5JLWA

Antphd with 15bp dna duplex r-monothioated at cytidine-8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
57
structure length
57
Chain Sequence
GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeotic protein antennapedia
publication title Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulator/dna
total genus 22
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5jlwA00
5F08A 4M3DA 2HOTA 1Y1VJ 1X2NA 5E3MA 2Y30A 2N8GA 5EG0A 4BBSJ 5EZGA 1T56A 1FIPA 1OCPA 1EF4A 3RQIA 1Z77A 2R5YA 3FK6A 2CUFA 2DA4A 2HOAA 5DS9A 3K2AA 1WH7A 5J3LA 1I3QJ 1X58A 1TWGJ 3HBLA 1ETVA 2XGEA 3BTJA 4DYCA 5FKKA 4AYBN 1K83J 4IHWA 4D5CA 1W0UA 3S1QJ 2NS8A 3LNQA 1MBJA 1X2MA 3FK7A 3PM1A 4XRSA 1QVUA 2MGQA 2RAEA 4JX6A 1IV6A 5K7ZA 1ZR4A 4A3CJ 5C44J 1VI0A 3ZQCA 1IJWC 4FTHA 1WI3A 2ECBA 2R92J 4LOCA 2H1KA 1JTYA 2HXIA 2DMNA 3ZOBA 3BQYA 1RR7A 1JT0A 3S16J 3IV5A 1CQTA 4MFDA 1H89C 2YUSA 3FIWA 1OJLA 4L5EA 1UG2A 1MSEC 2FQ4A 5C4XJ 3HEFA 1HF0A 1VNDA 1JGGA 3JRIA 1T33A 1P7JA 3GTGJ 3RZOJ 1O4XA 1TWCJ 1RESA 2Y31A 2LKXA 1Q1VA 2NOGA 2HDDA 2EH3A 2VPRA 2JN6A 3Q3SA 3TEDA 2Y2ZA 5F0CA 1HLVA 1ETOA 2LY9A 2ELKA 4DYQA 1MSFC 3B6AA 2TCTA 2GM4A 2G0EA 2XPWA 3OOUA 1ETWA 4A3GJ 5JLXA 4BKXA 3D1NI 3DCFA 1POGA 4D5FA 2X6OA 1QRYA 4CYCB 1LFBA 3MN2A 1RKWA 4XRSG 2CU7A 1IDYA 2HQ5A 2Y0SN 1ETQA 4JX4A 3VPRA 4DW6A 1HDPA 2PMZN 2Y9ZA 5FLVA 2WB1N 1GV5A 3K7AJ 2XB5A 1GVDA 5IP9J 2NVYJ 2LR8A 1JKOC 2IAIA 5EF6A 3G1OA 3ZQFA 2E2JJ 3BG5A 5FKNA 4FCYA 3W6VA 1IG7A 3CMYA 1ZQ3P 3BR6A 2E1OA 3QQAA 3F0CA 4IHXA 1VF9A 1VFCA 1BL0A 3BQZA 5GP9A 2JK3A 5M5YJ 2EZIA 1JKPC 3HKZN 1AKHB 3ZQIA 2XPVA 1NK2P 1JT6A 2EBIA 2L7MP 2JJ7A 5FKMA 3TP0A 4DYRA 1LE8B 2DMTA 4A3KJ 1B8IB 1MBFA 1AU7A 2K40A 5IP6A 1ETKA 5EGOB 2EZLA 1IRZA 1I6HJ 2LLKA 4M3BA 1MBEA 5F0FA 2O7OA 4BY7J 3JRGA 3M4OJ 2QF7A 1WCMJ 2XRLA 4J19A 1FJLA 5K7FA 1HDDC 1ZGWA 1F36A 1SFOJ 3S15J 4QIWN 2XSDC 3FISA 1WGXA 3HOVJ 2NVQJ 3TP3A 3WHCA 3PO3J 4A3DJ 3BT9A 4A3EJ 1JTXA 1JUMA 2ME6A 3S14J 1ORKA 1IUFA 2CQXA 3C2BA 2LTPA 4AC0A 3S1MJ 3A03A 1AKHA 2DN0A 2KT0A 4XRMA 1WH5A 1ENHA 1YRNA 4Y52J 3ZQLA 2WAQN 3BG9A 3OSGA 2LVSA 4ABZA 1LE8A 5JLWA 1A5JA 1Z0XA 1B8IA 2JMWA 3OIOA 5FKOA 2DMUA 5EGOA 1K61A 1FTZA 3G1MA 5EZHA 2X9DA 4W97A 4C2MJ 3NAUA 2CUEA 2E2IJ 3GBGA 2TRTA 3CQZJ 5M3FJ 5FLMJ 3S1RJ 4MLOA 3JRFA 5DTDA 3A01B 4JP0A 2L7FP 1MH3A 3HGYA 2FX0A 2K9QA 2IEKA 3GTMJ 2DTZA 4QSHA 4RBOA 1PUFB 1JUPA 2ME0A 2M8GX 3IH3A 4C3HJ 1JJ6C 5F0HA 2MG4A 3UKGA 1HOMA 1FEXA 3JRAA 2DA7A 2NS7A 4G12A 2LFBA 5IYBJ 5M5WJ 5IYDJ 2XPUA 4M3GA 3Q0VA 2M9HA 2W48A 5E3OA 4BY1J 2CJJA 2VI6A 3QPLA 3WHBA 2M34A 3S2DJ 2ECCA 4A3FJ 2L9RA 5EDNA 2HYJA 1F43A 5EEAA 5FJ8J 2R5ZB 2WV1A 4EEFG 3ZQHA 2JA8J 3GTJJ 1APLC 2AHQA 3LSRA 5J1RA 4A69C 1FTTA 3L1PA 4Y7NJ 3LOCA 1TWAJ 3NARA 1U78A 5EYRA 3H3VK 1DU0A 4M3EA 5K7HA 2R0QC 2K9NA 2B63J 2JA5J 2LD5A 1PUFA 4MFEA 2MW8A 4DZPA 3A02A 2Y9YA 1D5YA 2MSYA 3CCYA 4AUXA 2DA1A 1GUUA 2DA3A 2HI3A 5E3LA 3I4NJ 1ETYA 3LSGA 4JYKA 4DZJA 1Y1WJ 2NVTJ 3HM5A 3GTOJ 3SDGA 2H8RA 4UUSB 1BW6A 1R9TJ 4IHVA 3LSPA 5M3MJ 3HOUJ 5GPAA 3Q0WA 1JJ8C 2ID3A 4M6VA 5IP7J 1BW5A 3QPSA 3CDLA 4C3IJ 2I10A 2DA6A 4CYCA 2DJNA 2R5ZA 2HOSA 4MIMA 3GTKJ 1XS9A 3BR5A 3JRBA 2COBA 3MVPA 4I76A 1MBGA 2YU9J 1H8AC 3TW6A 3RKQA 1IGNA 4XIDA 2R7ZJ 1HCRA 3O8GA 3BG3A 3JREA 2L7ZA 2L0KA 1RETA 1MBKA 5IPAA 4XK4A 1OFCX 2M0CA 4JX5A 1ZKGA 3BR3A 3SFIA 4FE7A 4A3MJ 3S2HJ 1BA5A 4A3JJ 2CQQA 2LK2A 2ID6A 2X48A 3ZQGA 4QTRA 3BR1A 3E7LA 4FE4A 3B6CA 2NVXJ 4A3LJ 1UHSA 4FISA 3HOYJ 1TWFJ 3MKLA 1H88C 2OPTA 1P7IA 3S1NJ 1ITYA 4UUSA 1NK3P 2HXOA 1MNMC 1U9OA 3GTQJ 1XG1A 1RPWA 5J1UA 4MO7A 2E19A 3BTIA 3GTLJ 1FIAA 1UMQA 3DEWA 1IDZA 1GT0C 2EQRA 2JA6J 2CRGA 3BTLA 3I4MJ 3G1LA 5IYCJ 4A3IJ 9ANTA 3HOZJ 2DMPA 1LFUP 5C4JJ 5C3EJ 2GBYA 3HGGA 4B4CA 2K9SA 2XB0X 4V2FA 1U9NA 5F04A 2DMQA 3BTCA 3BR2A 2VKEA 4V2GA 4HNVA 4X1EA 1GV2A 4IHYA 3JRDA 1BJZA 1A6IA 3HOXJ 3JRCA 3HB9A 5M5XJ 4I6ZA 1AHDP 5J1YA 1ZK8A 4RDUA 1U8BA 4GFBA 3GTPJ 2YS9A 4UUTA 1G2HA 5BNGA 2LP0A 3Q0UA 2M2EA 1I50J 1IC8A 1B72B 3A01A 3PO2J 1MBHA 1SANA 2O9LA 3M3YJ 2ZB9A 1JKRC 4W1UA 3TW7A 3SJMA 2QCOA 2EZHA 2JWTA 4A93J 4BXXJ 3H0GJ 3HOWJ 3BR0A 3OSFA 3JR9A 2DA2A 1TC3C 2O8KA 1ZR2A 4A3BJ 1S7EA 4M3FA 2E2HJ 2JA7J 3IH4A 4B1RA 1QVTA 5EG0B 1JKQC 5IOYA 2XGCA 5E3NA 1RKTA 5HODA 2DA5A 5F1JA 4X6AJ 2P81A 4S0HB 2R5YB 1GDTA 1XC5A 2D5VA 5FKLA 2OF7A 4IEJA 1E3OC 2FJ1A 1YRNB 2XGDA 4D7NA 4BBRJ 1W0TA 1OCTC 2GLOA 1JUSA 3S17J 4B3AA 5GPCA 4XICA 5F27A 4D7MA 1B72A 1DU6A 1ZTRA 2VUMJ 5IOZA 1ETXA 1WPKA 3HDDA 2FD5A 3O8HA 1MH4A 1TWHJ 1NTCA 2IBDA 3LSJA 4NDLA 3RZDJ 2KDZA 2R93J 3FKIJ 3IH2A 4C3JJ 3JRHA 1QPIA 2VKVA 2AO9A 2EZKA
chains in the Genus database with same CATH superfamily
3QPHA 3X2QH 3K4LA 1S8NA 3R4KA 3RPUA 1GHCA 2BXZA 3PQJA 3DLAA 2RNJA 3KP5A 1F4KA 5EG0A 4BBSJ 1MIJA 1R1VA 5E8GA 2AQFA 3KCCA 2F2EA 2R5YA 1U3EM 2DA4A 2HOAA 3DKXA 4N9IA 3H3ZA 1WH7A 4PFPA 2STWA 3K70C 4JBAA 5J3LA 5JR3A 4WXCA 4J01A 1P4XA 3KZZA 3G73A 2WWYA 5FKKA 2NXNB 1K83J 4IHWA 4IHSA 1HSTA 3A4CA 1W0UA 4M6YA 4F7ZA 2H8WA 2NS8A 2L4MA 1HSJA 1ZG3A 1QVUA 1T6SA 1W7PA 1OQYA 4IOAF 5K7ZA 1KU2A 4NC8A 1VI0A 4O3MA 4IPAA 1U2WA 4FTHA 2EK5A 2G7HA 2KMUA 1HW1A 1LFPA 2J5PA 2KP6A 3BQYA 3ROUA 3J80K 5ICCA 1YX3A 4GDFA 4L5EA 2R7QA 3G2BA 3CUOA 1T0FA 2EILH 4CICA 2DPDA 3IL2A 5LHHA 3RZOJ 3CLQA 1TWCJ 2NS0A 3G4SI 1MJAA 1Z6TA 1EH7A 2NOGA 4XN0A 1QA6A 1YYVA 2EH3A 4N4OB 3TEDA 3LSIA 2Y2ZA 1U5TC 1HKQA 1BJAA 4F55A 2E7XA 2ELKA 4AIDA 2PJRB 4DYQA 2V79A 1MSFC 4C2UA 4YIFA 4RAGA 2B0LA 2GM4A 3WU0A 2XPWA 4BAYA 3AFHA 4IRIA 4A3GJ 2RKHA 1HC8A 4RGSA 2O6GE 3WODF 3HXLA 3DCFA 1POGA 4M9SA 3LA3A 2X6OA 1UAAA 3MN2A 2FUG2 1RKWA 3VYRB 4XRSG 1I6XA 2CUJA 2CU7A 4JX4A 2UWMA 1IRFA 5CKTA 1TQIA 3GFMA 3H5RA 5IP9J 1JKOC 1XGSA 5EF6A 5FKNA 5GAGJ 3W6VA 3PSIA 3KYDB 2LDUA 3IWZA 3EUKL 3S2WA 4BQOA 1ERDA 3H5NA 2MFZA 2VJJA 1VF9A 4A0ZA 3HSEA 2ZXHA 2VXDA 1JKPC 3L9FA 5GP9A 2BY2A 5IT3A 1YI2I 1QZEA 2X1CA 3ZQIA 5K5OA 4DGWB 2LKSA 2L9SA 2KIMA 3PIPF 1HA8A 3LSKA 2ZJPF 4DYRA 4A3KJ 4XQFA 5ILUA 1AU7A 2HQNA 1S29A 2PJRA 2FA5A 5EGOB 2EZLA 1IRZA 4OU0A 5IT9Z 3CMEI 1BR2A 4BQNA 2O7OA 3JRGA 1XMKA 2DFIA 2RDPA 3JSOA 2XRLA 3G71I 4J19A 3MKZA 5F64A 1FOWA 2IT0A 2VKHA 1FJLA 4UVBA 4PFOA 2M4KA 5AONA 5EJCA 2DODA 3HSFA 1T2KA 3M7GA 2CQKA 4IQ4A 4M6XA 4OAZA 2W57A 5D4SA 1P2FA 3HOVJ 2EV5A 2VE8A 3M1CA 5ICFA 2K86A 2KRHA 3WHCA 4YIIA 3BT9A 4YIRX 3S14J 3F8BA 4WX9A 2CQXA 4YRVA 4EJOA 3PUFA 3WU1B 4MQVA 4KMFA 2JZYA 5FFZA 2KT0A 3MKWB 2ELHA 3HOTA 3MZ8A 2HS5A 1VQPI 3DWLE 4BH9A 1ENHA 5GAHJ 1ZRCA 3H5AA 3FDYA 1K6YA 3ECOA 4ABZA 5TRDA 3NEUA 5HLIA 3V7SA 4XLNF 1LDDA 2DMUA 5EGOA 1K61A 1FTZA 1R1TA 2X9DA 4W97A 4C2MJ 2M30A 4M9XA 2CUEA 1YG2A 2TRTA 5M3FJ 5HS8A 1YJWI 2CFXA 5DTDA 3VSLA 1G6NA 2L7FP 1MH3A 4JP0A 1MDMB 2DTZA 4RBOA 2Y69H 2H6CA 1I1SA 2PMZA 3NWTA 2WB1A 2M8GX 2M0MA 3B02A 2P0WA 4L0ZB 2GQQA 2PMHA 5F0HA 4N4NB 1XPXA 3CJNA 2Z3YA 5J4YA 5D8LB 3JRAA 1YHQI 2DA7A 2L2OA 3QOPA 2R7SA 3TOBA 4A5NA 1OR7A 4XLAA 2HTSA 2W48A 1BBYA 5E3OA 1FYLA 2CJJA 3VSKA 4ENMA 5D6FA 1XMAA 4XONA 5H2FC 1T8IA 4A3FJ 2KLOA 5L3GA 2P6TA 4C9YA 3ABTA 4B48A 4XSZF 1XSXA 2M8EA 3DQVC 3DBLB 2WV1A 2FRHA 3ABMH 2IGNA 5LLQA 2QQBA 2AHQA 4CCMA 5J1RA 2F6CA 1FTTA 3IWFA 4BDYA 3K6GA 4KT5C 1D8KA 1HBXG 1V54H 3H3VK 2E60A 3H35A 3T1BA 5K7HA 1MDMA 2K9NA 4Y33A 2LD5A 3OYHA 3GX4X 3FXMA 1IN5A 1YW9A 2HVSA 2P4WA 1VQMI 1TQPA 3LSMA 3EQLF 4DZPA 2Y9YA 3HHHA 5DUIA 2MSYA 2I5UA 3OYGA 1IW7F 2DA1A 2W4SA 2DYRH 3U1DA 4B09A 3OS0A 4ZZDA 4UXNA 2HI3A 4LK1F 5E3LA 3U2RA 1R00A 3CP2A 3ZN0A 1ZREA 1I39A 1IO2A 3MQ0A 3ZMDA 2E5NA 3GTOJ 3SDGA 2O3FA 3KEOA 5KNLA 3LSPA 5M3MJ 3HOUJ 4HQMA 5CVIA 4O5VA 3TDZC 1JJ8C 2FNPA 2ID3A 5IP7J 2I10A 5FO5A 5HLHA 1MNEA 4CYCA 1G8XA 3GTKJ 4MIMA 4UVAA 1O3TA 3BR5A 2VBZA 4II2A 2B9SA 2A5YB 2BW3A 3KZYA 1MBGA 2GZWA 2YU9J 2Q2EB 2V7FA 2VONA 2ADUA 2R7ZJ 2KQRA 4ENJA 2JPCA 2KZGA 1TNTA 2F4IA 2BY0A 4BJ6C 4XN3A 4CA0A 1QBJA 1ZYRF 1KA8A 4YG2F 4IO9F 3QODA 3ASOH 4PUSA 2M0CA 3OIPA 4EJUA 4O6JA 2L01A 4FE7A 1V5EA 3S2HJ 3UNGC 3IUOA 2LK2A 3ONQA 1TNSA 2X48A 4MTEA 4F92B 3E7LA 2NNYA 2E1MB 3BPVA 3B6CA 1ZARA 2NVXJ 4A3LJ 4B8XA 1HW2A 2E35A 3T8RA 1LDKB 2W25A 3GTQJ 3F9KA 5KHDA 1PUEE 2DQLA 3P5JA 3U1KA 1QGPA 1JGSA 3IRRA 3TBIA 1XCBA 1FIAA 2ZC2A 1GT0C 3F6OA 2G9WA 4LK0F 3UR3C 5ERIA 1H9GA 3IRQA 3HOZJ 2Q2EA 2V6CA 1LFUP 2LOOA 5C4JJ 1XB4A 2OCEA 4PGHA 1YW8A 3HGGA 1PJRA 3QYBA 2UV1A 3I71A 2DLLA 2IRFG 3FBIB 3BTCA 2COMA 4BEHB 2A61A 2QKLB 3CZ6A 3PUBA 4HNVA 2XRNA 5E1XA 1PDNC 3J81K 3JRDA 3FX3A 4P9UA 3L2CA 1MZBA 2CW0F 2E7WA 1S9HA 4XLPF 5FLXK 1MMSA 2D1HA 4XM3A 4B44A 4F3QA 1TW3A 3CP8A 3VODA 1BOBA 2VIXA 1J0RA 1AHDP 3K4BA 1WKMA 3E0JB 1TLHB 1EH8A 4FHTA 4CCLA 2L4AA 1WJBA 1U8BA 3GTPJ 1D0ZA 2EIJH 1GLNA 1RI7A 1VQ4I 1G2HA 3EYIA 4JK1X 5BNGA 3I55I 2K85A 3M9AA 4KICA 4IXAA 2NAZA 1SFEA 2BHZA 2ZCWA 1B72B 3PO2J 5DD4A 1MBHA 2ESNA 1QNTA 3I58A 2JUCA 4EGYA 2XAQA 2KIQA 1JKRC 4XORA 3TW7A 4BHBA 4G6TB 3N4MA 2QCOA 2EZHA 4A93J 4BXXJ 2RC4A 2WADA 3SQNA 3W6KB 4HW0A 1FBQA 1QZZA 4BEHA 5D5WB 1ZR2A 2OAZA 4A3BJ 1T0FC 1BI3A 2STTA 2KJCA 3IH4A 1QVTA 4EM1A 2OU2A 3DFGA 1KZHA 5IOYA 1R36A 3K4CA 2X6YA 2HZTA 3SEZA 5E3NA 3R61A 1RKTA 1MD0A 2LF8A 5HODA 1P6RA 3PNTA 5F1JA 3A1YA 3DTIA 1GDTA 4S0HB 3RPQA 1WVRA 4C2TA 3R0JA 1JI8A 4Q4ZF 3TMOA 2DK8A 4D7NA 3WTUC 3RI4A 3QP5A 4RA2A 3CCLI 3MZHA 4BL0B 2GLOA 1JUSA 3QOEA 4N9HA 2P5VA 3BP8A 5E1WA 3S17J 4B3AA 4XICA 1K79A 3LA7A 1B72A 1ZHFA 3AG3H 3V7CA 2OC6A 3K4NA 2LRDA 2JRMA 2XAUA 1EA3A 1W5SA 1WJ5A 2ZFWA 2OQRA 2DJIA 2QQ8A 1WJEA 4NDLA 4AM3A 3IP4B 5DUKA 2AO9A 4HSTA 4IJAA 3E3VA 4M3DA 4G94A 1P4AA 1Y1VJ 2HOTA 3KYLA 3CTAA 3F21A 2Y30A 1D8JA 3BC8A 4ZDOA 2BBYA 2IGOA 3E1SA 4QPOA 5EZGA 4KDPA 1UHWA 3CD6I 2CQNA 3E97A 2CUFA 2D45A 2P8TA 1LKXA 3GZ6A 4HNTA 2DDAA 3LQQA 3S3MA 1X4PA 3CMAI 4GGGA 2EFWA 3BTJA 2Q0OA 3LL7A 1BC8C 1R5ID 1DPRA 1ON1A 1W4MA 4MEYF 3FK7A 1FC3A 5KAFC 4XRSA 3JTGA 3ABLH 1HOMA 4DJAA 4JX6A 5B1AH 2LY2A 2MD5A 1ZR4A 1SD4A 5C44J 1EKEA 2EIKH 3ZQCA 4UV9A 3TO6A 4CXFA 1WI3A 1G3WA 2ECBA 1USTA 2W82A 1JTYA 4I99C 3MAJA 3CO6C 2RVCA 3AL0B 4EQQA 2YUSA 1UG2A 2G7UA 2FQ4A 1AOYA 3HEFA 3K4MA 2LBFB 2IPQX 1P7JA 2MBFA 2NOJB 2BYVE 3AKZA 5TISC 2NVUB 3RKYA 3QU6A 5E20A 3SYTA 2QKMB 3QP6A 2AXTC 2BZTA 3BG6A 1YQAA 1TT5B 1OYIA 2GAUA 5DM6F 3KYCB 4BHCA 1ETOA 2L3DA 2RQQA 4XKWA 4Q47A 2L54A 1O3RA 3SZGA 5HVQC 2TCTA 5H6QA 3OOUA 2ZNYA 3I64A 4BKXA 4E7HA 3K10A 3WE3A 4D5FA 1WZ2A 1LFBA 2A3SA 1FBSA 2Y9ZA 4DW6A 2PMZN 1EJ9A 4HPQA 2WB1N 2Q8KA 2WY7Q 4ETSA 2XB5A 1GVDA 3FMQA 2ZKZA 2K7LA 4GCVA 4E7SA 1LPQA 1ONVA 2OTJI 4XNFA 1IG7A 1RUOA 2H94A 4OMZA 1LNWA 4ZC3A 1OCCH 1ZG1A 4IHXA 1VFCA 1BL0A 2LBFA 2JK3A 2EZIA 1OR7C 3VB2A 4B43A 1WWXA 2M1BA 1R1UA 2PEXA 3H92A 4FT8A 2XPVA 1BI2A 1E17A 3OS1A 3L2VA 4L0YB 3OYNA 2EBIA 2E34A 3F8FA 1KGSA 5H20A 1KQ8A 1HQCA 4OIOF 1MBFA 2CS3A 2XAHA 4MQ9F 4ZYEA 5IP6A 2HPMA 2KHMA 2LLKA 5DDGA 4GO1A 3OYAA 5LD2C 2EFPA 2FBKA 4AYBA 2DO7A 2MH9A 1O57A 2MA3A 2ZJQF 3RPUD 2VC0A 1HDDC 1F36A 3S15J 3G6EI 3OIQA 2XSDC 2IGMA 2Z33A 3O3KA 3VYSB 2EA2A 1XDSA 4MEXF 2NVQJ 3M8JA 1X19A 3PFYA 1SFKA 5DCFA 3BG7A 3TGNA 3ULQB 3HHGA 3BY6A 1MW7A 2XUBA 4KMUX 3C2BA 2VQCA 4FX4A 3P9CA 2LTPA 3S1MJ 3E6CC 4I02A 2R7XA 1WQ2A 4XRMA 5B1BH 1DUXC 1JHFA 5LGUA 4KA4A 4IF4A 1WHUA 4CCNA 4DOZA 2HYFA 1W7PD 3BG9A 4BNCA 2LVSA 5AIPA 3ERED 5JLWA 2KL4A 4BS9A 1EH6A 4S04A 2ESHA 3OIOA 5FKOA 1YLFA 4EJWA 2DFEA 4FQGA 2R3SA 1Z9CA 5JI6A 2E2IJ 2K4BA 4HBLA 3CUQB 3E6DA 3S1RJ 4MLOA 2HKXA 3P9IA 5H6RA 3HGYA 5CPRB 1REPC 2FX0A 3W2WA 2IEKA 5D5XB 3D5SC 2Y0SA 2VBXA 2VJ5A 2DYSH 1ZRDA 2FOKA 1OPCA 2WV0A 4X0GA 1FEXA 3OYDA 1DPUA 4RB1A 4DBRA 2CFOA 2ZXJA 3Q0VA 2XAGA 3RTRA 4PGGA 1B6AA 3WHBA 3HKZA 2M34A 4RB2C 1PP8F 3S2DJ 1I27A 2ECCA 1NHAA 2O5RA 3OYLA 4HV5A 5EDNA 3EUHA 3LAPA 3P9KA 3W2AA 1B1BA 3DPUA 4HV6A 2HVRA 2JSCA 1F43A 2EPFA 4KUMA 5EEAA 3CC7I 2LREA 4NUBA 3GTJJ 4Z6YA 4A69C 3CUQA 4KYWA 4Y7NJ 1TWAJ 2UZKA 1IXSB 5FRMA 2PBIA 2W00A 1YTYA 1U78A 4ZDPA 4PCQA 4XOTA 2Z9OA 3M8FA 1X1PA 2XF5A 4GYIA 3C2GA 2HU9A 5BQTA 4G9YA 4MFEA 3HYIA 2MW8A 4BQAA 3CCYA 3OL3A 1I3AA 3L2UA 4ZTJA 2NNNA 2E1MC 3I59B 1FP2A 2XVCA 5KAIC 4Q5SF 3LSGA 1TT0A 1IF1A 2X6XA 1Y1WJ 1XTAA 1SC7A 1XDUA 4KN4X 2KPMA 3ZQ7A 4H0EA 1SAUA 4UUSB 1R9TJ 4IHVA 4XKCA 1WJCA 1EV7A 2A5WA 2OCCH 2WAQA 3Q0WA 1J9IA 4XOPA 3WTSC 3CDLA 5GTIC 2DI3A 1ODDA 4CZZA 2COBA 2R7TA 1YS6A 3MVPA 4PZJA 4PJLA 2MD0A 1H8AC 1QHHD 1J75A 4ESBA 1RRJA 3KLOA 4LGWA 4CYDA 4OMYA 1S3JA 3KE2A 1UELB 2E1CA 3BG3A 5HNHA 1FZPB 2L0KA 3DU5A 3WG9A 1USSA 4G7OF 3JAMZ 3T0YA 2BOLA 1S7AA 5IPAA 3OR1C 2BVMA 3C3WA 4LLGF 1LUJB 4GRIA 1ZKGA 4YELA 3BR3A 3SFIA 2H09A 1BA5A 2OQGA 4A3JJ 3PFIA 4LIUA 3I59A 3ZQGA 2P6SA 3BR1A 3PSFA 3LFUA 4FE4A 2LKPA 3L2WA 1TWFJ 2RREA 3MKLA 1FLIA 1O7FA 2A07F 3RJPA 4UUSA 1NK3P 3PNVA 1WJAA 2QZ8A 2R7UA 3AG2H 4BGDA 5J1UA 3V8LA 2VQHA 3RYPA 3BTIA 4HX4A 1Y8QB 3GTLJ 2FXAA 4U7BA 3K1PA 3DEWA 5HS7A 4S05A 2HYGD 3BJ6A 2JA2A 2JA6J 1Y0NA 1BC7C 1ZH5A 4RM3A 1JE8A 3CCVI 2JVHA 3F3XA 2IS1A 5D4RA 3FXRA 2K9SA 3EDPA 3GCMA 1YITI 1N78A 3I54A 3QYFA 2XASA 3WTXC 2DMQA 2HFHA 2KRFA 4L9JA 5J6XA 3CCSI 2ZNZA 3BR2A 4V2GA 1GV2A 2GIZA 3K4KA 4IHYA 2YPRA 4LB6B 2R7FA 3OL4A 2LSOA 4R79A 4RGUA 2Y48A 1A6IA 2KRCA 1BIAA 1FP1D 1ZN2A 2XC7A 1VQ6I 2CG4A 1E3PA 3JRCA 4I6ZA 4AIHA 1UB9A 2M4GA 3C7JA 2VKDA 1FWZA 2CGPA 1OCOH 1JHHA 2LH9A 2DPUA 4XLFA 3I3LA 5L3EA 1T98A 3VYTB 3ASNH 4BXFA 5CQEA 3RKXA 3TOAA 5J4VA 4I2OA 2M2EA 3N05A 1P4WA 1FYKA 3BDDA 2QBYB 2XV4S 1WSUA 4IL6C 3OYKA 4ZH4F 2VBYA 3AG1H 4B3XA 2O9LA 1P9QC 2ZB9A 2HQRA 3S3OA 2DT5A 1J59A 3WGIA 3SJMA 3ML6A 2JWTA 2XDVA 2X1EA 3H0GJ 2DFHA 4B47A 3ZP5A 1TC3C 5HDGA 4HF2A 1HKSA 4M3FA 2E2HJ 4I98B 2JA7J 4B1RA 4RB3C 2CV1A 1IUYA 1JKQC 5CYVA 1TZLA 2IS6A 3WE2A 1RC9A 1ZLJA 2FOWA 4KITB 4X6AJ 3ZXSA 1XC5A 2D5VA 1C0WA 1SFXA 6PAXA 2K02A 1MKMA 1F9NA 1SVOA 3JW4A 2H1LA 3HRSA 1YRNB 1VQOI 2XGDA 1FX7A 4HDVA 5J8CA 1W0TA 4II3A 1VZ0A 4BJ5C 2ZMEB 3SDBA 2JT1A 2V1UA 2X51A 3OY9A 3HRUA 5GPCA 3EYYA 2QBYA 5F27A 1DU6A 2KJBA 2VUMJ 2FF4A 5IOZA 1WPKA 4M72A 4BUPA 1SMYF 1SFUA 4ENNA 3O8HA 3ISPA 3KETA 4RM2A 2QQ9A 3ECHA 1NTCA 4L9TA 2E5ZA 1PP7U 1YIJI 2BY3A 2K27A 2P5LC 4E7ZA 3AL0C 2WTEA 3IH2A 4C3JJ 2KKOA 2VKVA 4HOBA 1VQ9I 1Z7UA 2EFQA 2VJ4A 5F08A 5LRRA 5TJJA 1IN4A 4YFNF 3WTYC 1X2NA 4LG3A 4YFKF 5E3MA 3R0AA 2F5EA 5L3FA 2Z2SB 1DGWY 2N8GA 5LRSA 3HRMA 2CMPA 1T56A 2K5CA 2KISA 1OCPA 3RQIA 1A36A 3FK6A 2PQ8A 3K1NA 2JPBA 3K2AA 4UNOA 2KIUA 4E4HA 1W5CC 2GIVA 1K6OA 1KQ9A 2LY1A 2HPIA 2M87A 1SD6A 2WC2A 5FD6A 1I3QJ 1X58A 1KYZA 2XGEA 4LIVA 3H9JA 3DTKA 1KONA 4AYBN 1IAWA 1OYWA 2ZMEA 1FOYA 3E6MA 3DBRB 3PQKA 3QWLA 4PSXA 4NQWB 4XLEA 1CGPA 1A6QA 2PLYA 1T38A 2D2WA 2IW5A 3KLNA 4ZTFA 1IV6A 4RAFA 2JRTA 3HOSA 4A3CJ 3QAHA 5CVRA 2IVMA 5B66C 1N25A 1IJWC 1TW2A 1Z1DA 3FXUA 4LITA 2R92J 3H0DA 2H1KA 3FBNB 3M1EA 2DMNA 3BZ6A 1VTNC 1YO5C 1JT0A 3CCUI 1CQTA 3S16J 1RIOH 3JTHA 2PMUA 4MNUA 3BWGA 1H89C 1OJLA 1IN8A 5GAEJ 1MSEC 3VYUB 1YW7A 1HF0A 1JGGA 3JRIA 4IHTA 4XSXF 4M74A 4FASD 1Q1VA 4U88A 2DTRA 2HDDA 3OYFA 3PL8A 3Q3SA 2MLKA 1VQ7I 5F0CA 2H27A 4F91B 1SVLA 4AIKA 5BMZA 2EV0A 4BXUA 1Z3XA 2IA2A 2LY9A 4UV8A 3E6BA 1X1BA 3CJRB 2HKOA 4CCJA 3B6AA 2EFNA 2CW8A 1ETWA 1MMNA 4NQWA 3D1NI 3SHFA 3COAC 4I7HA 2Y0MA 3BZKA 4QWQA 3FHNA 5LEKA 1FY7A 1IDYA 4OOIA 2Y0SN 1ETQA 4TV7A 5LGNA 4ZYDA 1HDPA 1LDJA 1GV5A 3K7AJ 2R7VA 3W6JB 1R4MB 3EUAA 4BE2A 2NVYJ 2LR8A 2PN6A 3G1OA 4PJMA 3ZQFA 3BG5A 3FMSA 5E18F 4HQEA 1OMIA 4EJVA 4ZYGA 2EB7A 3OV8A 3CMYA 5E1ZB 3BCBA 3CCQI 4L9NA 2E1OA 3HRTA 2MYSA 3CJQB 2X6WA 3QQAA 3F0CA 5FRNA 1RNLA 3BQZA 5M5YJ 4U0WA 3V4GA 3HKZN 2F48A 5JVTA 3K9TA 3LSHA 3WTWC 4CO8A 3CDHA 3KPHA 5CQGA 1R23A 1JT6A 3IHUA 3EUHC 3FXJA 3BPXA 4OWRB 3ZN1A 3RYRA 2LG4A 3F22A 4LD5A 4LLNA 3IC7A 3IAM2 1LE8B 4LG0B 1YE9A 2IP2A 2VE9A 3DPTA 2FNAA 4ZDLA 2DBBA 3FM3A 2K40A 5HOOA 2QEXI 5JHUA 3GVAA 4RB0A 4BY7J 3J7YJ 3CUQC 3HG9A 1ZELA 2QF7A 3GFJA 4PDKA 5K7FA 1ZGWA 1S7OA 1SFOJ 4I09A 2HQAA 2YX7A 4WF2A 5J47A 3BJAA 5IY5H 1LJ9A 2W7NA 2XHKA 3FISA 3LSTA 1WGXA 3TP3A 2V9VA 2DOEA 3FXQA 4R8HA 4E7IA 1Z6RA 4IOCF 4ESJA 4IRHA 2L02A 2ME6A 3GXOA 5BPDA 1ORKA 1GVJA 1M1EB 2LMDA 1IUFA 2X85A 1S5LC 1YJNI 4AC0A 3V8JA 3S93A 2ZSHB 3OYEA 1O3SA 2VT2A 1S72I 2BGCA 2DN0A 2DOFA 5ICEA 4A12A 5LGTA 5D6EA 1XD7A 2DFFA 3NQOA 4AVPA 3ZQLA 4QPQA 2WAQN 4NNJA 3CESA 2EJRA 2ZSIB 3OSGA 4ESFA 2VASA 2YU3A 1TBXA 1LE8A 5JFRA 1A5JA 4LG0A 2X1DA 2JMWA 3LFKA 1UCRA 2VL8A 2BXYA 3HC7A 1BOAA 5EZHA 3W3CA 5ILSA 1O7LA 1YOVB 1K4SA 4YEJA 3GBGA 3CQZJ 1XGNA 1PYVA 4AIJA 2EWNA 1Z91A 3JRFA 3A01B 4UVCA 4IZZA 3PJRA 3ZMUA 4U87A 2VOPA 1W1WE 2BE5F 2ETHA 1RZ4A 1PUFB 2P5KA 1E2XA 5HNFA 4C3HJ 2WA0A 2A6HF 3B73A 2DQRA 4CCKA 3R6SA 5HDNA 3UKGA 3VWBA 2LF7A 2MABA 2XAJA 3DEEA 1Z3YA 4XL9A 1WJDA 3VOEA 1N75A 2QSHX 4RAYA 3HIFA 2XPUA 5E79C 3HPHA 5F6FA 2ZO4A 4G6QA 3ABKH 2M9HA 1TQMA 4BY1J 4PJJA 2VI6A 3MEXA 2L9NA 1GXQA 2MC4A 2CH0A 2L9RA 4HX7A 4BU2A 4G7HF 5J40A 1X3WB 2HYJA 5FJ8J 2R5ZB 1LVKA 2WBMA 4EEFG 1FYMA 3ZQHA 4D1QA 5K5RA 3FHZA 1R49A 1APLC 3W2VA 3LSRA 3CLOA 2UUZA 3L1PA 1V5FA 2BHYA 4CHUA 4HG2A 3MKYB 4LB5A 1Y56A 2VBWA 2Z16A 4UB6C 5EYRA 1DU0A 4M3EA 4IKFA 2OD5A 2R0QC 1MNDA 1Q1HA 4U0VA 1ZRFA 2QENA 2JA5J 1NG6A 2B63J 1PUFA 3CCEI 2IJLA 3MD2A 2R7DA 4M71A 4HNUA 1SEUA 4ZYAA 3A02A 5KCMA 4HEA2 2HGCA 1D5YA 1BR4A 3HSRA 4AUXA 5CVUA 1GUUA 3KZIC 5CLSA 4IQJA 3OOPA 3GEZA 5FB2A 1ETYA 3DTEA 4JYKA 5FROA 5HLGA 1V55H 1MGTA 2W84A 2F5FA 5GTHC 2H8RA 2V6EA 2L9VA 4PK4A 2HEOA 1OLTA 5HS9A 2FE3A 5GPAA 2CW7A 2NYXA 2OA4A 4MTDA 1BW5A 3QPSA 2DJNA 2R5ZA 2HOSA 1K7AA 2WAFA 1XS9A 3FKJA 3PIOF 4PJ0C 2QQAA 2RV8A 2V1DA 3BOQA 4EMSA 3JRBA 5IT9K 2VXZA 3CCRI 4HX8A 3DKWA 3GWZA 3RKQA 1SD5A 2OV7A 4XIDA 1BR1A 1HCRA 3O8GA 1G4DA 5BS6A 3L00A 1XMXA 2R7RA 3F8CA 3M07A 1MBKA 4ENKA 4XK4A 3T5XA 4BE0A 1UHMA 4IX7A 1B9NA 2UXXA 3V7RA 3ZPLA 2CWEA 2GA2A 1B59A 4YFXF 5EEHA 1E3HA 4XKVA 3GZNB 1QO0D 4A3MJ 3S8PA 3JAMK 2RNGA 4H4KC 2Z99A 5A2QZ 1XCVA 1HKTA 4QTRA 4LLLA 1V4RA 2A6EF 3HOYJ 1IN7A 2OPTA 1P7IA 3SEQA 3S1NJ 1ITYA 4HYEA 1MNMC 2AXLA 4C30A 1SD7A 2ZXIA 1DP3A 4G7ZF 1XG1A 4CZCA 4GYGA 2AQEA 4JOMA 3T8TA 2QYOA 2ZJ2A 2QSGX 3F23A 1IDZA 3J7AO 4RLFA 3CO7C 4V19K 2QUFA 3G1LA 5LBQA 3OS2A 4BDZA 3LAJA 2F4MB 1KU7A 3ELKA 3AG4H 2DCEA 9ANTA 1SMTA 2DMPA 4LFUA 3ZMVA 5JVGF 2X0LA 2DU9A 5C3EJ 1FNNA 4B4CA 4HF1A 2YR2A 1U9NA 3ZMTA 3V8KA 2CV2A 1ON2A 4JQFA 3HZJA 4QLCU 2JQ7A 1FT9A 2IA0A 2VKEA 3WGGA 4X1EA 4DBQA 2F5CA 1LEAA 1RUNA 4EM0B 1G59A 2K9LA 3HOXJ 3D0SA 3I5UA 1ZAOA 1TP4A 3HB9A 4AU7A 1BIBA 4RDUA 1KU3A 2HTJA 1R22A 2F5DA 4P55A 1E0EA 3K69A 2YS9A 4UUTA 2ZMEC 3WTTC 1R7JA 2CO5A 4Q48A 2C6YA 2LP0A 2QM3A 1IC8A 1I50J 2EFOA 5CVVA 4IRGA 4L9VA 4KJZA 1QPMA 2IA1A 4A0XA 1SANA 3HTUA 5TGTA 2LNBA 4KIGA 3K4JA 1H0MA 4RS8A 1ZGJA 3MWMA 1W36D 1ACIA 3HOWJ 3L09A 4P1WA 3ZMZA 3OSFA 5L3DA 4UUVA 3AAFA 2O8KA 1U8RA 1XSVA 2TDXA 3O6BB 1S7EA 3IKTA 2JVGA 2OTLI 1Z21A 4FX0A 3CCMI 1R4NB 2HVQA 4EV0A 2XIGA 1TTYA 2XGCA 2OZ6A 3QYEA 1XGMA 1Z05A 3WG7H 2DA5A 3JSPA 4ON0A 3I53A 1FMWA 2FEZA 3F6VA 3ZMSA 3L7WA 2R4GA 3IAS2 2FBHA 3OMYA 5ICGA 1BI1A 2FJ1A 5DEQA 5KK1A 3SZTA 2A6TA 3ZR8X 1X3ZB 3M8EA 1AA7A 3SZPA 3RSNA 4BBRJ 1YFHA 2M3AA 1FMVA 3BROA 4NBQA 1L3LA 4OIPF 5B3SH 2JTVA 4DIQA 3KP6A 1N77A 4LJZF 3FWEA 2BVLA 1ETXA 3HDDA 2FU4A 1J5YA 2QVOA 3I56I 2QSFX 2X4HA 2YSRA 3CDIA 4NC7A 1MH4A 3LMMA 2IBDA 2UXNA 4XMYA 2R93J 2EV6A 3L2QA 3FKIJ 2PFBA 2XGXA 5F1RA 1F5TA 4WCGA 1QPIA 3RKWA 4A3DJ 3OYMA 1K78B 2BY1A 4EJTA 1V3FA 3CCJI 3CC4I 2VJIA 2K3FA 4HA8A 2FSWA 2GOXB 3KP3A 1VQ5I 3H1CA 1FIPA 4ZJZA 1EF4A 2L7KA 1Z77A 2DAOA 1DGRM 4UB8C 3K1MA 4KNYA 5DS9A 1X1DA 3GO5A 4L5JA 1NG7A 2HDWA 3D5RC 1A31A 3ERMA 1D0XA 1TWGJ 2QA4I 3HBLA 1ETVA 3O2PE 4U0YA 2M7BA 4DYCA 2H6BA 2M7AA 2FQ3A 3DEUA 4D5CA 1DP7P 3S1QJ 3N97A 1Y6IA 3LNQA 1MBJA 1X2MA 3PM1A 3S3NA 3KIOA 2MGQA 3KP4A 2RAEA 1R5GA 4HSRA 4DNCA 5HDKA 3OWTA 2WAEA 4WXDA 3J80Z 4E7KA 1MMGA 4F52A 5DCMB 4DQ2A 2VT3A 2OUMA 4G6DA 4MGRA 3RCOA 4G8XA 3TO9A 4LOCA 1A35A 2HXIA 2MH2A 3ZOBA 1RR7A 1GXPA 3KP7A 3IV5A 4MFDA 1FSHA 4GXOA 3FIWA 2YX4A 3K0LA 1K78A 3GMEA 5C4XJ 1LB2A 1VNDA 2M45A 3Q9VA 4Y3OA 1T33A 3GTGJ 2J5OA 4AD9A 1R6RA 1O4XA 1VQKI 1RESA 2Y31A 2M5WA 4KIFA 2LKXA 1B4AA 1OISA 2NRAC 4XLHA 1MJ9A 2VPRA 2JN6A 5DM7F 1YS7A 1HLVA 1G3TA 1UG0A 4F93B 3HTSB 1IXCA 4KT6A 1IV8A 2IS4A 4A2UA 3FXLA 3GYHX 2KIFA 2G0EA 3Q5FA 2BV6A 2K3PA 4D9JA 5JLXA 3OYBA 2FMLA 3TL4X 3J7AY 4EGZA 1QRYA 4CYCB 1QU3A 2ZXWH 4ZYHA 3DP7A 2HQ5A 1X1AA 3VPRA 5FLVA 1K4TA 2BW3B 5DCMA 3GLLA 4HRIA 2IAIA 1KU9A 2VB6A 2E2JJ 3HUGB 4ASNA 4NC6A 4FCYA 3ABUA 1ZQ3P 3BR6A 1OYYA 2JSPA 2DW4A 1VQLI 3ZQQA 1FOKA 4WK8F 3FXOA 3H9GA 1AKHB 4ANJA 1NK2P 4BYYA 2O8XA 3NRVA 2KFDA 4E7LA 3K70D 1AWCA 1B9MA 3WU2C 2L7MP 2VOOA 2CSOA 2JJ7A 1D3YA 3H3UA 1T08B 5FKMA 3TP0A 3TQNA 1X4OA 2DMTA 2W1OA 1B8IB 3WTVC 2O03A 1ZG5A 1U5TB 3C1DA 5DD8A 1ETKA 3FXKA 1I6HJ 4M3BA 1MBEA 4OIQF 5F0FA 1QHGA 2VN2A 3M4OJ 5LHGA 4Y4RA 1WCMJ 3D5LA 2VQGA 2WY8Q 3E5UA 5E8IA 3ESWB 3JCUC 1KQ0A 3R60A 4QIWN 2OZUA 4UY8I 2Z1DA 2V1XA 2XF7A 3KFWX 3QU3A 2A05A 5LHIA 3HL2A 4HLXA 3U9GA 3HUGA 3PO3J 5AIQA 5B5EC 4A0YA 1OCRH 4A3EJ 1JTXA 1JUMA 2GXGA 2IGKA 3IKVA 1YX5A 3GUDA 4M73A 3OR2C 1LEBA 3I9V2 3K2ZA 3C18A 4RGRA 1XGOA 2PI0A 5L3CA 3A03A 1XN7A 4BQQA 1AKHA 1YIOA 3DPLC 2FMYA 1VQ8I 1WH5A 4XKBA 1YRNA 4Y52J 2FBIA 3PNYA 5CJ9A 4P96A 3ZRGA 2DT7B 1MMDA 3WGHA 1HW5A 2DT6A 1W5TA 1Z0XA 1X1CA 1B8IA 3QRFF 1FPQA 1U5TA 4WXHA 2P7VB 2XKOA 2LC2A 3KEYA 3G1MA 2K4JA 3NAUA 4XRFA 3G3ZA 1BN5A 4HAMA 4FETA 1D1BA 2O61A 2B7EA 5FLMJ 1J09A 2IS2A 1DDNA 1RR8C 4Y17A 5FGMA 1MJBA 1D1AA 2PG4A 2K9QA 3GTMJ 4QSHA 2IXSA 1JUPA 2ME0A 5HLTA 2XAFA 1QZYA 3IH3A 4K2EA 3DF8A 4E7JA 1JJ6C 3U21A 2MG4A 2V9PA 3TDUC 4I01A 4E6KG 3RQ4A 2NS7A 1I1GA 1FSEA 2LFBA 2Q1ZB 4G12A 3H9QA 3TO7A 5IYBJ 5ED4A 5M5WJ 1YJ9I 1TL8A 5IYDJ 2ELJA 4M3GA 3L2RA 3A2KA 1NH3A 2GXBA 3QPLA 5GADJ 2DXIA 3VDXA 1ZGAA 3V42A 5ILVA 2RGVA 4J00A 4HLYA 5LFAA 4RLQA 3CC2I 3C2HA 1CF7B 2V9KA 3S32A 2HDCA 3FM5A 5FFXA 4KIBA 2JA8J 1IZ1A 2KZVA 3F8MA 4Y15A 5JHFA 4Z2YA 2Z5UA 1A04A 1P92A 3LOCA 4M9ZA 3TKYA 3KX2A 4RMNA 3NARA 5E17F 2A69F 4ITVA 2F5VA 1R58A 1UZCA 3ZCOA 1OCZH 2QGUA 4NB5A 2OJED 5KVRA 4BHPA 5L3BA 1ULYA 1WI9A 1R5HA 2GWRA 2DA3A 3A0BC 1L0OC 1LVAA 1V5GA 4CCOA 3NWSA 3I4NJ 3EPZA 2A68F 5BPIA 2I8DA 4DZJA 2V26A 2NVTJ 3HM5A 2MLGA 4Y13A 3CF2A 1D5VA 1BW6A 3Q9SA 2V4JC 3I4PA 3QPTA 3HJEA 2ACJA 4M6VA 4AVZA 2HWVA 4I0AA 4C3IJ 2DA6A 1X3UA 2DOAA 1IN6A 2BEOA 1CF7A 1J7KA 4CSWA 3DV8A 4D0PA 4I76A 3DXJF 3TW6A 1S6LA 2XF6A 2GA1A 1IGNA 2E36A 1STZA 2DK5A 3F72A 4KISA 4HF0A 4CUGA 3JREA 1G3SA 2L7ZA 3MZYA 1BI0A 3REOA 3P7NA 4BJTA 1W36C 5D5UB 1RETA 2VQLA 2VPLA 3MCZA 3BZCA 2GXAA 1OFCX 4JX5A 2VODA 2JUGA 1IXRC 2AS5F 4NHJA 4CGZA 4XBFA 3OYCA 2CQQA 4HDUA 5DYMA 4L18B 1Z67A 2ID6A 1MMAA 3FZVA 1O3QA 2V1NA 4KN7X 1UHSA 3LQRA 4FISA 3ZGKA 2ISYA 4LMYA 1H88C 2W24A 4KFCA 1T95A 4P5OA 4RGXA 1WJFA 5A2QK 2E71A 2HXOA 1U9OA 1SVMA 1RPWA 4MO7A 4PJNA 4P9FA 2E19A 3LA2A 4N0BA 1U6GA 5J8FA 1UMQA 3GLXA 2ZJRF 4ZZLA 2EIMH 2EQRA 5CVJA 2CRGA 3BTLA 4R1HA 5K5QA 1Y39A 3I4MJ 4MHGA 3KP2A 1WRJA 3KEQA 3DKYA 4HZFA 5IYCJ 5BOXA 4A3IJ 1I5ZA 2F4OB 4A6EA 2KDOA 4PSWA 1R71A 3GW2A 3VEPA 3RIRA 1LQ1A 3E5XA 4WWCA 2GBYA 2XB0X 4V2FA 3J81Z 5F04A 5FLXZ 2HR3A 3LWFA 2HOEA 2HZDA 3CJTB 3CMMA 4E70A 4EM2A 5EEGA 2VC1A 2ISZA 1DQUA 1BJZA 2RQPA 2R7OA 3BJOA 2ZFUA 1JXSA 1Z7LA 3MFKA 2XSJC 4OAYA 2L5QA 4L5IA 4RAZA 5M5XJ 2RN7A 5J1YA 1BM9A 1ZK8A 5FD5A 1PVEA 3RDIA 1D0YA 4GFBA 3F8NA 1QQIA 3DU6A 2D1VA 3VFZA 1T39A 5D8KB 3Q0UA 3J7ZI 4A6DA 3CF5F 4XLCA 4EATA 4A5MA 3FF5A 3A01A 2P7CB 1D1CA 5D5VB 3M3YJ 4EVIA 3BLYA 4W1UA 3DLLF 2OBPA 1FOXA 1ZLKA 4BACA 2ICWG 1Y0UA 2CV0A 3EETA 4AWXB 2CUZA 1UFMA 4UHTA 1IRGA 2GOMA 3BR0A 3JR9A 2PX9A 4CH7A 1F1ZA 2DA2A 3A0HC 2W85A 3OYIA 2CQ7A 5K1YA 2XROA 3GZ5A 4CDGA 3GFLA 3SFZA 1WFXA 5EG0B 2Y75A 2XKPA 1KYWA 3GF2A 3E5QA 3BCAA 4OIRF 2P81A 2R5YB 1XX5A 5LEJA 1H9TA 5FKLA 1FBUA 2E1NA 2OF7A 4IEJA 3MMYB 1E3OC 3WTZA 4IVNA 2K9MA 4OINF 2HNHA 3HPGA 4BE1A 2EINH 3SXYA 3OYJA 1OCTC 2MC3A 2ZBKA 1VQNI 1UJ8A 3FMRA 3H36A 2LYCA 2VLAA 1XSDA 5DV5A 1G3YA 2PJPA 3GFIA 4D7MA 2R7WA 2QLZA 1SAXA 1ZTRA 1W7PB 3I0TA 2FD5A 4XR6A 2CYYA 1TWHJ 4U7DA 2DDBA 3DBHB 3LSJA 3RZDJ 2KDZA 1Y8RB 2QWWA 1J2XA 1IRXA 1U0JA 4I0BA 1HXDA 3JRHA 2O0YA 2EA4A 1OKRA 2EZKA
chains in the Genus database with same CATH topology
5F08A 4M3DA 2HOTA 1Y1VJ 1X2NA 5E3MA 2Y30A 2N8GA 5EG0A 4BBSJ 5EZGA 1T56A 1FIPA 1OCPA 1EF4A 3RQIA 1Z77A 2R5YA 3FK6A 2CUFA 2DA4A 2HOAA 5DS9A 3K2AA 1WH7A 5J3LA 1I3QJ 1X58A 1TWGJ 3HBLA 1ETVA 2XGEA 3BTJA 4DYCA 5FKKA 4AYBN 1K83J 4IHWA 4D5CA 1W0UA 3S1QJ 2NS8A 3LNQA 1MBJA 1X2MA 3FK7A 3PM1A 4XRSA 1QVUA 2MGQA 2RAEA 4JX6A 1IV6A 5K7ZA 1ZR4A 4A3CJ 5C44J 1VI0A 3ZQCA 1IJWC 4FTHA 1WI3A 2ECBA 2R92J 4LOCA 2H1KA 1JTYA 2HXIA 2DMNA 3ZOBA 3BQYA 1RR7A 1JT0A 3S16J 3IV5A 1CQTA 4MFDA 1H89C 2YUSA 3FIWA 1OJLA 4L5EA 1UG2A 1MSEC 2FQ4A 5C4XJ 3HEFA 1HF0A 1VNDA 1JGGA 3JRIA 1T33A 1P7JA 3GTGJ 3RZOJ 1O4XA 1TWCJ 1RESA 2Y31A 2LKXA 1Q1VA 2NOGA 2HDDA 2EH3A 2VPRA 2JN6A 3Q3SA 3TEDA 2Y2ZA 5F0CA 1HLVA 1ETOA 2LY9A 2ELKA 4DYQA 1MSFC 3B6AA 2TCTA 2GM4A 2G0EA 2XPWA 3OOUA 1ETWA 4A3GJ 5JLXA 4BKXA 3D1NI 3DCFA 1POGA 4D5FA 2X6OA 1QRYA 4CYCB 1LFBA 3MN2A 1RKWA 4XRSG 2CU7A 1IDYA 2HQ5A 2Y0SN 1ETQA 4JX4A 3VPRA 4DW6A 1HDPA 2PMZN 2Y9ZA 5FLVA 2WB1N 1GV5A 3K7AJ 2XB5A 1GVDA 5IP9J 2NVYJ 2LR8A 1JKOC 2IAIA 5EF6A 3G1OA 3ZQFA 2E2JJ 3BG5A 5FKNA 4FCYA 3W6VA 1IG7A 3CMYA 1ZQ3P 3BR6A 2E1OA 3QQAA 3F0CA 4IHXA 1VF9A 1VFCA 1BL0A 3BQZA 5GP9A 2JK3A 5M5YJ 2EZIA 1JKPC 3HKZN 1AKHB 3ZQIA 2XPVA 1NK2P 1JT6A 2EBIA 2L7MP 2JJ7A 5FKMA 3TP0A 4DYRA 1LE8B 2DMTA 4A3KJ 1B8IB 1MBFA 1AU7A 2K40A 5IP6A 1ETKA 5EGOB 2EZLA 1IRZA 1I6HJ 2LLKA 4M3BA 1MBEA 5F0FA 2O7OA 4BY7J 3JRGA 3M4OJ 2QF7A 1WCMJ 2XRLA 4J19A 1FJLA 5K7FA 1HDDC 1ZGWA 1F36A 1SFOJ 3S15J 4QIWN 2XSDC 3FISA 1WGXA 3HOVJ 2NVQJ 3TP3A 3WHCA 3PO3J 4A3DJ 3BT9A 4A3EJ 1JTXA 1JUMA 2ME6A 3S14J 1ORKA 1IUFA 2CQXA 3C2BA 2LTPA 4AC0A 3S1MJ 3A03A 1AKHA 2DN0A 2KT0A 4XRMA 1WH5A 1ENHA 1YRNA 4Y52J 3ZQLA 2WAQN 3BG9A 3OSGA 2LVSA 4ABZA 1LE8A 5JLWA 1A5JA 1Z0XA 1B8IA 2JMWA 3OIOA 5FKOA 2DMUA 5EGOA 1K61A 1FTZA 3G1MA 5EZHA 2X9DA 4W97A 4C2MJ 3NAUA 2CUEA 2E2IJ 3GBGA 2TRTA 3CQZJ 5M3FJ 5FLMJ 3S1RJ 4MLOA 3JRFA 5DTDA 3A01B 4JP0A 2L7FP 1MH3A 3HGYA 2FX0A 2K9QA 2IEKA 3GTMJ 2DTZA 4QSHA 4RBOA 1PUFB 1JUPA 2ME0A 2M8GX 3IH3A 4C3HJ 1JJ6C 5F0HA 2MG4A 3UKGA 1HOMA 1FEXA 3JRAA 2DA7A 2NS7A 4G12A 2LFBA 5IYBJ 5M5WJ 5IYDJ 2XPUA 4M3GA 3Q0VA 2M9HA 2W48A 5E3OA 4BY1J 2CJJA 2VI6A 3QPLA 3WHBA 2M34A 3S2DJ 2ECCA 4A3FJ 2L9RA 5EDNA 2HYJA 1F43A 5EEAA 5FJ8J 2R5ZB 2WV1A 4EEFG 3ZQHA 2JA8J 3GTJJ 1APLC 2AHQA 3LSRA 5J1RA 4A69C 1FTTA 3L1PA 4Y7NJ 3LOCA 1TWAJ 3NARA 1U78A 5EYRA 3H3VK 1DU0A 4M3EA 5K7HA 2R0QC 2K9NA 2B63J 2JA5J 2LD5A 1PUFA 4MFEA 2MW8A 4DZPA 3A02A 2Y9YA 1D5YA 2MSYA 3CCYA 4AUXA 2DA1A 1GUUA 2DA3A 2HI3A 5E3LA 3I4NJ 1ETYA 3LSGA 4JYKA 4DZJA 1Y1WJ 2NVTJ 3HM5A 3GTOJ 3SDGA 2H8RA 4UUSB 1BW6A 1R9TJ 4IHVA 3LSPA 5M3MJ 3HOUJ 5GPAA 3Q0WA 1JJ8C 2ID3A 4M6VA 5IP7J 1BW5A 3QPSA 3CDLA 4C3IJ 2I10A 2DA6A 4CYCA 2DJNA 2R5ZA 2HOSA 4MIMA 3GTKJ 1XS9A 3BR5A 3JRBA 2COBA 3MVPA 4I76A 1MBGA 2YU9J 1H8AC 3TW6A 3RKQA 1IGNA 4XIDA 2R7ZJ 1HCRA 3O8GA 3BG3A 3JREA 2L7ZA 2L0KA 1RETA 1MBKA 5IPAA 4XK4A 1OFCX 2M0CA 4JX5A 1ZKGA 3BR3A 3SFIA 4FE7A 4A3MJ 3S2HJ 1BA5A 4A3JJ 2CQQA 2LK2A 2ID6A 2X48A 3ZQGA 4QTRA 3BR1A 3E7LA 4FE4A 3B6CA 2NVXJ 4A3LJ 1UHSA 4FISA 3HOYJ 1TWFJ 3MKLA 1H88C 2OPTA 1P7IA 3S1NJ 1ITYA 4UUSA 1NK3P 2HXOA 1MNMC 1U9OA 3GTQJ 1XG1A 1RPWA 5J1UA 4MO7A 2E19A 3BTIA 3GTLJ 1FIAA 1UMQA 3DEWA 1IDZA 1GT0C 2EQRA 2JA6J 2CRGA 3BTLA 3I4MJ 3G1LA 5IYCJ 4A3IJ 9ANTA 3HOZJ 2DMPA 1LFUP 5C4JJ 5C3EJ 2GBYA 3HGGA 4B4CA 2K9SA 2XB0X 4V2FA 1U9NA 5F04A 2DMQA 3BTCA 3BR2A 2VKEA 4V2GA 4HNVA 4X1EA 1GV2A 4IHYA 3JRDA 1BJZA 1A6IA 3HOXJ 3JRCA 3HB9A 5M5XJ 4I6ZA 1AHDP 5J1YA 1ZK8A 4RDUA 1U8BA 4GFBA 3GTPJ 2YS9A 4UUTA 1G2HA 5BNGA 2LP0A 3Q0UA 2M2EA 1I50J 1IC8A 1B72B 3A01A 3PO2J 1MBHA 1SANA 2O9LA 3M3YJ 2ZB9A 1JKRC 4W1UA 3TW7A 3SJMA 2QCOA 2EZHA 2JWTA 4A93J 4BXXJ 3H0GJ 3HOWJ 3BR0A 3OSFA 3JR9A 2DA2A 1TC3C 2O8KA 1ZR2A 4A3BJ 1S7EA 4M3FA 2E2HJ 2JA7J 3IH4A 4B1RA 1QVTA 5EG0B 1JKQC 5IOYA 2XGCA 5E3NA 1RKTA 5HODA 2DA5A 5F1JA 4X6AJ 2P81A 4S0HB 2R5YB 1GDTA 1XC5A 2D5VA 5FKLA 2OF7A 4IEJA 1E3OC 2FJ1A 1YRNB 2XGDA 4D7NA 4BBRJ 1W0TA 1OCTC 2GLOA 1JUSA 3S17J 4B3AA 5GPCA 4XICA 5F27A 4D7MA 1B72A 1DU6A 1ZTRA 2VUMJ 5IOZA 1ETXA 1WPKA 3HDDA 2FD5A 3O8HA 1MH4A 1TWHJ 1NTCA 2IBDA 3LSJA 4NDLA 3RZDJ 2KDZA 2R93J 3FKIJ 3IH2A 4C3JJ 3JRHA 1QPIA 2VKVA 2AO9A 2EZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F08 A;  4M3D A;  2HOT A;  1Y1V J;  1X2N A;  5E3M A;  2Y30 A;  2N8G A;  5EG0 A;  4BBS J;  5EZG A;  1T56 A;  1FIP A;  1OCP A;  1EF4 A;  3RQI A;  1Z77 A;  2R5Y A;  3FK6 A;  2CUF A;  2DA4 A;  2HOA A;  5DS9 A;  3K2A A;  1WH7 A;  5J3L A;  1I3Q J;  1X58 A;  1TWG J;  3HBL A;  1ETV A;  2XGE A;  3BTJ A;  4DYC A;  5FKK A;  4AYB N;  1K83 J;  4IHW A;  4D5C A;  1W0U A;  3S1Q J;  2NS8 A;  3LNQ A;  1MBJ A;  1X2M A;  3FK7 A;  3PM1 A;  4XRS A;  1QVU A;  2MGQ A;  2RAE A;  4JX6 A;  1IV6 A;  5K7Z A;  1ZR4 A;  4A3C J;  5C44 J;  1VI0 A;  3ZQC A;  1IJW C;  4FTH A;  1WI3 A;  2ECB A;  2R92 J;  4LOC A;  2H1K A;  1JTY A;  2HXI A;  2DMN A;  3ZOB A;  3BQY A;  1RR7 A;  1JT0 A;  3S16 J;  3IV5 A;  1CQT A;  4MFD A;  1H89 C;  2YUS A;  3FIW A;  1OJL A;  4L5E A;  1UG2 A;  1MSE C;  2FQ4 A;  5C4X J;  3HEF A;  1HF0 A;  1VND A;  1JGG A;  3JRI A;  1T33 A;  1P7J A;  3GTG J;  3RZO J;  1O4X A;  1TWC J;  1RES A;  2Y31 A;  2LKX A;  1Q1V A;  2NOG A;  2HDD A;  2EH3 A;  2VPR A;  2JN6 A;  3Q3S A;  3TED A;  2Y2Z A;  5F0C A;  1HLV A;  1ETO A;  2LY9 A;  2ELK A;  4DYQ A;  1MSF C;  3B6A A;  2TCT A;  2GM4 A;  2G0E A;  2XPW A;  3OOU A;  1ETW A;  4A3G J;  5JLX A;  4BKX A;  3D1N I;  3DCF A;  1POG A;  4D5F A;  2X6O A;  1QRY A;  4CYC B;  1LFB A;  3MN2 A;  1RKW A;  4XRS G;  2CU7 A;  1IDY A;  2HQ5 A;  2Y0S N;  1ETQ A;  4JX4 A;  3VPR A;  4DW6 A;  1HDP A;  2PMZ N;  2Y9Z A;  5FLV A;  2WB1 N;  1GV5 A;  3K7A J;  2XB5 A;  1GVD A;  5IP9 J;  2NVY J;  2LR8 A;  1JKO C;  2IAI A;  5EF6 A;  3G1O A;  3ZQF A;  2E2J J;  3BG5 A;  5FKN A;  4FCY A;  3W6V A;  1IG7 A;  3CMY A;  1ZQ3 P;  3BR6 A;  2E1O A;  3QQA A;  3F0C A;  4IHX A;  1VF9 A;  1VFC A;  1BL0 A;  3BQZ A;  5GP9 A;  2JK3 A;  5M5Y J;  2EZI A;  1JKP C;  3HKZ N;  1AKH B;  3ZQI A;  2XPV A;  1NK2 P;  1JT6 A;  2EBI A;  2L7M P;  2JJ7 A;  5FKM A;  3TP0 A;  4DYR A;  1LE8 B;  2DMT A;  4A3K J;  1B8I B;  1MBF A;  1AU7 A;  2K40 A;  5IP6 A;  1ETK A;  5EGO B;  2EZL A;  1IRZ A;  1I6H J;  2LLK A;  4M3B A;  1MBE A;  5F0F A;  2O7O A;  4BY7 J;  3JRG A;  3M4O J;  2QF7 A;  1WCM J;  2XRL A;  4J19 A;  1FJL A;  5K7F A;  1HDD C;  1ZGW A;  1F36 A;  1SFO J;  3S15 J;  4QIW N;  2XSD C;  3FIS A;  1WGX A;  3HOV J;  2NVQ J;  3TP3 A;  3WHC A;  3PO3 J;  4A3D J;  3BT9 A;  4A3E J;  1JTX A;  1JUM A;  2ME6 A;  3S14 J;  1ORK A;  1IUF A;  2CQX A;  3C2B A;  2LTP A;  4AC0 A;  3S1M J;  3A03 A;  1AKH A;  2DN0 A;  2KT0 A;  4XRM A;  1WH5 A;  1ENH A;  1YRN A;  4Y52 J;  3ZQL A;  2WAQ N;  3BG9 A;  3OSG A;  2LVS A;  4ABZ A;  1LE8 A;  5JLW A;  1A5J A;  1Z0X A;  1B8I A;  2JMW A;  3OIO A;  5FKO A;  2DMU A;  5EGO A;  1K61 A;  1FTZ A;  3G1M A;  5EZH A;  2X9D A;  4W97 A;  4C2M J;  3NAU A;  2CUE A;  2E2I J;  3GBG A;  2TRT A;  3CQZ J;  5M3F J;  5FLM J;  3S1R J;  4MLO A;  3JRF A;  5DTD A;  3A01 B;  4JP0 A;  2L7F P;  1MH3 A;  3HGY A;  2FX0 A;  2K9Q A;  2IEK A;  3GTM J;  2DTZ A;  4QSH A;  4RBO A;  1PUF B;  1JUP A;  2ME0 A;  2M8G X;  3IH3 A;  4C3H J;  1JJ6 C;  5F0H A;  2MG4 A;  3UKG A;  1HOM A;  1FEX A;  3JRA A;  2DA7 A;  2NS7 A;  4G12 A;  2LFB A;  5IYB J;  5M5W J;  5IYD J;  2XPU A;  4M3G A;  3Q0V A;  2M9H A;  2W48 A;  5E3O A;  4BY1 J;  2CJJ A;  2VI6 A;  3QPL A;  3WHB A;  2M34 A;  3S2D J;  2ECC A;  4A3F J;  2L9R A;  5EDN A;  2HYJ A;  1F43 A;  5EEA A;  5FJ8 J;  2R5Z B;  2WV1 A;  4EEF G;  3ZQH A;  2JA8 J;  3GTJ J;  1APL C;  2AHQ A;  3LSR A;  5J1R A;  4A69 C;  1FTT A;  3L1P A;  4Y7N J;  3LOC A;  1TWA J;  3NAR A;  1U78 A;  5EYR A;  3H3V K;  1DU0 A;  4M3E A;  5K7H A;  2R0Q C;  2K9N A;  2B63 J;  2JA5 J;  2LD5 A;  1PUF A;  4MFE A;  2MW8 A;  4DZP A;  3A02 A;  2Y9Y A;  1D5Y A;  2MSY A;  3CCY A;  4AUX A;  2DA1 A;  1GUU A;  2DA3 A;  2HI3 A;  5E3L A;  3I4N J;  1ETY A;  3LSG A;  4JYK A;  4DZJ A;  1Y1W J;  2NVT J;  3HM5 A;  3GTO J;  3SDG A;  2H8R A;  4UUS B;  1BW6 A;  1R9T J;  4IHV A;  3LSP A;  5M3M J;  3HOU J;  5GPA A;  3Q0W A;  1JJ8 C;  2ID3 A;  4M6V A;  5IP7 J;  1BW5 A;  3QPS A;  3CDL A;  4C3I J;  2I10 A;  2DA6 A;  4CYC A;  2DJN A;  2R5Z A;  2HOS A;  4MIM A;  3GTK J;  1XS9 A;  3BR5 A;  3JRB A;  2COB A;  3MVP A;  4I76 A;  1MBG A;  2YU9 J;  1H8A C;  3TW6 A;  3RKQ A;  1IGN A;  4XID A;  2R7Z J;  1HCR A;  3O8G A;  3BG3 A;  3JRE A;  2L7Z A;  2L0K A;  1RET A;  1MBK A;  5IPA A;  4XK4 A;  1OFC X;  2M0C A;  4JX5 A;  1ZKG A;  3BR3 A;  3SFI A;  4FE7 A;  4A3M J;  3S2H J;  1BA5 A;  4A3J J;  2CQQ A;  2LK2 A;  2ID6 A;  2X48 A;  3ZQG A;  4QTR A;  3BR1 A;  3E7L A;  4FE4 A;  3B6C A;  2NVX J;  4A3L J;  1UHS A;  4FIS A;  3HOY J;  1TWF J;  3MKL A;  1H88 C;  2OPT A;  1P7I A;  3S1N J;  1ITY A;  4UUS A;  1NK3 P;  2HXO A;  1MNM C;  1U9O A;  3GTQ J;  1XG1 A;  1RPW A;  5J1U A;  4MO7 A;  2E19 A;  3BTI A;  3GTL J;  1FIA A;  1UMQ A;  3DEW A;  1IDZ A;  1GT0 C;  2EQR A;  2JA6 J;  2CRG A;  3BTL A;  3I4M J;  3G1L A;  5IYC J;  4A3I J;  9ANT A;  3HOZ J;  2DMP A;  1LFU P;  5C4J J;  5C3E J;  2GBY A;  3HGG A;  4B4C A;  2K9S A;  2XB0 X;  4V2F A;  1U9N A;  5F04 A;  2DMQ A;  3BTC A;  3BR2 A;  2VKE A;  4V2G A;  4HNV A;  4X1E A;  1GV2 A;  4IHY A;  3JRD A;  1BJZ A;  1A6I A;  3HOX J;  3JRC A;  3HB9 A;  5M5X J;  4I6Z A;  1AHD P;  5J1Y A;  1ZK8 A;  4RDU A;  1U8B A;  4GFB A;  3GTP J;  2YS9 A;  4UUT A;  1G2H A;  5BNG A;  2LP0 A;  3Q0U A;  2M2E A;  1I50 J;  1IC8 A;  1B72 B;  3A01 A;  3PO2 J;  1MBH A;  1SAN A;  2O9L A;  3M3Y J;  2ZB9 A;  1JKR C;  4W1U A;  3TW7 A;  3SJM A;  2QCO A;  2EZH A;  2JWT A;  4A93 J;  4BXX J;  3H0G J;  3HOW J;  3BR0 A;  3OSF A;  3JR9 A;  2DA2 A;  1TC3 C;  2O8K A;  1ZR2 A;  4A3B J;  1S7E A;  4M3F A;  2E2H J;  2JA7 J;  3IH4 A;  4B1R A;  1QVT A;  5EG0 B;  1JKQ C;  5IOY A;  2XGC A;  5E3N A;  1RKT A;  5HOD A;  2DA5 A;  5F1J A;  4X6A J;  2P81 A;  4S0H B;  2R5Y B;  1GDT A;  1XC5 A;  2D5V A;  5FKL A;  2OF7 A;  4IEJ A;  1E3O C;  2FJ1 A;  1YRN B;  2XGD A;  4D7N A;  4BBR J;  1W0T A;  1OCT C;  2GLO A;  1JUS A;  3S17 J;  4B3A A;  5GPC A;  4XIC A;  5F27 A;  4D7M A;  1B72 A;  1DU6 A;  1ZTR A;  2VUM J;  5IOZ A;  1ETX A;  1WPK A;  3HDD A;  2FD5 A;  3O8H A;  1MH4 A;  1TWH J;  1NTC A;  2IBD A;  3LSJ A;  4NDL A;  3RZD J;  2KDZ A;  2R93 J;  3FKI J;  3IH2 A;  4C3J J;  3JRH A;  1QPI A;  2VKV A;  2AO9 A;  2EZK A; 
#chains in the Genus database with same CATH topology
 3QPH A;  3X2Q H;  3K4L A;  1S8N A;  3R4K A;  3RPU A;  1GHC A;  2BXZ A;  3PQJ A;  3DLA A;  2RNJ A;  3KP5 A;  1F4K A;  5EG0 A;  4BBS J;  1MIJ A;  1R1V A;  5E8G A;  2AQF A;  3KCC A;  2F2E A;  2R5Y A;  1U3E M;  2DA4 A;  2HOA A;  3DKX A;  4N9I A;  3H3Z A;  1WH7 A;  4PFP A;  2STW A;  3K70 C;  4JBA A;  5J3L A;  5JR3 A;  4WXC A;  4J01 A;  1P4X A;  3KZZ A;  3G73 A;  2WWY A;  5FKK A;  2NXN B;  1K83 J;  4IHW A;  4IHS A;  1HST A;  3A4C A;  1W0U A;  4M6Y A;  4F7Z A;  2H8W A;  2NS8 A;  2L4M A;  1HSJ A;  1ZG3 A;  1QVU A;  1T6S A;  1W7P A;  1OQY A;  4IOA F;  5K7Z A;  1KU2 A;  4NC8 A;  1VI0 A;  4O3M A;  4IPA A;  1U2W A;  4FTH A;  2EK5 A;  2G7H A;  2KMU A;  1HW1 A;  1LFP A;  2J5P A;  2KP6 A;  3BQY A;  3ROU A;  3J80 K;  5ICC A;  1YX3 A;  4GDF A;  4L5E A;  2R7Q A;  3G2B A;  3CUO A;  1T0F A;  2EIL H;  4CIC A;  2DPD A;  3IL2 A;  5LHH A;  3RZO J;  3CLQ A;  1TWC J;  2NS0 A;  3G4S I;  1MJA A;  1Z6T A;  1EH7 A;  2NOG A;  4XN0 A;  1QA6 A;  1YYV A;  2EH3 A;  4N4O B;  3TED A;  3LSI A;  2Y2Z A;  1U5T C;  1HKQ A;  1BJA A;  4F55 A;  2E7X A;  2ELK A;  4AID A;  2PJR B;  4DYQ A;  2V79 A;  1MSF C;  4C2U A;  4YIF A;  4RAG A;  2B0L A;  2GM4 A;  3WU0 A;  2XPW A;  4BAY A;  3AFH A;  4IRI A;  4A3G J;  2RKH A;  1HC8 A;  4RGS A;  2O6G E;  3WOD F;  3HXL A;  3DCF A;  1POG A;  4M9S A;  3LA3 A;  2X6O A;  1UAA A;  3MN2 A;  2FUG 2;  1RKW A;  3VYR B;  4XRS G;  1I6X A;  2CUJ A;  2CU7 A;  4JX4 A;  2UWM A;  1IRF A;  5CKT A;  1TQI A;  3GFM A;  3H5R A;  5IP9 J;  1JKO C;  1XGS A;  5EF6 A;  5FKN A;  5GAG J;  3W6V A;  3PSI A;  3KYD B;  2LDU A;  3IWZ A;  3EUK L;  3S2W A;  4BQO A;  1ERD A;  3H5N A;  2MFZ A;  2VJJ A;  1VF9 A;  4A0Z A;  3HSE A;  2ZXH A;  2VXD A;  1JKP C;  3L9F A;  5GP9 A;  2BY2 A;  5IT3 A;  1YI2 I;  1QZE A;  2X1C A;  3ZQI A;  5K5O A;  4DGW B;  2LKS A;  2L9S A;  2KIM A;  3PIP F;  1HA8 A;  3LSK A;  2ZJP F;  4DYR A;  4A3K J;  4XQF A;  5ILU A;  1AU7 A;  2HQN A;  1S29 A;  2PJR A;  2FA5 A;  5EGO B;  2EZL A;  1IRZ A;  4OU0 A;  5IT9 Z;  3CME I;  1BR2 A;  4BQN A;  2O7O A;  3JRG A;  1XMK A;  2DFI A;  2RDP A;  3JSO A;  2XRL A;  3G71 I;  4J19 A;  3MKZ A;  5F64 A;  1FOW A;  2IT0 A;  2VKH A;  1FJL A;  4UVB A;  4PFO A;  2M4K A;  5AON A;  5EJC A;  2DOD A;  3HSF A;  1T2K A;  3M7G A;  2CQK A;  4IQ4 A;  4M6X A;  4OAZ A;  2W57 A;  5D4S A;  1P2F A;  3HOV J;  2EV5 A;  2VE8 A;  3M1C A;  5ICF A;  2K86 A;  2KRH A;  3WHC A;  4YII A;  3BT9 A;  4YIR X;  3S14 J;  3F8B A;  4WX9 A;  2CQX A;  4YRV A;  4EJO A;  3PUF A;  3WU1 B;  4MQV A;  4KMF A;  2JZY A;  5FFZ A;  2KT0 A;  3MKW B;  2ELH A;  3HOT A;  3MZ8 A;  2HS5 A;  1VQP I;  3DWL E;  4BH9 A;  1ENH A;  5GAH J;  1ZRC A;  3H5A A;  3FDY A;  1K6Y A;  3ECO A;  4ABZ A;  5TRD A;  3NEU A;  5HLI A;  3V7S A;  4XLN F;  1LDD A;  2DMU A;  5EGO A;  1K61 A;  1FTZ A;  1R1T A;  2X9D A;  4W97 A;  4C2M J;  2M30 A;  4M9X A;  2CUE A;  1YG2 A;  2TRT A;  5M3F J;  5HS8 A;  1YJW I;  2CFX A;  5DTD A;  3VSL A;  1G6N A;  2L7F P;  1MH3 A;  4JP0 A;  1MDM B;  2DTZ A;  4RBO A;  2Y69 H;  2H6C A;  1I1S A;  2PMZ A;  3NWT A;  2WB1 A;  2M8G X;  2M0M A;  3B02 A;  2P0W A;  4L0Z B;  2GQQ A;  2PMH A;  5F0H A;  4N4N B;  1XPX A;  3CJN A;  2Z3Y A;  5J4Y A;  5D8L B;  3JRA A;  1YHQ I;  2DA7 A;  2L2O A;  3QOP A;  2R7S A;  3TOB A;  4A5N A;  1OR7 A;  4XLA A;  2HTS A;  2W48 A;  1BBY A;  5E3O A;  1FYL A;  2CJJ A;  3VSK A;  4ENM A;  5D6F A;  1XMA A;  4XON A;  5H2F C;  1T8I A;  4A3F J;  2KLO A;  5L3G A;  2P6T A;  4C9Y A;  3ABT A;  4B48 A;  4XSZ F;  1XSX A;  2M8E A;  3DQV C;  3DBL B;  2WV1 A;  2FRH A;  3ABM H;  2IGN A;  5LLQ A;  2QQB A;  2AHQ A;  4CCM A;  5J1R A;  2F6C A;  1FTT A;  3IWF A;  4BDY A;  3K6G A;  4KT5 C;  1D8K A;  1HBX G;  1V54 H;  3H3V K;  2E60 A;  3H35 A;  3T1B A;  5K7H A;  1MDM A;  2K9N A;  4Y33 A;  2LD5 A;  3OYH A;  3GX4 X;  3FXM A;  1IN5 A;  1YW9 A;  2HVS A;  2P4W A;  1VQM I;  1TQP A;  3LSM A;  3EQL F;  4DZP A;  2Y9Y A;  3HHH A;  5DUI A;  2MSY A;  2I5U A;  3OYG A;  1IW7 F;  2DA1 A;  2W4S A;  2DYR H;  3U1D A;  4B09 A;  3OS0 A;  4ZZD A;  4UXN A;  2HI3 A;  4LK1 F;  5E3L A;  3U2R A;  1R00 A;  3CP2 A;  3ZN0 A;  1ZRE A;  1I39 A;  1IO2 A;  3MQ0 A;  3ZMD A;  2E5N A;  3GTO J;  3SDG A;  2O3F A;  3KEO A;  5KNL A;  3LSP A;  5M3M J;  3HOU J;  4HQM A;  5CVI A;  4O5V A;  3TDZ C;  1JJ8 C;  2FNP A;  2ID3 A;  5IP7 J;  2I10 A;  5FO5 A;  5HLH A;  1MNE A;  4CYC A;  1G8X A;  3GTK J;  4MIM A;  4UVA A;  1O3T A;  3BR5 A;  2VBZ A;  4II2 A;  2B9S A;  2A5Y B;  2BW3 A;  3KZY A;  1MBG A;  2GZW A;  2YU9 J;  2Q2E B;  2V7F A;  2VON A;  2ADU A;  2R7Z J;  2KQR A;  4ENJ A;  2JPC A;  2KZG A;  1TNT A;  2F4I A;  2BY0 A;  4BJ6 C;  4XN3 A;  4CA0 A;  1QBJ A;  1ZYR F;  1KA8 A;  4YG2 F;  4IO9 F;  3QOD A;  3ASO H;  4PUS A;  2M0C A;  3OIP A;  4EJU A;  4O6J A;  2L01 A;  4FE7 A;  1V5E A;  3S2H J;  3UNG C;  3IUO A;  2LK2 A;  3ONQ A;  1TNS A;  2X48 A;  4MTE A;  4F92 B;  3E7L A;  2NNY A;  2E1M B;  3BPV A;  3B6C A;  1ZAR A;  2NVX J;  4A3L J;  4B8X A;  1HW2 A;  2E35 A;  3T8R A;  1LDK B;  2W25 A;  3GTQ J;  3F9K A;  5KHD A;  1PUE E;  2DQL A;  3P5J A;  3U1K A;  1QGP A;  1JGS A;  3IRR A;  3TBI A;  1XCB A;  1FIA A;  2ZC2 A;  1GT0 C;  3F6O A;  2G9W A;  4LK0 F;  3UR3 C;  5ERI A;  1H9G A;  3IRQ A;  3HOZ J;  2Q2E A;  2V6C A;  1LFU P;  2LOO A;  5C4J J;  1XB4 A;  2OCE A;  4PGH A;  1YW8 A;  3HGG A;  1PJR A;  3QYB A;  2UV1 A;  3I71 A;  2DLL A;  2IRF G;  3FBI B;  3BTC A;  2COM A;  4BEH B;  2A61 A;  2QKL B;  3CZ6 A;  3PUB A;  4HNV A;  2XRN A;  5E1X A;  1PDN C;  3J81 K;  3JRD A;  3FX3 A;  4P9U A;  3L2C A;  1MZB A;  2CW0 F;  2E7W A;  1S9H A;  4XLP F;  5FLX K;  1MMS A;  2D1H A;  4XM3 A;  4B44 A;  4F3Q A;  1TW3 A;  3CP8 A;  3VOD A;  1BOB A;  2VIX A;  1J0R A;  1AHD P;  3K4B A;  1WKM A;  3E0J B;  1TLH B;  1EH8 A;  4FHT A;  4CCL A;  2L4A A;  1WJB A;  1U8B A;  3GTP J;  1D0Z A;  2EIJ H;  1GLN A;  1RI7 A;  1VQ4 I;  1G2H A;  3EYI A;  4JK1 X;  5BNG A;  3I55 I;  2K85 A;  3M9A A;  4KIC A;  4IXA A;  2NAZ A;  1SFE A;  2BHZ A;  2ZCW A;  1B72 B;  3PO2 J;  5DD4 A;  1MBH A;  2ESN A;  1QNT A;  3I58 A;  2JUC A;  4EGY A;  2XAQ A;  2KIQ A;  1JKR C;  4XOR A;  3TW7 A;  4BHB A;  4G6T B;  3N4M A;  2QCO A;  2EZH A;  4A93 J;  4BXX J;  2RC4 A;  2WAD A;  3SQN A;  3W6K B;  4HW0 A;  1FBQ A;  1QZZ A;  4BEH A;  5D5W B;  1ZR2 A;  2OAZ A;  4A3B J;  1T0F C;  1BI3 A;  2STT A;  2KJC A;  3IH4 A;  1QVT A;  4EM1 A;  2OU2 A;  3DFG A;  1KZH A;  5IOY A;  1R36 A;  3K4C A;  2X6Y A;  2HZT A;  3SEZ A;  5E3N A;  3R61 A;  1RKT A;  1MD0 A;  2LF8 A;  5HOD A;  1P6R A;  3PNT A;  5F1J A;  3A1Y A;  3DTI A;  1GDT A;  4S0H B;  3RPQ A;  1WVR A;  4C2T A;  3R0J A;  1JI8 A;  4Q4Z F;  3TMO A;  2DK8 A;  4D7N A;  3WTU C;  3RI4 A;  3QP5 A;  4RA2 A;  3CCL I;  3MZH A;  4BL0 B;  2GLO A;  1JUS A;  3QOE A;  4N9H A;  2P5V A;  3BP8 A;  5E1W A;  3S17 J;  4B3A A;  4XIC A;  1K79 A;  3LA7 A;  1B72 A;  1ZHF A;  3AG3 H;  3V7C A;  2OC6 A;  3K4N A;  2LRD A;  2JRM A;  2XAU A;  1EA3 A;  1W5S A;  1WJ5 A;  2ZFW A;  2OQR A;  2DJI A;  2QQ8 A;  1WJE A;  4NDL A;  4AM3 A;  3IP4 B;  5DUK A;  2AO9 A;  4HST A;  4IJA A;  3E3V A;  4M3D A;  4G94 A;  1P4A A;  1Y1V J;  2HOT A;  3KYL A;  3CTA A;  3F21 A;  2Y30 A;  1D8J A;  3BC8 A;  4ZDO A;  2BBY A;  2IGO A;  3E1S A;  4QPO A;  5EZG A;  4KDP A;  1UHW A;  3CD6 I;  2CQN A;  3E97 A;  2CUF A;  2D45 A;  2P8T A;  1LKX A;  3GZ6 A;  4HNT A;  2DDA A;  3LQQ A;  3S3M A;  1X4P A;  3CMA I;  4GGG A;  2EFW A;  3BTJ A;  2Q0O A;  3LL7 A;  1BC8 C;  1R5I D;  1DPR A;  1ON1 A;  1W4M A;  4MEY F;  3FK7 A;  1FC3 A;  5KAF C;  4XRS A;  3JTG A;  3ABL H;  1HOM A;  4DJA A;  4JX6 A;  5B1A H;  2LY2 A;  2MD5 A;  1ZR4 A;  1SD4 A;  5C44 J;  1EKE A;  2EIK H;  3ZQC A;  4UV9 A;  3TO6 A;  4CXF A;  1WI3 A;  1G3W A;  2ECB A;  1UST A;  2W82 A;  1JTY A;  4I99 C;  3MAJ A;  3CO6 C;  2RVC A;  3AL0 B;  4EQQ A;  2YUS A;  1UG2 A;  2G7U A;  2FQ4 A;  1AOY A;  3HEF A;  3K4M A;  2LBF B;  2IPQ X;  1P7J A;  2MBF A;  2NOJ B;  2BYV E;  3AKZ A;  5TIS C;  2NVU B;  3RKY A;  3QU6 A;  5E20 A;  3SYT A;  2QKM B;  3QP6 A;  2AXT C;  2BZT A;  3BG6 A;  1YQA A;  1TT5 B;  1OYI A;  2GAU A;  5DM6 F;  3KYC B;  4BHC A;  1ETO A;  2L3D A;  2RQQ A;  4XKW A;  4Q47 A;  2L54 A;  1O3R A;  3SZG A;  5HVQ C;  2TCT A;  5H6Q A;  3OOU A;  2ZNY A;  3I64 A;  4BKX A;  4E7H A;  3K10 A;  3WE3 A;  4D5F A;  1WZ2 A;  1LFB A;  2A3S A;  1FBS A;  2Y9Z A;  4DW6 A;  2PMZ N;  1EJ9 A;  4HPQ A;  2WB1 N;  2Q8K A;  2WY7 Q;  4ETS A;  2XB5 A;  1GVD A;  3FMQ A;  2ZKZ A;  2K7L A;  4GCV A;  4E7S A;  1LPQ A;  1ONV A;  2OTJ I;  4XNF A;  1IG7 A;  1RUO A;  2H94 A;  4OMZ A;  1LNW A;  4ZC3 A;  1OCC H;  1ZG1 A;  4IHX A;  1VFC A;  1BL0 A;  2LBF A;  2JK3 A;  2EZI A;  1OR7 C;  3VB2 A;  4B43 A;  1WWX A;  2M1B A;  1R1U A;  2PEX A;  3H92 A;  4FT8 A;  2XPV A;  1BI2 A;  1E17 A;  3OS1 A;  3L2V A;  4L0Y B;  3OYN A;  2EBI A;  2E34 A;  3F8F A;  1KGS A;  5H20 A;  1KQ8 A;  1HQC A;  4OIO F;  1MBF A;  2CS3 A;  2XAH A;  4MQ9 F;  4ZYE A;  5IP6 A;  2HPM A;  2KHM A;  2LLK A;  5DDG A;  4GO1 A;  3OYA A;  5LD2 C;  2EFP A;  2FBK A;  4AYB A;  2DO7 A;  2MH9 A;  1O57 A;  2MA3 A;  2ZJQ F;  3RPU D;  2VC0 A;  1HDD C;  1F36 A;  3S15 J;  3G6E I;  3OIQ A;  2XSD C;  2IGM A;  2Z33 A;  3O3K A;  3VYS B;  2EA2 A;  1XDS A;  4MEX F;  2NVQ J;  3M8J A;  1X19 A;  3PFY A;  1SFK A;  5DCF A;  3BG7 A;  3TGN A;  3ULQ B;  3HHG A;  3BY6 A;  1MW7 A;  2XUB A;  4KMU X;  3C2B A;  2VQC A;  4FX4 A;  3P9C A;  2LTP A;  3S1M J;  3E6C C;  4I02 A;  2R7X A;  1WQ2 A;  4XRM A;  5B1B H;  1DUX C;  1JHF A;  5LGU A;  4KA4 A;  4IF4 A;  1WHU A;  4CCN A;  4DOZ A;  2HYF A;  1W7P D;  3BG9 A;  4BNC A;  2LVS A;  5AIP A;  3ERE D;  5JLW A;  2KL4 A;  4BS9 A;  1EH6 A;  4S04 A;  2ESH A;  3OIO A;  5FKO A;  1YLF A;  4EJW A;  2DFE A;  4FQG A;  2R3S A;  1Z9C A;  5JI6 A;  2E2I J;  2K4B A;  4HBL A;  3CUQ B;  3E6D A;  3S1R J;  4MLO A;  2HKX A;  3P9I A;  5H6R A;  3HGY A;  5CPR B;  1REP C;  2FX0 A;  3W2W A;  2IEK A;  5D5X B;  3D5S C;  2Y0S A;  2VBX A;  2VJ5 A;  2DYS H;  1ZRD A;  2FOK A;  1OPC A;  2WV0 A;  4X0G A;  1FEX A;  3OYD A;  1DPU A;  4RB1 A;  4DBR A;  2CFO A;  2ZXJ A;  3Q0V A;  2XAG A;  3RTR A;  4PGG A;  1B6A A;  3WHB A;  3HKZ A;  2M34 A;  4RB2 C;  1PP8 F;  3S2D J;  1I27 A;  2ECC A;  1NHA A;  2O5R A;  3OYL A;  4HV5 A;  5EDN A;  3EUH A;  3LAP A;  3P9K A;  3W2A A;  1B1B A;  3DPU A;  4HV6 A;  2HVR A;  2JSC A;  1F43 A;  2EPF A;  4KUM A;  5EEA A;  3CC7 I;  2LRE A;  4NUB A;  3GTJ J;  4Z6Y A;  4A69 C;  3CUQ A;  4KYW A;  4Y7N J;  1TWA J;  2UZK A;  1IXS B;  5FRM A;  2PBI A;  2W00 A;  1YTY A;  1U78 A;  4ZDP A;  4PCQ A;  4XOT A;  2Z9O A;  3M8F A;  1X1P A;  2XF5 A;  4GYI A;  3C2G A;  2HU9 A;  5BQT A;  4G9Y A;  4MFE A;  3HYI A;  2MW8 A;  4BQA A;  3CCY A;  3OL3 A;  1I3A A;  3L2U A;  4ZTJ A;  2NNN A;  2E1M C;  3I59 B;  1FP2 A;  2XVC A;  5KAI C;  4Q5S F;  3LSG A;  1TT0 A;  1IF1 A;  2X6X A;  1Y1W J;  1XTA A;  1SC7 A;  1XDU A;  4KN4 X;  2KPM A;  3ZQ7 A;  4H0E A;  1SAU A;  4UUS B;  1R9T J;  4IHV A;  4XKC A;  1WJC A;  1EV7 A;  2A5W A;  2OCC H;  2WAQ A;  3Q0W A;  1J9I A;  4XOP A;  3WTS C;  3CDL A;  5GTI C;  2DI3 A;  1ODD A;  4CZZ A;  2COB A;  2R7T A;  1YS6 A;  3MVP A;  4PZJ A;  4PJL A;  2MD0 A;  1H8A C;  1QHH D;  1J75 A;  4ESB A;  1RRJ A;  3KLO A;  4LGW A;  4CYD A;  4OMY A;  1S3J A;  3KE2 A;  1UEL B;  2E1C A;  3BG3 A;  5HNH A;  1FZP B;  2L0K A;  3DU5 A;  3WG9 A;  1USS A;  4G7O F;  3JAM Z;  3T0Y A;  2BOL A;  1S7A A;  5IPA A;  3OR1 C;  2BVM A;  3C3W A;  4LLG F;  1LUJ B;  4GRI A;  1ZKG A;  4YEL A;  3BR3 A;  3SFI A;  2H09 A;  1BA5 A;  2OQG A;  4A3J J;  3PFI A;  4LIU A;  3I59 A;  3ZQG A;  2P6S A;  3BR1 A;  3PSF A;  3LFU A;  4FE4 A;  2LKP A;  3L2W A;  1TWF J;  2RRE A;  3MKL A;  1FLI A;  1O7F A;  2A07 F;  3RJP A;  4UUS A;  1NK3 P;  3PNV A;  1WJA A;  2QZ8 A;  2R7U A;  3AG2 H;  4BGD A;  5J1U A;  3V8L A;  2VQH A;  3RYP A;  3BTI A;  4HX4 A;  1Y8Q B;  3GTL J;  2FXA A;  4U7B A;  3K1P A;  3DEW A;  5HS7 A;  4S05 A;  2HYG D;  3BJ6 A;  2JA2 A;  2JA6 J;  1Y0N A;  1BC7 C;  1ZH5 A;  4RM3 A;  1JE8 A;  3CCV I;  2JVH A;  3F3X A;  2IS1 A;  5D4R A;  3FXR A;  2K9S A;  3EDP A;  3GCM A;  1YIT I;  1N78 A;  3I54 A;  3QYF A;  2XAS A;  3WTX C;  2DMQ A;  2HFH A;  2KRF A;  4L9J A;  5J6X A;  3CCS I;  2ZNZ A;  3BR2 A;  4V2G A;  1GV2 A;  2GIZ A;  3K4K A;  4IHY A;  2YPR A;  4LB6 B;  2R7F A;  3OL4 A;  2LSO A;  4R79 A;  4RGU A;  2Y48 A;  1A6I A;  2KRC A;  1BIA A;  1FP1 D;  1ZN2 A;  2XC7 A;  1VQ6 I;  2CG4 A;  1E3P A;  3JRC A;  4I6Z A;  4AIH A;  1UB9 A;  2M4G A;  3C7J A;  2VKD A;  1FWZ A;  2CGP A;  1OCO H;  1JHH A;  2LH9 A;  2DPU A;  4XLF A;  3I3L A;  5L3E A;  1T98 A;  3VYT B;  3ASN H;  4BXF A;  5CQE A;  3RKX A;  3TOA A;  5J4V A;  4I2O A;  2M2E A;  3N05 A;  1P4W A;  1FYK A;  3BDD A;  2QBY B;  2XV4 S;  1WSU A;  4IL6 C;  3OYK A;  4ZH4 F;  2VBY A;  3AG1 H;  4B3X A;  2O9L A;  1P9Q C;  2ZB9 A;  2HQR A;  3S3O A;  2DT5 A;  1J59 A;  3WGI A;  3SJM A;  3ML6 A;  2JWT A;  2XDV A;  2X1E A;  3H0G J;  2DFH A;  4B47 A;  3ZP5 A;  1TC3 C;  5HDG A;  4HF2 A;  1HKS A;  4M3F A;  2E2H J;  4I98 B;  2JA7 J;  4B1R A;  4RB3 C;  2CV1 A;  1IUY A;  1JKQ C;  5CYV A;  1TZL A;  2IS6 A;  3WE2 A;  1RC9 A;  1ZLJ A;  2FOW A;  4KIT B;  4X6A J;  3ZXS A;  1XC5 A;  2D5V A;  1C0W A;  1SFX A;  6PAX A;  2K02 A;  1MKM A;  1F9N A;  1SVO A;  3JW4 A;  2H1L A;  3HRS A;  1YRN B;  1VQO I;  2XGD A;  1FX7 A;  4HDV A;  5J8C A;  1W0T A;  4II3 A;  1VZ0 A;  4BJ5 C;  2ZME B;  3SDB A;  2JT1 A;  2V1U A;  2X51 A;  3OY9 A;  3HRU A;  5GPC A;  3EYY A;  2QBY A;  5F27 A;  1DU6 A;  2KJB A;  2VUM J;  2FF4 A;  5IOZ A;  1WPK A;  4M72 A;  4BUP A;  1SMY F;  1SFU A;  4ENN A;  3O8H A;  3ISP A;  3KET A;  4RM2 A;  2QQ9 A;  3ECH A;  1NTC A;  4L9T A;  2E5Z A;  1PP7 U;  1YIJ I;  2BY3 A;  2K27 A;  2P5L C;  4E7Z A;  3AL0 C;  2WTE A;  3IH2 A;  4C3J J;  2KKO A;  2VKV A;  4HOB A;  1VQ9 I;  1Z7U A;  2EFQ A;  2VJ4 A;  5F08 A;  5LRR A;  5TJJ A;  1IN4 A;  4YFN F;  3WTY C;  1X2N A;  4LG3 A;  4YFK F;  5E3M A;  3R0A A;  2F5E A;  5L3F A;  2Z2S B;  1DGW Y;  2N8G A;  5LRS A;  3HRM A;  2CMP A;  1T56 A;  2K5C A;  2KIS A;  1OCP A;  3RQI A;  1A36 A;  3FK6 A;  2PQ8 A;  3K1N A;  2JPB A;  3K2A A;  4UNO A;  2KIU A;  4E4H A;  1W5C C;  2GIV A;  1K6O A;  1KQ9 A;  2LY1 A;  2HPI A;  2M87 A;  1SD6 A;  2WC2 A;  5FD6 A;  1I3Q J;  1X58 A;  1KYZ A;  2XGE A;  4LIV A;  3H9J A;  3DTK A;  1KON A;  4AYB N;  1IAW A;  1OYW A;  2ZME A;  1FOY A;  3E6M A;  3DBR B;  3PQK A;  3QWL A;  4PSX A;  4NQW B;  4XLE A;  1CGP A;  1A6Q A;  2PLY A;  1T38 A;  2D2W A;  2IW5 A;  3KLN A;  4ZTF A;  1IV6 A;  4RAF A;  2JRT A;  3HOS A;  4A3C J;  3QAH A;  5CVR A;  2IVM A;  5B66 C;  1N25 A;  1IJW C;  1TW2 A;  1Z1D A;  3FXU A;  4LIT A;  2R92 J;  3H0D A;  2H1K A;  3FBN B;  3M1E A;  2DMN A;  3BZ6 A;  1VTN C;  1YO5 C;  1JT0 A;  3CCU I;  1CQT A;  3S16 J;  1RIO H;  3JTH A;  2PMU A;  4MNU A;  3BWG A;  1H89 C;  1OJL A;  1IN8 A;  5GAE J;  1MSE C;  3VYU B;  1YW7 A;  1HF0 A;  1JGG A;  3JRI A;  4IHT A;  4XSX F;  4M74 A;  4FAS D;  1Q1V A;  4U88 A;  2DTR A;  2HDD A;  3OYF A;  3PL8 A;  3Q3S A;  2MLK A;  1VQ7 I;  5F0C A;  2H27 A;  4F91 B;  1SVL A;  4AIK A;  5BMZ A;  2EV0 A;  4BXU A;  1Z3X A;  2IA2 A;  2LY9 A;  4UV8 A;  3E6B A;  1X1B A;  3CJR B;  2HKO A;  4CCJ A;  3B6A A;  2EFN A;  2CW8 A;  1ETW A;  1MMN A;  4NQW A;  3D1N I;  3SHF A;  3COA C;  4I7H A;  2Y0M A;  3BZK A;  4QWQ A;  3FHN A;  5LEK A;  1FY7 A;  1IDY A;  4OOI A;  2Y0S N;  1ETQ A;  4TV7 A;  5LGN A;  4ZYD A;  1HDP A;  1LDJ A;  1GV5 A;  3K7A J;  2R7V A;  3W6J B;  1R4M B;  3EUA A;  4BE2 A;  2NVY J;  2LR8 A;  2PN6 A;  3G1O A;  4PJM A;  3ZQF A;  3BG5 A;  3FMS A;  5E18 F;  4HQE A;  1OMI A;  4EJV A;  4ZYG A;  2EB7 A;  3OV8 A;  3CMY A;  5E1Z B;  3BCB A;  3CCQ I;  4L9N A;  2E1O A;  3HRT A;  2MYS A;  3CJQ B;  2X6W A;  3QQA A;  3F0C A;  5FRN A;  1RNL A;  3BQZ A;  5M5Y J;  4U0W A;  3V4G A;  3HKZ N;  2F48 A;  5JVT A;  3K9T A;  3LSH A;  3WTW C;  4CO8 A;  3CDH A;  3KPH A;  5CQG A;  1R23 A;  1JT6 A;  3IHU A;  3EUH C;  3FXJ A;  3BPX A;  4OWR B;  3ZN1 A;  3RYR A;  2LG4 A;  3F22 A;  4LD5 A;  4LLN A;  3IC7 A;  3IAM 2;  1LE8 B;  4LG0 B;  1YE9 A;  2IP2 A;  2VE9 A;  3DPT A;  2FNA A;  4ZDL A;  2DBB A;  3FM3 A;  2K40 A;  5HOO A;  2QEX I;  5JHU A;  3GVA A;  4RB0 A;  4BY7 J;  3J7Y J;  3CUQ C;  3HG9 A;  1ZEL A;  2QF7 A;  3GFJ A;  4PDK A;  5K7F A;  1ZGW A;  1S7O A;  1SFO J;  4I09 A;  2HQA A;  2YX7 A;  4WF2 A;  5J47 A;  3BJA A;  5IY5 H;  1LJ9 A;  2W7N A;  2XHK A;  3FIS A;  3LST A;  1WGX A;  3TP3 A;  2V9V A;  2DOE A;  3FXQ A;  4R8H A;  4E7I A;  1Z6R A;  4IOC F;  4ESJ A;  4IRH A;  2L02 A;  2ME6 A;  3GXO A;  5BPD A;  1ORK A;  1GVJ A;  1M1E B;  2LMD A;  1IUF A;  2X85 A;  1S5L C;  1YJN I;  4AC0 A;  3V8J A;  3S93 A;  2ZSH B;  3OYE A;  1O3S A;  2VT2 A;  1S72 I;  2BGC A;  2DN0 A;  2DOF A;  5ICE A;  4A12 A;  5LGT A;  5D6E A;  1XD7 A;  2DFF A;  3NQO A;  4AVP A;  3ZQL A;  4QPQ A;  2WAQ N;  4NNJ A;  3CES A;  2EJR A;  2ZSI B;  3OSG A;  4ESF A;  2VAS A;  2YU3 A;  1TBX A;  1LE8 A;  5JFR A;  1A5J A;  4LG0 A;  2X1D A;  2JMW A;  3LFK A;  1UCR A;  2VL8 A;  2BXY A;  3HC7 A;  1BOA A;  5EZH A;  3W3C A;  5ILS A;  1O7L A;  1YOV B;  1K4S A;  4YEJ A;  3GBG A;  3CQZ J;  1XGN A;  1PYV A;  4AIJ A;  2EWN A;  1Z91 A;  3JRF A;  3A01 B;  4UVC A;  4IZZ A;  3PJR A;  3ZMU A;  4U87 A;  2VOP A;  1W1W E;  2BE5 F;  2ETH A;  1RZ4 A;  1PUF B;  2P5K A;  1E2X A;  5HNF A;  4C3H J;  2WA0 A;  2A6H F;  3B73 A;  2DQR A;  4CCK A;  3R6S A;  5HDN A;  3UKG A;  3VWB A;  2LF7 A;  2MAB A;  2XAJ A;  3DEE A;  1Z3Y A;  4XL9 A;  1WJD A;  3VOE A;  1N75 A;  2QSH X;  4RAY A;  3HIF A;  2XPU A;  5E79 C;  3HPH A;  5F6F A;  2ZO4 A;  4G6Q A;  3ABK H;  2M9H A;  1TQM A;  4BY1 J;  4PJJ A;  2VI6 A;  3MEX A;  2L9N A;  1GXQ A;  2MC4 A;  2CH0 A;  2L9R A;  4HX7 A;  4BU2 A;  4G7H F;  5J40 A;  1X3W B;  2HYJ A;  5FJ8 J;  2R5Z B;  1LVK A;  2WBM A;  4EEF G;  1FYM A;  3ZQH A;  4D1Q A;  5K5R A;  3FHZ A;  1R49 A;  1APL C;  3W2V A;  3LSR A;  3CLO A;  2UUZ A;  3L1P A;  1V5F A;  2BHY A;  4CHU A;  4HG2 A;  3MKY B;  4LB5 A;  1Y56 A;  2VBW A;  2Z16 A;  4UB6 C;  5EYR A;  1DU0 A;  4M3E A;  4IKF A;  2OD5 A;  2R0Q C;  1MND A;  1Q1H A;  4U0V A;  1ZRF A;  2QEN A;  2JA5 J;  1NG6 A;  2B63 J;  1PUF A;  3CCE I;  2IJL A;  3MD2 A;  2R7D A;  4M71 A;  4HNU A;  1SEU A;  4ZYA A;  3A02 A;  5KCM A;  4HEA 2;  2HGC A;  1D5Y A;  1BR4 A;  3HSR A;  4AUX A;  5CVU A;  1GUU A;  3KZI C;  5CLS A;  4IQJ A;  3OOP A;  3GEZ A;  5FB2 A;  1ETY A;  3DTE A;  4JYK A;  5FRO A;  5HLG A;  1V55 H;  1MGT A;  2W84 A;  2F5F A;  5GTH C;  2H8R A;  2V6E A;  2L9V A;  4PK4 A;  2HEO A;  1OLT A;  5HS9 A;  2FE3 A;  5GPA A;  2CW7 A;  2NYX A;  2OA4 A;  4MTD A;  1BW5 A;  3QPS A;  2DJN A;  2R5Z A;  2HOS A;  1K7A A;  2WAF A;  1XS9 A;  3FKJ A;  3PIO F;  4PJ0 C;  2QQA A;  2RV8 A;  2V1D A;  3BOQ A;  4EMS A;  3JRB A;  5IT9 K;  2VXZ A;  3CCR I;  4HX8 A;  3DKW A;  3GWZ A;  3RKQ A;  1SD5 A;  2OV7 A;  4XID A;  1BR1 A;  1HCR A;  3O8G A;  1G4D A;  5BS6 A;  3L00 A;  1XMX A;  2R7R A;  3F8C A;  3M07 A;  1MBK A;  4ENK A;  4XK4 A;  3T5X A;  4BE0 A;  1UHM A;  4IX7 A;  1B9N A;  2UXX A;  3V7R A;  3ZPL A;  2CWE A;  2GA2 A;  1B59 A;  4YFX F;  5EEH A;  1E3H A;  4XKV A;  3GZN B;  1QO0 D;  4A3M J;  3S8P A;  3JAM K;  2RNG A;  4H4K C;  2Z99 A;  5A2Q Z;  1XCV A;  1HKT A;  4QTR A;  4LLL A;  1V4R A;  2A6E F;  3HOY J;  1IN7 A;  2OPT A;  1P7I A;  3SEQ A;  3S1N J;  1ITY A;  4HYE A;  1MNM C;  2AXL A;  4C30 A;  1SD7 A;  2ZXI A;  1DP3 A;  4G7Z F;  1XG1 A;  4CZC A;  4GYG A;  2AQE A;  4JOM A;  3T8T A;  2QYO A;  2ZJ2 A;  2QSG X;  3F23 A;  1IDZ A;  3J7A O;  4RLF A;  3CO7 C;  4V19 K;  2QUF A;  3G1L A;  5LBQ A;  3OS2 A;  4BDZ A;  3LAJ A;  2F4M B;  1KU7 A;  3ELK A;  3AG4 H;  2DCE A;  9ANT A;  1SMT A;  2DMP A;  4LFU A;  3ZMV A;  5JVG F;  2X0L A;  2DU9 A;  5C3E J;  1FNN A;  4B4C A;  4HF1 A;  2YR2 A;  1U9N A;  3ZMT A;  3V8K A;  2CV2 A;  1ON2 A;  4JQF A;  3HZJ A;  4QLC U;  2JQ7 A;  1FT9 A;  2IA0 A;  2VKE A;  3WGG A;  4X1E A;  4DBQ A;  2F5C A;  1LEA A;  1RUN A;  4EM0 B;  1G59 A;  2K9L A;  3HOX J;  3D0S A;  3I5U A;  1ZAO A;  1TP4 A;  3HB9 A;  4AU7 A;  1BIB A;  4RDU A;  1KU3 A;  2HTJ A;  1R22 A;  2F5D A;  4P55 A;  1E0E A;  3K69 A;  2YS9 A;  4UUT A;  2ZME C;  3WTT C;  1R7J A;  2CO5 A;  4Q48 A;  2C6Y A;  2LP0 A;  2QM3 A;  1IC8 A;  1I50 J;  2EFO A;  5CVV A;  4IRG A;  4L9V A;  4KJZ A;  1QPM A;  2IA1 A;  4A0X A;  1SAN A;  3HTU A;  5TGT A;  2LNB A;  4KIG A;  3K4J A;  1H0M A;  4RS8 A;  1ZGJ A;  3MWM A;  1W36 D;  1ACI A;  3HOW J;  3L09 A;  4P1W A;  3ZMZ A;  3OSF A;  5L3D A;  4UUV A;  3AAF A;  2O8K A;  1U8R A;  1XSV A;  2TDX A;  3O6B B;  1S7E A;  3IKT A;  2JVG A;  2OTL I;  1Z21 A;  4FX0 A;  3CCM I;  1R4N B;  2HVQ A;  4EV0 A;  2XIG A;  1TTY A;  2XGC A;  2OZ6 A;  3QYE A;  1XGM A;  1Z05 A;  3WG7 H;  2DA5 A;  3JSP A;  4ON0 A;  3I53 A;  1FMW A;  2FEZ A;  3F6V A;  3ZMS A;  3L7W A;  2R4G A;  3IAS 2;  2FBH A;  3OMY A;  5ICG A;  1BI1 A;  2FJ1 A;  5DEQ A;  5KK1 A;  3SZT A;  2A6T A;  3ZR8 X;  1X3Z B;  3M8E A;  1AA7 A;  3SZP A;  3RSN A;  4BBR J;  1YFH A;  2M3A A;  1FMV A;  3BRO A;  4NBQ A;  1L3L A;  4OIP F;  5B3S H;  2JTV A;  4DIQ A;  3KP6 A;  1N77 A;  4LJZ F;  3FWE A;  2BVL A;  1ETX A;  3HDD A;  2FU4 A;  1J5Y A;  2QVO A;  3I56 I;  2QSF X;  2X4H A;  2YSR A;  3CDI A;  4NC7 A;  1MH4 A;  3LMM A;  2IBD A;  2UXN A;  4XMY A;  2R93 J;  2EV6 A;  3L2Q A;  3FKI J;  2PFB A;  2XGX A;  5F1R A;  1F5T A;  4WCG A;  1QPI A;  3RKW A;  4A3D J;  3OYM A;  1K78 B;  2BY1 A;  4EJT A;  1V3F A;  3CCJ I;  3CC4 I;  2VJI A;  2K3F A;  4HA8 A;  2FSW A;  2GOX B;  3KP3 A;  1VQ5 I;  3H1C A;  1FIP A;  4ZJZ A;  1EF4 A;  2L7K A;  1Z77 A;  2DAO A;  1DGR M;  4UB8 C;  3K1M A;  4KNY A;  5DS9 A;  1X1D A;  3GO5 A;  4L5J A;  1NG7 A;  2HDW A;  3D5R C;  1A31 A;  3ERM A;  1D0X A;  1TWG J;  2QA4 I;  3HBL A;  1ETV A;  3O2P E;  4U0Y A;  2M7B A;  4DYC A;  2H6B A;  2M7A A;  2FQ3 A;  3DEU A;  4D5C A;  1DP7 P;  3S1Q J;  3N97 A;  1Y6I A;  3LNQ A;  1MBJ A;  1X2M A;  3PM1 A;  3S3N A;  3KIO A;  2MGQ A;  3KP4 A;  2RAE A;  1R5G A;  4HSR A;  4DNC A;  5HDK A;  3OWT A;  2WAE A;  4WXD A;  3J80 Z;  4E7K A;  1MMG A;  4F52 A;  5DCM B;  4DQ2 A;  2VT3 A;  2OUM A;  4G6D A;  4MGR A;  3RCO A;  4G8X A;  3TO9 A;  4LOC A;  1A35 A;  2HXI A;  2MH2 A;  3ZOB A;  1RR7 A;  1GXP A;  3KP7 A;  3IV5 A;  4MFD A;  1FSH A;  4GXO A;  3FIW A;  2YX4 A;  3K0L A;  1K78 A;  3GME A;  5C4X J;  1LB2 A;  1VND A;  2M45 A;  3Q9V A;  4Y3O A;  1T33 A;  3GTG J;  2J5O A;  4AD9 A;  1R6R A;  1O4X A;  1VQK I;  1RES A;  2Y31 A;  2M5W A;  4KIF A;  2LKX A;  1B4A A;  1OIS A;  2NRA C;  4XLH A;  1MJ9 A;  2VPR A;  2JN6 A;  5DM7 F;  1YS7 A;  1HLV A;  1G3T A;  1UG0 A;  4F93 B;  3HTS B;  1IXC A;  4KT6 A;  1IV8 A;  2IS4 A;  4A2U A;  3FXL A;  3GYH X;  2KIF A;  2G0E A;  3Q5F A;  2BV6 A;  2K3P A;  4D9J A;  5JLX A;  3OYB A;  2FML A;  3TL4 X;  3J7A Y;  4EGZ A;  1QRY A;  4CYC B;  1QU3 A;  2ZXW H;  4ZYH A;  3DP7 A;  2HQ5 A;  1X1A A;  3VPR A;  5FLV A;  1K4T A;  2BW3 B;  5DCM A;  3GLL A;  4HRI A;  2IAI A;  1KU9 A;  2VB6 A;  2E2J J;  3HUG B;  4ASN A;  4NC6 A;  4FCY A;  3ABU A;  1ZQ3 P;  3BR6 A;  1OYY A;  2JSP A;  2DW4 A;  1VQL I;  3ZQQ A;  1FOK A;  4WK8 F;  3FXO A;  3H9G A;  1AKH B;  4ANJ A;  1NK2 P;  4BYY A;  2O8X A;  3NRV A;  2KFD A;  4E7L A;  3K70 D;  1AWC A;  1B9M A;  3WU2 C;  2L7M P;  2VOO A;  2CSO A;  2JJ7 A;  1D3Y A;  3H3U A;  1T08 B;  5FKM A;  3TP0 A;  3TQN A;  1X4O A;  2DMT A;  2W1O A;  1B8I B;  3WTV C;  2O03 A;  1ZG5 A;  1U5T B;  3C1D A;  5DD8 A;  1ETK A;  3FXK A;  1I6H J;  4M3B A;  1MBE A;  4OIQ F;  5F0F A;  1QHG A;  2VN2 A;  3M4O J;  5LHG A;  4Y4R A;  1WCM J;  3D5L A;  2VQG A;  2WY8 Q;  3E5U A;  5E8I A;  3ESW B;  3JCU C;  1KQ0 A;  3R60 A;  4QIW N;  2OZU A;  4UY8 I;  2Z1D A;  2V1X A;  2XF7 A;  3KFW X;  3QU3 A;  2A05 A;  5LHI A;  3HL2 A;  4HLX A;  3U9G A;  3HUG A;  3PO3 J;  5AIQ A;  5B5E C;  4A0Y A;  1OCR H;  4A3E J;  1JTX A;  1JUM A;  2GXG A;  2IGK A;  3IKV A;  1YX5 A;  3GUD A;  4M73 A;  3OR2 C;  1LEB A;  3I9V 2;  3K2Z A;  3C18 A;  4RGR A;  1XGO A;  2PI0 A;  5L3C A;  3A03 A;  1XN7 A;  4BQQ A;  1AKH A;  1YIO A;  3DPL C;  2FMY A;  1VQ8 I;  1WH5 A;  4XKB A;  1YRN A;  4Y52 J;  2FBI A;  3PNY A;  5CJ9 A;  4P96 A;  3ZRG A;  2DT7 B;  1MMD A;  3WGH A;  1HW5 A;  2DT6 A;  1W5T A;  1Z0X A;  1X1C A;  1B8I A;  3QRF F;  1FPQ A;  1U5T A;  4WXH A;  2P7V B;  2XKO A;  2LC2 A;  3KEY A;  3G1M A;  2K4J A;  3NAU A;  4XRF A;  3G3Z A;  1BN5 A;  4HAM A;  4FET A;  1D1B A;  2O61 A;  2B7E A;  5FLM J;  1J09 A;  2IS2 A;  1DDN A;  1RR8 C;  4Y17 A;  5FGM A;  1MJB A;  1D1A A;  2PG4 A;  2K9Q A;  3GTM J;  4QSH A;  2IXS A;  1JUP A;  2ME0 A;  5HLT A;  2XAF A;  1QZY A;  3IH3 A;  4K2E A;  3DF8 A;  4E7J A;  1JJ6 C;  3U21 A;  2MG4 A;  2V9P A;  3TDU C;  4I01 A;  4E6K G;  3RQ4 A;  2NS7 A;  1I1G A;  1FSE A;  2LFB A;  2Q1Z B;  4G12 A;  3H9Q A;  3TO7 A;  5IYB J;  5ED4 A;  5M5W J;  1YJ9 I;  1TL8 A;  5IYD J;  2ELJ A;  4M3G A;  3L2R A;  3A2K A;  1NH3 A;  2GXB A;  3QPL A;  5GAD J;  2DXI A;  3VDX A;  1ZGA A;  3V42 A;  5ILV A;  2RGV A;  4J00 A;  4HLY A;  5LFA A;  4RLQ A;  3CC2 I;  3C2H A;  1CF7 B;  2V9K A;  3S32 A;  2HDC A;  3FM5 A;  5FFX A;  4KIB A;  2JA8 J;  1IZ1 A;  2KZV A;  3F8M A;  4Y15 A;  5JHF A;  4Z2Y A;  2Z5U A;  1A04 A;  1P92 A;  3LOC A;  4M9Z A;  3TKY A;  3KX2 A;  4RMN A;  3NAR A;  5E17 F;  2A69 F;  4ITV A;  2F5V A;  1R58 A;  1UZC A;  3ZCO A;  1OCZ H;  2QGU A;  4NB5 A;  2OJE D;  5KVR A;  4BHP A;  5L3B A;  1ULY A;  1WI9 A;  1R5H A;  2GWR A;  2DA3 A;  3A0B C;  1L0O C;  1LVA A;  1V5G A;  4CCO A;  3NWS A;  3I4N J;  3EPZ A;  2A68 F;  5BPI A;  2I8D A;  4DZJ A;  2V26 A;  2NVT J;  3HM5 A;  2MLG A;  4Y13 A;  3CF2 A;  1D5V A;  1BW6 A;  3Q9S A;  2V4J C;  3I4P A;  3QPT A;  3HJE A;  2ACJ A;  4M6V A;  4AVZ A;  2HWV A;  4I0A A;  4C3I J;  2DA6 A;  1X3U A;  2DOA A;  1IN6 A;  2BEO A;  1CF7 A;  1J7K A;  4CSW A;  3DV8 A;  4D0P A;  4I76 A;  3DXJ F;  3TW6 A;  1S6L A;  2XF6 A;  2GA1 A;  1IGN A;  2E36 A;  1STZ A;  2DK5 A;  3F72 A;  4KIS A;  4HF0 A;  4CUG A;  3JRE A;  1G3S A;  2L7Z A;  3MZY A;  1BI0 A;  3REO A;  3P7N A;  4BJT A;  1W36 C;  5D5U B;  1RET A;  2VQL A;  2VPL A;  3MCZ A;  3BZC A;  2GXA A;  1OFC X;  4JX5 A;  2VOD A;  2JUG A;  1IXR C;  2AS5 F;  4NHJ A;  4CGZ A;  4XBF A;  3OYC A;  2CQQ A;  4HDU A;  5DYM A;  4L18 B;  1Z67 A;  2ID6 A;  1MMA A;  3FZV A;  1O3Q A;  2V1N A;  4KN7 X;  1UHS A;  3LQR A;  4FIS A;  3ZGK A;  2ISY A;  4LMY A;  1H88 C;  2W24 A;  4KFC A;  1T95 A;  4P5O A;  4RGX A;  1WJF A;  5A2Q K;  2E71 A;  2HXO A;  1U9O A;  1SVM A;  1RPW A;  4MO7 A;  4PJN A;  4P9F A;  2E19 A;  3LA2 A;  4N0B A;  1U6G A;  5J8F A;  1UMQ A;  3GLX A;  2ZJR F;  4ZZL A;  2EIM H;  2EQR A;  5CVJ A;  2CRG A;  3BTL A;  4R1H A;  5K5Q A;  1Y39 A;  3I4M J;  4MHG A;  3KP2 A;  1WRJ A;  3KEQ A;  3DKY A;  4HZF A;  5IYC J;  5BOX A;  4A3I J;  1I5Z A;  2F4O B;  4A6E A;  2KDO A;  4PSW A;  1R71 A;  3GW2 A;  3VEP A;  3RIR A;  1LQ1 A;  3E5X A;  4WWC A;  2GBY A;  2XB0 X;  4V2F A;  3J81 Z;  5F04 A;  5FLX Z;  2HR3 A;  3LWF A;  2HOE A;  2HZD A;  3CJT B;  3CMM A;  4E70 A;  4EM2 A;  5EEG A;  2VC1 A;  2ISZ A;  1DQU A;  1BJZ A;  2RQP A;  2R7O A;  3BJO A;  2ZFU A;  1JXS A;  1Z7L A;  3MFK A;  2XSJ C;  4OAY A;  2L5Q A;  4L5I A;  4RAZ A;  5M5X J;  2RN7 A;  5J1Y A;  1BM9 A;  1ZK8 A;  5FD5 A;  1PVE A;  3RDI A;  1D0Y A;  4GFB A;  3F8N A;  1QQI A;  3DU6 A;  2D1V A;  3VFZ A;  1T39 A;  5D8K B;  3Q0U A;  3J7Z I;  4A6D A;  3CF5 F;  4XLC A;  4EAT A;  4A5M A;  3FF5 A;  3A01 A;  2P7C B;  1D1C A;  5D5V B;  3M3Y J;  4EVI A;  3BLY A;  4W1U A;  3DLL F;  2OBP A;  1FOX A;  1ZLK A;  4BAC A;  2ICW G;  1Y0U A;  2CV0 A;  3EET A;  4AWX B;  2CUZ A;  1UFM A;  4UHT A;  1IRG A;  2GOM A;  3BR0 A;  3JR9 A;  2PX9 A;  4CH7 A;  1F1Z A;  2DA2 A;  3A0H C;  2W85 A;  3OYI A;  2CQ7 A;  5K1Y A;  2XRO A;  3GZ5 A;  4CDG A;  3GFL A;  3SFZ A;  1WFX A;  5EG0 B;  2Y75 A;  2XKP A;  1KYW A;  3GF2 A;  3E5Q A;  3BCA A;  4OIR F;  2P81 A;  2R5Y B;  1XX5 A;  5LEJ A;  1H9T A;  5FKL A;  1FBU A;  2E1N A;  2OF7 A;  4IEJ A;  3MMY B;  1E3O C;  3WTZ A;  4IVN A;  2K9M A;  4OIN F;  2HNH A;  3HPG A;  4BE1 A;  2EIN H;  3SXY A;  3OYJ A;  1OCT C;  2MC3 A;  2ZBK A;  1VQN I;  1UJ8 A;  3FMR A;  3H36 A;  2LYC A;  2VLA A;  1XSD A;  5DV5 A;  1G3Y A;  2PJP A;  3GFI A;  4D7M A;  2R7W A;  2QLZ A;  1SAX A;  1ZTR A;  1W7P B;  3I0T A;  2FD5 A;  4XR6 A;  2CYY A;  1TWH J;  4U7D A;  2DDB A;  3DBH B;  3LSJ A;  3RZD J;  2KDZ A;  1Y8R B;  2QWW A;  1J2X A;  1IRX A;  1U0J A;  4I0B A;  1HXD A;  3JRH A;  2O0Y A;  2EA4 A;  1OKR A;  2EZK A; 
#chains in the Genus database with same CATH homology
 5F08 A;  4M3D A;  2HOT A;  1Y1V J;  1X2N A;  5E3M A;  2Y30 A;  2N8G A;  5EG0 A;  4BBS J;  5EZG A;  1T56 A;  1FIP A;  1OCP A;  1EF4 A;  3RQI A;  1Z77 A;  2R5Y A;  3FK6 A;  2CUF A;  2DA4 A;  2HOA A;  5DS9 A;  3K2A A;  1WH7 A;  5J3L A;  1I3Q J;  1X58 A;  1TWG J;  3HBL A;  1ETV A;  2XGE A;  3BTJ A;  4DYC A;  5FKK A;  4AYB N;  1K83 J;  4IHW A;  4D5C A;  1W0U A;  3S1Q J;  2NS8 A;  3LNQ A;  1MBJ A;  1X2M A;  3FK7 A;  3PM1 A;  4XRS A;  1QVU A;  2MGQ A;  2RAE A;  4JX6 A;  1IV6 A;  5K7Z A;  1ZR4 A;  4A3C J;  5C44 J;  1VI0 A;  3ZQC A;  1IJW C;  4FTH A;  1WI3 A;  2ECB A;  2R92 J;  4LOC A;  2H1K A;  1JTY A;  2HXI A;  2DMN A;  3ZOB A;  3BQY A;  1RR7 A;  1JT0 A;  3S16 J;  3IV5 A;  1CQT A;  4MFD A;  1H89 C;  2YUS A;  3FIW A;  1OJL A;  4L5E A;  1UG2 A;  1MSE C;  2FQ4 A;  5C4X J;  3HEF A;  1HF0 A;  1VND A;  1JGG A;  3JRI A;  1T33 A;  1P7J A;  3GTG J;  3RZO J;  1O4X A;  1TWC J;  1RES A;  2Y31 A;  2LKX A;  1Q1V A;  2NOG A;  2HDD A;  2EH3 A;  2VPR A;  2JN6 A;  3Q3S A;  3TED A;  2Y2Z A;  5F0C A;  1HLV A;  1ETO A;  2LY9 A;  2ELK A;  4DYQ A;  1MSF C;  3B6A A;  2TCT A;  2GM4 A;  2G0E A;  2XPW A;  3OOU A;  1ETW A;  4A3G J;  5JLX A;  4BKX A;  3D1N I;  3DCF A;  1POG A;  4D5F A;  2X6O A;  1QRY A;  4CYC B;  1LFB A;  3MN2 A;  1RKW A;  4XRS G;  2CU7 A;  1IDY A;  2HQ5 A;  2Y0S N;  1ETQ A;  4JX4 A;  3VPR A;  4DW6 A;  1HDP A;  2PMZ N;  2Y9Z A;  5FLV A;  2WB1 N;  1GV5 A;  3K7A J;  2XB5 A;  1GVD A;  5IP9 J;  2NVY J;  2LR8 A;  1JKO C;  2IAI A;  5EF6 A;  3G1O A;  3ZQF A;  2E2J J;  3BG5 A;  5FKN A;  4FCY A;  3W6V A;  1IG7 A;  3CMY A;  1ZQ3 P;  3BR6 A;  2E1O A;  3QQA A;  3F0C A;  4IHX A;  1VF9 A;  1VFC A;  1BL0 A;  3BQZ A;  5GP9 A;  2JK3 A;  5M5Y J;  2EZI A;  1JKP C;  3HKZ N;  1AKH B;  3ZQI A;  2XPV A;  1NK2 P;  1JT6 A;  2EBI A;  2L7M P;  2JJ7 A;  5FKM A;  3TP0 A;  4DYR A;  1LE8 B;  2DMT A;  4A3K J;  1B8I B;  1MBF A;  1AU7 A;  2K40 A;  5IP6 A;  1ETK A;  5EGO B;  2EZL A;  1IRZ A;  1I6H J;  2LLK A;  4M3B A;  1MBE A;  5F0F A;  2O7O A;  4BY7 J;  3JRG A;  3M4O J;  2QF7 A;  1WCM J;  2XRL A;  4J19 A;  1FJL A;  5K7F A;  1HDD C;  1ZGW A;  1F36 A;  1SFO J;  3S15 J;  4QIW N;  2XSD C;  3FIS A;  1WGX A;  3HOV J;  2NVQ J;  3TP3 A;  3WHC A;  3PO3 J;  4A3D J;  3BT9 A;  4A3E J;  1JTX A;  1JUM A;  2ME6 A;  3S14 J;  1ORK A;  1IUF A;  2CQX A;  3C2B A;  2LTP A;  4AC0 A;  3S1M J;  3A03 A;  1AKH A;  2DN0 A;  2KT0 A;  4XRM A;  1WH5 A;  1ENH A;  1YRN A;  4Y52 J;  3ZQL A;  2WAQ N;  3BG9 A;  3OSG A;  2LVS A;  4ABZ A;  1LE8 A;  5JLW A;  1A5J A;  1Z0X A;  1B8I A;  2JMW A;  3OIO A;  5FKO A;  2DMU A;  5EGO A;  1K61 A;  1FTZ A;  3G1M A;  5EZH A;  2X9D A;  4W97 A;  4C2M J;  3NAU A;  2CUE A;  2E2I J;  3GBG A;  2TRT A;  3CQZ J;  5M3F J;  5FLM J;  3S1R J;  4MLO A;  3JRF A;  5DTD A;  3A01 B;  4JP0 A;  2L7F P;  1MH3 A;  3HGY A;  2FX0 A;  2K9Q A;  2IEK A;  3GTM J;  2DTZ A;  4QSH A;  4RBO A;  1PUF B;  1JUP A;  2ME0 A;  2M8G X;  3IH3 A;  4C3H J;  1JJ6 C;  5F0H A;  2MG4 A;  3UKG A;  1HOM A;  1FEX A;  3JRA A;  2DA7 A;  2NS7 A;  4G12 A;  2LFB A;  5IYB J;  5M5W J;  5IYD J;  2XPU A;  4M3G A;  3Q0V A;  2M9H A;  2W48 A;  5E3O A;  4BY1 J;  2CJJ A;  2VI6 A;  3QPL A;  3WHB A;  2M34 A;  3S2D J;  2ECC A;  4A3F J;  2L9R A;  5EDN A;  2HYJ A;  1F43 A;  5EEA A;  5FJ8 J;  2R5Z B;  2WV1 A;  4EEF G;  3ZQH A;  2JA8 J;  3GTJ J;  1APL C;  2AHQ A;  3LSR A;  5J1R A;  4A69 C;  1FTT A;  3L1P A;  4Y7N J;  3LOC A;  1TWA J;  3NAR A;  1U78 A;  5EYR A;  3H3V K;  1DU0 A;  4M3E A;  5K7H A;  2R0Q C;  2K9N A;  2B63 J;  2JA5 J;  2LD5 A;  1PUF A;  4MFE A;  2MW8 A;  4DZP A;  3A02 A;  2Y9Y A;  1D5Y A;  2MSY A;  3CCY A;  4AUX A;  2DA1 A;  1GUU A;  2DA3 A;  2HI3 A;  5E3L A;  3I4N J;  1ETY A;  3LSG A;  4JYK A;  4DZJ A;  1Y1W J;  2NVT J;  3HM5 A;  3GTO J;  3SDG A;  2H8R A;  4UUS B;  1BW6 A;  1R9T J;  4IHV A;  3LSP A;  5M3M J;  3HOU J;  5GPA A;  3Q0W A;  1JJ8 C;  2ID3 A;  4M6V A;  5IP7 J;  1BW5 A;  3QPS A;  3CDL A;  4C3I J;  2I10 A;  2DA6 A;  4CYC A;  2DJN A;  2R5Z A;  2HOS A;  4MIM A;  3GTK J;  1XS9 A;  3BR5 A;  3JRB A;  2COB A;  3MVP A;  4I76 A;  1MBG A;  2YU9 J;  1H8A C;  3TW6 A;  3RKQ A;  1IGN A;  4XID A;  2R7Z J;  1HCR A;  3O8G A;  3BG3 A;  3JRE A;  2L7Z A;  2L0K A;  1RET A;  1MBK A;  5IPA A;  4XK4 A;  1OFC X;  2M0C A;  4JX5 A;  1ZKG A;  3BR3 A;  3SFI A;  4FE7 A;  4A3M J;  3S2H J;  1BA5 A;  4A3J J;  2CQQ A;  2LK2 A;  2ID6 A;  2X48 A;  3ZQG A;  4QTR A;  3BR1 A;  3E7L A;  4FE4 A;  3B6C A;  2NVX J;  4A3L J;  1UHS A;  4FIS A;  3HOY J;  1TWF J;  3MKL A;  1H88 C;  2OPT A;  1P7I A;  3S1N J;  1ITY A;  4UUS A;  1NK3 P;  2HXO A;  1MNM C;  1U9O A;  3GTQ J;  1XG1 A;  1RPW A;  5J1U A;  4MO7 A;  2E19 A;  3BTI A;  3GTL J;  1FIA A;  1UMQ A;  3DEW A;  1IDZ A;  1GT0 C;  2EQR A;  2JA6 J;  2CRG A;  3BTL A;  3I4M J;  3G1L A;  5IYC J;  4A3I J;  9ANT A;  3HOZ J;  2DMP A;  1LFU P;  5C4J J;  5C3E J;  2GBY A;  3HGG A;  4B4C A;  2K9S A;  2XB0 X;  4V2F A;  1U9N A;  5F04 A;  2DMQ A;  3BTC A;  3BR2 A;  2VKE A;  4V2G A;  4HNV A;  4X1E A;  1GV2 A;  4IHY A;  3JRD A;  1BJZ A;  1A6I A;  3HOX J;  3JRC A;  3HB9 A;  5M5X J;  4I6Z A;  1AHD P;  5J1Y A;  1ZK8 A;  4RDU A;  1U8B A;  4GFB A;  3GTP J;  2YS9 A;  4UUT A;  1G2H A;  5BNG A;  2LP0 A;  3Q0U A;  2M2E A;  1I50 J;  1IC8 A;  1B72 B;  3A01 A;  3PO2 J;  1MBH A;  1SAN A;  2O9L A;  3M3Y J;  2ZB9 A;  1JKR C;  4W1U A;  3TW7 A;  3SJM A;  2QCO A;  2EZH A;  2JWT A;  4A93 J;  4BXX J;  3H0G J;  3HOW J;  3BR0 A;  3OSF A;  3JR9 A;  2DA2 A;  1TC3 C;  2O8K A;  1ZR2 A;  4A3B J;  1S7E A;  4M3F A;  2E2H J;  2JA7 J;  3IH4 A;  4B1R A;  1QVT A;  5EG0 B;  1JKQ C;  5IOY A;  2XGC A;  5E3N A;  1RKT A;  5HOD A;  2DA5 A;  5F1J A;  4X6A J;  2P81 A;  4S0H B;  2R5Y B;  1GDT A;  1XC5 A;  2D5V A;  5FKL A;  2OF7 A;  4IEJ A;  1E3O C;  2FJ1 A;  1YRN B;  2XGD A;  4D7N A;  4BBR J;  1W0T A;  1OCT C;  2GLO A;  1JUS A;  3S17 J;  4B3A A;  5GPC A;  4XIC A;  5F27 A;  4D7M A;  1B72 A;  1DU6 A;  1ZTR A;  2VUM J;  5IOZ A;  1ETX A;  1WPK A;  3HDD A;  2FD5 A;  3O8H A;  1MH4 A;  1TWH J;  1NTC A;  2IBD A;  3LSJ A;  4NDL A;  3RZD J;  2KDZ A;  2R93 J;  3FKI J;  3IH2 A;  4C3J J;  3JRH A;  1QPI A;  2VKV A;  2AO9 A;  2EZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...