1IGNA

Dna-binding domain of rap1 in complex with telomeric dna site
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
235
structure length
189
Chain Sequence
KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLIRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEEPMKNLTPTPGNYNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*CP*CP*GP*CP*AP*CP*AP*CP*CP*CP*AP*CP*AP*CP*AP*CP*C
publication title The crystal structure of the DNA-binding domain of yeast RAP1 in complex with telomeric DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 53
structure length 189
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF09197 Rap1-DNA-bind Rap1, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ignA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ignA01
2N8GA 5JLXA 5F08A 1JTXA 2R0QC 1R9TJ 5E3MA 3G1LA 1U9NA 4ABZA 3VPRA 1ZK8A 1A6IA 5FKMA 3K2AA 1OJLA 2WB1N 2HYJA 4QIWN 1DU6A 1YRNB 2M34A 1BA5A 3TP3A 3DEWA 1GDTA 2DMNA 2FJ1A 1K61A 1HCRA 3FK7A 3G1MA 1HDPA 1QPIA 2HXIA 5IYCJ 1HLVA 4BY7J 2DMUA 4X6AJ 2HI3A 3PM1A 4DYCA 1W0UA 1JKRC 3S1NJ 1FIAA 4V2GA 2R5ZA 4DZJA 4JX6A 1CQTA 4MLOA 3B6AA 2XGEA 2K9NA 5EZHA 4A3DJ 1B8IB 2HOSA 2OF7A 2R92J 2OPTA 1BW5A 3BG5A 2DA7A 1ZR4A 5IYBJ 4DYRA 1TWGJ 4D5CA 1ETVA 2Y31A 4MFDA 1GUUA 5IP6A 1QVTA 2D5VA 5IP7J 2QF7A 1RKWA 4UUSA 3IV5A 2G0EA 1O4XA 4M6VA 4CYCA 3QPLA 2ME6A 1FEXA 2XRLA 4C2MJ 3LSRA 2WV1A 3I4NJ 3BR3A 1IUFA 1MBEA 3CDLA 2CJJA 1MSFC 3BTIA 1RPWA 2VPRA 3MVPA 5F04A 1FTTA 2TRTA 4W1UA 1IRZA 3NARA 1P7JA 3RQIA 2JA5J 4XRMA 1WPKA 2MG4A 5EF6A 5M5WJ 2JMWA 2CUEA 4DZPA 3JRGA 4D7MA 1WI3A 1ZGWA 4A3BJ 1ETXA 1T33A 4AC0A 1H89C 1ETWA 3FKIJ 4A69C 1FTZA 3IH3A 3M4OJ 2XPWA 2X9DA 3JREA 2ME0A 3S14J 2CU7A 1JTYA 4JP0A 3TEDA 4UUTA 5C4XJ 3A01B 3JRDA 3OOUA 4JX5A 5EGOB 3LSPA 2NOGA 2GM4A 1I50J 4B4CA 1B72B 3GTQJ 4BBSJ 4M3DA 1IDYA 3NAUA 2KT0A 1RKTA 2YS9A 3GTJJ 4I76A 3C2BA 2DA3A 3O8GA 1RETA 5HODA 4G12A 1MH4A 1K83J 1MNMC 2MW8A 1LFUP 1GV2A 5M5XJ 2IBDA 3PO2J 2L7MP 1PUFB 2CQXA 4MFEA 1MH3A 4D5FA 1AKHB 4FTHA 3LSGA 2P81A 5F1JA 3HOWJ 3WHBA 2VKEA 4M3GA 5J1RA 3ZQCA 4M3EA 5F0HA 1X2MA 1ZQ3P 1Q1VA 1MBJA 2HOAA 1HOMA 2GLOA 1Z77A 1AU7A 1ZTRA 4RDUA 2IEKA 2M0CA 3K7AJ 3UKGA 1NTCA 3JRAA 3BTLA 1JGGA 2VKVA 4L5EA 5DTDA 4QTRA 5F27A 2Y0SN 5K7FA 3B6CA 2X48A 2DMPA 4AYBN 2Y2ZA 1TWAJ 2XSDC 4A3CJ 3IH4A 2NVXJ 1UMQA 5IOZA 1AHDP 5J1UA 2JK3A 5EG0B 1H88C 1I3QJ 1OCPA 4NDLA 4BY1J 2LFBA 1GVDA 3SFIA 1ZR2A 4XRSA 1UHSA 4A3KJ 2CQQA 1IJWC 1DU0A 3BR0A 5FLVA 2ID3A 2R5YB 2I10A 1BL0A 1NK3P 3GTGJ 3S1RJ 3LSJA 3M3YJ 2JJ7A 4W97A 3A03A 2HOTA 4MO7A 3I4MJ 1MBHA 3ZQLA 2R93J 1GT0C 3QPSA 2JA7J 4LOCA 5EDNA 4A3GJ 3JRIA 4B3AA 3Q3SA 2E2IJ 5J1YA 4X1EA 1GV5A 2M8GX 1SFOJ 1FJLA 5FLMJ 3BTCA 2JA8J 1XS9A 3Q0WA 2O8KA 2NVYJ 3D1NI 2L9RA 3FISA 3H3VK 2ECBA 4XIDA 2VUMJ 5F0CA 1MBFA 1LE8B 2DN0A 3HOUJ 4QSHA 1E3OC 3TP0A 5E3LA 4A3FJ 1YRNA 3HGGA 3HOYJ 3GTKJ 1TWCJ 1APLC 3RKQA 2MGQA 3BTJA 2EZLA 2DA6A 2XPVA 3BG3A 3OSGA 1A5JA 3JR9A 2EZHA 3BR5A 3HKZN 1ORKA 2DA5A 3FIWA 3RZDJ 1I6HJ 2LY9A 5EYRA 4EEFG 5GPCA 2FD5A 1JJ6C 5FKNA 5FKOA 4I6ZA 1B8IA 1TWFJ 4FCYA 3GBGA 3L1PA 1IDZA 5F0FA 4A3JJ 4IEJA 3BQYA 2L7FP 1MBKA 1ETKA 1JKOC 2NVQJ 4C3JJ 2R7ZJ 2LR8A 2ELKA 1WH7A 1SANA 1XC5A 4BKXA 3PO3J 3RZOJ 3BG9A 4RBOA 2MSYA 3CQZJ 3Q0VA 1U8BA 4IHXA 1EF4A 2E2HJ 4A3IJ 4B1RA 1G2HA 3QQAA 2JWTA 4A93J 1Z0XA 1JJ8C 1H8AC 1HF0A 2E1OA 2COBA 1ETOA 2CUFA 1D5YA 1X2NA 5BNGA 2EZIA 2HXOA 3BR1A 2GBYA 5E3OA 5C4JJ 5IPAA 2FX0A 2XPUA 5M3MJ 2R5ZB 1U9OA 2EH3A 4GFBA 2DA4A 3TW6A 2EQRA 2JA6J 1T56A 2NVTJ 2LTPA 4DW6A 3MKLA 3JRHA 2AO9A 1TWHJ 3IH2A 2LP0A 3ZQFA 1WH5A 9ANTA 1P7IA 5DS9A 3S2DJ 1JKQC 3BR2A 3GTOJ 3FK6A 1BJZA 4JYKA 5C3EJ 1S7EA 4UUSB 4IHWA 2H8RA 3ZQGA 4CYCB 1UG2A 1Y1VJ 2XB0X 5GPAA 2LLKA 2Y9ZA 4A3LJ 4A3MJ 1W0TA 3GTPJ 5IP9J 2H1KA 3A01A 2AHQA 2E19A 3LOCA 5EGOA 2M2EA 2DA2A 2X6OA 2ZB9A 4IHVA 3HOVJ 3HOXJ 2L7ZA 4BXXJ 1B72A 4HNVA 1IG7A 3SDGA 4MIMA 2NS8A 1ZKGA 2CRGA 3S15J 4A3EJ 1QRYA 2FQ4A 1MSEC 3JRCA 5FJ8J 5GP9A 2LKXA 1XG1A 2DMQA 3W6VA 2LD5A 3HEFA 3GTMJ 4C3HJ 3H0GJ 3CMYA 1PUFA 2L0KA 3F0CA 1AKHA 3ZQIA 4FE7A 4Y52J 3DCFA 3HGYA 5C44J 4V2FA 3HM5A 5K7HA 2TCTA 5EEAA 1VF9A 1IV6A 1NK2P 5IOYA 3SJMA 2QCOA 1F36A 4XICA 4D7NA 5EZGA 1LFBA 5E3NA 3HDDA 1QVUA 3ZQHA 3GTLJ 4FE4A 1MBGA 2DMTA 1U78A 2O7OA 1ENHA 4FISA 1JUSA 2W48A 3E7LA 1ETQA 4XK4A 3JRFA 2Y30A 2DA1A 3MN2A 5J3LA 3OSFA 1BW6A 1WCMJ 3HB9A 2VI6A 2NS7A 3ZOBA 1IGNA 2WAQN 1Y1WJ 2KDZA 5M3FJ 5EG0A 1FIPA 3HOZJ 1IC8A 2YUSA 3S16J 5K7ZA 3BT9A 2M9HA 1OFCX 3JRBA 3OIOA 4BBRJ 3S2HJ 3S1MJ 5FKLA 2DJNA 4IHYA 5FKKA 4XRSG 1JUMA 2Y9YA 3LNQA 1ETYA 2LVSA 3HBLA 5M5YJ 3CCYA 2R5YA 2HDDA 1RR7A 1HDDC 2K9QA 4C3IJ 1VFCA 1F43A 1VNDA 2LK2A 3BR6A 2B63J 1JUPA 4M3FA 1VI0A 1JKPC 1TC3C 2XGDA 3O8HA 4J19A 3S17J 2XB5A 3WHCA 1X58A 3G1OA 2ID6A 2ECCA 5IYDJ 4DYQA 3A02A 1JT6A 2XGCA 3BQZA 4Y7NJ 2YU9J 5JLWA 3S1QJ 2RAEA 1ITYA 2K9SA 1LE8A 2HQ5A 3TW7A 2E2JJ 1RESA 2PMZN 1WGXA 4AUXA 2EZKA 2JN6A 2K40A 2EBIA 4S0HB 3Q0UA 2DTZA 4JX4A 1OCTC 1POGA 2IAIA 1JT0A 4M3BA 2O9LA
chains in the Genus database with same CATH superfamily
3SFZA 2QLZA 4U7DA 1BR4A 2P5KA 2WV0A 3GZNB 4XNFA 3WG9A 2GWRA 3TGNA 4A6EA 3RPUA 1FWZA 2FNAA 2F5DA 3E5UA 3FM5A 3ZQQA 2VE9A 1OJLA 3R0AA 2CMPA 1R36A 4QIWN 3V7RA 2OV7A 2FMLA 4ZYHA 4KT6A 3HHGA 1GDTA 2DMNA 3KP7A 3IWZA 3HSRA 2ZXWH 4OMZA 3G1MA 1HDPA 1QPIA 1HLVA 5D8LB 3T1BA 4X6AJ 2HI3A 3HL2A 4DYCA 1D0YA 1W0UA 2ZXHA 3DBRB 4NUBA 2JZYA 4F7ZA 2Q1ZB 5B66C 2R5ZA 5B3SH 4U7BA 4JX6A 2F5FA 2WAFA 1ZRCA 2MH9A 3V42A 2NNYA 3FXKA 2UV1A 2VBYA 1HSTA 2R7OA 3WU0A 5B1AH 3RQ4A 2DDAA 2EK5A 3BG5A 2O0YA 2Y48A 5B1BH 4KUMA 2HVQA 1ETVA 4MFDA 4YEJA 1GUUA 3CP8A 2QSFX 1FMWA 2QF7A 3FXLA 4KA4A 2CQNA 1X3UA 1UFMA 4OU0A 3OYEA 1TQMA 3W3CA 2G0EA 2OC6A 5L3FA 4M6VA 5LEJA 1O4XA 4LB5A 2OUMA 3EETA 4A5NA 4BE1A 1GXPA 4Y13A 3QPLA 1FSHA 1FEXA 2V7FA 1HC8A 2K9MA 5CVVA 3DU6A 3KCCA 5L3BA 3I58A 1RPWA 2HDWA 3ABKH 5F04A 1FTTA 1MJAA 2ISZA 2A6HF 1VQ8I 3H3UA 2BY1A 3K69A 1DPRA 4IRGA 2R3SA 4WWCA 2HKXA 1Z6RA 3FXRA 5E18F 1OYYA 5EF6A 4B44A 2P4WA 3H1CA 4XLAA 4DZPA 3JRGA 3BPVA 4LK1F 3S3MA 3TOAA 3RKYA 2IS2A 2A5YB 1IN5A 4IOCF 4A3BJ 4XKCA 1ETXA 1G59A 2B9SA 1LEAA 1RI7A 3CJQB 1H89C 4G9YA 2MYSA 1YW7A 2KIMA 2BHYA 3FXUA 2XPWA 4Y3OA 4EJVA 5HDNA 2WWYA 1YQAA 3S14J 1JTYA 1WJDA 2CWEA 1VQ4I 4KIGA 5J40A 2CW0F 3K4KA 4YFKF 4UUTA 5C4XJ 4RLFA 3A01B 3VODA 2A61A 2DW4A 3OIPA 2ELHA 2GXGA 4JX5A 2DI3A 2NOGA 1F1ZA 2RC4A 4M9SA 1YOVB 1WKMA 4AD9A 4M3DA 1Z6TA 1J2XA 3V4GA 3IRRA 3GTJJ 4CXFA 3DEUA 3L09A 4BXUA 1CGPA 5HODA 1RETA 4G12A 1MH4A 4XL9A 2PJRB 4NC8A 1N77A 5M5XJ 1TZLA 1HA8A 2A68F 3RPUD 1W7PA 1SFKA 3L9FA 1X3WB 5GTIC 2QENA 5L3GA 2H1LA 4O6JA 3BG6A 2CUZA 4X0GA 2VKEA 3ZQCA 1IRFA 3R0JA 3KP2A 1X2MA 3Q9VA 3ZMDA 1OCCH 4ZYEA 3M1EA 4P5OA 2HR3A 3VYRB 1NTCA 1IXSB 3SQNA 4ESJA 2NXNB 4RB3C 5HS7A 4CDGA 3I9V2 3OS1A 4XLCA 1LNWA 2QZ8A 5DTDA 2Y0SN 4BEHB 2L9VA 5K7FA 2WTEA 3B6CA 2NNNA 4XM3A 1KQ9A 1VQOI 2W85A 4KNYA 2ICWG 1SEUA 1TWAJ 3P5JA 2XSDC 4NQWB 4A3CJ 1FLIA 2VN2A 5J47A 5D4SA 1UMQA 5ERIA 1T6SA 4IOAF 2Z9OA 1H88C 3DTIA 3A2KA 2O03A 1RC9A 2JSCA 4I0AA 2L3DA 4NDLA 2FSWA 1WVRA 3QPTA 1GVDA 1Y0UA 5KVRA 1MZBA 1YFHA 2V1NA 3MCZA 3GF2A 5HLGA 2IA2A 2QQ9A 4UVBA 4XORA 3CCEI 2ESHA 4XSZF 1HKSA 1NK3P 5HNHA 3O3KA 2BXYA 2QVOA 3HC7A 2FUG2 3M3YJ 1OYWA 2JJ7A 3QYBA 4W97A 4RB1A 5LRRA 3I4MJ 3I59A 3OYNA 4GRIA 1MGTA 2ZSIB 4M73A 3K70C 3Q3SA 2W82A 4WCGA 5KK1A 1ZYRF 1SFOJ 2BW3B 2A6TA 2QUFA 5KNLA 2NVYJ 3K0LA 4YRVA 4IHSA 2E36A 4MTEA 3JAMZ 2E1CA 4B43A 3G3ZA 2O6GE 2GA2A 5ICCA 4N9IA 3KLNA 3HOYJ 3WU2C 1GXQA 3GTKJ 1TWCJ 4LD5A 3HRSA 4P96A 5AIPA 1FNNA 1TW2A 3EUKL 3SYTA 2DK8A 3W2VA 3BG3A 1H9TA 1A5JA 2ZJPF 3JR9A 1A35A 3ELKA 2L9SA 2ZFUA 3PSIA 2RV8A 3CUOA 3GFLA 2R7SA 5GPCA 2OTJI 1T08B 4P55A 3DLLF 2DODA 1BI1A 1H0MA 4CGZA 3ONQA 3KZIC 1VQ5I 2CS3A 1B9MA 1UJ8A 3D5RC 4A3JJ 4MTDA 1FY7A 1ETKA 4RS8A 4R79A 2BVMA 2F4MB 3HRUA 3HZJA 1W7PD 2DT6A 3KZZA 3C2GA 4ENMA 1OQYA 3CQZJ 2W4SA 2O8XA 4RAGA 4IHXA 3HHHA 1K78B 3OYGA 4OAZA 4B1RA 3BP8A 3PNVA 3QQAA 5ILVA 1G3SA 1H8AC 2QQAA 3J80K 1HF0A 2OQRA 2CUFA 1GHCA 3QPHA 2CW7A 3TL4X 2K4BA 3OYFA 4YIRX 2OU2A 2BV6A 4EM0B 2FX0A 1SD5A 2I5UA 4RMNA 1YS7A 2VPLA 4PGHA 1U9OA 2JSPA 2EH3A 3CDHA 1OISA 4PJMA 2OZ6A 4Y33A 4XR6A 2JA6J 4KITB 3I64A 2A3SA 4DW6A 5LGTA 2NVTJ 1U2WA 2L7KA 3OYJA 3IH2A 3OR1C 3ZQFA 2VBXA 3RDIA 4RGUA 3FK6A 4RM3A 3VYUB 3MWMA 3ECOA 4LK0F 5H20A 1UG2A 1Y1VJ 2QM3A 2HTSA 2XB0X 1Z91A 2MD5A 2XKPA 4ZDLA 6PAXA 2IS1A 3ABLH 4PJ0C 2DBBA 2KIQA 4HZFA 4LIUA 3A01A 3ZN1A 2KRHA 4ENNA 4XQFA 1SVOA 2FF4A 2DO7A 3BJOA 5GTHC 4OAYA 3TKYA 4KIFA 3M9AA 2IW5A 3HOVJ 3H35A 3HOXJ 4Z2YA 2L7ZA 3COAC 2KLOA 3EPZA 1LJ9A 4BE0A 1EH6A 4G8XA 4LMYA 1VQMI 4A3EJ 1QRYA 3ABMH 3JRCA 4HX4A 4U0VA 2PJRA 5FJ8J 1ZG3A 1BR1A 2LKXA 1WRJA 1X1BA 2HQRA 3S2WA 2LD5A 3HEFA 3GTMJ 4C3HJ 4ZJZA 1UZCA 1LDKB 3J80Z 1SFXA 4UY8I 1XTAA 4ETSA 1Z21A 5D5WB 1XN7A 1F9NA 3ZQIA 4FE7A 1FPQA 3PFIA 3DCFA 3AAFA 1PUEE 4YG2F 1TT0A 4B3XA 1MJBA 5E79C 2ZBKA 5IOYA 3GEZA 4IXAA 1IN4A 1SD7A 4XICA 3TO7A 1T0FA 1DPUA 1N25A 2E1MC 2M8EA 3CC7I 1LFBA 5E3NA 1QVUA 2ESNA 1JUSA 4BEHA 3I55I 3KLOA 2VJ4A 3RTRA 1ETQA 4CH7A 3J81K 3JRFA 1VQPI 3BZKA 3L00A 2Y69H 2M45A 4PCQA 1TNTA 4NQWA 2VI6A 3J7AY 2NS7A 2JTVA 4PUSA 1U5TB 2FBHA 1QA6A 2KZGA 2RREA 3FMRA 5TRDA 1TTYA 2M7BA 1XMAA 3CJRB 3V8LA 2KIFA 2PMHA 2VASA 5JHFA 4BQQA 1KZHA 2F5EA 3QP5A 2M9HA 5CJ9A 5BQTA 4GCVA 3S2HJ 5FKLA 2DJNA 1ZLKA 1S9HA 2HPMA 3PUBA 4H4KC 2Y9YA 2V1XA 1FOYA 1AA7A 2Z33A 2PEXA 2X85A 1YW9A 5LHGA 3KIOA 2ZNZA 4B48A 4ANJA 5H6RA 1KA8A 1Y39A 1K79A 3F21A 1EH8A 3OYDA 4LJZF 3ASNH 4N4OB 1SVLA 4HNTA 3LAJA 1Y56A 3M8JA 1JKPC 1BI2A 3LMMA 1R1TA 2WY8Q 3KP5A 4FX0A 4OIPF 3O8HA 4A2UA 1T2KA 2BW3A 4Y4RA 4KYWA 4BE2A 1RZ4A 3VB2A 3CESA 2IT0A 1JT6A 3BQZA 1HKQA 2LDUA 2LRDA 3NQOA 4UVAA 3CUQB 2RQPA 2FE3A 2K9SA 3D5LA 3E5QA 5H6QA 3FHZA 2A07F 2HQ5A 4IO9F 1M1EB 5HLIA 1G6NA 2EV0A 2CQ7A 3A1YA 3X2QH 2YU3A 4AIHA 3ABUA 2EZKA 4AUXA 2JN6A 3J81Z 2EV5A 2BEOA 3LL7A 3F9KA 3FDYA 1I1SA 2HKOA 3PJRA 2JVGA 1O7FA 1SMTA 4NB5A 3DKYA 4OMYA 2DTZA 1OCTC 1XPXA 2N8GA 2D45A 1IV8A 5LLQA 4NBQA 2HFHA 2UWMA 2LNBA 2DK5A 3O2PE 2G7HA 1R9TJ 2CV2A 4IKFA 5E3MA 1AOYA 4EJOA 3MZHA 1ZHFA 1U9NA 2CW8A 1Z3XA 3H9GA 3VPRA 1A6IA 1SFUA 2R7WA 1E0EA 1PVEA 4YELA 3DP7A 1Z9CA 3DPTA 1ZREA 2X4HA 1K78A 1DU6A 2M34A 3GWZA 4XMYA 4EMSA 4PSXA 2BE5F 3FK7A 1YHQI 4XLHA 3GLLA 2ZJQF 2DMUA 1O3TA 3PM1A 2B0LA 1FIAA 1TW3A 4PDKA 2LMDA 3G6EI 3MKYB 1L0OC 4DZJA 4MLOA 3KP3A 2K9NA 5EZHA 5LFAA 1OLTA 2DAOA 3IUOA 2K3FA 2OF7A 1XMXA 1QPMA 2X1CA 5HLHA 1E17A 1E2XA 1W4MA 1BW5A 4BXFA 1XX5A 2BXZA 2BY2A 4DYRA 5DM6F 4ESBA 1TWGJ 2R7QA 2JPCA 3QU6A 1QVTA 1G3YA 5F64A 3IWFA 1ODDA 5D5XB 3FBIB 4HQMA 1BR2A 2P6TA 5LHHA 2FOKA 2ZMEB 1V3FA 2ME6A 1MKMA 4C2MJ 1K6YA 2WV1A 4BQNA 4C2UA 4L9NA 2CJJA 2O61A 1DQUA 1TNSA 3DQVC 2EFWA 4II3A 3NWTA 4UB6C 1WJCA 1IRZA 1P7JA 3HG9A 3RQIA 2JA5J 4XRMA 3QYFA 2XC7A 5DYMA 5M5WJ 2CUEA 1FYKA 3S3OA 4D7MA 1ZGWA 4IHTA 3E0JB 2JA2A 1W5SA 1T33A 2ZXJA 1LDJA 3LA2A 3ECHA 2HTJA 2R4GA 4ZC3A 1D1BA 1FYMA 1BIAA 4HG2A 2V9KA 2X51A 2WADA 5CLSA 4A69C 1IRGA 2WB1A 3M4OJ 2X9DA 2CU7A 2HGCA 4IX7A 1S72I 2CH0A 2F5VA 3EYIA 2IS4A 1ZGJA 4QWQA 1T38A 1RNLA 4U88A 5L3CA 3H9JA 4XBFA 2YX4A 4G7ZF 2M4GA 3OOUA 5EGOB 3LSPA 2W24A 2Y0MA 3FHNA 2EFOA 2EFQA 4B4CA 1B72B 1IDYA 1RKTA 2YS9A 3C2BA 1E3PA 2PI0A 1S6LA 3CF2A 2KRCA 3BROA 1UG0A 3HRTA 3TQNA 1MNMC 5BMZA 1OKRA 4HV6A 1BBYA 1GV2A 2CV0A 2IBDA 3FWEA 2PLYA 5HDKA 2L54A 1KQ0A 2V6CA 2BY0A 2L7MP 3SHFA 1BJAA 2K5CA 4MFEA 1TP4A 4D5FA 5D5VB 4BJ5C 3CCMI 1Z7LA 3WHBA 3FXOA 3BDDA 1TQPA 2LH9A 2QKMB 2XAFA 3M8FA 1YJWI 3RJPA 2L2OA 2A69F 2VJJA 3C7JA 2VC1A 3M1CA 2C6YA 4Q5SF 3I53A 2R7UA 2M0CA 3OV8A 4Q4ZF 1W5CC 3E1SA 5BOXA 5HOOA 1JGGA 5ICFA 3BG7A 2P7VB 5F27A 1MMGA 1BI0A 3G2BA 2IGMA 3P9CA 2DMPA 1J09A 4DOZA 3PFYA 2Y75A 2KJCA 1HW1A 4CICA 1PP8F 2JK3A 2KQRA 3GFIA 2KISA 1Z05A 2FQ3A 1OCPA 3FMQA 2AXTC 3DFGA 2LFBA 3F6OA 4LG0B 3CUQA 4XRSA 5FLXK 2W7NA 5A2QK 3BJAA 3ERED 4A3KJ 4IRIA 1P92A 2RDPA 5FLVA 2R5YB 3ML6A 2I10A 1BL0A 3GTGJ 3S1RJ 3LSJA 4BJTA 2DPUA 4D0PA 3BPXA 3IC7A 4LITA 5EEHA 1I39A 3A03A 2HOTA 4ZYGA 1SD6A 4FT8A 1MBHA 3IKVA 2JA7J 5EDNA 1UCRA 2RVCA 1R4MB 2OA4A 2KMUA 3ZMZA 3LQRA 3JRIA 1Q1HA 4PZJA 3BCBA 3MFKA 3L2VA 3AL0C 2E2IJ 4O5VA 2M8GX 5TJJA 1RR8C 1FJLA 3S8PA 3KYLA 3FISA 1ZN2A 4Y15A 4BQOA 3MKZA 2STWA 5F0CA 4KIBA 4ZYDA 3OYBA 1TL8A 1IO2A 2IXSA 2TDXA 1S5LC 4HX8A 3HOUJ 2ELJA 1BC7C 1U0JA 4QSHA 3FM3A 3L2RA 3N4MA 1A04A 3HGGA 1UELB 1K4TA 2X6XA 3H92A 4ZH4F 4L18B 1X1AA 3EUHC 2MGQA 2EZLA 5D6EA 3L7WA 2EZHA 4HF2A 1ORKA 1FT9A 2DA5A 2PJPA 4GYGA 1I6HJ 5EYRA 4ZZLA 5IT3A 3IHUA 4HQEA 3ROUA 1BI3A 1USTA 5FKNA 4CCOA 1J5YA 5FKOA 4UHTA 3QP6A 4I6ZA 3KEQA 4BHCA 2FBKA 1TWFJ 4BACA 4FCYA 1KU9A 4YIFA 2GAUA 2LREA 4IQ4A 5F0FA 4NC6A 3WTYC 4E7HA 1MBKA 5FLXZ 2NVQJ 2FRHA 4C3JJ 5A2QZ 2KPMA 5L3EA 2DTRA 5FO5A 1WH7A 4BKXA 5BS6A 1W36D 4F52A 3V8JA 2DQRA 4E7IA 4J00A 3NRVA 1WSUA 4OINF 2EIMH 4KT5C 2E2HJ 4EJWA 2HQNA 4WXCA 4AWXB 1G2HA 1R5GA 1Z0XA 2ZMEA 4I7HA 3M7GA 3HUGB 1IZ1A 2E1OA 4IRHA 5BNGA 2ACJA 2E7WA 1KGSA 2LYCA 1SC7A 2EZIA 2UXNA 1TLHB 1X3ZB 1B4AA 2GBYA 2CQKA 3GO5A 3ZGKA 5E3OA 1XCVA 5GAHJ 5C4JJ 2WC2A 2DFFA 5IPAA 4XOTA 5HDGA 2L5QA 2P5LC 1FMVA 2EIJH 3SEQA 2EQRA 2EA4A 2ZKZA 1A31A 2LTPA 1QU3A 3QOEA 3JRHA 2LP0A 3WE2A 5CVRA 2LKPA 2E7XA 2JT1A 1O3SA 5DS9A 2L02A 3AG3H 3OYKA 2ZC2A 3TOBA 5C3EJ 4XSXF 3ZQGA 1MW7A 4CYCB 3QWLA 1H9GA 3UNGC 2ISYA 1OPCA 4ENKA 1W0TA 2M3AA 2H1KA 1IN6A 2XAGA 4EJTA 1T0FC 3HKZA 2AHQA 5EGOA 3CLOA 2VC0A 1Y0NA 2DA2A 2X6OA 2ZB9A 4IHVA 5LD2C 2UUZA 4HDUA 1B72A 5JI6A 1JXSA 1IF1A 4EGYA 4Q47A 2NS8A 1W5TA 1O57A 2IP2A 3OMYA 2FQ4A 1FSEA 3T0YA 1MSEC 4GO1A 4G94A 2DMQA 3W6VA 4XLFA 4XLEA 2E5ZA 2DFEA 3AG1H 5CYVA 1JHHA 2L0KA 5E1WA 3KFWX 2H6CA 2D2WA 1STZA 4F91B 3WODF 1C0WA 3HGYA 4RGSA 5C44J 5JVGF 4V2FA 1U8RA 4Y17A 4CA0A 3T8TA 2R7RA 1D0ZA 2F4OB 1NK2P 4DJAA 1PDNC 1ZELA 4D7NA 5D8KB 5EZGA 3J7ZI 3OYIA 3CJTB 3SZTA 1R23A 2K85A 4CCLA 3AFHA 1K7AA 2O7OA 3OIQA 1HBXG 5E17F 1IN7A 3FXJA 2CFXA 5J3LA 3OYMA 3OSFA 4HNUA 1D1CA 2P8TA 4EATA 3HB9A 1B6AA 2XSJC 3H3ZA 3WGIA 1Y1WJ 3IL2A 4CCNA 1ZRFA 1R22A 3KETA 1FIPA 2FMYA 3QYEA 4YFXF 2F6CA 2VKHA 3R60A 1HQCA 2LY2A 1OFCX 4LG0A 3JRBA 1RUNA 1ZG1A 1R71A 5DEQA 1EKEA 5FKKA 4AU7A 5E8IA 1Y6IA 2R5YA 4HW0A 2ADUA 1K4SA 1T39A 1G3TA 1HDDC 3E6MA 2XAUA 3MEXA 5GADJ 2K9QA 4E7LA 1VFCA 1X4PA 2HZTA 4RGRA 3VOEA 3WE3A 4F55A 4NHJA 1XSVA 2LK2A 1YJNI 1LKXA 5TISC 2VXDA 1Y8QB 1FOWA 1JUPA 4M3FA 2COMA 5DUKA 1V5EA 3F22A 1TC3C 5ILUA 4KICA 3EDPA 4J19A 3S17J 3VSKA 2EA2A 1QQIA 2EFNA 2XHKA 3G73A 3G1OA 2GA1A 2XDVA 3V8KA 2ID6A 4R1HA 4E6KG 2I8DA 1OYIA 1YITI 2WY7Q 3BWGA 2LF7A 1IN8A 2VL8A 3G71I 3CF5F 4V19K 5ILSA 4P9FA 3HYIA 3KEOA 1HW2A 3UR3C 4N4NB 5K5RA 2VODA 3NEUA 2MLGA 2E2JJ 3U9GA 3WGHA 4DIQA 4EM1A 1ZGAA 1WGXA 2V79A 3FZVA 5K5QA 2K40A 1D8KA 1R5ID 2PN6A 1X19A 1YE9A 2AXLA 3ZR8X 3WTUC 2BGCA 3IP4B 5CQGA 3CCLI 2GOMA 4IZZA 3VFZA 3HOTA 3Q5FA 4XKVA 5IT9K 5JLXA 3KEYA 3H5AA 2M30A 2WAQA 4RM2A 5F08A 3RKWA 4LIVA 4HOBA 3L2WA 3F6VA 3GFJA 2DOEA 1LFPA 3G1LA 2LSOA 4P9UA 1ZK8A 4UV8A 5J4YA 4FHTA 5FKMA 4Z6YA 3K2AA 4HPQA 4F93B 2WB1N 1XGOA 4IPAA 4HF1A 3F8FA 1BC8C 1Z7UA 1LPQA 3TP3A 3DKWA 2DCEA 2FJ1A 3G4SI 1K61A 3HUGA 1HCRA 4FASD 2CGPA 2H6BA 4BY7J 3OYHA 2ZJ2A 1DGWY 3U1KA 2JUGA 4HDVA 2MD0A 4V2GA 2FNPA 2XF5A 4WK8F 1CQTA 2XGEA 3HSEA 4PFOA 1B8IB 2L01A 2HOSA 2LBFB 5IY5H 2R92J 2IA0A 1X1CA 2OPTA 3PQKA 4BAYA 1ZR4A 5IYBJ 2E34A 2H27A 2GIZA 5DUIA 2LOOA 4TV7A 3TDUC 2HVSA 3DKXA 4D5CA 3ESWB 2D5VA 4HF0A 4ZDOA 5CVJA 2E1MB 3B73A 3IV5A 3GXOA 4E7ZA 4CYCA 1LDDA 4ZZDA 3ZPLA 2VONA 2QQ8A 2XRLA 4LB6B 3I3LA 3LSRA 3I4NJ 3BR3A 1YIJI 4L5JA 4N9HA 1W1WE 3CMEI 1IUFA 1MBEA 4PJJA 5IT9Z 3MVPA 2KJBA 4ASNA 2KIUA 4CCMA 4W1UA 4E7KA 3NARA 4QLCU 3FKJA 5DM7F 3F8MA 3PSFA 2MG4A 1ZARA 4L9TA 3R6SA 3LQQA 4EGZA 1SMYF 2E71A 2VKDA 3K4LA 5F6FA 3RKXA 1S7OA 4RAYA 3OY9A 1U5TC 2K9LA 1KQ8A 4OIOF 1ETWA 1SFEA 3KP4A 2VBWA 2JRTA 3IH3A 3OOPA 4CCJA 5JVTA 1OR7C 3C18A 3JREA 2Y0SA 4A0XA 3MZYA 2CFOA 2DXIA 3TEDA 3RYRA 1IXRC 2RNGA 3CCSI 5FRNA 1WJFA 2HQAA 1YI2I 1O3QA 2DJIA 1OCRH 5AIQA 2R7VA 3JRDA 2BY3A 1USSA 3L2CA 4E7JA 2EPFA 1ACIA 2NOJB 1I1GA 3K4BA 1I6XA 4PFPA 3DBHB 2GQQA 2KT0A 3NAUA 2MABA 4I76A 2J5PA 4XONA 3PL8A 1OCZH 3HXLA 5H2FC 3O8GA 1ON1A 1K83J 5F1RA 2MW8A 2IGKA 1LFUP 3LSHA 1VQ7I 4LLNA 3CUQC 2R7XA 1LEBA 1MH3A 4CO8A 5B5EC 3PIPF 1AKHB 2DYRH 2O5RA 3JTHA 5F1JA 3HOWJ 4M3GA 2ZCWA 5J1RA 4M3EA 3BZCA 2KHMA 1ZQ3P 3VYTB 4R8HA 2MC3A 4I0BA 1IRXA 2HOAA 1HOMA 1Z77A 1ZTRA 4RDUA 3QRFF 3UKGA 3WTTC 3JRAA 4XN3A 5E1ZB 1FOKA 4A0ZA 2X1DA 2STTA 2XV4S 2X6WA 4KFCA 3S32A 4BDYA 3IH4A 3I56I 4OIQF 4UUVA 5IOZA 2XRNA 5FRMA 1XDSA 5J1UA 1AHDP 2DPDA 4CHUA 3CTAA 3W6KB 3I54A 2K86A 1I3QJ 2M87A 4BY1J 1Z3YA 4GXOA 3SFIA 3ZQ7A 4LLGF 3KX2A 2CQQA 3ZMSA 5BPDA 1IJWC 4C2TA 2ID3A 4AIKA 3V7CA 3OYLA 2HOEA 1QZEA 3KP6A 1WQ2A 1A36A 3PQJA 1GT0C 1XGMA 2IVMA 4A3GJ 2DT5A 4WXDA 4B3AA 2QGUA 3QAHA 4X1EA 2EB7A 2MLKA 3FBNB 3Q0WA 3D1NI 1XDUA 2E1NA 2K02A 3DWLE 1NHAA 2BBYA 2VUMJ 1MBFA 4DNCA 1MIJA 3GW2A 3JSOA 1QNTA 2WAEA 3Q9SA 1V5GA 5JFRA 1LE8B 2ZMEC 3TP0A 1R5HA 1YX5A 2WA0A 5J8FA 2L4MA 1APLC 1JI8A 1WJ5A 1S3JA 2LKSA 4M6XA 5HS8A 3K70D 4PSWA 2XPVA 4ZTJA 4LLLA 4F3QA 3HKZN 1ONVA 3FIWA 3RZDJ 2LY9A 3OWTA 1EJ9A 4EEFG 2EFPA 5FFXA 2YX7A 4WX9A 1ULYA 1O7LA 2QSHX 1JJ6C 4AYBA 1KYWA 2ZO4A 1B8IA 5FD5A 3GBGA 2LBFA 3FXMA 2K27A 1HSJA 1JKOC 5LHIA 1J75A 1XGSA 4IF4A 2LR8A 2QWWA 2ELKA 2VQCA 5L3DA 1FYLA 1SANA 3PO3J 1MNDA 2GIVA 4I98B 4EVIA 3RZOJ 2K4JA 3BG9A 4RBOA 4FX4A 1U6GA 3M07A 1U8BA 2A05A 4M71A 3GMEA 1G4DA 3HOSA 4JQFA 4B47A 2VOOA 4A93J 2Z3YA 5HS9A 2M7AA 2QKLB 3LSKA 4HEA2 2COBA 1SAXA 1ETOA 1QO0D 3GCMA 3SEZA 4MGRA 2VJ5A 5DD8A 2HXOA 2ZFWA 3A0HC 2IPQX 2HDCA 2VXZA 1R6RA 3HPHA 3VSLA 1R7JA 1T95A 5BPIA 2QBYB 2EJRA 2FU4A 2XPUA 3AG2H 1X1PA 1KYZA 1T8IA 4IQJA 1WZ2A 1ZG5A 1UAAA 2MH2A 4GFBA 2VT2A 3DXJF 5FFZA 1T56A 1Z1DA 1BN5A 2AO9A 1ERDA 3K6GA 1FZPB 2OAZA 1A6QA 3N05A 5E1XA 3S2DJ 1ZH5A 1R49A 2VQLA 1I5ZA 2BYVE 3D5SC 3WGGA 4L0ZB 4JYKA 4FQGA 4UUSB 2VOPA 2A5WA 5LEKA 1I27A 2H8RA 3CC2I 3A4CA 4RB0A 4XOPA 2W25A 5GPAA 2Y9ZA 1RRJA 2V9VA 4A3LJ 4BNCA 2Z2SB 3GTPJ 5IP9J 4D1QA 4K2EA 1EH7A 3ABTA 1WHUA 1TT5B 2EV6A 4BH9A 2E19A 1V54H 2P0WA 1SVMA 4HNVA 1LVKA 3QOPA 1QBJA 1IG7A 1S7AA 3GYHX 2VT3A 1ZKGA 2CRGA 2G9WA 4G6QA 2VE8A 2H94A 2XAHA 4F92B 3DTKA 2HNHA 4YIIA 1XSXA 1XG1A 4U0WA 3GUDA 1IXCA 3H0GJ 3P9IA 2PG4A 2IRFG 1X4OA 1D3YA 1J9IA 2LC2A 2OTLI 3F0CA 1YLFA 4P1WA 3L2UA 1AKHA 2LG4A 2P7CB 3K9TA 2HS5A 3F23A 4BU2A 1E3HA 2PFBA 3PNYA 3AL0B 4KMFA 3KPHA 5K7HA 2PBIA 5EEGA 2TCTA 2X0LA 2NYXA 4HYEA 1VF9A 4M72A 4PJLA 2H8WA 4RLQA 5EEAA 3SJMA 1FP2A 2Q0OA 1IV6A 1F36A 1QHGA 3K10A 3GLXA 4A5MA 4XLPF 3GTLJ 4UVCA 1MNEA 1MBGA 2DMTA 4HAMA 4L5IA 4S04A 2DDBA 3IAM2 3ISPA 2W48A 3CO7C 3MN2A 4AM3A 3TO6A 1R1UA 3CCRI 1I3AA 5DCMB 2BHZA 4ITVA 1AWCA 2FBIA 2ZNYA 5LGNA 4I09A 1IGNA 2WAQN 2RNJA 3N97A 1IC8A 3K4JA 2YUSA 3K1PA 3S16J 1G3WA 3DF8A 5FD6A 5K7ZA 2DYSH 1B9NA 2R7DA 3DU5A 2E60A 3E3VA 3OIOA 4HSTA 4IJAA 4BBRJ 4J01A 3S1MJ 1GLNA 2R7TA 1IAWA 4IHYA 1DUXC 2HU9A 4XRSG 2OCEA 4E7SA 4RGXA 2VJIA 3LNQA 2KRFA 4BJ6C 5M5YJ 3HBLA 4HLYA 5JR3A 2HDDA 2VIXA 4C3IJ 2YR2A 3HJEA 1V5FA 2HYGD 1F43A 2DQLA 3EQLF 4O3MA 4QPOA 4C9YA 3CMMA 3JTGA 1HW5A 2BVLA 1S29A 4BYYA 4I02A 3RIRA 3ZXSA 3FMSA 3TBIA 2XGDA 2RN7A 5HVQC 4M6YA 3SDBA 1F4KA 3JCUC 2NVUB 3U21A 3WHCA 1X58A 2H09A 2DOAA 2NAZA 3K4MA 3ZN0A 4ZYAA 2CYYA 2ECCA 5IYDJ 3FXQA 3A02A 4DYQA 4Y7NJ 3E6CC 4UXNA 3EUAA 3S1QJ 3WG7H 2RAEA 3VYSB 1LE8A 3QU3A 2F4IA 4RA2A 2OBPA 3WTSC 4DBQA 1RESA 3CCJI 3T5XA 2PMUA 2MC4A 3IAS2 1D0XA 2YSRA 4BL0B 4CCKA 2XGXA 1VZ0A 1Z67A 5TGTA 3RI4A 1Y8RB 2MBFA 1YW8A 2CUJA 3REOA 4ON0A 1UHWA 4MEYF 4I2OA 1POGA 3AKZA 3GZ6A 2O9LA 3JW4A 4HRIA 1ON2A 2Q2EB 3JAMK 4FETA 1JTXA 1S8NA 2PQ8A 2R0QC 4XRFA 2MA3A 2EINH 2W00A 5ED4A 4ABZA 4A0YA 2V6EA 2GXBA 4DGWB 4M74A 4PJNA 3LA7A 1P4AA 2HYJA 3CC4I 1OMIA 4L9VA 2L9NA 3K1MA 1FBSA 4LFUA 3RSNA 1V55H 3I0TA 3ZMVA 4EV0A 1YRNB 2DT7B 4G6TB 3C3WA 4UV9A 1BA5A 1PP7U 5JHUA 3DEWA 1VQ9I 5KHDA 3TMOA 4S05A 3D0SA 1R1VA 5J4VA 2HXIA 3LFUA 4HV5A 5IYCJ 5E8GA 2E35A 2NS0A 1QGPA 1NG6A 1XCBA 3F8BA 1JKRC 1P2FA 4L0YB 2QBYA 3S1NJ 3MQ0A 2OCCH 3RCOA 2DFIA 4BGDA 3B6AA 5GAEJ 4A3DJ 4UB8C 5HLTA 3HTSB 5CPRB 2OQGA 2DA7A 3CO6C 2L4AA 3OS0A 1WFXA 5LGUA 1YG2A 1GVJA 2Y31A 1EA3A 4B09A 5IP6A 3BY6A 5IP7J 5ICGA 3VDXA 1RKWA 3FF5A 4UUSA 4LG3A 5DDGA 2XVCA 2Z16A 2QYOA 2PMZA 2LY1A 3VEPA 4U87A 1V4RA 2W1OA 2F5CA 2XUBA 4OOIA 4OIRF 4BHBA 3CDLA 2MFZA 1MSFC 3BTIA 2VPRA 2E5NA 4OWRB 3KE2A 3B02A 1P9QC 2HZDA 2ZXIA 2TRTA 2WBMA 3SZPA 3HTUA 2F48A 2KKOA 2Z5UA 5DCFA 1BIBA 1KU2A 4WF2A 4BS9A 1WPKA 5D6FA 2JMWA 2VQGA 3V7SA 1P6RA 1WI3A 1MDMB 1VQKI 4XKWA 2OJED 1MMNA 4Q48A 4AC0A 2RKHA 3IKTA 3FKIJ 2UZKA 5D5UB 5KCMA 1LQ1A 1HXDA 1FTZA 2M0MA 3R61A 3ULQB 4I01A 2ME0A 4HX7A 4MNUA 4IL6C 1P4WA 1WJBA 3LSMA 3K4NA 3OR2C 4HBLA 4JP0A 4CYDA 4AVZA 1QHHD 2HWVA 3PUFA 1F5TA 1XD7A 3H36A 2V1UA 2HPIA 2ETHA 5CQEA 3LSTA 2DFHA 4CZZA 2FEZA 1IUYA 2D1VA 3I71A 1FC3A 2GM4A 5CKTA 3T8RA 1I50J 2IS6A 3GTQJ 4BBSJ 3DBLB 4KN7X 4HLXA 3CCQI 1N75A 3ZRGA 2DA3A 1QZYA 4JBAA 4G7OF 4GGGA 4DBRA 2AQFA 4NC7A 1RIOH 2Z1DA 5DCMA 1DP3A 3E5XA 3PO2J 4MHGA 4GDFA 3EUHA 4EM2A 3PNTA 5FROA 4CZCA 1PUFB 2CQXA 2ZJRF 3LWFA 3CMAI 3LAPA 1WJEA 2P81A 3LSGA 4RAZA 4FTHA 1REPC 2ZSHB 4BUPA 4PGGA 3HSFA 1D8JA 3OS2A 5F0HA 2KDOA 3K2ZA 1TQIA 1Q1VA 2QEXI 5CVIA 1MBJA 3H5RA 3MMYB 1FBUA 1AU7A 2GLOA 2IEKA 3BC8A 2V4JC 3K7AJ 2HVRA 1DGRM 1MMDA 1PJRA 3MD2A 1JGSA 3BTLA 4ZDPA 3U2RA 2VKVA 2AS5F 2XAQA 3C1DA 4L5EA 3W2AA 2XIGA 4QTRA 4GYIA 1DDNA 4RAFA 5J6XA 3DV8A 1PYVA 2X48A 2M5WA 4G7HF 4AYBN 2Y2ZA 2V1DA 2K7LA 2NVXJ 2QQBA 5J8CA 3ERMA 3BOQA 3KYCB 5GAGJ 3WU1B 1JE8A 3CJNA 5EG0B 2EIKH 2AQEA 1MJ9A 1YJ9I 1B59A 2DOFA 3LFKA 3DLAA 2BZTA 4E4HA 1YS6A 4HSRA 4L9JA 1XGNA 2XF6A 1ZR2A 1UHSA 2W84A 3GZ5A 4ESFA 3TDZC 3FX3A 4II2A 2W57A 1DU0A 3E6BA 3BR0A 2R7FA 1BM9A 1ZAOA 3SZGA 2F2EA 3BCAA 1UB9A 1JHFA 4MO7A 1K6OA 1FOXA 3ZQLA 2R93J 3QPSA 4LOCA 3ZMUA 5LBQA 3ASOH 2M1BA 2QA4I 3BLYA 4DQ2A 2CG4A 1DP7P 5D4RA 1VQ6I 1XMKA 2FA5A 5J1YA 1GV5A 5ICEA 3P9KA 2Q2EA 4JK1X 5FLMJ 4MEXF 3BZ6A 2GOXB 3BTCA 2JA8J 2OZUA 1XS9A 2IGOA 4HA8A 2O8KA 1SAUA 2GZWA 2L9RA 3H3VK 2ECBA 4XIDA 2LF8A 1CF7B 3LA3A 5DV5A 1YO5C 3MZ8A 1R58A 2DN0A 3QODA 4KJZA 4YFNF 1E3OC 5E3LA 4A3FJ 3HRMA 3U1DA 1YRNA 3P7NA 5HNFA 3F8NA 3RKQA 3LSIA 2X6YA 3BTJA 1W36C 2DA6A 3CCVI 1MD0A 1RUOA 4CSWA 3OSGA 1KONA 4ZTFA 1D5VA 3BR5A 4MQVA 4UNOA 2FD5A 1OCOH 3OYAA 2OD5A 3L1PA 1IDZA 4IEJA 3BQYA 1MMAA 2L7FP 2PX9A 3TO9A 3MAJA 2R7ZJ 4WXHA 1XC5A 2VB6A 2JPBA 5FB2A 2MSYA 3Q0VA 2Q8KA 1U3EM 1EF4A 1J59A 4A3IJ 3H0DA 2JWTA 3M8EA 1JJ8C 3DPLC 2YPRA 4KN4X 1D5YA 1FP1D 1X2NA 2BOLA 2NRAC 3H5NA 3BR1A 3DTEA 2EILH 3KZYA 4XKBA 3CP2A 2FOWA 2QSGX 3H9QA 5EJCA 5M3MJ 2R5ZB 4BDZA 1ZRDA 1R4NB 3R4KA 2DA4A 3OL4A 5K5OA 3TW6A 1LB2A 1MMSA 2P6SA 2JQ7A 1J7KA 3MKLA 3BJ6A 3J7YJ 3VWBA 1TWHJ 1MDMA 1BOBA 1WH5A 9ANTA 2HYFA 4KDPA 1P7IA 2VQHA 2IA1A 1JKQC 3BR2A 3GTOJ 1BJZA 1S7EA 3O6BB 3CDIA 4IHWA 5LRSA 2LLKA 2D1HA 4A3MJ 4EJUA 1N78A 1YIOA 2KP6A 4KISA 3RYPA 4KMUX 4RB2C 1YX3A 3LOCA 2M2EA 3WTZA 3OYCA 2K3PA 4BXXJ 3JSPA 3CCUI 4C30A 3DPUA 1B1BA 1KU3A 4H0EA 3SDGA 3F72A 4MIMA 3HIFA 1TBXA 3S15J 5DD4A 2A6EF 3E6DA 1X1DA 2XROA 3WTWC 3L2QA 3OL3A 5GP9A 3A0BC 3AG4H 2IGNA 2CSOA 3GVAA 1UHMA 3CZ6A 1YTYA 1EV7A 3CMYA 4AIJA 1PUFA 5CVUA 2V26A 1T98A 3EYYA 4EQQA 4IVNA 4A12A 3GX4X 4Y52J 4BHPA 2O3FA 4M9XA 4G6DA 3HM5A 4ENJA 2RGVA 5K1YA 1LVAA 3HPGA 3I4PA 2QCOA 1IW7F 5AONA 2XKOA 3F3XA 5E20A 2X1EA 3HDDA 3ZQHA 4NNJA 3MKWB 3WTVC 4FE4A 1U78A 2M4KA 1ENHA 2CO5A 4FISA 4PK4A 3E7LA 1WJAA 4XK4A 2Y30A 2DA1A 2JUCA 3CLQA 2G7UA 1HKTA 1XSDA 3ZCOA 1BW6A 1WCMJ 3ZOBA 1NH3A 1W7PB 2XAJA 2UXXA 2KDZA 5EG0A 5M3FJ 4JOMA 3HOZJ 1VTNC 1FX7A 3K4CA 4U0YA 1SD4A 2CV1A 4XLNF 3BT9A 4I99C 4M9ZA 2XF7A 4CUGA 4MQ9F 4AVPA 1JUMA 1R00A 3DEEA 1ETYA 2LVSA 3IRQA 1P4XA 3CCYA 1RR7A 2JVHA 3ZMTA 5KAFC 4QPQA 2DU9A 4A6DA 2DLLA 2FXAA 2KL4A 1O3RA 3NWSA 2XASA 1FBQA 1VNDA 1WWXA 2KZVA 3BR6A 4E70A 2B63J 2B7EA 1WI9A 3PIOF 2HEOA 2GXAA 3W6JB 4BQAA 3ZP5A 1VI0A 3E97A 2IJLA 3WTXC 4LGWA 2XB5A 1ZLJA 4XN0A 1D1AA 1YYVA 3S3NA 2XGCA 3S93A 2YU9J 3K1NA 1VQLI 5JLWA 1J0RA 1CF7A 3J7AO 1ITYA 4N0BA 1LUJB 3RPQA 4AIDA 2VBZA 3TW7A 2J5OA 2RQQA 2Z99A 1XB4A 3KYDB 2PMZN 4D9JA 2P5VA 3SXYA 1BOAA 1NG7A 2EWNA 3F8CA 2EBIA 1KU7A 4S0HB 1U5TA 3CD6I 3I59B 3W2WA 3I5UA 1QZZA 3GFMA 2JRMA 3Q0UA 1G8XA 1L3LA 4B8XA 5FGMA 4JX4A 2IAIA 3C2HA 1JT0A 2V9PA 4M3BA 1VQNI 5KAIC 1OR7A 2VLAA 2KFDA
chains in the Genus database with same CATH topology
2N8GA 5JLXA 5F08A 1JTXA 2R0QC 1R9TJ 5E3MA 3G1LA 1U9NA 4ABZA 3VPRA 1ZK8A 1A6IA 5FKMA 3K2AA 1OJLA 2WB1N 2HYJA 4QIWN 1DU6A 1YRNB 2M34A 1BA5A 3TP3A 3DEWA 1GDTA 2DMNA 2FJ1A 1K61A 1HCRA 3FK7A 3G1MA 1HDPA 1QPIA 2HXIA 5IYCJ 1HLVA 4BY7J 2DMUA 4X6AJ 2HI3A 3PM1A 4DYCA 1W0UA 1JKRC 3S1NJ 1FIAA 4V2GA 2R5ZA 4DZJA 4JX6A 1CQTA 4MLOA 3B6AA 2XGEA 2K9NA 5EZHA 4A3DJ 1B8IB 2HOSA 2OF7A 2R92J 2OPTA 1BW5A 3BG5A 2DA7A 1ZR4A 5IYBJ 4DYRA 1TWGJ 4D5CA 1ETVA 2Y31A 4MFDA 1GUUA 5IP6A 1QVTA 2D5VA 5IP7J 2QF7A 1RKWA 4UUSA 3IV5A 2G0EA 1O4XA 4M6VA 4CYCA 3QPLA 2ME6A 1FEXA 2XRLA 4C2MJ 3LSRA 2WV1A 3I4NJ 3BR3A 1IUFA 1MBEA 3CDLA 2CJJA 1MSFC 3BTIA 1RPWA 2VPRA 3MVPA 5F04A 1FTTA 2TRTA 4W1UA 1IRZA 3NARA 1P7JA 3RQIA 2JA5J 4XRMA 1WPKA 2MG4A 5EF6A 5M5WJ 2JMWA 2CUEA 4DZPA 3JRGA 4D7MA 1WI3A 1ZGWA 4A3BJ 1ETXA 1T33A 4AC0A 1H89C 1ETWA 3FKIJ 4A69C 1FTZA 3IH3A 3M4OJ 2XPWA 2X9DA 3JREA 2ME0A 3S14J 2CU7A 1JTYA 4JP0A 3TEDA 4UUTA 5C4XJ 3A01B 3JRDA 3OOUA 4JX5A 5EGOB 3LSPA 2NOGA 2GM4A 1I50J 4B4CA 1B72B 3GTQJ 4BBSJ 4M3DA 1IDYA 3NAUA 2KT0A 1RKTA 2YS9A 3GTJJ 4I76A 3C2BA 2DA3A 3O8GA 1RETA 5HODA 4G12A 1MH4A 1K83J 1MNMC 2MW8A 1LFUP 1GV2A 5M5XJ 2IBDA 3PO2J 2L7MP 1PUFB 2CQXA 4MFEA 1MH3A 4D5FA 1AKHB 4FTHA 3LSGA 2P81A 5F1JA 3HOWJ 3WHBA 2VKEA 4M3GA 5J1RA 3ZQCA 4M3EA 5F0HA 1X2MA 1ZQ3P 1Q1VA 1MBJA 2HOAA 1HOMA 2GLOA 1Z77A 1AU7A 1ZTRA 4RDUA 2IEKA 2M0CA 3K7AJ 3UKGA 1NTCA 3JRAA 3BTLA 1JGGA 2VKVA 4L5EA 5DTDA 4QTRA 5F27A 2Y0SN 5K7FA 3B6CA 2X48A 2DMPA 4AYBN 2Y2ZA 1TWAJ 2XSDC 4A3CJ 3IH4A 2NVXJ 1UMQA 5IOZA 1AHDP 5J1UA 2JK3A 5EG0B 1H88C 1I3QJ 1OCPA 4NDLA 4BY1J 2LFBA 1GVDA 3SFIA 1ZR2A 4XRSA 1UHSA 4A3KJ 2CQQA 1IJWC 1DU0A 3BR0A 5FLVA 2ID3A 2R5YB 2I10A 1BL0A 1NK3P 3GTGJ 3S1RJ 3LSJA 3M3YJ 2JJ7A 4W97A 3A03A 2HOTA 4MO7A 3I4MJ 1MBHA 3ZQLA 2R93J 1GT0C 3QPSA 2JA7J 4LOCA 5EDNA 4A3GJ 3JRIA 4B3AA 3Q3SA 2E2IJ 5J1YA 4X1EA 1GV5A 2M8GX 1SFOJ 1FJLA 5FLMJ 3BTCA 2JA8J 1XS9A 3Q0WA 2O8KA 2NVYJ 3D1NI 2L9RA 3FISA 3H3VK 2ECBA 4XIDA 2VUMJ 5F0CA 1MBFA 1LE8B 2DN0A 3HOUJ 4QSHA 1E3OC 3TP0A 5E3LA 4A3FJ 1YRNA 3HGGA 3HOYJ 3GTKJ 1TWCJ 1APLC 3RKQA 2MGQA 3BTJA 2EZLA 2DA6A 2XPVA 3BG3A 3OSGA 1A5JA 3JR9A 2EZHA 3BR5A 3HKZN 1ORKA 2DA5A 3FIWA 3RZDJ 1I6HJ 2LY9A 5EYRA 4EEFG 5GPCA 2FD5A 1JJ6C 5FKNA 5FKOA 4I6ZA 1B8IA 1TWFJ 4FCYA 3GBGA 3L1PA 1IDZA 5F0FA 4A3JJ 4IEJA 3BQYA 2L7FP 1MBKA 1ETKA 1JKOC 2NVQJ 4C3JJ 2R7ZJ 2LR8A 2ELKA 1WH7A 1SANA 1XC5A 4BKXA 3PO3J 3RZOJ 3BG9A 4RBOA 2MSYA 3CQZJ 3Q0VA 1U8BA 4IHXA 1EF4A 2E2HJ 4A3IJ 4B1RA 1G2HA 3QQAA 2JWTA 4A93J 1Z0XA 1JJ8C 1H8AC 1HF0A 2E1OA 2COBA 1ETOA 2CUFA 1D5YA 1X2NA 5BNGA 2EZIA 2HXOA 3BR1A 2GBYA 5E3OA 5C4JJ 5IPAA 2FX0A 2XPUA 5M3MJ 2R5ZB 1U9OA 2EH3A 4GFBA 2DA4A 3TW6A 2EQRA 2JA6J 1T56A 2NVTJ 2LTPA 4DW6A 3MKLA 3JRHA 2AO9A 1TWHJ 3IH2A 2LP0A 3ZQFA 1WH5A 9ANTA 1P7IA 5DS9A 3S2DJ 1JKQC 3BR2A 3GTOJ 3FK6A 1BJZA 4JYKA 5C3EJ 1S7EA 4UUSB 4IHWA 2H8RA 3ZQGA 4CYCB 1UG2A 1Y1VJ 2XB0X 5GPAA 2LLKA 2Y9ZA 4A3LJ 4A3MJ 1W0TA 3GTPJ 5IP9J 2H1KA 3A01A 2AHQA 2E19A 3LOCA 5EGOA 2M2EA 2DA2A 2X6OA 2ZB9A 4IHVA 3HOVJ 3HOXJ 2L7ZA 4BXXJ 1B72A 4HNVA 1IG7A 3SDGA 4MIMA 2NS8A 1ZKGA 2CRGA 3S15J 4A3EJ 1QRYA 2FQ4A 1MSEC 3JRCA 5FJ8J 5GP9A 2LKXA 1XG1A 2DMQA 3W6VA 2LD5A 3HEFA 3GTMJ 4C3HJ 3H0GJ 3CMYA 1PUFA 2L0KA 3F0CA 1AKHA 3ZQIA 4FE7A 4Y52J 3DCFA 3HGYA 5C44J 4V2FA 3HM5A 5K7HA 2TCTA 5EEAA 1VF9A 1IV6A 1NK2P 5IOYA 3SJMA 2QCOA 1F36A 4XICA 4D7NA 5EZGA 1LFBA 5E3NA 3HDDA 1QVUA 3ZQHA 3GTLJ 4FE4A 1MBGA 2DMTA 1U78A 2O7OA 1ENHA 4FISA 1JUSA 2W48A 3E7LA 1ETQA 4XK4A 3JRFA 2Y30A 2DA1A 3MN2A 5J3LA 3OSFA 1BW6A 1WCMJ 3HB9A 2VI6A 2NS7A 3ZOBA 1IGNA 2WAQN 1Y1WJ 2KDZA 5M3FJ 5EG0A 1FIPA 3HOZJ 1IC8A 2YUSA 3S16J 5K7ZA 3BT9A 2M9HA 1OFCX 3JRBA 3OIOA 4BBRJ 3S2HJ 3S1MJ 5FKLA 2DJNA 4IHYA 5FKKA 4XRSG 1JUMA 2Y9YA 3LNQA 1ETYA 2LVSA 3HBLA 5M5YJ 3CCYA 2R5YA 2HDDA 1RR7A 1HDDC 2K9QA 4C3IJ 1VFCA 1F43A 1VNDA 2LK2A 3BR6A 2B63J 1JUPA 4M3FA 1VI0A 1JKPC 1TC3C 2XGDA 3O8HA 4J19A 3S17J 2XB5A 3WHCA 1X58A 3G1OA 2ID6A 2ECCA 5IYDJ 4DYQA 3A02A 1JT6A 2XGCA 3BQZA 4Y7NJ 2YU9J 5JLWA 3S1QJ 2RAEA 1ITYA 2K9SA 1LE8A 2HQ5A 3TW7A 2E2JJ 1RESA 2PMZN 1WGXA 4AUXA 2EZKA 2JN6A 2K40A 2EBIA 4S0HB 3Q0UA 2DTZA 4JX4A 1OCTC 1POGA 2IAIA 1JT0A 4M3BA 2O9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N8G A;  5JLX A;  5F08 A;  1JTX A;  2R0Q C;  1R9T J;  5E3M A;  3G1L A;  1U9N A;  4ABZ A;  3VPR A;  1ZK8 A;  1A6I A;  5FKM A;  3K2A A;  1OJL A;  2WB1 N;  2HYJ A;  4QIW N;  1DU6 A;  1YRN B;  2M34 A;  1BA5 A;  3TP3 A;  3DEW A;  1GDT A;  2DMN A;  2FJ1 A;  1K61 A;  1HCR A;  3FK7 A;  3G1M A;  1HDP A;  1QPI A;  2HXI A;  5IYC J;  1HLV A;  4BY7 J;  2DMU A;  4X6A J;  2HI3 A;  3PM1 A;  4DYC A;  1W0U A;  1JKR C;  3S1N J;  1FIA A;  4V2G A;  2R5Z A;  4DZJ A;  4JX6 A;  1CQT A;  4MLO A;  3B6A A;  2XGE A;  2K9N A;  5EZH A;  4A3D J;  1B8I B;  2HOS A;  2OF7 A;  2R92 J;  2OPT A;  1BW5 A;  3BG5 A;  2DA7 A;  1ZR4 A;  5IYB J;  4DYR A;  1TWG J;  4D5C A;  1ETV A;  2Y31 A;  4MFD A;  1GUU A;  5IP6 A;  1QVT A;  2D5V A;  5IP7 J;  2QF7 A;  1RKW A;  4UUS A;  3IV5 A;  2G0E A;  1O4X A;  4M6V A;  4CYC A;  3QPL A;  2ME6 A;  1FEX A;  2XRL A;  4C2M J;  3LSR A;  2WV1 A;  3I4N J;  3BR3 A;  1IUF A;  1MBE A;  3CDL A;  2CJJ A;  1MSF C;  3BTI A;  1RPW A;  2VPR A;  3MVP A;  5F04 A;  1FTT A;  2TRT A;  4W1U A;  1IRZ A;  3NAR A;  1P7J A;  3RQI A;  2JA5 J;  4XRM A;  1WPK A;  2MG4 A;  5EF6 A;  5M5W J;  2JMW A;  2CUE A;  4DZP A;  3JRG A;  4D7M A;  1WI3 A;  1ZGW A;  4A3B J;  1ETX A;  1T33 A;  4AC0 A;  1H89 C;  1ETW A;  3FKI J;  4A69 C;  1FTZ A;  3IH3 A;  3M4O J;  2XPW A;  2X9D A;  3JRE A;  2ME0 A;  3S14 J;  2CU7 A;  1JTY A;  4JP0 A;  3TED A;  4UUT A;  5C4X J;  3A01 B;  3JRD A;  3OOU A;  4JX5 A;  5EGO B;  3LSP A;  2NOG A;  2GM4 A;  1I50 J;  4B4C A;  1B72 B;  3GTQ J;  4BBS J;  4M3D A;  1IDY A;  3NAU A;  2KT0 A;  1RKT A;  2YS9 A;  3GTJ J;  4I76 A;  3C2B A;  2DA3 A;  3O8G A;  1RET A;  5HOD A;  4G12 A;  1MH4 A;  1K83 J;  1MNM C;  2MW8 A;  1LFU P;  1GV2 A;  5M5X J;  2IBD A;  3PO2 J;  2L7M P;  1PUF B;  2CQX A;  4MFE A;  1MH3 A;  4D5F A;  1AKH B;  4FTH A;  3LSG A;  2P81 A;  5F1J A;  3HOW J;  3WHB A;  2VKE A;  4M3G A;  5J1R A;  3ZQC A;  4M3E A;  5F0H A;  1X2M A;  1ZQ3 P;  1Q1V A;  1MBJ A;  2HOA A;  1HOM A;  2GLO A;  1Z77 A;  1AU7 A;  1ZTR A;  4RDU A;  2IEK A;  2M0C A;  3K7A J;  3UKG A;  1NTC A;  3JRA A;  3BTL A;  1JGG A;  2VKV A;  4L5E A;  5DTD A;  4QTR A;  5F27 A;  2Y0S N;  5K7F A;  3B6C A;  2X48 A;  2DMP A;  4AYB N;  2Y2Z A;  1TWA J;  2XSD C;  4A3C J;  3IH4 A;  2NVX J;  1UMQ A;  5IOZ A;  1AHD P;  5J1U A;  2JK3 A;  5EG0 B;  1H88 C;  1I3Q J;  1OCP A;  4NDL A;  4BY1 J;  2LFB A;  1GVD A;  3SFI A;  1ZR2 A;  4XRS A;  1UHS A;  4A3K J;  2CQQ A;  1IJW C;  1DU0 A;  3BR0 A;  5FLV A;  2ID3 A;  2R5Y B;  2I10 A;  1BL0 A;  1NK3 P;  3GTG J;  3S1R J;  3LSJ A;  3M3Y J;  2JJ7 A;  4W97 A;  3A03 A;  2HOT A;  4MO7 A;  3I4M J;  1MBH A;  3ZQL A;  2R93 J;  1GT0 C;  3QPS A;  2JA7 J;  4LOC A;  5EDN A;  4A3G J;  3JRI A;  4B3A A;  3Q3S A;  2E2I J;  5J1Y A;  4X1E A;  1GV5 A;  2M8G X;  1SFO J;  1FJL A;  5FLM J;  3BTC A;  2JA8 J;  1XS9 A;  3Q0W A;  2O8K A;  2NVY J;  3D1N I;  2L9R A;  3FIS A;  3H3V K;  2ECB A;  4XID A;  2VUM J;  5F0C A;  1MBF A;  1LE8 B;  2DN0 A;  3HOU J;  4QSH A;  1E3O C;  3TP0 A;  5E3L A;  4A3F J;  1YRN A;  3HGG A;  3HOY J;  3GTK J;  1TWC J;  1APL C;  3RKQ A;  2MGQ A;  3BTJ A;  2EZL A;  2DA6 A;  2XPV A;  3BG3 A;  3OSG A;  1A5J A;  3JR9 A;  2EZH A;  3BR5 A;  3HKZ N;  1ORK A;  2DA5 A;  3FIW A;  3RZD J;  1I6H J;  2LY9 A;  5EYR A;  4EEF G;  5GPC A;  2FD5 A;  1JJ6 C;  5FKN A;  5FKO A;  4I6Z A;  1B8I A;  1TWF J;  4FCY A;  3GBG A;  3L1P A;  1IDZ A;  5F0F A;  4A3J J;  4IEJ A;  3BQY A;  2L7F P;  1MBK A;  1ETK A;  1JKO C;  2NVQ J;  4C3J J;  2R7Z J;  2LR8 A;  2ELK A;  1WH7 A;  1SAN A;  1XC5 A;  4BKX A;  3PO3 J;  3RZO J;  3BG9 A;  4RBO A;  2MSY A;  3CQZ J;  3Q0V A;  1U8B A;  4IHX A;  1EF4 A;  2E2H J;  4A3I J;  4B1R A;  1G2H A;  3QQA A;  2JWT A;  4A93 J;  1Z0X A;  1JJ8 C;  1H8A C;  1HF0 A;  2E1O A;  2COB A;  1ETO A;  2CUF A;  1D5Y A;  1X2N A;  5BNG A;  2EZI A;  2HXO A;  3BR1 A;  2GBY A;  5E3O A;  5C4J J;  5IPA A;  2FX0 A;  2XPU A;  5M3M J;  2R5Z B;  1U9O A;  2EH3 A;  4GFB A;  2DA4 A;  3TW6 A;  2EQR A;  2JA6 J;  1T56 A;  2NVT J;  2LTP A;  4DW6 A;  3MKL A;  3JRH A;  2AO9 A;  1TWH J;  3IH2 A;  2LP0 A;  3ZQF A;  1WH5 A;  9ANT A;  1P7I A;  5DS9 A;  3S2D J;  1JKQ C;  3BR2 A;  3GTO J;  3FK6 A;  1BJZ A;  4JYK A;  5C3E J;  1S7E A;  4UUS B;  4IHW A;  2H8R A;  3ZQG A;  4CYC B;  1UG2 A;  1Y1V J;  2XB0 X;  5GPA A;  2LLK A;  2Y9Z A;  4A3L J;  4A3M J;  1W0T A;  3GTP J;  5IP9 J;  2H1K A;  3A01 A;  2AHQ A;  2E19 A;  3LOC A;  5EGO A;  2M2E A;  2DA2 A;  2X6O A;  2ZB9 A;  4IHV A;  3HOV J;  3HOX J;  2L7Z A;  4BXX J;  1B72 A;  4HNV A;  1IG7 A;  3SDG A;  4MIM A;  2NS8 A;  1ZKG A;  2CRG A;  3S15 J;  4A3E J;  1QRY A;  2FQ4 A;  1MSE C;  3JRC A;  5FJ8 J;  5GP9 A;  2LKX A;  1XG1 A;  2DMQ A;  3W6V A;  2LD5 A;  3HEF A;  3GTM J;  4C3H J;  3H0G J;  3CMY A;  1PUF A;  2L0K A;  3F0C A;  1AKH A;  3ZQI A;  4FE7 A;  4Y52 J;  3DCF A;  3HGY A;  5C44 J;  4V2F A;  3HM5 A;  5K7H A;  2TCT A;  5EEA A;  1VF9 A;  1IV6 A;  1NK2 P;  5IOY A;  3SJM A;  2QCO A;  1F36 A;  4XIC A;  4D7N A;  5EZG A;  1LFB A;  5E3N A;  3HDD A;  1QVU A;  3ZQH A;  3GTL J;  4FE4 A;  1MBG A;  2DMT A;  1U78 A;  2O7O A;  1ENH A;  4FIS A;  1JUS A;  2W48 A;  3E7L A;  1ETQ A;  4XK4 A;  3JRF A;  2Y30 A;  2DA1 A;  3MN2 A;  5J3L A;  3OSF A;  1BW6 A;  1WCM J;  3HB9 A;  2VI6 A;  2NS7 A;  3ZOB A;  1IGN A;  2WAQ N;  1Y1W J;  2KDZ A;  5M3F J;  5EG0 A;  1FIP A;  3HOZ J;  1IC8 A;  2YUS A;  3S16 J;  5K7Z A;  3BT9 A;  2M9H A;  1OFC X;  3JRB A;  3OIO A;  4BBR J;  3S2H J;  3S1M J;  5FKL A;  2DJN A;  4IHY A;  5FKK A;  4XRS G;  1JUM A;  2Y9Y A;  3LNQ A;  1ETY A;  2LVS A;  3HBL A;  5M5Y J;  3CCY A;  2R5Y A;  2HDD A;  1RR7 A;  1HDD C;  2K9Q A;  4C3I J;  1VFC A;  1F43 A;  1VND A;  2LK2 A;  3BR6 A;  2B63 J;  1JUP A;  4M3F A;  1VI0 A;  1JKP C;  1TC3 C;  2XGD A;  3O8H A;  4J19 A;  3S17 J;  2XB5 A;  3WHC A;  1X58 A;  3G1O A;  2ID6 A;  2ECC A;  5IYD J;  4DYQ A;  3A02 A;  1JT6 A;  2XGC A;  3BQZ A;  4Y7N J;  2YU9 J;  5JLW A;  3S1Q J;  2RAE A;  1ITY A;  2K9S A;  1LE8 A;  2HQ5 A;  3TW7 A;  2E2J J;  1RES A;  2PMZ N;  1WGX A;  4AUX A;  2EZK A;  2JN6 A;  2K40 A;  2EBI A;  4S0H B;  3Q0U A;  2DTZ A;  4JX4 A;  1OCT C;  1POG A;  2IAI A;  1JT0 A;  4M3B A;  2O9L A; 
#chains in the Genus database with same CATH topology
 3SFZ A;  2QLZ A;  4U7D A;  1BR4 A;  2P5K A;  2WV0 A;  3GZN B;  4XNF A;  3WG9 A;  2GWR A;  3TGN A;  4A6E A;  3RPU A;  1FWZ A;  2FNA A;  2F5D A;  3E5U A;  3FM5 A;  3ZQQ A;  2VE9 A;  1OJL A;  3R0A A;  2CMP A;  1R36 A;  4QIW N;  3V7R A;  2OV7 A;  2FML A;  4ZYH A;  4KT6 A;  3HHG A;  1GDT A;  2DMN A;  3KP7 A;  3IWZ A;  3HSR A;  2ZXW H;  4OMZ A;  3G1M A;  1HDP A;  1QPI A;  1HLV A;  5D8L B;  3T1B A;  4X6A J;  2HI3 A;  3HL2 A;  4DYC A;  1D0Y A;  1W0U A;  2ZXH A;  3DBR B;  4NUB A;  2JZY A;  4F7Z A;  2Q1Z B;  5B66 C;  2R5Z A;  5B3S H;  4U7B A;  4JX6 A;  2F5F A;  2WAF A;  1ZRC A;  2MH9 A;  3V42 A;  2NNY A;  3FXK A;  2UV1 A;  2VBY A;  1HST A;  2R7O A;  3WU0 A;  5B1A H;  3RQ4 A;  2DDA A;  2EK5 A;  3BG5 A;  2O0Y A;  2Y48 A;  5B1B H;  4KUM A;  2HVQ A;  1ETV A;  4MFD A;  4YEJ A;  1GUU A;  3CP8 A;  2QSF X;  1FMW A;  2QF7 A;  3FXL A;  4KA4 A;  2CQN A;  1X3U A;  1UFM A;  4OU0 A;  3OYE A;  1TQM A;  3W3C A;  2G0E A;  2OC6 A;  5L3F A;  4M6V A;  5LEJ A;  1O4X A;  4LB5 A;  2OUM A;  3EET A;  4A5N A;  4BE1 A;  1GXP A;  4Y13 A;  3QPL A;  1FSH A;  1FEX A;  2V7F A;  1HC8 A;  2K9M A;  5CVV A;  3DU6 A;  3KCC A;  5L3B A;  3I58 A;  1RPW A;  2HDW A;  3ABK H;  5F04 A;  1FTT A;  1MJA A;  2ISZ A;  2A6H F;  1VQ8 I;  3H3U A;  2BY1 A;  3K69 A;  1DPR A;  4IRG A;  2R3S A;  4WWC A;  2HKX A;  1Z6R A;  3FXR A;  5E18 F;  1OYY A;  5EF6 A;  4B44 A;  2P4W A;  3H1C A;  4XLA A;  4DZP A;  3JRG A;  3BPV A;  4LK1 F;  3S3M A;  3TOA A;  3RKY A;  2IS2 A;  2A5Y B;  1IN5 A;  4IOC F;  4A3B J;  4XKC A;  1ETX A;  1G59 A;  2B9S A;  1LEA A;  1RI7 A;  3CJQ B;  1H89 C;  4G9Y A;  2MYS A;  1YW7 A;  2KIM A;  2BHY A;  3FXU A;  2XPW A;  4Y3O A;  4EJV A;  5HDN A;  2WWY A;  1YQA A;  3S14 J;  1JTY A;  1WJD A;  2CWE A;  1VQ4 I;  4KIG A;  5J40 A;  2CW0 F;  3K4K A;  4YFK F;  4UUT A;  5C4X J;  4RLF A;  3A01 B;  3VOD A;  2A61 A;  2DW4 A;  3OIP A;  2ELH A;  2GXG A;  4JX5 A;  2DI3 A;  2NOG A;  1F1Z A;  2RC4 A;  4M9S A;  1YOV B;  1WKM A;  4AD9 A;  4M3D A;  1Z6T A;  1J2X A;  3V4G A;  3IRR A;  3GTJ J;  4CXF A;  3DEU A;  3L09 A;  4BXU A;  1CGP A;  5HOD A;  1RET A;  4G12 A;  1MH4 A;  4XL9 A;  2PJR B;  4NC8 A;  1N77 A;  5M5X J;  1TZL A;  1HA8 A;  2A68 F;  3RPU D;  1W7P A;  1SFK A;  3L9F A;  1X3W B;  5GTI C;  2QEN A;  5L3G A;  2H1L A;  4O6J A;  3BG6 A;  2CUZ A;  4X0G A;  2VKE A;  3ZQC A;  1IRF A;  3R0J A;  3KP2 A;  1X2M A;  3Q9V A;  3ZMD A;  1OCC H;  4ZYE A;  3M1E A;  4P5O A;  2HR3 A;  3VYR B;  1NTC A;  1IXS B;  3SQN A;  4ESJ A;  2NXN B;  4RB3 C;  5HS7 A;  4CDG A;  3I9V 2;  3OS1 A;  4XLC A;  1LNW A;  2QZ8 A;  5DTD A;  2Y0S N;  4BEH B;  2L9V A;  5K7F A;  2WTE A;  3B6C A;  2NNN A;  4XM3 A;  1KQ9 A;  1VQO I;  2W85 A;  4KNY A;  2ICW G;  1SEU A;  1TWA J;  3P5J A;  2XSD C;  4NQW B;  4A3C J;  1FLI A;  2VN2 A;  5J47 A;  5D4S A;  1UMQ A;  5ERI A;  1T6S A;  4IOA F;  2Z9O A;  1H88 C;  3DTI A;  3A2K A;  2O03 A;  1RC9 A;  2JSC A;  4I0A A;  2L3D A;  4NDL A;  2FSW A;  1WVR A;  3QPT A;  1GVD A;  1Y0U A;  5KVR A;  1MZB A;  1YFH A;  2V1N A;  3MCZ A;  3GF2 A;  5HLG A;  2IA2 A;  2QQ9 A;  4UVB A;  4XOR A;  3CCE I;  2ESH A;  4XSZ F;  1HKS A;  1NK3 P;  5HNH A;  3O3K A;  2BXY A;  2QVO A;  3HC7 A;  2FUG 2;  3M3Y J;  1OYW A;  2JJ7 A;  3QYB A;  4W97 A;  4RB1 A;  5LRR A;  3I4M J;  3I59 A;  3OYN A;  4GRI A;  1MGT A;  2ZSI B;  4M73 A;  3K70 C;  3Q3S A;  2W82 A;  4WCG A;  5KK1 A;  1ZYR F;  1SFO J;  2BW3 B;  2A6T A;  2QUF A;  5KNL A;  2NVY J;  3K0L A;  4YRV A;  4IHS A;  2E36 A;  4MTE A;  3JAM Z;  2E1C A;  4B43 A;  3G3Z A;  2O6G E;  2GA2 A;  5ICC A;  4N9I A;  3KLN A;  3HOY J;  3WU2 C;  1GXQ A;  3GTK J;  1TWC J;  4LD5 A;  3HRS A;  4P96 A;  5AIP A;  1FNN A;  1TW2 A;  3EUK L;  3SYT A;  2DK8 A;  3W2V A;  3BG3 A;  1H9T A;  1A5J A;  2ZJP F;  3JR9 A;  1A35 A;  3ELK A;  2L9S A;  2ZFU A;  3PSI A;  2RV8 A;  3CUO A;  3GFL A;  2R7S A;  5GPC A;  2OTJ I;  1T08 B;  4P55 A;  3DLL F;  2DOD A;  1BI1 A;  1H0M A;  4CGZ A;  3ONQ A;  3KZI C;  1VQ5 I;  2CS3 A;  1B9M A;  1UJ8 A;  3D5R C;  4A3J J;  4MTD A;  1FY7 A;  1ETK A;  4RS8 A;  4R79 A;  2BVM A;  2F4M B;  3HRU A;  3HZJ A;  1W7P D;  2DT6 A;  3KZZ A;  3C2G A;  4ENM A;  1OQY A;  3CQZ J;  2W4S A;  2O8X A;  4RAG A;  4IHX A;  3HHH A;  1K78 B;  3OYG A;  4OAZ A;  4B1R A;  3BP8 A;  3PNV A;  3QQA A;  5ILV A;  1G3S A;  1H8A C;  2QQA A;  3J80 K;  1HF0 A;  2OQR A;  2CUF A;  1GHC A;  3QPH A;  2CW7 A;  3TL4 X;  2K4B A;  3OYF A;  4YIR X;  2OU2 A;  2BV6 A;  4EM0 B;  2FX0 A;  1SD5 A;  2I5U A;  4RMN A;  1YS7 A;  2VPL A;  4PGH A;  1U9O A;  2JSP A;  2EH3 A;  3CDH A;  1OIS A;  4PJM A;  2OZ6 A;  4Y33 A;  4XR6 A;  2JA6 J;  4KIT B;  3I64 A;  2A3S A;  4DW6 A;  5LGT A;  2NVT J;  1U2W A;  2L7K A;  3OYJ A;  3IH2 A;  3OR1 C;  3ZQF A;  2VBX A;  3RDI A;  4RGU A;  3FK6 A;  4RM3 A;  3VYU B;  3MWM A;  3ECO A;  4LK0 F;  5H20 A;  1UG2 A;  1Y1V J;  2QM3 A;  2HTS A;  2XB0 X;  1Z91 A;  2MD5 A;  2XKP A;  4ZDL A;  6PAX A;  2IS1 A;  3ABL H;  4PJ0 C;  2DBB A;  2KIQ A;  4HZF A;  4LIU A;  3A01 A;  3ZN1 A;  2KRH A;  4ENN A;  4XQF A;  1SVO A;  2FF4 A;  2DO7 A;  3BJO A;  5GTH C;  4OAY A;  3TKY A;  4KIF A;  3M9A A;  2IW5 A;  3HOV J;  3H35 A;  3HOX J;  4Z2Y A;  2L7Z A;  3COA C;  2KLO A;  3EPZ A;  1LJ9 A;  4BE0 A;  1EH6 A;  4G8X A;  4LMY A;  1VQM I;  4A3E J;  1QRY A;  3ABM H;  3JRC A;  4HX4 A;  4U0V A;  2PJR A;  5FJ8 J;  1ZG3 A;  1BR1 A;  2LKX A;  1WRJ A;  1X1B A;  2HQR A;  3S2W A;  2LD5 A;  3HEF A;  3GTM J;  4C3H J;  4ZJZ A;  1UZC A;  1LDK B;  3J80 Z;  1SFX A;  4UY8 I;  1XTA A;  4ETS A;  1Z21 A;  5D5W B;  1XN7 A;  1F9N A;  3ZQI A;  4FE7 A;  1FPQ A;  3PFI A;  3DCF A;  3AAF A;  1PUE E;  4YG2 F;  1TT0 A;  4B3X A;  1MJB A;  5E79 C;  2ZBK A;  5IOY A;  3GEZ A;  4IXA A;  1IN4 A;  1SD7 A;  4XIC A;  3TO7 A;  1T0F A;  1DPU A;  1N25 A;  2E1M C;  2M8E A;  3CC7 I;  1LFB A;  5E3N A;  1QVU A;  2ESN A;  1JUS A;  4BEH A;  3I55 I;  3KLO A;  2VJ4 A;  3RTR A;  1ETQ A;  4CH7 A;  3J81 K;  3JRF A;  1VQP I;  3BZK A;  3L00 A;  2Y69 H;  2M45 A;  4PCQ A;  1TNT A;  4NQW A;  2VI6 A;  3J7A Y;  2NS7 A;  2JTV A;  4PUS A;  1U5T B;  2FBH A;  1QA6 A;  2KZG A;  2RRE A;  3FMR A;  5TRD A;  1TTY A;  2M7B A;  1XMA A;  3CJR B;  3V8L A;  2KIF A;  2PMH A;  2VAS A;  5JHF A;  4BQQ A;  1KZH A;  2F5E A;  3QP5 A;  2M9H A;  5CJ9 A;  5BQT A;  4GCV A;  3S2H J;  5FKL A;  2DJN A;  1ZLK A;  1S9H A;  2HPM A;  3PUB A;  4H4K C;  2Y9Y A;  2V1X A;  1FOY A;  1AA7 A;  2Z33 A;  2PEX A;  2X85 A;  1YW9 A;  5LHG A;  3KIO A;  2ZNZ A;  4B48 A;  4ANJ A;  5H6R A;  1KA8 A;  1Y39 A;  1K79 A;  3F21 A;  1EH8 A;  3OYD A;  4LJZ F;  3ASN H;  4N4O B;  1SVL A;  4HNT A;  3LAJ A;  1Y56 A;  3M8J A;  1JKP C;  1BI2 A;  3LMM A;  1R1T A;  2WY8 Q;  3KP5 A;  4FX0 A;  4OIP F;  3O8H A;  4A2U A;  1T2K A;  2BW3 A;  4Y4R A;  4KYW A;  4BE2 A;  1RZ4 A;  3VB2 A;  3CES A;  2IT0 A;  1JT6 A;  3BQZ A;  1HKQ A;  2LDU A;  2LRD A;  3NQO A;  4UVA A;  3CUQ B;  2RQP A;  2FE3 A;  2K9S A;  3D5L A;  3E5Q A;  5H6Q A;  3FHZ A;  2A07 F;  2HQ5 A;  4IO9 F;  1M1E B;  5HLI A;  1G6N A;  2EV0 A;  2CQ7 A;  3A1Y A;  3X2Q H;  2YU3 A;  4AIH A;  3ABU A;  2EZK A;  4AUX A;  2JN6 A;  3J81 Z;  2EV5 A;  2BEO A;  3LL7 A;  3F9K A;  3FDY A;  1I1S A;  2HKO A;  3PJR A;  2JVG A;  1O7F A;  1SMT A;  4NB5 A;  3DKY A;  4OMY A;  2DTZ A;  1OCT C;  1XPX A;  2N8G A;  2D45 A;  1IV8 A;  5LLQ A;  4NBQ A;  2HFH A;  2UWM A;  2LNB A;  2DK5 A;  3O2P E;  2G7H A;  1R9T J;  2CV2 A;  4IKF A;  5E3M A;  1AOY A;  4EJO A;  3MZH A;  1ZHF A;  1U9N A;  2CW8 A;  1Z3X A;  3H9G A;  3VPR A;  1A6I A;  1SFU A;  2R7W A;  1E0E A;  1PVE A;  4YEL A;  3DP7 A;  1Z9C A;  3DPT A;  1ZRE A;  2X4H A;  1K78 A;  1DU6 A;  2M34 A;  3GWZ A;  4XMY A;  4EMS A;  4PSX A;  2BE5 F;  3FK7 A;  1YHQ I;  4XLH A;  3GLL A;  2ZJQ F;  2DMU A;  1O3T A;  3PM1 A;  2B0L A;  1FIA A;  1TW3 A;  4PDK A;  2LMD A;  3G6E I;  3MKY B;  1L0O C;  4DZJ A;  4MLO A;  3KP3 A;  2K9N A;  5EZH A;  5LFA A;  1OLT A;  2DAO A;  3IUO A;  2K3F A;  2OF7 A;  1XMX A;  1QPM A;  2X1C A;  5HLH A;  1E17 A;  1E2X A;  1W4M A;  1BW5 A;  4BXF A;  1XX5 A;  2BXZ A;  2BY2 A;  4DYR A;  5DM6 F;  4ESB A;  1TWG J;  2R7Q A;  2JPC A;  3QU6 A;  1QVT A;  1G3Y A;  5F64 A;  3IWF A;  1ODD A;  5D5X B;  3FBI B;  4HQM A;  1BR2 A;  2P6T A;  5LHH A;  2FOK A;  2ZME B;  1V3F A;  2ME6 A;  1MKM A;  4C2M J;  1K6Y A;  2WV1 A;  4BQN A;  4C2U A;  4L9N A;  2CJJ A;  2O61 A;  1DQU A;  1TNS A;  3DQV C;  2EFW A;  4II3 A;  3NWT A;  4UB6 C;  1WJC A;  1IRZ A;  1P7J A;  3HG9 A;  3RQI A;  2JA5 J;  4XRM A;  3QYF A;  2XC7 A;  5DYM A;  5M5W J;  2CUE A;  1FYK A;  3S3O A;  4D7M A;  1ZGW A;  4IHT A;  3E0J B;  2JA2 A;  1W5S A;  1T33 A;  2ZXJ A;  1LDJ A;  3LA2 A;  3ECH A;  2HTJ A;  2R4G A;  4ZC3 A;  1D1B A;  1FYM A;  1BIA A;  4HG2 A;  2V9K A;  2X51 A;  2WAD A;  5CLS A;  4A69 C;  1IRG A;  2WB1 A;  3M4O J;  2X9D A;  2CU7 A;  2HGC A;  4IX7 A;  1S72 I;  2CH0 A;  2F5V A;  3EYI A;  2IS4 A;  1ZGJ A;  4QWQ A;  1T38 A;  1RNL A;  4U88 A;  5L3C A;  3H9J A;  4XBF A;  2YX4 A;  4G7Z F;  2M4G A;  3OOU A;  5EGO B;  3LSP A;  2W24 A;  2Y0M A;  3FHN A;  2EFO A;  2EFQ A;  4B4C A;  1B72 B;  1IDY A;  1RKT A;  2YS9 A;  3C2B A;  1E3P A;  2PI0 A;  1S6L A;  3CF2 A;  2KRC A;  3BRO A;  1UG0 A;  3HRT A;  3TQN A;  1MNM C;  5BMZ A;  1OKR A;  4HV6 A;  1BBY A;  1GV2 A;  2CV0 A;  2IBD A;  3FWE A;  2PLY A;  5HDK A;  2L54 A;  1KQ0 A;  2V6C A;  2BY0 A;  2L7M P;  3SHF A;  1BJA A;  2K5C A;  4MFE A;  1TP4 A;  4D5F A;  5D5V B;  4BJ5 C;  3CCM I;  1Z7L A;  3WHB A;  3FXO A;  3BDD A;  1TQP A;  2LH9 A;  2QKM B;  2XAF A;  3M8F A;  1YJW I;  3RJP A;  2L2O A;  2A69 F;  2VJJ A;  3C7J A;  2VC1 A;  3M1C A;  2C6Y A;  4Q5S F;  3I53 A;  2R7U A;  2M0C A;  3OV8 A;  4Q4Z F;  1W5C C;  3E1S A;  5BOX A;  5HOO A;  1JGG A;  5ICF A;  3BG7 A;  2P7V B;  5F27 A;  1MMG A;  1BI0 A;  3G2B A;  2IGM A;  3P9C A;  2DMP A;  1J09 A;  4DOZ A;  3PFY A;  2Y75 A;  2KJC A;  1HW1 A;  4CIC A;  1PP8 F;  2JK3 A;  2KQR A;  3GFI A;  2KIS A;  1Z05 A;  2FQ3 A;  1OCP A;  3FMQ A;  2AXT C;  3DFG A;  2LFB A;  3F6O A;  4LG0 B;  3CUQ A;  4XRS A;  5FLX K;  2W7N A;  5A2Q K;  3BJA A;  3ERE D;  4A3K J;  4IRI A;  1P92 A;  2RDP A;  5FLV A;  2R5Y B;  3ML6 A;  2I10 A;  1BL0 A;  3GTG J;  3S1R J;  3LSJ A;  4BJT A;  2DPU A;  4D0P A;  3BPX A;  3IC7 A;  4LIT A;  5EEH A;  1I39 A;  3A03 A;  2HOT A;  4ZYG A;  1SD6 A;  4FT8 A;  1MBH A;  3IKV A;  2JA7 J;  5EDN A;  1UCR A;  2RVC A;  1R4M B;  2OA4 A;  2KMU A;  3ZMZ A;  3LQR A;  3JRI A;  1Q1H A;  4PZJ A;  3BCB A;  3MFK A;  3L2V A;  3AL0 C;  2E2I J;  4O5V A;  2M8G X;  5TJJ A;  1RR8 C;  1FJL A;  3S8P A;  3KYL A;  3FIS A;  1ZN2 A;  4Y15 A;  4BQO A;  3MKZ A;  2STW A;  5F0C A;  4KIB A;  4ZYD A;  3OYB A;  1TL8 A;  1IO2 A;  2IXS A;  2TDX A;  1S5L C;  4HX8 A;  3HOU J;  2ELJ A;  1BC7 C;  1U0J A;  4QSH A;  3FM3 A;  3L2R A;  3N4M A;  1A04 A;  3HGG A;  1UEL B;  1K4T A;  2X6X A;  3H92 A;  4ZH4 F;  4L18 B;  1X1A A;  3EUH C;  2MGQ A;  2EZL A;  5D6E A;  3L7W A;  2EZH A;  4HF2 A;  1ORK A;  1FT9 A;  2DA5 A;  2PJP A;  4GYG A;  1I6H J;  5EYR A;  4ZZL A;  5IT3 A;  3IHU A;  4HQE A;  3ROU A;  1BI3 A;  1UST A;  5FKN A;  4CCO A;  1J5Y A;  5FKO A;  4UHT A;  3QP6 A;  4I6Z A;  3KEQ A;  4BHC A;  2FBK A;  1TWF J;  4BAC A;  4FCY A;  1KU9 A;  4YIF A;  2GAU A;  2LRE A;  4IQ4 A;  5F0F A;  4NC6 A;  3WTY C;  4E7H A;  1MBK A;  5FLX Z;  2NVQ J;  2FRH A;  4C3J J;  5A2Q Z;  2KPM A;  5L3E A;  2DTR A;  5FO5 A;  1WH7 A;  4BKX A;  5BS6 A;  1W36 D;  4F52 A;  3V8J A;  2DQR A;  4E7I A;  4J00 A;  3NRV A;  1WSU A;  4OIN F;  2EIM H;  4KT5 C;  2E2H J;  4EJW A;  2HQN A;  4WXC A;  4AWX B;  1G2H A;  1R5G A;  1Z0X A;  2ZME A;  4I7H A;  3M7G A;  3HUG B;  1IZ1 A;  2E1O A;  4IRH A;  5BNG A;  2ACJ A;  2E7W A;  1KGS A;  2LYC A;  1SC7 A;  2EZI A;  2UXN A;  1TLH B;  1X3Z B;  1B4A A;  2GBY A;  2CQK A;  3GO5 A;  3ZGK A;  5E3O A;  1XCV A;  5GAH J;  5C4J J;  2WC2 A;  2DFF A;  5IPA A;  4XOT A;  5HDG A;  2L5Q A;  2P5L C;  1FMV A;  2EIJ H;  3SEQ A;  2EQR A;  2EA4 A;  2ZKZ A;  1A31 A;  2LTP A;  1QU3 A;  3QOE A;  3JRH A;  2LP0 A;  3WE2 A;  5CVR A;  2LKP A;  2E7X A;  2JT1 A;  1O3S A;  5DS9 A;  2L02 A;  3AG3 H;  3OYK A;  2ZC2 A;  3TOB A;  5C3E J;  4XSX F;  3ZQG A;  1MW7 A;  4CYC B;  3QWL A;  1H9G A;  3UNG C;  2ISY A;  1OPC A;  4ENK A;  1W0T A;  2M3A A;  2H1K A;  1IN6 A;  2XAG A;  4EJT A;  1T0F C;  3HKZ A;  2AHQ A;  5EGO A;  3CLO A;  2VC0 A;  1Y0N A;  2DA2 A;  2X6O A;  2ZB9 A;  4IHV A;  5LD2 C;  2UUZ A;  4HDU A;  1B72 A;  5JI6 A;  1JXS A;  1IF1 A;  4EGY A;  4Q47 A;  2NS8 A;  1W5T A;  1O57 A;  2IP2 A;  3OMY A;  2FQ4 A;  1FSE A;  3T0Y A;  1MSE C;  4GO1 A;  4G94 A;  2DMQ A;  3W6V A;  4XLF A;  4XLE A;  2E5Z A;  2DFE A;  3AG1 H;  5CYV A;  1JHH A;  2L0K A;  5E1W A;  3KFW X;  2H6C A;  2D2W A;  1STZ A;  4F91 B;  3WOD F;  1C0W A;  3HGY A;  4RGS A;  5C44 J;  5JVG F;  4V2F A;  1U8R A;  4Y17 A;  4CA0 A;  3T8T A;  2R7R A;  1D0Z A;  2F4O B;  1NK2 P;  4DJA A;  1PDN C;  1ZEL A;  4D7N A;  5D8K B;  5EZG A;  3J7Z I;  3OYI A;  3CJT B;  3SZT A;  1R23 A;  2K85 A;  4CCL A;  3AFH A;  1K7A A;  2O7O A;  3OIQ A;  1HBX G;  5E17 F;  1IN7 A;  3FXJ A;  2CFX A;  5J3L A;  3OYM A;  3OSF A;  4HNU A;  1D1C A;  2P8T A;  4EAT A;  3HB9 A;  1B6A A;  2XSJ C;  3H3Z A;  3WGI A;  1Y1W J;  3IL2 A;  4CCN A;  1ZRF A;  1R22 A;  3KET A;  1FIP A;  2FMY A;  3QYE A;  4YFX F;  2F6C A;  2VKH A;  3R60 A;  1HQC A;  2LY2 A;  1OFC X;  4LG0 A;  3JRB A;  1RUN A;  1ZG1 A;  1R71 A;  5DEQ A;  1EKE A;  5FKK A;  4AU7 A;  5E8I A;  1Y6I A;  2R5Y A;  4HW0 A;  2ADU A;  1K4S A;  1T39 A;  1G3T A;  1HDD C;  3E6M A;  2XAU A;  3MEX A;  5GAD J;  2K9Q A;  4E7L A;  1VFC A;  1X4P A;  2HZT A;  4RGR A;  3VOE A;  3WE3 A;  4F55 A;  4NHJ A;  1XSV A;  2LK2 A;  1YJN I;  1LKX A;  5TIS C;  2VXD A;  1Y8Q B;  1FOW A;  1JUP A;  4M3F A;  2COM A;  5DUK A;  1V5E A;  3F22 A;  1TC3 C;  5ILU A;  4KIC A;  3EDP A;  4J19 A;  3S17 J;  3VSK A;  2EA2 A;  1QQI A;  2EFN A;  2XHK A;  3G73 A;  3G1O A;  2GA1 A;  2XDV A;  3V8K A;  2ID6 A;  4R1H A;  4E6K G;  2I8D A;  1OYI A;  1YIT I;  2WY7 Q;  3BWG A;  2LF7 A;  1IN8 A;  2VL8 A;  3G71 I;  3CF5 F;  4V19 K;  5ILS A;  4P9F A;  3HYI A;  3KEO A;  1HW2 A;  3UR3 C;  4N4N B;  5K5R A;  2VOD A;  3NEU A;  2MLG A;  2E2J J;  3U9G A;  3WGH A;  4DIQ A;  4EM1 A;  1ZGA A;  1WGX A;  2V79 A;  3FZV A;  5K5Q A;  2K40 A;  1D8K A;  1R5I D;  2PN6 A;  1X19 A;  1YE9 A;  2AXL A;  3ZR8 X;  3WTU C;  2BGC A;  3IP4 B;  5CQG A;  3CCL I;  2GOM A;  4IZZ A;  3VFZ A;  3HOT A;  3Q5F A;  4XKV A;  5IT9 K;  5JLX A;  3KEY A;  3H5A A;  2M30 A;  2WAQ A;  4RM2 A;  5F08 A;  3RKW A;  4LIV A;  4HOB A;  3L2W A;  3F6V A;  3GFJ A;  2DOE A;  1LFP A;  3G1L A;  2LSO A;  4P9U A;  1ZK8 A;  4UV8 A;  5J4Y A;  4FHT A;  5FKM A;  4Z6Y A;  3K2A A;  4HPQ A;  4F93 B;  2WB1 N;  1XGO A;  4IPA A;  4HF1 A;  3F8F A;  1BC8 C;  1Z7U A;  1LPQ A;  3TP3 A;  3DKW A;  2DCE A;  2FJ1 A;  3G4S I;  1K61 A;  3HUG A;  1HCR A;  4FAS D;  2CGP A;  2H6B A;  4BY7 J;  3OYH A;  2ZJ2 A;  1DGW Y;  3U1K A;  2JUG A;  4HDV A;  2MD0 A;  4V2G A;  2FNP A;  2XF5 A;  4WK8 F;  1CQT A;  2XGE A;  3HSE A;  4PFO A;  1B8I B;  2L01 A;  2HOS A;  2LBF B;  5IY5 H;  2R92 J;  2IA0 A;  1X1C A;  2OPT A;  3PQK A;  4BAY A;  1ZR4 A;  5IYB J;  2E34 A;  2H27 A;  2GIZ A;  5DUI A;  2LOO A;  4TV7 A;  3TDU C;  2HVS A;  3DKX A;  4D5C A;  3ESW B;  2D5V A;  4HF0 A;  4ZDO A;  5CVJ A;  2E1M B;  3B73 A;  3IV5 A;  3GXO A;  4E7Z A;  4CYC A;  1LDD A;  4ZZD A;  3ZPL A;  2VON A;  2QQ8 A;  2XRL A;  4LB6 B;  3I3L A;  3LSR A;  3I4N J;  3BR3 A;  1YIJ I;  4L5J A;  4N9H A;  1W1W E;  3CME I;  1IUF A;  1MBE A;  4PJJ A;  5IT9 Z;  3MVP A;  2KJB A;  4ASN A;  2KIU A;  4CCM A;  4W1U A;  4E7K A;  3NAR A;  4QLC U;  3FKJ A;  5DM7 F;  3F8M A;  3PSF A;  2MG4 A;  1ZAR A;  4L9T A;  3R6S A;  3LQQ A;  4EGZ A;  1SMY F;  2E71 A;  2VKD A;  3K4L A;  5F6F A;  3RKX A;  1S7O A;  4RAY A;  3OY9 A;  1U5T C;  2K9L A;  1KQ8 A;  4OIO F;  1ETW A;  1SFE A;  3KP4 A;  2VBW A;  2JRT A;  3IH3 A;  3OOP A;  4CCJ A;  5JVT A;  1OR7 C;  3C18 A;  3JRE A;  2Y0S A;  4A0X A;  3MZY A;  2CFO A;  2DXI A;  3TED A;  3RYR A;  1IXR C;  2RNG A;  3CCS I;  5FRN A;  1WJF A;  2HQA A;  1YI2 I;  1O3Q A;  2DJI A;  1OCR H;  5AIQ A;  2R7V A;  3JRD A;  2BY3 A;  1USS A;  3L2C A;  4E7J A;  2EPF A;  1ACI A;  2NOJ B;  1I1G A;  3K4B A;  1I6X A;  4PFP A;  3DBH B;  2GQQ A;  2KT0 A;  3NAU A;  2MAB A;  4I76 A;  2J5P A;  4XON A;  3PL8 A;  1OCZ H;  3HXL A;  5H2F C;  3O8G A;  1ON1 A;  1K83 J;  5F1R A;  2MW8 A;  2IGK A;  1LFU P;  3LSH A;  1VQ7 I;  4LLN A;  3CUQ C;  2R7X A;  1LEB A;  1MH3 A;  4CO8 A;  5B5E C;  3PIP F;  1AKH B;  2DYR H;  2O5R A;  3JTH A;  5F1J A;  3HOW J;  4M3G A;  2ZCW A;  5J1R A;  4M3E A;  3BZC A;  2KHM A;  1ZQ3 P;  3VYT B;  4R8H A;  2MC3 A;  4I0B A;  1IRX A;  2HOA A;  1HOM A;  1Z77 A;  1ZTR A;  4RDU A;  3QRF F;  3UKG A;  3WTT C;  3JRA A;  4XN3 A;  5E1Z B;  1FOK A;  4A0Z A;  2X1D A;  2STT A;  2XV4 S;  2X6W A;  4KFC A;  3S32 A;  4BDY A;  3IH4 A;  3I56 I;  4OIQ F;  4UUV A;  5IOZ A;  2XRN A;  5FRM A;  1XDS A;  5J1U A;  1AHD P;  2DPD A;  4CHU A;  3CTA A;  3W6K B;  3I54 A;  2K86 A;  1I3Q J;  2M87 A;  4BY1 J;  1Z3Y A;  4GXO A;  3SFI A;  3ZQ7 A;  4LLG F;  3KX2 A;  2CQQ A;  3ZMS A;  5BPD A;  1IJW C;  4C2T A;  2ID3 A;  4AIK A;  3V7C A;  3OYL A;  2HOE A;  1QZE A;  3KP6 A;  1WQ2 A;  1A36 A;  3PQJ A;  1GT0 C;  1XGM A;  2IVM A;  4A3G J;  2DT5 A;  4WXD A;  4B3A A;  2QGU A;  3QAH A;  4X1E A;  2EB7 A;  2MLK A;  3FBN B;  3Q0W A;  3D1N I;  1XDU A;  2E1N A;  2K02 A;  3DWL E;  1NHA A;  2BBY A;  2VUM J;  1MBF A;  4DNC A;  1MIJ A;  3GW2 A;  3JSO A;  1QNT A;  2WAE A;  3Q9S A;  1V5G A;  5JFR A;  1LE8 B;  2ZME C;  3TP0 A;  1R5H A;  1YX5 A;  2WA0 A;  5J8F A;  2L4M A;  1APL C;  1JI8 A;  1WJ5 A;  1S3J A;  2LKS A;  4M6X A;  5HS8 A;  3K70 D;  4PSW A;  2XPV A;  4ZTJ A;  4LLL A;  4F3Q A;  3HKZ N;  1ONV A;  3FIW A;  3RZD J;  2LY9 A;  3OWT A;  1EJ9 A;  4EEF G;  2EFP A;  5FFX A;  2YX7 A;  4WX9 A;  1ULY A;  1O7L A;  2QSH X;  1JJ6 C;  4AYB A;  1KYW A;  2ZO4 A;  1B8I A;  5FD5 A;  3GBG A;  2LBF A;  3FXM A;  2K27 A;  1HSJ A;  1JKO C;  5LHI A;  1J75 A;  1XGS A;  4IF4 A;  2LR8 A;  2QWW A;  2ELK A;  2VQC A;  5L3D A;  1FYL A;  1SAN A;  3PO3 J;  1MND A;  2GIV A;  4I98 B;  4EVI A;  3RZO J;  2K4J A;  3BG9 A;  4RBO A;  4FX4 A;  1U6G A;  3M07 A;  1U8B A;  2A05 A;  4M71 A;  3GME A;  1G4D A;  3HOS A;  4JQF A;  4B47 A;  2VOO A;  4A93 J;  2Z3Y A;  5HS9 A;  2M7A A;  2QKL B;  3LSK A;  4HEA 2;  2COB A;  1SAX A;  1ETO A;  1QO0 D;  3GCM A;  3SEZ A;  4MGR A;  2VJ5 A;  5DD8 A;  2HXO A;  2ZFW A;  3A0H C;  2IPQ X;  2HDC A;  2VXZ A;  1R6R A;  3HPH A;  3VSL A;  1R7J A;  1T95 A;  5BPI A;  2QBY B;  2EJR A;  2FU4 A;  2XPU A;  3AG2 H;  1X1P A;  1KYZ A;  1T8I A;  4IQJ A;  1WZ2 A;  1ZG5 A;  1UAA A;  2MH2 A;  4GFB A;  2VT2 A;  3DXJ F;  5FFZ A;  1T56 A;  1Z1D A;  1BN5 A;  2AO9 A;  1ERD A;  3K6G A;  1FZP B;  2OAZ A;  1A6Q A;  3N05 A;  5E1X A;  3S2D J;  1ZH5 A;  1R49 A;  2VQL A;  1I5Z A;  2BYV E;  3D5S C;  3WGG A;  4L0Z B;  4JYK A;  4FQG A;  4UUS B;  2VOP A;  2A5W A;  5LEK A;  1I27 A;  2H8R A;  3CC2 I;  3A4C A;  4RB0 A;  4XOP A;  2W25 A;  5GPA A;  2Y9Z A;  1RRJ A;  2V9V A;  4A3L J;  4BNC A;  2Z2S B;  3GTP J;  5IP9 J;  4D1Q A;  4K2E A;  1EH7 A;  3ABT A;  1WHU A;  1TT5 B;  2EV6 A;  4BH9 A;  2E19 A;  1V54 H;  2P0W A;  1SVM A;  4HNV A;  1LVK A;  3QOP A;  1QBJ A;  1IG7 A;  1S7A A;  3GYH X;  2VT3 A;  1ZKG A;  2CRG A;  2G9W A;  4G6Q A;  2VE8 A;  2H94 A;  2XAH A;  4F92 B;  3DTK A;  2HNH A;  4YII A;  1XSX A;  1XG1 A;  4U0W A;  3GUD A;  1IXC A;  3H0G J;  3P9I A;  2PG4 A;  2IRF G;  1X4O A;  1D3Y A;  1J9I A;  2LC2 A;  2OTL I;  3F0C A;  1YLF A;  4P1W A;  3L2U A;  1AKH A;  2LG4 A;  2P7C B;  3K9T A;  2HS5 A;  3F23 A;  4BU2 A;  1E3H A;  2PFB A;  3PNY A;  3AL0 B;  4KMF A;  3KPH A;  5K7H A;  2PBI A;  5EEG A;  2TCT A;  2X0L A;  2NYX A;  4HYE A;  1VF9 A;  4M72 A;  4PJL A;  2H8W A;  4RLQ A;  5EEA A;  3SJM A;  1FP2 A;  2Q0O A;  1IV6 A;  1F36 A;  1QHG A;  3K10 A;  3GLX A;  4A5M A;  4XLP F;  3GTL J;  4UVC A;  1MNE A;  1MBG A;  2DMT A;  4HAM A;  4L5I A;  4S04 A;  2DDB A;  3IAM 2;  3ISP A;  2W48 A;  3CO7 C;  3MN2 A;  4AM3 A;  3TO6 A;  1R1U A;  3CCR I;  1I3A A;  5DCM B;  2BHZ A;  4ITV A;  1AWC A;  2FBI A;  2ZNY A;  5LGN A;  4I09 A;  1IGN A;  2WAQ N;  2RNJ A;  3N97 A;  1IC8 A;  3K4J A;  2YUS A;  3K1P A;  3S16 J;  1G3W A;  3DF8 A;  5FD6 A;  5K7Z A;  2DYS H;  1B9N A;  2R7D A;  3DU5 A;  2E60 A;  3E3V A;  3OIO A;  4HST A;  4IJA A;  4BBR J;  4J01 A;  3S1M J;  1GLN A;  2R7T A;  1IAW A;  4IHY A;  1DUX C;  2HU9 A;  4XRS G;  2OCE A;  4E7S A;  4RGX A;  2VJI A;  3LNQ A;  2KRF A;  4BJ6 C;  5M5Y J;  3HBL A;  4HLY A;  5JR3 A;  2HDD A;  2VIX A;  4C3I J;  2YR2 A;  3HJE A;  1V5F A;  2HYG D;  1F43 A;  2DQL A;  3EQL F;  4O3M A;  4QPO A;  4C9Y A;  3CMM A;  3JTG A;  1HW5 A;  2BVL A;  1S29 A;  4BYY A;  4I02 A;  3RIR A;  3ZXS A;  3FMS A;  3TBI A;  2XGD A;  2RN7 A;  5HVQ C;  4M6Y A;  3SDB A;  1F4K A;  3JCU C;  2NVU B;  3U21 A;  3WHC A;  1X58 A;  2H09 A;  2DOA A;  2NAZ A;  3K4M A;  3ZN0 A;  4ZYA A;  2CYY A;  2ECC A;  5IYD J;  3FXQ A;  3A02 A;  4DYQ A;  4Y7N J;  3E6C C;  4UXN A;  3EUA A;  3S1Q J;  3WG7 H;  2RAE A;  3VYS B;  1LE8 A;  3QU3 A;  2F4I A;  4RA2 A;  2OBP A;  3WTS C;  4DBQ A;  1RES A;  3CCJ I;  3T5X A;  2PMU A;  2MC4 A;  3IAS 2;  1D0X A;  2YSR A;  4BL0 B;  4CCK A;  2XGX A;  1VZ0 A;  1Z67 A;  5TGT A;  3RI4 A;  1Y8R B;  2MBF A;  1YW8 A;  2CUJ A;  3REO A;  4ON0 A;  1UHW A;  4MEY F;  4I2O A;  1POG A;  3AKZ A;  3GZ6 A;  2O9L A;  3JW4 A;  4HRI A;  1ON2 A;  2Q2E B;  3JAM K;  4FET A;  1JTX A;  1S8N A;  2PQ8 A;  2R0Q C;  4XRF A;  2MA3 A;  2EIN H;  2W00 A;  5ED4 A;  4ABZ A;  4A0Y A;  2V6E A;  2GXB A;  4DGW B;  4M74 A;  4PJN A;  3LA7 A;  1P4A A;  2HYJ A;  3CC4 I;  1OMI A;  4L9V A;  2L9N A;  3K1M A;  1FBS A;  4LFU A;  3RSN A;  1V55 H;  3I0T A;  3ZMV A;  4EV0 A;  1YRN B;  2DT7 B;  4G6T B;  3C3W A;  4UV9 A;  1BA5 A;  1PP7 U;  5JHU A;  3DEW A;  1VQ9 I;  5KHD A;  3TMO A;  4S05 A;  3D0S A;  1R1V A;  5J4V A;  2HXI A;  3LFU A;  4HV5 A;  5IYC J;  5E8G A;  2E35 A;  2NS0 A;  1QGP A;  1NG6 A;  1XCB A;  3F8B A;  1JKR C;  1P2F A;  4L0Y B;  2QBY A;  3S1N J;  3MQ0 A;  2OCC H;  3RCO A;  2DFI A;  4BGD A;  3B6A A;  5GAE J;  4A3D J;  4UB8 C;  5HLT A;  3HTS B;  5CPR B;  2OQG A;  2DA7 A;  3CO6 C;  2L4A A;  3OS0 A;  1WFX A;  5LGU A;  1YG2 A;  1GVJ A;  2Y31 A;  1EA3 A;  4B09 A;  5IP6 A;  3BY6 A;  5IP7 J;  5ICG A;  3VDX A;  1RKW A;  3FF5 A;  4UUS A;  4LG3 A;  5DDG A;  2XVC A;  2Z16 A;  2QYO A;  2PMZ A;  2LY1 A;  3VEP A;  4U87 A;  1V4R A;  2W1O A;  2F5C A;  2XUB A;  4OOI A;  4OIR F;  4BHB A;  3CDL A;  2MFZ A;  1MSF C;  3BTI A;  2VPR A;  2E5N A;  4OWR B;  3KE2 A;  3B02 A;  1P9Q C;  2HZD A;  2ZXI A;  2TRT A;  2WBM A;  3SZP A;  3HTU A;  2F48 A;  2KKO A;  2Z5U A;  5DCF A;  1BIB A;  1KU2 A;  4WF2 A;  4BS9 A;  1WPK A;  5D6F A;  2JMW A;  2VQG A;  3V7S A;  1P6R A;  1WI3 A;  1MDM B;  1VQK I;  4XKW A;  2OJE D;  1MMN A;  4Q48 A;  4AC0 A;  2RKH A;  3IKT A;  3FKI J;  2UZK A;  5D5U B;  5KCM A;  1LQ1 A;  1HXD A;  1FTZ A;  2M0M A;  3R61 A;  3ULQ B;  4I01 A;  2ME0 A;  4HX7 A;  4MNU A;  4IL6 C;  1P4W A;  1WJB A;  3LSM A;  3K4N A;  3OR2 C;  4HBL A;  4JP0 A;  4CYD A;  4AVZ A;  1QHH D;  2HWV A;  3PUF A;  1F5T A;  1XD7 A;  3H36 A;  2V1U A;  2HPI A;  2ETH A;  5CQE A;  3LST A;  2DFH A;  4CZZ A;  2FEZ A;  1IUY A;  2D1V A;  3I71 A;  1FC3 A;  2GM4 A;  5CKT A;  3T8R A;  1I50 J;  2IS6 A;  3GTQ J;  4BBS J;  3DBL B;  4KN7 X;  4HLX A;  3CCQ I;  1N75 A;  3ZRG A;  2DA3 A;  1QZY A;  4JBA A;  4G7O F;  4GGG A;  4DBR A;  2AQF A;  4NC7 A;  1RIO H;  2Z1D A;  5DCM A;  1DP3 A;  3E5X A;  3PO2 J;  4MHG A;  4GDF A;  3EUH A;  4EM2 A;  3PNT A;  5FRO A;  4CZC A;  1PUF B;  2CQX A;  2ZJR F;  3LWF A;  3CMA I;  3LAP A;  1WJE A;  2P81 A;  3LSG A;  4RAZ A;  4FTH A;  1REP C;  2ZSH B;  4BUP A;  4PGG A;  3HSF A;  1D8J A;  3OS2 A;  5F0H A;  2KDO A;  3K2Z A;  1TQI A;  1Q1V A;  2QEX I;  5CVI A;  1MBJ A;  3H5R A;  3MMY B;  1FBU A;  1AU7 A;  2GLO A;  2IEK A;  3BC8 A;  2V4J C;  3K7A J;  2HVR A;  1DGR M;  1MMD A;  1PJR A;  3MD2 A;  1JGS A;  3BTL A;  4ZDP A;  3U2R A;  2VKV A;  2AS5 F;  2XAQ A;  3C1D A;  4L5E A;  3W2A A;  2XIG A;  4QTR A;  4GYI A;  1DDN A;  4RAF A;  5J6X A;  3DV8 A;  1PYV A;  2X48 A;  2M5W A;  4G7H F;  4AYB N;  2Y2Z A;  2V1D A;  2K7L A;  2NVX J;  2QQB A;  5J8C A;  3ERM A;  3BOQ A;  3KYC B;  5GAG J;  3WU1 B;  1JE8 A;  3CJN A;  5EG0 B;  2EIK H;  2AQE A;  1MJ9 A;  1YJ9 I;  1B59 A;  2DOF A;  3LFK A;  3DLA A;  2BZT A;  4E4H A;  1YS6 A;  4HSR A;  4L9J A;  1XGN A;  2XF6 A;  1ZR2 A;  1UHS A;  2W84 A;  3GZ5 A;  4ESF A;  3TDZ C;  3FX3 A;  4II2 A;  2W57 A;  1DU0 A;  3E6B A;  3BR0 A;  2R7F A;  1BM9 A;  1ZAO A;  3SZG A;  2F2E A;  3BCA A;  1UB9 A;  1JHF A;  4MO7 A;  1K6O A;  1FOX A;  3ZQL A;  2R93 J;  3QPS A;  4LOC A;  3ZMU A;  5LBQ A;  3ASO H;  2M1B A;  2QA4 I;  3BLY A;  4DQ2 A;  2CG4 A;  1DP7 P;  5D4R A;  1VQ6 I;  1XMK A;  2FA5 A;  5J1Y A;  1GV5 A;  5ICE A;  3P9K A;  2Q2E A;  4JK1 X;  5FLM J;  4MEX F;  3BZ6 A;  2GOX B;  3BTC A;  2JA8 J;  2OZU A;  1XS9 A;  2IGO A;  4HA8 A;  2O8K A;  1SAU A;  2GZW A;  2L9R A;  3H3V K;  2ECB A;  4XID A;  2LF8 A;  1CF7 B;  3LA3 A;  5DV5 A;  1YO5 C;  3MZ8 A;  1R58 A;  2DN0 A;  3QOD A;  4KJZ A;  4YFN F;  1E3O C;  5E3L A;  4A3F J;  3HRM A;  3U1D A;  1YRN A;  3P7N A;  5HNF A;  3F8N A;  3RKQ A;  3LSI A;  2X6Y A;  3BTJ A;  1W36 C;  2DA6 A;  3CCV I;  1MD0 A;  1RUO A;  4CSW A;  3OSG A;  1KON A;  4ZTF A;  1D5V A;  3BR5 A;  4MQV A;  4UNO A;  2FD5 A;  1OCO H;  3OYA A;  2OD5 A;  3L1P A;  1IDZ A;  4IEJ A;  3BQY A;  1MMA A;  2L7F P;  2PX9 A;  3TO9 A;  3MAJ A;  2R7Z J;  4WXH A;  1XC5 A;  2VB6 A;  2JPB A;  5FB2 A;  2MSY A;  3Q0V A;  2Q8K A;  1U3E M;  1EF4 A;  1J59 A;  4A3I J;  3H0D A;  2JWT A;  3M8E A;  1JJ8 C;  3DPL C;  2YPR A;  4KN4 X;  1D5Y A;  1FP1 D;  1X2N A;  2BOL A;  2NRA C;  3H5N A;  3BR1 A;  3DTE A;  2EIL H;  3KZY A;  4XKB A;  3CP2 A;  2FOW A;  2QSG X;  3H9Q A;  5EJC A;  5M3M J;  2R5Z B;  4BDZ A;  1ZRD A;  1R4N B;  3R4K A;  2DA4 A;  3OL4 A;  5K5O A;  3TW6 A;  1LB2 A;  1MMS A;  2P6S A;  2JQ7 A;  1J7K A;  3MKL A;  3BJ6 A;  3J7Y J;  3VWB A;  1TWH J;  1MDM A;  1BOB A;  1WH5 A;  9ANT A;  2HYF A;  4KDP A;  1P7I A;  2VQH A;  2IA1 A;  1JKQ C;  3BR2 A;  3GTO J;  1BJZ A;  1S7E A;  3O6B B;  3CDI A;  4IHW A;  5LRS A;  2LLK A;  2D1H A;  4A3M J;  4EJU A;  1N78 A;  1YIO A;  2KP6 A;  4KIS A;  3RYP A;  4KMU X;  4RB2 C;  1YX3 A;  3LOC A;  2M2E A;  3WTZ A;  3OYC A;  2K3P A;  4BXX J;  3JSP A;  3CCU I;  4C30 A;  3DPU A;  1B1B A;  1KU3 A;  4H0E A;  3SDG A;  3F72 A;  4MIM A;  3HIF A;  1TBX A;  3S15 J;  5DD4 A;  2A6E F;  3E6D A;  1X1D A;  2XRO A;  3WTW C;  3L2Q A;  3OL3 A;  5GP9 A;  3A0B C;  3AG4 H;  2IGN A;  2CSO A;  3GVA A;  1UHM A;  3CZ6 A;  1YTY A;  1EV7 A;  3CMY A;  4AIJ A;  1PUF A;  5CVU A;  2V26 A;  1T98 A;  3EYY A;  4EQQ A;  4IVN A;  4A12 A;  3GX4 X;  4Y52 J;  4BHP A;  2O3F A;  4M9X A;  4G6D A;  3HM5 A;  4ENJ A;  2RGV A;  5K1Y A;  1LVA A;  3HPG A;  3I4P A;  2QCO A;  1IW7 F;  5AON A;  2XKO A;  3F3X A;  5E20 A;  2X1E A;  3HDD A;  3ZQH A;  4NNJ A;  3MKW B;  3WTV C;  4FE4 A;  1U78 A;  2M4K A;  1ENH A;  2CO5 A;  4FIS A;  4PK4 A;  3E7L A;  1WJA A;  4XK4 A;  2Y30 A;  2DA1 A;  2JUC A;  3CLQ A;  2G7U A;  1HKT A;  1XSD A;  3ZCO A;  1BW6 A;  1WCM J;  3ZOB A;  1NH3 A;  1W7P B;  2XAJ A;  2UXX A;  2KDZ A;  5EG0 A;  5M3F J;  4JOM A;  3HOZ J;  1VTN C;  1FX7 A;  3K4C A;  4U0Y A;  1SD4 A;  2CV1 A;  4XLN F;  3BT9 A;  4I99 C;  4M9Z A;  2XF7 A;  4CUG A;  4MQ9 F;  4AVP A;  1JUM A;  1R00 A;  3DEE A;  1ETY A;  2LVS A;  3IRQ A;  1P4X A;  3CCY A;  1RR7 A;  2JVH A;  3ZMT A;  5KAF C;  4QPQ A;  2DU9 A;  4A6D A;  2DLL A;  2FXA A;  2KL4 A;  1O3R A;  3NWS A;  2XAS A;  1FBQ A;  1VND A;  1WWX A;  2KZV A;  3BR6 A;  4E70 A;  2B63 J;  2B7E A;  1WI9 A;  3PIO F;  2HEO A;  2GXA A;  3W6J B;  4BQA A;  3ZP5 A;  1VI0 A;  3E97 A;  2IJL A;  3WTX C;  4LGW A;  2XB5 A;  1ZLJ A;  4XN0 A;  1D1A A;  1YYV A;  3S3N A;  2XGC A;  3S93 A;  2YU9 J;  3K1N A;  1VQL I;  5JLW A;  1J0R A;  1CF7 A;  3J7A O;  1ITY A;  4N0B A;  1LUJ B;  3RPQ A;  4AID A;  2VBZ A;  3TW7 A;  2J5O A;  2RQQ A;  2Z99 A;  1XB4 A;  3KYD B;  2PMZ N;  4D9J A;  2P5V A;  3SXY A;  1BOA A;  1NG7 A;  2EWN A;  3F8C A;  2EBI A;  1KU7 A;  4S0H B;  1U5T A;  3CD6 I;  3I59 B;  3W2W A;  3I5U A;  1QZZ A;  3GFM A;  2JRM A;  3Q0U A;  1G8X A;  1L3L A;  4B8X A;  5FGM A;  4JX4 A;  2IAI A;  3C2H A;  1JT0 A;  2V9P A;  4M3B A;  1VQN I;  5KAI C;  1OR7 A;  2VLA A;  2KFD A; 
#chains in the Genus database with same CATH homology
 2N8G A;  5JLX A;  5F08 A;  1JTX A;  2R0Q C;  1R9T J;  5E3M A;  3G1L A;  1U9N A;  4ABZ A;  3VPR A;  1ZK8 A;  1A6I A;  5FKM A;  3K2A A;  1OJL A;  2WB1 N;  2HYJ A;  4QIW N;  1DU6 A;  1YRN B;  2M34 A;  1BA5 A;  3TP3 A;  3DEW A;  1GDT A;  2DMN A;  2FJ1 A;  1K61 A;  1HCR A;  3FK7 A;  3G1M A;  1HDP A;  1QPI A;  2HXI A;  5IYC J;  1HLV A;  4BY7 J;  2DMU A;  4X6A J;  2HI3 A;  3PM1 A;  4DYC A;  1W0U A;  1JKR C;  3S1N J;  1FIA A;  4V2G A;  2R5Z A;  4DZJ A;  4JX6 A;  1CQT A;  4MLO A;  3B6A A;  2XGE A;  2K9N A;  5EZH A;  4A3D J;  1B8I B;  2HOS A;  2OF7 A;  2R92 J;  2OPT A;  1BW5 A;  3BG5 A;  2DA7 A;  1ZR4 A;  5IYB J;  4DYR A;  1TWG J;  4D5C A;  1ETV A;  2Y31 A;  4MFD A;  1GUU A;  5IP6 A;  1QVT A;  2D5V A;  5IP7 J;  2QF7 A;  1RKW A;  4UUS A;  3IV5 A;  2G0E A;  1O4X A;  4M6V A;  4CYC A;  3QPL A;  2ME6 A;  1FEX A;  2XRL A;  4C2M J;  3LSR A;  2WV1 A;  3I4N J;  3BR3 A;  1IUF A;  1MBE A;  3CDL A;  2CJJ A;  1MSF C;  3BTI A;  1RPW A;  2VPR A;  3MVP A;  5F04 A;  1FTT A;  2TRT A;  4W1U A;  1IRZ A;  3NAR A;  1P7J A;  3RQI A;  2JA5 J;  4XRM A;  1WPK A;  2MG4 A;  5EF6 A;  5M5W J;  2JMW A;  2CUE A;  4DZP A;  3JRG A;  4D7M A;  1WI3 A;  1ZGW A;  4A3B J;  1ETX A;  1T33 A;  4AC0 A;  1H89 C;  1ETW A;  3FKI J;  4A69 C;  1FTZ A;  3IH3 A;  3M4O J;  2XPW A;  2X9D A;  3JRE A;  2ME0 A;  3S14 J;  2CU7 A;  1JTY A;  4JP0 A;  3TED A;  4UUT A;  5C4X J;  3A01 B;  3JRD A;  3OOU A;  4JX5 A;  5EGO B;  3LSP A;  2NOG A;  2GM4 A;  1I50 J;  4B4C A;  1B72 B;  3GTQ J;  4BBS J;  4M3D A;  1IDY A;  3NAU A;  2KT0 A;  1RKT A;  2YS9 A;  3GTJ J;  4I76 A;  3C2B A;  2DA3 A;  3O8G A;  1RET A;  5HOD A;  4G12 A;  1MH4 A;  1K83 J;  1MNM C;  2MW8 A;  1LFU P;  1GV2 A;  5M5X J;  2IBD A;  3PO2 J;  2L7M P;  1PUF B;  2CQX A;  4MFE A;  1MH3 A;  4D5F A;  1AKH B;  4FTH A;  3LSG A;  2P81 A;  5F1J A;  3HOW J;  3WHB A;  2VKE A;  4M3G A;  5J1R A;  3ZQC A;  4M3E A;  5F0H A;  1X2M A;  1ZQ3 P;  1Q1V A;  1MBJ A;  2HOA A;  1HOM A;  2GLO A;  1Z77 A;  1AU7 A;  1ZTR A;  4RDU A;  2IEK A;  2M0C A;  3K7A J;  3UKG A;  1NTC A;  3JRA A;  3BTL A;  1JGG A;  2VKV A;  4L5E A;  5DTD A;  4QTR A;  5F27 A;  2Y0S N;  5K7F A;  3B6C A;  2X48 A;  2DMP A;  4AYB N;  2Y2Z A;  1TWA J;  2XSD C;  4A3C J;  3IH4 A;  2NVX J;  1UMQ A;  5IOZ A;  1AHD P;  5J1U A;  2JK3 A;  5EG0 B;  1H88 C;  1I3Q J;  1OCP A;  4NDL A;  4BY1 J;  2LFB A;  1GVD A;  3SFI A;  1ZR2 A;  4XRS A;  1UHS A;  4A3K J;  2CQQ A;  1IJW C;  1DU0 A;  3BR0 A;  5FLV A;  2ID3 A;  2R5Y B;  2I10 A;  1BL0 A;  1NK3 P;  3GTG J;  3S1R J;  3LSJ A;  3M3Y J;  2JJ7 A;  4W97 A;  3A03 A;  2HOT A;  4MO7 A;  3I4M J;  1MBH A;  3ZQL A;  2R93 J;  1GT0 C;  3QPS A;  2JA7 J;  4LOC A;  5EDN A;  4A3G J;  3JRI A;  4B3A A;  3Q3S A;  2E2I J;  5J1Y A;  4X1E A;  1GV5 A;  2M8G X;  1SFO J;  1FJL A;  5FLM J;  3BTC A;  2JA8 J;  1XS9 A;  3Q0W A;  2O8K A;  2NVY J;  3D1N I;  2L9R A;  3FIS A;  3H3V K;  2ECB A;  4XID A;  2VUM J;  5F0C A;  1MBF A;  1LE8 B;  2DN0 A;  3HOU J;  4QSH A;  1E3O C;  3TP0 A;  5E3L A;  4A3F J;  1YRN A;  3HGG A;  3HOY J;  3GTK J;  1TWC J;  1APL C;  3RKQ A;  2MGQ A;  3BTJ A;  2EZL A;  2DA6 A;  2XPV A;  3BG3 A;  3OSG A;  1A5J A;  3JR9 A;  2EZH A;  3BR5 A;  3HKZ N;  1ORK A;  2DA5 A;  3FIW A;  3RZD J;  1I6H J;  2LY9 A;  5EYR A;  4EEF G;  5GPC A;  2FD5 A;  1JJ6 C;  5FKN A;  5FKO A;  4I6Z A;  1B8I A;  1TWF J;  4FCY A;  3GBG A;  3L1P A;  1IDZ A;  5F0F A;  4A3J J;  4IEJ A;  3BQY A;  2L7F P;  1MBK A;  1ETK A;  1JKO C;  2NVQ J;  4C3J J;  2R7Z J;  2LR8 A;  2ELK A;  1WH7 A;  1SAN A;  1XC5 A;  4BKX A;  3PO3 J;  3RZO J;  3BG9 A;  4RBO A;  2MSY A;  3CQZ J;  3Q0V A;  1U8B A;  4IHX A;  1EF4 A;  2E2H J;  4A3I J;  4B1R A;  1G2H A;  3QQA A;  2JWT A;  4A93 J;  1Z0X A;  1JJ8 C;  1H8A C;  1HF0 A;  2E1O A;  2COB A;  1ETO A;  2CUF A;  1D5Y A;  1X2N A;  5BNG A;  2EZI A;  2HXO A;  3BR1 A;  2GBY A;  5E3O A;  5C4J J;  5IPA A;  2FX0 A;  2XPU A;  5M3M J;  2R5Z B;  1U9O A;  2EH3 A;  4GFB A;  2DA4 A;  3TW6 A;  2EQR A;  2JA6 J;  1T56 A;  2NVT J;  2LTP A;  4DW6 A;  3MKL A;  3JRH A;  2AO9 A;  1TWH J;  3IH2 A;  2LP0 A;  3ZQF A;  1WH5 A;  9ANT A;  1P7I A;  5DS9 A;  3S2D J;  1JKQ C;  3BR2 A;  3GTO J;  3FK6 A;  1BJZ A;  4JYK A;  5C3E J;  1S7E A;  4UUS B;  4IHW A;  2H8R A;  3ZQG A;  4CYC B;  1UG2 A;  1Y1V J;  2XB0 X;  5GPA A;  2LLK A;  2Y9Z A;  4A3L J;  4A3M J;  1W0T A;  3GTP J;  5IP9 J;  2H1K A;  3A01 A;  2AHQ A;  2E19 A;  3LOC A;  5EGO A;  2M2E A;  2DA2 A;  2X6O A;  2ZB9 A;  4IHV A;  3HOV J;  3HOX J;  2L7Z A;  4BXX J;  1B72 A;  4HNV A;  1IG7 A;  3SDG A;  4MIM A;  2NS8 A;  1ZKG A;  2CRG A;  3S15 J;  4A3E J;  1QRY A;  2FQ4 A;  1MSE C;  3JRC A;  5FJ8 J;  5GP9 A;  2LKX A;  1XG1 A;  2DMQ A;  3W6V A;  2LD5 A;  3HEF A;  3GTM J;  4C3H J;  3H0G J;  3CMY A;  1PUF A;  2L0K A;  3F0C A;  1AKH A;  3ZQI A;  4FE7 A;  4Y52 J;  3DCF A;  3HGY A;  5C44 J;  4V2F A;  3HM5 A;  5K7H A;  2TCT A;  5EEA A;  1VF9 A;  1IV6 A;  1NK2 P;  5IOY A;  3SJM A;  2QCO A;  1F36 A;  4XIC A;  4D7N A;  5EZG A;  1LFB A;  5E3N A;  3HDD A;  1QVU A;  3ZQH A;  3GTL J;  4FE4 A;  1MBG A;  2DMT A;  1U78 A;  2O7O A;  1ENH A;  4FIS A;  1JUS A;  2W48 A;  3E7L A;  1ETQ A;  4XK4 A;  3JRF A;  2Y30 A;  2DA1 A;  3MN2 A;  5J3L A;  3OSF A;  1BW6 A;  1WCM J;  3HB9 A;  2VI6 A;  2NS7 A;  3ZOB A;  1IGN A;  2WAQ N;  1Y1W J;  2KDZ A;  5M3F J;  5EG0 A;  1FIP A;  3HOZ J;  1IC8 A;  2YUS A;  3S16 J;  5K7Z A;  3BT9 A;  2M9H A;  1OFC X;  3JRB A;  3OIO A;  4BBR J;  3S2H J;  3S1M J;  5FKL A;  2DJN A;  4IHY A;  5FKK A;  4XRS G;  1JUM A;  2Y9Y A;  3LNQ A;  1ETY A;  2LVS A;  3HBL A;  5M5Y J;  3CCY A;  2R5Y A;  2HDD A;  1RR7 A;  1HDD C;  2K9Q A;  4C3I J;  1VFC A;  1F43 A;  1VND A;  2LK2 A;  3BR6 A;  2B63 J;  1JUP A;  4M3F A;  1VI0 A;  1JKP C;  1TC3 C;  2XGD A;  3O8H A;  4J19 A;  3S17 J;  2XB5 A;  3WHC A;  1X58 A;  3G1O A;  2ID6 A;  2ECC A;  5IYD J;  4DYQ A;  3A02 A;  1JT6 A;  2XGC A;  3BQZ A;  4Y7N J;  2YU9 J;  5JLW A;  3S1Q J;  2RAE A;  1ITY A;  2K9S A;  1LE8 A;  2HQ5 A;  3TW7 A;  2E2J J;  1RES A;  2PMZ N;  1WGX A;  4AUX A;  2EZK A;  2JN6 A;  2K40 A;  2EBI A;  4S0H B;  3Q0U A;  2DTZ A;  4JX4 A;  1OCT C;  1POG A;  2IAI A;  1JT0 A;  4M3B A;  2O9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...