1NK2P

Vnd/nk-2 homeodomain/dna complex, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*GP*TP*GP*TP*CP*AP*AP*GP*TP*GP*GP*CP*TP*GP*T)-3
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1nk2P00
3BG9A 5GPAA 2EBIA 3HKZN 3S17J 5DS9A 1H88C 3MN2A 2P81A 1PUFB 1K83J 1Q1VA 5EGOB 2LTPA 2Y9YA 2DN0A 2R5YB 3S2DJ 1B8IB 2LKXA 1QVUA 1ENHA 3S1QJ 2M34A 2LR8A 1G2HA 2DTZA 4NDLA 3PM1A 1RESA 2KDZA 1TC3C 5F0CA 1FIAA 3S14J 1IUFA 3CCYA 3GTOJ 2E2HJ 2XPUA 2OF7A 4FTHA 2Y0SN 3BT9A 2MG4A 2MSYA 4UUSA 3JRBA 2QCOA 9ANTA 3HOVJ 2R5ZA 3BG5A 3BTLA 2R92J 4M3BA 1JUSA 5FKLA 1MBHA 3IH3A 1FIPA 1HDPA 2CRGA 2FQ4A 3JRCA 3HOXJ 4A3FJ 4A69C 4LOCA 1OJLA 4W97A 2EH3A 5F0FA 1GV5A 3OSGA 1AKHB 2I10A 2NVQJ 1WPKA 2X48A 3PO3J 1VNDA 4JYKA 3ZQFA 1IJWC 5F1JA 2G0EA 1APLC 4D5FA 1P7IA 2HYJA 2M2EA 3SJMA 1WCMJ 1UG2A 1JJ6C 1ETKA 2DMQA 4M6VA 2DA7A 3BR6A 3I4NJ 2JA7J 3S2HJ 2EQRA 2QF7A 4V2GA 2YU9J 1MNMC 2O9LA 2E2IJ 3BR5A 4GFBA 2AO9A 2LK2A 3NARA 4M3GA 1VFCA 3HGGA 2ID3A 1F43A 1OCTC 1HLVA 2NS8A 1MH3A 1IDZA 3G1MA 3OOUA 3B6CA 4CYCB 4BBRJ 2XGCA 2YUSA 4RDUA 1U9NA 2IAIA 2Y31A 2RAEA 1AHDP 2N8GA 2GLOA 4QTRA 3JRHA 1A6IA 1CQTA 2DA4A 1IG7A 3JRAA 5C4XJ 4M3DA 1WGXA 4JP0A 1BW5A 2HQ5A 5E3LA 3ZQGA 4MFDA 5M5WJ 4MIMA 2ECCA 3H3VK 5EYRA 5EF6A 3A01A 1TWHJ 5IP7J 2XB0X 2ECBA 4I76A 5E3NA 3LSPA 1MSEC 3S16J 2EZIA 1YRNA 3W6VA 2R0QC 2GM4A 2HOAA 3ZQCA 2AHQA 4ABZA 3JREA 3MVPA 4L5EA 1DU0A 4IHYA 2JJ7A 1JUMA 1TWFJ 1SFOJ 3BR0A 4A3GJ 2PMZN 3LOCA 3B6AA 1FJLA 4S0HB 2Y2ZA 1JUPA 2X6OA 4J19A 3FKIJ 5DTDA 2YS9A 4D5CA 4AC0A 5EDNA 3A01B 1ZQ3P 1NK2P 2DMUA 4DW6A 2X9DA 1JTYA 1TWCJ 5EEAA 5C3EJ 1JKOC 3QPLA 4X1EA 2CUFA 2CUEA 5FKMA 3LSJA 4MFEA 1MBJA 1JJ8C 1GDTA 5K7FA 1XC5A 1IGNA 1ETYA 4JX6A 3BTJA 1JT6A 5GPCA 1PUFA 4XK4A 1IV6A 4FE7A 2LLKA 3HOWJ 5K7ZA 4XICA 3I4MJ 2KT0A 1D5YA 3M4OJ 3S1RJ 4QSHA 1ZK8A 3JRIA 3PO2J 1GVDA 2OPTA 2XGEA 3OSFA 5M5YJ 1S7EA 2JN6A 3OIOA 1MH4A 3LSRA 2M9HA 5FLMJ 4Y52J 3CMYA 1HOMA 2CQXA 3IH2A 2E2JJ 4D7MA 1GV2A 2FX0A 1LFUP 3HOUJ 4JX4A 3SDGA 2L7ZA 2FJ1A 2JA5J 3ZQLA 2HDDA 2R7ZJ 1W0UA 1A5JA 1X2NA 3TW6A 4A3BJ 3DEWA 3HDDA 1Z77A 2B63J 3GTMJ 2TRTA 2VKEA 4A3KJ 3QPSA 3K2AA 3HM5A 1X2MA 5M3FJ 1JKPC 3O8HA 1ZR4A 1B8IA 4XRSA 4G12A 4AUXA 5IOYA 2LD5A 1FEXA 4IHVA 1LFBA 5F27A 4B4CA 4C2MJ 1Y1WJ 4X6AJ 1U78A 4QIWN 3M3YJ 2DMNA 4DYCA 2JK3A 5JLXA 2XB5A 4DZPA 3BQZA 1E3OC 3NAUA 3HGYA 2CJJA 2M0CA 4A3JJ 2JMWA 1QRYA 2L7MP 3E7LA 2L7FP 1WI3A 3VPRA 4AYBN 3SFIA 4A3MJ 5IYCJ 2VI6A 3Q0WA 4FISA 1X58A 4C3JJ 5C4JJ 5FKKA 1FTTA 4A3DJ 2LFBA 1EF4A 3BQYA 4DYQA 2CU7A 3L1PA 5FKNA 1JGGA 2MGQA 3F0CA 4BY7J 3D1NI 1LE8B 2HOTA 2DA3A 5K7HA 4A3EJ 1HDDC 4FCYA 3GTPJ 2FD5A 2ZB9A 3FK7A 5E3MA 1SANA 4RBOA 2ME6A 2VPRA 1MBGA 1K61A 1JKRC 1JKQC 4IHXA 4XRMA 4BBSJ 3GTGJ 5F08A 3JRDA 5EGOA 5F04A 2HI3A 4C3HJ 2JA6J 1W0TA 4A3CJ 2XPVA 1WH7A 1POGA 2K40A 5FJ8J 1ZGWA 2LVSA 1H8AC 1ETQA 1ETXA 4XIDA 1AU7A 1BA5A 2DJNA 2EZHA 5J3LA 3TP3A 1MBEA 3BR2A 3ZQHA 3A03A 3LSGA 5EG0B 4IHWA 1MBFA 1BL0A 1XG1A 2H8RA 3IH4A 1ETWA 4M3FA 4D7NA 2JA8J 5J1RA 5JLWA 3MKLA 1MSFC 3HOZJ 1OCPA 1TWGJ 1HF0A 2XPWA 2WAQN 3RQIA 5HODA 4C3IJ 1FTZA 2ME0A 4B1RA 1Z0XA 2COBA 1JTXA 2VUMJ 1Y1VJ 3CQZJ 5IYDJ 3S15J 1MBKA 2IBDA 2O7OA 2Y30A 1TWAJ 4UUSB 3GTLJ 3GTQJ 4HNVA 3RZOJ 2NOGA 5IPAA 5IOZA 2JWTA 5FKOA 1ORKA 5E3OA 1IRZA 4M3EA 3WHCA 1ETOA 3TEDA 2XSDC 1O4XA 1U8BA 5C44J 2DA1A 3TP0A 2HXOA 1VI0A 3HB9A 4BKXA 2R93J 3BR1A 3K7AJ 5IP6A 2LP0A 2HOSA 4UUTA 1NK3P 3ZOBA 2ELKA 4EEFG 1I50J 5GP9A 5EZGA 1ETVA 2CQQA 3IV5A 1B72A 2WB1N 2WV1A 3DCFA 3JRFA 4A93J 1QPIA 3ZQIA 3JR9A 2NVTJ 3FK6A 4A3LJ 2IEKA 2E19A 2EZKA 3O8GA 2TCTA 3BR3A 3GBGA 5M3MJ 3Q0VA 1I6HJ 3H0GJ 2DMTA 4V2FA 4XRSG 1RPWA 5J1YA 2DA6A 3G1LA 2K9NA 1UMQA 1R9TJ 4B3AA 1RKWA 4DYRA 3UKGA 2K9SA 1UHSA 2LY9A 2NVXJ 1T56A 4FE4A 4IEJA 1NTCA 1RETA 2R5ZB 5F0HA 3GTKJ 5IP9J 2HXIA 1IDYA 5J1UA 1XS9A 2O8KA 2R5YA 1H89C 1ZR2A 3TW7A 1RR7A 2L0KA 1DU6A 2Y9ZA 5BNGA 1RKTA 1YRNB 3QQAA 4CYCA 2K9QA 1JT0A 1GT0C 3HEFA 5FLVA 1I3QJ 1U9OA 2M8GX 2MW8A 2DMPA 3Q3SA 1T33A 1WH5A 4A3IJ 3S1MJ 3CDLA 3RZDJ 1QVTA 4BY1J 2EZLA 3G1OA 3RKQA 1AKHA 2NS7A 4BXXJ 1BJZA 1ZTRA 3LNQA 2XGDA 2D5VA 3BTIA 2NVYJ 3A02A 3FISA 1B72B 4DZJA 4JX5A 3Q0UA 1LE8A 3GTJJ 5M5XJ 2H1KA 4MO7A 2W48A 4Y7NJ 1P7JA 3C2BA 1VF9A 4W1UA 1BW6A 1HCRA 2DA2A 2L9RA 1OFCX 3WHBA 3BG3A 5EG0A 5EZHA 2XRLA 3HOYJ 2E1OA 4I6ZA 2GBYA 3FIWA 3HBLA 3BTCA 2DA5A 1GUUA 1ZKGA 5IYBJ 1ITYA 2VKVA 4MLOA 3S1NJ 3JRGA 1IC8A 2ID6A 1F36A
chains in the Genus database with same CATH superfamily
3BG9A 5GPAA 4L5JA 3CP2A 3T1BA 3HKZN 4ZYEA 1H88C 2H94A 2MABA 1Q1VA 4UVBA 1L3LA 2R5YB 4K2EA 4RAGA 4RB1A 3S2DJ 1F1ZA 4A0XA 1B8IB 1Z91A 1QVUA 5D6EA 1KYWA 2LR8A 1YX3A 3HHGA 5H20A 4A0YA 1IUFA 3CCYA 3GTOJ 2ZXJA 2ZJQF 1WWXA 1KU9A 3HYIA 3IRQA 4Y4RA 3KZIC 1JUSA 3J80Z 4AVPA 2V6CA 2IS4A 4ANJA 3JRCA 4PFOA 4A69C 4LOCA 1OJLA 5J40A 2EH3A 5F0FA 2Y69H 4NUBA 1AKHB 3HPGA 3PO3J 3HSRA 1VNDA 5D5WB 5AONA 3CMAI 1XPXA 2LDUA 5L3GA 1I5ZA 2ZCWA 2RDPA 4IX7A 1A6QA 1KU2A 3M1EA 5F1JA 4A5NA 5LFAA 2BHZA 2CUZA 4D5FA 1P7IA 1IN7A 2HYJA 4UB8C 1SFUA 4LLNA 1RIOH 5BS6A 1UG2A 3F23A 1ETKA 4JOMA 4IRHA 3FF5A 4M6VA 3TMOA 3DTIA 3ONQA 3BLYA 1QHHD 3WTWC 2ELJA 3KZZA 2QF7A 4V2GA 4FT8A 3DPLC 3OIQA 4EJOA 1X1CA 3OYHA 2M45A 2AO9A 4ENJA 5CJ9A 4M3GA 4KT5C 3AAFA 2ID3A 2NAZA 1J5YA 1OCTC 4IRIA 1BIBA 1MH3A 2FF4A 1HW2A 3CCUI 2K4BA 2FU4A 3G1MA 1JHFA 5FD6A 4XKCA 4BBRJ 2YUSA 3BJ6A 2XGCA 3KPHA 4RDUA 2RAEA 1XGNA 4BE0A 1AHDP 2N8GA 4BXFA 2GLOA 2A6EF 4QLCU 2AQEA 3A1YA 3V7SA 4U0YA 4GRIA 2V4JC 5KCMA 4YFKF 4M3DA 1R22A 2XGXA 1WGXA 3SQNA 4UUVA 2HQ5A 3SEZA 2V1XA 4NQWB 4MFDA 5M5WJ 3ZN0A 4BL0B 2GXBA 1VZ0A 2IJLA 2BOLA 3CMMA 4HX4A 1TWHJ 3A01A 4FETA 4CCKA 2ECBA 4LGWA 4C9YA 5E3NA 1R5ID 3FMRA 4L9NA 5B1BH 3LSPA 3H36A 3L09A 2L2OA 2DOAA 3S16J 2JRMA 3BCAA 1D0ZA 1Z9CA 1X1DA 2R0QC 1YIOA 2H8WA 2A5YB 3CUQA 1B9MA 2AHQA 2PMUA 1SVMA 4M73A 4PK4A 1DU0A 1JUMA 1T0FC 2M4KA 2XVCA 4CUGA 2XRNA 4XLCA 3S2WA 3BJOA 4QPOA 2YS9A 4AC0A 1I3AA 1IN6A 4F52A 2IPQX 1N78A 2GQQA 2X51A 3SZTA 3A01B 3CCJI 1ZQ3P 2ISZA 3HZJA 2LKPA 2V26A 5EEAA 5C3EJ 1V5GA 2JZYA 2BY3A 2CUFA 3EDPA 1G6NA 1Z67A 4AIHA 2R7VA 2KHMA 3WE2A 5L3CA 2DO7A 1MBJA 1F9NA 2VBWA 3NWSA 3I9V2 5DD4A 5TGTA 4XN3A 1PUFA 1LQ1A 4I7HA 5DCMA 2OA4A 5EJCA 3HOWJ 2GZWA 2OTJI 2ESNA 3K70C 4AD9A 2E71A 2KIQA 3RJPA 1UELB 2E7XA 3S32A 1KQ8A 4B47A 3JRIA 2XGEA 3MMYB 1S7EA 3F3XA 3DXJF 4KFCA 3CCMI 2BV6A 3LSRA 5ILSA 3JCUC 1X19A 3O2PE 5FLMJ 3S8PA 2DFIA 2BW3B 2ZC2A 5E1XA 1EA3A 2VB6A 3BROA 1HSTA 2JUCA 2V6EA 3DV8A 3KEQA 3ZQLA 2HDDA 1BM9A 4YG2F 2NYXA 4A3BJ 3I56I 1Z77A 4Y17A 5JVTA 4II2A 3QU3A 1LVAA 5B3SH 2QSHX 2B63J 3QP6A 3J7YJ 4G6DA 3K2AA 5H6QA 4GYIA 4N9IA 1X2MA 4EVIA 3JSPA 5CKTA 1QA6A 3R0AA 1IW7F 2DQRA 2KDOA 4XLFA 4XRSA 2VQGA 2KZVA 4OU0A 1LFBA 4C2MJ 3OS2A 2MYSA 2KMUA 4CCLA 1Y1WJ 5LBQA 4QIWN 4CICA 3AG3H 1E3OC 3R60A 3NAUA 3HGYA 3WTUC 2CJJA 4A3JJ 2JMWA 4RAZA 2LH9A 3ZCOA 1A35A 4KNYA 3K70D 1WI3A 3P9CA 4WWCA 3WTVC 3W3CA 3L2VA 4A3MJ 3ECOA 1FYKA 1W7PA 3ASOH 3Q0WA 3IKTA 2JPCA 1QQIA 2ZJ2A 4MTDA 5JVGF 1T8IA 1ZHFA 1ACIA 1WJ5A 2V9KA 5LRSA 3U9GA 1YQAA 4U0WA 4HNUA 2B7EA 4DYQA 4UHTA 2CU7A 2LY2A 1LDJA 2XASA 2VQHA 3EUKL 4YIIA 5DCMB 2ZSIB 3JAMK 3VODA 1S3JA 2COMA 3FMQA 3HSFA 5K7HA 4KN4X 1YLFA 2F5FA 3U21A 2A3SA 4DQ2A 3DBHB 4I01A 3QYBA 1JXSA 1JKRC 4IHXA 5F08A 5EGOA 1Z6TA 2HVRA 1ZGJA 1W0TA 3NEUA 2IA1A 3CJRB 1POGA 1A31A 2DT5A 2K40A 5FRNA 3QODA 2VPLA 4ETSA 1U6GA 2RGVA 1XMAA 5FJ8J 1FP2A 2LVSA 3RTRA 1AU7A 3BDDA 4EJWA 1OCZH 3IP4B 1BA5A 3FXJA 2KFDA 5GAGJ 3CCLI 3KIOA 1MBEA 3BR2A 4IPAA 2QSGX 4HDUA 3VWBA 4IQJA 1BL0A 4NQWA 4MHGA 3CUQB 3DEEA 2W57A 3IH4A 1WFXA 2JA8J 5JLWA 3LA2A 4BACA 4CCJA 1MSFC 2L7KA 1U5TB 3OYKA 5K5RA 5LHHA 3CZ6A 3GFJA 2EFPA 1JTXA 3WU1B 3P9KA 2PG4A 3CTAA 4FHTA 4Y33A 3KLOA 4M71A 2A5WA 2Y30A 2V1DA 3WTZA 4BS9A 3ZMSA 3GTQJ 3EYIA 4P1WA 1O3RA 2OAZA 2NOGA 2PJRA 3E6MA 1JE8A 2CV0A 1IRZA 2J5PA 4GCVA 3WU2C 2KL4A 4Q48A 3F6OA 4CDGA 3BG6A 2DU9A 3E6CC 4ZZLA 2VQCA 2K3PA 4BU2A 1WSUA 1TLHB 1C0WA 5HNFA 1O7LA 1PJRA 3HB9A 3HPHA 2R93J 3BR1A 5E1ZB 5E8IA 4FASD 2ZMEC 1H0MA 3I55I 2DOFA 1VTNC 1K6OA 2WAQA 2ELKA 2O0YA 4KIFA 3TO6A 4EEFG 2HDCA 2M1BA 2FBHA 3IV5A 4IL6C 3HRMA 3RKYA 4IRGA 2G9WA 5GTHC 1IF1A 2Z16A 3JR9A 2NVTJ 5HNHA 3DKXA 1MJBA 1PP8F 3F6VA 2TCTA 3K1MA 4BJTA 1Y0UA 2P0WA 5A2QZ 4V2FA 2H6CA 3OR2C 2KIMA 1RPWA 3ABUA 4HSRA 4NC8A 2DA6A 5LGNA 1QZZA 3NWTA 4HX8A 5JFRA 2W4SA 2O61A 1YW9A 5E18F 2P5VA 1YFHA 4EJUA 1UHSA 3QAHA 3MKYB 2LY9A 3FX3A 4NHJA 2FMLA 5HOOA 4R1HA 1RETA 1QPMA 2EV5A 2DFEA 2R5ZB 1K4SA 1SC7A 4U88A 5IP9J 1UB9A 5BOXA 1XS9A 5L3EA 3T8RA 1YS6A 4L5IA 5IT9K 2DQLA 4M72A 2Y75A 1RKTA 1YRNB 1U5TC 2CW0F 4XKVA 2K9QA 1GXPA 2MD0A 2XKPA 1YJWI 1GT0C 2DT7B 1R4NB 2UXXA 1I3QJ 2LBFA 3GZ6A 5FFZA 2MW8A 3S3NA 2R7UA 2CFOA 1FSHA 5DUIA 1WH5A 2QSFX 3UNGC 3CC2I 4BAYA 1SD4A 1LDKB 1XCBA 2FA5A 3CDLA 3DTKA 3RZDJ 2WB1A 4P5OA 4BHBA 3RKQA 1AKHA 2Z2SB 1TT0A 5J8CA 1U3EM 3PUBA 2LF8A 3ZMDA 3BG7A 2XGDA 1ONVA 1R4MB 1VQ4I 4F55A 3FBIB 1B72B 2CUJA 3IAS2 3IUOA 1CGPA 1DDNA 4B44A 2KQRA 4LJZF 4L18B 2EILH 3C2BA 2BXZA 4LLGF 1S7AA 2F5DA 1LDDA 4YIRX 1V3FA 2XDVA 4RB0A 1P9QC 3WG7H 2Z99A 3CESA 2GBYA 3FIWA 4RGUA 3HBLA 1OYIA 1Y8RB 1GUUA 2FQ3A 4MLOA 1IN5A 1IC8A 2CH0A 2QGUA 2ZXIA 2JVGA 2JVHA 2LG4A 2OU2A 3ZMZA 4ZDLA 3K4KA 3HUGA 5DS9A 3AG2H 3S17J 1PUFB 2P81A 1S29A 1K83J 4RM3A 2KIUA 2DN0A 4HDVA 2XF5A 2XAJA 2GIZA 4NDLA 4RB3C 1FT9A 1J2XA 2XAGA 1FZPB 2R4GA 3S14J 4ZYDA 1RNLA 2CS3A 3WODF 4EJTA 3P5JA 2E2HJ 2XPUA 2OF7A 4IHSA 2Y0SN 2MG4A 4UUSA 1HQCA 2QCOA 9ANTA 2PFBA 3TO7A 2ZNZA 3HXLA 3V7RA 3HOVJ 2F5CA 5KHDA 4P9UA 5H2FC 2LOOA 2HZTA 4LG0B 2VJ4A 2KRHA 4G6QA 4HLXA 4M3BA 4ZJZA 5FKLA 2CQKA 1MBHA 3IH3A 1FIPA 1HDPA 5L3FA 2W25A 4LFUA 3VYTB 4W97A 5E17F 1YX5A 1GV5A 3ASNH 2L01A 2NVQJ 5LEKA 1SVOA 2X48A 3OS1A 2ZXHA 2GAUA 3ZQFA 4ASNA 2M8EA 1O3TA 1WI9A 3S3MA 1IJWC 2CW8A 3CLQA 2ZJRF 2PJRB 1P4XA 5LGTA 3SJMA 1R5GA 4OMYA 1WCMJ 4RM2A 3I54A 2XF6A 2DW4A 3FHNA 3E97A 2AQFA 2F2EA 2XIGA 1KZHA 2OUMA 3BR6A 2OV7A 5GADJ 1ZARA 3BC8A 2HQRA 3PJRA 3S2HJ 3F8FA 2E1MB 4A0ZA 2LY1A 1KYZA 2JSCA 3CF2A 3KP6A 2A05A 2O9LA 3QP5A 3FXUA 2VJ5A 5AIQA 4A6EA 1D1AA 3OR1C 1G3WA 2A07F 1FMVA 3PFYA 2LK2A 2IXSA 3NARA 2DLLA 2QQ9A 1W7PD 1J59A 4HNTA 1TW2A 1HLVA 3CCVI 4E4HA 3H9JA 4HQEA 3OOUA 3LMMA 2BZTA 2IAIA 2BY1A 1J09A 3H5RA 1E2XA 3W2WA 4IVNA 4BH9A 4KITB 3ABLH 3JRHA 1CQTA 1J0RA 3JRAA 3K1PA 3HL2A 3IWFA 1A36A 5HS8A 1U0JA 4JP0A 3GF2A 3HHHA 5D5XB 2IS6A 4II3A 1V54H 2LC2A 2ECCA 3H3VK 3FM5A 5EYRA 5EF6A 3GX4X 5IP7J 4LIUA 2XB0X 4I76A 3WG9A 1IV8A 3LL7A 4EGZA 1RUOA 3OL3A 1SAXA 2O8XA 2HOAA 4PJMA 3O6BB 5FO5A 4E7SA 1UJ8A 2FOKA 4ABZA 4IHYA 1LB2A 2HQNA 3TL4X 3BR0A 5JHUA 2GXGA 3LOCA 1FJLA 2P6TA 2Y2ZA 4ZTJA 4ZTFA 2OBPA 3T8TA 3WE3A 3ZGKA 4F92B 1NK2P 3E6BA 1JKOC 3QPLA 2MC3A 3CF5F 3Q9SA 5FKMA 4ENMA 2EIKH 1JJ8C 4XLEA 5K7FA 1GDTA 1D0XA 4JX6A 3BTJA 4LD5A 2HVQA 1DGWY 3CDIA 3ML6A 4FE7A 2KRFA 3ERED 2B9SA 3KFWX 3UR3C 1ZRDA 4XICA 3I4MJ 2KZGA 2KT0A 2DOEA 3S1RJ 4QSHA 2ZMEB 3MZ8A 2K9MA 4WXHA 1SAUA 2W82A 2ZSHB 3DPUA 4HF0A 4CSWA 1BC8C 3PO2J 2OPTA 3D5LA 2E35A 2PN6A 2YR2A 3OSFA 5M5YJ 1V5FA 3OIOA 1MH4A 3LA3A 1KONA 4Y52J 1HOMA 4PJJA 4XR6A 3F21A 1BJAA 3IH2A 4P96A 4Q47A 1UAAA 2BW3A 3E1SA 1R6RA 4XLNF 3SDBA 4BQQA 1VQOI 3HOUJ 3VEPA 2EJRA 2CFXA 3FZVA 4RA2A 3X2QH 4CCMA 2QEXI 1XSDA 4NNJA 3BP8A 1UHMA 1W0UA 1A5JA 3J7AY 1T39A 3S3OA 1KGSA 1OR7C 2TRTA 2KKOA 2BY2A 1DQUA 3TBIA 3C2HA 1OCOH 2QLZA 3QPSA 4IOCF 2F4OB 3NQOA 1F4KA 3O8HA 1B8IA 3GZ5A 2MFZA 3CJTB 5D8LB 5F64A 2ZBKA 4G12A 4ENNA 1ZG1A 1IXSB 1P6RA 1SFKA 4B4CA 2YX7A 3V8LA 4HRIA 4A5MA 1U5TA 2VT2A 4EM0B 1U78A 4X6AJ 2OCCH 3M3YJ 2DMNA 4BHPA 2RN7A 1HC8A 5JLXA 2XB5A 1QU3A 1WHUA 3HSEA 1T2KA 2M0CA 3K69A 4NC7A 4BHCA 2L9SA 1FOWA 1PP7U 2L7FP 3VPRA 1T98A 1ON2A 3CUOA 1XTAA 2OQRA 3OYIA 2F4MB 3M07A 3SFIA 3O3KA 5IYCJ 3REOA 1Q1HA 3RPUA 3K4MA 4FISA 1EH8A 5CVVA 4C3JJ 5C4JJ 3K10A 2MLGA 4HA8A 3RDIA 1FTTA 4A3DJ 3LSHA 4AU7A 2OTLI 2STWA 1EF4A 1BI3A 4HPQA 1X1BA 4XBFA 4IZZA 2V1NA 4M9XA 1TZLA 5HDKA 1BI1A 2Q2EB 1LE8B 2DA3A 1KU3A 3DKYA 2KISA 2FUG2 1OMIA 3GLXA 3GTPJ 2ZB9A 3FK7A 4G8XA 1SANA 4OOIA 4IKFA 2ME6A 3DF8A 3GEZA 1MNEA 4HV5A 1S5LC 4XRMA 5LRRA 3MAJA 2FNAA 4C3HJ 1MDMA 1ZRCA 2HOEA 3K4CA 2F4IA 5ILVA 2UV1A 5HLIA 3TQNA 1HKQA 1MMNA 1M1EB 2STTA 5LHIA 2J5OA 1W5TA 5KK1A 1H8AC 3BOQA 4F91B 1DP3A 3FXRA 1ETXA 2CGPA 2DJNA 3TP3A 4LMYA 2GWRA 3SXYA 4IHTA 1MBFA 3H5NA 3PSIA 2ZXWH 3FBNB 2EFNA 1IRFA 1ETWA 4M3FA 2A69F 3I5UA 3HOZJ 5D5VB 4PCQA 1HF0A 3D5SC 4DBQA 4PUSA 1LNWA 4BE1A 5HODA 3EYYA 2QZ8A 4C3IJ 3BCBA 2CV1A 3I59A 1W1WE 2CSOA 4G7ZF 2ME0A 2D2WA 1Z0XA 3L9FA 1Y1VJ 2GIVA 3HUGB 2FOWA 2KRCA 2DDAA 2O7OA 2O5RA 2I8DA 1K7AA 2LMDA 3ERMA 1OPCA 4E7JA 3G2BA 1X3ZB 5IOZA 3CUQC 2JWTA 5B5EC 1QO0D 3DLAA 1CF7A 3RIRA 3CP8A 2OC6A 4M3EA 2VC1A 3M7GA 3RI4A 1FOKA 2JQ7A 4M9SA 3G71I 3B73A 3K4BA 1SMYF 3DBLB 3ZMUA 2DA1A 4LB6B 2LREA 2HXOA 4RGRA 2EIMH 2BEOA 1R00A 4KUMA 4BKXA 2FEZA 2XAQA 5KAFC 5IP6A 1XD7A 2GA2A 2QM3A 3J80K 3J81K 2BHYA 3ZOBA 1I50J 5GP9A 2WAEA 2YSRA 4EATA 1ETVA 3L2RA 3F72A 1JI8A 2WB1N 2XC7A 2LRDA 4RGXA 5DYMA 2P5LC 3Q9VA 3DCFA 3FXQA 2R7QA 1SD7A 3KLNA 1MJAA 3BZ6A 3BPXA 3ZQIA 3FK6A 4YIFA 2WAFA 4G7HF 5FFXA 4CHUA 3BR3A 3R0JA 3Q0VA 1I6HJ 4HG2A 4Z2YA 2DMTA 1UG0A 1YI2I 2X1CA 3GLLA 4HAMA 5J1YA 1FBSA 2K9NA 1RC9A 4U7DA 1MJ9A 3BJAA 1KQ9A 1FBQA 1LUJB 2E1MC 4J01A 2Z3YA 1AA7A 1DUXC 3IHUA 1ON1A 3UKGA 3H1CA 2UXNA 3IL2A 2H6BA 2DPDA 4HF1A 1NTCA 2BYVE 2DI3A 4XKWA 3E5QA 1MKMA 4JBAA 3M8EA 4U87A 1LFPA 2XAUA 1Z6RA 1VQLI 4UVCA 2VOPA 2HXIA 3WGHA 4FX0A 5J1UA 1KQ0A 1ZR2A 2X6XA 3OYDA 3TW7A 4XSZF 4ZDOA 1DU6A 2Y9ZA 4BJ5C 4WF2A 1UCRA 1LJ9A 2L3DA 1U2WA 5JI6A 2PBIA 1USSA 1JT0A 2C6YA 3V8JA 4PZJA 4KMFA 3IAM2 3KYDB 2NNYA 5JHFA 1JGSA 4Y15A 1R5HA 2K4JA 4BXUA 4EM1A 1S8NA 3A0HC 3I3LA 1O3QA 4BY1J 1MIJA 2EZLA 1FC3A 4XM3A 2NS7A 4XL9A 4BXXJ 4H0EA 4YFXF 2FRHA 4UV8A 3GUDA 3LNQA 2JA2A 3FXOA 1GHCA 3HTSB 3FISA 3H3ZA 1SD5A 3ZQQA 4ZZDA 2HPIA 5K5OA 5HLGA 4XN0A 2H1KA 5F6FA 1P7JA 4Y7NJ 1K78A 1DPUA 1VF9A 2QYOA 4W1UA 4CH7A 1FOYA 2PJPA 2HTSA 3WHBA 3BG3A 5EG0A 5DV5A 4L0ZB 3PIOF 2K86A 3FM3A 3HOYJ 2E1OA 4I6ZA 3CD6I 2VIXA 1IN4A 1MGTA 2KP6A 3PQKA 1X1AA 2DA5A 3IC7A 4UXNA 4N0BA 4BNCA 1MZBA 3S1NJ 2VJJA 1YOVB 3KX2A 4BDZA 3I71A 2DK8A 3AG1H 4XKBA 2DXIA 1TNTA 4F7ZA 1LVKA 2FNPA 4I99C 3MZHA 3GW2A 5FROA 3FMSA 3H5AA 5ERIA 3M1CA 5EGOB 2LTPA 1WJAA 4L9VA 2RQPA 3GVAA 5CVJA 1ENHA 3OY9A 2M34A 3DQVC 1G2HA 3G6EI 3OYEA 4HX7A 2QBYB 1K6YA 2BVMA 2X6WA 4M9ZA 5F0CA 1FIAA 2DJIA 2P5KA 1FP1D 2QKMB 4BE2A 5E8GA 1ZREA 2PX9A 3V8KA 2MSYA 3JRBA 1YE9A 2DTRA 4TV7A 2MA3A 1TP4A 1Z7LA 3TDZC 3BTLA 2R92J 2NS0A 3EQLF 1IUYA 2LNBA 2Z5UA 2IS2A 1FYMA 4CYDA 2FQ4A 3OYLA 4A3FJ 3OOPA 3PSFA 1R1TA 3W2AA 1WRJA 2X1DA 1SFEA 3W2VA 2Y0MA 4UNOA 2NXNB 2K9LA 2ZFUA 1APLC 3VSLA 4GXOA 1N77A 3PFIA 2PLYA 3RKXA 1JJ6C 2DODA 1G8XA 2EFQA 4BQOA 5B66C 2VXDA 2JA7J 4Y13A 2K3FA 1SEUA 2YU9J 2VONA 1MNMC 1IAWA 2E2IJ 4G7OF 4GFBA 1WJBA 3LQRA 2Z33A 2ZKZA 3WU0A 2KJCA 3RPUD 4KIGA 4HEA2 2QWWA 2PI0A 3G4SI 1F43A 2NS8A 2CG4A 3ZXSA 1IDZA 4ESFA 1IRXA 3B6CA 1NG6A 1XMXA 2E36A 1U9NA 4MTEA 2Y31A 2Q8KA 4OINF 1AOYA 1A6IA 2VT3A 1OYWA 2DA4A 4HZFA 5C4XJ 2IW5A 3K1NA 1D3YA 1BW5A 2XAHA 5E3LA 3VSKA 4MIMA 5E1WA 3CO7C 2M87A 1E3HA 1N25A 4AYBA 2OD5A 2HVSA 4KA4A 1I39A 1MSEC 3K0LA 3JSOA 2E1NA 1VQMI 1EKEA 2EZIA 3GCMA 2DFHA 2GM4A 4N9HA 3ZQCA 4V19K 3F22A 4L5EA 1TWFJ 5ICFA 2H09A 2QQBA 2L5QA 5FLXK 4PSWA 2VN2A 3VYSB 2X6OA 1B1BA 2MC4A 3KCCA 3V4GA 5GAEJ 1LPQA 3FKIJ 4D5CA 2M4GA 1ZELA 2RNGA 2M7BA 4PGHA 2IGOA 5DCFA 1R58A 2DMUA 2QVOA 1FPQA 3JW4A 3FXMA 2UZKA 1TWCJ 3GO5A 4E7IA 2D1HA 2FBIA 4X1EA 4WCGA 2ACJA 2F5VA 3LSJA 4CZZA 2HWVA 3IWZA 2BY0A 1QZEA 1XC5A 3BZKA 4Z6YA 2DK5A 4KN7X 1YJNI 1O3SA 5L3DA 3KETA 3ROUA 1IV6A 1NG7A 3LSMA 4A2UA 2GXAA 2EPFA 5K7ZA 3OS0A 4NB5A 2IGKA 3M4OJ 5JR3A 4LB5A 2E5ZA 4E7ZA 2HEOA 1ZK8A 3HRUA 2BGCA 2X85A 2P8TA 1FOXA 2PEXA 1UFMA 2RQQA 2E34A 3GFMA 3MEXA 2NVUB 4XONA 2IGNA 2NRAC 1AWCA 2R7TA 3SZPA 4BQAA 2VKDA 4D7MA 1GV2A 3DKWA 4XNFA 2FX0A 1Z1DA 4ZC3A 4JX4A 4LK0F 3SDGA 1L0OC 2L7ZA 3E3VA 4QWQA 3LSKA 4XOTA 5LLQA 2R7ZJ 1BI0A 3CMEI 2VODA 5J4VA 3TW6A 3DEWA 1UHWA 1IZ1A 3PNVA 4KYWA 2EWNA 1X4OA 2OZ6A 4BEHB 4I98B 1UZCA 2VKEA 1QNTA 5J6XA 2OCEA 2V9PA 5M3FJ 2HNHA 5D4RA 3K4JA 1WZ2A 4ESJA 3BWGA 2EIJH 3I4PA 2KLOA 4AUXA 5IOYA 4MGRA 2WWYA 3CCSI 5F27A 2LD5A 4IHVA 1S7OA 2VQLA 5F1RA 2EV6A 4A6DA 5EEHA 2EA4A 1WKMA 3ZN1A 3DEUA 4DYCA 2ETHA 3BQZA 2ZJPF 3ZPLA 2BBYA 1D1BA 2ELHA 2XSJC 1WJCA 2L7MP 3E7LA 2W7NA 4AYBN 2CYYA 3FXKA 1W36C 5CYVA 1XMKA 4LG0A 1WJDA 2X4HA 2XF7A 2VE9A 3CC4I 5K1YA 3JTGA 5D8KB 1X58A 2ZFWA 1FYLA 3SZGA 4MEYF 1S6LA 2VBXA 4M6XA 1B9NA 2LBFB 2LFBA 3GWZA 3TGNA 3B02A 3F8MA 3BQYA 5GTIC 4D9JA 4RMNA 3HTUA 1T0FA 2F5EA 4F93B 3LSTA 3K4LA 2M0MA 1RZ4A 3QU6A 4RGSA 4BY7J 3D1NI 1OKRA 4LITA 2MBFA 2HOTA 4U0VA 2LKSA 4A3EJ 2GA1A 2PMHA 1HDDC 2IS1A 2FD5A 3HIFA 1R71A 4PDKA 3N97A 4RBOA 2V79A 1RI7A 1Z3XA 3S93A 1I1GA 2WA0A 1MBGA 1K61A 2L4MA 4RLFA 4UV9A 4AIKA 4BBSJ 3ZR8X 1BIAA 1W5CC 5HS7A 3GTGJ 4XLPF 2EFWA 5F04A 3HG9A 2HI3A 4B3XA 3W6KB 2A6HF 5CQEA 1BR2A 3VOEA 2R7XA 4EMSA 3M8FA 2XPVA 1WH7A 4P55A 1HW5A 1V5EA 1Z21A 5TJJA 2XKOA 1LEBA 2IA2A 1ZGWA 4EM2A 1R23A 1ETQA 2VKHA 1TBXA 5AIPA 5D6FA 4RAFA 4HYEA 5HDGA 4BEHA 3ZQHA 1MMAA 1X3WB 2RVCA 3A03A 3LSGA 5EG0B 3LAPA 1ZRFA 5LHGA 2BVLA 3BPVA 1XG1A 4OIPF 2H8RA 1FLIA 4D7NA 3FWEA 1YJ9I 3MKLA 1XB4A 2W85A 2E7WA 2EINH 4AIDA 5CVRA 3CCEI 1D8JA 2WAQN 3RQIA 3KYLA 2P6SA 4N4OB 3J7ZI 1JHHA 4NC6A 3ABKH 2COBA 2KJBA 1IN8A 2IA0A 1VQKI 2VUMJ 4UVAA 4OIRF 2MD5A 1O7FA 3K4NA 3S15J 3PNTA 2IBDA 1TWAJ 4UUSB 3GFIA 3K6GA 4DGWB 5IPAA 1G59A 3WHCA 1RR8C 1XGMA 1ETOA 2XSDC 4XLHA 1O4XA 5HS9A 1VQ9I 2CMPA 3HRTA 3DU6A 3VB2A 3DU5A 1YTYA 1O57A 1R1VA 3AKZA 3TP0A 1VI0A 2RC4A 1CF7B 4CA0A 3N05A 4O3MA 3K7AJ 2HGCA 2QQ8A 2HOSA 4YEJA 4S05A 4XMYA 2HTJA 4GO1A 1NK3P 3VYUB 4E6KG 3WTXC 2CWEA 5EZGA 2CQQA 3OYGA 1VQ7I 4OIQF 2AS5F 2WV1A 4M74A 3JRFA 2E1CA 3G73A 3KP3A 4GGGA 1BN5A 3ZQ7A 1QPIA 3H9GA 1OR7A 4B8XA 2HU9A 1EH7A 2B0LA 2IEKA 5GAHJ 2VBZA 3O8GA 3VFZA 2R3SA 3AG4H 3GMEA 1IRGA 3H0GJ 1HXDA 1ODDA 3F9KA 2FMYA 3LA7A 2UUZA 2RREA 3HC7A 1DGRM 3I59B 4CCNA 4HF2A 4ITVA 3LSIA 1P4AA 5TRDA 4HSTA 5J8FA 2VL8A 3H9QA 1BR1A 1FMWA 3RYPA 4E70A 3H3UA 2P7VB 2WADA 2NVXJ 1USTA 5LD2C 4I2OA 4MQVA 3U1KA 2IP2A 4AWXB 3OYCA 2G7UA 4S04A 1OLTA 5ICEA 3C3WA 1IDYA 2R5YA 1HA8A 2DPUA 4I02A 2HR3A 5BMZA 1I1SA 1HBXG 1VQ8I 2L0KA 3V7CA 3ELKA 4CXFA 4KDPA 4CCOA 2R7SA 5FLVA 4DBRA 1U9OA 2ADUA 3I58A 4L9TA 2M8GX 2ZO4A 2DMPA 2AXTC 3DTEA 4A3IJ 4ZH4F 3BY6A 3S1MJ 4HLYA 4XQFA 3HOSA 1QVTA 2F48A 3D0SA 3HJEA 2IT0A 4EJVA 4Q5SF 1D1CA 1BJZA 1SD6A 1TW3A 3OYBA 1HW1A 3BTIA 2CQ7A 2NVYJ 2K02A 3GXOA 1B59A 4DZJA 1V4RA 3Q0UA 4JX5A 1Y56A 2W48A 1VQ6I 3E0JB 1BW6A 2DA2A 3OYAA 2L9RA 1HSJA 2CO5A 3ISPA 2HKOA 1VQPI 4B48A 2X6YA 2L9NA 1XDUA 4WXDA 3U2RA 3OYFA 1IXRC 3TKYA 4Q4ZF 2VKVA 3MD2A 2ISYA 2ZMEA 2EB7A 2ID6A 4OIOF 1WJFA 3PUFA 5KVRA 1QHGA 2EBIA 2HQAA 2E60A 3GYHX 1FX7A 4XSXF 4XRFA 2QUFA 3MN2A 2Y9YA 3ABTA 5HVQC 1YHQI 4KIBA 2DYRH 3OL4A 4OAYA 2K5CA 2LKXA 6PAXA 2R7RA 3S1QJ 3NRVA 1P92A 5KAIC 3KYCB 3L2WA 1ZLJA 2DTZA 3PM1A 1RESA 2HDWA 2KDZA 1TC3C 2GOMA 2VE8A 3R61A 5A2QK 2W84A 1DP7P 1W5SA 3PQJA 4Y3OA 3BT9A 4FTHA 1STZA 2OZUA 3KP7A 3KZYA 2FSWA 2IRFG 2R5ZA 3RCOA 2KIFA 1EJ9A 1BI2A 2DDBA 3BG5A 3MZYA 1XX5A 1J75A 1BBYA 1E17A 2CRGA 2QENA 3HOXJ 5L3BA 3D5RC 3OSGA 4WXCA 2HKXA 2I10A 1WPKA 4JQFA 1K78B 4LK1F 2LSOA 4JYKA 4N4NB 2JSPA 1Z05A 2G0EA 2XUBA 3C2GA 1I6XA 2M2EA 1XGOA 1Y0NA 2WY7Q 1T08B 1R7JA 2VC0A 4RB2C 2OQGA 3SHFA 3U1DA 3CCQI 2DCEA 3LFUA 3J7AO 1OCRH 2DMQA 2DA7A 1K4TA 2DYSH 3I4NJ 1QBJA 3RYRA 2Y0SA 3KE2A 4ENKA 2EQRA 5DD8A 1YITI 1TL8A 3CDHA 3BR5A 3G3ZA 2HPMA 5BPDA 4WX9A 3ZMTA 4KMUX 1E0EA 1KA8A 1VFCA 3HGGA 4LIVA 2E5NA 4FQGA 2Q2EA 4KJZA 3W6JB 2JTVA 4I09A 3T5XA 5H6RA 2X0LA 2WY8Q 5HLTA 4CYCB 3EUHA 4CGZA 1MW7A 3FXLA 2CW7A 1S9HA 4R79A 4LLLA 5IT3A 3ABMH 4QTRA 4E7HA 3AL0C 1IG7A 4QPQA 3DFGA 5D4SA 3JAMZ 3ESWB 3FDYA 3MKZA 1MDMB 2FBKA 3ZQGA 3F8CA 2RKHA 3HRSA 5DM7F 3CLOA 3J81Z 3V42A 4CO8A 3KEOA 2EV0A 3LQQA 3RKWA 4BJ6C 5ILUA 2KPMA 3K9TA 1MD0A 1ZGAA 4FX4A 3SFZA 1NH3A 2R7DA 1YRNA 3QOEA 3W6VA 4A12A 2ESHA 2WTEA 4NBQA 3ZRGA 3T0YA 1ZN2A 4XORA 3JREA 3COAC 1MMDA 3MCZA 3MVPA 2R7WA 1W36D 2JJ7A 3VDXA 1SFOJ 2P7CB 1KU7A 3VYRB 4A3GJ 2O3FA 2PMZN 3B6AA 2IGMA 4S0HB 4J19A 1JUPA 3LWFA 4OAZA 2VASA 5DTDA 3H92A 1PVEA 2CQNA 4D0PA 3RSNA 3CC7I 5EDNA 1I27A 4PJLA 2RV8A 1PYVA 4DW6A 2X9DA 4ZYGA 1JTYA 1FBUA 2DAOA 2CUEA 1WQ2A 3I53A 1SVLA 5FB2A 1R36A 5J47A 4MFEA 2M5WA 4BYYA 3H0DA 1Y8QB 1XDSA 3PNYA 4IQ4A 1ETYA 2HYFA 1IGNA 1JT6A 5GPCA 1TNSA 1SFXA 1OCCH 1YG2A 3DPTA 4UB6C 4XK4A 5BQTA 1REPC 4MEXF 2DFFA 3ZMVA 1W7PB 3QOPA 2LLKA 5TISC 1FSEA 1YO5C 2VBYA 1FNNA 1HKSA 2Z9OA 2G7HA 1D5YA 2EA2A 2EK5A 1E3PA 2JUGA 1Y6IA 2NNNA 5E20A 1GVDA 3WGIA 5EEGA 2JN6A 2R7OA 2HZDA 2PMZA 5HLHA 1G4DA 3AL0B 2M9HA 4IF4A 3CMYA 4HOBA 1FY7A 2CQXA 2E2JJ 2A6TA 5DDGA 3JTHA 1WJEA 3P9IA 3OMYA 4PFPA 3C18A 1LFUP 2WBMA 5D5UB 2FJ1A 3R4KA 1XN7A 1T38A 1P4WA 2JA5J 1TQIA 2GOXB 2VJIA 3I0TA 3HKZA 5CVIA 4GYGA 4MQ9F 5LGUA 2VLAA 1X2NA 1J9IA 3HDDA 4IXAA 3WTTC 1WVRA 4G94A 3GTMJ 3FKJA 1YS7A 4A3KJ 2D45A 2LYCA 3HM5A 1JKPC 2L54A 1B4AA 3KP4A 1ZR4A 1EH6A 1GXQA 2PQ8A 1FWZA 2JT1A 4ZYHA 1FEXA 1Z7UA 2BXYA 3AFHA 3SEQA 3ULQB 3MKWB 4IOAF 2V1UA 2JK3A 4DZPA 5K5QA 4C30A 1MMSA 3R6SA 1QRYA 3OYJA 3OYMA 2NOJB 3TOAA 3HOTA 3DWLE 2M30A 3GFLA 2L9VA 3EETA 2VI6A 3DP7A 4MNUA 3MQ0A 2XV4S 2Y48A 3QPTA 5FKKA 3E6DA 2A61A 4AVZA 4WK8F 1OISA 1ERDA 3F8NA 4HBLA 3OYNA 1IO2A 3A2KA 4CZCA 2H27A 1G3SA 3M9AA 3TDUC 4DOZA 1DPRA 5FKNA 3L1PA 1JGGA 2MGQA 2FE3A 4ZYAA 4B43A 5IT9Z 1D0YA 3F0CA 2MH9A 4R8HA 1ZYRF 3CCRI 3BZCA 4E7LA 2Q0OA 2HFHA 1QGPA 2D1VA 4FCYA 3GZNB 2VXZA 4YELA 3H35A 2W24A 5E3MA 2H1LA 5HDNA 2VPRA 4H4KC 3MWMA 3A4CA 3QRFF 1JKQC 4LG3A 3WGGA 4ZDPA 3KP2A 4O5VA 5DUKA 3JRDA 2CV2A 2VOOA 2HS5A 2P4WA 1W4MA 3LFKA 2R7FA 2JA6J 3TOBA 3IRRA 1N75A 3ZP5A 4UY8I 3WTYC 4M6YA 4A3CJ 1BC7C 3CJQB 2DT6A 1D5VA 2HYGD 1EV7A 2OJED 4U7BA 1ZH5A 2M3AA 4XIDA 4L9JA 2L02A 3QWLA 2EZHA 3ECHA 3L00A 3P7NA 4J00A 2K27A 1K79A 2JRTA 5J3LA 1OYYA 4EGYA 1T6SA 4IHWA 4O6JA 1V55H 2DBBA 3QYEA 5CQGA 1TTYA 5ICGA 2XAFA 2YU3A 5J1RA 4D1QA 1OCPA 1TWGJ 2Z1DA 1LEAA 2XPWA 5CLSA 1GVJA 3LAJA 2A68F 2TDXA 5E79C 3I64A 4KICA 5FD5A 3L2UA 1FTZA 4B1RA 4DIQA 2QQAA 3CQZJ 5IYDJ 1A04A 1ULYA 1TQPA 2JPBA 2V9VA 4PGGA 1MBKA 3EUHC 2X1EA 2WC2A 3GTLJ 2YX4A 3C7JA 4BUPA 4HNVA 3OWTA 4X0GA 4DNCA 3PIPF 3A0BC 3RZOJ 4B09A 5FKOA 1ORKA 3M8JA 2MH2A 2QKLB 5IY5H 3OIPA 5E3OA 4GDFA 1T95A 1R49A 2MLKA 3TEDA 2FXAA 3EUAA 5J4YA 3C1DA 1U8BA 5C44J 1H9GA 5CVUA 1TT5B 3E5XA 5DM6F 4PSXA 4EQQA 4DJAA 4AIJA 2ZNYA 1S72I 2LP0A 4EV0A 2M7AA 4AM3A 4UUTA 2O03A 1NHAA 1YW8A 2V7FA 4E7KA 4I0AA 1B72A 1MMGA 1TQMA 5CPRB 5ED4A 4A93J 1PDNC 4G6TB 1RUNA 1VQ5I 1H9TA 4A3LJ 2E19A 1B6AA 5ICCA 2EZKA 5FRMA 2WV0A 3GBGA 5M3MJ 4BGDA 2EFOA 4G9YA 4PJ0C 4XRSG 3Q5FA 4RLQA 1QZYA 2AXLA 3G1LA 2O6GE 1YIJI 1UMQA 2QBYA 1R9TJ 1OQYA 3QPHA 4B3AA 1RKWA 1G3TA 2K7LA 5DEQA 4DYRA 5B1AH 4C2UA 1MNDA 1XSVA 2K9SA 4KISA 1T56A 1ZAOA 4FE4A 1BR4A 1YYVA 4IEJA 3RQ4A 1ZG5A 3OV8A 3DBRB 2L4AA 1SMTA 4ESBA 5F0HA 3GTKJ 1GLNA 2Q1ZB 4JK1X 4YRVA 2O8KA 4PJNA 1H89C 1BOAA 1IXCA 1X4PA 4IJAA 1RR7A 3EPZA 3N4MA 1Y39A 4C2TA 5BNGA 5KNLA 1LKXA 5BPIA 3QQAA 4BDYA 1G3YA 4KT6A 4CYCA 2XHKA 3HEFA 4HV6A 1VQNI 1ZLKA 1R1UA 2ICWG 3IKVA 1ZG3A 3CO6C 3KP5A 2RNJA 3Q3SA 1T33A 4IO9F 1HKTA 2UWMA 2F6CA 2W1OA 3G1OA 4RAYA 3E5UA 2W00A 3CJNA 1D8KA 4OWRB 3L2QA 1PUEE 4L0YB 4HQMA 2BE5F 1F5TA 1ZTRA 2D5VA 4F3QA 3A02A 1XCVA 3F8BA 3SYTA 3PL8A 5FGMA 4XLAA 3DLLF 2IVMA 1LE8A 3MFKA 1RRJA 1BOBA 3GTJJ 5M5XJ 2K85A 2LF7A 3K2ZA 1X3UA 4MO7A 4XOPA 4BQNA 1YW7A 3L2CA 2QA4I 5LEJA 4P9FA 4YFNF 3L7WA 1HCRA 3QYFA 2YPRA 3KEYA 1OFCX 4I0BA 3FHZA 3TO9A 3RPQA 1Z3YA 2XRLA 5EZHA 4OMZA 1X1PA 1XSXA 3BTCA 2XROA 1XGSA 4ON0A 1ZKGA 5IYBJ 1P2FA 5FLXZ 1ITYA 4RS8A 3WTSC 1U8RA 4HW0A 3JRGA 2I5UA 1J7KA 1F36A
chains in the Genus database with same CATH topology
3BG9A 5GPAA 2EBIA 3HKZN 3S17J 5DS9A 1H88C 3MN2A 2P81A 1PUFB 1K83J 1Q1VA 5EGOB 2LTPA 2Y9YA 2DN0A 2R5YB 3S2DJ 1B8IB 2LKXA 1QVUA 1ENHA 3S1QJ 2M34A 2LR8A 1G2HA 2DTZA 4NDLA 3PM1A 1RESA 2KDZA 1TC3C 5F0CA 1FIAA 3S14J 1IUFA 3CCYA 3GTOJ 2E2HJ 2XPUA 2OF7A 4FTHA 2Y0SN 3BT9A 2MG4A 2MSYA 4UUSA 3JRBA 2QCOA 9ANTA 3HOVJ 2R5ZA 3BG5A 3BTLA 2R92J 4M3BA 1JUSA 5FKLA 1MBHA 3IH3A 1FIPA 1HDPA 2CRGA 2FQ4A 3JRCA 3HOXJ 4A3FJ 4A69C 4LOCA 1OJLA 4W97A 2EH3A 5F0FA 1GV5A 3OSGA 1AKHB 2I10A 2NVQJ 1WPKA 2X48A 3PO3J 1VNDA 4JYKA 3ZQFA 1IJWC 5F1JA 2G0EA 1APLC 4D5FA 1P7IA 2HYJA 2M2EA 3SJMA 1WCMJ 1UG2A 1JJ6C 1ETKA 2DMQA 4M6VA 2DA7A 3BR6A 3I4NJ 2JA7J 3S2HJ 2EQRA 2QF7A 4V2GA 2YU9J 1MNMC 2O9LA 2E2IJ 3BR5A 4GFBA 2AO9A 2LK2A 3NARA 4M3GA 1VFCA 3HGGA 2ID3A 1F43A 1OCTC 1HLVA 2NS8A 1MH3A 1IDZA 3G1MA 3OOUA 3B6CA 4CYCB 4BBRJ 2XGCA 2YUSA 4RDUA 1U9NA 2IAIA 2Y31A 2RAEA 1AHDP 2N8GA 2GLOA 4QTRA 3JRHA 1A6IA 1CQTA 2DA4A 1IG7A 3JRAA 5C4XJ 4M3DA 1WGXA 4JP0A 1BW5A 2HQ5A 5E3LA 3ZQGA 4MFDA 5M5WJ 4MIMA 2ECCA 3H3VK 5EYRA 5EF6A 3A01A 1TWHJ 5IP7J 2XB0X 2ECBA 4I76A 5E3NA 3LSPA 1MSEC 3S16J 2EZIA 1YRNA 3W6VA 2R0QC 2GM4A 2HOAA 3ZQCA 2AHQA 4ABZA 3JREA 3MVPA 4L5EA 1DU0A 4IHYA 2JJ7A 1JUMA 1TWFJ 1SFOJ 3BR0A 4A3GJ 2PMZN 3LOCA 3B6AA 1FJLA 4S0HB 2Y2ZA 1JUPA 2X6OA 4J19A 3FKIJ 5DTDA 2YS9A 4D5CA 4AC0A 5EDNA 3A01B 1ZQ3P 1NK2P 2DMUA 4DW6A 2X9DA 1JTYA 1TWCJ 5EEAA 5C3EJ 1JKOC 3QPLA 4X1EA 2CUFA 2CUEA 5FKMA 3LSJA 4MFEA 1MBJA 1JJ8C 1GDTA 5K7FA 1XC5A 1IGNA 1ETYA 4JX6A 3BTJA 1JT6A 5GPCA 1PUFA 4XK4A 1IV6A 4FE7A 2LLKA 3HOWJ 5K7ZA 4XICA 3I4MJ 2KT0A 1D5YA 3M4OJ 3S1RJ 4QSHA 1ZK8A 3JRIA 3PO2J 1GVDA 2OPTA 2XGEA 3OSFA 5M5YJ 1S7EA 2JN6A 3OIOA 1MH4A 3LSRA 2M9HA 5FLMJ 4Y52J 3CMYA 1HOMA 2CQXA 3IH2A 2E2JJ 4D7MA 1GV2A 2FX0A 1LFUP 3HOUJ 4JX4A 3SDGA 2L7ZA 2FJ1A 2JA5J 3ZQLA 2HDDA 2R7ZJ 1W0UA 1A5JA 1X2NA 3TW6A 4A3BJ 3DEWA 3HDDA 1Z77A 2B63J 3GTMJ 2TRTA 2VKEA 4A3KJ 3QPSA 3K2AA 3HM5A 1X2MA 5M3FJ 1JKPC 3O8HA 1ZR4A 1B8IA 4XRSA 4G12A 4AUXA 5IOYA 2LD5A 1FEXA 4IHVA 1LFBA 5F27A 4B4CA 4C2MJ 1Y1WJ 4X6AJ 1U78A 4QIWN 3M3YJ 2DMNA 4DYCA 2JK3A 5JLXA 2XB5A 4DZPA 3BQZA 1E3OC 3NAUA 3HGYA 2CJJA 2M0CA 4A3JJ 2JMWA 1QRYA 2L7MP 3E7LA 2L7FP 1WI3A 3VPRA 4AYBN 3SFIA 4A3MJ 5IYCJ 2VI6A 3Q0WA 4FISA 1X58A 4C3JJ 5C4JJ 5FKKA 1FTTA 4A3DJ 2LFBA 1EF4A 3BQYA 4DYQA 2CU7A 3L1PA 5FKNA 1JGGA 2MGQA 3F0CA 4BY7J 3D1NI 1LE8B 2HOTA 2DA3A 5K7HA 4A3EJ 1HDDC 4FCYA 3GTPJ 2FD5A 2ZB9A 3FK7A 5E3MA 1SANA 4RBOA 2ME6A 2VPRA 1MBGA 1K61A 1JKRC 1JKQC 4IHXA 4XRMA 4BBSJ 3GTGJ 5F08A 3JRDA 5EGOA 5F04A 2HI3A 4C3HJ 2JA6J 1W0TA 4A3CJ 2XPVA 1WH7A 1POGA 2K40A 5FJ8J 1ZGWA 2LVSA 1H8AC 1ETQA 1ETXA 4XIDA 1AU7A 1BA5A 2DJNA 2EZHA 5J3LA 3TP3A 1MBEA 3BR2A 3ZQHA 3A03A 3LSGA 5EG0B 4IHWA 1MBFA 1BL0A 1XG1A 2H8RA 3IH4A 1ETWA 4M3FA 4D7NA 2JA8J 5J1RA 5JLWA 3MKLA 1MSFC 3HOZJ 1OCPA 1TWGJ 1HF0A 2XPWA 2WAQN 3RQIA 5HODA 4C3IJ 1FTZA 2ME0A 4B1RA 1Z0XA 2COBA 1JTXA 2VUMJ 1Y1VJ 3CQZJ 5IYDJ 3S15J 1MBKA 2IBDA 2O7OA 2Y30A 1TWAJ 4UUSB 3GTLJ 3GTQJ 4HNVA 3RZOJ 2NOGA 5IPAA 5IOZA 2JWTA 5FKOA 1ORKA 5E3OA 1IRZA 4M3EA 3WHCA 1ETOA 3TEDA 2XSDC 1O4XA 1U8BA 5C44J 2DA1A 3TP0A 2HXOA 1VI0A 3HB9A 4BKXA 2R93J 3BR1A 3K7AJ 5IP6A 2LP0A 2HOSA 4UUTA 1NK3P 3ZOBA 2ELKA 4EEFG 1I50J 5GP9A 5EZGA 1ETVA 2CQQA 3IV5A 1B72A 2WB1N 2WV1A 3DCFA 3JRFA 4A93J 1QPIA 3ZQIA 3JR9A 2NVTJ 3FK6A 4A3LJ 2IEKA 2E19A 2EZKA 3O8GA 2TCTA 3BR3A 3GBGA 5M3MJ 3Q0VA 1I6HJ 3H0GJ 2DMTA 4V2FA 4XRSG 1RPWA 5J1YA 2DA6A 3G1LA 2K9NA 1UMQA 1R9TJ 4B3AA 1RKWA 4DYRA 3UKGA 2K9SA 1UHSA 2LY9A 2NVXJ 1T56A 4FE4A 4IEJA 1NTCA 1RETA 2R5ZB 5F0HA 3GTKJ 5IP9J 2HXIA 1IDYA 5J1UA 1XS9A 2O8KA 2R5YA 1H89C 1ZR2A 3TW7A 1RR7A 2L0KA 1DU6A 2Y9ZA 5BNGA 1RKTA 1YRNB 3QQAA 4CYCA 2K9QA 1JT0A 1GT0C 3HEFA 5FLVA 1I3QJ 1U9OA 2M8GX 2MW8A 2DMPA 3Q3SA 1T33A 1WH5A 4A3IJ 3S1MJ 3CDLA 3RZDJ 1QVTA 4BY1J 2EZLA 3G1OA 3RKQA 1AKHA 2NS7A 4BXXJ 1BJZA 1ZTRA 3LNQA 2XGDA 2D5VA 3BTIA 2NVYJ 3A02A 3FISA 1B72B 4DZJA 4JX5A 3Q0UA 1LE8A 3GTJJ 5M5XJ 2H1KA 4MO7A 2W48A 4Y7NJ 1P7JA 3C2BA 1VF9A 4W1UA 1BW6A 1HCRA 2DA2A 2L9RA 1OFCX 3WHBA 3BG3A 5EG0A 5EZHA 2XRLA 3HOYJ 2E1OA 4I6ZA 2GBYA 3FIWA 3HBLA 3BTCA 2DA5A 1GUUA 1ZKGA 5IYBJ 1ITYA 2VKVA 4MLOA 3S1NJ 3JRGA 1IC8A 2ID6A 1F36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG9 A;  5GPA A;  2EBI A;  3HKZ N;  3S17 J;  5DS9 A;  1H88 C;  3MN2 A;  2P81 A;  1PUF B;  1K83 J;  1Q1V A;  5EGO B;  2LTP A;  2Y9Y A;  2DN0 A;  2R5Y B;  3S2D J;  1B8I B;  2LKX A;  1QVU A;  1ENH A;  3S1Q J;  2M34 A;  2LR8 A;  1G2H A;  2DTZ A;  4NDL A;  3PM1 A;  1RES A;  2KDZ A;  1TC3 C;  5F0C A;  1FIA A;  3S14 J;  1IUF A;  3CCY A;  3GTO J;  2E2H J;  2XPU A;  2OF7 A;  4FTH A;  2Y0S N;  3BT9 A;  2MG4 A;  2MSY A;  4UUS A;  3JRB A;  2QCO A;  9ANT A;  3HOV J;  2R5Z A;  3BG5 A;  3BTL A;  2R92 J;  4M3B A;  1JUS A;  5FKL A;  1MBH A;  3IH3 A;  1FIP A;  1HDP A;  2CRG A;  2FQ4 A;  3JRC A;  3HOX J;  4A3F J;  4A69 C;  4LOC A;  1OJL A;  4W97 A;  2EH3 A;  5F0F A;  1GV5 A;  3OSG A;  1AKH B;  2I10 A;  2NVQ J;  1WPK A;  2X48 A;  3PO3 J;  1VND A;  4JYK A;  3ZQF A;  1IJW C;  5F1J A;  2G0E A;  1APL C;  4D5F A;  1P7I A;  2HYJ A;  2M2E A;  3SJM A;  1WCM J;  1UG2 A;  1JJ6 C;  1ETK A;  2DMQ A;  4M6V A;  2DA7 A;  3BR6 A;  3I4N J;  2JA7 J;  3S2H J;  2EQR A;  2QF7 A;  4V2G A;  2YU9 J;  1MNM C;  2O9L A;  2E2I J;  3BR5 A;  4GFB A;  2AO9 A;  2LK2 A;  3NAR A;  4M3G A;  1VFC A;  3HGG A;  2ID3 A;  1F43 A;  1OCT C;  1HLV A;  2NS8 A;  1MH3 A;  1IDZ A;  3G1M A;  3OOU A;  3B6C A;  4CYC B;  4BBR J;  2XGC A;  2YUS A;  4RDU A;  1U9N A;  2IAI A;  2Y31 A;  2RAE A;  1AHD P;  2N8G A;  2GLO A;  4QTR A;  3JRH A;  1A6I A;  1CQT A;  2DA4 A;  1IG7 A;  3JRA A;  5C4X J;  4M3D A;  1WGX A;  4JP0 A;  1BW5 A;  2HQ5 A;  5E3L A;  3ZQG A;  4MFD A;  5M5W J;  4MIM A;  2ECC A;  3H3V K;  5EYR A;  5EF6 A;  3A01 A;  1TWH J;  5IP7 J;  2XB0 X;  2ECB A;  4I76 A;  5E3N A;  3LSP A;  1MSE C;  3S16 J;  2EZI A;  1YRN A;  3W6V A;  2R0Q C;  2GM4 A;  2HOA A;  3ZQC A;  2AHQ A;  4ABZ A;  3JRE A;  3MVP A;  4L5E A;  1DU0 A;  4IHY A;  2JJ7 A;  1JUM A;  1TWF J;  1SFO J;  3BR0 A;  4A3G J;  2PMZ N;  3LOC A;  3B6A A;  1FJL A;  4S0H B;  2Y2Z A;  1JUP A;  2X6O A;  4J19 A;  3FKI J;  5DTD A;  2YS9 A;  4D5C A;  4AC0 A;  5EDN A;  3A01 B;  1ZQ3 P;  1NK2 P;  2DMU A;  4DW6 A;  2X9D A;  1JTY A;  1TWC J;  5EEA A;  5C3E J;  1JKO C;  3QPL A;  4X1E A;  2CUF A;  2CUE A;  5FKM A;  3LSJ A;  4MFE A;  1MBJ A;  1JJ8 C;  1GDT A;  5K7F A;  1XC5 A;  1IGN A;  1ETY A;  4JX6 A;  3BTJ A;  1JT6 A;  5GPC A;  1PUF A;  4XK4 A;  1IV6 A;  4FE7 A;  2LLK A;  3HOW J;  5K7Z A;  4XIC A;  3I4M J;  2KT0 A;  1D5Y A;  3M4O J;  3S1R J;  4QSH A;  1ZK8 A;  3JRI A;  3PO2 J;  1GVD A;  2OPT A;  2XGE A;  3OSF A;  5M5Y J;  1S7E A;  2JN6 A;  3OIO A;  1MH4 A;  3LSR A;  2M9H A;  5FLM J;  4Y52 J;  3CMY A;  1HOM A;  2CQX A;  3IH2 A;  2E2J J;  4D7M A;  1GV2 A;  2FX0 A;  1LFU P;  3HOU J;  4JX4 A;  3SDG A;  2L7Z A;  2FJ1 A;  2JA5 J;  3ZQL A;  2HDD A;  2R7Z J;  1W0U A;  1A5J A;  1X2N A;  3TW6 A;  4A3B J;  3DEW A;  3HDD A;  1Z77 A;  2B63 J;  3GTM J;  2TRT A;  2VKE A;  4A3K J;  3QPS A;  3K2A A;  3HM5 A;  1X2M A;  5M3F J;  1JKP C;  3O8H A;  1ZR4 A;  1B8I A;  4XRS A;  4G12 A;  4AUX A;  5IOY A;  2LD5 A;  1FEX A;  4IHV A;  1LFB A;  5F27 A;  4B4C A;  4C2M J;  1Y1W J;  4X6A J;  1U78 A;  4QIW N;  3M3Y J;  2DMN A;  4DYC A;  2JK3 A;  5JLX A;  2XB5 A;  4DZP A;  3BQZ A;  1E3O C;  3NAU A;  3HGY A;  2CJJ A;  2M0C A;  4A3J J;  2JMW A;  1QRY A;  2L7M P;  3E7L A;  2L7F P;  1WI3 A;  3VPR A;  4AYB N;  3SFI A;  4A3M J;  5IYC J;  2VI6 A;  3Q0W A;  4FIS A;  1X58 A;  4C3J J;  5C4J J;  5FKK A;  1FTT A;  4A3D J;  2LFB A;  1EF4 A;  3BQY A;  4DYQ A;  2CU7 A;  3L1P A;  5FKN A;  1JGG A;  2MGQ A;  3F0C A;  4BY7 J;  3D1N I;  1LE8 B;  2HOT A;  2DA3 A;  5K7H A;  4A3E J;  1HDD C;  4FCY A;  3GTP J;  2FD5 A;  2ZB9 A;  3FK7 A;  5E3M A;  1SAN A;  4RBO A;  2ME6 A;  2VPR A;  1MBG A;  1K61 A;  1JKR C;  1JKQ C;  4IHX A;  4XRM A;  4BBS J;  3GTG J;  5F08 A;  3JRD A;  5EGO A;  5F04 A;  2HI3 A;  4C3H J;  2JA6 J;  1W0T A;  4A3C J;  2XPV A;  1WH7 A;  1POG A;  2K40 A;  5FJ8 J;  1ZGW A;  2LVS A;  1H8A C;  1ETQ A;  1ETX A;  4XID A;  1AU7 A;  1BA5 A;  2DJN A;  2EZH A;  5J3L A;  3TP3 A;  1MBE A;  3BR2 A;  3ZQH A;  3A03 A;  3LSG A;  5EG0 B;  4IHW A;  1MBF A;  1BL0 A;  1XG1 A;  2H8R A;  3IH4 A;  1ETW A;  4M3F A;  4D7N A;  2JA8 J;  5J1R A;  5JLW A;  3MKL A;  1MSF C;  3HOZ J;  1OCP A;  1TWG J;  1HF0 A;  2XPW A;  2WAQ N;  3RQI A;  5HOD A;  4C3I J;  1FTZ A;  2ME0 A;  4B1R A;  1Z0X A;  2COB A;  1JTX A;  2VUM J;  1Y1V J;  3CQZ J;  5IYD J;  3S15 J;  1MBK A;  2IBD A;  2O7O A;  2Y30 A;  1TWA J;  4UUS B;  3GTL J;  3GTQ J;  4HNV A;  3RZO J;  2NOG A;  5IPA A;  5IOZ A;  2JWT A;  5FKO A;  1ORK A;  5E3O A;  1IRZ A;  4M3E A;  3WHC A;  1ETO A;  3TED A;  2XSD C;  1O4X A;  1U8B A;  5C44 J;  2DA1 A;  3TP0 A;  2HXO A;  1VI0 A;  3HB9 A;  4BKX A;  2R93 J;  3BR1 A;  3K7A J;  5IP6 A;  2LP0 A;  2HOS A;  4UUT A;  1NK3 P;  3ZOB A;  2ELK A;  4EEF G;  1I50 J;  5GP9 A;  5EZG A;  1ETV A;  2CQQ A;  3IV5 A;  1B72 A;  2WB1 N;  2WV1 A;  3DCF A;  3JRF A;  4A93 J;  1QPI A;  3ZQI A;  3JR9 A;  2NVT J;  3FK6 A;  4A3L J;  2IEK A;  2E19 A;  2EZK A;  3O8G A;  2TCT A;  3BR3 A;  3GBG A;  5M3M J;  3Q0V A;  1I6H J;  3H0G J;  2DMT A;  4V2F A;  4XRS G;  1RPW A;  5J1Y A;  2DA6 A;  3G1L A;  2K9N A;  1UMQ A;  1R9T J;  4B3A A;  1RKW A;  4DYR A;  3UKG A;  2K9S A;  1UHS A;  2LY9 A;  2NVX J;  1T56 A;  4FE4 A;  4IEJ A;  1NTC A;  1RET A;  2R5Z B;  5F0H A;  3GTK J;  5IP9 J;  2HXI A;  1IDY A;  5J1U A;  1XS9 A;  2O8K A;  2R5Y A;  1H89 C;  1ZR2 A;  3TW7 A;  1RR7 A;  2L0K A;  1DU6 A;  2Y9Z A;  5BNG A;  1RKT A;  1YRN B;  3QQA A;  4CYC A;  2K9Q A;  1JT0 A;  1GT0 C;  3HEF A;  5FLV A;  1I3Q J;  1U9O A;  2M8G X;  2MW8 A;  2DMP A;  3Q3S A;  1T33 A;  1WH5 A;  4A3I J;  3S1M J;  3CDL A;  3RZD J;  1QVT A;  4BY1 J;  2EZL A;  3G1O A;  3RKQ A;  1AKH A;  2NS7 A;  4BXX J;  1BJZ A;  1ZTR A;  3LNQ A;  2XGD A;  2D5V A;  3BTI A;  2NVY J;  3A02 A;  3FIS A;  1B72 B;  4DZJ A;  4JX5 A;  3Q0U A;  1LE8 A;  3GTJ J;  5M5X J;  2H1K A;  4MO7 A;  2W48 A;  4Y7N J;  1P7J A;  3C2B A;  1VF9 A;  4W1U A;  1BW6 A;  1HCR A;  2DA2 A;  2L9R A;  1OFC X;  3WHB A;  3BG3 A;  5EG0 A;  5EZH A;  2XRL A;  3HOY J;  2E1O A;  4I6Z A;  2GBY A;  3FIW A;  3HBL A;  3BTC A;  2DA5 A;  1GUU A;  1ZKG A;  5IYB J;  1ITY A;  2VKV A;  4MLO A;  3S1N J;  3JRG A;  1IC8 A;  2ID6 A;  1F36 A; 
#chains in the Genus database with same CATH topology
 3BG9 A;  5GPA A;  4L5J A;  3CP2 A;  3T1B A;  3HKZ N;  4ZYE A;  1H88 C;  2H94 A;  2MAB A;  1Q1V A;  4UVB A;  1L3L A;  2R5Y B;  4K2E A;  4RAG A;  4RB1 A;  3S2D J;  1F1Z A;  4A0X A;  1B8I B;  1Z91 A;  1QVU A;  5D6E A;  1KYW A;  2LR8 A;  1YX3 A;  3HHG A;  5H20 A;  4A0Y A;  1IUF A;  3CCY A;  3GTO J;  2ZXJ A;  2ZJQ F;  1WWX A;  1KU9 A;  3HYI A;  3IRQ A;  4Y4R A;  3KZI C;  1JUS A;  3J80 Z;  4AVP A;  2V6C A;  2IS4 A;  4ANJ A;  3JRC A;  4PFO A;  4A69 C;  4LOC A;  1OJL A;  5J40 A;  2EH3 A;  5F0F A;  2Y69 H;  4NUB A;  1AKH B;  3HPG A;  3PO3 J;  3HSR A;  1VND A;  5D5W B;  5AON A;  3CMA I;  1XPX A;  2LDU A;  5L3G A;  1I5Z A;  2ZCW A;  2RDP A;  4IX7 A;  1A6Q A;  1KU2 A;  3M1E A;  5F1J A;  4A5N A;  5LFA A;  2BHZ A;  2CUZ A;  4D5F A;  1P7I A;  1IN7 A;  2HYJ A;  4UB8 C;  1SFU A;  4LLN A;  1RIO H;  5BS6 A;  1UG2 A;  3F23 A;  1ETK A;  4JOM A;  4IRH A;  3FF5 A;  4M6V A;  3TMO A;  3DTI A;  3ONQ A;  3BLY A;  1QHH D;  3WTW C;  2ELJ A;  3KZZ A;  2QF7 A;  4V2G A;  4FT8 A;  3DPL C;  3OIQ A;  4EJO A;  1X1C A;  3OYH A;  2M45 A;  2AO9 A;  4ENJ A;  5CJ9 A;  4M3G A;  4KT5 C;  3AAF A;  2ID3 A;  2NAZ A;  1J5Y A;  1OCT C;  4IRI A;  1BIB A;  1MH3 A;  2FF4 A;  1HW2 A;  3CCU I;  2K4B A;  2FU4 A;  3G1M A;  1JHF A;  5FD6 A;  4XKC A;  4BBR J;  2YUS A;  3BJ6 A;  2XGC A;  3KPH A;  4RDU A;  2RAE A;  1XGN A;  4BE0 A;  1AHD P;  2N8G A;  4BXF A;  2GLO A;  2A6E F;  4QLC U;  2AQE A;  3A1Y A;  3V7S A;  4U0Y A;  4GRI A;  2V4J C;  5KCM A;  4YFK F;  4M3D A;  1R22 A;  2XGX A;  1WGX A;  3SQN A;  4UUV A;  2HQ5 A;  3SEZ A;  2V1X A;  4NQW B;  4MFD A;  5M5W J;  3ZN0 A;  4BL0 B;  2GXB A;  1VZ0 A;  2IJL A;  2BOL A;  3CMM A;  4HX4 A;  1TWH J;  3A01 A;  4FET A;  4CCK A;  2ECB A;  4LGW A;  4C9Y A;  5E3N A;  1R5I D;  3FMR A;  4L9N A;  5B1B H;  3LSP A;  3H36 A;  3L09 A;  2L2O A;  2DOA A;  3S16 J;  2JRM A;  3BCA A;  1D0Z A;  1Z9C A;  1X1D A;  2R0Q C;  1YIO A;  2H8W A;  2A5Y B;  3CUQ A;  1B9M A;  2AHQ A;  2PMU A;  1SVM A;  4M73 A;  4PK4 A;  1DU0 A;  1JUM A;  1T0F C;  2M4K A;  2XVC A;  4CUG A;  2XRN A;  4XLC A;  3S2W A;  3BJO A;  4QPO A;  2YS9 A;  4AC0 A;  1I3A A;  1IN6 A;  4F52 A;  2IPQ X;  1N78 A;  2GQQ A;  2X51 A;  3SZT A;  3A01 B;  3CCJ I;  1ZQ3 P;  2ISZ A;  3HZJ A;  2LKP A;  2V26 A;  5EEA A;  5C3E J;  1V5G A;  2JZY A;  2BY3 A;  2CUF A;  3EDP A;  1G6N A;  1Z67 A;  4AIH A;  2R7V A;  2KHM A;  3WE2 A;  5L3C A;  2DO7 A;  1MBJ A;  1F9N A;  2VBW A;  3NWS A;  3I9V 2;  5DD4 A;  5TGT A;  4XN3 A;  1PUF A;  1LQ1 A;  4I7H A;  5DCM A;  2OA4 A;  5EJC A;  3HOW J;  2GZW A;  2OTJ I;  2ESN A;  3K70 C;  4AD9 A;  2E71 A;  2KIQ A;  3RJP A;  1UEL B;  2E7X A;  3S32 A;  1KQ8 A;  4B47 A;  3JRI A;  2XGE A;  3MMY B;  1S7E A;  3F3X A;  3DXJ F;  4KFC A;  3CCM I;  2BV6 A;  3LSR A;  5ILS A;  3JCU C;  1X19 A;  3O2P E;  5FLM J;  3S8P A;  2DFI A;  2BW3 B;  2ZC2 A;  5E1X A;  1EA3 A;  2VB6 A;  3BRO A;  1HST A;  2JUC A;  2V6E A;  3DV8 A;  3KEQ A;  3ZQL A;  2HDD A;  1BM9 A;  4YG2 F;  2NYX A;  4A3B J;  3I56 I;  1Z77 A;  4Y17 A;  5JVT A;  4II2 A;  3QU3 A;  1LVA A;  5B3S H;  2QSH X;  2B63 J;  3QP6 A;  3J7Y J;  4G6D A;  3K2A A;  5H6Q A;  4GYI A;  4N9I A;  1X2M A;  4EVI A;  3JSP A;  5CKT A;  1QA6 A;  3R0A A;  1IW7 F;  2DQR A;  2KDO A;  4XLF A;  4XRS A;  2VQG A;  2KZV A;  4OU0 A;  1LFB A;  4C2M J;  3OS2 A;  2MYS A;  2KMU A;  4CCL A;  1Y1W J;  5LBQ A;  4QIW N;  4CIC A;  3AG3 H;  1E3O C;  3R60 A;  3NAU A;  3HGY A;  3WTU C;  2CJJ A;  4A3J J;  2JMW A;  4RAZ A;  2LH9 A;  3ZCO A;  1A35 A;  4KNY A;  3K70 D;  1WI3 A;  3P9C A;  4WWC A;  3WTV C;  3W3C A;  3L2V A;  4A3M J;  3ECO A;  1FYK A;  1W7P A;  3ASO H;  3Q0W A;  3IKT A;  2JPC A;  1QQI A;  2ZJ2 A;  4MTD A;  5JVG F;  1T8I A;  1ZHF A;  1ACI A;  1WJ5 A;  2V9K A;  5LRS A;  3U9G A;  1YQA A;  4U0W A;  4HNU A;  2B7E A;  4DYQ A;  4UHT A;  2CU7 A;  2LY2 A;  1LDJ A;  2XAS A;  2VQH A;  3EUK L;  4YII A;  5DCM B;  2ZSI B;  3JAM K;  3VOD A;  1S3J A;  2COM A;  3FMQ A;  3HSF A;  5K7H A;  4KN4 X;  1YLF A;  2F5F A;  3U21 A;  2A3S A;  4DQ2 A;  3DBH B;  4I01 A;  3QYB A;  1JXS A;  1JKR C;  4IHX A;  5F08 A;  5EGO A;  1Z6T A;  2HVR A;  1ZGJ A;  1W0T A;  3NEU A;  2IA1 A;  3CJR B;  1POG A;  1A31 A;  2DT5 A;  2K40 A;  5FRN A;  3QOD A;  2VPL A;  4ETS A;  1U6G A;  2RGV A;  1XMA A;  5FJ8 J;  1FP2 A;  2LVS A;  3RTR A;  1AU7 A;  3BDD A;  4EJW A;  1OCZ H;  3IP4 B;  1BA5 A;  3FXJ A;  2KFD A;  5GAG J;  3CCL I;  3KIO A;  1MBE A;  3BR2 A;  4IPA A;  2QSG X;  4HDU A;  3VWB A;  4IQJ A;  1BL0 A;  4NQW A;  4MHG A;  3CUQ B;  3DEE A;  2W57 A;  3IH4 A;  1WFX A;  2JA8 J;  5JLW A;  3LA2 A;  4BAC A;  4CCJ A;  1MSF C;  2L7K A;  1U5T B;  3OYK A;  5K5R A;  5LHH A;  3CZ6 A;  3GFJ A;  2EFP A;  1JTX A;  3WU1 B;  3P9K A;  2PG4 A;  3CTA A;  4FHT A;  4Y33 A;  3KLO A;  4M71 A;  2A5W A;  2Y30 A;  2V1D A;  3WTZ A;  4BS9 A;  3ZMS A;  3GTQ J;  3EYI A;  4P1W A;  1O3R A;  2OAZ A;  2NOG A;  2PJR A;  3E6M A;  1JE8 A;  2CV0 A;  1IRZ A;  2J5P A;  4GCV A;  3WU2 C;  2KL4 A;  4Q48 A;  3F6O A;  4CDG A;  3BG6 A;  2DU9 A;  3E6C C;  4ZZL A;  2VQC A;  2K3P A;  4BU2 A;  1WSU A;  1TLH B;  1C0W A;  5HNF A;  1O7L A;  1PJR A;  3HB9 A;  3HPH A;  2R93 J;  3BR1 A;  5E1Z B;  5E8I A;  4FAS D;  2ZME C;  1H0M A;  3I55 I;  2DOF A;  1VTN C;  1K6O A;  2WAQ A;  2ELK A;  2O0Y A;  4KIF A;  3TO6 A;  4EEF G;  2HDC A;  2M1B A;  2FBH A;  3IV5 A;  4IL6 C;  3HRM A;  3RKY A;  4IRG A;  2G9W A;  5GTH C;  1IF1 A;  2Z16 A;  3JR9 A;  2NVT J;  5HNH A;  3DKX A;  1MJB A;  1PP8 F;  3F6V A;  2TCT A;  3K1M A;  4BJT A;  1Y0U A;  2P0W A;  5A2Q Z;  4V2F A;  2H6C A;  3OR2 C;  2KIM A;  1RPW A;  3ABU A;  4HSR A;  4NC8 A;  2DA6 A;  5LGN A;  1QZZ A;  3NWT A;  4HX8 A;  5JFR A;  2W4S A;  2O61 A;  1YW9 A;  5E18 F;  2P5V A;  1YFH A;  4EJU A;  1UHS A;  3QAH A;  3MKY B;  2LY9 A;  3FX3 A;  4NHJ A;  2FML A;  5HOO A;  4R1H A;  1RET A;  1QPM A;  2EV5 A;  2DFE A;  2R5Z B;  1K4S A;  1SC7 A;  4U88 A;  5IP9 J;  1UB9 A;  5BOX A;  1XS9 A;  5L3E A;  3T8R A;  1YS6 A;  4L5I A;  5IT9 K;  2DQL A;  4M72 A;  2Y75 A;  1RKT A;  1YRN B;  1U5T C;  2CW0 F;  4XKV A;  2K9Q A;  1GXP A;  2MD0 A;  2XKP A;  1YJW I;  1GT0 C;  2DT7 B;  1R4N B;  2UXX A;  1I3Q J;  2LBF A;  3GZ6 A;  5FFZ A;  2MW8 A;  3S3N A;  2R7U A;  2CFO A;  1FSH A;  5DUI A;  1WH5 A;  2QSF X;  3UNG C;  3CC2 I;  4BAY A;  1SD4 A;  1LDK B;  1XCB A;  2FA5 A;  3CDL A;  3DTK A;  3RZD J;  2WB1 A;  4P5O A;  4BHB A;  3RKQ A;  1AKH A;  2Z2S B;  1TT0 A;  5J8C A;  1U3E M;  3PUB A;  2LF8 A;  3ZMD A;  3BG7 A;  2XGD A;  1ONV A;  1R4M B;  1VQ4 I;  4F55 A;  3FBI B;  1B72 B;  2CUJ A;  3IAS 2;  3IUO A;  1CGP A;  1DDN A;  4B44 A;  2KQR A;  4LJZ F;  4L18 B;  2EIL H;  3C2B A;  2BXZ A;  4LLG F;  1S7A A;  2F5D A;  1LDD A;  4YIR X;  1V3F A;  2XDV A;  4RB0 A;  1P9Q C;  3WG7 H;  2Z99 A;  3CES A;  2GBY A;  3FIW A;  4RGU A;  3HBL A;  1OYI A;  1Y8R B;  1GUU A;  2FQ3 A;  4MLO A;  1IN5 A;  1IC8 A;  2CH0 A;  2QGU A;  2ZXI A;  2JVG A;  2JVH A;  2LG4 A;  2OU2 A;  3ZMZ A;  4ZDL A;  3K4K A;  3HUG A;  5DS9 A;  3AG2 H;  3S17 J;  1PUF B;  2P81 A;  1S29 A;  1K83 J;  4RM3 A;  2KIU A;  2DN0 A;  4HDV A;  2XF5 A;  2XAJ A;  2GIZ A;  4NDL A;  4RB3 C;  1FT9 A;  1J2X A;  2XAG A;  1FZP B;  2R4G A;  3S14 J;  4ZYD A;  1RNL A;  2CS3 A;  3WOD F;  4EJT A;  3P5J A;  2E2H J;  2XPU A;  2OF7 A;  4IHS A;  2Y0S N;  2MG4 A;  4UUS A;  1HQC A;  2QCO A;  9ANT A;  2PFB A;  3TO7 A;  2ZNZ A;  3HXL A;  3V7R A;  3HOV J;  2F5C A;  5KHD A;  4P9U A;  5H2F C;  2LOO A;  2HZT A;  4LG0 B;  2VJ4 A;  2KRH A;  4G6Q A;  4HLX A;  4M3B A;  4ZJZ A;  5FKL A;  2CQK A;  1MBH A;  3IH3 A;  1FIP A;  1HDP A;  5L3F A;  2W25 A;  4LFU A;  3VYT B;  4W97 A;  5E17 F;  1YX5 A;  1GV5 A;  3ASN H;  2L01 A;  2NVQ J;  5LEK A;  1SVO A;  2X48 A;  3OS1 A;  2ZXH A;  2GAU A;  3ZQF A;  4ASN A;  2M8E A;  1O3T A;  1WI9 A;  3S3M A;  1IJW C;  2CW8 A;  3CLQ A;  2ZJR F;  2PJR B;  1P4X A;  5LGT A;  3SJM A;  1R5G A;  4OMY A;  1WCM J;  4RM2 A;  3I54 A;  2XF6 A;  2DW4 A;  3FHN A;  3E97 A;  2AQF A;  2F2E A;  2XIG A;  1KZH A;  2OUM A;  3BR6 A;  2OV7 A;  5GAD J;  1ZAR A;  3BC8 A;  2HQR A;  3PJR A;  3S2H J;  3F8F A;  2E1M B;  4A0Z A;  2LY1 A;  1KYZ A;  2JSC A;  3CF2 A;  3KP6 A;  2A05 A;  2O9L A;  3QP5 A;  3FXU A;  2VJ5 A;  5AIQ A;  4A6E A;  1D1A A;  3OR1 C;  1G3W A;  2A07 F;  1FMV A;  3PFY A;  2LK2 A;  2IXS A;  3NAR A;  2DLL A;  2QQ9 A;  1W7P D;  1J59 A;  4HNT A;  1TW2 A;  1HLV A;  3CCV I;  4E4H A;  3H9J A;  4HQE A;  3OOU A;  3LMM A;  2BZT A;  2IAI A;  2BY1 A;  1J09 A;  3H5R A;  1E2X A;  3W2W A;  4IVN A;  4BH9 A;  4KIT B;  3ABL H;  3JRH A;  1CQT A;  1J0R A;  3JRA A;  3K1P A;  3HL2 A;  3IWF A;  1A36 A;  5HS8 A;  1U0J A;  4JP0 A;  3GF2 A;  3HHH A;  5D5X B;  2IS6 A;  4II3 A;  1V54 H;  2LC2 A;  2ECC A;  3H3V K;  3FM5 A;  5EYR A;  5EF6 A;  3GX4 X;  5IP7 J;  4LIU A;  2XB0 X;  4I76 A;  3WG9 A;  1IV8 A;  3LL7 A;  4EGZ A;  1RUO A;  3OL3 A;  1SAX A;  2O8X A;  2HOA A;  4PJM A;  3O6B B;  5FO5 A;  4E7S A;  1UJ8 A;  2FOK A;  4ABZ A;  4IHY A;  1LB2 A;  2HQN A;  3TL4 X;  3BR0 A;  5JHU A;  2GXG A;  3LOC A;  1FJL A;  2P6T A;  2Y2Z A;  4ZTJ A;  4ZTF A;  2OBP A;  3T8T A;  3WE3 A;  3ZGK A;  4F92 B;  1NK2 P;  3E6B A;  1JKO C;  3QPL A;  2MC3 A;  3CF5 F;  3Q9S A;  5FKM A;  4ENM A;  2EIK H;  1JJ8 C;  4XLE A;  5K7F A;  1GDT A;  1D0X A;  4JX6 A;  3BTJ A;  4LD5 A;  2HVQ A;  1DGW Y;  3CDI A;  3ML6 A;  4FE7 A;  2KRF A;  3ERE D;  2B9S A;  3KFW X;  3UR3 C;  1ZRD A;  4XIC A;  3I4M J;  2KZG A;  2KT0 A;  2DOE A;  3S1R J;  4QSH A;  2ZME B;  3MZ8 A;  2K9M A;  4WXH A;  1SAU A;  2W82 A;  2ZSH B;  3DPU A;  4HF0 A;  4CSW A;  1BC8 C;  3PO2 J;  2OPT A;  3D5L A;  2E35 A;  2PN6 A;  2YR2 A;  3OSF A;  5M5Y J;  1V5F A;  3OIO A;  1MH4 A;  3LA3 A;  1KON A;  4Y52 J;  1HOM A;  4PJJ A;  4XR6 A;  3F21 A;  1BJA A;  3IH2 A;  4P96 A;  4Q47 A;  1UAA A;  2BW3 A;  3E1S A;  1R6R A;  4XLN F;  3SDB A;  4BQQ A;  1VQO I;  3HOU J;  3VEP A;  2EJR A;  2CFX A;  3FZV A;  4RA2 A;  3X2Q H;  4CCM A;  2QEX I;  1XSD A;  4NNJ A;  3BP8 A;  1UHM A;  1W0U A;  1A5J A;  3J7A Y;  1T39 A;  3S3O A;  1KGS A;  1OR7 C;  2TRT A;  2KKO A;  2BY2 A;  1DQU A;  3TBI A;  3C2H A;  1OCO H;  2QLZ A;  3QPS A;  4IOC F;  2F4O B;  3NQO A;  1F4K A;  3O8H A;  1B8I A;  3GZ5 A;  2MFZ A;  3CJT B;  5D8L B;  5F64 A;  2ZBK A;  4G12 A;  4ENN A;  1ZG1 A;  1IXS B;  1P6R A;  1SFK A;  4B4C A;  2YX7 A;  3V8L A;  4HRI A;  4A5M A;  1U5T A;  2VT2 A;  4EM0 B;  1U78 A;  4X6A J;  2OCC H;  3M3Y J;  2DMN A;  4BHP A;  2RN7 A;  1HC8 A;  5JLX A;  2XB5 A;  1QU3 A;  1WHU A;  3HSE A;  1T2K A;  2M0C A;  3K69 A;  4NC7 A;  4BHC A;  2L9S A;  1FOW A;  1PP7 U;  2L7F P;  3VPR A;  1T98 A;  1ON2 A;  3CUO A;  1XTA A;  2OQR A;  3OYI A;  2F4M B;  3M07 A;  3SFI A;  3O3K A;  5IYC J;  3REO A;  1Q1H A;  3RPU A;  3K4M A;  4FIS A;  1EH8 A;  5CVV A;  4C3J J;  5C4J J;  3K10 A;  2MLG A;  4HA8 A;  3RDI A;  1FTT A;  4A3D J;  3LSH A;  4AU7 A;  2OTL I;  2STW A;  1EF4 A;  1BI3 A;  4HPQ A;  1X1B A;  4XBF A;  4IZZ A;  2V1N A;  4M9X A;  1TZL A;  5HDK A;  1BI1 A;  2Q2E B;  1LE8 B;  2DA3 A;  1KU3 A;  3DKY A;  2KIS A;  2FUG 2;  1OMI A;  3GLX A;  3GTP J;  2ZB9 A;  3FK7 A;  4G8X A;  1SAN A;  4OOI A;  4IKF A;  2ME6 A;  3DF8 A;  3GEZ A;  1MNE A;  4HV5 A;  1S5L C;  4XRM A;  5LRR A;  3MAJ A;  2FNA A;  4C3H J;  1MDM A;  1ZRC A;  2HOE A;  3K4C A;  2F4I A;  5ILV A;  2UV1 A;  5HLI A;  3TQN A;  1HKQ A;  1MMN A;  1M1E B;  2STT A;  5LHI A;  2J5O A;  1W5T A;  5KK1 A;  1H8A C;  3BOQ A;  4F91 B;  1DP3 A;  3FXR A;  1ETX A;  2CGP A;  2DJN A;  3TP3 A;  4LMY A;  2GWR A;  3SXY A;  4IHT A;  1MBF A;  3H5N A;  3PSI A;  2ZXW H;  3FBN B;  2EFN A;  1IRF A;  1ETW A;  4M3F A;  2A69 F;  3I5U A;  3HOZ J;  5D5V B;  4PCQ A;  1HF0 A;  3D5S C;  4DBQ A;  4PUS A;  1LNW A;  4BE1 A;  5HOD A;  3EYY A;  2QZ8 A;  4C3I J;  3BCB A;  2CV1 A;  3I59 A;  1W1W E;  2CSO A;  4G7Z F;  2ME0 A;  2D2W A;  1Z0X A;  3L9F A;  1Y1V J;  2GIV A;  3HUG B;  2FOW A;  2KRC A;  2DDA A;  2O7O A;  2O5R A;  2I8D A;  1K7A A;  2LMD A;  3ERM A;  1OPC A;  4E7J A;  3G2B A;  1X3Z B;  5IOZ A;  3CUQ C;  2JWT A;  5B5E C;  1QO0 D;  3DLA A;  1CF7 A;  3RIR A;  3CP8 A;  2OC6 A;  4M3E A;  2VC1 A;  3M7G A;  3RI4 A;  1FOK A;  2JQ7 A;  4M9S A;  3G71 I;  3B73 A;  3K4B A;  1SMY F;  3DBL B;  3ZMU A;  2DA1 A;  4LB6 B;  2LRE A;  2HXO A;  4RGR A;  2EIM H;  2BEO A;  1R00 A;  4KUM A;  4BKX A;  2FEZ A;  2XAQ A;  5KAF C;  5IP6 A;  1XD7 A;  2GA2 A;  2QM3 A;  3J80 K;  3J81 K;  2BHY A;  3ZOB A;  1I50 J;  5GP9 A;  2WAE A;  2YSR A;  4EAT A;  1ETV A;  3L2R A;  3F72 A;  1JI8 A;  2WB1 N;  2XC7 A;  2LRD A;  4RGX A;  5DYM A;  2P5L C;  3Q9V A;  3DCF A;  3FXQ A;  2R7Q A;  1SD7 A;  3KLN A;  1MJA A;  3BZ6 A;  3BPX A;  3ZQI A;  3FK6 A;  4YIF A;  2WAF A;  4G7H F;  5FFX A;  4CHU A;  3BR3 A;  3R0J A;  3Q0V A;  1I6H J;  4HG2 A;  4Z2Y A;  2DMT A;  1UG0 A;  1YI2 I;  2X1C A;  3GLL A;  4HAM A;  5J1Y A;  1FBS A;  2K9N A;  1RC9 A;  4U7D A;  1MJ9 A;  3BJA A;  1KQ9 A;  1FBQ A;  1LUJ B;  2E1M C;  4J01 A;  2Z3Y A;  1AA7 A;  1DUX C;  3IHU A;  1ON1 A;  3UKG A;  3H1C A;  2UXN A;  3IL2 A;  2H6B A;  2DPD A;  4HF1 A;  1NTC A;  2BYV E;  2DI3 A;  4XKW A;  3E5Q A;  1MKM A;  4JBA A;  3M8E A;  4U87 A;  1LFP A;  2XAU A;  1Z6R A;  1VQL I;  4UVC A;  2VOP A;  2HXI A;  3WGH A;  4FX0 A;  5J1U A;  1KQ0 A;  1ZR2 A;  2X6X A;  3OYD A;  3TW7 A;  4XSZ F;  4ZDO A;  1DU6 A;  2Y9Z A;  4BJ5 C;  4WF2 A;  1UCR A;  1LJ9 A;  2L3D A;  1U2W A;  5JI6 A;  2PBI A;  1USS A;  1JT0 A;  2C6Y A;  3V8J A;  4PZJ A;  4KMF A;  3IAM 2;  3KYD B;  2NNY A;  5JHF A;  1JGS A;  4Y15 A;  1R5H A;  2K4J A;  4BXU A;  4EM1 A;  1S8N A;  3A0H C;  3I3L A;  1O3Q A;  4BY1 J;  1MIJ A;  2EZL A;  1FC3 A;  4XM3 A;  2NS7 A;  4XL9 A;  4BXX J;  4H0E A;  4YFX F;  2FRH A;  4UV8 A;  3GUD A;  3LNQ A;  2JA2 A;  3FXO A;  1GHC A;  3HTS B;  3FIS A;  3H3Z A;  1SD5 A;  3ZQQ A;  4ZZD A;  2HPI A;  5K5O A;  5HLG A;  4XN0 A;  2H1K A;  5F6F A;  1P7J A;  4Y7N J;  1K78 A;  1DPU A;  1VF9 A;  2QYO A;  4W1U A;  4CH7 A;  1FOY A;  2PJP A;  2HTS A;  3WHB A;  3BG3 A;  5EG0 A;  5DV5 A;  4L0Z B;  3PIO F;  2K86 A;  3FM3 A;  3HOY J;  2E1O A;  4I6Z A;  3CD6 I;  2VIX A;  1IN4 A;  1MGT A;  2KP6 A;  3PQK A;  1X1A A;  2DA5 A;  3IC7 A;  4UXN A;  4N0B A;  4BNC A;  1MZB A;  3S1N J;  2VJJ A;  1YOV B;  3KX2 A;  4BDZ A;  3I71 A;  2DK8 A;  3AG1 H;  4XKB A;  2DXI A;  1TNT A;  4F7Z A;  1LVK A;  2FNP A;  4I99 C;  3MZH A;  3GW2 A;  5FRO A;  3FMS A;  3H5A A;  5ERI A;  3M1C A;  5EGO B;  2LTP A;  1WJA A;  4L9V A;  2RQP A;  3GVA A;  5CVJ A;  1ENH A;  3OY9 A;  2M34 A;  3DQV C;  1G2H A;  3G6E I;  3OYE A;  4HX7 A;  2QBY B;  1K6Y A;  2BVM A;  2X6W A;  4M9Z A;  5F0C A;  1FIA A;  2DJI A;  2P5K A;  1FP1 D;  2QKM B;  4BE2 A;  5E8G A;  1ZRE A;  2PX9 A;  3V8K A;  2MSY A;  3JRB A;  1YE9 A;  2DTR A;  4TV7 A;  2MA3 A;  1TP4 A;  1Z7L A;  3TDZ C;  3BTL A;  2R92 J;  2NS0 A;  3EQL F;  1IUY A;  2LNB A;  2Z5U A;  2IS2 A;  1FYM A;  4CYD A;  2FQ4 A;  3OYL A;  4A3F J;  3OOP A;  3PSF A;  1R1T A;  3W2A A;  1WRJ A;  2X1D A;  1SFE A;  3W2V A;  2Y0M A;  4UNO A;  2NXN B;  2K9L A;  2ZFU A;  1APL C;  3VSL A;  4GXO A;  1N77 A;  3PFI A;  2PLY A;  3RKX A;  1JJ6 C;  2DOD A;  1G8X A;  2EFQ A;  4BQO A;  5B66 C;  2VXD A;  2JA7 J;  4Y13 A;  2K3F A;  1SEU A;  2YU9 J;  2VON A;  1MNM C;  1IAW A;  2E2I J;  4G7O F;  4GFB A;  1WJB A;  3LQR A;  2Z33 A;  2ZKZ A;  3WU0 A;  2KJC A;  3RPU D;  4KIG A;  4HEA 2;  2QWW A;  2PI0 A;  3G4S I;  1F43 A;  2NS8 A;  2CG4 A;  3ZXS A;  1IDZ A;  4ESF A;  1IRX A;  3B6C A;  1NG6 A;  1XMX A;  2E36 A;  1U9N A;  4MTE A;  2Y31 A;  2Q8K A;  4OIN F;  1AOY A;  1A6I A;  2VT3 A;  1OYW A;  2DA4 A;  4HZF A;  5C4X J;  2IW5 A;  3K1N A;  1D3Y A;  1BW5 A;  2XAH A;  5E3L A;  3VSK A;  4MIM A;  5E1W A;  3CO7 C;  2M87 A;  1E3H A;  1N25 A;  4AYB A;  2OD5 A;  2HVS A;  4KA4 A;  1I39 A;  1MSE C;  3K0L A;  3JSO A;  2E1N A;  1VQM I;  1EKE A;  2EZI A;  3GCM A;  2DFH A;  2GM4 A;  4N9H A;  3ZQC A;  4V19 K;  3F22 A;  4L5E A;  1TWF J;  5ICF A;  2H09 A;  2QQB A;  2L5Q A;  5FLX K;  4PSW A;  2VN2 A;  3VYS B;  2X6O A;  1B1B A;  2MC4 A;  3KCC A;  3V4G A;  5GAE J;  1LPQ A;  3FKI J;  4D5C A;  2M4G A;  1ZEL A;  2RNG A;  2M7B A;  4PGH A;  2IGO A;  5DCF A;  1R58 A;  2DMU A;  2QVO A;  1FPQ A;  3JW4 A;  3FXM A;  2UZK A;  1TWC J;  3GO5 A;  4E7I A;  2D1H A;  2FBI A;  4X1E A;  4WCG A;  2ACJ A;  2F5V A;  3LSJ A;  4CZZ A;  2HWV A;  3IWZ A;  2BY0 A;  1QZE A;  1XC5 A;  3BZK A;  4Z6Y A;  2DK5 A;  4KN7 X;  1YJN I;  1O3S A;  5L3D A;  3KET A;  3ROU A;  1IV6 A;  1NG7 A;  3LSM A;  4A2U A;  2GXA A;  2EPF A;  5K7Z A;  3OS0 A;  4NB5 A;  2IGK A;  3M4O J;  5JR3 A;  4LB5 A;  2E5Z A;  4E7Z A;  2HEO A;  1ZK8 A;  3HRU A;  2BGC A;  2X85 A;  2P8T A;  1FOX A;  2PEX A;  1UFM A;  2RQQ A;  2E34 A;  3GFM A;  3MEX A;  2NVU B;  4XON A;  2IGN A;  2NRA C;  1AWC A;  2R7T A;  3SZP A;  4BQA A;  2VKD A;  4D7M A;  1GV2 A;  3DKW A;  4XNF A;  2FX0 A;  1Z1D A;  4ZC3 A;  4JX4 A;  4LK0 F;  3SDG A;  1L0O C;  2L7Z A;  3E3V A;  4QWQ A;  3LSK A;  4XOT A;  5LLQ A;  2R7Z J;  1BI0 A;  3CME I;  2VOD A;  5J4V A;  3TW6 A;  3DEW A;  1UHW A;  1IZ1 A;  3PNV A;  4KYW A;  2EWN A;  1X4O A;  2OZ6 A;  4BEH B;  4I98 B;  1UZC A;  2VKE A;  1QNT A;  5J6X A;  2OCE A;  2V9P A;  5M3F J;  2HNH A;  5D4R A;  3K4J A;  1WZ2 A;  4ESJ A;  3BWG A;  2EIJ H;  3I4P A;  2KLO A;  4AUX A;  5IOY A;  4MGR A;  2WWY A;  3CCS I;  5F27 A;  2LD5 A;  4IHV A;  1S7O A;  2VQL A;  5F1R A;  2EV6 A;  4A6D A;  5EEH A;  2EA4 A;  1WKM A;  3ZN1 A;  3DEU A;  4DYC A;  2ETH A;  3BQZ A;  2ZJP F;  3ZPL A;  2BBY A;  1D1B A;  2ELH A;  2XSJ C;  1WJC A;  2L7M P;  3E7L A;  2W7N A;  4AYB N;  2CYY A;  3FXK A;  1W36 C;  5CYV A;  1XMK A;  4LG0 A;  1WJD A;  2X4H A;  2XF7 A;  2VE9 A;  3CC4 I;  5K1Y A;  3JTG A;  5D8K B;  1X58 A;  2ZFW A;  1FYL A;  3SZG A;  4MEY F;  1S6L A;  2VBX A;  4M6X A;  1B9N A;  2LBF B;  2LFB A;  3GWZ A;  3TGN A;  3B02 A;  3F8M A;  3BQY A;  5GTI C;  4D9J A;  4RMN A;  3HTU A;  1T0F A;  2F5E A;  4F93 B;  3LST A;  3K4L A;  2M0M A;  1RZ4 A;  3QU6 A;  4RGS A;  4BY7 J;  3D1N I;  1OKR A;  4LIT A;  2MBF A;  2HOT A;  4U0V A;  2LKS A;  4A3E J;  2GA1 A;  2PMH A;  1HDD C;  2IS1 A;  2FD5 A;  3HIF A;  1R71 A;  4PDK A;  3N97 A;  4RBO A;  2V79 A;  1RI7 A;  1Z3X A;  3S93 A;  1I1G A;  2WA0 A;  1MBG A;  1K61 A;  2L4M A;  4RLF A;  4UV9 A;  4AIK A;  4BBS J;  3ZR8 X;  1BIA A;  1W5C C;  5HS7 A;  3GTG J;  4XLP F;  2EFW A;  5F04 A;  3HG9 A;  2HI3 A;  4B3X A;  3W6K B;  2A6H F;  5CQE A;  1BR2 A;  3VOE A;  2R7X A;  4EMS A;  3M8F A;  2XPV A;  1WH7 A;  4P55 A;  1HW5 A;  1V5E A;  1Z21 A;  5TJJ A;  2XKO A;  1LEB A;  2IA2 A;  1ZGW A;  4EM2 A;  1R23 A;  1ETQ A;  2VKH A;  1TBX A;  5AIP A;  5D6F A;  4RAF A;  4HYE A;  5HDG A;  4BEH A;  3ZQH A;  1MMA A;  1X3W B;  2RVC A;  3A03 A;  3LSG A;  5EG0 B;  3LAP A;  1ZRF A;  5LHG A;  2BVL A;  3BPV A;  1XG1 A;  4OIP F;  2H8R A;  1FLI A;  4D7N A;  3FWE A;  1YJ9 I;  3MKL A;  1XB4 A;  2W85 A;  2E7W A;  2EIN H;  4AID A;  5CVR A;  3CCE I;  1D8J A;  2WAQ N;  3RQI A;  3KYL A;  2P6S A;  4N4O B;  3J7Z I;  1JHH A;  4NC6 A;  3ABK H;  2COB A;  2KJB A;  1IN8 A;  2IA0 A;  1VQK I;  2VUM J;  4UVA A;  4OIR F;  2MD5 A;  1O7F A;  3K4N A;  3S15 J;  3PNT A;  2IBD A;  1TWA J;  4UUS B;  3GFI A;  3K6G A;  4DGW B;  5IPA A;  1G59 A;  3WHC A;  1RR8 C;  1XGM A;  1ETO A;  2XSD C;  4XLH A;  1O4X A;  5HS9 A;  1VQ9 I;  2CMP A;  3HRT A;  3DU6 A;  3VB2 A;  3DU5 A;  1YTY A;  1O57 A;  1R1V A;  3AKZ A;  3TP0 A;  1VI0 A;  2RC4 A;  1CF7 B;  4CA0 A;  3N05 A;  4O3M A;  3K7A J;  2HGC A;  2QQ8 A;  2HOS A;  4YEJ A;  4S05 A;  4XMY A;  2HTJ A;  4GO1 A;  1NK3 P;  3VYU B;  4E6K G;  3WTX C;  2CWE A;  5EZG A;  2CQQ A;  3OYG A;  1VQ7 I;  4OIQ F;  2AS5 F;  2WV1 A;  4M74 A;  3JRF A;  2E1C A;  3G73 A;  3KP3 A;  4GGG A;  1BN5 A;  3ZQ7 A;  1QPI A;  3H9G A;  1OR7 A;  4B8X A;  2HU9 A;  1EH7 A;  2B0L A;  2IEK A;  5GAH J;  2VBZ A;  3O8G A;  3VFZ A;  2R3S A;  3AG4 H;  3GME A;  1IRG A;  3H0G J;  1HXD A;  1ODD A;  3F9K A;  2FMY A;  3LA7 A;  2UUZ A;  2RRE A;  3HC7 A;  1DGR M;  3I59 B;  4CCN A;  4HF2 A;  4ITV A;  3LSI A;  1P4A A;  5TRD A;  4HST A;  5J8F A;  2VL8 A;  3H9Q A;  1BR1 A;  1FMW A;  3RYP A;  4E70 A;  3H3U A;  2P7V B;  2WAD A;  2NVX J;  1UST A;  5LD2 C;  4I2O A;  4MQV A;  3U1K A;  2IP2 A;  4AWX B;  3OYC A;  2G7U A;  4S04 A;  1OLT A;  5ICE A;  3C3W A;  1IDY A;  2R5Y A;  1HA8 A;  2DPU A;  4I02 A;  2HR3 A;  5BMZ A;  1I1S A;  1HBX G;  1VQ8 I;  2L0K A;  3V7C A;  3ELK A;  4CXF A;  4KDP A;  4CCO A;  2R7S A;  5FLV A;  4DBR A;  1U9O A;  2ADU A;  3I58 A;  4L9T A;  2M8G X;  2ZO4 A;  2DMP A;  2AXT C;  3DTE A;  4A3I J;  4ZH4 F;  3BY6 A;  3S1M J;  4HLY A;  4XQF A;  3HOS A;  1QVT A;  2F48 A;  3D0S A;  3HJE A;  2IT0 A;  4EJV A;  4Q5S F;  1D1C A;  1BJZ A;  1SD6 A;  1TW3 A;  3OYB A;  1HW1 A;  3BTI A;  2CQ7 A;  2NVY J;  2K02 A;  3GXO A;  1B59 A;  4DZJ A;  1V4R A;  3Q0U A;  4JX5 A;  1Y56 A;  2W48 A;  1VQ6 I;  3E0J B;  1BW6 A;  2DA2 A;  3OYA A;  2L9R A;  1HSJ A;  2CO5 A;  3ISP A;  2HKO A;  1VQP I;  4B48 A;  2X6Y A;  2L9N A;  1XDU A;  4WXD A;  3U2R A;  3OYF A;  1IXR C;  3TKY A;  4Q4Z F;  2VKV A;  3MD2 A;  2ISY A;  2ZME A;  2EB7 A;  2ID6 A;  4OIO F;  1WJF A;  3PUF A;  5KVR A;  1QHG A;  2EBI A;  2HQA A;  2E60 A;  3GYH X;  1FX7 A;  4XSX F;  4XRF A;  2QUF A;  3MN2 A;  2Y9Y A;  3ABT A;  5HVQ C;  1YHQ I;  4KIB A;  2DYR H;  3OL4 A;  4OAY A;  2K5C A;  2LKX A;  6PAX A;  2R7R A;  3S1Q J;  3NRV A;  1P92 A;  5KAI C;  3KYC B;  3L2W A;  1ZLJ A;  2DTZ A;  3PM1 A;  1RES A;  2HDW A;  2KDZ A;  1TC3 C;  2GOM A;  2VE8 A;  3R61 A;  5A2Q K;  2W84 A;  1DP7 P;  1W5S A;  3PQJ A;  4Y3O A;  3BT9 A;  4FTH A;  1STZ A;  2OZU A;  3KP7 A;  3KZY A;  2FSW A;  2IRF G;  2R5Z A;  3RCO A;  2KIF A;  1EJ9 A;  1BI2 A;  2DDB A;  3BG5 A;  3MZY A;  1XX5 A;  1J75 A;  1BBY A;  1E17 A;  2CRG A;  2QEN A;  3HOX J;  5L3B A;  3D5R C;  3OSG A;  4WXC A;  2HKX A;  2I10 A;  1WPK A;  4JQF A;  1K78 B;  4LK1 F;  2LSO A;  4JYK A;  4N4N B;  2JSP A;  1Z05 A;  2G0E A;  2XUB A;  3C2G A;  1I6X A;  2M2E A;  1XGO A;  1Y0N A;  2WY7 Q;  1T08 B;  1R7J A;  2VC0 A;  4RB2 C;  2OQG A;  3SHF A;  3U1D A;  3CCQ I;  2DCE A;  3LFU A;  3J7A O;  1OCR H;  2DMQ A;  2DA7 A;  1K4T A;  2DYS H;  3I4N J;  1QBJ A;  3RYR A;  2Y0S A;  3KE2 A;  4ENK A;  2EQR A;  5DD8 A;  1YIT I;  1TL8 A;  3CDH A;  3BR5 A;  3G3Z A;  2HPM A;  5BPD A;  4WX9 A;  3ZMT A;  4KMU X;  1E0E A;  1KA8 A;  1VFC A;  3HGG A;  4LIV A;  2E5N A;  4FQG A;  2Q2E A;  4KJZ A;  3W6J B;  2JTV A;  4I09 A;  3T5X A;  5H6R A;  2X0L A;  2WY8 Q;  5HLT A;  4CYC B;  3EUH A;  4CGZ A;  1MW7 A;  3FXL A;  2CW7 A;  1S9H A;  4R79 A;  4LLL A;  5IT3 A;  3ABM H;  4QTR A;  4E7H A;  3AL0 C;  1IG7 A;  4QPQ A;  3DFG A;  5D4S A;  3JAM Z;  3ESW B;  3FDY A;  3MKZ A;  1MDM B;  2FBK A;  3ZQG A;  3F8C A;  2RKH A;  3HRS A;  5DM7 F;  3CLO A;  3J81 Z;  3V42 A;  4CO8 A;  3KEO A;  2EV0 A;  3LQQ A;  3RKW A;  4BJ6 C;  5ILU A;  2KPM A;  3K9T A;  1MD0 A;  1ZGA A;  4FX4 A;  3SFZ A;  1NH3 A;  2R7D A;  1YRN A;  3QOE A;  3W6V A;  4A12 A;  2ESH A;  2WTE A;  4NBQ A;  3ZRG A;  3T0Y A;  1ZN2 A;  4XOR A;  3JRE A;  3COA C;  1MMD A;  3MCZ A;  3MVP A;  2R7W A;  1W36 D;  2JJ7 A;  3VDX A;  1SFO J;  2P7C B;  1KU7 A;  3VYR B;  4A3G J;  2O3F A;  2PMZ N;  3B6A A;  2IGM A;  4S0H B;  4J19 A;  1JUP A;  3LWF A;  4OAZ A;  2VAS A;  5DTD A;  3H92 A;  1PVE A;  2CQN A;  4D0P A;  3RSN A;  3CC7 I;  5EDN A;  1I27 A;  4PJL A;  2RV8 A;  1PYV A;  4DW6 A;  2X9D A;  4ZYG A;  1JTY A;  1FBU A;  2DAO A;  2CUE A;  1WQ2 A;  3I53 A;  1SVL A;  5FB2 A;  1R36 A;  5J47 A;  4MFE A;  2M5W A;  4BYY A;  3H0D A;  1Y8Q B;  1XDS A;  3PNY A;  4IQ4 A;  1ETY A;  2HYF A;  1IGN A;  1JT6 A;  5GPC A;  1TNS A;  1SFX A;  1OCC H;  1YG2 A;  3DPT A;  4UB6 C;  4XK4 A;  5BQT A;  1REP C;  4MEX F;  2DFF A;  3ZMV A;  1W7P B;  3QOP A;  2LLK A;  5TIS C;  1FSE A;  1YO5 C;  2VBY A;  1FNN A;  1HKS A;  2Z9O A;  2G7H A;  1D5Y A;  2EA2 A;  2EK5 A;  1E3P A;  2JUG A;  1Y6I A;  2NNN A;  5E20 A;  1GVD A;  3WGI A;  5EEG A;  2JN6 A;  2R7O A;  2HZD A;  2PMZ A;  5HLH A;  1G4D A;  3AL0 B;  2M9H A;  4IF4 A;  3CMY A;  4HOB A;  1FY7 A;  2CQX A;  2E2J J;  2A6T A;  5DDG A;  3JTH A;  1WJE A;  3P9I A;  3OMY A;  4PFP A;  3C18 A;  1LFU P;  2WBM A;  5D5U B;  2FJ1 A;  3R4K A;  1XN7 A;  1T38 A;  1P4W A;  2JA5 J;  1TQI A;  2GOX B;  2VJI A;  3I0T A;  3HKZ A;  5CVI A;  4GYG A;  4MQ9 F;  5LGU A;  2VLA A;  1X2N A;  1J9I A;  3HDD A;  4IXA A;  3WTT C;  1WVR A;  4G94 A;  3GTM J;  3FKJ A;  1YS7 A;  4A3K J;  2D45 A;  2LYC A;  3HM5 A;  1JKP C;  2L54 A;  1B4A A;  3KP4 A;  1ZR4 A;  1EH6 A;  1GXQ A;  2PQ8 A;  1FWZ A;  2JT1 A;  4ZYH A;  1FEX A;  1Z7U A;  2BXY A;  3AFH A;  3SEQ A;  3ULQ B;  3MKW B;  4IOA F;  2V1U A;  2JK3 A;  4DZP A;  5K5Q A;  4C30 A;  1MMS A;  3R6S A;  1QRY A;  3OYJ A;  3OYM A;  2NOJ B;  3TOA A;  3HOT A;  3DWL E;  2M30 A;  3GFL A;  2L9V A;  3EET A;  2VI6 A;  3DP7 A;  4MNU A;  3MQ0 A;  2XV4 S;  2Y48 A;  3QPT A;  5FKK A;  3E6D A;  2A61 A;  4AVZ A;  4WK8 F;  1OIS A;  1ERD A;  3F8N A;  4HBL A;  3OYN A;  1IO2 A;  3A2K A;  4CZC A;  2H27 A;  1G3S A;  3M9A A;  3TDU C;  4DOZ A;  1DPR A;  5FKN A;  3L1P A;  1JGG A;  2MGQ A;  2FE3 A;  4ZYA A;  4B43 A;  5IT9 Z;  1D0Y A;  3F0C A;  2MH9 A;  4R8H A;  1ZYR F;  3CCR I;  3BZC A;  4E7L A;  2Q0O A;  2HFH A;  1QGP A;  2D1V A;  4FCY A;  3GZN B;  2VXZ A;  4YEL A;  3H35 A;  2W24 A;  5E3M A;  2H1L A;  5HDN A;  2VPR A;  4H4K C;  3MWM A;  3A4C A;  3QRF F;  1JKQ C;  4LG3 A;  3WGG A;  4ZDP A;  3KP2 A;  4O5V A;  5DUK A;  3JRD A;  2CV2 A;  2VOO A;  2HS5 A;  2P4W A;  1W4M A;  3LFK A;  2R7F A;  2JA6 J;  3TOB A;  3IRR A;  1N75 A;  3ZP5 A;  4UY8 I;  3WTY C;  4M6Y A;  4A3C J;  1BC7 C;  3CJQ B;  2DT6 A;  1D5V A;  2HYG D;  1EV7 A;  2OJE D;  4U7B A;  1ZH5 A;  2M3A A;  4XID A;  4L9J A;  2L02 A;  3QWL A;  2EZH A;  3ECH A;  3L00 A;  3P7N A;  4J00 A;  2K27 A;  1K79 A;  2JRT A;  5J3L A;  1OYY A;  4EGY A;  1T6S A;  4IHW A;  4O6J A;  1V55 H;  2DBB A;  3QYE A;  5CQG A;  1TTY A;  5ICG A;  2XAF A;  2YU3 A;  5J1R A;  4D1Q A;  1OCP A;  1TWG J;  2Z1D A;  1LEA A;  2XPW A;  5CLS A;  1GVJ A;  3LAJ A;  2A68 F;  2TDX A;  5E79 C;  3I64 A;  4KIC A;  5FD5 A;  3L2U A;  1FTZ A;  4B1R A;  4DIQ A;  2QQA A;  3CQZ J;  5IYD J;  1A04 A;  1ULY A;  1TQP A;  2JPB A;  2V9V A;  4PGG A;  1MBK A;  3EUH C;  2X1E A;  2WC2 A;  3GTL J;  2YX4 A;  3C7J A;  4BUP A;  4HNV A;  3OWT A;  4X0G A;  4DNC A;  3PIP F;  3A0B C;  3RZO J;  4B09 A;  5FKO A;  1ORK A;  3M8J A;  2MH2 A;  2QKL B;  5IY5 H;  3OIP A;  5E3O A;  4GDF A;  1T95 A;  1R49 A;  2MLK A;  3TED A;  2FXA A;  3EUA A;  5J4Y A;  3C1D A;  1U8B A;  5C44 J;  1H9G A;  5CVU A;  1TT5 B;  3E5X A;  5DM6 F;  4PSX A;  4EQQ A;  4DJA A;  4AIJ A;  2ZNY A;  1S72 I;  2LP0 A;  4EV0 A;  2M7A A;  4AM3 A;  4UUT A;  2O03 A;  1NHA A;  1YW8 A;  2V7F A;  4E7K A;  4I0A A;  1B72 A;  1MMG A;  1TQM A;  5CPR B;  5ED4 A;  4A93 J;  1PDN C;  4G6T B;  1RUN A;  1VQ5 I;  1H9T A;  4A3L J;  2E19 A;  1B6A A;  5ICC A;  2EZK A;  5FRM A;  2WV0 A;  3GBG A;  5M3M J;  4BGD A;  2EFO A;  4G9Y A;  4PJ0 C;  4XRS G;  3Q5F A;  4RLQ A;  1QZY A;  2AXL A;  3G1L A;  2O6G E;  1YIJ I;  1UMQ A;  2QBY A;  1R9T J;  1OQY A;  3QPH A;  4B3A A;  1RKW A;  1G3T A;  2K7L A;  5DEQ A;  4DYR A;  5B1A H;  4C2U A;  1MND A;  1XSV A;  2K9S A;  4KIS A;  1T56 A;  1ZAO A;  4FE4 A;  1BR4 A;  1YYV A;  4IEJ A;  3RQ4 A;  1ZG5 A;  3OV8 A;  3DBR B;  2L4A A;  1SMT A;  4ESB A;  5F0H A;  3GTK J;  1GLN A;  2Q1Z B;  4JK1 X;  4YRV A;  2O8K A;  4PJN A;  1H89 C;  1BOA A;  1IXC A;  1X4P A;  4IJA A;  1RR7 A;  3EPZ A;  3N4M A;  1Y39 A;  4C2T A;  5BNG A;  5KNL A;  1LKX A;  5BPI A;  3QQA A;  4BDY A;  1G3Y A;  4KT6 A;  4CYC A;  2XHK A;  3HEF A;  4HV6 A;  1VQN I;  1ZLK A;  1R1U A;  2ICW G;  3IKV A;  1ZG3 A;  3CO6 C;  3KP5 A;  2RNJ A;  3Q3S A;  1T33 A;  4IO9 F;  1HKT A;  2UWM A;  2F6C A;  2W1O A;  3G1O A;  4RAY A;  3E5U A;  2W00 A;  3CJN A;  1D8K A;  4OWR B;  3L2Q A;  1PUE E;  4L0Y B;  4HQM A;  2BE5 F;  1F5T A;  1ZTR A;  2D5V A;  4F3Q A;  3A02 A;  1XCV A;  3F8B A;  3SYT A;  3PL8 A;  5FGM A;  4XLA A;  3DLL F;  2IVM A;  1LE8 A;  3MFK A;  1RRJ A;  1BOB A;  3GTJ J;  5M5X J;  2K85 A;  2LF7 A;  3K2Z A;  1X3U A;  4MO7 A;  4XOP A;  4BQN A;  1YW7 A;  3L2C A;  2QA4 I;  5LEJ A;  4P9F A;  4YFN F;  3L7W A;  1HCR A;  3QYF A;  2YPR A;  3KEY A;  1OFC X;  4I0B A;  3FHZ A;  3TO9 A;  3RPQ A;  1Z3Y A;  2XRL A;  5EZH A;  4OMZ A;  1X1P A;  1XSX A;  3BTC A;  2XRO A;  1XGS A;  4ON0 A;  1ZKG A;  5IYB J;  1P2F A;  5FLX Z;  1ITY A;  4RS8 A;  3WTS C;  1U8R A;  4HW0 A;  3JRG A;  2I5U A;  1J7K A;  1F36 A; 
#chains in the Genus database with same CATH homology
 3BG9 A;  5GPA A;  2EBI A;  3HKZ N;  3S17 J;  5DS9 A;  1H88 C;  3MN2 A;  2P81 A;  1PUF B;  1K83 J;  1Q1V A;  5EGO B;  2LTP A;  2Y9Y A;  2DN0 A;  2R5Y B;  3S2D J;  1B8I B;  2LKX A;  1QVU A;  1ENH A;  3S1Q J;  2M34 A;  2LR8 A;  1G2H A;  2DTZ A;  4NDL A;  3PM1 A;  1RES A;  2KDZ A;  1TC3 C;  5F0C A;  1FIA A;  3S14 J;  1IUF A;  3CCY A;  3GTO J;  2E2H J;  2XPU A;  2OF7 A;  4FTH A;  2Y0S N;  3BT9 A;  2MG4 A;  2MSY A;  4UUS A;  3JRB A;  2QCO A;  9ANT A;  3HOV J;  2R5Z A;  3BG5 A;  3BTL A;  2R92 J;  4M3B A;  1JUS A;  5FKL A;  1MBH A;  3IH3 A;  1FIP A;  1HDP A;  2CRG A;  2FQ4 A;  3JRC A;  3HOX J;  4A3F J;  4A69 C;  4LOC A;  1OJL A;  4W97 A;  2EH3 A;  5F0F A;  1GV5 A;  3OSG A;  1AKH B;  2I10 A;  2NVQ J;  1WPK A;  2X48 A;  3PO3 J;  1VND A;  4JYK A;  3ZQF A;  1IJW C;  5F1J A;  2G0E A;  1APL C;  4D5F A;  1P7I A;  2HYJ A;  2M2E A;  3SJM A;  1WCM J;  1UG2 A;  1JJ6 C;  1ETK A;  2DMQ A;  4M6V A;  2DA7 A;  3BR6 A;  3I4N J;  2JA7 J;  3S2H J;  2EQR A;  2QF7 A;  4V2G A;  2YU9 J;  1MNM C;  2O9L A;  2E2I J;  3BR5 A;  4GFB A;  2AO9 A;  2LK2 A;  3NAR A;  4M3G A;  1VFC A;  3HGG A;  2ID3 A;  1F43 A;  1OCT C;  1HLV A;  2NS8 A;  1MH3 A;  1IDZ A;  3G1M A;  3OOU A;  3B6C A;  4CYC B;  4BBR J;  2XGC A;  2YUS A;  4RDU A;  1U9N A;  2IAI A;  2Y31 A;  2RAE A;  1AHD P;  2N8G A;  2GLO A;  4QTR A;  3JRH A;  1A6I A;  1CQT A;  2DA4 A;  1IG7 A;  3JRA A;  5C4X J;  4M3D A;  1WGX A;  4JP0 A;  1BW5 A;  2HQ5 A;  5E3L A;  3ZQG A;  4MFD A;  5M5W J;  4MIM A;  2ECC A;  3H3V K;  5EYR A;  5EF6 A;  3A01 A;  1TWH J;  5IP7 J;  2XB0 X;  2ECB A;  4I76 A;  5E3N A;  3LSP A;  1MSE C;  3S16 J;  2EZI A;  1YRN A;  3W6V A;  2R0Q C;  2GM4 A;  2HOA A;  3ZQC A;  2AHQ A;  4ABZ A;  3JRE A;  3MVP A;  4L5E A;  1DU0 A;  4IHY A;  2JJ7 A;  1JUM A;  1TWF J;  1SFO J;  3BR0 A;  4A3G J;  2PMZ N;  3LOC A;  3B6A A;  1FJL A;  4S0H B;  2Y2Z A;  1JUP A;  2X6O A;  4J19 A;  3FKI J;  5DTD A;  2YS9 A;  4D5C A;  4AC0 A;  5EDN A;  3A01 B;  1ZQ3 P;  1NK2 P;  2DMU A;  4DW6 A;  2X9D A;  1JTY A;  1TWC J;  5EEA A;  5C3E J;  1JKO C;  3QPL A;  4X1E A;  2CUF A;  2CUE A;  5FKM A;  3LSJ A;  4MFE A;  1MBJ A;  1JJ8 C;  1GDT A;  5K7F A;  1XC5 A;  1IGN A;  1ETY A;  4JX6 A;  3BTJ A;  1JT6 A;  5GPC A;  1PUF A;  4XK4 A;  1IV6 A;  4FE7 A;  2LLK A;  3HOW J;  5K7Z A;  4XIC A;  3I4M J;  2KT0 A;  1D5Y A;  3M4O J;  3S1R J;  4QSH A;  1ZK8 A;  3JRI A;  3PO2 J;  1GVD A;  2OPT A;  2XGE A;  3OSF A;  5M5Y J;  1S7E A;  2JN6 A;  3OIO A;  1MH4 A;  3LSR A;  2M9H A;  5FLM J;  4Y52 J;  3CMY A;  1HOM A;  2CQX A;  3IH2 A;  2E2J J;  4D7M A;  1GV2 A;  2FX0 A;  1LFU P;  3HOU J;  4JX4 A;  3SDG A;  2L7Z A;  2FJ1 A;  2JA5 J;  3ZQL A;  2HDD A;  2R7Z J;  1W0U A;  1A5J A;  1X2N A;  3TW6 A;  4A3B J;  3DEW A;  3HDD A;  1Z77 A;  2B63 J;  3GTM J;  2TRT A;  2VKE A;  4A3K J;  3QPS A;  3K2A A;  3HM5 A;  1X2M A;  5M3F J;  1JKP C;  3O8H A;  1ZR4 A;  1B8I A;  4XRS A;  4G12 A;  4AUX A;  5IOY A;  2LD5 A;  1FEX A;  4IHV A;  1LFB A;  5F27 A;  4B4C A;  4C2M J;  1Y1W J;  4X6A J;  1U78 A;  4QIW N;  3M3Y J;  2DMN A;  4DYC A;  2JK3 A;  5JLX A;  2XB5 A;  4DZP A;  3BQZ A;  1E3O C;  3NAU A;  3HGY A;  2CJJ A;  2M0C A;  4A3J J;  2JMW A;  1QRY A;  2L7M P;  3E7L A;  2L7F P;  1WI3 A;  3VPR A;  4AYB N;  3SFI A;  4A3M J;  5IYC J;  2VI6 A;  3Q0W A;  4FIS A;  1X58 A;  4C3J J;  5C4J J;  5FKK A;  1FTT A;  4A3D J;  2LFB A;  1EF4 A;  3BQY A;  4DYQ A;  2CU7 A;  3L1P A;  5FKN A;  1JGG A;  2MGQ A;  3F0C A;  4BY7 J;  3D1N I;  1LE8 B;  2HOT A;  2DA3 A;  5K7H A;  4A3E J;  1HDD C;  4FCY A;  3GTP J;  2FD5 A;  2ZB9 A;  3FK7 A;  5E3M A;  1SAN A;  4RBO A;  2ME6 A;  2VPR A;  1MBG A;  1K61 A;  1JKR C;  1JKQ C;  4IHX A;  4XRM A;  4BBS J;  3GTG J;  5F08 A;  3JRD A;  5EGO A;  5F04 A;  2HI3 A;  4C3H J;  2JA6 J;  1W0T A;  4A3C J;  2XPV A;  1WH7 A;  1POG A;  2K40 A;  5FJ8 J;  1ZGW A;  2LVS A;  1H8A C;  1ETQ A;  1ETX A;  4XID A;  1AU7 A;  1BA5 A;  2DJN A;  2EZH A;  5J3L A;  3TP3 A;  1MBE A;  3BR2 A;  3ZQH A;  3A03 A;  3LSG A;  5EG0 B;  4IHW A;  1MBF A;  1BL0 A;  1XG1 A;  2H8R A;  3IH4 A;  1ETW A;  4M3F A;  4D7N A;  2JA8 J;  5J1R A;  5JLW A;  3MKL A;  1MSF C;  3HOZ J;  1OCP A;  1TWG J;  1HF0 A;  2XPW A;  2WAQ N;  3RQI A;  5HOD A;  4C3I J;  1FTZ A;  2ME0 A;  4B1R A;  1Z0X A;  2COB A;  1JTX A;  2VUM J;  1Y1V J;  3CQZ J;  5IYD J;  3S15 J;  1MBK A;  2IBD A;  2O7O A;  2Y30 A;  1TWA J;  4UUS B;  3GTL J;  3GTQ J;  4HNV A;  3RZO J;  2NOG A;  5IPA A;  5IOZ A;  2JWT A;  5FKO A;  1ORK A;  5E3O A;  1IRZ A;  4M3E A;  3WHC A;  1ETO A;  3TED A;  2XSD C;  1O4X A;  1U8B A;  5C44 J;  2DA1 A;  3TP0 A;  2HXO A;  1VI0 A;  3HB9 A;  4BKX A;  2R93 J;  3BR1 A;  3K7A J;  5IP6 A;  2LP0 A;  2HOS A;  4UUT A;  1NK3 P;  3ZOB A;  2ELK A;  4EEF G;  1I50 J;  5GP9 A;  5EZG A;  1ETV A;  2CQQ A;  3IV5 A;  1B72 A;  2WB1 N;  2WV1 A;  3DCF A;  3JRF A;  4A93 J;  1QPI A;  3ZQI A;  3JR9 A;  2NVT J;  3FK6 A;  4A3L J;  2IEK A;  2E19 A;  2EZK A;  3O8G A;  2TCT A;  3BR3 A;  3GBG A;  5M3M J;  3Q0V A;  1I6H J;  3H0G J;  2DMT A;  4V2F A;  4XRS G;  1RPW A;  5J1Y A;  2DA6 A;  3G1L A;  2K9N A;  1UMQ A;  1R9T J;  4B3A A;  1RKW A;  4DYR A;  3UKG A;  2K9S A;  1UHS A;  2LY9 A;  2NVX J;  1T56 A;  4FE4 A;  4IEJ A;  1NTC A;  1RET A;  2R5Z B;  5F0H A;  3GTK J;  5IP9 J;  2HXI A;  1IDY A;  5J1U A;  1XS9 A;  2O8K A;  2R5Y A;  1H89 C;  1ZR2 A;  3TW7 A;  1RR7 A;  2L0K A;  1DU6 A;  2Y9Z A;  5BNG A;  1RKT A;  1YRN B;  3QQA A;  4CYC A;  2K9Q A;  1JT0 A;  1GT0 C;  3HEF A;  5FLV A;  1I3Q J;  1U9O A;  2M8G X;  2MW8 A;  2DMP A;  3Q3S A;  1T33 A;  1WH5 A;  4A3I J;  3S1M J;  3CDL A;  3RZD J;  1QVT A;  4BY1 J;  2EZL A;  3G1O A;  3RKQ A;  1AKH A;  2NS7 A;  4BXX J;  1BJZ A;  1ZTR A;  3LNQ A;  2XGD A;  2D5V A;  3BTI A;  2NVY J;  3A02 A;  3FIS A;  1B72 B;  4DZJ A;  4JX5 A;  3Q0U A;  1LE8 A;  3GTJ J;  5M5X J;  2H1K A;  4MO7 A;  2W48 A;  4Y7N J;  1P7J A;  3C2B A;  1VF9 A;  4W1U A;  1BW6 A;  1HCR A;  2DA2 A;  2L9R A;  1OFC X;  3WHB A;  3BG3 A;  5EG0 A;  5EZH A;  2XRL A;  3HOY J;  2E1O A;  4I6Z A;  2GBY A;  3FIW A;  3HBL A;  3BTC A;  2DA5 A;  1GUU A;  1ZKG A;  5IYB J;  1ITY A;  2VKV A;  4MLO A;  3S1N J;  3JRG A;  1IC8 A;  2ID6 A;  1F36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...