5JLWA

Antphd with 15bp dna duplex r-monothioated at cytidine-8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
57
structure length
57
Chain Sequence
b'GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeotic protein antennapedia
publication title Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulator/dna
total genus 22
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5jlwA00
1F43A 1MSEC 1MNMC 2WB1N 2HOTA 4IHVA 1NK3P 5EZGA 3IH3A 1AKHA 4XRSA 4XRSG 1GT0C 3B6CA 1LE8B 3BTJA 1HDPA 4AUXA 1TWFJ 3SDGA 5K7ZA 1IG7A 3M3YJ 2DA1A 2OPTA 1UG2A 1IGNA 4XIDA 1WCMJ 2DA7A 2JK3A 2CUEA 2LVSA 3OSGA 1JJ8C 1VF9A 3CDLA 3G1LA 4ABZA 4A3GJ 4B3AA 1ETWA 1MBEA 2XPUA 2E2IJ 4X6AJ 2MGQA 2HXOA 3CQZJ 4BXXJ 2TRTA 5IYBJ 2JA8J 1OFCX 5E3MA 1U8BA 1S7EA 5GP9A 1JTYA 2H8RA 5E3LA 1Y1WJ 1MBJA 2L7MP 2PMZN 2GLOA 4M3FA 3HOYJ 2ECCA 3Q0VA 1B72A 4A3BJ 2M0CA 2QCOA 1FJLA 5DS9A 2CU7A 2YU9J 2GBYA 4IEJA 2O9LA 5EGOA 1E3OC 4IHWA 2B63J 3TEDA 5EDNA 4QIWN 1H89C 2EQRA 2G0EA 2L9RA 4J19A 1FTZA 5E3OA 2WV1A 2JJ7A 2ME6A 5F0FA 1QVTA 1ZR2A 3BQYA 3DEWA 3FK7A 3G1OA 5M5WJ 2DA2A 3FK6A 4EEFG 2JA7J 3BT9A 5F0HA 1APLC 3BTCA 5EZHA 1H8AC 2HOSA 4A93J 2DN0A 1MBGA 2VKEA 2EZIA 5EF6A 3WHCA 1XG1A 1HDDC 2FJ1A 4I6ZA 5F04A 1JKQC 3GTPJ 2CJJA 3JRGA 1WH5A 3QQAA 1B8IB 3TW7A 2VI6A 4DZJA 2M34A 2L0KA 2DA6A 1A6IA 4FTHA 2CQQA 2IAIA 3GBGA 5EG0A 2XGCA 3JR9A 3ZQGA 5M3FJ 4A3MJ 5F27A 1MH3A 3JRDA 3FISA 4A3FJ 1NK2P 3HM5A 1VFCA 2X6OA 1WGXA 1AKHB 2YS9A 4V2GA 4BKXA 2E2JJ 4BY7J 1FEXA 1F36A 5K7HA 1ZKGA 4JP0A 1IJWC 5C44J 2R5ZA 1BJZA 2MW8A 3GTQJ 4UUTA 4M3DA 3S17J 2LKXA 3LNQA 1I50J 1BL0A 2XPVA 4AYBN 4BBSJ 1LFUP 3S1MJ 3ZOBA 4UUSA 1H88C 5C4XJ 5FKLA 3G1MA 1MBKA 3A01A 1HLVA 1JGGA 4D5CA 3A03A 4XK4A 1UHSA 1JT0A 5F0CA 2NS7A 4FCYA 3JRHA 1B72B 2K40A 3O8GA 3JRBA 1WPKA 2VKVA 2XB0X 3HEFA 4A3IJ 2K9QA 2XB5A 4W97A 1ZTRA 1JT6A 3LSPA 3PO2J 5FJ8J 2EBIA 4BY1J 2AO9A 5EGOB 2DTZA 1I6HJ 2O8KA 1RKWA 1YRNA 2NVXJ 3HOVJ 4JYKA 1TWCJ 3L1PA 3LSRA 1HOMA 2DA4A 4DYQA 2JA5J 4XICA 3BTLA 1IDYA 4C3IJ 4CYCA 4JX4A 4DYRA 1U78A 1GV5A 2Y2ZA 1T33A 1P7JA 1T56A 2YUSA 3O8HA 3ZQIA 3HOWJ 3JRFA 4M3EA 2VUMJ 3Q0WA 3SJMA 3PM1A 5M3MJ 1A5JA 4I76A 1RESA 1AU7A 5JLXA 4RBOA 2XPWA 1JKRC 4C3JJ 2TCTA 3W6VA 5J3LA 2I10A 5M5XJ 5IP7J 3HOUJ 2HI3A 2JA6J 2IEKA 3TW6A 3S2HJ 2LR8A 1IDZA 3JREA 2XRLA 2Y30A 3CMYA 4MFDA 4V2FA 1XS9A 3MVPA 5EG0B 1FIPA 1WH7A 3A02A 1U9NA 1X58A 3IH2A 4HNVA 2LLKA 2E2HJ 5M5YJ 4BBRJ 1Y1VJ 4DYCA 3HOZJ 3UKGA 2RAEA 1FIAA 4RDUA 4A3LJ 5BNGA 3ZQLA 5IP9J 2ZB9A 2NVTJ 4DW6A 1ETQA 3OSFA 2HYJA 3BTIA 3PO3J 2EZKA 2CUFA 3S15J 4JX5A 4B4CA 5FKOA 1TWGJ 2XGDA 2R5ZB 4L5EA 2LFBA 4S0HB 2R5YA 2LY9A 2HDDA 3BR0A 2M2EA 2W48A 1JUPA 1UMQA 1PUFA 3RKQA 5IOZA 2XSDC 1LFBA 2DMTA 3S2DJ 1XC5A 4MO7A 4FISA 1W0UA 3JRIA 1SFOJ 4D7NA 3S1QJ 2CRGA 4Y7NJ 5K7FA 2NVYJ 3LSGA 1OJLA 2FQ4A 1HF0A 2R0QC 4G12A 2R7ZJ 4UUSB 3IV5A 5F08A 1RKTA 3K7AJ 3ZQCA 1ZGWA 5IPAA 3A01B 4A3JJ 4QTRA 5E3NA 1BW5A 1VI0A 3QPSA 1EF4A 2EZLA 1RETA 5IYCJ 2NS8A 3H0GJ 1AHDP 5C3EJ 1IUFA 1WI3A 2WAQN 3OIOA 4IHYA 2JWTA 1IC8A 3OOUA 3ZQHA 1P7IA 5FKMA 4AC0A 1TWHJ 1RPWA 2X9DA 1ETYA 4GFBA 1B8IA 2L7ZA 2Y9ZA 1YRNB 5F1JA 2HXIA 2HOAA 2KT0A 1JTXA 2DMPA 3BG3A 1W0TA 1MBHA 1OCTC 2Y31A 1G2HA 3GTJJ 5C4JJ 2DMUA 4A3DJ 2JN6A 3K2AA 4A3EJ 3I4NJ 4CYCB 5J1UA 3B6AA 3WHBA 5FLMJ 3RZOJ 1R9TJ 2OF7A 2M8GX 4M3BA 1NTCA 5GPCA 3TP3A 1ETVA 3HBLA 4FE4A 1ORKA 4B1RA 1I3QJ 4D5FA 2P81A 2ELKA 1MSFC 1QPIA 1GDTA 2LK2A 3IH4A 5J1RA 4A3CJ 4MIMA 5GPAA 1IV6A 3H3VK 2Y0SN 3SFIA 2K9NA 1GVDA 3FIWA 1Q1VA 4LOCA 1SANA 5FKKA 5JLWA 2D5VA 1BA5A 4C3HJ 3BR2A 3NAUA 2LD5A 1MBFA 2K9SA 1JKPC 1BW6A 2ID6A 2DA5A 3CCYA 1LE8A 1ZQ3P 4FE7A 3GTLJ 1ENHA 3GTOJ 4Y52J 2DMQA 2DMNA 3DCFA 1JJ6C 1D5YA 1OCPA 1X2MA 3BQZA 1CQTA 3FKIJ 2X48A 5HODA 2N8GA 4MLOA 3S14J 1ETXA 2EZHA 3HDDA 1GV2A 5IYDJ 2R5YB 5EYRA 2EH3A 3I4MJ 2ECBA 1PUFB 3BR3A 1IRZA 4XRMA 2AHQA 1POGA 4M6VA 3S1NJ 3C2BA 4X1EA 2O7OA 3RZDJ 2Y9YA 2MG4A 1MH4A 5IOYA 2CQXA 1Z77A 3HGGA 1ETKA 1HCRA 1K61A 2ME0A 3HKZN 3F0CA 2L7FP 5FLVA 1QVUA 3MN2A 5IP6A 3VPRA 2NOGA 1DU0A 2NVQJ 1GUUA 3TP0A 1RR7A 3HGYA 5J1YA 1JKOC 3ZQFA 3BR5A 3BG5A 2H1KA 3M4OJ 3GTGJ 3D1NI 3JRCA 2IBDA 1JUSA 2HQ5A 4A3KJ 3BG9A 1VNDA 3RQIA 2E1OA 4A69C 3LSJA 1DU6A 1FTTA 1QRYA 1X2NA 2LP0A 5EEAA 2R93J 3BR1A 2MSYA 1ETOA 2FD5A 2GM4A 5FKNA 3S1RJ 4IHXA 2E19A 3Q3SA 3HOXJ 4DZPA 1O4XA 2JMWA 2M9HA 2DJNA 2ID3A 3MKLA 9ANTA 3E7LA 3QPLA 4M3GA 4W1UA 2COBA 4C2MJ 1TWAJ 4MFEA 2QF7A 3Q0UA 4NDLA 2FX0A 1Z0XA 2KDZA 4JX6A 3NARA 2VPRA 5DTDA 3S16J 2DA3A 2XGEA 4D7MA 1JUMA 1K83J 3HB9A 2R92J 1ITYA 3BR6A 3LOCA 3JRAA 1ZK8A 2LTPA 1U9OA 1TC3C 4QSHA 3GTKJ 1ZR4A 3GTMJ
chains in the Genus database with same CATH superfamily
3TDZC 1E2XA 2QM3A 4C9YA 1F43A 3E1SA 3E0JB 4DIQA 4NC8A 2WAQA 2XGXA 4XRSG 3KCCA 2NVUB 4ZYAA 4IKFA 2VOPA 3HRUA 1HDPA 4G6QA 3BCBA 1TWFJ 1DDNA 4U87A 3WE3A 4MHGA 1IG7A 1A6QA 2R7TA 2X6XA 4WXHA 1J7KA 1GVJA 2CUEA 2QUFA 1R6RA 2BY2A 4XOPA 1JJ8C 1REPC 1ZRFA 1VF9A 3G1LA 1YIJI 2F4MB 4XN3A 1DP7P 4BHPA 1R4MB 4ABZA 4YFNF 4ZTFA 2XAUA 3WODF 4B3AA 3V8LA 1HQCA 1MBEA 2Z1DA 4OIRF 5D4SA 2E7WA 1ZG5A 1WVRA 1KYWA 3CQZJ 1TL8A 4BXXJ 5IYBJ 1OFCX 3J7ZI 1S7EA 5GAHJ 3WE2A 4BQAA 1YFHA 4BQNA 2XIGA 4EJWA 5A2QZ 5E3LA 2PMZN 3DPLC 2RVCA 1FP2A 1CF7B 4AM3A 3VOEA 4BEHA 4IHTA 4EVIA 3I53A 2IP2A 3QOEA 3D5RC 3ZMVA 1UELB 4WF2A 2LSOA 2JRTA 3R4KA 3L2UA 2CU7A 5CVJA 2V1NA 4P96A 4II3A 3IP4B 5CQEA 4IHWA 2B63J 2XSJC 4XQFA 2QKLB 5EDNA 1PJRA 4QPOA 1R4NB 3DWLE 5D8KB 1U5TA 1TQMA 1Y56A 2L9RA 2VJ4A 3QPTA 1KGSA 2WV1A 3A0BC 1UZCA 4XLPF 3QU3A 2CG4A 1QVTA 1KA8A 2ELHA 3RI4A 2PQ8A 2D1VA 3L2CA 3M1CA 1N77A 2BXYA 2DA2A 5LRRA 1VQ5I 2KIUA 2R7RA 2JA7J 1BR1A 1KU9A 2V9VA 3BTCA 3HOSA 4BE1A 1ZG1A 1H8AC 4A93J 2DN0A 4BUPA 1R5ID 3F8NA 4U0YA 2VKDA 3K4KA 4HSRA 5HLGA 1YI2I 2R7UA 1YW7A 1XG1A 4HW0A 2HWVA 4I6ZA 1FP1D 5HS9A 4BU2A 3ZXSA 3GTPJ 1WH5A 2NS0A 3GLLA 1B9MA 3HKZA 3TW7A 1YIOA 2MC3A 1FY7A 4DZJA 4R79A 3BJOA 1NG7A 4ITVA 4Y3OA 3RJPA 1RC9A 1X3ZB 2XGCA 4HA8A 1UG0A 3DTIA 4PJLA 1MH3A 3JRDA 2Z9OA 3FISA 5JFRA 1VQNI 4QPQA 4S05A 2X6OA 2BXZA 2A5WA 4V2GA 4BKXA 2E2JJ 2UUZA 4FT8A 1V3FA 1F36A 5K7HA 3KEQA 4KITB 1V5FA 2PN6A 1S5LC 4N9IA 1TZLA 4JP0A 2XF6A 3OYMA 2K85A 3MFKA 2Y0MA 3ZQ7A 5C44J 3AG1H 4PJJA 4PJ0C 5CLSA 2OZUA 1ZRDA 2Y48A 2R5ZA 1KQ0A 1ZAOA 5D8LB 1N75A 4KIFA 3WG9A 2RNJA 3GTQJ 4HNUA 1OR7C 3KETA 3LAJA 2O8XA 4UVBA 4PFOA 1Y0UA 2V6EA 1WJEA 3JTGA 3LNQA 2DAOA 1I50J 4ZDPA 2XKPA 1YITI 2E60A 2V79A 4UUSA 2HQAA 3KLOA 2E36A 1R1TA 4JQFA 4JOMA 1HLVA 4D5CA 3IWZA 5EJCA 3LA2A 2W7NA 4XK4A 2Q8KA 4FCYA 4A6EA 1YOVB 4F52A 1B72B 2K40A 3HSFA 2WB1A 2HVSA 4A3IJ 2VBWA 3I5UA 2XB5A 3DPTA 1C0WA 2M3AA 3R6SA 1JT6A 4NUBA 4NBQA 2W1OA 3QP6A 2BZTA 2DTZA 2ZMEC 1I6HJ 3V7RA 1YX5A 3U9GA 2O8KA 2KLOA 3CC4I 3ZMSA 2P6SA 3LSRA 2Q2EA 3LSMA 2CQKA 4XLHA 3FM5A 2F5DA 2KRFA 1IDYA 4HX7A 2LY1A 4GCVA 4HDVA 2UZKA 4HX8A 4IQ4A 2M5WA 2Y2ZA 3DKWA 3R60A 4GYIA 2YUSA 3O3KA 2AS5F 4M3EA 3SYTA 1G3WA 5B1AH 2VUMJ 3Q0WA 1Y8QB 4NC7A 4ENNA 1LDJA 5GADJ 2OQRA 1XMKA 4O5VA 1RESA 3D0SA 4HF1A 2M4KA 2W82A 4IQJA 3RTRA 1AU7A 3CCMI 2RQQA 2WY8Q 4AVZA 1JKRC 2FRHA 2ZFWA 2TCTA 4C3JJ 3W6VA 1BBYA 5KHDA 1YE9A 2LBFA 3HOUJ 5JHUA 3GF2A 1V54H 4HX4A 3UR3C 2Y30A 3CMYA 2QVOA 4E7ZA 2R7XA 4AIDA 2BEOA 5EG0B 2E1MC 2LNBA 4RLFA 4DOZA 3A02A 4ANJA 2EV0A 4BL0B 1FMWA 4M72A 5M5YJ 5ICEA 1Z7LA 2JT1A 3H92A 4RB1A 3E6DA 3R61A 2A05A 2XAJA 3N05A 5J40A 3UKGA 3CO7C 5HLIA 5IP9J 2VQLA 5J47A 5BMZA 1VQ6I 2HKXA 4FHTA 4G8XA 3OSFA 3WU2C 3BTIA 3IRQA 2JQ7A 3PO3J 2CUFA 1TP4A 1B6AA 2QQ8A 2FOWA 4B4CA 5LGUA 2STWA 3KYDB 4CCLA 3DF8A 2HDDA 4MNUA 2W48A 1PUFA 3E6BA 4XLAA 2XSDC 4IRIA 2VJIA 1SMYF 4U7BA 2KRCA 1W0UA 1SFOJ 2CRGA 3TBIA 4Y7NJ 2EINH 3G71I 5ERIA 2VQHA 3LSGA 1FZPB 1JI8A 2KZGA 1CGPA 2R7ZJ 1J75A 2R7DA 4CHUA 1WJ5A 4L5IA 3K7AJ 2PFBA 1A36A 5IPAA 5J8FA 4QTRA 1OCCH 3BG7A 3DKYA 3L2RA 4M73A 4OMYA 2QQBA 2X51A 2LG4A 2IS2A 5TRDA 1FBUA 3ZMUA 1B59A 3H0GJ 3H5NA 2WAQN 3I9V2 1IC8A 5CQGA 3ZQHA 3PUBA 4XN0A 4M9SA 3WU0A 3FXUA 4AC0A 4ZYHA 4ENJA 3S3NA 1BOBA 2W57A 2Y9ZA 1YRNB 3I54A 4KMUX 1YYVA 4HV6A 1W0TA 2A6HF 4XLEA 2KJCA 4XR6A 2Y31A 1TNTA 1G2HA 3GTJJ 3W6JB 1X1BA 4ON0A 3OR1C 4MEYF 5FFXA 1HW5A 1WRJA 2EFQA 2O03A 1SAUA 4E7SA 2HR3A 3ABTA 5K5QA 3B6AA 5DCMA 3Q9SA 3WHBA 2PG4A 4M3BA 4XMYA 3C2HA 3TP3A 3HBLA 4BXUA 1I3QJ 1PUEE 3RKYA 2W00A 1QPIA 5H6QA 4AYBA 2FOKA 4EJUA 1YS7A 1LDDA 5E18F 2Y69H 4RGSA 2K27A 4D1QA 2L01A 3FIWA 3L09A 3A2KA 3QYFA 1Q1VA 3FXLA 2VQGA 4E6KG 2JPCA 2KFDA 1SANA 5FKKA 1DPRA 3EUHC 3CJQB 5F1RA 4CGZA 4O6JA 2L9VA 3NAUA 4GXOA 3R0JA 1QZZA 4L0ZB 1JKPC 2UV1A 3M8EA 5KNLA 1BC8C 2PJPA 3S3MA 4FE7A 2XASA 2FU4A 3PNTA 2LMDA 3OYHA 3GTOJ 2DMQA 1T2KA 4IPAA 1OCPA 3FKIJ 5FLXZ 2L4MA 4ZDOA 2EZHA 1GV2A 5IYDJ 2R5YB 2GQQA 5EYRA 1QO0D 2ECBA 4HYEA 1R00A 5E20A 3S1NJ 5D5UB 3PSIA 3X2QH 4X1EA 1WJBA 4KUMA 2K86A 2O3FA 1MH4A 3CMAI 4C30A 2DQRA 3RPUA 2UWMA 2W4SA 1OCRH 1K61A 3HKZN 3RSNA 2QKMB 1ZRCA 1QVUA 1XN7A 3MN2A 5IP6A 3VPRA 3OYBA 3BWGA 3H36A 3PIOF 1JKOC 3H9GA 4MQVA 3BG5A 3SDBA 4LB5A 4XKCA 2A07F 5L3DA 5GAGJ 1ZHFA 5DUKA 4KISA 4NHJA 4A3KJ 3I59A 3LFUA 4KJZA 5LGTA 2ZBKA 2HPIA 2E1OA 4XKWA 3MKYB 4NC6A 1DU6A 2ICWG 2LP0A 4UY8I 3EUAA 2XF7A 4WWCA 3IKTA 3Q3SA 1Z9CA 2A3SA 1UHMA 4DZPA 3D5SC 2EIMH 3RCOA 1O4XA 2IGNA 4Q48A 2DJNA 2QBYA 3EDPA 2ID3A 3MKLA 1DQUA 1KQ9A 4M3GA 1MMAA 3HUGB 4W1UA 1ZGJA 1TWAJ 2ZXWH 4MFEA 4PGHA 4NDLA 1IRFA 2M0MA 3PFIA 4NNJA 1QZYA 2VPRA 3MZHA 1QU3A 5DD4A 4LGWA 2R7WA 3KZIC 3BR6A 3OYGA 3KLNA 1OYYA 4B09A 2HS5A 3EYIA 1U9OA 3K4LA 1D1BA 3BJ6A 2CO5A 2P7VB 4HLXA 4I7HA 1MJBA 2R7OA 5ILVA 3OIQA 4LIVA 1MSEC 2WB1N 3F8MA 3CMEI 2HOTA 5GAEJ 1VQ7I 1NK3P 4IHVA 3M7GA 5EZGA 5E8GA 4DNCA 2YSRA 1HSJA 3CZ6A 1GT0C 3B6CA 2EA2A 3KX2A 3BROA 4IJAA 4UNOA 3OS2A 3SDGA 5K7ZA 3M3YJ 2K3FA 1TBXA 1PVEA 1IGNA 4B47A 1MMDA 4XIDA 2OBPA 1R23A 2GXGA 4RGRA 4U88A 1R71A 1LVAA 3F9KA 2HVRA 2GXBA 3WGHA 2LKPA 4M9XA 4BH9A 4XKBA 3KYLA 4IHSA 2LF8A 4HRIA 1Z6TA 4RS8A 1ETWA 4RGXA 3DBRB 4HF2A 1ON2A 4E70A 5CPRB 3GYHX 4OU0A 2DBBA 2ISYA 5E3MA 3HRSA 4EV0A 1RRJA 5GP9A 2E1NA 5L3GA 2K4JA 2Y0SA 1W5TA 1Y1WJ 1MBJA 1MIJA 5JR3A 3QOPA 1FX7A 2R3SA 3FHNA 2GLOA 3M07A 4P9FA 1ZN2A 2MD0A 4HAMA 4G7HF 4KN4X 4OIQF 2XAGA 4A3BJ 3BZ6A 1XCBA 2M0CA 3LQQA 4BHCA 5DS9A 3Q5FA 3M9AA 4R1HA 2HZTA 4G7ZF 2MLKA 1S3JA 4AIKA 5H2FC 5CVVA 2CUJA 2CW8A 4L9NA 2M7AA 4ZZLA 3J80K 3TEDA 4J01A 1WSUA 2CFXA 2EQRA 2Z3YA 3IL2A 2O5RA 3OL4A 1Q1HA 3CO6C 2NNYA 4G94A 1W7PD 5LEKA 2E71A 3K1MA 2ME6A 3S32A 1S6LA 1BI0A 5LEJA 5F0FA 1P4AA 5JI6A 3BQYA 1ZR2A 1WFXA 1LNWA 3FK7A 3G1OA 2P5VA 3FK6A 4EEFG 2BGCA 5E79C 4QLCU 2HOSA 1R7JA 3CESA 3ZN0A 2VASA 5DM7F 2VKEA 1R22A 1K6YA 5J4VA 3TO9A 2F5CA 1JKQC 1I39A 2CJJA 1B8IB 2FBIA 4C2UA 3H9QA 2JVHA 2VI6A 3ECHA 2BV6A 3PIPF 2ZC2A 4ESBA 2E5NA 4BACA 3HTUA 2BW3A 3G4SI 1A6IA 4FTHA 2ESHA 4RA2A 1J09A 1T98A 4HF0A 2H94A 3K4NA 3C7JA 1EA3A 1U2WA 1JHHA 4A3FJ 1OCOH 4YIFA 1VFCA 1UAAA 1FYLA 1AKHB 4EGYA 1YO5C 2E7XA 3WTUC 2V1DA 2VBXA 1FEXA 1J5YA 1G8XA 3KFWX 3I4PA 3BPVA 1UCRA 3VYRB 2CMPA 3AG2H 3DU5A 2KIQA 2MA3A 2JVGA 2BOLA 2COMA 4PJMA 2XKOA 2HQRA 2K9LA 5FD5A 3CP8A 4XLCA 3HPHA 4UUTA 5D5XB 4M3DA 4MTDA 2Q1ZB 4RLQA 3I0TA 4B8XA 2VB6A 2A5YB 4RB3C 1Z7UA 2XPVA 4AYBN 3S1MJ 5ILSA 1LEAA 3PQJA 1WI9A 3GEZA 5FKLA 4OINF 3G1MA 1SFEA 4KN7X 2CV0A 3ERED 4BJ5C 3K4JA 4PK4A 1WZ2A 2ELJA 4PZJA 2NS7A 4MTEA 3JRHA 2CW7A 4IRHA 1KZHA 4AU7A 4J00A 1SMTA 2DFHA 1WPKA 4H4KC 5BPDA 1TW3A 5KK1A 3ONQA 4BYYA 2K9QA 3HYIA 2IA2A 5LBQA 4W97A 1VQ4I 3VB2A 4KT5C 5FJ8J 1VQMI 2EBIA 1EKEA 2AO9A 2BHZA 3O2PE 2VJJA 5EGOB 4UUVA 1R49A 1RKWA 2NVXJ 4ETSA 1LDKB 4ZJZA 1TWCJ 1YJWI 3E3VA 1O3QA 2DA4A 2KQRA 2B7EA 4DYQA 2WTEA 1WJDA 3BTLA 4CYCA 4C3IJ 4PSXA 4JX4A 1A35A 3IC7A 1ON1A 4BE0A 3N4MA 2LKSA 3H3ZA 2GOMA 4EQQA 1YJ9I 1K78B 2F5EA 1T56A 1P7JA 2BVMA 3ZQIA 3HOWJ 1T0FA 2NYXA 3OYJA 3PM1A 2XUBA 4I76A 1X1PA 3TMOA 2L9SA 1IXRC 5JLXA 4RBOA 4Z6YA 1RNLA 2BVLA 2YPRA 3AG3H 3FMRA 3IAS2 5CYVA 4UV9A 1W1WE 5IP7J 2HI3A 2JA6J 3S8PA 2IEKA 1XX5A 2LR8A 2XRLA 4A12A 4MFDA 4BDZA 1FOYA 1XS9A 3P7NA 4BE2A 1FIPA 2Y75A 1WH7A 1X58A 2UXXA 3IH2A 3FMSA 1QA6A 1V55H 1BR2A 3K2ZA 3CCVI 4BBRJ 3DTKA 2PEXA 2ZNZA 2G9WA 2RAEA 1FIAA 4RDUA 4OIPF 3P9KA 2C6YA 4A3LJ 1OPCA 5BNGA 3ZQLA 2ZB9A 3FXKA 1WQ2A 4XL9A 1HW1A 4IF4A 5GTHC 3KZYA 1G3SA 2XF5A 3ABUA 4F7ZA 1FOWA 3F22A 1O57A 2LFBA 4L5EA 1AOYA 4NQWA 2M2EA 4CYDA 2VBZA 3DEUA 1MD0A 1PP7U 2NOJB 2DOEA 4MO7A 5HNHA 4FISA 3JRIA 3OWTA 3ISPA 1IV8A 5K7FA 2NVYJ 3CUQC 1TT5B 1SFUA 1RR8C 4C2TA 2R0QC 4G12A 3LQRA 2PJRB 4EGZA 4CZZA 5F08A 1RKTA 3Q9VA 1ZGWA 5DM6F 2LRDA 3A01B 4UB8C 4CDGA 1BW5A 1VI0A 3CCSI 4ENKA 1W7PB 4XRFA 4ZH4F 1EF4A 1XPXA 3H5AA 2RQPA 4XSZF 4Q5SF 1RETA 5IYCJ 3E5UA 5C3EJ 1WI3A 2KHMA 2ZJ2A 3CMMA 2PMHA 3OIOA 4IHYA 2OCEA 1ZH5A 3DP7A 3OOUA 1QHGA 4LB6B 2CQ7A 1RPWA 2X9DA 4GFBA 1B8IA 1ACIA 4CO8A 5F6FA 5F1JA 3M8FA 1NG6A 3BG3A 3H1CA 3R0AA 4KFCA 3OY9A 2DFIA 5FRNA 1BC7C 4A3DJ 1Z1DA 2ADUA 1PYVA 3KIOA 3GZ6A 3I4NJ 2DI3A 1SAXA 3U2RA 4RAZA 1LFPA 3DBLB 1JHFA 2O0YA 5FLMJ 3RZOJ 2IJLA 4R8HA 3ZN1A 1NTCA 3MEXA 2E1CA 1ETVA 2X1EA 3W2AA 1VQ9I 2DPUA 4FE4A 4B1RA 1I6XA 5IT9K 1A04A 2P81A 1HA8A 3WTXC 2EFPA 5DDGA 1MSFC 1GDTA 3K4CA 4CCOA 3J81Z 4A3CJ 2BHYA 5E8IA 1QQIA 4EM2A 2Y0SN 3OR2C 2JA2A 3SFIA 1A31A 3W2VA 4B43A 3FHZA 2FXAA 2QQ9A 3OV8A 1HKQA 2GOXB 4WK8F 5TJJA 2IGKA 2K9MA 3DV8A 2K9SA 4EATA 1BW6A 2X85A 3LMMA 4EJTA 1SVOA 3CCYA 2NRAC 3ZGKA 5HDKA 2W25A 3DPUA 2D2WA 3EPZA 5LHGA 3GTLJ 2R7FA 3DCFA 2J5OA 1JJ6C 1D5YA 2EFWA 2Q0OA 1F4KA 2R4GA 2V26A 2ZCWA 2F48A 5BS6A 2IS1A 1YTYA 5HODA 3VEPA 2HYFA 5E1XA 1BI2A 3S14J 2F4OB 4LLNA 1MMSA 4HQMA 1V4RA 2X0LA 3CCEI 3OYDA 1POGA 4M6VA 1HSTA 3V7CA 1D1CA 1XGMA 3CJNA 1FOKA 1EH7A 3F21A 2DDAA 3MKZA 3O6BB 2OTLI 1ETKA 4WXCA 1K4TA 2ME0A 3F8CA 2NAZA 4KIGA 1CF7A 4HPQA 1X4PA 1GUUA 2ZMEB 1RR7A 3HGYA 3TP0A 2FNAA 2DK8A 3ZQFA 4Y13A 4DBRA 5J1YA 4HG2A 1FPQA 3M4OJ 2JTVA 3GTGJ 1S7AA 2G7UA 3ZCOA 1HC8A 2IBDA 2HQ5A 1XGNA 2CFOA 3BG9A 3V8JA 3OL3A 3FBNB 1VNDA 2DJIA 3VFZA 4G6DA 2EFOA 4Q4ZF 3B02A 2O61A 3QAHA 1KU3A 3CLOA 1QRYA 3U1KA 4KNYA 5EEAA 4IO9F 2R93J 1GHCA 4H0EA 5FKNA 3S1RJ 1TT0A 3HTSB 4ZC3A 3VODA 3HOXJ 2MLGA 5KAIC 4OWRB 2HQNA 2JMWA 2M9HA 3T8RA 1D0XA 2M7BA 5K5OA 2YX7A 3KP5A 9ANTA 1MDMB 1IO2A 3CCUI 3WTWC 4Z2YA 4YIIA 3E7LA 3GXOA 2DODA 1BJAA 3LSHA 3JAMZ 3Q0UA 3TGNA 5H6RA 2FE3A 1FBQA 1Z0XA 2L3DA 2P5LC 1BIAA 5DTDA 3BCAA 4QWQA 2XGEA 2DOAA 1K83J 1BOAA 3BY6A 3PNVA 2E1MB 2DT6A 3W2WA 1MGTA 3WTYC 1N25A 3JRAA 2MH2A 2KMUA 3MMYB 2L5QA 2PLYA 2FUG2 2VBYA 4QSHA 3H5RA 1Z6RA 1ZR4A 3JSOA 2O6GE 3GTMJ 2HTJA 3I58A 5J6XA 2CSOA 2KRHA 2OD5A 2ISZA 1ODDA 3DFGA 3FBIB 3MAJA 2BBYA 2CQNA 3F8FA 1LE8B 3VWBA 1U3EM 2A6TA 3KP3A 4AUXA 3ABKH 2JSCA 3JW4A 2CV2A 1TW2A 2DT5A 3PL8A 2DA1A 1UG2A 5B66C 1I5ZA 2IXSA 2EFNA 2DA7A 2JK3A 3L2VA 1MZBA 1D0YA 2WBMA 4I0BA 5IY5H 3J7AO 1X19A 1WHUA 2LVSA 2ZO4A 5AONA 3OSGA 2FF4A 3J7AY 3CDLA 1YW9A 5LLQA 5HOOA 3WTTC 1XTAA 2LYCA 1DUXC 2E2IJ 1LEBA 4XOTA 2MGQA 3E5XA 3V42A 2HXOA 3ABLH 2A6EF 1H0MA 1F5TA 4RM3A 1I3AA 2JA8J 3FF5A 4AIHA 1Z3YA 4LD5A 4HV5A 4MGRA 3IAM2 3TOBA 4ESJA 1FC3A 1H9GA 1D3YA 1BIBA 4F3QA 2X6WA 4BAYA 3HIFA 1IN4A 3MQ0A 3VYUB 5L3CA 3HOYJ 2OAZA 2P5KA 3FXRA 1B72A 3SEQA 1FT9A 2RN7A 1SVMA 1FJLA 1YLFA 3H9JA 2K7LA 5EEGA 3L2QA 2F2EA 3LL7A 2YU9J 2EV5A 2GBYA 5FRMA 2QLZA 2MABA 2O9LA 3WGIA 1MMNA 4UHTA 3GFJA 2RDPA 4D9JA 2I5UA 3D5LA 2F4IA 3LAPA 3EQLF 2DK5A 2L54A 1TQPA 2FQ3A 5E3OA 1FTZA 2P0WA 3WTZA 4PUSA 3FXQA 1F9NA 2ZKZA 3OYFA 1E0EA 4BQQA 2XAQA 3DEWA 1XSVA 5M5WJ 4CA0A 1ZREA 2IRFG 3AKZA 1UHWA 1P6RA 1SEUA 4YEJA 4BS9A 2EIKH 3IHUA 4XONA 2OUMA 2RKHA 3RIRA 1W5SA 4E7LA 2FJ1A 5DCFA 3CC7I 3HG9A 1NH3A 5F04A 3W6KB 3V4GA 2HDWA 4XBFA 3QQAA 3JRGA 3ESWB 2MH9A 1LKXA 1NHAA 3NQOA 5CJ9A 2XV4S 1USTA 5CVRA 2JUCA 2M34A 5KCMA 3FXMA 3WU1B 4I01A 5EG0A 4JK1X 2CYYA 1FSHA 4BJ6C 4Q47A 4L5JA 4M9ZA 2HKOA 4A3MJ 2MBFA 1IN7A 1U5TC 1ZG3A 1T6SA 3T8TA 4LLGF 3TOAA 1WGXA 1X1AA 2V9KA 2XAFA 1DPUA 4BY7J 1VQ8I 1YHQI 2IPQX 1ZKGA 3OOPA 2G7HA 1Y8RB 3F6OA 1T38A 3ABMH 1XGOA 3J80Z 4E7HA 2W85A 1Y0NA 3MCZA 2OTJI 2CWEA 4A5NA 2Z99A 1I27A 1M1EB 2QYOA 2IGOA 3CCQI 3HL2A 3HZJA 4RAGA 5FROA 1RI7A 3CCJI 3S17J 5FLXK 2JUGA 2LKXA 1R36A 2QSHX 1QNTA 4CUGA 4BDYA 3I64A 3ZOBA 5HVQC 1SVLA 3HOTA 3CUOA 1WKMA 1GLNA 2K4BA 1MDMA 2ESNA 1UHSA 5E17F 4MEXF 5F0CA 2VXZA 2CS3A 4M6XA 4AVPA 3O8GA 1F1ZA 3JRBA 2RGVA 2RC4A 1XD7A 2XDVA 1ONVA 4EMSA 3N97A 3GZ5A 3PO2J 3LSPA 3G3ZA 1YRNA 4XLNF 3KP7A 3CF5F 3HOVJ 4JYKA 1PP8F 2KJBA 4OAZA 1IXSB 1HOMA 1X1DA 3CTAA 4ASNA 3PUFA 2DFEA 4BHBA 2X1CA 2JA5J 1FLIA 4XICA 2OC6A 2ZXHA 3HPGA 2HOEA 3HXLA 2QSFX 1ERDA 3GO5A 3PSFA 4DYRA 2IT0A 1U78A 1GV5A 4XORA 1T33A 3T1BA 1STZA 5HDGA 1T08B 2XC7A 1EH6A 3VYTB 5M3MJ 2GIVA 2J5PA 3G2BA 3RKXA 3M1EA 2V9PA 4KDPA 1FNNA 3A0HC 5J3LA 2I10A 5FB2A 1ZLKA 2ZJQF 3JSPA 2RREA 4IX7A 2WC2A 3TKYA 3TW6A 3IWFA 3JREA 1IXCA 4V2FA 1YQAA 4XM3A 3QRFF 4ESFA 3ZRGA 1X3WB 5DD8A 1U9NA 1DGWY 3ZQQA 3U1DA 3DTEA 3RQ4A 2Z16A 4I09A 1SC7A 4DYCA 1Y1VJ 1O7FA 4DBQA 1TNSA 5BPIA 4GO1A 2AQFA 2IW5A 2VT3A 4RMNA 2QSGX 3F3XA 3U21A 2OZ6A 2EILH 3S15J 4LLLA 3EYYA 1K7AA 1LPQA 3CDHA 2XGDA 2R5ZB 3NWSA 4S0HB 2R5YA 2VLAA 3BR0A 3TO7A 1QPMA 1UMQA 2DLLA 2DXIA 1KONA 2H27A 3F72A 3RKQA 4GGGA 1LFBA 1Z3XA 2DMTA 4XLFA 3S2DJ 3V8KA 5ICFA 1P9QC 1OYWA 1G3YA 4I02A 4UXNA 2H6BA 2CW0F 2JSPA 3C3WA 4EJVA 1P4XA 2D45A 1WJFA 4UUSB 3K4MA 2EB7A 3IV5A 2WV0A 3K10A 4HNTA 1R1VA 2OV7A 3MKWB 3ZQCA 1VZ0A 5TGTA 3G6EI 1W36C 5E3NA 4M6YA 1P2FA 1J9IA 4GDFA 2QQAA 3L7WA 4HBLA 2FBHA 2NS8A 4PJNA 1IUFA 2PBIA 2JWTA 1OMIA 4RB0A 3RPUD 2AXTC 2WAFA 3TL4X 1P7IA 5FKMA 2D1HA 3FMQA 1S8NA 1ETYA 5DYMA 2F5VA 3OYEA 2KT0A 3KPHA 1IZ1A 2QZ8A 1OCTC 3ZPLA 2OA4A 1BI1A 2Q2EB 1MJAA 1D8KA 1MJ9A 1X1CA 2DYRH 3ML6A 2JN6A 2X6YA 4A3EJ 2NNNA 2M8EA 1IF1A 1BI3A 3CDIA 4K2EA 3HUGA 2ZXJA 2H6CA 3HSRA 4B48A 3IUOA 1R9TJ 2OF7A 4KA4A 2M8GX 1X4OA 3SZGA 2VE9A 5AIQA 3FXJA 3L00A 1QGPA 4FASD 1ORKA 1PDNC 1UFMA 4LITA 1VQLI 2ELKA 4YFKF 4LK1F 2LK2A 3IH4A 2BY0A 1B1BA 5GPAA 4B3XA 3WTSC 3OS1A 3OMYA 1W4MA 1HKSA 2CH0A 1SFXA 2K9NA 4F92B 1MNEA 2JZYA 2R7SA 4U0VA 2LBFB 2DOFA 5J8CA 4RAYA 3OYKA 4PFPA 3K70D 1BA5A 2D5VA 4G6TB 2FMYA 2TDXA 1MMGA 1USSA 2LD5A 4BQOA 4BXFA 2ID6A 1QZEA 5HLHA 3LFKA 3ULQB 4A0YA 3L2WA 2V1XA 3BC8A 1AWCA 2OU2A 1WWXA 3K1PA 4RM2A 3I3LA 2DMNA 1X2MA 1CQTA 1YX3A 1O7LA 5ED4A 1Y39A 1J59A 4YG2F 3MD2A 2FA5A 2N8GA 3K1NA 3NEUA 1G3TA 3LA7A 4CICA 2ZSHB 2M1BA 3I4MJ 2FNPA 1PUFB 3BR3A 3VDXA 2STTA 4XRMA 2AHQA 4GRIA 1B9NA 4YFXF 1O3TA 3C2BA 4AWXB 3E6MA 3RZDJ 5KAFC 4YIRX 4FX0A 4N4NB 5IOYA 2FSWA 2Z33A 1XSDA 4G9YA 3HGGA 1ZELA 4EJOA 3T0YA 3L9FA 4HSTA 1N78A 5IT9Z 5L3FA 3I56I 2F5FA 3BZKA 2XHKA 2H1KA 1FOXA 2V4JC 2XAHA 3BR5A 2EK5A 3GVAA 4OOIA 3JRCA 3AL0C 3VSKA 4HEA2 4KT6A 2EWNA 5CKTA 4EM1A 3RQIA 3BG6A 3A1YA 1YS6A 3LSJA 3A4CA 2KIFA 1X2NA 3CF2A 3GFIA 1U8RA 1ETOA 2MSYA 3QYEA 4ZZDA 2V7FA 3OS0A 1KQ8A 5FD6A 3OYAA 5CVIA 3QODA 3C18A 4N0BA 2HEOA 1ULYA 3ZMDA 3ECOA 3WGGA 4KICA 2DT7B 4FQGA 4U0WA 3DKXA 4TV7A 5DCMB 2W24A 3LA3A 2KP6A 4DGWB 3DU6A 2ZFUA 2KDZA 5A2QK 4JX6A 3KEOA 3NARA 1W5CC 1T8IA 2DA3A 1JUMA 5ICGA 2QGUA 2XRNA 2B0LA 1ZARA 3KP2A 2BE5F 2MD5A 1LVKA 3TO6A 1DGRM 1KU2A 1ITYA 3CLQA 4A5MA 5HNFA 5K1YA 2FEZA 1ZK8A 3LSIA 1S29A 4F93B 1RUNA 1XCVA 1TC3C 4PGGA 3GTKJ 2UXNA 1H9TA 1MNMC 2M87A 1I1GA 1RUOA 1R58A 1IAWA 4IOAF 1DP3A 3IH3A 4PDKA 1XMXA 2YX4A 3E6CC 2EJRA 1AKHA 1OKRA 5H20A 2JRMA 4XRSA 2HDCA 4RB2C 4BGDA 4XSXF 3BTJA 3PJRA 5L3BA 1ZGAA 2K3PA 1WJAA 5L3EA 3PNYA 3AL0B 3JCUC 2QENA 5CVUA 2LDUA 2OPTA 3CD6I 1R1UA 4V19K 5B1BH 3K70C 1WCMJ 3HSEA 3HHGA 2ZNYA 5DEQA 2DO7A 1P92A 3CUQB 2IS4A 1LJ9A 3OIPA 1Z05A 1S9HA 4P5OA 3TDUC 3DQVC 4PCQA 5D6FA 3GWZA 4A3GJ 4ZYGA 4LIUA 1J2XA 1R5HA 1Z67A 5DUIA 5HS8A 5B5EC 2XPUA 4ZYEA 3WTVC 4O3MA 4X6AJ 2FBKA 5FGMA 3OYLA 2TRTA 4KMFA 1T39A 1U8BA 2ETHA 1JTYA 1KU7A 2H8RA 2L7MP 3FX3A 2GAUA 3F8BA 2GA2A 4YELA 4M3FA 2WADA 2ECCA 2BYVE 3Q0VA 2ZJPF 3G73A 5LGNA 5LHHA 2QCOA 4N4OB 2KZVA 1G6NA 4A2UA 4IRGA 3I59B 3MWMA 4IEJA 2KL4A 3ELKA 5EGOA 1E3OC 5B3SH 3SQNA 4E7KA 1Y6IA 2KISA 3KZZA 4QIWN 4Y15A 1H89C 2G0EA 3P9CA 4XKVA 3KYCB 2H8WA 3T5XA 4J19A 1QHHD 1U6GA 2KPMA 1JGSA 2PI0A 2JJ7A 1SD5A 2QBYB 1MKMA 2EV6A 2VL8A 3K9TA 3MZYA 2DCEA 1K78A 2HZDA 3BT9A 5F0HA 1APLC 2Z2SB 5EZHA 4CCJA 3GX4X 3DEEA 2DU9A 1BM9A 1MBGA 2WWYA 3AG4H 3BLYA 1L3LA 5BQTA 3H3UA 2IS6A 2EZIA 5EF6A 3WHCA 1LB2A 1R5GA 4M71A 1HDDC 2V1UA 3C2GA 2E34A 3CJRB 4YRVA 3FWEA 2H1LA 4WCGA 2MYSA 1G59A 3CP2A 1I1SA 2FMLA 2L0KA 2P6TA 2VODA 4AD9A 2VQCA 5FFZA 2RV8A 2DA6A 2M4GA 1KYZA 2CQQA 2E5ZA 2IAIA 2R7QA 3GBGA 4KIBA 3JR9A 3J81K 3C1DA 3ZQGA 4B44A 5D4RA 5F27A 5M3FJ 4LG0B 4X0GA 3HM5A 1IN8A 1NK2P 1IUYA 3ZP5A 2LREA 2YS9A 1TTYA 2YR2A 3K4BA 4LG3A 3BOQA 4L9TA 1BR4A 1K79A 1IJWC 3AAFA 4CZCA 3NWTA 2LC2A 5E1WA 5AIPA 3OYNA 1SD4A 5TISC 1BJZA 2MW8A 2HU9A 2VC0A 4CCKA 4L9VA 4OIOF 1OYIA 2HNHA 4LK0F 4I2OA 4WX9A 4RAFA 3HRTA 2DW4A 2L7KA 1SFKA 1EJ9A 5LHIA 4XNFA 4CCMA 4CSWA 1BL0A 3RYRA 4BBSJ 1LFUP 1H88C 5C4XJ 2PJRA 2H09A 4E4HA 1MBKA 2IA1A 2GZWA 1V5GA 3A01A 1JGGA 2GXAA 3BPXA 4E7JA 2RNGA 3GFLA 3A03A 3P5JA 3FDYA 4DQ2A 1JT0A 3GLXA 1W7PA 2YU3A 3SFZA 2VKVA 2XB0X 3HEFA 3ASNH 3KE2A 1ZTRA 4F55A 5ILUA 4BY1J 3S2WA 2HYGD 1J0RA 2VXDA 3I55I 5D5VB 3L1PA 3RPQA 2VE8A 3BDDA 4I98B 3BP8A 1MNDA 1UB9A 2E35A 2JPBA 3ERMA 5LFAA 4IZZA 3BZCA 2K02A 4DJAA 1IRGA 3HJEA 3O8HA 2WY7Q 3JRFA 2DDBA 4IXAA 3SJMA 5DV5A 1D1AA 2OQGA 3DLLF 3S3OA 1A5JA 4S04A 4UVAA 3FM3A 3DBHB 4ENMA 2XPWA 2L2OA 3GCMA 4UVCA 2KKOA 2V6CA 3TQNA 5M5XJ 2PMZA 2VT2A 3CUQA 4HQEA 3JAMK 4UV8A 2DTRA 3S2HJ 1IDZA 1UJ8A 4P1WA 4AIJA 3KP4A 3F23A 1FYMA 2BW3B 2ZXIA 2A69F 3MVPA 1WJCA 2HGCA 2ACJA 3COAC 3FXOA 1EH8A 3MZ8A 3GMEA 3KEYA 5IT3A 2LF7A 4Y17A 4HNVA 4HLYA 1FSEA 1P4WA 2LLKA 3DXJF 3IKVA 2E2HJ 1HKTA 1D5VA 4I0AA 4A6DA 4P9UA 4P55A 4FX4A 1V5EA 3HOZJ 1GXQA 3QU6A 4OMZA 2LOOA 4BJTA 5K5RA 1OR7A 2NVTJ 2VN2A 4DW6A 1ETQA 2HYJA 5D6EA 3J7YJ 2EZKA 4JX5A 1T0FC 2KIMA 5FKOA 1TWGJ 3WG7H 1K6OA 3B73A 2LY9A 2Z5UA 4NB5A 1JUPA 4BNCA 1L0OC 4KYWA 1JXSA 5IOZA 2I8DA 2CV1A 1XC5A 4FETA 3PQKA 4L0YB 4D7NA 3S1QJ 2AQEA 1K4SA 2HTSA 2VKHA 2B9SA 2PX9A 1OJLA 1XGSA 2A68F 2FQ4A 2P4WA 1G4DA 1HF0A 1HXDA 2LY2A 1S72I 4JBAA 3ROUA 3W3CA 4OAYA 3HC7A 4A0ZA 2ZMEA 3AFHA 4A3JJ 1SD6A 2A61A 3QPSA 3H0DA 2W84A 2EZLA 1Z21A 1HW2A 1U0JA 5BOXA 1W36D 3SZTA 2M45A 5D5WB 1E3PA 4GYGA 5E1ZB 1AHDP 1IW7F 4RGUA 5KVRA 2CGPA 2X1DA 1VQKI 2VONA 2XVCA 1TWHJ 4G7OF 2L7ZA 3GZNB 3JTHA 2HXIA 2HOAA 2WAEA 1JTXA 2DMPA 1MBHA 3EUKL 1RIOH 5C4JJ 2DMUA 3K6GA 3CCLI 4HZFA 2OJED 3K2AA 3P9IA 2OCCH 3VYSB 4CYCB 4EM0B 5J1UA 4BEHB 1XMAA 3LSTA 2MC4A 3H35A 4LG0A 5GPCA 4M74A 1Z91A 4HOBA 1B4AA 2LH9A 5FO5A 1SD7A 1VTNC 2QEXI 5JVGF 4D5FA 1XB4A 4LFUA 3SHFA 2GIZA 2R7VA 5J1RA 4MIMA 5EEHA 3LWFA 1YJNI 1IV6A 3H3VK 2IGMA 1ZYRF 3SEZA 2L02A 1U5TB 1O3RA 2VOOA 3CJTB 1GVDA 4LOCA 2AXLA 3ZMZA 5JVTA 2HPMA 5JLWA 3CC2I 2ZJRF 4IOCF 1ZLJA 4C3HJ 3BR2A 1HBXG 3OYCA 4L18B 2ZSIB 1FMVA 1MBFA 4WXDA 4HDUA 2DA5A 1LE8A 1MW7A 1ZQ3P 3PFYA 3M8JA 3S93A 1IN6A 2K5CA 2NXNB 3FKJA 4UB6C 1XSXA 1D8JA 1XDSA 1D0ZA 3K0LA 1YW8A 1ENHA 5ICCA 2EIJH 4Y52J 4IVNA 3GUDA 4E7IA 3BQZA 2VC1A 3E97A 4CH7A 2F6CA 3I71A 3ZMTA 1T95A 2X48A 2VPLA 2L9NA 1RZ4A 4MLOA 1YG2A 1E17A 1ETXA 2QA4I 1AA7A 3HDDA 2EA4A 3OYIA 2GWRA 2EH3A 4NQWB 4CXFA 1OQYA 3ASOH 2HVQA 1IRZA 1VQOI 2XROA 2QWWA 1XDUA 2L4AA 3SXYA 2O7OA 2DPDA 1S7OA 1FBSA 2Y9YA 2MG4A 2BY3A 2X4HA 2CQXA 3VSLA 4A0XA 4LMYA 5HDNA 1OISA 1Z77A 1HCRA 2P7CB 3HHHA 2PMUA 3F0CA 4ZDLA 4U7DA 2L7FP 3NRVA 5FLVA 2WA0A 3E5QA 1LUJB 5GTIC 3K69A 3ZR8X 3HRMA 2NOGA 1DU0A 2NVQJ 2CUZA 2GA1A 6PAXA 1GXPA 2IA0A 4Y4RA 3D1NI 3REOA 2BY1A 3LSKA 4PSWA 2DYSH 1JUSA 3F6VA 1QBJA 1O3SA 2EPFA 4ZYDA 4I99C 4A69C 3EETA 1FTTA 3QP5A 3IRRA 1FYKA 4N9HA 5J4YA 2VJ5A 3BR1A 3GW2A 2GM4A 2FD5A 4IHXA 2E19A 3V7SA 4ZTJA 1JE8A 1IN5A 2VIXA 4F91B 4MQ9F 5F64A 3RYPA 2P8TA 1IRXA 3QPLA 2COBA 1TQIA 4C2MJ 1OLTA 4CCNA 3GFMA 5JHFA 3QWLA 2QF7A 2DFFA 3KP6A 1LQ1A 2FX0A 4D0PA 3BJAA 2KDOA 3RKWA 3QPHA 3S16J 3EUHA 4IL6C 4D7MA 1FWZA 1BN5A 5HS7A 1OCZH 1VQPI 5LD2C 3HB9A 2R92J 2DQLA 4LJZF 2HFHA 3DLAA 1EV7A 1X3UA 3LOCA 1TLHB 4II2A 5HLTA 2M30A 2IVMA 2LTPA 2MFZA 5LRSA 3FZVA 4Y33A 3RDIA 3SZPA 3UNGC 3QYBA 1E3HA 3CCRI 4L9JA
chains in the Genus database with same CATH topology
1F43A 1MSEC 1MNMC 2WB1N 2HOTA 4IHVA 1NK3P 5EZGA 3IH3A 1AKHA 4XRSA 4XRSG 1GT0C 3B6CA 1LE8B 3BTJA 1HDPA 4AUXA 1TWFJ 3SDGA 5K7ZA 1IG7A 3M3YJ 2DA1A 2OPTA 1UG2A 1IGNA 4XIDA 1WCMJ 2DA7A 2JK3A 2CUEA 2LVSA 3OSGA 1JJ8C 1VF9A 3CDLA 3G1LA 4ABZA 4A3GJ 4B3AA 1ETWA 1MBEA 2XPUA 2E2IJ 4X6AJ 2MGQA 2HXOA 3CQZJ 4BXXJ 2TRTA 5IYBJ 2JA8J 1OFCX 5E3MA 1U8BA 1S7EA 5GP9A 1JTYA 2H8RA 5E3LA 1Y1WJ 1MBJA 2L7MP 2PMZN 2GLOA 4M3FA 3HOYJ 2ECCA 3Q0VA 1B72A 4A3BJ 2M0CA 2QCOA 1FJLA 5DS9A 2CU7A 2YU9J 2GBYA 4IEJA 2O9LA 5EGOA 1E3OC 4IHWA 2B63J 3TEDA 5EDNA 4QIWN 1H89C 2EQRA 2G0EA 2L9RA 4J19A 1FTZA 5E3OA 2WV1A 2JJ7A 2ME6A 5F0FA 1QVTA 1ZR2A 3BQYA 3DEWA 3FK7A 3G1OA 5M5WJ 2DA2A 3FK6A 4EEFG 2JA7J 3BT9A 5F0HA 1APLC 3BTCA 5EZHA 1H8AC 2HOSA 4A93J 2DN0A 1MBGA 2VKEA 2EZIA 5EF6A 3WHCA 1XG1A 1HDDC 2FJ1A 4I6ZA 5F04A 1JKQC 3GTPJ 2CJJA 3JRGA 1WH5A 3QQAA 1B8IB 3TW7A 2VI6A 4DZJA 2M34A 2L0KA 2DA6A 1A6IA 4FTHA 2CQQA 2IAIA 3GBGA 5EG0A 2XGCA 3JR9A 3ZQGA 5M3FJ 4A3MJ 5F27A 1MH3A 3JRDA 3FISA 4A3FJ 1NK2P 3HM5A 1VFCA 2X6OA 1WGXA 1AKHB 2YS9A 4V2GA 4BKXA 2E2JJ 4BY7J 1FEXA 1F36A 5K7HA 1ZKGA 4JP0A 1IJWC 5C44J 2R5ZA 1BJZA 2MW8A 3GTQJ 4UUTA 4M3DA 3S17J 2LKXA 3LNQA 1I50J 1BL0A 2XPVA 4AYBN 4BBSJ 1LFUP 3S1MJ 3ZOBA 4UUSA 1H88C 5C4XJ 5FKLA 3G1MA 1MBKA 3A01A 1HLVA 1JGGA 4D5CA 3A03A 4XK4A 1UHSA 1JT0A 5F0CA 2NS7A 4FCYA 3JRHA 1B72B 2K40A 3O8GA 3JRBA 1WPKA 2VKVA 2XB0X 3HEFA 4A3IJ 2K9QA 2XB5A 4W97A 1ZTRA 1JT6A 3LSPA 3PO2J 5FJ8J 2EBIA 4BY1J 2AO9A 5EGOB 2DTZA 1I6HJ 2O8KA 1RKWA 1YRNA 2NVXJ 3HOVJ 4JYKA 1TWCJ 3L1PA 3LSRA 1HOMA 2DA4A 4DYQA 2JA5J 4XICA 3BTLA 1IDYA 4C3IJ 4CYCA 4JX4A 4DYRA 1U78A 1GV5A 2Y2ZA 1T33A 1P7JA 1T56A 2YUSA 3O8HA 3ZQIA 3HOWJ 3JRFA 4M3EA 2VUMJ 3Q0WA 3SJMA 3PM1A 5M3MJ 1A5JA 4I76A 1RESA 1AU7A 5JLXA 4RBOA 2XPWA 1JKRC 4C3JJ 2TCTA 3W6VA 5J3LA 2I10A 5M5XJ 5IP7J 3HOUJ 2HI3A 2JA6J 2IEKA 3TW6A 3S2HJ 2LR8A 1IDZA 3JREA 2XRLA 2Y30A 3CMYA 4MFDA 4V2FA 1XS9A 3MVPA 5EG0B 1FIPA 1WH7A 3A02A 1U9NA 1X58A 3IH2A 4HNVA 2LLKA 2E2HJ 5M5YJ 4BBRJ 1Y1VJ 4DYCA 3HOZJ 3UKGA 2RAEA 1FIAA 4RDUA 4A3LJ 5BNGA 3ZQLA 5IP9J 2ZB9A 2NVTJ 4DW6A 1ETQA 3OSFA 2HYJA 3BTIA 3PO3J 2EZKA 2CUFA 3S15J 4JX5A 4B4CA 5FKOA 1TWGJ 2XGDA 2R5ZB 4L5EA 2LFBA 4S0HB 2R5YA 2LY9A 2HDDA 3BR0A 2M2EA 2W48A 1JUPA 1UMQA 1PUFA 3RKQA 5IOZA 2XSDC 1LFBA 2DMTA 3S2DJ 1XC5A 4MO7A 4FISA 1W0UA 3JRIA 1SFOJ 4D7NA 3S1QJ 2CRGA 4Y7NJ 5K7FA 2NVYJ 3LSGA 1OJLA 2FQ4A 1HF0A 2R0QC 4G12A 2R7ZJ 4UUSB 3IV5A 5F08A 1RKTA 3K7AJ 3ZQCA 1ZGWA 5IPAA 3A01B 4A3JJ 4QTRA 5E3NA 1BW5A 1VI0A 3QPSA 1EF4A 2EZLA 1RETA 5IYCJ 2NS8A 3H0GJ 1AHDP 5C3EJ 1IUFA 1WI3A 2WAQN 3OIOA 4IHYA 2JWTA 1IC8A 3OOUA 3ZQHA 1P7IA 5FKMA 4AC0A 1TWHJ 1RPWA 2X9DA 1ETYA 4GFBA 1B8IA 2L7ZA 2Y9ZA 1YRNB 5F1JA 2HXIA 2HOAA 2KT0A 1JTXA 2DMPA 3BG3A 1W0TA 1MBHA 1OCTC 2Y31A 1G2HA 3GTJJ 5C4JJ 2DMUA 4A3DJ 2JN6A 3K2AA 4A3EJ 3I4NJ 4CYCB 5J1UA 3B6AA 3WHBA 5FLMJ 3RZOJ 1R9TJ 2OF7A 2M8GX 4M3BA 1NTCA 5GPCA 3TP3A 1ETVA 3HBLA 4FE4A 1ORKA 4B1RA 1I3QJ 4D5FA 2P81A 2ELKA 1MSFC 1QPIA 1GDTA 2LK2A 3IH4A 5J1RA 4A3CJ 4MIMA 5GPAA 1IV6A 3H3VK 2Y0SN 3SFIA 2K9NA 1GVDA 3FIWA 1Q1VA 4LOCA 1SANA 5FKKA 5JLWA 2D5VA 1BA5A 4C3HJ 3BR2A 3NAUA 2LD5A 1MBFA 2K9SA 1JKPC 1BW6A 2ID6A 2DA5A 3CCYA 1LE8A 1ZQ3P 4FE7A 3GTLJ 1ENHA 3GTOJ 4Y52J 2DMQA 2DMNA 3DCFA 1JJ6C 1D5YA 1OCPA 1X2MA 3BQZA 1CQTA 3FKIJ 2X48A 5HODA 2N8GA 4MLOA 3S14J 1ETXA 2EZHA 3HDDA 1GV2A 5IYDJ 2R5YB 5EYRA 2EH3A 3I4MJ 2ECBA 1PUFB 3BR3A 1IRZA 4XRMA 2AHQA 1POGA 4M6VA 3S1NJ 3C2BA 4X1EA 2O7OA 3RZDJ 2Y9YA 2MG4A 1MH4A 5IOYA 2CQXA 1Z77A 3HGGA 1ETKA 1HCRA 1K61A 2ME0A 3HKZN 3F0CA 2L7FP 5FLVA 1QVUA 3MN2A 5IP6A 3VPRA 2NOGA 1DU0A 2NVQJ 1GUUA 3TP0A 1RR7A 3HGYA 5J1YA 1JKOC 3ZQFA 3BR5A 3BG5A 2H1KA 3M4OJ 3GTGJ 3D1NI 3JRCA 2IBDA 1JUSA 2HQ5A 4A3KJ 3BG9A 1VNDA 3RQIA 2E1OA 4A69C 3LSJA 1DU6A 1FTTA 1QRYA 1X2NA 2LP0A 5EEAA 2R93J 3BR1A 2MSYA 1ETOA 2FD5A 2GM4A 5FKNA 3S1RJ 4IHXA 2E19A 3Q3SA 3HOXJ 4DZPA 1O4XA 2JMWA 2M9HA 2DJNA 2ID3A 3MKLA 9ANTA 3E7LA 3QPLA 4M3GA 4W1UA 2COBA 4C2MJ 1TWAJ 4MFEA 2QF7A 3Q0UA 4NDLA 2FX0A 1Z0XA 2KDZA 4JX6A 3NARA 2VPRA 5DTDA 3S16J 2DA3A 2XGEA 4D7MA 1JUMA 1K83J 3HB9A 2R92J 1ITYA 3BR6A 3LOCA 3JRAA 1ZK8A 2LTPA 1U9OA 1TC3C 4QSHA 3GTKJ 1ZR4A 3GTMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F43 A;  1MSE C;  1MNM C;  2WB1 N;  2HOT A;  4IHV A;  1NK3 P;  5EZG A;  3IH3 A;  1AKH A;  4XRS A;  4XRS G;  1GT0 C;  3B6C A;  1LE8 B;  3BTJ A;  1HDP A;  4AUX A;  1TWF J;  3SDG A;  5K7Z A;  1IG7 A;  3M3Y J;  2DA1 A;  2OPT A;  1UG2 A;  1IGN A;  4XID A;  1WCM J;  2DA7 A;  2JK3 A;  2CUE A;  2LVS A;  3OSG A;  1JJ8 C;  1VF9 A;  3CDL A;  3G1L A;  4ABZ A;  4A3G J;  4B3A A;  1ETW A;  1MBE A;  2XPU A;  2E2I J;  4X6A J;  2MGQ A;  2HXO A;  3CQZ J;  4BXX J;  2TRT A;  5IYB J;  2JA8 J;  1OFC X;  5E3M A;  1U8B A;  1S7E A;  5GP9 A;  1JTY A;  2H8R A;  5E3L A;  1Y1W J;  1MBJ A;  2L7M P;  2PMZ N;  2GLO A;  4M3F A;  3HOY J;  2ECC A;  3Q0V A;  1B72 A;  4A3B J;  2M0C A;  2QCO A;  1FJL A;  5DS9 A;  2CU7 A;  2YU9 J;  2GBY A;  4IEJ A;  2O9L A;  5EGO A;  1E3O C;  4IHW A;  2B63 J;  3TED A;  5EDN A;  4QIW N;  1H89 C;  2EQR A;  2G0E A;  2L9R A;  4J19 A;  1FTZ A;  5E3O A;  2WV1 A;  2JJ7 A;  2ME6 A;  5F0F A;  1QVT A;  1ZR2 A;  3BQY A;  3DEW A;  3FK7 A;  3G1O A;  5M5W J;  2DA2 A;  3FK6 A;  4EEF G;  2JA7 J;  3BT9 A;  5F0H A;  1APL C;  3BTC A;  5EZH A;  1H8A C;  2HOS A;  4A93 J;  2DN0 A;  1MBG A;  2VKE A;  2EZI A;  5EF6 A;  3WHC A;  1XG1 A;  1HDD C;  2FJ1 A;  4I6Z A;  5F04 A;  1JKQ C;  3GTP J;  2CJJ A;  3JRG A;  1WH5 A;  3QQA A;  1B8I B;  3TW7 A;  2VI6 A;  4DZJ A;  2M34 A;  2L0K A;  2DA6 A;  1A6I A;  4FTH A;  2CQQ A;  2IAI A;  3GBG A;  5EG0 A;  2XGC A;  3JR9 A;  3ZQG A;  5M3F J;  4A3M J;  5F27 A;  1MH3 A;  3JRD A;  3FIS A;  4A3F J;  1NK2 P;  3HM5 A;  1VFC A;  2X6O A;  1WGX A;  1AKH B;  2YS9 A;  4V2G A;  4BKX A;  2E2J J;  4BY7 J;  1FEX A;  1F36 A;  5K7H A;  1ZKG A;  4JP0 A;  1IJW C;  5C44 J;  2R5Z A;  1BJZ A;  2MW8 A;  3GTQ J;  4UUT A;  4M3D A;  3S17 J;  2LKX A;  3LNQ A;  1I50 J;  1BL0 A;  2XPV A;  4AYB N;  4BBS J;  1LFU P;  3S1M J;  3ZOB A;  4UUS A;  1H88 C;  5C4X J;  5FKL A;  3G1M A;  1MBK A;  3A01 A;  1HLV A;  1JGG A;  4D5C A;  3A03 A;  4XK4 A;  1UHS A;  1JT0 A;  5F0C A;  2NS7 A;  4FCY A;  3JRH A;  1B72 B;  2K40 A;  3O8G A;  3JRB A;  1WPK A;  2VKV A;  2XB0 X;  3HEF A;  4A3I J;  2K9Q A;  2XB5 A;  4W97 A;  1ZTR A;  1JT6 A;  3LSP A;  3PO2 J;  5FJ8 J;  2EBI A;  4BY1 J;  2AO9 A;  5EGO B;  2DTZ A;  1I6H J;  2O8K A;  1RKW A;  1YRN A;  2NVX J;  3HOV J;  4JYK A;  1TWC J;  3L1P A;  3LSR A;  1HOM A;  2DA4 A;  4DYQ A;  2JA5 J;  4XIC A;  3BTL A;  1IDY A;  4C3I J;  4CYC A;  4JX4 A;  4DYR A;  1U78 A;  1GV5 A;  2Y2Z A;  1T33 A;  1P7J A;  1T56 A;  2YUS A;  3O8H A;  3ZQI A;  3HOW J;  3JRF A;  4M3E A;  2VUM J;  3Q0W A;  3SJM A;  3PM1 A;  5M3M J;  1A5J A;  4I76 A;  1RES A;  1AU7 A;  5JLX A;  4RBO A;  2XPW A;  1JKR C;  4C3J J;  2TCT A;  3W6V A;  5J3L A;  2I10 A;  5M5X J;  5IP7 J;  3HOU J;  2HI3 A;  2JA6 J;  2IEK A;  3TW6 A;  3S2H J;  2LR8 A;  1IDZ A;  3JRE A;  2XRL A;  2Y30 A;  3CMY A;  4MFD A;  4V2F A;  1XS9 A;  3MVP A;  5EG0 B;  1FIP A;  1WH7 A;  3A02 A;  1U9N A;  1X58 A;  3IH2 A;  4HNV A;  2LLK A;  2E2H J;  5M5Y J;  4BBR J;  1Y1V J;  4DYC A;  3HOZ J;  3UKG A;  2RAE A;  1FIA A;  4RDU A;  4A3L J;  5BNG A;  3ZQL A;  5IP9 J;  2ZB9 A;  2NVT J;  4DW6 A;  1ETQ A;  3OSF A;  2HYJ A;  3BTI A;  3PO3 J;  2EZK A;  2CUF A;  3S15 J;  4JX5 A;  4B4C A;  5FKO A;  1TWG J;  2XGD A;  2R5Z B;  4L5E A;  2LFB A;  4S0H B;  2R5Y A;  2LY9 A;  2HDD A;  3BR0 A;  2M2E A;  2W48 A;  1JUP A;  1UMQ A;  1PUF A;  3RKQ A;  5IOZ A;  2XSD C;  1LFB A;  2DMT A;  3S2D J;  1XC5 A;  4MO7 A;  4FIS A;  1W0U A;  3JRI A;  1SFO J;  4D7N A;  3S1Q J;  2CRG A;  4Y7N J;  5K7F A;  2NVY J;  3LSG A;  1OJL A;  2FQ4 A;  1HF0 A;  2R0Q C;  4G12 A;  2R7Z J;  4UUS B;  3IV5 A;  5F08 A;  1RKT A;  3K7A J;  3ZQC A;  1ZGW A;  5IPA A;  3A01 B;  4A3J J;  4QTR A;  5E3N A;  1BW5 A;  1VI0 A;  3QPS A;  1EF4 A;  2EZL A;  1RET A;  5IYC J;  2NS8 A;  3H0G J;  1AHD P;  5C3E J;  1IUF A;  1WI3 A;  2WAQ N;  3OIO A;  4IHY A;  2JWT A;  1IC8 A;  3OOU A;  3ZQH A;  1P7I A;  5FKM A;  4AC0 A;  1TWH J;  1RPW A;  2X9D A;  1ETY A;  4GFB A;  1B8I A;  2L7Z A;  2Y9Z A;  1YRN B;  5F1J A;  2HXI A;  2HOA A;  2KT0 A;  1JTX A;  2DMP A;  3BG3 A;  1W0T A;  1MBH A;  1OCT C;  2Y31 A;  1G2H A;  3GTJ J;  5C4J J;  2DMU A;  4A3D J;  2JN6 A;  3K2A A;  4A3E J;  3I4N J;  4CYC B;  5J1U A;  3B6A A;  3WHB A;  5FLM J;  3RZO J;  1R9T J;  2OF7 A;  2M8G X;  4M3B A;  1NTC A;  5GPC A;  3TP3 A;  1ETV A;  3HBL A;  4FE4 A;  1ORK A;  4B1R A;  1I3Q J;  4D5F A;  2P81 A;  2ELK A;  1MSF C;  1QPI A;  1GDT A;  2LK2 A;  3IH4 A;  5J1R A;  4A3C J;  4MIM A;  5GPA A;  1IV6 A;  3H3V K;  2Y0S N;  3SFI A;  2K9N A;  1GVD A;  3FIW A;  1Q1V A;  4LOC A;  1SAN A;  5FKK A;  5JLW A;  2D5V A;  1BA5 A;  4C3H J;  3BR2 A;  3NAU A;  2LD5 A;  1MBF A;  2K9S A;  1JKP C;  1BW6 A;  2ID6 A;  2DA5 A;  3CCY A;  1LE8 A;  1ZQ3 P;  4FE7 A;  3GTL J;  1ENH A;  3GTO J;  4Y52 J;  2DMQ A;  2DMN A;  3DCF A;  1JJ6 C;  1D5Y A;  1OCP A;  1X2M A;  3BQZ A;  1CQT A;  3FKI J;  2X48 A;  5HOD A;  2N8G A;  4MLO A;  3S14 J;  1ETX A;  2EZH A;  3HDD A;  1GV2 A;  5IYD J;  2R5Y B;  5EYR A;  2EH3 A;  3I4M J;  2ECB A;  1PUF B;  3BR3 A;  1IRZ A;  4XRM A;  2AHQ A;  1POG A;  4M6V A;  3S1N J;  3C2B A;  4X1E A;  2O7O A;  3RZD J;  2Y9Y A;  2MG4 A;  1MH4 A;  5IOY A;  2CQX A;  1Z77 A;  3HGG A;  1ETK A;  1HCR A;  1K61 A;  2ME0 A;  3HKZ N;  3F0C A;  2L7F P;  5FLV A;  1QVU A;  3MN2 A;  5IP6 A;  3VPR A;  2NOG A;  1DU0 A;  2NVQ J;  1GUU A;  3TP0 A;  1RR7 A;  3HGY A;  5J1Y A;  1JKO C;  3ZQF A;  3BR5 A;  3BG5 A;  2H1K A;  3M4O J;  3GTG J;  3D1N I;  3JRC A;  2IBD A;  1JUS A;  2HQ5 A;  4A3K J;  3BG9 A;  1VND A;  3RQI A;  2E1O A;  4A69 C;  3LSJ A;  1DU6 A;  1FTT A;  1QRY A;  1X2N A;  2LP0 A;  5EEA A;  2R93 J;  3BR1 A;  2MSY A;  1ETO A;  2FD5 A;  2GM4 A;  5FKN A;  3S1R J;  4IHX A;  2E19 A;  3Q3S A;  3HOX J;  4DZP A;  1O4X A;  2JMW A;  2M9H A;  2DJN A;  2ID3 A;  3MKL A;  9ANT A;  3E7L A;  3QPL A;  4M3G A;  4W1U A;  2COB A;  4C2M J;  1TWA J;  4MFE A;  2QF7 A;  3Q0U A;  4NDL A;  2FX0 A;  1Z0X A;  2KDZ A;  4JX6 A;  3NAR A;  2VPR A;  5DTD A;  3S16 J;  2DA3 A;  2XGE A;  4D7M A;  1JUM A;  1K83 J;  3HB9 A;  2R92 J;  1ITY A;  3BR6 A;  3LOC A;  3JRA A;  1ZK8 A;  2LTP A;  1U9O A;  1TC3 C;  4QSH A;  3GTK J;  1ZR4 A;  3GTM J; 
#chains in the Genus database with same CATH topology
 3TDZ C;  1E2X A;  2QM3 A;  4C9Y A;  1F43 A;  3E1S A;  3E0J B;  4DIQ A;  4NC8 A;  2WAQ A;  2XGX A;  4XRS G;  3KCC A;  2NVU B;  4ZYA A;  4IKF A;  2VOP A;  3HRU A;  1HDP A;  4G6Q A;  3BCB A;  1TWF J;  1DDN A;  4U87 A;  3WE3 A;  4MHG A;  1IG7 A;  1A6Q A;  2R7T A;  2X6X A;  4WXH A;  1J7K A;  1GVJ A;  2CUE A;  2QUF A;  1R6R A;  2BY2 A;  4XOP A;  1JJ8 C;  1REP C;  1ZRF A;  1VF9 A;  3G1L A;  1YIJ I;  2F4M B;  4XN3 A;  1DP7 P;  4BHP A;  1R4M B;  4ABZ A;  4YFN F;  4ZTF A;  2XAU A;  3WOD F;  4B3A A;  3V8L A;  1HQC A;  1MBE A;  2Z1D A;  4OIR F;  5D4S A;  2E7W A;  1ZG5 A;  1WVR A;  1KYW A;  3CQZ J;  1TL8 A;  4BXX J;  5IYB J;  1OFC X;  3J7Z I;  1S7E A;  5GAH J;  3WE2 A;  4BQA A;  1YFH A;  4BQN A;  2XIG A;  4EJW A;  5A2Q Z;  5E3L A;  2PMZ N;  3DPL C;  2RVC A;  1FP2 A;  1CF7 B;  4AM3 A;  3VOE A;  4BEH A;  4IHT A;  4EVI A;  3I53 A;  2IP2 A;  3QOE A;  3D5R C;  3ZMV A;  1UEL B;  4WF2 A;  2LSO A;  2JRT A;  3R4K A;  3L2U A;  2CU7 A;  5CVJ A;  2V1N A;  4P96 A;  4II3 A;  3IP4 B;  5CQE A;  4IHW A;  2B63 J;  2XSJ C;  4XQF A;  2QKL B;  5EDN A;  1PJR A;  4QPO A;  1R4N B;  3DWL E;  5D8K B;  1U5T A;  1TQM A;  1Y56 A;  2L9R A;  2VJ4 A;  3QPT A;  1KGS A;  2WV1 A;  3A0B C;  1UZC A;  4XLP F;  3QU3 A;  2CG4 A;  1QVT A;  1KA8 A;  2ELH A;  3RI4 A;  2PQ8 A;  2D1V A;  3L2C A;  3M1C A;  1N77 A;  2BXY A;  2DA2 A;  5LRR A;  1VQ5 I;  2KIU A;  2R7R A;  2JA7 J;  1BR1 A;  1KU9 A;  2V9V A;  3BTC A;  3HOS A;  4BE1 A;  1ZG1 A;  1H8A C;  4A93 J;  2DN0 A;  4BUP A;  1R5I D;  3F8N A;  4U0Y A;  2VKD A;  3K4K A;  4HSR A;  5HLG A;  1YI2 I;  2R7U A;  1YW7 A;  1XG1 A;  4HW0 A;  2HWV A;  4I6Z A;  1FP1 D;  5HS9 A;  4BU2 A;  3ZXS A;  3GTP J;  1WH5 A;  2NS0 A;  3GLL A;  1B9M A;  3HKZ A;  3TW7 A;  1YIO A;  2MC3 A;  1FY7 A;  4DZJ A;  4R79 A;  3BJO A;  1NG7 A;  4ITV A;  4Y3O A;  3RJP A;  1RC9 A;  1X3Z B;  2XGC A;  4HA8 A;  1UG0 A;  3DTI A;  4PJL A;  1MH3 A;  3JRD A;  2Z9O A;  3FIS A;  5JFR A;  1VQN I;  4QPQ A;  4S05 A;  2X6O A;  2BXZ A;  2A5W A;  4V2G A;  4BKX A;  2E2J J;  2UUZ A;  4FT8 A;  1V3F A;  1F36 A;  5K7H A;  3KEQ A;  4KIT B;  1V5F A;  2PN6 A;  1S5L C;  4N9I A;  1TZL A;  4JP0 A;  2XF6 A;  3OYM A;  2K85 A;  3MFK A;  2Y0M A;  3ZQ7 A;  5C44 J;  3AG1 H;  4PJJ A;  4PJ0 C;  5CLS A;  2OZU A;  1ZRD A;  2Y48 A;  2R5Z A;  1KQ0 A;  1ZAO A;  5D8L B;  1N75 A;  4KIF A;  3WG9 A;  2RNJ A;  3GTQ J;  4HNU A;  1OR7 C;  3KET A;  3LAJ A;  2O8X A;  4UVB A;  4PFO A;  1Y0U A;  2V6E A;  1WJE A;  3JTG A;  3LNQ A;  2DAO A;  1I50 J;  4ZDP A;  2XKP A;  1YIT I;  2E60 A;  2V79 A;  4UUS A;  2HQA A;  3KLO A;  2E36 A;  1R1T A;  4JQF A;  4JOM A;  1HLV A;  4D5C A;  3IWZ A;  5EJC A;  3LA2 A;  2W7N A;  4XK4 A;  2Q8K A;  4FCY A;  4A6E A;  1YOV B;  4F52 A;  1B72 B;  2K40 A;  3HSF A;  2WB1 A;  2HVS A;  4A3I J;  2VBW A;  3I5U A;  2XB5 A;  3DPT A;  1C0W A;  2M3A A;  3R6S A;  1JT6 A;  4NUB A;  4NBQ A;  2W1O A;  3QP6 A;  2BZT A;  2DTZ A;  2ZME C;  1I6H J;  3V7R A;  1YX5 A;  3U9G A;  2O8K A;  2KLO A;  3CC4 I;  3ZMS A;  2P6S A;  3LSR A;  2Q2E A;  3LSM A;  2CQK A;  4XLH A;  3FM5 A;  2F5D A;  2KRF A;  1IDY A;  4HX7 A;  2LY1 A;  4GCV A;  4HDV A;  2UZK A;  4HX8 A;  4IQ4 A;  2M5W A;  2Y2Z A;  3DKW A;  3R60 A;  4GYI A;  2YUS A;  3O3K A;  2AS5 F;  4M3E A;  3SYT A;  1G3W A;  5B1A H;  2VUM J;  3Q0W A;  1Y8Q B;  4NC7 A;  4ENN A;  1LDJ A;  5GAD J;  2OQR A;  1XMK A;  4O5V A;  1RES A;  3D0S A;  4HF1 A;  2M4K A;  2W82 A;  4IQJ A;  3RTR A;  1AU7 A;  3CCM I;  2RQQ A;  2WY8 Q;  4AVZ A;  1JKR C;  2FRH A;  2ZFW A;  2TCT A;  4C3J J;  3W6V A;  1BBY A;  5KHD A;  1YE9 A;  2LBF A;  3HOU J;  5JHU A;  3GF2 A;  1V54 H;  4HX4 A;  3UR3 C;  2Y30 A;  3CMY A;  2QVO A;  4E7Z A;  2R7X A;  4AID A;  2BEO A;  5EG0 B;  2E1M C;  2LNB A;  4RLF A;  4DOZ A;  3A02 A;  4ANJ A;  2EV0 A;  4BL0 B;  1FMW A;  4M72 A;  5M5Y J;  5ICE A;  1Z7L A;  2JT1 A;  3H92 A;  4RB1 A;  3E6D A;  3R61 A;  2A05 A;  2XAJ A;  3N05 A;  5J40 A;  3UKG A;  3CO7 C;  5HLI A;  5IP9 J;  2VQL A;  5J47 A;  5BMZ A;  1VQ6 I;  2HKX A;  4FHT A;  4G8X A;  3OSF A;  3WU2 C;  3BTI A;  3IRQ A;  2JQ7 A;  3PO3 J;  2CUF A;  1TP4 A;  1B6A A;  2QQ8 A;  2FOW A;  4B4C A;  5LGU A;  2STW A;  3KYD B;  4CCL A;  3DF8 A;  2HDD A;  4MNU A;  2W48 A;  1PUF A;  3E6B A;  4XLA A;  2XSD C;  4IRI A;  2VJI A;  1SMY F;  4U7B A;  2KRC A;  1W0U A;  1SFO J;  2CRG A;  3TBI A;  4Y7N J;  2EIN H;  3G71 I;  5ERI A;  2VQH A;  3LSG A;  1FZP B;  1JI8 A;  2KZG A;  1CGP A;  2R7Z J;  1J75 A;  2R7D A;  4CHU A;  1WJ5 A;  4L5I A;  3K7A J;  2PFB A;  1A36 A;  5IPA A;  5J8F A;  4QTR A;  1OCC H;  3BG7 A;  3DKY A;  3L2R A;  4M73 A;  4OMY A;  2QQB A;  2X51 A;  2LG4 A;  2IS2 A;  5TRD A;  1FBU A;  3ZMU A;  1B59 A;  3H0G J;  3H5N A;  2WAQ N;  3I9V 2;  1IC8 A;  5CQG A;  3ZQH A;  3PUB A;  4XN0 A;  4M9S A;  3WU0 A;  3FXU A;  4AC0 A;  4ZYH A;  4ENJ A;  3S3N A;  1BOB A;  2W57 A;  2Y9Z A;  1YRN B;  3I54 A;  4KMU X;  1YYV A;  4HV6 A;  1W0T A;  2A6H F;  4XLE A;  2KJC A;  4XR6 A;  2Y31 A;  1TNT A;  1G2H A;  3GTJ J;  3W6J B;  1X1B A;  4ON0 A;  3OR1 C;  4MEY F;  5FFX A;  1HW5 A;  1WRJ A;  2EFQ A;  2O03 A;  1SAU A;  4E7S A;  2HR3 A;  3ABT A;  5K5Q A;  3B6A A;  5DCM A;  3Q9S A;  3WHB A;  2PG4 A;  4M3B A;  4XMY A;  3C2H A;  3TP3 A;  3HBL A;  4BXU A;  1I3Q J;  1PUE E;  3RKY A;  2W00 A;  1QPI A;  5H6Q A;  4AYB A;  2FOK A;  4EJU A;  1YS7 A;  1LDD A;  5E18 F;  2Y69 H;  4RGS A;  2K27 A;  4D1Q A;  2L01 A;  3FIW A;  3L09 A;  3A2K A;  3QYF A;  1Q1V A;  3FXL A;  2VQG A;  4E6K G;  2JPC A;  2KFD A;  1SAN A;  5FKK A;  1DPR A;  3EUH C;  3CJQ B;  5F1R A;  4CGZ A;  4O6J A;  2L9V A;  3NAU A;  4GXO A;  3R0J A;  1QZZ A;  4L0Z B;  1JKP C;  2UV1 A;  3M8E A;  5KNL A;  1BC8 C;  2PJP A;  3S3M A;  4FE7 A;  2XAS A;  2FU4 A;  3PNT A;  2LMD A;  3OYH A;  3GTO J;  2DMQ A;  1T2K A;  4IPA A;  1OCP A;  3FKI J;  5FLX Z;  2L4M A;  4ZDO A;  2EZH A;  1GV2 A;  5IYD J;  2R5Y B;  2GQQ A;  5EYR A;  1QO0 D;  2ECB A;  4HYE A;  1R00 A;  5E20 A;  3S1N J;  5D5U B;  3PSI A;  3X2Q H;  4X1E A;  1WJB A;  4KUM A;  2K86 A;  2O3F A;  1MH4 A;  3CMA I;  4C30 A;  2DQR A;  3RPU A;  2UWM A;  2W4S A;  1OCR H;  1K61 A;  3HKZ N;  3RSN A;  2QKM B;  1ZRC A;  1QVU A;  1XN7 A;  3MN2 A;  5IP6 A;  3VPR A;  3OYB A;  3BWG A;  3H36 A;  3PIO F;  1JKO C;  3H9G A;  4MQV A;  3BG5 A;  3SDB A;  4LB5 A;  4XKC A;  2A07 F;  5L3D A;  5GAG J;  1ZHF A;  5DUK A;  4KIS A;  4NHJ A;  4A3K J;  3I59 A;  3LFU A;  4KJZ A;  5LGT A;  2ZBK A;  2HPI A;  2E1O A;  4XKW A;  3MKY B;  4NC6 A;  1DU6 A;  2ICW G;  2LP0 A;  4UY8 I;  3EUA A;  2XF7 A;  4WWC A;  3IKT A;  3Q3S A;  1Z9C A;  2A3S A;  1UHM A;  4DZP A;  3D5S C;  2EIM H;  3RCO A;  1O4X A;  2IGN A;  4Q48 A;  2DJN A;  2QBY A;  3EDP A;  2ID3 A;  3MKL A;  1DQU A;  1KQ9 A;  4M3G A;  1MMA A;  3HUG B;  4W1U A;  1ZGJ A;  1TWA J;  2ZXW H;  4MFE A;  4PGH A;  4NDL A;  1IRF A;  2M0M A;  3PFI A;  4NNJ A;  1QZY A;  2VPR A;  3MZH A;  1QU3 A;  5DD4 A;  4LGW A;  2R7W A;  3KZI C;  3BR6 A;  3OYG A;  3KLN A;  1OYY A;  4B09 A;  2HS5 A;  3EYI A;  1U9O A;  3K4L A;  1D1B A;  3BJ6 A;  2CO5 A;  2P7V B;  4HLX A;  4I7H A;  1MJB A;  2R7O A;  5ILV A;  3OIQ A;  4LIV A;  1MSE C;  2WB1 N;  3F8M A;  3CME I;  2HOT A;  5GAE J;  1VQ7 I;  1NK3 P;  4IHV A;  3M7G A;  5EZG A;  5E8G A;  4DNC A;  2YSR A;  1HSJ A;  3CZ6 A;  1GT0 C;  3B6C A;  2EA2 A;  3KX2 A;  3BRO A;  4IJA A;  4UNO A;  3OS2 A;  3SDG A;  5K7Z A;  3M3Y J;  2K3F A;  1TBX A;  1PVE A;  1IGN A;  4B47 A;  1MMD A;  4XID A;  2OBP A;  1R23 A;  2GXG A;  4RGR A;  4U88 A;  1R71 A;  1LVA A;  3F9K A;  2HVR A;  2GXB A;  3WGH A;  2LKP A;  4M9X A;  4BH9 A;  4XKB A;  3KYL A;  4IHS A;  2LF8 A;  4HRI A;  1Z6T A;  4RS8 A;  1ETW A;  4RGX A;  3DBR B;  4HF2 A;  1ON2 A;  4E70 A;  5CPR B;  3GYH X;  4OU0 A;  2DBB A;  2ISY A;  5E3M A;  3HRS A;  4EV0 A;  1RRJ A;  5GP9 A;  2E1N A;  5L3G A;  2K4J A;  2Y0S A;  1W5T A;  1Y1W J;  1MBJ A;  1MIJ A;  5JR3 A;  3QOP A;  1FX7 A;  2R3S A;  3FHN A;  2GLO A;  3M07 A;  4P9F A;  1ZN2 A;  2MD0 A;  4HAM A;  4G7H F;  4KN4 X;  4OIQ F;  2XAG A;  4A3B J;  3BZ6 A;  1XCB A;  2M0C A;  3LQQ A;  4BHC A;  5DS9 A;  3Q5F A;  3M9A A;  4R1H A;  2HZT A;  4G7Z F;  2MLK A;  1S3J A;  4AIK A;  5H2F C;  5CVV A;  2CUJ A;  2CW8 A;  4L9N A;  2M7A A;  4ZZL A;  3J80 K;  3TED A;  4J01 A;  1WSU A;  2CFX A;  2EQR A;  2Z3Y A;  3IL2 A;  2O5R A;  3OL4 A;  1Q1H A;  3CO6 C;  2NNY A;  4G94 A;  1W7P D;  5LEK A;  2E71 A;  3K1M A;  2ME6 A;  3S32 A;  1S6L A;  1BI0 A;  5LEJ A;  5F0F A;  1P4A A;  5JI6 A;  3BQY A;  1ZR2 A;  1WFX A;  1LNW A;  3FK7 A;  3G1O A;  2P5V A;  3FK6 A;  4EEF G;  2BGC A;  5E79 C;  4QLC U;  2HOS A;  1R7J A;  3CES A;  3ZN0 A;  2VAS A;  5DM7 F;  2VKE A;  1R22 A;  1K6Y A;  5J4V A;  3TO9 A;  2F5C A;  1JKQ C;  1I39 A;  2CJJ A;  1B8I B;  2FBI A;  4C2U A;  3H9Q A;  2JVH A;  2VI6 A;  3ECH A;  2BV6 A;  3PIP F;  2ZC2 A;  4ESB A;  2E5N A;  4BAC A;  3HTU A;  2BW3 A;  3G4S I;  1A6I A;  4FTH A;  2ESH A;  4RA2 A;  1J09 A;  1T98 A;  4HF0 A;  2H94 A;  3K4N A;  3C7J A;  1EA3 A;  1U2W A;  1JHH A;  4A3F J;  1OCO H;  4YIF A;  1VFC A;  1UAA A;  1FYL A;  1AKH B;  4EGY A;  1YO5 C;  2E7X A;  3WTU C;  2V1D A;  2VBX A;  1FEX A;  1J5Y A;  1G8X A;  3KFW X;  3I4P A;  3BPV A;  1UCR A;  3VYR B;  2CMP A;  3AG2 H;  3DU5 A;  2KIQ A;  2MA3 A;  2JVG A;  2BOL A;  2COM A;  4PJM A;  2XKO A;  2HQR A;  2K9L A;  5FD5 A;  3CP8 A;  4XLC A;  3HPH A;  4UUT A;  5D5X B;  4M3D A;  4MTD A;  2Q1Z B;  4RLQ A;  3I0T A;  4B8X A;  2VB6 A;  2A5Y B;  4RB3 C;  1Z7U A;  2XPV A;  4AYB N;  3S1M J;  5ILS A;  1LEA A;  3PQJ A;  1WI9 A;  3GEZ A;  5FKL A;  4OIN F;  3G1M A;  1SFE A;  4KN7 X;  2CV0 A;  3ERE D;  4BJ5 C;  3K4J A;  4PK4 A;  1WZ2 A;  2ELJ A;  4PZJ A;  2NS7 A;  4MTE A;  3JRH A;  2CW7 A;  4IRH A;  1KZH A;  4AU7 A;  4J00 A;  1SMT A;  2DFH A;  1WPK A;  4H4K C;  5BPD A;  1TW3 A;  5KK1 A;  3ONQ A;  4BYY A;  2K9Q A;  3HYI A;  2IA2 A;  5LBQ A;  4W97 A;  1VQ4 I;  3VB2 A;  4KT5 C;  5FJ8 J;  1VQM I;  2EBI A;  1EKE A;  2AO9 A;  2BHZ A;  3O2P E;  2VJJ A;  5EGO B;  4UUV A;  1R49 A;  1RKW A;  2NVX J;  4ETS A;  1LDK B;  4ZJZ A;  1TWC J;  1YJW I;  3E3V A;  1O3Q A;  2DA4 A;  2KQR A;  2B7E A;  4DYQ A;  2WTE A;  1WJD A;  3BTL A;  4CYC A;  4C3I J;  4PSX A;  4JX4 A;  1A35 A;  3IC7 A;  1ON1 A;  4BE0 A;  3N4M A;  2LKS A;  3H3Z A;  2GOM A;  4EQQ A;  1YJ9 I;  1K78 B;  2F5E A;  1T56 A;  1P7J A;  2BVM A;  3ZQI A;  3HOW J;  1T0F A;  2NYX A;  3OYJ A;  3PM1 A;  2XUB A;  4I76 A;  1X1P A;  3TMO A;  2L9S A;  1IXR C;  5JLX A;  4RBO A;  4Z6Y A;  1RNL A;  2BVL A;  2YPR A;  3AG3 H;  3FMR A;  3IAS 2;  5CYV A;  4UV9 A;  1W1W E;  5IP7 J;  2HI3 A;  2JA6 J;  3S8P A;  2IEK A;  1XX5 A;  2LR8 A;  2XRL A;  4A12 A;  4MFD A;  4BDZ A;  1FOY A;  1XS9 A;  3P7N A;  4BE2 A;  1FIP A;  2Y75 A;  1WH7 A;  1X58 A;  2UXX A;  3IH2 A;  3FMS A;  1QA6 A;  1V55 H;  1BR2 A;  3K2Z A;  3CCV I;  4BBR J;  3DTK A;  2PEX A;  2ZNZ A;  2G9W A;  2RAE A;  1FIA A;  4RDU A;  4OIP F;  3P9K A;  2C6Y A;  4A3L J;  1OPC A;  5BNG A;  3ZQL A;  2ZB9 A;  3FXK A;  1WQ2 A;  4XL9 A;  1HW1 A;  4IF4 A;  5GTH C;  3KZY A;  1G3S A;  2XF5 A;  3ABU A;  4F7Z A;  1FOW A;  3F22 A;  1O57 A;  2LFB A;  4L5E A;  1AOY A;  4NQW A;  2M2E A;  4CYD A;  2VBZ A;  3DEU A;  1MD0 A;  1PP7 U;  2NOJ B;  2DOE A;  4MO7 A;  5HNH A;  4FIS A;  3JRI A;  3OWT A;  3ISP A;  1IV8 A;  5K7F A;  2NVY J;  3CUQ C;  1TT5 B;  1SFU A;  1RR8 C;  4C2T A;  2R0Q C;  4G12 A;  3LQR A;  2PJR B;  4EGZ A;  4CZZ A;  5F08 A;  1RKT A;  3Q9V A;  1ZGW A;  5DM6 F;  2LRD A;  3A01 B;  4UB8 C;  4CDG A;  1BW5 A;  1VI0 A;  3CCS I;  4ENK A;  1W7P B;  4XRF A;  4ZH4 F;  1EF4 A;  1XPX A;  3H5A A;  2RQP A;  4XSZ F;  4Q5S F;  1RET A;  5IYC J;  3E5U A;  5C3E J;  1WI3 A;  2KHM A;  2ZJ2 A;  3CMM A;  2PMH A;  3OIO A;  4IHY A;  2OCE A;  1ZH5 A;  3DP7 A;  3OOU A;  1QHG A;  4LB6 B;  2CQ7 A;  1RPW A;  2X9D A;  4GFB A;  1B8I A;  1ACI A;  4CO8 A;  5F6F A;  5F1J A;  3M8F A;  1NG6 A;  3BG3 A;  3H1C A;  3R0A A;  4KFC A;  3OY9 A;  2DFI A;  5FRN A;  1BC7 C;  4A3D J;  1Z1D A;  2ADU A;  1PYV A;  3KIO A;  3GZ6 A;  3I4N J;  2DI3 A;  1SAX A;  3U2R A;  4RAZ A;  1LFP A;  3DBL B;  1JHF A;  2O0Y A;  5FLM J;  3RZO J;  2IJL A;  4R8H A;  3ZN1 A;  1NTC A;  3MEX A;  2E1C A;  1ETV A;  2X1E A;  3W2A A;  1VQ9 I;  2DPU A;  4FE4 A;  4B1R A;  1I6X A;  5IT9 K;  1A04 A;  2P81 A;  1HA8 A;  3WTX C;  2EFP A;  5DDG A;  1MSF C;  1GDT A;  3K4C A;  4CCO A;  3J81 Z;  4A3C J;  2BHY A;  5E8I A;  1QQI A;  4EM2 A;  2Y0S N;  3OR2 C;  2JA2 A;  3SFI A;  1A31 A;  3W2V A;  4B43 A;  3FHZ A;  2FXA A;  2QQ9 A;  3OV8 A;  1HKQ A;  2GOX B;  4WK8 F;  5TJJ A;  2IGK A;  2K9M A;  3DV8 A;  2K9S A;  4EAT A;  1BW6 A;  2X85 A;  3LMM A;  4EJT A;  1SVO A;  3CCY A;  2NRA C;  3ZGK A;  5HDK A;  2W25 A;  3DPU A;  2D2W A;  3EPZ A;  5LHG A;  3GTL J;  2R7F A;  3DCF A;  2J5O A;  1JJ6 C;  1D5Y A;  2EFW A;  2Q0O A;  1F4K A;  2R4G A;  2V26 A;  2ZCW A;  2F48 A;  5BS6 A;  2IS1 A;  1YTY A;  5HOD A;  3VEP A;  2HYF A;  5E1X A;  1BI2 A;  3S14 J;  2F4O B;  4LLN A;  1MMS A;  4HQM A;  1V4R A;  2X0L A;  3CCE I;  3OYD A;  1POG A;  4M6V A;  1HST A;  3V7C A;  1D1C A;  1XGM A;  3CJN A;  1FOK A;  1EH7 A;  3F21 A;  2DDA A;  3MKZ A;  3O6B B;  2OTL I;  1ETK A;  4WXC A;  1K4T A;  2ME0 A;  3F8C A;  2NAZ A;  4KIG A;  1CF7 A;  4HPQ A;  1X4P A;  1GUU A;  2ZME B;  1RR7 A;  3HGY A;  3TP0 A;  2FNA A;  2DK8 A;  3ZQF A;  4Y13 A;  4DBR A;  5J1Y A;  4HG2 A;  1FPQ A;  3M4O J;  2JTV A;  3GTG J;  1S7A A;  2G7U A;  3ZCO A;  1HC8 A;  2IBD A;  2HQ5 A;  1XGN A;  2CFO A;  3BG9 A;  3V8J A;  3OL3 A;  3FBN B;  1VND A;  2DJI A;  3VFZ A;  4G6D A;  2EFO A;  4Q4Z F;  3B02 A;  2O61 A;  3QAH A;  1KU3 A;  3CLO A;  1QRY A;  3U1K A;  4KNY A;  5EEA A;  4IO9 F;  2R93 J;  1GHC A;  4H0E A;  5FKN A;  3S1R J;  1TT0 A;  3HTS B;  4ZC3 A;  3VOD A;  3HOX J;  2MLG A;  5KAI C;  4OWR B;  2HQN A;  2JMW A;  2M9H A;  3T8R A;  1D0X A;  2M7B A;  5K5O A;  2YX7 A;  3KP5 A;  9ANT A;  1MDM B;  1IO2 A;  3CCU I;  3WTW C;  4Z2Y A;  4YII A;  3E7L A;  3GXO A;  2DOD A;  1BJA A;  3LSH A;  3JAM Z;  3Q0U A;  3TGN A;  5H6R A;  2FE3 A;  1FBQ A;  1Z0X A;  2L3D A;  2P5L C;  1BIA A;  5DTD A;  3BCA A;  4QWQ A;  2XGE A;  2DOA A;  1K83 J;  1BOA A;  3BY6 A;  3PNV A;  2E1M B;  2DT6 A;  3W2W A;  1MGT A;  3WTY C;  1N25 A;  3JRA A;  2MH2 A;  2KMU A;  3MMY B;  2L5Q A;  2PLY A;  2FUG 2;  2VBY A;  4QSH A;  3H5R A;  1Z6R A;  1ZR4 A;  3JSO A;  2O6G E;  3GTM J;  2HTJ A;  3I58 A;  5J6X A;  2CSO A;  2KRH A;  2OD5 A;  2ISZ A;  1ODD A;  3DFG A;  3FBI B;  3MAJ A;  2BBY A;  2CQN A;  3F8F A;  1LE8 B;  3VWB A;  1U3E M;  2A6T A;  3KP3 A;  4AUX A;  3ABK H;  2JSC A;  3JW4 A;  2CV2 A;  1TW2 A;  2DT5 A;  3PL8 A;  2DA1 A;  1UG2 A;  5B66 C;  1I5Z A;  2IXS A;  2EFN A;  2DA7 A;  2JK3 A;  3L2V A;  1MZB A;  1D0Y A;  2WBM A;  4I0B A;  5IY5 H;  3J7A O;  1X19 A;  1WHU A;  2LVS A;  2ZO4 A;  5AON A;  3OSG A;  2FF4 A;  3J7A Y;  3CDL A;  1YW9 A;  5LLQ A;  5HOO A;  3WTT C;  1XTA A;  2LYC A;  1DUX C;  2E2I J;  1LEB A;  4XOT A;  2MGQ A;  3E5X A;  3V42 A;  2HXO A;  3ABL H;  2A6E F;  1H0M A;  1F5T A;  4RM3 A;  1I3A A;  2JA8 J;  3FF5 A;  4AIH A;  1Z3Y A;  4LD5 A;  4HV5 A;  4MGR A;  3IAM 2;  3TOB A;  4ESJ A;  1FC3 A;  1H9G A;  1D3Y A;  1BIB A;  4F3Q A;  2X6W A;  4BAY A;  3HIF A;  1IN4 A;  3MQ0 A;  3VYU B;  5L3C A;  3HOY J;  2OAZ A;  2P5K A;  3FXR A;  1B72 A;  3SEQ A;  1FT9 A;  2RN7 A;  1SVM A;  1FJL A;  1YLF A;  3H9J A;  2K7L A;  5EEG A;  3L2Q A;  2F2E A;  3LL7 A;  2YU9 J;  2EV5 A;  2GBY A;  5FRM A;  2QLZ A;  2MAB A;  2O9L A;  3WGI A;  1MMN A;  4UHT A;  3GFJ A;  2RDP A;  4D9J A;  2I5U A;  3D5L A;  2F4I A;  3LAP A;  3EQL F;  2DK5 A;  2L54 A;  1TQP A;  2FQ3 A;  5E3O A;  1FTZ A;  2P0W A;  3WTZ A;  4PUS A;  3FXQ A;  1F9N A;  2ZKZ A;  3OYF A;  1E0E A;  4BQQ A;  2XAQ A;  3DEW A;  1XSV A;  5M5W J;  4CA0 A;  1ZRE A;  2IRF G;  3AKZ A;  1UHW A;  1P6R A;  1SEU A;  4YEJ A;  4BS9 A;  2EIK H;  3IHU A;  4XON A;  2OUM A;  2RKH A;  3RIR A;  1W5S A;  4E7L A;  2FJ1 A;  5DCF A;  3CC7 I;  3HG9 A;  1NH3 A;  5F04 A;  3W6K B;  3V4G A;  2HDW A;  4XBF A;  3QQA A;  3JRG A;  3ESW B;  2MH9 A;  1LKX A;  1NHA A;  3NQO A;  5CJ9 A;  2XV4 S;  1UST A;  5CVR A;  2JUC A;  2M34 A;  5KCM A;  3FXM A;  3WU1 B;  4I01 A;  5EG0 A;  4JK1 X;  2CYY A;  1FSH A;  4BJ6 C;  4Q47 A;  4L5J A;  4M9Z A;  2HKO A;  4A3M J;  2MBF A;  1IN7 A;  1U5T C;  1ZG3 A;  1T6S A;  3T8T A;  4LLG F;  3TOA A;  1WGX A;  1X1A A;  2V9K A;  2XAF A;  1DPU A;  4BY7 J;  1VQ8 I;  1YHQ I;  2IPQ X;  1ZKG A;  3OOP A;  2G7H A;  1Y8R B;  3F6O A;  1T38 A;  3ABM H;  1XGO A;  3J80 Z;  4E7H A;  2W85 A;  1Y0N A;  3MCZ A;  2OTJ I;  2CWE A;  4A5N A;  2Z99 A;  1I27 A;  1M1E B;  2QYO A;  2IGO A;  3CCQ I;  3HL2 A;  3HZJ A;  4RAG A;  5FRO A;  1RI7 A;  3CCJ I;  3S17 J;  5FLX K;  2JUG A;  2LKX A;  1R36 A;  2QSH X;  1QNT A;  4CUG A;  4BDY A;  3I64 A;  3ZOB A;  5HVQ C;  1SVL A;  3HOT A;  3CUO A;  1WKM A;  1GLN A;  2K4B A;  1MDM A;  2ESN A;  1UHS A;  5E17 F;  4MEX F;  5F0C A;  2VXZ A;  2CS3 A;  4M6X A;  4AVP A;  3O8G A;  1F1Z A;  3JRB A;  2RGV A;  2RC4 A;  1XD7 A;  2XDV A;  1ONV A;  4EMS A;  3N97 A;  3GZ5 A;  3PO2 J;  3LSP A;  3G3Z A;  1YRN A;  4XLN F;  3KP7 A;  3CF5 F;  3HOV J;  4JYK A;  1PP8 F;  2KJB A;  4OAZ A;  1IXS B;  1HOM A;  1X1D A;  3CTA A;  4ASN A;  3PUF A;  2DFE A;  4BHB A;  2X1C A;  2JA5 J;  1FLI A;  4XIC A;  2OC6 A;  2ZXH A;  3HPG A;  2HOE A;  3HXL A;  2QSF X;  1ERD A;  3GO5 A;  3PSF A;  4DYR A;  2IT0 A;  1U78 A;  1GV5 A;  4XOR A;  1T33 A;  3T1B A;  1STZ A;  5HDG A;  1T08 B;  2XC7 A;  1EH6 A;  3VYT B;  5M3M J;  2GIV A;  2J5P A;  3G2B A;  3RKX A;  3M1E A;  2V9P A;  4KDP A;  1FNN A;  3A0H C;  5J3L A;  2I10 A;  5FB2 A;  1ZLK A;  2ZJQ F;  3JSP A;  2RRE A;  4IX7 A;  2WC2 A;  3TKY A;  3TW6 A;  3IWF A;  3JRE A;  1IXC A;  4V2F A;  1YQA A;  4XM3 A;  3QRF F;  4ESF A;  3ZRG A;  1X3W B;  5DD8 A;  1U9N A;  1DGW Y;  3ZQQ A;  3U1D A;  3DTE A;  3RQ4 A;  2Z16 A;  4I09 A;  1SC7 A;  4DYC A;  1Y1V J;  1O7F A;  4DBQ A;  1TNS A;  5BPI A;  4GO1 A;  2AQF A;  2IW5 A;  2VT3 A;  4RMN A;  2QSG X;  3F3X A;  3U21 A;  2OZ6 A;  2EIL H;  3S15 J;  4LLL A;  3EYY A;  1K7A A;  1LPQ A;  3CDH A;  2XGD A;  2R5Z B;  3NWS A;  4S0H B;  2R5Y A;  2VLA A;  3BR0 A;  3TO7 A;  1QPM A;  1UMQ A;  2DLL A;  2DXI A;  1KON A;  2H27 A;  3F72 A;  3RKQ A;  4GGG A;  1LFB A;  1Z3X A;  2DMT A;  4XLF A;  3S2D J;  3V8K A;  5ICF A;  1P9Q C;  1OYW A;  1G3Y A;  4I02 A;  4UXN A;  2H6B A;  2CW0 F;  2JSP A;  3C3W A;  4EJV A;  1P4X A;  2D45 A;  1WJF A;  4UUS B;  3K4M A;  2EB7 A;  3IV5 A;  2WV0 A;  3K10 A;  4HNT A;  1R1V A;  2OV7 A;  3MKW B;  3ZQC A;  1VZ0 A;  5TGT A;  3G6E I;  1W36 C;  5E3N A;  4M6Y A;  1P2F A;  1J9I A;  4GDF A;  2QQA A;  3L7W A;  4HBL A;  2FBH A;  2NS8 A;  4PJN A;  1IUF A;  2PBI A;  2JWT A;  1OMI A;  4RB0 A;  3RPU D;  2AXT C;  2WAF A;  3TL4 X;  1P7I A;  5FKM A;  2D1H A;  3FMQ A;  1S8N A;  1ETY A;  5DYM A;  2F5V A;  3OYE A;  2KT0 A;  3KPH A;  1IZ1 A;  2QZ8 A;  1OCT C;  3ZPL A;  2OA4 A;  1BI1 A;  2Q2E B;  1MJA A;  1D8K A;  1MJ9 A;  1X1C A;  2DYR H;  3ML6 A;  2JN6 A;  2X6Y A;  4A3E J;  2NNN A;  2M8E A;  1IF1 A;  1BI3 A;  3CDI A;  4K2E A;  3HUG A;  2ZXJ A;  2H6C A;  3HSR A;  4B48 A;  3IUO A;  1R9T J;  2OF7 A;  4KA4 A;  2M8G X;  1X4O A;  3SZG A;  2VE9 A;  5AIQ A;  3FXJ A;  3L00 A;  1QGP A;  4FAS D;  1ORK A;  1PDN C;  1UFM A;  4LIT A;  1VQL I;  2ELK A;  4YFK F;  4LK1 F;  2LK2 A;  3IH4 A;  2BY0 A;  1B1B A;  5GPA A;  4B3X A;  3WTS C;  3OS1 A;  3OMY A;  1W4M A;  1HKS A;  2CH0 A;  1SFX A;  2K9N A;  4F92 B;  1MNE A;  2JZY A;  2R7S A;  4U0V A;  2LBF B;  2DOF A;  5J8C A;  4RAY A;  3OYK A;  4PFP A;  3K70 D;  1BA5 A;  2D5V A;  4G6T B;  2FMY A;  2TDX A;  1MMG A;  1USS A;  2LD5 A;  4BQO A;  4BXF A;  2ID6 A;  1QZE A;  5HLH A;  3LFK A;  3ULQ B;  4A0Y A;  3L2W A;  2V1X A;  3BC8 A;  1AWC A;  2OU2 A;  1WWX A;  3K1P A;  4RM2 A;  3I3L A;  2DMN A;  1X2M A;  1CQT A;  1YX3 A;  1O7L A;  5ED4 A;  1Y39 A;  1J59 A;  4YG2 F;  3MD2 A;  2FA5 A;  2N8G A;  3K1N A;  3NEU A;  1G3T A;  3LA7 A;  4CIC A;  2ZSH B;  2M1B A;  3I4M J;  2FNP A;  1PUF B;  3BR3 A;  3VDX A;  2STT A;  4XRM A;  2AHQ A;  4GRI A;  1B9N A;  4YFX F;  1O3T A;  3C2B A;  4AWX B;  3E6M A;  3RZD J;  5KAF C;  4YIR X;  4FX0 A;  4N4N B;  5IOY A;  2FSW A;  2Z33 A;  1XSD A;  4G9Y A;  3HGG A;  1ZEL A;  4EJO A;  3T0Y A;  3L9F A;  4HST A;  1N78 A;  5IT9 Z;  5L3F A;  3I56 I;  2F5F A;  3BZK A;  2XHK A;  2H1K A;  1FOX A;  2V4J C;  2XAH A;  3BR5 A;  2EK5 A;  3GVA A;  4OOI A;  3JRC A;  3AL0 C;  3VSK A;  4HEA 2;  4KT6 A;  2EWN A;  5CKT A;  4EM1 A;  3RQI A;  3BG6 A;  3A1Y A;  1YS6 A;  3LSJ A;  3A4C A;  2KIF A;  1X2N A;  3CF2 A;  3GFI A;  1U8R A;  1ETO A;  2MSY A;  3QYE A;  4ZZD A;  2V7F A;  3OS0 A;  1KQ8 A;  5FD6 A;  3OYA A;  5CVI A;  3QOD A;  3C18 A;  4N0B A;  2HEO A;  1ULY A;  3ZMD A;  3ECO A;  3WGG A;  4KIC A;  2DT7 B;  4FQG A;  4U0W A;  3DKX A;  4TV7 A;  5DCM B;  2W24 A;  3LA3 A;  2KP6 A;  4DGW B;  3DU6 A;  2ZFU A;  2KDZ A;  5A2Q K;  4JX6 A;  3KEO A;  3NAR A;  1W5C C;  1T8I A;  2DA3 A;  1JUM A;  5ICG A;  2QGU A;  2XRN A;  2B0L A;  1ZAR A;  3KP2 A;  2BE5 F;  2MD5 A;  1LVK A;  3TO6 A;  1DGR M;  1KU2 A;  1ITY A;  3CLQ A;  4A5M A;  5HNF A;  5K1Y A;  2FEZ A;  1ZK8 A;  3LSI A;  1S29 A;  4F93 B;  1RUN A;  1XCV A;  1TC3 C;  4PGG A;  3GTK J;  2UXN A;  1H9T A;  1MNM C;  2M87 A;  1I1G A;  1RUO A;  1R58 A;  1IAW A;  4IOA F;  1DP3 A;  3IH3 A;  4PDK A;  1XMX A;  2YX4 A;  3E6C C;  2EJR A;  1AKH A;  1OKR A;  5H20 A;  2JRM A;  4XRS A;  2HDC A;  4RB2 C;  4BGD A;  4XSX F;  3BTJ A;  3PJR A;  5L3B A;  1ZGA A;  2K3P A;  1WJA A;  5L3E A;  3PNY A;  3AL0 B;  3JCU C;  2QEN A;  5CVU A;  2LDU A;  2OPT A;  3CD6 I;  1R1U A;  4V19 K;  5B1B H;  3K70 C;  1WCM J;  3HSE A;  3HHG A;  2ZNY A;  5DEQ A;  2DO7 A;  1P92 A;  3CUQ B;  2IS4 A;  1LJ9 A;  3OIP A;  1Z05 A;  1S9H A;  4P5O A;  3TDU C;  3DQV C;  4PCQ A;  5D6F A;  3GWZ A;  4A3G J;  4ZYG A;  4LIU A;  1J2X A;  1R5H A;  1Z67 A;  5DUI A;  5HS8 A;  5B5E C;  2XPU A;  4ZYE A;  3WTV C;  4O3M A;  4X6A J;  2FBK A;  5FGM A;  3OYL A;  2TRT A;  4KMF A;  1T39 A;  1U8B A;  2ETH A;  1JTY A;  1KU7 A;  2H8R A;  2L7M P;  3FX3 A;  2GAU A;  3F8B A;  2GA2 A;  4YEL A;  4M3F A;  2WAD A;  2ECC A;  2BYV E;  3Q0V A;  2ZJP F;  3G73 A;  5LGN A;  5LHH A;  2QCO A;  4N4O B;  2KZV A;  1G6N A;  4A2U A;  4IRG A;  3I59 B;  3MWM A;  4IEJ A;  2KL4 A;  3ELK A;  5EGO A;  1E3O C;  5B3S H;  3SQN A;  4E7K A;  1Y6I A;  2KIS A;  3KZZ A;  4QIW N;  4Y15 A;  1H89 C;  2G0E A;  3P9C A;  4XKV A;  3KYC B;  2H8W A;  3T5X A;  4J19 A;  1QHH D;  1U6G A;  2KPM A;  1JGS A;  2PI0 A;  2JJ7 A;  1SD5 A;  2QBY B;  1MKM A;  2EV6 A;  2VL8 A;  3K9T A;  3MZY A;  2DCE A;  1K78 A;  2HZD A;  3BT9 A;  5F0H A;  1APL C;  2Z2S B;  5EZH A;  4CCJ A;  3GX4 X;  3DEE A;  2DU9 A;  1BM9 A;  1MBG A;  2WWY A;  3AG4 H;  3BLY A;  1L3L A;  5BQT A;  3H3U A;  2IS6 A;  2EZI A;  5EF6 A;  3WHC A;  1LB2 A;  1R5G A;  4M71 A;  1HDD C;  2V1U A;  3C2G A;  2E34 A;  3CJR B;  4YRV A;  3FWE A;  2H1L A;  4WCG A;  2MYS A;  1G59 A;  3CP2 A;  1I1S A;  2FML A;  2L0K A;  2P6T A;  2VOD A;  4AD9 A;  2VQC A;  5FFZ A;  2RV8 A;  2DA6 A;  2M4G A;  1KYZ A;  2CQQ A;  2E5Z A;  2IAI A;  2R7Q A;  3GBG A;  4KIB A;  3JR9 A;  3J81 K;  3C1D A;  3ZQG A;  4B44 A;  5D4R A;  5F27 A;  5M3F J;  4LG0 B;  4X0G A;  3HM5 A;  1IN8 A;  1NK2 P;  1IUY A;  3ZP5 A;  2LRE A;  2YS9 A;  1TTY A;  2YR2 A;  3K4B A;  4LG3 A;  3BOQ A;  4L9T A;  1BR4 A;  1K79 A;  1IJW C;  3AAF A;  4CZC A;  3NWT A;  2LC2 A;  5E1W A;  5AIP A;  3OYN A;  1SD4 A;  5TIS C;  1BJZ A;  2MW8 A;  2HU9 A;  2VC0 A;  4CCK A;  4L9V A;  4OIO F;  1OYI A;  2HNH A;  4LK0 F;  4I2O A;  4WX9 A;  4RAF A;  3HRT A;  2DW4 A;  2L7K A;  1SFK A;  1EJ9 A;  5LHI A;  4XNF A;  4CCM A;  4CSW A;  1BL0 A;  3RYR A;  4BBS J;  1LFU P;  1H88 C;  5C4X J;  2PJR A;  2H09 A;  4E4H A;  1MBK A;  2IA1 A;  2GZW A;  1V5G A;  3A01 A;  1JGG A;  2GXA A;  3BPX A;  4E7J A;  2RNG A;  3GFL A;  3A03 A;  3P5J A;  3FDY A;  4DQ2 A;  1JT0 A;  3GLX A;  1W7P A;  2YU3 A;  3SFZ A;  2VKV A;  2XB0 X;  3HEF A;  3ASN H;  3KE2 A;  1ZTR A;  4F55 A;  5ILU A;  4BY1 J;  3S2W A;  2HYG D;  1J0R A;  2VXD A;  3I55 I;  5D5V B;  3L1P A;  3RPQ A;  2VE8 A;  3BDD A;  4I98 B;  3BP8 A;  1MND A;  1UB9 A;  2E35 A;  2JPB A;  3ERM A;  5LFA A;  4IZZ A;  3BZC A;  2K02 A;  4DJA A;  1IRG A;  3HJE A;  3O8H A;  2WY7 Q;  3JRF A;  2DDB A;  4IXA A;  3SJM A;  5DV5 A;  1D1A A;  2OQG A;  3DLL F;  3S3O A;  1A5J A;  4S04 A;  4UVA A;  3FM3 A;  3DBH B;  4ENM A;  2XPW A;  2L2O A;  3GCM A;  4UVC A;  2KKO A;  2V6C A;  3TQN A;  5M5X J;  2PMZ A;  2VT2 A;  3CUQ A;  4HQE A;  3JAM K;  4UV8 A;  2DTR A;  3S2H J;  1IDZ A;  1UJ8 A;  4P1W A;  4AIJ A;  3KP4 A;  3F23 A;  1FYM A;  2BW3 B;  2ZXI A;  2A69 F;  3MVP A;  1WJC A;  2HGC A;  2ACJ A;  3COA C;  3FXO A;  1EH8 A;  3MZ8 A;  3GME A;  3KEY A;  5IT3 A;  2LF7 A;  4Y17 A;  4HNV A;  4HLY A;  1FSE A;  1P4W A;  2LLK A;  3DXJ F;  3IKV A;  2E2H J;  1HKT A;  1D5V A;  4I0A A;  4A6D A;  4P9U A;  4P55 A;  4FX4 A;  1V5E A;  3HOZ J;  1GXQ A;  3QU6 A;  4OMZ A;  2LOO A;  4BJT A;  5K5R A;  1OR7 A;  2NVT J;  2VN2 A;  4DW6 A;  1ETQ A;  2HYJ A;  5D6E A;  3J7Y J;  2EZK A;  4JX5 A;  1T0F C;  2KIM A;  5FKO A;  1TWG J;  3WG7 H;  1K6O A;  3B73 A;  2LY9 A;  2Z5U A;  4NB5 A;  1JUP A;  4BNC A;  1L0O C;  4KYW A;  1JXS A;  5IOZ A;  2I8D A;  2CV1 A;  1XC5 A;  4FET A;  3PQK A;  4L0Y B;  4D7N A;  3S1Q J;  2AQE A;  1K4S A;  2HTS A;  2VKH A;  2B9S A;  2PX9 A;  1OJL A;  1XGS A;  2A68 F;  2FQ4 A;  2P4W A;  1G4D A;  1HF0 A;  1HXD A;  2LY2 A;  1S72 I;  4JBA A;  3ROU A;  3W3C A;  4OAY A;  3HC7 A;  4A0Z A;  2ZME A;  3AFH A;  4A3J J;  1SD6 A;  2A61 A;  3QPS A;  3H0D A;  2W84 A;  2EZL A;  1Z21 A;  1HW2 A;  1U0J A;  5BOX A;  1W36 D;  3SZT A;  2M45 A;  5D5W B;  1E3P A;  4GYG A;  5E1Z B;  1AHD P;  1IW7 F;  4RGU A;  5KVR A;  2CGP A;  2X1D A;  1VQK I;  2VON A;  2XVC A;  1TWH J;  4G7O F;  2L7Z A;  3GZN B;  3JTH A;  2HXI A;  2HOA A;  2WAE A;  1JTX A;  2DMP A;  1MBH A;  3EUK L;  1RIO H;  5C4J J;  2DMU A;  3K6G A;  3CCL I;  4HZF A;  2OJE D;  3K2A A;  3P9I A;  2OCC H;  3VYS B;  4CYC B;  4EM0 B;  5J1U A;  4BEH B;  1XMA A;  3LST A;  2MC4 A;  3H35 A;  4LG0 A;  5GPC A;  4M74 A;  1Z91 A;  4HOB A;  1B4A A;  2LH9 A;  5FO5 A;  1SD7 A;  1VTN C;  2QEX I;  5JVG F;  4D5F A;  1XB4 A;  4LFU A;  3SHF A;  2GIZ A;  2R7V A;  5J1R A;  4MIM A;  5EEH A;  3LWF A;  1YJN I;  1IV6 A;  3H3V K;  2IGM A;  1ZYR F;  3SEZ A;  2L02 A;  1U5T B;  1O3R A;  2VOO A;  3CJT B;  1GVD A;  4LOC A;  2AXL A;  3ZMZ A;  5JVT A;  2HPM A;  5JLW A;  3CC2 I;  2ZJR F;  4IOC F;  1ZLJ A;  4C3H J;  3BR2 A;  1HBX G;  3OYC A;  4L18 B;  2ZSI B;  1FMV A;  1MBF A;  4WXD A;  4HDU A;  2DA5 A;  1LE8 A;  1MW7 A;  1ZQ3 P;  3PFY A;  3M8J A;  3S93 A;  1IN6 A;  2K5C A;  2NXN B;  3FKJ A;  4UB6 C;  1XSX A;  1D8J A;  1XDS A;  1D0Z A;  3K0L A;  1YW8 A;  1ENH A;  5ICC A;  2EIJ H;  4Y52 J;  4IVN A;  3GUD A;  4E7I A;  3BQZ A;  2VC1 A;  3E97 A;  4CH7 A;  2F6C A;  3I71 A;  3ZMT A;  1T95 A;  2X48 A;  2VPL A;  2L9N A;  1RZ4 A;  4MLO A;  1YG2 A;  1E17 A;  1ETX A;  2QA4 I;  1AA7 A;  3HDD A;  2EA4 A;  3OYI A;  2GWR A;  2EH3 A;  4NQW B;  4CXF A;  1OQY A;  3ASO H;  2HVQ A;  1IRZ A;  1VQO I;  2XRO A;  2QWW A;  1XDU A;  2L4A A;  3SXY A;  2O7O A;  2DPD A;  1S7O A;  1FBS A;  2Y9Y A;  2MG4 A;  2BY3 A;  2X4H A;  2CQX A;  3VSL A;  4A0X A;  4LMY A;  5HDN A;  1OIS A;  1Z77 A;  1HCR A;  2P7C B;  3HHH A;  2PMU A;  3F0C A;  4ZDL A;  4U7D A;  2L7F P;  3NRV A;  5FLV A;  2WA0 A;  3E5Q A;  1LUJ B;  5GTI C;  3K69 A;  3ZR8 X;  3HRM A;  2NOG A;  1DU0 A;  2NVQ J;  2CUZ A;  2GA1 A;  6PAX A;  1GXP A;  2IA0 A;  4Y4R A;  3D1N I;  3REO A;  2BY1 A;  3LSK A;  4PSW A;  2DYS H;  1JUS A;  3F6V A;  1QBJ A;  1O3S A;  2EPF A;  4ZYD A;  4I99 C;  4A69 C;  3EET A;  1FTT A;  3QP5 A;  3IRR A;  1FYK A;  4N9H A;  5J4Y A;  2VJ5 A;  3BR1 A;  3GW2 A;  2GM4 A;  2FD5 A;  4IHX A;  2E19 A;  3V7S A;  4ZTJ A;  1JE8 A;  1IN5 A;  2VIX A;  4F91 B;  4MQ9 F;  5F64 A;  3RYP A;  2P8T A;  1IRX A;  3QPL A;  2COB A;  1TQI A;  4C2M J;  1OLT A;  4CCN A;  3GFM A;  5JHF A;  3QWL A;  2QF7 A;  2DFF A;  3KP6 A;  1LQ1 A;  2FX0 A;  4D0P A;  3BJA A;  2KDO A;  3RKW A;  3QPH A;  3S16 J;  3EUH A;  4IL6 C;  4D7M A;  1FWZ A;  1BN5 A;  5HS7 A;  1OCZ H;  1VQP I;  5LD2 C;  3HB9 A;  2R92 J;  2DQL A;  4LJZ F;  2HFH A;  3DLA A;  1EV7 A;  1X3U A;  3LOC A;  1TLH B;  4II2 A;  5HLT A;  2M30 A;  2IVM A;  2LTP A;  2MFZ A;  5LRS A;  3FZV A;  4Y33 A;  3RDI A;  3SZP A;  3UNG C;  3QYB A;  1E3H A;  3CCR I;  4L9J A; 
#chains in the Genus database with same CATH homology
 1F43 A;  1MSE C;  1MNM C;  2WB1 N;  2HOT A;  4IHV A;  1NK3 P;  5EZG A;  3IH3 A;  1AKH A;  4XRS A;  4XRS G;  1GT0 C;  3B6C A;  1LE8 B;  3BTJ A;  1HDP A;  4AUX A;  1TWF J;  3SDG A;  5K7Z A;  1IG7 A;  3M3Y J;  2DA1 A;  2OPT A;  1UG2 A;  1IGN A;  4XID A;  1WCM J;  2DA7 A;  2JK3 A;  2CUE A;  2LVS A;  3OSG A;  1JJ8 C;  1VF9 A;  3CDL A;  3G1L A;  4ABZ A;  4A3G J;  4B3A A;  1ETW A;  1MBE A;  2XPU A;  2E2I J;  4X6A J;  2MGQ A;  2HXO A;  3CQZ J;  4BXX J;  2TRT A;  5IYB J;  2JA8 J;  1OFC X;  5E3M A;  1U8B A;  1S7E A;  5GP9 A;  1JTY A;  2H8R A;  5E3L A;  1Y1W J;  1MBJ A;  2L7M P;  2PMZ N;  2GLO A;  4M3F A;  3HOY J;  2ECC A;  3Q0V A;  1B72 A;  4A3B J;  2M0C A;  2QCO A;  1FJL A;  5DS9 A;  2CU7 A;  2YU9 J;  2GBY A;  4IEJ A;  2O9L A;  5EGO A;  1E3O C;  4IHW A;  2B63 J;  3TED A;  5EDN A;  4QIW N;  1H89 C;  2EQR A;  2G0E A;  2L9R A;  4J19 A;  1FTZ A;  5E3O A;  2WV1 A;  2JJ7 A;  2ME6 A;  5F0F A;  1QVT A;  1ZR2 A;  3BQY A;  3DEW A;  3FK7 A;  3G1O A;  5M5W J;  2DA2 A;  3FK6 A;  4EEF G;  2JA7 J;  3BT9 A;  5F0H A;  1APL C;  3BTC A;  5EZH A;  1H8A C;  2HOS A;  4A93 J;  2DN0 A;  1MBG A;  2VKE A;  2EZI A;  5EF6 A;  3WHC A;  1XG1 A;  1HDD C;  2FJ1 A;  4I6Z A;  5F04 A;  1JKQ C;  3GTP J;  2CJJ A;  3JRG A;  1WH5 A;  3QQA A;  1B8I B;  3TW7 A;  2VI6 A;  4DZJ A;  2M34 A;  2L0K A;  2DA6 A;  1A6I A;  4FTH A;  2CQQ A;  2IAI A;  3GBG A;  5EG0 A;  2XGC A;  3JR9 A;  3ZQG A;  5M3F J;  4A3M J;  5F27 A;  1MH3 A;  3JRD A;  3FIS A;  4A3F J;  1NK2 P;  3HM5 A;  1VFC A;  2X6O A;  1WGX A;  1AKH B;  2YS9 A;  4V2G A;  4BKX A;  2E2J J;  4BY7 J;  1FEX A;  1F36 A;  5K7H A;  1ZKG A;  4JP0 A;  1IJW C;  5C44 J;  2R5Z A;  1BJZ A;  2MW8 A;  3GTQ J;  4UUT A;  4M3D A;  3S17 J;  2LKX A;  3LNQ A;  1I50 J;  1BL0 A;  2XPV A;  4AYB N;  4BBS J;  1LFU P;  3S1M J;  3ZOB A;  4UUS A;  1H88 C;  5C4X J;  5FKL A;  3G1M A;  1MBK A;  3A01 A;  1HLV A;  1JGG A;  4D5C A;  3A03 A;  4XK4 A;  1UHS A;  1JT0 A;  5F0C A;  2NS7 A;  4FCY A;  3JRH A;  1B72 B;  2K40 A;  3O8G A;  3JRB A;  1WPK A;  2VKV A;  2XB0 X;  3HEF A;  4A3I J;  2K9Q A;  2XB5 A;  4W97 A;  1ZTR A;  1JT6 A;  3LSP A;  3PO2 J;  5FJ8 J;  2EBI A;  4BY1 J;  2AO9 A;  5EGO B;  2DTZ A;  1I6H J;  2O8K A;  1RKW A;  1YRN A;  2NVX J;  3HOV J;  4JYK A;  1TWC J;  3L1P A;  3LSR A;  1HOM A;  2DA4 A;  4DYQ A;  2JA5 J;  4XIC A;  3BTL A;  1IDY A;  4C3I J;  4CYC A;  4JX4 A;  4DYR A;  1U78 A;  1GV5 A;  2Y2Z A;  1T33 A;  1P7J A;  1T56 A;  2YUS A;  3O8H A;  3ZQI A;  3HOW J;  3JRF A;  4M3E A;  2VUM J;  3Q0W A;  3SJM A;  3PM1 A;  5M3M J;  1A5J A;  4I76 A;  1RES A;  1AU7 A;  5JLX A;  4RBO A;  2XPW A;  1JKR C;  4C3J J;  2TCT A;  3W6V A;  5J3L A;  2I10 A;  5M5X J;  5IP7 J;  3HOU J;  2HI3 A;  2JA6 J;  2IEK A;  3TW6 A;  3S2H J;  2LR8 A;  1IDZ A;  3JRE A;  2XRL A;  2Y30 A;  3CMY A;  4MFD A;  4V2F A;  1XS9 A;  3MVP A;  5EG0 B;  1FIP A;  1WH7 A;  3A02 A;  1U9N A;  1X58 A;  3IH2 A;  4HNV A;  2LLK A;  2E2H J;  5M5Y J;  4BBR J;  1Y1V J;  4DYC A;  3HOZ J;  3UKG A;  2RAE A;  1FIA A;  4RDU A;  4A3L J;  5BNG A;  3ZQL A;  5IP9 J;  2ZB9 A;  2NVT J;  4DW6 A;  1ETQ A;  3OSF A;  2HYJ A;  3BTI A;  3PO3 J;  2EZK A;  2CUF A;  3S15 J;  4JX5 A;  4B4C A;  5FKO A;  1TWG J;  2XGD A;  2R5Z B;  4L5E A;  2LFB A;  4S0H B;  2R5Y A;  2LY9 A;  2HDD A;  3BR0 A;  2M2E A;  2W48 A;  1JUP A;  1UMQ A;  1PUF A;  3RKQ A;  5IOZ A;  2XSD C;  1LFB A;  2DMT A;  3S2D J;  1XC5 A;  4MO7 A;  4FIS A;  1W0U A;  3JRI A;  1SFO J;  4D7N A;  3S1Q J;  2CRG A;  4Y7N J;  5K7F A;  2NVY J;  3LSG A;  1OJL A;  2FQ4 A;  1HF0 A;  2R0Q C;  4G12 A;  2R7Z J;  4UUS B;  3IV5 A;  5F08 A;  1RKT A;  3K7A J;  3ZQC A;  1ZGW A;  5IPA A;  3A01 B;  4A3J J;  4QTR A;  5E3N A;  1BW5 A;  1VI0 A;  3QPS A;  1EF4 A;  2EZL A;  1RET A;  5IYC J;  2NS8 A;  3H0G J;  1AHD P;  5C3E J;  1IUF A;  1WI3 A;  2WAQ N;  3OIO A;  4IHY A;  2JWT A;  1IC8 A;  3OOU A;  3ZQH A;  1P7I A;  5FKM A;  4AC0 A;  1TWH J;  1RPW A;  2X9D A;  1ETY A;  4GFB A;  1B8I A;  2L7Z A;  2Y9Z A;  1YRN B;  5F1J A;  2HXI A;  2HOA A;  2KT0 A;  1JTX A;  2DMP A;  3BG3 A;  1W0T A;  1MBH A;  1OCT C;  2Y31 A;  1G2H A;  3GTJ J;  5C4J J;  2DMU A;  4A3D J;  2JN6 A;  3K2A A;  4A3E J;  3I4N J;  4CYC B;  5J1U A;  3B6A A;  3WHB A;  5FLM J;  3RZO J;  1R9T J;  2OF7 A;  2M8G X;  4M3B A;  1NTC A;  5GPC A;  3TP3 A;  1ETV A;  3HBL A;  4FE4 A;  1ORK A;  4B1R A;  1I3Q J;  4D5F A;  2P81 A;  2ELK A;  1MSF C;  1QPI A;  1GDT A;  2LK2 A;  3IH4 A;  5J1R A;  4A3C J;  4MIM A;  5GPA A;  1IV6 A;  3H3V K;  2Y0S N;  3SFI A;  2K9N A;  1GVD A;  3FIW A;  1Q1V A;  4LOC A;  1SAN A;  5FKK A;  5JLW A;  2D5V A;  1BA5 A;  4C3H J;  3BR2 A;  3NAU A;  2LD5 A;  1MBF A;  2K9S A;  1JKP C;  1BW6 A;  2ID6 A;  2DA5 A;  3CCY A;  1LE8 A;  1ZQ3 P;  4FE7 A;  3GTL J;  1ENH A;  3GTO J;  4Y52 J;  2DMQ A;  2DMN A;  3DCF A;  1JJ6 C;  1D5Y A;  1OCP A;  1X2M A;  3BQZ A;  1CQT A;  3FKI J;  2X48 A;  5HOD A;  2N8G A;  4MLO A;  3S14 J;  1ETX A;  2EZH A;  3HDD A;  1GV2 A;  5IYD J;  2R5Y B;  5EYR A;  2EH3 A;  3I4M J;  2ECB A;  1PUF B;  3BR3 A;  1IRZ A;  4XRM A;  2AHQ A;  1POG A;  4M6V A;  3S1N J;  3C2B A;  4X1E A;  2O7O A;  3RZD J;  2Y9Y A;  2MG4 A;  1MH4 A;  5IOY A;  2CQX A;  1Z77 A;  3HGG A;  1ETK A;  1HCR A;  1K61 A;  2ME0 A;  3HKZ N;  3F0C A;  2L7F P;  5FLV A;  1QVU A;  3MN2 A;  5IP6 A;  3VPR A;  2NOG A;  1DU0 A;  2NVQ J;  1GUU A;  3TP0 A;  1RR7 A;  3HGY A;  5J1Y A;  1JKO C;  3ZQF A;  3BR5 A;  3BG5 A;  2H1K A;  3M4O J;  3GTG J;  3D1N I;  3JRC A;  2IBD A;  1JUS A;  2HQ5 A;  4A3K J;  3BG9 A;  1VND A;  3RQI A;  2E1O A;  4A69 C;  3LSJ A;  1DU6 A;  1FTT A;  1QRY A;  1X2N A;  2LP0 A;  5EEA A;  2R93 J;  3BR1 A;  2MSY A;  1ETO A;  2FD5 A;  2GM4 A;  5FKN A;  3S1R J;  4IHX A;  2E19 A;  3Q3S A;  3HOX J;  4DZP A;  1O4X A;  2JMW A;  2M9H A;  2DJN A;  2ID3 A;  3MKL A;  9ANT A;  3E7L A;  3QPL A;  4M3G A;  4W1U A;  2COB A;  4C2M J;  1TWA J;  4MFE A;  2QF7 A;  3Q0U A;  4NDL A;  2FX0 A;  1Z0X A;  2KDZ A;  4JX6 A;  3NAR A;  2VPR A;  5DTD A;  3S16 J;  2DA3 A;  2XGE A;  4D7M A;  1JUM A;  1K83 J;  3HB9 A;  2R92 J;  1ITY A;  3BR6 A;  3LOC A;  3JRA A;  1ZK8 A;  2LTP A;  1U9O A;  1TC3 C;  4QSH A;  3GTK J;  1ZR4 A;  3GTM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...