1LNWA

Crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
b'NYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance operon repressor
molecule tags Transcription repressor
source organism Pseudomonas aeruginosa
publication title Crystal structure of the MexR repressor of the mexRAB-oprM multidrug efflux operon of Pseudomonas aeruginosa.
pubmed doi rcsb
total genus 48
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lnwA01
2KIMA 2OD5A 4IHSA 2XAFA 3RTRA 3HOSA 4LLGF 2O0YA 2P8TA 2K27A 2DQLA 1UFMA 1FSHA 2PEXA 4O6JA 1U8RA 4LFUA 3U2RA 1CF7A 2CFXA 5HOOA 2HTSA 3QU3A 3LA7A 4PDKA 1LEAA 2BE5F 1AWCA 1BBYA 1F9NA 1YTYA 3JSOA 4HV6A 2RNJA 1O57A 5IT3A 3F72A 3KP7A 3JAMK 2H94A 1YYVA 1JE8A 1ZLKA 3ZMUA 1WQ2A 4GGGA 1Z6TA 3AAFA 2VT3A 1L0OC 4UVCA 2H09A 3M8EA 4N0BA 2GQQA 3IWZA 5KK1A 3R0AA 1IRGA 3TO6A 3MFKA 1YFHA 1V4RA 2VC1A 2B0LA 1IF1A 4I09A 2DI3A 3ULQB 2D1HA 4OMZA 2HOEA 5HLHA 3GO5A 3V7SA 3F8CA 1KQ9A 3WTZA 4JK1X 3Q9SA 1Z1DA 3FHZA 1KYZA 2Z33A 5IT9Z 4KDPA 1SMTA 4LG0A 1G6NA 3ERED 1U6GA 4XSZF 1B59A 3M8FA 2OBPA 1BN5A 1CF7B 2DBBA 4L5IA 2FQ3A 2EFNA 2MLKA 4IXAA 4ZYDA 3GFIA 1J59A 4Q5SF 1BJAA 4XSXF 4RAYA 2OQGA 2Z3YA 2PMUA 1T39A 5IT9K 3SHFA 4EVIA 5L3DA 1HKQA 4ESBA 3I54A 5A2QK 2G9WA 2M87A 4PGHA 2G7UA 2VODA 3I58A 1Z6RA 2VBXA 2Q8KA 1ZRFA 5H20A 1ON1A 3J80Z 1R00A 1QPMA 5LHIA 4U88A 5LRRA 3IKTA 3I71A 1MJ9A 3DQVC 1SD5A 1KU3A 3K69A 1G3WA 4I01A 2J5PA 1QGPA 2WWYA 1R22A 2QWWA 1EV7A 4PZJA 3LWFA 4CYDA 4K2EA 2P7VB 2MA3A 5CVUA 5D8LB 1G3TA 4HX4A 2GA2A 2VBZA 2EV0A 5ICEA 1R1TA 4UV9A 3G73A 3N4MA 4HX8A 4LLLA 1J7KA 2VE8A 4R8HA 1XSDA 2W25A 2VOPA 2V1DA 1FY7A 2YX7A 1OYIA 1MDMB 2QBYB 1U5TB 2Z99A 1JHHA 4I02A 4IRGA 3N97A 2D1VA 4WF2A 4HBLA 4KUMA 1XB4A 3OV8A 2X4HA 3BOQA 3V8JA 4GYIA 2XV4S 1Y0UA 4A5MA 1Z91A 2CG4A 1SD6A 2HZTA 1BOAA 3CDHA 1NHAA 1BM9A 2ZXJA 3LAJA 2KIUA 1YLFA 4MTEA 5E1WA 1D3YA 2J5OA 5HLIA 5ICFA 3KETA 1IN7A 1ZLJA 4XBFA 1D8KA 1P92A 3GX4X 2XAQA 5DYMA 4ZYGA 1HSTA 2RQPA 3F6OA 1YIOA 3I59A 3GXOA 3WTTC 5DUIA 2GIVA 2WV0A 1ZRCA 2NNNA 2K4JA 3MZHA 3KP3A 4B8XA 1SD7A 1TNSA 1FPQA 2BYVE 4ZH4F 4BHCA 2PMHA 3ZN0A 1IXCA 1LQ1A 4U7BA 1BC8C 4CDGA 1R58A 3NEUA 4HV5A 2DPDA 2ZKZA 3IHUA 1RI7A 5KVRA 4P9FA 5K1YA 3CJNA 2P5KA 4EM2A 3CO6C 1O3TA 4A0YA 4I0BA 2GWRA 3ABTA 4KN7X 4CO8A 2XAGA 2L4AA 2A69F 4AIJA 4E70A 4IF4A 5D8KB 2AS5F 3BPVA 3L09A 2HYFA 4U0WA 4HQMA 1R23A 3GFJA 1IUYA 4EMSA 4IHTA 5ED4A 3BY6A 3BP8A 1KGSA 2Y0MA 1PUEE 3K1PA 4HW0A 5L3CA 2DPUA 2MBFA 1XMAA 4QLCU 1XGOA 4OIPF 3GFMA 2KJBA 2K86A 1OR7A 1RUNA 1LNWA 5E1ZB 3SZTA 2JPCA 2FBHA 2FNAA 2O61A 2KKOA 3E6MA 1UCRA 3RYRA 3IWFA 3RI4A 3PQKA 4RB0A 1RIOH 4HAMA 2QLZA 4ESFA 2QYOA 2P6TA 1XDSA 2PJPA 1IN4A 3DV8A 3CTAA 1KQ8A 1FWZA 4XLNF 2RVCA 4BAYA 3RYPA 2STTA 1TTYA 2UZKA 3BJAA 1D8JA 1LDDA 3QAHA 4ZYEA 1PP7U 3GZ6A 2KRFA 1HKSA 3GW2A 3HRUA 4IPAA 2ADUA 2RGVA 1QNTA 4EJTA 1O3QA 3V4GA 2ZMEB 3V7RA 4XLPF 4M9XA 1QQIA 1R5HA 5E8GA 3LQRA 3L2CA 3LQQA 3TO7A 1FZPB 1KQ0A 3M7GA 4D0PA 2DTRA 2OZ6A 3RPUA 2FXAA 1VTNC 1W7PD 2ACJA 4OIOF 4YG2F 4KMUX 2P5LC 3TDZC 3H3UA 4IJAA 4KA4A 2QM3A 3E5UA 1BI3A 2IA1A 2IRFG 3R0JA 1ZRDA 4R79A 3TOBA 4GXOA 4M9SA 2K7LA 2DAOA 2A6EF 3L00A 2O6GE 4EJVA 4GCVA 3K9TA 3BJOA 3WODF 3R61A 4ENKA 1XGNA 2MH2A 5CVJA 1LEBA 2FRHA 5DD4A 3QOPA 3MCZA 3E6CC 3I59B 2FA5A 5JFRA 2KIFA 1J9IA 5HDGA 2CGPA 2A3SA 3LAPA 4HX7A 4OIQF 2QZ8A 2CWEA 1KU2A 3S2WA 2XKPA 3JW4A 2PI0A 2ZO4A 2DK8A 3MEXA 5K5RA 4RB2C 4O5VA 5D4SA 3V8KA 4OMYA 3GF2A 5ILSA 5F6FA 4U0VA 3MZYA 5LGNA 1D5VA 1HBXG 2ZCWA 2HTJA 4U0YA 2RC4A 5ICCA 2QQ9A 1QZYA 1FBUA 2L4MA 2M1BA 4LGWA 1ZH5A 1FBSA 3E6DA 3WU1B 3ROUA 3M1EA 4HF1A 3MWMA 2VONA 2ZMEA 1FBQA 3HSFA 5E17F 1DUXC 2EK5A 2CO5A 1HSJA 4I98B 1Z9CA 4MHGA 3FX3A 4RB1A 3TQNA 1KA8A 5ILUA 4I2OA 3TDUC 2YR2A 3FXUA 5DD8A 3HRMA 5BQTA 4IRIA 2CYYA 4ENJA 4A0ZA 2PQ8A 3ZPLA 2QVOA 3H92A 5A2QZ 4L5JA 2VBWA 5L3GA 2UXNA 2IA0A 1W7PB 2Z5UA 4KIGA 3ECOA 1P4AA 2ELHA 1B6AA 2QQBA 3BPXA 1GXPA 4LK1F 5J8CA 1W4MA 4KT5C 3GEZA 2OAZA 2EJRA 3LA2A 2FBKA 4Y15A 4AIKA 4AD9A 3K2ZA 3F8NA 2YX4A 4A0XA 2FF4A 4RB3C 4A12A 1DDNA 5BOXA 4M74A 3VB2A 3HHGA 3FF5A 1S6LA 3QU6A 3KP2A 1MJAA 1DPUA 1HW1A 2C6YA 3R60A 1QZZA 1K78B 1XCBA 3VOEA 1T98A 3ZP5A 1J75A 4YFNF 2XIGA 4RS8A 1QO0D 4CZZA 1FYKA 3PQJA 4DNCA 5AONA 5JHUA 5AIQA 5JVTA 3FMSA 3WTWC 3WGHA 3GYHX 3K0LA 5HS9A 4EM1A 1G3YA 2BV6A 4KNYA 4ENNA 2XGXA 2O3FA 3KP5A 5HDKA 3CUQC 3IRQA 1FYMA 1MDMA 4KIBA 2V1UA 4YFXF 4KICA 2EFQA 1WI9A 1U5TC 5L3FA 1T2KA 5CYVA 4O3MA 2F5DA 4CGZA 5H6QA 4Q47A 1OPCA 2DO7A 2NS0A 3T8RA 4HDUA 4L9VA 2VC0A 3DXJF 2PFBA 3KFWX 2V9VA 2ESHA 1ODDA 1R7JA 5DEQA 2K4BA 1ZYRF 3LSTA 1XGMA 1ULYA 3TO9A 2CSOA 2IW5A 4WK8F 1J0RA 4P96A 5D5UB 3GWZA 5HDNA 2VXZA 5LRSA 2GXGA 4AIHA 3WG9A 2BEOA 2CW0F 1R1UA 3P7NA 4L9NA 1L3LA 2H6CA 3SXYA 3F22A 1ZG5A 2R7FA 4Z2YA 3F3XA 3HRTA 5LLQA 2RV8A 5FD6A 2D2WA 1EH7A 3B02A 3HUGA 5E8IA 4HQEA 3RDIA 2NAZA 3WE3A 1K79A 4NB5A 1YO5C 1FP2A 3KEOA 3WTVC 1FP1D 3DPTA 4RGUA 1I27A 1HW5A 4FT8A 4B09A 4OINF 1LDJA 4LG0B 2M8EA 2R3SA 5D5XB 4WXDA 1O3RA 1W7PA 1XGSA 2LSOA 3WTYC 5EEGA 3FM3A 3KP6A 5CVIA 1HW2A 3F8MA 5BS6A 4YIIA 1O3SA 5CVVA 5LGUA 1I6XA 1YG2A 3BROA 4JQFA 4Y13A 4IVNA 2DQRA 2LDUA 3C7JA 1O7LA 1GVJA 2ZBKA 2NRAC 1YS7A 3DEUA 2HS5A 1K7AA 2L01A 1TLHB 4KMFA 3T1BA 4HLYA 1I5ZA 1EH6A 1LJ9A 1WSUA 3E6BA 5L3BA 3RKXA 3I64A 2LKPA 4XRFA 4G8XA 4OIRF 4HYEA 2DLLA 3L9FA 3QRFF 3GZ5A 4HDVA 1P2FA 1Z7UA 3ELKA 3DP7A 3TKYA 2OU2A 4LB6B 3QPHA 4UVBA 3FWEA 2LF7A 3H3ZA 2E1CA 1BI1A 1ZG1A 4LMYA 3VFZA 1LVAA 3HRSA 5FO5A 1ZGAA 3HIFA 2V1XA 1PP8F 2EWNA 3JAMZ 2M5WA 3R4KA 2PN6A 4RGXA 3IC7A 4PGGA 4P55A 4LLNA 3KEQA 1X3UA 4EGZA 1PDNC 1S7OA 1JHFA 3WGIA 2DT5A 5ERIA 5H6RA 3F6VA 5LBQA 4FHTA 3D0SA 3M9AA 2JZYA 5FFXA 1OYWA 2WC2A 1MJBA 1K6OA 3JSPA 1IN6A 3RKYA 2G7HA 2GXBA 4YFKF 2EA2A 1ZHFA 2IA2A 1W5SA 2EV6A 2A07F 3WE2A 1YW9A 2M45A 1R1VA 1J5YA 2MC3A 3FMRA 3K1NA 3KZYA 1WKMA 3OOPA 5K5OA 5BPDA 3ISPA 3IRRA 3GUDA 2DK5A 2JPBA 2P5VA 3EDPA 4MGRA 5FD5A 1R5GA 5DCFA 2FEZA 1Z05A 1U5TA 5E1XA 2F5CA 3EQLF 3V7CA 4WXHA 1DP7P 5DCMB 4G6QA 3ABUA 3DFGA 2MLGA 4ESJA 4MEXF 4LJZF 3HYIA 3CUQA 4A2UA 2FNPA 1IZ1A 1USSA 1IN5A 1FC3A 3ML6A 2XUBA 3DPLC 4BHBA 4KFCA 2L54A 3ZQ7A 2VOOA 1U3EM 1OMIA 3O6BB 2LF8A 1XSVA 1LB2A 1FYLA 3KE2A 4P5OA 3GVAA 1UHMA 1I1GA 2E7XA 3TGNA 4G7ZF 5DV5A 2IPQX 1TQPA 3W6JB 1E2XA 4GO1A 3U1DA 4BYYA 3E5QA 4MTDA 2L3DA 3Q9VA 2Q2EA 2FOKA 5FLXK 4H0EA 4GYGA 4EJOA 3SFZA 3DF8A 3BDDA 1XSXA 3QP5A 1P4XA 3KLNA 5AIPA 2A68F 4M6YA 4UUVA 5HVQC 5JI6A 4WX9A 2VT2A 2TDXA 4NHJA 1CGPA 4Q4ZF 1F1ZA 3HHHA 5DUKA 5FFZA 1KYWA 5FLXZ 3BZ6A 1ZREA 2EA4A 3WTXC 2PLYA 1SFXA 4G7HF 4ENMA 3P9IA 4HZFA 2Y75A 1TW3A 4EGYA 3RKWA 5L3EA 2W85A 5J8FA 3JTHA 4WCGA 1UHWA 4OOIA 4BQAA 3ZMSA 2K02A 4M9ZA 3D5LA 4M73A 1YW8A 4BXUA 2V6CA 1H9TA 3ZN1A 1I1SA 2L02A 2LNBA 4G94A 5D5WB 2Y48A 2YU3A 2HGCA 1IAWA 3G3ZA 5CJ9A 2QUFA 4G6DA 1BI0A 4CICA 4AWXB 1K78A 1H0MA 1HXDA 2HQNA 2H6BA 3BWGA 4OU0A 2XKOA 4L0ZB 2A5YB 2P4WA 3PFIA 3SZPA 2HFHA 4CXFA 4EM0B 6PAXA 4HA8A 5D6EA 3I4PA 4N9HA 3P9KA 1B9NA 4UV8A 4MEYF 1IXSB 4NQWA 3HSRA 3NRVA 5F1RA 4FX4A 3O3KA 5TJJA 2M30A 2ZNYA 2HKXA 4BH9A 2EFOA 2JTVA 3Q5FA 1HKTA 2FBIA 1UB9A 3QPTA 1TW2A 1FNNA 5EEHA 1EH8A 1Q1HA 4KYWA 2V79A 4PCQA 1U78A 1XN7A 4MQVA 3F8FA 2DU9A 2H27A 4I7HA 4ZYHA 2XRNA 2XAHA 5CLSA 5DDGA 3J81Z 3WGGA 2HDCA 5LEKA 2W84A 3ZMTA 4M6XA 4ZZDA 3FZVA 5E20A 1BI2A 1XCVA 1MD0A 4S04A 4EJUA 5LHHA 1S8NA 1G4DA 3RJPA 2EFWA 4EV0A 2HR3A 1SD4A 1YS6A 2A61A 3F21A 4MNUA 2RDPA 2JRTA 3CUOA 2UWMA 3GLXA 2GAUA 2F5EA 1P6RA 3CO7C 4ON0A 1F5TA 3FXQA 5JR3A 2DFIA 1RUOA 3KP4A 3MQ0A 2XROA 5ILVA 3LFKA 2RKHA 4F7ZA 4G9YA 3CUQB 1B9MA 3RIRA 1S3JA 1FX7A 3KLOA 4S05A 4CHUA 2RN7A 4QWQA 4EQQA 3J7AO 3ECHA 2COMA 2E7WA 2BBYA 3T8TA 2XASA 1E17A 3U9GA 5LGTA 1KU9A 2YPRA 2VE9A 1SMYF 2P6SA 1O7FA 3GFLA 2ETHA 3L7WA 1FSEA 3K1MA 1BC7C 1FOKA 3I5UA 1R36A 4LD5A 4N9IA 1F4KA 1P4WA 4G7OF 5ICGA 2FSWA 1IW7F 2XAJA 4A5NA 2OZUA 1RNLA 1USTA 2CQKA 3EUHA 1ZN2A 2ISZA 3HOTA 2R7DA 3C18A 1MKMA 3COAC 2KJCA 1QBJA 3W6KB 2F2EA 3HSEA 2EFPA 1T0FA 1XD7A 1OKRA 2XHKA 1TQMA 3ZMDA 4M71A 4L0YB 4TV7A 4YIFA 4WWCA 1W5TA 5HLGA 1FT9A 3FM5A 2STWA 2HQRA 3VODA 2EB7A 3KZZA 4EJWA 3F8BA 1ZGJA 4U7DA 2JSCA 4KN4X 2E1NA 2MD5A 1KU7A 2EV5A 3WTUC 4L18B 3SQNA 2O03A 1C0WA 4DQ2A 1STZA 4JBAA 4L9JA 1AOYA 4RGRA 1HQCA 3FXRA 3ZMVA 1ONVA 2FE3A 1ZG3A 2ISYA 2D45A 4WXCA 4M72A 1S7AA 2AXLA 5F64A 2HKOA 2PG4A 2WTEA 1WWXA 3T0YA 1MGTA 4A6DA 2X0LA 3O2PE 1YW7A 2Z9OA 5LEJA 1XMKA 1OYYA 5BPIA 1B1BA 1TNTA 4UHTA 2IJLA 4UNOA 3REOA 5E18F 4IRHA 1IXRC 1RZ4A 3CLOA 2GZWA 1GXQA 2DW4A 5D4RA 2FU4A 2NNYA 4I0AA 4FX0A 3HTUA 4Y17A 2Q0OA 3QP6A 3BJ6A 3R6SA 4L9TA 2P7CB 2IT0A 1BIAA 4RAZA 1TBXA 3V8LA 3J80K 1SFUA 4R1HA 2GA1A 3WTSC 2HYGD 3HTSB 3LA3A 5D6FA 1BIBA 4HLXA 5HS8A 2QQAA 3F23A 3EYYA 4LK0F 1H9GA 1REPC 2OA4A 1G3SA 2ZJ2A 4HF2A 4UVAA 3I53A 1TQIA 2HWVA 4UXNA 2UXXA 3RPQA 3TOAA 1ZAOA 1WRJA 2W24A 2ZNZA 5DCMA 3DKWA 3E5XA 1ZARA 3ZMZA 1T6SA 3E3VA 1GHCA 3C3WA 3C1DA 5FB2A 4Q48A 4ASNA 2W57A 4BNCA 2XVCA 1V3FA 3IKVA 1JGSA 3B73A 1JXSA 3WU0A 4KIFA 3FMQA 3J81K 5TRDA 2QENA 4HF0A 4RGSA 5HS7A 2IVMA 1LDKB 2ESNA 3EYIA 1S29A 5FGMA 2FMLA 2O8XA 4A6EA 2BGCA 2HEOA 3KCCA 2QBYA 1T38A 3VEPA 3P9CA 1SAXA 2FMYA 1ON2A 2IP2A 2PBIA 2VBYA 4AVPA 3JTGA 5BMZA 3T5XA 2F5FA 4BHPA 5J6XA 4ETSA 5D5VB 1SFEA 1IN8A 4P9UA 4ZZLA 1A04A 4MQ9F 4HOBA 2VN2A 3I0TA 1IRFA 3NQOA 3IL2A 1J2XA 1YQAA 5CVRA 1XDUA 2JT1A 5LHGA 2YSRA 3EETA 1DPRA 4LB5A 2A6HF 2ZFWA 1B4AA 1FLIA 1MZBA 2OQRA 5K5QA 2MH9A 3MAJA 3E97A 2NYXA 1U2WA
chains in the Genus database with same CATH superfamily
1I3QJ 1OLTA 2M4KA 3Q0VA 3DCFA 4IEJA 2KIMA 2OD5A 3WU2C 3BR3A 2CW8A 4IHSA 3IAM2 2X6WA 3AL0B 2XAFA 2F6CA 5F27A 3RTRA 3HGYA 4UUTA 2CU7A 5FLMJ 3HOSA 4LLGF 2O0YA 2P8TA 1UJ8A 3K4KA 3JRBA 3OR2C 2K27A 1X3ZB 2DQLA 2DOAA 3H5RA 1UFMA 4BQNA 1B8IB 4AIDA 1FSHA 1QZEA 2PEXA 1G2HA 1W1WE 3WHBA 2CUEA 3QPLA 3OYFA 4BU2A 4BXFA 2JMWA 2KIQA 2UV1A 2L7MP 4O6JA 1NTCA 4LFUA 1U8RA 3U2RA 1CF7A 2CFXA 2XRLA 5HOOA 1SFOJ 2HTSA 3QU3A 3A01A 3CMAI 2ECCA 3LA7A 4PDKA 1LEAA 2BE5F 5IP6A 1LE8B 2ME6A 1AWCA 1BBYA 1F9NA 1YTYA 2LFBA 1EA3A 4HV6A 3JSOA 2RNJA 1O57A 5IT3A 3F72A 3KP7A 3JAMK 5EF6A 2H94A 1YYVA 2XF6A 1JE8A 2NVXJ 1ZLKA 3JCUC 2IGMA 1TT0A 3ZMUA 1WQ2A 2H1KA 4GGGA 1Z6TA 2CFOA 3AAFA 4JYKA 2VT3A 4Y4RA 1MMNA 4M3FA 1L0OC 4UVCA 3H0GJ 2H09A 3M8EA 4N0BA 2GQQA 3IWZA 5KK1A 4BXXJ 3ZQGA 1N75A 3GCMA 3S17J 1X2NA 3R0AA 3K6GA 3H35A 1IRGA 1TZLA 3TO6A 3MFKA 1YFHA 1V4RA 2VC1A 1SEUA 2B0LA 1IF1A 5BNGA 4FTHA 1WHUA 2LY9A 4I09A 4PJMA 4E6KG 2DI3A 3ULQB 2R7WA 4IHXA 2DT6A 2D1HA 3D5RC 4Y52J 3S16J 4OMZA 4C3HJ 2HOEA 5HLHA 3GO5A 3V7SA 3F8CA 1KQ9A 4BUPA 3WTZA 4JK1X 1R6RA 3Q9SA 1Z1DA 4ZDLA 3FHZA 1KYZA 3IV5A 2Z33A 5IT9Z 2X9DA 1SMTA 4KDPA 4LG0A 1G6NA 3ERED 1D0ZA 2IAIA 1U6GA 4XSZF 4A3IJ 1B59A 2DA1A 3M8FA 3KPHA 2OBPA 2W4SA 1BN5A 1AU7A 1CF7B 2E71A 2DBBA 2M4GA 4L5IA 2FQ3A 1KONA 2EFNA 2MLKA 4IXAA 5IP9J 4ZYDA 3GFIA 1J59A 1YI2I 4Q5SF 3CCRI 3AFHA 1BJAA 4XSXF 2JWTA 3A03A 4RAYA 2OQGA 3G4SI 1FMVA 2Z3YA 3FK6A 3HKZA 3MD2A 2PMUA 1T39A 2QF7A 5IT9K 4B44A 1JKPC 4M3EA 3SHFA 2KHMA 2XSJC 1LFBA 1GUUA 4EVIA 5L3DA 4UB8C 1HKQA 2JRMA 4ESBA 4IHWA 1HC8A 1S72I 3FBNB 2DDBA 2EZLA 3I54A 5A2QK 3FBIB 1K4SA 2G9WA 2M87A 2AO9A 4PGHA 2E5ZA 2G7UA 4XICA 2VODA 1WFXA 3I58A 1Z6RA 2CV1A 3ZOBA 2VBXA 2EZHA 2LBFB 2Q8KA 1ZRFA 3PO2J 3V42A 1TT5B 2JN6A 2E19A 5H20A 1ON1A 5K7FA 3J80Z 1R00A 1QPMA 5LHIA 4U88A 2L2OA 5LRRA 3ASOH 4B48A 1I50J 3IKTA 3S3NA 3I71A 3LSJA 1A6IA 1MJ9A 5GAGJ 3DQVC 2W82A 3HDDA 2EINH 3H1CA 1E3PA 1SD5A 1KU3A 4II2A 3K69A 5HNFA 4XN0A 1G3WA 4I01A 2J5PA 1QGPA 1R22A 2WWYA 2HZDA 5B66C 3AL0C 2QWWA 4PJJA 1EV7A 4XRSG 1VQNI 4PZJA 3LWFA 4C9YA 4CYDA 3P5JA 4XK4A 4PJ0C 4K2EA 2P7VB 2VI6A 2MA3A 2PMZA 2ELJA 5CVUA 5D8LB 5IP7J 1G3TA 4HX4A 4AM3A 1OCPA 3CMMA 2GA2A 2VBZA 2EV0A 4IQJA 5FKKA 1LVKA 3MKYB 3OYLA 5ICEA 1R1TA 3L2WA 4XKWA 1XTAA 4UV9A 5K7ZA 3G73A 2L9SA 4A3JJ 3JREA 3N4MA 4HX8A 4LLLA 3BZKA 1TWCJ 2ME0A 4RLFA 1J7KA 5CKTA 2VE8A 4R8HA 2VJ4A 2DYRH 2X1EA 1XSDA 3DBRB 5F04A 2W25A 2DA6A 2WAFA 2XGCA 3L2UA 2VOPA 2ZFUA 1S9HA 2V1DA 2E2JJ 3N05A 1FY7A 2M0CA 5FKOA 5J1UA 3BG5A 2YX7A 1OYIA 1MDMB 2QBYB 1U5TB 3HOZJ 2Z99A 1JHHA 1Z7LA 4I02A 3PNYA 4IRGA 2I8DA 3N97A 2D1VA 4WF2A 3W2WA 3M3YJ 4HBLA 3RKQA 3JRAA 4KUMA 1K61A 1Y8QB 1XB4A 3OV8A 2X4HA 3BOQA 3I56I 1VNDA 2Z2SB 3V8JA 4A3DJ 4GYIA 4F93B 2L7FP 2XV4S 1XPXA 4PFOA 1Y0UA 4IL6C 4A5MA 1ACIA 1Z91A 2TRTA 2K5CA 2CG4A 3OYCA 2VKHA 3VWBA 1SD6A 1T95A 2IGOA 3D5SC 2HZTA 1BOAA 3CDHA 2ZJRF 1VI0A 3RSNA 1NHAA 1BM9A 2ZXJA 5IYBJ 2X51A 4Z6YA 3LAJA 3OR1C 2AQEA 2KIUA 1RPWA 4MFEA 1YLFA 3G1LA 4MTEA 2VKDA 2VJIA 3Q0WA 2VIXA 2DA5A 5E1WA 4ZYAA 1D3YA 2J5OA 3BC8A 5HLIA 1HDDC 5ICFA 3KETA 5CQGA 3SEZA 3S1MJ 1IN7A 2BW3A 1ZLJA 4XBFA 3ZGKA 1D8KA 2EH3A 2R4GA 2EPFA 1P92A 3GX4X 1U9NA 2XAQA 1XX5A 1MNDA 5DYMA 4ZYGA 2ICWG 1VQ8I 3OIQA 1HSTA 3CC4I 1X3WB 4BL0B 1VFCA 3GTQJ 2RQPA 1YHQI 3F6OA 1YIOA 3I59A 3GXOA 3WTTC 3LFUA 1UELB 3DEWA 3LSPA 2DXIA 2R7SA 5DUIA 4MFDA 2GIVA 2F48A 2GBYA 1IO2A 4ZJZA 4F91B 4XKCA 4J00A 2WV0A 2OCCH 1ZRCA 2NNNA 1Y8RB 1YRNB 2K4JA 1QPIA 2CV0A 3MZHA 3KP3A 2XB5A 4B8XA 1SD7A 1TNSA 4PSWA 1FPQA 2BYVE 4ZH4F 1Y1VJ 2K9SA 4HSTA 4BHCA 2PMHA 2R7QA 3ZN0A 5CQEA 3DU5A 1IXCA 2DTZA 2LKXA 4U7BA 4ZTFA 1LQ1A 1BC8C 4CDGA 3BR5A 4NC7A 1R58A 2CQQA 3NEUA 5H2FC 1X1PA 1H8AC 1GT0C 4HV5A 2DPDA 2ZKZA 5J47A 3S3OA 3IHUA 1RI7A 5EZHA 2VQGA 3S1NJ 5KVRA 4P9FA 4BJ6C 5K1YA 5FRMA 3OYDA 4XRMA 1YE9A 1JT0A 3CJNA 2P5KA 3H5AA 4EM2A 3FHNA 3CO6C 1R5ID 1O3TA 4A0YA 3TL4X 4JP0A 3S32A 4I0BA 2L5QA 2GWRA 2ZXHA 3ABTA 4IQ4A 1MBKA 2NXNB 5IPAA 1X1BA 4MIMA 3O8GA 3CF2A 3ASNH 4KN7X 4XKBA 4CO8A 3OSFA 2XAGA 2L4AA 2BY2A 3PNVA 2A69F 4AIJA 4E70A 4IF4A 1I3AA 3VYRB 5D8KB 2AS5F 2DYSH 3OYIA 3BPVA 3L09A 3G71I 2HYFA 5KAIC 4U0WA 4Y3OA 4HQMA 4CCLA 4CA0A 1R23A 3GFJA 3HOWJ 1XMXA 1IG7A 3K4LA 1IUYA 4EMSA 4IHTA 5ED4A 3BY6A 4M3GA 4BE1A 3BP8A 1KGSA 4PUSA 2Y0MA 3BQZA 1PUEE 4D5CA 1N78A 2ZC2A 3IAS2 1W5CC 3KZIC 3WHCA 3K1PA 4HW0A 5L3CA 2DPUA 2MBFA 1XMAA 1GVDA 2CRGA 4QLCU 1UAAA 1QHHD 1XGOA 4OIPF 3OMYA 4IHVA 4E7ZA 2QSHX 1X4PA 4PSXA 3G2BA 2VKVA 2LREA 3H3VK 3GFMA 1B72B 2W00A 2KJBA 2K86A 1OR7A 2ID3A 1WVRA 1RUNA 1LNWA 4ZTJA 5E1ZB 3SZTA 2JPCA 2EQRA 3HXLA 3DLAA 5M5XJ 2FBHA 2FNAA 2O61A 2HYJA 2KKOA 2XGEA 3E6MA 2V7FA 1TWFJ 1UCRA 4DW6A 1SVMA 3AG4H 3IWFA 3RYRA 4CCOA 1YJ9I 5J1YA 1D1BA 3RI4A 5B1BH 2VPRA 3PQKA 4DZJA 4RB0A 1RIOH 4HAMA 2QLZA 4ESFA 2QYOA 2P6TA 1N77A 1XDSA 3QODA 4HNUA 2PJPA 2OUMA 2WAEA 3HOXJ 1IN4A 3DV8A 4D9JA 2QSGX 3J7AY 3CTAA 1SC7A 4DBRA 1KQ8A 1FWZA 4XLNF 1K6YA 2RVCA 4OAZA 4B3XA 4BAYA 1B72A 1P7JA 2F4IA 3RYPA 1TTYA 2STTA 5DTDA 2UZKA 1SAUA 2V4JC 3BJAA 4FETA 4BGDA 2HNHA 2QEXI 4GRIA 3ERMA 1D8JA 2E5NA 1LDDA 3QAHA 4ZYEA 1PP7U 1WJCA 3GZ6A 2I10A 2Y69H 2K9LA 2KRFA 1HKSA 2XF5A 3GW2A 2VL8A 3K4JA 3HRUA 4IPAA 2ADUA 2RGVA 1QNTA 4EJTA 1MBGA 1O3QA 1HF0A 2JSPA 2ZMEB 3V4GA 2NVQJ 3ZR8X 3V7RA 1D1AA 3E0JB 4XLPF 3K4CA 5HLTA 3BTIA 4M9XA 1QQIA 1R5HA 5DS9A 1JJ6C 5E8GA 2KFDA 3LQRA 3L2CA 3LQQA 3TO7A 3S93A 1FZPB 1KQ0A 3FXLA 3M7GA 4D0PA 2DTRA 2OZ6A 3RPUA 4E7HA 2FXAA 1VTNC 3KYCB 1I6HJ 1T8IA 1W7PD 4A3MJ 2ACJA 4OIOF 2LR8A 3ZQFA 4H4KC 4BBRJ 4YG2F 4KMUX 2P5LC 4AC0A 3FKJA 3TDZC 5J1RA 2EIMH 3H3UA 2CJJA 4ANJA 4IJAA 4KA4A 2QM3A 1YX5A 2ID6A 2O7OA 1BI3A 3E5UA 4A3EJ 3OYEA 3MN2A 2IA1A 5EEAA 2BZTA 2IRFG 3BT9A 4NQWB 2WADA 3R0JA 1ZRDA 3RZOJ 3M1CA 1PVEA 3FXJA 1ETWA 1WGXA 3TOBA 4R79A 4GXOA 4M9SA 3CDLA 2HVSA 2WY8Q 2HVQA 3HPGA 2K7LA 4CH7A 2DAOA 2A6EF 3L00A 2O6GE 1TC3C 4EJVA 4GCVA 5IOZA 3K9TA 2UUZA 3BJOA 3WODF 2RQQA 3R61A 4N4OB 4ENKA 3C2GA 3GBGA 3AG1H 1XGNA 2MH2A 5CVJA 2LKSA 1G8XA 1LEBA 1WJBA 2FRHA 5DD4A 1WJFA 3M07A 5KHDA 3QOPA 3MCZA 3E6CC 3OIOA 1BR4A 3I59B 3VYTB 2FA5A 3L1PA 2E34A 4PK4A 5JFRA 2KIFA 3CQZJ 1J9IA 2KL4A 5TGTA 1FOWA 5HDGA 2CGPA 2A3SA 1BA5A 3QPSA 3LAPA 1IV6A 4HX7A 4OIQF 2QZ8A 3I4MJ 3S2HJ 2CWEA 1KU2A 4FCYA 1D5YA 3S2WA 4UUSB 2XKPA 3JW4A 2PI0A 2ZO4A 2DK8A 2OJED 3MEXA 2XPVA 4YELA 5K5RA 4RB2C 1S7EA 2CUZA 2KRCA 4O5VA 5D4SA 3PUFA 3V8KA 3JR9A 4OMYA 3GF2A 5ILSA 5F6FA 2CV2A 3LOCA 4U0VA 3MZYA 5LGNA 1D5VA 2M2EA 3SFIA 1HBXG 4C2TA 4C3IJ 2IGKA 4XONA 2B9SA 5C44J 1YJNI 1QVUA 2ZCWA 2DJIA 1VQKI 2HTJA 2E1OA 3ABKH 4NBQA 4U0YA 2RC4A 5ICCA 3TW7A 2NOGA 2QQ9A 2E2HJ 2WAQN 1QZYA 1FBUA 2L4MA 4XQFA 3G6EI 2BY3A 2YUSA 1BJZA 2M1BA 4I99C 4LGWA 1ZH5A 1X2MA 1FBSA 3E6DA 3WU1B 3ROUA 4D7MA 3M1EA 4HF1A 3MWMA 2VONA 2ZMEA 1FBQA 3HSFA 2XGDA 5E17F 1DUXC 2EK5A 4AYBA 5J4VA 2CO5A 4D7NA 3OYBA 1HSJA 4I98B 2VLAA 1UMQA 4IOCF 2R7XA 1WH7A 3ABMH 1Z9CA 1S5LC 1D0YA 4MHGA 2LG4A 3FX3A 4RB1A 3OL3A 3TQNA 3CCLI 2R7TA 1KA8A 5ILUA 3A0BC 4I2OA 3A2KA 3FXKA 3TDUC 2YR2A 1FIAA 3FXUA 5FKNA 1ZELA 5DD8A 3HRMA 4IO9F 3SYTA 2GOMA 4BS9A 3ZQQA 5BQTA 3OYMA 4IRIA 1FIPA 2CQXA 4XIDA 2CYYA 1A5JA 4ENJA 4A0ZA 2PQ8A 3CDIA 4X1EA 3ZPLA 2QVOA 4B47A 3H92A 5A2QZ 3OS1A 4L5JA 2VBWA 3KIOA 5L3GA 3OS2A 2UXNA 2IA0A 4C30A 3TMOA 2VPLA 1W7PB 2Z5UA 4I76A 4KIGA 3ECOA 3HKZN 1A36A 2PMZN 1H88C 1P4AA 2ELHA 2K40A 2V1NA 1B6AA 3BTLA 2QQBA 3BPXA 2TCTA 1GXPA 4LK1F 5J8CA 3LSIA 1W4MA 2ZXIA 3GEZA 2OAZA 4KT5C 3SZGA 3CCMI 3S3MA 1WJEA 2EJRA 3LA2A 3MMYB 2FBKA 3JRCA 1ETOA 4Y15A 3HG9A 4F3QA 5GTHC 4CYCA 2OV7A 3BG9A 4AIKA 4AD9A 5GPAA 3K2ZA 3F8NA 1T56A 2YX4A 1MNMC 2KLOA 1HLVA 2K9MA 4A0XA 2FF4A 4RB3C 4A12A 2Y0SN 1DDNA 4B1RA 4F92B 5BOXA 4M74A 2DFEA 3VB2A 2HPIA 4ABZA 1X1AA 3HHGA 2LP0A 3KYLA 1BL0A 3FF5A 1S6LA 4DOZA 3QU6A 2PJRB 4C2MJ 2ZJQF 3KP2A 5F0HA 1JTXA 3EUKL 1MJAA 3A0HC 1DPUA 1HW1A 2C6YA 1F43A 3R60A 1QZZA 1K78B 1XCBA 2YS9A 3HGGA 3VOEA 1T98A 4V2GA 3BG3A 3ZP5A 1J75A 4YFNF 2K9QA 2XIGA 4RS8A 3OSGA 1QO0D 4CZZA 3JRGA 2LD5A 4CCMA 1FYKA 3PQJA 4DNCA 5AONA 5JHUA 1EKEA 3CP8A 5AIQA 5JVTA 3FMSA 1LUJB 3H0DA 2BXZA 3WTWC 3WGHA 3GYHX 1VQ7I 2VQLA 1TWHJ 3K0LA 5HS9A 4A69C 4EM1A 5KAFC 2IS6A 1G3YA 2BV6A 4KNYA 4ENNA 2XGXA 2O3FA 3QQAA 2H1LA 3KP5A 5HDKA 5J4YA 1ORKA 1VQOI 3CF5F 1MBEA 3FKIJ 1UG2A 1H89C 3B6AA 3CUQC 3IRQA 1FYMA 2D5VA 2R7RA 1JJ8C 1MDMA 4J01A 4KIBA 2V1UA 1VQ5I 2FX0A 4IKFA 4YFXF 5M3FJ 4XOPA 4KICA 2B7EA 4W97A 2EFQA 1WI9A 5IOYA 4MO7A 3HBLA 4FQGA 3MKZA 3K10A 1U5TC 3H5NA 4NC8A 5L3FA 3J7YJ 2LOOA 1T2KA 1JTYA 1BR2A 1DQUA 3A1YA 5CYVA 4O3MA 2F5DA 3IH4A 1VQ4I 4CGZA 1LPQA 5EZGA 5H6QA 4Q47A 1OPCA 2DO7A 5EYRA 3TBIA 3GTGJ 2XAUA 3F9KA 4XLAA 2NS0A 1X1DA 4BACA 3F0CA 3T8RA 5FROA 4HDUA 3DEEA 2NS8A 4L9VA 2M0MA 3W2VA 2VC0A 2X6XA 2IS2A 3DXJF 2PFBA 3KFWX 1VQLI 1WJDA 5EGOB 2V9VA 2ESHA 1ODDA 1R7JA 5DEQA 2K4BA 1ZYRF 4NUBA 3DU6A 3LSTA 1XGMA 4M3DA 1DP3A 1ULYA 2V9PA 3TO9A 1EJ9A 2CSOA 2IW5A 2AXTC 4WK8F 1J0RA 1I39A 4P96A 2VUMJ 3GWZA 5D5UB 2DJNA 2VXZA 5HDNA 3U1KA 5LRSA 3TEDA 3CCUI 2GXGA 4AIHA 3WG9A 3K2AA 2BEOA 1JUSA 2CW0F 2X1DA 1R1UA 3P7NA 1MBHA 4L9NA 1VQPI 2KDZA 1L3LA 1Y56A 1D0XA 2H6CA 2CS3A 3K4BA 3SXYA 3F22A 1ZG5A 2E35A 2R7FA 4Z2YA 1BW6A 3OOUA 3F3XA 3BTJA 4LG3A 4E7JA 3HRTA 2ZSHB 5JVGF 5LLQA 2RV8A 2R5YB 5FD6A 2D2WA 1EH7A 3B02A 3HUGA 5E8IA 3DKXA 4HQEA 1Y1WJ 2VB6A 4XOTA 3OWTA 3RDIA 2NAZA 3WE3A 1WCMJ 4OWRB 4LIVA 3QYEA 4EATA 1JKQC 1K79A 4NB5A 1YO5C 2BHZA 1FP2A 3M8JA 3KEOA 3HL2A 4KISA 3H9QA 1FP1D 2I5UA 4FE7A 5LFAA 3WTVC 3DPTA 4RGUA 2OF7A 2M8GX 1I27A 1HW5A 4FT8A 4B09A 4OINF 3BZCA 1LDJA 4LG0B 3BCAA 5TISC 2M8EA 2R3SA 5D5XB 4WXDA 3EUAA 2XF7A 1W7PA 4E7LA 1O3RA 1XGSA 5DM7F 2LBFA 2LSOA 3WTYC 5LD2C 5EEGA 3FM3A 1UG0A 4M6VA 3KP6A 1QA6A 2HDDA 5CVIA 5M3MJ 2MGQA 1HW2A 4B43A 3GTKJ 3HZJA 3BLYA 3F8MA 1W36C 5BS6A 4YIIA 1YITI 3KX2A 3IH3A 5GADJ 5C3EJ 1QHGA 2DA3A 2Y9YA 2F5VA 1O3SA 5CVVA 5LGUA 1I6XA 1YG2A 1R71A 3BROA 4JQFA 4HG2A 2LY2A 4CUGA 4Y13A 4IVNA 1RESA 2DQRA 1IDYA 2LDUA 3C7JA 3OY9A 4LITA 3U21A 1O7LA 2QQ8A 3GTLJ 5E3OA 1GVJA 2ZBKA 1W0TA 1BR1A 1YS7A 2NRAC 2E1MB 3BR6A 1U9OA 3DEUA 2HS5A 2XPUA 4C2UA 1WJ5A 1K7AA 2OTLI 1MMAA 2XB0X 2N8GA 2L01A 4BQQA 1TLHB 4KMFA 3T1BA 2YU9J 2M7BA 3RQ4A 1RR7A 3VSLA 1U8BA 4HLYA 1I5ZA 3HM5A 1EH6A 1WH5A 2K85A 1R49A 4F55A 4XLFA 1LJ9A 3KYDB 3I4NJ 2VXDA 2KP6A 2L7ZA 2MW8A 1WSUA 4RAGA 3E6BA 2HPMA 1MMSA 5L3BA 3RKXA 3I64A 2LKPA 4XRFA 4G8XA 4OIRF 1FMWA 4HYEA 2DLLA 3L9FA 2L9VA 3GZ5A 3QRFF 4HDVA 2DOFA 1FOYA 2JA5J 1P2FA 1Z7UA 3ELKA 1UZCA 3DP7A 3TKYA 2OU2A 2DA7A 4LB6B 3QPHA 2K3PA 4UVBA 3FWEA 3G1MA 4LOCA 2LF7A 3H3ZA 2E1CA 1BI1A 1ZG1A 2X85A 4LMYA 3VFZA 1LVAA 2Y31A 1NK3P 3HRSA 5FO5A 1ZGAA 3HIFA 4KT6A 2Q2EB 4E7SA 3ZQLA 1MH3A 3E7LA 2V1XA 1PP8F 2EWNA 2E2IJ 3OS0A 3JAMZ 2M5WA 3R4KA 2PN6A 2GLOA 1JUPA 3GZNB 4RGXA 3IC7A 4PGGA 4XR6A 4BEHA 4P55A 3PFYA 4LLNA 2V6EA 3KEQA 4L5EA 1X3UA 3A02A 1T08B 4EGZA 1S7OA 1PDNC 1JHFA 3WGIA 1K83J 4X6AJ 1NG7A 2V26A 2DT5A 4RAFA 2LVSA 5ERIA 5H6RA 3F6VA 5LBQA 2MSYA 4M3BA 4FHTA 1PUFA 3D0SA 3M9AA 4QPQA 2JZYA 5K7HA 5FFXA 2HXOA 3G1OA 1OYWA 2WC2A 1MJBA 1K6OA 3HJEA 3JSPA 1IN6A 5J3LA 2NVUB 3RKYA 2G7HA 2GXBA 2E60A 4YFKF 4CCKA 1XS9A 2EA2A 3TW6A 1ZHFA 5CPRB 2IA2A 3DBLB 4E7KA 1W5SA 1ZTRA 2EV6A 2RNGA 3TP0A 2A07F 1V55H 3WE2A 1YW9A 2M45A 1HCRA 2DMUA 3BG7A 1R1VA 2W7NA 1J5YA 2MC3A 3FMRA 3K1NA 3KZYA 1WKMA 3OOPA 5K5OA 1FTTA 5BPDA 3B6CA 3ISPA 3IRRA 3GUDA 2NVYJ 3S14J 3CCEI 4YRVA 2BVMA 4JX5A 2DK5A 2NS7A 2JPBA 2P5VA 3RQIA 3EDPA 4MGRA 5FD5A 1OCCH 5FRNA 4Y33A 1R5GA 1DU0A 1HOMA 1QVTA 5DCFA 2FEZA 2DA4A 3H36A 1Z05A 1U5TA 3PJRA 5E1XA 4XRSA 3ESWB 2F5CA 3EQLF 3V7CA 4DBQA 3VSKA 4WXHA 3L2VA 1DP7P 5DCMB 4G6QA 2QGUA 4HNTA 2JA6J 3ABUA 1YIJI 3DFGA 2MLGA 4ESJA 4MEXF 1WZ2A 4LJZF 3SJMA 3HYIA 5EDNA 3CUQA 1OCRH 4A2UA 3S1RJ 1TL8A 2NVTJ 1MMGA 2FNPA 3GTJJ 1ETQA 1IZ1A 1RKTA 1IN5A 1FC3A 1USSA 3ML6A 3CCVI 2XC7A 3CCJI 4W1UA 5C4JJ 2XUBA 3DPLC 4BHBA 1XC5A 1Y6IA 2R5ZA 4KFCA 4GFBA 2L54A 3ZQ7A 4FISA 2GM4A 2F4MB 3E1SA 3NWSA 9ANTA 3LMMA 2VOOA 2HDWA 1CQTA 1Q1VA 1U3EM 1OMIA 2CMPA 3O6BB 2LF8A 2DMNA 1XSVA 1V54H 3UR3C 4ZDOA 2Y30A 3Q0UA 5HNHA 1LB2A 3K7AJ 2H8WA 2BOLA 2O8KA 1FYLA 3ZXSA 3KE2A 4CCNA 4P5OA 3CLQA 3VPRA 3GVAA 1UHMA 1I1GA 5M5YJ 2E7XA 3TGNA 4G7ZF 2RAEA 1LFUP 4CYCB 4BKXA 2W1OA 5DV5A 2IPQX 1TQPA 3W6JB 1E2XA 3LNQA 5B5EC 4E7IA 1Z21A 4UUSA 4GO1A 2M7AA 4BE2A 3U1DA 4BYYA 3E5QA 1HDPA 1RETA 3K4MA 4MTDA 2L3DA 4QSHA 3Q9VA 2Q2EA 2FOKA 5FLXK 1HA8A 1Y39A 2VJ5A 4H0EA 1QU3A 4CZCA 4GYGA 5FJ8J 3C2BA 4EJOA 3SFZA 2DMQA 3DF8A 3BTCA 1MW7A 1XSXA 3BDDA 3QP5A 1D1CA 1P4XA 3KLNA 4RMNA 4QTRA 5AIPA 2A68F 1LFPA 1M1EB 4XLCA 4M6YA 4UUVA 2R7ZJ 5HVQC 5JI6A 4WX9A 2DA2A 2M3AA 2VT2A 2R5ZB 3OYHA 4PJLA 1GDTA 2TDXA 1ZK8A 1MNEA 4BDZA 2IS4A 4HSRA 4BY7J 1YJWI 4NHJA 1CGPA 4Q4ZF 1F1ZA 3HHHA 5DUKA 5FFZA 1KYWA 5FLXZ 5FKLA 3BZ6A 3X2QH 1ZREA 1Z67A 3OYKA 2EA4A 3WTXC 2PLYA 4XLHA 4I6ZA 3BR0A 1SFXA 4G7HF 4ENMA 3SDGA 1OCTC 3P9IA 4HZFA 2WA0A 2Y75A 4LIUA 5F1JA 4HEA2 4S0HB 4B4CA 1MBFA 2OCEA 5JLXA 4KJZA 1MSEC 2X6YA 3ONQA 1TW3A 5J40A 4EGYA 3RKWA 1PUFB 2XPWA 2IS1A 5L3EA 2IBDA 2W85A 2Y9ZA 1R4NB 5J8FA 3JTHA 4WCGA 1ZQ3P 1UHWA 1PYVA 1X58A 4OOIA 4BQAA 4DGWB 3ZMSA 4BY1J 2IEKA 2E1MC 3EUHC 3VYUB 2K02A 1TWGJ 4M9ZA 3D5LA 2KMUA 2AHQA 4M73A 2RREA 4D5FA 1YW8A 4BXUA 2V6CA 1H9TA 3ZN1A 1I1SA 2L02A 3OIPA 2KPMA 4XNFA 2FOWA 2G0EA 3K70C 4B3AA 2LNBA 4G94A 5D5WB 3S2DJ 2Y48A 2YU3A 3CMEI 3MVPA 2HGCA 1IAWA 3G3ZA 2GIZA 2LTPA 5CJ9A 2QUFA 3IH2A 1F36A 5E3MA 4G6DA 3DTEA 3GMEA 1ETXA 2Y0SA 2MD0A 1BI0A 2L9NA 4AWXB 4CICA 2HXIA 1H0MA 1HXDA 2HQNA 1K78A 2H6BA 2BHYA 1POGA 2HQ5A 3BWGA 4OU0A 2MG4A 2Y2ZA 2ECBA 1QRYA 3OYAA 1MMDA 2XKOA 2PJRA 4L0ZB 3PIPF 2DMPA 2A5YB 1RR8C 3CCQI 2P4WA 2KRHA 3PFIA 1NG6A 3SZPA 1IGNA 2HFHA 4G12A 3ZQCA 4CXFA 4EM0B 6PAXA 2LC2A 4HA8A 5D6EA 4RBOA 4V2FA 2CQNA 2OC6A 3I4PA 4N9HA 3P9KA 1B9NA 2W48A 4UV8A 4MEYF 1IXSB 1VF9A 4NQWA 1FJLA 3JRHA 3S8PA 3HSRA 3NRVA 1ITYA 5F1RA 4FX4A 3O3KA 5TJJA 1AA7A 2K3FA 3FIWA 5F08A 2O5RA 2NOJB 2EILH 1T33A 1MH4A 2M30A 4Y7NJ 4V19K 2ZNYA 3AG3H 2KT0A 2HKXA 3CESA 3H9GA 4BH9A 3CMYA 2EFOA 3DKYA 1ZR4A 2JTVA 3Q5FA 1HKTA 1V5GA 2FBIA 1UB9A 3QPTA 1TW2A 1KZHA 1FNNA 4EEFG 1T0FC 1X1CA 4XLEA 1EH8A 5EEHA 4HNVA 1SVOA 1Q1HA 4GDFA 4J19A 4KYWA 2V79A 4PCQA 3IUOA 4RLQA 1U78A 1XN7A 4MQVA 3F8FA 2DU9A 2H27A 2LMDA 1WJAA 3D1NI 2HVRA 4I7HA 4DYCA 3SDBA 1OCZH 2EZIA 4YEJA 4ZYHA 3GTOJ 2XRNA 1IRXA 2LYCA 1W0UA 1P7IA 1VQ9I 2XAHA 4X0GA 5CLSA 5DDGA 3J81Z 4PJNA 4JX4A 2FD5A 3WGGA 2HDCA 1VQMI 3CCYA 5LEKA 2W84A 2K9NA 3ZMTA 4M6XA 3SEQA 4ZZDA 3PUBA 3FZVA 5E20A 1SVLA 3HPHA 2HOTA 4XORA 1MSFC 1BI2A 1XCVA 4ZDPA 1MD0A 4S04A 3MKLA 4EJUA 5LHHA 3OL4A 1S8NA 2LLKA 1G4DA 3RJPA 2EFWA 2BVLA 4EV0A 2HR3A 4A3GJ 1SD4A 2KDOA 1Z3YA 1YS6A 4II3A 2JA7J 2A61A 3MZ8A 3F21A 4MNUA 2RDPA 2JRTA 2Q1ZB 2A6TA 3CUOA 2UWMA 3GLXA 4A93J 2CUFA 2GAUA 2F5EA 1E3OC 1P6RA 3DLLF 3CO7C 4ON0A 1F5TA 2MC4A 1OR7C 5JHFA 2R7VA 1YX3A 3FXQA 1VZ0A 5JR3A 1GV2A 2MFZA 2IGNA 2DFIA 1RUOA 1DU6A 1BOBA 3KP4A 1A31A 1ETKA 3MQ0A 3DPUA 4DYQA 3GLLA 4DYRA 5F0FA 2XROA 1FOXA 4IX7A 3IP4B 5ILVA 1SFKA 1E3HA 4CCJA 3LFKA 3FISA 4YIRX 2LK2A 2RKHA 2R5YA 1FTZA 4F7ZA 4G9YA 3CUQB 1B9MA 3HC7A 1S3JA 2M9HA 1R4MB 3RIRA 4E4HA 4MLOA 1V5EA 2KISA 1FX7A 2GXAA 2VQCA 3KLOA 5E3LA 3PIOF 2P81A 3LSMA 4S05A 4CHUA 2EIKH 2RN7A 3K4NA 4QWQA 4EQQA 3LSHA 2EBIA 3RPUD 3J7AO 3ECHA 1NH3A 2JQ7A 2JA2A 5GP9A 2COMA 3QWLA 1BW5A 1X4OA 2DT7B 2JJ7A 2E7WA 2BBYA 3UKGA 3T8TA 2BY0A 2XASA 4XL9A 4IOAF 2X6OA 1E17A 3U9GA 5EG0A 3CJQB 3VYSB 2VASA 5LGTA 4A3FJ 1RRJA 1KU9A 3BR1A 2YPRA 2VE9A 1SMYF 2P6SA 4ITVA 1O7FA 3CP2A 3GFLA 5FLVA 4XMYA 1EF4A 2ETHA 5EJCA 3L7WA 1OQYA 4XKVA 1FSEA 4BJTA 4NNJA 4A3KJ 3K1MA 4A3LJ 1BC7C 5JLWA 4DZPA 3FXMA 1FOKA 5FKMA 3I5UA 1R36A 3JRIA 2Z16A 4LD5A 3PO3J 4N9IA 4U87A 1W36D 1F4KA 1P4WA 4G7OF 3BCBA 2FSWA 4BJ5C 1IW7F 5ICGA 4JX6A 3LSKA 2XAJA 4A5NA 1P9QC 2OZUA 3DTIA 3LSGA 1RNLA 3NAUA 4CSWA 2PX9A 3S1QJ 4NC6A 1GLNA 1AKHB 1USTA 2CQKA 2P0WA 3EUHA 1R9TJ 1ZN2A 1IV8A 1G59A 2ISZA 3AKZA 1OFCX 4RM3A 3HOTA 2R7DA 2WAQA 3C18A 1MKMA 3COAC 4FASD 3BR2A 2R7OA 1IDZA 2XDVA 3I9V2 2KJCA 4IZZA 2WBMA 1PJRA 1QBJA 3W6KB 1LE8A 1LKXA 2R93J 2EZKA 2F2EA 3L2QA 3A4CA 3HSEA 1YRNA 2EFPA 1ETVA 1ETYA 1OKRA 1T0FA 1XD7A 2XHKA 1VQ6I 1TQMA 5B1AH 3UNGC 3ZMDA 4M71A 3QYBA 4L0YB 2ZSIB 4HRIA 2DFFA 4TV7A 2DMTA 3WG7H 4YIFA 4WWCA 3GTPJ 1W5TA 1JKRC 3TP3A 1ENHA 5HLGA 2QA4I 1FT9A 3FM5A 5DM6F 2STWA 2HQRA 4AVZA 3FXOA 1X19A 3VODA 2EB7A 2HI3A 1OJLA 5IYCJ 5F0CA 3KZZA 4EJWA 3F8BA 1N25A 1ZGJA 4NDLA 4U7DA 3CD6I 4RM2A 1RC9A 2JSCA 4KN4X 2OTJI 3FK7A 2A05A 1V5FA 2E1NA 2E36A 5M5WJ 4AYBN 2MD5A 1KU7A 2EV5A 2DODA 3HUGB 3WTUC 2DDAA 2ZXWH 5HODA 4L18B 3SQNA 2M34A 2O03A 3ABLH 3HOVJ 1IUFA 1C0WA 4DQ2A 1STZA 1JI8A 2LY1A 4JBAA 1JGGA 4QPOA 1TP4A 2KQRA 4L9JA 1JT6A 2JVHA 1AOYA 4RGRA 1HQCA 3FXRA 3C2HA 1ONVA 3ZMVA 4BE0A 2FE3A 1ZG3A 2R7UA 3KEYA 2ISYA 2D45A 4WXCA 4M72A 4A3CJ 1S7AA 2AXLA 5F64A 2HKOA 2PG4A 3NWTA 4F52A 2WTEA 2HQAA 4N4NB 2HOAA 4RDUA 4BBSJ 5GTIC 1WWXA 3ZQHA 4IHYA 2QCOA 3T0YA 1MGTA 2MABA 3L2RA 2DN0A 2LRDA 3ZCOA 1Z0XA 4A6DA 2X0LA 3O2PE 1GV5A 1YW7A 2Z9OA 3CC7I 5LEJA 2X48A 3CJTB 4JOMA 3I55I 1XMKA 3CZ6A 1OYYA 3GTMJ 5BPIA 2JK3A 2WV1A 1B1BA 2ELKA 1TNTA 4UHTA 2IJLA 4UNOA 3Q3SA 5GPCA 3HOUJ 2Z1DA 3REOA 2JA8J 5E18F 4IRHA 1IXRC 1WPKA 5B3SH 2FQ4A 2QSFX 3CLOA 1RZ4A 3PNTA 2GZWA 1GXQA 2DW4A 5D4RA 2FU4A 2NNYA 4I0AA 4FX0A 3HTUA 4Y17A 2Q0OA 3QP6A 3BG6A 2ZB9A 4AU7A 3BJ6A 1E0EA 4HPQA 3R6SA 1OISA 4L9TA 2P7CB 1DGWY 5IY5H 2JUCA 2WB1A 1IJWC 2IT0A 1BIAA 3BQYA 3W2AA 4RA2A 4RAZA 5C4XJ 2CQ7A 5GAEJ 1TBXA 3V8LA 3MKWB 3QOEA 1Z3XA 1SANA 2R92J 1Y0NA 3J80K 1SFUA 4R1HA 2FUG2 2GA1A 3WTSC 1K4TA 2HYGD 1B8IA 2IXSA 3LA3A 3HTSB 5D6FA 1BIBA 4HLXA 5HS8A 3S15J 2QQAA 4OAYA 1OCOH 2WB1N 3F23A 1JKOC 3CJRB 1A35A 3EYYA 4LK0F 4ZC3A 1O4XA 3JRDA 1A6QA 1H9GA 3ZQIA 1REPC 4FE4A 4PFPA 2DOEA 3HOYJ 2DCEA 2GOXB 4DIQA 2OA4A 2BW3B 1G3SA 2ZJ2A 5IYDJ 4P1WA 4HF2A 4UVAA 1ZKGA 3I53A 3PM1A 4D1QA 4G6TB 2MYSA 4BEHB 1TQIA 1J09A 2H8RA 2O9LA 2CW7A 2HWVA 3HB9A 4UXNA 2UXXA 3A01B 3RPQA 2KZVA 3TOAA 1ERDA 2COBA 1ZAOA 1APLC 3LL7A 1WRJA 2W24A 2ZNZA 5DCMA 3DKWA 1ZGWA 3E5XA 1ZARA 3PSFA 3ZMZA 3OYNA 1T6SA 2L9RA 3E3VA 1GHCA 3C3WA 3C1DA 1AHDP 4UB6C 2OPTA 5FB2A 4Q48A 4ASNA 3W6VA 2W57A 2X1CA 4BNCA 1FEXA 3CC2I 1U0JA 2XVCA 3RZDJ 1V3FA 3VDXA 2KZGA 2B63J 3IKVA 5EGOA 1JGSA 2WY7Q 2V9KA 3B73A 4A3BJ 1JXSA 3WU0A 4KIFA 4BDYA 3FMQA 2QENA 4HF0A 3J81K 4RGSA 5HS7A 5KNLA 5TRDA 2IVMA 1LDKB 2ESNA 3DTKA 3M4OJ 3HEFA 1MBJA 2BY1A 3EYIA 1S29A 3DWLE 2F4OB 2BXYA 5FGMA 2FMLA 2O8XA 4A6EA 2BGCA 2HU9A 4C3JJ 3OYGA 3K70D 2HEOA 3PL8A 5GAHJ 2L0KA 2CUJA 2JUGA 3KCCA 2QBYA 3JRFA 1T38A 3VEPA 2L7KA 3P9CA 3ZRGA 1SAXA 2FMYA 2JVGA 2ZMEC 4KITB 2DFHA 1AKHA 2VQHA 1ON2A 1WI3A 2IP2A 2PBIA 2VBYA 4AVPA 3JTGA 4AUXA 5BMZA 3T5XA 2F5FA 2ZJPF 3W3CA 4BHPA 5J6XA 2CH0A 3AG2H 1Z77A 3CCSI 2AQFA 4ETSA 3O8HA 5D5VB 1SFEA 1IN8A 4P9UA 1JUMA 4ZZLA 1A04A 1RKWA 2QKMB 3EPZA 1DGRM 4MQ9F 4HOBA 2FJ1A 2VN2A 1NK2P 4QIWN 3OYJA 3J7ZI 2R0QC 3I0TA 3H9JA 1IRFA 3NQOA 3FDYA 3LSRA 4DJAA 4XN3A 3IL2A 1J2XA 1XG1A 1YQAA 3QYFA 3PSIA 5CVRA 1XDUA 5E3NA 2XSDC 3NARA 2LH9A 5E79C 1TWAJ 2JT1A 5LHGA 2YSRA 5KCMA 1ZR2A 1UHSA 3EETA 1DPRA 4LB5A 2A6HF 2VJJA 2ZFWA 1B4AA 3RCOA 2A5WA 1FLIA 5EG0B 3DBHB 2VKEA 3I3LA 4BQOA 4XM3A 1MZBA 2QKLB 2OQRA 2MH9A 2EIJH 3MAJA 5K5QA 4UY8I 3E97A 2NYXA 1YOVB 2HOSA 1IC8A 1IRZA 1MIJA 1U2WA
chains in the Genus database with same CATH topology
2KIMA 2OD5A 4IHSA 2XAFA 3RTRA 3HOSA 4LLGF 2O0YA 2P8TA 2K27A 2DQLA 1UFMA 1FSHA 2PEXA 4O6JA 1U8RA 4LFUA 3U2RA 1CF7A 2CFXA 5HOOA 2HTSA 3QU3A 3LA7A 4PDKA 1LEAA 2BE5F 1AWCA 1BBYA 1F9NA 1YTYA 3JSOA 4HV6A 2RNJA 1O57A 5IT3A 3F72A 3KP7A 3JAMK 2H94A 1YYVA 1JE8A 1ZLKA 3ZMUA 1WQ2A 4GGGA 1Z6TA 3AAFA 2VT3A 1L0OC 4UVCA 2H09A 3M8EA 4N0BA 2GQQA 3IWZA 5KK1A 3R0AA 1IRGA 3TO6A 3MFKA 1YFHA 1V4RA 2VC1A 2B0LA 1IF1A 4I09A 2DI3A 3ULQB 2D1HA 4OMZA 2HOEA 5HLHA 3GO5A 3V7SA 3F8CA 1KQ9A 3WTZA 4JK1X 3Q9SA 1Z1DA 3FHZA 1KYZA 2Z33A 5IT9Z 4KDPA 1SMTA 4LG0A 1G6NA 3ERED 1U6GA 4XSZF 1B59A 3M8FA 2OBPA 1BN5A 1CF7B 2DBBA 4L5IA 2FQ3A 2EFNA 2MLKA 4IXAA 4ZYDA 3GFIA 1J59A 4Q5SF 1BJAA 4XSXF 4RAYA 2OQGA 2Z3YA 2PMUA 1T39A 5IT9K 3SHFA 4EVIA 5L3DA 1HKQA 4ESBA 3I54A 5A2QK 2G9WA 2M87A 4PGHA 2G7UA 2VODA 3I58A 1Z6RA 2VBXA 2Q8KA 1ZRFA 5H20A 1ON1A 3J80Z 1R00A 1QPMA 5LHIA 4U88A 5LRRA 3IKTA 3I71A 1MJ9A 3DQVC 1SD5A 1KU3A 3K69A 1G3WA 4I01A 2J5PA 1QGPA 2WWYA 1R22A 2QWWA 1EV7A 4PZJA 3LWFA 4CYDA 4K2EA 2P7VB 2MA3A 5CVUA 5D8LB 1G3TA 4HX4A 2GA2A 2VBZA 2EV0A 5ICEA 1R1TA 4UV9A 3G73A 3N4MA 4HX8A 4LLLA 1J7KA 2VE8A 4R8HA 1XSDA 2W25A 2VOPA 2V1DA 1FY7A 2YX7A 1OYIA 1MDMB 2QBYB 1U5TB 2Z99A 1JHHA 4I02A 4IRGA 3N97A 2D1VA 4WF2A 4HBLA 4KUMA 1XB4A 3OV8A 2X4HA 3BOQA 3V8JA 4GYIA 2XV4S 1Y0UA 4A5MA 1Z91A 2CG4A 1SD6A 2HZTA 1BOAA 3CDHA 1NHAA 1BM9A 2ZXJA 3LAJA 2KIUA 1YLFA 4MTEA 5E1WA 1D3YA 2J5OA 5HLIA 5ICFA 3KETA 1IN7A 1ZLJA 4XBFA 1D8KA 1P92A 3GX4X 2XAQA 5DYMA 4ZYGA 1HSTA 2RQPA 3F6OA 1YIOA 3I59A 3GXOA 3WTTC 5DUIA 2GIVA 2WV0A 1ZRCA 2NNNA 2K4JA 3MZHA 3KP3A 4B8XA 1SD7A 1TNSA 1FPQA 2BYVE 4ZH4F 4BHCA 2PMHA 3ZN0A 1IXCA 1LQ1A 4U7BA 1BC8C 4CDGA 1R58A 3NEUA 4HV5A 2DPDA 2ZKZA 3IHUA 1RI7A 5KVRA 4P9FA 5K1YA 3CJNA 2P5KA 4EM2A 3CO6C 1O3TA 4A0YA 4I0BA 2GWRA 3ABTA 4KN7X 4CO8A 2XAGA 2L4AA 2A69F 4AIJA 4E70A 4IF4A 5D8KB 2AS5F 3BPVA 3L09A 2HYFA 4U0WA 4HQMA 1R23A 3GFJA 1IUYA 4EMSA 4IHTA 5ED4A 3BY6A 3BP8A 1KGSA 2Y0MA 1PUEE 3K1PA 4HW0A 5L3CA 2DPUA 2MBFA 1XMAA 4QLCU 1XGOA 4OIPF 3GFMA 2KJBA 2K86A 1OR7A 1RUNA 1LNWA 5E1ZB 3SZTA 2JPCA 2FBHA 2FNAA 2O61A 2KKOA 3E6MA 1UCRA 3RYRA 3IWFA 3RI4A 3PQKA 4RB0A 1RIOH 4HAMA 2QLZA 4ESFA 2QYOA 2P6TA 1XDSA 2PJPA 1IN4A 3DV8A 3CTAA 1KQ8A 1FWZA 4XLNF 2RVCA 4BAYA 3RYPA 2STTA 1TTYA 2UZKA 3BJAA 1D8JA 1LDDA 3QAHA 4ZYEA 1PP7U 3GZ6A 2KRFA 1HKSA 3GW2A 3HRUA 4IPAA 2ADUA 2RGVA 1QNTA 4EJTA 1O3QA 3V4GA 2ZMEB 3V7RA 4XLPF 4M9XA 1QQIA 1R5HA 5E8GA 3LQRA 3L2CA 3LQQA 3TO7A 1FZPB 1KQ0A 3M7GA 4D0PA 2DTRA 2OZ6A 3RPUA 2FXAA 1VTNC 1W7PD 2ACJA 4OIOF 4YG2F 4KMUX 2P5LC 3TDZC 3H3UA 4IJAA 4KA4A 2QM3A 3E5UA 1BI3A 2IA1A 2IRFG 3R0JA 1ZRDA 4R79A 3TOBA 4GXOA 4M9SA 2K7LA 2DAOA 2A6EF 3L00A 2O6GE 4EJVA 4GCVA 3K9TA 3BJOA 3WODF 3R61A 4ENKA 1XGNA 2MH2A 5CVJA 1LEBA 2FRHA 5DD4A 3QOPA 3MCZA 3E6CC 3I59B 2FA5A 5JFRA 2KIFA 1J9IA 5HDGA 2CGPA 2A3SA 3LAPA 4HX7A 4OIQF 2QZ8A 2CWEA 1KU2A 3S2WA 2XKPA 3JW4A 2PI0A 2ZO4A 2DK8A 3MEXA 5K5RA 4RB2C 4O5VA 5D4SA 3V8KA 4OMYA 3GF2A 5ILSA 5F6FA 4U0VA 3MZYA 5LGNA 1D5VA 1HBXG 2ZCWA 2HTJA 4U0YA 2RC4A 5ICCA 2QQ9A 1QZYA 1FBUA 2L4MA 2M1BA 4LGWA 1ZH5A 1FBSA 3E6DA 3WU1B 3ROUA 3M1EA 4HF1A 3MWMA 2VONA 2ZMEA 1FBQA 3HSFA 5E17F 1DUXC 2EK5A 2CO5A 1HSJA 4I98B 1Z9CA 4MHGA 3FX3A 4RB1A 3TQNA 1KA8A 5ILUA 4I2OA 3TDUC 2YR2A 3FXUA 5DD8A 3HRMA 5BQTA 4IRIA 2CYYA 4ENJA 4A0ZA 2PQ8A 3ZPLA 2QVOA 3H92A 5A2QZ 4L5JA 2VBWA 5L3GA 2UXNA 2IA0A 1W7PB 2Z5UA 4KIGA 3ECOA 1P4AA 2ELHA 1B6AA 2QQBA 3BPXA 1GXPA 4LK1F 5J8CA 1W4MA 4KT5C 3GEZA 2OAZA 2EJRA 3LA2A 2FBKA 4Y15A 4AIKA 4AD9A 3K2ZA 3F8NA 2YX4A 4A0XA 2FF4A 4RB3C 4A12A 1DDNA 5BOXA 4M74A 3VB2A 3HHGA 3FF5A 1S6LA 3QU6A 3KP2A 1MJAA 1DPUA 1HW1A 2C6YA 3R60A 1QZZA 1K78B 1XCBA 3VOEA 1T98A 3ZP5A 1J75A 4YFNF 2XIGA 4RS8A 1QO0D 4CZZA 1FYKA 3PQJA 4DNCA 5AONA 5JHUA 5AIQA 5JVTA 3FMSA 3WTWC 3WGHA 3GYHX 3K0LA 5HS9A 4EM1A 1G3YA 2BV6A 4KNYA 4ENNA 2XGXA 2O3FA 3KP5A 5HDKA 3CUQC 3IRQA 1FYMA 1MDMA 4KIBA 2V1UA 4YFXF 4KICA 2EFQA 1WI9A 1U5TC 5L3FA 1T2KA 5CYVA 4O3MA 2F5DA 4CGZA 5H6QA 4Q47A 1OPCA 2DO7A 2NS0A 3T8RA 4HDUA 4L9VA 2VC0A 3DXJF 2PFBA 3KFWX 2V9VA 2ESHA 1ODDA 1R7JA 5DEQA 2K4BA 1ZYRF 3LSTA 1XGMA 1ULYA 3TO9A 2CSOA 2IW5A 4WK8F 1J0RA 4P96A 5D5UB 3GWZA 5HDNA 2VXZA 5LRSA 2GXGA 4AIHA 3WG9A 2BEOA 2CW0F 1R1UA 3P7NA 4L9NA 1L3LA 2H6CA 3SXYA 3F22A 1ZG5A 2R7FA 4Z2YA 3F3XA 3HRTA 5LLQA 2RV8A 5FD6A 2D2WA 1EH7A 3B02A 3HUGA 5E8IA 4HQEA 3RDIA 2NAZA 3WE3A 1K79A 4NB5A 1YO5C 1FP2A 3KEOA 3WTVC 1FP1D 3DPTA 4RGUA 1I27A 1HW5A 4FT8A 4B09A 4OINF 1LDJA 4LG0B 2M8EA 2R3SA 5D5XB 4WXDA 1O3RA 1W7PA 1XGSA 2LSOA 3WTYC 5EEGA 3FM3A 3KP6A 5CVIA 1HW2A 3F8MA 5BS6A 4YIIA 1O3SA 5CVVA 5LGUA 1I6XA 1YG2A 3BROA 4JQFA 4Y13A 4IVNA 2DQRA 2LDUA 3C7JA 1O7LA 1GVJA 2ZBKA 2NRAC 1YS7A 3DEUA 2HS5A 1K7AA 2L01A 1TLHB 4KMFA 3T1BA 4HLYA 1I5ZA 1EH6A 1LJ9A 1WSUA 3E6BA 5L3BA 3RKXA 3I64A 2LKPA 4XRFA 4G8XA 4OIRF 4HYEA 2DLLA 3L9FA 3QRFF 3GZ5A 4HDVA 1P2FA 1Z7UA 3ELKA 3DP7A 3TKYA 2OU2A 4LB6B 3QPHA 4UVBA 3FWEA 2LF7A 3H3ZA 2E1CA 1BI1A 1ZG1A 4LMYA 3VFZA 1LVAA 3HRSA 5FO5A 1ZGAA 3HIFA 2V1XA 1PP8F 2EWNA 3JAMZ 2M5WA 3R4KA 2PN6A 4RGXA 3IC7A 4PGGA 4P55A 4LLNA 3KEQA 1X3UA 4EGZA 1PDNC 1S7OA 1JHFA 3WGIA 2DT5A 5ERIA 5H6RA 3F6VA 5LBQA 4FHTA 3D0SA 3M9AA 2JZYA 5FFXA 1OYWA 2WC2A 1MJBA 1K6OA 3JSPA 1IN6A 3RKYA 2G7HA 2GXBA 4YFKF 2EA2A 1ZHFA 2IA2A 1W5SA 2EV6A 2A07F 3WE2A 1YW9A 2M45A 1R1VA 1J5YA 2MC3A 3FMRA 3K1NA 3KZYA 1WKMA 3OOPA 5K5OA 5BPDA 3ISPA 3IRRA 3GUDA 2DK5A 2JPBA 2P5VA 3EDPA 4MGRA 5FD5A 1R5GA 5DCFA 2FEZA 1Z05A 1U5TA 5E1XA 2F5CA 3EQLF 3V7CA 4WXHA 1DP7P 5DCMB 4G6QA 3ABUA 3DFGA 2MLGA 4ESJA 4MEXF 4LJZF 3HYIA 3CUQA 4A2UA 2FNPA 1IZ1A 1USSA 1IN5A 1FC3A 3ML6A 2XUBA 3DPLC 4BHBA 4KFCA 2L54A 3ZQ7A 2VOOA 1U3EM 1OMIA 3O6BB 2LF8A 1XSVA 1LB2A 1FYLA 3KE2A 4P5OA 3GVAA 1UHMA 1I1GA 2E7XA 3TGNA 4G7ZF 5DV5A 2IPQX 1TQPA 3W6JB 1E2XA 4GO1A 3U1DA 4BYYA 3E5QA 4MTDA 2L3DA 3Q9VA 2Q2EA 2FOKA 5FLXK 4H0EA 4GYGA 4EJOA 3SFZA 3DF8A 3BDDA 1XSXA 3QP5A 1P4XA 3KLNA 5AIPA 2A68F 4M6YA 4UUVA 5HVQC 5JI6A 4WX9A 2VT2A 2TDXA 4NHJA 1CGPA 4Q4ZF 1F1ZA 3HHHA 5DUKA 5FFZA 1KYWA 5FLXZ 3BZ6A 1ZREA 2EA4A 3WTXC 2PLYA 1SFXA 4G7HF 4ENMA 3P9IA 4HZFA 2Y75A 1TW3A 4EGYA 3RKWA 5L3EA 2W85A 5J8FA 3JTHA 4WCGA 1UHWA 4OOIA 4BQAA 3ZMSA 2K02A 4M9ZA 3D5LA 4M73A 1YW8A 4BXUA 2V6CA 1H9TA 3ZN1A 1I1SA 2L02A 2LNBA 4G94A 5D5WB 2Y48A 2YU3A 2HGCA 1IAWA 3G3ZA 5CJ9A 2QUFA 4G6DA 1BI0A 4CICA 4AWXB 1K78A 1H0MA 1HXDA 2HQNA 2H6BA 3BWGA 4OU0A 2XKOA 4L0ZB 2A5YB 2P4WA 3PFIA 3SZPA 2HFHA 4CXFA 4EM0B 6PAXA 4HA8A 5D6EA 3I4PA 4N9HA 3P9KA 1B9NA 4UV8A 4MEYF 1IXSB 4NQWA 3HSRA 3NRVA 5F1RA 4FX4A 3O3KA 5TJJA 2M30A 2ZNYA 2HKXA 4BH9A 2EFOA 2JTVA 3Q5FA 1HKTA 2FBIA 1UB9A 3QPTA 1TW2A 1FNNA 5EEHA 1EH8A 1Q1HA 4KYWA 2V79A 4PCQA 1U78A 1XN7A 4MQVA 3F8FA 2DU9A 2H27A 4I7HA 4ZYHA 2XRNA 2XAHA 5CLSA 5DDGA 3J81Z 3WGGA 2HDCA 5LEKA 2W84A 3ZMTA 4M6XA 4ZZDA 3FZVA 5E20A 1BI2A 1XCVA 1MD0A 4S04A 4EJUA 5LHHA 1S8NA 1G4DA 3RJPA 2EFWA 4EV0A 2HR3A 1SD4A 1YS6A 2A61A 3F21A 4MNUA 2RDPA 2JRTA 3CUOA 2UWMA 3GLXA 2GAUA 2F5EA 1P6RA 3CO7C 4ON0A 1F5TA 3FXQA 5JR3A 2DFIA 1RUOA 3KP4A 3MQ0A 2XROA 5ILVA 3LFKA 2RKHA 4F7ZA 4G9YA 3CUQB 1B9MA 3RIRA 1S3JA 1FX7A 3KLOA 4S05A 4CHUA 2RN7A 4QWQA 4EQQA 3J7AO 3ECHA 2COMA 2E7WA 2BBYA 3T8TA 2XASA 1E17A 3U9GA 5LGTA 1KU9A 2YPRA 2VE9A 1SMYF 2P6SA 1O7FA 3GFLA 2ETHA 3L7WA 1FSEA 3K1MA 1BC7C 1FOKA 3I5UA 1R36A 4LD5A 4N9IA 1F4KA 1P4WA 4G7OF 5ICGA 2FSWA 1IW7F 2XAJA 4A5NA 2OZUA 1RNLA 1USTA 2CQKA 3EUHA 1ZN2A 2ISZA 3HOTA 2R7DA 3C18A 1MKMA 3COAC 2KJCA 1QBJA 3W6KB 2F2EA 3HSEA 2EFPA 1T0FA 1XD7A 1OKRA 2XHKA 1TQMA 3ZMDA 4M71A 4L0YB 4TV7A 4YIFA 4WWCA 1W5TA 5HLGA 1FT9A 3FM5A 2STWA 2HQRA 3VODA 2EB7A 3KZZA 4EJWA 3F8BA 1ZGJA 4U7DA 2JSCA 4KN4X 2E1NA 2MD5A 1KU7A 2EV5A 3WTUC 4L18B 3SQNA 2O03A 1C0WA 4DQ2A 1STZA 4JBAA 4L9JA 1AOYA 4RGRA 1HQCA 3FXRA 3ZMVA 1ONVA 2FE3A 1ZG3A 2ISYA 2D45A 4WXCA 4M72A 1S7AA 2AXLA 5F64A 2HKOA 2PG4A 2WTEA 1WWXA 3T0YA 1MGTA 4A6DA 2X0LA 3O2PE 1YW7A 2Z9OA 5LEJA 1XMKA 1OYYA 5BPIA 1B1BA 1TNTA 4UHTA 2IJLA 4UNOA 3REOA 5E18F 4IRHA 1IXRC 1RZ4A 3CLOA 2GZWA 1GXQA 2DW4A 5D4RA 2FU4A 2NNYA 4I0AA 4FX0A 3HTUA 4Y17A 2Q0OA 3QP6A 3BJ6A 3R6SA 4L9TA 2P7CB 2IT0A 1BIAA 4RAZA 1TBXA 3V8LA 3J80K 1SFUA 4R1HA 2GA1A 3WTSC 2HYGD 3HTSB 3LA3A 5D6FA 1BIBA 4HLXA 5HS8A 2QQAA 3F23A 3EYYA 4LK0F 1H9GA 1REPC 2OA4A 1G3SA 2ZJ2A 4HF2A 4UVAA 3I53A 1TQIA 2HWVA 4UXNA 2UXXA 3RPQA 3TOAA 1ZAOA 1WRJA 2W24A 2ZNZA 5DCMA 3DKWA 3E5XA 1ZARA 3ZMZA 1T6SA 3E3VA 1GHCA 3C3WA 3C1DA 5FB2A 4Q48A 4ASNA 2W57A 4BNCA 2XVCA 1V3FA 3IKVA 1JGSA 3B73A 1JXSA 3WU0A 4KIFA 3FMQA 3J81K 5TRDA 2QENA 4HF0A 4RGSA 5HS7A 2IVMA 1LDKB 2ESNA 3EYIA 1S29A 5FGMA 2FMLA 2O8XA 4A6EA 2BGCA 2HEOA 3KCCA 2QBYA 1T38A 3VEPA 3P9CA 1SAXA 2FMYA 1ON2A 2IP2A 2PBIA 2VBYA 4AVPA 3JTGA 5BMZA 3T5XA 2F5FA 4BHPA 5J6XA 4ETSA 5D5VB 1SFEA 1IN8A 4P9UA 4ZZLA 1A04A 4MQ9F 4HOBA 2VN2A 3I0TA 1IRFA 3NQOA 3IL2A 1J2XA 1YQAA 5CVRA 1XDUA 2JT1A 5LHGA 2YSRA 3EETA 1DPRA 4LB5A 2A6HF 2ZFWA 1B4AA 1FLIA 1MZBA 2OQRA 5K5QA 2MH9A 3MAJA 3E97A 2NYXA 1U2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIM A;  2OD5 A;  4IHS A;  2XAF A;  3RTR A;  3HOS A;  4LLG F;  2O0Y A;  2P8T A;  2K27 A;  2DQL A;  1UFM A;  1FSH A;  2PEX A;  4O6J A;  1U8R A;  4LFU A;  3U2R A;  1CF7 A;  2CFX A;  5HOO A;  2HTS A;  3QU3 A;  3LA7 A;  4PDK A;  1LEA A;  2BE5 F;  1AWC A;  1BBY A;  1F9N A;  1YTY A;  3JSO A;  4HV6 A;  2RNJ A;  1O57 A;  5IT3 A;  3F72 A;  3KP7 A;  3JAM K;  2H94 A;  1YYV A;  1JE8 A;  1ZLK A;  3ZMU A;  1WQ2 A;  4GGG A;  1Z6T A;  3AAF A;  2VT3 A;  1L0O C;  4UVC A;  2H09 A;  3M8E A;  4N0B A;  2GQQ A;  3IWZ A;  5KK1 A;  3R0A A;  1IRG A;  3TO6 A;  3MFK A;  1YFH A;  1V4R A;  2VC1 A;  2B0L A;  1IF1 A;  4I09 A;  2DI3 A;  3ULQ B;  2D1H A;  4OMZ A;  2HOE A;  5HLH A;  3GO5 A;  3V7S A;  3F8C A;  1KQ9 A;  3WTZ A;  4JK1 X;  3Q9S A;  1Z1D A;  3FHZ A;  1KYZ A;  2Z33 A;  5IT9 Z;  4KDP A;  1SMT A;  4LG0 A;  1G6N A;  3ERE D;  1U6G A;  4XSZ F;  1B59 A;  3M8F A;  2OBP A;  1BN5 A;  1CF7 B;  2DBB A;  4L5I A;  2FQ3 A;  2EFN A;  2MLK A;  4IXA A;  4ZYD A;  3GFI A;  1J59 A;  4Q5S F;  1BJA A;  4XSX F;  4RAY A;  2OQG A;  2Z3Y A;  2PMU A;  1T39 A;  5IT9 K;  3SHF A;  4EVI A;  5L3D A;  1HKQ A;  4ESB A;  3I54 A;  5A2Q K;  2G9W A;  2M87 A;  4PGH A;  2G7U A;  2VOD A;  3I58 A;  1Z6R A;  2VBX A;  2Q8K A;  1ZRF A;  5H20 A;  1ON1 A;  3J80 Z;  1R00 A;  1QPM A;  5LHI A;  4U88 A;  5LRR A;  3IKT A;  3I71 A;  1MJ9 A;  3DQV C;  1SD5 A;  1KU3 A;  3K69 A;  1G3W A;  4I01 A;  2J5P A;  1QGP A;  2WWY A;  1R22 A;  2QWW A;  1EV7 A;  4PZJ A;  3LWF A;  4CYD A;  4K2E A;  2P7V B;  2MA3 A;  5CVU A;  5D8L B;  1G3T A;  4HX4 A;  2GA2 A;  2VBZ A;  2EV0 A;  5ICE A;  1R1T A;  4UV9 A;  3G73 A;  3N4M A;  4HX8 A;  4LLL A;  1J7K A;  2VE8 A;  4R8H A;  1XSD A;  2W25 A;  2VOP A;  2V1D A;  1FY7 A;  2YX7 A;  1OYI A;  1MDM B;  2QBY B;  1U5T B;  2Z99 A;  1JHH A;  4I02 A;  4IRG A;  3N97 A;  2D1V A;  4WF2 A;  4HBL A;  4KUM A;  1XB4 A;  3OV8 A;  2X4H A;  3BOQ A;  3V8J A;  4GYI A;  2XV4 S;  1Y0U A;  4A5M A;  1Z91 A;  2CG4 A;  1SD6 A;  2HZT A;  1BOA A;  3CDH A;  1NHA A;  1BM9 A;  2ZXJ A;  3LAJ A;  2KIU A;  1YLF A;  4MTE A;  5E1W A;  1D3Y A;  2J5O A;  5HLI A;  5ICF A;  3KET A;  1IN7 A;  1ZLJ A;  4XBF A;  1D8K A;  1P92 A;  3GX4 X;  2XAQ A;  5DYM A;  4ZYG A;  1HST A;  2RQP A;  3F6O A;  1YIO A;  3I59 A;  3GXO A;  3WTT C;  5DUI A;  2GIV A;  2WV0 A;  1ZRC A;  2NNN A;  2K4J A;  3MZH A;  3KP3 A;  4B8X A;  1SD7 A;  1TNS A;  1FPQ A;  2BYV E;  4ZH4 F;  4BHC A;  2PMH A;  3ZN0 A;  1IXC A;  1LQ1 A;  4U7B A;  1BC8 C;  4CDG A;  1R58 A;  3NEU A;  4HV5 A;  2DPD A;  2ZKZ A;  3IHU A;  1RI7 A;  5KVR A;  4P9F A;  5K1Y A;  3CJN A;  2P5K A;  4EM2 A;  3CO6 C;  1O3T A;  4A0Y A;  4I0B A;  2GWR A;  3ABT A;  4KN7 X;  4CO8 A;  2XAG A;  2L4A A;  2A69 F;  4AIJ A;  4E70 A;  4IF4 A;  5D8K B;  2AS5 F;  3BPV A;  3L09 A;  2HYF A;  4U0W A;  4HQM A;  1R23 A;  3GFJ A;  1IUY A;  4EMS A;  4IHT A;  5ED4 A;  3BY6 A;  3BP8 A;  1KGS A;  2Y0M A;  1PUE E;  3K1P A;  4HW0 A;  5L3C A;  2DPU A;  2MBF A;  1XMA A;  4QLC U;  1XGO A;  4OIP F;  3GFM A;  2KJB A;  2K86 A;  1OR7 A;  1RUN A;  1LNW A;  5E1Z B;  3SZT A;  2JPC A;  2FBH A;  2FNA A;  2O61 A;  2KKO A;  3E6M A;  1UCR A;  3RYR A;  3IWF A;  3RI4 A;  3PQK A;  4RB0 A;  1RIO H;  4HAM A;  2QLZ A;  4ESF A;  2QYO A;  2P6T A;  1XDS A;  2PJP A;  1IN4 A;  3DV8 A;  3CTA A;  1KQ8 A;  1FWZ A;  4XLN F;  2RVC A;  4BAY A;  3RYP A;  2STT A;  1TTY A;  2UZK A;  3BJA A;  1D8J A;  1LDD A;  3QAH A;  4ZYE A;  1PP7 U;  3GZ6 A;  2KRF A;  1HKS A;  3GW2 A;  3HRU A;  4IPA A;  2ADU A;  2RGV A;  1QNT A;  4EJT A;  1O3Q A;  3V4G A;  2ZME B;  3V7R A;  4XLP F;  4M9X A;  1QQI A;  1R5H A;  5E8G A;  3LQR A;  3L2C A;  3LQQ A;  3TO7 A;  1FZP B;  1KQ0 A;  3M7G A;  4D0P A;  2DTR A;  2OZ6 A;  3RPU A;  2FXA A;  1VTN C;  1W7P D;  2ACJ A;  4OIO F;  4YG2 F;  4KMU X;  2P5L C;  3TDZ C;  3H3U A;  4IJA A;  4KA4 A;  2QM3 A;  3E5U A;  1BI3 A;  2IA1 A;  2IRF G;  3R0J A;  1ZRD A;  4R79 A;  3TOB A;  4GXO A;  4M9S A;  2K7L A;  2DAO A;  2A6E F;  3L00 A;  2O6G E;  4EJV A;  4GCV A;  3K9T A;  3BJO A;  3WOD F;  3R61 A;  4ENK A;  1XGN A;  2MH2 A;  5CVJ A;  1LEB A;  2FRH A;  5DD4 A;  3QOP A;  3MCZ A;  3E6C C;  3I59 B;  2FA5 A;  5JFR A;  2KIF A;  1J9I A;  5HDG A;  2CGP A;  2A3S A;  3LAP A;  4HX7 A;  4OIQ F;  2QZ8 A;  2CWE A;  1KU2 A;  3S2W A;  2XKP A;  3JW4 A;  2PI0 A;  2ZO4 A;  2DK8 A;  3MEX A;  5K5R A;  4RB2 C;  4O5V A;  5D4S A;  3V8K A;  4OMY A;  3GF2 A;  5ILS A;  5F6F A;  4U0V A;  3MZY A;  5LGN A;  1D5V A;  1HBX G;  2ZCW A;  2HTJ A;  4U0Y A;  2RC4 A;  5ICC A;  2QQ9 A;  1QZY A;  1FBU A;  2L4M A;  2M1B A;  4LGW A;  1ZH5 A;  1FBS A;  3E6D A;  3WU1 B;  3ROU A;  3M1E A;  4HF1 A;  3MWM A;  2VON A;  2ZME A;  1FBQ A;  3HSF A;  5E17 F;  1DUX C;  2EK5 A;  2CO5 A;  1HSJ A;  4I98 B;  1Z9C A;  4MHG A;  3FX3 A;  4RB1 A;  3TQN A;  1KA8 A;  5ILU A;  4I2O A;  3TDU C;  2YR2 A;  3FXU A;  5DD8 A;  3HRM A;  5BQT A;  4IRI A;  2CYY A;  4ENJ A;  4A0Z A;  2PQ8 A;  3ZPL A;  2QVO A;  3H92 A;  5A2Q Z;  4L5J A;  2VBW A;  5L3G A;  2UXN A;  2IA0 A;  1W7P B;  2Z5U A;  4KIG A;  3ECO A;  1P4A A;  2ELH A;  1B6A A;  2QQB A;  3BPX A;  1GXP A;  4LK1 F;  5J8C A;  1W4M A;  4KT5 C;  3GEZ A;  2OAZ A;  2EJR A;  3LA2 A;  2FBK A;  4Y15 A;  4AIK A;  4AD9 A;  3K2Z A;  3F8N A;  2YX4 A;  4A0X A;  2FF4 A;  4RB3 C;  4A12 A;  1DDN A;  5BOX A;  4M74 A;  3VB2 A;  3HHG A;  3FF5 A;  1S6L A;  3QU6 A;  3KP2 A;  1MJA A;  1DPU A;  1HW1 A;  2C6Y A;  3R60 A;  1QZZ A;  1K78 B;  1XCB A;  3VOE A;  1T98 A;  3ZP5 A;  1J75 A;  4YFN F;  2XIG A;  4RS8 A;  1QO0 D;  4CZZ A;  1FYK A;  3PQJ A;  4DNC A;  5AON A;  5JHU A;  5AIQ A;  5JVT A;  3FMS A;  3WTW C;  3WGH A;  3GYH X;  3K0L A;  5HS9 A;  4EM1 A;  1G3Y A;  2BV6 A;  4KNY A;  4ENN A;  2XGX A;  2O3F A;  3KP5 A;  5HDK A;  3CUQ C;  3IRQ A;  1FYM A;  1MDM A;  4KIB A;  2V1U A;  4YFX F;  4KIC A;  2EFQ A;  1WI9 A;  1U5T C;  5L3F A;  1T2K A;  5CYV A;  4O3M A;  2F5D A;  4CGZ A;  5H6Q A;  4Q47 A;  1OPC A;  2DO7 A;  2NS0 A;  3T8R A;  4HDU A;  4L9V A;  2VC0 A;  3DXJ F;  2PFB A;  3KFW X;  2V9V A;  2ESH A;  1ODD A;  1R7J A;  5DEQ A;  2K4B A;  1ZYR F;  3LST A;  1XGM A;  1ULY A;  3TO9 A;  2CSO A;  2IW5 A;  4WK8 F;  1J0R A;  4P96 A;  5D5U B;  3GWZ A;  5HDN A;  2VXZ A;  5LRS A;  2GXG A;  4AIH A;  3WG9 A;  2BEO A;  2CW0 F;  1R1U A;  3P7N A;  4L9N A;  1L3L A;  2H6C A;  3SXY A;  3F22 A;  1ZG5 A;  2R7F A;  4Z2Y A;  3F3X A;  3HRT A;  5LLQ A;  2RV8 A;  5FD6 A;  2D2W A;  1EH7 A;  3B02 A;  3HUG A;  5E8I A;  4HQE A;  3RDI A;  2NAZ A;  3WE3 A;  1K79 A;  4NB5 A;  1YO5 C;  1FP2 A;  3KEO A;  3WTV C;  1FP1 D;  3DPT A;  4RGU A;  1I27 A;  1HW5 A;  4FT8 A;  4B09 A;  4OIN F;  1LDJ A;  4LG0 B;  2M8E A;  2R3S A;  5D5X B;  4WXD A;  1O3R A;  1W7P A;  1XGS A;  2LSO A;  3WTY C;  5EEG A;  3FM3 A;  3KP6 A;  5CVI A;  1HW2 A;  3F8M A;  5BS6 A;  4YII A;  1O3S A;  5CVV A;  5LGU A;  1I6X A;  1YG2 A;  3BRO A;  4JQF A;  4Y13 A;  4IVN A;  2DQR A;  2LDU A;  3C7J A;  1O7L A;  1GVJ A;  2ZBK A;  2NRA C;  1YS7 A;  3DEU A;  2HS5 A;  1K7A A;  2L01 A;  1TLH B;  4KMF A;  3T1B A;  4HLY A;  1I5Z A;  1EH6 A;  1LJ9 A;  1WSU A;  3E6B A;  5L3B A;  3RKX A;  3I64 A;  2LKP A;  4XRF A;  4G8X A;  4OIR F;  4HYE A;  2DLL A;  3L9F A;  3QRF F;  3GZ5 A;  4HDV A;  1P2F A;  1Z7U A;  3ELK A;  3DP7 A;  3TKY A;  2OU2 A;  4LB6 B;  3QPH A;  4UVB A;  3FWE A;  2LF7 A;  3H3Z A;  2E1C A;  1BI1 A;  1ZG1 A;  4LMY A;  3VFZ A;  1LVA A;  3HRS A;  5FO5 A;  1ZGA A;  3HIF A;  2V1X A;  1PP8 F;  2EWN A;  3JAM Z;  2M5W A;  3R4K A;  2PN6 A;  4RGX A;  3IC7 A;  4PGG A;  4P55 A;  4LLN A;  3KEQ A;  1X3U A;  4EGZ A;  1PDN C;  1S7O A;  1JHF A;  3WGI A;  2DT5 A;  5ERI A;  5H6R A;  3F6V A;  5LBQ A;  4FHT A;  3D0S A;  3M9A A;  2JZY A;  5FFX A;  1OYW A;  2WC2 A;  1MJB A;  1K6O A;  3JSP A;  1IN6 A;  3RKY A;  2G7H A;  2GXB A;  4YFK F;  2EA2 A;  1ZHF A;  2IA2 A;  1W5S A;  2EV6 A;  2A07 F;  3WE2 A;  1YW9 A;  2M45 A;  1R1V A;  1J5Y A;  2MC3 A;  3FMR A;  3K1N A;  3KZY A;  1WKM A;  3OOP A;  5K5O A;  5BPD A;  3ISP A;  3IRR A;  3GUD A;  2DK5 A;  2JPB A;  2P5V A;  3EDP A;  4MGR A;  5FD5 A;  1R5G A;  5DCF A;  2FEZ A;  1Z05 A;  1U5T A;  5E1X A;  2F5C A;  3EQL F;  3V7C A;  4WXH A;  1DP7 P;  5DCM B;  4G6Q A;  3ABU A;  3DFG A;  2MLG A;  4ESJ A;  4MEX F;  4LJZ F;  3HYI A;  3CUQ A;  4A2U A;  2FNP A;  1IZ1 A;  1USS A;  1IN5 A;  1FC3 A;  3ML6 A;  2XUB A;  3DPL C;  4BHB A;  4KFC A;  2L54 A;  3ZQ7 A;  2VOO A;  1U3E M;  1OMI A;  3O6B B;  2LF8 A;  1XSV A;  1LB2 A;  1FYL A;  3KE2 A;  4P5O A;  3GVA A;  1UHM A;  1I1G A;  2E7X A;  3TGN A;  4G7Z F;  5DV5 A;  2IPQ X;  1TQP A;  3W6J B;  1E2X A;  4GO1 A;  3U1D A;  4BYY A;  3E5Q A;  4MTD A;  2L3D A;  3Q9V A;  2Q2E A;  2FOK A;  5FLX K;  4H0E A;  4GYG A;  4EJO A;  3SFZ A;  3DF8 A;  3BDD A;  1XSX A;  3QP5 A;  1P4X A;  3KLN A;  5AIP A;  2A68 F;  4M6Y A;  4UUV A;  5HVQ C;  5JI6 A;  4WX9 A;  2VT2 A;  2TDX A;  4NHJ A;  1CGP A;  4Q4Z F;  1F1Z A;  3HHH A;  5DUK A;  5FFZ A;  1KYW A;  5FLX Z;  3BZ6 A;  1ZRE A;  2EA4 A;  3WTX C;  2PLY A;  1SFX A;  4G7H F;  4ENM A;  3P9I A;  4HZF A;  2Y75 A;  1TW3 A;  4EGY A;  3RKW A;  5L3E A;  2W85 A;  5J8F A;  3JTH A;  4WCG A;  1UHW A;  4OOI A;  4BQA A;  3ZMS A;  2K02 A;  4M9Z A;  3D5L A;  4M73 A;  1YW8 A;  4BXU A;  2V6C A;  1H9T A;  3ZN1 A;  1I1S A;  2L02 A;  2LNB A;  4G94 A;  5D5W B;  2Y48 A;  2YU3 A;  2HGC A;  1IAW A;  3G3Z A;  5CJ9 A;  2QUF A;  4G6D A;  1BI0 A;  4CIC A;  4AWX B;  1K78 A;  1H0M A;  1HXD A;  2HQN A;  2H6B A;  3BWG A;  4OU0 A;  2XKO A;  4L0Z B;  2A5Y B;  2P4W A;  3PFI A;  3SZP A;  2HFH A;  4CXF A;  4EM0 B;  6PAX A;  4HA8 A;  5D6E A;  3I4P A;  4N9H A;  3P9K A;  1B9N A;  4UV8 A;  4MEY F;  1IXS B;  4NQW A;  3HSR A;  3NRV A;  5F1R A;  4FX4 A;  3O3K A;  5TJJ A;  2M30 A;  2ZNY A;  2HKX A;  4BH9 A;  2EFO A;  2JTV A;  3Q5F A;  1HKT A;  2FBI A;  1UB9 A;  3QPT A;  1TW2 A;  1FNN A;  5EEH A;  1EH8 A;  1Q1H A;  4KYW A;  2V79 A;  4PCQ A;  1U78 A;  1XN7 A;  4MQV A;  3F8F A;  2DU9 A;  2H27 A;  4I7H A;  4ZYH A;  2XRN A;  2XAH A;  5CLS A;  5DDG A;  3J81 Z;  3WGG A;  2HDC A;  5LEK A;  2W84 A;  3ZMT A;  4M6X A;  4ZZD A;  3FZV A;  5E20 A;  1BI2 A;  1XCV A;  1MD0 A;  4S04 A;  4EJU A;  5LHH A;  1S8N A;  1G4D A;  3RJP A;  2EFW A;  4EV0 A;  2HR3 A;  1SD4 A;  1YS6 A;  2A61 A;  3F21 A;  4MNU A;  2RDP A;  2JRT A;  3CUO A;  2UWM A;  3GLX A;  2GAU A;  2F5E A;  1P6R A;  3CO7 C;  4ON0 A;  1F5T A;  3FXQ A;  5JR3 A;  2DFI A;  1RUO A;  3KP4 A;  3MQ0 A;  2XRO A;  5ILV A;  3LFK A;  2RKH A;  4F7Z A;  4G9Y A;  3CUQ B;  1B9M A;  3RIR A;  1S3J A;  1FX7 A;  3KLO A;  4S05 A;  4CHU A;  2RN7 A;  4QWQ A;  4EQQ A;  3J7A O;  3ECH A;  2COM A;  2E7W A;  2BBY A;  3T8T A;  2XAS A;  1E17 A;  3U9G A;  5LGT A;  1KU9 A;  2YPR A;  2VE9 A;  1SMY F;  2P6S A;  1O7F A;  3GFL A;  2ETH A;  3L7W A;  1FSE A;  3K1M A;  1BC7 C;  1FOK A;  3I5U A;  1R36 A;  4LD5 A;  4N9I A;  1F4K A;  1P4W A;  4G7O F;  5ICG A;  2FSW A;  1IW7 F;  2XAJ A;  4A5N A;  2OZU A;  1RNL A;  1UST A;  2CQK A;  3EUH A;  1ZN2 A;  2ISZ A;  3HOT A;  2R7D A;  3C18 A;  1MKM A;  3COA C;  2KJC A;  1QBJ A;  3W6K B;  2F2E A;  3HSE A;  2EFP A;  1T0F A;  1XD7 A;  1OKR A;  2XHK A;  1TQM A;  3ZMD A;  4M71 A;  4L0Y B;  4TV7 A;  4YIF A;  4WWC A;  1W5T A;  5HLG A;  1FT9 A;  3FM5 A;  2STW A;  2HQR A;  3VOD A;  2EB7 A;  3KZZ A;  4EJW A;  3F8B A;  1ZGJ A;  4U7D A;  2JSC A;  4KN4 X;  2E1N A;  2MD5 A;  1KU7 A;  2EV5 A;  3WTU C;  4L18 B;  3SQN A;  2O03 A;  1C0W A;  4DQ2 A;  1STZ A;  4JBA A;  4L9J A;  1AOY A;  4RGR A;  1HQC A;  3FXR A;  3ZMV A;  1ONV A;  2FE3 A;  1ZG3 A;  2ISY A;  2D45 A;  4WXC A;  4M72 A;  1S7A A;  2AXL A;  5F64 A;  2HKO A;  2PG4 A;  2WTE A;  1WWX A;  3T0Y A;  1MGT A;  4A6D A;  2X0L A;  3O2P E;  1YW7 A;  2Z9O A;  5LEJ A;  1XMK A;  1OYY A;  5BPI A;  1B1B A;  1TNT A;  4UHT A;  2IJL A;  4UNO A;  3REO A;  5E18 F;  4IRH A;  1IXR C;  1RZ4 A;  3CLO A;  2GZW A;  1GXQ A;  2DW4 A;  5D4R A;  2FU4 A;  2NNY A;  4I0A A;  4FX0 A;  3HTU A;  4Y17 A;  2Q0O A;  3QP6 A;  3BJ6 A;  3R6S A;  4L9T A;  2P7C B;  2IT0 A;  1BIA A;  4RAZ A;  1TBX A;  3V8L A;  3J80 K;  1SFU A;  4R1H A;  2GA1 A;  3WTS C;  2HYG D;  3HTS B;  3LA3 A;  5D6F A;  1BIB A;  4HLX A;  5HS8 A;  2QQA A;  3F23 A;  3EYY A;  4LK0 F;  1H9G A;  1REP C;  2OA4 A;  1G3S A;  2ZJ2 A;  4HF2 A;  4UVA A;  3I53 A;  1TQI A;  2HWV A;  4UXN A;  2UXX A;  3RPQ A;  3TOA A;  1ZAO A;  1WRJ A;  2W24 A;  2ZNZ A;  5DCM A;  3DKW A;  3E5X A;  1ZAR A;  3ZMZ A;  1T6S A;  3E3V A;  1GHC A;  3C3W A;  3C1D A;  5FB2 A;  4Q48 A;  4ASN A;  2W57 A;  4BNC A;  2XVC A;  1V3F A;  3IKV A;  1JGS A;  3B73 A;  1JXS A;  3WU0 A;  4KIF A;  3FMQ A;  3J81 K;  5TRD A;  2QEN A;  4HF0 A;  4RGS A;  5HS7 A;  2IVM A;  1LDK B;  2ESN A;  3EYI A;  1S29 A;  5FGM A;  2FML A;  2O8X A;  4A6E A;  2BGC A;  2HEO A;  3KCC A;  2QBY A;  1T38 A;  3VEP A;  3P9C A;  1SAX A;  2FMY A;  1ON2 A;  2IP2 A;  2PBI A;  2VBY A;  4AVP A;  3JTG A;  5BMZ A;  3T5X A;  2F5F A;  4BHP A;  5J6X A;  4ETS A;  5D5V B;  1SFE A;  1IN8 A;  4P9U A;  4ZZL A;  1A04 A;  4MQ9 F;  4HOB A;  2VN2 A;  3I0T A;  1IRF A;  3NQO A;  3IL2 A;  1J2X A;  1YQA A;  5CVR A;  1XDU A;  2JT1 A;  5LHG A;  2YSR A;  3EET A;  1DPR A;  4LB5 A;  2A6H F;  2ZFW A;  1B4A A;  1FLI A;  1MZB A;  2OQR A;  5K5Q A;  2MH9 A;  3MAJ A;  3E97 A;  2NYX A;  1U2W A; 
#chains in the Genus database with same CATH topology
 1I3Q J;  1OLT A;  2M4K A;  3Q0V A;  3DCF A;  4IEJ A;  2KIM A;  2OD5 A;  3WU2 C;  3BR3 A;  2CW8 A;  4IHS A;  3IAM 2;  2X6W A;  3AL0 B;  2XAF A;  2F6C A;  5F27 A;  3RTR A;  3HGY A;  4UUT A;  2CU7 A;  5FLM J;  3HOS A;  4LLG F;  2O0Y A;  2P8T A;  1UJ8 A;  3K4K A;  3JRB A;  3OR2 C;  2K27 A;  1X3Z B;  2DQL A;  2DOA A;  3H5R A;  1UFM A;  4BQN A;  1B8I B;  4AID A;  1FSH A;  1QZE A;  2PEX A;  1G2H A;  1W1W E;  3WHB A;  2CUE A;  3QPL A;  3OYF A;  4BU2 A;  4BXF A;  2JMW A;  2KIQ A;  2UV1 A;  2L7M P;  4O6J A;  1NTC A;  4LFU A;  1U8R A;  3U2R A;  1CF7 A;  2CFX A;  2XRL A;  5HOO A;  1SFO J;  2HTS A;  3QU3 A;  3A01 A;  3CMA I;  2ECC A;  3LA7 A;  4PDK A;  1LEA A;  2BE5 F;  5IP6 A;  1LE8 B;  2ME6 A;  1AWC A;  1BBY A;  1F9N A;  1YTY A;  2LFB A;  1EA3 A;  4HV6 A;  3JSO A;  2RNJ A;  1O57 A;  5IT3 A;  3F72 A;  3KP7 A;  3JAM K;  5EF6 A;  2H94 A;  1YYV A;  2XF6 A;  1JE8 A;  2NVX J;  1ZLK A;  3JCU C;  2IGM A;  1TT0 A;  3ZMU A;  1WQ2 A;  2H1K A;  4GGG A;  1Z6T A;  2CFO A;  3AAF A;  4JYK A;  2VT3 A;  4Y4R A;  1MMN A;  4M3F A;  1L0O C;  4UVC A;  3H0G J;  2H09 A;  3M8E A;  4N0B A;  2GQQ A;  3IWZ A;  5KK1 A;  4BXX J;  3ZQG A;  1N75 A;  3GCM A;  3S17 J;  1X2N A;  3R0A A;  3K6G A;  3H35 A;  1IRG A;  1TZL A;  3TO6 A;  3MFK A;  1YFH A;  1V4R A;  2VC1 A;  1SEU A;  2B0L A;  1IF1 A;  5BNG A;  4FTH A;  1WHU A;  2LY9 A;  4I09 A;  4PJM A;  4E6K G;  2DI3 A;  3ULQ B;  2R7W A;  4IHX A;  2DT6 A;  2D1H A;  3D5R C;  4Y52 J;  3S16 J;  4OMZ A;  4C3H J;  2HOE A;  5HLH A;  3GO5 A;  3V7S A;  3F8C A;  1KQ9 A;  4BUP A;  3WTZ A;  4JK1 X;  1R6R A;  3Q9S A;  1Z1D A;  4ZDL A;  3FHZ A;  1KYZ A;  3IV5 A;  2Z33 A;  5IT9 Z;  2X9D A;  1SMT A;  4KDP A;  4LG0 A;  1G6N A;  3ERE D;  1D0Z A;  2IAI A;  1U6G A;  4XSZ F;  4A3I J;  1B59 A;  2DA1 A;  3M8F A;  3KPH A;  2OBP A;  2W4S A;  1BN5 A;  1AU7 A;  1CF7 B;  2E71 A;  2DBB A;  2M4G A;  4L5I A;  2FQ3 A;  1KON A;  2EFN A;  2MLK A;  4IXA A;  5IP9 J;  4ZYD A;  3GFI A;  1J59 A;  1YI2 I;  4Q5S F;  3CCR I;  3AFH A;  1BJA A;  4XSX F;  2JWT A;  3A03 A;  4RAY A;  2OQG A;  3G4S I;  1FMV A;  2Z3Y A;  3FK6 A;  3HKZ A;  3MD2 A;  2PMU A;  1T39 A;  2QF7 A;  5IT9 K;  4B44 A;  1JKP C;  4M3E A;  3SHF A;  2KHM A;  2XSJ C;  1LFB A;  1GUU A;  4EVI A;  5L3D A;  4UB8 C;  1HKQ A;  2JRM A;  4ESB A;  4IHW A;  1HC8 A;  1S72 I;  3FBN B;  2DDB A;  2EZL A;  3I54 A;  5A2Q K;  3FBI B;  1K4S A;  2G9W A;  2M87 A;  2AO9 A;  4PGH A;  2E5Z A;  2G7U A;  4XIC A;  2VOD A;  1WFX A;  3I58 A;  1Z6R A;  2CV1 A;  3ZOB A;  2VBX A;  2EZH A;  2LBF B;  2Q8K A;  1ZRF A;  3PO2 J;  3V42 A;  1TT5 B;  2JN6 A;  2E19 A;  5H20 A;  1ON1 A;  5K7F A;  3J80 Z;  1R00 A;  1QPM A;  5LHI A;  4U88 A;  2L2O A;  5LRR A;  3ASO H;  4B48 A;  1I50 J;  3IKT A;  3S3N A;  3I71 A;  3LSJ A;  1A6I A;  1MJ9 A;  5GAG J;  3DQV C;  2W82 A;  3HDD A;  2EIN H;  3H1C A;  1E3P A;  1SD5 A;  1KU3 A;  4II2 A;  3K69 A;  5HNF A;  4XN0 A;  1G3W A;  4I01 A;  2J5P A;  1QGP A;  1R22 A;  2WWY A;  2HZD A;  5B66 C;  3AL0 C;  2QWW A;  4PJJ A;  1EV7 A;  4XRS G;  1VQN I;  4PZJ A;  3LWF A;  4C9Y A;  4CYD A;  3P5J A;  4XK4 A;  4PJ0 C;  4K2E A;  2P7V B;  2VI6 A;  2MA3 A;  2PMZ A;  2ELJ A;  5CVU A;  5D8L B;  5IP7 J;  1G3T A;  4HX4 A;  4AM3 A;  1OCP A;  3CMM A;  2GA2 A;  2VBZ A;  2EV0 A;  4IQJ A;  5FKK A;  1LVK A;  3MKY B;  3OYL A;  5ICE A;  1R1T A;  3L2W A;  4XKW A;  1XTA A;  4UV9 A;  5K7Z A;  3G73 A;  2L9S A;  4A3J J;  3JRE A;  3N4M A;  4HX8 A;  4LLL A;  3BZK A;  1TWC J;  2ME0 A;  4RLF A;  1J7K A;  5CKT A;  2VE8 A;  4R8H A;  2VJ4 A;  2DYR H;  2X1E A;  1XSD A;  3DBR B;  5F04 A;  2W25 A;  2DA6 A;  2WAF A;  2XGC A;  3L2U A;  2VOP A;  2ZFU A;  1S9H A;  2V1D A;  2E2J J;  3N05 A;  1FY7 A;  2M0C A;  5FKO A;  5J1U A;  3BG5 A;  2YX7 A;  1OYI A;  1MDM B;  2QBY B;  1U5T B;  3HOZ J;  2Z99 A;  1JHH A;  1Z7L A;  4I02 A;  3PNY A;  4IRG A;  2I8D A;  3N97 A;  2D1V A;  4WF2 A;  3W2W A;  3M3Y J;  4HBL A;  3RKQ A;  3JRA A;  4KUM A;  1K61 A;  1Y8Q B;  1XB4 A;  3OV8 A;  2X4H A;  3BOQ A;  3I56 I;  1VND A;  2Z2S B;  3V8J A;  4A3D J;  4GYI A;  4F93 B;  2L7F P;  2XV4 S;  1XPX A;  4PFO A;  1Y0U A;  4IL6 C;  4A5M A;  1ACI A;  1Z91 A;  2TRT A;  2K5C A;  2CG4 A;  3OYC A;  2VKH A;  3VWB A;  1SD6 A;  1T95 A;  2IGO A;  3D5S C;  2HZT A;  1BOA A;  3CDH A;  2ZJR F;  1VI0 A;  3RSN A;  1NHA A;  1BM9 A;  2ZXJ A;  5IYB J;  2X51 A;  4Z6Y A;  3LAJ A;  3OR1 C;  2AQE A;  2KIU A;  1RPW A;  4MFE A;  1YLF A;  3G1L A;  4MTE A;  2VKD A;  2VJI A;  3Q0W A;  2VIX A;  2DA5 A;  5E1W A;  4ZYA A;  1D3Y A;  2J5O A;  3BC8 A;  5HLI A;  1HDD C;  5ICF A;  3KET A;  5CQG A;  3SEZ A;  3S1M J;  1IN7 A;  2BW3 A;  1ZLJ A;  4XBF A;  3ZGK A;  1D8K A;  2EH3 A;  2R4G A;  2EPF A;  1P92 A;  3GX4 X;  1U9N A;  2XAQ A;  1XX5 A;  1MND A;  5DYM A;  4ZYG A;  2ICW G;  1VQ8 I;  3OIQ A;  1HST A;  3CC4 I;  1X3W B;  4BL0 B;  1VFC A;  3GTQ J;  2RQP A;  1YHQ I;  3F6O A;  1YIO A;  3I59 A;  3GXO A;  3WTT C;  3LFU A;  1UEL B;  3DEW A;  3LSP A;  2DXI A;  2R7S A;  5DUI A;  4MFD A;  2GIV A;  2F48 A;  2GBY A;  1IO2 A;  4ZJZ A;  4F91 B;  4XKC A;  4J00 A;  2WV0 A;  2OCC H;  1ZRC A;  2NNN A;  1Y8R B;  1YRN B;  2K4J A;  1QPI A;  2CV0 A;  3MZH A;  3KP3 A;  2XB5 A;  4B8X A;  1SD7 A;  1TNS A;  4PSW A;  1FPQ A;  2BYV E;  4ZH4 F;  1Y1V J;  2K9S A;  4HST A;  4BHC A;  2PMH A;  2R7Q A;  3ZN0 A;  5CQE A;  3DU5 A;  1IXC A;  2DTZ A;  2LKX A;  4U7B A;  4ZTF A;  1LQ1 A;  1BC8 C;  4CDG A;  3BR5 A;  4NC7 A;  1R58 A;  2CQQ A;  3NEU A;  5H2F C;  1X1P A;  1H8A C;  1GT0 C;  4HV5 A;  2DPD A;  2ZKZ A;  5J47 A;  3S3O A;  3IHU A;  1RI7 A;  5EZH A;  2VQG A;  3S1N J;  5KVR A;  4P9F A;  4BJ6 C;  5K1Y A;  5FRM A;  3OYD A;  4XRM A;  1YE9 A;  1JT0 A;  3CJN A;  2P5K A;  3H5A A;  4EM2 A;  3FHN A;  3CO6 C;  1R5I D;  1O3T A;  4A0Y A;  3TL4 X;  4JP0 A;  3S32 A;  4I0B A;  2L5Q A;  2GWR A;  2ZXH A;  3ABT A;  4IQ4 A;  1MBK A;  2NXN B;  5IPA A;  1X1B A;  4MIM A;  3O8G A;  3CF2 A;  3ASN H;  4KN7 X;  4XKB A;  4CO8 A;  3OSF A;  2XAG A;  2L4A A;  2BY2 A;  3PNV A;  2A69 F;  4AIJ A;  4E70 A;  4IF4 A;  1I3A A;  3VYR B;  5D8K B;  2AS5 F;  2DYS H;  3OYI A;  3BPV A;  3L09 A;  3G71 I;  2HYF A;  5KAI C;  4U0W A;  4Y3O A;  4HQM A;  4CCL A;  4CA0 A;  1R23 A;  3GFJ A;  3HOW J;  1XMX A;  1IG7 A;  3K4L A;  1IUY A;  4EMS A;  4IHT A;  5ED4 A;  3BY6 A;  4M3G A;  4BE1 A;  3BP8 A;  1KGS A;  4PUS A;  2Y0M A;  3BQZ A;  1PUE E;  4D5C A;  1N78 A;  2ZC2 A;  3IAS 2;  1W5C C;  3KZI C;  3WHC A;  3K1P A;  4HW0 A;  5L3C A;  2DPU A;  2MBF A;  1XMA A;  1GVD A;  2CRG A;  4QLC U;  1UAA A;  1QHH D;  1XGO A;  4OIP F;  3OMY A;  4IHV A;  4E7Z A;  2QSH X;  1X4P A;  4PSX A;  3G2B A;  2VKV A;  2LRE A;  3H3V K;  3GFM A;  1B72 B;  2W00 A;  2KJB A;  2K86 A;  1OR7 A;  2ID3 A;  1WVR A;  1RUN A;  1LNW A;  4ZTJ A;  5E1Z B;  3SZT A;  2JPC A;  2EQR A;  3HXL A;  3DLA A;  5M5X J;  2FBH A;  2FNA A;  2O61 A;  2HYJ A;  2KKO A;  2XGE A;  3E6M A;  2V7F A;  1TWF J;  1UCR A;  4DW6 A;  1SVM A;  3AG4 H;  3IWF A;  3RYR A;  4CCO A;  1YJ9 I;  5J1Y A;  1D1B A;  3RI4 A;  5B1B H;  2VPR A;  3PQK A;  4DZJ A;  4RB0 A;  1RIO H;  4HAM A;  2QLZ A;  4ESF A;  2QYO A;  2P6T A;  1N77 A;  1XDS A;  3QOD A;  4HNU A;  2PJP A;  2OUM A;  2WAE A;  3HOX J;  1IN4 A;  3DV8 A;  4D9J A;  2QSG X;  3J7A Y;  3CTA A;  1SC7 A;  4DBR A;  1KQ8 A;  1FWZ A;  4XLN F;  1K6Y A;  2RVC A;  4OAZ A;  4B3X A;  4BAY A;  1B72 A;  1P7J A;  2F4I A;  3RYP A;  1TTY A;  2STT A;  5DTD A;  2UZK A;  1SAU A;  2V4J C;  3BJA A;  4FET A;  4BGD A;  2HNH A;  2QEX I;  4GRI A;  3ERM A;  1D8J A;  2E5N A;  1LDD A;  3QAH A;  4ZYE A;  1PP7 U;  1WJC A;  3GZ6 A;  2I10 A;  2Y69 H;  2K9L A;  2KRF A;  1HKS A;  2XF5 A;  3GW2 A;  2VL8 A;  3K4J A;  3HRU A;  4IPA A;  2ADU A;  2RGV A;  1QNT A;  4EJT A;  1MBG A;  1O3Q A;  1HF0 A;  2JSP A;  2ZME B;  3V4G A;  2NVQ J;  3ZR8 X;  3V7R A;  1D1A A;  3E0J B;  4XLP F;  3K4C A;  5HLT A;  3BTI A;  4M9X A;  1QQI A;  1R5H A;  5DS9 A;  1JJ6 C;  5E8G A;  2KFD A;  3LQR A;  3L2C A;  3LQQ A;  3TO7 A;  3S93 A;  1FZP B;  1KQ0 A;  3FXL A;  3M7G A;  4D0P A;  2DTR A;  2OZ6 A;  3RPU A;  4E7H A;  2FXA A;  1VTN C;  3KYC B;  1I6H J;  1T8I A;  1W7P D;  4A3M J;  2ACJ A;  4OIO F;  2LR8 A;  3ZQF A;  4H4K C;  4BBR J;  4YG2 F;  4KMU X;  2P5L C;  4AC0 A;  3FKJ A;  3TDZ C;  5J1R A;  2EIM H;  3H3U A;  2CJJ A;  4ANJ A;  4IJA A;  4KA4 A;  2QM3 A;  1YX5 A;  2ID6 A;  2O7O A;  1BI3 A;  3E5U A;  4A3E J;  3OYE A;  3MN2 A;  2IA1 A;  5EEA A;  2BZT A;  2IRF G;  3BT9 A;  4NQW B;  2WAD A;  3R0J A;  1ZRD A;  3RZO J;  3M1C A;  1PVE A;  3FXJ A;  1ETW A;  1WGX A;  3TOB A;  4R79 A;  4GXO A;  4M9S A;  3CDL A;  2HVS A;  2WY8 Q;  2HVQ A;  3HPG A;  2K7L A;  4CH7 A;  2DAO A;  2A6E F;  3L00 A;  2O6G E;  1TC3 C;  4EJV A;  4GCV A;  5IOZ A;  3K9T A;  2UUZ A;  3BJO A;  3WOD F;  2RQQ A;  3R61 A;  4N4O B;  4ENK A;  3C2G A;  3GBG A;  3AG1 H;  1XGN A;  2MH2 A;  5CVJ A;  2LKS A;  1G8X A;  1LEB A;  1WJB A;  2FRH A;  5DD4 A;  1WJF A;  3M07 A;  5KHD A;  3QOP A;  3MCZ A;  3E6C C;  3OIO A;  1BR4 A;  3I59 B;  3VYT B;  2FA5 A;  3L1P A;  2E34 A;  4PK4 A;  5JFR A;  2KIF A;  3CQZ J;  1J9I A;  2KL4 A;  5TGT A;  1FOW A;  5HDG A;  2CGP A;  2A3S A;  1BA5 A;  3QPS A;  3LAP A;  1IV6 A;  4HX7 A;  4OIQ F;  2QZ8 A;  3I4M J;  3S2H J;  2CWE A;  1KU2 A;  4FCY A;  1D5Y A;  3S2W A;  4UUS B;  2XKP A;  3JW4 A;  2PI0 A;  2ZO4 A;  2DK8 A;  2OJE D;  3MEX A;  2XPV A;  4YEL A;  5K5R A;  4RB2 C;  1S7E A;  2CUZ A;  2KRC A;  4O5V A;  5D4S A;  3PUF A;  3V8K A;  3JR9 A;  4OMY A;  3GF2 A;  5ILS A;  5F6F A;  2CV2 A;  3LOC A;  4U0V A;  3MZY A;  5LGN A;  1D5V A;  2M2E A;  3SFI A;  1HBX G;  4C2T A;  4C3I J;  2IGK A;  4XON A;  2B9S A;  5C44 J;  1YJN I;  1QVU A;  2ZCW A;  2DJI A;  1VQK I;  2HTJ A;  2E1O A;  3ABK H;  4NBQ A;  4U0Y A;  2RC4 A;  5ICC A;  3TW7 A;  2NOG A;  2QQ9 A;  2E2H J;  2WAQ N;  1QZY A;  1FBU A;  2L4M A;  4XQF A;  3G6E I;  2BY3 A;  2YUS A;  1BJZ A;  2M1B A;  4I99 C;  4LGW A;  1ZH5 A;  1X2M A;  1FBS A;  3E6D A;  3WU1 B;  3ROU A;  4D7M A;  3M1E A;  4HF1 A;  3MWM A;  2VON A;  2ZME A;  1FBQ A;  3HSF A;  2XGD A;  5E17 F;  1DUX C;  2EK5 A;  4AYB A;  5J4V A;  2CO5 A;  4D7N A;  3OYB A;  1HSJ A;  4I98 B;  2VLA A;  1UMQ A;  4IOC F;  2R7X A;  1WH7 A;  3ABM H;  1Z9C A;  1S5L C;  1D0Y A;  4MHG A;  2LG4 A;  3FX3 A;  4RB1 A;  3OL3 A;  3TQN A;  3CCL I;  2R7T A;  1KA8 A;  5ILU A;  3A0B C;  4I2O A;  3A2K A;  3FXK A;  3TDU C;  2YR2 A;  1FIA A;  3FXU A;  5FKN A;  1ZEL A;  5DD8 A;  3HRM A;  4IO9 F;  3SYT A;  2GOM A;  4BS9 A;  3ZQQ A;  5BQT A;  3OYM A;  4IRI A;  1FIP A;  2CQX A;  4XID A;  2CYY A;  1A5J A;  4ENJ A;  4A0Z A;  2PQ8 A;  3CDI A;  4X1E A;  3ZPL A;  2QVO A;  4B47 A;  3H92 A;  5A2Q Z;  3OS1 A;  4L5J A;  2VBW A;  3KIO A;  5L3G A;  3OS2 A;  2UXN A;  2IA0 A;  4C30 A;  3TMO A;  2VPL A;  1W7P B;  2Z5U A;  4I76 A;  4KIG A;  3ECO A;  3HKZ N;  1A36 A;  2PMZ N;  1H88 C;  1P4A A;  2ELH A;  2K40 A;  2V1N A;  1B6A A;  3BTL A;  2QQB A;  3BPX A;  2TCT A;  1GXP A;  4LK1 F;  5J8C A;  3LSI A;  1W4M A;  2ZXI A;  3GEZ A;  2OAZ A;  4KT5 C;  3SZG A;  3CCM I;  3S3M A;  1WJE A;  2EJR A;  3LA2 A;  3MMY B;  2FBK A;  3JRC A;  1ETO A;  4Y15 A;  3HG9 A;  4F3Q A;  5GTH C;  4CYC A;  2OV7 A;  3BG9 A;  4AIK A;  4AD9 A;  5GPA A;  3K2Z A;  3F8N A;  1T56 A;  2YX4 A;  1MNM C;  2KLO A;  1HLV A;  2K9M A;  4A0X A;  2FF4 A;  4RB3 C;  4A12 A;  2Y0S N;  1DDN A;  4B1R A;  4F92 B;  5BOX A;  4M74 A;  2DFE A;  3VB2 A;  2HPI A;  4ABZ A;  1X1A A;  3HHG A;  2LP0 A;  3KYL A;  1BL0 A;  3FF5 A;  1S6L A;  4DOZ A;  3QU6 A;  2PJR B;  4C2M J;  2ZJQ F;  3KP2 A;  5F0H A;  1JTX A;  3EUK L;  1MJA A;  3A0H C;  1DPU A;  1HW1 A;  2C6Y A;  1F43 A;  3R60 A;  1QZZ A;  1K78 B;  1XCB A;  2YS9 A;  3HGG A;  3VOE A;  1T98 A;  4V2G A;  3BG3 A;  3ZP5 A;  1J75 A;  4YFN F;  2K9Q A;  2XIG A;  4RS8 A;  3OSG A;  1QO0 D;  4CZZ A;  3JRG A;  2LD5 A;  4CCM A;  1FYK A;  3PQJ A;  4DNC A;  5AON A;  5JHU A;  1EKE A;  3CP8 A;  5AIQ A;  5JVT A;  3FMS A;  1LUJ B;  3H0D A;  2BXZ A;  3WTW C;  3WGH A;  3GYH X;  1VQ7 I;  2VQL A;  1TWH J;  3K0L A;  5HS9 A;  4A69 C;  4EM1 A;  5KAF C;  2IS6 A;  1G3Y A;  2BV6 A;  4KNY A;  4ENN A;  2XGX A;  2O3F A;  3QQA A;  2H1L A;  3KP5 A;  5HDK A;  5J4Y A;  1ORK A;  1VQO I;  3CF5 F;  1MBE A;  3FKI J;  1UG2 A;  1H89 C;  3B6A A;  3CUQ C;  3IRQ A;  1FYM A;  2D5V A;  2R7R A;  1JJ8 C;  1MDM A;  4J01 A;  4KIB A;  2V1U A;  1VQ5 I;  2FX0 A;  4IKF A;  4YFX F;  5M3F J;  4XOP A;  4KIC A;  2B7E A;  4W97 A;  2EFQ A;  1WI9 A;  5IOY A;  4MO7 A;  3HBL A;  4FQG A;  3MKZ A;  3K10 A;  1U5T C;  3H5N A;  4NC8 A;  5L3F A;  3J7Y J;  2LOO A;  1T2K A;  1JTY A;  1BR2 A;  1DQU A;  3A1Y A;  5CYV A;  4O3M A;  2F5D A;  3IH4 A;  1VQ4 I;  4CGZ A;  1LPQ A;  5EZG A;  5H6Q A;  4Q47 A;  1OPC A;  2DO7 A;  5EYR A;  3TBI A;  3GTG J;  2XAU A;  3F9K A;  4XLA A;  2NS0 A;  1X1D A;  4BAC A;  3F0C A;  3T8R A;  5FRO A;  4HDU A;  3DEE A;  2NS8 A;  4L9V A;  2M0M A;  3W2V A;  2VC0 A;  2X6X A;  2IS2 A;  3DXJ F;  2PFB A;  3KFW X;  1VQL I;  1WJD A;  5EGO B;  2V9V A;  2ESH A;  1ODD A;  1R7J A;  5DEQ A;  2K4B A;  1ZYR F;  4NUB A;  3DU6 A;  3LST A;  1XGM A;  4M3D A;  1DP3 A;  1ULY A;  2V9P A;  3TO9 A;  1EJ9 A;  2CSO A;  2IW5 A;  2AXT C;  4WK8 F;  1J0R A;  1I39 A;  4P96 A;  2VUM J;  3GWZ A;  5D5U B;  2DJN A;  2VXZ A;  5HDN A;  3U1K A;  5LRS A;  3TED A;  3CCU I;  2GXG A;  4AIH A;  3WG9 A;  3K2A A;  2BEO A;  1JUS A;  2CW0 F;  2X1D A;  1R1U A;  3P7N A;  1MBH A;  4L9N A;  1VQP I;  2KDZ A;  1L3L A;  1Y56 A;  1D0X A;  2H6C A;  2CS3 A;  3K4B A;  3SXY A;  3F22 A;  1ZG5 A;  2E35 A;  2R7F A;  4Z2Y A;  1BW6 A;  3OOU A;  3F3X A;  3BTJ A;  4LG3 A;  4E7J A;  3HRT A;  2ZSH B;  5JVG F;  5LLQ A;  2RV8 A;  2R5Y B;  5FD6 A;  2D2W A;  1EH7 A;  3B02 A;  3HUG A;  5E8I A;  3DKX A;  4HQE A;  1Y1W J;  2VB6 A;  4XOT A;  3OWT A;  3RDI A;  2NAZ A;  3WE3 A;  1WCM J;  4OWR B;  4LIV A;  3QYE A;  4EAT A;  1JKQ C;  1K79 A;  4NB5 A;  1YO5 C;  2BHZ A;  1FP2 A;  3M8J A;  3KEO A;  3HL2 A;  4KIS A;  3H9Q A;  1FP1 D;  2I5U A;  4FE7 A;  5LFA A;  3WTV C;  3DPT A;  4RGU A;  2OF7 A;  2M8G X;  1I27 A;  1HW5 A;  4FT8 A;  4B09 A;  4OIN F;  3BZC A;  1LDJ A;  4LG0 B;  3BCA A;  5TIS C;  2M8E A;  2R3S A;  5D5X B;  4WXD A;  3EUA A;  2XF7 A;  1W7P A;  4E7L A;  1O3R A;  1XGS A;  5DM7 F;  2LBF A;  2LSO A;  3WTY C;  5LD2 C;  5EEG A;  3FM3 A;  1UG0 A;  4M6V A;  3KP6 A;  1QA6 A;  2HDD A;  5CVI A;  5M3M J;  2MGQ A;  1HW2 A;  4B43 A;  3GTK J;  3HZJ A;  3BLY A;  3F8M A;  1W36 C;  5BS6 A;  4YII A;  1YIT I;  3KX2 A;  3IH3 A;  5GAD J;  5C3E J;  1QHG A;  2DA3 A;  2Y9Y A;  2F5V A;  1O3S A;  5CVV A;  5LGU A;  1I6X A;  1YG2 A;  1R71 A;  3BRO A;  4JQF A;  4HG2 A;  2LY2 A;  4CUG A;  4Y13 A;  4IVN A;  1RES A;  2DQR A;  1IDY A;  2LDU A;  3C7J A;  3OY9 A;  4LIT A;  3U21 A;  1O7L A;  2QQ8 A;  3GTL J;  5E3O A;  1GVJ A;  2ZBK A;  1W0T A;  1BR1 A;  1YS7 A;  2NRA C;  2E1M B;  3BR6 A;  1U9O A;  3DEU A;  2HS5 A;  2XPU A;  4C2U A;  1WJ5 A;  1K7A A;  2OTL I;  1MMA A;  2XB0 X;  2N8G A;  2L01 A;  4BQQ A;  1TLH B;  4KMF A;  3T1B A;  2YU9 J;  2M7B A;  3RQ4 A;  1RR7 A;  3VSL A;  1U8B A;  4HLY A;  1I5Z A;  3HM5 A;  1EH6 A;  1WH5 A;  2K85 A;  1R49 A;  4F55 A;  4XLF A;  1LJ9 A;  3KYD B;  3I4N J;  2VXD A;  2KP6 A;  2L7Z A;  2MW8 A;  1WSU A;  4RAG A;  3E6B A;  2HPM A;  1MMS A;  5L3B A;  3RKX A;  3I64 A;  2LKP A;  4XRF A;  4G8X A;  4OIR F;  1FMW A;  4HYE A;  2DLL A;  3L9F A;  2L9V A;  3GZ5 A;  3QRF F;  4HDV A;  2DOF A;  1FOY A;  2JA5 J;  1P2F A;  1Z7U A;  3ELK A;  1UZC A;  3DP7 A;  3TKY A;  2OU2 A;  2DA7 A;  4LB6 B;  3QPH A;  2K3P A;  4UVB A;  3FWE A;  3G1M A;  4LOC A;  2LF7 A;  3H3Z A;  2E1C A;  1BI1 A;  1ZG1 A;  2X85 A;  4LMY A;  3VFZ A;  1LVA A;  2Y31 A;  1NK3 P;  3HRS A;  5FO5 A;  1ZGA A;  3HIF A;  4KT6 A;  2Q2E B;  4E7S A;  3ZQL A;  1MH3 A;  3E7L A;  2V1X A;  1PP8 F;  2EWN A;  2E2I J;  3OS0 A;  3JAM Z;  2M5W A;  3R4K A;  2PN6 A;  2GLO A;  1JUP A;  3GZN B;  4RGX A;  3IC7 A;  4PGG A;  4XR6 A;  4BEH A;  4P55 A;  3PFY A;  4LLN A;  2V6E A;  3KEQ A;  4L5E A;  1X3U A;  3A02 A;  1T08 B;  4EGZ A;  1S7O A;  1PDN C;  1JHF A;  3WGI A;  1K83 J;  4X6A J;  1NG7 A;  2V26 A;  2DT5 A;  4RAF A;  2LVS A;  5ERI A;  5H6R A;  3F6V A;  5LBQ A;  2MSY A;  4M3B A;  4FHT A;  1PUF A;  3D0S A;  3M9A A;  4QPQ A;  2JZY A;  5K7H A;  5FFX A;  2HXO A;  3G1O A;  1OYW A;  2WC2 A;  1MJB A;  1K6O A;  3HJE A;  3JSP A;  1IN6 A;  5J3L A;  2NVU B;  3RKY A;  2G7H A;  2GXB A;  2E60 A;  4YFK F;  4CCK A;  1XS9 A;  2EA2 A;  3TW6 A;  1ZHF A;  5CPR B;  2IA2 A;  3DBL B;  4E7K A;  1W5S A;  1ZTR A;  2EV6 A;  2RNG A;  3TP0 A;  2A07 F;  1V55 H;  3WE2 A;  1YW9 A;  2M45 A;  1HCR A;  2DMU A;  3BG7 A;  1R1V A;  2W7N A;  1J5Y A;  2MC3 A;  3FMR A;  3K1N A;  3KZY A;  1WKM A;  3OOP A;  5K5O A;  1FTT A;  5BPD A;  3B6C A;  3ISP A;  3IRR A;  3GUD A;  2NVY J;  3S14 J;  3CCE I;  4YRV A;  2BVM A;  4JX5 A;  2DK5 A;  2NS7 A;  2JPB A;  2P5V A;  3RQI A;  3EDP A;  4MGR A;  5FD5 A;  1OCC H;  5FRN A;  4Y33 A;  1R5G A;  1DU0 A;  1HOM A;  1QVT A;  5DCF A;  2FEZ A;  2DA4 A;  3H36 A;  1Z05 A;  1U5T A;  3PJR A;  5E1X A;  4XRS A;  3ESW B;  2F5C A;  3EQL F;  3V7C A;  4DBQ A;  3VSK A;  4WXH A;  3L2V A;  1DP7 P;  5DCM B;  4G6Q A;  2QGU A;  4HNT A;  2JA6 J;  3ABU A;  1YIJ I;  3DFG A;  2MLG A;  4ESJ A;  4MEX F;  1WZ2 A;  4LJZ F;  3SJM A;  3HYI A;  5EDN A;  3CUQ A;  1OCR H;  4A2U A;  3S1R J;  1TL8 A;  2NVT J;  1MMG A;  2FNP A;  3GTJ J;  1ETQ A;  1IZ1 A;  1RKT A;  1IN5 A;  1FC3 A;  1USS A;  3ML6 A;  3CCV I;  2XC7 A;  3CCJ I;  4W1U A;  5C4J J;  2XUB A;  3DPL C;  4BHB A;  1XC5 A;  1Y6I A;  2R5Z A;  4KFC A;  4GFB A;  2L54 A;  3ZQ7 A;  4FIS A;  2GM4 A;  2F4M B;  3E1S A;  3NWS A;  9ANT A;  3LMM A;  2VOO A;  2HDW A;  1CQT A;  1Q1V A;  1U3E M;  1OMI A;  2CMP A;  3O6B B;  2LF8 A;  2DMN A;  1XSV A;  1V54 H;  3UR3 C;  4ZDO A;  2Y30 A;  3Q0U A;  5HNH A;  1LB2 A;  3K7A J;  2H8W A;  2BOL A;  2O8K A;  1FYL A;  3ZXS A;  3KE2 A;  4CCN A;  4P5O A;  3CLQ A;  3VPR A;  3GVA A;  1UHM A;  1I1G A;  5M5Y J;  2E7X A;  3TGN A;  4G7Z F;  2RAE A;  1LFU P;  4CYC B;  4BKX A;  2W1O A;  5DV5 A;  2IPQ X;  1TQP A;  3W6J B;  1E2X A;  3LNQ A;  5B5E C;  4E7I A;  1Z21 A;  4UUS A;  4GO1 A;  2M7A A;  4BE2 A;  3U1D A;  4BYY A;  3E5Q A;  1HDP A;  1RET A;  3K4M A;  4MTD A;  2L3D A;  4QSH A;  3Q9V A;  2Q2E A;  2FOK A;  5FLX K;  1HA8 A;  1Y39 A;  2VJ5 A;  4H0E A;  1QU3 A;  4CZC A;  4GYG A;  5FJ8 J;  3C2B A;  4EJO A;  3SFZ A;  2DMQ A;  3DF8 A;  3BTC A;  1MW7 A;  1XSX A;  3BDD A;  3QP5 A;  1D1C A;  1P4X A;  3KLN A;  4RMN A;  4QTR A;  5AIP A;  2A68 F;  1LFP A;  1M1E B;  4XLC A;  4M6Y A;  4UUV A;  2R7Z J;  5HVQ C;  5JI6 A;  4WX9 A;  2DA2 A;  2M3A A;  2VT2 A;  2R5Z B;  3OYH A;  4PJL A;  1GDT A;  2TDX A;  1ZK8 A;  1MNE A;  4BDZ A;  2IS4 A;  4HSR A;  4BY7 J;  1YJW I;  4NHJ A;  1CGP A;  4Q4Z F;  1F1Z A;  3HHH A;  5DUK A;  5FFZ A;  1KYW A;  5FLX Z;  5FKL A;  3BZ6 A;  3X2Q H;  1ZRE A;  1Z67 A;  3OYK A;  2EA4 A;  3WTX C;  2PLY A;  4XLH A;  4I6Z A;  3BR0 A;  1SFX A;  4G7H F;  4ENM A;  3SDG A;  1OCT C;  3P9I A;  4HZF A;  2WA0 A;  2Y75 A;  4LIU A;  5F1J A;  4HEA 2;  4S0H B;  4B4C A;  1MBF A;  2OCE A;  5JLX A;  4KJZ A;  1MSE C;  2X6Y A;  3ONQ A;  1TW3 A;  5J40 A;  4EGY A;  3RKW A;  1PUF B;  2XPW A;  2IS1 A;  5L3E A;  2IBD A;  2W85 A;  2Y9Z A;  1R4N B;  5J8F A;  3JTH A;  4WCG A;  1ZQ3 P;  1UHW A;  1PYV A;  1X58 A;  4OOI A;  4BQA A;  4DGW B;  3ZMS A;  4BY1 J;  2IEK A;  2E1M C;  3EUH C;  3VYU B;  2K02 A;  1TWG J;  4M9Z A;  3D5L A;  2KMU A;  2AHQ A;  4M73 A;  2RRE A;  4D5F A;  1YW8 A;  4BXU A;  2V6C A;  1H9T A;  3ZN1 A;  1I1S A;  2L02 A;  3OIP A;  2KPM A;  4XNF A;  2FOW A;  2G0E A;  3K70 C;  4B3A A;  2LNB A;  4G94 A;  5D5W B;  3S2D J;  2Y48 A;  2YU3 A;  3CME I;  3MVP A;  2HGC A;  1IAW A;  3G3Z A;  2GIZ A;  2LTP A;  5CJ9 A;  2QUF A;  3IH2 A;  1F36 A;  5E3M A;  4G6D A;  3DTE A;  3GME A;  1ETX A;  2Y0S A;  2MD0 A;  1BI0 A;  2L9N A;  4AWX B;  4CIC A;  2HXI A;  1H0M A;  1HXD A;  2HQN A;  1K78 A;  2H6B A;  2BHY A;  1POG A;  2HQ5 A;  3BWG A;  4OU0 A;  2MG4 A;  2Y2Z A;  2ECB A;  1QRY A;  3OYA A;  1MMD A;  2XKO A;  2PJR A;  4L0Z B;  3PIP F;  2DMP A;  2A5Y B;  1RR8 C;  3CCQ I;  2P4W A;  2KRH A;  3PFI A;  1NG6 A;  3SZP A;  1IGN A;  2HFH A;  4G12 A;  3ZQC A;  4CXF A;  4EM0 B;  6PAX A;  2LC2 A;  4HA8 A;  5D6E A;  4RBO A;  4V2F A;  2CQN A;  2OC6 A;  3I4P A;  4N9H A;  3P9K A;  1B9N A;  2W48 A;  4UV8 A;  4MEY F;  1IXS B;  1VF9 A;  4NQW A;  1FJL A;  3JRH A;  3S8P A;  3HSR A;  3NRV A;  1ITY A;  5F1R A;  4FX4 A;  3O3K A;  5TJJ A;  1AA7 A;  2K3F A;  3FIW A;  5F08 A;  2O5R A;  2NOJ B;  2EIL H;  1T33 A;  1MH4 A;  2M30 A;  4Y7N J;  4V19 K;  2ZNY A;  3AG3 H;  2KT0 A;  2HKX A;  3CES A;  3H9G A;  4BH9 A;  3CMY A;  2EFO A;  3DKY A;  1ZR4 A;  2JTV A;  3Q5F A;  1HKT A;  1V5G A;  2FBI A;  1UB9 A;  3QPT A;  1TW2 A;  1KZH A;  1FNN A;  4EEF G;  1T0F C;  1X1C A;  4XLE A;  1EH8 A;  5EEH A;  4HNV A;  1SVO A;  1Q1H A;  4GDF A;  4J19 A;  4KYW A;  2V79 A;  4PCQ A;  3IUO A;  4RLQ A;  1U78 A;  1XN7 A;  4MQV A;  3F8F A;  2DU9 A;  2H27 A;  2LMD A;  1WJA A;  3D1N I;  2HVR A;  4I7H A;  4DYC A;  3SDB A;  1OCZ H;  2EZI A;  4YEJ A;  4ZYH A;  3GTO J;  2XRN A;  1IRX A;  2LYC A;  1W0U A;  1P7I A;  1VQ9 I;  2XAH A;  4X0G A;  5CLS A;  5DDG A;  3J81 Z;  4PJN A;  4JX4 A;  2FD5 A;  3WGG A;  2HDC A;  1VQM I;  3CCY A;  5LEK A;  2W84 A;  2K9N A;  3ZMT A;  4M6X A;  3SEQ A;  4ZZD A;  3PUB A;  3FZV A;  5E20 A;  1SVL A;  3HPH A;  2HOT A;  4XOR A;  1MSF C;  1BI2 A;  1XCV A;  4ZDP A;  1MD0 A;  4S04 A;  3MKL A;  4EJU A;  5LHH A;  3OL4 A;  1S8N A;  2LLK A;  1G4D A;  3RJP A;  2EFW A;  2BVL A;  4EV0 A;  2HR3 A;  4A3G J;  1SD4 A;  2KDO A;  1Z3Y A;  1YS6 A;  4II3 A;  2JA7 J;  2A61 A;  3MZ8 A;  3F21 A;  4MNU A;  2RDP A;  2JRT A;  2Q1Z B;  2A6T A;  3CUO A;  2UWM A;  3GLX A;  4A93 J;  2CUF A;  2GAU A;  2F5E A;  1E3O C;  1P6R A;  3DLL F;  3CO7 C;  4ON0 A;  1F5T A;  2MC4 A;  1OR7 C;  5JHF A;  2R7V A;  1YX3 A;  3FXQ A;  1VZ0 A;  5JR3 A;  1GV2 A;  2MFZ A;  2IGN A;  2DFI A;  1RUO A;  1DU6 A;  1BOB A;  3KP4 A;  1A31 A;  1ETK A;  3MQ0 A;  3DPU A;  4DYQ A;  3GLL A;  4DYR A;  5F0F A;  2XRO A;  1FOX A;  4IX7 A;  3IP4 B;  5ILV A;  1SFK A;  1E3H A;  4CCJ A;  3LFK A;  3FIS A;  4YIR X;  2LK2 A;  2RKH A;  2R5Y A;  1FTZ A;  4F7Z A;  4G9Y A;  3CUQ B;  1B9M A;  3HC7 A;  1S3J A;  2M9H A;  1R4M B;  3RIR A;  4E4H A;  4MLO A;  1V5E A;  2KIS A;  1FX7 A;  2GXA A;  2VQC A;  3KLO A;  5E3L A;  3PIO F;  2P81 A;  3LSM A;  4S05 A;  4CHU A;  2EIK H;  2RN7 A;  3K4N A;  4QWQ A;  4EQQ A;  3LSH A;  2EBI A;  3RPU D;  3J7A O;  3ECH A;  1NH3 A;  2JQ7 A;  2JA2 A;  5GP9 A;  2COM A;  3QWL A;  1BW5 A;  1X4O A;  2DT7 B;  2JJ7 A;  2E7W A;  2BBY A;  3UKG A;  3T8T A;  2BY0 A;  2XAS A;  4XL9 A;  4IOA F;  2X6O A;  1E17 A;  3U9G A;  5EG0 A;  3CJQ B;  3VYS B;  2VAS A;  5LGT A;  4A3F J;  1RRJ A;  1KU9 A;  3BR1 A;  2YPR A;  2VE9 A;  1SMY F;  2P6S A;  4ITV A;  1O7F A;  3CP2 A;  3GFL A;  5FLV A;  4XMY A;  1EF4 A;  2ETH A;  5EJC A;  3L7W A;  1OQY A;  4XKV A;  1FSE A;  4BJT A;  4NNJ A;  4A3K J;  3K1M A;  4A3L J;  1BC7 C;  5JLW A;  4DZP A;  3FXM A;  1FOK A;  5FKM A;  3I5U A;  1R36 A;  3JRI A;  2Z16 A;  4LD5 A;  3PO3 J;  4N9I A;  4U87 A;  1W36 D;  1F4K A;  1P4W A;  4G7O F;  3BCB A;  2FSW A;  4BJ5 C;  1IW7 F;  5ICG A;  4JX6 A;  3LSK A;  2XAJ A;  4A5N A;  1P9Q C;  2OZU A;  3DTI A;  3LSG A;  1RNL A;  3NAU A;  4CSW A;  2PX9 A;  3S1Q J;  4NC6 A;  1GLN A;  1AKH B;  1UST A;  2CQK A;  2P0W A;  3EUH A;  1R9T J;  1ZN2 A;  1IV8 A;  1G59 A;  2ISZ A;  3AKZ A;  1OFC X;  4RM3 A;  3HOT A;  2R7D A;  2WAQ A;  3C18 A;  1MKM A;  3COA C;  4FAS D;  3BR2 A;  2R7O A;  1IDZ A;  2XDV A;  3I9V 2;  2KJC A;  4IZZ A;  2WBM A;  1PJR A;  1QBJ A;  3W6K B;  1LE8 A;  1LKX A;  2R93 J;  2EZK A;  2F2E A;  3L2Q A;  3A4C A;  3HSE A;  1YRN A;  2EFP A;  1ETV A;  1ETY A;  1OKR A;  1T0F A;  1XD7 A;  2XHK A;  1VQ6 I;  1TQM A;  5B1A H;  3UNG C;  3ZMD A;  4M71 A;  3QYB A;  4L0Y B;  2ZSI B;  4HRI A;  2DFF A;  4TV7 A;  2DMT A;  3WG7 H;  4YIF A;  4WWC A;  3GTP J;  1W5T A;  1JKR C;  3TP3 A;  1ENH A;  5HLG A;  2QA4 I;  1FT9 A;  3FM5 A;  5DM6 F;  2STW A;  2HQR A;  4AVZ A;  3FXO A;  1X19 A;  3VOD A;  2EB7 A;  2HI3 A;  1OJL A;  5IYC J;  5F0C A;  3KZZ A;  4EJW A;  3F8B A;  1N25 A;  1ZGJ A;  4NDL A;  4U7D A;  3CD6 I;  4RM2 A;  1RC9 A;  2JSC A;  4KN4 X;  2OTJ I;  3FK7 A;  2A05 A;  1V5F A;  2E1N A;  2E36 A;  5M5W J;  4AYB N;  2MD5 A;  1KU7 A;  2EV5 A;  2DOD A;  3HUG B;  3WTU C;  2DDA A;  2ZXW H;  5HOD A;  4L18 B;  3SQN A;  2M34 A;  2O03 A;  3ABL H;  3HOV J;  1IUF A;  1C0W A;  4DQ2 A;  1STZ A;  1JI8 A;  2LY1 A;  4JBA A;  1JGG A;  4QPO A;  1TP4 A;  2KQR A;  4L9J A;  1JT6 A;  2JVH A;  1AOY A;  4RGR A;  1HQC A;  3FXR A;  3C2H A;  1ONV A;  3ZMV A;  4BE0 A;  2FE3 A;  1ZG3 A;  2R7U A;  3KEY A;  2ISY A;  2D45 A;  4WXC A;  4M72 A;  4A3C J;  1S7A A;  2AXL A;  5F64 A;  2HKO A;  2PG4 A;  3NWT A;  4F52 A;  2WTE A;  2HQA A;  4N4N B;  2HOA A;  4RDU A;  4BBS J;  5GTI C;  1WWX A;  3ZQH A;  4IHY A;  2QCO A;  3T0Y A;  1MGT A;  2MAB A;  3L2R A;  2DN0 A;  2LRD A;  3ZCO A;  1Z0X A;  4A6D A;  2X0L A;  3O2P E;  1GV5 A;  1YW7 A;  2Z9O A;  3CC7 I;  5LEJ A;  2X48 A;  3CJT B;  4JOM A;  3I55 I;  1XMK A;  3CZ6 A;  1OYY A;  3GTM J;  5BPI A;  2JK3 A;  2WV1 A;  1B1B A;  2ELK A;  1TNT A;  4UHT A;  2IJL A;  4UNO A;  3Q3S A;  5GPC A;  3HOU J;  2Z1D A;  3REO A;  2JA8 J;  5E18 F;  4IRH A;  1IXR C;  1WPK A;  5B3S H;  2FQ4 A;  2QSF X;  3CLO A;  1RZ4 A;  3PNT A;  2GZW A;  1GXQ A;  2DW4 A;  5D4R A;  2FU4 A;  2NNY A;  4I0A A;  4FX0 A;  3HTU A;  4Y17 A;  2Q0O A;  3QP6 A;  3BG6 A;  2ZB9 A;  4AU7 A;  3BJ6 A;  1E0E A;  4HPQ A;  3R6S A;  1OIS A;  4L9T A;  2P7C B;  1DGW Y;  5IY5 H;  2JUC A;  2WB1 A;  1IJW C;  2IT0 A;  1BIA A;  3BQY A;  3W2A A;  4RA2 A;  4RAZ A;  5C4X J;  2CQ7 A;  5GAE J;  1TBX A;  3V8L A;  3MKW B;  3QOE A;  1Z3X A;  1SAN A;  2R92 J;  1Y0N A;  3J80 K;  1SFU A;  4R1H A;  2FUG 2;  2GA1 A;  3WTS C;  1K4T A;  2HYG D;  1B8I A;  2IXS A;  3LA3 A;  3HTS B;  5D6F A;  1BIB A;  4HLX A;  5HS8 A;  3S15 J;  2QQA A;  4OAY A;  1OCO H;  2WB1 N;  3F23 A;  1JKO C;  3CJR B;  1A35 A;  3EYY A;  4LK0 F;  4ZC3 A;  1O4X A;  3JRD A;  1A6Q A;  1H9G A;  3ZQI A;  1REP C;  4FE4 A;  4PFP A;  2DOE A;  3HOY J;  2DCE A;  2GOX B;  4DIQ A;  2OA4 A;  2BW3 B;  1G3S A;  2ZJ2 A;  5IYD J;  4P1W A;  4HF2 A;  4UVA A;  1ZKG A;  3I53 A;  3PM1 A;  4D1Q A;  4G6T B;  2MYS A;  4BEH B;  1TQI A;  1J09 A;  2H8R A;  2O9L A;  2CW7 A;  2HWV A;  3HB9 A;  4UXN A;  2UXX A;  3A01 B;  3RPQ A;  2KZV A;  3TOA A;  1ERD A;  2COB A;  1ZAO A;  1APL C;  3LL7 A;  1WRJ A;  2W24 A;  2ZNZ A;  5DCM A;  3DKW A;  1ZGW A;  3E5X A;  1ZAR A;  3PSF A;  3ZMZ A;  3OYN A;  1T6S A;  2L9R A;  3E3V A;  1GHC A;  3C3W A;  3C1D A;  1AHD P;  4UB6 C;  2OPT A;  5FB2 A;  4Q48 A;  4ASN A;  3W6V A;  2W57 A;  2X1C A;  4BNC A;  1FEX A;  3CC2 I;  1U0J A;  2XVC A;  3RZD J;  1V3F A;  3VDX A;  2KZG A;  2B63 J;  3IKV A;  5EGO A;  1JGS A;  2WY7 Q;  2V9K A;  3B73 A;  4A3B J;  1JXS A;  3WU0 A;  4KIF A;  4BDY A;  3FMQ A;  2QEN A;  4HF0 A;  3J81 K;  4RGS A;  5HS7 A;  5KNL A;  5TRD A;  2IVM A;  1LDK B;  2ESN A;  3DTK A;  3M4O J;  3HEF A;  1MBJ A;  2BY1 A;  3EYI A;  1S29 A;  3DWL E;  2F4O B;  2BXY A;  5FGM A;  2FML A;  2O8X A;  4A6E A;  2BGC A;  2HU9 A;  4C3J J;  3OYG A;  3K70 D;  2HEO A;  3PL8 A;  5GAH J;  2L0K A;  2CUJ A;  2JUG A;  3KCC A;  2QBY A;  3JRF A;  1T38 A;  3VEP A;  2L7K A;  3P9C A;  3ZRG A;  1SAX A;  2FMY A;  2JVG A;  2ZME C;  4KIT B;  2DFH A;  1AKH A;  2VQH A;  1ON2 A;  1WI3 A;  2IP2 A;  2PBI A;  2VBY A;  4AVP A;  3JTG A;  4AUX A;  5BMZ A;  3T5X A;  2F5F A;  2ZJP F;  3W3C A;  4BHP A;  5J6X A;  2CH0 A;  3AG2 H;  1Z77 A;  3CCS I;  2AQF A;  4ETS A;  3O8H A;  5D5V B;  1SFE A;  1IN8 A;  4P9U A;  1JUM A;  4ZZL A;  1A04 A;  1RKW A;  2QKM B;  3EPZ A;  1DGR M;  4MQ9 F;  4HOB A;  2FJ1 A;  2VN2 A;  1NK2 P;  4QIW N;  3OYJ A;  3J7Z I;  2R0Q C;  3I0T A;  3H9J A;  1IRF A;  3NQO A;  3FDY A;  3LSR A;  4DJA A;  4XN3 A;  3IL2 A;  1J2X A;  1XG1 A;  1YQA A;  3QYF A;  3PSI A;  5CVR A;  1XDU A;  5E3N A;  2XSD C;  3NAR A;  2LH9 A;  5E79 C;  1TWA J;  2JT1 A;  5LHG A;  2YSR A;  5KCM A;  1ZR2 A;  1UHS A;  3EET A;  1DPR A;  4LB5 A;  2A6H F;  2VJJ A;  2ZFW A;  1B4A A;  3RCO A;  2A5W A;  1FLI A;  5EG0 B;  3DBH B;  2VKE A;  3I3L A;  4BQO A;  4XM3 A;  1MZB A;  2QKL B;  2OQR A;  2MH9 A;  2EIJ H;  3MAJ A;  5K5Q A;  4UY8 I;  3E97 A;  2NYX A;  1YOV B;  2HOS A;  1IC8 A;  1IRZ A;  1MIJ A;  1U2W A; 
#chains in the Genus database with same CATH homology
 2KIM A;  2OD5 A;  4IHS A;  2XAF A;  3RTR A;  3HOS A;  4LLG F;  2O0Y A;  2P8T A;  2K27 A;  2DQL A;  1UFM A;  1FSH A;  2PEX A;  4O6J A;  1U8R A;  4LFU A;  3U2R A;  1CF7 A;  2CFX A;  5HOO A;  2HTS A;  3QU3 A;  3LA7 A;  4PDK A;  1LEA A;  2BE5 F;  1AWC A;  1BBY A;  1F9N A;  1YTY A;  3JSO A;  4HV6 A;  2RNJ A;  1O57 A;  5IT3 A;  3F72 A;  3KP7 A;  3JAM K;  2H94 A;  1YYV A;  1JE8 A;  1ZLK A;  3ZMU A;  1WQ2 A;  4GGG A;  1Z6T A;  3AAF A;  2VT3 A;  1L0O C;  4UVC A;  2H09 A;  3M8E A;  4N0B A;  2GQQ A;  3IWZ A;  5KK1 A;  3R0A A;  1IRG A;  3TO6 A;  3MFK A;  1YFH A;  1V4R A;  2VC1 A;  2B0L A;  1IF1 A;  4I09 A;  2DI3 A;  3ULQ B;  2D1H A;  4OMZ A;  2HOE A;  5HLH A;  3GO5 A;  3V7S A;  3F8C A;  1KQ9 A;  3WTZ A;  4JK1 X;  3Q9S A;  1Z1D A;  3FHZ A;  1KYZ A;  2Z33 A;  5IT9 Z;  4KDP A;  1SMT A;  4LG0 A;  1G6N A;  3ERE D;  1U6G A;  4XSZ F;  1B59 A;  3M8F A;  2OBP A;  1BN5 A;  1CF7 B;  2DBB A;  4L5I A;  2FQ3 A;  2EFN A;  2MLK A;  4IXA A;  4ZYD A;  3GFI A;  1J59 A;  4Q5S F;  1BJA A;  4XSX F;  4RAY A;  2OQG A;  2Z3Y A;  2PMU A;  1T39 A;  5IT9 K;  3SHF A;  4EVI A;  5L3D A;  1HKQ A;  4ESB A;  3I54 A;  5A2Q K;  2G9W A;  2M87 A;  4PGH A;  2G7U A;  2VOD A;  3I58 A;  1Z6R A;  2VBX A;  2Q8K A;  1ZRF A;  5H20 A;  1ON1 A;  3J80 Z;  1R00 A;  1QPM A;  5LHI A;  4U88 A;  5LRR A;  3IKT A;  3I71 A;  1MJ9 A;  3DQV C;  1SD5 A;  1KU3 A;  3K69 A;  1G3W A;  4I01 A;  2J5P A;  1QGP A;  2WWY A;  1R22 A;  2QWW A;  1EV7 A;  4PZJ A;  3LWF A;  4CYD A;  4K2E A;  2P7V B;  2MA3 A;  5CVU A;  5D8L B;  1G3T A;  4HX4 A;  2GA2 A;  2VBZ A;  2EV0 A;  5ICE A;  1R1T A;  4UV9 A;  3G73 A;  3N4M A;  4HX8 A;  4LLL A;  1J7K A;  2VE8 A;  4R8H A;  1XSD A;  2W25 A;  2VOP A;  2V1D A;  1FY7 A;  2YX7 A;  1OYI A;  1MDM B;  2QBY B;  1U5T B;  2Z99 A;  1JHH A;  4I02 A;  4IRG A;  3N97 A;  2D1V A;  4WF2 A;  4HBL A;  4KUM A;  1XB4 A;  3OV8 A;  2X4H A;  3BOQ A;  3V8J A;  4GYI A;  2XV4 S;  1Y0U A;  4A5M A;  1Z91 A;  2CG4 A;  1SD6 A;  2HZT A;  1BOA A;  3CDH A;  1NHA A;  1BM9 A;  2ZXJ A;  3LAJ A;  2KIU A;  1YLF A;  4MTE A;  5E1W A;  1D3Y A;  2J5O A;  5HLI A;  5ICF A;  3KET A;  1IN7 A;  1ZLJ A;  4XBF A;  1D8K A;  1P92 A;  3GX4 X;  2XAQ A;  5DYM A;  4ZYG A;  1HST A;  2RQP A;  3F6O A;  1YIO A;  3I59 A;  3GXO A;  3WTT C;  5DUI A;  2GIV A;  2WV0 A;  1ZRC A;  2NNN A;  2K4J A;  3MZH A;  3KP3 A;  4B8X A;  1SD7 A;  1TNS A;  1FPQ A;  2BYV E;  4ZH4 F;  4BHC A;  2PMH A;  3ZN0 A;  1IXC A;  1LQ1 A;  4U7B A;  1BC8 C;  4CDG A;  1R58 A;  3NEU A;  4HV5 A;  2DPD A;  2ZKZ A;  3IHU A;  1RI7 A;  5KVR A;  4P9F A;  5K1Y A;  3CJN A;  2P5K A;  4EM2 A;  3CO6 C;  1O3T A;  4A0Y A;  4I0B A;  2GWR A;  3ABT A;  4KN7 X;  4CO8 A;  2XAG A;  2L4A A;  2A69 F;  4AIJ A;  4E70 A;  4IF4 A;  5D8K B;  2AS5 F;  3BPV A;  3L09 A;  2HYF A;  4U0W A;  4HQM A;  1R23 A;  3GFJ A;  1IUY A;  4EMS A;  4IHT A;  5ED4 A;  3BY6 A;  3BP8 A;  1KGS A;  2Y0M A;  1PUE E;  3K1P A;  4HW0 A;  5L3C A;  2DPU A;  2MBF A;  1XMA A;  4QLC U;  1XGO A;  4OIP F;  3GFM A;  2KJB A;  2K86 A;  1OR7 A;  1RUN A;  1LNW A;  5E1Z B;  3SZT A;  2JPC A;  2FBH A;  2FNA A;  2O61 A;  2KKO A;  3E6M A;  1UCR A;  3RYR A;  3IWF A;  3RI4 A;  3PQK A;  4RB0 A;  1RIO H;  4HAM A;  2QLZ A;  4ESF A;  2QYO A;  2P6T A;  1XDS A;  2PJP A;  1IN4 A;  3DV8 A;  3CTA A;  1KQ8 A;  1FWZ A;  4XLN F;  2RVC A;  4BAY A;  3RYP A;  2STT A;  1TTY A;  2UZK A;  3BJA A;  1D8J A;  1LDD A;  3QAH A;  4ZYE A;  1PP7 U;  3GZ6 A;  2KRF A;  1HKS A;  3GW2 A;  3HRU A;  4IPA A;  2ADU A;  2RGV A;  1QNT A;  4EJT A;  1O3Q A;  3V4G A;  2ZME B;  3V7R A;  4XLP F;  4M9X A;  1QQI A;  1R5H A;  5E8G A;  3LQR A;  3L2C A;  3LQQ A;  3TO7 A;  1FZP B;  1KQ0 A;  3M7G A;  4D0P A;  2DTR A;  2OZ6 A;  3RPU A;  2FXA A;  1VTN C;  1W7P D;  2ACJ A;  4OIO F;  4YG2 F;  4KMU X;  2P5L C;  3TDZ C;  3H3U A;  4IJA A;  4KA4 A;  2QM3 A;  3E5U A;  1BI3 A;  2IA1 A;  2IRF G;  3R0J A;  1ZRD A;  4R79 A;  3TOB A;  4GXO A;  4M9S A;  2K7L A;  2DAO A;  2A6E F;  3L00 A;  2O6G E;  4EJV A;  4GCV A;  3K9T A;  3BJO A;  3WOD F;  3R61 A;  4ENK A;  1XGN A;  2MH2 A;  5CVJ A;  1LEB A;  2FRH A;  5DD4 A;  3QOP A;  3MCZ A;  3E6C C;  3I59 B;  2FA5 A;  5JFR A;  2KIF A;  1J9I A;  5HDG A;  2CGP A;  2A3S A;  3LAP A;  4HX7 A;  4OIQ F;  2QZ8 A;  2CWE A;  1KU2 A;  3S2W A;  2XKP A;  3JW4 A;  2PI0 A;  2ZO4 A;  2DK8 A;  3MEX A;  5K5R A;  4RB2 C;  4O5V A;  5D4S A;  3V8K A;  4OMY A;  3GF2 A;  5ILS A;  5F6F A;  4U0V A;  3MZY A;  5LGN A;  1D5V A;  1HBX G;  2ZCW A;  2HTJ A;  4U0Y A;  2RC4 A;  5ICC A;  2QQ9 A;  1QZY A;  1FBU A;  2L4M A;  2M1B A;  4LGW A;  1ZH5 A;  1FBS A;  3E6D A;  3WU1 B;  3ROU A;  3M1E A;  4HF1 A;  3MWM A;  2VON A;  2ZME A;  1FBQ A;  3HSF A;  5E17 F;  1DUX C;  2EK5 A;  2CO5 A;  1HSJ A;  4I98 B;  1Z9C A;  4MHG A;  3FX3 A;  4RB1 A;  3TQN A;  1KA8 A;  5ILU A;  4I2O A;  3TDU C;  2YR2 A;  3FXU A;  5DD8 A;  3HRM A;  5BQT A;  4IRI A;  2CYY A;  4ENJ A;  4A0Z A;  2PQ8 A;  3ZPL A;  2QVO A;  3H92 A;  5A2Q Z;  4L5J A;  2VBW A;  5L3G A;  2UXN A;  2IA0 A;  1W7P B;  2Z5U A;  4KIG A;  3ECO A;  1P4A A;  2ELH A;  1B6A A;  2QQB A;  3BPX A;  1GXP A;  4LK1 F;  5J8C A;  1W4M A;  4KT5 C;  3GEZ A;  2OAZ A;  2EJR A;  3LA2 A;  2FBK A;  4Y15 A;  4AIK A;  4AD9 A;  3K2Z A;  3F8N A;  2YX4 A;  4A0X A;  2FF4 A;  4RB3 C;  4A12 A;  1DDN A;  5BOX A;  4M74 A;  3VB2 A;  3HHG A;  3FF5 A;  1S6L A;  3QU6 A;  3KP2 A;  1MJA A;  1DPU A;  1HW1 A;  2C6Y A;  3R60 A;  1QZZ A;  1K78 B;  1XCB A;  3VOE A;  1T98 A;  3ZP5 A;  1J75 A;  4YFN F;  2XIG A;  4RS8 A;  1QO0 D;  4CZZ A;  1FYK A;  3PQJ A;  4DNC A;  5AON A;  5JHU A;  5AIQ A;  5JVT A;  3FMS A;  3WTW C;  3WGH A;  3GYH X;  3K0L A;  5HS9 A;  4EM1 A;  1G3Y A;  2BV6 A;  4KNY A;  4ENN A;  2XGX A;  2O3F A;  3KP5 A;  5HDK A;  3CUQ C;  3IRQ A;  1FYM A;  1MDM A;  4KIB A;  2V1U A;  4YFX F;  4KIC A;  2EFQ A;  1WI9 A;  1U5T C;  5L3F A;  1T2K A;  5CYV A;  4O3M A;  2F5D A;  4CGZ A;  5H6Q A;  4Q47 A;  1OPC A;  2DO7 A;  2NS0 A;  3T8R A;  4HDU A;  4L9V A;  2VC0 A;  3DXJ F;  2PFB A;  3KFW X;  2V9V A;  2ESH A;  1ODD A;  1R7J A;  5DEQ A;  2K4B A;  1ZYR F;  3LST A;  1XGM A;  1ULY A;  3TO9 A;  2CSO A;  2IW5 A;  4WK8 F;  1J0R A;  4P96 A;  5D5U B;  3GWZ A;  5HDN A;  2VXZ A;  5LRS A;  2GXG A;  4AIH A;  3WG9 A;  2BEO A;  2CW0 F;  1R1U A;  3P7N A;  4L9N A;  1L3L A;  2H6C A;  3SXY A;  3F22 A;  1ZG5 A;  2R7F A;  4Z2Y A;  3F3X A;  3HRT A;  5LLQ A;  2RV8 A;  5FD6 A;  2D2W A;  1EH7 A;  3B02 A;  3HUG A;  5E8I A;  4HQE A;  3RDI A;  2NAZ A;  3WE3 A;  1K79 A;  4NB5 A;  1YO5 C;  1FP2 A;  3KEO A;  3WTV C;  1FP1 D;  3DPT A;  4RGU A;  1I27 A;  1HW5 A;  4FT8 A;  4B09 A;  4OIN F;  1LDJ A;  4LG0 B;  2M8E A;  2R3S A;  5D5X B;  4WXD A;  1O3R A;  1W7P A;  1XGS A;  2LSO A;  3WTY C;  5EEG A;  3FM3 A;  3KP6 A;  5CVI A;  1HW2 A;  3F8M A;  5BS6 A;  4YII A;  1O3S A;  5CVV A;  5LGU A;  1I6X A;  1YG2 A;  3BRO A;  4JQF A;  4Y13 A;  4IVN A;  2DQR A;  2LDU A;  3C7J A;  1O7L A;  1GVJ A;  2ZBK A;  2NRA C;  1YS7 A;  3DEU A;  2HS5 A;  1K7A A;  2L01 A;  1TLH B;  4KMF A;  3T1B A;  4HLY A;  1I5Z A;  1EH6 A;  1LJ9 A;  1WSU A;  3E6B A;  5L3B A;  3RKX A;  3I64 A;  2LKP A;  4XRF A;  4G8X A;  4OIR F;  4HYE A;  2DLL A;  3L9F A;  3QRF F;  3GZ5 A;  4HDV A;  1P2F A;  1Z7U A;  3ELK A;  3DP7 A;  3TKY A;  2OU2 A;  4LB6 B;  3QPH A;  4UVB A;  3FWE A;  2LF7 A;  3H3Z A;  2E1C A;  1BI1 A;  1ZG1 A;  4LMY A;  3VFZ A;  1LVA A;  3HRS A;  5FO5 A;  1ZGA A;  3HIF A;  2V1X A;  1PP8 F;  2EWN A;  3JAM Z;  2M5W A;  3R4K A;  2PN6 A;  4RGX A;  3IC7 A;  4PGG A;  4P55 A;  4LLN A;  3KEQ A;  1X3U A;  4EGZ A;  1PDN C;  1S7O A;  1JHF A;  3WGI A;  2DT5 A;  5ERI A;  5H6R A;  3F6V A;  5LBQ A;  4FHT A;  3D0S A;  3M9A A;  2JZY A;  5FFX A;  1OYW A;  2WC2 A;  1MJB A;  1K6O A;  3JSP A;  1IN6 A;  3RKY A;  2G7H A;  2GXB A;  4YFK F;  2EA2 A;  1ZHF A;  2IA2 A;  1W5S A;  2EV6 A;  2A07 F;  3WE2 A;  1YW9 A;  2M45 A;  1R1V A;  1J5Y A;  2MC3 A;  3FMR A;  3K1N A;  3KZY A;  1WKM A;  3OOP A;  5K5O A;  5BPD A;  3ISP A;  3IRR A;  3GUD A;  2DK5 A;  2JPB A;  2P5V A;  3EDP A;  4MGR A;  5FD5 A;  1R5G A;  5DCF A;  2FEZ A;  1Z05 A;  1U5T A;  5E1X A;  2F5C A;  3EQL F;  3V7C A;  4WXH A;  1DP7 P;  5DCM B;  4G6Q A;  3ABU A;  3DFG A;  2MLG A;  4ESJ A;  4MEX F;  4LJZ F;  3HYI A;  3CUQ A;  4A2U A;  2FNP A;  1IZ1 A;  1USS A;  1IN5 A;  1FC3 A;  3ML6 A;  2XUB A;  3DPL C;  4BHB A;  4KFC A;  2L54 A;  3ZQ7 A;  2VOO A;  1U3E M;  1OMI A;  3O6B B;  2LF8 A;  1XSV A;  1LB2 A;  1FYL A;  3KE2 A;  4P5O A;  3GVA A;  1UHM A;  1I1G A;  2E7X A;  3TGN A;  4G7Z F;  5DV5 A;  2IPQ X;  1TQP A;  3W6J B;  1E2X A;  4GO1 A;  3U1D A;  4BYY A;  3E5Q A;  4MTD A;  2L3D A;  3Q9V A;  2Q2E A;  2FOK A;  5FLX K;  4H0E A;  4GYG A;  4EJO A;  3SFZ A;  3DF8 A;  3BDD A;  1XSX A;  3QP5 A;  1P4X A;  3KLN A;  5AIP A;  2A68 F;  4M6Y A;  4UUV A;  5HVQ C;  5JI6 A;  4WX9 A;  2VT2 A;  2TDX A;  4NHJ A;  1CGP A;  4Q4Z F;  1F1Z A;  3HHH A;  5DUK A;  5FFZ A;  1KYW A;  5FLX Z;  3BZ6 A;  1ZRE A;  2EA4 A;  3WTX C;  2PLY A;  1SFX A;  4G7H F;  4ENM A;  3P9I A;  4HZF A;  2Y75 A;  1TW3 A;  4EGY A;  3RKW A;  5L3E A;  2W85 A;  5J8F A;  3JTH A;  4WCG A;  1UHW A;  4OOI A;  4BQA A;  3ZMS A;  2K02 A;  4M9Z A;  3D5L A;  4M73 A;  1YW8 A;  4BXU A;  2V6C A;  1H9T A;  3ZN1 A;  1I1S A;  2L02 A;  2LNB A;  4G94 A;  5D5W B;  2Y48 A;  2YU3 A;  2HGC A;  1IAW A;  3G3Z A;  5CJ9 A;  2QUF A;  4G6D A;  1BI0 A;  4CIC A;  4AWX B;  1K78 A;  1H0M A;  1HXD A;  2HQN A;  2H6B A;  3BWG A;  4OU0 A;  2XKO A;  4L0Z B;  2A5Y B;  2P4W A;  3PFI A;  3SZP A;  2HFH A;  4CXF A;  4EM0 B;  6PAX A;  4HA8 A;  5D6E A;  3I4P A;  4N9H A;  3P9K A;  1B9N A;  4UV8 A;  4MEY F;  1IXS B;  4NQW A;  3HSR A;  3NRV A;  5F1R A;  4FX4 A;  3O3K A;  5TJJ A;  2M30 A;  2ZNY A;  2HKX A;  4BH9 A;  2EFO A;  2JTV A;  3Q5F A;  1HKT A;  2FBI A;  1UB9 A;  3QPT A;  1TW2 A;  1FNN A;  5EEH A;  1EH8 A;  1Q1H A;  4KYW A;  2V79 A;  4PCQ A;  1U78 A;  1XN7 A;  4MQV A;  3F8F A;  2DU9 A;  2H27 A;  4I7H A;  4ZYH A;  2XRN A;  2XAH A;  5CLS A;  5DDG A;  3J81 Z;  3WGG A;  2HDC A;  5LEK A;  2W84 A;  3ZMT A;  4M6X A;  4ZZD A;  3FZV A;  5E20 A;  1BI2 A;  1XCV A;  1MD0 A;  4S04 A;  4EJU A;  5LHH A;  1S8N A;  1G4D A;  3RJP A;  2EFW A;  4EV0 A;  2HR3 A;  1SD4 A;  1YS6 A;  2A61 A;  3F21 A;  4MNU A;  2RDP A;  2JRT A;  3CUO A;  2UWM A;  3GLX A;  2GAU A;  2F5E A;  1P6R A;  3CO7 C;  4ON0 A;  1F5T A;  3FXQ A;  5JR3 A;  2DFI A;  1RUO A;  3KP4 A;  3MQ0 A;  2XRO A;  5ILV A;  3LFK A;  2RKH A;  4F7Z A;  4G9Y A;  3CUQ B;  1B9M A;  3RIR A;  1S3J A;  1FX7 A;  3KLO A;  4S05 A;  4CHU A;  2RN7 A;  4QWQ A;  4EQQ A;  3J7A O;  3ECH A;  2COM A;  2E7W A;  2BBY A;  3T8T A;  2XAS A;  1E17 A;  3U9G A;  5LGT A;  1KU9 A;  2YPR A;  2VE9 A;  1SMY F;  2P6S A;  1O7F A;  3GFL A;  2ETH A;  3L7W A;  1FSE A;  3K1M A;  1BC7 C;  1FOK A;  3I5U A;  1R36 A;  4LD5 A;  4N9I A;  1F4K A;  1P4W A;  4G7O F;  5ICG A;  2FSW A;  1IW7 F;  2XAJ A;  4A5N A;  2OZU A;  1RNL A;  1UST A;  2CQK A;  3EUH A;  1ZN2 A;  2ISZ A;  3HOT A;  2R7D A;  3C18 A;  1MKM A;  3COA C;  2KJC A;  1QBJ A;  3W6K B;  2F2E A;  3HSE A;  2EFP A;  1T0F A;  1XD7 A;  1OKR A;  2XHK A;  1TQM A;  3ZMD A;  4M71 A;  4L0Y B;  4TV7 A;  4YIF A;  4WWC A;  1W5T A;  5HLG A;  1FT9 A;  3FM5 A;  2STW A;  2HQR A;  3VOD A;  2EB7 A;  3KZZ A;  4EJW A;  3F8B A;  1ZGJ A;  4U7D A;  2JSC A;  4KN4 X;  2E1N A;  2MD5 A;  1KU7 A;  2EV5 A;  3WTU C;  4L18 B;  3SQN A;  2O03 A;  1C0W A;  4DQ2 A;  1STZ A;  4JBA A;  4L9J A;  1AOY A;  4RGR A;  1HQC A;  3FXR A;  3ZMV A;  1ONV A;  2FE3 A;  1ZG3 A;  2ISY A;  2D45 A;  4WXC A;  4M72 A;  1S7A A;  2AXL A;  5F64 A;  2HKO A;  2PG4 A;  2WTE A;  1WWX A;  3T0Y A;  1MGT A;  4A6D A;  2X0L A;  3O2P E;  1YW7 A;  2Z9O A;  5LEJ A;  1XMK A;  1OYY A;  5BPI A;  1B1B A;  1TNT A;  4UHT A;  2IJL A;  4UNO A;  3REO A;  5E18 F;  4IRH A;  1IXR C;  1RZ4 A;  3CLO A;  2GZW A;  1GXQ A;  2DW4 A;  5D4R A;  2FU4 A;  2NNY A;  4I0A A;  4FX0 A;  3HTU A;  4Y17 A;  2Q0O A;  3QP6 A;  3BJ6 A;  3R6S A;  4L9T A;  2P7C B;  2IT0 A;  1BIA A;  4RAZ A;  1TBX A;  3V8L A;  3J80 K;  1SFU A;  4R1H A;  2GA1 A;  3WTS C;  2HYG D;  3HTS B;  3LA3 A;  5D6F A;  1BIB A;  4HLX A;  5HS8 A;  2QQA A;  3F23 A;  3EYY A;  4LK0 F;  1H9G A;  1REP C;  2OA4 A;  1G3S A;  2ZJ2 A;  4HF2 A;  4UVA A;  3I53 A;  1TQI A;  2HWV A;  4UXN A;  2UXX A;  3RPQ A;  3TOA A;  1ZAO A;  1WRJ A;  2W24 A;  2ZNZ A;  5DCM A;  3DKW A;  3E5X A;  1ZAR A;  3ZMZ A;  1T6S A;  3E3V A;  1GHC A;  3C3W A;  3C1D A;  5FB2 A;  4Q48 A;  4ASN A;  2W57 A;  4BNC A;  2XVC A;  1V3F A;  3IKV A;  1JGS A;  3B73 A;  1JXS A;  3WU0 A;  4KIF A;  3FMQ A;  3J81 K;  5TRD A;  2QEN A;  4HF0 A;  4RGS A;  5HS7 A;  2IVM A;  1LDK B;  2ESN A;  3EYI A;  1S29 A;  5FGM A;  2FML A;  2O8X A;  4A6E A;  2BGC A;  2HEO A;  3KCC A;  2QBY A;  1T38 A;  3VEP A;  3P9C A;  1SAX A;  2FMY A;  1ON2 A;  2IP2 A;  2PBI A;  2VBY A;  4AVP A;  3JTG A;  5BMZ A;  3T5X A;  2F5F A;  4BHP A;  5J6X A;  4ETS A;  5D5V B;  1SFE A;  1IN8 A;  4P9U A;  4ZZL A;  1A04 A;  4MQ9 F;  4HOB A;  2VN2 A;  3I0T A;  1IRF A;  3NQO A;  3IL2 A;  1J2X A;  1YQA A;  5CVR A;  1XDU A;  2JT1 A;  5LHG A;  2YSR A;  3EET A;  1DPR A;  4LB5 A;  2A6H F;  2ZFW A;  1B4A A;  1FLI A;  1MZB A;  2OQR A;  5K5Q A;  2MH9 A;  3MAJ A;  3E97 A;  2NYX A;  1U2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...