1IGNA

Dna-binding domain of rap1 in complex with telomeric dna site
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
235
structure length
189
Chain Sequence
KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLIRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEEPMKNLTPTPGNYNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*CP*CP*GP*CP*AP*CP*AP*CP*CP*CP*AP*CP*AP*CP*AP*CP*C
publication title The crystal structure of the DNA-binding domain of yeast RAP1 in complex with telomeric DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 53
structure length 189
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF09197 Rap1-DNA-bind Rap1, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ignA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ignA01
1AKHB 3A02A 3QPLA 2Y9ZA 3VPRA 4A3MJ 3PO2J 3MVPA 3C2BA 3ZQLA 3BTCA 2ME6A 1VFCA 2JMWA 2X6OA 5F0HA 5HODA 3FISA 1IDZA 1F36A 5M5YJ 1PUFB 1A6IA 2QF7A 4QTRA 1I6HJ 2JA6J 3DCFA 3MKLA 1MNMC 2HDDA 3IV5A 1XC5A 4QIWN 3A01B 3BR5A 1FJLA 1ETQA 2M0CA 1ETOA 3BG3A 5FKLA 1XS9A 5EG0A 2EBIA 1IDYA 2AHQA 5DTDA 4XRSG 3QQAA 1JT0A 2R93J 2RAEA 5EEAA 3BR1A 2XRLA 4DZJA 5DS9A 1WI3A 2K9SA 1H88C 3JRFA 3ZOBA 2MG4A 4C3JJ 3FK7A 4JX6A 4IHXA 4X6AJ 1OCPA 5F08A 4A3BJ 1U8BA 5EYRA 4MIMA 2Y0SN 3BTJA 3Q0UA 2HOTA 1T33A 2EZKA 1HDDC 3RZOJ 2K40A 1ETKA 3TEDA 1ETXA 2LLKA 5F1JA 1RESA 4V2FA 1MSEC 2EQRA 4D5FA 3BTLA 4I76A 3JRDA 3OOUA 1I50J 3IH4A 4J19A 2R0QC 2K9NA 5JLXA 5IOZA 1H8AC 4EEFG 1ITYA 3GTPJ 1X58A 3JRBA 1ZR4A 1QPIA 3K7AJ 2GM4A 2DA2A 2OPTA 1FTZA 2L7FP 4DYRA 1WPKA 4MLOA 2DA3A 1JTXA 1MH3A 2LP0A 3HKZN 3E7LA 4FISA 2QCOA 3WHBA 1LE8A 1D5YA 5C4JJ 1VF9A 1BW6A 1MBKA 3H0GJ 1AU7A 3ZQHA 1WCMJ 2R5YA 1NTCA 4Y52J 1HDPA 1T56A 2X48A 4UUSA 2P81A 4A3CJ 4M3FA 3BG5A 1ZR2A 5J3LA 1ORKA 2HQ5A 1Y1VJ 1JKOC 3Q0VA 1HCRA 1YRNB 2ID6A 4BY7J 3O8HA 1UG2A 2JJ7A 4XICA 2DMQA 4C2MJ 5M5XJ 2EH3A 2LFBA 4LOCA 4V2GA 2MGQA 3LNQA 1Z77A 3FK6A 1WH5A 3LSRA 4JYKA 2YU9J 3ZQGA 2R92J 4A3EJ 2GBYA 5EGOB 1GT0C 5GPAA 5EDNA 3ZQFA 3G1LA 2NS8A 2E2JJ 5FLVA 3S2DJ 5F0FA 1Q1VA 3HOZJ 3FKIJ 5FKNA 1B72B 1PUFA 2EZIA 3GTQJ 2HOAA 2XSDC 1SFOJ 2XB5A 2HXOA 2X9DA 1BA5A 2YUSA 2CUFA 5K7HA 5JLWA 4JX4A 3A01A 3GTJJ 1GVDA 1ZQ3P 2JN6A 4BY1J 1MSFC 4XRSA 1RKTA 5FJ8J 5C4XJ 1BW5A 3BR2A 3HOXJ 2CRGA 1F43A 4ABZA 4BXXJ 2E1OA 5IP7J 4JP0A 2JA5J 3GTGJ 2Y2ZA 1W0UA 3JR9A 5IOYA 1JKPC 1APLC 4A3IJ 2HYJA 4D7MA 2LY9A 3HEFA 1QRYA 1LFBA 4GFBA 3DEWA 2VKEA 2TCTA 4M3DA 1JUMA 4M3GA 3IH2A 1MBEA 2H8RA 4A3GJ 2DMPA 1FEXA 1VI0A 5EF6A 2XGEA 3LSJA 1JKRC 4C3HJ 4XIDA 2LKXA 2DMTA 5E3MA 4JX5A 2DA5A 3RQIA 3JRIA 3OSFA 2HXIA 2B63J 1WH7A 3FIWA 2DA1A 2MW8A 2IAIA 1FIPA 1LFUP 5M3MJ 2KDZA 3IH3A 1JGGA 3F0CA 1Y1WJ 1MBFA 1OJLA 5IYCJ 1BL0A 3TW6A 2KT0A 3B6AA 3HOUJ 3LSGA 2FD5A 3PO3J 2LK2A 1GV5A 1VNDA 3GTKJ 3OSGA 4B3AA 2K9QA 4C3IJ 1U9NA 1IV6A 2W48A 4S0HB 3OIOA 3LSPA 1FTTA 2L7MP 4FE4A 1ETYA 2O9LA 2YS9A 3UKGA 3M4OJ 2LTPA 3RKQA 5C3EJ 1U9OA 5M3FJ 3S2HJ 2WAQN 2EZHA 1IG7A 2CJJA 4AYBN 1YRNA 3G1MA 2N8GA 4FCYA 1ZKGA 2AO9A 3NAUA 4AUXA 4BBRJ 1CQTA 2DMNA 2ME0A 2NOGA 3TP3A 1P7IA 4A3FJ 4BBSJ 1POGA 4IHWA 4BKXA 4W97A 2XB0X 4M6VA 4D5CA 3M3YJ 2M9HA 4M3BA 2FX0A 5IYBJ 1A5JA 3TW7A 5EGOA 5EZGA 5J1RA 4G12A 2XPUA 2NS7A 5F0CA 2WV1A 5FLMJ 1RETA 1HF0A 2XPVA 1ETWA 4RBOA 2XGCA 4MO7A 3QPSA 1JTYA 1B72A 3CMYA 4CYCB 4A3JJ 1ZGWA 1AKHA 2COBA 1JJ6C 4XK4A 1QVUA 3BR0A 2VUMJ 1JUPA 4A3KJ 3O8GA 4D7NA 1JUSA 4AC0A 3L1PA 1E3OC 2GLOA 4DYQA 1G2HA 3A03A 3GTLJ 2DA6A 2M8GX 3GTMJ 2ECCA 4DW6A 3S17J 1K83J 4MFDA 2JA8J 3RZDJ 1IGNA 1QVTA 1EF4A 1P7JA 1TWGJ 4MFEA 3HOWJ 3BQZA 2MSYA 1S7EA 1ZK8A 2FJ1A 1B8IB 1GV2A 1ETVA 1IJWC 3S15J 2VPRA 2JWTA 1GUUA 1JJ8C 1W0TA 1FIAA 2R5ZB 3H3VK 1OCTC 1OFCX 3HOVJ 1MBJA 2Y30A 1XG1A 3GTOJ 4QSHA 5C44J 4DYCA 2O8KA 2L0KA 1TWAJ 2IBDA 2XPWA 3JRHA 2L7ZA 2O7OA 1UHSA 4IEJA 1GDTA 3BT9A 1TWCJ 3GBGA 3Q3SA 5F27A 1IC8A 2I10A 3NARA 3SFIA 5FKKA 3JRGA 3HGGA 5BNGA 2Y9YA 4I6ZA 2EZLA 3S1RJ 1U78A 1H89C 3WHCA 1O4XA 1RR7A 4W1UA 4A69C 5IP6A 2VI6A 4X1EA 3S1NJ 3MN2A 3S1QJ 4XRMA 1RPWA 2HI3A 3SJMA 2JK3A 2NVTJ 1HOMA 1MBGA 3HM5A 5K7FA 2NVXJ 2E2HJ 1TWFJ 2JA7J 1NK2P 3HDDA 3K2AA 2DA7A 2OF7A 5EG0B 5FKOA 5GPCA 3CDLA 3W6VA 2DTZA 2XGDA 2E19A 3D1NI 3JRAA 1K61A 5E3OA 1R9TJ 2DA4A 1WGXA 1RKWA 2FQ4A 4A93J 2ZB9A 3JREA 1SANA 1MBHA 2LR8A 5J1UA 5E3NA 1HLVA 4Y7NJ 2Y31A 1IRZA 1TC3C 2NVYJ 3CQZJ 3HGYA 5EZHA 1JKQC 3S1MJ 4FE7A 5K7ZA 5M5WJ 2DMUA 1ZTRA 1MH4A 1DU6A 3I4MJ 4L5EA 2D5VA 2ECBA 5GP9A 4CYCA 4B1RA 2L9RA 4B4CA 4IHVA 2CQQA 3BR6A 3S16J 4M3EA 5E3LA 3SDGA 2LVSA 3B6CA 4IHYA 1X2NA 3HBLA 1AHDP 3Q0WA 3PM1A 5IYDJ 2M2EA 1NK3P 5F04A 3CCYA 5IPAA 4HNVA 3BR3A 1LE8B 3ZQIA 2ELKA 3LOCA 4DZPA 2CU7A 3BG9A 3I4NJ 2DN0A 3HB9A 2R5YB 2HOSA 2NVQJ 4FTHA 4UUTA 4UUSB 1B8IA 2TRTA 2H1KA 1JT6A 1Z0XA 2WB1N 2VKVA 2CUEA 5J1YA 4A3DJ 2R5ZA 2LD5A 5FKMA 2M34A 1DU0A 3TP0A 3S14J 1ENHA 2PMZN 2DJNA 3BTIA 2IEKA 9ANTA 1X2MA 2R7ZJ 4NDLA 1I3QJ 3BQYA 4RDUA 1UMQA 1IUFA 2E2IJ 3ZQCA 3JRCA 2G0EA 2CQXA 3HOYJ 5IP9J 1TWHJ 2ID3A 4A3LJ 3G1OA 1BJZA
chains in the Genus database with same CATH superfamily
3IWFA 3L9FA 4B43A 5BQTA 2BBYA 4M6XA 3VPRA 2BY2A 3H9JA 3K1PA 1X3ZB 4EV0A 3ZQLA 2W25A 2P6SA 4XLCA 1VFCA 1UHMA 2JMWA 2IJLA 3N97A 3QPTA 1OYWA 1X1DA 2DAOA 3FISA 1IDZA 3KP7A 4MTDA 2ZKZA 3DTEA 1TL8A 2A6HF 1T38A 1REPC 1PUFB 4BAYA 3ECOA 3ZGKA 4ENMA 5BS6A 2EINH 4I02A 2DYRH 1MNMC 3CTAA 1FX7A 3HHGA 3LQRA 3IUOA 1IN6A 2D1HA 3QAHA 3ZMTA 2RNJA 3PSIA 4HYEA 4HDUA 3CUQC 4L5JA 1XS9A 4LK1F 2VXZA 5HDKA 3EPZA 4G6QA 5DTDA 4XRSG 2RAEA 3BR1A 5DS9A 2BYVE 2KPMA 3HUGB 4PGGA 4AVPA 3J81Z 2ZJRF 3F72A 1UZCA 4C3JJ 4IHXA 4DQ2A 4HSRA 1U8BA 5TGTA 5EYRA 5K5OA 1QHGA 3K4NA 3QU6A 2PMUA 3FBIB 3TOBA 2EZKA 5H20A 1OR7A 1HDDC 3RZOJ 2K40A 2XAHA 3Q9SA 3UNGC 2LLKA 5F1JA 2ZBKA 3OOPA 1R1UA 4HSTA 2BEOA 3OYFA 3M8FA 2EQRA 2WAQA 4D5FA 1UCRA 3BTLA 4RLFA 3JRDA 1WJCA 3IH4A 1R5HA 5JLXA 5IOZA 1BM9A 5BPDA 3QRFF 1HXDA 2FNAA 5FRMA 2F6CA 2HPMA 2KRHA 5FRNA 1VQ9I 3GTPJ 1FLIA 3JRBA 1ZR4A 4ZTFA 1QPIA 3K7AJ 1IAWA 4R1HA 2QENA 3WU2C 1ZELA 2OPTA 5D8LB 2L7FP 1A04A 3OV8A 3QODA 4G6DA 1WPKA 4MLOA 2DA3A 1JTXA 2GA2A 4CA0A 4I0AA 4HG2A 1KU9A 1D5YA 1KU2A 3KZIC 1K7AA 1GVJA 1BW6A 2JUCA 5A2QZ 4HF1A 1N77A 4BQAA 3DPTA 2YR2A 1HDPA 1LUJB 2X48A 3DPUA 4EM2A 5D5WB 1MJAA 4U7DA 2L7KA 2M5WA 3VYUB 4N9HA 1Z7LA 4HW0A 5J3LA 1ZGAA 4HZFA 1EV7A 4HA8A 1D8KA 2ZJQF 4E7ZA 2JZYA 2M7AA 1K78A 1HCRA 1J7KA 3MFKA 2PJRA 1YRNB 4MEYF 3TDZC 2A07F 2OQGA 3KEQA 4H4KC 2IA0A 3VSKA 4FX4A 2LMDA 2QBYB 3J7AO 5D5XB 2DMQA 2FBHA 4DGWB 2EH3A 2F5EA 5B1AH 4WXHA 4RGSA 1YS6A 2GIVA 2MFZA 1F4KA 1U8RA 3CUQA 1J5YA 2NNNA 3ZMSA 2MGQA 3VYRB 3LNQA 1G59A 3OYDA 3MZYA 3SQNA 1PP8F 2R7DA 3LSRA 2VE9A 2R92J 4A3EJ 2VQCA 3P7NA 4RAFA 1IRXA 4KIFA 3G73A 3ABMH 1ZRDA 4L9VA 5EDNA 3FXLA 2VJJA 3ZQFA 2E2JJ 3TL4X 3ZQ7A 1R1TA 4DIQA 1PUFA 3WU1B 4LLNA 1FT9A 3B73A 2WA0A 1RC9A 2CV1A 1BA5A 1A35A 2ZXHA 2IGMA 2YUSA 2OCEA 3W2WA 5JLWA 3GTJJ 1GVDA 3BWGA 3P5JA 2R7VA 2HWVA 3PUFA 3VOEA 2JN6A 4J01A 4XRSA 1RI7A 2JPCA 1W7PB 2ZXJA 2ELHA 2H27A 3BR2A 3HOXJ 3RTRA 4UUVA 2XRNA 3KYLA 3CLQA 5IP7J 4JBAA 1FYLA 2JA5J 2Y2ZA 2LKPA 1TT5B 4D0PA 5IOYA 2R7RA 1JKPC 2NOJB 2CQ7A 1KU3A 2EIMH 2KIMA 4A3IJ 4D7MA 1MDMA 2VASA 5J8CA 4GFBA 1XB4A 2CGPA 2VKEA 1C0WA 2VJ5A 4RLQA 4ZC3A 2FOKA 1PP7U 4CUGA 2QSHX 3WGHA 1MKMA 1MBEA 2VT3A 3I59B 1YJNI 2XGEA 1JKRC 4XIDA 2QA4I 3V7SA 3F8CA 4CDGA 1P4AA 2NS0A 2WV0A 2O03A 1T6SA 3GFJA 1K6YA 1WH7A 1FP1D 2FXAA 1I1GA 2XF5A 1RNLA 2IAIA 2MW8A 2QUFA 3E6BA 1K6OA 1O3SA 2KFDA 2KDZA 4HBLA 4LGWA 1T8IA 4RM2A 5DCMB 2BXZA 1MBFA 3WG9A 4ZDOA 2ZFUA 3TW6A 1OYIA 5ICGA 1KYZA 3HRSA 5LHHA 1UG0A 4C2TA 3V7RA 1XGOA 3PO3J 1M1EB 3ZP5A 1YS7A 2QKLB 3CF5F 2XSJC 4B3AA 4BJ6C 3LSPA 3KEYA 4PGHA 5ICFA 4S05A 1AWCA 1LEBA 5BOXA 3OYKA 2ICWG 3HG9A 2GQQA 5DM7F 2EZHA 1IG7A 3L2VA 1W4MA 5LEJA 1YRNA 3JAMK 2AO9A 3NAUA 4BBRJ 2MC4A 4CSWA 3FXKA 2ZO4A 2QBYA 3K4BA 1V4RA 1WKMA 4YIFA 1T2KA 2NOGA 3TP3A 4P96A 2OTJI 4EGYA 2E1NA 1W5SA 2P5VA 2VONA 4EMSA 2VBZA 3M3YJ 1YOVB 4M3BA 2K5CA 3D5LA 5HLGA 1V5GA 4Q5SF 2A5YB 2ESNA 4HLXA 3LSIA 1KA8A 2VPLA 5AONA 5FLMJ 3MWMA 1MMDA 3BPVA 1YFHA 5L3CA 2K3FA 4CCOA 1VQNI 3K70D 5D4SA 2JSCA 2PMZA 4CYCB 4A3JJ 1AKHA 2CWEA 3CLOA 4XK4A 3FXJA 2L9VA 2P6TA 3U21A 2FU4A 2MABA 2VUMJ 5CPRB 1JUPA 4KICA 1E17A 4GYGA 4AC0A 3L1PA 2RQPA 1ZREA 2LDUA 3AKZA 2GXGA 4PJMA 1W7PA 4XLPF 3W6JB 3GTLJ 2KISA 4Y3OA 2DT5A 4IQJA 3S17J 2JA8J 3RZDJ 1U5TC 1WJEA 1QVTA 1IGNA 4OIRF 3VB2A 4MFEA 3K4MA 2FEZA 1PVEA 2MSYA 3BROA 1S7EA 4DBQA 2L5QA 4YG2F 3S15J 2VPRA 2JWTA 4Z2YA 2XC7A 1S7AA 1FYMA 1D1BA 1LPQA 2CV2A 3WODF 3EDPA 1H9TA 4DYCA 3I59A 3RIRA 2IBDA 3M1CA 1Y0NA 2QQAA 3KX2A 1SVLA 2E60A 4N4NB 4HQMA 3PNVA 4NNJA 3S2WA 4G7ZF 4HAMA 4PCQA 2L4AA 3ABLH 1TW2A 4MEXF 4Y15A 4JQFA 4XNFA 1D0YA 1G8XA 4XKWA 4ZYEA 2CV0A 1I27A 5FKKA 4AIJA 3JCUC 4ANJA 2RV8A 2Y9YA 2ISZA 1HSTA 3WHCA 1RR7A 3GLLA 3G3ZA 3H1CA 5JI6A 1Z21A 5LLQA 3BG6A 3H36A 4UB6C 2VOOA 1WVRA 3OL3A 2YPRA 3P9KA 5E8IA 2HI3A 4QLCU 2ISYA 5KCMA 4KUMA 4YEJA 4Y13A 3J80Z 3IKTA 3MD2A 4BDYA 1FOKA 4Q48A 1TWFJ 2KHMA 1NK2P 2EV0A 3V42A 2KZGA 4IXAA 1MNEA 3K2AA 4M9ZA 1SVMA 3J81K 3HDDA 4NHJA 2AXLA 4GGGA 5HNHA 1G6NA 4MQVA 5GPCA 3FKJA 1PUEE 4BYYA 3W6VA 1XGSA 2IS6A 3S8PA 1VZ0A 2FBIA 3HKZA 4IKFA 1I39A 4ZYAA 1R9TJ 3LA3A 1X4PA 3BLYA 4LIVA 1WGXA 3QP5A 1IF1A 1USSA 3TO6A 3IWZA 2FQ4A 1EH8A 4A93J 3GFLA 3I58A 1KGSA 3DTIA 4FASD 5J1UA 1HLVA 4BXUA 4E7JA 4KYWA 3CCVI 2Y31A 1Z91A 4IF4A 3G6EI 2OZUA 2IA2A 1MMNA 4HQEA 2O0YA 2DMUA 4PJNA 4ITVA 1DU6A 2L9SA 2EK5A 1PYVA 2DI3A 4L5EA 2ECBA 5GP9A 4CYCA 4DOZA 4L18B 1IW7F 3CZ6A 3SEQA 4B4CA 1BIAA 5LRRA 2J5PA 3KZZA 4G6TB 4G8XA 3B6CA 1TZLA 1X2NA 5IYDJ 1R22A 4A12A 2XHKA 4BE0A 1IO2A 2M4KA 3DU6A 4FT8A 3VODA 1RUOA 1GHCA 2COMA 2UV1A 2H6CA 2CO5A 3HSRA 2QLZA 2HEOA 2Y0MA 1ZN2A 4XL9A 3MCZA 5LGNA 4FTHA 2EIKH 2ACJA 3RPQA 1KQ0A 1T98A 2IGKA 1J0RA 1Z0XA 3CCUI 3REOA 2QGUA 1XSVA 3IKVA 4A3DJ 2CG4A 2H1LA 2LD5A 5FKMA 3PFYA 4F3QA 2KJBA 1ENHA 2OD5A 3H3ZA 2R3SA 2ZFWA 3BTIA 3KCCA 1X2MA 2I8DA 5DUIA 1VTNC 2CQNA 3MZ8A 3WTXC 3JRCA 1J75A 4IVNA 3MQ0A 3DEUA 2V26A 3SZTA 2DFFA 4NC7A 3A02A 3QPLA 3WTUC 2Y9ZA 4A3MJ 1KYWA 2EILH 4D1QA 3PO2J 4IRIA 2FOWA 3C2BA 2A69F 1X19A 3BTCA 2P5KA 3DXJF 5FD5A 1SD5A 4ZDLA 1XGNA 2W24A 4LB5A 2CW0F 4FQGA 3L09A 5M5YJ 4MNUA 2K9MA 4QTRA 1ULYA 3SYTA 4G7OF 2VBXA 4XSZF 4NC8A 1YTYA 2DDAA 3O3KA 3ZMZA 4B44A 2HDDA 1TNTA 2CFXA 4XSXF 3A01B 1X1BA 1YE9A 2GA1A 3O2PE 5GAGJ 2M0CA 3OYCA 3BG3A 4M74A 3PL8A 5DCFA 1FSHA 5JFRA 3SZGA 2AHQA 2MA3A 3CJQB 2R93J 3QQAA 5EEAA 1FBSA 2XRLA 1EH6A 3S3MA 2K9SA 3CP8A 3D0SA 2DFHA 1HW5A 4PK4A 2BW3B 2FBKA 3ZOBA 2MG4A 2RN7A 3R61A 3RSNA 3M1EA 2K4BA 4S04A 3F6OA 3JW4A 1OCPA 2XROA 3T8TA 1T39A 3JSOA 4EATA 1R49A 5L3GA 1SD4A 2WBMA 1G3YA 1ETKA 2HQNA 3TEDA 4F7ZA 2OBPA 5CQEA 1RESA 3S32A 1MSEC 2M45A 3ABTA 3HRMA 1UHWA 3AG3H 1XSDA 3FWEA 3ERED 5HVQC 1I50J 3EYIA 1UELB 2AQFA 2R0QC 2K9NA 1H8AC 3E3VA 3M07A 3N05A 1ON1A 4BGDA 4ESJA 5H2FC 5F1RA 4U0VA 4ZYHA 2QZ8A 3VEPA 2DA2A 2DOAA 1FTZA 1VQKI 3H5RA 5BPIA 2STWA 2EA2A 2QCOA 4PFOA 4ZZDA 2FF4A 4Q4ZF 5C4JJ 1RR8C 1VF9A 2QVOA 5H6RA 1MBKA 1L0OC 1ZG3A 2F5FA 3ZQHA 4C2UA 2MD5A 1NTCA 1T56A 1YHQI 2NVUB 2P81A 2ZSHB 1CGPA 4M3FA 3BG5A 1ZR2A 3DV8A 2LC2A 1ORKA 2JVHA 1Y1VJ 1FWZA 3HRTA 4ZYDA 1RIOH 4L5IA 3FDYA 1B59A 1SVOA 5ERIA 3KEOA 3HSFA 1YW9A 5JR3A 3O8HA 2RC4A 2LSOA 3ZMDA 3N4MA 2WAEA 3VYTB 2DK5A 1FC3A 5J8FA 4ZZLA 2HKOA 2LKSA 3MKWB 1WJ5A 3I9V2 1ON2A 2WY7Q 3FK6A 3RPUD 1WH5A 4P9FA 3E6DA 3GUDA 4JYKA 3JTHA 2YU9J 3WTYC 3J7YJ 2GBYA 1Z1DA 2KRCA 1HC8A 1OCOH 1OLTA 5GPAA 1LFPA 4RAYA 4EGZA 4I01A 2W1OA 3VDXA 3BCBA 5FKNA 2EFWA 4WF2A 4A6EA 2KRFA 4BQQA 1LVKA 3GTQJ 1SFOJ 5CJ9A 3KIOA 1V54H 2HXOA 4KISA 2VBWA 3FMSA 4O6JA 3DPLC 5K7HA 3A01A 2PX9A 3FHNA 5DD4A 2RGVA 2BGCA 5HS8A 5KVRA 1BR4A 5FFXA 2O6GE 2DBBA 4I2OA 5C4XJ 1BW5A 2CRGA 2Z16A 1F43A 3F22A 4ABZA 3FF5A 2HVSA 2E1OA 3F9KA 4JP0A 1RUNA 2QSFX 1R6RA 2K9LA 4M9SA 3KP4A 5FGMA 2BW3A 4HF0A 3DF8A 1ZGJA 1APLC 2XKOA 2GXBA 1IV8A 2HTSA 2HYJA 2LY9A 4KIBA 1T08B 1D1CA 1TP4A 2BY0A 2OCCH 2E1CA 1LFBA 4OOIA 2VQHA 3DEWA 1R1VA 3I0TA 3W2VA 4DNCA 4LD5A 4M3DA 1JUMA 1ONVA 2EFPA 3TKYA 2P5LC 2RQQA 1S8NA 3IH2A 1R5GA 1BI0A 4XLAA 1BOAA 4PDKA 1FEXA 4CYDA 1DPUA 4MGRA 4D9JA 4LG0B 4C3HJ 3E97A 3COAC 6PAXA 2DMTA 2TDXA 3L2QA 3JRIA 2E7WA 1K4TA 1HW2A 3FIWA 3OYLA 3X2QH 1LFUP 5M3MJ 3IH3A 2PLYA 2ZCWA 2F5DA 2IVMA 3F0CA 5J40A 2D1VA 1D0ZA 4XQFA 4RS8A 5IYCJ 3FM5A 5LGUA 3GMEA 1MNDA 5HS9A 1I3AA 2XAQA 2BE5F 4OMZA 1GV5A 1VNDA 3ZN0A 3J80K 3DKXA 4XLNF 2M1BA 1FTTA 3ZR8X 4XM3A 1O7LA 5GTHC 2FSWA 1VQOI 1ETYA 1STZA 2V9PA 2O9LA 2YS9A 2OZ6A 4BQNA 3M4OJ 3F8FA 1U9OA 3S2HJ 4AU7A 3HOTA 2XASA 4AYBN 2JA2A 3G1MA 4OIPF 4ETSA 1V5FA 2BHYA 2GZWA 2K27A 4XMYA 2HFHA 4CH7A 3MZHA 5L3EA 1P7IA 1FP2A 2UZKA 3H9QA 2OQRA 4NUBA 4UHTA 2IXSA 3CCEI 2VT2A 3KFWX 2VN2A 3KLOA 4W97A 4BKXA 4L0ZB 3OYIA 4IZZA 2M9HA 4IPAA 1D8JA 4BE2A 4BE1A 3NRVA 2ZMEB 2XPUA 1HKSA 2WV1A 1BR2A 3TO7A 1W36D 4LB6B 1J09A 1S6LA 1HF0A 2KLOA 2XGCA 2R7XA 1JTYA 1ZHFA 3CMYA 1XDUA 4XBFA 4CCNA 5GAHJ 4N4OB 2BHZA 3SEZA 4BH9A 1U3EM 1JGSA 2HDCA 2K02A 3Q5FA 2X1DA 1ZARA 3K4KA 1NH3A 2DLLA 1DP7P 5ICCA 3DFGA 2E35A 2M8GX 4Z6YA 2MLKA 2BV6A 4MFDA 2ZMEC 2BXYA 1EF4A 3GLXA 1OKRA 2RKHA 5TRDA 3PNTA 3F8MA 3I56I 2DTRA 4OWRB 3HOWJ 1N78A 3BQZA 3GYHX 2PFBA 3K2ZA 4MTEA 2X1CA 4DJAA 2FJ1A 1ETVA 2R7TA 2GAUA 5JHUA 4BDZA 1E0EA 1DGRM 3DEEA 1JJ8C 3PIOF 3H3VK 4A0ZA 1D5VA 4QPOA 1LDDA 1FMWA 4I7HA 3HUGA 1XG1A 3ULQB 4AM3A 4IOCF 2KMUA 1R4MB 4HX4A 4LMYA 1TWAJ 2L7ZA 2O7OA 1UHSA 4LG0A 4BXFA 1BR1A 4IQ4A 4U7BA 3EETA 3QP6A 3FM3A 5HLTA 5H6QA 1O3RA 4LLLA 1X1AA 3ABKH 4XLHA 1U6GA 4JK1X 1VQPI 1YO5C 4OAZA 3CMMA 3HPHA 3JRGA 2W82A 1BN5A 2VC0A 5J6XA 2O61A 4XLFA 2AQEA 4I6ZA 4ESBA 2EZLA 3S1RJ 1H89C 1GLNA 3K0LA 3TOAA 2DU9A 3ELKA 3HZJA 2LBFB 2W84A 1FOWA 2VI6A 4PUSA 4BJTA 2HKXA 4ZTJA 3S1NJ 1YG2A 3SJMA 4PJJA 1Z67A 2ESHA 3FXMA 1D1AA 2R7QA 1MBGA 2NVXJ 1X3WB 1D0XA 2Y69H 3QYBA 2KJCA 4PSXA 3DTKA 2DA7A 1YIJI 3ABUA 5ED4A 1K4SA 2KIUA 1CF7B 4ZDPA 2CS3A 3PNYA 4WCGA 1LNWA 3KP5A 1YX5A 4IRHA 3D1NI 1F1ZA 3NWTA 2MH2A 3V8KA 2EFOA 4AWXB 2M30A 2DW4A 4AVZA 1MJBA 2OUMA 1V3FA 2PQ8A 2ZB9A 3TMOA 4P9UA 3JREA 3IRQA 4QWQA 1Z6RA 1S72I 4Y7NJ 3MEXA 2L02A 3OR2C 2ZMEA 3HGYA 4HX8A 1S5LC 5EZHA 4BEHB 2I5UA 1Y8QB 4FE7A 5JVTA 4AIKA 3U1KA 3AAFA 4BACA 3CO7C 4B1RA 2EV5A 4G7HF 2L9RA 5FLXZ 4IHVA 2CQQA 3BR6A 3S16J 2DCEA 2LVSA 2OA4A 3TO9A 3K4LA 5AIPA 5F6FA 3Q0WA 4GDFA 1SFXA 1NK3P 2PBIA 4OIOF 5F04A 3CCYA 1MMAA 3D5SC 3LFUA 5IPAA 1Z6TA 5CVRA 3BR3A 3WTSC 1LE8B 1A36A 1XMAA 1J2XA 3AG2H 3SXYA 2Z2SB 5D5VB 3I4NJ 3GFMA 2F4MB 1XPXA 4XONA 1J9IA 3HB9A 2ZJ2A 2VLAA 2QKMB 3F8NA 5ILSA 4UUSB 2Q2EB 5F64A 1Y0UA 2TRTA 5IY5H 1JT6A 2WB1N 2OAZA 2KDOA 4YFKF 3E5QA 3F6VA 2WWYA 2EFNA 2PJPA 2DQLA 5K1YA 1EJ9A 3KYDB 2V9VA 2X4HA 3ZMUA 3S14J 2DJNA 3NEUA 4RGUA 1U0JA 4R79A 2B9SA 1YYVA 2R7UA 2R7ZJ 4NDLA 2CMPA 3LSMA 3M8EA 4LITA 1PJRA 2A6EF 3GF2A 2LG4A 1IUFA 1QZZA 3ZXSA 2E2IJ 3CCRI 4E7IA 2CQXA 3WTWC 4A3LJ 3OYBA 1P92A 1BJZA 3RJPA 3BG7A 4M6YA 2EIJH 1JHHA 2P8TA 2QYOA 2XKPA 4XRFA 3H35A 1YITI 2HGCA 3BJAA 3OL4A 2ME6A 5HOOA 2X6OA 5E17F 3HPGA 3LSKA 1SD7A 3QWLA 1QO0D 3LWFA 2HU9A 2HNHA 1UJ8A 3BJOA 1Z3YA 4HNUA 3OS0A 1O3TA 1ZH5A 1A6IA 1I6HJ 1YIOA 2JA6J 1R58A 3MKLA 4WK8F 2R7SA 1HQCA 1XC5A 5DCMA 2ELJA 3RI4A 1IUYA 1XGMA 1LDKB 5L3BA 1B9MA 4HDVA 1FJLA 1R4NB 1ETQA 5D8KB 4B8XA 3OYNA 4A5NA 1IDYA 1Z05A 3FXQA 1JT0A 1VQ8I 1CF7A 3I55I 4EJOA 3BZKA 1H88C 2IS1A 2XDVA 3GWZA 3F23A 3JRFA 2QWWA 3ROUA 4KNYA 4KDPA 3FK7A 2CSOA 3T1BA 3BY6A 5F08A 4RAGA 3EQLF 2Z3YA 2UUZA 4MIMA 2Y0SN 1FBQA 2M7BA 2V6EA 3BTJA 1H9GA 2F5VA 2CW8A 1W5CC 5J4VA 2RNGA 4R8HA 2IW5A 4KJZA 3CJRB 5KHDA 4HLYA 4V2FA 1W7PD 2XAGA 1MJ9A 3FX3A 1VQMI 4I76A 1ZG5A 3OOUA 2JVGA 4EJUA 4ZJZA 2FA5A 1ITYA 1IZ1A 4ENJA 2UXXA 1QU3A 1X58A 4BHCA 3DP7A 5DM6F 3B02A 2Q0OA 4DYRA 1JE8A 3PUBA 4XKVA 2LP0A 4RB1A 3U2RA 3E7LA 3EUHC 1RRJA 4FISA 3WHBA 1LE8A 1AOYA 1MMGA 3S3NA 2JTVA 1G4DA 5GAEJ 1OMIA 3IAM2 3FXRA 4XOPA 3WU0A 2ZSIB 2XUBA 2R4GA 4F55A 3K10A 2LOOA 2MLGA 1FPQA 4V19K 1ODDA 1IN7A 4UUSA 2Q2EA 5E79C 3BPXA 1BJAA 4A3CJ 2JQ7A 2CYYA 1R5ID 2Y48A 2HQ5A 1E3PA 4DBRA 4U0YA 1JKOC 3Q0VA 3T5XA 2K86A 4U87A 1UB9A 2ID6A 4PZJA 4XKBA 2JJ7A 4XICA 3K6GA 1WJFA 4C2MJ 2VJIA 3WG7H 1XCVA 2LFBA 4NQWB 4PFPA 3KE2A 3MKZA 4LOCA 4V2GA 3CCMI 2QSGX 5FO5A 2K3PA 2FMYA 1JI8A 4HOBA 2DXIA 1DUXC 3RCOA 4PJLA 4YFXF 1FY7A 3R0AA 3BDDA 2IS4A 4IRGA 2F2EA 2DYSH 3DBRB 2V9KA 3G1LA 2NS8A 5FLVA 1XX5A 3W6KB 2Z99A 4IOAF 2VJ4A 3DWLE 1LQ1A 5HDNA 2HDWA 2HOAA 4J00A 1SMYF 4HX7A 2XB5A 3OR1C 2W4SA 3GXOA 3ZQQA 1IN8A 4L0YB 1P6RA 3HTUA 1ZQ3P 2R7OA 3ERMA 1KONA 1QNTA 3CDHA 4JX4A 1LEAA 1SAXA 2V1NA 3KYCB 2LRDA 3I54A 1WJDA 4MQ9F 2Z1DA 1ZRCA 4BXXJ 4P55A 1T95A 3LA7A 3L2CA 3JR9A 4IJAA 1W0UA 5D6FA 2PI0A 1R71A 4YRVA 2B0LA 3V7CA 4HNTA 2DDBA 1FNNA 1QRYA 4ESFA 5E8GA 2QEXI 1R23A 2WC2A 3EUHA 2P4WA 2TCTA 1MW7A 3PQJA 3HC7A 1GXQA 3CUOA 3KZYA 4M3GA 3CMEI 3VYSB 1Y8RB 1WSUA 4A3GJ 2DMPA 5EF6A 1OISA 1S7OA 3LSJA 1SMTA 4YFNF 1SAUA 2OC6A 3H9GA 4M71A 4RB0A 1O57A 1RZ4A 1DPRA 2HXIA 4B3XA 2B63J 4II3A 1TQMA 1FIPA 1XMKA 1BL0A 3AG4H 3A0HC 4UVAA 1VQ5I 5CKTA 3B6AA 1TTYA 1OYYA 4C9YA 3GFIA 2L01A 2KQRA 2RREA 4B09A 2LK2A 1HBXG 1OQYA 3ISPA 2WAFA 3E6CC 4H0EA 3GTKJ 3OSGA 2E36A 2ZNZA 2NXNB 4C3IJ 4LFUA 3VSLA 4S0HB 1IV6A 3OIOA 2QQ9A 2IGOA 1FMVA 4MHGA 2L7MP 2F4OB 3FBNB 4F93B 4I09A 2Q1ZB 1FOYA 1BC8C 2B7EA 4Y33A 4AD9A 1BOBA 2LTPA 3SFZA 5M3FJ 1TQPA 2DOEA 2WAQN 4E70A 3DLLF 2VOPA 1ZG1A 3OYJA 4UVCA 2KL4A 2N8GA 1KU7A 2DT7B 1ZKGA 3BC8A 3RKXA 4AUXA 1WHUA 5LFAA 2X1EA 1P4WA 4ENKA 2DPUA 3CD6I 4I98B 3L2WA 2AS5F 2ME0A 3R0JA 5L3FA 3M7GA 1UFMA 2OJED 1MD0A 2W85A 3I71A 1POGA 2BY3A 4IHSA 2MYSA 4YELA 3J7ZI 2XB0X 3S3OA 4M6VA 4WXDA 1A5JA 3AFHA 3CESA 3H5AA 4BHPA 2DJIA 5J1RA 4G12A 1I6XA 2NS7A 5DYMA 5F0CA 1TBXA 5FLXK 1RETA 2XPVA 5FD6A 3ASOH 5D6EA 2YSRA 3QPSA 3I3LA 1KQ8A 2IS2A 1SFKA 1ZGWA 3OIQA 1R7JA 4BUPA 3GZ5A 3PFIA 4HPQA 2FUG2 3FMQA 2V6CA 4A3KJ 4LJZF 2MH9A 3LQQA 4DYQA 3OYMA 3A03A 3ZPLA 4KN7X 2DA6A 3SZPA 3GTMJ 3D5RC 3IHUA 2ECCA 4DW6A 1SFUA 2BVMA 3VWBA 2F48A 2EV6A 1TWGJ 2XIGA 2E1MB 3H92A 3VFZA 1HA8A 1OPCA 1ZK8A 5E18F 2XAUA 3WE2A 3WTZA 1W0TA 1FIAA 4L9NA 2A6TA 1OFCX 3CUQB 3PSFA 4BHBA 2DPDA 2Y30A 4WWCA 2X85A 3GTOJ 4QSHA 2O8KA 3K1NA 1Z3XA 2EFQA 3NQOA 4CCLA 2K85A 2BZTA 5KAIC 5LGTA 3ESWB 3WTVC 4IEJA 3QYFA 5JVGF 1FZPB 3IC7A 1X4OA 2HPIA 3Q3SA 2QQBA 5CYVA 2E1MC 1IC8A 1J59A 1FOXA 5LD2C 3KP3A 2I10A 3U1DA 3KLNA 3Q9VA 4CZZA 5BNGA 2V79A 2A68F 1O7FA 4HEA2 1WZ2A 5JHFA 3HOSA 1O4XA 2KKOA 5IP6A 4X1EA 2GOXB 3MN2A 1PDNC 3LA2A 4XRMA 3S1QJ 3HHHA 2FQ3A 1WFXA 2JK3A 5CVVA 2R7WA 2NVTJ 1HOMA 3HM5A 4GYIA 1MDMB 2JA7J 5EG0B 4RAZA 1B4AA 3I5UA 2LF8A 4UV8A 3CC7I 2VQLA 2DTZA 3G2BA 3CCSI 1VQLI 3F21A 2M87A 1XD7A 2IT0A 3JRAA 1G3SA 3CDIA 4TV7A 3QOPA 2A05A 2CH0A 2WTEA 3T8RA 1RKWA 5K5QA 4BS9A 2FRHA 4Y17A 1SANA 1MBHA 1BI1A 4LK0F 5E3NA 5HNFA 4EJWA 1B9NA 3OYHA 4L9TA 3EUAA 5DDGA 1IRZA 3CF2A 5GTIC 1YW8A 1X1PA 4WXCA 2BY1A 1A31A 2H6BA 1JKQC 1X3UA 5M5WJ 3K70C 3PQKA 4C30A 2DFIA 3I4MJ 3IRRA 4YIRX 3C1DA 2ZJPF 2M3AA 1OCRH 4M3EA 5E3LA 3SDGA 5B5EC 1W5TA 2X6WA 3HBLA 1AHDP 4LIUA 1F9NA 3RYPA 1DGWY 4CXFA 2STTA 1O3QA 1U2WA 4ZH4F 4HNVA 4A2UA 2HOEA 2H09A 2ELKA 3LOCA 2E71A 2MD0A 3A0BC 5AIQA 1UAAA 2CU7A 3BJ6A 5DUKA 2D2WA 2DN0A 2R5YB 2HOSA 1W1WE 4RB2C 2XVCA 3EYYA 4B48A 1TT0A 3DQVC 1QBJA 1AA7A 5DV5A 5HLIA 2H1KA 3QU3A 2VKVA 5J1YA 4U88A 4A6DA 2CUZA 3CMAI 2LYCA 2GIZA 2DO7A 2M34A 2Y75A 5CVJA 4EM1A 1BC7C 1DU0A 1HW1A 3TP0A 2OV7A 2PMZN 4BJ5C 3FXUA 3C18A 4WX9A 5CVIA 1YI2I 4RDUA 4EQQA 1T0FC 2YX4A 4UV9A 1NG7A 1P9QC 3FMRA 5LEKA 2G0EA 2LNBA 2JRMA 1TWHJ 2ID3A 3GEZA 3G1OA 4EM0B 3OYEA 1MIJA 1AKHB 3R4KA 4KT5C 2IRFG 2KIFA 2IGNA 2VBYA 1DDNA 1G3WA 3MVPA 3KP6A 5D5UB 1Y56A 2NYXA 1N25A 1WRJA 5F0HA 2NNYA 3K69A 3K1MA 5HODA 3E1SA 3MAJA 1LKXA 1F36A 1LDJA 2PEXA 1I1SA 4KIGA 2QF7A 2Z33A 3DCFA 1SEUA 1JXSA 1QZEA 4CZCA 4G9YA 3M9AA 4QIWN 2K4JA 3IV5A 1HSJA 3V8LA 5FB2A 4B47A 3BR5A 3IP4B 2CFOA 3H0DA 4HF2A 1ETOA 2L9NA 4P1WA 1TQIA 4XR6A 1QGPA 4G94A 5FKLA 2VE8A 4HRIA 5EG0A 2EBIA 3LSTA 3GZ6A 1IN4A 4XKCA 4DZJA 2W57A 4M73A 3S93A 1WI3A 3NWSA 2VL8A 4NBQA 2KZVA 3A2KA 5J4YA 2M4GA 2ZNYA 2O5RA 2WY8Q 2HVQA 1Y6IA 1R00A 4OAYA 4JX6A 5ILUA 4X6AJ 4XLEA 4A3BJ 5J47A 2G7HA 3ASNH 2G9WA 1VQ7I 2HOTA 3Q0UA 4YIIA 1YJ9I 1T33A 2M8EA 5KK1A 4KFCA 2X0LA 1Z7UA 3HYIA 2FE3A 2OU2A 2VC1A 1ETXA 2L4MA 2AXTC 3HSEA 2VKHA 1IRFA 3GZNB 4OIQF 1ZLKA 4AYBA 4F91B 4J19A 2A61A 3F8BA 4EEFG 3LSHA 1B6AA 1ZAOA 3MKYB 3P9CA 2PG4A 3G71I 1QHHD 2KIQA 1QQIA 2GM4A 2L2OA 1DQUA 4KITB 1E3HA 5EJCA 4N0BA 1MH3A 2HS5A 3HKZN 4EVIA 2RVCA 1TNSA 4UVBA 2O8XA 5E1XA 1T0FA 4E7SA 4NC6A 3H0GJ 1AU7A 3W2AA 2HR3A 4NB5A 1WCMJ 3A1YA 2R5YA 4ZYGA 4O5VA 3AL0B 4Y52J 1OCCH 5LRSA 3J7AY 1XN7A 2XV4S 2A3SA 3EUKL 4LLGF 3L2RA 4PJ0C 3GO5A 3RYRA 3RQ4A 2IP2A 2BVLA 2V1DA 4E7KA 4A0XA 3DU5A 5E20A 1VQ6I 4KMFA 3OIPA 1XDSA 1S9HA 1NG6A 4BY7J 1UG2A 4FX0A 1U5TB 5M5XJ 1A6QA 3K4JA 3DKYA 3QPHA 4HV6A 1BI2A 2GWRA 2VB6A 3CCLI 3ZCOA 4O3MA 3HRUA 1XCBA 1E2XA 3AL0C 2C6YA 1Z77A 1V55H 1YX3A 2LH9A 3LAPA 2R7FA 3ZQGA 1IXRC 2M0MA 3ML6A 4XORA 5EGOB 4JOMA 2Z5UA 1FBUA 1GT0C 4CHUA 1HKQA 3ECHA 2E34A 2DQRA 1JHFA 3S2DJ 5F0FA 1Q1VA 3R60A 2UXNA 3FKIJ 3HOZJ 3E6MA 3MMYB 1B72B 2HTJA 3HXLA 1BBYA 2EZIA 2XSDC 3BZCA 3OYGA 2X9DA 4RGXA 2X6YA 2W7NA 5E1WA 2CUFA 1KQ9A 3H5NA 1P4XA 5IT9K 4BY1J 4L9JA 1MSFC 3A4CA 2W00A 1EKEA 1RKTA 2XF7A 3K4CA 5FJ8J 5L3DA 2JUGA 2LBFA 4OU0A 2HZTA 3L2UA 4QPQA 3GTGJ 3JSPA 4GO1A 4RM3A 3PJRA 1B1BA 3R6SA 3OYAA 3GX4X 3RKWA 2YU3A 4FETA 3E5XA 3C2GA 2F4IA 3CJNA 2HZDA 4CCMA 1ACIA 3HEFA 5TJJA 3O6BB 5B1BH 4CGZA 3SHFA 2KP6A 4GXOA 2HYFA 2CQKA 3HJEA 3BOQA 1ZRFA 2H8RA 4RB3C 1VI0A 1WJBA 3AG1H 3DBHB 2P0WA 2FNPA 3HL2A 2LKXA 1BIBA 3V8JA 5E3MA 4OINF 4JX5A 3OWTA 2DA5A 3LMMA 2K7LA 3RQIA 3OSFA 4E7HA 1SFEA 2DA1A 2VXDA 4BEHA 2NRAC 2L3DA 2J5OA 2MBFA 1JGGA 1IXCA 3OS1A 3K9TA 4XOTA 1HKTA 3LFKA 3TQNA 3JTGA 1Y1WJ 1OJLA 3IAS2 2ETHA 3KPHA 5KAFC 3CCJI 4RMNA 1S29A 2FMLA 2KT0A 3V4GA 3HOUJ 3LSGA 1ZLJA 2FD5A 3GW2A 1YW7A 2K9QA 1U9NA 2W48A 4U0WA 4E6KG 4GCVA 1S3JA 4FE4A 3CC2I 1R36A 3UKGA 1WJAA 5KNLA 3RKQA 1TW3A 5C3EJ 4BU2A 2GXAA 1NHAA 2CJJA 3ONQA 5HS7A 4FCYA 1CQTA 4UY8I 4FHTA 3DLAA 3LAJA 2DMNA 1U5TA 2XGXA 2DK8A 1FSEA 4PSWA 4A3FJ 4F92B 4BBSJ 4II2A 3E0JB 2V1XA 4IHWA 3G4SI 5CLSA 4D5CA 2ADUA 2FX0A 2IPQX 5IYBJ 4CICA 1XMXA 2LY1A 2JT1A 3TW7A 5EGOA 5DD8A 5EZGA 5LBQA 2HQAA 2CUJA 2WB1A 2P7VB 1IXSB 3FZVA 3W3CA 4IHTA 1ETWA 4RBOA 5LHGA 4MO7A 2E7XA 5A2QK 3HTSB 1LJ9A 1B72A 4XN0A 3I64A 3GVAA 1GXPA 2WADA 5FROA 2COBA 5CQGA 1JJ6C 2VQGA 2JRTA 4F52A 4KN4X 2GOMA 1QVUA 3M8JA 3BR0A 4UB8C 3BP8A 2V1UA 2Z9OA 3O8GA 4D7NA 3IL2A 3QOEA 1JUSA 3DKWA 5TISC 1E3OC 2HVRA 4E7LA 5K5RA 1YQAA 2H94A 2GLOA 4KMUX 1G2HA 2HYGD 2DT6A 4IO9F 4CCJA 4AIHA 3KP2A 1K83J 2BOLA 4I99C 1P7JA 2PMHA 1EH7A 4UXNA 1USTA 1Z9CA 3BCAA 3GCMA 1B8IB 2LREA 1GV2A 1IJWC 3QYEA 4Q47A 2DOFA 2JPBA 1GUUA 4P5OA 2R5ZB 3H3UA 1OCTC 5HDGA 5HLHA 3HOVJ 1MBJA 2H8WA 1I5ZA 2PN6A 4GRIA 2P7CB 3ZMVA 5C44J 1YLFA 2MC3A 4ASNA 2L0KA 3JRHA 2XPWA 2G7UA 3SDBA 2A5WA 5D4RA 1MZBA 1GDTA 3BT9A 3PIPF 2OTLI 3RKYA 2HQRA 4EJTA 1TWCJ 3L7WA 3E5UA 3GBGA 3I4PA 4IX7A 5F27A 2E5ZA 4A5MA 2DFEA 4BL0B 2ZXIA 3NARA 4HV5A 3SFIA 2IA1A 3P9IA 5IT3A 5GADJ 1XSXA 3HGGA 5EEHA 3I53A 1XTAA 3C3WA 3HIFA 2EPFA 2Y0SA 2X6XA 4E4HA 2EA4A 1U78A 4CCKA 4W1UA 4I0BA 4A69C 1X1CA 2Q8KA 5ILVA 4A0YA 3BZ6A 2L54A 3TGNA 3UR3C 3RPUA 1QA6A 4RGRA 3DBLB 1RPWA 1QZYA 1FYKA 1H0MA 1LB2A 5EEGA 3LL7A 5K7FA 2E2HJ 5ICEA 4AIDA 4BNCA 4XN3A 1D3YA 2OF7A 2EJRA 1SC7A 4M9XA 3WE3A 2VKDA 5FKOA 2D45A 2LF7A 3CDLA 1WQ2A 5BMZA 1KZHA 2XGDA 2E19A 1K61A 2V4JC 3CCQI 5E3OA 2DA4A 3JAMZ 1K79A 3ZN1A 4UNOA 3TDUC 1Q1HA 1ERDA 2LR8A 1OCZH 1Y39A 1ZYRF 2NAZA 2JSPA 5FFZA 3KETA 1IRGA 3L00A 2QM3A 2YX7A 1W36C 1TC3C 4X0GA 2NVYJ 3CQZJ 3F3XA 4NQWA 2RDPA 2QQ8A 3FXOA 4IL6C 1ZTRA 4KT6A 5DEQA 5K7ZA 4CO8A 1MH4A 2D5VA 2O3FA 2VIXA 5LHIA 2UWMA 1DP3A 1BI3A 1SD6A 2LY2A 3CP2A 3WTTC 4ENNA 4ON0A 1QPMA 3CO6C 5B66C 3U9GA 4LG3A 4IHYA 3PM1A 3OMYA 4RA2A 2M2EA 1LVAA 2XAFA 1WWXA 4BQOA 2V7FA 2EWNA 2VODA 1G3TA 1OR7C 3C7JA 3ZQIA 3T0YA 2ZC2A 4DZPA 5CVUA 3CC4I 3BG9A 2X51A 2XAJA 1TLHB 1N75A 5E1ZB 1MGTA 2NVQJ 2E5NA 1MMSA 2EB7A 2CW7A 4EJVA 3CJTB 1F5TA 4UUTA 1B8IA 4M72A 4Y4RA 2CUEA 5IT9Z 3TBIA 1IN5A 2R5ZA 4N9IA 3RDIA 5B3SH 3WGIA 3OY9A 1V5EA 2PJRB 1K78B 4KA4A 1P2FA 3ZRGA 2IEKA 9ANTA 2DODA 3WGGA 4K2EA 2ZXWH 1I3QJ 3BQYA 1UMQA 4OMYA 2XF6A 3C2HA 1WI9A 1L3LA 1EA3A 3ZQCA 1VQ4I 3OS2A 3HOYJ 2F5CA 1YJWI 3FHZA 3S1MJ 5IP9J
chains in the Genus database with same CATH topology
1AKHB 3A02A 3QPLA 2Y9ZA 3VPRA 4A3MJ 3PO2J 3MVPA 3C2BA 3ZQLA 3BTCA 2ME6A 1VFCA 2JMWA 2X6OA 5F0HA 5HODA 3FISA 1IDZA 1F36A 5M5YJ 1PUFB 1A6IA 2QF7A 4QTRA 1I6HJ 2JA6J 3DCFA 3MKLA 1MNMC 2HDDA 3IV5A 1XC5A 4QIWN 3A01B 3BR5A 1FJLA 1ETQA 2M0CA 1ETOA 3BG3A 5FKLA 1XS9A 5EG0A 2EBIA 1IDYA 2AHQA 5DTDA 4XRSG 3QQAA 1JT0A 2R93J 2RAEA 5EEAA 3BR1A 2XRLA 4DZJA 5DS9A 1WI3A 2K9SA 1H88C 3JRFA 3ZOBA 2MG4A 4C3JJ 3FK7A 4JX6A 4IHXA 4X6AJ 1OCPA 5F08A 4A3BJ 1U8BA 5EYRA 4MIMA 2Y0SN 3BTJA 3Q0UA 2HOTA 1T33A 2EZKA 1HDDC 3RZOJ 2K40A 1ETKA 3TEDA 1ETXA 2LLKA 5F1JA 1RESA 4V2FA 1MSEC 2EQRA 4D5FA 3BTLA 4I76A 3JRDA 3OOUA 1I50J 3IH4A 4J19A 2R0QC 2K9NA 5JLXA 5IOZA 1H8AC 4EEFG 1ITYA 3GTPJ 1X58A 3JRBA 1ZR4A 1QPIA 3K7AJ 2GM4A 2DA2A 2OPTA 1FTZA 2L7FP 4DYRA 1WPKA 4MLOA 2DA3A 1JTXA 1MH3A 2LP0A 3HKZN 3E7LA 4FISA 2QCOA 3WHBA 1LE8A 1D5YA 5C4JJ 1VF9A 1BW6A 1MBKA 3H0GJ 1AU7A 3ZQHA 1WCMJ 2R5YA 1NTCA 4Y52J 1HDPA 1T56A 2X48A 4UUSA 2P81A 4A3CJ 4M3FA 3BG5A 1ZR2A 5J3LA 1ORKA 2HQ5A 1Y1VJ 1JKOC 3Q0VA 1HCRA 1YRNB 2ID6A 4BY7J 3O8HA 1UG2A 2JJ7A 4XICA 2DMQA 4C2MJ 5M5XJ 2EH3A 2LFBA 4LOCA 4V2GA 2MGQA 3LNQA 1Z77A 3FK6A 1WH5A 3LSRA 4JYKA 2YU9J 3ZQGA 2R92J 4A3EJ 2GBYA 5EGOB 1GT0C 5GPAA 5EDNA 3ZQFA 3G1LA 2NS8A 2E2JJ 5FLVA 3S2DJ 5F0FA 1Q1VA 3HOZJ 3FKIJ 5FKNA 1B72B 1PUFA 2EZIA 3GTQJ 2HOAA 2XSDC 1SFOJ 2XB5A 2HXOA 2X9DA 1BA5A 2YUSA 2CUFA 5K7HA 5JLWA 4JX4A 3A01A 3GTJJ 1GVDA 1ZQ3P 2JN6A 4BY1J 1MSFC 4XRSA 1RKTA 5FJ8J 5C4XJ 1BW5A 3BR2A 3HOXJ 2CRGA 1F43A 4ABZA 4BXXJ 2E1OA 5IP7J 4JP0A 2JA5J 3GTGJ 2Y2ZA 1W0UA 3JR9A 5IOYA 1JKPC 1APLC 4A3IJ 2HYJA 4D7MA 2LY9A 3HEFA 1QRYA 1LFBA 4GFBA 3DEWA 2VKEA 2TCTA 4M3DA 1JUMA 4M3GA 3IH2A 1MBEA 2H8RA 4A3GJ 2DMPA 1FEXA 1VI0A 5EF6A 2XGEA 3LSJA 1JKRC 4C3HJ 4XIDA 2LKXA 2DMTA 5E3MA 4JX5A 2DA5A 3RQIA 3JRIA 3OSFA 2HXIA 2B63J 1WH7A 3FIWA 2DA1A 2MW8A 2IAIA 1FIPA 1LFUP 5M3MJ 2KDZA 3IH3A 1JGGA 3F0CA 1Y1WJ 1MBFA 1OJLA 5IYCJ 1BL0A 3TW6A 2KT0A 3B6AA 3HOUJ 3LSGA 2FD5A 3PO3J 2LK2A 1GV5A 1VNDA 3GTKJ 3OSGA 4B3AA 2K9QA 4C3IJ 1U9NA 1IV6A 2W48A 4S0HB 3OIOA 3LSPA 1FTTA 2L7MP 4FE4A 1ETYA 2O9LA 2YS9A 3UKGA 3M4OJ 2LTPA 3RKQA 5C3EJ 1U9OA 5M3FJ 3S2HJ 2WAQN 2EZHA 1IG7A 2CJJA 4AYBN 1YRNA 3G1MA 2N8GA 4FCYA 1ZKGA 2AO9A 3NAUA 4AUXA 4BBRJ 1CQTA 2DMNA 2ME0A 2NOGA 3TP3A 1P7IA 4A3FJ 4BBSJ 1POGA 4IHWA 4BKXA 4W97A 2XB0X 4M6VA 4D5CA 3M3YJ 2M9HA 4M3BA 2FX0A 5IYBJ 1A5JA 3TW7A 5EGOA 5EZGA 5J1RA 4G12A 2XPUA 2NS7A 5F0CA 2WV1A 5FLMJ 1RETA 1HF0A 2XPVA 1ETWA 4RBOA 2XGCA 4MO7A 3QPSA 1JTYA 1B72A 3CMYA 4CYCB 4A3JJ 1ZGWA 1AKHA 2COBA 1JJ6C 4XK4A 1QVUA 3BR0A 2VUMJ 1JUPA 4A3KJ 3O8GA 4D7NA 1JUSA 4AC0A 3L1PA 1E3OC 2GLOA 4DYQA 1G2HA 3A03A 3GTLJ 2DA6A 2M8GX 3GTMJ 2ECCA 4DW6A 3S17J 1K83J 4MFDA 2JA8J 3RZDJ 1IGNA 1QVTA 1EF4A 1P7JA 1TWGJ 4MFEA 3HOWJ 3BQZA 2MSYA 1S7EA 1ZK8A 2FJ1A 1B8IB 1GV2A 1ETVA 1IJWC 3S15J 2VPRA 2JWTA 1GUUA 1JJ8C 1W0TA 1FIAA 2R5ZB 3H3VK 1OCTC 1OFCX 3HOVJ 1MBJA 2Y30A 1XG1A 3GTOJ 4QSHA 5C44J 4DYCA 2O8KA 2L0KA 1TWAJ 2IBDA 2XPWA 3JRHA 2L7ZA 2O7OA 1UHSA 4IEJA 1GDTA 3BT9A 1TWCJ 3GBGA 3Q3SA 5F27A 1IC8A 2I10A 3NARA 3SFIA 5FKKA 3JRGA 3HGGA 5BNGA 2Y9YA 4I6ZA 2EZLA 3S1RJ 1U78A 1H89C 3WHCA 1O4XA 1RR7A 4W1UA 4A69C 5IP6A 2VI6A 4X1EA 3S1NJ 3MN2A 3S1QJ 4XRMA 1RPWA 2HI3A 3SJMA 2JK3A 2NVTJ 1HOMA 1MBGA 3HM5A 5K7FA 2NVXJ 2E2HJ 1TWFJ 2JA7J 1NK2P 3HDDA 3K2AA 2DA7A 2OF7A 5EG0B 5FKOA 5GPCA 3CDLA 3W6VA 2DTZA 2XGDA 2E19A 3D1NI 3JRAA 1K61A 5E3OA 1R9TJ 2DA4A 1WGXA 1RKWA 2FQ4A 4A93J 2ZB9A 3JREA 1SANA 1MBHA 2LR8A 5J1UA 5E3NA 1HLVA 4Y7NJ 2Y31A 1IRZA 1TC3C 2NVYJ 3CQZJ 3HGYA 5EZHA 1JKQC 3S1MJ 4FE7A 5K7ZA 5M5WJ 2DMUA 1ZTRA 1MH4A 1DU6A 3I4MJ 4L5EA 2D5VA 2ECBA 5GP9A 4CYCA 4B1RA 2L9RA 4B4CA 4IHVA 2CQQA 3BR6A 3S16J 4M3EA 5E3LA 3SDGA 2LVSA 3B6CA 4IHYA 1X2NA 3HBLA 1AHDP 3Q0WA 3PM1A 5IYDJ 2M2EA 1NK3P 5F04A 3CCYA 5IPAA 4HNVA 3BR3A 1LE8B 3ZQIA 2ELKA 3LOCA 4DZPA 2CU7A 3BG9A 3I4NJ 2DN0A 3HB9A 2R5YB 2HOSA 2NVQJ 4FTHA 4UUTA 4UUSB 1B8IA 2TRTA 2H1KA 1JT6A 1Z0XA 2WB1N 2VKVA 2CUEA 5J1YA 4A3DJ 2R5ZA 2LD5A 5FKMA 2M34A 1DU0A 3TP0A 3S14J 1ENHA 2PMZN 2DJNA 3BTIA 2IEKA 9ANTA 1X2MA 2R7ZJ 4NDLA 1I3QJ 3BQYA 4RDUA 1UMQA 1IUFA 2E2IJ 3ZQCA 3JRCA 2G0EA 2CQXA 3HOYJ 5IP9J 1TWHJ 2ID3A 4A3LJ 3G1OA 1BJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AKH B;  3A02 A;  3QPL A;  2Y9Z A;  3VPR A;  4A3M J;  3PO2 J;  3MVP A;  3C2B A;  3ZQL A;  3BTC A;  2ME6 A;  1VFC A;  2JMW A;  2X6O A;  5F0H A;  5HOD A;  3FIS A;  1IDZ A;  1F36 A;  5M5Y J;  1PUF B;  1A6I A;  2QF7 A;  4QTR A;  1I6H J;  2JA6 J;  3DCF A;  3MKL A;  1MNM C;  2HDD A;  3IV5 A;  1XC5 A;  4QIW N;  3A01 B;  3BR5 A;  1FJL A;  1ETQ A;  2M0C A;  1ETO A;  3BG3 A;  5FKL A;  1XS9 A;  5EG0 A;  2EBI A;  1IDY A;  2AHQ A;  5DTD A;  4XRS G;  3QQA A;  1JT0 A;  2R93 J;  2RAE A;  5EEA A;  3BR1 A;  2XRL A;  4DZJ A;  5DS9 A;  1WI3 A;  2K9S A;  1H88 C;  3JRF A;  3ZOB A;  2MG4 A;  4C3J J;  3FK7 A;  4JX6 A;  4IHX A;  4X6A J;  1OCP A;  5F08 A;  4A3B J;  1U8B A;  5EYR A;  4MIM A;  2Y0S N;  3BTJ A;  3Q0U A;  2HOT A;  1T33 A;  2EZK A;  1HDD C;  3RZO J;  2K40 A;  1ETK A;  3TED A;  1ETX A;  2LLK A;  5F1J A;  1RES A;  4V2F A;  1MSE C;  2EQR A;  4D5F A;  3BTL A;  4I76 A;  3JRD A;  3OOU A;  1I50 J;  3IH4 A;  4J19 A;  2R0Q C;  2K9N A;  5JLX A;  5IOZ A;  1H8A C;  4EEF G;  1ITY A;  3GTP J;  1X58 A;  3JRB A;  1ZR4 A;  1QPI A;  3K7A J;  2GM4 A;  2DA2 A;  2OPT A;  1FTZ A;  2L7F P;  4DYR A;  1WPK A;  4MLO A;  2DA3 A;  1JTX A;  1MH3 A;  2LP0 A;  3HKZ N;  3E7L A;  4FIS A;  2QCO A;  3WHB A;  1LE8 A;  1D5Y A;  5C4J J;  1VF9 A;  1BW6 A;  1MBK A;  3H0G J;  1AU7 A;  3ZQH A;  1WCM J;  2R5Y A;  1NTC A;  4Y52 J;  1HDP A;  1T56 A;  2X48 A;  4UUS A;  2P81 A;  4A3C J;  4M3F A;  3BG5 A;  1ZR2 A;  5J3L A;  1ORK A;  2HQ5 A;  1Y1V J;  1JKO C;  3Q0V A;  1HCR A;  1YRN B;  2ID6 A;  4BY7 J;  3O8H A;  1UG2 A;  2JJ7 A;  4XIC A;  2DMQ A;  4C2M J;  5M5X J;  2EH3 A;  2LFB A;  4LOC A;  4V2G A;  2MGQ A;  3LNQ A;  1Z77 A;  3FK6 A;  1WH5 A;  3LSR A;  4JYK A;  2YU9 J;  3ZQG A;  2R92 J;  4A3E J;  2GBY A;  5EGO B;  1GT0 C;  5GPA A;  5EDN A;  3ZQF A;  3G1L A;  2NS8 A;  2E2J J;  5FLV A;  3S2D J;  5F0F A;  1Q1V A;  3HOZ J;  3FKI J;  5FKN A;  1B72 B;  1PUF A;  2EZI A;  3GTQ J;  2HOA A;  2XSD C;  1SFO J;  2XB5 A;  2HXO A;  2X9D A;  1BA5 A;  2YUS A;  2CUF A;  5K7H A;  5JLW A;  4JX4 A;  3A01 A;  3GTJ J;  1GVD A;  1ZQ3 P;  2JN6 A;  4BY1 J;  1MSF C;  4XRS A;  1RKT A;  5FJ8 J;  5C4X J;  1BW5 A;  3BR2 A;  3HOX J;  2CRG A;  1F43 A;  4ABZ A;  4BXX J;  2E1O A;  5IP7 J;  4JP0 A;  2JA5 J;  3GTG J;  2Y2Z A;  1W0U A;  3JR9 A;  5IOY A;  1JKP C;  1APL C;  4A3I J;  2HYJ A;  4D7M A;  2LY9 A;  3HEF A;  1QRY A;  1LFB A;  4GFB A;  3DEW A;  2VKE A;  2TCT A;  4M3D A;  1JUM A;  4M3G A;  3IH2 A;  1MBE A;  2H8R A;  4A3G J;  2DMP A;  1FEX A;  1VI0 A;  5EF6 A;  2XGE A;  3LSJ A;  1JKR C;  4C3H J;  4XID A;  2LKX A;  2DMT A;  5E3M A;  4JX5 A;  2DA5 A;  3RQI A;  3JRI A;  3OSF A;  2HXI A;  2B63 J;  1WH7 A;  3FIW A;  2DA1 A;  2MW8 A;  2IAI A;  1FIP A;  1LFU P;  5M3M J;  2KDZ A;  3IH3 A;  1JGG A;  3F0C A;  1Y1W J;  1MBF A;  1OJL A;  5IYC J;  1BL0 A;  3TW6 A;  2KT0 A;  3B6A A;  3HOU J;  3LSG A;  2FD5 A;  3PO3 J;  2LK2 A;  1GV5 A;  1VND A;  3GTK J;  3OSG A;  4B3A A;  2K9Q A;  4C3I J;  1U9N A;  1IV6 A;  2W48 A;  4S0H B;  3OIO A;  3LSP A;  1FTT A;  2L7M P;  4FE4 A;  1ETY A;  2O9L A;  2YS9 A;  3UKG A;  3M4O J;  2LTP A;  3RKQ A;  5C3E J;  1U9O A;  5M3F J;  3S2H J;  2WAQ N;  2EZH A;  1IG7 A;  2CJJ A;  4AYB N;  1YRN A;  3G1M A;  2N8G A;  4FCY A;  1ZKG A;  2AO9 A;  3NAU A;  4AUX A;  4BBR J;  1CQT A;  2DMN A;  2ME0 A;  2NOG A;  3TP3 A;  1P7I A;  4A3F J;  4BBS J;  1POG A;  4IHW A;  4BKX A;  4W97 A;  2XB0 X;  4M6V A;  4D5C A;  3M3Y J;  2M9H A;  4M3B A;  2FX0 A;  5IYB J;  1A5J A;  3TW7 A;  5EGO A;  5EZG A;  5J1R A;  4G12 A;  2XPU A;  2NS7 A;  5F0C A;  2WV1 A;  5FLM J;  1RET A;  1HF0 A;  2XPV A;  1ETW A;  4RBO A;  2XGC A;  4MO7 A;  3QPS A;  1JTY A;  1B72 A;  3CMY A;  4CYC B;  4A3J J;  1ZGW A;  1AKH A;  2COB A;  1JJ6 C;  4XK4 A;  1QVU A;  3BR0 A;  2VUM J;  1JUP A;  4A3K J;  3O8G A;  4D7N A;  1JUS A;  4AC0 A;  3L1P A;  1E3O C;  2GLO A;  4DYQ A;  1G2H A;  3A03 A;  3GTL J;  2DA6 A;  2M8G X;  3GTM J;  2ECC A;  4DW6 A;  3S17 J;  1K83 J;  4MFD A;  2JA8 J;  3RZD J;  1IGN A;  1QVT A;  1EF4 A;  1P7J A;  1TWG J;  4MFE A;  3HOW J;  3BQZ A;  2MSY A;  1S7E A;  1ZK8 A;  2FJ1 A;  1B8I B;  1GV2 A;  1ETV A;  1IJW C;  3S15 J;  2VPR A;  2JWT A;  1GUU A;  1JJ8 C;  1W0T A;  1FIA A;  2R5Z B;  3H3V K;  1OCT C;  1OFC X;  3HOV J;  1MBJ A;  2Y30 A;  1XG1 A;  3GTO J;  4QSH A;  5C44 J;  4DYC A;  2O8K A;  2L0K A;  1TWA J;  2IBD A;  2XPW A;  3JRH A;  2L7Z A;  2O7O A;  1UHS A;  4IEJ A;  1GDT A;  3BT9 A;  1TWC J;  3GBG A;  3Q3S A;  5F27 A;  1IC8 A;  2I10 A;  3NAR A;  3SFI A;  5FKK A;  3JRG A;  3HGG A;  5BNG A;  2Y9Y A;  4I6Z A;  2EZL A;  3S1R J;  1U78 A;  1H89 C;  3WHC A;  1O4X A;  1RR7 A;  4W1U A;  4A69 C;  5IP6 A;  2VI6 A;  4X1E A;  3S1N J;  3MN2 A;  3S1Q J;  4XRM A;  1RPW A;  2HI3 A;  3SJM A;  2JK3 A;  2NVT J;  1HOM A;  1MBG A;  3HM5 A;  5K7F A;  2NVX J;  2E2H J;  1TWF J;  2JA7 J;  1NK2 P;  3HDD A;  3K2A A;  2DA7 A;  2OF7 A;  5EG0 B;  5FKO A;  5GPC A;  3CDL A;  3W6V A;  2DTZ A;  2XGD A;  2E19 A;  3D1N I;  3JRA A;  1K61 A;  5E3O A;  1R9T J;  2DA4 A;  1WGX A;  1RKW A;  2FQ4 A;  4A93 J;  2ZB9 A;  3JRE A;  1SAN A;  1MBH A;  2LR8 A;  5J1U A;  5E3N A;  1HLV A;  4Y7N J;  2Y31 A;  1IRZ A;  1TC3 C;  2NVY J;  3CQZ J;  3HGY A;  5EZH A;  1JKQ C;  3S1M J;  4FE7 A;  5K7Z A;  5M5W J;  2DMU A;  1ZTR A;  1MH4 A;  1DU6 A;  3I4M J;  4L5E A;  2D5V A;  2ECB A;  5GP9 A;  4CYC A;  4B1R A;  2L9R A;  4B4C A;  4IHV A;  2CQQ A;  3BR6 A;  3S16 J;  4M3E A;  5E3L A;  3SDG A;  2LVS A;  3B6C A;  4IHY A;  1X2N A;  3HBL A;  1AHD P;  3Q0W A;  3PM1 A;  5IYD J;  2M2E A;  1NK3 P;  5F04 A;  3CCY A;  5IPA A;  4HNV A;  3BR3 A;  1LE8 B;  3ZQI A;  2ELK A;  3LOC A;  4DZP A;  2CU7 A;  3BG9 A;  3I4N J;  2DN0 A;  3HB9 A;  2R5Y B;  2HOS A;  2NVQ J;  4FTH A;  4UUT A;  4UUS B;  1B8I A;  2TRT A;  2H1K A;  1JT6 A;  1Z0X A;  2WB1 N;  2VKV A;  2CUE A;  5J1Y A;  4A3D J;  2R5Z A;  2LD5 A;  5FKM A;  2M34 A;  1DU0 A;  3TP0 A;  3S14 J;  1ENH A;  2PMZ N;  2DJN A;  3BTI A;  2IEK A;  9ANT A;  1X2M A;  2R7Z J;  4NDL A;  1I3Q J;  3BQY A;  4RDU A;  1UMQ A;  1IUF A;  2E2I J;  3ZQC A;  3JRC A;  2G0E A;  2CQX A;  3HOY J;  5IP9 J;  1TWH J;  2ID3 A;  4A3L J;  3G1O A;  1BJZ A; 
#chains in the Genus database with same CATH topology
 3IWF A;  3L9F A;  4B43 A;  5BQT A;  2BBY A;  4M6X A;  3VPR A;  2BY2 A;  3H9J A;  3K1P A;  1X3Z B;  4EV0 A;  3ZQL A;  2W25 A;  2P6S A;  4XLC A;  1VFC A;  1UHM A;  2JMW A;  2IJL A;  3N97 A;  3QPT A;  1OYW A;  1X1D A;  2DAO A;  3FIS A;  1IDZ A;  3KP7 A;  4MTD A;  2ZKZ A;  3DTE A;  1TL8 A;  2A6H F;  1T38 A;  1REP C;  1PUF B;  4BAY A;  3ECO A;  3ZGK A;  4ENM A;  5BS6 A;  2EIN H;  4I02 A;  2DYR H;  1MNM C;  3CTA A;  1FX7 A;  3HHG A;  3LQR A;  3IUO A;  1IN6 A;  2D1H A;  3QAH A;  3ZMT A;  2RNJ A;  3PSI A;  4HYE A;  4HDU A;  3CUQ C;  4L5J A;  1XS9 A;  4LK1 F;  2VXZ A;  5HDK A;  3EPZ A;  4G6Q A;  5DTD A;  4XRS G;  2RAE A;  3BR1 A;  5DS9 A;  2BYV E;  2KPM A;  3HUG B;  4PGG A;  4AVP A;  3J81 Z;  2ZJR F;  3F72 A;  1UZC A;  4C3J J;  4IHX A;  4DQ2 A;  4HSR A;  1U8B A;  5TGT A;  5EYR A;  5K5O A;  1QHG A;  3K4N A;  3QU6 A;  2PMU A;  3FBI B;  3TOB A;  2EZK A;  5H20 A;  1OR7 A;  1HDD C;  3RZO J;  2K40 A;  2XAH A;  3Q9S A;  3UNG C;  2LLK A;  5F1J A;  2ZBK A;  3OOP A;  1R1U A;  4HST A;  2BEO A;  3OYF A;  3M8F A;  2EQR A;  2WAQ A;  4D5F A;  1UCR A;  3BTL A;  4RLF A;  3JRD A;  1WJC A;  3IH4 A;  1R5H A;  5JLX A;  5IOZ A;  1BM9 A;  5BPD A;  3QRF F;  1HXD A;  2FNA A;  5FRM A;  2F6C A;  2HPM A;  2KRH A;  5FRN A;  1VQ9 I;  3GTP J;  1FLI A;  3JRB A;  1ZR4 A;  4ZTF A;  1QPI A;  3K7A J;  1IAW A;  4R1H A;  2QEN A;  3WU2 C;  1ZEL A;  2OPT A;  5D8L B;  2L7F P;  1A04 A;  3OV8 A;  3QOD A;  4G6D A;  1WPK A;  4MLO A;  2DA3 A;  1JTX A;  2GA2 A;  4CA0 A;  4I0A A;  4HG2 A;  1KU9 A;  1D5Y A;  1KU2 A;  3KZI C;  1K7A A;  1GVJ A;  1BW6 A;  2JUC A;  5A2Q Z;  4HF1 A;  1N77 A;  4BQA A;  3DPT A;  2YR2 A;  1HDP A;  1LUJ B;  2X48 A;  3DPU A;  4EM2 A;  5D5W B;  1MJA A;  4U7D A;  2L7K A;  2M5W A;  3VYU B;  4N9H A;  1Z7L A;  4HW0 A;  5J3L A;  1ZGA A;  4HZF A;  1EV7 A;  4HA8 A;  1D8K A;  2ZJQ F;  4E7Z A;  2JZY A;  2M7A A;  1K78 A;  1HCR A;  1J7K A;  3MFK A;  2PJR A;  1YRN B;  4MEY F;  3TDZ C;  2A07 F;  2OQG A;  3KEQ A;  4H4K C;  2IA0 A;  3VSK A;  4FX4 A;  2LMD A;  2QBY B;  3J7A O;  5D5X B;  2DMQ A;  2FBH A;  4DGW B;  2EH3 A;  2F5E A;  5B1A H;  4WXH A;  4RGS A;  1YS6 A;  2GIV A;  2MFZ A;  1F4K A;  1U8R A;  3CUQ A;  1J5Y A;  2NNN A;  3ZMS A;  2MGQ A;  3VYR B;  3LNQ A;  1G59 A;  3OYD A;  3MZY A;  3SQN A;  1PP8 F;  2R7D A;  3LSR A;  2VE9 A;  2R92 J;  4A3E J;  2VQC A;  3P7N A;  4RAF A;  1IRX A;  4KIF A;  3G73 A;  3ABM H;  1ZRD A;  4L9V A;  5EDN A;  3FXL A;  2VJJ A;  3ZQF A;  2E2J J;  3TL4 X;  3ZQ7 A;  1R1T A;  4DIQ A;  1PUF A;  3WU1 B;  4LLN A;  1FT9 A;  3B73 A;  2WA0 A;  1RC9 A;  2CV1 A;  1BA5 A;  1A35 A;  2ZXH A;  2IGM A;  2YUS A;  2OCE A;  3W2W A;  5JLW A;  3GTJ J;  1GVD A;  3BWG A;  3P5J A;  2R7V A;  2HWV A;  3PUF A;  3VOE A;  2JN6 A;  4J01 A;  4XRS A;  1RI7 A;  2JPC A;  1W7P B;  2ZXJ A;  2ELH A;  2H27 A;  3BR2 A;  3HOX J;  3RTR A;  4UUV A;  2XRN A;  3KYL A;  3CLQ A;  5IP7 J;  4JBA A;  1FYL A;  2JA5 J;  2Y2Z A;  2LKP A;  1TT5 B;  4D0P A;  5IOY A;  2R7R A;  1JKP C;  2NOJ B;  2CQ7 A;  1KU3 A;  2EIM H;  2KIM A;  4A3I J;  4D7M A;  1MDM A;  2VAS A;  5J8C A;  4GFB A;  1XB4 A;  2CGP A;  2VKE A;  1C0W A;  2VJ5 A;  4RLQ A;  4ZC3 A;  2FOK A;  1PP7 U;  4CUG A;  2QSH X;  3WGH A;  1MKM A;  1MBE A;  2VT3 A;  3I59 B;  1YJN I;  2XGE A;  1JKR C;  4XID A;  2QA4 I;  3V7S A;  3F8C A;  4CDG A;  1P4A A;  2NS0 A;  2WV0 A;  2O03 A;  1T6S A;  3GFJ A;  1K6Y A;  1WH7 A;  1FP1 D;  2FXA A;  1I1G A;  2XF5 A;  1RNL A;  2IAI A;  2MW8 A;  2QUF A;  3E6B A;  1K6O A;  1O3S A;  2KFD A;  2KDZ A;  4HBL A;  4LGW A;  1T8I A;  4RM2 A;  5DCM B;  2BXZ A;  1MBF A;  3WG9 A;  4ZDO A;  2ZFU A;  3TW6 A;  1OYI A;  5ICG A;  1KYZ A;  3HRS A;  5LHH A;  1UG0 A;  4C2T A;  3V7R A;  1XGO A;  3PO3 J;  1M1E B;  3ZP5 A;  1YS7 A;  2QKL B;  3CF5 F;  2XSJ C;  4B3A A;  4BJ6 C;  3LSP A;  3KEY A;  4PGH A;  5ICF A;  4S05 A;  1AWC A;  1LEB A;  5BOX A;  3OYK A;  2ICW G;  3HG9 A;  2GQQ A;  5DM7 F;  2EZH A;  1IG7 A;  3L2V A;  1W4M A;  5LEJ A;  1YRN A;  3JAM K;  2AO9 A;  3NAU A;  4BBR J;  2MC4 A;  4CSW A;  3FXK A;  2ZO4 A;  2QBY A;  3K4B A;  1V4R A;  1WKM A;  4YIF A;  1T2K A;  2NOG A;  3TP3 A;  4P96 A;  2OTJ I;  4EGY A;  2E1N A;  1W5S A;  2P5V A;  2VON A;  4EMS A;  2VBZ A;  3M3Y J;  1YOV B;  4M3B A;  2K5C A;  3D5L A;  5HLG A;  1V5G A;  4Q5S F;  2A5Y B;  2ESN A;  4HLX A;  3LSI A;  1KA8 A;  2VPL A;  5AON A;  5FLM J;  3MWM A;  1MMD A;  3BPV A;  1YFH A;  5L3C A;  2K3F A;  4CCO A;  1VQN I;  3K70 D;  5D4S A;  2JSC A;  2PMZ A;  4CYC B;  4A3J J;  1AKH A;  2CWE A;  3CLO A;  4XK4 A;  3FXJ A;  2L9V A;  2P6T A;  3U21 A;  2FU4 A;  2MAB A;  2VUM J;  5CPR B;  1JUP A;  4KIC A;  1E17 A;  4GYG A;  4AC0 A;  3L1P A;  2RQP A;  1ZRE A;  2LDU A;  3AKZ A;  2GXG A;  4PJM A;  1W7P A;  4XLP F;  3W6J B;  3GTL J;  2KIS A;  4Y3O A;  2DT5 A;  4IQJ A;  3S17 J;  2JA8 J;  3RZD J;  1U5T C;  1WJE A;  1QVT A;  1IGN A;  4OIR F;  3VB2 A;  4MFE A;  3K4M A;  2FEZ A;  1PVE A;  2MSY A;  3BRO A;  1S7E A;  4DBQ A;  2L5Q A;  4YG2 F;  3S15 J;  2VPR A;  2JWT A;  4Z2Y A;  2XC7 A;  1S7A A;  1FYM A;  1D1B A;  1LPQ A;  2CV2 A;  3WOD F;  3EDP A;  1H9T A;  4DYC A;  3I59 A;  3RIR A;  2IBD A;  3M1C A;  1Y0N A;  2QQA A;  3KX2 A;  1SVL A;  2E60 A;  4N4N B;  4HQM A;  3PNV A;  4NNJ A;  3S2W A;  4G7Z F;  4HAM A;  4PCQ A;  2L4A A;  3ABL H;  1TW2 A;  4MEX F;  4Y15 A;  4JQF A;  4XNF A;  1D0Y A;  1G8X A;  4XKW A;  4ZYE A;  2CV0 A;  1I27 A;  5FKK A;  4AIJ A;  3JCU C;  4ANJ A;  2RV8 A;  2Y9Y A;  2ISZ A;  1HST A;  3WHC A;  1RR7 A;  3GLL A;  3G3Z A;  3H1C A;  5JI6 A;  1Z21 A;  5LLQ A;  3BG6 A;  3H36 A;  4UB6 C;  2VOO A;  1WVR A;  3OL3 A;  2YPR A;  3P9K A;  5E8I A;  2HI3 A;  4QLC U;  2ISY A;  5KCM A;  4KUM A;  4YEJ A;  4Y13 A;  3J80 Z;  3IKT A;  3MD2 A;  4BDY A;  1FOK A;  4Q48 A;  1TWF J;  2KHM A;  1NK2 P;  2EV0 A;  3V42 A;  2KZG A;  4IXA A;  1MNE A;  3K2A A;  4M9Z A;  1SVM A;  3J81 K;  3HDD A;  4NHJ A;  2AXL A;  4GGG A;  5HNH A;  1G6N A;  4MQV A;  5GPC A;  3FKJ A;  1PUE E;  4BYY A;  3W6V A;  1XGS A;  2IS6 A;  3S8P A;  1VZ0 A;  2FBI A;  3HKZ A;  4IKF A;  1I39 A;  4ZYA A;  1R9T J;  3LA3 A;  1X4P A;  3BLY A;  4LIV A;  1WGX A;  3QP5 A;  1IF1 A;  1USS A;  3TO6 A;  3IWZ A;  2FQ4 A;  1EH8 A;  4A93 J;  3GFL A;  3I58 A;  1KGS A;  3DTI A;  4FAS D;  5J1U A;  1HLV A;  4BXU A;  4E7J A;  4KYW A;  3CCV I;  2Y31 A;  1Z91 A;  4IF4 A;  3G6E I;  2OZU A;  2IA2 A;  1MMN A;  4HQE A;  2O0Y A;  2DMU A;  4PJN A;  4ITV A;  1DU6 A;  2L9S A;  2EK5 A;  1PYV A;  2DI3 A;  4L5E A;  2ECB A;  5GP9 A;  4CYC A;  4DOZ A;  4L18 B;  1IW7 F;  3CZ6 A;  3SEQ A;  4B4C A;  1BIA A;  5LRR A;  2J5P A;  3KZZ A;  4G6T B;  4G8X A;  3B6C A;  1TZL A;  1X2N A;  5IYD J;  1R22 A;  4A12 A;  2XHK A;  4BE0 A;  1IO2 A;  2M4K A;  3DU6 A;  4FT8 A;  3VOD A;  1RUO A;  1GHC A;  2COM A;  2UV1 A;  2H6C A;  2CO5 A;  3HSR A;  2QLZ A;  2HEO A;  2Y0M A;  1ZN2 A;  4XL9 A;  3MCZ A;  5LGN A;  4FTH A;  2EIK H;  2ACJ A;  3RPQ A;  1KQ0 A;  1T98 A;  2IGK A;  1J0R A;  1Z0X A;  3CCU I;  3REO A;  2QGU A;  1XSV A;  3IKV A;  4A3D J;  2CG4 A;  2H1L A;  2LD5 A;  5FKM A;  3PFY A;  4F3Q A;  2KJB A;  1ENH A;  2OD5 A;  3H3Z A;  2R3S A;  2ZFW A;  3BTI A;  3KCC A;  1X2M A;  2I8D A;  5DUI A;  1VTN C;  2CQN A;  3MZ8 A;  3WTX C;  3JRC A;  1J75 A;  4IVN A;  3MQ0 A;  3DEU A;  2V26 A;  3SZT A;  2DFF A;  4NC7 A;  3A02 A;  3QPL A;  3WTU C;  2Y9Z A;  4A3M J;  1KYW A;  2EIL H;  4D1Q A;  3PO2 J;  4IRI A;  2FOW A;  3C2B A;  2A69 F;  1X19 A;  3BTC A;  2P5K A;  3DXJ F;  5FD5 A;  1SD5 A;  4ZDL A;  1XGN A;  2W24 A;  4LB5 A;  2CW0 F;  4FQG A;  3L09 A;  5M5Y J;  4MNU A;  2K9M A;  4QTR A;  1ULY A;  3SYT A;  4G7O F;  2VBX A;  4XSZ F;  4NC8 A;  1YTY A;  2DDA A;  3O3K A;  3ZMZ A;  4B44 A;  2HDD A;  1TNT A;  2CFX A;  4XSX F;  3A01 B;  1X1B A;  1YE9 A;  2GA1 A;  3O2P E;  5GAG J;  2M0C A;  3OYC A;  3BG3 A;  4M74 A;  3PL8 A;  5DCF A;  1FSH A;  5JFR A;  3SZG A;  2AHQ A;  2MA3 A;  3CJQ B;  2R93 J;  3QQA A;  5EEA A;  1FBS A;  2XRL A;  1EH6 A;  3S3M A;  2K9S A;  3CP8 A;  3D0S A;  2DFH A;  1HW5 A;  4PK4 A;  2BW3 B;  2FBK A;  3ZOB A;  2MG4 A;  2RN7 A;  3R61 A;  3RSN A;  3M1E A;  2K4B A;  4S04 A;  3F6O A;  3JW4 A;  1OCP A;  2XRO A;  3T8T A;  1T39 A;  3JSO A;  4EAT A;  1R49 A;  5L3G A;  1SD4 A;  2WBM A;  1G3Y A;  1ETK A;  2HQN A;  3TED A;  4F7Z A;  2OBP A;  5CQE A;  1RES A;  3S32 A;  1MSE C;  2M45 A;  3ABT A;  3HRM A;  1UHW A;  3AG3 H;  1XSD A;  3FWE A;  3ERE D;  5HVQ C;  1I50 J;  3EYI A;  1UEL B;  2AQF A;  2R0Q C;  2K9N A;  1H8A C;  3E3V A;  3M07 A;  3N05 A;  1ON1 A;  4BGD A;  4ESJ A;  5H2F C;  5F1R A;  4U0V A;  4ZYH A;  2QZ8 A;  3VEP A;  2DA2 A;  2DOA A;  1FTZ A;  1VQK I;  3H5R A;  5BPI A;  2STW A;  2EA2 A;  2QCO A;  4PFO A;  4ZZD A;  2FF4 A;  4Q4Z F;  5C4J J;  1RR8 C;  1VF9 A;  2QVO A;  5H6R A;  1MBK A;  1L0O C;  1ZG3 A;  2F5F A;  3ZQH A;  4C2U A;  2MD5 A;  1NTC A;  1T56 A;  1YHQ I;  2NVU B;  2P81 A;  2ZSH B;  1CGP A;  4M3F A;  3BG5 A;  1ZR2 A;  3DV8 A;  2LC2 A;  1ORK A;  2JVH A;  1Y1V J;  1FWZ A;  3HRT A;  4ZYD A;  1RIO H;  4L5I A;  3FDY A;  1B59 A;  1SVO A;  5ERI A;  3KEO A;  3HSF A;  1YW9 A;  5JR3 A;  3O8H A;  2RC4 A;  2LSO A;  3ZMD A;  3N4M A;  2WAE A;  3VYT B;  2DK5 A;  1FC3 A;  5J8F A;  4ZZL A;  2HKO A;  2LKS A;  3MKW B;  1WJ5 A;  3I9V 2;  1ON2 A;  2WY7 Q;  3FK6 A;  3RPU D;  1WH5 A;  4P9F A;  3E6D A;  3GUD A;  4JYK A;  3JTH A;  2YU9 J;  3WTY C;  3J7Y J;  2GBY A;  1Z1D A;  2KRC A;  1HC8 A;  1OCO H;  1OLT A;  5GPA A;  1LFP A;  4RAY A;  4EGZ A;  4I01 A;  2W1O A;  3VDX A;  3BCB A;  5FKN A;  2EFW A;  4WF2 A;  4A6E A;  2KRF A;  4BQQ A;  1LVK A;  3GTQ J;  1SFO J;  5CJ9 A;  3KIO A;  1V54 H;  2HXO A;  4KIS A;  2VBW A;  3FMS A;  4O6J A;  3DPL C;  5K7H A;  3A01 A;  2PX9 A;  3FHN A;  5DD4 A;  2RGV A;  2BGC A;  5HS8 A;  5KVR A;  1BR4 A;  5FFX A;  2O6G E;  2DBB A;  4I2O A;  5C4X J;  1BW5 A;  2CRG A;  2Z16 A;  1F43 A;  3F22 A;  4ABZ A;  3FF5 A;  2HVS A;  2E1O A;  3F9K A;  4JP0 A;  1RUN A;  2QSF X;  1R6R A;  2K9L A;  4M9S A;  3KP4 A;  5FGM A;  2BW3 A;  4HF0 A;  3DF8 A;  1ZGJ A;  1APL C;  2XKO A;  2GXB A;  1IV8 A;  2HTS A;  2HYJ A;  2LY9 A;  4KIB A;  1T08 B;  1D1C A;  1TP4 A;  2BY0 A;  2OCC H;  2E1C A;  1LFB A;  4OOI A;  2VQH A;  3DEW A;  1R1V A;  3I0T A;  3W2V A;  4DNC A;  4LD5 A;  4M3D A;  1JUM A;  1ONV A;  2EFP A;  3TKY A;  2P5L C;  2RQQ A;  1S8N A;  3IH2 A;  1R5G A;  1BI0 A;  4XLA A;  1BOA A;  4PDK A;  1FEX A;  4CYD A;  1DPU A;  4MGR A;  4D9J A;  4LG0 B;  4C3H J;  3E97 A;  3COA C;  6PAX A;  2DMT A;  2TDX A;  3L2Q A;  3JRI A;  2E7W A;  1K4T A;  1HW2 A;  3FIW A;  3OYL A;  3X2Q H;  1LFU P;  5M3M J;  3IH3 A;  2PLY A;  2ZCW A;  2F5D A;  2IVM A;  3F0C A;  5J40 A;  2D1V A;  1D0Z A;  4XQF A;  4RS8 A;  5IYC J;  3FM5 A;  5LGU A;  3GME A;  1MND A;  5HS9 A;  1I3A A;  2XAQ A;  2BE5 F;  4OMZ A;  1GV5 A;  1VND A;  3ZN0 A;  3J80 K;  3DKX A;  4XLN F;  2M1B A;  1FTT A;  3ZR8 X;  4XM3 A;  1O7L A;  5GTH C;  2FSW A;  1VQO I;  1ETY A;  1STZ A;  2V9P A;  2O9L A;  2YS9 A;  2OZ6 A;  4BQN A;  3M4O J;  3F8F A;  1U9O A;  3S2H J;  4AU7 A;  3HOT A;  2XAS A;  4AYB N;  2JA2 A;  3G1M A;  4OIP F;  4ETS A;  1V5F A;  2BHY A;  2GZW A;  2K27 A;  4XMY A;  2HFH A;  4CH7 A;  3MZH A;  5L3E A;  1P7I A;  1FP2 A;  2UZK A;  3H9Q A;  2OQR A;  4NUB A;  4UHT A;  2IXS A;  3CCE I;  2VT2 A;  3KFW X;  2VN2 A;  3KLO A;  4W97 A;  4BKX A;  4L0Z B;  3OYI A;  4IZZ A;  2M9H A;  4IPA A;  1D8J A;  4BE2 A;  4BE1 A;  3NRV A;  2ZME B;  2XPU A;  1HKS A;  2WV1 A;  1BR2 A;  3TO7 A;  1W36 D;  4LB6 B;  1J09 A;  1S6L A;  1HF0 A;  2KLO A;  2XGC A;  2R7X A;  1JTY A;  1ZHF A;  3CMY A;  1XDU A;  4XBF A;  4CCN A;  5GAH J;  4N4O B;  2BHZ A;  3SEZ A;  4BH9 A;  1U3E M;  1JGS A;  2HDC A;  2K02 A;  3Q5F A;  2X1D A;  1ZAR A;  3K4K A;  1NH3 A;  2DLL A;  1DP7 P;  5ICC A;  3DFG A;  2E35 A;  2M8G X;  4Z6Y A;  2MLK A;  2BV6 A;  4MFD A;  2ZME C;  2BXY A;  1EF4 A;  3GLX A;  1OKR A;  2RKH A;  5TRD A;  3PNT A;  3F8M A;  3I56 I;  2DTR A;  4OWR B;  3HOW J;  1N78 A;  3BQZ A;  3GYH X;  2PFB A;  3K2Z A;  4MTE A;  2X1C A;  4DJA A;  2FJ1 A;  1ETV A;  2R7T A;  2GAU A;  5JHU A;  4BDZ A;  1E0E A;  1DGR M;  3DEE A;  1JJ8 C;  3PIO F;  3H3V K;  4A0Z A;  1D5V A;  4QPO A;  1LDD A;  1FMW A;  4I7H A;  3HUG A;  1XG1 A;  3ULQ B;  4AM3 A;  4IOC F;  2KMU A;  1R4M B;  4HX4 A;  4LMY A;  1TWA J;  2L7Z A;  2O7O A;  1UHS A;  4LG0 A;  4BXF A;  1BR1 A;  4IQ4 A;  4U7B A;  3EET A;  3QP6 A;  3FM3 A;  5HLT A;  5H6Q A;  1O3R A;  4LLL A;  1X1A A;  3ABK H;  4XLH A;  1U6G A;  4JK1 X;  1VQP I;  1YO5 C;  4OAZ A;  3CMM A;  3HPH A;  3JRG A;  2W82 A;  1BN5 A;  2VC0 A;  5J6X A;  2O61 A;  4XLF A;  2AQE A;  4I6Z A;  4ESB A;  2EZL A;  3S1R J;  1H89 C;  1GLN A;  3K0L A;  3TOA A;  2DU9 A;  3ELK A;  3HZJ A;  2LBF B;  2W84 A;  1FOW A;  2VI6 A;  4PUS A;  4BJT A;  2HKX A;  4ZTJ A;  3S1N J;  1YG2 A;  3SJM A;  4PJJ A;  1Z67 A;  2ESH A;  3FXM A;  1D1A A;  2R7Q A;  1MBG A;  2NVX J;  1X3W B;  1D0X A;  2Y69 H;  3QYB A;  2KJC A;  4PSX A;  3DTK A;  2DA7 A;  1YIJ I;  3ABU A;  5ED4 A;  1K4S A;  2KIU A;  1CF7 B;  4ZDP A;  2CS3 A;  3PNY A;  4WCG A;  1LNW A;  3KP5 A;  1YX5 A;  4IRH A;  3D1N I;  1F1Z A;  3NWT A;  2MH2 A;  3V8K A;  2EFO A;  4AWX B;  2M30 A;  2DW4 A;  4AVZ A;  1MJB A;  2OUM A;  1V3F A;  2PQ8 A;  2ZB9 A;  3TMO A;  4P9U A;  3JRE A;  3IRQ A;  4QWQ A;  1Z6R A;  1S72 I;  4Y7N J;  3MEX A;  2L02 A;  3OR2 C;  2ZME A;  3HGY A;  4HX8 A;  1S5L C;  5EZH A;  4BEH B;  2I5U A;  1Y8Q B;  4FE7 A;  5JVT A;  4AIK A;  3U1K A;  3AAF A;  4BAC A;  3CO7 C;  4B1R A;  2EV5 A;  4G7H F;  2L9R A;  5FLX Z;  4IHV A;  2CQQ A;  3BR6 A;  3S16 J;  2DCE A;  2LVS A;  2OA4 A;  3TO9 A;  3K4L A;  5AIP A;  5F6F A;  3Q0W A;  4GDF A;  1SFX A;  1NK3 P;  2PBI A;  4OIO F;  5F04 A;  3CCY A;  1MMA A;  3D5S C;  3LFU A;  5IPA A;  1Z6T A;  5CVR A;  3BR3 A;  3WTS C;  1LE8 B;  1A36 A;  1XMA A;  1J2X A;  3AG2 H;  3SXY A;  2Z2S B;  5D5V B;  3I4N J;  3GFM A;  2F4M B;  1XPX A;  4XON A;  1J9I A;  3HB9 A;  2ZJ2 A;  2VLA A;  2QKM B;  3F8N A;  5ILS A;  4UUS B;  2Q2E B;  5F64 A;  1Y0U A;  2TRT A;  5IY5 H;  1JT6 A;  2WB1 N;  2OAZ A;  2KDO A;  4YFK F;  3E5Q A;  3F6V A;  2WWY A;  2EFN A;  2PJP A;  2DQL A;  5K1Y A;  1EJ9 A;  3KYD B;  2V9V A;  2X4H A;  3ZMU A;  3S14 J;  2DJN A;  3NEU A;  4RGU A;  1U0J A;  4R79 A;  2B9S A;  1YYV A;  2R7U A;  2R7Z J;  4NDL A;  2CMP A;  3LSM A;  3M8E A;  4LIT A;  1PJR A;  2A6E F;  3GF2 A;  2LG4 A;  1IUF A;  1QZZ A;  3ZXS A;  2E2I J;  3CCR I;  4E7I A;  2CQX A;  3WTW C;  4A3L J;  3OYB A;  1P92 A;  1BJZ A;  3RJP A;  3BG7 A;  4M6Y A;  2EIJ H;  1JHH A;  2P8T A;  2QYO A;  2XKP A;  4XRF A;  3H35 A;  1YIT I;  2HGC A;  3BJA A;  3OL4 A;  2ME6 A;  5HOO A;  2X6O A;  5E17 F;  3HPG A;  3LSK A;  1SD7 A;  3QWL A;  1QO0 D;  3LWF A;  2HU9 A;  2HNH A;  1UJ8 A;  3BJO A;  1Z3Y A;  4HNU A;  3OS0 A;  1O3T A;  1ZH5 A;  1A6I A;  1I6H J;  1YIO A;  2JA6 J;  1R58 A;  3MKL A;  4WK8 F;  2R7S A;  1HQC A;  1XC5 A;  5DCM A;  2ELJ A;  3RI4 A;  1IUY A;  1XGM A;  1LDK B;  5L3B A;  1B9M A;  4HDV A;  1FJL A;  1R4N B;  1ETQ A;  5D8K B;  4B8X A;  3OYN A;  4A5N A;  1IDY A;  1Z05 A;  3FXQ A;  1JT0 A;  1VQ8 I;  1CF7 A;  3I55 I;  4EJO A;  3BZK A;  1H88 C;  2IS1 A;  2XDV A;  3GWZ A;  3F23 A;  3JRF A;  2QWW A;  3ROU A;  4KNY A;  4KDP A;  3FK7 A;  2CSO A;  3T1B A;  3BY6 A;  5F08 A;  4RAG A;  3EQL F;  2Z3Y A;  2UUZ A;  4MIM A;  2Y0S N;  1FBQ A;  2M7B A;  2V6E A;  3BTJ A;  1H9G A;  2F5V A;  2CW8 A;  1W5C C;  5J4V A;  2RNG A;  4R8H A;  2IW5 A;  4KJZ A;  3CJR B;  5KHD A;  4HLY A;  4V2F A;  1W7P D;  2XAG A;  1MJ9 A;  3FX3 A;  1VQM I;  4I76 A;  1ZG5 A;  3OOU A;  2JVG A;  4EJU A;  4ZJZ A;  2FA5 A;  1ITY A;  1IZ1 A;  4ENJ A;  2UXX A;  1QU3 A;  1X58 A;  4BHC A;  3DP7 A;  5DM6 F;  3B02 A;  2Q0O A;  4DYR A;  1JE8 A;  3PUB A;  4XKV A;  2LP0 A;  4RB1 A;  3U2R A;  3E7L A;  3EUH C;  1RRJ A;  4FIS A;  3WHB A;  1LE8 A;  1AOY A;  1MMG A;  3S3N A;  2JTV A;  1G4D A;  5GAE J;  1OMI A;  3IAM 2;  3FXR A;  4XOP A;  3WU0 A;  2ZSI B;  2XUB A;  2R4G A;  4F55 A;  3K10 A;  2LOO A;  2MLG A;  1FPQ A;  4V19 K;  1ODD A;  1IN7 A;  4UUS A;  2Q2E A;  5E79 C;  3BPX A;  1BJA A;  4A3C J;  2JQ7 A;  2CYY A;  1R5I D;  2Y48 A;  2HQ5 A;  1E3P A;  4DBR A;  4U0Y A;  1JKO C;  3Q0V A;  3T5X A;  2K86 A;  4U87 A;  1UB9 A;  2ID6 A;  4PZJ A;  4XKB A;  2JJ7 A;  4XIC A;  3K6G A;  1WJF A;  4C2M J;  2VJI A;  3WG7 H;  1XCV A;  2LFB A;  4NQW B;  4PFP A;  3KE2 A;  3MKZ A;  4LOC A;  4V2G A;  3CCM I;  2QSG X;  5FO5 A;  2K3P A;  2FMY A;  1JI8 A;  4HOB A;  2DXI A;  1DUX C;  3RCO A;  4PJL A;  4YFX F;  1FY7 A;  3R0A A;  3BDD A;  2IS4 A;  4IRG A;  2F2E A;  2DYS H;  3DBR B;  2V9K A;  3G1L A;  2NS8 A;  5FLV A;  1XX5 A;  3W6K B;  2Z99 A;  4IOA F;  2VJ4 A;  3DWL E;  1LQ1 A;  5HDN A;  2HDW A;  2HOA A;  4J00 A;  1SMY F;  4HX7 A;  2XB5 A;  3OR1 C;  2W4S A;  3GXO A;  3ZQQ A;  1IN8 A;  4L0Y B;  1P6R A;  3HTU A;  1ZQ3 P;  2R7O A;  3ERM A;  1KON A;  1QNT A;  3CDH A;  4JX4 A;  1LEA A;  1SAX A;  2V1N A;  3KYC B;  2LRD A;  3I54 A;  1WJD A;  4MQ9 F;  2Z1D A;  1ZRC A;  4BXX J;  4P55 A;  1T95 A;  3LA7 A;  3L2C A;  3JR9 A;  4IJA A;  1W0U A;  5D6F A;  2PI0 A;  1R71 A;  4YRV A;  2B0L A;  3V7C A;  4HNT A;  2DDB A;  1FNN A;  1QRY A;  4ESF A;  5E8G A;  2QEX I;  1R23 A;  2WC2 A;  3EUH A;  2P4W A;  2TCT A;  1MW7 A;  3PQJ A;  3HC7 A;  1GXQ A;  3CUO A;  3KZY A;  4M3G A;  3CME I;  3VYS B;  1Y8R B;  1WSU A;  4A3G J;  2DMP A;  5EF6 A;  1OIS A;  1S7O A;  3LSJ A;  1SMT A;  4YFN F;  1SAU A;  2OC6 A;  3H9G A;  4M71 A;  4RB0 A;  1O57 A;  1RZ4 A;  1DPR A;  2HXI A;  4B3X A;  2B63 J;  4II3 A;  1TQM A;  1FIP A;  1XMK A;  1BL0 A;  3AG4 H;  3A0H C;  4UVA A;  1VQ5 I;  5CKT A;  3B6A A;  1TTY A;  1OYY A;  4C9Y A;  3GFI A;  2L01 A;  2KQR A;  2RRE A;  4B09 A;  2LK2 A;  1HBX G;  1OQY A;  3ISP A;  2WAF A;  3E6C C;  4H0E A;  3GTK J;  3OSG A;  2E36 A;  2ZNZ A;  2NXN B;  4C3I J;  4LFU A;  3VSL A;  4S0H B;  1IV6 A;  3OIO A;  2QQ9 A;  2IGO A;  1FMV A;  4MHG A;  2L7M P;  2F4O B;  3FBN B;  4F93 B;  4I09 A;  2Q1Z B;  1FOY A;  1BC8 C;  2B7E A;  4Y33 A;  4AD9 A;  1BOB A;  2LTP A;  3SFZ A;  5M3F J;  1TQP A;  2DOE A;  2WAQ N;  4E70 A;  3DLL F;  2VOP A;  1ZG1 A;  3OYJ A;  4UVC A;  2KL4 A;  2N8G A;  1KU7 A;  2DT7 B;  1ZKG A;  3BC8 A;  3RKX A;  4AUX A;  1WHU A;  5LFA A;  2X1E A;  1P4W A;  4ENK A;  2DPU A;  3CD6 I;  4I98 B;  3L2W A;  2AS5 F;  2ME0 A;  3R0J A;  5L3F A;  3M7G A;  1UFM A;  2OJE D;  1MD0 A;  2W85 A;  3I71 A;  1POG A;  2BY3 A;  4IHS A;  2MYS A;  4YEL A;  3J7Z I;  2XB0 X;  3S3O A;  4M6V A;  4WXD A;  1A5J A;  3AFH A;  3CES A;  3H5A A;  4BHP A;  2DJI A;  5J1R A;  4G12 A;  1I6X A;  2NS7 A;  5DYM A;  5F0C A;  1TBX A;  5FLX K;  1RET A;  2XPV A;  5FD6 A;  3ASO H;  5D6E A;  2YSR A;  3QPS A;  3I3L A;  1KQ8 A;  2IS2 A;  1SFK A;  1ZGW A;  3OIQ A;  1R7J A;  4BUP A;  3GZ5 A;  3PFI A;  4HPQ A;  2FUG 2;  3FMQ A;  2V6C A;  4A3K J;  4LJZ F;  2MH9 A;  3LQQ A;  4DYQ A;  3OYM A;  3A03 A;  3ZPL A;  4KN7 X;  2DA6 A;  3SZP A;  3GTM J;  3D5R C;  3IHU A;  2ECC A;  4DW6 A;  1SFU A;  2BVM A;  3VWB A;  2F48 A;  2EV6 A;  1TWG J;  2XIG A;  2E1M B;  3H92 A;  3VFZ A;  1HA8 A;  1OPC A;  1ZK8 A;  5E18 F;  2XAU A;  3WE2 A;  3WTZ A;  1W0T A;  1FIA A;  4L9N A;  2A6T A;  1OFC X;  3CUQ B;  3PSF A;  4BHB A;  2DPD A;  2Y30 A;  4WWC A;  2X85 A;  3GTO J;  4QSH A;  2O8K A;  3K1N A;  1Z3X A;  2EFQ A;  3NQO A;  4CCL A;  2K85 A;  2BZT A;  5KAI C;  5LGT A;  3ESW B;  3WTV C;  4IEJ A;  3QYF A;  5JVG F;  1FZP B;  3IC7 A;  1X4O A;  2HPI A;  3Q3S A;  2QQB A;  5CYV A;  2E1M C;  1IC8 A;  1J59 A;  1FOX A;  5LD2 C;  3KP3 A;  2I10 A;  3U1D A;  3KLN A;  3Q9V A;  4CZZ A;  5BNG A;  2V79 A;  2A68 F;  1O7F A;  4HEA 2;  1WZ2 A;  5JHF A;  3HOS A;  1O4X A;  2KKO A;  5IP6 A;  4X1E A;  2GOX B;  3MN2 A;  1PDN C;  3LA2 A;  4XRM A;  3S1Q J;  3HHH A;  2FQ3 A;  1WFX A;  2JK3 A;  5CVV A;  2R7W A;  2NVT J;  1HOM A;  3HM5 A;  4GYI A;  1MDM B;  2JA7 J;  5EG0 B;  4RAZ A;  1B4A A;  3I5U A;  2LF8 A;  4UV8 A;  3CC7 I;  2VQL A;  2DTZ A;  3G2B A;  3CCS I;  1VQL I;  3F21 A;  2M87 A;  1XD7 A;  2IT0 A;  3JRA A;  1G3S A;  3CDI A;  4TV7 A;  3QOP A;  2A05 A;  2CH0 A;  2WTE A;  3T8R A;  1RKW A;  5K5Q A;  4BS9 A;  2FRH A;  4Y17 A;  1SAN A;  1MBH A;  1BI1 A;  4LK0 F;  5E3N A;  5HNF A;  4EJW A;  1B9N A;  3OYH A;  4L9T A;  3EUA A;  5DDG A;  1IRZ A;  3CF2 A;  5GTI C;  1YW8 A;  1X1P A;  4WXC A;  2BY1 A;  1A31 A;  2H6B A;  1JKQ C;  1X3U A;  5M5W J;  3K70 C;  3PQK A;  4C30 A;  2DFI A;  3I4M J;  3IRR A;  4YIR X;  3C1D A;  2ZJP F;  2M3A A;  1OCR H;  4M3E A;  5E3L A;  3SDG A;  5B5E C;  1W5T A;  2X6W A;  3HBL A;  1AHD P;  4LIU A;  1F9N A;  3RYP A;  1DGW Y;  4CXF A;  2STT A;  1O3Q A;  1U2W A;  4ZH4 F;  4HNV A;  4A2U A;  2HOE A;  2H09 A;  2ELK A;  3LOC A;  2E71 A;  2MD0 A;  3A0B C;  5AIQ A;  1UAA A;  2CU7 A;  3BJ6 A;  5DUK A;  2D2W A;  2DN0 A;  2R5Y B;  2HOS A;  1W1W E;  4RB2 C;  2XVC A;  3EYY A;  4B48 A;  1TT0 A;  3DQV C;  1QBJ A;  1AA7 A;  5DV5 A;  5HLI A;  2H1K A;  3QU3 A;  2VKV A;  5J1Y A;  4U88 A;  4A6D A;  2CUZ A;  3CMA I;  2LYC A;  2GIZ A;  2DO7 A;  2M34 A;  2Y75 A;  5CVJ A;  4EM1 A;  1BC7 C;  1DU0 A;  1HW1 A;  3TP0 A;  2OV7 A;  2PMZ N;  4BJ5 C;  3FXU A;  3C18 A;  4WX9 A;  5CVI A;  1YI2 I;  4RDU A;  4EQQ A;  1T0F C;  2YX4 A;  4UV9 A;  1NG7 A;  1P9Q C;  3FMR A;  5LEK A;  2G0E A;  2LNB A;  2JRM A;  1TWH J;  2ID3 A;  3GEZ A;  3G1O A;  4EM0 B;  3OYE A;  1MIJ A;  1AKH B;  3R4K A;  4KT5 C;  2IRF G;  2KIF A;  2IGN A;  2VBY A;  1DDN A;  1G3W A;  3MVP A;  3KP6 A;  5D5U B;  1Y56 A;  2NYX A;  1N25 A;  1WRJ A;  5F0H A;  2NNY A;  3K69 A;  3K1M A;  5HOD A;  3E1S A;  3MAJ A;  1LKX A;  1F36 A;  1LDJ A;  2PEX A;  1I1S A;  4KIG A;  2QF7 A;  2Z33 A;  3DCF A;  1SEU A;  1JXS A;  1QZE A;  4CZC A;  4G9Y A;  3M9A A;  4QIW N;  2K4J A;  3IV5 A;  1HSJ A;  3V8L A;  5FB2 A;  4B47 A;  3BR5 A;  3IP4 B;  2CFO A;  3H0D A;  4HF2 A;  1ETO A;  2L9N A;  4P1W A;  1TQI A;  4XR6 A;  1QGP A;  4G94 A;  5FKL A;  2VE8 A;  4HRI A;  5EG0 A;  2EBI A;  3LST A;  3GZ6 A;  1IN4 A;  4XKC A;  4DZJ A;  2W57 A;  4M73 A;  3S93 A;  1WI3 A;  3NWS A;  2VL8 A;  4NBQ A;  2KZV A;  3A2K A;  5J4Y A;  2M4G A;  2ZNY A;  2O5R A;  2WY8 Q;  2HVQ A;  1Y6I A;  1R00 A;  4OAY A;  4JX6 A;  5ILU A;  4X6A J;  4XLE A;  4A3B J;  5J47 A;  2G7H A;  3ASN H;  2G9W A;  1VQ7 I;  2HOT A;  3Q0U A;  4YII A;  1YJ9 I;  1T33 A;  2M8E A;  5KK1 A;  4KFC A;  2X0L A;  1Z7U A;  3HYI A;  2FE3 A;  2OU2 A;  2VC1 A;  1ETX A;  2L4M A;  2AXT C;  3HSE A;  2VKH A;  1IRF A;  3GZN B;  4OIQ F;  1ZLK A;  4AYB A;  4F91 B;  4J19 A;  2A61 A;  3F8B A;  4EEF G;  3LSH A;  1B6A A;  1ZAO A;  3MKY B;  3P9C A;  2PG4 A;  3G71 I;  1QHH D;  2KIQ A;  1QQI A;  2GM4 A;  2L2O A;  1DQU A;  4KIT B;  1E3H A;  5EJC A;  4N0B A;  1MH3 A;  2HS5 A;  3HKZ N;  4EVI A;  2RVC A;  1TNS A;  4UVB A;  2O8X A;  5E1X A;  1T0F A;  4E7S A;  4NC6 A;  3H0G J;  1AU7 A;  3W2A A;  2HR3 A;  4NB5 A;  1WCM J;  3A1Y A;  2R5Y A;  4ZYG A;  4O5V A;  3AL0 B;  4Y52 J;  1OCC H;  5LRS A;  3J7A Y;  1XN7 A;  2XV4 S;  2A3S A;  3EUK L;  4LLG F;  3L2R A;  4PJ0 C;  3GO5 A;  3RYR A;  3RQ4 A;  2IP2 A;  2BVL A;  2V1D A;  4E7K A;  4A0X A;  3DU5 A;  5E20 A;  1VQ6 I;  4KMF A;  3OIP A;  1XDS A;  1S9H A;  1NG6 A;  4BY7 J;  1UG2 A;  4FX0 A;  1U5T B;  5M5X J;  1A6Q A;  3K4J A;  3DKY A;  3QPH A;  4HV6 A;  1BI2 A;  2GWR A;  2VB6 A;  3CCL I;  3ZCO A;  4O3M A;  3HRU A;  1XCB A;  1E2X A;  3AL0 C;  2C6Y A;  1Z77 A;  1V55 H;  1YX3 A;  2LH9 A;  3LAP A;  2R7F A;  3ZQG A;  1IXR C;  2M0M A;  3ML6 A;  4XOR A;  5EGO B;  4JOM A;  2Z5U A;  1FBU A;  1GT0 C;  4CHU A;  1HKQ A;  3ECH A;  2E34 A;  2DQR A;  1JHF A;  3S2D J;  5F0F A;  1Q1V A;  3R60 A;  2UXN A;  3FKI J;  3HOZ J;  3E6M A;  3MMY B;  1B72 B;  2HTJ A;  3HXL A;  1BBY A;  2EZI A;  2XSD C;  3BZC A;  3OYG A;  2X9D A;  4RGX A;  2X6Y A;  2W7N A;  5E1W A;  2CUF A;  1KQ9 A;  3H5N A;  1P4X A;  5IT9 K;  4BY1 J;  4L9J A;  1MSF C;  3A4C A;  2W00 A;  1EKE A;  1RKT A;  2XF7 A;  3K4C A;  5FJ8 J;  5L3D A;  2JUG A;  2LBF A;  4OU0 A;  2HZT A;  3L2U A;  4QPQ A;  3GTG J;  3JSP A;  4GO1 A;  4RM3 A;  3PJR A;  1B1B A;  3R6S A;  3OYA A;  3GX4 X;  3RKW A;  2YU3 A;  4FET A;  3E5X A;  3C2G A;  2F4I A;  3CJN A;  2HZD A;  4CCM A;  1ACI A;  3HEF A;  5TJJ A;  3O6B B;  5B1B H;  4CGZ A;  3SHF A;  2KP6 A;  4GXO A;  2HYF A;  2CQK A;  3HJE A;  3BOQ A;  1ZRF A;  2H8R A;  4RB3 C;  1VI0 A;  1WJB A;  3AG1 H;  3DBH B;  2P0W A;  2FNP A;  3HL2 A;  2LKX A;  1BIB A;  3V8J A;  5E3M A;  4OIN F;  4JX5 A;  3OWT A;  2DA5 A;  3LMM A;  2K7L A;  3RQI A;  3OSF A;  4E7H A;  1SFE A;  2DA1 A;  2VXD A;  4BEH A;  2NRA C;  2L3D A;  2J5O A;  2MBF A;  1JGG A;  1IXC A;  3OS1 A;  3K9T A;  4XOT A;  1HKT A;  3LFK A;  3TQN A;  3JTG A;  1Y1W J;  1OJL A;  3IAS 2;  2ETH A;  3KPH A;  5KAF C;  3CCJ I;  4RMN A;  1S29 A;  2FML A;  2KT0 A;  3V4G A;  3HOU J;  3LSG A;  1ZLJ A;  2FD5 A;  3GW2 A;  1YW7 A;  2K9Q A;  1U9N A;  2W48 A;  4U0W A;  4E6K G;  4GCV A;  1S3J A;  4FE4 A;  3CC2 I;  1R36 A;  3UKG A;  1WJA A;  5KNL A;  3RKQ A;  1TW3 A;  5C3E J;  4BU2 A;  2GXA A;  1NHA A;  2CJJ A;  3ONQ A;  5HS7 A;  4FCY A;  1CQT A;  4UY8 I;  4FHT A;  3DLA A;  3LAJ A;  2DMN A;  1U5T A;  2XGX A;  2DK8 A;  1FSE A;  4PSW A;  4A3F J;  4F92 B;  4BBS J;  4II2 A;  3E0J B;  2V1X A;  4IHW A;  3G4S I;  5CLS A;  4D5C A;  2ADU A;  2FX0 A;  2IPQ X;  5IYB J;  4CIC A;  1XMX A;  2LY1 A;  2JT1 A;  3TW7 A;  5EGO A;  5DD8 A;  5EZG A;  5LBQ A;  2HQA A;  2CUJ A;  2WB1 A;  2P7V B;  1IXS B;  3FZV A;  3W3C A;  4IHT A;  1ETW A;  4RBO A;  5LHG A;  4MO7 A;  2E7X A;  5A2Q K;  3HTS B;  1LJ9 A;  1B72 A;  4XN0 A;  3I64 A;  3GVA A;  1GXP A;  2WAD A;  5FRO A;  2COB A;  5CQG A;  1JJ6 C;  2VQG A;  2JRT A;  4F52 A;  4KN4 X;  2GOM A;  1QVU A;  3M8J A;  3BR0 A;  4UB8 C;  3BP8 A;  2V1U A;  2Z9O A;  3O8G A;  4D7N A;  3IL2 A;  3QOE A;  1JUS A;  3DKW A;  5TIS C;  1E3O C;  2HVR A;  4E7L A;  5K5R A;  1YQA A;  2H94 A;  2GLO A;  4KMU X;  1G2H A;  2HYG D;  2DT6 A;  4IO9 F;  4CCJ A;  4AIH A;  3KP2 A;  1K83 J;  2BOL A;  4I99 C;  1P7J A;  2PMH A;  1EH7 A;  4UXN A;  1UST A;  1Z9C A;  3BCA A;  3GCM A;  1B8I B;  2LRE A;  1GV2 A;  1IJW C;  3QYE A;  4Q47 A;  2DOF A;  2JPB A;  1GUU A;  4P5O A;  2R5Z B;  3H3U A;  1OCT C;  5HDG A;  5HLH A;  3HOV J;  1MBJ A;  2H8W A;  1I5Z A;  2PN6 A;  4GRI A;  2P7C B;  3ZMV A;  5C44 J;  1YLF A;  2MC3 A;  4ASN A;  2L0K A;  3JRH A;  2XPW A;  2G7U A;  3SDB A;  2A5W A;  5D4R A;  1MZB A;  1GDT A;  3BT9 A;  3PIP F;  2OTL I;  3RKY A;  2HQR A;  4EJT A;  1TWC J;  3L7W A;  3E5U A;  3GBG A;  3I4P A;  4IX7 A;  5F27 A;  2E5Z A;  4A5M A;  2DFE A;  4BL0 B;  2ZXI A;  3NAR A;  4HV5 A;  3SFI A;  2IA1 A;  3P9I A;  5IT3 A;  5GAD J;  1XSX A;  3HGG A;  5EEH A;  3I53 A;  1XTA A;  3C3W A;  3HIF A;  2EPF A;  2Y0S A;  2X6X A;  4E4H A;  2EA4 A;  1U78 A;  4CCK A;  4W1U A;  4I0B A;  4A69 C;  1X1C A;  2Q8K A;  5ILV A;  4A0Y A;  3BZ6 A;  2L54 A;  3TGN A;  3UR3 C;  3RPU A;  1QA6 A;  4RGR A;  3DBL B;  1RPW A;  1QZY A;  1FYK A;  1H0M A;  1LB2 A;  5EEG A;  3LL7 A;  5K7F A;  2E2H J;  5ICE A;  4AID A;  4BNC A;  4XN3 A;  1D3Y A;  2OF7 A;  2EJR A;  1SC7 A;  4M9X A;  3WE3 A;  2VKD A;  5FKO A;  2D45 A;  2LF7 A;  3CDL A;  1WQ2 A;  5BMZ A;  1KZH A;  2XGD A;  2E19 A;  1K61 A;  2V4J C;  3CCQ I;  5E3O A;  2DA4 A;  3JAM Z;  1K79 A;  3ZN1 A;  4UNO A;  3TDU C;  1Q1H A;  1ERD A;  2LR8 A;  1OCZ H;  1Y39 A;  1ZYR F;  2NAZ A;  2JSP A;  5FFZ A;  3KET A;  1IRG A;  3L00 A;  2QM3 A;  2YX7 A;  1W36 C;  1TC3 C;  4X0G A;  2NVY J;  3CQZ J;  3F3X A;  4NQW A;  2RDP A;  2QQ8 A;  3FXO A;  4IL6 C;  1ZTR A;  4KT6 A;  5DEQ A;  5K7Z A;  4CO8 A;  1MH4 A;  2D5V A;  2O3F A;  2VIX A;  5LHI A;  2UWM A;  1DP3 A;  1BI3 A;  1SD6 A;  2LY2 A;  3CP2 A;  3WTT C;  4ENN A;  4ON0 A;  1QPM A;  3CO6 C;  5B66 C;  3U9G A;  4LG3 A;  4IHY A;  3PM1 A;  3OMY A;  4RA2 A;  2M2E A;  1LVA A;  2XAF A;  1WWX A;  4BQO A;  2V7F A;  2EWN A;  2VOD A;  1G3T A;  1OR7 C;  3C7J A;  3ZQI A;  3T0Y A;  2ZC2 A;  4DZP A;  5CVU A;  3CC4 I;  3BG9 A;  2X51 A;  2XAJ A;  1TLH B;  1N75 A;  5E1Z B;  1MGT A;  2NVQ J;  2E5N A;  1MMS A;  2EB7 A;  2CW7 A;  4EJV A;  3CJT B;  1F5T A;  4UUT A;  1B8I A;  4M72 A;  4Y4R A;  2CUE A;  5IT9 Z;  3TBI A;  1IN5 A;  2R5Z A;  4N9I A;  3RDI A;  5B3S H;  3WGI A;  3OY9 A;  1V5E A;  2PJR B;  1K78 B;  4KA4 A;  1P2F A;  3ZRG A;  2IEK A;  9ANT A;  2DOD A;  3WGG A;  4K2E A;  2ZXW H;  1I3Q J;  3BQY A;  1UMQ A;  4OMY A;  2XF6 A;  3C2H A;  1WI9 A;  1L3L A;  1EA3 A;  3ZQC A;  1VQ4 I;  3OS2 A;  3HOY J;  2F5C A;  1YJW I;  3FHZ A;  3S1M J;  5IP9 J; 
#chains in the Genus database with same CATH homology
 1AKH B;  3A02 A;  3QPL A;  2Y9Z A;  3VPR A;  4A3M J;  3PO2 J;  3MVP A;  3C2B A;  3ZQL A;  3BTC A;  2ME6 A;  1VFC A;  2JMW A;  2X6O A;  5F0H A;  5HOD A;  3FIS A;  1IDZ A;  1F36 A;  5M5Y J;  1PUF B;  1A6I A;  2QF7 A;  4QTR A;  1I6H J;  2JA6 J;  3DCF A;  3MKL A;  1MNM C;  2HDD A;  3IV5 A;  1XC5 A;  4QIW N;  3A01 B;  3BR5 A;  1FJL A;  1ETQ A;  2M0C A;  1ETO A;  3BG3 A;  5FKL A;  1XS9 A;  5EG0 A;  2EBI A;  1IDY A;  2AHQ A;  5DTD A;  4XRS G;  3QQA A;  1JT0 A;  2R93 J;  2RAE A;  5EEA A;  3BR1 A;  2XRL A;  4DZJ A;  5DS9 A;  1WI3 A;  2K9S A;  1H88 C;  3JRF A;  3ZOB A;  2MG4 A;  4C3J J;  3FK7 A;  4JX6 A;  4IHX A;  4X6A J;  1OCP A;  5F08 A;  4A3B J;  1U8B A;  5EYR A;  4MIM A;  2Y0S N;  3BTJ A;  3Q0U A;  2HOT A;  1T33 A;  2EZK A;  1HDD C;  3RZO J;  2K40 A;  1ETK A;  3TED A;  1ETX A;  2LLK A;  5F1J A;  1RES A;  4V2F A;  1MSE C;  2EQR A;  4D5F A;  3BTL A;  4I76 A;  3JRD A;  3OOU A;  1I50 J;  3IH4 A;  4J19 A;  2R0Q C;  2K9N A;  5JLX A;  5IOZ A;  1H8A C;  4EEF G;  1ITY A;  3GTP J;  1X58 A;  3JRB A;  1ZR4 A;  1QPI A;  3K7A J;  2GM4 A;  2DA2 A;  2OPT A;  1FTZ A;  2L7F P;  4DYR A;  1WPK A;  4MLO A;  2DA3 A;  1JTX A;  1MH3 A;  2LP0 A;  3HKZ N;  3E7L A;  4FIS A;  2QCO A;  3WHB A;  1LE8 A;  1D5Y A;  5C4J J;  1VF9 A;  1BW6 A;  1MBK A;  3H0G J;  1AU7 A;  3ZQH A;  1WCM J;  2R5Y A;  1NTC A;  4Y52 J;  1HDP A;  1T56 A;  2X48 A;  4UUS A;  2P81 A;  4A3C J;  4M3F A;  3BG5 A;  1ZR2 A;  5J3L A;  1ORK A;  2HQ5 A;  1Y1V J;  1JKO C;  3Q0V A;  1HCR A;  1YRN B;  2ID6 A;  4BY7 J;  3O8H A;  1UG2 A;  2JJ7 A;  4XIC A;  2DMQ A;  4C2M J;  5M5X J;  2EH3 A;  2LFB A;  4LOC A;  4V2G A;  2MGQ A;  3LNQ A;  1Z77 A;  3FK6 A;  1WH5 A;  3LSR A;  4JYK A;  2YU9 J;  3ZQG A;  2R92 J;  4A3E J;  2GBY A;  5EGO B;  1GT0 C;  5GPA A;  5EDN A;  3ZQF A;  3G1L A;  2NS8 A;  2E2J J;  5FLV A;  3S2D J;  5F0F A;  1Q1V A;  3HOZ J;  3FKI J;  5FKN A;  1B72 B;  1PUF A;  2EZI A;  3GTQ J;  2HOA A;  2XSD C;  1SFO J;  2XB5 A;  2HXO A;  2X9D A;  1BA5 A;  2YUS A;  2CUF A;  5K7H A;  5JLW A;  4JX4 A;  3A01 A;  3GTJ J;  1GVD A;  1ZQ3 P;  2JN6 A;  4BY1 J;  1MSF C;  4XRS A;  1RKT A;  5FJ8 J;  5C4X J;  1BW5 A;  3BR2 A;  3HOX J;  2CRG A;  1F43 A;  4ABZ A;  4BXX J;  2E1O A;  5IP7 J;  4JP0 A;  2JA5 J;  3GTG J;  2Y2Z A;  1W0U A;  3JR9 A;  5IOY A;  1JKP C;  1APL C;  4A3I J;  2HYJ A;  4D7M A;  2LY9 A;  3HEF A;  1QRY A;  1LFB A;  4GFB A;  3DEW A;  2VKE A;  2TCT A;  4M3D A;  1JUM A;  4M3G A;  3IH2 A;  1MBE A;  2H8R A;  4A3G J;  2DMP A;  1FEX A;  1VI0 A;  5EF6 A;  2XGE A;  3LSJ A;  1JKR C;  4C3H J;  4XID A;  2LKX A;  2DMT A;  5E3M A;  4JX5 A;  2DA5 A;  3RQI A;  3JRI A;  3OSF A;  2HXI A;  2B63 J;  1WH7 A;  3FIW A;  2DA1 A;  2MW8 A;  2IAI A;  1FIP A;  1LFU P;  5M3M J;  2KDZ A;  3IH3 A;  1JGG A;  3F0C A;  1Y1W J;  1MBF A;  1OJL A;  5IYC J;  1BL0 A;  3TW6 A;  2KT0 A;  3B6A A;  3HOU J;  3LSG A;  2FD5 A;  3PO3 J;  2LK2 A;  1GV5 A;  1VND A;  3GTK J;  3OSG A;  4B3A A;  2K9Q A;  4C3I J;  1U9N A;  1IV6 A;  2W48 A;  4S0H B;  3OIO A;  3LSP A;  1FTT A;  2L7M P;  4FE4 A;  1ETY A;  2O9L A;  2YS9 A;  3UKG A;  3M4O J;  2LTP A;  3RKQ A;  5C3E J;  1U9O A;  5M3F J;  3S2H J;  2WAQ N;  2EZH A;  1IG7 A;  2CJJ A;  4AYB N;  1YRN A;  3G1M A;  2N8G A;  4FCY A;  1ZKG A;  2AO9 A;  3NAU A;  4AUX A;  4BBR J;  1CQT A;  2DMN A;  2ME0 A;  2NOG A;  3TP3 A;  1P7I A;  4A3F J;  4BBS J;  1POG A;  4IHW A;  4BKX A;  4W97 A;  2XB0 X;  4M6V A;  4D5C A;  3M3Y J;  2M9H A;  4M3B A;  2FX0 A;  5IYB J;  1A5J A;  3TW7 A;  5EGO A;  5EZG A;  5J1R A;  4G12 A;  2XPU A;  2NS7 A;  5F0C A;  2WV1 A;  5FLM J;  1RET A;  1HF0 A;  2XPV A;  1ETW A;  4RBO A;  2XGC A;  4MO7 A;  3QPS A;  1JTY A;  1B72 A;  3CMY A;  4CYC B;  4A3J J;  1ZGW A;  1AKH A;  2COB A;  1JJ6 C;  4XK4 A;  1QVU A;  3BR0 A;  2VUM J;  1JUP A;  4A3K J;  3O8G A;  4D7N A;  1JUS A;  4AC0 A;  3L1P A;  1E3O C;  2GLO A;  4DYQ A;  1G2H A;  3A03 A;  3GTL J;  2DA6 A;  2M8G X;  3GTM J;  2ECC A;  4DW6 A;  3S17 J;  1K83 J;  4MFD A;  2JA8 J;  3RZD J;  1IGN A;  1QVT A;  1EF4 A;  1P7J A;  1TWG J;  4MFE A;  3HOW J;  3BQZ A;  2MSY A;  1S7E A;  1ZK8 A;  2FJ1 A;  1B8I B;  1GV2 A;  1ETV A;  1IJW C;  3S15 J;  2VPR A;  2JWT A;  1GUU A;  1JJ8 C;  1W0T A;  1FIA A;  2R5Z B;  3H3V K;  1OCT C;  1OFC X;  3HOV J;  1MBJ A;  2Y30 A;  1XG1 A;  3GTO J;  4QSH A;  5C44 J;  4DYC A;  2O8K A;  2L0K A;  1TWA J;  2IBD A;  2XPW A;  3JRH A;  2L7Z A;  2O7O A;  1UHS A;  4IEJ A;  1GDT A;  3BT9 A;  1TWC J;  3GBG A;  3Q3S A;  5F27 A;  1IC8 A;  2I10 A;  3NAR A;  3SFI A;  5FKK A;  3JRG A;  3HGG A;  5BNG A;  2Y9Y A;  4I6Z A;  2EZL A;  3S1R J;  1U78 A;  1H89 C;  3WHC A;  1O4X A;  1RR7 A;  4W1U A;  4A69 C;  5IP6 A;  2VI6 A;  4X1E A;  3S1N J;  3MN2 A;  3S1Q J;  4XRM A;  1RPW A;  2HI3 A;  3SJM A;  2JK3 A;  2NVT J;  1HOM A;  1MBG A;  3HM5 A;  5K7F A;  2NVX J;  2E2H J;  1TWF J;  2JA7 J;  1NK2 P;  3HDD A;  3K2A A;  2DA7 A;  2OF7 A;  5EG0 B;  5FKO A;  5GPC A;  3CDL A;  3W6V A;  2DTZ A;  2XGD A;  2E19 A;  3D1N I;  3JRA A;  1K61 A;  5E3O A;  1R9T J;  2DA4 A;  1WGX A;  1RKW A;  2FQ4 A;  4A93 J;  2ZB9 A;  3JRE A;  1SAN A;  1MBH A;  2LR8 A;  5J1U A;  5E3N A;  1HLV A;  4Y7N J;  2Y31 A;  1IRZ A;  1TC3 C;  2NVY J;  3CQZ J;  3HGY A;  5EZH A;  1JKQ C;  3S1M J;  4FE7 A;  5K7Z A;  5M5W J;  2DMU A;  1ZTR A;  1MH4 A;  1DU6 A;  3I4M J;  4L5E A;  2D5V A;  2ECB A;  5GP9 A;  4CYC A;  4B1R A;  2L9R A;  4B4C A;  4IHV A;  2CQQ A;  3BR6 A;  3S16 J;  4M3E A;  5E3L A;  3SDG A;  2LVS A;  3B6C A;  4IHY A;  1X2N A;  3HBL A;  1AHD P;  3Q0W A;  3PM1 A;  5IYD J;  2M2E A;  1NK3 P;  5F04 A;  3CCY A;  5IPA A;  4HNV A;  3BR3 A;  1LE8 B;  3ZQI A;  2ELK A;  3LOC A;  4DZP A;  2CU7 A;  3BG9 A;  3I4N J;  2DN0 A;  3HB9 A;  2R5Y B;  2HOS A;  2NVQ J;  4FTH A;  4UUT A;  4UUS B;  1B8I A;  2TRT A;  2H1K A;  1JT6 A;  1Z0X A;  2WB1 N;  2VKV A;  2CUE A;  5J1Y A;  4A3D J;  2R5Z A;  2LD5 A;  5FKM A;  2M34 A;  1DU0 A;  3TP0 A;  3S14 J;  1ENH A;  2PMZ N;  2DJN A;  3BTI A;  2IEK A;  9ANT A;  1X2M A;  2R7Z J;  4NDL A;  1I3Q J;  3BQY A;  4RDU A;  1UMQ A;  1IUF A;  2E2I J;  3ZQC A;  3JRC A;  2G0E A;  2CQX A;  3HOY J;  5IP9 J;  1TWH J;  2ID3 A;  4A3L J;  3G1O A;  1BJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...