1LNWA

Crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
NYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance operon repressor
publication title Crystal structure of the MexR repressor of the mexRAB-oprM multidrug efflux operon of Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription repressor
total genus 48
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lnwA01
5LGUA 4BHCA 3RDIA 5DCMA 3HOSA 4HX8A 5DUIA 3KP5A 1SD5A 1QBJA 2RDPA 3WTWC 3T8RA 5DEQA 3VB2A 3GZ6A 3T1BA 1IAWA 3RKWA 1MJAA 2XASA 1TW3A 2FU4A 4K2EA 2RC4A 5LRSA 3R60A 4GYGA 5E1WA 3H3UA 4CZZA 2NYXA 4JK1X 2MLGA 4KIGA 5E8IA 5FD6A 1G3TA 3R4KA 2FSWA 3F8CA 2P8TA 2ESHA 3FHZA 1USSA 4RAZA 2GIVA 2IA1A 2XHKA 4G7HF 3V8LA 3G3ZA 3TKYA 5CYVA 3CUQC 5IT3A 3K1MA 3JW4A 2QBYB 5D4RA 2ZCWA 2XIGA 3BJAA 1D3YA 3E97A 2JPBA 3LAJA 4P55A 3I64A 4EJUA 3HHHA 1CGPA 2L4MA 1NHAA 1GVJA 2KJBA 2XAFA 3F6VA 4R1HA 5D8KB 3BY6A 2F5CA 5L3GA 5BPIA 2PN6A 2MD5A 1TQIA 1XGSA 1XD7A 3ROUA 3J80K 2DU9A 3I59B 2JSCA 3V7SA 3HSRA 5HDGA 4HV6A 3R0JA 3WGHA 2ZNZA 1IN8A 2VT3A 5HLGA 1MD0A 2HS5A 2PMUA 4FT8A 4KN7X 5HLIA 2EV0A 2EA2A 1FP1D 3RPUA 1XMKA 3DXJF 5BQTA 2GXBA 3IC7A 1XGNA 4GYIA 3QRFF 3T8TA 4UV8A 2Z33A 5H6RA 4DQ2A 4HF0A 2JZYA 2PEXA 1XSDA 4LD5A 3EQLF 3HTUA 1XSVA 2HTJA 4RGXA 1XCVA 3F6OA 2Y75A 1R7JA 2FMYA 3KP7A 5DCMB 4NHJA 4ENJA 1B9MA 1B6AA 1QGPA 4Q47A 3KFWX 3HSEA 1ONVA 4CDGA 5E17F 3HRUA 2L02A 2IT0A 2Y48A 2VC0A 1D8KA 5KVRA 2F5EA 3TO6A 1I27A 2BEOA 3FMQA 4E70A 2QM3A 1BJAA 4OIQF 2WV0A 3QP5A 3GXOA 3V7RA 2LDUA 1C0WA 2MC3A 3M1EA 4I0BA 2AS5F 1S6LA 1DP7P 2DTRA 2MA3A 2IA2A 1RIOH 4AVPA 2EFPA 4LK1F 4ENMA 3DV8A 2KIMA 3GFMA 3MFKA 3KEOA 3V8JA 4U0YA 1LVAA 4UVBA 2FBHA 3MZYA 1TQMA 1LB2A 1T38A 2H09A 4HDVA 1T0FA 3BDDA 1LQ1A 3SHFA 4A0ZA 2JRTA 3RIRA 4M9ZA 4U0VA 3KP3A 4EGZA 4L0ZB 2P5VA 3SQNA 5LGTA 1E2XA 4EJWA 1P4WA 4CGZA 4PDKA 5ERIA 2HFHA 4IPAA 3GEZA 2DPDA 4F7ZA 2NS0A 2CFXA 2RV8A 3ECOA 3HRTA 1UHWA 3WGGA 1FYLA 2B0LA 1HW1A 3D0SA 4HLXA 1O3TA 2ESNA 1J2XA 1YG2A 2R7FA 1ZG1A 1TBXA 1V3FA 5E20A 1ZRFA 3IRQA 2OU2A 1IN7A 1SMYF 2MLKA 4MQVA 1L0OC 5BOXA 3H92A 3QPHA 4EM0B 3CDHA 4EM1A 1KYZA 3WTZA 2D1HA 4M71A 1TTYA 5AONA 4WCGA 3PQJA 5FB2A 5ICEA 2V6CA 3WTSC 4OIOF 5CVJA 2IA0A 2LF7A 2HQNA 3KP4A 2ISZA 4L9VA 4HAMA 3W6JB 4I01A 1MJ9A 2XKOA 2EFNA 2JT1A 2OA4A 2RQPA 1YO5C 3V8KA 3GF2A 2GQQA 1MGTA 2QQ9A 2IRFG 2ZXJA 3EETA 3HHGA 5FLXZ 1IRFA 5HDNA 1QPMA 2H6CA 2Q8KA 1FZPB 1FBSA 3DPLC 1BIBA 3GO5A 1U5TA 2DW4A 3E3VA 1HW2A 1KQ8A 3KE2A 2DPUA 2EFOA 3R6SA 4ZZLA 1R23A 5HDKA 1ZG3A 5ILUA 4XLPF 2A6HF 2FA5A 2NNNA 4M6XA 3KEQA 4CYDA 3DP7A 2K4JA 5DCFA 4YG2F 2ACJA 3WG9A 3O6BB 6PAXA 2RGVA 1HKTA 4YFXF 5FLXK 2W25A 3GFLA 4OIRF 2A69F 2EV5A 1YYVA 1BM9A 4OIPF 2IVMA 2KJCA 3LSTA 2BGCA 1BI0A 1JHFA 3I71A 1ZGAA 1QNTA 5LHIA 3P7NA 1U3EM 3COAC 1JXSA 4GO1A 2MH9A 5LBQA 2ZKZA 1XMAA 5A2QZ 4Y15A 1A04A 2QBYA 2GWRA 4XSXF 1FBQA 2M45A 3QAHA 4FX0A 5J8FA 1I1GA 2M8EA 5D5WB 2FXAA 1FNNA 2YR2A 3GYHX 3FZVA 3T5XA 2CGPA 4TV7A 4I09A 1YTYA 4R79A 4MNUA 2BBYA 1BN5A 3ZMTA 2GZWA 2LF8A 3BJOA 1TNSA 5CJ9A 1KGSA 3V7CA 3TOBA 2IPQX 3I59A 3HIFA 1F5TA 3MQ0A 5CVVA 3K69A 1IRGA 1S8NA 3TDUC 1KU3A 3K1PA 2C6YA 3F22A 3FF5A 2FOKA 1UFMA 4EMSA 3FMRA 2EFWA 3RPQA 4YFKF 4M74A 5K5OA 2XGXA 1JHHA 4B8XA 1FP2A 4AD9A 3BOQA 2XAHA 5DUKA 5FFZA 3J81K 3LQQA 4RB1A 1K79A 5E18F 2ZO4A 4ON0A 3ZMVA 4EGYA 2ADUA 3HRMA 4IRIA 2XAGA 4ZYEA 1H9TA 2DLLA 4IJAA 3F72A 4RB3C 3CO6C 1IXCA 3DQVC 2V1UA 4ZYHA 2O8XA 1H0MA 3JAMZ 1SFEA 2OZUA 4Y17A 3KETA 1BI2A 1HSJA 2CQKA 1YS6A 1GXPA 2Z3YA 3CLOA 5L3FA 3WTVC 1R1VA 4AIJA 4BXUA 4MGRA 1BC8C 3JSOA 1R00A 1RUOA 4HLYA 3L00A 5K5RA 1D8JA 1ZARA 4WX9A 2NNYA 5ICGA 3JTGA 4O3MA 3LQRA 4KIBA 1WI9A 2P7VB 2YU3A 3ABTA 4RGRA 1T6SA 3I53A 3J80Z 3C18A 3F8NA 2O03A 1FWZA 1HKQA 1B1BA 3GLXA 3CUOA 3JAMK 4LGWA 4LK0F 1KU2A 1ZH5A 4EJOA 3IWFA 5ILVA 3L2CA 4RGUA 5JFRA 3W6KB 2PLYA 1SFXA 4CHUA 4ENKA 3RJPA 3KLOA 2FEZA 4M72A 2EFQA 5DD8A 2AXLA 1Y0UA 1B59A 5EEHA 5D5UB 2ZBKA 1QQIA 2QWWA 1EH7A 1Q1HA 4KICA 4HYEA 2PFBA 3I0TA 5EEGA 4HQEA 3B02A 4GGGA 3IHUA 5BMZA 2V1DA 1PP8F 2VBZA 1YW7A 3L09A 4AWXB 4P9FA 1XGOA 3IKVA 2K7LA 1K7AA 3F3XA 2HTSA 3ECHA 4I7HA 5ICCA 1ZGJA 2HKXA 4BQAA 2DQLA 2V9VA 1Z91A 2V79A 1OPCA 3TQNA 4M73A 4XLNF 2LNBA 5CVIA 2VT2A 1EH8A 4H0EA 2PQ8A 1YFHA 3GW2A 4G7ZF 3BP8A 1RZ4A 2QQBA 4EM2A 2Q2EA 2R7DA 4M6YA 3IWZA 1R5GA 2RN7A 1KU9A 2X0LA 3I58A 4KNYA 2NRAC 3FX3A 3NEUA 3RYRA 1ZREA 1ZN2A 3U1DA 1EV7A 1O57A 2DK8A 4GXOA 3HSFA 3EYIA 4PZJA 3WU1B 1W7PA 4IHTA 2L01A 3Q9VA 1IXRC 1EH6A 1S3JA 1J9IA 1FC3A 4HBLA 4MTDA 2D45A 2ELHA 3ISPA 5JI6A 5CVUA 2QENA 1B9NA 1IN5A 1DPUA 3PFIA 2O3FA 4G8XA 1BC7C 5BPDA 5J6XA 5AIPA 3HRSA 2IJLA 2FBKA 2Z99A 2DQRA 1GXQA 1XCBA 3DEUA 4G9YA 2VODA 2J5OA 4YIIA 5ICFA 1S7AA 3CUQB 5F64A 2DO7A 4A5MA 4L5JA 3J7AO 3FM5A 3F23A 1ODDA 1BBYA 1YIOA 3Q9SA 1TW2A 1AOYA 4YFNF 3AAFA 4G7OF 4PGGA 3KCCA 2EJRA 2XV4S 4IHSA 3E6BA 3M7GA 4RB2C 1Z05A 3Q5FA 2HYGD 2G7UA 3GZ5A 3K1NA 1J5YA 2Y0MA 4WXCA 4BYYA 1OYWA 4ESBA 2ISYA 2QUFA 1XN7A 2G9WA 4JBAA 2M5WA 2HEOA 3O2PE 5HS9A 2ZFWA 2FE3A 5D6EA 1XGMA 4UNOA 1LJ9A 3N4MA 4HZFA 4UVCA 1DUXC 1YQAA 1K78B 3RKYA 2A5YB 2K86A 5LLQA 1WRJA 3WU0A 1UB9A 4U0WA 3WTUC 2VC1A 4EJTA 5HOOA 3SZPA 4O5VA 1KU7A 3LAPA 5D8LB 3GUDA 2L3DA 3GX4X 4NQWA 3ZQ7A 3FXRA 1AWCA 2ZJ2A 1R5HA 4AIHA 4BHBA 1XDSA 5H6QA 4A0XA 4P9UA 1Z9CA 2KIFA 2E1CA 2M1BA 1OMIA 1W7PB 2QLZA 1HXDA 2OQGA 4KN4X 4P5OA 4UXNA 1J59A 3KLNA 1PDNC 1UHMA 2W84A 2VBWA 3VEPA 3WTTC 2DI3A 3ZP5A 5TRDA 2VOOA 4I02A 3IRRA 2DAOA 4L0YB 1G3YA 2FRHA 1LDJA 4MEYF 3FXUA 1IN4A 3GWZA 5E1ZB 5FFXA 1ZRCA 2P6TA 4EQQA 4Z2YA 2E7XA 2IP2A 2COMA 1X3UA 1R1UA 3L7WA 1OYYA 2R3SA 3EYYA 2Z5UA 3WTXC 3NRVA 4L18B 2GA1A 1SMTA 1MZBA 2G7HA 1IUYA 1ZLJA 5DYMA 1O3RA 4HX4A 2O61A 2QYOA 2PI0A 3DKWA 4FHTA 5E8GA 3OOPA 1OR7A 2Q0OA 2FNAA 1CF7B 1W5TA 1W4MA 3DFGA 2HYFA 1WSUA 3QP6A 3MZHA 2L54A 1FX7A 5AIQA 2XKPA 3U9GA 2XUBA 2X4HA 4L9NA 3SXYA 2RKHA 5DD4A 2P5KA 3J81Z 5F1RA 1KQ9A 3RTRA 2HKOA 3BJ6A 2O6GE 4DNCA 1K6OA 1I6XA 3LA3A 4LLGF 1RUNA 3JSPA 1IF1A 2F2EA 1FOKA 2BV6A 2CW0F 2STTA 3REOA 1OKRA 4Q5SF 2RVCA 4I0AA 2EB7A 4YIFA 1D5VA 1WKMA 4HF2A 2PG4A 3BPVA 4ASNA 4CXFA 1SD4A 1FPQA 3LA7A 3HTSB 3GFIA 1Z6RA 3WODF 2LSOA 4IRGA 1HBXG 1J7KA 4HX7A 4KDPA 3IL2A 3JTHA 1G3WA 3VOEA 4LFUA 2YX7A 3M8FA 4BHPA 2L4AA 3BPXA 4KFCA 1YW9A 2CSOA 1Z1DA 3E6DA 5LHGA 4LG0A 4A2UA 4IXAA 3TO9A 4U7DA 5D4SA 1LDDA 2A07F 3FWEA 4ZYGA 1SD6A 1J75A 4KA4A 3PQKA 2KIUA 1L3LA 3LFKA 4XSZF 5LHHA 4UUVA 1TLHB 2YPRA 3TGNA 2HR3A 4ZZDA 3T0YA 3KP2A 1BIAA 4HF1A 3BWGA 1YS7A 2UXXA 4ENNA 2FNPA 3GFJA 2DFIA 3VODA 5L3EA 4UVAA 4HOBA 4KUMA 2F5FA 2YX4A 3LA2A 3E5QA 2MBFA 2VOPA 5D6FA 5ED4A 5L3DA 1P4XA 4A6EA 2STWA 2UXNA 3VFZA 2P6SA 3CUQA 2XAJA 3P9IA 1E17A 1BI3A 3K9TA 1FSEA 4G94A 4HA8A 2D1VA 2K27A 1XDUA 3QPTA 4WK8F 1DPRA 1PUEE 4KT5C 4R8HA 3EDPA 4LLLA 4I2OA 4QWQA 1VTNC 1KQ0A 2MH2A 5LGNA 3CO7C 1W5SA 5JR3A 1I1SA 4B09A 2CO5A 3R61A 1FSHA 4MEXF 4A0YA 1HKSA 1XSXA 1WQ2A 3ML6A 4CO8A 4MQ9F 4IRHA 2GA2A 2EWNA 4M9XA 1R58A 1HW5A 3N97A 1UCRA 2O0YA 3C7JA 3IKTA 5KK1A 1ZG5A 2QZ8A 1ULYA 4I98B 1IXSB 3HYIA 2Z9OA 5D5VB 1SFUA 2A61A 4OMZA 4WWCA 1TNTA 3WE3A 4OOIA 4PGHA 4U88A 3RKXA 5HS8A 1U2WA 4N0BA 1K78A 3SZTA 5HLHA 1QZYA 3KP6A 1SD7A 3ZMSA 3I5UA 1G4DA 2M30A 1ZHFA 2OZ6A 3P9KA 4KMUX 4CICA 5HVQC 4LG0B 2H27A 3F8MA 1F1ZA 4ZYDA 1U78A 1P2FA 2E7WA 5HS7A 3F8FA 4A6DA 1KYWA 1LEAA 1Z6TA 2KRFA 2BE5F 4JQFA 3U2RA 2OQRA 5TJJA 3K2ZA 1T39A 5H20A 2M87A 2P4WA 5CVRA 5BS6A 1YLFA 4A12A 4BH9A 4NB5A 2WC2A 2W85A 5JHUA 1I5ZA 1XB4A 2XROA 2DT5A 2J5PA 1O7FA 2H6BA 4RB0A 4Q48A 3TOAA 1W7PD 2JTVA 1R1TA 3BROA 1PP7U 2HGCA 3WGIA 2XRNA 2FF4A 2GXGA 4LMYA 2CYYA 3DF8A 5F6FA 1U6GA 5K1YA 3ZMZA 2EK5A 2EV6A 3WTYC 2V1XA 3NQOA 1STZA 4WF2A 4N9HA 2P5LC 1V4RA 3WE2A 2RNJA 2D2WA 1HQCA 3P9CA 5LRRA 4WXHA 1MDMA 2QVOA 1H9GA 4GCVA 3LWFA 3E5UA 2FBIA 3ZMUA 2PJPA 4Q4ZF 5J8CA 1F9NA 1Z7UA 4IVNA 4RGSA 1MJBA 3MCZA 2HDCA 2DBBA 2FQ3A 1TQPA 2E1NA 3E5XA 1RNLA 3V4GA 4HQMA 2W57A 1CF7A 2W24A 1IN6A 3MEXA 2EA4A 4EV0A 1ON1A 1U8RA 4L5IA 3ULQB 3I4PA 4OU0A 3B73A 4U7BA 4Y13A 3MWMA 2JPCA 4D0PA 3L9FA 4M9SA 3BZ6A 3ZN0A 4QLCU 1USTA 3ELKA 2UZKA 3ABUA 2F5DA 2ZNYA 5DDGA 3CTAA 4WXDA 4EVIA 5D5XB 2OAZA 2CG4A 5IT9Z 3KZYA 2ZMEA 2GAUA 1ZLKA 3H3ZA 5E1XA 2BYVE 1LEBA 4IF4A 1ZAOA 3ZN1A 1SAXA 3R0AA 2XAQA 1FBUA 3F8BA 1YW8A 4RAYA 1QZZA 4ESJA 4L9JA 1LDKB 1F4KA 2OBPA 1P4AA 2VN2A 4G6QA 3ZMDA 2ETHA 3SFZA 3HOTA 3F21A 2A6EF 3DPTA 3QU6A 1O3QA 5CLSA 2LKPA 5IT9K 2VONA 2A68F 1BI1A 1OYIA 1O7LA 2OD5A 1BOAA 3M8EA 5FGMA 1U5TC 3TO7A 4OINF 1LNWA 1FYMA 4ESFA 4LLNA 1DDNA 4HV5A 2WTEA 1ZRDA 2VXZA 3C3WA 2PMHA 1ZYRF 1S7OA 4BNCA 3RI4A 2VBXA 1FT9A 2P7CB 4LB6B 4KMFA 1MDMB 3FXQA 5FO5A 3RYPA 1MKMA 2K4BA 4EJVA 4HDUA 4AIKA 3E6MA 2A3SA 2PBIA 2UWMA 4MHGA 1GHCA 2TDXA 2CWEA 3HUGA 3QOPA 4L9TA 5LEJA 1J0RA 4HW0A 3FM3A 4MTEA 1B4AA 2NAZA 1RI7A 1HSTA 3ERED 2IW5A 1T2KA 1P92A 2HWVA 1FY7A 4XRFA 3C1DA 3QU3A 5JVTA 4KYWA 2H94A 3D5LA 2XVCA 4A5NA 1REPC 4UV9A 2HOEA 2KKOA 4PCQA 5L3CA 4N9IA 2QQAA 4FX4A 4RS8A 3ZPLA 2VBYA 2ZMEB 4LJZF 2VE8A 1O3SA 1P6RA 2HQRA 1S29A 3OV8A 1ON2A 1QO0D 5DV5A 4ETSA 1G6NA 2K02A 4S05A 2HZTA 4OMYA 3E6CC 1FLIA 1G3SA 1JE8A 3M9AA 2YSRA 5K5QA 1JGSA 3G73A 1IW7F 1T98A 3I54A 5A2QK 4XBFA 3FMSA 3O3KA 4ZH4F 5ILSA 1R36A 1FYKA 2VE9A 4O6JA 1WWXA 3CJNA 4G6DA 3MAJA 1R22A 2DK5A 2WWYA 2FMLA 4BAYA 3TDZC 4P96A 5LEKA 5FD5A 1IZ1A 3S2WA 4UHTA 4S04A 3EUHA 1KA8A 4KIFA 1U5TB 4LB5A 5L3BA 3KZZA 3GVAA 3K0LA
chains in the Genus database with same CATH superfamily
2NS8A 4BHCA 5LGUA 3U21A 3RDIA 5DCMA 3HOSA 4HX8A 5DUIA 3KP5A 1SD5A 1QBJA 2RDPA 3HBLA 2GOXB 2R92J 3WTWC 5C44J 2IAIA 3DKXA 2DYSH 3T8RA 5DEQA 4DBQA 3VB2A 3GZ6A 3T1BA 3QYEA 1IAWA 3RKWA 1MJAA 1X2NA 2XASA 1NK2P 2M8GX 1TW3A 2FU4A 3PJRA 1X58A 4K2EA 2RC4A 4C2TA 5LRSA 3BTLA 2CU7A 2XPUA 3R60A 3H9JA 4GYGA 5E1WA 3GLLA 4BDYA 1KONA 3H3UA 4CZZA 1YX3A 2NYXA 4PK4A 4JK1X 4XKCA 2MLGA 4KIGA 5E8IA 5FD6A 5E3OA 1G3TA 3R4KA 3S17J 4IQ4A 3OIQA 2FSWA 4NC6A 2WADA 3WHCA 3FBIB 4CUGA 1DU6A 1VF9A 3F8CA 5GPAA 2P8TA 2ESHA 3FHZA 2ID6A 1USSA 5TISC 4RAZA 2IGMA 2GIVA 4XIDA 2IA1A 3DWLE 3CF5F 2XHKA 4G7HF 3V8LA 3G3ZA 3TKYA 4NC8A 5CYVA 4NC7A 2RREA 3CUQC 2HVRA 3LFUA 2CJJA 5IT3A 3K1MA 3JW4A 4V2GA 2CUEA 2QBYB 3QQAA 5D4RA 5F0FA 3FK7A 3HOUJ 1YX5A 2ZCWA 5C3EJ 2XIGA 3BJAA 1D3YA 3E97A 4A3FJ 1IV6A 3VWBA 3Q0WA 2JPBA 3TMOA 3LAJA 2ECBA 4P55A 3I64A 4EJUA 3HHHA 1CGPA 2L4MA 3I55I 1NHAA 1GVJA 1OCPA 4BL0B 4II3A 4CYCA 2KJBA 4D7NA 3ERMA 2XGEA 1Y8QB 2XAFA 2LY2A 1QHHD 3DBLB 3F6VA 3QPLA 4R1HA 5J1UA 5D8KB 1J09A 2VB6A 1TWGJ 3H0GJ 3PL8A 3BY6A 2F5CA 5L3GA 3CC7I 5BPIA 2M7BA 2PN6A 4ZTFA 2LTPA 2MD5A 2KP6A 2HDDA 2XF7A 1TQIA 1QRYA 1XGSA 2KISA 1XD7A 2LVSA 3OYGA 3ROUA 3J80K 2DU9A 4D1QA 3I59B 2JSCA 3V7SA 3HSRA 3LSPA 2CQNA 5EG0B 5HDGA 3CD6I 4HV6A 3R0JA 3WGHA 2ZNZA 3IAM2 2Y2ZA 1IN8A 2VT3A 5HLGA 1E3HA 1MD0A 1X4OA 2KRCA 2HS5A 2PMUA 3K10A 4FT8A 1LPQA 1VQ7I 2DDAA 4KN7X 5HLIA 2LK2A 1R49A 2DA6A 2WA0A 1UAAA 2EV0A 4BQNA 1MNEA 3A4CA 1YRNB 1N78A 1ENHA 2EA2A 1FP1D 3RPUA 2UUZA 2IS6A 3MVPA 1XMKA 3DXJF 3OYLA 1SC7A 5BQTA 2KL4A 2DMPA 1FTTA 2E71A 2GXBA 3IC7A 1D1BA 3OYHA 3I56I 1XGNA 4GYIA 3CMEI 3QRFF 1JKOC 3T8TA 4UV8A 2Z33A 1HA8A 3ZXSA 5H6RA 3TL4X 4DQ2A 4F55A 2X6XA 4HF0A 2JZYA 2PEXA 1XSDA 4LD5A 3IUOA 3TP0A 1SFOJ 2DA5A 3EQLF 4E7KA 3HTUA 3RPUD 3OYAA 1XSVA 1MMNA 2HTJA 2LH9A 4RGXA 1XCVA 3F6OA 2Y75A 1R7JA 3P5JA 2Y69H 2FMYA 3KP7A 5F27A 5DCMB 4NHJA 3GTGJ 1Q1VA 1JT0A 4ENJA 1B9MA 1B6AA 1QGPA 4PSWA 2FJ1A 4Q47A 3FKJA 3KFWX 4NUBA 4OWRB 1QZEA 2X85A 1ONVA 3HSEA 3JRBA 4CDGA 5E17F 3HRUA 4C9YA 1JJ8C 1MSFC 2L02A 2IT0A 4B1RA 2Y48A 1YJWI 2W4SA 1U8BA 4HSRA 1B72B 2VC0A 3UKGA 2H1KA 2RNGA 4B47A 1JUPA 1D8KA 5KVRA 2F5EA 3TO6A 1I27A 2BEOA 3FMQA 3OMYA 4E70A 2QM3A 5KAFC 1BJAA 3S2DJ 4OIQF 2WV0A 3QP5A 3GXOA 3V7RA 2LDUA 4B44A 4ZTJA 1GV5A 1MW7A 1C0WA 3AKZA 3MMYB 3CCUI 2MC3A 4IKFA 3DEEA 3M1EA 4I0BA 2AS5F 1S6LA 1DP7P 1ZR4A 5FRNA 2F4IA 3DCFA 2DTRA 2MA3A 3D5SC 1FMVA 1X1CA 2ZC2A 2KZVA 2IA2A 3FK6A 5BNGA 3OYCA 2OUMA 1RIOH 1JTYA 3GTOJ 2R7OA 3S16J 2ZJPF 4AVPA 4BY1J 2EFPA 3S2HJ 1VI0A 4LK1F 4ENMA 3DV8A 3EPZA 2KIMA 5DTDA 2FX0A 3GFMA 4CH7A 3MFKA 3KEOA 3V8JA 2VL8A 4U0YA 1LVAA 4UVBA 1ZELA 2CQXA 2FBHA 3MZYA 1FEXA 1TQMA 3E0JB 4F3QA 1LB2A 1T38A 2H09A 4HDVA 1T0FA 2XB0X 3MKLA 3BDDA 3OIOA 2VQCA 1LQ1A 2EZHA 3SHFA 4A0ZA 3O8HA 2CW8A 2JRTA 3RIRA 2ZJRF 2GBYA 3DTKA 2VASA 4M9ZA 4U0VA 4U87A 1JGGA 4PJMA 2HVSA 3KP3A 4EGZA 3MKWB 4L0ZB 2P5VA 2M4GA 3SQNA 2LLKA 1M1EB 3QYFA 5LGTA 2X48A 1WJFA 3SFIA 4FASD 1E2XA 1EKEA 1QHGA 3A1YA 2Z2SB 4EJWA 1IJWC 1P4WA 4CGZA 5LFAA 4PDKA 5ERIA 2HFHA 5J4VA 1NG6A 4IPAA 3GEZA 2DPDA 4F7ZA 1MBEA 2NS0A 2CFXA 1TL8A 1ZK8A 2NOJB 3X2QH 3OS2A 2RV8A 3ECOA 4BJ6C 1ETQA 3HRTA 1UHWA 1YI2I 3WGGA 1FYLA 2V4JC 4HEA2 2B0LA 3SZGA 1HW1A 3D0SA 4HLXA 3SJMA 2WY8Q 1O3TA 2QGUA 3G2BA 2ESNA 3W2WA 1J2XA 4IHXA 1YG2A 1RR8C 2R7FA 4RLQA 1ZG1A 1MBHA 4YIRX 1TBXA 1V3FA 4BE2A 5E20A 1ZRFA 2M7AA 5FLVA 4HPQA 3SYTA 1K61A 3IRQA 2K9QA 1IGNA 3ZGKA 2OU2A 1SMYF 1IN7A 2MLKA 2IGKA 4MQVA 5J1RA 1N75A 1L0OC 1DU0A 5TGTA 5BOXA 4RM3A 3H92A 3QPHA 4EM0B 3CDHA 1JKQC 1QVUA 4EM1A 2JMWA 2ID3A 4L5EA 3J7YJ 2Q2EB 1KYZA 1GV2A 4YRVA 3WTZA 2K9LA 4IOCF 2D1HA 4M71A 1TTYA 2WAQN 3H5RA 5AONA 4A3LJ 2X1EA 4WCGA 4RAFA 1PYVA 3PQJA 4IEJA 4N4OB 5ICEA 5FB2A 3BT9A 4XL9A 2V6CA 4OAZA 3WTSC 5B1BH 5IP7J 2L5QA 4OIOF 2CQ7A 5CVJA 2IA0A 1I39A 2LF7A 2HQNA 3CCMI 2LD5A 3KP4A 3L2WA 2L9RA 5GAGJ 4GDFA 2H1LA 4DYCA 5FKOA 2OF7A 2ISZA 4XLCA 2CUZA 4EATA 4L9VA 1A36A 3S3OA 4HAMA 3W6JB 4I01A 3S3MA 3G1MA 3J7ZI 2K9MA 1MJ9A 1BW6A 4F91B 2XKOA 2EFNA 2JT1A 2OA4A 2OPTA 2RQPA 1YO5C 1PUFA 3V8KA 3GF2A 2DDBA 1MGTA 1T08B 2GQQA 2QQ9A 2Y30A 1X3WB 4M3GA 2IRFG 5CKTA 2ZXJA 2N8GA 3EETA 2QSHX 2ZJQF 4E4HA 3HHGA 5FLXZ 1IRFA 2CMPA 2EZIA 5HDNA 2WY7Q 3IV5A 1ZGWA 1QPMA 4BJTA 2H6CA 2K9SA 2Q8KA 4P1WA 2WB1A 1FZPB 3BCAA 2LBFB 1FBSA 1H8AC 3DPLC 1BIBA 1MBGA 3GO5A 1U5TA 2DW4A 3C2GA 2ECCA 2VQGA 3E3VA 1HW2A 2W7NA 1KQ8A 3KE2A 5J1YA 2DPUA 2DMUA 2EFOA 2R7ZJ 3R6SA 2MW8A 1R23A 4ZZLA 3CCSI 2V9PA 5HDKA 5KHDA 1ZG3A 2NXNB 5ILUA 1HLVA 4XLPF 2FOWA 2A6HF 2FA5A 3ZRGA 1RKTA 2NNNA 2E2HJ 4M6XA 4E6KG 3KEQA 4GFBA 4CYDA 3DP7A 2K4JA 5DCFA 4YG2F 5GTHC 2LOOA 2ACJA 1A6QA 2HQAA 3CCYA 3WG9A 3V42A 3HOXJ 1S7EA 3O6BB 4E7HA 6PAXA 2I5UA 2JUCA 2AHQA 2RGVA 4LIUA 3VYUB 1HKTA 4YFXF 5FLXK 2V7FA 2W25A 1ERDA 1R9TJ 3GFLA 4JOMA 2A69F 2EV5A 4OIRF 4ANJA 1YYVA 1BM9A 5IY5H 4OIPF 2IVMA 3OIPA 2KJCA 3GCMA 3LSTA 5KNLA 3A01B 1D1AA 2HZDA 2BGCA 3IH4A 1JKRC 4PFOA 1K4SA 3LSHA 2Z1DA 1BI0A 2NVTJ 1VQ9I 1JHFA 2HYJA 3I71A 1UG0A 4CCKA 1ZGAA 1QNTA 2KHMA 3OS1A 1UHSA 4FE4A 5LHIA 2HXIA 3P7NA 2R7TA 1U3EM 1OR7C 5E79C 3COAC 1JXSA 4GO1A 5FRMA 1LE8B 3DU5A 3KX2A 3IAS2 2MH9A 2HVQA 5LBQA 2ZKZA 1XMAA 3RCOA 5A2QZ 4XNFA 4Y15A 1WZ2A 2BHYA 1A04A 2QBYA 2KT0A 2GWRA 4QIWN 4XSXF 2IGOA 3F0CA 1FBQA 4CA0A 3D5RC 2DA4A 1VFCA 3ZQCA 2M45A 1FOYA 3QAHA 4FX0A 5J8FA 1I1GA 1JKPC 2M8EA 2E1MB 5D5WB 2FXAA 4J00A 4MIMA 1FNNA 1FIPA 3OOUA 2YR2A 2QSFX 2AQFA 4ZDPA 2JA5J 4XOTA 3GYHX 3FZVA 3FXMA 3T5XA 2CGPA 4TV7A 4I09A 1X2MA 1YTYA 3IH3A 4R79A 2ZSHB 1XC5A 4MNUA 2BBYA 1BN5A 3K6GA 3CP8A 3ZMTA 2GZWA 2LF8A 3BJOA 4NQWB 2OCEA 1TNSA 3PSIA 5CJ9A 2EZLA 1KGSA 3MN2A 3HKZA 3BR2A 4YELA 1DGRM 1OQYA 3TOBA 2IPQX 3I59A 3HIFA 3V7CA 1F5TA 3MQ0A 5EG0A 5JLWA 5CVVA 2V6EA 3K69A 1IRGA 2DCEA 2X6WA 1S8NA 3TDUC 1KU3A 3K1PA 2C6YA 3F22A 1SVLA 3FF5A 2FOKA 1UFMA 4EMSA 3FMRA 2EFWA 3RPQA 4ZDOA 1A31A 4YFKF 1S5LC 4CCLA 1YRNA 2L7FP 2Y9ZA 4M74A 5K5OA 2AQEA 2XGXA 1JHHA 3OL3A 1Y39A 4B8XA 1FP2A 1U9NA 2V26A 2HPIA 2YUSA 4AD9A 5M5WJ 2IS4A 3BOQA 3CCLI 2XAHA 5DUKA 4DYRA 3AL0B 5FFZA 3J81K 1VQNI 4FCYA 5IP6A 2DA1A 3LQQA 4NNJA 4RB1A 3AG2H 5E18F 2ZO4A 4ON0A 1K79A 3O8GA 3ZMVA 3S1MJ 4W1UA 4EGYA 2ADUA 3HRMA 4IRIA 2XAGA 4ZYEA 4E7ZA 1H9TA 3A0HC 2FQ4A 4XKWA 2DLLA 3OYBA 4IJAA 3F72A 1BOBA 5HODA 4RB3C 3CO6C 1IXCA 3DQVC 2CV0A 2CUFA 3A03A 2V1UA 4ZYHA 2O8XA 1H0MA 3VPRA 4UUSB 3UNGC 1V55H 3JAMZ 3EUHC 2Y9YA 1XG1A 1SFEA 3Q3SA 4KISA 2OTJI 2EINH 4IHWA 2OZUA 4Y17A 3KETA 1BI2A 4QTRA 1HSJA 2CQKA 1YS6A 2XPWA 1GXPA 2Z3YA 3K4KA 2K3PA 1XPXA 1JT6A 3CLOA 5L3FA 3WTVC 1R1VA 4AIJA 4BXUA 4G12A 4MGRA 1BC8C 3JSOA 3FIWA 1R00A 1RUOA 4HLYA 3L00A 5K5RA 1B72A 1D8JA 3LSJA 2B7EA 1ZARA 3HJEA 4WX9A 1JI8A 1WVRA 1RRJA 4Y3OA 2NNYA 1QVTA 1MNDA 5ICGA 3JTGA 2HNHA 4Y33A 3UR3C 3K4MA 1BR2A 3JRHA 4O3MA 3LQRA 4KIBA 1WI9A 3VYSB 3HB9A 1TZLA 2P7VB 2YU3A 3ABTA 3KYDB 4RGRA 1MSEC 2L7KA 3CJTB 1WHUA 4XKBA 4J19A 5B1AH 4IOAF 4X6AJ 1DQUA 2X51A 3HM5A 1T6SA 2KMUA 4G6TB 1PVEA 3I53A 5JHFA 3J80Z 4UB8C 2CW7A 2DA7A 3C18A 1I3AA 3F8NA 2O03A 1FWZA 1G8XA 2F6CA 1HKQA 1B1BA 1Y56A 2DOAA 3AG4H 3CUOA 3GLXA 3JAMK 4LGWA 4LK0F 4M3FA 2LKSA 4A3JJ 1KU2A 1ZH5A 4EJOA 4Y4RA 3IWFA 5CPRB 2VQLA 5ILVA 3L2CA 4FETA 4RGUA 5JFRA 3W6KB 2PLYA 2MABA 2RQQA 3ABLH 3AG3H 1D0XA 1A6IA 1SFXA 3NAUA 4CHUA 3M4OJ 2EZKA 4ENKA 2O9LA 3RJPA 1LVKA 3KLOA 2FEZA 4M72A 2EFQA 2R93J 1K4TA 5DD8A 2CH0A 1X19A 1RPWA 1Y0UA 2AXLA 3CCEI 1B59A 5EEHA 5D5UB 2JVHA 3ZQHA 1BR4A 2ZBKA 1QQIA 2QWWA 3BR3A 1EH7A 3VYRB 3MZ8A 5HLTA 1Q1HA 3K7AJ 2ZFUA 4KICA 2B9SA 1T95A 1IG7A 4HYEA 2PFBA 3U1KA 4W97A 3I0TA 4A3DJ 2EQRA 2DMQA 5EEGA 4HQEA 2HU9A 3B02A 3H9QA 4GGGA 3RQ4A 2O8KA 3IHUA 5BMZA 2V1DA 1PP8F 2R5YA 2VPRA 2JA8J 2VBZA 3CDLA 5GPCA 1YW7A 3L09A 1K83J 4AWXB 4P9FA 1XGOA 3IKVA 2F4OB 2K7LA 1K7AA 3F3XA 4A3EJ 1F36A 2HTSA 3ECHA 4I7HA 4AVZA 3LSGA 3PM1A 2DA3A 4IHVA 1WJ5A 3DLAA 2BW3B 1VNDA 3K4JA 5ICCA 1YOVB 1ZGJA 2HKXA 3ZQGA 4BQAA 2K5CA 2DQLA 2V9VA 1Z91A 2V79A 4BE0A 3CZ6A 1OPCA 3H5NA 3TQNA 4M73A 4XLNF 1X4PA 2LNBA 5CVIA 2VT2A 1B8IB 1EH8A 2VJJA 4H0EA 2PQ8A 2KDOA 1YFHA 3GW2A 4BDZA 2AO9A 2X9DA 2M0MA 2R5ZA 1LUJB 4G7ZF 2VJIA 2VKDA 4A69C 3BP8A 1RZ4A 2PMZN 3GZNB 4DW6A 2GXAA 2QQBA 4EM2A 2Q2EA 2R7DA 3TEDA 2L0KA 2M0CA 2QKLB 4DYQA 4M6YA 1TT5B 1R5GA 3IWZA 4BACA 5IYCJ 4PJLA 2RN7A 1KU9A 2X0LA 5FKNA 2WAEA 3I58A 4KNYA 2L9VA 2NRAC 2M9HA 3FX3A 5J3LA 3NEUA 2WB1N 4II2A 3RYRA 1ZREA 3H0DA 3HGGA 4IO9F 2V9KA 4XRSA 1FMWA 1ZN2A 1S9HA 3U1DA 2DMNA 3S1NJ 4AUXA 1MMGA 1EV7A 1O57A 2XAUA 2LREA 2DT7B 1WFXA 2DK8A 2X6YA 4GXOA 4C3JJ 3HSFA 2E19A 2KLOA 2PX9A 3EYIA 4PZJA 3WU1B 3DTIA 1W7PA 2ZXHA 5FKMA 2LR8A 4IHTA 2L01A 3Q9VA 1IXRC 1EH6A 1S3JA 2HOAA 4J01A 1J9IA 1FC3A 4HBLA 4MTDA 1UELB 1T56A 2D45A 2ELHA 3ISPA 5JI6A 5CVUA 2QENA 4DJAA 4D7MA 1B9NA 3I4MJ 1D5YA 1IN5A 4MFDA 1DPUA 1HDDC 3PFIA 1WH5A 2O3FA 4G8XA 4X1EA 1BC7C 5BPDA 1BW5A 2JVGA 5J6XA 3VSLA 5AIPA 2BXZA 3HRSA 2IJLA 2FBKA 2Z99A 4RA2A 2LBFA 1IRZA 2DQRA 1GXQA 1XCBA 3DEUA 4G9YA 2DYRH 1SAUA 2VKEA 2J5OA 4YIIA 5ICFA 3RZDJ 2VODA 3GTJJ 3LMMA 1S7AA 3CUQB 4JP0A 1Y1VJ 1IV8A 4RDUA 4BQQA 3RQIA 3L1PA 5F64A 3DTEA 2DO7A 4A5MA 4L5JA 3J7AO 3DPUA 3FM5A 3HEFA 1JTXA 1ODDA 3F23A 1BBYA 1YITI 3A02A 1YIOA 4HSTA 2E1OA 5DS9A 4A3IJ 3Q9SA 2D5VA 3M3YJ 1TW2A 1AOYA 5EZGA 4YFNF 3AAFA 4G7OF 5F0CA 4PGGA 4X0GA 3KCCA 3PIPF 1ETOA 1YJ9I 1I3QJ 2BVLA 2EJRA 3OR2C 2XV4S 1NTCA 4IHSA 2TCTA 3E6BA 3M7GA 1JUMA 3BQZA 4RB2C 4A3BJ 1Z05A 3AFHA 4BEHB 2E2JJ 2ZSIB 3Q5FA 1MBJA 1DP3A 2EIKH 2HYGD 2G7UA 3GZ5A 2R5YB 3A01A 1RR7A 3TW7A 3K1NA 3S8PA 2EIJH 1J5YA 4RAGA 3ASNH 2BHZA 2VJ5A 2Y0MA 4XN0A 1Z77A 4PFPA 4CCJA 2G0EA 2JA7J 4AU7A 4WXCA 4BYYA 1OYWA 4ESBA 3H9GA 4XRMA 4E7JA 2ISYA 1QPIA 5IYBJ 2QUFA 2ME6A 3HKZN 4XQFA 5EGOB 1LE8A 1RETA 2CQQA 1XN7A 2DFHA 2G9WA 4JBAA 2M5WA 1W36D 1MMSA 2HEOA 1P9QC 1FTZA 2PJRB 3O2PE 1IDYA 5HS9A 3VDXA 3QOEA 2HI3A 2ZFWA 3OSGA 4XR6A 2M3AA 2Y0SA 2V1NA 3BR6A 3SEZA 1QA6A 5EDNA 2FE3A 3EUAA 1O4XA 5D6EA 1XGMA 4UNOA 1LJ9A 1XS9A 3N4MA 4HZFA 4UVCA 1ETYA 2QF7A 1UZCA 2DJNA 5EYRA 1YQAA 1DUXC 3KPHA 1K78B 2VPLA 3RKYA 2A5YB 5F08A 2K86A 1TWHJ 5LLQA 1FOXA 1WRJA 2R5ZB 3WU0A 1UB9A 3PO3J 4U0WA 3WTUC 2VC1A 4GRIA 4EJTA 2ELJA 3JRAA 2CFOA 5HOOA 1GUUA 1Y6IA 1D0ZA 3FISA 4NDLA 3NWSA 4O5VA 3SZPA 3LAPA 5D8LB 1KU7A 4C3HJ 3GUDA 2E2IJ 2LRDA 2L3DA 4BU2A 4NQWA 3GX4X 3K4LA 3W3CA 1Z0XA 3ZQ7A 3DU6A 2ZMEC 3FXRA 4H4KC 1AWCA 2ZJ2A 1R5HA 1R6RA 4PUSA 4AIHA 4BHBA 4QPOA 5B3SH 1XDSA 5KAIC 4IX7A 3NWTA 5H6QA 2A5WA 4V19K 1BJZA 4DZPA 4A0XA 3GMEA 4P9UA 1VQMI 1SANA 3AG1H 1Z9CA 4FQGA 2WBMA 2KIFA 4I76A 2E1CA 4B48A 5B66C 2M1BA 2R7XA 1OMIA 1W7PB 5H2FC 2QLZA 1HXDA 3ZQQA 2FUG2 2P0WA 3TP3A 1VQ6I 2OQGA 1I6HJ 4KN4X 1X1PA 4LOCA 1G2HA 3ABMH 1OCTC 4P5OA 3BG6A 4UXNA 3FXKA 4A3KJ 2JK3A 1J59A 3KLNA 1PDNC 2DOFA 1UHMA 2I8DA 2XF6A 2W84A 5FROA 2OCCH 1EJ9A 2VBWA 2HXOA 3OYIA 3LSKA 1VQ8I 2XGCA 3OYMA 4PJNA 3VEPA 3WTTC 2DI3A 1V5EA 1ETXA 4A3MJ 3B6AA 1IRXA 4BKXA 4JX6A 1Y8RB 3ZP5A 5TRDA 2CV1A 3HOWJ 3M07A 2VOOA 3JCUC 3CCRI 3FDYA 5B5EC 4I02A 3SDGA 3IRRA 2DAOA 1TWFJ 2ZXWH 1G3YA 2FRHA 4L0YB 4MLOA 1LDJA 4MEYF 4UUSA 3ZOBA 3K4BA 3FXUA 2F4MB 1VQ5I 1HDPA 5K7FA 3CDIA 1IN4A 3GWZA 5E1ZB 2X1CA 5FFXA 1ZRCA 2P6TA 2JN6A 2JUGA 4EQQA 4Z2YA 2LP0A 3GBGA 2E7XA 1BL0A 2MFZA 3F9KA 3OYFA 3CQZJ 2IP2A 2COMA 1X3UA 4ABZA 1R1UA 4FE7A 4ZYAA 2EILH 3L7WA 4QSHA 3PNTA 1DGWY 2DODA 1GT0C 2K9NA 1OYYA 2R3SA 3EYYA 4DOZA 2Z5UA 3WTXC 4E7LA 3NRVA 4L18B 2KFDA 2GA1A 1SMTA 1HCRA 1WI3A 1AHDP 3W2VA 3K70D 2L2OA 1MZBA 4C3IJ 2G7HA 3KIOA 1R5ID 1IUYA 1ZLJA 5DYMA 1O3RA 4A93J 4HX4A 3M1CA 2O61A 2ICWG 2QYOA 1OCCH 2PI0A 3DKWA 2X6OA 4FHTA 3CCJI 3FHNA 5E8GA 3OOPA 1OR7A 3WU2C 4XMYA 2Q0OA 3JRGA 1K6YA 2FNAA 1CF7B 1W5TA 2KQRA 1W4MA 3DFGA 2HYFA 1WSUA 3QP6A 3CJRB 3MZHA 2L54A 1RC9A 3BG5A 3JRDA 4LITA 1FX7A 5AIQA 2XKPA 3U9GA 2XUBA 2HDWA 2X4HA 2E36A 4L9NA 3SXYA 3HC7A 2RKHA 5DD4A 2P5KA 3J81Z 2Q1ZB 4YEJA 3MKYB 5F1RA 1KQ9A 1YJNI 1NK3P 3KEYA 3RTRA 2HKOA 5IYDJ 3BJ6A 2O6GE 4DNCA 1OLTA 1K6OA 3I3LA 2GLOA 3HZJA 1I6XA 3PSFA 3NARA 2JSPA 3CESA 3FXOA 4IQJA 4M3EA 2KRHA 3PUFA 1TC3C 3LA3A 1UG2A 4LLGF 1RUNA 3JSPA 3HOYJ 2E5ZA 1IF1A 2F2EA 1FOKA 1IDZA 1W5CC 1TP4A 4BY7J 2BV6A 2CW0F 2E35A 1BA5A 2STTA 4IHYA 3EUKL 4EEFG 3MKZA 3W6VA 3CF2A 3FBNB 1YIJI 3REOA 5E3LA 1OKRA 2JA6J 2BW3A 3L2QA 1G59A 1ZKGA 1UJ8A 5FJ8J 4JYKA 3DBHB 4Q5SF 1CQTA 2RVCA 3PNYA 5CQEA 4I0AA 2EB7A 4YIFA 5FKKA 2A05A 2LKXA 1D5VA 1WKMA 3GTKJ 4HF2A 2PG4A 3BPVA 1ZR2A 3ONQA 4ASNA 4CXFA 5DM7F 1SD4A 1FPQA 3TBIA 3G6EI 1ZQ3P 3LA7A 3HTSB 1N77A 5LD2C 3GFIA 1Z6RA 1B8IA 3W2AA 3PUBA 3WODF 2LSOA 2JQ7A 1MIJA 2QQ8A 4IRGA 1HBXG 2NS7A 1J7KA 4HX7A 2DFEA 4KDPA 4JX5A 3IL2A 3L2VA 3JTHA 1G3WA 2M4KA 3VOEA 3BR5A 2W82A 4BBRJ 1AKHB 4LFUA 1P7IA 2YX7A 3M8FA 4BHPA 4C2MJ 2L4AA 1V5FA 3BPXA 4KFCA 1YW9A 2NVYJ 2CSOA 1Z1DA 1Z67A 2MG4A 3E6DA 4B3AA 1MH4A 2YU9J 5LHGA 1LFUP 3BR0A 2R7RA 4BBSJ 4LG0A 4A2UA 4JX4A 4IXAA 3TO9A 2LYCA 4U7DA 3BLYA 4QPQA 5D4SA 4D5CA 1LDDA 3VYTB 2A07F 3FWEA 1Z21A 2GIZA 3BZKA 4LIVA 4ITVA 1WJEA 3K2AA 4E7SA 4ZYGA 1SD6A 1HOMA 1J75A 3JRFA 4KA4A 1EA3A 3CCQI 3PQKA 1XTAA 2KIUA 2VUMJ 1X1AA 3C2HA 3IP4B 4BS9A 1L3LA 3LFKA 1E3OC 4XSZF 5LHHA 2OV7A 1IO2A 2GOMA 4UUVA 1TLHB 4N4NB 1FJLA 1NG7A 2AXTC 2BXYA 3K4CA 2YPRA 3TGNA 2HR3A 4ZZDA 1ETKA 1N25A 3T0YA 1Y1WJ 3KP2A 1BIAA 1VQPI 4HF1A 4UUTA 2LY9A 3BWGA 3PIOF 4IL6C 1YS7A 2DJIA 2UXXA 3KZIC 4ZDLA 2FNPA 2W48A 4ENNA 3GFJA 2DFIA 3I9V2 3VODA 4UVAA 5L3EA 3K4NA 1WJBA 4XOPA 4HOBA 4KUMA 4ZJZA 4KT6A 4D9JA 1MNMC 2F5FA 2YX4A 2X1DA 3LA2A 3E5QA 3HUGB 2MBFA 2VOPA 5D6FA 3ABKH 5ED4A 4RM2A 5L3DA 1P4XA 4A6EA 4XRSG 2STWA 3BQYA 2R7WA 2UXNA 3VFZA 2P6SA 4V2FA 3CUQA 2ZB9A 2XAJA 3P9IA 1WCMJ 1E17A 1BI3A 3K9TA 1FSEA 2JJ7A 2IXSA 4G94A 4HA8A 2D1VA 2K27A 1XDUA 3QPTA 4WK8F 1SEUA 1DPRA 1SVOA 1PUEE 4KT5C 2QSGX 1OCZH 4R8HA 4B43A 1MBFA 1V5GA 2Y0SN 3BZCA 3EDPA 4LLLA 3DEWA 4I2OA 4QWQA 1VTNC 3OR1C 1KQ0A 1VQOI 2MH2A 2W00A 3I4NJ 3ASOH 5LGNA 3JREA 3HOZJ 3CO7C 1W5SA 5JR3A 1D1CA 1I1SA 3ZCOA 3PO2J 4B09A 2CO5A 3R61A 4BEHA 2IGNA 3BTIA 4XLFA 1FSHA 4MEXF 1LFPA 4A0YA 1HKSA 4AM3A 3C2BA 1E3PA 1WQ2A 1XSXA 3ML6A 4CO8A 3Q0UA 4MQ9F 4IRHA 2GA2A 3H1CA 1VQ4I 2EWNA 3VSKA 4M9XA 2L9SA 2BZTA 3DLLF 1R58A 5JVGF 1HW5A 4AYBA 5HNHA 3N97A 1UCRA 2O0YA 3C7JA 3OL4A 3IKTA 5EGOA 3S1RJ 5KK1A 1ZG5A 2QZ8A 2PJRA 1P7JA 1ULYA 4I98B 1IXSB 3HYIA 4OAYA 4XLHA 4CSWA 2Z9OA 5D5VB 1SFUA 2A61A 4OMZA 4WWCA 1TNTA 3WE3A 4OOIA 4PGHA 4U88A 4BUPA 2QA4I 5F0HA 3RKXA 3LNQA 5HS8A 4DZJA 1QU3A 4C2UA 3HG9A 1U2WA 4N0BA 1K78A 3OYNA 3SZTA 4Y52J 5HLHA 1W0TA 1QZYA 3A2KA 3CCVI 3KP6A 4XM3A 3OYJA 4XLAA 1SD7A 3ZMSA 3LL7A 4XORA 3I5UA 1G4DA 2M30A 2NVQJ 1ZHFA 2OZ6A 3HL2A 3P9KA 4KMUX 1U0JA 1X1DA 4CICA 3BG7A 5HVQC 2EIMH 4F93B 4LG0B 3JRCA 4BE1A 2H27A 3F8MA 1ORKA 1ZTRA 3QPSA 3MD2A 1F1ZA 4ZYDA 4IZZA 2XSJC 3OYKA 2WV1A 1U78A 2EBIA 1P2FA 2E7WA 1I50J 5HS7A 3F8FA 4A6DA 2IS2A 2W1OA 1KYWA 1LEAA 1Z6TA 2KRFA 2BE5F 4JQFA 2K3FA 5HNFA 3U2RA 1WJCA 2OQRA 5GAEJ 5TJJA 3K2ZA 1ITYA 5IOZA 1T39A 5H20A 2M87A 2P4WA 2DN0A 5CVRA 5BS6A 4HNVA 3JRIA 1H88C 1YLFA 2XGDA 4A12A 4XONA 2GM4A 4BH9A 4NB5A 2WC2A 2W85A 5JHUA 1I5ZA 1XB4A 2XROA 2DT5A 4A3GJ 2J5PA 1VQLI 1O7FA 2VQHA 2BY3A 2H6BA 4RB0A 3G1OA 2BY0A 4Q48A 4ZC3A 1W7PD 2JTVA 3TOAA 4CCNA 4HNTA 3GTQJ 3CJQB 1R1TA 3BROA 1OFCX 1PP7U 4HG2A 2HGCA 3WGIA 2R0QC 2XRNA 3BR1A 1OCOH 2FF4A 3L2UA 2GXGA 2L7ZA 3BC8A 4LMYA 2CYYA 3DF8A 4RLFA 5F6FA 2O7OA 1U6GA 2OC6A 5K1YA 3ZMZA 3H36A 3ZQLA 2EK5A 4M3DA 3HPGA 2EV6A 2WAFA 3WTYC 2V1XA 3NQOA 1STZA 2VIXA 4WF2A 4N9HA 2P5LC 4PSXA 2FD5A 1V4RA 3WE2A 5E3MA 2HOTA 2RNJA 2D2WA 1HQCA 3P9CA 4CZCA 4DGWB 3BTJA 3L2RA 5C4JJ 1X3ZB 2KDZA 3KYCB 5LRRA 4WXHA 3CC2I 5KCMA 1T0FC 2LMDA 4XLEA 3LSRA 3G4SI 2BOLA 1MDMA 2XPVA 2QVOA 3HXLA 2P81A 1YE9A 4BQOA 4CYCB 1H9GA 4GCVA 3LWFA 3HOVJ 3ZR8X 3BTCA 3DKYA 2K40A 3S1QJ 4MFEA 3HPHA 5F1JA 4AIDA 3G71I 3E5UA 2FBIA 3ZMUA 2PJPA 2E60A 4NBQA 4Q4ZF 5J8CA 1F9NA 1Z7UA 4IVNA 4RGSA 2MD0A 2QCOA 5IOYA 1MJBA 1W36C 3MCZA 4Z6YA 2HDCA 3RZOJ 1WJAA 2DBBA 2FQ3A 1TQPA 3N05A 2E1NA 3QWLA 2NVXJ 2H8WA 2CRGA 3BG9A 3CLQA 4KITB 3E5XA 1RNLA 3V4GA 3Q0VA 4HQMA 2ELKA 2W57A 1CF7A 2W24A 2Z16A 4KJZA 2OTLI 1IN6A 3MEXA 2EA4A 4EV0A 4S0HB 4UY8I 1ON1A 1U8RA 1R4NB 4L5IA 3J7AY 3CMMA 3ULQB 5M3FJ 2IBDA 1ETVA 3FXJA 2M2EA 3I4PA 2CV2A 1TT0A 4OU0A 3B73A 4U7BA 4Y13A 3MWMA 2KZGA 2BY2A 1OCRH 2JPCA 4D0PA 4M6VA 3L9FA 5K7ZA 3IH2A 4F52A 3GTMJ 4M9SA 3WHBA 3BZ6A 2DXIA 2K85A 3ZN0A 4QLCU 1YHQI 1USTA 2E5NA 3ELKA 1LFBA 1RESA 2F5DA 2ZNYA 3ABUA 4PJJA 5CQGA 4C30A 5DDGA 2UZKA 2E1MC 4HNUA 3OYEA 3CTAA 1IC8A 4WXDA 4EVIA 4Y7NJ 5D5XB 2COBA 1WJDA 5EF6A 2NVUB 2L7MP 2OAZA 2LFBA 4B3XA 4DIQA 2HPMA 2MYSA 5IPAA 1W0UA 2CG4A 2ME0A 3S3NA 5IT9Z 2QKMB 3KZYA 2ZMEA 4XKVA 2GAUA 3S93A 1ZLKA 3H3ZA 3H5AA 5E1XA 2BYVE 4XICA 1LEBA 2LY1A 2KIQA 2VXDA 1U9OA 4IF4A 1ZAOA 3ZN1A 1SAXA 1HC8A 4I99C 3LSMA 2TRTA 3R0AA 1V54H 4MO7A 2XAQA 5GAHJ 1FBUA 2LC2A 3F8BA 2QEXI 1FIAA 2EH3A 1GVDA 1YW8A 4RAYA 5IP9J 5JLXA 1Z7LA 4XK4A 3ZQFA 3OSFA 1QZZA 4ESJA 3BG3A 3WG7H 4L9JA 1LDKB 1WH7A 1F4KA 2XSDC 2OBPA 1P4AA 2DA2A 2VN2A 4G6QA 3ZMDA 5J47A 2ETHA 1AU7A 3SFZA 3HOTA 2HOSA 3E1SA 2BY1A 3F21A 1POGA 1WGXA 1Y0NA 2A6EF 3DPTA 1T8IA 2R7SA 1AA7A 4D5FA 3GTPJ 2XF5A 3QU6A 3LOCA 1Z3YA 1O3QA 5CLSA 2IEKA 2LKPA 3AL0C 2LG4A 2PMZA 3KYLA 4HRIA 5IT9K 2VONA 2A68F 1AKHA 1BI1A 2HQ5A 4RBOA 1OYIA 4UB6C 1O7LA 2OD5A 5DM6F 1BOAA 3M8EA 5K7HA 3HDDA 5C4XJ 2DT6A 2JRMA 1Z3XA 5FGMA 1H89C 1U5TC 3S15J 2M34A 3TO7A 1ACIA 3CC4I 1HF0A 4OINF 1LNWA 5J40A 5J4YA 1S72I 1FYMA 2XC7A 4ESFA 4LLNA 1DDNA 4HV5A 2WTEA 1ZRDA 3FKIJ 2L9NA 2KPMA 2VXZA 3C3WA 1F43A 2PMHA 5F04A 2XB5A 1ZYRF 1S7OA 4BNCA 3OS0A 3PNVA 3RI4A 2VBXA 2MGQA 1FT9A 3B6CA 2P7CB 3QODA 5FKLA 4LB6B 1LKXA 1MBKA 4PJ0C 1UMQA 1VZ0A 4KMFA 1MDMB 3FXQA 3K70C 2DTZA 3PFYA 3D1NI 5FO5A 3RYPA 1MKMA 2K4BA 1OJLA 4EJVA 4HDUA 4AIKA 1T33A 2UV1A 2R7QA 3E6MA 1R71A 2VJ4A 2A3SA 2PBIA 5M5XJ 5M5YJ 1JUSA 2UWMA 1IUFA 4BJ5C 4MHGA 1GLNA 1GHCA 3TW6A 3H35A 2TDXA 3S32A 2CWEA 3HUGA 4XN3A 2VKVA 3QOPA 4L9TA 4CCMA 4FTHA 3ESWB 1MMDA 1TWAJ 3DBRB 4E7IA 4DBRA 5LEJA 1J0RA 3QYBA 4HW0A 3SDBA 3FM3A 4MTEA 2JWTA 4AYBN 1B4AA 4LG3A 3HGYA 1E0EA 4I6ZA 2RAEA 2NAZA 5EJCA 3GTLJ 1RI7A 1R4MB 1HSTA 2IW5A 3ERED 1D0YA 1T2KA 1P92A 2HWVA 1FY7A 1TWCJ 4XRFA 2EPFA 3A0BC 3ZQIA 3C1DA 3QU3A 3SEQA 4BXXJ 2YS9A 2JA2A 5JVTA 1VQKI 4KYWA 2H94A 3D5LA 3M8JA 2XVCA 4RMNA 3E7LA 5E3NA 4AC0A 1APLC 1ETWA 2IS1A 1KZHA 4A5NA 1NH3A 1REPC 4UV9A 2HOEA 2KKOA 2F5VA 2ZXIA 4PCQA 5L3CA 1SVMA 4N9IA 1PJRA 2QQAA 3OWTA 4FX4A 2O5RA 4RS8A 3ZPLA 5FLMJ 2BVMA 3OYDA 2DOEA 2VBYA 2MC4A 2ZMEB 4LJZF 2VE8A 1O3SA 2VLAA 5GTIC 2VI6A 3FXLA 5EEAA 1P6RA 2E34A 2HQRA 1S29A 3OV8A 4F92B 1ON2A 9ANTA 1QO0D 5DV5A 4ETSA 1G6NA 2F48A 2A6TA 2K02A 4CCOA 2DMTA 2DFFA 5GP9A 4S05A 2HZTA 4OMYA 2R7VA 3E6CC 1FLIA 1G3SA 2CUJA 3M9AA 1JE8A 1X1BA 2XDVA 2YSRA 2NOGA 5K5QA 1JGSA 3G73A 1IW7F 1T98A 4FISA 1GDTA 3RKQA 2B63J 3I54A 5M3MJ 5A2QK 1MMAA 3G1LA 2MSYA 4XBFA 2VKHA 3FMSA 3CMAI 3CP2A 3O3KA 4ZH4F 2OJED 1WPKA 5EZHA 5ILSA 5GADJ 3OY9A 3H3VK 2R7UA 1EF4A 1R36A 1BR1A 1FYKA 3CMYA 2VE9A 4O6JA 3JR9A 1WWXA 4B4CA 1PUFB 3CJNA 2Y31A 4G6DA 3MAJA 1R22A 1RKWA 1XMXA 3S14J 2DK5A 2WWYA 1XX5A 2FMLA 1JJ6C 4BAYA 3TDZC 3BCBA 4P96A 1SFKA 5LEKA 2CS3A 5FD5A 1A35A 1IZ1A 2WAQA 3LSIA 4M3BA 4BXFA 4BGDA 3S2WA 2R4GA 2XRLA 4UHTA 4S04A 1FOWA 4A3CJ 3RSNA 1MH3A 3EUHA 1KA8A 4KIFA 2I10A 1W1WE 1OISA 1U5TB 4LB5A 5L3BA 3KZZA 3GVAA 3K0LA 2H8RA 1A5JA
chains in the Genus database with same CATH topology
5LGUA 4BHCA 3RDIA 5DCMA 3HOSA 4HX8A 5DUIA 3KP5A 1SD5A 1QBJA 2RDPA 3WTWC 3T8RA 5DEQA 3VB2A 3GZ6A 3T1BA 1IAWA 3RKWA 1MJAA 2XASA 1TW3A 2FU4A 4K2EA 2RC4A 5LRSA 3R60A 4GYGA 5E1WA 3H3UA 4CZZA 2NYXA 4JK1X 2MLGA 4KIGA 5E8IA 5FD6A 1G3TA 3R4KA 2FSWA 3F8CA 2P8TA 2ESHA 3FHZA 1USSA 4RAZA 2GIVA 2IA1A 2XHKA 4G7HF 3V8LA 3G3ZA 3TKYA 5CYVA 3CUQC 5IT3A 3K1MA 3JW4A 2QBYB 5D4RA 2ZCWA 2XIGA 3BJAA 1D3YA 3E97A 2JPBA 3LAJA 4P55A 3I64A 4EJUA 3HHHA 1CGPA 2L4MA 1NHAA 1GVJA 2KJBA 2XAFA 3F6VA 4R1HA 5D8KB 3BY6A 2F5CA 5L3GA 5BPIA 2PN6A 2MD5A 1TQIA 1XGSA 1XD7A 3ROUA 3J80K 2DU9A 3I59B 2JSCA 3V7SA 3HSRA 5HDGA 4HV6A 3R0JA 3WGHA 2ZNZA 1IN8A 2VT3A 5HLGA 1MD0A 2HS5A 2PMUA 4FT8A 4KN7X 5HLIA 2EV0A 2EA2A 1FP1D 3RPUA 1XMKA 3DXJF 5BQTA 2GXBA 3IC7A 1XGNA 4GYIA 3QRFF 3T8TA 4UV8A 2Z33A 5H6RA 4DQ2A 4HF0A 2JZYA 2PEXA 1XSDA 4LD5A 3EQLF 3HTUA 1XSVA 2HTJA 4RGXA 1XCVA 3F6OA 2Y75A 1R7JA 2FMYA 3KP7A 5DCMB 4NHJA 4ENJA 1B9MA 1B6AA 1QGPA 4Q47A 3KFWX 3HSEA 1ONVA 4CDGA 5E17F 3HRUA 2L02A 2IT0A 2Y48A 2VC0A 1D8KA 5KVRA 2F5EA 3TO6A 1I27A 2BEOA 3FMQA 4E70A 2QM3A 1BJAA 4OIQF 2WV0A 3QP5A 3GXOA 3V7RA 2LDUA 1C0WA 2MC3A 3M1EA 4I0BA 2AS5F 1S6LA 1DP7P 2DTRA 2MA3A 2IA2A 1RIOH 4AVPA 2EFPA 4LK1F 4ENMA 3DV8A 2KIMA 3GFMA 3MFKA 3KEOA 3V8JA 4U0YA 1LVAA 4UVBA 2FBHA 3MZYA 1TQMA 1LB2A 1T38A 2H09A 4HDVA 1T0FA 3BDDA 1LQ1A 3SHFA 4A0ZA 2JRTA 3RIRA 4M9ZA 4U0VA 3KP3A 4EGZA 4L0ZB 2P5VA 3SQNA 5LGTA 1E2XA 4EJWA 1P4WA 4CGZA 4PDKA 5ERIA 2HFHA 4IPAA 3GEZA 2DPDA 4F7ZA 2NS0A 2CFXA 2RV8A 3ECOA 3HRTA 1UHWA 3WGGA 1FYLA 2B0LA 1HW1A 3D0SA 4HLXA 1O3TA 2ESNA 1J2XA 1YG2A 2R7FA 1ZG1A 1TBXA 1V3FA 5E20A 1ZRFA 3IRQA 2OU2A 1IN7A 1SMYF 2MLKA 4MQVA 1L0OC 5BOXA 3H92A 3QPHA 4EM0B 3CDHA 4EM1A 1KYZA 3WTZA 2D1HA 4M71A 1TTYA 5AONA 4WCGA 3PQJA 5FB2A 5ICEA 2V6CA 3WTSC 4OIOF 5CVJA 2IA0A 2LF7A 2HQNA 3KP4A 2ISZA 4L9VA 4HAMA 3W6JB 4I01A 1MJ9A 2XKOA 2EFNA 2JT1A 2OA4A 2RQPA 1YO5C 3V8KA 3GF2A 2GQQA 1MGTA 2QQ9A 2IRFG 2ZXJA 3EETA 3HHGA 5FLXZ 1IRFA 5HDNA 1QPMA 2H6CA 2Q8KA 1FZPB 1FBSA 3DPLC 1BIBA 3GO5A 1U5TA 2DW4A 3E3VA 1HW2A 1KQ8A 3KE2A 2DPUA 2EFOA 3R6SA 4ZZLA 1R23A 5HDKA 1ZG3A 5ILUA 4XLPF 2A6HF 2FA5A 2NNNA 4M6XA 3KEQA 4CYDA 3DP7A 2K4JA 5DCFA 4YG2F 2ACJA 3WG9A 3O6BB 6PAXA 2RGVA 1HKTA 4YFXF 5FLXK 2W25A 3GFLA 4OIRF 2A69F 2EV5A 1YYVA 1BM9A 4OIPF 2IVMA 2KJCA 3LSTA 2BGCA 1BI0A 1JHFA 3I71A 1ZGAA 1QNTA 5LHIA 3P7NA 1U3EM 3COAC 1JXSA 4GO1A 2MH9A 5LBQA 2ZKZA 1XMAA 5A2QZ 4Y15A 1A04A 2QBYA 2GWRA 4XSXF 1FBQA 2M45A 3QAHA 4FX0A 5J8FA 1I1GA 2M8EA 5D5WB 2FXAA 1FNNA 2YR2A 3GYHX 3FZVA 3T5XA 2CGPA 4TV7A 4I09A 1YTYA 4R79A 4MNUA 2BBYA 1BN5A 3ZMTA 2GZWA 2LF8A 3BJOA 1TNSA 5CJ9A 1KGSA 3V7CA 3TOBA 2IPQX 3I59A 3HIFA 1F5TA 3MQ0A 5CVVA 3K69A 1IRGA 1S8NA 3TDUC 1KU3A 3K1PA 2C6YA 3F22A 3FF5A 2FOKA 1UFMA 4EMSA 3FMRA 2EFWA 3RPQA 4YFKF 4M74A 5K5OA 2XGXA 1JHHA 4B8XA 1FP2A 4AD9A 3BOQA 2XAHA 5DUKA 5FFZA 3J81K 3LQQA 4RB1A 1K79A 5E18F 2ZO4A 4ON0A 3ZMVA 4EGYA 2ADUA 3HRMA 4IRIA 2XAGA 4ZYEA 1H9TA 2DLLA 4IJAA 3F72A 4RB3C 3CO6C 1IXCA 3DQVC 2V1UA 4ZYHA 2O8XA 1H0MA 3JAMZ 1SFEA 2OZUA 4Y17A 3KETA 1BI2A 1HSJA 2CQKA 1YS6A 1GXPA 2Z3YA 3CLOA 5L3FA 3WTVC 1R1VA 4AIJA 4BXUA 4MGRA 1BC8C 3JSOA 1R00A 1RUOA 4HLYA 3L00A 5K5RA 1D8JA 1ZARA 4WX9A 2NNYA 5ICGA 3JTGA 4O3MA 3LQRA 4KIBA 1WI9A 2P7VB 2YU3A 3ABTA 4RGRA 1T6SA 3I53A 3J80Z 3C18A 3F8NA 2O03A 1FWZA 1HKQA 1B1BA 3GLXA 3CUOA 3JAMK 4LGWA 4LK0F 1KU2A 1ZH5A 4EJOA 3IWFA 5ILVA 3L2CA 4RGUA 5JFRA 3W6KB 2PLYA 1SFXA 4CHUA 4ENKA 3RJPA 3KLOA 2FEZA 4M72A 2EFQA 5DD8A 2AXLA 1Y0UA 1B59A 5EEHA 5D5UB 2ZBKA 1QQIA 2QWWA 1EH7A 1Q1HA 4KICA 4HYEA 2PFBA 3I0TA 5EEGA 4HQEA 3B02A 4GGGA 3IHUA 5BMZA 2V1DA 1PP8F 2VBZA 1YW7A 3L09A 4AWXB 4P9FA 1XGOA 3IKVA 2K7LA 1K7AA 3F3XA 2HTSA 3ECHA 4I7HA 5ICCA 1ZGJA 2HKXA 4BQAA 2DQLA 2V9VA 1Z91A 2V79A 1OPCA 3TQNA 4M73A 4XLNF 2LNBA 5CVIA 2VT2A 1EH8A 4H0EA 2PQ8A 1YFHA 3GW2A 4G7ZF 3BP8A 1RZ4A 2QQBA 4EM2A 2Q2EA 2R7DA 4M6YA 3IWZA 1R5GA 2RN7A 1KU9A 2X0LA 3I58A 4KNYA 2NRAC 3FX3A 3NEUA 3RYRA 1ZREA 1ZN2A 3U1DA 1EV7A 1O57A 2DK8A 4GXOA 3HSFA 3EYIA 4PZJA 3WU1B 1W7PA 4IHTA 2L01A 3Q9VA 1IXRC 1EH6A 1S3JA 1J9IA 1FC3A 4HBLA 4MTDA 2D45A 2ELHA 3ISPA 5JI6A 5CVUA 2QENA 1B9NA 1IN5A 1DPUA 3PFIA 2O3FA 4G8XA 1BC7C 5BPDA 5J6XA 5AIPA 3HRSA 2IJLA 2FBKA 2Z99A 2DQRA 1GXQA 1XCBA 3DEUA 4G9YA 2VODA 2J5OA 4YIIA 5ICFA 1S7AA 3CUQB 5F64A 2DO7A 4A5MA 4L5JA 3J7AO 3FM5A 3F23A 1ODDA 1BBYA 1YIOA 3Q9SA 1TW2A 1AOYA 4YFNF 3AAFA 4G7OF 4PGGA 3KCCA 2EJRA 2XV4S 4IHSA 3E6BA 3M7GA 4RB2C 1Z05A 3Q5FA 2HYGD 2G7UA 3GZ5A 3K1NA 1J5YA 2Y0MA 4WXCA 4BYYA 1OYWA 4ESBA 2ISYA 2QUFA 1XN7A 2G9WA 4JBAA 2M5WA 2HEOA 3O2PE 5HS9A 2ZFWA 2FE3A 5D6EA 1XGMA 4UNOA 1LJ9A 3N4MA 4HZFA 4UVCA 1DUXC 1YQAA 1K78B 3RKYA 2A5YB 2K86A 5LLQA 1WRJA 3WU0A 1UB9A 4U0WA 3WTUC 2VC1A 4EJTA 5HOOA 3SZPA 4O5VA 1KU7A 3LAPA 5D8LB 3GUDA 2L3DA 3GX4X 4NQWA 3ZQ7A 3FXRA 1AWCA 2ZJ2A 1R5HA 4AIHA 4BHBA 1XDSA 5H6QA 4A0XA 4P9UA 1Z9CA 2KIFA 2E1CA 2M1BA 1OMIA 1W7PB 2QLZA 1HXDA 2OQGA 4KN4X 4P5OA 4UXNA 1J59A 3KLNA 1PDNC 1UHMA 2W84A 2VBWA 3VEPA 3WTTC 2DI3A 3ZP5A 5TRDA 2VOOA 4I02A 3IRRA 2DAOA 4L0YB 1G3YA 2FRHA 1LDJA 4MEYF 3FXUA 1IN4A 3GWZA 5E1ZB 5FFXA 1ZRCA 2P6TA 4EQQA 4Z2YA 2E7XA 2IP2A 2COMA 1X3UA 1R1UA 3L7WA 1OYYA 2R3SA 3EYYA 2Z5UA 3WTXC 3NRVA 4L18B 2GA1A 1SMTA 1MZBA 2G7HA 1IUYA 1ZLJA 5DYMA 1O3RA 4HX4A 2O61A 2QYOA 2PI0A 3DKWA 4FHTA 5E8GA 3OOPA 1OR7A 2Q0OA 2FNAA 1CF7B 1W5TA 1W4MA 3DFGA 2HYFA 1WSUA 3QP6A 3MZHA 2L54A 1FX7A 5AIQA 2XKPA 3U9GA 2XUBA 2X4HA 4L9NA 3SXYA 2RKHA 5DD4A 2P5KA 3J81Z 5F1RA 1KQ9A 3RTRA 2HKOA 3BJ6A 2O6GE 4DNCA 1K6OA 1I6XA 3LA3A 4LLGF 1RUNA 3JSPA 1IF1A 2F2EA 1FOKA 2BV6A 2CW0F 2STTA 3REOA 1OKRA 4Q5SF 2RVCA 4I0AA 2EB7A 4YIFA 1D5VA 1WKMA 4HF2A 2PG4A 3BPVA 4ASNA 4CXFA 1SD4A 1FPQA 3LA7A 3HTSB 3GFIA 1Z6RA 3WODF 2LSOA 4IRGA 1HBXG 1J7KA 4HX7A 4KDPA 3IL2A 3JTHA 1G3WA 3VOEA 4LFUA 2YX7A 3M8FA 4BHPA 2L4AA 3BPXA 4KFCA 1YW9A 2CSOA 1Z1DA 3E6DA 5LHGA 4LG0A 4A2UA 4IXAA 3TO9A 4U7DA 5D4SA 1LDDA 2A07F 3FWEA 4ZYGA 1SD6A 1J75A 4KA4A 3PQKA 2KIUA 1L3LA 3LFKA 4XSZF 5LHHA 4UUVA 1TLHB 2YPRA 3TGNA 2HR3A 4ZZDA 3T0YA 3KP2A 1BIAA 4HF1A 3BWGA 1YS7A 2UXXA 4ENNA 2FNPA 3GFJA 2DFIA 3VODA 5L3EA 4UVAA 4HOBA 4KUMA 2F5FA 2YX4A 3LA2A 3E5QA 2MBFA 2VOPA 5D6FA 5ED4A 5L3DA 1P4XA 4A6EA 2STWA 2UXNA 3VFZA 2P6SA 3CUQA 2XAJA 3P9IA 1E17A 1BI3A 3K9TA 1FSEA 4G94A 4HA8A 2D1VA 2K27A 1XDUA 3QPTA 4WK8F 1DPRA 1PUEE 4KT5C 4R8HA 3EDPA 4LLLA 4I2OA 4QWQA 1VTNC 1KQ0A 2MH2A 5LGNA 3CO7C 1W5SA 5JR3A 1I1SA 4B09A 2CO5A 3R61A 1FSHA 4MEXF 4A0YA 1HKSA 1XSXA 1WQ2A 3ML6A 4CO8A 4MQ9F 4IRHA 2GA2A 2EWNA 4M9XA 1R58A 1HW5A 3N97A 1UCRA 2O0YA 3C7JA 3IKTA 5KK1A 1ZG5A 2QZ8A 1ULYA 4I98B 1IXSB 3HYIA 2Z9OA 5D5VB 1SFUA 2A61A 4OMZA 4WWCA 1TNTA 3WE3A 4OOIA 4PGHA 4U88A 3RKXA 5HS8A 1U2WA 4N0BA 1K78A 3SZTA 5HLHA 1QZYA 3KP6A 1SD7A 3ZMSA 3I5UA 1G4DA 2M30A 1ZHFA 2OZ6A 3P9KA 4KMUX 4CICA 5HVQC 4LG0B 2H27A 3F8MA 1F1ZA 4ZYDA 1U78A 1P2FA 2E7WA 5HS7A 3F8FA 4A6DA 1KYWA 1LEAA 1Z6TA 2KRFA 2BE5F 4JQFA 3U2RA 2OQRA 5TJJA 3K2ZA 1T39A 5H20A 2M87A 2P4WA 5CVRA 5BS6A 1YLFA 4A12A 4BH9A 4NB5A 2WC2A 2W85A 5JHUA 1I5ZA 1XB4A 2XROA 2DT5A 2J5PA 1O7FA 2H6BA 4RB0A 4Q48A 3TOAA 1W7PD 2JTVA 1R1TA 3BROA 1PP7U 2HGCA 3WGIA 2XRNA 2FF4A 2GXGA 4LMYA 2CYYA 3DF8A 5F6FA 1U6GA 5K1YA 3ZMZA 2EK5A 2EV6A 3WTYC 2V1XA 3NQOA 1STZA 4WF2A 4N9HA 2P5LC 1V4RA 3WE2A 2RNJA 2D2WA 1HQCA 3P9CA 5LRRA 4WXHA 1MDMA 2QVOA 1H9GA 4GCVA 3LWFA 3E5UA 2FBIA 3ZMUA 2PJPA 4Q4ZF 5J8CA 1F9NA 1Z7UA 4IVNA 4RGSA 1MJBA 3MCZA 2HDCA 2DBBA 2FQ3A 1TQPA 2E1NA 3E5XA 1RNLA 3V4GA 4HQMA 2W57A 1CF7A 2W24A 1IN6A 3MEXA 2EA4A 4EV0A 1ON1A 1U8RA 4L5IA 3ULQB 3I4PA 4OU0A 3B73A 4U7BA 4Y13A 3MWMA 2JPCA 4D0PA 3L9FA 4M9SA 3BZ6A 3ZN0A 4QLCU 1USTA 3ELKA 2UZKA 3ABUA 2F5DA 2ZNYA 5DDGA 3CTAA 4WXDA 4EVIA 5D5XB 2OAZA 2CG4A 5IT9Z 3KZYA 2ZMEA 2GAUA 1ZLKA 3H3ZA 5E1XA 2BYVE 1LEBA 4IF4A 1ZAOA 3ZN1A 1SAXA 3R0AA 2XAQA 1FBUA 3F8BA 1YW8A 4RAYA 1QZZA 4ESJA 4L9JA 1LDKB 1F4KA 2OBPA 1P4AA 2VN2A 4G6QA 3ZMDA 2ETHA 3SFZA 3HOTA 3F21A 2A6EF 3DPTA 3QU6A 1O3QA 5CLSA 2LKPA 5IT9K 2VONA 2A68F 1BI1A 1OYIA 1O7LA 2OD5A 1BOAA 3M8EA 5FGMA 1U5TC 3TO7A 4OINF 1LNWA 1FYMA 4ESFA 4LLNA 1DDNA 4HV5A 2WTEA 1ZRDA 2VXZA 3C3WA 2PMHA 1ZYRF 1S7OA 4BNCA 3RI4A 2VBXA 1FT9A 2P7CB 4LB6B 4KMFA 1MDMB 3FXQA 5FO5A 3RYPA 1MKMA 2K4BA 4EJVA 4HDUA 4AIKA 3E6MA 2A3SA 2PBIA 2UWMA 4MHGA 1GHCA 2TDXA 2CWEA 3HUGA 3QOPA 4L9TA 5LEJA 1J0RA 4HW0A 3FM3A 4MTEA 1B4AA 2NAZA 1RI7A 1HSTA 3ERED 2IW5A 1T2KA 1P92A 2HWVA 1FY7A 4XRFA 3C1DA 3QU3A 5JVTA 4KYWA 2H94A 3D5LA 2XVCA 4A5NA 1REPC 4UV9A 2HOEA 2KKOA 4PCQA 5L3CA 4N9IA 2QQAA 4FX4A 4RS8A 3ZPLA 2VBYA 2ZMEB 4LJZF 2VE8A 1O3SA 1P6RA 2HQRA 1S29A 3OV8A 1ON2A 1QO0D 5DV5A 4ETSA 1G6NA 2K02A 4S05A 2HZTA 4OMYA 3E6CC 1FLIA 1G3SA 1JE8A 3M9AA 2YSRA 5K5QA 1JGSA 3G73A 1IW7F 1T98A 3I54A 5A2QK 4XBFA 3FMSA 3O3KA 4ZH4F 5ILSA 1R36A 1FYKA 2VE9A 4O6JA 1WWXA 3CJNA 4G6DA 3MAJA 1R22A 2DK5A 2WWYA 2FMLA 4BAYA 3TDZC 4P96A 5LEKA 5FD5A 1IZ1A 3S2WA 4UHTA 4S04A 3EUHA 1KA8A 4KIFA 1U5TB 4LB5A 5L3BA 3KZZA 3GVAA 3K0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LGU A;  4BHC A;  3RDI A;  5DCM A;  3HOS A;  4HX8 A;  5DUI A;  3KP5 A;  1SD5 A;  1QBJ A;  2RDP A;  3WTW C;  3T8R A;  5DEQ A;  3VB2 A;  3GZ6 A;  3T1B A;  1IAW A;  3RKW A;  1MJA A;  2XAS A;  1TW3 A;  2FU4 A;  4K2E A;  2RC4 A;  5LRS A;  3R60 A;  4GYG A;  5E1W A;  3H3U A;  4CZZ A;  2NYX A;  4JK1 X;  2MLG A;  4KIG A;  5E8I A;  5FD6 A;  1G3T A;  3R4K A;  2FSW A;  3F8C A;  2P8T A;  2ESH A;  3FHZ A;  1USS A;  4RAZ A;  2GIV A;  2IA1 A;  2XHK A;  4G7H F;  3V8L A;  3G3Z A;  3TKY A;  5CYV A;  3CUQ C;  5IT3 A;  3K1M A;  3JW4 A;  2QBY B;  5D4R A;  2ZCW A;  2XIG A;  3BJA A;  1D3Y A;  3E97 A;  2JPB A;  3LAJ A;  4P55 A;  3I64 A;  4EJU A;  3HHH A;  1CGP A;  2L4M A;  1NHA A;  1GVJ A;  2KJB A;  2XAF A;  3F6V A;  4R1H A;  5D8K B;  3BY6 A;  2F5C A;  5L3G A;  5BPI A;  2PN6 A;  2MD5 A;  1TQI A;  1XGS A;  1XD7 A;  3ROU A;  3J80 K;  2DU9 A;  3I59 B;  2JSC A;  3V7S A;  3HSR A;  5HDG A;  4HV6 A;  3R0J A;  3WGH A;  2ZNZ A;  1IN8 A;  2VT3 A;  5HLG A;  1MD0 A;  2HS5 A;  2PMU A;  4FT8 A;  4KN7 X;  5HLI A;  2EV0 A;  2EA2 A;  1FP1 D;  3RPU A;  1XMK A;  3DXJ F;  5BQT A;  2GXB A;  3IC7 A;  1XGN A;  4GYI A;  3QRF F;  3T8T A;  4UV8 A;  2Z33 A;  5H6R A;  4DQ2 A;  4HF0 A;  2JZY A;  2PEX A;  1XSD A;  4LD5 A;  3EQL F;  3HTU A;  1XSV A;  2HTJ A;  4RGX A;  1XCV A;  3F6O A;  2Y75 A;  1R7J A;  2FMY A;  3KP7 A;  5DCM B;  4NHJ A;  4ENJ A;  1B9M A;  1B6A A;  1QGP A;  4Q47 A;  3KFW X;  3HSE A;  1ONV A;  4CDG A;  5E17 F;  3HRU A;  2L02 A;  2IT0 A;  2Y48 A;  2VC0 A;  1D8K A;  5KVR A;  2F5E A;  3TO6 A;  1I27 A;  2BEO A;  3FMQ A;  4E70 A;  2QM3 A;  1BJA A;  4OIQ F;  2WV0 A;  3QP5 A;  3GXO A;  3V7R A;  2LDU A;  1C0W A;  2MC3 A;  3M1E A;  4I0B A;  2AS5 F;  1S6L A;  1DP7 P;  2DTR A;  2MA3 A;  2IA2 A;  1RIO H;  4AVP A;  2EFP A;  4LK1 F;  4ENM A;  3DV8 A;  2KIM A;  3GFM A;  3MFK A;  3KEO A;  3V8J A;  4U0Y A;  1LVA A;  4UVB A;  2FBH A;  3MZY A;  1TQM A;  1LB2 A;  1T38 A;  2H09 A;  4HDV A;  1T0F A;  3BDD A;  1LQ1 A;  3SHF A;  4A0Z A;  2JRT A;  3RIR A;  4M9Z A;  4U0V A;  3KP3 A;  4EGZ A;  4L0Z B;  2P5V A;  3SQN A;  5LGT A;  1E2X A;  4EJW A;  1P4W A;  4CGZ A;  4PDK A;  5ERI A;  2HFH A;  4IPA A;  3GEZ A;  2DPD A;  4F7Z A;  2NS0 A;  2CFX A;  2RV8 A;  3ECO A;  3HRT A;  1UHW A;  3WGG A;  1FYL A;  2B0L A;  1HW1 A;  3D0S A;  4HLX A;  1O3T A;  2ESN A;  1J2X A;  1YG2 A;  2R7F A;  1ZG1 A;  1TBX A;  1V3F A;  5E20 A;  1ZRF A;  3IRQ A;  2OU2 A;  1IN7 A;  1SMY F;  2MLK A;  4MQV A;  1L0O C;  5BOX A;  3H92 A;  3QPH A;  4EM0 B;  3CDH A;  4EM1 A;  1KYZ A;  3WTZ A;  2D1H A;  4M71 A;  1TTY A;  5AON A;  4WCG A;  3PQJ A;  5FB2 A;  5ICE A;  2V6C A;  3WTS C;  4OIO F;  5CVJ A;  2IA0 A;  2LF7 A;  2HQN A;  3KP4 A;  2ISZ A;  4L9V A;  4HAM A;  3W6J B;  4I01 A;  1MJ9 A;  2XKO A;  2EFN A;  2JT1 A;  2OA4 A;  2RQP A;  1YO5 C;  3V8K A;  3GF2 A;  2GQQ A;  1MGT A;  2QQ9 A;  2IRF G;  2ZXJ A;  3EET A;  3HHG A;  5FLX Z;  1IRF A;  5HDN A;  1QPM A;  2H6C A;  2Q8K A;  1FZP B;  1FBS A;  3DPL C;  1BIB A;  3GO5 A;  1U5T A;  2DW4 A;  3E3V A;  1HW2 A;  1KQ8 A;  3KE2 A;  2DPU A;  2EFO A;  3R6S A;  4ZZL A;  1R23 A;  5HDK A;  1ZG3 A;  5ILU A;  4XLP F;  2A6H F;  2FA5 A;  2NNN A;  4M6X A;  3KEQ A;  4CYD A;  3DP7 A;  2K4J A;  5DCF A;  4YG2 F;  2ACJ A;  3WG9 A;  3O6B B;  6PAX A;  2RGV A;  1HKT A;  4YFX F;  5FLX K;  2W25 A;  3GFL A;  4OIR F;  2A69 F;  2EV5 A;  1YYV A;  1BM9 A;  4OIP F;  2IVM A;  2KJC A;  3LST A;  2BGC A;  1BI0 A;  1JHF A;  3I71 A;  1ZGA A;  1QNT A;  5LHI A;  3P7N A;  1U3E M;  3COA C;  1JXS A;  4GO1 A;  2MH9 A;  5LBQ A;  2ZKZ A;  1XMA A;  5A2Q Z;  4Y15 A;  1A04 A;  2QBY A;  2GWR A;  4XSX F;  1FBQ A;  2M45 A;  3QAH A;  4FX0 A;  5J8F A;  1I1G A;  2M8E A;  5D5W B;  2FXA A;  1FNN A;  2YR2 A;  3GYH X;  3FZV A;  3T5X A;  2CGP A;  4TV7 A;  4I09 A;  1YTY A;  4R79 A;  4MNU A;  2BBY A;  1BN5 A;  3ZMT A;  2GZW A;  2LF8 A;  3BJO A;  1TNS A;  5CJ9 A;  1KGS A;  3V7C A;  3TOB A;  2IPQ X;  3I59 A;  3HIF A;  1F5T A;  3MQ0 A;  5CVV A;  3K69 A;  1IRG A;  1S8N A;  3TDU C;  1KU3 A;  3K1P A;  2C6Y A;  3F22 A;  3FF5 A;  2FOK A;  1UFM A;  4EMS A;  3FMR A;  2EFW A;  3RPQ A;  4YFK F;  4M74 A;  5K5O A;  2XGX A;  1JHH A;  4B8X A;  1FP2 A;  4AD9 A;  3BOQ A;  2XAH A;  5DUK A;  5FFZ A;  3J81 K;  3LQQ A;  4RB1 A;  1K79 A;  5E18 F;  2ZO4 A;  4ON0 A;  3ZMV A;  4EGY A;  2ADU A;  3HRM A;  4IRI A;  2XAG A;  4ZYE A;  1H9T A;  2DLL A;  4IJA A;  3F72 A;  4RB3 C;  3CO6 C;  1IXC A;  3DQV C;  2V1U A;  4ZYH A;  2O8X A;  1H0M A;  3JAM Z;  1SFE A;  2OZU A;  4Y17 A;  3KET A;  1BI2 A;  1HSJ A;  2CQK A;  1YS6 A;  1GXP A;  2Z3Y A;  3CLO A;  5L3F A;  3WTV C;  1R1V A;  4AIJ A;  4BXU A;  4MGR A;  1BC8 C;  3JSO A;  1R00 A;  1RUO A;  4HLY A;  3L00 A;  5K5R A;  1D8J A;  1ZAR A;  4WX9 A;  2NNY A;  5ICG A;  3JTG A;  4O3M A;  3LQR A;  4KIB A;  1WI9 A;  2P7V B;  2YU3 A;  3ABT A;  4RGR A;  1T6S A;  3I53 A;  3J80 Z;  3C18 A;  3F8N A;  2O03 A;  1FWZ A;  1HKQ A;  1B1B A;  3GLX A;  3CUO A;  3JAM K;  4LGW A;  4LK0 F;  1KU2 A;  1ZH5 A;  4EJO A;  3IWF A;  5ILV A;  3L2C A;  4RGU A;  5JFR A;  3W6K B;  2PLY A;  1SFX A;  4CHU A;  4ENK A;  3RJP A;  3KLO A;  2FEZ A;  4M72 A;  2EFQ A;  5DD8 A;  2AXL A;  1Y0U A;  1B59 A;  5EEH A;  5D5U B;  2ZBK A;  1QQI A;  2QWW A;  1EH7 A;  1Q1H A;  4KIC A;  4HYE A;  2PFB A;  3I0T A;  5EEG A;  4HQE A;  3B02 A;  4GGG A;  3IHU A;  5BMZ A;  2V1D A;  1PP8 F;  2VBZ A;  1YW7 A;  3L09 A;  4AWX B;  4P9F A;  1XGO A;  3IKV A;  2K7L A;  1K7A A;  3F3X A;  2HTS A;  3ECH A;  4I7H A;  5ICC A;  1ZGJ A;  2HKX A;  4BQA A;  2DQL A;  2V9V A;  1Z91 A;  2V79 A;  1OPC A;  3TQN A;  4M73 A;  4XLN F;  2LNB A;  5CVI A;  2VT2 A;  1EH8 A;  4H0E A;  2PQ8 A;  1YFH A;  3GW2 A;  4G7Z F;  3BP8 A;  1RZ4 A;  2QQB A;  4EM2 A;  2Q2E A;  2R7D A;  4M6Y A;  3IWZ A;  1R5G A;  2RN7 A;  1KU9 A;  2X0L A;  3I58 A;  4KNY A;  2NRA C;  3FX3 A;  3NEU A;  3RYR A;  1ZRE A;  1ZN2 A;  3U1D A;  1EV7 A;  1O57 A;  2DK8 A;  4GXO A;  3HSF A;  3EYI A;  4PZJ A;  3WU1 B;  1W7P A;  4IHT A;  2L01 A;  3Q9V A;  1IXR C;  1EH6 A;  1S3J A;  1J9I A;  1FC3 A;  4HBL A;  4MTD A;  2D45 A;  2ELH A;  3ISP A;  5JI6 A;  5CVU A;  2QEN A;  1B9N A;  1IN5 A;  1DPU A;  3PFI A;  2O3F A;  4G8X A;  1BC7 C;  5BPD A;  5J6X A;  5AIP A;  3HRS A;  2IJL A;  2FBK A;  2Z99 A;  2DQR A;  1GXQ A;  1XCB A;  3DEU A;  4G9Y A;  2VOD A;  2J5O A;  4YII A;  5ICF A;  1S7A A;  3CUQ B;  5F64 A;  2DO7 A;  4A5M A;  4L5J A;  3J7A O;  3FM5 A;  3F23 A;  1ODD A;  1BBY A;  1YIO A;  3Q9S A;  1TW2 A;  1AOY A;  4YFN F;  3AAF A;  4G7O F;  4PGG A;  3KCC A;  2EJR A;  2XV4 S;  4IHS A;  3E6B A;  3M7G A;  4RB2 C;  1Z05 A;  3Q5F A;  2HYG D;  2G7U A;  3GZ5 A;  3K1N A;  1J5Y A;  2Y0M A;  4WXC A;  4BYY A;  1OYW A;  4ESB A;  2ISY A;  2QUF A;  1XN7 A;  2G9W A;  4JBA A;  2M5W A;  2HEO A;  3O2P E;  5HS9 A;  2ZFW A;  2FE3 A;  5D6E A;  1XGM A;  4UNO A;  1LJ9 A;  3N4M A;  4HZF A;  4UVC A;  1DUX C;  1YQA A;  1K78 B;  3RKY A;  2A5Y B;  2K86 A;  5LLQ A;  1WRJ A;  3WU0 A;  1UB9 A;  4U0W A;  3WTU C;  2VC1 A;  4EJT A;  5HOO A;  3SZP A;  4O5V A;  1KU7 A;  3LAP A;  5D8L B;  3GUD A;  2L3D A;  3GX4 X;  4NQW A;  3ZQ7 A;  3FXR A;  1AWC A;  2ZJ2 A;  1R5H A;  4AIH A;  4BHB A;  1XDS A;  5H6Q A;  4A0X A;  4P9U A;  1Z9C A;  2KIF A;  2E1C A;  2M1B A;  1OMI A;  1W7P B;  2QLZ A;  1HXD A;  2OQG A;  4KN4 X;  4P5O A;  4UXN A;  1J59 A;  3KLN A;  1PDN C;  1UHM A;  2W84 A;  2VBW A;  3VEP A;  3WTT C;  2DI3 A;  3ZP5 A;  5TRD A;  2VOO A;  4I02 A;  3IRR A;  2DAO A;  4L0Y B;  1G3Y A;  2FRH A;  1LDJ A;  4MEY F;  3FXU A;  1IN4 A;  3GWZ A;  5E1Z B;  5FFX A;  1ZRC A;  2P6T A;  4EQQ A;  4Z2Y A;  2E7X A;  2IP2 A;  2COM A;  1X3U A;  1R1U A;  3L7W A;  1OYY A;  2R3S A;  3EYY A;  2Z5U A;  3WTX C;  3NRV A;  4L18 B;  2GA1 A;  1SMT A;  1MZB A;  2G7H A;  1IUY A;  1ZLJ A;  5DYM A;  1O3R A;  4HX4 A;  2O61 A;  2QYO A;  2PI0 A;  3DKW A;  4FHT A;  5E8G A;  3OOP A;  1OR7 A;  2Q0O A;  2FNA A;  1CF7 B;  1W5T A;  1W4M A;  3DFG A;  2HYF A;  1WSU A;  3QP6 A;  3MZH A;  2L54 A;  1FX7 A;  5AIQ A;  2XKP A;  3U9G A;  2XUB A;  2X4H A;  4L9N A;  3SXY A;  2RKH A;  5DD4 A;  2P5K A;  3J81 Z;  5F1R A;  1KQ9 A;  3RTR A;  2HKO A;  3BJ6 A;  2O6G E;  4DNC A;  1K6O A;  1I6X A;  3LA3 A;  4LLG F;  1RUN A;  3JSP A;  1IF1 A;  2F2E A;  1FOK A;  2BV6 A;  2CW0 F;  2STT A;  3REO A;  1OKR A;  4Q5S F;  2RVC A;  4I0A A;  2EB7 A;  4YIF A;  1D5V A;  1WKM A;  4HF2 A;  2PG4 A;  3BPV A;  4ASN A;  4CXF A;  1SD4 A;  1FPQ A;  3LA7 A;  3HTS B;  3GFI A;  1Z6R A;  3WOD F;  2LSO A;  4IRG A;  1HBX G;  1J7K A;  4HX7 A;  4KDP A;  3IL2 A;  3JTH A;  1G3W A;  3VOE A;  4LFU A;  2YX7 A;  3M8F A;  4BHP A;  2L4A A;  3BPX A;  4KFC A;  1YW9 A;  2CSO A;  1Z1D A;  3E6D A;  5LHG A;  4LG0 A;  4A2U A;  4IXA A;  3TO9 A;  4U7D A;  5D4S A;  1LDD A;  2A07 F;  3FWE A;  4ZYG A;  1SD6 A;  1J75 A;  4KA4 A;  3PQK A;  2KIU A;  1L3L A;  3LFK A;  4XSZ F;  5LHH A;  4UUV A;  1TLH B;  2YPR A;  3TGN A;  2HR3 A;  4ZZD A;  3T0Y A;  3KP2 A;  1BIA A;  4HF1 A;  3BWG A;  1YS7 A;  2UXX A;  4ENN A;  2FNP A;  3GFJ A;  2DFI A;  3VOD A;  5L3E A;  4UVA A;  4HOB A;  4KUM A;  2F5F A;  2YX4 A;  3LA2 A;  3E5Q A;  2MBF A;  2VOP A;  5D6F A;  5ED4 A;  5L3D A;  1P4X A;  4A6E A;  2STW A;  2UXN A;  3VFZ A;  2P6S A;  3CUQ A;  2XAJ A;  3P9I A;  1E17 A;  1BI3 A;  3K9T A;  1FSE A;  4G94 A;  4HA8 A;  2D1V A;  2K27 A;  1XDU A;  3QPT A;  4WK8 F;  1DPR A;  1PUE E;  4KT5 C;  4R8H A;  3EDP A;  4LLL A;  4I2O A;  4QWQ A;  1VTN C;  1KQ0 A;  2MH2 A;  5LGN A;  3CO7 C;  1W5S A;  5JR3 A;  1I1S A;  4B09 A;  2CO5 A;  3R61 A;  1FSH A;  4MEX F;  4A0Y A;  1HKS A;  1XSX A;  1WQ2 A;  3ML6 A;  4CO8 A;  4MQ9 F;  4IRH A;  2GA2 A;  2EWN A;  4M9X A;  1R58 A;  1HW5 A;  3N97 A;  1UCR A;  2O0Y A;  3C7J A;  3IKT A;  5KK1 A;  1ZG5 A;  2QZ8 A;  1ULY A;  4I98 B;  1IXS B;  3HYI A;  2Z9O A;  5D5V B;  1SFU A;  2A61 A;  4OMZ A;  4WWC A;  1TNT A;  3WE3 A;  4OOI A;  4PGH A;  4U88 A;  3RKX A;  5HS8 A;  1U2W A;  4N0B A;  1K78 A;  3SZT A;  5HLH A;  1QZY A;  3KP6 A;  1SD7 A;  3ZMS A;  3I5U A;  1G4D A;  2M30 A;  1ZHF A;  2OZ6 A;  3P9K A;  4KMU X;  4CIC A;  5HVQ C;  4LG0 B;  2H27 A;  3F8M A;  1F1Z A;  4ZYD A;  1U78 A;  1P2F A;  2E7W A;  5HS7 A;  3F8F A;  4A6D A;  1KYW A;  1LEA A;  1Z6T A;  2KRF A;  2BE5 F;  4JQF A;  3U2R A;  2OQR A;  5TJJ A;  3K2Z A;  1T39 A;  5H20 A;  2M87 A;  2P4W A;  5CVR A;  5BS6 A;  1YLF A;  4A12 A;  4BH9 A;  4NB5 A;  2WC2 A;  2W85 A;  5JHU A;  1I5Z A;  1XB4 A;  2XRO A;  2DT5 A;  2J5P A;  1O7F A;  2H6B A;  4RB0 A;  4Q48 A;  3TOA A;  1W7P D;  2JTV A;  1R1T A;  3BRO A;  1PP7 U;  2HGC A;  3WGI A;  2XRN A;  2FF4 A;  2GXG A;  4LMY A;  2CYY A;  3DF8 A;  5F6F A;  1U6G A;  5K1Y A;  3ZMZ A;  2EK5 A;  2EV6 A;  3WTY C;  2V1X A;  3NQO A;  1STZ A;  4WF2 A;  4N9H A;  2P5L C;  1V4R A;  3WE2 A;  2RNJ A;  2D2W A;  1HQC A;  3P9C A;  5LRR A;  4WXH A;  1MDM A;  2QVO A;  1H9G A;  4GCV A;  3LWF A;  3E5U A;  2FBI A;  3ZMU A;  2PJP A;  4Q4Z F;  5J8C A;  1F9N A;  1Z7U A;  4IVN A;  4RGS A;  1MJB A;  3MCZ A;  2HDC A;  2DBB A;  2FQ3 A;  1TQP A;  2E1N A;  3E5X A;  1RNL A;  3V4G A;  4HQM A;  2W57 A;  1CF7 A;  2W24 A;  1IN6 A;  3MEX A;  2EA4 A;  4EV0 A;  1ON1 A;  1U8R A;  4L5I A;  3ULQ B;  3I4P A;  4OU0 A;  3B73 A;  4U7B A;  4Y13 A;  3MWM A;  2JPC A;  4D0P A;  3L9F A;  4M9S A;  3BZ6 A;  3ZN0 A;  4QLC U;  1UST A;  3ELK A;  2UZK A;  3ABU A;  2F5D A;  2ZNY A;  5DDG A;  3CTA A;  4WXD A;  4EVI A;  5D5X B;  2OAZ A;  2CG4 A;  5IT9 Z;  3KZY A;  2ZME A;  2GAU A;  1ZLK A;  3H3Z A;  5E1X A;  2BYV E;  1LEB A;  4IF4 A;  1ZAO A;  3ZN1 A;  1SAX A;  3R0A A;  2XAQ A;  1FBU A;  3F8B A;  1YW8 A;  4RAY A;  1QZZ A;  4ESJ A;  4L9J A;  1LDK B;  1F4K A;  2OBP A;  1P4A A;  2VN2 A;  4G6Q A;  3ZMD A;  2ETH A;  3SFZ A;  3HOT A;  3F21 A;  2A6E F;  3DPT A;  3QU6 A;  1O3Q A;  5CLS A;  2LKP A;  5IT9 K;  2VON A;  2A68 F;  1BI1 A;  1OYI A;  1O7L A;  2OD5 A;  1BOA A;  3M8E A;  5FGM A;  1U5T C;  3TO7 A;  4OIN F;  1LNW A;  1FYM A;  4ESF A;  4LLN A;  1DDN A;  4HV5 A;  2WTE A;  1ZRD A;  2VXZ A;  3C3W A;  2PMH A;  1ZYR F;  1S7O A;  4BNC A;  3RI4 A;  2VBX A;  1FT9 A;  2P7C B;  4LB6 B;  4KMF A;  1MDM B;  3FXQ A;  5FO5 A;  3RYP A;  1MKM A;  2K4B A;  4EJV A;  4HDU A;  4AIK A;  3E6M A;  2A3S A;  2PBI A;  2UWM A;  4MHG A;  1GHC A;  2TDX A;  2CWE A;  3HUG A;  3QOP A;  4L9T A;  5LEJ A;  1J0R A;  4HW0 A;  3FM3 A;  4MTE A;  1B4A A;  2NAZ A;  1RI7 A;  1HST A;  3ERE D;  2IW5 A;  1T2K A;  1P92 A;  2HWV A;  1FY7 A;  4XRF A;  3C1D A;  3QU3 A;  5JVT A;  4KYW A;  2H94 A;  3D5L A;  2XVC A;  4A5N A;  1REP C;  4UV9 A;  2HOE A;  2KKO A;  4PCQ A;  5L3C A;  4N9I A;  2QQA A;  4FX4 A;  4RS8 A;  3ZPL A;  2VBY A;  2ZME B;  4LJZ F;  2VE8 A;  1O3S A;  1P6R A;  2HQR A;  1S29 A;  3OV8 A;  1ON2 A;  1QO0 D;  5DV5 A;  4ETS A;  1G6N A;  2K02 A;  4S05 A;  2HZT A;  4OMY A;  3E6C C;  1FLI A;  1G3S A;  1JE8 A;  3M9A A;  2YSR A;  5K5Q A;  1JGS A;  3G73 A;  1IW7 F;  1T98 A;  3I54 A;  5A2Q K;  4XBF A;  3FMS A;  3O3K A;  4ZH4 F;  5ILS A;  1R36 A;  1FYK A;  2VE9 A;  4O6J A;  1WWX A;  3CJN A;  4G6D A;  3MAJ A;  1R22 A;  2DK5 A;  2WWY A;  2FML A;  4BAY A;  3TDZ C;  4P96 A;  5LEK A;  5FD5 A;  1IZ1 A;  3S2W A;  4UHT A;  4S04 A;  3EUH A;  1KA8 A;  4KIF A;  1U5T B;  4LB5 A;  5L3B A;  3KZZ A;  3GVA A;  3K0L A; 
#chains in the Genus database with same CATH topology
 2NS8 A;  4BHC A;  5LGU A;  3U21 A;  3RDI A;  5DCM A;  3HOS A;  4HX8 A;  5DUI A;  3KP5 A;  1SD5 A;  1QBJ A;  2RDP A;  3HBL A;  2GOX B;  2R92 J;  3WTW C;  5C44 J;  2IAI A;  3DKX A;  2DYS H;  3T8R A;  5DEQ A;  4DBQ A;  3VB2 A;  3GZ6 A;  3T1B A;  3QYE A;  1IAW A;  3RKW A;  1MJA A;  1X2N A;  2XAS A;  1NK2 P;  2M8G X;  1TW3 A;  2FU4 A;  3PJR A;  1X58 A;  4K2E A;  2RC4 A;  4C2T A;  5LRS A;  3BTL A;  2CU7 A;  2XPU A;  3R60 A;  3H9J A;  4GYG A;  5E1W A;  3GLL A;  4BDY A;  1KON A;  3H3U A;  4CZZ A;  1YX3 A;  2NYX A;  4PK4 A;  4JK1 X;  4XKC A;  2MLG A;  4KIG A;  5E8I A;  5FD6 A;  5E3O A;  1G3T A;  3R4K A;  3S17 J;  4IQ4 A;  3OIQ A;  2FSW A;  4NC6 A;  2WAD A;  3WHC A;  3FBI B;  4CUG A;  1DU6 A;  1VF9 A;  3F8C A;  5GPA A;  2P8T A;  2ESH A;  3FHZ A;  2ID6 A;  1USS A;  5TIS C;  4RAZ A;  2IGM A;  2GIV A;  4XID A;  2IA1 A;  3DWL E;  3CF5 F;  2XHK A;  4G7H F;  3V8L A;  3G3Z A;  3TKY A;  4NC8 A;  5CYV A;  4NC7 A;  2RRE A;  3CUQ C;  2HVR A;  3LFU A;  2CJJ A;  5IT3 A;  3K1M A;  3JW4 A;  4V2G A;  2CUE A;  2QBY B;  3QQA A;  5D4R A;  5F0F A;  3FK7 A;  3HOU J;  1YX5 A;  2ZCW A;  5C3E J;  2XIG A;  3BJA A;  1D3Y A;  3E97 A;  4A3F J;  1IV6 A;  3VWB A;  3Q0W A;  2JPB A;  3TMO A;  3LAJ A;  2ECB A;  4P55 A;  3I64 A;  4EJU A;  3HHH A;  1CGP A;  2L4M A;  3I55 I;  1NHA A;  1GVJ A;  1OCP A;  4BL0 B;  4II3 A;  4CYC A;  2KJB A;  4D7N A;  3ERM A;  2XGE A;  1Y8Q B;  2XAF A;  2LY2 A;  1QHH D;  3DBL B;  3F6V A;  3QPL A;  4R1H A;  5J1U A;  5D8K B;  1J09 A;  2VB6 A;  1TWG J;  3H0G J;  3PL8 A;  3BY6 A;  2F5C A;  5L3G A;  3CC7 I;  5BPI A;  2M7B A;  2PN6 A;  4ZTF A;  2LTP A;  2MD5 A;  2KP6 A;  2HDD A;  2XF7 A;  1TQI A;  1QRY A;  1XGS A;  2KIS A;  1XD7 A;  2LVS A;  3OYG A;  3ROU A;  3J80 K;  2DU9 A;  4D1Q A;  3I59 B;  2JSC A;  3V7S A;  3HSR A;  3LSP A;  2CQN A;  5EG0 B;  5HDG A;  3CD6 I;  4HV6 A;  3R0J A;  3WGH A;  2ZNZ A;  3IAM 2;  2Y2Z A;  1IN8 A;  2VT3 A;  5HLG A;  1E3H A;  1MD0 A;  1X4O A;  2KRC A;  2HS5 A;  2PMU A;  3K10 A;  4FT8 A;  1LPQ A;  1VQ7 I;  2DDA A;  4KN7 X;  5HLI A;  2LK2 A;  1R49 A;  2DA6 A;  2WA0 A;  1UAA A;  2EV0 A;  4BQN A;  1MNE A;  3A4C A;  1YRN B;  1N78 A;  1ENH A;  2EA2 A;  1FP1 D;  3RPU A;  2UUZ A;  2IS6 A;  3MVP A;  1XMK A;  3DXJ F;  3OYL A;  1SC7 A;  5BQT A;  2KL4 A;  2DMP A;  1FTT A;  2E71 A;  2GXB A;  3IC7 A;  1D1B A;  3OYH A;  3I56 I;  1XGN A;  4GYI A;  3CME I;  3QRF F;  1JKO C;  3T8T A;  4UV8 A;  2Z33 A;  1HA8 A;  3ZXS A;  5H6R A;  3TL4 X;  4DQ2 A;  4F55 A;  2X6X A;  4HF0 A;  2JZY A;  2PEX A;  1XSD A;  4LD5 A;  3IUO A;  3TP0 A;  1SFO J;  2DA5 A;  3EQL F;  4E7K A;  3HTU A;  3RPU D;  3OYA A;  1XSV A;  1MMN A;  2HTJ A;  2LH9 A;  4RGX A;  1XCV A;  3F6O A;  2Y75 A;  1R7J A;  3P5J A;  2Y69 H;  2FMY A;  3KP7 A;  5F27 A;  5DCM B;  4NHJ A;  3GTG J;  1Q1V A;  1JT0 A;  4ENJ A;  1B9M A;  1B6A A;  1QGP A;  4PSW A;  2FJ1 A;  4Q47 A;  3FKJ A;  3KFW X;  4NUB A;  4OWR B;  1QZE A;  2X85 A;  1ONV A;  3HSE A;  3JRB A;  4CDG A;  5E17 F;  3HRU A;  4C9Y A;  1JJ8 C;  1MSF C;  2L02 A;  2IT0 A;  4B1R A;  2Y48 A;  1YJW I;  2W4S A;  1U8B A;  4HSR A;  1B72 B;  2VC0 A;  3UKG A;  2H1K A;  2RNG A;  4B47 A;  1JUP A;  1D8K A;  5KVR A;  2F5E A;  3TO6 A;  1I27 A;  2BEO A;  3FMQ A;  3OMY A;  4E70 A;  2QM3 A;  5KAF C;  1BJA A;  3S2D J;  4OIQ F;  2WV0 A;  3QP5 A;  3GXO A;  3V7R A;  2LDU A;  4B44 A;  4ZTJ A;  1GV5 A;  1MW7 A;  1C0W A;  3AKZ A;  3MMY B;  3CCU I;  2MC3 A;  4IKF A;  3DEE A;  3M1E A;  4I0B A;  2AS5 F;  1S6L A;  1DP7 P;  1ZR4 A;  5FRN A;  2F4I A;  3DCF A;  2DTR A;  2MA3 A;  3D5S C;  1FMV A;  1X1C A;  2ZC2 A;  2KZV A;  2IA2 A;  3FK6 A;  5BNG A;  3OYC A;  2OUM A;  1RIO H;  1JTY A;  3GTO J;  2R7O A;  3S16 J;  2ZJP F;  4AVP A;  4BY1 J;  2EFP A;  3S2H J;  1VI0 A;  4LK1 F;  4ENM A;  3DV8 A;  3EPZ A;  2KIM A;  5DTD A;  2FX0 A;  3GFM A;  4CH7 A;  3MFK A;  3KEO A;  3V8J A;  2VL8 A;  4U0Y A;  1LVA A;  4UVB A;  1ZEL A;  2CQX A;  2FBH A;  3MZY A;  1FEX A;  1TQM A;  3E0J B;  4F3Q A;  1LB2 A;  1T38 A;  2H09 A;  4HDV A;  1T0F A;  2XB0 X;  3MKL A;  3BDD A;  3OIO A;  2VQC A;  1LQ1 A;  2EZH A;  3SHF A;  4A0Z A;  3O8H A;  2CW8 A;  2JRT A;  3RIR A;  2ZJR F;  2GBY A;  3DTK A;  2VAS A;  4M9Z A;  4U0V A;  4U87 A;  1JGG A;  4PJM A;  2HVS A;  3KP3 A;  4EGZ A;  3MKW B;  4L0Z B;  2P5V A;  2M4G A;  3SQN A;  2LLK A;  1M1E B;  3QYF A;  5LGT A;  2X48 A;  1WJF A;  3SFI A;  4FAS D;  1E2X A;  1EKE A;  1QHG A;  3A1Y A;  2Z2S B;  4EJW A;  1IJW C;  1P4W A;  4CGZ A;  5LFA A;  4PDK A;  5ERI A;  2HFH A;  5J4V A;  1NG6 A;  4IPA A;  3GEZ A;  2DPD A;  4F7Z A;  1MBE A;  2NS0 A;  2CFX A;  1TL8 A;  1ZK8 A;  2NOJ B;  3X2Q H;  3OS2 A;  2RV8 A;  3ECO A;  4BJ6 C;  1ETQ A;  3HRT A;  1UHW A;  1YI2 I;  3WGG A;  1FYL A;  2V4J C;  4HEA 2;  2B0L A;  3SZG A;  1HW1 A;  3D0S A;  4HLX A;  3SJM A;  2WY8 Q;  1O3T A;  2QGU A;  3G2B A;  2ESN A;  3W2W A;  1J2X A;  4IHX A;  1YG2 A;  1RR8 C;  2R7F A;  4RLQ A;  1ZG1 A;  1MBH A;  4YIR X;  1TBX A;  1V3F A;  4BE2 A;  5E20 A;  1ZRF A;  2M7A A;  5FLV A;  4HPQ A;  3SYT A;  1K61 A;  3IRQ A;  2K9Q A;  1IGN A;  3ZGK A;  2OU2 A;  1SMY F;  1IN7 A;  2MLK A;  2IGK A;  4MQV A;  5J1R A;  1N75 A;  1L0O C;  1DU0 A;  5TGT A;  5BOX A;  4RM3 A;  3H92 A;  3QPH A;  4EM0 B;  3CDH A;  1JKQ C;  1QVU A;  4EM1 A;  2JMW A;  2ID3 A;  4L5E A;  3J7Y J;  2Q2E B;  1KYZ A;  1GV2 A;  4YRV A;  3WTZ A;  2K9L A;  4IOC F;  2D1H A;  4M71 A;  1TTY A;  2WAQ N;  3H5R A;  5AON A;  4A3L J;  2X1E A;  4WCG A;  4RAF A;  1PYV A;  3PQJ A;  4IEJ A;  4N4O B;  5ICE A;  5FB2 A;  3BT9 A;  4XL9 A;  2V6C A;  4OAZ A;  3WTS C;  5B1B H;  5IP7 J;  2L5Q A;  4OIO F;  2CQ7 A;  5CVJ A;  2IA0 A;  1I39 A;  2LF7 A;  2HQN A;  3CCM I;  2LD5 A;  3KP4 A;  3L2W A;  2L9R A;  5GAG J;  4GDF A;  2H1L A;  4DYC A;  5FKO A;  2OF7 A;  2ISZ A;  4XLC A;  2CUZ A;  4EAT A;  4L9V A;  1A36 A;  3S3O A;  4HAM A;  3W6J B;  4I01 A;  3S3M A;  3G1M A;  3J7Z I;  2K9M A;  1MJ9 A;  1BW6 A;  4F91 B;  2XKO A;  2EFN A;  2JT1 A;  2OA4 A;  2OPT A;  2RQP A;  1YO5 C;  1PUF A;  3V8K A;  3GF2 A;  2DDB A;  1MGT A;  1T08 B;  2GQQ A;  2QQ9 A;  2Y30 A;  1X3W B;  4M3G A;  2IRF G;  5CKT A;  2ZXJ A;  2N8G A;  3EET A;  2QSH X;  2ZJQ F;  4E4H A;  3HHG A;  5FLX Z;  1IRF A;  2CMP A;  2EZI A;  5HDN A;  2WY7 Q;  3IV5 A;  1ZGW A;  1QPM A;  4BJT A;  2H6C A;  2K9S A;  2Q8K A;  4P1W A;  2WB1 A;  1FZP B;  3BCA A;  2LBF B;  1FBS A;  1H8A C;  3DPL C;  1BIB A;  1MBG A;  3GO5 A;  1U5T A;  2DW4 A;  3C2G A;  2ECC A;  2VQG A;  3E3V A;  1HW2 A;  2W7N A;  1KQ8 A;  3KE2 A;  5J1Y A;  2DPU A;  2DMU A;  2EFO A;  2R7Z J;  3R6S A;  2MW8 A;  1R23 A;  4ZZL A;  3CCS I;  2V9P A;  5HDK A;  5KHD A;  1ZG3 A;  2NXN B;  5ILU A;  1HLV A;  4XLP F;  2FOW A;  2A6H F;  2FA5 A;  3ZRG A;  1RKT A;  2NNN A;  2E2H J;  4M6X A;  4E6K G;  3KEQ A;  4GFB A;  4CYD A;  3DP7 A;  2K4J A;  5DCF A;  4YG2 F;  5GTH C;  2LOO A;  2ACJ A;  1A6Q A;  2HQA A;  3CCY A;  3WG9 A;  3V42 A;  3HOX J;  1S7E A;  3O6B B;  4E7H A;  6PAX A;  2I5U A;  2JUC A;  2AHQ A;  2RGV A;  4LIU A;  3VYU B;  1HKT A;  4YFX F;  5FLX K;  2V7F A;  2W25 A;  1ERD A;  1R9T J;  3GFL A;  4JOM A;  2A69 F;  2EV5 A;  4OIR F;  4ANJ A;  1YYV A;  1BM9 A;  5IY5 H;  4OIP F;  2IVM A;  3OIP A;  2KJC A;  3GCM A;  3LST A;  5KNL A;  3A01 B;  1D1A A;  2HZD A;  2BGC A;  3IH4 A;  1JKR C;  4PFO A;  1K4S A;  3LSH A;  2Z1D A;  1BI0 A;  2NVT J;  1VQ9 I;  1JHF A;  2HYJ A;  3I71 A;  1UG0 A;  4CCK A;  1ZGA A;  1QNT A;  2KHM A;  3OS1 A;  1UHS A;  4FE4 A;  5LHI A;  2HXI A;  3P7N A;  2R7T A;  1U3E M;  1OR7 C;  5E79 C;  3COA C;  1JXS A;  4GO1 A;  5FRM A;  1LE8 B;  3DU5 A;  3KX2 A;  3IAS 2;  2MH9 A;  2HVQ A;  5LBQ A;  2ZKZ A;  1XMA A;  3RCO A;  5A2Q Z;  4XNF A;  4Y15 A;  1WZ2 A;  2BHY A;  1A04 A;  2QBY A;  2KT0 A;  2GWR A;  4QIW N;  4XSX F;  2IGO A;  3F0C A;  1FBQ A;  4CA0 A;  3D5R C;  2DA4 A;  1VFC A;  3ZQC A;  2M45 A;  1FOY A;  3QAH A;  4FX0 A;  5J8F A;  1I1G A;  1JKP C;  2M8E A;  2E1M B;  5D5W B;  2FXA A;  4J00 A;  4MIM A;  1FNN A;  1FIP A;  3OOU A;  2YR2 A;  2QSF X;  2AQF A;  4ZDP A;  2JA5 J;  4XOT A;  3GYH X;  3FZV A;  3FXM A;  3T5X A;  2CGP A;  4TV7 A;  4I09 A;  1X2M A;  1YTY A;  3IH3 A;  4R79 A;  2ZSH B;  1XC5 A;  4MNU A;  2BBY A;  1BN5 A;  3K6G A;  3CP8 A;  3ZMT A;  2GZW A;  2LF8 A;  3BJO A;  4NQW B;  2OCE A;  1TNS A;  3PSI A;  5CJ9 A;  2EZL A;  1KGS A;  3MN2 A;  3HKZ A;  3BR2 A;  4YEL A;  1DGR M;  1OQY A;  3TOB A;  2IPQ X;  3I59 A;  3HIF A;  3V7C A;  1F5T A;  3MQ0 A;  5EG0 A;  5JLW A;  5CVV A;  2V6E A;  3K69 A;  1IRG A;  2DCE A;  2X6W A;  1S8N A;  3TDU C;  1KU3 A;  3K1P A;  2C6Y A;  3F22 A;  1SVL A;  3FF5 A;  2FOK A;  1UFM A;  4EMS A;  3FMR A;  2EFW A;  3RPQ A;  4ZDO A;  1A31 A;  4YFK F;  1S5L C;  4CCL A;  1YRN A;  2L7F P;  2Y9Z A;  4M74 A;  5K5O A;  2AQE A;  2XGX A;  1JHH A;  3OL3 A;  1Y39 A;  4B8X A;  1FP2 A;  1U9N A;  2V26 A;  2HPI A;  2YUS A;  4AD9 A;  5M5W J;  2IS4 A;  3BOQ A;  3CCL I;  2XAH A;  5DUK A;  4DYR A;  3AL0 B;  5FFZ A;  3J81 K;  1VQN I;  4FCY A;  5IP6 A;  2DA1 A;  3LQQ A;  4NNJ A;  4RB1 A;  3AG2 H;  5E18 F;  2ZO4 A;  4ON0 A;  1K79 A;  3O8G A;  3ZMV A;  3S1M J;  4W1U A;  4EGY A;  2ADU A;  3HRM A;  4IRI A;  2XAG A;  4ZYE A;  4E7Z A;  1H9T A;  3A0H C;  2FQ4 A;  4XKW A;  2DLL A;  3OYB A;  4IJA A;  3F72 A;  1BOB A;  5HOD A;  4RB3 C;  3CO6 C;  1IXC A;  3DQV C;  2CV0 A;  2CUF A;  3A03 A;  2V1U A;  4ZYH A;  2O8X A;  1H0M A;  3VPR A;  4UUS B;  3UNG C;  1V55 H;  3JAM Z;  3EUH C;  2Y9Y A;  1XG1 A;  1SFE A;  3Q3S A;  4KIS A;  2OTJ I;  2EIN H;  4IHW A;  2OZU A;  4Y17 A;  3KET A;  1BI2 A;  4QTR A;  1HSJ A;  2CQK A;  1YS6 A;  2XPW A;  1GXP A;  2Z3Y A;  3K4K A;  2K3P A;  1XPX A;  1JT6 A;  3CLO A;  5L3F A;  3WTV C;  1R1V A;  4AIJ A;  4BXU A;  4G12 A;  4MGR A;  1BC8 C;  3JSO A;  3FIW A;  1R00 A;  1RUO A;  4HLY A;  3L00 A;  5K5R A;  1B72 A;  1D8J A;  3LSJ A;  2B7E A;  1ZAR A;  3HJE A;  4WX9 A;  1JI8 A;  1WVR A;  1RRJ A;  4Y3O A;  2NNY A;  1QVT A;  1MND A;  5ICG A;  3JTG A;  2HNH A;  4Y33 A;  3UR3 C;  3K4M A;  1BR2 A;  3JRH A;  4O3M A;  3LQR A;  4KIB A;  1WI9 A;  3VYS B;  3HB9 A;  1TZL A;  2P7V B;  2YU3 A;  3ABT A;  3KYD B;  4RGR A;  1MSE C;  2L7K A;  3CJT B;  1WHU A;  4XKB A;  4J19 A;  5B1A H;  4IOA F;  4X6A J;  1DQU A;  2X51 A;  3HM5 A;  1T6S A;  2KMU A;  4G6T B;  1PVE A;  3I53 A;  5JHF A;  3J80 Z;  4UB8 C;  2CW7 A;  2DA7 A;  3C18 A;  1I3A A;  3F8N A;  2O03 A;  1FWZ A;  1G8X A;  2F6C A;  1HKQ A;  1B1B A;  1Y56 A;  2DOA A;  3AG4 H;  3CUO A;  3GLX A;  3JAM K;  4LGW A;  4LK0 F;  4M3F A;  2LKS A;  4A3J J;  1KU2 A;  1ZH5 A;  4EJO A;  4Y4R A;  3IWF A;  5CPR B;  2VQL A;  5ILV A;  3L2C A;  4FET A;  4RGU A;  5JFR A;  3W6K B;  2PLY A;  2MAB A;  2RQQ A;  3ABL H;  3AG3 H;  1D0X A;  1A6I A;  1SFX A;  3NAU A;  4CHU A;  3M4O J;  2EZK A;  4ENK A;  2O9L A;  3RJP A;  1LVK A;  3KLO A;  2FEZ A;  4M72 A;  2EFQ A;  2R93 J;  1K4T A;  5DD8 A;  2CH0 A;  1X19 A;  1RPW A;  1Y0U A;  2AXL A;  3CCE I;  1B59 A;  5EEH A;  5D5U B;  2JVH A;  3ZQH A;  1BR4 A;  2ZBK A;  1QQI A;  2QWW A;  3BR3 A;  1EH7 A;  3VYR B;  3MZ8 A;  5HLT A;  1Q1H A;  3K7A J;  2ZFU A;  4KIC A;  2B9S A;  1T95 A;  1IG7 A;  4HYE A;  2PFB A;  3U1K A;  4W97 A;  3I0T A;  4A3D J;  2EQR A;  2DMQ A;  5EEG A;  4HQE A;  2HU9 A;  3B02 A;  3H9Q A;  4GGG A;  3RQ4 A;  2O8K A;  3IHU A;  5BMZ A;  2V1D A;  1PP8 F;  2R5Y A;  2VPR A;  2JA8 J;  2VBZ A;  3CDL A;  5GPC A;  1YW7 A;  3L09 A;  1K83 J;  4AWX B;  4P9F A;  1XGO A;  3IKV A;  2F4O B;  2K7L A;  1K7A A;  3F3X A;  4A3E J;  1F36 A;  2HTS A;  3ECH A;  4I7H A;  4AVZ A;  3LSG A;  3PM1 A;  2DA3 A;  4IHV A;  1WJ5 A;  3DLA A;  2BW3 B;  1VND A;  3K4J A;  5ICC A;  1YOV B;  1ZGJ A;  2HKX A;  3ZQG A;  4BQA A;  2K5C A;  2DQL A;  2V9V A;  1Z91 A;  2V79 A;  4BE0 A;  3CZ6 A;  1OPC A;  3H5N A;  3TQN A;  4M73 A;  4XLN F;  1X4P A;  2LNB A;  5CVI A;  2VT2 A;  1B8I B;  1EH8 A;  2VJJ A;  4H0E A;  2PQ8 A;  2KDO A;  1YFH A;  3GW2 A;  4BDZ A;  2AO9 A;  2X9D A;  2M0M A;  2R5Z A;  1LUJ B;  4G7Z F;  2VJI A;  2VKD A;  4A69 C;  3BP8 A;  1RZ4 A;  2PMZ N;  3GZN B;  4DW6 A;  2GXA A;  2QQB A;  4EM2 A;  2Q2E A;  2R7D A;  3TED A;  2L0K A;  2M0C A;  2QKL B;  4DYQ A;  4M6Y A;  1TT5 B;  1R5G A;  3IWZ A;  4BAC A;  5IYC J;  4PJL A;  2RN7 A;  1KU9 A;  2X0L A;  5FKN A;  2WAE A;  3I58 A;  4KNY A;  2L9V A;  2NRA C;  2M9H A;  3FX3 A;  5J3L A;  3NEU A;  2WB1 N;  4II2 A;  3RYR A;  1ZRE A;  3H0D A;  3HGG A;  4IO9 F;  2V9K A;  4XRS A;  1FMW A;  1ZN2 A;  1S9H A;  3U1D A;  2DMN A;  3S1N J;  4AUX A;  1MMG A;  1EV7 A;  1O57 A;  2XAU A;  2LRE A;  2DT7 B;  1WFX A;  2DK8 A;  2X6Y A;  4GXO A;  4C3J J;  3HSF A;  2E19 A;  2KLO A;  2PX9 A;  3EYI A;  4PZJ A;  3WU1 B;  3DTI A;  1W7P A;  2ZXH A;  5FKM A;  2LR8 A;  4IHT A;  2L01 A;  3Q9V A;  1IXR C;  1EH6 A;  1S3J A;  2HOA A;  4J01 A;  1J9I A;  1FC3 A;  4HBL A;  4MTD A;  1UEL B;  1T56 A;  2D45 A;  2ELH A;  3ISP A;  5JI6 A;  5CVU A;  2QEN A;  4DJA A;  4D7M A;  1B9N A;  3I4M J;  1D5Y A;  1IN5 A;  4MFD A;  1DPU A;  1HDD C;  3PFI A;  1WH5 A;  2O3F A;  4G8X A;  4X1E A;  1BC7 C;  5BPD A;  1BW5 A;  2JVG A;  5J6X A;  3VSL A;  5AIP A;  2BXZ A;  3HRS A;  2IJL A;  2FBK A;  2Z99 A;  4RA2 A;  2LBF A;  1IRZ A;  2DQR A;  1GXQ A;  1XCB A;  3DEU A;  4G9Y A;  2DYR H;  1SAU A;  2VKE A;  2J5O A;  4YII A;  5ICF A;  3RZD J;  2VOD A;  3GTJ J;  3LMM A;  1S7A A;  3CUQ B;  4JP0 A;  1Y1V J;  1IV8 A;  4RDU A;  4BQQ A;  3RQI A;  3L1P A;  5F64 A;  3DTE A;  2DO7 A;  4A5M A;  4L5J A;  3J7A O;  3DPU A;  3FM5 A;  3HEF A;  1JTX A;  1ODD A;  3F23 A;  1BBY A;  1YIT I;  3A02 A;  1YIO A;  4HST A;  2E1O A;  5DS9 A;  4A3I J;  3Q9S A;  2D5V A;  3M3Y J;  1TW2 A;  1AOY A;  5EZG A;  4YFN F;  3AAF A;  4G7O F;  5F0C A;  4PGG A;  4X0G A;  3KCC A;  3PIP F;  1ETO A;  1YJ9 I;  1I3Q J;  2BVL A;  2EJR A;  3OR2 C;  2XV4 S;  1NTC A;  4IHS A;  2TCT A;  3E6B A;  3M7G A;  1JUM A;  3BQZ A;  4RB2 C;  4A3B J;  1Z05 A;  3AFH A;  4BEH B;  2E2J J;  2ZSI B;  3Q5F A;  1MBJ A;  1DP3 A;  2EIK H;  2HYG D;  2G7U A;  3GZ5 A;  2R5Y B;  3A01 A;  1RR7 A;  3TW7 A;  3K1N A;  3S8P A;  2EIJ H;  1J5Y A;  4RAG A;  3ASN H;  2BHZ A;  2VJ5 A;  2Y0M A;  4XN0 A;  1Z77 A;  4PFP A;  4CCJ A;  2G0E A;  2JA7 J;  4AU7 A;  4WXC A;  4BYY A;  1OYW A;  4ESB A;  3H9G A;  4XRM A;  4E7J A;  2ISY A;  1QPI A;  5IYB J;  2QUF A;  2ME6 A;  3HKZ N;  4XQF A;  5EGO B;  1LE8 A;  1RET A;  2CQQ A;  1XN7 A;  2DFH A;  2G9W A;  4JBA A;  2M5W A;  1W36 D;  1MMS A;  2HEO A;  1P9Q C;  1FTZ A;  2PJR B;  3O2P E;  1IDY A;  5HS9 A;  3VDX A;  3QOE A;  2HI3 A;  2ZFW A;  3OSG A;  4XR6 A;  2M3A A;  2Y0S A;  2V1N A;  3BR6 A;  3SEZ A;  1QA6 A;  5EDN A;  2FE3 A;  3EUA A;  1O4X A;  5D6E A;  1XGM A;  4UNO A;  1LJ9 A;  1XS9 A;  3N4M A;  4HZF A;  4UVC A;  1ETY A;  2QF7 A;  1UZC A;  2DJN A;  5EYR A;  1YQA A;  1DUX C;  3KPH A;  1K78 B;  2VPL A;  3RKY A;  2A5Y B;  5F08 A;  2K86 A;  1TWH J;  5LLQ A;  1FOX A;  1WRJ A;  2R5Z B;  3WU0 A;  1UB9 A;  3PO3 J;  4U0W A;  3WTU C;  2VC1 A;  4GRI A;  4EJT A;  2ELJ A;  3JRA A;  2CFO A;  5HOO A;  1GUU A;  1Y6I A;  1D0Z A;  3FIS A;  4NDL A;  3NWS A;  4O5V A;  3SZP A;  3LAP A;  5D8L B;  1KU7 A;  4C3H J;  3GUD A;  2E2I J;  2LRD A;  2L3D A;  4BU2 A;  4NQW A;  3GX4 X;  3K4L A;  3W3C A;  1Z0X A;  3ZQ7 A;  3DU6 A;  2ZME C;  3FXR A;  4H4K C;  1AWC A;  2ZJ2 A;  1R5H A;  1R6R A;  4PUS A;  4AIH A;  4BHB A;  4QPO A;  5B3S H;  1XDS A;  5KAI C;  4IX7 A;  3NWT A;  5H6Q A;  2A5W A;  4V19 K;  1BJZ A;  4DZP A;  4A0X A;  3GME A;  4P9U A;  1VQM I;  1SAN A;  3AG1 H;  1Z9C A;  4FQG A;  2WBM A;  2KIF A;  4I76 A;  2E1C A;  4B48 A;  5B66 C;  2M1B A;  2R7X A;  1OMI A;  1W7P B;  5H2F C;  2QLZ A;  1HXD A;  3ZQQ A;  2FUG 2;  2P0W A;  3TP3 A;  1VQ6 I;  2OQG A;  1I6H J;  4KN4 X;  1X1P A;  4LOC A;  1G2H A;  3ABM H;  1OCT C;  4P5O A;  3BG6 A;  4UXN A;  3FXK A;  4A3K J;  2JK3 A;  1J59 A;  3KLN A;  1PDN C;  2DOF A;  1UHM A;  2I8D A;  2XF6 A;  2W84 A;  5FRO A;  2OCC H;  1EJ9 A;  2VBW A;  2HXO A;  3OYI A;  3LSK A;  1VQ8 I;  2XGC A;  3OYM A;  4PJN A;  3VEP A;  3WTT C;  2DI3 A;  1V5E A;  1ETX A;  4A3M J;  3B6A A;  1IRX A;  4BKX A;  4JX6 A;  1Y8R B;  3ZP5 A;  5TRD A;  2CV1 A;  3HOW J;  3M07 A;  2VOO A;  3JCU C;  3CCR I;  3FDY A;  5B5E C;  4I02 A;  3SDG A;  3IRR A;  2DAO A;  1TWF J;  2ZXW H;  1G3Y A;  2FRH A;  4L0Y B;  4MLO A;  1LDJ A;  4MEY F;  4UUS A;  3ZOB A;  3K4B A;  3FXU A;  2F4M B;  1VQ5 I;  1HDP A;  5K7F A;  3CDI A;  1IN4 A;  3GWZ A;  5E1Z B;  2X1C A;  5FFX A;  1ZRC A;  2P6T A;  2JN6 A;  2JUG A;  4EQQ A;  4Z2Y A;  2LP0 A;  3GBG A;  2E7X A;  1BL0 A;  2MFZ A;  3F9K A;  3OYF A;  3CQZ J;  2IP2 A;  2COM A;  1X3U A;  4ABZ A;  1R1U A;  4FE7 A;  4ZYA A;  2EIL H;  3L7W A;  4QSH A;  3PNT A;  1DGW Y;  2DOD A;  1GT0 C;  2K9N A;  1OYY A;  2R3S A;  3EYY A;  4DOZ A;  2Z5U A;  3WTX C;  4E7L A;  3NRV A;  4L18 B;  2KFD A;  2GA1 A;  1SMT A;  1HCR A;  1WI3 A;  1AHD P;  3W2V A;  3K70 D;  2L2O A;  1MZB A;  4C3I J;  2G7H A;  3KIO A;  1R5I D;  1IUY A;  1ZLJ A;  5DYM A;  1O3R A;  4A93 J;  4HX4 A;  3M1C A;  2O61 A;  2ICW G;  2QYO A;  1OCC H;  2PI0 A;  3DKW A;  2X6O A;  4FHT A;  3CCJ I;  3FHN A;  5E8G A;  3OOP A;  1OR7 A;  3WU2 C;  4XMY A;  2Q0O A;  3JRG A;  1K6Y A;  2FNA A;  1CF7 B;  1W5T A;  2KQR A;  1W4M A;  3DFG A;  2HYF A;  1WSU A;  3QP6 A;  3CJR B;  3MZH A;  2L54 A;  1RC9 A;  3BG5 A;  3JRD A;  4LIT A;  1FX7 A;  5AIQ A;  2XKP A;  3U9G A;  2XUB A;  2HDW A;  2X4H A;  2E36 A;  4L9N A;  3SXY A;  3HC7 A;  2RKH A;  5DD4 A;  2P5K A;  3J81 Z;  2Q1Z B;  4YEJ A;  3MKY B;  5F1R A;  1KQ9 A;  1YJN I;  1NK3 P;  3KEY A;  3RTR A;  2HKO A;  5IYD J;  3BJ6 A;  2O6G E;  4DNC A;  1OLT A;  1K6O A;  3I3L A;  2GLO A;  3HZJ A;  1I6X A;  3PSF A;  3NAR A;  2JSP A;  3CES A;  3FXO A;  4IQJ A;  4M3E A;  2KRH A;  3PUF A;  1TC3 C;  3LA3 A;  1UG2 A;  4LLG F;  1RUN A;  3JSP A;  3HOY J;  2E5Z A;  1IF1 A;  2F2E A;  1FOK A;  1IDZ A;  1W5C C;  1TP4 A;  4BY7 J;  2BV6 A;  2CW0 F;  2E35 A;  1BA5 A;  2STT A;  4IHY A;  3EUK L;  4EEF G;  3MKZ A;  3W6V A;  3CF2 A;  3FBN B;  1YIJ I;  3REO A;  5E3L A;  1OKR A;  2JA6 J;  2BW3 A;  3L2Q A;  1G59 A;  1ZKG A;  1UJ8 A;  5FJ8 J;  4JYK A;  3DBH B;  4Q5S F;  1CQT A;  2RVC A;  3PNY A;  5CQE A;  4I0A A;  2EB7 A;  4YIF A;  5FKK A;  2A05 A;  2LKX A;  1D5V A;  1WKM A;  3GTK J;  4HF2 A;  2PG4 A;  3BPV A;  1ZR2 A;  3ONQ A;  4ASN A;  4CXF A;  5DM7 F;  1SD4 A;  1FPQ A;  3TBI A;  3G6E I;  1ZQ3 P;  3LA7 A;  3HTS B;  1N77 A;  5LD2 C;  3GFI A;  1Z6R A;  1B8I A;  3W2A A;  3PUB A;  3WOD F;  2LSO A;  2JQ7 A;  1MIJ A;  2QQ8 A;  4IRG A;  1HBX G;  2NS7 A;  1J7K A;  4HX7 A;  2DFE A;  4KDP A;  4JX5 A;  3IL2 A;  3L2V A;  3JTH A;  1G3W A;  2M4K A;  3VOE A;  3BR5 A;  2W82 A;  4BBR J;  1AKH B;  4LFU A;  1P7I A;  2YX7 A;  3M8F A;  4BHP A;  4C2M J;  2L4A A;  1V5F A;  3BPX A;  4KFC A;  1YW9 A;  2NVY J;  2CSO A;  1Z1D A;  1Z67 A;  2MG4 A;  3E6D A;  4B3A A;  1MH4 A;  2YU9 J;  5LHG A;  1LFU P;  3BR0 A;  2R7R A;  4BBS J;  4LG0 A;  4A2U A;  4JX4 A;  4IXA A;  3TO9 A;  2LYC A;  4U7D A;  3BLY A;  4QPQ A;  5D4S A;  4D5C A;  1LDD A;  3VYT B;  2A07 F;  3FWE A;  1Z21 A;  2GIZ A;  3BZK A;  4LIV A;  4ITV A;  1WJE A;  3K2A A;  4E7S A;  4ZYG A;  1SD6 A;  1HOM A;  1J75 A;  3JRF A;  4KA4 A;  1EA3 A;  3CCQ I;  3PQK A;  1XTA A;  2KIU A;  2VUM J;  1X1A A;  3C2H A;  3IP4 B;  4BS9 A;  1L3L A;  3LFK A;  1E3O C;  4XSZ F;  5LHH A;  2OV7 A;  1IO2 A;  2GOM A;  4UUV A;  1TLH B;  4N4N B;  1FJL A;  1NG7 A;  2AXT C;  2BXY A;  3K4C A;  2YPR A;  3TGN A;  2HR3 A;  4ZZD A;  1ETK A;  1N25 A;  3T0Y A;  1Y1W J;  3KP2 A;  1BIA A;  1VQP I;  4HF1 A;  4UUT A;  2LY9 A;  3BWG A;  3PIO F;  4IL6 C;  1YS7 A;  2DJI A;  2UXX A;  3KZI C;  4ZDL A;  2FNP A;  2W48 A;  4ENN A;  3GFJ A;  2DFI A;  3I9V 2;  3VOD A;  4UVA A;  5L3E A;  3K4N A;  1WJB A;  4XOP A;  4HOB A;  4KUM A;  4ZJZ A;  4KT6 A;  4D9J A;  1MNM C;  2F5F A;  2YX4 A;  2X1D A;  3LA2 A;  3E5Q A;  3HUG B;  2MBF A;  2VOP A;  5D6F A;  3ABK H;  5ED4 A;  4RM2 A;  5L3D A;  1P4X A;  4A6E A;  4XRS G;  2STW A;  3BQY A;  2R7W A;  2UXN A;  3VFZ A;  2P6S A;  4V2F A;  3CUQ A;  2ZB9 A;  2XAJ A;  3P9I A;  1WCM J;  1E17 A;  1BI3 A;  3K9T A;  1FSE A;  2JJ7 A;  2IXS A;  4G94 A;  4HA8 A;  2D1V A;  2K27 A;  1XDU A;  3QPT A;  4WK8 F;  1SEU A;  1DPR A;  1SVO A;  1PUE E;  4KT5 C;  2QSG X;  1OCZ H;  4R8H A;  4B43 A;  1MBF A;  1V5G A;  2Y0S N;  3BZC A;  3EDP A;  4LLL A;  3DEW A;  4I2O A;  4QWQ A;  1VTN C;  3OR1 C;  1KQ0 A;  1VQO I;  2MH2 A;  2W00 A;  3I4N J;  3ASO H;  5LGN A;  3JRE A;  3HOZ J;  3CO7 C;  1W5S A;  5JR3 A;  1D1C A;  1I1S A;  3ZCO A;  3PO2 J;  4B09 A;  2CO5 A;  3R61 A;  4BEH A;  2IGN A;  3BTI A;  4XLF A;  1FSH A;  4MEX F;  1LFP A;  4A0Y A;  1HKS A;  4AM3 A;  3C2B A;  1E3P A;  1WQ2 A;  1XSX A;  3ML6 A;  4CO8 A;  3Q0U A;  4MQ9 F;  4IRH A;  2GA2 A;  3H1C A;  1VQ4 I;  2EWN A;  3VSK A;  4M9X A;  2L9S A;  2BZT A;  3DLL F;  1R58 A;  5JVG F;  1HW5 A;  4AYB A;  5HNH A;  3N97 A;  1UCR A;  2O0Y A;  3C7J A;  3OL4 A;  3IKT A;  5EGO A;  3S1R J;  5KK1 A;  1ZG5 A;  2QZ8 A;  2PJR A;  1P7J A;  1ULY A;  4I98 B;  1IXS B;  3HYI A;  4OAY A;  4XLH A;  4CSW A;  2Z9O A;  5D5V B;  1SFU A;  2A61 A;  4OMZ A;  4WWC A;  1TNT A;  3WE3 A;  4OOI A;  4PGH A;  4U88 A;  4BUP A;  2QA4 I;  5F0H A;  3RKX A;  3LNQ A;  5HS8 A;  4DZJ A;  1QU3 A;  4C2U A;  3HG9 A;  1U2W A;  4N0B A;  1K78 A;  3OYN A;  3SZT A;  4Y52 J;  5HLH A;  1W0T A;  1QZY A;  3A2K A;  3CCV I;  3KP6 A;  4XM3 A;  3OYJ A;  4XLA A;  1SD7 A;  3ZMS A;  3LL7 A;  4XOR A;  3I5U A;  1G4D A;  2M30 A;  2NVQ J;  1ZHF A;  2OZ6 A;  3HL2 A;  3P9K A;  4KMU X;  1U0J A;  1X1D A;  4CIC A;  3BG7 A;  5HVQ C;  2EIM H;  4F93 B;  4LG0 B;  3JRC A;  4BE1 A;  2H27 A;  3F8M A;  1ORK A;  1ZTR A;  3QPS A;  3MD2 A;  1F1Z A;  4ZYD A;  4IZZ A;  2XSJ C;  3OYK A;  2WV1 A;  1U78 A;  2EBI A;  1P2F A;  2E7W A;  1I50 J;  5HS7 A;  3F8F A;  4A6D A;  2IS2 A;  2W1O A;  1KYW A;  1LEA A;  1Z6T A;  2KRF A;  2BE5 F;  4JQF A;  2K3F A;  5HNF A;  3U2R A;  1WJC A;  2OQR A;  5GAE J;  5TJJ A;  3K2Z A;  1ITY A;  5IOZ A;  1T39 A;  5H20 A;  2M87 A;  2P4W A;  2DN0 A;  5CVR A;  5BS6 A;  4HNV A;  3JRI A;  1H88 C;  1YLF A;  2XGD A;  4A12 A;  4XON A;  2GM4 A;  4BH9 A;  4NB5 A;  2WC2 A;  2W85 A;  5JHU A;  1I5Z A;  1XB4 A;  2XRO A;  2DT5 A;  4A3G J;  2J5P A;  1VQL I;  1O7F A;  2VQH A;  2BY3 A;  2H6B A;  4RB0 A;  3G1O A;  2BY0 A;  4Q48 A;  4ZC3 A;  1W7P D;  2JTV A;  3TOA A;  4CCN A;  4HNT A;  3GTQ J;  3CJQ B;  1R1T A;  3BRO A;  1OFC X;  1PP7 U;  4HG2 A;  2HGC A;  3WGI A;  2R0Q C;  2XRN A;  3BR1 A;  1OCO H;  2FF4 A;  3L2U A;  2GXG A;  2L7Z A;  3BC8 A;  4LMY A;  2CYY A;  3DF8 A;  4RLF A;  5F6F A;  2O7O A;  1U6G A;  2OC6 A;  5K1Y A;  3ZMZ A;  3H36 A;  3ZQL A;  2EK5 A;  4M3D A;  3HPG A;  2EV6 A;  2WAF A;  3WTY C;  2V1X A;  3NQO A;  1STZ A;  2VIX A;  4WF2 A;  4N9H A;  2P5L C;  4PSX A;  2FD5 A;  1V4R A;  3WE2 A;  5E3M A;  2HOT A;  2RNJ A;  2D2W A;  1HQC A;  3P9C A;  4CZC A;  4DGW B;  3BTJ A;  3L2R A;  5C4J J;  1X3Z B;  2KDZ A;  3KYC B;  5LRR A;  4WXH A;  3CC2 I;  5KCM A;  1T0F C;  2LMD A;  4XLE A;  3LSR A;  3G4S I;  2BOL A;  1MDM A;  2XPV A;  2QVO A;  3HXL A;  2P81 A;  1YE9 A;  4BQO A;  4CYC B;  1H9G A;  4GCV A;  3LWF A;  3HOV J;  3ZR8 X;  3BTC A;  3DKY A;  2K40 A;  3S1Q J;  4MFE A;  3HPH A;  5F1J A;  4AID A;  3G71 I;  3E5U A;  2FBI A;  3ZMU A;  2PJP A;  2E60 A;  4NBQ A;  4Q4Z F;  5J8C A;  1F9N A;  1Z7U A;  4IVN A;  4RGS A;  2MD0 A;  2QCO A;  5IOY A;  1MJB A;  1W36 C;  3MCZ A;  4Z6Y A;  2HDC A;  3RZO J;  1WJA A;  2DBB A;  2FQ3 A;  1TQP A;  3N05 A;  2E1N A;  3QWL A;  2NVX J;  2H8W A;  2CRG A;  3BG9 A;  3CLQ A;  4KIT B;  3E5X A;  1RNL A;  3V4G A;  3Q0V A;  4HQM A;  2ELK A;  2W57 A;  1CF7 A;  2W24 A;  2Z16 A;  4KJZ A;  2OTL I;  1IN6 A;  3MEX A;  2EA4 A;  4EV0 A;  4S0H B;  4UY8 I;  1ON1 A;  1U8R A;  1R4N B;  4L5I A;  3J7A Y;  3CMM A;  3ULQ B;  5M3F J;  2IBD A;  1ETV A;  3FXJ A;  2M2E A;  3I4P A;  2CV2 A;  1TT0 A;  4OU0 A;  3B73 A;  4U7B A;  4Y13 A;  3MWM A;  2KZG A;  2BY2 A;  1OCR H;  2JPC A;  4D0P A;  4M6V A;  3L9F A;  5K7Z A;  3IH2 A;  4F52 A;  3GTM J;  4M9S A;  3WHB A;  3BZ6 A;  2DXI A;  2K85 A;  3ZN0 A;  4QLC U;  1YHQ I;  1UST A;  2E5N A;  3ELK A;  1LFB A;  1RES A;  2F5D A;  2ZNY A;  3ABU A;  4PJJ A;  5CQG A;  4C30 A;  5DDG A;  2UZK A;  2E1M C;  4HNU A;  3OYE A;  3CTA A;  1IC8 A;  4WXD A;  4EVI A;  4Y7N J;  5D5X B;  2COB A;  1WJD A;  5EF6 A;  2NVU B;  2L7M P;  2OAZ A;  2LFB A;  4B3X A;  4DIQ A;  2HPM A;  2MYS A;  5IPA A;  1W0U A;  2CG4 A;  2ME0 A;  3S3N A;  5IT9 Z;  2QKM B;  3KZY A;  2ZME A;  4XKV A;  2GAU A;  3S93 A;  1ZLK A;  3H3Z A;  3H5A A;  5E1X A;  2BYV E;  4XIC A;  1LEB A;  2LY1 A;  2KIQ A;  2VXD A;  1U9O A;  4IF4 A;  1ZAO A;  3ZN1 A;  1SAX A;  1HC8 A;  4I99 C;  3LSM A;  2TRT A;  3R0A A;  1V54 H;  4MO7 A;  2XAQ A;  5GAH J;  1FBU A;  2LC2 A;  3F8B A;  2QEX I;  1FIA A;  2EH3 A;  1GVD A;  1YW8 A;  4RAY A;  5IP9 J;  5JLX A;  1Z7L A;  4XK4 A;  3ZQF A;  3OSF A;  1QZZ A;  4ESJ A;  3BG3 A;  3WG7 H;  4L9J A;  1LDK B;  1WH7 A;  1F4K A;  2XSD C;  2OBP A;  1P4A A;  2DA2 A;  2VN2 A;  4G6Q A;  3ZMD A;  5J47 A;  2ETH A;  1AU7 A;  3SFZ A;  3HOT A;  2HOS A;  3E1S A;  2BY1 A;  3F21 A;  1POG A;  1WGX A;  1Y0N A;  2A6E F;  3DPT A;  1T8I A;  2R7S A;  1AA7 A;  4D5F A;  3GTP J;  2XF5 A;  3QU6 A;  3LOC A;  1Z3Y A;  1O3Q A;  5CLS A;  2IEK A;  2LKP A;  3AL0 C;  2LG4 A;  2PMZ A;  3KYL A;  4HRI A;  5IT9 K;  2VON A;  2A68 F;  1AKH A;  1BI1 A;  2HQ5 A;  4RBO A;  1OYI A;  4UB6 C;  1O7L A;  2OD5 A;  5DM6 F;  1BOA A;  3M8E A;  5K7H A;  3HDD A;  5C4X J;  2DT6 A;  2JRM A;  1Z3X A;  5FGM A;  1H89 C;  1U5T C;  3S15 J;  2M34 A;  3TO7 A;  1ACI A;  3CC4 I;  1HF0 A;  4OIN F;  1LNW A;  5J40 A;  5J4Y A;  1S72 I;  1FYM A;  2XC7 A;  4ESF A;  4LLN A;  1DDN A;  4HV5 A;  2WTE A;  1ZRD A;  3FKI J;  2L9N A;  2KPM A;  2VXZ A;  3C3W A;  1F43 A;  2PMH A;  5F04 A;  2XB5 A;  1ZYR F;  1S7O A;  4BNC A;  3OS0 A;  3PNV A;  3RI4 A;  2VBX A;  2MGQ A;  1FT9 A;  3B6C A;  2P7C B;  3QOD A;  5FKL A;  4LB6 B;  1LKX A;  1MBK A;  4PJ0 C;  1UMQ A;  1VZ0 A;  4KMF A;  1MDM B;  3FXQ A;  3K70 C;  2DTZ A;  3PFY A;  3D1N I;  5FO5 A;  3RYP A;  1MKM A;  2K4B A;  1OJL A;  4EJV A;  4HDU A;  4AIK A;  1T33 A;  2UV1 A;  2R7Q A;  3E6M A;  1R71 A;  2VJ4 A;  2A3S A;  2PBI A;  5M5X J;  5M5Y J;  1JUS A;  2UWM A;  1IUF A;  4BJ5 C;  4MHG A;  1GLN A;  1GHC A;  3TW6 A;  3H35 A;  2TDX A;  3S32 A;  2CWE A;  3HUG A;  4XN3 A;  2VKV A;  3QOP A;  4L9T A;  4CCM A;  4FTH A;  3ESW B;  1MMD A;  1TWA J;  3DBR B;  4E7I A;  4DBR A;  5LEJ A;  1J0R A;  3QYB A;  4HW0 A;  3SDB A;  3FM3 A;  4MTE A;  2JWT A;  4AYB N;  1B4A A;  4LG3 A;  3HGY A;  1E0E A;  4I6Z A;  2RAE A;  2NAZ A;  5EJC A;  3GTL J;  1RI7 A;  1R4M B;  1HST A;  2IW5 A;  3ERE D;  1D0Y A;  1T2K A;  1P92 A;  2HWV A;  1FY7 A;  1TWC J;  4XRF A;  2EPF A;  3A0B C;  3ZQI A;  3C1D A;  3QU3 A;  3SEQ A;  4BXX J;  2YS9 A;  2JA2 A;  5JVT A;  1VQK I;  4KYW A;  2H94 A;  3D5L A;  3M8J A;  2XVC A;  4RMN A;  3E7L A;  5E3N A;  4AC0 A;  1APL C;  1ETW A;  2IS1 A;  1KZH A;  4A5N A;  1NH3 A;  1REP C;  4UV9 A;  2HOE A;  2KKO A;  2F5V A;  2ZXI A;  4PCQ A;  5L3C A;  1SVM A;  4N9I A;  1PJR A;  2QQA A;  3OWT A;  4FX4 A;  2O5R A;  4RS8 A;  3ZPL A;  5FLM J;  2BVM A;  3OYD A;  2DOE A;  2VBY A;  2MC4 A;  2ZME B;  4LJZ F;  2VE8 A;  1O3S A;  2VLA A;  5GTI C;  2VI6 A;  3FXL A;  5EEA A;  1P6R A;  2E34 A;  2HQR A;  1S29 A;  3OV8 A;  4F92 B;  1ON2 A;  9ANT A;  1QO0 D;  5DV5 A;  4ETS A;  1G6N A;  2F48 A;  2A6T A;  2K02 A;  4CCO A;  2DMT A;  2DFF A;  5GP9 A;  4S05 A;  2HZT A;  4OMY A;  2R7V A;  3E6C C;  1FLI A;  1G3S A;  2CUJ A;  3M9A A;  1JE8 A;  1X1B A;  2XDV A;  2YSR A;  2NOG A;  5K5Q A;  1JGS A;  3G73 A;  1IW7 F;  1T98 A;  4FIS A;  1GDT A;  3RKQ A;  2B63 J;  3I54 A;  5M3M J;  5A2Q K;  1MMA A;  3G1L A;  2MSY A;  4XBF A;  2VKH A;  3FMS A;  3CMA I;  3CP2 A;  3O3K A;  4ZH4 F;  2OJE D;  1WPK A;  5EZH A;  5ILS A;  5GAD J;  3OY9 A;  3H3V K;  2R7U A;  1EF4 A;  1R36 A;  1BR1 A;  1FYK A;  3CMY A;  2VE9 A;  4O6J A;  3JR9 A;  1WWX A;  4B4C A;  1PUF B;  3CJN A;  2Y31 A;  4G6D A;  3MAJ A;  1R22 A;  1RKW A;  1XMX A;  3S14 J;  2DK5 A;  2WWY A;  1XX5 A;  2FML A;  1JJ6 C;  4BAY A;  3TDZ C;  3BCB A;  4P96 A;  1SFK A;  5LEK A;  2CS3 A;  5FD5 A;  1A35 A;  1IZ1 A;  2WAQ A;  3LSI A;  4M3B A;  4BXF A;  4BGD A;  3S2W A;  2R4G A;  2XRL A;  4UHT A;  4S04 A;  1FOW A;  4A3C J;  3RSN A;  1MH3 A;  3EUH A;  1KA8 A;  4KIF A;  2I10 A;  1W1W E;  1OIS A;  1U5T B;  4LB5 A;  5L3B A;  3KZZ A;  3GVA A;  3K0L A;  2H8R A;  1A5J A; 
#chains in the Genus database with same CATH homology
 5LGU A;  4BHC A;  3RDI A;  5DCM A;  3HOS A;  4HX8 A;  5DUI A;  3KP5 A;  1SD5 A;  1QBJ A;  2RDP A;  3WTW C;  3T8R A;  5DEQ A;  3VB2 A;  3GZ6 A;  3T1B A;  1IAW A;  3RKW A;  1MJA A;  2XAS A;  1TW3 A;  2FU4 A;  4K2E A;  2RC4 A;  5LRS A;  3R60 A;  4GYG A;  5E1W A;  3H3U A;  4CZZ A;  2NYX A;  4JK1 X;  2MLG A;  4KIG A;  5E8I A;  5FD6 A;  1G3T A;  3R4K A;  2FSW A;  3F8C A;  2P8T A;  2ESH A;  3FHZ A;  1USS A;  4RAZ A;  2GIV A;  2IA1 A;  2XHK A;  4G7H F;  3V8L A;  3G3Z A;  3TKY A;  5CYV A;  3CUQ C;  5IT3 A;  3K1M A;  3JW4 A;  2QBY B;  5D4R A;  2ZCW A;  2XIG A;  3BJA A;  1D3Y A;  3E97 A;  2JPB A;  3LAJ A;  4P55 A;  3I64 A;  4EJU A;  3HHH A;  1CGP A;  2L4M A;  1NHA A;  1GVJ A;  2KJB A;  2XAF A;  3F6V A;  4R1H A;  5D8K B;  3BY6 A;  2F5C A;  5L3G A;  5BPI A;  2PN6 A;  2MD5 A;  1TQI A;  1XGS A;  1XD7 A;  3ROU A;  3J80 K;  2DU9 A;  3I59 B;  2JSC A;  3V7S A;  3HSR A;  5HDG A;  4HV6 A;  3R0J A;  3WGH A;  2ZNZ A;  1IN8 A;  2VT3 A;  5HLG A;  1MD0 A;  2HS5 A;  2PMU A;  4FT8 A;  4KN7 X;  5HLI A;  2EV0 A;  2EA2 A;  1FP1 D;  3RPU A;  1XMK A;  3DXJ F;  5BQT A;  2GXB A;  3IC7 A;  1XGN A;  4GYI A;  3QRF F;  3T8T A;  4UV8 A;  2Z33 A;  5H6R A;  4DQ2 A;  4HF0 A;  2JZY A;  2PEX A;  1XSD A;  4LD5 A;  3EQL F;  3HTU A;  1XSV A;  2HTJ A;  4RGX A;  1XCV A;  3F6O A;  2Y75 A;  1R7J A;  2FMY A;  3KP7 A;  5DCM B;  4NHJ A;  4ENJ A;  1B9M A;  1B6A A;  1QGP A;  4Q47 A;  3KFW X;  3HSE A;  1ONV A;  4CDG A;  5E17 F;  3HRU A;  2L02 A;  2IT0 A;  2Y48 A;  2VC0 A;  1D8K A;  5KVR A;  2F5E A;  3TO6 A;  1I27 A;  2BEO A;  3FMQ A;  4E70 A;  2QM3 A;  1BJA A;  4OIQ F;  2WV0 A;  3QP5 A;  3GXO A;  3V7R A;  2LDU A;  1C0W A;  2MC3 A;  3M1E A;  4I0B A;  2AS5 F;  1S6L A;  1DP7 P;  2DTR A;  2MA3 A;  2IA2 A;  1RIO H;  4AVP A;  2EFP A;  4LK1 F;  4ENM A;  3DV8 A;  2KIM A;  3GFM A;  3MFK A;  3KEO A;  3V8J A;  4U0Y A;  1LVA A;  4UVB A;  2FBH A;  3MZY A;  1TQM A;  1LB2 A;  1T38 A;  2H09 A;  4HDV A;  1T0F A;  3BDD A;  1LQ1 A;  3SHF A;  4A0Z A;  2JRT A;  3RIR A;  4M9Z A;  4U0V A;  3KP3 A;  4EGZ A;  4L0Z B;  2P5V A;  3SQN A;  5LGT A;  1E2X A;  4EJW A;  1P4W A;  4CGZ A;  4PDK A;  5ERI A;  2HFH A;  4IPA A;  3GEZ A;  2DPD A;  4F7Z A;  2NS0 A;  2CFX A;  2RV8 A;  3ECO A;  3HRT A;  1UHW A;  3WGG A;  1FYL A;  2B0L A;  1HW1 A;  3D0S A;  4HLX A;  1O3T A;  2ESN A;  1J2X A;  1YG2 A;  2R7F A;  1ZG1 A;  1TBX A;  1V3F A;  5E20 A;  1ZRF A;  3IRQ A;  2OU2 A;  1IN7 A;  1SMY F;  2MLK A;  4MQV A;  1L0O C;  5BOX A;  3H92 A;  3QPH A;  4EM0 B;  3CDH A;  4EM1 A;  1KYZ A;  3WTZ A;  2D1H A;  4M71 A;  1TTY A;  5AON A;  4WCG A;  3PQJ A;  5FB2 A;  5ICE A;  2V6C A;  3WTS C;  4OIO F;  5CVJ A;  2IA0 A;  2LF7 A;  2HQN A;  3KP4 A;  2ISZ A;  4L9V A;  4HAM A;  3W6J B;  4I01 A;  1MJ9 A;  2XKO A;  2EFN A;  2JT1 A;  2OA4 A;  2RQP A;  1YO5 C;  3V8K A;  3GF2 A;  2GQQ A;  1MGT A;  2QQ9 A;  2IRF G;  2ZXJ A;  3EET A;  3HHG A;  5FLX Z;  1IRF A;  5HDN A;  1QPM A;  2H6C A;  2Q8K A;  1FZP B;  1FBS A;  3DPL C;  1BIB A;  3GO5 A;  1U5T A;  2DW4 A;  3E3V A;  1HW2 A;  1KQ8 A;  3KE2 A;  2DPU A;  2EFO A;  3R6S A;  4ZZL A;  1R23 A;  5HDK A;  1ZG3 A;  5ILU A;  4XLP F;  2A6H F;  2FA5 A;  2NNN A;  4M6X A;  3KEQ A;  4CYD A;  3DP7 A;  2K4J A;  5DCF A;  4YG2 F;  2ACJ A;  3WG9 A;  3O6B B;  6PAX A;  2RGV A;  1HKT A;  4YFX F;  5FLX K;  2W25 A;  3GFL A;  4OIR F;  2A69 F;  2EV5 A;  1YYV A;  1BM9 A;  4OIP F;  2IVM A;  2KJC A;  3LST A;  2BGC A;  1BI0 A;  1JHF A;  3I71 A;  1ZGA A;  1QNT A;  5LHI A;  3P7N A;  1U3E M;  3COA C;  1JXS A;  4GO1 A;  2MH9 A;  5LBQ A;  2ZKZ A;  1XMA A;  5A2Q Z;  4Y15 A;  1A04 A;  2QBY A;  2GWR A;  4XSX F;  1FBQ A;  2M45 A;  3QAH A;  4FX0 A;  5J8F A;  1I1G A;  2M8E A;  5D5W B;  2FXA A;  1FNN A;  2YR2 A;  3GYH X;  3FZV A;  3T5X A;  2CGP A;  4TV7 A;  4I09 A;  1YTY A;  4R79 A;  4MNU A;  2BBY A;  1BN5 A;  3ZMT A;  2GZW A;  2LF8 A;  3BJO A;  1TNS A;  5CJ9 A;  1KGS A;  3V7C A;  3TOB A;  2IPQ X;  3I59 A;  3HIF A;  1F5T A;  3MQ0 A;  5CVV A;  3K69 A;  1IRG A;  1S8N A;  3TDU C;  1KU3 A;  3K1P A;  2C6Y A;  3F22 A;  3FF5 A;  2FOK A;  1UFM A;  4EMS A;  3FMR A;  2EFW A;  3RPQ A;  4YFK F;  4M74 A;  5K5O A;  2XGX A;  1JHH A;  4B8X A;  1FP2 A;  4AD9 A;  3BOQ A;  2XAH A;  5DUK A;  5FFZ A;  3J81 K;  3LQQ A;  4RB1 A;  1K79 A;  5E18 F;  2ZO4 A;  4ON0 A;  3ZMV A;  4EGY A;  2ADU A;  3HRM A;  4IRI A;  2XAG A;  4ZYE A;  1H9T A;  2DLL A;  4IJA A;  3F72 A;  4RB3 C;  3CO6 C;  1IXC A;  3DQV C;  2V1U A;  4ZYH A;  2O8X A;  1H0M A;  3JAM Z;  1SFE A;  2OZU A;  4Y17 A;  3KET A;  1BI2 A;  1HSJ A;  2CQK A;  1YS6 A;  1GXP A;  2Z3Y A;  3CLO A;  5L3F A;  3WTV C;  1R1V A;  4AIJ A;  4BXU A;  4MGR A;  1BC8 C;  3JSO A;  1R00 A;  1RUO A;  4HLY A;  3L00 A;  5K5R A;  1D8J A;  1ZAR A;  4WX9 A;  2NNY A;  5ICG A;  3JTG A;  4O3M A;  3LQR A;  4KIB A;  1WI9 A;  2P7V B;  2YU3 A;  3ABT A;  4RGR A;  1T6S A;  3I53 A;  3J80 Z;  3C18 A;  3F8N A;  2O03 A;  1FWZ A;  1HKQ A;  1B1B A;  3GLX A;  3CUO A;  3JAM K;  4LGW A;  4LK0 F;  1KU2 A;  1ZH5 A;  4EJO A;  3IWF A;  5ILV A;  3L2C A;  4RGU A;  5JFR A;  3W6K B;  2PLY A;  1SFX A;  4CHU A;  4ENK A;  3RJP A;  3KLO A;  2FEZ A;  4M72 A;  2EFQ A;  5DD8 A;  2AXL A;  1Y0U A;  1B59 A;  5EEH A;  5D5U B;  2ZBK A;  1QQI A;  2QWW A;  1EH7 A;  1Q1H A;  4KIC A;  4HYE A;  2PFB A;  3I0T A;  5EEG A;  4HQE A;  3B02 A;  4GGG A;  3IHU A;  5BMZ A;  2V1D A;  1PP8 F;  2VBZ A;  1YW7 A;  3L09 A;  4AWX B;  4P9F A;  1XGO A;  3IKV A;  2K7L A;  1K7A A;  3F3X A;  2HTS A;  3ECH A;  4I7H A;  5ICC A;  1ZGJ A;  2HKX A;  4BQA A;  2DQL A;  2V9V A;  1Z91 A;  2V79 A;  1OPC A;  3TQN A;  4M73 A;  4XLN F;  2LNB A;  5CVI A;  2VT2 A;  1EH8 A;  4H0E A;  2PQ8 A;  1YFH A;  3GW2 A;  4G7Z F;  3BP8 A;  1RZ4 A;  2QQB A;  4EM2 A;  2Q2E A;  2R7D A;  4M6Y A;  3IWZ A;  1R5G A;  2RN7 A;  1KU9 A;  2X0L A;  3I58 A;  4KNY A;  2NRA C;  3FX3 A;  3NEU A;  3RYR A;  1ZRE A;  1ZN2 A;  3U1D A;  1EV7 A;  1O57 A;  2DK8 A;  4GXO A;  3HSF A;  3EYI A;  4PZJ A;  3WU1 B;  1W7P A;  4IHT A;  2L01 A;  3Q9V A;  1IXR C;  1EH6 A;  1S3J A;  1J9I A;  1FC3 A;  4HBL A;  4MTD A;  2D45 A;  2ELH A;  3ISP A;  5JI6 A;  5CVU A;  2QEN A;  1B9N A;  1IN5 A;  1DPU A;  3PFI A;  2O3F A;  4G8X A;  1BC7 C;  5BPD A;  5J6X A;  5AIP A;  3HRS A;  2IJL A;  2FBK A;  2Z99 A;  2DQR A;  1GXQ A;  1XCB A;  3DEU A;  4G9Y A;  2VOD A;  2J5O A;  4YII A;  5ICF A;  1S7A A;  3CUQ B;  5F64 A;  2DO7 A;  4A5M A;  4L5J A;  3J7A O;  3FM5 A;  3F23 A;  1ODD A;  1BBY A;  1YIO A;  3Q9S A;  1TW2 A;  1AOY A;  4YFN F;  3AAF A;  4G7O F;  4PGG A;  3KCC A;  2EJR A;  2XV4 S;  4IHS A;  3E6B A;  3M7G A;  4RB2 C;  1Z05 A;  3Q5F A;  2HYG D;  2G7U A;  3GZ5 A;  3K1N A;  1J5Y A;  2Y0M A;  4WXC A;  4BYY A;  1OYW A;  4ESB A;  2ISY A;  2QUF A;  1XN7 A;  2G9W A;  4JBA A;  2M5W A;  2HEO A;  3O2P E;  5HS9 A;  2ZFW A;  2FE3 A;  5D6E A;  1XGM A;  4UNO A;  1LJ9 A;  3N4M A;  4HZF A;  4UVC A;  1DUX C;  1YQA A;  1K78 B;  3RKY A;  2A5Y B;  2K86 A;  5LLQ A;  1WRJ A;  3WU0 A;  1UB9 A;  4U0W A;  3WTU C;  2VC1 A;  4EJT A;  5HOO A;  3SZP A;  4O5V A;  1KU7 A;  3LAP A;  5D8L B;  3GUD A;  2L3D A;  3GX4 X;  4NQW A;  3ZQ7 A;  3FXR A;  1AWC A;  2ZJ2 A;  1R5H A;  4AIH A;  4BHB A;  1XDS A;  5H6Q A;  4A0X A;  4P9U A;  1Z9C A;  2KIF A;  2E1C A;  2M1B A;  1OMI A;  1W7P B;  2QLZ A;  1HXD A;  2OQG A;  4KN4 X;  4P5O A;  4UXN A;  1J59 A;  3KLN A;  1PDN C;  1UHM A;  2W84 A;  2VBW A;  3VEP A;  3WTT C;  2DI3 A;  3ZP5 A;  5TRD A;  2VOO A;  4I02 A;  3IRR A;  2DAO A;  4L0Y B;  1G3Y A;  2FRH A;  1LDJ A;  4MEY F;  3FXU A;  1IN4 A;  3GWZ A;  5E1Z B;  5FFX A;  1ZRC A;  2P6T A;  4EQQ A;  4Z2Y A;  2E7X A;  2IP2 A;  2COM A;  1X3U A;  1R1U A;  3L7W A;  1OYY A;  2R3S A;  3EYY A;  2Z5U A;  3WTX C;  3NRV A;  4L18 B;  2GA1 A;  1SMT A;  1MZB A;  2G7H A;  1IUY A;  1ZLJ A;  5DYM A;  1O3R A;  4HX4 A;  2O61 A;  2QYO A;  2PI0 A;  3DKW A;  4FHT A;  5E8G A;  3OOP A;  1OR7 A;  2Q0O A;  2FNA A;  1CF7 B;  1W5T A;  1W4M A;  3DFG A;  2HYF A;  1WSU A;  3QP6 A;  3MZH A;  2L54 A;  1FX7 A;  5AIQ A;  2XKP A;  3U9G A;  2XUB A;  2X4H A;  4L9N A;  3SXY A;  2RKH A;  5DD4 A;  2P5K A;  3J81 Z;  5F1R A;  1KQ9 A;  3RTR A;  2HKO A;  3BJ6 A;  2O6G E;  4DNC A;  1K6O A;  1I6X A;  3LA3 A;  4LLG F;  1RUN A;  3JSP A;  1IF1 A;  2F2E A;  1FOK A;  2BV6 A;  2CW0 F;  2STT A;  3REO A;  1OKR A;  4Q5S F;  2RVC A;  4I0A A;  2EB7 A;  4YIF A;  1D5V A;  1WKM A;  4HF2 A;  2PG4 A;  3BPV A;  4ASN A;  4CXF A;  1SD4 A;  1FPQ A;  3LA7 A;  3HTS B;  3GFI A;  1Z6R A;  3WOD F;  2LSO A;  4IRG A;  1HBX G;  1J7K A;  4HX7 A;  4KDP A;  3IL2 A;  3JTH A;  1G3W A;  3VOE A;  4LFU A;  2YX7 A;  3M8F A;  4BHP A;  2L4A A;  3BPX A;  4KFC A;  1YW9 A;  2CSO A;  1Z1D A;  3E6D A;  5LHG A;  4LG0 A;  4A2U A;  4IXA A;  3TO9 A;  4U7D A;  5D4S A;  1LDD A;  2A07 F;  3FWE A;  4ZYG A;  1SD6 A;  1J75 A;  4KA4 A;  3PQK A;  2KIU A;  1L3L A;  3LFK A;  4XSZ F;  5LHH A;  4UUV A;  1TLH B;  2YPR A;  3TGN A;  2HR3 A;  4ZZD A;  3T0Y A;  3KP2 A;  1BIA A;  4HF1 A;  3BWG A;  1YS7 A;  2UXX A;  4ENN A;  2FNP A;  3GFJ A;  2DFI A;  3VOD A;  5L3E A;  4UVA A;  4HOB A;  4KUM A;  2F5F A;  2YX4 A;  3LA2 A;  3E5Q A;  2MBF A;  2VOP A;  5D6F A;  5ED4 A;  5L3D A;  1P4X A;  4A6E A;  2STW A;  2UXN A;  3VFZ A;  2P6S A;  3CUQ A;  2XAJ A;  3P9I A;  1E17 A;  1BI3 A;  3K9T A;  1FSE A;  4G94 A;  4HA8 A;  2D1V A;  2K27 A;  1XDU A;  3QPT A;  4WK8 F;  1DPR A;  1PUE E;  4KT5 C;  4R8H A;  3EDP A;  4LLL A;  4I2O A;  4QWQ A;  1VTN C;  1KQ0 A;  2MH2 A;  5LGN A;  3CO7 C;  1W5S A;  5JR3 A;  1I1S A;  4B09 A;  2CO5 A;  3R61 A;  1FSH A;  4MEX F;  4A0Y A;  1HKS A;  1XSX A;  1WQ2 A;  3ML6 A;  4CO8 A;  4MQ9 F;  4IRH A;  2GA2 A;  2EWN A;  4M9X A;  1R58 A;  1HW5 A;  3N97 A;  1UCR A;  2O0Y A;  3C7J A;  3IKT A;  5KK1 A;  1ZG5 A;  2QZ8 A;  1ULY A;  4I98 B;  1IXS B;  3HYI A;  2Z9O A;  5D5V B;  1SFU A;  2A61 A;  4OMZ A;  4WWC A;  1TNT A;  3WE3 A;  4OOI A;  4PGH A;  4U88 A;  3RKX A;  5HS8 A;  1U2W A;  4N0B A;  1K78 A;  3SZT A;  5HLH A;  1QZY A;  3KP6 A;  1SD7 A;  3ZMS A;  3I5U A;  1G4D A;  2M30 A;  1ZHF A;  2OZ6 A;  3P9K A;  4KMU X;  4CIC A;  5HVQ C;  4LG0 B;  2H27 A;  3F8M A;  1F1Z A;  4ZYD A;  1U78 A;  1P2F A;  2E7W A;  5HS7 A;  3F8F A;  4A6D A;  1KYW A;  1LEA A;  1Z6T A;  2KRF A;  2BE5 F;  4JQF A;  3U2R A;  2OQR A;  5TJJ A;  3K2Z A;  1T39 A;  5H20 A;  2M87 A;  2P4W A;  5CVR A;  5BS6 A;  1YLF A;  4A12 A;  4BH9 A;  4NB5 A;  2WC2 A;  2W85 A;  5JHU A;  1I5Z A;  1XB4 A;  2XRO A;  2DT5 A;  2J5P A;  1O7F A;  2H6B A;  4RB0 A;  4Q48 A;  3TOA A;  1W7P D;  2JTV A;  1R1T A;  3BRO A;  1PP7 U;  2HGC A;  3WGI A;  2XRN A;  2FF4 A;  2GXG A;  4LMY A;  2CYY A;  3DF8 A;  5F6F A;  1U6G A;  5K1Y A;  3ZMZ A;  2EK5 A;  2EV6 A;  3WTY C;  2V1X A;  3NQO A;  1STZ A;  4WF2 A;  4N9H A;  2P5L C;  1V4R A;  3WE2 A;  2RNJ A;  2D2W A;  1HQC A;  3P9C A;  5LRR A;  4WXH A;  1MDM A;  2QVO A;  1H9G A;  4GCV A;  3LWF A;  3E5U A;  2FBI A;  3ZMU A;  2PJP A;  4Q4Z F;  5J8C A;  1F9N A;  1Z7U A;  4IVN A;  4RGS A;  1MJB A;  3MCZ A;  2HDC A;  2DBB A;  2FQ3 A;  1TQP A;  2E1N A;  3E5X A;  1RNL A;  3V4G A;  4HQM A;  2W57 A;  1CF7 A;  2W24 A;  1IN6 A;  3MEX A;  2EA4 A;  4EV0 A;  1ON1 A;  1U8R A;  4L5I A;  3ULQ B;  3I4P A;  4OU0 A;  3B73 A;  4U7B A;  4Y13 A;  3MWM A;  2JPC A;  4D0P A;  3L9F A;  4M9S A;  3BZ6 A;  3ZN0 A;  4QLC U;  1UST A;  3ELK A;  2UZK A;  3ABU A;  2F5D A;  2ZNY A;  5DDG A;  3CTA A;  4WXD A;  4EVI A;  5D5X B;  2OAZ A;  2CG4 A;  5IT9 Z;  3KZY A;  2ZME A;  2GAU A;  1ZLK A;  3H3Z A;  5E1X A;  2BYV E;  1LEB A;  4IF4 A;  1ZAO A;  3ZN1 A;  1SAX A;  3R0A A;  2XAQ A;  1FBU A;  3F8B A;  1YW8 A;  4RAY A;  1QZZ A;  4ESJ A;  4L9J A;  1LDK B;  1F4K A;  2OBP A;  1P4A A;  2VN2 A;  4G6Q A;  3ZMD A;  2ETH A;  3SFZ A;  3HOT A;  3F21 A;  2A6E F;  3DPT A;  3QU6 A;  1O3Q A;  5CLS A;  2LKP A;  5IT9 K;  2VON A;  2A68 F;  1BI1 A;  1OYI A;  1O7L A;  2OD5 A;  1BOA A;  3M8E A;  5FGM A;  1U5T C;  3TO7 A;  4OIN F;  1LNW A;  1FYM A;  4ESF A;  4LLN A;  1DDN A;  4HV5 A;  2WTE A;  1ZRD A;  2VXZ A;  3C3W A;  2PMH A;  1ZYR F;  1S7O A;  4BNC A;  3RI4 A;  2VBX A;  1FT9 A;  2P7C B;  4LB6 B;  4KMF A;  1MDM B;  3FXQ A;  5FO5 A;  3RYP A;  1MKM A;  2K4B A;  4EJV A;  4HDU A;  4AIK A;  3E6M A;  2A3S A;  2PBI A;  2UWM A;  4MHG A;  1GHC A;  2TDX A;  2CWE A;  3HUG A;  3QOP A;  4L9T A;  5LEJ A;  1J0R A;  4HW0 A;  3FM3 A;  4MTE A;  1B4A A;  2NAZ A;  1RI7 A;  1HST A;  3ERE D;  2IW5 A;  1T2K A;  1P92 A;  2HWV A;  1FY7 A;  4XRF A;  3C1D A;  3QU3 A;  5JVT A;  4KYW A;  2H94 A;  3D5L A;  2XVC A;  4A5N A;  1REP C;  4UV9 A;  2HOE A;  2KKO A;  4PCQ A;  5L3C A;  4N9I A;  2QQA A;  4FX4 A;  4RS8 A;  3ZPL A;  2VBY A;  2ZME B;  4LJZ F;  2VE8 A;  1O3S A;  1P6R A;  2HQR A;  1S29 A;  3OV8 A;  1ON2 A;  1QO0 D;  5DV5 A;  4ETS A;  1G6N A;  2K02 A;  4S05 A;  2HZT A;  4OMY A;  3E6C C;  1FLI A;  1G3S A;  1JE8 A;  3M9A A;  2YSR A;  5K5Q A;  1JGS A;  3G73 A;  1IW7 F;  1T98 A;  3I54 A;  5A2Q K;  4XBF A;  3FMS A;  3O3K A;  4ZH4 F;  5ILS A;  1R36 A;  1FYK A;  2VE9 A;  4O6J A;  1WWX A;  3CJN A;  4G6D A;  3MAJ A;  1R22 A;  2DK5 A;  2WWY A;  2FML A;  4BAY A;  3TDZ C;  4P96 A;  5LEK A;  5FD5 A;  1IZ1 A;  3S2W A;  4UHT A;  4S04 A;  3EUH A;  1KA8 A;  4KIF A;  1U5T B;  4LB5 A;  5L3B A;  3KZZ A;  3GVA A;  3K0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...