1NK2P

Vnd/nk-2 homeodomain/dna complex, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*GP*TP*GP*TP*CP*AP*AP*GP*TP*GP*GP*CP*TP*GP*T)-3
publication title Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1nk2P00
2XPVA 2IBDA 3NAUA 5F04A 3QPLA 5FJ8J 3D1NI 4XICA 1ETVA 2M2EA 3BQZA 3BR5A 1FIPA 3ZQGA 2EZHA 4J19A 5JLWA 4A93J 1JT6A 3LSGA 3TW7A 2NVTJ 4GFBA 4G12A 1NK2P 2WB1N 1JKQC 4XRSG 1ETOA 2XB5A 3JRCA 1ZR4A 4FE4A 1UMQA 5IYCJ 2DJNA 5IOZA 1WPKA 2E19A 3PM1A 5HODA 3IH2A 3Q3SA 2JA8J 5C4JJ 2R92J 1NK3P 3GBGA 1I6HJ 1H88C 5M5WJ 1LE8A 2LD5A 4D7NA 2TRTA 2JA7J 4MFDA 2ID6A 4NDLA 4DW6A 2NVYJ 2DMUA 1MBEA 1RKWA 1H8AC 3W6VA 3PO3J 3BT9A 3HGGA 4M3FA 1QPIA 2B63J 5F0CA 3OOUA 1UHSA 2DMTA 1MBGA 4D5CA 1G2HA 1TWHJ 3BG9A 2LVSA 3BG3A 4V2GA 3BTJA 4DZPA 4B1RA 3BR3A 5EG0A 2LK2A 1OCTC 1FTTA 2H8RA 1MH4A 2MSYA 1ZK8A 5K7HA 2M0CA 2D5VA 2O8KA 4LOCA 1P7IA 3HBLA 1I50J 4BBSJ 3G1MA 3HEFA 1JJ8C 2FX0A 4RBOA 3A03A 2CQXA 5M3MJ 3B6AA 3S1QJ 4IHVA 5F27A 1SANA 1ZGWA 1UG2A 1BJZA 1IGNA 2VKEA 1WGXA 2IEKA 2LKXA 2HDDA 4A3GJ 2E2HJ 2R5ZA 2DA2A 1WH7A 1B72B 1X2NA 3GTKJ 1GVDA 4RDUA 2CUEA 1U9NA 5FKNA 2DA5A 1F36A 3HDDA 3GTQJ 1BW5A 3M3YJ 4ABZA 4IHWA 3JRHA 2N8GA 3HB9A 2P81A 2M8GX 1AU7A 2JA6J 3RKQA 4BKXA 2HXIA 3CCYA 3B6CA 2X9DA 5F1JA 5C3EJ 2E1OA 4XK4A 3LNQA 2O9LA 3MVPA 2ME0A 2G0EA 2LLKA 2CRGA 3HOYJ 1LE8B 2QF7A 1XG1A 2ECCA 2WAQN 4DYRA 1MSEC 2GLOA 1S7EA 1TWGJ 4C2MJ 5GPCA 4XRMA 3S1NJ 4FCYA 2AHQA 1QVTA 3H3VK 1OJLA 4A3FJ 2CU7A 1PUFB 2Y9ZA 4HNVA 1Y1VJ 1QVUA 1Y1WJ 5JLXA 4Y52J 4M6VA 2K40A 2IAIA 3S2HJ 2JJ7A 4W97A 4BY7J 5EG0B 1HOMA 1X2MA 4I76A 5C44J 2M34A 3BTCA 3JRFA 3S1MJ 5M3FJ 2DA3A 2L7FP 3A01A 2L7ZA 1JKRC 1JUMA 1OFCX 3LSPA 2NS7A 3BG5A 1B8IA 1Z77A 2XSDC 4FISA 3FISA 3RQIA 3A02A 3MN2A 4AC0A 2ECBA 3QPSA 5FKLA 5BNGA 3GTGJ 1WI3A 1MBFA 2XB0X 4XIDA 1VF9A 4JX4A 1ZQ3P 3WHCA 1B72A 2K9NA 2R5ZB 4EEFG 3ZOBA 4A3MJ 2Y31A 4IEJA 2HQ5A 1WCMJ 2ELKA 3S16J 5EYRA 3JRIA 1JT0A 1GDTA 2R93J 3FIWA 2XGDA 4IHXA 1BW6A 2HXOA 4QTRA 5EGOA 9ANTA 3O8GA 1A5JA 4V2FA 3SJMA 4JX6A 4DZJA 2XGCA 5IPAA 4X6AJ 2COBA 2W48A 3C2BA 3ZQLA 4BY1J 3FK6A 5EDNA 2VKVA 2ME6A 1PUFA 1ZR2A 4UUTA 5IYBJ 5E3LA 2YS9A 5DTDA 3I4NJ 3QQAA 1F43A 1APLC 1IDYA 5E3MA 1HF0A 1U78A 3HOXJ 3TP0A 5IOYA 3HOUJ 3HGYA 1GV2A 1AHDP 4A3DJ 1T33A 2MGQA 3GTPJ 3A01B 1B8IB 2E2IJ 4QIWN 1XC5A 5DS9A 5J1YA 1MH3A 2DTZA 1POGA 2HOSA 1IRZA 1YRNA 2FJ1A 3OSFA 1ETXA 1LFUP 2XGEA 1BL0A 1IV6A 3Q0WA 4Y7NJ 3RZDJ 2L9RA 2LR8A 2XPWA 3O8HA 1JGGA 3JR9A 2DMPA 3BR6A 2DMQA 2KT0A 4JYKA 4B3AA 2WV1A 2I10A 3ZQIA 1JUPA 3BQYA 2R5YA 5IYDJ 4W1UA 1MBHA 2ZB9A 1Z0XA 2EZKA 2NVQJ 2JK3A 1O4XA 1W0TA 3S14J 2DA7A 5EGOB 5E3OA 1MNMC 4CYCA 2OPTA 4AUXA 2OF7A 1XS9A 1IJWC 2HYJA 4M3DA 3CMYA 3JRBA 3S1RJ 3HM5A 1FTZA 3WHBA 1NTCA 1FJLA 1IDZA 1TWFJ 2MW8A 2M9HA 1JJ6C 1BA5A 2JMWA 3SFIA 4XRSA 1U8BA 1SFOJ 1P7JA 3S15J 1DU6A 2YU9J 3NARA 1ETKA 1K83J 4BXXJ 2EBIA 2DA1A 1VNDA 5J3LA 3GTLJ 2DA6A 2O7OA 5IP9J 3RZOJ 5K7FA 1MBJA 1Q1VA 4M3GA 5FKKA 1ITYA 3K2AA 2FQ4A 1JTYA 5FLMJ 2TCTA 2NOGA 1X58A 1IC8A 3M4OJ 1OCPA 1WH5A 1YRNB 4A3BJ 3BTLA 5EF6A 3PO2J 3UKGA 5E3NA 4IHYA 2LFBA 4A3LJ 2CQQA 2VUMJ 1IUFA 2CUFA 3LSJA 5J1UA 1GV5A 3ZQHA 5F0HA 5IP6A 3IV5A 1ZTRA 2EH3A 3BR1A 2R5YB 3FK7A 4A3JJ 5F0FA 2PMZN 2X48A 4UUSB 3FKIJ 4DYCA 1HDDC 3LOCA 1JKPC 4CYCB 2AO9A 2CJJA 3Q0UA 1ORKA 1VFCA 1U9OA 2JWTA 2VPRA 5IP7J 4M3EA 3SDGA 2JA5J 1RETA 1JKOC 1ENHA 2RAEA 2K9SA 3OSGA 3HOVJ 3L1PA 5K7ZA 1MSFC 3GTJJ 2HOTA 4D7MA 4JP0A 2MG4A 2E2JJ 5FKOA 3DEWA 3Q0VA 2Y30A 5M5XJ 3TW6A 2L7MP 2NS8A 1H89C 1ETYA 3HKZN 1AKHA 4A69C 3ZQFA 1JUSA 4JX5A 3BR2A 1JTXA 4MIMA 3GTMJ 5C4XJ 3S2DJ 1RR7A 3MKLA 5M5YJ 3ZQCA 2FD5A 1R9TJ 3HOZJ 5EEAA 1GUUA 2EZIA 4S0HB 1RKTA 3F0CA 2DN0A 1QRYA 1RESA 1A6IA 2GBYA 2EQRA 1FIAA 3OIOA 2DA4A 2R0QC 3S17J 3G1OA 3H0GJ 2YUSA 4MFEA 3IH3A 4C3IJ 4UUSA 3GTOJ 3BTIA 4QSHA 3E7LA 1ZKGA 2JN6A 4MO7A 2VI6A 3K7AJ 4FE7A 1TWAJ 1IG7A 1GT0C 2LY9A 2KDZA 4L5EA 4MLOA 3JRAA 1ETWA 2Y9YA 4FTHA 2R7ZJ 3JRGA 4C3HJ 1CQTA 4BBRJ 3TP3A 4D5FA 1LFBA 2EZLA 5GP9A 2XRLA 1HDPA 5J1RA 3VPRA 4C3JJ 2NVXJ 2GM4A 1RPWA 3JREA 1I3QJ 2ID3A 3HOWJ 2QCOA 3DCFA 1AKHB 2HOAA 4I6ZA 2X6OA 2LTPA 2DMNA 1EF4A 3G1LA 1HCRA 1VI0A 1E3OC 3CDLA 1DU0A 2K9QA 2LP0A 3LSRA 4A3EJ 4AYBN 3CQZJ 1TC3C 5F08A 2Y0SN 1T56A 5EZHA 1W0UA 2L0KA 2HI3A 2Y2ZA 1ETQA 4A3KJ 1MBKA 1HLVA 4M3BA 4A3CJ 4DYQA 1D5YA 5EZGA 3IH4A 3I4MJ 2H1KA 4X1EA 1TWCJ 5GPAA 3BR0A 5FKMA 5FLVA 3TEDA 4A3IJ 3JRDA 2XPUA 4B4CA 1FEXA 1K61A
chains in the Genus database with same CATH superfamily
5F04A 3CCEI 4RLFA 3D1NI 3E5QA 1BOBA 3R0JA 3F6OA 4J19A 4E7HA 4AD9A 2K85A 2PMHA 5JLWA 1LFPA 1MKMA 4II2A 3BJ6A 1J0RA 1ETOA 4XRSG 4M74A 3CDIA 4I0BA 5A2QK 2GXAA 4JBAA 5HODA 1SAXA 2E19A 3IH2A 3Q3SA 5LD2C 2X51A 3EUHC 1IN8A 3WG7H 1HW1A 2E60A 5EEGA 1I6HJ 2OD5A 2XAQA 1X1AA 2Z16A 3K4MA 3OR2C 2CSOA 4RS8A 5L3FA 1H88C 4EGZA 4D7NA 1XMAA 3CD6I 4BQOA 2ID6A 4NDLA 1H8AC 3C1DA 3D5RC 4L5IA 5HDNA 3BROA 3HIFA 3ZMVA 5LRRA 1R1UA 4A0XA 2BBYA 3BC8A 5H20A 1MBGA 2LSOA 3ZQQA 2M1BA 2VE8A 1YJWI 3BG3A 4FHTA 3L2WA 4V2GA 3BR3A 3C2HA 5ILSA 3HZJA 1IAWA 2KZGA 5K5RA 3FHZA 2H8WA 4A6DA 2V6CA 1IN7A 2BZTA 3FXUA 2MLKA 3AL0C 1BC7C 1ZK8A 5K7HA 2D5VA 3BZKA 1W1WE 1WZ2A 3WTVC 2PG4A 4LLLA 2VT3A 3E6DA 3KEOA 3OL4A 4BBSJ 1R5HA 1YS6A 2FX0A 3HHGA 2CQXA 3AG3H 3F3XA 1NHAA 3S32A 3GVAA 4BDYA 3MKWB 1L0OC 4UV8A 5AIQA 4LGWA 3WTUC 1BJZA 2P5LC 1IGNA 4XLNF 2VKEA 1WGXA 3DU6A 4Q47A 3IAS2 2HDDA 2G9WA 1USTA 4RA2A 1G3WA 1RNLA 3HOSA 3CMEI 4D9JA 4XLAA 3GTKJ 1GVDA 4RDUA 2WC2A 4IJAA 2HVSA 2OUMA 2VBXA 3HRTA 3R61A 2QQAA 3NWSA 1F36A 2ICWG 3M3YJ 1OCRH 4ABZA 1LVKA 4IHWA 4YFNF 4N4OB 2STTA 1IF1A 1N78A 4HQEA 5KVRA 4KIFA 4BKXA 4OOIA 4OIPF 4PUSA 5B1BH 2E1OA 3LNQA 1FY7A 2O9LA 2DBBA 1PVEA 4UNOA 2G0EA 3PSFA 1XG1A 5JVTA 1FSEA 2ECCA 4E70A 2GLOA 1PYVA 3X2QH 3ROUA 1J9IA 2RNJA 4XRMA 4FCYA 2AHQA 1OJLA 4A3FJ 2CU7A 1PUFB 4XBFA 2Y9ZA 4QPOA 1WJDA 3G3ZA 3K4CA 2Y75A 1B9MA 3H3ZA 3ZMZA 1XGNA 3SQNA 3P9KA 4CYDA 3G6EI 2R7WA 4MQ9F 1AWCA 4KDPA 3L9FA 1X2MA 3KE2A 3BTCA 5C44J 3S1MJ 2EINH 2DA3A 1P92A 1LEAA 1OFCX 2WBMA 2NS7A 2CGPA 3PFYA 3P9CA 3SZGA 1W5CC 4BJ6C 1D0YA 1IXSB 1T38A 3A02A 3MN2A 3RYPA 2VOPA 4CA0A 1SFKA 1J5YA 1N75A 1KZHA 1VQ4I 2RREA 1V55H 2STWA 3CO6C 4YELA 3U9GA 1ZRDA 2IVMA 4U88A 1SVLA 4EEFG 1LDJA 2ZMEB 2KHMA 4DQ2A 1IXRC 1O7FA 1FMWA 4XKWA 1IZ1A 2H6BA 5EYRA 4CH7A 5GAHJ 1D3YA 2FOWA 4L9TA 2IGMA 2R93J 3FIWA 4IHXA 3WGGA 1BW6A 4IVNA 1Z3YA 9ANTA 3I3LA 2EFWA 3ISPA 4JX6A 2ACJA 2XGCA 2JA2A 3CUOA 2KRFA 1JGSA 3C2BA 3ZQLA 5EDNA 3CJTB 3JTHA 3DQVC 1ZR2A 4UUTA 3M8JA 1A6QA 4ZYGA 2JTVA 5E3LA 5DTDA 1D0XA 4PCQA 1F43A 2IS4A 1IDYA 1P2FA 3PNTA 4LD5A 5E3MA 3NWTA 4I09A 3HOXJ 1MMSA 5IOYA 1GHCA 2RVCA 3HTUA 3H5AA 3HOUJ 1MZBA 2E34A 2XAGA 2D45A 3W6KB 2MGQA 2VONA 1ZELA 1R5GA 2EA4A 3L2UA 4XL9A 1HQCA 3LA7A 3KYCB 3DFGA 5TJJA 4N0BA 1HW5A 3QYEA 2P6SA 1VQLI 4HF0A 1YRNA 3DLLF 1YI2I 3VYUB 3BPXA 3J80K 1IV6A 3OR1C 1TW3A 4IKFA 4V19K 1DP3A 2GWRA 4PGHA 2DI3A 4G7ZF 2LR8A 2XPWA 3CJRB 3WE2A 3CLQA 1DPRA 2VIXA 3EQLF 1YIJI 2DT7B 4JYKA 4RGRA 4BGDA 3BDDA 2R5YA 3HC7A 4W1UA 4TV7A 3E6CC 2JK3A 4HX7A 3MZYA 2PBIA 1W0TA 2IRFG 1O3QA 2OPTA 3ZN0A 1BI2A 4BEHB 2LH9A 3FBNB 1XS9A 1IJWC 2HYJA 2VQCA 3PQKA 3F8BA 3S1RJ 3WHBA 1B6AA 1EH7A 2EJRA 4CXFA 2RC4A 3OYBA 2HPMA 2V79A 3S2WA 1JJ6C 5E8IA 2JMWA 3RYRA 3SFIA 4A0ZA 1SFOJ 2V9VA 1DU6A 3L7WA 3H0DA 1ETKA 3IKTA 4F92B 3NEUA 2F5CA 4RLQA 5AIPA 1YJNI 4HLYA 1E0EA 1XGOA 3MZHA 1XTAA 2DA6A 1SFXA 2BW3B 2J5OA 3GEZA 5HS8A 1WJCA 3DKYA 2IW5A 3PUFA 1WVRA 1D0ZA 3FXRA 1SMYF 2HTJA 1QO0D 4EJWA 3LSHA 2L4AA 2FQ4A 3K4KA 1ZG1A 1QHHD 1YHQI 3WODF 1FYLA 1FOYA 1TTYA 2EK5A 2F5FA 4UB8C 2ZFUA 3E1SA 1IC8A 2IS1A 3ML6A 1D5VA 2HWVA 4IXAA 1XGSA 4DBQA 4IRGA 4LK0F 3FM5A 3BP8A 1UAAA 5LBQA 4IHYA 4QPQA 4A3LJ 1Z6RA 2ZXIA 3CF5F 2CUFA 2XHKA 3ESWB 5J1UA 3EUHA 2L9VA 3ERED 2DK8A 1H9GA 1TBXA 5IP6A 4IX7A 2NRAC 2XAUA 2NS0A 3GYHX 1ZHFA 1OCZH 1F1ZA 2KIQA 1MD0A 4PJJA 5F0FA 3U21A 2PMZN 4WWCA 3L2CA 2DFFA 3FKIJ 4KMFA 1STZA 1HDDC 3LOCA 4I7HA 4ASNA 2DYRH 2XC7A 3DTIA 4M3EA 1BI1A 3SDGA 2IS2A 4RB3C 2JA5J 2V4JC 2BE5F 2F4OB 1JKOC 2LBFB 4BUPA 3OSGA 3HOVJ 2YX7A 2A6HF 4F52A 2BVLA 1BOAA 2HOTA 3FXLA 3I4PA 4WXCA 3K2ZA 5FKOA 4ESBA 2X1EA 2Y30A 2DK5A 2NAZA 2NS8A 4ESFA 3QRFF 1LQ1A 1YYVA 1UJ8A 1OYWA 2AS5F 3K6GA 2R7TA 3OYEA 4OIOF 3ZMSA 2W7NA 2X0LA 2VE9A 4O5VA 5DCMA 2CO5A 5C4XJ 1UCRA 2JSPA 1XN7A 3HPHA 3S2DJ 3OS1A 2O0YA 3ABKH 3ZQCA 2FD5A 2E7XA 1R9TJ 1D1AA 2QLZA 5FFXA 2CV2A 4CCJA 4YG2F 3DPUA 3H3UA 3HYIA 4AU7A 4UHTA 2EZIA 1ULYA 1RKTA 2AQEA 2X6WA 1J7KA 3SHFA 2ZKZA 2GBYA 1BBYA 2RNGA 2HYGD 4D0PA 3OIOA 1I5ZA 2DA4A 2R0QC 4ZTFA 2GOXB 1HA8A 3H0GJ 4BAYA 4IQJA 3IWFA 3BY6A 1JXSA 3IH3A 4UUSA 4AM3A 1P6RA 2L54A 3VWBA 2HOEA 1ZKGA 2GIZA 4U0YA 3H5NA 3J7AY 5DUKA 3JTGA 4FE7A 1U5TC 2HDWA 2K86A 3CUQC 1SVMA 1FPQA 3TDZC 4A5MA 4RAYA 5FGMA 1S8NA 3FMSA 5D4SA 4GCVA 3DF8A 1U0JA 1WQ2A 2HGCA 3KLOA 4C3HJ 3FXMA 5D5WB 1K4SA 1LFBA 4ZH4F 4ON0A 4DGWB 1P4AA 1W7PB 2WA0A 1HDPA 2E1MB 2LREA 3DPTA 5J1RA 3NQOA 3BOQA 4I02A 3MEXA 3JREA 1I3QJ 2QBYB 3WU1B 3HOWJ 4I2OA 3DCFA 1AKHB 3V7SA 3GXOA 2MH9A 3KYLA 2KISA 2QZ8A 4E7JA 2W84A 2RQQA 1E3OC 1DU0A 2E1NA 3LSRA 2Z9OA 1XD7A 3CQZJ 3AG4H 5GADJ 3VYSB 2HI3A 5DD8A 1FMVA 2EB7A 1I39A 4A3KJ 1VQMI 2RV8A 3EUAA 3VEPA 1MMNA 3CCRI 1YW7A 1PDNC 1S3JA 3OYLA 1S5LC 4X1EA 3VOEA 4XNFA 4ENMA 1JHHA 1TWCJ 2OC6A 5GPAA 1TLHB 5FKMA 2CQ7A 2QQBA 3J7YJ 4HSTA 5ERIA 3JRDA 4RGXA 4B4CA 2WWYA 5KAFC 1ON1A 2Z3YA 2XPVA 3AG2H 1FBSA 2VLAA 4S04A 1CF7B 1FIPA 3CJNA 4XLFA 4XSZF 2EZHA 3GLXA 3ZQGA 5HDGA 2QA4I 2FEZA 2M0MA 3FZVA 3PSIA 3TW7A 3S93A 1NK2P 2WB1N 3JRCA 1ZR4A 4FE4A 1UMQA 5IYCJ 4G6QA 5IOZA 1WPKA 2R92J 4OWRB 1X1CA 4BQAA 2JSCA 2AQFA 1OLTA 2LD5A 4E6KG 2X1CA 2JA7J 4MFDA 2MA3A 4U87A 1A36A 1MBEA 1RKWA 4P9FA 2IA2A 2K4BA 2M4KA 3HGGA 3I0TA 2QQ9A 2B63J 5F0CA 3OOUA 1UHSA 2V6EA 5D6EA 1G2HA 1TWHJ 3TMOA 3DWLE 3BTJA 1I27A 3GW2A 2W00A 4HQMA 2V9KA 1YTYA 4A5NA 5FLXZ 5EG0A 2LK2A 3OY9A 1MH4A 1WKMA 2B7EA 2EFQA 5J47A 4UY8I 3W2WA 3LMMA 3QPTA 1SD6A 2OA4A 3A0BC 5E1WA 2BY1A 4LOCA 1P7IA 2CS3A 2P5VA 3CESA 3FMQA 1I50J 3HBLA 4WXHA 1VQPI 2P6TA 2EIJH 3VYRB 5E79C 2FU4A 1RUOA 2DTRA 2VC1A 1SANA 3EPZA 2W25A 1ZGWA 2W57A 3KP2A 5LEJA 2IEKA 2VL8A 2LKXA 2E2HJ 2R5ZA 3FHNA 1WJEA 1WH7A 1ZGAA 1AOYA 3ZMTA 1X2NA 3F8MA 2CUEA 2FUG2 1UHWA 1U9NA 3O6BB 5D8KB 2FBKA 3GFIA 4ZDOA 1S9HA 2DFIA 1MMGA 3GTQJ 2OQRA 3B02A 4G6TB 1O7LA 5CQEA 1BW5A 5DEQA 4PSXA 2ISZA 3G73A 3HB9A 2P81A 2Y0SA 2FQ3A 3P7NA 1UG0A 2M8GX 2JA6J 2ZFWA 1R22A 1TW2A 1RZ4A 2FOKA 5C3EJ 3MKZA 4LLNA 2ME0A 2CW0F 1LE8B 3E6BA 2E7WA 3LQRA 1ZN2A 3MKYB 3LFUA 5E17F 2XASA 1ZRCA 2VXDA 4C2MJ 3RCOA 2CYYA 5GPCA 4XLPF 3COAC 1I3AA 3E0JB 4HG2A 4ZDLA 3PJRA 3BCAA 1S7OA 3BLYA 1Y1VJ 4UVCA 3P9IA 3TO9A 2LDUA 2JZYA 4M6VA 2KDOA 1BIAA 2WY7Q 3I59A 1UZCA 3JRFA 1EH8A 3GF2A 4LK1F 4PFOA 4I98B 3HOTA 3A01A 2L7ZA 2A6EF 3LSPA 4C2UA 2KIMA 3R6SA 1V5FA 1Z77A 2DXIA 2XSDC 3TBIA 1W5SA 3K4JA 3CMMA 2O3FA 1ODDA 2CH0A 2P0WA 4AC0A 2A68F 5BNGA 4CO8A 1G59A 2ETHA 2ZBKA 4CCNA 1I6XA 2Q1ZB 4Q4ZF 4PFPA 3VSLA 2K4JA 3MWMA 1Z7UA 1K78A 2AXTC 2P8TA 4I01A 3HHHA 3IRRA 5EEHA 1ZARA 2BYVE 2Y48A 1P9QC 4K2EA 2JPCA 3E6MA 4A3MJ 3OYHA 1MDMA 4EJVA 2LRDA 4KMUX 3DKXA 2CV0A 3PIOF 2YR2A 2MD5A 2ELJA 1IUYA 4LFUA 4HOBA 3MMYB 1K61A 3FX3A 3NRVA 3SJMA 3GFLA 3E3VA 1YFHA 5DD4A 1LEBA 3O3KA 4X6AJ 3GZNB 3PNYA 2COBA 1ZLKA 4BY1J 4LG3A 2ADUA 1FX7A 4UUVA 3R60A 1IRFA 1E3HA 2VKVA 2E5NA 1NG6A 2DOEA 2HTSA 3PNVA 3I4NJ 3K10A 3IHUA 2IGNA 1YO5C 1APLC 1K4TA 4LITA 1R71A 1HF0A 3J7AO 2K9MA 2MYSA 3SZTA 1BIBA 1IXCA 1NG7A 2H6CA 3DLAA 2YU3A 3HGYA 3ZR8X 4A3DJ 2PMUA 1T33A 3TDUC 3OYKA 1R1TA 1B8IB 4PZJA 3WTZA 1FYKA 3QP6A 1FNNA 4FT8A 4IHSA 3OOPA 1M1EB 2DTZA 3JAMK 3JSOA 2R7XA 1WSUA 1Z91A 3OIPA 3H36A 2HDCA 2HOSA 1U5TA 1ETXA 4ENJA 3CUQA 1VQKI 3Q0WA 2L9RA 3JR9A 2F4MB 1FBUA 5FLXK 1YITI 3I5UA 3LQQA 3DBRB 3ZQIA 1W36D 3BQYA 2L3DA 2FRHA 2CQNA 5DDGA 3DEUA 1WJAA 1HSTA 2ZB9A 3VSKA 2XAJA 1Z0XA 3VODA 1OMIA 1O4XA 5JR3A 4B48A 5EGOB 3QPHA 3LWFA 5D6FA 4CYCA 1XGMA 2UXNA 1MNEA 3CCVI 2XSJC 4LJZF 3FXJA 4ZYAA 1BR2A 2OJED 1H0MA 2GXBA 1Z67A 3JRBA 5GAGJ 4HBLA 4ZC3A 1FOXA 5KCMA 4DNCA 5ICGA 1FTZA 3QU3A 1TWFJ 2QSFX 3KLNA 1TP4A 2MW8A 4MEYF 2PJPA 3GFJA 3AL0B 5IT9Z 5F6FA 1U8BA 4IOAF 4HAMA 1RIOH 4XKCA 2KRCA 4YIRX 2YU9J 3M7GA 4BU2A 4M71A 2EBIA 2DA1A 1VNDA 2DFHA 1YE9A 2V1XA 5J3LA 4BQQA 1OYYA 1Z05A 1VQ7I 4ENKA 3SXYA 2PQ8A 3BWGA 4KICA 5FD5A 1Q1VA 3QODA 1QA6A 5DCMB 3MCZA 4RB0A 3S3MA 3ONQA 1RI7A 3CP2A 2EFPA 1JTYA 2W1OA 4FETA 2NOGA 2R7RA 1X3ZB 2RQPA 1X58A 3DP7A 4RB2C 1WH5A 2KL4A 3IC7A 2CV1A 3BTLA 2ZJPF 5EF6A 2VJ5A 3UKGA 3H1CA 1OCCH 2QKMB 2ZNZA 1P4WA 4PSWA 3KX2A 4KIBA 1IUFA 3RKYA 5HOOA 1QU3A 3LSJA 3TOBA 5KNLA 3ABUA 3OL3A 3MD2A 3IV5A 2JUGA 1ZTRA 1LB2A 2RKHA 4C2TA 1VQ6I 4Q48A 5K1YA 5L3BA 3FK7A 3UR3C 3QYBA 3CCLI 3K69A 3ZP5A 3MQ0A 4UUSB 2V1DA 1MJ9A 2CMPA 4OU0A 3HUGA 2YPRA 2TDXA 1WI9A 2CJJA 2JWTA 2VPRA 5IP7J 5CQGA 2UXXA 1U8RA 1YOVB 3ELKA 4E7LA 2K9SA 1YW9A 5CYVA 3QOPA 4LIUA 3F6VA 2XF6A 5BS6A 1CGPA 1F4KA 1MSFC 1KONA 1FP2A 4D7MA 3DEWA 3K4LA 5M5XJ 3GZ5A 2D1VA 2QSGX 5ICEA 3CC7I 2L7MP 2V7FA 2CQKA 1H89C 2H27A 1EV7A 2XVCA 3HKZN 1J59A 2V26A 4FX0A 1KQ9A 2LKSA 1TQPA 3H92A 4S05A 2CG4A 3CCQI 4G7OF 3OS0A 2H09A 3R4KA 3BR2A 4JX5A 5CVVA 1UELB 4Y17A 2IA0A 6PAXA 4WK8F 1Z6TA 3LA3A 3C2GA 1ZAOA 3FWEA 3DBHB 1Y39A 3DTEA 3IUOA 3ZN1A 3PL8A 1SFUA 3RPQA 4L0YB 1KGSA 5GTIC 2OAZA 5FFZA 5LHGA 3F0CA 2BY3A 2DN0A 4E7KA 3H9GA 4F7ZA 2EQRA 3HJEA 2L9SA 1MJAA 2GAUA 1JI8A 3G1OA 1XDUA 3BG7A 5TRDA 4MFEA 1VQ8I 4OAZA 1Z1DA 4BE0A 2BVMA 4C3IJ 3ZMDA 3GTOJ 4OMZA 2KRHA 3RQ4A 2W24A 2PEXA 2A3SA 5J8FA 2JN6A 1R1VA 4MO7A 4OINF 5D4RA 4H0EA 3HSRA 2VB6A 3N05A 3KZYA 1FZPB 4L5EA 4MLOA 3JRAA 1G4DA 1JHFA 5E20A 2R7ZJ 2HKXA 3OYIA 3L2QA 1CQTA 1W4MA 3I55I 5GP9A 1MGTA 1BM9A 3FXQA 3W2VA 5HLTA 3RIRA 2MH2A 4PJLA 2E5ZA 5L3GA 5BPIA 2HR3A 1SVOA 1MMDA 5KK1A 2GM4A 1RPWA 2A5YB 4ZYHA 2ID3A 2A05A 1BR4A 3FXKA 4I6ZA 3D5SC 3ZRGA 3OYMA 1VI0A 1HC8A 1Z21A 2E1CA 2PJRB 2DCEA 1YJ9I 2LP0A 5B5EC 4AYBN 1T08B 2MFZA 4P5OA 5F08A 2PMZA 2FE3A 4YRVA 2MD0A 4OIRF 2Y2ZA 5LLQA 1B4AA 2K7LA 2VKHA 2EWNA 2QKLB 2C6YA 2FBIA 4DYQA 2OTLI 2QQ8A 1Q1HA 3BR0A 3H5RA 2K5CA 5FLVA 4XLCA 2FNAA 3TEDA 3WGHA 2XPUA 3KEQA 1ZG3A 2IPQX 1OR7C 2JPBA 1XMKA 3SYTA 3A2KA 3WTSC 3NAUA 1BJAA 2ZJ2A 5CLSA 3OYFA 3SFZA 2KJBA 4BXUA 2WTEA 3KZIC 2HFHA 2KZVA 4RM3A 4NNJA 2Z1DA 1S7AA 2NVTJ 1K79A 4GFBA 4CZZA 1K6OA 1JKQC 4RMNA 2DJNA 2OU2A 3I9V2 3PM1A 4AIKA 2NOJB 2DU9A 2L7KA 5C4JJ 1NK3P 3CO7C 5IT3A 4A2UA 2JVHA 4G8XA 3QP5A 1EH6A 2M45A 3TO6A 1LJ9A 1I1GA 2LMDA 2TRTA 3ULQB 3F72A 4DW6A 1N25A 1DGWY 3BJAA 4RAFA 3BT9A 2FF4A 4XLHA 2ZXJA 3D0SA 2BXZA 3H35A 2VPLA 1J2XA 3L2VA 3OYGA 2VJ4A 4L0ZB 3BG9A 4Y33A 1E17A 1TL8A 4B1RA 3RKWA 2KIUA 2F6CA 2GQQA 2CUZA 2H8RA 2OQGA 1ONVA 2MSYA 2IGKA 5FROA 2M0CA 2O8KA 3KZZA 3V4GA 4ZYDA 3J81Z 1V5EA 2XAFA 4XM3A 2Z99A 2LF7A 2R7FA 2VBWA 4HNUA 1GVJA 4KNYA 1REPC 1D1BA 1FT9A 1MMAA 3G2BA 4RBOA 3A03A 5M3MJ 4J01A 3S1QJ 4IHVA 4HX8A 4M72A 4MTEA 2QGUA 4CCKA 2Q2EA 5ICFA 2ZMEA 2OTJI 5H6QA 3BCBA 1HKSA 2V9PA 3ECHA 4NBQA 2BHZA 1MDMB 4N9HA 2IJLA 4C30A 2DA5A 3TQNA 3HDDA 4L9NA 4L18B 1LDDA 2RGVA 3IRQA 1KYZA 2N8GA 1D8KA 1X1DA 3TKYA 3RKQA 1AU7A 1W36C 2COMA 2DJIA 2X9DA 5F1JA 2IXSA 4XK4A 3MVPA 1BI0A 2LLKA 3A4CA 3HOYJ 1Y0UA 2ZJRF 4XKVA 4RGUA 3K0LA 4EM2A 3IL2A 2WAQN 1DDNA 2QENA 3TO7A 2EA2A 1FSHA 3IWZA 4IF4A 1J75A 2DO7A 2WV0A 1IRGA 1KYWA 1IRXA 2Q8KA 5DM7F 4HZFA 3OYJA 1IN5A 5DV5A 3ZGKA 2NYXA 5F64A 1Y1WJ 4Y52J 1LUJB 1QNTA 3GFMA 2XGXA 2FBHA 2VXZA 3N97A 4W97A 4BY7J 2JVGA 2D1HA 3I71A 4YEJA 2F5DA 2O61A 4BJ5C 5M3FJ 4HF2A 1JKRC 4XLEA 3BG5A 3T8RA 2WB1A 2VQHA 3T1BA 5LRSA 2ZSIB 4M6XA 3K1PA 3WTTC 3DBLB 5IY5H 4KT5C 3T8TA 4LLGF 2ECBA 5FKLA 4P55A 1LDKB 1WI3A 1ZYRF 2Z33A 2R7UA 1MBFA 4BHBA 1R7JA 1VF9A 1XCVA 2X4HA 3AG1H 4JX4A 4BJTA 1YX3A 2FMLA 4CSWA 1U5TB 3GLLA 5A2QZ 3CUQB 1B72A 2K9NA 2PFBA 3FKJA 2XV4S 2Y31A 1R6RA 1XSXA 4IEJA 5J8CA 1T2KA 5HLIA 4BNCA 2BHYA 1WCMJ 2Y0MA 3I58A 3HPGA 3WTYC 2WAFA 2VODA 1JT0A 4Z2YA 1GDTA 5CVUA 5LGNA 1T0FC 3QAHA 3OIQA 1S6LA 1B1BA 1XSDA 3VYTB 5DYMA 4QTRA 5L3EA 1RC9A 4A12A 3ZMUA 4BEHA 4M9SA 3S3OA 4DZJA 1O3RA 3KYDB 5IPAA 3KETA 4OMYA 1QHGA 2UWMA 5FB2A 2W48A 3CCMI 4U0WA 2P7CB 4KITB 2M3AA 2P7VB 3VDXA 2LC2A 2PLYA 3VFZA 2Z5UA 3F23A 5GAEJ 4C9YA 3RTRA 5IYBJ 4XOTA 3QOEA 4HA8A 2YS9A 4CZCA 1YIOA 3QYFA 1XCBA 2LY2A 3QQAA 3TL4X 2M4GA 2K3FA 1U78A 3CJQB 5BPDA 3BG6A 2XF7A 2R7QA 2XRNA 4XORA 3WTXC 4HDVA 4HV6A 1NH3A 4BE2A 3I53A 2BW3A 1D1CA 5JFRA 2LG4A 2HQRA 4NQWA 1XB4A 3D5LA 4QIWN 2VC0A 2IA1A 5DS9A 2DOAA 5J1YA 1VZ0A 1VQ5I 4R79A 3PFIA 3HRMA 1MH3A 3E5XA 2I5UA 4KN4X 5CKTA 1POGA 2H94A 2KQRA 2FJ1A 5JVGF 3OSFA 2B0LA 1LFUP 2XGEA 5CPRB 1R49A 4UB6C 4UVBA 2OV7A 5E1ZB 3RZDJ 3IAM2 4EV0A 4NC8A 3O8HA 1JGGA 2DMPA 4E7SA 3KP6A 5BMZA 4BH9A 2JUCA 1FOKA 2DMQA 2KT0A 2CW8A 1ZH5A 1MBHA 3BPVA 4AIJA 2KLOA 2MC3A 2XAHA 2NVQJ 4ESJA 3LA2A 5E3OA 1MNMC 4CICA 4KISA 4AWXB 1TT5B 3HUGB 4IPAA 3GX4X 2GXGA 5CVRA 3L09A 1SD4A 4HW0A 3HM5A 3KP3A 1QBJA 2EILH 1JE8A 1FJLA 4JQFA 2LBFA 3O2PE 3E5UA 3M07A 3PIPF 3OWTA 2M9HA 4DJAA 1BA5A 4XRSA 3N4MA 3QU6A 4F93B 2KMUA 3S15J 1K6YA 3A1YA 2X85A 3NARA 5ILVA 1ZG5A 4BXXJ 2DOFA 2QM3A 4AIDA 3GTLJ 4Y15A 4AVPA 1Z7LA 4MQVA 3HRSA 4F91B 3CTAA 1U2WA 2O7OA 1GXQA 1OR7A 4H4KC 4M3GA 3W6JB 4E4HA 4G7HF 5JHUA 5L3DA 2QSHX 2TCTA 4ITVA 4AVZA 1C0WA 2NNYA 2D2WA 4L5JA 1WJ5A 5TGTA 3M4OJ 1OCPA 1YRNB 2Y69H 4I0AA 4FQGA 3K70D 4IOCF 2F2EA 3H9JA 3PO2J 4MEXF 4KUMA 1OPCA 2CFXA 4ZZLA 4RM2A 2VUMJ 1QPMA 3REOA 3ZQHA 5F0HA 4IO9F 1XMXA 2X1DA 4PDKA 1BR1A 4PJ0C 3F21A 2CFOA 3OYNA 3CCSI 4IRHA 4LMYA 1HSJA 2R5YB 1OKRA 3M8FA 2LKPA 2L02A 3HTSB 1USSA 2HKOA 4O3MA 3S3NA 4BHCA 2AO9A 2HU9A 4RB1A 1YX5A 3ECOA 3Q0UA 1VFCA 1U9OA 4LIVA 4BE1A 3DV8A 1KA8A 1RETA 2MLGA 2ZC2A 1V54H 1KU7A 1LPQA 5E8GA 4ENNA 1DPUA 4G6DA 5K7ZA 3WGIA 2B9SA 2BEOA 1W7PA 4Y3OA 4UXNA 2MG4A 1YLFA 2E2JJ 1W7PD 3Q0VA 4E7IA 4XN0A 3TW6A 2QBYA 5HDKA 3MFKA 1AKHA 2AXLA 5B66C 1HKTA 4Y4RA 1PJRA 3JSPA 2R7VA 1SD5A 3SEQA 3J80Z 3RJPA 3GCMA 4BYYA 1ERDA 5M5YJ 5EEAA 2IT0A 1PUEE 1GUUA 1Y56A 3L00A 4S0HB 1K7AA 3K4NA 3W2AA 4PK4A 3WU0A 1QZYA 5J4VA 5JHFA 1B59A 1QRYA 1RESA 4EJUA 1A6IA 4IRIA 2OZ6A 5CVJA 4OAYA 2NVUB 5FD6A 4KT6A 2L5QA 3CP8A 1Z3XA 1R00A 2K9LA 4XRFA 2QEXI 4DOZA 4PJNA 2HZDA 1XDSA 1MJBA 1CF7A 4Y13A 1HKQA 4QSHA 3K1MA 1WWXA 3E7LA 4XMYA 1TT0A 1EJ9A 4KIGA 4KA4A 1S72I 2XDVA 2KPMA 4WXDA 3FMRA 2EV0A 3K7AJ 5ICCA 1A31A 2M7BA 1TWAJ 5LHIA 5ED4A 1IG7A 2LY1A 4BHPA 1N77A 1TQMA 2ZMEC 5JI6A 5HLHA 2G7HA 2KFDA 2R4GA 4FTHA 3JRGA 3OYDA 2BY2A 3EETA 2BXYA 1TQIA 1UB9A 2W4SA 3VPRA 2R3SA 4C3JJ 2X6XA 2NVXJ 2YSRA 1OCOH 2M5WA 2QCOA 2HOAA 1LNWA 2ZNYA 1HBXG 2LTPA 3LSKA 2DMNA 1HCRA 2FSWA 2L2OA 3I56I 1KU2A 4F55A 1IO2A 3KIOA 3RSNA 2K9QA 4HPQA 4A3EJ 1ON2A 1WRJA 2HS5A 3L2RA 2A5WA 5K5QA 2VN2A 5EZHA 5J40A 1W0UA 2L0KA 2QUFA 3CZ6A 2G7UA 1U6GA 3HSFA 1HXDA 1MBKA 1W5TA 4B43A 1VQOI 2M8EA 3V8KA 3WTWC 5CJ9A 2VBYA 3G4SI 1T0FA 4MNUA 4A3CJ 5EZGA 3IH4A 4II3A 2H1KA 3EUKL 2R7SA 4NUBA 3QWLA 1V3FA 2GIVA 4CCOA 4A3IJ 4N9IA 1FEXA 3F8NA 2CW7A 4PGGA 2IBDA 3LAJA 3BZ6A 2GA2A 2A07F 3QPLA 1T6SA 5FJ8J 2Q2EB 4XICA 1ETVA 2M2EA 3BQZA 4X0GA 3BR5A 3HKZA 4L9JA 1D8JA 2OZUA 5AONA 4A93J 1ZREA 1ZGJA 1JT6A 1KU3A 3LSGA 3U1DA 3Q5FA 4G12A 5GTHC 1DQUA 2XB5A 1A35A 2NNNA 2EV5A 3HL2A 4I99C 4BACA 3DXJF 3OYAA 2JA8J 1RR8C 2ESNA 2WY8Q 5DCFA 5F1RA 1R4NB 3GBGA 3T5XA 4NHJA 2MBFA 4LG0A 3SZPA 1VQNI 1O57A 2XUBA 5M5WJ 1LE8A 1R58A 4Z6YA 4NC6A 4YIFA 4F3QA 2NVYJ 2DMUA 5K5OA 3W6VA 4P1WA 3PO3J 4CHUA 1SFEA 4M3FA 1QPIA 3OMYA 2DPUA 3LFKA 2I8DA 2VASA 4MTDA 2DMTA 4D5CA 2UUZA 4JK1X 2LVSA 4XR6A 3ZXSA 4DZPA 1EA3A 4HNTA 2DODA 4BL0B 3JW4A 2EIMH 4RAZA 4LB6B 4KFCA 1OCTC 1FTTA 1ACIA 1X1PA 2JT1A 1YG2A 2Q0OA 1R23A 1P4XA 3G1MA 4D1QA 3HEFA 1JJ8C 4GYIA 4IL6C 1X3UA 3B6AA 4LB5A 5F27A 1XPXA 2DQLA 4M6YA 2K3PA 4U7BA 1UG2A 1O3SA 1QQIA 4A3GJ 2HEOA 2DA2A 2ELHA 4YFKF 1B72B 4CDGA 1I1SA 1ZLJA 5FRMA 3EDPA 3P5JA 1FYMA 4DIQA 5FKNA 1PP7U 4FASD 3T0YA 1S29A 4CGZA 4WF2A 2BV6A 1DGRM 2XIGA 5HVQC 2M30A 3JRHA 4AYBA 3OS2A 2PN6A 4XOPA 4OIQF 2NXNB 1FOWA 2A69F 5TISC 1U3EM 1BN5A 2GA1A 5B1AH 3FXOA 2HXIA 3CCYA 3B6CA 2DPDA 1X19A 3DTKA 2HZTA 2O8XA 2CRGA 2CWEA 2DDBA 2QF7A 5LEKA 1ZRFA 4DYRA 4AIHA 2UV1A 1MSEC 4BS9A 1S7EA 1TWGJ 4P96A 3S1NJ 1GXPA 1QVTA 2DAOA 4RGSA 3H3VK 4HNVA 2XKPA 1G6NA 1QVUA 5JLXA 3DPLC 2K40A 3LSTA 2IAIA 3S2HJ 2JJ7A 5HNHA 5EG0B 2VT2A 1HOMA 4I76A 2M34A 1TNSA 2L7FP 4BQNA 1JUMA 4M9XA 1B8IA 5IT9K 2V1NA 4G94A 2L01A 4KJZA 2GOMA 3M1CA 4NQWB 4FISA 1G3TA 3FISA 3RQIA 1E3PA 2VJJA 1A04A 4KYWA 2M87A 3Q9VA 3PUBA 3QPSA 3GTGJ 5B3SH 1BC8C 2XB0X 4U0VA 3CDHA 2HPIA 3IP4B 4XIDA 3I54A 3MAJA 1X3WB 3CLOA 1ZQ3P 1G8XA 3OYCA 3WHCA 2R5ZB 4ETSA 4YFXF 3ZOBA 2RDPA 4UVAA 5DUIA 5BOXA 1SMTA 2YX4A 3F22A 2HQ5A 1L3LA 3CMAI 3F9KA 2ESHA 3K70C 3AFHA 2ELKA 3S16J 3JRIA 4GDFA 2FNPA 5BQTA 4IQ4A 2E71A 3B73A 2V1UA 2HNHA 2XGDA 2HXOA 4MGRA 4B44A 3HXLA 2P4WA 5E18F 5EGOA 3O8GA 1A5JA 1PP8F 4V2FA 1H9TA 3KP4A 4G9YA 1IV8A 2DLLA 2J5PA 4Q5SF 2DFEA 4QWQA 3IKVA 2DYSH 3GWZA 3MZ8A 3LSMA 1TNTA 1VQ9I 2HYFA 3FK6A 1FP1D 3M8EA 2X6YA 1UFMA 2OCEA 2ME6A 1PUFA 2ZJQF 2KIFA 3BZCA 4B8XA 2EV6A 2EFOA 1WJBA 4EVIA 4NC7A 3FBIB 3C18A 3HRUA 3KCCA 3WG9A 4ZYEA 3TP0A 4GYGA 4EM0B 1SAUA 3I59B 1GV2A 2WADA 1AHDP 4HYEA 3SDBA 4ZJZA 3GTPJ 1SC7A 3V7RA 1IW7F 3A01B 1Y8RB 2E1MC 4ZDPA 2E2IJ 1XC5A 1YQAA 2CUJA 2DDAA 4XQFA 2ZXHA 3HG9A 2H1LA 2JRTA 1T98A 3ASOH 3BJOA 5FO5A 3V8LA 3ZCOA 3G71I 4IHTA 4HEA2 2FA5A 2VKDA 1IRZA 1YW8A 4BDZA 3ASNH 5HNFA 1R5ID 5HS9A 1BL0A 2K02A 1K78B 2QYOA 4Y7NJ 4EATA 1IN4A 2WAQA 3FDYA 5LGTA 3H9QA 2ZSHB 5ILUA 4U7DA 3EYIA 3C7JA 5DM6F 5D5UB 2O03A 3OV8A 3BR6A 4B3AA 1GLNA 2I10A 2WV1A 1JUPA 3K1NA 5IYDJ 3ZPLA 3RDIA 4YIIA 3ABTA 1OQYA 2EZKA 1WHUA 4HSRA 1KQ0A 2DA7A 3S14J 1RRJA 1O3TA 2W85A 4AUXA 2OF7A 3WU2C 1EKEA 4M3DA 5CVIA 3CMYA 4RAGA 3UNGC 1G3YA 1LKXA 2DT5A 4WCGA 4HX4A 1NTCA 4CCMA 1IDZA 2P5KA 1TZLA 3A0HC 1Y6IA 3KP7A 4A0YA 4B09A 5H2FC 5LHHA 4A6EA 3M1EA 2HQNA 1QZEA 2BOLA 2VBZA 4XONA 1P7JA 5L3CA 3K9TA 1J09A 2JQ7A 2VOOA 1K83J 1E2XA 2LOOA 2OBPA 3LL7A 4EGYA 5H6RA 4R8HA 1RUNA 2MABA 1KU9A 3SEZA 2MC4A 5IP9J 5K7FA 3RZOJ 3ABMH 4XSXF 5LGUA 1MBJA 4UV9A 3FF5A 5FKKA 1ITYA 1WFXA 2R7DA 4L9VA 3K2AA 3TOAA 3DKWA 1SD7A 2FMYA 5FLMJ 2IGOA 3K4BA 3CF2A 1R4MB 1DP7P 1UHMA 2Z2SB 4M73A 3CC4I 4A3BJ 2F48A 3Q9SA 3GUDA 1Y8QB 2PI0A 4DBRA 5E3NA 4QLCU 2LFBA 3V8JA 1QGPA 2CQQA 3RPUA 4PJMA 2IS6A 5J4YA 4EM1A 1GV5A 3RPUD 3VB2A 5D5XB 5HS7A 2ZO4A 2EH3A 3BR1A 2O6GE 1FBQA 1XSVA 5HLGA 4A3JJ 3WE3A 2O5RA 2X48A 3TGNA 1BI3A 4DYCA 4EQQA 3HSEA 3S8PA 4IZZA 1R36A 4GO1A 1JKPC 2HQAA 4CYCB 1LVAA 4ZTJA 1X1BA 2IP2A 2VJIA 2ZXWH 1ORKA 1HW2A 3E97A 4WX9A 2QWWA 1FLIA 5KHDA 2DW4A 1ENHA 2RAEA 3AAFA 1X4PA 3ERMA 2VQLA 3L1PA 3LSIA 3GTJJ 2KP6A 2QVOA 4P9UA 4JP0A 4EJOA 1XX5A 2LYCA 3GO5A 1Y0NA 4MHGA 1OISA 2UZKA 1ETYA 2PX9A 2HVRA 4GXOA 3W3CA 3JAMZ 4FX4A 4A69C 3F8CA 3ZQFA 4HDUA 1JUSA 2KKOA 1F5TA 4N4NB 2ISYA 3JCUC 2F5VA 1JTXA 4MIMA 3GTMJ 2PJRA 4NB5A 2HVQA 3DEEA 2BGCA 5J6XA 1F9NA 3U2RA 3RKXA 4GGGA 1RR7A 3R0AA 2RN7A 3MKLA 1T39A 5EJCA 2DQRA 3PQJA 3HOZJ 1T8IA 2E35A 3CCJI 2M7AA 4EJTA 4R1HA 1B9NA 2OCCH 2F4IA 3DU5A 2ZCWA 2EFNA 3GZ6A 1FIAA 3S17J 4ZZDA 3J81K 4CUGA 2YUSA 2LNBA 4HV5A 3KP5A 1DUXC 1MNDA 4XKBA 3BTIA 1MIJA 3CC2I 2L9NA 3ZQ7A 1QZZA 2W82A 4XN3A 2K27A 2VI6A 3V7CA 1MW7A 3ABLH 1FWZA 1YS7A 3RI4A 2GZWA 1GT0C 2LY9A 2KDZA 2EIKH 1VTNC 4HF1A 1ETWA 2Y9YA 4ANJA 3U1KA 3FM3A 1G3SA 2JRMA 1AA7A 4BBRJ 4BXFA 3TP3A 4D5FA 2EZLA 3C3WA 3GMEA 1SEUA 2F5EA 2XRLA 3V42A 5D8LB 4O6JA 3I64A 4B3XA 2XF5A 4LG0B 3KFWX 4JOMA 2VQGA 5E1XA 2E36A 4HLXA 4GRIA 2X6OA 1FC3A 1EF4A 2WAEA 3G1LA 2XKOA 4CCLA 1Z9CA 3CDLA 3EYYA 2EPFA 1T95A 5KAIC 5D5VB 2XROA 1TC3C 3J7ZI 4J00A 1V4RA 2Y0SN 4HRIA 1T56A 2LF8A 3LAPA 2BY0A 3CCUI 1ETQA 2A61A 3KEYA 1IN6A 2DT6A 5LFAA 3M9AA 1HLVA 4M9ZA 4M3BA 4B47A 1V5GA 1D5YA 3I4MJ 5FRNA 2L4MA 2KJCA 3F8FA 2A6TA 2R7OA 1OYIA 4EMSA 4KN7X 2FXAA 4E7ZA 1WJFA 3KPHA 1KQ8A 3AKZA 1X4OA
chains in the Genus database with same CATH topology
2XPVA 2IBDA 3NAUA 5F04A 3QPLA 5FJ8J 3D1NI 4XICA 1ETVA 2M2EA 3BQZA 3BR5A 1FIPA 3ZQGA 2EZHA 4J19A 5JLWA 4A93J 1JT6A 3LSGA 3TW7A 2NVTJ 4GFBA 4G12A 1NK2P 2WB1N 1JKQC 4XRSG 1ETOA 2XB5A 3JRCA 1ZR4A 4FE4A 1UMQA 5IYCJ 2DJNA 5IOZA 1WPKA 2E19A 3PM1A 5HODA 3IH2A 3Q3SA 2JA8J 5C4JJ 2R92J 1NK3P 3GBGA 1I6HJ 1H88C 5M5WJ 1LE8A 2LD5A 4D7NA 2TRTA 2JA7J 4MFDA 2ID6A 4NDLA 4DW6A 2NVYJ 2DMUA 1MBEA 1RKWA 1H8AC 3W6VA 3PO3J 3BT9A 3HGGA 4M3FA 1QPIA 2B63J 5F0CA 3OOUA 1UHSA 2DMTA 1MBGA 4D5CA 1G2HA 1TWHJ 3BG9A 2LVSA 3BG3A 4V2GA 3BTJA 4DZPA 4B1RA 3BR3A 5EG0A 2LK2A 1OCTC 1FTTA 2H8RA 1MH4A 2MSYA 1ZK8A 5K7HA 2M0CA 2D5VA 2O8KA 4LOCA 1P7IA 3HBLA 1I50J 4BBSJ 3G1MA 3HEFA 1JJ8C 2FX0A 4RBOA 3A03A 2CQXA 5M3MJ 3B6AA 3S1QJ 4IHVA 5F27A 1SANA 1ZGWA 1UG2A 1BJZA 1IGNA 2VKEA 1WGXA 2IEKA 2LKXA 2HDDA 4A3GJ 2E2HJ 2R5ZA 2DA2A 1WH7A 1B72B 1X2NA 3GTKJ 1GVDA 4RDUA 2CUEA 1U9NA 5FKNA 2DA5A 1F36A 3HDDA 3GTQJ 1BW5A 3M3YJ 4ABZA 4IHWA 3JRHA 2N8GA 3HB9A 2P81A 2M8GX 1AU7A 2JA6J 3RKQA 4BKXA 2HXIA 3CCYA 3B6CA 2X9DA 5F1JA 5C3EJ 2E1OA 4XK4A 3LNQA 2O9LA 3MVPA 2ME0A 2G0EA 2LLKA 2CRGA 3HOYJ 1LE8B 2QF7A 1XG1A 2ECCA 2WAQN 4DYRA 1MSEC 2GLOA 1S7EA 1TWGJ 4C2MJ 5GPCA 4XRMA 3S1NJ 4FCYA 2AHQA 1QVTA 3H3VK 1OJLA 4A3FJ 2CU7A 1PUFB 2Y9ZA 4HNVA 1Y1VJ 1QVUA 1Y1WJ 5JLXA 4Y52J 4M6VA 2K40A 2IAIA 3S2HJ 2JJ7A 4W97A 4BY7J 5EG0B 1HOMA 1X2MA 4I76A 5C44J 2M34A 3BTCA 3JRFA 3S1MJ 5M3FJ 2DA3A 2L7FP 3A01A 2L7ZA 1JKRC 1JUMA 1OFCX 3LSPA 2NS7A 3BG5A 1B8IA 1Z77A 2XSDC 4FISA 3FISA 3RQIA 3A02A 3MN2A 4AC0A 2ECBA 3QPSA 5FKLA 5BNGA 3GTGJ 1WI3A 1MBFA 2XB0X 4XIDA 1VF9A 4JX4A 1ZQ3P 3WHCA 1B72A 2K9NA 2R5ZB 4EEFG 3ZOBA 4A3MJ 2Y31A 4IEJA 2HQ5A 1WCMJ 2ELKA 3S16J 5EYRA 3JRIA 1JT0A 1GDTA 2R93J 3FIWA 2XGDA 4IHXA 1BW6A 2HXOA 4QTRA 5EGOA 9ANTA 3O8GA 1A5JA 4V2FA 3SJMA 4JX6A 4DZJA 2XGCA 5IPAA 4X6AJ 2COBA 2W48A 3C2BA 3ZQLA 4BY1J 3FK6A 5EDNA 2VKVA 2ME6A 1PUFA 1ZR2A 4UUTA 5IYBJ 5E3LA 2YS9A 5DTDA 3I4NJ 3QQAA 1F43A 1APLC 1IDYA 5E3MA 1HF0A 1U78A 3HOXJ 3TP0A 5IOYA 3HOUJ 3HGYA 1GV2A 1AHDP 4A3DJ 1T33A 2MGQA 3GTPJ 3A01B 1B8IB 2E2IJ 4QIWN 1XC5A 5DS9A 5J1YA 1MH3A 2DTZA 1POGA 2HOSA 1IRZA 1YRNA 2FJ1A 3OSFA 1ETXA 1LFUP 2XGEA 1BL0A 1IV6A 3Q0WA 4Y7NJ 3RZDJ 2L9RA 2LR8A 2XPWA 3O8HA 1JGGA 3JR9A 2DMPA 3BR6A 2DMQA 2KT0A 4JYKA 4B3AA 2WV1A 2I10A 3ZQIA 1JUPA 3BQYA 2R5YA 5IYDJ 4W1UA 1MBHA 2ZB9A 1Z0XA 2EZKA 2NVQJ 2JK3A 1O4XA 1W0TA 3S14J 2DA7A 5EGOB 5E3OA 1MNMC 4CYCA 2OPTA 4AUXA 2OF7A 1XS9A 1IJWC 2HYJA 4M3DA 3CMYA 3JRBA 3S1RJ 3HM5A 1FTZA 3WHBA 1NTCA 1FJLA 1IDZA 1TWFJ 2MW8A 2M9HA 1JJ6C 1BA5A 2JMWA 3SFIA 4XRSA 1U8BA 1SFOJ 1P7JA 3S15J 1DU6A 2YU9J 3NARA 1ETKA 1K83J 4BXXJ 2EBIA 2DA1A 1VNDA 5J3LA 3GTLJ 2DA6A 2O7OA 5IP9J 3RZOJ 5K7FA 1MBJA 1Q1VA 4M3GA 5FKKA 1ITYA 3K2AA 2FQ4A 1JTYA 5FLMJ 2TCTA 2NOGA 1X58A 1IC8A 3M4OJ 1OCPA 1WH5A 1YRNB 4A3BJ 3BTLA 5EF6A 3PO2J 3UKGA 5E3NA 4IHYA 2LFBA 4A3LJ 2CQQA 2VUMJ 1IUFA 2CUFA 3LSJA 5J1UA 1GV5A 3ZQHA 5F0HA 5IP6A 3IV5A 1ZTRA 2EH3A 3BR1A 2R5YB 3FK7A 4A3JJ 5F0FA 2PMZN 2X48A 4UUSB 3FKIJ 4DYCA 1HDDC 3LOCA 1JKPC 4CYCB 2AO9A 2CJJA 3Q0UA 1ORKA 1VFCA 1U9OA 2JWTA 2VPRA 5IP7J 4M3EA 3SDGA 2JA5J 1RETA 1JKOC 1ENHA 2RAEA 2K9SA 3OSGA 3HOVJ 3L1PA 5K7ZA 1MSFC 3GTJJ 2HOTA 4D7MA 4JP0A 2MG4A 2E2JJ 5FKOA 3DEWA 3Q0VA 2Y30A 5M5XJ 3TW6A 2L7MP 2NS8A 1H89C 1ETYA 3HKZN 1AKHA 4A69C 3ZQFA 1JUSA 4JX5A 3BR2A 1JTXA 4MIMA 3GTMJ 5C4XJ 3S2DJ 1RR7A 3MKLA 5M5YJ 3ZQCA 2FD5A 1R9TJ 3HOZJ 5EEAA 1GUUA 2EZIA 4S0HB 1RKTA 3F0CA 2DN0A 1QRYA 1RESA 1A6IA 2GBYA 2EQRA 1FIAA 3OIOA 2DA4A 2R0QC 3S17J 3G1OA 3H0GJ 2YUSA 4MFEA 3IH3A 4C3IJ 4UUSA 3GTOJ 3BTIA 4QSHA 3E7LA 1ZKGA 2JN6A 4MO7A 2VI6A 3K7AJ 4FE7A 1TWAJ 1IG7A 1GT0C 2LY9A 2KDZA 4L5EA 4MLOA 3JRAA 1ETWA 2Y9YA 4FTHA 2R7ZJ 3JRGA 4C3HJ 1CQTA 4BBRJ 3TP3A 4D5FA 1LFBA 2EZLA 5GP9A 2XRLA 1HDPA 5J1RA 3VPRA 4C3JJ 2NVXJ 2GM4A 1RPWA 3JREA 1I3QJ 2ID3A 3HOWJ 2QCOA 3DCFA 1AKHB 2HOAA 4I6ZA 2X6OA 2LTPA 2DMNA 1EF4A 3G1LA 1HCRA 1VI0A 1E3OC 3CDLA 1DU0A 2K9QA 2LP0A 3LSRA 4A3EJ 4AYBN 3CQZJ 1TC3C 5F08A 2Y0SN 1T56A 5EZHA 1W0UA 2L0KA 2HI3A 2Y2ZA 1ETQA 4A3KJ 1MBKA 1HLVA 4M3BA 4A3CJ 4DYQA 1D5YA 5EZGA 3IH4A 3I4MJ 2H1KA 4X1EA 1TWCJ 5GPAA 3BR0A 5FKMA 5FLVA 3TEDA 4A3IJ 3JRDA 2XPUA 4B4CA 1FEXA 1K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPV A;  2IBD A;  3NAU A;  5F04 A;  3QPL A;  5FJ8 J;  3D1N I;  4XIC A;  1ETV A;  2M2E A;  3BQZ A;  3BR5 A;  1FIP A;  3ZQG A;  2EZH A;  4J19 A;  5JLW A;  4A93 J;  1JT6 A;  3LSG A;  3TW7 A;  2NVT J;  4GFB A;  4G12 A;  1NK2 P;  2WB1 N;  1JKQ C;  4XRS G;  1ETO A;  2XB5 A;  3JRC A;  1ZR4 A;  4FE4 A;  1UMQ A;  5IYC J;  2DJN A;  5IOZ A;  1WPK A;  2E19 A;  3PM1 A;  5HOD A;  3IH2 A;  3Q3S A;  2JA8 J;  5C4J J;  2R92 J;  1NK3 P;  3GBG A;  1I6H J;  1H88 C;  5M5W J;  1LE8 A;  2LD5 A;  4D7N A;  2TRT A;  2JA7 J;  4MFD A;  2ID6 A;  4NDL A;  4DW6 A;  2NVY J;  2DMU A;  1MBE A;  1RKW A;  1H8A C;  3W6V A;  3PO3 J;  3BT9 A;  3HGG A;  4M3F A;  1QPI A;  2B63 J;  5F0C A;  3OOU A;  1UHS A;  2DMT A;  1MBG A;  4D5C A;  1G2H A;  1TWH J;  3BG9 A;  2LVS A;  3BG3 A;  4V2G A;  3BTJ A;  4DZP A;  4B1R A;  3BR3 A;  5EG0 A;  2LK2 A;  1OCT C;  1FTT A;  2H8R A;  1MH4 A;  2MSY A;  1ZK8 A;  5K7H A;  2M0C A;  2D5V A;  2O8K A;  4LOC A;  1P7I A;  3HBL A;  1I50 J;  4BBS J;  3G1M A;  3HEF A;  1JJ8 C;  2FX0 A;  4RBO A;  3A03 A;  2CQX A;  5M3M J;  3B6A A;  3S1Q J;  4IHV A;  5F27 A;  1SAN A;  1ZGW A;  1UG2 A;  1BJZ A;  1IGN A;  2VKE A;  1WGX A;  2IEK A;  2LKX A;  2HDD A;  4A3G J;  2E2H J;  2R5Z A;  2DA2 A;  1WH7 A;  1B72 B;  1X2N A;  3GTK J;  1GVD A;  4RDU A;  2CUE A;  1U9N A;  5FKN A;  2DA5 A;  1F36 A;  3HDD A;  3GTQ J;  1BW5 A;  3M3Y J;  4ABZ A;  4IHW A;  3JRH A;  2N8G A;  3HB9 A;  2P81 A;  2M8G X;  1AU7 A;  2JA6 J;  3RKQ A;  4BKX A;  2HXI A;  3CCY A;  3B6C A;  2X9D A;  5F1J A;  5C3E J;  2E1O A;  4XK4 A;  3LNQ A;  2O9L A;  3MVP A;  2ME0 A;  2G0E A;  2LLK A;  2CRG A;  3HOY J;  1LE8 B;  2QF7 A;  1XG1 A;  2ECC A;  2WAQ N;  4DYR A;  1MSE C;  2GLO A;  1S7E A;  1TWG J;  4C2M J;  5GPC A;  4XRM A;  3S1N J;  4FCY A;  2AHQ A;  1QVT A;  3H3V K;  1OJL A;  4A3F J;  2CU7 A;  1PUF B;  2Y9Z A;  4HNV A;  1Y1V J;  1QVU A;  1Y1W J;  5JLX A;  4Y52 J;  4M6V A;  2K40 A;  2IAI A;  3S2H J;  2JJ7 A;  4W97 A;  4BY7 J;  5EG0 B;  1HOM A;  1X2M A;  4I76 A;  5C44 J;  2M34 A;  3BTC A;  3JRF A;  3S1M J;  5M3F J;  2DA3 A;  2L7F P;  3A01 A;  2L7Z A;  1JKR C;  1JUM A;  1OFC X;  3LSP A;  2NS7 A;  3BG5 A;  1B8I A;  1Z77 A;  2XSD C;  4FIS A;  3FIS A;  3RQI A;  3A02 A;  3MN2 A;  4AC0 A;  2ECB A;  3QPS A;  5FKL A;  5BNG A;  3GTG J;  1WI3 A;  1MBF A;  2XB0 X;  4XID A;  1VF9 A;  4JX4 A;  1ZQ3 P;  3WHC A;  1B72 A;  2K9N A;  2R5Z B;  4EEF G;  3ZOB A;  4A3M J;  2Y31 A;  4IEJ A;  2HQ5 A;  1WCM J;  2ELK A;  3S16 J;  5EYR A;  3JRI A;  1JT0 A;  1GDT A;  2R93 J;  3FIW A;  2XGD A;  4IHX A;  1BW6 A;  2HXO A;  4QTR A;  5EGO A;  9ANT A;  3O8G A;  1A5J A;  4V2F A;  3SJM A;  4JX6 A;  4DZJ A;  2XGC A;  5IPA A;  4X6A J;  2COB A;  2W48 A;  3C2B A;  3ZQL A;  4BY1 J;  3FK6 A;  5EDN A;  2VKV A;  2ME6 A;  1PUF A;  1ZR2 A;  4UUT A;  5IYB J;  5E3L A;  2YS9 A;  5DTD A;  3I4N J;  3QQA A;  1F43 A;  1APL C;  1IDY A;  5E3M A;  1HF0 A;  1U78 A;  3HOX J;  3TP0 A;  5IOY A;  3HOU J;  3HGY A;  1GV2 A;  1AHD P;  4A3D J;  1T33 A;  2MGQ A;  3GTP J;  3A01 B;  1B8I B;  2E2I J;  4QIW N;  1XC5 A;  5DS9 A;  5J1Y A;  1MH3 A;  2DTZ A;  1POG A;  2HOS A;  1IRZ A;  1YRN A;  2FJ1 A;  3OSF A;  1ETX A;  1LFU P;  2XGE A;  1BL0 A;  1IV6 A;  3Q0W A;  4Y7N J;  3RZD J;  2L9R A;  2LR8 A;  2XPW A;  3O8H A;  1JGG A;  3JR9 A;  2DMP A;  3BR6 A;  2DMQ A;  2KT0 A;  4JYK A;  4B3A A;  2WV1 A;  2I10 A;  3ZQI A;  1JUP A;  3BQY A;  2R5Y A;  5IYD J;  4W1U A;  1MBH A;  2ZB9 A;  1Z0X A;  2EZK A;  2NVQ J;  2JK3 A;  1O4X A;  1W0T A;  3S14 J;  2DA7 A;  5EGO B;  5E3O A;  1MNM C;  4CYC A;  2OPT A;  4AUX A;  2OF7 A;  1XS9 A;  1IJW C;  2HYJ A;  4M3D A;  3CMY A;  3JRB A;  3S1R J;  3HM5 A;  1FTZ A;  3WHB A;  1NTC A;  1FJL A;  1IDZ A;  1TWF J;  2MW8 A;  2M9H A;  1JJ6 C;  1BA5 A;  2JMW A;  3SFI A;  4XRS A;  1U8B A;  1SFO J;  1P7J A;  3S15 J;  1DU6 A;  2YU9 J;  3NAR A;  1ETK A;  1K83 J;  4BXX J;  2EBI A;  2DA1 A;  1VND A;  5J3L A;  3GTL J;  2DA6 A;  2O7O A;  5IP9 J;  3RZO J;  5K7F A;  1MBJ A;  1Q1V A;  4M3G A;  5FKK A;  1ITY A;  3K2A A;  2FQ4 A;  1JTY A;  5FLM J;  2TCT A;  2NOG A;  1X58 A;  1IC8 A;  3M4O J;  1OCP A;  1WH5 A;  1YRN B;  4A3B J;  3BTL A;  5EF6 A;  3PO2 J;  3UKG A;  5E3N A;  4IHY A;  2LFB A;  4A3L J;  2CQQ A;  2VUM J;  1IUF A;  2CUF A;  3LSJ A;  5J1U A;  1GV5 A;  3ZQH A;  5F0H A;  5IP6 A;  3IV5 A;  1ZTR A;  2EH3 A;  3BR1 A;  2R5Y B;  3FK7 A;  4A3J J;  5F0F A;  2PMZ N;  2X48 A;  4UUS B;  3FKI J;  4DYC A;  1HDD C;  3LOC A;  1JKP C;  4CYC B;  2AO9 A;  2CJJ A;  3Q0U A;  1ORK A;  1VFC A;  1U9O A;  2JWT A;  2VPR A;  5IP7 J;  4M3E A;  3SDG A;  2JA5 J;  1RET A;  1JKO C;  1ENH A;  2RAE A;  2K9S A;  3OSG A;  3HOV J;  3L1P A;  5K7Z A;  1MSF C;  3GTJ J;  2HOT A;  4D7M A;  4JP0 A;  2MG4 A;  2E2J J;  5FKO A;  3DEW A;  3Q0V A;  2Y30 A;  5M5X J;  3TW6 A;  2L7M P;  2NS8 A;  1H89 C;  1ETY A;  3HKZ N;  1AKH A;  4A69 C;  3ZQF A;  1JUS A;  4JX5 A;  3BR2 A;  1JTX A;  4MIM A;  3GTM J;  5C4X J;  3S2D J;  1RR7 A;  3MKL A;  5M5Y J;  3ZQC A;  2FD5 A;  1R9T J;  3HOZ J;  5EEA A;  1GUU A;  2EZI A;  4S0H B;  1RKT A;  3F0C A;  2DN0 A;  1QRY A;  1RES A;  1A6I A;  2GBY A;  2EQR A;  1FIA A;  3OIO A;  2DA4 A;  2R0Q C;  3S17 J;  3G1O A;  3H0G J;  2YUS A;  4MFE A;  3IH3 A;  4C3I J;  4UUS A;  3GTO J;  3BTI A;  4QSH A;  3E7L A;  1ZKG A;  2JN6 A;  4MO7 A;  2VI6 A;  3K7A J;  4FE7 A;  1TWA J;  1IG7 A;  1GT0 C;  2LY9 A;  2KDZ A;  4L5E A;  4MLO A;  3JRA A;  1ETW A;  2Y9Y A;  4FTH A;  2R7Z J;  3JRG A;  4C3H J;  1CQT A;  4BBR J;  3TP3 A;  4D5F A;  1LFB A;  2EZL A;  5GP9 A;  2XRL A;  1HDP A;  5J1R A;  3VPR A;  4C3J J;  2NVX J;  2GM4 A;  1RPW A;  3JRE A;  1I3Q J;  2ID3 A;  3HOW J;  2QCO A;  3DCF A;  1AKH B;  2HOA A;  4I6Z A;  2X6O A;  2LTP A;  2DMN A;  1EF4 A;  3G1L A;  1HCR A;  1VI0 A;  1E3O C;  3CDL A;  1DU0 A;  2K9Q A;  2LP0 A;  3LSR A;  4A3E J;  4AYB N;  3CQZ J;  1TC3 C;  5F08 A;  2Y0S N;  1T56 A;  5EZH A;  1W0U A;  2L0K A;  2HI3 A;  2Y2Z A;  1ETQ A;  4A3K J;  1MBK A;  1HLV A;  4M3B A;  4A3C J;  4DYQ A;  1D5Y A;  5EZG A;  3IH4 A;  3I4M J;  2H1K A;  4X1E A;  1TWC J;  5GPA A;  3BR0 A;  5FKM A;  5FLV A;  3TED A;  4A3I J;  3JRD A;  2XPU A;  4B4C A;  1FEX A;  1K61 A; 
#chains in the Genus database with same CATH topology
 5F04 A;  3CCE I;  4RLF A;  3D1N I;  3E5Q A;  1BOB A;  3R0J A;  3F6O A;  4J19 A;  4E7H A;  4AD9 A;  2K85 A;  2PMH A;  5JLW A;  1LFP A;  1MKM A;  4II2 A;  3BJ6 A;  1J0R A;  1ETO A;  4XRS G;  4M74 A;  3CDI A;  4I0B A;  5A2Q K;  2GXA A;  4JBA A;  5HOD A;  1SAX A;  2E19 A;  3IH2 A;  3Q3S A;  5LD2 C;  2X51 A;  3EUH C;  1IN8 A;  3WG7 H;  1HW1 A;  2E60 A;  5EEG A;  1I6H J;  2OD5 A;  2XAQ A;  1X1A A;  2Z16 A;  3K4M A;  3OR2 C;  2CSO A;  4RS8 A;  5L3F A;  1H88 C;  4EGZ A;  4D7N A;  1XMA A;  3CD6 I;  4BQO A;  2ID6 A;  4NDL A;  1H8A C;  3C1D A;  3D5R C;  4L5I A;  5HDN A;  3BRO A;  3HIF A;  3ZMV A;  5LRR A;  1R1U A;  4A0X A;  2BBY A;  3BC8 A;  5H20 A;  1MBG A;  2LSO A;  3ZQQ A;  2M1B A;  2VE8 A;  1YJW I;  3BG3 A;  4FHT A;  3L2W A;  4V2G A;  3BR3 A;  3C2H A;  5ILS A;  3HZJ A;  1IAW A;  2KZG A;  5K5R A;  3FHZ A;  2H8W A;  4A6D A;  2V6C A;  1IN7 A;  2BZT A;  3FXU A;  2MLK A;  3AL0 C;  1BC7 C;  1ZK8 A;  5K7H A;  2D5V A;  3BZK A;  1W1W E;  1WZ2 A;  3WTV C;  2PG4 A;  4LLL A;  2VT3 A;  3E6D A;  3KEO A;  3OL4 A;  4BBS J;  1R5H A;  1YS6 A;  2FX0 A;  3HHG A;  2CQX A;  3AG3 H;  3F3X A;  1NHA A;  3S32 A;  3GVA A;  4BDY A;  3MKW B;  1L0O C;  4UV8 A;  5AIQ A;  4LGW A;  3WTU C;  1BJZ A;  2P5L C;  1IGN A;  4XLN F;  2VKE A;  1WGX A;  3DU6 A;  4Q47 A;  3IAS 2;  2HDD A;  2G9W A;  1UST A;  4RA2 A;  1G3W A;  1RNL A;  3HOS A;  3CME I;  4D9J A;  4XLA A;  3GTK J;  1GVD A;  4RDU A;  2WC2 A;  4IJA A;  2HVS A;  2OUM A;  2VBX A;  3HRT A;  3R61 A;  2QQA A;  3NWS A;  1F36 A;  2ICW G;  3M3Y J;  1OCR H;  4ABZ A;  1LVK A;  4IHW A;  4YFN F;  4N4O B;  2STT A;  1IF1 A;  1N78 A;  4HQE A;  5KVR A;  4KIF A;  4BKX A;  4OOI A;  4OIP F;  4PUS A;  5B1B H;  2E1O A;  3LNQ A;  1FY7 A;  2O9L A;  2DBB A;  1PVE A;  4UNO A;  2G0E A;  3PSF A;  1XG1 A;  5JVT A;  1FSE A;  2ECC A;  4E70 A;  2GLO A;  1PYV A;  3X2Q H;  3ROU A;  1J9I A;  2RNJ A;  4XRM A;  4FCY A;  2AHQ A;  1OJL A;  4A3F J;  2CU7 A;  1PUF B;  4XBF A;  2Y9Z A;  4QPO A;  1WJD A;  3G3Z A;  3K4C A;  2Y75 A;  1B9M A;  3H3Z A;  3ZMZ A;  1XGN A;  3SQN A;  3P9K A;  4CYD A;  3G6E I;  2R7W A;  4MQ9 F;  1AWC A;  4KDP A;  3L9F A;  1X2M A;  3KE2 A;  3BTC A;  5C44 J;  3S1M J;  2EIN H;  2DA3 A;  1P92 A;  1LEA A;  1OFC X;  2WBM A;  2NS7 A;  2CGP A;  3PFY A;  3P9C A;  3SZG A;  1W5C C;  4BJ6 C;  1D0Y A;  1IXS B;  1T38 A;  3A02 A;  3MN2 A;  3RYP A;  2VOP A;  4CA0 A;  1SFK A;  1J5Y A;  1N75 A;  1KZH A;  1VQ4 I;  2RRE A;  1V55 H;  2STW A;  3CO6 C;  4YEL A;  3U9G A;  1ZRD A;  2IVM A;  4U88 A;  1SVL A;  4EEF G;  1LDJ A;  2ZME B;  2KHM A;  4DQ2 A;  1IXR C;  1O7F A;  1FMW A;  4XKW A;  1IZ1 A;  2H6B A;  5EYR A;  4CH7 A;  5GAH J;  1D3Y A;  2FOW A;  4L9T A;  2IGM A;  2R93 J;  3FIW A;  4IHX A;  3WGG A;  1BW6 A;  4IVN A;  1Z3Y A;  9ANT A;  3I3L A;  2EFW A;  3ISP A;  4JX6 A;  2ACJ A;  2XGC A;  2JA2 A;  3CUO A;  2KRF A;  1JGS A;  3C2B A;  3ZQL A;  5EDN A;  3CJT B;  3JTH A;  3DQV C;  1ZR2 A;  4UUT A;  3M8J A;  1A6Q A;  4ZYG A;  2JTV A;  5E3L A;  5DTD A;  1D0X A;  4PCQ A;  1F43 A;  2IS4 A;  1IDY A;  1P2F A;  3PNT A;  4LD5 A;  5E3M A;  3NWT A;  4I09 A;  3HOX J;  1MMS A;  5IOY A;  1GHC A;  2RVC A;  3HTU A;  3H5A A;  3HOU J;  1MZB A;  2E34 A;  2XAG A;  2D45 A;  3W6K B;  2MGQ A;  2VON A;  1ZEL A;  1R5G A;  2EA4 A;  3L2U A;  4XL9 A;  1HQC A;  3LA7 A;  3KYC B;  3DFG A;  5TJJ A;  4N0B A;  1HW5 A;  3QYE A;  2P6S A;  1VQL I;  4HF0 A;  1YRN A;  3DLL F;  1YI2 I;  3VYU B;  3BPX A;  3J80 K;  1IV6 A;  3OR1 C;  1TW3 A;  4IKF A;  4V19 K;  1DP3 A;  2GWR A;  4PGH A;  2DI3 A;  4G7Z F;  2LR8 A;  2XPW A;  3CJR B;  3WE2 A;  3CLQ A;  1DPR A;  2VIX A;  3EQL F;  1YIJ I;  2DT7 B;  4JYK A;  4RGR A;  4BGD A;  3BDD A;  2R5Y A;  3HC7 A;  4W1U A;  4TV7 A;  3E6C C;  2JK3 A;  4HX7 A;  3MZY A;  2PBI A;  1W0T A;  2IRF G;  1O3Q A;  2OPT A;  3ZN0 A;  1BI2 A;  4BEH B;  2LH9 A;  3FBN B;  1XS9 A;  1IJW C;  2HYJ A;  2VQC A;  3PQK A;  3F8B A;  3S1R J;  3WHB A;  1B6A A;  1EH7 A;  2EJR A;  4CXF A;  2RC4 A;  3OYB A;  2HPM A;  2V79 A;  3S2W A;  1JJ6 C;  5E8I A;  2JMW A;  3RYR A;  3SFI A;  4A0Z A;  1SFO J;  2V9V A;  1DU6 A;  3L7W A;  3H0D A;  1ETK A;  3IKT A;  4F92 B;  3NEU A;  2F5C A;  4RLQ A;  5AIP A;  1YJN I;  4HLY A;  1E0E A;  1XGO A;  3MZH A;  1XTA A;  2DA6 A;  1SFX A;  2BW3 B;  2J5O A;  3GEZ A;  5HS8 A;  1WJC A;  3DKY A;  2IW5 A;  3PUF A;  1WVR A;  1D0Z A;  3FXR A;  1SMY F;  2HTJ A;  1QO0 D;  4EJW A;  3LSH A;  2L4A A;  2FQ4 A;  3K4K A;  1ZG1 A;  1QHH D;  1YHQ I;  3WOD F;  1FYL A;  1FOY A;  1TTY A;  2EK5 A;  2F5F A;  4UB8 C;  2ZFU A;  3E1S A;  1IC8 A;  2IS1 A;  3ML6 A;  1D5V A;  2HWV A;  4IXA A;  1XGS A;  4DBQ A;  4IRG A;  4LK0 F;  3FM5 A;  3BP8 A;  1UAA A;  5LBQ A;  4IHY A;  4QPQ A;  4A3L J;  1Z6R A;  2ZXI A;  3CF5 F;  2CUF A;  2XHK A;  3ESW B;  5J1U A;  3EUH A;  2L9V A;  3ERE D;  2DK8 A;  1H9G A;  1TBX A;  5IP6 A;  4IX7 A;  2NRA C;  2XAU A;  2NS0 A;  3GYH X;  1ZHF A;  1OCZ H;  1F1Z A;  2KIQ A;  1MD0 A;  4PJJ A;  5F0F A;  3U21 A;  2PMZ N;  4WWC A;  3L2C A;  2DFF A;  3FKI J;  4KMF A;  1STZ A;  1HDD C;  3LOC A;  4I7H A;  4ASN A;  2DYR H;  2XC7 A;  3DTI A;  4M3E A;  1BI1 A;  3SDG A;  2IS2 A;  4RB3 C;  2JA5 J;  2V4J C;  2BE5 F;  2F4O B;  1JKO C;  2LBF B;  4BUP A;  3OSG A;  3HOV J;  2YX7 A;  2A6H F;  4F52 A;  2BVL A;  1BOA A;  2HOT A;  3FXL A;  3I4P A;  4WXC A;  3K2Z A;  5FKO A;  4ESB A;  2X1E A;  2Y30 A;  2DK5 A;  2NAZ A;  2NS8 A;  4ESF A;  3QRF F;  1LQ1 A;  1YYV A;  1UJ8 A;  1OYW A;  2AS5 F;  3K6G A;  2R7T A;  3OYE A;  4OIO F;  3ZMS A;  2W7N A;  2X0L A;  2VE9 A;  4O5V A;  5DCM A;  2CO5 A;  5C4X J;  1UCR A;  2JSP A;  1XN7 A;  3HPH A;  3S2D J;  3OS1 A;  2O0Y A;  3ABK H;  3ZQC A;  2FD5 A;  2E7X A;  1R9T J;  1D1A A;  2QLZ A;  5FFX A;  2CV2 A;  4CCJ A;  4YG2 F;  3DPU A;  3H3U A;  3HYI A;  4AU7 A;  4UHT A;  2EZI A;  1ULY A;  1RKT A;  2AQE A;  2X6W A;  1J7K A;  3SHF A;  2ZKZ A;  2GBY A;  1BBY A;  2RNG A;  2HYG D;  4D0P A;  3OIO A;  1I5Z A;  2DA4 A;  2R0Q C;  4ZTF A;  2GOX B;  1HA8 A;  3H0G J;  4BAY A;  4IQJ A;  3IWF A;  3BY6 A;  1JXS A;  3IH3 A;  4UUS A;  4AM3 A;  1P6R A;  2L54 A;  3VWB A;  2HOE A;  1ZKG A;  2GIZ A;  4U0Y A;  3H5N A;  3J7A Y;  5DUK A;  3JTG A;  4FE7 A;  1U5T C;  2HDW A;  2K86 A;  3CUQ C;  1SVM A;  1FPQ A;  3TDZ C;  4A5M A;  4RAY A;  5FGM A;  1S8N A;  3FMS A;  5D4S A;  4GCV A;  3DF8 A;  1U0J A;  1WQ2 A;  2HGC A;  3KLO A;  4C3H J;  3FXM A;  5D5W B;  1K4S A;  1LFB A;  4ZH4 F;  4ON0 A;  4DGW B;  1P4A A;  1W7P B;  2WA0 A;  1HDP A;  2E1M B;  2LRE A;  3DPT A;  5J1R A;  3NQO A;  3BOQ A;  4I02 A;  3MEX A;  3JRE A;  1I3Q J;  2QBY B;  3WU1 B;  3HOW J;  4I2O A;  3DCF A;  1AKH B;  3V7S A;  3GXO A;  2MH9 A;  3KYL A;  2KIS A;  2QZ8 A;  4E7J A;  2W84 A;  2RQQ A;  1E3O C;  1DU0 A;  2E1N A;  3LSR A;  2Z9O A;  1XD7 A;  3CQZ J;  3AG4 H;  5GAD J;  3VYS B;  2HI3 A;  5DD8 A;  1FMV A;  2EB7 A;  1I39 A;  4A3K J;  1VQM I;  2RV8 A;  3EUA A;  3VEP A;  1MMN A;  3CCR I;  1YW7 A;  1PDN C;  1S3J A;  3OYL A;  1S5L C;  4X1E A;  3VOE A;  4XNF A;  4ENM A;  1JHH A;  1TWC J;  2OC6 A;  5GPA A;  1TLH B;  5FKM A;  2CQ7 A;  2QQB A;  3J7Y J;  4HST A;  5ERI A;  3JRD A;  4RGX A;  4B4C A;  2WWY A;  5KAF C;  1ON1 A;  2Z3Y A;  2XPV A;  3AG2 H;  1FBS A;  2VLA A;  4S04 A;  1CF7 B;  1FIP A;  3CJN A;  4XLF A;  4XSZ F;  2EZH A;  3GLX A;  3ZQG A;  5HDG A;  2QA4 I;  2FEZ A;  2M0M A;  3FZV A;  3PSI A;  3TW7 A;  3S93 A;  1NK2 P;  2WB1 N;  3JRC A;  1ZR4 A;  4FE4 A;  1UMQ A;  5IYC J;  4G6Q A;  5IOZ A;  1WPK A;  2R92 J;  4OWR B;  1X1C A;  4BQA A;  2JSC A;  2AQF A;  1OLT A;  2LD5 A;  4E6K G;  2X1C A;  2JA7 J;  4MFD A;  2MA3 A;  4U87 A;  1A36 A;  1MBE A;  1RKW A;  4P9F A;  2IA2 A;  2K4B A;  2M4K A;  3HGG A;  3I0T A;  2QQ9 A;  2B63 J;  5F0C A;  3OOU A;  1UHS A;  2V6E A;  5D6E A;  1G2H A;  1TWH J;  3TMO A;  3DWL E;  3BTJ A;  1I27 A;  3GW2 A;  2W00 A;  4HQM A;  2V9K A;  1YTY A;  4A5N A;  5FLX Z;  5EG0 A;  2LK2 A;  3OY9 A;  1MH4 A;  1WKM A;  2B7E A;  2EFQ A;  5J47 A;  4UY8 I;  3W2W A;  3LMM A;  3QPT A;  1SD6 A;  2OA4 A;  3A0B C;  5E1W A;  2BY1 A;  4LOC A;  1P7I A;  2CS3 A;  2P5V A;  3CES A;  3FMQ A;  1I50 J;  3HBL A;  4WXH A;  1VQP I;  2P6T A;  2EIJ H;  3VYR B;  5E79 C;  2FU4 A;  1RUO A;  2DTR A;  2VC1 A;  1SAN A;  3EPZ A;  2W25 A;  1ZGW A;  2W57 A;  3KP2 A;  5LEJ A;  2IEK A;  2VL8 A;  2LKX A;  2E2H J;  2R5Z A;  3FHN A;  1WJE A;  1WH7 A;  1ZGA A;  1AOY A;  3ZMT A;  1X2N A;  3F8M A;  2CUE A;  2FUG 2;  1UHW A;  1U9N A;  3O6B B;  5D8K B;  2FBK A;  3GFI A;  4ZDO A;  1S9H A;  2DFI A;  1MMG A;  3GTQ J;  2OQR A;  3B02 A;  4G6T B;  1O7L A;  5CQE A;  1BW5 A;  5DEQ A;  4PSX A;  2ISZ A;  3G73 A;  3HB9 A;  2P81 A;  2Y0S A;  2FQ3 A;  3P7N A;  1UG0 A;  2M8G X;  2JA6 J;  2ZFW A;  1R22 A;  1TW2 A;  1RZ4 A;  2FOK A;  5C3E J;  3MKZ A;  4LLN A;  2ME0 A;  2CW0 F;  1LE8 B;  3E6B A;  2E7W A;  3LQR A;  1ZN2 A;  3MKY B;  3LFU A;  5E17 F;  2XAS A;  1ZRC A;  2VXD A;  4C2M J;  3RCO A;  2CYY A;  5GPC A;  4XLP F;  3COA C;  1I3A A;  3E0J B;  4HG2 A;  4ZDL A;  3PJR A;  3BCA A;  1S7O A;  3BLY A;  1Y1V J;  4UVC A;  3P9I A;  3TO9 A;  2LDU A;  2JZY A;  4M6V A;  2KDO A;  1BIA A;  2WY7 Q;  3I59 A;  1UZC A;  3JRF A;  1EH8 A;  3GF2 A;  4LK1 F;  4PFO A;  4I98 B;  3HOT A;  3A01 A;  2L7Z A;  2A6E F;  3LSP A;  4C2U A;  2KIM A;  3R6S A;  1V5F A;  1Z77 A;  2DXI A;  2XSD C;  3TBI A;  1W5S A;  3K4J A;  3CMM A;  2O3F A;  1ODD A;  2CH0 A;  2P0W A;  4AC0 A;  2A68 F;  5BNG A;  4CO8 A;  1G59 A;  2ETH A;  2ZBK A;  4CCN A;  1I6X A;  2Q1Z B;  4Q4Z F;  4PFP A;  3VSL A;  2K4J A;  3MWM A;  1Z7U A;  1K78 A;  2AXT C;  2P8T A;  4I01 A;  3HHH A;  3IRR A;  5EEH A;  1ZAR A;  2BYV E;  2Y48 A;  1P9Q C;  4K2E A;  2JPC A;  3E6M A;  4A3M J;  3OYH A;  1MDM A;  4EJV A;  2LRD A;  4KMU X;  3DKX A;  2CV0 A;  3PIO F;  2YR2 A;  2MD5 A;  2ELJ A;  1IUY A;  4LFU A;  4HOB A;  3MMY B;  1K61 A;  3FX3 A;  3NRV A;  3SJM A;  3GFL A;  3E3V A;  1YFH A;  5DD4 A;  1LEB A;  3O3K A;  4X6A J;  3GZN B;  3PNY A;  2COB A;  1ZLK A;  4BY1 J;  4LG3 A;  2ADU A;  1FX7 A;  4UUV A;  3R60 A;  1IRF A;  1E3H A;  2VKV A;  2E5N A;  1NG6 A;  2DOE A;  2HTS A;  3PNV A;  3I4N J;  3K10 A;  3IHU A;  2IGN A;  1YO5 C;  1APL C;  1K4T A;  4LIT A;  1R71 A;  1HF0 A;  3J7A O;  2K9M A;  2MYS A;  3SZT A;  1BIB A;  1IXC A;  1NG7 A;  2H6C A;  3DLA A;  2YU3 A;  3HGY A;  3ZR8 X;  4A3D J;  2PMU A;  1T33 A;  3TDU C;  3OYK A;  1R1T A;  1B8I B;  4PZJ A;  3WTZ A;  1FYK A;  3QP6 A;  1FNN A;  4FT8 A;  4IHS A;  3OOP A;  1M1E B;  2DTZ A;  3JAM K;  3JSO A;  2R7X A;  1WSU A;  1Z91 A;  3OIP A;  3H36 A;  2HDC A;  2HOS A;  1U5T A;  1ETX A;  4ENJ A;  3CUQ A;  1VQK I;  3Q0W A;  2L9R A;  3JR9 A;  2F4M B;  1FBU A;  5FLX K;  1YIT I;  3I5U A;  3LQQ A;  3DBR B;  3ZQI A;  1W36 D;  3BQY A;  2L3D A;  2FRH A;  2CQN A;  5DDG A;  3DEU A;  1WJA A;  1HST A;  2ZB9 A;  3VSK A;  2XAJ A;  1Z0X A;  3VOD A;  1OMI A;  1O4X A;  5JR3 A;  4B48 A;  5EGO B;  3QPH A;  3LWF A;  5D6F A;  4CYC A;  1XGM A;  2UXN A;  1MNE A;  3CCV I;  2XSJ C;  4LJZ F;  3FXJ A;  4ZYA A;  1BR2 A;  2OJE D;  1H0M A;  2GXB A;  1Z67 A;  3JRB A;  5GAG J;  4HBL A;  4ZC3 A;  1FOX A;  5KCM A;  4DNC A;  5ICG A;  1FTZ A;  3QU3 A;  1TWF J;  2QSF X;  3KLN A;  1TP4 A;  2MW8 A;  4MEY F;  2PJP A;  3GFJ A;  3AL0 B;  5IT9 Z;  5F6F A;  1U8B A;  4IOA F;  4HAM A;  1RIO H;  4XKC A;  2KRC A;  4YIR X;  2YU9 J;  3M7G A;  4BU2 A;  4M71 A;  2EBI A;  2DA1 A;  1VND A;  2DFH A;  1YE9 A;  2V1X A;  5J3L A;  4BQQ A;  1OYY A;  1Z05 A;  1VQ7 I;  4ENK A;  3SXY A;  2PQ8 A;  3BWG A;  4KIC A;  5FD5 A;  1Q1V A;  3QOD A;  1QA6 A;  5DCM B;  3MCZ A;  4RB0 A;  3S3M A;  3ONQ A;  1RI7 A;  3CP2 A;  2EFP A;  1JTY A;  2W1O A;  4FET A;  2NOG A;  2R7R A;  1X3Z B;  2RQP A;  1X58 A;  3DP7 A;  4RB2 C;  1WH5 A;  2KL4 A;  3IC7 A;  2CV1 A;  3BTL A;  2ZJP F;  5EF6 A;  2VJ5 A;  3UKG A;  3H1C A;  1OCC H;  2QKM B;  2ZNZ A;  1P4W A;  4PSW A;  3KX2 A;  4KIB A;  1IUF A;  3RKY A;  5HOO A;  1QU3 A;  3LSJ A;  3TOB A;  5KNL A;  3ABU A;  3OL3 A;  3MD2 A;  3IV5 A;  2JUG A;  1ZTR A;  1LB2 A;  2RKH A;  4C2T A;  1VQ6 I;  4Q48 A;  5K1Y A;  5L3B A;  3FK7 A;  3UR3 C;  3QYB A;  3CCL I;  3K69 A;  3ZP5 A;  3MQ0 A;  4UUS B;  2V1D A;  1MJ9 A;  2CMP A;  4OU0 A;  3HUG A;  2YPR A;  2TDX A;  1WI9 A;  2CJJ A;  2JWT A;  2VPR A;  5IP7 J;  5CQG A;  2UXX A;  1U8R A;  1YOV B;  3ELK A;  4E7L A;  2K9S A;  1YW9 A;  5CYV A;  3QOP A;  4LIU A;  3F6V A;  2XF6 A;  5BS6 A;  1CGP A;  1F4K A;  1MSF C;  1KON A;  1FP2 A;  4D7M A;  3DEW A;  3K4L A;  5M5X J;  3GZ5 A;  2D1V A;  2QSG X;  5ICE A;  3CC7 I;  2L7M P;  2V7F A;  2CQK A;  1H89 C;  2H27 A;  1EV7 A;  2XVC A;  3HKZ N;  1J59 A;  2V26 A;  4FX0 A;  1KQ9 A;  2LKS A;  1TQP A;  3H92 A;  4S05 A;  2CG4 A;  3CCQ I;  4G7O F;  3OS0 A;  2H09 A;  3R4K A;  3BR2 A;  4JX5 A;  5CVV A;  1UEL B;  4Y17 A;  2IA0 A;  6PAX A;  4WK8 F;  1Z6T A;  3LA3 A;  3C2G A;  1ZAO A;  3FWE A;  3DBH B;  1Y39 A;  3DTE A;  3IUO A;  3ZN1 A;  3PL8 A;  1SFU A;  3RPQ A;  4L0Y B;  1KGS A;  5GTI C;  2OAZ A;  5FFZ A;  5LHG A;  3F0C A;  2BY3 A;  2DN0 A;  4E7K A;  3H9G A;  4F7Z A;  2EQR A;  3HJE A;  2L9S A;  1MJA A;  2GAU A;  1JI8 A;  3G1O A;  1XDU A;  3BG7 A;  5TRD A;  4MFE A;  1VQ8 I;  4OAZ A;  1Z1D A;  4BE0 A;  2BVM A;  4C3I J;  3ZMD A;  3GTO J;  4OMZ A;  2KRH A;  3RQ4 A;  2W24 A;  2PEX A;  2A3S A;  5J8F A;  2JN6 A;  1R1V A;  4MO7 A;  4OIN F;  5D4R A;  4H0E A;  3HSR A;  2VB6 A;  3N05 A;  3KZY A;  1FZP B;  4L5E A;  4MLO A;  3JRA A;  1G4D A;  1JHF A;  5E20 A;  2R7Z J;  2HKX A;  3OYI A;  3L2Q A;  1CQT A;  1W4M A;  3I55 I;  5GP9 A;  1MGT A;  1BM9 A;  3FXQ A;  3W2V A;  5HLT A;  3RIR A;  2MH2 A;  4PJL A;  2E5Z A;  5L3G A;  5BPI A;  2HR3 A;  1SVO A;  1MMD A;  5KK1 A;  2GM4 A;  1RPW A;  2A5Y B;  4ZYH A;  2ID3 A;  2A05 A;  1BR4 A;  3FXK A;  4I6Z A;  3D5S C;  3ZRG A;  3OYM A;  1VI0 A;  1HC8 A;  1Z21 A;  2E1C A;  2PJR B;  2DCE A;  1YJ9 I;  2LP0 A;  5B5E C;  4AYB N;  1T08 B;  2MFZ A;  4P5O A;  5F08 A;  2PMZ A;  2FE3 A;  4YRV A;  2MD0 A;  4OIR F;  2Y2Z A;  5LLQ A;  1B4A A;  2K7L A;  2VKH A;  2EWN A;  2QKL B;  2C6Y A;  2FBI A;  4DYQ A;  2OTL I;  2QQ8 A;  1Q1H A;  3BR0 A;  3H5R A;  2K5C A;  5FLV A;  4XLC A;  2FNA A;  3TED A;  3WGH A;  2XPU A;  3KEQ A;  1ZG3 A;  2IPQ X;  1OR7 C;  2JPB A;  1XMK A;  3SYT A;  3A2K A;  3WTS C;  3NAU A;  1BJA A;  2ZJ2 A;  5CLS A;  3OYF A;  3SFZ A;  2KJB A;  4BXU A;  2WTE A;  3KZI C;  2HFH A;  2KZV A;  4RM3 A;  4NNJ A;  2Z1D A;  1S7A A;  2NVT J;  1K79 A;  4GFB A;  4CZZ A;  1K6O A;  1JKQ C;  4RMN A;  2DJN A;  2OU2 A;  3I9V 2;  3PM1 A;  4AIK A;  2NOJ B;  2DU9 A;  2L7K A;  5C4J J;  1NK3 P;  3CO7 C;  5IT3 A;  4A2U A;  2JVH A;  4G8X A;  3QP5 A;  1EH6 A;  2M45 A;  3TO6 A;  1LJ9 A;  1I1G A;  2LMD A;  2TRT A;  3ULQ B;  3F72 A;  4DW6 A;  1N25 A;  1DGW Y;  3BJA A;  4RAF A;  3BT9 A;  2FF4 A;  4XLH A;  2ZXJ A;  3D0S A;  2BXZ A;  3H35 A;  2VPL A;  1J2X A;  3L2V A;  3OYG A;  2VJ4 A;  4L0Z B;  3BG9 A;  4Y33 A;  1E17 A;  1TL8 A;  4B1R A;  3RKW A;  2KIU A;  2F6C A;  2GQQ A;  2CUZ A;  2H8R A;  2OQG A;  1ONV A;  2MSY A;  2IGK A;  5FRO A;  2M0C A;  2O8K A;  3KZZ A;  3V4G A;  4ZYD A;  3J81 Z;  1V5E A;  2XAF A;  4XM3 A;  2Z99 A;  2LF7 A;  2R7F A;  2VBW A;  4HNU A;  1GVJ A;  4KNY A;  1REP C;  1D1B A;  1FT9 A;  1MMA A;  3G2B A;  4RBO A;  3A03 A;  5M3M J;  4J01 A;  3S1Q J;  4IHV A;  4HX8 A;  4M72 A;  4MTE A;  2QGU A;  4CCK A;  2Q2E A;  5ICF A;  2ZME A;  2OTJ I;  5H6Q A;  3BCB A;  1HKS A;  2V9P A;  3ECH A;  4NBQ A;  2BHZ A;  1MDM B;  4N9H A;  2IJL A;  4C30 A;  2DA5 A;  3TQN A;  3HDD A;  4L9N A;  4L18 B;  1LDD A;  2RGV A;  3IRQ A;  1KYZ A;  2N8G A;  1D8K A;  1X1D A;  3TKY A;  3RKQ A;  1AU7 A;  1W36 C;  2COM A;  2DJI A;  2X9D A;  5F1J A;  2IXS A;  4XK4 A;  3MVP A;  1BI0 A;  2LLK A;  3A4C A;  3HOY J;  1Y0U A;  2ZJR F;  4XKV A;  4RGU A;  3K0L A;  4EM2 A;  3IL2 A;  2WAQ N;  1DDN A;  2QEN A;  3TO7 A;  2EA2 A;  1FSH A;  3IWZ A;  4IF4 A;  1J75 A;  2DO7 A;  2WV0 A;  1IRG A;  1KYW A;  1IRX A;  2Q8K A;  5DM7 F;  4HZF A;  3OYJ A;  1IN5 A;  5DV5 A;  3ZGK A;  2NYX A;  5F64 A;  1Y1W J;  4Y52 J;  1LUJ B;  1QNT A;  3GFM A;  2XGX A;  2FBH A;  2VXZ A;  3N97 A;  4W97 A;  4BY7 J;  2JVG A;  2D1H A;  3I71 A;  4YEJ A;  2F5D A;  2O61 A;  4BJ5 C;  5M3F J;  4HF2 A;  1JKR C;  4XLE A;  3BG5 A;  3T8R A;  2WB1 A;  2VQH A;  3T1B A;  5LRS A;  2ZSI B;  4M6X A;  3K1P A;  3WTT C;  3DBL B;  5IY5 H;  4KT5 C;  3T8T A;  4LLG F;  2ECB A;  5FKL A;  4P55 A;  1LDK B;  1WI3 A;  1ZYR F;  2Z33 A;  2R7U A;  1MBF A;  4BHB A;  1R7J A;  1VF9 A;  1XCV A;  2X4H A;  3AG1 H;  4JX4 A;  4BJT A;  1YX3 A;  2FML A;  4CSW A;  1U5T B;  3GLL A;  5A2Q Z;  3CUQ B;  1B72 A;  2K9N A;  2PFB A;  3FKJ A;  2XV4 S;  2Y31 A;  1R6R A;  1XSX A;  4IEJ A;  5J8C A;  1T2K A;  5HLI A;  4BNC A;  2BHY A;  1WCM J;  2Y0M A;  3I58 A;  3HPG A;  3WTY C;  2WAF A;  2VOD A;  1JT0 A;  4Z2Y A;  1GDT A;  5CVU A;  5LGN A;  1T0F C;  3QAH A;  3OIQ A;  1S6L A;  1B1B A;  1XSD A;  3VYT B;  5DYM A;  4QTR A;  5L3E A;  1RC9 A;  4A12 A;  3ZMU A;  4BEH A;  4M9S A;  3S3O A;  4DZJ A;  1O3R A;  3KYD B;  5IPA A;  3KET A;  4OMY A;  1QHG A;  2UWM A;  5FB2 A;  2W48 A;  3CCM I;  4U0W A;  2P7C B;  4KIT B;  2M3A A;  2P7V B;  3VDX A;  2LC2 A;  2PLY A;  3VFZ A;  2Z5U A;  3F23 A;  5GAE J;  4C9Y A;  3RTR A;  5IYB J;  4XOT A;  3QOE A;  4HA8 A;  2YS9 A;  4CZC A;  1YIO A;  3QYF A;  1XCB A;  2LY2 A;  3QQA A;  3TL4 X;  2M4G A;  2K3F A;  1U78 A;  3CJQ B;  5BPD A;  3BG6 A;  2XF7 A;  2R7Q A;  2XRN A;  4XOR A;  3WTX C;  4HDV A;  4HV6 A;  1NH3 A;  4BE2 A;  3I53 A;  2BW3 A;  1D1C A;  5JFR A;  2LG4 A;  2HQR A;  4NQW A;  1XB4 A;  3D5L A;  4QIW N;  2VC0 A;  2IA1 A;  5DS9 A;  2DOA A;  5J1Y A;  1VZ0 A;  1VQ5 I;  4R79 A;  3PFI A;  3HRM A;  1MH3 A;  3E5X A;  2I5U A;  4KN4 X;  5CKT A;  1POG A;  2H94 A;  2KQR A;  2FJ1 A;  5JVG F;  3OSF A;  2B0L A;  1LFU P;  2XGE A;  5CPR B;  1R49 A;  4UB6 C;  4UVB A;  2OV7 A;  5E1Z B;  3RZD J;  3IAM 2;  4EV0 A;  4NC8 A;  3O8H A;  1JGG A;  2DMP A;  4E7S A;  3KP6 A;  5BMZ A;  4BH9 A;  2JUC A;  1FOK A;  2DMQ A;  2KT0 A;  2CW8 A;  1ZH5 A;  1MBH A;  3BPV A;  4AIJ A;  2KLO A;  2MC3 A;  2XAH A;  2NVQ J;  4ESJ A;  3LA2 A;  5E3O A;  1MNM C;  4CIC A;  4KIS A;  4AWX B;  1TT5 B;  3HUG B;  4IPA A;  3GX4 X;  2GXG A;  5CVR A;  3L09 A;  1SD4 A;  4HW0 A;  3HM5 A;  3KP3 A;  1QBJ A;  2EIL H;  1JE8 A;  1FJL A;  4JQF A;  2LBF A;  3O2P E;  3E5U A;  3M07 A;  3PIP F;  3OWT A;  2M9H A;  4DJA A;  1BA5 A;  4XRS A;  3N4M A;  3QU6 A;  4F93 B;  2KMU A;  3S15 J;  1K6Y A;  3A1Y A;  2X85 A;  3NAR A;  5ILV A;  1ZG5 A;  4BXX J;  2DOF A;  2QM3 A;  4AID A;  3GTL J;  4Y15 A;  4AVP A;  1Z7L A;  4MQV A;  3HRS A;  4F91 B;  3CTA A;  1U2W A;  2O7O A;  1GXQ A;  1OR7 A;  4H4K C;  4M3G A;  3W6J B;  4E4H A;  4G7H F;  5JHU A;  5L3D A;  2QSH X;  2TCT A;  4ITV A;  4AVZ A;  1C0W A;  2NNY A;  2D2W A;  4L5J A;  1WJ5 A;  5TGT A;  3M4O J;  1OCP A;  1YRN B;  2Y69 H;  4I0A A;  4FQG A;  3K70 D;  4IOC F;  2F2E A;  3H9J A;  3PO2 J;  4MEX F;  4KUM A;  1OPC A;  2CFX A;  4ZZL A;  4RM2 A;  2VUM J;  1QPM A;  3REO A;  3ZQH A;  5F0H A;  4IO9 F;  1XMX A;  2X1D A;  4PDK A;  1BR1 A;  4PJ0 C;  3F21 A;  2CFO A;  3OYN A;  3CCS I;  4IRH A;  4LMY A;  1HSJ A;  2R5Y B;  1OKR A;  3M8F A;  2LKP A;  2L02 A;  3HTS B;  1USS A;  2HKO A;  4O3M A;  3S3N A;  4BHC A;  2AO9 A;  2HU9 A;  4RB1 A;  1YX5 A;  3ECO A;  3Q0U A;  1VFC A;  1U9O A;  4LIV A;  4BE1 A;  3DV8 A;  1KA8 A;  1RET A;  2MLG A;  2ZC2 A;  1V54 H;  1KU7 A;  1LPQ A;  5E8G A;  4ENN A;  1DPU A;  4G6D A;  5K7Z A;  3WGI A;  2B9S A;  2BEO A;  1W7P A;  4Y3O A;  4UXN A;  2MG4 A;  1YLF A;  2E2J J;  1W7P D;  3Q0V A;  4E7I A;  4XN0 A;  3TW6 A;  2QBY A;  5HDK A;  3MFK A;  1AKH A;  2AXL A;  5B66 C;  1HKT A;  4Y4R A;  1PJR A;  3JSP A;  2R7V A;  1SD5 A;  3SEQ A;  3J80 Z;  3RJP A;  3GCM A;  4BYY A;  1ERD A;  5M5Y J;  5EEA A;  2IT0 A;  1PUE E;  1GUU A;  1Y56 A;  3L00 A;  4S0H B;  1K7A A;  3K4N A;  3W2A A;  4PK4 A;  3WU0 A;  1QZY A;  5J4V A;  5JHF A;  1B59 A;  1QRY A;  1RES A;  4EJU A;  1A6I A;  4IRI A;  2OZ6 A;  5CVJ A;  4OAY A;  2NVU B;  5FD6 A;  4KT6 A;  2L5Q A;  3CP8 A;  1Z3X A;  1R00 A;  2K9L A;  4XRF A;  2QEX I;  4DOZ A;  4PJN A;  2HZD A;  1XDS A;  1MJB A;  1CF7 A;  4Y13 A;  1HKQ A;  4QSH A;  3K1M A;  1WWX A;  3E7L A;  4XMY A;  1TT0 A;  1EJ9 A;  4KIG A;  4KA4 A;  1S72 I;  2XDV A;  2KPM A;  4WXD A;  3FMR A;  2EV0 A;  3K7A J;  5ICC A;  1A31 A;  2M7B A;  1TWA J;  5LHI A;  5ED4 A;  1IG7 A;  2LY1 A;  4BHP A;  1N77 A;  1TQM A;  2ZME C;  5JI6 A;  5HLH A;  2G7H A;  2KFD A;  2R4G A;  4FTH A;  3JRG A;  3OYD A;  2BY2 A;  3EET A;  2BXY A;  1TQI A;  1UB9 A;  2W4S A;  3VPR A;  2R3S A;  4C3J J;  2X6X A;  2NVX J;  2YSR A;  1OCO H;  2M5W A;  2QCO A;  2HOA A;  1LNW A;  2ZNY A;  1HBX G;  2LTP A;  3LSK A;  2DMN A;  1HCR A;  2FSW A;  2L2O A;  3I56 I;  1KU2 A;  4F55 A;  1IO2 A;  3KIO A;  3RSN A;  2K9Q A;  4HPQ A;  4A3E J;  1ON2 A;  1WRJ A;  2HS5 A;  3L2R A;  2A5W A;  5K5Q A;  2VN2 A;  5EZH A;  5J40 A;  1W0U A;  2L0K A;  2QUF A;  3CZ6 A;  2G7U A;  1U6G A;  3HSF A;  1HXD A;  1MBK A;  1W5T A;  4B43 A;  1VQO I;  2M8E A;  3V8K A;  3WTW C;  5CJ9 A;  2VBY A;  3G4S I;  1T0F A;  4MNU A;  4A3C J;  5EZG A;  3IH4 A;  4II3 A;  2H1K A;  3EUK L;  2R7S A;  4NUB A;  3QWL A;  1V3F A;  2GIV A;  4CCO A;  4A3I J;  4N9I A;  1FEX A;  3F8N A;  2CW7 A;  4PGG A;  2IBD A;  3LAJ A;  3BZ6 A;  2GA2 A;  2A07 F;  3QPL A;  1T6S A;  5FJ8 J;  2Q2E B;  4XIC A;  1ETV A;  2M2E A;  3BQZ A;  4X0G A;  3BR5 A;  3HKZ A;  4L9J A;  1D8J A;  2OZU A;  5AON A;  4A93 J;  1ZRE A;  1ZGJ A;  1JT6 A;  1KU3 A;  3LSG A;  3U1D A;  3Q5F A;  4G12 A;  5GTH C;  1DQU A;  2XB5 A;  1A35 A;  2NNN A;  2EV5 A;  3HL2 A;  4I99 C;  4BAC A;  3DXJ F;  3OYA A;  2JA8 J;  1RR8 C;  2ESN A;  2WY8 Q;  5DCF A;  5F1R A;  1R4N B;  3GBG A;  3T5X A;  4NHJ A;  2MBF A;  4LG0 A;  3SZP A;  1VQN I;  1O57 A;  2XUB A;  5M5W J;  1LE8 A;  1R58 A;  4Z6Y A;  4NC6 A;  4YIF A;  4F3Q A;  2NVY J;  2DMU A;  5K5O A;  3W6V A;  4P1W A;  3PO3 J;  4CHU A;  1SFE A;  4M3F A;  1QPI A;  3OMY A;  2DPU A;  3LFK A;  2I8D A;  2VAS A;  4MTD A;  2DMT A;  4D5C A;  2UUZ A;  4JK1 X;  2LVS A;  4XR6 A;  3ZXS A;  4DZP A;  1EA3 A;  4HNT A;  2DOD A;  4BL0 B;  3JW4 A;  2EIM H;  4RAZ A;  4LB6 B;  4KFC A;  1OCT C;  1FTT A;  1ACI A;  1X1P A;  2JT1 A;  1YG2 A;  2Q0O A;  1R23 A;  1P4X A;  3G1M A;  4D1Q A;  3HEF A;  1JJ8 C;  4GYI A;  4IL6 C;  1X3U A;  3B6A A;  4LB5 A;  5F27 A;  1XPX A;  2DQL A;  4M6Y A;  2K3P A;  4U7B A;  1UG2 A;  1O3S A;  1QQI A;  4A3G J;  2HEO A;  2DA2 A;  2ELH A;  4YFK F;  1B72 B;  4CDG A;  1I1S A;  1ZLJ A;  5FRM A;  3EDP A;  3P5J A;  1FYM A;  4DIQ A;  5FKN A;  1PP7 U;  4FAS D;  3T0Y A;  1S29 A;  4CGZ A;  4WF2 A;  2BV6 A;  1DGR M;  2XIG A;  5HVQ C;  2M30 A;  3JRH A;  4AYB A;  3OS2 A;  2PN6 A;  4XOP A;  4OIQ F;  2NXN B;  1FOW A;  2A69 F;  5TIS C;  1U3E M;  1BN5 A;  2GA1 A;  5B1A H;  3FXO A;  2HXI A;  3CCY A;  3B6C A;  2DPD A;  1X19 A;  3DTK A;  2HZT A;  2O8X A;  2CRG A;  2CWE A;  2DDB A;  2QF7 A;  5LEK A;  1ZRF A;  4DYR A;  4AIH A;  2UV1 A;  1MSE C;  4BS9 A;  1S7E A;  1TWG J;  4P96 A;  3S1N J;  1GXP A;  1QVT A;  2DAO A;  4RGS A;  3H3V K;  4HNV A;  2XKP A;  1G6N A;  1QVU A;  5JLX A;  3DPL C;  2K40 A;  3LST A;  2IAI A;  3S2H J;  2JJ7 A;  5HNH A;  5EG0 B;  2VT2 A;  1HOM A;  4I76 A;  2M34 A;  1TNS A;  2L7F P;  4BQN A;  1JUM A;  4M9X A;  1B8I A;  5IT9 K;  2V1N A;  4G94 A;  2L01 A;  4KJZ A;  2GOM A;  3M1C A;  4NQW B;  4FIS A;  1G3T A;  3FIS A;  3RQI A;  1E3P A;  2VJJ A;  1A04 A;  4KYW A;  2M87 A;  3Q9V A;  3PUB A;  3QPS A;  3GTG J;  5B3S H;  1BC8 C;  2XB0 X;  4U0V A;  3CDH A;  2HPI A;  3IP4 B;  4XID A;  3I54 A;  3MAJ A;  1X3W B;  3CLO A;  1ZQ3 P;  1G8X A;  3OYC A;  3WHC A;  2R5Z B;  4ETS A;  4YFX F;  3ZOB A;  2RDP A;  4UVA A;  5DUI A;  5BOX A;  1SMT A;  2YX4 A;  3F22 A;  2HQ5 A;  1L3L A;  3CMA I;  3F9K A;  2ESH A;  3K70 C;  3AFH A;  2ELK A;  3S16 J;  3JRI A;  4GDF A;  2FNP A;  5BQT A;  4IQ4 A;  2E71 A;  3B73 A;  2V1U A;  2HNH A;  2XGD A;  2HXO A;  4MGR A;  4B44 A;  3HXL A;  2P4W A;  5E18 F;  5EGO A;  3O8G A;  1A5J A;  1PP8 F;  4V2F A;  1H9T A;  3KP4 A;  4G9Y A;  1IV8 A;  2DLL A;  2J5P A;  4Q5S F;  2DFE A;  4QWQ A;  3IKV A;  2DYS H;  3GWZ A;  3MZ8 A;  3LSM A;  1TNT A;  1VQ9 I;  2HYF A;  3FK6 A;  1FP1 D;  3M8E A;  2X6Y A;  1UFM A;  2OCE A;  2ME6 A;  1PUF A;  2ZJQ F;  2KIF A;  3BZC A;  4B8X A;  2EV6 A;  2EFO A;  1WJB A;  4EVI A;  4NC7 A;  3FBI B;  3C18 A;  3HRU A;  3KCC A;  3WG9 A;  4ZYE A;  3TP0 A;  4GYG A;  4EM0 B;  1SAU A;  3I59 B;  1GV2 A;  2WAD A;  1AHD P;  4HYE A;  3SDB A;  4ZJZ A;  3GTP J;  1SC7 A;  3V7R A;  1IW7 F;  3A01 B;  1Y8R B;  2E1M C;  4ZDP A;  2E2I J;  1XC5 A;  1YQA A;  2CUJ A;  2DDA A;  4XQF A;  2ZXH A;  3HG9 A;  2H1L A;  2JRT A;  1T98 A;  3ASO H;  3BJO A;  5FO5 A;  3V8L A;  3ZCO A;  3G71 I;  4IHT A;  4HEA 2;  2FA5 A;  2VKD A;  1IRZ A;  1YW8 A;  4BDZ A;  3ASN H;  5HNF A;  1R5I D;  5HS9 A;  1BL0 A;  2K02 A;  1K78 B;  2QYO A;  4Y7N J;  4EAT A;  1IN4 A;  2WAQ A;  3FDY A;  5LGT A;  3H9Q A;  2ZSH B;  5ILU A;  4U7D A;  3EYI A;  3C7J A;  5DM6 F;  5D5U B;  2O03 A;  3OV8 A;  3BR6 A;  4B3A A;  1GLN A;  2I10 A;  2WV1 A;  1JUP A;  3K1N A;  5IYD J;  3ZPL A;  3RDI A;  4YII A;  3ABT A;  1OQY A;  2EZK A;  1WHU A;  4HSR A;  1KQ0 A;  2DA7 A;  3S14 J;  1RRJ A;  1O3T A;  2W85 A;  4AUX A;  2OF7 A;  3WU2 C;  1EKE A;  4M3D A;  5CVI A;  3CMY A;  4RAG A;  3UNG C;  1G3Y A;  1LKX A;  2DT5 A;  4WCG A;  4HX4 A;  1NTC A;  4CCM A;  1IDZ A;  2P5K A;  1TZL A;  3A0H C;  1Y6I A;  3KP7 A;  4A0Y A;  4B09 A;  5H2F C;  5LHH A;  4A6E A;  3M1E A;  2HQN A;  1QZE A;  2BOL A;  2VBZ A;  4XON A;  1P7J A;  5L3C A;  3K9T A;  1J09 A;  2JQ7 A;  2VOO A;  1K83 J;  1E2X A;  2LOO A;  2OBP A;  3LL7 A;  4EGY A;  5H6R A;  4R8H A;  1RUN A;  2MAB A;  1KU9 A;  3SEZ A;  2MC4 A;  5IP9 J;  5K7F A;  3RZO J;  3ABM H;  4XSX F;  5LGU A;  1MBJ A;  4UV9 A;  3FF5 A;  5FKK A;  1ITY A;  1WFX A;  2R7D A;  4L9V A;  3K2A A;  3TOA A;  3DKW A;  1SD7 A;  2FMY A;  5FLM J;  2IGO A;  3K4B A;  3CF2 A;  1R4M B;  1DP7 P;  1UHM A;  2Z2S B;  4M73 A;  3CC4 I;  4A3B J;  2F48 A;  3Q9S A;  3GUD A;  1Y8Q B;  2PI0 A;  4DBR A;  5E3N A;  4QLC U;  2LFB A;  3V8J A;  1QGP A;  2CQQ A;  3RPU A;  4PJM A;  2IS6 A;  5J4Y A;  4EM1 A;  1GV5 A;  3RPU D;  3VB2 A;  5D5X B;  5HS7 A;  2ZO4 A;  2EH3 A;  3BR1 A;  2O6G E;  1FBQ A;  1XSV A;  5HLG A;  4A3J J;  3WE3 A;  2O5R A;  2X48 A;  3TGN A;  1BI3 A;  4DYC A;  4EQQ A;  3HSE A;  3S8P A;  4IZZ A;  1R36 A;  4GO1 A;  1JKP C;  2HQA A;  4CYC B;  1LVA A;  4ZTJ A;  1X1B A;  2IP2 A;  2VJI A;  2ZXW H;  1ORK A;  1HW2 A;  3E97 A;  4WX9 A;  2QWW A;  1FLI A;  5KHD A;  2DW4 A;  1ENH A;  2RAE A;  3AAF A;  1X4P A;  3ERM A;  2VQL A;  3L1P A;  3LSI A;  3GTJ J;  2KP6 A;  2QVO A;  4P9U A;  4JP0 A;  4EJO A;  1XX5 A;  2LYC A;  3GO5 A;  1Y0N A;  4MHG A;  1OIS A;  2UZK A;  1ETY A;  2PX9 A;  2HVR A;  4GXO A;  3W3C A;  3JAM Z;  4FX4 A;  4A69 C;  3F8C A;  3ZQF A;  4HDU A;  1JUS A;  2KKO A;  1F5T A;  4N4N B;  2ISY A;  3JCU C;  2F5V A;  1JTX A;  4MIM A;  3GTM J;  2PJR A;  4NB5 A;  2HVQ A;  3DEE A;  2BGC A;  5J6X A;  1F9N A;  3U2R A;  3RKX A;  4GGG A;  1RR7 A;  3R0A A;  2RN7 A;  3MKL A;  1T39 A;  5EJC A;  2DQR A;  3PQJ A;  3HOZ J;  1T8I A;  2E35 A;  3CCJ I;  2M7A A;  4EJT A;  4R1H A;  1B9N A;  2OCC H;  2F4I A;  3DU5 A;  2ZCW A;  2EFN A;  3GZ6 A;  1FIA A;  3S17 J;  4ZZD A;  3J81 K;  4CUG A;  2YUS A;  2LNB A;  4HV5 A;  3KP5 A;  1DUX C;  1MND A;  4XKB A;  3BTI A;  1MIJ A;  3CC2 I;  2L9N A;  3ZQ7 A;  1QZZ A;  2W82 A;  4XN3 A;  2K27 A;  2VI6 A;  3V7C A;  1MW7 A;  3ABL H;  1FWZ A;  1YS7 A;  3RI4 A;  2GZW A;  1GT0 C;  2LY9 A;  2KDZ A;  2EIK H;  1VTN C;  4HF1 A;  1ETW A;  2Y9Y A;  4ANJ A;  3U1K A;  3FM3 A;  1G3S A;  2JRM A;  1AA7 A;  4BBR J;  4BXF A;  3TP3 A;  4D5F A;  2EZL A;  3C3W A;  3GME A;  1SEU A;  2F5E A;  2XRL A;  3V42 A;  5D8L B;  4O6J A;  3I64 A;  4B3X A;  2XF5 A;  4LG0 B;  3KFW X;  4JOM A;  2VQG A;  5E1X A;  2E36 A;  4HLX A;  4GRI A;  2X6O A;  1FC3 A;  1EF4 A;  2WAE A;  3G1L A;  2XKO A;  4CCL A;  1Z9C A;  3CDL A;  3EYY A;  2EPF A;  1T95 A;  5KAI C;  5D5V B;  2XRO A;  1TC3 C;  3J7Z I;  4J00 A;  1V4R A;  2Y0S N;  4HRI A;  1T56 A;  2LF8 A;  3LAP A;  2BY0 A;  3CCU I;  1ETQ A;  2A61 A;  3KEY A;  1IN6 A;  2DT6 A;  5LFA A;  3M9A A;  1HLV A;  4M9Z A;  4M3B A;  4B47 A;  1V5G A;  1D5Y A;  3I4M J;  5FRN A;  2L4M A;  2KJC A;  3F8F A;  2A6T A;  2R7O A;  1OYI A;  4EMS A;  4KN7 X;  2FXA A;  4E7Z A;  1WJF A;  3KPH A;  1KQ8 A;  3AKZ A;  1X4O A; 
#chains in the Genus database with same CATH homology
 2XPV A;  2IBD A;  3NAU A;  5F04 A;  3QPL A;  5FJ8 J;  3D1N I;  4XIC A;  1ETV A;  2M2E A;  3BQZ A;  3BR5 A;  1FIP A;  3ZQG A;  2EZH A;  4J19 A;  5JLW A;  4A93 J;  1JT6 A;  3LSG A;  3TW7 A;  2NVT J;  4GFB A;  4G12 A;  1NK2 P;  2WB1 N;  1JKQ C;  4XRS G;  1ETO A;  2XB5 A;  3JRC A;  1ZR4 A;  4FE4 A;  1UMQ A;  5IYC J;  2DJN A;  5IOZ A;  1WPK A;  2E19 A;  3PM1 A;  5HOD A;  3IH2 A;  3Q3S A;  2JA8 J;  5C4J J;  2R92 J;  1NK3 P;  3GBG A;  1I6H J;  1H88 C;  5M5W J;  1LE8 A;  2LD5 A;  4D7N A;  2TRT A;  2JA7 J;  4MFD A;  2ID6 A;  4NDL A;  4DW6 A;  2NVY J;  2DMU A;  1MBE A;  1RKW A;  1H8A C;  3W6V A;  3PO3 J;  3BT9 A;  3HGG A;  4M3F A;  1QPI A;  2B63 J;  5F0C A;  3OOU A;  1UHS A;  2DMT A;  1MBG A;  4D5C A;  1G2H A;  1TWH J;  3BG9 A;  2LVS A;  3BG3 A;  4V2G A;  3BTJ A;  4DZP A;  4B1R A;  3BR3 A;  5EG0 A;  2LK2 A;  1OCT C;  1FTT A;  2H8R A;  1MH4 A;  2MSY A;  1ZK8 A;  5K7H A;  2M0C A;  2D5V A;  2O8K A;  4LOC A;  1P7I A;  3HBL A;  1I50 J;  4BBS J;  3G1M A;  3HEF A;  1JJ8 C;  2FX0 A;  4RBO A;  3A03 A;  2CQX A;  5M3M J;  3B6A A;  3S1Q J;  4IHV A;  5F27 A;  1SAN A;  1ZGW A;  1UG2 A;  1BJZ A;  1IGN A;  2VKE A;  1WGX A;  2IEK A;  2LKX A;  2HDD A;  4A3G J;  2E2H J;  2R5Z A;  2DA2 A;  1WH7 A;  1B72 B;  1X2N A;  3GTK J;  1GVD A;  4RDU A;  2CUE A;  1U9N A;  5FKN A;  2DA5 A;  1F36 A;  3HDD A;  3GTQ J;  1BW5 A;  3M3Y J;  4ABZ A;  4IHW A;  3JRH A;  2N8G A;  3HB9 A;  2P81 A;  2M8G X;  1AU7 A;  2JA6 J;  3RKQ A;  4BKX A;  2HXI A;  3CCY A;  3B6C A;  2X9D A;  5F1J A;  5C3E J;  2E1O A;  4XK4 A;  3LNQ A;  2O9L A;  3MVP A;  2ME0 A;  2G0E A;  2LLK A;  2CRG A;  3HOY J;  1LE8 B;  2QF7 A;  1XG1 A;  2ECC A;  2WAQ N;  4DYR A;  1MSE C;  2GLO A;  1S7E A;  1TWG J;  4C2M J;  5GPC A;  4XRM A;  3S1N J;  4FCY A;  2AHQ A;  1QVT A;  3H3V K;  1OJL A;  4A3F J;  2CU7 A;  1PUF B;  2Y9Z A;  4HNV A;  1Y1V J;  1QVU A;  1Y1W J;  5JLX A;  4Y52 J;  4M6V A;  2K40 A;  2IAI A;  3S2H J;  2JJ7 A;  4W97 A;  4BY7 J;  5EG0 B;  1HOM A;  1X2M A;  4I76 A;  5C44 J;  2M34 A;  3BTC A;  3JRF A;  3S1M J;  5M3F J;  2DA3 A;  2L7F P;  3A01 A;  2L7Z A;  1JKR C;  1JUM A;  1OFC X;  3LSP A;  2NS7 A;  3BG5 A;  1B8I A;  1Z77 A;  2XSD C;  4FIS A;  3FIS A;  3RQI A;  3A02 A;  3MN2 A;  4AC0 A;  2ECB A;  3QPS A;  5FKL A;  5BNG A;  3GTG J;  1WI3 A;  1MBF A;  2XB0 X;  4XID A;  1VF9 A;  4JX4 A;  1ZQ3 P;  3WHC A;  1B72 A;  2K9N A;  2R5Z B;  4EEF G;  3ZOB A;  4A3M J;  2Y31 A;  4IEJ A;  2HQ5 A;  1WCM J;  2ELK A;  3S16 J;  5EYR A;  3JRI A;  1JT0 A;  1GDT A;  2R93 J;  3FIW A;  2XGD A;  4IHX A;  1BW6 A;  2HXO A;  4QTR A;  5EGO A;  9ANT A;  3O8G A;  1A5J A;  4V2F A;  3SJM A;  4JX6 A;  4DZJ A;  2XGC A;  5IPA A;  4X6A J;  2COB A;  2W48 A;  3C2B A;  3ZQL A;  4BY1 J;  3FK6 A;  5EDN A;  2VKV A;  2ME6 A;  1PUF A;  1ZR2 A;  4UUT A;  5IYB J;  5E3L A;  2YS9 A;  5DTD A;  3I4N J;  3QQA A;  1F43 A;  1APL C;  1IDY A;  5E3M A;  1HF0 A;  1U78 A;  3HOX J;  3TP0 A;  5IOY A;  3HOU J;  3HGY A;  1GV2 A;  1AHD P;  4A3D J;  1T33 A;  2MGQ A;  3GTP J;  3A01 B;  1B8I B;  2E2I J;  4QIW N;  1XC5 A;  5DS9 A;  5J1Y A;  1MH3 A;  2DTZ A;  1POG A;  2HOS A;  1IRZ A;  1YRN A;  2FJ1 A;  3OSF A;  1ETX A;  1LFU P;  2XGE A;  1BL0 A;  1IV6 A;  3Q0W A;  4Y7N J;  3RZD J;  2L9R A;  2LR8 A;  2XPW A;  3O8H A;  1JGG A;  3JR9 A;  2DMP A;  3BR6 A;  2DMQ A;  2KT0 A;  4JYK A;  4B3A A;  2WV1 A;  2I10 A;  3ZQI A;  1JUP A;  3BQY A;  2R5Y A;  5IYD J;  4W1U A;  1MBH A;  2ZB9 A;  1Z0X A;  2EZK A;  2NVQ J;  2JK3 A;  1O4X A;  1W0T A;  3S14 J;  2DA7 A;  5EGO B;  5E3O A;  1MNM C;  4CYC A;  2OPT A;  4AUX A;  2OF7 A;  1XS9 A;  1IJW C;  2HYJ A;  4M3D A;  3CMY A;  3JRB A;  3S1R J;  3HM5 A;  1FTZ A;  3WHB A;  1NTC A;  1FJL A;  1IDZ A;  1TWF J;  2MW8 A;  2M9H A;  1JJ6 C;  1BA5 A;  2JMW A;  3SFI A;  4XRS A;  1U8B A;  1SFO J;  1P7J A;  3S15 J;  1DU6 A;  2YU9 J;  3NAR A;  1ETK A;  1K83 J;  4BXX J;  2EBI A;  2DA1 A;  1VND A;  5J3L A;  3GTL J;  2DA6 A;  2O7O A;  5IP9 J;  3RZO J;  5K7F A;  1MBJ A;  1Q1V A;  4M3G A;  5FKK A;  1ITY A;  3K2A A;  2FQ4 A;  1JTY A;  5FLM J;  2TCT A;  2NOG A;  1X58 A;  1IC8 A;  3M4O J;  1OCP A;  1WH5 A;  1YRN B;  4A3B J;  3BTL A;  5EF6 A;  3PO2 J;  3UKG A;  5E3N A;  4IHY A;  2LFB A;  4A3L J;  2CQQ A;  2VUM J;  1IUF A;  2CUF A;  3LSJ A;  5J1U A;  1GV5 A;  3ZQH A;  5F0H A;  5IP6 A;  3IV5 A;  1ZTR A;  2EH3 A;  3BR1 A;  2R5Y B;  3FK7 A;  4A3J J;  5F0F A;  2PMZ N;  2X48 A;  4UUS B;  3FKI J;  4DYC A;  1HDD C;  3LOC A;  1JKP C;  4CYC B;  2AO9 A;  2CJJ A;  3Q0U A;  1ORK A;  1VFC A;  1U9O A;  2JWT A;  2VPR A;  5IP7 J;  4M3E A;  3SDG A;  2JA5 J;  1RET A;  1JKO C;  1ENH A;  2RAE A;  2K9S A;  3OSG A;  3HOV J;  3L1P A;  5K7Z A;  1MSF C;  3GTJ J;  2HOT A;  4D7M A;  4JP0 A;  2MG4 A;  2E2J J;  5FKO A;  3DEW A;  3Q0V A;  2Y30 A;  5M5X J;  3TW6 A;  2L7M P;  2NS8 A;  1H89 C;  1ETY A;  3HKZ N;  1AKH A;  4A69 C;  3ZQF A;  1JUS A;  4JX5 A;  3BR2 A;  1JTX A;  4MIM A;  3GTM J;  5C4X J;  3S2D J;  1RR7 A;  3MKL A;  5M5Y J;  3ZQC A;  2FD5 A;  1R9T J;  3HOZ J;  5EEA A;  1GUU A;  2EZI A;  4S0H B;  1RKT A;  3F0C A;  2DN0 A;  1QRY A;  1RES A;  1A6I A;  2GBY A;  2EQR A;  1FIA A;  3OIO A;  2DA4 A;  2R0Q C;  3S17 J;  3G1O A;  3H0G J;  2YUS A;  4MFE A;  3IH3 A;  4C3I J;  4UUS A;  3GTO J;  3BTI A;  4QSH A;  3E7L A;  1ZKG A;  2JN6 A;  4MO7 A;  2VI6 A;  3K7A J;  4FE7 A;  1TWA J;  1IG7 A;  1GT0 C;  2LY9 A;  2KDZ A;  4L5E A;  4MLO A;  3JRA A;  1ETW A;  2Y9Y A;  4FTH A;  2R7Z J;  3JRG A;  4C3H J;  1CQT A;  4BBR J;  3TP3 A;  4D5F A;  1LFB A;  2EZL A;  5GP9 A;  2XRL A;  1HDP A;  5J1R A;  3VPR A;  4C3J J;  2NVX J;  2GM4 A;  1RPW A;  3JRE A;  1I3Q J;  2ID3 A;  3HOW J;  2QCO A;  3DCF A;  1AKH B;  2HOA A;  4I6Z A;  2X6O A;  2LTP A;  2DMN A;  1EF4 A;  3G1L A;  1HCR A;  1VI0 A;  1E3O C;  3CDL A;  1DU0 A;  2K9Q A;  2LP0 A;  3LSR A;  4A3E J;  4AYB N;  3CQZ J;  1TC3 C;  5F08 A;  2Y0S N;  1T56 A;  5EZH A;  1W0U A;  2L0K A;  2HI3 A;  2Y2Z A;  1ETQ A;  4A3K J;  1MBK A;  1HLV A;  4M3B A;  4A3C J;  4DYQ A;  1D5Y A;  5EZG A;  3IH4 A;  3I4M J;  2H1K A;  4X1E A;  1TWC J;  5GPA A;  3BR0 A;  5FKM A;  5FLV A;  3TED A;  4A3I J;  3JRD A;  2XPU A;  4B4C A;  1FEX A;  1K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...