5JLWA

Antphd with 15bp dna duplex r-monothioated at cytidine-8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
57
structure length
57
Chain Sequence
GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords Homeotic protein antennapedia
publication title Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 22
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5jlwA00
3ZQGA 3BR5A 3RKQA 4W97A 1NTCA 5IP9J 1HDDC 1LE8B 1G2HA 2O7OA 3WHCA 2WV1A 1MBKA 1BL0A 5C44J 2L7MP 2MSYA 1U9NA 4LOCA 3QPLA 3ZQLA 3JRAA 3K7AJ 1GT0C 4IHVA 1MBJA 2HYJA 4A3LJ 1W0TA 1JKPC 2K9SA 5EZGA 5JLXA 4D5FA 2CUEA 1B8IA 2YUSA 1TWGJ 1ETXA 3M3YJ 1LFBA 2OPTA 2L0KA 1QPIA 2JN6A 1JJ8C 5EGOB 2XGDA 4W1UA 2EZIA 1WCMJ 4M3BA 2VKVA 3RQIA 1R9TJ 3IH3A 1ETVA 1A5JA 3L1PA 2YS9A 1O4XA 1TWHJ 1IRZA 1RPWA 2DA7A 3A03A 3WHBA 1FTTA 2ECBA 1UG2A 2HDDA 2L7ZA 1IDYA 5EYRA 4M3EA 2PMZN 4XICA 2LY9A 5M3FJ 2LKXA 3I4NJ 2IAIA 4RBOA 4MFDA 1MSFC 1NK2P 3ZQIA 4A3IJ 2DTZA 1VNDA 1MBHA 3HOZJ 4IEJA 5EF6A 1WH5A 4DZPA 3G1OA 1JT6A 3ZQCA 5F08A 5M3MJ 5IYBJ 1XG1A 3QQAA 2ME0A 2LLKA 1IC8A 2EQRA 3BTJA 1IUFA 3TW7A 3S16J 2TRTA 3BR3A 5C4XJ 1JUSA 1WI3A 5K7ZA 2Y30A 3BTLA 3CCYA 5EDNA 3GTLJ 1JUPA 1B8IB 1SANA 3BTCA 4MIMA 5JLWA 2K40A 2VKEA 5IP6A 5FLVA 5IYDJ 4M3GA 1YRNA 2FJ1A 1JTXA 5E3NA 3TW6A 1S7EA 3GTKJ 1F43A 3BR2A 1AU7A 2R5YA 1CQTA 1UHSA 4X6AJ 5F0FA 4A3DJ 2E2HJ 3BT9A 2TCTA 2JJ7A 4G12A 2ID3A 2JMWA 3O8HA 4M3DA 2R93J 5C3EJ 5F1JA 4A3GJ 2NVTJ 1Q1VA 2M9HA 1ZGWA 1OJLA 1ZKGA 2AHQA 3GBGA 4A3FJ 1FIAA 4A3MJ 2EZLA 2N8GA 3FKIJ 1OFCX 3QPSA 2NVYJ 3BR0A 2XGCA 1WGXA 3IH2A 2Y31A 2O8KA 2LTPA 3DCFA 1MBFA 4V2GA 1FEXA 4FTHA 2JK3A 1BW6A 4J19A 2CJJA 1JKQC 2DA1A 2H8RA 1P7IA 3C2BA 5J1UA 4IHYA 4Y7NJ 1B72A 3A01A 3JREA 2YU9J 1GV2A 4B3AA 1ZR2A 4EEFG 3OOUA 2L7FP 1MNMC 5IYCJ 1I6HJ 1YRNB 1FIPA 1MBGA 3GTGJ 4UUTA 2XB0X 3S1NJ 3JRGA 5DS9A 2E2IJ 3GTMJ 2OF7A 1ETQA 4JX5A 1ETWA 3OSFA 3A02A 3IH4A 2HOTA 1VF9A 3RZDJ 2QF7A 1MSEC 1X2MA 4XRMA 2EH3A 5BNGA 2R5YB 3LSGA 2AO9A 5M5XJ 1Y1WJ 1IGNA 4DYRA 1HOMA 4AC0A 5HODA 2LR8A 3BR6A 3GTPJ 2XB5A 1ZK8A 1F36A 3HOYJ 1APLC 1RESA 1P7JA 2IBDA 1JTYA 2X48A 1H88C 2DA2A 3H0GJ 3TEDA 1MH3A 1U8BA 2DMQA 3SJMA 1K83J 2HQ5A 3FK7A 2MW8A 1OCPA 1HLVA 4XIDA 1BA5A 2ME6A 4A3BJ 3G1MA 4A3EJ 1NK3P 3HKZN 3S1QJ 2K9NA 2XGEA 3MN2A 2D5VA 2Y9YA 3CQZJ 3Q3SA 2R7ZJ 1D5YA 4BY1J 5GPAA 4FISA 2DMUA 1RETA 2LFBA 1GDTA 1X2NA 5DTDA 1B72B 4FCYA 3A01B 3LOCA 3JRBA 1H8AC 3FISA 1PUFA 2IEKA 3LSJA 2VUMJ 2GLOA 2HXOA 2HI3A 1RR7A 1POGA 1X58A 2JA5J 5K7HA 3TP0A 1RKWA 4XK4A 2JA8J 4MFEA 1FJLA 5M5YJ 3CMYA 2NS7A 5FKKA 2O9LA 3HM5A 3HB9A 4IHXA 2NVQJ 3FK6A 3D1NI 1HDPA 2DA5A 2HOAA 3S1RJ 3F0CA 4JYKA 2R92J 5GPCA 1OCTC 1QVUA 4BBRJ 3HOWJ 5FKLA 1HF0A 3S14J 2LP0A 1ITYA 2FX0A 3LSPA 2EZHA 2JA6J 2JWTA 1ZTRA 3TP3A 2Y9ZA 1ETKA 4JX6A 5FKNA 4DYQA 2XPVA 3BR1A 5C4JJ 1DU0A 2NVXJ 1MH4A 4DYCA 4B4CA 3MVPA 5J1YA 2ELKA 3VPRA 3ZOBA 4CYCA 1JGGA 3Q0VA 3B6AA 3GTQJ 4GFBA 5EG0A 2DJNA 1PUFB 2X9DA 2R5ZA 5GP9A 1TWCJ 2VPRA 1AKHA 4C2MJ 2GM4A 4I76A 1T56A 4BBSJ 4DZJA 2GBYA 2HXIA 2R0QC 2Y0SN 5J3LA 3IV5A 3PO3J 4ABZA 2DMNA 1K61A 2E19A 3PM1A 1MBEA 2LD5A 1A6IA 4DW6A 3NAUA 1ZQ3P 2HOSA 4QSHA 2FD5A 3S2HJ 3CDLA 2KDZA 4HNVA 3HDDA 3B6CA 3RZOJ 5E3MA 3LSRA 1GUUA 3S17J 2ECCA 2CQQA 2EBIA 4MO7A 1FTZA 2VI6A 1IJWC 1BW5A 3SDGA 2LVSA 9ANTA 4L5EA 5FLMJ 2MGQA 4X1EA 5FKOA 5IOZA 3E7LA 3JRDA 2DMPA 3ZQFA 2M2EA 4Y52J 4QTRA 3H3VK 1I50J 1JUMA 4RDUA 2DN0A 1Z0XA 3K2AA 1T33A 2ID6A 1HCRA 3OSGA 4CYCB 3JRCA 5M5WJ 3M4OJ 4XRSG 5F27A 2K9QA 2CQXA 2E1OA 3Q0UA 3HGGA 1ORKA 3MKLA 4A3CJ 5EG0B 3JR9A 2KT0A 2DA4A 2W48A 3S15J 1XC5A 2RAEA 4BKXA 4UUSA 2COBA 3HBLA 3HOXJ 1JKRC 1TWFJ 2R5ZB 3NARA 1GVDA 1AKHB 2FQ4A 2M0CA 1UMQA 5EEAA 1ETOA 1AHDP 2NS8A 2M34A 3SFIA 2DMTA 3JRHA 4AUXA 2QCOA 1ZR4A 2NOGA 4S0HB 4NDLA 5IP7J 2B63J 3GTJJ 5K7FA 4M3FA 1GV5A 4AYBN 1ENHA 2I10A 2Y2ZA 5IPAA 3BG5A 2XPUA 2XPWA 1SFOJ 1XS9A 4JP0A 3UKGA 5F04A 5EZHA 1QVTA 1IG7A 2M8GX 2G0EA 2CRGA 3Q0WA 4A3JJ 2X6OA 2H1KA 5F0CA 1QRYA 2DA3A 4V2FA 2LK2A 1TC3C 3DEWA 4A3KJ 1VI0A 3BG3A 4C3HJ 3W6VA 4M6VA 3GTOJ 2WB1N 4B1RA 4QIWN 3HEFA 4FE4A 5E3LA 3S1MJ 3G1LA 4C3JJ 2ZB9A 3HOVJ 1LE8A 3HOUJ 1W0UA 3I4MJ 2JA7J 4C3IJ 1BJZA 1H89C 1U9OA 4UUSB 5E3OA 4I6ZA 2CU7A 1EF4A 1VFCA 1LFUP 1E3OC 4FE7A 5J1RA 4A69C 2XSDC 2MG4A 1Y1VJ 2WAQN 1TWAJ 1WH7A 3HGYA 1IDZA 3BG9A 3JRIA 5EGOA 1I3QJ 1JJ6C 2CUFA 5FKMA 4JX4A 2EZKA 3FIWA 5F0HA 1JKOC 3JRFA 1Z77A 1WPKA 4BY7J 3BTIA 2E2JJ 1DU6A 5FJ8J 2L9RA 2DA6A 4D5CA 4MLOA 2XRLA 3BQYA 3BQZA 1JT0A 2P81A 4D7NA 1RKTA 4XRSA 4IHWA 1U78A 3LNQA 3ZQHA 1ETYA 1IV6A 3OIOA 4D7MA 3O8GA 4BXXJ 3S2DJ 5IOYA 4A93J 3PO2J
chains in the Genus database with same CATH superfamily
3ZQGA 3GZNB 1P4XA 1BOAA 3BR5A 1TBXA 4E7ZA 4W97A 1NTCA 4XLPF 4Y3OA 4DJAA 4ESJA 2DXIA 3GLLA 2F4IA 2OTLI 1G2HA 2J5PA 2DJIA 5D6EA 2L7MP 2OU2A 3CF2A 2BW3A 2CO5A 2OJED 2XRNA 5FLXK 1XSXA 3OL4A 2LKSA 3RPUA 1JKPC 2A69F 3I3LA 1NG7A 5J8CA 4NUBA 1B59A 3BJ6A 2STTA 4XNFA 2OPTA 4P5OA 1T98A 1EH6A 1UELB 2JN6A 1D8JA 2XGDA 4NQWB 1BIAA 4XSZF 2EZIA 2O0YA 3VYTB 3EDPA 2UXNA 1C0WA 2VKVA 2XAUA 1R9TJ 4RAFA 3CUQB 1TWHJ 1RPWA 2DA7A 3A03A 3CJRB 4RA2A 1FTTA 3ZMTA 1X3UA 2XF7A 1OMIA 4C30A 4J00A 2ZJ2A 1RUNA 1ZHFA 2VQLA 2W1OA 1SD7A 2IGOA 3DPUA 2LDUA 3CDHA 4AYBA 1YJWI 4F55A 4XICA 1A04A 2QVOA 1KQ0A 1U2WA 1UHWA 2IS4A 4A3IJ 4U0VA 5ILVA 2TDXA 1RUOA 3LQRA 5LD2C 4IEJA 3VODA 1QU3A 5TRDA 1JT6A 2R7VA 4XLHA 2XAHA 1XTAA 2XSJC 3QOEA 4HW0A 4XORA 3E97A 2WC2A 3MWMA 5D6FA 2BW3B 3S16J 3NWTA 3WTZA 2E1MB 3BR3A 4DQ2A 4L9VA 4KICA 2VBXA 3GUDA 1FBSA 4HLXA 1SANA 3BTCA 2EFWA 3S3MA 2K40A 3K1MA 1UG0A 2CV0A 1LDJA 2H94A 2FJ1A 3HL2A 2HU9A 4N4OB 3M07A 5E3NA 3J7AO 3A4CA 1F43A 4AVZA 3MZHA 4EJTA 1ZYRF 1CQTA 5F64A 4OIPF 2G7HA 3I71A 5F0FA 5J4YA 2LYCA 3BT9A 3IUOA 2JJ7A 2KIFA 2EA2A 3P7NA 2KZGA 4BEHA 3EQLF 3W2AA 2R93J 4G9YA 5HDNA 3KP4A 4LLLA 4CICA 2VBZA 4H4KC 3HOSA 1XX5A 3K4NA 1TT0A 2AHQA 2JVGA 3A2KA 5EEGA 1E3HA 2VOPA 1WFXA 3GBGA 1LUJB 4IHSA 4XLFA 1YYVA 2XGXA 3BJAA 1OFCX 2R7DA 1WGXA 3ECHA 4PGGA 2QQ8A 2LTPA 2ZXIA 4N4NB 2QLZA 4LB6B 3B73A 1MBFA 1J2XA 4HEA2 4PUSA 1FYLA 2VN2A 2W00A 1XSDA 4FTHA 2COMA 3JAMK 1FP2A 1JKQC 2L01A 4A0YA 2LREA 2VBYA 1R58A 1VQ8I 2AQEA 3RIRA 3BDDA 4XRFA 3A01A 1VQ9I 5D5VB 3TDUC 1GV2A 2YU9J 3W2WA 4BQAA 2A5WA 3HXLA 3QU3A 1I6HJ 3PUBA 1MNDA 3IAM2 2CWEA 3Q9VA 4KUMA 3H92A 1FIPA 3IKTA 2VLAA 1OQYA 3GTGJ 1PVEA 4PGHA 1JGSA 2BY3A 2VKHA 3M1CA 4LJZF 3TDZC 3GTMJ 1ETQA 2F5VA 4BAYA 2K4BA 2RN7A 2VKDA 4GCVA 1Z9CA 3RZDJ 1ZRDA 2WWYA 5E1XA 1B4AA 1XMAA 5HODA 4HNUA 4O6JA 2XB5A 3BC8A 1ZK8A 1A6QA 3HZJA 4MEYF 4BEHB 3IKVA 1U6GA 1U8RA 1V5EA 4I02A 4HF0A 1JTYA 3PNTA 1H88C 2DA2A 3H0GJ 5K1YA 1MH3A 3LFUA 1I5ZA 1X1AA 2P0WA 2MW8A 2JUCA 2CW0F 2Z33A 2H6BA 4M73A 3I56I 1PP7U 1BA5A 2H1LA 4RGRA 3AKZA 1LNWA 1P2FA 2V1NA 2LKPA 4DGWB 4BE0A 3ESWB 3HKZN 2XGEA 3MN2A 1SVLA 2D5VA 3VB2A 2R7ZJ 1SVMA 3PUFA 5ERIA 1D3YA 4E7LA 1EH8A 1VQLI 1MMDA 4BY1J 3ZMSA 4RM3A 4YIRX 3FF5A 1GDTA 4CH7A 1X2NA 2CUZA 2VC1A 5DTDA 4FCYA 3A01B 4KFCA 1H8AC 4U87A 1PUFA 3LSJA 4OIOF 3SEQA 2HI3A 2LBFA 1POGA 3HSRA 3DTEA 3V7SA 1X58A 2L9NA 2FUG2 3OL3A 5D5WB 2X6XA 3LA2A 2F48A 4MFEA 5HNFA 1FJLA 4RLQA 5FKKA 3DKWA 2O9LA 3HM5A 2VJ4A 2NVQJ 1QZYA 4RAGA 1YFHA 3CCEI 4HG2A 3S1RJ 1FX7A 1ZGJA 2EV0A 2IA0A 4JYKA 1RNLA 1B9MA 3IP4B 1FBQA 2P6TA 4UVCA 2IVMA 3K1PA 4BBRJ 1R5ID 1ZGAA 3VYUB 2DYSH 1STZA 2LP0A 1GVJA 1DP3A 1S7AA 2FMYA 1V55H 2BXZA 2DOFA 2CSOA 1Z3XA 2W85A 2XV4S 1SC7A 3TP3A 3V7RA 2MD5A 5FRMA 2DK8A 3DLAA 1SMTA 4JX6A 4PZJA 3BR1A 3WG7H 3LAPA 2NVXJ 4KISA 1MH4A 4DYCA 2DU9A 2ZXHA 1AWCA 2IA1A 5E20A 5F6FA 2ELKA 1LFPA 3RTRA 2E7XA 3W3CA 3S2WA 3Q0VA 4BXFA 3F8NA 5HDKA 4GFBA 3U2RA 3E5XA 1XD7A 2DJNA 2H6CA 3LSTA 1PUFB 2X9DA 2LBFB 2OCEA 2P7CB 1JHFA 5GP9A 1T0FC 2HTJA 4DBRA 1AKHA 4RGUA 1R6RA 1K7AA 3FBNB 3WGGA 1X1DA 1ZG5A 1T56A 5HS8A 4OINF 2FA5A 3VDXA 1R22A 2MABA 5J3LA 1VQNI 4ABZA 3PO3J 3BPVA 4AWXB 4LGWA 2E19A 2RKHA 3PM1A 4WXHA 1WVRA 3JCUC 3S8PA 3OYEA 2GIZA 2LD5A 2E1CA 1R36A 1I39A 2HOSA 2NNNA 2FD5A 3N05A 4G7HF 3S2HJ 3G3ZA 4M9XA 2XAQA 2DOEA 4S05A 2CQQA 2L54A 4E7IA 1FTZA 4XN0A 4EM0B 4AM3A 1UFMA 5H2FC 5BMZA 1IJWC 2Z2SB 2DTRA 1Z21A 5E18F 2FF4A 4GO1A 2L9VA 3P9IA 4L9JA 4HDUA 1J9IA 5IOZA 4CO8A 1BC8C 2FE3A 3ZQFA 2R7TA 3J80K 3FM5A 2ZNZA 3H9GA 4II2A 1I50J 1JUMA 3L2WA 3EUHC 1Z0XA 3WTVC 2ID6A 3WU1B 3OSGA 1R5HA 3GWZA 4XRSG 5ICCA 2KJBA 3Q0UA 3MKLA 1SEUA 4A3CJ 3HTUA 1Z05A 2EIKH 4IRIA 2F4OB 2MD0A 2HVRA 2W48A 3S15J 2HDWA 4UUSA 1W36C 5CKTA 4M9SA 3X2QH 4KT5C 5DUKA 4O5VA 1AKHB 1AHDP 1MNEA 2P4WA 3SFIA 4R8HA 1V5GA 3C3WA 3V8JA 2BVMA 4ESFA 3DPLC 1K4TA 4S0HB 3U1DA 3T8RA 1J09A 2B63J 3ZR8X 1YITI 5D4RA 2QKLB 5DD8A 5HS9A 5GAEJ 5HNHA 2O6GE 1GV5A 3DBRB 1BJAA 3F3XA 2PQ8A 2ZJRF 2BVLA 3BG5A 4DBQA 1X3WB 2KISA 3DKXA 5FFXA 2QYOA 1TW3A 3T8TA 2BXYA 2G0EA 2KIUA 3AG4H 2KIQA 4LK1F 1FSEA 3QODA 4NC8A 2VONA 1R23A 2X6OA 2BOLA 4MHGA 3H9JA 5IY5H 5F0CA 2WTEA 3O2PE 2LH9A 4A5MA 1HXDA 3RPUD 3K0LA 1ZREA 3OYIA 1VI0A 1UJ8A 3K69A 3TL4X 3IRQA 3CD6I 2WB1N 4LG0A 2VT3A 2BEOA 3HEFA 4FE4A 5E3LA 3BCBA 3KP3A 2JUGA 2E7WA 1LE8A 3LQQA 1R7JA 1MMNA 5KVRA 1YX5A 1EJ9A 2IS6A 2HOEA 4C3IJ 1BJZA 4UUSB 2X4HA 2XAGA 4N0BA 4I6ZA 2DYRH 3ZQQA 3W6JB 5GADJ 2HDCA 4ZYHA 2JRMA 1VFCA 3E6CC 2F6CA 2KLOA 4A69C 1FLIA 2XSDC 1D0YA 1IDZA 5DDGA 3K1NA 1XGMA 1XDUA 1UZCA 3CUQC 2CUFA 1JXSA 3GFIA 2EZKA 2MLGA 3D0SA 4MGRA 2EINH 5F0HA 5CVRA 5JHFA 1A36A 3ZCOA 2FBKA 2E35A 3Q9SA 2P5VA 3HHHA 1ERDA 1DU6A 2VC0A 1XPXA 5K5RA 4LG3A 2DA6A 2F5FA 3BQYA 1JT0A 4J01A 5B1BH 5FGMA 1FOKA 3DXJF 3N97A 3RKWA 1RI7A 4YG2F 2HPMA 1TL8A 2FSWA 4HAMA 3BP8A 3LNQA 1EV7A 2DODA 1SAXA 2CH0A 1IXSB 2GA2A 4KIFA 2KHMA 4A2UA 4HQEA 3S2DJ 3FX3A 4LG0B 3CF5F 5CVUA 2E1MC 2LSOA 3DTIA 1D1BA 2OQGA 5A2QZ 1ZRFA 1LKXA 4MTDA 3V42A 1LE8B 1BL0A 3R61A 2WV0A 2XF6A 3ASNH 2MSYA 4I99C 4CXFA 2DT5A 3QPLA 3ZQLA 2W82A 2EPFA 1BR1A 3LAJA 2G7UA 4IZZA 3F23A 4BJTA 3D5SC 3MKWB 4A12A 4A3LJ 1FC3A 4RB2C 4Y4RA 2CW7A 2Y0MA 3IRRA 4G7OF 2DPDA 3M3YJ 1N25A 2L0KA 3F8FA 4F7ZA 4HZFA 5DM7F 5CVIA 4XOPA 4OMYA 1MIJA 4LLNA 1WKMA 3CZ6A 1KU9A 3CC2I 3IH3A 1ETVA 2R7FA 4BJ5C 3L1PA 2RDPA 3LA7A 1IXCA 1UB9A 1IDYA 3PIOF 2P5KA 4M3EA 2JT1A 4B09A 4CCMA 4PJNA 3MKYB 1F1ZA 1JHHA 2DFHA 2GOMA 3HG9A 2EFOA 3K9TA 3ZQIA 5HVQC 2DTZA 4UY8I 1VNDA 3IWFA 2HWVA 4OOIA 3ULQB 3WU0A 5EF6A 3ABTA 5DYMA 4BQOA 5M3MJ 4ETSA 3AAFA 4KN4X 1P6RA 3TW7A 4ZJZA 3PNYA 2TRTA 1Y0UA 1E0EA 2BY2A 1W5CC 3TQNA 5TJJA 5K7ZA 2RGVA 3BTLA 4EJVA 4L5JA 4C9YA 1JUPA 3BJOA 3OIQA 2A6HF 3LSMA 2V7FA 4C2UA 5IYDJ 5J47A 4KMUX 1YRNA 3ZMZA 1SD6A 4AIKA 4M6XA 2R7UA 1JTXA 3O3KA 4YRVA 3GTKJ 1YTYA 2D1VA 2QSHX 5KHDA 1UHSA 2LNBA 5HOOA 4M74A 4CDGA 3KZZA 3BCAA 1YS7A 2MH2A 2TCTA 1PP8F 1IN8A 4L0YB 2KPMA 4G12A 2ID3A 3GZ6A 2IP2A 3O8HA 4XONA 4M3DA 4CA0A 3EYYA 3HRUA 5C3EJ 2EFPA 1JE8A 2MBFA 2NVTJ 4A3GJ 2HEOA 1G3YA 1ZGWA 2UZKA 1ZKGA 2R4GA 1IRXA 2OZUA 3W6KB 3LFKA 2JSCA 3QYBA 1FIAA 2EZLA 2N8GA 2VQCA 5LLQA 2V4JC 4G6TB 4NBQA 4YEJA 2QSFX 3QPSA 4GXOA 3BPXA 2V1DA 2XGCA 1U3EM 3ZQ7A 3WTWC 1Y56A 4XQFA 4BJ6C 1QBJA 3AL0B 2CUJA 2Z3YA 1FEXA 2JTVA 1YI2I 3CP2A 4BHBA 1BW6A 4M6YA 2CJJA 1W5TA 3LSKA 5DUIA 1H9TA 1OYYA 4AIHA 3BZCA 3L2UA 4XLCA 4IRHA 2HPIA 5J1UA 4Y7NJ 3OOPA 2OZ6A 4ZTJA 1IXRC 4HX4A 2OA4A 2RQQA 5K5QA 2QQ9A 2JRTA 2DW4A 1IW7F 3WGIA 4ZDLA 1K78A 1YRNB 2O61A 2XB0X 3PQKA 2DI3A 1QZZA 2J5OA 2QF7A 3QOPA 1MSEC 3S3OA 2EH3A 2QENA 3LSGA 3R4KA 4MTEA 4II3A 4DYRA 1S8NA 4ZYDA 2M1BA 5E1WA 2LR8A 3GTPJ 4Q5SF 4OWRB 1MMAA 3I54A 4AIJA 2X51A 3GEZA 3HOYJ 3I9V2 4AD9A 1P7JA 2IBDA 1S29A 1TW2A 3TEDA 2HNHA 1KYZA 3BROA 3S32A 2FNAA 1ZG1A 2DMQA 3SJMA 1K83J 2HQ5A 2K02A 1KU3A 4CCJA 4F91B 1YG2A 2VE8A 1BC7C 3CJQB 2K27A 2VXZA 1HKQA 3IC7A 4UB8C 1NK3P 4ON0A 1J59A 2K9NA 4CZCA 1DGRM 2GA1A 1R4MB 3T0YA 1MD0A 2Y9YA 3K4KA 1WJCA 2M7BA 1SFEA 3OR1C 3OYGA 3HOTA 4ENKA 5GPAA 2UUZA 4IOCF 3EUAA 1XCBA 2EIJH 1FNNA 5DM6F 2AS5F 1J0RA 3F72A 4M72A 4ZDOA 3TOAA 1HKSA 1BIBA 4IQ4A 2IEKA 1PJRA 2VUMJ 2HXOA 3IL2A 1K78B 1ZARA 2PMUA 2JA5J 1LDDA 3CMAI 4HDVA 1RKWA 3OMYA 4XK4A 4I2OA 1Z1DA 3DF8A 1ON1A 3U1KA 3NQOA 3SHFA 3HB9A 2ZSHB 4IHXA 3OYKA 2DK5A 1REPC 5CVVA 1FP1D 4UV9A 4NHJA 2ZC2A 5J6XA 2LF8A 3SEZA 5GPCA 3NEUA 2ELJA 4G94A 2Q8KA 2Y75A 3TKYA 3ERMA 1ZLKA 1TQPA 4MNUA 3ONQA 2F4MB 4L5IA 1WJEA 2EZHA 2ZXJA 4MEXF 5JHUA 2JA6J 3H36A 1F5TA 4JK1X 2JWTA 2Y9ZA 2BHZA 4D9JA 3QRFF 1ETKA 4P9UA 2LOOA 3E0JB 5FKNA 5C4JJ 2XPVA 2VASA 1DU0A 1ACIA 4EMSA 1W4MA 2NNYA 3HRMA 3H3UA 1WWXA 2D2WA 5LHHA 3FXQA 4B4CA 3MVPA 2KZVA 4CYCA 2WAEA 3VSLA 4ASNA 3GTQJ 1IRFA 4UV8A 4GYGA 2Z16A 5EG0A 3MQ0A 1VTNC 5D8KB 2KDOA 1YW9A 1SFKA 2MH9A 1G3WA 3OS1A 4U0WA 2R5ZA 3AFHA 2M4GA 1TWCJ 1WJ5A 3BOQA 1X1BA 4HYEA 4HSRA 1A35A 2DAOA 1SD5A 2L02A 2PMHA 2HXIA 2PJRA 5L3BA 2B7EA 3LWFA 3OS0A 3WE3A 3ZN1A 4PFOA 3PL8A 1MBEA 3G71I 4Q47A 1DGWY 2W25A 3CCJI 5B5EC 4GYIA 4HSTA 3SFZA 4DW6A 1ZQ3P 3ZMDA 1TTYA 1USTA 4BHCA 3CDLA 2KDZA 3PJRA 3M8FA 2V6CA 4HNVA 3HDDA 3IWZA 4QLCU 4RB1A 3KFWX 3R6SA 3LSRA 1O7LA 3CLQA 2GZWA 3WGHA 2ECCA 2VQHA 2EBIA 4MO7A 1BW5A 2E5ZA 5EJCA 2LVSA 1MMGA 1QNTA 5HLIA 5FLMJ 2CYYA 3E7LA 3JRDA 2X0LA 1HW2A 5BPDA 2GXBA 2KRHA 4RDUA 1HCRA 1FPQA 2PX9A 4CYCB 3DP7A 3FZVA 2L7KA 4IQJA 3LMMA 1BI0A 4PFPA 4ENJA 1BI2A 5EG0B 1G3TA 1TT5B 3E3VA 1HKTA 1UHMA 4BKXA 2RAEA 2COBA 3HBLA 3A1YA 2OUMA 2WA0A 4HPQA 3NARA 2R5ZB 4UVBA 1YO5C 3P5JA 1OKRA 4F92B 2P6SA 1O3SA 4YIFA 3KYLA 3TO7A 1IN5A 1U5TA 5FFZA 2RC4A 1ZR4A 6PAXA 3I58A 4RB0A 4ZYEA 4CHUA 2NOGA 1VQ4I 4HX8A 2PJRB 2IGMA 3GFJA 2M87A 3H9QA 3FBIB 3GTJJ 2W7NA 1PDNC 1ZLJA 3HUGB 4M3FA 1T8IA 3EYIA 1RR8C 1MKMA 3GLXA 3S3NA 2HYGD 4BXUA 4JP0A 4R1HA 1SFUA 5D4SA 1HW1A 2M8GX 2F5CA 1T6SA 2CRGA 2M45A 4FASD 3FWEA 4QPOA 2X6YA 3MKZA 4CCLA 3KEYA 4V2FA 3OWTA 1E3PA 2X85A 3QPTA 2DOAA 2V1XA 3W6VA 5F1RA 4B1RA 1VQMI 1QZEA 3W2VA 3G1LA 4C3JJ 5CLSA 2XKPA 3HOVJ 3RQ4A 4D0PA 1W0UA 1HSJA 1N75A 4OMZA 3KEOA 1H89C 4OIQF 4O3MA 4KNYA 3KP7A 1W36D 1SD4A 3KYCB 3CCVI 1YW8A 1U5TB 3VEPA 5J1RA 4MQVA 3F22A 1KZHA 4PDKA 1WH7A 2V9VA 4B48A 3BG9A 5D8LB 4CCKA 3OYNA 3JRIA 1IUYA 2VL8A 4XKVA 2O8XA 4YFNF 3E5QA 4ZZDA 1LVAA 2CFOA 2DFIA 5E8GA 3K4CA 3LSHA 4XM3A 4L0ZB 4KMFA 4S04A 1JKOC 2ZO4A 3ZRGA 3RI4A 1Z91A 1Z77A 2ELHA 2DQRA 4BY7J 3FXKA 4KIBA 4U0YA 2E2JJ 4NB5A 2E60A 2L9RA 1LEBA 4GGGA 3FMSA 2XRLA 3PNVA 1GXQA 1TNTA 2YU3A 3E6DA 5AIPA 1FZPB 2M5WA 4D7NA 3CCRI 2K3PA 2NXNB 4B44A 4Q4ZF 1U78A 3HPGA 2EV6A 3ZP5A 3CJNA 1VQKI 5LHIA 4A93J 2FBIA 2FOKA 2YR2A 3ASOH 1MDMA 2RVCA 3RKQA 2B9SA 1HDDC 3WHCA 1MBKA 2H09A 4ZYAA 1FWZA 2WBMA 4FX0A 4AU7A 4RS8A 3JRAA 3K7AJ 5BQTA 4IHVA 1MBJA 4H0EA 1W1WE 5EZGA 5JLXA 2CUEA 1VQ5I 3SYTA 1USSA 1ETXA 3LL7A 1LFBA 2R7XA 2JPBA 4NNJA 4FX4A 1JJ8C 3OY9A 3DWLE 5L3GA 4UUVA 1YS6A 4UHTA 3I4PA 3TO9A 4ESBA 1WCMJ 3HC7A 3SDBA 4X0GA 1P92A 3BG7A 3EPZA 3RQIA 3WTSC 4NC6A 3J7ZI 4F3QA 2VXDA 3GF2A 2ESHA 2V26A 2YS9A 2HKXA 4E7KA 1F4KA 1IRZA 1VZ0A 2ECBA 1UG2A 2HDDA 3ABKH 4XBFA 2AXTC 1UAAA 1IV8A 4UXNA 3RDIA 1FYMA 2BY0A 4M71A 4IVNA 2XIGA 2HGCA 3C7JA 3FHZA 1I1GA 3AL0C 1QHHD 3FXLA 3I4NJ 3QPHA 4ZTFA 5AIQA 3K6GA 4RBOA 2F5EA 4Z6YA 1NK2P 4WWCA 1MDMB 1MBHA 1R1UA 3HOZJ 2K5CA 1GLNA 3G1OA 3VFZA 3K4MA 4G7ZF 3ZQCA 1XG1A 4XN3A 2LLKA 1IC8A 5ICFA 3BTJA 1IUFA 3GZ5A 1Z6TA 1J7KA 3S93A 1WI3A 5EDNA 2Y30A 3CCYA 3OYCA 3FDYA 1FOXA 4L9TA 3SXYA 3L9FA 2RNGA 3HRTA 4MIMA 5JLWA 2VKEA 5IP6A 3OS2A 5FLVA 2NOJB 2DO7A 3KPHA 1TLHB 3GMEA 5AONA 5JVTA 3DBHB 2QQBA 3TW6A 1S7EA 2OCCH 3AG2H 3BR2A 3KCCA 3M8EA 3CTAA 4X6AJ 1D1CA 4A3DJ 3F6OA 2E2HJ 3OIPA 1EA3A 2KFDA 3ZPLA 4BQQA 5L3CA 1Z7UA 2A61A 2JMWA 4EGYA 1V5FA 1YJ9I 1RIOH 4TV7A 5F1JA 3F6VA 3F21A 4Q48A 4BYYA 5IT9Z 1D0XA 3A0BC 3V7CA 2A05A 1OCCH 4IXAA 3OYJA 2K9MA 1E2XA 5LEJA 4A3FJ 1OYIA 2R7OA 3I64A 2F5DA 3FKIJ 3J7AY 1K4SA 1TNSA 4DIQA 5CVJA 2DFFA 2Z99A 2KIMA 2NVYJ 3BR0A 5JR3A 2ZCWA 3IH2A 3F8CA 3WTUC 1FT9A 2F2EA 3DCFA 4V2GA 1YIOA 1AOYA 4KYWA 1WJAA 3U21A 2LF7A 1FOYA 4J19A 5D5UB 3CP8A 1FY7A 2DA1A 3KE2A 2A5YB 2KRFA 1P7IA 4XKBA 3C2BA 3KYDB 1XGOA 4B3AA 1ZR2A 3OOUA 1MNMC 4KIGA 5IYCJ 4EGZA 2FQ3A 3LSIA 4HV6A 1IN7A 3D5RC 3H1CA 1HA8A 4UUTA 1XCVA 3S1NJ 1NH3A 3JRGA 5DS9A 4I09A 3ABLH 3CJTB 1W7PA 3ELKA 4P9FA 1N77A 2OF7A 4JX5A 1ETWA 3OSFA 1YJNI 2LY1A 1MMSA 3OR2C 2EILH 3MZYA 1R1TA 5BNGA 4XRMA 1IGNA 2A3SA 3J7YJ 4EJWA 4RAYA 1HOMA 1WJDA 3ABUA 3BR6A 3GFMA 5DD4A 5HLHA 1APLC 1LJ9A 2HQAA 2I8DA 4EV0A 2X48A 3C1DA 3CCSI 4RLFA 1G6NA 3RYRA 1LVKA 1N78A 5DCMA 2NS0A 4BS9A 3L2VA 3FK7A 3K4BA 3WTTC 4PJMA 3L09A 1X1CA 2UWMA 2ME6A 3BZKA 1Z7LA 1XB4A 3J81Z 3BLYA 3S1QJ 1P4AA 1IF1A 3CQZJ 3Q3SA 4PCQA 1D5YA 2YPRA 4XSXF 2FMLA 5E8IA 5L3EA 4BUPA 5FLXZ 2ZJQF 1O7FA 1S7OA 3RYPA 2CG4A 4B43A 1X19A 1LDKB 2OBPA 2XDVA 3LOCA 4RGXA 3HIFA 3JTHA 2DPUA 2IPQX 4WK8F 3FISA 2UXXA 1FYKA 2V9PA 4PJJA 3WTXC 2IT0A 3HSEA 1BI3A 1SAUA 5CPRB 3CC7I 2QQAA 2GIVA 4BDZA 3GO5A 1BBYA 1W7PB 1G8XA 3TP0A 1V3FA 2JA8J 3E6BA 4I98B 5M5YJ 5DV5A 3CCUI 4BDYA 1RRJA 1V4RA 1MW7A 3MZ8A 3OYDA 2E1NA 2L9SA 4L18B 4IF4A 1QPMA 2DA5A 2DT6A 2HOAA 2OQRA 2IW5A 4IO9F 3SQNA 4AVPA 2L3DA 5LRSA 3CC4I 3P9CA 5DCMB 1QVUA 2JVHA 3HOWJ 3RPQA 5FKLA 1D5VA 4BHPA 1P9QC 3SZPA 4HOBA 1HF0A 1ITYA 1AA7A 2CW8A 4HX7A 2FX0A 3LSPA 3AG1H 4I0BA 5DCFA 5FD5A 1T39A 2BV6A 3OYAA 3MMYB 2VQGA 1NHAA 2EWNA 2ZNYA 3H5AA 5J1YA 3VPRA 4LFUA 3ZOBA 3OYLA 5LGUA 2BGCA 2XROA 3KP2A 1JGGA 5IT3A 3B6AA 3VOEA 5A2QK 1D0ZA 2IS1A 5D5XB 2ESNA 2FNPA 3KX2A 5LGTA 1RC9A 2MA3A 4C2MJ 1W5SA 2EV5A 2GM4A 2V6EA 3TO6A 2CV2A 2ZFWA 2QGUA 1T2KA 3U9GA 4I76A 3G73A 2R7QA 3IV5A 2K7LA 3FMQA 4CYDA 2HZDA 4BACA 1WHUA 2X1CA 1CF7B 4RMNA 3CDIA 3NAUA 4QSHA 4NC7A 1IN6A 1Y0NA 3KZIC 4QPQA 4CCNA 2XC7A 2C6YA 5KNLA 3B6CA 3G2BA 3RZOJ 4OAZA 5E3MA 4F93B 4LITA 3S17J 2DBBA 2VI6A 4BGDA 2AXLA 1TQMA 4JOMA 4FQGA 4ENNA 2GWRA 2M7AA 3E6MA 4L5EA 4KITB 5FRNA 5FKOA 5H6RA 3H0DA 2AQFA 3KIOA 2DMPA 1MJAA 2NVUB 2VIXA 4Y52J 4RM2A 1BR4A 4QTRA 3JAMZ 1O3QA 1T33A 3FXJA 1I1SA 3M4OJ 2NYXA 2R3SA 2CQXA 2E1OA 3VYSB 3ERED 1K6OA 1ONVA 1ORKA 1R5GA 4P1WA 1ZELA 1U5TC 3I0TA 1ZAOA 4PSWA 3JR9A 1E17A 2KT0A 1YX3A 2DA4A 2Q0OA 3IAS2 2JQ7A 1XC5A 3JW4A 2M3AA 4EVIA 1JKRC 3C18A 3ZXSA 2BBYA 3E1SA 1ETOA 3RKXA 3L2CA 2NS8A 2M34A 4UB6C 2DMTA 2ISZA 4AUXA 4ZDPA 2QCOA 4I0AA 5GTHC 1BR2A 4C2TA 5BS6A 1EKEA 3DEUA 4LMYA 2K9LA 3DU5A 4NDLA 5IP7J 5K7FA 2CMPA 4GRIA 2W57A 2XUBA 2I10A 3E5UA 2Y2ZA 5IPAA 2XPWA 4JBAA 1SFOJ 1XS9A 5F04A 5EZHA 5HLGA 3CESA 4A3JJ 2D45A 3RSNA 1R71A 2VJ5A 1ODDA 2FBHA 2H1KA 2K4JA 4EM1A 1S9HA 1KU2A 4DOZA 2QA4I 2BHYA 2M4KA 5KK1A 2YX7A 3EUKL 1VQ6I 3DEWA 4XOTA 4A3KJ 2RREA 3BG3A 4HF1A 3I55I 4BE1A 3OYMA 1DDNA 4JQFA 4QIWN 2L4MA 3MCZA 3ECOA 3COAC 1D8KA 2XKOA 1TQIA 4BL0B 2GQQA 3HOUJ 3WTYC 4A6DA 2B0LA 2XASA 3I4MJ 4EATA 1J75A 2H8WA 4LK0F 2JA7J 1U9OA 2ADUA 4G6QA 4A0ZA 5E3OA 2HYFA 1XGSA 2Y69H 1UCRA 2CU7A 1WZ2A 3GVAA 3UNGC 1EF4A 1WSUA 4PJLA 1LFUP 4FE7A 3VSKA 3VWBA 1B9NA 2QSGX 3I53A 2MG4A 2WAQN 3HGYA 1X4PA 2A6EF 1FOWA 2Y48A 5EGOA 1I3QJ 4PSXA 2LRDA 1KA8A 1TZLA 2IRFG 3G4SI 3JSOA 4XKCA 1YHQI 3K70D 5FKMA 1CGPA 4JX4A 1BOBA 2STWA 2Z9OA 3FIWA 4WF2A 1U0JA 3RJPA 2IS2A 2E34A 1EH7A 3QYFA 3T5XA 3JRFA 1WPKA 1LB2A 4MQ9F 3K4LA 3R0AA 4MLOA 5H20A 3HUGA 1R49A 1RKTA 4XRSA 3JSPA 3WU2C 1T38A 3FXOA 5J40A 4XR6A 2ZMEA 2CGPA 1JI8A 3OIOA 3M7GA 4D7MA 3HPHA 4B8XA 3KP5A 4XLEA 3L2RA 5IOYA 1YIJI 1SFXA 3PO2J 1SMYF 1YLFA 2EK5A 1VQOI 1GHCA 4XMYA 3G6EI 5IP9J 5E79C 1XSVA 1A31A 2O7OA 2WV1A 4UNOA 5C44J 5GAHJ 3FKJA 1DQUA 2MFZA 1U9NA 4LOCA 1YW7A 3QP6A 1VQ7I 1TP4A 2OC6A 3KLOA 4HA8A 1T95A 4YELA 5DEQA 1B1BA 2YSRA 5JFRA 1HSTA 1GT0C 2HYJA 4M9ZA 2LC2A 1W0TA 2K9SA 4D5FA 2HQRA 4CGZA 4FETA 1B8IA 2YUSA 3V8KA 2QBYA 1TWGJ 1O3TA 2WADA 1QPIA 5EGOB 3SZTA 2GXGA 3OYFA 1HW5A 2CS3A 4W1UA 4OU0A 3GYHX 3CCMI 2KKOA 3HRSA 4ZYGA 2X1EA 4ANJA 2XHKA 5TISC 1S5LC 4KJZA 4M3BA 5B1AH 4E7HA 3HSFA 4P96A 2QWWA 3DU6A 3OYBA 1IZ1A 2KL4A 3BY6A 4HQMA 5FD6A 3QP5A 3K10A 1OISA 2PFBA 4HLYA 1A5JA 3F8BA 3UR3C 4YIIA 2JSPA 4WXDA 1O4XA 4A5NA 3R0JA 1XN7A 3WHBA 3K70C 5CQEA 5LGNA 3V8LA 2L7ZA 1M1EB 4EQQA 5HLTA 3L2QA 4IOAF 1QHGA 5EYRA 3TBIA 1ZH5A 3CLOA 4HBLA 3GCMA 3DPTA 1V54H 2HR3A 2PMZN 2ZMEB 2K3FA 5LBQA 3J80Z 5M3FJ 2LY9A 1MGTA 1GXPA 2LKXA 1O57A 2V9KA 1MZBA 2IAIA 4RGSA 4MFDA 2JA2A 1R1VA 1MSFC 2X1DA 4B47A 3ISPA 2DDBA 2HS5A 1W7PD 2RNJA 1WH5A 1XDSA 2EFNA 4DZPA 5F08A 4FHTA 2PBIA 2ZBKA 1XMXA 3NRVA 5IYBJ 3QQAA 2ME0A 1OYWA 2EQRA 4YFXF 1OCZH 2L2OA 2E36A 4IL6C 3MD2A 2ZFUA 5FO5A 5C4XJ 1JUSA 4CZZA 3GTLJ 2FEZA 2QBYB 1B8IB 2FOWA 3HTSB 1VQPI 4M3GA 1I3AA 2W4SA 2MC4A 4EJUA 2FRHA 3OV8A 1ULYA 4DNCA 5BOXA 2D1HA 1AU7A 2DCEA 2R5YA 1WJFA 1S6LA 4N9IA 4AIDA 3ZMVA 1Z6RA 2VT2A 4BH9A 2ZSIB 4XL9A 2BY1A 4XKWA 2WAQA 2WY7Q 3QYEA 5LFAA 4P55A 1Y8QB 4U7BA 4KDPA 1Q1VA 2M9HA 1OJLA 5GAGJ 2ICWG 2MLKA 1I27A 2E71A 4Y17A 4A3MJ 2DT7B 3DEEA 2GAUA 2Y31A 2O8KA 1WQ2A 1OPCA 2K86A 2HQNA 5FB2A 4E7SA 2JK3A 3M9AA 3CO7C 2O03A 5ILSA 2JPCA 3NWSA 2DLLA 3VYRB 3FXUA 2H8RA 1G3SA 2KJCA 4IHYA 4BE2A 1B72A 3JREA 5KAIC 4WCGA 1SVOA 4EEFG 2VE9A 2DQLA 2L7FP 3QAHA 4LB5A 2R7SA 1MBGA 4A6EA 2ZJPF 2E2IJ 5ICEA 2R7WA 2KRCA 3EETA 2KMUA 1QGPA 3FMRA 1Q1HA 3A02A 5ICGA 3IH4A 2HOTA 1VF9A 4PJ0C 5KCMA 1LQ1A 2Q2EA 1X2MA 2R5YB 1Y1WJ 2AO9A 5M5XJ 5FROA 4AC0A 3KP6A 3ZGKA 1HBXG 3BZ6A 1YE9A 1F36A 4ENMA 1ZN2A 1RESA 3WODF 2PLYA 3DLLF 4QWQA 5B3SH 2Z1DA 1FMWA 3OYHA 1U8BA 4Y15A 2LG4A 1KQ9A 5CQGA 1D1AA 2H27A 1Y6IA 1LPQA 1OCPA 1HLVA 2BZTA 2BYVE 4XIDA 2X6WA 1OLTA 2E5NA 4A3BJ 3G1MA 2OD5A 3O6BB 4A3EJ 1H0MA 4I01A 1H9GA 1YOVB 4D1QA 5JVGF 4EJOA 1IRGA 3Q5FA 4FT8A 3CO6C 2M30A 3HKZA 1HQCA 1L0OC 2VODA 2K85A 1KONA 2VJJA 4FISA 2ETHA 2EJRA 4KN7X 2DMUA 1RETA 2LFBA 3CMMA 1QA6A 2PMZA 3I5UA 2JZYA 5H6QA 1B72B 3D5LA 3JRBA 5B66C 3DV8A 3ABMH 1IN4A 5BPIA 2HVSA 2I5UA 3HJEA 3DQVC 2Z5UA 1FBUA 4LIVA 2P8TA 2GLOA 3WE2A 3FXMA 1RR7A 2A68F 2M0MA 4G6DA 1OR7C 2HKOA 4ZH4F 1BI1A 5K7HA 2QZ8A 2IGKA 3C2HA 1O3RA 3CMYA 2Q2EB 2NS7A 1R00A 1R4NB 2UV1A 3CUOA 3FK6A 3D1NI 3MFKA 4E7JA 3K4JA 3MEXA 1HDPA 4Z2YA 1IAWA 1XGNA 3GW2A 2A07F 3QWLA 3F0CA 2CQNA 5LEKA 1KQ8A 1KGSA 1RZ4A 2R92J 1OCTC 2G9WA 1WI9A 3A0HC 3AG3H 2EIMH 2LMDA 2KQRA 2WAFA 2ZXWH 3S14J 1T08B 3PSFA 4HNTA 2L5QA 3PSIA 4RAZA 4V19K 3FM3A 1G4DA 1ZTRA 2HVQA 4KT6A 4I7HA 1J5YA 4IX7A 1WJBA 4DYQA 3DKYA 1MJ9A 2OV7A 2O5RA 2PN6A 3REOA 3L00A 1MJBA 5L3DA 2PG4A 5HS7A 3H35A 1QQIA 2YX4A 4CUGA 2DDAA 1PUEE 2O3FA 1BN5A 3M8JA 1Z3YA 5LRRA 2IJLA 2VPRA 3GXOA 1ZG3A 3HHGA 3K2ZA 1K79A 4BBSJ 3HYIA 4DZJA 2GBYA 2P7VB 1X3ZB 2R0QC 1ON2A 2Y0SN 4IPAA 4LIUA 2V1UA 2DMNA 1T0FA 1K61A 1WRJA 2Q1ZB 3H5NA 4G8XA 1KU7A 4ZC3A 1A6IA 1PYVA 2XVCA 2MC3A 2EA4A 4B3XA 4L9NA 3FXRA 2MYSA 1YQAA 1GUUA 4HRIA 2BE5F 2EFQA 3DFGA 4OAYA 3RKYA 5E1ZB 2FXAA 4PK4A 1X4OA 1S3JA 2WY8Q 3BG6A 3SDGA 5ED4A 4U7DA 1FSHA 9ANTA 2VJIA 2MGQA 1G59A 4X1EA 4N9HA 2DFEA 4IJAA 3TOBA 3KEQA 3LA3A 4RB3C 2ISYA 4IRGA 3WG9A 2R7RA 3JTGA 2CQ7A 2M2EA 2XAJA 4HV5A 3B02A 2PJPA 3H3VK 4CCOA 2DN0A 3K2AA 3R60A 4U88A 5GTIC 2PI0A 2W84A 3JRCA 4WX9A 5M5WJ 1DUXC 2HFHA 5F27A 2K9QA 3KLNA 3QU6A 2NRAC 3HGGA 5KAFC 4BU2A 1Y8RB 1Z67A 2VPLA 3EUHA 3I59A 3PQJA 4E70A 4HF2A 1KYWA 3HOXJ 3TMOA 1TWFJ 1DPUA 1GVDA 3GX4X 1OCOH 2FQ4A 2M0CA 1UMQA 5EEAA 1Y39A 3F9KA 3P9KA 3IHUA 3N4MA 3JRHA 3KETA 1P4WA 3L7WA 5CJ9A 2HZTA 2XAFA 1OCRH 3H3ZA 4CSWA 2KP6A 4OIRF 2OTJI 3F8MA 4E4HA 4AYBN 2RV8A 1ENHA 4BQNA 2VOOA 2XPUA 4IHTA 1QO0D 3CMEI 3UKGA 1QVTA 1S72I 2P5LC 1IG7A 3MAJA 3PFIA 3T1BA 2RQPA 3Q0WA 1OR7A 2QKMB 4LD5A 5JI6A 1CF7A 2OAZA 4K2EA 4Y33A 1QRYA 1IO2A 4KA4A 3DBLB 2DA3A 4UVAA 4E6KG 2LK2A 3SZGA 1DP7P 5IT9K 1TC3C 5J4VA 2FU4A 3TGNA 4F52A 3PIPF 2M8EA 4C3HJ 4EM2A 4M6VA 1XMKA 3GTOJ 5ILUA 5TGTA 3H5RA 4ITVA 5EEHA 2A6TA 1B6AA 2CV1A 2QEXI 2GOXB 1F9NA 5L3FA 3S1MJ 1I6XA 4YFKF 2WB1A 2ZB9A 1L3LA 3M1EA 4A0XA 1HC8A 4GDFA 5K5OA 3I59B 4IKFA 5HDGA 4WXCA 2CQKA 3KZYA 3ZN0A 2EB7A 3CCQI 3C2GA 4XLNF 1E3OC 2V79A 1X1PA 2W24A 3BWGA 2IA2A 2LY2A 2QM3A 1Y1VJ 2NAZA 1TWAJ 2VB6A 1ZRCA 4NQWA 3GFLA 4R79A 1JJ6C 3ROUA 1LEAA 2PEXA 3PFYA 4Y13A 3RCOA 3ML6A 2CFXA 1BM9A 2ZKZA 3BTIA 2VBWA 1NG6A 2ZMEC 3ZMUA 5FJ8J 3CCLI 3CUQA 1DPRA 4ZZLA 2IGNA 3V4GA 4D5CA 1FMVA 2Y0SA 2IXSA 4BNCA 2XF5A 3BQZA 2HTSA 2P81A 5J8FA 1K6YA 4LLGF 4XLAA 5LHGA 3DTKA 2L4AA 4IHWA 2ACJA 3ZQHA 1ETYA 5CYVA 2QUFA 1IV6A 5E17F 2GXAA 3O8GA 4BXXJ 3FHNA 3J81K
chains in the Genus database with same CATH topology
3ZQGA 3BR5A 3RKQA 4W97A 1NTCA 5IP9J 1HDDC 1LE8B 1G2HA 2O7OA 3WHCA 2WV1A 1MBKA 1BL0A 5C44J 2L7MP 2MSYA 1U9NA 4LOCA 3QPLA 3ZQLA 3JRAA 3K7AJ 1GT0C 4IHVA 1MBJA 2HYJA 4A3LJ 1W0TA 1JKPC 2K9SA 5EZGA 5JLXA 4D5FA 2CUEA 1B8IA 2YUSA 1TWGJ 1ETXA 3M3YJ 1LFBA 2OPTA 2L0KA 1QPIA 2JN6A 1JJ8C 5EGOB 2XGDA 4W1UA 2EZIA 1WCMJ 4M3BA 2VKVA 3RQIA 1R9TJ 3IH3A 1ETVA 1A5JA 3L1PA 2YS9A 1O4XA 1TWHJ 1IRZA 1RPWA 2DA7A 3A03A 3WHBA 1FTTA 2ECBA 1UG2A 2HDDA 2L7ZA 1IDYA 5EYRA 4M3EA 2PMZN 4XICA 2LY9A 5M3FJ 2LKXA 3I4NJ 2IAIA 4RBOA 4MFDA 1MSFC 1NK2P 3ZQIA 4A3IJ 2DTZA 1VNDA 1MBHA 3HOZJ 4IEJA 5EF6A 1WH5A 4DZPA 3G1OA 1JT6A 3ZQCA 5F08A 5M3MJ 5IYBJ 1XG1A 3QQAA 2ME0A 2LLKA 1IC8A 2EQRA 3BTJA 1IUFA 3TW7A 3S16J 2TRTA 3BR3A 5C4XJ 1JUSA 1WI3A 5K7ZA 2Y30A 3BTLA 3CCYA 5EDNA 3GTLJ 1JUPA 1B8IB 1SANA 3BTCA 4MIMA 5JLWA 2K40A 2VKEA 5IP6A 5FLVA 5IYDJ 4M3GA 1YRNA 2FJ1A 1JTXA 5E3NA 3TW6A 1S7EA 3GTKJ 1F43A 3BR2A 1AU7A 2R5YA 1CQTA 1UHSA 4X6AJ 5F0FA 4A3DJ 2E2HJ 3BT9A 2TCTA 2JJ7A 4G12A 2ID3A 2JMWA 3O8HA 4M3DA 2R93J 5C3EJ 5F1JA 4A3GJ 2NVTJ 1Q1VA 2M9HA 1ZGWA 1OJLA 1ZKGA 2AHQA 3GBGA 4A3FJ 1FIAA 4A3MJ 2EZLA 2N8GA 3FKIJ 1OFCX 3QPSA 2NVYJ 3BR0A 2XGCA 1WGXA 3IH2A 2Y31A 2O8KA 2LTPA 3DCFA 1MBFA 4V2GA 1FEXA 4FTHA 2JK3A 1BW6A 4J19A 2CJJA 1JKQC 2DA1A 2H8RA 1P7IA 3C2BA 5J1UA 4IHYA 4Y7NJ 1B72A 3A01A 3JREA 2YU9J 1GV2A 4B3AA 1ZR2A 4EEFG 3OOUA 2L7FP 1MNMC 5IYCJ 1I6HJ 1YRNB 1FIPA 1MBGA 3GTGJ 4UUTA 2XB0X 3S1NJ 3JRGA 5DS9A 2E2IJ 3GTMJ 2OF7A 1ETQA 4JX5A 1ETWA 3OSFA 3A02A 3IH4A 2HOTA 1VF9A 3RZDJ 2QF7A 1MSEC 1X2MA 4XRMA 2EH3A 5BNGA 2R5YB 3LSGA 2AO9A 5M5XJ 1Y1WJ 1IGNA 4DYRA 1HOMA 4AC0A 5HODA 2LR8A 3BR6A 3GTPJ 2XB5A 1ZK8A 1F36A 3HOYJ 1APLC 1RESA 1P7JA 2IBDA 1JTYA 2X48A 1H88C 2DA2A 3H0GJ 3TEDA 1MH3A 1U8BA 2DMQA 3SJMA 1K83J 2HQ5A 3FK7A 2MW8A 1OCPA 1HLVA 4XIDA 1BA5A 2ME6A 4A3BJ 3G1MA 4A3EJ 1NK3P 3HKZN 3S1QJ 2K9NA 2XGEA 3MN2A 2D5VA 2Y9YA 3CQZJ 3Q3SA 2R7ZJ 1D5YA 4BY1J 5GPAA 4FISA 2DMUA 1RETA 2LFBA 1GDTA 1X2NA 5DTDA 1B72B 4FCYA 3A01B 3LOCA 3JRBA 1H8AC 3FISA 1PUFA 2IEKA 3LSJA 2VUMJ 2GLOA 2HXOA 2HI3A 1RR7A 1POGA 1X58A 2JA5J 5K7HA 3TP0A 1RKWA 4XK4A 2JA8J 4MFEA 1FJLA 5M5YJ 3CMYA 2NS7A 5FKKA 2O9LA 3HM5A 3HB9A 4IHXA 2NVQJ 3FK6A 3D1NI 1HDPA 2DA5A 2HOAA 3S1RJ 3F0CA 4JYKA 2R92J 5GPCA 1OCTC 1QVUA 4BBRJ 3HOWJ 5FKLA 1HF0A 3S14J 2LP0A 1ITYA 2FX0A 3LSPA 2EZHA 2JA6J 2JWTA 1ZTRA 3TP3A 2Y9ZA 1ETKA 4JX6A 5FKNA 4DYQA 2XPVA 3BR1A 5C4JJ 1DU0A 2NVXJ 1MH4A 4DYCA 4B4CA 3MVPA 5J1YA 2ELKA 3VPRA 3ZOBA 4CYCA 1JGGA 3Q0VA 3B6AA 3GTQJ 4GFBA 5EG0A 2DJNA 1PUFB 2X9DA 2R5ZA 5GP9A 1TWCJ 2VPRA 1AKHA 4C2MJ 2GM4A 4I76A 1T56A 4BBSJ 4DZJA 2GBYA 2HXIA 2R0QC 2Y0SN 5J3LA 3IV5A 3PO3J 4ABZA 2DMNA 1K61A 2E19A 3PM1A 1MBEA 2LD5A 1A6IA 4DW6A 3NAUA 1ZQ3P 2HOSA 4QSHA 2FD5A 3S2HJ 3CDLA 2KDZA 4HNVA 3HDDA 3B6CA 3RZOJ 5E3MA 3LSRA 1GUUA 3S17J 2ECCA 2CQQA 2EBIA 4MO7A 1FTZA 2VI6A 1IJWC 1BW5A 3SDGA 2LVSA 9ANTA 4L5EA 5FLMJ 2MGQA 4X1EA 5FKOA 5IOZA 3E7LA 3JRDA 2DMPA 3ZQFA 2M2EA 4Y52J 4QTRA 3H3VK 1I50J 1JUMA 4RDUA 2DN0A 1Z0XA 3K2AA 1T33A 2ID6A 1HCRA 3OSGA 4CYCB 3JRCA 5M5WJ 3M4OJ 4XRSG 5F27A 2K9QA 2CQXA 2E1OA 3Q0UA 3HGGA 1ORKA 3MKLA 4A3CJ 5EG0B 3JR9A 2KT0A 2DA4A 2W48A 3S15J 1XC5A 2RAEA 4BKXA 4UUSA 2COBA 3HBLA 3HOXJ 1JKRC 1TWFJ 2R5ZB 3NARA 1GVDA 1AKHB 2FQ4A 2M0CA 1UMQA 5EEAA 1ETOA 1AHDP 2NS8A 2M34A 3SFIA 2DMTA 3JRHA 4AUXA 2QCOA 1ZR4A 2NOGA 4S0HB 4NDLA 5IP7J 2B63J 3GTJJ 5K7FA 4M3FA 1GV5A 4AYBN 1ENHA 2I10A 2Y2ZA 5IPAA 3BG5A 2XPUA 2XPWA 1SFOJ 1XS9A 4JP0A 3UKGA 5F04A 5EZHA 1QVTA 1IG7A 2M8GX 2G0EA 2CRGA 3Q0WA 4A3JJ 2X6OA 2H1KA 5F0CA 1QRYA 2DA3A 4V2FA 2LK2A 1TC3C 3DEWA 4A3KJ 1VI0A 3BG3A 4C3HJ 3W6VA 4M6VA 3GTOJ 2WB1N 4B1RA 4QIWN 3HEFA 4FE4A 5E3LA 3S1MJ 3G1LA 4C3JJ 2ZB9A 3HOVJ 1LE8A 3HOUJ 1W0UA 3I4MJ 2JA7J 4C3IJ 1BJZA 1H89C 1U9OA 4UUSB 5E3OA 4I6ZA 2CU7A 1EF4A 1VFCA 1LFUP 1E3OC 4FE7A 5J1RA 4A69C 2XSDC 2MG4A 1Y1VJ 2WAQN 1TWAJ 1WH7A 3HGYA 1IDZA 3BG9A 3JRIA 5EGOA 1I3QJ 1JJ6C 2CUFA 5FKMA 4JX4A 2EZKA 3FIWA 5F0HA 1JKOC 3JRFA 1Z77A 1WPKA 4BY7J 3BTIA 2E2JJ 1DU6A 5FJ8J 2L9RA 2DA6A 4D5CA 4MLOA 2XRLA 3BQYA 3BQZA 1JT0A 2P81A 4D7NA 1RKTA 4XRSA 4IHWA 1U78A 3LNQA 3ZQHA 1ETYA 1IV6A 3OIOA 4D7MA 3O8GA 4BXXJ 3S2DJ 5IOYA 4A93J 3PO2J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQG A;  3BR5 A;  3RKQ A;  4W97 A;  1NTC A;  5IP9 J;  1HDD C;  1LE8 B;  1G2H A;  2O7O A;  3WHC A;  2WV1 A;  1MBK A;  1BL0 A;  5C44 J;  2L7M P;  2MSY A;  1U9N A;  4LOC A;  3QPL A;  3ZQL A;  3JRA A;  3K7A J;  1GT0 C;  4IHV A;  1MBJ A;  2HYJ A;  4A3L J;  1W0T A;  1JKP C;  2K9S A;  5EZG A;  5JLX A;  4D5F A;  2CUE A;  1B8I A;  2YUS A;  1TWG J;  1ETX A;  3M3Y J;  1LFB A;  2OPT A;  2L0K A;  1QPI A;  2JN6 A;  1JJ8 C;  5EGO B;  2XGD A;  4W1U A;  2EZI A;  1WCM J;  4M3B A;  2VKV A;  3RQI A;  1R9T J;  3IH3 A;  1ETV A;  1A5J A;  3L1P A;  2YS9 A;  1O4X A;  1TWH J;  1IRZ A;  1RPW A;  2DA7 A;  3A03 A;  3WHB A;  1FTT A;  2ECB A;  1UG2 A;  2HDD A;  2L7Z A;  1IDY A;  5EYR A;  4M3E A;  2PMZ N;  4XIC A;  2LY9 A;  5M3F J;  2LKX A;  3I4N J;  2IAI A;  4RBO A;  4MFD A;  1MSF C;  1NK2 P;  3ZQI A;  4A3I J;  2DTZ A;  1VND A;  1MBH A;  3HOZ J;  4IEJ A;  5EF6 A;  1WH5 A;  4DZP A;  3G1O A;  1JT6 A;  3ZQC A;  5F08 A;  5M3M J;  5IYB J;  1XG1 A;  3QQA A;  2ME0 A;  2LLK A;  1IC8 A;  2EQR A;  3BTJ A;  1IUF A;  3TW7 A;  3S16 J;  2TRT A;  3BR3 A;  5C4X J;  1JUS A;  1WI3 A;  5K7Z A;  2Y30 A;  3BTL A;  3CCY A;  5EDN A;  3GTL J;  1JUP A;  1B8I B;  1SAN A;  3BTC A;  4MIM A;  5JLW A;  2K40 A;  2VKE A;  5IP6 A;  5FLV A;  5IYD J;  4M3G A;  1YRN A;  2FJ1 A;  1JTX A;  5E3N A;  3TW6 A;  1S7E A;  3GTK J;  1F43 A;  3BR2 A;  1AU7 A;  2R5Y A;  1CQT A;  1UHS A;  4X6A J;  5F0F A;  4A3D J;  2E2H J;  3BT9 A;  2TCT A;  2JJ7 A;  4G12 A;  2ID3 A;  2JMW A;  3O8H A;  4M3D A;  2R93 J;  5C3E J;  5F1J A;  4A3G J;  2NVT J;  1Q1V A;  2M9H A;  1ZGW A;  1OJL A;  1ZKG A;  2AHQ A;  3GBG A;  4A3F J;  1FIA A;  4A3M J;  2EZL A;  2N8G A;  3FKI J;  1OFC X;  3QPS A;  2NVY J;  3BR0 A;  2XGC A;  1WGX A;  3IH2 A;  2Y31 A;  2O8K A;  2LTP A;  3DCF A;  1MBF A;  4V2G A;  1FEX A;  4FTH A;  2JK3 A;  1BW6 A;  4J19 A;  2CJJ A;  1JKQ C;  2DA1 A;  2H8R A;  1P7I A;  3C2B A;  5J1U A;  4IHY A;  4Y7N J;  1B72 A;  3A01 A;  3JRE A;  2YU9 J;  1GV2 A;  4B3A A;  1ZR2 A;  4EEF G;  3OOU A;  2L7F P;  1MNM C;  5IYC J;  1I6H J;  1YRN B;  1FIP A;  1MBG A;  3GTG J;  4UUT A;  2XB0 X;  3S1N J;  3JRG A;  5DS9 A;  2E2I J;  3GTM J;  2OF7 A;  1ETQ A;  4JX5 A;  1ETW A;  3OSF A;  3A02 A;  3IH4 A;  2HOT A;  1VF9 A;  3RZD J;  2QF7 A;  1MSE C;  1X2M A;  4XRM A;  2EH3 A;  5BNG A;  2R5Y B;  3LSG A;  2AO9 A;  5M5X J;  1Y1W J;  1IGN A;  4DYR A;  1HOM A;  4AC0 A;  5HOD A;  2LR8 A;  3BR6 A;  3GTP J;  2XB5 A;  1ZK8 A;  1F36 A;  3HOY J;  1APL C;  1RES A;  1P7J A;  2IBD A;  1JTY A;  2X48 A;  1H88 C;  2DA2 A;  3H0G J;  3TED A;  1MH3 A;  1U8B A;  2DMQ A;  3SJM A;  1K83 J;  2HQ5 A;  3FK7 A;  2MW8 A;  1OCP A;  1HLV A;  4XID A;  1BA5 A;  2ME6 A;  4A3B J;  3G1M A;  4A3E J;  1NK3 P;  3HKZ N;  3S1Q J;  2K9N A;  2XGE A;  3MN2 A;  2D5V A;  2Y9Y A;  3CQZ J;  3Q3S A;  2R7Z J;  1D5Y A;  4BY1 J;  5GPA A;  4FIS A;  2DMU A;  1RET A;  2LFB A;  1GDT A;  1X2N A;  5DTD A;  1B72 B;  4FCY A;  3A01 B;  3LOC A;  3JRB A;  1H8A C;  3FIS A;  1PUF A;  2IEK A;  3LSJ A;  2VUM J;  2GLO A;  2HXO A;  2HI3 A;  1RR7 A;  1POG A;  1X58 A;  2JA5 J;  5K7H A;  3TP0 A;  1RKW A;  4XK4 A;  2JA8 J;  4MFE A;  1FJL A;  5M5Y J;  3CMY A;  2NS7 A;  5FKK A;  2O9L A;  3HM5 A;  3HB9 A;  4IHX A;  2NVQ J;  3FK6 A;  3D1N I;  1HDP A;  2DA5 A;  2HOA A;  3S1R J;  3F0C A;  4JYK A;  2R92 J;  5GPC A;  1OCT C;  1QVU A;  4BBR J;  3HOW J;  5FKL A;  1HF0 A;  3S14 J;  2LP0 A;  1ITY A;  2FX0 A;  3LSP A;  2EZH A;  2JA6 J;  2JWT A;  1ZTR A;  3TP3 A;  2Y9Z A;  1ETK A;  4JX6 A;  5FKN A;  4DYQ A;  2XPV A;  3BR1 A;  5C4J J;  1DU0 A;  2NVX J;  1MH4 A;  4DYC A;  4B4C A;  3MVP A;  5J1Y A;  2ELK A;  3VPR A;  3ZOB A;  4CYC A;  1JGG A;  3Q0V A;  3B6A A;  3GTQ J;  4GFB A;  5EG0 A;  2DJN A;  1PUF B;  2X9D A;  2R5Z A;  5GP9 A;  1TWC J;  2VPR A;  1AKH A;  4C2M J;  2GM4 A;  4I76 A;  1T56 A;  4BBS J;  4DZJ A;  2GBY A;  2HXI A;  2R0Q C;  2Y0S N;  5J3L A;  3IV5 A;  3PO3 J;  4ABZ A;  2DMN A;  1K61 A;  2E19 A;  3PM1 A;  1MBE A;  2LD5 A;  1A6I A;  4DW6 A;  3NAU A;  1ZQ3 P;  2HOS A;  4QSH A;  2FD5 A;  3S2H J;  3CDL A;  2KDZ A;  4HNV A;  3HDD A;  3B6C A;  3RZO J;  5E3M A;  3LSR A;  1GUU A;  3S17 J;  2ECC A;  2CQQ A;  2EBI A;  4MO7 A;  1FTZ A;  2VI6 A;  1IJW C;  1BW5 A;  3SDG A;  2LVS A;  9ANT A;  4L5E A;  5FLM J;  2MGQ A;  4X1E A;  5FKO A;  5IOZ A;  3E7L A;  3JRD A;  2DMP A;  3ZQF A;  2M2E A;  4Y52 J;  4QTR A;  3H3V K;  1I50 J;  1JUM A;  4RDU A;  2DN0 A;  1Z0X A;  3K2A A;  1T33 A;  2ID6 A;  1HCR A;  3OSG A;  4CYC B;  3JRC A;  5M5W J;  3M4O J;  4XRS G;  5F27 A;  2K9Q A;  2CQX A;  2E1O A;  3Q0U A;  3HGG A;  1ORK A;  3MKL A;  4A3C J;  5EG0 B;  3JR9 A;  2KT0 A;  2DA4 A;  2W48 A;  3S15 J;  1XC5 A;  2RAE A;  4BKX A;  4UUS A;  2COB A;  3HBL A;  3HOX J;  1JKR C;  1TWF J;  2R5Z B;  3NAR A;  1GVD A;  1AKH B;  2FQ4 A;  2M0C A;  1UMQ A;  5EEA A;  1ETO A;  1AHD P;  2NS8 A;  2M34 A;  3SFI A;  2DMT A;  3JRH A;  4AUX A;  2QCO A;  1ZR4 A;  2NOG A;  4S0H B;  4NDL A;  5IP7 J;  2B63 J;  3GTJ J;  5K7F A;  4M3F A;  1GV5 A;  4AYB N;  1ENH A;  2I10 A;  2Y2Z A;  5IPA A;  3BG5 A;  2XPU A;  2XPW A;  1SFO J;  1XS9 A;  4JP0 A;  3UKG A;  5F04 A;  5EZH A;  1QVT A;  1IG7 A;  2M8G X;  2G0E A;  2CRG A;  3Q0W A;  4A3J J;  2X6O A;  2H1K A;  5F0C A;  1QRY A;  2DA3 A;  4V2F A;  2LK2 A;  1TC3 C;  3DEW A;  4A3K J;  1VI0 A;  3BG3 A;  4C3H J;  3W6V A;  4M6V A;  3GTO J;  2WB1 N;  4B1R A;  4QIW N;  3HEF A;  4FE4 A;  5E3L A;  3S1M J;  3G1L A;  4C3J J;  2ZB9 A;  3HOV J;  1LE8 A;  3HOU J;  1W0U A;  3I4M J;  2JA7 J;  4C3I J;  1BJZ A;  1H89 C;  1U9O A;  4UUS B;  5E3O A;  4I6Z A;  2CU7 A;  1EF4 A;  1VFC A;  1LFU P;  1E3O C;  4FE7 A;  5J1R A;  4A69 C;  2XSD C;  2MG4 A;  1Y1V J;  2WAQ N;  1TWA J;  1WH7 A;  3HGY A;  1IDZ A;  3BG9 A;  3JRI A;  5EGO A;  1I3Q J;  1JJ6 C;  2CUF A;  5FKM A;  4JX4 A;  2EZK A;  3FIW A;  5F0H A;  1JKO C;  3JRF A;  1Z77 A;  1WPK A;  4BY7 J;  3BTI A;  2E2J J;  1DU6 A;  5FJ8 J;  2L9R A;  2DA6 A;  4D5C A;  4MLO A;  2XRL A;  3BQY A;  3BQZ A;  1JT0 A;  2P81 A;  4D7N A;  1RKT A;  4XRS A;  4IHW A;  1U78 A;  3LNQ A;  3ZQH A;  1ETY A;  1IV6 A;  3OIO A;  4D7M A;  3O8G A;  4BXX J;  3S2D J;  5IOY A;  4A93 J;  3PO2 J; 
#chains in the Genus database with same CATH topology
 3ZQG A;  3GZN B;  1P4X A;  1BOA A;  3BR5 A;  1TBX A;  4E7Z A;  4W97 A;  1NTC A;  4XLP F;  4Y3O A;  4DJA A;  4ESJ A;  2DXI A;  3GLL A;  2F4I A;  2OTL I;  1G2H A;  2J5P A;  2DJI A;  5D6E A;  2L7M P;  2OU2 A;  3CF2 A;  2BW3 A;  2CO5 A;  2OJE D;  2XRN A;  5FLX K;  1XSX A;  3OL4 A;  2LKS A;  3RPU A;  1JKP C;  2A69 F;  3I3L A;  1NG7 A;  5J8C A;  4NUB A;  1B59 A;  3BJ6 A;  2STT A;  4XNF A;  2OPT A;  4P5O A;  1T98 A;  1EH6 A;  1UEL B;  2JN6 A;  1D8J A;  2XGD A;  4NQW B;  1BIA A;  4XSZ F;  2EZI A;  2O0Y A;  3VYT B;  3EDP A;  2UXN A;  1C0W A;  2VKV A;  2XAU A;  1R9T J;  4RAF A;  3CUQ B;  1TWH J;  1RPW A;  2DA7 A;  3A03 A;  3CJR B;  4RA2 A;  1FTT A;  3ZMT A;  1X3U A;  2XF7 A;  1OMI A;  4C30 A;  4J00 A;  2ZJ2 A;  1RUN A;  1ZHF A;  2VQL A;  2W1O A;  1SD7 A;  2IGO A;  3DPU A;  2LDU A;  3CDH A;  4AYB A;  1YJW I;  4F55 A;  4XIC A;  1A04 A;  2QVO A;  1KQ0 A;  1U2W A;  1UHW A;  2IS4 A;  4A3I J;  4U0V A;  5ILV A;  2TDX A;  1RUO A;  3LQR A;  5LD2 C;  4IEJ A;  3VOD A;  1QU3 A;  5TRD A;  1JT6 A;  2R7V A;  4XLH A;  2XAH A;  1XTA A;  2XSJ C;  3QOE A;  4HW0 A;  4XOR A;  3E97 A;  2WC2 A;  3MWM A;  5D6F A;  2BW3 B;  3S16 J;  3NWT A;  3WTZ A;  2E1M B;  3BR3 A;  4DQ2 A;  4L9V A;  4KIC A;  2VBX A;  3GUD A;  1FBS A;  4HLX A;  1SAN A;  3BTC A;  2EFW A;  3S3M A;  2K40 A;  3K1M A;  1UG0 A;  2CV0 A;  1LDJ A;  2H94 A;  2FJ1 A;  3HL2 A;  2HU9 A;  4N4O B;  3M07 A;  5E3N A;  3J7A O;  3A4C A;  1F43 A;  4AVZ A;  3MZH A;  4EJT A;  1ZYR F;  1CQT A;  5F64 A;  4OIP F;  2G7H A;  3I71 A;  5F0F A;  5J4Y A;  2LYC A;  3BT9 A;  3IUO A;  2JJ7 A;  2KIF A;  2EA2 A;  3P7N A;  2KZG A;  4BEH A;  3EQL F;  3W2A A;  2R93 J;  4G9Y A;  5HDN A;  3KP4 A;  4LLL A;  4CIC A;  2VBZ A;  4H4K C;  3HOS A;  1XX5 A;  3K4N A;  1TT0 A;  2AHQ A;  2JVG A;  3A2K A;  5EEG A;  1E3H A;  2VOP A;  1WFX A;  3GBG A;  1LUJ B;  4IHS A;  4XLF A;  1YYV A;  2XGX A;  3BJA A;  1OFC X;  2R7D A;  1WGX A;  3ECH A;  4PGG A;  2QQ8 A;  2LTP A;  2ZXI A;  4N4N B;  2QLZ A;  4LB6 B;  3B73 A;  1MBF A;  1J2X A;  4HEA 2;  4PUS A;  1FYL A;  2VN2 A;  2W00 A;  1XSD A;  4FTH A;  2COM A;  3JAM K;  1FP2 A;  1JKQ C;  2L01 A;  4A0Y A;  2LRE A;  2VBY A;  1R58 A;  1VQ8 I;  2AQE A;  3RIR A;  3BDD A;  4XRF A;  3A01 A;  1VQ9 I;  5D5V B;  3TDU C;  1GV2 A;  2YU9 J;  3W2W A;  4BQA A;  2A5W A;  3HXL A;  3QU3 A;  1I6H J;  3PUB A;  1MND A;  3IAM 2;  2CWE A;  3Q9V A;  4KUM A;  3H92 A;  1FIP A;  3IKT A;  2VLA A;  1OQY A;  3GTG J;  1PVE A;  4PGH A;  1JGS A;  2BY3 A;  2VKH A;  3M1C A;  4LJZ F;  3TDZ C;  3GTM J;  1ETQ A;  2F5V A;  4BAY A;  2K4B A;  2RN7 A;  2VKD A;  4GCV A;  1Z9C A;  3RZD J;  1ZRD A;  2WWY A;  5E1X A;  1B4A A;  1XMA A;  5HOD A;  4HNU A;  4O6J A;  2XB5 A;  3BC8 A;  1ZK8 A;  1A6Q A;  3HZJ A;  4MEY F;  4BEH B;  3IKV A;  1U6G A;  1U8R A;  1V5E A;  4I02 A;  4HF0 A;  1JTY A;  3PNT A;  1H88 C;  2DA2 A;  3H0G J;  5K1Y A;  1MH3 A;  3LFU A;  1I5Z A;  1X1A A;  2P0W A;  2MW8 A;  2JUC A;  2CW0 F;  2Z33 A;  2H6B A;  4M73 A;  3I56 I;  1PP7 U;  1BA5 A;  2H1L A;  4RGR A;  3AKZ A;  1LNW A;  1P2F A;  2V1N A;  2LKP A;  4DGW B;  4BE0 A;  3ESW B;  3HKZ N;  2XGE A;  3MN2 A;  1SVL A;  2D5V A;  3VB2 A;  2R7Z J;  1SVM A;  3PUF A;  5ERI A;  1D3Y A;  4E7L A;  1EH8 A;  1VQL I;  1MMD A;  4BY1 J;  3ZMS A;  4RM3 A;  4YIR X;  3FF5 A;  1GDT A;  4CH7 A;  1X2N A;  2CUZ A;  2VC1 A;  5DTD A;  4FCY A;  3A01 B;  4KFC A;  1H8A C;  4U87 A;  1PUF A;  3LSJ A;  4OIO F;  3SEQ A;  2HI3 A;  2LBF A;  1POG A;  3HSR A;  3DTE A;  3V7S A;  1X58 A;  2L9N A;  2FUG 2;  3OL3 A;  5D5W B;  2X6X A;  3LA2 A;  2F48 A;  4MFE A;  5HNF A;  1FJL A;  4RLQ A;  5FKK A;  3DKW A;  2O9L A;  3HM5 A;  2VJ4 A;  2NVQ J;  1QZY A;  4RAG A;  1YFH A;  3CCE I;  4HG2 A;  3S1R J;  1FX7 A;  1ZGJ A;  2EV0 A;  2IA0 A;  4JYK A;  1RNL A;  1B9M A;  3IP4 B;  1FBQ A;  2P6T A;  4UVC A;  2IVM A;  3K1P A;  4BBR J;  1R5I D;  1ZGA A;  3VYU B;  2DYS H;  1STZ A;  2LP0 A;  1GVJ A;  1DP3 A;  1S7A A;  2FMY A;  1V55 H;  2BXZ A;  2DOF A;  2CSO A;  1Z3X A;  2W85 A;  2XV4 S;  1SC7 A;  3TP3 A;  3V7R A;  2MD5 A;  5FRM A;  2DK8 A;  3DLA A;  1SMT A;  4JX6 A;  4PZJ A;  3BR1 A;  3WG7 H;  3LAP A;  2NVX J;  4KIS A;  1MH4 A;  4DYC A;  2DU9 A;  2ZXH A;  1AWC A;  2IA1 A;  5E20 A;  5F6F A;  2ELK A;  1LFP A;  3RTR A;  2E7X A;  3W3C A;  3S2W A;  3Q0V A;  4BXF A;  3F8N A;  5HDK A;  4GFB A;  3U2R A;  3E5X A;  1XD7 A;  2DJN A;  2H6C A;  3LST A;  1PUF B;  2X9D A;  2LBF B;  2OCE A;  2P7C B;  1JHF A;  5GP9 A;  1T0F C;  2HTJ A;  4DBR A;  1AKH A;  4RGU A;  1R6R A;  1K7A A;  3FBN B;  3WGG A;  1X1D A;  1ZG5 A;  1T56 A;  5HS8 A;  4OIN F;  2FA5 A;  3VDX A;  1R22 A;  2MAB A;  5J3L A;  1VQN I;  4ABZ A;  3PO3 J;  3BPV A;  4AWX B;  4LGW A;  2E19 A;  2RKH A;  3PM1 A;  4WXH A;  1WVR A;  3JCU C;  3S8P A;  3OYE A;  2GIZ A;  2LD5 A;  2E1C A;  1R36 A;  1I39 A;  2HOS A;  2NNN A;  2FD5 A;  3N05 A;  4G7H F;  3S2H J;  3G3Z A;  4M9X A;  2XAQ A;  2DOE A;  4S05 A;  2CQQ A;  2L54 A;  4E7I A;  1FTZ A;  4XN0 A;  4EM0 B;  4AM3 A;  1UFM A;  5H2F C;  5BMZ A;  1IJW C;  2Z2S B;  2DTR A;  1Z21 A;  5E18 F;  2FF4 A;  4GO1 A;  2L9V A;  3P9I A;  4L9J A;  4HDU A;  1J9I A;  5IOZ A;  4CO8 A;  1BC8 C;  2FE3 A;  3ZQF A;  2R7T A;  3J80 K;  3FM5 A;  2ZNZ A;  3H9G A;  4II2 A;  1I50 J;  1JUM A;  3L2W A;  3EUH C;  1Z0X A;  3WTV C;  2ID6 A;  3WU1 B;  3OSG A;  1R5H A;  3GWZ A;  4XRS G;  5ICC A;  2KJB A;  3Q0U A;  3MKL A;  1SEU A;  4A3C J;  3HTU A;  1Z05 A;  2EIK H;  4IRI A;  2F4O B;  2MD0 A;  2HVR A;  2W48 A;  3S15 J;  2HDW A;  4UUS A;  1W36 C;  5CKT A;  4M9S A;  3X2Q H;  4KT5 C;  5DUK A;  4O5V A;  1AKH B;  1AHD P;  1MNE A;  2P4W A;  3SFI A;  4R8H A;  1V5G A;  3C3W A;  3V8J A;  2BVM A;  4ESF A;  3DPL C;  1K4T A;  4S0H B;  3U1D A;  3T8R A;  1J09 A;  2B63 J;  3ZR8 X;  1YIT I;  5D4R A;  2QKL B;  5DD8 A;  5HS9 A;  5GAE J;  5HNH A;  2O6G E;  1GV5 A;  3DBR B;  1BJA A;  3F3X A;  2PQ8 A;  2ZJR F;  2BVL A;  3BG5 A;  4DBQ A;  1X3W B;  2KIS A;  3DKX A;  5FFX A;  2QYO A;  1TW3 A;  3T8T A;  2BXY A;  2G0E A;  2KIU A;  3AG4 H;  2KIQ A;  4LK1 F;  1FSE A;  3QOD A;  4NC8 A;  2VON A;  1R23 A;  2X6O A;  2BOL A;  4MHG A;  3H9J A;  5IY5 H;  5F0C A;  2WTE A;  3O2P E;  2LH9 A;  4A5M A;  1HXD A;  3RPU D;  3K0L A;  1ZRE A;  3OYI A;  1VI0 A;  1UJ8 A;  3K69 A;  3TL4 X;  3IRQ A;  3CD6 I;  2WB1 N;  4LG0 A;  2VT3 A;  2BEO A;  3HEF A;  4FE4 A;  5E3L A;  3BCB A;  3KP3 A;  2JUG A;  2E7W A;  1LE8 A;  3LQQ A;  1R7J A;  1MMN A;  5KVR A;  1YX5 A;  1EJ9 A;  2IS6 A;  2HOE A;  4C3I J;  1BJZ A;  4UUS B;  2X4H A;  2XAG A;  4N0B A;  4I6Z A;  2DYR H;  3ZQQ A;  3W6J B;  5GAD J;  2HDC A;  4ZYH A;  2JRM A;  1VFC A;  3E6C C;  2F6C A;  2KLO A;  4A69 C;  1FLI A;  2XSD C;  1D0Y A;  1IDZ A;  5DDG A;  3K1N A;  1XGM A;  1XDU A;  1UZC A;  3CUQ C;  2CUF A;  1JXS A;  3GFI A;  2EZK A;  2MLG A;  3D0S A;  4MGR A;  2EIN H;  5F0H A;  5CVR A;  5JHF A;  1A36 A;  3ZCO A;  2FBK A;  2E35 A;  3Q9S A;  2P5V A;  3HHH A;  1ERD A;  1DU6 A;  2VC0 A;  1XPX A;  5K5R A;  4LG3 A;  2DA6 A;  2F5F A;  3BQY A;  1JT0 A;  4J01 A;  5B1B H;  5FGM A;  1FOK A;  3DXJ F;  3N97 A;  3RKW A;  1RI7 A;  4YG2 F;  2HPM A;  1TL8 A;  2FSW A;  4HAM A;  3BP8 A;  3LNQ A;  1EV7 A;  2DOD A;  1SAX A;  2CH0 A;  1IXS B;  2GA2 A;  4KIF A;  2KHM A;  4A2U A;  4HQE A;  3S2D J;  3FX3 A;  4LG0 B;  3CF5 F;  5CVU A;  2E1M C;  2LSO A;  3DTI A;  1D1B A;  2OQG A;  5A2Q Z;  1ZRF A;  1LKX A;  4MTD A;  3V42 A;  1LE8 B;  1BL0 A;  3R61 A;  2WV0 A;  2XF6 A;  3ASN H;  2MSY A;  4I99 C;  4CXF A;  2DT5 A;  3QPL A;  3ZQL A;  2W82 A;  2EPF A;  1BR1 A;  3LAJ A;  2G7U A;  4IZZ A;  3F23 A;  4BJT A;  3D5S C;  3MKW B;  4A12 A;  4A3L J;  1FC3 A;  4RB2 C;  4Y4R A;  2CW7 A;  2Y0M A;  3IRR A;  4G7O F;  2DPD A;  3M3Y J;  1N25 A;  2L0K A;  3F8F A;  4F7Z A;  4HZF A;  5DM7 F;  5CVI A;  4XOP A;  4OMY A;  1MIJ A;  4LLN A;  1WKM A;  3CZ6 A;  1KU9 A;  3CC2 I;  3IH3 A;  1ETV A;  2R7F A;  4BJ5 C;  3L1P A;  2RDP A;  3LA7 A;  1IXC A;  1UB9 A;  1IDY A;  3PIO F;  2P5K A;  4M3E A;  2JT1 A;  4B09 A;  4CCM A;  4PJN A;  3MKY B;  1F1Z A;  1JHH A;  2DFH A;  2GOM A;  3HG9 A;  2EFO A;  3K9T A;  3ZQI A;  5HVQ C;  2DTZ A;  4UY8 I;  1VND A;  3IWF A;  2HWV A;  4OOI A;  3ULQ B;  3WU0 A;  5EF6 A;  3ABT A;  5DYM A;  4BQO A;  5M3M J;  4ETS A;  3AAF A;  4KN4 X;  1P6R A;  3TW7 A;  4ZJZ A;  3PNY A;  2TRT A;  1Y0U A;  1E0E A;  2BY2 A;  1W5C C;  3TQN A;  5TJJ A;  5K7Z A;  2RGV A;  3BTL A;  4EJV A;  4L5J A;  4C9Y A;  1JUP A;  3BJO A;  3OIQ A;  2A6H F;  3LSM A;  2V7F A;  4C2U A;  5IYD J;  5J47 A;  4KMU X;  1YRN A;  3ZMZ A;  1SD6 A;  4AIK A;  4M6X A;  2R7U A;  1JTX A;  3O3K A;  4YRV A;  3GTK J;  1YTY A;  2D1V A;  2QSH X;  5KHD A;  1UHS A;  2LNB A;  5HOO A;  4M74 A;  4CDG A;  3KZZ A;  3BCA A;  1YS7 A;  2MH2 A;  2TCT A;  1PP8 F;  1IN8 A;  4L0Y B;  2KPM A;  4G12 A;  2ID3 A;  3GZ6 A;  2IP2 A;  3O8H A;  4XON A;  4M3D A;  4CA0 A;  3EYY A;  3HRU A;  5C3E J;  2EFP A;  1JE8 A;  2MBF A;  2NVT J;  4A3G J;  2HEO A;  1G3Y A;  1ZGW A;  2UZK A;  1ZKG A;  2R4G A;  1IRX A;  2OZU A;  3W6K B;  3LFK A;  2JSC A;  3QYB A;  1FIA A;  2EZL A;  2N8G A;  2VQC A;  5LLQ A;  2V4J C;  4G6T B;  4NBQ A;  4YEJ A;  2QSF X;  3QPS A;  4GXO A;  3BPX A;  2V1D A;  2XGC A;  1U3E M;  3ZQ7 A;  3WTW C;  1Y56 A;  4XQF A;  4BJ6 C;  1QBJ A;  3AL0 B;  2CUJ A;  2Z3Y A;  1FEX A;  2JTV A;  1YI2 I;  3CP2 A;  4BHB A;  1BW6 A;  4M6Y A;  2CJJ A;  1W5T A;  3LSK A;  5DUI A;  1H9T A;  1OYY A;  4AIH A;  3BZC A;  3L2U A;  4XLC A;  4IRH A;  2HPI A;  5J1U A;  4Y7N J;  3OOP A;  2OZ6 A;  4ZTJ A;  1IXR C;  4HX4 A;  2OA4 A;  2RQQ A;  5K5Q A;  2QQ9 A;  2JRT A;  2DW4 A;  1IW7 F;  3WGI A;  4ZDL A;  1K78 A;  1YRN B;  2O61 A;  2XB0 X;  3PQK A;  2DI3 A;  1QZZ A;  2J5O A;  2QF7 A;  3QOP A;  1MSE C;  3S3O A;  2EH3 A;  2QEN A;  3LSG A;  3R4K A;  4MTE A;  4II3 A;  4DYR A;  1S8N A;  4ZYD A;  2M1B A;  5E1W A;  2LR8 A;  3GTP J;  4Q5S F;  4OWR B;  1MMA A;  3I54 A;  4AIJ A;  2X51 A;  3GEZ A;  3HOY J;  3I9V 2;  4AD9 A;  1P7J A;  2IBD A;  1S29 A;  1TW2 A;  3TED A;  2HNH A;  1KYZ A;  3BRO A;  3S32 A;  2FNA A;  1ZG1 A;  2DMQ A;  3SJM A;  1K83 J;  2HQ5 A;  2K02 A;  1KU3 A;  4CCJ A;  4F91 B;  1YG2 A;  2VE8 A;  1BC7 C;  3CJQ B;  2K27 A;  2VXZ A;  1HKQ A;  3IC7 A;  4UB8 C;  1NK3 P;  4ON0 A;  1J59 A;  2K9N A;  4CZC A;  1DGR M;  2GA1 A;  1R4M B;  3T0Y A;  1MD0 A;  2Y9Y A;  3K4K A;  1WJC A;  2M7B A;  1SFE A;  3OR1 C;  3OYG A;  3HOT A;  4ENK A;  5GPA A;  2UUZ A;  4IOC F;  3EUA A;  1XCB A;  2EIJ H;  1FNN A;  5DM6 F;  2AS5 F;  1J0R A;  3F72 A;  4M72 A;  4ZDO A;  3TOA A;  1HKS A;  1BIB A;  4IQ4 A;  2IEK A;  1PJR A;  2VUM J;  2HXO A;  3IL2 A;  1K78 B;  1ZAR A;  2PMU A;  2JA5 J;  1LDD A;  3CMA I;  4HDV A;  1RKW A;  3OMY A;  4XK4 A;  4I2O A;  1Z1D A;  3DF8 A;  1ON1 A;  3U1K A;  3NQO A;  3SHF A;  3HB9 A;  2ZSH B;  4IHX A;  3OYK A;  2DK5 A;  1REP C;  5CVV A;  1FP1 D;  4UV9 A;  4NHJ A;  2ZC2 A;  5J6X A;  2LF8 A;  3SEZ A;  5GPC A;  3NEU A;  2ELJ A;  4G94 A;  2Q8K A;  2Y75 A;  3TKY A;  3ERM A;  1ZLK A;  1TQP A;  4MNU A;  3ONQ A;  2F4M B;  4L5I A;  1WJE A;  2EZH A;  2ZXJ A;  4MEX F;  5JHU A;  2JA6 J;  3H36 A;  1F5T A;  4JK1 X;  2JWT A;  2Y9Z A;  2BHZ A;  4D9J A;  3QRF F;  1ETK A;  4P9U A;  2LOO A;  3E0J B;  5FKN A;  5C4J J;  2XPV A;  2VAS A;  1DU0 A;  1ACI A;  4EMS A;  1W4M A;  2NNY A;  3HRM A;  3H3U A;  1WWX A;  2D2W A;  5LHH A;  3FXQ A;  4B4C A;  3MVP A;  2KZV A;  4CYC A;  2WAE A;  3VSL A;  4ASN A;  3GTQ J;  1IRF A;  4UV8 A;  4GYG A;  2Z16 A;  5EG0 A;  3MQ0 A;  1VTN C;  5D8K B;  2KDO A;  1YW9 A;  1SFK A;  2MH9 A;  1G3W A;  3OS1 A;  4U0W A;  2R5Z A;  3AFH A;  2M4G A;  1TWC J;  1WJ5 A;  3BOQ A;  1X1B A;  4HYE A;  4HSR A;  1A35 A;  2DAO A;  1SD5 A;  2L02 A;  2PMH A;  2HXI A;  2PJR A;  5L3B A;  2B7E A;  3LWF A;  3OS0 A;  3WE3 A;  3ZN1 A;  4PFO A;  3PL8 A;  1MBE A;  3G71 I;  4Q47 A;  1DGW Y;  2W25 A;  3CCJ I;  5B5E C;  4GYI A;  4HST A;  3SFZ A;  4DW6 A;  1ZQ3 P;  3ZMD A;  1TTY A;  1UST A;  4BHC A;  3CDL A;  2KDZ A;  3PJR A;  3M8F A;  2V6C A;  4HNV A;  3HDD A;  3IWZ A;  4QLC U;  4RB1 A;  3KFW X;  3R6S A;  3LSR A;  1O7L A;  3CLQ A;  2GZW A;  3WGH A;  2ECC A;  2VQH A;  2EBI A;  4MO7 A;  1BW5 A;  2E5Z A;  5EJC A;  2LVS A;  1MMG A;  1QNT A;  5HLI A;  5FLM J;  2CYY A;  3E7L A;  3JRD A;  2X0L A;  1HW2 A;  5BPD A;  2GXB A;  2KRH A;  4RDU A;  1HCR A;  1FPQ A;  2PX9 A;  4CYC B;  3DP7 A;  3FZV A;  2L7K A;  4IQJ A;  3LMM A;  1BI0 A;  4PFP A;  4ENJ A;  1BI2 A;  5EG0 B;  1G3T A;  1TT5 B;  3E3V A;  1HKT A;  1UHM A;  4BKX A;  2RAE A;  2COB A;  3HBL A;  3A1Y A;  2OUM A;  2WA0 A;  4HPQ A;  3NAR A;  2R5Z B;  4UVB A;  1YO5 C;  3P5J A;  1OKR A;  4F92 B;  2P6S A;  1O3S A;  4YIF A;  3KYL A;  3TO7 A;  1IN5 A;  1U5T A;  5FFZ A;  2RC4 A;  1ZR4 A;  6PAX A;  3I58 A;  4RB0 A;  4ZYE A;  4CHU A;  2NOG A;  1VQ4 I;  4HX8 A;  2PJR B;  2IGM A;  3GFJ A;  2M87 A;  3H9Q A;  3FBI B;  3GTJ J;  2W7N A;  1PDN C;  1ZLJ A;  3HUG B;  4M3F A;  1T8I A;  3EYI A;  1RR8 C;  1MKM A;  3GLX A;  3S3N A;  2HYG D;  4BXU A;  4JP0 A;  4R1H A;  1SFU A;  5D4S A;  1HW1 A;  2M8G X;  2F5C A;  1T6S A;  2CRG A;  2M45 A;  4FAS D;  3FWE A;  4QPO A;  2X6Y A;  3MKZ A;  4CCL A;  3KEY A;  4V2F A;  3OWT A;  1E3P A;  2X85 A;  3QPT A;  2DOA A;  2V1X A;  3W6V A;  5F1R A;  4B1R A;  1VQM I;  1QZE A;  3W2V A;  3G1L A;  4C3J J;  5CLS A;  2XKP A;  3HOV J;  3RQ4 A;  4D0P A;  1W0U A;  1HSJ A;  1N75 A;  4OMZ A;  3KEO A;  1H89 C;  4OIQ F;  4O3M A;  4KNY A;  3KP7 A;  1W36 D;  1SD4 A;  3KYC B;  3CCV I;  1YW8 A;  1U5T B;  3VEP A;  5J1R A;  4MQV A;  3F22 A;  1KZH A;  4PDK A;  1WH7 A;  2V9V A;  4B48 A;  3BG9 A;  5D8L B;  4CCK A;  3OYN A;  3JRI A;  1IUY A;  2VL8 A;  4XKV A;  2O8X A;  4YFN F;  3E5Q A;  4ZZD A;  1LVA A;  2CFO A;  2DFI A;  5E8G A;  3K4C A;  3LSH A;  4XM3 A;  4L0Z B;  4KMF A;  4S04 A;  1JKO C;  2ZO4 A;  3ZRG A;  3RI4 A;  1Z91 A;  1Z77 A;  2ELH A;  2DQR A;  4BY7 J;  3FXK A;  4KIB A;  4U0Y A;  2E2J J;  4NB5 A;  2E60 A;  2L9R A;  1LEB A;  4GGG A;  3FMS A;  2XRL A;  3PNV A;  1GXQ A;  1TNT A;  2YU3 A;  3E6D A;  5AIP A;  1FZP B;  2M5W A;  4D7N A;  3CCR I;  2K3P A;  2NXN B;  4B44 A;  4Q4Z F;  1U78 A;  3HPG A;  2EV6 A;  3ZP5 A;  3CJN A;  1VQK I;  5LHI A;  4A93 J;  2FBI A;  2FOK A;  2YR2 A;  3ASO H;  1MDM A;  2RVC A;  3RKQ A;  2B9S A;  1HDD C;  3WHC A;  1MBK A;  2H09 A;  4ZYA A;  1FWZ A;  2WBM A;  4FX0 A;  4AU7 A;  4RS8 A;  3JRA A;  3K7A J;  5BQT A;  4IHV A;  1MBJ A;  4H0E A;  1W1W E;  5EZG A;  5JLX A;  2CUE A;  1VQ5 I;  3SYT A;  1USS A;  1ETX A;  3LL7 A;  1LFB A;  2R7X A;  2JPB A;  4NNJ A;  4FX4 A;  1JJ8 C;  3OY9 A;  3DWL E;  5L3G A;  4UUV A;  1YS6 A;  4UHT A;  3I4P A;  3TO9 A;  4ESB A;  1WCM J;  3HC7 A;  3SDB A;  4X0G A;  1P92 A;  3BG7 A;  3EPZ A;  3RQI A;  3WTS C;  4NC6 A;  3J7Z I;  4F3Q A;  2VXD A;  3GF2 A;  2ESH A;  2V26 A;  2YS9 A;  2HKX A;  4E7K A;  1F4K A;  1IRZ A;  1VZ0 A;  2ECB A;  1UG2 A;  2HDD A;  3ABK H;  4XBF A;  2AXT C;  1UAA A;  1IV8 A;  4UXN A;  3RDI A;  1FYM A;  2BY0 A;  4M71 A;  4IVN A;  2XIG A;  2HGC A;  3C7J A;  3FHZ A;  1I1G A;  3AL0 C;  1QHH D;  3FXL A;  3I4N J;  3QPH A;  4ZTF A;  5AIQ A;  3K6G A;  4RBO A;  2F5E A;  4Z6Y A;  1NK2 P;  4WWC A;  1MDM B;  1MBH A;  1R1U A;  3HOZ J;  2K5C A;  1GLN A;  3G1O A;  3VFZ A;  3K4M A;  4G7Z F;  3ZQC A;  1XG1 A;  4XN3 A;  2LLK A;  1IC8 A;  5ICF A;  3BTJ A;  1IUF A;  3GZ5 A;  1Z6T A;  1J7K A;  3S93 A;  1WI3 A;  5EDN A;  2Y30 A;  3CCY A;  3OYC A;  3FDY A;  1FOX A;  4L9T A;  3SXY A;  3L9F A;  2RNG A;  3HRT A;  4MIM A;  5JLW A;  2VKE A;  5IP6 A;  3OS2 A;  5FLV A;  2NOJ B;  2DO7 A;  3KPH A;  1TLH B;  3GME A;  5AON A;  5JVT A;  3DBH B;  2QQB A;  3TW6 A;  1S7E A;  2OCC H;  3AG2 H;  3BR2 A;  3KCC A;  3M8E A;  3CTA A;  4X6A J;  1D1C A;  4A3D J;  3F6O A;  2E2H J;  3OIP A;  1EA3 A;  2KFD A;  3ZPL A;  4BQQ A;  5L3C A;  1Z7U A;  2A61 A;  2JMW A;  4EGY A;  1V5F A;  1YJ9 I;  1RIO H;  4TV7 A;  5F1J A;  3F6V A;  3F21 A;  4Q48 A;  4BYY A;  5IT9 Z;  1D0X A;  3A0B C;  3V7C A;  2A05 A;  1OCC H;  4IXA A;  3OYJ A;  2K9M A;  1E2X A;  5LEJ A;  4A3F J;  1OYI A;  2R7O A;  3I64 A;  2F5D A;  3FKI J;  3J7A Y;  1K4S A;  1TNS A;  4DIQ A;  5CVJ A;  2DFF A;  2Z99 A;  2KIM A;  2NVY J;  3BR0 A;  5JR3 A;  2ZCW A;  3IH2 A;  3F8C A;  3WTU C;  1FT9 A;  2F2E A;  3DCF A;  4V2G A;  1YIO A;  1AOY A;  4KYW A;  1WJA A;  3U21 A;  2LF7 A;  1FOY A;  4J19 A;  5D5U B;  3CP8 A;  1FY7 A;  2DA1 A;  3KE2 A;  2A5Y B;  2KRF A;  1P7I A;  4XKB A;  3C2B A;  3KYD B;  1XGO A;  4B3A A;  1ZR2 A;  3OOU A;  1MNM C;  4KIG A;  5IYC J;  4EGZ A;  2FQ3 A;  3LSI A;  4HV6 A;  1IN7 A;  3D5R C;  3H1C A;  1HA8 A;  4UUT A;  1XCV A;  3S1N J;  1NH3 A;  3JRG A;  5DS9 A;  4I09 A;  3ABL H;  3CJT B;  1W7P A;  3ELK A;  4P9F A;  1N77 A;  2OF7 A;  4JX5 A;  1ETW A;  3OSF A;  1YJN I;  2LY1 A;  1MMS A;  3OR2 C;  2EIL H;  3MZY A;  1R1T A;  5BNG A;  4XRM A;  1IGN A;  2A3S A;  3J7Y J;  4EJW A;  4RAY A;  1HOM A;  1WJD A;  3ABU A;  3BR6 A;  3GFM A;  5DD4 A;  5HLH A;  1APL C;  1LJ9 A;  2HQA A;  2I8D A;  4EV0 A;  2X48 A;  3C1D A;  3CCS I;  4RLF A;  1G6N A;  3RYR A;  1LVK A;  1N78 A;  5DCM A;  2NS0 A;  4BS9 A;  3L2V A;  3FK7 A;  3K4B A;  3WTT C;  4PJM A;  3L09 A;  1X1C A;  2UWM A;  2ME6 A;  3BZK A;  1Z7L A;  1XB4 A;  3J81 Z;  3BLY A;  3S1Q J;  1P4A A;  1IF1 A;  3CQZ J;  3Q3S A;  4PCQ A;  1D5Y A;  2YPR A;  4XSX F;  2FML A;  5E8I A;  5L3E A;  4BUP A;  5FLX Z;  2ZJQ F;  1O7F A;  1S7O A;  3RYP A;  2CG4 A;  4B43 A;  1X19 A;  1LDK B;  2OBP A;  2XDV A;  3LOC A;  4RGX A;  3HIF A;  3JTH A;  2DPU A;  2IPQ X;  4WK8 F;  3FIS A;  2UXX A;  1FYK A;  2V9P A;  4PJJ A;  3WTX C;  2IT0 A;  3HSE A;  1BI3 A;  1SAU A;  5CPR B;  3CC7 I;  2QQA A;  2GIV A;  4BDZ A;  3GO5 A;  1BBY A;  1W7P B;  1G8X A;  3TP0 A;  1V3F A;  2JA8 J;  3E6B A;  4I98 B;  5M5Y J;  5DV5 A;  3CCU I;  4BDY A;  1RRJ A;  1V4R A;  1MW7 A;  3MZ8 A;  3OYD A;  2E1N A;  2L9S A;  4L18 B;  4IF4 A;  1QPM A;  2DA5 A;  2DT6 A;  2HOA A;  2OQR A;  2IW5 A;  4IO9 F;  3SQN A;  4AVP A;  2L3D A;  5LRS A;  3CC4 I;  3P9C A;  5DCM B;  1QVU A;  2JVH A;  3HOW J;  3RPQ A;  5FKL A;  1D5V A;  4BHP A;  1P9Q C;  3SZP A;  4HOB A;  1HF0 A;  1ITY A;  1AA7 A;  2CW8 A;  4HX7 A;  2FX0 A;  3LSP A;  3AG1 H;  4I0B A;  5DCF A;  5FD5 A;  1T39 A;  2BV6 A;  3OYA A;  3MMY B;  2VQG A;  1NHA A;  2EWN A;  2ZNY A;  3H5A A;  5J1Y A;  3VPR A;  4LFU A;  3ZOB A;  3OYL A;  5LGU A;  2BGC A;  2XRO A;  3KP2 A;  1JGG A;  5IT3 A;  3B6A A;  3VOE A;  5A2Q K;  1D0Z A;  2IS1 A;  5D5X B;  2ESN A;  2FNP A;  3KX2 A;  5LGT A;  1RC9 A;  2MA3 A;  4C2M J;  1W5S A;  2EV5 A;  2GM4 A;  2V6E A;  3TO6 A;  2CV2 A;  2ZFW A;  2QGU A;  1T2K A;  3U9G A;  4I76 A;  3G73 A;  2R7Q A;  3IV5 A;  2K7L A;  3FMQ A;  4CYD A;  2HZD A;  4BAC A;  1WHU A;  2X1C A;  1CF7 B;  4RMN A;  3CDI A;  3NAU A;  4QSH A;  4NC7 A;  1IN6 A;  1Y0N A;  3KZI C;  4QPQ A;  4CCN A;  2XC7 A;  2C6Y A;  5KNL A;  3B6C A;  3G2B A;  3RZO J;  4OAZ A;  5E3M A;  4F93 B;  4LIT A;  3S17 J;  2DBB A;  2VI6 A;  4BGD A;  2AXL A;  1TQM A;  4JOM A;  4FQG A;  4ENN A;  2GWR A;  2M7A A;  3E6M A;  4L5E A;  4KIT B;  5FRN A;  5FKO A;  5H6R A;  3H0D A;  2AQF A;  3KIO A;  2DMP A;  1MJA A;  2NVU B;  2VIX A;  4Y52 J;  4RM2 A;  1BR4 A;  4QTR A;  3JAM Z;  1O3Q A;  1T33 A;  3FXJ A;  1I1S A;  3M4O J;  2NYX A;  2R3S A;  2CQX A;  2E1O A;  3VYS B;  3ERE D;  1K6O A;  1ONV A;  1ORK A;  1R5G A;  4P1W A;  1ZEL A;  1U5T C;  3I0T A;  1ZAO A;  4PSW A;  3JR9 A;  1E17 A;  2KT0 A;  1YX3 A;  2DA4 A;  2Q0O A;  3IAS 2;  2JQ7 A;  1XC5 A;  3JW4 A;  2M3A A;  4EVI A;  1JKR C;  3C18 A;  3ZXS A;  2BBY A;  3E1S A;  1ETO A;  3RKX A;  3L2C A;  2NS8 A;  2M34 A;  4UB6 C;  2DMT A;  2ISZ A;  4AUX A;  4ZDP A;  2QCO A;  4I0A A;  5GTH C;  1BR2 A;  4C2T A;  5BS6 A;  1EKE A;  3DEU A;  4LMY A;  2K9L A;  3DU5 A;  4NDL A;  5IP7 J;  5K7F A;  2CMP A;  4GRI A;  2W57 A;  2XUB A;  2I10 A;  3E5U A;  2Y2Z A;  5IPA A;  2XPW A;  4JBA A;  1SFO J;  1XS9 A;  5F04 A;  5EZH A;  5HLG A;  3CES A;  4A3J J;  2D45 A;  3RSN A;  1R71 A;  2VJ5 A;  1ODD A;  2FBH A;  2H1K A;  2K4J A;  4EM1 A;  1S9H A;  1KU2 A;  4DOZ A;  2QA4 I;  2BHY A;  2M4K A;  5KK1 A;  2YX7 A;  3EUK L;  1VQ6 I;  3DEW A;  4XOT A;  4A3K J;  2RRE A;  3BG3 A;  4HF1 A;  3I55 I;  4BE1 A;  3OYM A;  1DDN A;  4JQF A;  4QIW N;  2L4M A;  3MCZ A;  3ECO A;  3COA C;  1D8K A;  2XKO A;  1TQI A;  4BL0 B;  2GQQ A;  3HOU J;  3WTY C;  4A6D A;  2B0L A;  2XAS A;  3I4M J;  4EAT A;  1J75 A;  2H8W A;  4LK0 F;  2JA7 J;  1U9O A;  2ADU A;  4G6Q A;  4A0Z A;  5E3O A;  2HYF A;  1XGS A;  2Y69 H;  1UCR A;  2CU7 A;  1WZ2 A;  3GVA A;  3UNG C;  1EF4 A;  1WSU A;  4PJL A;  1LFU P;  4FE7 A;  3VSK A;  3VWB A;  1B9N A;  2QSG X;  3I53 A;  2MG4 A;  2WAQ N;  3HGY A;  1X4P A;  2A6E F;  1FOW A;  2Y48 A;  5EGO A;  1I3Q J;  4PSX A;  2LRD A;  1KA8 A;  1TZL A;  2IRF G;  3G4S I;  3JSO A;  4XKC A;  1YHQ I;  3K70 D;  5FKM A;  1CGP A;  4JX4 A;  1BOB A;  2STW A;  2Z9O A;  3FIW A;  4WF2 A;  1U0J A;  3RJP A;  2IS2 A;  2E34 A;  1EH7 A;  3QYF A;  3T5X A;  3JRF A;  1WPK A;  1LB2 A;  4MQ9 F;  3K4L A;  3R0A A;  4MLO A;  5H20 A;  3HUG A;  1R49 A;  1RKT A;  4XRS A;  3JSP A;  3WU2 C;  1T38 A;  3FXO A;  5J40 A;  4XR6 A;  2ZME A;  2CGP A;  1JI8 A;  3OIO A;  3M7G A;  4D7M A;  3HPH A;  4B8X A;  3KP5 A;  4XLE A;  3L2R A;  5IOY A;  1YIJ I;  1SFX A;  3PO2 J;  1SMY F;  1YLF A;  2EK5 A;  1VQO I;  1GHC A;  4XMY A;  3G6E I;  5IP9 J;  5E79 C;  1XSV A;  1A31 A;  2O7O A;  2WV1 A;  4UNO A;  5C44 J;  5GAH J;  3FKJ A;  1DQU A;  2MFZ A;  1U9N A;  4LOC A;  1YW7 A;  3QP6 A;  1VQ7 I;  1TP4 A;  2OC6 A;  3KLO A;  4HA8 A;  1T95 A;  4YEL A;  5DEQ A;  1B1B A;  2YSR A;  5JFR A;  1HST A;  1GT0 C;  2HYJ A;  4M9Z A;  2LC2 A;  1W0T A;  2K9S A;  4D5F A;  2HQR A;  4CGZ A;  4FET A;  1B8I A;  2YUS A;  3V8K A;  2QBY A;  1TWG J;  1O3T A;  2WAD A;  1QPI A;  5EGO B;  3SZT A;  2GXG A;  3OYF A;  1HW5 A;  2CS3 A;  4W1U A;  4OU0 A;  3GYH X;  3CCM I;  2KKO A;  3HRS A;  4ZYG A;  2X1E A;  4ANJ A;  2XHK A;  5TIS C;  1S5L C;  4KJZ A;  4M3B A;  5B1A H;  4E7H A;  3HSF A;  4P96 A;  2QWW A;  3DU6 A;  3OYB A;  1IZ1 A;  2KL4 A;  3BY6 A;  4HQM A;  5FD6 A;  3QP5 A;  3K10 A;  1OIS A;  2PFB A;  4HLY A;  1A5J A;  3F8B A;  3UR3 C;  4YII A;  2JSP A;  4WXD A;  1O4X A;  4A5N A;  3R0J A;  1XN7 A;  3WHB A;  3K70 C;  5CQE A;  5LGN A;  3V8L A;  2L7Z A;  1M1E B;  4EQQ A;  5HLT A;  3L2Q A;  4IOA F;  1QHG A;  5EYR A;  3TBI A;  1ZH5 A;  3CLO A;  4HBL A;  3GCM A;  3DPT A;  1V54 H;  2HR3 A;  2PMZ N;  2ZME B;  2K3F A;  5LBQ A;  3J80 Z;  5M3F J;  2LY9 A;  1MGT A;  1GXP A;  2LKX A;  1O57 A;  2V9K A;  1MZB A;  2IAI A;  4RGS A;  4MFD A;  2JA2 A;  1R1V A;  1MSF C;  2X1D A;  4B47 A;  3ISP A;  2DDB A;  2HS5 A;  1W7P D;  2RNJ A;  1WH5 A;  1XDS A;  2EFN A;  4DZP A;  5F08 A;  4FHT A;  2PBI A;  2ZBK A;  1XMX A;  3NRV A;  5IYB J;  3QQA A;  2ME0 A;  1OYW A;  2EQR A;  4YFX F;  1OCZ H;  2L2O A;  2E36 A;  4IL6 C;  3MD2 A;  2ZFU A;  5FO5 A;  5C4X J;  1JUS A;  4CZZ A;  3GTL J;  2FEZ A;  2QBY B;  1B8I B;  2FOW A;  3HTS B;  1VQP I;  4M3G A;  1I3A A;  2W4S A;  2MC4 A;  4EJU A;  2FRH A;  3OV8 A;  1ULY A;  4DNC A;  5BOX A;  2D1H A;  1AU7 A;  2DCE A;  2R5Y A;  1WJF A;  1S6L A;  4N9I A;  4AID A;  3ZMV A;  1Z6R A;  2VT2 A;  4BH9 A;  2ZSI B;  4XL9 A;  2BY1 A;  4XKW A;  2WAQ A;  2WY7 Q;  3QYE A;  5LFA A;  4P55 A;  1Y8Q B;  4U7B A;  4KDP A;  1Q1V A;  2M9H A;  1OJL A;  5GAG J;  2ICW G;  2MLK A;  1I27 A;  2E71 A;  4Y17 A;  4A3M J;  2DT7 B;  3DEE A;  2GAU A;  2Y31 A;  2O8K A;  1WQ2 A;  1OPC A;  2K86 A;  2HQN A;  5FB2 A;  4E7S A;  2JK3 A;  3M9A A;  3CO7 C;  2O03 A;  5ILS A;  2JPC A;  3NWS A;  2DLL A;  3VYR B;  3FXU A;  2H8R A;  1G3S A;  2KJC A;  4IHY A;  4BE2 A;  1B72 A;  3JRE A;  5KAI C;  4WCG A;  1SVO A;  4EEF G;  2VE9 A;  2DQL A;  2L7F P;  3QAH A;  4LB5 A;  2R7S A;  1MBG A;  4A6E A;  2ZJP F;  2E2I J;  5ICE A;  2R7W A;  2KRC A;  3EET A;  2KMU A;  1QGP A;  3FMR A;  1Q1H A;  3A02 A;  5ICG A;  3IH4 A;  2HOT A;  1VF9 A;  4PJ0 C;  5KCM A;  1LQ1 A;  2Q2E A;  1X2M A;  2R5Y B;  1Y1W J;  2AO9 A;  5M5X J;  5FRO A;  4AC0 A;  3KP6 A;  3ZGK A;  1HBX G;  3BZ6 A;  1YE9 A;  1F36 A;  4ENM A;  1ZN2 A;  1RES A;  3WOD F;  2PLY A;  3DLL F;  4QWQ A;  5B3S H;  2Z1D A;  1FMW A;  3OYH A;  1U8B A;  4Y15 A;  2LG4 A;  1KQ9 A;  5CQG A;  1D1A A;  2H27 A;  1Y6I A;  1LPQ A;  1OCP A;  1HLV A;  2BZT A;  2BYV E;  4XID A;  2X6W A;  1OLT A;  2E5N A;  4A3B J;  3G1M A;  2OD5 A;  3O6B B;  4A3E J;  1H0M A;  4I01 A;  1H9G A;  1YOV B;  4D1Q A;  5JVG F;  4EJO A;  1IRG A;  3Q5F A;  4FT8 A;  3CO6 C;  2M30 A;  3HKZ A;  1HQC A;  1L0O C;  2VOD A;  2K85 A;  1KON A;  2VJJ A;  4FIS A;  2ETH A;  2EJR A;  4KN7 X;  2DMU A;  1RET A;  2LFB A;  3CMM A;  1QA6 A;  2PMZ A;  3I5U A;  2JZY A;  5H6Q A;  1B72 B;  3D5L A;  3JRB A;  5B66 C;  3DV8 A;  3ABM H;  1IN4 A;  5BPI A;  2HVS A;  2I5U A;  3HJE A;  3DQV C;  2Z5U A;  1FBU A;  4LIV A;  2P8T A;  2GLO A;  3WE2 A;  3FXM A;  1RR7 A;  2A68 F;  2M0M A;  4G6D A;  1OR7 C;  2HKO A;  4ZH4 F;  1BI1 A;  5K7H A;  2QZ8 A;  2IGK A;  3C2H A;  1O3R A;  3CMY A;  2Q2E B;  2NS7 A;  1R00 A;  1R4N B;  2UV1 A;  3CUO A;  3FK6 A;  3D1N I;  3MFK A;  4E7J A;  3K4J A;  3MEX A;  1HDP A;  4Z2Y A;  1IAW A;  1XGN A;  3GW2 A;  2A07 F;  3QWL A;  3F0C A;  2CQN A;  5LEK A;  1KQ8 A;  1KGS A;  1RZ4 A;  2R92 J;  1OCT C;  2G9W A;  1WI9 A;  3A0H C;  3AG3 H;  2EIM H;  2LMD A;  2KQR A;  2WAF A;  2ZXW H;  3S14 J;  1T08 B;  3PSF A;  4HNT A;  2L5Q A;  3PSI A;  4RAZ A;  4V19 K;  3FM3 A;  1G4D A;  1ZTR A;  2HVQ A;  4KT6 A;  4I7H A;  1J5Y A;  4IX7 A;  1WJB A;  4DYQ A;  3DKY A;  1MJ9 A;  2OV7 A;  2O5R A;  2PN6 A;  3REO A;  3L00 A;  1MJB A;  5L3D A;  2PG4 A;  5HS7 A;  3H35 A;  1QQI A;  2YX4 A;  4CUG A;  2DDA A;  1PUE E;  2O3F A;  1BN5 A;  3M8J A;  1Z3Y A;  5LRR A;  2IJL A;  2VPR A;  3GXO A;  1ZG3 A;  3HHG A;  3K2Z A;  1K79 A;  4BBS J;  3HYI A;  4DZJ A;  2GBY A;  2P7V B;  1X3Z B;  2R0Q C;  1ON2 A;  2Y0S N;  4IPA A;  4LIU A;  2V1U A;  2DMN A;  1T0F A;  1K61 A;  1WRJ A;  2Q1Z B;  3H5N A;  4G8X A;  1KU7 A;  4ZC3 A;  1A6I A;  1PYV A;  2XVC A;  2MC3 A;  2EA4 A;  4B3X A;  4L9N A;  3FXR A;  2MYS A;  1YQA A;  1GUU A;  4HRI A;  2BE5 F;  2EFQ A;  3DFG A;  4OAY A;  3RKY A;  5E1Z B;  2FXA A;  4PK4 A;  1X4O A;  1S3J A;  2WY8 Q;  3BG6 A;  3SDG A;  5ED4 A;  4U7D A;  1FSH A;  9ANT A;  2VJI A;  2MGQ A;  1G59 A;  4X1E A;  4N9H A;  2DFE A;  4IJA A;  3TOB A;  3KEQ A;  3LA3 A;  4RB3 C;  2ISY A;  4IRG A;  3WG9 A;  2R7R A;  3JTG A;  2CQ7 A;  2M2E A;  2XAJ A;  4HV5 A;  3B02 A;  2PJP A;  3H3V K;  4CCO A;  2DN0 A;  3K2A A;  3R60 A;  4U88 A;  5GTI C;  2PI0 A;  2W84 A;  3JRC A;  4WX9 A;  5M5W J;  1DUX C;  2HFH A;  5F27 A;  2K9Q A;  3KLN A;  3QU6 A;  2NRA C;  3HGG A;  5KAF C;  4BU2 A;  1Y8R B;  1Z67 A;  2VPL A;  3EUH A;  3I59 A;  3PQJ A;  4E70 A;  4HF2 A;  1KYW A;  3HOX J;  3TMO A;  1TWF J;  1DPU A;  1GVD A;  3GX4 X;  1OCO H;  2FQ4 A;  2M0C A;  1UMQ A;  5EEA A;  1Y39 A;  3F9K A;  3P9K A;  3IHU A;  3N4M A;  3JRH A;  3KET A;  1P4W A;  3L7W A;  5CJ9 A;  2HZT A;  2XAF A;  1OCR H;  3H3Z A;  4CSW A;  2KP6 A;  4OIR F;  2OTJ I;  3F8M A;  4E4H A;  4AYB N;  2RV8 A;  1ENH A;  4BQN A;  2VOO A;  2XPU A;  4IHT A;  1QO0 D;  3CME I;  3UKG A;  1QVT A;  1S72 I;  2P5L C;  1IG7 A;  3MAJ A;  3PFI A;  3T1B A;  2RQP A;  3Q0W A;  1OR7 A;  2QKM B;  4LD5 A;  5JI6 A;  1CF7 A;  2OAZ A;  4K2E A;  4Y33 A;  1QRY A;  1IO2 A;  4KA4 A;  3DBL B;  2DA3 A;  4UVA A;  4E6K G;  2LK2 A;  3SZG A;  1DP7 P;  5IT9 K;  1TC3 C;  5J4V A;  2FU4 A;  3TGN A;  4F52 A;  3PIP F;  2M8E A;  4C3H J;  4EM2 A;  4M6V A;  1XMK A;  3GTO J;  5ILU A;  5TGT A;  3H5R A;  4ITV A;  5EEH A;  2A6T A;  1B6A A;  2CV1 A;  2QEX I;  2GOX B;  1F9N A;  5L3F A;  3S1M J;  1I6X A;  4YFK F;  2WB1 A;  2ZB9 A;  1L3L A;  3M1E A;  4A0X A;  1HC8 A;  4GDF A;  5K5O A;  3I59 B;  4IKF A;  5HDG A;  4WXC A;  2CQK A;  3KZY A;  3ZN0 A;  2EB7 A;  3CCQ I;  3C2G A;  4XLN F;  1E3O C;  2V79 A;  1X1P A;  2W24 A;  3BWG A;  2IA2 A;  2LY2 A;  2QM3 A;  1Y1V J;  2NAZ A;  1TWA J;  2VB6 A;  1ZRC A;  4NQW A;  3GFL A;  4R79 A;  1JJ6 C;  3ROU A;  1LEA A;  2PEX A;  3PFY A;  4Y13 A;  3RCO A;  3ML6 A;  2CFX A;  1BM9 A;  2ZKZ A;  3BTI A;  2VBW A;  1NG6 A;  2ZME C;  3ZMU A;  5FJ8 J;  3CCL I;  3CUQ A;  1DPR A;  4ZZL A;  2IGN A;  3V4G A;  4D5C A;  1FMV A;  2Y0S A;  2IXS A;  4BNC A;  2XF5 A;  3BQZ A;  2HTS A;  2P81 A;  5J8F A;  1K6Y A;  4LLG F;  4XLA A;  5LHG A;  3DTK A;  2L4A A;  4IHW A;  2ACJ A;  3ZQH A;  1ETY A;  5CYV A;  2QUF A;  1IV6 A;  5E17 F;  2GXA A;  3O8G A;  4BXX J;  3FHN A;  3J81 K; 
#chains in the Genus database with same CATH homology
 3ZQG A;  3BR5 A;  3RKQ A;  4W97 A;  1NTC A;  5IP9 J;  1HDD C;  1LE8 B;  1G2H A;  2O7O A;  3WHC A;  2WV1 A;  1MBK A;  1BL0 A;  5C44 J;  2L7M P;  2MSY A;  1U9N A;  4LOC A;  3QPL A;  3ZQL A;  3JRA A;  3K7A J;  1GT0 C;  4IHV A;  1MBJ A;  2HYJ A;  4A3L J;  1W0T A;  1JKP C;  2K9S A;  5EZG A;  5JLX A;  4D5F A;  2CUE A;  1B8I A;  2YUS A;  1TWG J;  1ETX A;  3M3Y J;  1LFB A;  2OPT A;  2L0K A;  1QPI A;  2JN6 A;  1JJ8 C;  5EGO B;  2XGD A;  4W1U A;  2EZI A;  1WCM J;  4M3B A;  2VKV A;  3RQI A;  1R9T J;  3IH3 A;  1ETV A;  1A5J A;  3L1P A;  2YS9 A;  1O4X A;  1TWH J;  1IRZ A;  1RPW A;  2DA7 A;  3A03 A;  3WHB A;  1FTT A;  2ECB A;  1UG2 A;  2HDD A;  2L7Z A;  1IDY A;  5EYR A;  4M3E A;  2PMZ N;  4XIC A;  2LY9 A;  5M3F J;  2LKX A;  3I4N J;  2IAI A;  4RBO A;  4MFD A;  1MSF C;  1NK2 P;  3ZQI A;  4A3I J;  2DTZ A;  1VND A;  1MBH A;  3HOZ J;  4IEJ A;  5EF6 A;  1WH5 A;  4DZP A;  3G1O A;  1JT6 A;  3ZQC A;  5F08 A;  5M3M J;  5IYB J;  1XG1 A;  3QQA A;  2ME0 A;  2LLK A;  1IC8 A;  2EQR A;  3BTJ A;  1IUF A;  3TW7 A;  3S16 J;  2TRT A;  3BR3 A;  5C4X J;  1JUS A;  1WI3 A;  5K7Z A;  2Y30 A;  3BTL A;  3CCY A;  5EDN A;  3GTL J;  1JUP A;  1B8I B;  1SAN A;  3BTC A;  4MIM A;  5JLW A;  2K40 A;  2VKE A;  5IP6 A;  5FLV A;  5IYD J;  4M3G A;  1YRN A;  2FJ1 A;  1JTX A;  5E3N A;  3TW6 A;  1S7E A;  3GTK J;  1F43 A;  3BR2 A;  1AU7 A;  2R5Y A;  1CQT A;  1UHS A;  4X6A J;  5F0F A;  4A3D J;  2E2H J;  3BT9 A;  2TCT A;  2JJ7 A;  4G12 A;  2ID3 A;  2JMW A;  3O8H A;  4M3D A;  2R93 J;  5C3E J;  5F1J A;  4A3G J;  2NVT J;  1Q1V A;  2M9H A;  1ZGW A;  1OJL A;  1ZKG A;  2AHQ A;  3GBG A;  4A3F J;  1FIA A;  4A3M J;  2EZL A;  2N8G A;  3FKI J;  1OFC X;  3QPS A;  2NVY J;  3BR0 A;  2XGC A;  1WGX A;  3IH2 A;  2Y31 A;  2O8K A;  2LTP A;  3DCF A;  1MBF A;  4V2G A;  1FEX A;  4FTH A;  2JK3 A;  1BW6 A;  4J19 A;  2CJJ A;  1JKQ C;  2DA1 A;  2H8R A;  1P7I A;  3C2B A;  5J1U A;  4IHY A;  4Y7N J;  1B72 A;  3A01 A;  3JRE A;  2YU9 J;  1GV2 A;  4B3A A;  1ZR2 A;  4EEF G;  3OOU A;  2L7F P;  1MNM C;  5IYC J;  1I6H J;  1YRN B;  1FIP A;  1MBG A;  3GTG J;  4UUT A;  2XB0 X;  3S1N J;  3JRG A;  5DS9 A;  2E2I J;  3GTM J;  2OF7 A;  1ETQ A;  4JX5 A;  1ETW A;  3OSF A;  3A02 A;  3IH4 A;  2HOT A;  1VF9 A;  3RZD J;  2QF7 A;  1MSE C;  1X2M A;  4XRM A;  2EH3 A;  5BNG A;  2R5Y B;  3LSG A;  2AO9 A;  5M5X J;  1Y1W J;  1IGN A;  4DYR A;  1HOM A;  4AC0 A;  5HOD A;  2LR8 A;  3BR6 A;  3GTP J;  2XB5 A;  1ZK8 A;  1F36 A;  3HOY J;  1APL C;  1RES A;  1P7J A;  2IBD A;  1JTY A;  2X48 A;  1H88 C;  2DA2 A;  3H0G J;  3TED A;  1MH3 A;  1U8B A;  2DMQ A;  3SJM A;  1K83 J;  2HQ5 A;  3FK7 A;  2MW8 A;  1OCP A;  1HLV A;  4XID A;  1BA5 A;  2ME6 A;  4A3B J;  3G1M A;  4A3E J;  1NK3 P;  3HKZ N;  3S1Q J;  2K9N A;  2XGE A;  3MN2 A;  2D5V A;  2Y9Y A;  3CQZ J;  3Q3S A;  2R7Z J;  1D5Y A;  4BY1 J;  5GPA A;  4FIS A;  2DMU A;  1RET A;  2LFB A;  1GDT A;  1X2N A;  5DTD A;  1B72 B;  4FCY A;  3A01 B;  3LOC A;  3JRB A;  1H8A C;  3FIS A;  1PUF A;  2IEK A;  3LSJ A;  2VUM J;  2GLO A;  2HXO A;  2HI3 A;  1RR7 A;  1POG A;  1X58 A;  2JA5 J;  5K7H A;  3TP0 A;  1RKW A;  4XK4 A;  2JA8 J;  4MFE A;  1FJL A;  5M5Y J;  3CMY A;  2NS7 A;  5FKK A;  2O9L A;  3HM5 A;  3HB9 A;  4IHX A;  2NVQ J;  3FK6 A;  3D1N I;  1HDP A;  2DA5 A;  2HOA A;  3S1R J;  3F0C A;  4JYK A;  2R92 J;  5GPC A;  1OCT C;  1QVU A;  4BBR J;  3HOW J;  5FKL A;  1HF0 A;  3S14 J;  2LP0 A;  1ITY A;  2FX0 A;  3LSP A;  2EZH A;  2JA6 J;  2JWT A;  1ZTR A;  3TP3 A;  2Y9Z A;  1ETK A;  4JX6 A;  5FKN A;  4DYQ A;  2XPV A;  3BR1 A;  5C4J J;  1DU0 A;  2NVX J;  1MH4 A;  4DYC A;  4B4C A;  3MVP A;  5J1Y A;  2ELK A;  3VPR A;  3ZOB A;  4CYC A;  1JGG A;  3Q0V A;  3B6A A;  3GTQ J;  4GFB A;  5EG0 A;  2DJN A;  1PUF B;  2X9D A;  2R5Z A;  5GP9 A;  1TWC J;  2VPR A;  1AKH A;  4C2M J;  2GM4 A;  4I76 A;  1T56 A;  4BBS J;  4DZJ A;  2GBY A;  2HXI A;  2R0Q C;  2Y0S N;  5J3L A;  3IV5 A;  3PO3 J;  4ABZ A;  2DMN A;  1K61 A;  2E19 A;  3PM1 A;  1MBE A;  2LD5 A;  1A6I A;  4DW6 A;  3NAU A;  1ZQ3 P;  2HOS A;  4QSH A;  2FD5 A;  3S2H J;  3CDL A;  2KDZ A;  4HNV A;  3HDD A;  3B6C A;  3RZO J;  5E3M A;  3LSR A;  1GUU A;  3S17 J;  2ECC A;  2CQQ A;  2EBI A;  4MO7 A;  1FTZ A;  2VI6 A;  1IJW C;  1BW5 A;  3SDG A;  2LVS A;  9ANT A;  4L5E A;  5FLM J;  2MGQ A;  4X1E A;  5FKO A;  5IOZ A;  3E7L A;  3JRD A;  2DMP A;  3ZQF A;  2M2E A;  4Y52 J;  4QTR A;  3H3V K;  1I50 J;  1JUM A;  4RDU A;  2DN0 A;  1Z0X A;  3K2A A;  1T33 A;  2ID6 A;  1HCR A;  3OSG A;  4CYC B;  3JRC A;  5M5W J;  3M4O J;  4XRS G;  5F27 A;  2K9Q A;  2CQX A;  2E1O A;  3Q0U A;  3HGG A;  1ORK A;  3MKL A;  4A3C J;  5EG0 B;  3JR9 A;  2KT0 A;  2DA4 A;  2W48 A;  3S15 J;  1XC5 A;  2RAE A;  4BKX A;  4UUS A;  2COB A;  3HBL A;  3HOX J;  1JKR C;  1TWF J;  2R5Z B;  3NAR A;  1GVD A;  1AKH B;  2FQ4 A;  2M0C A;  1UMQ A;  5EEA A;  1ETO A;  1AHD P;  2NS8 A;  2M34 A;  3SFI A;  2DMT A;  3JRH A;  4AUX A;  2QCO A;  1ZR4 A;  2NOG A;  4S0H B;  4NDL A;  5IP7 J;  2B63 J;  3GTJ J;  5K7F A;  4M3F A;  1GV5 A;  4AYB N;  1ENH A;  2I10 A;  2Y2Z A;  5IPA A;  3BG5 A;  2XPU A;  2XPW A;  1SFO J;  1XS9 A;  4JP0 A;  3UKG A;  5F04 A;  5EZH A;  1QVT A;  1IG7 A;  2M8G X;  2G0E A;  2CRG A;  3Q0W A;  4A3J J;  2X6O A;  2H1K A;  5F0C A;  1QRY A;  2DA3 A;  4V2F A;  2LK2 A;  1TC3 C;  3DEW A;  4A3K J;  1VI0 A;  3BG3 A;  4C3H J;  3W6V A;  4M6V A;  3GTO J;  2WB1 N;  4B1R A;  4QIW N;  3HEF A;  4FE4 A;  5E3L A;  3S1M J;  3G1L A;  4C3J J;  2ZB9 A;  3HOV J;  1LE8 A;  3HOU J;  1W0U A;  3I4M J;  2JA7 J;  4C3I J;  1BJZ A;  1H89 C;  1U9O A;  4UUS B;  5E3O A;  4I6Z A;  2CU7 A;  1EF4 A;  1VFC A;  1LFU P;  1E3O C;  4FE7 A;  5J1R A;  4A69 C;  2XSD C;  2MG4 A;  1Y1V J;  2WAQ N;  1TWA J;  1WH7 A;  3HGY A;  1IDZ A;  3BG9 A;  3JRI A;  5EGO A;  1I3Q J;  1JJ6 C;  2CUF A;  5FKM A;  4JX4 A;  2EZK A;  3FIW A;  5F0H A;  1JKO C;  3JRF A;  1Z77 A;  1WPK A;  4BY7 J;  3BTI A;  2E2J J;  1DU6 A;  5FJ8 J;  2L9R A;  2DA6 A;  4D5C A;  4MLO A;  2XRL A;  3BQY A;  3BQZ A;  1JT0 A;  2P81 A;  4D7N A;  1RKT A;  4XRS A;  4IHW A;  1U78 A;  3LNQ A;  3ZQH A;  1ETY A;  1IV6 A;  3OIO A;  4D7M A;  3O8G A;  4BXX J;  3S2D J;  5IOY A;  4A93 J;  3PO2 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...