2DOAA

Solution structure of the helical domain in human eleven-nineteen lysine-rich leukemia protein ell
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
GSSGSSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II elongation factor ELL
publication title Solution structure of the helical domain in human Eleven-nineteen lysine-rich leukemia protein ELL
rcsb
source organism Homo sapiens
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2doaA00
2DOAA 2E5NA
chains in the Genus database with same CATH superfamily
1HOMA 4PJMA 1FT9A 1VQ9I 1B8IA 2FX0A 2JTVA 2YU9J 1XMAA 2V6EA 3GWZA 1I3QJ 2EFWA 1SD5A 3TO6A 3AFHA 2XROA 1YIOA 3KPHA 4XKBA 5LHGA 2RQPA 1IRZA 1FOKA 4YFNF 2E5ZA 1WQ2A 2R3SA 1QA6A 1IO2A 1TQPA 2HXIA 4A3MJ 1OCPA 1X3UA 2IGMA 1RETA 1MMDA 4ESFA 1TQMA 5DTDA 4LMYA 4CCNA 2M9HA 5DM6F 1WI9A 1SFKA 3U1KA 2QLZA 3PNVA 2PQ8A 1R6RA 3SDBA 4XLCA 1KQ9A 3RYRA 4M3GA 2GLOA 3H9GA 2EZKA 2K40A 1ZG1A 5CQEA 3V7CA 3LWFA 2K5CA 1DDNA 2XASA 1SFXA 3E1SA 4WWCA 4HF2A 1D5YA 4BAYA 1LPQA 2M87A 1Z77A 4BKXA 3A4CA 1E3PA 2DOFA 2M8GX 1JTYA 2I8DA 1V5EA 4FE4A 4DGWB 2M2EA 3CF2A 4X1EA 3ZPLA 2XF6A 1I5ZA 2CV1A 3JRCA 2Y0SA 3QPSA 3EUHA 3E6MA 1J59A 2QBYA 3CCJI 1TZLA 2A5YB 3QYBA 1Q1HA 1KQ8A 4IEJA 1NK3P 3VYTB 3SDGA 4A5NA 4E7KA 2GXAA 3IWZA 3GF2A 2ELJA 4KMUX 4R1HA 2VKVA 3TOAA 3JSOA 2JSCA 3Q9VA 3F8BA 4D0PA 1MZBA 1UJ8A 2W84A 2DDAA 1HLVA 2IP2A 2RNGA 2ZBKA 1BL0A 3CCLI 4G7OF 4FHTA 2JMWA 3FXKA 2VBYA 2V26A 3GZNB 4E4HA 5K7ZA 3G4SI 3D5SC 2VL8A 3TQNA 4G6DA 4M74A 4HQEA 2HI3A 2H94A 4KYWA 1FYMA 2Q8KA 5J4VA 3HC7A 1X2MA 3CMEI 2R5YA 4HDVA 2AQFA 1Y8RB 4IRIA 4A0XA 4EQQA 1S9HA 3FMRA 2K27A 1IXCA 3HTSB 1QZEA 2H6CA 3QOEA 3DU6A 4QPQA 4EM1A 4D5CA 2VE8A 5BOXA 1APLC 3CDHA 1FLIA 1KU2A 2R4GA 3TW7A 4IHWA 3GX4X 3P9KA 3BG6A 3LNQA 1EH8A 3H35A 1K78A 3M8EA 4XL9A 1MD0A 1NH3A 4LJZF 3RSNA 1LFUP 2CV0A 1PVEA 3SFIA 5IP6A 5M3FJ 5CQGA 2K3FA 2CUZA 2DYRH 5E1ZB 5B5EC 2R7ZJ 3WTWC 5L3GA 2DXIA 2OZ6A 5DUIA 2XB5A 3MKYB 4ANJA 5D5UB 3PNTA 3HUGA 4KJZA 5DS9A 4B3XA 2VI6A 2R7OA 1D0XA 2XVCA 1X1PA 4EJVA 4LK1F 5LEKA 2HDCA 3DU5A 5LRSA 2M5WA 2QF7A 2HPMA 1R5ID 2JPBA 2KIMA 2X1DA 1ETYA 2KIUA 5J1YA 3DF8A 5D5VB 3I54A 3MCZA 1K7AA 4PGHA 2OA4A 2ZB9A 3QP6A 2IT0A 2LKXA 4NQWB 3JRAA 4YFKF 4MO7A 2IRFG 4KFCA 3O8HA 2HYGD 5E3OA 5L3FA 5M5WJ 1X19A 1TWCJ 3FKJA 1RKTA 1OMIA 1IV6A 4AYBN 1TW3A 3GEZA 2Y9ZA 4RB3C 1YX5A 2QENA 2XAGA 3PO2J 1BW5A 1GDTA 3FXLA 5IYBJ 2MC3A 3JRGA 4IF4A 4XKCA 2PMHA 4A93J 1U5TA 3BTJA 2M45A 2M4KA 1LVKA 5F04A 5FLXZ 1WGXA 2Q2EB 4D9JA 4ENJA 5LD2C 1BJAA 1LUJB 5ED4A 4XLPF 1VZ0A 2DA3A 2DMNA 2DA5A 4MQVA 2XGDA 2R7VA 3KP6A 3PIPF 1Z0XA 3IL2A 1NHAA 2HYJA 4ZYAA 3HL2A 2OD5A 1CF7A 1TNSA 2E7XA 2UXXA 1MNMC 1ZTRA 2HQRA 3HRMA 5HS8A 3LSKA 1WFXA 4II2A 3J81Z 2X9DA 1X1DA 4LFUA 4U88A 4O3MA 4RGSA 1DU0A 5D6FA 2ZCWA 2LG4A 5B3SH 2R7XA 4EV0A 5ILUA 4KIFA 3BTIA 4PCQA 3H9JA 1ZELA 5B1AH 1YO5C 1S72I 3B6AA 3KCCA 2EIJH 2DYSH 3FXMA 1R4MB 1Z3XA 1V54H 4B3AA 4RAFA 4ESJA 2DFIA 2QUFA 1Z05A 2W48A 4UVAA 4XRFA 1R4NB 3DTEA 4FX4A 3V8LA 2X1CA 2QSGX 3DKWA 2QKLB 1BI0A 2K4BA 2DDBA 2OCEA 2UV1A 2XPUA 2BGCA 3G3ZA 4Q47A 3AG3H 1KU9A 3JRFA 2EFNA 2KKOA 2FQ3A 2K9LA 3L00A 2VKDA 4IL6C 2VB6A 3FDYA 4S05A 1BIAA 1BIBA 1K79A 4BXXJ 2YSRA 4AC0A 1ODDA 1W0TA 1UB9A 4BHCA 2ZJRF 2JN6A 1FJLA 2V1DA 1VQ6I 2IGOA 1VQ7I 4BNCA 4AVPA 1F1ZA 3TL4X 1ZKGA 1ZGAA 3CP2A 1YW7A 1ZK8A 2WAFA 2ZNZA 4A3BJ 4BACA 3ZQIA 1U9OA 2HDWA 2N8GA 2L7KA 2X48A 4U7BA 3H0GJ 1MBHA 3HEFA 4L9TA 2L54A 5KVRA 1U9NA 1ZHFA 4CO8A 3OYEA 3FXOA 4HW0A 3ROUA 1O57A 1XB4A 1G3SA 4EGYA 3CUQC 4KA4A 1YYVA 2VN2A 1UZCA 3PFIA 1MBKA 1T95A 2FMYA 4WXDA 3VYSB 5LGTA 1TWAJ 2IBDA 1I27A 3PFYA 5EG0A 3LFUA 1RKWA 3H3UA 1X1AA 2BBYA 2HQNA 1LKXA 2KIFA 3KP4A 2AXTC 1B9NA 3T5XA 4F7ZA 1RR7A 2ZMEB 2BZTA 3J7AO 4HPQA 3AAFA 3RKWA 2EFQA 3CCVI 1MJAA 2A6TA 5F6FA 4XKWA 2JVHA 1YS7A 2GBYA 4BQQA 2ID6A 1IG7A 3AL0C 2IJLA 4CHUA 4CZCA 2QSFX 5GAHJ 2ECBA 4JQFA 3SQNA 1FIPA 3DV8A 4KN7X 3CTAA 2A5WA 1W5SA 1U0JA 3BQYA 2K4JA 1QNTA 4BHPA 2LKSA 1BI3A 4ZYGA 2JA6J 4LLLA 2ZMEC 3VDXA 2QZ8A 4BXUA 3FISA 1SD7A 3ZQHA 2V1NA 3DLAA 4HEA2 4Z6YA 4EEFG 2IS1A 3HM5A 3OYIA 2GA2A 5KCMA 1SVOA 3T1BA 2HTSA 3FHNA 1IRXA 1O7FA 1SFUA 2IS4A 2LOOA 2GM4A 3R0AA 5M3MJ 2Y69H 3K10A 2GAUA 2R7RA 2HEOA 3GCMA 4IHTA 4LLGF 3S14J 3K4CA 1N78A 1IN5A 3DEWA 3IRQA 2F5CA 2VT3A 2CFXA 3MKZA 4EVIA 3CZ6A 3A2KA 2BHYA 3OS0A 3OL4A 4Y15A 2NVTJ 1JUMA 3GTKJ 3I64A 3S3MA 3IC7A 1EKEA 4B44A 2HVSA 2EK5A 4I76A 2JA5J 2JUGA 2VIXA 3MN2A 5FRMA 4XORA 3WTSC 1XMKA 3RKYA 2A61A 1Z6TA 2CYYA 3DTKA 1H89C 2V1XA 3I58A 1O4XA 2RN7A 3TMOA 2FSWA 1IV8A 1UHSA 2H8WA 2LKPA 2L9SA 3IH4A 2HYFA 3H0DA 2BY1A 4H4KC 2VBXA 3C2GA 2PBIA 4E7LA 1VQMI 1U3EM 2A05A 1PUEE 4CA0A 2A6HF 1OCTC 2L4MA 4N9IA 1HXDA 4Y4RA 2F4MB 3IKTA 4DYQA 5GADJ 3V7SA 4Q5SF 3HIFA 3I59B 2KRFA 1JT0A 4KN4X 4ZDLA 2O8KA 2WAEA 2ZSHB 2V9VA 1R7JA 1LFPA 3OL3A 3IHUA 1T2KA 2VXZA 3MEXA 2BXYA 3EETA 1U78A 3BROA 1USTA 1SVMA 4ZDOA 4OAYA 3HPHA 3CMAI 1IW7F 1PUFB 4O5VA 2HTJA 3C1DA 2O5RA 1GUUA 4I7HA 3QOPA 2ZXWH 1Z91A 1VQ4I 5GAGJ 1DPRA 1TWFJ 4IQJA 5HDGA 3ONQA 1WJDA 3LSHA 3KIOA 3CCRI 2P6TA 4MNUA 3S32A 3V8JA 3C2HA 2DW4A 2JRTA 3OIPA 2NS8A 3ERMA 3BR3A 1K6YA 2JPCA 3Q9SA 2F6CA 3S17J 2A68F 4IVNA 3OOUA 5GTIC 3N05A 5HLTA 1UMQA 4RAGA 4CCLA 3F23A 4BBSJ 2ZC2A 2R7DA 3BJAA 3U21A 3I9V2 4YELA 4BXFA 1T0FC 4CCKA 1YJ9I 1LEBA 2R7WA 1JUPA 2X6YA 4BY7J 3LSJA 2X85A 2V6CA 1MH3A 3S2HJ 2CGPA 4L9NA 3PJRA 1JGSA 3RYPA 2HPIA 2YR2A 2DMPA 6PAXA 3M1EA 2GOMA 2AXLA 1FTTA 5FKOA 3QAHA 4HQMA 3WTZA 3K7AJ 3EUAA 2VASA 5E1WA 5IPAA 2E1MB 5IYDJ 4Y7NJ 1ORKA 5CPRB 4MIMA 2XDVA 4NUBA 5AONA 2WAQN 3PNYA 1MNEA 2VC0A 2OTLI 3CJTB 2LH9A 4IOAF 5DM7F 5FKLA 1LNWA 3OS2A 4BHBA 5H20A 3ZQGA 2FF4A 1IRGA 2EIMH 1J2XA 3BZ6A 5DV5A 3ABLH 5TJJA 2E1MC 2D1HA 4W1UA 1D1CA 2K9SA 3JREA 2VQGA 1XC5A 5L3DA 3WG9A 3OY9A 4HA8A 1DGWY 1IUYA 1X3ZB 4I2OA 2NVQJ 2W00A 1K61A 2E1OA 4ZTFA 1FMWA 1AWCA 5CVIA 3F8CA 2BXZA 3H3VK 3HOYJ 3E97A 4HNTA 1AKHB 3W2AA 2EH3A 2L7ZA 2PMZN 2A07F 3E3VA 1IDYA 4EGZA 1XSXA 3L2VA 3FZVA 1A31A 1BA5A 3RPQA 3PUFA 5EF6A 2P0WA 2HFHA 4L0ZB 1QU3A 3GZ5A 3BWGA 3IH3A 2E2JJ 4M3EA 2NYXA 4B48A 2Z2SB 1VF9A 1XGOA 1LB2A 2E71A 3W2WA 2CQ7A 2C6YA 4F3QA 3VYRB 2Y31A 1TWHJ 2QQBA 4WF2A 5HNFA 1O7LA 1F9NA 3I71A 1ONVA 1HKQA 3O2PE 2NAZA 4A3KJ 3GTLJ 2CUEA 3SJMA 2QEXI 2XF5A 5TGTA 5D5WB 3JR9A 1I6XA 2WY8Q 3BPXA 4XM3A 2A6EF 5KNLA 3J80K 2PMZA 4LG3A 4U87A 4J00A 2GZWA 3G6EI 4BYYA 3K69A 4OWRB 3S2DJ 4BE2A 3K4NA 4PSWA 4U7DA 1WCMJ 2RDPA 4IOCF 4KIGA 3F72A 1T98A 2ELKA 4A0ZA 5IP9J 1G4DA 3WU2C 3ECHA 2W24A 2BYVE 3GVAA 2NNNA 3LA7A 1JKPC 2KRCA 3A0HC 2YUSA 3W3CA 4CCMA 3ASNH 3HDDA 2OQGA 4BEHB 2WTEA 4LGWA 2QA4I 1P6RA 1WJCA 1WJAA 1X1CA 1XDUA 2KJBA 5ERIA 3G71I 1Y1VJ 2I5UA 2L01A 2LY1A 5E79C 2MLGA 2VODA 3F8NA 4RDUA 3ABMH 2D45A 3L2WA 1IC8A 3S15J 4NQWA 1OCCH 2X4HA 1U2WA 3DPLC 3TOBA 4CXFA 2PEXA 4Z2YA 2YU3A 2WB1A 1MBEA 2H8RA 1Y8QB 5FKKA 2F4OB 2XRLA 2Y0SN 2CQKA 3HRSA 3IKVA 3MQ0A 3RI4A 1FOXA 2LMDA 2DMTA 2ZJ2A 2JA2A 4HX8A 4PJJA 4UXNA 2PLYA 3F9KA 3ZCOA 1YIJI 1S29A 2RGVA 5FGMA 3HSEA 3G2BA 4J19A 1JKRC 2VPLA 2FNAA 2DOAA 1G6NA 1D0YA 2E19A 4FETA 2JK3A 2NOJB 3OOPA 5ICGA 5E3MA 5EEAA 2GOXB 4G7ZF 3CO6C 5K5OA 2Q2EA 1LDJA 1YS6A 2QQAA 4XK4A 4LIVA 2RVCA 2EJRA 3I53A 3OYNA 3W2VA 5BMZA 1TP4A 2ZXHA 1Z3YA 5LEJA 2EFOA 4BE1A 4JX4A 3BR2A 4O6JA 4DBQA 1MBJA 4RGXA 3F8FA 3JAMK 2LF7A 1WJBA 2OBPA 4UUTA 4CUGA 2KIQA 3BDDA 4AD9A 2BW3B 4UB6C 2CQNA 5AIPA 3KX2A 3V8KA 2X6WA 4YIFA 4M9XA 1D8JA 1UELB 4IRHA 3G73A 1IN8A 4UVCA 5D8KB 3FM5A 1I1SA 3S8PA 3DBRB 4N0BA 3O8GA 3SXYA 1ULYA 3BY6A 4XR6A 3AG1H 3ZMUA 1Z7UA 1T8IA 2KDOA 4YRVA 3S1RJ 1EF4A 2DQLA 2EQRA 2WY7Q 2MH9A 3RCOA 1IAWA 5IT9Z 2F48A 1TC3C 3KLOA 4S0HB 4XN3A 5IY5H 4B1RA 2B63J 2F4IA 5AIQA 4ZYEA 2XGCA 3Q5FA 2Z9OA 1WH5A 4HV6A 4XSZF 5JVGF 4BUPA 4DZJA 2G7HA 2YX4A 1B6AA 1UHMA 1FBQA 1IZ1A 3MKLA 3G1OA 4UHTA 2ZKZA 3U9GA 1BI2A 1QBJA 3PL8A 1E3HA 4OU0A 1S7EA 2O0YA 3DP7A 3N97A 5BPDA 1R23A 3GFJA 1MIJA 4OIRF 3ZMSA 1POGA 5DCMB 1W36D 5GPAA 3OYGA 1MDMB 2LDUA 4EJWA 1YHQI 3F0CA 5E17F 4JP0A 3KFWX 5CVVA 5E20A 4UNOA 4WCGA 4J01A 1I39A 1OCRH 4M3BA 1ERDA 3H5RA 5C44J 3QWLA 5J47A 2ID3A 1WWXA 2CW7A 1ETXA 2DCEA 3SZTA 2DLLA 2RKHA 3KE2A 4CYCB 3TBIA 3H36A 4ESBA 2L4AA 1V55H 4G9YA 2NXNB 3QYFA 1H0MA 1IGNA 2DK8A 2L9VA 5E8GA 3S1NJ 3LL7A 2BE5F 2X0LA 1O3QA 1GV5A 1GXQA 1A35A 2DT6A 2XIGA 2Q1ZB 2OTJI 1M1EB 2F5EA 3NQOA 4DQ2A 1ZGWA 4HNUA 1TW2A 1R5HA 2CV2A 2E2HJ 1MMNA 3CLQA 2VKEA 3OSGA 4FCYA 1WPKA 1BC8C 3BG5A 5EDNA 4LB5A 2ZMEA 3WTVC 1J9IA 3GFIA 2CG4A 3HOUJ 1RZ4A 3K1NA 1B9MA 2VOPA 4BDZA 1X4PA 2L3DA 4A3LJ 1G59A 2K9NA 4A69C 4A5MA 4UUVA 1FBUA 4D5FA 3KEOA 5M5YJ 4CSWA 1FNNA 2JRMA 4RS8A 1OPCA 4RAYA 4P55A 2VJJA 5J1RA 2HOTA 5FLVA 3M7GA 2DK5A 3LSIA 3R4KA 3FMQA 5LRRA 1D8KA 3P9IA 1KQ0A 1WJFA 5JHFA 3L7WA 3VEPA 2MC4A 4BE0A 5F1RA 1JXSA 5FKMA 1Y0UA 1LQ1A 3HOXJ 4XQFA 4JYKA 2XSJC 1WHUA 5J6XA 3COAC 2WBMA 4KICA 4C3IJ 3REOA 2JZYA 1R1TA 1EH7A 1FY7A 3QU3A 2QM3A 3WE3A 1PP7U 4ETSA 1ZAOA 2L02A 2FNPA 2CMPA 2H27A 3QPLA 3Q0WA 4BJ6C 2HOEA 4HYEA 2DMQA 3V4GA 3E6BA 1SD6A 2DFHA 2IA2A 3LQRA 1P7JA 1P2FA 2KQRA 5TISC 5DDGA 5CLSA 4MFEA 2TCTA 2CH0A 2X1EA 2QVOA 2QGUA 3C7JA 4HLYA 2IGKA 3D1NI 3K0LA 4UY8I 2KZGA 3WGIA 2P5KA 4LLNA 3I3LA 1FZPB 3CQZJ 3QP5A 1HA8A 1XCVA 1SAUA 5F08A 2GIZA 2LNBA 4ENKA 4QSHA 3T8RA 2H1KA 4Q48A 1MNDA 2HQ5A 3CCQI 4FQGA 3ZQ7A 4M3FA 4HZFA 3NRVA 2LBFB 1ZQ3P 2K02A 4UV9A 4AIDA 2OUMA 4A3IJ 4RB1A 3GTQJ 3L09A 1HW2A 5HDNA 3QU6A 2EBIA 5L3BA 1FOWA 1OR7C 1FBSA 1UG0A 4NBQA 4AU7A 1RESA 3I59A 2FE3A 3FK6A 1LJ9A 3O6BB 2YPRA 1TLHB 2E5NA 5J40A 2K7LA 5LHHA 2IW5A 4H0EA 2FA5A 1VI0A 1FIAA 3AG2H 2BEOA 2M0CA 3HOZJ 1Y39A 2FJ1A 4A3EJ 4BDYA 1KGSA 1HSTA 5HLIA 1PUFA 1A6QA 1DGRM 1T0FA 4NB5A 1Z7LA 4ZDPA 4RA2A 2VONA 2LD5A 1XN7A 2DJIA 2R93J 2CQQA 3CUQB 1JUSA 5DUKA 1LEAA 4F52A 1NG7A 2P4WA 2OU2A 2E35A 4KMFA 4AIJA 4FTHA 3OYKA 2MD0A 4M71A 2HQAA 1VQPI 3K4MA 4IHSA 1BC7C 2EILH 3DKYA 2PN6A 1YG2A 2WV0A 2M34A 2KISA 4JX6A 5HS7A 1IN4A 3AL0B 3DEUA 5HS9A 5HNHA 1MMAA 1TBXA 1K6OA 3DWLE 5A2QZ 2EV0A 2B9SA 4KNYA 2PJRB 4PJLA 4F92B 3G1MA 1MJ9A 2W57A 3BZCA 3CMYA 3TEDA 2CWEA 9ANTA 4B8XA 1BJZA 5E1XA 2RQQA 4MEYF 5FROA 5EYRA 3BTCA 3FX3A 1P4WA 4UUSB 2MLKA 1QZYA 2DPDA 5FJ8J 1YI2I 5C4XJ 4P9UA 2E1NA 3QYEA 4CICA 1J7KA 4F55A 2JA8J 3PM1A 2DA2A 2QYOA 2OF7A 2XGXA 4DOZA 5BS6A 4I6ZA 2QQ8A 3NAUA 5KHDA 2H09A 2OV7A 4DW6A 1AKHA 4WXHA 2GIVA 3V7RA 2NVUB 3OYJA 4JK1X 3OV8A 1BI1A 3DLLF 3FXQA 4MTDA 5HLGA 1BR2A 1YFHA 3ZN0A 3VOEA 3IH2A 4PSXA 2M30A 3HGYA 3P7NA 5LHIA 2IS6A 1LFBA 3UR3C 2LRDA 1MMSA 2COMA 3K2AA 1A36A 4G12A 5ICCA 2VQCA 2XB0X 5L3EA 1QPMA 2Y48A 1QPIA 1XG1A 3WG7H 1EJ9A 3DPTA 4BQAA 1HQCA 1HKTA 1BW6A 1Y0NA 2VJ5A 2EV5A 3KP7A 2M4GA 1Y6IA 2MG4A 2HKXA 3KP5A 3ZMTA 2V79A 2F2EA 1TL8A 1DP3A 2E60A 2RREA 3PUBA 1T56A 2G7UA 2XAJA 4B47A 3GLXA 2H1LA 3BR5A 5FLMJ 3RZOJ 2LY9A 3TDUC 2M1BA 4ZJZA 4KDPA 2DTRA 4R79A 4NDLA 1VQKI 2FBIA 2HVQA 2LLKA 3MKWB 4C3HJ 2P6SA 4FISA 4XN0A 3ZQFA 2OC6A 3LOCA 4ASNA 4CDGA 3BR0A 1F43A 3ULQB 3HOSA 1MBGA 1RRJA 2VBZA 1HDPA 1JTXA 2Y30A 1YX3A 1P4AA 5DD8A 2O6GE 4LD5A 2DN0A 3GTMJ 2HGCA 3RZDJ 4NNJA 1ZG3A 4P5OA 2VT2A 1ETOA 2DA1A 2R7QA 1RIOH 4XLAA 4ZYHA 2K9MA 1N25A 1YITI 5FLXK 3BG3A 1RPWA 1JKQC 1B59A 4XBFA 3BT9A 2QWWA 4CCJA 2ADUA 3E6CC 1Z67A 4W97A 4BEHA 4E7IA 4PZJA 4IHVA 2DOEA 3C2BA 2MYSA 4XRSG 3BTLA 1V3FA 3F8MA 4GRIA 1G3WA 4V19K 1B4AA 3M8FA 5EEGA 4WX9A 3OSFA 4IJAA 5GTHC 1STZA 5FD6A 3VODA 2HOAA 2IA1A 3GZ6A 3J81K 2MGQA 5LFAA 3MD2A 3K70D 1WI3A 5E3LA 2XAFA 5EEHA 4QLCU 3OS1A 2KDZA 1NTCA 5CJ9A 1OLTA 4ABZA 2CW8A 3CO7C 4EATA 2Z1DA 1W1WE 4RLFA 3A01B 1SANA 3FIWA 4DJAA 4N4OB 2VJ4A 4YIRX 2EINH 4Y33A 1O3TA 2FBHA 1A5JA 2JT1A 2M0MA 2CJJA 2XUBA 4M6XA 1IUFA 1W36C 3CD6I 3HZJA 2W7NA 2O61A 5F0HA 4D1QA 1YRNB 2UZKA 4Y13A 4HSRA 3I4NJ 2XV4S 5IYCJ 1OJLA 1OCOH 4C2MJ 2CUJA 3BCAA 4L5JA 5CVRA 2DFEA 1RUOA 4A3GJ 1WKMA 2XGEA 3TW6A 1ZRFA 3M3YJ 2P5LC 4QWQA 1LE8A 3HXLA 3HHGA 3ZMVA 1OYYA 4M9SA 1VQ8I 3P9CA 3ZMDA 4HF0A 4RB2C 3CC2I 4RM2A 3WGHA 5K7FA 4GYGA 4U0YA 3I4MJ 1QHGA 2NS7A 2Y75A 1HW1A 3RDIA 2FOWA 2FU4A 2FXAA 1T39A 3LSPA 2XSDC 3CDLA 1N75A 2LYCA 3GXOA 1YE9A 5JHUA 1X4OA 2BW3A 2DFFA 4MLOA 1FYLA 3OYMA 3QQAA 3GLLA 4HX4A 4LG0A 4B09A 3DBHB 4G6QA 3ZGKA 4B43A 2MH2A 3TO7A 3FK7A 3MZHA 3A03A 2FBKA 2F5DA 4JOMA 3DKXA 1MW7A 3D0SA 3LFKA 2NVYJ 3TGNA 1BR4A 2MSYA 1VQLI 4L5IA 2A69F 1SC7A 2AS5F 3FF5A 4YIIA 2O8XA 3Q0UA 1XDSA 1RC9A 2YS9A 5EGOB 2V1UA 2GXBA 3FBIB 2ESNA 4C9YA 2EZHA 4XLFA 1DPUA 2CU7A 1KYWA 1MGTA 1W5CC 2B0LA 3RIRA 1MBFA 2JWTA 4NHJA 4X0GA 2HDDA 1T6SA 1XS9A 4KT6A 1UG2A 3TP0A 3BR6A 3JRBA 5B1BH 1MMGA 3WU1B 2ELHA 1U8RA 4FE7A 2QQ9A 3I4PA 4IO9F 1EV7A 3RPUA 3S3OA 2KL4A 2DU9A 3WGGA 3CC4I 2HOSA 5DCMA 3J7ZI 4AM3A 1MDMA 1SMTA 2M7BA 2D1VA 3K4JA 1HCRA 3RQIA 5D4RA 5IOZA 4XOPA 1GXPA 3OMYA 4ZYDA 2QCOA 2I10A 4MHGA 2KPMA 2XPWA 2L9NA 2EZLA 4CYCA 2MW8A 1X1BA 3ZMZA 3S16J 3K9TA 1DUXC 4Y3OA 4G7HF 4OIPF 2L7FP 2WB1N 1ITYA 4MFDA 3LMMA 4WXCA 3VPRA 2PG4A 4HSTA 3ML6A 3U1DA 2DMUA 4M72A 3ERED 4NC7A 1H8AC 3ZQCA 5JFRA 2GA1A 2DT7B 3ZOBA 4AIKA 1IXSB 2A3SA 3KLNA 2FMLA 3K1MA 3CESA 1HW5A 2DO7A 3TDZC 3BLYA 4LB6B 3HPGA 3W6JB 1WSUA 4XICA 1G3TA 1O3RA 2G0EA 3HGGA 1W0UA 3E5XA 2EA4A 3WTXC 4ZZLA 3JSPA 2ISYA 1S7OA 2BHZA 1JHFA 3VSLA 3E5QA 1D5VA 1VQ5I 2M3AA 1YJWI 2EIKH 5BPIA 2R0QC 3IAM2 3HRTA 3IWFA 4I0BA 3VYUB 2CUFA 3M9AA 2NS0A 4X6AJ 2X6OA 1ZLJA 3WU0A 4QTRA 2WC2A 1B72B 1IDZA 1ZN2A 1DP7P 4ZH4F 4IX7A 2E34A 2P8TA 4PFPA 3CJRB 4N4NB 1T33A 2ZFUA 3DXJF 3F6VA 1KZHA 5D5XB 3MZYA 5ILVA 3CJQB 4FT8A 1TTYA 2PJPA 5KK1A 2ICWG 4NC8A 1LE8B 1K4SA 3HSFA 1JHHA 2DA4A 3LA2A 2G9WA 1X2NA 4A3CJ 1XMXA 2LSOA 4PDKA 1DQUA 1I3AA 2M8EA 2Z5UA 2KHMA 3T0YA 1K4TA 5H6RA 2O3FA 4RB0A 5IP7J 2EV6A 5L3CA 3H5AA 2EPFA 1QHHD 3NEUA 1R9TJ 1P9QC 2VOOA 3CLOA 2ZXIA 2WV1A 4I98B 3CUOA 4M6YA 4XLNF 5JVTA 3GUDA 3R60A 1ETVA 3LA3A 2IPQX 4V2GA 1QVUA 5ICFA 4PFOA 4LG0B 2TDXA 3IP4B 5E3NA 4EJTA 2HZDA 2ZXJA 1OR7A 1WVRA 4K2EA 4Q4ZF 3FXUA 1YJNI 3CC7I 3V42A 1BOBA 2DA7A 3F21A 1J5YA 1OKRA 3IUOA 2H6BA 2FRHA 2GXGA 4G8XA 2LBFA 2RAEA 4IHYA 1FMVA 1D1AA 5F64A 2MFZA 3ABKH 3L2CA 2VQLA 3LSRA 1S8NA 1R1UA 4KUMA 3MWMA 4M3DA 1A6IA 2BVLA 1OYWA 1TT0A 1JI8A 1ZRDA 4XRSA 2MABA 4MTEA 4EMSA 2XF7A 1YLFA 4P96A 4OMZA 4BQNA 1NK2P 1RR8C 2F5VA 1IF1A 5K5RA 2LP0A 1QVTA 4HBLA 5J8FA 4ENMA 2HR3A 3HYIA 5J1UA 5J4YA 1KYZA 2RV8A 5IT3A 2KFDA 3CF5F 5D4SA 2STWA 5LGNA 3CUQA 2RNJA 1PP8F 3OYDA 3HJEA 3ESWB 4EM0B 3WTTC 2JQ7A 3M4OJ 1W7PA 3FXJA 2AQEA 2R92J 1P7IA 4IQ4A 4D7NA 2IEKA 2IGNA 3H5NA 5KAIC 4U0WA 4C2TA 5FRNA 2JJ7A 3CCYA 1L0OC 1U6GA 1GT0C 1ZG5A 2IAIA 3ABTA 2KRHA 1SFOJ 3F6OA 2NVXJ 1I50J 1YOVB 3GYHX 5K1YA 1Z1DA 4RMNA 3KZIC 3QPHA 2PJRA 2OCCH 2LF8A 1XGSA 4LIUA 2GQQA 5GP9A 5HODA 4EJUA 4ENNA 3MVPA 1R5GA 2YX7A 4P9FA 1VNDA 3KEYA 1XPXA 1K83J 5LBQA 2OQRA 1IN7A 2IA0A 2PX9A 4UV8A 1JJ6C 2K9QA 4LITA 3D5LA 2L9RA 2P81A 4L0YB 1H88C 2R5ZB 4HLXA 2FQ4A 4IPAA 2KZVA 4CZZA 4UUSA 1FTZA 4A6DA 2BVMA 2R7SA 2KP6A 3GO5A 4KITB 2O03A 5EJCA 2J5OA 1BN5A 1XSDA 2ACJA 1B8IB 1JJ8C 2DA6A 2ME6A 4GXOA 3UKGA 3GFMA 1Z9CA 2AHQA 3MMYB 2NOGA 4HG2A 1HSJA 2VLAA 4I09A 1ON1A 3RKXA 3K2ZA 3SEQA 2KLOA 3K70C 1IRFA 3PSFA 1R71A 1UFMA 3S1MJ 3BQZA 2PFBA 2R7UA 3H9QA 3TKYA 3BPVA 3L1PA 5LGUA 1MKMA 1A04A 4JX5A 3GTOJ 3JTHA 2W1OA 3MAJA 2VKHA 4GCVA 3B02A 5EZHA 4XLHA 2Y2ZA 2DQRA 2ESHA 3ELKA 4ITVA 1ETQA 2O9LA 4RM3A 2DJNA 1D3YA 4DYRA 3FKIJ 4CCOA 3IAS2 3DEEA 3K4LA 1PYVA 1X3WB 2CQXA 2ETHA 1E0EA 1GLNA 3WODF 4LOCA 2XRNA 5DEQA 3A0BC 3GW2A 2ZO4A 3FBNB 2P5VA 1VFCA 3B6CA 3HOWJ 5GPCA 3S93A 1ZR4A 3T8TA 2OAZA 3EDPA 1RUNA 1FSHA 1IXRC 3CDIA 4AYBA 1FOYA 3I55I 3LAJA 4IKFA 5DYMA 2QBYB 1SMYF 2CRGA 1F4KA 3OIQA 2MD5A 3OR2C 1Q1VA 4OOIA 3LSMA 4MQ9F 3BJ6A 5HOOA 1FSEA 2VJIA 3M1CA 1UCRA 2D5VA 1ZRCA 1ETKA 1X58A 2COBA 4MGRA 3ZR8X 1USSA 3I0TA 3L9FA 2J5PA 3BG7A 3VFZA 2DPUA 2W85A 4L5EA 4YEJA 1XSVA 2LVSA 4E70A 4XIDA 1J75A 5J8CA 4EJOA 4G6TB 5BQTA 1HDDC 1ZLKA 5JLWA 3HG9A 3EUHC 2X6XA 2E36A 3C3WA 2XC7A 3X2QH 2CFOA 5DCFA 1TT5B 4BL0B 2Z3YA 3P5JA 1ETWA 4XKVA 3HB9A 1YW8A 2UUZA 5KAFC 2R5YB 2VUMJ 2D2WA 2R7FA 2UXNA 3G1LA 5CYVA 3KYCB 4A3JJ 3GTPJ 4IRGA 1HF0A 4KIBA 2Y9YA 4E6KG 3ZN1A 4F93B 3VSKA 4B4CA 4A3DJ 5CVUA 1D0ZA 2K86A 1W7PB 4PJ0C 4XLEA 4OIQF 1BBYA 1IN6A 3KZYA 3FWEA 3Q3SA 3K4BA 1XGNA 4S04A 3L2QA 3VB2A 1K78B 4GDFA 3A01A 3ZQLA 2DI3A 2FOKA 1VTNC 4DIQA 5JI6A 3SFZA 1JT6A 4ON0A 2ZFWA 3IV5A 5TRDA 2P7CB 1ON2A 1AOYA 3HOTA 1ZREA 3QRFF 1YRNA 4GFBA 3WTYC 1PDNC 1UAAA 5IT9K 1LVAA 3H92A 4A3FJ 1SD4A 3WE2A 1SEUA 1VQOI 4IZZA 4V2FA 3L2UA 2W25A 1FP1D 1TQIA 4CYDA 1XCBA 2VC1A 3E0JB 3AKZA 2M7AA 3HUGB 1S5LC 1TNTA 5HVQC 5J3LA 4AUXA 1REPC 2OZUA 2WWYA 1CQTA 1HBXG 3R61A 1JGGA 4I0AA 3JRHA 3ZXSA 2EWNA 3F22A 4UB8C 3TO9A 2F5FA 1E2XA 1BOAA 4C2UA 1OYIA 2VQHA 5ILSA 5FFZA 2K85A 1TWGJ 2V7FA 4UVBA 4OIOF 1E17A 4IHXA 2Z99A 4BU2A 2XKPA 4R8HA 4D7MA 2HKOA 4PJNA 2L0KA 3UNGC 3D5RC 3OIOA 3BP8A 4E7ZA 1ZH5A 4A6EA 2EFPA 3FXRA 4P1WA 2STTA 4XSXF 5CVJA 3OWTA 2JVGA 4DYCA 4E7JA 3EUKL 3WTUC 3ABUA 2FD5A 3J80Z 4FASD 1V4RA 4PUSA 5E18F 2BY2A 2CSOA 3FHZA 1GV2A 1ZR2A 5BNGA 3BZKA 2ZJPF 1FYKA 4I02A 4F91B 2BY3A 4I99C 3HHHA 1QO0D 2PMUA 2LR8A 3CMMA 4CGZA 3RKQA 1BM9A 5EGOA 4II3A 3ISPA 2HWVA 4HAMA 3NWTA 4AIHA 1FC3A 1WRJA 2V9KA 3QODA 4RGUA 1GVDA 4BH9A 2UWMA 1OFCX 3GBGA 2E7WA 3N4MA 3WHCA 3AG4H 2R7TA 4M9ZA 1SAXA 4TV7A 5LLQA 2Z16A 4I01A 3E7LA 4NC6A 3I56I 2RC4A 3CCEI 3LQQA 5F0CA 3J7AY 1U5TB 2MA3A 4XNFA 1KA8A 1D1BA 3RJPA 2DT5A 3GMEA 1QZZA 3EYYA 3S2WA 3GTGJ 3BR1A 1FP2A 3GFLA 3J7YJ 3HBLA 5ICEA 4HDUA 3ASOH 4EM2A 3CP8A 1G2HA 1CF7B 1XTAA 2XHKA 2PI0A 1BR1A 1J0RA 1ZGJA 4HV5A 4L9JA 4DBRA 5D8LB 2JUCA 4RBOA 2VE9A 4MEXF 3RPUD 2BV6A 3E6DA 1U5TC 2HXOA 1Z6RA 3R6SA 2HU9A 4GGGA 1V5GA 1O3SA 2HVRA 2ISZA 1WJ5A 2KT0A 2ZJQF 2ZSIB 2BY0A 3EQLF 1G8XA 1R1VA 3R0JA 4HNVA 2Z33A 3HSRA 4HF1A 1EH6A 2LY2A 3BOQA 3FM3A 3LSGA 3OYAA 4IXAA 1FEXA 3K1PA 4QPOA 3JW4A 2LC2A 5H2FC 4DNCA 3M07A 1ZYRF 2P7VB 1MSEC 1YQAA 3O3KA 4N9HA 2EB7A 4HX7A 3JRDA 4BQOA 3HKZN 3Q0VA 2O7OA 5K5QA 4ZTJA 4BJ5C 3BG9A 3KETA 3CCSI 3RTRA 1LDDA 5CKTA 1HKSA 2WA0A 1QGPA 2Y0MA 1JKOC 2GWRA 2W82A 5C3EJ 4XOTA 2FUG2 2JA7J 4AVZA 3JAMZ 2JSPA 4KT5C 2KJCA 1KU3A 1GHCA 3FMSA 3EYIA 1B1BA 2Q0OA 5E8IA 2MBFA 5M5XJ 2LTPA 1W4MA 3H3ZA 5GAEJ 1LDKB 1MH4A 4BBRJ 1I6HJ 2ECCA 3NWSA 1R58A 5F1JA 3PQKA 3KYDB 1B72A 3ZRGA 5JLXA 3DQVC 3DTIA 4DZPA 3ZQQA 3OR1C 3S1QJ 2EZIA 4M6VA 4Y52J 1VQNI 2XPVA 3KYLA 4AWXB 3HKZA 4FX0A 3BJOA 3OYFA 3HOVJ 1RNLA 1T38A 2QSHX 1FPQA 2IVMA 2AO9A 4RLQA 2W4SA 3OYLA 3HRUA 3ZP5A 1F36A 4OAZA 5HDKA 3L2RA 1YW9A 1WJEA 3K4KA 1WZ2A 1W5TA 3IRRA 4L18B 3CJNA 3JTGA 1SFEA 3A02A 5IOYA 1V5FA 1AU7A 2L2OA 4M73A 5EG0B 3C18A 4E7HA 1GVJA 3OYCA 5HLHA 1KU7A 3TP3A 1R49A 5FO5A 3OYBA 3LAPA 3QPTA 2XAQA 4G94A 2DAOA 3SZPA 4YG2F 5H6QA 1H9GA 3U2RA 1J09A 1NG6A 3HTUA 3CCMI 4XONA 3A1YA 3DCFA 4E7SA 1DU6A 5B66C 2K3PA 1SVLA 3S3NA 4QIWN 4U0VA 1F5TA 2IS2A 1I1GA 4BS9A 5DD4A 5K7HA 1QQIA 2TRTA 3DBLB 2EA2A 3JCUC 5F27A 2OPTA 3SZGA 1OQYA 2DBBA 5FB2A 2XKOA 2DTZA 4XMYA 3B73A 3PSIA 3SHFA 3W6VA 5A2QK 1FX7A 3DPUA 2CO5A 3PQJA 1Z21A 2BOLA 2DODA 4LK0F 4PK4A 2HS5A 1S6LA 2VBWA 2HNHA 4OINF 1EA3A 2WADA 3F3XA 4BGDA 3ECOA 1JE8A 4Y17A 4A0YA 4A12A 3KP3A 1OCZH 2WAQA 1AA7A 1MJBA 4RGRA 1QRYA 3KEQA 3W6KB 1E3OC 4C3JJ 5F0FA 1R36A 2CW0F 3KP2A 1XGMA 3I5UA 3RQ4A 4GO1A 1R00A 1XD7A 3SEZA 1N77A 2FEZA 1MSFC 3EPZA 1R22A 2KMUA 2LREA 1S7AA 3MZ8A 2E1CA 2OJED 2XAHA 4BY1J 1HC8A 3CCUI 1KONA 4C30A 1PJRA 1YTYA 2VXDA 3VWBA 2L7MP 4PGGA 5JR3A 4L9VA 1P92A 2VPRA 1Y1WJ 5EZGA 1U8BA 1ZARA 3MFKA 3K6GA 2B7EA 2LFBA 3M8JA 4XRMA 3OYHA 3NARA 2V4JC 5D6EA 2CS3A 1XX5A 2QKMB 2XAUA 2V9PA 1W7PD 3GTJJ 1C0WA 4KISA 4HOBA 3BCBA 4GYIA 3KZZA 2IXSA 4ZZDA 3WHBA 1AHDP 3SYTA 4HRIA 1P4XA 5FFXA 2E2IJ 1IJWC 1H9TA 3PO3J 2NNYA 2HZTA 3JRIA 4OMYA 1G3YA 5FKNA 4CH7A 5FD5A 3LSTA 4WK8F 3BC8A 1WH7A 5C4JJ 2R5ZA 1RI7A 1ENHA 4ZC3A 1OISA 3PIOF 1Y56A 2X51A 4A2UA 1CGPA 1S3JA 4JBAA 2L5QA 1L3LA 4RAZA 4YFXF 1UHWA 2ME0A 1ACIA 2ZNYA 3DFGA 1T08B 2LK2A 2NRAC 4BJTA 1FWZA 3E5UA 3H1CA
chains in the Genus database with same CATH topology
4BXFA 4PJMA 3U21A 3I9V2 4YELA 2PJRB 1T0FC 4CCKA 4PJLA 4F92B 2R7WA 2X6YA 2KZVA 2X85A 2V6EA 3PJRA 2HPIA 2GOMA 2BVMA 2R7SA 2KP6A 2RQQA 4KITB 3AFHA 5FROA 4XKBA 3EUAA 2E5ZA 2VASA 2E1MB 2IGMA 5CPRB 3MMYB 1MMDA 2XDVA 4HG2A 4NUBA 2VLAA 3PNYA 1MNEA 4CCNA 1SFKA 3SEQA 2KLOA 3PNVA 3K70C 3PSFA 3QYEA 2LH9A 1R6RA 3SDBA 4F55A 4XLCA 2R7UA 3OS2A 4DOZA 3H9QA 3H9GA 5CQEA 5KHDA 2OV7A 2K5CA 2E1MC 1D1CA 3OYJA 3E1SA 2W1OA 2VKHA 2VQGA 3OY9A 1DGWY 1BR2A 4XLHA 4ITVA 2W00A 3A4CA 4RM3A 4PSXA 2I8DA 1V5EA 4ZTFA 4DGWB 1FMWA 3CF2A 2IS6A 3UR3C 4HNTA 2LRDA 4CCOA 3IAS2 2XF6A 2CV1A 3W2AA 2Y0SA 2VQCA 1PYVA 3DEEA 3K4LA 1E0EA 3L2VA 1TZLA 1GLNA 3DPTA 3QYBA 2VJ5A 2P0WA 3FBNB 3VYTB 2M4GA 4E7KA 1Y6IA 1QU3A 3S93A 2ELJA 4IKFA 4AYBA 1DP3A 2E60A 2RREA 3PUBA 4B48A 2Z2SB 3OIQA 3OR2C 4B47A 3W2WA 2RNGA 4ZJZA 3LSMA 4F3QA 4R79A 3VYRB 5HOOA 2HVQA 3MKWB 2VJIA 3M1CA 4E4HA 2V26A 5HNFA 3D5SC 4XN0A 2VL8A 2OC6A 3ZR8X 3BG7A 3HOSA 2XF5A 3HC7A 4YEJA 5TGTA 1YX3A 2AQFA 2WY8Q 4XM3A 1S9HA 4G6TB 5KNLA 2PMZA 4LG3A 4U87A 3HG9A 4J00A 3EUHC 2X6XA 4NNJA 2XC7A 2CFOA 3QOEA 3DU6A 4QPQA 4P5OA 4BL0B 4OWRB 2R7QA 2R4GA 4XKVA 4BE2A 3K4NA 4PSWA 4XLAA 2UUZA 2K9MA 3BG6A 3H35A 4CCJA 4E7IA 4XL9A 4BEHA 4E6KG 3RSNA 4F93B 2CV0A 3VSKA 2MYSA 5CQGA 1D0ZA 2KRCA 4GRIA 4XLEA 2CUZA 3W3CA 4CCMA 3K4BA 3L2QA 4BEHB 4DIQA 5LFAA 2DXIA 3MD2A 3K70D 3MKYB 3OS1A 4ANJA 3HOTA 3PNTA 1WJCA 1WJAA 1OLTA 1X1CA 2CW8A 4KJZA 4EATA 1UAAA 2Z1DA 4B3XA 4RLFA 2R7OA 1D0XA 2LY1A 4IZZA 3L2UA 3DU5A 2HPMA 4DJAA 2X1DA 4N4OB 2VJ4A 3L2WA 4Y33A 3E0JB 2M0MA 3AKZA 1W36C 2M7AA 3HUGB 2W7NA 3DPLC 4D1QA 4HSRA 5HVQC 2CUJA 3BCAA 2WB1A 3ZXSA 4NQWB 3HXLA 4C2UA 4PJJA 2JA2A 2VQHA 3F9KA 3ZCOA 2V7FA 4RM2A 1QHGA 3G2BA 4BU2A 2VPLA 4PJNA 3UNGC 3D5RC 4E7ZA 1X19A 2DOAA 1D0YA 3FKJA 4FETA 2NOJB 4P1WA 3OWTA 2JVGA 1N75A 2GOXB 3EUKL 2LYCA 4E7JA 1YE9A 4LIVA 1X4OA 2BW3A 4FASD 3OYNA 4MLOA 4PUSA 1YX5A 3W2VA 2ZXHA 3OYMA 1Z3YA 4BE1A 4F91B 3ZGKA 4XKCA 3CMMA 4DBQA 4B43A 4II3A 1WJBA 3NWTA 2M4KA 2V9KA 1LVKA 3QODA 4CUGA 2UWMA 2Q2EB 4JOMA 4D9JA 2BW3B 3DKXA 5LD2C 3GBGA 1MW7A 3KX2A 2X6WA 2R7TA 1VZ0A 1UELB 1BR4A 2R7VA 2Z16A 3HL2A 4ZYAA 3J7AY 3FBIB 4XNFA 4C9YA 1D1BA 3S8PA 4XLFA 3LSKA 1WFXA 4II2A 4XR6A 2KDOA 1X1DA 4YRVA 2WY7Q 3CP8A 4X0GA 4KT6A 3RCOA 2LG4A 4XN3A 1MMGA 1BR1A 2R7XA 4DBRA 2F4IA 3RPUD 3H9JA 1ZELA 2KL4A 3S3OA 2HU9A 1V5GA 4BUPA 2HVRA 1WJ5A 1Z3XA 2M7BA 3K4JA 2ZSIB 1G8XA 4XOPA 3PL8A 3DTEA 3OMYA 2X1CA 2LY2A 3LSGA 3OYAA 2QKLB 2KPMA 4QPOA 1W36D 2LC2A 3OYGA 2L9NA 2UV1A 1X1BA 4BQOA 4Y3OA 2K9LA 4J01A 1ERDA 2VKDA 3H5RA 2VB6A 3LMMA 3FDYA 4BJ5C 4ZTJA 2CW7A 4HSTA 2DCEA 3RTRA 5CKTA 2WA0A 2IGOA 3TBIA 2W82A 4NC7A 4XOTA 2FUG2 3TL4X 3CP2A 4AVZA 2WAFA 2JSPA 2DT7B 4BACA 3QYFA 3CESA 2HDWA 3LL7A 1LDKB 3BLYA 3NWSA 3HPGA 2DT6A 2L7KA 2Q1ZB 4U7BA 3ZRGA 4HNUA 3DQVC 3DTIA 3ZQQA 2CV2A 3OR1C 1MMNA 3VSLA 3OYEA 3KYLA 3HKZA 2M3AA 3IAM2 3VYUB 3OYFA 1T95A 3VYSB 4BDZA 1X4PA 3PFYA 4IX7A 1G59A 4PFPA 3LFUA 1X1AA 3CJRB 4N4NB 4RLQA 2W4SA 2ZFUA 1LKXA 3OYLA 3CJQB 4CSWA 4OAZA 3L2RA 1WJEA 3K4KA 4HPQA 4NC8A 2A6TA 2VJJA 4XKWA 2JVHA 4BQQA 3AL0C 3LSIA 4CZCA 1V5FA 1WJFA 5JHFA 2L2OA 4E7HA 2MC4A 4JQFA 4BE0A 1DQUA 3OYCA 2A5WA 2KHMA 1U0JA 3OYBA 4XQFA 3H5AA 2XSJC 1QHHD 1P9QC 2WBMA 2ZXIA 1J09A 1NG6A 4XONA 3A1YA 3VDXA 4E7SA 2K3PA 2CMPA 2V1NA 3DLAA 4HEA2 4PFOA 4BJ6C 3S3NA 2IS1A 2IS2A 3IP4B 4BS9A 3OYIA 5KCMA 2KQRA 2HZDA 3FHNA 1IRXA 2CH0A 2X1EA 3SZGA 2IS4A 2LOOA 4XMYA 2IGKA 1BOBA 3V42A 3PSIA 3K10A 3IUOA 2R7RA 3DPUA 2LBFA 3I3LA 3K4CA 1Z21A 2BOLA 1N78A 1FMVA 1HA8A 1D1AA 4PK4A 1SAUA 2HNHA 1EA3A 2MFZA 2WADA 4BGDA 1MNDA 3MKZA 2VQLA 2WAQA 1AA7A 3CZ6A 3A2KA 3OS0A 3OL4A 2LBFB 3S3MA 4B44A 2BVLA 1TT0A 2HVSA 1JI8A 2JUGA 2VIXA 5FRMA 3RQ4A 2MABA 3SEZA 2OUMA 4XORA 1N77A 3EPZA 2KMUA 2XF7A 2LREA 3DTKA 4BQNA 1KONA 2F5VA 1OR7C 4C30A 1PJRA 1UG0A 2VXDA 3TMOA 4AU7A 2L9SA 3VWBA 3H0DA 4H4KC 2E5NA 3C2GA 4E7LA 4CA0A 3K6GA 4Y4RA 3M8JA 3OYHA 4BDYA 2V4JC 2CS3A 3OYDA 2QKMB 2XAUA 4ZDLA 1DGRM 2WAEA 2ZSHB 1Z7LA 4ZDPA 1LFPA 2AQEA 4KISA 4IQ4A 3OL3A 2IGNA 3H5NA 2DJIA 2VXZA 3BCBA 2IXSA 4C2TA 5FRNA 4ZDOA 4OAYA 3HPHA 3SYTA 4HRIA 4F52A 1NG7A 2KRHA 2O5RA 4RMNA 4CH7A 3OYKA 2MD0A 4IQJA 2HQAA 3ONQA 1WJDA 3BC8A 3LSHA 2PJRA 3K4MA 3S32A 4LIUA 3C2HA 4ZC3A 3DKYA 3OIPA 1Y56A 2X51A 3AL0B 2L5QA 5HNHA 1MMAA 1K6YA 3KEYA 2F6CA 3DWLE 3OOUA 3N05A 4BJTA 5HLTA 4CCLA 4LITA 3D5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOA A;  2E5N A; 
#chains in the Genus database with same CATH topology
 1HOM A;  4PJM A;  1FT9 A;  1VQ9 I;  1B8I A;  2FX0 A;  2JTV A;  2YU9 J;  1XMA A;  2V6E A;  3GWZ A;  1I3Q J;  2EFW A;  1SD5 A;  3TO6 A;  3AFH A;  2XRO A;  1YIO A;  3KPH A;  4XKB A;  5LHG A;  2RQP A;  1IRZ A;  1FOK A;  4YFN F;  2E5Z A;  1WQ2 A;  2R3S A;  1QA6 A;  1IO2 A;  1TQP A;  2HXI A;  4A3M J;  1OCP A;  1X3U A;  2IGM A;  1RET A;  1MMD A;  4ESF A;  1TQM A;  5DTD A;  4LMY A;  4CCN A;  2M9H A;  5DM6 F;  1WI9 A;  1SFK A;  3U1K A;  2QLZ A;  3PNV A;  2PQ8 A;  1R6R A;  3SDB A;  4XLC A;  1KQ9 A;  3RYR A;  4M3G A;  2GLO A;  3H9G A;  2EZK A;  2K40 A;  1ZG1 A;  5CQE A;  3V7C A;  3LWF A;  2K5C A;  1DDN A;  2XAS A;  1SFX A;  3E1S A;  4WWC A;  4HF2 A;  1D5Y A;  4BAY A;  1LPQ A;  2M87 A;  1Z77 A;  4BKX A;  3A4C A;  1E3P A;  2DOF A;  2M8G X;  1JTY A;  2I8D A;  1V5E A;  4FE4 A;  4DGW B;  2M2E A;  3CF2 A;  4X1E A;  3ZPL A;  2XF6 A;  1I5Z A;  2CV1 A;  3JRC A;  2Y0S A;  3QPS A;  3EUH A;  3E6M A;  1J59 A;  2QBY A;  3CCJ I;  1TZL A;  2A5Y B;  3QYB A;  1Q1H A;  1KQ8 A;  4IEJ A;  1NK3 P;  3VYT B;  3SDG A;  4A5N A;  4E7K A;  2GXA A;  3IWZ A;  3GF2 A;  2ELJ A;  4KMU X;  4R1H A;  2VKV A;  3TOA A;  3JSO A;  2JSC A;  3Q9V A;  3F8B A;  4D0P A;  1MZB A;  1UJ8 A;  2W84 A;  2DDA A;  1HLV A;  2IP2 A;  2RNG A;  2ZBK A;  1BL0 A;  3CCL I;  4G7O F;  4FHT A;  2JMW A;  3FXK A;  2VBY A;  2V26 A;  3GZN B;  4E4H A;  5K7Z A;  3G4S I;  3D5S C;  2VL8 A;  3TQN A;  4G6D A;  4M74 A;  4HQE A;  2HI3 A;  2H94 A;  4KYW A;  1FYM A;  2Q8K A;  5J4V A;  3HC7 A;  1X2M A;  3CME I;  2R5Y A;  4HDV A;  2AQF A;  1Y8R B;  4IRI A;  4A0X A;  4EQQ A;  1S9H A;  3FMR A;  2K27 A;  1IXC A;  3HTS B;  1QZE A;  2H6C A;  3QOE A;  3DU6 A;  4QPQ A;  4EM1 A;  4D5C A;  2VE8 A;  5BOX A;  1APL C;  3CDH A;  1FLI A;  1KU2 A;  2R4G A;  3TW7 A;  4IHW A;  3GX4 X;  3P9K A;  3BG6 A;  3LNQ A;  1EH8 A;  3H35 A;  1K78 A;  3M8E A;  4XL9 A;  1MD0 A;  1NH3 A;  4LJZ F;  3RSN A;  1LFU P;  2CV0 A;  1PVE A;  3SFI A;  5IP6 A;  5M3F J;  5CQG A;  2K3F A;  2CUZ A;  2DYR H;  5E1Z B;  5B5E C;  2R7Z J;  3WTW C;  5L3G A;  2DXI A;  2OZ6 A;  5DUI A;  2XB5 A;  3MKY B;  4ANJ A;  5D5U B;  3PNT A;  3HUG A;  4KJZ A;  5DS9 A;  4B3X A;  2VI6 A;  2R7O A;  1D0X A;  2XVC A;  1X1P A;  4EJV A;  4LK1 F;  5LEK A;  2HDC A;  3DU5 A;  5LRS A;  2M5W A;  2QF7 A;  2HPM A;  1R5I D;  2JPB A;  2KIM A;  2X1D A;  1ETY A;  2KIU A;  5J1Y A;  3DF8 A;  5D5V B;  3I54 A;  3MCZ A;  1K7A A;  4PGH A;  2OA4 A;  2ZB9 A;  3QP6 A;  2IT0 A;  2LKX A;  4NQW B;  3JRA A;  4YFK F;  4MO7 A;  2IRF G;  4KFC A;  3O8H A;  2HYG D;  5E3O A;  5L3F A;  5M5W J;  1X19 A;  1TWC J;  3FKJ A;  1RKT A;  1OMI A;  1IV6 A;  4AYB N;  1TW3 A;  3GEZ A;  2Y9Z A;  4RB3 C;  1YX5 A;  2QEN A;  2XAG A;  3PO2 J;  1BW5 A;  1GDT A;  3FXL A;  5IYB J;  2MC3 A;  3JRG A;  4IF4 A;  4XKC A;  2PMH A;  4A93 J;  1U5T A;  3BTJ A;  2M45 A;  2M4K A;  1LVK A;  5F04 A;  5FLX Z;  1WGX A;  2Q2E B;  4D9J A;  4ENJ A;  5LD2 C;  1BJA A;  1LUJ B;  5ED4 A;  4XLP F;  1VZ0 A;  2DA3 A;  2DMN A;  2DA5 A;  4MQV A;  2XGD A;  2R7V A;  3KP6 A;  3PIP F;  1Z0X A;  3IL2 A;  1NHA A;  2HYJ A;  4ZYA A;  3HL2 A;  2OD5 A;  1CF7 A;  1TNS A;  2E7X A;  2UXX A;  1MNM C;  1ZTR A;  2HQR A;  3HRM A;  5HS8 A;  3LSK A;  1WFX A;  4II2 A;  3J81 Z;  2X9D A;  1X1D A;  4LFU A;  4U88 A;  4O3M A;  4RGS A;  1DU0 A;  5D6F A;  2ZCW A;  2LG4 A;  5B3S H;  2R7X A;  4EV0 A;  5ILU A;  4KIF A;  3BTI A;  4PCQ A;  3H9J A;  1ZEL A;  5B1A H;  1YO5 C;  1S72 I;  3B6A A;  3KCC A;  2EIJ H;  2DYS H;  3FXM A;  1R4M B;  1Z3X A;  1V54 H;  4B3A A;  4RAF A;  4ESJ A;  2DFI A;  2QUF A;  1Z05 A;  2W48 A;  4UVA A;  4XRF A;  1R4N B;  3DTE A;  4FX4 A;  3V8L A;  2X1C A;  2QSG X;  3DKW A;  2QKL B;  1BI0 A;  2K4B A;  2DDB A;  2OCE A;  2UV1 A;  2XPU A;  2BGC A;  3G3Z A;  4Q47 A;  3AG3 H;  1KU9 A;  3JRF A;  2EFN A;  2KKO A;  2FQ3 A;  2K9L A;  3L00 A;  2VKD A;  4IL6 C;  2VB6 A;  3FDY A;  4S05 A;  1BIA A;  1BIB A;  1K79 A;  4BXX J;  2YSR A;  4AC0 A;  1ODD A;  1W0T A;  1UB9 A;  4BHC A;  2ZJR F;  2JN6 A;  1FJL A;  2V1D A;  1VQ6 I;  2IGO A;  1VQ7 I;  4BNC A;  4AVP A;  1F1Z A;  3TL4 X;  1ZKG A;  1ZGA A;  3CP2 A;  1YW7 A;  1ZK8 A;  2WAF A;  2ZNZ A;  4A3B J;  4BAC A;  3ZQI A;  1U9O A;  2HDW A;  2N8G A;  2L7K A;  2X48 A;  4U7B A;  3H0G J;  1MBH A;  3HEF A;  4L9T A;  2L54 A;  5KVR A;  1U9N A;  1ZHF A;  4CO8 A;  3OYE A;  3FXO A;  4HW0 A;  3ROU A;  1O57 A;  1XB4 A;  1G3S A;  4EGY A;  3CUQ C;  4KA4 A;  1YYV A;  2VN2 A;  1UZC A;  3PFI A;  1MBK A;  1T95 A;  2FMY A;  4WXD A;  3VYS B;  5LGT A;  1TWA J;  2IBD A;  1I27 A;  3PFY A;  5EG0 A;  3LFU A;  1RKW A;  3H3U A;  1X1A A;  2BBY A;  2HQN A;  1LKX A;  2KIF A;  3KP4 A;  2AXT C;  1B9N A;  3T5X A;  4F7Z A;  1RR7 A;  2ZME B;  2BZT A;  3J7A O;  4HPQ A;  3AAF A;  3RKW A;  2EFQ A;  3CCV I;  1MJA A;  2A6T A;  5F6F A;  4XKW A;  2JVH A;  1YS7 A;  2GBY A;  4BQQ A;  2ID6 A;  1IG7 A;  3AL0 C;  2IJL A;  4CHU A;  4CZC A;  2QSF X;  5GAH J;  2ECB A;  4JQF A;  3SQN A;  1FIP A;  3DV8 A;  4KN7 X;  3CTA A;  2A5W A;  1W5S A;  1U0J A;  3BQY A;  2K4J A;  1QNT A;  4BHP A;  2LKS A;  1BI3 A;  4ZYG A;  2JA6 J;  4LLL A;  2ZME C;  3VDX A;  2QZ8 A;  4BXU A;  3FIS A;  1SD7 A;  3ZQH A;  2V1N A;  3DLA A;  4HEA 2;  4Z6Y A;  4EEF G;  2IS1 A;  3HM5 A;  3OYI A;  2GA2 A;  5KCM A;  1SVO A;  3T1B A;  2HTS A;  3FHN A;  1IRX A;  1O7F A;  1SFU A;  2IS4 A;  2LOO A;  2GM4 A;  3R0A A;  5M3M J;  2Y69 H;  3K10 A;  2GAU A;  2R7R A;  2HEO A;  3GCM A;  4IHT A;  4LLG F;  3S14 J;  3K4C A;  1N78 A;  1IN5 A;  3DEW A;  3IRQ A;  2F5C A;  2VT3 A;  2CFX A;  3MKZ A;  4EVI A;  3CZ6 A;  3A2K A;  2BHY A;  3OS0 A;  3OL4 A;  4Y15 A;  2NVT J;  1JUM A;  3GTK J;  3I64 A;  3S3M A;  3IC7 A;  1EKE A;  4B44 A;  2HVS A;  2EK5 A;  4I76 A;  2JA5 J;  2JUG A;  2VIX A;  3MN2 A;  5FRM A;  4XOR A;  3WTS C;  1XMK A;  3RKY A;  2A61 A;  1Z6T A;  2CYY A;  3DTK A;  1H89 C;  2V1X A;  3I58 A;  1O4X A;  2RN7 A;  3TMO A;  2FSW A;  1IV8 A;  1UHS A;  2H8W A;  2LKP A;  2L9S A;  3IH4 A;  2HYF A;  3H0D A;  2BY1 A;  4H4K C;  2VBX A;  3C2G A;  2PBI A;  4E7L A;  1VQM I;  1U3E M;  2A05 A;  1PUE E;  4CA0 A;  2A6H F;  1OCT C;  2L4M A;  4N9I A;  1HXD A;  4Y4R A;  2F4M B;  3IKT A;  4DYQ A;  5GAD J;  3V7S A;  4Q5S F;  3HIF A;  3I59 B;  2KRF A;  1JT0 A;  4KN4 X;  4ZDL A;  2O8K A;  2WAE A;  2ZSH B;  2V9V A;  1R7J A;  1LFP A;  3OL3 A;  3IHU A;  1T2K A;  2VXZ A;  3MEX A;  2BXY A;  3EET A;  1U78 A;  3BRO A;  1UST A;  1SVM A;  4ZDO A;  4OAY A;  3HPH A;  3CMA I;  1IW7 F;  1PUF B;  4O5V A;  2HTJ A;  3C1D A;  2O5R A;  1GUU A;  4I7H A;  3QOP A;  2ZXW H;  1Z91 A;  1VQ4 I;  5GAG J;  1DPR A;  1TWF J;  4IQJ A;  5HDG A;  3ONQ A;  1WJD A;  3LSH A;  3KIO A;  3CCR I;  2P6T A;  4MNU A;  3S32 A;  3V8J A;  3C2H A;  2DW4 A;  2JRT A;  3OIP A;  2NS8 A;  3ERM A;  3BR3 A;  1K6Y A;  2JPC A;  3Q9S A;  2F6C A;  3S17 J;  2A68 F;  4IVN A;  3OOU A;  5GTI C;  3N05 A;  5HLT A;  1UMQ A;  4RAG A;  4CCL A;  3F23 A;  4BBS J;  2ZC2 A;  2R7D A;  3BJA A;  3U21 A;  3I9V 2;  4YEL A;  4BXF A;  1T0F C;  4CCK A;  1YJ9 I;  1LEB A;  2R7W A;  1JUP A;  2X6Y A;  4BY7 J;  3LSJ A;  2X85 A;  2V6C A;  1MH3 A;  3S2H J;  2CGP A;  4L9N A;  3PJR A;  1JGS A;  3RYP A;  2HPI A;  2YR2 A;  2DMP A;  6PAX A;  3M1E A;  2GOM A;  2AXL A;  1FTT A;  5FKO A;  3QAH A;  4HQM A;  3WTZ A;  3K7A J;  3EUA A;  2VAS A;  5E1W A;  5IPA A;  2E1M B;  5IYD J;  4Y7N J;  1ORK A;  5CPR B;  4MIM A;  2XDV A;  4NUB A;  5AON A;  2WAQ N;  3PNY A;  1MNE A;  2VC0 A;  2OTL I;  3CJT B;  2LH9 A;  4IOA F;  5DM7 F;  5FKL A;  1LNW A;  3OS2 A;  4BHB A;  5H20 A;  3ZQG A;  2FF4 A;  1IRG A;  2EIM H;  1J2X A;  3BZ6 A;  5DV5 A;  3ABL H;  5TJJ A;  2E1M C;  2D1H A;  4W1U A;  1D1C A;  2K9S A;  3JRE A;  2VQG A;  1XC5 A;  5L3D A;  3WG9 A;  3OY9 A;  4HA8 A;  1DGW Y;  1IUY A;  1X3Z B;  4I2O A;  2NVQ J;  2W00 A;  1K61 A;  2E1O A;  4ZTF A;  1FMW A;  1AWC A;  5CVI A;  3F8C A;  2BXZ A;  3H3V K;  3HOY J;  3E97 A;  4HNT A;  1AKH B;  3W2A A;  2EH3 A;  2L7Z A;  2PMZ N;  2A07 F;  3E3V A;  1IDY A;  4EGZ A;  1XSX A;  3L2V A;  3FZV A;  1A31 A;  1BA5 A;  3RPQ A;  3PUF A;  5EF6 A;  2P0W A;  2HFH A;  4L0Z B;  1QU3 A;  3GZ5 A;  3BWG A;  3IH3 A;  2E2J J;  4M3E A;  2NYX A;  4B48 A;  2Z2S B;  1VF9 A;  1XGO A;  1LB2 A;  2E71 A;  3W2W A;  2CQ7 A;  2C6Y A;  4F3Q A;  3VYR B;  2Y31 A;  1TWH J;  2QQB A;  4WF2 A;  5HNF A;  1O7L A;  1F9N A;  3I71 A;  1ONV A;  1HKQ A;  3O2P E;  2NAZ A;  4A3K J;  3GTL J;  2CUE A;  3SJM A;  2QEX I;  2XF5 A;  5TGT A;  5D5W B;  3JR9 A;  1I6X A;  2WY8 Q;  3BPX A;  4XM3 A;  2A6E F;  5KNL A;  3J80 K;  2PMZ A;  4LG3 A;  4U87 A;  4J00 A;  2GZW A;  3G6E I;  4BYY A;  3K69 A;  4OWR B;  3S2D J;  4BE2 A;  3K4N A;  4PSW A;  4U7D A;  1WCM J;  2RDP A;  4IOC F;  4KIG A;  3F72 A;  1T98 A;  2ELK A;  4A0Z A;  5IP9 J;  1G4D A;  3WU2 C;  3ECH A;  2W24 A;  2BYV E;  3GVA A;  2NNN A;  3LA7 A;  1JKP C;  2KRC A;  3A0H C;  2YUS A;  3W3C A;  4CCM A;  3ASN H;  3HDD A;  2OQG A;  4BEH B;  2WTE A;  4LGW A;  2QA4 I;  1P6R A;  1WJC A;  1WJA A;  1X1C A;  1XDU A;  2KJB A;  5ERI A;  3G71 I;  1Y1V J;  2I5U A;  2L01 A;  2LY1 A;  5E79 C;  2MLG A;  2VOD A;  3F8N A;  4RDU A;  3ABM H;  2D45 A;  3L2W A;  1IC8 A;  3S15 J;  4NQW A;  1OCC H;  2X4H A;  1U2W A;  3DPL C;  3TOB A;  4CXF A;  2PEX A;  4Z2Y A;  2YU3 A;  2WB1 A;  1MBE A;  2H8R A;  1Y8Q B;  5FKK A;  2F4O B;  2XRL A;  2Y0S N;  2CQK A;  3HRS A;  3IKV A;  3MQ0 A;  3RI4 A;  1FOX A;  2LMD A;  2DMT A;  2ZJ2 A;  2JA2 A;  4HX8 A;  4PJJ A;  4UXN A;  2PLY A;  3F9K A;  3ZCO A;  1YIJ I;  1S29 A;  2RGV A;  5FGM A;  3HSE A;  3G2B A;  4J19 A;  1JKR C;  2VPL A;  2FNA A;  2DOA A;  1G6N A;  1D0Y A;  2E19 A;  4FET A;  2JK3 A;  2NOJ B;  3OOP A;  5ICG A;  5E3M A;  5EEA A;  2GOX B;  4G7Z F;  3CO6 C;  5K5O A;  2Q2E A;  1LDJ A;  1YS6 A;  2QQA A;  4XK4 A;  4LIV A;  2RVC A;  2EJR A;  3I53 A;  3OYN A;  3W2V A;  5BMZ A;  1TP4 A;  2ZXH A;  1Z3Y A;  5LEJ A;  2EFO A;  4BE1 A;  4JX4 A;  3BR2 A;  4O6J A;  4DBQ A;  1MBJ A;  4RGX A;  3F8F A;  3JAM K;  2LF7 A;  1WJB A;  2OBP A;  4UUT A;  4CUG A;  2KIQ A;  3BDD A;  4AD9 A;  2BW3 B;  4UB6 C;  2CQN A;  5AIP A;  3KX2 A;  3V8K A;  2X6W A;  4YIF A;  4M9X A;  1D8J A;  1UEL B;  4IRH A;  3G73 A;  1IN8 A;  4UVC A;  5D8K B;  3FM5 A;  1I1S A;  3S8P A;  3DBR B;  4N0B A;  3O8G A;  3SXY A;  1ULY A;  3BY6 A;  4XR6 A;  3AG1 H;  3ZMU A;  1Z7U A;  1T8I A;  2KDO A;  4YRV A;  3S1R J;  1EF4 A;  2DQL A;  2EQR A;  2WY7 Q;  2MH9 A;  3RCO A;  1IAW A;  5IT9 Z;  2F48 A;  1TC3 C;  3KLO A;  4S0H B;  4XN3 A;  5IY5 H;  4B1R A;  2B63 J;  2F4I A;  5AIQ A;  4ZYE A;  2XGC A;  3Q5F A;  2Z9O A;  1WH5 A;  4HV6 A;  4XSZ F;  5JVG F;  4BUP A;  4DZJ A;  2G7H A;  2YX4 A;  1B6A A;  1UHM A;  1FBQ A;  1IZ1 A;  3MKL A;  3G1O A;  4UHT A;  2ZKZ A;  3U9G A;  1BI2 A;  1QBJ A;  3PL8 A;  1E3H A;  4OU0 A;  1S7E A;  2O0Y A;  3DP7 A;  3N97 A;  5BPD A;  1R23 A;  3GFJ A;  1MIJ A;  4OIR F;  3ZMS A;  1POG A;  5DCM B;  1W36 D;  5GPA A;  3OYG A;  1MDM B;  2LDU A;  4EJW A;  1YHQ I;  3F0C A;  5E17 F;  4JP0 A;  3KFW X;  5CVV A;  5E20 A;  4UNO A;  4WCG A;  4J01 A;  1I39 A;  1OCR H;  4M3B A;  1ERD A;  3H5R A;  5C44 J;  3QWL A;  5J47 A;  2ID3 A;  1WWX A;  2CW7 A;  1ETX A;  2DCE A;  3SZT A;  2DLL A;  2RKH A;  3KE2 A;  4CYC B;  3TBI A;  3H36 A;  4ESB A;  2L4A A;  1V55 H;  4G9Y A;  2NXN B;  3QYF A;  1H0M A;  1IGN A;  2DK8 A;  2L9V A;  5E8G A;  3S1N J;  3LL7 A;  2BE5 F;  2X0L A;  1O3Q A;  1GV5 A;  1GXQ A;  1A35 A;  2DT6 A;  2XIG A;  2Q1Z B;  2OTJ I;  1M1E B;  2F5E A;  3NQO A;  4DQ2 A;  1ZGW A;  4HNU A;  1TW2 A;  1R5H A;  2CV2 A;  2E2H J;  1MMN A;  3CLQ A;  2VKE A;  3OSG A;  4FCY A;  1WPK A;  1BC8 C;  3BG5 A;  5EDN A;  4LB5 A;  2ZME A;  3WTV C;  1J9I A;  3GFI A;  2CG4 A;  3HOU J;  1RZ4 A;  3K1N A;  1B9M A;  2VOP A;  4BDZ A;  1X4P A;  2L3D A;  4A3L J;  1G59 A;  2K9N A;  4A69 C;  4A5M A;  4UUV A;  1FBU A;  4D5F A;  3KEO A;  5M5Y J;  4CSW A;  1FNN A;  2JRM A;  4RS8 A;  1OPC A;  4RAY A;  4P55 A;  2VJJ A;  5J1R A;  2HOT A;  5FLV A;  3M7G A;  2DK5 A;  3LSI A;  3R4K A;  3FMQ A;  5LRR A;  1D8K A;  3P9I A;  1KQ0 A;  1WJF A;  5JHF A;  3L7W A;  3VEP A;  2MC4 A;  4BE0 A;  5F1R A;  1JXS A;  5FKM A;  1Y0U A;  1LQ1 A;  3HOX J;  4XQF A;  4JYK A;  2XSJ C;  1WHU A;  5J6X A;  3COA C;  2WBM A;  4KIC A;  4C3I J;  3REO A;  2JZY A;  1R1T A;  1EH7 A;  1FY7 A;  3QU3 A;  2QM3 A;  3WE3 A;  1PP7 U;  4ETS A;  1ZAO A;  2L02 A;  2FNP A;  2CMP A;  2H27 A;  3QPL A;  3Q0W A;  4BJ6 C;  2HOE A;  4HYE A;  2DMQ A;  3V4G A;  3E6B A;  1SD6 A;  2DFH A;  2IA2 A;  3LQR A;  1P7J A;  1P2F A;  2KQR A;  5TIS C;  5DDG A;  5CLS A;  4MFE A;  2TCT A;  2CH0 A;  2X1E A;  2QVO A;  2QGU A;  3C7J A;  4HLY A;  2IGK A;  3D1N I;  3K0L A;  4UY8 I;  2KZG A;  3WGI A;  2P5K A;  4LLN A;  3I3L A;  1FZP B;  3CQZ J;  3QP5 A;  1HA8 A;  1XCV A;  1SAU A;  5F08 A;  2GIZ A;  2LNB A;  4ENK A;  4QSH A;  3T8R A;  2H1K A;  4Q48 A;  1MND A;  2HQ5 A;  3CCQ I;  4FQG A;  3ZQ7 A;  4M3F A;  4HZF A;  3NRV A;  2LBF B;  1ZQ3 P;  2K02 A;  4UV9 A;  4AID A;  2OUM A;  4A3I J;  4RB1 A;  3GTQ J;  3L09 A;  1HW2 A;  5HDN A;  3QU6 A;  2EBI A;  5L3B A;  1FOW A;  1OR7 C;  1FBS A;  1UG0 A;  4NBQ A;  4AU7 A;  1RES A;  3I59 A;  2FE3 A;  3FK6 A;  1LJ9 A;  3O6B B;  2YPR A;  1TLH B;  2E5N A;  5J40 A;  2K7L A;  5LHH A;  2IW5 A;  4H0E A;  2FA5 A;  1VI0 A;  1FIA A;  3AG2 H;  2BEO A;  2M0C A;  3HOZ J;  1Y39 A;  2FJ1 A;  4A3E J;  4BDY A;  1KGS A;  1HST A;  5HLI A;  1PUF A;  1A6Q A;  1DGR M;  1T0F A;  4NB5 A;  1Z7L A;  4ZDP A;  4RA2 A;  2VON A;  2LD5 A;  1XN7 A;  2DJI A;  2R93 J;  2CQQ A;  3CUQ B;  1JUS A;  5DUK A;  1LEA A;  4F52 A;  1NG7 A;  2P4W A;  2OU2 A;  2E35 A;  4KMF A;  4AIJ A;  4FTH A;  3OYK A;  2MD0 A;  4M71 A;  2HQA A;  1VQP I;  3K4M A;  4IHS A;  1BC7 C;  2EIL H;  3DKY A;  2PN6 A;  1YG2 A;  2WV0 A;  2M34 A;  2KIS A;  4JX6 A;  5HS7 A;  1IN4 A;  3AL0 B;  3DEU A;  5HS9 A;  5HNH A;  1MMA A;  1TBX A;  1K6O A;  3DWL E;  5A2Q Z;  2EV0 A;  2B9S A;  4KNY A;  2PJR B;  4PJL A;  4F92 B;  3G1M A;  1MJ9 A;  2W57 A;  3BZC A;  3CMY A;  3TED A;  2CWE A;  9ANT A;  4B8X A;  1BJZ A;  5E1X A;  2RQQ A;  4MEY F;  5FRO A;  5EYR A;  3BTC A;  3FX3 A;  1P4W A;  4UUS B;  2MLK A;  1QZY A;  2DPD A;  5FJ8 J;  1YI2 I;  5C4X J;  4P9U A;  2E1N A;  3QYE A;  4CIC A;  1J7K A;  4F55 A;  2JA8 J;  3PM1 A;  2DA2 A;  2QYO A;  2OF7 A;  2XGX A;  4DOZ A;  5BS6 A;  4I6Z A;  2QQ8 A;  3NAU A;  5KHD A;  2H09 A;  2OV7 A;  4DW6 A;  1AKH A;  4WXH A;  2GIV A;  3V7R A;  2NVU B;  3OYJ A;  4JK1 X;  3OV8 A;  1BI1 A;  3DLL F;  3FXQ A;  4MTD A;  5HLG A;  1BR2 A;  1YFH A;  3ZN0 A;  3VOE A;  3IH2 A;  4PSX A;  2M30 A;  3HGY A;  3P7N A;  5LHI A;  2IS6 A;  1LFB A;  3UR3 C;  2LRD A;  1MMS A;  2COM A;  3K2A A;  1A36 A;  4G12 A;  5ICC A;  2VQC A;  2XB0 X;  5L3E A;  1QPM A;  2Y48 A;  1QPI A;  1XG1 A;  3WG7 H;  1EJ9 A;  3DPT A;  4BQA A;  1HQC A;  1HKT A;  1BW6 A;  1Y0N A;  2VJ5 A;  2EV5 A;  3KP7 A;  2M4G A;  1Y6I A;  2MG4 A;  2HKX A;  3KP5 A;  3ZMT A;  2V79 A;  2F2E A;  1TL8 A;  1DP3 A;  2E60 A;  2RRE A;  3PUB A;  1T56 A;  2G7U A;  2XAJ A;  4B47 A;  3GLX A;  2H1L A;  3BR5 A;  5FLM J;  3RZO J;  2LY9 A;  3TDU C;  2M1B A;  4ZJZ A;  4KDP A;  2DTR A;  4R79 A;  4NDL A;  1VQK I;  2FBI A;  2HVQ A;  2LLK A;  3MKW B;  4C3H J;  2P6S A;  4FIS A;  4XN0 A;  3ZQF A;  2OC6 A;  3LOC A;  4ASN A;  4CDG A;  3BR0 A;  1F43 A;  3ULQ B;  3HOS A;  1MBG A;  1RRJ A;  2VBZ A;  1HDP A;  1JTX A;  2Y30 A;  1YX3 A;  1P4A A;  5DD8 A;  2O6G E;  4LD5 A;  2DN0 A;  3GTM J;  2HGC A;  3RZD J;  4NNJ A;  1ZG3 A;  4P5O A;  2VT2 A;  1ETO A;  2DA1 A;  2R7Q A;  1RIO H;  4XLA A;  4ZYH A;  2K9M A;  1N25 A;  1YIT I;  5FLX K;  3BG3 A;  1RPW A;  1JKQ C;  1B59 A;  4XBF A;  3BT9 A;  2QWW A;  4CCJ A;  2ADU A;  3E6C C;  1Z67 A;  4W97 A;  4BEH A;  4E7I A;  4PZJ A;  4IHV A;  2DOE A;  3C2B A;  2MYS A;  4XRS G;  3BTL A;  1V3F A;  3F8M A;  4GRI A;  1G3W A;  4V19 K;  1B4A A;  3M8F A;  5EEG A;  4WX9 A;  3OSF A;  4IJA A;  5GTH C;  1STZ A;  5FD6 A;  3VOD A;  2HOA A;  2IA1 A;  3GZ6 A;  3J81 K;  2MGQ A;  5LFA A;  3MD2 A;  3K70 D;  1WI3 A;  5E3L A;  2XAF A;  5EEH A;  4QLC U;  3OS1 A;  2KDZ A;  1NTC A;  5CJ9 A;  1OLT A;  4ABZ A;  2CW8 A;  3CO7 C;  4EAT A;  2Z1D A;  1W1W E;  4RLF A;  3A01 B;  1SAN A;  3FIW A;  4DJA A;  4N4O B;  2VJ4 A;  4YIR X;  2EIN H;  4Y33 A;  1O3T A;  2FBH A;  1A5J A;  2JT1 A;  2M0M A;  2CJJ A;  2XUB A;  4M6X A;  1IUF A;  1W36 C;  3CD6 I;  3HZJ A;  2W7N A;  2O61 A;  5F0H A;  4D1Q A;  1YRN B;  2UZK A;  4Y13 A;  4HSR A;  3I4N J;  2XV4 S;  5IYC J;  1OJL A;  1OCO H;  4C2M J;  2CUJ A;  3BCA A;  4L5J A;  5CVR A;  2DFE A;  1RUO A;  4A3G J;  1WKM A;  2XGE A;  3TW6 A;  1ZRF A;  3M3Y J;  2P5L C;  4QWQ A;  1LE8 A;  3HXL A;  3HHG A;  3ZMV A;  1OYY A;  4M9S A;  1VQ8 I;  3P9C A;  3ZMD A;  4HF0 A;  4RB2 C;  3CC2 I;  4RM2 A;  3WGH A;  5K7F A;  4GYG A;  4U0Y A;  3I4M J;  1QHG A;  2NS7 A;  2Y75 A;  1HW1 A;  3RDI A;  2FOW A;  2FU4 A;  2FXA A;  1T39 A;  3LSP A;  2XSD C;  3CDL A;  1N75 A;  2LYC A;  3GXO A;  1YE9 A;  5JHU A;  1X4O A;  2BW3 A;  2DFF A;  4MLO A;  1FYL A;  3OYM A;  3QQA A;  3GLL A;  4HX4 A;  4LG0 A;  4B09 A;  3DBH B;  4G6Q A;  3ZGK A;  4B43 A;  2MH2 A;  3TO7 A;  3FK7 A;  3MZH A;  3A03 A;  2FBK A;  2F5D A;  4JOM A;  3DKX A;  1MW7 A;  3D0S A;  3LFK A;  2NVY J;  3TGN A;  1BR4 A;  2MSY A;  1VQL I;  4L5I A;  2A69 F;  1SC7 A;  2AS5 F;  3FF5 A;  4YII A;  2O8X A;  3Q0U A;  1XDS A;  1RC9 A;  2YS9 A;  5EGO B;  2V1U A;  2GXB A;  3FBI B;  2ESN A;  4C9Y A;  2EZH A;  4XLF A;  1DPU A;  2CU7 A;  1KYW A;  1MGT A;  1W5C C;  2B0L A;  3RIR A;  1MBF A;  2JWT A;  4NHJ A;  4X0G A;  2HDD A;  1T6S A;  1XS9 A;  4KT6 A;  1UG2 A;  3TP0 A;  3BR6 A;  3JRB A;  5B1B H;  1MMG A;  3WU1 B;  2ELH A;  1U8R A;  4FE7 A;  2QQ9 A;  3I4P A;  4IO9 F;  1EV7 A;  3RPU A;  3S3O A;  2KL4 A;  2DU9 A;  3WGG A;  3CC4 I;  2HOS A;  5DCM A;  3J7Z I;  4AM3 A;  1MDM A;  1SMT A;  2M7B A;  2D1V A;  3K4J A;  1HCR A;  3RQI A;  5D4R A;  5IOZ A;  4XOP A;  1GXP A;  3OMY A;  4ZYD A;  2QCO A;  2I10 A;  4MHG A;  2KPM A;  2XPW A;  2L9N A;  2EZL A;  4CYC A;  2MW8 A;  1X1B A;  3ZMZ A;  3S16 J;  3K9T A;  1DUX C;  4Y3O A;  4G7H F;  4OIP F;  2L7F P;  2WB1 N;  1ITY A;  4MFD A;  3LMM A;  4WXC A;  3VPR A;  2PG4 A;  4HST A;  3ML6 A;  3U1D A;  2DMU A;  4M72 A;  3ERE D;  4NC7 A;  1H8A C;  3ZQC A;  5JFR A;  2GA1 A;  2DT7 B;  3ZOB A;  4AIK A;  1IXS B;  2A3S A;  3KLN A;  2FML A;  3K1M A;  3CES A;  1HW5 A;  2DO7 A;  3TDZ C;  3BLY A;  4LB6 B;  3HPG A;  3W6J B;  1WSU A;  4XIC A;  1G3T A;  1O3R A;  2G0E A;  3HGG A;  1W0U A;  3E5X A;  2EA4 A;  3WTX C;  4ZZL A;  3JSP A;  2ISY A;  1S7O A;  2BHZ A;  1JHF A;  3VSL A;  3E5Q A;  1D5V A;  1VQ5 I;  2M3A A;  1YJW I;  2EIK H;  5BPI A;  2R0Q C;  3IAM 2;  3HRT A;  3IWF A;  4I0B A;  3VYU B;  2CUF A;  3M9A A;  2NS0 A;  4X6A J;  2X6O A;  1ZLJ A;  3WU0 A;  4QTR A;  2WC2 A;  1B72 B;  1IDZ A;  1ZN2 A;  1DP7 P;  4ZH4 F;  4IX7 A;  2E34 A;  2P8T A;  4PFP A;  3CJR B;  4N4N B;  1T33 A;  2ZFU A;  3DXJ F;  3F6V A;  1KZH A;  5D5X B;  3MZY A;  5ILV A;  3CJQ B;  4FT8 A;  1TTY A;  2PJP A;  5KK1 A;  2ICW G;  4NC8 A;  1LE8 B;  1K4S A;  3HSF A;  1JHH A;  2DA4 A;  3LA2 A;  2G9W A;  1X2N A;  4A3C J;  1XMX A;  2LSO A;  4PDK A;  1DQU A;  1I3A A;  2M8E A;  2Z5U A;  2KHM A;  3T0Y A;  1K4T A;  5H6R A;  2O3F A;  4RB0 A;  5IP7 J;  2EV6 A;  5L3C A;  3H5A A;  2EPF A;  1QHH D;  3NEU A;  1R9T J;  1P9Q C;  2VOO A;  3CLO A;  2ZXI A;  2WV1 A;  4I98 B;  3CUO A;  4M6Y A;  4XLN F;  5JVT A;  3GUD A;  3R60 A;  1ETV A;  3LA3 A;  2IPQ X;  4V2G A;  1QVU A;  5ICF A;  4PFO A;  4LG0 B;  2TDX A;  3IP4 B;  5E3N A;  4EJT A;  2HZD A;  2ZXJ A;  1OR7 A;  1WVR A;  4K2E A;  4Q4Z F;  3FXU A;  1YJN I;  3CC7 I;  3V42 A;  1BOB A;  2DA7 A;  3F21 A;  1J5Y A;  1OKR A;  3IUO A;  2H6B A;  2FRH A;  2GXG A;  4G8X A;  2LBF A;  2RAE A;  4IHY A;  1FMV A;  1D1A A;  5F64 A;  2MFZ A;  3ABK H;  3L2C A;  2VQL A;  3LSR A;  1S8N A;  1R1U A;  4KUM A;  3MWM A;  4M3D A;  1A6I A;  2BVL A;  1OYW A;  1TT0 A;  1JI8 A;  1ZRD A;  4XRS A;  2MAB A;  4MTE A;  4EMS A;  2XF7 A;  1YLF A;  4P96 A;  4OMZ A;  4BQN A;  1NK2 P;  1RR8 C;  2F5V A;  1IF1 A;  5K5R A;  2LP0 A;  1QVT A;  4HBL A;  5J8F A;  4ENM A;  2HR3 A;  3HYI A;  5J1U A;  5J4Y A;  1KYZ A;  2RV8 A;  5IT3 A;  2KFD A;  3CF5 F;  5D4S A;  2STW A;  5LGN A;  3CUQ A;  2RNJ A;  1PP8 F;  3OYD A;  3HJE A;  3ESW B;  4EM0 B;  3WTT C;  2JQ7 A;  3M4O J;  1W7P A;  3FXJ A;  2AQE A;  2R92 J;  1P7I A;  4IQ4 A;  4D7N A;  2IEK A;  2IGN A;  3H5N A;  5KAI C;  4U0W A;  4C2T A;  5FRN A;  2JJ7 A;  3CCY A;  1L0O C;  1U6G A;  1GT0 C;  1ZG5 A;  2IAI A;  3ABT A;  2KRH A;  1SFO J;  3F6O A;  2NVX J;  1I50 J;  1YOV B;  3GYH X;  5K1Y A;  1Z1D A;  4RMN A;  3KZI C;  3QPH A;  2PJR A;  2OCC H;  2LF8 A;  1XGS A;  4LIU A;  2GQQ A;  5GP9 A;  5HOD A;  4EJU A;  4ENN A;  3MVP A;  1R5G A;  2YX7 A;  4P9F A;  1VND A;  3KEY A;  1XPX A;  1K83 J;  5LBQ A;  2OQR A;  1IN7 A;  2IA0 A;  2PX9 A;  4UV8 A;  1JJ6 C;  2K9Q A;  4LIT A;  3D5L A;  2L9R A;  2P81 A;  4L0Y B;  1H88 C;  2R5Z B;  4HLX A;  2FQ4 A;  4IPA A;  2KZV A;  4CZZ A;  4UUS A;  1FTZ A;  4A6D A;  2BVM A;  2R7S A;  2KP6 A;  3GO5 A;  4KIT B;  2O03 A;  5EJC A;  2J5O A;  1BN5 A;  1XSD A;  2ACJ A;  1B8I B;  1JJ8 C;  2DA6 A;  2ME6 A;  4GXO A;  3UKG A;  3GFM A;  1Z9C A;  2AHQ A;  3MMY B;  2NOG A;  4HG2 A;  1HSJ A;  2VLA A;  4I09 A;  1ON1 A;  3RKX A;  3K2Z A;  3SEQ A;  2KLO A;  3K70 C;  1IRF A;  3PSF A;  1R71 A;  1UFM A;  3S1M J;  3BQZ A;  2PFB A;  2R7U A;  3H9Q A;  3TKY A;  3BPV A;  3L1P A;  5LGU A;  1MKM A;  1A04 A;  4JX5 A;  3GTO J;  3JTH A;  2W1O A;  3MAJ A;  2VKH A;  4GCV A;  3B02 A;  5EZH A;  4XLH A;  2Y2Z A;  2DQR A;  2ESH A;  3ELK A;  4ITV A;  1ETQ A;  2O9L A;  4RM3 A;  2DJN A;  1D3Y A;  4DYR A;  3FKI J;  4CCO A;  3IAS 2;  3DEE A;  3K4L A;  1PYV A;  1X3W B;  2CQX A;  2ETH A;  1E0E A;  1GLN A;  3WOD F;  4LOC A;  2XRN A;  5DEQ A;  3A0B C;  3GW2 A;  2ZO4 A;  3FBN B;  2P5V A;  1VFC A;  3B6C A;  3HOW J;  5GPC A;  3S93 A;  1ZR4 A;  3T8T A;  2OAZ A;  3EDP A;  1RUN A;  1FSH A;  1IXR C;  3CDI A;  4AYB A;  1FOY A;  3I55 I;  3LAJ A;  4IKF A;  5DYM A;  2QBY B;  1SMY F;  2CRG A;  1F4K A;  3OIQ A;  2MD5 A;  3OR2 C;  1Q1V A;  4OOI A;  3LSM A;  4MQ9 F;  3BJ6 A;  5HOO A;  1FSE A;  2VJI A;  3M1C A;  1UCR A;  2D5V A;  1ZRC A;  1ETK A;  1X58 A;  2COB A;  4MGR A;  3ZR8 X;  1USS A;  3I0T A;  3L9F A;  2J5P A;  3BG7 A;  3VFZ A;  2DPU A;  2W85 A;  4L5E A;  4YEJ A;  1XSV A;  2LVS A;  4E70 A;  4XID A;  1J75 A;  5J8C A;  4EJO A;  4G6T B;  5BQT A;  1HDD C;  1ZLK A;  5JLW A;  3HG9 A;  3EUH C;  2X6X A;  2E36 A;  3C3W A;  2XC7 A;  3X2Q H;  2CFO A;  5DCF A;  1TT5 B;  4BL0 B;  2Z3Y A;  3P5J A;  1ETW A;  4XKV A;  3HB9 A;  1YW8 A;  2UUZ A;  5KAF C;  2R5Y B;  2VUM J;  2D2W A;  2R7F A;  2UXN A;  3G1L A;  5CYV A;  3KYC B;  4A3J J;  3GTP J;  4IRG A;  1HF0 A;  4KIB A;  2Y9Y A;  4E6K G;  3ZN1 A;  4F93 B;  3VSK A;  4B4C A;  4A3D J;  5CVU A;  1D0Z A;  2K86 A;  1W7P B;  4PJ0 C;  4XLE A;  4OIQ F;  1BBY A;  1IN6 A;  3KZY A;  3FWE A;  3Q3S A;  3K4B A;  1XGN A;  4S04 A;  3L2Q A;  3VB2 A;  1K78 B;  4GDF A;  3A01 A;  3ZQL A;  2DI3 A;  2FOK A;  1VTN C;  4DIQ A;  5JI6 A;  3SFZ A;  1JT6 A;  4ON0 A;  2ZFW A;  3IV5 A;  5TRD A;  2P7C B;  1ON2 A;  1AOY A;  3HOT A;  1ZRE A;  3QRF F;  1YRN A;  4GFB A;  3WTY C;  1PDN C;  1UAA A;  5IT9 K;  1LVA A;  3H92 A;  4A3F J;  1SD4 A;  3WE2 A;  1SEU A;  1VQO I;  4IZZ A;  4V2F A;  3L2U A;  2W25 A;  1FP1 D;  1TQI A;  4CYD A;  1XCB A;  2VC1 A;  3E0J B;  3AKZ A;  2M7A A;  3HUG B;  1S5L C;  1TNT A;  5HVQ C;  5J3L A;  4AUX A;  1REP C;  2OZU A;  2WWY A;  1CQT A;  1HBX G;  3R61 A;  1JGG A;  4I0A A;  3JRH A;  3ZXS A;  2EWN A;  3F22 A;  4UB8 C;  3TO9 A;  2F5F A;  1E2X A;  1BOA A;  4C2U A;  1OYI A;  2VQH A;  5ILS A;  5FFZ A;  2K85 A;  1TWG J;  2V7F A;  4UVB A;  4OIO F;  1E17 A;  4IHX A;  2Z99 A;  4BU2 A;  2XKP A;  4R8H A;  4D7M A;  2HKO A;  4PJN A;  2L0K A;  3UNG C;  3D5R C;  3OIO A;  3BP8 A;  4E7Z A;  1ZH5 A;  4A6E A;  2EFP A;  3FXR A;  4P1W A;  2STT A;  4XSX F;  5CVJ A;  3OWT A;  2JVG A;  4DYC A;  4E7J A;  3EUK L;  3WTU C;  3ABU A;  2FD5 A;  3J80 Z;  4FAS D;  1V4R A;  4PUS A;  5E18 F;  2BY2 A;  2CSO A;  3FHZ A;  1GV2 A;  1ZR2 A;  5BNG A;  3BZK A;  2ZJP F;  1FYK A;  4I02 A;  4F91 B;  2BY3 A;  4I99 C;  3HHH A;  1QO0 D;  2PMU A;  2LR8 A;  3CMM A;  4CGZ A;  3RKQ A;  1BM9 A;  5EGO A;  4II3 A;  3ISP A;  2HWV A;  4HAM A;  3NWT A;  4AIH A;  1FC3 A;  1WRJ A;  2V9K A;  3QOD A;  4RGU A;  1GVD A;  4BH9 A;  2UWM A;  1OFC X;  3GBG A;  2E7W A;  3N4M A;  3WHC A;  3AG4 H;  2R7T A;  4M9Z A;  1SAX A;  4TV7 A;  5LLQ A;  2Z16 A;  4I01 A;  3E7L A;  4NC6 A;  3I56 I;  2RC4 A;  3CCE I;  3LQQ A;  5F0C A;  3J7A Y;  1U5T B;  2MA3 A;  4XNF A;  1KA8 A;  1D1B A;  3RJP A;  2DT5 A;  3GME A;  1QZZ A;  3EYY A;  3S2W A;  3GTG J;  3BR1 A;  1FP2 A;  3GFL A;  3J7Y J;  3HBL A;  5ICE A;  4HDU A;  3ASO H;  4EM2 A;  3CP8 A;  1G2H A;  1CF7 B;  1XTA A;  2XHK A;  2PI0 A;  1BR1 A;  1J0R A;  1ZGJ A;  4HV5 A;  4L9J A;  4DBR A;  5D8L B;  2JUC A;  4RBO A;  2VE9 A;  4MEX F;  3RPU D;  2BV6 A;  3E6D A;  1U5T C;  2HXO A;  1Z6R A;  3R6S A;  2HU9 A;  4GGG A;  1V5G A;  1O3S A;  2HVR A;  2ISZ A;  1WJ5 A;  2KT0 A;  2ZJQ F;  2ZSI B;  2BY0 A;  3EQL F;  1G8X A;  1R1V A;  3R0J A;  4HNV A;  2Z33 A;  3HSR A;  4HF1 A;  1EH6 A;  2LY2 A;  3BOQ A;  3FM3 A;  3LSG A;  3OYA A;  4IXA A;  1FEX A;  3K1P A;  4QPO A;  3JW4 A;  2LC2 A;  5H2F C;  4DNC A;  3M07 A;  1ZYR F;  2P7V B;  1MSE C;  1YQA A;  3O3K A;  4N9H A;  2EB7 A;  4HX7 A;  3JRD A;  4BQO A;  3HKZ N;  3Q0V A;  2O7O A;  5K5Q A;  4ZTJ A;  4BJ5 C;  3BG9 A;  3KET A;  3CCS I;  3RTR A;  1LDD A;  5CKT A;  1HKS A;  2WA0 A;  1QGP A;  2Y0M A;  1JKO C;  2GWR A;  2W82 A;  5C3E J;  4XOT A;  2FUG 2;  2JA7 J;  4AVZ A;  3JAM Z;  2JSP A;  4KT5 C;  2KJC A;  1KU3 A;  1GHC A;  3FMS A;  3EYI A;  1B1B A;  2Q0O A;  5E8I A;  2MBF A;  5M5X J;  2LTP A;  1W4M A;  3H3Z A;  5GAE J;  1LDK B;  1MH4 A;  4BBR J;  1I6H J;  2ECC A;  3NWS A;  1R58 A;  5F1J A;  3PQK A;  3KYD B;  1B72 A;  3ZRG A;  5JLX A;  3DQV C;  3DTI A;  4DZP A;  3ZQQ A;  3OR1 C;  3S1Q J;  2EZI A;  4M6V A;  4Y52 J;  1VQN I;  2XPV A;  3KYL A;  4AWX B;  3HKZ A;  4FX0 A;  3BJO A;  3OYF A;  3HOV J;  1RNL A;  1T38 A;  2QSH X;  1FPQ A;  2IVM A;  2AO9 A;  4RLQ A;  2W4S A;  3OYL A;  3HRU A;  3ZP5 A;  1F36 A;  4OAZ A;  5HDK A;  3L2R A;  1YW9 A;  1WJE A;  3K4K A;  1WZ2 A;  1W5T A;  3IRR A;  4L18 B;  3CJN A;  3JTG A;  1SFE A;  3A02 A;  5IOY A;  1V5F A;  1AU7 A;  2L2O A;  4M73 A;  5EG0 B;  3C18 A;  4E7H A;  1GVJ A;  3OYC A;  5HLH A;  1KU7 A;  3TP3 A;  1R49 A;  5FO5 A;  3OYB A;  3LAP A;  3QPT A;  2XAQ A;  4G94 A;  2DAO A;  3SZP A;  4YG2 F;  5H6Q A;  1H9G A;  3U2R A;  1J09 A;  1NG6 A;  3HTU A;  3CCM I;  4XON A;  3A1Y A;  3DCF A;  4E7S A;  1DU6 A;  5B66 C;  2K3P A;  1SVL A;  3S3N A;  4QIW N;  4U0V A;  1F5T A;  2IS2 A;  1I1G A;  4BS9 A;  5DD4 A;  5K7H A;  1QQI A;  2TRT A;  3DBL B;  2EA2 A;  3JCU C;  5F27 A;  2OPT A;  3SZG A;  1OQY A;  2DBB A;  5FB2 A;  2XKO A;  2DTZ A;  4XMY A;  3B73 A;  3PSI A;  3SHF A;  3W6V A;  5A2Q K;  1FX7 A;  3DPU A;  2CO5 A;  3PQJ A;  1Z21 A;  2BOL A;  2DOD A;  4LK0 F;  4PK4 A;  2HS5 A;  1S6L A;  2VBW A;  2HNH A;  4OIN F;  1EA3 A;  2WAD A;  3F3X A;  4BGD A;  3ECO A;  1JE8 A;  4Y17 A;  4A0Y A;  4A12 A;  3KP3 A;  1OCZ H;  2WAQ A;  1AA7 A;  1MJB A;  4RGR A;  1QRY A;  3KEQ A;  3W6K B;  1E3O C;  4C3J J;  5F0F A;  1R36 A;  2CW0 F;  3KP2 A;  1XGM A;  3I5U A;  3RQ4 A;  4GO1 A;  1R00 A;  1XD7 A;  3SEZ A;  1N77 A;  2FEZ A;  1MSF C;  3EPZ A;  1R22 A;  2KMU A;  2LRE A;  1S7A A;  3MZ8 A;  2E1C A;  2OJE D;  2XAH A;  4BY1 J;  1HC8 A;  3CCU I;  1KON A;  4C30 A;  1PJR A;  1YTY A;  2VXD A;  3VWB A;  2L7M P;  4PGG A;  5JR3 A;  4L9V A;  1P92 A;  2VPR A;  1Y1W J;  5EZG A;  1U8B A;  1ZAR A;  3MFK A;  3K6G A;  2B7E A;  2LFB A;  3M8J A;  4XRM A;  3OYH A;  3NAR A;  2V4J C;  5D6E A;  2CS3 A;  1XX5 A;  2QKM B;  2XAU A;  2V9P A;  1W7P D;  3GTJ J;  1C0W A;  4KIS A;  4HOB A;  3BCB A;  4GYI A;  3KZZ A;  2IXS A;  4ZZD A;  3WHB A;  1AHD P;  3SYT A;  4HRI A;  1P4X A;  5FFX A;  2E2I J;  1IJW C;  1H9T A;  3PO3 J;  2NNY A;  2HZT A;  3JRI A;  4OMY A;  1G3Y A;  5FKN A;  4CH7 A;  5FD5 A;  3LST A;  4WK8 F;  3BC8 A;  1WH7 A;  5C4J J;  2R5Z A;  1RI7 A;  1ENH A;  4ZC3 A;  1OIS A;  3PIO F;  1Y56 A;  2X51 A;  4A2U A;  1CGP A;  1S3J A;  4JBA A;  2L5Q A;  1L3L A;  4RAZ A;  4YFX F;  1UHW A;  2ME0 A;  1ACI A;  2ZNY A;  3DFG A;  1T08 B;  2LK2 A;  2NRA C;  4BJT A;  1FWZ A;  3E5U A;  3H1C A; 
#chains in the Genus database with same CATH homology
 4BXF A;  4PJM A;  3U21 A;  3I9V 2;  4YEL A;  2PJR B;  1T0F C;  4CCK A;  4PJL A;  4F92 B;  2R7W A;  2X6Y A;  2KZV A;  2X85 A;  2V6E A;  3PJR A;  2HPI A;  2GOM A;  2BVM A;  2R7S A;  2KP6 A;  2RQQ A;  4KIT B;  3AFH A;  5FRO A;  4XKB A;  3EUA A;  2E5Z A;  2VAS A;  2E1M B;  2IGM A;  5CPR B;  3MMY B;  1MMD A;  2XDV A;  4HG2 A;  4NUB A;  2VLA A;  3PNY A;  1MNE A;  4CCN A;  1SFK A;  3SEQ A;  2KLO A;  3PNV A;  3K70 C;  3PSF A;  3QYE A;  2LH9 A;  1R6R A;  3SDB A;  4F55 A;  4XLC A;  2R7U A;  3OS2 A;  4DOZ A;  3H9Q A;  3H9G A;  5CQE A;  5KHD A;  2OV7 A;  2K5C A;  2E1M C;  1D1C A;  3OYJ A;  3E1S A;  2W1O A;  2VKH A;  2VQG A;  3OY9 A;  1DGW Y;  1BR2 A;  4XLH A;  4ITV A;  2W00 A;  3A4C A;  4RM3 A;  4PSX A;  2I8D A;  1V5E A;  4ZTF A;  4DGW B;  1FMW A;  3CF2 A;  2IS6 A;  3UR3 C;  4HNT A;  2LRD A;  4CCO A;  3IAS 2;  2XF6 A;  2CV1 A;  3W2A A;  2Y0S A;  2VQC A;  1PYV A;  3DEE A;  3K4L A;  1E0E A;  3L2V A;  1TZL A;  1GLN A;  3DPT A;  3QYB A;  2VJ5 A;  2P0W A;  3FBN B;  3VYT B;  2M4G A;  4E7K A;  1Y6I A;  1QU3 A;  3S93 A;  2ELJ A;  4IKF A;  4AYB A;  1DP3 A;  2E60 A;  2RRE A;  3PUB A;  4B48 A;  2Z2S B;  3OIQ A;  3OR2 C;  4B47 A;  3W2W A;  2RNG A;  4ZJZ A;  3LSM A;  4F3Q A;  4R79 A;  3VYR B;  5HOO A;  2HVQ A;  3MKW B;  2VJI A;  3M1C A;  4E4H A;  2V26 A;  5HNF A;  3D5S C;  4XN0 A;  2VL8 A;  2OC6 A;  3ZR8 X;  3BG7 A;  3HOS A;  2XF5 A;  3HC7 A;  4YEJ A;  5TGT A;  1YX3 A;  2AQF A;  2WY8 Q;  4XM3 A;  1S9H A;  4G6T B;  5KNL A;  2PMZ A;  4LG3 A;  4U87 A;  3HG9 A;  4J00 A;  3EUH C;  2X6X A;  4NNJ A;  2XC7 A;  2CFO A;  3QOE A;  3DU6 A;  4QPQ A;  4P5O A;  4BL0 B;  4OWR B;  2R7Q A;  2R4G A;  4XKV A;  4BE2 A;  3K4N A;  4PSW A;  4XLA A;  2UUZ A;  2K9M A;  3BG6 A;  3H35 A;  4CCJ A;  4E7I A;  4XL9 A;  4BEH A;  4E6K G;  3RSN A;  4F93 B;  2CV0 A;  3VSK A;  2MYS A;  5CQG A;  1D0Z A;  2KRC A;  4GRI A;  4XLE A;  2CUZ A;  3W3C A;  4CCM A;  3K4B A;  3L2Q A;  4BEH B;  4DIQ A;  5LFA A;  2DXI A;  3MD2 A;  3K70 D;  3MKY B;  3OS1 A;  4ANJ A;  3HOT A;  3PNT A;  1WJC A;  1WJA A;  1OLT A;  1X1C A;  2CW8 A;  4KJZ A;  4EAT A;  1UAA A;  2Z1D A;  4B3X A;  4RLF A;  2R7O A;  1D0X A;  2LY1 A;  4IZZ A;  3L2U A;  3DU5 A;  2HPM A;  4DJA A;  2X1D A;  4N4O B;  2VJ4 A;  3L2W A;  4Y33 A;  3E0J B;  2M0M A;  3AKZ A;  1W36 C;  2M7A A;  3HUG B;  2W7N A;  3DPL C;  4D1Q A;  4HSR A;  5HVQ C;  2CUJ A;  3BCA A;  2WB1 A;  3ZXS A;  4NQW B;  3HXL A;  4C2U A;  4PJJ A;  2JA2 A;  2VQH A;  3F9K A;  3ZCO A;  2V7F A;  4RM2 A;  1QHG A;  3G2B A;  4BU2 A;  2VPL A;  4PJN A;  3UNG C;  3D5R C;  4E7Z A;  1X19 A;  2DOA A;  1D0Y A;  3FKJ A;  4FET A;  2NOJ B;  4P1W A;  3OWT A;  2JVG A;  1N75 A;  2GOX B;  3EUK L;  2LYC A;  4E7J A;  1YE9 A;  4LIV A;  1X4O A;  2BW3 A;  4FAS D;  3OYN A;  4MLO A;  4PUS A;  1YX5 A;  3W2V A;  2ZXH A;  3OYM A;  1Z3Y A;  4BE1 A;  4F91 B;  3ZGK A;  4XKC A;  3CMM A;  4DBQ A;  4B43 A;  4II3 A;  1WJB A;  3NWT A;  2M4K A;  2V9K A;  1LVK A;  3QOD A;  4CUG A;  2UWM A;  2Q2E B;  4JOM A;  4D9J A;  2BW3 B;  3DKX A;  5LD2 C;  3GBG A;  1MW7 A;  3KX2 A;  2X6W A;  2R7T A;  1VZ0 A;  1UEL B;  1BR4 A;  2R7V A;  2Z16 A;  3HL2 A;  4ZYA A;  3J7A Y;  3FBI B;  4XNF A;  4C9Y A;  1D1B A;  3S8P A;  4XLF A;  3LSK A;  1WFX A;  4II2 A;  4XR6 A;  2KDO A;  1X1D A;  4YRV A;  2WY7 Q;  3CP8 A;  4X0G A;  4KT6 A;  3RCO A;  2LG4 A;  4XN3 A;  1MMG A;  1BR1 A;  2R7X A;  4DBR A;  2F4I A;  3RPU D;  3H9J A;  1ZEL A;  2KL4 A;  3S3O A;  2HU9 A;  1V5G A;  4BUP A;  2HVR A;  1WJ5 A;  1Z3X A;  2M7B A;  3K4J A;  2ZSI B;  1G8X A;  4XOP A;  3PL8 A;  3DTE A;  3OMY A;  2X1C A;  2LY2 A;  3LSG A;  3OYA A;  2QKL B;  2KPM A;  4QPO A;  1W36 D;  2LC2 A;  3OYG A;  2L9N A;  2UV1 A;  1X1B A;  4BQO A;  4Y3O A;  2K9L A;  4J01 A;  1ERD A;  2VKD A;  3H5R A;  2VB6 A;  3LMM A;  3FDY A;  4BJ5 C;  4ZTJ A;  2CW7 A;  4HST A;  2DCE A;  3RTR A;  5CKT A;  2WA0 A;  2IGO A;  3TBI A;  2W82 A;  4NC7 A;  4XOT A;  2FUG 2;  3TL4 X;  3CP2 A;  4AVZ A;  2WAF A;  2JSP A;  2DT7 B;  4BAC A;  3QYF A;  3CES A;  2HDW A;  3LL7 A;  1LDK B;  3BLY A;  3NWS A;  3HPG A;  2DT6 A;  2L7K A;  2Q1Z B;  4U7B A;  3ZRG A;  4HNU A;  3DQV C;  3DTI A;  3ZQQ A;  2CV2 A;  3OR1 C;  1MMN A;  3VSL A;  3OYE A;  3KYL A;  3HKZ A;  2M3A A;  3IAM 2;  3VYU B;  3OYF A;  1T95 A;  3VYS B;  4BDZ A;  1X4P A;  3PFY A;  4IX7 A;  1G59 A;  4PFP A;  3LFU A;  1X1A A;  3CJR B;  4N4N B;  4RLQ A;  2W4S A;  2ZFU A;  1LKX A;  3OYL A;  3CJQ B;  4CSW A;  4OAZ A;  3L2R A;  1WJE A;  3K4K A;  4HPQ A;  4NC8 A;  2A6T A;  2VJJ A;  4XKW A;  2JVH A;  4BQQ A;  3AL0 C;  3LSI A;  4CZC A;  1V5F A;  1WJF A;  5JHF A;  2L2O A;  4E7H A;  2MC4 A;  4JQF A;  4BE0 A;  1DQU A;  3OYC A;  2A5W A;  2KHM A;  1U0J A;  3OYB A;  4XQF A;  3H5A A;  2XSJ C;  1QHH D;  1P9Q C;  2WBM A;  2ZXI A;  1J09 A;  1NG6 A;  4XON A;  3A1Y A;  3VDX A;  4E7S A;  2K3P A;  2CMP A;  2V1N A;  3DLA A;  4HEA 2;  4PFO A;  4BJ6 C;  3S3N A;  2IS1 A;  2IS2 A;  3IP4 B;  4BS9 A;  3OYI A;  5KCM A;  2KQR A;  2HZD A;  3FHN A;  1IRX A;  2CH0 A;  2X1E A;  3SZG A;  2IS4 A;  2LOO A;  4XMY A;  2IGK A;  1BOB A;  3V42 A;  3PSI A;  3K10 A;  3IUO A;  2R7R A;  3DPU A;  2LBF A;  3I3L A;  3K4C A;  1Z21 A;  2BOL A;  1N78 A;  1FMV A;  1HA8 A;  1D1A A;  4PK4 A;  1SAU A;  2HNH A;  1EA3 A;  2MFZ A;  2WAD A;  4BGD A;  1MND A;  3MKZ A;  2VQL A;  2WAQ A;  1AA7 A;  3CZ6 A;  3A2K A;  3OS0 A;  3OL4 A;  2LBF B;  3S3M A;  4B44 A;  2BVL A;  1TT0 A;  2HVS A;  1JI8 A;  2JUG A;  2VIX A;  5FRM A;  3RQ4 A;  2MAB A;  3SEZ A;  2OUM A;  4XOR A;  1N77 A;  3EPZ A;  2KMU A;  2XF7 A;  2LRE A;  3DTK A;  4BQN A;  1KON A;  2F5V A;  1OR7 C;  4C30 A;  1PJR A;  1UG0 A;  2VXD A;  3TMO A;  4AU7 A;  2L9S A;  3VWB A;  3H0D A;  4H4K C;  2E5N A;  3C2G A;  4E7L A;  4CA0 A;  3K6G A;  4Y4R A;  3M8J A;  3OYH A;  4BDY A;  2V4J C;  2CS3 A;  3OYD A;  2QKM B;  2XAU A;  4ZDL A;  1DGR M;  2WAE A;  2ZSH B;  1Z7L A;  4ZDP A;  1LFP A;  2AQE A;  4KIS A;  4IQ4 A;  3OL3 A;  2IGN A;  3H5N A;  2DJI A;  2VXZ A;  3BCB A;  2IXS A;  4C2T A;  5FRN A;  4ZDO A;  4OAY A;  3HPH A;  3SYT A;  4HRI A;  4F52 A;  1NG7 A;  2KRH A;  2O5R A;  4RMN A;  4CH7 A;  3OYK A;  2MD0 A;  4IQJ A;  2HQA A;  3ONQ A;  1WJD A;  3BC8 A;  3LSH A;  2PJR A;  3K4M A;  3S32 A;  4LIU A;  3C2H A;  4ZC3 A;  3DKY A;  3OIP A;  1Y56 A;  2X51 A;  3AL0 B;  2L5Q A;  5HNH A;  1MMA A;  1K6Y A;  3KEY A;  2F6C A;  3DWL E;  3OOU A;  3N05 A;  4BJT A;  5HLT A;  4CCL A;  4LIT A;  3D5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...