2DOAA

Solution structure of the helical domain in human eleven-nineteen lysine-rich leukemia protein ell
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
GSSGSSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II elongation factor ELL
publication title Solution structure of the helical domain in human Eleven-nineteen lysine-rich leukemia protein ELL
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2doaA00
2E5NA 2DOAA
chains in the Genus database with same CATH superfamily
4NQWB 1E3HA 1SANA 1X1PA 4BACA 2ZFUA 4UXNA 5IYBJ 4MFDA 1H9TA 2V79A 2R7SA 3TL4X 1LFBA 2VUMJ 3BR0A 3HBLA 1P92A 1TZLA 1XD7A 5IT9K 4RAFA 3SEZA 3KP5A 4ZTFA 1Z9CA 1RI7A 1XSXA 4L5EA 2E1NA 1S6LA 1R36A 2LFBA 1D8JA 1TWGJ 2DPUA 2Z5UA 2JJ7A 3F8BA 2NNNA 1UFMA 2JMWA 2EA2A 2L9VA 2NOJB 2DQLA 1W7PA 1Z21A 4A93J 3GZNB 3MMYB 3X2QH 3LL7A 1FMVA 2Z16A 3IH4A 5IY5H 1ORKA 2FQ4A 2L7ZA 1ETVA 2X48A 4RGSA 2DA3A 5J1RA 3IKTA 5CQEA 2VONA 2KL4A 2A6HF 1CF7A 2M8EA 4LMYA 5M3FJ 1IUYA 2W25A 2V26A 2XSJC 3OS0A 4ZDOA 3FKJA 1Y6IA 3VYUB 3G73A 2WAFA 4XICA 1YFHA 1AU7A 1A5JA 4WWCA 5FGMA 4A3LJ 3SQNA 1IG7A 2XAQA 2ZCWA 4UUSA 1W36C 5L3FA 2DW4A 1R5ID 1HBXG 4NC7A 2DMTA 3JR9A 3GTGJ 1DQUA 1M1EB 3EYYA 5F08A 3FDYA 3CJQB 2LKXA 4B8XA 5EZGA 4OIRF 4IHWA 1ZHFA 2WC2A 2CUZA 3CP8A 3PFYA 3CO7C 4DYQA 3LFKA 5AIQA 1IRXA 5J1UA 2C6YA 4EM2A 3K7AJ 1H89C 3E6MA 4BQQA 1MSFC 3FBIB 4JOMA 1VQOI 3VDXA 4EJVA 4G94A 3FXJA 3UKGA 1X2NA 3HPGA 1HW1A 2EV0A 4XRSA 1UG0A 1T6SA 1W7PD 2FNAA 2HTJA 5LGUA 1QHHD 2IA0A 1S5LC 4Q5SF 4BXUA 2MC3A 3VODA 2D5VA 2HVSA 1G8XA 1X1CA 3PQJA 3SJMA 2DMNA 5EGOA 2JA5J 3R0AA 1G3WA 2O5RA 4IF4A 4UV8A 2B7EA 2PMZA 3A03A 4QWQA 4XLCA 3CESA 5EDNA 5LFAA 4A3IJ 1K4SA 4MQVA 4IHXA 2LP0A 1P7IA 3D1NI 1JHFA 3KZYA 1EKEA 2KP6A 1OCPA 2HFHA 4DOZA 3H1CA 3TQNA 2Q2EA 3BZCA 2DYRH 3CCRI 3I59B 3TO9A 2FMYA 3L1PA 5EF6A 3R60A 4RGUA 4ENJA 2EK5A 4OIPF 1KYWA 3C3WA 3FXUA 2JSCA 3CF2A 3ABMH 3HOVJ 5K5QA 1MBEA 2OJED 2VBYA 3JTHA 1MBGA 3I4PA 3ABTA 5JVTA 1Q1VA 1JKRC 1K79A 5F1RA 2VC1A 4ESBA 2V1UA 1J59A 4UV9A 5GTIC 2NNYA 2EFQA 2DTRA 4AYBA 3QP5A 2HQ5A 3V7RA 3RQ4A 1X3UA 4NC6A 1YITI 3CJRB 5AONA 3LSGA 1UMQA 4XBFA 2K9LA 2LLKA 1TL8A 5DUIA 2Y30A 4BQAA 3JSOA 3WU0A 4CGZA 4BBSJ 1W5TA 2LY2A 2OQGA 5CVJA 4WK8F 3Q0VA 1N25A 4RBOA 4L0ZB 1T38A 1RETA 3DQVC 2A68F 1YJ9I 2PMHA 4UB8C 1MIJA 3BQZA 4LOCA 2A07F 4C2MJ 2BY2A 5EZHA 5IP7J 1E3PA 3J81K 4NUBA 4DYRA 4QIWN 4CUGA 1HCRA 3TMOA 3VFZA 5IT3A 3C18A 5LHHA 3MKLA 2PN6A 1W7PB 1X3WB 1XN7A 4CZZA 1IN6A 2H6BA 1ITYA 3ZMUA 2DMQA 2CFXA 3OOPA 1FNNA 1X2MA 4BHPA 3OYAA 4BNCA 3FZVA 2P6TA 4P9UA 1FP1D 2IS2A 2W4SA 4DYCA 3RKXA 2IJLA 2V6EA 2X1CA 3BROA 2HQRA 2FBHA 1G3TA 1OQYA 3BY6A 3E7LA 1FT9A 1BIAA 4UUSB 4YG2F 1B6AA 1QZYA 3WG7H 3GEZA 1FJLA 2E1MC 5HLGA 4MEYF 3ZMTA 1JKQC 3LSHA 3KP2A 2O9LA 1K6YA 2VXDA 3MAJA 4JQFA 5GAHJ 3CTAA 2OTLI 5BPIA 2KZGA 4X6AJ 4KMUX 1ERDA 3LMMA 4WXCA 3GLXA 1PDNC 2COBA 1FYKA 2L4MA 5GAGJ 2P5VA 2CYYA 4RMNA 4P1WA 3BG5A 2KLOA 4NBQA 4ZYAA 1GV2A 1Z6TA 2MW8A 2IEKA 4BKXA 4B3AA 2X6YA 4DQ2A 2WAEA 3CDHA 2D2WA 3OYHA 3MKWB 5EGOB 3UNGC 2LDUA 2X1DA 1GT0C 1LVAA 1Z7LA 1A36A 5FD6A 3ZXSA 1AWCA 4F55A 1HLVA 3BT9A 1OMIA 5FKLA 4E7HA 1SVMA 4HW0A 1SD7A 2LH9A 3V8LA 4L5IA 4ENKA 1IF1A 1MBHA 3P5JA 2IS6A 2FOKA 2KPMA 1JTXA 3QYEA 2Q2EB 4ZDPA 1VTNC 4IQJA 1R00A 1ZARA 1A6QA 2AO9A 2W57A 2EZIA 4JX4A 4CCKA 1HF0A 3ERMA 5IPAA 3S15J 2MH9A 4W97A 4HRIA 3LSKA 2E1MB 4KNYA 5A2QZ 1ON1A 3W2VA 1B9MA 1LFPA 5FFZA 4G7HF 3QODA 2L9SA 1PUEE 3CC2I 1O57A 2Z99A 3HOYJ 2FBIA 2BV6A 3FXLA 4XKCA 5DM6F 2JZYA 2KIMA 2Q1ZB 5H6QA 4EJWA 1TT0A 1KA8A 2IBDA 3FIWA 4BAYA 1DP3A 4N9HA 2BY3A 3BCAA 5FKMA 4CO8A 2H8WA 5FLMJ 4HBLA 1PP7U 3R6SA 2XF5A 5D5VB 2ACJA 2KDZA 2K9QA 2W24A 1KQ9A 3HOUJ 3AG2H 3DPTA 2K3PA 4U7DA 3IWFA 2ID3A 4AIJA 1G3SA 2RC4A 3PM1A 2G7HA 3K4KA 2W00A 2H1LA 5E1XA 2JA8J 2QSGX 3F8MA 3HKZA 1L3LA 2K40A 1FYMA 1KONA 3P7NA 1SMYF 3RKQA 4KUMA 1KYZA 2HVQA 2NVTJ 1AOYA 4G6DA 2IGNA 1P4XA 3ABLH 2IGKA 2KIQA 4EJOA 4B43A 2VT2A 4M9ZA 2MGQA 3A01A 3SYTA 3H9JA 2LBFA 2ZNYA 2ZKZA 3FXMA 3T1BA 3B6CA 1U0JA 2A69F 4E7LA 2V9PA 3O3KA 3HC7A 4II3A 5E3LA 2AXLA 4XONA 1VQ5I 2HVRA 4GXOA 4QTRA 2KISA 2OQRA 3SXYA 1ZYRF 1TWHJ 4XORA 4M9XA 2FU4A 4CCJA 4EMSA 2R7QA 1NG7A 1QO0D 4B48A 4EM0B 2IS4A 4U87A 3QU6A 1K78B 3EUHA 3ZGKA 5AIPA 3OR1C 4BJTA 4HYEA 4OIOF 3B02A 1K4TA 1GVDA 3DU6A 2ZXJA 4C30A 3D0SA 1ETYA 4LG0B 2CRGA 2WB1A 1RNLA 3VPRA 4I76A 4A3KJ 3QAHA 3CJNA 3DEEA 1HSTA 3HOZJ 4Y3OA 5B5EC 2AQFA 3ROUA 4YIRX 2MD0A 2LYCA 5H20A 2K7LA 3N97A 2HPMA 4OIQF 1HQCA 2LSOA 4P55A 1HXDA 2LC2A 4L9TA 1R49A 1YIOA 1LFUP 5CVRA 2VE8A 3LSMA 4UY8I 2FEZA 5FLVA 2F6CA 4Y33A 2CQNA 2DMPA 3T8RA 4Y7NJ 1ZRFA 1F36A 3R0JA 1WI9A 3BJOA 1LQ1A 2CFOA 1ZKGA 5E3MA 3TW6A 5J4VA 1SMTA 3QYFA 3IAS2 4M3BA 3M8FA 3OR2C 4A5NA 1S29A 2W7NA 2VQCA 5EEHA 3NAUA 1FBSA 1LDKB 4CH7A 2ZSHB 4O5VA 5M3MJ 4P5OA 2XGDA 1ZG3A 2VPRA 5LGNA 2QWWA 2DMUA 3S17J 1ONVA 4Y4RA 4AIKA 2R7DA 4EATA 4NDLA 1MSEC 1B8IA 1FYLA 2ZJRF 2L01A 3BTLA 2EZLA 2M87A 2QZ8A 5IOYA 1W0TA 4UNOA 2LY9A 4BS9A 1LVKA 2ESNA 4A6DA 1FX7A 1LKXA 3NRVA 4QSHA 2Q8KA 4ETSA 1R4MB 4CCNA 3R61A 2VBWA 2L4AA 3BJ6A 4NQWA 3K4NA 5FRMA 4I09A 1MD0A 3H3VK 1MBKA 3KP3A 3OS2A 4XL9A 2RKHA 1W4MA 3CCEI 1JE8A 1XTAA 2BXZA 3EUHC 2PLYA 2MG4A 2UXNA 1V3FA 3KIOA 3M7GA 3HGYA 3KE2A 3P9KA 2R7FA 5K1YA 1I39A 2DT5A 4XRMA 4MNUA 2EPFA 2ZXHA 2QYOA 1TNTA 3F6VA 2VJ5A 4HF0A 4CDGA 3JRDA 4YFNF 4HG2A 1OCTC 4NHJA 3G1OA 4KFCA 3E3VA 2R7VA 4XSXF 1P9QC 1J09A 4XM3A 3B6AA 2DAOA 1JJ6C 3U2RA 3IV5A 1MGTA 1R4NB 1X19A 2PMZN 3D5LA 4RB0A 4BH9A 3S2HJ 2L2OA 2Q0OA 5E20A 1HW2A 1LEAA 3LAJA 4ASNA 1D5YA 1MMNA 4KT6A 1T95A 1IN5A 2WADA 3LSIA 1X1DA 4LK1F 3R4KA 1I3QJ 2BHZA 2P7VB 3LA2A 3U1KA 1XSDA 2M45A 3PNVA 2L54A 4HSTA 5CLSA 4L9VA 3S32A 2DODA 2P6SA 5DD4A 3ABUA 1XPXA 3A01B 3B73A 2DLLA 2LBFB 2G7UA 3RKYA 1USSA 1IDYA 2XB5A 4WX9A 2GXBA 1Y1VJ 5F0FA 4AUXA 2HU9A 1H0MA 5J8FA 2CO5A 2CMPA 2QQ8A 3DU5A 3Q9SA 4AYBN 4XIDA 2KIUA 4S0HB 5HNHA 5E18F 1LB2A 4B4CA 5ICCA 3G1LA 3QPLA 3ZRGA 3OYEA 2XVCA 1FP2A 4PJLA 2GXAA 2P4WA 1F43A 1QZZA 1EH8A 1LNWA 3OIPA 3CQZJ 1BI3A 1F4KA 3OL4A 5BNGA 3IC7A 1SVOA 3CCLI 5DUKA 2ETHA 4G6QA 4MGRA 3QOPA 3JW4A 4V19K 2Y48A 3WE3A 2NS0A 3CZ6A 4DGWB 3OYMA 2STTA 1J75A 3DTEA 4M9SA 1VQLI 5BQTA 2M5WA 1XX5A 1Y8QB 5FJ8J 1A04A 1Z1DA 3J80K 5ILVA 1TLHB 1EV7A 3CJTB 3H9QA 3CD6I 5HLHA 4ENMA 3CCYA 3FM5A 4II2A 2HYJA 2G0EA 1TW2A 2JN6A 2WY8Q 1DUXC 1LDJA 4DW6A 2FBKA 1FBQA 1IXRC 4YIIA 3IH2A 5IP6A 1U8RA 5GPAA 2CUEA 3MWMA 1ZQ3P 5M5YJ 2IA1A 2D1HA 1B59A 2OZ6A 1IRFA 3I59A 2E2JJ 1DGWY 1O3QA 2EFPA 4BUPA 2EJRA 3JRHA 1VZ0A 1R58A 2HZTA 2IP2A 4IRHA 2BBYA 2X9DA 1PUFA 3WHBA 2QM3A 1HC8A 1XDSA 2JTVA 2P81A 1BI1A 2RQQA 3GFIA 2EFOA 5TISC 3G1MA 2WAQA 4A6EA 1S9HA 3BR5A 3SDGA 3DP7A 1KU9A 3E97A 2ADUA 1UHWA 1X4OA 2M1BA 2JA7J 2UWMA 2VI6A 2O61A 2Y0SA 2CU7A 3L2UA 1O3TA 4CCMA 1D1AA 3TO7A 2DFIA 1YI2I 1S3JA 5LLQA 2QSFX 3EUAA 2AS5F 4KA4A 4V2GA 5L3DA 1DP7P 3HOXJ 1PP8F 4R1HA 2QKMB 1XGSA 3BC8A 3TOAA 3CLQA 2QUFA 3I71A 4RM3A 4DZJA 5HLIA 1F5TA 1JHHA 3FXKA 4BHBA 3IUOA 4D7MA 1XGMA 4IHVA 1D0YA 1X4PA 1D3YA 3GWZA 4ZJZA 5JR3A 2ISZA 1QU3A 4ITVA 1H88C 2BW3A 2CJJA 4PUSA 4G7ZF 4HPQA 3VSLA 3M9AA 5K7ZA 4Y15A 3OYCA 1Y39A 3KYCB 1R23A 5J8CA 2A6TA 4UVAA 2ZJPF 3K70D 1RESA 3GTOJ 1W36D 1OR7A 2W48A 1Z67A 3KP6A 1J2XA 1W5SA 1WJEA 2MLKA 3DCFA 4I02A 3RDIA 3A02A 2QKLB 4LLNA 2MLGA 3J7AY 2VQGA 5FB2A 5ICFA 2QQ9A 1TBXA 2L7MP 2IRFG 1PYVA 2VKEA 3IKVA 1SFOJ 1GV5A 4B47A 2XUBA 4BBRJ 2HDCA 5FKKA 1UHSA 5CYVA 4QLCU 3K70C 2HOTA 2GIZA 1ACIA 2M30A 4I98B 3G4SI 2KZVA 1HKQA 1IRZA 3RPUA 3ZN0A 3AL0B 2XPWA 2DO7A 3HTSB 3SZPA 3T8TA 2WY7Q 3I54A 2FA5A 3S1MJ 3M8JA 1U5TA 1RRJA 3L2QA 1WJDA 3VOEA 4LGWA 3CDLA 3GW2A 3BOQA 2H94A 1YTYA 2E19A 3GTLJ 1I27A 3LFUA 2DA4A 5DD8A 1OLTA 2XRLA 2LR8A 4FCYA 2ELKA 3VSKA 1R5HA 3BR2A 2I8DA 2JUGA 2L7FP 2YX7A 4IZZA 5J40A 4FTHA 2DJNA 3K4MA 1VQNI 3F9KA 3LNQA 1X58A 2L3DA 2X1EA 2LNBA 3FM3A 1T08B 4KMFA 1ZH5A 3K0LA 3DBHB 2EA4A 1QPIA 1ZG1A 3HKZN 2VOPA 3FBNB 1EA3A 1F1ZA 4RLFA 3QYBA 3GZ6A 4Q4ZF 2O7OA 1WKMA 4BL0B 4UVBA 1RZ4A 1V4RA 1YW8A 3I56I 1XCVA 5D8LB 4HV5A 2FF4A 5GP9A 4AIHA 1B1BA 4HQEA 2OUMA 1ZGJA 3AG4H 3HJEA 3CMMA 2PFBA 3K4JA 5J4YA 1OR7C 4D1QA 2V6CA 3RPUD 2F4MB 2OBPA 5B1BH 3REOA 1PUFB 1BR1A 3HTUA 4RAZA 2KIFA 1IN7A 3L9FA 4X1EA 4BE0A 1TP4A 2XIGA 3ZQ7A 1FWZA 4A3GJ 1OCZH 2JA2A 4R79A 2VASA 3CP2A 3LSTA 3I4NJ 1V5FA 3EUKL 2XAJA 3GYHX 1Z7UA 3TO6A 2B0LA 2GWRA 1VQ9I 1P4WA 5B1AH 1WI3A 3MZYA 3DPLC 3H3UA 2WB1N 3H36A 3JRAA 2R5YA 3JRGA 3BG6A 4RDUA 4PJ0C 5GAEJ 1U5TC 1U9OA 1MZBA 1I1SA 2A05A 3JREA 1Y56A 4F93B 1ZG5A 3AAFA 1U78A 4TV7A 4EGYA 3FWEA 4PZJA 4I01A 5F6FA 4OAZA 2BY1A 2E7WA 4MTEA 1TC3C 3BDDA 3DEUA 5ICEA 3S1RJ 3DBLB 4KIFA 1ZK8A 2UZKA 5IYDJ 2W82A 4UHTA 3S8PA 2VODA 1VI0A 1Z77A 4N9IA 1LE8B 2N8GA 5HOOA 4CZCA 4J01A 2BW3B 4AC0A 3H5RA 3CUOA 3E0JB 4U0VA 4XOTA 2JRMA 3DEWA 2OTJI 1X1AA 3BPVA 3GTQJ 2VBXA 3RYPA 1R6RA 5L3BA 3Q5FA 1V5GA 1WWXA 1E3OC 2GA2A 4EGZA 2BE5F 4YFKF 5DDGA 2GIVA 3GFLA 3J7AO 2IVMA 3CMEI 3BQYA 5H2FC 2Y9YA 1ZR2A 4CYDA 2R0QC 4MO7A 5LGTA 5F1JA 4W1UA 2LREA 3LA7A 2PEXA 2EH3A 2FSWA 2KDOA 3MCZA 3KX2A 3T0YA 1IN8A 3GFMA 3F8NA 3LOCA 3PFIA 2Y75A 1YLFA 2AHQA 2KT0A 2X0LA 3FXOA 3L7WA 3FK6A 4G7OF 2FX0A 4E7ZA 3JAMZ 4L5JA 1K78A 3DLLF 2LD5A 4RAYA 5ED4A 3RSNA 2R92J 5CJ9A 4HA8A 3KETA 4PCQA 4OWRB 2DFEA 2XDVA 1BR4A 4LG0A 1USTA 2MA3A 3FHNA 1U5TB 4BDZA 3P9IA 4UB6C 2DT6A 4HZFA 2JPBA 1H9GA 3DFGA 4CYCA 5HS9A 4DBQA 2X85A 3WTXC 2DQRA 3BG3A 2X6OA 2NRAC 4RB1A 1RR8C 2DDAA 5ERIA 2EV5A 3DLAA 3G2BA 2HEOA 4D5FA 1R5GA 1DPRA 1REPC 3F72A 2HI3A 1VQ8I 2CS3A 5TJJA 1MNDA 4M3GA 1T98A 1Y1WJ 1XCBA 1K61A 2E7XA 2ZJ2A 1XB4A 1ZAOA 4CCOA 3KPHA 1MKMA 1JJ8C 2DCEA 4L0YB 2K4JA 4P96A 1MH4A 5LBQA 4A0ZA 4H0EA 3WTWC 5JHUA 2ELJA 2K5CA 3F23A 1P4AA 2DN0A 3NQOA 1GXQA 1E17A 1WFXA 1VQPI 5L3EA 2F5EA 4HX4A 5D6EA 5E8GA 4EQQA 4M74A 2F5FA 4HEA2 3VYRB 5KK1A 1B9NA 2E60A 3HGGA 2QENA 1YJWI 2R7UA 3ECHA 2HYFA 5FROA 4DJAA 4FQGA 2K4BA 4LLGF 3K1MA 1JGGA 1BC8C 3OYJA 4IX7A 2QLZA 5CKTA 4FX0A 2KRCA 1ETQA 3PNYA 3HHGA 4XRSG 2XGCA 1FMWA 2Y31A 3V8JA 1YIJI 2FRHA 2MBFA 2Z2SB 2GBYA 4MEXF 4E7IA 5J1YA 4XKBA 5KAFC 2HKXA 2TRTA 2D45A 4MFEA 2BEOA 4UUVA 2R5YB 4YEJA 3NARA 5BOXA 2E35A 5A2QK 5LRRA 4CA0A 1TT5B 1RC9A 2DOFA 5CVUA 1QVTA 3DWLE 1XMAA 4S05A 2FUG2 1R71A 3ZQLA 4IHTA 2DJIA 2XAHA 3IAM2 4XKWA 2L7KA 1IRGA 1A35A 2ISYA 3HYIA 4E7SA 1FPQA 2NVXJ 2OPTA 2QQAA 2TCTA 3GBGA 5D5XB 3CF5F 2PJPA 5LEKA 5C3EJ 2VE9A 3RYRA 4U88A 1JGSA 5CVIA 1JI8A 3GX4X 3GFJA 1HA8A 2JWTA 1MNEA 2DK5A 4J00A 2YR2A 2OCCH 3G71I 1ZELA 1FC3A 2ZSIB 1VF9A 4ZYDA 4WCGA 3PO3J 2XAGA 4OMYA 3OYLA 3ZR8X 1E2XA 2LRDA 4I0AA 1HDPA 3GF2A 3SHFA 3KEOA 3H5NA 4EJUA 4BQNA 1MBFA 1U9NA 5E8IA 1T39A 2XKPA 2WAQN 2P0WA 3C1DA 3WTYC 4BQOA 5DM7F 1RIOH 1SFEA 3KYLA 1K83J 1T8IA 4IRIA 1UHMA 2J5OA 2Y0SN 1BOBA 3F0CA 4ANJA 3BJAA 1SC7A 3QPTA 2HWVA 4ZH4F 3ONQA 4BY7J 4CCLA 1JKOC 5KCMA 5K7HA 2HS5A 4HLXA 2YX4A 4M6XA 4O6JA 5E1WA 2DYSH 2IT0A 1U6GA 2K86A 1LPQA 1FBUA 3LQRA 4O3MA 3LSJA 4WXHA 4BJ5C 5LHGA 4IJAA 3S2DJ 5J3LA 3UR3C 4AIDA 1IV8A 2VXZA 4G6TB 3RJPA 5F64A 4AM3A 3WE2A 1X3ZB 4E6KG 4CYCB 1ETKA 2XF7A 4B09A 3ZOBA 3SFIA 4M71A 3FISA 2JK3A 4XLAA 5F0HA 5H6RA 2OV7A 1I3AA 1BR2A 4JP0A 1CQTA 2HXIA 2LMDA 5LHIA 1WJCA 2IW5A 3CCQI 4IRGA 1C0WA 3HOWJ 1TNSA 1Z6RA 5D4RA 1K7AA 3FX3A 1FLIA 4FHTA 1ZN2A 1WHUA 2L0KA 4ESFA 3GLLA 3V4GA 4I0BA 1VQ4I 1WSUA 4OINF 2X6XA 4A69C 4BDYA 4M6VA 4GFBA 3ZQCA 4KJZA 4PGHA 3FF5A 3WTZA 3W6JB 1I6XA 3TP3A 3HHHA 2PQ8A 4Q47A 3V7SA 4OMZA 2XC7A 2CUFA 5GTHC 3K69A 3QQAA 3KP7A 4IEJA 4NB5A 4K2EA 6PAXA 2OC6A 4HAMA 4ZYGA 1FEXA 4PSXA 3OL3A 3BLYA 3MKYB 2PJRB 2JUCA 2RNGA 3HOTA 5TGTA 2GAUA 3ZMVA 4YIFA 2LF8A 3RPQA 3M07A 2XPUA 3L2RA 2LF7A 2O8XA 5E3NA 5KNLA 2HZDA 2WV1A 2O3FA 2VKDA 2QQBA 3ZQHA 1SD6A 2EIJH 2JA6J 1KQ0A 1O3SA 2ID6A 5HS7A 3PL8A 4OU0A 3ZP5A 2VBZA 1GXPA 2JT1A 1TQIA 2KKOA 3BR1A 4Z6YA 4IO9F 3DKYA 1D5VA 1QGPA 3FMSA 3BTCA 1AKHA 5DEQA 1YW7A 3OYNA 4KYWA 2O0YA 3HSFA 1NH3A 4JK1X 4LIVA 1WZ2A 2NXNB 3WHCA 2BXYA 1SEUA 3E5XA 1W0UA 4XSZF 2F5DA 2XPVA 1CGPA 1ZRDA 1WH5A 1D0ZA 3A0HC 2QGUA 2VB6A 5GPCA 3EPZA 2JRTA 4GGGA 2YSRA 3CCUI 4EM1A 1VFCA 1YRNA 4XLNF 1OISA 5FLXK 1MH3A 1MJAA 2XHKA 4GRIA 3QWLA 3LWFA 2QBYB 4LK0F 2GOXB 1R1TA 1S8NA 3CMAI 5EJCA 1I6HJ 1R9TJ 2LKSA 2HTSA 1YO5C 1K6OA 5L3GA 5EYRA 3F3XA 1A6IA 3RI4A 1BW6A 4M6YA 4N4OB 4A3CJ 1TWCJ 1NK3P 1VNDA 2IA2A 1OYIA 1NK2P 3E1SA 3CC7I 1Z91A 2DU9A 1OYYA 5ILUA 2YS9A 3W6VA 5B3SH 1QVUA 5FKOA 5FFXA 3F22A 2HNHA 3A4CA 3OMYA 2QF7A 3ZQIA 4HNUA 3OYDA 3H35A 3F8CA 3CMYA 1IDZA 5TRDA 3M1EA 1D0XA 3OS1A 2O8KA 4HSRA 4XN0A 2UUZA 3WU2C 2HQAA 5LD2C 2M4KA 4IL6C 2BVMA 4KIBA 1B4AA 2M2EA 2DA5A 4F7ZA 3PSFA 3O2PE 2UXXA 5HDKA 2VN2A 3E6CC 1FY7A 3TBIA 3ECOA 1Y0NA 1UAAA 4S04A 2R93J 1G3YA 4DNCA 2LTPA 3NWTA 4ZC3A 4DZPA 1IO2A 3TW7A 2L9NA 4KDPA 3AG1H 3BTIA 4A2UA 2COMA 1I1GA 2IPQX 2VKVA 1P7JA 5D4SA 1VQ6I 1WRJA 4FISA 3LAPA 4MLOA 4HDVA 3NWSA 4M73A 5JLXA 1LUJB 1O7FA 1WQ2A 3M1CA 1BBYA 1VQKI 2MYSA 2IXSA 4GYIA 2PG4A 1IN4A 3OWTA 3ZMDA 1JUSA 1HOMA 3KZZA 2CQQA 1XMKA 3DKWA 4AVZA 5E17F 3I5UA 1S7EA 2Y9ZA 1MMAA 5FO5A 2A61A 2WBMA 4XNFA 1WGXA 2R4GA 3DBRB 2JQ7A 1S7AA 3HIFA 1O7LA 2Y2ZA 3PIPF 3S1NJ 2H1KA 3HXLA 3ULQB 1BIBA 3W6KB 2W84A 3LQQA 2IGOA 4BE2A 1P2FA 2HOEA 4MIMA 1RKWA 2PMUA 4LLLA 5GADJ 2OA4A 2RVCA 4QPQA 1YJNI 2CSOA 3Q0UA 4RB2C 3TGNA 3WTUC 2OU2A 3GUDA 4PJJA 3ZQQA 2AQEA 2KJBA 4NNJA 4RLQA 4F3QA 3AL0C 2EZHA 4IVNA 4U0YA 1FIAA 1YYVA 4DIQA 3L2WA 3HUGA 2OD5A 4FT8A 4IKFA 1S72I 3HRTA 4ZTJA 1D8KA 3K1PA 4M3FA 2XSDC 2E5ZA 5BPDA 3U1DA 4ZDLA 2HYGD 3F21A 1FOKA 2BOLA 1IUFA 2R7OA 2DOEA 1ODDA 4XLPF 2CW0F 4LJZF 3LSPA 5IT9Z 1T0FA 3RZOJ 2OZUA 1WJBA 1LE8A 4D0PA 1JUMA 1ZR4A 3MD2A 2Y69H 1XMXA 2A3SA 4G8XA 1FTZA 1AKHB 3RKWA 2NVUB 3OSFA 3I53A 3K6GA 4PJMA 1NHAA 1ENHA 2K9NA 4CICA 2WV0A 2B63J 4BY1J 3F6OA 3O6BB 3CUQA 1IC8A 1YS7A 2JVGA 2RV8A 4N0BA 3LA3A 4GDFA 3HB9A 1GHCA 2OF7A 5E3OA 1TW3A 1WCMJ 1OYWA 2EILH 3CLOA 1YRNB 4WF2A 1MMSA 2IS1A 2NVYJ 3P9CA 3VB2A 2R7RA 2JVHA 2W1OA 1T33A 1UJ8A 2M34A 1A31A 2FJ1A 3DTKA 1VQMI 4G12A 1DGRM 1ZLJA 4HLYA 1YQAA 3OSGA 2ECCA 4F92B 1TWFJ 2LK2A 4RB3C 1SFUA 3OYFA 2H6CA 4FX4A 2UV1A 2PI0A 4X0GA 2DPDA 3KCCA 1DDNA 4RM2A 4Z2YA 1J7KA 4J19A 3GCMA 4M3DA 2WA0A 2LY1A 4MHGA 3ZQGA 4M3EA 3JCUC 1YOVB 3M8EA 2DA7A 3TOBA 3V7CA 4OOIA 5F04A 1U3EM 3E5QA 1KZHA 2RDPA 5ICGA 4A3MJ 5L3CA 1B72B 2BGCA 3TP0A 4BE1A 1H8AC 3ESWB 3MKZA 3AKZA 4GYGA 4ENNA 3CCJI 4CSWA 5B66C 3L2CA 2RQPA 1ETOA 3J7ZI 2H09A 1T0FC 5FD5A 1ON2A 3K4CA 1MBJA 4ON0A 3KZIC 4F52A 3W2AA 4A3DJ 1UCRA 2DK8A 2RGVA 1BI0A 1I5ZA 2F5VA 2L9RA 5C44J 4C2UA 1OCOH 4BU2A 5HDGA 5C4XJ 2M7BA 2EBIA 4HDUA 5F27A 3D5RC 2Y0MA 4CXFA 1BJAA 2P5LC 2FMLA 3JRFA 4IOAF 3CUQC 3OYIA 1V54H 4YRVA 1FOYA 9ANTA 3ABKH 3ZPLA 1IAWA 4IQ4A 1SD4A 1Z3YA 1FSHA 5KHDA 2BYVE 4JX6A 5IOZA 1OCCH 4NC8A 3PO2J 2GXGA 4BEHB 1YS6A 1WJ5A 2KHMA 4QPOA 2MABA 2VC0A 3GTKJ 2X51A 3KFWX 2GM4A 3GTPJ 3SZTA 1YX5A 2M7AA 2MSYA 2AXTC 3L2VA 2EZKA 2M4GA 2BY0A 3OV8A 3K9TA 2DT7B 1V5EA 2NOGA 2TDXA 3I3LA 2CUJA 1XSVA 4XLEA 2RNJA 2YU9J 3F8FA 4XN3A 1Y0UA 1IZ1A 3HRUA 4FETA 1QQIA 3MEXA 5DCFA 2ZJQF 3HUGB 3A2KA 2CG4A 5FKNA 3TDUC 1D1BA 1BN5A 3U9GA 1ETXA 2F4IA 2HKOA 5D6FA 3WGHA 2B9SA 2CH0A 2DA1A 2KJCA 3KP4A 3I4MJ 2LG4A 4N4NB 2M9HA 2HPIA 2M8GX 2OCEA 3HM5A 1GVJA 1WJAA 4I99C 4PK4A 3IWZA 4H4KC 5KVRA 1KQ8A 1IGNA 2I10A 1XGOA 2ICWG 2JSPA 2H8RA 2WTEA 3ML6A 3J81Z 4JBAA 4XQFA 2XROA 2W85A 4ESJA 2MD5A 3VEPA 2RREA 4XMYA 5HS8A 1R7JA 2VJJA 3PNTA 1MJBA 3CUQB 4U7BA 2CV0A 3PQKA 4A0YA 4Y13A 3QPSA 3JRBA 2KQRA 3HDDA 3HRMA 3KEQA 1Q1HA 1ZGAA 1SFXA 3EDPA 3WG9A 1DPUA 3PSIA 4LIUA 2EIMH 3S3NA 4LFUA 3JTGA 2BHYA 4IHSA 4F91B 2ZXWH 1X1BA 2CQKA 3J7YJ 1J0RA 3PUBA 4B3XA 3S14J 4A3BJ 2QCOA 3I55I 1LJ9A 3BPXA 3S3MA 3JSPA 4D5CA 3PIOF 1EF4A 1CF7B 2X6WA 1WVRA 3H92A 3V8KA 2E1CA 2YU3A 3BZ6A 1JUPA 4XLHA 1ZLKA 2VPLA 3HPHA 2PBIA 2O03A 2VL8A 4MQ9F 4XRFA 5J6XA 5CPRB 3E6DA 3KLOA 1OKRA 3OIOA 3JAMK 2QEXI 1AA7A 2RN7A 3HOSA 1LDDA 3C7JA 3TDZC 3MQ0A 4C9YA 2GQQA 2ECBA 2L5QA 3IRQA 3CC4I 3I64A 5C4JJ 1T56A 3DF8A 3MVPA 2HOSA 3HEFA 5EEGA 1IJWC 2R7WA 2V7FA 2EV6A 4HQMA 3ELKA 1Z05A 1U2WA 2J5PA 2I5UA 1DU0A 5D5UB 3BR3A 1LEBA 2O6GE 2ZXIA 3I0TA 1TQPA 1GLNA 3VYSB 3SEQA 5K7FA 3QPHA 1HDDC 1HW5A 2CQ7A 3N4MA 4XKVA 2F48A 2X4HA 5KAIC 1L0OC 3L09A 2E2IJ 5HODA 4OAYA 3PUFA 1JTYA 2PJRA 4Y52J 4AU7A 4FE4A 1QA6A 4I2OA 3ISPA 3ZCOA 5DV5A 1ZREA 4XK4A 3E5UA 3WGGA 5D8KB 2DXIA 2GLOA 3PJRA 2Z1DA 4IPAA 2GA1A 1MDMA 2E71A 2V4JC 1MJ9A 3OYGA 4BHCA 3HG9A 4KN7X 4KT5C 5CVVA 3T5XA 3JRIA 1BM9A 4BXFA 4L9JA 5IYCJ 4E70A 4RA2A 4E4HA 1MW7A 4A5MA 5HLTA 2VLAA 4LB5A 1TQMA 5HNFA 1G6NA 3N05A 2Z9OA 2HGCA 3H3ZA 5BS6A 4AWXB 3QOEA 4IXAA 2FQ3A 1G59A 2E1OA 3Q3SA 4LD5A 5EEAA 1SD5A 1YG2A 2P7CB 1J5YA 2YUSA 4RAGA 5EG0A 2KRFA 2DOAA 2K85A 4ZYEA 3IHUA 1RPWA 2K02A 1APLC 5JHFA 3H5AA 2HDDA 3C2GA 2KFDA 1W5CC 3DPUA 4R8HA 2A6EF 3H0DA 3U21A 2M0MA 4D9JA 1BOAA 1HKTA 3K10A 2HDWA 4C3IJ 3FHZA 3HRSA 4B44A 2DA2A 3C2HA 4KICA 3W3CA 3S1QJ 1SAXA 2QBYA 3WGIA 3ZN1A 3TKYA 4GO1A 4LITA 4Y17A 4LG3A 4HF1A 2R7TA 2FOWA 5IP9J 5E79C 1EH7A 2CWEA 1UELB 3K4BA 1IXSB 2MC4A 3COAC 2R7XA 4AD9A 2NAZA 3A1YA 2A5WA 4EEFG 2ZO4A 5LRSA 1ZTRA 2A5YB 2P8TA 1I50J 4EJTA 3AG3H 3I58A 2XB0X 5HDNA 1N78A 4PJNA 1YE9A 3LSRA 2VKHA 3QRFF 1JT6A 4RGXA 5JLWA 2PX9A 4HX7A 2M0CA 1IW7F 3FK7A 1FTTA 4XR6A 3C2BA 5JI6A 2LKPA 1HSJA 2XAFA 1FOWA 4C3JJ 2E5NA 4L18B 3BCBA 5DYMA 3WTVC 1TWAJ 3S93A 5M5XJ 1HKSA 3BR6A 3EQLF 2VIXA 3CCVI 1PVEA 2GOMA 1SVLA 2ZC2A 2E36A 2V1XA 4U0WA 2CV1A 1XGNA 2NYXA 1QBJA 3EYIA 1P6RA 3SDBA 3IH3A 4XOPA 2P5KA 3Q9VA 2DBBA 4B1RA 1BI2A 2XKOA 2FD5A 2L02A 2QVOA 2ZMEA 4PGGA 1AHDP 1N77A 4FE7A 1RUNA 5HVQC 1ETWA 1QZEA 3VWBA 3FKIJ 1Z3XA 4BYYA 4ZZDA 2E2HJ 2EIKH 5DCMA 1U8BA 2XGEA 3SFZA 3W2WA 2V9KA 3NEUA 4A3JJ 1JKPC 5DS9A 5J47A 4PSWA 3AFHA 4EV0A 1KGSA 3MN2A 1NG6A 3OIQA 3HL2A 1BW5A 3M4OJ 1JXSA 4P9FA 3M3YJ 1STZA 5ILSA 3ASOH 1R1VA 3WTTC 5DTDA 2MFZA 1R22A 3MFKA 3O8GA 3A0BC 1XS9A 1DU6A 2ESHA 1S7OA 3G3ZA 3DTIA 3HSRA 3TEDA 2EWNA 1MMDA 2M3AA 3ZMZA 1FZPB 1SFKA 2VOOA 3OOUA 2FE3A 4PFOA 1MDMB 1EJ9A 3JRCA 1KU7A 1OFCX 4HNVA 4A12A 2ELHA 2EQRA 4I6ZA 1QRYA 3CCMI 3KEYA 3OYBA 3RQIA 2K3FA 3BP8A 2DFFA 1VQ7I 1W1WE 2NS7A 2XRNA 2VQHA 2R5ZA 5E1ZB 1F9NA 3S3OA 3CO6C 4UUTA 4ZYHA 3KYDB 3BG9A 4ZZLA 1ZRCA 1XC5A 3GMEA 3MZ8A 4BJ6C 2BZTA 3RIRA 2EFNA 2FNPA 2HOAA 1UZCA 2CGPA 3IRRA 3RZDJ 3OY9A 2HQNA 5EG0B 2K27A 2XAUA 2QA4I 5BMZA 5LEJA 4WXDA 3ERED 3HZJA 1G4DA 4CHUA 4LB6B 5F0CA 1KU3A 3KLNA 1WJFA 4A0XA 4A3FJ 4HF2A 4ABZA 2STWA 2DI3A 3GVAA 4KIGA 5CQGA 4G9YA 2EFWA 3QU3A 2NS8A 4RGRA 1R1UA 4M72A 1V55H 2G9WA 2ZMEC 5FLXZ 1EH6A 3GXOA 1GDTA 3S2WA 4A3EJ 2F5CA 4AVPA 4HV6A 2BVLA 4JX5A 3ASNH 2VJIA 4KISA 3DXJF 3MZHA 1J9IA 3FXRA 3ZQFA 4EVIA 1ZGWA 2ZFWA 3E6BA 2EB7A 3IP4B 2CW8A 4HOBA 4Q48A 1POGA 1UB9A 3GTJJ 3DKXA 4IHYA 2OAZA 2K9MA 2IAIA 2IGMA 1YHQI 2CW7A 4C2TA 2H27A 3GZ5A 4HX8A 2QSHX 3K2AA 2R3SA 1QPMA 3GTMJ 1QNTA 3EETA 1TTYA 2HR3A 1B72A 2V1DA 3ZMSA 2CQXA 1Z0XA 1D1CA 4YFXF 1WPKA 3HSEA 3K1NA 1BJZA 3V42A 4E7JA 3I9V2 3WTSC 2ZNZA 1FIPA 2KMUA 4I7HA 1IXCA 2RAEA 3BWGA 3J80Z 1GUUA 2ME6A 1OCRH 2XASA 1WH7A 1N75A 2V1NA 4D7NA 1OJLA 1SAUA 2K9SA 3OYKA 2E34A 1T2KA 4BXXJ 1IV6A 2DTZA 4YELA 4HNTA 4C3HJ 1FSEA 2ZMEB 3CCSI 4BGDA 2F4OB 4E7KA 2LVSA 3QP6A 3G6EI 2HXOA 2D1VA 1ULYA 2EINH 2V9VA 5DCMB 1NTCA 3BZKA 4MTDA 1RKTA 2ZB9A 4L9NA 3RCOA 4BEHA 4PFPA 3DV8A 1BC7C 3Q0WA 2CV2A 1RUOA 3FMQA 2ME0A 3SZGA 5M5WJ 3BTJA 1XG1A 1O3RA 1FOXA 3H0GJ 4JYKA 1O4XA 2VT3A 3BG7A 1OPCA 3H9GA 2MH2A 1UG2A 1MNMC 3K4LA 2FXAA 3RTRA 3S16J 2VQLA 5K5RA 2DDBA 4FASD 2Z3YA 2XF6A 3O8HA 5JFRA 1JT0A 3VYTB 5D5WB 4KITB 1BA5A 1YX3A 3FXQA 1YW9A 1KU2A 4UVCA 3CDIA 1QHGA 1G2HA 1RR7A 2JPCA 4XLFA 2NVQJ 4V2FA 3WU1B 1BL0A 1Y8RB 4GCVA 2KRHA 3IL2A 2R7ZJ 1E0EA 4IOCF 4DBRA 1B8IB 5K5OA 4RS8A 2DA6A 2XGXA 1XDUA 1PJRA 2XV4S 2YPRA 2LOOA 2WWYA 5JVGF 2R5ZB 4KN4X 2VJ4A 5FRNA 3FMRA 3WODF 1MMGA 2Z33A 2DFHA 3GO5A 3D5SC 4PDKA 3K2ZA 2ZBKA 3L00A 2F2EA 2GZWA
chains in the Genus database with same CATH topology
4NQWB 4BACA 2HPIA 2ZFUA 3DWLE 1WJAA 2FUG2 2DJIA 3IAM2 4XKWA 4PK4A 2L7KA 4H4KC 2ZXHA 2R7SA 3TL4X 2JSPA 2VJ5A 4E7SA 4HG2A 1TZLA 3GBGA 3SEZA 4ZTFA 2R7VA 4XQFA 1P9QC 1J09A 4XM3A 1JI8A 2RREA 4XMYA 1X19A 2VJJA 3PNTA 3D5LA 1HA8A 1MNEA 4J00A 1ZELA 4U7BA 2L2OA 2CV0A 2ZSIB 2KQRA 2NOJB 1Z21A 3OYLA 3MMYB 3ZR8X 1MMNA 3LL7A 4KT6A 1FMVA 1T95A 2LRDA 2Z16A 2WADA 3PSIA 4LIUA 3S3NA 3LSIA 1X1DA 3H5NA 4BQNA 5CQEA 4F91B 2KL4A 1X1BA 3PNVA 4HSTA 2P0WA 3PUBA 3S32A 4B3XA 4BQOA 2V26A 2XSJC 2LBFB 3OS0A 3KYLA 3S3MA 4ZDOA 3FKJA 1Y6IA 3VYUB 2WAFA 2X6WA 1BOBA 4ANJA 2HU9A 4XLHA 3ONQA 2CMPA 3DU5A 4CCLA 5KCMA 5HNHA 1W36C 2VPLA 3HPHA 2VL8A 5CPRB 3ZRGA 3OYEA 4NC7A 1AA7A 1DQUA 4PJLA 3HOSA 4BJ5C 4C9YA 3FDYA 2L5QA 3CJQB 3OIPA 3UR3C 3CP8A 2CUZA 2VXZA 3OL4A 3PFYA 4G6TB 1IRXA 4E6KG 2XF7A 4BQQA 3FBIB 4JOMA 2R7WA 2V7FA 4XLAA 3VDXA 3CZ6A 4DGWB 2OV7A 3OYMA 3HPGA 1BR2A 3DTEA 1UG0A 1WJCA 1QHHD 2ZXIA 3VYSB 1GLNA 3SEQA 3H9QA 4II2A 2HVSA 1G8XA 1X1CA 2WY8Q 4XKVA 2X6XA 4BDYA 2O5RA 2PMZA 4KJZA 4OAYA 4XLCA 3CESA 5LFAA 2PJRA 4AU7A 1DGWY 2XC7A 4BUPA 3ZCOA 1VZ0A 2KP6A 2OC6A 4DOZA 2DXIA 4PSXA 3OL3A 3PJRA 2Z1DA 3BLYA 3MKYB 2RQQA 2PJRB 2V4JC 3OYGA 3HG9A 2WAQA 2RNGA 1S9HA 3HOTA 5TGTA 4BXFA 3CF2A 4E4HA 1MW7A 3L2RA 5HLTA 1X4OA 2VLAA 2UWMA 2Y0SA 5HNFA 5KNLA 2HZDA 3L2UA 3N05A 4CCMA 1D1AA 2VKDA 3QOEA 4AYBA 1G59A 3EUAA 3RQ4A 2QKMB 3PL8A 3CJRB 3BC8A 3LSGA 2DOAA 2K9LA 4RM3A 3DKYA 5JHFA 3H5AA 3C2GA 3DPUA 3IUOA 3H0DA 3OYNA 1D0YA 1X4PA 2M0MA 3U21A 2LY2A 4ZJZA 4D9JA 1QU3A 3K10A 2HDWA 3DQVC 4ITVA 4LIVA 2BW3A 4PUSA 4HPQA 3VSLA 3C2HA 4B44A 3W3CA 1D0ZA 3OYCA 2VB6A 3EPZA 2A6TA 4NUBA 4CUGA 3K70D 3TMOA 1W36D 4LITA 1WJEA 4GRIA 4LG3A 2QKLB 2R7TA 2GOXB 3J7AY 2VQGA 3K4BA 1UELB 2MC4A 2R7XA 3OYAA 3A1YA 2A5WA 1PYVA 4B47A 4N4OB 2IS2A 2W4SA 2V6EA 2X1CA 3E1SA 1N78A 4PJNA 1YE9A 3K70C 2VKHA 2HNHA 2KZVA 3A4CA 3OMYA 4XR6A 4HNUA 3AL0B 3OYDA 3H35A 2WY7Q 3M8JA 3L2QA 1WJDA 1D0XA 2E1MC 3OS1A 2E5NA 4HSRA 4XN0A 2UUZA 3BCBA 3LSHA 5LD2C 2HQAA 1K6YA 2VXDA 3LFUA 4JQFA 3S93A 2M4KA 2BVMA 2VIXA 1OLTA 3VSKA 1ERDA 2GOMA 3LMMA 3PSFA 2I8DA 2JUGA 2CV1A 4IZZA 3TBIA 1UAAA 3K4MA 3SDBA 4XOPA 3F9KA 3NWTA 4ZC3A 2X1EA 4RMNA 2L9NA 4P1WA 2KLOA 3FBNB 1EA3A 4RLFA 4ZYAA 3QYBA 1N77A 5HVQC 3VWBA 1Z3XA 2X6YA 4BL0B 4MLOA 3W2WA 2WAEA 2V9KA 3NWSA 3OYHA 3M1CA 3MKWB 3UNGC 2X1DA 3AFHA 4PSWA 2MYSA 2IXSA 2OUMA 3OIQA 1NG6A 1Z7LA 3HL2A 3OWTA 3ZXSA 4F55A 3CMMA 4AVZA 4E7HA 3K4JA 1MMAA 1OR7C 2LH9A 2MFZA 2WBMA 4XNFA 2R4GA 4D1QA 3DTIA 2IS6A 3RPUD 1MMDA 2M3AA 2KPMA 1BR1A 3HXLA 3QYEA 2Q2EB 1SFKA 4BE0A 4ZDPA 4IQJA 2IGOA 4BE2A 3OOUA 4PFOA 4QPQA 2JA2A 4CCKA 2VASA 3CP2A 4R79A 1V5FA 4PJJA 3ZQQA 3EUKL 2AQEA 4NNJA 4RLQA 4F3QA 3AL0C 3KEYA 3OYBA 4DIQA 3L2WA 4HRIA 3LSKA 2E1MB 4IKFA 2VQHA 3W2VA 3S3OA 4ZTJA 1LFPA 2E5ZA 3QODA 3DPLC 2L9SA 4ZDLA 4BJ6C 3BG6A 2BOLA 2R7OA 4XKCA 2Q1ZB 1Y56A 4F93B 1TT0A 1DP3A 3OY9A 3BCAA 4OAZA 1WJBA 2XAUA 3MD2A 2XF5A 2W82A 3S8PA 4PJMA 3K6GA 3DPTA 2K3PA 5HOOA 4CZCA 4J01A 1WJFA 2BW3B 3H5RA 2JVGA 3E0JB 5CQGA 4XOTA 1X1AA 3K4KA 2W00A 3HKZA 1R6RA 1KONA 1V5GA 2HVQA 2BVLA 2VJIA 2IGNA 4KISA 2IS1A 2IGKA 2R7RA 2W1OA 2JVHA 4B43A 3DTKA 2LREA 3SYTA 3H9JA 1DGRM 2LBFA 2KDOA 3KX2A 3IP4B 2CW8A 1U0JA 4F92B 4E7LA 3DKXA 3HC7A 4II3A 2K9MA 3OYFA 2IGMA 2UV1A 4XONA 2CW7A 4X0GA 4E7ZA 2HVRA 4C2TA 4RM2A 4CA0A 4XORA 3RSNA 4CCJA 2WA0A 2LY1A 2R7QA 1NG7A 4B48A 2IS4A 4OWRB 4U87A 1D1CA 3ZGKA 2XDVA 1BR4A 3FHNA 4BDZA 3OR1C 4BJTA 2DT6A 3DU6A 4C30A 3V42A 4DBQA 4BE1A 2X85A 4E7JA 3I9V2 3MKZA 2WB1A 2KMUA 3AKZA 4CSWA 3DEEA 3DLAA 3G2BA 4Y3OA 1N75A 2AQFA 2V1NA 2MD0A 1SAUA 2LYCA 1T0FC 2HPMA 3OYKA 2CS3A 3K4CA 4F52A 3W2AA 2LC2A 1MNDA 4YELA 4HNTA 2F5VA 4C2UA 3LSMA 4BU2A 4BGDA 4E7KA 2F6CA 4Y33A 2M7BA 4CCOA 3D5RC 3RCOA 4BEHA 2DCEA 2CFOA 4PFPA 2CV2A 3OYIA 3SZGA 4YRVA 3QYFA 4IQ4A 3IAS2 1Z3YA 2ELJA 2K5CA 5KHDA 3OR2C 3BG7A 3H9GA 4NC8A 2W7NA 2VQCA 4BEHB 1WFXA 1WJ5A 2KHMA 4QPOA 3K4LA 2MABA 1LDKB 4CH7A 3RTRA 2ZSHB 2X51A 4P5OA 4HEA2 2VQLA 3VYRB 1YX5A 2M7AA 2E60A 2XF6A 4FASD 3L2VA 4Y4RA 3VYTB 2M4GA 2R7UA 4EATA 4KITB 1YX3A 2DT7B 1V5EA 5FROA 4DJAA 3OYJA 3I3LA 1QHGA 4IX7A 5CKTA 2CUJA 2KRCA 4XLFA 4XLEA 1LVKA 3PNYA 4BS9A 1E0EA 2KRHA 4XN3A 1LKXA 4DBRA 1FMWA 4FETA 1PJRA 2Z2SB 3HUGB 4CCNA 3A2KA 2LOOA 1D1BA 4E7IA 2F4IA 3K4NA 5FRMA 2VJ4A 5FRNA 1MMGA 4YEJA 3OS2A 4XL9A 2CH0A 3D5SC 2LG4A 4XKBA 3EUHC 4N4NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5N A;  2DOA A; 
#chains in the Genus database with same CATH topology
 4NQW B;  1E3H A;  1SAN A;  1X1P A;  4BAC A;  2ZFU A;  4UXN A;  5IYB J;  4MFD A;  1H9T A;  2V79 A;  2R7S A;  3TL4 X;  1LFB A;  2VUM J;  3BR0 A;  3HBL A;  1P92 A;  1TZL A;  1XD7 A;  5IT9 K;  4RAF A;  3SEZ A;  3KP5 A;  4ZTF A;  1Z9C A;  1RI7 A;  1XSX A;  4L5E A;  2E1N A;  1S6L A;  1R36 A;  2LFB A;  1D8J A;  1TWG J;  2DPU A;  2Z5U A;  2JJ7 A;  3F8B A;  2NNN A;  1UFM A;  2JMW A;  2EA2 A;  2L9V A;  2NOJ B;  2DQL A;  1W7P A;  1Z21 A;  4A93 J;  3GZN B;  3MMY B;  3X2Q H;  3LL7 A;  1FMV A;  2Z16 A;  3IH4 A;  5IY5 H;  1ORK A;  2FQ4 A;  2L7Z A;  1ETV A;  2X48 A;  4RGS A;  2DA3 A;  5J1R A;  3IKT A;  5CQE A;  2VON A;  2KL4 A;  2A6H F;  1CF7 A;  2M8E A;  4LMY A;  5M3F J;  1IUY A;  2W25 A;  2V26 A;  2XSJ C;  3OS0 A;  4ZDO A;  3FKJ A;  1Y6I A;  3VYU B;  3G73 A;  2WAF A;  4XIC A;  1YFH A;  1AU7 A;  1A5J A;  4WWC A;  5FGM A;  4A3L J;  3SQN A;  1IG7 A;  2XAQ A;  2ZCW A;  4UUS A;  1W36 C;  5L3F A;  2DW4 A;  1R5I D;  1HBX G;  4NC7 A;  2DMT A;  3JR9 A;  3GTG J;  1DQU A;  1M1E B;  3EYY A;  5F08 A;  3FDY A;  3CJQ B;  2LKX A;  4B8X A;  5EZG A;  4OIR F;  4IHW A;  1ZHF A;  2WC2 A;  2CUZ A;  3CP8 A;  3PFY A;  3CO7 C;  4DYQ A;  3LFK A;  5AIQ A;  1IRX A;  5J1U A;  2C6Y A;  4EM2 A;  3K7A J;  1H89 C;  3E6M A;  4BQQ A;  1MSF C;  3FBI B;  4JOM A;  1VQO I;  3VDX A;  4EJV A;  4G94 A;  3FXJ A;  3UKG A;  1X2N A;  3HPG A;  1HW1 A;  2EV0 A;  4XRS A;  1UG0 A;  1T6S A;  1W7P D;  2FNA A;  2HTJ A;  5LGU A;  1QHH D;  2IA0 A;  1S5L C;  4Q5S F;  4BXU A;  2MC3 A;  3VOD A;  2D5V A;  2HVS A;  1G8X A;  1X1C A;  3PQJ A;  3SJM A;  2DMN A;  5EGO A;  2JA5 J;  3R0A A;  1G3W A;  2O5R A;  4IF4 A;  4UV8 A;  2B7E A;  2PMZ A;  3A03 A;  4QWQ A;  4XLC A;  3CES A;  5EDN A;  5LFA A;  4A3I J;  1K4S A;  4MQV A;  4IHX A;  2LP0 A;  1P7I A;  3D1N I;  1JHF A;  3KZY A;  1EKE A;  2KP6 A;  1OCP A;  2HFH A;  4DOZ A;  3H1C A;  3TQN A;  2Q2E A;  3BZC A;  2DYR H;  3CCR I;  3I59 B;  3TO9 A;  2FMY A;  3L1P A;  5EF6 A;  3R60 A;  4RGU A;  4ENJ A;  2EK5 A;  4OIP F;  1KYW A;  3C3W A;  3FXU A;  2JSC A;  3CF2 A;  3ABM H;  3HOV J;  5K5Q A;  1MBE A;  2OJE D;  2VBY A;  3JTH A;  1MBG A;  3I4P A;  3ABT A;  5JVT A;  1Q1V A;  1JKR C;  1K79 A;  5F1R A;  2VC1 A;  4ESB A;  2V1U A;  1J59 A;  4UV9 A;  5GTI C;  2NNY A;  2EFQ A;  2DTR A;  4AYB A;  3QP5 A;  2HQ5 A;  3V7R A;  3RQ4 A;  1X3U A;  4NC6 A;  1YIT I;  3CJR B;  5AON A;  3LSG A;  1UMQ A;  4XBF A;  2K9L A;  2LLK A;  1TL8 A;  5DUI A;  2Y30 A;  4BQA A;  3JSO A;  3WU0 A;  4CGZ A;  4BBS J;  1W5T A;  2LY2 A;  2OQG A;  5CVJ A;  4WK8 F;  3Q0V A;  1N25 A;  4RBO A;  4L0Z B;  1T38 A;  1RET A;  3DQV C;  2A68 F;  1YJ9 I;  2PMH A;  4UB8 C;  1MIJ A;  3BQZ A;  4LOC A;  2A07 F;  4C2M J;  2BY2 A;  5EZH A;  5IP7 J;  1E3P A;  3J81 K;  4NUB A;  4DYR A;  4QIW N;  4CUG A;  1HCR A;  3TMO A;  3VFZ A;  5IT3 A;  3C18 A;  5LHH A;  3MKL A;  2PN6 A;  1W7P B;  1X3W B;  1XN7 A;  4CZZ A;  1IN6 A;  2H6B A;  1ITY A;  3ZMU A;  2DMQ A;  2CFX A;  3OOP A;  1FNN A;  1X2M A;  4BHP A;  3OYA A;  4BNC A;  3FZV A;  2P6T A;  4P9U A;  1FP1 D;  2IS2 A;  2W4S A;  4DYC A;  3RKX A;  2IJL A;  2V6E A;  2X1C A;  3BRO A;  2HQR A;  2FBH A;  1G3T A;  1OQY A;  3BY6 A;  3E7L A;  1FT9 A;  1BIA A;  4UUS B;  4YG2 F;  1B6A A;  1QZY A;  3WG7 H;  3GEZ A;  1FJL A;  2E1M C;  5HLG A;  4MEY F;  3ZMT A;  1JKQ C;  3LSH A;  3KP2 A;  2O9L A;  1K6Y A;  2VXD A;  3MAJ A;  4JQF A;  5GAH J;  3CTA A;  2OTL I;  5BPI A;  2KZG A;  4X6A J;  4KMU X;  1ERD A;  3LMM A;  4WXC A;  3GLX A;  1PDN C;  2COB A;  1FYK A;  2L4M A;  5GAG J;  2P5V A;  2CYY A;  4RMN A;  4P1W A;  3BG5 A;  2KLO A;  4NBQ A;  4ZYA A;  1GV2 A;  1Z6T A;  2MW8 A;  2IEK A;  4BKX A;  4B3A A;  2X6Y A;  4DQ2 A;  2WAE A;  3CDH A;  2D2W A;  3OYH A;  3MKW B;  5EGO B;  3UNG C;  2LDU A;  2X1D A;  1GT0 C;  1LVA A;  1Z7L A;  1A36 A;  5FD6 A;  3ZXS A;  1AWC A;  4F55 A;  1HLV A;  3BT9 A;  1OMI A;  5FKL A;  4E7H A;  1SVM A;  4HW0 A;  1SD7 A;  2LH9 A;  3V8L A;  4L5I A;  4ENK A;  1IF1 A;  1MBH A;  3P5J A;  2IS6 A;  2FOK A;  2KPM A;  1JTX A;  3QYE A;  2Q2E B;  4ZDP A;  1VTN C;  4IQJ A;  1R00 A;  1ZAR A;  1A6Q A;  2AO9 A;  2W57 A;  2EZI A;  4JX4 A;  4CCK A;  1HF0 A;  3ERM A;  5IPA A;  3S15 J;  2MH9 A;  4W97 A;  4HRI A;  3LSK A;  2E1M B;  4KNY A;  5A2Q Z;  1ON1 A;  3W2V A;  1B9M A;  1LFP A;  5FFZ A;  4G7H F;  3QOD A;  2L9S A;  1PUE E;  3CC2 I;  1O57 A;  2Z99 A;  3HOY J;  2FBI A;  2BV6 A;  3FXL A;  4XKC A;  5DM6 F;  2JZY A;  2KIM A;  2Q1Z B;  5H6Q A;  4EJW A;  1TT0 A;  1KA8 A;  2IBD A;  3FIW A;  4BAY A;  1DP3 A;  4N9H A;  2BY3 A;  3BCA A;  5FKM A;  4CO8 A;  2H8W A;  5FLM J;  4HBL A;  1PP7 U;  3R6S A;  2XF5 A;  5D5V B;  2ACJ A;  2KDZ A;  2K9Q A;  2W24 A;  1KQ9 A;  3HOU J;  3AG2 H;  3DPT A;  2K3P A;  4U7D A;  3IWF A;  2ID3 A;  4AIJ A;  1G3S A;  2RC4 A;  3PM1 A;  2G7H A;  3K4K A;  2W00 A;  2H1L A;  5E1X A;  2JA8 J;  2QSG X;  3F8M A;  3HKZ A;  1L3L A;  2K40 A;  1FYM A;  1KON A;  3P7N A;  1SMY F;  3RKQ A;  4KUM A;  1KYZ A;  2HVQ A;  2NVT J;  1AOY A;  4G6D A;  2IGN A;  1P4X A;  3ABL H;  2IGK A;  2KIQ A;  4EJO A;  4B43 A;  2VT2 A;  4M9Z A;  2MGQ A;  3A01 A;  3SYT A;  3H9J A;  2LBF A;  2ZNY A;  2ZKZ A;  3FXM A;  3T1B A;  3B6C A;  1U0J A;  2A69 F;  4E7L A;  2V9P A;  3O3K A;  3HC7 A;  4II3 A;  5E3L A;  2AXL A;  4XON A;  1VQ5 I;  2HVR A;  4GXO A;  4QTR A;  2KIS A;  2OQR A;  3SXY A;  1ZYR F;  1TWH J;  4XOR A;  4M9X A;  2FU4 A;  4CCJ A;  4EMS A;  2R7Q A;  1NG7 A;  1QO0 D;  4B48 A;  4EM0 B;  2IS4 A;  4U87 A;  3QU6 A;  1K78 B;  3EUH A;  3ZGK A;  5AIP A;  3OR1 C;  4BJT A;  4HYE A;  4OIO F;  3B02 A;  1K4T A;  1GVD A;  3DU6 A;  2ZXJ A;  4C30 A;  3D0S A;  1ETY A;  4LG0 B;  2CRG A;  2WB1 A;  1RNL A;  3VPR A;  4I76 A;  4A3K J;  3QAH A;  3CJN A;  3DEE A;  1HST A;  3HOZ J;  4Y3O A;  5B5E C;  2AQF A;  3ROU A;  4YIR X;  2MD0 A;  2LYC A;  5H20 A;  2K7L A;  3N97 A;  2HPM A;  4OIQ F;  1HQC A;  2LSO A;  4P55 A;  1HXD A;  2LC2 A;  4L9T A;  1R49 A;  1YIO A;  1LFU P;  5CVR A;  2VE8 A;  3LSM A;  4UY8 I;  2FEZ A;  5FLV A;  2F6C A;  4Y33 A;  2CQN A;  2DMP A;  3T8R A;  4Y7N J;  1ZRF A;  1F36 A;  3R0J A;  1WI9 A;  3BJO A;  1LQ1 A;  2CFO A;  1ZKG A;  5E3M A;  3TW6 A;  5J4V A;  1SMT A;  3QYF A;  3IAS 2;  4M3B A;  3M8F A;  3OR2 C;  4A5N A;  1S29 A;  2W7N A;  2VQC A;  5EEH A;  3NAU A;  1FBS A;  1LDK B;  4CH7 A;  2ZSH B;  4O5V A;  5M3M J;  4P5O A;  2XGD A;  1ZG3 A;  2VPR A;  5LGN A;  2QWW A;  2DMU A;  3S17 J;  1ONV A;  4Y4R A;  4AIK A;  2R7D A;  4EAT A;  4NDL A;  1MSE C;  1B8I A;  1FYL A;  2ZJR F;  2L01 A;  3BTL A;  2EZL A;  2M87 A;  2QZ8 A;  5IOY A;  1W0T A;  4UNO A;  2LY9 A;  4BS9 A;  1LVK A;  2ESN A;  4A6D A;  1FX7 A;  1LKX A;  3NRV A;  4QSH A;  2Q8K A;  4ETS A;  1R4M B;  4CCN A;  3R61 A;  2VBW A;  2L4A A;  3BJ6 A;  4NQW A;  3K4N A;  5FRM A;  4I09 A;  1MD0 A;  3H3V K;  1MBK A;  3KP3 A;  3OS2 A;  4XL9 A;  2RKH A;  1W4M A;  3CCE I;  1JE8 A;  1XTA A;  2BXZ A;  3EUH C;  2PLY A;  2MG4 A;  2UXN A;  1V3F A;  3KIO A;  3M7G A;  3HGY A;  3KE2 A;  3P9K A;  2R7F A;  5K1Y A;  1I39 A;  2DT5 A;  4XRM A;  4MNU A;  2EPF A;  2ZXH A;  2QYO A;  1TNT A;  3F6V A;  2VJ5 A;  4HF0 A;  4CDG A;  3JRD A;  4YFN F;  4HG2 A;  1OCT C;  4NHJ A;  3G1O A;  4KFC A;  3E3V A;  2R7V A;  4XSX F;  1P9Q C;  1J09 A;  4XM3 A;  3B6A A;  2DAO A;  1JJ6 C;  3U2R A;  3IV5 A;  1MGT A;  1R4N B;  1X19 A;  2PMZ N;  3D5L A;  4RB0 A;  4BH9 A;  3S2H J;  2L2O A;  2Q0O A;  5E20 A;  1HW2 A;  1LEA A;  3LAJ A;  4ASN A;  1D5Y A;  1MMN A;  4KT6 A;  1T95 A;  1IN5 A;  2WAD A;  3LSI A;  1X1D A;  4LK1 F;  3R4K A;  1I3Q J;  2BHZ A;  2P7V B;  3LA2 A;  3U1K A;  1XSD A;  2M45 A;  3PNV A;  2L54 A;  4HST A;  5CLS A;  4L9V A;  3S32 A;  2DOD A;  2P6S A;  5DD4 A;  3ABU A;  1XPX A;  3A01 B;  3B73 A;  2DLL A;  2LBF B;  2G7U A;  3RKY A;  1USS A;  1IDY A;  2XB5 A;  4WX9 A;  2GXB A;  1Y1V J;  5F0F A;  4AUX A;  2HU9 A;  1H0M A;  5J8F A;  2CO5 A;  2CMP A;  2QQ8 A;  3DU5 A;  3Q9S A;  4AYB N;  4XID A;  2KIU A;  4S0H B;  5HNH A;  5E18 F;  1LB2 A;  4B4C A;  5ICC A;  3G1L A;  3QPL A;  3ZRG A;  3OYE A;  2XVC A;  1FP2 A;  4PJL A;  2GXA A;  2P4W A;  1F43 A;  1QZZ A;  1EH8 A;  1LNW A;  3OIP A;  3CQZ J;  1BI3 A;  1F4K A;  3OL4 A;  5BNG A;  3IC7 A;  1SVO A;  3CCL I;  5DUK A;  2ETH A;  4G6Q A;  4MGR A;  3QOP A;  3JW4 A;  4V19 K;  2Y48 A;  3WE3 A;  2NS0 A;  3CZ6 A;  4DGW B;  3OYM A;  2STT A;  1J75 A;  3DTE A;  4M9S A;  1VQL I;  5BQT A;  2M5W A;  1XX5 A;  1Y8Q B;  5FJ8 J;  1A04 A;  1Z1D A;  3J80 K;  5ILV A;  1TLH B;  1EV7 A;  3CJT B;  3H9Q A;  3CD6 I;  5HLH A;  4ENM A;  3CCY A;  3FM5 A;  4II2 A;  2HYJ A;  2G0E A;  1TW2 A;  2JN6 A;  2WY8 Q;  1DUX C;  1LDJ A;  4DW6 A;  2FBK A;  1FBQ A;  1IXR C;  4YII A;  3IH2 A;  5IP6 A;  1U8R A;  5GPA A;  2CUE A;  3MWM A;  1ZQ3 P;  5M5Y J;  2IA1 A;  2D1H A;  1B59 A;  2OZ6 A;  1IRF A;  3I59 A;  2E2J J;  1DGW Y;  1O3Q A;  2EFP A;  4BUP A;  2EJR A;  3JRH A;  1VZ0 A;  1R58 A;  2HZT A;  2IP2 A;  4IRH A;  2BBY A;  2X9D A;  1PUF A;  3WHB A;  2QM3 A;  1HC8 A;  1XDS A;  2JTV A;  2P81 A;  1BI1 A;  2RQQ A;  3GFI A;  2EFO A;  5TIS C;  3G1M A;  2WAQ A;  4A6E A;  1S9H A;  3BR5 A;  3SDG A;  3DP7 A;  1KU9 A;  3E97 A;  2ADU A;  1UHW A;  1X4O A;  2M1B A;  2JA7 J;  2UWM A;  2VI6 A;  2O61 A;  2Y0S A;  2CU7 A;  3L2U A;  1O3T A;  4CCM A;  1D1A A;  3TO7 A;  2DFI A;  1YI2 I;  1S3J A;  5LLQ A;  2QSF X;  3EUA A;  2AS5 F;  4KA4 A;  4V2G A;  5L3D A;  1DP7 P;  3HOX J;  1PP8 F;  4R1H A;  2QKM B;  1XGS A;  3BC8 A;  3TOA A;  3CLQ A;  2QUF A;  3I71 A;  4RM3 A;  4DZJ A;  5HLI A;  1F5T A;  1JHH A;  3FXK A;  4BHB A;  3IUO A;  4D7M A;  1XGM A;  4IHV A;  1D0Y A;  1X4P A;  1D3Y A;  3GWZ A;  4ZJZ A;  5JR3 A;  2ISZ A;  1QU3 A;  4ITV A;  1H88 C;  2BW3 A;  2CJJ A;  4PUS A;  4G7Z F;  4HPQ A;  3VSL A;  3M9A A;  5K7Z A;  4Y15 A;  3OYC A;  1Y39 A;  3KYC B;  1R23 A;  5J8C A;  2A6T A;  4UVA A;  2ZJP F;  3K70 D;  1RES A;  3GTO J;  1W36 D;  1OR7 A;  2W48 A;  1Z67 A;  3KP6 A;  1J2X A;  1W5S A;  1WJE A;  2MLK A;  3DCF A;  4I02 A;  3RDI A;  3A02 A;  2QKL B;  4LLN A;  2MLG A;  3J7A Y;  2VQG A;  5FB2 A;  5ICF A;  2QQ9 A;  1TBX A;  2L7M P;  2IRF G;  1PYV A;  2VKE A;  3IKV A;  1SFO J;  1GV5 A;  4B47 A;  2XUB A;  4BBR J;  2HDC A;  5FKK A;  1UHS A;  5CYV A;  4QLC U;  3K70 C;  2HOT A;  2GIZ A;  1ACI A;  2M30 A;  4I98 B;  3G4S I;  2KZV A;  1HKQ A;  1IRZ A;  3RPU A;  3ZN0 A;  3AL0 B;  2XPW A;  2DO7 A;  3HTS B;  3SZP A;  3T8T A;  2WY7 Q;  3I54 A;  2FA5 A;  3S1M J;  3M8J A;  1U5T A;  1RRJ A;  3L2Q A;  1WJD A;  3VOE A;  4LGW A;  3CDL A;  3GW2 A;  3BOQ A;  2H94 A;  1YTY A;  2E19 A;  3GTL J;  1I27 A;  3LFU A;  2DA4 A;  5DD8 A;  1OLT A;  2XRL A;  2LR8 A;  4FCY A;  2ELK A;  3VSK A;  1R5H A;  3BR2 A;  2I8D A;  2JUG A;  2L7F P;  2YX7 A;  4IZZ A;  5J40 A;  4FTH A;  2DJN A;  3K4M A;  1VQN I;  3F9K A;  3LNQ A;  1X58 A;  2L3D A;  2X1E A;  2LNB A;  3FM3 A;  1T08 B;  4KMF A;  1ZH5 A;  3K0L A;  3DBH B;  2EA4 A;  1QPI A;  1ZG1 A;  3HKZ N;  2VOP A;  3FBN B;  1EA3 A;  1F1Z A;  4RLF A;  3QYB A;  3GZ6 A;  4Q4Z F;  2O7O A;  1WKM A;  4BL0 B;  4UVB A;  1RZ4 A;  1V4R A;  1YW8 A;  3I56 I;  1XCV A;  5D8L B;  4HV5 A;  2FF4 A;  5GP9 A;  4AIH A;  1B1B A;  4HQE A;  2OUM A;  1ZGJ A;  3AG4 H;  3HJE A;  3CMM A;  2PFB A;  3K4J A;  5J4Y A;  1OR7 C;  4D1Q A;  2V6C A;  3RPU D;  2F4M B;  2OBP A;  5B1B H;  3REO A;  1PUF B;  1BR1 A;  3HTU A;  4RAZ A;  2KIF A;  1IN7 A;  3L9F A;  4X1E A;  4BE0 A;  1TP4 A;  2XIG A;  3ZQ7 A;  1FWZ A;  4A3G J;  1OCZ H;  2JA2 A;  4R79 A;  2VAS A;  3CP2 A;  3LST A;  3I4N J;  1V5F A;  3EUK L;  2XAJ A;  3GYH X;  1Z7U A;  3TO6 A;  2B0L A;  2GWR A;  1VQ9 I;  1P4W A;  5B1A H;  1WI3 A;  3MZY A;  3DPL C;  3H3U A;  2WB1 N;  3H36 A;  3JRA A;  2R5Y A;  3JRG A;  3BG6 A;  4RDU A;  4PJ0 C;  5GAE J;  1U5T C;  1U9O A;  1MZB A;  1I1S A;  2A05 A;  3JRE A;  1Y56 A;  4F93 B;  1ZG5 A;  3AAF A;  1U78 A;  4TV7 A;  4EGY A;  3FWE A;  4PZJ A;  4I01 A;  5F6F A;  4OAZ A;  2BY1 A;  2E7W A;  4MTE A;  1TC3 C;  3BDD A;  3DEU A;  5ICE A;  3S1R J;  3DBL B;  4KIF A;  1ZK8 A;  2UZK A;  5IYD J;  2W82 A;  4UHT A;  3S8P A;  2VOD A;  1VI0 A;  1Z77 A;  4N9I A;  1LE8 B;  2N8G A;  5HOO A;  4CZC A;  4J01 A;  2BW3 B;  4AC0 A;  3H5R A;  3CUO A;  3E0J B;  4U0V A;  4XOT A;  2JRM A;  3DEW A;  2OTJ I;  1X1A A;  3BPV A;  3GTQ J;  2VBX A;  3RYP A;  1R6R A;  5L3B A;  3Q5F A;  1V5G A;  1WWX A;  1E3O C;  2GA2 A;  4EGZ A;  2BE5 F;  4YFK F;  5DDG A;  2GIV A;  3GFL A;  3J7A O;  2IVM A;  3CME I;  3BQY A;  5H2F C;  2Y9Y A;  1ZR2 A;  4CYD A;  2R0Q C;  4MO7 A;  5LGT A;  5F1J A;  4W1U A;  2LRE A;  3LA7 A;  2PEX A;  2EH3 A;  2FSW A;  2KDO A;  3MCZ A;  3KX2 A;  3T0Y A;  1IN8 A;  3GFM A;  3F8N A;  3LOC A;  3PFI A;  2Y75 A;  1YLF A;  2AHQ A;  2KT0 A;  2X0L A;  3FXO A;  3L7W A;  3FK6 A;  4G7O F;  2FX0 A;  4E7Z A;  3JAM Z;  4L5J A;  1K78 A;  3DLL F;  2LD5 A;  4RAY A;  5ED4 A;  3RSN A;  2R92 J;  5CJ9 A;  4HA8 A;  3KET A;  4PCQ A;  4OWR B;  2DFE A;  2XDV A;  1BR4 A;  4LG0 A;  1UST A;  2MA3 A;  3FHN A;  1U5T B;  4BDZ A;  3P9I A;  4UB6 C;  2DT6 A;  4HZF A;  2JPB A;  1H9G A;  3DFG A;  4CYC A;  5HS9 A;  4DBQ A;  2X85 A;  3WTX C;  2DQR A;  3BG3 A;  2X6O A;  2NRA C;  4RB1 A;  1RR8 C;  2DDA A;  5ERI A;  2EV5 A;  3DLA A;  3G2B A;  2HEO A;  4D5F A;  1R5G A;  1DPR A;  1REP C;  3F72 A;  2HI3 A;  1VQ8 I;  2CS3 A;  5TJJ A;  1MND A;  4M3G A;  1T98 A;  1Y1W J;  1XCB A;  1K61 A;  2E7X A;  2ZJ2 A;  1XB4 A;  1ZAO A;  4CCO A;  3KPH A;  1MKM A;  1JJ8 C;  2DCE A;  4L0Y B;  2K4J A;  4P96 A;  1MH4 A;  5LBQ A;  4A0Z A;  4H0E A;  3WTW C;  5JHU A;  2ELJ A;  2K5C A;  3F23 A;  1P4A A;  2DN0 A;  3NQO A;  1GXQ A;  1E17 A;  1WFX A;  1VQP I;  5L3E A;  2F5E A;  4HX4 A;  5D6E A;  5E8G A;  4EQQ A;  4M74 A;  2F5F A;  4HEA 2;  3VYR B;  5KK1 A;  1B9N A;  2E60 A;  3HGG A;  2QEN A;  1YJW I;  2R7U A;  3ECH A;  2HYF A;  5FRO A;  4DJA A;  4FQG A;  2K4B A;  4LLG F;  3K1M A;  1JGG A;  1BC8 C;  3OYJ A;  4IX7 A;  2QLZ A;  5CKT A;  4FX0 A;  2KRC A;  1ETQ A;  3PNY A;  3HHG A;  4XRS G;  2XGC A;  1FMW A;  2Y31 A;  3V8J A;  1YIJ I;  2FRH A;  2MBF A;  2Z2S B;  2GBY A;  4MEX F;  4E7I A;  5J1Y A;  4XKB A;  5KAF C;  2HKX A;  2TRT A;  2D45 A;  4MFE A;  2BEO A;  4UUV A;  2R5Y B;  4YEJ A;  3NAR A;  5BOX A;  2E35 A;  5A2Q K;  5LRR A;  4CA0 A;  1TT5 B;  1RC9 A;  2DOF A;  5CVU A;  1QVT A;  3DWL E;  1XMA A;  4S05 A;  2FUG 2;  1R71 A;  3ZQL A;  4IHT A;  2DJI A;  2XAH A;  3IAM 2;  4XKW A;  2L7K A;  1IRG A;  1A35 A;  2ISY A;  3HYI A;  4E7S A;  1FPQ A;  2NVX J;  2OPT A;  2QQA A;  2TCT A;  3GBG A;  5D5X B;  3CF5 F;  2PJP A;  5LEK A;  5C3E J;  2VE9 A;  3RYR A;  4U88 A;  1JGS A;  5CVI A;  1JI8 A;  3GX4 X;  3GFJ A;  1HA8 A;  2JWT A;  1MNE A;  2DK5 A;  4J00 A;  2YR2 A;  2OCC H;  3G71 I;  1ZEL A;  1FC3 A;  2ZSI B;  1VF9 A;  4ZYD A;  4WCG A;  3PO3 J;  2XAG A;  4OMY A;  3OYL A;  3ZR8 X;  1E2X A;  2LRD A;  4I0A A;  1HDP A;  3GF2 A;  3SHF A;  3KEO A;  3H5N A;  4EJU A;  4BQN A;  1MBF A;  1U9N A;  5E8I A;  1T39 A;  2XKP A;  2WAQ N;  2P0W A;  3C1D A;  3WTY C;  4BQO A;  5DM7 F;  1RIO H;  1SFE A;  3KYL A;  1K83 J;  1T8I A;  4IRI A;  1UHM A;  2J5O A;  2Y0S N;  1BOB A;  3F0C A;  4ANJ A;  3BJA A;  1SC7 A;  3QPT A;  2HWV A;  4ZH4 F;  3ONQ A;  4BY7 J;  4CCL A;  1JKO C;  5KCM A;  5K7H A;  2HS5 A;  4HLX A;  2YX4 A;  4M6X A;  4O6J A;  5E1W A;  2DYS H;  2IT0 A;  1U6G A;  2K86 A;  1LPQ A;  1FBU A;  3LQR A;  4O3M A;  3LSJ A;  4WXH A;  4BJ5 C;  5LHG A;  4IJA A;  3S2D J;  5J3L A;  3UR3 C;  4AID A;  1IV8 A;  2VXZ A;  4G6T B;  3RJP A;  5F64 A;  4AM3 A;  3WE2 A;  1X3Z B;  4E6K G;  4CYC B;  1ETK A;  2XF7 A;  4B09 A;  3ZOB A;  3SFI A;  4M71 A;  3FIS A;  2JK3 A;  4XLA A;  5F0H A;  5H6R A;  2OV7 A;  1I3A A;  1BR2 A;  4JP0 A;  1CQT A;  2HXI A;  2LMD A;  5LHI A;  1WJC A;  2IW5 A;  3CCQ I;  4IRG A;  1C0W A;  3HOW J;  1TNS A;  1Z6R A;  5D4R A;  1K7A A;  3FX3 A;  1FLI A;  4FHT A;  1ZN2 A;  1WHU A;  2L0K A;  4ESF A;  3GLL A;  3V4G A;  4I0B A;  1VQ4 I;  1WSU A;  4OIN F;  2X6X A;  4A69 C;  4BDY A;  4M6V A;  4GFB A;  3ZQC A;  4KJZ A;  4PGH A;  3FF5 A;  3WTZ A;  3W6J B;  1I6X A;  3TP3 A;  3HHH A;  2PQ8 A;  4Q47 A;  3V7S A;  4OMZ A;  2XC7 A;  2CUF A;  5GTH C;  3K69 A;  3QQA A;  3KP7 A;  4IEJ A;  4NB5 A;  4K2E A;  6PAX A;  2OC6 A;  4HAM A;  4ZYG A;  1FEX A;  4PSX A;  3OL3 A;  3BLY A;  3MKY B;  2PJR B;  2JUC A;  2RNG A;  3HOT A;  5TGT A;  2GAU A;  3ZMV A;  4YIF A;  2LF8 A;  3RPQ A;  3M07 A;  2XPU A;  3L2R A;  2LF7 A;  2O8X A;  5E3N A;  5KNL A;  2HZD A;  2WV1 A;  2O3F A;  2VKD A;  2QQB A;  3ZQH A;  1SD6 A;  2EIJ H;  2JA6 J;  1KQ0 A;  1O3S A;  2ID6 A;  5HS7 A;  3PL8 A;  4OU0 A;  3ZP5 A;  2VBZ A;  1GXP A;  2JT1 A;  1TQI A;  2KKO A;  3BR1 A;  4Z6Y A;  4IO9 F;  3DKY A;  1D5V A;  1QGP A;  3FMS A;  3BTC A;  1AKH A;  5DEQ A;  1YW7 A;  3OYN A;  4KYW A;  2O0Y A;  3HSF A;  1NH3 A;  4JK1 X;  4LIV A;  1WZ2 A;  2NXN B;  3WHC A;  2BXY A;  1SEU A;  3E5X A;  1W0U A;  4XSZ F;  2F5D A;  2XPV A;  1CGP A;  1ZRD A;  1WH5 A;  1D0Z A;  3A0H C;  2QGU A;  2VB6 A;  5GPC A;  3EPZ A;  2JRT A;  4GGG A;  2YSR A;  3CCU I;  4EM1 A;  1VFC A;  1YRN A;  4XLN F;  1OIS A;  5FLX K;  1MH3 A;  1MJA A;  2XHK A;  4GRI A;  3QWL A;  3LWF A;  2QBY B;  4LK0 F;  2GOX B;  1R1T A;  1S8N A;  3CMA I;  5EJC A;  1I6H J;  1R9T J;  2LKS A;  2HTS A;  1YO5 C;  1K6O A;  5L3G A;  5EYR A;  3F3X A;  1A6I A;  3RI4 A;  1BW6 A;  4M6Y A;  4N4O B;  4A3C J;  1TWC J;  1NK3 P;  1VND A;  2IA2 A;  1OYI A;  1NK2 P;  3E1S A;  3CC7 I;  1Z91 A;  2DU9 A;  1OYY A;  5ILU A;  2YS9 A;  3W6V A;  5B3S H;  1QVU A;  5FKO A;  5FFX A;  3F22 A;  2HNH A;  3A4C A;  3OMY A;  2QF7 A;  3ZQI A;  4HNU A;  3OYD A;  3H35 A;  3F8C A;  3CMY A;  1IDZ A;  5TRD A;  3M1E A;  1D0X A;  3OS1 A;  2O8K A;  4HSR A;  4XN0 A;  2UUZ A;  3WU2 C;  2HQA A;  5LD2 C;  2M4K A;  4IL6 C;  2BVM A;  4KIB A;  1B4A A;  2M2E A;  2DA5 A;  4F7Z A;  3PSF A;  3O2P E;  2UXX A;  5HDK A;  2VN2 A;  3E6C C;  1FY7 A;  3TBI A;  3ECO A;  1Y0N A;  1UAA A;  4S04 A;  2R93 J;  1G3Y A;  4DNC A;  2LTP A;  3NWT A;  4ZC3 A;  4DZP A;  1IO2 A;  3TW7 A;  2L9N A;  4KDP A;  3AG1 H;  3BTI A;  4A2U A;  2COM A;  1I1G A;  2IPQ X;  2VKV A;  1P7J A;  5D4S A;  1VQ6 I;  1WRJ A;  4FIS A;  3LAP A;  4MLO A;  4HDV A;  3NWS A;  4M73 A;  5JLX A;  1LUJ B;  1O7F A;  1WQ2 A;  3M1C A;  1BBY A;  1VQK I;  2MYS A;  2IXS A;  4GYI A;  2PG4 A;  1IN4 A;  3OWT A;  3ZMD A;  1JUS A;  1HOM A;  3KZZ A;  2CQQ A;  1XMK A;  3DKW A;  4AVZ A;  5E17 F;  3I5U A;  1S7E A;  2Y9Z A;  1MMA A;  5FO5 A;  2A61 A;  2WBM A;  4XNF A;  1WGX A;  2R4G A;  3DBR B;  2JQ7 A;  1S7A A;  3HIF A;  1O7L A;  2Y2Z A;  3PIP F;  3S1N J;  2H1K A;  3HXL A;  3ULQ B;  1BIB A;  3W6K B;  2W84 A;  3LQQ A;  2IGO A;  4BE2 A;  1P2F A;  2HOE A;  4MIM A;  1RKW A;  2PMU A;  4LLL A;  5GAD J;  2OA4 A;  2RVC A;  4QPQ A;  1YJN I;  2CSO A;  3Q0U A;  4RB2 C;  3TGN A;  3WTU C;  2OU2 A;  3GUD A;  4PJJ A;  3ZQQ A;  2AQE A;  2KJB A;  4NNJ A;  4RLQ A;  4F3Q A;  3AL0 C;  2EZH A;  4IVN A;  4U0Y A;  1FIA A;  1YYV A;  4DIQ A;  3L2W A;  3HUG A;  2OD5 A;  4FT8 A;  4IKF A;  1S72 I;  3HRT A;  4ZTJ A;  1D8K A;  3K1P A;  4M3F A;  2XSD C;  2E5Z A;  5BPD A;  3U1D A;  4ZDL A;  2HYG D;  3F21 A;  1FOK A;  2BOL A;  1IUF A;  2R7O A;  2DOE A;  1ODD A;  4XLP F;  2CW0 F;  4LJZ F;  3LSP A;  5IT9 Z;  1T0F A;  3RZO J;  2OZU A;  1WJB A;  1LE8 A;  4D0P A;  1JUM A;  1ZR4 A;  3MD2 A;  2Y69 H;  1XMX A;  2A3S A;  4G8X A;  1FTZ A;  1AKH B;  3RKW A;  2NVU B;  3OSF A;  3I53 A;  3K6G A;  4PJM A;  1NHA A;  1ENH A;  2K9N A;  4CIC A;  2WV0 A;  2B63 J;  4BY1 J;  3F6O A;  3O6B B;  3CUQ A;  1IC8 A;  1YS7 A;  2JVG A;  2RV8 A;  4N0B A;  3LA3 A;  4GDF A;  3HB9 A;  1GHC A;  2OF7 A;  5E3O A;  1TW3 A;  1WCM J;  1OYW A;  2EIL H;  3CLO A;  1YRN B;  4WF2 A;  1MMS A;  2IS1 A;  2NVY J;  3P9C A;  3VB2 A;  2R7R A;  2JVH A;  2W1O A;  1T33 A;  1UJ8 A;  2M34 A;  1A31 A;  2FJ1 A;  3DTK A;  1VQM I;  4G12 A;  1DGR M;  1ZLJ A;  4HLY A;  1YQA A;  3OSG A;  2ECC A;  4F92 B;  1TWF J;  2LK2 A;  4RB3 C;  1SFU A;  3OYF A;  2H6C A;  4FX4 A;  2UV1 A;  2PI0 A;  4X0G A;  2DPD A;  3KCC A;  1DDN A;  4RM2 A;  4Z2Y A;  1J7K A;  4J19 A;  3GCM A;  4M3D A;  2WA0 A;  2LY1 A;  4MHG A;  3ZQG A;  4M3E A;  3JCU C;  1YOV B;  3M8E A;  2DA7 A;  3TOB A;  3V7C A;  4OOI A;  5F04 A;  1U3E M;  3E5Q A;  1KZH A;  2RDP A;  5ICG A;  4A3M J;  5L3C A;  1B72 B;  2BGC A;  3TP0 A;  4BE1 A;  1H8A C;  3ESW B;  3MKZ A;  3AKZ A;  4GYG A;  4ENN A;  3CCJ I;  4CSW A;  5B66 C;  3L2C A;  2RQP A;  1ETO A;  3J7Z I;  2H09 A;  1T0F C;  5FD5 A;  1ON2 A;  3K4C A;  1MBJ A;  4ON0 A;  3KZI C;  4F52 A;  3W2A A;  4A3D J;  1UCR A;  2DK8 A;  2RGV A;  1BI0 A;  1I5Z A;  2F5V A;  2L9R A;  5C44 J;  4C2U A;  1OCO H;  4BU2 A;  5HDG A;  5C4X J;  2M7B A;  2EBI A;  4HDU A;  5F27 A;  3D5R C;  2Y0M A;  4CXF A;  1BJA A;  2P5L C;  2FML A;  3JRF A;  4IOA F;  3CUQ C;  3OYI A;  1V54 H;  4YRV A;  1FOY A;  9ANT A;  3ABK H;  3ZPL A;  1IAW A;  4IQ4 A;  1SD4 A;  1Z3Y A;  1FSH A;  5KHD A;  2BYV E;  4JX6 A;  5IOZ A;  1OCC H;  4NC8 A;  3PO2 J;  2GXG A;  4BEH B;  1YS6 A;  1WJ5 A;  2KHM A;  4QPO A;  2MAB A;  2VC0 A;  3GTK J;  2X51 A;  3KFW X;  2GM4 A;  3GTP J;  3SZT A;  1YX5 A;  2M7A A;  2MSY A;  2AXT C;  3L2V A;  2EZK A;  2M4G A;  2BY0 A;  3OV8 A;  3K9T A;  2DT7 B;  1V5E A;  2NOG A;  2TDX A;  3I3L A;  2CUJ A;  1XSV A;  4XLE A;  2RNJ A;  2YU9 J;  3F8F A;  4XN3 A;  1Y0U A;  1IZ1 A;  3HRU A;  4FET A;  1QQI A;  3MEX A;  5DCF A;  2ZJQ F;  3HUG B;  3A2K A;  2CG4 A;  5FKN A;  3TDU C;  1D1B A;  1BN5 A;  3U9G A;  1ETX A;  2F4I A;  2HKO A;  5D6F A;  3WGH A;  2B9S A;  2CH0 A;  2DA1 A;  2KJC A;  3KP4 A;  3I4M J;  2LG4 A;  4N4N B;  2M9H A;  2HPI A;  2M8G X;  2OCE A;  3HM5 A;  1GVJ A;  1WJA A;  4I99 C;  4PK4 A;  3IWZ A;  4H4K C;  5KVR A;  1KQ8 A;  1IGN A;  2I10 A;  1XGO A;  2ICW G;  2JSP A;  2H8R A;  2WTE A;  3ML6 A;  3J81 Z;  4JBA A;  4XQF A;  2XRO A;  2W85 A;  4ESJ A;  2MD5 A;  3VEP A;  2RRE A;  4XMY A;  5HS8 A;  1R7J A;  2VJJ A;  3PNT A;  1MJB A;  3CUQ B;  4U7B A;  2CV0 A;  3PQK A;  4A0Y A;  4Y13 A;  3QPS A;  3JRB A;  2KQR A;  3HDD A;  3HRM A;  3KEQ A;  1Q1H A;  1ZGA A;  1SFX A;  3EDP A;  3WG9 A;  1DPU A;  3PSI A;  4LIU A;  2EIM H;  3S3N A;  4LFU A;  3JTG A;  2BHY A;  4IHS A;  4F91 B;  2ZXW H;  1X1B A;  2CQK A;  3J7Y J;  1J0R A;  3PUB A;  4B3X A;  3S14 J;  4A3B J;  2QCO A;  3I55 I;  1LJ9 A;  3BPX A;  3S3M A;  3JSP A;  4D5C A;  3PIO F;  1EF4 A;  1CF7 B;  2X6W A;  1WVR A;  3H92 A;  3V8K A;  2E1C A;  2YU3 A;  3BZ6 A;  1JUP A;  4XLH A;  1ZLK A;  2VPL A;  3HPH A;  2PBI A;  2O03 A;  2VL8 A;  4MQ9 F;  4XRF A;  5J6X A;  5CPR B;  3E6D A;  3KLO A;  1OKR A;  3OIO A;  3JAM K;  2QEX I;  1AA7 A;  2RN7 A;  3HOS A;  1LDD A;  3C7J A;  3TDZ C;  3MQ0 A;  4C9Y A;  2GQQ A;  2ECB A;  2L5Q A;  3IRQ A;  3CC4 I;  3I64 A;  5C4J J;  1T56 A;  3DF8 A;  3MVP A;  2HOS A;  3HEF A;  5EEG A;  1IJW C;  2R7W A;  2V7F A;  2EV6 A;  4HQM A;  3ELK A;  1Z05 A;  1U2W A;  2J5P A;  2I5U A;  1DU0 A;  5D5U B;  3BR3 A;  1LEB A;  2O6G E;  2ZXI A;  3I0T A;  1TQP A;  1GLN A;  3VYS B;  3SEQ A;  5K7F A;  3QPH A;  1HDD C;  1HW5 A;  2CQ7 A;  3N4M A;  4XKV A;  2F48 A;  2X4H A;  5KAI C;  1L0O C;  3L09 A;  2E2I J;  5HOD A;  4OAY A;  3PUF A;  1JTY A;  2PJR A;  4Y52 J;  4AU7 A;  4FE4 A;  1QA6 A;  4I2O A;  3ISP A;  3ZCO A;  5DV5 A;  1ZRE A;  4XK4 A;  3E5U A;  3WGG A;  5D8K B;  2DXI A;  2GLO A;  3PJR A;  2Z1D A;  4IPA A;  2GA1 A;  1MDM A;  2E71 A;  2V4J C;  1MJ9 A;  3OYG A;  4BHC A;  3HG9 A;  4KN7 X;  4KT5 C;  5CVV A;  3T5X A;  3JRI A;  1BM9 A;  4BXF A;  4L9J A;  5IYC J;  4E70 A;  4RA2 A;  4E4H A;  1MW7 A;  4A5M A;  5HLT A;  2VLA A;  4LB5 A;  1TQM A;  5HNF A;  1G6N A;  3N05 A;  2Z9O A;  2HGC A;  3H3Z A;  5BS6 A;  4AWX B;  3QOE A;  4IXA A;  2FQ3 A;  1G59 A;  2E1O A;  3Q3S A;  4LD5 A;  5EEA A;  1SD5 A;  1YG2 A;  2P7C B;  1J5Y A;  2YUS A;  4RAG A;  5EG0 A;  2KRF A;  2DOA A;  2K85 A;  4ZYE A;  3IHU A;  1RPW A;  2K02 A;  1APL C;  5JHF A;  3H5A A;  2HDD A;  3C2G A;  2KFD A;  1W5C C;  3DPU A;  4R8H A;  2A6E F;  3H0D A;  3U21 A;  2M0M A;  4D9J A;  1BOA A;  1HKT A;  3K10 A;  2HDW A;  4C3I J;  3FHZ A;  3HRS A;  4B44 A;  2DA2 A;  3C2H A;  4KIC A;  3W3C A;  3S1Q J;  1SAX A;  2QBY A;  3WGI A;  3ZN1 A;  3TKY A;  4GO1 A;  4LIT A;  4Y17 A;  4LG3 A;  4HF1 A;  2R7T A;  2FOW A;  5IP9 J;  5E79 C;  1EH7 A;  2CWE A;  1UEL B;  3K4B A;  1IXS B;  2MC4 A;  3COA C;  2R7X A;  4AD9 A;  2NAZ A;  3A1Y A;  2A5W A;  4EEF G;  2ZO4 A;  5LRS A;  1ZTR A;  2A5Y B;  2P8T A;  1I50 J;  4EJT A;  3AG3 H;  3I58 A;  2XB0 X;  5HDN A;  1N78 A;  4PJN A;  1YE9 A;  3LSR A;  2VKH A;  3QRF F;  1JT6 A;  4RGX A;  5JLW A;  2PX9 A;  4HX7 A;  2M0C A;  1IW7 F;  3FK7 A;  1FTT A;  4XR6 A;  3C2B A;  5JI6 A;  2LKP A;  1HSJ A;  2XAF A;  1FOW A;  4C3J J;  2E5N A;  4L18 B;  3BCB A;  5DYM A;  3WTV C;  1TWA J;  3S93 A;  5M5X J;  1HKS A;  3BR6 A;  3EQL F;  2VIX A;  3CCV I;  1PVE A;  2GOM A;  1SVL A;  2ZC2 A;  2E36 A;  2V1X A;  4U0W A;  2CV1 A;  1XGN A;  2NYX A;  1QBJ A;  3EYI A;  1P6R A;  3SDB A;  3IH3 A;  4XOP A;  2P5K A;  3Q9V A;  2DBB A;  4B1R A;  1BI2 A;  2XKO A;  2FD5 A;  2L02 A;  2QVO A;  2ZME A;  4PGG A;  1AHD P;  1N77 A;  4FE7 A;  1RUN A;  5HVQ C;  1ETW A;  1QZE A;  3VWB A;  3FKI J;  1Z3X A;  4BYY A;  4ZZD A;  2E2H J;  2EIK H;  5DCM A;  1U8B A;  2XGE A;  3SFZ A;  3W2W A;  2V9K A;  3NEU A;  4A3J J;  1JKP C;  5DS9 A;  5J47 A;  4PSW A;  3AFH A;  4EV0 A;  1KGS A;  3MN2 A;  1NG6 A;  3OIQ A;  3HL2 A;  1BW5 A;  3M4O J;  1JXS A;  4P9F A;  3M3Y J;  1STZ A;  5ILS A;  3ASO H;  1R1V A;  3WTT C;  5DTD A;  2MFZ A;  1R22 A;  3MFK A;  3O8G A;  3A0B C;  1XS9 A;  1DU6 A;  2ESH A;  1S7O A;  3G3Z A;  3DTI A;  3HSR A;  3TED A;  2EWN A;  1MMD A;  2M3A A;  3ZMZ A;  1FZP B;  1SFK A;  2VOO A;  3OOU A;  2FE3 A;  4PFO A;  1MDM B;  1EJ9 A;  3JRC A;  1KU7 A;  1OFC X;  4HNV A;  4A12 A;  2ELH A;  2EQR A;  4I6Z A;  1QRY A;  3CCM I;  3KEY A;  3OYB A;  3RQI A;  2K3F A;  3BP8 A;  2DFF A;  1VQ7 I;  1W1W E;  2NS7 A;  2XRN A;  2VQH A;  2R5Z A;  5E1Z B;  1F9N A;  3S3O A;  3CO6 C;  4UUT A;  4ZYH A;  3KYD B;  3BG9 A;  4ZZL A;  1ZRC A;  1XC5 A;  3GME A;  3MZ8 A;  4BJ6 C;  2BZT A;  3RIR A;  2EFN A;  2FNP A;  2HOA A;  1UZC A;  2CGP A;  3IRR A;  3RZD J;  3OY9 A;  2HQN A;  5EG0 B;  2K27 A;  2XAU A;  2QA4 I;  5BMZ A;  5LEJ A;  4WXD A;  3ERE D;  3HZJ A;  1G4D A;  4CHU A;  4LB6 B;  5F0C A;  1KU3 A;  3KLN A;  1WJF A;  4A0X A;  4A3F J;  4HF2 A;  4ABZ A;  2STW A;  2DI3 A;  3GVA A;  4KIG A;  5CQG A;  4G9Y A;  2EFW A;  3QU3 A;  2NS8 A;  4RGR A;  1R1U A;  4M72 A;  1V55 H;  2G9W A;  2ZME C;  5FLX Z;  1EH6 A;  3GXO A;  1GDT A;  3S2W A;  4A3E J;  2F5C A;  4AVP A;  4HV6 A;  2BVL A;  4JX5 A;  3ASN H;  2VJI A;  4KIS A;  3DXJ F;  3MZH A;  1J9I A;  3FXR A;  3ZQF A;  4EVI A;  1ZGW A;  2ZFW A;  3E6B A;  2EB7 A;  3IP4 B;  2CW8 A;  4HOB A;  4Q48 A;  1POG A;  1UB9 A;  3GTJ J;  3DKX A;  4IHY A;  2OAZ A;  2K9M A;  2IAI A;  2IGM A;  1YHQ I;  2CW7 A;  4C2T A;  2H27 A;  3GZ5 A;  4HX8 A;  2QSH X;  3K2A A;  2R3S A;  1QPM A;  3GTM J;  1QNT A;  3EET A;  1TTY A;  2HR3 A;  1B72 A;  2V1D A;  3ZMS A;  2CQX A;  1Z0X A;  1D1C A;  4YFX F;  1WPK A;  3HSE A;  3K1N A;  1BJZ A;  3V42 A;  4E7J A;  3I9V 2;  3WTS C;  2ZNZ A;  1FIP A;  2KMU A;  4I7H A;  1IXC A;  2RAE A;  3BWG A;  3J80 Z;  1GUU A;  2ME6 A;  1OCR H;  2XAS A;  1WH7 A;  1N75 A;  2V1N A;  4D7N A;  1OJL A;  1SAU A;  2K9S A;  3OYK A;  2E34 A;  1T2K A;  4BXX J;  1IV6 A;  2DTZ A;  4YEL A;  4HNT A;  4C3H J;  1FSE A;  2ZME B;  3CCS I;  4BGD A;  2F4O B;  4E7K A;  2LVS A;  3QP6 A;  3G6E I;  2HXO A;  2D1V A;  1ULY A;  2EIN H;  2V9V A;  5DCM B;  1NTC A;  3BZK A;  4MTD A;  1RKT A;  2ZB9 A;  4L9N A;  3RCO A;  4BEH A;  4PFP A;  3DV8 A;  1BC7 C;  3Q0W A;  2CV2 A;  1RUO A;  3FMQ A;  2ME0 A;  3SZG A;  5M5W J;  3BTJ A;  1XG1 A;  1O3R A;  1FOX A;  3H0G J;  4JYK A;  1O4X A;  2VT3 A;  3BG7 A;  1OPC A;  3H9G A;  2MH2 A;  1UG2 A;  1MNM C;  3K4L A;  2FXA A;  3RTR A;  3S16 J;  2VQL A;  5K5R A;  2DDB A;  4FAS D;  2Z3Y A;  2XF6 A;  3O8H A;  5JFR A;  1JT0 A;  3VYT B;  5D5W B;  4KIT B;  1BA5 A;  1YX3 A;  3FXQ A;  1YW9 A;  1KU2 A;  4UVC A;  3CDI A;  1QHG A;  1G2H A;  1RR7 A;  2JPC A;  4XLF A;  2NVQ J;  4V2F A;  3WU1 B;  1BL0 A;  1Y8R B;  4GCV A;  2KRH A;  3IL2 A;  2R7Z J;  1E0E A;  4IOC F;  4DBR A;  1B8I B;  5K5O A;  4RS8 A;  2DA6 A;  2XGX A;  1XDU A;  1PJR A;  2XV4 S;  2YPR A;  2LOO A;  2WWY A;  5JVG F;  2R5Z B;  4KN4 X;  2VJ4 A;  5FRN A;  3FMR A;  3WOD F;  1MMG A;  2Z33 A;  2DFH A;  3GO5 A;  3D5S C;  4PDK A;  3K2Z A;  2ZBK A;  3L00 A;  2F2E A;  2GZW A; 
#chains in the Genus database with same CATH homology
 4NQW B;  4BAC A;  2HPI A;  2ZFU A;  3DWL E;  1WJA A;  2FUG 2;  2DJI A;  3IAM 2;  4XKW A;  4PK4 A;  2L7K A;  4H4K C;  2ZXH A;  2R7S A;  3TL4 X;  2JSP A;  2VJ5 A;  4E7S A;  4HG2 A;  1TZL A;  3GBG A;  3SEZ A;  4ZTF A;  2R7V A;  4XQF A;  1P9Q C;  1J09 A;  4XM3 A;  1JI8 A;  2RRE A;  4XMY A;  1X19 A;  2VJJ A;  3PNT A;  3D5L A;  1HA8 A;  1MNE A;  4J00 A;  1ZEL A;  4U7B A;  2L2O A;  2CV0 A;  2ZSI B;  2KQR A;  2NOJ B;  1Z21 A;  3OYL A;  3MMY B;  3ZR8 X;  1MMN A;  3LL7 A;  4KT6 A;  1FMV A;  1T95 A;  2LRD A;  2Z16 A;  2WAD A;  3PSI A;  4LIU A;  3S3N A;  3LSI A;  1X1D A;  3H5N A;  4BQN A;  5CQE A;  4F91 B;  2KL4 A;  1X1B A;  3PNV A;  4HST A;  2P0W A;  3PUB A;  3S32 A;  4B3X A;  4BQO A;  2V26 A;  2XSJ C;  2LBF B;  3OS0 A;  3KYL A;  3S3M A;  4ZDO A;  3FKJ A;  1Y6I A;  3VYU B;  2WAF A;  2X6W A;  1BOB A;  4ANJ A;  2HU9 A;  4XLH A;  3ONQ A;  2CMP A;  3DU5 A;  4CCL A;  5KCM A;  5HNH A;  1W36 C;  2VPL A;  3HPH A;  2VL8 A;  5CPR B;  3ZRG A;  3OYE A;  4NC7 A;  1AA7 A;  1DQU A;  4PJL A;  3HOS A;  4BJ5 C;  4C9Y A;  3FDY A;  2L5Q A;  3CJQ B;  3OIP A;  3UR3 C;  3CP8 A;  2CUZ A;  2VXZ A;  3OL4 A;  3PFY A;  4G6T B;  1IRX A;  4E6K G;  2XF7 A;  4BQQ A;  3FBI B;  4JOM A;  2R7W A;  2V7F A;  4XLA A;  3VDX A;  3CZ6 A;  4DGW B;  2OV7 A;  3OYM A;  3HPG A;  1BR2 A;  3DTE A;  1UG0 A;  1WJC A;  1QHH D;  2ZXI A;  3VYS B;  1GLN A;  3SEQ A;  3H9Q A;  4II2 A;  2HVS A;  1G8X A;  1X1C A;  2WY8 Q;  4XKV A;  2X6X A;  4BDY A;  2O5R A;  2PMZ A;  4KJZ A;  4OAY A;  4XLC A;  3CES A;  5LFA A;  2PJR A;  4AU7 A;  1DGW Y;  2XC7 A;  4BUP A;  3ZCO A;  1VZ0 A;  2KP6 A;  2OC6 A;  4DOZ A;  2DXI A;  4PSX A;  3OL3 A;  3PJR A;  2Z1D A;  3BLY A;  3MKY B;  2RQQ A;  2PJR B;  2V4J C;  3OYG A;  3HG9 A;  2WAQ A;  2RNG A;  1S9H A;  3HOT A;  5TGT A;  4BXF A;  3CF2 A;  4E4H A;  1MW7 A;  3L2R A;  5HLT A;  1X4O A;  2VLA A;  2UWM A;  2Y0S A;  5HNF A;  5KNL A;  2HZD A;  3L2U A;  3N05 A;  4CCM A;  1D1A A;  2VKD A;  3QOE A;  4AYB A;  1G59 A;  3EUA A;  3RQ4 A;  2QKM B;  3PL8 A;  3CJR B;  3BC8 A;  3LSG A;  2DOA A;  2K9L A;  4RM3 A;  3DKY A;  5JHF A;  3H5A A;  3C2G A;  3DPU A;  3IUO A;  3H0D A;  3OYN A;  1D0Y A;  1X4P A;  2M0M A;  3U21 A;  2LY2 A;  4ZJZ A;  4D9J A;  1QU3 A;  3K10 A;  2HDW A;  3DQV C;  4ITV A;  4LIV A;  2BW3 A;  4PUS A;  4HPQ A;  3VSL A;  3C2H A;  4B44 A;  3W3C A;  1D0Z A;  3OYC A;  2VB6 A;  3EPZ A;  2A6T A;  4NUB A;  4CUG A;  3K70 D;  3TMO A;  1W36 D;  4LIT A;  1WJE A;  4GRI A;  4LG3 A;  2QKL B;  2R7T A;  2GOX B;  3J7A Y;  2VQG A;  3K4B A;  1UEL B;  2MC4 A;  2R7X A;  3OYA A;  3A1Y A;  2A5W A;  1PYV A;  4B47 A;  4N4O B;  2IS2 A;  2W4S A;  2V6E A;  2X1C A;  3E1S A;  1N78 A;  4PJN A;  1YE9 A;  3K70 C;  2VKH A;  2HNH A;  2KZV A;  3A4C A;  3OMY A;  4XR6 A;  4HNU A;  3AL0 B;  3OYD A;  3H35 A;  2WY7 Q;  3M8J A;  3L2Q A;  1WJD A;  1D0X A;  2E1M C;  3OS1 A;  2E5N A;  4HSR A;  4XN0 A;  2UUZ A;  3BCB A;  3LSH A;  5LD2 C;  2HQA A;  1K6Y A;  2VXD A;  3LFU A;  4JQF A;  3S93 A;  2M4K A;  2BVM A;  2VIX A;  1OLT A;  3VSK A;  1ERD A;  2GOM A;  3LMM A;  3PSF A;  2I8D A;  2JUG A;  2CV1 A;  4IZZ A;  3TBI A;  1UAA A;  3K4M A;  3SDB A;  4XOP A;  3F9K A;  3NWT A;  4ZC3 A;  2X1E A;  4RMN A;  2L9N A;  4P1W A;  2KLO A;  3FBN B;  1EA3 A;  4RLF A;  4ZYA A;  3QYB A;  1N77 A;  5HVQ C;  3VWB A;  1Z3X A;  2X6Y A;  4BL0 B;  4MLO A;  3W2W A;  2WAE A;  2V9K A;  3NWS A;  3OYH A;  3M1C A;  3MKW B;  3UNG C;  2X1D A;  3AFH A;  4PSW A;  2MYS A;  2IXS A;  2OUM A;  3OIQ A;  1NG6 A;  1Z7L A;  3HL2 A;  3OWT A;  3ZXS A;  4F55 A;  3CMM A;  4AVZ A;  4E7H A;  3K4J A;  1MMA A;  1OR7 C;  2LH9 A;  2MFZ A;  2WBM A;  4XNF A;  2R4G A;  4D1Q A;  3DTI A;  2IS6 A;  3RPU D;  1MMD A;  2M3A A;  2KPM A;  1BR1 A;  3HXL A;  3QYE A;  2Q2E B;  1SFK A;  4BE0 A;  4ZDP A;  4IQJ A;  2IGO A;  4BE2 A;  3OOU A;  4PFO A;  4QPQ A;  2JA2 A;  4CCK A;  2VAS A;  3CP2 A;  4R79 A;  1V5F A;  4PJJ A;  3ZQQ A;  3EUK L;  2AQE A;  4NNJ A;  4RLQ A;  4F3Q A;  3AL0 C;  3KEY A;  3OYB A;  4DIQ A;  3L2W A;  4HRI A;  3LSK A;  2E1M B;  4IKF A;  2VQH A;  3W2V A;  3S3O A;  4ZTJ A;  1LFP A;  2E5Z A;  3QOD A;  3DPL C;  2L9S A;  4ZDL A;  4BJ6 C;  3BG6 A;  2BOL A;  2R7O A;  4XKC A;  2Q1Z B;  1Y56 A;  4F93 B;  1TT0 A;  1DP3 A;  3OY9 A;  3BCA A;  4OAZ A;  1WJB A;  2XAU A;  3MD2 A;  2XF5 A;  2W82 A;  3S8P A;  4PJM A;  3K6G A;  3DPT A;  2K3P A;  5HOO A;  4CZC A;  4J01 A;  1WJF A;  2BW3 B;  3H5R A;  2JVG A;  3E0J B;  5CQG A;  4XOT A;  1X1A A;  3K4K A;  2W00 A;  3HKZ A;  1R6R A;  1KON A;  1V5G A;  2HVQ A;  2BVL A;  2VJI A;  2IGN A;  4KIS A;  2IS1 A;  2IGK A;  2R7R A;  2W1O A;  2JVH A;  4B43 A;  3DTK A;  2LRE A;  3SYT A;  3H9J A;  1DGR M;  2LBF A;  2KDO A;  3KX2 A;  3IP4 B;  2CW8 A;  1U0J A;  4F92 B;  4E7L A;  3DKX A;  3HC7 A;  4II3 A;  2K9M A;  3OYF A;  2IGM A;  2UV1 A;  4XON A;  2CW7 A;  4X0G A;  4E7Z A;  2HVR A;  4C2T A;  4RM2 A;  4CA0 A;  4XOR A;  3RSN A;  4CCJ A;  2WA0 A;  2LY1 A;  2R7Q A;  1NG7 A;  4B48 A;  2IS4 A;  4OWR B;  4U87 A;  1D1C A;  3ZGK A;  2XDV A;  1BR4 A;  3FHN A;  4BDZ A;  3OR1 C;  4BJT A;  2DT6 A;  3DU6 A;  4C30 A;  3V42 A;  4DBQ A;  4BE1 A;  2X85 A;  4E7J A;  3I9V 2;  3MKZ A;  2WB1 A;  2KMU A;  3AKZ A;  4CSW A;  3DEE A;  3DLA A;  3G2B A;  4Y3O A;  1N75 A;  2AQF A;  2V1N A;  2MD0 A;  1SAU A;  2LYC A;  1T0F C;  2HPM A;  3OYK A;  2CS3 A;  3K4C A;  4F52 A;  3W2A A;  2LC2 A;  1MND A;  4YEL A;  4HNT A;  2F5V A;  4C2U A;  3LSM A;  4BU2 A;  4BGD A;  4E7K A;  2F6C A;  4Y33 A;  2M7B A;  4CCO A;  3D5R C;  3RCO A;  4BEH A;  2DCE A;  2CFO A;  4PFP A;  2CV2 A;  3OYI A;  3SZG A;  4YRV A;  3QYF A;  4IQ4 A;  3IAS 2;  1Z3Y A;  2ELJ A;  2K5C A;  5KHD A;  3OR2 C;  3BG7 A;  3H9G A;  4NC8 A;  2W7N A;  2VQC A;  4BEH B;  1WFX A;  1WJ5 A;  2KHM A;  4QPO A;  3K4L A;  2MAB A;  1LDK B;  4CH7 A;  3RTR A;  2ZSH B;  2X51 A;  4P5O A;  4HEA 2;  2VQL A;  3VYR B;  1YX5 A;  2M7A A;  2E60 A;  2XF6 A;  4FAS D;  3L2V A;  4Y4R A;  3VYT B;  2M4G A;  2R7U A;  4EAT A;  4KIT B;  1YX3 A;  2DT7 B;  1V5E A;  5FRO A;  4DJA A;  3OYJ A;  3I3L A;  1QHG A;  4IX7 A;  5CKT A;  2CUJ A;  2KRC A;  4XLF A;  4XLE A;  1LVK A;  3PNY A;  4BS9 A;  1E0E A;  2KRH A;  4XN3 A;  1LKX A;  4DBR A;  1FMW A;  4FET A;  1PJR A;  2Z2S B;  3HUG B;  4CCN A;  3A2K A;  2LOO A;  1D1B A;  4E7I A;  2F4I A;  3K4N A;  5FRM A;  2VJ4 A;  5FRN A;  1MMG A;  4YEJ A;  3OS2 A;  4XL9 A;  2CH0 A;  3D5S C;  2LG4 A;  4XKB A;  3EUH C;  4N4N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...