1LNWA

Crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
b'NYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance operon repressor
publication title Crystal structure of the MexR repressor of the mexRAB-oprM multidrug efflux operon of Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription repressor
total genus 48
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lnwA01
2OU2A 3ZMDA 4A6DA 2QUFA 4B09A 3R6SA 3CTAA 5CJ9A 4WXHA 3CDHA 4GYGA 3GO5A 3EQLF 3ZMTA 3G3ZA 4Y17A 4H0EA 2JT1A 1FSEA 2FXAA 4RB0A 3MCZA 3V8LA 2M45A 5LHHA 3WU0A 1R22A 2M5WA 1HW5A 3U1DA 5K5QA 4U0VA 3GFJA 2JRTA 5FO5A 3CO7C 5K5RA 1O57A 3HSFA 1MJAA 3SXYA 2D1VA 2HS5A 2BYVE 3FM5A 1W5SA 3GFLA 4UUVA 5AONA 3JTGA 1R1VA 3WTXC 1STZA 4O6JA 1R5GA 3F8MA 2DU9A 2NYXA 5D8KB 4MNUA 3FXUA 2P5VA 5DD8A 1MJBA 1T0FA 4BYYA 3OOPA 2XAGA 1XD7A 2HYFA 1TLHB 1YQAA 4HQEA 1ZH5A 2XUBA 4JBAA 3LWFA 3P9CA 3KE2A 1XSVA 3KP4A 1D5VA 2QQ9A 2RDPA 1FBSA 2XIGA 5BQTA 3VODA 3IRQA 3P9KA 3WGHA 5D6EA 3RI4A 3IWZA 3RIRA 2Z33A 4ON0A 3BWGA 4M6XA 1WI9A 4M74A 2GA1A 1T38A 2OD5A 1YO5C 1IN8A 3LAJA 2BEOA 4IXAA 1O3QA 5D5VB 2CGPA 1UB9A 2RNJA 4HF1A 4EM2A 4ASNA 2DW4A 1J7KA 2LDUA 4HA8A 1IN4A 2EA2A 1T39A 4HW0A 4M72A 2FNPA 2NAZA 2PMHA 2QQBA 3HYIA 2V9VA 3LQQA 1H0MA 2O0YA 4RGRA 2FOKA 3ABTA 2XGXA 3I59A 4L9TA 3EYYA 1HQCA 1CF7B 4BHPA 3DPLC 2EWNA 4A0XA 1IXSB 4EJVA 3BOQA 3I71A 4CO8A 5L3BA 3JAMZ 3RKXA 2DAOA 5CVRA 4GGGA 1RIOH 2F2EA 2VXZA 5J8FA 1LDJA 3EUHA 1R7JA 2D1HA 4MEYF 5ED4A 1SD5A 3E6BA 1F1ZA 4S04A 5DCFA 2HWVA 4PZJA 1DP7P 3MFKA 1YLFA 3W6KB 4ZYEA 2GXGA 2GAUA 3F8CA 3I64A 2O3FA 1U3EM 4L9JA 3TOBA 2K4JA 2HFHA 3J81Z 1XGMA 2ACJA 2UWMA 2CG4A 5D6FA 2KJBA 2L02A 4OIQF 3FMRA 3F21A 3T8RA 1TQPA 2OQRA 3QPHA 3KP2A 4LLGF 1U2WA 2MBFA 3HSEA 2BE5F 2XVCA 3ZMUA 1I27A 6PAXA 3IHUA 4XSXF 1XGSA 1HBXG 4GXOA 2O6GE 4FHTA 4WXCA 1VTNC 2OQGA 5CVVA 2EJRA 5K1YA 2WWYA 4L5JA 2NS0A 2EA4A 1K78B 2RN7A 3F8FA 1HXDA 5F6FA 4IHTA 1CGPA 1ZG5A 2DQLA 3KZZA 1O7LA 3E5XA 4HLXA 3V8KA 3IKTA 2XV4S 2PQ8A 2HTJA 2JPCA 1IN7A 5CVUA 1XGNA 3HTUA 1XCVA 2LF8A 3ULQB 2PLYA 4I98B 2M8EA 1T6SA 2ZXJA 4KT5C 4LD5A 2IA1A 2HEOA 1D3YA 3TDUC 1KU7A 4HX7A 5JVTA 2ADUA 1IAWA 4UVBA 4BHBA 4UV8A 1D8KA 4IRIA 1BI3A 1MZBA 5L3FA 4HF2A 3O2PE 1Z91A 2EV0A 4KIBA 2MH2A 1J0RA 5HLGA 4OIRF 3LA2A 4EV0A 3KP7A 2JPBA 2M1BA 3NQOA 4UHTA 3K1NA 2YSRA 4LG0B 5HLIA 2ZMEB 3KLOA 4KN7X 2DI3A 1P2FA 1W7PD 1YTYA 2WC2A 3KCCA 3JW4A 2QBYB 4OMYA 2XKPA 1I6XA 4L9NA 2ZNZA 2FEZA 3FMQA 5LHGA 5HS7A 1OKRA 3BY6A 1ZRFA 2PJPA 3P9IA 3VOEA 3KETA 2BBYA 2OZ6A 4XLNF 2MLGA 1Z6TA 2OZUA 4YIFA 3KP3A 1TNSA 4MGRA 1IF1A 3FHZA 5FD5A 4OINF 5DUKA 1HSTA 2ISZA 4LMYA 1XSXA 3K9TA 3D5LA 5LRSA 3W6JB 3EDPA 3RKWA 2MD5A 2VT3A 2ZKZA 3FM3A 2H94A 3E6DA 4I0AA 3I5UA 5ICGA 2QM3A 3SHFA 5DDGA 4IPAA 1B9NA 3TO9A 1ULYA 2Q8KA 1TTYA 1DPUA 2XAJA 3LA7A 4RS8A 5D5UB 3DFGA 2NRAC 4DNCA 3GEZA 4EM1A 3H92A 3BJOA 3ZMSA 3GFIA 2E7XA 4A5MA 5F64A 4I2OA 2R7DA 3VFZA 4CZZA 3VB2A 5ILUA 3QU3A 3FXRA 1U8RA 1BIAA 5LHIA 3MEXA 2F5FA 5DCMB 1KU3A 4EJUA 1AOYA 3GLXA 1PP7U 4LB5A 3DQVC 4I01A 4CXFA 1Y0UA 2L01A 4L18B 1I1GA 4I09A 1YG2A 3ELKA 4YIIA 2IPQX 2CSOA 4M9SA 1J2XA 1FP2A 2E1NA 2KRFA 1W7PA 1DUXC 1LJ9A 4NB5A 5L3GA 1T2KA 3WTTC 1EH7A 3QAHA 4LFUA 2KIMA 2V1XA 3ZQ7A 1ONVA 5FLXK 2YR2A 2IA0A 5DD4A 1FC3A 1SFUA 3OV8A 2DPUA 1ZGJA 1JXSA 4M71A 3GYHX 3TGNA 5IT3A 2FBHA 4MQVA 3HRSA 1FYLA 4PCQA 2G9WA 2UXNA 5DV5A 2J5OA 3FWEA 3RKYA 4I7HA 5HVQC 1TQIA 3DPTA 4ESJA 5CYVA 2VODA 1U6GA 1I1SA 3F8NA 4MEXF 4XBFA 1HKQA 5D8LB 2CO5A 2R7FA 4CDGA 2K7LA 3JSPA 3IKVA 3E6MA 3SZPA 5CVJA 1E17A 3BPXA 1FZPB 2VC0A 4QLCU 3L00A 5EEGA 1LDDA 5LGUA 5BMZA 4LB6B 4Z2YA 3J80K 1BI1A 3O6BB 5A2QK 3N4MA 5HOOA 1R36A 2GIVA 3V8JA 2NNYA 2ELHA 1Z05A 4RB1A 4EJWA 1J75A 3RPQA 2OBPA 1QBJA 3PQKA 4BXUA 1EH6A 1B9MA 4ZH4F 4LK0F 4AVPA 4HDUA 2FSWA 5L3DA 2W25A 2YPRA 1UCRA 1F4KA 2H09A 2Y0MA 1DDNA 4BAYA 5AIQA 1YW8A 2Y75A 4KUMA 1OMIA 4Y15A 3CUQA 4KA4A 3CUOA 4PDKA 1QPMA 2EFOA 2L54A 1QGPA 1JE8A 4LGWA 4CICA 3C18A 1LEBA 2EFPA 4EM0B 1USSA 1ZAOA 2A68F 3P7NA 2DK8A 1OYYA 1RUNA 4YG2F 5H20A 2PI0A 1SMTA 4ENJA 2LKPA 4KN4X 4KFCA 2A69F 1JHHA 4IJAA 3FZVA 4XRFA 1U5TA 3ZN1A 2KKOA 4M73A 4HV6A 2DPDA 5D5XB 4P5OA 2L4MA 1W5TA 3K2ZA 5J6XA 2W57A 2DO7A 1R58A 3KP6A 3RYPA 3HHHA 1MDMB 3GVAA 2BV6A 2QZ8A 2VOOA 5F1RA 4G8XA 4MHGA 3RTRA 1J59A 4AWXB 3HIFA 3LQRA 1O3TA 2LF7A 5LLQA 5LEJA 4OMZA 3U2RA 4M9ZA 1K78A 1ON1A 2CYYA 3AAFA 1SFXA 4HF0A 3M9AA 1YS7A 3F23A 4MTDA 4A2UA 4IHSA 3REOA 1XDUA 1R1TA 5LRRA 2Z5UA 3I58A 3V7CA 3E5UA 2ZJ2A 3R0AA 3TKYA 2HQRA 3HRUA 5ICEA 2XAHA 3E5QA 2UXXA 2XAFA 1U78A 2W24A 3BDDA 4I02A 3KFWX 1KYWA 1IUYA 1IXRC 2HQNA 1P4AA 4FX4A 2YX7A 3C1DA 1EV7A 2R3SA 4CYDA 3CLOA 1MKMA 2HTSA 2LSOA 5BPIA 1BJAA 3GX4X 5L3EA 1FBQA 1P4XA 3KEQA 3D0SA 5TJJA 1WRJA 1USTA 1UFMA 4Y13A 2Z3YA 2IVMA 1ZLJA 2RQPA 1YFHA 1ZRDA 3BROA 5E1XA 4OIOF 1OYWA 3K69A 5IT9K 4ZYHA 2Z9OA 1B59A 1SFEA 2PFBA 2PMUA 3I4PA 4UVCA 2QBYA 2FQ3A 2JTVA 3J7AO 3E97A 3PQJA 3HSRA 4G6DA 2G7HA 5JR3A 2RKHA 2K4BA 3WTVC 1QO0D 3F8BA 2QVOA 3WGIA 3COAC 1PUEE 2F5DA 2GQQA 1QZYA 4NHJA 2MA3A 2P5KA 2PEXA 4EQQA 3ZMVA 3ML6A 1L0OC 1IN5A 5FLXZ 2MC3A 4KDPA 2F5CA 4ESBA 3QOPA 2DT5A 4XSZF 5LBQA 3BZ6A 1O3RA 4RGSA 2M30A 2DBBA 1O3SA 4AIHA 1BC7C 2VE9A 4UXNA 3IC7A 5DEQA 1TW2A 4LK1F 3DF8A 2K86A 5D5WB 4LLNA 2H6CA 4ENNA 3GXOA 3QP5A 3EETA 1FOKA 1S3JA 5J8CA 5AIPA 3R0JA 2C6YA 4HOBA 4L0YB 3MQ0A 2ZCWA 1R5HA 5DUIA 3K0LA 3SZTA 3TO7A 2ETHA 4M6YA 4ENKA 3H3UA 3ERED 3ZMZA 2FU4A 3J80Z 3WG9A 5LGTA 5A2QZ 3T0YA 3RDIA 3RJPA 3O3KA 4DQ2A 1OR7A 5ICCA 4WXDA 2J5PA 3FMSA 4FX0A 2KJCA 1ZLKA 2H27A 1BI0A 1S7OA 1FYKA 1TNTA 2FA5A 1F5TA 2HDCA 2IA2A 2ISYA 4R1HA 5JHUA 2GA2A 2IW5A 2HOEA 1SD6A 1UHMA 2FMLA 1H9GA 3ISPA 1Z1DA 2VOPA 1LVAA 1C0WA 4HX4A 4WWCA 3CO6C 4RAYA 4I0BA 4P55A 1G3WA 1REPC 2Q2EA 4RGXA 1ZREA 2O61A 1RUOA 3GW2A 4D0PA 2G7UA 3B02A 1KYZA 4U7BA 3J81K 5JI6A 4ZZDA 4HBLA 4G9YA 3M1EA 3M8FA 3TOAA 3QU6A 2IJLA 4YFKF 4WK8F 5TRDA 3RYRA 2MLKA 1RZ4A 3IWFA 5CVIA 2EK5A 1HKTA 2YU3A 2ESNA 4NQWA 4HV5A 2HZTA 2YX4A 1KU2A 3ECHA 1V4RA 4OIPF 2W84A 3GF2A 1K7AA 4U7DA 4Q4ZF 2AXLA 4JK1X 1ZG3A 4HYEA 1EH8A 2EV6A 4RGUA 2CWEA 5HS8A 2KIFA 2COMA 4O3MA 5BPDA 3T1BA 3BP8A 2EB7A 1SD4A 3GZ6A 5E17F 4RAZA 3K1PA 4BNCA 4BQAA 2P8TA 1FY7A 1KA8A 3BPVA 2HYGD 1ZG1A 5HDNA 1TQMA 2EFQA 2Q0OA 2X0LA 2XROA 4N9HA 2A3SA 4ZYDA 4PGHA 3U9GA 2A07F 3T8TA 2TDXA 1W4MA 1FX7A 3I0TA 2OAZA 3M7GA 2FBKA 2V6CA 3DKWA 2FMYA 4FT8A 1TBXA 1XDSA 3V7SA 1P92A 1AWCA 4A6EA 1WQ2A 1KGSA 3BJAA 3WTUC 4CHUA 3R61A 1B1BA 3ZPLA 5IT9Z 1HW2A 1HKSA 4HQMA 4YFXF 5E1ZB 4PGGA 3NEUA 5E20A 2WV0A 5E8GA 5HS9A 3L9FA 1G3TA 1XB4A 1IW7F 4L5IA 4TV7A 5FD6A 1CF7A 3WU1B 2HGCA 2M87A 4S05A 5FGMA 3E6CC 1MGTA 4M9XA 4U0WA 1J5YA 3VEPA 2V79A 3R60A 1JGSA 1FSHA 3WGGA 2XHKA 2VE8A 2K27A 1ZHFA 4AIKA 3I54A 3PFIA 4L0ZB 3NRVA 1FWZA 3V7RA 2DLLA 3TQNA 4IRGA 1W7PB 1HSJA 3HUGA 2GWRA 3Q9SA 3QP6A 4BH9A 3IRRA 3GUDA 3TDZC 1TW3A 2VBZA 1FPQA 2P5LC 4EGYA 1Z6RA 4F7ZA 3R4KA 1ZARA 2F5EA 2PG4A 3V4GA 4WX9A 3C3WA 5H6RA 3KP5A 4AIJA 2RC4A 1OYIA 2FF4A 2STTA 1BM9A 3F3XA 4IRHA 1RNLA 2IRFG 1MD0A 1L3LA 2FE3A 1R1UA 3WE2A 4G6QA 4WF2A 3CUQC 1P6RA 5L3CA 5DYMA 4P9UA 1PP8F 2KIUA 1G3SA 2GXBA 2FRHA 2QYOA 2DTRA 3C7JA 1K79A 2XRNA 3JSOA 4G7OF 2L3DA 4R8HA 1F9NA 3GZ5A 4L9VA 5D4SA 4Q48A 3IL2A 4EGZA 4OOIA 2A6EF 4CGZA 2VBXA 4OU0A 5E8IA 5HDKA 1S29A 4N0BA 3S2WA 3WTSC 2STWA 3G73A 1U5TC 3DP7A 2Y48A 2GZWA 1YW7A 1PDNC 4G7ZF 3GWZA 2E1CA 3BJ6A 1ON2A 3EYIA 4G7HF 3T5XA 4KIFA 1LEAA 1WWXA 1IZ1A 1LNWA 1Q1HA 4WCGA 2P4WA 3ABUA 4EMSA 1BIBA 1BBYA 3LSTA 4R79A 1RI7A 1FYMA 2K02A 1MJ9A 2QQAA 4U88A 3WTYC 5H6QA 1IRGA 1OPCA 3Q5FA 3CUQB 1XN7A 2P7CB 2LNBA 1XCBA 4Q47A 1BN5A 2ZBKA 3E3VA 3QRFF 2ZNYA 2PBIA 3LAPA 3ECOA 1K6OA 5BOXA 1G6NA 4KICA 4KNYA 4ESFA 1BOAA 1KQ9A 1IXCA 2NNNA 4LG0A 1Z7UA 2ZMEA 4HZFA 3RPUA 1XGOA 3F22A 4K2EA 4XLPF 2DK5A 2X4HA 1SD7A 5ILVA 3LFKA 1DPRA 3LA3A 1G3YA 2PN6A 1LDKB 1YYVA 4HLYA 1A04A 2JSCA 5E18F 1GHCA 2HKOA 1U5TB 3L7WA 2CW0F 4GYIA 1IN6A 4HX8A 1QZZA 1XMAA 2ESHA 1XMKA 3FX3A 3DV8A 2MH9A 3MZYA 2IT0A 1FP1D 2A61A 4O5VA 1YIOA 3Q9VA 3M8EA 2D45A 4BHCA 1QQIA 4IF4A 3I59B 3FF5A 1J9IA 3WE3A 2VC1A 2CFXA 3DEUA 3TO6A 4B8XA 2EFWA 3ROUA 1ZYRF 1G4DA 2W85A 3KZYA 3WODF 4KYWA 4A0YA 1NHAA 3HOSA 4KMUX 4A12A 5DCMA 1GVJA 1KQ0A 2A5YB 4MQ9F 5BS6A 1LB2A 1ODDA 5LGNA 1SAXA 3MAJA 1H9TA 2RVCA 2WTEA 1R23A 2O03A 2VBYA 1QNTA 5FB2A 3K1MA 3HTSB 3MWMA 1FLIA 3QPTA 2A6HF 4Q5SF 3GFMA 4IVNA 4AD9A 4EVIA 2DFIA 4ETSA 1B6AA 1JHFA 3SQNA 1ZN2A 3KLNA 2ZFWA 4G94A 4GCVA 3F6VA 1S8NA 3FXQA 5EEHA 1YW9A 1V3FA 5ILSA 5E1WA 3JAMK 2BGCA 4HDVA 3SFZA 2QLZA 4A5NA 1ZRCA 1KU9A 5CLSA 4EJOA 1KQ8A 3L09A 5KK1A 2DQRA 2CQKA 4EJTA 4ZZLA 4A0ZA 1GXQA 4UV9A 4KIGA 2QWWA 3WTZA 5FFXA 5LEKA 4MTEA 2V1DA 5D4RA 2UZKA 2VT2A 2O8XA 1UHWA 2FNAA 2EV5A 2VONA 1FNNA 1IRFA 2V1UA 2VN2A 1BI2A 4KMFA 1S7AA 1XSDA 1YS6A 1B4AA 3ZN0A 4E70A 2XKOA 4RB3C 1Z9CA 1S6LA 2JZYA 2VBWA 1BC8C 2IP2A 1FT9A 2EFNA 5HDGA 4GO1A 3HRTA 3I53A 2FBIA 4N9IA 5JFRA 1FBUA 2L4AA 2XASA 5HLHA 4ZYGA 2RGVA 1D8JA 2ZO4A 3N97A 3DXJF 5FFZA 2AS5F 4P9FA 2P7VB 3H3ZA 4UVAA 2HKXA 1P4WA 5ERIA 2RV8A 4LJZF 3WTWC 1WSUA 2H6BA 3L2CA 4P96A 1T98A 2D2WA 3CJNA 2P6SA 4QWQA 1WKMA 4RB2C 2Z99A 5ICFA 4HAMA 2XAQA 1ZGAA 3JTHA 1E2XA 1X3UA 4JQFA 1GXPA 2P6TA 3ZP5A 3MZHA 3F72A 2E7WA 1I5ZA 1O7FA 3KEOA 2QENA 1SMYF 2B0LA 1R00A 4LLLA 5K5OA 2OA4A 3F6OA 5KVRA 2HR3A 3B73A 4YFNF 1MDMA 1LQ1A 3HRMA 4ENMA 1HW1A 4U0YA 3HOTA 4UNOA 3HHGA
chains in the Genus database with same CATH superfamily
3I4MJ 5FKOA 1Z3XA 2OU2A 2MSYA 1BA5A 3BTCA 3ZMDA 4A6DA 4CCMA 2QUFA 1WJFA 4QPOA 4ZDLA 3R6SA 4B09A 3CTAA 5CJ9A 4FASD 2I5UA 4WXHA 4BBRJ 1LE8A 2DA2A 2R5YB 3CDHA 1FTZA 4GYGA 3GO5A 5HNFA 3PUBA 1UELB 2DOFA 3EQLF 3ZMTA 3G3ZA 4Y17A 1FOXA 3IUOA 4BXXJ 3RZOJ 3CCMI 4H0EA 2ZFUA 2JT1A 1I3QJ 5E79C 1FSEA 3DTEA 2FXAA 4RB0A 4DZPA 1XMXA 5GPAA 3MCZA 3V8LA 4BBSJ 2CU7A 1T8IA 2E2IJ 4IL6C 4IQ4A 2M45A 5LHHA 1WH7A 1VQ4I 4DBQA 3WU0A 5J1YA 1R22A 2DMQA 2M5WA 1QZEA 2CW8A 1HW5A 3DEEA 3U1DA 5J3LA 5GPCA 4V19K 2LMDA 4BUPA 5K5QA 4U0VA 3GFJA 2JRTA 5FO5A 2EIJH 2DTZA 1JJ8C 3CO7C 5K5RA 1AHDP 1O57A 1VQ7I 3HSFA 1MJAA 2Y30A 3SXYA 2D1VA 4NQWB 2HS5A 2BYVE 3FM5A 1ENHA 1W5SA 3GFLA 1H88C 4UUVA 2VIXA 2CV1A 1TWFJ 5AONA 2JA2A 3JTGA 1R1VA 1WPKA 2KZGA 1STZA 3WTXC 4O6JA 4XOTA 4FTHA 4DBRA 1R5GA 5IP6A 3BT9A 3F8MA 2DU9A 2NYXA 1OCOH 5D8KB 4MNUA 3FXUA 2DMTA 2P5VA 2M9HA 3GZNB 5DD8A 1S7EA 5E3LA 5K7HA 2MFZA 1MJBA 3SFIA 1G59A 2WA0A 4J19A 2BZTA 3ZXSA 1T0FA 1Y8RB 3OOPA 4BYYA 1YJNI 2DMUA 2YUSA 4EEFG 3WU2C 4E7SA 2XAGA 1XD7A 2CUEA 3L2QA 2XSDC 2HYFA 1TLHB 1YQAA 4HSTA 4HQEA 1ZH5A 2XUBA 4JBAA 3LWFA 3P9CA 4IZZA 4BEHA 2XDVA 1BOBA 3KE2A 1WZ2A 1XSVA 1YOVB 2V26A 2AXTC 3HKZA 3KP4A 1D5VA 2QQ9A 3QQAA 2RDPA 3RPUD 1FBSA 2XIGA 5BQTA 3VODA 3C2HA 2QA4I 3IRQA 1MNMC 3P9KA 5M5XJ 1VQMI 3WGHA 2XSJC 5D6EA 3IWZA 3RIRA 3RI4A 2JUGA 2Z33A 2EPFA 1D0YA 4ON0A 3BWGA 3DWLE 2LY2A 4M6XA 2YU9J 1WI9A 1IJWC 4M74A 2GA1A 3BR5A 1T38A 2OD5A 4BJTA 4ITVA 3FHNA 1YO5C 3LOCA 4XRSA 1IN8A 5FRNA 2GIZA 2CMPA 2VKHA 3S3MA 1D1BA 3OYDA 3LAJA 3BCAA 2BEOA 4IXAA 4RDUA 1O3QA 4UY8I 3M8JA 3FXJA 4D1QA 1XC5A 3K10A 1M1EB 2MG4A 3LSJA 5B66C 3CDLA 5D5VB 1B72A 2GXAA 5IYBJ 2CGPA 2V6EA 2W00A 4XONA 1UB9A 2RNJA 4HF1A 3PL8A 4EM2A 4ASNA 4A3IJ 3OYKA 2DW4A 5IP7J 1J7KA 2LDUA 1FOWA 2NOJB 1I50J 5JLWA 3BZKA 4G12A 4CCNA 4HA8A 3CC2I 3NWTA 1IN4A 2EA2A 3SDBA 3WHBA 1T39A 2L7MP 1D1AA 4HW0A 4M72A 4NC6A 2FNPA 2TCTA 2LD5A 2NAZA 2PMHA 2QQBA 3BC8A 2L2OA 3HYIA 4H4KC 5F04A 2V9VA 4II2A 3LQQA 2VUMJ 1H0MA 2RAEA 2O0YA 4RGRA 2HXOA 1X19A 2HPMA 2FOKA 4X6AJ 2ELKA 2R7QA 3ABTA 2XC7A 2XGXA 3I59A 4L9TA 3ZQHA 1RRJA 4A3MJ 3EYYA 2K9LA 1HQCA 1F36A 1CF7B 4BHPA 3DPLC 3GTMJ 2EWNA 4A0XA 1ETWA 1IXSB 1JUMA 4EJVA 2HVQA 3BOQA 3I71A 3FBIB 3KYDB 4CO8A 5L3BA 3JAMZ 3RKXA 1QHHD 4BACA 1P7IA 2DAOA 1JJ6C 5CVRA 4GGGA 1RIOH 1OCRH 2F2EA 2VXZA 2FX0A 5EF6A 2ZJQF 1A6QA 2K3PA 5J8FA 1LDJA 2IS4A 3VYUB 3EUHA 1R7JA 1U9NA 1POGA 2D1HA 4MEYF 3S1QJ 1Z67A 5ED4A 1SD5A 3BQZA 3E6BA 1F1ZA 4S04A 5DCFA 2HWVA 2L7ZA 4PZJA 1DP7P 3CZ6A 3MKZA 3MFKA 1IO2A 3HUGB 3PUFA 1MMDA 1RKTA 1YLFA 3LFUA 3OYLA 4MFDA 4JX6A 3UNGC 3W6KB 4E7KA 4ZYEA 2R7XA 2GXGA 3U1KA 2GAUA 3F8CA 1GV2A 3I64A 2O3FA 1U3EM 4L9JA 3TOBA 2DODA 1H8AC 2K4JA 2HFHA 3I4NJ 5CQGA 3J81Z 4JYKA 3RSNA 3H36A 2OF7A 1XGMA 2ACJA 3N05A 2UWMA 1U9OA 2CG4A 5D6FA 2KJBA 2L02A 4BY1J 3OL3A 2IGNA 1DGRM 1JKRC 2JA5J 4OIQF 5FJ8J 3CJTB 2X6YA 3FMRA 3NWSA 3F21A 2JA8J 3T8RA 1TQPA 2EZKA 2OQRA 3QPHA 3KP2A 4LLGF 2K9MA 3JRCA 4EATA 1U2WA 2MBFA 3I56I 2BOLA 4BQQA 1YJ9I 2GBYA 4C2UA 3HSEA 3LSKA 4A3FJ 2BE5F 5KAIC 1ORKA 1UHSA 1VQ6I 1DP3A 3OOUA 2KDZA 4XKVA 2XVCA 3ZMUA 1I27A 2LR8A 1JI8A 6PAXA 3E7LA 3HC7A 5IP9J 5B1AH 5M5YJ 4KJZA 3GLLA 2X6XA 1B8IB 3JRFA 3IHUA 2BHZA 4XSXF 2IXSA 1XGSA 3ABKH 4OAYA 1WGXA 2CQ7A 5B1BH 4CA0A 5H2FC 1SEUA 2JVHA 1HBXG 3OYBA 4GXOA 4RAFA 2O6GE 3BTLA 4FHTA 4WXCA 1VTNC 2ZMEC 2OQGA 5EGOB 1MBFA 5CVVA 1JUPA 2PJRA 3ERMA 2EJRA 1N78A 4LIVA 3S3OA 5IY5H 5K1YA 3TW7A 4NC8A 2WWYA 4L5JA 1FOYA 2EA4A 2FQ4A 2NS0A 1K78B 2RN7A 3MVPA 3F8FA 1WJAA 3HDDA 1HXDA 5F6FA 4YIRX 4IHTA 1SANA 3JR9A 4U87A 3VDXA 3S93A 4F3QA 2DN0A 4RM3A 1CGPA 5FKKA 4A3EJ 3E1SA 1ZG5A 2OTJI 5JHFA 1RKWA 2DQLA 3KZZA 3CCVI 1O7LA 3E5XA 4UB6C 4XM3A 4HLXA 3V8KA 1UZCA 3J7ZI 2QSHX 3IKTA 2JSPA 2XV4S 2F48A 5M5WJ 1A6IA 4F52A 1OQYA 2PQ8A 3X2QH 5DM6F 2HTJA 2VXDA 2JPCA 1IN7A 5GP9A 5CVUA 4DW6A 1XGNA 1RR8C 3HTUA 4XKWA 4CCJA 1XCVA 2LF8A 2F4OB 4ZDOA 3ULQB 3OS0A 2PLYA 4I98B 1TP4A 2Q1ZB 2M8EA 1T6SA 2ZXJA 4KT5C 4LD5A 2IA1A 2HEOA 1D3YA 3TDUC 3KX2A 1IDZA 1NK2P 1KU7A 4HX7A 5JVTA 1VFCA 1V55H 2ADUA 1IAWA 1FEXA 4UVBA 4BHBA 1WJBA 3O8HA 4UV8A 1D8KA 4IRIA 4XICA 4X1EA 1YRNA 1BI3A 1MZBA 2BW3A 5L3FA 1AKHA 3S14J 3DLLF 4HF2A 3O2PE 3JRDA 1V5FA 3EUKL 2HOTA 1Z91A 2EV0A 2BVMA 4KIBA 1MMAA 4RA2A 4FE4A 3H1CA 3A1YA 4CCKA 2MH2A 3LSHA 1J0RA 5HLGA 4OIRF 3KYCB 3LA2A 4EV0A 4IOAF 5CPRB 3HL2A 3KP7A 2JPBA 2M1BA 3NQOA 4UHTA 4ANJA 1U8BA 2M0MA 3HPGA 3K1NA 2YSRA 2R7ZJ 4LG0B 5HLIA 2ZMEB 3KLOA 4KN7X 3NAUA 2DI3A 1P2FA 1LFUP 3Q0UA 1W7PD 1YTYA 2WC2A 3KCCA 3JW4A 5IPAA 2QBYB 4OMYA 1V5GA 2XKPA 2Z2SB 3I9V2 1I6XA 3IP4B 4L9NA 4BQOA 2ZNZA 4QPQA 2FEZA 1EJ9A 3FMQA 2I10A 5LHGA 1IGNA 3VWBA 1Z77A 5HS7A 1OKRA 3BY6A 1GV5A 2KPMA 4AUXA 5K7ZA 1ZRFA 2PJPA 2R5ZA 1K4TA 3P9IA 3VOEA 3KETA 4XLHA 2BBYA 2OZ6A 3GTQJ 4XLNF 2MLGA 1Z6TA 2OZUA 4YIFA 3KP3A 1TNSA 4MGRA 1IF1A 3FHZA 5FD5A 1UMQA 4IEJA 3BZCA 4OINF 5DUKA 1SFKA 1HSTA 1HC8A 2LRDA 2V1NA 2ISZA 4LMYA 1XSXA 4B44A 3K9TA 3D5LA 5LRSA 3JRIA 3HOYJ 1ZK8A 3W6JB 4PJ0C 3GTGJ 1SAUA 1OR7C 3EDPA 3RKWA 2MD5A 2A05A 2VT3A 2ZKZA 3BG9A 3FM3A 1MMNA 3A01B 4A3KJ 2H94A 2VASA 3E6DA 1OCZH 3LSPA 4I0AA 2PX9A 3I5UA 4Y7NJ 5ICGA 2ZC2A 3MKYB 2QM3A 3SHFA 3W2VA 5DDGA 4IPAA 1OJLA 1B9NA 3TO9A 4MO7A 4A3JJ 1ULYA 2X1CA 2Q8KA 1TTYA 3TMOA 2XAJA 3LA7A 4RS8A 3ZR8X 1DPUA 5D5UB 3DFGA 2H1KA 2NRAC 4DNCA 3GEZA 4EM1A 3OSGA 4PFOA 2QEXI 3H92A 3QYFA 3BJOA 3ZMSA 2M3AA 3GFIA 4CUGA 3K7AJ 1MSEC 2E7XA 4B1RA 4A5MA 1RESA 2JJ7A 5F64A 2P81A 4I2OA 3H5RA 3CF2A 2R7DA 3VFZA 2OC6A 3VB2A 4CZZA 5ILUA 4D7MA 3PJRA 3QU3A 1QPIA 3FXRA 1U8RA 1BIAA 2HPIA 2E19A 5LHIA 3I3LA 3MEXA 2F5FA 1R71A 5DCMB 1VQNI 1OCPA 1KU3A 2ZXWH 4EJUA 4F91B 4X0GA 4XORA 1MMGA 2LC2A 3GLXA 4IOCF 1AOYA 2BY0A 5EG0A 1PP7U 2UUZA 4LB5A 3LSRA 3AL0B 1F43A 3DQVC 4I01A 4CXFA 3K4LA 1Y0UA 1YX3A 2L01A 4L18B 1I1GA 4I09A 1A35A 1YG2A 4C3IJ 4PUSA 3ELKA 2ZXIA 4YIIA 4II3A 2VJIA 2IPQX 4XR6A 2CSOA 4M9SA 1J2XA 1FP2A 2E1NA 2KRFA 1W7PA 1DUXC 3AG2H 2L9RA 1LJ9A 4NB5A 5L3GA 1T2KA 4L5EA 2RNGA 3JCUC 4E6KG 3WTTC 1EH7A 3QAHA 4LFUA 3JREA 1Y1WJ 4RLFA 2Y2ZA 1LFBA 2KHMA 2DOEA 2KIMA 5CQEA 2V1XA 3ZQ7A 2BY2A 4CCOA 1ONVA 5FLXK 1MIJA 2YR2A 2IA0A 5DD4A 4ABZA 1FC3A 1SFUA 3OV8A 2DPUA 2P0WA 1ZGJA 1JXSA 4M71A 3GYHX 3TGNA 5IT3A 2FBHA 4MQVA 4Y3OA 2X85A 3HRSA 2KLOA 3QPLA 1R4MB 3WHCA 4E4HA 1FYLA 5JLXA 4PCQA 1X1BA 2G9WA 3HGYA 3OL4A 3DBLB 4HG2A 2M0CA 2UXNA 5DV5A 2J5OA 2LBFB 4XRSG 3FWEA 3RKYA 1ETVA 3RCOA 4I7HA 5HVQC 1TQIA 3DPTA 4ESJA 3GBGA 5CYVA 3M1CA 2VODA 3BG7A 1U6GA 2M34A 2X1DA 1I1SA 3F8NA 1T33A 4MEXF 1ZELA 4XBFA 1QVTA 3B6AA 1HKQA 3ESWB 5D8LB 2CO5A 1NG7A 2R7FA 2VKDA 3VYRB 1UAAA 4CDGA 2K7LA 2DXIA 3JSPA 3IKVA 3E6MA 5E3NA 3CESA 3SZPA 1NK3P 1Y56A 5CVJA 1U0JA 1E17A 1UG0A 3W3CA 1HLVA 3BPXA 3PNTA 1GLNA 1FZPB 5IOZA 2VC0A 4QLCU 4KITB 3OS1A 3L00A 5EEGA 2R7VA 1LDDA 1Y6IA 4XRMA 5LGUA 5BMZA 4LB6B 3S1RJ 4B3XA 1WJ5A 1S9HA 3F9KA 4HNTA 3PNVA 4Z2YA 3J80K 2DT7B 1BI1A 1N25A 3O6BB 4DIQA 5A2QK 5HOOA 3N4MA 3K70C 1R36A 2GIVA 3IH3A 3V8JA 3BCBA 1HOMA 2NNYA 1MBKA 2ELHA 1Z05A 4RB1A 4EJWA 1J75A 3RPQA 2KT0A 1K6YA 2OBPA 1QBJA 3PQKA 3OR2C 4BXUA 3RZDJ 4DYQA 3FDYA 5BNGA 4HNUA 2L9SA 1EH6A 1B9MA 4ZH4F 1UG2A 4LK0F 4AVPA 4HDUA 2FSWA 5L3DA 2W25A 3GTKJ 2KZVA 3A2KA 1V54H 3GCMA 2YPRA 3L2RA 2DA5A 1AU7A 1UCRA 2MABA 1F4KA 2H09A 3S2DJ 5FLMJ 4A3GJ 2Y0MA 3BQYA 1DDNA 5FKNA 3QOEA 4BAYA 3HOWJ 5AIQA 3EUAA 3H35A 3J7YJ 2VQLA 1YW8A 2Y75A 4KUMA 4RAGA 1OMIA 2PMZN 4Y15A 1MNEA 3SZGA 3CUQA 1ITYA 4XK4A 4KA4A 3PIOF 2ID3A 3CUOA 4PDKA 1QPMA 2EFOA 2M4GA 3C2BA 4XOPA 2L54A 1IDYA 1QGPA 2CUZA 2B7EA 1WFXA 1JE8A 1K83J 4LGWA 1BR4A 3AFHA 4CICA 4UUSB 4Y52J 3C18A 1T56A 1LEBA 3H9GA 2BY1A 2EFPA 2LOOA 4EM0B 1USSA 2CQXA 2E35A 1ZAOA 2NVUB 2X6WA 3HB9A 3PSFA 2A68F 3P7NA 2DK8A 1OYYA 1RUNA 3GTLJ 5J1RA 4YG2F 2CW7A 4PJMA 2LG4A 5H20A 2PI0A 2HQ5A 1SMTA 1SFOJ 4ENJA 4B47A 2LKPA 4KN4X 2EBIA 1PJRA 4KFCA 2A69F 1JHHA 4IJAA 3FZVA 3BR6A 4XRFA 5F0HA 2LLKA 1R5ID 3ZOBA 5DTDA 1U5TA 3ZN1A 5GADJ 4KISA 2ID6A 2KKOA 3G71I 4XL9A 3ASOH 3HBLA 4BJ5C 4M73A 4HV6A 2DPDA 3HOVJ 5D5XB 3CMAI 4A3DJ 4P5OA 1BW6A 2L4MA 1W5TA 3K2ZA 5J6XA 4DYCA 2W57A 2DO7A 1T0FC 3W2AA 2HDDA 4C3HJ 2CV2A 1PVEA 1R58A 3DKYA 3CF5F 3KP6A 3RYPA 3A03A 3HHHA 2ZJPF 1MDMB 2KP6A 1BR1A 4A93J 3GVAA 2BV6A 2I8DA 5E3MA 2QZ8A 1BW5A 1OISA 2VOOA 5F1RA 4G8XA 3L2WA 2E2JJ 4BJ6C 3BTJA 4LOCA 4MHGA 2K85A 3RTRA 1J59A 2KIQA 2N8GA 4AWXB 3HIFA 3PIPF 1SVMA 3LQRA 1O3TA 2LF7A 1X1DA 5LLQA 5LFAA 5LEJA 4OMZA 1LE8B 3U2RA 4M9ZA 1K78A 3SYTA 3OSFA 4AC0A 1ON1A 2CYYA 1SC7A 3AAFA 1WJDA 1SFXA 4HF0A 3M9AA 1YS7A 3F23A 3BG6A 4A2UA 4MTDA 1VQOI 4IHSA 3REOA 1XDUA 1WHUA 1R1TA 3D5SC 5LRRA 3PO3J 2Z5UA 3IV5A 3I58A 3K4KA 3V7CA 4B48A 1FMWA 2OPTA 2RREA 2ZJ2A 3E5UA 3R0AA 3CDIA 3TKYA 2XB5A 2HQRA 3HRUA 3G1OA 5ICEA 4XQFA 5GTIC 2XAHA 3E5QA 2LY1A 4GFBA 4I99C 2UXXA 2XGDA 2XAFA 1U78A 2W24A 3BDDA 2KRCA 1S5LC 4I02A 3KFWX 1KYWA 1ERDA 2LP0A 1IUYA 1IXRC 1FTTA 2HQNA 1P4AA 4FX4A 3CQZJ 2B63J 1EF4A 1TWCJ 2YX7A 2X48A 3LNQA 1AA7A 3C1DA 1EV7A 2R3SA 4CYDA 2JUCA 1VQKI 2HVRA 3CLOA 3HXLA 2BVLA 3CJQB 1MKMA 2HTSA 1Y8QB 2LSOA 5BPIA 1BJAA 1FBQA 1P4XA 1TZLA 5L3EA 3GX4X 3KEQA 2B9SA 3D0SA 2R7SA 3HOZJ 2KQRA 5TJJA 1WRJA 4HRIA 2ELJA 1ZKGA 3G6EI 1TC3C 4BE1A 1HA8A 1USTA 4ZTJA 1UFMA 4Y13A 5C4XJ 2E1MC 2Z3YA 1PUFA 3OS2A 2IVMA 1ZLJA 2RQPA 1S72I 3OMYA 4BEHB 2Y9ZA 2DA7A 1YFHA 1ZRDA 3BROA 5E1XA 4OIOF 1OYWA 3OIQA 3K69A 1ACIA 1ETYA 2W4SA 3CP8A 5IT9K 1A31A 4ZYHA 1OCCH 1B59A 2W82A 3Q3SA 2Z9OA 4J01A 1SFEA 1Y0NA 2PFBA 2PMUA 3I4PA 4UVCA 2QBYA 3CD6I 1QRYA 2FQ3A 3TBIA 2ME6A 2JTVA 4KT6A 3DBRB 3J7AO 3G1LA 3E97A 5B5EC 3PQJA 4QSHA 3DTKA 3HSRA 4G6DA 2G7HA 5JR3A 1MW7A 2RKHA 2K4BA 5GAGJ 3WTVC 4PFPA 3S1MJ 1MSFC 1QO0D 3F8BA 3H3VK 2QVOA 3WGIA 3COAC 2IGMA 2E36A 1PUEE 2DT6A 2F5DA 4BE0A 2JK3A 3OYCA 4AYBN 2GQQA 1QZYA 1DU0A 4NHJA 2MA3A 2P5KA 1OLTA 2VJJA 3QWLA 4MFEA 2PEXA 1IV8A 4EQQA 1K4SA 3BR0A 3ZMVA 3ML6A 1LUJB 1L0OC 3MZ8A 3DPUA 1IN5A 3GMEA 3K4JA 2XGCA 1VQ9I 2E5NA 4PJJA 4Y33A 1YITI 5FLXZ 3TEDA 1X4OA 2X6OA 2E5ZA 3EPZA 4BDYA 3ABLH 2MC3A 4KDPA 2F5CA 4ESBA 3OIOA 3QOPA 2DT5A 2WBMA 4XSZF 1X1CA 2CUJA 2AHQA 3BZ6A 5LBQA 2IBDA 1O3RA 1VNDA 4E7ZA 4RGSA 3CMMA 2K9QA 2DBBA 2M30A 2QKLB 2E1MB 1X3WB 1O3SA 4AIHA 1BC7C 2VE9A 3ZQFA 3JRHA 4UXNA 3IC7A 3LSGA 2GM4A 5DEQA 1TW2A 4LK1F 3DF8A 2K86A 5D5WB 4LLNA 2H6CA 4ENNA 3K6GA 3GXOA 3QP5A 3EETA 1FOKA 3FK6A 1S3JA 5J8CA 3A0HC 2F4IA 5AIPA 3OYAA 1XPXA 3R0JA 2L5QA 2C6YA 4AIDA 5GAHJ 4HOBA 4L0YB 2NVQJ 3MQ0A 2QGUA 2ZCWA 1VQ8I 3JRBA 3OYGA 5C44J 3CCYA 1R5HA 1LVKA 5DUIA 3K0LA 2MD0A 3SZTA 5GAEJ 4LG3A 4W1UA 3TO7A 2ETHA 2IGOA 4M6YA 4ENKA 3H3UA 2HQAA 3ERED 3ZMZA 2FU4A 2LYCA 3J80Z 3DU5A 3WG9A 5LGTA 3BR1A 3KPHA 3RQIA 5A2QZ 3T0YA 1IRXA 2L7FP 3RDIA 3RJPA 3O3KA 4CZCA 2X9DA 4DQ2A 5FRMA 2COBA 2EILH 1YE9A 1OR7A 5ICCA 3V42A 4WXDA 3F0CA 2OCEA 5HNHA 4CYCA 2J5PA 3FMSA 1W36D 4BDZA 4C9YA 4BGDA 4FX0A 2KJCA 2WY8Q 1ZLKA 1JGGA 2H27A 3AL0C 1SVOA 4P1WA 1BI0A 2VL8A 4BKXA 4IO9F 1S7OA 1FYKA 2ZSHB 4AM3A 1WI3A 3QYBA 1TNTA 2FA5A 1F5TA 2HDCA 2HOSA 1QHGA 2IA2A 2ISYA 4R1HA 5JHUA 2K5CA 3S3NA 2LBFA 3UR3C 2O5RA 1X1PA 2GA2A 2IW5A 3MMYB 2HOEA 1SD6A 1UHMA 2FMLA 3ZQLA 3CC4I 1GUUA 2ZJRF 4UUTA 1H9GA 3ISPA 3DBHB 2PJRB 3PO2J 1Z1DA 3U21A 3CC7I 3IH4A 3TP0A 3BR3A 2VOPA 2JN6A 2O7OA 3OYFA 1LVAA 2IS2A 1E3PA 1C0WA 4HX4A 3HOUJ 3S15J 4WWCA 1MMSA 3CO6C 3ZGKA 4RAYA 4I0BA 4C2MJ 4P55A 1G3WA 2AO9A 1REPC 2Q2EA 1DU6A 4RGXA 2JWTA 4JX5A 2LH9A 3HPHA 1ZREA 2O61A 4M3GA 5GTHC 2W7NA 1RUOA 2IS6A 3GW2A 3OYNA 4D0PA 2G7UA 2R5YA 2H8WA 3B02A 1HDDC 2EZLA 1KYZA 4U7BA 2CH0A 1WJEA 3Q0VA 3J81K 2H1LA 2DOAA 5JI6A 2VPRA 2Y69H 4GRIA 4ZZDA 1Q1VA 3KIOA 4IQJA 2WAFA 4HBLA 1MBGA 4G9YA 5CKTA 3M1EA 3M8FA 3TOAA 4RM2A 5F0CA 1FJLA 2NS7A 3QU6A 2IJLA 4YFKF 4WK8F 5TRDA 3RYRA 1LKXA 5M3MJ 2MLKA 4C30A 1YRNB 2BW3B 1AKHB 1RZ4A 3IWFA 5CVIA 2EK5A 1P7JA 4M3DA 3HGGA 2JVGA 9ANTA 1HKTA 2YU3A 2ESNA 4NQWA 4HV5A 3C2GA 1FIPA 2HZTA 1T08B 3O8GA 1N77A 2AQEA 5KNLA 2YX4A 1KU2A 3VPRA 5M3FJ 3RQ4A 4B4CA 3BTIA 3ECHA 2DFHA 1V4RA 4OIPF 4YRVA 2W84A 3GF2A 1K7AA 2OCCH 2DDAA 5E3OA 4U7DA 4Q4ZF 2AXLA 4XN0A 4JK1X 3CCEI 3W6VA 1ZG3A 4ZDPA 4HYEA 1EH8A 2EV6A 2M4KA 4RGUA 4BQNA 3QPSA 2G0EA 2M7AA 2Y0SN 2CWEA 4N4NB 5HS8A 2KIFA 5HLTA 2AQFA 3AG3H 2COMA 4O3MA 2WADA 2PMZA 2XRLA 2M7BA 3T1BA 3BLYA 1XX5A 5BPDA 3H5NA 3BP8A 2EB7A 2IGKA 1SD4A 4XKCA 1ETKA 3GZ6A 1VI0A 4HPQA 2VKEA 2R5ZB 1OFCX 5E17F 2K40A 4RAZA 3K1PA 1GVDA 4BNCA 3WG7H 1TT5B 5EJCA 4BQAA 2P8TA 2V9PA 2WB1N 1D0ZA 1FY7A 1KA8A 3BPVA 2QQ8A 1V5EA 2HYGD 3Q0WA 3FIWA 4XLEA 1XS9A 1ZG1A 3VYSB 1TQMA 2EFQA 5J47A 5HDNA 5HODA 2Q0OA 2X0LA 2XROA 4N9HA 2A3SA 4ZYDA 4PGHA 4FCYA 3K2AA 3U9GA 2NVXJ 1RPWA 2A07F 3M4OJ 3T8TA 3ZQGA 3CCUI 2LFBA 2TDXA 1W4MA 1FX7A 4DGWB 2GLOA 3I0TA 1YX5A 2WV1A 2OAZA 3M7GA 3KZIC 2FBKA 2OTLI 2V6CA 3DKWA 2FMYA 4FT8A 1W0TA 1XG1A 1TWGJ 1TBXA 1XDSA 1D0XA 2FUG2 5TGTA 3V7SA 1P92A 2R7WA 1AWCA 4A6EA 1WQ2A 4A3CJ 1KGSA 3SEQA 4E7HA 1MBEA 3HG9A 3BJAA 2EZHA 3WTUC 2NS8A 4CHUA 2R0QC 3R61A 2KMUA 1B1BA 3JRAA 3ZPLA 5IT9Z 2HOAA 1HW2A 2X51A 4HNVA 3CCQI 1X58A 3BG5A 3CLQA 3OIPA 1X2NA 1OCTC 1HKSA 3ZCOA 2DJIA 4HQMA 4YFXF 5E1ZB 4PGGA 3NEUA 5E20A 3A4CA 2WV0A 5E8GA 3ZQCA 5HS9A 2A5WA 5KAFC 2EZIA 3L9FA 1G3TA 1IG7A 1XB4A 1MH3A 4RLQA 3AKZA 1JKQC 1IW7F 4L5IA 4TV7A 3TW6A 5FD6A 1CF7A 3WU1B 2HGCA 2M87A 2R4GA 4OAZA 4S05A 3SJMA 5FGMA 2VI6A 1MGTA 4M9XA 3E6CC 2XF5A 4DJAA 1K61A 2R93J 4U0WA 1J5YA 3VEPA 2VJ4A 4CSWA 2V79A 1BJZA 1IV6A 4AU7A 3R60A 3BR2A 1JGSA 5EG0B 4ZTFA 2QSGX 4BY7J 3WGGA 1FSHA 2DA1A 2XHKA 1BR2A 2XAUA 2BHYA 2VE8A 4JP0A 2K27A 1WVRA 4V2FA 1VQ5I 1ZHFA 4AIKA 3I54A 3HZJA 3PFIA 4L0ZB 1QA6A 2HNHA 3NRVA 2ECCA 2CJJA 2E71A 1FWZA 4FISA 3V7RA 1Y39A 2DLLA 3TQNA 4IRGA 1W7PB 1HSJA 3HUGA 2GWRA 3Q9SA 3QP6A 4BH9A 3IRRA 3GUDA 2FOWA 3TDZC 1KONA 2HZDA 1TW3A 2VBZA 1FPQA 2P5LC 4EGYA 3OR1C 1ETXA 1Z6RA 2QSFX 4F7ZA 2ICWG 3W2WA 2MC4A 4BU2A 4F55A 1Z0XA 3R4KA 1ZARA 2F5EA 2PG4A 3V4GA 2EINH 2L9NA 4WX9A 4M6VA 3C3WA 5EDNA 1FIAA 3DEWA 3FXOA 4NC7A 5H6RA 3KP5A 4AIJA 1I6HJ 2GOMA 2RC4A 1OYIA 3GTJJ 2IS1A 2FF4A 4A69C 2STTA 1IC8A 1BM9A 3F3XA 5DS9A 1RETA 5B3SH 4IRHA 3OYHA 1RNLA 2IRFG 4IHVA 4I6ZA 1MD0A 2LREA 4LITA 3CCSI 1HF0A 2R7UA 1L3LA 2FE3A 5FKLA 1HDPA 1R1UA 3AG1H 3WE2A 2YS9A 4G6QA 3J7AY 4WF2A 3CUQC 1P6RA 5L3CA 5DYMA 2R92J 4P9UA 5KCMA 2LKXA 1PP8F 1LFPA 2KIUA 3NARA 1G3SA 2GXBA 2ZSIB 3IAM2 3A02A 2FRHA 2QYOA 1N75A 2DTRA 3C7JA 1K79A 3GTOJ 3P5JA 2XRNA 1B8IA 4XLFA 3JSOA 4G7OF 3TL4X 2L3DA 4R8HA 1F9NA 3OYMA 1SVLA 4XIDA 4M3BA 1TL8A 5JVGF 3GZ5A 4L9VA 3LMMA 5D4SA 4Q48A 2NOGA 4IX7A 2WY7Q 3IL2A 2XF6A 3S2HJ 5EGOA 4XNFA 4EGZA 2DCEA 2VJ5A 4W97A 2F6CA 4OOIA 2A6EF 4RBOA 4CGZA 1KZHA 2VBXA 3M07A 4OU0A 5E8IA 2E2HJ 5HDKA 1S29A 4XMYA 2IAIA 3FXLA 4N0BA 3D1NI 3S2WA 4I76A 3WTSC 1R6RA 2STWA 3G73A 4OWRB 1U5TC 3DP7A 2Y48A 3MKWB 2X1EA 3H9QA 5EYRA 4E7LA 3OYIA 4AYBA 2GZWA 1YW7A 2DA6A 3DTIA 1PDNC 4G7ZF 3H0DA 1MNDA 2VQHA 3GWZA 2E1CA 3BJ6A 4D5FA 2VKVA 5KHDA 1ON2A 3EYIA 2JA7J 4G7HF 3DKXA 3T5XA 1A36A 4KIFA 2D5VA 2WAQA 1LEAA 4YELA 1WWXA 1IZ1A 1IUFA 3OYJA 1LNWA 5IOYA 1Q1HA 4WCGA 5C4JJ 5F08A 1O4XA 2EQRA 2ECBA 1DQUA 2P4WA 3S8PA 1RC9A 3ABUA 4EMSA 1BIBA 1BBYA 3LSTA 4CH7A 2EIKH 1NG6A 1ZTRA 2F5VA 2DA4A 2XB0X 3E0JB 4N4OB 1RI7A 4R79A 1FYMA 2BY3A 1MJ9A 2K02A 2H8RA 2QQAA 3HEFA 4U88A 2XGEA 5H6QA 3WTYC 4GDFA 1IRGA 1OPCA 3Q5FA 5EEAA 3TP3A 4XLCA 1JKPC 4IHXA 3CUQB 2V7FA 1XN7A 3ONQA 1UJ8A 3OY9A 2R7RA 2P7CB 1TT0A 2LNBA 3HKZN 2JA6J 1XCBA 2RQQA 4Q47A 1BN5A 2ZBKA 2EIMH 3E3VA 3QRFF 3I55I 1DGWY 2ZNYA 3SDGA 3CCJI 2PBIA 3LAPA 3ECOA 1K6OA 1X2MA 2LKSA 5BOXA 1G6NA 5J40A 3FKIJ 4KICA 4KNYA 4ESFA 1BOAA 1Z3YA 2VQCA 1KQ9A 1IXCA 2NNNA 5FLVA 4JX4A 4LG0A 1MH4A 1Z7UA 2ZMEA 2XPUA 3QYEA 4CCLA 2E34A 1W1WE 2DA3A 1ETOA 4HZFA 1XGOA 3EUHC 3RPUA 3F22A 2QKMB 1QVUA 1X4PA 4K2EA 4XLPF 2DK5A 4M3EA 4BS9A 2X4HA 1SD7A 5ILVA 4FQGA 3LFKA 2FD5A 4HEA2 1JT0A 1DPRA 3FBNB 3LA3A 1G3YA 2PN6A 2DMPA 4F93B 1LDKB 1YYVA 2K9NA 4HLYA 1A04A 2JSCA 5E18F 1YJWI 1GHCA 2HKOA 3CJRB 1U5TB 3L7WA 2DYSH 5C3EJ 3H5AA 2CW0F 4GYIA 2BXYA 4M3FA 1X3ZB 1MBHA 1IN6A 4HX8A 1QZZA 4NBQA 1XMAA 2ESHA 1VZ0A 1B72B 3K4NA 4YEJA 1H89C 1XMKA 3UKGA 1LPQA 2DDBA 3FX3A 2MGQA 4NUBA 3DV8A 3PSIA 3SEZA 2DYRH 3S17J 4V2GA 2MH9A 2JMWA 4RMNA 2F4MB 4XLAA 3ZQQA 2O8KA 3MZYA 2WAQN 2NXNB 3DU6A 4XKBA 1FP1D 1GT0C 2IT0A 2W1OA 3A01A 2A61A 4O5VA 1YIOA 3CMYA 3PFYA 3Q9VA 3FISA 3M8EA 3CCRI 2D45A 4IHYA 2K3FA 3L2UA 2ZB9A 3K4CA 4BHCA 1QQIA 4IF4A 3FXKA 2CQQA 3I59B 3FF5A 2DMNA 3HJEA 2ZXHA 4AVZA 1ZR2A 1J9IA 3WE3A 2VC1A 2CFXA 5FKMA 3DEUA 2KL4A 3TO6A 4B8XA 2KISA 2EFWA 1RR7A 3ROUA 1ZYRF 4HSRA 4NNJA 4B3AA 2XF7A 2W85A 1G4DA 3ASNH 2CQNA 3KZYA 2TRTA 4E7IA 3WODF 3MN2A 3AG4H 4KYWA 5F27A 2Z1DA 4A0YA 2VB6A 1T95A 1NHAA 3KYLA 2E60A 3BG3A 3HOSA 4KMUX 4A12A 3A0BC 5DCMA 1EA3A 1GVJA 4IHWA 3FK7A 1KQ0A 2A5YB 4NDLA 4MQ9F 5BS6A 4UB8C 1LB2A 1WCMJ 1JKOC 1ODDA 5LGNA 1SAXA 3MAJA 2WAEA 3S1NJ 1H9TA 2RVCA 4PJNA 4DZJA 2WTEA 1R23A 1R4NB 2O03A 5EZGA 1HCRA 2M8GX 2VBYA 1QNTA 5FB2A 4QIWN 3K1MA 1VQPI 3HTSB 1PUFB 3QODA 3MWMA 1FLIA 3QPTA 3HM5A 2A6HF 3VYTB 2L7KA 2HYJA 4Q5SF 3GFMA 4IVNA 4AD9A 4EVIA 2DFIA 2BXZA 1TWAJ 1Y1VJ 2HU9A 1E3OC 4ETSA 2L9VA 2MW8A 3G4SI 1B6AA 2EH3A 2NVTJ 1JHFA 2OJED 3SQNA 4F92B 1G8XA 1ZN2A 2LTPA 3KLNA 2HI3A 4B43A 4BE2A 2W48A 2CV0A 5J4VA 2CFOA 2JRMA 2Y0SA 2ME0A 3GTPJ 2ZFWA 1VF9A 1E3HA 4G94A 5J1UA 4GCVA 2DFEA 3F6VA 1S8NA 4D7NA 2O9LA 3FXQA 5EEHA 1YW9A 1V3FA 5ILSA 5E1WA 3JAMK 3JRGA 1Z21A 2BGCA 4HDVA 3SFZA 3G1MA 2QLZA 4A5NA 4E7JA 3K70D 1ZRCA 2KRHA 1BL0A 2Z16A 1KU9A 3IH2A 5CLSA 4G6TB 5EZHA 2KDOA 2WB1A 3K4BA 3LL7A 3VSLA 4EJOA 1KQ8A 2KFDA 3L09A 2CS3A 5KK1A 3RKQA 1JTXA 3L2VA 3S32A 2DQRA 2CQKA 2DFFA 4EJTA 1R49A 1APLC 4FETA 4FE7A 5FROA 3CCLI 4ZZLA 2CRGA 4A0ZA 4BL0B 1GXQA 1MBJA 1QU3A 4PK4A 4KIGA 4UV9A 5DM7F 2QWWA 2E1OA 3WTZA 4D5CA 5FFXA 2GOXB 5LEKA 1JT6A 4MLOA 3LSIA 3LSMA 3B6CA 4ZJZA 2R7TA 4MTEA 4D9JA 2V1DA 2UV1A 1VQLI 1X1AA 3DCFA 1FMVA 5D4RA 2UZKA 2VT2A 1J09A 2M2EA 2O8XA 3HOXJ 2IEKA 1GDTA 3CP2A 4QTRA 1TWHJ 2XPVA 5TISC 1XTAA 3IAS2 1D1CA 1UHWA 5K7FA 2VLAA 2JQ7A 2HDWA 2NVYJ 3L1PA 1I3AA 2FNAA 2EV5A 2VONA 1FNNA 1IRFA 2L0KA 2HXIA 1YI2I 2V1UA 2VN2A 4PJLA 1BI2A 4KMFA 1S7AA 4Y4RA 3OWTA 1YS6A 1XSDA 4A3LJ 1JTYA 1B4AA 3ZN0A 4Z6YA 4E70A 2XKOA 3ABMH 3S16J 4RB3C 1Z9CA 1S6LA 3ZQIA 2HVSA 3H0GJ 1R9TJ 2JZYA 2VBWA 1BC8C 1WH5A 2IP2A 3CMEI 1FT9A 2OUMA 4A3BJ 4IKFA 2EFNA 5HDGA 4GO1A 3HRTA 3I53A 3FKJA 1NH3A 3OYEA 5LD2C 2FBIA 4ZC3A 3PM1A 4S0HB 4N9IA 3H9JA 1W0UA 1YIJI 5JFRA 1FBUA 2L4AA 4LIUA 4C2TA 2XASA 5HLHA 5IYDJ 4ZYGA 2RGVA 5IYCJ 1D8JA 2ZO4A 3N97A 3DXJF 5FFZA 2AS5F 3M3YJ 2LK2A 4P9FA 2LY9A 4JOMA 1E0EA 1I39A 2P7VB 4UUSA 1EKEA 3H3ZA 1ZQ3P 1W5CC 2HKXA 4PSWA 4UVAA 2K9SA 3PNYA 4DYRA 1P4WA 5ERIA 2RV8A 2V4JC 4LJZF 4PSXA 3WTWC 1WSUA 4CYCB 2H6BA 3L2CA 1ZR4A 4P96A 1T98A 2D2WA 1ZGWA 2LVSA 3CJNA 2P6SA 4QWQA 2CUFA 4DOZA 3MKLA 2VPLA 2VQGA 4ZYAA 1WKMA 1YHQI 4RB2C 2Z99A 5ICFA 4J00A 4HAMA 2XAQA 1ZGAA 3JTHA 1E2XA 1X3UA 4JQFA 1GXPA 1NTCA 1G2HA 2QF7A 3VSKA 2P6TA 3ZP5A 3MZHA 1D5YA 1A5JA 1JUSA 2DJNA 3F72A 2E7WA 3FXMA 1I5ZA 2R7OA 4BXFA 1O7FA 2A6TA 3D5RC 4MIMA 3KEOA 3KEYA 1CQTA 2QENA 1SMYF 1PYVA 4C3JJ 5J4YA 2B0LA 1R00A 4LLLA 1WJCA 5K5OA 2Y9YA 2Y31A 1ETQA 2OA4A 3F6OA 3ZRGA 5F1JA 1W36C 5KVRA 2HR3A 3B73A 3DLAA 2MYSA 4YFNF 1P9QC 1MDMA 1LQ1A 3HRMA 2QCOA 5F0FA 4XN3A 4ENMA 2XPWA 2OV7A 1HW1A 3K4MA 4U0YA 3HOTA 1Z7LA 2V9KA 2FJ1A 1IRZA 3MD2A 3G2BA 4UNOA 2Q2EB 3HHGA
chains in the Genus database with same CATH topology
2OU2A 3ZMDA 4A6DA 2QUFA 4B09A 3R6SA 3CTAA 5CJ9A 4WXHA 3CDHA 4GYGA 3GO5A 3EQLF 3ZMTA 3G3ZA 4Y17A 4H0EA 2JT1A 1FSEA 2FXAA 4RB0A 3MCZA 3V8LA 2M45A 5LHHA 3WU0A 1R22A 2M5WA 1HW5A 3U1DA 5K5QA 4U0VA 3GFJA 2JRTA 5FO5A 3CO7C 5K5RA 1O57A 3HSFA 1MJAA 3SXYA 2D1VA 2HS5A 2BYVE 3FM5A 1W5SA 3GFLA 4UUVA 5AONA 3JTGA 1R1VA 3WTXC 1STZA 4O6JA 1R5GA 3F8MA 2DU9A 2NYXA 5D8KB 4MNUA 3FXUA 2P5VA 5DD8A 1MJBA 1T0FA 4BYYA 3OOPA 2XAGA 1XD7A 2HYFA 1TLHB 1YQAA 4HQEA 1ZH5A 2XUBA 4JBAA 3LWFA 3P9CA 3KE2A 1XSVA 3KP4A 1D5VA 2QQ9A 2RDPA 1FBSA 2XIGA 5BQTA 3VODA 3IRQA 3P9KA 3WGHA 5D6EA 3RI4A 3IWZA 3RIRA 2Z33A 4ON0A 3BWGA 4M6XA 1WI9A 4M74A 2GA1A 1T38A 2OD5A 1YO5C 1IN8A 3LAJA 2BEOA 4IXAA 1O3QA 5D5VB 2CGPA 1UB9A 2RNJA 4HF1A 4EM2A 4ASNA 2DW4A 1J7KA 2LDUA 4HA8A 1IN4A 2EA2A 1T39A 4HW0A 4M72A 2FNPA 2NAZA 2PMHA 2QQBA 3HYIA 2V9VA 3LQQA 1H0MA 2O0YA 4RGRA 2FOKA 3ABTA 2XGXA 3I59A 4L9TA 3EYYA 1HQCA 1CF7B 4BHPA 3DPLC 2EWNA 4A0XA 1IXSB 4EJVA 3BOQA 3I71A 4CO8A 5L3BA 3JAMZ 3RKXA 2DAOA 5CVRA 4GGGA 1RIOH 2F2EA 2VXZA 5J8FA 1LDJA 3EUHA 1R7JA 2D1HA 4MEYF 5ED4A 1SD5A 3E6BA 1F1ZA 4S04A 5DCFA 2HWVA 4PZJA 1DP7P 3MFKA 1YLFA 3W6KB 4ZYEA 2GXGA 2GAUA 3F8CA 3I64A 2O3FA 1U3EM 4L9JA 3TOBA 2K4JA 2HFHA 3J81Z 1XGMA 2ACJA 2UWMA 2CG4A 5D6FA 2KJBA 2L02A 4OIQF 3FMRA 3F21A 3T8RA 1TQPA 2OQRA 3QPHA 3KP2A 4LLGF 1U2WA 2MBFA 3HSEA 2BE5F 2XVCA 3ZMUA 1I27A 6PAXA 3IHUA 4XSXF 1XGSA 1HBXG 4GXOA 2O6GE 4FHTA 4WXCA 1VTNC 2OQGA 5CVVA 2EJRA 5K1YA 2WWYA 4L5JA 2NS0A 2EA4A 1K78B 2RN7A 3F8FA 1HXDA 5F6FA 4IHTA 1CGPA 1ZG5A 2DQLA 3KZZA 1O7LA 3E5XA 4HLXA 3V8KA 3IKTA 2XV4S 2PQ8A 2HTJA 2JPCA 1IN7A 5CVUA 1XGNA 3HTUA 1XCVA 2LF8A 3ULQB 2PLYA 4I98B 2M8EA 1T6SA 2ZXJA 4KT5C 4LD5A 2IA1A 2HEOA 1D3YA 3TDUC 1KU7A 4HX7A 5JVTA 2ADUA 1IAWA 4UVBA 4BHBA 4UV8A 1D8KA 4IRIA 1BI3A 1MZBA 5L3FA 4HF2A 3O2PE 1Z91A 2EV0A 4KIBA 2MH2A 1J0RA 5HLGA 4OIRF 3LA2A 4EV0A 3KP7A 2JPBA 2M1BA 3NQOA 4UHTA 3K1NA 2YSRA 4LG0B 5HLIA 2ZMEB 3KLOA 4KN7X 2DI3A 1P2FA 1W7PD 1YTYA 2WC2A 3KCCA 3JW4A 2QBYB 4OMYA 2XKPA 1I6XA 4L9NA 2ZNZA 2FEZA 3FMQA 5LHGA 5HS7A 1OKRA 3BY6A 1ZRFA 2PJPA 3P9IA 3VOEA 3KETA 2BBYA 2OZ6A 4XLNF 2MLGA 1Z6TA 2OZUA 4YIFA 3KP3A 1TNSA 4MGRA 1IF1A 3FHZA 5FD5A 4OINF 5DUKA 1HSTA 2ISZA 4LMYA 1XSXA 3K9TA 3D5LA 5LRSA 3W6JB 3EDPA 3RKWA 2MD5A 2VT3A 2ZKZA 3FM3A 2H94A 3E6DA 4I0AA 3I5UA 5ICGA 2QM3A 3SHFA 5DDGA 4IPAA 1B9NA 3TO9A 1ULYA 2Q8KA 1TTYA 1DPUA 2XAJA 3LA7A 4RS8A 5D5UB 3DFGA 2NRAC 4DNCA 3GEZA 4EM1A 3H92A 3BJOA 3ZMSA 3GFIA 2E7XA 4A5MA 5F64A 4I2OA 2R7DA 3VFZA 4CZZA 3VB2A 5ILUA 3QU3A 3FXRA 1U8RA 1BIAA 5LHIA 3MEXA 2F5FA 5DCMB 1KU3A 4EJUA 1AOYA 3GLXA 1PP7U 4LB5A 3DQVC 4I01A 4CXFA 1Y0UA 2L01A 4L18B 1I1GA 4I09A 1YG2A 3ELKA 4YIIA 2IPQX 2CSOA 4M9SA 1J2XA 1FP2A 2E1NA 2KRFA 1W7PA 1DUXC 1LJ9A 4NB5A 5L3GA 1T2KA 3WTTC 1EH7A 3QAHA 4LFUA 2KIMA 2V1XA 3ZQ7A 1ONVA 5FLXK 2YR2A 2IA0A 5DD4A 1FC3A 1SFUA 3OV8A 2DPUA 1ZGJA 1JXSA 4M71A 3GYHX 3TGNA 5IT3A 2FBHA 4MQVA 3HRSA 1FYLA 4PCQA 2G9WA 2UXNA 5DV5A 2J5OA 3FWEA 3RKYA 4I7HA 5HVQC 1TQIA 3DPTA 4ESJA 5CYVA 2VODA 1U6GA 1I1SA 3F8NA 4MEXF 4XBFA 1HKQA 5D8LB 2CO5A 2R7FA 4CDGA 2K7LA 3JSPA 3IKVA 3E6MA 3SZPA 5CVJA 1E17A 3BPXA 1FZPB 2VC0A 4QLCU 3L00A 5EEGA 1LDDA 5LGUA 5BMZA 4LB6B 4Z2YA 3J80K 1BI1A 3O6BB 5A2QK 3N4MA 5HOOA 1R36A 2GIVA 3V8JA 2NNYA 2ELHA 1Z05A 4RB1A 4EJWA 1J75A 3RPQA 2OBPA 1QBJA 3PQKA 4BXUA 1EH6A 1B9MA 4ZH4F 4LK0F 4AVPA 4HDUA 2FSWA 5L3DA 2W25A 2YPRA 1UCRA 1F4KA 2H09A 2Y0MA 1DDNA 4BAYA 5AIQA 1YW8A 2Y75A 4KUMA 1OMIA 4Y15A 3CUQA 4KA4A 3CUOA 4PDKA 1QPMA 2EFOA 2L54A 1QGPA 1JE8A 4LGWA 4CICA 3C18A 1LEBA 2EFPA 4EM0B 1USSA 1ZAOA 2A68F 3P7NA 2DK8A 1OYYA 1RUNA 4YG2F 5H20A 2PI0A 1SMTA 4ENJA 2LKPA 4KN4X 4KFCA 2A69F 1JHHA 4IJAA 3FZVA 4XRFA 1U5TA 3ZN1A 2KKOA 4M73A 4HV6A 2DPDA 5D5XB 4P5OA 2L4MA 1W5TA 3K2ZA 5J6XA 2W57A 2DO7A 1R58A 3KP6A 3RYPA 3HHHA 1MDMB 3GVAA 2BV6A 2QZ8A 2VOOA 5F1RA 4G8XA 4MHGA 3RTRA 1J59A 4AWXB 3HIFA 3LQRA 1O3TA 2LF7A 5LLQA 5LEJA 4OMZA 3U2RA 4M9ZA 1K78A 1ON1A 2CYYA 3AAFA 1SFXA 4HF0A 3M9AA 1YS7A 3F23A 4MTDA 4A2UA 4IHSA 3REOA 1XDUA 1R1TA 5LRRA 2Z5UA 3I58A 3V7CA 3E5UA 2ZJ2A 3R0AA 3TKYA 2HQRA 3HRUA 5ICEA 2XAHA 3E5QA 2UXXA 2XAFA 1U78A 2W24A 3BDDA 4I02A 3KFWX 1KYWA 1IUYA 1IXRC 2HQNA 1P4AA 4FX4A 2YX7A 3C1DA 1EV7A 2R3SA 4CYDA 3CLOA 1MKMA 2HTSA 2LSOA 5BPIA 1BJAA 3GX4X 5L3EA 1FBQA 1P4XA 3KEQA 3D0SA 5TJJA 1WRJA 1USTA 1UFMA 4Y13A 2Z3YA 2IVMA 1ZLJA 2RQPA 1YFHA 1ZRDA 3BROA 5E1XA 4OIOF 1OYWA 3K69A 5IT9K 4ZYHA 2Z9OA 1B59A 1SFEA 2PFBA 2PMUA 3I4PA 4UVCA 2QBYA 2FQ3A 2JTVA 3J7AO 3E97A 3PQJA 3HSRA 4G6DA 2G7HA 5JR3A 2RKHA 2K4BA 3WTVC 1QO0D 3F8BA 2QVOA 3WGIA 3COAC 1PUEE 2F5DA 2GQQA 1QZYA 4NHJA 2MA3A 2P5KA 2PEXA 4EQQA 3ZMVA 3ML6A 1L0OC 1IN5A 5FLXZ 2MC3A 4KDPA 2F5CA 4ESBA 3QOPA 2DT5A 4XSZF 5LBQA 3BZ6A 1O3RA 4RGSA 2M30A 2DBBA 1O3SA 4AIHA 1BC7C 2VE9A 4UXNA 3IC7A 5DEQA 1TW2A 4LK1F 3DF8A 2K86A 5D5WB 4LLNA 2H6CA 4ENNA 3GXOA 3QP5A 3EETA 1FOKA 1S3JA 5J8CA 5AIPA 3R0JA 2C6YA 4HOBA 4L0YB 3MQ0A 2ZCWA 1R5HA 5DUIA 3K0LA 3SZTA 3TO7A 2ETHA 4M6YA 4ENKA 3H3UA 3ERED 3ZMZA 2FU4A 3J80Z 3WG9A 5LGTA 5A2QZ 3T0YA 3RDIA 3RJPA 3O3KA 4DQ2A 1OR7A 5ICCA 4WXDA 2J5PA 3FMSA 4FX0A 2KJCA 1ZLKA 2H27A 1BI0A 1S7OA 1FYKA 1TNTA 2FA5A 1F5TA 2HDCA 2IA2A 2ISYA 4R1HA 5JHUA 2GA2A 2IW5A 2HOEA 1SD6A 1UHMA 2FMLA 1H9GA 3ISPA 1Z1DA 2VOPA 1LVAA 1C0WA 4HX4A 4WWCA 3CO6C 4RAYA 4I0BA 4P55A 1G3WA 1REPC 2Q2EA 4RGXA 1ZREA 2O61A 1RUOA 3GW2A 4D0PA 2G7UA 3B02A 1KYZA 4U7BA 3J81K 5JI6A 4ZZDA 4HBLA 4G9YA 3M1EA 3M8FA 3TOAA 3QU6A 2IJLA 4YFKF 4WK8F 5TRDA 3RYRA 2MLKA 1RZ4A 3IWFA 5CVIA 2EK5A 1HKTA 2YU3A 2ESNA 4NQWA 4HV5A 2HZTA 2YX4A 1KU2A 3ECHA 1V4RA 4OIPF 2W84A 3GF2A 1K7AA 4U7DA 4Q4ZF 2AXLA 4JK1X 1ZG3A 4HYEA 1EH8A 2EV6A 4RGUA 2CWEA 5HS8A 2KIFA 2COMA 4O3MA 5BPDA 3T1BA 3BP8A 2EB7A 1SD4A 3GZ6A 5E17F 4RAZA 3K1PA 4BNCA 4BQAA 2P8TA 1FY7A 1KA8A 3BPVA 2HYGD 1ZG1A 5HDNA 1TQMA 2EFQA 2Q0OA 2X0LA 2XROA 4N9HA 2A3SA 4ZYDA 4PGHA 3U9GA 2A07F 3T8TA 2TDXA 1W4MA 1FX7A 3I0TA 2OAZA 3M7GA 2FBKA 2V6CA 3DKWA 2FMYA 4FT8A 1TBXA 1XDSA 3V7SA 1P92A 1AWCA 4A6EA 1WQ2A 1KGSA 3BJAA 3WTUC 4CHUA 3R61A 1B1BA 3ZPLA 5IT9Z 1HW2A 1HKSA 4HQMA 4YFXF 5E1ZB 4PGGA 3NEUA 5E20A 2WV0A 5E8GA 5HS9A 3L9FA 1G3TA 1XB4A 1IW7F 4L5IA 4TV7A 5FD6A 1CF7A 3WU1B 2HGCA 2M87A 4S05A 5FGMA 3E6CC 1MGTA 4M9XA 4U0WA 1J5YA 3VEPA 2V79A 3R60A 1JGSA 1FSHA 3WGGA 2XHKA 2VE8A 2K27A 1ZHFA 4AIKA 3I54A 3PFIA 4L0ZB 3NRVA 1FWZA 3V7RA 2DLLA 3TQNA 4IRGA 1W7PB 1HSJA 3HUGA 2GWRA 3Q9SA 3QP6A 4BH9A 3IRRA 3GUDA 3TDZC 1TW3A 2VBZA 1FPQA 2P5LC 4EGYA 1Z6RA 4F7ZA 3R4KA 1ZARA 2F5EA 2PG4A 3V4GA 4WX9A 3C3WA 5H6RA 3KP5A 4AIJA 2RC4A 1OYIA 2FF4A 2STTA 1BM9A 3F3XA 4IRHA 1RNLA 2IRFG 1MD0A 1L3LA 2FE3A 1R1UA 3WE2A 4G6QA 4WF2A 3CUQC 1P6RA 5L3CA 5DYMA 4P9UA 1PP8F 2KIUA 1G3SA 2GXBA 2FRHA 2QYOA 2DTRA 3C7JA 1K79A 2XRNA 3JSOA 4G7OF 2L3DA 4R8HA 1F9NA 3GZ5A 4L9VA 5D4SA 4Q48A 3IL2A 4EGZA 4OOIA 2A6EF 4CGZA 2VBXA 4OU0A 5E8IA 5HDKA 1S29A 4N0BA 3S2WA 3WTSC 2STWA 3G73A 1U5TC 3DP7A 2Y48A 2GZWA 1YW7A 1PDNC 4G7ZF 3GWZA 2E1CA 3BJ6A 1ON2A 3EYIA 4G7HF 3T5XA 4KIFA 1LEAA 1WWXA 1IZ1A 1LNWA 1Q1HA 4WCGA 2P4WA 3ABUA 4EMSA 1BIBA 1BBYA 3LSTA 4R79A 1RI7A 1FYMA 2K02A 1MJ9A 2QQAA 4U88A 3WTYC 5H6QA 1IRGA 1OPCA 3Q5FA 3CUQB 1XN7A 2P7CB 2LNBA 1XCBA 4Q47A 1BN5A 2ZBKA 3E3VA 3QRFF 2ZNYA 2PBIA 3LAPA 3ECOA 1K6OA 5BOXA 1G6NA 4KICA 4KNYA 4ESFA 1BOAA 1KQ9A 1IXCA 2NNNA 4LG0A 1Z7UA 2ZMEA 4HZFA 3RPUA 1XGOA 3F22A 4K2EA 4XLPF 2DK5A 2X4HA 1SD7A 5ILVA 3LFKA 1DPRA 3LA3A 1G3YA 2PN6A 1LDKB 1YYVA 4HLYA 1A04A 2JSCA 5E18F 1GHCA 2HKOA 1U5TB 3L7WA 2CW0F 4GYIA 1IN6A 4HX8A 1QZZA 1XMAA 2ESHA 1XMKA 3FX3A 3DV8A 2MH9A 3MZYA 2IT0A 1FP1D 2A61A 4O5VA 1YIOA 3Q9VA 3M8EA 2D45A 4BHCA 1QQIA 4IF4A 3I59B 3FF5A 1J9IA 3WE3A 2VC1A 2CFXA 3DEUA 3TO6A 4B8XA 2EFWA 3ROUA 1ZYRF 1G4DA 2W85A 3KZYA 3WODF 4KYWA 4A0YA 1NHAA 3HOSA 4KMUX 4A12A 5DCMA 1GVJA 1KQ0A 2A5YB 4MQ9F 5BS6A 1LB2A 1ODDA 5LGNA 1SAXA 3MAJA 1H9TA 2RVCA 2WTEA 1R23A 2O03A 2VBYA 1QNTA 5FB2A 3K1MA 3HTSB 3MWMA 1FLIA 3QPTA 2A6HF 4Q5SF 3GFMA 4IVNA 4AD9A 4EVIA 2DFIA 4ETSA 1B6AA 1JHFA 3SQNA 1ZN2A 3KLNA 2ZFWA 4G94A 4GCVA 3F6VA 1S8NA 3FXQA 5EEHA 1YW9A 1V3FA 5ILSA 5E1WA 3JAMK 2BGCA 4HDVA 3SFZA 2QLZA 4A5NA 1ZRCA 1KU9A 5CLSA 4EJOA 1KQ8A 3L09A 5KK1A 2DQRA 2CQKA 4EJTA 4ZZLA 4A0ZA 1GXQA 4UV9A 4KIGA 2QWWA 3WTZA 5FFXA 5LEKA 4MTEA 2V1DA 5D4RA 2UZKA 2VT2A 2O8XA 1UHWA 2FNAA 2EV5A 2VONA 1FNNA 1IRFA 2V1UA 2VN2A 1BI2A 4KMFA 1S7AA 1XSDA 1YS6A 1B4AA 3ZN0A 4E70A 2XKOA 4RB3C 1Z9CA 1S6LA 2JZYA 2VBWA 1BC8C 2IP2A 1FT9A 2EFNA 5HDGA 4GO1A 3HRTA 3I53A 2FBIA 4N9IA 5JFRA 1FBUA 2L4AA 2XASA 5HLHA 4ZYGA 2RGVA 1D8JA 2ZO4A 3N97A 3DXJF 5FFZA 2AS5F 4P9FA 2P7VB 3H3ZA 4UVAA 2HKXA 1P4WA 5ERIA 2RV8A 4LJZF 3WTWC 1WSUA 2H6BA 3L2CA 4P96A 1T98A 2D2WA 3CJNA 2P6SA 4QWQA 1WKMA 4RB2C 2Z99A 5ICFA 4HAMA 2XAQA 1ZGAA 3JTHA 1E2XA 1X3UA 4JQFA 1GXPA 2P6TA 3ZP5A 3MZHA 3F72A 2E7WA 1I5ZA 1O7FA 3KEOA 2QENA 1SMYF 2B0LA 1R00A 4LLLA 5K5OA 2OA4A 3F6OA 5KVRA 2HR3A 3B73A 4YFNF 1MDMA 1LQ1A 3HRMA 4ENMA 1HW1A 4U0YA 3HOTA 4UNOA 3HHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU2 A;  3ZMD A;  4A6D A;  2QUF A;  4B09 A;  3R6S A;  3CTA A;  5CJ9 A;  4WXH A;  3CDH A;  4GYG A;  3GO5 A;  3EQL F;  3ZMT A;  3G3Z A;  4Y17 A;  4H0E A;  2JT1 A;  1FSE A;  2FXA A;  4RB0 A;  3MCZ A;  3V8L A;  2M45 A;  5LHH A;  3WU0 A;  1R22 A;  2M5W A;  1HW5 A;  3U1D A;  5K5Q A;  4U0V A;  3GFJ A;  2JRT A;  5FO5 A;  3CO7 C;  5K5R A;  1O57 A;  3HSF A;  1MJA A;  3SXY A;  2D1V A;  2HS5 A;  2BYV E;  3FM5 A;  1W5S A;  3GFL A;  4UUV A;  5AON A;  3JTG A;  1R1V A;  3WTX C;  1STZ A;  4O6J A;  1R5G A;  3F8M A;  2DU9 A;  2NYX A;  5D8K B;  4MNU A;  3FXU A;  2P5V A;  5DD8 A;  1MJB A;  1T0F A;  4BYY A;  3OOP A;  2XAG A;  1XD7 A;  2HYF A;  1TLH B;  1YQA A;  4HQE A;  1ZH5 A;  2XUB A;  4JBA A;  3LWF A;  3P9C A;  3KE2 A;  1XSV A;  3KP4 A;  1D5V A;  2QQ9 A;  2RDP A;  1FBS A;  2XIG A;  5BQT A;  3VOD A;  3IRQ A;  3P9K A;  3WGH A;  5D6E A;  3RI4 A;  3IWZ A;  3RIR A;  2Z33 A;  4ON0 A;  3BWG A;  4M6X A;  1WI9 A;  4M74 A;  2GA1 A;  1T38 A;  2OD5 A;  1YO5 C;  1IN8 A;  3LAJ A;  2BEO A;  4IXA A;  1O3Q A;  5D5V B;  2CGP A;  1UB9 A;  2RNJ A;  4HF1 A;  4EM2 A;  4ASN A;  2DW4 A;  1J7K A;  2LDU A;  4HA8 A;  1IN4 A;  2EA2 A;  1T39 A;  4HW0 A;  4M72 A;  2FNP A;  2NAZ A;  2PMH A;  2QQB A;  3HYI A;  2V9V A;  3LQQ A;  1H0M A;  2O0Y A;  4RGR A;  2FOK A;  3ABT A;  2XGX A;  3I59 A;  4L9T A;  3EYY A;  1HQC A;  1CF7 B;  4BHP A;  3DPL C;  2EWN A;  4A0X A;  1IXS B;  4EJV A;  3BOQ A;  3I71 A;  4CO8 A;  5L3B A;  3JAM Z;  3RKX A;  2DAO A;  5CVR A;  4GGG A;  1RIO H;  2F2E A;  2VXZ A;  5J8F A;  1LDJ A;  3EUH A;  1R7J A;  2D1H A;  4MEY F;  5ED4 A;  1SD5 A;  3E6B A;  1F1Z A;  4S04 A;  5DCF A;  2HWV A;  4PZJ A;  1DP7 P;  3MFK A;  1YLF A;  3W6K B;  4ZYE A;  2GXG A;  2GAU A;  3F8C A;  3I64 A;  2O3F A;  1U3E M;  4L9J A;  3TOB A;  2K4J A;  2HFH A;  3J81 Z;  1XGM A;  2ACJ A;  2UWM A;  2CG4 A;  5D6F A;  2KJB A;  2L02 A;  4OIQ F;  3FMR A;  3F21 A;  3T8R A;  1TQP A;  2OQR A;  3QPH A;  3KP2 A;  4LLG F;  1U2W A;  2MBF A;  3HSE A;  2BE5 F;  2XVC A;  3ZMU A;  1I27 A;  6PAX A;  3IHU A;  4XSX F;  1XGS A;  1HBX G;  4GXO A;  2O6G E;  4FHT A;  4WXC A;  1VTN C;  2OQG A;  5CVV A;  2EJR A;  5K1Y A;  2WWY A;  4L5J A;  2NS0 A;  2EA4 A;  1K78 B;  2RN7 A;  3F8F A;  1HXD A;  5F6F A;  4IHT A;  1CGP A;  1ZG5 A;  2DQL A;  3KZZ A;  1O7L A;  3E5X A;  4HLX A;  3V8K A;  3IKT A;  2XV4 S;  2PQ8 A;  2HTJ A;  2JPC A;  1IN7 A;  5CVU A;  1XGN A;  3HTU A;  1XCV A;  2LF8 A;  3ULQ B;  2PLY A;  4I98 B;  2M8E A;  1T6S A;  2ZXJ A;  4KT5 C;  4LD5 A;  2IA1 A;  2HEO A;  1D3Y A;  3TDU C;  1KU7 A;  4HX7 A;  5JVT A;  2ADU A;  1IAW A;  4UVB A;  4BHB A;  4UV8 A;  1D8K A;  4IRI A;  1BI3 A;  1MZB A;  5L3F A;  4HF2 A;  3O2P E;  1Z91 A;  2EV0 A;  4KIB A;  2MH2 A;  1J0R A;  5HLG A;  4OIR F;  3LA2 A;  4EV0 A;  3KP7 A;  2JPB A;  2M1B A;  3NQO A;  4UHT A;  3K1N A;  2YSR A;  4LG0 B;  5HLI A;  2ZME B;  3KLO A;  4KN7 X;  2DI3 A;  1P2F A;  1W7P D;  1YTY A;  2WC2 A;  3KCC A;  3JW4 A;  2QBY B;  4OMY A;  2XKP A;  1I6X A;  4L9N A;  2ZNZ A;  2FEZ A;  3FMQ A;  5LHG A;  5HS7 A;  1OKR A;  3BY6 A;  1ZRF A;  2PJP A;  3P9I A;  3VOE A;  3KET A;  2BBY A;  2OZ6 A;  4XLN F;  2MLG A;  1Z6T A;  2OZU A;  4YIF A;  3KP3 A;  1TNS A;  4MGR A;  1IF1 A;  3FHZ A;  5FD5 A;  4OIN F;  5DUK A;  1HST A;  2ISZ A;  4LMY A;  1XSX A;  3K9T A;  3D5L A;  5LRS A;  3W6J B;  3EDP A;  3RKW A;  2MD5 A;  2VT3 A;  2ZKZ A;  3FM3 A;  2H94 A;  3E6D A;  4I0A A;  3I5U A;  5ICG A;  2QM3 A;  3SHF A;  5DDG A;  4IPA A;  1B9N A;  3TO9 A;  1ULY A;  2Q8K A;  1TTY A;  1DPU A;  2XAJ A;  3LA7 A;  4RS8 A;  5D5U B;  3DFG A;  2NRA C;  4DNC A;  3GEZ A;  4EM1 A;  3H92 A;  3BJO A;  3ZMS A;  3GFI A;  2E7X A;  4A5M A;  5F64 A;  4I2O A;  2R7D A;  3VFZ A;  4CZZ A;  3VB2 A;  5ILU A;  3QU3 A;  3FXR A;  1U8R A;  1BIA A;  5LHI A;  3MEX A;  2F5F A;  5DCM B;  1KU3 A;  4EJU A;  1AOY A;  3GLX A;  1PP7 U;  4LB5 A;  3DQV C;  4I01 A;  4CXF A;  1Y0U A;  2L01 A;  4L18 B;  1I1G A;  4I09 A;  1YG2 A;  3ELK A;  4YII A;  2IPQ X;  2CSO A;  4M9S A;  1J2X A;  1FP2 A;  2E1N A;  2KRF A;  1W7P A;  1DUX C;  1LJ9 A;  4NB5 A;  5L3G A;  1T2K A;  3WTT C;  1EH7 A;  3QAH A;  4LFU A;  2KIM A;  2V1X A;  3ZQ7 A;  1ONV A;  5FLX K;  2YR2 A;  2IA0 A;  5DD4 A;  1FC3 A;  1SFU A;  3OV8 A;  2DPU A;  1ZGJ A;  1JXS A;  4M71 A;  3GYH X;  3TGN A;  5IT3 A;  2FBH A;  4MQV A;  3HRS A;  1FYL A;  4PCQ A;  2G9W A;  2UXN A;  5DV5 A;  2J5O A;  3FWE A;  3RKY A;  4I7H A;  5HVQ C;  1TQI A;  3DPT A;  4ESJ A;  5CYV A;  2VOD A;  1U6G A;  1I1S A;  3F8N A;  4MEX F;  4XBF A;  1HKQ A;  5D8L B;  2CO5 A;  2R7F A;  4CDG A;  2K7L A;  3JSP A;  3IKV A;  3E6M A;  3SZP A;  5CVJ A;  1E17 A;  3BPX A;  1FZP B;  2VC0 A;  4QLC U;  3L00 A;  5EEG A;  1LDD A;  5LGU A;  5BMZ A;  4LB6 B;  4Z2Y A;  3J80 K;  1BI1 A;  3O6B B;  5A2Q K;  3N4M A;  5HOO A;  1R36 A;  2GIV A;  3V8J A;  2NNY A;  2ELH A;  1Z05 A;  4RB1 A;  4EJW A;  1J75 A;  3RPQ A;  2OBP A;  1QBJ A;  3PQK A;  4BXU A;  1EH6 A;  1B9M A;  4ZH4 F;  4LK0 F;  4AVP A;  4HDU A;  2FSW A;  5L3D A;  2W25 A;  2YPR A;  1UCR A;  1F4K A;  2H09 A;  2Y0M A;  1DDN A;  4BAY A;  5AIQ A;  1YW8 A;  2Y75 A;  4KUM A;  1OMI A;  4Y15 A;  3CUQ A;  4KA4 A;  3CUO A;  4PDK A;  1QPM A;  2EFO A;  2L54 A;  1QGP A;  1JE8 A;  4LGW A;  4CIC A;  3C18 A;  1LEB A;  2EFP A;  4EM0 B;  1USS A;  1ZAO A;  2A68 F;  3P7N A;  2DK8 A;  1OYY A;  1RUN A;  4YG2 F;  5H20 A;  2PI0 A;  1SMT A;  4ENJ A;  2LKP A;  4KN4 X;  4KFC A;  2A69 F;  1JHH A;  4IJA A;  3FZV A;  4XRF A;  1U5T A;  3ZN1 A;  2KKO A;  4M73 A;  4HV6 A;  2DPD A;  5D5X B;  4P5O A;  2L4M A;  1W5T A;  3K2Z A;  5J6X A;  2W57 A;  2DO7 A;  1R58 A;  3KP6 A;  3RYP A;  3HHH A;  1MDM B;  3GVA A;  2BV6 A;  2QZ8 A;  2VOO A;  5F1R A;  4G8X A;  4MHG A;  3RTR A;  1J59 A;  4AWX B;  3HIF A;  3LQR A;  1O3T A;  2LF7 A;  5LLQ A;  5LEJ A;  4OMZ A;  3U2R A;  4M9Z A;  1K78 A;  1ON1 A;  2CYY A;  3AAF A;  1SFX A;  4HF0 A;  3M9A A;  1YS7 A;  3F23 A;  4MTD A;  4A2U A;  4IHS A;  3REO A;  1XDU A;  1R1T A;  5LRR A;  2Z5U A;  3I58 A;  3V7C A;  3E5U A;  2ZJ2 A;  3R0A A;  3TKY A;  2HQR A;  3HRU A;  5ICE A;  2XAH A;  3E5Q A;  2UXX A;  2XAF A;  1U78 A;  2W24 A;  3BDD A;  4I02 A;  3KFW X;  1KYW A;  1IUY A;  1IXR C;  2HQN A;  1P4A A;  4FX4 A;  2YX7 A;  3C1D A;  1EV7 A;  2R3S A;  4CYD A;  3CLO A;  1MKM A;  2HTS A;  2LSO A;  5BPI A;  1BJA A;  3GX4 X;  5L3E A;  1FBQ A;  1P4X A;  3KEQ A;  3D0S A;  5TJJ A;  1WRJ A;  1UST A;  1UFM A;  4Y13 A;  2Z3Y A;  2IVM A;  1ZLJ A;  2RQP A;  1YFH A;  1ZRD A;  3BRO A;  5E1X A;  4OIO F;  1OYW A;  3K69 A;  5IT9 K;  4ZYH A;  2Z9O A;  1B59 A;  1SFE A;  2PFB A;  2PMU A;  3I4P A;  4UVC A;  2QBY A;  2FQ3 A;  2JTV A;  3J7A O;  3E97 A;  3PQJ A;  3HSR A;  4G6D A;  2G7H A;  5JR3 A;  2RKH A;  2K4B A;  3WTV C;  1QO0 D;  3F8B A;  2QVO A;  3WGI A;  3COA C;  1PUE E;  2F5D A;  2GQQ A;  1QZY A;  4NHJ A;  2MA3 A;  2P5K A;  2PEX A;  4EQQ A;  3ZMV A;  3ML6 A;  1L0O C;  1IN5 A;  5FLX Z;  2MC3 A;  4KDP A;  2F5C A;  4ESB A;  3QOP A;  2DT5 A;  4XSZ F;  5LBQ A;  3BZ6 A;  1O3R A;  4RGS A;  2M30 A;  2DBB A;  1O3S A;  4AIH A;  1BC7 C;  2VE9 A;  4UXN A;  3IC7 A;  5DEQ A;  1TW2 A;  4LK1 F;  3DF8 A;  2K86 A;  5D5W B;  4LLN A;  2H6C A;  4ENN A;  3GXO A;  3QP5 A;  3EET A;  1FOK A;  1S3J A;  5J8C A;  5AIP A;  3R0J A;  2C6Y A;  4HOB A;  4L0Y B;  3MQ0 A;  2ZCW A;  1R5H A;  5DUI A;  3K0L A;  3SZT A;  3TO7 A;  2ETH A;  4M6Y A;  4ENK A;  3H3U A;  3ERE D;  3ZMZ A;  2FU4 A;  3J80 Z;  3WG9 A;  5LGT A;  5A2Q Z;  3T0Y A;  3RDI A;  3RJP A;  3O3K A;  4DQ2 A;  1OR7 A;  5ICC A;  4WXD A;  2J5P A;  3FMS A;  4FX0 A;  2KJC A;  1ZLK A;  2H27 A;  1BI0 A;  1S7O A;  1FYK A;  1TNT A;  2FA5 A;  1F5T A;  2HDC A;  2IA2 A;  2ISY A;  4R1H A;  5JHU A;  2GA2 A;  2IW5 A;  2HOE A;  1SD6 A;  1UHM A;  2FML A;  1H9G A;  3ISP A;  1Z1D A;  2VOP A;  1LVA A;  1C0W A;  4HX4 A;  4WWC A;  3CO6 C;  4RAY A;  4I0B A;  4P55 A;  1G3W A;  1REP C;  2Q2E A;  4RGX A;  1ZRE A;  2O61 A;  1RUO A;  3GW2 A;  4D0P A;  2G7U A;  3B02 A;  1KYZ A;  4U7B A;  3J81 K;  5JI6 A;  4ZZD A;  4HBL A;  4G9Y A;  3M1E A;  3M8F A;  3TOA A;  3QU6 A;  2IJL A;  4YFK F;  4WK8 F;  5TRD A;  3RYR A;  2MLK A;  1RZ4 A;  3IWF A;  5CVI A;  2EK5 A;  1HKT A;  2YU3 A;  2ESN A;  4NQW A;  4HV5 A;  2HZT A;  2YX4 A;  1KU2 A;  3ECH A;  1V4R A;  4OIP F;  2W84 A;  3GF2 A;  1K7A A;  4U7D A;  4Q4Z F;  2AXL A;  4JK1 X;  1ZG3 A;  4HYE A;  1EH8 A;  2EV6 A;  4RGU A;  2CWE A;  5HS8 A;  2KIF A;  2COM A;  4O3M A;  5BPD A;  3T1B A;  3BP8 A;  2EB7 A;  1SD4 A;  3GZ6 A;  5E17 F;  4RAZ A;  3K1P A;  4BNC A;  4BQA A;  2P8T A;  1FY7 A;  1KA8 A;  3BPV A;  2HYG D;  1ZG1 A;  5HDN A;  1TQM A;  2EFQ A;  2Q0O A;  2X0L A;  2XRO A;  4N9H A;  2A3S A;  4ZYD A;  4PGH A;  3U9G A;  2A07 F;  3T8T A;  2TDX A;  1W4M A;  1FX7 A;  3I0T A;  2OAZ A;  3M7G A;  2FBK A;  2V6C A;  3DKW A;  2FMY A;  4FT8 A;  1TBX A;  1XDS A;  3V7S A;  1P92 A;  1AWC A;  4A6E A;  1WQ2 A;  1KGS A;  3BJA A;  3WTU C;  4CHU A;  3R61 A;  1B1B A;  3ZPL A;  5IT9 Z;  1HW2 A;  1HKS A;  4HQM A;  4YFX F;  5E1Z B;  4PGG A;  3NEU A;  5E20 A;  2WV0 A;  5E8G A;  5HS9 A;  3L9F A;  1G3T A;  1XB4 A;  1IW7 F;  4L5I A;  4TV7 A;  5FD6 A;  1CF7 A;  3WU1 B;  2HGC A;  2M87 A;  4S05 A;  5FGM A;  3E6C C;  1MGT A;  4M9X A;  4U0W A;  1J5Y A;  3VEP A;  2V79 A;  3R60 A;  1JGS A;  1FSH A;  3WGG A;  2XHK A;  2VE8 A;  2K27 A;  1ZHF A;  4AIK A;  3I54 A;  3PFI A;  4L0Z B;  3NRV A;  1FWZ A;  3V7R A;  2DLL A;  3TQN A;  4IRG A;  1W7P B;  1HSJ A;  3HUG A;  2GWR A;  3Q9S A;  3QP6 A;  4BH9 A;  3IRR A;  3GUD A;  3TDZ C;  1TW3 A;  2VBZ A;  1FPQ A;  2P5L C;  4EGY A;  1Z6R A;  4F7Z A;  3R4K A;  1ZAR A;  2F5E A;  2PG4 A;  3V4G A;  4WX9 A;  3C3W A;  5H6R A;  3KP5 A;  4AIJ A;  2RC4 A;  1OYI A;  2FF4 A;  2STT A;  1BM9 A;  3F3X A;  4IRH A;  1RNL A;  2IRF G;  1MD0 A;  1L3L A;  2FE3 A;  1R1U A;  3WE2 A;  4G6Q A;  4WF2 A;  3CUQ C;  1P6R A;  5L3C A;  5DYM A;  4P9U A;  1PP8 F;  2KIU A;  1G3S A;  2GXB A;  2FRH A;  2QYO A;  2DTR A;  3C7J A;  1K79 A;  2XRN A;  3JSO A;  4G7O F;  2L3D A;  4R8H A;  1F9N A;  3GZ5 A;  4L9V A;  5D4S A;  4Q48 A;  3IL2 A;  4EGZ A;  4OOI A;  2A6E F;  4CGZ A;  2VBX A;  4OU0 A;  5E8I A;  5HDK A;  1S29 A;  4N0B A;  3S2W A;  3WTS C;  2STW A;  3G73 A;  1U5T C;  3DP7 A;  2Y48 A;  2GZW A;  1YW7 A;  1PDN C;  4G7Z F;  3GWZ A;  2E1C A;  3BJ6 A;  1ON2 A;  3EYI A;  4G7H F;  3T5X A;  4KIF A;  1LEA A;  1WWX A;  1IZ1 A;  1LNW A;  1Q1H A;  4WCG A;  2P4W A;  3ABU A;  4EMS A;  1BIB A;  1BBY A;  3LST A;  4R79 A;  1RI7 A;  1FYM A;  2K02 A;  1MJ9 A;  2QQA A;  4U88 A;  3WTY C;  5H6Q A;  1IRG A;  1OPC A;  3Q5F A;  3CUQ B;  1XN7 A;  2P7C B;  2LNB A;  1XCB A;  4Q47 A;  1BN5 A;  2ZBK A;  3E3V A;  3QRF F;  2ZNY A;  2PBI A;  3LAP A;  3ECO A;  1K6O A;  5BOX A;  1G6N A;  4KIC A;  4KNY A;  4ESF A;  1BOA A;  1KQ9 A;  1IXC A;  2NNN A;  4LG0 A;  1Z7U A;  2ZME A;  4HZF A;  3RPU A;  1XGO A;  3F22 A;  4K2E A;  4XLP F;  2DK5 A;  2X4H A;  1SD7 A;  5ILV A;  3LFK A;  1DPR A;  3LA3 A;  1G3Y A;  2PN6 A;  1LDK B;  1YYV A;  4HLY A;  1A04 A;  2JSC A;  5E18 F;  1GHC A;  2HKO A;  1U5T B;  3L7W A;  2CW0 F;  4GYI A;  1IN6 A;  4HX8 A;  1QZZ A;  1XMA A;  2ESH A;  1XMK A;  3FX3 A;  3DV8 A;  2MH9 A;  3MZY A;  2IT0 A;  1FP1 D;  2A61 A;  4O5V A;  1YIO A;  3Q9V A;  3M8E A;  2D45 A;  4BHC A;  1QQI A;  4IF4 A;  3I59 B;  3FF5 A;  1J9I A;  3WE3 A;  2VC1 A;  2CFX A;  3DEU A;  3TO6 A;  4B8X A;  2EFW A;  3ROU A;  1ZYR F;  1G4D A;  2W85 A;  3KZY A;  3WOD F;  4KYW A;  4A0Y A;  1NHA A;  3HOS A;  4KMU X;  4A12 A;  5DCM A;  1GVJ A;  1KQ0 A;  2A5Y B;  4MQ9 F;  5BS6 A;  1LB2 A;  1ODD A;  5LGN A;  1SAX A;  3MAJ A;  1H9T A;  2RVC A;  2WTE A;  1R23 A;  2O03 A;  2VBY A;  1QNT A;  5FB2 A;  3K1M A;  3HTS B;  3MWM A;  1FLI A;  3QPT A;  2A6H F;  4Q5S F;  3GFM A;  4IVN A;  4AD9 A;  4EVI A;  2DFI A;  4ETS A;  1B6A A;  1JHF A;  3SQN A;  1ZN2 A;  3KLN A;  2ZFW A;  4G94 A;  4GCV A;  3F6V A;  1S8N A;  3FXQ A;  5EEH A;  1YW9 A;  1V3F A;  5ILS A;  5E1W A;  3JAM K;  2BGC A;  4HDV A;  3SFZ A;  2QLZ A;  4A5N A;  1ZRC A;  1KU9 A;  5CLS A;  4EJO A;  1KQ8 A;  3L09 A;  5KK1 A;  2DQR A;  2CQK A;  4EJT A;  4ZZL A;  4A0Z A;  1GXQ A;  4UV9 A;  4KIG A;  2QWW A;  3WTZ A;  5FFX A;  5LEK A;  4MTE A;  2V1D A;  5D4R A;  2UZK A;  2VT2 A;  2O8X A;  1UHW A;  2FNA A;  2EV5 A;  2VON A;  1FNN A;  1IRF A;  2V1U A;  2VN2 A;  1BI2 A;  4KMF A;  1S7A A;  1XSD A;  1YS6 A;  1B4A A;  3ZN0 A;  4E70 A;  2XKO A;  4RB3 C;  1Z9C A;  1S6L A;  2JZY A;  2VBW A;  1BC8 C;  2IP2 A;  1FT9 A;  2EFN A;  5HDG A;  4GO1 A;  3HRT A;  3I53 A;  2FBI A;  4N9I A;  5JFR A;  1FBU A;  2L4A A;  2XAS A;  5HLH A;  4ZYG A;  2RGV A;  1D8J A;  2ZO4 A;  3N97 A;  3DXJ F;  5FFZ A;  2AS5 F;  4P9F A;  2P7V B;  3H3Z A;  4UVA A;  2HKX A;  1P4W A;  5ERI A;  2RV8 A;  4LJZ F;  3WTW C;  1WSU A;  2H6B A;  3L2C A;  4P96 A;  1T98 A;  2D2W A;  3CJN A;  2P6S A;  4QWQ A;  1WKM A;  4RB2 C;  2Z99 A;  5ICF A;  4HAM A;  2XAQ A;  1ZGA A;  3JTH A;  1E2X A;  1X3U A;  4JQF A;  1GXP A;  2P6T A;  3ZP5 A;  3MZH A;  3F72 A;  2E7W A;  1I5Z A;  1O7F A;  3KEO A;  2QEN A;  1SMY F;  2B0L A;  1R00 A;  4LLL A;  5K5O A;  2OA4 A;  3F6O A;  5KVR A;  2HR3 A;  3B73 A;  4YFN F;  1MDM A;  1LQ1 A;  3HRM A;  4ENM A;  1HW1 A;  4U0Y A;  3HOT A;  4UNO A;  3HHG A; 
#chains in the Genus database with same CATH topology
 3I4M J;  5FKO A;  1Z3X A;  2OU2 A;  2MSY A;  1BA5 A;  3BTC A;  3ZMD A;  4A6D A;  4CCM A;  2QUF A;  1WJF A;  4QPO A;  4ZDL A;  3R6S A;  4B09 A;  3CTA A;  5CJ9 A;  4FAS D;  2I5U A;  4WXH A;  4BBR J;  1LE8 A;  2DA2 A;  2R5Y B;  3CDH A;  1FTZ A;  4GYG A;  3GO5 A;  5HNF A;  3PUB A;  1UEL B;  2DOF A;  3EQL F;  3ZMT A;  3G3Z A;  4Y17 A;  1FOX A;  3IUO A;  4BXX J;  3RZO J;  3CCM I;  4H0E A;  2ZFU A;  2JT1 A;  1I3Q J;  5E79 C;  1FSE A;  3DTE A;  2FXA A;  4RB0 A;  4DZP A;  1XMX A;  5GPA A;  3MCZ A;  3V8L A;  4BBS J;  2CU7 A;  1T8I A;  2E2I J;  4IL6 C;  4IQ4 A;  2M45 A;  5LHH A;  1WH7 A;  1VQ4 I;  4DBQ A;  3WU0 A;  5J1Y A;  1R22 A;  2DMQ A;  2M5W A;  1QZE A;  2CW8 A;  1HW5 A;  3DEE A;  3U1D A;  5J3L A;  5GPC A;  4V19 K;  2LMD A;  4BUP A;  5K5Q A;  4U0V A;  3GFJ A;  2JRT A;  5FO5 A;  2EIJ H;  2DTZ A;  1JJ8 C;  3CO7 C;  5K5R A;  1AHD P;  1O57 A;  1VQ7 I;  3HSF A;  1MJA A;  2Y30 A;  3SXY A;  2D1V A;  4NQW B;  2HS5 A;  2BYV E;  3FM5 A;  1ENH A;  1W5S A;  3GFL A;  1H88 C;  4UUV A;  2VIX A;  2CV1 A;  1TWF J;  5AON A;  2JA2 A;  3JTG A;  1R1V A;  1WPK A;  2KZG A;  1STZ A;  3WTX C;  4O6J A;  4XOT A;  4FTH A;  4DBR A;  1R5G A;  5IP6 A;  3BT9 A;  3F8M A;  2DU9 A;  2NYX A;  1OCO H;  5D8K B;  4MNU A;  3FXU A;  2DMT A;  2P5V A;  2M9H A;  3GZN B;  5DD8 A;  1S7E A;  5E3L A;  5K7H A;  2MFZ A;  1MJB A;  3SFI A;  1G59 A;  2WA0 A;  4J19 A;  2BZT A;  3ZXS A;  1T0F A;  1Y8R B;  3OOP A;  4BYY A;  1YJN I;  2DMU A;  2YUS A;  4EEF G;  3WU2 C;  4E7S A;  2XAG A;  1XD7 A;  2CUE A;  3L2Q A;  2XSD C;  2HYF A;  1TLH B;  1YQA A;  4HST A;  4HQE A;  1ZH5 A;  2XUB A;  4JBA A;  3LWF A;  3P9C A;  4IZZ A;  4BEH A;  2XDV A;  1BOB A;  3KE2 A;  1WZ2 A;  1XSV A;  1YOV B;  2V26 A;  2AXT C;  3HKZ A;  3KP4 A;  1D5V A;  2QQ9 A;  3QQA A;  2RDP A;  3RPU D;  1FBS A;  2XIG A;  5BQT A;  3VOD A;  3C2H A;  2QA4 I;  3IRQ A;  1MNM C;  3P9K A;  5M5X J;  1VQM I;  3WGH A;  2XSJ C;  5D6E A;  3IWZ A;  3RIR A;  3RI4 A;  2JUG A;  2Z33 A;  2EPF A;  1D0Y A;  4ON0 A;  3BWG A;  3DWL E;  2LY2 A;  4M6X A;  2YU9 J;  1WI9 A;  1IJW C;  4M74 A;  2GA1 A;  3BR5 A;  1T38 A;  2OD5 A;  4BJT A;  4ITV A;  3FHN A;  1YO5 C;  3LOC A;  4XRS A;  1IN8 A;  5FRN A;  2GIZ A;  2CMP A;  2VKH A;  3S3M A;  1D1B A;  3OYD A;  3LAJ A;  3BCA A;  2BEO A;  4IXA A;  4RDU A;  1O3Q A;  4UY8 I;  3M8J A;  3FXJ A;  4D1Q A;  1XC5 A;  3K10 A;  1M1E B;  2MG4 A;  3LSJ A;  5B66 C;  3CDL A;  5D5V B;  1B72 A;  2GXA A;  5IYB J;  2CGP A;  2V6E A;  2W00 A;  4XON A;  1UB9 A;  2RNJ A;  4HF1 A;  3PL8 A;  4EM2 A;  4ASN A;  4A3I J;  3OYK A;  2DW4 A;  5IP7 J;  1J7K A;  2LDU A;  1FOW A;  2NOJ B;  1I50 J;  5JLW A;  3BZK A;  4G12 A;  4CCN A;  4HA8 A;  3CC2 I;  3NWT A;  1IN4 A;  2EA2 A;  3SDB A;  3WHB A;  1T39 A;  2L7M P;  1D1A A;  4HW0 A;  4M72 A;  4NC6 A;  2FNP A;  2TCT A;  2LD5 A;  2NAZ A;  2PMH A;  2QQB A;  3BC8 A;  2L2O A;  3HYI A;  4H4K C;  5F04 A;  2V9V A;  4II2 A;  3LQQ A;  2VUM J;  1H0M A;  2RAE A;  2O0Y A;  4RGR A;  2HXO A;  1X19 A;  2HPM A;  2FOK A;  4X6A J;  2ELK A;  2R7Q A;  3ABT A;  2XC7 A;  2XGX A;  3I59 A;  4L9T A;  3ZQH A;  1RRJ A;  4A3M J;  3EYY A;  2K9L A;  1HQC A;  1F36 A;  1CF7 B;  4BHP A;  3DPL C;  3GTM J;  2EWN A;  4A0X A;  1ETW A;  1IXS B;  1JUM A;  4EJV A;  2HVQ A;  3BOQ A;  3I71 A;  3FBI B;  3KYD B;  4CO8 A;  5L3B A;  3JAM Z;  3RKX A;  1QHH D;  4BAC A;  1P7I A;  2DAO A;  1JJ6 C;  5CVR A;  4GGG A;  1RIO H;  1OCR H;  2F2E A;  2VXZ A;  2FX0 A;  5EF6 A;  2ZJQ F;  1A6Q A;  2K3P A;  5J8F A;  1LDJ A;  2IS4 A;  3VYU B;  3EUH A;  1R7J A;  1U9N A;  1POG A;  2D1H A;  4MEY F;  3S1Q J;  1Z67 A;  5ED4 A;  1SD5 A;  3BQZ A;  3E6B A;  1F1Z A;  4S04 A;  5DCF A;  2HWV A;  2L7Z A;  4PZJ A;  1DP7 P;  3CZ6 A;  3MKZ A;  3MFK A;  1IO2 A;  3HUG B;  3PUF A;  1MMD A;  1RKT A;  1YLF A;  3LFU A;  3OYL A;  4MFD A;  4JX6 A;  3UNG C;  3W6K B;  4E7K A;  4ZYE A;  2R7X A;  2GXG A;  3U1K A;  2GAU A;  3F8C A;  1GV2 A;  3I64 A;  2O3F A;  1U3E M;  4L9J A;  3TOB A;  2DOD A;  1H8A C;  2K4J A;  2HFH A;  3I4N J;  5CQG A;  3J81 Z;  4JYK A;  3RSN A;  3H36 A;  2OF7 A;  1XGM A;  2ACJ A;  3N05 A;  2UWM A;  1U9O A;  2CG4 A;  5D6F A;  2KJB A;  2L02 A;  4BY1 J;  3OL3 A;  2IGN A;  1DGR M;  1JKR C;  2JA5 J;  4OIQ F;  5FJ8 J;  3CJT B;  2X6Y A;  3FMR A;  3NWS A;  3F21 A;  2JA8 J;  3T8R A;  1TQP A;  2EZK A;  2OQR A;  3QPH A;  3KP2 A;  4LLG F;  2K9M A;  3JRC A;  4EAT A;  1U2W A;  2MBF A;  3I56 I;  2BOL A;  4BQQ A;  1YJ9 I;  2GBY A;  4C2U A;  3HSE A;  3LSK A;  4A3F J;  2BE5 F;  5KAI C;  1ORK A;  1UHS A;  1VQ6 I;  1DP3 A;  3OOU A;  2KDZ A;  4XKV A;  2XVC A;  3ZMU A;  1I27 A;  2LR8 A;  1JI8 A;  6PAX A;  3E7L A;  3HC7 A;  5IP9 J;  5B1A H;  5M5Y J;  4KJZ A;  3GLL A;  2X6X A;  1B8I B;  3JRF A;  3IHU A;  2BHZ A;  4XSX F;  2IXS A;  1XGS A;  3ABK H;  4OAY A;  1WGX A;  2CQ7 A;  5B1B H;  4CA0 A;  5H2F C;  1SEU A;  2JVH A;  1HBX G;  3OYB A;  4GXO A;  4RAF A;  2O6G E;  3BTL A;  4FHT A;  4WXC A;  1VTN C;  2ZME C;  2OQG A;  5EGO B;  1MBF A;  5CVV A;  1JUP A;  2PJR A;  3ERM A;  2EJR A;  1N78 A;  4LIV A;  3S3O A;  5IY5 H;  5K1Y A;  3TW7 A;  4NC8 A;  2WWY A;  4L5J A;  1FOY A;  2EA4 A;  2FQ4 A;  2NS0 A;  1K78 B;  2RN7 A;  3MVP A;  3F8F A;  1WJA A;  3HDD A;  1HXD A;  5F6F A;  4YIR X;  4IHT A;  1SAN A;  3JR9 A;  4U87 A;  3VDX A;  3S93 A;  4F3Q A;  2DN0 A;  4RM3 A;  1CGP A;  5FKK A;  4A3E J;  3E1S A;  1ZG5 A;  2OTJ I;  5JHF A;  1RKW A;  2DQL A;  3KZZ A;  3CCV I;  1O7L A;  3E5X A;  4UB6 C;  4XM3 A;  4HLX A;  3V8K A;  1UZC A;  3J7Z I;  2QSH X;  3IKT A;  2JSP A;  2XV4 S;  2F48 A;  5M5W J;  1A6I A;  4F52 A;  1OQY A;  2PQ8 A;  3X2Q H;  5DM6 F;  2HTJ A;  2VXD A;  2JPC A;  1IN7 A;  5GP9 A;  5CVU A;  4DW6 A;  1XGN A;  1RR8 C;  3HTU A;  4XKW A;  4CCJ A;  1XCV A;  2LF8 A;  2F4O B;  4ZDO A;  3ULQ B;  3OS0 A;  2PLY A;  4I98 B;  1TP4 A;  2Q1Z B;  2M8E A;  1T6S A;  2ZXJ A;  4KT5 C;  4LD5 A;  2IA1 A;  2HEO A;  1D3Y A;  3TDU C;  3KX2 A;  1IDZ A;  1NK2 P;  1KU7 A;  4HX7 A;  5JVT A;  1VFC A;  1V55 H;  2ADU A;  1IAW A;  1FEX A;  4UVB A;  4BHB A;  1WJB A;  3O8H A;  4UV8 A;  1D8K A;  4IRI A;  4XIC A;  4X1E A;  1YRN A;  1BI3 A;  1MZB A;  2BW3 A;  5L3F A;  1AKH A;  3S14 J;  3DLL F;  4HF2 A;  3O2P E;  3JRD A;  1V5F A;  3EUK L;  2HOT A;  1Z91 A;  2EV0 A;  2BVM A;  4KIB A;  1MMA A;  4RA2 A;  4FE4 A;  3H1C A;  3A1Y A;  4CCK A;  2MH2 A;  3LSH A;  1J0R A;  5HLG A;  4OIR F;  3KYC B;  3LA2 A;  4EV0 A;  4IOA F;  5CPR B;  3HL2 A;  3KP7 A;  2JPB A;  2M1B A;  3NQO A;  4UHT A;  4ANJ A;  1U8B A;  2M0M A;  3HPG A;  3K1N A;  2YSR A;  2R7Z J;  4LG0 B;  5HLI A;  2ZME B;  3KLO A;  4KN7 X;  3NAU A;  2DI3 A;  1P2F A;  1LFU P;  3Q0U A;  1W7P D;  1YTY A;  2WC2 A;  3KCC A;  3JW4 A;  5IPA A;  2QBY B;  4OMY A;  1V5G A;  2XKP A;  2Z2S B;  3I9V 2;  1I6X A;  3IP4 B;  4L9N A;  4BQO A;  2ZNZ A;  4QPQ A;  2FEZ A;  1EJ9 A;  3FMQ A;  2I10 A;  5LHG A;  1IGN A;  3VWB A;  1Z77 A;  5HS7 A;  1OKR A;  3BY6 A;  1GV5 A;  2KPM A;  4AUX A;  5K7Z A;  1ZRF A;  2PJP A;  2R5Z A;  1K4T A;  3P9I A;  3VOE A;  3KET A;  4XLH A;  2BBY A;  2OZ6 A;  3GTQ J;  4XLN F;  2MLG A;  1Z6T A;  2OZU A;  4YIF A;  3KP3 A;  1TNS A;  4MGR A;  1IF1 A;  3FHZ A;  5FD5 A;  1UMQ A;  4IEJ A;  3BZC A;  4OIN F;  5DUK A;  1SFK A;  1HST A;  1HC8 A;  2LRD A;  2V1N A;  2ISZ A;  4LMY A;  1XSX A;  4B44 A;  3K9T A;  3D5L A;  5LRS A;  3JRI A;  3HOY J;  1ZK8 A;  3W6J B;  4PJ0 C;  3GTG J;  1SAU A;  1OR7 C;  3EDP A;  3RKW A;  2MD5 A;  2A05 A;  2VT3 A;  2ZKZ A;  3BG9 A;  3FM3 A;  1MMN A;  3A01 B;  4A3K J;  2H94 A;  2VAS A;  3E6D A;  1OCZ H;  3LSP A;  4I0A A;  2PX9 A;  3I5U A;  4Y7N J;  5ICG A;  2ZC2 A;  3MKY B;  2QM3 A;  3SHF A;  3W2V A;  5DDG A;  4IPA A;  1OJL A;  1B9N A;  3TO9 A;  4MO7 A;  4A3J J;  1ULY A;  2X1C A;  2Q8K A;  1TTY A;  3TMO A;  2XAJ A;  3LA7 A;  4RS8 A;  3ZR8 X;  1DPU A;  5D5U B;  3DFG A;  2H1K A;  2NRA C;  4DNC A;  3GEZ A;  4EM1 A;  3OSG A;  4PFO A;  2QEX I;  3H92 A;  3QYF A;  3BJO A;  3ZMS A;  2M3A A;  3GFI A;  4CUG A;  3K7A J;  1MSE C;  2E7X A;  4B1R A;  4A5M A;  1RES A;  2JJ7 A;  5F64 A;  2P81 A;  4I2O A;  3H5R A;  3CF2 A;  2R7D A;  3VFZ A;  2OC6 A;  3VB2 A;  4CZZ A;  5ILU A;  4D7M A;  3PJR A;  3QU3 A;  1QPI A;  3FXR A;  1U8R A;  1BIA A;  2HPI A;  2E19 A;  5LHI A;  3I3L A;  3MEX A;  2F5F A;  1R71 A;  5DCM B;  1VQN I;  1OCP A;  1KU3 A;  2ZXW H;  4EJU A;  4F91 B;  4X0G A;  4XOR A;  1MMG A;  2LC2 A;  3GLX A;  4IOC F;  1AOY A;  2BY0 A;  5EG0 A;  1PP7 U;  2UUZ A;  4LB5 A;  3LSR A;  3AL0 B;  1F43 A;  3DQV C;  4I01 A;  4CXF A;  3K4L A;  1Y0U A;  1YX3 A;  2L01 A;  4L18 B;  1I1G A;  4I09 A;  1A35 A;  1YG2 A;  4C3I J;  4PUS A;  3ELK A;  2ZXI A;  4YII A;  4II3 A;  2VJI A;  2IPQ X;  4XR6 A;  2CSO A;  4M9S A;  1J2X A;  1FP2 A;  2E1N A;  2KRF A;  1W7P A;  1DUX C;  3AG2 H;  2L9R A;  1LJ9 A;  4NB5 A;  5L3G A;  1T2K A;  4L5E A;  2RNG A;  3JCU C;  4E6K G;  3WTT C;  1EH7 A;  3QAH A;  4LFU A;  3JRE A;  1Y1W J;  4RLF A;  2Y2Z A;  1LFB A;  2KHM A;  2DOE A;  2KIM A;  5CQE A;  2V1X A;  3ZQ7 A;  2BY2 A;  4CCO A;  1ONV A;  5FLX K;  1MIJ A;  2YR2 A;  2IA0 A;  5DD4 A;  4ABZ A;  1FC3 A;  1SFU A;  3OV8 A;  2DPU A;  2P0W A;  1ZGJ A;  1JXS A;  4M71 A;  3GYH X;  3TGN A;  5IT3 A;  2FBH A;  4MQV A;  4Y3O A;  2X85 A;  3HRS A;  2KLO A;  3QPL A;  1R4M B;  3WHC A;  4E4H A;  1FYL A;  5JLX A;  4PCQ A;  1X1B A;  2G9W A;  3HGY A;  3OL4 A;  3DBL B;  4HG2 A;  2M0C A;  2UXN A;  5DV5 A;  2J5O A;  2LBF B;  4XRS G;  3FWE A;  3RKY A;  1ETV A;  3RCO A;  4I7H A;  5HVQ C;  1TQI A;  3DPT A;  4ESJ A;  3GBG A;  5CYV A;  3M1C A;  2VOD A;  3BG7 A;  1U6G A;  2M34 A;  2X1D A;  1I1S A;  3F8N A;  1T33 A;  4MEX F;  1ZEL A;  4XBF A;  1QVT A;  3B6A A;  1HKQ A;  3ESW B;  5D8L B;  2CO5 A;  1NG7 A;  2R7F A;  2VKD A;  3VYR B;  1UAA A;  4CDG A;  2K7L A;  2DXI A;  3JSP A;  3IKV A;  3E6M A;  5E3N A;  3CES A;  3SZP A;  1NK3 P;  1Y56 A;  5CVJ A;  1U0J A;  1E17 A;  1UG0 A;  3W3C A;  1HLV A;  3BPX A;  3PNT A;  1GLN A;  1FZP B;  5IOZ A;  2VC0 A;  4QLC U;  4KIT B;  3OS1 A;  3L00 A;  5EEG A;  2R7V A;  1LDD A;  1Y6I A;  4XRM A;  5LGU A;  5BMZ A;  4LB6 B;  3S1R J;  4B3X A;  1WJ5 A;  1S9H A;  3F9K A;  4HNT A;  3PNV A;  4Z2Y A;  3J80 K;  2DT7 B;  1BI1 A;  1N25 A;  3O6B B;  4DIQ A;  5A2Q K;  5HOO A;  3N4M A;  3K70 C;  1R36 A;  2GIV A;  3IH3 A;  3V8J A;  3BCB A;  1HOM A;  2NNY A;  1MBK A;  2ELH A;  1Z05 A;  4RB1 A;  4EJW A;  1J75 A;  3RPQ A;  2KT0 A;  1K6Y A;  2OBP A;  1QBJ A;  3PQK A;  3OR2 C;  4BXU A;  3RZD J;  4DYQ A;  3FDY A;  5BNG A;  4HNU A;  2L9S A;  1EH6 A;  1B9M A;  4ZH4 F;  1UG2 A;  4LK0 F;  4AVP A;  4HDU A;  2FSW A;  5L3D A;  2W25 A;  3GTK J;  2KZV A;  3A2K A;  1V54 H;  3GCM A;  2YPR A;  3L2R A;  2DA5 A;  1AU7 A;  1UCR A;  2MAB A;  1F4K A;  2H09 A;  3S2D J;  5FLM J;  4A3G J;  2Y0M A;  3BQY A;  1DDN A;  5FKN A;  3QOE A;  4BAY A;  3HOW J;  5AIQ A;  3EUA A;  3H35 A;  3J7Y J;  2VQL A;  1YW8 A;  2Y75 A;  4KUM A;  4RAG A;  1OMI A;  2PMZ N;  4Y15 A;  1MNE A;  3SZG A;  3CUQ A;  1ITY A;  4XK4 A;  4KA4 A;  3PIO F;  2ID3 A;  3CUO A;  4PDK A;  1QPM A;  2EFO A;  2M4G A;  3C2B A;  4XOP A;  2L54 A;  1IDY A;  1QGP A;  2CUZ A;  2B7E A;  1WFX A;  1JE8 A;  1K83 J;  4LGW A;  1BR4 A;  3AFH A;  4CIC A;  4UUS B;  4Y52 J;  3C18 A;  1T56 A;  1LEB A;  3H9G A;  2BY1 A;  2EFP A;  2LOO A;  4EM0 B;  1USS A;  2CQX A;  2E35 A;  1ZAO A;  2NVU B;  2X6W A;  3HB9 A;  3PSF A;  2A68 F;  3P7N A;  2DK8 A;  1OYY A;  1RUN A;  3GTL J;  5J1R A;  4YG2 F;  2CW7 A;  4PJM A;  2LG4 A;  5H20 A;  2PI0 A;  2HQ5 A;  1SMT A;  1SFO J;  4ENJ A;  4B47 A;  2LKP A;  4KN4 X;  2EBI A;  1PJR A;  4KFC A;  2A69 F;  1JHH A;  4IJA A;  3FZV A;  3BR6 A;  4XRF A;  5F0H A;  2LLK A;  1R5I D;  3ZOB A;  5DTD A;  1U5T A;  3ZN1 A;  5GAD J;  4KIS A;  2ID6 A;  2KKO A;  3G71 I;  4XL9 A;  3ASO H;  3HBL A;  4BJ5 C;  4M73 A;  4HV6 A;  2DPD A;  3HOV J;  5D5X B;  3CMA I;  4A3D J;  4P5O A;  1BW6 A;  2L4M A;  1W5T A;  3K2Z A;  5J6X A;  4DYC A;  2W57 A;  2DO7 A;  1T0F C;  3W2A A;  2HDD A;  4C3H J;  2CV2 A;  1PVE A;  1R58 A;  3DKY A;  3CF5 F;  3KP6 A;  3RYP A;  3A03 A;  3HHH A;  2ZJP F;  1MDM B;  2KP6 A;  1BR1 A;  4A93 J;  3GVA A;  2BV6 A;  2I8D A;  5E3M A;  2QZ8 A;  1BW5 A;  1OIS A;  2VOO A;  5F1R A;  4G8X A;  3L2W A;  2E2J J;  4BJ6 C;  3BTJ A;  4LOC A;  4MHG A;  2K85 A;  3RTR A;  1J59 A;  2KIQ A;  2N8G A;  4AWX B;  3HIF A;  3PIP F;  1SVM A;  3LQR A;  1O3T A;  2LF7 A;  1X1D A;  5LLQ A;  5LFA A;  5LEJ A;  4OMZ A;  1LE8 B;  3U2R A;  4M9Z A;  1K78 A;  3SYT A;  3OSF A;  4AC0 A;  1ON1 A;  2CYY A;  1SC7 A;  3AAF A;  1WJD A;  1SFX A;  4HF0 A;  3M9A A;  1YS7 A;  3F23 A;  3BG6 A;  4A2U A;  4MTD A;  1VQO I;  4IHS A;  3REO A;  1XDU A;  1WHU A;  1R1T A;  3D5S C;  5LRR A;  3PO3 J;  2Z5U A;  3IV5 A;  3I58 A;  3K4K A;  3V7C A;  4B48 A;  1FMW A;  2OPT A;  2RRE A;  2ZJ2 A;  3E5U A;  3R0A A;  3CDI A;  3TKY A;  2XB5 A;  2HQR A;  3HRU A;  3G1O A;  5ICE A;  4XQF A;  5GTI C;  2XAH A;  3E5Q A;  2LY1 A;  4GFB A;  4I99 C;  2UXX A;  2XGD A;  2XAF A;  1U78 A;  2W24 A;  3BDD A;  2KRC A;  1S5L C;  4I02 A;  3KFW X;  1KYW A;  1ERD A;  2LP0 A;  1IUY A;  1IXR C;  1FTT A;  2HQN A;  1P4A A;  4FX4 A;  3CQZ J;  2B63 J;  1EF4 A;  1TWC J;  2YX7 A;  2X48 A;  3LNQ A;  1AA7 A;  3C1D A;  1EV7 A;  2R3S A;  4CYD A;  2JUC A;  1VQK I;  2HVR A;  3CLO A;  3HXL A;  2BVL A;  3CJQ B;  1MKM A;  2HTS A;  1Y8Q B;  2LSO A;  5BPI A;  1BJA A;  1FBQ A;  1P4X A;  1TZL A;  5L3E A;  3GX4 X;  3KEQ A;  2B9S A;  3D0S A;  2R7S A;  3HOZ J;  2KQR A;  5TJJ A;  1WRJ A;  4HRI A;  2ELJ A;  1ZKG A;  3G6E I;  1TC3 C;  4BE1 A;  1HA8 A;  1UST A;  4ZTJ A;  1UFM A;  4Y13 A;  5C4X J;  2E1M C;  2Z3Y A;  1PUF A;  3OS2 A;  2IVM A;  1ZLJ A;  2RQP A;  1S72 I;  3OMY A;  4BEH B;  2Y9Z A;  2DA7 A;  1YFH A;  1ZRD A;  3BRO A;  5E1X A;  4OIO F;  1OYW A;  3OIQ A;  3K69 A;  1ACI A;  1ETY A;  2W4S A;  3CP8 A;  5IT9 K;  1A31 A;  4ZYH A;  1OCC H;  1B59 A;  2W82 A;  3Q3S A;  2Z9O A;  4J01 A;  1SFE A;  1Y0N A;  2PFB A;  2PMU A;  3I4P A;  4UVC A;  2QBY A;  3CD6 I;  1QRY A;  2FQ3 A;  3TBI A;  2ME6 A;  2JTV A;  4KT6 A;  3DBR B;  3J7A O;  3G1L A;  3E97 A;  5B5E C;  3PQJ A;  4QSH A;  3DTK A;  3HSR A;  4G6D A;  2G7H A;  5JR3 A;  1MW7 A;  2RKH A;  2K4B A;  5GAG J;  3WTV C;  4PFP A;  3S1M J;  1MSF C;  1QO0 D;  3F8B A;  3H3V K;  2QVO A;  3WGI A;  3COA C;  2IGM A;  2E36 A;  1PUE E;  2DT6 A;  2F5D A;  4BE0 A;  2JK3 A;  3OYC A;  4AYB N;  2GQQ A;  1QZY A;  1DU0 A;  4NHJ A;  2MA3 A;  2P5K A;  1OLT A;  2VJJ A;  3QWL A;  4MFE A;  2PEX A;  1IV8 A;  4EQQ A;  1K4S A;  3BR0 A;  3ZMV A;  3ML6 A;  1LUJ B;  1L0O C;  3MZ8 A;  3DPU A;  1IN5 A;  3GME A;  3K4J A;  2XGC A;  1VQ9 I;  2E5N A;  4PJJ A;  4Y33 A;  1YIT I;  5FLX Z;  3TED A;  1X4O A;  2X6O A;  2E5Z A;  3EPZ A;  4BDY A;  3ABL H;  2MC3 A;  4KDP A;  2F5C A;  4ESB A;  3OIO A;  3QOP A;  2DT5 A;  2WBM A;  4XSZ F;  1X1C A;  2CUJ A;  2AHQ A;  3BZ6 A;  5LBQ A;  2IBD A;  1O3R A;  1VND A;  4E7Z A;  4RGS A;  3CMM A;  2K9Q A;  2DBB A;  2M30 A;  2QKL B;  2E1M B;  1X3W B;  1O3S A;  4AIH A;  1BC7 C;  2VE9 A;  3ZQF A;  3JRH A;  4UXN A;  3IC7 A;  3LSG A;  2GM4 A;  5DEQ A;  1TW2 A;  4LK1 F;  3DF8 A;  2K86 A;  5D5W B;  4LLN A;  2H6C A;  4ENN A;  3K6G A;  3GXO A;  3QP5 A;  3EET A;  1FOK A;  3FK6 A;  1S3J A;  5J8C A;  3A0H C;  2F4I A;  5AIP A;  3OYA A;  1XPX A;  3R0J A;  2L5Q A;  2C6Y A;  4AID A;  5GAH J;  4HOB A;  4L0Y B;  2NVQ J;  3MQ0 A;  2QGU A;  2ZCW A;  1VQ8 I;  3JRB A;  3OYG A;  5C44 J;  3CCY A;  1R5H A;  1LVK A;  5DUI A;  3K0L A;  2MD0 A;  3SZT A;  5GAE J;  4LG3 A;  4W1U A;  3TO7 A;  2ETH A;  2IGO A;  4M6Y A;  4ENK A;  3H3U A;  2HQA A;  3ERE D;  3ZMZ A;  2FU4 A;  2LYC A;  3J80 Z;  3DU5 A;  3WG9 A;  5LGT A;  3BR1 A;  3KPH A;  3RQI A;  5A2Q Z;  3T0Y A;  1IRX A;  2L7F P;  3RDI A;  3RJP A;  3O3K A;  4CZC A;  2X9D A;  4DQ2 A;  5FRM A;  2COB A;  2EIL H;  1YE9 A;  1OR7 A;  5ICC A;  3V42 A;  4WXD A;  3F0C A;  2OCE A;  5HNH A;  4CYC A;  2J5P A;  3FMS A;  1W36 D;  4BDZ A;  4C9Y A;  4BGD A;  4FX0 A;  2KJC A;  2WY8 Q;  1ZLK A;  1JGG A;  2H27 A;  3AL0 C;  1SVO A;  4P1W A;  1BI0 A;  2VL8 A;  4BKX A;  4IO9 F;  1S7O A;  1FYK A;  2ZSH B;  4AM3 A;  1WI3 A;  3QYB A;  1TNT A;  2FA5 A;  1F5T A;  2HDC A;  2HOS A;  1QHG A;  2IA2 A;  2ISY A;  4R1H A;  5JHU A;  2K5C A;  3S3N A;  2LBF A;  3UR3 C;  2O5R A;  1X1P A;  2GA2 A;  2IW5 A;  3MMY B;  2HOE A;  1SD6 A;  1UHM A;  2FML A;  3ZQL A;  3CC4 I;  1GUU A;  2ZJR F;  4UUT A;  1H9G A;  3ISP A;  3DBH B;  2PJR B;  3PO2 J;  1Z1D A;  3U21 A;  3CC7 I;  3IH4 A;  3TP0 A;  3BR3 A;  2VOP A;  2JN6 A;  2O7O A;  3OYF A;  1LVA A;  2IS2 A;  1E3P A;  1C0W A;  4HX4 A;  3HOU J;  3S15 J;  4WWC A;  1MMS A;  3CO6 C;  3ZGK A;  4RAY A;  4I0B A;  4C2M J;  4P55 A;  1G3W A;  2AO9 A;  1REP C;  2Q2E A;  1DU6 A;  4RGX A;  2JWT A;  4JX5 A;  2LH9 A;  3HPH A;  1ZRE A;  2O61 A;  4M3G A;  5GTH C;  2W7N A;  1RUO A;  2IS6 A;  3GW2 A;  3OYN A;  4D0P A;  2G7U A;  2R5Y A;  2H8W A;  3B02 A;  1HDD C;  2EZL A;  1KYZ A;  4U7B A;  2CH0 A;  1WJE A;  3Q0V A;  3J81 K;  2H1L A;  2DOA A;  5JI6 A;  2VPR A;  2Y69 H;  4GRI A;  4ZZD A;  1Q1V A;  3KIO A;  4IQJ A;  2WAF A;  4HBL A;  1MBG A;  4G9Y A;  5CKT A;  3M1E A;  3M8F A;  3TOA A;  4RM2 A;  5F0C A;  1FJL A;  2NS7 A;  3QU6 A;  2IJL A;  4YFK F;  4WK8 F;  5TRD A;  3RYR A;  1LKX A;  5M3M J;  2MLK A;  4C30 A;  1YRN B;  2BW3 B;  1AKH B;  1RZ4 A;  3IWF A;  5CVI A;  2EK5 A;  1P7J A;  4M3D A;  3HGG A;  2JVG A;  9ANT A;  1HKT A;  2YU3 A;  2ESN A;  4NQW A;  4HV5 A;  3C2G A;  1FIP A;  2HZT A;  1T08 B;  3O8G A;  1N77 A;  2AQE A;  5KNL A;  2YX4 A;  1KU2 A;  3VPR A;  5M3F J;  3RQ4 A;  4B4C A;  3BTI A;  3ECH A;  2DFH A;  1V4R A;  4OIP F;  4YRV A;  2W84 A;  3GF2 A;  1K7A A;  2OCC H;  2DDA A;  5E3O A;  4U7D A;  4Q4Z F;  2AXL A;  4XN0 A;  4JK1 X;  3CCE I;  3W6V A;  1ZG3 A;  4ZDP A;  4HYE A;  1EH8 A;  2EV6 A;  2M4K A;  4RGU A;  4BQN A;  3QPS A;  2G0E A;  2M7A A;  2Y0S N;  2CWE A;  4N4N B;  5HS8 A;  2KIF A;  5HLT A;  2AQF A;  3AG3 H;  2COM A;  4O3M A;  2WAD A;  2PMZ A;  2XRL A;  2M7B A;  3T1B A;  3BLY A;  1XX5 A;  5BPD A;  3H5N A;  3BP8 A;  2EB7 A;  2IGK A;  1SD4 A;  4XKC A;  1ETK A;  3GZ6 A;  1VI0 A;  4HPQ A;  2VKE A;  2R5Z B;  1OFC X;  5E17 F;  2K40 A;  4RAZ A;  3K1P A;  1GVD A;  4BNC A;  3WG7 H;  1TT5 B;  5EJC A;  4BQA A;  2P8T A;  2V9P A;  2WB1 N;  1D0Z A;  1FY7 A;  1KA8 A;  3BPV A;  2QQ8 A;  1V5E A;  2HYG D;  3Q0W A;  3FIW A;  4XLE A;  1XS9 A;  1ZG1 A;  3VYS B;  1TQM A;  2EFQ A;  5J47 A;  5HDN A;  5HOD A;  2Q0O A;  2X0L A;  2XRO A;  4N9H A;  2A3S A;  4ZYD A;  4PGH A;  4FCY A;  3K2A A;  3U9G A;  2NVX J;  1RPW A;  2A07 F;  3M4O J;  3T8T A;  3ZQG A;  3CCU I;  2LFB A;  2TDX A;  1W4M A;  1FX7 A;  4DGW B;  2GLO A;  3I0T A;  1YX5 A;  2WV1 A;  2OAZ A;  3M7G A;  3KZI C;  2FBK A;  2OTL I;  2V6C A;  3DKW A;  2FMY A;  4FT8 A;  1W0T A;  1XG1 A;  1TWG J;  1TBX A;  1XDS A;  1D0X A;  2FUG 2;  5TGT A;  3V7S A;  1P92 A;  2R7W A;  1AWC A;  4A6E A;  1WQ2 A;  4A3C J;  1KGS A;  3SEQ A;  4E7H A;  1MBE A;  3HG9 A;  3BJA A;  2EZH A;  3WTU C;  2NS8 A;  4CHU A;  2R0Q C;  3R61 A;  2KMU A;  1B1B A;  3JRA A;  3ZPL A;  5IT9 Z;  2HOA A;  1HW2 A;  2X51 A;  4HNV A;  3CCQ I;  1X58 A;  3BG5 A;  3CLQ A;  3OIP A;  1X2N A;  1OCT C;  1HKS A;  3ZCO A;  2DJI A;  4HQM A;  4YFX F;  5E1Z B;  4PGG A;  3NEU A;  5E20 A;  3A4C A;  2WV0 A;  5E8G A;  3ZQC A;  5HS9 A;  2A5W A;  5KAF C;  2EZI A;  3L9F A;  1G3T A;  1IG7 A;  1XB4 A;  1MH3 A;  4RLQ A;  3AKZ A;  1JKQ C;  1IW7 F;  4L5I A;  4TV7 A;  3TW6 A;  5FD6 A;  1CF7 A;  3WU1 B;  2HGC A;  2M87 A;  2R4G A;  4OAZ A;  4S05 A;  3SJM A;  5FGM A;  2VI6 A;  1MGT A;  4M9X A;  3E6C C;  2XF5 A;  4DJA A;  1K61 A;  2R93 J;  4U0W A;  1J5Y A;  3VEP A;  2VJ4 A;  4CSW A;  2V79 A;  1BJZ A;  1IV6 A;  4AU7 A;  3R60 A;  3BR2 A;  1JGS A;  5EG0 B;  4ZTF A;  2QSG X;  4BY7 J;  3WGG A;  1FSH A;  2DA1 A;  2XHK A;  1BR2 A;  2XAU A;  2BHY A;  2VE8 A;  4JP0 A;  2K27 A;  1WVR A;  4V2F A;  1VQ5 I;  1ZHF A;  4AIK A;  3I54 A;  3HZJ A;  3PFI A;  4L0Z B;  1QA6 A;  2HNH A;  3NRV A;  2ECC A;  2CJJ A;  2E71 A;  1FWZ A;  4FIS A;  3V7R A;  1Y39 A;  2DLL A;  3TQN A;  4IRG A;  1W7P B;  1HSJ A;  3HUG A;  2GWR A;  3Q9S A;  3QP6 A;  4BH9 A;  3IRR A;  3GUD A;  2FOW A;  3TDZ C;  1KON A;  2HZD A;  1TW3 A;  2VBZ A;  1FPQ A;  2P5L C;  4EGY A;  3OR1 C;  1ETX A;  1Z6R A;  2QSF X;  4F7Z A;  2ICW G;  3W2W A;  2MC4 A;  4BU2 A;  4F55 A;  1Z0X A;  3R4K A;  1ZAR A;  2F5E A;  2PG4 A;  3V4G A;  2EIN H;  2L9N A;  4WX9 A;  4M6V A;  3C3W A;  5EDN A;  1FIA A;  3DEW A;  3FXO A;  4NC7 A;  5H6R A;  3KP5 A;  4AIJ A;  1I6H J;  2GOM A;  2RC4 A;  1OYI A;  3GTJ J;  2IS1 A;  2FF4 A;  4A69 C;  2STT A;  1IC8 A;  1BM9 A;  3F3X A;  5DS9 A;  1RET A;  5B3S H;  4IRH A;  3OYH A;  1RNL A;  2IRF G;  4IHV A;  4I6Z A;  1MD0 A;  2LRE A;  4LIT A;  3CCS I;  1HF0 A;  2R7U A;  1L3L A;  2FE3 A;  5FKL A;  1HDP A;  1R1U A;  3AG1 H;  3WE2 A;  2YS9 A;  4G6Q A;  3J7A Y;  4WF2 A;  3CUQ C;  1P6R A;  5L3C A;  5DYM A;  2R92 J;  4P9U A;  5KCM A;  2LKX A;  1PP8 F;  1LFP A;  2KIU A;  3NAR A;  1G3S A;  2GXB A;  2ZSI B;  3IAM 2;  3A02 A;  2FRH A;  2QYO A;  1N75 A;  2DTR A;  3C7J A;  1K79 A;  3GTO J;  3P5J A;  2XRN A;  1B8I A;  4XLF A;  3JSO A;  4G7O F;  3TL4 X;  2L3D A;  4R8H A;  1F9N A;  3OYM A;  1SVL A;  4XID A;  4M3B A;  1TL8 A;  5JVG F;  3GZ5 A;  4L9V A;  3LMM A;  5D4S A;  4Q48 A;  2NOG A;  4IX7 A;  2WY7 Q;  3IL2 A;  2XF6 A;  3S2H J;  5EGO A;  4XNF A;  4EGZ A;  2DCE A;  2VJ5 A;  4W97 A;  2F6C A;  4OOI A;  2A6E F;  4RBO A;  4CGZ A;  1KZH A;  2VBX A;  3M07 A;  4OU0 A;  5E8I A;  2E2H J;  5HDK A;  1S29 A;  4XMY A;  2IAI A;  3FXL A;  4N0B A;  3D1N I;  3S2W A;  4I76 A;  3WTS C;  1R6R A;  2STW A;  3G73 A;  4OWR B;  1U5T C;  3DP7 A;  2Y48 A;  3MKW B;  2X1E A;  3H9Q A;  5EYR A;  4E7L A;  3OYI A;  4AYB A;  2GZW A;  1YW7 A;  2DA6 A;  3DTI A;  1PDN C;  4G7Z F;  3H0D A;  1MND A;  2VQH A;  3GWZ A;  2E1C A;  3BJ6 A;  4D5F A;  2VKV A;  5KHD A;  1ON2 A;  3EYI A;  2JA7 J;  4G7H F;  3DKX A;  3T5X A;  1A36 A;  4KIF A;  2D5V A;  2WAQ A;  1LEA A;  4YEL A;  1WWX A;  1IZ1 A;  1IUF A;  3OYJ A;  1LNW A;  5IOY A;  1Q1H A;  4WCG A;  5C4J J;  5F08 A;  1O4X A;  2EQR A;  2ECB A;  1DQU A;  2P4W A;  3S8P A;  1RC9 A;  3ABU A;  4EMS A;  1BIB A;  1BBY A;  3LST A;  4CH7 A;  2EIK H;  1NG6 A;  1ZTR A;  2F5V A;  2DA4 A;  2XB0 X;  3E0J B;  4N4O B;  1RI7 A;  4R79 A;  1FYM A;  2BY3 A;  1MJ9 A;  2K02 A;  2H8R A;  2QQA A;  3HEF A;  4U88 A;  2XGE A;  5H6Q A;  3WTY C;  4GDF A;  1IRG A;  1OPC A;  3Q5F A;  5EEA A;  3TP3 A;  4XLC A;  1JKP C;  4IHX A;  3CUQ B;  2V7F A;  1XN7 A;  3ONQ A;  1UJ8 A;  3OY9 A;  2R7R A;  2P7C B;  1TT0 A;  2LNB A;  3HKZ N;  2JA6 J;  1XCB A;  2RQQ A;  4Q47 A;  1BN5 A;  2ZBK A;  2EIM H;  3E3V A;  3QRF F;  3I55 I;  1DGW Y;  2ZNY A;  3SDG A;  3CCJ I;  2PBI A;  3LAP A;  3ECO A;  1K6O A;  1X2M A;  2LKS A;  5BOX A;  1G6N A;  5J40 A;  3FKI J;  4KIC A;  4KNY A;  4ESF A;  1BOA A;  1Z3Y A;  2VQC A;  1KQ9 A;  1IXC A;  2NNN A;  5FLV A;  4JX4 A;  4LG0 A;  1MH4 A;  1Z7U A;  2ZME A;  2XPU A;  3QYE A;  4CCL A;  2E34 A;  1W1W E;  2DA3 A;  1ETO A;  4HZF A;  1XGO A;  3EUH C;  3RPU A;  3F22 A;  2QKM B;  1QVU A;  1X4P A;  4K2E A;  4XLP F;  2DK5 A;  4M3E A;  4BS9 A;  2X4H A;  1SD7 A;  5ILV A;  4FQG A;  3LFK A;  2FD5 A;  4HEA 2;  1JT0 A;  1DPR A;  3FBN B;  3LA3 A;  1G3Y A;  2PN6 A;  2DMP A;  4F93 B;  1LDK B;  1YYV A;  2K9N A;  4HLY A;  1A04 A;  2JSC A;  5E18 F;  1YJW I;  1GHC A;  2HKO A;  3CJR B;  1U5T B;  3L7W A;  2DYS H;  5C3E J;  3H5A A;  2CW0 F;  4GYI A;  2BXY A;  4M3F A;  1X3Z B;  1MBH A;  1IN6 A;  4HX8 A;  1QZZ A;  4NBQ A;  1XMA A;  2ESH A;  1VZ0 A;  1B72 B;  3K4N A;  4YEJ A;  1H89 C;  1XMK A;  3UKG A;  1LPQ A;  2DDB A;  3FX3 A;  2MGQ A;  4NUB A;  3DV8 A;  3PSI A;  3SEZ A;  2DYR H;  3S17 J;  4V2G A;  2MH9 A;  2JMW A;  4RMN A;  2F4M B;  4XLA A;  3ZQQ A;  2O8K A;  3MZY A;  2WAQ N;  2NXN B;  3DU6 A;  4XKB A;  1FP1 D;  1GT0 C;  2IT0 A;  2W1O A;  3A01 A;  2A61 A;  4O5V A;  1YIO A;  3CMY A;  3PFY A;  3Q9V A;  3FIS A;  3M8E A;  3CCR I;  2D45 A;  4IHY A;  2K3F A;  3L2U A;  2ZB9 A;  3K4C A;  4BHC A;  1QQI A;  4IF4 A;  3FXK A;  2CQQ A;  3I59 B;  3FF5 A;  2DMN A;  3HJE A;  2ZXH A;  4AVZ A;  1ZR2 A;  1J9I A;  3WE3 A;  2VC1 A;  2CFX A;  5FKM A;  3DEU A;  2KL4 A;  3TO6 A;  4B8X A;  2KIS A;  2EFW A;  1RR7 A;  3ROU A;  1ZYR F;  4HSR A;  4NNJ A;  4B3A A;  2XF7 A;  2W85 A;  1G4D A;  3ASN H;  2CQN A;  3KZY A;  2TRT A;  4E7I A;  3WOD F;  3MN2 A;  3AG4 H;  4KYW A;  5F27 A;  2Z1D A;  4A0Y A;  2VB6 A;  1T95 A;  1NHA A;  3KYL A;  2E60 A;  3BG3 A;  3HOS A;  4KMU X;  4A12 A;  3A0B C;  5DCM A;  1EA3 A;  1GVJ A;  4IHW A;  3FK7 A;  1KQ0 A;  2A5Y B;  4NDL A;  4MQ9 F;  5BS6 A;  4UB8 C;  1LB2 A;  1WCM J;  1JKO C;  1ODD A;  5LGN A;  1SAX A;  3MAJ A;  2WAE A;  3S1N J;  1H9T A;  2RVC A;  4PJN A;  4DZJ A;  2WTE A;  1R23 A;  1R4N B;  2O03 A;  5EZG A;  1HCR A;  2M8G X;  2VBY A;  1QNT A;  5FB2 A;  4QIW N;  3K1M A;  1VQP I;  3HTS B;  1PUF B;  3QOD A;  3MWM A;  1FLI A;  3QPT A;  3HM5 A;  2A6H F;  3VYT B;  2L7K A;  2HYJ A;  4Q5S F;  3GFM A;  4IVN A;  4AD9 A;  4EVI A;  2DFI A;  2BXZ A;  1TWA J;  1Y1V J;  2HU9 A;  1E3O C;  4ETS A;  2L9V A;  2MW8 A;  3G4S I;  1B6A A;  2EH3 A;  2NVT J;  1JHF A;  2OJE D;  3SQN A;  4F92 B;  1G8X A;  1ZN2 A;  2LTP A;  3KLN A;  2HI3 A;  4B43 A;  4BE2 A;  2W48 A;  2CV0 A;  5J4V A;  2CFO A;  2JRM A;  2Y0S A;  2ME0 A;  3GTP J;  2ZFW A;  1VF9 A;  1E3H A;  4G94 A;  5J1U A;  4GCV A;  2DFE A;  3F6V A;  1S8N A;  4D7N A;  2O9L A;  3FXQ A;  5EEH A;  1YW9 A;  1V3F A;  5ILS A;  5E1W A;  3JAM K;  3JRG A;  1Z21 A;  2BGC A;  4HDV A;  3SFZ A;  3G1M A;  2QLZ A;  4A5N A;  4E7J A;  3K70 D;  1ZRC A;  2KRH A;  1BL0 A;  2Z16 A;  1KU9 A;  3IH2 A;  5CLS A;  4G6T B;  5EZH A;  2KDO A;  2WB1 A;  3K4B A;  3LL7 A;  3VSL A;  4EJO A;  1KQ8 A;  2KFD A;  3L09 A;  2CS3 A;  5KK1 A;  3RKQ A;  1JTX A;  3L2V A;  3S32 A;  2DQR A;  2CQK A;  2DFF A;  4EJT A;  1R49 A;  1APL C;  4FET A;  4FE7 A;  5FRO A;  3CCL I;  4ZZL A;  2CRG A;  4A0Z A;  4BL0 B;  1GXQ A;  1MBJ A;  1QU3 A;  4PK4 A;  4KIG A;  4UV9 A;  5DM7 F;  2QWW A;  2E1O A;  3WTZ A;  4D5C A;  5FFX A;  2GOX B;  5LEK A;  1JT6 A;  4MLO A;  3LSI A;  3LSM A;  3B6C A;  4ZJZ A;  2R7T A;  4MTE A;  4D9J A;  2V1D A;  2UV1 A;  1VQL I;  1X1A A;  3DCF A;  1FMV A;  5D4R A;  2UZK A;  2VT2 A;  1J09 A;  2M2E A;  2O8X A;  3HOX J;  2IEK A;  1GDT A;  3CP2 A;  4QTR A;  1TWH J;  2XPV A;  5TIS C;  1XTA A;  3IAS 2;  1D1C A;  1UHW A;  5K7F A;  2VLA A;  2JQ7 A;  2HDW A;  2NVY J;  3L1P A;  1I3A A;  2FNA A;  2EV5 A;  2VON A;  1FNN A;  1IRF A;  2L0K A;  2HXI A;  1YI2 I;  2V1U A;  2VN2 A;  4PJL A;  1BI2 A;  4KMF A;  1S7A A;  4Y4R A;  3OWT A;  1YS6 A;  1XSD A;  4A3L J;  1JTY A;  1B4A A;  3ZN0 A;  4Z6Y A;  4E70 A;  2XKO A;  3ABM H;  3S16 J;  4RB3 C;  1Z9C A;  1S6L A;  3ZQI A;  2HVS A;  3H0G J;  1R9T J;  2JZY A;  2VBW A;  1BC8 C;  1WH5 A;  2IP2 A;  3CME I;  1FT9 A;  2OUM A;  4A3B J;  4IKF A;  2EFN A;  5HDG A;  4GO1 A;  3HRT A;  3I53 A;  3FKJ A;  1NH3 A;  3OYE A;  5LD2 C;  2FBI A;  4ZC3 A;  3PM1 A;  4S0H B;  4N9I A;  3H9J A;  1W0U A;  1YIJ I;  5JFR A;  1FBU A;  2L4A A;  4LIU A;  4C2T A;  2XAS A;  5HLH A;  5IYD J;  4ZYG A;  2RGV A;  5IYC J;  1D8J A;  2ZO4 A;  3N97 A;  3DXJ F;  5FFZ A;  2AS5 F;  3M3Y J;  2LK2 A;  4P9F A;  2LY9 A;  4JOM A;  1E0E A;  1I39 A;  2P7V B;  4UUS A;  1EKE A;  3H3Z A;  1ZQ3 P;  1W5C C;  2HKX A;  4PSW A;  4UVA A;  2K9S A;  3PNY A;  4DYR A;  1P4W A;  5ERI A;  2RV8 A;  2V4J C;  4LJZ F;  4PSX A;  3WTW C;  1WSU A;  4CYC B;  2H6B A;  3L2C A;  1ZR4 A;  4P96 A;  1T98 A;  2D2W A;  1ZGW A;  2LVS A;  3CJN A;  2P6S A;  4QWQ A;  2CUF A;  4DOZ A;  3MKL A;  2VPL A;  2VQG A;  4ZYA A;  1WKM A;  1YHQ I;  4RB2 C;  2Z99 A;  5ICF A;  4J00 A;  4HAM A;  2XAQ A;  1ZGA A;  3JTH A;  1E2X A;  1X3U A;  4JQF A;  1GXP A;  1NTC A;  1G2H A;  2QF7 A;  3VSK A;  2P6T A;  3ZP5 A;  3MZH A;  1D5Y A;  1A5J A;  1JUS A;  2DJN A;  3F72 A;  2E7W A;  3FXM A;  1I5Z A;  2R7O A;  4BXF A;  1O7F A;  2A6T A;  3D5R C;  4MIM A;  3KEO A;  3KEY A;  1CQT A;  2QEN A;  1SMY F;  1PYV A;  4C3J J;  5J4Y A;  2B0L A;  1R00 A;  4LLL A;  1WJC A;  5K5O A;  2Y9Y A;  2Y31 A;  1ETQ A;  2OA4 A;  3F6O A;  3ZRG A;  5F1J A;  1W36 C;  5KVR A;  2HR3 A;  3B73 A;  3DLA A;  2MYS A;  4YFN F;  1P9Q C;  1MDM A;  1LQ1 A;  3HRM A;  2QCO A;  5F0F A;  4XN3 A;  4ENM A;  2XPW A;  2OV7 A;  1HW1 A;  3K4M A;  4U0Y A;  3HOT A;  1Z7L A;  2V9K A;  2FJ1 A;  1IRZ A;  3MD2 A;  3G2B A;  4UNO A;  2Q2E B;  3HHG A; 
#chains in the Genus database with same CATH homology
 2OU2 A;  3ZMD A;  4A6D A;  2QUF A;  4B09 A;  3R6S A;  3CTA A;  5CJ9 A;  4WXH A;  3CDH A;  4GYG A;  3GO5 A;  3EQL F;  3ZMT A;  3G3Z A;  4Y17 A;  4H0E A;  2JT1 A;  1FSE A;  2FXA A;  4RB0 A;  3MCZ A;  3V8L A;  2M45 A;  5LHH A;  3WU0 A;  1R22 A;  2M5W A;  1HW5 A;  3U1D A;  5K5Q A;  4U0V A;  3GFJ A;  2JRT A;  5FO5 A;  3CO7 C;  5K5R A;  1O57 A;  3HSF A;  1MJA A;  3SXY A;  2D1V A;  2HS5 A;  2BYV E;  3FM5 A;  1W5S A;  3GFL A;  4UUV A;  5AON A;  3JTG A;  1R1V A;  3WTX C;  1STZ A;  4O6J A;  1R5G A;  3F8M A;  2DU9 A;  2NYX A;  5D8K B;  4MNU A;  3FXU A;  2P5V A;  5DD8 A;  1MJB A;  1T0F A;  4BYY A;  3OOP A;  2XAG A;  1XD7 A;  2HYF A;  1TLH B;  1YQA A;  4HQE A;  1ZH5 A;  2XUB A;  4JBA A;  3LWF A;  3P9C A;  3KE2 A;  1XSV A;  3KP4 A;  1D5V A;  2QQ9 A;  2RDP A;  1FBS A;  2XIG A;  5BQT A;  3VOD A;  3IRQ A;  3P9K A;  3WGH A;  5D6E A;  3RI4 A;  3IWZ A;  3RIR A;  2Z33 A;  4ON0 A;  3BWG A;  4M6X A;  1WI9 A;  4M74 A;  2GA1 A;  1T38 A;  2OD5 A;  1YO5 C;  1IN8 A;  3LAJ A;  2BEO A;  4IXA A;  1O3Q A;  5D5V B;  2CGP A;  1UB9 A;  2RNJ A;  4HF1 A;  4EM2 A;  4ASN A;  2DW4 A;  1J7K A;  2LDU A;  4HA8 A;  1IN4 A;  2EA2 A;  1T39 A;  4HW0 A;  4M72 A;  2FNP A;  2NAZ A;  2PMH A;  2QQB A;  3HYI A;  2V9V A;  3LQQ A;  1H0M A;  2O0Y A;  4RGR A;  2FOK A;  3ABT A;  2XGX A;  3I59 A;  4L9T A;  3EYY A;  1HQC A;  1CF7 B;  4BHP A;  3DPL C;  2EWN A;  4A0X A;  1IXS B;  4EJV A;  3BOQ A;  3I71 A;  4CO8 A;  5L3B A;  3JAM Z;  3RKX A;  2DAO A;  5CVR A;  4GGG A;  1RIO H;  2F2E A;  2VXZ A;  5J8F A;  1LDJ A;  3EUH A;  1R7J A;  2D1H A;  4MEY F;  5ED4 A;  1SD5 A;  3E6B A;  1F1Z A;  4S04 A;  5DCF A;  2HWV A;  4PZJ A;  1DP7 P;  3MFK A;  1YLF A;  3W6K B;  4ZYE A;  2GXG A;  2GAU A;  3F8C A;  3I64 A;  2O3F A;  1U3E M;  4L9J A;  3TOB A;  2K4J A;  2HFH A;  3J81 Z;  1XGM A;  2ACJ A;  2UWM A;  2CG4 A;  5D6F A;  2KJB A;  2L02 A;  4OIQ F;  3FMR A;  3F21 A;  3T8R A;  1TQP A;  2OQR A;  3QPH A;  3KP2 A;  4LLG F;  1U2W A;  2MBF A;  3HSE A;  2BE5 F;  2XVC A;  3ZMU A;  1I27 A;  6PAX A;  3IHU A;  4XSX F;  1XGS A;  1HBX G;  4GXO A;  2O6G E;  4FHT A;  4WXC A;  1VTN C;  2OQG A;  5CVV A;  2EJR A;  5K1Y A;  2WWY A;  4L5J A;  2NS0 A;  2EA4 A;  1K78 B;  2RN7 A;  3F8F A;  1HXD A;  5F6F A;  4IHT A;  1CGP A;  1ZG5 A;  2DQL A;  3KZZ A;  1O7L A;  3E5X A;  4HLX A;  3V8K A;  3IKT A;  2XV4 S;  2PQ8 A;  2HTJ A;  2JPC A;  1IN7 A;  5CVU A;  1XGN A;  3HTU A;  1XCV A;  2LF8 A;  3ULQ B;  2PLY A;  4I98 B;  2M8E A;  1T6S A;  2ZXJ A;  4KT5 C;  4LD5 A;  2IA1 A;  2HEO A;  1D3Y A;  3TDU C;  1KU7 A;  4HX7 A;  5JVT A;  2ADU A;  1IAW A;  4UVB A;  4BHB A;  4UV8 A;  1D8K A;  4IRI A;  1BI3 A;  1MZB A;  5L3F A;  4HF2 A;  3O2P E;  1Z91 A;  2EV0 A;  4KIB A;  2MH2 A;  1J0R A;  5HLG A;  4OIR F;  3LA2 A;  4EV0 A;  3KP7 A;  2JPB A;  2M1B A;  3NQO A;  4UHT A;  3K1N A;  2YSR A;  4LG0 B;  5HLI A;  2ZME B;  3KLO A;  4KN7 X;  2DI3 A;  1P2F A;  1W7P D;  1YTY A;  2WC2 A;  3KCC A;  3JW4 A;  2QBY B;  4OMY A;  2XKP A;  1I6X A;  4L9N A;  2ZNZ A;  2FEZ A;  3FMQ A;  5LHG A;  5HS7 A;  1OKR A;  3BY6 A;  1ZRF A;  2PJP A;  3P9I A;  3VOE A;  3KET A;  2BBY A;  2OZ6 A;  4XLN F;  2MLG A;  1Z6T A;  2OZU A;  4YIF A;  3KP3 A;  1TNS A;  4MGR A;  1IF1 A;  3FHZ A;  5FD5 A;  4OIN F;  5DUK A;  1HST A;  2ISZ A;  4LMY A;  1XSX A;  3K9T A;  3D5L A;  5LRS A;  3W6J B;  3EDP A;  3RKW A;  2MD5 A;  2VT3 A;  2ZKZ A;  3FM3 A;  2H94 A;  3E6D A;  4I0A A;  3I5U A;  5ICG A;  2QM3 A;  3SHF A;  5DDG A;  4IPA A;  1B9N A;  3TO9 A;  1ULY A;  2Q8K A;  1TTY A;  1DPU A;  2XAJ A;  3LA7 A;  4RS8 A;  5D5U B;  3DFG A;  2NRA C;  4DNC A;  3GEZ A;  4EM1 A;  3H92 A;  3BJO A;  3ZMS A;  3GFI A;  2E7X A;  4A5M A;  5F64 A;  4I2O A;  2R7D A;  3VFZ A;  4CZZ A;  3VB2 A;  5ILU A;  3QU3 A;  3FXR A;  1U8R A;  1BIA A;  5LHI A;  3MEX A;  2F5F A;  5DCM B;  1KU3 A;  4EJU A;  1AOY A;  3GLX A;  1PP7 U;  4LB5 A;  3DQV C;  4I01 A;  4CXF A;  1Y0U A;  2L01 A;  4L18 B;  1I1G A;  4I09 A;  1YG2 A;  3ELK A;  4YII A;  2IPQ X;  2CSO A;  4M9S A;  1J2X A;  1FP2 A;  2E1N A;  2KRF A;  1W7P A;  1DUX C;  1LJ9 A;  4NB5 A;  5L3G A;  1T2K A;  3WTT C;  1EH7 A;  3QAH A;  4LFU A;  2KIM A;  2V1X A;  3ZQ7 A;  1ONV A;  5FLX K;  2YR2 A;  2IA0 A;  5DD4 A;  1FC3 A;  1SFU A;  3OV8 A;  2DPU A;  1ZGJ A;  1JXS A;  4M71 A;  3GYH X;  3TGN A;  5IT3 A;  2FBH A;  4MQV A;  3HRS A;  1FYL A;  4PCQ A;  2G9W A;  2UXN A;  5DV5 A;  2J5O A;  3FWE A;  3RKY A;  4I7H A;  5HVQ C;  1TQI A;  3DPT A;  4ESJ A;  5CYV A;  2VOD A;  1U6G A;  1I1S A;  3F8N A;  4MEX F;  4XBF A;  1HKQ A;  5D8L B;  2CO5 A;  2R7F A;  4CDG A;  2K7L A;  3JSP A;  3IKV A;  3E6M A;  3SZP A;  5CVJ A;  1E17 A;  3BPX A;  1FZP B;  2VC0 A;  4QLC U;  3L00 A;  5EEG A;  1LDD A;  5LGU A;  5BMZ A;  4LB6 B;  4Z2Y A;  3J80 K;  1BI1 A;  3O6B B;  5A2Q K;  3N4M A;  5HOO A;  1R36 A;  2GIV A;  3V8J A;  2NNY A;  2ELH A;  1Z05 A;  4RB1 A;  4EJW A;  1J75 A;  3RPQ A;  2OBP A;  1QBJ A;  3PQK A;  4BXU A;  1EH6 A;  1B9M A;  4ZH4 F;  4LK0 F;  4AVP A;  4HDU A;  2FSW A;  5L3D A;  2W25 A;  2YPR A;  1UCR A;  1F4K A;  2H09 A;  2Y0M A;  1DDN A;  4BAY A;  5AIQ A;  1YW8 A;  2Y75 A;  4KUM A;  1OMI A;  4Y15 A;  3CUQ A;  4KA4 A;  3CUO A;  4PDK A;  1QPM A;  2EFO A;  2L54 A;  1QGP A;  1JE8 A;  4LGW A;  4CIC A;  3C18 A;  1LEB A;  2EFP A;  4EM0 B;  1USS A;  1ZAO A;  2A68 F;  3P7N A;  2DK8 A;  1OYY A;  1RUN A;  4YG2 F;  5H20 A;  2PI0 A;  1SMT A;  4ENJ A;  2LKP A;  4KN4 X;  4KFC A;  2A69 F;  1JHH A;  4IJA A;  3FZV A;  4XRF A;  1U5T A;  3ZN1 A;  2KKO A;  4M73 A;  4HV6 A;  2DPD A;  5D5X B;  4P5O A;  2L4M A;  1W5T A;  3K2Z A;  5J6X A;  2W57 A;  2DO7 A;  1R58 A;  3KP6 A;  3RYP A;  3HHH A;  1MDM B;  3GVA A;  2BV6 A;  2QZ8 A;  2VOO A;  5F1R A;  4G8X A;  4MHG A;  3RTR A;  1J59 A;  4AWX B;  3HIF A;  3LQR A;  1O3T A;  2LF7 A;  5LLQ A;  5LEJ A;  4OMZ A;  3U2R A;  4M9Z A;  1K78 A;  1ON1 A;  2CYY A;  3AAF A;  1SFX A;  4HF0 A;  3M9A A;  1YS7 A;  3F23 A;  4MTD A;  4A2U A;  4IHS A;  3REO A;  1XDU A;  1R1T A;  5LRR A;  2Z5U A;  3I58 A;  3V7C A;  3E5U A;  2ZJ2 A;  3R0A A;  3TKY A;  2HQR A;  3HRU A;  5ICE A;  2XAH A;  3E5Q A;  2UXX A;  2XAF A;  1U78 A;  2W24 A;  3BDD A;  4I02 A;  3KFW X;  1KYW A;  1IUY A;  1IXR C;  2HQN A;  1P4A A;  4FX4 A;  2YX7 A;  3C1D A;  1EV7 A;  2R3S A;  4CYD A;  3CLO A;  1MKM A;  2HTS A;  2LSO A;  5BPI A;  1BJA A;  3GX4 X;  5L3E A;  1FBQ A;  1P4X A;  3KEQ A;  3D0S A;  5TJJ A;  1WRJ A;  1UST A;  1UFM A;  4Y13 A;  2Z3Y A;  2IVM A;  1ZLJ A;  2RQP A;  1YFH A;  1ZRD A;  3BRO A;  5E1X A;  4OIO F;  1OYW A;  3K69 A;  5IT9 K;  4ZYH A;  2Z9O A;  1B59 A;  1SFE A;  2PFB A;  2PMU A;  3I4P A;  4UVC A;  2QBY A;  2FQ3 A;  2JTV A;  3J7A O;  3E97 A;  3PQJ A;  3HSR A;  4G6D A;  2G7H A;  5JR3 A;  2RKH A;  2K4B A;  3WTV C;  1QO0 D;  3F8B A;  2QVO A;  3WGI A;  3COA C;  1PUE E;  2F5D A;  2GQQ A;  1QZY A;  4NHJ A;  2MA3 A;  2P5K A;  2PEX A;  4EQQ A;  3ZMV A;  3ML6 A;  1L0O C;  1IN5 A;  5FLX Z;  2MC3 A;  4KDP A;  2F5C A;  4ESB A;  3QOP A;  2DT5 A;  4XSZ F;  5LBQ A;  3BZ6 A;  1O3R A;  4RGS A;  2M30 A;  2DBB A;  1O3S A;  4AIH A;  1BC7 C;  2VE9 A;  4UXN A;  3IC7 A;  5DEQ A;  1TW2 A;  4LK1 F;  3DF8 A;  2K86 A;  5D5W B;  4LLN A;  2H6C A;  4ENN A;  3GXO A;  3QP5 A;  3EET A;  1FOK A;  1S3J A;  5J8C A;  5AIP A;  3R0J A;  2C6Y A;  4HOB A;  4L0Y B;  3MQ0 A;  2ZCW A;  1R5H A;  5DUI A;  3K0L A;  3SZT A;  3TO7 A;  2ETH A;  4M6Y A;  4ENK A;  3H3U A;  3ERE D;  3ZMZ A;  2FU4 A;  3J80 Z;  3WG9 A;  5LGT A;  5A2Q Z;  3T0Y A;  3RDI A;  3RJP A;  3O3K A;  4DQ2 A;  1OR7 A;  5ICC A;  4WXD A;  2J5P A;  3FMS A;  4FX0 A;  2KJC A;  1ZLK A;  2H27 A;  1BI0 A;  1S7O A;  1FYK A;  1TNT A;  2FA5 A;  1F5T A;  2HDC A;  2IA2 A;  2ISY A;  4R1H A;  5JHU A;  2GA2 A;  2IW5 A;  2HOE A;  1SD6 A;  1UHM A;  2FML A;  1H9G A;  3ISP A;  1Z1D A;  2VOP A;  1LVA A;  1C0W A;  4HX4 A;  4WWC A;  3CO6 C;  4RAY A;  4I0B A;  4P55 A;  1G3W A;  1REP C;  2Q2E A;  4RGX A;  1ZRE A;  2O61 A;  1RUO A;  3GW2 A;  4D0P A;  2G7U A;  3B02 A;  1KYZ A;  4U7B A;  3J81 K;  5JI6 A;  4ZZD A;  4HBL A;  4G9Y A;  3M1E A;  3M8F A;  3TOA A;  3QU6 A;  2IJL A;  4YFK F;  4WK8 F;  5TRD A;  3RYR A;  2MLK A;  1RZ4 A;  3IWF A;  5CVI A;  2EK5 A;  1HKT A;  2YU3 A;  2ESN A;  4NQW A;  4HV5 A;  2HZT A;  2YX4 A;  1KU2 A;  3ECH A;  1V4R A;  4OIP F;  2W84 A;  3GF2 A;  1K7A A;  4U7D A;  4Q4Z F;  2AXL A;  4JK1 X;  1ZG3 A;  4HYE A;  1EH8 A;  2EV6 A;  4RGU A;  2CWE A;  5HS8 A;  2KIF A;  2COM A;  4O3M A;  5BPD A;  3T1B A;  3BP8 A;  2EB7 A;  1SD4 A;  3GZ6 A;  5E17 F;  4RAZ A;  3K1P A;  4BNC A;  4BQA A;  2P8T A;  1FY7 A;  1KA8 A;  3BPV A;  2HYG D;  1ZG1 A;  5HDN A;  1TQM A;  2EFQ A;  2Q0O A;  2X0L A;  2XRO A;  4N9H A;  2A3S A;  4ZYD A;  4PGH A;  3U9G A;  2A07 F;  3T8T A;  2TDX A;  1W4M A;  1FX7 A;  3I0T A;  2OAZ A;  3M7G A;  2FBK A;  2V6C A;  3DKW A;  2FMY A;  4FT8 A;  1TBX A;  1XDS A;  3V7S A;  1P92 A;  1AWC A;  4A6E A;  1WQ2 A;  1KGS A;  3BJA A;  3WTU C;  4CHU A;  3R61 A;  1B1B A;  3ZPL A;  5IT9 Z;  1HW2 A;  1HKS A;  4HQM A;  4YFX F;  5E1Z B;  4PGG A;  3NEU A;  5E20 A;  2WV0 A;  5E8G A;  5HS9 A;  3L9F A;  1G3T A;  1XB4 A;  1IW7 F;  4L5I A;  4TV7 A;  5FD6 A;  1CF7 A;  3WU1 B;  2HGC A;  2M87 A;  4S05 A;  5FGM A;  3E6C C;  1MGT A;  4M9X A;  4U0W A;  1J5Y A;  3VEP A;  2V79 A;  3R60 A;  1JGS A;  1FSH A;  3WGG A;  2XHK A;  2VE8 A;  2K27 A;  1ZHF A;  4AIK A;  3I54 A;  3PFI A;  4L0Z B;  3NRV A;  1FWZ A;  3V7R A;  2DLL A;  3TQN A;  4IRG A;  1W7P B;  1HSJ A;  3HUG A;  2GWR A;  3Q9S A;  3QP6 A;  4BH9 A;  3IRR A;  3GUD A;  3TDZ C;  1TW3 A;  2VBZ A;  1FPQ A;  2P5L C;  4EGY A;  1Z6R A;  4F7Z A;  3R4K A;  1ZAR A;  2F5E A;  2PG4 A;  3V4G A;  4WX9 A;  3C3W A;  5H6R A;  3KP5 A;  4AIJ A;  2RC4 A;  1OYI A;  2FF4 A;  2STT A;  1BM9 A;  3F3X A;  4IRH A;  1RNL A;  2IRF G;  1MD0 A;  1L3L A;  2FE3 A;  1R1U A;  3WE2 A;  4G6Q A;  4WF2 A;  3CUQ C;  1P6R A;  5L3C A;  5DYM A;  4P9U A;  1PP8 F;  2KIU A;  1G3S A;  2GXB A;  2FRH A;  2QYO A;  2DTR A;  3C7J A;  1K79 A;  2XRN A;  3JSO A;  4G7O F;  2L3D A;  4R8H A;  1F9N A;  3GZ5 A;  4L9V A;  5D4S A;  4Q48 A;  3IL2 A;  4EGZ A;  4OOI A;  2A6E F;  4CGZ A;  2VBX A;  4OU0 A;  5E8I A;  5HDK A;  1S29 A;  4N0B A;  3S2W A;  3WTS C;  2STW A;  3G73 A;  1U5T C;  3DP7 A;  2Y48 A;  2GZW A;  1YW7 A;  1PDN C;  4G7Z F;  3GWZ A;  2E1C A;  3BJ6 A;  1ON2 A;  3EYI A;  4G7H F;  3T5X A;  4KIF A;  1LEA A;  1WWX A;  1IZ1 A;  1LNW A;  1Q1H A;  4WCG A;  2P4W A;  3ABU A;  4EMS A;  1BIB A;  1BBY A;  3LST A;  4R79 A;  1RI7 A;  1FYM A;  2K02 A;  1MJ9 A;  2QQA A;  4U88 A;  3WTY C;  5H6Q A;  1IRG A;  1OPC A;  3Q5F A;  3CUQ B;  1XN7 A;  2P7C B;  2LNB A;  1XCB A;  4Q47 A;  1BN5 A;  2ZBK A;  3E3V A;  3QRF F;  2ZNY A;  2PBI A;  3LAP A;  3ECO A;  1K6O A;  5BOX A;  1G6N A;  4KIC A;  4KNY A;  4ESF A;  1BOA A;  1KQ9 A;  1IXC A;  2NNN A;  4LG0 A;  1Z7U A;  2ZME A;  4HZF A;  3RPU A;  1XGO A;  3F22 A;  4K2E A;  4XLP F;  2DK5 A;  2X4H A;  1SD7 A;  5ILV A;  3LFK A;  1DPR A;  3LA3 A;  1G3Y A;  2PN6 A;  1LDK B;  1YYV A;  4HLY A;  1A04 A;  2JSC A;  5E18 F;  1GHC A;  2HKO A;  1U5T B;  3L7W A;  2CW0 F;  4GYI A;  1IN6 A;  4HX8 A;  1QZZ A;  1XMA A;  2ESH A;  1XMK A;  3FX3 A;  3DV8 A;  2MH9 A;  3MZY A;  2IT0 A;  1FP1 D;  2A61 A;  4O5V A;  1YIO A;  3Q9V A;  3M8E A;  2D45 A;  4BHC A;  1QQI A;  4IF4 A;  3I59 B;  3FF5 A;  1J9I A;  3WE3 A;  2VC1 A;  2CFX A;  3DEU A;  3TO6 A;  4B8X A;  2EFW A;  3ROU A;  1ZYR F;  1G4D A;  2W85 A;  3KZY A;  3WOD F;  4KYW A;  4A0Y A;  1NHA A;  3HOS A;  4KMU X;  4A12 A;  5DCM A;  1GVJ A;  1KQ0 A;  2A5Y B;  4MQ9 F;  5BS6 A;  1LB2 A;  1ODD A;  5LGN A;  1SAX A;  3MAJ A;  1H9T A;  2RVC A;  2WTE A;  1R23 A;  2O03 A;  2VBY A;  1QNT A;  5FB2 A;  3K1M A;  3HTS B;  3MWM A;  1FLI A;  3QPT A;  2A6H F;  4Q5S F;  3GFM A;  4IVN A;  4AD9 A;  4EVI A;  2DFI A;  4ETS A;  1B6A A;  1JHF A;  3SQN A;  1ZN2 A;  3KLN A;  2ZFW A;  4G94 A;  4GCV A;  3F6V A;  1S8N A;  3FXQ A;  5EEH A;  1YW9 A;  1V3F A;  5ILS A;  5E1W A;  3JAM K;  2BGC A;  4HDV A;  3SFZ A;  2QLZ A;  4A5N A;  1ZRC A;  1KU9 A;  5CLS A;  4EJO A;  1KQ8 A;  3L09 A;  5KK1 A;  2DQR A;  2CQK A;  4EJT A;  4ZZL A;  4A0Z A;  1GXQ A;  4UV9 A;  4KIG A;  2QWW A;  3WTZ A;  5FFX A;  5LEK A;  4MTE A;  2V1D A;  5D4R A;  2UZK A;  2VT2 A;  2O8X A;  1UHW A;  2FNA A;  2EV5 A;  2VON A;  1FNN A;  1IRF A;  2V1U A;  2VN2 A;  1BI2 A;  4KMF A;  1S7A A;  1XSD A;  1YS6 A;  1B4A A;  3ZN0 A;  4E70 A;  2XKO A;  4RB3 C;  1Z9C A;  1S6L A;  2JZY A;  2VBW A;  1BC8 C;  2IP2 A;  1FT9 A;  2EFN A;  5HDG A;  4GO1 A;  3HRT A;  3I53 A;  2FBI A;  4N9I A;  5JFR A;  1FBU A;  2L4A A;  2XAS A;  5HLH A;  4ZYG A;  2RGV A;  1D8J A;  2ZO4 A;  3N97 A;  3DXJ F;  5FFZ A;  2AS5 F;  4P9F A;  2P7V B;  3H3Z A;  4UVA A;  2HKX A;  1P4W A;  5ERI A;  2RV8 A;  4LJZ F;  3WTW C;  1WSU A;  2H6B A;  3L2C A;  4P96 A;  1T98 A;  2D2W A;  3CJN A;  2P6S A;  4QWQ A;  1WKM A;  4RB2 C;  2Z99 A;  5ICF A;  4HAM A;  2XAQ A;  1ZGA A;  3JTH A;  1E2X A;  1X3U A;  4JQF A;  1GXP A;  2P6T A;  3ZP5 A;  3MZH A;  3F72 A;  2E7W A;  1I5Z A;  1O7F A;  3KEO A;  2QEN A;  1SMY F;  2B0L A;  1R00 A;  4LLL A;  5K5O A;  2OA4 A;  3F6O A;  5KVR A;  2HR3 A;  3B73 A;  4YFN F;  1MDM A;  1LQ1 A;  3HRM A;  4ENM A;  1HW1 A;  4U0Y A;  3HOT A;  4UNO A;  3HHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...