2WA0A

Crystal structure of the human magea4
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
214
Chain Sequence
SGVDLGTYFQSMDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDSNTYTLVTCLGLSYDGLLNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVRYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYPSLREAALLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MELANOMA-ASSOCIATED ANTIGEN 4
publication title Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 214
sequence length 227
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01454 MAGE MAGE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2wa0A01
1.10.10.1210 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2wa0A02
2WA0A
chains in the Genus database with same CATH superfamily
5CVVA 5M5XJ 2ADUA 4LG0B 3I53A 3CF5F 3K1PA 1IN7A 3SJMA 1LVKA 2LBFA 3OYCA 3JRDA 1ZGJA 1WWXA 1Z21A 3ASNH 2M1BA 4YRVA 2DOFA 1V5FA 1RKWA 1P4AA 2F2EA 3IKTA 1SFUA 2HQRA 3H3UA 5TISC 4F7ZA 3DV8A 1FT9A 3BY6A 2FOWA 5CLSA 4PJNA 2YU3A 1SD5A 3RIRA 3NQOA 4WXDA 4C2UA 2NVYJ 1IRXA 3FF5A 2BXYA 3EUAA 4EV0A 1LDDA 1OYIA 1Z3XA 3Q0UA 3RKWA 2OCCH 1UHSA 1QZZA 4MQVA 1WQ2A 3RKXA 4ESFA 3LMMA 4EJTA 1B1BA 1IJWC 1ZR4A 1A35A 3SZGA 1HF0A 3Q0WA 3EETA 1RNLA 3EYYA 4E7KA 2UUZA 2P7CB 2DMQA 4ENNA 4BY7J 3S32A 3BWGA 3I9V2 1BA5A 3QU6A 1LDKB 3SDGA 5E1ZB 2PMUA 3CJRB 4BQNA 2L9RA 4DBRA 2KIQA 1KU3A 3W2AA 3M1CA 1ZELA 2XVCA 4BACA 4BY1J 3E6DA 2HOTA 4IHSA 4IOAF 2JUCA 1XSDA 3KLNA 1HXDA 2H6CA 2L7KA 4S0HB 2QQBA 5HNFA 4L5EA 1FMVA 1FYLA 1NTCA 2LNBA 1XTAA 3F21A 4JOMA 4AIHA 4G8XA 2CUFA 3V8LA 5L3CA 2FNAA 1OR7A 3A0HC 1KQ8A 5B3SH 1H9TA 1ZG3A 2WAFA 5JVTA 1V3FA 3IH3A 1RIOH 4M6XA 1MD0A 1XMAA 3F72A 3WHCA 1HOMA 1YIJI 4A3GJ 2E5NA 2L01A 4MHGA 2E36A 5E3NA 2XPUA 2E34A 1BJZA 3B6AA 1XPXA 1PP7U 4G12A 3GTMJ 4I02A 1D1BA 3F8FA 5DD4A 5K5OA 2GZWA 4NC7A 4AYBA 2LSOA 2VC0A 2VKHA 1ZGWA 4JYKA 4XQFA 2VUMJ 3DPLC 3E7LA 3HXLA 1Y56A 2VT3A 2JRTA 3KPHA 5JHFA 1I39A 2N8GA 2XPVA 1HLVA 1AU7A 3OYKA 1HC8A 1N78A 4ZTFA 2VKDA 1J9IA 4LD5A 1F1ZA 4KYWA 2Y31A 4CZZA 2PMZN 2COMA 5M3MJ 5E3OA 5DD8A 1O3TA 2EIJH 3HEFA 4AU7A 2HWVA 2BY3A 3B73A 1FJLA 3M4OJ 1QNTA 3DU5A 2HXIA 2EA2A 1UZCA 1VF9A 3MN2A 1O3QA 4HX8A 3R6SA 3AG2H 4Y52J 3BG9A 1FX7A 1HW2A 4HF1A 2QWWA 1HDDC 4RLFA 4BXFA 4CYCA 4GXOA 2BW3A 2W48A 5D5XB 1SAUA 3ZN0A 4HF0A 3WTYC 4IHYA 4RA2A 2LFBA 3MWMA 1FMWA 3TOBA 4I99C 2BVLA 1H8AC 2QKLB 3KP6A 1O57A 1D1CA 3A1YA 3RZOJ 5GTIC 3M3YJ 4BS9A 3WE3A 5EEGA 1KA8A 3MMYB 4DJAA 1TNTA 3BG5A 1G3YA 2QSFX 3I55I 2EV6A 3OYMA 2MABA 2NNYA 2LDUA 2XF7A 5J40A 3TOAA 2XRNA 2KIFA 3CCYA 4AIKA 2K4JA 1J09A 1REPC 1TTYA 4C9YA 4XLNF 3WU0A 1G3SA 3FM3A 2IA2A 4UV9A 1X3UA 2IS2A 4YFNF 4DZPA 5CVRA 5DCFA 3CDIA 3VYUB 2H1LA 4D0PA 2IS4A 4M72A 4QPOA 1NHAA 4AVPA 1OYYA 2LREA 4D5FA 3CP8A 1QU3A 3OYDA 4XBFA 3JRBA 3HSFA 2MA3A 2WB1N 3PSIA 3OSFA 1Z3YA 2LRDA 3OOPA 4IL6C 3GYHX 2Y69H 1HW1A 3E6BA 1JHFA 2VI6A 1P4XA 1Y0NA 1GT0C 5IYCJ 5E17F 3MVPA 3VYRB 2LP0A 5JVGF 4BKXA 3WG7H 3IV5A 1T2KA 1DUXC 4RM3A 3AAFA 3ONQA 3HSEA 3IRQA 2DA5A 3LSIA 4FASD 2FX0A 3OYJA 1QHGA 3C7JA 4LK0F 3FHZA 2WY7Q 1QGPA 1RI7A 3WU2C 4ENJA 3RKQA 3WTWC 4EM0B 5J1UA 2ACJA 1D0YA 4KMFA 1F4KA 3JTHA 2XRLA 3BPXA 3I4PA 3TO9A 3Q5FA 1YJWI 3HRTA 3FBNB 2YSRA 1BL0A 3C1DA 2R7WA 5JLWA 4XLCA 3CUQC 2OV7A 1JJ6C 1X2MA 5FKOA 4A3LJ 1SD6A 2L9NA 1WH5A 2HQ5A 1LNWA 2AHQA 3QPHA 2ID3A 2ZBKA 3RZDJ 2H09A 3H9GA 5JLXA 4U88A 3ZQIA 5BNGA 5DYMA 3C2BA 2Z9OA 4ZDOA 1E2XA 5EDNA 5J8FA 2HOAA 3S3MA 2W1OA 3F0CA 5J6XA 2CFXA 1K83J 2Z5UA 1W36D 4I98B 1W4MA 1V5GA 2KFDA 2X6XA 2E1MC 2LG4A 2VKVA 3ABTA 5IOZA 3KYDB 2ME0A 4LLNA 4BEHB 1ZTRA 3ERMA 1MSFC 1DGWY 5E8IA 3I58A 2NRAC 4L9VA 1K61A 3T8RA 3CCRI 1GLNA 4FTHA 2CFOA 3FWEA 2Q8KA 2DDBA 5GAGJ 5A2QK 5J3LA 2RN7A 4LB5A 1CF7A 4P1WA 1B4AA 1Z1DA 3V8KA 4OIPF 3EYIA 3FXQA 4OWRB 1B9NA 3S2WA 2QBYB 2CW7A 2H8RA 2BV6A 1MMGA 2EFNA 4C2MJ 1ZHFA 1Z0XA 3ASOH 2TCTA 4GO1A 5FLVA 3MAJA 1X4PA 3V7SA 1A6IA 4GFBA 3RCOA 4UVCA 1UMQA 1BN5A 4D5CA 5ILVA 1FOXA 3MQ0A 2ZC2A 4GDFA 4IHXA 9ANTA 1FBQA 2R7TA 2R7OA 3BJ6A 3HKZA 1MDMA 1QZYA 3BQYA 2NS0A 2Y75A 2E7XA 2PEXA 2QZ8A 3I59B 3GWZA 1S8NA 1GXPA 2Y9ZA 3TDZC 5LBQA 2K85A 1JT0A 1T95A 4X0GA 1J75A 1POGA 3GTLJ 5BOXA 5C44J 4IKFA 2QQAA 2OZUA 3I4MJ 4UUSB 3ERED 4UV8A 4M9SA 1JTYA 2DJNA 3D5RC 4P55A 4U87A 1WJAA 2EFOA 4BHBA 5FB2A 2YR2A 2JT1A 4Y33A 3Q0VA 3CDHA 3CQZJ 1STZA 5HLHA 2ZXJA 3ZMZA 4MQ9F 1R71A 1BW6A 4MFEA 1MBFA 3SQNA 4MLOA 1UAAA 4HX4A 2A68F 3SEZA 2NXNB 2VONA 2TDXA 4RB1A 1D0XA 4K2EA 2QLZA 1E3PA 5FD5A 3L2RA 2JA8J 5IY5H 1J2XA 2ZFUA 4BXXJ 3ECOA 3ZQFA 2RGVA 3DP7A 2VXZA 2E60A 2Y30A 4Y15A 2EK5A 1J5YA 1GV2A 1HKSA 3H35A 2VE9A 3FXKA 3ZQQA 4OMZA 5E3MA 4II3A 3G6EI 2A6TA 2RKHA 5FLMJ 4CYDA 5FFZA 3G3ZA 5FKLA 3S2HJ 1CGPA 3EQLF 2IEKA 1Z7UA 3RJPA 2K02A 1B8IA 2DA2A 2VJ4A 1DGRM 3KP4A 5ERIA 2P7VB 3Q9VA 2F5VA 2X1CA 1X1AA 1LUJB 3BJAA 4EGYA 4WXHA 3J81K 5HDGA 1F5TA 4M3BA 2DYSH 2DFIA 2V7FA 1YRNA 3RSNA 3W6JB 3QPSA 3DF8A 3ZPLA 1K6OA 2IS6A 1UG2A 1U0JA 1X1CA 1X1PA 2EH3A 2O61A 2Y48A 2VBZA 4B44A 2RDPA 2CMPA 1XG1A 4BJTA 2XB5A 4LIVA 2JA6J 2GA2A 2G9WA 1YYVA 1WJEA 1W1WE 4IF4A 3LL7A 1ETXA 2JA7J 2FOKA 1ONVA 3WE2A 3S1NJ 3LSHA 2Q1ZB 2GOXB 1TQMA 3DU6A 1T0FC 3LQQA 3KETA 1U78A 1HKTA 3FK6A 2P5VA 1BC8C 3W2VA 4XMYA 2O8KA 4I0AA 3DTIA 4U0YA 3HRSA 5LGTA 5LGNA 3DKWA 2K4BA 2LY1A 3WTXC 2XGCA 2L4MA 2CQXA 4CXFA 3OYAA 3BTJA 2DA6A 5HNHA 5IT3A 2A5YB 1HSTA 2BY0A 1SD7A 2VBWA 2IP2A 2MBFA 2ZMEB 3NEUA 3CCVI 3FM5A 4HG2A 3D1NI 3L2UA 4BUPA 1XCVA 4XKBA 4LMYA 4CO8A 2GQQA 3OWTA 4A6EA 2HS5A 1SD4A 1ETQA 3E0JB 4FT8A 3LAPA 3BTLA 2W82A 2V1XA 3PIPF 2A3SA 2MH9A 4N0BA 2VLAA 2UXNA 1O4XA 2ZJ2A 2W4SA 4BAYA 3HTUA 4XL9A 1WRJA 4KJZA 2CS3A 4LFUA 2IW5A 1J59A 4XLEA 3FXUA 2QUFA 1R6RA 4I76A 3DTEA 2HKOA 2TRTA 4NC6A 5JHUA 2L7MP 5L3GA 4MTEA 5M5YJ 1FIPA 1U5TB 5B1BH 3DEEA 2BYVE 2RREA 1PP8F 5K7ZA 1AWCA 4OU0A 3F8CA 2HPIA 2OPTA 3PUFA 1OMIA 1PVEA 3T8TA 1VQ4I 2STTA 1JUSA 2GAUA 3KZIC 4IJAA 3DLLF 3ZMSA 1MJAA 2ICWG 3QPTA 1IC8A 4BJ6C 2CJJA 4OINF 1UG0A 2ME6A 3BTCA 1W5TA 3BG6A 1XD7A 5HOOA 5IYBJ 1BW5A 1YHQI 4YG2F 2XSJC 3J80Z 2HYGD 2GBYA 5DEQA 1R5HA 1LB2A 2L9VA 1WJBA 3CMEI 2LF8A 2HXOA 3FZVA 4E7LA 1P6RA 1R49A 4BBSJ 2HYJA 4N4OB 1IZ1A 4FE7A 3TKYA 3VB2A 1P4WA 2EZLA 3PFIA 4FCYA 5IP7J 3BR2A 3E5QA 1ZRFA 2Z16A 2L9SA 2MC3A 4NQWA 4IHWA 2OA4A 2DU9A 2M4GA 3LSTA 4LB6B 3QYFA 3N4MA 3WTTC 2P8TA 3PNTA 3DFGA 3QYBA 4LIUA 2VPRA 3HOTA 4EEFG 5LRSA 3BJOA 1T38A 4WWCA 4CUGA 2QF7A 3TMOA 4C3IJ 4D1QA 1ON1A 2KHMA 1A5JA 2VQGA 4CGZA 1I5ZA 5F0HA 2OTLI 2Y0SN 4DNCA 2DOEA 3GLXA 4C2TA 3K6GA 1FLIA 5IT9Z 2LR8A 3NWSA 5KK1A 1Z77A 2EPFA 2KPMA 4DIQA 3CO6C 1XGOA 4IZZA 1JXSA 1JKQC 2VQHA 1K4TA 2V6CA 2CQNA 5EEHA 4JX6A 3F6VA 5F64A 1X3ZB 3PL8A 2KLOA 4KITB 4L0YB 4XRSA 1VQ6I 3G1MA 4PJLA 4ON0A 5L3FA 4XKWA 3OIOA 1K4SA 1JJ8C 1ZN2A 2Y2ZA 1JGSA 2OJED 1N75A 2V6EA 2JTVA 2DTRA 1I6XA 1IN5A 5CJ9A 1RR8C 2XASA 3HUGB 3ZCOA 2MLKA 3SEQA 4PUSA 4IRHA 2EV5A 1SANA 2K5CA 4KIBA 1W5CC 3DXJF 2QSHX 1FIAA 1EF4A 5K5RA 2LKPA 4C3HJ 2F4OB 1Y1WJ 3HOUJ 1KQ0A 2ID6A 3ECHA 3K9TA 5B66C 4KN4X 5DUIA 5HS7A 1TNSA 3ZQGA 4IX7A 2PMZA 4H4KC 4YEJA 2JVGA 2PG4A 3KIOA 2Z33A 1Q1VA 2ZSIB 4HOBA 1JTXA 3RPUA 2ZXWH 3GO5A 5TRDA 1YJ9I 1X58A 2BY2A 3P9CA 4LJZF 1W0TA 1AKHA 1DDNA 5EYRA 2DQRA 1PUFB 1R36A 2L7FP 2FA5A 4HDUA 2HKXA 3BZ6A 4XLFA 2W7NA 2E35A 1MH3A 1C0WA 2GOMA 4A0ZA 1LVAA 1I6HJ 3J7YJ 4ESJA 2AQEA 3JTGA 3A01B 4AC0A 4XICA 1I3QJ 1EA3A 3CESA 5CQGA 2KL4A 1ORKA 5GTHC 2DW4A 4ZYEA 4Z6YA 5F1RA 1BI3A 3CCQI 1ZGAA 2DOAA 3F3XA 1BC7C 4NDLA 2NYXA 5LD2C 4BHCA 3W2WA 4BE1A 2CV2A 2A07F 3PQJA 1N25A 2JN6A 2WAEA 3NAUA 5F04A 3HHHA 3S3NA 3KP5A 2IJLA 1MW7A 1J0RA 2JSPA 4KICA 5EEAA 3MKYB 1OKRA 2I5UA 4UUTA 2XGXA 3K4LA 1Y8RB 3CCEI 2R3SA 5FROA 2Z2SB 4JQFA 3MEXA 2OCEA 2LOOA 1YS6A 3KP3A 5JI6A 5L3DA 4KDPA 1TL8A 2WB1A 4S05A 1B72B 5LFAA 1QPMA 1WVRA 4Y3OA 2ZB9A 3TEDA 3GVAA 2MG4A 2XB0X 1KU2A 2XKPA 2H8WA 3QODA 3ULQB 3L2CA 1DPRA 4P5OA 3I4NJ 2NVQJ 3OL3A 3ZQ7A 2NOJB 1W0UA 1K7AA 1ETWA 2BY1A 3JSPA 4HSTA 4DYCA 1ZAOA 4RGRA 2HOSA 2DFFA 3FIWA 2JJ7A 3P7NA 3LA2A 3M8JA 4PGHA 4BEHA 5J8CA 5H20A 3RYRA 1TWFJ 1JUPA 3CMMA 4ZYGA 5ICGA 4IEJA 4BQAA 3S93A 1S6LA 4IOCF 2E2IJ 3DBHB 1R5ID 5B1AH 2KDOA 4XLAA 4LLGF 4HW0A 2F5CA 3S15J 2K3PA 2X0LA 3FMRA 3TP3A 4E7IA 2QBYA 3KE2A 1LFPA 2V1UA 2VQLA 4B8XA 5F6FA 2X4HA 5K7HA 2VJIA 1Y8QB 5EG0B 2FE3A 1PDNC 2F6CA 2Y0MA 1XC5A 4RB2C 2X1EA 1OFCX 2A69F 2OZ6A 4LK1F 2DK5A 1IAWA 1IN8A 3AL0C 1QHHD 1MBGA 5HLTA 3ZRGA 4O6JA 3JAMZ 1D8JA 3KP7A 4ZH4F 1FP2A 3I59A 3BOQA 4EQQA 1G3TA 3W6KB 2DFEA 5DCMB 3GMEA 4XORA 1GVJA 1KYWA 4KMUX 2CQKA 2WTEA 2EFWA 2DBBA 5CVIA 3B6CA 3BDDA 2EA4A 2R0QC 1E0EA 3MFKA 3P5JA 4UUSA 4XIDA 3A2KA 5J1YA 3SYTA 4G6QA 4G7HF 1ZYRF 2M2EA 2LD5A 2IGMA 3VYTB 3OSGA 3LSJA 1MKMA 1FWZA 3ABUA 3GFJA 3O3KA 3EUKL 3HIFA 3LSGA 4M3GA 4RAZA 1DP3A 3IC7A 4A3BJ 2P6TA 2F4IA 2CO5A 2M7AA 3GBGA 5KCMA 2B63J 4WCGA 2RNJA 1OR7C 1P2FA 1VQKI 3CJNA 2FUG2 2DJIA 2C6YA 4A3CJ 4Q47A 1BI2A 2HQAA 2LKSA 4OIQF 4I09A 3COAC 2XGDA 2R7VA 2CUZA 3VYSB 3EPZA 5J47A 3JREA 2O9LA 3L00A 4ZTJA 1TWHJ 1WHUA 3FKIJ 1U2WA 3OYLA 3OS2A 2NVUB 2P6SA 3WGGA 2CW8A 3BCBA 3T0YA 1T08B 4HPQA 4HNTA 5LHHA 1MNMC 3HM5A 1LEBA 2FRHA 4G9YA 4R79A 1ZH5A 5LEJA 3ZR8X 1IRZA 3OR2C 3OYFA 3KZYA 4F93B 1YIOA 1ETKA 2OBPA 4HEA2 4G6DA 1HW5A 1MJBA 2JPBA 4HX7A 5ICFA 2WADA 1ON2A 4LLLA 2XAFA 3FX3A 3Q9SA 1AHDP 3ML6A 3KP2A 2X6WA 2KJBA 3CC7I 2HNHA 3W3CA 3BG7A 2QQ9A 1G3WA 3RDIA 3QOEA 1A6QA 1BJAA 3IUOA 1CQTA 4IQJA 1IDZA 2EB7A 2DMTA 2HGCA 1FOWA 4PK4A 5FKNA 3QP6A 3F8NA 1R23A 5TJJA 2IGKA 3SDBA 2A61A 1IG7A 3HGYA 4MO7A 2HZDA 1Z7LA 1G8XA 1QVTA 2DN0A 4RMNA 1X1BA 4TV7A 1OJLA 2D45A 1FBUA 1JHHA 1DU6A 3FXOA 2NS8A 5F0CA 1YG2A 2COBA 2XF6A 2F5EA 4Q48A 3IKVA 1MMNA 4A69C 2R5YB 3N97A 1L3LA 2ZMEA 4IRGA 6PAXA 3VWBA 1UHMA 2CV1A 1BOBA 3LOCA 4FHTA 4V2FA 2PX9A 4PSWA 1AA7A 1R22A 2DK8A 2L2OA 3M8EA 4Z2YA 2V79A 4NHJA 3LA3A 1H89C 3JRHA 1MMAA 1OQYA 4NNJA 2E5ZA 3H0DA 3VFZA 3BR1A 2HTJA 2DDAA 2WV0A 4BBRJ 1IDYA 5DDGA 1HBXG 1I3AA 5KNLA 2KQRA 4A0YA 2M34A 1X1DA 2PJRA 2AO9A 1Y0UA 3OOUA 4ENMA 1K78B 2ZKZA 1VQLI 1BIBA 2FF4A 3LSMA 4RB0A 4PDKA 2WAQN 5KHDA 2YU9J 3D0SA 4ESBA 4AYBN 2QKMB 3DKYA 1J7KA 4FE4A 1WKMA 1HCRA 1U5TA 1DQUA 4M9XA 4EMSA 4U7BA 3CUOA 3O8HA 3BR3A 1TW2A 4G6TB 3ZMVA 1YLFA 1APLC 2DA1A 2H94A 4B3AA 2XSDC 3GZ6A 2CV0A 1S7AA 3GW2A 2O5RA 1YQAA 3HOZJ 4GGGA 3K2AA 2ELKA 1JKRC 5GAEJ 5K7FA 2VIXA 2O3FA 4XONA 2CUJA 4L0ZB 2Q2EB 3K1NA 5C4JJ 1IN4A 4FX4A 1OPCA 2BVMA 2B9SA 1JUMA 1DU0A 1XGNA 2QEXI 1XGMA 1GUUA 1IN6A 1KYZA 3FKJA 3HOYJ 1YI2I 1ITYA 1NG7A 3VEPA 4HLXA 3ZMDA 3GTGJ 3CCSI 4C30A 3HL2A 3SZTA 3BLYA 3BZCA 3S16J 1MBJA 2ZCWA 2BBYA 4B48A 2HDWA 3DCFA 1KU9A 2M8EA 3KFWX 3RQIA 1TQPA 1FBSA 1EJ9A 4CCJA 1XGSA 4HZFA 2QM3A 3PNYA 3GLLA 1D5YA 2R5ZB 2V9VA 2ZXIA 3A03A 1RKTA 2K9NA 4HLYA 1TT5B 4KN7X 4L9NA 3CCMI 2HVQA 4R1HA 4BDYA 3RQ4A 3FBIB 3UKGA 5D5UB 3FXLA 3HPGA 2QGUA 2VE8A 4RDUA 3PUBA 4W97A 4KIFA 5KVRA 2WC2A 5IOYA 3BTIA 1OCTC 1RZ4A 2VN2A 2UXXA 2EV0A 2I8DA 4DYRA 1ZKGA 1QVUA 3V42A 2W57A 2JZYA 4QPQA 1FOKA 3HDDA 3H3ZA 4KT6A 1FSEA 4AWXB 4L5IA 2DFHA 2XAHA 2DCEA 2MYSA 2D2WA 3O2PE 5IYDJ 2X48A 1T8IA 2BW3B 2M5WA 2CQ7A 1LFUP 3CC2I 3LSRA 2FQ3A 4FETA 1W7PA 3PQKA 3L9FA 2CG4A 3K7AJ 4X1EA 3M8FA 4EGZA 1U6GA 4A3JJ 1T56A 5ILSA 4F91B 2M8GX 4CSWA 5E18F 3VDXA 2VQCA 2IA0A 4JP0A 2RQQA 5E79C 3DBRB 2CUEA 4WX9A 4WF2A 5IP6A 5LEKA 5FFXA 3A0BC 2DT5A 3CUQB 3MZYA 5LGUA 3PNVA 1I1GA 2VT2A 2MD0A 3HZJA 2WWYA 1B59A 3HGGA 1SFKA 2V9PA 2EBIA 3N05A 4DZJA 5LLQA 4XN3A 4N4NB 2HOEA 4CCNA 3I56I 1EV7A 3JRAA 1NH3A 2V4JC 2DI3A 1YX3A 3J80K 2M4KA 3LFKA 5BMZA 1LEAA 1LE8B 4A0XA 5D4RA 5D4SA 4XK4A 1G59A 2A6EF 2IS1A 1Q1HA 4BHPA 3F22A 4UHTA 3HSRA 3OYIA 3LSPA 2PMHA 1JE8A 1PUFA 2E1MB 4GYGA 4HBLA 2HDDA 3HRUA 4R8HA 3L09A 1JKPC 3FXMA 2VPLA 3AKZA 4AIJA 4QLCU 1FPQA 2PJPA 2K9LA 2A5WA 2O03A 4RGSA 3A01A 4OAZA 1S9HA 2M9HA 3IL2A 2GIZA 4LG0A 4KA4A 4A3IJ 4O3MA 4HV5A 1FEXA 2CWEA 4O5VA 2VBXA 4XOTA 5FJ8J 4BE0A 5F27A 1HKQA 1ZR2A 5JFRA 1IGNA 2QQ8A 5GP9A 3V8JA 5HLIA 1ZRCA 1XDSA 3DBLB 3EDPA 1O7FA 4LOCA 4NB5A 1V54H 3Q3SA 2LC2A 2XPWA 1PJRA 2IA1A 5IT9K 1MNEA 3DQVC 2K86A 3IAS2 3S2DJ 1FTZA 4HQEA 1RR7A 3VPRA 4OIOF 1G6NA 4EVIA 4N9IA 3I71A 4Y17A 1LJ9A 2R7FA 4X6AJ 2XAQA 5HS9A 4QWQA 3U21A 1EH6A 4N9HA 1SFEA 2L7ZA 3TO7A 1H0MA 1X3WB 4E7ZA 1WZ2A 4IRIA 3E6CC 3DEUA 1SAXA 1YJNI 2CYYA 2KT0A 5M5WJ 3I3LA 2YS9A 4KUMA 1B72A 3HKZN 3CCJI 3MD2A 2V1NA 5D6EA 3IH4A 2XC7A 5DV5A 4XRFA 3K4KA 3OY9A 3J7AO 2XKOA 1JGGA 2ZXHA 4CCLA 5HODA 1WFXA 3DPTA 4KFCA 5AONA 2NOGA 5EGOB 2AQFA 2F5FA 2BHZA 2EFQA 2HZTA 4Q4ZF 4IVNA 2CQQA 3TL4X 2STWA 4NC8A 2KDZA 2B7EA 1B9MA 4RAGA 1UB9A 2L54A 2RNGA 4QIWN 2ELJA 2DMUA 2M30A 4LG3A 1D1AA 5FLXZ 1YW8A 3OR1C 3VSKA 4OMYA 3H36A 1EH8A 1IO2A 1IXSB 1WPKA 2GXAA 3HG9A 5C4XJ 2L0KA 3GUDA 2L5QA 3E5UA 5LHGA 3NARA 1QQIA 5EJCA 4E70A 4ZDLA 3OIQA 5HS8A 1VFCA 3H5AA 1T98A 5EG0A 5ICEA 1VQ7I 1YS7A 1R1UA 1TWCJ 4EM2A 4RBOA 2MGQA 1OCPA 2R4GA 2VKEA 4ZZLA 2BXZA 5D5VB 1R1VA 2LY9A 5FKMA 3HOWJ 3DPUA 1U8RA 2OQGA 3GTOJ 1ERDA 3D5LA 4L9JA 2JK3A 3UNGC 1YITI 5DCMA 4A5MA 4DQ2A 3E1SA 3PFYA 2Q0OA 2YPRA 3R4KA 1ACIA 1OCZH 2KRFA 2DA7A 1TC3C 2OU2A 4P9UA 2DT6A 2GM4A 4F52A 1BI1A 1IUYA 2MSYA 3HOSA 1LQ1A 4PGGA 3OV8A 2GIVA 2VASA 3GTPJ 4CCKA 4YELA 3ZMUA 1IXCA 2CH0A 4FISA 1FY7A 3OYGA 2DPDA 3KEYA 1U9NA 4V2GA 3PM1A 1Z9CA 3BR6A 4F3QA 4B1RA 4XR6A 3K70C 3IHUA 3S1MJ 5E20A 2UV1A 4IO9F 1TWAJ 2ETHA 2HTSA 2HEOA 3BC8A 3CZ6A 3H1CA 4L18B 3DWLE 3HOXJ 4NBQA 2KZGA 2M7BA 4PCQA 5CVJA 3WG9A 5IPAA 2QENA 2X1DA 3GF2A 1H9GA 1Z6TA 1TT0A 2DT7B 2DPUA 1EKEA 1G2HA 3FXJA 1Z91A 2JPCA 3U2RA 1BIAA 2BHYA 5HLGA 4KNYA 1XX5A 1S72I 3S1QJ 1RUOA 4UB8C 2KIUA 1ODDA 1YOVB 1TQIA 2ZJRF 2LMDA 5E1XA 1ETVA 3V7CA 1A31A 4XNFA 4Y7NJ 3K10A 2NNNA 3HJEA 3GCMA 2D1VA 1QO0D 2FNPA 4ANJA 1JT6A 2E2HJ 2E1OA 2QCOA 1KGSA 2UZKA 3I0TA 1R4MB 3JRIA 4OIRF 1NK2P 4IXAA 3F6OA 1Z05A 4PJ0C 1FYMA 2CGPA 2R7DA 2LTPA 2YX4A 3QOPA 2R92J 4JX5A 1MMSA 2A6HF 2F48A 2HU9A 3TBIA 2O0YA 5BS6A 5FO5A 3O8GA 5FD6A 3K69A 1HDPA 2A05A 3P9IA 2OF7A 1SFXA 1MMDA 2KRCA 5GADJ 3JAMK 3GTKJ 4BL0B 3CD6I 4ENKA 3FHNA 2EWNA 2K40A 3ZP5A 4HDVA 1MGTA 2GLOA 3HOVJ 2DA4A 2KP6A 4CDGA 2R5YA 1WJCA 2ZFWA 2E2JJ 2EIKH 1YX5A 1FNNA 2XIGA 4B43A 4G94A 4BXUA 3FK7A 1IF1A 2DO7A 4S04A 3V4GA 2H1KA 2P81A 4AUXA 5GPCA 2H27A 1XMXA 1DP7P 3LQRA 2XAGA 3TP0A 4MEYF 1S3JA 2OQRA 4RS8A 5J4YA 2WV1A 2BOLA 3KX2A 2JQ7A 2LH9A 1GVDA 1OLTA 1R5GA 2J5OA 2JUGA 4CICA 4E7HA 5H6QA 4ETSA 1KZHA 2OD5A 2CW0F 2EFPA 3REOA 4YIFA 3DLAA 3BG3A 3DTKA 4U0VA 4C3JJ 4IPAA 4D7NA 1VI0A 4JBAA 4XSZF 5FRNA 4XM3A 2YX7A 3WTSC 1K78A 1RESA 2GXGA 4PFPA 2HDCA 3QPLA 1RETA 3TGNA 2GXBA 4BDZA 1RRJA 1VQ8I 3WHBA 2FXAA 4OOIA 4EM1A 1X2NA 5L3EA 2Z3YA 1Z67A 1PUEE 2VODA 4CH7A 3O6BB 1WCMJ 5E3LA 3ELKA 3QWLA 1A36A 2W85A 2K27A 3H92A 2W25A 4E4HA 4HNUA 1BR4A 1YO5C 4PSXA 2QYOA 3H9JA 3KYCB 4KIGA 2ESNA 2E1CA 5J1RA 2QVOA 3IH2A 2Q2EA 1W36C 2HVSA 3VOEA 5E8GA 3GFLA 1LFBA 3ABKH 3GX4X 5HDKA 1O7LA 2IGNA 2FEZA 4EJOA 3WTUC 2LKXA 3ZQHA 2XF5A 2WA0A 2G7HA 1F36A 2JRMA 4NQWB 4W1UA 2O6GE 2FBIA 2ELHA 3CO7C 2V1DA 3SFZA 4RAFA 5ILUA 4J00A 5BPIA 2WAQA 1HQCA 2FBHA 3E3VA 2XGEA 1XN7A 3K4CA 4DW6A 1L0OC 3AG3H 2PI0A 4CCOA 1HSJA 2JVHA 3C3WA 4BH9A 3GEZA 3SXYA 4ZJZA 5EZHA 1E3HA 2R5ZA 1Y39A 5GPAA 3CJTB 2GWRA 2JWTA 5DM6F 3K70D 2Z99A 3SZPA 4ABZA 3HPHA 3MZHA 1S7OA 2VC1A 3HBLA 2H6BA 2XHKA 3FXRA 1P9QC 2XV4S 5D8LB 1TP4A 3BR5A 1SMYF 1WJDA 2LVSA 2P4WA 3RKYA 3ABLH 4YIRX 4ZC3A 2I10A 1MIJA 4JX4A 2IPQX 2W84A 1I27A 1D8KA 3CP2A 3QAHA 4Q5SF 2R7RA 2EJRA 4YIIA 3I5UA 1WI9A 3K2ZA 3LA7A 2YUSA 4FX0A 3U1KA 4D9JA 2IXSA 4G7OF 4HA8A 4LITA 5CKTA 4UUVA 4MTDA 4I6ZA 2IT0A 1IRGA 2VBYA 2XAJA 2E1NA 4B3XA 1U3EM 2UWMA 2ZNZA 5F0FA 2P5LC 3PSFA 3BQZA 4ZYAA 1R1TA 5TGTA 1SFOJ 5DS9A 4PZJA 3LSKA 4NUBA 4D7MA 4HYEA 1S7EA 2D1HA 4XSXF 3G4SI 3L1PA 3OYNA 3OYBA 2LY2A 4OAYA 2KISA 3CUQA 4RGXA 3TW6A 2FU4A 3JRFA 2HR3A 2ZSHB 3JCUC 3X2QH 2K9MA 4LGWA 2CSOA 4PFOA 2ESHA 3QYEA 5CYVA 1AKHB 3L7WA 1I50J 2VOOA 4CCMA 2M0CA 1O3RA 1PYVA 1ZG5A 3BZKA 1BBYA 4M3DA 2PBIA 4YFKF 1BR1A 2IBDA 2MW8A 3CTAA 3S8PA 3ZN1A 4GRIA 1LE8A 3FMQA 4E7SA 3L2WA 4B09A 2FSWA 2G0EA 4JK1X 1X4OA 3K4MA 4M71A 2FBKA 4DBQA 4UB6C 5CPRB 3CF2A 4BE2A 4MIMA 5H2FC 4XRSG 1E17A 1P92A 3M7GA 3J7AY 2M45A 3KCCA 2DXIA 1IRFA 2LBFB 2ZNYA 4KT5C 2HVRA 2JSCA 2DMPA 2DLLA 3RPUD 1YE9A 1SEUA 2IRFG 3M07A 3VSLA 3WODF 4M9ZA 1IXRC 1BI0A 5FGMA 3H5NA 4B47A 2JMWA 3J7ZI 2PFBA 2NVXJ 1BOAA 5L3BA 2W24A 1LKXA 4L9TA 3WTZA 1TLHB 1P7JA 3OS1A 2E19A 2LK2A 4ZDPA 3KLOA 2M0MA 4E6KG 4HRIA 1LPQA 4F92B 1ZK8A 3R0AA 3AL0B 2XROA 1BR2A 1RUNA 1USSA 3GTJJ 5AIQA 1SVLA 3JW4A 3LWFA 3FISA 3GTQJ 2GA1A 3C2GA 2AXLA 3IRRA 1W5SA 1IW7F 2FMLA 3C18A 3GFMA 1GHCA 4P96A 2P5KA 2KZVA 3HC7A 1K79A 2R7SA 4ZYDA 4A3DJ 3IP4B 4BQOA 2E71A 4M6VA 4XRMA 1RC9A 1X19A 1UELB 2EZHA 2ZJPF 1QZEA 2KMUA 2EIMH 4XLPF 5F1JA 4U7DA 4E7JA 4DYQA 1AOYA 2ZMEC 1D3YA 4U0WA 2MH2A 5EGOA 2D5VA 4H0EA 4HSRA 3JRGA 4M3FA 1V55H 5HDNA 5JR3A 4UNOA 4GYIA 2CU7A 1O3SA 4XKVA 1IV8A 4FQGA 1Z6RA 4UXNA 3U1DA 1MBHA 5CVUA 3QP5A 3PO2J 4M74A 3OYEA 4MFDA 3UR3C 1XDUA 3IAM2 2OUMA 1ZLKA 3AFHA 3GFIA 4M73A 1BM9A 1MBEA 3S3OA 5KAFC 2XUBA 1VTNC 4HAMA 1GXQA 4XN0A 1UFMA 2BE5F 3KYLA 3HTSB 4EJUA 2RAEA 1XMKA 3ESWB 1U5TC 2ECBA 2CRGA 4A2UA 3JSOA 2R7XA 4L5JA 3BP8A 2X85A 1ETYA 2Y9YA 4ASNA 1GV5A 1YW7A 2VXDA 1XSXA 2FJ1A 3PIOF 4EATA 1T0FA 5DM7F 4CYCB 4IHTA 1FTTA 3ZXSA 4HNVA 1Y6IA 2JA5J 2VL8A 5K1YA 3T5XA 1MSEC 3LNQA 3R60A 2KJCA 1XCBA 4M6YA 1V5EA 1OISA 3ZMTA 3GZ5A 2O8XA 4RGUA 4EJWA 2VOPA 3TW7A 4J01A 1WSUA 1TW3A 4BYYA 3C2HA 1SMTA 1D5VA 3HUGA 4RLQA 4WXCA 2P0WA 3H5RA 4UVBA 4XLHA 1WGXA 3TQNA 4J19A 4A3KJ 4A5NA 2BGCA 2L4AA 2RV8A 2LF7A 2IAIA 5BPDA 1ETOA 2MD5A 2ISYA 2NAZA 5J4VA 3M1EA 1R7JA 2Y0SA 1OCOH 2WY8Q 3LFUA 1KQ9A 2E7WA 3OL4A 5A2QZ 1TWGJ 2KIMA 1MH4A 1MZBA 3E5XA 3I54A 3IWFA 3WGIA 1VQMI 4Y4RA 1FSHA 2X51A 4Y13A 3F8MA 3PO3J 3CMAI 5DTDA 4AD9A 4A93J 5BQTA 4IHVA 2M87A 3CC4I 1GDTA 4HF2A 1S5LC 1FYKA 5HVQC 1A04A 1NG6A 1QRYA 3A02A 3K0LA 3RTRA 3A4CA 3ZOBA 3L2VA 1YW9A 2VJJA 1NK3P 5FLXK 1WH7A 2IGOA 1KONA 3QRFF 1F9NA 5GAHJ 1FC3A 1IV6A 2R7ZJ 2R7UA 1MJ9A 3RI4A 3K4BA 4RB3C 1LDJA 2EILH 3QQAA 5IP9J 1UJ8A 5H6RA 2BZTA 4CA0A 3OYHA 1VQOI 2IVMA 1XB4A 3VODA 4BGDA 1RPWA 1R9TJ 1R00A 2O7OA 3I64A 4UVAA 2DYRH 4XKCA 3CLQA 4I7HA 1MNDA 1UHWA 1KU7A 3PJRA 3K4NA 4ZZDA 5D5WB 2DMNA 3LAJA 2DODA 1VNDA 2K3FA 2ZJQF 2HI3A 3HRMA 5EF6A 1T39A 4AM3A 3DEWA 5C3EJ 2AXTC 4CZCA 3CLOA 3AG1H 3R61A 1N77A 3F9KA 1F43A 2K7LA 5FRMA 3R0JA 1SVOA 4GCVA 1Y1VJ 5FKKA 3NWTA 2FD5A 1ZARA 5KAIC 3BROA 3TO6A 4DGWB 1VQ5I 4A12A 2V26A 3BPVA 3TDUC 4YFXF 2AS5F 2PJRB 2X6OA 3G2BA 1M1EB 4I2OA 4RM2A 3H9QA 2L02A 1ULYA 4B4CA 3RPQA 3NRVA 3S14J 1D0ZA 2VJ5A 4QSHA 3T1BA 4BQQA 2DQLA 1SC7A 4BU2A 5CQEA 4MEXF 1I1SA 4ZYHA 3ZGKA 5K5QA 3OMYA 1T33A 1R58A 5LHIA 5M3FJ 3J81Z 1JKOC 4II2A 3S17J 4I01A 1DPUA 2RQPA 1CF7B 4M3EA 4A3MJ 2MC4A 1B6AA 4PJJA 3GXOA 2ECCA 3GZNB 3BR0A 2PN6A 3CCUI 4A6DA 4AVZA 3ISPA 2Z1DA 1JI8A 3FMSA 3E97A 3JRCA 4WK8F 1VZ0A 4I0BA 1MBKA 1USTA 1WI3A 1T6SA 2EZIA 3E6MA 3HHGA 1S29A 3KZZA 1E3OC 5B5EC 5DUKA 4BJ5C 3W6VA 4MGRA 5EZGA 2L3DA 1SVMA 1MDMB 4PJMA 2DA3A 3WTVC 2G7UA 2LYCA 3F8BA 2ZO4A 1ZG1A 1ZRDA 2OTJI 2RVCA 3HYIA 2NS7A 3L2QA 3B02A 2F5DA 3D5SC 2OAZA 1HA8A 3K4JA 3RYPA 2V9KA 5ICCA 2HPMA 5E1WA 3KEQA 1ZLJA 1QA6A 1G4DA 3G71I 1IUFA 1OCRH 1YTYA 2NVTJ 4A3EJ 1YFHA 2QA4I 3EUHA 3MKZA 3P9KA 2OC6A 2PQ8A 1FZPB 4BNCA 1FOYA 3AG4H 2HFHA 2BEOA 2K9SA 3BT9A 2HYFA 2KRHA 3BCAA 1ENHA 1QBJA 2QSGX 4KISA 4ITVA 1WJ5A 2X9DA 2LLKA 2VB6A 2K9QA 1WJFA 2JA2A 3CJQB 3DKXA 3F23A 1ZQ3P 2WBMA 4RAYA 3ABMH 3OIPA 3CDLA 1XS9A 1H88C 1EH7A 4QTRA 5D8KB 5AIPA 1UCRA 2R93J 2XDVA 4HV6A 2EZKA 1VQ9I 3SHFA 1W7PB 4HQMA 1P7IA 2B0LA 3MCZA 3MKWB 1B8IB 1VQPI 3WGHA 3FDYA 4CHUA 2EQRA 2J5PA 2MLGA 3SFIA 4A3FJ 1YRNB 1U8BA 1OCCH 2DAOA 1VQNI 1U9OA 4XOPA 3ZQLA 2F4MB 4IQ4A 3H3VK 4F55A 3IWZA 3MKLA 2M3AA 4MNUA 4G7ZF 4AIDA 3OS0A 4P9FA 1QPIA 3V7RA 2HQNA 2FQ4A 3H0GJ 2XAUA 1K6YA 3M9AA 2MFZA 5LRRA 1TZLA 2EINH 3G73A 2PLYA 4V19K 1W7PD 3EUHC 3HB9A 4DOZA 4EJVA 1ZREA 1OYWA 1R4NB 4UY8I 2RC4A 5F08A 1V4RA 3CMYA 1TBXA 1XSVA 2X6YA 3ROUA 3KEOA 2FMYA 2KKOA 2DTZA 3JR9A 3G1LA 3ZQCA 3WU1B 3K1MA 5ED4A 1FP1D 3G1OA 3CCLI 2W00A 2R7QA 3U9GA 3S1RJ 5D6FA 3QU3A 2ISZA 3MZ8A
chains in the Genus database with same CATH topology
4CCJA 2HPIA 3PNYA 3PSFA 2ZXIA 4ZYAA 5TGTA 1LVKA 2LBFA 3LSKA 4NUBA 4BJ6C 3OYCA 1Z21A 2HVQA 4BDYA 1UG0A 3RQ4A 3OYNA 3FBIB 3HPGA 3OYBA 2LY2A 3BG6A 4OAYA 4YRVA 1V5FA 5HOOA 3PUBA 2ZSHB 2K9MA 2XSJC 4PJNA 4PFOA 3QYEA 2I8DA 3V42A 1WJBA 4CCMA 4QPQA 4C2UA 1PYVA 4E7LA 1IRXA 4KT6A 4N4OB 3EUAA 1BR1A 1Z3XA 2DCEA 2MYSA 3S8PA 4GRIA 3LMMA 2BW3B 4E7SA 3L2WA 3SZGA 1X4OA 4FETA 3K4MA 2Z16A 4DBQA 5CPRB 4BE2A 2L9SA 3CF2A 2UUZA 4E7KA 4F91B 3J7AY 2M4GA 3S32A 3QYFA 4CSWA 2DXIA 3PNTA 3I9V2 3QYBA 4LIUA 2LBFB 3VDXA 1LDKB 2VQCA 3HOTA 2HVRA 2RQQA 3RPUD 3CJRB 4CUGA 1YE9A 3TMOA 4BQNA 4DBRA 3W2AA 3M1CA 1ZELA 4D1QA 4BACA 3VSLA 2KHMA 2L7KA 2VQGA 3H5NA 5HNFA 4B47A 3PNVA 1FMVA 2MD0A 1SFKA 3N05A 4JOMA 4XN3A 4C2TA 3K6GA 1LKXA 4N4NB 3NWSA 2KPMA 4DIQA 4CCNA 3OS1A 4IZZA 4ZDPA 4E6KG 2M0MA 2V4JC 4HRIA 1YX3A 2WAFA 2VQHA 4F92B 2M4KA 3AL0B 3PL8A 1BR2A 2KLOA 4KITB 1G59A 2IS1A 2E5NA 4PJLA 3OYIA 4XKWA 2E1MB 3C2GA 2V6EA 1N75A 1D1BA 2VPLA 3AKZA 4NC7A 4AYBA 2K9LA 2VKHA 2A5WA 4XQFA 3HUGB 3ZCOA 3DPLC 3HXLA 3SEQA 4PUSA 2KZVA 2K5CA 3HC7A 1Y56A 4OAZA 1S9HA 5JHFA 2R7SA 3IP4B 3OYKA 4BQOA 1N78A 4ZTFA 2VKDA 4XOTA 4BE0A 4IX7A 1X19A 1UELB 2PMZA 4H4KC 4YEJA 2KMUA 2JVGA 4AU7A 2ZSIB 4E7JA 2LC2A 1PJRA 3DU5A 1MNEA 3DQVC 3IAS2 4HSRA 4XLFA 4RLFA 4BXFA 2W7NA 3U21A 4XKVA 2BW3A 2GOMA 1SAUA 2AQEA 4E7ZA 1EA3A 3CESA 1FMWA 5CQGA 2KL4A 2BVLA 3OYEA 2QKLB 3UR3C 3I3LA 1D1CA 3IAM2 2V1NA 3MD2A 3A1YA 2XC7A 2OUMA 2DOAA 3K4KA 3OY9A 4BS9A 3AFHA 2ZXHA 4CCLA 3S3OA 1WFXA 5LD2C 3MMYB 4DJAA 3DPTA 4XN0A 3W2WA 3KYLA 4BE1A 2CV2A 3OYMA 2WAEA 2MABA 2AQFA 2XF7A 3TL4X 2R7XA 4NC8A 3S3NA 2X85A 2RNGA 1MW7A 2JSPA 1J09A 4C9YA 2ELJA 2VXDA 4LG3A 1D1AA 3MKYB 4EATA 2IS2A 3OR1C 3VSKA 3K4LA 3ZXSA 1Y6IA 3VYUB 2IS4A 2VL8A 5FROA 3HG9A 2Z2SB 4QPOA 4JQFA 1QU3A 2L5QA 2LREA 1V5EA 3CP8A 2LOOA 3OYDA 3PSIA 1Z3YA 2LRDA 2WB1A 4ZDLA 5LFAA 4J01A 3OIQA 4Y3OA 3H5AA 3C2HA 4RLQA 3VYRB 2P0WA 3H5RA 4XLHA 3QODA 2R4GA 4P5OA 4RM3A 3OL3A 2NOJB 3ONQA 3LSIA 4FASD 3DPUA 3OYJA 1QHGA 4HSTA 2Y0SA 2WY8Q 2WY7Q 3LFUA 1ERDA 3D5LA 3OL4A 3UNGC 3M8JA 4BEHA 3E1SA 3PFYA 4Y4RA 1D0YA 2X51A 3CMMA 3FBNB 3S93A 2KDOA 2R7WA 4XLAA 2DT6A 4XLCA 4F52A 5HVQC 2OV7A 1NG6A 3HOSA 3RTRA 3A4CA 3L2VA 2K3PA 2VJJA 2VASA 2L9NA 4E7IA 4CCKA 4YELA 2IGOA 1KONA 1LFPA 2CH0A 2VQLA 3H9GA 3OYGA 3KEYA 2VJIA 2F6CA 4F3QA 2R7UA 2X1EA 3K4BA 4XR6A 3K70C 4ZDOA 2UV1A 3S3MA 3AL0C 1QHHD 2W1OA 5HLTA 3ZRGA 3BC8A 3CZ6A 4CA0A 3OYHA 1W36D 3DWLE 1V5GA 2M7BA 4BGDA 2X6XA 2E1MC 2LG4A 2X1DA 1TT0A 2DT7B 4XORA 4BEHB 4XKCA 1MNDA 3PJRA 3K4NA 1DGWY 1E0EA 1GLNA 3A2KA 3SYTA 2CFOA 2IGMA 3VYTB 4P1WA 4CZCA 3EUKL 3LSGA 4XNFA 4OWRB 1N77A 3F9KA 3K10A 2CW7A 1DP3A 1MMGA 5FRMA 4ANJA 2F4IA 2M7AA 5KCMA 3GBGA 3NWTA 1OR7C 4DGWB 1X4PA 2FUG2 2DJIA 3RCOA 2HQAA 2V26A 2PJRB 3G2BA 2R7VA 2CUZA 3VYSB 3EPZA 4RM2A 3H9QA 2R7TA 2R7OA 3HKZA 1D0ZA 4ZTJA 2VJ5A 2HU9A 3TBIA 4BQQA 3OYLA 3OS2A 1T95A 4BU2A 4X0GA 5CQEA 2CW8A 3BCBA 1MMDA 2KRCA 4HPQA 4HNTA 3ZGKA 4BL0B 4IKFA 3OMYA 3FHNA 4II2A 3D5RC 4U87A 1WJAA 4R79A 2MC4A 3ZR8X 2KP6A 4Y33A 1WJCA 4PJJA 3OR2C 3OYFA 4F93B 4HEA2 1YX5A 4B43A 4MLOA 1UAAA 4AVZA 2WADA 1JI8A 2Z1DA 3SEZA 2X6WA 1VZ0A 2HNHA 3W3CA 3BG7A 1D0XA 3QOEA 2BOLA 3IUOA 3KX2A 4BJ5C 3L2RA 2LH9A 4IQJA 1OLTA 2ZFUA 4PK4A 2JUGA 4PJMA 4E7HA 2VXZA 2E60A 2LYCA 2IGKA 3SDBA 3DLAA 3DTKA 3L2QA 3H35A 3D5SC 3ZQQA 2HZDA 1HA8A 4II3A 1Z7LA 5FRNA 3K4JA 2A6TA 2V9KA 1G8XA 4XM3A 4RMNA 2HPMA 1X1BA 4PFPA 4BDZA 2XF6A 2VJ4A 1DGRM 1MMNA 2F5VA 2X1CA 1X1AA 3MKZA 4CH7A 2V7FA 3RSNA 3VWBA 2OC6A 2CV1A 1BOBA 2IS6A 1U0JA 4E4HA 4PSWA 1X1CA 2KRHA 3BCAA 4HNUA 1BR4A 1AA7A 4KISA 4B44A 2L2OA 2CMPA 4PSXA 4BJTA 4LIVA 4ITVA 1WJ5A 3H9JA 2VB6A 1MMAA 4NNJA 1WJEA 1WJFA 2E5ZA 2JA2A 3H0DA 3CJQB 3DKXA 3LL7A 2WBMA 3LSHA 2Q1ZB 3OIPA 1W36C 2GOXB 3DU6A 2HVSA 1T0FC 5KNLA 2KQRA 1X1DA 2PJRA 2IGNA 3W2VA 4XMYA 3OOUA 2XDVA 3DTIA 2XF5A 2WA0A 2LY1A 3LSMA 4NQWB 3MKWB 3OYAA 3FDYA 5HNHA 5KHDA 4J00A 2WAQA 2QKMB 3DKYA 3K4CA 1DQUA 4CCOA 4U7BA 2JVHA 4HG2A 3L2UA 4XOPA 4BUPA 4G6TB 4XKBA 4IQ4A 4ZJZA 4F55A 2M3AA 2CV0A 3K70D 2O5RA 3OS0A 3OWTA 3HPHA 3E0JB 2VIXA 2XAUA 4XONA 2CUJA 1K6YA 2MFZA 1P9QC 2Q2EB 2W82A 1TZLA 2BVMA 3EUHC 1WJDA 4DOZA 4ZC3A 2VLAA 3FKJA 1NG7A 2W4SA 2X6YA 4XL9A 3CP2A 4KJZA 2CS3A 2R7RA 4XLEA 1R6RA 4C30A 3DTEA 3HL2A 4D9JA 2W00A 2IXSA 3BLYA 2R7QA 4LITA 5CKTA 4B48A 2HDWA 3DEEA 2RREA 4B3XA 2UWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WA0 A; 
#chains in the Genus database with same CATH topology
 5CVV A;  5M5X J;  2ADU A;  4LG0 B;  3I53 A;  3CF5 F;  3K1P A;  1IN7 A;  3SJM A;  1LVK A;  2LBF A;  3OYC A;  3JRD A;  1ZGJ A;  1WWX A;  1Z21 A;  3ASN H;  2M1B A;  4YRV A;  2DOF A;  1V5F A;  1RKW A;  1P4A A;  2F2E A;  3IKT A;  1SFU A;  2HQR A;  3H3U A;  5TIS C;  4F7Z A;  3DV8 A;  1FT9 A;  3BY6 A;  2FOW A;  5CLS A;  4PJN A;  2YU3 A;  1SD5 A;  3RIR A;  3NQO A;  4WXD A;  4C2U A;  2NVY J;  1IRX A;  3FF5 A;  2BXY A;  3EUA A;  4EV0 A;  1LDD A;  1OYI A;  1Z3X A;  3Q0U A;  3RKW A;  2OCC H;  1UHS A;  1QZZ A;  4MQV A;  1WQ2 A;  3RKX A;  4ESF A;  3LMM A;  4EJT A;  1B1B A;  1IJW C;  1ZR4 A;  1A35 A;  3SZG A;  1HF0 A;  3Q0W A;  3EET A;  1RNL A;  3EYY A;  4E7K A;  2UUZ A;  2P7C B;  2DMQ A;  4ENN A;  4BY7 J;  3S32 A;  3BWG A;  3I9V 2;  1BA5 A;  3QU6 A;  1LDK B;  3SDG A;  5E1Z B;  2PMU A;  3CJR B;  4BQN A;  2L9R A;  4DBR A;  2KIQ A;  1KU3 A;  3W2A A;  3M1C A;  1ZEL A;  2XVC A;  4BAC A;  4BY1 J;  3E6D A;  2HOT A;  4IHS A;  4IOA F;  2JUC A;  1XSD A;  3KLN A;  1HXD A;  2H6C A;  2L7K A;  4S0H B;  2QQB A;  5HNF A;  4L5E A;  1FMV A;  1FYL A;  1NTC A;  2LNB A;  1XTA A;  3F21 A;  4JOM A;  4AIH A;  4G8X A;  2CUF A;  3V8L A;  5L3C A;  2FNA A;  1OR7 A;  3A0H C;  1KQ8 A;  5B3S H;  1H9T A;  1ZG3 A;  2WAF A;  5JVT A;  1V3F A;  3IH3 A;  1RIO H;  4M6X A;  1MD0 A;  1XMA A;  3F72 A;  3WHC A;  1HOM A;  1YIJ I;  4A3G J;  2E5N A;  2L01 A;  4MHG A;  2E36 A;  5E3N A;  2XPU A;  2E34 A;  1BJZ A;  3B6A A;  1XPX A;  1PP7 U;  4G12 A;  3GTM J;  4I02 A;  1D1B A;  3F8F A;  5DD4 A;  5K5O A;  2GZW A;  4NC7 A;  4AYB A;  2LSO A;  2VC0 A;  2VKH A;  1ZGW A;  4JYK A;  4XQF A;  2VUM J;  3DPL C;  3E7L A;  3HXL A;  1Y56 A;  2VT3 A;  2JRT A;  3KPH A;  5JHF A;  1I39 A;  2N8G A;  2XPV A;  1HLV A;  1AU7 A;  3OYK A;  1HC8 A;  1N78 A;  4ZTF A;  2VKD A;  1J9I A;  4LD5 A;  1F1Z A;  4KYW A;  2Y31 A;  4CZZ A;  2PMZ N;  2COM A;  5M3M J;  5E3O A;  5DD8 A;  1O3T A;  2EIJ H;  3HEF A;  4AU7 A;  2HWV A;  2BY3 A;  3B73 A;  1FJL A;  3M4O J;  1QNT A;  3DU5 A;  2HXI A;  2EA2 A;  1UZC A;  1VF9 A;  3MN2 A;  1O3Q A;  4HX8 A;  3R6S A;  3AG2 H;  4Y52 J;  3BG9 A;  1FX7 A;  1HW2 A;  4HF1 A;  2QWW A;  1HDD C;  4RLF A;  4BXF A;  4CYC A;  4GXO A;  2BW3 A;  2W48 A;  5D5X B;  1SAU A;  3ZN0 A;  4HF0 A;  3WTY C;  4IHY A;  4RA2 A;  2LFB A;  3MWM A;  1FMW A;  3TOB A;  4I99 C;  2BVL A;  1H8A C;  2QKL B;  3KP6 A;  1O57 A;  1D1C A;  3A1Y A;  3RZO J;  5GTI C;  3M3Y J;  4BS9 A;  3WE3 A;  5EEG A;  1KA8 A;  3MMY B;  4DJA A;  1TNT A;  3BG5 A;  1G3Y A;  2QSF X;  3I55 I;  2EV6 A;  3OYM A;  2MAB A;  2NNY A;  2LDU A;  2XF7 A;  5J40 A;  3TOA A;  2XRN A;  2KIF A;  3CCY A;  4AIK A;  2K4J A;  1J09 A;  1REP C;  1TTY A;  4C9Y A;  4XLN F;  3WU0 A;  1G3S A;  3FM3 A;  2IA2 A;  4UV9 A;  1X3U A;  2IS2 A;  4YFN F;  4DZP A;  5CVR A;  5DCF A;  3CDI A;  3VYU B;  2H1L A;  4D0P A;  2IS4 A;  4M72 A;  4QPO A;  1NHA A;  4AVP A;  1OYY A;  2LRE A;  4D5F A;  3CP8 A;  1QU3 A;  3OYD A;  4XBF A;  3JRB A;  3HSF A;  2MA3 A;  2WB1 N;  3PSI A;  3OSF A;  1Z3Y A;  2LRD A;  3OOP A;  4IL6 C;  3GYH X;  2Y69 H;  1HW1 A;  3E6B A;  1JHF A;  2VI6 A;  1P4X A;  1Y0N A;  1GT0 C;  5IYC J;  5E17 F;  3MVP A;  3VYR B;  2LP0 A;  5JVG F;  4BKX A;  3WG7 H;  3IV5 A;  1T2K A;  1DUX C;  4RM3 A;  3AAF A;  3ONQ A;  3HSE A;  3IRQ A;  2DA5 A;  3LSI A;  4FAS D;  2FX0 A;  3OYJ A;  1QHG A;  3C7J A;  4LK0 F;  3FHZ A;  2WY7 Q;  1QGP A;  1RI7 A;  3WU2 C;  4ENJ A;  3RKQ A;  3WTW C;  4EM0 B;  5J1U A;  2ACJ A;  1D0Y A;  4KMF A;  1F4K A;  3JTH A;  2XRL A;  3BPX A;  3I4P A;  3TO9 A;  3Q5F A;  1YJW I;  3HRT A;  3FBN B;  2YSR A;  1BL0 A;  3C1D A;  2R7W A;  5JLW A;  4XLC A;  3CUQ C;  2OV7 A;  1JJ6 C;  1X2M A;  5FKO A;  4A3L J;  1SD6 A;  2L9N A;  1WH5 A;  2HQ5 A;  1LNW A;  2AHQ A;  3QPH A;  2ID3 A;  2ZBK A;  3RZD J;  2H09 A;  3H9G A;  5JLX A;  4U88 A;  3ZQI A;  5BNG A;  5DYM A;  3C2B A;  2Z9O A;  4ZDO A;  1E2X A;  5EDN A;  5J8F A;  2HOA A;  3S3M A;  2W1O A;  3F0C A;  5J6X A;  2CFX A;  1K83 J;  2Z5U A;  1W36 D;  4I98 B;  1W4M A;  1V5G A;  2KFD A;  2X6X A;  2E1M C;  2LG4 A;  2VKV A;  3ABT A;  5IOZ A;  3KYD B;  2ME0 A;  4LLN A;  4BEH B;  1ZTR A;  3ERM A;  1MSF C;  1DGW Y;  5E8I A;  3I58 A;  2NRA C;  4L9V A;  1K61 A;  3T8R A;  3CCR I;  1GLN A;  4FTH A;  2CFO A;  3FWE A;  2Q8K A;  2DDB A;  5GAG J;  5A2Q K;  5J3L A;  2RN7 A;  4LB5 A;  1CF7 A;  4P1W A;  1B4A A;  1Z1D A;  3V8K A;  4OIP F;  3EYI A;  3FXQ A;  4OWR B;  1B9N A;  3S2W A;  2QBY B;  2CW7 A;  2H8R A;  2BV6 A;  1MMG A;  2EFN A;  4C2M J;  1ZHF A;  1Z0X A;  3ASO H;  2TCT A;  4GO1 A;  5FLV A;  3MAJ A;  1X4P A;  3V7S A;  1A6I A;  4GFB A;  3RCO A;  4UVC A;  1UMQ A;  1BN5 A;  4D5C A;  5ILV A;  1FOX A;  3MQ0 A;  2ZC2 A;  4GDF A;  4IHX A;  9ANT A;  1FBQ A;  2R7T A;  2R7O A;  3BJ6 A;  3HKZ A;  1MDM A;  1QZY A;  3BQY A;  2NS0 A;  2Y75 A;  2E7X A;  2PEX A;  2QZ8 A;  3I59 B;  3GWZ A;  1S8N A;  1GXP A;  2Y9Z A;  3TDZ C;  5LBQ A;  2K85 A;  1JT0 A;  1T95 A;  4X0G A;  1J75 A;  1POG A;  3GTL J;  5BOX A;  5C44 J;  4IKF A;  2QQA A;  2OZU A;  3I4M J;  4UUS B;  3ERE D;  4UV8 A;  4M9S A;  1JTY A;  2DJN A;  3D5R C;  4P55 A;  4U87 A;  1WJA A;  2EFO A;  4BHB A;  5FB2 A;  2YR2 A;  2JT1 A;  4Y33 A;  3Q0V A;  3CDH A;  3CQZ J;  1STZ A;  5HLH A;  2ZXJ A;  3ZMZ A;  4MQ9 F;  1R71 A;  1BW6 A;  4MFE A;  1MBF A;  3SQN A;  4MLO A;  1UAA A;  4HX4 A;  2A68 F;  3SEZ A;  2NXN B;  2VON A;  2TDX A;  4RB1 A;  1D0X A;  4K2E A;  2QLZ A;  1E3P A;  5FD5 A;  3L2R A;  2JA8 J;  5IY5 H;  1J2X A;  2ZFU A;  4BXX J;  3ECO A;  3ZQF A;  2RGV A;  3DP7 A;  2VXZ A;  2E60 A;  2Y30 A;  4Y15 A;  2EK5 A;  1J5Y A;  1GV2 A;  1HKS A;  3H35 A;  2VE9 A;  3FXK A;  3ZQQ A;  4OMZ A;  5E3M A;  4II3 A;  3G6E I;  2A6T A;  2RKH A;  5FLM J;  4CYD A;  5FFZ A;  3G3Z A;  5FKL A;  3S2H J;  1CGP A;  3EQL F;  2IEK A;  1Z7U A;  3RJP A;  2K02 A;  1B8I A;  2DA2 A;  2VJ4 A;  1DGR M;  3KP4 A;  5ERI A;  2P7V B;  3Q9V A;  2F5V A;  2X1C A;  1X1A A;  1LUJ B;  3BJA A;  4EGY A;  4WXH A;  3J81 K;  5HDG A;  1F5T A;  4M3B A;  2DYS H;  2DFI A;  2V7F A;  1YRN A;  3RSN A;  3W6J B;  3QPS A;  3DF8 A;  3ZPL A;  1K6O A;  2IS6 A;  1UG2 A;  1U0J A;  1X1C A;  1X1P A;  2EH3 A;  2O61 A;  2Y48 A;  2VBZ A;  4B44 A;  2RDP A;  2CMP A;  1XG1 A;  4BJT A;  2XB5 A;  4LIV A;  2JA6 J;  2GA2 A;  2G9W A;  1YYV A;  1WJE A;  1W1W E;  4IF4 A;  3LL7 A;  1ETX A;  2JA7 J;  2FOK A;  1ONV A;  3WE2 A;  3S1N J;  3LSH A;  2Q1Z B;  2GOX B;  1TQM A;  3DU6 A;  1T0F C;  3LQQ A;  3KET A;  1U78 A;  1HKT A;  3FK6 A;  2P5V A;  1BC8 C;  3W2V A;  4XMY A;  2O8K A;  4I0A A;  3DTI A;  4U0Y A;  3HRS A;  5LGT A;  5LGN A;  3DKW A;  2K4B A;  2LY1 A;  3WTX C;  2XGC A;  2L4M A;  2CQX A;  4CXF A;  3OYA A;  3BTJ A;  2DA6 A;  5HNH A;  5IT3 A;  2A5Y B;  1HST A;  2BY0 A;  1SD7 A;  2VBW A;  2IP2 A;  2MBF A;  2ZME B;  3NEU A;  3CCV I;  3FM5 A;  4HG2 A;  3D1N I;  3L2U A;  4BUP A;  1XCV A;  4XKB A;  4LMY A;  4CO8 A;  2GQQ A;  3OWT A;  4A6E A;  2HS5 A;  1SD4 A;  1ETQ A;  3E0J B;  4FT8 A;  3LAP A;  3BTL A;  2W82 A;  2V1X A;  3PIP F;  2A3S A;  2MH9 A;  4N0B A;  2VLA A;  2UXN A;  1O4X A;  2ZJ2 A;  2W4S A;  4BAY A;  3HTU A;  4XL9 A;  1WRJ A;  4KJZ A;  2CS3 A;  4LFU A;  2IW5 A;  1J59 A;  4XLE A;  3FXU A;  2QUF A;  1R6R A;  4I76 A;  3DTE A;  2HKO A;  2TRT A;  4NC6 A;  5JHU A;  2L7M P;  5L3G A;  4MTE A;  5M5Y J;  1FIP A;  1U5T B;  5B1B H;  3DEE A;  2BYV E;  2RRE A;  1PP8 F;  5K7Z A;  1AWC A;  4OU0 A;  3F8C A;  2HPI A;  2OPT A;  3PUF A;  1OMI A;  1PVE A;  3T8T A;  1VQ4 I;  2STT A;  1JUS A;  2GAU A;  3KZI C;  4IJA A;  3DLL F;  3ZMS A;  1MJA A;  2ICW G;  3QPT A;  1IC8 A;  4BJ6 C;  2CJJ A;  4OIN F;  1UG0 A;  2ME6 A;  3BTC A;  1W5T A;  3BG6 A;  1XD7 A;  5HOO A;  5IYB J;  1BW5 A;  1YHQ I;  4YG2 F;  2XSJ C;  3J80 Z;  2HYG D;  2GBY A;  5DEQ A;  1R5H A;  1LB2 A;  2L9V A;  1WJB A;  3CME I;  2LF8 A;  2HXO A;  3FZV A;  4E7L A;  1P6R A;  1R49 A;  4BBS J;  2HYJ A;  4N4O B;  1IZ1 A;  4FE7 A;  3TKY A;  3VB2 A;  1P4W A;  2EZL A;  3PFI A;  4FCY A;  5IP7 J;  3BR2 A;  3E5Q A;  1ZRF A;  2Z16 A;  2L9S A;  2MC3 A;  4NQW A;  4IHW A;  2OA4 A;  2DU9 A;  2M4G A;  3LST A;  4LB6 B;  3QYF A;  3N4M A;  3WTT C;  2P8T A;  3PNT A;  3DFG A;  3QYB A;  4LIU A;  2VPR A;  3HOT A;  4EEF G;  5LRS A;  3BJO A;  1T38 A;  4WWC A;  4CUG A;  2QF7 A;  3TMO A;  4C3I J;  4D1Q A;  1ON1 A;  2KHM A;  1A5J A;  2VQG A;  4CGZ A;  1I5Z A;  5F0H A;  2OTL I;  2Y0S N;  4DNC A;  2DOE A;  3GLX A;  4C2T A;  3K6G A;  1FLI A;  5IT9 Z;  2LR8 A;  3NWS A;  5KK1 A;  1Z77 A;  2EPF A;  2KPM A;  4DIQ A;  3CO6 C;  1XGO A;  4IZZ A;  1JXS A;  1JKQ C;  2VQH A;  1K4T A;  2V6C A;  2CQN A;  5EEH A;  4JX6 A;  3F6V A;  5F64 A;  1X3Z B;  3PL8 A;  2KLO A;  4KIT B;  4L0Y B;  4XRS A;  1VQ6 I;  3G1M A;  4PJL A;  4ON0 A;  5L3F A;  4XKW A;  3OIO A;  1K4S A;  1JJ8 C;  1ZN2 A;  2Y2Z A;  1JGS A;  2OJE D;  1N75 A;  2V6E A;  2JTV A;  2DTR A;  1I6X A;  1IN5 A;  5CJ9 A;  1RR8 C;  2XAS A;  3HUG B;  3ZCO A;  2MLK A;  3SEQ A;  4PUS A;  4IRH A;  2EV5 A;  1SAN A;  2K5C A;  4KIB A;  1W5C C;  3DXJ F;  2QSH X;  1FIA A;  1EF4 A;  5K5R A;  2LKP A;  4C3H J;  2F4O B;  1Y1W J;  3HOU J;  1KQ0 A;  2ID6 A;  3ECH A;  3K9T A;  5B66 C;  4KN4 X;  5DUI A;  5HS7 A;  1TNS A;  3ZQG A;  4IX7 A;  2PMZ A;  4H4K C;  4YEJ A;  2JVG A;  2PG4 A;  3KIO A;  2Z33 A;  1Q1V A;  2ZSI B;  4HOB A;  1JTX A;  3RPU A;  2ZXW H;  3GO5 A;  5TRD A;  1YJ9 I;  1X58 A;  2BY2 A;  3P9C A;  4LJZ F;  1W0T A;  1AKH A;  1DDN A;  5EYR A;  2DQR A;  1PUF B;  1R36 A;  2L7F P;  2FA5 A;  4HDU A;  2HKX A;  3BZ6 A;  4XLF A;  2W7N A;  2E35 A;  1MH3 A;  1C0W A;  2GOM A;  4A0Z A;  1LVA A;  1I6H J;  3J7Y J;  4ESJ A;  2AQE A;  3JTG A;  3A01 B;  4AC0 A;  4XIC A;  1I3Q J;  1EA3 A;  3CES A;  5CQG A;  2KL4 A;  1ORK A;  5GTH C;  2DW4 A;  4ZYE A;  4Z6Y A;  5F1R A;  1BI3 A;  3CCQ I;  1ZGA A;  2DOA A;  3F3X A;  1BC7 C;  4NDL A;  2NYX A;  5LD2 C;  4BHC A;  3W2W A;  4BE1 A;  2CV2 A;  2A07 F;  3PQJ A;  1N25 A;  2JN6 A;  2WAE A;  3NAU A;  5F04 A;  3HHH A;  3S3N A;  3KP5 A;  2IJL A;  1MW7 A;  1J0R A;  2JSP A;  4KIC A;  5EEA A;  3MKY B;  1OKR A;  2I5U A;  4UUT A;  2XGX A;  3K4L A;  1Y8R B;  3CCE I;  2R3S A;  5FRO A;  2Z2S B;  4JQF A;  3MEX A;  2OCE A;  2LOO A;  1YS6 A;  3KP3 A;  5JI6 A;  5L3D A;  4KDP A;  1TL8 A;  2WB1 A;  4S05 A;  1B72 B;  5LFA A;  1QPM A;  1WVR A;  4Y3O A;  2ZB9 A;  3TED A;  3GVA A;  2MG4 A;  2XB0 X;  1KU2 A;  2XKP A;  2H8W A;  3QOD A;  3ULQ B;  3L2C A;  1DPR A;  4P5O A;  3I4N J;  2NVQ J;  3OL3 A;  3ZQ7 A;  2NOJ B;  1W0U A;  1K7A A;  1ETW A;  2BY1 A;  3JSP A;  4HST A;  4DYC A;  1ZAO A;  4RGR A;  2HOS A;  2DFF A;  3FIW A;  2JJ7 A;  3P7N A;  3LA2 A;  3M8J A;  4PGH A;  4BEH A;  5J8C A;  5H20 A;  3RYR A;  1TWF J;  1JUP A;  3CMM A;  4ZYG A;  5ICG A;  4IEJ A;  4BQA A;  3S93 A;  1S6L A;  4IOC F;  2E2I J;  3DBH B;  1R5I D;  5B1A H;  2KDO A;  4XLA A;  4LLG F;  4HW0 A;  2F5C A;  3S15 J;  2K3P A;  2X0L A;  3FMR A;  3TP3 A;  4E7I A;  2QBY A;  3KE2 A;  1LFP A;  2V1U A;  2VQL A;  4B8X A;  5F6F A;  2X4H A;  5K7H A;  2VJI A;  1Y8Q B;  5EG0 B;  2FE3 A;  1PDN C;  2F6C A;  2Y0M A;  1XC5 A;  4RB2 C;  2X1E A;  1OFC X;  2A69 F;  2OZ6 A;  4LK1 F;  2DK5 A;  1IAW A;  1IN8 A;  3AL0 C;  1QHH D;  1MBG A;  5HLT A;  3ZRG A;  4O6J A;  3JAM Z;  1D8J A;  3KP7 A;  4ZH4 F;  1FP2 A;  3I59 A;  3BOQ A;  4EQQ A;  1G3T A;  3W6K B;  2DFE A;  5DCM B;  3GME A;  4XOR A;  1GVJ A;  1KYW A;  4KMU X;  2CQK A;  2WTE A;  2EFW A;  2DBB A;  5CVI A;  3B6C A;  3BDD A;  2EA4 A;  2R0Q C;  1E0E A;  3MFK A;  3P5J A;  4UUS A;  4XID A;  3A2K A;  5J1Y A;  3SYT A;  4G6Q A;  4G7H F;  1ZYR F;  2M2E A;  2LD5 A;  2IGM A;  3VYT B;  3OSG A;  3LSJ A;  1MKM A;  1FWZ A;  3ABU A;  3GFJ A;  3O3K A;  3EUK L;  3HIF A;  3LSG A;  4M3G A;  4RAZ A;  1DP3 A;  3IC7 A;  4A3B J;  2P6T A;  2F4I A;  2CO5 A;  2M7A A;  3GBG A;  5KCM A;  2B63 J;  4WCG A;  2RNJ A;  1OR7 C;  1P2F A;  1VQK I;  3CJN A;  2FUG 2;  2DJI A;  2C6Y A;  4A3C J;  4Q47 A;  1BI2 A;  2HQA A;  2LKS A;  4OIQ F;  4I09 A;  3COA C;  2XGD A;  2R7V A;  2CUZ A;  3VYS B;  3EPZ A;  5J47 A;  3JRE A;  2O9L A;  3L00 A;  4ZTJ A;  1TWH J;  1WHU A;  3FKI J;  1U2W A;  3OYL A;  3OS2 A;  2NVU B;  2P6S A;  3WGG A;  2CW8 A;  3BCB A;  3T0Y A;  1T08 B;  4HPQ A;  4HNT A;  5LHH A;  1MNM C;  3HM5 A;  1LEB A;  2FRH A;  4G9Y A;  4R79 A;  1ZH5 A;  5LEJ A;  3ZR8 X;  1IRZ A;  3OR2 C;  3OYF A;  3KZY A;  4F93 B;  1YIO A;  1ETK A;  2OBP A;  4HEA 2;  4G6D A;  1HW5 A;  1MJB A;  2JPB A;  4HX7 A;  5ICF A;  2WAD A;  1ON2 A;  4LLL A;  2XAF A;  3FX3 A;  3Q9S A;  1AHD P;  3ML6 A;  3KP2 A;  2X6W A;  2KJB A;  3CC7 I;  2HNH A;  3W3C A;  3BG7 A;  2QQ9 A;  1G3W A;  3RDI A;  3QOE A;  1A6Q A;  1BJA A;  3IUO A;  1CQT A;  4IQJ A;  1IDZ A;  2EB7 A;  2DMT A;  2HGC A;  1FOW A;  4PK4 A;  5FKN A;  3QP6 A;  3F8N A;  1R23 A;  5TJJ A;  2IGK A;  3SDB A;  2A61 A;  1IG7 A;  3HGY A;  4MO7 A;  2HZD A;  1Z7L A;  1G8X A;  1QVT A;  2DN0 A;  4RMN A;  1X1B A;  4TV7 A;  1OJL A;  2D45 A;  1FBU A;  1JHH A;  1DU6 A;  3FXO A;  2NS8 A;  5F0C A;  1YG2 A;  2COB A;  2XF6 A;  2F5E A;  4Q48 A;  3IKV A;  1MMN A;  4A69 C;  2R5Y B;  3N97 A;  1L3L A;  2ZME A;  4IRG A;  6PAX A;  3VWB A;  1UHM A;  2CV1 A;  1BOB A;  3LOC A;  4FHT A;  4V2F A;  2PX9 A;  4PSW A;  1AA7 A;  1R22 A;  2DK8 A;  2L2O A;  3M8E A;  4Z2Y A;  2V79 A;  4NHJ A;  3LA3 A;  1H89 C;  3JRH A;  1MMA A;  1OQY A;  4NNJ A;  2E5Z A;  3H0D A;  3VFZ A;  3BR1 A;  2HTJ A;  2DDA A;  2WV0 A;  4BBR J;  1IDY A;  5DDG A;  1HBX G;  1I3A A;  5KNL A;  2KQR A;  4A0Y A;  2M34 A;  1X1D A;  2PJR A;  2AO9 A;  1Y0U A;  3OOU A;  4ENM A;  1K78 B;  2ZKZ A;  1VQL I;  1BIB A;  2FF4 A;  3LSM A;  4RB0 A;  4PDK A;  2WAQ N;  5KHD A;  2YU9 J;  3D0S A;  4ESB A;  4AYB N;  2QKM B;  3DKY A;  1J7K A;  4FE4 A;  1WKM A;  1HCR A;  1U5T A;  1DQU A;  4M9X A;  4EMS A;  4U7B A;  3CUO A;  3O8H A;  3BR3 A;  1TW2 A;  4G6T B;  3ZMV A;  1YLF A;  1APL C;  2DA1 A;  2H94 A;  4B3A A;  2XSD C;  3GZ6 A;  2CV0 A;  1S7A A;  3GW2 A;  2O5R A;  1YQA A;  3HOZ J;  4GGG A;  3K2A A;  2ELK A;  1JKR C;  5GAE J;  5K7F A;  2VIX A;  2O3F A;  4XON A;  2CUJ A;  4L0Z B;  2Q2E B;  3K1N A;  5C4J J;  1IN4 A;  4FX4 A;  1OPC A;  2BVM A;  2B9S A;  1JUM A;  1DU0 A;  1XGN A;  2QEX I;  1XGM A;  1GUU A;  1IN6 A;  1KYZ A;  3FKJ A;  3HOY J;  1YI2 I;  1ITY A;  1NG7 A;  3VEP A;  4HLX A;  3ZMD A;  3GTG J;  3CCS I;  4C30 A;  3HL2 A;  3SZT A;  3BLY A;  3BZC A;  3S16 J;  1MBJ A;  2ZCW A;  2BBY A;  4B48 A;  2HDW A;  3DCF A;  1KU9 A;  2M8E A;  3KFW X;  3RQI A;  1TQP A;  1FBS A;  1EJ9 A;  4CCJ A;  1XGS A;  4HZF A;  2QM3 A;  3PNY A;  3GLL A;  1D5Y A;  2R5Z B;  2V9V A;  2ZXI A;  3A03 A;  1RKT A;  2K9N A;  4HLY A;  1TT5 B;  4KN7 X;  4L9N A;  3CCM I;  2HVQ A;  4R1H A;  4BDY A;  3RQ4 A;  3FBI B;  3UKG A;  5D5U B;  3FXL A;  3HPG A;  2QGU A;  2VE8 A;  4RDU A;  3PUB A;  4W97 A;  4KIF A;  5KVR A;  2WC2 A;  5IOY A;  3BTI A;  1OCT C;  1RZ4 A;  2VN2 A;  2UXX A;  2EV0 A;  2I8D A;  4DYR A;  1ZKG A;  1QVU A;  3V42 A;  2W57 A;  2JZY A;  4QPQ A;  1FOK A;  3HDD A;  3H3Z A;  4KT6 A;  1FSE A;  4AWX B;  4L5I A;  2DFH A;  2XAH A;  2DCE A;  2MYS A;  2D2W A;  3O2P E;  5IYD J;  2X48 A;  1T8I A;  2BW3 B;  2M5W A;  2CQ7 A;  1LFU P;  3CC2 I;  3LSR A;  2FQ3 A;  4FET A;  1W7P A;  3PQK A;  3L9F A;  2CG4 A;  3K7A J;  4X1E A;  3M8F A;  4EGZ A;  1U6G A;  4A3J J;  1T56 A;  5ILS A;  4F91 B;  2M8G X;  4CSW A;  5E18 F;  3VDX A;  2VQC A;  2IA0 A;  4JP0 A;  2RQQ A;  5E79 C;  3DBR B;  2CUE A;  4WX9 A;  4WF2 A;  5IP6 A;  5LEK A;  5FFX A;  3A0B C;  2DT5 A;  3CUQ B;  3MZY A;  5LGU A;  3PNV A;  1I1G A;  2VT2 A;  2MD0 A;  3HZJ A;  2WWY A;  1B59 A;  3HGG A;  1SFK A;  2V9P A;  2EBI A;  3N05 A;  4DZJ A;  5LLQ A;  4XN3 A;  4N4N B;  2HOE A;  4CCN A;  3I56 I;  1EV7 A;  3JRA A;  1NH3 A;  2V4J C;  2DI3 A;  1YX3 A;  3J80 K;  2M4K A;  3LFK A;  5BMZ A;  1LEA A;  1LE8 B;  4A0X A;  5D4R A;  5D4S A;  4XK4 A;  1G59 A;  2A6E F;  2IS1 A;  1Q1H A;  4BHP A;  3F22 A;  4UHT A;  3HSR A;  3OYI A;  3LSP A;  2PMH A;  1JE8 A;  1PUF A;  2E1M B;  4GYG A;  4HBL A;  2HDD A;  3HRU A;  4R8H A;  3L09 A;  1JKP C;  3FXM A;  2VPL A;  3AKZ A;  4AIJ A;  4QLC U;  1FPQ A;  2PJP A;  2K9L A;  2A5W A;  2O03 A;  4RGS A;  3A01 A;  4OAZ A;  1S9H A;  2M9H A;  3IL2 A;  2GIZ A;  4LG0 A;  4KA4 A;  4A3I J;  4O3M A;  4HV5 A;  1FEX A;  2CWE A;  4O5V A;  2VBX A;  4XOT A;  5FJ8 J;  4BE0 A;  5F27 A;  1HKQ A;  1ZR2 A;  5JFR A;  1IGN A;  2QQ8 A;  5GP9 A;  3V8J A;  5HLI A;  1ZRC A;  1XDS A;  3DBL B;  3EDP A;  1O7F A;  4LOC A;  4NB5 A;  1V54 H;  3Q3S A;  2LC2 A;  2XPW A;  1PJR A;  2IA1 A;  5IT9 K;  1MNE A;  3DQV C;  2K86 A;  3IAS 2;  3S2D J;  1FTZ A;  4HQE A;  1RR7 A;  3VPR A;  4OIO F;  1G6N A;  4EVI A;  4N9I A;  3I71 A;  4Y17 A;  1LJ9 A;  2R7F A;  4X6A J;  2XAQ A;  5HS9 A;  4QWQ A;  3U21 A;  1EH6 A;  4N9H A;  1SFE A;  2L7Z A;  3TO7 A;  1H0M A;  1X3W B;  4E7Z A;  1WZ2 A;  4IRI A;  3E6C C;  3DEU A;  1SAX A;  1YJN I;  2CYY A;  2KT0 A;  5M5W J;  3I3L A;  2YS9 A;  4KUM A;  1B72 A;  3HKZ N;  3CCJ I;  3MD2 A;  2V1N A;  5D6E A;  3IH4 A;  2XC7 A;  5DV5 A;  4XRF A;  3K4K A;  3OY9 A;  3J7A O;  2XKO A;  1JGG A;  2ZXH A;  4CCL A;  5HOD A;  1WFX A;  3DPT A;  4KFC A;  5AON A;  2NOG A;  5EGO B;  2AQF A;  2F5F A;  2BHZ A;  2EFQ A;  2HZT A;  4Q4Z F;  4IVN A;  2CQQ A;  3TL4 X;  2STW A;  4NC8 A;  2KDZ A;  2B7E A;  1B9M A;  4RAG A;  1UB9 A;  2L54 A;  2RNG A;  4QIW N;  2ELJ A;  2DMU A;  2M30 A;  4LG3 A;  1D1A A;  5FLX Z;  1YW8 A;  3OR1 C;  3VSK A;  4OMY A;  3H36 A;  1EH8 A;  1IO2 A;  1IXS B;  1WPK A;  2GXA A;  3HG9 A;  5C4X J;  2L0K A;  3GUD A;  2L5Q A;  3E5U A;  5LHG A;  3NAR A;  1QQI A;  5EJC A;  4E70 A;  4ZDL A;  3OIQ A;  5HS8 A;  1VFC A;  3H5A A;  1T98 A;  5EG0 A;  5ICE A;  1VQ7 I;  1YS7 A;  1R1U A;  1TWC J;  4EM2 A;  4RBO A;  2MGQ A;  1OCP A;  2R4G A;  2VKE A;  4ZZL A;  2BXZ A;  5D5V B;  1R1V A;  2LY9 A;  5FKM A;  3HOW J;  3DPU A;  1U8R A;  2OQG A;  3GTO J;  1ERD A;  3D5L A;  4L9J A;  2JK3 A;  3UNG C;  1YIT I;  5DCM A;  4A5M A;  4DQ2 A;  3E1S A;  3PFY A;  2Q0O A;  2YPR A;  3R4K A;  1ACI A;  1OCZ H;  2KRF A;  2DA7 A;  1TC3 C;  2OU2 A;  4P9U A;  2DT6 A;  2GM4 A;  4F52 A;  1BI1 A;  1IUY A;  2MSY A;  3HOS A;  1LQ1 A;  4PGG A;  3OV8 A;  2GIV A;  2VAS A;  3GTP J;  4CCK A;  4YEL A;  3ZMU A;  1IXC A;  2CH0 A;  4FIS A;  1FY7 A;  3OYG A;  2DPD A;  3KEY A;  1U9N A;  4V2G A;  3PM1 A;  1Z9C A;  3BR6 A;  4F3Q A;  4B1R A;  4XR6 A;  3K70 C;  3IHU A;  3S1M J;  5E20 A;  2UV1 A;  4IO9 F;  1TWA J;  2ETH A;  2HTS A;  2HEO A;  3BC8 A;  3CZ6 A;  3H1C A;  4L18 B;  3DWL E;  3HOX J;  4NBQ A;  2KZG A;  2M7B A;  4PCQ A;  5CVJ A;  3WG9 A;  5IPA A;  2QEN A;  2X1D A;  3GF2 A;  1H9G A;  1Z6T A;  1TT0 A;  2DT7 B;  2DPU A;  1EKE A;  1G2H A;  3FXJ A;  1Z91 A;  2JPC A;  3U2R A;  1BIA A;  2BHY A;  5HLG A;  4KNY A;  1XX5 A;  1S72 I;  3S1Q J;  1RUO A;  4UB8 C;  2KIU A;  1ODD A;  1YOV B;  1TQI A;  2ZJR F;  2LMD A;  5E1X A;  1ETV A;  3V7C A;  1A31 A;  4XNF A;  4Y7N J;  3K10 A;  2NNN A;  3HJE A;  3GCM A;  2D1V A;  1QO0 D;  2FNP A;  4ANJ A;  1JT6 A;  2E2H J;  2E1O A;  2QCO A;  1KGS A;  2UZK A;  3I0T A;  1R4M B;  3JRI A;  4OIR F;  1NK2 P;  4IXA A;  3F6O A;  1Z05 A;  4PJ0 C;  1FYM A;  2CGP A;  2R7D A;  2LTP A;  2YX4 A;  3QOP A;  2R92 J;  4JX5 A;  1MMS A;  2A6H F;  2F48 A;  2HU9 A;  3TBI A;  2O0Y A;  5BS6 A;  5FO5 A;  3O8G A;  5FD6 A;  3K69 A;  1HDP A;  2A05 A;  3P9I A;  2OF7 A;  1SFX A;  1MMD A;  2KRC A;  5GAD J;  3JAM K;  3GTK J;  4BL0 B;  3CD6 I;  4ENK A;  3FHN A;  2EWN A;  2K40 A;  3ZP5 A;  4HDV A;  1MGT A;  2GLO A;  3HOV J;  2DA4 A;  2KP6 A;  4CDG A;  2R5Y A;  1WJC A;  2ZFW A;  2E2J J;  2EIK H;  1YX5 A;  1FNN A;  2XIG A;  4B43 A;  4G94 A;  4BXU A;  3FK7 A;  1IF1 A;  2DO7 A;  4S04 A;  3V4G A;  2H1K A;  2P81 A;  4AUX A;  5GPC A;  2H27 A;  1XMX A;  1DP7 P;  3LQR A;  2XAG A;  3TP0 A;  4MEY F;  1S3J A;  2OQR A;  4RS8 A;  5J4Y A;  2WV1 A;  2BOL A;  3KX2 A;  2JQ7 A;  2LH9 A;  1GVD A;  1OLT A;  1R5G A;  2J5O A;  2JUG A;  4CIC A;  4E7H A;  5H6Q A;  4ETS A;  1KZH A;  2OD5 A;  2CW0 F;  2EFP A;  3REO A;  4YIF A;  3DLA A;  3BG3 A;  3DTK A;  4U0V A;  4C3J J;  4IPA A;  4D7N A;  1VI0 A;  4JBA A;  4XSZ F;  5FRN A;  4XM3 A;  2YX7 A;  3WTS C;  1K78 A;  1RES A;  2GXG A;  4PFP A;  2HDC A;  3QPL A;  1RET A;  3TGN A;  2GXB A;  4BDZ A;  1RRJ A;  1VQ8 I;  3WHB A;  2FXA A;  4OOI A;  4EM1 A;  1X2N A;  5L3E A;  2Z3Y A;  1Z67 A;  1PUE E;  2VOD A;  4CH7 A;  3O6B B;  1WCM J;  5E3L A;  3ELK A;  3QWL A;  1A36 A;  2W85 A;  2K27 A;  3H92 A;  2W25 A;  4E4H A;  4HNU A;  1BR4 A;  1YO5 C;  4PSX A;  2QYO A;  3H9J A;  3KYC B;  4KIG A;  2ESN A;  2E1C A;  5J1R A;  2QVO A;  3IH2 A;  2Q2E A;  1W36 C;  2HVS A;  3VOE A;  5E8G A;  3GFL A;  1LFB A;  3ABK H;  3GX4 X;  5HDK A;  1O7L A;  2IGN A;  2FEZ A;  4EJO A;  3WTU C;  2LKX A;  3ZQH A;  2XF5 A;  2WA0 A;  2G7H A;  1F36 A;  2JRM A;  4NQW B;  4W1U A;  2O6G E;  2FBI A;  2ELH A;  3CO7 C;  2V1D A;  3SFZ A;  4RAF A;  5ILU A;  4J00 A;  5BPI A;  2WAQ A;  1HQC A;  2FBH A;  3E3V A;  2XGE A;  1XN7 A;  3K4C A;  4DW6 A;  1L0O C;  3AG3 H;  2PI0 A;  4CCO A;  1HSJ A;  2JVH A;  3C3W A;  4BH9 A;  3GEZ A;  3SXY A;  4ZJZ A;  5EZH A;  1E3H A;  2R5Z A;  1Y39 A;  5GPA A;  3CJT B;  2GWR A;  2JWT A;  5DM6 F;  3K70 D;  2Z99 A;  3SZP A;  4ABZ A;  3HPH A;  3MZH A;  1S7O A;  2VC1 A;  3HBL A;  2H6B A;  2XHK A;  3FXR A;  1P9Q C;  2XV4 S;  5D8L B;  1TP4 A;  3BR5 A;  1SMY F;  1WJD A;  2LVS A;  2P4W A;  3RKY A;  3ABL H;  4YIR X;  4ZC3 A;  2I10 A;  1MIJ A;  4JX4 A;  2IPQ X;  2W84 A;  1I27 A;  1D8K A;  3CP2 A;  3QAH A;  4Q5S F;  2R7R A;  2EJR A;  4YII A;  3I5U A;  1WI9 A;  3K2Z A;  3LA7 A;  2YUS A;  4FX0 A;  3U1K A;  4D9J A;  2IXS A;  4G7O F;  4HA8 A;  4LIT A;  5CKT A;  4UUV A;  4MTD A;  4I6Z A;  2IT0 A;  1IRG A;  2VBY A;  2XAJ A;  2E1N A;  4B3X A;  1U3E M;  2UWM A;  2ZNZ A;  5F0F A;  2P5L C;  3PSF A;  3BQZ A;  4ZYA A;  1R1T A;  5TGT A;  1SFO J;  5DS9 A;  4PZJ A;  3LSK A;  4NUB A;  4D7M A;  4HYE A;  1S7E A;  2D1H A;  4XSX F;  3G4S I;  3L1P A;  3OYN A;  3OYB A;  2LY2 A;  4OAY A;  2KIS A;  3CUQ A;  4RGX A;  3TW6 A;  2FU4 A;  3JRF A;  2HR3 A;  2ZSH B;  3JCU C;  3X2Q H;  2K9M A;  4LGW A;  2CSO A;  4PFO A;  2ESH A;  3QYE A;  5CYV A;  1AKH B;  3L7W A;  1I50 J;  2VOO A;  4CCM A;  2M0C A;  1O3R A;  1PYV A;  1ZG5 A;  3BZK A;  1BBY A;  4M3D A;  2PBI A;  4YFK F;  1BR1 A;  2IBD A;  2MW8 A;  3CTA A;  3S8P A;  3ZN1 A;  4GRI A;  1LE8 A;  3FMQ A;  4E7S A;  3L2W A;  4B09 A;  2FSW A;  2G0E A;  4JK1 X;  1X4O A;  3K4M A;  4M71 A;  2FBK A;  4DBQ A;  4UB6 C;  5CPR B;  3CF2 A;  4BE2 A;  4MIM A;  5H2F C;  4XRS G;  1E17 A;  1P92 A;  3M7G A;  3J7A Y;  2M45 A;  3KCC A;  2DXI A;  1IRF A;  2LBF B;  2ZNY A;  4KT5 C;  2HVR A;  2JSC A;  2DMP A;  2DLL A;  3RPU D;  1YE9 A;  1SEU A;  2IRF G;  3M07 A;  3VSL A;  3WOD F;  4M9Z A;  1IXR C;  1BI0 A;  5FGM A;  3H5N A;  4B47 A;  2JMW A;  3J7Z I;  2PFB A;  2NVX J;  1BOA A;  5L3B A;  2W24 A;  1LKX A;  4L9T A;  3WTZ A;  1TLH B;  1P7J A;  3OS1 A;  2E19 A;  2LK2 A;  4ZDP A;  3KLO A;  2M0M A;  4E6K G;  4HRI A;  1LPQ A;  4F92 B;  1ZK8 A;  3R0A A;  3AL0 B;  2XRO A;  1BR2 A;  1RUN A;  1USS A;  3GTJ J;  5AIQ A;  1SVL A;  3JW4 A;  3LWF A;  3FIS A;  3GTQ J;  2GA1 A;  3C2G A;  2AXL A;  3IRR A;  1W5S A;  1IW7 F;  2FML A;  3C18 A;  3GFM A;  1GHC A;  4P96 A;  2P5K A;  2KZV A;  3HC7 A;  1K79 A;  2R7S A;  4ZYD A;  4A3D J;  3IP4 B;  4BQO A;  2E71 A;  4M6V A;  4XRM A;  1RC9 A;  1X19 A;  1UEL B;  2EZH A;  2ZJP F;  1QZE A;  2KMU A;  2EIM H;  4XLP F;  5F1J A;  4U7D A;  4E7J A;  4DYQ A;  1AOY A;  2ZME C;  1D3Y A;  4U0W A;  2MH2 A;  5EGO A;  2D5V A;  4H0E A;  4HSR A;  3JRG A;  4M3F A;  1V55 H;  5HDN A;  5JR3 A;  4UNO A;  4GYI A;  2CU7 A;  1O3S A;  4XKV A;  1IV8 A;  4FQG A;  1Z6R A;  4UXN A;  3U1D A;  1MBH A;  5CVU A;  3QP5 A;  3PO2 J;  4M74 A;  3OYE A;  4MFD A;  3UR3 C;  1XDU A;  3IAM 2;  2OUM A;  1ZLK A;  3AFH A;  3GFI A;  4M73 A;  1BM9 A;  1MBE A;  3S3O A;  5KAF C;  2XUB A;  1VTN C;  4HAM A;  1GXQ A;  4XN0 A;  1UFM A;  2BE5 F;  3KYL A;  3HTS B;  4EJU A;  2RAE A;  1XMK A;  3ESW B;  1U5T C;  2ECB A;  2CRG A;  4A2U A;  3JSO A;  2R7X A;  4L5J A;  3BP8 A;  2X85 A;  1ETY A;  2Y9Y A;  4ASN A;  1GV5 A;  1YW7 A;  2VXD A;  1XSX A;  2FJ1 A;  3PIO F;  4EAT A;  1T0F A;  5DM7 F;  4CYC B;  4IHT A;  1FTT A;  3ZXS A;  4HNV A;  1Y6I A;  2JA5 J;  2VL8 A;  5K1Y A;  3T5X A;  1MSE C;  3LNQ A;  3R60 A;  2KJC A;  1XCB A;  4M6Y A;  1V5E A;  1OIS A;  3ZMT A;  3GZ5 A;  2O8X A;  4RGU A;  4EJW A;  2VOP A;  3TW7 A;  4J01 A;  1WSU A;  1TW3 A;  4BYY A;  3C2H A;  1SMT A;  1D5V A;  3HUG A;  4RLQ A;  4WXC A;  2P0W A;  3H5R A;  4UVB A;  4XLH A;  1WGX A;  3TQN A;  4J19 A;  4A3K J;  4A5N A;  2BGC A;  2L4A A;  2RV8 A;  2LF7 A;  2IAI A;  5BPD A;  1ETO A;  2MD5 A;  2ISY A;  2NAZ A;  5J4V A;  3M1E A;  1R7J A;  2Y0S A;  1OCO H;  2WY8 Q;  3LFU A;  1KQ9 A;  2E7W A;  3OL4 A;  5A2Q Z;  1TWG J;  2KIM A;  1MH4 A;  1MZB A;  3E5X A;  3I54 A;  3IWF A;  3WGI A;  1VQM I;  4Y4R A;  1FSH A;  2X51 A;  4Y13 A;  3F8M A;  3PO3 J;  3CMA I;  5DTD A;  4AD9 A;  4A93 J;  5BQT A;  4IHV A;  2M87 A;  3CC4 I;  1GDT A;  4HF2 A;  1S5L C;  1FYK A;  5HVQ C;  1A04 A;  1NG6 A;  1QRY A;  3A02 A;  3K0L A;  3RTR A;  3A4C A;  3ZOB A;  3L2V A;  1YW9 A;  2VJJ A;  1NK3 P;  5FLX K;  1WH7 A;  2IGO A;  1KON A;  3QRF F;  1F9N A;  5GAH J;  1FC3 A;  1IV6 A;  2R7Z J;  2R7U A;  1MJ9 A;  3RI4 A;  3K4B A;  4RB3 C;  1LDJ A;  2EIL H;  3QQA A;  5IP9 J;  1UJ8 A;  5H6R A;  2BZT A;  4CA0 A;  3OYH A;  1VQO I;  2IVM A;  1XB4 A;  3VOD A;  4BGD A;  1RPW A;  1R9T J;  1R00 A;  2O7O A;  3I64 A;  4UVA A;  2DYR H;  4XKC A;  3CLQ A;  4I7H A;  1MND A;  1UHW A;  1KU7 A;  3PJR A;  3K4N A;  4ZZD A;  5D5W B;  2DMN A;  3LAJ A;  2DOD A;  1VND A;  2K3F A;  2ZJQ F;  2HI3 A;  3HRM A;  5EF6 A;  1T39 A;  4AM3 A;  3DEW A;  5C3E J;  2AXT C;  4CZC A;  3CLO A;  3AG1 H;  3R61 A;  1N77 A;  3F9K A;  1F43 A;  2K7L A;  5FRM A;  3R0J A;  1SVO A;  4GCV A;  1Y1V J;  5FKK A;  3NWT A;  2FD5 A;  1ZAR A;  5KAI C;  3BRO A;  3TO6 A;  4DGW B;  1VQ5 I;  4A12 A;  2V26 A;  3BPV A;  3TDU C;  4YFX F;  2AS5 F;  2PJR B;  2X6O A;  3G2B A;  1M1E B;  4I2O A;  4RM2 A;  3H9Q A;  2L02 A;  1ULY A;  4B4C A;  3RPQ A;  3NRV A;  3S14 J;  1D0Z A;  2VJ5 A;  4QSH A;  3T1B A;  4BQQ A;  2DQL A;  1SC7 A;  4BU2 A;  5CQE A;  4MEX F;  1I1S A;  4ZYH A;  3ZGK A;  5K5Q A;  3OMY A;  1T33 A;  1R58 A;  5LHI A;  5M3F J;  3J81 Z;  1JKO C;  4II2 A;  3S17 J;  4I01 A;  1DPU A;  2RQP A;  1CF7 B;  4M3E A;  4A3M J;  2MC4 A;  1B6A A;  4PJJ A;  3GXO A;  2ECC A;  3GZN B;  3BR0 A;  2PN6 A;  3CCU I;  4A6D A;  4AVZ A;  3ISP A;  2Z1D A;  1JI8 A;  3FMS A;  3E97 A;  3JRC A;  4WK8 F;  1VZ0 A;  4I0B A;  1MBK A;  1UST A;  1WI3 A;  1T6S A;  2EZI A;  3E6M A;  3HHG A;  1S29 A;  3KZZ A;  1E3O C;  5B5E C;  5DUK A;  4BJ5 C;  3W6V A;  4MGR A;  5EZG A;  2L3D A;  1SVM A;  1MDM B;  4PJM A;  2DA3 A;  3WTV C;  2G7U A;  2LYC A;  3F8B A;  2ZO4 A;  1ZG1 A;  1ZRD A;  2OTJ I;  2RVC A;  3HYI A;  2NS7 A;  3L2Q A;  3B02 A;  2F5D A;  3D5S C;  2OAZ A;  1HA8 A;  3K4J A;  3RYP A;  2V9K A;  5ICC A;  2HPM A;  5E1W A;  3KEQ A;  1ZLJ A;  1QA6 A;  1G4D A;  3G71 I;  1IUF A;  1OCR H;  1YTY A;  2NVT J;  4A3E J;  1YFH A;  2QA4 I;  3EUH A;  3MKZ A;  3P9K A;  2OC6 A;  2PQ8 A;  1FZP B;  4BNC A;  1FOY A;  3AG4 H;  2HFH A;  2BEO A;  2K9S A;  3BT9 A;  2HYF A;  2KRH A;  3BCA A;  1ENH A;  1QBJ A;  2QSG X;  4KIS A;  4ITV A;  1WJ5 A;  2X9D A;  2LLK A;  2VB6 A;  2K9Q A;  1WJF A;  2JA2 A;  3CJQ B;  3DKX A;  3F23 A;  1ZQ3 P;  2WBM A;  4RAY A;  3ABM H;  3OIP A;  3CDL A;  1XS9 A;  1H88 C;  1EH7 A;  4QTR A;  5D8K B;  5AIP A;  1UCR A;  2R93 J;  2XDV A;  4HV6 A;  2EZK A;  1VQ9 I;  3SHF A;  1W7P B;  4HQM A;  1P7I A;  2B0L A;  3MCZ A;  3MKW B;  1B8I B;  1VQP I;  3WGH A;  3FDY A;  4CHU A;  2EQR A;  2J5P A;  2MLG A;  3SFI A;  4A3F J;  1YRN B;  1U8B A;  1OCC H;  2DAO A;  1VQN I;  1U9O A;  4XOP A;  3ZQL A;  2F4M B;  4IQ4 A;  3H3V K;  4F55 A;  3IWZ A;  3MKL A;  2M3A A;  4MNU A;  4G7Z F;  4AID A;  3OS0 A;  4P9F A;  1QPI A;  3V7R A;  2HQN A;  2FQ4 A;  3H0G J;  2XAU A;  1K6Y A;  3M9A A;  2MFZ A;  5LRR A;  1TZL A;  2EIN H;  3G73 A;  2PLY A;  4V19 K;  1W7P D;  3EUH C;  3HB9 A;  4DOZ A;  4EJV A;  1ZRE A;  1OYW A;  1R4N B;  4UY8 I;  2RC4 A;  5F08 A;  1V4R A;  3CMY A;  1TBX A;  1XSV A;  2X6Y A;  3ROU A;  3KEO A;  2FMY A;  2KKO A;  2DTZ A;  3JR9 A;  3G1L A;  3ZQC A;  3WU1 B;  3K1M A;  5ED4 A;  1FP1 D;  3G1O A;  3CCL I;  2W00 A;  2R7Q A;  3U9G A;  3S1R J;  5D6F A;  3QU3 A;  2ISZ A;  3MZ8 A; 
#chains in the Genus database with same CATH homology
 4CCJ A;  2HPI A;  3PNY A;  3PSF A;  2ZXI A;  4ZYA A;  5TGT A;  1LVK A;  2LBF A;  3LSK A;  4NUB A;  4BJ6 C;  3OYC A;  1Z21 A;  2HVQ A;  4BDY A;  1UG0 A;  3RQ4 A;  3OYN A;  3FBI B;  3HPG A;  3OYB A;  2LY2 A;  3BG6 A;  4OAY A;  4YRV A;  1V5F A;  5HOO A;  3PUB A;  2ZSH B;  2K9M A;  2XSJ C;  4PJN A;  4PFO A;  3QYE A;  2I8D A;  3V42 A;  1WJB A;  4CCM A;  4QPQ A;  4C2U A;  1PYV A;  4E7L A;  1IRX A;  4KT6 A;  4N4O B;  3EUA A;  1BR1 A;  1Z3X A;  2DCE A;  2MYS A;  3S8P A;  4GRI A;  3LMM A;  2BW3 B;  4E7S A;  3L2W A;  3SZG A;  1X4O A;  4FET A;  3K4M A;  2Z16 A;  4DBQ A;  5CPR B;  4BE2 A;  2L9S A;  3CF2 A;  2UUZ A;  4E7K A;  4F91 B;  3J7A Y;  2M4G A;  3S32 A;  3QYF A;  4CSW A;  2DXI A;  3PNT A;  3I9V 2;  3QYB A;  4LIU A;  2LBF B;  3VDX A;  1LDK B;  2VQC A;  3HOT A;  2HVR A;  2RQQ A;  3RPU D;  3CJR B;  4CUG A;  1YE9 A;  3TMO A;  4BQN A;  4DBR A;  3W2A A;  3M1C A;  1ZEL A;  4D1Q A;  4BAC A;  3VSL A;  2KHM A;  2L7K A;  2VQG A;  3H5N A;  5HNF A;  4B47 A;  3PNV A;  1FMV A;  2MD0 A;  1SFK A;  3N05 A;  4JOM A;  4XN3 A;  4C2T A;  3K6G A;  1LKX A;  4N4N B;  3NWS A;  2KPM A;  4DIQ A;  4CCN A;  3OS1 A;  4IZZ A;  4ZDP A;  4E6K G;  2M0M A;  2V4J C;  4HRI A;  1YX3 A;  2WAF A;  2VQH A;  4F92 B;  2M4K A;  3AL0 B;  3PL8 A;  1BR2 A;  2KLO A;  4KIT B;  1G59 A;  2IS1 A;  2E5N A;  4PJL A;  3OYI A;  4XKW A;  2E1M B;  3C2G A;  2V6E A;  1N75 A;  1D1B A;  2VPL A;  3AKZ A;  4NC7 A;  4AYB A;  2K9L A;  2VKH A;  2A5W A;  4XQF A;  3HUG B;  3ZCO A;  3DPL C;  3HXL A;  3SEQ A;  4PUS A;  2KZV A;  2K5C A;  3HC7 A;  1Y56 A;  4OAZ A;  1S9H A;  5JHF A;  2R7S A;  3IP4 B;  3OYK A;  4BQO A;  1N78 A;  4ZTF A;  2VKD A;  4XOT A;  4BE0 A;  4IX7 A;  1X19 A;  1UEL B;  2PMZ A;  4H4K C;  4YEJ A;  2KMU A;  2JVG A;  4AU7 A;  2ZSI B;  4E7J A;  2LC2 A;  1PJR A;  3DU5 A;  1MNE A;  3DQV C;  3IAS 2;  4HSR A;  4XLF A;  4RLF A;  4BXF A;  2W7N A;  3U21 A;  4XKV A;  2BW3 A;  2GOM A;  1SAU A;  2AQE A;  4E7Z A;  1EA3 A;  3CES A;  1FMW A;  5CQG A;  2KL4 A;  2BVL A;  3OYE A;  2QKL B;  3UR3 C;  3I3L A;  1D1C A;  3IAM 2;  2V1N A;  3MD2 A;  3A1Y A;  2XC7 A;  2OUM A;  2DOA A;  3K4K A;  3OY9 A;  4BS9 A;  3AFH A;  2ZXH A;  4CCL A;  3S3O A;  1WFX A;  5LD2 C;  3MMY B;  4DJA A;  3DPT A;  4XN0 A;  3W2W A;  3KYL A;  4BE1 A;  2CV2 A;  3OYM A;  2WAE A;  2MAB A;  2AQF A;  2XF7 A;  3TL4 X;  2R7X A;  4NC8 A;  3S3N A;  2X85 A;  2RNG A;  1MW7 A;  2JSP A;  1J09 A;  4C9Y A;  2ELJ A;  2VXD A;  4LG3 A;  1D1A A;  3MKY B;  4EAT A;  2IS2 A;  3OR1 C;  3VSK A;  3K4L A;  3ZXS A;  1Y6I A;  3VYU B;  2IS4 A;  2VL8 A;  5FRO A;  3HG9 A;  2Z2S B;  4QPO A;  4JQF A;  1QU3 A;  2L5Q A;  2LRE A;  1V5E A;  3CP8 A;  2LOO A;  3OYD A;  3PSI A;  1Z3Y A;  2LRD A;  2WB1 A;  4ZDL A;  5LFA A;  4J01 A;  3OIQ A;  4Y3O A;  3H5A A;  3C2H A;  4RLQ A;  3VYR B;  2P0W A;  3H5R A;  4XLH A;  3QOD A;  2R4G A;  4P5O A;  4RM3 A;  3OL3 A;  2NOJ B;  3ONQ A;  3LSI A;  4FAS D;  3DPU A;  3OYJ A;  1QHG A;  4HST A;  2Y0S A;  2WY8 Q;  2WY7 Q;  3LFU A;  1ERD A;  3D5L A;  3OL4 A;  3UNG C;  3M8J A;  4BEH A;  3E1S A;  3PFY A;  4Y4R A;  1D0Y A;  2X51 A;  3CMM A;  3FBN B;  3S93 A;  2KDO A;  2R7W A;  4XLA A;  2DT6 A;  4XLC A;  4F52 A;  5HVQ C;  2OV7 A;  1NG6 A;  3HOS A;  3RTR A;  3A4C A;  3L2V A;  2K3P A;  2VJJ A;  2VAS A;  2L9N A;  4E7I A;  4CCK A;  4YEL A;  2IGO A;  1KON A;  1LFP A;  2CH0 A;  2VQL A;  3H9G A;  3OYG A;  3KEY A;  2VJI A;  2F6C A;  4F3Q A;  2R7U A;  2X1E A;  3K4B A;  4XR6 A;  3K70 C;  4ZDO A;  2UV1 A;  3S3M A;  3AL0 C;  1QHH D;  2W1O A;  5HLT A;  3ZRG A;  3BC8 A;  3CZ6 A;  4CA0 A;  3OYH A;  1W36 D;  3DWL E;  1V5G A;  2M7B A;  4BGD A;  2X6X A;  2E1M C;  2LG4 A;  2X1D A;  1TT0 A;  2DT7 B;  4XOR A;  4BEH B;  4XKC A;  1MND A;  3PJR A;  3K4N A;  1DGW Y;  1E0E A;  1GLN A;  3A2K A;  3SYT A;  2CFO A;  2IGM A;  3VYT B;  4P1W A;  4CZC A;  3EUK L;  3LSG A;  4XNF A;  4OWR B;  1N77 A;  3F9K A;  3K10 A;  2CW7 A;  1DP3 A;  1MMG A;  5FRM A;  4ANJ A;  2F4I A;  2M7A A;  5KCM A;  3GBG A;  3NWT A;  1OR7 C;  4DGW B;  1X4P A;  2FUG 2;  2DJI A;  3RCO A;  2HQA A;  2V26 A;  2PJR B;  3G2B A;  2R7V A;  2CUZ A;  3VYS B;  3EPZ A;  4RM2 A;  3H9Q A;  2R7T A;  2R7O A;  3HKZ A;  1D0Z A;  4ZTJ A;  2VJ5 A;  2HU9 A;  3TBI A;  4BQQ A;  3OYL A;  3OS2 A;  1T95 A;  4BU2 A;  4X0G A;  5CQE A;  2CW8 A;  3BCB A;  1MMD A;  2KRC A;  4HPQ A;  4HNT A;  3ZGK A;  4BL0 B;  4IKF A;  3OMY A;  3FHN A;  4II2 A;  3D5R C;  4U87 A;  1WJA A;  4R79 A;  2MC4 A;  3ZR8 X;  2KP6 A;  4Y33 A;  1WJC A;  4PJJ A;  3OR2 C;  3OYF A;  4F93 B;  4HEA 2;  1YX5 A;  4B43 A;  4MLO A;  1UAA A;  4AVZ A;  2WAD A;  1JI8 A;  2Z1D A;  3SEZ A;  2X6W A;  1VZ0 A;  2HNH A;  3W3C A;  3BG7 A;  1D0X A;  3QOE A;  2BOL A;  3IUO A;  3KX2 A;  4BJ5 C;  3L2R A;  2LH9 A;  4IQJ A;  1OLT A;  2ZFU A;  4PK4 A;  2JUG A;  4PJM A;  4E7H A;  2VXZ A;  2E60 A;  2LYC A;  2IGK A;  3SDB A;  3DLA A;  3DTK A;  3L2Q A;  3H35 A;  3D5S C;  3ZQQ A;  2HZD A;  1HA8 A;  4II3 A;  1Z7L A;  5FRN A;  3K4J A;  2A6T A;  2V9K A;  1G8X A;  4XM3 A;  4RMN A;  2HPM A;  1X1B A;  4PFP A;  4BDZ A;  2XF6 A;  2VJ4 A;  1DGR M;  1MMN A;  2F5V A;  2X1C A;  1X1A A;  3MKZ A;  4CH7 A;  2V7F A;  3RSN A;  3VWB A;  2OC6 A;  2CV1 A;  1BOB A;  2IS6 A;  1U0J A;  4E4H A;  4PSW A;  1X1C A;  2KRH A;  3BCA A;  4HNU A;  1BR4 A;  1AA7 A;  4KIS A;  4B44 A;  2L2O A;  2CMP A;  4PSX A;  4BJT A;  4LIV A;  4ITV A;  1WJ5 A;  3H9J A;  2VB6 A;  1MMA A;  4NNJ A;  1WJE A;  1WJF A;  2E5Z A;  2JA2 A;  3H0D A;  3CJQ B;  3DKX A;  3LL7 A;  2WBM A;  3LSH A;  2Q1Z B;  3OIP A;  1W36 C;  2GOX B;  3DU6 A;  2HVS A;  1T0F C;  5KNL A;  2KQR A;  1X1D A;  2PJR A;  2IGN A;  3W2V A;  4XMY A;  3OOU A;  2XDV A;  3DTI A;  2XF5 A;  2WA0 A;  2LY1 A;  3LSM A;  4NQW B;  3MKW B;  3OYA A;  3FDY A;  5HNH A;  5KHD A;  4J00 A;  2WAQ A;  2QKM B;  3DKY A;  3K4C A;  1DQU A;  4CCO A;  4U7B A;  2JVH A;  4HG2 A;  3L2U A;  4XOP A;  4BUP A;  4G6T B;  4XKB A;  4IQ4 A;  4ZJZ A;  4F55 A;  2M3A A;  2CV0 A;  3K70 D;  2O5R A;  3OS0 A;  3OWT A;  3HPH A;  3E0J B;  2VIX A;  2XAU A;  4XON A;  2CUJ A;  1K6Y A;  2MFZ A;  1P9Q C;  2Q2E B;  2W82 A;  1TZL A;  2BVM A;  3EUH C;  1WJD A;  4DOZ A;  4ZC3 A;  2VLA A;  3FKJ A;  1NG7 A;  2W4S A;  2X6Y A;  4XL9 A;  3CP2 A;  4KJZ A;  2CS3 A;  2R7R A;  4XLE A;  1R6R A;  4C30 A;  3DTE A;  3HL2 A;  4D9J A;  2W00 A;  2IXS A;  3BLY A;  2R7Q A;  4LIT A;  5CKT A;  4B48 A;  2HDW A;  3DEE A;  2RRE A;  4B3X A;  2UWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...