2EZIA

Solution nmr structure of the igamma subdomain of the mu end dna binding domain of mu phage transposase, 30 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
MNVHKSEFDEDAWQFLIADYLRPEKPAFRKCYERLELAAREHGWSIPSRATAFRRIQQLDEAMVVACREGEHALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the I gamma subdomain of the Mu end DNA-binding domain of phage Mu transposase.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords TRANSPOSASE
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1997-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eziA00
2R93J 3OSFA 3OOUA 4BY1J 4EEFG 3LSGA 4BXXJ 4A3BJ 1W0TA 3O8GA 1RKWA 1QVTA 2DMUA 2W48A 2HXOA 3FK7A 2Y30A 1D5YA 2EZHA 1Q1VA 2LLKA 5FJ8J 1WH7A 5J3LA 1ZKGA 2E2JJ 2JK3A 3HOWJ 5JLXA 2XPWA 3HM5A 3S14J 5IOYA 2NVXJ 1ZR2A 2GLOA 5FKKA 2DA7A 2DA6A 1OFCX 2EBIA 1JKRC 2M0CA 5M3MJ 3RQIA 2CUEA 3JRHA 2VPRA 4JX4A 4BBRJ 2ZB9A 1ETVA 4V2GA 1ZGWA 2VUMJ 5HODA 3BTCA 1FIAA 1MH3A 1IDYA 5EG0B 1IGNA 2E1OA 1MNMC 1PUFB 1IJWC 3DCFA 3RZOJ 4A3CJ 4AUXA 3FK6A 3H0GJ 2X9DA 4D5FA 4M6VA 3HOYJ 5F04A 3D1NI 2P81A 1AKHA 1DU6A 2M8GX 1JT0A 1JUPA 4LOCA 2DA4A 3Q3SA 1MBEA 3S15J 3BR3A 1F43A 1Y1VJ 1GT0C 1ITYA 1ZQ3P 4UUTA 1H8AC 3H3VK 1HLVA 3S1RJ 2ECCA 1O4XA 2Y2ZA 3C2BA 1CQTA 1H89C 4G12A 3SDGA 3MN2A 5EG0A 3JRDA 1VF9A 2KDZA 4DYQA 1GV2A 2H1KA 2I10A 1S7EA 3O8HA 1RKTA 4I76A 1GUUA 3BT9A 1JJ8C 3JREA 4UUSB 1JTYA 1ORKA 2LP0A 3Q0UA 1JT6A 1OJLA 1G2HA 4M3EA 5DTDA 3QQAA 2MGQA 2WAQN 3JRFA 3E7LA 1F36A 5EDNA 3TP0A 4Y52J 1ETYA 2LR8A 2VKVA 5IP7J 4FCYA 1ETQA 2JN6A 3UKGA 3S1QJ 5EZGA 2DMTA 1B72B 1U9NA 3GTLJ 2E19A 1FJLA 1BW6A 3PM1A 1LFUP 3HOVJ 5F0CA 4S0HB 2XGEA 5EEAA 2DMQA 1IC8A 4A69C 3BTLA 3HDDA 3JRCA 3BG9A 2XPUA 1I6HJ 1MH4A 2HYJA 2WV1A 4FTHA 1RETA 5E3LA 1IUFA 2WB1N 2ME6A 3ZQIA 2K9QA 3BG3A 3SJMA 4CYCB 5EGOA 2E2HJ 1JKOC 2HQ5A 2ID3A 2FX0A 3Q0WA 1QRYA 2QF7A 4AC0A 2NVYJ 3FKIJ 2EQRA 1BL0A 5E3NA 3S1NJ 3TP3A 3IV5A 5IOZA 4C2MJ 1B8IA 1I3QJ 1FTZA 4DZJA 3S17J 4X6AJ 3GTKJ 2XGDA 4QTRA 3FISA 5F27A 1TWHJ 4DZPA 5IYBJ 2HOSA 2JA6J 1JJ6C 3HOUJ 2AO9A 1K61A 2M9HA 4A3GJ 4W97A 1NTCA 4BBSJ 2Y0SN 2LY9A 1BJZA 5GPCA 1ZR4A 3HB9A 3OIOA 4A3FJ 4V2FA 2JWTA 4C3IJ 1IDZA 4IHXA 1UHSA 3NARA 4A3KJ 2DA5A 2JA7J 3S16J 2HI3A 2R5ZA 1U78A 2EH3A 5IPAA 2HOAA 1Y1WJ 3I4NJ 5FLVA 2HOTA 1SFOJ 5M5YJ 3JR9A 1I50J 1QPIA 1VNDA 1P7IA 1FTTA 1GVDA 4B3AA 1TWCJ 1NK3P 3FIWA 1MBJA 5EYRA 4JYKA 4NDLA 3BR6A 3GTGJ 5C4JJ 2ME0A 4A93J 1TWGJ 1XG1A 1IG7A 4D5CA 5E3OA 3PO3J 3B6AA 3LSRA 3IH2A 1WGXA 3BR0A 3G1MA 1MSEC 3Q0VA 2R5YA 3M3YJ 2VKEA 1OCTC 4XRMA 5C44J 2MG4A 4D7MA 1RR7A 3LSJA 1ENHA 1TWAJ 1RPWA 1ZK8A 2EZLA 1LE8A 1VFCA 1HDDC 1YRNB 1U9OA 2LTPA 4RDUA 3HGGA 1ETWA 2L7MP 1LE8B 3S2HJ 4M3FA 5F08A 2R92J 3HBLA 3MKLA 1X2MA 3MVPA 2O9LA 4M3DA 1WPKA 1X58A 2DA2A 2XGCA 1R9TJ 2R5YB 5F0HA 1WH5A 3G1OA 4Y7NJ 2L0KA 2LK2A 4IHVA 2CJJA 5BNGA 4QIWN 1LFBA 4FISA 2FD5A 5FKLA 2CRGA 5GPAA 2HDDA 3WHCA 2L9RA 4A3IJ 2TCTA 1XC5A 2M34A 2NS7A 1AU7A 5C4XJ 5JLWA 2IAIA 3IH3A 5IP9J 2ID6A 1JUSA 4C3HJ 1EF4A 1UMQA 1DU0A 1ETXA 3GTOJ 3LSPA 5J1YA 4FE7A 1H88C 1BW5A 3BR2A 4BKXA 4IHYA 3A01B 1APLC 4XICA 1MSFC 3IH4A 4MO7A 4DYRA 1ETKA 2DMNA 1JKPC 1SANA 3BQZA 5K7ZA 4A3JJ 2OF7A 3TW7A 2CQQA 2MW8A 2JA8J 2MSYA 4XRSA 1YRNA 4RBOA 2GM4A 3JRAA 2TRTA 3RKQA 1U8BA 2DA1A 4QSHA 2M2EA 5F1JA 2R5ZB 4JP0A 5M5XJ 1HOMA 5IYCJ 1GDTA 3JRGA 2K40A 3I4MJ 2NOGA 2AHQA 4ABZA 5C3EJ 4L5EA 3PO2J 5FKOA 3QPSA 3DEWA 4A3DJ 3CDLA 3TW6A 4AYBN 3A03A 3G1LA 3OSGA 2KT0A 1MBGA 3ZQHA 1POGA 1VI0A 5IP6A 1NK2P 1HDPA 2R0QC 3S2DJ 4JX6A 3GTMJ 5IYDJ 1WI3A 1QVUA 3A01A 2K9NA 4M3GA 1OCPA 2O7OA 1JKQC 2NS8A 3BQYA 3JRIA 2FJ1A 2LD5A 1MBFA 5J1UA 3GBGA 3BG5A 2YU9J 2Y9ZA 3M4OJ 2LFBA 2DTZA 4B1RA 1UG2A 1T56A 3BTJA 3CMYA 2IEKA 3ZQFA 2JA5J 3B6CA 1JUMA 3LNQA 1AHDP 4B4CA 4C3JJ 9ANTA 1A5JA 1IRZA 3LOCA 2XRLA 4XK4A 4J19A 1W0UA 1FEXA 5J1RA 2XSDC 2COBA 2ECBA 2EZKA 3SFIA 3ZQLA 5K7HA 2CQXA 2G0EA 2LVSA 3GTQJ 1B72A 3HEFA 2DN0A 2N8GA 1JGGA 4IEJA 4DW6A 2L7ZA 2NVQJ 1MBHA 1IV6A 1B8IB 4DYCA 5M5WJ 5K7FA 4W1UA 1HCRA 3S1MJ 2CUFA 3HGYA 2OPTA 4MFDA 1E3OC 4JX5A 2D5VA 5M3FJ 2DMPA 2Y9YA 4D7NA 2GBYA 2O8KA 3HOXJ 1WCMJ 2XB0X 2ELKA 1TC3C 2JJ7A 3W6VA 1RESA 5F0FA 3GTPJ 3F0CA 3HOZJ 3BTIA 1K83J 1Z0XA 2VI6A 5EZHA 1X2NA 1P7JA 4BY7J 4M3BA 3BR1A 3CQZJ 1T33A 3QPLA 4XIDA 4GFBA 5E3MA 2XPVA 2CU7A 1HF0A 2YS9A 2H8RA 4XRSG 4I6ZA 1ZTRA 3NAUA 2X6OA 1GV5A 5EGOB 1ETOA 4CYCA 2DJNA 3A02A 1FIPA 1XS9A 2R7ZJ 1JTXA 3VPRA 5FLMJ 1AKHB 2E2IJ 2L7FP 2RAEA 3CCYA 5FKNA 5FKMA 3ZOBA 1TWFJ 4MFEA 2Y31A 1PUFA 2X48A 5DS9A 4X1EA 3JRBA 2YUSA 4HNVA 5GP9A 1A6IA 4MIMA 2IBDA 2JMWA 3BR5A 3L1PA 4IHWA 1Z77A 2DA3A 2B63J 4A3MJ 5EF6A 3K7AJ 2EZIA 4MLOA 3TEDA 4A3EJ 2QCOA 3K2AA 1BA5A 2FQ4A 3WHBA 3GTJJ 2HXIA 2NVTJ 3ZQCA 4A3LJ 2XB5A 2PMZN 1MBKA 3HKZN 3ZQGA 2LKXA 4FE4A 2K9SA 4UUSA 3RZDJ
chains in the Genus database with same CATH superfamily
2LF8A 2BW3B 3H9QA 2EPFA 5FRMA 4BY1J 1D8JA 3K6GA 1WQ2A 2ZJQF 2A6EF 4A3BJ 1W0TA 1RKWA 4BNCA 2XKPA 1QVTA 2DMUA 3FK7A 3ZQQA 1R58A 1MNDA 3LA7A 1KZHA 2EZHA 2YPRA 2CGPA 1M1EB 2LLKA 2CO5A 1WH7A 5CVJA 5J3LA 2DFEA 2X6YA 2IW5A 2JK3A 2DW4A 1P4XA 1R22A 1TBXA 3LQQA 2EJRA 5DD4A 2DA6A 1OFCX 2YX7A 3SZGA 5JHUA 1J75A 1BN5A 4HLXA 2VT3A 3RQIA 4EJUA 5M3MJ 2O6GE 1WHUA 3J7YJ 3CD6I 2EIKH 2MC4A 3IC7A 3RSNA 4F3QA 4BH9A 1FOWA 3A4CA 4V2GA 3HOTA 2R7XA 2VUMJ 1MMAA 3P7NA 5LGUA 1FIAA 5GTHC 4ZZDA 3E6MA 2JZYA 5J8CA 2KRCA 1HA8A 2MYSA 1B9NA 2D45A 2R7VA 1E17A 4A3CJ 3Q5FA 3AL0B 4S05A 1WJAA 4M6VA 3ELKA 3MZ8A 2DQRA 1HW2A 4P96A 1UB9A 2P81A 3E3VA 1DU6A 1WJDA 2GA2A 5HDGA 4PUSA 4MTEA 2BY2A 2FUG2 2WADA 3V8KA 1GT0C 1K4SA 1H8AC 3DEEA 2PQ8A 1HLVA 2XAQA 3S1RJ 1O4XA 3HSRA 3Q9VA 1ODDA 4IKFA 1J7KA 3CUQB 2DAOA 3MN2A 1Z21A 1JGSA 2BW3A 1RKTA 4I76A 4RAFA 2QQAA 1I5ZA 1MMDA 1GUUA 3BT9A 4XRFA 4UUSB 2XAGA 1OKRA 3TQNA 2A6HF 3Q0UA 3CJQB 1JT6A 3DV8A 4PFOA 5KCMA 4IOAF 4A5MA 3ZMVA 1MGTA 2WB1A 1F36A 2K85A 3K4MA 3LMMA 1FMVA 4CGZA 5CVUA 5DDGA 1ETYA 1QQIA 4KJZA 5KK1A 3CUQC 1T38A 3HXLA 4M72A 2CW0F 3GX4X 1TNTA 5CKTA 1QZZA 4OIQF 1ZREA 3JSOA 1KU2A 2DMTA 4BXFA 2IS2A 3PM1A 1LFUP 4TV7A 4LB5A 1SD7A 1WVRA 4CZCA 3CMEI 3RQ4A 4XKVA 2DMQA 1PVEA 2DTRA 3FMQA 2VE8A 1TW3A 5K1YA 3F3XA 1R49A 3HDDA 3KP5A 3BZ6A 1KU9A 1I6HJ 3DBLB 3NEUA 2XF7A 2WB1N 2ZXJA 3WU1B 3ZQIA 4G6TB 2R7QA 4HQEA 5ED4A 5DV5A 1JKOC 2GXGA 4FHTA 4L5JA 2LYCA 3P5JA 3QYEA 2E1CA 3ZRGA 1Z6TA 2Q1ZB 4HQMA 4XLCA 4RLQA 5F6FA 2XKOA 2Z16A 2ZJ2A 2FBKA 1B8IA 1XGNA 3L00A 1FY7A 4OMZA 1I3QJ 3I4PA 4BQOA 2ZMEB 5B3SH 2VOPA 4CO8A 3B73A 4X6AJ 2XGDA 2NXNB 4IRHA 5F27A 1TWHJ 2VPLA 4I7HA 2KJCA 3OS0A 2B0LA 2JA6J 2RNGA 3RPQA 1UZCA 2M9HA 4A3GJ 1K78A 1NTCA 2KKOA 3PFIA 3MD2A 4DOZA 1X3WB 3C2GA 1ZR4A 3K1NA 5AIPA 3GEZA 5GTIC 3H3ZA 2V1NA 4Q5SF 2JWTA 4KDPA 2DDBA 2F2EA 3WE3A 2RKHA 3BZCA 2HNHA 5KAFC 3RDIA 1EKEA 1S9HA 2DA5A 3FXOA 3BJOA 3HJEA 3GFJA 1IRFA 2EH3A 4KA4A 5BOXA 4KFCA 2WY7Q 2CUJA 3MMYB 3NRVA 4A5NA 5J6XA 4XORA 4ENMA 4EATA 1VNDA 3OYFA 3ISPA 2FF4A 1V3FA 4BJTA 4RGRA 4B3AA 1P2FA 2QBYA 5J4YA 2OU2A 2PEXA 3FXQA 2HFHA 3V8JA 3AKZA 4JYKA 1B4AA 2Z1DA 3AG4H 4JK1X 4D1QA 2DU9A 2L3DA 3FF5A 2BXZA 1VQMI 2D2WA 4A93J 3RTRA 4EJTA 3P9CA 2ZSIB 4WXDA 1XG1A 4D5CA 3S2WA 3JSPA 3GYHX 1I1SA 1YW9A 4G7HF 2CQ7A 3P9IA 4N4OB 1LUJB 1E2XA 2HQRA 4CCKA 1WGXA 5E18F 2V9PA 3G1MA 2EV5A 5LGNA 5HDKA 4ON0A 4C2TA 3PSIA 1WJFA 4D7MA 1UELB 2A07F 3RIRA 3F6VA 2OAZA 3ULQB 1ENHA 4HZFA 2HDWA 3TDUC 1ACIA 4HYEA 2LTPA 2MH2A 4M3FA 5FD6A 2JSCA 3HBLA 1BI3A 1X2MA 1WPKA 1X58A 1VQ8I 4GDFA 2M3AA 1E3PA 2PMHA 5LLQA 3W2WA 2CJJA 2B7EA 5BNGA 3PNYA 2STWA 3RPUA 2CRGA 5GPAA 5ICCA 3IRQA 3ABMH 2TCTA 1PJRA 4A3IJ 2NS7A 1FZPB 1UFMA 2IAIA 4II3A 4CCOA 3BCAA 1EF4A 2QQBA 4L9TA 4ANJA 1CF7A 1G8XA 1YW8A 1FSHA 1G3YA 1W7PD 3BR2A 3A01B 3KP2A 3UR3C 4LIUA 1Z9CA 3S93A 2DK5A 3NQOA 1ETKA 2HVSA 2DMNA 1JKPC 3BQZA 3MQ0A 4BYYA 3D5RC 3T8RA 4EGYA 2IGNA 2JA2A 5LRSA 4HW0A 3BDDA 3JRAA 3ONQA 2QKMB 3QPHA 4QSHA 1U8BA 5F1JA 3QPTA 2QENA 3IKVA 2H27A 2V7FA 5M5XJ 4CCLA 3VOEA 1GDTA 4M9SA 2K40A 4UHTA 4KNYA 1FT9A 3ZMSA 1S3JA 1QBJA 2QZ8A 2ESNA 4BAYA 2DDAA 5D8LB 5D5WB 1NH3A 5C3EJ 1YQAA 2AQFA 4IXAA 3TW6A 1MDMB 4PJJA 1G3SA 4AYBN 1Z05A 4IPAA 3G1LA 4LLNA 5E1XA 3E6DA 2DBBA 2ZBKA 3WGGA 3TO7A 5H6QA 3DXJF 3TO9A 4J01A 3F8MA 4BGDA 5HLHA 2DPDA 1UCRA 3OS1A 1D8KA 3W6KB 1QVUA 2GAUA 3A01A 2K9NA 1YO5C 3J7AO 3SXYA 2O7OA 1WKMA 5D5XB 4CDGA 4PSXA 1EJ9A 4KMFA 2M5WA 3VYUB 1HSJA 5E1WA 4OAYA 2BE5F 4HX7A 2CWEA 1XGOA 4MHGA 3V42A 3JRIA 2LD5A 5J1UA 2OCCH 3WU0A 3BG5A 4G9YA 3TDZC 3J80K 1L0OC 4B1RA 1O3TA 3VYTB 1I3AA 1UG2A 2VXDA 2DI3A 4N9HA 2KISA 3CTAA 4OIRF 3LA2A 3LOCA 1IRXA 1XCVA 2Q2EB 3I71A 2WBMA 4DBQA 3BPXA 3PIPF 1T0FC 3ZMUA 1S5LC 2WA0A 1JHFA 2PJPA 4UVCA 5LEJA 1Z7UA 2F6CA 4L9JA 2BY1A 1HKQA 3CDIA 1ON2A 1N25A 2QEXI 5GAEJ 2M4GA 4LITA 3L2RA 1B8IB 3BZKA 3DLLF 2OQGA 2CUFA 3JCUC 1E3OC 4RB0A 4JX5A 3E6BA 2EFPA 2FE3A 1W4MA 2P7CB 3GLLA 2GBYA 3KEOA 4QWQA 5LHGA 2O8KA 5D8KB 3MZHA 1LFPA 1JXSA 3IUOA 1EA3A 4UV8A 2X85A 1HXDA 2RDPA 3GZNB 3KZIC 4NHJA 1RESA 1T95A 3CF5F 3GTPJ 2XASA 1WJCA 2R7TA 3F22A 2OA4A 3ERMA 5EZHA 1X2NA 4KMUX 4BY7J 3BR1A 1S7AA 3CQZJ 5DEQA 3GXOA 3QPLA 3T8TA 5E3MA 2P8TA 3FKJA 2XPVA 2CU7A 1VQPI 2YS9A 5BQTA 4LIVA 2JTVA 4MNUA 4XSZF 3CP8A 4I6ZA 4DQ2A 2X6OA 5EGOB 4BDYA 1ETOA 3GLXA 2DJNA 3A02A 4CZZA 1XS9A 3MKZA 2FU4A 4PJ0C 5FLMJ 3CCYA 1K78B 2RVCA 4XLEA 2DJIA 2H94A 4JQFA 2IT0A 3P9KA 3HC7A 2GIVA 4E7LA 5DD8A 1O3QA 2A6TA 1AA7A 2YUSA 4ZDPA 2XV4S 4HNVA 1VQ6I 3DTKA 4MIMA 4XKWA 1U5TB 2LBFA 3L1PA 3REOA 5D5VB 3SEZA 1EH8A 1IRGA 1OISA 1OR7A 2DA3A 2XF5A 2H09A 1ZARA 3KZZA 3LSHA 3K2AA 1BC7C 1FBUA 2FQ4A 3CP2A 1QA6A 1TT0A 4Q48A 3GTJJ 1VQ7I 3A0BC 3ZQCA 4A3LJ 4A6DA 5FLXZ 1MBKA 2ZMEC 3ZQGA 2KIQA 4EM0B 3HRSA 2MC3A 2J5OA 3HTUA 5BPIA 3I64A 2EK5A 3HUGB 4FT8A 4E7ZA 2ESHA 3OOUA 2QM3A 2KFDA 3KYDB 4XM3A 1SD6A 4EEFG 3LSGA 4U0WA 1B1BA 1G3WA 3O8GA 5EEHA 4G94A 4IZZA 2CV2A 1E0EA 1X4OA 1A31A 2KRHA 3S3OA 3SQNA 2QSHX 1DQUA 3BC8A 2VKHA 3TO6A 3HM5A 3GZ6A 3VODA 3CC2I 2OQRA 2NVXJ 2GLOA 1FP2A 4E7JA 1V55H 2DA7A 2R7SA 1YIOA 1VQ5I 3QYFA 5JHFA 1OYIA 1SVMA 5CVIA 2VPRA 4HEA2 3H92A 4JX4A 4R1HA 3K70D 3G73A 2ZB9A 2HEOA 4RAGA 5ERIA 2HTJA 3BTCA 3FBNB 3I9V2 2KRFA 5EG0B 5AIQA 2E1OA 3KP4A 1R4NB 1MNMC 1USSA 3F8BA 4E7KA 1HW5A 2HGCA 2D1HA 1BOAA 5LHIA 4D5FA 3ZMDA 3HOYJ 5F04A 1RR8C 1AKHA 3L2WA 5JR3A 1JT0A 4NQWA 4P9UA 2UXNA 2DT5A 4HLYA 1JUPA 1BR1A 1QNTA 4LOCA 1QZYA 5KAIC 4CCMA 4YIRX 2XAUA 3Q3SA 4Y17A 3F8FA 4HV5A 2VXZA 1GVJA 3CC7I 1FOXA 1Y1VJ 3QODA 3KP7A 1ZQ3P 2OZUA 3EUKL 3KIOA 5FO5A 4BDZA 2ECCA 3DU5A 4WCGA 3AFHA 2HVQA 3IHUA 1X1BA 3RKYA 3SDGA 5EG0A 4DYQA 3WTSC 5HLIA 4IVNA 2I10A 1W7PA 3OYDA 3O8HA 2MA3A 3DEUA 1JJ8C 3JREA 2QLZA 3CCMI 1LEAA 2F5EA 1KONA 5D6EA 1LKXA 4BS9A 1ZN2A 2E1MC 5CYVA 3QQAA 2WAQN 2VBWA 4RB3C 1GXQA 2STTA 4HX4A 1W1WE 4F55A 2XF6A 3QOEA 1BM9A 3B02A 5IP7J 1L3LA 3K10A 3S1QJ 3IL2A 3UKGA 1B72B 4PZJA 1J9IA 1FJLA 1BR2A 2UUZA 5F0CA 2QGUA 2R7WA 5EEAA 1S7OA 2VQLA 4ZYHA 2ISYA 1X1CA 2ELJA 3BTLA 4FETA 2XPUA 5H20A 1Y0UA 3HUGA 2DO7A 4FTHA 2OZ6A 1RETA 2E34A 4II2A 5DUKA 4BEHB 2CUZA 2K9QA 3BPVA 3CLOA 3K0LA 4CYCB 1Z6RA 3IP4B 4RLFA 1D3YA 1TZLA 2D1VA 2FX0A 2I5UA 3GVAA 3ZGKA 5IT3A 1MIJA 2QF7A 3L7WA 3PUBA 2EQRA 3AAFA 2HDCA 3W3CA 5E3NA 3S1NJ 2KP6A 3SZTA 4AU7A 3IV5A 1Y8QB 2F5FA 1KYZA 4L9VA 4DZJA 3CF2A 2LY2A 3IAS2 4O6JA 3FMSA 2NS0A 2DOEA 4OWRB 3I55I 4B44A 3FISA 1FP1D 4AIKA 2DFHA 1JHHA 2FMLA 4Y3OA 3ABKH 2Z2SB 2JVGA 2ZXHA 5H6RA 5HLTA 2L7KA 1T39A 4ZTFA 1BC8C 4OMYA 2E1NA 4LGWA 1UHSA 3NARA 3G71I 5JI6A 3G4SI 3S16J 1SVLA 2HI3A 2R7RA 4GGGA 2HOAA 4OINF 1Z91A 3LAJA 1Y1WJ 3I4NJ 1SD5A 1IXSB 1R6RA 1PDNC 5FLVA 1SFOJ 2WAQA 2Y0SA 3PFYA 4MQVA 1RRJA 2HPIA 3ZR8X 1IZ1A 4XQFA 1FTTA 1KA8A 2Q2EA 3QU3A 1NG7A 1NK3P 3ABTA 2ZSHB 1ZG5A 3OYBA 2ZO4A 4F93B 4NDLA 3BR6A 2L01A 1YE9A 3UNGC 5C4JJ 3S3NA 3HRTA 1TWGJ 1FX7A 1IG7A 4ZYEA 4LD5A 3F72A 5E3OA 3V7CA 1MJBA 3PO3J 2W82A 1ZGAA 4J00A 1J09A 3LSRA 4PFPA 5L3FA 1MSEC 1TNSA 3D5SC 1W36D 1G3TA 5C44J 2PJRA 1YYVA 3OV8A 3J7AY 4KUMA 3QP6A 4XMYA 1TWAJ 1RPWA 1ZK8A 1LE8A 1HDDC 1VFCA 2DT7B 4CCJA 2H6CA 4RDUA 3S2HJ 4PJNA 2R92J 1ULYA 3BROA 4NC7A 1DPUA 4RAYA 2P6SA 3HZJA 3AG2H 3MVPA 4NNJA 4M3DA 2O9LA 1UHMA 1O7LA 2R5YB 2CSOA 1WH5A 3FBIB 2F5DA 3G1OA 3K4BA 3K4CA 3LQRA 4YG2F 2A69F 2VBYA 4IHVA 3GUDA 2LG4A 1LFBA 1V4RA 2FD5A 3LAPA 2EIJH 4HF2A 2HYFA 1Z3XA 3WHCA 2L9RA 2LNBA 1XTAA 2CW8A 2Y48A 4AIDA 4BACA 1OLTA 2NNYA 2BVMA 3MFKA 4ENKA 2ID6A 4B09A 4L5IA 2HVRA 3CZ6A 2LKSA 4IHYA 3IAM2 3IH4A 3BLYA 2Z33A 1YJWI 3U2RA 1LJ9A 2BY3A 3WGHA 1HBXG 3G2BA 4UVBA 4A3JJ 2V9KA 3GW2A 2CQQA 2JA8J 1YRNA 2ETHA 2O8XA 4ESJA 3RKQA 2PFBA 2X1DA 3BG7A 3ROUA 1FYMA 2GOXB 4G7OF 3DPUA 2EILH 5KVRA 2K7LA 4BXUA 5E8IA 5B5EC 1AWCA 2EIMH 2JUCA 3S3MA 2ZFWA 4BE0A 3QPSA 2P5VA 5LD2C 2CW7A 2EA4A 3DTIA 2FOKA 3K4KA 3TBIA 5E8GA 3BWGA 1O57A 3A03A 3OSGA 2DT6A 3EUHC 2MD0A 3VYRB 2DPUA 3ZQHA 5TISC 1POGA 1RIOH 3D0SA 4LK1F 4E4HA 3VDXA 1HC8A 1D1BA 4FASD 2JT1A 4GXOA 4JX6A 3T5XA 1IF1A 2JUGA 2L2OA 2LMDA 2K3FA 2V9VA 4HX8A 4S04A 3L2UA 1OCPA 1YJ9I 4YRVA 3ZN0A 1JKQC 2NS8A 1SFXA 3HPGA 4CCNA 2IPQX 1RC9A 2F4MB 2TDXA 1P4WA 3E97A 3VSLA 2Y9ZA 2YU9J 2B9SA 4HA8A 1ZELA 2VJ4A 1W5CC 3CCEI 4IHSA 1T56A 2V6CA 3BTJA 4NBQA 3FZVA 3QAHA 4KN4X 3ZQFA 2BXYA 4Y13A 4B4CA 1MZBA 2PMZA 1Q1HA 2DOAA 1A5JA 1IRZA 5LRRA 2XRLA 4M74A 5J40A 3HOSA 4XK4A 3KCCA 1N75A 2FNPA 2QVOA 4CYDA 1DGRM 2A05A 2COBA 2EZKA 2G0EA 4I01A 2IS4A 3H5AA 4RM2A 1J2XA 1B72A 4CICA 1XSDA 1D0YA 2DN0A 1I27A 1ZAOA 3H3UA 1JGGA 2IGKA 1WZ2A 2M45A 4EJVA 4DW6A 2ZKZA 2L7ZA 3KP3A 2X6XA 5K7FA 4WWCA 2K9MA 2VJIA 4MFDA 2OPTA 4OOIA 3CCJI 2PBIA 4BE1A 2XIGA 4I0AA 5M3FJ 2DMPA 2Y9YA 2D5VA 4D7NA 2M4KA 1U8RA 1QZEA 3PSFA 2EFWA 5FB2A 2E71A 3MZYA 2JJ7A 4UB8C 3W6VA 5F0FA 3T1BA 3K2ZA 4EJOA 3RI4A 1I39A 2LSOA 2FA5A 1X4PA 1V5GA 4BQAA 4E6KG 2DOFA 3IWFA 3OIPA 2ADUA 4XKBA 4QPQA 2VI6A 1F5TA 2VASA 1P7JA 2KQRA 2L54A 4RA2A 2W1OA 1TQPA 1YITI 2VOOA 2ZXWH 3OR2C 1T33A 2CFXA 4LMYA 4GFBA 2EB7A 3DFGA 4E7SA 4PDKA 2RQPA 3H35A 4NUBA 4RB1A 2RN7A 3W6JB 5JVGF 2CMPA 1GHCA 1Y0NA 4CYCA 3E6CC 2CQKA 1JTXA 1G4DA 3CCVI 3CDHA 2CV1A 2P4WA 3FXRA 2E2IJ 2L7FP 2RAEA 5CQGA 1LDDA 2DODA 3ZOBA 3FXUA 1XSXA 5FRNA 2VQCA 3M1EA 4AYBA 3OYNA 4CSWA 1V5EA 1DP3A 1K79A 2X48A 1X1AA 2BOLA 5ILUA 5L3DA 3JRBA 1A6IA 2IBDA 1LPQA 1Z77A 2I8DA 3FMRA 5D6FA 4E70A 3GFIA 4RS8A 3K7AJ 2OC6A 3C1DA 2FMYA 4LK0F 3TEDA 3C3WA 1BA5A 1IW7F 1XMXA 2A61A 3WODF 1XD7A 2ACJA 4F52A 2R7FA 3EYYA 2HXIA 1Z67A 1DP7P 1QPMA 3I59B 2CS3A 1DPRA 2V1DA 2XB5A 2A5WA 4FE4A 2K9SA 2EV0A 2R93J 3OSFA 1PP7U 3DKWA 1QHHD 3A1YA 4ZYAA 1YHQI 4PGHA 4BXXJ 2GQQA 2HU9A 4LG3A 5EJCA 1BI2A 2FQ3A 3HYIA 2W48A 2Y30A 1D5YA 2L9VA 4B8XA 1KGSA 3SEQA 4BJ5C 5E1ZB 3U9GA 3WTYC 5FJ8J 1LEBA 1T08B 5ILVA 4E7HA 2E2JJ 3HOWJ 2XPWA 4GCVA 2Z9OA 3E5QA 3FM3A 3A0HC 5IOYA 2E7WA 3LSMA 5FKKA 5E20A 2EFOA 5ILSA 2EBIA 4CXFA 1JKRC 2HS5A 3WTWC 2M0CA 1H0MA 3JRHA 3MEXA 2OTJI 1WI9A 2P7VB 4EM2A 1ETVA 2DCEA 5HS9A 1ZGWA 2M8EA 3DBHB 3GF2A 5HODA 4L18B 1W7PB 3FXKA 2QSGX 3L09A 1RZ4A 1IDYA 3GZ5A 3OWTA 4I99C 3HL2A 1PUFB 1IJWC 2Q0OA 3DCFA 1YX3A 3RZOJ 2Z5UA 3U21A 2K4JA 3EYIA 3ASNH 3FK6A 2KDOA 3GCMA 4A2UA 1USTA 2X9DA 1X3UA 4UVAA 4F7ZA 1TQMA 1O3RA 1Z7LA 3MWMA 4Y33A 4I0BA 4HBLA 1Y8RB 2M8GX 3ABLH 4YFNF 1XSVA 3DP7A 2ZCWA 4PCQA 2C6YA 3K4JA 2DA4A 4DBRA 2HZDA 3LFKA 3I59A 2ZC2A 3S15J 3BR3A 1NG6A 5HNFA 4UUTA 1VQ4I 2Y2ZA 4Y4RA 2X4HA 1CQTA 1H89C 3JAMZ 2HKOA 4IX7A 1SD4A 1D0ZA 2LBFB 3JRDA 2Q8KA 2H1KA 2XVCA 1U3EM 1ERDA 2LREA 4MEYF 2W25A 5L3GA 3OYIA 3F9KA 5DUIA 1JTYA 1ORKA 4D0PA 3CJTB 2LP0A 3LSTA 1X19A 5BS6A 1X3ZB 3OYMA 1STZA 1OJLA 2JRMA 5K5QA 1ZRFA 4AM3A 1HQCA 1G2HA 1W5TA 2MGQA 1B6AA 2WY8Q 2XAFA 2BVLA 4MGRA 1IN7A 4WXHA 4R79A 1OQYA 4LG0A 4I02A 2IA2A 3U1KA 5ICGA 4FCYA 1Y6IA 3EUAA 1ETQA 2JN6A 5EZGA 4OAZA 4U88A 2NNNA 1YOVB 1U9NA 3QOPA 2WWYA 1BW6A 3HOVJ 3L9FA 4HF1A 4S0HB 2PX9A 4CA0A 3ASOH 3WU2C 4MTDA 3J80Z 1SMYF 3OL4A 2HQNA 1D0XA 1FSEA 3BG9A 4XL9A 1MH4A 3ESWB 3KFWX 2WV1A 3J81Z 2Z99A 4ETSA 1IUFA 3ZXSA 3BG3A 4IL6C 3SJMA 5EGOA 1YJNI 1PP8F 2IS1A 5FGMA 2HQ5A 4ZJZA 5KNLA 3Q0WA 3OY9A 3BJAA 4AC0A 4U87A 1IN4A 3K1MA 4BL0B 2BHYA 1BL0A 1RUOA 3TP3A 2IGMA 2LC2A 3FHZA 4C2MJ 3FWEA 1IN6A 2Z3YA 1U5TA 2VL8A 2QKLB 4P5OA 3GTKJ 2EWNA 2KIMA 4YEJA 3E5XA 1F1ZA 5LGTA 5IYBJ 3CCSI 2CFOA 2JPCA 2HOSA 2VB6A 3L2CA 1R23A 2XHKA 4GRIA 3ML6A 2YU3A 3RCOA 1K61A 5HOOA 2J5PA 4GYIA 4PJLA 4W97A 4OIPF 2E60A 2Y0SN 2LY9A 4WF2A 3DKYA 1BJZA 3K4NA 1F4KA 2IVMA 4UV9A 3HB9A 3OIOA 4V2FA 3DWLE 4AD9A 4C3IJ 1IDZA 3OYAA 1HKSA 4IHXA 3TKYA 4A3KJ 1MMNA 3FDYA 4H0EA 1LDJA 1I6XA 3TOBA 5LEKA 2IGOA 2PI0A 5EEGA 1U78A 2OCEA 1OYYA 2KPMA 3LFUA 5IPAA 1SAXA 2EFQA 2MLKA 1FBQA 2GWRA 1KU7A 3R61A 3LWFA 3PQJA 5FD5A 5M5YJ 2K3PA 1I50J 1BI0A 1XN7A 3CCRI 1QGPA 1GVDA 4ITVA 1TWCJ 3FIWA 2HYGD 1MBJA 1HW1A 2VQHA 2FEZA 2VQGA 2A68F 1XGSA 2G7HA 2O5RA 3HRMA 2AS5F 4L0YB 2XSJC 2M1BA 2ME0A 3ZMTA 1KYWA 1IUYA 2OV7A 2M7AA 1F9NA 1BIAA 1J5YA 2KIUA 1KU3A 2WAFA 4YIIA 1WSUA 2VJ5A 2XUBA 3GFMA 2UWMA 2XROA 1TT5B 1BIBA 3SYTA 2R5YA 2F5CA 3N97A 2IS6A 2VKEA 1OCTC 4XRMA 4RM3A 2QWWA 2QA4I 3PNVA 2BBYA 5J47A 1YRNB 1U9OA 2NRAC 1K7AA 3VYSB 3CJNA 5LHHA 2L7MP 5F08A 5L3BA 3KLNA 1YW7A 3H1CA 3I54A 3MKLA 3Q9SA 1VQLI 2KL4A 3U1DA 4UUVA 4CUGA 4Y7NJ 2ZXIA 1CF7B 1JE8A 2X1EA 5FKLA 4YIFA 3LA3A 3HRUA 5HNHA 1R5GA 3WGIA 4QPOA 3WE2A 2L9SA 2M34A 1FLIA 5C4XJ 3RYPA 1FMWA 5IP9J 4C3HJ 5F64A 1UMQA 2O3FA 3TMOA 1DU0A 1ETXA 4WX9A 3G3ZA 3LSPA 5HLGA 4P55A 1ZLKA 1PYVA 2R7DA 3M8FA 1H88C 2G7UA 4BKXA 2QSFX 4BUPA 2K02A 4MO7A 2FBIA 3WTVC 3H0DA 2P0WA 3PIOF 1E3HA 1SANA 4B43A 2OTLI 4M6YA 5ICFA 4UB6C 2OF7A 1H9GA 3TW7A 4EVIA 2MW8A 2M7BA 4XRSA 1KQ0A 3A2KA 1HSTA 2GM4A 2E35A 2TRTA 3ZPLA 1BBYA 3I3LA 2DA1A 4FQGA 3BJ6A 1MDMA 2M2EA 2MD5A 2R5ZB 4JP0A 1HOMA 4M71A 4DNCA 5IYCJ 3JRGA 1ZG1A 1TL8A 5CLSA 4G6DA 4D9JA 2HTSA 4KIFA 3OYCA 3DBRB 1FPQA 2XGXA 3CUOA 4ABZA 4IF4A 4L5EA 5L3EA 3PO2J 4I09A 4A3DJ 4XN0A 3N4MA 6PAXA 3SHFA 2E7XA 2KT0A 2OD5A 4PSWA 2E36A 3F21A 2MABA 3WG7H 3QWLA 5TJJA 3MKYB 5E79C 3PUFA 1HDPA 4UXNA 4JBAA 2R0QC 3S2DJ 3H5RA 1EH6A 3M9AA 4HAMA 2PJRB 5IYDJ 5J8FA 4U0YA 1WI3A 4M3GA 4GYGA 3TGNA 2P6TA 2M0MA 1YG2A 2ZJRF 3BQYA 2MLGA 3J7ZI 2R3SA 1YI2I 2FJ1A 2FRHA 3D5LA 3AG1H 3GBGA 1OCRH 1LVKA 2DTZA 4KYWA 2LH9A 4U7DA 1IV8A 1BI1A 2RC4A 2QBYB 3OYEA 3LNQA 3CO6C 4C3JJ 3I5UA 1Y39A 4FX0A 1DGWY 4L0ZB 3OYLA 4J19A 4F91B 2VT2A 2QUFA 1W0UA 2E1MB 2HR3A 2H1LA 3GMEA 5D4RA 1ZGJA 3DTEA 4HF0A 3COAC 5K7HA 2CQXA 1ON1A 5BPDA 2LVSA 1D1AA 4U0VA 2P5LC 4G7ZF 3HEFA 2YX4A 4IEJA 2VBXA 1EV7A 2VC1A 1FC3A 2NVQJ 2XAJA 4P9FA 4DYCA 5J4VA 3CC4I 3S1MJ 4UNOA 3HGYA 4XOPA 3IWZA 4KT6A 2VONA 1LNWA 2Y0MA 3HOXJ 4PK4A 4XSXF 3CESA 3M8JA 2ELKA 3IKTA 1TC3C 4X0GA 1TQIA 1B59A 4HDUA 4ZYDA 1Y56A 4XKCA 1Z1DA 3BTIA 3HHHA 4HV6A 4IRGA 3RKXA 1I1GA 1XDUA 1OCZH 4YELA 4RMNA 3C18A 3W2AA 3MAJA 2RREA 5LFAA 2YR2A 3F23A 3G6EI 3KYLA 3KE2A 1O3SA 4CHUA 2DFFA 1HF0A 3F8NA 4C30A 2FNAA 1TP4A 4WXCA 5CQEA 2FOWA 2PLYA 1ZTRA 3NAUA 5CJ9A 1P4AA 2W24A 1GV5A 3AG3H 1FIPA 2R7ZJ 1KQ8A 2FXAA 1P9QC 5D5UB 1AKHB 4E7IA 1UG0A 2W84A 2XDVA 1R5HA 3EPZA 2O61A 4JOMA 5FKMA 2GIZA 3C2HA 1OCCH 3V8LA 1OPCA 1S8NA 3RYRA 4MQ9F 3R4KA 5DS9A 2L02A 1VQ9I 3L2VA 2IA1A 3HG9A 2RQQA 2VJJA 4MEXF 1VQNI 4HSTA 1DUXC 3CUQA 3TL4X 2L5QA 1ZRCA 2BY0A 1YLFA 3RPUD 1TW2A 3DQVC 1FBSA 1R00A 2CH0A 4H4KC 2EZIA 4AVZA 4A3EJ 2QCOA 3DU6A 2R4GA 3WHBA 4M73A 1K4TA 2F4OB 3BOQA 3LL7A 3JW4A 2EFNA 2PMZN 4ZYGA 3F8CA 4KITB 3JTGA 2LKXA 4UUSA 1P6RA 3RZDJ 4NB5A 2W85A 3OL3A 2GXAA 4BEHA 3GO5A 3WTTC 3CMMA 3KZYA 1A35A 2YSRA 1YX5A 3ZN1A 1R1UA 3SDBA 2BZTA 2KZVA 2GOMA 4O3MA 1GXPA 1SEUA 2HXOA 3SFZA 1TLHB 4DGWB 1IN8A 3M1CA 5DCMB 2XRNA 1V5FA 1Q1VA 2R7UA 1T8IA 2F48A 4KN7X 1ZKGA 4AIJA 5JLXA 4HNTA 3OOPA 1ZLJA 3S14J 1ZHFA 1ZR2A 1BOBA 1R4MB 2NYXA 4DJAA 4EV0A 3VFZA 1D5VA 3E5UA 2Y75A 2CUEA 3KEYA 3HTSB 4BBRJ 4EGZA 1R7JA 2L4MA 3NWTA 4ESBA 2KJBA 3LSIA 3R6SA 1RNLA 4AVPA 2V26A 1MH3A 1IGNA 3N05A 5GADJ 2EA2A 3OIQA 3WTZA 2ELHA 4XLPF 3OR1C 4AUXA 4ZDLA 2XAHA 1BJAA 4RGUA 2K86A 5CPRB 3H0GJ 5JFRA 2G9WA 2VC0A 4I98B 4FX4A 3BCBA 3D1NI 1MJ9A 2IA0A 3O3KA 1K6OA 5BMZA 1DDNA 4Q4ZF 4ZDOA 1S72I 1MBEA 3KLOA 4IRIA 2H8WA 2K5CA 1YS6A 1F43A 2AXLA 2X1CA 1IXRC 2LY1A 1MKMA 2R7OA 5DCMA 2BV6A 5TGTA 1ITYA 3V7SA 3H3VK 1MJAA 3O2PE 2F4IA 4XBFA 2MBFA 3C2BA 5CVRA 4G12A 2VN2A 3FXJA 3HHGA 2CYYA 4A0ZA 1VF9A 2KDZA 1MW7A 5K5RA 2ZJPF 4G8XA 1GV2A 2X51A 5A2QZ 1S7EA 2MFZA 3DF8A 2K9LA 3M07A 4Y15A 1SAUA 2BGCA 4XLNF 2NOJB 2WV0A 1VQKI 4ENNA 1QU3A 1VTNC 2VBZA 4IOCF 1REPC 4M3EA 5DTDA 4AWXB 2LOOA 2PG4A 3JRFA 3E7LA 5FFZA 4HPQA 1XX5A 3TP0A 5EDNA 2FBHA 2A3SA 3T0YA 2LF7A 2UXXA 4Y52J 4XNFA 3W2VA 1LDKB 3SZPA 1WFXA 2HKXA 2LR8A 2VKVA 3KX2A 2NAZA 4UY8I 1FOYA 1XMAA 3RJPA 4KISA 4PJMA 3GTLJ 1XMKA 2E19A 5B66C 4IO9F 4BHPA 1N77A 1UJ8A 1HKTA 3K69A 2XGEA 3VEPA 2KIFA 1IC8A 1G59A 4A69C 2DK8A 3JRCA 4YFKF 2HYJA 5E3LA 2ME6A 3NWSA 2O03A 3QYBA 3S8PA 2E2HJ 2V1XA 4EMSA 4RB2C 2RGVA 2H6BA 2E5ZA 3LSKA 2ID3A 3OMYA 4XLHA 4O5VA 2CQNA 2JVHA 1MD0A 2W57A 2EV6A 5FFXA 1QRYA 2NVYJ 3FXLA 5KHDA 3FKIJ 5F1RA 1MNEA 3JAMK 5GAHJ 3DLAA 4Z6YA 4U7BA 5IOZA 3CJRB 5HDNA 3PQKA 2RNJA 1FTZA 3BG6A 4IJAA 3S17J 2NVUB 4HDVA 2PMUA 4QTRA 4QLCU 2VKDA 5IT9K 4DZPA 3I0TA 3CO7C 1WJ5A 1U6GA 1WJEA 3KEQA 4XONA 4ZTJA 2ZFUA 1JJ6C 3HOUJ 2AO9A 4M9ZA 1WJBA 4BBSJ 2LKPA 4A12A 5DYMA 5GPCA 1S29A 1OYWA 3DPTA 4Z2YA 4OIOF 4A3FJ 4K2EA 2QYOA 4KIGA 2OUMA 4WK8F 2EINH 3WG9A 3F6OA 2JA7J 2R5ZA 2M87A 3I53A 4V19K 4N4NB 1SMTA 4I2OA 2IXSA 2HOTA 4M6XA 3H36A 3JR9A 4BQQA 1QPIA 1P7IA 4DIQA 2JSPA 3HKZA 2KMUA 3H9JA 5LBQA 2HOEA 4A6EA 2ZNZA 3E1SA 4KT5C 5EYRA 1B9MA 5CVVA 3ERED 3R0AA 2V6EA 1S6LA 3GTGJ 5TRDA 3VWBA 5FROA 5FLXK 3PJRA 3ZCOA 3B6AA 3IH2A 2Y69H 3V7RA 3BR0A 3KETA 2L4AA 2L9NA 3Q0VA 3M3YJ 3WTUC 2W4SA 5K5OA 5DM7F 2MG4A 1NHAA 2P5KA 3ZQ7A 1IN5A 4YFXF 3CCUI 1RR7A 1SVOA 3LSJA 4ZH4F 2EZLA 1UAAA 3QU6A 1QO0D 1XB4A 4AIHA 4B48A 3K4LA 3HGGA 1ETWA 1PUEE 1LE8B 3DKXA 1CGPA 2V1UA 2WTEA 2ZNYA 1LQ1A 1T98A 3H9GA 1FWZA 2DA2A 4B47A 2UZKA 2XGCA 3OYGA 1QHGA 1R9TJ 1SFEA 1TTYA 5F0HA 1ZG3A 2GZWA 2L0KA 2LK2A 1U5TC 4QIWN 3GWZA 4FISA 2IRFG 3EDPA 2HDDA 3BY6A 4XLFA 2DFIA 2PN6A 3FXMA 1XC5A 1AU7A 2W00A 5JLWA 3AL0C 3IH3A 1JUSA 1IO2A 1G6NA 2K27A 3I58A 3GTOJ 2GA1A 1RI7A 2X0LA 5J1YA 3CCQI 5E17F 4FE7A 2BHZA 1BW5A 5HS7A 2JPBA 1APLC 4XICA 1MSFC 1XDSA 1XGMA 4DYRA 3ZP5A 1D1CA 2COMA 4RAZA 1N78A 1A04A 1P92A 5K7ZA 1R1VA 4G6QA 1H9TA 2MSYA 1R36A 5JVTA 4RBOA 1SFUA 2X6WA 4IQJA 4GO1A 1JI8A 1J0RA 3VSKA 1VZ0A 2K4BA 3I4MJ 2ICWG 3M7GA 1YS7A 2NOGA 1ZRDA 4ESFA 3K70C 2VE9A 4A0YA 1MMSA 2JRTA 2AHQA 2WAEA 2VODA 4ASNA 3R0JA 4C9YA 2FSWA 5FKOA 3MCZA 1A6QA 3DEWA 1ZH5A 1OR7C 3CDLA 1T0FA 4NC6A 3HSEA 1T2KA 1U2WA 2AXTC 3EETA 1C0WA 1R5ID 1MBGA 3EQLF 1FYLA 5IY5H 1VI0A 5IP6A 2V4JC 1NK2P 2BEOA 3CLQA 2VIXA 4HNUA 2HZTA 2IP2A 1OCOH 2VLAA 2F5VA 2QQ8A 1W36C 3GTMJ 2OJED 1YIJI 2AQEA 2ZMEA 4XR6A 3R60A 3HSFA 4NC8A 4RGXA 1YFHA 5L3CA 4BJ6C 1ONVA 3FM5A 3E0JB 1MBFA 5ICEA 4LB6B 2O0YA 1WWXA 1X1PA 4HSRA 3M4OJ 2LFBA 4B3XA 3OS2A 2DLLA 3IRRA 3CMYA 2DXIA 1J59A 2IEKA 5D4SA 2JA5J 3RKWA 3B6CA 1JUMA 3DPLC 3ECOA 3CMAI 4BE2A 1XPXA 1AHDP 4EM1A 1MMGA 1X1DA 4BU2A 4F92B 9ANTA 1FOKA 1IXCA 2LDUA 1IAWA 2CG4A 3GFLA 4LLGF 3V4GA 1FNNA 2DYSH 1OMIA 2CV0A 1FEXA 2DQLA 1LB2A 4OU0A 5J1RA 2XSDC 4L9NA 2ECBA 2OBPA 4M9XA 4RGSA 3SFIA 3X2QH 1GLNA 3ZQLA 4EQQA 4IQ4A 3GTQJ 2BYVE 1XCBA 3KPHA 3ZMZA 2N8GA 4BQNA 2W7NA 3L2QA 1Z3YA 4XOTA 3OYKA 1U0JA 1MBHA 3ECHA 4LFUA 1IV6A 2KHMA 3K9TA 1AOYA 4XLAA 5M5WJ 3OYHA 4W1UA 1HCRA 5DCFA 1EH7A 5DM6F 4ENJA 5HVQC 1V54H 5B1BH 3TOAA 4HG2A 1ZYRF 1WCMJ 2XB0X 1SFKA 3QRFF 4ZZLA 3I56I 2A5YB 3ABUA 3M8EA 1WRJA 5GAGJ 1RUNA 1KQ9A 4KICA 3F0CA 3HOZJ 3HIFA 1K83J 1Z0XA 1R71A 2E5NA 3PL8A 1LVAA 2KLOA 2WC2A 3O6BB 4C2UA 4HRIA 4M3BA 4R8HA 4N0BA 3WTXC 1R1TA 4XIDA 3QP5A 1VQOI 1A36A 3FX3A 3FHNA 2HPMA 3S32A 2H8RA 2QQ9A 1SC7A 4XRSG 3C7JA 2UV1A 4P1WA 3BP8A 3CCLI 5HS8A 1YTYA 2V79A 4IHTA 3VPRA 4CH7A 2RV8A 2GXBA 4LJZF 4BHCA 5B1AH 5FKNA 4N9IA 2MH9A 3HPHA 5AONA 1TWFJ 4MFEA 2LRDA 2M30A 4BHBA 2Y31A 4ZC3A 1PUFA 2JQ7A 4X1EA 1FYKA 4KIBA 4EJWA 5GP9A 3PNTA 4LLLA 4IHWA 2JMWA 3BR5A 2HQAA 3KP6A 1T6SA 4LG0B 1K6YA 2ISZA 4A0XA 3K1PA 1BR4A 2B63J 5H2FC 3EUHA 4A3MJ 5EF6A 5IT9Z 3VB2A 4XN3A 4HOBA 4MLOA 1O7FA 1W5SA 2XC7A 2HWVA 1UHWA 4PGGA 3OYJA 2IJLA 2NVTJ 3KYCB 2DYRH 2KZGA 3H5NA 3JTHA 3MKWB 3HKZN 4Q47A 3J81K 5A2QK 4NQWB
chains in the Genus database with same CATH topology
2R93J 3OSFA 3OOUA 4BY1J 4EEFG 3LSGA 4BXXJ 4A3BJ 1W0TA 3O8GA 1RKWA 1QVTA 2DMUA 2W48A 2HXOA 3FK7A 2Y30A 1D5YA 2EZHA 1Q1VA 2LLKA 5FJ8J 1WH7A 5J3LA 1ZKGA 2E2JJ 2JK3A 3HOWJ 5JLXA 2XPWA 3HM5A 3S14J 5IOYA 2NVXJ 1ZR2A 2GLOA 5FKKA 2DA7A 2DA6A 1OFCX 2EBIA 1JKRC 2M0CA 5M3MJ 3RQIA 2CUEA 3JRHA 2VPRA 4JX4A 4BBRJ 2ZB9A 1ETVA 4V2GA 1ZGWA 2VUMJ 5HODA 3BTCA 1FIAA 1MH3A 1IDYA 5EG0B 1IGNA 2E1OA 1MNMC 1PUFB 1IJWC 3DCFA 3RZOJ 4A3CJ 4AUXA 3FK6A 3H0GJ 2X9DA 4D5FA 4M6VA 3HOYJ 5F04A 3D1NI 2P81A 1AKHA 1DU6A 2M8GX 1JT0A 1JUPA 4LOCA 2DA4A 3Q3SA 1MBEA 3S15J 3BR3A 1F43A 1Y1VJ 1GT0C 1ITYA 1ZQ3P 4UUTA 1H8AC 3H3VK 1HLVA 3S1RJ 2ECCA 1O4XA 2Y2ZA 3C2BA 1CQTA 1H89C 4G12A 3SDGA 3MN2A 5EG0A 3JRDA 1VF9A 2KDZA 4DYQA 1GV2A 2H1KA 2I10A 1S7EA 3O8HA 1RKTA 4I76A 1GUUA 3BT9A 1JJ8C 3JREA 4UUSB 1JTYA 1ORKA 2LP0A 3Q0UA 1JT6A 1OJLA 1G2HA 4M3EA 5DTDA 3QQAA 2MGQA 2WAQN 3JRFA 3E7LA 1F36A 5EDNA 3TP0A 4Y52J 1ETYA 2LR8A 2VKVA 5IP7J 4FCYA 1ETQA 2JN6A 3UKGA 3S1QJ 5EZGA 2DMTA 1B72B 1U9NA 3GTLJ 2E19A 1FJLA 1BW6A 3PM1A 1LFUP 3HOVJ 5F0CA 4S0HB 2XGEA 5EEAA 2DMQA 1IC8A 4A69C 3BTLA 3HDDA 3JRCA 3BG9A 2XPUA 1I6HJ 1MH4A 2HYJA 2WV1A 4FTHA 1RETA 5E3LA 1IUFA 2WB1N 2ME6A 3ZQIA 2K9QA 3BG3A 3SJMA 4CYCB 5EGOA 2E2HJ 1JKOC 2HQ5A 2ID3A 2FX0A 3Q0WA 1QRYA 2QF7A 4AC0A 2NVYJ 3FKIJ 2EQRA 1BL0A 5E3NA 3S1NJ 3TP3A 3IV5A 5IOZA 4C2MJ 1B8IA 1I3QJ 1FTZA 4DZJA 3S17J 4X6AJ 3GTKJ 2XGDA 4QTRA 3FISA 5F27A 1TWHJ 4DZPA 5IYBJ 2HOSA 2JA6J 1JJ6C 3HOUJ 2AO9A 1K61A 2M9HA 4A3GJ 4W97A 1NTCA 4BBSJ 2Y0SN 2LY9A 1BJZA 5GPCA 1ZR4A 3HB9A 3OIOA 4A3FJ 4V2FA 2JWTA 4C3IJ 1IDZA 4IHXA 1UHSA 3NARA 4A3KJ 2DA5A 2JA7J 3S16J 2HI3A 2R5ZA 1U78A 2EH3A 5IPAA 2HOAA 1Y1WJ 3I4NJ 5FLVA 2HOTA 1SFOJ 5M5YJ 3JR9A 1I50J 1QPIA 1VNDA 1P7IA 1FTTA 1GVDA 4B3AA 1TWCJ 1NK3P 3FIWA 1MBJA 5EYRA 4JYKA 4NDLA 3BR6A 3GTGJ 5C4JJ 2ME0A 4A93J 1TWGJ 1XG1A 1IG7A 4D5CA 5E3OA 3PO3J 3B6AA 3LSRA 3IH2A 1WGXA 3BR0A 3G1MA 1MSEC 3Q0VA 2R5YA 3M3YJ 2VKEA 1OCTC 4XRMA 5C44J 2MG4A 4D7MA 1RR7A 3LSJA 1ENHA 1TWAJ 1RPWA 1ZK8A 2EZLA 1LE8A 1VFCA 1HDDC 1YRNB 1U9OA 2LTPA 4RDUA 3HGGA 1ETWA 2L7MP 1LE8B 3S2HJ 4M3FA 5F08A 2R92J 3HBLA 3MKLA 1X2MA 3MVPA 2O9LA 4M3DA 1WPKA 1X58A 2DA2A 2XGCA 1R9TJ 2R5YB 5F0HA 1WH5A 3G1OA 4Y7NJ 2L0KA 2LK2A 4IHVA 2CJJA 5BNGA 4QIWN 1LFBA 4FISA 2FD5A 5FKLA 2CRGA 5GPAA 2HDDA 3WHCA 2L9RA 4A3IJ 2TCTA 1XC5A 2M34A 2NS7A 1AU7A 5C4XJ 5JLWA 2IAIA 3IH3A 5IP9J 2ID6A 1JUSA 4C3HJ 1EF4A 1UMQA 1DU0A 1ETXA 3GTOJ 3LSPA 5J1YA 4FE7A 1H88C 1BW5A 3BR2A 4BKXA 4IHYA 3A01B 1APLC 4XICA 1MSFC 3IH4A 4MO7A 4DYRA 1ETKA 2DMNA 1JKPC 1SANA 3BQZA 5K7ZA 4A3JJ 2OF7A 3TW7A 2CQQA 2MW8A 2JA8J 2MSYA 4XRSA 1YRNA 4RBOA 2GM4A 3JRAA 2TRTA 3RKQA 1U8BA 2DA1A 4QSHA 2M2EA 5F1JA 2R5ZB 4JP0A 5M5XJ 1HOMA 5IYCJ 1GDTA 3JRGA 2K40A 3I4MJ 2NOGA 2AHQA 4ABZA 5C3EJ 4L5EA 3PO2J 5FKOA 3QPSA 3DEWA 4A3DJ 3CDLA 3TW6A 4AYBN 3A03A 3G1LA 3OSGA 2KT0A 1MBGA 3ZQHA 1POGA 1VI0A 5IP6A 1NK2P 1HDPA 2R0QC 3S2DJ 4JX6A 3GTMJ 5IYDJ 1WI3A 1QVUA 3A01A 2K9NA 4M3GA 1OCPA 2O7OA 1JKQC 2NS8A 3BQYA 3JRIA 2FJ1A 2LD5A 1MBFA 5J1UA 3GBGA 3BG5A 2YU9J 2Y9ZA 3M4OJ 2LFBA 2DTZA 4B1RA 1UG2A 1T56A 3BTJA 3CMYA 2IEKA 3ZQFA 2JA5J 3B6CA 1JUMA 3LNQA 1AHDP 4B4CA 4C3JJ 9ANTA 1A5JA 1IRZA 3LOCA 2XRLA 4XK4A 4J19A 1W0UA 1FEXA 5J1RA 2XSDC 2COBA 2ECBA 2EZKA 3SFIA 3ZQLA 5K7HA 2CQXA 2G0EA 2LVSA 3GTQJ 1B72A 3HEFA 2DN0A 2N8GA 1JGGA 4IEJA 4DW6A 2L7ZA 2NVQJ 1MBHA 1IV6A 1B8IB 4DYCA 5M5WJ 5K7FA 4W1UA 1HCRA 3S1MJ 2CUFA 3HGYA 2OPTA 4MFDA 1E3OC 4JX5A 2D5VA 5M3FJ 2DMPA 2Y9YA 4D7NA 2GBYA 2O8KA 3HOXJ 1WCMJ 2XB0X 2ELKA 1TC3C 2JJ7A 3W6VA 1RESA 5F0FA 3GTPJ 3F0CA 3HOZJ 3BTIA 1K83J 1Z0XA 2VI6A 5EZHA 1X2NA 1P7JA 4BY7J 4M3BA 3BR1A 3CQZJ 1T33A 3QPLA 4XIDA 4GFBA 5E3MA 2XPVA 2CU7A 1HF0A 2YS9A 2H8RA 4XRSG 4I6ZA 1ZTRA 3NAUA 2X6OA 1GV5A 5EGOB 1ETOA 4CYCA 2DJNA 3A02A 1FIPA 1XS9A 2R7ZJ 1JTXA 3VPRA 5FLMJ 1AKHB 2E2IJ 2L7FP 2RAEA 3CCYA 5FKNA 5FKMA 3ZOBA 1TWFJ 4MFEA 2Y31A 1PUFA 2X48A 5DS9A 4X1EA 3JRBA 2YUSA 4HNVA 5GP9A 1A6IA 4MIMA 2IBDA 2JMWA 3BR5A 3L1PA 4IHWA 1Z77A 2DA3A 2B63J 4A3MJ 5EF6A 3K7AJ 2EZIA 4MLOA 3TEDA 4A3EJ 2QCOA 3K2AA 1BA5A 2FQ4A 3WHBA 3GTJJ 2HXIA 2NVTJ 3ZQCA 4A3LJ 2XB5A 2PMZN 1MBKA 3HKZN 3ZQGA 2LKXA 4FE4A 2K9SA 4UUSA 3RZDJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R93 J;  3OSF A;  3OOU A;  4BY1 J;  4EEF G;  3LSG A;  4BXX J;  4A3B J;  1W0T A;  3O8G A;  1RKW A;  1QVT A;  2DMU A;  2W48 A;  2HXO A;  3FK7 A;  2Y30 A;  1D5Y A;  2EZH A;  1Q1V A;  2LLK A;  5FJ8 J;  1WH7 A;  5J3L A;  1ZKG A;  2E2J J;  2JK3 A;  3HOW J;  5JLX A;  2XPW A;  3HM5 A;  3S14 J;  5IOY A;  2NVX J;  1ZR2 A;  2GLO A;  5FKK A;  2DA7 A;  2DA6 A;  1OFC X;  2EBI A;  1JKR C;  2M0C A;  5M3M J;  3RQI A;  2CUE A;  3JRH A;  2VPR A;  4JX4 A;  4BBR J;  2ZB9 A;  1ETV A;  4V2G A;  1ZGW A;  2VUM J;  5HOD A;  3BTC A;  1FIA A;  1MH3 A;  1IDY A;  5EG0 B;  1IGN A;  2E1O A;  1MNM C;  1PUF B;  1IJW C;  3DCF A;  3RZO J;  4A3C J;  4AUX A;  3FK6 A;  3H0G J;  2X9D A;  4D5F A;  4M6V A;  3HOY J;  5F04 A;  3D1N I;  2P81 A;  1AKH A;  1DU6 A;  2M8G X;  1JT0 A;  1JUP A;  4LOC A;  2DA4 A;  3Q3S A;  1MBE A;  3S15 J;  3BR3 A;  1F43 A;  1Y1V J;  1GT0 C;  1ITY A;  1ZQ3 P;  4UUT A;  1H8A C;  3H3V K;  1HLV A;  3S1R J;  2ECC A;  1O4X A;  2Y2Z A;  3C2B A;  1CQT A;  1H89 C;  4G12 A;  3SDG A;  3MN2 A;  5EG0 A;  3JRD A;  1VF9 A;  2KDZ A;  4DYQ A;  1GV2 A;  2H1K A;  2I10 A;  1S7E A;  3O8H A;  1RKT A;  4I76 A;  1GUU A;  3BT9 A;  1JJ8 C;  3JRE A;  4UUS B;  1JTY A;  1ORK A;  2LP0 A;  3Q0U A;  1JT6 A;  1OJL A;  1G2H A;  4M3E A;  5DTD A;  3QQA A;  2MGQ A;  2WAQ N;  3JRF A;  3E7L A;  1F36 A;  5EDN A;  3TP0 A;  4Y52 J;  1ETY A;  2LR8 A;  2VKV A;  5IP7 J;  4FCY A;  1ETQ A;  2JN6 A;  3UKG A;  3S1Q J;  5EZG A;  2DMT A;  1B72 B;  1U9N A;  3GTL J;  2E19 A;  1FJL A;  1BW6 A;  3PM1 A;  1LFU P;  3HOV J;  5F0C A;  4S0H B;  2XGE A;  5EEA A;  2DMQ A;  1IC8 A;  4A69 C;  3BTL A;  3HDD A;  3JRC A;  3BG9 A;  2XPU A;  1I6H J;  1MH4 A;  2HYJ A;  2WV1 A;  4FTH A;  1RET A;  5E3L A;  1IUF A;  2WB1 N;  2ME6 A;  3ZQI A;  2K9Q A;  3BG3 A;  3SJM A;  4CYC B;  5EGO A;  2E2H J;  1JKO C;  2HQ5 A;  2ID3 A;  2FX0 A;  3Q0W A;  1QRY A;  2QF7 A;  4AC0 A;  2NVY J;  3FKI J;  2EQR A;  1BL0 A;  5E3N A;  3S1N J;  3TP3 A;  3IV5 A;  5IOZ A;  4C2M J;  1B8I A;  1I3Q J;  1FTZ A;  4DZJ A;  3S17 J;  4X6A J;  3GTK J;  2XGD A;  4QTR A;  3FIS A;  5F27 A;  1TWH J;  4DZP A;  5IYB J;  2HOS A;  2JA6 J;  1JJ6 C;  3HOU J;  2AO9 A;  1K61 A;  2M9H A;  4A3G J;  4W97 A;  1NTC A;  4BBS J;  2Y0S N;  2LY9 A;  1BJZ A;  5GPC A;  1ZR4 A;  3HB9 A;  3OIO A;  4A3F J;  4V2F A;  2JWT A;  4C3I J;  1IDZ A;  4IHX A;  1UHS A;  3NAR A;  4A3K J;  2DA5 A;  2JA7 J;  3S16 J;  2HI3 A;  2R5Z A;  1U78 A;  2EH3 A;  5IPA A;  2HOA A;  1Y1W J;  3I4N J;  5FLV A;  2HOT A;  1SFO J;  5M5Y J;  3JR9 A;  1I50 J;  1QPI A;  1VND A;  1P7I A;  1FTT A;  1GVD A;  4B3A A;  1TWC J;  1NK3 P;  3FIW A;  1MBJ A;  5EYR A;  4JYK A;  4NDL A;  3BR6 A;  3GTG J;  5C4J J;  2ME0 A;  4A93 J;  1TWG J;  1XG1 A;  1IG7 A;  4D5C A;  5E3O A;  3PO3 J;  3B6A A;  3LSR A;  3IH2 A;  1WGX A;  3BR0 A;  3G1M A;  1MSE C;  3Q0V A;  2R5Y A;  3M3Y J;  2VKE A;  1OCT C;  4XRM A;  5C44 J;  2MG4 A;  4D7M A;  1RR7 A;  3LSJ A;  1ENH A;  1TWA J;  1RPW A;  1ZK8 A;  2EZL A;  1LE8 A;  1VFC A;  1HDD C;  1YRN B;  1U9O A;  2LTP A;  4RDU A;  3HGG A;  1ETW A;  2L7M P;  1LE8 B;  3S2H J;  4M3F A;  5F08 A;  2R92 J;  3HBL A;  3MKL A;  1X2M A;  3MVP A;  2O9L A;  4M3D A;  1WPK A;  1X58 A;  2DA2 A;  2XGC A;  1R9T J;  2R5Y B;  5F0H A;  1WH5 A;  3G1O A;  4Y7N J;  2L0K A;  2LK2 A;  4IHV A;  2CJJ A;  5BNG A;  4QIW N;  1LFB A;  4FIS A;  2FD5 A;  5FKL A;  2CRG A;  5GPA A;  2HDD A;  3WHC A;  2L9R A;  4A3I J;  2TCT A;  1XC5 A;  2M34 A;  2NS7 A;  1AU7 A;  5C4X J;  5JLW A;  2IAI A;  3IH3 A;  5IP9 J;  2ID6 A;  1JUS A;  4C3H J;  1EF4 A;  1UMQ A;  1DU0 A;  1ETX A;  3GTO J;  3LSP A;  5J1Y A;  4FE7 A;  1H88 C;  1BW5 A;  3BR2 A;  4BKX A;  4IHY A;  3A01 B;  1APL C;  4XIC A;  1MSF C;  3IH4 A;  4MO7 A;  4DYR A;  1ETK A;  2DMN A;  1JKP C;  1SAN A;  3BQZ A;  5K7Z A;  4A3J J;  2OF7 A;  3TW7 A;  2CQQ A;  2MW8 A;  2JA8 J;  2MSY A;  4XRS A;  1YRN A;  4RBO A;  2GM4 A;  3JRA A;  2TRT A;  3RKQ A;  1U8B A;  2DA1 A;  4QSH A;  2M2E A;  5F1J A;  2R5Z B;  4JP0 A;  5M5X J;  1HOM A;  5IYC J;  1GDT A;  3JRG A;  2K40 A;  3I4M J;  2NOG A;  2AHQ A;  4ABZ A;  5C3E J;  4L5E A;  3PO2 J;  5FKO A;  3QPS A;  3DEW A;  4A3D J;  3CDL A;  3TW6 A;  4AYB N;  3A03 A;  3G1L A;  3OSG A;  2KT0 A;  1MBG A;  3ZQH A;  1POG A;  1VI0 A;  5IP6 A;  1NK2 P;  1HDP A;  2R0Q C;  3S2D J;  4JX6 A;  3GTM J;  5IYD J;  1WI3 A;  1QVU A;  3A01 A;  2K9N A;  4M3G A;  1OCP A;  2O7O A;  1JKQ C;  2NS8 A;  3BQY A;  3JRI A;  2FJ1 A;  2LD5 A;  1MBF A;  5J1U A;  3GBG A;  3BG5 A;  2YU9 J;  2Y9Z A;  3M4O J;  2LFB A;  2DTZ A;  4B1R A;  1UG2 A;  1T56 A;  3BTJ A;  3CMY A;  2IEK A;  3ZQF A;  2JA5 J;  3B6C A;  1JUM A;  3LNQ A;  1AHD P;  4B4C A;  4C3J J;  9ANT A;  1A5J A;  1IRZ A;  3LOC A;  2XRL A;  4XK4 A;  4J19 A;  1W0U A;  1FEX A;  5J1R A;  2XSD C;  2COB A;  2ECB A;  2EZK A;  3SFI A;  3ZQL A;  5K7H A;  2CQX A;  2G0E A;  2LVS A;  3GTQ J;  1B72 A;  3HEF A;  2DN0 A;  2N8G A;  1JGG A;  4IEJ A;  4DW6 A;  2L7Z A;  2NVQ J;  1MBH A;  1IV6 A;  1B8I B;  4DYC A;  5M5W J;  5K7F A;  4W1U A;  1HCR A;  3S1M J;  2CUF A;  3HGY A;  2OPT A;  4MFD A;  1E3O C;  4JX5 A;  2D5V A;  5M3F J;  2DMP A;  2Y9Y A;  4D7N A;  2GBY A;  2O8K A;  3HOX J;  1WCM J;  2XB0 X;  2ELK A;  1TC3 C;  2JJ7 A;  3W6V A;  1RES A;  5F0F A;  3GTP J;  3F0C A;  3HOZ J;  3BTI A;  1K83 J;  1Z0X A;  2VI6 A;  5EZH A;  1X2N A;  1P7J A;  4BY7 J;  4M3B A;  3BR1 A;  3CQZ J;  1T33 A;  3QPL A;  4XID A;  4GFB A;  5E3M A;  2XPV A;  2CU7 A;  1HF0 A;  2YS9 A;  2H8R A;  4XRS G;  4I6Z A;  1ZTR A;  3NAU A;  2X6O A;  1GV5 A;  5EGO B;  1ETO A;  4CYC A;  2DJN A;  3A02 A;  1FIP A;  1XS9 A;  2R7Z J;  1JTX A;  3VPR A;  5FLM J;  1AKH B;  2E2I J;  2L7F P;  2RAE A;  3CCY A;  5FKN A;  5FKM A;  3ZOB A;  1TWF J;  4MFE A;  2Y31 A;  1PUF A;  2X48 A;  5DS9 A;  4X1E A;  3JRB A;  2YUS A;  4HNV A;  5GP9 A;  1A6I A;  4MIM A;  2IBD A;  2JMW A;  3BR5 A;  3L1P A;  4IHW A;  1Z77 A;  2DA3 A;  2B63 J;  4A3M J;  5EF6 A;  3K7A J;  2EZI A;  4MLO A;  3TED A;  4A3E J;  2QCO A;  3K2A A;  1BA5 A;  2FQ4 A;  3WHB A;  3GTJ J;  2HXI A;  2NVT J;  3ZQC A;  4A3L J;  2XB5 A;  2PMZ N;  1MBK A;  3HKZ N;  3ZQG A;  2LKX A;  4FE4 A;  2K9S A;  4UUS A;  3RZD J; 
#chains in the Genus database with same CATH topology
 2LF8 A;  2BW3 B;  3H9Q A;  2EPF A;  5FRM A;  4BY1 J;  1D8J A;  3K6G A;  1WQ2 A;  2ZJQ F;  2A6E F;  4A3B J;  1W0T A;  1RKW A;  4BNC A;  2XKP A;  1QVT A;  2DMU A;  3FK7 A;  3ZQQ A;  1R58 A;  1MND A;  3LA7 A;  1KZH A;  2EZH A;  2YPR A;  2CGP A;  1M1E B;  2LLK A;  2CO5 A;  1WH7 A;  5CVJ A;  5J3L A;  2DFE A;  2X6Y A;  2IW5 A;  2JK3 A;  2DW4 A;  1P4X A;  1R22 A;  1TBX A;  3LQQ A;  2EJR A;  5DD4 A;  2DA6 A;  1OFC X;  2YX7 A;  3SZG A;  5JHU A;  1J75 A;  1BN5 A;  4HLX A;  2VT3 A;  3RQI A;  4EJU A;  5M3M J;  2O6G E;  1WHU A;  3J7Y J;  3CD6 I;  2EIK H;  2MC4 A;  3IC7 A;  3RSN A;  4F3Q A;  4BH9 A;  1FOW A;  3A4C A;  4V2G A;  3HOT A;  2R7X A;  2VUM J;  1MMA A;  3P7N A;  5LGU A;  1FIA A;  5GTH C;  4ZZD A;  3E6M A;  2JZY A;  5J8C A;  2KRC A;  1HA8 A;  2MYS A;  1B9N A;  2D45 A;  2R7V A;  1E17 A;  4A3C J;  3Q5F A;  3AL0 B;  4S05 A;  1WJA A;  4M6V A;  3ELK A;  3MZ8 A;  2DQR A;  1HW2 A;  4P96 A;  1UB9 A;  2P81 A;  3E3V A;  1DU6 A;  1WJD A;  2GA2 A;  5HDG A;  4PUS A;  4MTE A;  2BY2 A;  2FUG 2;  2WAD A;  3V8K A;  1GT0 C;  1K4S A;  1H8A C;  3DEE A;  2PQ8 A;  1HLV A;  2XAQ A;  3S1R J;  1O4X A;  3HSR A;  3Q9V A;  1ODD A;  4IKF A;  1J7K A;  3CUQ B;  2DAO A;  3MN2 A;  1Z21 A;  1JGS A;  2BW3 A;  1RKT A;  4I76 A;  4RAF A;  2QQA A;  1I5Z A;  1MMD A;  1GUU A;  3BT9 A;  4XRF A;  4UUS B;  2XAG A;  1OKR A;  3TQN A;  2A6H F;  3Q0U A;  3CJQ B;  1JT6 A;  3DV8 A;  4PFO A;  5KCM A;  4IOA F;  4A5M A;  3ZMV A;  1MGT A;  2WB1 A;  1F36 A;  2K85 A;  3K4M A;  3LMM A;  1FMV A;  4CGZ A;  5CVU A;  5DDG A;  1ETY A;  1QQI A;  4KJZ A;  5KK1 A;  3CUQ C;  1T38 A;  3HXL A;  4M72 A;  2CW0 F;  3GX4 X;  1TNT A;  5CKT A;  1QZZ A;  4OIQ F;  1ZRE A;  3JSO A;  1KU2 A;  2DMT A;  4BXF A;  2IS2 A;  3PM1 A;  1LFU P;  4TV7 A;  4LB5 A;  1SD7 A;  1WVR A;  4CZC A;  3CME I;  3RQ4 A;  4XKV A;  2DMQ A;  1PVE A;  2DTR A;  3FMQ A;  2VE8 A;  1TW3 A;  5K1Y A;  3F3X A;  1R49 A;  3HDD A;  3KP5 A;  3BZ6 A;  1KU9 A;  1I6H J;  3DBL B;  3NEU A;  2XF7 A;  2WB1 N;  2ZXJ A;  3WU1 B;  3ZQI A;  4G6T B;  2R7Q A;  4HQE A;  5ED4 A;  5DV5 A;  1JKO C;  2GXG A;  4FHT A;  4L5J A;  2LYC A;  3P5J A;  3QYE A;  2E1C A;  3ZRG A;  1Z6T A;  2Q1Z B;  4HQM A;  4XLC A;  4RLQ A;  5F6F A;  2XKO A;  2Z16 A;  2ZJ2 A;  2FBK A;  1B8I A;  1XGN A;  3L00 A;  1FY7 A;  4OMZ A;  1I3Q J;  3I4P A;  4BQO A;  2ZME B;  5B3S H;  2VOP A;  4CO8 A;  3B73 A;  4X6A J;  2XGD A;  2NXN B;  4IRH A;  5F27 A;  1TWH J;  2VPL A;  4I7H A;  2KJC A;  3OS0 A;  2B0L A;  2JA6 J;  2RNG A;  3RPQ A;  1UZC A;  2M9H A;  4A3G J;  1K78 A;  1NTC A;  2KKO A;  3PFI A;  3MD2 A;  4DOZ A;  1X3W B;  3C2G A;  1ZR4 A;  3K1N A;  5AIP A;  3GEZ A;  5GTI C;  3H3Z A;  2V1N A;  4Q5S F;  2JWT A;  4KDP A;  2DDB A;  2F2E A;  3WE3 A;  2RKH A;  3BZC A;  2HNH A;  5KAF C;  3RDI A;  1EKE A;  1S9H A;  2DA5 A;  3FXO A;  3BJO A;  3HJE A;  3GFJ A;  1IRF A;  2EH3 A;  4KA4 A;  5BOX A;  4KFC A;  2WY7 Q;  2CUJ A;  3MMY B;  3NRV A;  4A5N A;  5J6X A;  4XOR A;  4ENM A;  4EAT A;  1VND A;  3OYF A;  3ISP A;  2FF4 A;  1V3F A;  4BJT A;  4RGR A;  4B3A A;  1P2F A;  2QBY A;  5J4Y A;  2OU2 A;  2PEX A;  3FXQ A;  2HFH A;  3V8J A;  3AKZ A;  4JYK A;  1B4A A;  2Z1D A;  3AG4 H;  4JK1 X;  4D1Q A;  2DU9 A;  2L3D A;  3FF5 A;  2BXZ A;  1VQM I;  2D2W A;  4A93 J;  3RTR A;  4EJT A;  3P9C A;  2ZSI B;  4WXD A;  1XG1 A;  4D5C A;  3S2W A;  3JSP A;  3GYH X;  1I1S A;  1YW9 A;  4G7H F;  2CQ7 A;  3P9I A;  4N4O B;  1LUJ B;  1E2X A;  2HQR A;  4CCK A;  1WGX A;  5E18 F;  2V9P A;  3G1M A;  2EV5 A;  5LGN A;  5HDK A;  4ON0 A;  4C2T A;  3PSI A;  1WJF A;  4D7M A;  1UEL B;  2A07 F;  3RIR A;  3F6V A;  2OAZ A;  3ULQ B;  1ENH A;  4HZF A;  2HDW A;  3TDU C;  1ACI A;  4HYE A;  2LTP A;  2MH2 A;  4M3F A;  5FD6 A;  2JSC A;  3HBL A;  1BI3 A;  1X2M A;  1WPK A;  1X58 A;  1VQ8 I;  4GDF A;  2M3A A;  1E3P A;  2PMH A;  5LLQ A;  3W2W A;  2CJJ A;  2B7E A;  5BNG A;  3PNY A;  2STW A;  3RPU A;  2CRG A;  5GPA A;  5ICC A;  3IRQ A;  3ABM H;  2TCT A;  1PJR A;  4A3I J;  2NS7 A;  1FZP B;  1UFM A;  2IAI A;  4II3 A;  4CCO A;  3BCA A;  1EF4 A;  2QQB A;  4L9T A;  4ANJ A;  1CF7 A;  1G8X A;  1YW8 A;  1FSH A;  1G3Y A;  1W7P D;  3BR2 A;  3A01 B;  3KP2 A;  3UR3 C;  4LIU A;  1Z9C A;  3S93 A;  2DK5 A;  3NQO A;  1ETK A;  2HVS A;  2DMN A;  1JKP C;  3BQZ A;  3MQ0 A;  4BYY A;  3D5R C;  3T8R A;  4EGY A;  2IGN A;  2JA2 A;  5LRS A;  4HW0 A;  3BDD A;  3JRA A;  3ONQ A;  2QKM B;  3QPH A;  4QSH A;  1U8B A;  5F1J A;  3QPT A;  2QEN A;  3IKV A;  2H27 A;  2V7F A;  5M5X J;  4CCL A;  3VOE A;  1GDT A;  4M9S A;  2K40 A;  4UHT A;  4KNY A;  1FT9 A;  3ZMS A;  1S3J A;  1QBJ A;  2QZ8 A;  2ESN A;  4BAY A;  2DDA A;  5D8L B;  5D5W B;  1NH3 A;  5C3E J;  1YQA A;  2AQF A;  4IXA A;  3TW6 A;  1MDM B;  4PJJ A;  1G3S A;  4AYB N;  1Z05 A;  4IPA A;  3G1L A;  4LLN A;  5E1X A;  3E6D A;  2DBB A;  2ZBK A;  3WGG A;  3TO7 A;  5H6Q A;  3DXJ F;  3TO9 A;  4J01 A;  3F8M A;  4BGD A;  5HLH A;  2DPD A;  1UCR A;  3OS1 A;  1D8K A;  3W6K B;  1QVU A;  2GAU A;  3A01 A;  2K9N A;  1YO5 C;  3J7A O;  3SXY A;  2O7O A;  1WKM A;  5D5X B;  4CDG A;  4PSX A;  1EJ9 A;  4KMF A;  2M5W A;  3VYU B;  1HSJ A;  5E1W A;  4OAY A;  2BE5 F;  4HX7 A;  2CWE A;  1XGO A;  4MHG A;  3V42 A;  3JRI A;  2LD5 A;  5J1U A;  2OCC H;  3WU0 A;  3BG5 A;  4G9Y A;  3TDZ C;  3J80 K;  1L0O C;  4B1R A;  1O3T A;  3VYT B;  1I3A A;  1UG2 A;  2VXD A;  2DI3 A;  4N9H A;  2KIS A;  3CTA A;  4OIR F;  3LA2 A;  3LOC A;  1IRX A;  1XCV A;  2Q2E B;  3I71 A;  2WBM A;  4DBQ A;  3BPX A;  3PIP F;  1T0F C;  3ZMU A;  1S5L C;  2WA0 A;  1JHF A;  2PJP A;  4UVC A;  5LEJ A;  1Z7U A;  2F6C A;  4L9J A;  2BY1 A;  1HKQ A;  3CDI A;  1ON2 A;  1N25 A;  2QEX I;  5GAE J;  2M4G A;  4LIT A;  3L2R A;  1B8I B;  3BZK A;  3DLL F;  2OQG A;  2CUF A;  3JCU C;  1E3O C;  4RB0 A;  4JX5 A;  3E6B A;  2EFP A;  2FE3 A;  1W4M A;  2P7C B;  3GLL A;  2GBY A;  3KEO A;  4QWQ A;  5LHG A;  2O8K A;  5D8K B;  3MZH A;  1LFP A;  1JXS A;  3IUO A;  1EA3 A;  4UV8 A;  2X85 A;  1HXD A;  2RDP A;  3GZN B;  3KZI C;  4NHJ A;  1RES A;  1T95 A;  3CF5 F;  3GTP J;  2XAS A;  1WJC A;  2R7T A;  3F22 A;  2OA4 A;  3ERM A;  5EZH A;  1X2N A;  4KMU X;  4BY7 J;  3BR1 A;  1S7A A;  3CQZ J;  5DEQ A;  3GXO A;  3QPL A;  3T8T A;  5E3M A;  2P8T A;  3FKJ A;  2XPV A;  2CU7 A;  1VQP I;  2YS9 A;  5BQT A;  4LIV A;  2JTV A;  4MNU A;  4XSZ F;  3CP8 A;  4I6Z A;  4DQ2 A;  2X6O A;  5EGO B;  4BDY A;  1ETO A;  3GLX A;  2DJN A;  3A02 A;  4CZZ A;  1XS9 A;  3MKZ A;  2FU4 A;  4PJ0 C;  5FLM J;  3CCY A;  1K78 B;  2RVC A;  4XLE A;  2DJI A;  2H94 A;  4JQF A;  2IT0 A;  3P9K A;  3HC7 A;  2GIV A;  4E7L A;  5DD8 A;  1O3Q A;  2A6T A;  1AA7 A;  2YUS A;  4ZDP A;  2XV4 S;  4HNV A;  1VQ6 I;  3DTK A;  4MIM A;  4XKW A;  1U5T B;  2LBF A;  3L1P A;  3REO A;  5D5V B;  3SEZ A;  1EH8 A;  1IRG A;  1OIS A;  1OR7 A;  2DA3 A;  2XF5 A;  2H09 A;  1ZAR A;  3KZZ A;  3LSH A;  3K2A A;  1BC7 C;  1FBU A;  2FQ4 A;  3CP2 A;  1QA6 A;  1TT0 A;  4Q48 A;  3GTJ J;  1VQ7 I;  3A0B C;  3ZQC A;  4A3L J;  4A6D A;  5FLX Z;  1MBK A;  2ZME C;  3ZQG A;  2KIQ A;  4EM0 B;  3HRS A;  2MC3 A;  2J5O A;  3HTU A;  5BPI A;  3I64 A;  2EK5 A;  3HUG B;  4FT8 A;  4E7Z A;  2ESH A;  3OOU A;  2QM3 A;  2KFD A;  3KYD B;  4XM3 A;  1SD6 A;  4EEF G;  3LSG A;  4U0W A;  1B1B A;  1G3W A;  3O8G A;  5EEH A;  4G94 A;  4IZZ A;  2CV2 A;  1E0E A;  1X4O A;  1A31 A;  2KRH A;  3S3O A;  3SQN A;  2QSH X;  1DQU A;  3BC8 A;  2VKH A;  3TO6 A;  3HM5 A;  3GZ6 A;  3VOD A;  3CC2 I;  2OQR A;  2NVX J;  2GLO A;  1FP2 A;  4E7J A;  1V55 H;  2DA7 A;  2R7S A;  1YIO A;  1VQ5 I;  3QYF A;  5JHF A;  1OYI A;  1SVM A;  5CVI A;  2VPR A;  4HEA 2;  3H92 A;  4JX4 A;  4R1H A;  3K70 D;  3G73 A;  2ZB9 A;  2HEO A;  4RAG A;  5ERI A;  2HTJ A;  3BTC A;  3FBN B;  3I9V 2;  2KRF A;  5EG0 B;  5AIQ A;  2E1O A;  3KP4 A;  1R4N B;  1MNM C;  1USS A;  3F8B A;  4E7K A;  1HW5 A;  2HGC A;  2D1H A;  1BOA A;  5LHI A;  4D5F A;  3ZMD A;  3HOY J;  5F04 A;  1RR8 C;  1AKH A;  3L2W A;  5JR3 A;  1JT0 A;  4NQW A;  4P9U A;  2UXN A;  2DT5 A;  4HLY A;  1JUP A;  1BR1 A;  1QNT A;  4LOC A;  1QZY A;  5KAI C;  4CCM A;  4YIR X;  2XAU A;  3Q3S A;  4Y17 A;  3F8F A;  4HV5 A;  2VXZ A;  1GVJ A;  3CC7 I;  1FOX A;  1Y1V J;  3QOD A;  3KP7 A;  1ZQ3 P;  2OZU A;  3EUK L;  3KIO A;  5FO5 A;  4BDZ A;  2ECC A;  3DU5 A;  4WCG A;  3AFH A;  2HVQ A;  3IHU A;  1X1B A;  3RKY A;  3SDG A;  5EG0 A;  4DYQ A;  3WTS C;  5HLI A;  4IVN A;  2I10 A;  1W7P A;  3OYD A;  3O8H A;  2MA3 A;  3DEU A;  1JJ8 C;  3JRE A;  2QLZ A;  3CCM I;  1LEA A;  2F5E A;  1KON A;  5D6E A;  1LKX A;  4BS9 A;  1ZN2 A;  2E1M C;  5CYV A;  3QQA A;  2WAQ N;  2VBW A;  4RB3 C;  1GXQ A;  2STT A;  4HX4 A;  1W1W E;  4F55 A;  2XF6 A;  3QOE A;  1BM9 A;  3B02 A;  5IP7 J;  1L3L A;  3K10 A;  3S1Q J;  3IL2 A;  3UKG A;  1B72 B;  4PZJ A;  1J9I A;  1FJL A;  1BR2 A;  2UUZ A;  5F0C A;  2QGU A;  2R7W A;  5EEA A;  1S7O A;  2VQL A;  4ZYH A;  2ISY A;  1X1C A;  2ELJ A;  3BTL A;  4FET A;  2XPU A;  5H20 A;  1Y0U A;  3HUG A;  2DO7 A;  4FTH A;  2OZ6 A;  1RET A;  2E34 A;  4II2 A;  5DUK A;  4BEH B;  2CUZ A;  2K9Q A;  3BPV A;  3CLO A;  3K0L A;  4CYC B;  1Z6R A;  3IP4 B;  4RLF A;  1D3Y A;  1TZL A;  2D1V A;  2FX0 A;  2I5U A;  3GVA A;  3ZGK A;  5IT3 A;  1MIJ A;  2QF7 A;  3L7W A;  3PUB A;  2EQR A;  3AAF A;  2HDC A;  3W3C A;  5E3N A;  3S1N J;  2KP6 A;  3SZT A;  4AU7 A;  3IV5 A;  1Y8Q B;  2F5F A;  1KYZ A;  4L9V A;  4DZJ A;  3CF2 A;  2LY2 A;  3IAS 2;  4O6J A;  3FMS A;  2NS0 A;  2DOE A;  4OWR B;  3I55 I;  4B44 A;  3FIS A;  1FP1 D;  4AIK A;  2DFH A;  1JHH A;  2FML A;  4Y3O A;  3ABK H;  2Z2S B;  2JVG A;  2ZXH A;  5H6R A;  5HLT A;  2L7K A;  1T39 A;  4ZTF A;  1BC8 C;  4OMY A;  2E1N A;  4LGW A;  1UHS A;  3NAR A;  3G71 I;  5JI6 A;  3G4S I;  3S16 J;  1SVL A;  2HI3 A;  2R7R A;  4GGG A;  2HOA A;  4OIN F;  1Z91 A;  3LAJ A;  1Y1W J;  3I4N J;  1SD5 A;  1IXS B;  1R6R A;  1PDN C;  5FLV A;  1SFO J;  2WAQ A;  2Y0S A;  3PFY A;  4MQV A;  1RRJ A;  2HPI A;  3ZR8 X;  1IZ1 A;  4XQF A;  1FTT A;  1KA8 A;  2Q2E A;  3QU3 A;  1NG7 A;  1NK3 P;  3ABT A;  2ZSH B;  1ZG5 A;  3OYB A;  2ZO4 A;  4F93 B;  4NDL A;  3BR6 A;  2L01 A;  1YE9 A;  3UNG C;  5C4J J;  3S3N A;  3HRT A;  1TWG J;  1FX7 A;  1IG7 A;  4ZYE A;  4LD5 A;  3F72 A;  5E3O A;  3V7C A;  1MJB A;  3PO3 J;  2W82 A;  1ZGA A;  4J00 A;  1J09 A;  3LSR A;  4PFP A;  5L3F A;  1MSE C;  1TNS A;  3D5S C;  1W36 D;  1G3T A;  5C44 J;  2PJR A;  1YYV A;  3OV8 A;  3J7A Y;  4KUM A;  3QP6 A;  4XMY A;  1TWA J;  1RPW A;  1ZK8 A;  1LE8 A;  1HDD C;  1VFC A;  2DT7 B;  4CCJ A;  2H6C A;  4RDU A;  3S2H J;  4PJN A;  2R92 J;  1ULY A;  3BRO A;  4NC7 A;  1DPU A;  4RAY A;  2P6S A;  3HZJ A;  3AG2 H;  3MVP A;  4NNJ A;  4M3D A;  2O9L A;  1UHM A;  1O7L A;  2R5Y B;  2CSO A;  1WH5 A;  3FBI B;  2F5D A;  3G1O A;  3K4B A;  3K4C A;  3LQR A;  4YG2 F;  2A69 F;  2VBY A;  4IHV A;  3GUD A;  2LG4 A;  1LFB A;  1V4R A;  2FD5 A;  3LAP A;  2EIJ H;  4HF2 A;  2HYF A;  1Z3X A;  3WHC A;  2L9R A;  2LNB A;  1XTA A;  2CW8 A;  2Y48 A;  4AID A;  4BAC A;  1OLT A;  2NNY A;  2BVM A;  3MFK A;  4ENK A;  2ID6 A;  4B09 A;  4L5I A;  2HVR A;  3CZ6 A;  2LKS A;  4IHY A;  3IAM 2;  3IH4 A;  3BLY A;  2Z33 A;  1YJW I;  3U2R A;  1LJ9 A;  2BY3 A;  3WGH A;  1HBX G;  3G2B A;  4UVB A;  4A3J J;  2V9K A;  3GW2 A;  2CQQ A;  2JA8 J;  1YRN A;  2ETH A;  2O8X A;  4ESJ A;  3RKQ A;  2PFB A;  2X1D A;  3BG7 A;  3ROU A;  1FYM A;  2GOX B;  4G7O F;  3DPU A;  2EIL H;  5KVR A;  2K7L A;  4BXU A;  5E8I A;  5B5E C;  1AWC A;  2EIM H;  2JUC A;  3S3M A;  2ZFW A;  4BE0 A;  3QPS A;  2P5V A;  5LD2 C;  2CW7 A;  2EA4 A;  3DTI A;  2FOK A;  3K4K A;  3TBI A;  5E8G A;  3BWG A;  1O57 A;  3A03 A;  3OSG A;  2DT6 A;  3EUH C;  2MD0 A;  3VYR B;  2DPU A;  3ZQH A;  5TIS C;  1POG A;  1RIO H;  3D0S A;  4LK1 F;  4E4H A;  3VDX A;  1HC8 A;  1D1B A;  4FAS D;  2JT1 A;  4GXO A;  4JX6 A;  3T5X A;  1IF1 A;  2JUG A;  2L2O A;  2LMD A;  2K3F A;  2V9V A;  4HX8 A;  4S04 A;  3L2U A;  1OCP A;  1YJ9 I;  4YRV A;  3ZN0 A;  1JKQ C;  2NS8 A;  1SFX A;  3HPG A;  4CCN A;  2IPQ X;  1RC9 A;  2F4M B;  2TDX A;  1P4W A;  3E97 A;  3VSL A;  2Y9Z A;  2YU9 J;  2B9S A;  4HA8 A;  1ZEL A;  2VJ4 A;  1W5C C;  3CCE I;  4IHS A;  1T56 A;  2V6C A;  3BTJ A;  4NBQ A;  3FZV A;  3QAH A;  4KN4 X;  3ZQF A;  2BXY A;  4Y13 A;  4B4C A;  1MZB A;  2PMZ A;  1Q1H A;  2DOA A;  1A5J A;  1IRZ A;  5LRR A;  2XRL A;  4M74 A;  5J40 A;  3HOS A;  4XK4 A;  3KCC A;  1N75 A;  2FNP A;  2QVO A;  4CYD A;  1DGR M;  2A05 A;  2COB A;  2EZK A;  2G0E A;  4I01 A;  2IS4 A;  3H5A A;  4RM2 A;  1J2X A;  1B72 A;  4CIC A;  1XSD A;  1D0Y A;  2DN0 A;  1I27 A;  1ZAO A;  3H3U A;  1JGG A;  2IGK A;  1WZ2 A;  2M45 A;  4EJV A;  4DW6 A;  2ZKZ A;  2L7Z A;  3KP3 A;  2X6X A;  5K7F A;  4WWC A;  2K9M A;  2VJI A;  4MFD A;  2OPT A;  4OOI A;  3CCJ I;  2PBI A;  4BE1 A;  2XIG A;  4I0A A;  5M3F J;  2DMP A;  2Y9Y A;  2D5V A;  4D7N A;  2M4K A;  1U8R A;  1QZE A;  3PSF A;  2EFW A;  5FB2 A;  2E71 A;  3MZY A;  2JJ7 A;  4UB8 C;  3W6V A;  5F0F A;  3T1B A;  3K2Z A;  4EJO A;  3RI4 A;  1I39 A;  2LSO A;  2FA5 A;  1X4P A;  1V5G A;  4BQA A;  4E6K G;  2DOF A;  3IWF A;  3OIP A;  2ADU A;  4XKB A;  4QPQ A;  2VI6 A;  1F5T A;  2VAS A;  1P7J A;  2KQR A;  2L54 A;  4RA2 A;  2W1O A;  1TQP A;  1YIT I;  2VOO A;  2ZXW H;  3OR2 C;  1T33 A;  2CFX A;  4LMY A;  4GFB A;  2EB7 A;  3DFG A;  4E7S A;  4PDK A;  2RQP A;  3H35 A;  4NUB A;  4RB1 A;  2RN7 A;  3W6J B;  5JVG F;  2CMP A;  1GHC A;  1Y0N A;  4CYC A;  3E6C C;  2CQK A;  1JTX A;  1G4D A;  3CCV I;  3CDH A;  2CV1 A;  2P4W A;  3FXR A;  2E2I J;  2L7F P;  2RAE A;  5CQG A;  1LDD A;  2DOD A;  3ZOB A;  3FXU A;  1XSX A;  5FRN A;  2VQC A;  3M1E A;  4AYB A;  3OYN A;  4CSW A;  1V5E A;  1DP3 A;  1K79 A;  2X48 A;  1X1A A;  2BOL A;  5ILU A;  5L3D A;  3JRB A;  1A6I A;  2IBD A;  1LPQ A;  1Z77 A;  2I8D A;  3FMR A;  5D6F A;  4E70 A;  3GFI A;  4RS8 A;  3K7A J;  2OC6 A;  3C1D A;  2FMY A;  4LK0 F;  3TED A;  3C3W A;  1BA5 A;  1IW7 F;  1XMX A;  2A61 A;  3WOD F;  1XD7 A;  2ACJ A;  4F52 A;  2R7F A;  3EYY A;  2HXI A;  1Z67 A;  1DP7 P;  1QPM A;  3I59 B;  2CS3 A;  1DPR A;  2V1D A;  2XB5 A;  2A5W A;  4FE4 A;  2K9S A;  2EV0 A;  2R93 J;  3OSF A;  1PP7 U;  3DKW A;  1QHH D;  3A1Y A;  4ZYA A;  1YHQ I;  4PGH A;  4BXX J;  2GQQ A;  2HU9 A;  4LG3 A;  5EJC A;  1BI2 A;  2FQ3 A;  3HYI A;  2W48 A;  2Y30 A;  1D5Y A;  2L9V A;  4B8X A;  1KGS A;  3SEQ A;  4BJ5 C;  5E1Z B;  3U9G A;  3WTY C;  5FJ8 J;  1LEB A;  1T08 B;  5ILV A;  4E7H A;  2E2J J;  3HOW J;  2XPW A;  4GCV A;  2Z9O A;  3E5Q A;  3FM3 A;  3A0H C;  5IOY A;  2E7W A;  3LSM A;  5FKK A;  5E20 A;  2EFO A;  5ILS A;  2EBI A;  4CXF A;  1JKR C;  2HS5 A;  3WTW C;  2M0C A;  1H0M A;  3JRH A;  3MEX A;  2OTJ I;  1WI9 A;  2P7V B;  4EM2 A;  1ETV A;  2DCE A;  5HS9 A;  1ZGW A;  2M8E A;  3DBH B;  3GF2 A;  5HOD A;  4L18 B;  1W7P B;  3FXK A;  2QSG X;  3L09 A;  1RZ4 A;  1IDY A;  3GZ5 A;  3OWT A;  4I99 C;  3HL2 A;  1PUF B;  1IJW C;  2Q0O A;  3DCF A;  1YX3 A;  3RZO J;  2Z5U A;  3U21 A;  2K4J A;  3EYI A;  3ASN H;  3FK6 A;  2KDO A;  3GCM A;  4A2U A;  1UST A;  2X9D A;  1X3U A;  4UVA A;  4F7Z A;  1TQM A;  1O3R A;  1Z7L A;  3MWM A;  4Y33 A;  4I0B A;  4HBL A;  1Y8R B;  2M8G X;  3ABL H;  4YFN F;  1XSV A;  3DP7 A;  2ZCW A;  4PCQ A;  2C6Y A;  3K4J A;  2DA4 A;  4DBR A;  2HZD A;  3LFK A;  3I59 A;  2ZC2 A;  3S15 J;  3BR3 A;  1NG6 A;  5HNF A;  4UUT A;  1VQ4 I;  2Y2Z A;  4Y4R A;  2X4H A;  1CQT A;  1H89 C;  3JAM Z;  2HKO A;  4IX7 A;  1SD4 A;  1D0Z A;  2LBF B;  3JRD A;  2Q8K A;  2H1K A;  2XVC A;  1U3E M;  1ERD A;  2LRE A;  4MEY F;  2W25 A;  5L3G A;  3OYI A;  3F9K A;  5DUI A;  1JTY A;  1ORK A;  4D0P A;  3CJT B;  2LP0 A;  3LST A;  1X19 A;  5BS6 A;  1X3Z B;  3OYM A;  1STZ A;  1OJL A;  2JRM A;  5K5Q A;  1ZRF A;  4AM3 A;  1HQC A;  1G2H A;  1W5T A;  2MGQ A;  1B6A A;  2WY8 Q;  2XAF A;  2BVL A;  4MGR A;  1IN7 A;  4WXH A;  4R79 A;  1OQY A;  4LG0 A;  4I02 A;  2IA2 A;  3U1K A;  5ICG A;  4FCY A;  1Y6I A;  3EUA A;  1ETQ A;  2JN6 A;  5EZG A;  4OAZ A;  4U88 A;  2NNN A;  1YOV B;  1U9N A;  3QOP A;  2WWY A;  1BW6 A;  3HOV J;  3L9F A;  4HF1 A;  4S0H B;  2PX9 A;  4CA0 A;  3ASO H;  3WU2 C;  4MTD A;  3J80 Z;  1SMY F;  3OL4 A;  2HQN A;  1D0X A;  1FSE A;  3BG9 A;  4XL9 A;  1MH4 A;  3ESW B;  3KFW X;  2WV1 A;  3J81 Z;  2Z99 A;  4ETS A;  1IUF A;  3ZXS A;  3BG3 A;  4IL6 C;  3SJM A;  5EGO A;  1YJN I;  1PP8 F;  2IS1 A;  5FGM A;  2HQ5 A;  4ZJZ A;  5KNL A;  3Q0W A;  3OY9 A;  3BJA A;  4AC0 A;  4U87 A;  1IN4 A;  3K1M A;  4BL0 B;  2BHY A;  1BL0 A;  1RUO A;  3TP3 A;  2IGM A;  2LC2 A;  3FHZ A;  4C2M J;  3FWE A;  1IN6 A;  2Z3Y A;  1U5T A;  2VL8 A;  2QKL B;  4P5O A;  3GTK J;  2EWN A;  2KIM A;  4YEJ A;  3E5X A;  1F1Z A;  5LGT A;  5IYB J;  3CCS I;  2CFO A;  2JPC A;  2HOS A;  2VB6 A;  3L2C A;  1R23 A;  2XHK A;  4GRI A;  3ML6 A;  2YU3 A;  3RCO A;  1K61 A;  5HOO A;  2J5P A;  4GYI A;  4PJL A;  4W97 A;  4OIP F;  2E60 A;  2Y0S N;  2LY9 A;  4WF2 A;  3DKY A;  1BJZ A;  3K4N A;  1F4K A;  2IVM A;  4UV9 A;  3HB9 A;  3OIO A;  4V2F A;  3DWL E;  4AD9 A;  4C3I J;  1IDZ A;  3OYA A;  1HKS A;  4IHX A;  3TKY A;  4A3K J;  1MMN A;  3FDY A;  4H0E A;  1LDJ A;  1I6X A;  3TOB A;  5LEK A;  2IGO A;  2PI0 A;  5EEG A;  1U78 A;  2OCE A;  1OYY A;  2KPM A;  3LFU A;  5IPA A;  1SAX A;  2EFQ A;  2MLK A;  1FBQ A;  2GWR A;  1KU7 A;  3R61 A;  3LWF A;  3PQJ A;  5FD5 A;  5M5Y J;  2K3P A;  1I50 J;  1BI0 A;  1XN7 A;  3CCR I;  1QGP A;  1GVD A;  4ITV A;  1TWC J;  3FIW A;  2HYG D;  1MBJ A;  1HW1 A;  2VQH A;  2FEZ A;  2VQG A;  2A68 F;  1XGS A;  2G7H A;  2O5R A;  3HRM A;  2AS5 F;  4L0Y B;  2XSJ C;  2M1B A;  2ME0 A;  3ZMT A;  1KYW A;  1IUY A;  2OV7 A;  2M7A A;  1F9N A;  1BIA A;  1J5Y A;  2KIU A;  1KU3 A;  2WAF A;  4YII A;  1WSU A;  2VJ5 A;  2XUB A;  3GFM A;  2UWM A;  2XRO A;  1TT5 B;  1BIB A;  3SYT A;  2R5Y A;  2F5C A;  3N97 A;  2IS6 A;  2VKE A;  1OCT C;  4XRM A;  4RM3 A;  2QWW A;  2QA4 I;  3PNV A;  2BBY A;  5J47 A;  1YRN B;  1U9O A;  2NRA C;  1K7A A;  3VYS B;  3CJN A;  5LHH A;  2L7M P;  5F08 A;  5L3B A;  3KLN A;  1YW7 A;  3H1C A;  3I54 A;  3MKL A;  3Q9S A;  1VQL I;  2KL4 A;  3U1D A;  4UUV A;  4CUG A;  4Y7N J;  2ZXI A;  1CF7 B;  1JE8 A;  2X1E A;  5FKL A;  4YIF A;  3LA3 A;  3HRU A;  5HNH A;  1R5G A;  3WGI A;  4QPO A;  3WE2 A;  2L9S A;  2M34 A;  1FLI A;  5C4X J;  3RYP A;  1FMW A;  5IP9 J;  4C3H J;  5F64 A;  1UMQ A;  2O3F A;  3TMO A;  1DU0 A;  1ETX A;  4WX9 A;  3G3Z A;  3LSP A;  5HLG A;  4P55 A;  1ZLK A;  1PYV A;  2R7D A;  3M8F A;  1H88 C;  2G7U A;  4BKX A;  2QSF X;  4BUP A;  2K02 A;  4MO7 A;  2FBI A;  3WTV C;  3H0D A;  2P0W A;  3PIO F;  1E3H A;  1SAN A;  4B43 A;  2OTL I;  4M6Y A;  5ICF A;  4UB6 C;  2OF7 A;  1H9G A;  3TW7 A;  4EVI A;  2MW8 A;  2M7B A;  4XRS A;  1KQ0 A;  3A2K A;  1HST A;  2GM4 A;  2E35 A;  2TRT A;  3ZPL A;  1BBY A;  3I3L A;  2DA1 A;  4FQG A;  3BJ6 A;  1MDM A;  2M2E A;  2MD5 A;  2R5Z B;  4JP0 A;  1HOM A;  4M71 A;  4DNC A;  5IYC J;  3JRG A;  1ZG1 A;  1TL8 A;  5CLS A;  4G6D A;  4D9J A;  2HTS A;  4KIF A;  3OYC A;  3DBR B;  1FPQ A;  2XGX A;  3CUO A;  4ABZ A;  4IF4 A;  4L5E A;  5L3E A;  3PO2 J;  4I09 A;  4A3D J;  4XN0 A;  3N4M A;  6PAX A;  3SHF A;  2E7X A;  2KT0 A;  2OD5 A;  4PSW A;  2E36 A;  3F21 A;  2MAB A;  3WG7 H;  3QWL A;  5TJJ A;  3MKY B;  5E79 C;  3PUF A;  1HDP A;  4UXN A;  4JBA A;  2R0Q C;  3S2D J;  3H5R A;  1EH6 A;  3M9A A;  4HAM A;  2PJR B;  5IYD J;  5J8F A;  4U0Y A;  1WI3 A;  4M3G A;  4GYG A;  3TGN A;  2P6T A;  2M0M A;  1YG2 A;  2ZJR F;  3BQY A;  2MLG A;  3J7Z I;  2R3S A;  1YI2 I;  2FJ1 A;  2FRH A;  3D5L A;  3AG1 H;  3GBG A;  1OCR H;  1LVK A;  2DTZ A;  4KYW A;  2LH9 A;  4U7D A;  1IV8 A;  1BI1 A;  2RC4 A;  2QBY B;  3OYE A;  3LNQ A;  3CO6 C;  4C3J J;  3I5U A;  1Y39 A;  4FX0 A;  1DGW Y;  4L0Z B;  3OYL A;  4J19 A;  4F91 B;  2VT2 A;  2QUF A;  1W0U A;  2E1M B;  2HR3 A;  2H1L A;  3GME A;  5D4R A;  1ZGJ A;  3DTE A;  4HF0 A;  3COA C;  5K7H A;  2CQX A;  1ON1 A;  5BPD A;  2LVS A;  1D1A A;  4U0V A;  2P5L C;  4G7Z F;  3HEF A;  2YX4 A;  4IEJ A;  2VBX A;  1EV7 A;  2VC1 A;  1FC3 A;  2NVQ J;  2XAJ A;  4P9F A;  4DYC A;  5J4V A;  3CC4 I;  3S1M J;  4UNO A;  3HGY A;  4XOP A;  3IWZ A;  4KT6 A;  2VON A;  1LNW A;  2Y0M A;  3HOX J;  4PK4 A;  4XSX F;  3CES A;  3M8J A;  2ELK A;  3IKT A;  1TC3 C;  4X0G A;  1TQI A;  1B59 A;  4HDU A;  4ZYD A;  1Y56 A;  4XKC A;  1Z1D A;  3BTI A;  3HHH A;  4HV6 A;  4IRG A;  3RKX A;  1I1G A;  1XDU A;  1OCZ H;  4YEL A;  4RMN A;  3C18 A;  3W2A A;  3MAJ A;  2RRE A;  5LFA A;  2YR2 A;  3F23 A;  3G6E I;  3KYL A;  3KE2 A;  1O3S A;  4CHU A;  2DFF A;  1HF0 A;  3F8N A;  4C30 A;  2FNA A;  1TP4 A;  4WXC A;  5CQE A;  2FOW A;  2PLY A;  1ZTR A;  3NAU A;  5CJ9 A;  1P4A A;  2W24 A;  1GV5 A;  3AG3 H;  1FIP A;  2R7Z J;  1KQ8 A;  2FXA A;  1P9Q C;  5D5U B;  1AKH B;  4E7I A;  1UG0 A;  2W84 A;  2XDV A;  1R5H A;  3EPZ A;  2O61 A;  4JOM A;  5FKM A;  2GIZ A;  3C2H A;  1OCC H;  3V8L A;  1OPC A;  1S8N A;  3RYR A;  4MQ9 F;  3R4K A;  5DS9 A;  2L02 A;  1VQ9 I;  3L2V A;  2IA1 A;  3HG9 A;  2RQQ A;  2VJJ A;  4MEX F;  1VQN I;  4HST A;  1DUX C;  3CUQ A;  3TL4 X;  2L5Q A;  1ZRC A;  2BY0 A;  1YLF A;  3RPU D;  1TW2 A;  3DQV C;  1FBS A;  1R00 A;  2CH0 A;  4H4K C;  2EZI A;  4AVZ A;  4A3E J;  2QCO A;  3DU6 A;  2R4G A;  3WHB A;  4M73 A;  1K4T A;  2F4O B;  3BOQ A;  3LL7 A;  3JW4 A;  2EFN A;  2PMZ N;  4ZYG A;  3F8C A;  4KIT B;  3JTG A;  2LKX A;  4UUS A;  1P6R A;  3RZD J;  4NB5 A;  2W85 A;  3OL3 A;  2GXA A;  4BEH A;  3GO5 A;  3WTT C;  3CMM A;  3KZY A;  1A35 A;  2YSR A;  1YX5 A;  3ZN1 A;  1R1U A;  3SDB A;  2BZT A;  2KZV A;  2GOM A;  4O3M A;  1GXP A;  1SEU A;  2HXO A;  3SFZ A;  1TLH B;  4DGW B;  1IN8 A;  3M1C A;  5DCM B;  2XRN A;  1V5F A;  1Q1V A;  2R7U A;  1T8I A;  2F48 A;  4KN7 X;  1ZKG A;  4AIJ A;  5JLX A;  4HNT A;  3OOP A;  1ZLJ A;  3S14 J;  1ZHF A;  1ZR2 A;  1BOB A;  1R4M B;  2NYX A;  4DJA A;  4EV0 A;  3VFZ A;  1D5V A;  3E5U A;  2Y75 A;  2CUE A;  3KEY A;  3HTS B;  4BBR J;  4EGZ A;  1R7J A;  2L4M A;  3NWT A;  4ESB A;  2KJB A;  3LSI A;  3R6S A;  1RNL A;  4AVP A;  2V26 A;  1MH3 A;  1IGN A;  3N05 A;  5GAD J;  2EA2 A;  3OIQ A;  3WTZ A;  2ELH A;  4XLP F;  3OR1 C;  4AUX A;  4ZDL A;  2XAH A;  1BJA A;  4RGU A;  2K86 A;  5CPR B;  3H0G J;  5JFR A;  2G9W A;  2VC0 A;  4I98 B;  4FX4 A;  3BCB A;  3D1N I;  1MJ9 A;  2IA0 A;  3O3K A;  1K6O A;  5BMZ A;  1DDN A;  4Q4Z F;  4ZDO A;  1S72 I;  1MBE A;  3KLO A;  4IRI A;  2H8W A;  2K5C A;  1YS6 A;  1F43 A;  2AXL A;  2X1C A;  1IXR C;  2LY1 A;  1MKM A;  2R7O A;  5DCM A;  2BV6 A;  5TGT A;  1ITY A;  3V7S A;  3H3V K;  1MJA A;  3O2P E;  2F4I A;  4XBF A;  2MBF A;  3C2B A;  5CVR A;  4G12 A;  2VN2 A;  3FXJ A;  3HHG A;  2CYY A;  4A0Z A;  1VF9 A;  2KDZ A;  1MW7 A;  5K5R A;  2ZJP F;  4G8X A;  1GV2 A;  2X51 A;  5A2Q Z;  1S7E A;  2MFZ A;  3DF8 A;  2K9L A;  3M07 A;  4Y15 A;  1SAU A;  2BGC A;  4XLN F;  2NOJ B;  2WV0 A;  1VQK I;  4ENN A;  1QU3 A;  1VTN C;  2VBZ A;  4IOC F;  1REP C;  4M3E A;  5DTD A;  4AWX B;  2LOO A;  2PG4 A;  3JRF A;  3E7L A;  5FFZ A;  4HPQ A;  1XX5 A;  3TP0 A;  5EDN A;  2FBH A;  2A3S A;  3T0Y A;  2LF7 A;  2UXX A;  4Y52 J;  4XNF A;  3W2V A;  1LDK B;  3SZP A;  1WFX A;  2HKX A;  2LR8 A;  2VKV A;  3KX2 A;  2NAZ A;  4UY8 I;  1FOY A;  1XMA A;  3RJP A;  4KIS A;  4PJM A;  3GTL J;  1XMK A;  2E19 A;  5B66 C;  4IO9 F;  4BHP A;  1N77 A;  1UJ8 A;  1HKT A;  3K69 A;  2XGE A;  3VEP A;  2KIF A;  1IC8 A;  1G59 A;  4A69 C;  2DK8 A;  3JRC A;  4YFK F;  2HYJ A;  5E3L A;  2ME6 A;  3NWS A;  2O03 A;  3QYB A;  3S8P A;  2E2H J;  2V1X A;  4EMS A;  4RB2 C;  2RGV A;  2H6B A;  2E5Z A;  3LSK A;  2ID3 A;  3OMY A;  4XLH A;  4O5V A;  2CQN A;  2JVH A;  1MD0 A;  2W57 A;  2EV6 A;  5FFX A;  1QRY A;  2NVY J;  3FXL A;  5KHD A;  3FKI J;  5F1R A;  1MNE A;  3JAM K;  5GAH J;  3DLA A;  4Z6Y A;  4U7B A;  5IOZ A;  3CJR B;  5HDN A;  3PQK A;  2RNJ A;  1FTZ A;  3BG6 A;  4IJA A;  3S17 J;  2NVU B;  4HDV A;  2PMU A;  4QTR A;  4QLC U;  2VKD A;  5IT9 K;  4DZP A;  3I0T A;  3CO7 C;  1WJ5 A;  1U6G A;  1WJE A;  3KEQ A;  4XON A;  4ZTJ A;  2ZFU A;  1JJ6 C;  3HOU J;  2AO9 A;  4M9Z A;  1WJB A;  4BBS J;  2LKP A;  4A12 A;  5DYM A;  5GPC A;  1S29 A;  1OYW A;  3DPT A;  4Z2Y A;  4OIO F;  4A3F J;  4K2E A;  2QYO A;  4KIG A;  2OUM A;  4WK8 F;  2EIN H;  3WG9 A;  3F6O A;  2JA7 J;  2R5Z A;  2M87 A;  3I53 A;  4V19 K;  4N4N B;  1SMT A;  4I2O A;  2IXS A;  2HOT A;  4M6X A;  3H36 A;  3JR9 A;  4BQQ A;  1QPI A;  1P7I A;  4DIQ A;  2JSP A;  3HKZ A;  2KMU A;  3H9J A;  5LBQ A;  2HOE A;  4A6E A;  2ZNZ A;  3E1S A;  4KT5 C;  5EYR A;  1B9M A;  5CVV A;  3ERE D;  3R0A A;  2V6E A;  1S6L A;  3GTG J;  5TRD A;  3VWB A;  5FRO A;  5FLX K;  3PJR A;  3ZCO A;  3B6A A;  3IH2 A;  2Y69 H;  3V7R A;  3BR0 A;  3KET A;  2L4A A;  2L9N A;  3Q0V A;  3M3Y J;  3WTU C;  2W4S A;  5K5O A;  5DM7 F;  2MG4 A;  1NHA A;  2P5K A;  3ZQ7 A;  1IN5 A;  4YFX F;  3CCU I;  1RR7 A;  1SVO A;  3LSJ A;  4ZH4 F;  2EZL A;  1UAA A;  3QU6 A;  1QO0 D;  1XB4 A;  4AIH A;  4B48 A;  3K4L A;  3HGG A;  1ETW A;  1PUE E;  1LE8 B;  3DKX A;  1CGP A;  2V1U A;  2WTE A;  2ZNY A;  1LQ1 A;  1T98 A;  3H9G A;  1FWZ A;  2DA2 A;  4B47 A;  2UZK A;  2XGC A;  3OYG A;  1QHG A;  1R9T J;  1SFE A;  1TTY A;  5F0H A;  1ZG3 A;  2GZW A;  2L0K A;  2LK2 A;  1U5T C;  4QIW N;  3GWZ A;  4FIS A;  2IRF G;  3EDP A;  2HDD A;  3BY6 A;  4XLF A;  2DFI A;  2PN6 A;  3FXM A;  1XC5 A;  1AU7 A;  2W00 A;  5JLW A;  3AL0 C;  3IH3 A;  1JUS A;  1IO2 A;  1G6N A;  2K27 A;  3I58 A;  3GTO J;  2GA1 A;  1RI7 A;  2X0L A;  5J1Y A;  3CCQ I;  5E17 F;  4FE7 A;  2BHZ A;  1BW5 A;  5HS7 A;  2JPB A;  1APL C;  4XIC A;  1MSF C;  1XDS A;  1XGM A;  4DYR A;  3ZP5 A;  1D1C A;  2COM A;  4RAZ A;  1N78 A;  1A04 A;  1P92 A;  5K7Z A;  1R1V A;  4G6Q A;  1H9T A;  2MSY A;  1R36 A;  5JVT A;  4RBO A;  1SFU A;  2X6W A;  4IQJ A;  4GO1 A;  1JI8 A;  1J0R A;  3VSK A;  1VZ0 A;  2K4B A;  3I4M J;  2ICW G;  3M7G A;  1YS7 A;  2NOG A;  1ZRD A;  4ESF A;  3K70 C;  2VE9 A;  4A0Y A;  1MMS A;  2JRT A;  2AHQ A;  2WAE A;  2VOD A;  4ASN A;  3R0J A;  4C9Y A;  2FSW A;  5FKO A;  3MCZ A;  1A6Q A;  3DEW A;  1ZH5 A;  1OR7 C;  3CDL A;  1T0F A;  4NC6 A;  3HSE A;  1T2K A;  1U2W A;  2AXT C;  3EET A;  1C0W A;  1R5I D;  1MBG A;  3EQL F;  1FYL A;  5IY5 H;  1VI0 A;  5IP6 A;  2V4J C;  1NK2 P;  2BEO A;  3CLQ A;  2VIX A;  4HNU A;  2HZT A;  2IP2 A;  1OCO H;  2VLA A;  2F5V A;  2QQ8 A;  1W36 C;  3GTM J;  2OJE D;  1YIJ I;  2AQE A;  2ZME A;  4XR6 A;  3R60 A;  3HSF A;  4NC8 A;  4RGX A;  1YFH A;  5L3C A;  4BJ6 C;  1ONV A;  3FM5 A;  3E0J B;  1MBF A;  5ICE A;  4LB6 B;  2O0Y A;  1WWX A;  1X1P A;  4HSR A;  3M4O J;  2LFB A;  4B3X A;  3OS2 A;  2DLL A;  3IRR A;  3CMY A;  2DXI A;  1J59 A;  2IEK A;  5D4S A;  2JA5 J;  3RKW A;  3B6C A;  1JUM A;  3DPL C;  3ECO A;  3CMA I;  4BE2 A;  1XPX A;  1AHD P;  4EM1 A;  1MMG A;  1X1D A;  4BU2 A;  4F92 B;  9ANT A;  1FOK A;  1IXC A;  2LDU A;  1IAW A;  2CG4 A;  3GFL A;  4LLG F;  3V4G A;  1FNN A;  2DYS H;  1OMI A;  2CV0 A;  1FEX A;  2DQL A;  1LB2 A;  4OU0 A;  5J1R A;  2XSD C;  4L9N A;  2ECB A;  2OBP A;  4M9X A;  4RGS A;  3SFI A;  3X2Q H;  1GLN A;  3ZQL A;  4EQQ A;  4IQ4 A;  3GTQ J;  2BYV E;  1XCB A;  3KPH A;  3ZMZ A;  2N8G A;  4BQN A;  2W7N A;  3L2Q A;  1Z3Y A;  4XOT A;  3OYK A;  1U0J A;  1MBH A;  3ECH A;  4LFU A;  1IV6 A;  2KHM A;  3K9T A;  1AOY A;  4XLA A;  5M5W J;  3OYH A;  4W1U A;  1HCR A;  5DCF A;  1EH7 A;  5DM6 F;  4ENJ A;  5HVQ C;  1V54 H;  5B1B H;  3TOA A;  4HG2 A;  1ZYR F;  1WCM J;  2XB0 X;  1SFK A;  3QRF F;  4ZZL A;  3I56 I;  2A5Y B;  3ABU A;  3M8E A;  1WRJ A;  5GAG J;  1RUN A;  1KQ9 A;  4KIC A;  3F0C A;  3HOZ J;  3HIF A;  1K83 J;  1Z0X A;  1R71 A;  2E5N A;  3PL8 A;  1LVA A;  2KLO A;  2WC2 A;  3O6B B;  4C2U A;  4HRI A;  4M3B A;  4R8H A;  4N0B A;  3WTX C;  1R1T A;  4XID A;  3QP5 A;  1VQO I;  1A36 A;  3FX3 A;  3FHN A;  2HPM A;  3S32 A;  2H8R A;  2QQ9 A;  1SC7 A;  4XRS G;  3C7J A;  2UV1 A;  4P1W A;  3BP8 A;  3CCL I;  5HS8 A;  1YTY A;  2V79 A;  4IHT A;  3VPR A;  4CH7 A;  2RV8 A;  2GXB A;  4LJZ F;  4BHC A;  5B1A H;  5FKN A;  4N9I A;  2MH9 A;  3HPH A;  5AON A;  1TWF J;  4MFE A;  2LRD A;  2M30 A;  4BHB A;  2Y31 A;  4ZC3 A;  1PUF A;  2JQ7 A;  4X1E A;  1FYK A;  4KIB A;  4EJW A;  5GP9 A;  3PNT A;  4LLL A;  4IHW A;  2JMW A;  3BR5 A;  2HQA A;  3KP6 A;  1T6S A;  4LG0 B;  1K6Y A;  2ISZ A;  4A0X A;  3K1P A;  1BR4 A;  2B63 J;  5H2F C;  3EUH A;  4A3M J;  5EF6 A;  5IT9 Z;  3VB2 A;  4XN3 A;  4HOB A;  4MLO A;  1O7F A;  1W5S A;  2XC7 A;  2HWV A;  1UHW A;  4PGG A;  3OYJ A;  2IJL A;  2NVT J;  3KYC B;  2DYR H;  2KZG A;  3H5N A;  3JTH A;  3MKW B;  3HKZ N;  4Q47 A;  3J81 K;  5A2Q K;  4NQW B; 
#chains in the Genus database with same CATH homology
 2R93 J;  3OSF A;  3OOU A;  4BY1 J;  4EEF G;  3LSG A;  4BXX J;  4A3B J;  1W0T A;  3O8G A;  1RKW A;  1QVT A;  2DMU A;  2W48 A;  2HXO A;  3FK7 A;  2Y30 A;  1D5Y A;  2EZH A;  1Q1V A;  2LLK A;  5FJ8 J;  1WH7 A;  5J3L A;  1ZKG A;  2E2J J;  2JK3 A;  3HOW J;  5JLX A;  2XPW A;  3HM5 A;  3S14 J;  5IOY A;  2NVX J;  1ZR2 A;  2GLO A;  5FKK A;  2DA7 A;  2DA6 A;  1OFC X;  2EBI A;  1JKR C;  2M0C A;  5M3M J;  3RQI A;  2CUE A;  3JRH A;  2VPR A;  4JX4 A;  4BBR J;  2ZB9 A;  1ETV A;  4V2G A;  1ZGW A;  2VUM J;  5HOD A;  3BTC A;  1FIA A;  1MH3 A;  1IDY A;  5EG0 B;  1IGN A;  2E1O A;  1MNM C;  1PUF B;  1IJW C;  3DCF A;  3RZO J;  4A3C J;  4AUX A;  3FK6 A;  3H0G J;  2X9D A;  4D5F A;  4M6V A;  3HOY J;  5F04 A;  3D1N I;  2P81 A;  1AKH A;  1DU6 A;  2M8G X;  1JT0 A;  1JUP A;  4LOC A;  2DA4 A;  3Q3S A;  1MBE A;  3S15 J;  3BR3 A;  1F43 A;  1Y1V J;  1GT0 C;  1ITY A;  1ZQ3 P;  4UUT A;  1H8A C;  3H3V K;  1HLV A;  3S1R J;  2ECC A;  1O4X A;  2Y2Z A;  3C2B A;  1CQT A;  1H89 C;  4G12 A;  3SDG A;  3MN2 A;  5EG0 A;  3JRD A;  1VF9 A;  2KDZ A;  4DYQ A;  1GV2 A;  2H1K A;  2I10 A;  1S7E A;  3O8H A;  1RKT A;  4I76 A;  1GUU A;  3BT9 A;  1JJ8 C;  3JRE A;  4UUS B;  1JTY A;  1ORK A;  2LP0 A;  3Q0U A;  1JT6 A;  1OJL A;  1G2H A;  4M3E A;  5DTD A;  3QQA A;  2MGQ A;  2WAQ N;  3JRF A;  3E7L A;  1F36 A;  5EDN A;  3TP0 A;  4Y52 J;  1ETY A;  2LR8 A;  2VKV A;  5IP7 J;  4FCY A;  1ETQ A;  2JN6 A;  3UKG A;  3S1Q J;  5EZG A;  2DMT A;  1B72 B;  1U9N A;  3GTL J;  2E19 A;  1FJL A;  1BW6 A;  3PM1 A;  1LFU P;  3HOV J;  5F0C A;  4S0H B;  2XGE A;  5EEA A;  2DMQ A;  1IC8 A;  4A69 C;  3BTL A;  3HDD A;  3JRC A;  3BG9 A;  2XPU A;  1I6H J;  1MH4 A;  2HYJ A;  2WV1 A;  4FTH A;  1RET A;  5E3L A;  1IUF A;  2WB1 N;  2ME6 A;  3ZQI A;  2K9Q A;  3BG3 A;  3SJM A;  4CYC B;  5EGO A;  2E2H J;  1JKO C;  2HQ5 A;  2ID3 A;  2FX0 A;  3Q0W A;  1QRY A;  2QF7 A;  4AC0 A;  2NVY J;  3FKI J;  2EQR A;  1BL0 A;  5E3N A;  3S1N J;  3TP3 A;  3IV5 A;  5IOZ A;  4C2M J;  1B8I A;  1I3Q J;  1FTZ A;  4DZJ A;  3S17 J;  4X6A J;  3GTK J;  2XGD A;  4QTR A;  3FIS A;  5F27 A;  1TWH J;  4DZP A;  5IYB J;  2HOS A;  2JA6 J;  1JJ6 C;  3HOU J;  2AO9 A;  1K61 A;  2M9H A;  4A3G J;  4W97 A;  1NTC A;  4BBS J;  2Y0S N;  2LY9 A;  1BJZ A;  5GPC A;  1ZR4 A;  3HB9 A;  3OIO A;  4A3F J;  4V2F A;  2JWT A;  4C3I J;  1IDZ A;  4IHX A;  1UHS A;  3NAR A;  4A3K J;  2DA5 A;  2JA7 J;  3S16 J;  2HI3 A;  2R5Z A;  1U78 A;  2EH3 A;  5IPA A;  2HOA A;  1Y1W J;  3I4N J;  5FLV A;  2HOT A;  1SFO J;  5M5Y J;  3JR9 A;  1I50 J;  1QPI A;  1VND A;  1P7I A;  1FTT A;  1GVD A;  4B3A A;  1TWC J;  1NK3 P;  3FIW A;  1MBJ A;  5EYR A;  4JYK A;  4NDL A;  3BR6 A;  3GTG J;  5C4J J;  2ME0 A;  4A93 J;  1TWG J;  1XG1 A;  1IG7 A;  4D5C A;  5E3O A;  3PO3 J;  3B6A A;  3LSR A;  3IH2 A;  1WGX A;  3BR0 A;  3G1M A;  1MSE C;  3Q0V A;  2R5Y A;  3M3Y J;  2VKE A;  1OCT C;  4XRM A;  5C44 J;  2MG4 A;  4D7M A;  1RR7 A;  3LSJ A;  1ENH A;  1TWA J;  1RPW A;  1ZK8 A;  2EZL A;  1LE8 A;  1VFC A;  1HDD C;  1YRN B;  1U9O A;  2LTP A;  4RDU A;  3HGG A;  1ETW A;  2L7M P;  1LE8 B;  3S2H J;  4M3F A;  5F08 A;  2R92 J;  3HBL A;  3MKL A;  1X2M A;  3MVP A;  2O9L A;  4M3D A;  1WPK A;  1X58 A;  2DA2 A;  2XGC A;  1R9T J;  2R5Y B;  5F0H A;  1WH5 A;  3G1O A;  4Y7N J;  2L0K A;  2LK2 A;  4IHV A;  2CJJ A;  5BNG A;  4QIW N;  1LFB A;  4FIS A;  2FD5 A;  5FKL A;  2CRG A;  5GPA A;  2HDD A;  3WHC A;  2L9R A;  4A3I J;  2TCT A;  1XC5 A;  2M34 A;  2NS7 A;  1AU7 A;  5C4X J;  5JLW A;  2IAI A;  3IH3 A;  5IP9 J;  2ID6 A;  1JUS A;  4C3H J;  1EF4 A;  1UMQ A;  1DU0 A;  1ETX A;  3GTO J;  3LSP A;  5J1Y A;  4FE7 A;  1H88 C;  1BW5 A;  3BR2 A;  4BKX A;  4IHY A;  3A01 B;  1APL C;  4XIC A;  1MSF C;  3IH4 A;  4MO7 A;  4DYR A;  1ETK A;  2DMN A;  1JKP C;  1SAN A;  3BQZ A;  5K7Z A;  4A3J J;  2OF7 A;  3TW7 A;  2CQQ A;  2MW8 A;  2JA8 J;  2MSY A;  4XRS A;  1YRN A;  4RBO A;  2GM4 A;  3JRA A;  2TRT A;  3RKQ A;  1U8B A;  2DA1 A;  4QSH A;  2M2E A;  5F1J A;  2R5Z B;  4JP0 A;  5M5X J;  1HOM A;  5IYC J;  1GDT A;  3JRG A;  2K40 A;  3I4M J;  2NOG A;  2AHQ A;  4ABZ A;  5C3E J;  4L5E A;  3PO2 J;  5FKO A;  3QPS A;  3DEW A;  4A3D J;  3CDL A;  3TW6 A;  4AYB N;  3A03 A;  3G1L A;  3OSG A;  2KT0 A;  1MBG A;  3ZQH A;  1POG A;  1VI0 A;  5IP6 A;  1NK2 P;  1HDP A;  2R0Q C;  3S2D J;  4JX6 A;  3GTM J;  5IYD J;  1WI3 A;  1QVU A;  3A01 A;  2K9N A;  4M3G A;  1OCP A;  2O7O A;  1JKQ C;  2NS8 A;  3BQY A;  3JRI A;  2FJ1 A;  2LD5 A;  1MBF A;  5J1U A;  3GBG A;  3BG5 A;  2YU9 J;  2Y9Z A;  3M4O J;  2LFB A;  2DTZ A;  4B1R A;  1UG2 A;  1T56 A;  3BTJ A;  3CMY A;  2IEK A;  3ZQF A;  2JA5 J;  3B6C A;  1JUM A;  3LNQ A;  1AHD P;  4B4C A;  4C3J J;  9ANT A;  1A5J A;  1IRZ A;  3LOC A;  2XRL A;  4XK4 A;  4J19 A;  1W0U A;  1FEX A;  5J1R A;  2XSD C;  2COB A;  2ECB A;  2EZK A;  3SFI A;  3ZQL A;  5K7H A;  2CQX A;  2G0E A;  2LVS A;  3GTQ J;  1B72 A;  3HEF A;  2DN0 A;  2N8G A;  1JGG A;  4IEJ A;  4DW6 A;  2L7Z A;  2NVQ J;  1MBH A;  1IV6 A;  1B8I B;  4DYC A;  5M5W J;  5K7F A;  4W1U A;  1HCR A;  3S1M J;  2CUF A;  3HGY A;  2OPT A;  4MFD A;  1E3O C;  4JX5 A;  2D5V A;  5M3F J;  2DMP A;  2Y9Y A;  4D7N A;  2GBY A;  2O8K A;  3HOX J;  1WCM J;  2XB0 X;  2ELK A;  1TC3 C;  2JJ7 A;  3W6V A;  1RES A;  5F0F A;  3GTP J;  3F0C A;  3HOZ J;  3BTI A;  1K83 J;  1Z0X A;  2VI6 A;  5EZH A;  1X2N A;  1P7J A;  4BY7 J;  4M3B A;  3BR1 A;  3CQZ J;  1T33 A;  3QPL A;  4XID A;  4GFB A;  5E3M A;  2XPV A;  2CU7 A;  1HF0 A;  2YS9 A;  2H8R A;  4XRS G;  4I6Z A;  1ZTR A;  3NAU A;  2X6O A;  1GV5 A;  5EGO B;  1ETO A;  4CYC A;  2DJN A;  3A02 A;  1FIP A;  1XS9 A;  2R7Z J;  1JTX A;  3VPR A;  5FLM J;  1AKH B;  2E2I J;  2L7F P;  2RAE A;  3CCY A;  5FKN A;  5FKM A;  3ZOB A;  1TWF J;  4MFE A;  2Y31 A;  1PUF A;  2X48 A;  5DS9 A;  4X1E A;  3JRB A;  2YUS A;  4HNV A;  5GP9 A;  1A6I A;  4MIM A;  2IBD A;  2JMW A;  3BR5 A;  3L1P A;  4IHW A;  1Z77 A;  2DA3 A;  2B63 J;  4A3M J;  5EF6 A;  3K7A J;  2EZI A;  4MLO A;  3TED A;  4A3E J;  2QCO A;  3K2A A;  1BA5 A;  2FQ4 A;  3WHB A;  3GTJ J;  2HXI A;  2NVT J;  3ZQC A;  4A3L J;  2XB5 A;  2PMZ N;  1MBK A;  3HKZ N;  3ZQG A;  2LKX A;  4FE4 A;  2K9S A;  4UUS A;  3RZD J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...