2WA0A

Crystal structure of the human magea4
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
214
Chain Sequence
b'SGVDLGTYFQSMDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDSNTYTLVTCLGLSYDGLLNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVRYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYPSLREAALLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MELANOMA-ASSOCIATED ANTIGEN 4
publication title Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 214
sequence length 227
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01454 MAGE MAGE family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2wa0A01
1.10.10.1210 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2wa0A02
2WA0A
chains in the Genus database with same CATH superfamily
4RM2A 2YX4A 2BHZA 3N05A 4AYBN 2JA8J 4L5EA 2GIVA 2D5VA 1MSEC 1YW8A 1FBQA 2OTJI 2E5NA 2MG4A 1XB4A 4KN4X 4XRSA 2F2EA 4FE7A 1B59A 1UFMA 4ZDLA 2YSRA 4E7KA 4Q48A 4ZYAA 4AVZA 1W4MA 5EEAA 4B44A 4E6KG 4M3BA 2AO9A 5DD8A 5BPIA 2B9SA 2JA5J 2GXBA 3DU5A 1HSJA 2XUBA 4C3IJ 4HAMA 4KFCA 5FRNA 3LSPA 3LSHA 2DK5A 2M7BA 1D0YA 4EVIA 4O6JA 2V1XA 4XLPF 4MQVA 4A0YA 4N9HA 1X58A 1B8IB 5F0HA 5J6XA 2EK5A 1OPCA 4M74A 1VF9A 4HG2A 3TP0A 1MNMC 4RB3C 2KFDA 2XC7A 1BI1A 5B66C 4IZZA 1W1WE 1XX5A 4BBSJ 4BAYA 1XPXA 3J80Z 2AQFA 2EV6A 3NRVA 5CVIA 2RKHA 1UG0A 5F0CA 1XDSA 1SANA 2F5VA 2HYFA 2VXDA 3ZQQA 1SMYF 3HOTA 1GHCA 1S9HA 3NWTA 1WJDA 4FHTA 3F8MA 3HJEA 4A12A 3IWZA 3RCOA 2QYOA 4BXUA 1BW6A 1XGOA 3T5XA 4DZJA 1BC8C 1MJBA 5HLGA 2EFPA 1WI3A 2XSJC 4A3KJ 1BIAA 1HKQA 2ZSHB 2PMZN 4HF1A 1WJBA 3HGYA 1U2WA 3HPGA 2ESHA 4HSTA 3V8KA 1BM9A 1W0UA 5J3LA 5GP9A 1DUXC 3Q3SA 1IUYA 2XIGA 4X1EA 4MHGA 1EA3A 3CC7I 2XGXA 3BDDA 1EH8A 2LFBA 3GTPJ 4LFUA 1RUNA 2XAJA 3BROA 3G1LA 1RPWA 1KZHA 3RKQA 1VZ0A 5LEJA 3K4LA 3K70D 3V8LA 1ZG5A 4D0PA 3MKZA 3SDBA 3BPXA 1T8IA 4II2A 3GVAA 3VYUB 5JHFA 3VDXA 3WTWC 1VFCA 2LKXA 1T38A 5BQTA 3ZCOA 2KIFA 3S2DJ 1B6AA 1RIOH 1O7FA 2IA1A 3EQLF 4LG0A 5A2QK 3OYCA 3VYTB 1ACIA 3ZMVA 1XGSA 3K4CA 4XKWA 3PNTA 3OYNA 4IRIA 5IT9K 4BGDA 2LDUA 1U78A 3CD6I 5IYDJ 2ECBA 1QA6A 1ORKA 2HOEA 3S93A 4OINF 3KYLA 1YJ9I 1R71A 2P0WA 4MQ9F 5J8FA 3IKVA 4AIDA 4ABZA 1WI9A 4XK4A 2IXSA 2LD5A 2EFOA 1MH4A 4CO8A 1ZRFA 1ETOA 3SQNA 1FBUA 2VJJA 1NHAA 4U87A 1Y8RB 3HGGA 2E34A 2R5ZA 4N4OB 4LLGF 3A01A 4S0HB 4RS8A 1IAWA 3WTUC 2CQQA 3FISA 3IUOA 5CVJA 5EEHA 2V1NA 2B63J 4KUMA 1DGRM 5F08A 1ZARA 2VKDA 1T95A 2W25A 3D0SA 3H5RA 4W97A 5TISC 2IS6A 3AG2H 5E3LA 2K9LA 3WTVC 2GOXB 4M3GA 4NUBA 1IGNA 3QYBA 1GV2A 2E60A 4OU0A 4KMFA 3ERMA 3G3ZA 4CXFA 2P5KA 2MD0A 3HSFA 5J47A 1V5EA 1MBEA 2Y0MA 4BHCA 3OOUA 3DEWA 2R7SA 2DK8A 2HWVA 5K5OA 3A1YA 2IT0A 3CDLA 2NNNA 2H94A 5EF6A 4I02A 4L5IA 2D1VA 2OQGA 2VC0A 4BYYA 4CCLA 2ZXJA 3OS0A 3GTJJ 4EGYA 1G3WA 2Y9YA 4ZTFA 3GMEA 3U1KA 2VLAA 4U7BA 2M30A 4CYDA 2VPRA 2VJIA 2CJJA 2PMUA 3GUDA 5HDKA 4EMSA 3KX2A 2L7KA 3DBHB 4LG0B 3O2PE 1T0FA 2KHMA 2LF8A 3LSKA 2QCOA 3P7NA 1BJZA 2HQAA 5EGOA 1JGGA 2EH3A 1LNWA 2Z2SB 4F92B 4OIRF 4HNTA 1GV5A 2WY8Q 1TT0A 1DGWY 3TOBA 3WU2C 5H2FC 2FBIA 4KDPA 2LP0A 2HKXA 4QPOA 2BY3A 3GFMA 1R1TA 2LY9A 3MAJA 3LSIA 1K61A 2ELJA 1Y1VJ 2HNHA 3ZMTA 2ZJ2A 4XSZF 2X1DA 3GFIA 4KA4A 1BOAA 4W1UA 1V5GA 4GXOA 4WX9A 1BI2A 2R5ZB 3P9IA 3A01B 3VSLA 2CW7A 3JRGA 3GZ5A 4Z2YA 4BE1A 1U5TA 5FLXZ 2X0LA 1Y0NA 3FBIB 1ZR4A 3CC2I 2VBZA 1ZGWA 1I50J 2W82A 4UV8A 4YG2F 1ZN2A 3K70C 3TGNA 2HQNA 3LQQA 1ZAOA 2DPUA 2NXNB 1RETA 2DN0A 2XB5A 1R4MB 1IC8A 5J1RA 1V5FA 3HRUA 4PJMA 3GCMA 4XN0A 5K5RA 5B1BH 2NOJB 1XS9A 1J5YA 1OMIA 5ICGA 2A05A 4HYEA 3TO6A 3J7ZI 1ODDA 1Z7UA 4A3GJ 2CG4A 4UY8I 1OQYA 4C3JJ 2FBHA 4Y13A 5CJ9A 1TWAJ 1U8RA 1MBKA 2P6TA 2LK2A 4UB8C 5ICFA 4Z6YA 3E3VA 1QQIA 2W24A 4HV5A 2CW0F 2DO7A 4GGGA 3OMYA 1FT9A 5H20A 3WTYC 1J9IA 3CJNA 1EKEA 3S8PA 2LRDA 1BR1A 3QPLA 4IOAF 3LFUA 1MDMA 2PJRA 3OYLA 1FX7A 4C9YA 3KFWX 3H92A 4XONA 1D0ZA 1DPRA 3OYBA 2QQBA 4CCMA 4RGRA 3F8FA 5GPAA 3QRFF 1OCPA 1QZYA 5EGOB 2FNPA 3J81K 1SFXA 1D8KA 4HX7A 4YFNF 5IOYA 1LB2A 1KU3A 2NYXA 2I10A 3NQOA 3RIRA 2R3SA 1CQTA 3CC4I 4AIHA 2HZTA 2JRMA 3LSRA 4ENNA 3ZGKA 4HX4A 1YITI 5CQGA 2KDZA 4FCYA 1WJFA 4KT6A 3E7LA 5FGMA 2LBFA 3CCRI 3LSMA 4U7DA 2VOOA 9ANTA 4IJAA 3B6AA 3GTLJ 2JPCA 1U5TB 5J4VA 3IC7A 1XN7A 3Q0WA 2MBFA 3PO2J 1UHWA 3SEZA 4ITVA 1KGSA 2RAEA 3QP6A 3KP4A 2FOKA 2DT5A 1E3PA 1HC8A 2IJLA 2M1BA 1SC7A 2EA4A 4RB1A 4P9FA 4BDZA 4BJTA 4RMNA 5FD5A 2K02A 1SVOA 1NG7A 1MJ9A 4IPAA 4N9IA 2ZNZA 4RAYA 2CFXA 5ED4A 3K7AJ 3C1DA 1G59A 4BY1J 3BPVA 3H5AA 3JCUC 1MNDA 4A69C 4UXNA 4A3CJ 1XSDA 3FM3A 3JRCA 4IHTA 4RB0A 1SD4A 3A03A 4G8XA 3GF2A 5DCMA 3K4KA 4BXXJ 1TQIA 5ERIA 1G2HA 5EYRA 2R0QC 4L18B 1MDMB 2R7OA 3K6GA 4R8HA 2PJRB 2AXLA 4C2UA 3KP5A 2NVYJ 1J59A 1FNNA 4IF4A 5E1XA 1Q1VA 1U0JA 2H6CA 1Z91A 4BH9A 4M71A 3QPHA 4CYCB 3CCLI 2K5CA 4XLFA 2WB1A 1FSHA 3H9QA 2GQQA 3SJMA 2XRNA 5JLXA 3E97A 2O9LA 1R5HA 4RAZA 4UVCA 1IZ1A 3DPTA 1KYWA 3FMSA 1YRNA 1YFHA 3CMMA 2A6TA 3I53A 5J1YA 4CCKA 4E7IA 1YHQI 1I39A 2GIZA 3C2GA 1SFEA 2ZBKA 1LEBA 2L9RA 3LOCA 2FEZA 5HLIA 1Z67A 3KEQA 2LBFB 3WE3A 5KVRA 5HS8A 3EUKL 1OCCH 1X1CA 4OMZA 2QEXI 4FISA 1AWCA 5F27A 4BE0A 5E1WA 3ABMH 3T8TA 3WU0A 5DDGA 3K2AA 1RI7A 5KNLA 5KCMA 1LEAA 3QODA 5H6QA 4OAZA 3ISPA 3FZVA 1BR2A 2QM3A 4RAFA 1X1DA 3K9TA 2TRTA 3FX3A 1ZR2A 1QHGA 5CQEA 1QVTA 1X4PA 1A31A 4PZJA 1TWGJ 3BR3A 3OIOA 2UWMA 3BJOA 1QGPA 1SD5A 2EWNA 2NS7A 1WGXA 4IVNA 4M72A 4A0XA 3U9GA 4KIFA 3U21A 1VQLI 3QAHA 5B3SH 3ECOA 2CQ7A 3ABKH 3EETA 5KAIC 4BXFA 3OS2A 2VJ4A 3HOXJ 1JGSA 4UNOA 2DFIA 4B3AA 1D5VA 2F5DA 1MNEA 4KMUX 4YRVA 2IW5A 3WHBA 2JRTA 2M4GA 2Z1DA 2YUSA 2UZKA 2FSWA 2JSPA 1OJLA 4PGHA 1Z3YA 4NB5A 2F5CA 5DCMB 4RB2C 5D5VB 3OYHA 2CRGA 1H9GA 1MMDA 2P8TA 3PSIA 5LHHA 3BG3A 3WTTC 1FOXA 5B5EC 4L5JA 4CCNA 4MEYF 1SFKA 2DFHA 1BN5A 4BJ5C 3JRBA 1QO0D 4UUVA 3ZMUA 1R1UA 4PJNA 4BE2A 3CP2A 1IRGA 5CYVA 1WVRA 2X51A 1K83J 4E7SA 1E17A 3OYFA 3ZN0A 3COAC 2YS9A 5LD2C 2OV7A 4KT5C 1X3WB 3LMMA 3I5UA 1TT5B 2XSDC 3RQIA 5F64A 1I3QJ 1OYYA 2OCCH 1G3SA 2YX7A 1PP7U 1YRNB 2F5FA 3I64A 1ZGAA 1KQ8A 2QSFX 4PFOA 1WJAA 2Q0OA 3WODF 4JK1X 1J7KA 4ASNA 2FF4A 4LLNA 4OMYA 1MZBA 2L01A 1W7PA 2YR2A 3S2WA 4DJAA 4FASD 4DGWB 2FXAA 2CO5A 1WSUA 2KL4A 2CW8A 2ID3A 3HC7A 2FD5A 4B09A 3HUGA 2G7UA 2H1KA 5KK1A 5HVQC 3JRFA 3HM5A 2KZVA 5JLWA 1UCRA 1ZKGA 1SAUA 3M4OJ 1D1CA 2W1OA 3ZP5A 2JQ7A 4BS9A 2A68F 3L2RA 1LVAA 4B3XA 1L0OC 2JMWA 3LAPA 3S17J 2VB6A 3AG1H 3L2UA 3E5UA 4F93B 3M1EA 4A3EJ 2EZHA 5A2QZ 3H3ZA 2IAIA 3HXLA 2NVXJ 4JYKA 1WQ2A 3E6MA 2K9QA 2PQ8A 2VQGA 2Y31A 3CUOA 3L2QA 5FJ8J 4L9TA 5IT9Z 3WTSC 3HOSA 2RREA 1S3JA 1MMNA 2W48A 2EZLA 4J00A 4XLEA 2A5YB 2Z33A 2O7OA 3HEFA 3BQZA 1VQ4I 3IH2A 2H8WA 5CPRB 5E1ZB 4BY7J 3OYDA 2VODA 3K4MA 2XDVA 2CGPA 2MSYA 1XGNA 2H09A 3QU6A 2COBA 4KIBA 4FE4A 1K4SA 2E2HJ 4UVAA 2M0MA 1IXRC 3AL0B 4RDUA 2LREA 5L3FA 3GFLA 2D1HA 1UHMA 4AVPA 3TDUC 1VQ6I 5HS9A 5LEKA 2XROA 3NAUA 1F1ZA 1YX5A 2HDWA 1ETVA 2QVOA 2R7WA 1W7PB 2YU3A 3FMRA 1VQMI 3BTJA 1ETYA 1AKHA 3TP3A 3TQNA 4II3A 3S1MJ 3G2BA 4CZZA 2EFNA 1ERDA 1U9NA 3HUGB 1JKQC 1F5TA 4LJZF 1QHHD 3V42A 3BG5A 3BCBA 3CJTB 5GAGJ 1USTA 2XAQA 1HW1A 2BW3A 3ESWB 3CDHA 3P5JA 4XLHA 4B1RA 2BZTA 1DU0A 3IP4B 1USSA 4BL0B 4B4CA 1H89C 1MIJA 3MZYA 3OL4A 2HU9A 4YIRX 4A3BJ 3MMYB 3IL2A 5AONA 2HTSA 2ZXHA 3CQZJ 4CGZA 1T56A 2K4JA 2R7RA 3QP5A 3KPHA 1A35A 4BKXA 5BPDA 1LFBA 2ISZA 3FHZA 4BHPA 3C18A 2K86A 3BTIA 2JTVA 4M3DA 1Y8QB 3AKZA 1VQNI 3HKZN 1HCRA 4AC0A 2F6CA 4XICA 4M9SA 2ECCA 3C2HA 2LSOA 4XLNF 1X1BA 2XAHA 2W00A 1HOMA 4ZYHA 2IP2A 5HODA 2STWA 5F04A 3F8NA 4IL6C 3CTAA 4E70A 3GFJA 1K78B 1POGA 1VQ7I 2E7WA 4A3DJ 1OCOH 3ONQA 1D3YA 4B43A 5DM7F 2A5WA 2M2EA 2VC1A 1P4XA 4YELA 4J19A 3ASOH 4CZCA 2EILH 3CZ6A 1VNDA 2KMUA 2BV6A 1TLHB 3FK7A 1MMSA 4HQEA 4BQQA 5TRDA 2LOOA 2F4IA 4LGWA 2A61A 2MD5A 2R5YA 5M3FJ 2NVUB 2OC6A 3PL8A 3V7RA 2MABA 1YLFA 2HXIA 4XBFA 5KAFC 1YO5C 2Y9ZA 4M3EA 3E0JB 2WAQN 1RR7A 2DBBA 3TW6A 3NARA 1AKHB 4LB5A 2UXXA 1K79A 4HSRA 1Y1WJ 4M6XA 2F5EA 2LC2A 4XNFA 1JUMA 3W6JB 3ZQFA 4A0ZA 1OR7A 2W4SA 2X1CA 1JUPA 3ERED 1YW7A 1A6IA 1BJAA 1FOKA 2BW3B 5L3CA 3HL2A 2E7XA 5ILSA 3REOA 3OYJA 3JRIA 4JX5A 1AHDP 4D5CA 1MMAA 1EH7A 4I76A 3S16J 5D6EA 3FF5A 2DMPA 4I09A 2DTRA 3U1DA 2QSGX 3F8CA 3HTSB 2OF7A 2LVSA 1TP4A 3X2QH 2DMTA 4WK8F 1FEXA 1HW5A 1B9NA 1Z6RA 3F21A 2BBYA 5FRMA 3S1RJ 2TDXA 1UZCA 2DT6A 3J81Z 5K7HA 3MWMA 3ZN1A 5FLVA 3M9AA 4AIKA 5LRRA 3GZ6A 1R58A 1QNTA 3HBLA 1KONA 1FPQA 2FE3A 2IGMA 2EBIA 4EV0A 2X9DA 2IA2A 3HG9A 2BE5F 2IPQX 3LA7A 2K4BA 4UUSA 5IP6A 1SVMA 2JWTA 3CJQB 5E3NA 1SFOJ 4AU7A 4NDLA 2CQKA 3TO7A 2A07F 4A3FJ 1B72A 3OWTA 3R0AA 1YS6A 4RBOA 3ML6A 4IKFA 2R5YB 1WH7A 3TMOA 5BS6A 3NWSA 1AA7A 3RPUA 2LYCA 3FXUA 1C0WA 2ZKZA 1V4RA 1TWFJ 2ZB9A 1L3LA 5E3MA 2M45A 1Q1HA 1G8XA 2FU4A 1R49A 4RA2A 4AWXB 3G71I 3HYIA 3ZRGA 4PDKA 1WRJA 3ZXSA 3ASNH 2XF7A 1VQPI 5K1YA 2HDCA 2WA0A 1W7PD 3CUQA 4XQFA 1J75A 1UAAA 3ABTA 1XSVA 6PAXA 1X1PA 1E0EA 4BBRJ 4MGRA 3SZGA 2XAFA 2OQRA 1ZTRA 5FLMJ 4NHJA 4UHTA 4KNYA 5J1UA 4BQNA 4E7LA 2XV4S 1SD6A 2ZXWH 4IQ4A 4MNUA 4MFDA 2DMNA 4RAGA 2CV2A 2CSOA 4ENMA 4F7ZA 2V6CA 4JX4A 4CA0A 4XM3A 3DCFA 5EG0A 1ETWA 2XKPA 4ZYDA 3BLYA 2WV1A 2HXOA 5IPAA 1IN6A 2EQRA 4AYBA 1F9NA 1P2FA 2GXAA 2M5WA 1KU2A 3K4JA 1KU7A 4O3MA 1Z21A 3BTCA 1SMTA 4HNVA 1H88C 1IN8A 5IY5H 1PUFA 5GTHC 3IV5A 1HW2A 2IGKA 2HOSA 3CMYA 4P9UA 2NOGA 2DT7B 1VQ9I 4OIQF 2L3DA 1RR8C 2J5OA 2Y30A 2D45A 2XGEA 3FXJA 1Y39A 5FKNA 3SEQA 2DA3A 4DYCA 3OV8A 2QBYA 4UUSB 3GW2A 3S1QJ 4BACA 1YIOA 2PFBA 3J7AO 2Y75A 4C2MJ 1EV7A 1KQ0A 4BDYA 1B72B 1IN4A 2VQCA 1I3AA 2STTA 2V6EA 3BZKA 3Q0VA 3IH3A 4PJ0C 2ZO4A 3KZIC 2CH0A 1MJAA 3H1CA 5D8KB 1OCTC 1BW5A 3OR2C 2QA4I 3T0YA 3TKYA 3DTEA 2L9NA 2L54A 1WJCA 3QYEA 5E3OA 2HGCA 1PDNC 3OSFA 1T39A 1Y56A 2JA7J 4ZTJA 3JRAA 3CUQB 1I6XA 3UNGC 4DQ2A 2H27A 1UHSA 1YYVA 5ILUA 3W2VA 5GTIC 2PMZA 4HX8A 5HNFA 5IYCJ 1XCBA 5JVGF 2VBYA 3DP7A 2EPFA 2ID6A 1REPC 2IS2A 2LKPA 3QYFA 3VYRB 5EG0B 1D1BA 2E35A 1IDYA 3EYIA 1HBXG 3WGHA 2M3AA 3H9GA 1FMWA 3TL4X 2DA7A 4IQJA 1SD7A 2BY0A 2H6BA 2Y69H 3JRHA 4QWQA 5M5XJ 2I8DA 5FKMA 1PUFB 3V7SA 1HF0A 2V1DA 2HYGD 1TTYA 3F72A 1FP1D 5D8LB 4QIWN 3Q9VA 1EJ9A 5BOXA 1LFPA 3H5NA 4DOZA 2CYYA 2KDOA 1FWZA 2PI0A 2M87A 5C4XJ 2QBYB 4CYCA 2OUMA 2XKOA 3K10A 1KU9A 1PYVA 5FROA 2K3FA 1S5LC 4KIGA 2KIQA 4I7HA 1YW9A 4D7MA 5LHGA 4G6DA 2R7TA 4EATA 1VQ5I 1Z6TA 2UXNA 1HXDA 1RESA 4NC6A 3EPZA 2PBIA 4EJUA 2V79A 1AU7A 2M8EA 2FOWA 3IAS2 1R6RA 3ZOBA 2DTZA 4KN7X 4B47A 1IF1A 3KZYA 5FFXA 3LWFA 2K85A 4MTDA 3BR5A 3E5XA 3LA3A 1JT6A 3O8GA 3G1MA 1S7OA 4XMYA 1GDTA 1I27A 3DQVC 4PUSA 2VUMJ 4KICA 3M07A 3EUHC 3F6VA 4IO9F 2CV0A 1MD0A 1TWCJ 2XAUA 1S72I 2CUZA 1MW7A 1IXSB 4U0WA 4RLFA 4XN3A 3CCUI 1OLTA 1W5TA 3CF5F 2KISA 2M4KA 3IKTA 2Z3YA 5TJJA 2DA2A 2DJNA 3PNYA 4A6EA 2Q1ZB 3HOVJ 3RJPA 4U0VA 3I59A 1OYWA 4UV9A 1U6GA 1P4WA 1ZRDA 3PUFA 5F0FA 1R7JA 1I1GA 2CUEA 2VE9A 5GAEJ 3HOYJ 2KPMA 5DM6F 3B73A 3BZ6A 3KCCA 2WBMA 2DI3A 3AFHA 2FNAA 2QENA 5CVUA 1JE8A 3GTKJ 2AXTC 3L2VA 4V2GA 2BXYA 1E2XA 4I98B 2A6EF 2TCTA 2W7NA 3F22A 3HDDA 5E17F 2GA2A 1H8AC 3ZQIA 2XPWA 4DIQA 1E3HA 2LTPA 1MKMA 4HPQA 2V9KA 4CCJA 5HDGA 1HQCA 1LFUP 2ICWG 2HPIA 3N97A 1FZPB 2K27A 3PFYA 4XRFA 2OJED 2KRHA 3M3YJ 3FBNB 4G7HF 2Q8KA 4Q47A 3R6SA 3I71A 2DDAA 4XR6A 2NAZA 3BP8A 3OL3A 1LUJB 3JSOA 3F0CA 3MQ0A 2E1MB 1G4DA 5E79C 2W85A 3JR9A 4I0BA 4M9XA 2FQ3A 4HZFA 4KJZA 2VT3A 3I4NJ 3DPLC 5L3DA 2VPLA 2CFOA 2W57A 1STZA 2MC3A 3AG4H 1Z77A 4HDVA 5GPCA 4LLLA 2OZUA 3LQRA 2HOAA 5DYMA 3RPUD 2HVRA 5D5XB 1JI8A 3VWBA 3BCAA 3LSTA 4PFPA 2MLKA 3H35A 3K1PA 2COMA 2EFQA 4HDUA 3KEOA 2K9MA 1TL8A 2ZJPF 3FKIJ 1IJWC 2BY1A 2EZIA 4M6VA 2C6YA 3OIQA 4LOCA 3ZMDA 3H0GJ 4G12A 3DF8A 4EQQA 2CUFA 2A3SA 3IHUA 4BU2A 3OYIA 1YTYA 1BL0A 1U3EM 3FXRA 1JTYA 2L5QA 1D5YA 1TW3A 2AHQA 3I59B 2WADA 3S3MA 3FK6A 4IRHA 4RLQA 1WJEA 2VKHA 4JQFA 4X0GA 2IGNA 2Q2EA 2EV5A 2L9VA 3HIFA 1X3ZB 2M8GX 3CESA 2DA1A 2LLKA 4OIPF 2DOEA 3GTGJ 2BGCA 3Q9SA 2DMQA 4HNUA 2FJ1A 2WC2A 1W5CC 3R61A 3PQKA 3H36A 1FC3A 2NS8A 3CJRB 1ZLKA 3TO9A 3WE2A 2LG4A 2E19A 1O57A 4XSXF 2KJCA 2MA3A 2L7FP 4XL9A 4WXDA 3A2KA 3S14J 4NBQA 4CH7A 1A04A 4G7ZF 1R5ID 4Y52J 3CP8A 4AM3A 4L0ZB 1FIAA 4KYWA 1X2MA 4DNCA 2WWYA 3KLNA 2GA1A 3GTOJ 4A6DA 1DPUA 4YIFA 1OR7C 1S6LA 3QU3A 3HTUA 2ZMEA 4HEA2 2X1EA 3SXYA 1YG2A 2PX9A 3SHFA 4IRGA 1NK3P 1QBJA 3R4KA 1H9TA 2XF6A 4BQAA 1NG6A 2V9PA 3H3UA 3BJ6A 5GADJ 4CCOA 2XASA 3K4NA 2Z99A 2VKEA 1TNTA 1LDKB 1QPIA 3OYEA 1O4XA 2X6WA 1JKOC 2VT2A 2VKVA 2FUG2 1TZLA 3BOQA 1W5SA 2HFHA 1CGPA 3DFGA 4GYIA 4ESJA 3DKWA 1KA8A 4ENKA 1B4AA 3W6KB 5FO5A 4MFEA 4NC8A 2E36A 4WF2A 2KP6A 5DUKA 3SFZA 2ESNA 1PP8F 2QQ9A 5K5QA 1T98A 3DBLB 2A69F 2Z9OA 3I9V2 4Y17A 4R1HA 3GYHX 2P7VB 4ZDOA 2Q2EB 2K7LA 2KRCA 3K2ZA 3DEEA 3MFKA 4DW6A 2P4WA 2EA2A 3DV8A 3GZNB 2ZSIB 1ULYA 2RN7A 2KIUA 2X6YA 4PK4A 2VBXA 2E71A 3RKYA 1YOVB 1WZ2A 3FDYA 2VONA 2RV8A 3BG6A 3ZQHA 3KETA 3CCQI 1K78A 3G6EI 1LJ9A 1ZK8A 3WTXC 1WJ5A 3RSNA 2PG4A 4DBRA 5FFZA 3I3LA 4QSHA 1IRZA 2LMDA 4X6AJ 2IS4A 3J7AY 3W3CA 2O0YA 3BG7A 4M6YA 5DCFA 4C30A 2H8RA 1WWXA 2VQLA 4EGZA 3R0JA 2HOTA 2DQLA 1YJWI 3R60A 3CUQC 2ZMEB 3SZTA 1XMAA 4TV7A 5J8CA 3HOUJ 2LY2A 2XVCA 1P6RA 4ENJA 1MBGA 2VJ5A 2DA4A 2MH2A 3WHCA 4D9JA 2NVQJ 2JUCA 1NH3A 1ZREA 1QZZA 1FP2A 3GO5A 3SZPA 2GBYA 1O3SA 2GAUA 2UV1A 5D5WB 4G6TB 3JSPA 3PJRA 1VQOI 2WAFA 2DFFA 3MKLA 3HRTA 3UKGA 1RUOA 2P5VA 1FMVA 1ETKA 1HDDC 3GBGA 1H0MA 5M5YJ 3MN2A 2JZYA 2MH9A 5TGTA 2DQRA 2ELKA 4XORA 3WG7H 1X2NA 2NS0A 2M7AA 2MW8A 4CSWA 5F1RA 3BJAA 3PO3J 3MZHA 4F52A 4G9YA 1RNLA 3BWGA 2BY2A 1T0FC 4ZDPA 2FX0A 2K40A 3S3NA 1R1VA 3PM1A 3JAMK 1OKRA 2P81A 3D5RC 4BUPA 1IRXA 4Q5SF 3PFIA 3GX4X 2O61A 2XHKA 1KQ9A 3V4GA 1YJNI 1FLIA 3VODA 3D5LA 1FY7A 3MD2A 5AIPA 2ZC2A 2ZCWA 4BHBA 3FM5A 5LGUA 4GFBA 1ONVA 3HSEA 4Y33A 1JUSA 2VE8A 4H4KC 2KQRA 2NRAC 5JI6A 1XGMA 3MKWB 2PMHA 4HA8A 3LNQA 1O3QA 2IBDA 5EEGA 2DCEA 5IYBJ 5IT3A 4PGGA 5HLTA 1SVLA 3A0BC 5CKTA 2R4GA 3S2HJ 1U5TC 1R00A 2O3FA 1JT0A 3A0HC 2L4AA 3GWZA 1ZQ3P 2OA4A 1YE9A 1E3OC 5M5WJ 1K4TA 2E5ZA 2JVHA 5J40A 3RPQA 3WTZA 3D5SC 2OPTA 5L3GA 4L9NA 3N4MA 4GO1A 3KYCB 2DYRH 5DTDA 1PJRA 1V54H 1WHUA 2ETHA 2HS5A 3GLLA 3H3VK 3IAM2 3WU1B 2ADUA 1YIJI 4RGUA 3T8RA 5M3MJ 4CICA 3QOEA 4GCVA 3BQYA 1LVKA 1OCRH 3RYRA 1MMGA 1N75A 2DLLA 3HRMA 3L2WA 2QSHX 2B0LA 3BZCA 3OR1C 3FMQA 2VXZA 3PNVA 5ICEA 4PCQA 1XD7A 2H1LA 1BI0A 3K0LA 4D7NA 4EM1A 1U8BA 5BNGA 1LQ1A 2ZXIA 3TW7A 1FYKA 1WCMJ 3DKXA 2PLYA 4CDGA 3LSJA 4WWCA 1W36D 3HSRA 2O03A 2Z16A 3I4MJ 4OWRB 3AG3H 2EIKH 2AQEA 3BR0A 3PUBA 1N25A 1MH3A 3DWLE 4BEHA 5EZGA 2IRFG 3MCZA 1YS7A 1NK2P 1QPMA 1TQPA 1DDNA 1T33A 4C2TA 2RDPA 3WGGA 1T08B 1WPKA 3KP6A 4DYRA 3OYGA 3KP2A 4WCGA 2V26A 1VQKI 2Y2ZA 1R23A 5FKKA 5K7FA 5JVTA 3O6BB 4BNCA 2E2JJ 4HLXA 5CVRA 3BG9A 2ACJA 2E1MC 1Z7LA 1K6YA 2DMUA 3HRSA 3BR6A 3FKJA 3PSFA 3G73A 3BTLA 2E2IJ 2Y0SN 4IHSA 1V3FA 2W84A 2GXGA 2Z5UA 1LKXA 3ZQ7A 1HLVA 3J7YJ 2DPDA 2LKSA 2QQAA 2KT0A 1PUEE 2VN2A 2KRFA 2G7HA 5E8IA 4PJLA 1IO2A 3RKXA 2L7ZA 3L00A 4L9JA 2XPVA 1Z3XA 4ZZDA 4F91B 3LAJA 4HQMA 1FYLA 3K69A 5FD6A 1VQ8I 3DEUA 1IV6A 1XC5A 2DOFA 3B02A 4IXAA 1BR4A 3JTHA 2JPBA 3PQJA 1FOWA 5H6RA 2O5RA 1CF7A 1P4AA 4MEXF 4K2EA 3FHNA 2VQHA 3ULQB 4I0AA 3FXQA 4EM0B 1T2KA 4FX4A 2CV1A 2DXIA 1OYIA 2A6HF 1ON1A 5ILVA 2QGUA 3DTKA 2I5UA 2MYSA 4OIOF 2O8KA 5CLSA 1JXSA 4JBAA 1FSEA 3M1CA 1GLNA 3H0DA 2ELHA 2FRHA 2VASA 4Y7NJ 4V19K 2PEXA 3KYDB 2HZDA 4OOIA 2PJPA 2QWWA 2N8GA 1ZRCA 4ZYGA 3PIOF 2QUFA 5AIQA 4WXCA 3I58A 2RC4A 2QQ8A 1WKMA 3CMAI 1HKTA 3S32A 1MSFC 4JX6A 1I6HJ 4BEHB 3TOAA 3RQ4A 2HYJA 3A4CA 2R7XA 1FYMA 2XPUA 2JT1A 1J0RA 1G3TA 1FBSA 3G4SI 5LFAA 1APLC 2NVTJ 2FQ4A 3O3KA 1IUFA 3TEDA 2GOMA 3OSGA 4U0YA 4A5NA 2M34A 3HKZA 4G7OF 2R92J 5JFRA 2OCEA 5HNHA 1P7IA 4ZJZA 1XTAA 2X48A 4LG3A 5KHDA 2DW4A 4JP0A 3Q5FA 3OIPA 1FIPA 5FB2A 3BR2A 4M73A 1GXPA 4F3QA 4AUXA 4LK1F 2IS1A 4PSWA 3L7WA 4CUGA 1XCVA 4DZPA 1JJ6C 4HV6A 2R7DA 1ETQA 1IN7A 2XRLA 2BVMA 3OYKA 3QOPA 2DJIA 3BR1A 3CCSI 1FTZA 3ZQCA 1JHFA 1R22A 3KIOA 4A3IJ 1JTXA 1WH5A 3JW4A 2WB1N 3Q0UA 5BMZA 1FJLA 2V1UA 1MBFA 1ON2A 4FT8A 4AIJA 4XRSG 4FTHA 2OTLI 4BQOA 3HHGA 1S7EA 2B7EA 4EJVA 4HRIA 4P55A 3GTQJ 2K3PA 1ZGJA 2JUGA 3EUAA 3WG9A 3RZOJ 1IG7A 2XAGA 1YX3A 4ZC3A 3NEUA 1XMKA 1W36C 2M0CA 3QWLA 2X6OA 3ZMZA 2BOLA 4Q4ZF 1LDJA 2PN6A 2L2OA 2WAQA 5IP9J 1CF7B 3VOEA 4EJOA 4BJ6C 1DU6A 3QQAA 4ZYEA 1X19A 2DAOA 5EZHA 5LGNA 2DOAA 3ZQGA 2G0EA 2RGVA 4A5MA 4HBLA 1LPQA 1UG2A 1NTCA 4MLOA 2R7QA 1OCZH 1XMXA 5E18F 2MGQA 3CLOA 3WGIA 1R36A 3GTMJ 1AOYA 5DUIA 3DLLF 3HZJA 4LD5A 4B8XA 1DQUA 3S15J 3J80K 1DP7P 4NC7A 5K7ZA 1Z0XA 4ANJA 1BOBA 3IRQA 4IHWA 2V9VA 4V2FA 3V7CA 1X1AA 2OBPA 2R7ZJ 2BYVE 2LF7A 2OAZA 2L4MA 1D8JA 1ZLJA 4S05A 2DA5A 3K1NA 2XGCA 2FBKA 2AS5F 2YU9J 1IDZA 2JVGA 4QTRA 3AL0C 3TBIA 1F36A 1XSXA 1HA8A 3BC8A 3OOPA 1ITYA 1I1SA 2BXZA 3KE2A 3A02A 3S3OA 4RGSA 1RKWA 2CQNA 2UUZA 4WXHA 2P6SA 2EZKA 4XKVA 2HTJA 1MGTA 2ZMEC 4ESBA 5D5UB 4I6ZA 1B1BA 2JJ7A 3QPSA 4NQWA 1UJ8A 3OYMA 3L9FA 3HPHA 1IV8A 1X3UA 1SEUA 4MIMA 3VEPA 2HVSA 3MKYB 2F48A 5B1AH 4UB6C 3C7JA 4HOBA 2DA6A 2GLOA 4XIDA 1QZEA 2Y0SA 3JRDA 1ZYRF 2XF5A 1G3YA 2CWEA 5IP7J 4RM3A 3RDIA 3P9KA 3DKYA 1YQAA 2IGOA 3CO7C 3I56I 3PIPF 2DDBA 3O8HA 2FMLA 4OAYA 1SFUA 1QRYA 1BC7C 5E8GA 1ZH5A 2P5LC 1GVJA 2BVLA 4R79A 3BT9A 1LE8A 4I01A 3ROUA 2E1NA 3LFKA 1EH6A 4HW0A 1IW7F 1Z1DA 3BY6A 1HDPA 1P92A 3RZDJ 1DP3A 2HQRA 3G1OA 1MBJA 3F6OA 3FXLA 2P7CB 3GEZA 1U9OA 4JOMA 4NNJA 2QZ8A 3TDZC 3E6BA 2EINH 3M8EA 1ENHA 2R7UA 4HF2A 1BI3A 4IX7A 1UELB 2MFZA 1ETXA 2LR8A 1T6SA 2HQ5A 5D4RA 3ZMSA 4P1WA 3EYYA 3DU6A 4KITB 4EJWA 1R4NB 5FKLA 4A93J 3SDGA 3H9JA 1GXQA 4O5VA 5DS9A 2HI3A 1IN5A 3F9KA 4YFXF 1V55H 3MEXA 4ZH4F 2BHYA 3DXJF 2EV0A 3I54A 3HOZJ 3SFIA 2LY1A 4LITA 1QVUA 3CDIA 2J5PA 1R9TJ 4YIIA 1RC9A 1S29A 2ME0A 4IOCF 3VYSB 5CVVA 2DFEA 2VOPA 3K4BA 4NQWB 4LIUA 4F55A 4YFKF 2KKOA 3CCJI 3KEYA 1IRFA 1G6NA 4LIVA 4AD9A 5DV5A 2G9WA 2CS3A 3P9CA 5E20A 3U2RA 2DODA 1W0TA 2KLOA 3CMEI 5LHIA 1RZ4A 3LSGA 3VB2A 4DBQA 5LGTA 1TQMA 2WY7Q 1Z05A 4A3LJ 1QU3A 1Y0UA 2O6GE 2JN6A 2CMPA 3KLOA 4GYGA 2QLZA 3RI4A 2WTEA 1B9MA 4YEJA 1BA5A 2HPMA 5HS7A 3ZR8X 3W2AA 3QPTA 1HKSA 4LMYA 2EB7A 2K9NA 4DYQA 1LE8B 4MTEA 2OU2A 3E6DA 4A3JJ 2ZNYA 4XLAA 4B48A 1FTTA 4UVBA 4XKBA 3JAMZ 1A36A 2OZ6A 2L02A 4ON0A 2EJRA 2IEKA 1S8NA 1XG1A 4XKCA 2FA5A 4C3HJ 4LB6B 2L7MP 2RQPA 3IRRA 5GAHJ 3CCMI 4M3FA 2ZFUA 2XGDA 3F23A 4FQGA 3SYTA 5D6FA 3D1NI 4E7JA 1D1AA 3CF2A 4XRMA 3T1BA 2YPRA 4IHYA 5DEQA 4CHUA 2L9SA 2LH9A 1UMQA 4I99C 2ZJQF 2L0KA 2VI6A 4RGXA 4FETA 3V8JA 3DTIA 3F8BA 1J2XA 4N4NB 5FLXK 2JK3A 4FX0A 2CU7A 1O3RA 4GDFA 3GXOA 3LA2A 4E7ZA 5JHUA 2JA6J 1SAXA 3E1SA 3DLAA 3LL7A 4E7HA 1K6OA 5HOOA 3ZQLA 2R93J 1Z9CA 2JSCA 5IOZA 3ECHA 3CLQA 2KIMA 2QF7A 4LK0F 2RVCA 1LDDA 3FXKA 3OY9A 3FIWA 2KZGA 3DBRB 4S04A 4J01A 1MBHA 2BEOA 3C3WA 3JTGA 4IHVA 1EF4A 5JR3A 1I5ZA 1RKTA 4G6QA 3AAFA 2V4JC 1O7LA 2VL8A 1JKPC 2WV0A 1ZELA 2K9SA 2EFWA 3ZPLA 2EIJH 1TW2A 1P7JA 3K1MA 3RYPA 2V7FA 1OFCX 1WFXA 4PJJA 3C2BA 2MC4A 1X4OA 1TWHJ 2ME6A 1JJ8C 3RKWA 1UB9A 1ZG1A 5J4YA 2F4OB 4MO7A 1M1EB 3ELKA 4EEFG 4U88A 4A2UA 2R7FA 5L3BA 3IH4A 3I0TA 3OYAA 4XLCA 3W2WA 4A3MJ 2QKLB 3S1NJ 4IHXA 1JKRC 1F43A 2RQQA 1TC3C 2WAEA 1R5GA 3CCVI 4N0BA 4Y4RA 1GUUA 5LBQA 5C4JJ 2GM4A 3IWFA 4D5FA 3I4PA 3M8FA 4H0EA 1XDUA 2NNYA 2X4HA 2RNGA 4L9VA 1GT0C 3ABUA 3KZZA 2IA0A 2VIXA 2X85A 4ESFA 2KJBA 2LNBA 4I2OA 4EJTA 1A6QA 2F4MB 5C3EJ 5DD4A 3VFZA 5FKOA 1Y6IA 4PSXA 3EUHA 2FMYA 2ISYA 3M8JA 2DYSH 3VPRA 2HDDA 3B6CA 3ABLH 2CQXA 1N78A 3L09A 5ICCA 3E6CC 5D4SA 5EJCA 4IEJA 3RTRA 4M9ZA 2QKMB 2CUJA 1N77A 4KISA 1TBXA 3E5QA 1PVEA 4Y15A 4Y3OA 4ETSA 3MZ8A 4D1QA 2JA2A 2EIMH 3HOWJ 3FXOA 5HLHA 3JREA 2ZJRF 4EM2A 1IXCA 2HEOA 5L3EA 4E4HA 1S7AA 1D0XA 1BBYA 3HB9A 2OD5A 1F4KA 3DPUA 2E1CA 2IVMA 3KP7A 1B8IA 1P9QC 2ZFWA 2DU9A 1GVDA 3F3XA 5F6FA 3GLXA 4GRIA 3HHHA 4XOPA 4QLCU 3M7GA 2GZWA 4P96A 3OS1A 3UR3C 1K7AA 4L0YB 2HR3A 3CCYA 1O3TA 1JHHA 4P5OA 5LRSA 1A5JA 3W6VA 2GWRA 2MLGA 1YI2I 2E1OA 5HDNA 4QPQA 3VSKA 1FOYA 3CO6C 1ZG3A 2X6XA 4UUTA 1J09A 2VBWA 2HKOA 5F1JA 5C44J 1ZHFA 3FWEA 1HSTA 1OISA 1VI0A 4HLYA 2HVQA 2M9HA 3MVPA 1TNSA 4HF0A 5LLQA 3FXMA 2RNJA 1VTNC 1RRJA 3I55I 1BIBA 3KP3A 4XOTA 4ZZLA 2XB0X 3EDPA 5EDNA 2Y48A 3L2CA 3CCEI 4G94A 2D2WA 2O8XA 1KYZA 2R7VA 3L1PA
chains in the Genus database with same CATH topology
3OYHA 1MMDA 2CV1A 2R7TA 3PSIA 4RM2A 4EATA 2DXIA 3N05A 3DTKA 3EPZA 2MYSA 4CCNA 3IAS2 1R6RA 3M1CA 1GLNA 3H0DA 1SFKA 4BJ5C 2VASA 4B47A 4PJNA 4BE2A 3CP2A 2E5NA 2X51A 4E7SA 3OYFA 2HZDA 4XMYA 4ZDLA 5LD2C 2OV7A 3DQVC 4PUSA 4E7KA 3LMMA 3EUHC 4ZYAA 4AVZA 3S32A 4B44A 4E6KG 4BEHB 3RQ4A 3A4CA 2R7XA 2CV0A 4PFOA 3DU5A 2XAUA 5LFAA 2CUZA 1WJAA 1MW7A 5FRNA 2GOMA 3LSHA 2M7BA 4RLFA 1D0YA 4XN3A 1OLTA 3HKZA 2M4KA 4DJAA 4FASD 3PNYA 4DGWB 5HNHA 2Q1ZB 4ZJZA 2KL4A 2CW8A 3HC7A 4LG3A 5KHDA 4HG2A 5HVQC 2XC7A 3OIPA 4IZZA 4F3QA 2KZVA 2IS1A 4PSWA 2AQFA 1UG0A 4CUGA 1SAUA 2F5VA 2KPMA 2VXDA 3ZQQA 2BVMA 3OYKA 3HOTA 2DJIA 1D1CA 1S9HA 2WBMA 2W1OA 3NWTA 1WJDA 3AFHA 4BS9A 3L2RA 3L2VA 2W7NA 4B3XA 3RCOA 2VB6A 3L2UA 4BQOA 4DIQA 4F93B 4HRIA 4HPQA 2V9KA 2K3PA 4CCJA 2XSJC 3HXLA 2JUGA 3EUAA 2ZSHB 1WJBA 1YX3A 4ZC3A 3HPGA 1W36C 2VQGA 2HPIA 4HSTA 3L2QA 3PFYA 2BOLA 2L2OA 2KRHA 2WAQA 3FBNB 3HOSA 4BJ6C 2RREA 1MMNA 4XR6A 1X19A 3OL3A 2DOAA 4J00A 4XLEA 2E1MB 4MLOA 2R7QA 4KJZA 5CPRB 1EA3A 3OYDA 3DPLC 2VPLA 2CFOA 3K4MA 2XDVA 1DQUA 4NC7A 3RPUD 2HVRA 1JI8A 1VZ0A 3VWBA 3BCAA 4PFPA 3H35A 1BOBA 3K4LA 4ANJA 3K70D 3MKZA 2M0MA 3SDBA 3AL0B 2K9MA 1X1AA 2LREA 4II2A 5JHFA 3VYUB 3VDXA 3OIQA 3ZCOA 1YX5A 2HDWA 4BU2A 3VYTB 3OYCA 3OYIA 2R7WA 2JVGA 3K4CA 3AL0C 3TBIA 4II3A 3G2BA 1HA8A 3BC8A 2L5QA 3PNTA 4XKWA 3OYNA 4BGDA 1ERDA 3HUGB 3S3OA 2WADA 3S3MA 2UUZA 4RLQA 4XKVA 1WJEA 3V42A 1QHHD 3S93A 2VKHA 3BCBA 4JQFA 3KYLA 2P0WA 4X0GA 2IGNA 3CESA 2BW3A 4XLHA 3OYMA 3HPHA 2IXSA 3IP4B 4HNUA 2HVSA 4BL0B 3MKYB 3CJRB 2VJJA 3OL4A 4U87A 2HU9A 2LG4A 3MMYB 4N4OB 2Y0SA 2XF5A 2ZXHA 3IUOA 4XL9A 3A2KA 2R7RA 4RM3A 4CH7A 3DKYA 2V1NA 2IGOA 3CP8A 1DGRM 2VKDA 1T95A 3H5RA 4OAYA 3AKZA 2IS6A 2K9LA 2GOXB 4NUBA 3QYBA 2F6CA 2BVLA 4R79A 2E60A 3C2HA 1X1BA 1DP3A 2MD0A 2W00A 1OR7C 1V5EA 4JOMA 4NNJA 4HEA2 2X1EA 3OOUA 2R7SA 3A1YA 2XF6A 3ONQA 1NG6A 4B43A 2R7UA 4IX7A 1UELB 2A5WA 2MFZA 3OS0A 4CCLA 4YELA 4CCOA 4P1WA 4CZCA 3DU6A 3K4NA 4KITB 3CZ6A 4ZTFA 2KMUA 1LDKB 2VLAA 3OYEA 2X6WA 4BQQA 2LOOA 2F4IA 3H9JA 4U7BA 2FUG2 2VJIA 1TZLA 2OC6A 3F9KA 3PL8A 2MABA 3KX2A 2L7KA 3E0JB 2KHMA 3LSKA 4NC8A 2KP6A 4HSRA 2HQAA 2LY1A 4LITA 2LC2A 4XNFA 3I9V2 2W4SA 2X1CA 2Z2SB 4F92B 3VYSB 4HNTA 4ZDOA 3K4BA 2Q2EB 2WY8Q 1TT0A 4LIUA 4NQWB 4F55A 1DGWY 2BW3B 2KRCA 3KEYA 3DEEA 4LIVA 4QPOA 3HL2A 3LSIA 2ELJA 2HNHA 2CS3A 2ZSIB 2X1DA 3OYJA 2KLOA 2X6YA 4PK4A 1MMAA 1V5GA 3LSGA 4DBQA 3FDYA 2WY7Q 3BG6A 3VSLA 2CW7A 1QU3A 2CMPA 4BE1A 3FBIB 4YEJA 1WJ5A 3RSNA 2W82A 4DBRA 3I3LA 2HPMA 3ZR8X 3K70C 3W2AA 5FRMA 2DT6A 2IS4A 3J7AY 3W3CA 1KONA 3BG7A 4C30A 4XLAA 2VQLA 4B48A 1V5FA 4XKBA 4PJMA 2IGMA 4XN0A 3HG9A 2NOJB 2LY2A 4XKCA 2VJ5A 4D9JA 3CJQB 4AU7A 2UV1A 2ZFUA 3SYTA 4G6TB 3OWTA 3PJRA 3OMYA 2WAFA 4E7JA 1D1AA 3CF2A 3S8PA 4IKFA 2LRDA 2L9SA 1BR1A 1FMVA 2LH9A 3TMOA 3LFUA 3NWSA 2PJRA 3GBGA 1AA7A 3OYLA 4FETA 2LYCA 3DTIA 4C9YA 4XONA 1D0ZA 4N4NB 5TGTA 3OYBA 4XORA 4CCMA 1G8XA 4E7ZA 2M7AA 4CSWA 3ZRGA 3E1SA 3DLAA 3LL7A 4E7HA 3ZXSA 4F52A 5HOOA 2XF7A 2WA0A 4XQFA 1UAAA 1T0FC 4ZDPA 1E0EA 3SZGA 3S3NA 3D5RC 4BUPA 1IRXA 3ZGKA 3OY9A 5CQGA 1WJFA 3D5LA 4KT6A 3MD2A 4BQNA 4IQ4A 2LBFA 4E7LA 4J01A 4Y33A 3LSMA 2CV2A 4H4KC 4CA0A 2KQRA 4XM3A 2V4JC 3BLYA 2VL8A 3MKWB 1ZELA 4AYBA 3SEZA 4ITVA 2DCEA 2V7FA 3K4JA 5HLTA 1Z21A 1WFXA 5CKTA 2R4GA 4PJJA 2MC4A 1X4OA 4BDZA 4BJTA 4RMNA 2IGKA 1NG7A 1YE9A 2DT7B 2E5ZA 2JVHA 3OYAA 4XLCA 3W2WA 3D5SC 2QKLB 3SEQA 1G59A 3H5AA 1MNDA 2RQQA 2WAEA 4BACA 1PJRA 4Y4RA 4BDYA 3IAM2 2VQCA 2RNGA 2V6EA 3K4KA 3QOEA 1LVKA 2VIXA 1MMGA 1N75A 3L2WA 2X85A 3OR1C 2R7OA 3K6GA 2PJRB 2VXZA 3PNVA 2CH0A 4C2UA 1Y6IA 4PSXA 3OR2C 3DTEA 2L9NA 1U0JA 2ZXIA 3M8JA 1WJCA 3QYEA 2K5CA 4XLFA 3DKXA 1Y56A 2WB1A 1W36D 2Z16A 3H9QA 1N78A 4OWRB 4ZTJA 2AQEA 3PUBA 3RTRA 2QKMB 2CUJA 3DWLE 1N77A 4BEHA 4KISA 3UNGC 3DPTA 3CMMA 2A6TA 4Y3OA 4CCKA 4C2TA 4E7IA 3C2GA 2JA2A 3W2VA 2PMZA 5HNFA 4D1QA 2LBFB 3OYGA 3EUKL 4E4HA 1D0XA 1X1CA 2V26A 2IS2A 3DPUA 4BE0A 1P9QC 3QYFA 3VYRB 5KNLA 1D1BA 1Z7LA 2E1MC 5KCMA 1K6YA 3QODA 4GRIA 4XOPA 4OAZA 3OS1A 3UR3C 1BR2A 1X1DA 2M3AA 3H9GA 1FMWA 3TL4X 3FKJA 1QHGA 3PSFA 1X4PA 5CQEA 4IQJA 4P5OA 1LKXA 2UWMA 2I8DA 4QPQA 3VSKA 3U21A 2X6XA 1J09A 1LFPA 4PJLA 4BXFA 3H5NA 4DOZA 2VJ4A 1Z3XA 4F91B 3OS2A 2KDOA 1MNEA 2OUMA 4YRVA 3K10A 2M4GA 2HVQA 2Z1DA 1PYVA 2JSPA 1BR4A 5FROA 4XOTA 2O5RA 1Z3YA 3FHNA 2VQHA 2R7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WA0 A; 
#chains in the Genus database with same CATH topology
 4RM2 A;  2YX4 A;  2BHZ A;  3N05 A;  4AYB N;  2JA8 J;  4L5E A;  2GIV A;  2D5V A;  1MSE C;  1YW8 A;  1FBQ A;  2OTJ I;  2E5N A;  2MG4 A;  1XB4 A;  4KN4 X;  4XRS A;  2F2E A;  4FE7 A;  1B59 A;  1UFM A;  4ZDL A;  2YSR A;  4E7K A;  4Q48 A;  4ZYA A;  4AVZ A;  1W4M A;  5EEA A;  4B44 A;  4E6K G;  4M3B A;  2AO9 A;  5DD8 A;  5BPI A;  2B9S A;  2JA5 J;  2GXB A;  3DU5 A;  1HSJ A;  2XUB A;  4C3I J;  4HAM A;  4KFC A;  5FRN A;  3LSP A;  3LSH A;  2DK5 A;  2M7B A;  1D0Y A;  4EVI A;  4O6J A;  2V1X A;  4XLP F;  4MQV A;  4A0Y A;  4N9H A;  1X58 A;  1B8I B;  5F0H A;  5J6X A;  2EK5 A;  1OPC A;  4M74 A;  1VF9 A;  4HG2 A;  3TP0 A;  1MNM C;  4RB3 C;  2KFD A;  2XC7 A;  1BI1 A;  5B66 C;  4IZZ A;  1W1W E;  1XX5 A;  4BBS J;  4BAY A;  1XPX A;  3J80 Z;  2AQF A;  2EV6 A;  3NRV A;  5CVI A;  2RKH A;  1UG0 A;  5F0C A;  1XDS A;  1SAN A;  2F5V A;  2HYF A;  2VXD A;  3ZQQ A;  1SMY F;  3HOT A;  1GHC A;  1S9H A;  3NWT A;  1WJD A;  4FHT A;  3F8M A;  3HJE A;  4A12 A;  3IWZ A;  3RCO A;  2QYO A;  4BXU A;  1BW6 A;  1XGO A;  3T5X A;  4DZJ A;  1BC8 C;  1MJB A;  5HLG A;  2EFP A;  1WI3 A;  2XSJ C;  4A3K J;  1BIA A;  1HKQ A;  2ZSH B;  2PMZ N;  4HF1 A;  1WJB A;  3HGY A;  1U2W A;  3HPG A;  2ESH A;  4HST A;  3V8K A;  1BM9 A;  1W0U A;  5J3L A;  5GP9 A;  1DUX C;  3Q3S A;  1IUY A;  2XIG A;  4X1E A;  4MHG A;  1EA3 A;  3CC7 I;  2XGX A;  3BDD A;  1EH8 A;  2LFB A;  3GTP J;  4LFU A;  1RUN A;  2XAJ A;  3BRO A;  3G1L A;  1RPW A;  1KZH A;  3RKQ A;  1VZ0 A;  5LEJ A;  3K4L A;  3K70 D;  3V8L A;  1ZG5 A;  4D0P A;  3MKZ A;  3SDB A;  3BPX A;  1T8I A;  4II2 A;  3GVA A;  3VYU B;  5JHF A;  3VDX A;  3WTW C;  1VFC A;  2LKX A;  1T38 A;  5BQT A;  3ZCO A;  2KIF A;  3S2D J;  1B6A A;  1RIO H;  1O7F A;  2IA1 A;  3EQL F;  4LG0 A;  5A2Q K;  3OYC A;  3VYT B;  1ACI A;  3ZMV A;  1XGS A;  3K4C A;  4XKW A;  3PNT A;  3OYN A;  4IRI A;  5IT9 K;  4BGD A;  2LDU A;  1U78 A;  3CD6 I;  5IYD J;  2ECB A;  1QA6 A;  1ORK A;  2HOE A;  3S93 A;  4OIN F;  3KYL A;  1YJ9 I;  1R71 A;  2P0W A;  4MQ9 F;  5J8F A;  3IKV A;  4AID A;  4ABZ A;  1WI9 A;  4XK4 A;  2IXS A;  2LD5 A;  2EFO A;  1MH4 A;  4CO8 A;  1ZRF A;  1ETO A;  3SQN A;  1FBU A;  2VJJ A;  1NHA A;  4U87 A;  1Y8R B;  3HGG A;  2E34 A;  2R5Z A;  4N4O B;  4LLG F;  3A01 A;  4S0H B;  4RS8 A;  1IAW A;  3WTU C;  2CQQ A;  3FIS A;  3IUO A;  5CVJ A;  5EEH A;  2V1N A;  2B63 J;  4KUM A;  1DGR M;  5F08 A;  1ZAR A;  2VKD A;  1T95 A;  2W25 A;  3D0S A;  3H5R A;  4W97 A;  5TIS C;  2IS6 A;  3AG2 H;  5E3L A;  2K9L A;  3WTV C;  2GOX B;  4M3G A;  4NUB A;  1IGN A;  3QYB A;  1GV2 A;  2E60 A;  4OU0 A;  4KMF A;  3ERM A;  3G3Z A;  4CXF A;  2P5K A;  2MD0 A;  3HSF A;  5J47 A;  1V5E A;  1MBE A;  2Y0M A;  4BHC A;  3OOU A;  3DEW A;  2R7S A;  2DK8 A;  2HWV A;  5K5O A;  3A1Y A;  2IT0 A;  3CDL A;  2NNN A;  2H94 A;  5EF6 A;  4I02 A;  4L5I A;  2D1V A;  2OQG A;  2VC0 A;  4BYY A;  4CCL A;  2ZXJ A;  3OS0 A;  3GTJ J;  4EGY A;  1G3W A;  2Y9Y A;  4ZTF A;  3GME A;  3U1K A;  2VLA A;  4U7B A;  2M30 A;  4CYD A;  2VPR A;  2VJI A;  2CJJ A;  2PMU A;  3GUD A;  5HDK A;  4EMS A;  3KX2 A;  2L7K A;  3DBH B;  4LG0 B;  3O2P E;  1T0F A;  2KHM A;  2LF8 A;  3LSK A;  2QCO A;  3P7N A;  1BJZ A;  2HQA A;  5EGO A;  1JGG A;  2EH3 A;  1LNW A;  2Z2S B;  4F92 B;  4OIR F;  4HNT A;  1GV5 A;  2WY8 Q;  1TT0 A;  1DGW Y;  3TOB A;  3WU2 C;  5H2F C;  2FBI A;  4KDP A;  2LP0 A;  2HKX A;  4QPO A;  2BY3 A;  3GFM A;  1R1T A;  2LY9 A;  3MAJ A;  3LSI A;  1K61 A;  2ELJ A;  1Y1V J;  2HNH A;  3ZMT A;  2ZJ2 A;  4XSZ F;  2X1D A;  3GFI A;  4KA4 A;  1BOA A;  4W1U A;  1V5G A;  4GXO A;  4WX9 A;  1BI2 A;  2R5Z B;  3P9I A;  3A01 B;  3VSL A;  2CW7 A;  3JRG A;  3GZ5 A;  4Z2Y A;  4BE1 A;  1U5T A;  5FLX Z;  2X0L A;  1Y0N A;  3FBI B;  1ZR4 A;  3CC2 I;  2VBZ A;  1ZGW A;  1I50 J;  2W82 A;  4UV8 A;  4YG2 F;  1ZN2 A;  3K70 C;  3TGN A;  2HQN A;  3LQQ A;  1ZAO A;  2DPU A;  2NXN B;  1RET A;  2DN0 A;  2XB5 A;  1R4M B;  1IC8 A;  5J1R A;  1V5F A;  3HRU A;  4PJM A;  3GCM A;  4XN0 A;  5K5R A;  5B1B H;  2NOJ B;  1XS9 A;  1J5Y A;  1OMI A;  5ICG A;  2A05 A;  4HYE A;  3TO6 A;  3J7Z I;  1ODD A;  1Z7U A;  4A3G J;  2CG4 A;  4UY8 I;  1OQY A;  4C3J J;  2FBH A;  4Y13 A;  5CJ9 A;  1TWA J;  1U8R A;  1MBK A;  2P6T A;  2LK2 A;  4UB8 C;  5ICF A;  4Z6Y A;  3E3V A;  1QQI A;  2W24 A;  4HV5 A;  2CW0 F;  2DO7 A;  4GGG A;  3OMY A;  1FT9 A;  5H20 A;  3WTY C;  1J9I A;  3CJN A;  1EKE A;  3S8P A;  2LRD A;  1BR1 A;  3QPL A;  4IOA F;  3LFU A;  1MDM A;  2PJR A;  3OYL A;  1FX7 A;  4C9Y A;  3KFW X;  3H92 A;  4XON A;  1D0Z A;  1DPR A;  3OYB A;  2QQB A;  4CCM A;  4RGR A;  3F8F A;  5GPA A;  3QRF F;  1OCP A;  1QZY A;  5EGO B;  2FNP A;  3J81 K;  1SFX A;  1D8K A;  4HX7 A;  4YFN F;  5IOY A;  1LB2 A;  1KU3 A;  2NYX A;  2I10 A;  3NQO A;  3RIR A;  2R3S A;  1CQT A;  3CC4 I;  4AIH A;  2HZT A;  2JRM A;  3LSR A;  4ENN A;  3ZGK A;  4HX4 A;  1YIT I;  5CQG A;  2KDZ A;  4FCY A;  1WJF A;  4KT6 A;  3E7L A;  5FGM A;  2LBF A;  3CCR I;  3LSM A;  4U7D A;  2VOO A;  9ANT A;  4IJA A;  3B6A A;  3GTL J;  2JPC A;  1U5T B;  5J4V A;  3IC7 A;  1XN7 A;  3Q0W A;  2MBF A;  3PO2 J;  1UHW A;  3SEZ A;  4ITV A;  1KGS A;  2RAE A;  3QP6 A;  3KP4 A;  2FOK A;  2DT5 A;  1E3P A;  1HC8 A;  2IJL A;  2M1B A;  1SC7 A;  2EA4 A;  4RB1 A;  4P9F A;  4BDZ A;  4BJT A;  4RMN A;  5FD5 A;  2K02 A;  1SVO A;  1NG7 A;  1MJ9 A;  4IPA A;  4N9I A;  2ZNZ A;  4RAY A;  2CFX A;  5ED4 A;  3K7A J;  3C1D A;  1G59 A;  4BY1 J;  3BPV A;  3H5A A;  3JCU C;  1MND A;  4A69 C;  4UXN A;  4A3C J;  1XSD A;  3FM3 A;  3JRC A;  4IHT A;  4RB0 A;  1SD4 A;  3A03 A;  4G8X A;  3GF2 A;  5DCM A;  3K4K A;  4BXX J;  1TQI A;  5ERI A;  1G2H A;  5EYR A;  2R0Q C;  4L18 B;  1MDM B;  2R7O A;  3K6G A;  4R8H A;  2PJR B;  2AXL A;  4C2U A;  3KP5 A;  2NVY J;  1J59 A;  1FNN A;  4IF4 A;  5E1X A;  1Q1V A;  1U0J A;  2H6C A;  1Z91 A;  4BH9 A;  4M71 A;  3QPH A;  4CYC B;  3CCL I;  2K5C A;  4XLF A;  2WB1 A;  1FSH A;  3H9Q A;  2GQQ A;  3SJM A;  2XRN A;  5JLX A;  3E97 A;  2O9L A;  1R5H A;  4RAZ A;  4UVC A;  1IZ1 A;  3DPT A;  1KYW A;  3FMS A;  1YRN A;  1YFH A;  3CMM A;  2A6T A;  3I53 A;  5J1Y A;  4CCK A;  4E7I A;  1YHQ I;  1I39 A;  2GIZ A;  3C2G A;  1SFE A;  2ZBK A;  1LEB A;  2L9R A;  3LOC A;  2FEZ A;  5HLI A;  1Z67 A;  3KEQ A;  2LBF B;  3WE3 A;  5KVR A;  5HS8 A;  3EUK L;  1OCC H;  1X1C A;  4OMZ A;  2QEX I;  4FIS A;  1AWC A;  5F27 A;  4BE0 A;  5E1W A;  3ABM H;  3T8T A;  3WU0 A;  5DDG A;  3K2A A;  1RI7 A;  5KNL A;  5KCM A;  1LEA A;  3QOD A;  5H6Q A;  4OAZ A;  3ISP A;  3FZV A;  1BR2 A;  2QM3 A;  4RAF A;  1X1D A;  3K9T A;  2TRT A;  3FX3 A;  1ZR2 A;  1QHG A;  5CQE A;  1QVT A;  1X4P A;  1A31 A;  4PZJ A;  1TWG J;  3BR3 A;  3OIO A;  2UWM A;  3BJO A;  1QGP A;  1SD5 A;  2EWN A;  2NS7 A;  1WGX A;  4IVN A;  4M72 A;  4A0X A;  3U9G A;  4KIF A;  3U21 A;  1VQL I;  3QAH A;  5B3S H;  3ECO A;  2CQ7 A;  3ABK H;  3EET A;  5KAI C;  4BXF A;  3OS2 A;  2VJ4 A;  3HOX J;  1JGS A;  4UNO A;  2DFI A;  4B3A A;  1D5V A;  2F5D A;  1MNE A;  4KMU X;  4YRV A;  2IW5 A;  3WHB A;  2JRT A;  2M4G A;  2Z1D A;  2YUS A;  2UZK A;  2FSW A;  2JSP A;  1OJL A;  4PGH A;  1Z3Y A;  4NB5 A;  2F5C A;  5DCM B;  4RB2 C;  5D5V B;  3OYH A;  2CRG A;  1H9G A;  1MMD A;  2P8T A;  3PSI A;  5LHH A;  3BG3 A;  3WTT C;  1FOX A;  5B5E C;  4L5J A;  4CCN A;  4MEY F;  1SFK A;  2DFH A;  1BN5 A;  4BJ5 C;  3JRB A;  1QO0 D;  4UUV A;  3ZMU A;  1R1U A;  4PJN A;  4BE2 A;  3CP2 A;  1IRG A;  5CYV A;  1WVR A;  2X51 A;  1K83 J;  4E7S A;  1E17 A;  3OYF A;  3ZN0 A;  3COA C;  2YS9 A;  5LD2 C;  2OV7 A;  4KT5 C;  1X3W B;  3LMM A;  3I5U A;  1TT5 B;  2XSD C;  3RQI A;  5F64 A;  1I3Q J;  1OYY A;  2OCC H;  1G3S A;  2YX7 A;  1PP7 U;  1YRN B;  2F5F A;  3I64 A;  1ZGA A;  1KQ8 A;  2QSF X;  4PFO A;  1WJA A;  2Q0O A;  3WOD F;  4JK1 X;  1J7K A;  4ASN A;  2FF4 A;  4LLN A;  4OMY A;  1MZB A;  2L01 A;  1W7P A;  2YR2 A;  3S2W A;  4DJA A;  4FAS D;  4DGW B;  2FXA A;  2CO5 A;  1WSU A;  2KL4 A;  2CW8 A;  2ID3 A;  3HC7 A;  2FD5 A;  4B09 A;  3HUG A;  2G7U A;  2H1K A;  5KK1 A;  5HVQ C;  3JRF A;  3HM5 A;  2KZV A;  5JLW A;  1UCR A;  1ZKG A;  1SAU A;  3M4O J;  1D1C A;  2W1O A;  3ZP5 A;  2JQ7 A;  4BS9 A;  2A68 F;  3L2R A;  1LVA A;  4B3X A;  1L0O C;  2JMW A;  3LAP A;  3S17 J;  2VB6 A;  3AG1 H;  3L2U A;  3E5U A;  4F93 B;  3M1E A;  4A3E J;  2EZH A;  5A2Q Z;  3H3Z A;  2IAI A;  3HXL A;  2NVX J;  4JYK A;  1WQ2 A;  3E6M A;  2K9Q A;  2PQ8 A;  2VQG A;  2Y31 A;  3CUO A;  3L2Q A;  5FJ8 J;  4L9T A;  5IT9 Z;  3WTS C;  3HOS A;  2RRE A;  1S3J A;  1MMN A;  2W48 A;  2EZL A;  4J00 A;  4XLE A;  2A5Y B;  2Z33 A;  2O7O A;  3HEF A;  3BQZ A;  1VQ4 I;  3IH2 A;  2H8W A;  5CPR B;  5E1Z B;  4BY7 J;  3OYD A;  2VOD A;  3K4M A;  2XDV A;  2CGP A;  2MSY A;  1XGN A;  2H09 A;  3QU6 A;  2COB A;  4KIB A;  4FE4 A;  1K4S A;  2E2H J;  4UVA A;  2M0M A;  1IXR C;  3AL0 B;  4RDU A;  2LRE A;  5L3F A;  3GFL A;  2D1H A;  1UHM A;  4AVP A;  3TDU C;  1VQ6 I;  5HS9 A;  5LEK A;  2XRO A;  3NAU A;  1F1Z A;  1YX5 A;  2HDW A;  1ETV A;  2QVO A;  2R7W A;  1W7P B;  2YU3 A;  3FMR A;  1VQM I;  3BTJ A;  1ETY A;  1AKH A;  3TP3 A;  3TQN A;  4II3 A;  3S1M J;  3G2B A;  4CZZ A;  2EFN A;  1ERD A;  1U9N A;  3HUG B;  1JKQ C;  1F5T A;  4LJZ F;  1QHH D;  3V42 A;  3BG5 A;  3BCB A;  3CJT B;  5GAG J;  1UST A;  2XAQ A;  1HW1 A;  2BW3 A;  3ESW B;  3CDH A;  3P5J A;  4XLH A;  4B1R A;  2BZT A;  1DU0 A;  3IP4 B;  1USS A;  4BL0 B;  4B4C A;  1H89 C;  1MIJ A;  3MZY A;  3OL4 A;  2HU9 A;  4YIR X;  4A3B J;  3MMY B;  3IL2 A;  5AON A;  2HTS A;  2ZXH A;  3CQZ J;  4CGZ A;  1T56 A;  2K4J A;  2R7R A;  3QP5 A;  3KPH A;  1A35 A;  4BKX A;  5BPD A;  1LFB A;  2ISZ A;  3FHZ A;  4BHP A;  3C18 A;  2K86 A;  3BTI A;  2JTV A;  4M3D A;  1Y8Q B;  3AKZ A;  1VQN I;  3HKZ N;  1HCR A;  4AC0 A;  2F6C A;  4XIC A;  4M9S A;  2ECC A;  3C2H A;  2LSO A;  4XLN F;  1X1B A;  2XAH A;  2W00 A;  1HOM A;  4ZYH A;  2IP2 A;  5HOD A;  2STW A;  5F04 A;  3F8N A;  4IL6 C;  3CTA A;  4E70 A;  3GFJ A;  1K78 B;  1POG A;  1VQ7 I;  2E7W A;  4A3D J;  1OCO H;  3ONQ A;  1D3Y A;  4B43 A;  5DM7 F;  2A5W A;  2M2E A;  2VC1 A;  1P4X A;  4YEL A;  4J19 A;  3ASO H;  4CZC A;  2EIL H;  3CZ6 A;  1VND A;  2KMU A;  2BV6 A;  1TLH B;  3FK7 A;  1MMS A;  4HQE A;  4BQQ A;  5TRD A;  2LOO A;  2F4I A;  4LGW A;  2A61 A;  2MD5 A;  2R5Y A;  5M3F J;  2NVU B;  2OC6 A;  3PL8 A;  3V7R A;  2MAB A;  1YLF A;  2HXI A;  4XBF A;  5KAF C;  1YO5 C;  2Y9Z A;  4M3E A;  3E0J B;  2WAQ N;  1RR7 A;  2DBB A;  3TW6 A;  3NAR A;  1AKH B;  4LB5 A;  2UXX A;  1K79 A;  4HSR A;  1Y1W J;  4M6X A;  2F5E A;  2LC2 A;  4XNF A;  1JUM A;  3W6J B;  3ZQF A;  4A0Z A;  1OR7 A;  2W4S A;  2X1C A;  1JUP A;  3ERE D;  1YW7 A;  1A6I A;  1BJA A;  1FOK A;  2BW3 B;  5L3C A;  3HL2 A;  2E7X A;  5ILS A;  3REO A;  3OYJ A;  3JRI A;  4JX5 A;  1AHD P;  4D5C A;  1MMA A;  1EH7 A;  4I76 A;  3S16 J;  5D6E A;  3FF5 A;  2DMP A;  4I09 A;  2DTR A;  3U1D A;  2QSG X;  3F8C A;  3HTS B;  2OF7 A;  2LVS A;  1TP4 A;  3X2Q H;  2DMT A;  4WK8 F;  1FEX A;  1HW5 A;  1B9N A;  1Z6R A;  3F21 A;  2BBY A;  5FRM A;  3S1R J;  2TDX A;  1UZC A;  2DT6 A;  3J81 Z;  5K7H A;  3MWM A;  3ZN1 A;  5FLV A;  3M9A A;  4AIK A;  5LRR A;  3GZ6 A;  1R58 A;  1QNT A;  3HBL A;  1KON A;  1FPQ A;  2FE3 A;  2IGM A;  2EBI A;  4EV0 A;  2X9D A;  2IA2 A;  3HG9 A;  2BE5 F;  2IPQ X;  3LA7 A;  2K4B A;  4UUS A;  5IP6 A;  1SVM A;  2JWT A;  3CJQ B;  5E3N A;  1SFO J;  4AU7 A;  4NDL A;  2CQK A;  3TO7 A;  2A07 F;  4A3F J;  1B72 A;  3OWT A;  3R0A A;  1YS6 A;  4RBO A;  3ML6 A;  4IKF A;  2R5Y B;  1WH7 A;  3TMO A;  5BS6 A;  3NWS A;  1AA7 A;  3RPU A;  2LYC A;  3FXU A;  1C0W A;  2ZKZ A;  1V4R A;  1TWF J;  2ZB9 A;  1L3L A;  5E3M A;  2M45 A;  1Q1H A;  1G8X A;  2FU4 A;  1R49 A;  4RA2 A;  4AWX B;  3G71 I;  3HYI A;  3ZRG A;  4PDK A;  1WRJ A;  3ZXS A;  3ASN H;  2XF7 A;  1VQP I;  5K1Y A;  2HDC A;  2WA0 A;  1W7P D;  3CUQ A;  4XQF A;  1J75 A;  1UAA A;  3ABT A;  1XSV A;  6PAX A;  1X1P A;  1E0E A;  4BBR J;  4MGR A;  3SZG A;  2XAF A;  2OQR A;  1ZTR A;  5FLM J;  4NHJ A;  4UHT A;  4KNY A;  5J1U A;  4BQN A;  4E7L A;  2XV4 S;  1SD6 A;  2ZXW H;  4IQ4 A;  4MNU A;  4MFD A;  2DMN A;  4RAG A;  2CV2 A;  2CSO A;  4ENM A;  4F7Z A;  2V6C A;  4JX4 A;  4CA0 A;  4XM3 A;  3DCF A;  5EG0 A;  1ETW A;  2XKP A;  4ZYD A;  3BLY A;  2WV1 A;  2HXO A;  5IPA A;  1IN6 A;  2EQR A;  4AYB A;  1F9N A;  1P2F A;  2GXA A;  2M5W A;  1KU2 A;  3K4J A;  1KU7 A;  4O3M A;  1Z21 A;  3BTC A;  1SMT A;  4HNV A;  1H88 C;  1IN8 A;  5IY5 H;  1PUF A;  5GTH C;  3IV5 A;  1HW2 A;  2IGK A;  2HOS A;  3CMY A;  4P9U A;  2NOG A;  2DT7 B;  1VQ9 I;  4OIQ F;  2L3D A;  1RR8 C;  2J5O A;  2Y30 A;  2D45 A;  2XGE A;  3FXJ A;  1Y39 A;  5FKN A;  3SEQ A;  2DA3 A;  4DYC A;  3OV8 A;  2QBY A;  4UUS B;  3GW2 A;  3S1Q J;  4BAC A;  1YIO A;  2PFB A;  3J7A O;  2Y75 A;  4C2M J;  1EV7 A;  1KQ0 A;  4BDY A;  1B72 B;  1IN4 A;  2VQC A;  1I3A A;  2STT A;  2V6E A;  3BZK A;  3Q0V A;  3IH3 A;  4PJ0 C;  2ZO4 A;  3KZI C;  2CH0 A;  1MJA A;  3H1C A;  5D8K B;  1OCT C;  1BW5 A;  3OR2 C;  2QA4 I;  3T0Y A;  3TKY A;  3DTE A;  2L9N A;  2L54 A;  1WJC A;  3QYE A;  5E3O A;  2HGC A;  1PDN C;  3OSF A;  1T39 A;  1Y56 A;  2JA7 J;  4ZTJ A;  3JRA A;  3CUQ B;  1I6X A;  3UNG C;  4DQ2 A;  2H27 A;  1UHS A;  1YYV A;  5ILU A;  3W2V A;  5GTI C;  2PMZ A;  4HX8 A;  5HNF A;  5IYC J;  1XCB A;  5JVG F;  2VBY A;  3DP7 A;  2EPF A;  2ID6 A;  1REP C;  2IS2 A;  2LKP A;  3QYF A;  3VYR B;  5EG0 B;  1D1B A;  2E35 A;  1IDY A;  3EYI A;  1HBX G;  3WGH A;  2M3A A;  3H9G A;  1FMW A;  3TL4 X;  2DA7 A;  4IQJ A;  1SD7 A;  2BY0 A;  2H6B A;  2Y69 H;  3JRH A;  4QWQ A;  5M5X J;  2I8D A;  5FKM A;  1PUF B;  3V7S A;  1HF0 A;  2V1D A;  2HYG D;  1TTY A;  3F72 A;  1FP1 D;  5D8L B;  4QIW N;  3Q9V A;  1EJ9 A;  5BOX A;  1LFP A;  3H5N A;  4DOZ A;  2CYY A;  2KDO A;  1FWZ A;  2PI0 A;  2M87 A;  5C4X J;  2QBY B;  4CYC A;  2OUM A;  2XKO A;  3K10 A;  1KU9 A;  1PYV A;  5FRO A;  2K3F A;  1S5L C;  4KIG A;  2KIQ A;  4I7H A;  1YW9 A;  4D7M A;  5LHG A;  4G6D A;  2R7T A;  4EAT A;  1VQ5 I;  1Z6T A;  2UXN A;  1HXD A;  1RES A;  4NC6 A;  3EPZ A;  2PBI A;  4EJU A;  2V79 A;  1AU7 A;  2M8E A;  2FOW A;  3IAS 2;  1R6R A;  3ZOB A;  2DTZ A;  4KN7 X;  4B47 A;  1IF1 A;  3KZY A;  5FFX A;  3LWF A;  2K85 A;  4MTD A;  3BR5 A;  3E5X A;  3LA3 A;  1JT6 A;  3O8G A;  3G1M A;  1S7O A;  4XMY A;  1GDT A;  1I27 A;  3DQV C;  4PUS A;  2VUM J;  4KIC A;  3M07 A;  3EUH C;  3F6V A;  4IO9 F;  2CV0 A;  1MD0 A;  1TWC J;  2XAU A;  1S72 I;  2CUZ A;  1MW7 A;  1IXS B;  4U0W A;  4RLF A;  4XN3 A;  3CCU I;  1OLT A;  1W5T A;  3CF5 F;  2KIS A;  2M4K A;  3IKT A;  2Z3Y A;  5TJJ A;  2DA2 A;  2DJN A;  3PNY A;  4A6E A;  2Q1Z B;  3HOV J;  3RJP A;  4U0V A;  3I59 A;  1OYW A;  4UV9 A;  1U6G A;  1P4W A;  1ZRD A;  3PUF A;  5F0F A;  1R7J A;  1I1G A;  2CUE A;  2VE9 A;  5GAE J;  3HOY J;  2KPM A;  5DM6 F;  3B73 A;  3BZ6 A;  3KCC A;  2WBM A;  2DI3 A;  3AFH A;  2FNA A;  2QEN A;  5CVU A;  1JE8 A;  3GTK J;  2AXT C;  3L2V A;  4V2G A;  2BXY A;  1E2X A;  4I98 B;  2A6E F;  2TCT A;  2W7N A;  3F22 A;  3HDD A;  5E17 F;  2GA2 A;  1H8A C;  3ZQI A;  2XPW A;  4DIQ A;  1E3H A;  2LTP A;  1MKM A;  4HPQ A;  2V9K A;  4CCJ A;  5HDG A;  1HQC A;  1LFU P;  2ICW G;  2HPI A;  3N97 A;  1FZP B;  2K27 A;  3PFY A;  4XRF A;  2OJE D;  2KRH A;  3M3Y J;  3FBN B;  4G7H F;  2Q8K A;  4Q47 A;  3R6S A;  3I71 A;  2DDA A;  4XR6 A;  2NAZ A;  3BP8 A;  3OL3 A;  1LUJ B;  3JSO A;  3F0C A;  3MQ0 A;  2E1M B;  1G4D A;  5E79 C;  2W85 A;  3JR9 A;  4I0B A;  4M9X A;  2FQ3 A;  4HZF A;  4KJZ A;  2VT3 A;  3I4N J;  3DPL C;  5L3D A;  2VPL A;  2CFO A;  2W57 A;  1STZ A;  2MC3 A;  3AG4 H;  1Z77 A;  4HDV A;  5GPC A;  4LLL A;  2OZU A;  3LQR A;  2HOA A;  5DYM A;  3RPU D;  2HVR A;  5D5X B;  1JI8 A;  3VWB A;  3BCA A;  3LST A;  4PFP A;  2MLK A;  3H35 A;  3K1P A;  2COM A;  2EFQ A;  4HDU A;  3KEO A;  2K9M A;  1TL8 A;  2ZJP F;  3FKI J;  1IJW C;  2BY1 A;  2EZI A;  4M6V A;  2C6Y A;  3OIQ A;  4LOC A;  3ZMD A;  3H0G J;  4G12 A;  3DF8 A;  4EQQ A;  2CUF A;  2A3S A;  3IHU A;  4BU2 A;  3OYI A;  1YTY A;  1BL0 A;  1U3E M;  3FXR A;  1JTY A;  2L5Q A;  1D5Y A;  1TW3 A;  2AHQ A;  3I59 B;  2WAD A;  3S3M A;  3FK6 A;  4IRH A;  4RLQ A;  1WJE A;  2VKH A;  4JQF A;  4X0G A;  2IGN A;  2Q2E A;  2EV5 A;  2L9V A;  3HIF A;  1X3Z B;  2M8G X;  3CES A;  2DA1 A;  2LLK A;  4OIP F;  2DOE A;  3GTG J;  2BGC A;  3Q9S A;  2DMQ A;  4HNU A;  2FJ1 A;  2WC2 A;  1W5C C;  3R61 A;  3PQK A;  3H36 A;  1FC3 A;  2NS8 A;  3CJR B;  1ZLK A;  3TO9 A;  3WE2 A;  2LG4 A;  2E19 A;  1O57 A;  4XSX F;  2KJC A;  2MA3 A;  2L7F P;  4XL9 A;  4WXD A;  3A2K A;  3S14 J;  4NBQ A;  4CH7 A;  1A04 A;  4G7Z F;  1R5I D;  4Y52 J;  3CP8 A;  4AM3 A;  4L0Z B;  1FIA A;  4KYW A;  1X2M A;  4DNC A;  2WWY A;  3KLN A;  2GA1 A;  3GTO J;  4A6D A;  1DPU A;  4YIF A;  1OR7 C;  1S6L A;  3QU3 A;  3HTU A;  2ZME A;  4HEA 2;  2X1E A;  3SXY A;  1YG2 A;  2PX9 A;  3SHF A;  4IRG A;  1NK3 P;  1QBJ A;  3R4K A;  1H9T A;  2XF6 A;  4BQA A;  1NG6 A;  2V9P A;  3H3U A;  3BJ6 A;  5GAD J;  4CCO A;  2XAS A;  3K4N A;  2Z99 A;  2VKE A;  1TNT A;  1LDK B;  1QPI A;  3OYE A;  1O4X A;  2X6W A;  1JKO C;  2VT2 A;  2VKV A;  2FUG 2;  1TZL A;  3BOQ A;  1W5S A;  2HFH A;  1CGP A;  3DFG A;  4GYI A;  4ESJ A;  3DKW A;  1KA8 A;  4ENK A;  1B4A A;  3W6K B;  5FO5 A;  4MFE A;  4NC8 A;  2E36 A;  4WF2 A;  2KP6 A;  5DUK A;  3SFZ A;  2ESN A;  1PP8 F;  2QQ9 A;  5K5Q A;  1T98 A;  3DBL B;  2A69 F;  2Z9O A;  3I9V 2;  4Y17 A;  4R1H A;  3GYH X;  2P7V B;  4ZDO A;  2Q2E B;  2K7L A;  2KRC A;  3K2Z A;  3DEE A;  3MFK A;  4DW6 A;  2P4W A;  2EA2 A;  3DV8 A;  3GZN B;  2ZSI B;  1ULY A;  2RN7 A;  2KIU A;  2X6Y A;  4PK4 A;  2VBX A;  2E71 A;  3RKY A;  1YOV B;  1WZ2 A;  3FDY A;  2VON A;  2RV8 A;  3BG6 A;  3ZQH A;  3KET A;  3CCQ I;  1K78 A;  3G6E I;  1LJ9 A;  1ZK8 A;  3WTX C;  1WJ5 A;  3RSN A;  2PG4 A;  4DBR A;  5FFZ A;  3I3L A;  4QSH A;  1IRZ A;  2LMD A;  4X6A J;  2IS4 A;  3J7A Y;  3W3C A;  2O0Y A;  3BG7 A;  4M6Y A;  5DCF A;  4C30 A;  2H8R A;  1WWX A;  2VQL A;  4EGZ A;  3R0J A;  2HOT A;  2DQL A;  1YJW I;  3R60 A;  3CUQ C;  2ZME B;  3SZT A;  1XMA A;  4TV7 A;  5J8C A;  3HOU J;  2LY2 A;  2XVC A;  1P6R A;  4ENJ A;  1MBG A;  2VJ5 A;  2DA4 A;  2MH2 A;  3WHC A;  4D9J A;  2NVQ J;  2JUC A;  1NH3 A;  1ZRE A;  1QZZ A;  1FP2 A;  3GO5 A;  3SZP A;  2GBY A;  1O3S A;  2GAU A;  2UV1 A;  5D5W B;  4G6T B;  3JSP A;  3PJR A;  1VQO I;  2WAF A;  2DFF A;  3MKL A;  3HRT A;  3UKG A;  1RUO A;  2P5V A;  1FMV A;  1ETK A;  1HDD C;  3GBG A;  1H0M A;  5M5Y J;  3MN2 A;  2JZY A;  2MH9 A;  5TGT A;  2DQR A;  2ELK A;  4XOR A;  3WG7 H;  1X2N A;  2NS0 A;  2M7A A;  2MW8 A;  4CSW A;  5F1R A;  3BJA A;  3PO3 J;  3MZH A;  4F52 A;  4G9Y A;  1RNL A;  3BWG A;  2BY2 A;  1T0F C;  4ZDP A;  2FX0 A;  2K40 A;  3S3N A;  1R1V A;  3PM1 A;  3JAM K;  1OKR A;  2P81 A;  3D5R C;  4BUP A;  1IRX A;  4Q5S F;  3PFI A;  3GX4 X;  2O61 A;  2XHK A;  1KQ9 A;  3V4G A;  1YJN I;  1FLI A;  3VOD A;  3D5L A;  1FY7 A;  3MD2 A;  5AIP A;  2ZC2 A;  2ZCW A;  4BHB A;  3FM5 A;  5LGU A;  4GFB A;  1ONV A;  3HSE A;  4Y33 A;  1JUS A;  2VE8 A;  4H4K C;  2KQR A;  2NRA C;  5JI6 A;  1XGM A;  3MKW B;  2PMH A;  4HA8 A;  3LNQ A;  1O3Q A;  2IBD A;  5EEG A;  2DCE A;  5IYB J;  5IT3 A;  4PGG A;  5HLT A;  1SVL A;  3A0B C;  5CKT A;  2R4G A;  3S2H J;  1U5T C;  1R00 A;  2O3F A;  1JT0 A;  3A0H C;  2L4A A;  3GWZ A;  1ZQ3 P;  2OA4 A;  1YE9 A;  1E3O C;  5M5W J;  1K4T A;  2E5Z A;  2JVH A;  5J40 A;  3RPQ A;  3WTZ A;  3D5S C;  2OPT A;  5L3G A;  4L9N A;  3N4M A;  4GO1 A;  3KYC B;  2DYR H;  5DTD A;  1PJR A;  1V54 H;  1WHU A;  2ETH A;  2HS5 A;  3GLL A;  3H3V K;  3IAM 2;  3WU1 B;  2ADU A;  1YIJ I;  4RGU A;  3T8R A;  5M3M J;  4CIC A;  3QOE A;  4GCV A;  3BQY A;  1LVK A;  1OCR H;  3RYR A;  1MMG A;  1N75 A;  2DLL A;  3HRM A;  3L2W A;  2QSH X;  2B0L A;  3BZC A;  3OR1 C;  3FMQ A;  2VXZ A;  3PNV A;  5ICE A;  4PCQ A;  1XD7 A;  2H1L A;  1BI0 A;  3K0L A;  4D7N A;  4EM1 A;  1U8B A;  5BNG A;  1LQ1 A;  2ZXI A;  3TW7 A;  1FYK A;  1WCM J;  3DKX A;  2PLY A;  4CDG A;  3LSJ A;  4WWC A;  1W36 D;  3HSR A;  2O03 A;  2Z16 A;  3I4M J;  4OWR B;  3AG3 H;  2EIK H;  2AQE A;  3BR0 A;  3PUB A;  1N25 A;  1MH3 A;  3DWL E;  4BEH A;  5EZG A;  2IRF G;  3MCZ A;  1YS7 A;  1NK2 P;  1QPM A;  1TQP A;  1DDN A;  1T33 A;  4C2T A;  2RDP A;  3WGG A;  1T08 B;  1WPK A;  3KP6 A;  4DYR A;  3OYG A;  3KP2 A;  4WCG A;  2V26 A;  1VQK I;  2Y2Z A;  1R23 A;  5FKK A;  5K7F A;  5JVT A;  3O6B B;  4BNC A;  2E2J J;  4HLX A;  5CVR A;  3BG9 A;  2ACJ A;  2E1M C;  1Z7L A;  1K6Y A;  2DMU A;  3HRS A;  3BR6 A;  3FKJ A;  3PSF A;  3G73 A;  3BTL A;  2E2I J;  2Y0S N;  4IHS A;  1V3F A;  2W84 A;  2GXG A;  2Z5U A;  1LKX A;  3ZQ7 A;  1HLV A;  3J7Y J;  2DPD A;  2LKS A;  2QQA A;  2KT0 A;  1PUE E;  2VN2 A;  2KRF A;  2G7H A;  5E8I A;  4PJL A;  1IO2 A;  3RKX A;  2L7Z A;  3L00 A;  4L9J A;  2XPV A;  1Z3X A;  4ZZD A;  4F91 B;  3LAJ A;  4HQM A;  1FYL A;  3K69 A;  5FD6 A;  1VQ8 I;  3DEU A;  1IV6 A;  1XC5 A;  2DOF A;  3B02 A;  4IXA A;  1BR4 A;  3JTH A;  2JPB A;  3PQJ A;  1FOW A;  5H6R A;  2O5R A;  1CF7 A;  1P4A A;  4MEX F;  4K2E A;  3FHN A;  2VQH A;  3ULQ B;  4I0A A;  3FXQ A;  4EM0 B;  1T2K A;  4FX4 A;  2CV1 A;  2DXI A;  1OYI A;  2A6H F;  1ON1 A;  5ILV A;  2QGU A;  3DTK A;  2I5U A;  2MYS A;  4OIO F;  2O8K A;  5CLS A;  1JXS A;  4JBA A;  1FSE A;  3M1C A;  1GLN A;  3H0D A;  2ELH A;  2FRH A;  2VAS A;  4Y7N J;  4V19 K;  2PEX A;  3KYD B;  2HZD A;  4OOI A;  2PJP A;  2QWW A;  2N8G A;  1ZRC A;  4ZYG A;  3PIO F;  2QUF A;  5AIQ A;  4WXC A;  3I58 A;  2RC4 A;  2QQ8 A;  1WKM A;  3CMA I;  1HKT A;  3S32 A;  1MSF C;  4JX6 A;  1I6H J;  4BEH B;  3TOA A;  3RQ4 A;  2HYJ A;  3A4C A;  2R7X A;  1FYM A;  2XPU A;  2JT1 A;  1J0R A;  1G3T A;  1FBS A;  3G4S I;  5LFA A;  1APL C;  2NVT J;  2FQ4 A;  3O3K A;  1IUF A;  3TED A;  2GOM A;  3OSG A;  4U0Y A;  4A5N A;  2M34 A;  3HKZ A;  4G7O F;  2R92 J;  5JFR A;  2OCE A;  5HNH A;  1P7I A;  4ZJZ A;  1XTA A;  2X48 A;  4LG3 A;  5KHD A;  2DW4 A;  4JP0 A;  3Q5F A;  3OIP A;  1FIP A;  5FB2 A;  3BR2 A;  4M73 A;  1GXP A;  4F3Q A;  4AUX A;  4LK1 F;  2IS1 A;  4PSW A;  3L7W A;  4CUG A;  1XCV A;  4DZP A;  1JJ6 C;  4HV6 A;  2R7D A;  1ETQ A;  1IN7 A;  2XRL A;  2BVM A;  3OYK A;  3QOP A;  2DJI A;  3BR1 A;  3CCS I;  1FTZ A;  3ZQC A;  1JHF A;  1R22 A;  3KIO A;  4A3I J;  1JTX A;  1WH5 A;  3JW4 A;  2WB1 N;  3Q0U A;  5BMZ A;  1FJL A;  2V1U A;  1MBF A;  1ON2 A;  4FT8 A;  4AIJ A;  4XRS G;  4FTH A;  2OTL I;  4BQO A;  3HHG A;  1S7E A;  2B7E A;  4EJV A;  4HRI A;  4P55 A;  3GTQ J;  2K3P A;  1ZGJ A;  2JUG A;  3EUA A;  3WG9 A;  3RZO J;  1IG7 A;  2XAG A;  1YX3 A;  4ZC3 A;  3NEU A;  1XMK A;  1W36 C;  2M0C A;  3QWL A;  2X6O A;  3ZMZ A;  2BOL A;  4Q4Z F;  1LDJ A;  2PN6 A;  2L2O A;  2WAQ A;  5IP9 J;  1CF7 B;  3VOE A;  4EJO A;  4BJ6 C;  1DU6 A;  3QQA A;  4ZYE A;  1X19 A;  2DAO A;  5EZH A;  5LGN A;  2DOA A;  3ZQG A;  2G0E A;  2RGV A;  4A5M A;  4HBL A;  1LPQ A;  1UG2 A;  1NTC A;  4MLO A;  2R7Q A;  1OCZ H;  1XMX A;  5E18 F;  2MGQ A;  3CLO A;  3WGI A;  1R36 A;  3GTM J;  1AOY A;  5DUI A;  3DLL F;  3HZJ A;  4LD5 A;  4B8X A;  1DQU A;  3S15 J;  3J80 K;  1DP7 P;  4NC7 A;  5K7Z A;  1Z0X A;  4ANJ A;  1BOB A;  3IRQ A;  4IHW A;  2V9V A;  4V2F A;  3V7C A;  1X1A A;  2OBP A;  2R7Z J;  2BYV E;  2LF7 A;  2OAZ A;  2L4M A;  1D8J A;  1ZLJ A;  4S05 A;  2DA5 A;  3K1N A;  2XGC A;  2FBK A;  2AS5 F;  2YU9 J;  1IDZ A;  2JVG A;  4QTR A;  3AL0 C;  3TBI A;  1F36 A;  1XSX A;  1HA8 A;  3BC8 A;  3OOP A;  1ITY A;  1I1S A;  2BXZ A;  3KE2 A;  3A02 A;  3S3O A;  4RGS A;  1RKW A;  2CQN A;  2UUZ A;  4WXH A;  2P6S A;  2EZK A;  4XKV A;  2HTJ A;  1MGT A;  2ZME C;  4ESB A;  5D5U B;  4I6Z A;  1B1B A;  2JJ7 A;  3QPS A;  4NQW A;  1UJ8 A;  3OYM A;  3L9F A;  3HPH A;  1IV8 A;  1X3U A;  1SEU A;  4MIM A;  3VEP A;  2HVS A;  3MKY B;  2F48 A;  5B1A H;  4UB6 C;  3C7J A;  4HOB A;  2DA6 A;  2GLO A;  4XID A;  1QZE A;  2Y0S A;  3JRD A;  1ZYR F;  2XF5 A;  1G3Y A;  2CWE A;  5IP7 J;  4RM3 A;  3RDI A;  3P9K A;  3DKY A;  1YQA A;  2IGO A;  3CO7 C;  3I56 I;  3PIP F;  2DDB A;  3O8H A;  2FML A;  4OAY A;  1SFU A;  1QRY A;  1BC7 C;  5E8G A;  1ZH5 A;  2P5L C;  1GVJ A;  2BVL A;  4R79 A;  3BT9 A;  1LE8 A;  4I01 A;  3ROU A;  2E1N A;  3LFK A;  1EH6 A;  4HW0 A;  1IW7 F;  1Z1D A;  3BY6 A;  1HDP A;  1P92 A;  3RZD J;  1DP3 A;  2HQR A;  3G1O A;  1MBJ A;  3F6O A;  3FXL A;  2P7C B;  3GEZ A;  1U9O A;  4JOM A;  4NNJ A;  2QZ8 A;  3TDZ C;  3E6B A;  2EIN H;  3M8E A;  1ENH A;  2R7U A;  4HF2 A;  1BI3 A;  4IX7 A;  1UEL B;  2MFZ A;  1ETX A;  2LR8 A;  1T6S A;  2HQ5 A;  5D4R A;  3ZMS A;  4P1W A;  3EYY A;  3DU6 A;  4KIT B;  4EJW A;  1R4N B;  5FKL A;  4A93 J;  3SDG A;  3H9J A;  1GXQ A;  4O5V A;  5DS9 A;  2HI3 A;  1IN5 A;  3F9K A;  4YFX F;  1V55 H;  3MEX A;  4ZH4 F;  2BHY A;  3DXJ F;  2EV0 A;  3I54 A;  3HOZ J;  3SFI A;  2LY1 A;  4LIT A;  1QVU A;  3CDI A;  2J5P A;  1R9T J;  4YII A;  1RC9 A;  1S29 A;  2ME0 A;  4IOC F;  3VYS B;  5CVV A;  2DFE A;  2VOP A;  3K4B A;  4NQW B;  4LIU A;  4F55 A;  4YFK F;  2KKO A;  3CCJ I;  3KEY A;  1IRF A;  1G6N A;  4LIV A;  4AD9 A;  5DV5 A;  2G9W A;  2CS3 A;  3P9C A;  5E20 A;  3U2R A;  2DOD A;  1W0T A;  2KLO A;  3CME I;  5LHI A;  1RZ4 A;  3LSG A;  3VB2 A;  4DBQ A;  5LGT A;  1TQM A;  2WY7 Q;  1Z05 A;  4A3L J;  1QU3 A;  1Y0U A;  2O6G E;  2JN6 A;  2CMP A;  3KLO A;  4GYG A;  2QLZ A;  3RI4 A;  2WTE A;  1B9M A;  4YEJ A;  1BA5 A;  2HPM A;  5HS7 A;  3ZR8 X;  3W2A A;  3QPT A;  1HKS A;  4LMY A;  2EB7 A;  2K9N A;  4DYQ A;  1LE8 B;  4MTE A;  2OU2 A;  3E6D A;  4A3J J;  2ZNY A;  4XLA A;  4B48 A;  1FTT A;  4UVB A;  4XKB A;  3JAM Z;  1A36 A;  2OZ6 A;  2L02 A;  4ON0 A;  2EJR A;  2IEK A;  1S8N A;  1XG1 A;  4XKC A;  2FA5 A;  4C3H J;  4LB6 B;  2L7M P;  2RQP A;  3IRR A;  5GAH J;  3CCM I;  4M3F A;  2ZFU A;  2XGD A;  3F23 A;  4FQG A;  3SYT A;  5D6F A;  3D1N I;  4E7J A;  1D1A A;  3CF2 A;  4XRM A;  3T1B A;  2YPR A;  4IHY A;  5DEQ A;  4CHU A;  2L9S A;  2LH9 A;  1UMQ A;  4I99 C;  2ZJQ F;  2L0K A;  2VI6 A;  4RGX A;  4FET A;  3V8J A;  3DTI A;  3F8B A;  1J2X A;  4N4N B;  5FLX K;  2JK3 A;  4FX0 A;  2CU7 A;  1O3R A;  4GDF A;  3GXO A;  3LA2 A;  4E7Z A;  5JHU A;  2JA6 J;  1SAX A;  3E1S A;  3DLA A;  3LL7 A;  4E7H A;  1K6O A;  5HOO A;  3ZQL A;  2R93 J;  1Z9C A;  2JSC A;  5IOZ A;  3ECH A;  3CLQ A;  2KIM A;  2QF7 A;  4LK0 F;  2RVC A;  1LDD A;  3FXK A;  3OY9 A;  3FIW A;  2KZG A;  3DBR B;  4S04 A;  4J01 A;  1MBH A;  2BEO A;  3C3W A;  3JTG A;  4IHV A;  1EF4 A;  5JR3 A;  1I5Z A;  1RKT A;  4G6Q A;  3AAF A;  2V4J C;  1O7L A;  2VL8 A;  1JKP C;  2WV0 A;  1ZEL A;  2K9S A;  2EFW A;  3ZPL A;  2EIJ H;  1TW2 A;  1P7J A;  3K1M A;  3RYP A;  2V7F A;  1OFC X;  1WFX A;  4PJJ A;  3C2B A;  2MC4 A;  1X4O A;  1TWH J;  2ME6 A;  1JJ8 C;  3RKW A;  1UB9 A;  1ZG1 A;  5J4Y A;  2F4O B;  4MO7 A;  1M1E B;  3ELK A;  4EEF G;  4U88 A;  4A2U A;  2R7F A;  5L3B A;  3IH4 A;  3I0T A;  3OYA A;  4XLC A;  3W2W A;  4A3M J;  2QKL B;  3S1N J;  4IHX A;  1JKR C;  1F43 A;  2RQQ A;  1TC3 C;  2WAE A;  1R5G A;  3CCV I;  4N0B A;  4Y4R A;  1GUU A;  5LBQ A;  5C4J J;  2GM4 A;  3IWF A;  4D5F A;  3I4P A;  3M8F A;  4H0E A;  1XDU A;  2NNY A;  2X4H A;  2RNG A;  4L9V A;  1GT0 C;  3ABU A;  3KZZ A;  2IA0 A;  2VIX A;  2X85 A;  4ESF A;  2KJB A;  2LNB A;  4I2O A;  4EJT A;  1A6Q A;  2F4M B;  5C3E J;  5DD4 A;  3VFZ A;  5FKO A;  1Y6I A;  4PSX A;  3EUH A;  2FMY A;  2ISY A;  3M8J A;  2DYS H;  3VPR A;  2HDD A;  3B6C A;  3ABL H;  2CQX A;  1N78 A;  3L09 A;  5ICC A;  3E6C C;  5D4S A;  5EJC A;  4IEJ A;  3RTR A;  4M9Z A;  2QKM B;  2CUJ A;  1N77 A;  4KIS A;  1TBX A;  3E5Q A;  1PVE A;  4Y15 A;  4Y3O A;  4ETS A;  3MZ8 A;  4D1Q A;  2JA2 A;  2EIM H;  3HOW J;  3FXO A;  5HLH A;  3JRE A;  2ZJR F;  4EM2 A;  1IXC A;  2HEO A;  5L3E A;  4E4H A;  1S7A A;  1D0X A;  1BBY A;  3HB9 A;  2OD5 A;  1F4K A;  3DPU A;  2E1C A;  2IVM A;  3KP7 A;  1B8I A;  1P9Q C;  2ZFW A;  2DU9 A;  1GVD A;  3F3X A;  5F6F A;  3GLX A;  4GRI A;  3HHH A;  4XOP A;  4QLC U;  3M7G A;  2GZW A;  4P96 A;  3OS1 A;  3UR3 C;  1K7A A;  4L0Y B;  2HR3 A;  3CCY A;  1O3T A;  1JHH A;  4P5O A;  5LRS A;  1A5J A;  3W6V A;  2GWR A;  2MLG A;  1YI2 I;  2E1O A;  5HDN A;  4QPQ A;  3VSK A;  1FOY A;  3CO6 C;  1ZG3 A;  2X6X A;  4UUT A;  1J09 A;  2VBW A;  2HKO A;  5F1J A;  5C44 J;  1ZHF A;  3FWE A;  1HST A;  1OIS A;  1VI0 A;  4HLY A;  2HVQ A;  2M9H A;  3MVP A;  1TNS A;  4HF0 A;  5LLQ A;  3FXM A;  2RNJ A;  1VTN C;  1RRJ A;  3I55 I;  1BIB A;  3KP3 A;  4XOT A;  4ZZL A;  2XB0 X;  3EDP A;  5EDN A;  2Y48 A;  3L2C A;  3CCE I;  4G94 A;  2D2W A;  2O8X A;  1KYZ A;  2R7V A;  3L1P A; 
#chains in the Genus database with same CATH homology
 3OYH A;  1MMD A;  2CV1 A;  2R7T A;  3PSI A;  4RM2 A;  4EAT A;  2DXI A;  3N05 A;  3DTK A;  3EPZ A;  2MYS A;  4CCN A;  3IAS 2;  1R6R A;  3M1C A;  1GLN A;  3H0D A;  1SFK A;  4BJ5 C;  2VAS A;  4B47 A;  4PJN A;  4BE2 A;  3CP2 A;  2E5N A;  2X51 A;  4E7S A;  3OYF A;  2HZD A;  4XMY A;  4ZDL A;  5LD2 C;  2OV7 A;  3DQV C;  4PUS A;  4E7K A;  3LMM A;  3EUH C;  4ZYA A;  4AVZ A;  3S32 A;  4B44 A;  4E6K G;  4BEH B;  3RQ4 A;  3A4C A;  2R7X A;  2CV0 A;  4PFO A;  3DU5 A;  2XAU A;  5LFA A;  2CUZ A;  1WJA A;  1MW7 A;  5FRN A;  2GOM A;  3LSH A;  2M7B A;  4RLF A;  1D0Y A;  4XN3 A;  1OLT A;  3HKZ A;  2M4K A;  4DJA A;  4FAS D;  3PNY A;  4DGW B;  5HNH A;  2Q1Z B;  4ZJZ A;  2KL4 A;  2CW8 A;  3HC7 A;  4LG3 A;  5KHD A;  4HG2 A;  5HVQ C;  2XC7 A;  3OIP A;  4IZZ A;  4F3Q A;  2KZV A;  2IS1 A;  4PSW A;  2AQF A;  1UG0 A;  4CUG A;  1SAU A;  2F5V A;  2KPM A;  2VXD A;  3ZQQ A;  2BVM A;  3OYK A;  3HOT A;  2DJI A;  1D1C A;  1S9H A;  2WBM A;  2W1O A;  3NWT A;  1WJD A;  3AFH A;  4BS9 A;  3L2R A;  3L2V A;  2W7N A;  4B3X A;  3RCO A;  2VB6 A;  3L2U A;  4BQO A;  4DIQ A;  4F93 B;  4HRI A;  4HPQ A;  2V9K A;  2K3P A;  4CCJ A;  2XSJ C;  3HXL A;  2JUG A;  3EUA A;  2ZSH B;  1WJB A;  1YX3 A;  4ZC3 A;  3HPG A;  1W36 C;  2VQG A;  2HPI A;  4HST A;  3L2Q A;  3PFY A;  2BOL A;  2L2O A;  2KRH A;  2WAQ A;  3FBN B;  3HOS A;  4BJ6 C;  2RRE A;  1MMN A;  4XR6 A;  1X19 A;  3OL3 A;  2DOA A;  4J00 A;  4XLE A;  2E1M B;  4MLO A;  2R7Q A;  4KJZ A;  5CPR B;  1EA3 A;  3OYD A;  3DPL C;  2VPL A;  2CFO A;  3K4M A;  2XDV A;  1DQU A;  4NC7 A;  3RPU D;  2HVR A;  1JI8 A;  1VZ0 A;  3VWB A;  3BCA A;  4PFP A;  3H35 A;  1BOB A;  3K4L A;  4ANJ A;  3K70 D;  3MKZ A;  2M0M A;  3SDB A;  3AL0 B;  2K9M A;  1X1A A;  2LRE A;  4II2 A;  5JHF A;  3VYU B;  3VDX A;  3OIQ A;  3ZCO A;  1YX5 A;  2HDW A;  4BU2 A;  3VYT B;  3OYC A;  3OYI A;  2R7W A;  2JVG A;  3K4C A;  3AL0 C;  3TBI A;  4II3 A;  3G2B A;  1HA8 A;  3BC8 A;  2L5Q A;  3PNT A;  4XKW A;  3OYN A;  4BGD A;  1ERD A;  3HUG B;  3S3O A;  2WAD A;  3S3M A;  2UUZ A;  4RLQ A;  4XKV A;  1WJE A;  3V42 A;  1QHH D;  3S93 A;  2VKH A;  3BCB A;  4JQF A;  3KYL A;  2P0W A;  4X0G A;  2IGN A;  3CES A;  2BW3 A;  4XLH A;  3OYM A;  3HPH A;  2IXS A;  3IP4 B;  4HNU A;  2HVS A;  4BL0 B;  3MKY B;  3CJR B;  2VJJ A;  3OL4 A;  4U87 A;  2HU9 A;  2LG4 A;  3MMY B;  4N4O B;  2Y0S A;  2XF5 A;  2ZXH A;  3IUO A;  4XL9 A;  3A2K A;  2R7R A;  4RM3 A;  4CH7 A;  3DKY A;  2V1N A;  2IGO A;  3CP8 A;  1DGR M;  2VKD A;  1T95 A;  3H5R A;  4OAY A;  3AKZ A;  2IS6 A;  2K9L A;  2GOX B;  4NUB A;  3QYB A;  2F6C A;  2BVL A;  4R79 A;  2E60 A;  3C2H A;  1X1B A;  1DP3 A;  2MD0 A;  2W00 A;  1OR7 C;  1V5E A;  4JOM A;  4NNJ A;  4HEA 2;  2X1E A;  3OOU A;  2R7S A;  3A1Y A;  2XF6 A;  3ONQ A;  1NG6 A;  4B43 A;  2R7U A;  4IX7 A;  1UEL B;  2A5W A;  2MFZ A;  3OS0 A;  4CCL A;  4YEL A;  4CCO A;  4P1W A;  4CZC A;  3DU6 A;  3K4N A;  4KIT B;  3CZ6 A;  4ZTF A;  2KMU A;  1LDK B;  2VLA A;  3OYE A;  2X6W A;  4BQQ A;  2LOO A;  2F4I A;  3H9J A;  4U7B A;  2FUG 2;  2VJI A;  1TZL A;  2OC6 A;  3F9K A;  3PL8 A;  2MAB A;  3KX2 A;  2L7K A;  3E0J B;  2KHM A;  3LSK A;  4NC8 A;  2KP6 A;  4HSR A;  2HQA A;  2LY1 A;  4LIT A;  2LC2 A;  4XNF A;  3I9V 2;  2W4S A;  2X1C A;  2Z2S B;  4F92 B;  3VYS B;  4HNT A;  4ZDO A;  3K4B A;  2Q2E B;  2WY8 Q;  1TT0 A;  4LIU A;  4NQW B;  4F55 A;  1DGW Y;  2BW3 B;  2KRC A;  3KEY A;  3DEE A;  4LIV A;  4QPO A;  3HL2 A;  3LSI A;  2ELJ A;  2HNH A;  2CS3 A;  2ZSI B;  2X1D A;  3OYJ A;  2KLO A;  2X6Y A;  4PK4 A;  1MMA A;  1V5G A;  3LSG A;  4DBQ A;  3FDY A;  2WY7 Q;  3BG6 A;  3VSL A;  2CW7 A;  1QU3 A;  2CMP A;  4BE1 A;  3FBI B;  4YEJ A;  1WJ5 A;  3RSN A;  2W82 A;  4DBR A;  3I3L A;  2HPM A;  3ZR8 X;  3K70 C;  3W2A A;  5FRM A;  2DT6 A;  2IS4 A;  3J7A Y;  3W3C A;  1KON A;  3BG7 A;  4C30 A;  4XLA A;  2VQL A;  4B48 A;  1V5F A;  4XKB A;  4PJM A;  2IGM A;  4XN0 A;  3HG9 A;  2NOJ B;  2LY2 A;  4XKC A;  2VJ5 A;  4D9J A;  3CJQ B;  4AU7 A;  2UV1 A;  2ZFU A;  3SYT A;  4G6T B;  3OWT A;  3PJR A;  3OMY A;  2WAF A;  4E7J A;  1D1A A;  3CF2 A;  3S8P A;  4IKF A;  2LRD A;  2L9S A;  1BR1 A;  1FMV A;  2LH9 A;  3TMO A;  3LFU A;  3NWS A;  2PJR A;  3GBG A;  1AA7 A;  3OYL A;  4FET A;  2LYC A;  3DTI A;  4C9Y A;  4XON A;  1D0Z A;  4N4N B;  5TGT A;  3OYB A;  4XOR A;  4CCM A;  1G8X A;  4E7Z A;  2M7A A;  4CSW A;  3ZRG A;  3E1S A;  3DLA A;  3LL7 A;  4E7H A;  3ZXS A;  4F52 A;  5HOO A;  2XF7 A;  2WA0 A;  4XQF A;  1UAA A;  1T0F C;  4ZDP A;  1E0E A;  3SZG A;  3S3N A;  3D5R C;  4BUP A;  1IRX A;  3ZGK A;  3OY9 A;  5CQG A;  1WJF A;  3D5L A;  4KT6 A;  3MD2 A;  4BQN A;  4IQ4 A;  2LBF A;  4E7L A;  4J01 A;  4Y33 A;  3LSM A;  2CV2 A;  4H4K C;  4CA0 A;  2KQR A;  4XM3 A;  2V4J C;  3BLY A;  2VL8 A;  3MKW B;  1ZEL A;  4AYB A;  3SEZ A;  4ITV A;  2DCE A;  2V7F A;  3K4J A;  5HLT A;  1Z21 A;  1WFX A;  5CKT A;  2R4G A;  4PJJ A;  2MC4 A;  1X4O A;  4BDZ A;  4BJT A;  4RMN A;  2IGK A;  1NG7 A;  1YE9 A;  2DT7 B;  2E5Z A;  2JVH A;  3OYA A;  4XLC A;  3W2W A;  3D5S C;  2QKL B;  3SEQ A;  1G59 A;  3H5A A;  1MND A;  2RQQ A;  2WAE A;  4BAC A;  1PJR A;  4Y4R A;  4BDY A;  3IAM 2;  2VQC A;  2RNG A;  2V6E A;  3K4K A;  3QOE A;  1LVK A;  2VIX A;  1MMG A;  1N75 A;  3L2W A;  2X85 A;  3OR1 C;  2R7O A;  3K6G A;  2PJR B;  2VXZ A;  3PNV A;  2CH0 A;  4C2U A;  1Y6I A;  4PSX A;  3OR2 C;  3DTE A;  2L9N A;  1U0J A;  2ZXI A;  3M8J A;  1WJC A;  3QYE A;  2K5C A;  4XLF A;  3DKX A;  1Y56 A;  2WB1 A;  1W36 D;  2Z16 A;  3H9Q A;  1N78 A;  4OWR B;  4ZTJ A;  2AQE A;  3PUB A;  3RTR A;  2QKM B;  2CUJ A;  3DWL E;  1N77 A;  4BEH A;  4KIS A;  3UNG C;  3DPT A;  3CMM A;  2A6T A;  4Y3O A;  4CCK A;  4C2T A;  4E7I A;  3C2G A;  2JA2 A;  3W2V A;  2PMZ A;  5HNF A;  4D1Q A;  2LBF B;  3OYG A;  3EUK L;  4E4H A;  1D0X A;  1X1C A;  2V26 A;  2IS2 A;  3DPU A;  4BE0 A;  1P9Q C;  3QYF A;  3VYR B;  5KNL A;  1D1B A;  1Z7L A;  2E1M C;  5KCM A;  1K6Y A;  3QOD A;  4GRI A;  4XOP A;  4OAZ A;  3OS1 A;  3UR3 C;  1BR2 A;  1X1D A;  2M3A A;  3H9G A;  1FMW A;  3TL4 X;  3FKJ A;  1QHG A;  3PSF A;  1X4P A;  5CQE A;  4IQJ A;  4P5O A;  1LKX A;  2UWM A;  2I8D A;  4QPQ A;  3VSK A;  3U21 A;  2X6X A;  1J09 A;  1LFP A;  4PJL A;  4BXF A;  3H5N A;  4DOZ A;  2VJ4 A;  1Z3X A;  4F91 B;  3OS2 A;  2KDO A;  1MNE A;  2OUM A;  4YRV A;  3K10 A;  2M4G A;  2HVQ A;  2Z1D A;  1PYV A;  2JSP A;  1BR4 A;  5FRO A;  4XOT A;  2O5R A;  1Z3Y A;  3FHN A;  2VQH A;  2R7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...