1LNWA

Crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
NYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor
molecule keywords Multidrug resistance operon repressor
publication title Crystal structure of the MexR repressor of the mexRAB-oprM multidrug efflux operon of Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 48
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lnwA01
4M9XA 2EFQA 1XGMA 3WGHA 2VBXA 3WTVC 2LDUA 1K78A 4WCGA 1KGSA 4ASNA 3HOTA 3QPTA 4OIRF 4RB2C 5HLHA 4I02A 3V8JA 2Q2EA 3HSEA 1BN5A 1BI3A 5E1ZB 4HX8A 4WK8F 5TRDA 2CWEA 4IVNA 2BYVE 1Y0UA 4OIQF 1XDUA 1GXPA 4IRGA 1XSVA 1DP7P 4P9UA 5BMZA 3GLXA 2YX7A 2KIUA 4BQAA 2VT3A 3TQNA 4ENNA 4A6DA 5EEGA 2PFBA 1IN8A 3Q9SA 1A04A 4KMUX 4KIFA 3WU1B 3FWEA 2PQ8A 2L54A 3F8NA 2QM3A 5TJJA 5HDGA 3E6BA 4I2OA 4M9ZA 5KVRA 3E6CC 1ZG1A 3L2CA 5DCMA 1KQ9A 1C0WA 5E8IA 1GHCA 2G7HA 3H92A 2M1BA 1IXCA 1KU9A 2PLYA 1DPRA 3KEOA 1S6LA 3GF2A 1SD5A 4ETSA 3DXJF 2A61A 3HSRA 3NRVA 3H3UA 3L00A 1SD6A 2EWNA 3W6JB 2Z9OA 2K86A 3HHHA 4UV9A 4OINF 4ZZDA 5D5XB 3FMQA 4OOIA 3TO6A 3EDPA 1J5YA 4CICA 2J5PA 2VOPA 4YFXF 3ZMVA 2TDXA 4ZYEA 3BPVA 3F8MA 5LBQA 1BBYA 3MZYA 3CLOA 2DW4A 3GZ6A 3ROUA 3G73A 4G8XA 1IN6A 3MWMA 4MNUA 1XMKA 3MCZA 2VOOA 4A2UA 4YIIA 3HHGA 3F8FA 4M72A 2FOKA 2HTSA 4BNCA 3HYIA 4I7HA 4I09A 1XCBA 1G3TA 5LLQA 1PP8F 1WRJA 2QQAA 4A0XA 4OIPF 4ESJA 2XKPA 4YG2F 2GIVA 2F2EA 2Y48A 1T98A 1MZBA 1TTYA 2CG4A 3EQLF 5CVUA 2MC3A 3ABUA 3KCCA 2LSOA 3JAMZ 4HF0A 2OAZA 2RNJA 1MGTA 2D1HA 3MEXA 3QU6A 4CDGA 2F5FA 2ZNZA 4I01A 1SD4A 3C18A 1G3SA 3K0LA 4AIHA 3DKWA 1HKTA 4CO8A 4L18B 1RNLA 2Z99A 2FA5A 3V8KA 1YLFA 2RV8A 1WQ2A 1HKSA 1O3TA 5ILUA 2QBYA 1K79A 1U8RA 3KP2A 2A68F 4FT8A 3LQQA 1R1VA 1IXSB 3QOPA 1ZGAA 5CVJA 2QBYB 1R5GA 1ZN2A 2DBBA 1O57A 1U78A 4S05A 3E5UA 5HS9A 1IXRC 2X4HA 2QZ8A 4EM2A 2EV6A 5D5UB 2AXLA 2XUBA 1BI0A 1YW8A 2BGCA 4Q48A 4M6YA 4LMYA 1P4XA 4RGRA 3H3ZA 1MKMA 2VE8A 5D6FA 4I98B 3DPTA 3OOPA 3JSOA 3MFKA 3JSPA 2CQKA 1TQIA 3CUQC 4HYEA 3M8EA 2H6BA 2DFIA 1V3FA 2O0YA 3FXQA 2Y75A 2FF4A 5E17F 5LEKA 1IN7A 1FBQA 3JAMK 5D8KB 3D5LA 1FLIA 5K5RA 1FYLA 3IL2A 4HZFA 5DUKA 1S7AA 3I59A 4AWXB 4GCVA 1IRFA 2FRHA 3T5XA 2D45A 1LEBA 2K02A 3IKVA 2E7WA 2RC4A 4OIOF 1X3UA 3WODF 3L7WA 1U3EM 3FMSA 3PFIA 2DT5A 3TO7A 1T38A 1FC3A 3WTUC 4NB5A 2ISZA 3P9IA 1YW9A 1O7FA 1W5TA 5BOXA 1OR7A 4G6DA 1G4DA 3C3WA 4AIJA 3GFMA 2BE5F 1P4AA 3K1PA 4WX9A 3ECHA 1I1GA 3RYPA 2RKHA 5ICGA 4WF2A 1FBSA 1CGPA 2Z5UA 2ZBKA 3VEPA 4E70A 2HYFA 4NHJA 4HW0A 2UWMA 2VBWA 5LRSA 1ZH5A 1WSUA 4KNYA 4KA4A 4CYDA 4PGGA 2ZKZA 5E1XA 2O6GE 1ODDA 3DFGA 4L5JA 3ZN0A 5KK1A 3BPXA 4M6XA 1EH6A 2XASA 1YO5C 3BJAA 3LA3A 2QWWA 4ESBA 1HKQA 2NYXA 1ZG5A 2ESHA 2ZO4A 4XSZF 2JPBA 4PCQA 1B1BA 3I53A 1B6AA 3I4PA 2D1VA 5JR3A 3Q5FA 3VODA 3BP8A 4HOBA 1BOAA 4IPAA 4HQEA 2O61A 3HRTA 2M30A 1D8JA 2R7FA 1SAXA 5FGMA 4BHBA 4GGGA 2RDPA 4N0BA 3RTRA 4BHPA 5F1RA 4RS8A 3JTHA 1QO0D 3LAJA 1H0MA 3EETA 2HTJA 4R8HA 2OZ6A 4ENMA 2VODA 3NQOA 2IT0A 2W84A 2XGXA 4L9JA 3LSTA 1RI7A 5DUIA 2FMYA 2B0LA 3E6MA 2KJCA 1B9NA 5LHHA 5ERIA 1TQMA 2F5CA 2HEOA 4A0YA 3F21A 4LLNA 3GUDA 3R60A 1LNWA 3VB2A 1UCRA 1YG2A 4YFNF 5D5VB 1ON2A 2ETHA 4LK0F 4PDKA 4A6EA 4MEXF 2L3DA 3CUQA 5DV5A 2DAOA 2GQQA 2KRFA 1USSA 1JE8A 3HRUA 1BIAA 3CUQB 4LB6B 4KN4X 1LEAA 4EQQA 3J80Z 3RKXA 1KYZA 3I54A 4UXNA 1YW7A 2VE9A 5FFZA 3K9TA 5FO5A 5ICCA 2GXBA 4HV6A 4Q47A 3JW4A 1G3WA 1GVJA 1XGOA 3MQ0A 1SFUA 3ZMDA 4HDUA 4G9YA 4OMYA 2XRNA 4QLCU 1FBUA 3TDUC 2MD5A 1B9MA 3HOSA 2QQ9A 2O03A 5LGTA 4LJZF 3GZ5A 3P9KA 4WXHA 1J59A 2LF8A 5HLGA 3WE3A 2A69F 1Z9CA 5DCFA 3I5UA 1OYWA 2K4BA 1IRGA 3HTSB 2M8EA 1QPMA 2LKPA 1D5VA 2DO7A 2IA1A 3QRFF 3R0AA 3P9CA 4Q4ZF 5ED4A 4ZZLA 4EGZA 2A3SA 4ENKA 4A12A 3WG9A 4EJVA 4KUMA 2H6CA 3B73A 4JK1X 4UVAA 2OA4A 3GFLA 2XAGA 3FXUA 4HAMA 3J80K 5BPDA 5J8FA 4ENJA 1KYWA 2XKOA 2DPDA 2IRFG 3ZMTA 4GYIA 5L3EA 1ZHFA 4M9SA 3G3ZA 2DPUA 2GA1A 2EFWA 2IP2A 5J8CA 2F5EA 1ZRDA 2VBYA 1FWZA 5AONA 4L0YB 4G7OF 3HUGA 4EM0B 1P92A 2M45A 1R1UA 3E6DA 1U5TC 4KT5C 2FXAA 1LVAA 1ZAOA 2L4AA 3BDDA 1NHAA 2L01A 2PJPA 2R3SA 2FSWA 1MDMB 4JBAA 2KJBA 1XN7A 4L9NA 2GAUA 2OQGA 4UVCA 2PI0A 4AVPA 1SFEA 2V6CA 3P7NA 4HX7A 1MJBA 2JTVA 4RGUA 3EYIA 1FSHA 3E5QA 1R36A 2DQLA 3LFKA 2L4MA 3IHUA 1TNSA 4XLNF 1FP1D 5FB2A 2W24A 3QPHA 1UHWA 5CLSA 5EEHA 4ZYGA 2JZYA 1ON1A 2GZWA 4HLXA 1R1TA 1W7PA 2W85A 2YPRA 4FX4A 3DQVC 1J0RA 3LWFA 5JI6A 3L09A 3E5XA 4AIKA 1HSJA 3TKYA 1W7PB 1L0OC 1ZRFA 5FLXZ 1I5ZA 4M73A 3IC7A 1Z6TA 4GXOA 5E20A 5HDNA 3WGGA 2E1CA 3TDZC 3O3KA 2K7LA 2WC2A 5FD6A 2ZCWA 3LA2A 2STWA 2CW0F 3SXYA 2EA4A 4G7HF 1WKMA 1H9TA 4P55A 1I27A 2UXXA 5D5WB 2UZKA 4XRFA 1OYIA 1QGPA 2QVOA 3D0SA 2MLKA 1XDSA 1I6XA 4KIBA 2PN6A 5DD4A 3JTGA 2A6EF 3GXOA 5CVIA 5IT9Z 2ZXJA 4BAYA 1CF7A 2DU9A 1QZYA 1LDKB 1RZ4A 3F3XA 4HF1A 3BZ6A 1OYYA 2ISYA 1CF7B 5K5OA 1RUOA 5H6RA 2P5LC 2Q8KA 5A2QZ 1U2WA 3WTTC 1F5TA 5H6QA 2F5DA 5JFRA 4KMFA 5HDKA 1F1ZA 2KIMA 1R7JA 5L3GA 1S7OA 3BOQA 2P7VB 4IRHA 2A5YB 2HWVA 4Q5SF 2HOEA 5F6FA 1H9GA 2MLGA 5FLXK 3HRMA 1QQIA 2D2WA 2EV0A 1USTA 4IHSA 2MA3A 1RUNA 1ZARA 4HA8A 2MH9A 3TGNA 4O5VA 1HW1A 5DYMA 2STTA 1TW3A 4ESFA 1ZRCA 3ERED 3LAPA 1S3JA 4O6JA 2RVCA 1FOKA 5BS6A 1OKRA 3BJ6A 2IVMA 4KFCA 2FEZA 3K2ZA 1YTYA 5J6XA 1QZZA 1V4RA 1DDNA 5ICEA 4AD9A 1D8KA 4UUVA 5ILSA 1FT9A 3AAFA 3SQNA 5IT9K 4L9VA 2WWYA 1RIOH 4LD5A 5CVRA 1U5TB 2ADUA 3O2PE 2HR3A 5D6EA 3TO9A 2OD5A 5A2QK 1PUEE 3COAC 2WTEA 3K69A 1MJAA 2BV6A 4EVIA 2K27A 1SMTA 4L0ZB 2Z3YA 4PGHA 4JQFA 3J7AO 1KA8A 1HW5A 3GO5A 3RDIA 5BQTA 1BI1A 5K1YA 3ECOA 1TLHB 2HGCA 4P5OA 2KKOA 2V9VA 3GX4X 4MHGA 4H0EA 3KZZA 1QNTA 2RQPA 2GXGA 1EH8A 3E97A 2QYOA 1UB9A 4CGZA 3I71A 3V7RA 4XLPF 2V1XA 3SFZA 2M87A 1ONVA 3VOEA 1EV7A 3NEUA 2XAQA 2FBHA 2EV5A 1IN5A 1MJ9A 2G7UA 1Z05A 4HV5A 3V8LA 3F22A 3R0JA 4WWCA 4LLGF 4G7ZF 2HS5A 1G3YA 5D4SA 1FY7A 1J75A 1P6RA 5LGNA 2VXZA 2E7XA 4Y17A 1I1SA 3TOBA 4DQ2A 2PEXA 3ULQB 4A5MA 4KYWA 3FZVA 2NNNA 5LHGA 4MEYF 2HQNA 3I58A 4HDVA 6PAXA 4WXDA 1R23A 4L9TA 3KZYA 2HDCA 4RGSA 1WI9A 4RAYA 3V7SA 3PQKA 3DP7A 2P8TA 2O3FA 1IF1A 1XSDA 4FHTA 2ELHA 4MQ9F 5LRRA 3RJPA 4F7ZA 4U7DA 1TW2A 3F23A 1W4MA 2W25A 3M9AA 1F9NA 5ILVA 1LJ9A 1P4WA 2DTRA 4YIFA 2C6YA 4G6QA 1XMAA 4CHUA 5L3DA 2BBYA 2P6SA 1O3RA 2XIGA 3DEUA 1UHMA 4G94A 4A5NA 3CO7C 2YX4A 4Z2YA 1YIOA 1GXQA 1Z91A 1J9IA 3WTWC 1IN4A 4HX4A 1L3LA 2WV0A 2Z33A 2MH2A 2O8XA 1TBXA 2X0LA 2EB7A 4IJAA 2P6TA 4IHTA 2FU4A 4UNOA 3CO6C 5D4RA 4OMZA 5CYVA 3J81Z 2H09A 3GFIA 1VTNC 1W5SA 3QAHA 2PMHA 2KIFA 4CZZA 4RB0A 3FXRA 3WE2A 3IWFA 1E17A 4FX0A 1K78B 3HTUA 4QWQA 3L9FA 3ZMZA 2EFOA 2EFPA 1FP2A 2YSRA 2OQRA 2P5KA 2RGVA 3LQRA 4HF2A 3GEZA 3ELKA 2JSCA 4B09A 1FNNA 1FPQA 4ZYDA 1ZREA 3V4GA 4KDPA 4U0YA 2XAFA 1XSXA 2DLLA 2NAZA 2GWRA 2YR2A 5HS8A 1KU3A 5E8GA 4LB5A 2DI3A 2EJRA 2HZTA 3ZQ7A 2YU3A 3KP5A 2R7DA 4ON0A 4R1HA 2DK8A 3TOAA 4LK1F 2XVCA 1E2XA 4MTEA 1BM9A 4UHTA 3F72A 2L02A 3ZPLA 3HSFA 2CGPA 2EFNA 1IZ1A 3QP6A 5K5QA 2G9WA 5CVVA 2NNYA 3RPQA 4OU0A 2V79A 1O3SA 4IRIA 4Y15A 3BWGA 3REOA 4RGXA 3KFWX 1MDMA 2IA0A 1R58A 3J81K 4Y13A 1P2FA 5DCMB 4GO1A 1R00A 4LFUA 1STZA 3IRRA 3F6VA 2JPCA 1LDJA 3WTZA 1YFHA 3KLNA 3E3VA 1T2KA 4UVBA 4O3MA 1YS7A 1BI2A 2HQRA 2IJLA 5JHUA 4GYGA 2VBZA 2DK5A 1YYVA 1D3YA 5DEQA 1SMYF 1B59A 5DDGA 3C7JA 2JRTA 1O7LA 1KQ0A 4LLLA 2DQRA 3WTSC 1T39A 1R5HA 3FM3A 4KN7X 2ZMEA 3T8TA 4MTDA 1FYMA 4HLYA 2CSOA 3KE2A 5AIQA 1SD7A 1FYKA 3ML6A 3EYYA 1HXDA 2UXNA 5L3BA 4MGRA 3KLOA 2ZMEB 2FQ3A 5FFXA 3S2WA 3GW2A 4ZYHA 4BYYA 3M8FA 3BROA 5H20A 3I64A 3RKYA 2QENA 2VT2A 4HBLA 3QP5A 4B8XA 3U9GA 1ZG3A 2PMUA 3OV8A 1HW2A 1XCVA 1AWCA 2JT1A 1KU2A 2A6HF 3MAJA 3MZHA 4M71A 5JVTA 3RKWA 4KIGA 2P5VA 5IT3A 5E1WA 3T8RA 3VFZA 1JHFA 1XGNA 1B4AA 1BJAA 2XAJA 3M1EA 2K4JA 1BIBA 3CDHA 4K2EA 3LA7A 1JHHA 3KP7A 2BEOA 1UFMA 1Z7UA 3KP3A 4M74A 3DV8A 3U2RA 3QU3A 1O3QA 4RB3C 4RAZA 2HKOA 5LEJA 1S29A 1OMIA 2QUFA 2ACJA 2FE3A 3DPLC 1FZPB 5D8LB 1FSEA 4DNCA 1F4KA 1LDDA 2RN7A 1ZYRF 3V7CA 2V1UA 2OZUA 2VN2A 1DUXC 5HOOA 1BC7C 3ZMUA 3BJOA 2GA2A 4HQMA 4UV8A 3R6SA 4P9FA 4LG0A 4EJUA 4I0BA 4BH9A 3CTAA 3KP4A 3N97A 4BXUA 2NS0A 2FNPA 2LF7A 3WU0A 4EJOA 5BPIA 3KEQA 2PBIA 1IUYA 1TNTA 4LG0B 2AS5F 1HSTA 2J5OA 3CUOA 4KICA 3KP6A 3GWZA 1KU7A 4RB1A 1DPUA 2ZFWA 1U5TA 4BHCA 4R79A 1ULYA 3FHZA 1Q1HA 2CO5A 1IW7F 5LGUA 5LHIA 4N9HA 3I59B 2P7CB 1J2XA 2NRAC 3R4KA 1MD0A 1S8NA 3FF5A 4D0PA 4U0WA 3T0YA 3CJNA 3U1DA 4MQVA 2FBIA 2M5WA 2CFXA 3K1MA 1LB2A 2FNAA 2EK5A 2HKXA 2HYGD 3I0TA 1BC8C 2XAHA 4XBFA 1K7AA 5HVQC 1W7PD 3RPUA 3KETA 1ZGJA 4PZJA 4P96A 1LQ1A 1K6OA 5ICFA 4U88A 1XB4A 3T1BA 3ZP5A 1FX7A 1PDNC 3HIFA 2CYYA 1REPC 2ZNYA 3ISPA 3B02A 4ZH4F 3FMRA 4LGWA 1ZLJA 5HS7A 5DD8A 2EA2A 3C1DA 4IF4A 1PP7U 1KQ8A 3Q9VA 2VC0A 3HRSA 1R22A 2A07F 2H27A 1JXSA 3SZPA 3GYHX 5FD5A 5L3FA 3R61A 3GFJA 3EUHA 3BY6A 2Q0OA 1QBJA 2H94A 1XGSA 4NQWA 3IRQA 3ZN1A 5F64A 2QLZA 4L5IA 4A0ZA 4EMSA 3ABTA 1ZLKA 2PG4A 1WWXA 1Z6RA 1G6NA 3W6KB 5L3CA 2COMA 2OU2A 3PQJA 3F6OA 3O6BB 3WGIA 2W57A 1J7KA 1XD7A 3IWZA 5CJ9A 4XSXF 2E1NA 2MBFA 4YFKF 3FX3A 2ESNA 4U0VA 4EV0A 1EH7A 4TV7A 4U7BA 4WXCA 1HBXG 4EJWA 2HFHA 2IA2A 3RIRA 1TQPA 3WTXC 5HLIA 2XHKA 3IKTA 1SFXA 3N4MA 5E18F 1OPCA 2XROA 4N9IA 1YQAA 3ZMSA 2IPQX 4EM1A 3RI4A 3RYRA 1Z1DA 2FBKA 2Y0MA 2VONA 5AIPA 2LNBA 1T6SA 2OBPA 3DF8A 3FM5A 1HQCA 3F8CA 1U6GA 4EGYA 4IXAA 2FMLA 4I0AA 3WTYC 2XV4S 1T0FA 2ZJ2A 1JGSA 3M7GA 4EJTA 3K1NA 3GVAA 3SHFA 1IAWA 2VC1A 2QQBA 2P4WA 2V1DA 4S04A 1AOYA 4CXFA 3SZTA 2IW5A 3F8BA 1YS6A
chains in the Genus database with same CATH superfamily
4E6KG 4M9XA 2EFQA 2VQCA 3HC7A 4CCKA 3Q3SA 2IS4A 2M7BA 1XGMA 3WGHA 2VBXA 4M3EA 2JA7J 3WTVC 2EILH 2LDUA 1K78A 2W82A 3CC4I 4WCGA 1HDDC 1KGSA 3BQYA 4ASNA 3HOTA 1SEUA 3QPTA 4OIRF 2WAQA 4RB2C 5HLHA 4I02A 1WJDA 1XC5A 1PYVA 3C2GA 3V8JA 1OJLA 2Q2EA 3HSEA 1BN5A 4XLCA 3BG6A 3RPUD 1BI3A 3LSJA 2O7OA 5E1ZB 1MBKA 4HX8A 1WVRA 4WK8F 5TRDA 2CWEA 4IVNA 2BYVE 1Y0UA 4OIQF 4F92B 4A3KJ 3OS1A 1XDUA 1APLC 1GXPA 2Q2EB 5F0CA 3M4OJ 4IRGA 1NTCA 3RKQA 1XSVA 1DP7P 2Y0SN 4P9UA 5J4YA 5BMZA 3GLXA 1RRJA 4A3GJ 1MIJA 2YX7A 1U9OA 2W1OA 2KIUA 4BQAA 2VT3A 1X2MA 3TQNA 1MBJA 3GTQJ 2ZSHB 1JGGA 2LKSA 1VQPI 4ENNA 4A6DA 5EEGA 2PFBA 1J09A 1VFCA 1IN8A 4BL0B 3ERMA 2ME6A 1ETKA 3Q9SA 1FOWA 1A04A 2K9MA 4KMUX 1IV6A 4KIFA 3OYIA 3WU1B 4Z6YA 3FWEA 1DU0A 1H8AC 1D0XA 1P7JA 2PQ8A 2L54A 3F8NA 3ZGKA 4XKVA 2QM3A 5TJJA 5HDGA 3E6BA 4CH7A 4BXFA 4I2OA 3BR1A 1Y1WJ 1BJZA 3MVPA 2DFEA 5B1AH 4M9ZA 3H9QA 1QPIA 5KVRA 3E6CC 1ZG1A 4B43A 3L2CA 3PFYA 2QKMB 3PL8A 1ZGWA 5F04A 2P81A 2NVUB 5DM6F 1FJLA 1OCCH 5DCMA 1N77A 1KQ9A 5EZHA 3NWSA 1C0WA 4IQ4A 5E8IA 4MIMA 1GHCA 2G7HA 3K7AJ 3H92A 4XOTA 3SFIA 3VYSB 5EG0A 2M1BA 1OISA 3BTIA 1IXCA 1KU9A 2PLYA 3G4SI 1DPRA 1ZR4A 3KEOA 1S6LA 3GF2A 2GXAA 1A5JA 1SD5A 1MMNA 2CV2A 5EG0B 4ETSA 1X1BA 3DXJF 2A61A 5F1JA 3HSRA 3NRVA 1W1WE 1MW7A 3H3UA 1WGXA 3L00A 1SD6A 2EWNA 1X3WB 1HCRA 1A6QA 4N4OB 2E2JJ 2I5UA 3W6JB 2K86A 3HHHA 4FQGA 3ZCOA 4UV9A 4BKXA 3DWLE 3A0HC 5M5XJ 4OINF 1MMDA 3ZXSA 4ZZDA 5D5XB 4DW6A 3FMQA 1FOYA 1QZEA 2VI6A 3OOUA 4OOIA 1PVEA 5F0FA 3TO6A 3LNQA 1OR7C 3EDPA 1YOVB 1J5YA 1HOMA 4CICA 2J5PA 2K5CA 3GZNB 2VOPA 4YFXF 1XPXA 3DLAA 3ZMVA 1AU7A 2WBMA 3DKXA 2JVHA 2DOFA 2TDXA 4ZYEA 3BPVA 3QYFA 4DGWB 3F8MA 5LBQA 2KISA 1JUMA 5EJCA 1BBYA 3MZYA 3CLOA 2DW4A 3GZ6A 3ROUA 3RSNA 2NS8A 3G73A 3X2QH 4G8XA 1IN6A 3MWMA 2BY1A 3C2BA 4MNUA 3A1YA 3ZQIA 4A3FJ 1QVTA 1XMKA 1KZHA 5DS9A 3GTMJ 3MCZA 2KDOA 1WJFA 4EEFG 1D1CA 1ZK8A 1R49A 2VOOA 4A2UA 1YX5A 4YIIA 3HHGA 4B48A 2V1NA 3F8FA 4M72A 1EA3A 2FOKA 4XNFA 1IDZA 4DYQA 2JA5J 2HTSA 3FK6A 2HYJA 4ITVA 3Q0VA 4BNCA 2NVYJ 2CQNA 3HYIA 4I7HA 4I09A 1XCBA 1G3TA 5LLQA 5LFAA 3B6AA 1PP8F 3TBIA 2V7FA 1WRJA 2EIMH 2MFZA 3JRIA 2JK3A 2QQAA 4A0XA 4F3QA 4OIPF 1VNDA 4ESJA 2XKPA 4YG2F 2Y30A 2GIVA 2PJRA 2F2EA 2Y48A 1T98A 4X0GA 1MZBA 1TTYA 4PFOA 2CG4A 3EQLF 5CVUA 2MC3A 3ABUA 4D9JA 3AG1H 1JKQC 3KCCA 4LG3A 4NC6A 2GOXB 2LSOA 3JAMZ 1MBFA 4HF0A 2OAZA 2A6TA 3OYAA 2RNJA 1MGTA 2D1HA 3MEXA 3QU6A 4X6AJ 2QKLB 4CDGA 3JRFA 3CCVI 3QYEA 2F5FA 4MO7A 3K6GA 2KPMA 2ZNZA 4I01A 1SD4A 3C18A 1G3SA 5B1BH 3I4NJ 3K0LA 2GM4A 1VQ5I 2R93J 2DT7B 1H89C 4AIHA 1UG2A 4BQOA 1ZELA 3LL7A 2MW8A 3DKWA 3DU5A 4CO8A 1HKTA 4N4NB 4L18B 1RNLA 4QSHA 2KMUA 2Z99A 2F48A 2FA5A 3V8KA 1YLFA 2RV8A 2E2IJ 1WQ2A 1HKSA 2HI3A 5ILUA 1O3TA 3D5SC 2QBYA 1K79A 1U8RA 1PUFA 3KP2A 2A68F 5C3EJ 4FT8A 4XK4A 2VKVA 3LQQA 1R1VA 1IXSB 4B4CA 1LUJB 3QOPA 1ZGAA 1WH7A 3FXKA 4E4HA 5CVJA 2FJ1A 2B9SA 1FOXA 2QBYB 2DFHA 2KRCA 3K10A 1R5GA 1ZN2A 1PUFB 2DBBA 1O57A 3K70C 1U78A 4Y33A 4S05A 3G1OA 3JRHA 1RR7A 2FUG2 3E5UA 5HS9A 2GOMA 3PIOF 1IXRC 2OC6A 2H8WA 3CCQI 2LD5A 2ZC2A 1WHUA 3A4CA 3LOCA 3L2VA 2X4HA 5EEAA 3KX2A 2QZ8A 2YS9A 3K4MA 4EM2A 2EV6A 3AFHA 2NOJB 5D5UB 2AXLA 2XUBA 1BI0A 2CUZA 1JTXA 1YW8A 2BGCA 4Q48A 3FXJA 4M6YA 4LMYA 2YU9J 4J19A 2V9KA 1P4XA 4RGRA 3H3ZA 2M4GA 2V9PA 1MKMA 2VE8A 1V5GA 5HNFA 5E79C 4NC7A 5D6FA 2FX0A 4I98B 3DPTA 4PJ0C 1A31A 3OOPA 3JSOA 4IQJA 3IH2A 3MFKA 3FHNA 3QODA 1G59A 3JSPA 1UZCA 2BZTA 3L2QA 5IYCJ 2CQKA 3IH4A 4ZDLA 4XRSA 3KPHA 1TQIA 1JKPC 3CUQC 4RAGA 4HYEA 3M8EA 2H6BA 2DFIA 1V3FA 1AKHB 1P7IA 2O0YA 3FXQA 2DMTA 4A3JJ 2DA7A 2Y75A 2FF4A 5E17F 5LEKA 3CP8A 2XF7A 1IN7A 1FBQA 3JAMK 4YELA 5D8KB 3AG4H 3D5LA 2XGCA 3CZ6A 1FLIA 2VKHA 2ZFUA 5K5RA 1FYLA 3IL2A 4HZFA 5FRMA 5DUKA 2WADA 4AVZA 4XLEA 1S7AA 3P5JA 3I59A 4AWXB 2OF7A 1IRFA 2FRHA 4GCVA 3T5XA 2D45A 2BXYA 2DA1A 1GLNA 3H9JA 1LEBA 3CMEI 2K02A 3IKVA 4OAYA 2ZJPF 2E7WA 1ETVA 1F36A 2X6XA 1GVDA 2OUMA 2RC4A 4V2FA 4OIOF 2CQ7A 2M3AA 3HOZJ 3HJEA 1UMQA 2DYRH 1X3UA 3WODF 1W36C 3L7WA 5IOZA 3FMSA 3KYDB 3PFIA 2DT5A 3TO7A 1JUPA 1U3EM 4GDFA 1T38A 2IGOA 1OCZH 1FC3A 5H2FC 3WTUC 4NB5A 2ISZA 3P9IA 1YW9A 1O7FA 1W5TA 5BOXA 3CP2A 1OR7A 3HKZA 3ASNH 4G6DA 1G4DA 3C3WA 5J40A 3CDIA 1MMSA 2X6OA 5K7ZA 4AIJA 4RM3A 3GFMA 3PNVA 1ZKGA 2EZKA 1G2HA 3GTJJ 2AQFA 5FJ8J 2BE5F 3OL4A 1P4AA 2CUFA 2LBFA 2XB0X 3K1PA 4WX9A 3ECHA 1I1GA 3RYPA 2RKHA 1X4OA 3CCUI 2Z9OA 2OTJI 3A0BC 5ICGA 4WF2A 3ASOH 3G1MA 1FBSA 1QHGA 3G2BA 2IS1A 3U1KA 1NH3A 2Z1DA 1BA5A 1OQYA 3DTEA 3OIOA 1CGPA 2Z5UA 2ZBKA 5IP6A 3VEPA 3CCYA 4B44A 2LBFB 4A93J 2IS6A 3IP4B 1TP4A 3S1RJ 4H4KC 4E70A 2HYFA 2BW3A 4NHJA 2JA8J 1QA6A 4YEJA 4G6TB 5F0HA 4LITA 3FK7A 4HW0A 4IHXA 1BR4A 3J7YJ 2LK2A 2UWMA 3L2RA 3K4NA 3VWBA 4D5CA 2WB1A 2VBWA 5LRSA 1ZH5A 1WSUA 2BW3B 4KNYA 3JRBA 3S3OA 1LFBA 4KA4A 4HEA2 4CYDA 4PGGA 1EF4A 2ZKZA 2L7MP 3CMMA 5E1XA 2O6GE 1ODDA 3DFGA 4L5JA 3SDGA 3ZN0A 3W2AA 5KK1A 1ITYA 3BPXA 4M6XA 1EH6A 1Z3XA 2XASA 1X1PA 3FXOA 3CD6I 1YO5C 1Z67A 2HDDA 3BJAA 3LA3A 2AQEA 2QWWA 2FD5A 2WAQN 1M1EB 2DTZA 2EPFA 4ESBA 1HKQA 4E7ZA 1K4TA 2NYXA 2D5VA 1GV2A 1ZG5A 2DCEA 1FIPA 2ESHA 2ZO4A 4YIRX 1AA7A 4XSZF 3KYCB 4IEJA 1E3HA 2JPBA 4RBOA 4PCQA 2DOAA 1B1BA 4DZPA 2VIXA 3I53A 4XLAA 3ESWB 1B6AA 3OIPA 3I4PA 2D1VA 5JR3A 2VKDA 3Q5FA 3TW6A 1SANA 3VODA 2DT6A 4RDUA 2R7XA 3BP8A 4HOBA 4FTHA 1MMAA 2R7TA 1Y56A 1BOAA 3UNGC 4IPAA 4HQEA 2O61A 3BR6A 1I3QJ 3HRTA 2M30A 3QQAA 1D8JA 4Y7NJ 4XL9A 4HSRA 3CMAI 3VYUB 2I8DA 2R7FA 1W5CC 1SAXA 4FASD 5FGMA 4BEHA 4BHBA 4GGGA 3H5RA 2RDPA 4PFPA 4AU7A 4N0BA 2DA6A 1PJRA 4ZC3A 4Y4RA 4BEHB 3RTRA 1SC7A 4BHPA 4HNVA 2CW8A 3OYLA 5F1RA 4RS8A 1RR8C 3HBLA 4I6ZA 3LSHA 3JTHA 1QO0D 1WCMJ 3BLYA 4CCJA 3LAJA 3WHCA 4M6VA 1UG0A 2PMZA 2W00A 4BGDA 3EETA 1H0MA 2HOSA 2HTJA 4MFEA 5IY5H 4R8HA 2OZ6A 4ENMA 2VODA 3NQOA 2IT0A 1Z3YA 2W84A 2XGXA 4L9JA 3LSTA 3OWTA 3RZOJ 4D1QA 4G12A 2IAIA 5C4JJ 1RI7A 3OS2A 5DUIA 3L1PA 2FMYA 2B0LA 3E6MA 2KJCA 2WV1A 1B9NA 2JUCA 5LHHA 5ERIA 1TQMA 2F5CA 2HEOA 3CC2I 4A0YA 3SJMA 3F21A 1VQ7I 4A3LJ 4LLNA 2ZXIA 2WY7Q 2CH0A 3GUDA 5FROA 3R60A 5LD2C 1FMVA 4L5EA 1LNWA 3VB2A 1DGRM 1UCRA 1O4XA 3HDDA 1YG2A 1JKRC 4YFNF 5D5VB 3W3CA 1ON2A 4E7HA 2QSGX 2ETHA 1Z0XA 3DBHB 4LK0F 1TWCJ 4PDKA 4A6EA 4MEXF 3S14J 2L3DA 3CUQA 3MD2A 3TMOA 5DV5A 1D1AA 2Z2SB 2DAOA 2GQQA 1B72A 2LH9A 5GPAA 3M1CA 4J01A 2KRFA 1USSA 1JE8A 1I39A 3HRUA 5GTIC 1VQ6I 1BIAA 1VQKI 1YJNI 1N78A 1WZ2A 3CUQB 4LB6B 4KN4X 4ZTJA 1LEAA 4EQQA 2F5VA 3PO2J 4AIDA 3I56I 4DZJA 2KLOA 3ZQHA 2Y2ZA 2K9NA 3J80Z 3RKXA 1HC8A 4BE1A 3K4KA 2LTPA 2QF7A 1KYZA 3I54A 3LSGA 4FE7A 2KFDA 4UXNA 1YW7A 2LFBA 2VE9A 3CF2A 5FFZA 3AKZA 2JA6J 3K9TA 3CJTB 5FO5A 5ICCA 1YE9A 4BJTA 2GXBA 4HV6A 2K85A 4Q47A 3BTCA 4J00A 3JW4A 1I3AA 2E1OA 1G3WA 1GVJA 4CCMA 1XGOA 3MQ0A 2XF6A 3BQZA 1SFUA 4HNUA 3ZMDA 4HDUA 2EZIA 4RA2A 4IX7A 4G9YA 4OMYA 1XG1A 3G6EI 2XRNA 4QLCU 3NAUA 1FBUA 1T33A 2MD5A 3IAM2 3TDUC 1B9MA 2HZDA 2EIKH 5EYRA 3BR0A 1MNEA 3HOSA 2QQ9A 2O03A 5LGTA 1RPWA 1U0JA 2MC4A 3GZ5A 3P9KA 3D5RC 4LJZF 4WXHA 1J59A 4IOCF 4BDZA 2LF8A 5HLGA 1VF9A 4XLHA 5IOYA 4BY7J 2XSDC 3W2WA 1AHDP 3WE3A 2A69F 1Z9CA 3NARA 5DCFA 1UELB 3I5UA 1OYWA 3BCBA 2BVLA 4AM3A 4DIQA 2K4BA 1IRGA 3HTSB 2IGKA 2M8EA 1QPMA 2LKPA 4E7JA 3DEEA 1D5VA 2DO7A 2IA1A 3QRFF 3R0AA 3P9CA 4Q4ZF 5ED4A 4ZZLA 1CQTA 2HOAA 4XIDA 2DJNA 4EGZA 2A3SA 5KAFC 4ENKA 1Y0NA 4A12A 3WG9A 1T8IA 4EJVA 1JT6A 1SVOA 3CMYA 4BE0A 2XPVA 2BXZA 4KUMA 3FDYA 2H6CA 3B73A 4D7MA 2JN6A 4JK1X 4UVAA 2KZGA 2OA4A 2H1KA 2LRDA 3GFLA 2XAGA 3OYCA 1MMGA 2R0QC 3FXUA 4BY1J 1U9NA 1IV8A 4HAMA 3J80K 5BPDA 5J8FA 4ENJA 1KYWA 2R7ZJ 2TCTA 2XKOA 4XN0A 4UUSA 1HA8A 3HB9A 2DPDA 2IRFG 3ZMTA 4GYIA 3J7ZI 5L3EA 3PM1A 1ZHFA 4M9SA 4X1EA 3CCMI 2EIJH 3G3ZA 5FKMA 2DPUA 3HOYJ 2GA1A 3QPLA 1TC3C 2EFWA 2DODA 1DQUA 2IP2A 5J8CA 4UUSB 2F5EA 4KISA 2EH3A 1ZRDA 2VBYA 2NOGA 1FWZA 5AONA 4L0YB 2JWTA 3HG9A 4G7OF 1R4MB 3HUGA 2KZVA 2IBDA 4QPQA 3JRAA 2HVSA 2R4GA 4EM0B 1P92A 4C2TA 3G1LA 5B66C 2M45A 2M7AA 1R1UA 2CV1A 2VPRA 3IUOA 3HUGB 2VJ4A 2X6WA 3I4MJ 1TWAJ 4BQQA 3E6DA 1U5TC 4LOCA 4KT5C 4BBSJ 4PJLA 2FXAA 1LVAA 4IHVA 2XF5A 1ZAOA 1JJ8C 2L4AA 1S5LC 1NHAA 2L01A 3BDDA 3BTLA 2PJPA 2R3SA 2FSWA 1MDMB 2JMWA 4P1WA 4JBAA 2KJBA 2R5ZA 1XN7A 4L9NA 2GAUA 2OQGA 4UVCA 4CCNA 1VQNI 2PI0A 2CUEA 4AVPA 2V6EA 5HLTA 1YI2I 2CU7A 1SFEA 4C3JJ 2V6CA 3P7NA 4HX7A 1MJBA 2JTVA 3OIQA 4RGUA 2R5ZB 3E5QA 3EYIA 1FSHA 1R36A 4ZYAA 2DQLA 3LFKA 2L4MA 3IHUA 2VLAA 1TNSA 2WAEA 4XLNF 1HDPA 4B3AA 2DXIA 3HPHA 1FP1D 3PNYA 2LR8A 5FB2A 2E5NA 2W24A 1S7EA 5EZGA 2IGMA 4FE4A 4BDYA 3QPHA 5E3LA 1LE8A 1IG7A 1UHWA 5CLSA 5EEHA 2VKEA 4ZYGA 1UJ8A 2JZYA 3FXMA 1E0EA 1ON1A 2GZWA 4HLXA 4Y52J 3ZQGA 1R1TA 1W7PA 2W85A 2YPRA 3VYRB 4FX4A 2LC2A 4A3DJ 3DQVC 1J0RA 3LWFA 5JI6A 1LE8B 3L09A 3SEQA 1D0ZA 3E5XA 4V19K 4AIKA 1MSFC 1HSJA 2E2HJ 4KJZA 3TKYA 1W7PB 1L0OC 1RKTA 3ZRGA 5IPAA 1ZRFA 5FLXZ 4ABZA 3WG7H 4RLFA 1I5ZA 1XTAA 2XPUA 4II2A 4M73A 3IC7A 1VI0A 4LIVA 2W7NA 3A02A 1Z6TA 4GXOA 5E20A 1IRZA 2F6CA 3KIOA 5HDNA 3WGGA 1SVLA 4XQFA 2E1CA 3HKZN 3TDZC 3O3KA 2K7LA 2WC2A 5FD6A 2ZCWA 3LA2A 2STWA 3OYFA 2CW0F 3SXYA 2DFFA 2R7RA 2XGDA 2EA4A 3I55I 4G7HF 3RZDJ 2B63J 1WKMA 3CF5F 3A01A 5GAEJ 1H9TA 2LLKA 4P55A 1I27A 1ZQ3P 1ZTRA 2UXXA 5D5WB 1ETYA 3OYEA 3EUHC 2IGNA 2UZKA 4XRFA 2JJ7A 1WI3A 1OYIA 1QGPA 2QVOA 3A01B 3MKYB 3D0SA 5CKTA 2MLKA 1XDSA 3PSFA 1I6XA 4KIBA 2PN6A 2MABA 2MG4A 5DD4A 3VPRA 3IAS2 3JTGA 2A6EF 2Y9YA 3DTIA 3GXOA 3BR3A 5CVIA 3GTPJ 5JHFA 5IT9Z 2ZXJA 4BAYA 1CF7A 4RAFA 4RMNA 5KHDA 3H35A 2DU9A 3MN2A 1QZYA 1LDKB 1RZ4A 2WB1N 3F3XA 5C4XJ 4JOMA 5HNHA 4HF1A 3BZ6A 1JUSA 5J1YA 5C44J 1OYYA 2ISYA 1BR1A 2A05A 3F9KA 1CF7B 5K5OA 1RUOA 5H6RA 2P5LC 2Q8KA 5A2QZ 1U2WA 1JKOC 3WTTC 4NC8A 5H6QA 1F5TA 2F5DA 2VUMJ 5JFRA 1NK3P 4KMFA 2KIMA 1F1ZA 1R7JA 5HDKA 3SDBA 5M3MJ 5L3GA 3H0GJ 3HL2A 1S7OA 3BOQA 2VJJA 2E71A 3S3NA 2P7VB 3DU6A 3J7AY 2BVMA 2CW7A 2K9QA 4IRHA 2A5YB 2HWVA 3BCAA 3L2WA 1Y6IA 4Q5SF 1VQ9I 2HOEA 1MBHA 5B3SH 1AKHA 5F6FA 2JSPA 4DBQA 1H9GA 2XSJC 4M3FA 4C3HJ 4MLOA 2I10A 2MLGA 3E1SA 5FLXK 3HRMA 1QQIA 2D2WA 2F4MB 1T95A 1USTA 2EV0A 4CA0A 4IHSA 2MA3A 1RUNA 1LVKA 1ZARA 4HA8A 2MH9A 3TGNA 3GCMA 4O5VA 1TT0A 2F4IA 5EDNA 3HPGA 2DA3A 1HW1A 5DYMA 2STTA 1X1AA 2L7FP 1TW3A 4ESFA 4BACA 1VQMI 1ZRCA 3ERED 3LAPA 2XDVA 1S3JA 4O6JA 3S1QJ 2OCCH 2RVCA 1X2NA 1FOKA 5BS6A 1OKRA 3BG7A 3BJ6A 2IVMA 4KFCA 1ZR2A 4NBQA 1T0FC 3O8GA 2FEZA 3I9V2 4KT6A 3K2ZA 1YTYA 5J6XA 2PMZN 2QGUA 4E7LA 4IKFA 1QZZA 1V4RA 1DDNA 5ICEA 2OJED 4AD9A 1D8KA 4UUVA 5ILSA 3HOWJ 3BZKA 4PJNA 3W6VA 2W4SA 1X4PA 3ABMH 1ETWA 1FT9A 3AAFA 4BJ6C 3SQNA 2L9VA 1RKWA 3FBNB 3OS0A 5IT9K 4L9VA 2WWYA 5GADJ 2Q1ZB 1RIOH 2VQHA 4LD5A 3S3MA 3FKIJ 5CVRA 2DJIA 3HM5A 1U5TB 1TT5B 4M3BA 3VSLA 3QPSA 1Y8QB 2ADUA 4CSWA 3O2PE 2HR3A 1D5YA 5D6EA 3TO9A 4BU2A 2OD5A 5J1UA 5A2QK 1PUEE 3COAC 2O8KA 2CRGA 2WTEA 3K69A 1MJAA 2R92J 2BY0A 2BV6A 4EVIA 2K27A 1SMTA 5KNLA 4Y3OA 4L0ZB 2Z3YA 3UR3C 1BW6A 4PGHA 4JQFA 1XS9A 1KA8A 1HW5A 2DYSH 3HEFA 1IC8A 3J7AO 3GO5A 4C2MJ 3RDIA 3LSKA 3TP3A 5BQTA 1EKEA 1BI1A 5K1YA 2QCOA 3ECOA 5IYBJ 1TLHB 2HGCA 2BHZA 4P5OA 5DM7F 2KKOA 5J47A 2V9VA 3GX4X 2AO9A 4MHGA 4H0EA 1R71A 3KZZA 4CYCA 5J3LA 3DBLB 4XONA 3K4LA 4ZDOA 3MKZA 4D5FA 1GDTA 1QNTA 4FETA 2RQPA 4XR6A 2VJIA 2GXGA 3OR2C 2FOWA 1EH8A 2JRMA 2VQGA 3E97A 2QYOA 4CYCB 1UB9A 4CGZA 3I71A 3V7RA 3WU2C 4PSXA 5J1RA 1S72I 2WY8Q 4XLPF 2V1XA 3SFZA 4NDLA 1ORKA 3O8HA 3GTGJ 4QTRA 2M87A 1ONVA 3BG5A 3VOEA 1EV7A 3NEUA 2XAQA 2FBHA 2EV5A 1IN5A 1MJ9A 2G7UA 3CESA 2DDAA 4RLQA 1Z05A 2X1CA 3EUAA 4HV5A 3V8LA 5J4VA 3JRCA 5KAIC 3F22A 2ELKA 4BS9A 3R0JA 4WWCA 4LLGF 4ANJA 4G7ZF 4V2GA 2HS5A 4UB8C 1G3YA 1QVUA 5D4SA 2VPLA 1FY7A 3OSFA 1J75A 1P6RA 1YJWI 2ID3A 5LGNA 2VXZA 5FLMJ 2E7XA 4Y17A 2W48A 1I1SA 3TOBA 3H5NA 3HXLA 4DQ2A 2HXOA 3PSIA 2QQ8A 2PEXA 2Y9ZA 5HODA 3ULQB 1QU3A 4A5MA 3BTJA 3K4BA 4KYWA 3FZVA 2NNNA 5LHGA 2KIQA 4MEYF 1XX5A 2HQNA 3I58A 4HDVA 6PAXA 4WXDA 4C2UA 1Z77A 1T56A 2F4OB 1GT0C 2XB5A 2M2EA 1R23A 2JQ7A 4L9TA 3KZYA 5CQEA 1WJAA 3HZJA 2MGQA 2HDCA 4RGSA 1WI9A 4RAYA 3E0JB 3V7SA 2K3PA 3PQKA 3KEYA 3DP7A 2L5QA 2P8TA 2E5ZA 2O3FA 1N75A 2L9SA 1A36A 1IF1A 1XSDA 3CJQB 3K2AA 4FHTA 2ELHA 4MQ9F 4JX5A 3BG3A 2RAEA 2DDBA 5LRRA 2LY1A 3RJPA 2LY9A 2M9HA 4F7ZA 4U7DA 1TW2A 3F23A 2O9LA 1W4MA 4XICA 4CZCA 3QOEA 4HPQA 2W25A 3MKLA 3M9AA 1F9NA 1YX3A 2ZB9A 5ILVA 3EPZA 1LJ9A 1P4WA 2DTRA 4YIFA 2HQAA 3F0CA 3GMEA 2ZMEC 2C6YA 2RNGA 1N25A 2LVSA 2M34A 1YRNA 4G6QA 1XMAA 1MNDA 4CHUA 3M8JA 5L3DA 1SVMA 2BBYA 2P6SA 4AYBA 1O3RA 2XIGA 2JUGA 3DEUA 1UHMA 3ABKH 4G94A 1OCTC 2CJJA 2E19A 2R7OA 1YRNB 4A5NA 3A2KA 1X58A 2M0CA 3CO7C 5GPCA 2YX4A 4Z2YA 1YIOA 4UUTA 2L0KA 2XGEA 1GXQA 3JRDA 1WJCA 1Z91A 1DU6A 1J9IA 3WTWC 1IN4A 2R7WA 4HX4A 4OAZA 1L3LA 2WV0A 2Z33A 2MH2A 2O8XA 1TBXA 3LSMA 2X0LA 3I3LA 1X3ZB 2EB7A 3Q0UA 4IJAA 4B3XA 2P6TA 3HGYA 1ACIA 4IHTA 1FTZA 2FU4A 1RC9A 2K40A 3S1NJ 1YHQI 5EGOA 3DCFA 3HOXJ 4UNOA 2KDZA 3CO6C 2A5WA 2DA2A 5D4RA 2VL8A 2HPMA 4OMZA 2VB6A 5F08A 5CYVA 3J81Z 2H09A 5BNGA 5EGOB 3GFIA 1VTNC 2XPWA 3ONQA 1W5SA 4HG2A 3SEZA 3QAHA 2PMHA 2G0EA 2KIFA 1NG7A 4CZZA 4RB0A 3FXRA 2E36A 3WE2A 3IWFA 1E17A 4FX0A 1K78B 2RQQA 3HTUA 4CCOA 3BR2A 1K4SA 4QWQA 3L9FA 3ZMZA 2DMNA 2VXDA 2EFOA 3DKYA 1VQLI 3K4JA 1DP3A 1R4NB 2EFPA 1FP2A 3U21A 2YSRA 1D1BA 2X51A 1V55H 1H88C 3WHBA 2IXSA 2OQRA 1YJ9I 2P5KA 4BJ5C 2RGVA 1FEXA 3LQRA 4HF2A 2WA0A 1R9TJ 3GEZA 3SZGA 1IUFA 1ETQA 3ELKA 1GUUA 2PX9A 2FQ4A 5JLXA 2JSCA 4B09A 3AL0C 1FNNA 1FPQA 3H36A 3KYLA 4ZYDA 1ZREA 2KQRA 2OV7A 1Z21A 3V4GA 3JCUC 2B7EA 4KDPA 1A35A 3FBIB 4U0YA 2XAFA 4HNTA 5JLWA 1XSXA 2DLLA 3DTKA 2NAZA 1QRYA 2GWRA 4IL6C 3PO3J 2YR2A 5HS8A 3JR9A 1KU3A 5E8GA 4LB5A 2DI3A 2EJRA 2Z16A 1U8BA 2HZTA 2LREA 4D7NA 3ZQ7A 1P9QC 2YU3A 3DBRB 3KP5A 2M0MA 2R7DA 3N05A 2QA4I 4ON0A 4R1HA 1OCOH 2DK8A 3TOAA 4LK1F 2XVCA 3CC7I 1GV5A 1E2XA 4MTEA 1BM9A 1SFOJ 2COBA 4UHTA 4M3DA 1RETA 3F72A 2L02A 1I50J 2ME0A 3ZPLA 4QIWN 3HSFA 2CGPA 2EFNA 1IZ1A 3QP6A 3ZOBA 1ETOA 5K5QA 4C9YA 2G9WA 1OCPA 3ZQQA 3OY9A 5CVVA 2NNYA 3CQZJ 4AC0A 3RPQA 4OU0A 4FISA 4EATA 2V79A 2IS2A 1O3SA 4JX4A 4IRIA 3GBGA 4Y15A 2CFOA 3S15J 2H1LA 3BWGA 4CUGA 3REOA 2E35A 4A3IJ 2HQ5A 4RGXA 3VSKA 3KFWX 1MDMA 2IA0A 1R58A 3QYBA 3J81K 3K70D 4Y13A 1P2FA 5DCMB 4GO1A 4DJAA 1R00A 4LFUA 3ZQCA 2HVRA 1STZA 1WPKA 1E3PA 3V42A 5CQGA 3IRRA 2R7UA 4DOZA 3F6VA 4E7SA 2JPCA 5M5WJ 1LDJA 3WTZA 1YFHA 3KLNA 2QSHX 3E3VA 1T2KA 4UVBA 4O3MA 1YS7A 1BI2A 2HQRA 3CCEI 2IJLA 5EF6A 3OL3A 3C2HA 1JT0A 1ENHA 2OTLI 5JHUA 4ZTFA 2ZJRF 1OCRH 1LPQA 4GRIA 2MD0A 2VBZA 4GYGA 3CDLA 2DK5A 1EJ9A 1YYVA 1MSEC 1D3YA 2HVQA 4PK4A 5DEQA 1SMYF 1B59A 2NS7A 3C7JA 5FKLA 5DDGA 1LFUP 5K7FA 1KONA 2JRTA 2KP6A 1O7LA 1X1CA 1KQ0A 4LLLA 3OYJA 3UKGA 1K61A 5GAHJ 1TWHJ 1NK2P 2M8GX 4A69C 2DQRA 3WTSC 4NNJA 1T39A 4PSWA 2L2OA 1W0TA 1ERDA 1R5HA 3FM3A 4KN7X 2ZMEA 3T8TA 3DPUA 4MTDA 1FYMA 2DMPA 4HLYA 2BHYA 2CSOA 2TRTA 3KE2A 3BG9A 5AIQA 1SD7A 1FYKA 3ML6A 3EYYA 1HXDA 2UXNA 3OMYA 5L3BA 4MGRA 3KLOA 2HPIA 2ZMEB 2FQ3A 4JX6A 4A3BJ 3S8PA 2LP0A 5FFXA 3S2WA 3EUKL 2LYCA 3GLLA 3GW2A 4ZYHA 4PJJA 1W0UA 2X1DA 1V5FA 5E3MA 5JVGF 2Y0SA 1WJEA 4BYYA 3M8FA 3BROA 1Y1VJ 5H20A 4DYCA 1W36D 3I64A 3E7LA 2L7KA 3RKYA 2QENA 4UY8I 2VT2A 4W1UA 2K9SA 4HBLA 3QP5A 4B8XA 1BW5A 3U9GA 3VDXA 3S1MJ 1ZG3A 2PMUA 1Y39A 4NUBA 3B6CA 3PUFA 3OV8A 1HW2A 1XCVA 1MBGA 1AWCA 2JT1A 1KU2A 2A6HF 3MZ8A 3MAJA 3PUBA 2Y69H 3MZHA 3H0DA 3IH3A 4M71A 5JVTA 3RKWA 4KIGA 3CCRI 2P5VA 3LSIA 1VQ4I 2ZXWH 5IT3A 2K3FA 4XRSG 5IP9J 1UHSA 5E1WA 4IO9F 4CCLA 2R5YA 1OFCX 1HLVA 4JP0A 3T8RA 2ZJQF 3VFZA 3CCSI 2PJRB 1JHFA 4PUSA 1XGNA 2GIZA 4XLFA 1B4AA 1BJAA 2XAJA 3M1EA 2UUZA 4A3CJ 2K4JA 1BIBA 2UV1A 3CDHA 5FKNA 4K2EA 1I6HJ 2R5YB 2MSYA 2ZSIB 3LA7A 2IEKA 1JHHA 4E7IA 3W2VA 4F91B 4A3MJ 2ZXHA 3KP7A 1X1DA 2E1MC 2LKXA 2L7ZA 2YUSA 2HNHA 2BEOA 4XM3A 1XMXA 3FXLA 1UFMA 1Z7UA 3KP3A 2CUJA 4M74A 3GTKJ 1OLTA 1F43A 3CLQA 3DV8A 3QU3A 3U2RA 1O3QA 2AXTC 3PNTA 5FRNA 4RB3C 2NXNB 4BE2A 3KZIC 4RAZA 2HKOA 2VJ5A 2HDWA 5LEJA 4B47A 1S29A 1D0YA 1OMIA 2QUFA 2ACJA 2CQQA 2FE3A 4XMYA 3DPLC 2R7QA 1FZPB 5D8LB 1FSEA 4DNCA 1F4KA 1LDDA 2RN7A 2BOLA 5FKOA 1ZYRF 3V7CA 4B1RA 2X6YA 5GP9A 4I76A 2V1UA 3RCOA 3AL0B 4XN3A 1RESA 2EZLA 2OZUA 2VN2A 1SFKA 4XRMA 1DUXC 4HRIA 1R6RA 5M5YJ 4F52A 3M3YJ 1ETXA 5HOOA 2P0WA 1BC7C 3ZQLA 2DA5A 1WFXA 3OYNA 1HF0A 3VYTB 3ZMUA 2XRLA 3BJOA 3DEWA 3TW7A 3MMYB 2GA2A 4YRVA 2NVQJ 4KITB 4HQMA 4UV8A 1JJ6C 3R6SA 3BZCA 3LFUA 3OYDA 3HOVJ 4XKWA 1YIJI 5K7HA 2KRHA 4P9FA 4LG0A 4EJUA 4I0BA 4BH9A 3CTAA 3KP4A 4I99C 3N97A 2CQXA 2ID6A 2NVXJ 4BXUA 2NS0A 1K6YA 2FNPA 2LF7A 3AG3H 4F93B 2HXIA 3WU0A 4EJOA 5BPIA 3KEQA 2PBIA 2AHQA 3S93A 2R7VA 5M3FJ 1IUYA 1TNTA 3K4CA 4LG0B 2AS5F 1HSTA 2J5OA 5FLVA 3CUOA 2DA4A 4KICA 2DMQA 3S32A 3KP6A 3GWZA 2DMUA 1KU7A 4RB1A 3QWLA 1IRXA 1DPUA 2ZFWA 1U5TA 1JTYA 4BHCA 4R79A 1ULYA 2KL4A 3FIWA 1IO2A 1JI8A 3FHZA 1Q1HA 2EZHA 5FKKA 4W97A 2OPTA 2CO5A 1IW7F 5LGUA 3TEDA 5LHIA 3OYGA 3JREA 4N9HA 3I59B 2P7CB 2ELJA 1J2XA 2NRAC 3R4KA 1YITI 2ICWG 1MD0A 1S8NA 3A03A 3FF5A 3MKWB 4D0PA 4U0WA 3T0YA 4F55A 1BR2A 3CJNA 3FKJA 3U1DA 4MQVA 2FBIA 2HU9A 3OR1C 1WH5A 2M5WA 2CFXA 3NWTA 3K1MA 1LB2A 4LIUA 2FNAA 4AYBN 2EK5A 3CCJI 1TZLA 2HKXA 3RQIA 4FCYA 2HYGD 3I0TA 2EINH 4OWRB 1BC8C 3GTOJ 2DN0A 2XAHA 4XBFA 1K7AA 5HVQC 1W7PD 4DBRA 3H1CA 3G71I 3OYMA 4QPOA 3RPUA 2V26A 3KETA 1LKXA 1V5EA 1ZGJA 4PZJA 4P96A 4E7KA 4ZJZA 1LQ1A 4IHYA 1K6OA 5ICFA 4ZDPA 4U88A 3FISA 4II3A 1XB4A 2JA2A 3T1BA 3AG2H 3ZP5A 2CS3A 1FX7A 1PDNC 3HIFA 3CCLI 2CYYA 1REPC 2ZNYA 4PJMA 4S0HB 2MYSA 3ISPA 4AUXA 3B02A 3BR5A 4ZH4F 3FMRA 3TP0A 1VQ8I 4LGWA 1ZLJA 5HS7A 2EQRA 3S2DJ 1G8XA 5DD8A 2EA2A 3C1DA 4IF4A 1PP7U 3OYBA 3S17J 1KQ8A 4DYRA 1WJ5A 3Q9VA 3PJRA 4XKCA 2KHMA 2VC0A 3HRSA 4C30A 1R22A 2H8RA 2A07F 2XAUA 3BT9A 3HOUJ 4U87A 2H27A 2OCEA 4JYKA 1JXSA 3SZPA 3LMMA 3S2HJ 1IGNA 3GYHX 3H5AA 5GTHC 5FD5A 5L3FA 2E34A 4BQNA 3R61A 3DLLF 3GFJA 1IDYA 2VQLA 3EUHA 3BY6A 2Q0OA 1QBJA 2H94A 1XGSA 4XKBA 3S16J 5TISC 2EBIA 2N8GA 4NQWA 4BBRJ 2BY2A 2LMDA 3IRQA 3ZN1A 3L2UA 2GBYA 4MFDA 5F64A 2QLZA 4L5IA 5TGTA 4A0ZA 3CJRB 2GLOA 1Z7LA 2V4JC 4EMSA 3ABTA 1ZLKA 1S9HA 2ECCA 1T08B 2PG4A 3Q0WA 1VQOI 1WWXA 3H9GA 1SAUA 1Z6RA 3RQ4A 3IV5A 1A6IA 4NQWB 1G6NA 3W6KB 5L3CA 2COMA 1FTTA 4XORA 2R7SA 2OU2A 3PQJA 4C3IJ 3F6OA 1B8IA 2HOTA 3GTLJ 3O6BB 1FMWA 1Y8RB 3ZR8X 2L9RA 1X19A 3WGIA 2W57A 1J7KA 1XD7A 3IWZA 1MH3A 5KCMA 2E60A 2LY2A 2NVTJ 5CJ9A 2DOEA 4XSXF 2E1NA 1B8IB 2MBFA 4YFKF 2ECBA 2RREA 2JVGA 2E1MB 3FX3A 2KT0A 2LOOA 2ESNA 3ZQFA 4U0VA 4EV0A 2CV0A 3LSPA 1EH7A 2LG4A 4TV7A 4U7BA 4WXCA 4IZZA 3JRGA 4HSTA 2X9DA 1HBXG 1IJWC 4RM2A 3PIPF 4EJWA 2HFHA 1TWFJ 1MBEA 1R5ID 1WJBA 2IA2A 2X48A 2Y31A 3RIRA 2K9LA 1TQPA 3WTXC 5HLIA 3OSGA 2XHKA 1VZ0A 3IKTA 1SFXA 2X85A 3N4MA 5E18F 3ABLH 1OPCA 4M3GA 2XROA 1E3OC 2BY3A 4N9IA 5F27A 1YQAA 3ZMSA 1BL0A 3H3VK 2IPQX 2QEXI 5IYDJ 1NG6A 4EM1A 3RI4A 3RYRA 1Q1VA 1Z1DA 2FBKA 2Y0MA 5GAGJ 5E3OA 2VONA 1MH4A 5AIPA 3TL4X 2LNBA 5CPRB 2QSFX 1T6SA 2OBPA 4UB6C 3DF8A 1V54H 5DTDA 5B5EC 3FM5A 5E3NA 3BC8A 1LFPA 1TL8A 1HQCA 4A3EJ 3F8CA 1U6GA 4XOPA 1FIAA 4IXAA 4EGYA 1TWGJ 3OYKA 1MNMC 2FMLA 4GFBA 3HGGA 1BOBA 4I0AA 3WTYC 2XV4S 3LSRA 1T0FA 4IHWA 2L9NA 1DGWY 2ZJ2A 1JGSA 2WAFA 3D1NI 2X1EA 4IOAF 2VASA 2CMPA 3M07A 2XC7A 3M7GA 4EJTA 4BXXJ 3K1NA 3GVAA 3SHFA 1IAWA 1B72B 9ANTA 2VC1A 2QQBA 2P4WA 2V1DA 4S04A 1AOYA 5IP7J 4CXFA 3SZTA 2O5RA 1K83J 1POGA 2IW5A 3F8BA 1YS6A 1UAAA 1QHHD 3OYHA 2M4KA 3SYTA 4BUPA
chains in the Genus database with same CATH topology
4M9XA 2EFQA 1XGMA 3WGHA 2VBXA 3WTVC 2LDUA 1K78A 4WCGA 1KGSA 4ASNA 3HOTA 3QPTA 4OIRF 4RB2C 5HLHA 4I02A 3V8JA 2Q2EA 3HSEA 1BN5A 1BI3A 5E1ZB 4HX8A 4WK8F 5TRDA 2CWEA 4IVNA 2BYVE 1Y0UA 4OIQF 1XDUA 1GXPA 4IRGA 1XSVA 1DP7P 4P9UA 5BMZA 3GLXA 2YX7A 2KIUA 4BQAA 2VT3A 3TQNA 4ENNA 4A6DA 5EEGA 2PFBA 1IN8A 3Q9SA 1A04A 4KMUX 4KIFA 3WU1B 3FWEA 2PQ8A 2L54A 3F8NA 2QM3A 5TJJA 5HDGA 3E6BA 4I2OA 4M9ZA 5KVRA 3E6CC 1ZG1A 3L2CA 5DCMA 1KQ9A 1C0WA 5E8IA 1GHCA 2G7HA 3H92A 2M1BA 1IXCA 1KU9A 2PLYA 1DPRA 3KEOA 1S6LA 3GF2A 1SD5A 4ETSA 3DXJF 2A61A 3HSRA 3NRVA 3H3UA 3L00A 1SD6A 2EWNA 3W6JB 2Z9OA 2K86A 3HHHA 4UV9A 4OINF 4ZZDA 5D5XB 3FMQA 4OOIA 3TO6A 3EDPA 1J5YA 4CICA 2J5PA 2VOPA 4YFXF 3ZMVA 2TDXA 4ZYEA 3BPVA 3F8MA 5LBQA 1BBYA 3MZYA 3CLOA 2DW4A 3GZ6A 3ROUA 3G73A 4G8XA 1IN6A 3MWMA 4MNUA 1XMKA 3MCZA 2VOOA 4A2UA 4YIIA 3HHGA 3F8FA 4M72A 2FOKA 2HTSA 4BNCA 3HYIA 4I7HA 4I09A 1XCBA 1G3TA 5LLQA 1PP8F 1WRJA 2QQAA 4A0XA 4OIPF 4ESJA 2XKPA 4YG2F 2GIVA 2F2EA 2Y48A 1T98A 1MZBA 1TTYA 2CG4A 3EQLF 5CVUA 2MC3A 3ABUA 3KCCA 2LSOA 3JAMZ 4HF0A 2OAZA 2RNJA 1MGTA 2D1HA 3MEXA 3QU6A 4CDGA 2F5FA 2ZNZA 4I01A 1SD4A 3C18A 1G3SA 3K0LA 4AIHA 3DKWA 1HKTA 4CO8A 4L18B 1RNLA 2Z99A 2FA5A 3V8KA 1YLFA 2RV8A 1WQ2A 1HKSA 1O3TA 5ILUA 2QBYA 1K79A 1U8RA 3KP2A 2A68F 4FT8A 3LQQA 1R1VA 1IXSB 3QOPA 1ZGAA 5CVJA 2QBYB 1R5GA 1ZN2A 2DBBA 1O57A 1U78A 4S05A 3E5UA 5HS9A 1IXRC 2X4HA 2QZ8A 4EM2A 2EV6A 5D5UB 2AXLA 2XUBA 1BI0A 1YW8A 2BGCA 4Q48A 4M6YA 4LMYA 1P4XA 4RGRA 3H3ZA 1MKMA 2VE8A 5D6FA 4I98B 3DPTA 3OOPA 3JSOA 3MFKA 3JSPA 2CQKA 1TQIA 3CUQC 4HYEA 3M8EA 2H6BA 2DFIA 1V3FA 2O0YA 3FXQA 2Y75A 2FF4A 5E17F 5LEKA 1IN7A 1FBQA 3JAMK 5D8KB 3D5LA 1FLIA 5K5RA 1FYLA 3IL2A 4HZFA 5DUKA 1S7AA 3I59A 4AWXB 4GCVA 1IRFA 2FRHA 3T5XA 2D45A 1LEBA 2K02A 3IKVA 2E7WA 2RC4A 4OIOF 1X3UA 3WODF 3L7WA 1U3EM 3FMSA 3PFIA 2DT5A 3TO7A 1T38A 1FC3A 3WTUC 4NB5A 2ISZA 3P9IA 1YW9A 1O7FA 1W5TA 5BOXA 1OR7A 4G6DA 1G4DA 3C3WA 4AIJA 3GFMA 2BE5F 1P4AA 3K1PA 4WX9A 3ECHA 1I1GA 3RYPA 2RKHA 5ICGA 4WF2A 1FBSA 1CGPA 2Z5UA 2ZBKA 3VEPA 4E70A 2HYFA 4NHJA 4HW0A 2UWMA 2VBWA 5LRSA 1ZH5A 1WSUA 4KNYA 4KA4A 4CYDA 4PGGA 2ZKZA 5E1XA 2O6GE 1ODDA 3DFGA 4L5JA 3ZN0A 5KK1A 3BPXA 4M6XA 1EH6A 2XASA 1YO5C 3BJAA 3LA3A 2QWWA 4ESBA 1HKQA 2NYXA 1ZG5A 2ESHA 2ZO4A 4XSZF 2JPBA 4PCQA 1B1BA 3I53A 1B6AA 3I4PA 2D1VA 5JR3A 3Q5FA 3VODA 3BP8A 4HOBA 1BOAA 4IPAA 4HQEA 2O61A 3HRTA 2M30A 1D8JA 2R7FA 1SAXA 5FGMA 4BHBA 4GGGA 2RDPA 4N0BA 3RTRA 4BHPA 5F1RA 4RS8A 3JTHA 1QO0D 3LAJA 1H0MA 3EETA 2HTJA 4R8HA 2OZ6A 4ENMA 2VODA 3NQOA 2IT0A 2W84A 2XGXA 4L9JA 3LSTA 1RI7A 5DUIA 2FMYA 2B0LA 3E6MA 2KJCA 1B9NA 5LHHA 5ERIA 1TQMA 2F5CA 2HEOA 4A0YA 3F21A 4LLNA 3GUDA 3R60A 1LNWA 3VB2A 1UCRA 1YG2A 4YFNF 5D5VB 1ON2A 2ETHA 4LK0F 4PDKA 4A6EA 4MEXF 2L3DA 3CUQA 5DV5A 2DAOA 2GQQA 2KRFA 1USSA 1JE8A 3HRUA 1BIAA 3CUQB 4LB6B 4KN4X 1LEAA 4EQQA 3J80Z 3RKXA 1KYZA 3I54A 4UXNA 1YW7A 2VE9A 5FFZA 3K9TA 5FO5A 5ICCA 2GXBA 4HV6A 4Q47A 3JW4A 1G3WA 1GVJA 1XGOA 3MQ0A 1SFUA 3ZMDA 4HDUA 4G9YA 4OMYA 2XRNA 4QLCU 1FBUA 3TDUC 2MD5A 1B9MA 3HOSA 2QQ9A 2O03A 5LGTA 4LJZF 3GZ5A 3P9KA 4WXHA 1J59A 2LF8A 5HLGA 3WE3A 2A69F 1Z9CA 5DCFA 3I5UA 1OYWA 2K4BA 1IRGA 3HTSB 2M8EA 1QPMA 2LKPA 1D5VA 2DO7A 2IA1A 3QRFF 3R0AA 3P9CA 4Q4ZF 5ED4A 4ZZLA 4EGZA 2A3SA 4ENKA 4A12A 3WG9A 4EJVA 4KUMA 2H6CA 3B73A 4JK1X 4UVAA 2OA4A 3GFLA 2XAGA 3FXUA 4HAMA 3J80K 5BPDA 5J8FA 4ENJA 1KYWA 2XKOA 2DPDA 2IRFG 3ZMTA 4GYIA 5L3EA 1ZHFA 4M9SA 3G3ZA 2DPUA 2GA1A 2EFWA 2IP2A 5J8CA 2F5EA 1ZRDA 2VBYA 1FWZA 5AONA 4L0YB 4G7OF 3HUGA 4EM0B 1P92A 2M45A 1R1UA 3E6DA 1U5TC 4KT5C 2FXAA 1LVAA 1ZAOA 2L4AA 3BDDA 1NHAA 2L01A 2PJPA 2R3SA 2FSWA 1MDMB 4JBAA 2KJBA 1XN7A 4L9NA 2GAUA 2OQGA 4UVCA 2PI0A 4AVPA 1SFEA 2V6CA 3P7NA 4HX7A 1MJBA 2JTVA 4RGUA 3EYIA 1FSHA 3E5QA 1R36A 2DQLA 3LFKA 2L4MA 3IHUA 1TNSA 4XLNF 1FP1D 5FB2A 2W24A 3QPHA 1UHWA 5CLSA 5EEHA 4ZYGA 2JZYA 1ON1A 2GZWA 4HLXA 1R1TA 1W7PA 2W85A 2YPRA 4FX4A 3DQVC 1J0RA 3LWFA 5JI6A 3L09A 3E5XA 4AIKA 1HSJA 3TKYA 1W7PB 1L0OC 1ZRFA 5FLXZ 1I5ZA 4M73A 3IC7A 1Z6TA 4GXOA 5E20A 5HDNA 3WGGA 2E1CA 3TDZC 3O3KA 2K7LA 2WC2A 5FD6A 2ZCWA 3LA2A 2STWA 2CW0F 3SXYA 2EA4A 4G7HF 1WKMA 1H9TA 4P55A 1I27A 2UXXA 5D5WB 2UZKA 4XRFA 1OYIA 1QGPA 2QVOA 3D0SA 2MLKA 1XDSA 1I6XA 4KIBA 2PN6A 5DD4A 3JTGA 2A6EF 3GXOA 5CVIA 5IT9Z 2ZXJA 4BAYA 1CF7A 2DU9A 1QZYA 1LDKB 1RZ4A 3F3XA 4HF1A 3BZ6A 1OYYA 2ISYA 1CF7B 5K5OA 1RUOA 5H6RA 2P5LC 2Q8KA 5A2QZ 1U2WA 3WTTC 1F5TA 5H6QA 2F5DA 5JFRA 4KMFA 5HDKA 1F1ZA 2KIMA 1R7JA 5L3GA 1S7OA 3BOQA 2P7VB 4IRHA 2A5YB 2HWVA 4Q5SF 2HOEA 5F6FA 1H9GA 2MLGA 5FLXK 3HRMA 1QQIA 2D2WA 2EV0A 1USTA 4IHSA 2MA3A 1RUNA 1ZARA 4HA8A 2MH9A 3TGNA 4O5VA 1HW1A 5DYMA 2STTA 1TW3A 4ESFA 1ZRCA 3ERED 3LAPA 1S3JA 4O6JA 2RVCA 1FOKA 5BS6A 1OKRA 3BJ6A 2IVMA 4KFCA 2FEZA 3K2ZA 1YTYA 5J6XA 1QZZA 1V4RA 1DDNA 5ICEA 4AD9A 1D8KA 4UUVA 5ILSA 1FT9A 3AAFA 3SQNA 5IT9K 4L9VA 2WWYA 1RIOH 4LD5A 5CVRA 1U5TB 2ADUA 3O2PE 2HR3A 5D6EA 3TO9A 2OD5A 5A2QK 1PUEE 3COAC 2WTEA 3K69A 1MJAA 2BV6A 4EVIA 2K27A 1SMTA 4L0ZB 2Z3YA 4PGHA 4JQFA 3J7AO 1KA8A 1HW5A 3GO5A 3RDIA 5BQTA 1BI1A 5K1YA 3ECOA 1TLHB 2HGCA 4P5OA 2KKOA 2V9VA 3GX4X 4MHGA 4H0EA 3KZZA 1QNTA 2RQPA 2GXGA 1EH8A 3E97A 2QYOA 1UB9A 4CGZA 3I71A 3V7RA 4XLPF 2V1XA 3SFZA 2M87A 1ONVA 3VOEA 1EV7A 3NEUA 2XAQA 2FBHA 2EV5A 1IN5A 1MJ9A 2G7UA 1Z05A 4HV5A 3V8LA 3F22A 3R0JA 4WWCA 4LLGF 4G7ZF 2HS5A 1G3YA 5D4SA 1FY7A 1J75A 1P6RA 5LGNA 2VXZA 2E7XA 4Y17A 1I1SA 3TOBA 4DQ2A 2PEXA 3ULQB 4A5MA 4KYWA 3FZVA 2NNNA 5LHGA 4MEYF 2HQNA 3I58A 4HDVA 6PAXA 4WXDA 1R23A 4L9TA 3KZYA 2HDCA 4RGSA 1WI9A 4RAYA 3V7SA 3PQKA 3DP7A 2P8TA 2O3FA 1IF1A 1XSDA 4FHTA 2ELHA 4MQ9F 5LRRA 3RJPA 4F7ZA 4U7DA 1TW2A 3F23A 1W4MA 2W25A 3M9AA 1F9NA 5ILVA 1LJ9A 1P4WA 2DTRA 4YIFA 2C6YA 4G6QA 1XMAA 4CHUA 5L3DA 2BBYA 2P6SA 1O3RA 2XIGA 3DEUA 1UHMA 4G94A 4A5NA 3CO7C 2YX4A 4Z2YA 1YIOA 1GXQA 1Z91A 1J9IA 3WTWC 1IN4A 4HX4A 1L3LA 2WV0A 2Z33A 2MH2A 2O8XA 1TBXA 2X0LA 2EB7A 4IJAA 2P6TA 4IHTA 2FU4A 4UNOA 3CO6C 5D4RA 4OMZA 5CYVA 3J81Z 2H09A 3GFIA 1VTNC 1W5SA 3QAHA 2PMHA 2KIFA 4CZZA 4RB0A 3FXRA 3WE2A 3IWFA 1E17A 4FX0A 1K78B 3HTUA 4QWQA 3L9FA 3ZMZA 2EFOA 2EFPA 1FP2A 2YSRA 2OQRA 2P5KA 2RGVA 3LQRA 4HF2A 3GEZA 3ELKA 2JSCA 4B09A 1FNNA 1FPQA 4ZYDA 1ZREA 3V4GA 4KDPA 4U0YA 2XAFA 1XSXA 2DLLA 2NAZA 2GWRA 2YR2A 5HS8A 1KU3A 5E8GA 4LB5A 2DI3A 2EJRA 2HZTA 3ZQ7A 2YU3A 3KP5A 2R7DA 4ON0A 4R1HA 2DK8A 3TOAA 4LK1F 2XVCA 1E2XA 4MTEA 1BM9A 4UHTA 3F72A 2L02A 3ZPLA 3HSFA 2CGPA 2EFNA 1IZ1A 3QP6A 5K5QA 2G9WA 5CVVA 2NNYA 3RPQA 4OU0A 2V79A 1O3SA 4IRIA 4Y15A 3BWGA 3REOA 4RGXA 3KFWX 1MDMA 2IA0A 1R58A 3J81K 4Y13A 1P2FA 5DCMB 4GO1A 1R00A 4LFUA 1STZA 3IRRA 3F6VA 2JPCA 1LDJA 3WTZA 1YFHA 3KLNA 3E3VA 1T2KA 4UVBA 4O3MA 1YS7A 1BI2A 2HQRA 2IJLA 5JHUA 4GYGA 2VBZA 2DK5A 1YYVA 1D3YA 5DEQA 1SMYF 1B59A 5DDGA 3C7JA 2JRTA 1O7LA 1KQ0A 4LLLA 2DQRA 3WTSC 1T39A 1R5HA 3FM3A 4KN7X 2ZMEA 3T8TA 4MTDA 1FYMA 4HLYA 2CSOA 3KE2A 5AIQA 1SD7A 1FYKA 3ML6A 3EYYA 1HXDA 2UXNA 5L3BA 4MGRA 3KLOA 2ZMEB 2FQ3A 5FFXA 3S2WA 3GW2A 4ZYHA 4BYYA 3M8FA 3BROA 5H20A 3I64A 3RKYA 2QENA 2VT2A 4HBLA 3QP5A 4B8XA 3U9GA 1ZG3A 2PMUA 3OV8A 1HW2A 1XCVA 1AWCA 2JT1A 1KU2A 2A6HF 3MAJA 3MZHA 4M71A 5JVTA 3RKWA 4KIGA 2P5VA 5IT3A 5E1WA 3T8RA 3VFZA 1JHFA 1XGNA 1B4AA 1BJAA 2XAJA 3M1EA 2K4JA 1BIBA 3CDHA 4K2EA 3LA7A 1JHHA 3KP7A 2BEOA 1UFMA 1Z7UA 3KP3A 4M74A 3DV8A 3U2RA 3QU3A 1O3QA 4RB3C 4RAZA 2HKOA 5LEJA 1S29A 1OMIA 2QUFA 2ACJA 2FE3A 3DPLC 1FZPB 5D8LB 1FSEA 4DNCA 1F4KA 1LDDA 2RN7A 1ZYRF 3V7CA 2V1UA 2OZUA 2VN2A 1DUXC 5HOOA 1BC7C 3ZMUA 3BJOA 2GA2A 4HQMA 4UV8A 3R6SA 4P9FA 4LG0A 4EJUA 4I0BA 4BH9A 3CTAA 3KP4A 3N97A 4BXUA 2NS0A 2FNPA 2LF7A 3WU0A 4EJOA 5BPIA 3KEQA 2PBIA 1IUYA 1TNTA 4LG0B 2AS5F 1HSTA 2J5OA 3CUOA 4KICA 3KP6A 3GWZA 1KU7A 4RB1A 1DPUA 2ZFWA 1U5TA 4BHCA 4R79A 1ULYA 3FHZA 1Q1HA 2CO5A 1IW7F 5LGUA 5LHIA 4N9HA 3I59B 2P7CB 1J2XA 2NRAC 3R4KA 1MD0A 1S8NA 3FF5A 4D0PA 4U0WA 3T0YA 3CJNA 3U1DA 4MQVA 2FBIA 2M5WA 2CFXA 3K1MA 1LB2A 2FNAA 2EK5A 2HKXA 2HYGD 3I0TA 1BC8C 2XAHA 4XBFA 1K7AA 5HVQC 1W7PD 3RPUA 3KETA 1ZGJA 4PZJA 4P96A 1LQ1A 1K6OA 5ICFA 4U88A 1XB4A 3T1BA 3ZP5A 1FX7A 1PDNC 3HIFA 2CYYA 1REPC 2ZNYA 3ISPA 3B02A 4ZH4F 3FMRA 4LGWA 1ZLJA 5HS7A 5DD8A 2EA2A 3C1DA 4IF4A 1PP7U 1KQ8A 3Q9VA 2VC0A 3HRSA 1R22A 2A07F 2H27A 1JXSA 3SZPA 3GYHX 5FD5A 5L3FA 3R61A 3GFJA 3EUHA 3BY6A 2Q0OA 1QBJA 2H94A 1XGSA 4NQWA 3IRQA 3ZN1A 5F64A 2QLZA 4L5IA 4A0ZA 4EMSA 3ABTA 1ZLKA 2PG4A 1WWXA 1Z6RA 1G6NA 3W6KB 5L3CA 2COMA 2OU2A 3PQJA 3F6OA 3O6BB 3WGIA 2W57A 1J7KA 1XD7A 3IWZA 5CJ9A 4XSXF 2E1NA 2MBFA 4YFKF 3FX3A 2ESNA 4U0VA 4EV0A 1EH7A 4TV7A 4U7BA 4WXCA 1HBXG 4EJWA 2HFHA 2IA2A 3RIRA 1TQPA 3WTXC 5HLIA 2XHKA 3IKTA 1SFXA 3N4MA 5E18F 1OPCA 2XROA 4N9IA 1YQAA 3ZMSA 2IPQX 4EM1A 3RI4A 3RYRA 1Z1DA 2FBKA 2Y0MA 2VONA 5AIPA 2LNBA 1T6SA 2OBPA 3DF8A 3FM5A 1HQCA 3F8CA 1U6GA 4EGYA 4IXAA 2FMLA 4I0AA 3WTYC 2XV4S 1T0FA 2ZJ2A 1JGSA 3M7GA 4EJTA 3K1NA 3GVAA 3SHFA 1IAWA 2VC1A 2QQBA 2P4WA 2V1DA 4S04A 1AOYA 4CXFA 3SZTA 2IW5A 3F8BA 1YS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9X A;  2EFQ A;  1XGM A;  3WGH A;  2VBX A;  3WTV C;  2LDU A;  1K78 A;  4WCG A;  1KGS A;  4ASN A;  3HOT A;  3QPT A;  4OIR F;  4RB2 C;  5HLH A;  4I02 A;  3V8J A;  2Q2E A;  3HSE A;  1BN5 A;  1BI3 A;  5E1Z B;  4HX8 A;  4WK8 F;  5TRD A;  2CWE A;  4IVN A;  2BYV E;  1Y0U A;  4OIQ F;  1XDU A;  1GXP A;  4IRG A;  1XSV A;  1DP7 P;  4P9U A;  5BMZ A;  3GLX A;  2YX7 A;  2KIU A;  4BQA A;  2VT3 A;  3TQN A;  4ENN A;  4A6D A;  5EEG A;  2PFB A;  1IN8 A;  3Q9S A;  1A04 A;  4KMU X;  4KIF A;  3WU1 B;  3FWE A;  2PQ8 A;  2L54 A;  3F8N A;  2QM3 A;  5TJJ A;  5HDG A;  3E6B A;  4I2O A;  4M9Z A;  5KVR A;  3E6C C;  1ZG1 A;  3L2C A;  5DCM A;  1KQ9 A;  1C0W A;  5E8I A;  1GHC A;  2G7H A;  3H92 A;  2M1B A;  1IXC A;  1KU9 A;  2PLY A;  1DPR A;  3KEO A;  1S6L A;  3GF2 A;  1SD5 A;  4ETS A;  3DXJ F;  2A61 A;  3HSR A;  3NRV A;  3H3U A;  3L00 A;  1SD6 A;  2EWN A;  3W6J B;  2Z9O A;  2K86 A;  3HHH A;  4UV9 A;  4OIN F;  4ZZD A;  5D5X B;  3FMQ A;  4OOI A;  3TO6 A;  3EDP A;  1J5Y A;  4CIC A;  2J5P A;  2VOP A;  4YFX F;  3ZMV A;  2TDX A;  4ZYE A;  3BPV A;  3F8M A;  5LBQ A;  1BBY A;  3MZY A;  3CLO A;  2DW4 A;  3GZ6 A;  3ROU A;  3G73 A;  4G8X A;  1IN6 A;  3MWM A;  4MNU A;  1XMK A;  3MCZ A;  2VOO A;  4A2U A;  4YII A;  3HHG A;  3F8F A;  4M72 A;  2FOK A;  2HTS A;  4BNC A;  3HYI A;  4I7H A;  4I09 A;  1XCB A;  1G3T A;  5LLQ A;  1PP8 F;  1WRJ A;  2QQA A;  4A0X A;  4OIP F;  4ESJ A;  2XKP A;  4YG2 F;  2GIV A;  2F2E A;  2Y48 A;  1T98 A;  1MZB A;  1TTY A;  2CG4 A;  3EQL F;  5CVU A;  2MC3 A;  3ABU A;  3KCC A;  2LSO A;  3JAM Z;  4HF0 A;  2OAZ A;  2RNJ A;  1MGT A;  2D1H A;  3MEX A;  3QU6 A;  4CDG A;  2F5F A;  2ZNZ A;  4I01 A;  1SD4 A;  3C18 A;  1G3S A;  3K0L A;  4AIH A;  3DKW A;  1HKT A;  4CO8 A;  4L18 B;  1RNL A;  2Z99 A;  2FA5 A;  3V8K A;  1YLF A;  2RV8 A;  1WQ2 A;  1HKS A;  1O3T A;  5ILU A;  2QBY A;  1K79 A;  1U8R A;  3KP2 A;  2A68 F;  4FT8 A;  3LQQ A;  1R1V A;  1IXS B;  3QOP A;  1ZGA A;  5CVJ A;  2QBY B;  1R5G A;  1ZN2 A;  2DBB A;  1O57 A;  1U78 A;  4S05 A;  3E5U A;  5HS9 A;  1IXR C;  2X4H A;  2QZ8 A;  4EM2 A;  2EV6 A;  5D5U B;  2AXL A;  2XUB A;  1BI0 A;  1YW8 A;  2BGC A;  4Q48 A;  4M6Y A;  4LMY A;  1P4X A;  4RGR A;  3H3Z A;  1MKM A;  2VE8 A;  5D6F A;  4I98 B;  3DPT A;  3OOP A;  3JSO A;  3MFK A;  3JSP A;  2CQK A;  1TQI A;  3CUQ C;  4HYE A;  3M8E A;  2H6B A;  2DFI A;  1V3F A;  2O0Y A;  3FXQ A;  2Y75 A;  2FF4 A;  5E17 F;  5LEK A;  1IN7 A;  1FBQ A;  3JAM K;  5D8K B;  3D5L A;  1FLI A;  5K5R A;  1FYL A;  3IL2 A;  4HZF A;  5DUK A;  1S7A A;  3I59 A;  4AWX B;  4GCV A;  1IRF A;  2FRH A;  3T5X A;  2D45 A;  1LEB A;  2K02 A;  3IKV A;  2E7W A;  2RC4 A;  4OIO F;  1X3U A;  3WOD F;  3L7W A;  1U3E M;  3FMS A;  3PFI A;  2DT5 A;  3TO7 A;  1T38 A;  1FC3 A;  3WTU C;  4NB5 A;  2ISZ A;  3P9I A;  1YW9 A;  1O7F A;  1W5T A;  5BOX A;  1OR7 A;  4G6D A;  1G4D A;  3C3W A;  4AIJ A;  3GFM A;  2BE5 F;  1P4A A;  3K1P A;  4WX9 A;  3ECH A;  1I1G A;  3RYP A;  2RKH A;  5ICG A;  4WF2 A;  1FBS A;  1CGP A;  2Z5U A;  2ZBK A;  3VEP A;  4E70 A;  2HYF A;  4NHJ A;  4HW0 A;  2UWM A;  2VBW A;  5LRS A;  1ZH5 A;  1WSU A;  4KNY A;  4KA4 A;  4CYD A;  4PGG A;  2ZKZ A;  5E1X A;  2O6G E;  1ODD A;  3DFG A;  4L5J A;  3ZN0 A;  5KK1 A;  3BPX A;  4M6X A;  1EH6 A;  2XAS A;  1YO5 C;  3BJA A;  3LA3 A;  2QWW A;  4ESB A;  1HKQ A;  2NYX A;  1ZG5 A;  2ESH A;  2ZO4 A;  4XSZ F;  2JPB A;  4PCQ A;  1B1B A;  3I53 A;  1B6A A;  3I4P A;  2D1V A;  5JR3 A;  3Q5F A;  3VOD A;  3BP8 A;  4HOB A;  1BOA A;  4IPA A;  4HQE A;  2O61 A;  3HRT A;  2M30 A;  1D8J A;  2R7F A;  1SAX A;  5FGM A;  4BHB A;  4GGG A;  2RDP A;  4N0B A;  3RTR A;  4BHP A;  5F1R A;  4RS8 A;  3JTH A;  1QO0 D;  3LAJ A;  1H0M A;  3EET A;  2HTJ A;  4R8H A;  2OZ6 A;  4ENM A;  2VOD A;  3NQO A;  2IT0 A;  2W84 A;  2XGX A;  4L9J A;  3LST A;  1RI7 A;  5DUI A;  2FMY A;  2B0L A;  3E6M A;  2KJC A;  1B9N A;  5LHH A;  5ERI A;  1TQM A;  2F5C A;  2HEO A;  4A0Y A;  3F21 A;  4LLN A;  3GUD A;  3R60 A;  1LNW A;  3VB2 A;  1UCR A;  1YG2 A;  4YFN F;  5D5V B;  1ON2 A;  2ETH A;  4LK0 F;  4PDK A;  4A6E A;  4MEX F;  2L3D A;  3CUQ A;  5DV5 A;  2DAO A;  2GQQ A;  2KRF A;  1USS A;  1JE8 A;  3HRU A;  1BIA A;  3CUQ B;  4LB6 B;  4KN4 X;  1LEA A;  4EQQ A;  3J80 Z;  3RKX A;  1KYZ A;  3I54 A;  4UXN A;  1YW7 A;  2VE9 A;  5FFZ A;  3K9T A;  5FO5 A;  5ICC A;  2GXB A;  4HV6 A;  4Q47 A;  3JW4 A;  1G3W A;  1GVJ A;  1XGO A;  3MQ0 A;  1SFU A;  3ZMD A;  4HDU A;  4G9Y A;  4OMY A;  2XRN A;  4QLC U;  1FBU A;  3TDU C;  2MD5 A;  1B9M A;  3HOS A;  2QQ9 A;  2O03 A;  5LGT A;  4LJZ F;  3GZ5 A;  3P9K A;  4WXH A;  1J59 A;  2LF8 A;  5HLG A;  3WE3 A;  2A69 F;  1Z9C A;  5DCF A;  3I5U A;  1OYW A;  2K4B A;  1IRG A;  3HTS B;  2M8E A;  1QPM A;  2LKP A;  1D5V A;  2DO7 A;  2IA1 A;  3QRF F;  3R0A A;  3P9C A;  4Q4Z F;  5ED4 A;  4ZZL A;  4EGZ A;  2A3S A;  4ENK A;  4A12 A;  3WG9 A;  4EJV A;  4KUM A;  2H6C A;  3B73 A;  4JK1 X;  4UVA A;  2OA4 A;  3GFL A;  2XAG A;  3FXU A;  4HAM A;  3J80 K;  5BPD A;  5J8F A;  4ENJ A;  1KYW A;  2XKO A;  2DPD A;  2IRF G;  3ZMT A;  4GYI A;  5L3E A;  1ZHF A;  4M9S A;  3G3Z A;  2DPU A;  2GA1 A;  2EFW A;  2IP2 A;  5J8C A;  2F5E A;  1ZRD A;  2VBY A;  1FWZ A;  5AON A;  4L0Y B;  4G7O F;  3HUG A;  4EM0 B;  1P92 A;  2M45 A;  1R1U A;  3E6D A;  1U5T C;  4KT5 C;  2FXA A;  1LVA A;  1ZAO A;  2L4A A;  3BDD A;  1NHA A;  2L01 A;  2PJP A;  2R3S A;  2FSW A;  1MDM B;  4JBA A;  2KJB A;  1XN7 A;  4L9N A;  2GAU A;  2OQG A;  4UVC A;  2PI0 A;  4AVP A;  1SFE A;  2V6C A;  3P7N A;  4HX7 A;  1MJB A;  2JTV A;  4RGU A;  3EYI A;  1FSH A;  3E5Q A;  1R36 A;  2DQL A;  3LFK A;  2L4M A;  3IHU A;  1TNS A;  4XLN F;  1FP1 D;  5FB2 A;  2W24 A;  3QPH A;  1UHW A;  5CLS A;  5EEH A;  4ZYG A;  2JZY A;  1ON1 A;  2GZW A;  4HLX A;  1R1T A;  1W7P A;  2W85 A;  2YPR A;  4FX4 A;  3DQV C;  1J0R A;  3LWF A;  5JI6 A;  3L09 A;  3E5X A;  4AIK A;  1HSJ A;  3TKY A;  1W7P B;  1L0O C;  1ZRF A;  5FLX Z;  1I5Z A;  4M73 A;  3IC7 A;  1Z6T A;  4GXO A;  5E20 A;  5HDN A;  3WGG A;  2E1C A;  3TDZ C;  3O3K A;  2K7L A;  2WC2 A;  5FD6 A;  2ZCW A;  3LA2 A;  2STW A;  2CW0 F;  3SXY A;  2EA4 A;  4G7H F;  1WKM A;  1H9T A;  4P55 A;  1I27 A;  2UXX A;  5D5W B;  2UZK A;  4XRF A;  1OYI A;  1QGP A;  2QVO A;  3D0S A;  2MLK A;  1XDS A;  1I6X A;  4KIB A;  2PN6 A;  5DD4 A;  3JTG A;  2A6E F;  3GXO A;  5CVI A;  5IT9 Z;  2ZXJ A;  4BAY A;  1CF7 A;  2DU9 A;  1QZY A;  1LDK B;  1RZ4 A;  3F3X A;  4HF1 A;  3BZ6 A;  1OYY A;  2ISY A;  1CF7 B;  5K5O A;  1RUO A;  5H6R A;  2P5L C;  2Q8K A;  5A2Q Z;  1U2W A;  3WTT C;  1F5T A;  5H6Q A;  2F5D A;  5JFR A;  4KMF A;  5HDK A;  1F1Z A;  2KIM A;  1R7J A;  5L3G A;  1S7O A;  3BOQ A;  2P7V B;  4IRH A;  2A5Y B;  2HWV A;  4Q5S F;  2HOE A;  5F6F A;  1H9G A;  2MLG A;  5FLX K;  3HRM A;  1QQI A;  2D2W A;  2EV0 A;  1UST A;  4IHS A;  2MA3 A;  1RUN A;  1ZAR A;  4HA8 A;  2MH9 A;  3TGN A;  4O5V A;  1HW1 A;  5DYM A;  2STT A;  1TW3 A;  4ESF A;  1ZRC A;  3ERE D;  3LAP A;  1S3J A;  4O6J A;  2RVC A;  1FOK A;  5BS6 A;  1OKR A;  3BJ6 A;  2IVM A;  4KFC A;  2FEZ A;  3K2Z A;  1YTY A;  5J6X A;  1QZZ A;  1V4R A;  1DDN A;  5ICE A;  4AD9 A;  1D8K A;  4UUV A;  5ILS A;  1FT9 A;  3AAF A;  3SQN A;  5IT9 K;  4L9V A;  2WWY A;  1RIO H;  4LD5 A;  5CVR A;  1U5T B;  2ADU A;  3O2P E;  2HR3 A;  5D6E A;  3TO9 A;  2OD5 A;  5A2Q K;  1PUE E;  3COA C;  2WTE A;  3K69 A;  1MJA A;  2BV6 A;  4EVI A;  2K27 A;  1SMT A;  4L0Z B;  2Z3Y A;  4PGH A;  4JQF A;  3J7A O;  1KA8 A;  1HW5 A;  3GO5 A;  3RDI A;  5BQT A;  1BI1 A;  5K1Y A;  3ECO A;  1TLH B;  2HGC A;  4P5O A;  2KKO A;  2V9V A;  3GX4 X;  4MHG A;  4H0E A;  3KZZ A;  1QNT A;  2RQP A;  2GXG A;  1EH8 A;  3E97 A;  2QYO A;  1UB9 A;  4CGZ A;  3I71 A;  3V7R A;  4XLP F;  2V1X A;  3SFZ A;  2M87 A;  1ONV A;  3VOE A;  1EV7 A;  3NEU A;  2XAQ A;  2FBH A;  2EV5 A;  1IN5 A;  1MJ9 A;  2G7U A;  1Z05 A;  4HV5 A;  3V8L A;  3F22 A;  3R0J A;  4WWC A;  4LLG F;  4G7Z F;  2HS5 A;  1G3Y A;  5D4S A;  1FY7 A;  1J75 A;  1P6R A;  5LGN A;  2VXZ A;  2E7X A;  4Y17 A;  1I1S A;  3TOB A;  4DQ2 A;  2PEX A;  3ULQ B;  4A5M A;  4KYW A;  3FZV A;  2NNN A;  5LHG A;  4MEY F;  2HQN A;  3I58 A;  4HDV A;  6PAX A;  4WXD A;  1R23 A;  4L9T A;  3KZY A;  2HDC A;  4RGS A;  1WI9 A;  4RAY A;  3V7S A;  3PQK A;  3DP7 A;  2P8T A;  2O3F A;  1IF1 A;  1XSD A;  4FHT A;  2ELH A;  4MQ9 F;  5LRR A;  3RJP A;  4F7Z A;  4U7D A;  1TW2 A;  3F23 A;  1W4M A;  2W25 A;  3M9A A;  1F9N A;  5ILV A;  1LJ9 A;  1P4W A;  2DTR A;  4YIF A;  2C6Y A;  4G6Q A;  1XMA A;  4CHU A;  5L3D A;  2BBY A;  2P6S A;  1O3R A;  2XIG A;  3DEU A;  1UHM A;  4G94 A;  4A5N A;  3CO7 C;  2YX4 A;  4Z2Y A;  1YIO A;  1GXQ A;  1Z91 A;  1J9I A;  3WTW C;  1IN4 A;  4HX4 A;  1L3L A;  2WV0 A;  2Z33 A;  2MH2 A;  2O8X A;  1TBX A;  2X0L A;  2EB7 A;  4IJA A;  2P6T A;  4IHT A;  2FU4 A;  4UNO A;  3CO6 C;  5D4R A;  4OMZ A;  5CYV A;  3J81 Z;  2H09 A;  3GFI A;  1VTN C;  1W5S A;  3QAH A;  2PMH A;  2KIF A;  4CZZ A;  4RB0 A;  3FXR A;  3WE2 A;  3IWF A;  1E17 A;  4FX0 A;  1K78 B;  3HTU A;  4QWQ A;  3L9F A;  3ZMZ A;  2EFO A;  2EFP A;  1FP2 A;  2YSR A;  2OQR A;  2P5K A;  2RGV A;  3LQR A;  4HF2 A;  3GEZ A;  3ELK A;  2JSC A;  4B09 A;  1FNN A;  1FPQ A;  4ZYD A;  1ZRE A;  3V4G A;  4KDP A;  4U0Y A;  2XAF A;  1XSX A;  2DLL A;  2NAZ A;  2GWR A;  2YR2 A;  5HS8 A;  1KU3 A;  5E8G A;  4LB5 A;  2DI3 A;  2EJR A;  2HZT A;  3ZQ7 A;  2YU3 A;  3KP5 A;  2R7D A;  4ON0 A;  4R1H A;  2DK8 A;  3TOA A;  4LK1 F;  2XVC A;  1E2X A;  4MTE A;  1BM9 A;  4UHT A;  3F72 A;  2L02 A;  3ZPL A;  3HSF A;  2CGP A;  2EFN A;  1IZ1 A;  3QP6 A;  5K5Q A;  2G9W A;  5CVV A;  2NNY A;  3RPQ A;  4OU0 A;  2V79 A;  1O3S A;  4IRI A;  4Y15 A;  3BWG A;  3REO A;  4RGX A;  3KFW X;  1MDM A;  2IA0 A;  1R58 A;  3J81 K;  4Y13 A;  1P2F A;  5DCM B;  4GO1 A;  1R00 A;  4LFU A;  1STZ A;  3IRR A;  3F6V A;  2JPC A;  1LDJ A;  3WTZ A;  1YFH A;  3KLN A;  3E3V A;  1T2K A;  4UVB A;  4O3M A;  1YS7 A;  1BI2 A;  2HQR A;  2IJL A;  5JHU A;  4GYG A;  2VBZ A;  2DK5 A;  1YYV A;  1D3Y A;  5DEQ A;  1SMY F;  1B59 A;  5DDG A;  3C7J A;  2JRT A;  1O7L A;  1KQ0 A;  4LLL A;  2DQR A;  3WTS C;  1T39 A;  1R5H A;  3FM3 A;  4KN7 X;  2ZME A;  3T8T A;  4MTD A;  1FYM A;  4HLY A;  2CSO A;  3KE2 A;  5AIQ A;  1SD7 A;  1FYK A;  3ML6 A;  3EYY A;  1HXD A;  2UXN A;  5L3B A;  4MGR A;  3KLO A;  2ZME B;  2FQ3 A;  5FFX A;  3S2W A;  3GW2 A;  4ZYH A;  4BYY A;  3M8F A;  3BRO A;  5H20 A;  3I64 A;  3RKY A;  2QEN A;  2VT2 A;  4HBL A;  3QP5 A;  4B8X A;  3U9G A;  1ZG3 A;  2PMU A;  3OV8 A;  1HW2 A;  1XCV A;  1AWC A;  2JT1 A;  1KU2 A;  2A6H F;  3MAJ A;  3MZH A;  4M71 A;  5JVT A;  3RKW A;  4KIG A;  2P5V A;  5IT3 A;  5E1W A;  3T8R A;  3VFZ A;  1JHF A;  1XGN A;  1B4A A;  1BJA A;  2XAJ A;  3M1E A;  2K4J A;  1BIB A;  3CDH A;  4K2E A;  3LA7 A;  1JHH A;  3KP7 A;  2BEO A;  1UFM A;  1Z7U A;  3KP3 A;  4M74 A;  3DV8 A;  3U2R A;  3QU3 A;  1O3Q A;  4RB3 C;  4RAZ A;  2HKO A;  5LEJ A;  1S29 A;  1OMI A;  2QUF A;  2ACJ A;  2FE3 A;  3DPL C;  1FZP B;  5D8L B;  1FSE A;  4DNC A;  1F4K A;  1LDD A;  2RN7 A;  1ZYR F;  3V7C A;  2V1U A;  2OZU A;  2VN2 A;  1DUX C;  5HOO A;  1BC7 C;  3ZMU A;  3BJO A;  2GA2 A;  4HQM A;  4UV8 A;  3R6S A;  4P9F A;  4LG0 A;  4EJU A;  4I0B A;  4BH9 A;  3CTA A;  3KP4 A;  3N97 A;  4BXU A;  2NS0 A;  2FNP A;  2LF7 A;  3WU0 A;  4EJO A;  5BPI A;  3KEQ A;  2PBI A;  1IUY A;  1TNT A;  4LG0 B;  2AS5 F;  1HST A;  2J5O A;  3CUO A;  4KIC A;  3KP6 A;  3GWZ A;  1KU7 A;  4RB1 A;  1DPU A;  2ZFW A;  1U5T A;  4BHC A;  4R79 A;  1ULY A;  3FHZ A;  1Q1H A;  2CO5 A;  1IW7 F;  5LGU A;  5LHI A;  4N9H A;  3I59 B;  2P7C B;  1J2X A;  2NRA C;  3R4K A;  1MD0 A;  1S8N A;  3FF5 A;  4D0P A;  4U0W A;  3T0Y A;  3CJN A;  3U1D A;  4MQV A;  2FBI A;  2M5W A;  2CFX A;  3K1M A;  1LB2 A;  2FNA A;  2EK5 A;  2HKX A;  2HYG D;  3I0T A;  1BC8 C;  2XAH A;  4XBF A;  1K7A A;  5HVQ C;  1W7P D;  3RPU A;  3KET A;  1ZGJ A;  4PZJ A;  4P96 A;  1LQ1 A;  1K6O A;  5ICF A;  4U88 A;  1XB4 A;  3T1B A;  3ZP5 A;  1FX7 A;  1PDN C;  3HIF A;  2CYY A;  1REP C;  2ZNY A;  3ISP A;  3B02 A;  4ZH4 F;  3FMR A;  4LGW A;  1ZLJ A;  5HS7 A;  5DD8 A;  2EA2 A;  3C1D A;  4IF4 A;  1PP7 U;  1KQ8 A;  3Q9V A;  2VC0 A;  3HRS A;  1R22 A;  2A07 F;  2H27 A;  1JXS A;  3SZP A;  3GYH X;  5FD5 A;  5L3F A;  3R61 A;  3GFJ A;  3EUH A;  3BY6 A;  2Q0O A;  1QBJ A;  2H94 A;  1XGS A;  4NQW A;  3IRQ A;  3ZN1 A;  5F64 A;  2QLZ A;  4L5I A;  4A0Z A;  4EMS A;  3ABT A;  1ZLK A;  2PG4 A;  1WWX A;  1Z6R A;  1G6N A;  3W6K B;  5L3C A;  2COM A;  2OU2 A;  3PQJ A;  3F6O A;  3O6B B;  3WGI A;  2W57 A;  1J7K A;  1XD7 A;  3IWZ A;  5CJ9 A;  4XSX F;  2E1N A;  2MBF A;  4YFK F;  3FX3 A;  2ESN A;  4U0V A;  4EV0 A;  1EH7 A;  4TV7 A;  4U7B A;  4WXC A;  1HBX G;  4EJW A;  2HFH A;  2IA2 A;  3RIR A;  1TQP A;  3WTX C;  5HLI A;  2XHK A;  3IKT A;  1SFX A;  3N4M A;  5E18 F;  1OPC A;  2XRO A;  4N9I A;  1YQA A;  3ZMS A;  2IPQ X;  4EM1 A;  3RI4 A;  3RYR A;  1Z1D A;  2FBK A;  2Y0M A;  2VON A;  5AIP A;  2LNB A;  1T6S A;  2OBP A;  3DF8 A;  3FM5 A;  1HQC A;  3F8C A;  1U6G A;  4EGY A;  4IXA A;  2FML A;  4I0A A;  3WTY C;  2XV4 S;  1T0F A;  2ZJ2 A;  1JGS A;  3M7G A;  4EJT A;  3K1N A;  3GVA A;  3SHF A;  1IAW A;  2VC1 A;  2QQB A;  2P4W A;  2V1D A;  4S04 A;  1AOY A;  4CXF A;  3SZT A;  2IW5 A;  3F8B A;  1YS6 A; 
#chains in the Genus database with same CATH topology
 4E6K G;  4M9X A;  2EFQ A;  2VQC A;  3HC7 A;  4CCK A;  3Q3S A;  2IS4 A;  2M7B A;  1XGM A;  3WGH A;  2VBX A;  4M3E A;  2JA7 J;  3WTV C;  2EIL H;  2LDU A;  1K78 A;  2W82 A;  3CC4 I;  4WCG A;  1HDD C;  1KGS A;  3BQY A;  4ASN A;  3HOT A;  1SEU A;  3QPT A;  4OIR F;  2WAQ A;  4RB2 C;  5HLH A;  4I02 A;  1WJD A;  1XC5 A;  1PYV A;  3C2G A;  3V8J A;  1OJL A;  2Q2E A;  3HSE A;  1BN5 A;  4XLC A;  3BG6 A;  3RPU D;  1BI3 A;  3LSJ A;  2O7O A;  5E1Z B;  1MBK A;  4HX8 A;  1WVR A;  4WK8 F;  5TRD A;  2CWE A;  4IVN A;  2BYV E;  1Y0U A;  4OIQ F;  4F92 B;  4A3K J;  3OS1 A;  1XDU A;  1APL C;  1GXP A;  2Q2E B;  5F0C A;  3M4O J;  4IRG A;  1NTC A;  3RKQ A;  1XSV A;  1DP7 P;  2Y0S N;  4P9U A;  5J4Y A;  5BMZ A;  3GLX A;  1RRJ A;  4A3G J;  1MIJ A;  2YX7 A;  1U9O A;  2W1O A;  2KIU A;  4BQA A;  2VT3 A;  1X2M A;  3TQN A;  1MBJ A;  3GTQ J;  2ZSH B;  1JGG A;  2LKS A;  1VQP I;  4ENN A;  4A6D A;  5EEG A;  2PFB A;  1J09 A;  1VFC A;  1IN8 A;  4BL0 B;  3ERM A;  2ME6 A;  1ETK A;  3Q9S A;  1FOW A;  1A04 A;  2K9M A;  4KMU X;  1IV6 A;  4KIF A;  3OYI A;  3WU1 B;  4Z6Y A;  3FWE A;  1DU0 A;  1H8A C;  1D0X A;  1P7J A;  2PQ8 A;  2L54 A;  3F8N A;  3ZGK A;  4XKV A;  2QM3 A;  5TJJ A;  5HDG A;  3E6B A;  4CH7 A;  4BXF A;  4I2O A;  3BR1 A;  1Y1W J;  1BJZ A;  3MVP A;  2DFE A;  5B1A H;  4M9Z A;  3H9Q A;  1QPI A;  5KVR A;  3E6C C;  1ZG1 A;  4B43 A;  3L2C A;  3PFY A;  2QKM B;  3PL8 A;  1ZGW A;  5F04 A;  2P81 A;  2NVU B;  5DM6 F;  1FJL A;  1OCC H;  5DCM A;  1N77 A;  1KQ9 A;  5EZH A;  3NWS A;  1C0W A;  4IQ4 A;  5E8I A;  4MIM A;  1GHC A;  2G7H A;  3K7A J;  3H92 A;  4XOT A;  3SFI A;  3VYS B;  5EG0 A;  2M1B A;  1OIS A;  3BTI A;  1IXC A;  1KU9 A;  2PLY A;  3G4S I;  1DPR A;  1ZR4 A;  3KEO A;  1S6L A;  3GF2 A;  2GXA A;  1A5J A;  1SD5 A;  1MMN A;  2CV2 A;  5EG0 B;  4ETS A;  1X1B A;  3DXJ F;  2A61 A;  5F1J A;  3HSR A;  3NRV A;  1W1W E;  1MW7 A;  3H3U A;  1WGX A;  3L00 A;  1SD6 A;  2EWN A;  1X3W B;  1HCR A;  1A6Q A;  4N4O B;  2E2J J;  2I5U A;  3W6J B;  2K86 A;  3HHH A;  4FQG A;  3ZCO A;  4UV9 A;  4BKX A;  3DWL E;  3A0H C;  5M5X J;  4OIN F;  1MMD A;  3ZXS A;  4ZZD A;  5D5X B;  4DW6 A;  3FMQ A;  1FOY A;  1QZE A;  2VI6 A;  3OOU A;  4OOI A;  1PVE A;  5F0F A;  3TO6 A;  3LNQ A;  1OR7 C;  3EDP A;  1YOV B;  1J5Y A;  1HOM A;  4CIC A;  2J5P A;  2K5C A;  3GZN B;  2VOP A;  4YFX F;  1XPX A;  3DLA A;  3ZMV A;  1AU7 A;  2WBM A;  3DKX A;  2JVH A;  2DOF A;  2TDX A;  4ZYE A;  3BPV A;  3QYF A;  4DGW B;  3F8M A;  5LBQ A;  2KIS A;  1JUM A;  5EJC A;  1BBY A;  3MZY A;  3CLO A;  2DW4 A;  3GZ6 A;  3ROU A;  3RSN A;  2NS8 A;  3G73 A;  3X2Q H;  4G8X A;  1IN6 A;  3MWM A;  2BY1 A;  3C2B A;  4MNU A;  3A1Y A;  3ZQI A;  4A3F J;  1QVT A;  1XMK A;  1KZH A;  5DS9 A;  3GTM J;  3MCZ A;  2KDO A;  1WJF A;  4EEF G;  1D1C A;  1ZK8 A;  1R49 A;  2VOO A;  4A2U A;  1YX5 A;  4YII A;  3HHG A;  4B48 A;  2V1N A;  3F8F A;  4M72 A;  1EA3 A;  2FOK A;  4XNF A;  1IDZ A;  4DYQ A;  2JA5 J;  2HTS A;  3FK6 A;  2HYJ A;  4ITV A;  3Q0V A;  4BNC A;  2NVY J;  2CQN A;  3HYI A;  4I7H A;  4I09 A;  1XCB A;  1G3T A;  5LLQ A;  5LFA A;  3B6A A;  1PP8 F;  3TBI A;  2V7F A;  1WRJ A;  2EIM H;  2MFZ A;  3JRI A;  2JK3 A;  2QQA A;  4A0X A;  4F3Q A;  4OIP F;  1VND A;  4ESJ A;  2XKP A;  4YG2 F;  2Y30 A;  2GIV A;  2PJR A;  2F2E A;  2Y48 A;  1T98 A;  4X0G A;  1MZB A;  1TTY A;  4PFO A;  2CG4 A;  3EQL F;  5CVU A;  2MC3 A;  3ABU A;  4D9J A;  3AG1 H;  1JKQ C;  3KCC A;  4LG3 A;  4NC6 A;  2GOX B;  2LSO A;  3JAM Z;  1MBF A;  4HF0 A;  2OAZ A;  2A6T A;  3OYA A;  2RNJ A;  1MGT A;  2D1H A;  3MEX A;  3QU6 A;  4X6A J;  2QKL B;  4CDG A;  3JRF A;  3CCV I;  3QYE A;  2F5F A;  4MO7 A;  3K6G A;  2KPM A;  2ZNZ A;  4I01 A;  1SD4 A;  3C18 A;  1G3S A;  5B1B H;  3I4N J;  3K0L A;  2GM4 A;  1VQ5 I;  2R93 J;  2DT7 B;  1H89 C;  4AIH A;  1UG2 A;  4BQO A;  1ZEL A;  3LL7 A;  2MW8 A;  3DKW A;  3DU5 A;  4CO8 A;  1HKT A;  4N4N B;  4L18 B;  1RNL A;  4QSH A;  2KMU A;  2Z99 A;  2F48 A;  2FA5 A;  3V8K A;  1YLF A;  2RV8 A;  2E2I J;  1WQ2 A;  1HKS A;  2HI3 A;  5ILU A;  1O3T A;  3D5S C;  2QBY A;  1K79 A;  1U8R A;  1PUF A;  3KP2 A;  2A68 F;  5C3E J;  4FT8 A;  4XK4 A;  2VKV A;  3LQQ A;  1R1V A;  1IXS B;  4B4C A;  1LUJ B;  3QOP A;  1ZGA A;  1WH7 A;  3FXK A;  4E4H A;  5CVJ A;  2FJ1 A;  2B9S A;  1FOX A;  2QBY B;  2DFH A;  2KRC A;  3K10 A;  1R5G A;  1ZN2 A;  1PUF B;  2DBB A;  1O57 A;  3K70 C;  1U78 A;  4Y33 A;  4S05 A;  3G1O A;  3JRH A;  1RR7 A;  2FUG 2;  3E5U A;  5HS9 A;  2GOM A;  3PIO F;  1IXR C;  2OC6 A;  2H8W A;  3CCQ I;  2LD5 A;  2ZC2 A;  1WHU A;  3A4C A;  3LOC A;  3L2V A;  2X4H A;  5EEA A;  3KX2 A;  2QZ8 A;  2YS9 A;  3K4M A;  4EM2 A;  2EV6 A;  3AFH A;  2NOJ B;  5D5U B;  2AXL A;  2XUB A;  1BI0 A;  2CUZ A;  1JTX A;  1YW8 A;  2BGC A;  4Q48 A;  3FXJ A;  4M6Y A;  4LMY A;  2YU9 J;  4J19 A;  2V9K A;  1P4X A;  4RGR A;  3H3Z A;  2M4G A;  2V9P A;  1MKM A;  2VE8 A;  1V5G A;  5HNF A;  5E79 C;  4NC7 A;  5D6F A;  2FX0 A;  4I98 B;  3DPT A;  4PJ0 C;  1A31 A;  3OOP A;  3JSO A;  4IQJ A;  3IH2 A;  3MFK A;  3FHN A;  3QOD A;  1G59 A;  3JSP A;  1UZC A;  2BZT A;  3L2Q A;  5IYC J;  2CQK A;  3IH4 A;  4ZDL A;  4XRS A;  3KPH A;  1TQI A;  1JKP C;  3CUQ C;  4RAG A;  4HYE A;  3M8E A;  2H6B A;  2DFI A;  1V3F A;  1AKH B;  1P7I A;  2O0Y A;  3FXQ A;  2DMT A;  4A3J J;  2DA7 A;  2Y75 A;  2FF4 A;  5E17 F;  5LEK A;  3CP8 A;  2XF7 A;  1IN7 A;  1FBQ A;  3JAM K;  4YEL A;  5D8K B;  3AG4 H;  3D5L A;  2XGC A;  3CZ6 A;  1FLI A;  2VKH A;  2ZFU A;  5K5R A;  1FYL A;  3IL2 A;  4HZF A;  5FRM A;  5DUK A;  2WAD A;  4AVZ A;  4XLE A;  1S7A A;  3P5J A;  3I59 A;  4AWX B;  2OF7 A;  1IRF A;  2FRH A;  4GCV A;  3T5X A;  2D45 A;  2BXY A;  2DA1 A;  1GLN A;  3H9J A;  1LEB A;  3CME I;  2K02 A;  3IKV A;  4OAY A;  2ZJP F;  2E7W A;  1ETV A;  1F36 A;  2X6X A;  1GVD A;  2OUM A;  2RC4 A;  4V2F A;  4OIO F;  2CQ7 A;  2M3A A;  3HOZ J;  3HJE A;  1UMQ A;  2DYR H;  1X3U A;  3WOD F;  1W36 C;  3L7W A;  5IOZ A;  3FMS A;  3KYD B;  3PFI A;  2DT5 A;  3TO7 A;  1JUP A;  1U3E M;  4GDF A;  1T38 A;  2IGO A;  1OCZ H;  1FC3 A;  5H2F C;  3WTU C;  4NB5 A;  2ISZ A;  3P9I A;  1YW9 A;  1O7F A;  1W5T A;  5BOX A;  3CP2 A;  1OR7 A;  3HKZ A;  3ASN H;  4G6D A;  1G4D A;  3C3W A;  5J40 A;  3CDI A;  1MMS A;  2X6O A;  5K7Z A;  4AIJ A;  4RM3 A;  3GFM A;  3PNV A;  1ZKG A;  2EZK A;  1G2H A;  3GTJ J;  2AQF A;  5FJ8 J;  2BE5 F;  3OL4 A;  1P4A A;  2CUF A;  2LBF A;  2XB0 X;  3K1P A;  4WX9 A;  3ECH A;  1I1G A;  3RYP A;  2RKH A;  1X4O A;  3CCU I;  2Z9O A;  2OTJ I;  3A0B C;  5ICG A;  4WF2 A;  3ASO H;  3G1M A;  1FBS A;  1QHG A;  3G2B A;  2IS1 A;  3U1K A;  1NH3 A;  2Z1D A;  1BA5 A;  1OQY A;  3DTE A;  3OIO A;  1CGP A;  2Z5U A;  2ZBK A;  5IP6 A;  3VEP A;  3CCY A;  4B44 A;  2LBF B;  4A93 J;  2IS6 A;  3IP4 B;  1TP4 A;  3S1R J;  4H4K C;  4E70 A;  2HYF A;  2BW3 A;  4NHJ A;  2JA8 J;  1QA6 A;  4YEJ A;  4G6T B;  5F0H A;  4LIT A;  3FK7 A;  4HW0 A;  4IHX A;  1BR4 A;  3J7Y J;  2LK2 A;  2UWM A;  3L2R A;  3K4N A;  3VWB A;  4D5C A;  2WB1 A;  2VBW A;  5LRS A;  1ZH5 A;  1WSU A;  2BW3 B;  4KNY A;  3JRB A;  3S3O A;  1LFB A;  4KA4 A;  4HEA 2;  4CYD A;  4PGG A;  1EF4 A;  2ZKZ A;  2L7M P;  3CMM A;  5E1X A;  2O6G E;  1ODD A;  3DFG A;  4L5J A;  3SDG A;  3ZN0 A;  3W2A A;  5KK1 A;  1ITY A;  3BPX A;  4M6X A;  1EH6 A;  1Z3X A;  2XAS A;  1X1P A;  3FXO A;  3CD6 I;  1YO5 C;  1Z67 A;  2HDD A;  3BJA A;  3LA3 A;  2AQE A;  2QWW A;  2FD5 A;  2WAQ N;  1M1E B;  2DTZ A;  2EPF A;  4ESB A;  1HKQ A;  4E7Z A;  1K4T A;  2NYX A;  2D5V A;  1GV2 A;  1ZG5 A;  2DCE A;  1FIP A;  2ESH A;  2ZO4 A;  4YIR X;  1AA7 A;  4XSZ F;  3KYC B;  4IEJ A;  1E3H A;  2JPB A;  4RBO A;  4PCQ A;  2DOA A;  1B1B A;  4DZP A;  2VIX A;  3I53 A;  4XLA A;  3ESW B;  1B6A A;  3OIP A;  3I4P A;  2D1V A;  5JR3 A;  2VKD A;  3Q5F A;  3TW6 A;  1SAN A;  3VOD A;  2DT6 A;  4RDU A;  2R7X A;  3BP8 A;  4HOB A;  4FTH A;  1MMA A;  2R7T A;  1Y56 A;  1BOA A;  3UNG C;  4IPA A;  4HQE A;  2O61 A;  3BR6 A;  1I3Q J;  3HRT A;  2M30 A;  3QQA A;  1D8J A;  4Y7N J;  4XL9 A;  4HSR A;  3CMA I;  3VYU B;  2I8D A;  2R7F A;  1W5C C;  1SAX A;  4FAS D;  5FGM A;  4BEH A;  4BHB A;  4GGG A;  3H5R A;  2RDP A;  4PFP A;  4AU7 A;  4N0B A;  2DA6 A;  1PJR A;  4ZC3 A;  4Y4R A;  4BEH B;  3RTR A;  1SC7 A;  4BHP A;  4HNV A;  2CW8 A;  3OYL A;  5F1R A;  4RS8 A;  1RR8 C;  3HBL A;  4I6Z A;  3LSH A;  3JTH A;  1QO0 D;  1WCM J;  3BLY A;  4CCJ A;  3LAJ A;  3WHC A;  4M6V A;  1UG0 A;  2PMZ A;  2W00 A;  4BGD A;  3EET A;  1H0M A;  2HOS A;  2HTJ A;  4MFE A;  5IY5 H;  4R8H A;  2OZ6 A;  4ENM A;  2VOD A;  3NQO A;  2IT0 A;  1Z3Y A;  2W84 A;  2XGX A;  4L9J A;  3LST A;  3OWT A;  3RZO J;  4D1Q A;  4G12 A;  2IAI A;  5C4J J;  1RI7 A;  3OS2 A;  5DUI A;  3L1P A;  2FMY A;  2B0L A;  3E6M A;  2KJC A;  2WV1 A;  1B9N A;  2JUC A;  5LHH A;  5ERI A;  1TQM A;  2F5C A;  2HEO A;  3CC2 I;  4A0Y A;  3SJM A;  3F21 A;  1VQ7 I;  4A3L J;  4LLN A;  2ZXI A;  2WY7 Q;  2CH0 A;  3GUD A;  5FRO A;  3R60 A;  5LD2 C;  1FMV A;  4L5E A;  1LNW A;  3VB2 A;  1DGR M;  1UCR A;  1O4X A;  3HDD A;  1YG2 A;  1JKR C;  4YFN F;  5D5V B;  3W3C A;  1ON2 A;  4E7H A;  2QSG X;  2ETH A;  1Z0X A;  3DBH B;  4LK0 F;  1TWC J;  4PDK A;  4A6E A;  4MEX F;  3S14 J;  2L3D A;  3CUQ A;  3MD2 A;  3TMO A;  5DV5 A;  1D1A A;  2Z2S B;  2DAO A;  2GQQ A;  1B72 A;  2LH9 A;  5GPA A;  3M1C A;  4J01 A;  2KRF A;  1USS A;  1JE8 A;  1I39 A;  3HRU A;  5GTI C;  1VQ6 I;  1BIA A;  1VQK I;  1YJN I;  1N78 A;  1WZ2 A;  3CUQ B;  4LB6 B;  4KN4 X;  4ZTJ A;  1LEA A;  4EQQ A;  2F5V A;  3PO2 J;  4AID A;  3I56 I;  4DZJ A;  2KLO A;  3ZQH A;  2Y2Z A;  2K9N A;  3J80 Z;  3RKX A;  1HC8 A;  4BE1 A;  3K4K A;  2LTP A;  2QF7 A;  1KYZ A;  3I54 A;  3LSG A;  4FE7 A;  2KFD A;  4UXN A;  1YW7 A;  2LFB A;  2VE9 A;  3CF2 A;  5FFZ A;  3AKZ A;  2JA6 J;  3K9T A;  3CJT B;  5FO5 A;  5ICC A;  1YE9 A;  4BJT A;  2GXB A;  4HV6 A;  2K85 A;  4Q47 A;  3BTC A;  4J00 A;  3JW4 A;  1I3A A;  2E1O A;  1G3W A;  1GVJ A;  4CCM A;  1XGO A;  3MQ0 A;  2XF6 A;  3BQZ A;  1SFU A;  4HNU A;  3ZMD A;  4HDU A;  2EZI A;  4RA2 A;  4IX7 A;  4G9Y A;  4OMY A;  1XG1 A;  3G6E I;  2XRN A;  4QLC U;  3NAU A;  1FBU A;  1T33 A;  2MD5 A;  3IAM 2;  3TDU C;  1B9M A;  2HZD A;  2EIK H;  5EYR A;  3BR0 A;  1MNE A;  3HOS A;  2QQ9 A;  2O03 A;  5LGT A;  1RPW A;  1U0J A;  2MC4 A;  3GZ5 A;  3P9K A;  3D5R C;  4LJZ F;  4WXH A;  1J59 A;  4IOC F;  4BDZ A;  2LF8 A;  5HLG A;  1VF9 A;  4XLH A;  5IOY A;  4BY7 J;  2XSD C;  3W2W A;  1AHD P;  3WE3 A;  2A69 F;  1Z9C A;  3NAR A;  5DCF A;  1UEL B;  3I5U A;  1OYW A;  3BCB A;  2BVL A;  4AM3 A;  4DIQ A;  2K4B A;  1IRG A;  3HTS B;  2IGK A;  2M8E A;  1QPM A;  2LKP A;  4E7J A;  3DEE A;  1D5V A;  2DO7 A;  2IA1 A;  3QRF F;  3R0A A;  3P9C A;  4Q4Z F;  5ED4 A;  4ZZL A;  1CQT A;  2HOA A;  4XID A;  2DJN A;  4EGZ A;  2A3S A;  5KAF C;  4ENK A;  1Y0N A;  4A12 A;  3WG9 A;  1T8I A;  4EJV A;  1JT6 A;  1SVO A;  3CMY A;  4BE0 A;  2XPV A;  2BXZ A;  4KUM A;  3FDY A;  2H6C A;  3B73 A;  4D7M A;  2JN6 A;  4JK1 X;  4UVA A;  2KZG A;  2OA4 A;  2H1K A;  2LRD A;  3GFL A;  2XAG A;  3OYC A;  1MMG A;  2R0Q C;  3FXU A;  4BY1 J;  1U9N A;  1IV8 A;  4HAM A;  3J80 K;  5BPD A;  5J8F A;  4ENJ A;  1KYW A;  2R7Z J;  2TCT A;  2XKO A;  4XN0 A;  4UUS A;  1HA8 A;  3HB9 A;  2DPD A;  2IRF G;  3ZMT A;  4GYI A;  3J7Z I;  5L3E A;  3PM1 A;  1ZHF A;  4M9S A;  4X1E A;  3CCM I;  2EIJ H;  3G3Z A;  5FKM A;  2DPU A;  3HOY J;  2GA1 A;  3QPL A;  1TC3 C;  2EFW A;  2DOD A;  1DQU A;  2IP2 A;  5J8C A;  4UUS B;  2F5E A;  4KIS A;  2EH3 A;  1ZRD A;  2VBY A;  2NOG A;  1FWZ A;  5AON A;  4L0Y B;  2JWT A;  3HG9 A;  4G7O F;  1R4M B;  3HUG A;  2KZV A;  2IBD A;  4QPQ A;  3JRA A;  2HVS A;  2R4G A;  4EM0 B;  1P92 A;  4C2T A;  3G1L A;  5B66 C;  2M45 A;  2M7A A;  1R1U A;  2CV1 A;  2VPR A;  3IUO A;  3HUG B;  2VJ4 A;  2X6W A;  3I4M J;  1TWA J;  4BQQ A;  3E6D A;  1U5T C;  4LOC A;  4KT5 C;  4BBS J;  4PJL A;  2FXA A;  1LVA A;  4IHV A;  2XF5 A;  1ZAO A;  1JJ8 C;  2L4A A;  1S5L C;  1NHA A;  2L01 A;  3BDD A;  3BTL A;  2PJP A;  2R3S A;  2FSW A;  1MDM B;  2JMW A;  4P1W A;  4JBA A;  2KJB A;  2R5Z A;  1XN7 A;  4L9N A;  2GAU A;  2OQG A;  4UVC A;  4CCN A;  1VQN I;  2PI0 A;  2CUE A;  4AVP A;  2V6E A;  5HLT A;  1YI2 I;  2CU7 A;  1SFE A;  4C3J J;  2V6C A;  3P7N A;  4HX7 A;  1MJB A;  2JTV A;  3OIQ A;  4RGU A;  2R5Z B;  3E5Q A;  3EYI A;  1FSH A;  1R36 A;  4ZYA A;  2DQL A;  3LFK A;  2L4M A;  3IHU A;  2VLA A;  1TNS A;  2WAE A;  4XLN F;  1HDP A;  4B3A A;  2DXI A;  3HPH A;  1FP1 D;  3PNY A;  2LR8 A;  5FB2 A;  2E5N A;  2W24 A;  1S7E A;  5EZG A;  2IGM A;  4FE4 A;  4BDY A;  3QPH A;  5E3L A;  1LE8 A;  1IG7 A;  1UHW A;  5CLS A;  5EEH A;  2VKE A;  4ZYG A;  1UJ8 A;  2JZY A;  3FXM A;  1E0E A;  1ON1 A;  2GZW A;  4HLX A;  4Y52 J;  3ZQG A;  1R1T A;  1W7P A;  2W85 A;  2YPR A;  3VYR B;  4FX4 A;  2LC2 A;  4A3D J;  3DQV C;  1J0R A;  3LWF A;  5JI6 A;  1LE8 B;  3L09 A;  3SEQ A;  1D0Z A;  3E5X A;  4V19 K;  4AIK A;  1MSF C;  1HSJ A;  2E2H J;  4KJZ A;  3TKY A;  1W7P B;  1L0O C;  1RKT A;  3ZRG A;  5IPA A;  1ZRF A;  5FLX Z;  4ABZ A;  3WG7 H;  4RLF A;  1I5Z A;  1XTA A;  2XPU A;  4II2 A;  4M73 A;  3IC7 A;  1VI0 A;  4LIV A;  2W7N A;  3A02 A;  1Z6T A;  4GXO A;  5E20 A;  1IRZ A;  2F6C A;  3KIO A;  5HDN A;  3WGG A;  1SVL A;  4XQF A;  2E1C A;  3HKZ N;  3TDZ C;  3O3K A;  2K7L A;  2WC2 A;  5FD6 A;  2ZCW A;  3LA2 A;  2STW A;  3OYF A;  2CW0 F;  3SXY A;  2DFF A;  2R7R A;  2XGD A;  2EA4 A;  3I55 I;  4G7H F;  3RZD J;  2B63 J;  1WKM A;  3CF5 F;  3A01 A;  5GAE J;  1H9T A;  2LLK A;  4P55 A;  1I27 A;  1ZQ3 P;  1ZTR A;  2UXX A;  5D5W B;  1ETY A;  3OYE A;  3EUH C;  2IGN A;  2UZK A;  4XRF A;  2JJ7 A;  1WI3 A;  1OYI A;  1QGP A;  2QVO A;  3A01 B;  3MKY B;  3D0S A;  5CKT A;  2MLK A;  1XDS A;  3PSF A;  1I6X A;  4KIB A;  2PN6 A;  2MAB A;  2MG4 A;  5DD4 A;  3VPR A;  3IAS 2;  3JTG A;  2A6E F;  2Y9Y A;  3DTI A;  3GXO A;  3BR3 A;  5CVI A;  3GTP J;  5JHF A;  5IT9 Z;  2ZXJ A;  4BAY A;  1CF7 A;  4RAF A;  4RMN A;  5KHD A;  3H35 A;  2DU9 A;  3MN2 A;  1QZY A;  1LDK B;  1RZ4 A;  2WB1 N;  3F3X A;  5C4X J;  4JOM A;  5HNH A;  4HF1 A;  3BZ6 A;  1JUS A;  5J1Y A;  5C44 J;  1OYY A;  2ISY A;  1BR1 A;  2A05 A;  3F9K A;  1CF7 B;  5K5O A;  1RUO A;  5H6R A;  2P5L C;  2Q8K A;  5A2Q Z;  1U2W A;  1JKO C;  3WTT C;  4NC8 A;  5H6Q A;  1F5T A;  2F5D A;  2VUM J;  5JFR A;  1NK3 P;  4KMF A;  2KIM A;  1F1Z A;  1R7J A;  5HDK A;  3SDB A;  5M3M J;  5L3G A;  3H0G J;  3HL2 A;  1S7O A;  3BOQ A;  2VJJ A;  2E71 A;  3S3N A;  2P7V B;  3DU6 A;  3J7A Y;  2BVM A;  2CW7 A;  2K9Q A;  4IRH A;  2A5Y B;  2HWV A;  3BCA A;  3L2W A;  1Y6I A;  4Q5S F;  1VQ9 I;  2HOE A;  1MBH A;  5B3S H;  1AKH A;  5F6F A;  2JSP A;  4DBQ A;  1H9G A;  2XSJ C;  4M3F A;  4C3H J;  4MLO A;  2I10 A;  2MLG A;  3E1S A;  5FLX K;  3HRM A;  1QQI A;  2D2W A;  2F4M B;  1T95 A;  1UST A;  2EV0 A;  4CA0 A;  4IHS A;  2MA3 A;  1RUN A;  1LVK A;  1ZAR A;  4HA8 A;  2MH9 A;  3TGN A;  3GCM A;  4O5V A;  1TT0 A;  2F4I A;  5EDN A;  3HPG A;  2DA3 A;  1HW1 A;  5DYM A;  2STT A;  1X1A A;  2L7F P;  1TW3 A;  4ESF A;  4BAC A;  1VQM I;  1ZRC A;  3ERE D;  3LAP A;  2XDV A;  1S3J A;  4O6J A;  3S1Q J;  2OCC H;  2RVC A;  1X2N A;  1FOK A;  5BS6 A;  1OKR A;  3BG7 A;  3BJ6 A;  2IVM A;  4KFC A;  1ZR2 A;  4NBQ A;  1T0F C;  3O8G A;  2FEZ A;  3I9V 2;  4KT6 A;  3K2Z A;  1YTY A;  5J6X A;  2PMZ N;  2QGU A;  4E7L A;  4IKF A;  1QZZ A;  1V4R A;  1DDN A;  5ICE A;  2OJE D;  4AD9 A;  1D8K A;  4UUV A;  5ILS A;  3HOW J;  3BZK A;  4PJN A;  3W6V A;  2W4S A;  1X4P A;  3ABM H;  1ETW A;  1FT9 A;  3AAF A;  4BJ6 C;  3SQN A;  2L9V A;  1RKW A;  3FBN B;  3OS0 A;  5IT9 K;  4L9V A;  2WWY A;  5GAD J;  2Q1Z B;  1RIO H;  2VQH A;  4LD5 A;  3S3M A;  3FKI J;  5CVR A;  2DJI A;  3HM5 A;  1U5T B;  1TT5 B;  4M3B A;  3VSL A;  3QPS A;  1Y8Q B;  2ADU A;  4CSW A;  3O2P E;  2HR3 A;  1D5Y A;  5D6E A;  3TO9 A;  4BU2 A;  2OD5 A;  5J1U A;  5A2Q K;  1PUE E;  3COA C;  2O8K A;  2CRG A;  2WTE A;  3K69 A;  1MJA A;  2R92 J;  2BY0 A;  2BV6 A;  4EVI A;  2K27 A;  1SMT A;  5KNL A;  4Y3O A;  4L0Z B;  2Z3Y A;  3UR3 C;  1BW6 A;  4PGH A;  4JQF A;  1XS9 A;  1KA8 A;  1HW5 A;  2DYS H;  3HEF A;  1IC8 A;  3J7A O;  3GO5 A;  4C2M J;  3RDI A;  3LSK A;  3TP3 A;  5BQT A;  1EKE A;  1BI1 A;  5K1Y A;  2QCO A;  3ECO A;  5IYB J;  1TLH B;  2HGC A;  2BHZ A;  4P5O A;  5DM7 F;  2KKO A;  5J47 A;  2V9V A;  3GX4 X;  2AO9 A;  4MHG A;  4H0E A;  1R71 A;  3KZZ A;  4CYC A;  5J3L A;  3DBL B;  4XON A;  3K4L A;  4ZDO A;  3MKZ A;  4D5F A;  1GDT A;  1QNT A;  4FET A;  2RQP A;  4XR6 A;  2VJI A;  2GXG A;  3OR2 C;  2FOW A;  1EH8 A;  2JRM A;  2VQG A;  3E97 A;  2QYO A;  4CYC B;  1UB9 A;  4CGZ A;  3I71 A;  3V7R A;  3WU2 C;  4PSX A;  5J1R A;  1S72 I;  2WY8 Q;  4XLP F;  2V1X A;  3SFZ A;  4NDL A;  1ORK A;  3O8H A;  3GTG J;  4QTR A;  2M87 A;  1ONV A;  3BG5 A;  3VOE A;  1EV7 A;  3NEU A;  2XAQ A;  2FBH A;  2EV5 A;  1IN5 A;  1MJ9 A;  2G7U A;  3CES A;  2DDA A;  4RLQ A;  1Z05 A;  2X1C A;  3EUA A;  4HV5 A;  3V8L A;  5J4V A;  3JRC A;  5KAI C;  3F22 A;  2ELK A;  4BS9 A;  3R0J A;  4WWC A;  4LLG F;  4ANJ A;  4G7Z F;  4V2G A;  2HS5 A;  4UB8 C;  1G3Y A;  1QVU A;  5D4S A;  2VPL A;  1FY7 A;  3OSF A;  1J75 A;  1P6R A;  1YJW I;  2ID3 A;  5LGN A;  2VXZ A;  5FLM J;  2E7X A;  4Y17 A;  2W48 A;  1I1S A;  3TOB A;  3H5N A;  3HXL A;  4DQ2 A;  2HXO A;  3PSI A;  2QQ8 A;  2PEX A;  2Y9Z A;  5HOD A;  3ULQ B;  1QU3 A;  4A5M A;  3BTJ A;  3K4B A;  4KYW A;  3FZV A;  2NNN A;  5LHG A;  2KIQ A;  4MEY F;  1XX5 A;  2HQN A;  3I58 A;  4HDV A;  6PAX A;  4WXD A;  4C2U A;  1Z77 A;  1T56 A;  2F4O B;  1GT0 C;  2XB5 A;  2M2E A;  1R23 A;  2JQ7 A;  4L9T A;  3KZY A;  5CQE A;  1WJA A;  3HZJ A;  2MGQ A;  2HDC A;  4RGS A;  1WI9 A;  4RAY A;  3E0J B;  3V7S A;  2K3P A;  3PQK A;  3KEY A;  3DP7 A;  2L5Q A;  2P8T A;  2E5Z A;  2O3F A;  1N75 A;  2L9S A;  1A36 A;  1IF1 A;  1XSD A;  3CJQ B;  3K2A A;  4FHT A;  2ELH A;  4MQ9 F;  4JX5 A;  3BG3 A;  2RAE A;  2DDB A;  5LRR A;  2LY1 A;  3RJP A;  2LY9 A;  2M9H A;  4F7Z A;  4U7D A;  1TW2 A;  3F23 A;  2O9L A;  1W4M A;  4XIC A;  4CZC A;  3QOE A;  4HPQ A;  2W25 A;  3MKL A;  3M9A A;  1F9N A;  1YX3 A;  2ZB9 A;  5ILV A;  3EPZ A;  1LJ9 A;  1P4W A;  2DTR A;  4YIF A;  2HQA A;  3F0C A;  3GME A;  2ZME C;  2C6Y A;  2RNG A;  1N25 A;  2LVS A;  2M34 A;  1YRN A;  4G6Q A;  1XMA A;  1MND A;  4CHU A;  3M8J A;  5L3D A;  1SVM A;  2BBY A;  2P6S A;  4AYB A;  1O3R A;  2XIG A;  2JUG A;  3DEU A;  1UHM A;  3ABK H;  4G94 A;  1OCT C;  2CJJ A;  2E19 A;  2R7O A;  1YRN B;  4A5N A;  3A2K A;  1X58 A;  2M0C A;  3CO7 C;  5GPC A;  2YX4 A;  4Z2Y A;  1YIO A;  4UUT A;  2L0K A;  2XGE A;  1GXQ A;  3JRD A;  1WJC A;  1Z91 A;  1DU6 A;  1J9I A;  3WTW C;  1IN4 A;  2R7W A;  4HX4 A;  4OAZ A;  1L3L A;  2WV0 A;  2Z33 A;  2MH2 A;  2O8X A;  1TBX A;  3LSM A;  2X0L A;  3I3L A;  1X3Z B;  2EB7 A;  3Q0U A;  4IJA A;  4B3X A;  2P6T A;  3HGY A;  1ACI A;  4IHT A;  1FTZ A;  2FU4 A;  1RC9 A;  2K40 A;  3S1N J;  1YHQ I;  5EGO A;  3DCF A;  3HOX J;  4UNO A;  2KDZ A;  3CO6 C;  2A5W A;  2DA2 A;  5D4R A;  2VL8 A;  2HPM A;  4OMZ A;  2VB6 A;  5F08 A;  5CYV A;  3J81 Z;  2H09 A;  5BNG A;  5EGO B;  3GFI A;  1VTN C;  2XPW A;  3ONQ A;  1W5S A;  4HG2 A;  3SEZ A;  3QAH A;  2PMH A;  2G0E A;  2KIF A;  1NG7 A;  4CZZ A;  4RB0 A;  3FXR A;  2E36 A;  3WE2 A;  3IWF A;  1E17 A;  4FX0 A;  1K78 B;  2RQQ A;  3HTU A;  4CCO A;  3BR2 A;  1K4S A;  4QWQ A;  3L9F A;  3ZMZ A;  2DMN A;  2VXD A;  2EFO A;  3DKY A;  1VQL I;  3K4J A;  1DP3 A;  1R4N B;  2EFP A;  1FP2 A;  3U21 A;  2YSR A;  1D1B A;  2X51 A;  1V55 H;  1H88 C;  3WHB A;  2IXS A;  2OQR A;  1YJ9 I;  2P5K A;  4BJ5 C;  2RGV A;  1FEX A;  3LQR A;  4HF2 A;  2WA0 A;  1R9T J;  3GEZ A;  3SZG A;  1IUF A;  1ETQ A;  3ELK A;  1GUU A;  2PX9 A;  2FQ4 A;  5JLX A;  2JSC A;  4B09 A;  3AL0 C;  1FNN A;  1FPQ A;  3H36 A;  3KYL A;  4ZYD A;  1ZRE A;  2KQR A;  2OV7 A;  1Z21 A;  3V4G A;  3JCU C;  2B7E A;  4KDP A;  1A35 A;  3FBI B;  4U0Y A;  2XAF A;  4HNT A;  5JLW A;  1XSX A;  2DLL A;  3DTK A;  2NAZ A;  1QRY A;  2GWR A;  4IL6 C;  3PO3 J;  2YR2 A;  5HS8 A;  3JR9 A;  1KU3 A;  5E8G A;  4LB5 A;  2DI3 A;  2EJR A;  2Z16 A;  1U8B A;  2HZT A;  2LRE A;  4D7N A;  3ZQ7 A;  1P9Q C;  2YU3 A;  3DBR B;  3KP5 A;  2M0M A;  2R7D A;  3N05 A;  2QA4 I;  4ON0 A;  4R1H A;  1OCO H;  2DK8 A;  3TOA A;  4LK1 F;  2XVC A;  3CC7 I;  1GV5 A;  1E2X A;  4MTE A;  1BM9 A;  1SFO J;  2COB A;  4UHT A;  4M3D A;  1RET A;  3F72 A;  2L02 A;  1I50 J;  2ME0 A;  3ZPL A;  4QIW N;  3HSF A;  2CGP A;  2EFN A;  1IZ1 A;  3QP6 A;  3ZOB A;  1ETO A;  5K5Q A;  4C9Y A;  2G9W A;  1OCP A;  3ZQQ A;  3OY9 A;  5CVV A;  2NNY A;  3CQZ J;  4AC0 A;  3RPQ A;  4OU0 A;  4FIS A;  4EAT A;  2V79 A;  2IS2 A;  1O3S A;  4JX4 A;  4IRI A;  3GBG A;  4Y15 A;  2CFO A;  3S15 J;  2H1L A;  3BWG A;  4CUG A;  3REO A;  2E35 A;  4A3I J;  2HQ5 A;  4RGX A;  3VSK A;  3KFW X;  1MDM A;  2IA0 A;  1R58 A;  3QYB A;  3J81 K;  3K70 D;  4Y13 A;  1P2F A;  5DCM B;  4GO1 A;  4DJA A;  1R00 A;  4LFU A;  3ZQC A;  2HVR A;  1STZ A;  1WPK A;  1E3P A;  3V42 A;  5CQG A;  3IRR A;  2R7U A;  4DOZ A;  3F6V A;  4E7S A;  2JPC A;  5M5W J;  1LDJ A;  3WTZ A;  1YFH A;  3KLN A;  2QSH X;  3E3V A;  1T2K A;  4UVB A;  4O3M A;  1YS7 A;  1BI2 A;  2HQR A;  3CCE I;  2IJL A;  5EF6 A;  3OL3 A;  3C2H A;  1JT0 A;  1ENH A;  2OTL I;  5JHU A;  4ZTF A;  2ZJR F;  1OCR H;  1LPQ A;  4GRI A;  2MD0 A;  2VBZ A;  4GYG A;  3CDL A;  2DK5 A;  1EJ9 A;  1YYV A;  1MSE C;  1D3Y A;  2HVQ A;  4PK4 A;  5DEQ A;  1SMY F;  1B59 A;  2NS7 A;  3C7J A;  5FKL A;  5DDG A;  1LFU P;  5K7F A;  1KON A;  2JRT A;  2KP6 A;  1O7L A;  1X1C A;  1KQ0 A;  4LLL A;  3OYJ A;  3UKG A;  1K61 A;  5GAH J;  1TWH J;  1NK2 P;  2M8G X;  4A69 C;  2DQR A;  3WTS C;  4NNJ A;  1T39 A;  4PSW A;  2L2O A;  1W0T A;  1ERD A;  1R5H A;  3FM3 A;  4KN7 X;  2ZME A;  3T8T A;  3DPU A;  4MTD A;  1FYM A;  2DMP A;  4HLY A;  2BHY A;  2CSO A;  2TRT A;  3KE2 A;  3BG9 A;  5AIQ A;  1SD7 A;  1FYK A;  3ML6 A;  3EYY A;  1HXD A;  2UXN A;  3OMY A;  5L3B A;  4MGR A;  3KLO A;  2HPI A;  2ZME B;  2FQ3 A;  4JX6 A;  4A3B J;  3S8P A;  2LP0 A;  5FFX A;  3S2W A;  3EUK L;  2LYC A;  3GLL A;  3GW2 A;  4ZYH A;  4PJJ A;  1W0U A;  2X1D A;  1V5F A;  5E3M A;  5JVG F;  2Y0S A;  1WJE A;  4BYY A;  3M8F A;  3BRO A;  1Y1V J;  5H20 A;  4DYC A;  1W36 D;  3I64 A;  3E7L A;  2L7K A;  3RKY A;  2QEN A;  4UY8 I;  2VT2 A;  4W1U A;  2K9S A;  4HBL A;  3QP5 A;  4B8X A;  1BW5 A;  3U9G A;  3VDX A;  3S1M J;  1ZG3 A;  2PMU A;  1Y39 A;  4NUB A;  3B6C A;  3PUF A;  3OV8 A;  1HW2 A;  1XCV A;  1MBG A;  1AWC A;  2JT1 A;  1KU2 A;  2A6H F;  3MZ8 A;  3MAJ A;  3PUB A;  2Y69 H;  3MZH A;  3H0D A;  3IH3 A;  4M71 A;  5JVT A;  3RKW A;  4KIG A;  3CCR I;  2P5V A;  3LSI A;  1VQ4 I;  2ZXW H;  5IT3 A;  2K3F A;  4XRS G;  5IP9 J;  1UHS A;  5E1W A;  4IO9 F;  4CCL A;  2R5Y A;  1OFC X;  1HLV A;  4JP0 A;  3T8R A;  2ZJQ F;  3VFZ A;  3CCS I;  2PJR B;  1JHF A;  4PUS A;  1XGN A;  2GIZ A;  4XLF A;  1B4A A;  1BJA A;  2XAJ A;  3M1E A;  2UUZ A;  4A3C J;  2K4J A;  1BIB A;  2UV1 A;  3CDH A;  5FKN A;  4K2E A;  1I6H J;  2R5Y B;  2MSY A;  2ZSI B;  3LA7 A;  2IEK A;  1JHH A;  4E7I A;  3W2V A;  4F91 B;  4A3M J;  2ZXH A;  3KP7 A;  1X1D A;  2E1M C;  2LKX A;  2L7Z A;  2YUS A;  2HNH A;  2BEO A;  4XM3 A;  1XMX A;  3FXL A;  1UFM A;  1Z7U A;  3KP3 A;  2CUJ A;  4M74 A;  3GTK J;  1OLT A;  1F43 A;  3CLQ A;  3DV8 A;  3QU3 A;  3U2R A;  1O3Q A;  2AXT C;  3PNT A;  5FRN A;  4RB3 C;  2NXN B;  4BE2 A;  3KZI C;  4RAZ A;  2HKO A;  2VJ5 A;  2HDW A;  5LEJ A;  4B47 A;  1S29 A;  1D0Y A;  1OMI A;  2QUF A;  2ACJ A;  2CQQ A;  2FE3 A;  4XMY A;  3DPL C;  2R7Q A;  1FZP B;  5D8L B;  1FSE A;  4DNC A;  1F4K A;  1LDD A;  2RN7 A;  2BOL A;  5FKO A;  1ZYR F;  3V7C A;  4B1R A;  2X6Y A;  5GP9 A;  4I76 A;  2V1U A;  3RCO A;  3AL0 B;  4XN3 A;  1RES A;  2EZL A;  2OZU A;  2VN2 A;  1SFK A;  4XRM A;  1DUX C;  4HRI A;  1R6R A;  5M5Y J;  4F52 A;  3M3Y J;  1ETX A;  5HOO A;  2P0W A;  1BC7 C;  3ZQL A;  2DA5 A;  1WFX A;  3OYN A;  1HF0 A;  3VYT B;  3ZMU A;  2XRL A;  3BJO A;  3DEW A;  3TW7 A;  3MMY B;  2GA2 A;  4YRV A;  2NVQ J;  4KIT B;  4HQM A;  4UV8 A;  1JJ6 C;  3R6S A;  3BZC A;  3LFU A;  3OYD A;  3HOV J;  4XKW A;  1YIJ I;  5K7H A;  2KRH A;  4P9F A;  4LG0 A;  4EJU A;  4I0B A;  4BH9 A;  3CTA A;  3KP4 A;  4I99 C;  3N97 A;  2CQX A;  2ID6 A;  2NVX J;  4BXU A;  2NS0 A;  1K6Y A;  2FNP A;  2LF7 A;  3AG3 H;  4F93 B;  2HXI A;  3WU0 A;  4EJO A;  5BPI A;  3KEQ A;  2PBI A;  2AHQ A;  3S93 A;  2R7V A;  5M3F J;  1IUY A;  1TNT A;  3K4C A;  4LG0 B;  2AS5 F;  1HST A;  2J5O A;  5FLV A;  3CUO A;  2DA4 A;  4KIC A;  2DMQ A;  3S32 A;  3KP6 A;  3GWZ A;  2DMU A;  1KU7 A;  4RB1 A;  3QWL A;  1IRX A;  1DPU A;  2ZFW A;  1U5T A;  1JTY A;  4BHC A;  4R79 A;  1ULY A;  2KL4 A;  3FIW A;  1IO2 A;  1JI8 A;  3FHZ A;  1Q1H A;  2EZH A;  5FKK A;  4W97 A;  2OPT A;  2CO5 A;  1IW7 F;  5LGU A;  3TED A;  5LHI A;  3OYG A;  3JRE A;  4N9H A;  3I59 B;  2P7C B;  2ELJ A;  1J2X A;  2NRA C;  3R4K A;  1YIT I;  2ICW G;  1MD0 A;  1S8N A;  3A03 A;  3FF5 A;  3MKW B;  4D0P A;  4U0W A;  3T0Y A;  4F55 A;  1BR2 A;  3CJN A;  3FKJ A;  3U1D A;  4MQV A;  2FBI A;  2HU9 A;  3OR1 C;  1WH5 A;  2M5W A;  2CFX A;  3NWT A;  3K1M A;  1LB2 A;  4LIU A;  2FNA A;  4AYB N;  2EK5 A;  3CCJ I;  1TZL A;  2HKX A;  3RQI A;  4FCY A;  2HYG D;  3I0T A;  2EIN H;  4OWR B;  1BC8 C;  3GTO J;  2DN0 A;  2XAH A;  4XBF A;  1K7A A;  5HVQ C;  1W7P D;  4DBR A;  3H1C A;  3G71 I;  3OYM A;  4QPO A;  3RPU A;  2V26 A;  3KET A;  1LKX A;  1V5E A;  1ZGJ A;  4PZJ A;  4P96 A;  4E7K A;  4ZJZ A;  1LQ1 A;  4IHY A;  1K6O A;  5ICF A;  4ZDP A;  4U88 A;  3FIS A;  4II3 A;  1XB4 A;  2JA2 A;  3T1B A;  3AG2 H;  3ZP5 A;  2CS3 A;  1FX7 A;  1PDN C;  3HIF A;  3CCL I;  2CYY A;  1REP C;  2ZNY A;  4PJM A;  4S0H B;  2MYS A;  3ISP A;  4AUX A;  3B02 A;  3BR5 A;  4ZH4 F;  3FMR A;  3TP0 A;  1VQ8 I;  4LGW A;  1ZLJ A;  5HS7 A;  2EQR A;  3S2D J;  1G8X A;  5DD8 A;  2EA2 A;  3C1D A;  4IF4 A;  1PP7 U;  3OYB A;  3S17 J;  1KQ8 A;  4DYR A;  1WJ5 A;  3Q9V A;  3PJR A;  4XKC A;  2KHM A;  2VC0 A;  3HRS A;  4C30 A;  1R22 A;  2H8R A;  2A07 F;  2XAU A;  3BT9 A;  3HOU J;  4U87 A;  2H27 A;  2OCE A;  4JYK A;  1JXS A;  3SZP A;  3LMM A;  3S2H J;  1IGN A;  3GYH X;  3H5A A;  5GTH C;  5FD5 A;  5L3F A;  2E34 A;  4BQN A;  3R61 A;  3DLL F;  3GFJ A;  1IDY A;  2VQL A;  3EUH A;  3BY6 A;  2Q0O A;  1QBJ A;  2H94 A;  1XGS A;  4XKB A;  3S16 J;  5TIS C;  2EBI A;  2N8G A;  4NQW A;  4BBR J;  2BY2 A;  2LMD A;  3IRQ A;  3ZN1 A;  3L2U A;  2GBY A;  4MFD A;  5F64 A;  2QLZ A;  4L5I A;  5TGT A;  4A0Z A;  3CJR B;  2GLO A;  1Z7L A;  2V4J C;  4EMS A;  3ABT A;  1ZLK A;  1S9H A;  2ECC A;  1T08 B;  2PG4 A;  3Q0W A;  1VQO I;  1WWX A;  3H9G A;  1SAU A;  1Z6R A;  3RQ4 A;  3IV5 A;  1A6I A;  4NQW B;  1G6N A;  3W6K B;  5L3C A;  2COM A;  1FTT A;  4XOR A;  2R7S A;  2OU2 A;  3PQJ A;  4C3I J;  3F6O A;  1B8I A;  2HOT A;  3GTL J;  3O6B B;  1FMW A;  1Y8R B;  3ZR8 X;  2L9R A;  1X19 A;  3WGI A;  2W57 A;  1J7K A;  1XD7 A;  3IWZ A;  1MH3 A;  5KCM A;  2E60 A;  2LY2 A;  2NVT J;  5CJ9 A;  2DOE A;  4XSX F;  2E1N A;  1B8I B;  2MBF A;  4YFK F;  2ECB A;  2RRE A;  2JVG A;  2E1M B;  3FX3 A;  2KT0 A;  2LOO A;  2ESN A;  3ZQF A;  4U0V A;  4EV0 A;  2CV0 A;  3LSP A;  1EH7 A;  2LG4 A;  4TV7 A;  4U7B A;  4WXC A;  4IZZ A;  3JRG A;  4HST A;  2X9D A;  1HBX G;  1IJW C;  4RM2 A;  3PIP F;  4EJW A;  2HFH A;  1TWF J;  1MBE A;  1R5I D;  1WJB A;  2IA2 A;  2X48 A;  2Y31 A;  3RIR A;  2K9L A;  1TQP A;  3WTX C;  5HLI A;  3OSG A;  2XHK A;  1VZ0 A;  3IKT A;  1SFX A;  2X85 A;  3N4M A;  5E18 F;  3ABL H;  1OPC A;  4M3G A;  2XRO A;  1E3O C;  2BY3 A;  4N9I A;  5F27 A;  1YQA A;  3ZMS A;  1BL0 A;  3H3V K;  2IPQ X;  2QEX I;  5IYD J;  1NG6 A;  4EM1 A;  3RI4 A;  3RYR A;  1Q1V A;  1Z1D A;  2FBK A;  2Y0M A;  5GAG J;  5E3O A;  2VON A;  1MH4 A;  5AIP A;  3TL4 X;  2LNB A;  5CPR B;  2QSF X;  1T6S A;  2OBP A;  4UB6 C;  3DF8 A;  1V54 H;  5DTD A;  5B5E C;  3FM5 A;  5E3N A;  3BC8 A;  1LFP A;  1TL8 A;  1HQC A;  4A3E J;  3F8C A;  1U6G A;  4XOP A;  1FIA A;  4IXA A;  4EGY A;  1TWG J;  3OYK A;  1MNM C;  2FML A;  4GFB A;  3HGG A;  1BOB A;  4I0A A;  3WTY C;  2XV4 S;  3LSR A;  1T0F A;  4IHW A;  2L9N A;  1DGW Y;  2ZJ2 A;  1JGS A;  2WAF A;  3D1N I;  2X1E A;  4IOA F;  2VAS A;  2CMP A;  3M07 A;  2XC7 A;  3M7G A;  4EJT A;  4BXX J;  3K1N A;  3GVA A;  3SHF A;  1IAW A;  1B72 B;  9ANT A;  2VC1 A;  2QQB A;  2P4W A;  2V1D A;  4S04 A;  1AOY A;  5IP7 J;  4CXF A;  3SZT A;  2O5R A;  1K83 J;  1POG A;  2IW5 A;  3F8B A;  1YS6 A;  1UAA A;  1QHH D;  3OYH A;  2M4K A;  3SYT A;  4BUP A; 
#chains in the Genus database with same CATH homology
 4M9X A;  2EFQ A;  1XGM A;  3WGH A;  2VBX A;  3WTV C;  2LDU A;  1K78 A;  4WCG A;  1KGS A;  4ASN A;  3HOT A;  3QPT A;  4OIR F;  4RB2 C;  5HLH A;  4I02 A;  3V8J A;  2Q2E A;  3HSE A;  1BN5 A;  1BI3 A;  5E1Z B;  4HX8 A;  4WK8 F;  5TRD A;  2CWE A;  4IVN A;  2BYV E;  1Y0U A;  4OIQ F;  1XDU A;  1GXP A;  4IRG A;  1XSV A;  1DP7 P;  4P9U A;  5BMZ A;  3GLX A;  2YX7 A;  2KIU A;  4BQA A;  2VT3 A;  3TQN A;  4ENN A;  4A6D A;  5EEG A;  2PFB A;  1IN8 A;  3Q9S A;  1A04 A;  4KMU X;  4KIF A;  3WU1 B;  3FWE A;  2PQ8 A;  2L54 A;  3F8N A;  2QM3 A;  5TJJ A;  5HDG A;  3E6B A;  4I2O A;  4M9Z A;  5KVR A;  3E6C C;  1ZG1 A;  3L2C A;  5DCM A;  1KQ9 A;  1C0W A;  5E8I A;  1GHC A;  2G7H A;  3H92 A;  2M1B A;  1IXC A;  1KU9 A;  2PLY A;  1DPR A;  3KEO A;  1S6L A;  3GF2 A;  1SD5 A;  4ETS A;  3DXJ F;  2A61 A;  3HSR A;  3NRV A;  3H3U A;  3L00 A;  1SD6 A;  2EWN A;  3W6J B;  2Z9O A;  2K86 A;  3HHH A;  4UV9 A;  4OIN F;  4ZZD A;  5D5X B;  3FMQ A;  4OOI A;  3TO6 A;  3EDP A;  1J5Y A;  4CIC A;  2J5P A;  2VOP A;  4YFX F;  3ZMV A;  2TDX A;  4ZYE A;  3BPV A;  3F8M A;  5LBQ A;  1BBY A;  3MZY A;  3CLO A;  2DW4 A;  3GZ6 A;  3ROU A;  3G73 A;  4G8X A;  1IN6 A;  3MWM A;  4MNU A;  1XMK A;  3MCZ A;  2VOO A;  4A2U A;  4YII A;  3HHG A;  3F8F A;  4M72 A;  2FOK A;  2HTS A;  4BNC A;  3HYI A;  4I7H A;  4I09 A;  1XCB A;  1G3T A;  5LLQ A;  1PP8 F;  1WRJ A;  2QQA A;  4A0X A;  4OIP F;  4ESJ A;  2XKP A;  4YG2 F;  2GIV A;  2F2E A;  2Y48 A;  1T98 A;  1MZB A;  1TTY A;  2CG4 A;  3EQL F;  5CVU A;  2MC3 A;  3ABU A;  3KCC A;  2LSO A;  3JAM Z;  4HF0 A;  2OAZ A;  2RNJ A;  1MGT A;  2D1H A;  3MEX A;  3QU6 A;  4CDG A;  2F5F A;  2ZNZ A;  4I01 A;  1SD4 A;  3C18 A;  1G3S A;  3K0L A;  4AIH A;  3DKW A;  1HKT A;  4CO8 A;  4L18 B;  1RNL A;  2Z99 A;  2FA5 A;  3V8K A;  1YLF A;  2RV8 A;  1WQ2 A;  1HKS A;  1O3T A;  5ILU A;  2QBY A;  1K79 A;  1U8R A;  3KP2 A;  2A68 F;  4FT8 A;  3LQQ A;  1R1V A;  1IXS B;  3QOP A;  1ZGA A;  5CVJ A;  2QBY B;  1R5G A;  1ZN2 A;  2DBB A;  1O57 A;  1U78 A;  4S05 A;  3E5U A;  5HS9 A;  1IXR C;  2X4H A;  2QZ8 A;  4EM2 A;  2EV6 A;  5D5U B;  2AXL A;  2XUB A;  1BI0 A;  1YW8 A;  2BGC A;  4Q48 A;  4M6Y A;  4LMY A;  1P4X A;  4RGR A;  3H3Z A;  1MKM A;  2VE8 A;  5D6F A;  4I98 B;  3DPT A;  3OOP A;  3JSO A;  3MFK A;  3JSP A;  2CQK A;  1TQI A;  3CUQ C;  4HYE A;  3M8E A;  2H6B A;  2DFI A;  1V3F A;  2O0Y A;  3FXQ A;  2Y75 A;  2FF4 A;  5E17 F;  5LEK A;  1IN7 A;  1FBQ A;  3JAM K;  5D8K B;  3D5L A;  1FLI A;  5K5R A;  1FYL A;  3IL2 A;  4HZF A;  5DUK A;  1S7A A;  3I59 A;  4AWX B;  4GCV A;  1IRF A;  2FRH A;  3T5X A;  2D45 A;  1LEB A;  2K02 A;  3IKV A;  2E7W A;  2RC4 A;  4OIO F;  1X3U A;  3WOD F;  3L7W A;  1U3E M;  3FMS A;  3PFI A;  2DT5 A;  3TO7 A;  1T38 A;  1FC3 A;  3WTU C;  4NB5 A;  2ISZ A;  3P9I A;  1YW9 A;  1O7F A;  1W5T A;  5BOX A;  1OR7 A;  4G6D A;  1G4D A;  3C3W A;  4AIJ A;  3GFM A;  2BE5 F;  1P4A A;  3K1P A;  4WX9 A;  3ECH A;  1I1G A;  3RYP A;  2RKH A;  5ICG A;  4WF2 A;  1FBS A;  1CGP A;  2Z5U A;  2ZBK A;  3VEP A;  4E70 A;  2HYF A;  4NHJ A;  4HW0 A;  2UWM A;  2VBW A;  5LRS A;  1ZH5 A;  1WSU A;  4KNY A;  4KA4 A;  4CYD A;  4PGG A;  2ZKZ A;  5E1X A;  2O6G E;  1ODD A;  3DFG A;  4L5J A;  3ZN0 A;  5KK1 A;  3BPX A;  4M6X A;  1EH6 A;  2XAS A;  1YO5 C;  3BJA A;  3LA3 A;  2QWW A;  4ESB A;  1HKQ A;  2NYX A;  1ZG5 A;  2ESH A;  2ZO4 A;  4XSZ F;  2JPB A;  4PCQ A;  1B1B A;  3I53 A;  1B6A A;  3I4P A;  2D1V A;  5JR3 A;  3Q5F A;  3VOD A;  3BP8 A;  4HOB A;  1BOA A;  4IPA A;  4HQE A;  2O61 A;  3HRT A;  2M30 A;  1D8J A;  2R7F A;  1SAX A;  5FGM A;  4BHB A;  4GGG A;  2RDP A;  4N0B A;  3RTR A;  4BHP A;  5F1R A;  4RS8 A;  3JTH A;  1QO0 D;  3LAJ A;  1H0M A;  3EET A;  2HTJ A;  4R8H A;  2OZ6 A;  4ENM A;  2VOD A;  3NQO A;  2IT0 A;  2W84 A;  2XGX A;  4L9J A;  3LST A;  1RI7 A;  5DUI A;  2FMY A;  2B0L A;  3E6M A;  2KJC A;  1B9N A;  5LHH A;  5ERI A;  1TQM A;  2F5C A;  2HEO A;  4A0Y A;  3F21 A;  4LLN A;  3GUD A;  3R60 A;  1LNW A;  3VB2 A;  1UCR A;  1YG2 A;  4YFN F;  5D5V B;  1ON2 A;  2ETH A;  4LK0 F;  4PDK A;  4A6E A;  4MEX F;  2L3D A;  3CUQ A;  5DV5 A;  2DAO A;  2GQQ A;  2KRF A;  1USS A;  1JE8 A;  3HRU A;  1BIA A;  3CUQ B;  4LB6 B;  4KN4 X;  1LEA A;  4EQQ A;  3J80 Z;  3RKX A;  1KYZ A;  3I54 A;  4UXN A;  1YW7 A;  2VE9 A;  5FFZ A;  3K9T A;  5FO5 A;  5ICC A;  2GXB A;  4HV6 A;  4Q47 A;  3JW4 A;  1G3W A;  1GVJ A;  1XGO A;  3MQ0 A;  1SFU A;  3ZMD A;  4HDU A;  4G9Y A;  4OMY A;  2XRN A;  4QLC U;  1FBU A;  3TDU C;  2MD5 A;  1B9M A;  3HOS A;  2QQ9 A;  2O03 A;  5LGT A;  4LJZ F;  3GZ5 A;  3P9K A;  4WXH A;  1J59 A;  2LF8 A;  5HLG A;  3WE3 A;  2A69 F;  1Z9C A;  5DCF A;  3I5U A;  1OYW A;  2K4B A;  1IRG A;  3HTS B;  2M8E A;  1QPM A;  2LKP A;  1D5V A;  2DO7 A;  2IA1 A;  3QRF F;  3R0A A;  3P9C A;  4Q4Z F;  5ED4 A;  4ZZL A;  4EGZ A;  2A3S A;  4ENK A;  4A12 A;  3WG9 A;  4EJV A;  4KUM A;  2H6C A;  3B73 A;  4JK1 X;  4UVA A;  2OA4 A;  3GFL A;  2XAG A;  3FXU A;  4HAM A;  3J80 K;  5BPD A;  5J8F A;  4ENJ A;  1KYW A;  2XKO A;  2DPD A;  2IRF G;  3ZMT A;  4GYI A;  5L3E A;  1ZHF A;  4M9S A;  3G3Z A;  2DPU A;  2GA1 A;  2EFW A;  2IP2 A;  5J8C A;  2F5E A;  1ZRD A;  2VBY A;  1FWZ A;  5AON A;  4L0Y B;  4G7O F;  3HUG A;  4EM0 B;  1P92 A;  2M45 A;  1R1U A;  3E6D A;  1U5T C;  4KT5 C;  2FXA A;  1LVA A;  1ZAO A;  2L4A A;  3BDD A;  1NHA A;  2L01 A;  2PJP A;  2R3S A;  2FSW A;  1MDM B;  4JBA A;  2KJB A;  1XN7 A;  4L9N A;  2GAU A;  2OQG A;  4UVC A;  2PI0 A;  4AVP A;  1SFE A;  2V6C A;  3P7N A;  4HX7 A;  1MJB A;  2JTV A;  4RGU A;  3EYI A;  1FSH A;  3E5Q A;  1R36 A;  2DQL A;  3LFK A;  2L4M A;  3IHU A;  1TNS A;  4XLN F;  1FP1 D;  5FB2 A;  2W24 A;  3QPH A;  1UHW A;  5CLS A;  5EEH A;  4ZYG A;  2JZY A;  1ON1 A;  2GZW A;  4HLX A;  1R1T A;  1W7P A;  2W85 A;  2YPR A;  4FX4 A;  3DQV C;  1J0R A;  3LWF A;  5JI6 A;  3L09 A;  3E5X A;  4AIK A;  1HSJ A;  3TKY A;  1W7P B;  1L0O C;  1ZRF A;  5FLX Z;  1I5Z A;  4M73 A;  3IC7 A;  1Z6T A;  4GXO A;  5E20 A;  5HDN A;  3WGG A;  2E1C A;  3TDZ C;  3O3K A;  2K7L A;  2WC2 A;  5FD6 A;  2ZCW A;  3LA2 A;  2STW A;  2CW0 F;  3SXY A;  2EA4 A;  4G7H F;  1WKM A;  1H9T A;  4P55 A;  1I27 A;  2UXX A;  5D5W B;  2UZK A;  4XRF A;  1OYI A;  1QGP A;  2QVO A;  3D0S A;  2MLK A;  1XDS A;  1I6X A;  4KIB A;  2PN6 A;  5DD4 A;  3JTG A;  2A6E F;  3GXO A;  5CVI A;  5IT9 Z;  2ZXJ A;  4BAY A;  1CF7 A;  2DU9 A;  1QZY A;  1LDK B;  1RZ4 A;  3F3X A;  4HF1 A;  3BZ6 A;  1OYY A;  2ISY A;  1CF7 B;  5K5O A;  1RUO A;  5H6R A;  2P5L C;  2Q8K A;  5A2Q Z;  1U2W A;  3WTT C;  1F5T A;  5H6Q A;  2F5D A;  5JFR A;  4KMF A;  5HDK A;  1F1Z A;  2KIM A;  1R7J A;  5L3G A;  1S7O A;  3BOQ A;  2P7V B;  4IRH A;  2A5Y B;  2HWV A;  4Q5S F;  2HOE A;  5F6F A;  1H9G A;  2MLG A;  5FLX K;  3HRM A;  1QQI A;  2D2W A;  2EV0 A;  1UST A;  4IHS A;  2MA3 A;  1RUN A;  1ZAR A;  4HA8 A;  2MH9 A;  3TGN A;  4O5V A;  1HW1 A;  5DYM A;  2STT A;  1TW3 A;  4ESF A;  1ZRC A;  3ERE D;  3LAP A;  1S3J A;  4O6J A;  2RVC A;  1FOK A;  5BS6 A;  1OKR A;  3BJ6 A;  2IVM A;  4KFC A;  2FEZ A;  3K2Z A;  1YTY A;  5J6X A;  1QZZ A;  1V4R A;  1DDN A;  5ICE A;  4AD9 A;  1D8K A;  4UUV A;  5ILS A;  1FT9 A;  3AAF A;  3SQN A;  5IT9 K;  4L9V A;  2WWY A;  1RIO H;  4LD5 A;  5CVR A;  1U5T B;  2ADU A;  3O2P E;  2HR3 A;  5D6E A;  3TO9 A;  2OD5 A;  5A2Q K;  1PUE E;  3COA C;  2WTE A;  3K69 A;  1MJA A;  2BV6 A;  4EVI A;  2K27 A;  1SMT A;  4L0Z B;  2Z3Y A;  4PGH A;  4JQF A;  3J7A O;  1KA8 A;  1HW5 A;  3GO5 A;  3RDI A;  5BQT A;  1BI1 A;  5K1Y A;  3ECO A;  1TLH B;  2HGC A;  4P5O A;  2KKO A;  2V9V A;  3GX4 X;  4MHG A;  4H0E A;  3KZZ A;  1QNT A;  2RQP A;  2GXG A;  1EH8 A;  3E97 A;  2QYO A;  1UB9 A;  4CGZ A;  3I71 A;  3V7R A;  4XLP F;  2V1X A;  3SFZ A;  2M87 A;  1ONV A;  3VOE A;  1EV7 A;  3NEU A;  2XAQ A;  2FBH A;  2EV5 A;  1IN5 A;  1MJ9 A;  2G7U A;  1Z05 A;  4HV5 A;  3V8L A;  3F22 A;  3R0J A;  4WWC A;  4LLG F;  4G7Z F;  2HS5 A;  1G3Y A;  5D4S A;  1FY7 A;  1J75 A;  1P6R A;  5LGN A;  2VXZ A;  2E7X A;  4Y17 A;  1I1S A;  3TOB A;  4DQ2 A;  2PEX A;  3ULQ B;  4A5M A;  4KYW A;  3FZV A;  2NNN A;  5LHG A;  4MEY F;  2HQN A;  3I58 A;  4HDV A;  6PAX A;  4WXD A;  1R23 A;  4L9T A;  3KZY A;  2HDC A;  4RGS A;  1WI9 A;  4RAY A;  3V7S A;  3PQK A;  3DP7 A;  2P8T A;  2O3F A;  1IF1 A;  1XSD A;  4FHT A;  2ELH A;  4MQ9 F;  5LRR A;  3RJP A;  4F7Z A;  4U7D A;  1TW2 A;  3F23 A;  1W4M A;  2W25 A;  3M9A A;  1F9N A;  5ILV A;  1LJ9 A;  1P4W A;  2DTR A;  4YIF A;  2C6Y A;  4G6Q A;  1XMA A;  4CHU A;  5L3D A;  2BBY A;  2P6S A;  1O3R A;  2XIG A;  3DEU A;  1UHM A;  4G94 A;  4A5N A;  3CO7 C;  2YX4 A;  4Z2Y A;  1YIO A;  1GXQ A;  1Z91 A;  1J9I A;  3WTW C;  1IN4 A;  4HX4 A;  1L3L A;  2WV0 A;  2Z33 A;  2MH2 A;  2O8X A;  1TBX A;  2X0L A;  2EB7 A;  4IJA A;  2P6T A;  4IHT A;  2FU4 A;  4UNO A;  3CO6 C;  5D4R A;  4OMZ A;  5CYV A;  3J81 Z;  2H09 A;  3GFI A;  1VTN C;  1W5S A;  3QAH A;  2PMH A;  2KIF A;  4CZZ A;  4RB0 A;  3FXR A;  3WE2 A;  3IWF A;  1E17 A;  4FX0 A;  1K78 B;  3HTU A;  4QWQ A;  3L9F A;  3ZMZ A;  2EFO A;  2EFP A;  1FP2 A;  2YSR A;  2OQR A;  2P5K A;  2RGV A;  3LQR A;  4HF2 A;  3GEZ A;  3ELK A;  2JSC A;  4B09 A;  1FNN A;  1FPQ A;  4ZYD A;  1ZRE A;  3V4G A;  4KDP A;  4U0Y A;  2XAF A;  1XSX A;  2DLL A;  2NAZ A;  2GWR A;  2YR2 A;  5HS8 A;  1KU3 A;  5E8G A;  4LB5 A;  2DI3 A;  2EJR A;  2HZT A;  3ZQ7 A;  2YU3 A;  3KP5 A;  2R7D A;  4ON0 A;  4R1H A;  2DK8 A;  3TOA A;  4LK1 F;  2XVC A;  1E2X A;  4MTE A;  1BM9 A;  4UHT A;  3F72 A;  2L02 A;  3ZPL A;  3HSF A;  2CGP A;  2EFN A;  1IZ1 A;  3QP6 A;  5K5Q A;  2G9W A;  5CVV A;  2NNY A;  3RPQ A;  4OU0 A;  2V79 A;  1O3S A;  4IRI A;  4Y15 A;  3BWG A;  3REO A;  4RGX A;  3KFW X;  1MDM A;  2IA0 A;  1R58 A;  3J81 K;  4Y13 A;  1P2F A;  5DCM B;  4GO1 A;  1R00 A;  4LFU A;  1STZ A;  3IRR A;  3F6V A;  2JPC A;  1LDJ A;  3WTZ A;  1YFH A;  3KLN A;  3E3V A;  1T2K A;  4UVB A;  4O3M A;  1YS7 A;  1BI2 A;  2HQR A;  2IJL A;  5JHU A;  4GYG A;  2VBZ A;  2DK5 A;  1YYV A;  1D3Y A;  5DEQ A;  1SMY F;  1B59 A;  5DDG A;  3C7J A;  2JRT A;  1O7L A;  1KQ0 A;  4LLL A;  2DQR A;  3WTS C;  1T39 A;  1R5H A;  3FM3 A;  4KN7 X;  2ZME A;  3T8T A;  4MTD A;  1FYM A;  4HLY A;  2CSO A;  3KE2 A;  5AIQ A;  1SD7 A;  1FYK A;  3ML6 A;  3EYY A;  1HXD A;  2UXN A;  5L3B A;  4MGR A;  3KLO A;  2ZME B;  2FQ3 A;  5FFX A;  3S2W A;  3GW2 A;  4ZYH A;  4BYY A;  3M8F A;  3BRO A;  5H20 A;  3I64 A;  3RKY A;  2QEN A;  2VT2 A;  4HBL A;  3QP5 A;  4B8X A;  3U9G A;  1ZG3 A;  2PMU A;  3OV8 A;  1HW2 A;  1XCV A;  1AWC A;  2JT1 A;  1KU2 A;  2A6H F;  3MAJ A;  3MZH A;  4M71 A;  5JVT A;  3RKW A;  4KIG A;  2P5V A;  5IT3 A;  5E1W A;  3T8R A;  3VFZ A;  1JHF A;  1XGN A;  1B4A A;  1BJA A;  2XAJ A;  3M1E A;  2K4J A;  1BIB A;  3CDH A;  4K2E A;  3LA7 A;  1JHH A;  3KP7 A;  2BEO A;  1UFM A;  1Z7U A;  3KP3 A;  4M74 A;  3DV8 A;  3U2R A;  3QU3 A;  1O3Q A;  4RB3 C;  4RAZ A;  2HKO A;  5LEJ A;  1S29 A;  1OMI A;  2QUF A;  2ACJ A;  2FE3 A;  3DPL C;  1FZP B;  5D8L B;  1FSE A;  4DNC A;  1F4K A;  1LDD A;  2RN7 A;  1ZYR F;  3V7C A;  2V1U A;  2OZU A;  2VN2 A;  1DUX C;  5HOO A;  1BC7 C;  3ZMU A;  3BJO A;  2GA2 A;  4HQM A;  4UV8 A;  3R6S A;  4P9F A;  4LG0 A;  4EJU A;  4I0B A;  4BH9 A;  3CTA A;  3KP4 A;  3N97 A;  4BXU A;  2NS0 A;  2FNP A;  2LF7 A;  3WU0 A;  4EJO A;  5BPI A;  3KEQ A;  2PBI A;  1IUY A;  1TNT A;  4LG0 B;  2AS5 F;  1HST A;  2J5O A;  3CUO A;  4KIC A;  3KP6 A;  3GWZ A;  1KU7 A;  4RB1 A;  1DPU A;  2ZFW A;  1U5T A;  4BHC A;  4R79 A;  1ULY A;  3FHZ A;  1Q1H A;  2CO5 A;  1IW7 F;  5LGU A;  5LHI A;  4N9H A;  3I59 B;  2P7C B;  1J2X A;  2NRA C;  3R4K A;  1MD0 A;  1S8N A;  3FF5 A;  4D0P A;  4U0W A;  3T0Y A;  3CJN A;  3U1D A;  4MQV A;  2FBI A;  2M5W A;  2CFX A;  3K1M A;  1LB2 A;  2FNA A;  2EK5 A;  2HKX A;  2HYG D;  3I0T A;  1BC8 C;  2XAH A;  4XBF A;  1K7A A;  5HVQ C;  1W7P D;  3RPU A;  3KET A;  1ZGJ A;  4PZJ A;  4P96 A;  1LQ1 A;  1K6O A;  5ICF A;  4U88 A;  1XB4 A;  3T1B A;  3ZP5 A;  1FX7 A;  1PDN C;  3HIF A;  2CYY A;  1REP C;  2ZNY A;  3ISP A;  3B02 A;  4ZH4 F;  3FMR A;  4LGW A;  1ZLJ A;  5HS7 A;  5DD8 A;  2EA2 A;  3C1D A;  4IF4 A;  1PP7 U;  1KQ8 A;  3Q9V A;  2VC0 A;  3HRS A;  1R22 A;  2A07 F;  2H27 A;  1JXS A;  3SZP A;  3GYH X;  5FD5 A;  5L3F A;  3R61 A;  3GFJ A;  3EUH A;  3BY6 A;  2Q0O A;  1QBJ A;  2H94 A;  1XGS A;  4NQW A;  3IRQ A;  3ZN1 A;  5F64 A;  2QLZ A;  4L5I A;  4A0Z A;  4EMS A;  3ABT A;  1ZLK A;  2PG4 A;  1WWX A;  1Z6R A;  1G6N A;  3W6K B;  5L3C A;  2COM A;  2OU2 A;  3PQJ A;  3F6O A;  3O6B B;  3WGI A;  2W57 A;  1J7K A;  1XD7 A;  3IWZ A;  5CJ9 A;  4XSX F;  2E1N A;  2MBF A;  4YFK F;  3FX3 A;  2ESN A;  4U0V A;  4EV0 A;  1EH7 A;  4TV7 A;  4U7B A;  4WXC A;  1HBX G;  4EJW A;  2HFH A;  2IA2 A;  3RIR A;  1TQP A;  3WTX C;  5HLI A;  2XHK A;  3IKT A;  1SFX A;  3N4M A;  5E18 F;  1OPC A;  2XRO A;  4N9I A;  1YQA A;  3ZMS A;  2IPQ X;  4EM1 A;  3RI4 A;  3RYR A;  1Z1D A;  2FBK A;  2Y0M A;  2VON A;  5AIP A;  2LNB A;  1T6S A;  2OBP A;  3DF8 A;  3FM5 A;  1HQC A;  3F8C A;  1U6G A;  4EGY A;  4IXA A;  2FML A;  4I0A A;  3WTY C;  2XV4 S;  1T0F A;  2ZJ2 A;  1JGS A;  3M7G A;  4EJT A;  3K1N A;  3GVA A;  3SHF A;  1IAW A;  2VC1 A;  2QQB A;  2P4W A;  2V1D A;  4S04 A;  1AOY A;  4CXF A;  3SZT A;  2IW5 A;  3F8B A;  1YS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...