYA 3CDHA 4I01A 3MZYA 2ZMEA 1P4XA 4S05A 3R4KA 3GVAA 4RAYA 3QPTA 1QZYA 5L3FA 3O6BB 3JAMK 2A6HF 3QOPA 4CO8A 3BWGA 1YG2A 2JT1A 4AWXB 2FSWA 2P7VB 4EJOA 1T2KA 5TRDA 1PP7U 4G9YA 2MD5A 3RKWA 3TDUC 4YFKF 5ICGA 1D3YA 1W5TA 1IRFA 1SFUA 2W25A 2DAOA 4A0YA 3TO9A 2EFPA 3DFGA 5L3DA 4XLNF 1KGSA 2H94A 1Z1DA 4A5MA 1IRGA 2Y48A 2WTEA 3AAFA 3EQLF 3R61A 1DUXC 3B73A 4RB2C 3CO6C 4ENNA 3F8MA 1S29A 3T0YA 3R0JA 2XIGA 1USSA 2BE5F 4WXHA 1ZREA 4HF1A 3J80K 3QRFF 3JW4A 3T1BA 2FRHA 2VN2A 4Q47A 1ZHFA 2BEOA 3JTHA 3KFWX 5HOOA 1TW2A 4KN7X 3MZHA 3KP3A 1YQAA 4ESBA 5D5VB 4KIFA 4PGHA 3GF2A 1HKSA 2ISYA 2A3SA 4MTEA 4G7ZF 3WU0A 5JI6A 1IXCA 4EQQA 2AXLA 4HQEA 1LEBA 4LD5A 3IL2A 3GUDA 5DV5A 3LA2A 1IN7A 4MEYF 2YPRA 4MNUA 1O7LA 3VOEA 4Z2YA 1ODDA 2HZTA 2O0YA 3FWEA 2P4WA 5TJJA 3CTAA 1QQIA 3QU3A 5CVJA 5E1WA 4KMUX 1Z6TA 1R1VA 1XMAA 2ZKZA 5BPDA 3ZMTA 2TDXA 1IAWA 2HFHA 1TW3A 4GO1A 2L4AA 2LKPA 2V6CA 1UHWA 1U8RA 1HSTA 3BOQA 3K1NA 1MJAA 4M9ZA 3T5XA 5K1YA 2DT5A 1G3TA 1K7AA 4I02A 4UNOA 2K86A 3KETA 2HTJA 3GFIA 2Z99A 4O6JA 3F6OA 1X3UA 1ZAOA 2CQKA 4UVBA 5ICFA 1YIOA 3EYIA 3ZMUA 2O8XA 5FD6A 1OPCA 2OU2A 2KRFA 2RN7A 4HAMA 1SD7A 5HLGA 4ESJA 3E3VA 2L4MA 1YS6A 2KJBA 4FT8A 3FM3A 1S7OA 1J59A 3LFKA 1R5GA 2VC1A 5A2QK 4S04A 3M9AA 1HBXG 1BOAA 4F7ZA 4I2OA 4ZYDA 4WXDA 3ZN0A 1MDMB 4BHPA 3WGIA 2R7DA 1YW7A 1R1TA 3C3WA 2A69F 4Y15A 1FLIA 2VXZA 5L3GA 1LJ9A 2EV5A 4UXNA 1STZA 3DF8A 3F8FA 1TBXA 5CVUA 4L0ZB 1LDJA 3E6MA 2O61A 3Q9VA 1XSDA 3BZ6A 2CW0F 4LB6B 1Z91A 4ENKA 2DLLA 1OKRA 3N97A 5BOXA 4EGZA 2AS5F 1KYWA 1MKMA 4HYEA 3CJNA 4NB5A 2QYOA 4BNCA 2ZMEB 1XDSA 3D0SA 2OAZA 2FF4A 3J7AO 1HSJA 3BDDA 3MCZA 2EWNA 4HLYA 4M9XA 1U3EM 2WWYA 4A6DA 1TQPA 3E97A 1L3LA 2CGPA 1XCBA 5DCMA 1T98A 1HW2A 4XLPF 1USTA 3ISPA 2P6SA 2QQBA 2QWWA 3WTSC 1TNTA 1FBUA 1J5YA 2FNPA 2C6YA 2EV0A 4WF2A 4MQVA 1WI9A 2MLGA 1FYMA 2YX7A 3KZYA 2XAGA 3LQRA 2FBKA 3LAJA 2NNYA 2K4JA 3F8NA 3O3KA 5J8CA 5AIPA 5IT9Z 1O3QA 4IJAA 1SFXA 1KYZA 4CHUA 3BROA 1FBQA 1K79A 2GA1A 2HQNA 3F21A 1O3TA 2K7LA 3P9CA 2G7HA 2IA1A 1I27A 1BN5A 4LG0A 1ON1A 2IJLA 2QBYA 5J6XA 4D0PA 1H0MA 4L5JA 1R00A 5K5OA 2M1BA 5FB2A 3TDZC 1O3SA 3V4GA 3GZ6A 2XASA 2YSRA 3GW2A 2H09A 3HSRA 1KQ9A 2MA3A 1YYVA 1S3JA 4IPAA 3E5UA 4UV8A 1O7FA 2K02A 5DD8A 2DPDA 3IC7A 3J81K 1I1GA 3C18A 2NYXA 3CUOA 4Q48A 2FU4A 4IXAA 5J8FA 5D5WB 4G8XA 4LMYA 3HTUA 1U5TA 5DEQA 2VBWA 4HW0A 4M73A 3HOSA 3RTRA 5ICCA 1OYWA 4AIJA 2H6CA 5FD5A 5HDGA 1UFMA 3S2WA 4P96A 2XAQA 4CGZA 4EMSA
chains in the Genus database with same CATH superfamily
5DYMA 2IP2A 3IHUA 1Q1VA 2JRTA 1EV7A 5IT3A 1AHDP 4WXCA 3K4MA 3ZGKA 4F91B 4AVPA 4L0YB 2DA7A 3S15J 2NAZA 4ETSA 2WAFA 4WX9A 3BPXA 1VQ6I 3JSOA 2BW3A 3A1YA 1I3QJ 4EJTA 1ZG5A 2KIMA 4IOCF 1R23A 4O3MA 2E5ZA 1V4RA 3R60A 3CCMI 2FXAA 2OZ6A 2DYSH 2AHQA 5GPCA 2R5YB 4A6EA 2MBFA 3R0AA 3RYRA 3MVPA 2EFQA 2B7EA 1W5SA 1Y56A 3K4KA 1PJRA 3HZJA 4KT5C 1WWXA 3SZPA 1BOBA 1V55H 1FNNA 2K5CA 4C2UA 1TWFJ 5FKMA 1BBYA 2W48A 3RYPA 4RBOA 2LF7A 4B43A 3E6CC 3PFIA 2OQGA 3MZ8A 2DDAA 1JT6A 1FOXA 3HRMA 3BQYA 5DS9A 1P92A 3WG9A 3KE2A 1R5HA 4BY1J 1S7EA 4KT6A 2BY2A 4RB3C 2LH9A 1LDDA 3ERMA 4AU7A 2DMNA 3S3OA 3DU5A 1Z3YA 5M5WJ 2WV0A 1ZGJA 4HLXA 5FLXK 1IDYA 2ZXWH 3PNYA 3NWSA 2RV8A 5E1XA 2CV0A 5F0FA 3WTWC 3LSKA 3CCLI 3GX4X 2DQRA 2RNGA 1IRXA 2V26A 1XD7A 1UAAA 4XSZF 3KYDB 3FZVA 1XC5A 3FMSA 4Y3OA 1M1EB 4II2A 3G3ZA 3Q9SA 5L3CA 4E7JA 2QSGX 4A3LJ 2Z3YA 2JTVA 5M3MJ 1WJEA 3RI4A 1DPUA 1R4MB 4XLEA 4A2UA 3ZQHA 5LBQA 3CMAI 2X0LA 3CJQB 1MJBA 2CUEA 5LLQA 1T33A 1TLHB 2Q8KA 1BR2A 3FIWA 3K4BA 1X4PA 1E3OC 2DJNA 3FXQA 3IH3A 4DIQA 2GZWA 1OR7C 1EF4A 4E7ZA 4V2FA 2TRTA 3IKVA 5BPIA 3I4MJ 1GHCA 1ZGAA 3KYLA 3TOBA 4IHWA 2HR3A 1ZLKA 4D5FA 5D6FA 4HDUA 4L5EA 2DK8A 3OS0A 3SEZA 2O03A 2OTLI 2JVGA 2A05A 2W4SA 2HQAA 3SZTA 1OYIA 4BS9A 4M72A 3CP8A 2QLZA 1I1SA 4A3CJ 1XMKA 2OF7A 3HRSA 3LWFA 3IH4A 4CICA 2FNAA 4X1EA 4MIMA 3TW7A 4L9JA 4D9JA 1R36A 3DLAA 3HRTA 1N25A 2QQAA 1R71A 2KP6A 4BJ6C 1V5EA 3BR2A 2MABA 2FMYA 4IF4A 4IL6C 3IV5A 4FCYA 2PMHA 3FXMA 5GTIC 3ZMZA 2COMA 3FMQA 1BC7C 1D1AA 2QQ8A 1ZRFA 1KU7A 1YIJI 3D5RC 1ZR4A 5DCMB 4V2GA 3KPHA 1ZG3A 2EV6A 3RPUA 1SC7A 3F8BA 2EB7A 2M3AA 4XORA 2Y0MA 4CUGA 3DBRB 4DOZA 1UCRA 5EEHA 2DMQA 4RB1A 3HBLA 3CCUI 5JVTA 4BJTA 4GYIA 2XRNA 4U87A 2WA0A 4EM1A 4A3GJ 4QWQA 1QNTA 1QPIA 5EEGA 1B8IA 2BV6A 2NNNA 2V1NA 5BQTA 1S7AA 2F48A 5H6QA 2V7FA 4UB8C 3CCRI 2XF7A 3G2BA 3UKGA 1H8AC 2CQNA 2V1UA 5DTDA 1ZN2A 4FE7A 4XN3A 3ZQGA 5DUIA 1ULYA 2X85A 3ECHA 4B3XA 2DW4A 2K85A 4XOTA 5K5RA 4V19K 5LRSA 3WG7H 2DBBA 2VONA 1AWCA 4XN0A 5D4SA 3HRUA 5HS7A 2E60A 1U9OA 2R92J 1G59A 1U0JA 3C7JA 2L9VA 1MW7A 3N05A 1OCTC 2AO9A 1RKWA 1F4KA 2O3FA 1D0XA 4M3BA 4RM2A 3I55I 2BXZA 2ZXJA 3W2VA 1EA3A 5BS6A 2DQLA 2LF8A 3R6SA 1FOWA 3J7YJ 2ZMEC 2BYVE 3L00A 5H6RA 4NNJA 4A0ZA 5HODA 1OMIA 1ZARA 2VJ4A 4HF0A 2K3FA 2EZHA 3S17J 3LSIA 5AIQA 3K1PA 1I5ZA 2M4KA 3KP4A 2F5VA 3C1DA 3WTZA 4LG0B 1D8KA 4B44A 2QBYB 2Y0SA 2K9NA 1KA8A 3CC7I 2M30A 1FBSA 5IOYA 3PO3J 1K61A 1UELB 1XGMA 3GFJA 3KP2A 1TT5B 3I56I 5GAHJ 3MFKA 4D1QA 4Y17A 2DXIA 4JX5A 1XCVA 5EF6A 1W0TA 2XPUA 3GTJJ 3B6CA 5F1RA 1RUNA 3RPQA 1Z6RA 3CCEI 3C2BA 2ESNA 4C9YA 3BR1A 3G1OA 1B4AA 3VODA 2Z9OA 2R3SA 3QU6A 4YFNF 1MH3A 1ZYRF 2LREA 3DV8A 4Y52J 3I71A 1JKPC 3FHNA 2GBYA 3CF2A 3M07A 4ENJA 2H27A 3S16J 2IBDA 3H9JA 4JOMA 2HXIA 4ZYAA 2LP0A 5ILUA 5IP6A 3D5LA 2W1OA 1QVTA 4A3BJ 3FK6A 5LGNA 1ZQ3P 2PFBA 2Y2ZA 1OCZH 3KEOA 3S1QJ 4KDPA 4DZJA 1X1BA 4G12A 4QIWN 1RZ4A 4QPOA 1ZELA 3OWTA 3O2PE 4DYQA 5ED4A 4RAFA 2LKXA 4GFBA 2F5DA 2W85A 2FQ3A 3J80Z 5J4VA 3FDYA 3W3CA 1VZ0A 1U5TB 2DOFA 2Q1ZB 3I4PA 2CJJA 4IEJA 3L7WA 1JHFA 2DFHA 3ZPLA 4MTDA 4CCKA 5JHFA 2LSOA 5IP9J 5FLVA 4DBRA 1QA6A 3H1CA 3REOA 1T39A 4HBLA 4XICA 4EJWA 2A07F 3Q5FA 2COBA 5GTHC 3OYCA 4DZPA 3MKYB 2LNBA 2STTA 3RJPA 2MYSA 3BCAA 1FSEA 1BI2A 1HKQA 3K70C 1NTCA 2L2OA 4E7LA 5LHHA 1X2MA 2KLOA 1ETYA 2IGKA 4DW6A 5EGOA 3K4JA 1ETVA 3QODA 1X4OA 4AIDA 5JLWA 2P7CB 4NUBA 1Y8RB 2OA4A 2BW3B 2XAJA 2E1MB 2P5LC 1P2FA 9ANTA 3PIPF 1XDUA 3KZZA 1W1WE 4N9HA 2ELJA 1AKHA 3VFZA 3OYDA 1TP4A 2R5ZB 1CF7A 4RGXA 2W24A 4RGUA 1W4MA 4J00A 3FXKA 3K4CA 2XF6A 2DFFA 5F0CA 3TL4X 5FROA 3KZIC 1I39A 2R7TA 2OUMA 1Z3XA 3FXRA 3NRVA 5F08A 3F9KA 3S32A 2RQPA 1RNLA 3HSEA 2O5RA 3ZN1A 2PEXA 1Y8QB 3DLLF 4RAGA 2VKEA 3OIPA 1S9HA 4UVCA 2RNJA 1JTXA 5J47A 4IRGA 1G3YA 3EDPA 1Z0XA 1XPXA 2PMZN 2ZCWA 1SD5A 2W57A 2VODA 4C2MJ 3TW6A 3BTCA 3WHCA 2CG4A 2OZUA 4RS8A 4FASD 2W82A 2L9NA 3ABMH 5HLHA 2V79A 5GAGJ 1S8NA 2HNHA 3OSFA 3DEWA 4A3JJ 2Z1DA 1QZZA 2H8RA 4BKXA 2E5NA 4M6VA 1TC3C 4EM2A 1U2WA 1J75A 2R7ZJ 2LDUA 1HQCA 1VNDA 4KN4X 3LNQA 2VOOA 2Q2EA 4G7HF 3OYAA 5F1JA 2KZVA 4XL9A 3DPTA 5K5QA 3FF5A 3ROUA 3F3XA 4UB6C 3DCFA 2E2HJ 2UWMA 5DDGA 2HEOA 4B09A 2QKMB 4CXFA 1MGTA 3VSKA 2HVSA 4OU0A 4ENMA 4EMSA 4FTHA 4IX7A 3RKXA 4N4OB 1QU3A 4ZZLA 3ZQQA 2F5EA 2XAFA 3SHFA 3GFLA 2XSDC 4IHYA 3S14J 3V42A 1ON2A 4ZDPA 1R9TJ 4HDVA 2STWA 1J7KA 2YX4A 5J4YA 1ETQA 2XAHA 4OIQF 2VT3A 3WGHA 1TNSA 4HQMA 1WFXA 1WRJA 2LLKA 2X1EA 3CD6I 2BVMA 2W00A 2VB6A 3A01A 3BY6A 2WC2A 2EH3A 2W84A 2VPLA 1X1PA 1GDTA 3GWZA 3HXLA 4YIFA 2L0KA 4YIRX 1HW5A 5K7FA 1JGGA 3K2ZA 4OOIA 5FFXA 4P9UA 1FMWA 2VE8A 3EETA 2I10A 4CYDA 4KIBA 5C3EJ 1U9NA 3W6JB 2ELHA 2HPIA 1U8BA 4OMZA 4CDGA 2F5CA 5E20A 1V5GA 2JMWA 5LRRA 1C0WA 2GXAA 1TQIA 3WODF 4B1RA 5B5EC 3FM5A 3K69A 2IS4A 4CYCA 2ZNZA 4JX6A 5FKLA 2ZXIA 3OYLA 1B6AA 1FMVA 2KFDA 3MAJA 3M4OJ 3JREA 1T6SA 1K78A 2QSFX 3ZRGA 1MJ9A 4F55A 3JRGA 3NWTA 2EFWA 2GA2A 1VQNI 2LVSA 3F8CA 3K1MA 1PUEE 3H3UA 2DODA 2DOEA 3M8FA 1JE8A 5D8KB 1VFCA 2DMPA 1YX3A 1WJ5A 3RSNA 3CUQC 3U9GA 1R58A 4J19A 2EZIA 1RR7A 1BIBA 1TQMA 1B8IB 4MGRA 1MNMC 1UG0A 1P4AA 3HHGA 4N4NB 1BC8C 1DDNA 2JSCA 2IAIA 2KKOA 2DTZA 3H36A 2LY1A 2WADA 1NK2P 5D5XB 2M45A 4EJUA 1IN8A 3OOPA 4U88A 1YRNA 4XONA 4DYRA 3F22A 2HKXA 2PN6A 2Z16A 4D5CA 4YEJA 2R7XA 3DKXA 3OIQA 1O4XA 4BHBA 2QEXI 2VUMJ 3ESWB 2M7BA 2VC0A 2LMDA 4K2EA 1KONA 3SYTA 2DA2A 3T8RA 3HIFA 3HGGA 3HJEA 2ZNYA 4IOAF 1BI0A 2K9LA 2R7WA 1YFHA 4NQWB 3LSRA 2XRLA 4XRSA 4ZH4F 2BY0A 2R7QA 2PJPA 1Y0UA 4ITVA 2E1NA 4LLGF 1TWGJ 3WTYC 4M3EA 2MH2A 3HOVJ 2JPCA 3G1MA 3TOAA 1SAXA 5EDNA 2FUG2 1H9TA 1PUFA 4I0AA 1KQ0A 3AKZA 4P5OA 5AONA 2YU9J 4CCMA 4ZYEA 3LL7A 4LB5A 2OV7A 5L3BA 3VSLA 2Y9ZA 1WGXA 3HPHA 2KISA 2OD5A 1RRJA 3WTUC 4MHGA 1UJ8A 2KJCA 3N4MA 2YUSA 2NOGA 5LGTA 2WB1N 2MLKA 3W2AA 5E3MA 3DPLC 1VI0A 1YJWI 3U1KA 4ZYHA 4GDFA 1IW7F 4EM0B 3M1EA 3JRDA 2KDOA 2VQCA 1RI7A 3CQZJ 1T38A 1D0ZA 1IF1A 2O6GE 3BP8A 2KDZA 5F6FA 1BR4A 5H2FC 1V5FA 3I0TA 2XSJC 1TTYA 4CZCA 1KQ8A 3QPHA 2FD5A 5H20A 3RIRA 1IRZA 5HDNA 1JKQC 3JCUC 4IVNA 2BHYA 3W2WA 1YTYA 2CUFA 1TL8A 4W1UA 1A6QA 4C2TA 4RGRA 2PI0A 3OYMA 3ML6A 1FP2A 2K4BA 2DDBA 2JSPA 4BHCA 2VPRA 3J7ZI 1DPRA 2J5OA 3QP5A 4AM3A 1R1UA 5JR3A 1X2NA 1XGSA 1X1AA 1BJAA 2OCEA 3QYFA 1RUOA 5D5UB 3G73A 3GFMA 2GAUA 4G7OF 1D5VA 1SD4A 4XM3A 3CCJI 3S93A 4P55A 4HV6A 3H3VK 3AG1H 4LIUA 3L9FA 1KU3A 3LA7A 2HPMA 3QP6A 2DCEA 4DGWB 5F04A 3HSFA 2XKPA 4OIPF 3K4NA 1DP3A 1HW1A 1XSVA 4ZZDA 5FJ8J 3GTQJ 3V7SA 3BCBA 5IY5H 2J5PA 2ZSIB 1YW9A 3ZMDA 1N77A 3S8PA 2K9MA 4G6QA 2DYRH 5IYCJ 2XB0X 1BI1A 2DTRA 5FRMA 3ZCOA 2ME6A 2X9DA 2MC3A 4PZJA 3OSGA 2EA4A 1I6XA 2IA0A 1ONVA 1LFPA 1WH5A 1ITYA 2EBIA 3NEUA 3KLOA 2RC4A 3H3ZA 1QHGA 2G7UA 1Z7UA 3DXJF 3IP4B 1UB9A 2R5ZA 4BEHA 4PJMA 4BH9A 4H4KC 4AIKA 2DA1A 3LSPA 4RLQA 1A04A 4M3FA 4A5NA 3DEEA 3ELKA 2VLAA 5LEKA 5EGOB 1FEXA 3VPRA 5CQEA 3TGNA 5J1RA 2L02A 3WU1B 1VQ5I 4XKWA 1WH7A 1XG1A 3GTPJ 3BG3A 4RMNA 5E8GA 1PP8F 4GGGA 1F5TA 4GRIA 4L5IA 1DP7P 3LFUA 3Q0UA 4JX4A 4M6YA 1X19A 1SD6A 3Q0VA 4A0XA 1Y1VJ 2E7WA 2KQRA 1AKHB 5JLXA 3F23A 1CF7B 2QKLB 2VOPA 1YOVB 3FISA 3J81Z 1IXSB 4L9NA 3PNVA 4PSWA 3MKWB 5E1ZB 1FX7A 1ZRDA 3CJTB 3BJOA 1DQUA 3BR5A 3IKTA 2IEKA 4E7KA 1REPC 2JUCA 2MD0A 3I4NJ 4CZZA 2NVYJ 1J2XA 2H6BA 4IHSA 2D1HA 1J9IA 4GCVA 1WJAA 4MQ9F 1BIAA 3EUAA 3TP3A 1JUMA 1HLVA 4YELA 4AUXA 5D8LB 3E5QA 2G9WA 3DKYA 2MC4A 3RCOA 1D0YA 4WK8F 2XGDA 4KYWA 1G6NA 5GAEJ 1QGPA 1ZR2A 5TGTA 3OL4A 4I0BA 3ZQ7A 3Q0WA 4PFPA 3ECOA 3AL0B 3GTGJ 2OC6A 2HS5A 3U2RA 1B1BA 4A69C 1K6OA 2MSYA 1XN7A 5E17F 1SMTA 4R8HA 3VEPA 1GT0C 4PSXA 5F27A 1B72A 4A3MJ 1NK3P 1P9QC 5LEJA 2IW5A 4HA8A 2Q2EB 3I54A 3PFYA 1K4SA 2D1VA 2MH9A 3I5UA 4G94A 1X58A 2IGNA 5DM6F 3QOEA 2QZ8A 2IS2A 4HZFA 4RA2A 1BI3A 4KIGA 3H92A 3BTIA 4DQ2A 4XQFA 5D4RA 4JK1X 1OCOH 4I7HA 5CVIA 3HC7A 1MNDA 1MBGA 1I50J 4RLFA 4FETA 3OS1A 4HSRA 2X6OA 3CCVI 5CLSA 1POGA 2L7FP 2LRDA 3OIOA 5ILSA 2IVMA 1QRYA 3A0BC 2DT7B 2VL8A 4DNCA 4M74A 2BHZA 5EZGA 2PQ8A 2PMZA 3EUHC 2E1MC 1HCRA 3OY9A 3ERED 2XROA 1XSXA 2EZLA 3GXOA 1G2HA 3A01B 1LFBA 2CSOA 4KNYA 1R6RA 1T0FA 4E70A 4RDUA 1SMYF 1TZLA 4KICA 3IAS2 3C2HA 3I3LA 5ICEA 3HGYA 3WE2A 5FLXZ 1AOYA 2M8EA 3HEFA 1GLNA 4EJVA 3DEUA 5LHGA 2E1OA 3X2QH 1OQYA 3LOCA 2D45A 4BQAA 3E5XA 1LDKB 4LITA 3PUBA 4W97A 1UHSA 4CYCB 3F0CA 2XVCA 3CP2A 1WPKA 4Q5SF 1K78B 3L2CA 4GYGA 2CV1A 1FJLA 1OCRH 2FA5A 2CUZA 3DP7A 1MH4A 5HLIA 3DTIA 1QO0D 2OTJI 3OYKA 1SVLA 3JRCA 4EGYA 1FWZA 4PGGA 3FX3A 4MO7A 3TO7A 3S1MJ 1U6GA 3DQVC 4YIIA 2Z33A 1GVJA 3NQOA 4GXOA 1VQ9I 3O8GA 4CGZA 3ZQLA 4JQFA 1JUPA 4HNVA 2L01A 3KP7A 3DBHB 1F36A 3ABTA 1D8JA 1MZBA 5KAFC 4NQWA 1FC3A 3H0GJ 1QHHD 5KNLA 3WTXC 3JAMZ 1APLC 1S6LA 2RKHA 1B9MA 2VJ5A 1YRNB 5HS8A 2XB5A 1VQKI 4WWCA 4EV0A 4AYBA 1Y6IA 2BGCA 1ERDA 3V7RA 2JUGA 5J3LA 1IN5A 3DPUA 2PG4A 1OISA 4R1HA 2WY7Q 3MEXA 4F52A 5CVVA 3A2KA 3FKIJ 2PBIA 3FMRA 2ZC2A 4LK0F 2ESHA 2ICWG 3T8TA 3RPUD 4NC8A 2L54A 1XGOA 4JP0A 2P6TA 2DT6A 2JQ7A 4LLNA 2PLYA 4XBFA 3AG3H 1LVKA 1PUFB 3LSGA 1Q1HA 3KP6A 1R49A 3J7AY 1EH7A 4IKFA 4YRVA 4BBRJ 1Z9CA 1WJCA 3E6DA 4XKVA 3L09A 4WCGA 2EPFA 3QPSA 3JTGA 2XF5A 1T08B 5KVRA 1NHAA 5LHIA 3K4LA 3ZMSA 1FOKA 1BL0A 3I64A 3LQQA 4QTRA 3ZQCA 4LLLA 2V4JC 4B8XA 3KP5A 3SQNA 4ZJZA 1J0RA 5KK1A 3OYIA 3BR6A 3ZQIA 1VQ7I 2HTSA 2JA7J 3V8LA 3K2AA 1TWHJ 1E17A 1IUFA 1IGNA 1X1DA 3BTLA 1SFOJ 3TBIA 4Y4RA 3H5NA 1RC9A 1Z7LA 2FJ1A 1F43A 4ZDLA 2P5VA 4NHJA 1A35A 2QVOA 3OL3A 4KITB 1OJLA 3CJRB 1KU9A 5IYBJ 3I58A 1LUJB 1X1CA 4OINF 2BOLA 3K0LA 2HVQA 1A31A 1GXQA 4M6XA 3HDDA 2ZBKA 1ZH5A 2DI3A 1Y39A 3UR3C 4FHTA 3A02A 2A61A 4B4CA 4Y7NJ 4IRIA 2YR2A 2UZKA 2HDWA 2V9KA 1BR1A 1W36D 3ZMVA 2NS0A 4F93B 3B02A 4FQGA 3SDBA 2WBMA 3CC4I 1IXRC 3V8JA 5HNFA 3RKQA 2P5KA 1LE8A 3H9QA 4IZZA 2IS1A 1ZKGA 1XB4A 2CS3A 4AC0A 2AXTC 2EINH 4E7SA 5J1YA 4HNUA 3FKJA 3CMYA 5C4XJ 1SVMA 2RVCA 2LC2A 4DBQA 1ETXA 3ZP5A 3NARA 3VDXA 4BJ5C 2NRAC 1AA7A 2WB1A 2L9SA 1F9NA 3MWMA 3GZ5A 4N9IA 1MBEA 4KFCA 1SEUA 3WHBA 2ZJ2A 1Z67A 4YFXF 3JSPA 2DMTA 2QA4I 1VQ8I 1WZ2A 4PDKA 4I99C 1HA8A 3QQAA 5FO5A 3GEZA 2O9LA 3DU6A 1ETWA 2VBXA 1RR8C 2ZSHB 1CGPA 3KCCA 1LPQA 2E2JJ 1F1ZA 2ETHA 4BEHB 3CCSI 3M7GA 3VB2A 2DJIA 5HDKA 1JXSA 2CFOA 5E3OA 4KA4A 4LFUA 4UVAA 2GXBA 2JA6J 3FBNB 3HL2A 4FX4A 2LBFB 4MFDA 3CC2I 1K4TA 2CU7A 3H35A 1FT9A 2VXDA 1MMGA 3IWZA 1FP1D 2XGCA 3HYIA 3IWFA 2HZDA 3GTOJ 3GTKJ 3VYUB 4B48A 4ESFA 3PQJA 2L5QA 3OR2C 4P9FA 3TMOA 1W7PA 2VJIA 1VTNC 1G4DA 4I09A 2KRCA 1U78A 2E19A 2EK5A 5ERIA 4LK1F 2LK2A 5IPAA 1MSFC 2ID6A 4EVIA 4YG2F 3OV8A 3JRIA 5L3EA 1MMAA 5LGUA 4XLCA 4UUSA 1PVEA 1KU2A 1QPMA 5ILVA 5GADJ 2KIFA 1NG7A 3FHZA 3CUQA 3F72A 4TV7A 2DOAA 1MSEC 2HKOA 4LJZF 1WSUA 3HHHA 1FZPB 3BG6A 2IA2A 4JBAA 2F4OB 4ANJA 2F2EA 1LNWA 3D1NI 3LAPA 4BYYA 2IT0A 3I59A 3WGGA 1V3FA 2VQLA 4A3EJ 1ZLJA 3HUGA 1WQ2A 4LGWA 3V8KA 3ULQB 2JVHA 5DCFA 1YJ9I 2KHMA 3GLXA 3E1SA 4AD9A 2HWVA 3WTVC 3S2DJ 2CW7A 3CLOA 1R22A 2H1LA 3PO2J 4X6AJ 3K9TA 2V1XA 4U7BA 3LSHA 3ZOBA 4U0YA 1Z05A 1NG6A 3BJ6A 1S72I 3KX2A 1B72B 5M3FJ 1GUUA 1VQOI 4HRIA 4H0EA 5IT9K 1LB2A 1YITI 2K27A 4MEXF 3LSTA 2R7OA 1E3PA 5EZHA 4QLCU 1VQPI 3PSFA 1ENHA 3UNGC 4XLHA 2GIZA 4Q4ZF 4M9SA 4IRHA 3FXJA 4II3A 1IZ1A 2EZKA 1WVRA 1R5ID 2JWTA 2XC7A 3L2UA 1LFUP 5CJ9A 4G6TB 3AG2H 2PMUA 3CLQA 1EH8A 3RQIA 1NH3A 2GQQA 3ABKH 4XRSG 4HF2A 2HYGD 5A2QZ 4AYBN 3PSIA 1GVDA 3M1CA 1TWAJ 3BJAA 3I53A 4UHTA 1MD0A 5E18F 2E36A 2JA8J 2OBPA 1P7IA 3TP0A 2GWRA 1W7PD 2EFOA 4M71A 1FIAA 4PUSA 2V6EA 2KIUA 1R7JA 4BAYA 2HYJA 2RQQA 2ACJA 4IO9F 4L9TA 2L3DA 4Y13A 4IHVA 2NS7A 1FTZA 4BXUA 3FXOA 5JFRA 4PFOA 5FKKA 2V9PA 2KL4A 2X1DA 3F6VA 3LSJA 1G8XA 1DGWY 1B59A 5CYVA 2XGXA 1W0UA 5GPAA 1OYYA 2CUJA 2DPUA 2GXGA 3VWBA 2ZFUA 3GYHX 3WE3A 4A3DJ 2EJRA 4F92B 4ZTFA 4RGSA 2V9VA 1EKEA 1O57A 4I76A 3VYRB 3OMYA 1ZG1A 3KEQA 2BZTA 1G3WA 4B47A 4U7DA 3AL0C 5FGMA 1HKTA 3BG9A 3QAHA 4HOBA 2XKOA 4HX7A 3I9V2 1G3SA 1D5YA 2OPTA 3HOYJ 2Z5UA 3RDIA 2CO5A 1FY7A 2A68F 2BBYA 3WU2C 1MBHA 1XGNA 1MBFA 2A5YB 1YS7A 3P7NA 2IPQX 4LIVA 5E79C 2CYYA 3RQ4A 5FKOA 1XS9A 1H9GA 2HVRA 5LD2C 3LA3A 1FSHA 2CMPA 2P8TA 3E6BA 2ZXHA 1J09A 4O5VA 5F64A 4DYCA 2P0WA 2Q0OA 3KLNA 2DK5A 2OJED 1IUYA 2WAQN 4L9VA 2M7AA 3EYYA 2QENA 5HS9A 2EFNA 1EH6A 3OYJA 3BPVA 3SFZA 2M5WA 1B9NA 4ZYGA 5TISC 3WTTC 2GOXB 2OQRA 4M3GA 5D6EA 3K10A 2LY2A 4ASNA 2GIVA 4FISA 4IQJA 1TWCJ 4BXXJ 2R7FA 2UXNA 1Y0NA 2X6YA 3JRHA 1LEAA 2QUFA 2VKDA 5HVQC 2CWEA 4ON0A 2JPBA 1IO2A 3GO5A 4FX0A 4HX8A 2FBIA 3CO7C 2RREA 4E4HA 3W6KB 4CH7A 4NC7A 1OFCX 3O8HA 1UMQA 1UHMA 2ME0A 5FFZA 2ECCA 3BQZA 4I6ZA 1YE9A 2EA2A 2VE9A 2FEZA 2FBHA 1T95A 2DU9A 4JYKA 4N0BA 1K83J 1ZRCA 1UG2A 4KMFA 3TO6A 2F5FA 1SFKA 3COAC 1IN6A 2NVTJ 2R7VA 1WKMA 2DO7A 1L0OC 2D2WA 2HGCA 2E35A 2RDPA 5B1AH 2E1CA 2CQXA 4IHTA 3U1DA 5DM7F 2E7XA 3GTLJ 3H5AA 3HTSB 1RIOH 2XGEA 1KZHA 2X6XA 1WJDA 1QBJA 1JHHA 3JRAA 4KISA 2VIXA 5E3NA 3FXLA 2XV4S 2MW8A 2YU3A 3TKYA 1FYKA 3RKYA 1BM9A 3IRQA 1HXDA 2FMLA 4BXFA 3GLLA 3ABUA 2ELKA 3JRFA 3DKWA 5DD4A 1OR7A 1SFEA 2DFIA 3IAM2 3HOTA 2CH0A 1H89C 4PCQA 3BTJA 4AIHA 2Y9YA 1IJWC 4U0VA 1LE8B 1GV2A 3H9GA 2WV1A 3M3YJ 1GXPA 2QQ9A 2M0MA 1JT0A 3LMMA 1O3RA 2Y30A 1LQ1A 4UUVA 1E2XA 2LTPA 1OCCH 1PDNC 2ISZA 2VBYA 4CCOA 4KUMA 3IRRA 4L18B 4XRFA 5JHUA 4XMYA 4EATA 1YJNI 1I6HJ 2ZFWA 3CDLA 2R93J 5DUKA 5M5XJ 1FYLA 2CRGA 2RGVA 2ADUA 1IN4A 2LBFA 4I98B 3EUHA 2HOEA 3OYHA 4E7HA 2BY3A 3OYEA 4BDYA 4RAZA 4HV5A 3P9IA 5E8IA 2VBZA 4BACA 2JZYA 2M87A 4CA0A 4UV9A 2IRFG 4G6DA 3MQ0A 4HSTA 3HKZN 4BL0B 2IGOA 4D7NA 4LOCA 2E71A 2VT2A 1YLFA 1P4WA 2HYFA 1QZEA 2FE3A 4HX4A 3QWLA 3V7CA 3PQKA 4C3JJ 2MG4A 4OMYA 2E2IJ 2HQRA 3CMEI 2A6EF 2QM3A 2X4HA 5HNHA 2FQ4A 4PJJA 2ECBA 2EIMH 2B0LA 3BZKA 6PAXA 3IUOA 4ZC3A 1MDMA 4R79A 4XSXF 4OIRF 4CCJA 1HC8A 2FOKA 3E7LA 4BE2A 2PJRA 4X0GA 3E0JB 2UXXA 4B3AA 2H8WA 1RKTA 3C2GA 1E3HA 1W7PB 2M4GA 5KAIC 3HG9A 2VQGA 3M8EA 3HOXJ 4A12A 2N8GA 2CFXA 4OIOF 2I8DA 2HOAA 3FXUA 2X1CA 2JRMA 1YO5C 4U0WA 4RB0A 1T56A 4ABZA 3SFIA 4OAYA 5B3SH 4UUSB 1JGSA 2XHKA 2Y75A 1U5TC 3CUQB 2HDCA 4XLFA 1P6RA 3IH2A 3G1LA 4MLOA 4PJNA 1LVAA 5FKNA 1FPQA 3OYFA 1OLTA 3TQNA 2ZO4A 5CVRA 5BMZA 1YW8A 2V1DA 3KYCB 3I59B 3HUGB 3P9KA 5EJCA 2E34A 2R7SA 4A93J 2XUBA 3SXYA 2JN6A 4M3DA 3CDHA 4I01A 3MZYA 2ZMEA 1HOMA 1P4XA 4S05A 2WAEA 4LG3A 3R4KA 3GVAA 4A3IJ 2DFEA 4RAYA 3QPTA 2M9HA 1QZYA 5L3FA 3O6BB 3JAMK 2A6HF 4MFEA 3L2QA 3QOPA 2GLOA 2EILH 4D7MA 4CO8A 3BWGA 1YG2A 2VQHA 3VYTB 2JT1A 1RESA 4XIDA 2R0QC 3CZ6A 4AWXB 1ZK8A 2K3PA 1MMDA 2FSWA 2P7VB 4EJOA 1IV8A 2XDVA 1T2KA 5TRDA 1ACIA 1PP7U 4G9YA 1BW5A 2MD5A 3BLYA 3RKWA 3PIOF 2OCCH 3TDUC 4YFKF 3ZQFA 2M2EA 1D3YA 3K6GA 5ICGA 3JRBA 5IYDJ 1XMXA 2QSHX 3B6AA 1W5TA 1IRFA 2ZB9A 1ORKA 1SFUA 2W25A 2DAOA 2RAEA 4PK4A 4A0YA 4IHXA 3TO9A 2R4GA 2EFPA 3DFGA 5L3DA 2K9QA 4XLNF 3A03A 1KGSA 1AU7A 2H94A 1X3ZB 2W7NA 3G71I 1Z1DA 4A5MA 1ZGWA 1IRGA 2Y48A 3ABLH 2WTEA 3CMMA 3H5RA 4XRMA 3AAFA 4XK4A 3EQLF 3R61A 1DUXC 3B73A 4RB2C 4NDLA 1YX5A 1VQLI 2CQQA 3CO6C 4ENNA 2L7ZA 3F8MA 3BG5A 1S29A 3K7AJ 3T0YA 3R0JA 1V54H 4BE1A 2XIGA 2X48A 1USSA 4AVZA 2BE5F 3OYGA 4WXHA 3GBGA 1ZREA 4HF1A 3DBLB 3LSMA 3QYEA 2Y31A 4OAZA 1JJ8C 3J80K 3GTMJ 3OOUA 3TEDA 3HPGA 3QRFF 1T8IA 5B1BH 2BY1A 2HOSA 1ZTRA 3JW4A 3MN2A 2FRHA 2VN2A 4Q47A 3T1BA 1VQMI 1ZHFA 1P7JA 4UUTA 5HLTA 2D5VA 4XOPA 2BEOA 3JTHA 3KFWX 5HOOA 3CESA 1TW2A 5K7ZA 4KN7X 1A5JA 2JJ7A 3MZHA 4FE4A 2XPWA 3KP3A 3BR3A 5EG0A 4Y33A 2NOJB 1YHQI 1YQAA 4ESBA 1WJBA 5D5VB 1S5LC 3ASOH 4XNFA 2H1KA 2DMUA 4HPQA 5KHDA 4KIFA 2PX9A 4PGHA 4DJAA 3GF2A 4F3QA 1HKSA 3HOWJ 2ISYA 2KT0A 2ID3A 2A3SA 4MTEA 4G7ZF 3WU0A 4HNTA 1ETOA 3BC8A 5JI6A 1IXCA 1N75A 4EQQA 3CDIA 2AXLA 1VF9A 4HQEA 1LEBA 4LD5A 3IL2A 1WJFA 3L2VA 4BE0A 3GUDA 3CCQI 1CQTA 2X6WA 5DV5A 4KJZA 3LA2A 1T0FC 1IN7A 1WHUA 3A0HC 4MEYF 2TCTA 2YPRA 4MNUA 4NC6A 1O7LA 3VOEA 4Z2YA 1ODDA 2HZTA 2O0YA 3FWEA 2P4WA 5TJJA 2A6TA 1EJ9A 2AQFA 5J40A 5KCMA 2A5WA 3CTAA 2DN0A 1JUSA 1QQIA 3QU3A 5CVJA 5E3LA 3DTEA 2DA5A 1PYVA 2WAQA 4KMUX 5E1WA 1Z6TA 1R1VA 2EQRA 2Z2SB 2NVXJ 1XMAA 4BUPA 4XKBA 2ZKZA 5GP9A 2YS9A 3GCMA 1MBJA 4EEFG 3ZMTA 5BPDA 2UV1A 3K70D 2R7RA 2TDXA 1IAWA 3HB9A 5F0HA 2HFHA 2R7UA 1FTTA 5K7HA 1TW3A 4GO1A 2L4AA 4QPQA 2LKPA 2V6CA 3AFHA 1UHWA 1Y1WJ 1WCMJ 3FK7A 2VASA 4PJLA 1U8RA 3OR1C 4OWRB 1HSTA 3BOQA 3K1NA 1JKOC 4BDZA 1MJAA 3BG7A 4M9ZA 2X51A 3P5JA 3T5XA 3OYBA 1MMNA 4ZDOA 3ZR8X 4BQNA 2DT5A 5K1YA 3OYNA 1XTAA 1IC8A 1G3TA 1W36C 2R5YA 1K7AA 1JKRC 4I02A 5FRNA 3ONQA 4UNOA 2F6CA 2K86A 3EPZA 3KETA 3OS2A 3S2HJ 2M8GX 2HTJA 3GFIA 2Z99A 4O6JA 3F6OA 1X3UA 1ZAOA 2CQKA 4UVBA 3DTKA 1YIOA 5ICFA 3EYIA 3ZMUA 2O8XA 5FD6A 4CCNA 4A3FJ 3RZDJ 3BZCA 5M5YJ 1OPCA 3S1NJ 2OU2A 2KRFA 2RN7A 4HAMA 1N78A 1SD7A 5HLGA 4ESJA 1Z77A 2CW8A 3E3VA 2KZGA 2L4MA 2VI6A 1YS6A 2KJBA 3MKLA 1WI3A 2NXNB 3M8JA 3PJRA 4FT8A 3QPLA 3FM3A 1ETKA 3SDGA 1S7OA 1J59A 1W5CC 2KPMA 4QSHA 1SVOA 5EYRA 5J1UA 3LFKA 1R5GA 2VC1A 5A2QK 4S04A 3S3NA 1SAUA 2B9SA 2QF7A 2WY8Q 2ZJPF 2HXOA 3M9AA 1HBXG 1BOAA 1Z21A 4F7ZA 2HDDA 3QYBA 5C4JJ 4I2OA 3CCYA 2M34A 4ZYDA 1BA5A 4WXDA 3ZN0A 1MBKA 1YI2I 1MDMB 4BHPA 3PNTA 3S3MA 1XX5A 3WGIA 2R7DA 2KIQA 1YW7A 1R1TA 3C3WA 2PJRB 2KMUA 2A69F 2HI3A 4Y15A 4CCLA 1FLIA 2VXZA 5L3GA 1MIJA 1LJ9A 2EV5A 4RM3A 3PM1A 2LKSA 3Q3SA 3SZGA 4UXNA 1STZA 4HG2A 1VQ4I 3DF8A 2LR8A 2FX0A 3F8FA 1TBXA 5CVUA 4XKCA 2BXYA 2K40A 2DA6A 4L0ZB 1LDJA 3A4CA 3E6MA 2O61A 2FOWA 3Q9VA 3MKZA 1XSDA 3BZ6A 2CW0F 4LB6B 1Z91A 4ENKA 3HKZA 4BU2A 1OKRA 2DLLA 3N97A 5BOXA 4EGZA 2AS5F 3DWLE 3MD2A 1KYWA 2EIKH 1MKMA 4HYEA 3CJNA 4NB5A 2CQ7A 2QYOA 4BNCA 2ZMEB 1XDSA 3D0SA 2OAZA 4PJ0C 2FF4A 4Z6YA 2HU9A 2QCOA 4XR6A 3J7AO 1HSJA 3SEQA 2MFZA 3BDDA 3MCZA 3L2WA 3HOUJ 3MMYB 2EWNA 2UUZA 1FOYA 4HLYA 1DGRM 4C3HJ 4M9XA 1U3EM 2WWYA 4A6DA 1TQPA 1OCPA 2JK3A 3PL8A 3E97A 3G4SI 1L3LA 4UY8I 2CGPA 1XCBA 5LFAA 4P1WA 5DCMA 1T98A 4ZTJA 3GMEA 1HW2A 1DU0A 1I3AA 4XLPF 1DU6A 1USTA 1K6YA 3ISPA 1JTYA 1QVUA 2P6SA 3S1RJ 2LFBA 4XLAA 2GM4A 2QQBA 2QWWA 3WTSC 1TNTA 1FBUA 2Y0SN 1J5YA 2FNPA 1MNEA 3JR9A 3FBIB 1HF0A 4BBSJ 1JJ6C 2C6YA 1BW6A 2EV0A 2Y69H 4WF2A 4S0HB 4MQVA 4C30A 1WI9A 2CV2A 4HEA2 2F4MB 3KEYA 4NBQA 3L1PA 2KRHA 1GV5A 2MLGA 1JI8A 1IV6A 1FYMA 2YX7A 3KZYA 2XAGA 3LQRA 2FBKA 3LAJA 2L9RA 4E7IA 2NNYA 4CSWA 2K4JA 2K9SA 3F8NA 3HM5A 3O3KA 4BQQA 2I5UA 3AG4H 2XAUA 1LKXA 2IGMA 2P81A 2VKVA 5J8CA 5AIPA 5IT9Z 1A6IA 2O8KA 2B63J 1O3QA 5C44J 4IJAA 3H0DA 1SFXA 1KYZA 2BVLA 4E6KG 4BQOA 3D5SC 4CHUA 3BROA 2LY9A 1FBQA 1K79A 2GA1A 2HQNA 3F21A 1O3TA 2K7LA 3P9CA 1IDZA 1FIPA 2G7HA 5JVGF 3ZXSA 4A3KJ 2IA1A 1I27A 4J01A 1BN5A 2XPVA 3U21A 3BT9A 1H88C 4LG0A 1ON1A 2IJLA 4BGDA 2QBYA 5J6XA 4D0PA 1MMSA 2NVQJ 1H0MA 4L5JA 1R00A 5K5OA 2M1BA 3EUKL 5EG0B 5FB2A 5BNGA 3TDZC 1O3SA 3NAUA 3V4GA 3GZ6A 2LG4A 1D1CA 2LYCA 1TT0A 3CF5F 2XASA 2YSRA 3GW2A 1D1BA 3L2RA 2AQEA 4C3IJ 1R4NB 2H09A 3GZNB 3HSRA 2EIJH 1UZCA 1KQ9A 2M0CA 2DA4A 2MA3A 1YYVA 2LD5A 1E0EA 1BJZA 2JA5J 1HDDC 2ZJRF 1S3JA 4IPAA 5CQGA 3E5UA 3SJMA 5CKTA 4UV8A 1O7FA 2K02A 5DD8A 2DPDA 3RZOJ 5CPRB 2LOOA 5IP7J 3IC7A 3J81K 1I1GA 5IOZA 3C18A 2HQ5A 2DA3A 2NYXA 3CUOA 3PUFA 4IQ4A 1IG7A 4Q48A 2FU4A 4IXAA 5J8FA 5B66C 2IS6A 2NS8A 5D5WB 2NVUB 1RPWA 2MGQA 2O7OA 2ZJQF 2G0EA 3VYSB 3ASNH 2L7KA 4G8XA 4LMYA 2F4IA 1RETA 3HTUA 1U5TA 2QGUA 1HDPA 5DEQA 1A36A 4BY7J 2IXSA 2VJJA 2VBWA 4HW0A 4M73A 1X3WB 3HOSA 3RTRA 5ICCA 3G6EI 1OYWA 3KIOA 4AIJA 3HOZJ 2H6CA 2VKHA 5FLMJ 5FD5A 5HDGA 1UFMA 2JA2A 2L7MP 3S2WA 2HOTA 4P96A 1SANA 2XAQA 3W6VA 5EEAA 3BR0A 2GOMA
chains in the Genus database with same CATH topology
5DYMA 2IP2A 3IHUA 5IT3A 2JRTA 1EV7A 4L0YB 4WXCA 4AVPA 2NAZA 4ETSA 4WX9A 3BPXA 3JSOA 4EJTA 1ZG5A 2KIMA 1R23A 4O3MA 1V4RA 3R60A 2FXAA 2OZ6A 4A6EA 2MBFA 3R0AA 3RYRA 2EFQA 1W5SA 4KT5C 1WWXA 3SZPA 1FNNA 1BBYA 3RYPA 2LF7A 3E6CC 3PFIA 2OQGA 3HRMA 1P92A 3WG9A 3KE2A 1R5HA 4RB3C 1LDDA 2WV0A 1ZGJA 4HLXA 5FLXK 2RV8A 5E1XA 3WTWC 3GX4X 2DQRA 1XD7A 4XSZF 3FZVA 3FMSA 3G3ZA 3Q9SA 5L3CA 2Z3YA 2JTVA 3RI4A 1DPUA 4A2UA 5LBQA 2X0LA 1MJBA 5LLQA 1TLHB 2Q8KA 3FXQA 2GZWA 3IKVA 5BPIA 1GHCA 1ZGAA 3TOBA 2HR3A 1ZLKA 4HDUA 5D6FA 2DK8A 2O03A 3SZTA 1OYIA 4M72A 2QLZA 1I1SA 1XMKA 3HRSA 3LWFA 4CICA 2FNAA 4L9JA 1R36A 3HRTA 2QQAA 2FMYA 4IF4A 2PMHA 3ZMZA 2COMA 3FMQA 1BC7C 1ZRFA 1KU7A 5DCMB 1ZG3A 2EV6A 3RPUA 3F8BA 2EB7A 2Y0MA 1UCRA 5EEHA 4RB1A 5JVTA 4GYIA 2XRNA 4EM1A 4QWQA 1QNTA 5EEGA 2BV6A 2NNNA 5BQTA 1S7AA 5H6QA 2V1UA 1ZN2A 5DUIA 1ULYA 3ECHA 2DW4A 5K5RA 5LRSA 2DBBA 2VONA 1AWCA 5D4SA 3HRUA 5HS7A 3C7JA 1F4KA 2O3FA 2ZXJA 5BS6A 2DQLA 2LF8A 3R6SA 2BYVE 3L00A 5H6RA 4A0ZA 1OMIA 1ZARA 4HF0A 5AIQA 3K1PA 1I5ZA 3KP4A 3C1DA 3WTZA 4LG0B 1D8KA 2QBYB 1KA8A 2M30A 1FBSA 1XGMA 3GFJA 3KP2A 3MFKA 4Y17A 1XCVA 5F1RA 1RUNA 3RPQA 1Z6RA 2ESNA 1B4AA 3VODA 2Z9OA 2R3SA 3QU6A 4YFNF 1ZYRF 3DV8A 3I71A 4ENJA 2H27A 5ILUA 3D5LA 5LGNA 2PFBA 3KEOA 4KDPA 1RZ4A 3O2PE 5ED4A 2F5DA 2W85A 2FQ3A 3J80Z 1U5TB 3I4PA 3L7WA 1JHFA 3ZPLA 4MTDA 2LSOA 3REOA 1T39A 4HBLA 4EJWA 2A07F 3Q5FA 2LNBA 2STTA 3RJPA 1FSEA 1BI2A 1HKQA 5LHHA 2P7CB 2OA4A 2XAJA 2P5LC 1P2FA 1XDUA 3KZZA 4N9HA 3VFZA 1CF7A 4RGXA 2W24A 4RGUA 1W4MA 3FXRA 3NRVA 2RQPA 1RNLA 3HSEA 3ZN1A 2PEXA 4UVCA 2RNJA 4IRGA 1G3YA 3EDPA 2ZCWA 1SD5A 2W57A 2VODA 2CG4A 2OZUA 4RS8A 5HLHA 2V79A 1S8NA 1QZZA 4EM2A 1U2WA 1J75A 2LDUA 1HQCA 4KN4X 2VOOA 2Q2EA 4G7HF 3DPTA 5K5QA 3FF5A 3ROUA 3F3XA 2UWMA 5DDGA 2HEOA 4B09A 4CXFA 1MGTA 4OU0A 4ENMA 3RKXA 4ZZLA 2F5EA 2XAFA 3SHFA 3GFLA 1ON2A 4HDVA 2STWA 1J7KA 2YX4A 2XAHA 4OIQF 2VT3A 3WGHA 1TNSA 4HQMA 1WRJA 3BY6A 2WC2A 2W84A 3GWZA 4YIFA 1HW5A 3K2ZA 4OOIA 5FFXA 4P9UA 2VE8A 3EETA 4CYDA 4KIBA 3W6JB 2ELHA 4OMZA 4CDGA 2F5CA 5E20A 5LRRA 1C0WA 1TQIA 3WODF 3FM5A 3K69A 2ZNZA 1B6AA 3MAJA 1T6SA 1K78A 1MJ9A 2EFWA 2GA2A 3F8CA 3K1MA 1PUEE 3H3UA 3M8FA 1JE8A 5D8KB 3CUQC 3U9GA 1R58A 1BIBA 1TQMA 4MGRA 1P4AA 3HHGA 1BC8C 1DDNA 2JSCA 2KKOA 5D5XB 2M45A 4EJUA 1IN8A 3OOPA 4U88A 3F22A 2HKXA 2PN6A 4BHBA 2VC0A 4K2EA 3T8RA 3HIFA 2ZNYA 1BI0A 1YFHA 4ZH4F 2PJPA 1Y0UA 2E1NA 4LLGF 3WTYC 2MH2A 2JPCA 3TOAA 1SAXA 1H9TA 4I0AA 1KQ0A 4P5OA 5AONA 4ZYEA 4LB5A 5L3BA 2OD5A 3WTUC 4MHGA 3N4MA 2KJCA 5LGTA 2MLKA 3DPLC 4ZYHA 1IW7F 4EM0B 3M1EA 1RI7A 1T38A 1IF1A 2O6GE 3BP8A 5F6FA 3I0TA 1KQ8A 1TTYA 3QPHA 5H20A 3RIRA 5HDNA 4IVNA 1YTYA 4RGRA 2PI0A 3ML6A 1FP2A 2K4BA 4BHCA 1DPRA 2J5OA 3QP5A 1R1UA 5JR3A 1XGSA 1BJAA 1RUOA 5D5UB 3G73A 3GFMA 2GAUA 4G7OF 1D5VA 1SD4A 4P55A 4HV6A 3L9FA 1KU3A 3LA7A 3QP6A 3HSFA 2XKPA 4OIPF 1HW1A 1XSVA 4ZZDA 3V7SA 2J5PA 1YW9A 3ZMDA 4G6QA 1BI1A 2DTRA 2MC3A 4PZJA 2EA4A 1I6XA 2IA0A 1ONVA 3NEUA 3KLOA 2RC4A 3H3ZA 2G7UA 1Z7UA 3DXJF 1UB9A 4BH9A 4AIKA 1A04A 4A5NA 3ELKA 5LEKA 3TGNA 3WU1B 2L02A 5E8GA 1PP8F 1F5TA 4GGGA 4L5IA 1DP7P 4M6YA 1SD6A 4A0XA 2E7WA 3F23A 1CF7B 2VOPA 3J81Z 1IXSB 4L9NA 5E1ZB 1FX7A 1ZRDA 3BJOA 3IKTA 1REPC 4CZZA 1J2XA 2H6BA 4IHSA 2D1HA 1J9IA 4GCVA 4MQ9F 1BIAA 5D8LB 3E5QA 2G9WA 4WK8F 4KYWA 1G6NA 1QGPA 4I0BA 3ZQ7A 3ECOA 2HS5A 3U2RA 1B1BA 1K6OA 1XN7A 5E17F 1SMTA 4R8HA 3VEPA 5LEJA 2IW5A 4HA8A 3I54A 2D1VA 2MH9A 3I5UA 4G94A 2QZ8A 4HZFA 1BI3A 4KIGA 3H92A 4DQ2A 5D4RA 4JK1X 4I7HA 5CVIA 5CLSA 5ILSA 2IVMA 4DNCA 4M74A 2PQ8A 3ERED 2XROA 1XSXA 3GXOA 2CSOA 4KNYA 1T0FA 4E70A 1SMYF 4KICA 5ICEA 3WE2A 5FLXZ 1AOYA 2M8EA 5LHGA 4EJVA 3DEUA 2D45A 4BQAA 3E5XA 1LDKB 2XVCA 4Q5SF 1K78B 3L2CA 4GYGA 2FA5A 3DP7A 5HLIA 1QO0D 4EGYA 1FWZA 4PGGA 3FX3A 3TO7A 1U6GA 3DQVC 4YIIA 2Z33A 1GVJA 3NQOA 4GXOA 4JQFA 2L01A 3KP7A 3ABTA 1D8JA 1MZBA 4NQWA 1FC3A 3WTXC 3JAMZ 1S6LA 2RKHA 1B9MA 5HS8A 4WWCA 4EV0A 2BGCA 3V7RA 1IN5A 2PG4A 4R1HA 3MEXA 5CVVA 2PBIA 3FMRA 4LK0F 2ESHA 3T8TA 2L54A 1XGOA 2P6TA 4LLNA 2PLYA 4XBFA 1Q1HA 3KP6A 1EH7A 1Z9CA 3E6DA 4WCGA 3L09A 3JTGA 5KVRA 1NHAA 5LHIA 3ZMSA 1FOKA 3I64A 3LQQA 4LLLA 4B8XA 3KP5A 3SQNA 1J0RA 5KK1A 2HTSA 3V8LA 1E17A 2P5VA 4NHJA 2QVOA 1KU9A 3I58A 4OINF 3K0LA 1GXQA 4M6XA 2ZBKA 1ZH5A 2DI3A 4FHTA 2A61A 4IRIA 2YR2A 2UZKA 3ZMVA 2NS0A 3B02A 1IXRC 3V8JA 2P5KA 1XB4A 2RVCA 3ZP5A 2NRAC 1F9NA 3MWMA 3GZ5A 4N9IA 4KFCA 4YFXF 2ZJ2A 3JSPA 4PDKA 5FO5A 3GEZA 2VBXA 1CGPA 3KCCA 1F1ZA 2ETHA 3M7GA 3VB2A 5HDKA 1JXSA 4KA4A 4LFUA 4UVAA 2GXBA 4FX4A 1FT9A 3IWZA 1FP1D 3HYIA 3IWFA 4ESFA 3PQJA 4P9FA 1W7PA 1VTNC 1G4DA 4I09A 1U78A 2EK5A 5ERIA 4LK1F 4EVIA 4YG2F 3OV8A 5L3EA 5LGUA 1QPMA 1KU2A 5ILVA 2KIFA 3FHZA 3CUQA 3F72A 4TV7A 2HKOA 4LJZF 1WSUA 3HHHA 1FZPB 2IA2A 4JBAA 2F2EA 1LNWA 3LAPA 4BYYA 2IT0A 3I59A 3WGGA 1V3FA 1ZLJA 3HUGA 1WQ2A 4LGWA 3V8KA 3ULQB 5DCFA 3GLXA 4AD9A 3WTVC 2HWVA 3CLOA 1R22A 3K9TA 2V1XA 4U7BA 4U0YA 1Z05A 3BJ6A 4H0EA 5IT9K 1LB2A 2K27A 4MEXF 3LSTA 4QLCU 4Q4ZF 4M9SA 4IRHA 1IZ1A 5CJ9A 2PMUA 1EH8A 2GQQA 4HF2A 2HYGD 5A2QZ 3BJAA 3I53A 5E18F 4UHTA 1MD0A 2OBPA 2GWRA 1W7PD 2EFOA 4M71A 2KIUA 1R7JA 4BAYA 2ACJA 4L9TA 2L3DA 4Y13A 4BXUA 5JFRA 3F6VA 1B59A 5CYVA 2XGXA 1OYYA 2DPUA 2GXGA 3GYHX 3WE3A 2EJRA 4RGSA 2V9VA 1O57A 1ZG1A 3KEQA 1G3WA 4U7DA 5FGMA 1HKTA 3QAHA 4HOBA 2XKOA 4HX7A 1G3SA 2Z5UA 3RDIA 2CO5A 1FY7A 2A68F 2BBYA 1XGNA 2A5YB 1YS7A 3P7NA 2IPQX 2CYYA 1H9GA 3LA3A 1FSHA 2P8TA 3E6BA 4O5VA 5F64A 3KLNA 2Q0OA 2DK5A 1IUYA 4L9VA 3EYYA 2QENA 5HS9A 2EFNA 1EH6A 3BPVA 3SFZA 2M5WA 1B9NA 4ZYGA 3WTTC 2OQRA 5D6EA 4ASNA 2GIVA 2R7FA 2UXNA 1LEAA 2QUFA 5HVQC 2CWEA 4ON0A 2JPBA 3GO5A 4FX0A 4HX8A 2FBIA 3CO7C 3W6KB 1UHMA 5FFZA 2EA2A 2VE9A 2FEZA 2FBHA 2DU9A 4N0BA 1ZRCA 4KMFA 3TO6A 2F5FA 3COAC 1IN6A 1WKMA 2DO7A 1L0OC 2D2WA 2HGCA 2E1CA 2RDPA 4IHTA 3U1DA 2E7XA 3HTSB 1RIOH 1QBJA 1JHHA 2XV4S 2YU3A 3TKYA 1FYKA 3RKYA 1BM9A 3IRQA 1HXDA 2FMLA 3ABUA 3DKWA 5DD4A 1OR7A 1SFEA 2DFIA 3HOTA 4PCQA 4AIHA 4U0VA 1GXPA 2QQ9A 1O3RA 1LQ1A 4UUVA 1E2XA 1PDNC 2ISZA 2VBYA 4KUMA 3IRRA 4L18B 4XRFA 5JHUA 2ZFWA 5DUKA 1FYLA 2RGVA 2ADUA 1IN4A 4I98B 3EUHA 2HOEA 4RAZA 4HV5A 3P9IA 5E8IA 2VBZA 2JZYA 2M87A 2IRFG 4UV9A 4G6DA 3MQ0A 2VT2A 1YLFA 1P4WA 2HYFA 2FE3A 4HX4A 3V7CA 3PQKA 4OMYA 2HQRA 2A6EF 2QM3A 2X4HA 2B0LA 6PAXA 1MDMA 4R79A 4XSXF 4OIRF 2FOKA 2UXXA 1W7PB 3M8EA 4A12A 2CFXA 4OIOF 3FXUA 1YO5C 4U0WA 4RB0A 1JGSA 2XHKA 2Y75A 1U5TC 3CUQB 2HDCA 1P6RA 1LVAA 1FPQA 3TQNA 2ZO4A 5CVRA 5BMZA 1YW8A 2V1DA 3I59B 3P9KA 2XUBA 3SXYA 3CDHA 4I01A 3MZYA 2ZMEA 1P4XA 4S05A 3R4KA 3GVAA 4RAYA 3QPTA 1QZYA 5L3FA 3O6BB 3JAMK 2A6HF 3QOPA 4CO8A 3BWGA 1YG2A 2JT1A 4AWXB 2FSWA 2P7VB 4EJOA 1T2KA 5TRDA 1PP7U 4G9YA 2MD5A 3RKWA 3TDUC 4YFKF 5ICGA 1D3YA 1W5TA 1IRFA 1SFUA 2W25A 2DAOA 4A0YA 3TO9A 2EFPA 3DFGA 5L3DA 4XLNF 1KGSA 2H94A 1Z1DA 4A5MA 1IRGA 2Y48A 2WTEA 3AAFA 3EQLF 3R61A 1DUXC 3B73A 4RB2C 3CO6C 4ENNA 3F8MA 1S29A 3T0YA 3R0JA 2XIGA 1USSA 2BE5F 4WXHA 1ZREA 4HF1A 3J80K 3QRFF 3JW4A 3T1BA 2FRHA 2VN2A 4Q47A 1ZHFA 2BEOA 3JTHA 3KFWX 5HOOA 1TW2A 4KN7X 3MZHA 3KP3A 1YQAA 4ESBA 5D5VB 4KIFA 4PGHA 3GF2A 1HKSA 2ISYA 2A3SA 4MTEA 4G7ZF 3WU0A 5JI6A 1IXCA 4EQQA 2AXLA 4HQEA 1LEBA 4LD5A 3IL2A 3GUDA 5DV5A 3LA2A 1IN7A 4MEYF 2YPRA 4MNUA 1O7LA 3VOEA 4Z2YA 1ODDA 2HZTA 2O0YA 3FWEA 2P4WA 5TJJA 3CTAA 1QQIA 3QU3A 5CVJA 5E1WA 4KMUX 1Z6TA 1R1VA 1XMAA 2ZKZA 5BPDA 3ZMTA 2TDXA 1IAWA 2HFHA 1TW3A 4GO1A 2L4AA 2LKPA 2V6CA 1UHWA 1U8RA 1HSTA 3BOQA 3K1NA 1MJAA 4M9ZA 3T5XA 5K1YA 2DT5A 1G3TA 1K7AA 4I02A 4UNOA 2K86A 3KETA 2HTJA 3GFIA 2Z99A 4O6JA 3F6OA 1X3UA 1ZAOA 2CQKA 4UVBA 5ICFA 1YIOA 3EYIA 3ZMUA 2O8XA 5FD6A 1OPCA 2OU2A 2KRFA 2RN7A 4HAMA 1SD7A 5HLGA 4ESJA 3E3VA 2L4MA 1YS6A 2KJBA 4FT8A 3FM3A 1S7OA 1J59A 3LFKA 1R5GA 2VC1A 5A2QK 4S04A 3M9AA 1HBXG 1BOAA 4F7ZA 4I2OA 4ZYDA 4WXDA 3ZN0A 1MDMB 4BHPA 3WGIA 2R7DA 1YW7A 1R1TA 3C3WA 2A69F 4Y15A 1FLIA 2VXZA 5L3GA 1LJ9A 2EV5A 4UXNA 1STZA 3DF8A 3F8FA 1TBXA 5CVUA 4L0ZB 1LDJA 3E6MA 2O61A 3Q9VA 1XSDA 3BZ6A 2CW0F 4LB6B 1Z91A 4ENKA 2DLLA 1OKRA 3N97A 5BOXA 4EGZA 2AS5F 1KYWA 1MKMA 4HYEA 3CJNA 4NB5A 2QYOA 4BNCA 2ZMEB 1XDSA 3D0SA 2OAZA 2FF4A 3J7AO 1HSJA 3BDDA 3MCZA 2EWNA 4HLYA 4M9XA 1U3EM 2WWYA 4A6DA 1TQPA 3E97A 1L3LA 2CGPA 1XCBA 5DCMA 1T98A 1HW2A 4XLPF 1USTA 3ISPA 2P6SA 2QQBA 2QWWA 3WTSC 1TNTA 1FBUA 1J5YA 2FNPA 2C6YA 2EV0A 4WF2A 4MQVA 1WI9A 2MLGA 1FYMA 2YX7A 3KZYA 2XAGA 3LQRA 2FBKA 3LAJA 2NNYA 2K4JA 3F8NA 3O3KA 5J8CA 5AIPA 5IT9Z 1O3QA 4IJAA 1SFXA 1KYZA 4CHUA 3BROA 1FBQA 1K79A 2GA1A 2HQNA 3F21A 1O3TA 2K7LA 3P9CA 2G7HA 2IA1A 1I27A 1BN5A 4LG0A 1ON1A 2IJLA 2QBYA 5J6XA 4D0PA 1H0MA 4L5JA 1R00A 5K5OA 2M1BA 5FB2A 3TDZC 1O3SA 3V4GA 3GZ6A 2XASA 2YSRA 3GW2A 2H09A 3HSRA 1KQ9A 2MA3A 1YYVA 1S3JA 4IPAA 3E5UA 4UV8A 1O7FA 2K02A 5DD8A 2DPDA 3IC7A 3J81K 1I1GA 3C18A 2NYXA 3CUOA 4Q48A 2FU4A 4IXAA 5J8FA 5D5WB 4G8XA 4LMYA 3HTUA 1U5TA 5DEQA 2VBWA 4HW0A 4M73A 3HOSA 3RTRA 5ICCA 1OYWA 4AIJA 2H6CA 5FD5A 5HDGA 1UFMA 3S2WA 4P96A 2XAQA 4CGZA 4EMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYM A;  2IP2 A;  3IHU A;  5IT3 A;  2JRT A;  1EV7 A;  4L0Y B;  4WXC A;  4AVP A;  2NAZ A;  4ETS A;  4WX9 A;  3BPX A;  3JSO A;  4EJT A;  1ZG5 A;  2KIM A;  1R23 A;  4O3M A;  1V4R A;  3R60 A;  2FXA A;  2OZ6 A;  4A6E A;  2MBF A;  3R0A A;  3RYR A;  2EFQ A;  1W5S A;  4KT5 C;  1WWX A;  3SZP A;  1FNN A;  1BBY A;  3RYP A;  2LF7 A;  3E6C C;  3PFI A;  2OQG A;  3HRM A;  1P92 A;  3WG9 A;  3KE2 A;  1R5H A;  4RB3 C;  1LDD A;  2WV0 A;  1ZGJ A;  4HLX A;  5FLX K;  2RV8 A;  5E1X A;  3WTW C;  3GX4 X;  2DQR A;  1XD7 A;  4XSZ F;  3FZV A;  3FMS A;  3G3Z A;  3Q9S A;  5L3C A;  2Z3Y A;  2JTV A;  3RI4 A;  1DPU A;  4A2U A;  5LBQ A;  2X0L A;  1MJB A;  5LLQ A;  1TLH B;  2Q8K A;  3FXQ A;  2GZW A;  3IKV A;  5BPI A;  1GHC A;  1ZGA A;  3TOB A;  2HR3 A;  1ZLK A;  4HDU A;  5D6F A;  2DK8 A;  2O03 A;  3SZT A;  1OYI A;  4M72 A;  2QLZ A;  1I1S A;  1XMK A;  3HRS A;  3LWF A;  4CIC A;  2FNA A;  4L9J A;  1R36 A;  3HRT A;  2QQA A;  2FMY A;  4IF4 A;  2PMH A;  3ZMZ A;  2COM A;  3FMQ A;  1BC7 C;  1ZRF A;  1KU7 A;  5DCM B;  1ZG3 A;  2EV6 A;  3RPU A;  3F8B A;  2EB7 A;  2Y0M A;  1UCR A;  5EEH A;  4RB1 A;  5JVT A;  4GYI A;  2XRN A;  4EM1 A;  4QWQ A;  1QNT A;  5EEG A;  2BV6 A;  2NNN A;  5BQT A;  1S7A A;  5H6Q A;  2V1U A;  1ZN2 A;  5DUI A;  1ULY A;  3ECH A;  2DW4 A;  5K5R A;  5LRS A;  2DBB A;  2VON A;  1AWC A;  5D4S A;  3HRU A;  5HS7 A;  3C7J A;  1F4K A;  2O3F A;  2ZXJ A;  5BS6 A;  2DQL A;  2LF8 A;  3R6S A;  2BYV E;  3L00 A;  5H6R A;  4A0Z A;  1OMI A;  1ZAR A;  4HF0 A;  5AIQ A;  3K1P A;  1I5Z A;  3KP4 A;  3C1D A;  3WTZ A;  4LG0 B;  1D8K A;  2QBY B;  1KA8 A;  2M30 A;  1FBS A;  1XGM A;  3GFJ A;  3KP2 A;  3MFK A;  4Y17 A;  1XCV A;  5F1R A;  1RUN A;  3RPQ A;  1Z6R A;  2ESN A;  1B4A A;  3VOD A;  2Z9O A;  2R3S A;  3QU6 A;  4YFN F;  1ZYR F;  3DV8 A;  3I71 A;  4ENJ A;  2H27 A;  5ILU A;  3D5L A;  5LGN A;  2PFB A;  3KEO A;  4KDP A;  1RZ4 A;  3O2P E;  5ED4 A;  2F5D A;  2W85 A;  2FQ3 A;  3J80 Z;  1U5T B;  3I4P A;  3L7W A;  1JHF A;  3ZPL A;  4MTD A;  2LSO A;  3REO A;  1T39 A;  4HBL A;  4EJW A;  2A07 F;  3Q5F A;  2LNB A;  2STT A;  3RJP A;  1FSE A;  1BI2 A;  1HKQ A;  5LHH A;  2P7C B;  2OA4 A;  2XAJ A;  2P5L C;  1P2F A;  1XDU A;  3KZZ A;  4N9H A;  3VFZ A;  1CF7 A;  4RGX A;  2W24 A;  4RGU A;  1W4M A;  3FXR A;  3NRV A;  2RQP A;  1RNL A;  3HSE A;  3ZN1 A;  2PEX A;  4UVC A;  2RNJ A;  4IRG A;  1G3Y A;  3EDP A;  2ZCW A;  1SD5 A;  2W57 A;  2VOD A;  2CG4 A;  2OZU A;  4RS8 A;  5HLH A;  2V79 A;  1S8N A;  1QZZ A;  4EM2 A;  1U2W A;  1J75 A;  2LDU A;  1HQC A;  4KN4 X;  2VOO A;  2Q2E A;  4G7H F;  3DPT A;  5K5Q A;  3FF5 A;  3ROU A;  3F3X A;  2UWM A;  5DDG A;  2HEO A;  4B09 A;  4CXF A;  1MGT A;  4OU0 A;  4ENM A;  3RKX A;  4ZZL A;  2F5E A;  2XAF A;  3SHF A;  3GFL A;  1ON2 A;  4HDV A;  2STW A;  1J7K A;  2YX4 A;  2XAH A;  4OIQ F;  2VT3 A;  3WGH A;  1TNS A;  4HQM A;  1WRJ A;  3BY6 A;  2WC2 A;  2W84 A;  3GWZ A;  4YIF A;  1HW5 A;  3K2Z A;  4OOI A;  5FFX A;  4P9U A;  2VE8 A;  3EET A;  4CYD A;  4KIB A;  3W6J B;  2ELH A;  4OMZ A;  4CDG A;  2F5C A;  5E20 A;  5LRR A;  1C0W A;  1TQI A;  3WOD F;  3FM5 A;  3K69 A;  2ZNZ A;  1B6A A;  3MAJ A;  1T6S A;  1K78 A;  1MJ9 A;  2EFW A;  2GA2 A;  3F8C A;  3K1M A;  1PUE E;  3H3U A;  3M8F A;  1JE8 A;  5D8K B;  3CUQ C;  3U9G A;  1R58 A;  1BIB A;  1TQM A;  4MGR A;  1P4A A;  3HHG A;  1BC8 C;  1DDN A;  2JSC A;  2KKO A;  5D5X B;  2M45 A;  4EJU A;  1IN8 A;  3OOP A;  4U88 A;  3F22 A;  2HKX A;  2PN6 A;  4BHB A;  2VC0 A;  4K2E A;  3T8R A;  3HIF A;  2ZNY A;  1BI0 A;  1YFH A;  4ZH4 F;  2PJP A;  1Y0U A;  2E1N A;  4LLG F;  3WTY C;  2MH2 A;  2JPC A;  3TOA A;  1SAX A;  1H9T A;  4I0A A;  1KQ0 A;  4P5O A;  5AON A;  4ZYE A;  4LB5 A;  5L3B A;  2OD5 A;  3WTU C;  4MHG A;  3N4M A;  2KJC A;  5LGT A;  2MLK A;  3DPL C;  4ZYH A;  1IW7 F;  4EM0 B;  3M1E A;  1RI7 A;  1T38 A;  1IF1 A;  2O6G E;  3BP8 A;  5F6F A;  3I0T A;  1KQ8 A;  1TTY A;  3QPH A;  5H20 A;  3RIR A;  5HDN A;  4IVN A;  1YTY A;  4RGR A;  2PI0 A;  3ML6 A;  1FP2 A;  2K4B A;  4BHC A;  1DPR A;  2J5O A;  3QP5 A;  1R1U A;  5JR3 A;  1XGS A;  1BJA A;  1RUO A;  5D5U B;  3G73 A;  3GFM A;  2GAU A;  4G7O F;  1D5V A;  1SD4 A;  4P55 A;  4HV6 A;  3L9F A;  1KU3 A;  3LA7 A;  3QP6 A;  3HSF A;  2XKP A;  4OIP F;  1HW1 A;  1XSV A;  4ZZD A;  3V7S A;  2J5P A;  1YW9 A;  3ZMD A;  4G6Q A;  1BI1 A;  2DTR A;  2MC3 A;  4PZJ A;  2EA4 A;  1I6X A;  2IA0 A;  1ONV A;  3NEU A;  3KLO A;  2RC4 A;  3H3Z A;  2G7U A;  1Z7U A;  3DXJ F;  1UB9 A;  4BH9 A;  4AIK A;  1A04 A;  4A5N A;  3ELK A;  5LEK A;  3TGN A;  3WU1 B;  2L02 A;  5E8G A;  1PP8 F;  1F5T A;  4GGG A;  4L5I A;  1DP7 P;  4M6Y A;  1SD6 A;  4A0X A;  2E7W A;  3F23 A;  1CF7 B;  2VOP A;  3J81 Z;  1IXS B;  4L9N A;  5E1Z B;  1FX7 A;  1ZRD A;  3BJO A;  3IKT A;  1REP C;  4CZZ A;  1J2X A;  2H6B A;  4IHS A;  2D1H A;  1J9I A;  4GCV A;  4MQ9 F;  1BIA A;  5D8L B;  3E5Q A;  2G9W A;  4WK8 F;  4KYW A;  1G6N A;  1QGP A;  4I0B A;  3ZQ7 A;  3ECO A;  2HS5 A;  3U2R A;  1B1B A;  1K6O A;  1XN7 A;  5E17 F;  1SMT A;  4R8H A;  3VEP A;  5LEJ A;  2IW5 A;  4HA8 A;  3I54 A;  2D1V A;  2MH9 A;  3I5U A;  4G94 A;  2QZ8 A;  4HZF A;  1BI3 A;  4KIG A;  3H92 A;  4DQ2 A;  5D4R A;  4JK1 X;  4I7H A;  5CVI A;  5CLS A;  5ILS A;  2IVM A;  4DNC A;  4M74 A;  2PQ8 A;  3ERE D;  2XRO A;  1XSX A;  3GXO A;  2CSO A;  4KNY A;  1T0F A;  4E70 A;  1SMY F;  4KIC A;  5ICE A;  3WE2 A;  5FLX Z;  1AOY A;  2M8E A;  5LHG A;  4EJV A;  3DEU A;  2D45 A;  4BQA A;  3E5X A;  1LDK B;  2XVC A;  4Q5S F;  1K78 B;  3L2C A;  4GYG A;  2FA5 A;  3DP7 A;  5HLI A;  1QO0 D;  4EGY A;  1FWZ A;  4PGG A;  3FX3 A;  3TO7 A;  1U6G A;  3DQV C;  4YII A;  2Z33 A;  1GVJ A;  3NQO A;  4GXO A;  4JQF A;  2L01 A;  3KP7 A;  3ABT A;  1D8J A;  1MZB A;  4NQW A;  1FC3 A;  3WTX C;  3JAM Z;  1S6L A;  2RKH A;  1B9M A;  5HS8 A;  4WWC A;  4EV0 A;  2BGC A;  3V7R A;  1IN5 A;  2PG4 A;  4R1H A;  3MEX A;  5CVV A;  2PBI A;  3FMR A;  4LK0 F;  2ESH A;  3T8T A;  2L54 A;  1XGO A;  2P6T A;  4LLN A;  2PLY A;  4XBF A;  1Q1H A;  3KP6 A;  1EH7 A;  1Z9C A;  3E6D A;  4WCG A;  3L09 A;  3JTG A;  5KVR A;  1NHA A;  5LHI A;  3ZMS A;  1FOK A;  3I64 A;  3LQQ A;  4LLL A;  4B8X A;  3KP5 A;  3SQN A;  1J0R A;  5KK1 A;  2HTS A;  3V8L A;  1E17 A;  2P5V A;  4NHJ A;  2QVO A;  1KU9 A;  3I58 A;  4OIN F;  3K0L A;  1GXQ A;  4M6X A;  2ZBK A;  1ZH5 A;  2DI3 A;  4FHT A;  2A61 A;  4IRI A;  2YR2 A;  2UZK A;  3ZMV A;  2NS0 A;  3B02 A;  1IXR C;  3V8J A;  2P5K A;  1XB4 A;  2RVC A;  3ZP5 A;  2NRA C;  1F9N A;  3MWM A;  3GZ5 A;  4N9I A;  4KFC A;  4YFX F;  2ZJ2 A;  3JSP A;  4PDK A;  5FO5 A;  3GEZ A;  2VBX A;  1CGP A;  3KCC A;  1F1Z A;  2ETH A;  3M7G A;  3VB2 A;  5HDK A;  1JXS A;  4KA4 A;  4LFU A;  4UVA A;  2GXB A;  4FX4 A;  1FT9 A;  3IWZ A;  1FP1 D;  3HYI A;  3IWF A;  4ESF A;  3PQJ A;  4P9F A;  1W7P A;  1VTN C;  1G4D A;  4I09 A;  1U78 A;  2EK5 A;  5ERI A;  4LK1 F;  4EVI A;  4YG2 F;  3OV8 A;  5L3E A;  5LGU A;  1QPM A;  1KU2 A;  5ILV A;  2KIF A;  3FHZ A;  3CUQ A;  3F72 A;  4TV7 A;  2HKO A;  4LJZ F;  1WSU A;  3HHH A;  1FZP B;  2IA2 A;  4JBA A;  2F2E A;  1LNW A;  3LAP A;  4BYY A;  2IT0 A;  3I59 A;  3WGG A;  1V3F A;  1ZLJ A;  3HUG A;  1WQ2 A;  4LGW A;  3V8K A;  3ULQ B;  5DCF A;  3GLX A;  4AD9 A;  3WTV C;  2HWV A;  3CLO A;  1R22 A;  3K9T A;  2V1X A;  4U7B A;  4U0Y A;  1Z05 A;  3BJ6 A;  4H0E A;  5IT9 K;  1LB2 A;  2K27 A;  4MEX F;  3LST A;  4QLC U;  4Q4Z F;  4M9S A;  4IRH A;  1IZ1 A;  5CJ9 A;  2PMU A;  1EH8 A;  2GQQ A;  4HF2 A;  2HYG D;  5A2Q Z;  3BJA A;  3I53 A;  5E18 F;  4UHT A;  1MD0 A;  2OBP A;  2GWR A;  1W7P D;  2EFO A;  4M71 A;  2KIU A;  1R7J A;  4BAY A;  2ACJ A;  4L9T A;  2L3D A;  4Y13 A;  4BXU A;  5JFR A;  3F6V A;  1B59 A;  5CYV A;  2XGX A;  1OYY A;  2DPU A;  2GXG A;  3GYH X;  3WE3 A;  2EJR A;  4RGS A;  2V9V A;  1O57 A;  1ZG1 A;  3KEQ A;  1G3W A;  4U7D A;  5FGM A;  1HKT A;  3QAH A;  4HOB A;  2XKO A;  4HX7 A;  1G3S A;  2Z5U A;  3RDI A;  2CO5 A;  1FY7 A;  2A68 F;  2BBY A;  1XGN A;  2A5Y B;  1YS7 A;  3P7N A;  2IPQ X;  2CYY A;  1H9G A;  3LA3 A;  1FSH A;  2P8T A;  3E6B A;  4O5V A;  5F64 A;  3KLN A;  2Q0O A;  2DK5 A;  1IUY A;  4L9V A;  3EYY A;  2QEN A;  5HS9 A;  2EFN A;  1EH6 A;  3BPV A;  3SFZ A;  2M5W A;  1B9N A;  4ZYG A;  3WTT C;  2OQR A;  5D6E A;  4ASN A;  2GIV A;  2R7F A;  2UXN A;  1LEA A;  2QUF A;  5HVQ C;  2CWE A;  4ON0 A;  2JPB A;  3GO5 A;  4FX0 A;  4HX8 A;  2FBI A;  3CO7 C;  3W6K B;  1UHM A;  5FFZ A;  2EA2 A;  2VE9 A;  2FEZ A;  2FBH A;  2DU9 A;  4N0B A;  1ZRC A;  4KMF A;  3TO6 A;  2F5F A;  3COA C;  1IN6 A;  1WKM A;  2DO7 A;  1L0O C;  2D2W A;  2HGC A;  2E1C A;  2RDP A;  4IHT A;  3U1D A;  2E7X A;  3HTS B;  1RIO H;  1QBJ A;  1JHH A;  2XV4 S;  2YU3 A;  3TKY A;  1FYK A;  3RKY A;  1BM9 A;  3IRQ A;  1HXD A;  2FML A;  3ABU A;  3DKW A;  5DD4 A;  1OR7 A;  1SFE A;  2DFI A;  3HOT A;  4PCQ A;  4AIH A;  4U0V A;  1GXP A;  2QQ9 A;  1O3R A;  1LQ1 A;  4UUV A;  1E2X A;  1PDN C;  2ISZ A;  2VBY A;  4KUM A;  3IRR A;  4L18 B;  4XRF A;  5JHU A;  2ZFW A;  5DUK A;  1FYL A;  2RGV A;  2ADU A;  1IN4 A;  4I98 B;  3EUH A;  2HOE A;  4RAZ A;  4HV5 A;  3P9I A;  5E8I A;  2VBZ A;  2JZY A;  2M87 A;  2IRF G;  4UV9 A;  4G6D A;  3MQ0 A;  2VT2 A;  1YLF A;  1P4W A;  2HYF A;  2FE3 A;  4HX4 A;  3V7C A;  3PQK A;  4OMY A;  2HQR A;  2A6E F;  2QM3 A;  2X4H A;  2B0L A;  6PAX A;  1MDM A;  4R79 A;  4XSX F;  4OIR F;  2FOK A;  2UXX A;  1W7P B;  3M8E A;  4A12 A;  2CFX A;  4OIO F;  3FXU A;  1YO5 C;  4U0W A;  4RB0 A;  1JGS A;  2XHK A;  2Y75 A;  1U5T C;  3CUQ B;  2HDC A;  1P6R A;  1LVA A;  1FPQ A;  3TQN A;  2ZO4 A;  5CVR A;  5BMZ A;  1YW8 A;  2V1D A;  3I59 B;  3P9K A;  2XUB A;  3SXY A;  3CDH A;  4I01 A;  3MZY A;  2ZME A;  1P4X A;  4S05 A;  3R4K A;  3GVA A;  4RAY A;  3QPT A;  1QZY A;  5L3F A;  3O6B B;  3JAM K;  2A6H F;  3QOP A;  4CO8 A;  3BWG A;  1YG2 A;  2JT1 A;  4AWX B;  2FSW A;  2P7V B;  4EJO A;  1T2K A;  5TRD A;  1PP7 U;  4G9Y A;  2MD5 A;  3RKW A;  3TDU C;  4YFK F;  5ICG A;  1D3Y A;  1W5T A;  1IRF A;  1SFU A;  2W25 A;  2DAO A;  4A0Y A;  3TO9 A;  2EFP A;  3DFG A;  5L3D A;  4XLN F;  1KGS A;  2H94 A;  1Z1D A;  4A5M A;  1IRG A;  2Y48 A;  2WTE A;  3AAF A;  3EQL F;  3R61 A;  1DUX C;  3B73 A;  4RB2 C;  3CO6 C;  4ENN A;  3F8M A;  1S29 A;  3T0Y A;  3R0J A;  2XIG A;  1USS A;  2BE5 F;  4WXH A;  1ZRE A;  4HF1 A;  3J80 K;  3QRF F;  3JW4 A;  3T1B A;  2FRH A;  2VN2 A;  4Q47 A;  1ZHF A;  2BEO A;  3JTH A;  3KFW X;  5HOO A;  1TW2 A;  4KN7 X;  3MZH A;  3KP3 A;  1YQA A;  4ESB A;  5D5V B;  4KIF A;  4PGH A;  3GF2 A;  1HKS A;  2ISY A;  2A3S A;  4MTE A;  4G7Z F;  3WU0 A;  5JI6 A;  1IXC A;  4EQQ A;  2AXL A;  4HQE A;  1LEB A;  4LD5 A;  3IL2 A;  3GUD A;  5DV5 A;  3LA2 A;  1IN7 A;  4MEY F;  2YPR A;  4MNU A;  1O7L A;  3VOE A;  4Z2Y A;  1ODD A;  2HZT A;  2O0Y A;  3FWE A;  2P4W A;  5TJJ A;  3CTA A;  1QQI A;  3QU3 A;  5CVJ A;  5E1W A;  4KMU X;  1Z6T A;  1R1V A;  1XMA A;  2ZKZ A;  5BPD A;  3ZMT A;  2TDX A;  1IAW A;  2HFH A;  1TW3 A;  4GO1 A;  2L4A A;  2LKP A;  2V6C A;  1UHW A;  1U8R A;  1HST A;  3BOQ A;  3K1N A;  1MJA A;  4M9Z A;  3T5X A;  5K1Y A;  2DT5 A;  1G3T A;  1K7A A;  4I02 A;  4UNO A;  2K86 A;  3KET A;  2HTJ A;  3GFI A;  2Z99 A;  4O6J A;  3F6O A;  1X3U A;  1ZAO A;  2CQK A;  4UVB A;  5ICF A;  1YIO A;  3EYI A;  3ZMU A;  2O8X A;  5FD6 A;  1OPC A;  2OU2 A;  2KRF A;  2RN7 A;  4HAM A;  1SD7 A;  5HLG A;  4ESJ A;  3E3V A;  2L4M A;  1YS6 A;  2KJB A;  4FT8 A;  3FM3 A;  1S7O A;  1J59 A;  3LFK A;  1R5G A;  2VC1 A;  5A2Q K;  4S04 A;  3M9A A;  1HBX G;  1BOA A;  4F7Z A;  4I2O A;  4ZYD A;  4WXD A;  3ZN0 A;  1MDM B;  4BHP A;  3WGI A;  2R7D A;  1YW7 A;  1R1T A;  3C3W A;  2A69 F;  4Y15 A;  1FLI A;  2VXZ A;  5L3G A;  1LJ9 A;  2EV5 A;  4UXN A;  1STZ A;  3DF8 A;  3F8F A;  1TBX A;  5CVU A;  4L0Z B;  1LDJ A;  3E6M A;  2O61 A;  3Q9V A;  1XSD A;  3BZ6 A;  2CW0 F;  4LB6 B;  1Z91 A;  4ENK A;  2DLL A;  1OKR A;  3N97 A;  5BOX A;  4EGZ A;  2AS5 F;  1KYW A;  1MKM A;  4HYE A;  3CJN A;  4NB5 A;  2QYO A;  4BNC A;  2ZME B;  1XDS A;  3D0S A;  2OAZ A;  2FF4 A;  3J7A O;  1HSJ A;  3BDD A;  3MCZ A;  2EWN A;  4HLY A;  4M9X A;  1U3E M;  2WWY A;  4A6D A;  1TQP A;  3E97 A;  1L3L A;  2CGP A;  1XCB A;  5DCM A;  1T98 A;  1HW2 A;  4XLP F;  1UST A;  3ISP A;  2P6S A;  2QQB A;  2QWW A;  3WTS C;  1TNT A;  1FBU A;  1J5Y A;  2FNP A;  2C6Y A;  2EV0 A;  4WF2 A;  4MQV A;  1WI9 A;  2MLG A;  1FYM A;  2YX7 A;  3KZY A;  2XAG A;  3LQR A;  2FBK A;  3LAJ A;  2NNY A;  2K4J A;  3F8N A;  3O3K A;  5J8C A;  5AIP A;  5IT9 Z;  1O3Q A;  4IJA A;  1SFX A;  1KYZ A;  4CHU A;  3BRO A;  1FBQ A;  1K79 A;  2GA1 A;  2HQN A;  3F21 A;  1O3T A;  2K7L A;  3P9C A;  2G7H A;  2IA1 A;  1I27 A;  1BN5 A;  4LG0 A;  1ON1 A;  2IJL A;  2QBY A;  5J6X A;  4D0P A;  1H0M A;  4L5J A;  1R00 A;  5K5O A;  2M1B A;  5FB2 A;  3TDZ C;  1O3S A;  3V4G A;  3GZ6 A;  2XAS A;  2YSR A;  3GW2 A;  2H09 A;  3HSR A;  1KQ9 A;  2MA3 A;  1YYV A;  1S3J A;  4IPA A;  3E5U A;  4UV8 A;  1O7F A;  2K02 A;  5DD8 A;  2DPD A;  3IC7 A;  3J81 K;  1I1G A;  3C18 A;  2NYX A;  3CUO A;  4Q48 A;  2FU4 A;  4IXA A;  5J8F A;  5D5W B;  4G8X A;  4LMY A;  3HTU A;  1U5T A;  5DEQ A;  2VBW A;  4HW0 A;  4M73 A;  3HOS A;  3RTR A;  5ICC A;  1OYW A;  4AIJ A;  2H6C A;  5FD5 A;  5HDG A;  1UFM A;  3S2W A;  4P96 A;  2XAQ A;  4CGZ A;  4EMS A; 
#chains in the Genus database with same CATH topology
 5DYM A;  2IP2 A;  3IHU A;  1Q1V A;  2JRT A;  1EV7 A;  5IT3 A;  1AHD P;  4WXC A;  3K4M A;  3ZGK A;  4F91 B;  4AVP A;  4L0Y B;  2DA7 A;  3S15 J;  2NAZ A;  4ETS A;  2WAF A;  4WX9 A;  3BPX A;  1VQ6 I;  3JSO A;  2BW3 A;  3A1Y A;  1I3Q J;  4EJT A;  1ZG5 A;  2KIM A;  4IOC F;  1R23 A;  4O3M A;  2E5Z A;  1V4R A;  3R60 A;  3CCM I;  2FXA A;  2OZ6 A;  2DYS H;  2AHQ A;  5GPC A;  2R5Y B;  4A6E A;  2MBF A;  3R0A A;  3RYR A;  3MVP A;  2EFQ A;  2B7E A;  1W5S A;  1Y56 A;  3K4K A;  1PJR A;  3HZJ A;  4KT5 C;  1WWX A;  3SZP A;  1BOB A;  1V55 H;  1FNN A;  2K5C A;  4C2U A;  1TWF J;  5FKM A;  1BBY A;  2W48 A;  3RYP A;  4RBO A;  2LF7 A;  4B43 A;  3E6C C;  3PFI A;  2OQG A;  3MZ8 A;  2DDA A;  1JT6 A;  1FOX A;  3HRM A;  3BQY A;  5DS9 A;  1P92 A;  3WG9 A;  3KE2 A;  1R5H A;  4BY1 J;  1S7E A;  4KT6 A;  2BY2 A;  4RB3 C;  2LH9 A;  1LDD A;  3ERM A;  4AU7 A;  2DMN A;  3S3O A;  3DU5 A;  1Z3Y A;  5M5W J;  2WV0 A;  1ZGJ A;  4HLX A;  5FLX K;  1IDY A;  2ZXW H;  3PNY A;  3NWS A;  2RV8 A;  5E1X A;  2CV0 A;  5F0F A;  3WTW C;  3LSK A;  3CCL I;  3GX4 X;  2DQR A;  2RNG A;  1IRX A;  2V26 A;  1XD7 A;  1UAA A;  4XSZ F;  3KYD B;  3FZV A;  1XC5 A;  3FMS A;  4Y3O A;  1M1E B;  4II2 A;  3G3Z A;  3Q9S A;  5L3C A;  4E7J A;  2QSG X;  4A3L J;  2Z3Y A;  2JTV A;  5M3M J;  1WJE A;  3RI4 A;  1DPU A;  1R4M B;  4XLE A;  4A2U A;  3ZQH A;  5LBQ A;  3CMA I;  2X0L A;  3CJQ B;  1MJB A;  2CUE A;  5LLQ A;  1T33 A;  1TLH B;  2Q8K A;  1BR2 A;  3FIW A;  3K4B A;  1X4P A;  1E3O C;  2DJN A;  3FXQ A;  3IH3 A;  4DIQ A;  2GZW A;  1OR7 C;  1EF4 A;  4E7Z A;  4V2F A;  2TRT A;  3IKV A;  5BPI A;  3I4M J;  1GHC A;  1ZGA A;  3KYL A;  3TOB A;  4IHW A;  2HR3 A;  1ZLK A;  4D5F A;  5D6F A;  4HDU A;  4L5E A;  2DK8 A;  3OS0 A;  3SEZ A;  2O03 A;  2OTL I;  2JVG A;  2A05 A;  2W4S A;  2HQA A;  3SZT A;  1OYI A;  4BS9 A;  4M72 A;  3CP8 A;  2QLZ A;  1I1S A;  4A3C J;  1XMK A;  2OF7 A;  3HRS A;  3LWF A;  3IH4 A;  4CIC A;  2FNA A;  4X1E A;  4MIM A;  3TW7 A;  4L9J A;  4D9J A;  1R36 A;  3DLA A;  3HRT A;  1N25 A;  2QQA A;  1R71 A;  2KP6 A;  4BJ6 C;  1V5E A;  3BR2 A;  2MAB A;  2FMY A;  4IF4 A;  4IL6 C;  3IV5 A;  4FCY A;  2PMH A;  3FXM A;  5GTI C;  3ZMZ A;  2COM A;  3FMQ A;  1BC7 C;  1D1A A;  2QQ8 A;  1ZRF A;  1KU7 A;  1YIJ I;  3D5R C;  1ZR4 A;  5DCM B;  4V2G A;  3KPH A;  1ZG3 A;  2EV6 A;  3RPU A;  1SC7 A;  3F8B A;  2EB7 A;  2M3A A;  4XOR A;  2Y0M A;  4CUG A;  3DBR B;  4DOZ A;  1UCR A;  5EEH A;  2DMQ A;  4RB1 A;  3HBL A;  3CCU I;  5JVT A;  4BJT A;  4GYI A;  2XRN A;  4U87 A;  2WA0 A;  4EM1 A;  4A3G J;  4QWQ A;  1QNT A;  1QPI A;  5EEG A;  1B8I A;  2BV6 A;  2NNN A;  2V1N A;  5BQT A;  1S7A A;  2F48 A;  5H6Q A;  2V7F A;  4UB8 C;  3CCR I;  2XF7 A;  3G2B A;  3UKG A;  1H8A C;  2CQN A;  2V1U A;  5DTD A;  1ZN2 A;  4FE7 A;  4XN3 A;  3ZQG A;  5DUI A;  1ULY A;  2X85 A;  3ECH A;  4B3X A;  2DW4 A;  2K85 A;  4XOT A;  5K5R A;  4V19 K;  5LRS A;  3WG7 H;  2DBB A;  2VON A;  1AWC A;  4XN0 A;  5D4S A;  3HRU A;  5HS7 A;  2E60 A;  1U9O A;  2R92 J;  1G59 A;  1U0J A;  3C7J A;  2L9V A;  1MW7 A;  3N05 A;  1OCT C;  2AO9 A;  1RKW A;  1F4K A;  2O3F A;  1D0X A;  4M3B A;  4RM2 A;  3I55 I;  2BXZ A;  2ZXJ A;  3W2V A;  1EA3 A;  5BS6 A;  2DQL A;  2LF8 A;  3R6S A;  1FOW A;  3J7Y J;  2ZME C;  2BYV E;  3L00 A;  5H6R A;  4NNJ A;  4A0Z A;  5HOD A;  1OMI A;  1ZAR A;  2VJ4 A;  4HF0 A;  2K3F A;  2EZH A;  3S17 J;  3LSI A;  5AIQ A;  3K1P A;  1I5Z A;  2M4K A;  3KP4 A;  2F5V A;  3C1D A;  3WTZ A;  4LG0 B;  1D8K A;  4B44 A;  2QBY B;  2Y0S A;  2K9N A;  1KA8 A;  3CC7 I;  2M30 A;  1FBS A;  5IOY A;  3PO3 J;  1K61 A;  1UEL B;  1XGM A;  3GFJ A;  3KP2 A;  1TT5 B;  3I56 I;  5GAH J;  3MFK A;  4D1Q A;  4Y17 A;  2DXI A;  4JX5 A;  1XCV A;  5EF6 A;  1W0T A;  2XPU A;  3GTJ J;  3B6C A;  5F1R A;  1RUN A;  3RPQ A;  1Z6R A;  3CCE I;  3C2B A;  2ESN A;  4C9Y A;  3BR1 A;  3G1O A;  1B4A A;  3VOD A;  2Z9O A;  2R3S A;  3QU6 A;  4YFN F;  1MH3 A;  1ZYR F;  2LRE A;  3DV8 A;  4Y52 J;  3I71 A;  1JKP C;  3FHN A;  2GBY A;  3CF2 A;  3M07 A;  4ENJ A;  2H27 A;  3S16 J;  2IBD A;  3H9J A;  4JOM A;  2HXI A;  4ZYA A;  2LP0 A;  5ILU A;  5IP6 A;  3D5L A;  2W1O A;  1QVT A;  4A3B J;  3FK6 A;  5LGN A;  1ZQ3 P;  2PFB A;  2Y2Z A;  1OCZ H;  3KEO A;  3S1Q J;  4KDP A;  4DZJ A;  1X1B A;  4G12 A;  4QIW N;  1RZ4 A;  4QPO A;  1ZEL A;  3OWT A;  3O2P E;  4DYQ A;  5ED4 A;  4RAF A;  2LKX A;  4GFB A;  2F5D A;  2W85 A;  2FQ3 A;  3J80 Z;  5J4V A;  3FDY A;  3W3C A;  1VZ0 A;  1U5T B;  2DOF A;  2Q1Z B;  3I4P A;  2CJJ A;  4IEJ A;  3L7W A;  1JHF A;  2DFH A;  3ZPL A;  4MTD A;  4CCK A;  5JHF A;  2LSO A;  5IP9 J;  5FLV A;  4DBR A;  1QA6 A;  3H1C A;  3REO A;  1T39 A;  4HBL A;  4XIC A;  4EJW A;  2A07 F;  3Q5F A;  2COB A;  5GTH C;  3OYC A;  4DZP A;  3MKY B;  2LNB A;  2STT A;  3RJP A;  2MYS A;  3BCA A;  1FSE A;  1BI2 A;  1HKQ A;  3K70 C;  1NTC A;  2L2O A;  4E7L A;  5LHH A;  1X2M A;  2KLO A;  1ETY A;  2IGK A;  4DW6 A;  5EGO A;  3K4J A;  1ETV A;  3QOD A;  1X4O A;  4AID A;  5JLW A;  2P7C B;  4NUB A;  1Y8R B;  2OA4 A;  2BW3 B;  2XAJ A;  2E1M B;  2P5L C;  1P2F A;  9ANT A;  3PIP F;  1XDU A;  3KZZ A;  1W1W E;  4N9H A;  2ELJ A;  1AKH A;  3VFZ A;  3OYD A;  1TP4 A;  2R5Z B;  1CF7 A;  4RGX A;  2W24 A;  4RGU A;  1W4M A;  4J00 A;  3FXK A;  3K4C A;  2XF6 A;  2DFF A;  5F0C A;  3TL4 X;  5FRO A;  3KZI C;  1I39 A;  2R7T A;  2OUM A;  1Z3X A;  3FXR A;  3NRV A;  5F08 A;  3F9K A;  3S32 A;  2RQP A;  1RNL A;  3HSE A;  2O5R A;  3ZN1 A;  2PEX A;  1Y8Q B;  3DLL F;  4RAG A;  2VKE A;  3OIP A;  1S9H A;  4UVC A;  2RNJ A;  1JTX A;  5J47 A;  4IRG A;  1G3Y A;  3EDP A;  1Z0X A;  1XPX A;  2PMZ N;  2ZCW A;  1SD5 A;  2W57 A;  2VOD A;  4C2M J;  3TW6 A;  3BTC A;  3WHC A;  2CG4 A;  2OZU A;  4RS8 A;  4FAS D;  2W82 A;  2L9N A;  3ABM H;  5HLH A;  2V79 A;  5GAG J;  1S8N A;  2HNH A;  3OSF A;  3DEW A;  4A3J J;  2Z1D A;  1QZZ A;  2H8R A;  4BKX A;  2E5N A;  4M6V A;  1TC3 C;  4EM2 A;  1U2W A;  1J75 A;  2R7Z J;  2LDU A;  1HQC A;  1VND A;  4KN4 X;  3LNQ A;  2VOO A;  2Q2E A;  4G7H F;  3OYA A;  5F1J A;  2KZV A;  4XL9 A;  3DPT A;  5K5Q A;  3FF5 A;  3ROU A;  3F3X A;  4UB6 C;  3DCF A;  2E2H J;  2UWM A;  5DDG A;  2HEO A;  4B09 A;  2QKM B;  4CXF A;  1MGT A;  3VSK A;  2HVS A;  4OU0 A;  4ENM A;  4EMS A;  4FTH A;  4IX7 A;  3RKX A;  4N4O B;  1QU3 A;  4ZZL A;  3ZQQ A;  2F5E A;  2XAF A;  3SHF A;  3GFL A;  2XSD C;  4IHY A;  3S14 J;  3V42 A;  1ON2 A;  4ZDP A;  1R9T J;  4HDV A;  2STW A;  1J7K A;  2YX4 A;  5J4Y A;  1ETQ A;  2XAH A;  4OIQ F;  2VT3 A;  3WGH A;  1TNS A;  4HQM A;  1WFX A;  1WRJ A;  2LLK A;  2X1E A;  3CD6 I;  2BVM A;  2W00 A;  2VB6 A;  3A01 A;  3BY6 A;  2WC2 A;  2EH3 A;  2W84 A;  2VPL A;  1X1P A;  1GDT A;  3GWZ A;  3HXL A;  4YIF A;  2L0K A;  4YIR X;  1HW5 A;  5K7F A;  1JGG A;  3K2Z A;  4OOI A;  5FFX A;  4P9U A;  1FMW A;  2VE8 A;  3EET A;  2I10 A;  4CYD A;  4KIB A;  5C3E J;  1U9N A;  3W6J B;  2ELH A;  2HPI A;  1U8B A;  4OMZ A;  4CDG A;  2F5C A;  5E20 A;  1V5G A;  2JMW A;  5LRR A;  1C0W A;  2GXA A;  1TQI A;  3WOD F;  4B1R A;  5B5E C;  3FM5 A;  3K69 A;  2IS4 A;  4CYC A;  2ZNZ A;  4JX6 A;  5FKL A;  2ZXI A;  3OYL A;  1B6A A;  1FMV A;  2KFD A;  3MAJ A;  3M4O J;  3JRE A;  1T6S A;  1K78 A;  2QSF X;  3ZRG A;  1MJ9 A;  4F55 A;  3JRG A;  3NWT A;  2EFW A;  2GA2 A;  1VQN I;  2LVS A;  3F8C A;  3K1M A;  1PUE E;  3H3U A;  2DOD A;  2DOE A;  3M8F A;  1JE8 A;  5D8K B;  1VFC A;  2DMP A;  1YX3 A;  1WJ5 A;  3RSN A;  3CUQ C;  3U9G A;  1R58 A;  4J19 A;  2EZI A;  1RR7 A;  1BIB A;  1TQM A;  1B8I B;  4MGR A;  1MNM C;  1UG0 A;  1P4A A;  3HHG A;  4N4N B;  1BC8 C;  1DDN A;  2JSC A;  2IAI A;  2KKO A;  2DTZ A;  3H36 A;  2LY1 A;  2WAD A;  1NK2 P;  5D5X B;  2M45 A;  4EJU A;  1IN8 A;  3OOP A;  4U88 A;  1YRN A;  4XON A;  4DYR A;  3F22 A;  2HKX A;  2PN6 A;  2Z16 A;  4D5C A;  4YEJ A;  2R7X A;  3DKX A;  3OIQ A;  1O4X A;  4BHB A;  2QEX I;  2VUM J;  3ESW B;  2M7B A;  2VC0 A;  2LMD A;  4K2E A;  1KON A;  3SYT A;  2DA2 A;  3T8R A;  3HIF A;  3HGG A;  3HJE A;  2ZNY A;  4IOA F;  1BI0 A;  2K9L A;  2R7W A;  1YFH A;  4NQW B;  3LSR A;  2XRL A;  4XRS A;  4ZH4 F;  2BY0 A;  2R7Q A;  2PJP A;  1Y0U A;  4ITV A;  2E1N A;  4LLG F;  1TWG J;  3WTY C;  4M3E A;  2MH2 A;  3HOV J;  2JPC A;  3G1M A;  3TOA A;  1SAX A;  5EDN A;  2FUG 2;  1H9T A;  1PUF A;  4I0A A;  1KQ0 A;  3AKZ A;  4P5O A;  5AON A;  2YU9 J;  4CCM A;  4ZYE A;  3LL7 A;  4LB5 A;  2OV7 A;  5L3B A;  3VSL A;  2Y9Z A;  1WGX A;  3HPH A;  2KIS A;  2OD5 A;  1RRJ A;  3WTU C;  4MHG A;  1UJ8 A;  2KJC A;  3N4M A;  2YUS A;  2NOG A;  5LGT A;  2WB1 N;  2MLK A;  3W2A A;  5E3M A;  3DPL C;  1VI0 A;  1YJW I;  3U1K A;  4ZYH A;  4GDF A;  1IW7 F;  4EM0 B;  3M1E A;  3JRD A;  2KDO A;  2VQC A;  1RI7 A;  3CQZ J;  1T38 A;  1D0Z A;  1IF1 A;  2O6G E;  3BP8 A;  2KDZ A;  5F6F A;  1BR4 A;  5H2F C;  1V5F A;  3I0T A;  2XSJ C;  1TTY A;  4CZC A;  1KQ8 A;  3QPH A;  2FD5 A;  5H20 A;  3RIR A;  1IRZ A;  5HDN A;  1JKQ C;  3JCU C;  4IVN A;  2BHY A;  3W2W A;  1YTY A;  2CUF A;  1TL8 A;  4W1U A;  1A6Q A;  4C2T A;  4RGR A;  2PI0 A;  3OYM A;  3ML6 A;  1FP2 A;  2K4B A;  2DDB A;  2JSP A;  4BHC A;  2VPR A;  3J7Z I;  1DPR A;  2J5O A;  3QP5 A;  4AM3 A;  1R1U A;  5JR3 A;  1X2N A;  1XGS A;  1X1A A;  1BJA A;  2OCE A;  3QYF A;  1RUO A;  5D5U B;  3G73 A;  3GFM A;  2GAU A;  4G7O F;  1D5V A;  1SD4 A;  4XM3 A;  3CCJ I;  3S93 A;  4P55 A;  4HV6 A;  3H3V K;  3AG1 H;  4LIU A;  3L9F A;  1KU3 A;  3LA7 A;  2HPM A;  3QP6 A;  2DCE A;  4DGW B;  5F04 A;  3HSF A;  2XKP A;  4OIP F;  3K4N A;  1DP3 A;  1HW1 A;  1XSV A;  4ZZD A;  5FJ8 J;  3GTQ J;  3V7S A;  3BCB A;  5IY5 H;  2J5P A;  2ZSI B;  1YW9 A;  3ZMD A;  1N77 A;  3S8P A;  2K9M A;  4G6Q A;  2DYR H;  5IYC J;  2XB0 X;  1BI1 A;  2DTR A;  5FRM A;  3ZCO A;  2ME6 A;  2X9D A;  2MC3 A;  4PZJ A;  3OSG A;  2EA4 A;  1I6X A;  2IA0 A;  1ONV A;  1LFP A;  1WH5 A;  1ITY A;  2EBI A;  3NEU A;  3KLO A;  2RC4 A;  3H3Z A;  1QHG A;  2G7U A;  1Z7U A;  3DXJ F;  3IP4 B;  1UB9 A;  2R5Z A;  4BEH A;  4PJM A;  4BH9 A;  4H4K C;  4AIK A;  2DA1 A;  3LSP A;  4RLQ A;  1A04 A;  4M3F A;  4A5N A;  3DEE A;  3ELK A;  2VLA A;  5LEK A;  5EGO B;  1FEX A;  3VPR A;  5CQE A;  3TGN A;  5J1R A;  2L02 A;  3WU1 B;  1VQ5 I;  4XKW A;  1WH7 A;  1XG1 A;  3GTP J;  3BG3 A;  4RMN A;  5E8G A;  1PP8 F;  4GGG A;  1F5T A;  4GRI A;  4L5I A;  1DP7 P;  3LFU A;  3Q0U A;  4JX4 A;  4M6Y A;  1X19 A;  1SD6 A;  3Q0V A;  4A0X A;  1Y1V J;  2E7W A;  2KQR A;  1AKH B;  5JLX A;  3F23 A;  1CF7 B;  2QKL B;  2VOP A;  1YOV B;  3FIS A;  3J81 Z;  1IXS B;  4L9N A;  3PNV A;  4PSW A;  3MKW B;  5E1Z B;  1FX7 A;  1ZRD A;  3CJT B;  3BJO A;  1DQU A;  3BR5 A;  3IKT A;  2IEK A;  4E7K A;  1REP C;  2JUC A;  2MD0 A;  3I4N J;  4CZZ A;  2NVY J;  1J2X A;  2H6B A;  4IHS A;  2D1H A;  1J9I A;  4GCV A;  1WJA A;  4MQ9 F;  1BIA A;  3EUA A;  3TP3 A;  1JUM A;  1HLV A;  4YEL A;  4AUX A;  5D8L B;  3E5Q A;  2G9W A;  3DKY A;  2MC4 A;  3RCO A;  1D0Y A;  4WK8 F;  2XGD A;  4KYW A;  1G6N A;  5GAE J;  1QGP A;  1ZR2 A;  5TGT A;  3OL4 A;  4I0B A;  3ZQ7 A;  3Q0W A;  4PFP A;  3ECO A;  3AL0 B;  3GTG J;  2OC6 A;  2HS5 A;  3U2R A;  1B1B A;  4A69 C;  1K6O A;  2MSY A;  1XN7 A;  5E17 F;  1SMT A;  4R8H A;  3VEP A;  1GT0 C;  4PSX A;  5F27 A;  1B72 A;  4A3M J;  1NK3 P;  1P9Q C;  5LEJ A;  2IW5 A;  4HA8 A;  2Q2E B;  3I54 A;  3PFY A;  1K4S A;  2D1V A;  2MH9 A;  3I5U A;  4G94 A;  1X58 A;  2IGN A;  5DM6 F;  3QOE A;  2QZ8 A;  2IS2 A;  4HZF A;  4RA2 A;  1BI3 A;  4KIG A;  3H92 A;  3BTI A;  4DQ2 A;  4XQF A;  5D4R A;  4JK1 X;  1OCO H;  4I7H A;  5CVI A;  3HC7 A;  1MND A;  1MBG A;  1I50 J;  4RLF A;  4FET A;  3OS1 A;  4HSR A;  2X6O A;  3CCV I;  5CLS A;  1POG A;  2L7F P;  2LRD A;  3OIO A;  5ILS A;  2IVM A;  1QRY A;  3A0B C;  2DT7 B;  2VL8 A;  4DNC A;  4M74 A;  2BHZ A;  5EZG A;  2PQ8 A;  2PMZ A;  3EUH C;  2E1M C;  1HCR A;  3OY9 A;  3ERE D;  2XRO A;  1XSX A;  2EZL A;  3GXO A;  1G2H A;  3A01 B;  1LFB A;  2CSO A;  4KNY A;  1R6R A;  1T0F A;  4E70 A;  4RDU A;  1SMY F;  1TZL A;  4KIC A;  3IAS 2;  3C2H A;  3I3L A;  5ICE A;  3HGY A;  3WE2 A;  5FLX Z;  1AOY A;  2M8E A;  3HEF A;  1GLN A;  4EJV A;  3DEU A;  5LHG A;  2E1O A;  3X2Q H;  1OQY A;  3LOC A;  2D45 A;  4BQA A;  3E5X A;  1LDK B;  4LIT A;  3PUB A;  4W97 A;  1UHS A;  4CYC B;  3F0C A;  2XVC A;  3CP2 A;  1WPK A;  4Q5S F;  1K78 B;  3L2C A;  4GYG A;  2CV1 A;  1FJL A;  1OCR H;  2FA5 A;  2CUZ A;  3DP7 A;  1MH4 A;  5HLI A;  3DTI A;  1QO0 D;  2OTJ I;  3OYK A;  1SVL A;  3JRC A;  4EGY A;  1FWZ A;  4PGG A;  3FX3 A;  4MO7 A;  3TO7 A;  3S1M J;  1U6G A;  3DQV C;  4YII A;  2Z33 A;  1GVJ A;  3NQO A;  4GXO A;  1VQ9 I;  3O8G A;  4CGZ A;  3ZQL A;  4JQF A;  1JUP A;  4HNV A;  2L01 A;  3KP7 A;  3DBH B;  1F36 A;  3ABT A;  1D8J A;  1MZB A;  5KAF C;  4NQW A;  1FC3 A;  3H0G J;  1QHH D;  5KNL A;  3WTX C;  3JAM Z;  1APL C;  1S6L A;  2RKH A;  1B9M A;  2VJ5 A;  1YRN B;  5HS8 A;  2XB5 A;  1VQK I;  4WWC A;  4EV0 A;  4AYB A;  1Y6I A;  2BGC A;  1ERD A;  3V7R A;  2JUG A;  5J3L A;  1IN5 A;  3DPU A;  2PG4 A;  1OIS A;  4R1H A;  2WY7 Q;  3MEX A;  4F52 A;  5CVV A;  3A2K A;  3FKI J;  2PBI A;  3FMR A;  2ZC2 A;  4LK0 F;  2ESH A;  2ICW G;  3T8T A;  3RPU D;  4NC8 A;  2L54 A;  1XGO A;  4JP0 A;  2P6T A;  2DT6 A;  2JQ7 A;  4LLN A;  2PLY A;  4XBF A;  3AG3 H;  1LVK A;  1PUF B;  3LSG A;  1Q1H A;  3KP6 A;  1R49 A;  3J7A Y;  1EH7 A;  4IKF A;  4YRV A;  4BBR J;  1Z9C A;  1WJC A;  3E6D A;  4XKV A;  3L09 A;  4WCG A;  2EPF A;  3QPS A;  3JTG A;  2XF5 A;  1T08 B;  5KVR A;  1NHA A;  5LHI A;  3K4L A;  3ZMS A;  1FOK A;  1BL0 A;  3I64 A;  3LQQ A;  4QTR A;  3ZQC A;  4LLL A;  2V4J C;  4B8X A;  3KP5 A;  3SQN A;  4ZJZ A;  1J0R A;  5KK1 A;  3OYI A;  3BR6 A;  3ZQI A;  1VQ7 I;  2HTS A;  2JA7 J;  3V8L A;  3K2A A;  1TWH J;  1E17 A;  1IUF A;  1IGN A;  1X1D A;  3BTL A;  1SFO J;  3TBI A;  4Y4R A;  3H5N A;  1RC9 A;  1Z7L A;  2FJ1 A;  1F43 A;  4ZDL A;  2P5V A;  4NHJ A;  1A35 A;  2QVO A;  3OL3 A;  4KIT B;  1OJL A;  3CJR B;  1KU9 A;  5IYB J;  3I58 A;  1LUJ B;  1X1C A;  4OIN F;  2BOL A;  3K0L A;  2HVQ A;  1A31 A;  1GXQ A;  4M6X A;  3HDD A;  2ZBK A;  1ZH5 A;  2DI3 A;  1Y39 A;  3UR3 C;  4FHT A;  3A02 A;  2A61 A;  4B4C A;  4Y7N J;  4IRI A;  2YR2 A;  2UZK A;  2HDW A;  2V9K A;  1BR1 A;  1W36 D;  3ZMV A;  2NS0 A;  4F93 B;  3B02 A;  4FQG A;  3SDB A;  2WBM A;  3CC4 I;  1IXR C;  3V8J A;  5HNF A;  3RKQ A;  2P5K A;  1LE8 A;  3H9Q A;  4IZZ A;  2IS1 A;  1ZKG A;  1XB4 A;  2CS3 A;  4AC0 A;  2AXT C;  2EIN H;  4E7S A;  5J1Y A;  4HNU A;  3FKJ A;  3CMY A;  5C4X J;  1SVM A;  2RVC A;  2LC2 A;  4DBQ A;  1ETX A;  3ZP5 A;  3NAR A;  3VDX A;  4BJ5 C;  2NRA C;  1AA7 A;  2WB1 A;  2L9S A;  1F9N A;  3MWM A;  3GZ5 A;  4N9I A;  1MBE A;  4KFC A;  1SEU A;  3WHB A;  2ZJ2 A;  1Z67 A;  4YFX F;  3JSP A;  2DMT A;  2QA4 I;  1VQ8 I;  1WZ2 A;  4PDK A;  4I99 C;  1HA8 A;  3QQA A;  5FO5 A;  3GEZ A;  2O9L A;  3DU6 A;  1ETW A;  2VBX A;  1RR8 C;  2ZSH B;  1CGP A;  3KCC A;  1LPQ A;  2E2J J;  1F1Z A;  2ETH A;  4BEH B;  3CCS I;  3M7G A;  3VB2 A;  2DJI A;  5HDK A;  1JXS A;  2CFO A;  5E3O A;  4KA4 A;  4LFU A;  4UVA A;  2GXB A;  2JA6 J;  3FBN B;  3HL2 A;  4FX4 A;  2LBF B;  4MFD A;  3CC2 I;  1K4T A;  2CU7 A;  3H35 A;  1FT9 A;  2VXD A;  1MMG A;  3IWZ A;  1FP1 D;  2XGC A;  3HYI A;  3IWF A;  2HZD A;  3GTO J;  3GTK J;  3VYU B;  4B48 A;  4ESF A;  3PQJ A;  2L5Q A;  3OR2 C;  4P9F A;  3TMO A;  1W7P A;  2VJI A;  1VTN C;  1G4D A;  4I09 A;  2KRC A;  1U78 A;  2E19 A;  2EK5 A;  5ERI A;  4LK1 F;  2LK2 A;  5IPA A;  1MSF C;  2ID6 A;  4EVI A;  4YG2 F;  3OV8 A;  3JRI A;  5L3E A;  1MMA A;  5LGU A;  4XLC A;  4UUS A;  1PVE A;  1KU2 A;  1QPM A;  5ILV A;  5GAD J;  2KIF A;  1NG7 A;  3FHZ A;  3CUQ A;  3F72 A;  4TV7 A;  2DOA A;  1MSE C;  2HKO A;  4LJZ F;  1WSU A;  3HHH A;  1FZP B;  3BG6 A;  2IA2 A;  4JBA A;  2F4O B;  4ANJ A;  2F2E A;  1LNW A;  3D1N I;  3LAP A;  4BYY A;  2IT0 A;  3I59 A;  3WGG A;  1V3F A;  2VQL A;  4A3E J;  1ZLJ A;  3HUG A;  1WQ2 A;  4LGW A;  3V8K A;  3ULQ B;  2JVH A;  5DCF A;  1YJ9 I;  2KHM A;  3GLX A;  3E1S A;  4AD9 A;  2HWV A;  3WTV C;  3S2D J;  2CW7 A;  3CLO A;  1R22 A;  2H1L A;  3PO2 J;  4X6A J;  3K9T A;  2V1X A;  4U7B A;  3LSH A;  3ZOB A;  4U0Y A;  1Z05 A;  1NG6 A;  3BJ6 A;  1S72 I;  3KX2 A;  1B72 B;  5M3F J;  1GUU A;  1VQO I;  4HRI A;  4H0E A;  5IT9 K;  1LB2 A;  1YIT I;  2K27 A;  4MEX F;  3LST A;  2R7O A;  1E3P A;  5EZH A;  4QLC U;  1VQP I;  3PSF A;  1ENH A;  3UNG C;  4XLH A;  2GIZ A;  4Q4Z F;  4M9S A;  4IRH A;  3FXJ A;  4II3 A;  1IZ1 A;  2EZK A;  1WVR A;  1R5I D;  2JWT A;  2XC7 A;  3L2U A;  1LFU P;  5CJ9 A;  4G6T B;  3AG2 H;  2PMU A;  3CLQ A;  1EH8 A;  3RQI A;  1NH3 A;  2GQQ A;  3ABK H;  4XRS G;  4HF2 A;  2HYG D;  5A2Q Z;  4AYB N;  3PSI A;  1GVD A;  3M1C A;  1TWA J;  3BJA A;  3I53 A;  4UHT A;  1MD0 A;  5E18 F;  2E36 A;  2JA8 J;  2OBP A;  1P7I A;  3TP0 A;  2GWR A;  1W7P D;  2EFO A;  4M71 A;  1FIA A;  4PUS A;  2V6E A;  2KIU A;  1R7J A;  4BAY A;  2HYJ A;  2RQQ A;  2ACJ A;  4IO9 F;  4L9T A;  2L3D A;  4Y13 A;  4IHV A;  2NS7 A;  1FTZ A;  4BXU A;  3FXO A;  5JFR A;  4PFO A;  5FKK A;  2V9P A;  2KL4 A;  2X1D A;  3F6V A;  3LSJ A;  1G8X A;  1DGW Y;  1B59 A;  5CYV A;  2XGX A;  1W0U A;  5GPA A;  1OYY A;  2CUJ A;  2DPU A;  2GXG A;  3VWB A;  2ZFU A;  3GYH X;  3WE3 A;  4A3D J;  2EJR A;  4F92 B;  4ZTF A;  4RGS A;  2V9V A;  1EKE A;  1O57 A;  4I76 A;  3VYR B;  3OMY A;  1ZG1 A;  3KEQ A;  2BZT A;  1G3W A;  4B47 A;  4U7D A;  3AL0 C;  5FGM A;  1HKT A;  3BG9 A;  3QAH A;  4HOB A;  2XKO A;  4HX7 A;  3I9V 2;  1G3S A;  1D5Y A;  2OPT A;  3HOY J;  2Z5U A;  3RDI A;  2CO5 A;  1FY7 A;  2A68 F;  2BBY A;  3WU2 C;  1MBH A;  1XGN A;  1MBF A;  2A5Y B;  1YS7 A;  3P7N A;  2IPQ X;  4LIV A;  5E79 C;  2CYY A;  3RQ4 A;  5FKO A;  1XS9 A;  1H9G A;  2HVR A;  5LD2 C;  3LA3 A;  1FSH A;  2CMP A;  2P8T A;  3E6B A;  2ZXH A;  1J09 A;  4O5V A;  5F64 A;  4DYC A;  2P0W A;  2Q0O A;  3KLN A;  2DK5 A;  2OJE D;  1IUY A;  2WAQ N;  4L9V A;  2M7A A;  3EYY A;  2QEN A;  5HS9 A;  2EFN A;  1EH6 A;  3OYJ A;  3BPV A;  3SFZ A;  2M5W A;  1B9N A;  4ZYG A;  5TIS C;  3WTT C;  2GOX B;  2OQR A;  4M3G A;  5D6E A;  3K10 A;  2LY2 A;  4ASN A;  2GIV A;  4FIS A;  4IQJ A;  1TWC J;  4BXX J;  2R7F A;  2UXN A;  1Y0N A;  2X6Y A;  3JRH A;  1LEA A;  2QUF A;  2VKD A;  5HVQ C;  2CWE A;  4ON0 A;  2JPB A;  1IO2 A;  3GO5 A;  4FX0 A;  4HX8 A;  2FBI A;  3CO7 C;  2RRE A;  4E4H A;  3W6K B;  4CH7 A;  4NC7 A;  1OFC X;  3O8H A;  1UMQ A;  1UHM A;  2ME0 A;  5FFZ A;  2ECC A;  3BQZ A;  4I6Z A;  1YE9 A;  2EA2 A;  2VE9 A;  2FEZ A;  2FBH A;  1T95 A;  2DU9 A;  4JYK A;  4N0B A;  1K83 J;  1ZRC A;  1UG2 A;  4KMF A;  3TO6 A;  2F5F A;  1SFK A;  3COA C;  1IN6 A;  2NVT J;  2R7V A;  1WKM A;  2DO7 A;  1L0O C;  2D2W A;  2HGC A;  2E35 A;  2RDP A;  5B1A H;  2E1C A;  2CQX A;  4IHT A;  3U1D A;  5DM7 F;  2E7X A;  3GTL J;  3H5A A;  3HTS B;  1RIO H;  2XGE A;  1KZH A;  2X6X A;  1WJD A;  1QBJ A;  1JHH A;  3JRA A;  4KIS A;  2VIX A;  5E3N A;  3FXL A;  2XV4 S;  2MW8 A;  2YU3 A;  3TKY A;  1FYK A;  3RKY A;  1BM9 A;  3IRQ A;  1HXD A;  2FML A;  4BXF A;  3GLL A;  3ABU A;  2ELK A;  3JRF A;  3DKW A;  5DD4 A;  1OR7 A;  1SFE A;  2DFI A;  3IAM 2;  3HOT A;  2CH0 A;  1H89 C;  4PCQ A;  3BTJ A;  4AIH A;  2Y9Y A;  1IJW C;  4U0V A;  1LE8 B;  1GV2 A;  3H9G A;  2WV1 A;  3M3Y J;  1GXP A;  2QQ9 A;  2M0M A;  1JT0 A;  3LMM A;  1O3R A;  2Y30 A;  1LQ1 A;  4UUV A;  1E2X A;  2LTP A;  1OCC H;  1PDN C;  2ISZ A;  2VBY A;  4CCO A;  4KUM A;  3IRR A;  4L18 B;  4XRF A;  5JHU A;  4XMY A;  4EAT A;  1YJN I;  1I6H J;  2ZFW A;  3CDL A;  2R93 J;  5DUK A;  5M5X J;  1FYL A;  2CRG A;  2RGV A;  2ADU A;  1IN4 A;  2LBF A;  4I98 B;  3EUH A;  2HOE A;  3OYH A;  4E7H A;  2BY3 A;  3OYE A;  4BDY A;  4RAZ A;  4HV5 A;  3P9I A;  5E8I A;  2VBZ A;  4BAC A;  2JZY A;  2M87 A;  4CA0 A;  4UV9 A;  2IRF G;  4G6D A;  3MQ0 A;  4HST A;  3HKZ N;  4BL0 B;  2IGO A;  4D7N A;  4LOC A;  2E71 A;  2VT2 A;  1YLF A;  1P4W A;  2HYF A;  1QZE A;  2FE3 A;  4HX4 A;  3QWL A;  3V7C A;  3PQK A;  4C3J J;  2MG4 A;  4OMY A;  2E2I J;  2HQR A;  3CME I;  2A6E F;  2QM3 A;  2X4H A;  5HNH A;  2FQ4 A;  4PJJ A;  2ECB A;  2EIM H;  2B0L A;  3BZK A;  6PAX A;  3IUO A;  4ZC3 A;  1MDM A;  4R79 A;  4XSX F;  4OIR F;  4CCJ A;  1HC8 A;  2FOK A;  3E7L A;  4BE2 A;  2PJR A;  4X0G A;  3E0J B;  2UXX A;  4B3A A;  2H8W A;  1RKT A;  3C2G A;  1E3H A;  1W7P B;  2M4G A;  5KAI C;  3HG9 A;  2VQG A;  3M8E A;  3HOX J;  4A12 A;  2N8G A;  2CFX A;  4OIO F;  2I8D A;  2HOA A;  3FXU A;  2X1C A;  2JRM A;  1YO5 C;  4U0W A;  4RB0 A;  1T56 A;  4ABZ A;  3SFI A;  4OAY A;  5B3S H;  4UUS B;  1JGS A;  2XHK A;  2Y75 A;  1U5T C;  3CUQ B;  2HDC A;  4XLF A;  1P6R A;  3IH2 A;  3G1L A;  4MLO A;  4PJN A;  1LVA A;  5FKN A;  1FPQ A;  3OYF A;  1OLT A;  3TQN A;  2ZO4 A;  5CVR A;  5BMZ A;  1YW8 A;  2V1D A;  3KYC B;  3I59 B;  3HUG B;  3P9K A;  5EJC A;  2E34 A;  2R7S A;  4A93 J;  2XUB A;  3SXY A;  2JN6 A;  4M3D A;  3CDH A;  4I01 A;  3MZY A;  2ZME A;  1HOM A;  1P4X A;  4S05 A;  2WAE A;  4LG3 A;  3R4K A;  3GVA A;  4A3I J;  2DFE A;  4RAY A;  3QPT A;  2M9H A;  1QZY A;  5L3F A;  3O6B B;  3JAM K;  2A6H F;  4MFE A;  3L2Q A;  3QOP A;  2GLO A;  2EIL H;  4D7M A;  4CO8 A;  3BWG A;  1YG2 A;  2VQH A;  3VYT B;  2JT1 A;  1RES A;  4XID A;  2R0Q C;  3CZ6 A;  4AWX B;  1ZK8 A;  2K3P A;  1MMD A;  2FSW A;  2P7V B;  4EJO A;  1IV8 A;  2XDV A;  1T2K A;  5TRD A;  1ACI A;  1PP7 U;  4G9Y A;  1BW5 A;  2MD5 A;  3BLY A;  3RKW A;  3PIO F;  2OCC H;  3TDU C;  4YFK F;  3ZQF A;  2M2E A;  1D3Y A;  3K6G A;  5ICG A;  3JRB A;  5IYD J;  1XMX A;  2QSH X;  3B6A A;  1W5T A;  1IRF A;  2ZB9 A;  1ORK A;  1SFU A;  2W25 A;  2DAO A;  2RAE A;  4PK4 A;  4A0Y A;  4IHX A;  3TO9 A;  2R4G A;  2EFP A;  3DFG A;  5L3D A;  2K9Q A;  4XLN F;  3A03 A;  1KGS A;  1AU7 A;  2H94 A;  1X3Z B;  2W7N A;  3G71 I;  1Z1D A;  4A5M A;  1ZGW A;  1IRG A;  2Y48 A;  3ABL H;  2WTE A;  3CMM A;  3H5R A;  4XRM A;  3AAF A;  4XK4 A;  3EQL F;  3R61 A;  1DUX C;  3B73 A;  4RB2 C;  4NDL A;  1YX5 A;  1VQL I;  2CQQ A;  3CO6 C;  4ENN A;  2L7Z A;  3F8M A;  3BG5 A;  1S29 A;  3K7A J;  3T0Y A;  3R0J A;  1V54 H;  4BE1 A;  2XIG A;  2X48 A;  1USS A;  4AVZ A;  2BE5 F;  3OYG A;  4WXH A;  3GBG A;  1ZRE A;  4HF1 A;  3DBL B;  3LSM A;  3QYE A;  2Y31 A;  4OAZ A;  1JJ8 C;  3J80 K;  3GTM J;  3OOU A;  3TED A;  3HPG A;  3QRF F;  1T8I A;  5B1B H;  2BY1 A;  2HOS A;  1ZTR A;  3JW4 A;  3MN2 A;  2FRH A;  2VN2 A;  4Q47 A;  3T1B A;  1VQM I;  1ZHF A;  1P7J A;  4UUT A;  5HLT A;  2D5V A;  4XOP A;  2BEO A;  3JTH A;  3KFW X;  5HOO A;  3CES A;  1TW2 A;  5K7Z A;  4KN7 X;  1A5J A;  2JJ7 A;  3MZH A;  4FE4 A;  2XPW A;  3KP3 A;  3BR3 A;  5EG0 A;  4Y33 A;  2NOJ B;  1YHQ I;  1YQA A;  4ESB A;  1WJB A;  5D5V B;  1S5L C;  3ASO H;  4XNF A;  2H1K A;  2DMU A;  4HPQ A;  5KHD A;  4KIF A;  2PX9 A;  4PGH A;  4DJA A;  3GF2 A;  4F3Q A;  1HKS A;  3HOW J;  2ISY A;  2KT0 A;  2ID3 A;  2A3S A;  4MTE A;  4G7Z F;  3WU0 A;  4HNT A;  1ETO A;  3BC8 A;  5JI6 A;  1IXC A;  1N75 A;  4EQQ A;  3CDI A;  2AXL A;  1VF9 A;  4HQE A;  1LEB A;  4LD5 A;  3IL2 A;  1WJF A;  3L2V A;  4BE0 A;  3GUD A;  3CCQ I;  1CQT A;  2X6W A;  5DV5 A;  4KJZ A;  3LA2 A;  1T0F C;  1IN7 A;  1WHU A;  3A0H C;  4MEY F;  2TCT A;  2YPR A;  4MNU A;  4NC6 A;  1O7L A;  3VOE A;  4Z2Y A;  1ODD A;  2HZT A;  2O0Y A;  3FWE A;  2P4W A;  5TJJ A;  2A6T A;  1EJ9 A;  2AQF A;  5J40 A;  5KCM A;  2A5W A;  3CTA A;  2DN0 A;  1JUS A;  1QQI A;  3QU3 A;  5CVJ A;  5E3L A;  3DTE A;  2DA5 A;  1PYV A;  2WAQ A;  4KMU X;  5E1W A;  1Z6T A;  1R1V A;  2EQR A;  2Z2S B;  2NVX J;  1XMA A;  4BUP A;  4XKB A;  2ZKZ A;  5GP9 A;  2YS9 A;  3GCM A;  1MBJ A;  4EEF G;  3ZMT A;  5BPD A;  2UV1 A;  3K70 D;  2R7R A;  2TDX A;  1IAW A;  3HB9 A;  5F0H A;  2HFH A;  2R7U A;  1FTT A;  5K7H A;  1TW3 A;  4GO1 A;  2L4A A;  4QPQ A;  2LKP A;  2V6C A;  3AFH A;  1UHW A;  1Y1W J;  1WCM J;  3FK7 A;  2VAS A;  4PJL A;  1U8R A;  3OR1 C;  4OWR B;  1HST A;  3BOQ A;  3K1N A;  1JKO C;  4BDZ A;  1MJA A;  3BG7 A;  4M9Z A;  2X51 A;  3P5J A;  3T5X A;  3OYB A;  1MMN A;  4ZDO A;  3ZR8 X;  4BQN A;  2DT5 A;  5K1Y A;  3OYN A;  1XTA A;  1IC8 A;  1G3T A;  1W36 C;  2R5Y A;  1K7A A;  1JKR C;  4I02 A;  5FRN A;  3ONQ A;  4UNO A;  2F6C A;  2K86 A;  3EPZ A;  3KET A;  3OS2 A;  3S2H J;  2M8G X;  2HTJ A;  3GFI A;  2Z99 A;  4O6J A;  3F6O A;  1X3U A;  1ZAO A;  2CQK A;  4UVB A;  3DTK A;  1YIO A;  5ICF A;  3EYI A;  3ZMU A;  2O8X A;  5FD6 A;  4CCN A;  4A3F J;  3RZD J;  3BZC A;  5M5Y J;  1OPC A;  3S1N J;  2OU2 A;  2KRF A;  2RN7 A;  4HAM A;  1N78 A;  1SD7 A;  5HLG A;  4ESJ A;  1Z77 A;  2CW8 A;  3E3V A;  2KZG A;  2L4M A;  2VI6 A;  1YS6 A;  2KJB A;  3MKL A;  1WI3 A;  2NXN B;  3M8J A;  3PJR A;  4FT8 A;  3QPL A;  3FM3 A;  1ETK A;  3SDG A;  1S7O A;  1J59 A;  1W5C C;  2KPM A;  4QSH A;  1SVO A;  5EYR A;  5J1U A;  3LFK A;  1R5G A;  2VC1 A;  5A2Q K;  4S04 A;  3S3N A;  1SAU A;  2B9S A;  2QF7 A;  2WY8 Q;  2ZJP F;  2HXO A;  3M9A A;  1HBX G;  1BOA A;  1Z21 A;  4F7Z A;  2HDD A;  3QYB A;  5C4J J;  4I2O A;  3CCY A;  2M34 A;  4ZYD A;  1BA5 A;  4WXD A;  3ZN0 A;  1MBK A;  1YI2 I;  1MDM B;  4BHP A;  3PNT A;  3S3M A;  1XX5 A;  3WGI A;  2R7D A;  2KIQ A;  1YW7 A;  1R1T A;  3C3W A;  2PJR B;  2KMU A;  2A69 F;  2HI3 A;  4Y15 A;  4CCL A;  1FLI A;  2VXZ A;  5L3G A;  1MIJ A;  1LJ9 A;  2EV5 A;  4RM3 A;  3PM1 A;  2LKS A;  3Q3S A;  3SZG A;  4UXN A;  1STZ A;  4HG2 A;  1VQ4 I;  3DF8 A;  2LR8 A;  2FX0 A;  3F8F A;  1TBX A;  5CVU A;  4XKC A;  2BXY A;  2K40 A;  2DA6 A;  4L0Z B;  1LDJ A;  3A4C A;  3E6M A;  2O61 A;  2FOW A;  3Q9V A;  3MKZ A;  1XSD A;  3BZ6 A;  2CW0 F;  4LB6 B;  1Z91 A;  4ENK A;  3HKZ A;  4BU2 A;  1OKR A;  2DLL A;  3N97 A;  5BOX A;  4EGZ A;  2AS5 F;  3DWL E;  3MD2 A;  1KYW A;  2EIK H;  1MKM A;  4HYE A;  3CJN A;  4NB5 A;  2CQ7 A;  2QYO A;  4BNC A;  2ZME B;  1XDS A;  3D0S A;  2OAZ A;  4PJ0 C;  2FF4 A;  4Z6Y A;  2HU9 A;  2QCO A;  4XR6 A;  3J7A O;  1HSJ A;  3SEQ A;  2MFZ A;  3BDD A;  3MCZ A;  3L2W A;  3HOU J;  3MMY B;  2EWN A;  2UUZ A;  1FOY A;  4HLY A;  1DGR M;  4C3H J;  4M9X A;  1U3E M;  2WWY A;  4A6D A;  1TQP A;  1OCP A;  2JK3 A;  3PL8 A;  3E97 A;  3G4S I;  1L3L A;  4UY8 I;  2CGP A;  1XCB A;  5LFA A;  4P1W A;  5DCM A;  1T98 A;  4ZTJ A;  3GME A;  1HW2 A;  1DU0 A;  1I3A A;  4XLP F;  1DU6 A;  1UST A;  1K6Y A;  3ISP A;  1JTY A;  1QVU A;  2P6S A;  3S1R J;  2LFB A;  4XLA A;  2GM4 A;  2QQB A;  2QWW A;  3WTS C;  1TNT A;  1FBU A;  2Y0S N;  1J5Y A;  2FNP A;  1MNE A;  3JR9 A;  3FBI B;  1HF0 A;  4BBS J;  1JJ6 C;  2C6Y A;  1BW6 A;  2EV0 A;  2Y69 H;  4WF2 A;  4S0H B;  4MQV A;  4C30 A;  1WI9 A;  2CV2 A;  4HEA 2;  2F4M B;  3KEY A;  4NBQ A;  3L1P A;  2KRH A;  1GV5 A;  2MLG A;  1JI8 A;  1IV6 A;  1FYM A;  2YX7 A;  3KZY A;  2XAG A;  3LQR A;  2FBK A;  3LAJ A;  2L9R A;  4E7I A;  2NNY A;  4CSW A;  2K4J A;  2K9S A;  3F8N A;  3HM5 A;  3O3K A;  4BQQ A;  2I5U A;  3AG4 H;  2XAU A;  1LKX A;  2IGM A;  2P81 A;  2VKV A;  5J8C A;  5AIP A;  5IT9 Z;  1A6I A;  2O8K A;  2B63 J;  1O3Q A;  5C44 J;  4IJA A;  3H0D A;  1SFX A;  1KYZ A;  2BVL A;  4E6K G;  4BQO A;  3D5S C;  4CHU A;  3BRO A;  2LY9 A;  1FBQ A;  1K79 A;  2GA1 A;  2HQN A;  3F21 A;  1O3T A;  2K7L A;  3P9C A;  1IDZ A;  1FIP A;  2G7H A;  5JVG F;  3ZXS A;  4A3K J;  2IA1 A;  1I27 A;  4J01 A;  1BN5 A;  2XPV A;  3U21 A;  3BT9 A;  1H88 C;  4LG0 A;  1ON1 A;  2IJL A;  4BGD A;  2QBY A;  5J6X A;  4D0P A;  1MMS A;  2NVQ J;  1H0M A;  4L5J A;  1R00 A;  5K5O A;  2M1B A;  3EUK L;  5EG0 B;  5FB2 A;  5BNG A;  3TDZ C;  1O3S A;  3NAU A;  3V4G A;  3GZ6 A;  2LG4 A;  1D1C A;  2LYC A;  1TT0 A;  3CF5 F;  2XAS A;  2YSR A;  3GW2 A;  1D1B A;  3L2R A;  2AQE A;  4C3I J;  1R4N B;  2H09 A;  3GZN B;  3HSR A;  2EIJ H;  1UZC A;  1KQ9 A;  2M0C A;  2DA4 A;  2MA3 A;  1YYV A;  2LD5 A;  1E0E A;  1BJZ A;  2JA5 J;  1HDD C;  2ZJR F;  1S3J A;  4IPA A;  5CQG A;  3E5U A;  3SJM A;  5CKT A;  4UV8 A;  1O7F A;  2K02 A;  5DD8 A;  2DPD A;  3RZO J;  5CPR B;  2LOO A;  5IP7 J;  3IC7 A;  3J81 K;  1I1G A;  5IOZ A;  3C18 A;  2HQ5 A;  2DA3 A;  2NYX A;  3CUO A;  3PUF A;  4IQ4 A;  1IG7 A;  4Q48 A;  2FU4 A;  4IXA A;  5J8F A;  5B66 C;  2IS6 A;  2NS8 A;  5D5W B;  2NVU B;  1RPW A;  2MGQ A;  2O7O A;  2ZJQ F;  2G0E A;  3VYS B;  3ASN H;  2L7K A;  4G8X A;  4LMY A;  2F4I A;  1RET A;  3HTU A;  1U5T A;  2QGU A;  1HDP A;  5DEQ A;  1A36 A;  4BY7 J;  2IXS A;  2VJJ A;  2VBW A;  4HW0 A;  4M73 A;  1X3W B;  3HOS A;  3RTR A;  5ICC A;  3G6E I;  1OYW A;  3KIO A;  4AIJ A;  3HOZ J;  2H6C A;  2VKH A;  5FLM J;  5FD5 A;  5HDG A;  1UFM A;  2JA2 A;  2L7M P;  3S2W A;  2HOT A;  4P96 A;  1SAN A;  2XAQ A;  3W6V A;  5EEA A;  3BR0 A;  2GOM A; 
#chains in the Genus database with same CATH homology
 5DYM A;  2IP2 A;  3IHU A;  5IT3 A;  2JRT A;  1EV7 A;  4L0Y B;  4WXC A;  4AVP A;  2NAZ A;  4ETS A;  4WX9 A;  3BPX A;  3JSO A;  4EJT A;  1ZG5 A;  2KIM A;  1R23 A;  4O3M A;  1V4R A;  3R60 A;  2FXA A;  2OZ6 A;  4A6E A;  2MBF A;  3R0A A;  3RYR A;  2EFQ A;  1W5S A;  4KT5 C;  1WWX A;  3SZP A;  1FNN A;  1BBY A;  3RYP A;  2LF7 A;  3E6C C;  3PFI A;  2OQG A;  3HRM A;  1P92 A;  3WG9 A;  3KE2 A;  1R5H A;  4RB3 C;  1LDD A;  2WV0 A;  1ZGJ A;  4HLX A;  5FLX K;  2RV8 A;  5E1X A;  3WTW C;  3GX4 X;  2DQR A;  1XD7 A;  4XSZ F;  3FZV A;  3FMS A;  3G3Z A;  3Q9S A;  5L3C A;  2Z3Y A;  2JTV A;  3RI4 A;  1DPU A;  4A2U A;  5LBQ A;  2X0L A;  1MJB A;  5LLQ A;  1TLH B;  2Q8K A;  3FXQ A;  2GZW A;  3IKV A;  5BPI A;  1GHC A;  1ZGA A;  3TOB A;  2HR3 A;  1ZLK A;  4HDU A;  5D6F A;  2DK8 A;  2O03 A;  3SZT A;  1OYI A;  4M72 A;  2QLZ A;  1I1S A;  1XMK A;  3HRS A;  3LWF A;  4CIC A;  2FNA A;  4L9J A;  1R36 A;  3HRT A;  2QQA A;  2FMY A;  4IF4 A;  2PMH A;  3ZMZ A;  2COM A;  3FMQ A;  1BC7 C;  1ZRF A;  1KU7 A;  5DCM B;  1ZG3 A;  2EV6 A;  3RPU A;  3F8B A;  2EB7 A;  2Y0M A;  1UCR A;  5EEH A;  4RB1 A;  5JVT A;  4GYI A;  2XRN A;  4EM1 A;  4QWQ A;  1QNT A;  5EEG A;  2BV6 A;  2NNN A;  5BQT A;  1S7A A;  5H6Q A;  2V1U A;  1ZN2 A;  5DUI A;  1ULY A;  3ECH A;  2DW4 A;  5K5R A;  5LRS A;  2DBB A;  2VON A;  1AWC A;  5D4S A;  3HRU A;  5HS7 A;  3C7J A;  1F4K A;  2O3F A;  2ZXJ A;  5BS6 A;  2DQL A;  2LF8 A;  3R6S A;  2BYV E;  3L00 A;  5H6R A;  4A0Z A;  1OMI A;  1ZAR A;  4HF0 A;  5AIQ A;  3K1P A;  1I5Z A;  3KP4 A;  3C1D A;  3WTZ A;  4LG0 B;  1D8K A;  2QBY B;  1KA8 A;  2M30 A;  1FBS A;  1XGM A;  3GFJ A;  3KP2 A;  3MFK A;  4Y17 A;  1XCV A;  5F1R A;  1RUN A;  3RPQ A;  1Z6R A;  2ESN A;  1B4A A;  3VOD A;  2Z9O A;  2R3S A;  3QU6 A;  4YFN F;  1ZYR F;  3DV8 A;  3I71 A;  4ENJ A;  2H27 A;  5ILU A;  3D5L A;  5LGN A;  2PFB A;  3KEO A;  4KDP A;  1RZ4 A;  3O2P E;  5ED4 A;  2F5D A;  2W85 A;  2FQ3 A;  3J80 Z;  1U5T B;  3I4P A;  3L7W A;  1JHF A;  3ZPL A;  4MTD A;  2LSO A;  3REO A;  1T39 A;  4HBL A;  4EJW A;  2A07 F;  3Q5F A;  2LNB A;  2STT A;  3RJP A;  1FSE A;  1BI2 A;  1HKQ A;  5LHH A;  2P7C B;  2OA4 A;  2XAJ A;  2P5L C;  1P2F A;  1XDU A;  3KZZ A;  4N9H A;  3VFZ A;  1CF7 A;  4RGX A;  2W24 A;  4RGU A;  1W4M A;  3FXR A;  3NRV A;  2RQP A;  1RNL A;  3HSE A;  3ZN1 A;  2PEX A;  4UVC A;  2RNJ A;  4IRG A;  1G3Y A;  3EDP A;  2ZCW A;  1SD5 A;  2W57 A;  2VOD A;  2CG4 A;  2OZU A;  4RS8 A;  5HLH A;  2V79 A;  1S8N A;  1QZZ A;  4EM2 A;  1U2W A;  1J75 A;  2LDU A;  1HQC A;  4KN4 X;  2VOO A;  2Q2E A;  4G7H F;  3DPT A;  5K5Q A;  3FF5 A;  3ROU A;  3F3X A;  2UWM A;  5DDG A;  2HEO A;  4B09 A;  4CXF A;  1MGT A;  4OU0 A;  4ENM A;  3RKX A;  4ZZL A;  2F5E A;  2XAF A;  3SHF A;  3GFL A;  1ON2 A;  4HDV A;  2STW A;  1J7K A;  2YX4 A;  2XAH A;  4OIQ F;  2VT3 A;  3WGH A;  1TNS A;  4HQM A;  1WRJ A;  3BY6 A;  2WC2 A;  2W84 A;  3GWZ A;  4YIF A;  1HW5 A;  3K2Z A;  4OOI A;  5FFX A;  4P9U A;  2VE8 A;  3EET A;  4CYD A;  4KIB A;  3W6J B;  2ELH A;  4OMZ A;  4CDG A;  2F5C A;  5E20 A;  5LRR A;  1C0W A;  1TQI A;  3WOD F;  3FM5 A;  3K69 A;  2ZNZ A;  1B6A A;  3MAJ A;  1T6S A;  1K78 A;  1MJ9 A;  2EFW A;  2GA2 A;  3F8C A;  3K1M A;  1PUE E;  3H3U A;  3M8F A;  1JE8 A;  5D8K B;  3CUQ C;  3U9G A;  1R58 A;  1BIB A;  1TQM A;  4MGR A;  1P4A A;  3HHG A;  1BC8 C;  1DDN A;  2JSC A;  2KKO A;  5D5X B;  2M45 A;  4EJU A;  1IN8 A;  3OOP A;  4U88 A;  3F22 A;  2HKX A;  2PN6 A;  4BHB A;  2VC0 A;  4K2E A;  3T8R A;  3HIF A;  2ZNY A;  1BI0 A;  1YFH A;  4ZH4 F;  2PJP A;  1Y0U A;  2E1N A;  4LLG F;  3WTY C;  2MH2 A;  2JPC A;  3TOA A;  1SAX A;  1H9T A;  4I0A A;  1KQ0 A;  4P5O A;  5AON A;  4ZYE A;  4LB5 A;  5L3B A;  2OD5 A;  3WTU C;  4MHG A;  3N4M A;  2KJC A;  5LGT A;  2MLK A;  3DPL C;  4ZYH A;  1IW7 F;  4EM0 B;  3M1E A;  1RI7 A;  1T38 A;  1IF1 A;  2O6G E;  3BP8 A;  5F6F A;  3I0T A;  1KQ8 A;  1TTY A;  3QPH A;  5H20 A;  3RIR A;  5HDN A;  4IVN A;  1YTY A;  4RGR A;  2PI0 A;  3ML6 A;  1FP2 A;  2K4B A;  4BHC A;  1DPR A;  2J5O A;  3QP5 A;  1R1U A;  5JR3 A;  1XGS A;  1BJA A;  1RUO A;  5D5U B;  3G73 A;  3GFM A;  2GAU A;  4G7O F;  1D5V A;  1SD4 A;  4P55 A;  4HV6 A;  3L9F A;  1KU3 A;  3LA7 A;  3QP6 A;  3HSF A;  2XKP A;  4OIP F;  1HW1 A;  1XSV A;  4ZZD A;  3V7S A;  2J5P A;  1YW9 A;  3ZMD A;  4G6Q A;  1BI1 A;  2DTR A;  2MC3 A;  4PZJ A;  2EA4 A;  1I6X A;  2IA0 A;  1ONV A;  3NEU A;  3KLO A;  2RC4 A;  3H3Z A;  2G7U A;  1Z7U A;  3DXJ F;  1UB9 A;  4BH9 A;  4AIK A;  1A04 A;  4A5N A;  3ELK A;  5LEK A;  3TGN A;  3WU1 B;  2L02 A;  5E8G A;  1PP8 F;  1F5T A;  4GGG A;  4L5I A;  1DP7 P;  4M6Y A;  1SD6 A;  4A0X A;  2E7W A;  3F23 A;  1CF7 B;  2VOP A;  3J81 Z;  1IXS B;  4L9N A;  5E1Z B;  1FX7 A;  1ZRD A;  3BJO A;  3IKT A;  1REP C;  4CZZ A;  1J2X A;  2H6B A;  4IHS A;  2D1H A;  1J9I A;  4GCV A;  4MQ9 F;  1BIA A;  5D8L B;  3E5Q A;  2G9W A;  4WK8 F;  4KYW A;  1G6N A;  1QGP A;  4I0B A;  3ZQ7 A;  3ECO A;  2HS5 A;  3U2R A;  1B1B A;  1K6O A;  1XN7 A;  5E17 F;  1SMT A;  4R8H A;  3VEP A;  5LEJ A;  2IW5 A;  4HA8 A;  3I54 A;  2D1V A;  2MH9 A;  3I5U A;  4G94 A;  2QZ8 A;  4HZF A;  1BI3 A;  4KIG A;  3H92 A;  4DQ2 A;  5D4R A;  4JK1 X;  4I7H A;  5CVI A;  5CLS A;  5ILS A;  2IVM A;  4DNC A;  4M74 A;  2PQ8 A;  3ERE D;  2XRO A;  1XSX A;  3GXO A;  2CSO A;  4KNY A;  1T0F A;  4E70 A;  1SMY F;  4KIC A;  5ICE A;  3WE2 A;  5FLX Z;  1AOY A;  2M8E A;  5LHG A;  4EJV A;  3DEU A;  2D45 A;  4BQA A;  3E5X A;  1LDK B;  2XVC A;  4Q5S F;  1K78 B;  3L2C A;  4GYG A;  2FA5 A;  3DP7 A;  5HLI A;  1QO0 D;  4EGY A;  1FWZ A;  4PGG A;  3FX3 A;  3TO7 A;  1U6G A;  3DQV C;  4YII A;  2Z33 A;  1GVJ A;  3NQO A;  4GXO A;  4JQF A;  2L01 A;  3KP7 A;  3ABT A;  1D8J A;  1MZB A;  4NQW A;  1FC3 A;  3WTX C;  3JAM Z;  1S6L A;  2RKH A;  1B9M A;  5HS8 A;  4WWC A;  4EV0 A;  2BGC A;  3V7R A;  1IN5 A;  2PG4 A;  4R1H A;  3MEX A;  5CVV A;  2PBI A;  3FMR A;  4LK0 F;  2ESH A;  3T8T A;  2L54 A;  1XGO A;  2P6T A;  4LLN A;  2PLY A;  4XBF A;  1Q1H A;  3KP6 A;  1EH7 A;  1Z9C A;  3E6D A;  4WCG A;  3L09 A;  3JTG A;  5KVR A;  1NHA A;  5LHI A;  3ZMS A;  1FOK A;  3I64 A;  3LQQ A;  4LLL A;  4B8X A;  3KP5 A;  3SQN A;  1J0R A;  5KK1 A;  2HTS A;  3V8L A;  1E17 A;  2P5V A;  4NHJ A;  2QVO A;  1KU9 A;  3I58 A;  4OIN F;  3K0L A;  1GXQ A;  4M6X A;  2ZBK A;  1ZH5 A;  2DI3 A;  4FHT A;  2A61 A;  4IRI A;  2YR2 A;  2UZK A;  3ZMV A;  2NS0 A;  3B02 A;  1IXR C;  3V8J A;  2P5K A;  1XB4 A;  2RVC A;  3ZP5 A;  2NRA C;  1F9N A;  3MWM A;  3GZ5 A;  4N9I A;  4KFC A;  4YFX F;  2ZJ2 A;  3JSP A;  4PDK A;  5FO5 A;  3GEZ A;  2VBX A;  1CGP A;  3KCC A;  1F1Z A;  2ETH A;  3M7G A;  3VB2 A;  5HDK A;  1JXS A;  4KA4 A;  4LFU A;  4UVA A;  2GXB A;  4FX4 A;  1FT9 A;  3IWZ A;  1FP1 D;  3HYI A;  3IWF A;  4ESF A;  3PQJ A;  4P9F A;  1W7P A;  1VTN C;  1G4D A;  4I09 A;  1U78 A;  2EK5 A;  5ERI A;  4LK1 F;  4EVI A;  4YG2 F;  3OV8 A;  5L3E A;  5LGU A;  1QPM A;  1KU2 A;  5ILV A;  2KIF A;  3FHZ A;  3CUQ A;  3F72 A;  4TV7 A;  2HKO A;  4LJZ F;  1WSU A;  3HHH A;  1FZP B;  2IA2 A;  4JBA A;  2F2E A;  1LNW A;  3LAP A;  4BYY A;  2IT0 A;  3I59 A;  3WGG A;  1V3F A;  1ZLJ A;  3HUG A;  1WQ2 A;  4LGW A;  3V8K A;  3ULQ B;  5DCF A;  3GLX A;  4AD9 A;  3WTV C;  2HWV A;  3CLO A;  1R22 A;  3K9T A;  2V1X A;  4U7B A;  4U0Y A;  1Z05 A;  3BJ6 A;  4H0E A;  5IT9 K;  1LB2 A;  2K27 A;  4MEX F;  3LST A;  4QLC U;  4Q4Z F;  4M9S A;  4IRH A;  1IZ1 A;  5CJ9 A;  2PMU A;  1EH8 A;  2GQQ A;  4HF2 A;  2HYG D;  5A2Q Z;  3BJA A;  3I53 A;  5E18 F;  4UHT A;  1MD0 A;  2OBP A;  2GWR A;  1W7P D;  2EFO A;  4M71 A;  2KIU A;  1R7J A;  4BAY A;  2ACJ A;  4L9T A;  2L3D A;  4Y13 A;  4BXU A;  5JFR A;  3F6V A;  1B59 A;  5CYV A;  2XGX A;  1OYY A;  2DPU A;  2GXG A;  3GYH X;  3WE3 A;  2EJR A;  4RGS A;  2V9V A;  1O57 A;  1ZG1 A;  3KEQ A;  1G3W A;  4U7D A;  5FGM A;  1HKT A;  3QAH A;  4HOB A;  2XKO A;  4HX7 A;  1G3S A;  2Z5U A;  3RDI A;  2CO5 A;  1FY7 A;  2A68 F;  2BBY A;  1XGN A;  2A5Y B;  1YS7 A;  3P7N A;  2IPQ X;  2CYY A;  1H9G A;  3LA3 A;  1FSH A;  2P8T A;  3E6B A;  4O5V A;  5F64 A;  3KLN A;  2Q0O A;  2DK5 A;  1IUY A;  4L9V A;  3EYY A;  2QEN A;  5HS9 A;  2EFN A;  1EH6 A;  3BPV A;  3SFZ A;  2M5W A;  1B9N A;  4ZYG A;  3WTT C;  2OQR A;  5D6E A;  4ASN A;  2GIV A;  2R7F A;  2UXN A;  1LEA A;  2QUF A;  5HVQ C;  2CWE A;  4ON0 A;  2JPB A;  3GO5 A;  4FX0 A;  4HX8 A;  2FBI A;  3CO7 C;  3W6K B;  1UHM A;  5FFZ A;  2EA2 A;  2VE9 A;  2FEZ A;  2FBH A;  2DU9 A;  4N0B A;  1ZRC A;  4KMF A;  3TO6 A;  2F5F A;  3COA C;  1IN6 A;  1WKM A;  2DO7 A;  1L0O C;  2D2W A;  2HGC A;  2E1C A;  2RDP A;  4IHT A;  3U1D A;  2E7X A;  3HTS B;  1RIO H;  1QBJ A;  1JHH A;  2XV4 S;  2YU3 A;  3TKY A;  1FYK A;  3RKY A;  1BM9 A;  3IRQ A;  1HXD A;  2FML A;  3ABU A;  3DKW A;  5DD4 A;  1OR7 A;  1SFE A;  2DFI A;  3HOT A;  4PCQ A;  4AIH A;  4U0V A;  1GXP A;  2QQ9 A;  1O3R A;  1LQ1 A;  4UUV A;  1E2X A;  1PDN C;  2ISZ A;  2VBY A;  4KUM A;  3IRR A;  4L18 B;  4XRF A;  5JHU A;  2ZFW A;  5DUK A;  1FYL A;  2RGV A;  2ADU A;  1IN4 A;  4I98 B;  3EUH A;  2HOE A;  4RAZ A;  4HV5 A;  3P9I A;  5E8I A;  2VBZ A;  2JZY A;  2M87 A;  2IRF G;  4UV9 A;  4G6D A;  3MQ0 A;  2VT2 A;  1YLF A;  1P4W A;  2HYF A;  2FE3 A;  4HX4 A;  3V7C A;  3PQK A;  4OMY A;  2HQR A;  2A6E F;  2QM3 A;  2X4H A;  2B0L A;  6PAX A;  1MDM A;  4R79 A;  4XSX F;  4OIR F;  2FOK A;  2UXX A;  1W7P B;  3M8E A;  4A12 A;  2CFX A;  4OIO F;  3FXU A;  1YO5 C;  4U0W A;  4RB0 A;  1JGS A;  2XHK A;  2Y75 A;  1U5T C;  3CUQ B;  2HDC A;  1P6R A;  1LVA A;  1FPQ A;  3TQN A;  2ZO4 A;  5CVR A;  5BMZ A;  1YW8 A;  2V1D A;  3I59 B;  3P9K A;  2XUB A;  3SXY A;  3CDH A;  4I01 A;  3MZY A;  2ZME A;  1P4X A;  4S05 A;  3R4K A;  3GVA A;  4RAY A;  3QPT A;  1QZY A;  5L3F A;  3O6B B;  3JAM K;  2A6H F;  3QOP A;  4CO8 A;  3BWG A;  1YG2 A;  2JT1 A;  4AWX B;  2FSW A;  2P7V B;  4EJO A;  1T2K A;  5TRD A;  1PP7 U;  4G9Y A;  2MD5 A;  3RKW A;  3TDU C;  4YFK F;  5ICG A;  1D3Y A;  1W5T A;  1IRF A;  1SFU A;  2W25 A;  2DAO A;  4A0Y A;  3TO9 A;  2EFP A;  3DFG A;  5L3D A;  4XLN F;  1KGS A;  2H94 A;  1Z1D A;  4A5M A;  1IRG A;  2Y48 A;  2WTE A;  3AAF A;  3EQL F;  3R61 A;  1DUX C;  3B73 A;  4RB2 C;  3CO6 C;  4ENN A;  3F8M A;  1S29 A;  3T0Y A;  3R0J A;  2XIG A;  1USS A;  2BE5 F;  4WXH A;  1ZRE A;  4HF1 A;  3J80 K;  3QRF F;  3JW4 A;  3T1B A;  2FRH A;  2VN2 A;  4Q47 A;  1ZHF A;  2BEO A;  3JTH A;  3KFW X;  5HOO A;  1TW2 A;  4KN7 X;  3MZH A;  3KP3 A;  1YQA A;  4ESB A;  5D5V B;  4KIF A;  4PGH A;  3GF2 A;  1HKS A;  2ISY A;  2A3S A;  4MTE A;  4G7Z F;  3WU0 A;  5JI6 A;  1IXC A;  4EQQ A;  2AXL A;  4HQE A;  1LEB A;  4LD5 A;  3IL2 A;  3GUD A;  5DV5 A;  3LA2 A;  1IN7 A;  4MEY F;  2YPR A;  4MNU A;  1O7L A;  3VOE A;  4Z2Y A;  1ODD A;  2HZT A;  2O0Y A;  3FWE A;  2P4W A;  5TJJ A;  3CTA A;  1QQI A;  3QU3 A;  5CVJ A;  5E1W A;  4KMU X;  1Z6T A;  1R1V A;  1XMA A;  2ZKZ A;  5BPD A;  3ZMT A;  2TDX A;  1IAW A;  2HFH A;  1TW3 A;  4GO1 A;  2L4A A;  2LKP A;  2V6C A;  1UHW A;  1U8R A;  1HST A;  3BOQ A;  3K1N A;  1MJA A;  4M9Z A;  3T5X A;  5K1Y A;  2DT5 A;  1G3T A;  1K7A A;  4I02 A;  4UNO A;  2K86 A;  3KET A;  2HTJ A;  3GFI A;  2Z99 A;  4O6J A;  3F6O A;  1X3U A;  1ZAO A;  2CQK A;  4UVB A;  5ICF A;  1YIO A;  3EYI A;  3ZMU A;  2O8X A;  5FD6 A;  1OPC A;  2OU2 A;  2KRF A;  2RN7 A;  4HAM A;  1SD7 A;  5HLG A;  4ESJ A;  3E3V A;  2L4M A;  1YS6 A;  2KJB A;  4FT8 A;  3FM3 A;  1S7O A;  1J59 A;  3LFK A;  1R5G A;  2VC1 A;  5A2Q K;  4S04 A;  3M9A A;  1HBX G;  1BOA A;  4F7Z A;  4I2O A;  4ZYD A;  4WXD A;  3ZN0 A;  1MDM B;  4BHP A;  3WGI A;  2R7D A;  1YW7 A;  1R1T A;  3C3W A;  2A69 F;  4Y15 A;  1FLI A;  2VXZ A;  5L3G A;  1LJ9 A;  2EV5 A;  4UXN A;  1STZ A;  3DF8 A;  3F8F A;  1TBX A;  5CVU A;  4L0Z B;  1LDJ A;  3E6M A;  2O61 A;  3Q9V A;  1XSD A;  3BZ6 A;  2CW0 F;  4LB6 B;  1Z91 A;  4ENK A;  2DLL A;  1OKR A;  3N97 A;  5BOX A;  4EGZ A;  2AS5 F;  1KYW A;  1MKM A;  4HYE A;  3CJN A;  4NB5 A;  2QYO A;  4BNC A;  2ZME B;  1XDS A;  3D0S A;  2OAZ A;  2FF4 A;  3J7A O;  1HSJ A;  3BDD A;  3MCZ A;  2EWN A;  4HLY A;  4M9X A;  1U3E M;  2WWY A;  4A6D A;  1TQP A;  3E97 A;  1L3L A;  2CGP A;  1XCB A;  5DCM A;  1T98 A;  1HW2 A;  4XLP F;  1UST A;  3ISP A;  2P6S A;  2QQB A;  2QWW A;  3WTS C;  1TNT A;  1FBU A;  1J5Y A;  2FNP A;  2C6Y A;  2EV0 A;  4WF2 A;  4MQV A;  1WI9 A;  2MLG A;  1FYM A;  2YX7 A;  3KZY A;  2XAG A;  3LQR A;  2FBK A;  3LAJ A;  2NNY A;  2K4J A;  3F8N A;  3O3K A;  5J8C A;  5AIP A;  5IT9 Z;  1O3Q A;  4IJA A;  1SFX A;  1KYZ A;  4CHU A;  3BRO A;  1FBQ A;  1K79 A;  2GA1 A;  2HQN A;  3F21 A;  1O3T A;  2K7L A;  3P9C A;  2G7H A;  2IA1 A;  1I27 A;  1BN5 A;  4LG0 A;  1ON1 A;  2IJL A;  2QBY A;  5J6X A;  4D0P A;  1H0M A;  4L5J A;  1R00 A;  5K5O A;  2M1B A;  5FB2 A;  3TDZ C;  1O3S A;  3V4G A;  3GZ6 A;  2XAS A;  2YSR A;  3GW2 A;  2H09 A;  3HSR A;  1KQ9 A;  2MA3 A;  1YYV A;  1S3J A;  4IPA A;  3E5U A;  4UV8 A;  1O7F A;  2K02 A;  5DD8 A;  2DPD A;  3IC7 A;  3J81 K;  1I1G A;  3C18 A;  2NYX A;  3CUO A;  4Q48 A;  2FU4 A;  4IXA A;  5J8F A;  5D5W B;  4G8X A;  4LMY A;  3HTU A;  1U5T A;  5DEQ A;  2VBW A;  4HW0 A;  4M73 A;  3HOS A;  3RTR A;  5ICC A;  1OYW A;  4AIJ A;  2H6C A;  5FD5 A;  5HDG A;  1UFM A;  3S2W A;  4P96 A;  2XAQ A;  4CGZ A;  4EMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...