2DOAA

Solution structure of the helical domain in human eleven-nineteen lysine-rich leukemia protein ell
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
b'GSSGSSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II elongation factor ELL
publication title Solution structure of the helical domain in human Eleven-nineteen lysine-rich leukemia protein ELL
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2doaA00
2E5NA 2DOAA
chains in the Genus database with same CATH superfamily
2L02A 2HOEA 4ZTFA 4CYDA 1JUSA 5D8KB 3RYRA 3HUGA 1BR2A 2LY1A 4IOAF 2FUG2 4O5VA 3QPLA 3TDUC 4NNJA 3OYLA 1ZN2A 4ENNA 2KHMA 5FROA 2M87A 3BG6A 3ASNH 1A5JA 4BUPA 2Q8KA 1XMAA 3RQIA 1G6NA 4OINF 4HSRA 2XAHA 3MCZA 4MFDA 1MBHA 2RDPA 4RAZA 3PO3J 3E6DA 4P9FA 2DTRA 1J75A 3J80K 4Y33A 3J7AY 1HDPA 5GTIC 1I50J 3QRFF 3L2CA 4D1QA 2LKPA 4EV0A 1IDZA 2R7DA 4BXFA 4P96A 2FBKA 2WV1A 2OTJI 4XLCA 3ZQGA 5E3OA 2EFQA 2HXIA 5E18F 4I76A 3E5XA 4QLCU 5BPDA 1S6LA 1KU2A 4OAZA 1ENHA 3SEZA 2XAJA 1ODDA 3CP8A 1WCMJ 1YOVB 5K5OA 4MEYF 1I39A 5D6EA 3J81Z 2LF7A 1XC5A 4OAYA 5C44J 3QOPA 4XQFA 4NDLA 2WAQN 3DWLE 4IOCF 1IRGA 2CMPA 2ZNYA 2W57A 4E7IA 3OIOA 1KONA 1S5LC 1WSUA 4HF1A 2K85A 3F0CA 4N0BA 4DBQA 1BA5A 2NS7A 3E6BA 5BOXA 3BPXA 5DUIA 3A01A 4E7JA 3E6CC 2LY9A 1B6AA 3B6CA 3ESWB 2DPDA 3IRRA 4L18B 2UXXA 2XGXA 2F5EA 3ONQA 1C0WA 4A3BJ 3C2GA 1XPXA 3A01B 3OYHA 4CCJA 3K10A 4A5NA 3HOZJ 3SDGA 1FLIA 2BY0A 3HXLA 3R61A 5AONA 1D1BA 1IUFA 1OCTC 1T08B 2NS0A 1K79A 5E17F 4KMFA 4PZJA 4Y7NJ 4E7KA 3V42A 1IXCA 9ANTA 3WTUC 3CCYA 4KITB 3HSFA 5J40A 2LF8A 3HOTA 1HDDC 3K9TA 5IYBJ 3CC4I 2WADA 2FE3A 3N4MA 2WAEA 2L3DA 1P4XA 2LDUA 4M9ZA 2K9SA 1J0RA 1IZ1A 1RETA 3WHCA 4JX5A 2QF7A 4RGUA 2BOLA 4IHVA 1GVJA 5JHUA 2GIZA 3ZR8X 3OYMA 1K4TA 2H8WA 1TC3C 3JAMZ 1N75A 3I58A 2IS4A 2OBPA 5J1RA 1HKQA 4NC7A 5C4XJ 2BY1A 4XRMA 3WHBA 1HW1A 2F48A 5EG0A 3RCOA 3GTOJ 3PIPF 2Q0OA 3BTIA 4FCYA 3PQJA 2WY7Q 5E3MA 2R7SA 2X4HA 4CCLA 1TLHB 1Z3XA 3F8BA 4QPOA 2BGCA 3ZQQA 5BPIA 1J7KA 5GPAA 1KQ9A 2JA6J 2FF4A 1Q1HA 4OWRB 1VQKI 2VQCA 1FTTA 1CQTA 1GDTA 1E3OC 1A31A 1SEUA 3FM5A 2R7WA 3WU1B 2HZTA 3IUOA 4ZDLA 5JVTA 2DFFA 2HKOA 1XSXA 1R5ID 5DV5A 1Z05A 4A93J 5HDKA 1U8RA 2EFPA 3KEQA 4HQEA 2BXYA 4OMYA 2DYRH 4B4CA 4DW6A 3S93A 2CU7A 4A3JJ 1YJWI 5JI6A 3GBGA 3BTCA 3BQYA 1AHDP 3LOCA 3KYDB 3BCBA 3K4LA 4S0HB 2F4MB 3MZ8A 3OYBA 5EEAA 1SVMA 1YX5A 2IBDA 4IEJA 4O6JA 1P6RA 3CCUI 1Z9CA 2ZXWH 3QP5A 4MNUA 4L9JA 4I0AA 1Z67A 4JQFA 3DXJF 2DT5A 1B8IB 2JSPA 2XRLA 1QZZA 1RZ4A 3HSEA 2EA4A 1HF0A 4A0YA 1D8JA 2YX7A 2WTEA 2R7RA 3LSPA 3V4GA 4CYCB 1WKMA 3P5JA 4LMYA 2QZ8A 2KIFA 2GZWA 2ZBKA 3SFIA 3H1CA 1VQ5I 3K7AJ 4P55A 4M6XA 2RNGA 1X4OA 2WC2A 4MLOA 5CKTA 2MFZA 3KETA 2R5ZA 4LLNA 2IRFG 1Y39A 1YJNI 1IV6A 3DTIA 4HX4A 4Z6YA 1RNLA 2XAFA 5KAIC 3SQNA 1VZ0A 2VQLA 1GHCA 1D5VA 4L9TA 2VBXA 3DU6A 3CD6I 1AA7A 1UAAA 4U0VA 2ICWG 3NARA 2HGCA 3DFGA 2CWEA 4LK1F 5IPAA 5AIQA 1JHHA 1PVEA 3GLXA 4JYKA 2E34A 2AS5F 2A3SA 4C3JJ 3J81K 3VSLA 1XD7A 4XOPA 3FHZA 2OZUA 2FQ3A 2YX4A 2BY2A 1F43A 4EGYA 3LAPA 5TRDA 4XKWA 3HSRA 1NG6A 1XDSA 2R7FA 2E2JJ 2M1BA 3HRTA 1APLC 4IXAA 1S29A 3VFZA 3NWTA 1O7FA 4YELA 5D8LB 3GTGJ 2OV7A 3GUDA 4QTRA 2XHKA 2A5WA 1MSEC 4HV6A 1I1GA 2W85A 4I09A 1RPWA 1SD4A 3HPGA 3DU5A 4CZZA 3JRHA 4KDPA 3DCFA 4L5IA 4EJVA 3PUFA 1LDJA 2E60A 4FASD 1SC7A 5FRNA 4IHXA 4DQ2A 2QQ9A 4HYEA 2DTZA 3TO7A 5J4VA 1IN4A 1P2FA 4IZZA 1B9NA 1V55H 4QPQA 2CUZA 4M3GA 3ZQLA 1U9NA 3ZN1A 1A6QA 4PFOA 3BWGA 3IP4B 4U0WA 1IN8A 4EM1A 2IEKA 2CQNA 3OR2C 1I6XA 3R4KA 1S7EA 2G9WA 3HGYA 1S7AA 1WH5A 2XB5A 2NAZA 3DPTA 4CH7A 3S3OA 5HS9A 1K78A 3FBNB 2HVQA 3KIOA 2WB1A 4S05A 2W7NA 1MGTA 1U0JA 3E97A 1GLNA 2VN2A 3JAMK 4A3IJ 1R9TJ 1K78B 1JTYA 5FKMA 3WTYC 2JPCA 3U2RA 1Z91A 2ZNZA 3CLOA 1E3PA 4FX0A 4Y3OA 3IH3A 1PP7U 3NWSA 1U6GA 4M3FA 2OZ6A 4M71A 3BT9A 4PCQA 3FXRA 4XOTA 3M8JA 4RAFA 2Z1DA 3G1LA 4BQNA 3PSFA 1R6RA 1R58A 2CQXA 2I5UA 3ABTA 3L2WA 3AL0C 3DKWA 3K70C 1R5HA 3OYNA 1FYKA 1ZTRA 5K7ZA 4IQ4A 1D1CA 1ZKGA 2HYGD 2IA1A 1ZLJA 3FXUA 1T98A 4KIGA 3SZTA 4A3EJ 1KYZA 3A0HC 4Y15A 1JXSA 3F23A 1YLFA 3DPUA 4DZJA 3CC7I 3FF5A 2CFOA 3OL4A 1QO0D 1R7JA 2AQEA 5HLHA 1DU0A 1MMNA 2A6TA 2H27A 3CLQA 2MLKA 1Z77A 1XMXA 5HLIA 1JKPC 2KIQA 2RQPA 4PGHA 4ZH4F 5E1WA 3W6JB 3L7WA 1KGSA 1OR7C 5IY5H 1RRJA 3R60A 4M6YA 6PAXA 1D0XA 2DMQA 1P9QC 3ZQCA 5HVQC 3S1RJ 2HDCA 1RESA 1I5ZA 4U7DA 2JA2A 3I54A 2X1DA 2R7OA 3MD2A 2KIMA 2P8TA 3RKYA 3GEZA 2N8GA 5B1AH 1ZGAA 2PMZA 2Z3YA 3BCAA 3REOA 4CA0A 1D0ZA 2BHYA 3QAHA 2GXAA 4JBAA 4LB6B 2JT1A 4A69C 4B3AA 4D5CA 1GV2A 4GCVA 2Y31A 3WU0A 4BU2A 2M7BA 1BJZA 2K86A 1W0TA 2PFBA 1FOKA 2JRMA 3IH2A 1Y0UA 4WWCA 2PG4A 2HYFA 5FGMA 1WJEA 3G6EI 1K6YA 1KU7A 3K2AA 3UR3C 1SD5A 3R0JA 1QBJA 1Z6RA 4NC8A 4C3IJ 2FNAA 2VQHA 1FIPA 4WF2A 2M2EA 5ERIA 2OCCH 3JCUC 3PM1A 4HAMA 4Y4RA 3Q3SA 4ESFA 5DYMA 1ZQ3P 1TTYA 1GV5A 4XRSA 2TRTA 3GW2A 4DYCA 4LGWA 4G7OF 1B72A 2V9VA 4GFBA 2EINH 4WX9A 3EUHC 1QNTA 4RAYA 5EEGA 4BXXJ 3BJ6A 3HG9A 1UB9A 3S17J 4XRFA 2GBYA 3C18A 4B43A 5M3MJ 5D4RA 1H0MA 4N9HA 2DI3A 4FTHA 4LD5A 3VYUB 3AKZA 4EGZA 2L54A 5FO5A 3BG5A 2EFNA 5AIPA 3ZQIA 2JJ7A 3CP2A 3WG9A 2JUCA 1PJRA 2DODA 2HNHA 4ZTJA 1T95A 4BY1J 1FSHA 1ZHFA 3HHGA 4XSXF 1BJAA 1ZK8A 3GZ6A 1HW5A 3LSMA 3GFMA 4I7HA 3ZCOA 1HA8A 2EFWA 3PNYA 2P81A 4QWQA 3RJPA 2HTSA 3U21A 1ETWA 2R5YB 1TZLA 1XG1A 1K7AA 2Y75A 3WU2C 1FYMA 5LBQA 2QKLB 4M72A 3HRSA 4UHTA 4BACA 1FYLA 2ZSHB 4J00A 1BOAA 2YSRA 3V7CA 3PFYA 1AKHA 3T0YA 3ZMSA 3KP4A 2H09A 2E1MB 3KZYA 2DQRA 4ITVA 3BP8A 1R00A 2NYXA 3LSHA 3HTSB 2XSJC 4EEFG 1LE8B 4B3XA 1ZGJA 4II3A 4BH9A 1H9TA 3WTZA 2Z33A 2LP0A 4IRGA 2IT0A 3RZOJ 1R49A 1K6OA 1YW7A 4AIDA 2GA1A 2K4JA 3I4PA 4OIOF 3ASOH 3CMEI 3TP3A 2XAUA 3CDHA 3LSGA 3A4CA 1ZG1A 5K5RA 4HF2A 3WODF 4C30A 1IXSB 3LL7A 4F93B 2PEXA 2CQ7A 4HF0A 2ID3A 3M1EA 5E20A 1TQMA 4ETSA 5FLXZ 1ZRFA 1BBYA 1ETOA 4WXDA 5FLVA 4A3DJ 2XIGA 5EEHA 2Y9ZA 1T38A 3WGHA 1YG2A 5LGNA 1PYVA 3CO7C 1DP7P 4IHWA 2IAIA 4UVAA 4DYRA 2QVOA 2B63J 3AL0B 3FBIB 1OCCH 3CMYA 2R4GA 2DK8A 4CO8A 2B9SA 2FX0A 1A6IA 1FT9A 4OU0A 3JSPA 1R23A 2NNNA 3IWZA 1YW9A 3WTTC 1MKMA 4YFNF 4PGGA 3HOVJ 3HKZN 3HTUA 3MWMA 4UUVA 1QPMA 1MW7A 1OR7A 4LIUA 1XX5A 1VQNI 1N78A 2HVRA 2ISYA 1DGWY 5FFXA 1NTCA 4KIFA 2KRHA 2XKOA 3HPHA 4Q47A 5FKOA 1KQ8A 3RSNA 1KA8A 3MFKA 4X0GA 1G3YA 1MJBA 3HRMA 5JLWA 2VOOA 1J59A 3H36A 3Q0VA 3OYEA 2F4IA 3CMMA 2WAQA 1CF7B 2JSCA 4LK0F 2MABA 3BTJA 2LOOA 1SFEA 1MZBA 2E19A 3I64A 2L7ZA 2X6WA 4MTDA 1OYIA 2GXGA 1IW7F 4UXNA 3RDIA 5J3LA 1FOYA 3FKIJ 3CZ6A 3J7ZI 5D5WB 4OIQF 4OIRF 1KU3A 4ZDPA 2M0MA 4I01A 3L2QA 2GWRA 1E2XA 1U5TC 3F9KA 5DTDA 2C6YA 3DKYA 1MIJA 3KLNA 1Y0NA 1VI0A 2KQRA 3GVAA 3H9QA 1TP4A 3O8GA 4D5FA 3JRAA 3PO2J 1BL0A 4L9NA 2H8RA 2R7VA 3PNVA 4MHGA 2ELJA 2K27A 1IAWA 1BN5A 1NK3P 5F04A 2M9HA 3OYCA 3EUHA 4ZC3A 3K0LA 2P7CB 1HCRA 3TBIA 3JRGA 3MKLA 3D1NI 1G3TA 3W6KB 4WK8F 1WJBA 2M5WA 4XLEA 4G6QA 4M3EA 1B4AA 1TT5B 3KP3A 1UCRA 1WWXA 2O03A 3M8FA 2F2EA 2G0EA 1X1PA 3U1KA 1D5YA 2M7AA 2VC0A 5LFAA 3G71I 1BW6A 1TQIA 3LSKA 1IXRC 2R3SA 3ABMH 3QQAA 4JOMA 4M6VA 5CJ9A 1MH4A 2FEZA 3CCMI 4AIJA 5TISC 3OYKA 2WAFA 4UVCA 3BR5A 3BC8A 4HPQA 2OQGA 3X2QH 1BIAA 1MD0A 2E2IJ 3OIQA 4DNCA 4PJJA 3FMQA 3M4OJ 3P9CA 1G59A 2W24A 3M3YJ 1UG2A 2MD0A 1JUPA 1XB4A 3MEXA 3F21A 4IO9F 1OCOH 1Y1VJ 2OQRA 2X9DA 1GXQA 3GTMJ 2ISZA 4C9YA 3T8RA 3ERMA 2H6BA 2HU9A 2MC3A 3H5RA 5KK1A 4KNYA 1J09A 3E6MA 2HKXA 4Y13A 4W97A 1IC8A 1QVTA 1A04A 2IXSA 3L2VA 4N4OB 2IVMA 4E6KG 1YW8A 4XMYA 2PJPA 1A35A 4GO1A 1DUXC 2R7QA 1JGGA 1ZH5A 2W84A 4FT8A 3W2VA 4E7ZA 3QPTA 2P5LC 3G1MA 4MO7A 2HOTA 2BVMA 1RIOH 4G7HF 4W1UA 4II2A 3T8TA 4A6DA 2ZSIB 4DYQA 4O3MA 3RTRA 2JWTA 2VL8A 1FBQA 4A3FJ 4GGGA 4D7MA 3P9IA 5FLXK 1BR4A 4UY8I 2ZO4A 3Q9SA 3OOPA 2HR3A 1B1BA 1W5CC 3LWFA 3I0TA 2ZXIA 4I0BA 2R7ZJ 3HOXJ 3OL3A 4ESJA 4BYYA 2KJCA 3GXOA 1ZLKA 1X2NA 3PQKA 4AYBN 4G6DA 2DBBA 1JHFA 4XRSG 2O61A 4RLQA 3N97A 4MEXF 2DDBA 5E1ZB 2CW8A 3K1PA 3FK6A 3I9V2 1X58A 5EYRA 3QPSA 2IS1A 4M3DA 1VNDA 1ZG3A 5A2QZ 1UZCA 3WGIA 1FC3A 3EYIA 3VYRB 2KRCA 4L9VA 3ML6A 3ABKH 3CJTB 4YIRX 3VODA 5D5XB 3JRIA 4XR6A 3ZMDA 2M8EA 4CHUA 1EKEA 3OYAA 4BJ5C 5B66C 1FZPB 3FISA 3HM5A 3GTLJ 5GAEJ 4D9JA 5IT3A 2JA7J 5IT9Z 3E3VA 2JN6A 5F27A 4XLAA 2Z5UA 1GUUA 2G7HA 2ZC2A 1R22A 1KYWA 2NOGA 2OU2A 2KJBA 2DFHA 3M07A 3BZKA 4L0ZB 2XC7A 3I3LA 5FB2A 3OYJA 2WA0A 5FKLA 1V5EA 3CDIA 1ONVA 1OQYA 1XTAA 1WRJA 5HNHA 4WCGA 1U5TA 4U88A 2CJJA 1E3HA 2PQ8A 3HEFA 4V2FA 2QKMB 4PDKA 1VQ8I 5FKKA 2YS9A 2QQBA 2LR8A 3DF8A 5GP9A 5L3EA 1UMQA 1U5TB 1WPKA 1ZR2A 5F1RA 1B8IA 3NQOA 5E79C 4P5OA 3ZP5A 4H4KC 4IHTA 4A3GJ 5LHIA 3JRDA 4CYCA 1G3SA 2EB7A 4G12A 4HDVA 5CVUA 2QEXI 1EV7A 2EV5A 5E8GA 2CV0A 3MN2A 2VKVA 5BS6A 4A5MA 3S3MA 1ACIA 3QWLA 1XGMA 1Z1DA 3T1BA 4XKVA 4B47A 2VB6A 2E35A 1N25A 3F22A 5DEQA 3H35A 3ZMTA 2WBMA 3V7RA 2V1XA 2BZTA 1MMGA 2LLKA 5BNGA 2XV4S 2V4JC 2UWMA 2JUGA 3B73A 4KICA 3F6OA 3PFIA 4UB8C 5GPCA 3CMAI 4F55A 3FMRA 3QODA 3BG9A 1JKOC 1BI2A 2EPFA 5JFRA 2ECBA 4IHSA 4CSWA 2K7LA 3HZJA 1HQCA 2W1OA 5KVRA 4LIVA 5F64A 4PK4A 4UUSB 3FKJA 1IO2A 5DUKA 4U0YA 2XGEA 3QP6A 3IRQA 2FOKA 2KRFA 2OD5A 3E0JB 4KISA 4BKXA 2M0CA 2OCEA 2FXAA 1XSDA 1Z6TA 3LSIA 2NS8A 4HG2A 1R1UA 3K4NA 4AD9A 2IGKA 2ZXJA 5LHGA 2OF7A 2M45A 3HJEA 1LQ1A 1ZARA 4HEA2 5IOYA 3F72A 1IN6A 1D0YA 2GOXB 4UUTA 2DFIA 5FRMA 4J01A 2R92J 3S16J 3RYPA 2QBYB 4HLXA 4LB5A 1T2KA 5GAHJ 4LJZF 5EZGA 2HI3A 2X85A 1TWHJ 4F7ZA 2MH2A 2ME0A 4HQMA 2ZB9A 3M9AA 3WTXC 5L3CA 1QHGA 4DGWB 3F3XA 1TWCJ 3MAJA 2GIVA 3VSKA 2O7OA 2Y30A 4MTEA 1SFXA 2F5FA 3H92A 2A5YB 2L2OA 1MMDA 2XPVA 5DCMB 2MG4A 1O7LA 2RNJA 4GYGA 4HNUA 2JA5J 1TW3A 1SVOA 4KN7X 5ICCA 1IG7A 1Z21A 2KMUA 3CCEI 5F0CA 2V26A 2QSFX 4BEHB 1JE8A 1XS9A 1RUNA 1OCPA 1H8AC 1E17A 2JZYA 2HDDA 2E1MC 5JHFA 4A2UA 4S04A 2EQRA 1FOXA 3W2WA 3KP2A 4XL9A 1YO5C 1SANA 3HGGA 1VTNC 3K6GA 2DMUA 3RIRA 2CQKA 2K3PA 4L0YB 4B44A 1YE9A 5HS8A 1Y6IA 1NK2P 1WI3A 3H0GJ 3HHHA 1T6SA 3D5RC 3ECOA 3VB2A 1UHSA 3IHUA 1QGPA 1X3WB 3ZOBA 2XPUA 2VODA 2Z16A 5D6FA 2QGUA 2PJRB 4DBRA 2V1UA 2O0YA 3S8PA 2Y0MA 1IV8A 2QUFA 4ZYEA 4C3HJ 1H88C 3GTKJ 4ZDOA 1ZAOA 5GTHC 1R4NB 2Y9YA 2A07F 3C2HA 2DN0A 3VDXA 4HV5A 2HQRA 5CLSA 1BOBA 2Q2EA 2VE9A 3L00A 4OMZA 3IAS2 4A12A 2E1OA 4I02A 4C2UA 2PMHA 2H94A 2EFOA 3PL8A 4BE2A 2DJIA 2Q2EB 1FX7A 5HDNA 2A6EF 5HODA 2IGNA 4HW0A 1JKQC 2VASA 2EV6A 1LUJB 1MNMC 3TGNA 2COMA 3HL2A 3P7NA 2LY2A 1L0OC 1JI8A 4X6AJ 3BG3A 4BXUA 5CVIA 1YS7A 2FD5A 2QSHX 3CCRI 3CJRB 1IRFA 4BS9A 1LNWA 2VONA 4A0XA 4AIHA 3FMSA 3MMYB 3TMOA 3U1DA 5IOZA 4P1WA 5ICEA 1WFXA 1X1DA 1IGNA 2WV0A 2K5CA 1CGPA 1XGNA 1PUEE 4XN3A 2FBIA 4HNVA 1IRXA 4EJWA 2HPIA 4HX7A 3L2UA 1NHAA 4IHYA 3V8KA 3S15J 2LRDA 1LB2A 2MH9A 4KYWA 3L09A 1P7JA 4I98B 3ELKA 3H5AA 1QVUA 2LC2A 4MGRA 3ABLH 3D5LA 3CUQC 4AWXB 3JRCA 2E5ZA 1V54H 2DCEA 1W5SA 4G6TB 3LAJA 2FMYA 5D5VB 5EGOB 2VQGA 5HNFA 2DDAA 4PJNA 2ZJPF 4RLFA 3I56I 4HSTA 4RM2A 2DA2A 1BM9A 1R1TA 2DYSH 1U3EM 1Z0XA 5CYVA 2COBA 2E2HJ 2XGDA 5F6FA 1S8NA 3H9GA 4UB6C 5GADJ 1SVLA 1LKXA 2VPRA 2F5CA 4F52A 3TOAA 4CZCA 1EF4A 1G3WA 3QPHA 3GFLA 2VJ4A 3LA3A 4ZYGA 1MBFA 4BDYA 4RB1A 3BR0A 2IJLA 3K70D 2UUZA 3G73A 1YQAA 3TEDA 2W4SA 4M9SA 4IJAA 2CV1A 3DTKA 2Z2SB 2K3FA 2XF7A 4Q48A 3HKZA 3E5UA 2MLGA 2BE5F 2BYVE 2PX9A 3MKZA 1SD7A 2DA1A 4NB5A 2BW3B 3EPZA 4XKBA 1MJAA 1TWAJ 2DA5A 5GAGJ 4BQQA 1A36A 3DV8A 3F8FA 3F8CA 3FK7A 1EH8A 1XDUA 3UKGA 1HSTA 5CQGA 4AVZA 5CQEA 2O8KA 1LFBA 3WTVC 1JKRC 3O6BB 1BW5A 4WXCA 3KPHA 2R5YA 3EUAA 5LRSA 2HYJA 2RN7A 1PDNC 4ABZA 3OWTA 1W7PB 4ZYAA 4AIKA 1FTZA 3CO6C 1FMWA 5HLTA 2IA0A 1B9MA 1S3JA 2TDXA 2FA5A 3KEYA 4CICA 3C7JA 4NC6A 2W25A 2ZJQF 2OUMA 1BR1A 3MKWB 1X1CA 4ENKA 1SMTA 1OYYA 1LE8A 1Y8RB 5IP9J 1VFCA 4F3QA 4MQ9F 1YS6A 3AG3H 1LFPA 5J8FA 3HDDA 2A69F 2GQQA 3IC7A 3ZPLA 3LSJA 4X1EA 3BR1A 1HSJA 4XKCA 3ZMZA 2BVLA 4JX4A 2HQ5A 2NOJB 1XCBA 3GX4X 3HB9A 1TQPA 3GO5A 5C4JJ 1Z7UA 1TT0A 4EJUA 5EDNA 2RREA 1XCVA 2ETHA 3CCJI 1FEXA 2BXZA 3BY6A 1TW2A 1D3YA 2I10A 1RR8C 2P6SA 2RAEA 4AVPA 4OOIA 3TQNA 2VE8A 1HC8A 4LG0B 3MKYB 1H9GA 2EA2A 1I3QJ 1UJ8A 3PIOF 4XORA 3BG7A 4BY7J 4B8XA 3T5XA 3A0BC 3E5QA 5CVJA 1JT6A 3ABUA 2CH0A 5LLQA 3K1MA 5E8IA 4XLHA 3CCQI 2M34A 3K4BA 4GRIA 1VQOI 3BPVA 4AU7A 3KYLA 2E5NA 2ESNA 5TJJA 4XLNF 1YRNB 3F8NA 4RA2A 1FBUA 2DT6A 5B3SH 3BR3A 2LMDA 3IH4A 4RMNA 5HLGA 2NNYA 3LSTA 2JMWA 2LFBA 2Y48A 3GCMA 4F92B 1QZYA 1U78A 3VYSB 2BY3A 3VWBA 2JVGA 2ZFWA 4B09A 4B48A 1K4SA 1JJ8C 4HNTA 3GFIA 5FJ8J 2FJ1A 4RGSA 3QYEA 3C3WA 4XICA 5IP7J 1CF7A 3Q0UA 1ITYA 1BI3A 3TOBA 1OJLA 4HA8A 5J4YA 3QYBA 4A3CJ 1EJ9A 2DA4A 4EVIA 1SAUA 2CSOA 3ZRGA 5J1UA 2O8XA 1FJLA 2GA2A 3NRVA 3I4MJ 4BHPA 4H0EA 2AHQA 3OSGA 3H3VK 4ZYDA 2LBFA 1JTXA 1AU7A 3COAC 2HQNA 2JRTA 3CUQA 3G2BA 3VOEA 3FM3A 2OJED 3V8LA 3ZN0A 1S7OA 4PJLA 4GDFA 3D0SA 2ACJA 3BOQA 4XLFA 2LBFB 2A61A 3FXQA 3CUQB 1QZEA 1ETKA 2OTLI 3BLYA 2VJJA 3W2AA 3S14J 5IYDJ 2F5VA 1IUYA 3S2DJ 1HW2A 3V7SA 1YIJI 3F8MA 3K1NA 4RBOA 1POGA 1EA3A 2KDZA 1U2WA 5CPRB 3F6VA 1HLVA 4FHTA 1LFUP 1TL8A 3FXOA 4AM3A 2ZMEB 1WJAA 2EZIA 5D4SA 1T39A 1WI9A 3I53A 4K2EA 4KT6A 5KAFC 5E3LA 4U87A 3E7LA 1PP8F 4IVNA 4M9XA 2EH3A 2ZJ2A 3CESA 5K7HA 1PUFA 1QPIA 1F5TA 3HOYJ 4A3KJ 1QRYA 3CJQB 3K2ZA 1MJ9A 1IN7A 1GXPA 4M74A 5H2FC 1FWZA 4AYBA 2XAQA 3OYDA 2FNPA 2KL4A 3FZVA 1T33A 2FSWA 1PUFB 2YPRA 2GXBA 1X2MA 1XGOA 2LYCA 2ZXHA 1AOYA 1FNNA 2E36A 3PJRA 3JRBA 2HOAA 3OS0A 3HUGB 4YFKF 2QA4I 4EJOA 2P5VA 2D1HA 3IAM2 2X6OA 4XN0A 2CRGA 1R5GA 2IPQX 1I1SA 4PJMA 2Y0SN 3RPUA 5M5YJ 3DTEA 1P92A 1V5FA 3RKWA 5L3FA 3OSFA 2EIMH 3ECHA 1WVRA 1WJDA 1DPRA 3KP6A 4M73A 2DO7A 4R79A 2XUBA 4LLGF 3MZHA 3HOWJ 1ETVA 1N77A 1ZYRF 1O57A 5KCMA 2E71A 2CW7A 3QU6A 4LFUA 2DOAA 4E7LA 2CUJA 2L4AA 5HS7A 2HWVA 4V2GA 3GTJJ 3DEEA 2P5KA 1FP1D 1K83J 4QIWN 2QCOA 3WGGA 5E1XA 4RB2C 1VQ6I 2X1EA 3FXJA 1LDDA 3LFUA 2EILH 1LVAA 2RVCA 3QU3A 4G9YA 1ORKA 4YIFA 1S72I 2MBFA 2R7UA 4MFEA 4CUGA 3CC2I 1QU3A 2K40A 2CW0F 3C2BA 3LMMA 5LRRA 1I3AA 4ENMA 2K02A 2KLOA 2M3AA 3ERED 2O3FA 2AXTC 5IYCJ 3FX3A 1TWFJ 2M30A 4RGRA 3GFJA 2FBHA 1O4XA 4KMUX 2ZFUA 2CV2A 1BI1A 2KZGA 4C2TA 3Q9VA 2ADUA 1WH7A 4BBRJ 2HDWA 3D5SC 2CUEA 5FFZA 4CCMA 1OCZH 2BHZA 1P4WA 5FD6A 2XF5A 2F4OB 1UELB 2X0LA 5BMZA 1SFOJ 3U9GA 2DQLA 3KP7A 3K4MA 4IPAA 4I6ZA 3DLAA 1QQIA 3DBRB 2VUMJ 3ULQB 4EQQA 1MMAA 1DU6A 4FX4A 2LKSA 2O5RA 3GLLA 3H5NA 1YFHA 3C1DA 4UVBA 3JTHA 2DK5A 2D1VA 2NXNB 2VBYA 3FXKA 5H6QA 3JRFA 3HOSA 4BBSJ 1UHMA 3BROA 5EJCA 2A6HF 3ZXSA 2R93J 1ULYA 2V9KA 1LEAA 3IWFA 3SXYA 4U7BA 2OAZA 3R6SA 4N9IA 4A3MJ 5L3DA 5ILSA 4L5JA 1UHWA 4CDGA 5K7FA 2CGPA 3JR9A 1J9IA 3K4JA 3ZGKA 1X19A 2QM3A 2DOEA 3L9FA 2KPMA 3R0AA 1IDYA 1O3SA 3TW7A 3LNQA 1TNSA 5JVGF 2K9LA 2XF6A 3GTQJ 5KHDA 4D7NA 1LVKA 5F0FA 1DQUA 2R0QC 2V6EA 3O3KA 3W6VA 4NUBA 4EATA 3OYIA 1AWCA 4KIBA 1R1VA 3DEWA 4GXOA 1U8BA 2ZJRF 1FIAA 4CCNA 5DM6F 2LTPA 2ESHA 3FXLA 2NVUB 2L7KA 3FHNA 4MIMA 3NEUA 3ROUA 2D2WA 2Z99A 2VKHA 2JVHA 2EZKA 2HTJA 4RDUA 4PSWA 5LEKA 1DP3A 2HQAA 3P9KA 3PUBA 4E70A 4HLYA 4I2OA 3L2RA 3W3CA 2XASA 3A2KA 2YUSA 1SFKA 2QLZA 4FQGA 5ICFA 5H20A 2DFEA 4N4NB 1KU9A 5EG0B 2P4WA 1XN7A 4KT5C 2E1NA 1ZRDA 2VBWA 5M5WJ 1Y8QB 1X3ZB 2EZHA 4LG3A 3TO6A 5FKNA 3OY9A 4IQJA 2LSOA 4KFCA 2LH9A 3VYTB 4ZZLA 3I5UA 2AO9A 1W4MA 4BJ6C 2GM4A 2JQ7A 4IRIA 5ILVA 3DEUA 1RR7A 1JUMA 2B0LA 3Q5FA 2VJ5A 3EETA 3RZDJ 1O3TA 1JT0A 1VQMI 3KYCB 1JJ6C 2H1LA 1OMIA 1TWGJ 4EMSA 2E7XA 5L3BA 5J47A 1T8IA 3BJAA 1F36A 5LHHA 2M4GA 1Y1WJ 2Q1ZB 3I59A 2EIJH 3EQLF 2P7VB 1O3RA 4YG2F 2UXNA 1IRZA 3EDPA 1FMVA 2B7EA 1YX3A 3I59B 3OYGA 2ECCA 3DQVC 3SZGA 1SFUA 3RQ4A 2OA4A 2E7WA 4XNFA 2KISA 3VEPA 2X1CA 1YI2I 3BQZA 5JR3A 3CCSI 2D45A 2STWA 2L7MP 1ETYA 4BAYA 4CGZA 1H89C 2DMTA 3KX2A 4ZYHA 1OYWA 5LEJA 3AG4H 2P6TA 4L5EA 4OIPF 2DJNA 2LD5A 3TP0A 1T0FC 4HRIA 2A68F 3BZCA 5DS9A 4UUSA 4LOCA 4IRHA 2MGQA 4Z2YA 2L7FP 3S2WA 1VQ7I 1D8KA 2XSDC 3IKVA 2VXZA 1V4RA 2J5PA 2L01A 1XMKA 2X48A 4JK1X 2IGMA 4HDUA 4ENJA 3S3NA 2CS3A 3JW4A 2HPMA 2QSGX 1VQ9I 3OYFA 3TDZC 1P4AA 2OPTA 2K9NA 2J5OA 2RQQA 2ZCWA 1NG7A 4HOBA 4YFXF 5DM7F 1RUOA 1R4MB 2VLAA 2QYOA 1HKSA 1WJCA 2LKXA 1O3QA 3QOEA 2R5ZB 3ZQ7A 5LGUA 3SEQA 2FQ4A 2FU4A 1U9OA 2XGCA 3I71A 2CO5A 1VF9A 4CCOA 4E7SA 2QWWA 2QBYA 4KA4A 2DLLA 1ZRCA 5EF6A 3WE3A 1ZREA 2XVCA 1YTYA 3NAUA 4FISA 4R8HA 2Z9OA 1V5GA 1STZA 1R71A 2NVYJ 2EK5A 1HBXG 3I4NJ 5F08A 2GLOA 1OISA 3OS2A 2VKEA 1WGXA 5EZHA 2ME6A 1MBGA 2L9SA 4EJTA 2VOPA 1W1WE 5DCMA 2VXDA 5DD4A 1RC9A 3FDYA 2EJRA 4FE7A 4PSXA 2MC4A 2YR2A 4RM3A 2YU9J 1OLTA 3S32A 2EBIA 3J7AO 2PBIA 4HX8A 3G1OA 4BEHA 2F6CA 5ILUA 2W00A 5B5EC 2RKHA 1LPQA 3SFZA 2DA6A 2XROA 2RC4A 2LVSA 3OIPA 3BZ6A 3LQRA 2DT7B 2KDOA 2O6GE 3H9JA 4G7ZF 2STTA 3H0DA 2ELHA 2D5VA 1DPUA 3G4SI 3AFHA 3MZYA 1BIBA 1ON2A 1X1BA 1E0EA 1ETQA 3M7GA 4YRVA 2IS6A 1HXDA 2L4MA 1USSA 2KKOA 1WQ2A 3FWEA 2EIKH 1YHQI 3GYHX 4HZFA 2KIUA 5KNLA 1W36C 1DDNA 2RV8A 5BQTA 4RB0A 4XSZF 2PJRA 3DP7A 3K4CA 3IL2A 3S1MJ 2IP2A 3KZIC 5L3GA 4YEJA 2PMUA 4B1RA 3CCLI 3SJMA 2BEOA 2A05A 3OOUA 5A2QK 2FRHA 2XPWA 3L1PA 2AQFA 2IGOA 2VT3A 3WG7H 1MBJA 2JTVA 3FXMA 5J6XA 4NBQA 4BHBA 2NVQJ 5E3NA 2PN6A 4IF4A 4EM2A 1QA6A 5JLXA 4G8XA 3A02A 5LGTA 1VQPI 2G7UA 5IT9K 4CXFA 3PNTA 4BGDA 2DPUA 3CCVI 1XGSA 2CG4A 5H6RA 1KQ0A 3KEOA 2I8DA 1ON1A 2XB0X 4UNOA 4TV7A 3WTWC 2VPLA 2DA7A 4P9UA 1ZG5A 2WY8Q 2R7XA 2AXLA 4PFPA 4NQWA 3CUOA 1VQ4I 2EWNA 2MW8A 2VKDA 1R36A 3CTAA 4ANJA 1MBKA 1W5TA 4BE0A 1LJ9A 2HOSA 3AG2H 2L9NA 2W48A 1KZHA 3ZQHA 1GVDA 4A6EA 3A03A 1LEBA 1MNEA 3ZMUA 4R1HA 3M1CA 4NQWB 2DMNA 4QSHA 1W0UA 4BQOA 1TNTA 1W7PD 4ON0A 2YU3A 5HDGA 1JGSA 1FSEA 1J5YA 2PLYA 2K4BA 1EH7A 3LQQA 4E7HA 3HOUJ 2EV0A 3RKQA 1Z3YA 1MMSA 3DBLB 1UFMA 3LA7A 1QHHD 2LG4A 2L5QA 2IW5A 1SMYF 5EGOA 1IJWC 2IA2A 3Q0WA 4KUMA 1V3FA 4DJAA 2QQAA 1USTA 2XAGA 2BBYA 3KZZA 5CVVA 4NHJA 1T0FA 3GZ5A 2MSYA 4HBLA 5IP6A 4XK4A 2K9QA 3BDDA 4LLLA 4WXHA 2KFDA 1FY7A 5CVRA 5LD2C 2LNBA 5D5UB 1W36D 2ZMEC 1ETXA 3DBHB 2HEOA 4J19A 3B02A 4KJZA 2DXIA 3HRUA 2X51A 5ED4A 2L9VA 5C3EJ 3A1YA 3TW6A 3K4KA 1RKWA 3KCCA 1RI7A 2Y2ZA 3RPQA 4UV8A 4BNCA 1WJ5A 4MQVA 1XSVA 1S9HA 1Z7LA 3JSOA 1ZR4A 1Q1VA 2UZKA 4ESBA 5J8CA 4DOZA 2WB1N 3FIWA 4FETA 1WJFA 3HC7A 2E1CA 3BJOA 2CYYA 1K61A 3ZMVA 4XLPF 4ZZDA 2L0KA 3S1NJ 2QENA 2BW3A 1G8XA 2HXOA 2DOFA 4RB3C 2F5DA 3H3ZA 1RKTA 4BDZA 2X6YA 5DCFA 4XBFA 3WE2A 2V1DA 3OR1C 4RS8A 1HOMA 2MA3A 2Y69H 1SAXA 1WHUA 1X1AA 1Y56A 3MQ0A 5FD5A 4XIDA 3S1QJ 1OPCA 2TCTA 2MD5A 2QQ8A 1F4KA 1HKTA 2HZDA 4PUSA 4F91B 4ASNA 1W7PA 1DGRM 4AC0A 4BE1A 2NVTJ 3J80Z 4Y52J 1REPC 2JK3A 2DW4A 3N05A 1FBSA 2X6XA 1P7IA 1B72B 1MDMA 2CFXA 2HFHA 3GZNB 5DD8A 4RAGA 2V1NA 2DA3A 3KP5A 4IX7A 5J1YA 2ELKA 1MSFC 1UG0A 2M8GX 1X3UA 3H3UA 1MDMB 5M5XJ 3DLLF 5DDGA 1IN5A 4V19K 1YYVA 3GMEA 3OV8A 2VJIA 4Q4ZF 1BI0A 4PJ0C 3BR2A 2PI0A 3LSRA 1TBXA 2DU9A 2P0WA 3VPRA 3OS1A 1VQLI 2RGVA 2KP6A 3DKXA 4JX6A 1YITI 4BL0B 2WWYA 4BQAA 2JPBA 1X4PA 3IKTA 1IF1A 2GAUA 4CCKA 4DIQA 3K69A 2XDVA 2CQQA 3CJNA 2PMZN 3EYYA 1T56A 3RI4A 1F9NA 2CUFA 4EM0B 3CF2A 3KFWX 4LG0A 5HOOA 1BC7C 5K1YA 3PSIA 5K5QA 4FE4A 4RGXA 3E1SA 3TKYA 3GTPJ 1ERDA 2BV6A 3BTLA 3AAFA 3OMYA 1AKHB 1G4DA 2R7TA 1GT0C 2VIXA 3HBLA 3IV5A 2LREA 4M3BA 2HVSA 2JA8J 1MH3A 4G94A 2XRNA 3MVPA 1YRNA 2FMLA 4UV9A 4BJTA 2ZKZA 3LFKA 3TO9A 3SDBA 5ICGA 4A0ZA 1J2XA 1L3LA 3CF5F 1I27A 2MYSA 2ID6A 3LA2A 4YIIA 4JP0A 3ZQFA 3S2HJ 1FOWA 1ZGWA 2L9RA 1NH3A 3QYFA 4A3LJ 2Y0SA 3SYTA 2VC1A 1I6HJ 3G3ZA 5M3FJ 2NVXJ 1D1AA 2W82A 4BHCA 5F1JA 5TGTA 1OKRA 1B59A 2DMPA 2FOWA 2VI6A 3KE2A 4Y17A 3V8JA 3RPUD 2NRAC 2O9LA 2XKPA 2K9MA 2V6CA 1M1EB 4GYIA 2UV1A 2HS5A 2M4KA 3B6AA 3CQZJ 4DZPA 2KZVA 4LITA 1F1ZA 1OFCX 3KLOA 1OCRH 4Q5SF 1MBEA 1LDKB 4IKFA 1G2HA 3TL4X 3EUKL 4XM3A 3SZPA 5B1BH 4KN4X 3AG1H 1ZELA 1SD6A 1EH6A 2V79A 5F0HA 3WTSC 2OC6A 3SHFA 3O2PE 2H6CA 1FP2A 3GF2A 4XONA 2EZLA 3JREA 1BC8C 3O8HA 3BR6A 2ZMEA 2H1KA 3M8EA 2V9PA 2VBZA 3RKXA 3CDLA 3I55I 3GWZA 2IS2A 2KT0A 3ISPA 1MNDA 3JTGA 2LK2A 3HYIA 3UNGC 4E4HA 2VT2A 4C2MJ 2DAOA 1WZ2A 4I99C 3HIFA 2V7FA 4IL6C 4ZJZA 2GOMA 1YIOA 1YJ9I 5FLMJ 1FPQA 3J7YJ 4D0PA 3DPLC 4AUXA
chains in the Genus database with same CATH topology
4XL9A 3PUBA 4ZTFA 3L2RA 3W3CA 3A2KA 3VYUB 3AKZA 1SFKA 3K6GA 1BR2A 2LY1A 4N4NB 2FUG2 2K3PA 3CP2A 4B44A 1YE9A 1Y6IA 1PJRA 2HNHA 4ZTJA 1T95A 4NNJA 4LG3A 3OYLA 2KHMA 3D5RC 5FROA 3OY9A 4IQJA 3BG6A 2LH9A 3VYTB 3LSMA 4BUPA 3ZCOA 4BJ6C 1HA8A 2Z16A 3PNYA 4HSRA 2PJRB 4DBRA 3S8PA 3U21A 1TZLA 2VJ5A 4ZDOA 2QKLB 4BACA 4Y33A 2ZSHB 3J7AY 4J00A 3C2HA 3PFYA 2M4GA 3VDXA 2Q1ZB 4D1QA 1BOBA 2E1MB 4BXFA 4ITVA 3IAS2 1FMVA 3LSHA 4XLCA 2XSJC 4C2UA 1YX3A 4B3XA 3PL8A 4II3A 3OYGA 2DJIA 3DQVC 3SZGA 4BE2A 3RQ4A 2Q2EB 4XNFA 2X1CA 4OAZA 2IGNA 3SEZA 2VASA 3CP8A 2XAUA 3LSGA 3A4CA 3HL2A 3KX2A 4C30A 2LY2A 3LL7A 4F93B 1JI8A 1T0FC 3CJRB 4HRIA 4OAYA 4BS9A 2VXZA 3MMYB 3TMOA 4XQFA 3DWLE 1PYVA 2IGMA 2CMPA 3S3NA 2CS3A 4E7IA 2HPMA 1KONA 3OYFA 4P1WA 2RQQA 1WFXA 1X1DA 1NG7A 2K5CA 3AL0B 4DBQA 3FBIB 4XN3A 2VLAA 1WJCA 2R4GA 1IRXA 2HPIA 4E7JA 3L2UA 3QOEA 3SEQA 2LRDA 3ONQA 4CCOA 4E7SA 3H5AA 2LC2A 3C2GA 3OYHA 4CCJA 3D5LA 1MW7A 3K10A 2E5ZA 4LIUA 2DCEA 3HXLA 4G6TB 2HVRA 1N78A 1DGWY 1D1BA 2VQGA 5HNFA 4PJNA 1V5GA 4RLFA 4HSTA 4RM2A 3V42A 4E7KA 2KRHA 3HPHA 3RSNA 4KITB 3OS2A 3HOTA 4X0GA 2L9SA 2WADA 3H9GA 2VXDA 2WAEA 1LKXA 2F4IA 3CMMA 2WAQA 3OYEA 3FDYA 4F52A 4PSXA 2MC4A 4RM3A 1OLTA 4CZCA 2MABA 3S32A 2LOOA 4BEHA 2F6CA 2BOLA 2W00A 2VJ4A 2X6WA 4BDYA 3ZR8X 3K70D 2UUZA 3OIPA 3OYMA 2W4SA 2CV1A 3DTKA 2Z2SB 3CZ6A 1N75A 2DT7B 2IS4A 2KDOA 3H9JA 2XF7A 4NC7A 3H0DA 3HKZA 3AFHA 4ZDPA 3RCOA 3MKZA 2M0MA 1X1BA 3L2QA 1E0EA 2BW3B 3EPZA 3F9KA 4XKBA 4YRVA 3DKYA 2IS6A 2WY7Q 2R7SA 4BQQA 4CCLA 2KQRA 1Z3XA 3H9QA 4QPOA 5KNLA 3ZQQA 1W36C 5CQGA 4AVZA 5CQEA 2PJRA 2R7VA 3K4CA 3PNVA 3EUAA 4YEJA 2ELJA 4OWRB 3OOUA 2VQCA 3OWTA 4ZYAA 3OYCA 2R7WA 1FMWA 5HLTA 4ZC3A 3IUOA 3KEYA 2AQFA 2IGOA 4ZDLA 3TBIA 2OUMA 1WJBA 1BR1A 3MKWB 1X1CA 4XLEA 3S93A 3PNTA 4F3QA 2M7AA 3GBGA 4BGDA 5LFAA 1LFPA 3LSKA 4JOMA 3BCBA 3K4LA 2I8DA 4XKCA 2BVLA 3OYBA 2VPLA 3OYKA 2WAFA 1YX5A 3BC8A 4HPQA 2NOJB 3OIQA 2WY8Q 4PJJA 2R7XA 1TT0A 4PFPA 2RREA 1G59A 4JQFA 2VKDA 4ANJA 2MD0A 2JSPA 4BE0A 2L9NA 1MNEA 3M1CA 4NQWB 4C9YA 2R7RA 2HU9A 3H5RA 4BQOA 1J09A 3MKYB 2RNGA 1X4OA 4MLOA 5CKTA 2MFZA 4XORA 3BG7A 2IXSA 3L2VA 4N4OB 4E6KG 4E7HA 3DTIA 2CH0A 4XMYA 4XLHA 2R7QA 3K4BA 1Z3YA 4GRIA 4AU7A 1VZ0A 2VQLA 3KYLA 2E5NA 3W2VA 1QHHD 4E7ZA 2LG4A 2L5QA 2DT6A 3DU6A 4RMNA 1AA7A 2BVMA 1UAAA 4DJAA 4II2A 2ZSIB 4F92B 3RTRA 3VYSB 2VL8A 3VWBA 2JVGA 4B48A 4HNTA 3VSLA 4XOPA 1BR4A 3QYEA 5LD2C 1W36D 4KJZA 2DXIA 2X51A 3A1YA 3K4KA 4XKWA 3QYBA 1NG6A 2ZXIA 1SAUA 3ZRGA 1WJ5A 3OL3A 1S9HA 1Z7LA 3NWTA 4YELA 2OV7A 2A5WA 4DOZA 4FETA 1WJFA 3HC7A 3DU5A 3HPGA 2LBFA 3G2BA 4RLQA 2BW3A 1G8XA 2E60A 4FASD 4PJLA 5FRNA 4XLFA 2LBFB 2CW8A 4BDZA 2X6YA 3BLYA 2VJJA 3I9V2 3W2AA 2IS1A 2F5VA 3OR1C 4IZZA 1X1AA 4QPQA 1Y56A 3VYRB 2KRCA 1EA3A 5CPRB 2CUZA 2HZDA 4PUSA 4F91B 1DGRM 1WJAA 4BE1A 4XR6A 4PFOA 3IP4B 3OYAA 4BJ5C 4KT6A 3N05A 4D9JA 2X6XA 4U87A 3OR2C 3CESA 4XLAA 3DPTA 4CH7A 2V1NA 3S3OA 4IX7A 3FBNB 2HVQA 3CJQB 1UG0A 2WB1A 2W7NA 4AYBA 3OYDA 1U0JA 3I3LA 2XC7A 2KL4A 1GLNA 1DP3A 3OYJA 2WA0A 2LYCA 1V5EA 2VJIA 2ZXHA 5HNHA 3PJRA 3OS0A 3HUGB 4Y3OA 2P0WA 3OS1A 3NWSA 2QKMB 3IAM2 2KP6A 4XN0A 3DKXA 4XOTA 4BL0B 3M8JA 1X4PA 4PJMA 2Z1DA 4BQNA 3DTEA 1V5FA 3PSFA 1R6RA 4CCKA 4DIQA 4P5OA 2XDVA 3L2WA 1WJDA 4R79A 3AL0C 3K70C 4H4KC 3OYNA 4IQ4A 3CF2A 1N77A 1D1CA 5KCMA 2CW7A 5HOOA 2DOAA 4E7LA 2CUJA 3PSIA 2CV0A 3S3MA 3DEEA 1ERDA 3E1SA 3DPUA 4XKVA 3OMYA 2X1EA 3LFUA 2VB6A 4B47A 2CFOA 3OL4A 2R7TA 3H35A 2R7UA 2AQEA 2VIXA 2WBMA 1MMNA 2A6TA 4CUGA 1QU3A 1MMGA 3LMMA 2LREA 2HVSA 2V4JC 2M3AA 2JUGA 2KLOA 2UWMA 4BJTA 4F55A 1OR7C 3QODA 3SDBA 1D0XA 2ZFUA 2CV2A 2MYSA 4C2TA 1P9QC 5HVQC 4CSWA 2HDWA 3D5SC 4CCMA 2JA2A 2W1OA 4LIVA 2X1DA 2R7OA 3MD2A 3QYFA 2Y0SA 2XF5A 3SYTA 4PK4A 1UELB 3FKJA 1D1AA 2PMZA 2W82A 3K4MA 4KISA 3DLAA 3E0JB 3BCAA 4CA0A 5TGTA 1D0ZA 1MMAA 3LSIA 2O5RA 3H5NA 4HG2A 3RPUD 4BU2A 3K4NA 2K9MA 2M7BA 2IGKA 3HOSA 2UV1A 2M4KA 4HEA2 3ZXSA 1D0YA 2GOXB 2KZVA 4LITA 2V9KA 5FRMA 1LDKB 4U7BA 1WJEA 4J01A 4IKFA 1K6YA 3TL4X 3EUKL 4XM3A 3UR3C 1ZELA 3K4JA 4NC8A 3ZGKA 1X19A 2VQHA 2X85A 2KPMA 2OC6A 1QHGA 4DGWB 4XONA 2K9LA 2XF6A 4Y4RA 3VSKA 5KHDA 1LVKA 2V6EA 1DQUA 2L2OA 4NUBA 4EATA 1MMDA 3OYIA 4HNUA 2IS2A 1MNDA 1Z21A 2KMUA 3UNGC 4CCNA 4E4HA 3EUHC 2L7KA 3FHNA 2V26A 2V7FA 4BEHB 4ZJZA 3HG9A 2GOMA 4B43A 2VKHA 2E1MC 5JHFA 2JVHA 3DPLC 3W2WA 4PSWA 2HQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5N A;  2DOA A; 
#chains in the Genus database with same CATH topology
 2L02 A;  2HOE A;  4ZTF A;  4CYD A;  1JUS A;  5D8K B;  3RYR A;  3HUG A;  1BR2 A;  2LY1 A;  4IOA F;  2FUG 2;  4O5V A;  3QPL A;  3TDU C;  4NNJ A;  3OYL A;  1ZN2 A;  4ENN A;  2KHM A;  5FRO A;  2M87 A;  3BG6 A;  3ASN H;  1A5J A;  4BUP A;  2Q8K A;  1XMA A;  3RQI A;  1G6N A;  4OIN F;  4HSR A;  2XAH A;  3MCZ A;  4MFD A;  1MBH A;  2RDP A;  4RAZ A;  3PO3 J;  3E6D A;  4P9F A;  2DTR A;  1J75 A;  3J80 K;  4Y33 A;  3J7A Y;  1HDP A;  5GTI C;  1I50 J;  3QRF F;  3L2C A;  4D1Q A;  2LKP A;  4EV0 A;  1IDZ A;  2R7D A;  4BXF A;  4P96 A;  2FBK A;  2WV1 A;  2OTJ I;  4XLC A;  3ZQG A;  5E3O A;  2EFQ A;  2HXI A;  5E18 F;  4I76 A;  3E5X A;  4QLC U;  5BPD A;  1S6L A;  1KU2 A;  4OAZ A;  1ENH A;  3SEZ A;  2XAJ A;  1ODD A;  3CP8 A;  1WCM J;  1YOV B;  5K5O A;  4MEY F;  1I39 A;  5D6E A;  3J81 Z;  2LF7 A;  1XC5 A;  4OAY A;  5C44 J;  3QOP A;  4XQF A;  4NDL A;  2WAQ N;  3DWL E;  4IOC F;  1IRG A;  2CMP A;  2ZNY A;  2W57 A;  4E7I A;  3OIO A;  1KON A;  1S5L C;  1WSU A;  4HF1 A;  2K85 A;  3F0C A;  4N0B A;  4DBQ A;  1BA5 A;  2NS7 A;  3E6B A;  5BOX A;  3BPX A;  5DUI A;  3A01 A;  4E7J A;  3E6C C;  2LY9 A;  1B6A A;  3B6C A;  3ESW B;  2DPD A;  3IRR A;  4L18 B;  2UXX A;  2XGX A;  2F5E A;  3ONQ A;  1C0W A;  4A3B J;  3C2G A;  1XPX A;  3A01 B;  3OYH A;  4CCJ A;  3K10 A;  4A5N A;  3HOZ J;  3SDG A;  1FLI A;  2BY0 A;  3HXL A;  3R61 A;  5AON A;  1D1B A;  1IUF A;  1OCT C;  1T08 B;  2NS0 A;  1K79 A;  5E17 F;  4KMF A;  4PZJ A;  4Y7N J;  4E7K A;  3V42 A;  1IXC A;  9ANT A;  3WTU C;  3CCY A;  4KIT B;  3HSF A;  5J40 A;  2LF8 A;  3HOT A;  1HDD C;  3K9T A;  5IYB J;  3CC4 I;  2WAD A;  2FE3 A;  3N4M A;  2WAE A;  2L3D A;  1P4X A;  2LDU A;  4M9Z A;  2K9S A;  1J0R A;  1IZ1 A;  1RET A;  3WHC A;  4JX5 A;  2QF7 A;  4RGU A;  2BOL A;  4IHV A;  1GVJ A;  5JHU A;  2GIZ A;  3ZR8 X;  3OYM A;  1K4T A;  2H8W A;  1TC3 C;  3JAM Z;  1N75 A;  3I58 A;  2IS4 A;  2OBP A;  5J1R A;  1HKQ A;  4NC7 A;  5C4X J;  2BY1 A;  4XRM A;  3WHB A;  1HW1 A;  2F48 A;  5EG0 A;  3RCO A;  3GTO J;  3PIP F;  2Q0O A;  3BTI A;  4FCY A;  3PQJ A;  2WY7 Q;  5E3M A;  2R7S A;  2X4H A;  4CCL A;  1TLH B;  1Z3X A;  3F8B A;  4QPO A;  2BGC A;  3ZQQ A;  5BPI A;  1J7K A;  5GPA A;  1KQ9 A;  2JA6 J;  2FF4 A;  1Q1H A;  4OWR B;  1VQK I;  2VQC A;  1FTT A;  1CQT A;  1GDT A;  1E3O C;  1A31 A;  1SEU A;  3FM5 A;  2R7W A;  3WU1 B;  2HZT A;  3IUO A;  4ZDL A;  5JVT A;  2DFF A;  2HKO A;  1XSX A;  1R5I D;  5DV5 A;  1Z05 A;  4A93 J;  5HDK A;  1U8R A;  2EFP A;  3KEQ A;  4HQE A;  2BXY A;  4OMY A;  2DYR H;  4B4C A;  4DW6 A;  3S93 A;  2CU7 A;  4A3J J;  1YJW I;  5JI6 A;  3GBG A;  3BTC A;  3BQY A;  1AHD P;  3LOC A;  3KYD B;  3BCB A;  3K4L A;  4S0H B;  2F4M B;  3MZ8 A;  3OYB A;  5EEA A;  1SVM A;  1YX5 A;  2IBD A;  4IEJ A;  4O6J A;  1P6R A;  3CCU I;  1Z9C A;  2ZXW H;  3QP5 A;  4MNU A;  4L9J A;  4I0A A;  1Z67 A;  4JQF A;  3DXJ F;  2DT5 A;  1B8I B;  2JSP A;  2XRL A;  1QZZ A;  1RZ4 A;  3HSE A;  2EA4 A;  1HF0 A;  4A0Y A;  1D8J A;  2YX7 A;  2WTE A;  2R7R A;  3LSP A;  3V4G A;  4CYC B;  1WKM A;  3P5J A;  4LMY A;  2QZ8 A;  2KIF A;  2GZW A;  2ZBK A;  3SFI A;  3H1C A;  1VQ5 I;  3K7A J;  4P55 A;  4M6X A;  2RNG A;  1X4O A;  2WC2 A;  4MLO A;  5CKT A;  2MFZ A;  3KET A;  2R5Z A;  4LLN A;  2IRF G;  1Y39 A;  1YJN I;  1IV6 A;  3DTI A;  4HX4 A;  4Z6Y A;  1RNL A;  2XAF A;  5KAI C;  3SQN A;  1VZ0 A;  2VQL A;  1GHC A;  1D5V A;  4L9T A;  2VBX A;  3DU6 A;  3CD6 I;  1AA7 A;  1UAA A;  4U0V A;  2ICW G;  3NAR A;  2HGC A;  3DFG A;  2CWE A;  4LK1 F;  5IPA A;  5AIQ A;  1JHH A;  1PVE A;  3GLX A;  4JYK A;  2E34 A;  2AS5 F;  2A3S A;  4C3J J;  3J81 K;  3VSL A;  1XD7 A;  4XOP A;  3FHZ A;  2OZU A;  2FQ3 A;  2YX4 A;  2BY2 A;  1F43 A;  4EGY A;  3LAP A;  5TRD A;  4XKW A;  3HSR A;  1NG6 A;  1XDS A;  2R7F A;  2E2J J;  2M1B A;  3HRT A;  1APL C;  4IXA A;  1S29 A;  3VFZ A;  3NWT A;  1O7F A;  4YEL A;  5D8L B;  3GTG J;  2OV7 A;  3GUD A;  4QTR A;  2XHK A;  2A5W A;  1MSE C;  4HV6 A;  1I1G A;  2W85 A;  4I09 A;  1RPW A;  1SD4 A;  3HPG A;  3DU5 A;  4CZZ A;  3JRH A;  4KDP A;  3DCF A;  4L5I A;  4EJV A;  3PUF A;  1LDJ A;  2E60 A;  4FAS D;  1SC7 A;  5FRN A;  4IHX A;  4DQ2 A;  2QQ9 A;  4HYE A;  2DTZ A;  3TO7 A;  5J4V A;  1IN4 A;  1P2F A;  4IZZ A;  1B9N A;  1V55 H;  4QPQ A;  2CUZ A;  4M3G A;  3ZQL A;  1U9N A;  3ZN1 A;  1A6Q A;  4PFO A;  3BWG A;  3IP4 B;  4U0W A;  1IN8 A;  4EM1 A;  2IEK A;  2CQN A;  3OR2 C;  1I6X A;  3R4K A;  1S7E A;  2G9W A;  3HGY A;  1S7A A;  1WH5 A;  2XB5 A;  2NAZ A;  3DPT A;  4CH7 A;  3S3O A;  5HS9 A;  1K78 A;  3FBN B;  2HVQ A;  3KIO A;  2WB1 A;  4S05 A;  2W7N A;  1MGT A;  1U0J A;  3E97 A;  1GLN A;  2VN2 A;  3JAM K;  4A3I J;  1R9T J;  1K78 B;  1JTY A;  5FKM A;  3WTY C;  2JPC A;  3U2R A;  1Z91 A;  2ZNZ A;  3CLO A;  1E3P A;  4FX0 A;  4Y3O A;  3IH3 A;  1PP7 U;  3NWS A;  1U6G A;  4M3F A;  2OZ6 A;  4M71 A;  3BT9 A;  4PCQ A;  3FXR A;  4XOT A;  3M8J A;  4RAF A;  2Z1D A;  3G1L A;  4BQN A;  3PSF A;  1R6R A;  1R58 A;  2CQX A;  2I5U A;  3ABT A;  3L2W A;  3AL0 C;  3DKW A;  3K70 C;  1R5H A;  3OYN A;  1FYK A;  1ZTR A;  5K7Z A;  4IQ4 A;  1D1C A;  1ZKG A;  2HYG D;  2IA1 A;  1ZLJ A;  3FXU A;  1T98 A;  4KIG A;  3SZT A;  4A3E J;  1KYZ A;  3A0H C;  4Y15 A;  1JXS A;  3F23 A;  1YLF A;  3DPU A;  4DZJ A;  3CC7 I;  3FF5 A;  2CFO A;  3OL4 A;  1QO0 D;  1R7J A;  2AQE A;  5HLH A;  1DU0 A;  1MMN A;  2A6T A;  2H27 A;  3CLQ A;  2MLK A;  1Z77 A;  1XMX A;  5HLI A;  1JKP C;  2KIQ A;  2RQP A;  4PGH A;  4ZH4 F;  5E1W A;  3W6J B;  3L7W A;  1KGS A;  1OR7 C;  5IY5 H;  1RRJ A;  3R60 A;  4M6Y A;  6PAX A;  1D0X A;  2DMQ A;  1P9Q C;  3ZQC A;  5HVQ C;  3S1R J;  2HDC A;  1RES A;  1I5Z A;  4U7D A;  2JA2 A;  3I54 A;  2X1D A;  2R7O A;  3MD2 A;  2KIM A;  2P8T A;  3RKY A;  3GEZ A;  2N8G A;  5B1A H;  1ZGA A;  2PMZ A;  2Z3Y A;  3BCA A;  3REO A;  4CA0 A;  1D0Z A;  2BHY A;  3QAH A;  2GXA A;  4JBA A;  4LB6 B;  2JT1 A;  4A69 C;  4B3A A;  4D5C A;  1GV2 A;  4GCV A;  2Y31 A;  3WU0 A;  4BU2 A;  2M7B A;  1BJZ A;  2K86 A;  1W0T A;  2PFB A;  1FOK A;  2JRM A;  3IH2 A;  1Y0U A;  4WWC A;  2PG4 A;  2HYF A;  5FGM A;  1WJE A;  3G6E I;  1K6Y A;  1KU7 A;  3K2A A;  3UR3 C;  1SD5 A;  3R0J A;  1QBJ A;  1Z6R A;  4NC8 A;  4C3I J;  2FNA A;  2VQH A;  1FIP A;  4WF2 A;  2M2E A;  5ERI A;  2OCC H;  3JCU C;  3PM1 A;  4HAM A;  4Y4R A;  3Q3S A;  4ESF A;  5DYM A;  1ZQ3 P;  1TTY A;  1GV5 A;  4XRS A;  2TRT A;  3GW2 A;  4DYC A;  4LGW A;  4G7O F;  1B72 A;  2V9V A;  4GFB A;  2EIN H;  4WX9 A;  3EUH C;  1QNT A;  4RAY A;  5EEG A;  4BXX J;  3BJ6 A;  3HG9 A;  1UB9 A;  3S17 J;  4XRF A;  2GBY A;  3C18 A;  4B43 A;  5M3M J;  5D4R A;  1H0M A;  4N9H A;  2DI3 A;  4FTH A;  4LD5 A;  3VYU B;  3AKZ A;  4EGZ A;  2L54 A;  5FO5 A;  3BG5 A;  2EFN A;  5AIP A;  3ZQI A;  2JJ7 A;  3CP2 A;  3WG9 A;  2JUC A;  1PJR A;  2DOD A;  2HNH A;  4ZTJ A;  1T95 A;  4BY1 J;  1FSH A;  1ZHF A;  3HHG A;  4XSX F;  1BJA A;  1ZK8 A;  3GZ6 A;  1HW5 A;  3LSM A;  3GFM A;  4I7H A;  3ZCO A;  1HA8 A;  2EFW A;  3PNY A;  2P81 A;  4QWQ A;  3RJP A;  2HTS A;  3U21 A;  1ETW A;  2R5Y B;  1TZL A;  1XG1 A;  1K7A A;  2Y75 A;  3WU2 C;  1FYM A;  5LBQ A;  2QKL B;  4M72 A;  3HRS A;  4UHT A;  4BAC A;  1FYL A;  2ZSH B;  4J00 A;  1BOA A;  2YSR A;  3V7C A;  3PFY A;  1AKH A;  3T0Y A;  3ZMS A;  3KP4 A;  2H09 A;  2E1M B;  3KZY A;  2DQR A;  4ITV A;  3BP8 A;  1R00 A;  2NYX A;  3LSH A;  3HTS B;  2XSJ C;  4EEF G;  1LE8 B;  4B3X A;  1ZGJ A;  4II3 A;  4BH9 A;  1H9T A;  3WTZ A;  2Z33 A;  2LP0 A;  4IRG A;  2IT0 A;  3RZO J;  1R49 A;  1K6O A;  1YW7 A;  4AID A;  2GA1 A;  2K4J A;  3I4P A;  4OIO F;  3ASO H;  3CME I;  3TP3 A;  2XAU A;  3CDH A;  3LSG A;  3A4C A;  1ZG1 A;  5K5R A;  4HF2 A;  3WOD F;  4C30 A;  1IXS B;  3LL7 A;  4F93 B;  2PEX A;  2CQ7 A;  4HF0 A;  2ID3 A;  3M1E A;  5E20 A;  1TQM A;  4ETS A;  5FLX Z;  1ZRF A;  1BBY A;  1ETO A;  4WXD A;  5FLV A;  4A3D J;  2XIG A;  5EEH A;  2Y9Z A;  1T38 A;  3WGH A;  1YG2 A;  5LGN A;  1PYV A;  3CO7 C;  1DP7 P;  4IHW A;  2IAI A;  4UVA A;  4DYR A;  2QVO A;  2B63 J;  3AL0 B;  3FBI B;  1OCC H;  3CMY A;  2R4G A;  2DK8 A;  4CO8 A;  2B9S A;  2FX0 A;  1A6I A;  1FT9 A;  4OU0 A;  3JSP A;  1R23 A;  2NNN A;  3IWZ A;  1YW9 A;  3WTT C;  1MKM A;  4YFN F;  4PGG A;  3HOV J;  3HKZ N;  3HTU A;  3MWM A;  4UUV A;  1QPM A;  1MW7 A;  1OR7 A;  4LIU A;  1XX5 A;  1VQN I;  1N78 A;  2HVR A;  2ISY A;  1DGW Y;  5FFX A;  1NTC A;  4KIF A;  2KRH A;  2XKO A;  3HPH A;  4Q47 A;  5FKO A;  1KQ8 A;  3RSN A;  1KA8 A;  3MFK A;  4X0G A;  1G3Y A;  1MJB A;  3HRM A;  5JLW A;  2VOO A;  1J59 A;  3H36 A;  3Q0V A;  3OYE A;  2F4I A;  3CMM A;  2WAQ A;  1CF7 B;  2JSC A;  4LK0 F;  2MAB A;  3BTJ A;  2LOO A;  1SFE A;  1MZB A;  2E19 A;  3I64 A;  2L7Z A;  2X6W A;  4MTD A;  1OYI A;  2GXG A;  1IW7 F;  4UXN A;  3RDI A;  5J3L A;  1FOY A;  3FKI J;  3CZ6 A;  3J7Z I;  5D5W B;  4OIQ F;  4OIR F;  1KU3 A;  4ZDP A;  2M0M A;  4I01 A;  3L2Q A;  2GWR A;  1E2X A;  1U5T C;  3F9K A;  5DTD A;  2C6Y A;  3DKY A;  1MIJ A;  3KLN A;  1Y0N A;  1VI0 A;  2KQR A;  3GVA A;  3H9Q A;  1TP4 A;  3O8G A;  4D5F A;  3JRA A;  3PO2 J;  1BL0 A;  4L9N A;  2H8R A;  2R7V A;  3PNV A;  4MHG A;  2ELJ A;  2K27 A;  1IAW A;  1BN5 A;  1NK3 P;  5F04 A;  2M9H A;  3OYC A;  3EUH A;  4ZC3 A;  3K0L A;  2P7C B;  1HCR A;  3TBI A;  3JRG A;  3MKL A;  3D1N I;  1G3T A;  3W6K B;  4WK8 F;  1WJB A;  2M5W A;  4XLE A;  4G6Q A;  4M3E A;  1B4A A;  1TT5 B;  3KP3 A;  1UCR A;  1WWX A;  2O03 A;  3M8F A;  2F2E A;  2G0E A;  1X1P A;  3U1K A;  1D5Y A;  2M7A A;  2VC0 A;  5LFA A;  3G71 I;  1BW6 A;  1TQI A;  3LSK A;  1IXR C;  2R3S A;  3ABM H;  3QQA A;  4JOM A;  4M6V A;  5CJ9 A;  1MH4 A;  2FEZ A;  3CCM I;  4AIJ A;  5TIS C;  3OYK A;  2WAF A;  4UVC A;  3BR5 A;  3BC8 A;  4HPQ A;  2OQG A;  3X2Q H;  1BIA A;  1MD0 A;  2E2I J;  3OIQ A;  4DNC A;  4PJJ A;  3FMQ A;  3M4O J;  3P9C A;  1G59 A;  2W24 A;  3M3Y J;  1UG2 A;  2MD0 A;  1JUP A;  1XB4 A;  3MEX A;  3F21 A;  4IO9 F;  1OCO H;  1Y1V J;  2OQR A;  2X9D A;  1GXQ A;  3GTM J;  2ISZ A;  4C9Y A;  3T8R A;  3ERM A;  2H6B A;  2HU9 A;  2MC3 A;  3H5R A;  5KK1 A;  4KNY A;  1J09 A;  3E6M A;  2HKX A;  4Y13 A;  4W97 A;  1IC8 A;  1QVT A;  1A04 A;  2IXS A;  3L2V A;  4N4O B;  2IVM A;  4E6K G;  1YW8 A;  4XMY A;  2PJP A;  1A35 A;  4GO1 A;  1DUX C;  2R7Q A;  1JGG A;  1ZH5 A;  2W84 A;  4FT8 A;  3W2V A;  4E7Z A;  3QPT A;  2P5L C;  3G1M A;  4MO7 A;  2HOT A;  2BVM A;  1RIO H;  4G7H F;  4W1U A;  4II2 A;  3T8T A;  4A6D A;  2ZSI B;  4DYQ A;  4O3M A;  3RTR A;  2JWT A;  2VL8 A;  1FBQ A;  4A3F J;  4GGG A;  4D7M A;  3P9I A;  5FLX K;  1BR4 A;  4UY8 I;  2ZO4 A;  3Q9S A;  3OOP A;  2HR3 A;  1B1B A;  1W5C C;  3LWF A;  3I0T A;  2ZXI A;  4I0B A;  2R7Z J;  3HOX J;  3OL3 A;  4ESJ A;  4BYY A;  2KJC A;  3GXO A;  1ZLK A;  1X2N A;  3PQK A;  4AYB N;  4G6D A;  2DBB A;  1JHF A;  4XRS G;  2O61 A;  4RLQ A;  3N97 A;  4MEX F;  2DDB A;  5E1Z B;  2CW8 A;  3K1P A;  3FK6 A;  3I9V 2;  1X58 A;  5EYR A;  3QPS A;  2IS1 A;  4M3D A;  1VND A;  1ZG3 A;  5A2Q Z;  1UZC A;  3WGI A;  1FC3 A;  3EYI A;  3VYR B;  2KRC A;  4L9V A;  3ML6 A;  3ABK H;  3CJT B;  4YIR X;  3VOD A;  5D5X B;  3JRI A;  4XR6 A;  3ZMD A;  2M8E A;  4CHU A;  1EKE A;  3OYA A;  4BJ5 C;  5B66 C;  1FZP B;  3FIS A;  3HM5 A;  3GTL J;  5GAE J;  4D9J A;  5IT3 A;  2JA7 J;  5IT9 Z;  3E3V A;  2JN6 A;  5F27 A;  4XLA A;  2Z5U A;  1GUU A;  2G7H A;  2ZC2 A;  1R22 A;  1KYW A;  2NOG A;  2OU2 A;  2KJB A;  2DFH A;  3M07 A;  3BZK A;  4L0Z B;  2XC7 A;  3I3L A;  5FB2 A;  3OYJ A;  2WA0 A;  5FKL A;  1V5E A;  3CDI A;  1ONV A;  1OQY A;  1XTA A;  1WRJ A;  5HNH A;  4WCG A;  1U5T A;  4U88 A;  2CJJ A;  1E3H A;  2PQ8 A;  3HEF A;  4V2F A;  2QKM B;  4PDK A;  1VQ8 I;  5FKK A;  2YS9 A;  2QQB A;  2LR8 A;  3DF8 A;  5GP9 A;  5L3E A;  1UMQ A;  1U5T B;  1WPK A;  1ZR2 A;  5F1R A;  1B8I A;  3NQO A;  5E79 C;  4P5O A;  3ZP5 A;  4H4K C;  4IHT A;  4A3G J;  5LHI A;  3JRD A;  4CYC A;  1G3S A;  2EB7 A;  4G12 A;  4HDV A;  5CVU A;  2QEX I;  1EV7 A;  2EV5 A;  5E8G A;  2CV0 A;  3MN2 A;  2VKV A;  5BS6 A;  4A5M A;  3S3M A;  1ACI A;  3QWL A;  1XGM A;  1Z1D A;  3T1B A;  4XKV A;  4B47 A;  2VB6 A;  2E35 A;  1N25 A;  3F22 A;  5DEQ A;  3H35 A;  3ZMT A;  2WBM A;  3V7R A;  2V1X A;  2BZT A;  1MMG A;  2LLK A;  5BNG A;  2XV4 S;  2V4J C;  2UWM A;  2JUG A;  3B73 A;  4KIC A;  3F6O A;  3PFI A;  4UB8 C;  5GPC A;  3CMA I;  4F55 A;  3FMR A;  3QOD A;  3BG9 A;  1JKO C;  1BI2 A;  2EPF A;  5JFR A;  2ECB A;  4IHS A;  4CSW A;  2K7L A;  3HZJ A;  1HQC A;  2W1O A;  5KVR A;  4LIV A;  5F64 A;  4PK4 A;  4UUS B;  3FKJ A;  1IO2 A;  5DUK A;  4U0Y A;  2XGE A;  3QP6 A;  3IRQ A;  2FOK A;  2KRF A;  2OD5 A;  3E0J B;  4KIS A;  4BKX A;  2M0C A;  2OCE A;  2FXA A;  1XSD A;  1Z6T A;  3LSI A;  2NS8 A;  4HG2 A;  1R1U A;  3K4N A;  4AD9 A;  2IGK A;  2ZXJ A;  5LHG A;  2OF7 A;  2M45 A;  3HJE A;  1LQ1 A;  1ZAR A;  4HEA 2;  5IOY A;  3F72 A;  1IN6 A;  1D0Y A;  2GOX B;  4UUT A;  2DFI A;  5FRM A;  4J01 A;  2R92 J;  3S16 J;  3RYP A;  2QBY B;  4HLX A;  4LB5 A;  1T2K A;  5GAH J;  4LJZ F;  5EZG A;  2HI3 A;  2X85 A;  1TWH J;  4F7Z A;  2MH2 A;  2ME0 A;  4HQM A;  2ZB9 A;  3M9A A;  3WTX C;  5L3C A;  1QHG A;  4DGW B;  3F3X A;  1TWC J;  3MAJ A;  2GIV A;  3VSK A;  2O7O A;  2Y30 A;  4MTE A;  1SFX A;  2F5F A;  3H92 A;  2A5Y B;  2L2O A;  1MMD A;  2XPV A;  5DCM B;  2MG4 A;  1O7L A;  2RNJ A;  4GYG A;  4HNU A;  2JA5 J;  1TW3 A;  1SVO A;  4KN7 X;  5ICC A;  1IG7 A;  1Z21 A;  2KMU A;  3CCE I;  5F0C A;  2V26 A;  2QSF X;  4BEH B;  1JE8 A;  1XS9 A;  1RUN A;  1OCP A;  1H8A C;  1E17 A;  2JZY A;  2HDD A;  2E1M C;  5JHF A;  4A2U A;  4S04 A;  2EQR A;  1FOX A;  3W2W A;  3KP2 A;  4XL9 A;  1YO5 C;  1SAN A;  3HGG A;  1VTN C;  3K6G A;  2DMU A;  3RIR A;  2CQK A;  2K3P A;  4L0Y B;  4B44 A;  1YE9 A;  5HS8 A;  1Y6I A;  1NK2 P;  1WI3 A;  3H0G J;  3HHH A;  1T6S A;  3D5R C;  3ECO A;  3VB2 A;  1UHS A;  3IHU A;  1QGP A;  1X3W B;  3ZOB A;  2XPU A;  2VOD A;  2Z16 A;  5D6F A;  2QGU A;  2PJR B;  4DBR A;  2V1U A;  2O0Y A;  3S8P A;  2Y0M A;  1IV8 A;  2QUF A;  4ZYE A;  4C3H J;  1H88 C;  3GTK J;  4ZDO A;  1ZAO A;  5GTH C;  1R4N B;  2Y9Y A;  2A07 F;  3C2H A;  2DN0 A;  3VDX A;  4HV5 A;  2HQR A;  5CLS A;  1BOB A;  2Q2E A;  2VE9 A;  3L00 A;  4OMZ A;  3IAS 2;  4A12 A;  2E1O A;  4I02 A;  4C2U A;  2PMH A;  2H94 A;  2EFO A;  3PL8 A;  4BE2 A;  2DJI A;  2Q2E B;  1FX7 A;  5HDN A;  2A6E F;  5HOD A;  2IGN A;  4HW0 A;  1JKQ C;  2VAS A;  2EV6 A;  1LUJ B;  1MNM C;  3TGN A;  2COM A;  3HL2 A;  3P7N A;  2LY2 A;  1L0O C;  1JI8 A;  4X6A J;  3BG3 A;  4BXU A;  5CVI A;  1YS7 A;  2FD5 A;  2QSH X;  3CCR I;  3CJR B;  1IRF A;  4BS9 A;  1LNW A;  2VON A;  4A0X A;  4AIH A;  3FMS A;  3MMY B;  3TMO A;  3U1D A;  5IOZ A;  4P1W A;  5ICE A;  1WFX A;  1X1D A;  1IGN A;  2WV0 A;  2K5C A;  1CGP A;  1XGN A;  1PUE E;  4XN3 A;  2FBI A;  4HNV A;  1IRX A;  4EJW A;  2HPI A;  4HX7 A;  3L2U A;  1NHA A;  4IHY A;  3V8K A;  3S15 J;  2LRD A;  1LB2 A;  2MH9 A;  4KYW A;  3L09 A;  1P7J A;  4I98 B;  3ELK A;  3H5A A;  1QVU A;  2LC2 A;  4MGR A;  3ABL H;  3D5L A;  3CUQ C;  4AWX B;  3JRC A;  2E5Z A;  1V54 H;  2DCE A;  1W5S A;  4G6T B;  3LAJ A;  2FMY A;  5D5V B;  5EGO B;  2VQG A;  5HNF A;  2DDA A;  4PJN A;  2ZJP F;  4RLF A;  3I56 I;  4HST A;  4RM2 A;  2DA2 A;  1BM9 A;  1R1T A;  2DYS H;  1U3E M;  1Z0X A;  5CYV A;  2COB A;  2E2H J;  2XGD A;  5F6F A;  1S8N A;  3H9G A;  4UB6 C;  5GAD J;  1SVL A;  1LKX A;  2VPR A;  2F5C A;  4F52 A;  3TOA A;  4CZC A;  1EF4 A;  1G3W A;  3QPH A;  3GFL A;  2VJ4 A;  3LA3 A;  4ZYG A;  1MBF A;  4BDY A;  4RB1 A;  3BR0 A;  2IJL A;  3K70 D;  2UUZ A;  3G73 A;  1YQA A;  3TED A;  2W4S A;  4M9S A;  4IJA A;  2CV1 A;  3DTK A;  2Z2S B;  2K3F A;  2XF7 A;  4Q48 A;  3HKZ A;  3E5U A;  2MLG A;  2BE5 F;  2BYV E;  2PX9 A;  3MKZ A;  1SD7 A;  2DA1 A;  4NB5 A;  2BW3 B;  3EPZ A;  4XKB A;  1MJA A;  1TWA J;  2DA5 A;  5GAG J;  4BQQ A;  1A36 A;  3DV8 A;  3F8F A;  3F8C A;  3FK7 A;  1EH8 A;  1XDU A;  3UKG A;  1HST A;  5CQG A;  4AVZ A;  5CQE A;  2O8K A;  1LFB A;  3WTV C;  1JKR C;  3O6B B;  1BW5 A;  4WXC A;  3KPH A;  2R5Y A;  3EUA A;  5LRS A;  2HYJ A;  2RN7 A;  1PDN C;  4ABZ A;  3OWT A;  1W7P B;  4ZYA A;  4AIK A;  1FTZ A;  3CO6 C;  1FMW A;  5HLT A;  2IA0 A;  1B9M A;  1S3J A;  2TDX A;  2FA5 A;  3KEY A;  4CIC A;  3C7J A;  4NC6 A;  2W25 A;  2ZJQ F;  2OUM A;  1BR1 A;  3MKW B;  1X1C A;  4ENK A;  1SMT A;  1OYY A;  1LE8 A;  1Y8R B;  5IP9 J;  1VFC A;  4F3Q A;  4MQ9 F;  1YS6 A;  3AG3 H;  1LFP A;  5J8F A;  3HDD A;  2A69 F;  2GQQ A;  3IC7 A;  3ZPL A;  3LSJ A;  4X1E A;  3BR1 A;  1HSJ A;  4XKC A;  3ZMZ A;  2BVL A;  4JX4 A;  2HQ5 A;  2NOJ B;  1XCB A;  3GX4 X;  3HB9 A;  1TQP A;  3GO5 A;  5C4J J;  1Z7U A;  1TT0 A;  4EJU A;  5EDN A;  2RRE A;  1XCV A;  2ETH A;  3CCJ I;  1FEX A;  2BXZ A;  3BY6 A;  1TW2 A;  1D3Y A;  2I10 A;  1RR8 C;  2P6S A;  2RAE A;  4AVP A;  4OOI A;  3TQN A;  2VE8 A;  1HC8 A;  4LG0 B;  3MKY B;  1H9G A;  2EA2 A;  1I3Q J;  1UJ8 A;  3PIO F;  4XOR A;  3BG7 A;  4BY7 J;  4B8X A;  3T5X A;  3A0B C;  3E5Q A;  5CVJ A;  1JT6 A;  3ABU A;  2CH0 A;  5LLQ A;  3K1M A;  5E8I A;  4XLH A;  3CCQ I;  2M34 A;  3K4B A;  4GRI A;  1VQO I;  3BPV A;  4AU7 A;  3KYL A;  2E5N A;  2ESN A;  5TJJ A;  4XLN F;  1YRN B;  3F8N A;  4RA2 A;  1FBU A;  2DT6 A;  5B3S H;  3BR3 A;  2LMD A;  3IH4 A;  4RMN A;  5HLG A;  2NNY A;  3LST A;  2JMW A;  2LFB A;  2Y48 A;  3GCM A;  4F92 B;  1QZY A;  1U78 A;  3VYS B;  2BY3 A;  3VWB A;  2JVG A;  2ZFW A;  4B09 A;  4B48 A;  1K4S A;  1JJ8 C;  4HNT A;  3GFI A;  5FJ8 J;  2FJ1 A;  4RGS A;  3QYE A;  3C3W A;  4XIC A;  5IP7 J;  1CF7 A;  3Q0U A;  1ITY A;  1BI3 A;  3TOB A;  1OJL A;  4HA8 A;  5J4Y A;  3QYB A;  4A3C J;  1EJ9 A;  2DA4 A;  4EVI A;  1SAU A;  2CSO A;  3ZRG A;  5J1U A;  2O8X A;  1FJL A;  2GA2 A;  3NRV A;  3I4M J;  4BHP A;  4H0E A;  2AHQ A;  3OSG A;  3H3V K;  4ZYD A;  2LBF A;  1JTX A;  1AU7 A;  3COA C;  2HQN A;  2JRT A;  3CUQ A;  3G2B A;  3VOE A;  3FM3 A;  2OJE D;  3V8L A;  3ZN0 A;  1S7O A;  4PJL A;  4GDF A;  3D0S A;  2ACJ A;  3BOQ A;  4XLF A;  2LBF B;  2A61 A;  3FXQ A;  3CUQ B;  1QZE A;  1ETK A;  2OTL I;  3BLY A;  2VJJ A;  3W2A A;  3S14 J;  5IYD J;  2F5V A;  1IUY A;  3S2D J;  1HW2 A;  3V7S A;  1YIJ I;  3F8M A;  3K1N A;  4RBO A;  1POG A;  1EA3 A;  2KDZ A;  1U2W A;  5CPR B;  3F6V A;  1HLV A;  4FHT A;  1LFU P;  1TL8 A;  3FXO A;  4AM3 A;  2ZME B;  1WJA A;  2EZI A;  5D4S A;  1T39 A;  1WI9 A;  3I53 A;  4K2E A;  4KT6 A;  5KAF C;  5E3L A;  4U87 A;  3E7L A;  1PP8 F;  4IVN A;  4M9X A;  2EH3 A;  2ZJ2 A;  3CES A;  5K7H A;  1PUF A;  1QPI A;  1F5T A;  3HOY J;  4A3K J;  1QRY A;  3CJQ B;  3K2Z A;  1MJ9 A;  1IN7 A;  1GXP A;  4M74 A;  5H2F C;  1FWZ A;  4AYB A;  2XAQ A;  3OYD A;  2FNP A;  2KL4 A;  3FZV A;  1T33 A;  2FSW A;  1PUF B;  2YPR A;  2GXB A;  1X2M A;  1XGO A;  2LYC A;  2ZXH A;  1AOY A;  1FNN A;  2E36 A;  3PJR A;  3JRB A;  2HOA A;  3OS0 A;  3HUG B;  4YFK F;  2QA4 I;  4EJO A;  2P5V A;  2D1H A;  3IAM 2;  2X6O A;  4XN0 A;  2CRG A;  1R5G A;  2IPQ X;  1I1S A;  4PJM A;  2Y0S N;  3RPU A;  5M5Y J;  3DTE A;  1P92 A;  1V5F A;  3RKW A;  5L3F A;  3OSF A;  2EIM H;  3ECH A;  1WVR A;  1WJD A;  1DPR A;  3KP6 A;  4M73 A;  2DO7 A;  4R79 A;  2XUB A;  4LLG F;  3MZH A;  3HOW J;  1ETV A;  1N77 A;  1ZYR F;  1O57 A;  5KCM A;  2E71 A;  2CW7 A;  3QU6 A;  4LFU A;  2DOA A;  4E7L A;  2CUJ A;  2L4A A;  5HS7 A;  2HWV A;  4V2G A;  3GTJ J;  3DEE A;  2P5K A;  1FP1 D;  1K83 J;  4QIW N;  2QCO A;  3WGG A;  5E1X A;  4RB2 C;  1VQ6 I;  2X1E A;  3FXJ A;  1LDD A;  3LFU A;  2EIL H;  1LVA A;  2RVC A;  3QU3 A;  4G9Y A;  1ORK A;  4YIF A;  1S72 I;  2MBF A;  2R7U A;  4MFE A;  4CUG A;  3CC2 I;  1QU3 A;  2K40 A;  2CW0 F;  3C2B A;  3LMM A;  5LRR A;  1I3A A;  4ENM A;  2K02 A;  2KLO A;  2M3A A;  3ERE D;  2O3F A;  2AXT C;  5IYC J;  3FX3 A;  1TWF J;  2M30 A;  4RGR A;  3GFJ A;  2FBH A;  1O4X A;  4KMU X;  2ZFU A;  2CV2 A;  1BI1 A;  2KZG A;  4C2T A;  3Q9V A;  2ADU A;  1WH7 A;  4BBR J;  2HDW A;  3D5S C;  2CUE A;  5FFZ A;  4CCM A;  1OCZ H;  2BHZ A;  1P4W A;  5FD6 A;  2XF5 A;  2F4O B;  1UEL B;  2X0L A;  5BMZ A;  1SFO J;  3U9G A;  2DQL A;  3KP7 A;  3K4M A;  4IPA A;  4I6Z A;  3DLA A;  1QQI A;  3DBR B;  2VUM J;  3ULQ B;  4EQQ A;  1MMA A;  1DU6 A;  4FX4 A;  2LKS A;  2O5R A;  3GLL A;  3H5N A;  1YFH A;  3C1D A;  4UVB A;  3JTH A;  2DK5 A;  2D1V A;  2NXN B;  2VBY A;  3FXK A;  5H6Q A;  3JRF A;  3HOS A;  4BBS J;  1UHM A;  3BRO A;  5EJC A;  2A6H F;  3ZXS A;  2R93 J;  1ULY A;  2V9K A;  1LEA A;  3IWF A;  3SXY A;  4U7B A;  2OAZ A;  3R6S A;  4N9I A;  4A3M J;  5L3D A;  5ILS A;  4L5J A;  1UHW A;  4CDG A;  5K7F A;  2CGP A;  3JR9 A;  1J9I A;  3K4J A;  3ZGK A;  1X19 A;  2QM3 A;  2DOE A;  3L9F A;  2KPM A;  3R0A A;  1IDY A;  1O3S A;  3TW7 A;  3LNQ A;  1TNS A;  5JVG F;  2K9L A;  2XF6 A;  3GTQ J;  5KHD A;  4D7N A;  1LVK A;  5F0F A;  1DQU A;  2R0Q C;  2V6E A;  3O3K A;  3W6V A;  4NUB A;  4EAT A;  3OYI A;  1AWC A;  4KIB A;  1R1V A;  3DEW A;  4GXO A;  1U8B A;  2ZJR F;  1FIA A;  4CCN A;  5DM6 F;  2LTP A;  2ESH A;  3FXL A;  2NVU B;  2L7K A;  3FHN A;  4MIM A;  3NEU A;  3ROU A;  2D2W A;  2Z99 A;  2VKH A;  2JVH A;  2EZK A;  2HTJ A;  4RDU A;  4PSW A;  5LEK A;  1DP3 A;  2HQA A;  3P9K A;  3PUB A;  4E70 A;  4HLY A;  4I2O A;  3L2R A;  3W3C A;  2XAS A;  3A2K A;  2YUS A;  1SFK A;  2QLZ A;  4FQG A;  5ICF A;  5H20 A;  2DFE A;  4N4N B;  1KU9 A;  5EG0 B;  2P4W A;  1XN7 A;  4KT5 C;  2E1N A;  1ZRD A;  2VBW A;  5M5W J;  1Y8Q B;  1X3Z B;  2EZH A;  4LG3 A;  3TO6 A;  5FKN A;  3OY9 A;  4IQJ A;  2LSO A;  4KFC A;  2LH9 A;  3VYT B;  4ZZL A;  3I5U A;  2AO9 A;  1W4M A;  4BJ6 C;  2GM4 A;  2JQ7 A;  4IRI A;  5ILV A;  3DEU A;  1RR7 A;  1JUM A;  2B0L A;  3Q5F A;  2VJ5 A;  3EET A;  3RZD J;  1O3T A;  1JT0 A;  1VQM I;  3KYC B;  1JJ6 C;  2H1L A;  1OMI A;  1TWG J;  4EMS A;  2E7X A;  5L3B A;  5J47 A;  1T8I A;  3BJA A;  1F36 A;  5LHH A;  2M4G A;  1Y1W J;  2Q1Z B;  3I59 A;  2EIJ H;  3EQL F;  2P7V B;  1O3R A;  4YG2 F;  2UXN A;  1IRZ A;  3EDP A;  1FMV A;  2B7E A;  1YX3 A;  3I59 B;  3OYG A;  2ECC A;  3DQV C;  3SZG A;  1SFU A;  3RQ4 A;  2OA4 A;  2E7W A;  4XNF A;  2KIS A;  3VEP A;  2X1C A;  1YI2 I;  3BQZ A;  5JR3 A;  3CCS I;  2D45 A;  2STW A;  2L7M P;  1ETY A;  4BAY A;  4CGZ A;  1H89 C;  2DMT A;  3KX2 A;  4ZYH A;  1OYW A;  5LEJ A;  3AG4 H;  2P6T A;  4L5E A;  4OIP F;  2DJN A;  2LD5 A;  3TP0 A;  1T0F C;  4HRI A;  2A68 F;  3BZC A;  5DS9 A;  4UUS A;  4LOC A;  4IRH A;  2MGQ A;  4Z2Y A;  2L7F P;  3S2W A;  1VQ7 I;  1D8K A;  2XSD C;  3IKV A;  2VXZ A;  1V4R A;  2J5P A;  2L01 A;  1XMK A;  2X48 A;  4JK1 X;  2IGM A;  4HDU A;  4ENJ A;  3S3N A;  2CS3 A;  3JW4 A;  2HPM A;  2QSG X;  1VQ9 I;  3OYF A;  3TDZ C;  1P4A A;  2OPT A;  2K9N A;  2J5O A;  2RQQ A;  2ZCW A;  1NG7 A;  4HOB A;  4YFX F;  5DM7 F;  1RUO A;  1R4M B;  2VLA A;  2QYO A;  1HKS A;  1WJC A;  2LKX A;  1O3Q A;  3QOE A;  2R5Z B;  3ZQ7 A;  5LGU A;  3SEQ A;  2FQ4 A;  2FU4 A;  1U9O A;  2XGC A;  3I71 A;  2CO5 A;  1VF9 A;  4CCO A;  4E7S A;  2QWW A;  2QBY A;  4KA4 A;  2DLL A;  1ZRC A;  5EF6 A;  3WE3 A;  1ZRE A;  2XVC A;  1YTY A;  3NAU A;  4FIS A;  4R8H A;  2Z9O A;  1V5G A;  1STZ A;  1R71 A;  2NVY J;  2EK5 A;  1HBX G;  3I4N J;  5F08 A;  2GLO A;  1OIS A;  3OS2 A;  2VKE A;  1WGX A;  5EZH A;  2ME6 A;  1MBG A;  2L9S A;  4EJT A;  2VOP A;  1W1W E;  5DCM A;  2VXD A;  5DD4 A;  1RC9 A;  3FDY A;  2EJR A;  4FE7 A;  4PSX A;  2MC4 A;  2YR2 A;  4RM3 A;  2YU9 J;  1OLT A;  3S32 A;  2EBI A;  3J7A O;  2PBI A;  4HX8 A;  3G1O A;  4BEH A;  2F6C A;  5ILU A;  2W00 A;  5B5E C;  2RKH A;  1LPQ A;  3SFZ A;  2DA6 A;  2XRO A;  2RC4 A;  2LVS A;  3OIP A;  3BZ6 A;  3LQR A;  2DT7 B;  2KDO A;  2O6G E;  3H9J A;  4G7Z F;  2STT A;  3H0D A;  2ELH A;  2D5V A;  1DPU A;  3G4S I;  3AFH A;  3MZY A;  1BIB A;  1ON2 A;  1X1B A;  1E0E A;  1ETQ A;  3M7G A;  4YRV A;  2IS6 A;  1HXD A;  2L4M A;  1USS A;  2KKO A;  1WQ2 A;  3FWE A;  2EIK H;  1YHQ I;  3GYH X;  4HZF A;  2KIU A;  5KNL A;  1W36 C;  1DDN A;  2RV8 A;  5BQT A;  4RB0 A;  4XSZ F;  2PJR A;  3DP7 A;  3K4C A;  3IL2 A;  3S1M J;  2IP2 A;  3KZI C;  5L3G A;  4YEJ A;  2PMU A;  4B1R A;  3CCL I;  3SJM A;  2BEO A;  2A05 A;  3OOU A;  5A2Q K;  2FRH A;  2XPW A;  3L1P A;  2AQF A;  2IGO A;  2VT3 A;  3WG7 H;  1MBJ A;  2JTV A;  3FXM A;  5J6X A;  4NBQ A;  4BHB A;  2NVQ J;  5E3N A;  2PN6 A;  4IF4 A;  4EM2 A;  1QA6 A;  5JLX A;  4G8X A;  3A02 A;  5LGT A;  1VQP I;  2G7U A;  5IT9 K;  4CXF A;  3PNT A;  4BGD A;  2DPU A;  3CCV I;  1XGS A;  2CG4 A;  5H6R A;  1KQ0 A;  3KEO A;  2I8D A;  1ON1 A;  2XB0 X;  4UNO A;  4TV7 A;  3WTW C;  2VPL A;  2DA7 A;  4P9U A;  1ZG5 A;  2WY8 Q;  2R7X A;  2AXL A;  4PFP A;  4NQW A;  3CUO A;  1VQ4 I;  2EWN A;  2MW8 A;  2VKD A;  1R36 A;  3CTA A;  4ANJ A;  1MBK A;  1W5T A;  4BE0 A;  1LJ9 A;  2HOS A;  3AG2 H;  2L9N A;  2W48 A;  1KZH A;  3ZQH A;  1GVD A;  4A6E A;  3A03 A;  1LEB A;  1MNE A;  3ZMU A;  4R1H A;  3M1C A;  4NQW B;  2DMN A;  4QSH A;  1W0U A;  4BQO A;  1TNT A;  1W7P D;  4ON0 A;  2YU3 A;  5HDG A;  1JGS A;  1FSE A;  1J5Y A;  2PLY A;  2K4B A;  1EH7 A;  3LQQ A;  4E7H A;  3HOU J;  2EV0 A;  3RKQ A;  1Z3Y A;  1MMS A;  3DBL B;  1UFM A;  3LA7 A;  1QHH D;  2LG4 A;  2L5Q A;  2IW5 A;  1SMY F;  5EGO A;  1IJW C;  2IA2 A;  3Q0W A;  4KUM A;  1V3F A;  4DJA A;  2QQA A;  1UST A;  2XAG A;  2BBY A;  3KZZ A;  5CVV A;  4NHJ A;  1T0F A;  3GZ5 A;  2MSY A;  4HBL A;  5IP6 A;  4XK4 A;  2K9Q A;  3BDD A;  4LLL A;  4WXH A;  2KFD A;  1FY7 A;  5CVR A;  5LD2 C;  2LNB A;  5D5U B;  1W36 D;  2ZME C;  1ETX A;  3DBH B;  2HEO A;  4J19 A;  3B02 A;  4KJZ A;  2DXI A;  3HRU A;  2X51 A;  5ED4 A;  2L9V A;  5C3E J;  3A1Y A;  3TW6 A;  3K4K A;  1RKW A;  3KCC A;  1RI7 A;  2Y2Z A;  3RPQ A;  4UV8 A;  4BNC A;  1WJ5 A;  4MQV A;  1XSV A;  1S9H A;  1Z7L A;  3JSO A;  1ZR4 A;  1Q1V A;  2UZK A;  4ESB A;  5J8C A;  4DOZ A;  2WB1 N;  3FIW A;  4FET A;  1WJF A;  3HC7 A;  2E1C A;  3BJO A;  2CYY A;  1K61 A;  3ZMV A;  4XLP F;  4ZZD A;  2L0K A;  3S1N J;  2QEN A;  2BW3 A;  1G8X A;  2HXO A;  2DOF A;  4RB3 C;  2F5D A;  3H3Z A;  1RKT A;  4BDZ A;  2X6Y A;  5DCF A;  4XBF A;  3WE2 A;  2V1D A;  3OR1 C;  4RS8 A;  1HOM A;  2MA3 A;  2Y69 H;  1SAX A;  1WHU A;  1X1A A;  1Y56 A;  3MQ0 A;  5FD5 A;  4XID A;  3S1Q J;  1OPC A;  2TCT A;  2MD5 A;  2QQ8 A;  1F4K A;  1HKT A;  2HZD A;  4PUS A;  4F91 B;  4ASN A;  1W7P A;  1DGR M;  4AC0 A;  4BE1 A;  2NVT J;  3J80 Z;  4Y52 J;  1REP C;  2JK3 A;  2DW4 A;  3N05 A;  1FBS A;  2X6X A;  1P7I A;  1B72 B;  1MDM A;  2CFX A;  2HFH A;  3GZN B;  5DD8 A;  4RAG A;  2V1N A;  2DA3 A;  3KP5 A;  4IX7 A;  5J1Y A;  2ELK A;  1MSF C;  1UG0 A;  2M8G X;  1X3U A;  3H3U A;  1MDM B;  5M5X J;  3DLL F;  5DDG A;  1IN5 A;  4V19 K;  1YYV A;  3GME A;  3OV8 A;  2VJI A;  4Q4Z F;  1BI0 A;  4PJ0 C;  3BR2 A;  2PI0 A;  3LSR A;  1TBX A;  2DU9 A;  2P0W A;  3VPR A;  3OS1 A;  1VQL I;  2RGV A;  2KP6 A;  3DKX A;  4JX6 A;  1YIT I;  4BL0 B;  2WWY A;  4BQA A;  2JPB A;  1X4P A;  3IKT A;  1IF1 A;  2GAU A;  4CCK A;  4DIQ A;  3K69 A;  2XDV A;  2CQQ A;  3CJN A;  2PMZ N;  3EYY A;  1T56 A;  3RI4 A;  1F9N A;  2CUF A;  4EM0 B;  3CF2 A;  3KFW X;  4LG0 A;  5HOO A;  1BC7 C;  5K1Y A;  3PSI A;  5K5Q A;  4FE4 A;  4RGX A;  3E1S A;  3TKY A;  3GTP J;  1ERD A;  2BV6 A;  3BTL A;  3AAF A;  3OMY A;  1AKH B;  1G4D A;  2R7T A;  1GT0 C;  2VIX A;  3HBL A;  3IV5 A;  2LRE A;  4M3B A;  2HVS A;  2JA8 J;  1MH3 A;  4G94 A;  2XRN A;  3MVP A;  1YRN A;  2FML A;  4UV9 A;  4BJT A;  2ZKZ A;  3LFK A;  3TO9 A;  3SDB A;  5ICG A;  4A0Z A;  1J2X A;  1L3L A;  3CF5 F;  1I27 A;  2MYS A;  2ID6 A;  3LA2 A;  4YII A;  4JP0 A;  3ZQF A;  3S2H J;  1FOW A;  1ZGW A;  2L9R A;  1NH3 A;  3QYF A;  4A3L J;  2Y0S A;  3SYT A;  2VC1 A;  1I6H J;  3G3Z A;  5M3F J;  2NVX J;  1D1A A;  2W82 A;  4BHC A;  5F1J A;  5TGT A;  1OKR A;  1B59 A;  2DMP A;  2FOW A;  2VI6 A;  3KE2 A;  4Y17 A;  3V8J A;  3RPU D;  2NRA C;  2O9L A;  2XKP A;  2K9M A;  2V6C A;  1M1E B;  4GYI A;  2UV1 A;  2HS5 A;  2M4K A;  3B6A A;  3CQZ J;  4DZP A;  2KZV A;  4LIT A;  1F1Z A;  1OFC X;  3KLO A;  1OCR H;  4Q5S F;  1MBE A;  1LDK B;  4IKF A;  1G2H A;  3TL4 X;  3EUK L;  4XM3 A;  3SZP A;  5B1B H;  4KN4 X;  3AG1 H;  1ZEL A;  1SD6 A;  1EH6 A;  2V79 A;  5F0H A;  3WTS C;  2OC6 A;  3SHF A;  3O2P E;  2H6C A;  1FP2 A;  3GF2 A;  4XON A;  2EZL A;  3JRE A;  1BC8 C;  3O8H A;  3BR6 A;  2ZME A;  2H1K A;  3M8E A;  2V9P A;  2VBZ A;  3RKX A;  3CDL A;  3I55 I;  3GWZ A;  2IS2 A;  2KT0 A;  3ISP A;  1MND A;  3JTG A;  2LK2 A;  3HYI A;  3UNG C;  4E4H A;  2VT2 A;  4C2M J;  2DAO A;  1WZ2 A;  4I99 C;  3HIF A;  2V7F A;  4IL6 C;  4ZJZ A;  2GOM A;  1YIO A;  1YJ9 I;  5FLM J;  1FPQ A;  3J7Y J;  4D0P A;  3DPL C;  4AUX A; 
#chains in the Genus database with same CATH homology
 4XL9 A;  3PUB A;  4ZTF A;  3L2R A;  3W3C A;  3A2K A;  3VYU B;  3AKZ A;  1SFK A;  3K6G A;  1BR2 A;  2LY1 A;  4N4N B;  2FUG 2;  2K3P A;  3CP2 A;  4B44 A;  1YE9 A;  1Y6I A;  1PJR A;  2HNH A;  4ZTJ A;  1T95 A;  4NNJ A;  4LG3 A;  3OYL A;  2KHM A;  3D5R C;  5FRO A;  3OY9 A;  4IQJ A;  3BG6 A;  2LH9 A;  3VYT B;  3LSM A;  4BUP A;  3ZCO A;  4BJ6 C;  1HA8 A;  2Z16 A;  3PNY A;  4HSR A;  2PJR B;  4DBR A;  3S8P A;  3U21 A;  1TZL A;  2VJ5 A;  4ZDO A;  2QKL B;  4BAC A;  4Y33 A;  2ZSH B;  3J7A Y;  4J00 A;  3C2H A;  3PFY A;  2M4G A;  3VDX A;  2Q1Z B;  4D1Q A;  1BOB A;  2E1M B;  4BXF A;  4ITV A;  3IAS 2;  1FMV A;  3LSH A;  4XLC A;  2XSJ C;  4C2U A;  1YX3 A;  4B3X A;  3PL8 A;  4II3 A;  3OYG A;  2DJI A;  3DQV C;  3SZG A;  4BE2 A;  3RQ4 A;  2Q2E B;  4XNF A;  2X1C A;  4OAZ A;  2IGN A;  3SEZ A;  2VAS A;  3CP8 A;  2XAU A;  3LSG A;  3A4C A;  3HL2 A;  3KX2 A;  4C30 A;  2LY2 A;  3LL7 A;  4F93 B;  1JI8 A;  1T0F C;  3CJR B;  4HRI A;  4OAY A;  4BS9 A;  2VXZ A;  3MMY B;  3TMO A;  4XQF A;  3DWL E;  1PYV A;  2IGM A;  2CMP A;  3S3N A;  2CS3 A;  4E7I A;  2HPM A;  1KON A;  3OYF A;  4P1W A;  2RQQ A;  1WFX A;  1X1D A;  1NG7 A;  2K5C A;  3AL0 B;  4DBQ A;  3FBI B;  4XN3 A;  2VLA A;  1WJC A;  2R4G A;  1IRX A;  2HPI A;  4E7J A;  3L2U A;  3QOE A;  3SEQ A;  2LRD A;  3ONQ A;  4CCO A;  4E7S A;  3H5A A;  2LC2 A;  3C2G A;  3OYH A;  4CCJ A;  3D5L A;  1MW7 A;  3K10 A;  2E5Z A;  4LIU A;  2DCE A;  3HXL A;  4G6T B;  2HVR A;  1N78 A;  1DGW Y;  1D1B A;  2VQG A;  5HNF A;  4PJN A;  1V5G A;  4RLF A;  4HST A;  4RM2 A;  3V42 A;  4E7K A;  2KRH A;  3HPH A;  3RSN A;  4KIT B;  3OS2 A;  3HOT A;  4X0G A;  2L9S A;  2WAD A;  3H9G A;  2VXD A;  2WAE A;  1LKX A;  2F4I A;  3CMM A;  2WAQ A;  3OYE A;  3FDY A;  4F52 A;  4PSX A;  2MC4 A;  4RM3 A;  1OLT A;  4CZC A;  2MAB A;  3S32 A;  2LOO A;  4BEH A;  2F6C A;  2BOL A;  2W00 A;  2VJ4 A;  2X6W A;  4BDY A;  3ZR8 X;  3K70 D;  2UUZ A;  3OIP A;  3OYM A;  2W4S A;  2CV1 A;  3DTK A;  2Z2S B;  3CZ6 A;  1N75 A;  2DT7 B;  2IS4 A;  2KDO A;  3H9J A;  2XF7 A;  4NC7 A;  3H0D A;  3HKZ A;  3AFH A;  4ZDP A;  3RCO A;  3MKZ A;  2M0M A;  1X1B A;  3L2Q A;  1E0E A;  2BW3 B;  3EPZ A;  3F9K A;  4XKB A;  4YRV A;  3DKY A;  2IS6 A;  2WY7 Q;  2R7S A;  4BQQ A;  4CCL A;  2KQR A;  1Z3X A;  3H9Q A;  4QPO A;  5KNL A;  3ZQQ A;  1W36 C;  5CQG A;  4AVZ A;  5CQE A;  2PJR A;  2R7V A;  3K4C A;  3PNV A;  3EUA A;  4YEJ A;  2ELJ A;  4OWR B;  3OOU A;  2VQC A;  3OWT A;  4ZYA A;  3OYC A;  2R7W A;  1FMW A;  5HLT A;  4ZC3 A;  3IUO A;  3KEY A;  2AQF A;  2IGO A;  4ZDL A;  3TBI A;  2OUM A;  1WJB A;  1BR1 A;  3MKW B;  1X1C A;  4XLE A;  3S93 A;  3PNT A;  4F3Q A;  2M7A A;  3GBG A;  4BGD A;  5LFA A;  1LFP A;  3LSK A;  4JOM A;  3BCB A;  3K4L A;  2I8D A;  4XKC A;  2BVL A;  3OYB A;  2VPL A;  3OYK A;  2WAF A;  1YX5 A;  3BC8 A;  4HPQ A;  2NOJ B;  3OIQ A;  2WY8 Q;  4PJJ A;  2R7X A;  1TT0 A;  4PFP A;  2RRE A;  1G59 A;  4JQF A;  2VKD A;  4ANJ A;  2MD0 A;  2JSP A;  4BE0 A;  2L9N A;  1MNE A;  3M1C A;  4NQW B;  4C9Y A;  2R7R A;  2HU9 A;  3H5R A;  4BQO A;  1J09 A;  3MKY B;  2RNG A;  1X4O A;  4MLO A;  5CKT A;  2MFZ A;  4XOR A;  3BG7 A;  2IXS A;  3L2V A;  4N4O B;  4E6K G;  4E7H A;  3DTI A;  2CH0 A;  4XMY A;  4XLH A;  2R7Q A;  3K4B A;  1Z3Y A;  4GRI A;  4AU7 A;  1VZ0 A;  2VQL A;  3KYL A;  2E5N A;  3W2V A;  1QHH D;  4E7Z A;  2LG4 A;  2L5Q A;  2DT6 A;  3DU6 A;  4RMN A;  1AA7 A;  2BVM A;  1UAA A;  4DJA A;  4II2 A;  2ZSI B;  4F92 B;  3RTR A;  3VYS B;  2VL8 A;  3VWB A;  2JVG A;  4B48 A;  4HNT A;  3VSL A;  4XOP A;  1BR4 A;  3QYE A;  5LD2 C;  1W36 D;  4KJZ A;  2DXI A;  2X51 A;  3A1Y A;  3K4K A;  4XKW A;  3QYB A;  1NG6 A;  2ZXI A;  1SAU A;  3ZRG A;  1WJ5 A;  3OL3 A;  1S9H A;  1Z7L A;  3NWT A;  4YEL A;  2OV7 A;  2A5W A;  4DOZ A;  4FET A;  1WJF A;  3HC7 A;  3DU5 A;  3HPG A;  2LBF A;  3G2B A;  4RLQ A;  2BW3 A;  1G8X A;  2E60 A;  4FAS D;  4PJL A;  5FRN A;  4XLF A;  2LBF B;  2CW8 A;  4BDZ A;  2X6Y A;  3BLY A;  2VJJ A;  3I9V 2;  3W2A A;  2IS1 A;  2F5V A;  3OR1 C;  4IZZ A;  1X1A A;  4QPQ A;  1Y56 A;  3VYR B;  2KRC A;  1EA3 A;  5CPR B;  2CUZ A;  2HZD A;  4PUS A;  4F91 B;  1DGR M;  1WJA A;  4BE1 A;  4XR6 A;  4PFO A;  3IP4 B;  3OYA A;  4BJ5 C;  4KT6 A;  3N05 A;  4D9J A;  2X6X A;  4U87 A;  3OR2 C;  3CES A;  4XLA A;  3DPT A;  4CH7 A;  2V1N A;  3S3O A;  4IX7 A;  3FBN B;  2HVQ A;  3CJQ B;  1UG0 A;  2WB1 A;  2W7N A;  4AYB A;  3OYD A;  1U0J A;  3I3L A;  2XC7 A;  2KL4 A;  1GLN A;  1DP3 A;  3OYJ A;  2WA0 A;  2LYC A;  1V5E A;  2VJI A;  2ZXH A;  5HNH A;  3PJR A;  3OS0 A;  3HUG B;  4Y3O A;  2P0W A;  3OS1 A;  3NWS A;  2QKM B;  3IAM 2;  2KP6 A;  4XN0 A;  3DKX A;  4XOT A;  4BL0 B;  3M8J A;  1X4P A;  4PJM A;  2Z1D A;  4BQN A;  3DTE A;  1V5F A;  3PSF A;  1R6R A;  4CCK A;  4DIQ A;  4P5O A;  2XDV A;  3L2W A;  1WJD A;  4R79 A;  3AL0 C;  3K70 C;  4H4K C;  3OYN A;  4IQ4 A;  3CF2 A;  1N77 A;  1D1C A;  5KCM A;  2CW7 A;  5HOO A;  2DOA A;  4E7L A;  2CUJ A;  3PSI A;  2CV0 A;  3S3M A;  3DEE A;  1ERD A;  3E1S A;  3DPU A;  4XKV A;  3OMY A;  2X1E A;  3LFU A;  2VB6 A;  4B47 A;  2CFO A;  3OL4 A;  2R7T A;  3H35 A;  2R7U A;  2AQE A;  2VIX A;  2WBM A;  1MMN A;  2A6T A;  4CUG A;  1QU3 A;  1MMG A;  3LMM A;  2LRE A;  2HVS A;  2V4J C;  2M3A A;  2JUG A;  2KLO A;  2UWM A;  4BJT A;  4F55 A;  1OR7 C;  3QOD A;  3SDB A;  1D0X A;  2ZFU A;  2CV2 A;  2MYS A;  4C2T A;  1P9Q C;  5HVQ C;  4CSW A;  2HDW A;  3D5S C;  4CCM A;  2JA2 A;  2W1O A;  4LIV A;  2X1D A;  2R7O A;  3MD2 A;  3QYF A;  2Y0S A;  2XF5 A;  3SYT A;  4PK4 A;  1UEL B;  3FKJ A;  1D1A A;  2PMZ A;  2W82 A;  3K4M A;  4KIS A;  3DLA A;  3E0J B;  3BCA A;  4CA0 A;  5TGT A;  1D0Z A;  1MMA A;  3LSI A;  2O5R A;  3H5N A;  4HG2 A;  3RPU D;  4BU2 A;  3K4N A;  2K9M A;  2M7B A;  2IGK A;  3HOS A;  2UV1 A;  2M4K A;  4HEA 2;  3ZXS A;  1D0Y A;  2GOX B;  2KZV A;  4LIT A;  2V9K A;  5FRM A;  1LDK B;  4U7B A;  1WJE A;  4J01 A;  4IKF A;  1K6Y A;  3TL4 X;  3EUK L;  4XM3 A;  3UR3 C;  1ZEL A;  3K4J A;  4NC8 A;  3ZGK A;  1X19 A;  2VQH A;  2X85 A;  2KPM A;  2OC6 A;  1QHG A;  4DGW B;  4XON A;  2K9L A;  2XF6 A;  4Y4R A;  3VSK A;  5KHD A;  1LVK A;  2V6E A;  1DQU A;  2L2O A;  4NUB A;  4EAT A;  1MMD A;  3OYI A;  4HNU A;  2IS2 A;  1MND A;  1Z21 A;  2KMU A;  3UNG C;  4CCN A;  4E4H A;  3EUH C;  2L7K A;  3FHN A;  2V26 A;  2V7F A;  4BEH B;  4ZJZ A;  3HG9 A;  2GOM A;  4B43 A;  2VKH A;  2E1M C;  5JHF A;  2JVH A;  3DPL C;  3W2W A;  4PSW A;  2HQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...