1LNWA

Crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
NYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the MexR repressor of the mexRAB-oprM multidrug efflux operon of Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription repressor
molecule keywords Multidrug resistance operon repressor
total genus 48
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lnwA01
3WG9A 3RKYA 4I01A 4ETSA 2Q2EA 1T0FA 2X0LA 3VB2A 1MZBA 3O6BB 3HRMA 4RGSA 1YG2A 3TO9A 1UCRA 1T98A 5D4RA 1CF7B 3WU1B 2YR2A 2O8XA 2VBZA 4ZYDA 1WQ2A 3GEZA 5DCMB 2MA3A 4RGRA 3I5UA 4UV9A 1REPC 4HLXA 3I54A 4R1HA 4Y13A 3MZYA 2P6TA 5FD5A 4BNCA 4GGGA 3FWEA 1A04A 1U78A 3E97A 4MGRA 5L3GA 1YO5C 5D8KB 5LGUA 1FSHA 3V4GA 2W24A 2VONA 2FBIA 1RI7A 2VBXA 1YS7A 4UHTA 4HX8A 2OZ6A 2EFPA 2H94A 1FOKA 4EJWA 4U0YA 4M9ZA 5BPDA 2GZWA 2MBFA 1G6NA 1ZGJA 2V6CA 1G3WA 2AXLA 4GYIA 4G6QA 4PDKA 2RGVA 1FY7A 5J8FA 3W6JB 5ICFA 4EQQA 4A0ZA 2A6HF 2DTRA 2QLZA 5K5RA 1P4WA 2XVCA 3ZP5A 4ZZDA 1I1SA 1XSXA 1BN5A 2XUBA 1BBYA 2FU4A 2F5CA 2Q0OA 4M9SA 3HIFA 4A2UA 4RS8A 4Y15A 1Z1DA 2HZTA 2P7CB 1W7PB 3GF2A 3QPTA 3KP5A 1STZA 1R1VA 2UZKA 1KU7A 2XKPA 1BC8C 1TQMA 3QPHA 2DK8A 1X3UA 4KIFA 2MH9A 2F5EA 5TRDA 1UHWA 4ENNA 3FXUA 3RJPA 4O5VA 3U2RA 5D6EA 5L3FA 3WE3A 5CLSA 4AD9A 5ILUA 1U8RA 5D5XB 2Y48A 5L3DA 4XLPF 1EH8A 2OAZA 2DO7A 2Q8KA 1HSJA 1WRJA 4LK1F 3HRUA 1P92A 2HKOA 3SFZA 4D0PA 1YLFA 2HQRA 5ILSA 2EA4A 1O3SA 2A07F 5FFXA 4KIBA 4U0VA 3SZTA 1LQ1A 2JSCA 2EV6A 2BGCA 4I98B 2ZKZA 3F23A 2K4JA 2CWEA 5CVIA 3ECHA 1OR7A 2XASA 3BP8A 2LKPA 1KQ0A 2DLLA 1GXQA 4QLCU 3C7JA 4KMUX 2H09A 4G9YA 1LDKB 3C3WA 4HW0A 1LNWA 1HW1A 1U6GA 2H27A 3FMRA 1YW8A 2A3SA 4I0BA 4CO8A 4R79A 3MWMA 2QVOA 5BMZA 3R60A 2HFHA 3T8TA 3KP7A 2FBKA 1EH6A 4LB6B 4ESJA 2F2EA 4U0WA 1MDMA 3OV8A 4WXHA 5E8IA 2ZNYA 4Y17A 4MTEA 1QO0D 1G3TA 1BOAA 1ULYA 5LLQA 3ABUA 4RGXA 5E8GA 4RB0A 4YIFA 4RB1A 3KZZA 4M6XA 2ESHA 1FYLA 1SD4A 4TV7A 3GFLA 2QZ8A 2EB7A 2YX7A 1TW3A 2IVMA 2RDPA 3RYPA 2M8EA 3I71A 4DNCA 4Q48A 1Y0UA 3KP6A 5KK1A 3TDUC 1PDNC 1U5TB 3ZMUA 4EM2A 3L9FA 3F8CA 3IC7A 4YFKF 3TO7A 4FX4A 1TNSA 4ZYHA 1JE8A 4UVCA 4RB3C 4BHBA 2QBYA 1IXSB 2D1HA 2XV4S 4HDVA 3GZ6A 3H3ZA 4Q5SF 3M8EA 2EFWA 1WWXA 2DFIA 2PJPA 3LA7A 1IZ1A 2ACJA 2DQRA 2Y0MA 1SMTA 2ZFWA 3J81Z 3LQRA 1K78A 2G7HA 3R61A 2ZMEA 3HSEA 4AIKA 3F6VA 3BWGA 1T39A 1O57A 2VOOA 5ICCA 4L5JA 4OINF 4EM1A 4A5MA 4WK8F 2Z3YA 5EEGA 3LSTA 5IT9Z 4LK0F 1J0RA 2GIVA 2PI0A 1O3TA 3FM5A 4O6JA 2V1DA 4XBFA 3VEPA 1GXPA 1SMYF 3GXOA 3BJOA 2Z33A 4IRIA 1RZ4A 3VFZA 3EUHA 2CW0F 1UHMA 3FXQA 3L2CA 2HKXA 1MKMA 3KP4A 3IL2A 2QM3A 5JHUA 3WGIA 3HRTA 4IHSA 2DU9A 4HA8A 4IRHA 4JK1X 1FYKA 1ZH5A 3HSRA 4LG0A 1QQIA 2MH2A 1FP2A 2M87A 4I7HA 1JXSA 3IKVA 2HR3A 3GX4X 3NRVA 3BY6A 1CF7A 3SQNA 3MFKA 2PMUA 3SXYA 1BM9A 2ISYA 1B4AA 2P6SA 2VT2A 1R23A 3PQJA 2MC3A 2OU2A 1HBXG 3M1EA 2PFBA 1KYWA 1U3EM 2PBIA 2VE8A 2JRTA 4A12A 1R1TA 1FBSA 2F5FA 5LGTA 4CICA 5FO5A 4HX7A 3BPXA 3WGHA 2DI3A 4FT8A 1USTA 2L01A 1MD0A 3RPQA 2XKOA 4GYGA 4HF0A 2EFNA 3HHGA 3J80K 4EV0A 2FSWA 3F22A 2DBBA 1MJ9A 4OU0A 4HYEA 4BAYA 3GFIA 4HQEA 4PGHA 2ADUA 2EK5A 3U1DA 4BHCA 1BIAA 2GWRA 3BOQA 4ASNA 3E3VA 1FWZA 5HLIA 4AIJA 4OOIA 2VC1A 3TGNA 2E1NA 2EV0A 5J8CA 1J7KA 3U9GA 1KGSA 3MAJA 4RB2C 3ZMSA 4WF2A 3I59B 4KICA 4HV6A 3GLXA 4OMYA 1IXRC 1DPRA 3WU0A 1SFXA 1ZG5A 3JAMZ 2W84A 3M8FA 3F3XA 4L9TA 3FXRA 3R0JA 2EFOA 1LDDA 2HWVA 2UWMA 2G9WA 5FFZA 2RKHA 4BYYA 1UB9A 2Y75A 4IRGA 4XSXF 2VODA 3JSOA 4N9HA 4KYWA 1J9IA 2FA5A 1FT9A 1QZZA 4UUVA 1KQ9A 1ZYRF 1UFMA 4LMYA 2XROA 1KQ8A 5FGMA 3HOSA 1C0WA 3ZMDA 1VTNC 1W7PD 5LHHA 4E70A 1XMAA 2A68F 3C18A 1WKMA 1LDJA 4KT5C 6PAXA 3KEQA 5CYVA 1SD7A 3M9AA 1BJAA 3I0TA 4L18B 2O3FA 3E6MA 4WCGA 1P4XA 4UV8A 1OMIA 4CXFA 1I1GA 5IT3A 2E7XA 3ML6A 2DPDA 2NRAC 5CVRA 4I02A 3DF8A 1FC3A 1RIOH 4EGZA 3TO6A 2WWYA 1R00A 1ZRDA 1ZLKA 3K0LA 2BBYA 4EMSA 3G3ZA 3HHHA 5HOOA 4PZJA 5F64A 3DV8A 2NAZA 1XB4A 2QENA 1IN7A 1F9NA 3HRSA 4MQVA 2EFQA 1QPMA 3BDDA 1USSA 1T2KA 2VBWA 2VBYA 3F8MA 4BXUA 2HTSA 1YYVA 3DEUA 3O3KA 2J5PA 2FNPA 2MLGA 5E1WA 3GFJA 5TJJA 3R4KA 4CDGA 1XGMA 1D8JA 3D5LA 1TQIA 1XGOA 3WTUC 2IP2A 2XIGA 2QBYB 2ISZA 1QGPA 4CZZA 1I27A 3B73A 1QBJA 3RKWA 4S05A 1U5TA 3F72A 3HOTA 2W25A 4L0YB 2OQGA 1OYWA 3ULQB 1ZG3A 2RNJA 3QAHA 3GO5A 4M6YA 3I58A 1BIBA 1BI1A 3LAJA 3BJ6A 4K2EA 3CO7C 5LRRA 1ONVA 1G3YA 4U88A 4MTDA 5D8LB 2PEXA 1F5TA 3I4PA 2JTVA 3DKWA 1Z7UA 2VE9A 4H0EA 1XGNA 4KIGA 3T8RA 2M45A 1L3LA 5DCFA 1R5HA 3K1MA 1PP8F 3H3UA 4U7DA 4F7ZA 3QRFF 4ZYGA 2CFXA 2XGXA 1FZPB 3ERED 2DQLA 1OYYA 3KP2A 1E2XA 5DUIA 3E6BA 4ZZLA 4GO1A 1L0OC 1IRGA 4P9FA 1OPCA 4EGYA 2QQ9A 3QP6A 1IN5A 4OIPF 4BH9A 4AVPA 5E1ZB 3J80Z 1W7PA 5F1RA 1FX7A 2M1BA 3J7AO 1FSEA 1ZN2A 1KU9A 5LHIA 3KCCA 2VN2A 3FX3A 1FBUA 4EJOA 5L3BA 3WTYC 1OYIA 1TTYA 2UXNA 2PQ8A 1ZRFA 3MCZA 5DEQA 2VT3A 3P9KA 3WTWC 4XRFA 5DUKA 2IA2A 3FF5A 2R3SA 4A6DA 4IJAA 1H0MA 2PMHA 3HSFA 3P9CA 1TW2A 4B8XA 5L3CA 2FRHA 1FP1D 4FX0A 2R7DA 4WXCA 3FMSA 2FOKA 1B1BA 2A6EF 4MQ9F 2CO5A 2XAQA 4HV5A 2OBPA 1U5TC 3WTXC 1GVJA 2RV8A 2FNAA 3MQ0A 5ICEA 1HKSA 1W5TA 4KFCA 3IKTA 5ICGA 2QWWA 3GVAA 1D8KA 4LGWA 1O3RA 3DPTA 2B0LA 2PLYA 2BYVE 4AIHA 2ZXJA 3HTUA 2O61A 1YFHA 2KJCA 2LF8A 3SZPA 4R8HA 2LDUA 5D5VB 2DW4A 4KA4A 4NQWA 2ZO4A 1ZARA 3TOAA 2M30A 4KNYA 4EM0B 1BI2A 1TQPA 2HOEA 4WXDA 1ZLJA 2BEOA 4U7BA 1MGTA 2E7WA 2ZCWA 1HSTA 4XSZF 4HF2A 5HDKA 4P9UA 1R5GA 5A2QK 1V4RA 2AS5F 2K4BA 1LB2A 4IHTA 1S7AA 4BHPA 1DP7P 5LHGA 3ECOA 2HEOA 4L9NA 3Q9VA 2WC2A 4LD5A 1ON2A 3FZVA 5DV5A 4HBLA 4ENKA 1YIOA 1Z9CA 2BV6A 1S29A 1XDSA 3IWFA 3ZMTA 1B6AA 1XN7A 3KP3A 5E20A 5DYMA 4EJVA 3HUGA 2MD5A 1YTYA 1J2XA 1WI9A 4YFXF 4ENMA 4P55A 2D2WA 3D0SA 3CUQB 1DPUA 2Z9OA 2O0YA 4G6DA 1B59A 4RAZA 4A0YA 3QOPA 4ESFA 5AONA 4IF4A 2LF7A 3T0YA 5H20A 1EH7A 3V7RA 2JT1A 4IPAA 2D1VA 3RTRA 1HKTA 2L02A 3MEXA 4IXAA 3W6KB 3LAPA 2RN7A 4RGUA 5E17F 1Z05A 2EJRA 4WWCA 2P5VA 2LSOA 3E6DA 2L3DA 4BQAA 3CUOA 3P7NA 4N9IA 5FB2A 3QU6A 3RYRA 2Z99A 1G3SA 3EETA 4L5IA 2JPBA 4LG0B 3T5XA 3CTAA 2NNNA 1IAWA 3KZYA 2OA4A 5K1YA 2XAFA 2RC4A 2FE3A 1DUXC 4M72A 2HS5A 5DCMA 1HW5A 1HW2A 3ZN1A 2W85A 3TOBA 4G7OF 2YSRA 3DPLC 5L3EA 3ELKA 3O2PE 1FYMA 4HZFA 3WTVC 3NEUA 3E5UA 1Q1HA 1NHAA 3M7GA 2A61A 1XCBA 1SD6A 4HAMA 1JHHA 5HS9A 2EA2A 4O3MA 5BPIA 4JBAA 3F21A 2VC0A 5K5QA 3LWFA 5J6XA 2FEZA 3IWZA 3Q5FA 5CJ9A 1E17A 3E6CC 1Z6TA 4M71A 4UVAA 4DQ2A 2UXXA 5HDNA 1HKQA 3LA2A 4I09A 5JR3A 4LLLA 2P5KA 3JSPA 4LLGF 3IHUA 2K27A 4HDUA 2IA1A 3WGGA 3COAC 2CGPA 2COMA 1PUEE 2A5YB 2NS0A 1AWCA 1S3JA 3BPVA 1R1UA 1S7OA 4OMZA 4OIOF 1ZHFA 1ZGAA 3IRRA 2OQRA 2FQ3A 5LEJA 1ZREA 5JVTA 3RIRA 3K69A 4HOBA 1FLIA 1ODDA 1LVAA 1ZG1A 3CJNA 4RAYA 1MJBA 2F5DA 3K9TA 4NB5A 2GAUA 3JTGA 2HYFA 3PFIA 2HTJA 3I53A 3S2WA 4UXNA 2IA0A 3TQNA 4YFNF 4ENJA 2ELHA 5HS8A 3Q9SA 3E5QA 4PCQA 5F6FA 2Z5UA 1RUOA 5EEHA 2IW5A 2ZJ2A 2OZUA 3T1BA 4FHTA 4ON0A 3V7CA 1IN4A 2GXGA 2A69F 3F6OA 1U2WA 4KUMA 1KU2A 4Q4ZF 1FNNA 3GFMA 3RI4A 1IRFA 3GUDA 2CQKA 1O7LA 2H6BA 2PN6A 2HDCA 1JGSA 2FF4A 2GA2A 2YU3A 3V8LA 2FMLA 5BQTA 5ED4A 2QYOA 2FXAA 3ROUA 3KLOA 1XCVA 2V9VA 4ZYEA 4OIRF 3ZQ7A 3F8NA 2P8TA 5DDGA 5HDGA 2RQPA 1K6OA 5FLXZ 5E1XA 3CO6C 4ESBA 5A2QZ 4WX9A 1PP7U 3HYIA 2IT0A 1IXCA 3WTZA 2LNBA 5H6RA 4B09A 1R36A 1WSUA 4N0BA 1GHCA 3K2ZA 2P5LC 1CGPA 2M5WA 1IN8A 1Z91A 1JHFA 4KN4X 2KRFA 4I0AA 1XD7A 2L4AA 3JW4A 2EWNA 4S04A 4A5NA 5CVVA 3OOPA 3GYHX 1XSVA 4GCVA 2V79A 5DD8A 4QWQA 2OD5A 2J5OA 2L4MA 2PG4A 5ERIA 4UVBA 1EV7A 3K1NA 3L09A 3L7WA 1P2FA 3GZ5A 1P6RA 1KU3A 3P9IA 1K7AA 1YQAA 3DFGA 1XGSA 3FHZA 3KFWX 3KE2A 4A6EA 3B02A 2ETHA 1XDUA 1OKRA 1LEBA 1SFUA 3N4MA 3VODA 1R58A 2MLKA 1AOYA 2K02A 2CG4A 2XRNA 3ZN0A 2KIUA 1QNTA 3C1DA 3V8KA 4UNOA 2KIFA 5KVRA 3GW2A 2XAHA 4YIIA 2XAJA 3K1PA 2DPUA 2CSOA 4XLNF 3F8FA 4CYDA 5LRSA 3L00A 4KDPA 5CVUA 2V1UA 3EYYA 5LBQA 5JI6A 3EDPA 4KMFA 5IT9K 2BE5F 1SFEA 3E5XA 3N97A 4M74A 3ISPA 3V7SA 3JTHA 2HQNA 3EYIA 2ESNA 3VOEA 1K79A 3CUQA 1B9NA 3V8JA 4MNUA 4G7HF 5HLHA 1H9GA 4Q47A 1T38A 1BI3A 1R22A 4LB5A 3LA3A 3KLNA 3J81K 1K78B 2YPRA 2E1CA 2D45A 1BC7C 1ZRCA 5BS6A 3ZMZA 3LFKA 4NHJA 1IW7F 5LGNA 2W57A 3HTSB 4KN7X 2NNYA 5FLXK 2FMYA 2EV5A 2GXBA 2V1XA 3I64A 2HYGD 2JZYA 5ILVA 4AWXB 3BZ6A 2XHKA 3F8BA 2NYXA 3FMQA 3CLOA 3LQQA 3ABTA 5D6FA 2P7VB 2JPCA 3AAFA 4CGZA 2TDXA 1RUNA 5K5OA 1IN6A 3G73A 3ZMVA 1HQCA 5H6QA 1IF1A 5HS7A 1H9TA 3RKXA 4M9XA 4EJUA 4LJZF 2G7UA 3TKYA 1LEAA 5D5WB 2IPQX 1F1ZA 2VOPA 4EJTA 1Z6RA 5D5UB 4CHUA 3ZPLA 2K86A 2GA1A 3MZHA 1I5ZA 1RNLA 3R0AA 2RVCA 1YS6A 1SAXA 4I2OA 1B9MA 1ZAOA 3KETA 2L54A 2DT5A 4HF1A 1D3YA 2WV0A 1DDNA 1R7JA 3BJAA 1O7FA 1MJAA 4PGGA 4Z2YA 2FBHA 4JQFA 1V3FA 2QQAA 1S6LA 5AIPA 1FPQA 1MDMB 3CUQC 4IVNA 1BI0A 1YW9A 5FD6A 3QU3A 4MHGA 3I59A 2C6YA 1J75A 3QP5A 1W4MA 2O6GE 1O3QA 2ZBKA 1KYZA 4EVIA 4G8XA 1IUYA 4L9VA 2CYYA 3NQOA 2YX4A 1XSDA 1I6XA 1P4AA 3WTTC 4LLNA 1LJ9A 2P4WA 4G94A 1SD5A 3FM3A 2WTEA 3EQLF 5E18F 2IRFG 4L9JA 3IRQA 4A0XA 1TLHB 2KKOA 3SHFA 2H6CA 3BROA 2HGCA 3RDIA 4YG2F 5AIQA 4OIQF 2KJBA 2ZNZA 4MEYF 3WTSC 2DK5A 2IJLA 5D4SA 3DP7A 4HLYA 1W5SA 3KEOA 4L0ZB 5CVJA 3DQVC 2QUFA 1TBXA 5LEKA 4M73A 4MEXF 2O03A 3H92A 4G7ZF 1QZYA 1YW7A 3DXJF 5HLGA 1F4KA 1S8NA 1T6SA 5DD4A 5HVQC 2ZMEB 3CDHA 3TDZC 3PQKA 2GQQA 4P96A 1XMKA 2STTA 4P5OA 1HXDA 2R7FA 3REOA 2DAOA 3RPUA 2VXZA 3JAMK 4HQMA 2QQBA 4LFUA 2STWA 4GXOA 1G4DA 5JFRA 3WODF 1D5VA 1ON1A 2KIMA 2X4HA 1FBQA 1J59A 1J5YA 4HX4A 4ZH4F 3GWZA 1TNTA 3WE2A 3R6SA 5BOXA 1KA8A 2K7LA 2XAGA
chains in the Genus database with same CATH superfamily
1EKEA 3WG9A 3H5RA 3RKYA 1IV8A 1OR7C 4L5EA 4ANJA 2F48A 4PJ0C 4I01A 2BW3B 4ETSA 2Q2EA 1T0FA 2HZDA 2X0LA 3BTJA 2MC4A 3DKYA 1NH3A 5M3MJ 3HGYA 3VB2A 2ZJPF 2Y9YA 1OCRH 3KYDB 3JRGA 1A35A 1MZBA 3O6BB 1VQPI 2VI6A 4CUGA 2CQXA 3HRMA 2DCEA 1B8IA 4RGSA 1YG2A 1FIPA 3TO9A 3GTKJ 3IAS2 1UCRA 1T98A 5LD2C 5D4RA 2ME6A 4PSWA 1CF7B 4XR6A 1LE8A 1YIJI 3WU1B 1CQTA 5E3LA 2YR2A 1YITI 2O8XA 2VBZA 4ZYDA 1WQ2A 3GEZA 4HSTA 5DCMB 2MA3A 4RGRA 2ME0A 5E3OA 5GTHC 2QF7A 2VPLA 4HNUA 3I5UA 3A01B 3K70D 4UV9A 2CV0A 4C2MJ 1X3WB 1FIAA 1REPC 1S72I 2JN6A 4BXFA 2OUMA 4HLXA 3I54A 1G2HA 2CW7A 4R1HA 3OSGA 4Y13A 3MZYA 2P6TA 5FD5A 4BNCA 4GGGA 3FWEA 1A04A 5IOZA 1U78A 3E97A 2W7NA 4MGRA 5L3GA 1YO5C 2NOGA 5D8KB 5LGUA 1FSHA 1D1AA 3V4GA 2W24A 2VONA 2FBIA 2N8GA 1RI7A 2VBXA 1YS7A 4UHTA 3Q0VA 4DBRA 4HX8A 4IEJA 2OZ6A 2EFPA 2LREA 1NTCA 2H94A 2IXSA 1FOKA 4EJWA 4U0YA 4M9ZA 4B43A 5BPDA 2GZWA 2MBFA 4PFOA 1G6NA 2DOAA 1ZGJA 3QYEA 2V6CA 1G3WA 4YELA 2AXLA 4GYIA 1FJLA 4G6QA 1AKHB 1XMXA 2MGQA 4PDKA 5H2FC 3OYIA 2L7KA 2E35A 2RGVA 1FY7A 5J8FA 5J4YA 3OOUA 3W6JB 3NAUA 5ICFA 4EQQA 4A0ZA 2XPWA 2A6HF 1Y1VJ 2DTRA 1OJLA 4LOCA 1HDPA 3HBLA 3HM5A 1Z21A 1BW5A 1X1CA 2QLZA 2RREA 2W48A 5K5RA 1P4WA 2XVCA 4E7HA 2MFZA 3ZP5A 1R71A 2DMTA 3P5JA 4ZZDA 3BC8A 2VUMJ 3DKXA 1PVEA 2XGEA 1I1SA 1XSXA 2LKSA 3LSRA 1BN5A 1M1EB 2XUBA 3CMEI 2Y0SN 1BBYA 2FU4A 2F5CA 2Q0OA 1YE9A 3BR1A 4M9SA 3HIFA 4IX7A 4A2UA 2LTPA 5K7HA 1KONA 4EEFG 4RS8A 5C44J 4Y15A 1OLTA 1Z1DA 4DZJA 2HZTA 2LBFB 2P7CB 1W7PB 3GF2A 3QPTA 3KP5A 2CUFA 1STZA 5EZGA 1R1VA 2XF5A 1YX3A 2UZKA 2QQ8A 2XKPA 4XMYA 1KU7A 1BC8C 1TQMA 4F91B 3QPHA 2OTJI 2ID6A 2DK8A 1X3UA 3OYFA 4KIFA 1ETYA 2MH9A 2F5EA 5TRDA 4IOAF 1UHWA 4ENNA 3OYAA 4A3IJ 3FXUA 2Y9ZA 4PFPA 2VJIA 1DGRM 4PJLA 2XAUA 3RJPA 4O5VA 2LH9A 3OYKA 3U2RA 5D6EA 1Y56A 1JUMA 3TBIA 2PX9A 5L3FA 4IQJA 2BY0A 3H9QA 4KT6A 5BNGA 4MFDA 3WE3A 1ZKGA 5CLSA 4AD9A 3L2UA 4A3CJ 5ILUA 1U8RA 2OCEA 5D5XB 2Y48A 5L3DA 1MBHA 3K2AA 4PUSA 4XLPF 3PO2J 1EH8A 1Z77A 2OAZA 2DO7A 2ZXHA 2W00A 2Q8KA 1HSJA 2V26A 4FISA 1WRJA 2UUZA 4LK1F 3HRUA 1P92A 2HKOA 3SFZA 4DW6A 1OCCH 4D0PA 3JRHA 1YLFA 5KHDA 3HUGB 2HQRA 5ILSA 1N78A 2V7FA 2EA4A 3K4LA 3CESA 2A05A 1O3SA 5FFXA 1MSFC 4BL0B 2A07F 4KIBA 2VPRA 4F93B 3O8HA 4U0VA 2WBMA 3SZTA 3S2HJ 3JRAA 3RKQA 1LQ1A 2YUSA 3FXLA 2JSCA 2EV6A 5E3NA 4E7KA 3GTMJ 4RAFA 4CCMA 2BGCA 4I98B 2DOFA 2M4GA 2ZKZA 3F23A 4XN0A 1BR1A 2ICWG 2K4JA 2CWEA 2BY3A 5CVIA 3ECHA 2MG4A 1OR7A 2XASA 1YJWI 1TWGJ 2BHZA 3BP8A 2LKPA 2DA1A 3DLLF 1KQ0A 2DLLA 1GXQA 4QLCU 3C7JA 4KMUX 1R9TJ 2H09A 3HKZA 4G9YA 3K4BA 1LDKB 3C3WA 4B1RA 4HW0A 4NBQA 3CCJI 1LNWA 4XN3A 2JK3A 1W0UA 1RR7A 2R4GA 3SEQA 2K9MA 1HW1A 1MH4A 1D5YA 1U6GA 2H27A 3FMRA 1YW8A 2A3SA 4I0BA 4CO8A 5FLMJ 4R79A 3MWMA 4XLCA 3L2VA 2QVOA 4CZCA 1BR4A 1X1AA 4BQQA 3BZKA 4RLQA 5BMZA 3EUKL 2HFHA 3R60A 3T8TA 2QKMB 2NVYJ 2FBKA 1EH6A 3KP7A 4LB6B 2R7XA 4ESJA 1IRZA 3OYHA 2Y30A 3GTPJ 2IBDA 2F2EA 4ZDLA 4U0WA 1MDMA 5B3SH 5FKOA 3OV8A 4WXHA 5E8IA 2ZNYA 2NVTJ 4Y17A 4MTEA 3FIWA 1QO0D 1G3TA 1BOAA 2CJJA 2M0MA 3HJEA 2V6EA 4JP0A 1ULYA 4D9JA 5LLQA 3GTQJ 3ABUA 2HYJA 2JA8J 4RGXA 5E8GA 5FJ8J 4RB0A 4YIFA 2VJJA 4RB1A 3OWTA 3KZZA 3FBIB 4M6XA 2OF7A 2X6OA 2ESHA 4CCLA 1S9HA 4XM3A 1FYLA 1SD4A 4QIWN 4TV7A 2IAIA 1MBEA 4RBOA 2L9RA 3GFLA 1ERDA 2QZ8A 2I10A 5EGOA 2EB7A 5IPAA 2YX7A 1TW3A 2IVMA 2KPMA 2RDPA 3H36A 1Q1VA 1Z3YA 2BXYA 3E1SA 4KITB 3RYPA 2M8EA 3I71A 4DNCA 4Q48A 2V4JC 3QYBA 1XX5A 1Y0UA 2XB0X 4JYKA 3OYCA 3KP6A 1QZEA 5KK1A 3TDUC 3CCMI 1U5TB 2CQNA 1MH3A 3ZMUA 1PDNC 4EM2A 3PUBA 1F43A 4W97A 3IH2A 3L9FA 4ZDPA 2XF6A 5IYCJ 4XICA 5CQGA 3RZOJ 3F8CA 1JUPA 3IC7A 5FKKA 3G1MA 3ZRGA 4YFKF 1WJFA 4B47A 5DM7F 3TO7A 2MD0A 4NNJA 4D5FA 1BL0A 2LVSA 4BQNA 4FX4A 2E1OA 1TNSA 1NG7A 4ZYHA 1JE8A 4B48A 1IRXA 4UVCA 4RB3C 3MKYB 4BHBA 2QBYA 3BR6A 1IXSB 3OL3A 1JKPC 2AQFA 2D1HA 1XPXA 1XTAA 2XV4S 4HDVA 1DGWY 3GZ6A 1BR2A 3H3ZA 5B66C 4IL6C 4Q5SF 3ONQA 1MBFA 2YU9J 3M8EA 5IP7J 4IHVA 2O7OA 2EFWA 3LSGA 1WWXA 2DFIA 2R7QA 2PJPA 3LA7A 2KIQA 1IZ1A 1TWAJ 2ACJA 2DQRA 2Y0MA 1SMTA 2ZFWA 3J81Z 3M1CA 3LQRA 3J7YJ 1K78A 1MSEC 2G7HA 3EUAA 3R61A 2ZMEA 3HSEA 3MD2A 2XF7A 3S15J 1UG0A 1I6HJ 2DA2A 4AIKA 3Q3SA 4DBQA 3F6VA 3IAM2 3BWGA 3BLYA 3VSLA 1T39A 1O57A 3H0GJ 2VOOA 5ICCA 2VLAA 3FISA 4L5JA 4OINF 4EM1A 1T95A 4A5MA 4WK8F 4V2FA 3H1CA 2R5YA 2Z3YA 5EEGA 2NS7A 1TL8A 3LSTA 5CQEA 3JRDA 2GM4A 5IT9Z 3KYLA 3BG5A 4LK0F 1J0RA 3NWTA 2GIVA 2MSYA 3SYTA 2PI0A 3BR2A 1O3TA 3NARA 1QPIA 4DYRA 3FM5A 4Y7NJ 4O6JA 2V1DA 1R6RA 4XBFA 4AVZA 3VEPA 1GXPA 1SMYF 3GXOA 3BJOA 4D5CA 2M7AA 2Z33A 4IRIA 1RZ4A 3VFZA 3EUHA 4Y52J 2CW0F 4Z6YA 1ZQ3P 4P1WA 3PIPF 4AYBA 1AU7A 2Y31A 1N75A 1UHMA 2KL4A 1DQUA 1HA8A 3ESWB 3J7AY 3FXQA 3L2CA 4ZDOA 2HKXA 1MKMA 3SDBA 3KP4A 3IL2A 2QM3A 5JHUA 3WGIA 3HRTA 4IHSA 2DU9A 4HA8A 4IRHA 4JK1X 2CW8A 4PJJA 2Q2EB 1FYKA 1JKOC 1ZH5A 3HSRA 4LG0A 4E4HA 1QQIA 1R4NB 2MH2A 5TGTA 2HVSA 5FRMA 3MN2A 1FP2A 4A3JJ 4E7SA 2M87A 2ELJA 4I7HA 4BJTA 1JXSA 1Y1WJ 3IKVA 2HR3A 2HNHA 2HQAA 1V55H 2X6WA 3GX4X 2OJED 3NRVA 3BY6A 3CP8A 1CF7A 3SQNA 2DA4A 4M3DA 3MFKA 2PMUA 3I55I 1JGGA 3HB9A 4QSHA 2XDVA 3SXYA 1BM9A 2ISYA 1VQ4I 1B4AA 2LG4A 2P6SA 2VT2A 3ZGKA 1R23A 3PQJA 2MC3A 2OU2A 1HBXG 3M1EA 2PFBA 1KYWA 5HLTA 1U3EM 4XOTA 1NK3P 2IS6A 3LFUA 2PBIA 2VE8A 2JRTA 2WAQA 4A12A 2ZSIB 1R1TA 1FBSA 2F5FA 5LGTA 4HRIA 1WGXA 2K40A 3V42A 3LSMA 1R49A 4CICA 5FO5A 1Z7LA 4ZJZA 2VJ5A 4HX7A 3BPXA 3WGHA 2FD5A 1IV6A 2DI3A 2V9KA 4FT8A 1USTA 4V19K 2L01A 2OV7A 1MD0A 3CLQA 3BT9A 2XKOA 3RPQA 4GYGA 4HF0A 2EFNA 3ZOBA 3HHGA 3OYDA 3J80K 4EV0A 3M3YJ 3D1NI 1BW6A 4A3BJ 2FSWA 3AG2H 3U1KA 3HOZJ 3F22A 3AG1H 2DBBA 1MJ9A 4OU0A 4HYEA 3C2GA 4BAYA 3GFIA 4HQEA 3S3MA 4LIVA 3A0HC 4PGHA 2ADUA 2E1MC 2EK5A 3I4MJ 3U1DA 4BHCA 1VQOI 3OIOA 3PO3J 1BIAA 1LFBA 1I39A 2GWRA 3BOQA 1AA7A 4ASNA 3E3VA 1YJNI 1FWZA 5HLIA 4AIJA 4OOIA 2E2IJ 2VC1A 2M9HA 3TGNA 2E1NA 2EZKA 2BY1A 5EG0B 2EV0A 5J8CA 2E19A 1J7KA 4IO9F 3U9GA 3M4OJ 4E6KG 1KGSA 2X51A 2G0EA 3MAJA 4RB2C 4M3EA 3ZMSA 2HU9A 2LMDA 2KDZA 2FQ4A 2E60A 4BEHB 3CCEI 2ZFUA 3CJQB 1VFCA 4E7IA 1IG7A 1LPQA 3AFHA 3WU2C 1MBKA 2LOOA 4UB8C 4WF2A 3I59B 4KICA 1VQ5I 2DFFA 5IYBJ 1XS9A 4I6ZA 4HV6A 2B9SA 2DJIA 5HNHA 3GLXA 2EIMH 1IXRC 3TP0A 2BOLA 1DPRA 4F3QA 2R7WA 4OMYA 2CFOA 3WU0A 1SFXA 4BGDA 1ZG5A 2R7OA 3JAMZ 2W84A 3AKZA 3M8FA 3F3XA 4L9TA 3FXRA 3R0JA 4C3IJ 2GBYA 2EFOA 1PJRA 1LDDA 2HWVA 2UWMA 2G9WA 1VQ6I 3OYEA 1G8XA 5FFZA 3Q0UA 3KYCB 3A02A 2RKHA 5EYRA 4BYYA 1UB9A 2Y75A 4IRGA 4M3GA 4XSXF 2VODA 1FTTA 3JSOA 4FTHA 5IOYA 4N9HA 4KYWA 1J9IA 2FA5A 1FT9A 2KZGA 3HZJA 1QZZA 4UUVA 1KQ9A 1ZYRF 1UFMA 3BR0A 2QSHX 1ZELA 4LMYA 3PM1A 4PJNA 2XROA 3L2WA 1X2NA 5FGMA 1KQ8A 2ZSHB 3UR3C 3HXLA 4A3KJ 3HEFA 4KISA 1X3ZB 3HOSA 4XIDA 3HOXJ 1C0WA 3MMYB 2LD5A 3CZ6A 3ZMDA 1VTNC 1W7PD 3FXKA 2R0QC 2UV1A 5LHHA 2TCTA 2LKXA 4E70A 3ERMA 1XMAA 2A68F 3C18A 1WKMA 1LDJA 2M2EA 4E7LA 4IKFA 2BXZA 4KT5C 3L2RA 2XSDC 1E0EA 6PAXA 3KEQA 5CYVA 1SD7A 3M9AA 2XPVA 2AQEA 2X85A 1ACIA 2H8WA 1ENHA 1BJAA 3I0TA 1YX5A 4L18B 2O3FA 3E6MA 4WCGA 1P4XA 4UV8A 5TISC 1OMIA 2JA7J 4CXFA 1YI2I 1TP4A 1I1GA 1WJ5A 1Y8QB 5IT3A 3CMAI 2E7XA 3DPUA 3ML6A 2DPDA 2NRAC 5CVRA 4I02A 3DF8A 1FC3A 3DTIA 5DM6F 1ETOA 1WPKA 1RIOH 4IQ4A 4EGZA 4G6TB 3TO6A 3VWBA 1WCMJ 2WWYA 1R00A 3PNYA 3SEZA 3CMMA 1ZRDA 2XGCA 1ZLKA 3K0LA 2BBYA 5C4JJ 4EMSA 1B8IB 3SFIA 3G3ZA 1FOYA 3HHHA 5HOOA 4PZJA 4C3HJ 5F64A 3U21A 3DV8A 2NAZA 1GDTA 4U87A 1XB4A 5EGOB 2MYSA 2NS8A 1QA6A 2QENA 1IN7A 1F9NA 3HRSA 1VQ8I 2L7ZA 4MFEA 1VQMI 3OYMA 4MQVA 1DU6A 2EFQA 1QPMA 2IGOA 2JUGA 5K7ZA 2WB1N 3BDDA 1USSA 2JJ7A 1T2KA 2VBWA 2VBYA 5HODA 3F8MA 2QGUA 4BXUA 3JRIA 2HTSA 1VI0A 2E71A 1YYVA 3DEUA 1VNDA 4LITA 4X1EA 1TT5B 5J40A 3O3KA 3D5SC 1MBJA 2FNPA 2J5PA 2MLGA 5E1WA 3GFJA 5M5XJ 2E5ZA 5TJJA 3R4KA 4JX5A 3MKWB 2M8GX 2K9LA 1XGMA 4CDGA 3JRCA 3D5LA 1D8JA 2AXTC 1TQIA 1XGOA 3WTUC 2IP2A 1IUFA 2XIGA 2QBYB 4D7NA 2ISZA 4DOZA 5F04A 5M5YJ 3QWLA 1QGPA 3G1OA 5IP9J 3S1NJ 1U0JA 3C2BA 4CZZA 1UZCA 2R7ZJ 1I27A 3MVPA 4XRMA 3W2WA 3B73A 3A01A 2CU7A 1QBJA 3ABKH 3RKWA 4S05A 1MMAA 1U5TA 2EZIA 2VASA 3F72A 2W25A 3HG9A 3HOTA 2OQGA 4L0YB 1X1BA 2Z16A 1OYWA 3ULQB 1ZG3A 2RNJA 3QAHA 3GO5A 2LK2A 4M6YA 3AG4H 3G1LA 3CP2A 2PMZN 3I58A 1BIBA 2HVQA 1BI1A 1RRJA 1SFKA 1QVUA 3BJ6A 4K2EA 3LAJA 2VKEA 5LRRA 3CO7C 1ONVA 3S16J 1G3YA 5IP6A 1J09A 1SANA 2HXIA 2KDOA 2VJ4A 4HSRA 4U88A 5D8LB 4MTDA 1JTXA 2PEXA 1F5TA 1QVTA 3I4PA 1MMSA 1UJ8A 3HGGA 2JTVA 3DKWA 1Z7UA 2VE9A 4H0EA 1WI3A 2OCCH 1XGNA 2E2JJ 4KIGA 5JVGF 1YOVB 3T8RA 2A5WA 2M45A 1L3LA 2JUCA 4ZTJA 5DCFA 1R5HA 3K1MA 1PP8F 3SZGA 3JR9A 3H3UA 2MABA 2LBFA 4U7DA 4F7ZA 4HF1A 3QRFF 1N25A 2X1CA 4ZYGA 2F6CA 3ZR8X 2CFXA 2XGXA 3FXOA 4XLAA 1FZPB 1ZR4A 4LIUA 5LFAA 5C3EJ 3TW7A 3CQZJ 3ERED 2DQLA 1OYYA 3KP2A 1EA3A 2GOXB 1WH7A 2X48A 1E2XA 5DUIA 4AYBN 4DYCA 2X1EA 3E6BA 2X9DA 4C2TA 2HPIA 3CCQI 4AUXA 4ZZLA 4GO1A 1L0OC 1IRGA 4P9FA 1OPCA 4EGYA 2QQ9A 1U9OA 3TL4X 3QP6A 1IN5A 4OIPF 4BH9A 1X19A 5J3LA 4ABZA 1WFXA 2H8RA 2X6YA 2XPUA 4AVPA 3B6AA 5E1ZB 3J80Z 1W7PA 1SVMA 1FMVA 2R5ZA 1E3HA 5F1RA 4II2A 1XC5A 1FX7A 2M1BA 3J7AO 1FSEA 3PSFA 3WHCA 2RQQA 3QPLA 4F52A 1ZN2A 2COBA 4XRSA 1W36C 1KU9A 5LHIA 3KCCA 2VN2A 3UNGC 2V1NA 1UAAA 3FX3A 3S93A 1FBUA 4XK4A 2PMZA 4EJOA 2QKLB 1T8IA 3QQAA 3BQZA 5L3BA 1T08B 2DDAA 3WTYC 2QSGX 1OYIA 1TTYA 2UXNA 2PQ8A 1ZRFA 2DMPA 4CCJA 2DA3A 3MCZA 4EATA 3HDDA 3BR5A 5DEQA 3HC7A 2E5NA 2VT3A 5F08A 4BBSJ 3P9KA 3WTWC 2DA5A 4XRFA 1X58A 2B7EA 5DUKA 3VYSB 1HF0A 2JA5J 4IHXA 2IA2A 3TEDA 4IHYA 2CH0A 3FF5A 2R3SA 3S32A 5FROA 4FCYA 4A6DA 3CCLI 4IJAA 1H0MA 2PMHA 3HSFA 2QCOA 3P9CA 1TW2A 1D0XA 3OIQA 4B8XA 5L3CA 1RC9A 2LC2A 2FRHA 1FP1D 4NC8A 4FX0A 2R7DA 4WXCA 3FMSA 2FOKA 2F4IA 4GRIA 1B1BA 3I3LA 2A6EF 4MQ9F 2CO5A 2XAQA 3EUHC 4HV5A 2OBPA 3KX2A 1U5TC 3LNQA 3WTXC 1GVJA 2WAQN 2RV8A 5KCMA 2M0CA 3SDGA 2FNAA 4BQOA 1MMNA 3MQ0A 5ICEA 1HOMA 1HKSA 5K7FA 1W5TA 4KFCA 5F27A 3IKTA 1JKRC 2IGKA 3A1YA 2VKDA 4B44A 5ICGA 5IY5H 5HNFA 2QWWA 2DA7A 1GUUA 3IP4B 3GVAA 4NUBA 4CCKA 1D8KA 4BUPA 2W1OA 5J1UA 3WG7H 4LGWA 2HOSA 1O3RA 3DPTA 2B0LA 1R5ID 2ELKA 2PLYA 1SVLA 2BYVE 2ZXJA 4XL9A 1QHGA 5CPRB 3RQIA 1RESA 3HTUA 1BJZA 5GTIC 3A0BC 2O61A 1T56A 1YFHA 3ZQQA 2KJCA 2LF8A 3SZPA 3QYFA 1RKWA 4M3BA 2K3PA 4R8HA 3BQYA 2LDUA 3CF5F 4D7MA 4W1UA 5D5VB 3RQ4A 3J7ZI 2DW4A 1WZ2A 2EZLA 4KA4A 1ETVA 4NQWA 3BG6A 3CC4I 1X4OA 2ZO4A 1ZARA 3HL2A 1A31A 3TOAA 2M30A 3CDLA 4KNYA 4CA0A 4EM0B 3KPHA 1BI2A 2HOTA 3ASNH 1TQPA 4BDYA 2HOEA 4WXDA 1ZLJA 2M34A 2BEOA 4U7BA 1MGTA 2E7WA 3OIPA 2ZCWA 1HSTA 1A6QA 2CQ7A 1T33A 1E3PA 2CMPA 4PSXA 1JT6A 1Y8RB 4XSZF 4BKXA 4DYQA 4HF2A 5HDKA 4P9UA 1R5GA 3H0DA 5A2QK 1SVOA 1V4RA 4B3XA 2AS5F 4AC0A 3S3NA 2JA2A 2K4BA 4NC7A 1LB2A 1IJWC 1D0ZA 4IHTA 3GBGA 1S7AA 4FE7A 4BHPA 3OY9A 1DP7P 1IO2A 5LHGA 3ECOA 2RNGA 2HEOA 4L9NA 3Q9VA 1MW7A 1Y0NA 4PJMA 4A3EJ 3O8GA 2WC2A 1WJCA 4LD5A 1ON2A 4QPQA 2KISA 3FZVA 5DV5A 3GTGJ 4HBLA 4ENKA 5FKLA 2CUZA 1YIOA 2CRGA 1Z9CA 2BV6A 1S29A 4NC6A 4MIMA 1XDSA 3ASOH 3IWFA 3ZMTA 1B6AA 3OSFA 2GIZA 2F4OB 5GAEJ 1XN7A 3KP3A 2KZVA 5E20A 4BJ6C 2IS1A 5DYMA 4EJVA 3HUGA 2MD5A 4BBRJ 4C2UA 1FTZA 5FKMA 3OS1A 1YTYA 1J2XA 1WI9A 3KEYA 4HG2A 2QEXI 4YFXF 4ENMA 4P55A 5CKTA 2L9SA 2DT7B 4HPQA 2D2WA 3D0SA 3CUQB 3WHBA 1DPUA 2Z9OA 4J19A 4AIDA 4Y33A 4AM3A 2O0YA 1PYVA 2WA0A 2E1MB 5C4XJ 2HPMA 4G6DA 3L1PA 1B59A 3OL4A 4RAZA 1DU0A 2NOJB 1UELB 4A0YA 3S1QJ 1JI8A 3HPHA 3QOPA 4ESFA 2DFHA 5AONA 1SEUA 2E34A 4IF4A 3ZXSA 3CC7I 2LF7A 3FHNA 2PJRA 4CYCB 3UKGA 3T0YA 1V5EA 5KAFC 3CMYA 2VB6A 5H20A 1EH7A 3V7RA 2R7VA 2JT1A 4IPAA 4C9YA 2D1VA 3FXMA 3I9V2 3RTRA 1HKTA 2L02A 2BW3A 2I8DA 3MEXA 4IXAA 3H5NA 5J4VA 3E7LA 1Y39A 1PUFB 3W6KB 5GPCA 3LAPA 2R7RA 2HI3A 2RN7A 4RGUA 5E17F 2BVLA 3DEEA 2BHYA 2R5ZB 1Z05A 1W0TA 3DBRB 2EJRA 3FK6A 1V5FA 4WWCA 2P5VA 2LSOA 2LY2A 5F0CA 3E6DA 1WH5A 2L3DA 3JRFA 4YRVA 4BQAA 3CCRI 4ZYAA 4GFBA 3CUOA 5FRNA 3GMEA 3P7NA 3K10A 4N9IA 5FB2A 3QU6A 3RYRA 3QOEA 2E36A 3LSHA 2BVMA 1O4XA 4CCOA 5FKNA 1V54H 2Z99A 1G3SA 3EETA 4L5IA 2JPBA 3CCSI 4LG0B 3T5XA 1VQ9I 3CTAA 2NNNA 1IAWA 3K6GA 3KZYA 2OA4A 5K1YA 2LR8A 2XAFA 4UUTA 4A3GJ 2KRHA 3CJRB 2RC4A 2FE3A 5GADJ 1DUXC 5KNLA 4RM2A 4IZZA 2EIJH 4UUSB 4M72A 4XLEA 5B1BH 4I76A 4OWRB 4YIRX 2HS5A 3OYBA 5DCMA 3NWSA 3G71I 4I99C 1HW5A 3BTCA 1I3QJ 1QU3A 3W2VA 1HW2A 2B63J 2WAFA 1MMDA 3FK7A 3ZN1A 2W85A 3TOBA 2KHMA 1LE8B 4G7OF 1IC8A 3ELKA 2YSRA 3DPLC 5L3EA 3O2PE 1FYMA 3DEWA 2WV1A 4HZFA 3WTVC 3NEUA 3E5UA 4XORA 2WADA 3S8PA 1K4SA 4J01A 4NDLA 1Q1HA 1NHAA 3M7GA 2A61A 1XCBA 2NVUB 1Z67A 1SD6A 4HAMA 1F36A 2KFDA 4M3FA 3PL8A 1JHHA 5HS9A 2EA2A 2JA6J 2CV1A 4O3MA 3CF2A 1MIJA 3C2HA 4N4OB 5BPIA 4B4CA 4ZC3A 4JBAA 3F21A 2VC0A 5K5QA 4RDUA 2KP6A 2R7SA 4B3AA 1E3OC 3LWFA 5J6XA 2FEZA 3IWZA 1AKHA 3Q5FA 5CJ9A 4BE0A 2GXAA 1E17A 3LMMA 1VQLI 3E6CC 1Z6TA 4M71A 4UVAA 4DQ2A 2UXXA 5HDNA 5B5EC 1HKQA 3RCOA 2TRTA 2GOMA 3LA2A 2M7BA 3S1RJ 3JREA 4I09A 5JR3A 4LLLA 1SFOJ 2P5KA 3KIOA 3JSPA 4YEJA 4LLGF 3IHUA 2NVXJ 2K27A 4HDUA 4FQGA 5FLVA 1RKTA 3DBLB 2IA1A 3WGGA 5JLWA 3COAC 1HC8A 2CGPA 1RPWA 2DXIA 1I3AA 2COMA 2HOAA 2K9NA 2F4MB 3DU6A 3DBHB 5GAGJ 1PUEE 3BZCA 2JVHA 2A5YB 1WJEA 1P9QC 3BCBA 4BEHA 1YRNB 3AL0B 2NS0A 1AWCA 1S3JA 3BG3A 3BPVA 2VQGA 1R1UA 2R93J 1S7OA 1D1BA 4H4KC 4OMZA 4OIOF 1EF4A 1ZHFA 4IOCF 1ZGAA 3IRRA 1UMQA 4J00A 2OQRA 2A6TA 2FQ3A 5LEJA 1ZREA 5JVTA 3CJTB 4XNFA 3OYJA 3CCUI 3RIRA 3K69A 2EH3A 2NVQJ 4HOBA 1FLIA 3LSJA 1ODDA 1LVAA 1ZG1A 2BY2A 5DS9A 3CJNA 4RAYA 1MJBA 5J1RA 2F5DA 3K9TA 4NB5A 2GAUA 3JTGA 4C30A 3F9KA 2HYFA 3PFIA 2HTJA 3I53A 3S2WA 1VF9A 4UXNA 2IA0A 2ZC2A 3TQNA 4BY1J 5M5WJ 4YFNF 3TP3A 4ENJA 2ELHA 2DYSH 5HS8A 3Q9SA 3E5QA 4PCQA 2XB5A 1QRYA 4XRSG 5F6FA 2Z5UA 1RUOA 4BE1A 5EEHA 3IUOA 2IW5A 2ZJ2A 2OZUA 2X1DA 2HXOA 3T1BA 4FHTA 2HDWA 4ON0A 3K70C 1LFPA 3V7CA 1IN4A 2ZMEC 3ABLH 4F55A 2A69F 2GXGA 9ANTA 3PUFA 2K85A 3F6OA 3LSKA 1U2WA 2IGNA 4KUMA 1KU2A 4Q4ZF 1FNNA 2DFEA 4ITVA 3RZDJ 3GFMA 3RI4A 3PJRA 1IRFA 3ZQHA 2Y0SA 3GUDA 2CQKA 1MBGA 4ZTFA 1IGNA 1ETQA 1O7LA 2H6BA 2PN6A 3OMYA 1JGSA 5GPAA 2FF4A 2HDCA 2LYCA 2GA2A 3F0CA 5KAIC 4FE4A 4HNVA 2YU3A 3GLLA 3V8LA 2DT6A 2FMLA 3Q0WA 3TW6A 2FOWA 5BQTA 5ED4A 4QTRA 2QYOA 2FXAA 4FASD 3S17J 3ROUA 3KLOA 1QHHD 1U8BA 2LRDA 1YHQI 1JTYA 3G2BA 3ZCOA 1XCVA 3VSKA 3S1MJ 4RLFA 2FJ1A 2V9VA 3K7AJ 4ZYEA 2ZJQF 4OIRF 3ZQ7A 3F8NA 2VQHA 2P8TA 5DDGA 4HEA2 1FOXA 2H1KA 2JMWA 3K4MA 5HDGA 1JT0A 5M3FJ 2RQPA 3M07A 4UB6C 1K6OA 5FLXZ 2Z1DA 2VXDA 3DCFA 2PJRB 1D1CA 5E1XA 3CO6C 4D1QA 4ESBA 2VQCA 5A2QZ 5GP9A 1U9NA 3QPSA 4WX9A 1PP7U 3HYIA 1BA5A 2IT0A 3IH3A 2K5CA 2L0KA 1IXCA 3HOYJ 4A3FJ 3S14J 3WTZA 2IGMA 2LNBA 5H6RA 4B09A 4F92B 2VKHA 1R36A 3LL7A 2WY7Q 3H3VK 4CCNA 1ETWA 1WSUA 4N0BA 1GHCA 3K2ZA 2P5LC 3VYRB 1CGPA 2M5WA 1IN8A 1Z91A 3CDIA 1JHFA 3HOWJ 4KN4X 2KLOA 1GV5A 2KRFA 3OR1C 3MZ8A 4I0AA 1XD7A 3PNTA 1JKQC 2L4AA 1UG2A 3JW4A 4A93J 2EWNA 1ORKA 4S04A 1I50J 4A5NA 5CVVA 4XKCA 3OOPA 3GYHX 1XSVA 2DOEA 4GCVA 2V79A 3K4JA 5DD8A 4BACA 4QWQA 2OD5A 5B1AH 2J5OA 2L4MA 3AL0C 2PG4A 5ERIA 4UVBA 1EV7A 3K1NA 3L09A 3L7WA 1P2FA 3GZ5A 4XOPA 1P6RA 1KU3A 2Z2SB 3P9IA 1K7AA 1Y6IA 1YQAA 3DFGA 1XGSA 3FHZA 3KFWX 1ZK8A 2Q1ZB 3KE2A 4A3MJ 1IDZA 1VQKI 2WAEA 4BDZA 4A6EA 3FKJA 5EDNA 3B02A 2XC7A 2QA4I 3DTKA 2IS2A 2ETHA 2L7FP 1HDDC 2JRMA 2F5VA 1XDUA 2OC6A 1A36A 1OKRA 2AO9A 3BG9A 4G12A 1LEBA 1SFUA 3N4MA 1JJ6C 1WJBA 3K4CA 1VZ0A 2V9PA 2L9NA 3VODA 1POGA 3A4CA 1R58A 1X4PA 2Y2ZA 2MLKA 3FXJA 1MNMC 1AOYA 1W5CC 3JRBA 2K02A 2CG4A 4A3DJ 2XRNA 3ZN0A 2KIUA 4XKVA 4XLHA 1QNTA 3C1DA 2HVRA 2CV2A 4PK4A 3V8KA 4UNOA 2KIFA 5KVRA 3GW2A 4MO7A 4N4NB 2R7UA 3MKZA 1FMWA 4KJZA 5EZHA 2XAHA 4YIIA 2XAJA 1GV2A 2L9VA 2DTZA 3K1PA 2L2OA 1V5GA 2DPUA 2CSOA 4XLNF 3F8FA 1D0YA 2LFBA 4CYDA 1TWHJ 5GAHJ 5LRSA 3L00A 2FX0A 4KDPA 1YJ9I 5E79C 5CVUA 2V1UA 3HOVJ 2EIKH 3EYYA 5LBQA 5JI6A 3GTJJ 3EDPA 3VDXA 5F0HA 1ZR2A 1LFUP 1OCOH 2LP0A 4KMFA 2ECBA 5IT9K 3A03A 2BE5F 2R7TA 3E0JB 3OS2A 1SFEA 4DZPA 1Z0XA 2IS4A 4XQFA 3E5XA 4QPOA 4M74A 3ISPA 1NG6A 3ZQCA 3N97A 1XG1A 3V7SA 3JTHA 4V2GA 2HQNA 3EYIA 2ESNA 3VOEA 1K79A 3CUQA 1B9NA 3V8JA 2EINH 4MNUA 4G7HF 5HLHA 1YRNA 1H9GA 1TC3C 4Q47A 1T38A 1BI3A 1S5LC 1R22A 3BR3A 4CSWA 1VQNI 2DDBA 3VPRA 4LB5A 3LA3A 3KLNA 3J81K 2HQ5A 1K78B 1ZTRA 2YPRA 2E1CA 4Y4RA 2DMNA 2P81A 2D45A 1BC7C 1AHDP 1ZRCA 1RETA 3ZMZA 5BS6A 3ZQLA 3LFKA 2HDDA 4NHJA 4M6VA 3CCYA 4CYCA 1IW7F 1TWFJ 2BZTA 3L2QA 5LGNA 2W57A 2M3AA 2CUJA 3HTSB 4KN7X 2NNYA 5FLXK 2FMYA 3H9GA 2EV5A 4C3JJ 5EEAA 4X0GA 2GXBA 2V1XA 4XLFA 2R5YB 3BTLA 3I64A 2HYGD 3W3CA 4RAGA 4JOMA 2JZYA 2EPFA 1P7JA 5ILVA 2JWTA 2EZHA 2NXNB 4AWXB 2FUG2 3BZ6A 4BJ5C 2XHKA 3F8BA 2NYXA 3FMQA 4UUSA 3GTLJ 3CLOA 2K3FA 2DODA 1SC7A 2XRLA 2M4KA 3LQQA 3ABTA 5D6FA 2I5UA 2P7VB 2JPCA 3AAFA 3A2KA 5EF6A 4CGZA 2TDXA 2EBIA 2LLKA 1RUNA 5K5OA 1IN6A 4OAZA 3G73A 3ZMVA 4AIHA 1ZGWA 1HQCA 2DN0A 5H6QA 1IF1A 3IH4A 3IV5A 5HS7A 1H9TA 2ZJRF 5IYDJ 3RKXA 3X2QH 1K83J 4M9XA 3VYTB 3K4KA 4EJUA 4LJZF 2G7UA 3TKYA 1LEAA 2KMUA 1G59A 3LOCA 2X6XA 3GTOJ 4BS9A 3PSIA 1W1WE 2IPQX 5D5WB 4BU2A 1F1ZA 3GCMA 1ETXA 5F1JA 2VOPA 2LY9A 4EJTA 4Y3OA 1Z6RA 5D5UB 4LG3A 4CHUA 3ZQGA 3ZPLA 2K86A 1APLC 2GA1A 1W36D 3MZHA 4DJAA 1I5ZA 1BOBA 1RNLA 1H88C 3R0AA 3OYLA 2RVCA 3LSPA 2RAEA 3S3OA 2ZXIA 2EQRA 1K4TA 3W6VA 1OCPA 1YS6A 2GLOA 4II3A 3G4SI 3HKZN 2ZXWH 1UHSA 2D5VA 1SAXA 4I2OA 1B9MA 1ZAOA 3KETA 2L54A 2W82A 2DT5A 3DU5A 1D3YA 1B72B 2WV0A 3TMOA 5E3MA 1DDNA 1R7JA 1OCTC 3W2AA 3PIOF 2H1LA 2WB1A 4JX6A 4HNTA 3BJAA 1O7FA 3MKLA 2YS9A 1MMGA 1MJAA 2QSFX 2XGDA 1VQ7I 4PGGA 2ID3A 3D5RC 4Z2YA 2FBHA 4JQFA 1B72A 1V3FA 2OTLI 2QQAA 4RA2A 1TZLA 1S6LA 3ZQFA 1JJ8C 5AIPA 2O9LA 2WY8Q 1FPQA 4JX4A 1MDMB 3CUQC 4E7ZA 4IVNA 4XONA 2ECCA 1BI0A 1YW9A 1H89C 5FD6A 3BCAA 1KZHA 4NQWB 4RM3A 2LY1A 3DWLE 3AG3H 3QU3A 4MHGA 3I59A 1WHUA 2C6YA 3PFYA 4GDFA 1J75A 3FBNB 3QP5A 4BE2A 1W4MA 1WJDA 3H9JA 2L7MP 2O6GE 1T0FC 1K6YA 3RSNA 2O8KA 3HPGA 4DIQA 2ZBKA 1O3QA 1KYZA 2W4SA 3H35A 4EVIA 1SAUA 3G6EI 1HCRA 4G8XA 1IUYA 1GLNA 2P0WA 4L9VA 2JQ7A 2CYYA 3NQOA 3BG7A 2YX4A 2KQRA 1XSDA 1I6XA 3LSIA 3B6CA 1P4AA 3M8JA 5EG0A 3WTTC 2ZB9A 3QODA 1RR8C 5JHFA 2XSJC 4LLNA 1LJ9A 2VIXA 2CQQA 3OYNA 2P4WA 4G94A 1Z3XA 1X1PA 1SD5A 3GZNB 2WTEA 3FM3A 3EQLF 3RPUD 5E18F 2DMUA 2JSPA 2IRFG 4L9JA 3IRQA 4FETA 3CCVI 4CH7A 2OPTA 4A0XA 3OR2C 1TLHB 2KKOA 3SHFA 1HLVA 2CUEA 2EILH 2H6CA 5DTDA 3BROA 2HGCA 3RDIA 3OYGA 2DJNA 3FDYA 4YG2F 5AIQA 4UY8I 1GVDA 4XKWA 4OIQF 2K9SA 1LUJB 2KJBA 1A6IA 2VL8A 2ZNZA 3S2DJ 4MEYF 3WTSC 2DK5A 3KZIC 1ITYA 2IJLA 5D4SA 3DP7A 1LKXA 3CC2I 1MNDA 3DLAA 1ETKA 4HLYA 4X6AJ 3EPZA 1W5SA 2DYRH 2E2HJ 3KEOA 1TT0A 4L0ZB 3ZQIA 5CVJA 1H8AC 4RMNA 3DQVC 2QUFA 1TBXA 5LEKA 1K61A 4M73A 4MEXF 2O03A 3H92A 4G7ZF 1QZYA 1YW7A 3DXJF 4A69C 5HLGA 1F4KA 3I56I 1S8NA 1T6SA 2L5QA 3DTEA 5DD4A 3VYUB 4AU7A 5HVQC 1OFCX 2ZMEB 3CDHA 1X2MA 2K9QA 2IEKA 3PQKA 2GQQA 2AHQA 3TDZC 1NK2P 3ABMH 4P96A 1LVKA 1XMKA 3JCUC 2O5RA 2STTA 3HOUJ 3BTIA 1IDYA 4P5OA 3SJMA 1HXDA 2R7FA 4S0HB 2MW8A 3K4NA 3REOA 1EJ9A 2DAOA 3RPUA 3N05A 1WVRA 2JVGA 1S7EA 2VXZA 1FOWA 1R4MB 1OISA 1WJAA 2KT0A 4A3LJ 3JAMK 4HQMA 3OS0A 3PNVA 1P7IA 3CD6I 2QQBA 4LFUA 2STWA 1OCZH 4GXOA 1G4DA 1N77A 4IHWA 5JFRA 3WODF 1D5VA 1ON1A 4BXXJ 2KIMA 2X4HA 4DGWB 4OAYA 4XKBA 3H5AA 4E7JA 1MNEA 1FBQA 1DP3A 5J1YA 1JUSA 2KRCA 5JLXA 2Y69H 5F0FA 1J5YA 1J59A 4HX4A 1PUFA 2DMQA 4ZH4F 1FEXA 1X1DA 1GT0C 2DA6A 3GWZA 1A5JA 1TNTA 4BY7J 3FKIJ 2R92J 3WE2A 3R6SA 1OQYA 3I4NJ 2CS3A 1TWCJ 5BOXA 1KA8A 2VQLA 2VKVA 5J47A 2K7LA 2XAGA 5EJCA 4MLOA
chains in the Genus database with same CATH topology
3WG9A 3RKYA 4I01A 4ETSA 2Q2EA 1T0FA 2X0LA 3VB2A 1MZBA 3O6BB 3HRMA 4RGSA 1YG2A 3TO9A 1UCRA 1T98A 5D4RA 1CF7B 3WU1B 2YR2A 2O8XA 2VBZA 4ZYDA 1WQ2A 3GEZA 5DCMB 2MA3A 4RGRA 3I5UA 4UV9A 1REPC 4HLXA 3I54A 4R1HA 4Y13A 3MZYA 2P6TA 5FD5A 4BNCA 4GGGA 3FWEA 1A04A 1U78A 3E97A 4MGRA 5L3GA 1YO5C 5D8KB 5LGUA 1FSHA 3V4GA 2W24A 2VONA 2FBIA 1RI7A 2VBXA 1YS7A 4UHTA 4HX8A 2OZ6A 2EFPA 2H94A 1FOKA 4EJWA 4U0YA 4M9ZA 5BPDA 2GZWA 2MBFA 1G6NA 1ZGJA 2V6CA 1G3WA 2AXLA 4GYIA 4G6QA 4PDKA 2RGVA 1FY7A 5J8FA 3W6JB 5ICFA 4EQQA 4A0ZA 2A6HF 2DTRA 2QLZA 5K5RA 1P4WA 2XVCA 3ZP5A 4ZZDA 1I1SA 1XSXA 1BN5A 2XUBA 1BBYA 2FU4A 2F5CA 2Q0OA 4M9SA 3HIFA 4A2UA 4RS8A 4Y15A 1Z1DA 2HZTA 2P7CB 1W7PB 3GF2A 3QPTA 3KP5A 1STZA 1R1VA 2UZKA 1KU7A 2XKPA 1BC8C 1TQMA 3QPHA 2DK8A 1X3UA 4KIFA 2MH9A 2F5EA 5TRDA 1UHWA 4ENNA 3FXUA 3RJPA 4O5VA 3U2RA 5D6EA 5L3FA 3WE3A 5CLSA 4AD9A 5ILUA 1U8RA 5D5XB 2Y48A 5L3DA 4XLPF 1EH8A 2OAZA 2DO7A 2Q8KA 1HSJA 1WRJA 4LK1F 3HRUA 1P92A 2HKOA 3SFZA 4D0PA 1YLFA 2HQRA 5ILSA 2EA4A 1O3SA 2A07F 5FFXA 4KIBA 4U0VA 3SZTA 1LQ1A 2JSCA 2EV6A 2BGCA 4I98B 2ZKZA 3F23A 2K4JA 2CWEA 5CVIA 3ECHA 1OR7A 2XASA 3BP8A 2LKPA 1KQ0A 2DLLA 1GXQA 4QLCU 3C7JA 4KMUX 2H09A 4G9YA 1LDKB 3C3WA 4HW0A 1LNWA 1HW1A 1U6GA 2H27A 3FMRA 1YW8A 2A3SA 4I0BA 4CO8A 4R79A 3MWMA 2QVOA 5BMZA 3R60A 2HFHA 3T8TA 3KP7A 2FBKA 1EH6A 4LB6B 4ESJA 2F2EA 4U0WA 1MDMA 3OV8A 4WXHA 5E8IA 2ZNYA 4Y17A 4MTEA 1QO0D 1G3TA 1BOAA 1ULYA 5LLQA 3ABUA 4RGXA 5E8GA 4RB0A 4YIFA 4RB1A 3KZZA 4M6XA 2ESHA 1FYLA 1SD4A 4TV7A 3GFLA 2QZ8A 2EB7A 2YX7A 1TW3A 2IVMA 2RDPA 3RYPA 2M8EA 3I71A 4DNCA 4Q48A 1Y0UA 3KP6A 5KK1A 3TDUC 1PDNC 1U5TB 3ZMUA 4EM2A 3L9FA 3F8CA 3IC7A 4YFKF 3TO7A 4FX4A 1TNSA 4ZYHA 1JE8A 4UVCA 4RB3C 4BHBA 2QBYA 1IXSB 2D1HA 2XV4S 4HDVA 3GZ6A 3H3ZA 4Q5SF 3M8EA 2EFWA 1WWXA 2DFIA 2PJPA 3LA7A 1IZ1A 2ACJA 2DQRA 2Y0MA 1SMTA 2ZFWA 3J81Z 3LQRA 1K78A 2G7HA 3R61A 2ZMEA 3HSEA 4AIKA 3F6VA 3BWGA 1T39A 1O57A 2VOOA 5ICCA 4L5JA 4OINF 4EM1A 4A5MA 4WK8F 2Z3YA 5EEGA 3LSTA 5IT9Z 4LK0F 1J0RA 2GIVA 2PI0A 1O3TA 3FM5A 4O6JA 2V1DA 4XBFA 3VEPA 1GXPA 1SMYF 3GXOA 3BJOA 2Z33A 4IRIA 1RZ4A 3VFZA 3EUHA 2CW0F 1UHMA 3FXQA 3L2CA 2HKXA 1MKMA 3KP4A 3IL2A 2QM3A 5JHUA 3WGIA 3HRTA 4IHSA 2DU9A 4HA8A 4IRHA 4JK1X 1FYKA 1ZH5A 3HSRA 4LG0A 1QQIA 2MH2A 1FP2A 2M87A 4I7HA 1JXSA 3IKVA 2HR3A 3GX4X 3NRVA 3BY6A 1CF7A 3SQNA 3MFKA 2PMUA 3SXYA 1BM9A 2ISYA 1B4AA 2P6SA 2VT2A 1R23A 3PQJA 2MC3A 2OU2A 1HBXG 3M1EA 2PFBA 1KYWA 1U3EM 2PBIA 2VE8A 2JRTA 4A12A 1R1TA 1FBSA 2F5FA 5LGTA 4CICA 5FO5A 4HX7A 3BPXA 3WGHA 2DI3A 4FT8A 1USTA 2L01A 1MD0A 3RPQA 2XKOA 4GYGA 4HF0A 2EFNA 3HHGA 3J80K 4EV0A 2FSWA 3F22A 2DBBA 1MJ9A 4OU0A 4HYEA 4BAYA 3GFIA 4HQEA 4PGHA 2ADUA 2EK5A 3U1DA 4BHCA 1BIAA 2GWRA 3BOQA 4ASNA 3E3VA 1FWZA 5HLIA 4AIJA 4OOIA 2VC1A 3TGNA 2E1NA 2EV0A 5J8CA 1J7KA 3U9GA 1KGSA 3MAJA 4RB2C 3ZMSA 4WF2A 3I59B 4KICA 4HV6A 3GLXA 4OMYA 1IXRC 1DPRA 3WU0A 1SFXA 1ZG5A 3JAMZ 2W84A 3M8FA 3F3XA 4L9TA 3FXRA 3R0JA 2EFOA 1LDDA 2HWVA 2UWMA 2G9WA 5FFZA 2RKHA 4BYYA 1UB9A 2Y75A 4IRGA 4XSXF 2VODA 3JSOA 4N9HA 4KYWA 1J9IA 2FA5A 1FT9A 1QZZA 4UUVA 1KQ9A 1ZYRF 1UFMA 4LMYA 2XROA 1KQ8A 5FGMA 3HOSA 1C0WA 3ZMDA 1VTNC 1W7PD 5LHHA 4E70A 1XMAA 2A68F 3C18A 1WKMA 1LDJA 4KT5C 6PAXA 3KEQA 5CYVA 1SD7A 3M9AA 1BJAA 3I0TA 4L18B 2O3FA 3E6MA 4WCGA 1P4XA 4UV8A 1OMIA 4CXFA 1I1GA 5IT3A 2E7XA 3ML6A 2DPDA 2NRAC 5CVRA 4I02A 3DF8A 1FC3A 1RIOH 4EGZA 3TO6A 2WWYA 1R00A 1ZRDA 1ZLKA 3K0LA 2BBYA 4EMSA 3G3ZA 3HHHA 5HOOA 4PZJA 5F64A 3DV8A 2NAZA 1XB4A 2QENA 1IN7A 1F9NA 3HRSA 4MQVA 2EFQA 1QPMA 3BDDA 1USSA 1T2KA 2VBWA 2VBYA 3F8MA 4BXUA 2HTSA 1YYVA 3DEUA 3O3KA 2J5PA 2FNPA 2MLGA 5E1WA 3GFJA 5TJJA 3R4KA 4CDGA 1XGMA 1D8JA 3D5LA 1TQIA 1XGOA 3WTUC 2IP2A 2XIGA 2QBYB 2ISZA 1QGPA 4CZZA 1I27A 3B73A 1QBJA 3RKWA 4S05A 1U5TA 3F72A 3HOTA 2W25A 4L0YB 2OQGA 1OYWA 3ULQB 1ZG3A 2RNJA 3QAHA 3GO5A 4M6YA 3I58A 1BIBA 1BI1A 3LAJA 3BJ6A 4K2EA 3CO7C 5LRRA 1ONVA 1G3YA 4U88A 4MTDA 5D8LB 2PEXA 1F5TA 3I4PA 2JTVA 3DKWA 1Z7UA 2VE9A 4H0EA 1XGNA 4KIGA 3T8RA 2M45A 1L3LA 5DCFA 1R5HA 3K1MA 1PP8F 3H3UA 4U7DA 4F7ZA 3QRFF 4ZYGA 2CFXA 2XGXA 1FZPB 3ERED 2DQLA 1OYYA 3KP2A 1E2XA 5DUIA 3E6BA 4ZZLA 4GO1A 1L0OC 1IRGA 4P9FA 1OPCA 4EGYA 2QQ9A 3QP6A 1IN5A 4OIPF 4BH9A 4AVPA 5E1ZB 3J80Z 1W7PA 5F1RA 1FX7A 2M1BA 3J7AO 1FSEA 1ZN2A 1KU9A 5LHIA 3KCCA 2VN2A 3FX3A 1FBUA 4EJOA 5L3BA 3WTYC 1OYIA 1TTYA 2UXNA 2PQ8A 1ZRFA 3MCZA 5DEQA 2VT3A 3P9KA 3WTWC 4XRFA 5DUKA 2IA2A 3FF5A 2R3SA 4A6DA 4IJAA 1H0MA 2PMHA 3HSFA 3P9CA 1TW2A 4B8XA 5L3CA 2FRHA 1FP1D 4FX0A 2R7DA 4WXCA 3FMSA 2FOKA 1B1BA 2A6EF 4MQ9F 2CO5A 2XAQA 4HV5A 2OBPA 1U5TC 3WTXC 1GVJA 2RV8A 2FNAA 3MQ0A 5ICEA 1HKSA 1W5TA 4KFCA 3IKTA 5ICGA 2QWWA 3GVAA 1D8KA 4LGWA 1O3RA 3DPTA 2B0LA 2PLYA 2BYVE 4AIHA 2ZXJA 3HTUA 2O61A 1YFHA 2KJCA 2LF8A 3SZPA 4R8HA 2LDUA 5D5VB 2DW4A 4KA4A 4NQWA 2ZO4A 1ZARA 3TOAA 2M30A 4KNYA 4EM0B 1BI2A 1TQPA 2HOEA 4WXDA 1ZLJA 2BEOA 4U7BA 1MGTA 2E7WA 2ZCWA 1HSTA 4XSZF 4HF2A 5HDKA 4P9UA 1R5GA 5A2QK 1V4RA 2AS5F 2K4BA 1LB2A 4IHTA 1S7AA 4BHPA 1DP7P 5LHGA 3ECOA 2HEOA 4L9NA 3Q9VA 2WC2A 4LD5A 1ON2A 3FZVA 5DV5A 4HBLA 4ENKA 1YIOA 1Z9CA 2BV6A 1S29A 1XDSA 3IWFA 3ZMTA 1B6AA 1XN7A 3KP3A 5E20A 5DYMA 4EJVA 3HUGA 2MD5A 1YTYA 1J2XA 1WI9A 4YFXF 4ENMA 4P55A 2D2WA 3D0SA 3CUQB 1DPUA 2Z9OA 2O0YA 4G6DA 1B59A 4RAZA 4A0YA 3QOPA 4ESFA 5AONA 4IF4A 2LF7A 3T0YA 5H20A 1EH7A 3V7RA 2JT1A 4IPAA 2D1VA 3RTRA 1HKTA 2L02A 3MEXA 4IXAA 3W6KB 3LAPA 2RN7A 4RGUA 5E17F 1Z05A 2EJRA 4WWCA 2P5VA 2LSOA 3E6DA 2L3DA 4BQAA 3CUOA 3P7NA 4N9IA 5FB2A 3QU6A 3RYRA 2Z99A 1G3SA 3EETA 4L5IA 2JPBA 4LG0B 3T5XA 3CTAA 2NNNA 1IAWA 3KZYA 2OA4A 5K1YA 2XAFA 2RC4A 2FE3A 1DUXC 4M72A 2HS5A 5DCMA 1HW5A 1HW2A 3ZN1A 2W85A 3TOBA 4G7OF 2YSRA 3DPLC 5L3EA 3ELKA 3O2PE 1FYMA 4HZFA 3WTVC 3NEUA 3E5UA 1Q1HA 1NHAA 3M7GA 2A61A 1XCBA 1SD6A 4HAMA 1JHHA 5HS9A 2EA2A 4O3MA 5BPIA 4JBAA 3F21A 2VC0A 5K5QA 3LWFA 5J6XA 2FEZA 3IWZA 3Q5FA 5CJ9A 1E17A 3E6CC 1Z6TA 4M71A 4UVAA 4DQ2A 2UXXA 5HDNA 1HKQA 3LA2A 4I09A 5JR3A 4LLLA 2P5KA 3JSPA 4LLGF 3IHUA 2K27A 4HDUA 2IA1A 3WGGA 3COAC 2CGPA 2COMA 1PUEE 2A5YB 2NS0A 1AWCA 1S3JA 3BPVA 1R1UA 1S7OA 4OMZA 4OIOF 1ZHFA 1ZGAA 3IRRA 2OQRA 2FQ3A 5LEJA 1ZREA 5JVTA 3RIRA 3K69A 4HOBA 1FLIA 1ODDA 1LVAA 1ZG1A 3CJNA 4RAYA 1MJBA 2F5DA 3K9TA 4NB5A 2GAUA 3JTGA 2HYFA 3PFIA 2HTJA 3I53A 3S2WA 4UXNA 2IA0A 3TQNA 4YFNF 4ENJA 2ELHA 5HS8A 3Q9SA 3E5QA 4PCQA 5F6FA 2Z5UA 1RUOA 5EEHA 2IW5A 2ZJ2A 2OZUA 3T1BA 4FHTA 4ON0A 3V7CA 1IN4A 2GXGA 2A69F 3F6OA 1U2WA 4KUMA 1KU2A 4Q4ZF 1FNNA 3GFMA 3RI4A 1IRFA 3GUDA 2CQKA 1O7LA 2H6BA 2PN6A 2HDCA 1JGSA 2FF4A 2GA2A 2YU3A 3V8LA 2FMLA 5BQTA 5ED4A 2QYOA 2FXAA 3ROUA 3KLOA 1XCVA 2V9VA 4ZYEA 4OIRF 3ZQ7A 3F8NA 2P8TA 5DDGA 5HDGA 2RQPA 1K6OA 5FLXZ 5E1XA 3CO6C 4ESBA 5A2QZ 4WX9A 1PP7U 3HYIA 2IT0A 1IXCA 3WTZA 2LNBA 5H6RA 4B09A 1R36A 1WSUA 4N0BA 1GHCA 3K2ZA 2P5LC 1CGPA 2M5WA 1IN8A 1Z91A 1JHFA 4KN4X 2KRFA 4I0AA 1XD7A 2L4AA 3JW4A 2EWNA 4S04A 4A5NA 5CVVA 3OOPA 3GYHX 1XSVA 4GCVA 2V79A 5DD8A 4QWQA 2OD5A 2J5OA 2L4MA 2PG4A 5ERIA 4UVBA 1EV7A 3K1NA 3L09A 3L7WA 1P2FA 3GZ5A 1P6RA 1KU3A 3P9IA 1K7AA 1YQAA 3DFGA 1XGSA 3FHZA 3KFWX 3KE2A 4A6EA 3B02A 2ETHA 1XDUA 1OKRA 1LEBA 1SFUA 3N4MA 3VODA 1R58A 2MLKA 1AOYA 2K02A 2CG4A 2XRNA 3ZN0A 2KIUA 1QNTA 3C1DA 3V8KA 4UNOA 2KIFA 5KVRA 3GW2A 2XAHA 4YIIA 2XAJA 3K1PA 2DPUA 2CSOA 4XLNF 3F8FA 4CYDA 5LRSA 3L00A 4KDPA 5CVUA 2V1UA 3EYYA 5LBQA 5JI6A 3EDPA 4KMFA 5IT9K 2BE5F 1SFEA 3E5XA 3N97A 4M74A 3ISPA 3V7SA 3JTHA 2HQNA 3EYIA 2ESNA 3VOEA 1K79A 3CUQA 1B9NA 3V8JA 4MNUA 4G7HF 5HLHA 1H9GA 4Q47A 1T38A 1BI3A 1R22A 4LB5A 3LA3A 3KLNA 3J81K 1K78B 2YPRA 2E1CA 2D45A 1BC7C 1ZRCA 5BS6A 3ZMZA 3LFKA 4NHJA 1IW7F 5LGNA 2W57A 3HTSB 4KN7X 2NNYA 5FLXK 2FMYA 2EV5A 2GXBA 2V1XA 3I64A 2HYGD 2JZYA 5ILVA 4AWXB 3BZ6A 2XHKA 3F8BA 2NYXA 3FMQA 3CLOA 3LQQA 3ABTA 5D6FA 2P7VB 2JPCA 3AAFA 4CGZA 2TDXA 1RUNA 5K5OA 1IN6A 3G73A 3ZMVA 1HQCA 5H6QA 1IF1A 5HS7A 1H9TA 3RKXA 4M9XA 4EJUA 4LJZF 2G7UA 3TKYA 1LEAA 5D5WB 2IPQX 1F1ZA 2VOPA 4EJTA 1Z6RA 5D5UB 4CHUA 3ZPLA 2K86A 2GA1A 3MZHA 1I5ZA 1RNLA 3R0AA 2RVCA 1YS6A 1SAXA 4I2OA 1B9MA 1ZAOA 3KETA 2L54A 2DT5A 4HF1A 1D3YA 2WV0A 1DDNA 1R7JA 3BJAA 1O7FA 1MJAA 4PGGA 4Z2YA 2FBHA 4JQFA 1V3FA 2QQAA 1S6LA 5AIPA 1FPQA 1MDMB 3CUQC 4IVNA 1BI0A 1YW9A 5FD6A 3QU3A 4MHGA 3I59A 2C6YA 1J75A 3QP5A 1W4MA 2O6GE 1O3QA 2ZBKA 1KYZA 4EVIA 4G8XA 1IUYA 4L9VA 2CYYA 3NQOA 2YX4A 1XSDA 1I6XA 1P4AA 3WTTC 4LLNA 1LJ9A 2P4WA 4G94A 1SD5A 3FM3A 2WTEA 3EQLF 5E18F 2IRFG 4L9JA 3IRQA 4A0XA 1TLHB 2KKOA 3SHFA 2H6CA 3BROA 2HGCA 3RDIA 4YG2F 5AIQA 4OIQF 2KJBA 2ZNZA 4MEYF 3WTSC 2DK5A 2IJLA 5D4SA 3DP7A 4HLYA 1W5SA 3KEOA 4L0ZB 5CVJA 3DQVC 2QUFA 1TBXA 5LEKA 4M73A 4MEXF 2O03A 3H92A 4G7ZF 1QZYA 1YW7A 3DXJF 5HLGA 1F4KA 1S8NA 1T6SA 5DD4A 5HVQC 2ZMEB 3CDHA 3TDZC 3PQKA 2GQQA 4P96A 1XMKA 2STTA 4P5OA 1HXDA 2R7FA 3REOA 2DAOA 3RPUA 2VXZA 3JAMK 4HQMA 2QQBA 4LFUA 2STWA 4GXOA 1G4DA 5JFRA 3WODF 1D5VA 1ON1A 2KIMA 2X4HA 1FBQA 1J59A 1J5YA 4HX4A 4ZH4F 3GWZA 1TNTA 3WE2A 3R6SA 5BOXA 1KA8A 2K7LA 2XAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WG9 A;  3RKY A;  4I01 A;  4ETS A;  2Q2E A;  1T0F A;  2X0L A;  3VB2 A;  1MZB A;  3O6B B;  3HRM A;  4RGS A;  1YG2 A;  3TO9 A;  1UCR A;  1T98 A;  5D4R A;  1CF7 B;  3WU1 B;  2YR2 A;  2O8X A;  2VBZ A;  4ZYD A;  1WQ2 A;  3GEZ A;  5DCM B;  2MA3 A;  4RGR A;  3I5U A;  4UV9 A;  1REP C;  4HLX A;  3I54 A;  4R1H A;  4Y13 A;  3MZY A;  2P6T A;  5FD5 A;  4BNC A;  4GGG A;  3FWE A;  1A04 A;  1U78 A;  3E97 A;  4MGR A;  5L3G A;  1YO5 C;  5D8K B;  5LGU A;  1FSH A;  3V4G A;  2W24 A;  2VON A;  2FBI A;  1RI7 A;  2VBX A;  1YS7 A;  4UHT A;  4HX8 A;  2OZ6 A;  2EFP A;  2H94 A;  1FOK A;  4EJW A;  4U0Y A;  4M9Z A;  5BPD A;  2GZW A;  2MBF A;  1G6N A;  1ZGJ A;  2V6C A;  1G3W A;  2AXL A;  4GYI A;  4G6Q A;  4PDK A;  2RGV A;  1FY7 A;  5J8F A;  3W6J B;  5ICF A;  4EQQ A;  4A0Z A;  2A6H F;  2DTR A;  2QLZ A;  5K5R A;  1P4W A;  2XVC A;  3ZP5 A;  4ZZD A;  1I1S A;  1XSX A;  1BN5 A;  2XUB A;  1BBY A;  2FU4 A;  2F5C A;  2Q0O A;  4M9S A;  3HIF A;  4A2U A;  4RS8 A;  4Y15 A;  1Z1D A;  2HZT A;  2P7C B;  1W7P B;  3GF2 A;  3QPT A;  3KP5 A;  1STZ A;  1R1V A;  2UZK A;  1KU7 A;  2XKP A;  1BC8 C;  1TQM A;  3QPH A;  2DK8 A;  1X3U A;  4KIF A;  2MH9 A;  2F5E A;  5TRD A;  1UHW A;  4ENN A;  3FXU A;  3RJP A;  4O5V A;  3U2R A;  5D6E A;  5L3F A;  3WE3 A;  5CLS A;  4AD9 A;  5ILU A;  1U8R A;  5D5X B;  2Y48 A;  5L3D A;  4XLP F;  1EH8 A;  2OAZ A;  2DO7 A;  2Q8K A;  1HSJ A;  1WRJ A;  4LK1 F;  3HRU A;  1P92 A;  2HKO A;  3SFZ A;  4D0P A;  1YLF A;  2HQR A;  5ILS A;  2EA4 A;  1O3S A;  2A07 F;  5FFX A;  4KIB A;  4U0V A;  3SZT A;  1LQ1 A;  2JSC A;  2EV6 A;  2BGC A;  4I98 B;  2ZKZ A;  3F23 A;  2K4J A;  2CWE A;  5CVI A;  3ECH A;  1OR7 A;  2XAS A;  3BP8 A;  2LKP A;  1KQ0 A;  2DLL A;  1GXQ A;  4QLC U;  3C7J A;  4KMU X;  2H09 A;  4G9Y A;  1LDK B;  3C3W A;  4HW0 A;  1LNW A;  1HW1 A;  1U6G A;  2H27 A;  3FMR A;  1YW8 A;  2A3S A;  4I0B A;  4CO8 A;  4R79 A;  3MWM A;  2QVO A;  5BMZ A;  3R60 A;  2HFH A;  3T8T A;  3KP7 A;  2FBK A;  1EH6 A;  4LB6 B;  4ESJ A;  2F2E A;  4U0W A;  1MDM A;  3OV8 A;  4WXH A;  5E8I A;  2ZNY A;  4Y17 A;  4MTE A;  1QO0 D;  1G3T A;  1BOA A;  1ULY A;  5LLQ A;  3ABU A;  4RGX A;  5E8G A;  4RB0 A;  4YIF A;  4RB1 A;  3KZZ A;  4M6X A;  2ESH A;  1FYL A;  1SD4 A;  4TV7 A;  3GFL A;  2QZ8 A;  2EB7 A;  2YX7 A;  1TW3 A;  2IVM A;  2RDP A;  3RYP A;  2M8E A;  3I71 A;  4DNC A;  4Q48 A;  1Y0U A;  3KP6 A;  5KK1 A;  3TDU C;  1PDN C;  1U5T B;  3ZMU A;  4EM2 A;  3L9F A;  3F8C A;  3IC7 A;  4YFK F;  3TO7 A;  4FX4 A;  1TNS A;  4ZYH A;  1JE8 A;  4UVC A;  4RB3 C;  4BHB A;  2QBY A;  1IXS B;  2D1H A;  2XV4 S;  4HDV A;  3GZ6 A;  3H3Z A;  4Q5S F;  3M8E A;  2EFW A;  1WWX A;  2DFI A;  2PJP A;  3LA7 A;  1IZ1 A;  2ACJ A;  2DQR A;  2Y0M A;  1SMT A;  2ZFW A;  3J81 Z;  3LQR A;  1K78 A;  2G7H A;  3R61 A;  2ZME A;  3HSE A;  4AIK A;  3F6V A;  3BWG A;  1T39 A;  1O57 A;  2VOO A;  5ICC A;  4L5J A;  4OIN F;  4EM1 A;  4A5M A;  4WK8 F;  2Z3Y A;  5EEG A;  3LST A;  5IT9 Z;  4LK0 F;  1J0R A;  2GIV A;  2PI0 A;  1O3T A;  3FM5 A;  4O6J A;  2V1D A;  4XBF A;  3VEP A;  1GXP A;  1SMY F;  3GXO A;  3BJO A;  2Z33 A;  4IRI A;  1RZ4 A;  3VFZ A;  3EUH A;  2CW0 F;  1UHM A;  3FXQ A;  3L2C A;  2HKX A;  1MKM A;  3KP4 A;  3IL2 A;  2QM3 A;  5JHU A;  3WGI A;  3HRT A;  4IHS A;  2DU9 A;  4HA8 A;  4IRH A;  4JK1 X;  1FYK A;  1ZH5 A;  3HSR A;  4LG0 A;  1QQI A;  2MH2 A;  1FP2 A;  2M87 A;  4I7H A;  1JXS A;  3IKV A;  2HR3 A;  3GX4 X;  3NRV A;  3BY6 A;  1CF7 A;  3SQN A;  3MFK A;  2PMU A;  3SXY A;  1BM9 A;  2ISY A;  1B4A A;  2P6S A;  2VT2 A;  1R23 A;  3PQJ A;  2MC3 A;  2OU2 A;  1HBX G;  3M1E A;  2PFB A;  1KYW A;  1U3E M;  2PBI A;  2VE8 A;  2JRT A;  4A12 A;  1R1T A;  1FBS A;  2F5F A;  5LGT A;  4CIC A;  5FO5 A;  4HX7 A;  3BPX A;  3WGH A;  2DI3 A;  4FT8 A;  1UST A;  2L01 A;  1MD0 A;  3RPQ A;  2XKO A;  4GYG A;  4HF0 A;  2EFN A;  3HHG A;  3J80 K;  4EV0 A;  2FSW A;  3F22 A;  2DBB A;  1MJ9 A;  4OU0 A;  4HYE A;  4BAY A;  3GFI A;  4HQE A;  4PGH A;  2ADU A;  2EK5 A;  3U1D A;  4BHC A;  1BIA A;  2GWR A;  3BOQ A;  4ASN A;  3E3V A;  1FWZ A;  5HLI A;  4AIJ A;  4OOI A;  2VC1 A;  3TGN A;  2E1N A;  2EV0 A;  5J8C A;  1J7K A;  3U9G A;  1KGS A;  3MAJ A;  4RB2 C;  3ZMS A;  4WF2 A;  3I59 B;  4KIC A;  4HV6 A;  3GLX A;  4OMY A;  1IXR C;  1DPR A;  3WU0 A;  1SFX A;  1ZG5 A;  3JAM Z;  2W84 A;  3M8F A;  3F3X A;  4L9T A;  3FXR A;  3R0J A;  2EFO A;  1LDD A;  2HWV A;  2UWM A;  2G9W A;  5FFZ A;  2RKH A;  4BYY A;  1UB9 A;  2Y75 A;  4IRG A;  4XSX F;  2VOD A;  3JSO A;  4N9H A;  4KYW A;  1J9I A;  2FA5 A;  1FT9 A;  1QZZ A;  4UUV A;  1KQ9 A;  1ZYR F;  1UFM A;  4LMY A;  2XRO A;  1KQ8 A;  5FGM A;  3HOS A;  1C0W A;  3ZMD A;  1VTN C;  1W7P D;  5LHH A;  4E70 A;  1XMA A;  2A68 F;  3C18 A;  1WKM A;  1LDJ A;  4KT5 C;  6PAX A;  3KEQ A;  5CYV A;  1SD7 A;  3M9A A;  1BJA A;  3I0T A;  4L18 B;  2O3F A;  3E6M A;  4WCG A;  1P4X A;  4UV8 A;  1OMI A;  4CXF A;  1I1G A;  5IT3 A;  2E7X A;  3ML6 A;  2DPD A;  2NRA C;  5CVR A;  4I02 A;  3DF8 A;  1FC3 A;  1RIO H;  4EGZ A;  3TO6 A;  2WWY A;  1R00 A;  1ZRD A;  1ZLK A;  3K0L A;  2BBY A;  4EMS A;  3G3Z A;  3HHH A;  5HOO A;  4PZJ A;  5F64 A;  3DV8 A;  2NAZ A;  1XB4 A;  2QEN A;  1IN7 A;  1F9N A;  3HRS A;  4MQV A;  2EFQ A;  1QPM A;  3BDD A;  1USS A;  1T2K A;  2VBW A;  2VBY A;  3F8M A;  4BXU A;  2HTS A;  1YYV A;  3DEU A;  3O3K A;  2J5P A;  2FNP A;  2MLG A;  5E1W A;  3GFJ A;  5TJJ A;  3R4K A;  4CDG A;  1XGM A;  1D8J A;  3D5L A;  1TQI A;  1XGO A;  3WTU C;  2IP2 A;  2XIG A;  2QBY B;  2ISZ A;  1QGP A;  4CZZ A;  1I27 A;  3B73 A;  1QBJ A;  3RKW A;  4S05 A;  1U5T A;  3F72 A;  3HOT A;  2W25 A;  4L0Y B;  2OQG A;  1OYW A;  3ULQ B;  1ZG3 A;  2RNJ A;  3QAH A;  3GO5 A;  4M6Y A;  3I58 A;  1BIB A;  1BI1 A;  3LAJ A;  3BJ6 A;  4K2E A;  3CO7 C;  5LRR A;  1ONV A;  1G3Y A;  4U88 A;  4MTD A;  5D8L B;  2PEX A;  1F5T A;  3I4P A;  2JTV A;  3DKW A;  1Z7U A;  2VE9 A;  4H0E A;  1XGN A;  4KIG A;  3T8R A;  2M45 A;  1L3L A;  5DCF A;  1R5H A;  3K1M A;  1PP8 F;  3H3U A;  4U7D A;  4F7Z A;  3QRF F;  4ZYG A;  2CFX A;  2XGX A;  1FZP B;  3ERE D;  2DQL A;  1OYY A;  3KP2 A;  1E2X A;  5DUI A;  3E6B A;  4ZZL A;  4GO1 A;  1L0O C;  1IRG A;  4P9F A;  1OPC A;  4EGY A;  2QQ9 A;  3QP6 A;  1IN5 A;  4OIP F;  4BH9 A;  4AVP A;  5E1Z B;  3J80 Z;  1W7P A;  5F1R A;  1FX7 A;  2M1B A;  3J7A O;  1FSE A;  1ZN2 A;  1KU9 A;  5LHI A;  3KCC A;  2VN2 A;  3FX3 A;  1FBU A;  4EJO A;  5L3B A;  3WTY C;  1OYI A;  1TTY A;  2UXN A;  2PQ8 A;  1ZRF A;  3MCZ A;  5DEQ A;  2VT3 A;  3P9K A;  3WTW C;  4XRF A;  5DUK A;  2IA2 A;  3FF5 A;  2R3S A;  4A6D A;  4IJA A;  1H0M A;  2PMH A;  3HSF A;  3P9C A;  1TW2 A;  4B8X A;  5L3C A;  2FRH A;  1FP1 D;  4FX0 A;  2R7D A;  4WXC A;  3FMS A;  2FOK A;  1B1B A;  2A6E F;  4MQ9 F;  2CO5 A;  2XAQ A;  4HV5 A;  2OBP A;  1U5T C;  3WTX C;  1GVJ A;  2RV8 A;  2FNA A;  3MQ0 A;  5ICE A;  1HKS A;  1W5T A;  4KFC A;  3IKT A;  5ICG A;  2QWW A;  3GVA A;  1D8K A;  4LGW A;  1O3R A;  3DPT A;  2B0L A;  2PLY A;  2BYV E;  4AIH A;  2ZXJ A;  3HTU A;  2O61 A;  1YFH A;  2KJC A;  2LF8 A;  3SZP A;  4R8H A;  2LDU A;  5D5V B;  2DW4 A;  4KA4 A;  4NQW A;  2ZO4 A;  1ZAR A;  3TOA A;  2M30 A;  4KNY A;  4EM0 B;  1BI2 A;  1TQP A;  2HOE A;  4WXD A;  1ZLJ A;  2BEO A;  4U7B A;  1MGT A;  2E7W A;  2ZCW A;  1HST A;  4XSZ F;  4HF2 A;  5HDK A;  4P9U A;  1R5G A;  5A2Q K;  1V4R A;  2AS5 F;  2K4B A;  1LB2 A;  4IHT A;  1S7A A;  4BHP A;  1DP7 P;  5LHG A;  3ECO A;  2HEO A;  4L9N A;  3Q9V A;  2WC2 A;  4LD5 A;  1ON2 A;  3FZV A;  5DV5 A;  4HBL A;  4ENK A;  1YIO A;  1Z9C A;  2BV6 A;  1S29 A;  1XDS A;  3IWF A;  3ZMT A;  1B6A A;  1XN7 A;  3KP3 A;  5E20 A;  5DYM A;  4EJV A;  3HUG A;  2MD5 A;  1YTY A;  1J2X A;  1WI9 A;  4YFX F;  4ENM A;  4P55 A;  2D2W A;  3D0S A;  3CUQ B;  1DPU A;  2Z9O A;  2O0Y A;  4G6D A;  1B59 A;  4RAZ A;  4A0Y A;  3QOP A;  4ESF A;  5AON A;  4IF4 A;  2LF7 A;  3T0Y A;  5H20 A;  1EH7 A;  3V7R A;  2JT1 A;  4IPA A;  2D1V A;  3RTR A;  1HKT A;  2L02 A;  3MEX A;  4IXA A;  3W6K B;  3LAP A;  2RN7 A;  4RGU A;  5E17 F;  1Z05 A;  2EJR A;  4WWC A;  2P5V A;  2LSO A;  3E6D A;  2L3D A;  4BQA A;  3CUO A;  3P7N A;  4N9I A;  5FB2 A;  3QU6 A;  3RYR A;  2Z99 A;  1G3S A;  3EET A;  4L5I A;  2JPB A;  4LG0 B;  3T5X A;  3CTA A;  2NNN A;  1IAW A;  3KZY A;  2OA4 A;  5K1Y A;  2XAF A;  2RC4 A;  2FE3 A;  1DUX C;  4M72 A;  2HS5 A;  5DCM A;  1HW5 A;  1HW2 A;  3ZN1 A;  2W85 A;  3TOB A;  4G7O F;  2YSR A;  3DPL C;  5L3E A;  3ELK A;  3O2P E;  1FYM A;  4HZF A;  3WTV C;  3NEU A;  3E5U A;  1Q1H A;  1NHA A;  3M7G A;  2A61 A;  1XCB A;  1SD6 A;  4HAM A;  1JHH A;  5HS9 A;  2EA2 A;  4O3M A;  5BPI A;  4JBA A;  3F21 A;  2VC0 A;  5K5Q A;  3LWF A;  5J6X A;  2FEZ A;  3IWZ A;  3Q5F A;  5CJ9 A;  1E17 A;  3E6C C;  1Z6T A;  4M71 A;  4UVA A;  4DQ2 A;  2UXX A;  5HDN A;  1HKQ A;  3LA2 A;  4I09 A;  5JR3 A;  4LLL A;  2P5K A;  3JSP A;  4LLG F;  3IHU A;  2K27 A;  4HDU A;  2IA1 A;  3WGG A;  3COA C;  2CGP A;  2COM A;  1PUE E;  2A5Y B;  2NS0 A;  1AWC A;  1S3J A;  3BPV A;  1R1U A;  1S7O A;  4OMZ A;  4OIO F;  1ZHF A;  1ZGA A;  3IRR A;  2OQR A;  2FQ3 A;  5LEJ A;  1ZRE A;  5JVT A;  3RIR A;  3K69 A;  4HOB A;  1FLI A;  1ODD A;  1LVA A;  1ZG1 A;  3CJN A;  4RAY A;  1MJB A;  2F5D A;  3K9T A;  4NB5 A;  2GAU A;  3JTG A;  2HYF A;  3PFI A;  2HTJ A;  3I53 A;  3S2W A;  4UXN A;  2IA0 A;  3TQN A;  4YFN F;  4ENJ A;  2ELH A;  5HS8 A;  3Q9S A;  3E5Q A;  4PCQ A;  5F6F A;  2Z5U A;  1RUO A;  5EEH A;  2IW5 A;  2ZJ2 A;  2OZU A;  3T1B A;  4FHT A;  4ON0 A;  3V7C A;  1IN4 A;  2GXG A;  2A69 F;  3F6O A;  1U2W A;  4KUM A;  1KU2 A;  4Q4Z F;  1FNN A;  3GFM A;  3RI4 A;  1IRF A;  3GUD A;  2CQK A;  1O7L A;  2H6B A;  2PN6 A;  2HDC A;  1JGS A;  2FF4 A;  2GA2 A;  2YU3 A;  3V8L A;  2FML A;  5BQT A;  5ED4 A;  2QYO A;  2FXA A;  3ROU A;  3KLO A;  1XCV A;  2V9V A;  4ZYE A;  4OIR F;  3ZQ7 A;  3F8N A;  2P8T A;  5DDG A;  5HDG A;  2RQP A;  1K6O A;  5FLX Z;  5E1X A;  3CO6 C;  4ESB A;  5A2Q Z;  4WX9 A;  1PP7 U;  3HYI A;  2IT0 A;  1IXC A;  3WTZ A;  2LNB A;  5H6R A;  4B09 A;  1R36 A;  1WSU A;  4N0B A;  1GHC A;  3K2Z A;  2P5L C;  1CGP A;  2M5W A;  1IN8 A;  1Z91 A;  1JHF A;  4KN4 X;  2KRF A;  4I0A A;  1XD7 A;  2L4A A;  3JW4 A;  2EWN A;  4S04 A;  4A5N A;  5CVV A;  3OOP A;  3GYH X;  1XSV A;  4GCV A;  2V79 A;  5DD8 A;  4QWQ A;  2OD5 A;  2J5O A;  2L4M A;  2PG4 A;  5ERI A;  4UVB A;  1EV7 A;  3K1N A;  3L09 A;  3L7W A;  1P2F A;  3GZ5 A;  1P6R A;  1KU3 A;  3P9I A;  1K7A A;  1YQA A;  3DFG A;  1XGS A;  3FHZ A;  3KFW X;  3KE2 A;  4A6E A;  3B02 A;  2ETH A;  1XDU A;  1OKR A;  1LEB A;  1SFU A;  3N4M A;  3VOD A;  1R58 A;  2MLK A;  1AOY A;  2K02 A;  2CG4 A;  2XRN A;  3ZN0 A;  2KIU A;  1QNT A;  3C1D A;  3V8K A;  4UNO A;  2KIF A;  5KVR A;  3GW2 A;  2XAH A;  4YII A;  2XAJ A;  3K1P A;  2DPU A;  2CSO A;  4XLN F;  3F8F A;  4CYD A;  5LRS A;  3L00 A;  4KDP A;  5CVU A;  2V1U A;  3EYY A;  5LBQ A;  5JI6 A;  3EDP A;  4KMF A;  5IT9 K;  2BE5 F;  1SFE A;  3E5X A;  3N97 A;  4M74 A;  3ISP A;  3V7S A;  3JTH A;  2HQN A;  3EYI A;  2ESN A;  3VOE A;  1K79 A;  3CUQ A;  1B9N A;  3V8J A;  4MNU A;  4G7H F;  5HLH A;  1H9G A;  4Q47 A;  1T38 A;  1BI3 A;  1R22 A;  4LB5 A;  3LA3 A;  3KLN A;  3J81 K;  1K78 B;  2YPR A;  2E1C A;  2D45 A;  1BC7 C;  1ZRC A;  5BS6 A;  3ZMZ A;  3LFK A;  4NHJ A;  1IW7 F;  5LGN A;  2W57 A;  3HTS B;  4KN7 X;  2NNY A;  5FLX K;  2FMY A;  2EV5 A;  2GXB A;  2V1X A;  3I64 A;  2HYG D;  2JZY A;  5ILV A;  4AWX B;  3BZ6 A;  2XHK A;  3F8B A;  2NYX A;  3FMQ A;  3CLO A;  3LQQ A;  3ABT A;  5D6F A;  2P7V B;  2JPC A;  3AAF A;  4CGZ A;  2TDX A;  1RUN A;  5K5O A;  1IN6 A;  3G73 A;  3ZMV A;  1HQC A;  5H6Q A;  1IF1 A;  5HS7 A;  1H9T A;  3RKX A;  4M9X A;  4EJU A;  4LJZ F;  2G7U A;  3TKY A;  1LEA A;  5D5W B;  2IPQ X;  1F1Z A;  2VOP A;  4EJT A;  1Z6R A;  5D5U B;  4CHU A;  3ZPL A;  2K86 A;  2GA1 A;  3MZH A;  1I5Z A;  1RNL A;  3R0A A;  2RVC A;  1YS6 A;  1SAX A;  4I2O A;  1B9M A;  1ZAO A;  3KET A;  2L54 A;  2DT5 A;  4HF1 A;  1D3Y A;  2WV0 A;  1DDN A;  1R7J A;  3BJA A;  1O7F A;  1MJA A;  4PGG A;  4Z2Y A;  2FBH A;  4JQF A;  1V3F A;  2QQA A;  1S6L A;  5AIP A;  1FPQ A;  1MDM B;  3CUQ C;  4IVN A;  1BI0 A;  1YW9 A;  5FD6 A;  3QU3 A;  4MHG A;  3I59 A;  2C6Y A;  1J75 A;  3QP5 A;  1W4M A;  2O6G E;  1O3Q A;  2ZBK A;  1KYZ A;  4EVI A;  4G8X A;  1IUY A;  4L9V A;  2CYY A;  3NQO A;  2YX4 A;  1XSD A;  1I6X A;  1P4A A;  3WTT C;  4LLN A;  1LJ9 A;  2P4W A;  4G94 A;  1SD5 A;  3FM3 A;  2WTE A;  3EQL F;  5E18 F;  2IRF G;  4L9J A;  3IRQ A;  4A0X A;  1TLH B;  2KKO A;  3SHF A;  2H6C A;  3BRO A;  2HGC A;  3RDI A;  4YG2 F;  5AIQ A;  4OIQ F;  2KJB A;  2ZNZ A;  4MEY F;  3WTS C;  2DK5 A;  2IJL A;  5D4S A;  3DP7 A;  4HLY A;  1W5S A;  3KEO A;  4L0Z B;  5CVJ A;  3DQV C;  2QUF A;  1TBX A;  5LEK A;  4M73 A;  4MEX F;  2O03 A;  3H92 A;  4G7Z F;  1QZY A;  1YW7 A;  3DXJ F;  5HLG A;  1F4K A;  1S8N A;  1T6S A;  5DD4 A;  5HVQ C;  2ZME B;  3CDH A;  3TDZ C;  3PQK A;  2GQQ A;  4P96 A;  1XMK A;  2STT A;  4P5O A;  1HXD A;  2R7F A;  3REO A;  2DAO A;  3RPU A;  2VXZ A;  3JAM K;  4HQM A;  2QQB A;  4LFU A;  2STW A;  4GXO A;  1G4D A;  5JFR A;  3WOD F;  1D5V A;  1ON1 A;  2KIM A;  2X4H A;  1FBQ A;  1J59 A;  1J5Y A;  4HX4 A;  4ZH4 F;  3GWZ A;  1TNT A;  3WE2 A;  3R6S A;  5BOX A;  1KA8 A;  2K7L A;  2XAG A; 
#chains in the Genus database with same CATH topology
 1EKE A;  3WG9 A;  3H5R A;  3RKY A;  1IV8 A;  1OR7 C;  4L5E A;  4ANJ A;  2F48 A;  4PJ0 C;  4I01 A;  2BW3 B;  4ETS A;  2Q2E A;  1T0F A;  2HZD A;  2X0L A;  3BTJ A;  2MC4 A;  3DKY A;  1NH3 A;  5M3M J;  3HGY A;  3VB2 A;  2ZJP F;  2Y9Y A;  1OCR H;  3KYD B;  3JRG A;  1A35 A;  1MZB A;  3O6B B;  1VQP I;  2VI6 A;  4CUG A;  2CQX A;  3HRM A;  2DCE A;  1B8I A;  4RGS A;  1YG2 A;  1FIP A;  3TO9 A;  3GTK J;  3IAS 2;  1UCR A;  1T98 A;  5LD2 C;  5D4R A;  2ME6 A;  4PSW A;  1CF7 B;  4XR6 A;  1LE8 A;  1YIJ I;  3WU1 B;  1CQT A;  5E3L A;  2YR2 A;  1YIT I;  2O8X A;  2VBZ A;  4ZYD A;  1WQ2 A;  3GEZ A;  4HST A;  5DCM B;  2MA3 A;  4RGR A;  2ME0 A;  5E3O A;  5GTH C;  2QF7 A;  2VPL A;  4HNU A;  3I5U A;  3A01 B;  3K70 D;  4UV9 A;  2CV0 A;  4C2M J;  1X3W B;  1FIA A;  1REP C;  1S72 I;  2JN6 A;  4BXF A;  2OUM A;  4HLX A;  3I54 A;  1G2H A;  2CW7 A;  4R1H A;  3OSG A;  4Y13 A;  3MZY A;  2P6T A;  5FD5 A;  4BNC A;  4GGG A;  3FWE A;  1A04 A;  5IOZ A;  1U78 A;  3E97 A;  2W7N A;  4MGR A;  5L3G A;  1YO5 C;  2NOG A;  5D8K B;  5LGU A;  1FSH A;  1D1A A;  3V4G A;  2W24 A;  2VON A;  2FBI A;  2N8G A;  1RI7 A;  2VBX A;  1YS7 A;  4UHT A;  3Q0V A;  4DBR A;  4HX8 A;  4IEJ A;  2OZ6 A;  2EFP A;  2LRE A;  1NTC A;  2H94 A;  2IXS A;  1FOK A;  4EJW A;  4U0Y A;  4M9Z A;  4B43 A;  5BPD A;  2GZW A;  2MBF A;  4PFO A;  1G6N A;  2DOA A;  1ZGJ A;  3QYE A;  2V6C A;  1G3W A;  4YEL A;  2AXL A;  4GYI A;  1FJL A;  4G6Q A;  1AKH B;  1XMX A;  2MGQ A;  4PDK A;  5H2F C;  3OYI A;  2L7K A;  2E35 A;  2RGV A;  1FY7 A;  5J8F A;  5J4Y A;  3OOU A;  3W6J B;  3NAU A;  5ICF A;  4EQQ A;  4A0Z A;  2XPW A;  2A6H F;  1Y1V J;  2DTR A;  1OJL A;  4LOC A;  1HDP A;  3HBL A;  3HM5 A;  1Z21 A;  1BW5 A;  1X1C A;  2QLZ A;  2RRE A;  2W48 A;  5K5R A;  1P4W A;  2XVC A;  4E7H A;  2MFZ A;  3ZP5 A;  1R71 A;  2DMT A;  3P5J A;  4ZZD A;  3BC8 A;  2VUM J;  3DKX A;  1PVE A;  2XGE A;  1I1S A;  1XSX A;  2LKS A;  3LSR A;  1BN5 A;  1M1E B;  2XUB A;  3CME I;  2Y0S N;  1BBY A;  2FU4 A;  2F5C A;  2Q0O A;  1YE9 A;  3BR1 A;  4M9S A;  3HIF A;  4IX7 A;  4A2U A;  2LTP A;  5K7H A;  1KON A;  4EEF G;  4RS8 A;  5C44 J;  4Y15 A;  1OLT A;  1Z1D A;  4DZJ A;  2HZT A;  2LBF B;  2P7C B;  1W7P B;  3GF2 A;  3QPT A;  3KP5 A;  2CUF A;  1STZ A;  5EZG A;  1R1V A;  2XF5 A;  1YX3 A;  2UZK A;  2QQ8 A;  2XKP A;  4XMY A;  1KU7 A;  1BC8 C;  1TQM A;  4F91 B;  3QPH A;  2OTJ I;  2ID6 A;  2DK8 A;  1X3U A;  3OYF A;  4KIF A;  1ETY A;  2MH9 A;  2F5E A;  5TRD A;  4IOA F;  1UHW A;  4ENN A;  3OYA A;  4A3I J;  3FXU A;  2Y9Z A;  4PFP A;  2VJI A;  1DGR M;  4PJL A;  2XAU A;  3RJP A;  4O5V A;  2LH9 A;  3OYK A;  3U2R A;  5D6E A;  1Y56 A;  1JUM A;  3TBI A;  2PX9 A;  5L3F A;  4IQJ A;  2BY0 A;  3H9Q A;  4KT6 A;  5BNG A;  4MFD A;  3WE3 A;  1ZKG A;  5CLS A;  4AD9 A;  3L2U A;  4A3C J;  5ILU A;  1U8R A;  2OCE A;  5D5X B;  2Y48 A;  5L3D A;  1MBH A;  3K2A A;  4PUS A;  4XLP F;  3PO2 J;  1EH8 A;  1Z77 A;  2OAZ A;  2DO7 A;  2ZXH A;  2W00 A;  2Q8K A;  1HSJ A;  2V26 A;  4FIS A;  1WRJ A;  2UUZ A;  4LK1 F;  3HRU A;  1P92 A;  2HKO A;  3SFZ A;  4DW6 A;  1OCC H;  4D0P A;  3JRH A;  1YLF A;  5KHD A;  3HUG B;  2HQR A;  5ILS A;  1N78 A;  2V7F A;  2EA4 A;  3K4L A;  3CES A;  2A05 A;  1O3S A;  5FFX A;  1MSF C;  4BL0 B;  2A07 F;  4KIB A;  2VPR A;  4F93 B;  3O8H A;  4U0V A;  2WBM A;  3SZT A;  3S2H J;  3JRA A;  3RKQ A;  1LQ1 A;  2YUS A;  3FXL A;  2JSC A;  2EV6 A;  5E3N A;  4E7K A;  3GTM J;  4RAF A;  4CCM A;  2BGC A;  4I98 B;  2DOF A;  2M4G A;  2ZKZ A;  3F23 A;  4XN0 A;  1BR1 A;  2ICW G;  2K4J A;  2CWE A;  2BY3 A;  5CVI A;  3ECH A;  2MG4 A;  1OR7 A;  2XAS A;  1YJW I;  1TWG J;  2BHZ A;  3BP8 A;  2LKP A;  2DA1 A;  3DLL F;  1KQ0 A;  2DLL A;  1GXQ A;  4QLC U;  3C7J A;  4KMU X;  1R9T J;  2H09 A;  3HKZ A;  4G9Y A;  3K4B A;  1LDK B;  3C3W A;  4B1R A;  4HW0 A;  4NBQ A;  3CCJ I;  1LNW A;  4XN3 A;  2JK3 A;  1W0U A;  1RR7 A;  2R4G A;  3SEQ A;  2K9M A;  1HW1 A;  1MH4 A;  1D5Y A;  1U6G A;  2H27 A;  3FMR A;  1YW8 A;  2A3S A;  4I0B A;  4CO8 A;  5FLM J;  4R79 A;  3MWM A;  4XLC A;  3L2V A;  2QVO A;  4CZC A;  1BR4 A;  1X1A A;  4BQQ A;  3BZK A;  4RLQ A;  5BMZ A;  3EUK L;  2HFH A;  3R60 A;  3T8T A;  2QKM B;  2NVY J;  2FBK A;  1EH6 A;  3KP7 A;  4LB6 B;  2R7X A;  4ESJ A;  1IRZ A;  3OYH A;  2Y30 A;  3GTP J;  2IBD A;  2F2E A;  4ZDL A;  4U0W A;  1MDM A;  5B3S H;  5FKO A;  3OV8 A;  4WXH A;  5E8I A;  2ZNY A;  2NVT J;  4Y17 A;  4MTE A;  3FIW A;  1QO0 D;  1G3T A;  1BOA A;  2CJJ A;  2M0M A;  3HJE A;  2V6E A;  4JP0 A;  1ULY A;  4D9J A;  5LLQ A;  3GTQ J;  3ABU A;  2HYJ A;  2JA8 J;  4RGX A;  5E8G A;  5FJ8 J;  4RB0 A;  4YIF A;  2VJJ A;  4RB1 A;  3OWT A;  3KZZ A;  3FBI B;  4M6X A;  2OF7 A;  2X6O A;  2ESH A;  4CCL A;  1S9H A;  4XM3 A;  1FYL A;  1SD4 A;  4QIW N;  4TV7 A;  2IAI A;  1MBE A;  4RBO A;  2L9R A;  3GFL A;  1ERD A;  2QZ8 A;  2I10 A;  5EGO A;  2EB7 A;  5IPA A;  2YX7 A;  1TW3 A;  2IVM A;  2KPM A;  2RDP A;  3H36 A;  1Q1V A;  1Z3Y A;  2BXY A;  3E1S A;  4KIT B;  3RYP A;  2M8E A;  3I71 A;  4DNC A;  4Q48 A;  2V4J C;  3QYB A;  1XX5 A;  1Y0U A;  2XB0 X;  4JYK A;  3OYC A;  3KP6 A;  1QZE A;  5KK1 A;  3TDU C;  3CCM I;  1U5T B;  2CQN A;  1MH3 A;  3ZMU A;  1PDN C;  4EM2 A;  3PUB A;  1F43 A;  4W97 A;  3IH2 A;  3L9F A;  4ZDP A;  2XF6 A;  5IYC J;  4XIC A;  5CQG A;  3RZO J;  3F8C A;  1JUP A;  3IC7 A;  5FKK A;  3G1M A;  3ZRG A;  4YFK F;  1WJF A;  4B47 A;  5DM7 F;  3TO7 A;  2MD0 A;  4NNJ A;  4D5F A;  1BL0 A;  2LVS A;  4BQN A;  4FX4 A;  2E1O A;  1TNS A;  1NG7 A;  4ZYH A;  1JE8 A;  4B48 A;  1IRX A;  4UVC A;  4RB3 C;  3MKY B;  4BHB A;  2QBY A;  3BR6 A;  1IXS B;  3OL3 A;  1JKP C;  2AQF A;  2D1H A;  1XPX A;  1XTA A;  2XV4 S;  4HDV A;  1DGW Y;  3GZ6 A;  1BR2 A;  3H3Z A;  5B66 C;  4IL6 C;  4Q5S F;  3ONQ A;  1MBF A;  2YU9 J;  3M8E A;  5IP7 J;  4IHV A;  2O7O A;  2EFW A;  3LSG A;  1WWX A;  2DFI A;  2R7Q A;  2PJP A;  3LA7 A;  2KIQ A;  1IZ1 A;  1TWA J;  2ACJ A;  2DQR A;  2Y0M A;  1SMT A;  2ZFW A;  3J81 Z;  3M1C A;  3LQR A;  3J7Y J;  1K78 A;  1MSE C;  2G7H A;  3EUA A;  3R61 A;  2ZME A;  3HSE A;  3MD2 A;  2XF7 A;  3S15 J;  1UG0 A;  1I6H J;  2DA2 A;  4AIK A;  3Q3S A;  4DBQ A;  3F6V A;  3IAM 2;  3BWG A;  3BLY A;  3VSL A;  1T39 A;  1O57 A;  3H0G J;  2VOO A;  5ICC A;  2VLA A;  3FIS A;  4L5J A;  4OIN F;  4EM1 A;  1T95 A;  4A5M A;  4WK8 F;  4V2F A;  3H1C A;  2R5Y A;  2Z3Y A;  5EEG A;  2NS7 A;  1TL8 A;  3LST A;  5CQE A;  3JRD A;  2GM4 A;  5IT9 Z;  3KYL A;  3BG5 A;  4LK0 F;  1J0R A;  3NWT A;  2GIV A;  2MSY A;  3SYT A;  2PI0 A;  3BR2 A;  1O3T A;  3NAR A;  1QPI A;  4DYR A;  3FM5 A;  4Y7N J;  4O6J A;  2V1D A;  1R6R A;  4XBF A;  4AVZ A;  3VEP A;  1GXP A;  1SMY F;  3GXO A;  3BJO A;  4D5C A;  2M7A A;  2Z33 A;  4IRI A;  1RZ4 A;  3VFZ A;  3EUH A;  4Y52 J;  2CW0 F;  4Z6Y A;  1ZQ3 P;  4P1W A;  3PIP F;  4AYB A;  1AU7 A;  2Y31 A;  1N75 A;  1UHM A;  2KL4 A;  1DQU A;  1HA8 A;  3ESW B;  3J7A Y;  3FXQ A;  3L2C A;  4ZDO A;  2HKX A;  1MKM A;  3SDB A;  3KP4 A;  3IL2 A;  2QM3 A;  5JHU A;  3WGI A;  3HRT A;  4IHS A;  2DU9 A;  4HA8 A;  4IRH A;  4JK1 X;  2CW8 A;  4PJJ A;  2Q2E B;  1FYK A;  1JKO C;  1ZH5 A;  3HSR A;  4LG0 A;  4E4H A;  1QQI A;  1R4N B;  2MH2 A;  5TGT A;  2HVS A;  5FRM A;  3MN2 A;  1FP2 A;  4A3J J;  4E7S A;  2M87 A;  2ELJ A;  4I7H A;  4BJT A;  1JXS A;  1Y1W J;  3IKV A;  2HR3 A;  2HNH A;  2HQA A;  1V55 H;  2X6W A;  3GX4 X;  2OJE D;  3NRV A;  3BY6 A;  3CP8 A;  1CF7 A;  3SQN A;  2DA4 A;  4M3D A;  3MFK A;  2PMU A;  3I55 I;  1JGG A;  3HB9 A;  4QSH A;  2XDV A;  3SXY A;  1BM9 A;  2ISY A;  1VQ4 I;  1B4A A;  2LG4 A;  2P6S A;  2VT2 A;  3ZGK A;  1R23 A;  3PQJ A;  2MC3 A;  2OU2 A;  1HBX G;  3M1E A;  2PFB A;  1KYW A;  5HLT A;  1U3E M;  4XOT A;  1NK3 P;  2IS6 A;  3LFU A;  2PBI A;  2VE8 A;  2JRT A;  2WAQ A;  4A12 A;  2ZSI B;  1R1T A;  1FBS A;  2F5F A;  5LGT A;  4HRI A;  1WGX A;  2K40 A;  3V42 A;  3LSM A;  1R49 A;  4CIC A;  5FO5 A;  1Z7L A;  4ZJZ A;  2VJ5 A;  4HX7 A;  3BPX A;  3WGH A;  2FD5 A;  1IV6 A;  2DI3 A;  2V9K A;  4FT8 A;  1UST A;  4V19 K;  2L01 A;  2OV7 A;  1MD0 A;  3CLQ A;  3BT9 A;  2XKO A;  3RPQ A;  4GYG A;  4HF0 A;  2EFN A;  3ZOB A;  3HHG A;  3OYD A;  3J80 K;  4EV0 A;  3M3Y J;  3D1N I;  1BW6 A;  4A3B J;  2FSW A;  3AG2 H;  3U1K A;  3HOZ J;  3F22 A;  3AG1 H;  2DBB A;  1MJ9 A;  4OU0 A;  4HYE A;  3C2G A;  4BAY A;  3GFI A;  4HQE A;  3S3M A;  4LIV A;  3A0H C;  4PGH A;  2ADU A;  2E1M C;  2EK5 A;  3I4M J;  3U1D A;  4BHC A;  1VQO I;  3OIO A;  3PO3 J;  1BIA A;  1LFB A;  1I39 A;  2GWR A;  3BOQ A;  1AA7 A;  4ASN A;  3E3V A;  1YJN I;  1FWZ A;  5HLI A;  4AIJ A;  4OOI A;  2E2I J;  2VC1 A;  2M9H A;  3TGN A;  2E1N A;  2EZK A;  2BY1 A;  5EG0 B;  2EV0 A;  5J8C A;  2E19 A;  1J7K A;  4IO9 F;  3U9G A;  3M4O J;  4E6K G;  1KGS A;  2X51 A;  2G0E A;  3MAJ A;  4RB2 C;  4M3E A;  3ZMS A;  2HU9 A;  2LMD A;  2KDZ A;  2FQ4 A;  2E60 A;  4BEH B;  3CCE I;  2ZFU A;  3CJQ B;  1VFC A;  4E7I A;  1IG7 A;  1LPQ A;  3AFH A;  3WU2 C;  1MBK A;  2LOO A;  4UB8 C;  4WF2 A;  3I59 B;  4KIC A;  1VQ5 I;  2DFF A;  5IYB J;  1XS9 A;  4I6Z A;  4HV6 A;  2B9S A;  2DJI A;  5HNH A;  3GLX A;  2EIM H;  1IXR C;  3TP0 A;  2BOL A;  1DPR A;  4F3Q A;  2R7W A;  4OMY A;  2CFO A;  3WU0 A;  1SFX A;  4BGD A;  1ZG5 A;  2R7O A;  3JAM Z;  2W84 A;  3AKZ A;  3M8F A;  3F3X A;  4L9T A;  3FXR A;  3R0J A;  4C3I J;  2GBY A;  2EFO A;  1PJR A;  1LDD A;  2HWV A;  2UWM A;  2G9W A;  1VQ6 I;  3OYE A;  1G8X A;  5FFZ A;  3Q0U A;  3KYC B;  3A02 A;  2RKH A;  5EYR A;  4BYY A;  1UB9 A;  2Y75 A;  4IRG A;  4M3G A;  4XSX F;  2VOD A;  1FTT A;  3JSO A;  4FTH A;  5IOY A;  4N9H A;  4KYW A;  1J9I A;  2FA5 A;  1FT9 A;  2KZG A;  3HZJ A;  1QZZ A;  4UUV A;  1KQ9 A;  1ZYR F;  1UFM A;  3BR0 A;  2QSH X;  1ZEL A;  4LMY A;  3PM1 A;  4PJN A;  2XRO A;  3L2W A;  1X2N A;  5FGM A;  1KQ8 A;  2ZSH B;  3UR3 C;  3HXL A;  4A3K J;  3HEF A;  4KIS A;  1X3Z B;  3HOS A;  4XID A;  3HOX J;  1C0W A;  3MMY B;  2LD5 A;  3CZ6 A;  3ZMD A;  1VTN C;  1W7P D;  3FXK A;  2R0Q C;  2UV1 A;  5LHH A;  2TCT A;  2LKX A;  4E70 A;  3ERM A;  1XMA A;  2A68 F;  3C18 A;  1WKM A;  1LDJ A;  2M2E A;  4E7L A;  4IKF A;  2BXZ A;  4KT5 C;  3L2R A;  2XSD C;  1E0E A;  6PAX A;  3KEQ A;  5CYV A;  1SD7 A;  3M9A A;  2XPV A;  2AQE A;  2X85 A;  1ACI A;  2H8W A;  1ENH A;  1BJA A;  3I0T A;  1YX5 A;  4L18 B;  2O3F A;  3E6M A;  4WCG A;  1P4X A;  4UV8 A;  5TIS C;  1OMI A;  2JA7 J;  4CXF A;  1YI2 I;  1TP4 A;  1I1G A;  1WJ5 A;  1Y8Q B;  5IT3 A;  3CMA I;  2E7X A;  3DPU A;  3ML6 A;  2DPD A;  2NRA C;  5CVR A;  4I02 A;  3DF8 A;  1FC3 A;  3DTI A;  5DM6 F;  1ETO A;  1WPK A;  1RIO H;  4IQ4 A;  4EGZ A;  4G6T B;  3TO6 A;  3VWB A;  1WCM J;  2WWY A;  1R00 A;  3PNY A;  3SEZ A;  3CMM A;  1ZRD A;  2XGC A;  1ZLK A;  3K0L A;  2BBY A;  5C4J J;  4EMS A;  1B8I B;  3SFI A;  3G3Z A;  1FOY A;  3HHH A;  5HOO A;  4PZJ A;  4C3H J;  5F64 A;  3U21 A;  3DV8 A;  2NAZ A;  1GDT A;  4U87 A;  1XB4 A;  5EGO B;  2MYS A;  2NS8 A;  1QA6 A;  2QEN A;  1IN7 A;  1F9N A;  3HRS A;  1VQ8 I;  2L7Z A;  4MFE A;  1VQM I;  3OYM A;  4MQV A;  1DU6 A;  2EFQ A;  1QPM A;  2IGO A;  2JUG A;  5K7Z A;  2WB1 N;  3BDD A;  1USS A;  2JJ7 A;  1T2K A;  2VBW A;  2VBY A;  5HOD A;  3F8M A;  2QGU A;  4BXU A;  3JRI A;  2HTS A;  1VI0 A;  2E71 A;  1YYV A;  3DEU A;  1VND A;  4LIT A;  4X1E A;  1TT5 B;  5J40 A;  3O3K A;  3D5S C;  1MBJ A;  2FNP A;  2J5P A;  2MLG A;  5E1W A;  3GFJ A;  5M5X J;  2E5Z A;  5TJJ A;  3R4K A;  4JX5 A;  3MKW B;  2M8G X;  2K9L A;  1XGM A;  4CDG A;  3JRC A;  3D5L A;  1D8J A;  2AXT C;  1TQI A;  1XGO A;  3WTU C;  2IP2 A;  1IUF A;  2XIG A;  2QBY B;  4D7N A;  2ISZ A;  4DOZ A;  5F04 A;  5M5Y J;  3QWL A;  1QGP A;  3G1O A;  5IP9 J;  3S1N J;  1U0J A;  3C2B A;  4CZZ A;  1UZC A;  2R7Z J;  1I27 A;  3MVP A;  4XRM A;  3W2W A;  3B73 A;  3A01 A;  2CU7 A;  1QBJ A;  3ABK H;  3RKW A;  4S05 A;  1MMA A;  1U5T A;  2EZI A;  2VAS A;  3F72 A;  2W25 A;  3HG9 A;  3HOT A;  2OQG A;  4L0Y B;  1X1B A;  2Z16 A;  1OYW A;  3ULQ B;  1ZG3 A;  2RNJ A;  3QAH A;  3GO5 A;  2LK2 A;  4M6Y A;  3AG4 H;  3G1L A;  3CP2 A;  2PMZ N;  3I58 A;  1BIB A;  2HVQ A;  1BI1 A;  1RRJ A;  1SFK A;  1QVU A;  3BJ6 A;  4K2E A;  3LAJ A;  2VKE A;  5LRR A;  3CO7 C;  1ONV A;  3S16 J;  1G3Y A;  5IP6 A;  1J09 A;  1SAN A;  2HXI A;  2KDO A;  2VJ4 A;  4HSR A;  4U88 A;  5D8L B;  4MTD A;  1JTX A;  2PEX A;  1F5T A;  1QVT A;  3I4P A;  1MMS A;  1UJ8 A;  3HGG A;  2JTV A;  3DKW A;  1Z7U A;  2VE9 A;  4H0E A;  1WI3 A;  2OCC H;  1XGN A;  2E2J J;  4KIG A;  5JVG F;  1YOV B;  3T8R A;  2A5W A;  2M45 A;  1L3L A;  2JUC A;  4ZTJ A;  5DCF A;  1R5H A;  3K1M A;  1PP8 F;  3SZG A;  3JR9 A;  3H3U A;  2MAB A;  2LBF A;  4U7D A;  4F7Z A;  4HF1 A;  3QRF F;  1N25 A;  2X1C A;  4ZYG A;  2F6C A;  3ZR8 X;  2CFX A;  2XGX A;  3FXO A;  4XLA A;  1FZP B;  1ZR4 A;  4LIU A;  5LFA A;  5C3E J;  3TW7 A;  3CQZ J;  3ERE D;  2DQL A;  1OYY A;  3KP2 A;  1EA3 A;  2GOX B;  1WH7 A;  2X48 A;  1E2X A;  5DUI A;  4AYB N;  4DYC A;  2X1E A;  3E6B A;  2X9D A;  4C2T A;  2HPI A;  3CCQ I;  4AUX A;  4ZZL A;  4GO1 A;  1L0O C;  1IRG A;  4P9F A;  1OPC A;  4EGY A;  2QQ9 A;  1U9O A;  3TL4 X;  3QP6 A;  1IN5 A;  4OIP F;  4BH9 A;  1X19 A;  5J3L A;  4ABZ A;  1WFX A;  2H8R A;  2X6Y A;  2XPU A;  4AVP A;  3B6A A;  5E1Z B;  3J80 Z;  1W7P A;  1SVM A;  1FMV A;  2R5Z A;  1E3H A;  5F1R A;  4II2 A;  1XC5 A;  1FX7 A;  2M1B A;  3J7A O;  1FSE A;  3PSF A;  3WHC A;  2RQQ A;  3QPL A;  4F52 A;  1ZN2 A;  2COB A;  4XRS A;  1W36 C;  1KU9 A;  5LHI A;  3KCC A;  2VN2 A;  3UNG C;  2V1N A;  1UAA A;  3FX3 A;  3S93 A;  1FBU A;  4XK4 A;  2PMZ A;  4EJO A;  2QKL B;  1T8I A;  3QQA A;  3BQZ A;  5L3B A;  1T08 B;  2DDA A;  3WTY C;  2QSG X;  1OYI A;  1TTY A;  2UXN A;  2PQ8 A;  1ZRF A;  2DMP A;  4CCJ A;  2DA3 A;  3MCZ A;  4EAT A;  3HDD A;  3BR5 A;  5DEQ A;  3HC7 A;  2E5N A;  2VT3 A;  5F08 A;  4BBS J;  3P9K A;  3WTW C;  2DA5 A;  4XRF A;  1X58 A;  2B7E A;  5DUK A;  3VYS B;  1HF0 A;  2JA5 J;  4IHX A;  2IA2 A;  3TED A;  4IHY A;  2CH0 A;  3FF5 A;  2R3S A;  3S32 A;  5FRO A;  4FCY A;  4A6D A;  3CCL I;  4IJA A;  1H0M A;  2PMH A;  3HSF A;  2QCO A;  3P9C A;  1TW2 A;  1D0X A;  3OIQ A;  4B8X A;  5L3C A;  1RC9 A;  2LC2 A;  2FRH A;  1FP1 D;  4NC8 A;  4FX0 A;  2R7D A;  4WXC A;  3FMS A;  2FOK A;  2F4I A;  4GRI A;  1B1B A;  3I3L A;  2A6E F;  4MQ9 F;  2CO5 A;  2XAQ A;  3EUH C;  4HV5 A;  2OBP A;  3KX2 A;  1U5T C;  3LNQ A;  3WTX C;  1GVJ A;  2WAQ N;  2RV8 A;  5KCM A;  2M0C A;  3SDG A;  2FNA A;  4BQO A;  1MMN A;  3MQ0 A;  5ICE A;  1HOM A;  1HKS A;  5K7F A;  1W5T A;  4KFC A;  5F27 A;  3IKT A;  1JKR C;  2IGK A;  3A1Y A;  2VKD A;  4B44 A;  5ICG A;  5IY5 H;  5HNF A;  2QWW A;  2DA7 A;  1GUU A;  3IP4 B;  3GVA A;  4NUB A;  4CCK A;  1D8K A;  4BUP A;  2W1O A;  5J1U A;  3WG7 H;  4LGW A;  2HOS A;  1O3R A;  3DPT A;  2B0L A;  1R5I D;  2ELK A;  2PLY A;  1SVL A;  2BYV E;  2ZXJ A;  4XL9 A;  1QHG A;  5CPR B;  3RQI A;  1RES A;  3HTU A;  1BJZ A;  5GTI C;  3A0B C;  2O61 A;  1T56 A;  1YFH A;  3ZQQ A;  2KJC A;  2LF8 A;  3SZP A;  3QYF A;  1RKW A;  4M3B A;  2K3P A;  4R8H A;  3BQY A;  2LDU A;  3CF5 F;  4D7M A;  4W1U A;  5D5V B;  3RQ4 A;  3J7Z I;  2DW4 A;  1WZ2 A;  2EZL A;  4KA4 A;  1ETV A;  4NQW A;  3BG6 A;  3CC4 I;  1X4O A;  2ZO4 A;  1ZAR A;  3HL2 A;  1A31 A;  3TOA A;  2M30 A;  3CDL A;  4KNY A;  4CA0 A;  4EM0 B;  3KPH A;  1BI2 A;  2HOT A;  3ASN H;  1TQP A;  4BDY A;  2HOE A;  4WXD A;  1ZLJ A;  2M34 A;  2BEO A;  4U7B A;  1MGT A;  2E7W A;  3OIP A;  2ZCW A;  1HST A;  1A6Q A;  2CQ7 A;  1T33 A;  1E3P A;  2CMP A;  4PSX A;  1JT6 A;  1Y8R B;  4XSZ F;  4BKX A;  4DYQ A;  4HF2 A;  5HDK A;  4P9U A;  1R5G A;  3H0D A;  5A2Q K;  1SVO A;  1V4R A;  4B3X A;  2AS5 F;  4AC0 A;  3S3N A;  2JA2 A;  2K4B A;  4NC7 A;  1LB2 A;  1IJW C;  1D0Z A;  4IHT A;  3GBG A;  1S7A A;  4FE7 A;  4BHP A;  3OY9 A;  1DP7 P;  1IO2 A;  5LHG A;  3ECO A;  2RNG A;  2HEO A;  4L9N A;  3Q9V A;  1MW7 A;  1Y0N A;  4PJM A;  4A3E J;  3O8G A;  2WC2 A;  1WJC A;  4LD5 A;  1ON2 A;  4QPQ A;  2KIS A;  3FZV A;  5DV5 A;  3GTG J;  4HBL A;  4ENK A;  5FKL A;  2CUZ A;  1YIO A;  2CRG A;  1Z9C A;  2BV6 A;  1S29 A;  4NC6 A;  4MIM A;  1XDS A;  3ASO H;  3IWF A;  3ZMT A;  1B6A A;  3OSF A;  2GIZ A;  2F4O B;  5GAE J;  1XN7 A;  3KP3 A;  2KZV A;  5E20 A;  4BJ6 C;  2IS1 A;  5DYM A;  4EJV A;  3HUG A;  2MD5 A;  4BBR J;  4C2U A;  1FTZ A;  5FKM A;  3OS1 A;  1YTY A;  1J2X A;  1WI9 A;  3KEY A;  4HG2 A;  2QEX I;  4YFX F;  4ENM A;  4P55 A;  5CKT A;  2L9S A;  2DT7 B;  4HPQ A;  2D2W A;  3D0S A;  3CUQ B;  3WHB A;  1DPU A;  2Z9O A;  4J19 A;  4AID A;  4Y33 A;  4AM3 A;  2O0Y A;  1PYV A;  2WA0 A;  2E1M B;  5C4X J;  2HPM A;  4G6D A;  3L1P A;  1B59 A;  3OL4 A;  4RAZ A;  1DU0 A;  2NOJ B;  1UEL B;  4A0Y A;  3S1Q J;  1JI8 A;  3HPH A;  3QOP A;  4ESF A;  2DFH A;  5AON A;  1SEU A;  2E34 A;  4IF4 A;  3ZXS A;  3CC7 I;  2LF7 A;  3FHN A;  2PJR A;  4CYC B;  3UKG A;  3T0Y A;  1V5E A;  5KAF C;  3CMY A;  2VB6 A;  5H20 A;  1EH7 A;  3V7R A;  2R7V A;  2JT1 A;  4IPA A;  4C9Y A;  2D1V A;  3FXM A;  3I9V 2;  3RTR A;  1HKT A;  2L02 A;  2BW3 A;  2I8D A;  3MEX A;  4IXA A;  3H5N A;  5J4V A;  3E7L A;  1Y39 A;  1PUF B;  3W6K B;  5GPC A;  3LAP A;  2R7R A;  2HI3 A;  2RN7 A;  4RGU A;  5E17 F;  2BVL A;  3DEE A;  2BHY A;  2R5Z B;  1Z05 A;  1W0T A;  3DBR B;  2EJR A;  3FK6 A;  1V5F A;  4WWC A;  2P5V A;  2LSO A;  2LY2 A;  5F0C A;  3E6D A;  1WH5 A;  2L3D A;  3JRF A;  4YRV A;  4BQA A;  3CCR I;  4ZYA A;  4GFB A;  3CUO A;  5FRN A;  3GME A;  3P7N A;  3K10 A;  4N9I A;  5FB2 A;  3QU6 A;  3RYR A;  3QOE A;  2E36 A;  3LSH A;  2BVM A;  1O4X A;  4CCO A;  5FKN A;  1V54 H;  2Z99 A;  1G3S A;  3EET A;  4L5I A;  2JPB A;  3CCS I;  4LG0 B;  3T5X A;  1VQ9 I;  3CTA A;  2NNN A;  1IAW A;  3K6G A;  3KZY A;  2OA4 A;  5K1Y A;  2LR8 A;  2XAF A;  4UUT A;  4A3G J;  2KRH A;  3CJR B;  2RC4 A;  2FE3 A;  5GAD J;  1DUX C;  5KNL A;  4RM2 A;  4IZZ A;  2EIJ H;  4UUS B;  4M72 A;  4XLE A;  5B1B H;  4I76 A;  4OWR B;  4YIR X;  2HS5 A;  3OYB A;  5DCM A;  3NWS A;  3G71 I;  4I99 C;  1HW5 A;  3BTC A;  1I3Q J;  1QU3 A;  3W2V A;  1HW2 A;  2B63 J;  2WAF A;  1MMD A;  3FK7 A;  3ZN1 A;  2W85 A;  3TOB A;  2KHM A;  1LE8 B;  4G7O F;  1IC8 A;  3ELK A;  2YSR A;  3DPL C;  5L3E A;  3O2P E;  1FYM A;  3DEW A;  2WV1 A;  4HZF A;  3WTV C;  3NEU A;  3E5U A;  4XOR A;  2WAD A;  3S8P A;  1K4S A;  4J01 A;  4NDL A;  1Q1H A;  1NHA A;  3M7G A;  2A61 A;  1XCB A;  2NVU B;  1Z67 A;  1SD6 A;  4HAM A;  1F36 A;  2KFD A;  4M3F A;  3PL8 A;  1JHH A;  5HS9 A;  2EA2 A;  2JA6 J;  2CV1 A;  4O3M A;  3CF2 A;  1MIJ A;  3C2H A;  4N4O B;  5BPI A;  4B4C A;  4ZC3 A;  4JBA A;  3F21 A;  2VC0 A;  5K5Q A;  4RDU A;  2KP6 A;  2R7S A;  4B3A A;  1E3O C;  3LWF A;  5J6X A;  2FEZ A;  3IWZ A;  1AKH A;  3Q5F A;  5CJ9 A;  4BE0 A;  2GXA A;  1E17 A;  3LMM A;  1VQL I;  3E6C C;  1Z6T A;  4M71 A;  4UVA A;  4DQ2 A;  2UXX A;  5HDN A;  5B5E C;  1HKQ A;  3RCO A;  2TRT A;  2GOM A;  3LA2 A;  2M7B A;  3S1R J;  3JRE A;  4I09 A;  5JR3 A;  4LLL A;  1SFO J;  2P5K A;  3KIO A;  3JSP A;  4YEJ A;  4LLG F;  3IHU A;  2NVX J;  2K27 A;  4HDU A;  4FQG A;  5FLV A;  1RKT A;  3DBL B;  2IA1 A;  3WGG A;  5JLW A;  3COA C;  1HC8 A;  2CGP A;  1RPW A;  2DXI A;  1I3A A;  2COM A;  2HOA A;  2K9N A;  2F4M B;  3DU6 A;  3DBH B;  5GAG J;  1PUE E;  3BZC A;  2JVH A;  2A5Y B;  1WJE A;  1P9Q C;  3BCB A;  4BEH A;  1YRN B;  3AL0 B;  2NS0 A;  1AWC A;  1S3J A;  3BG3 A;  3BPV A;  2VQG A;  1R1U A;  2R93 J;  1S7O A;  1D1B A;  4H4K C;  4OMZ A;  4OIO F;  1EF4 A;  1ZHF A;  4IOC F;  1ZGA A;  3IRR A;  1UMQ A;  4J00 A;  2OQR A;  2A6T A;  2FQ3 A;  5LEJ A;  1ZRE A;  5JVT A;  3CJT B;  4XNF A;  3OYJ A;  3CCU I;  3RIR A;  3K69 A;  2EH3 A;  2NVQ J;  4HOB A;  1FLI A;  3LSJ A;  1ODD A;  1LVA A;  1ZG1 A;  2BY2 A;  5DS9 A;  3CJN A;  4RAY A;  1MJB A;  5J1R A;  2F5D A;  3K9T A;  4NB5 A;  2GAU A;  3JTG A;  4C30 A;  3F9K A;  2HYF A;  3PFI A;  2HTJ A;  3I53 A;  3S2W A;  1VF9 A;  4UXN A;  2IA0 A;  2ZC2 A;  3TQN A;  4BY1 J;  5M5W J;  4YFN F;  3TP3 A;  4ENJ A;  2ELH A;  2DYS H;  5HS8 A;  3Q9S A;  3E5Q A;  4PCQ A;  2XB5 A;  1QRY A;  4XRS G;  5F6F A;  2Z5U A;  1RUO A;  4BE1 A;  5EEH A;  3IUO A;  2IW5 A;  2ZJ2 A;  2OZU A;  2X1D A;  2HXO A;  3T1B A;  4FHT A;  2HDW A;  4ON0 A;  3K70 C;  1LFP A;  3V7C A;  1IN4 A;  2ZME C;  3ABL H;  4F55 A;  2A69 F;  2GXG A;  9ANT A;  3PUF A;  2K85 A;  3F6O A;  3LSK A;  1U2W A;  2IGN A;  4KUM A;  1KU2 A;  4Q4Z F;  1FNN A;  2DFE A;  4ITV A;  3RZD J;  3GFM A;  3RI4 A;  3PJR A;  1IRF A;  3ZQH A;  2Y0S A;  3GUD A;  2CQK A;  1MBG A;  4ZTF A;  1IGN A;  1ETQ A;  1O7L A;  2H6B A;  2PN6 A;  3OMY A;  1JGS A;  5GPA A;  2FF4 A;  2HDC A;  2LYC A;  2GA2 A;  3F0C A;  5KAI C;  4FE4 A;  4HNV A;  2YU3 A;  3GLL A;  3V8L A;  2DT6 A;  2FML A;  3Q0W A;  3TW6 A;  2FOW A;  5BQT A;  5ED4 A;  4QTR A;  2QYO A;  2FXA A;  4FAS D;  3S17 J;  3ROU A;  3KLO A;  1QHH D;  1U8B A;  2LRD A;  1YHQ I;  1JTY A;  3G2B A;  3ZCO A;  1XCV A;  3VSK A;  3S1M J;  4RLF A;  2FJ1 A;  2V9V A;  3K7A J;  4ZYE A;  2ZJQ F;  4OIR F;  3ZQ7 A;  3F8N A;  2VQH A;  2P8T A;  5DDG A;  4HEA 2;  1FOX A;  2H1K A;  2JMW A;  3K4M A;  5HDG A;  1JT0 A;  5M3F J;  2RQP A;  3M07 A;  4UB6 C;  1K6O A;  5FLX Z;  2Z1D A;  2VXD A;  3DCF A;  2PJR B;  1D1C A;  5E1X A;  3CO6 C;  4D1Q A;  4ESB A;  2VQC A;  5A2Q Z;  5GP9 A;  1U9N A;  3QPS A;  4WX9 A;  1PP7 U;  3HYI A;  1BA5 A;  2IT0 A;  3IH3 A;  2K5C A;  2L0K A;  1IXC A;  3HOY J;  4A3F J;  3S14 J;  3WTZ A;  2IGM A;  2LNB A;  5H6R A;  4B09 A;  4F92 B;  2VKH A;  1R36 A;  3LL7 A;  2WY7 Q;  3H3V K;  4CCN A;  1ETW A;  1WSU A;  4N0B A;  1GHC A;  3K2Z A;  2P5L C;  3VYR B;  1CGP A;  2M5W A;  1IN8 A;  1Z91 A;  3CDI A;  1JHF A;  3HOW J;  4KN4 X;  2KLO A;  1GV5 A;  2KRF A;  3OR1 C;  3MZ8 A;  4I0A A;  1XD7 A;  3PNT A;  1JKQ C;  2L4A A;  1UG2 A;  3JW4 A;  4A93 J;  2EWN A;  1ORK A;  4S04 A;  1I50 J;  4A5N A;  5CVV A;  4XKC A;  3OOP A;  3GYH X;  1XSV A;  2DOE A;  4GCV A;  2V79 A;  3K4J A;  5DD8 A;  4BAC A;  4QWQ A;  2OD5 A;  5B1A H;  2J5O A;  2L4M A;  3AL0 C;  2PG4 A;  5ERI A;  4UVB A;  1EV7 A;  3K1N A;  3L09 A;  3L7W A;  1P2F A;  3GZ5 A;  4XOP A;  1P6R A;  1KU3 A;  2Z2S B;  3P9I A;  1K7A A;  1Y6I A;  1YQA A;  3DFG A;  1XGS A;  3FHZ A;  3KFW X;  1ZK8 A;  2Q1Z B;  3KE2 A;  4A3M J;  1IDZ A;  1VQK I;  2WAE A;  4BDZ A;  4A6E A;  3FKJ A;  5EDN A;  3B02 A;  2XC7 A;  2QA4 I;  3DTK A;  2IS2 A;  2ETH A;  2L7F P;  1HDD C;  2JRM A;  2F5V A;  1XDU A;  2OC6 A;  1A36 A;  1OKR A;  2AO9 A;  3BG9 A;  4G12 A;  1LEB A;  1SFU A;  3N4M A;  1JJ6 C;  1WJB A;  3K4C A;  1VZ0 A;  2V9P A;  2L9N A;  3VOD A;  1POG A;  3A4C A;  1R58 A;  1X4P A;  2Y2Z A;  2MLK A;  3FXJ A;  1MNM C;  1AOY A;  1W5C C;  3JRB A;  2K02 A;  2CG4 A;  4A3D J;  2XRN A;  3ZN0 A;  2KIU A;  4XKV A;  4XLH A;  1QNT A;  3C1D A;  2HVR A;  2CV2 A;  4PK4 A;  3V8K A;  4UNO A;  2KIF A;  5KVR A;  3GW2 A;  4MO7 A;  4N4N B;  2R7U A;  3MKZ A;  1FMW A;  4KJZ A;  5EZH A;  2XAH A;  4YII A;  2XAJ A;  1GV2 A;  2L9V A;  2DTZ A;  3K1P A;  2L2O A;  1V5G A;  2DPU A;  2CSO A;  4XLN F;  3F8F A;  1D0Y A;  2LFB A;  4CYD A;  1TWH J;  5GAH J;  5LRS A;  3L00 A;  2FX0 A;  4KDP A;  1YJ9 I;  5E79 C;  5CVU A;  2V1U A;  3HOV J;  2EIK H;  3EYY A;  5LBQ A;  5JI6 A;  3GTJ J;  3EDP A;  3VDX A;  5F0H A;  1ZR2 A;  1LFU P;  1OCO H;  2LP0 A;  4KMF A;  2ECB A;  5IT9 K;  3A03 A;  2BE5 F;  2R7T A;  3E0J B;  3OS2 A;  1SFE A;  4DZP A;  1Z0X A;  2IS4 A;  4XQF A;  3E5X A;  4QPO A;  4M74 A;  3ISP A;  1NG6 A;  3ZQC A;  3N97 A;  1XG1 A;  3V7S A;  3JTH A;  4V2G A;  2HQN A;  3EYI A;  2ESN A;  3VOE A;  1K79 A;  3CUQ A;  1B9N A;  3V8J A;  2EIN H;  4MNU A;  4G7H F;  5HLH A;  1YRN A;  1H9G A;  1TC3 C;  4Q47 A;  1T38 A;  1BI3 A;  1S5L C;  1R22 A;  3BR3 A;  4CSW A;  1VQN I;  2DDB A;  3VPR A;  4LB5 A;  3LA3 A;  3KLN A;  3J81 K;  2HQ5 A;  1K78 B;  1ZTR A;  2YPR A;  2E1C A;  4Y4R A;  2DMN A;  2P81 A;  2D45 A;  1BC7 C;  1AHD P;  1ZRC A;  1RET A;  3ZMZ A;  5BS6 A;  3ZQL A;  3LFK A;  2HDD A;  4NHJ A;  4M6V A;  3CCY A;  4CYC A;  1IW7 F;  1TWF J;  2BZT A;  3L2Q A;  5LGN A;  2W57 A;  2M3A A;  2CUJ A;  3HTS B;  4KN7 X;  2NNY A;  5FLX K;  2FMY A;  3H9G A;  2EV5 A;  4C3J J;  5EEA A;  4X0G A;  2GXB A;  2V1X A;  4XLF A;  2R5Y B;  3BTL A;  3I64 A;  2HYG D;  3W3C A;  4RAG A;  4JOM A;  2JZY A;  2EPF A;  1P7J A;  5ILV A;  2JWT A;  2EZH A;  2NXN B;  4AWX B;  2FUG 2;  3BZ6 A;  4BJ5 C;  2XHK A;  3F8B A;  2NYX A;  3FMQ A;  4UUS A;  3GTL J;  3CLO A;  2K3F A;  2DOD A;  1SC7 A;  2XRL A;  2M4K A;  3LQQ A;  3ABT A;  5D6F A;  2I5U A;  2P7V B;  2JPC A;  3AAF A;  3A2K A;  5EF6 A;  4CGZ A;  2TDX A;  2EBI A;  2LLK A;  1RUN A;  5K5O A;  1IN6 A;  4OAZ A;  3G73 A;  3ZMV A;  4AIH A;  1ZGW A;  1HQC A;  2DN0 A;  5H6Q A;  1IF1 A;  3IH4 A;  3IV5 A;  5HS7 A;  1H9T A;  2ZJR F;  5IYD J;  3RKX A;  3X2Q H;  1K83 J;  4M9X A;  3VYT B;  3K4K A;  4EJU A;  4LJZ F;  2G7U A;  3TKY A;  1LEA A;  2KMU A;  1G59 A;  3LOC A;  2X6X A;  3GTO J;  4BS9 A;  3PSI A;  1W1W E;  2IPQ X;  5D5W B;  4BU2 A;  1F1Z A;  3GCM A;  1ETX A;  5F1J A;  2VOP A;  2LY9 A;  4EJT A;  4Y3O A;  1Z6R A;  5D5U B;  4LG3 A;  4CHU A;  3ZQG A;  3ZPL A;  2K86 A;  1APL C;  2GA1 A;  1W36 D;  3MZH A;  4DJA A;  1I5Z A;  1BOB A;  1RNL A;  1H88 C;  3R0A A;  3OYL A;  2RVC A;  3LSP A;  2RAE A;  3S3O A;  2ZXI A;  2EQR A;  1K4T A;  3W6V A;  1OCP A;  1YS6 A;  2GLO A;  4II3 A;  3G4S I;  3HKZ N;  2ZXW H;  1UHS A;  2D5V A;  1SAX A;  4I2O A;  1B9M A;  1ZAO A;  3KET A;  2L54 A;  2W82 A;  2DT5 A;  3DU5 A;  1D3Y A;  1B72 B;  2WV0 A;  3TMO A;  5E3M A;  1DDN A;  1R7J A;  1OCT C;  3W2A A;  3PIO F;  2H1L A;  2WB1 A;  4JX6 A;  4HNT A;  3BJA A;  1O7F A;  3MKL A;  2YS9 A;  1MMG A;  1MJA A;  2QSF X;  2XGD A;  1VQ7 I;  4PGG A;  2ID3 A;  3D5R C;  4Z2Y A;  2FBH A;  4JQF A;  1B72 A;  1V3F A;  2OTL I;  2QQA A;  4RA2 A;  1TZL A;  1S6L A;  3ZQF A;  1JJ8 C;  5AIP A;  2O9L A;  2WY8 Q;  1FPQ A;  4JX4 A;  1MDM B;  3CUQ C;  4E7Z A;  4IVN A;  4XON A;  2ECC A;  1BI0 A;  1YW9 A;  1H89 C;  5FD6 A;  3BCA A;  1KZH A;  4NQW B;  4RM3 A;  2LY1 A;  3DWL E;  3AG3 H;  3QU3 A;  4MHG A;  3I59 A;  1WHU A;  2C6Y A;  3PFY A;  4GDF A;  1J75 A;  3FBN B;  3QP5 A;  4BE2 A;  1W4M A;  1WJD A;  3H9J A;  2L7M P;  2O6G E;  1T0F C;  1K6Y A;  3RSN A;  2O8K A;  3HPG A;  4DIQ A;  2ZBK A;  1O3Q A;  1KYZ A;  2W4S A;  3H35 A;  4EVI A;  1SAU A;  3G6E I;  1HCR A;  4G8X A;  1IUY A;  1GLN A;  2P0W A;  4L9V A;  2JQ7 A;  2CYY A;  3NQO A;  3BG7 A;  2YX4 A;  2KQR A;  1XSD A;  1I6X A;  3LSI A;  3B6C A;  1P4A A;  3M8J A;  5EG0 A;  3WTT C;  2ZB9 A;  3QOD A;  1RR8 C;  5JHF A;  2XSJ C;  4LLN A;  1LJ9 A;  2VIX A;  2CQQ A;  3OYN A;  2P4W A;  4G94 A;  1Z3X A;  1X1P A;  1SD5 A;  3GZN B;  2WTE A;  3FM3 A;  3EQL F;  3RPU D;  5E18 F;  2DMU A;  2JSP A;  2IRF G;  4L9J A;  3IRQ A;  4FET A;  3CCV I;  4CH7 A;  2OPT A;  4A0X A;  3OR2 C;  1TLH B;  2KKO A;  3SHF A;  1HLV A;  2CUE A;  2EIL H;  2H6C A;  5DTD A;  3BRO A;  2HGC A;  3RDI A;  3OYG A;  2DJN A;  3FDY A;  4YG2 F;  5AIQ A;  4UY8 I;  1GVD A;  4XKW A;  4OIQ F;  2K9S A;  1LUJ B;  2KJB A;  1A6I A;  2VL8 A;  2ZNZ A;  3S2D J;  4MEY F;  3WTS C;  2DK5 A;  3KZI C;  1ITY A;  2IJL A;  5D4S A;  3DP7 A;  1LKX A;  3CC2 I;  1MND A;  3DLA A;  1ETK A;  4HLY A;  4X6A J;  3EPZ A;  1W5S A;  2DYR H;  2E2H J;  3KEO A;  1TT0 A;  4L0Z B;  3ZQI A;  5CVJ A;  1H8A C;  4RMN A;  3DQV C;  2QUF A;  1TBX A;  5LEK A;  1K61 A;  4M73 A;  4MEX F;  2O03 A;  3H92 A;  4G7Z F;  1QZY A;  1YW7 A;  3DXJ F;  4A69 C;  5HLG A;  1F4K A;  3I56 I;  1S8N A;  1T6S A;  2L5Q A;  3DTE A;  5DD4 A;  3VYU B;  4AU7 A;  5HVQ C;  1OFC X;  2ZME B;  3CDH A;  1X2M A;  2K9Q A;  2IEK A;  3PQK A;  2GQQ A;  2AHQ A;  3TDZ C;  1NK2 P;  3ABM H;  4P96 A;  1LVK A;  1XMK A;  3JCU C;  2O5R A;  2STT A;  3HOU J;  3BTI A;  1IDY A;  4P5O A;  3SJM A;  1HXD A;  2R7F A;  4S0H B;  2MW8 A;  3K4N A;  3REO A;  1EJ9 A;  2DAO A;  3RPU A;  3N05 A;  1WVR A;  2JVG A;  1S7E A;  2VXZ A;  1FOW A;  1R4M B;  1OIS A;  1WJA A;  2KT0 A;  4A3L J;  3JAM K;  4HQM A;  3OS0 A;  3PNV A;  1P7I A;  3CD6 I;  2QQB A;  4LFU A;  2STW A;  1OCZ H;  4GXO A;  1G4D A;  1N77 A;  4IHW A;  5JFR A;  3WOD F;  1D5V A;  1ON1 A;  4BXX J;  2KIM A;  2X4H A;  4DGW B;  4OAY A;  4XKB A;  3H5A A;  4E7J A;  1MNE A;  1FBQ A;  1DP3 A;  5J1Y A;  1JUS A;  2KRC A;  5JLX A;  2Y69 H;  5F0F A;  1J5Y A;  1J59 A;  4HX4 A;  1PUF A;  2DMQ A;  4ZH4 F;  1FEX A;  1X1D A;  1GT0 C;  2DA6 A;  3GWZ A;  1A5J A;  1TNT A;  4BY7 J;  3FKI J;  2R92 J;  3WE2 A;  3R6S A;  1OQY A;  3I4N J;  2CS3 A;  1TWC J;  5BOX A;  1KA8 A;  2VQL A;  2VKV A;  5J47 A;  2K7L A;  2XAG A;  5EJC A;  4MLO A; 
#chains in the Genus database with same CATH homology
 3WG9 A;  3RKY A;  4I01 A;  4ETS A;  2Q2E A;  1T0F A;  2X0L A;  3VB2 A;  1MZB A;  3O6B B;  3HRM A;  4RGS A;  1YG2 A;  3TO9 A;  1UCR A;  1T98 A;  5D4R A;  1CF7 B;  3WU1 B;  2YR2 A;  2O8X A;  2VBZ A;  4ZYD A;  1WQ2 A;  3GEZ A;  5DCM B;  2MA3 A;  4RGR A;  3I5U A;  4UV9 A;  1REP C;  4HLX A;  3I54 A;  4R1H A;  4Y13 A;  3MZY A;  2P6T A;  5FD5 A;  4BNC A;  4GGG A;  3FWE A;  1A04 A;  1U78 A;  3E97 A;  4MGR A;  5L3G A;  1YO5 C;  5D8K B;  5LGU A;  1FSH A;  3V4G A;  2W24 A;  2VON A;  2FBI A;  1RI7 A;  2VBX A;  1YS7 A;  4UHT A;  4HX8 A;  2OZ6 A;  2EFP A;  2H94 A;  1FOK A;  4EJW A;  4U0Y A;  4M9Z A;  5BPD A;  2GZW A;  2MBF A;  1G6N A;  1ZGJ A;  2V6C A;  1G3W A;  2AXL A;  4GYI A;  4G6Q A;  4PDK A;  2RGV A;  1FY7 A;  5J8F A;  3W6J B;  5ICF A;  4EQQ A;  4A0Z A;  2A6H F;  2DTR A;  2QLZ A;  5K5R A;  1P4W A;  2XVC A;  3ZP5 A;  4ZZD A;  1I1S A;  1XSX A;  1BN5 A;  2XUB A;  1BBY A;  2FU4 A;  2F5C A;  2Q0O A;  4M9S A;  3HIF A;  4A2U A;  4RS8 A;  4Y15 A;  1Z1D A;  2HZT A;  2P7C B;  1W7P B;  3GF2 A;  3QPT A;  3KP5 A;  1STZ A;  1R1V A;  2UZK A;  1KU7 A;  2XKP A;  1BC8 C;  1TQM A;  3QPH A;  2DK8 A;  1X3U A;  4KIF A;  2MH9 A;  2F5E A;  5TRD A;  1UHW A;  4ENN A;  3FXU A;  3RJP A;  4O5V A;  3U2R A;  5D6E A;  5L3F A;  3WE3 A;  5CLS A;  4AD9 A;  5ILU A;  1U8R A;  5D5X B;  2Y48 A;  5L3D A;  4XLP F;  1EH8 A;  2OAZ A;  2DO7 A;  2Q8K A;  1HSJ A;  1WRJ A;  4LK1 F;  3HRU A;  1P92 A;  2HKO A;  3SFZ A;  4D0P A;  1YLF A;  2HQR A;  5ILS A;  2EA4 A;  1O3S A;  2A07 F;  5FFX A;  4KIB A;  4U0V A;  3SZT A;  1LQ1 A;  2JSC A;  2EV6 A;  2BGC A;  4I98 B;  2ZKZ A;  3F23 A;  2K4J A;  2CWE A;  5CVI A;  3ECH A;  1OR7 A;  2XAS A;  3BP8 A;  2LKP A;  1KQ0 A;  2DLL A;  1GXQ A;  4QLC U;  3C7J A;  4KMU X;  2H09 A;  4G9Y A;  1LDK B;  3C3W A;  4HW0 A;  1LNW A;  1HW1 A;  1U6G A;  2H27 A;  3FMR A;  1YW8 A;  2A3S A;  4I0B A;  4CO8 A;  4R79 A;  3MWM A;  2QVO A;  5BMZ A;  3R60 A;  2HFH A;  3T8T A;  3KP7 A;  2FBK A;  1EH6 A;  4LB6 B;  4ESJ A;  2F2E A;  4U0W A;  1MDM A;  3OV8 A;  4WXH A;  5E8I A;  2ZNY A;  4Y17 A;  4MTE A;  1QO0 D;  1G3T A;  1BOA A;  1ULY A;  5LLQ A;  3ABU A;  4RGX A;  5E8G A;  4RB0 A;  4YIF A;  4RB1 A;  3KZZ A;  4M6X A;  2ESH A;  1FYL A;  1SD4 A;  4TV7 A;  3GFL A;  2QZ8 A;  2EB7 A;  2YX7 A;  1TW3 A;  2IVM A;  2RDP A;  3RYP A;  2M8E A;  3I71 A;  4DNC A;  4Q48 A;  1Y0U A;  3KP6 A;  5KK1 A;  3TDU C;  1PDN C;  1U5T B;  3ZMU A;  4EM2 A;  3L9F A;  3F8C A;  3IC7 A;  4YFK F;  3TO7 A;  4FX4 A;  1TNS A;  4ZYH A;  1JE8 A;  4UVC A;  4RB3 C;  4BHB A;  2QBY A;  1IXS B;  2D1H A;  2XV4 S;  4HDV A;  3GZ6 A;  3H3Z A;  4Q5S F;  3M8E A;  2EFW A;  1WWX A;  2DFI A;  2PJP A;  3LA7 A;  1IZ1 A;  2ACJ A;  2DQR A;  2Y0M A;  1SMT A;  2ZFW A;  3J81 Z;  3LQR A;  1K78 A;  2G7H A;  3R61 A;  2ZME A;  3HSE A;  4AIK A;  3F6V A;  3BWG A;  1T39 A;  1O57 A;  2VOO A;  5ICC A;  4L5J A;  4OIN F;  4EM1 A;  4A5M A;  4WK8 F;  2Z3Y A;  5EEG A;  3LST A;  5IT9 Z;  4LK0 F;  1J0R A;  2GIV A;  2PI0 A;  1O3T A;  3FM5 A;  4O6J A;  2V1D A;  4XBF A;  3VEP A;  1GXP A;  1SMY F;  3GXO A;  3BJO A;  2Z33 A;  4IRI A;  1RZ4 A;  3VFZ A;  3EUH A;  2CW0 F;  1UHM A;  3FXQ A;  3L2C A;  2HKX A;  1MKM A;  3KP4 A;  3IL2 A;  2QM3 A;  5JHU A;  3WGI A;  3HRT A;  4IHS A;  2DU9 A;  4HA8 A;  4IRH A;  4JK1 X;  1FYK A;  1ZH5 A;  3HSR A;  4LG0 A;  1QQI A;  2MH2 A;  1FP2 A;  2M87 A;  4I7H A;  1JXS A;  3IKV A;  2HR3 A;  3GX4 X;  3NRV A;  3BY6 A;  1CF7 A;  3SQN A;  3MFK A;  2PMU A;  3SXY A;  1BM9 A;  2ISY A;  1B4A A;  2P6S A;  2VT2 A;  1R23 A;  3PQJ A;  2MC3 A;  2OU2 A;  1HBX G;  3M1E A;  2PFB A;  1KYW A;  1U3E M;  2PBI A;  2VE8 A;  2JRT A;  4A12 A;  1R1T A;  1FBS A;  2F5F A;  5LGT A;  4CIC A;  5FO5 A;  4HX7 A;  3BPX A;  3WGH A;  2DI3 A;  4FT8 A;  1UST A;  2L01 A;  1MD0 A;  3RPQ A;  2XKO A;  4GYG A;  4HF0 A;  2EFN A;  3HHG A;  3J80 K;  4EV0 A;  2FSW A;  3F22 A;  2DBB A;  1MJ9 A;  4OU0 A;  4HYE A;  4BAY A;  3GFI A;  4HQE A;  4PGH A;  2ADU A;  2EK5 A;  3U1D A;  4BHC A;  1BIA A;  2GWR A;  3BOQ A;  4ASN A;  3E3V A;  1FWZ A;  5HLI A;  4AIJ A;  4OOI A;  2VC1 A;  3TGN A;  2E1N A;  2EV0 A;  5J8C A;  1J7K A;  3U9G A;  1KGS A;  3MAJ A;  4RB2 C;  3ZMS A;  4WF2 A;  3I59 B;  4KIC A;  4HV6 A;  3GLX A;  4OMY A;  1IXR C;  1DPR A;  3WU0 A;  1SFX A;  1ZG5 A;  3JAM Z;  2W84 A;  3M8F A;  3F3X A;  4L9T A;  3FXR A;  3R0J A;  2EFO A;  1LDD A;  2HWV A;  2UWM A;  2G9W A;  5FFZ A;  2RKH A;  4BYY A;  1UB9 A;  2Y75 A;  4IRG A;  4XSX F;  2VOD A;  3JSO A;  4N9H A;  4KYW A;  1J9I A;  2FA5 A;  1FT9 A;  1QZZ A;  4UUV A;  1KQ9 A;  1ZYR F;  1UFM A;  4LMY A;  2XRO A;  1KQ8 A;  5FGM A;  3HOS A;  1C0W A;  3ZMD A;  1VTN C;  1W7P D;  5LHH A;  4E70 A;  1XMA A;  2A68 F;  3C18 A;  1WKM A;  1LDJ A;  4KT5 C;  6PAX A;  3KEQ A;  5CYV A;  1SD7 A;  3M9A A;  1BJA A;  3I0T A;  4L18 B;  2O3F A;  3E6M A;  4WCG A;  1P4X A;  4UV8 A;  1OMI A;  4CXF A;  1I1G A;  5IT3 A;  2E7X A;  3ML6 A;  2DPD A;  2NRA C;  5CVR A;  4I02 A;  3DF8 A;  1FC3 A;  1RIO H;  4EGZ A;  3TO6 A;  2WWY A;  1R00 A;  1ZRD A;  1ZLK A;  3K0L A;  2BBY A;  4EMS A;  3G3Z A;  3HHH A;  5HOO A;  4PZJ A;  5F64 A;  3DV8 A;  2NAZ A;  1XB4 A;  2QEN A;  1IN7 A;  1F9N A;  3HRS A;  4MQV A;  2EFQ A;  1QPM A;  3BDD A;  1USS A;  1T2K A;  2VBW A;  2VBY A;  3F8M A;  4BXU A;  2HTS A;  1YYV A;  3DEU A;  3O3K A;  2J5P A;  2FNP A;  2MLG A;  5E1W A;  3GFJ A;  5TJJ A;  3R4K A;  4CDG A;  1XGM A;  1D8J A;  3D5L A;  1TQI A;  1XGO A;  3WTU C;  2IP2 A;  2XIG A;  2QBY B;  2ISZ A;  1QGP A;  4CZZ A;  1I27 A;  3B73 A;  1QBJ A;  3RKW A;  4S05 A;  1U5T A;  3F72 A;  3HOT A;  2W25 A;  4L0Y B;  2OQG A;  1OYW A;  3ULQ B;  1ZG3 A;  2RNJ A;  3QAH A;  3GO5 A;  4M6Y A;  3I58 A;  1BIB A;  1BI1 A;  3LAJ A;  3BJ6 A;  4K2E A;  3CO7 C;  5LRR A;  1ONV A;  1G3Y A;  4U88 A;  4MTD A;  5D8L B;  2PEX A;  1F5T A;  3I4P A;  2JTV A;  3DKW A;  1Z7U A;  2VE9 A;  4H0E A;  1XGN A;  4KIG A;  3T8R A;  2M45 A;  1L3L A;  5DCF A;  1R5H A;  3K1M A;  1PP8 F;  3H3U A;  4U7D A;  4F7Z A;  3QRF F;  4ZYG A;  2CFX A;  2XGX A;  1FZP B;  3ERE D;  2DQL A;  1OYY A;  3KP2 A;  1E2X A;  5DUI A;  3E6B A;  4ZZL A;  4GO1 A;  1L0O C;  1IRG A;  4P9F A;  1OPC A;  4EGY A;  2QQ9 A;  3QP6 A;  1IN5 A;  4OIP F;  4BH9 A;  4AVP A;  5E1Z B;  3J80 Z;  1W7P A;  5F1R A;  1FX7 A;  2M1B A;  3J7A O;  1FSE A;  1ZN2 A;  1KU9 A;  5LHI A;  3KCC A;  2VN2 A;  3FX3 A;  1FBU A;  4EJO A;  5L3B A;  3WTY C;  1OYI A;  1TTY A;  2UXN A;  2PQ8 A;  1ZRF A;  3MCZ A;  5DEQ A;  2VT3 A;  3P9K A;  3WTW C;  4XRF A;  5DUK A;  2IA2 A;  3FF5 A;  2R3S A;  4A6D A;  4IJA A;  1H0M A;  2PMH A;  3HSF A;  3P9C A;  1TW2 A;  4B8X A;  5L3C A;  2FRH A;  1FP1 D;  4FX0 A;  2R7D A;  4WXC A;  3FMS A;  2FOK A;  1B1B A;  2A6E F;  4MQ9 F;  2CO5 A;  2XAQ A;  4HV5 A;  2OBP A;  1U5T C;  3WTX C;  1GVJ A;  2RV8 A;  2FNA A;  3MQ0 A;  5ICE A;  1HKS A;  1W5T A;  4KFC A;  3IKT A;  5ICG A;  2QWW A;  3GVA A;  1D8K A;  4LGW A;  1O3R A;  3DPT A;  2B0L A;  2PLY A;  2BYV E;  4AIH A;  2ZXJ A;  3HTU A;  2O61 A;  1YFH A;  2KJC A;  2LF8 A;  3SZP A;  4R8H A;  2LDU A;  5D5V B;  2DW4 A;  4KA4 A;  4NQW A;  2ZO4 A;  1ZAR A;  3TOA A;  2M30 A;  4KNY A;  4EM0 B;  1BI2 A;  1TQP A;  2HOE A;  4WXD A;  1ZLJ A;  2BEO A;  4U7B A;  1MGT A;  2E7W A;  2ZCW A;  1HST A;  4XSZ F;  4HF2 A;  5HDK A;  4P9U A;  1R5G A;  5A2Q K;  1V4R A;  2AS5 F;  2K4B A;  1LB2 A;  4IHT A;  1S7A A;  4BHP A;  1DP7 P;  5LHG A;  3ECO A;  2HEO A;  4L9N A;  3Q9V A;  2WC2 A;  4LD5 A;  1ON2 A;  3FZV A;  5DV5 A;  4HBL A;  4ENK A;  1YIO A;  1Z9C A;  2BV6 A;  1S29 A;  1XDS A;  3IWF A;  3ZMT A;  1B6A A;  1XN7 A;  3KP3 A;  5E20 A;  5DYM A;  4EJV A;  3HUG A;  2MD5 A;  1YTY A;  1J2X A;  1WI9 A;  4YFX F;  4ENM A;  4P55 A;  2D2W A;  3D0S A;  3CUQ B;  1DPU A;  2Z9O A;  2O0Y A;  4G6D A;  1B59 A;  4RAZ A;  4A0Y A;  3QOP A;  4ESF A;  5AON A;  4IF4 A;  2LF7 A;  3T0Y A;  5H20 A;  1EH7 A;  3V7R A;  2JT1 A;  4IPA A;  2D1V A;  3RTR A;  1HKT A;  2L02 A;  3MEX A;  4IXA A;  3W6K B;  3LAP A;  2RN7 A;  4RGU A;  5E17 F;  1Z05 A;  2EJR A;  4WWC A;  2P5V A;  2LSO A;  3E6D A;  2L3D A;  4BQA A;  3CUO A;  3P7N A;  4N9I A;  5FB2 A;  3QU6 A;  3RYR A;  2Z99 A;  1G3S A;  3EET A;  4L5I A;  2JPB A;  4LG0 B;  3T5X A;  3CTA A;  2NNN A;  1IAW A;  3KZY A;  2OA4 A;  5K1Y A;  2XAF A;  2RC4 A;  2FE3 A;  1DUX C;  4M72 A;  2HS5 A;  5DCM A;  1HW5 A;  1HW2 A;  3ZN1 A;  2W85 A;  3TOB A;  4G7O F;  2YSR A;  3DPL C;  5L3E A;  3ELK A;  3O2P E;  1FYM A;  4HZF A;  3WTV C;  3NEU A;  3E5U A;  1Q1H A;  1NHA A;  3M7G A;  2A61 A;  1XCB A;  1SD6 A;  4HAM A;  1JHH A;  5HS9 A;  2EA2 A;  4O3M A;  5BPI A;  4JBA A;  3F21 A;  2VC0 A;  5K5Q A;  3LWF A;  5J6X A;  2FEZ A;  3IWZ A;  3Q5F A;  5CJ9 A;  1E17 A;  3E6C C;  1Z6T A;  4M71 A;  4UVA A;  4DQ2 A;  2UXX A;  5HDN A;  1HKQ A;  3LA2 A;  4I09 A;  5JR3 A;  4LLL A;  2P5K A;  3JSP A;  4LLG F;  3IHU A;  2K27 A;  4HDU A;  2IA1 A;  3WGG A;  3COA C;  2CGP A;  2COM A;  1PUE E;  2A5Y B;  2NS0 A;  1AWC A;  1S3J A;  3BPV A;  1R1U A;  1S7O A;  4OMZ A;  4OIO F;  1ZHF A;  1ZGA A;  3IRR A;  2OQR A;  2FQ3 A;  5LEJ A;  1ZRE A;  5JVT A;  3RIR A;  3K69 A;  4HOB A;  1FLI A;  1ODD A;  1LVA A;  1ZG1 A;  3CJN A;  4RAY A;  1MJB A;  2F5D A;  3K9T A;  4NB5 A;  2GAU A;  3JTG A;  2HYF A;  3PFI A;  2HTJ A;  3I53 A;  3S2W A;  4UXN A;  2IA0 A;  3TQN A;  4YFN F;  4ENJ A;  2ELH A;  5HS8 A;  3Q9S A;  3E5Q A;  4PCQ A;  5F6F A;  2Z5U A;  1RUO A;  5EEH A;  2IW5 A;  2ZJ2 A;  2OZU A;  3T1B A;  4FHT A;  4ON0 A;  3V7C A;  1IN4 A;  2GXG A;  2A69 F;  3F6O A;  1U2W A;  4KUM A;  1KU2 A;  4Q4Z F;  1FNN A;  3GFM A;  3RI4 A;  1IRF A;  3GUD A;  2CQK A;  1O7L A;  2H6B A;  2PN6 A;  2HDC A;  1JGS A;  2FF4 A;  2GA2 A;  2YU3 A;  3V8L A;  2FML A;  5BQT A;  5ED4 A;  2QYO A;  2FXA A;  3ROU A;  3KLO A;  1XCV A;  2V9V A;  4ZYE A;  4OIR F;  3ZQ7 A;  3F8N A;  2P8T A;  5DDG A;  5HDG A;  2RQP A;  1K6O A;  5FLX Z;  5E1X A;  3CO6 C;  4ESB A;  5A2Q Z;  4WX9 A;  1PP7 U;  3HYI A;  2IT0 A;  1IXC A;  3WTZ A;  2LNB A;  5H6R A;  4B09 A;  1R36 A;  1WSU A;  4N0B A;  1GHC A;  3K2Z A;  2P5L C;  1CGP A;  2M5W A;  1IN8 A;  1Z91 A;  1JHF A;  4KN4 X;  2KRF A;  4I0A A;  1XD7 A;  2L4A A;  3JW4 A;  2EWN A;  4S04 A;  4A5N A;  5CVV A;  3OOP A;  3GYH X;  1XSV A;  4GCV A;  2V79 A;  5DD8 A;  4QWQ A;  2OD5 A;  2J5O A;  2L4M A;  2PG4 A;  5ERI A;  4UVB A;  1EV7 A;  3K1N A;  3L09 A;  3L7W A;  1P2F A;  3GZ5 A;  1P6R A;  1KU3 A;  3P9I A;  1K7A A;  1YQA A;  3DFG A;  1XGS A;  3FHZ A;  3KFW X;  3KE2 A;  4A6E A;  3B02 A;  2ETH A;  1XDU A;  1OKR A;  1LEB A;  1SFU A;  3N4M A;  3VOD A;  1R58 A;  2MLK A;  1AOY A;  2K02 A;  2CG4 A;  2XRN A;  3ZN0 A;  2KIU A;  1QNT A;  3C1D A;  3V8K A;  4UNO A;  2KIF A;  5KVR A;  3GW2 A;  2XAH A;  4YII A;  2XAJ A;  3K1P A;  2DPU A;  2CSO A;  4XLN F;  3F8F A;  4CYD A;  5LRS A;  3L00 A;  4KDP A;  5CVU A;  2V1U A;  3EYY A;  5LBQ A;  5JI6 A;  3EDP A;  4KMF A;  5IT9 K;  2BE5 F;  1SFE A;  3E5X A;  3N97 A;  4M74 A;  3ISP A;  3V7S A;  3JTH A;  2HQN A;  3EYI A;  2ESN A;  3VOE A;  1K79 A;  3CUQ A;  1B9N A;  3V8J A;  4MNU A;  4G7H F;  5HLH A;  1H9G A;  4Q47 A;  1T38 A;  1BI3 A;  1R22 A;  4LB5 A;  3LA3 A;  3KLN A;  3J81 K;  1K78 B;  2YPR A;  2E1C A;  2D45 A;  1BC7 C;  1ZRC A;  5BS6 A;  3ZMZ A;  3LFK A;  4NHJ A;  1IW7 F;  5LGN A;  2W57 A;  3HTS B;  4KN7 X;  2NNY A;  5FLX K;  2FMY A;  2EV5 A;  2GXB A;  2V1X A;  3I64 A;  2HYG D;  2JZY A;  5ILV A;  4AWX B;  3BZ6 A;  2XHK A;  3F8B A;  2NYX A;  3FMQ A;  3CLO A;  3LQQ A;  3ABT A;  5D6F A;  2P7V B;  2JPC A;  3AAF A;  4CGZ A;  2TDX A;  1RUN A;  5K5O A;  1IN6 A;  3G73 A;  3ZMV A;  1HQC A;  5H6Q A;  1IF1 A;  5HS7 A;  1H9T A;  3RKX A;  4M9X A;  4EJU A;  4LJZ F;  2G7U A;  3TKY A;  1LEA A;  5D5W B;  2IPQ X;  1F1Z A;  2VOP A;  4EJT A;  1Z6R A;  5D5U B;  4CHU A;  3ZPL A;  2K86 A;  2GA1 A;  3MZH A;  1I5Z A;  1RNL A;  3R0A A;  2RVC A;  1YS6 A;  1SAX A;  4I2O A;  1B9M A;  1ZAO A;  3KET A;  2L54 A;  2DT5 A;  4HF1 A;  1D3Y A;  2WV0 A;  1DDN A;  1R7J A;  3BJA A;  1O7F A;  1MJA A;  4PGG A;  4Z2Y A;  2FBH A;  4JQF A;  1V3F A;  2QQA A;  1S6L A;  5AIP A;  1FPQ A;  1MDM B;  3CUQ C;  4IVN A;  1BI0 A;  1YW9 A;  5FD6 A;  3QU3 A;  4MHG A;  3I59 A;  2C6Y A;  1J75 A;  3QP5 A;  1W4M A;  2O6G E;  1O3Q A;  2ZBK A;  1KYZ A;  4EVI A;  4G8X A;  1IUY A;  4L9V A;  2CYY A;  3NQO A;  2YX4 A;  1XSD A;  1I6X A;  1P4A A;  3WTT C;  4LLN A;  1LJ9 A;  2P4W A;  4G94 A;  1SD5 A;  3FM3 A;  2WTE A;  3EQL F;  5E18 F;  2IRF G;  4L9J A;  3IRQ A;  4A0X A;  1TLH B;  2KKO A;  3SHF A;  2H6C A;  3BRO A;  2HGC A;  3RDI A;  4YG2 F;  5AIQ A;  4OIQ F;  2KJB A;  2ZNZ A;  4MEY F;  3WTS C;  2DK5 A;  2IJL A;  5D4S A;  3DP7 A;  4HLY A;  1W5S A;  3KEO A;  4L0Z B;  5CVJ A;  3DQV C;  2QUF A;  1TBX A;  5LEK A;  4M73 A;  4MEX F;  2O03 A;  3H92 A;  4G7Z F;  1QZY A;  1YW7 A;  3DXJ F;  5HLG A;  1F4K A;  1S8N A;  1T6S A;  5DD4 A;  5HVQ C;  2ZME B;  3CDH A;  3TDZ C;  3PQK A;  2GQQ A;  4P96 A;  1XMK A;  2STT A;  4P5O A;  1HXD A;  2R7F A;  3REO A;  2DAO A;  3RPU A;  2VXZ A;  3JAM K;  4HQM A;  2QQB A;  4LFU A;  2STW A;  4GXO A;  1G4D A;  5JFR A;  3WOD F;  1D5V A;  1ON1 A;  2KIM A;  2X4H A;  1FBQ A;  1J59 A;  1J5Y A;  4HX4 A;  4ZH4 F;  3GWZ A;  1TNT A;  3WE2 A;  3R6S A;  5BOX A;  1KA8 A;  2K7L A;  2XAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...