2EZIA

Solution nmr structure of the igamma subdomain of the mu end dna binding domain of mu phage transposase, 30 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
MNVHKSEFDEDAWQFLIADYLRPEKPAFRKCYERLELAAREHGWSIPSRATAFRRIQQLDEAMVVACREGEHALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords TRANSPOSASE
publication title Solution structure of the I gamma subdomain of the Mu end DNA-binding domain of phage Mu transposase.
pubmed doi rcsb
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1997-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eziA00
2HXOA 2L0KA 1ETQA 1MH3A 5F27A 3S15J 2R92J 4A3MJ 2HOAA 5F0HA 4DZPA 4DYCA 5EGOA 1B8IA 2NVTJ 3HOWJ 4DYQA 1DU6A 1G2HA 5IP9J 5EDNA 2W48A 3LOCA 1T33A 3TEDA 2Y0SN 5M5XJ 1RETA 4MIMA 1MSFC 4DZJA 2HOTA 3K7AJ 4FTHA 2KDZA 9ANTA 2DMPA 2WV1A 4D5CA 2L7FP 4RDUA 2X9DA 2NS7A 3JRGA 2GBYA 3GTGJ 2M8GX 4C3IJ 1IV6A 3ZQCA 4NDLA 2K9QA 2ECCA 1RKWA 4EEFG 2R5ZA 5FKLA 3CMYA 1GV5A 1IDYA 2JN6A 1BL0A 3A02A 1BW5A 4B1RA 2QF7A 3RZDJ 2X6OA 1JJ6C 1MNMC 2EZIA 1B72A 1ETYA 1ORKA 1W0UA 2CJJA 1OCPA 4FCYA 3GTQJ 4XIDA 1PUFA 2K40A 2L7MP 3PM1A 4QSHA 1U9OA 5FKOA 3JRAA 5F04A 4XK4A 2DMUA 2ME0A 4B4CA 3ZQFA 4W1UA 2GLOA 1H88C 5JLWA 4M6VA 2CRGA 2FJ1A 2ID3A 3HKZN 3Q0WA 4JP0A 3ZOBA 5DS9A 2DN0A 1ZQ3P 3LSPA 1HF0A 2WB1N 2E1OA 5J1UA 1IC8A 3HOYJ 3S17J 1GVDA 2KT0A 3JRFA 2XPVA 4BY1J 3HM5A 1MBHA 5EGOB 3BR0A 1SFOJ 1RKTA 5FKKA 3IV5A 1B8IB 3W6VA 4MFDA 2ID6A 1YRNA 2LY9A 4J19A 3Q0VA 1ZGWA 1HCRA 3TP0A 4ABZA 2E2HJ 1H8AC 5F1JA 2DMTA 2LR8A 4DYRA 3SDGA 3S1QJ 3JREA 1LFBA 1FTTA 4A3LJ 3I4MJ 3MKLA 3HGGA 3Q0UA 2R0QC 3G1OA 3CQZJ 4V2FA 1WPKA 2R5YA 3RKQA 1VI0A 2LK2A 3QPSA 1ETKA 2PMZN 1U8BA 1FIAA 4I6ZA 3BTCA 2Y31A 5GP9A 5F0CA 1FIPA 5DTDA 1IG7A 1T56A 3BTJA 1JTYA 3BQZA 1ITYA 2DMNA 1UHSA 3LSJA 1MBKA 2H8RA 2GM4A 1U78A 1BW6A 2G0EA 5K7HA 3H3VK 4A3KJ 4G12A 2E2IJ 5JLXA 1GUUA 1QRYA 3SFIA 4IEJA 3ZQGA 5IYBJ 2AO9A 2HXIA 1ZKGA 3LSGA 3IH2A 3FKIJ 1D5YA 2B63J 3GTPJ 3GTMJ 1JTXA 4BXXJ 3RZOJ 1EF4A 3JRHA 2H1KA 1Z77A 2MGQA 2M2EA 4AC0A 1QVUA 3BQYA 3VPRA 1H89C 2HI3A 4BY7J 1UG2A 1BA5A 2LFBA 1QPIA 2LVSA 2M0CA 5FKMA 1W0TA 4D7MA 1QVTA 4MFEA 2CU7A 1HDPA 3HOXJ 4IHYA 2HDDA 1MBEA 1ZR2A 2AHQA 2R5YB 3UKGA 3CCYA 1JGGA 2XPWA 3BR1A 3G1MA 1RR7A 1RESA 4X1EA 1JT6A 3GTOJ 1TWFJ 2OPTA 3S14J 3MN2A 1WCMJ 1XG1A 3HGYA 3BR3A 5F08A 2E19A 1JUMA 5C4JJ 1UMQA 3DCFA 3BR6A 1IUFA 3A03A 4MLOA 1WH5A 2JA8J 1ETWA 4HNVA 2VKEA 4IHXA 4A69C 3PO2J 1TWCJ 3HBLA 3S2DJ 1U9NA 2M9HA 1E3OC 2E2JJ 1HDDC 3A01A 3MVPA 2X48A 4A3JJ 1ETXA 4A3DJ 3S1RJ 2DA1A 2ECBA 4XRSG 5M3FJ 3OOUA 4A3CJ 5EG0B 2IEKA 1AU7A 1K61A 2DA7A 1A5JA 3GTKJ 1LFUP 3O8HA 2HOSA 5IP7J 5FLMJ 2IAIA 3NARA 1A6IA 5GPCA 3BTIA 3TP3A 1GDTA 4M3EA 3BR2A 5J3LA 2DA2A 5EF6A 4XRSA 3S1MJ 4C3JJ 4QTRA 4I76A 2JWTA 4RBOA 1GT0C 3TW6A 5FLVA 4CYCA 3BG9A 2DA5A 4C3HJ 2RAEA 3K2AA 1WH7A 2LP0A 3S16J 2Y30A 4A93J 1IDZA 2XRLA 4LOCA 1IRZA 4IHWA 5IYDJ 1O4XA 5M5YJ 3BG3A 1MH4A 4B3AA 5K7ZA 2ZB9A 5HODA 3JRCA 1Y1WJ 3GTLJ 1AKHB 2CQXA 1I3QJ 3WHBA 1NK2P 2EQRA 5EYRA 1HOMA 2XGEA 3Q3SA 5BNGA 2NS8A 1I6HJ 1S7EA 1P7IA 2Y9ZA 3A01B 3I4NJ 4MO7A 4BBSJ 4AYBN 5M3MJ 3FIWA 5FKNA 2P81A 2LD5A 1SANA 3HEFA 1FEXA 5J1YA 5E3OA 1NK3P 1MBJA 2JA7J 1R9TJ 3G1LA 4FISA 2DMQA 5IP6A 1NTCA 3BT9A 1TWAJ 4D7NA 4GFBA 4XRMA 1X2MA 3F0CA 3WHCA 2EBIA 2VPRA 1LE8B 1F43A 2O7OA 1X58A 3BTLA 3FK6A 3HOVJ 2EZKA 5EG0A 2XGDA 3LNQA 2DA6A 4A3IJ 5M5WJ 4M3DA 4JX5A 5IOYA 4CYCB 2QCOA 2D5VA 3B6AA 3ZQIA 3LSRA 4A3EJ 1RPWA 1IJWC 3JRBA 1MBGA 5IYCJ 3QQAA 2DA3A 1APLC 2R7ZJ 4FE4A 2NVYJ 3GTJJ 1DU0A 5K7FA 4IHVA 1FTZA 1JUSA 2LKXA 5IOZA 3FK7A 3CDLA 4L5EA 5C44J 1FJLA 2YUSA 3HDDA 2COBA 3RQIA 1Q1VA 4BKXA 2JMWA 1ETVA 4QIWN 2R93J 2EH3A 2DJNA 1JKOC 3OSGA 5EZHA 1BJZA 3TW7A 2XB5A 5E3LA 4S0HB 1AKHA 2LTPA 2MG4A 2HQ5A 4M3FA 2JJ7A 2JA6J 5E3NA 3M4OJ 3BR5A 2K9SA 2CUFA 5C4XJ 2ME6A 4FE7A 1WI3A 1XS9A 3B6CA 4DW6A 2I10A 2FX0A 2O8KA 1XC5A 2N8GA 1OJLA 4JX6A 2O9LA 3JR9A 1POGA 1CQTA 2YS9A 4V2GA 1JKPC 1TC3C 2YU9J 2Y9YA 4BBRJ 2NVXJ 4M3BA 3GBGA 1LE8A 2JK3A 1JUPA 3ZQLA 2K9NA 4UUSA 2L7ZA 2FD5A 4A3FJ 5GPAA 1P7JA 2Y2ZA 3QPLA 1F36A 1JKQC 3L1PA 5IPAA 5FJ8J 1VNDA 4M3GA 2IBDA 1JJ8C 1MBFA 4D5FA 1VFCA 3E7LA 2LLKA 1GV2A 2XGCA 1OCTC 3S1NJ 2EZLA 3D1NI 2DA4A 4Y7NJ 2HYJA 2JA5J 4X6AJ 2CQQA 3JRDA 3FISA 1ZTRA 3NAUA 2XSDC 3HOUJ 3ZQHA 3C2BA 5J1RA 2VI6A 5F0FA 4XICA 3H0GJ 4A3BJ 3IH3A 3M3YJ 1ZR4A 3S2HJ 5C3EJ 1K83J 2L9RA 2MW8A 2R5ZB 2NOGA 1AHDP 1ENHA 1I50J 1OFCX 1Z0XA 2TRTA 4JX4A 1B72B 2DTZA 5E3MA 1PUFB 1X2NA 2EZHA 1JT0A 4Y52J 3BG5A 3IH4A 1HLVA 1Y1VJ 2FQ4A 1MSEC 2VKVA 3O8GA 2TCTA 1ETOA 5EZGA 1IGNA 1TWHJ 1VF9A 2XB0X 5EEAA 2NVQJ 4UUSB 3DEWA 3PO3J 2OF7A 4W97A 4AUXA 3JRIA 2WAQN 4UUTA 1TWGJ 3HOZJ 4A3GJ 1ZK8A 3HB9A 3OSFA 2CUEA 2M34A 3OIOA 4JYKA 2MSYA 1YRNB 2VUMJ 3SJMA 4C2MJ 2XPUA 1WGXA 1JKRC 2ELKA
chains in the Genus database with same CATH superfamily
3OYIA 2ELJA 1GLNA 1WJCA 4KJZA 2ESNA 5F27A 4XQFA 1S3JA 5BQTA 3S15J 3LA7A 5LEJA 4UB6C 5HLIA 3BCBA 4PZJA 4DZPA 2IS2A 1G2HA 3FWEA 4IOAF 2MC4A 3TOBA 1VQ8I 3LAJA 2CFOA 3CJTB 3DEEA 4PJJA 1UZCA 1O3RA 4MIMA 3U1KA 1ZRFA 1R7JA 4BU2A 3CP2A 3RYRA 1TQIA 2O6GE 1D0XA 4OIRF 2CO5A 1J09A 3GFMA 4WK8F 2PLYA 4AVPA 1XD7A 1MMNA 4BH9A 1H9GA 2WC2A 3I56I 1VQNI 4C3IJ 3HKZA 4NDLA 2O61A 2K9QA 4G6TB 3BOQA 3CMYA 1GV5A 3A02A 2HTSA 4RAGA 2WB1A 3HHHA 2F5CA 3TBIA 2R7WA 1IXCA 3DTKA 3GTQJ 2X85A 4XIDA 1TL8A 1WVRA 3KFWX 4UV8A 5E18F 3K2ZA 4ETSA 4II2A 4HF2A 2VQHA 4Z2YA 1D5VA 2K27A 3OYDA 2GLOA 4HEA2 2JPBA 2Q1ZB 5ILVA 4FT8A 2CRGA 2FNPA 2F5VA 3VSKA 4AWXB 2CWEA 4JP0A 3J81K 2X6XA 3FM3A 2CW0F 1HF0A 4I0BA 1P4AA 2P0WA 5ERIA 2HQAA 4Y3OA 1G59A 2PJRA 2EA4A 3TDUC 1VQMI 2OQRA 1MBHA 5B1AH 5EGOB 3BR0A 3W6VA 3IV5A 3DPTA 3TOAA 3VFZA 2X1EA 3IRRA 5LHIA 4ABZA 4BACA 1H8AC 3L2QA 4BXFA 2FOKA 3AG1H 1SD6A 3SDGA 3NQOA 1TT0A 2E5ZA 4G7OF 3VYRB 2HDCA 4A3LJ 3I4MJ 2VASA 3QOPA 1X1PA 2QA4I 3G1OA 3MKYB 2R0QC 4F92B 2PMZN 2QM3A 1K79A 5DDGA 1U8BA 4ZYAA 1K78A 3K4KA 1QGPA 1I39A 2WAQA 2R3SA 4ENNA 2XKPA 2R7DA 3QAHA 5E1WA 3W3CA 2VIXA 2JRTA 3LA3A 2DMNA 4P9FA 3GZ6A 1YW8A 3MZYA 1QO0D 2GM4A 2HPMA 5K7HA 4MNUA 2O8XA 3ZMTA 4IVNA 2G7UA 1GUUA 2RKHA 3SFIA 5E8GA 4IEJA 3ZQGA 5IT3A 2OBPA 1MGTA 2QENA 1ZKGA 2AQEA 4J01A 4XBFA 1VQ4I 3IAS2 1SAXA 3GTPJ 5DCFA 2DAOA 3T5XA 2MFZA 1K4TA 2MGQA 1KZHA 4P1WA 5KHDA 3BQYA 1BC7C 3VPRA 2O3FA 3CCQI 4YG2F 3NRVA 2J5PA 2CV1A 1T38A 3MD2A 3VEPA 5ICGA 5FKMA 1O3SA 3OYBA 4D7MA 2L4AA 1QVTA 2YU3A 1T8IA 2E35A 1BIBA 4IHYA 1YS7A 1U5TC 2OZUA 4LG0A 2GXAA 3RYPA 3AG3H 4L9NA 2R5YB 4CCNA 1OR7A 1AOYA 3DLLF 3ZQ7A 1W5CC 1USSA 3PFYA 4EMSA 1C0WA 1RR7A 2BOLA 4IQJA 4EJUA 1MMAA 2ZSHB 1JT6A 3KLNA 1TWFJ 4I09A 2IGOA 1VQ6I 3M1CA 1IN7A 3S14J 2CGPA 2CQNA 3TQNA 3MN2A 4E7HA 3OYKA 3HGYA 1J59A 5B66C 3HOTA 1SC7A 5F08A 2E19A 3HXLA 5C4JJ 1NH3A 4YFKF 3BR6A 2ADUA 1IRFA 2RV8A 3QPTA 1D0YA 4RLFA 5CJ9A 4IHXA 1OYWA 4UNOA 3PO2J 1TWCJ 3AFHA 5D4SA 2IGMA 1F1ZA 2X48A 2Z2SB 3JW4A 2EIKH 4NBQA 1Y8QB 1HSTA 3L2RA 2VPLA 3ZRGA 5M3FJ 4A3CJ 3GF2A 3LSKA 4QPQA 4CCJA 5GADJ 1SFKA 3GTKJ 1P6RA 4HLXA 1LFUP 4B44A 5BPIA 5FLMJ 3PUBA 4CSWA 3AAFA 1GDTA 2KKOA 2DA2A 2R7TA 3SDBA 2KIMA 1YW7A 2GAUA 4GO1A 2E60A 1HW2A 3EPZA 2L9SA 4E4HA 2CW7A 5J47A 2QBYA 1U5TB 2DK5A 1FPQA 3LQRA 3RJPA 4L0YB 2QZ8A 1WH7A 2QQ8A 4FETA 3DWLE 2Y30A 5LEKA 3S16J 1Y56A 3ERED 3BCAA 3AG2H 4P9UA 1VQKI 3FMRA 2H6CA 4HYEA 3S3OA 5IYDJ 2FBKA 2YSRA 2BEOA 2E1CA 2FSWA 2DI3A 2DT5A 2QYOA 1MH4A 2P6TA 4OMZA 1FBUA 5LFAA 1W7PA 5H20A 4LK0F 1KA8A 4A0ZA 4BNCA 1YYVA 1HOMA 4E7SA 4X0GA 3GCMA 2BXZA 4N9IA 5DD8A 4C2TA 2B7EA 2HGCA 4M72A 1T39A 2Y9ZA 4HNTA 5EEHA 2K9MA 3FXRA 3I4NJ 4MO7A 3F8BA 5M3MJ 4B43A 1QZYA 4HQEA 3I5UA 1NK3P 5CPRB 2JA7J 1R9TJ 2Z16A 3P9IA 4FISA 1I3AA 1FMVA 2HVRA 5FD5A 1X2MA 2VJ4A 3SFZA 4OIQF 2M87A 4PJ0C 1F43A 2O7OA 4WXCA 2YX4A 3D5SC 2A68F 1A04A 2RNJA 3LQQA 5EG0A 2XGDA 1UG0A 1TP4A 4HBLA 5ICCA 3BY6A 2IGNA 2D5VA 2VB6A 3BJ6A 3LSRA 2O03A 4A3EJ 5TISC 1IJWC 3JRBA 3K1NA 2FNAA 1HXDA 1MBGA 3DF8A 2CS3A 4EV0A 2DA3A 1S9HA 1APLC 3C3WA 4FE4A 4Y4RA 1BR2A 4U0WA 1TW3A 1JUSA 2LKXA 3H5NA 5IOZA 2L7KA 3ISPA 2P4WA 2LG4A 2XSJC 1FJLA 2YUSA 2FEZA 3K4CA 3HDDA 4BKXA 1ETVA 2P5VA 2DJNA 3K4MA 5K5RA 3DTEA 2FF4A 2XB5A 4S0HB 4U7DA 3AL0C 3U21A 5HDKA 2IS4A 1Z21A 2AS5F 3TL4X 3I71A 5E3NA 5HNFA 2JA6J 3ECOA 3M4OJ 5DUIA 4E7LA 3FBNB 2CUFA 1OCOH 3C2HA 5C4XJ 2PG4A 3P9KA 2BY2A 5GAGJ 5LGUA 1XS9A 1YJNI 3H9QA 2FX0A 2LRDA 3I53A 1IZ1A 1FBSA 2DFIA 3GMEA 3D5LA 2HDWA 1J75A 1ZRDA 4Q48A 1CQTA 2E36A 4XMYA 5GAHJ 2KPMA 4BBRJ 1BR1A 1W4MA 2I8DA 3MZ8A 4GYGA 3GBGA 3CUQA 1LE8A 4Q4ZF 5D4RA 2JK3A 4RGSA 2FE3A 1JUPA 2VONA 3GFLA 2XDVA 3M7GA 2Z3YA 3AKZA 2XAJA 4CDGA 4ZDLA 4A3FJ 1T0FA 4BS9A 3QPLA 4JQFA 3REOA 1JKQC 4UY8I 4RA2A 2MBFA 4RM3A 2IBDA 1MKMA 4N0BA 1MBFA 4L9TA 1GV2A 4U88A 4EM1A 2BVLA 1IN8A 2EZLA 5LGTA 4BE0A 4LLNA 4Q5SF 2DA4A 2HKXA 2HYJA 4X6AJ 3GO5A 3JRDA 4RGRA 2JRMA 1ZTRA 1N78A 3BPXA 5L3FA 1YHQI 4LIUA 4UVBA 4KN7X 4XICA 3SQNA 4II3A 2CYYA 4EJOA 3J80Z 3M3YJ 2VBYA 3UR3C 1ZR4A 3GW2A 1ZYRF 3KP4A 2HEOA 4S04A 3ZN1A 3JTHA 2MW8A 3SZPA 1IRGA 1AHDP 3A2KA 2CUJA 2EPFA 4F91B 1EH8A 3CCJI 2P7CB 2YX7A 1KYZA 3N4MA 4JX4A 5CVIA 3AL0B 3J80K 4E7ZA 3QYFA 3I58A 1ZGAA 3CMAI 3KYCB 2KQRA 3BG5A 2K9LA 5LHGA 1WJ5A 2M3AA 1HLVA 1B6AA 2ZFUA 3EUAA 3WGHA 4FX0A 1TWHJ 3HSEA 1VQ9I 4UUSB 4ON0A 2A5WA 4O6JA 3PO3J 5FD6A 4W97A 2HZTA 2XROA 1TWGJ 3WTYC 3HOZJ 4A3GJ 3GZNB 1ZK8A 4G9YA 3TO9A 3DTIA 4O5VA 3OIOA 1YRNB 4B3XA 1XCBA 2XPUA 1R23A 1WGXA 2AQFA 2EA2A 4IL6C 4M74A 3K6GA 3H0DA 2HXOA 2L0KA 1P4WA 1R36A 2W4SA 2L4MA 4DYCA 5EGOA 2NRAC 3E6DA 1DU6A 5IP9J 4BEHA 2BVMA 3LOCA 2Y0SN 5M5XJ 5K5QA 3U1DA 4XN3A 3CF2A 3IWFA 4ENKA 4OOIA 1R4NB 2ZMEC 1Y0NA 4FTHA 3FBIB 3W6KB 4RDUA 3MFKA 4A6EA 1FY7A 5IY5H 1JI8A 5AIQA 2NS7A 3DPLC 2GBYA 5H6QA 3E6MA 4BGDA 4HNUA 3R61A 1RKWA 1OYYA 1V54H 2M0MA 1KQ9A 3H92A 4KMUX 5FKLA 1MD0A 2R5ZA 1ULYA 1D8KA 1T6SA 2QF7A 2CUZA 3RZDJ 3PSFA 1IF1A 3V7CA 2EZIA 1B72A 2F5FA 2CJJA 3G4SI 2K40A 3PM1A 1YI2I 3JRAA 3L2WA 3NEUA 2DMUA 3ZQFA 4W1UA 2M8EA 1LEBA 3LL7A 4PDKA 4OAZA 4PJLA 1XDUA 3CDIA 3E3VA 2H8WA 4M6VA 3V8KA 3HKZN 3Q0WA 1QA6A 3DXJF 2DN0A 4P5OA 5HS9A 3TDZC 1ZQ3P 3GFIA 3EYYA 5LD2C 2K02A 3V4GA 3WTUC 2WB1N 4JK1X 1R5HA 1AWCA 3CC4I 3F22A 5D8KB 1U3EM 5CKTA 1QPMA 1CGPA 2I5UA 3KP2A 3LFKA 3JRFA 4BY1J 3M8JA 4WXDA 2ZC2A 1YLFA 5DUKA 1G3TA 4DJAA 4UV9A 1RKTA 3HYIA 5FKKA 3CLQA 1P2FA 2ID6A 1K6OA 3H5AA 1W5TA 2E5NA 1ZGWA 3UNGC 3N05A 3IHUA 1RUOA 3DU6A 1IXSB 3I54A 2JZYA 1AA7A 2E34A 2DMTA 4DYRA 2AXLA 2BY0A 2RQQA 4RAZA 3S1QJ 1REPC 2R7QA 5LHHA 1JHFA 2XAGA 4I01A 2ZSIB 1D1CA 1V4RA 2W00A 2Z5UA 3MKLA 3Q0UA 3DBRB 4NUBA 3CQZJ 3ZN0A 2R5YA 3CO6C 1VI0A 4BAYA 3WTZA 3PJRA 5TGTA 1FIAA 4LJZF 4A5NA 3F21A 4I6ZA 5FLXZ 2DDAA 1LNWA 1Z05A 2ZMEB 5TJJA 2Q2EA 2Y31A 2ESHA 3O2PE 1KQ8A 2UXXA 2BHYA 5DTDA 2QQBA 1T56A 2VL8A 3WU0A 1JTYA 3RPUA 1YJ9I 3IKVA 1USTA 2DOFA 4PGHA 2M1BA 4A5MA 2A6EF 1BW6A 2G0EA 1IN5A 3MCZA 1E3HA 2E2IJ 1MJAA 1GXQA 3BP8A 3R4KA 4WX9A 5ILUA 1G3WA 2L9VA 5IYBJ 1OYIA 1RRJA 3OL3A 1YFHA 3CD6I 1BBYA 2ISZA 3E5XA 4EJVA 2VE9A 3VDXA 4F52A 3LSGA 2P6SA 2KJCA 2Y0SA 3GTMJ 1LJ9A 1JTXA 4BXXJ 2XKOA 2FXAA 3G6EI 3JRHA 1V5EA 2H1KA 2CFXA 3VYUB 2M2EA 4AC0A 5E1XA 5J40A 1O3TA 1H89C 2HI3A 2Q0OA 2KRFA 4BY7J 2VJ5A 3DBLB 5DM6F 1QPIA 2LVSA 1VZ0A 5JFRA 4S05A 1W0TA 3KYLA 1SVLA 4L0ZB 3L7WA 4MFEA 3HTSB 2CU7A 3J7AY 1HKTA 1HDPA 2EV0A 4BDZA 2HDDA 1MBEA 2LF7A 2X4HA 4PUSA 3BZ6A 2CQ7A 3HRTA 2ZJPF 4RGUA 2XPWA 2WAFA 5D6EA 4RM2A 3BR1A 1WI9A 2JTVA 3SXYA 1P92A 1RESA 1Z91A 3K4LA 3KLOA 1LUJB 2Z1DA 2CV0A 1J9IA 3CMMA 1U5TA 3CC7I 3GTOJ 5KVRA 2DW4A 4LMYA 1WKMA 2OPTA 3DEUA 4HOBA 2PI0A 2VQLA 3K70C 1GHCA 4G8XA 2STTA 2ZXWH 3HTUA 4HSRA 3DU5A 4PSXA 3BR3A 1JUMA 3RQ4A 4CXFA 2XAUA 3PIPF 2M4GA 5BMZA 4XOTA 1UMQA 4DQ2A 1FOWA 2VT2A 1BI3A 1IUFA 1QNTA 3WODF 4MLOA 4RGXA 2BGCA 5F1RA 2WWYA 1QU3A 4HNVA 1MMDA 1MDMB 4A69C 1XCVA 2DOAA 3FXMA 4N4NB 3PQKA 1RI7A 3PIOF 1W5SA 3KP7A 1E3OC 1QQIA 1HW5A 1Z6TA 3ZQQA 2ECBA 3BZKA 4C30A 2XUBA 2ACJA 2EK5A 2IEKA 4OAYA 2KFDA 2DA7A 3GFJA 4NB5A 1QHHD 2A3SA 4AU7A 3EYIA 1XSXA 5IP7J 3OYGA 1R5ID 4ZYHA 1BN5A 2X6WA 1KU7A 2IAIA 1BI1A 2OZ6A 3ERMA 1A6IA 1YX3A 2JSCA 4NQWB 4M3EA 3S1MJ 4KICA 3CMEI 5IT9Z 4YFNF 4UVAA 4I76A 4RBOA 4FHTA 1N25A 2VJIA 4NC8A 4I7HA 3FXKA 4KIBA 3TW6A 3OS2A 3I64A 1ZAOA 3E97A 1U6GA 2RAEA 1BJAA 3CZ6A 3K2AA 4BHCA 1V5FA 5DCMB 2NOJB 1XMAA 4BJ6C 4ZJZA 1IDZA 5IT9K 4LOCA 4F7ZA 4GDFA 1PP8F 2X1DA 3BDDA 3K10A 3KX2A 3OYEA 3S93A 5M5YJ 2M4KA 4K2EA 1LPQA 2PEXA 2ZB9A 4EQQA 1I1SA 2PN6A 1J2XA 2KDOA 3OYFA 3WHBA 1NK2P 1EKEA 1XTAA 2A69F 2IA0A 4BL0B 1Y39A 2CH0A 5BNGA 1I6HJ 5FGMA 1MJ9A 3BLYA 1S7EA 4HAMA 3R0JA 2EFOA 2CV2A 2R4GA 3ASOH 4AYBN 1RR8C 2P81A 2LD5A 4OU0A 3GYHX 5F6FA 1SANA 4HDUA 5E3OA 1MBJA 3EUKL 2WAEA 2OCEA 1OCCH 5IP6A 2KLOA 3BT9A 1TWAJ 1FNNA 4XLHA 3WU1B 4GFBA 3WHCA 1ODDA 2EBIA 4ZZDA 3ZMUA 2KZGA 3O3KA 1SAUA 3I3LA 3HOVJ 1UELB 2K4BA 1R5GA 5FROA 2Z33A 5E20A 3HSRA 2B9SA 3CTAA 1HW1A 1A36A 2M5WA 3FDYA 4CHUA 3LNQA 1GXPA 2DA6A 5BPDA 1D1AA 1JE8A 2KIFA 3ABKH 1OCRH 5M5WJ 3DBHB 4JX5A 1R6RA 4CYCB 2V6EA 3L9FA 1DQUA 1W36C 4IRHA 3BROA 3K4NA 4RS8A 2DO7A 3JSPA 2FBIA 3RTRA 2HQRA 3JCUC 1LVKA 3CC2I 3O6BB 2MLGA 2R7ZJ 2NVYJ 4LB5A 1IW7F 4IHVA 3IRQA 3U2RA 2NNNA 4BQNA 2WBMA 3QYBA 3GXOA 5ICFA 1IUYA 3CDLA 5ILSA 4L5EA 3W2AA 3IWZA 3RPQA 1Q1VA 4HV5A 4BQOA 2JMWA 4RB2C 4RAFA 3E1SA 4YRVA 1BJZA 5H6RA 3WG9A 3TW7A 4Y13A 5FRMA 2NXNB 3S3NA 1AKHA 2VBWA 3N97A 2HQ5A 2JJ7A 3CCMI 4XKVA 1DGWY 4IQ4A 2IXSA 3LSMA 1X4OA 2BV6A 1X1CA 4XSZF 3W2VA 2I10A 2GOMA 1XC5A 2A5YB 4WF2A 1DUXC 2DK8A 3GWZA 5E79C 4EGZA 3P5JA 2N8GA 1OJLA 3H35A 4JX6A 2O9LA 2V1NA 1K7AA 1FOYA 1V55H 4PFOA 3JR9A 1A31A 1TC3C 2YS9A 1T08B 1WJDA 2Y9YA 2VT3A 3U9GA 2HKOA 1LEAA 1FBQA 4M3BA 4MQVA 1D1BA 3H3UA 2PMUA 2E7XA 4DNCA 3Q5FA 4IHTA 2R7XA 1BIAA 1TW2A 4E7IA 4UUSA 3ZQLA 3H9JA 2QQAA 3OYCA 3RDIA 1F36A 3QU3A 3L1PA 5IPAA 1UCRA 5AONA 2VN2A 3A1YA 3HIFA 1YG2A 4D5FA 1VFCA 1XGSA 1I6XA 2X1CA 2ZXJA 1IN6A 2M30A 2HPIA 4U0YA 4EJWA 4AYBA 2LDUA 4MTEA 4IOCF 3GX4X 2F4MB 1PVEA 5D5WB 2XSDC 3M07A 3HOUJ 3ZQHA 3C2BA 3FHNA 5J1RA 5F0FA 1BOAA 2LSOA 4HRIA 5FFZA 3S2HJ 4NNJA 4B8XA 5JR3A 2IPQX 3WG7H 5HLTA 1XPXA 5C3EJ 3M8EA 4BQQA 2BY3A 2NOGA 1GVJA 2GIZA 4NC7A 1WWXA 5DV5A 4AIKA 3S8PA 3KYDB 5CVRA 4AIJA 2HTJA 2NS0A 4R8HA 3QYEA 4L9VA 3SHFA 4GXOA 2VLAA 1JT0A 3HC7A 4KT5C 4I02A 2DPDA 5D5XB 1B9NA 1Y1VJ 2BXYA 2PFBA 2TCTA 4XR6A 5J8CA 5EZGA 3RKWA 2VXZA 2ZCWA 2XB0X 3EETA 5EEAA 2NVQJ 1SFXA 1W7PD 2DDBA 2F5EA 3DEWA 5FB2A 1YITI 2EFPA 2XAHA 4KA4A 3E5UA 4GCVA 1ZN2A 4AUXA 5HS7A 1OQYA 2PJRB 5KCMA 4UUTA 2K7LA 4HF0A 4CA0A 2A6HF 2CUEA 1SVOA 1TZLA 2DQLA 1J7KA 1MNEA 2HR3A 2M34A 3M9AA 3P7NA 4A6DA 2VUMJ 1XB4A 5LRSA 4C2MJ 3SJMA 1KONA 3E6CC 3R60A 1FZPB 2ELKA 3E6BA 5EJCA 3COAC 2A05A 4CO8A 3BG7A 3CUOA 1ETQA 1MH3A 3SZTA 2DXIA 1HA8A 1T98A 4A3MJ 2HOAA 3ZMZA 1Z6RA 4DYQA 3HOWJ 1FYKA 2DQRA 1LVAA 2R7OA 4HF1A 2V1XA 2W48A 3H3ZA 1XGNA 3TEDA 1FYLA 4M6XA 4UXNA 2W57A 2ZXIA 3CCUI 1RETA 3S32A 1O57A 4DZJA 3L2UA 3K7AJ 1FMWA 3ASNH 2KDZA 4CH7A 1KQ0A 2ZNZA 3I0TA 2DMPA 2KRCA 4ZYGA 2L7FP 2ETHA 1XMKA 3H36A 2KZVA 4PCQA 3JRGA 2O5RA 3GTGJ 2M8GX 2ZJRF 1Z7UA 2FQ3A 2LYCA 4EEFG 4F55A 5ICEA 5HLGA 1IDYA 3OS0A 2ZBKA 1BW5A 3CCLI 3KPHA 1ZGJA 4XLEA 3S3MA 4I98B 2EV6A 2JPCA 1YS6A 1MNMC 2V6CA 1ORKA 4TV7A 2IA1A 4L9JA 4FCYA 3WTSC 1PUFA 4IXAA 1L3LA 4QSHA 3OYMA 2F5DA 4XK4A 5F04A 2D45A 4B4CA 2GZWA 4U87A 4IPAA 4E6KG 1S72I 4ZZLA 5JLWA 1ZH5A 3K9TA 1FWZA 2OUMA 5KAIC 3ZOBA 2RNGA 1UAAA 1TTYA 1D3YA 2X6YA 3V8JA 2DOEA 1TQMA 2ELHA 3VB2A 3LSPA 1OPCA 4HLYA 3OOPA 1R4MB 2E1OA 4M73A 5J1UA 2QEXI 2PX9A 2HU9A 1KU9A 3S17J 1GVDA 1EJ9A 1O3QA 2ISYA 1F5TA 2M7BA 3HM5A 3QODA 4YIRX 1B8IB 4LG0B 4MFDA 2LY9A 3ML6A 4MTDA 4J19A 3OR1C 4E7KA 2HVQA 1NG7A 1FSEA 3TP0A 2E2HJ 3DP7A 1KGSA 1XSVA 2DJIA 3PSIA 2G9WA 3K1PA 2LR8A 2V9KA 2DU9A 5E1ZB 2G7HA 3MWMA 1DP7P 4HPQA 4XLAA 3ULQB 1PP7U 3D5RC 4Y15A 2WTEA 3HGGA 2FU4A 3HPGA 1S8NA 4CYDA 1WPKA 2JSPA 3HUGB 5JHUA 1Z1DA 3EUHA 3GZ5A 3C1DA 2HOEA 5JI6A 3OS1A 1ZG5A 3LWFA 4RMNA 1J0RA 1X1AA 5F0CA 1FIPA 1IG7A 3P9CA 5JHFA 3S2WA 1ITYA 2XRNA 1MBKA 2E1NA 1UHMA 3LSJA 2QKLB 2H8RA 4G6QA 5J4VA 1U78A 2LH9A 3BC8A 3ZPLA 3ZMDA 3C2GA 3K1MA 3H3VK 2V1DA 3VODA 5JLXA 3W2WA 3CCRI 1VQLI 1HKSA 2YR2A 1RNLA 1ZLKA 3CESA 2AO9A 3F6OA 1V3FA 2HFHA 2W24A 1MDMA 3IH2A 3ZR8X 3OV8A 4RB3C 1D5YA 1G6NA 1WRJA 2H09A 5EEGA 4XSXF 3Q9SA 2QSFX 2JA2A 2R7SA 2DYSH 2JQ7A 5CYVA 3VYSB 2A6TA 3HG9A 4AVZA 1BA5A 2TDXA 3LSHA 1WJAA 2LFBA 3MKZA 2M0CA 1WJEA 3WTWC 5FFXA 3T8RA 1KU3A 4M9SA 2KRHA 2K4JA 3HZJA 1H9TA 2AHQA 1MJBA 2CSOA 3E5QA 5KAFC 3HL2A 3JAMZ 4NQWA 3MEXA 4OIOF 3UKGA 1FOKA 3W6JB 4IHSA 4V19K 2HWVA 4X1EA 2Z9OA 4IZZA 4ZH4F 1SFEA 3M8FA 2Z99A 2EINH 1SEUA 4LITA 3H9GA 4MHGA 3JAMK 3CF5F 2M7AA 5DCMA 3OWTA 2NVUB 3G71I 5FRNA 4B09A 3FHZA 3NWTA 2W82A 3KP5A 1LQ1A 3AG4H 3OYLA 4Z6YA 3OYHA 4P96A 3LSTA 2FRHA 4AIDA 4R1HA 2LREA 3A03A 1WH5A 3ZXSA 1B9MA 1X1DA 1IRXA 1DGRM 3F8NA 5DD4A 4LGWA 4ZDPA 4HSTA 2BBYA 3WTTC 1U9NA 2L3DA 2L9NA 4I2OA 5HVQC 1HDDC 1UB9A 3MVPA 4A3JJ 3PNYA 3CJRB 1ETXA 5LGNA 1TNSA 2FBHA 5CVUA 3S1RJ 2DA1A 4A3DJ 3OOUA 4B48A 4HX4A 2EIJH 4LB6B 1UFMA 5EG0B 1YE9A 1K61A 1AU7A 1A5JA 1S7OA 2UV1A 3DKWA 4PJNA 1QHGA 2VBXA 4IJAA 3VOEA 1CF7B 2JUCA 3NARA 1V5GA 1UHWA 5L3GA 3J7ZI 3BTIA 3TP3A 2K5CA 1B59A 2VKDA 4XRSA 4C3JJ 2PMHA 4XN0A 1GT0C 2VODA 2XF7A 4ENJA 5FLVA 4CYCA 1N75A 4BYYA 4HX7A 1PJRA 1FP2A 4C3HJ 4Q47A 3L2VA 4QWQA 2V26A 2JVHA 3HSFA 4B47A 3A4CA 1HKQA 1KYWA 2L02A 4A93J 3C18A 1QBJA 2NYXA 3TO7A 1X3WB 1IRZA 3G2BA 5E8IA 3BG3A 3DQVC 2LNBA 2ZFWA 1PYVA 5AIPA 4GRIA 2EFQA 4D9JA 5B1BH 2VXDA 5HNHA 2LF8A 2C6YA 1Y6IA 3CCSI 1I3QJ 4KITB 2EQRA 5EYRA 2MD0A 3M1EA 2XAFA 3K69A 4KIGA 1B4AA 5FLXK 3V7SA 3A01B 3V7RA 4CCOA 2KIUA 1E3PA 1O7FA 2HYFA 2BYVE 2DFFA 2OU2A 3FIWA 5J8FA 4BBSJ 1LDDA 2OCCH 2A61A 2VKHA 1U2WA 3IL2A 5J1YA 3KIOA 3ABLH 1F9NA 1L0OC 3G1LA 3B73A 3GUDA 3RIRA 1OISA 2DMQA 3J7YJ 4FX4A 1NTCA 5BS6A 3DV8A 4HV6A 1ACIA 3F6VA 3LMMA 1LE8B 1X58A 5J4YA 2LY2A 2UZKA 5TRDA 2DTRA 2EILH 4UUVA 4YEJA 3RPUD 1Z7LA 1LKXA 4A3IJ 3V8LA 1SD5A 2L2OA 4XONA 4NHJA 1BOBA 2QCOA 1I1GA 1ZHFA 3LA2A 2IP2A 4BHPA 1IO2A 4LLGF 1RPWA 1IN4A 4BXUA 1U0JA 4KUMA 5IYCJ 5E17F 3QQAA 2ICWG 2UWMA 1FP1D 2K86A 3RSNA 5HDNA 3CCVI 1DU0A 4ZDOA 1FTZA 3OY9A 3BJOA 4MGRA 1Z67A 3JSOA 4BQAA 3FXQA 2IGKA 4MEYF 5C44J 1MNDA 2OTLI 1NHAA 2ZNYA 4QIWN 2QVOA 3BWGA 2EV5A 2GQQA 3MQ0A 1Z9CA 4KT6A 3FXJA 3L2CA 1TBXA 5EZHA 2R7UA 3A0HC 3PFIA 4DBRA 2M45A 1O7LA 5LRRA 2LTPA 2MG4A 1WJBA 2PQ8A 1Q1HA 3QWLA 1WSUA 4AM3A 3EDPA 3HRSA 4MQ9F 3BJAA 2K9SA 2Y69H 2XF6A 3I9V2 2ME6A 3WE3A 4FE7A 1WI3A 5LBQA 1BI0A 2E71A 4AD9A 4DIQA 3IKTA 3MMYB 1TLHB 4GYIA 5L3DA 4DW6A 2O8KA 2W25A 5GAEJ 1ERDA 3J81Z 1W36D 1X3ZB 2W7NA 2WY7Q 4XM3A 4OIPF 3LAPA 4V2GA 1JKPC 2YU9J 2ZXHA 4GGGA 2QKMB 3KE2A 2NVXJ 2CW8A 4XKBA 4C2UA 4FQGA 2BW3B 2EJRA 3HRMA 4A12A 5B5EC 4KISA 2D1VA 1VQ5I 1STZA 3PQJA 4KN4X 2L7ZA 2GIVA 5CQEA 3DLAA 2YPRA 5GPAA 1R58A 1VNDA 2D2WA 4M3GA 1JJ8C 1XSDA 5CVVA 2VJJA 4I0AA 4LFUA 2NAZA 4BEHB 4Y7NJ 2FMLA 4PFPA 1G3SA 1OKRA 2XIGA 2JA5J 3V42A 4DBQA 5L3EA 4E70A 2CQQA 2CG4A 2QWWA 3GVAA 1OMIA 4J00A 2JVGA 2VI6A 3H0GJ 1XMXA 1SMYF 4YELA 3KP3A 1H0MA 3I59B 5L3CA 2R5ZB 3ZMSA 3WE2A 1I50J 3K4BA 2BZTA 1Z0XA 3VYTB 1MZBA 5DEQA 5HDGA 2R7FA 3ABTA 1T2KA 1B72B 1MIJA 5E3MA 2KIQA 5FO5A 4N4OB 4EATA 2P7VB 2QGUA 2Q8KA 2MLKA 2XVCA 1N77A 1S29A 3BG6A 2E1MC 1I5ZA 2DYRH 2MH2A 1MSEC 2VKVA 2XASA 3O8GA 3RCOA 4RB1A 1VF9A 1YJWI 2XGXA 3FXUA 4A0XA 2STWA 4MEXF 3LFUA 1DPUA 3WGGA 3JRIA 1TT5B 3GLLA 4H4KC 4CGZA 4G6DA 3HB9A 1DPRA 1WJFA 2MSYA 2F48A 2GA2A 2BHZA 1NG6A 1JKRC 3KCCA 2FOWA 4JBAA 4LG3A 4HW0A 1PUEE 4YIIA 2OQGA 2LBFB 4BE1A 3FF5A 3SYTA 2R92J 1E2XA 2WA0A 3TKYA 1S6LA 5F0HA 2V9VA 3ELKA 1B8IA 1WQ2A 2NVTJ 2HYGD 4PGGA 4BJTA 1FYMA 1WZ2A 3VSLA 3DFGA 5EDNA 3DKYA 3NWSA 1MMSA 1T33A 1RZ4A 1UJ8A 2XHKA 3HJEA 1X1BA 1R00A 1R71A 1MSFC 4KIFA 4OINF 2HOTA 3ESWB 3B02A 4DGWB 9ANTA 2HNHA 1BI2A 2Q2EB 2NNYA 2WV1A 4D5CA 2X9DA 2IVMA 4CUGA 1SD4A 1XDSA 4WXHA 2EB7A 3C7JA 1IV6A 2LC2A 3ZQCA 2WV0A 3WTXC 2H94A 3HUGA 2ECCA 1EH7A 2JN6A 1BL0A 2HS5A 4B1RA 2X6OA 1JJ6C 1XN7A 1Z3XA 4C9YA 2XF5A 2KL4A 1ETYA 1W0UA 4M9XA 1OCPA 4G94A 2L7MP 5FKOA 3TGNA 5JVTA 1U9OA 5DYMA 1SMTA 2XAQA 3SEZA 3OYNA 2ME0A 4RLQA 5CVJA 4BDYA 1E0EA 4ZYEA 1BM9A 1H88C 3IAM2 4F3QA 2E1MB 4UHTA 1A6QA 1D8JA 5JVGF 2FJ1A 2ID3A 4HX8A 5DS9A 1YTYA 2RN7A 2X51A 1MMGA 4ASNA 2XC7A 4P55A 1B1BA 4AIHA 1IC8A 3PNVA 3ZGKA 1ZELA 3KZZA 4ITVA 4XOPA 3HOYJ 4G7ZF 2KT0A 2XPVA 4L5IA 4ENMA 2PMZA 5KNLA 1SFOJ 4HQMA 2IJLA 2CQKA 2OJED 5J6XA 1YRNA 3Q0VA 2RQPA 1HCRA 2OC6A 2MH9A 4QPOA 2H6BA 3IC7A 3ZCOA 2VQCA 4XL9A 5F1JA 4HZFA 2EFWA 4CICA 2DBBA 1FT9A 3JREA 1LFBA 1EV7A 1FTTA 2K3PA 5D5UB 3WTVC 4XLFA 3F23A 2DFEA 3QP6A 3VWBA 3RKQA 4V2FA 1HC8A 3QRFF 1D0ZA 2LK2A 3QPSA 1ETKA 4BUPA 1S7AA 3T1BA 1ON2A 2JT1A 1EH6A 1X19A 3BTCA 4PK4A 1G4DA 3FM5A 5GP9A 1WFXA 3BTJA 4A0YA 4XLPF 1X3UA 3BQZA 2LOOA 5GTIC 1UHSA 2QUFA 1RIOH 2QSGX 4EVIA 4IKFA 4XKCA 1R1TA 2HVSA 4UVCA 2P5LC 4G12A 1MW7A 4A3KJ 2ZJ2A 3GEZA 4QLCU 3BPVA 3RI4A 1YIOA 1QRYA 3OMYA 3TMOA 1S5LC 4KDPA 2IT0A 5ED4A 4ZTJA 2A07F 4ESJA 2LKPA 2DFHA 2HXIA 3L00A 3T0YA 2L54A 3FKIJ 2B63J 6PAXA 2GWRA 1W1WE 3FZVA 2WY8Q 3RZOJ 4FASD 1EF4A 2MA3A 1Z77A 3CJNA 1Z3YA 3KZYA 1QVUA 4IF4A 2RGVA 1OR7C 2OA4A 1UG2A 4HDVA 2COMA 2F4OB 4CCMA 2H1LA 3ABMH 1LB2A 1LDKB 3CLOA 3HOXJ 1VQ7I 1Y0UA 1P4XA 1CF7A 2BE5F 1ZR2A 4BHBA 3H1CA 4U7BA 1YO5C 2V7FA 3CCYA 2IS1A 4F93B 1JGGA 4M6YA 4ESBA 3CCEI 2WADA 1K78B 3G1MA 3R6SA 3F8MA 4BJ5C 5BOXA 2DT7B 3ONQA 2RREA 3KEYA 1HQCA 5GTHC 1SD7A 3RKYA 2R7RA 1WCMJ 1I27A 2DLLA 1XG1A 4YIFA 2ZMEA 2UUZA 3ZMVA 3KP6A 2AXTC 2MC3A 3PNTA 4ZYDA 4XLCA 2K3FA 3DCFA 3OL4A 2VOPA 2QSHX 2JA8J 1ETWA 4WWCA 3DKXA 2VKEA 4IRGA 1IXRC 4WCGA 4OMYA 3HBLA 4IO9F 1IV8A 3S2DJ 1QZEA 2M9HA 3SZGA 4CZCA 1U8RA 2E2JJ 3A01A 4N9HA 1G3YA 3HRUA 5D6FA 2HZDA 2QLZA 2W84A 1PDNC 4XRSG 1G8XA 4UB8C 4L5JA 2RDPA 2EIMH 2CMPA 2XV4S 2VC0A 4XRFA 4RB0A 3O8HA 2ZO4A 5F64A 3T8TA 5A2QZ 2HOSA 2F4IA 3I55I 1QZZA 1HSJA 5GPCA 5DM7F 2VOOA 3QPHA 2EWNA 3F3XA 3QP5A 4XLNF 3BR2A 1FC3A 5J3LA 5EF6A 3J7AO 2VBZA 3HPHA 4QTRA 2JWTA 2OTJI 1OLTA 3OIPA 1T95A 3X2QH 3D0SA 1JHHA 3CJQB 3BG9A 2DA5A 3CP8A 5A2QK 2H27A 3LSIA 1ON1A 2LP0A 3RKXA 3OIQA 2XRLA 1YX5A 3MAJA 1ZG1A 4CZZA 4KMFA 2KP6A 3FXOA 3L09A 4ZC3A 5HOOA 3CO7C 3FXLA 1YW9A 4IHWA 2FUG2 1O4XA 1E17A 2RVCA 3PUFA 4XNFA 2V4JC 4LLLA 4B3AA 4EM0B 5K7ZA 5K1YA 3G3ZA 5HODA 3JRCA 1Y1WJ 2MABA 3ABUA 3K4JA 5CQGA 2CQXA 1AKHB 3GTLJ 3SEQA 3OR2C 4JOMA 3FMQA 3KEQA 2MD5A 2XGEA 3Q3SA 2NS8A 1EA3A 1A35A 1P7IA 1BC8C 1ZLJA 2OV7A 5D8LB 2PJPA 2Y75A 2EFNA 5FKNA 1ZARA 2FMYA 3HHGA 2W85A 3HEFA 3I4PA 1FEXA 2GOXB 2KMUA 2L01A 2Y0MA 4LIVA 5HS8A 3FX3A 2JUGA 4D7NA 4XRMA 3F0CA 4D1QA 2VPRA 5D5VB 1LFPA 3BTLA 3FK6A 4XKWA 3F72A 4H0EA 2EZKA 4Y17A 2MYSA 3G73A 1ONVA 4M71A 2KJBA 4OWRB 1BR4A 2VE8A 3ECHA 1FLIA 4M3DA 5IOYA 2QBYB 3A0BC 4M9ZA 3MKWB 1X4PA 1SFUA 4IRIA 4EGYA 3B6AA 3ZQIA 1ZG3A 3BZCA 2BW3A 2LKSA 4EJTA 2PBIA 3DPUA 2GXBA 1FSHA 2IRFG 4LK1F 3ZP5A 1J5YA 4Y33A 3GTJJ 3F8FA 5K7FA 3WU2C 1YIJI 2LMDA 3KEOA 2O0YA 2RC4A 2F6CA 3FK7A 3ROUA 4HG2A 1W7PB 4G7HF 2DT6A 4ANJA 2K85A 4KNYA 2COBA 3RQIA 1YOVB 2OAZA 3MZHA 2R93J 1M1EB 2EH3A 2P5KA 2P8TA 1JKOC 3OSGA 1R22A 3K0LA 1JXSA 2Y48A 1DP3A 4PSWA 1WHUA 4RAYA 1IAWA 1Y8RB 5E3LA 2X0LA 3F9KA 4M3FA 2OD5A 3KETA 4O3MA 3BR5A 3I59A 3TO6A 2V79A 5B3SH 3CUQC 2BY1A 3B6CA 2DODA 3JTGA 3OYJA 4KYWA 3QOEA 2GA1A 1ZREA 1T0FC 2KHMA 3Q9VA 1POGA 4ESFA 5H2FC 1DDNA 2V9PA 1TNTA 4L18B 2ZKZA 1K6YA 4XORA 2GXGA 2K9NA 2FD5A 2VC1A 3OYAA 2E7WA 3PL8A 1P7JA 2F2EA 2Y2ZA 3E0JB 1R1UA 4BE2A 3K70D 2J5OA 5FJ8J 2IW5A 2ZJQF 3E7LA 1HBXG 2LLKA 4HA8A 2DPUA 1YQAA 2XGCA 4DOZA 4CCKA 1OCTC 3S1NJ 3GLXA 3D1NI 3EUHC 2R7VA 3FISA 3QU6A 3NAUA 4NC6A 3IP4B 1R49A 1XX5A 2LBFA 4EM2A 2IS6A 1SVMA 2B0LA 3F8CA 1FX7A 1R1VA 5CLSA 4A3BJ 3IH3A 4IX7A 4D0PA 1VTNC 1K83J 3EQLF 2L9RA 2V1UA 1LDJA 3H5RA 1ENHA 3WGIA 5HLHA 2HQNA 3FMSA 3R0AA 1OFCX 5L3BA 4KFCA 2UXNA 4CCLA 2TRTA 2L5QA 1TQPA 4PJMA 3FKJA 2DTZA 1FOXA 2KISA 4I99C 1XGMA 1PUFB 1X2NA 1P9QC 2EZHA 5LLQA 2W1OA 1RUNA 4Y52J 3CDHA 5K5OA 5KK1A 3IH4A 2D1HA 2FQ4A 3CUQB 1VQOI 1ETOA 3HOSA 1RC9A 1IGNA 1F4KA 2VQGA 2LY1A 1ZRCA 4YFXF 4A2UA 4R79A 2OF7A 1OCZH 2WAQN 1XGOA 3KZIC 4LD5A 3IUOA 1K4SA 4E7JA 3OSFA 4U0VA 1KU2A 4JYKA 2QQ9A 1VQPI 2IA2A 4ZTFA 2DCEA 2FA5A 1JGSA
chains in the Genus database with same CATH topology
2HXOA 2L0KA 1ETQA 1MH3A 5F27A 3S15J 2R92J 4A3MJ 2HOAA 5F0HA 4DZPA 4DYCA 5EGOA 1B8IA 2NVTJ 3HOWJ 4DYQA 1DU6A 1G2HA 5IP9J 5EDNA 2W48A 3LOCA 1T33A 3TEDA 2Y0SN 5M5XJ 1RETA 4MIMA 1MSFC 4DZJA 2HOTA 3K7AJ 4FTHA 2KDZA 9ANTA 2DMPA 2WV1A 4D5CA 2L7FP 4RDUA 2X9DA 2NS7A 3JRGA 2GBYA 3GTGJ 2M8GX 4C3IJ 1IV6A 3ZQCA 4NDLA 2K9QA 2ECCA 1RKWA 4EEFG 2R5ZA 5FKLA 3CMYA 1GV5A 1IDYA 2JN6A 1BL0A 3A02A 1BW5A 4B1RA 2QF7A 3RZDJ 2X6OA 1JJ6C 1MNMC 2EZIA 1B72A 1ETYA 1ORKA 1W0UA 2CJJA 1OCPA 4FCYA 3GTQJ 4XIDA 1PUFA 2K40A 2L7MP 3PM1A 4QSHA 1U9OA 5FKOA 3JRAA 5F04A 4XK4A 2DMUA 2ME0A 4B4CA 3ZQFA 4W1UA 2GLOA 1H88C 5JLWA 4M6VA 2CRGA 2FJ1A 2ID3A 3HKZN 3Q0WA 4JP0A 3ZOBA 5DS9A 2DN0A 1ZQ3P 3LSPA 1HF0A 2WB1N 2E1OA 5J1UA 1IC8A 3HOYJ 3S17J 1GVDA 2KT0A 3JRFA 2XPVA 4BY1J 3HM5A 1MBHA 5EGOB 3BR0A 1SFOJ 1RKTA 5FKKA 3IV5A 1B8IB 3W6VA 4MFDA 2ID6A 1YRNA 2LY9A 4J19A 3Q0VA 1ZGWA 1HCRA 3TP0A 4ABZA 2E2HJ 1H8AC 5F1JA 2DMTA 2LR8A 4DYRA 3SDGA 3S1QJ 3JREA 1LFBA 1FTTA 4A3LJ 3I4MJ 3MKLA 3HGGA 3Q0UA 2R0QC 3G1OA 3CQZJ 4V2FA 1WPKA 2R5YA 3RKQA 1VI0A 2LK2A 3QPSA 1ETKA 2PMZN 1U8BA 1FIAA 4I6ZA 3BTCA 2Y31A 5GP9A 5F0CA 1FIPA 5DTDA 1IG7A 1T56A 3BTJA 1JTYA 3BQZA 1ITYA 2DMNA 1UHSA 3LSJA 1MBKA 2H8RA 2GM4A 1U78A 1BW6A 2G0EA 5K7HA 3H3VK 4A3KJ 4G12A 2E2IJ 5JLXA 1GUUA 1QRYA 3SFIA 4IEJA 3ZQGA 5IYBJ 2AO9A 2HXIA 1ZKGA 3LSGA 3IH2A 3FKIJ 1D5YA 2B63J 3GTPJ 3GTMJ 1JTXA 4BXXJ 3RZOJ 1EF4A 3JRHA 2H1KA 1Z77A 2MGQA 2M2EA 4AC0A 1QVUA 3BQYA 3VPRA 1H89C 2HI3A 4BY7J 1UG2A 1BA5A 2LFBA 1QPIA 2LVSA 2M0CA 5FKMA 1W0TA 4D7MA 1QVTA 4MFEA 2CU7A 1HDPA 3HOXJ 4IHYA 2HDDA 1MBEA 1ZR2A 2AHQA 2R5YB 3UKGA 3CCYA 1JGGA 2XPWA 3BR1A 3G1MA 1RR7A 1RESA 4X1EA 1JT6A 3GTOJ 1TWFJ 2OPTA 3S14J 3MN2A 1WCMJ 1XG1A 3HGYA 3BR3A 5F08A 2E19A 1JUMA 5C4JJ 1UMQA 3DCFA 3BR6A 1IUFA 3A03A 4MLOA 1WH5A 2JA8J 1ETWA 4HNVA 2VKEA 4IHXA 4A69C 3PO2J 1TWCJ 3HBLA 3S2DJ 1U9NA 2M9HA 1E3OC 2E2JJ 1HDDC 3A01A 3MVPA 2X48A 4A3JJ 1ETXA 4A3DJ 3S1RJ 2DA1A 2ECBA 4XRSG 5M3FJ 3OOUA 4A3CJ 5EG0B 2IEKA 1AU7A 1K61A 2DA7A 1A5JA 3GTKJ 1LFUP 3O8HA 2HOSA 5IP7J 5FLMJ 2IAIA 3NARA 1A6IA 5GPCA 3BTIA 3TP3A 1GDTA 4M3EA 3BR2A 5J3LA 2DA2A 5EF6A 4XRSA 3S1MJ 4C3JJ 4QTRA 4I76A 2JWTA 4RBOA 1GT0C 3TW6A 5FLVA 4CYCA 3BG9A 2DA5A 4C3HJ 2RAEA 3K2AA 1WH7A 2LP0A 3S16J 2Y30A 4A93J 1IDZA 2XRLA 4LOCA 1IRZA 4IHWA 5IYDJ 1O4XA 5M5YJ 3BG3A 1MH4A 4B3AA 5K7ZA 2ZB9A 5HODA 3JRCA 1Y1WJ 3GTLJ 1AKHB 2CQXA 1I3QJ 3WHBA 1NK2P 2EQRA 5EYRA 1HOMA 2XGEA 3Q3SA 5BNGA 2NS8A 1I6HJ 1S7EA 1P7IA 2Y9ZA 3A01B 3I4NJ 4MO7A 4BBSJ 4AYBN 5M3MJ 3FIWA 5FKNA 2P81A 2LD5A 1SANA 3HEFA 1FEXA 5J1YA 5E3OA 1NK3P 1MBJA 2JA7J 1R9TJ 3G1LA 4FISA 2DMQA 5IP6A 1NTCA 3BT9A 1TWAJ 4D7NA 4GFBA 4XRMA 1X2MA 3F0CA 3WHCA 2EBIA 2VPRA 1LE8B 1F43A 2O7OA 1X58A 3BTLA 3FK6A 3HOVJ 2EZKA 5EG0A 2XGDA 3LNQA 2DA6A 4A3IJ 5M5WJ 4M3DA 4JX5A 5IOYA 4CYCB 2QCOA 2D5VA 3B6AA 3ZQIA 3LSRA 4A3EJ 1RPWA 1IJWC 3JRBA 1MBGA 5IYCJ 3QQAA 2DA3A 1APLC 2R7ZJ 4FE4A 2NVYJ 3GTJJ 1DU0A 5K7FA 4IHVA 1FTZA 1JUSA 2LKXA 5IOZA 3FK7A 3CDLA 4L5EA 5C44J 1FJLA 2YUSA 3HDDA 2COBA 3RQIA 1Q1VA 4BKXA 2JMWA 1ETVA 4QIWN 2R93J 2EH3A 2DJNA 1JKOC 3OSGA 5EZHA 1BJZA 3TW7A 2XB5A 5E3LA 4S0HB 1AKHA 2LTPA 2MG4A 2HQ5A 4M3FA 2JJ7A 2JA6J 5E3NA 3M4OJ 3BR5A 2K9SA 2CUFA 5C4XJ 2ME6A 4FE7A 1WI3A 1XS9A 3B6CA 4DW6A 2I10A 2FX0A 2O8KA 1XC5A 2N8GA 1OJLA 4JX6A 2O9LA 3JR9A 1POGA 1CQTA 2YS9A 4V2GA 1JKPC 1TC3C 2YU9J 2Y9YA 4BBRJ 2NVXJ 4M3BA 3GBGA 1LE8A 2JK3A 1JUPA 3ZQLA 2K9NA 4UUSA 2L7ZA 2FD5A 4A3FJ 5GPAA 1P7JA 2Y2ZA 3QPLA 1F36A 1JKQC 3L1PA 5IPAA 5FJ8J 1VNDA 4M3GA 2IBDA 1JJ8C 1MBFA 4D5FA 1VFCA 3E7LA 2LLKA 1GV2A 2XGCA 1OCTC 3S1NJ 2EZLA 3D1NI 2DA4A 4Y7NJ 2HYJA 2JA5J 4X6AJ 2CQQA 3JRDA 3FISA 1ZTRA 3NAUA 2XSDC 3HOUJ 3ZQHA 3C2BA 5J1RA 2VI6A 5F0FA 4XICA 3H0GJ 4A3BJ 3IH3A 3M3YJ 1ZR4A 3S2HJ 5C3EJ 1K83J 2L9RA 2MW8A 2R5ZB 2NOGA 1AHDP 1ENHA 1I50J 1OFCX 1Z0XA 2TRTA 4JX4A 1B72B 2DTZA 5E3MA 1PUFB 1X2NA 2EZHA 1JT0A 4Y52J 3BG5A 3IH4A 1HLVA 1Y1VJ 2FQ4A 1MSEC 2VKVA 3O8GA 2TCTA 1ETOA 5EZGA 1IGNA 1TWHJ 1VF9A 2XB0X 5EEAA 2NVQJ 4UUSB 3DEWA 3PO3J 2OF7A 4W97A 4AUXA 3JRIA 2WAQN 4UUTA 1TWGJ 3HOZJ 4A3GJ 1ZK8A 3HB9A 3OSFA 2CUEA 2M34A 3OIOA 4JYKA 2MSYA 1YRNB 2VUMJ 3SJMA 4C2MJ 2XPUA 1WGXA 1JKRC 2ELKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXO A;  2L0K A;  1ETQ A;  1MH3 A;  5F27 A;  3S15 J;  2R92 J;  4A3M J;  2HOA A;  5F0H A;  4DZP A;  4DYC A;  5EGO A;  1B8I A;  2NVT J;  3HOW J;  4DYQ A;  1DU6 A;  1G2H A;  5IP9 J;  5EDN A;  2W48 A;  3LOC A;  1T33 A;  3TED A;  2Y0S N;  5M5X J;  1RET A;  4MIM A;  1MSF C;  4DZJ A;  2HOT A;  3K7A J;  4FTH A;  2KDZ A;  9ANT A;  2DMP A;  2WV1 A;  4D5C A;  2L7F P;  4RDU A;  2X9D A;  2NS7 A;  3JRG A;  2GBY A;  3GTG J;  2M8G X;  4C3I J;  1IV6 A;  3ZQC A;  4NDL A;  2K9Q A;  2ECC A;  1RKW A;  4EEF G;  2R5Z A;  5FKL A;  3CMY A;  1GV5 A;  1IDY A;  2JN6 A;  1BL0 A;  3A02 A;  1BW5 A;  4B1R A;  2QF7 A;  3RZD J;  2X6O A;  1JJ6 C;  1MNM C;  2EZI A;  1B72 A;  1ETY A;  1ORK A;  1W0U A;  2CJJ A;  1OCP A;  4FCY A;  3GTQ J;  4XID A;  1PUF A;  2K40 A;  2L7M P;  3PM1 A;  4QSH A;  1U9O A;  5FKO A;  3JRA A;  5F04 A;  4XK4 A;  2DMU A;  2ME0 A;  4B4C A;  3ZQF A;  4W1U A;  2GLO A;  1H88 C;  5JLW A;  4M6V A;  2CRG A;  2FJ1 A;  2ID3 A;  3HKZ N;  3Q0W A;  4JP0 A;  3ZOB A;  5DS9 A;  2DN0 A;  1ZQ3 P;  3LSP A;  1HF0 A;  2WB1 N;  2E1O A;  5J1U A;  1IC8 A;  3HOY J;  3S17 J;  1GVD A;  2KT0 A;  3JRF A;  2XPV A;  4BY1 J;  3HM5 A;  1MBH A;  5EGO B;  3BR0 A;  1SFO J;  1RKT A;  5FKK A;  3IV5 A;  1B8I B;  3W6V A;  4MFD A;  2ID6 A;  1YRN A;  2LY9 A;  4J19 A;  3Q0V A;  1ZGW A;  1HCR A;  3TP0 A;  4ABZ A;  2E2H J;  1H8A C;  5F1J A;  2DMT A;  2LR8 A;  4DYR A;  3SDG A;  3S1Q J;  3JRE A;  1LFB A;  1FTT A;  4A3L J;  3I4M J;  3MKL A;  3HGG A;  3Q0U A;  2R0Q C;  3G1O A;  3CQZ J;  4V2F A;  1WPK A;  2R5Y A;  3RKQ A;  1VI0 A;  2LK2 A;  3QPS A;  1ETK A;  2PMZ N;  1U8B A;  1FIA A;  4I6Z A;  3BTC A;  2Y31 A;  5GP9 A;  5F0C A;  1FIP A;  5DTD A;  1IG7 A;  1T56 A;  3BTJ A;  1JTY A;  3BQZ A;  1ITY A;  2DMN A;  1UHS A;  3LSJ A;  1MBK A;  2H8R A;  2GM4 A;  1U78 A;  1BW6 A;  2G0E A;  5K7H A;  3H3V K;  4A3K J;  4G12 A;  2E2I J;  5JLX A;  1GUU A;  1QRY A;  3SFI A;  4IEJ A;  3ZQG A;  5IYB J;  2AO9 A;  2HXI A;  1ZKG A;  3LSG A;  3IH2 A;  3FKI J;  1D5Y A;  2B63 J;  3GTP J;  3GTM J;  1JTX A;  4BXX J;  3RZO J;  1EF4 A;  3JRH A;  2H1K A;  1Z77 A;  2MGQ A;  2M2E A;  4AC0 A;  1QVU A;  3BQY A;  3VPR A;  1H89 C;  2HI3 A;  4BY7 J;  1UG2 A;  1BA5 A;  2LFB A;  1QPI A;  2LVS A;  2M0C A;  5FKM A;  1W0T A;  4D7M A;  1QVT A;  4MFE A;  2CU7 A;  1HDP A;  3HOX J;  4IHY A;  2HDD A;  1MBE A;  1ZR2 A;  2AHQ A;  2R5Y B;  3UKG A;  3CCY A;  1JGG A;  2XPW A;  3BR1 A;  3G1M A;  1RR7 A;  1RES A;  4X1E A;  1JT6 A;  3GTO J;  1TWF J;  2OPT A;  3S14 J;  3MN2 A;  1WCM J;  1XG1 A;  3HGY A;  3BR3 A;  5F08 A;  2E19 A;  1JUM A;  5C4J J;  1UMQ A;  3DCF A;  3BR6 A;  1IUF A;  3A03 A;  4MLO A;  1WH5 A;  2JA8 J;  1ETW A;  4HNV A;  2VKE A;  4IHX A;  4A69 C;  3PO2 J;  1TWC J;  3HBL A;  3S2D J;  1U9N A;  2M9H A;  1E3O C;  2E2J J;  1HDD C;  3A01 A;  3MVP A;  2X48 A;  4A3J J;  1ETX A;  4A3D J;  3S1R J;  2DA1 A;  2ECB A;  4XRS G;  5M3F J;  3OOU A;  4A3C J;  5EG0 B;  2IEK A;  1AU7 A;  1K61 A;  2DA7 A;  1A5J A;  3GTK J;  1LFU P;  3O8H A;  2HOS A;  5IP7 J;  5FLM J;  2IAI A;  3NAR A;  1A6I A;  5GPC A;  3BTI A;  3TP3 A;  1GDT A;  4M3E A;  3BR2 A;  5J3L A;  2DA2 A;  5EF6 A;  4XRS A;  3S1M J;  4C3J J;  4QTR A;  4I76 A;  2JWT A;  4RBO A;  1GT0 C;  3TW6 A;  5FLV A;  4CYC A;  3BG9 A;  2DA5 A;  4C3H J;  2RAE A;  3K2A A;  1WH7 A;  2LP0 A;  3S16 J;  2Y30 A;  4A93 J;  1IDZ A;  2XRL A;  4LOC A;  1IRZ A;  4IHW A;  5IYD J;  1O4X A;  5M5Y J;  3BG3 A;  1MH4 A;  4B3A A;  5K7Z A;  2ZB9 A;  5HOD A;  3JRC A;  1Y1W J;  3GTL J;  1AKH B;  2CQX A;  1I3Q J;  3WHB A;  1NK2 P;  2EQR A;  5EYR A;  1HOM A;  2XGE A;  3Q3S A;  5BNG A;  2NS8 A;  1I6H J;  1S7E A;  1P7I A;  2Y9Z A;  3A01 B;  3I4N J;  4MO7 A;  4BBS J;  4AYB N;  5M3M J;  3FIW A;  5FKN A;  2P81 A;  2LD5 A;  1SAN A;  3HEF A;  1FEX A;  5J1Y A;  5E3O A;  1NK3 P;  1MBJ A;  2JA7 J;  1R9T J;  3G1L A;  4FIS A;  2DMQ A;  5IP6 A;  1NTC A;  3BT9 A;  1TWA J;  4D7N A;  4GFB A;  4XRM A;  1X2M A;  3F0C A;  3WHC A;  2EBI A;  2VPR A;  1LE8 B;  1F43 A;  2O7O A;  1X58 A;  3BTL A;  3FK6 A;  3HOV J;  2EZK A;  5EG0 A;  2XGD A;  3LNQ A;  2DA6 A;  4A3I J;  5M5W J;  4M3D A;  4JX5 A;  5IOY A;  4CYC B;  2QCO A;  2D5V A;  3B6A A;  3ZQI A;  3LSR A;  4A3E J;  1RPW A;  1IJW C;  3JRB A;  1MBG A;  5IYC J;  3QQA A;  2DA3 A;  1APL C;  2R7Z J;  4FE4 A;  2NVY J;  3GTJ J;  1DU0 A;  5K7F A;  4IHV A;  1FTZ A;  1JUS A;  2LKX A;  5IOZ A;  3FK7 A;  3CDL A;  4L5E A;  5C44 J;  1FJL A;  2YUS A;  3HDD A;  2COB A;  3RQI A;  1Q1V A;  4BKX A;  2JMW A;  1ETV A;  4QIW N;  2R93 J;  2EH3 A;  2DJN A;  1JKO C;  3OSG A;  5EZH A;  1BJZ A;  3TW7 A;  2XB5 A;  5E3L A;  4S0H B;  1AKH A;  2LTP A;  2MG4 A;  2HQ5 A;  4M3F A;  2JJ7 A;  2JA6 J;  5E3N A;  3M4O J;  3BR5 A;  2K9S A;  2CUF A;  5C4X J;  2ME6 A;  4FE7 A;  1WI3 A;  1XS9 A;  3B6C A;  4DW6 A;  2I10 A;  2FX0 A;  2O8K A;  1XC5 A;  2N8G A;  1OJL A;  4JX6 A;  2O9L A;  3JR9 A;  1POG A;  1CQT A;  2YS9 A;  4V2G A;  1JKP C;  1TC3 C;  2YU9 J;  2Y9Y A;  4BBR J;  2NVX J;  4M3B A;  3GBG A;  1LE8 A;  2JK3 A;  1JUP A;  3ZQL A;  2K9N A;  4UUS A;  2L7Z A;  2FD5 A;  4A3F J;  5GPA A;  1P7J A;  2Y2Z A;  3QPL A;  1F36 A;  1JKQ C;  3L1P A;  5IPA A;  5FJ8 J;  1VND A;  4M3G A;  2IBD A;  1JJ8 C;  1MBF A;  4D5F A;  1VFC A;  3E7L A;  2LLK A;  1GV2 A;  2XGC A;  1OCT C;  3S1N J;  2EZL A;  3D1N I;  2DA4 A;  4Y7N J;  2HYJ A;  2JA5 J;  4X6A J;  2CQQ A;  3JRD A;  3FIS A;  1ZTR A;  3NAU A;  2XSD C;  3HOU J;  3ZQH A;  3C2B A;  5J1R A;  2VI6 A;  5F0F A;  4XIC A;  3H0G J;  4A3B J;  3IH3 A;  3M3Y J;  1ZR4 A;  3S2H J;  5C3E J;  1K83 J;  2L9R A;  2MW8 A;  2R5Z B;  2NOG A;  1AHD P;  1ENH A;  1I50 J;  1OFC X;  1Z0X A;  2TRT A;  4JX4 A;  1B72 B;  2DTZ A;  5E3M A;  1PUF B;  1X2N A;  2EZH A;  1JT0 A;  4Y52 J;  3BG5 A;  3IH4 A;  1HLV A;  1Y1V J;  2FQ4 A;  1MSE C;  2VKV A;  3O8G A;  2TCT A;  1ETO A;  5EZG A;  1IGN A;  1TWH J;  1VF9 A;  2XB0 X;  5EEA A;  2NVQ J;  4UUS B;  3DEW A;  3PO3 J;  2OF7 A;  4W97 A;  4AUX A;  3JRI A;  2WAQ N;  4UUT A;  1TWG J;  3HOZ J;  4A3G J;  1ZK8 A;  3HB9 A;  3OSF A;  2CUE A;  2M34 A;  3OIO A;  4JYK A;  2MSY A;  1YRN B;  2VUM J;  3SJM A;  4C2M J;  2XPU A;  1WGX A;  1JKR C;  2ELK A; 
#chains in the Genus database with same CATH topology
 3OYI A;  2ELJ A;  1GLN A;  1WJC A;  4KJZ A;  2ESN A;  5F27 A;  4XQF A;  1S3J A;  5BQT A;  3S15 J;  3LA7 A;  5LEJ A;  4UB6 C;  5HLI A;  3BCB A;  4PZJ A;  4DZP A;  2IS2 A;  1G2H A;  3FWE A;  4IOA F;  2MC4 A;  3TOB A;  1VQ8 I;  3LAJ A;  2CFO A;  3CJT B;  3DEE A;  4PJJ A;  1UZC A;  1O3R A;  4MIM A;  3U1K A;  1ZRF A;  1R7J A;  4BU2 A;  3CP2 A;  3RYR A;  1TQI A;  2O6G E;  1D0X A;  4OIR F;  2CO5 A;  1J09 A;  3GFM A;  4WK8 F;  2PLY A;  4AVP A;  1XD7 A;  1MMN A;  4BH9 A;  1H9G A;  2WC2 A;  3I56 I;  1VQN I;  4C3I J;  3HKZ A;  4NDL A;  2O61 A;  2K9Q A;  4G6T B;  3BOQ A;  3CMY A;  1GV5 A;  3A02 A;  2HTS A;  4RAG A;  2WB1 A;  3HHH A;  2F5C A;  3TBI A;  2R7W A;  1IXC A;  3DTK A;  3GTQ J;  2X85 A;  4XID A;  1TL8 A;  1WVR A;  3KFW X;  4UV8 A;  5E18 F;  3K2Z A;  4ETS A;  4II2 A;  4HF2 A;  2VQH A;  4Z2Y A;  1D5V A;  2K27 A;  3OYD A;  2GLO A;  4HEA 2;  2JPB A;  2Q1Z B;  5ILV A;  4FT8 A;  2CRG A;  2FNP A;  2F5V A;  3VSK A;  4AWX B;  2CWE A;  4JP0 A;  3J81 K;  2X6X A;  3FM3 A;  2CW0 F;  1HF0 A;  4I0B A;  1P4A A;  2P0W A;  5ERI A;  2HQA A;  4Y3O A;  1G59 A;  2PJR A;  2EA4 A;  3TDU C;  1VQM I;  2OQR A;  1MBH A;  5B1A H;  5EGO B;  3BR0 A;  3W6V A;  3IV5 A;  3DPT A;  3TOA A;  3VFZ A;  2X1E A;  3IRR A;  5LHI A;  4ABZ A;  4BAC A;  1H8A C;  3L2Q A;  4BXF A;  2FOK A;  3AG1 H;  1SD6 A;  3SDG A;  3NQO A;  1TT0 A;  2E5Z A;  4G7O F;  3VYR B;  2HDC A;  4A3L J;  3I4M J;  2VAS A;  3QOP A;  1X1P A;  2QA4 I;  3G1O A;  3MKY B;  2R0Q C;  4F92 B;  2PMZ N;  2QM3 A;  1K79 A;  5DDG A;  1U8B A;  4ZYA A;  1K78 A;  3K4K A;  1QGP A;  1I39 A;  2WAQ A;  2R3S A;  4ENN A;  2XKP A;  2R7D A;  3QAH A;  5E1W A;  3W3C A;  2VIX A;  2JRT A;  3LA3 A;  2DMN A;  4P9F A;  3GZ6 A;  1YW8 A;  3MZY A;  1QO0 D;  2GM4 A;  2HPM A;  5K7H A;  4MNU A;  2O8X A;  3ZMT A;  4IVN A;  2G7U A;  1GUU A;  2RKH A;  3SFI A;  5E8G A;  4IEJ A;  3ZQG A;  5IT3 A;  2OBP A;  1MGT A;  2QEN A;  1ZKG A;  2AQE A;  4J01 A;  4XBF A;  1VQ4 I;  3IAS 2;  1SAX A;  3GTP J;  5DCF A;  2DAO A;  3T5X A;  2MFZ A;  1K4T A;  2MGQ A;  1KZH A;  4P1W A;  5KHD A;  3BQY A;  1BC7 C;  3VPR A;  2O3F A;  3CCQ I;  4YG2 F;  3NRV A;  2J5P A;  2CV1 A;  1T38 A;  3MD2 A;  3VEP A;  5ICG A;  5FKM A;  1O3S A;  3OYB A;  4D7M A;  2L4A A;  1QVT A;  2YU3 A;  1T8I A;  2E35 A;  1BIB A;  4IHY A;  1YS7 A;  1U5T C;  2OZU A;  4LG0 A;  2GXA A;  3RYP A;  3AG3 H;  4L9N A;  2R5Y B;  4CCN A;  1OR7 A;  1AOY A;  3DLL F;  3ZQ7 A;  1W5C C;  1USS A;  3PFY A;  4EMS A;  1C0W A;  1RR7 A;  2BOL A;  4IQJ A;  4EJU A;  1MMA A;  2ZSH B;  1JT6 A;  3KLN A;  1TWF J;  4I09 A;  2IGO A;  1VQ6 I;  3M1C A;  1IN7 A;  3S14 J;  2CGP A;  2CQN A;  3TQN A;  3MN2 A;  4E7H A;  3OYK A;  3HGY A;  1J59 A;  5B66 C;  3HOT A;  1SC7 A;  5F08 A;  2E19 A;  3HXL A;  5C4J J;  1NH3 A;  4YFK F;  3BR6 A;  2ADU A;  1IRF A;  2RV8 A;  3QPT A;  1D0Y A;  4RLF A;  5CJ9 A;  4IHX A;  1OYW A;  4UNO A;  3PO2 J;  1TWC J;  3AFH A;  5D4S A;  2IGM A;  1F1Z A;  2X48 A;  2Z2S B;  3JW4 A;  2EIK H;  4NBQ A;  1Y8Q B;  1HST A;  3L2R A;  2VPL A;  3ZRG A;  5M3F J;  4A3C J;  3GF2 A;  3LSK A;  4QPQ A;  4CCJ A;  5GAD J;  1SFK A;  3GTK J;  1P6R A;  4HLX A;  1LFU P;  4B44 A;  5BPI A;  5FLM J;  3PUB A;  4CSW A;  3AAF A;  1GDT A;  2KKO A;  2DA2 A;  2R7T A;  3SDB A;  2KIM A;  1YW7 A;  2GAU A;  4GO1 A;  2E60 A;  1HW2 A;  3EPZ A;  2L9S A;  4E4H A;  2CW7 A;  5J47 A;  2QBY A;  1U5T B;  2DK5 A;  1FPQ A;  3LQR A;  3RJP A;  4L0Y B;  2QZ8 A;  1WH7 A;  2QQ8 A;  4FET A;  3DWL E;  2Y30 A;  5LEK A;  3S16 J;  1Y56 A;  3ERE D;  3BCA A;  3AG2 H;  4P9U A;  1VQK I;  3FMR A;  2H6C A;  4HYE A;  3S3O A;  5IYD J;  2FBK A;  2YSR A;  2BEO A;  2E1C A;  2FSW A;  2DI3 A;  2DT5 A;  2QYO A;  1MH4 A;  2P6T A;  4OMZ A;  1FBU A;  5LFA A;  1W7P A;  5H20 A;  4LK0 F;  1KA8 A;  4A0Z A;  4BNC A;  1YYV A;  1HOM A;  4E7S A;  4X0G A;  3GCM A;  2BXZ A;  4N9I A;  5DD8 A;  4C2T A;  2B7E A;  2HGC A;  4M72 A;  1T39 A;  2Y9Z A;  4HNT A;  5EEH A;  2K9M A;  3FXR A;  3I4N J;  4MO7 A;  3F8B A;  5M3M J;  4B43 A;  1QZY A;  4HQE A;  3I5U A;  1NK3 P;  5CPR B;  2JA7 J;  1R9T J;  2Z16 A;  3P9I A;  4FIS A;  1I3A A;  1FMV A;  2HVR A;  5FD5 A;  1X2M A;  2VJ4 A;  3SFZ A;  4OIQ F;  2M87 A;  4PJ0 C;  1F43 A;  2O7O A;  4WXC A;  2YX4 A;  3D5S C;  2A68 F;  1A04 A;  2RNJ A;  3LQQ A;  5EG0 A;  2XGD A;  1UG0 A;  1TP4 A;  4HBL A;  5ICC A;  3BY6 A;  2IGN A;  2D5V A;  2VB6 A;  3BJ6 A;  3LSR A;  2O03 A;  4A3E J;  5TIS C;  1IJW C;  3JRB A;  3K1N A;  2FNA A;  1HXD A;  1MBG A;  3DF8 A;  2CS3 A;  4EV0 A;  2DA3 A;  1S9H A;  1APL C;  3C3W A;  4FE4 A;  4Y4R A;  1BR2 A;  4U0W A;  1TW3 A;  1JUS A;  2LKX A;  3H5N A;  5IOZ A;  2L7K A;  3ISP A;  2P4W A;  2LG4 A;  2XSJ C;  1FJL A;  2YUS A;  2FEZ A;  3K4C A;  3HDD A;  4BKX A;  1ETV A;  2P5V A;  2DJN A;  3K4M A;  5K5R A;  3DTE A;  2FF4 A;  2XB5 A;  4S0H B;  4U7D A;  3AL0 C;  3U21 A;  5HDK A;  2IS4 A;  1Z21 A;  2AS5 F;  3TL4 X;  3I71 A;  5E3N A;  5HNF A;  2JA6 J;  3ECO A;  3M4O J;  5DUI A;  4E7L A;  3FBN B;  2CUF A;  1OCO H;  3C2H A;  5C4X J;  2PG4 A;  3P9K A;  2BY2 A;  5GAG J;  5LGU A;  1XS9 A;  1YJN I;  3H9Q A;  2FX0 A;  2LRD A;  3I53 A;  1IZ1 A;  1FBS A;  2DFI A;  3GME A;  3D5L A;  2HDW A;  1J75 A;  1ZRD A;  4Q48 A;  1CQT A;  2E36 A;  4XMY A;  5GAH J;  2KPM A;  4BBR J;  1BR1 A;  1W4M A;  2I8D A;  3MZ8 A;  4GYG A;  3GBG A;  3CUQ A;  1LE8 A;  4Q4Z F;  5D4R A;  2JK3 A;  4RGS A;  2FE3 A;  1JUP A;  2VON A;  3GFL A;  2XDV A;  3M7G A;  2Z3Y A;  3AKZ A;  2XAJ A;  4CDG A;  4ZDL A;  4A3F J;  1T0F A;  4BS9 A;  3QPL A;  4JQF A;  3REO A;  1JKQ C;  4UY8 I;  4RA2 A;  2MBF A;  4RM3 A;  2IBD A;  1MKM A;  4N0B A;  1MBF A;  4L9T A;  1GV2 A;  4U88 A;  4EM1 A;  2BVL A;  1IN8 A;  2EZL A;  5LGT A;  4BE0 A;  4LLN A;  4Q5S F;  2DA4 A;  2HKX A;  2HYJ A;  4X6A J;  3GO5 A;  3JRD A;  4RGR A;  2JRM A;  1ZTR A;  1N78 A;  3BPX A;  5L3F A;  1YHQ I;  4LIU A;  4UVB A;  4KN7 X;  4XIC A;  3SQN A;  4II3 A;  2CYY A;  4EJO A;  3J80 Z;  3M3Y J;  2VBY A;  3UR3 C;  1ZR4 A;  3GW2 A;  1ZYR F;  3KP4 A;  2HEO A;  4S04 A;  3ZN1 A;  3JTH A;  2MW8 A;  3SZP A;  1IRG A;  1AHD P;  3A2K A;  2CUJ A;  2EPF A;  4F91 B;  1EH8 A;  3CCJ I;  2P7C B;  2YX7 A;  1KYZ A;  3N4M A;  4JX4 A;  5CVI A;  3AL0 B;  3J80 K;  4E7Z A;  3QYF A;  3I58 A;  1ZGA A;  3CMA I;  3KYC B;  2KQR A;  3BG5 A;  2K9L A;  5LHG A;  1WJ5 A;  2M3A A;  1HLV A;  1B6A A;  2ZFU A;  3EUA A;  3WGH A;  4FX0 A;  1TWH J;  3HSE A;  1VQ9 I;  4UUS B;  4ON0 A;  2A5W A;  4O6J A;  3PO3 J;  5FD6 A;  4W97 A;  2HZT A;  2XRO A;  1TWG J;  3WTY C;  3HOZ J;  4A3G J;  3GZN B;  1ZK8 A;  4G9Y A;  3TO9 A;  3DTI A;  4O5V A;  3OIO A;  1YRN B;  4B3X A;  1XCB A;  2XPU A;  1R23 A;  1WGX A;  2AQF A;  2EA2 A;  4IL6 C;  4M74 A;  3K6G A;  3H0D A;  2HXO A;  2L0K A;  1P4W A;  1R36 A;  2W4S A;  2L4M A;  4DYC A;  5EGO A;  2NRA C;  3E6D A;  1DU6 A;  5IP9 J;  4BEH A;  2BVM A;  3LOC A;  2Y0S N;  5M5X J;  5K5Q A;  3U1D A;  4XN3 A;  3CF2 A;  3IWF A;  4ENK A;  4OOI A;  1R4N B;  2ZME C;  1Y0N A;  4FTH A;  3FBI B;  3W6K B;  4RDU A;  3MFK A;  4A6E A;  1FY7 A;  5IY5 H;  1JI8 A;  5AIQ A;  2NS7 A;  3DPL C;  2GBY A;  5H6Q A;  3E6M A;  4BGD A;  4HNU A;  3R61 A;  1RKW A;  1OYY A;  1V54 H;  2M0M A;  1KQ9 A;  3H92 A;  4KMU X;  5FKL A;  1MD0 A;  2R5Z A;  1ULY A;  1D8K A;  1T6S A;  2QF7 A;  2CUZ A;  3RZD J;  3PSF A;  1IF1 A;  3V7C A;  2EZI A;  1B72 A;  2F5F A;  2CJJ A;  3G4S I;  2K40 A;  3PM1 A;  1YI2 I;  3JRA A;  3L2W A;  3NEU A;  2DMU A;  3ZQF A;  4W1U A;  2M8E A;  1LEB A;  3LL7 A;  4PDK A;  4OAZ A;  4PJL A;  1XDU A;  3CDI A;  3E3V A;  2H8W A;  4M6V A;  3V8K A;  3HKZ N;  3Q0W A;  1QA6 A;  3DXJ F;  2DN0 A;  4P5O A;  5HS9 A;  3TDZ C;  1ZQ3 P;  3GFI A;  3EYY A;  5LD2 C;  2K02 A;  3V4G A;  3WTU C;  2WB1 N;  4JK1 X;  1R5H A;  1AWC A;  3CC4 I;  3F22 A;  5D8K B;  1U3E M;  5CKT A;  1QPM A;  1CGP A;  2I5U A;  3KP2 A;  3LFK A;  3JRF A;  4BY1 J;  3M8J A;  4WXD A;  2ZC2 A;  1YLF A;  5DUK A;  1G3T A;  4DJA A;  4UV9 A;  1RKT A;  3HYI A;  5FKK A;  3CLQ A;  1P2F A;  2ID6 A;  1K6O A;  3H5A A;  1W5T A;  2E5N A;  1ZGW A;  3UNG C;  3N05 A;  3IHU A;  1RUO A;  3DU6 A;  1IXS B;  3I54 A;  2JZY A;  1AA7 A;  2E34 A;  2DMT A;  4DYR A;  2AXL A;  2BY0 A;  2RQQ A;  4RAZ A;  3S1Q J;  1REP C;  2R7Q A;  5LHH A;  1JHF A;  2XAG A;  4I01 A;  2ZSI B;  1D1C A;  1V4R A;  2W00 A;  2Z5U A;  3MKL A;  3Q0U A;  3DBR B;  4NUB A;  3CQZ J;  3ZN0 A;  2R5Y A;  3CO6 C;  1VI0 A;  4BAY A;  3WTZ A;  3PJR A;  5TGT A;  1FIA A;  4LJZ F;  4A5N A;  3F21 A;  4I6Z A;  5FLX Z;  2DDA A;  1LNW A;  1Z05 A;  2ZME B;  5TJJ A;  2Q2E A;  2Y31 A;  2ESH A;  3O2P E;  1KQ8 A;  2UXX A;  2BHY A;  5DTD A;  2QQB A;  1T56 A;  2VL8 A;  3WU0 A;  1JTY A;  3RPU A;  1YJ9 I;  3IKV A;  1UST A;  2DOF A;  4PGH A;  2M1B A;  4A5M A;  2A6E F;  1BW6 A;  2G0E A;  1IN5 A;  3MCZ A;  1E3H A;  2E2I J;  1MJA A;  1GXQ A;  3BP8 A;  3R4K A;  4WX9 A;  5ILU A;  1G3W A;  2L9V A;  5IYB J;  1OYI A;  1RRJ A;  3OL3 A;  1YFH A;  3CD6 I;  1BBY A;  2ISZ A;  3E5X A;  4EJV A;  2VE9 A;  3VDX A;  4F52 A;  3LSG A;  2P6S A;  2KJC A;  2Y0S A;  3GTM J;  1LJ9 A;  1JTX A;  4BXX J;  2XKO A;  2FXA A;  3G6E I;  3JRH A;  1V5E A;  2H1K A;  2CFX A;  3VYU B;  2M2E A;  4AC0 A;  5E1X A;  5J40 A;  1O3T A;  1H89 C;  2HI3 A;  2Q0O A;  2KRF A;  4BY7 J;  2VJ5 A;  3DBL B;  5DM6 F;  1QPI A;  2LVS A;  1VZ0 A;  5JFR A;  4S05 A;  1W0T A;  3KYL A;  1SVL A;  4L0Z B;  3L7W A;  4MFE A;  3HTS B;  2CU7 A;  3J7A Y;  1HKT A;  1HDP A;  2EV0 A;  4BDZ A;  2HDD A;  1MBE A;  2LF7 A;  2X4H A;  4PUS A;  3BZ6 A;  2CQ7 A;  3HRT A;  2ZJP F;  4RGU A;  2XPW A;  2WAF A;  5D6E A;  4RM2 A;  3BR1 A;  1WI9 A;  2JTV A;  3SXY A;  1P92 A;  1RES A;  1Z91 A;  3K4L A;  3KLO A;  1LUJ B;  2Z1D A;  2CV0 A;  1J9I A;  3CMM A;  1U5T A;  3CC7 I;  3GTO J;  5KVR A;  2DW4 A;  4LMY A;  1WKM A;  2OPT A;  3DEU A;  4HOB A;  2PI0 A;  2VQL A;  3K70 C;  1GHC A;  4G8X A;  2STT A;  2ZXW H;  3HTU A;  4HSR A;  3DU5 A;  4PSX A;  3BR3 A;  1JUM A;  3RQ4 A;  4CXF A;  2XAU A;  3PIP F;  2M4G A;  5BMZ A;  4XOT A;  1UMQ A;  4DQ2 A;  1FOW A;  2VT2 A;  1BI3 A;  1IUF A;  1QNT A;  3WOD F;  4MLO A;  4RGX A;  2BGC A;  5F1R A;  2WWY A;  1QU3 A;  4HNV A;  1MMD A;  1MDM B;  4A69 C;  1XCV A;  2DOA A;  3FXM A;  4N4N B;  3PQK A;  1RI7 A;  3PIO F;  1W5S A;  3KP7 A;  1E3O C;  1QQI A;  1HW5 A;  1Z6T A;  3ZQQ A;  2ECB A;  3BZK A;  4C30 A;  2XUB A;  2ACJ A;  2EK5 A;  2IEK A;  4OAY A;  2KFD A;  2DA7 A;  3GFJ A;  4NB5 A;  1QHH D;  2A3S A;  4AU7 A;  3EYI A;  1XSX A;  5IP7 J;  3OYG A;  1R5I D;  4ZYH A;  1BN5 A;  2X6W A;  1KU7 A;  2IAI A;  1BI1 A;  2OZ6 A;  3ERM A;  1A6I A;  1YX3 A;  2JSC A;  4NQW B;  4M3E A;  3S1M J;  4KIC A;  3CME I;  5IT9 Z;  4YFN F;  4UVA A;  4I76 A;  4RBO A;  4FHT A;  1N25 A;  2VJI A;  4NC8 A;  4I7H A;  3FXK A;  4KIB A;  3TW6 A;  3OS2 A;  3I64 A;  1ZAO A;  3E97 A;  1U6G A;  2RAE A;  1BJA A;  3CZ6 A;  3K2A A;  4BHC A;  1V5F A;  5DCM B;  2NOJ B;  1XMA A;  4BJ6 C;  4ZJZ A;  1IDZ A;  5IT9 K;  4LOC A;  4F7Z A;  4GDF A;  1PP8 F;  2X1D A;  3BDD A;  3K10 A;  3KX2 A;  3OYE A;  3S93 A;  5M5Y J;  2M4K A;  4K2E A;  1LPQ A;  2PEX A;  2ZB9 A;  4EQQ A;  1I1S A;  2PN6 A;  1J2X A;  2KDO A;  3OYF A;  3WHB A;  1NK2 P;  1EKE A;  1XTA A;  2A69 F;  2IA0 A;  4BL0 B;  1Y39 A;  2CH0 A;  5BNG A;  1I6H J;  5FGM A;  1MJ9 A;  3BLY A;  1S7E A;  4HAM A;  3R0J A;  2EFO A;  2CV2 A;  2R4G A;  3ASO H;  4AYB N;  1RR8 C;  2P81 A;  2LD5 A;  4OU0 A;  3GYH X;  5F6F A;  1SAN A;  4HDU A;  5E3O A;  1MBJ A;  3EUK L;  2WAE A;  2OCE A;  1OCC H;  5IP6 A;  2KLO A;  3BT9 A;  1TWA J;  1FNN A;  4XLH A;  3WU1 B;  4GFB A;  3WHC A;  1ODD A;  2EBI A;  4ZZD A;  3ZMU A;  2KZG A;  3O3K A;  1SAU A;  3I3L A;  3HOV J;  1UEL B;  2K4B A;  1R5G A;  5FRO A;  2Z33 A;  5E20 A;  3HSR A;  2B9S A;  3CTA A;  1HW1 A;  1A36 A;  2M5W A;  3FDY A;  4CHU A;  3LNQ A;  1GXP A;  2DA6 A;  5BPD A;  1D1A A;  1JE8 A;  2KIF A;  3ABK H;  1OCR H;  5M5W J;  3DBH B;  4JX5 A;  1R6R A;  4CYC B;  2V6E A;  3L9F A;  1DQU A;  1W36 C;  4IRH A;  3BRO A;  3K4N A;  4RS8 A;  2DO7 A;  3JSP A;  2FBI A;  3RTR A;  2HQR A;  3JCU C;  1LVK A;  3CC2 I;  3O6B B;  2MLG A;  2R7Z J;  2NVY J;  4LB5 A;  1IW7 F;  4IHV A;  3IRQ A;  3U2R A;  2NNN A;  4BQN A;  2WBM A;  3QYB A;  3GXO A;  5ICF A;  1IUY A;  3CDL A;  5ILS A;  4L5E A;  3W2A A;  3IWZ A;  3RPQ A;  1Q1V A;  4HV5 A;  4BQO A;  2JMW A;  4RB2 C;  4RAF A;  3E1S A;  4YRV A;  1BJZ A;  5H6R A;  3WG9 A;  3TW7 A;  4Y13 A;  5FRM A;  2NXN B;  3S3N A;  1AKH A;  2VBW A;  3N97 A;  2HQ5 A;  2JJ7 A;  3CCM I;  4XKV A;  1DGW Y;  4IQ4 A;  2IXS A;  3LSM A;  1X4O A;  2BV6 A;  1X1C A;  4XSZ F;  3W2V A;  2I10 A;  2GOM A;  1XC5 A;  2A5Y B;  4WF2 A;  1DUX C;  2DK8 A;  3GWZ A;  5E79 C;  4EGZ A;  3P5J A;  2N8G A;  1OJL A;  3H35 A;  4JX6 A;  2O9L A;  2V1N A;  1K7A A;  1FOY A;  1V55 H;  4PFO A;  3JR9 A;  1A31 A;  1TC3 C;  2YS9 A;  1T08 B;  1WJD A;  2Y9Y A;  2VT3 A;  3U9G A;  2HKO A;  1LEA A;  1FBQ A;  4M3B A;  4MQV A;  1D1B A;  3H3U A;  2PMU A;  2E7X A;  4DNC A;  3Q5F A;  4IHT A;  2R7X A;  1BIA A;  1TW2 A;  4E7I A;  4UUS A;  3ZQL A;  3H9J A;  2QQA A;  3OYC A;  3RDI A;  1F36 A;  3QU3 A;  3L1P A;  5IPA A;  1UCR A;  5AON A;  2VN2 A;  3A1Y A;  3HIF A;  1YG2 A;  4D5F A;  1VFC A;  1XGS A;  1I6X A;  2X1C A;  2ZXJ A;  1IN6 A;  2M30 A;  2HPI A;  4U0Y A;  4EJW A;  4AYB A;  2LDU A;  4MTE A;  4IOC F;  3GX4 X;  2F4M B;  1PVE A;  5D5W B;  2XSD C;  3M07 A;  3HOU J;  3ZQH A;  3C2B A;  3FHN A;  5J1R A;  5F0F A;  1BOA A;  2LSO A;  4HRI A;  5FFZ A;  3S2H J;  4NNJ A;  4B8X A;  5JR3 A;  2IPQ X;  3WG7 H;  5HLT A;  1XPX A;  5C3E J;  3M8E A;  4BQQ A;  2BY3 A;  2NOG A;  1GVJ A;  2GIZ A;  4NC7 A;  1WWX A;  5DV5 A;  4AIK A;  3S8P A;  3KYD B;  5CVR A;  4AIJ A;  2HTJ A;  2NS0 A;  4R8H A;  3QYE A;  4L9V A;  3SHF A;  4GXO A;  2VLA A;  1JT0 A;  3HC7 A;  4KT5 C;  4I02 A;  2DPD A;  5D5X B;  1B9N A;  1Y1V J;  2BXY A;  2PFB A;  2TCT A;  4XR6 A;  5J8C A;  5EZG A;  3RKW A;  2VXZ A;  2ZCW A;  2XB0 X;  3EET A;  5EEA A;  2NVQ J;  1SFX A;  1W7P D;  2DDB A;  2F5E A;  3DEW A;  5FB2 A;  1YIT I;  2EFP A;  2XAH A;  4KA4 A;  3E5U A;  4GCV A;  1ZN2 A;  4AUX A;  5HS7 A;  1OQY A;  2PJR B;  5KCM A;  4UUT A;  2K7L A;  4HF0 A;  4CA0 A;  2A6H F;  2CUE A;  1SVO A;  1TZL A;  2DQL A;  1J7K A;  1MNE A;  2HR3 A;  2M34 A;  3M9A A;  3P7N A;  4A6D A;  2VUM J;  1XB4 A;  5LRS A;  4C2M J;  3SJM A;  1KON A;  3E6C C;  3R60 A;  1FZP B;  2ELK A;  3E6B A;  5EJC A;  3COA C;  2A05 A;  4CO8 A;  3BG7 A;  3CUO A;  1ETQ A;  1MH3 A;  3SZT A;  2DXI A;  1HA8 A;  1T98 A;  4A3M J;  2HOA A;  3ZMZ A;  1Z6R A;  4DYQ A;  3HOW J;  1FYK A;  2DQR A;  1LVA A;  2R7O A;  4HF1 A;  2V1X A;  2W48 A;  3H3Z A;  1XGN A;  3TED A;  1FYL A;  4M6X A;  4UXN A;  2W57 A;  2ZXI A;  3CCU I;  1RET A;  3S32 A;  1O57 A;  4DZJ A;  3L2U A;  3K7A J;  1FMW A;  3ASN H;  2KDZ A;  4CH7 A;  1KQ0 A;  2ZNZ A;  3I0T A;  2DMP A;  2KRC A;  4ZYG A;  2L7F P;  2ETH A;  1XMK A;  3H36 A;  2KZV A;  4PCQ A;  3JRG A;  2O5R A;  3GTG J;  2M8G X;  2ZJR F;  1Z7U A;  2FQ3 A;  2LYC A;  4EEF G;  4F55 A;  5ICE A;  5HLG A;  1IDY A;  3OS0 A;  2ZBK A;  1BW5 A;  3CCL I;  3KPH A;  1ZGJ A;  4XLE A;  3S3M A;  4I98 B;  2EV6 A;  2JPC A;  1YS6 A;  1MNM C;  2V6C A;  1ORK A;  4TV7 A;  2IA1 A;  4L9J A;  4FCY A;  3WTS C;  1PUF A;  4IXA A;  1L3L A;  4QSH A;  3OYM A;  2F5D A;  4XK4 A;  5F04 A;  2D45 A;  4B4C A;  2GZW A;  4U87 A;  4IPA A;  4E6K G;  1S72 I;  4ZZL A;  5JLW A;  1ZH5 A;  3K9T A;  1FWZ A;  2OUM A;  5KAI C;  3ZOB A;  2RNG A;  1UAA A;  1TTY A;  1D3Y A;  2X6Y A;  3V8J A;  2DOE A;  1TQM A;  2ELH A;  3VB2 A;  3LSP A;  1OPC A;  4HLY A;  3OOP A;  1R4M B;  2E1O A;  4M73 A;  5J1U A;  2QEX I;  2PX9 A;  2HU9 A;  1KU9 A;  3S17 J;  1GVD A;  1EJ9 A;  1O3Q A;  2ISY A;  1F5T A;  2M7B A;  3HM5 A;  3QOD A;  4YIR X;  1B8I B;  4LG0 B;  4MFD A;  2LY9 A;  3ML6 A;  4MTD A;  4J19 A;  3OR1 C;  4E7K A;  2HVQ A;  1NG7 A;  1FSE A;  3TP0 A;  2E2H J;  3DP7 A;  1KGS A;  1XSV A;  2DJI A;  3PSI A;  2G9W A;  3K1P A;  2LR8 A;  2V9K A;  2DU9 A;  5E1Z B;  2G7H A;  3MWM A;  1DP7 P;  4HPQ A;  4XLA A;  3ULQ B;  1PP7 U;  3D5R C;  4Y15 A;  2WTE A;  3HGG A;  2FU4 A;  3HPG A;  1S8N A;  4CYD A;  1WPK A;  2JSP A;  3HUG B;  5JHU A;  1Z1D A;  3EUH A;  3GZ5 A;  3C1D A;  2HOE A;  5JI6 A;  3OS1 A;  1ZG5 A;  3LWF A;  4RMN A;  1J0R A;  1X1A A;  5F0C A;  1FIP A;  1IG7 A;  3P9C A;  5JHF A;  3S2W A;  1ITY A;  2XRN A;  1MBK A;  2E1N A;  1UHM A;  3LSJ A;  2QKL B;  2H8R A;  4G6Q A;  5J4V A;  1U78 A;  2LH9 A;  3BC8 A;  3ZPL A;  3ZMD A;  3C2G A;  3K1M A;  3H3V K;  2V1D A;  3VOD A;  5JLX A;  3W2W A;  3CCR I;  1VQL I;  1HKS A;  2YR2 A;  1RNL A;  1ZLK A;  3CES A;  2AO9 A;  3F6O A;  1V3F A;  2HFH A;  2W24 A;  1MDM A;  3IH2 A;  3ZR8 X;  3OV8 A;  4RB3 C;  1D5Y A;  1G6N A;  1WRJ A;  2H09 A;  5EEG A;  4XSX F;  3Q9S A;  2QSF X;  2JA2 A;  2R7S A;  2DYS H;  2JQ7 A;  5CYV A;  3VYS B;  2A6T A;  3HG9 A;  4AVZ A;  1BA5 A;  2TDX A;  3LSH A;  1WJA A;  2LFB A;  3MKZ A;  2M0C A;  1WJE A;  3WTW C;  5FFX A;  3T8R A;  1KU3 A;  4M9S A;  2KRH A;  2K4J A;  3HZJ A;  1H9T A;  2AHQ A;  1MJB A;  2CSO A;  3E5Q A;  5KAF C;  3HL2 A;  3JAM Z;  4NQW A;  3MEX A;  4OIO F;  3UKG A;  1FOK A;  3W6J B;  4IHS A;  4V19 K;  2HWV A;  4X1E A;  2Z9O A;  4IZZ A;  4ZH4 F;  1SFE A;  3M8F A;  2Z99 A;  2EIN H;  1SEU A;  4LIT A;  3H9G A;  4MHG A;  3JAM K;  3CF5 F;  2M7A A;  5DCM A;  3OWT A;  2NVU B;  3G71 I;  5FRN A;  4B09 A;  3FHZ A;  3NWT A;  2W82 A;  3KP5 A;  1LQ1 A;  3AG4 H;  3OYL A;  4Z6Y A;  3OYH A;  4P96 A;  3LST A;  2FRH A;  4AID A;  4R1H A;  2LRE A;  3A03 A;  1WH5 A;  3ZXS A;  1B9M A;  1X1D A;  1IRX A;  1DGR M;  3F8N A;  5DD4 A;  4LGW A;  4ZDP A;  4HST A;  2BBY A;  3WTT C;  1U9N A;  2L3D A;  2L9N A;  4I2O A;  5HVQ C;  1HDD C;  1UB9 A;  3MVP A;  4A3J J;  3PNY A;  3CJR B;  1ETX A;  5LGN A;  1TNS A;  2FBH A;  5CVU A;  3S1R J;  2DA1 A;  4A3D J;  3OOU A;  4B48 A;  4HX4 A;  2EIJ H;  4LB6 B;  1UFM A;  5EG0 B;  1YE9 A;  1K61 A;  1AU7 A;  1A5J A;  1S7O A;  2UV1 A;  3DKW A;  4PJN A;  1QHG A;  2VBX A;  4IJA A;  3VOE A;  1CF7 B;  2JUC A;  3NAR A;  1V5G A;  1UHW A;  5L3G A;  3J7Z I;  3BTI A;  3TP3 A;  2K5C A;  1B59 A;  2VKD A;  4XRS A;  4C3J J;  2PMH A;  4XN0 A;  1GT0 C;  2VOD A;  2XF7 A;  4ENJ A;  5FLV A;  4CYC A;  1N75 A;  4BYY A;  4HX7 A;  1PJR A;  1FP2 A;  4C3H J;  4Q47 A;  3L2V A;  4QWQ A;  2V26 A;  2JVH A;  3HSF A;  4B47 A;  3A4C A;  1HKQ A;  1KYW A;  2L02 A;  4A93 J;  3C18 A;  1QBJ A;  2NYX A;  3TO7 A;  1X3W B;  1IRZ A;  3G2B A;  5E8I A;  3BG3 A;  3DQV C;  2LNB A;  2ZFW A;  1PYV A;  5AIP A;  4GRI A;  2EFQ A;  4D9J A;  5B1B H;  2VXD A;  5HNH A;  2LF8 A;  2C6Y A;  1Y6I A;  3CCS I;  1I3Q J;  4KIT B;  2EQR A;  5EYR A;  2MD0 A;  3M1E A;  2XAF A;  3K69 A;  4KIG A;  1B4A A;  5FLX K;  3V7S A;  3A01 B;  3V7R A;  4CCO A;  2KIU A;  1E3P A;  1O7F A;  2HYF A;  2BYV E;  2DFF A;  2OU2 A;  3FIW A;  5J8F A;  4BBS J;  1LDD A;  2OCC H;  2A61 A;  2VKH A;  1U2W A;  3IL2 A;  5J1Y A;  3KIO A;  3ABL H;  1F9N A;  1L0O C;  3G1L A;  3B73 A;  3GUD A;  3RIR A;  1OIS A;  2DMQ A;  3J7Y J;  4FX4 A;  1NTC A;  5BS6 A;  3DV8 A;  4HV6 A;  1ACI A;  3F6V A;  3LMM A;  1LE8 B;  1X58 A;  5J4Y A;  2LY2 A;  2UZK A;  5TRD A;  2DTR A;  2EIL H;  4UUV A;  4YEJ A;  3RPU D;  1Z7L A;  1LKX A;  4A3I J;  3V8L A;  1SD5 A;  2L2O A;  4XON A;  4NHJ A;  1BOB A;  2QCO A;  1I1G A;  1ZHF A;  3LA2 A;  2IP2 A;  4BHP A;  1IO2 A;  4LLG F;  1RPW A;  1IN4 A;  4BXU A;  1U0J A;  4KUM A;  5IYC J;  5E17 F;  3QQA A;  2ICW G;  2UWM A;  1FP1 D;  2K86 A;  3RSN A;  5HDN A;  3CCV I;  1DU0 A;  4ZDO A;  1FTZ A;  3OY9 A;  3BJO A;  4MGR A;  1Z67 A;  3JSO A;  4BQA A;  3FXQ A;  2IGK A;  4MEY F;  5C44 J;  1MND A;  2OTL I;  1NHA A;  2ZNY A;  4QIW N;  2QVO A;  3BWG A;  2EV5 A;  2GQQ A;  3MQ0 A;  1Z9C A;  4KT6 A;  3FXJ A;  3L2C A;  1TBX A;  5EZH A;  2R7U A;  3A0H C;  3PFI A;  4DBR A;  2M45 A;  1O7L A;  5LRR A;  2LTP A;  2MG4 A;  1WJB A;  2PQ8 A;  1Q1H A;  3QWL A;  1WSU A;  4AM3 A;  3EDP A;  3HRS A;  4MQ9 F;  3BJA A;  2K9S A;  2Y69 H;  2XF6 A;  3I9V 2;  2ME6 A;  3WE3 A;  4FE7 A;  1WI3 A;  5LBQ A;  1BI0 A;  2E71 A;  4AD9 A;  4DIQ A;  3IKT A;  3MMY B;  1TLH B;  4GYI A;  5L3D A;  4DW6 A;  2O8K A;  2W25 A;  5GAE J;  1ERD A;  3J81 Z;  1W36 D;  1X3Z B;  2W7N A;  2WY7 Q;  4XM3 A;  4OIP F;  3LAP A;  4V2G A;  1JKP C;  2YU9 J;  2ZXH A;  4GGG A;  2QKM B;  3KE2 A;  2NVX J;  2CW8 A;  4XKB A;  4C2U A;  4FQG A;  2BW3 B;  2EJR A;  3HRM A;  4A12 A;  5B5E C;  4KIS A;  2D1V A;  1VQ5 I;  1STZ A;  3PQJ A;  4KN4 X;  2L7Z A;  2GIV A;  5CQE A;  3DLA A;  2YPR A;  5GPA A;  1R58 A;  1VND A;  2D2W A;  4M3G A;  1JJ8 C;  1XSD A;  5CVV A;  2VJJ A;  4I0A A;  4LFU A;  2NAZ A;  4BEH B;  4Y7N J;  2FML A;  4PFP A;  1G3S A;  1OKR A;  2XIG A;  2JA5 J;  3V42 A;  4DBQ A;  5L3E A;  4E70 A;  2CQQ A;  2CG4 A;  2QWW A;  3GVA A;  1OMI A;  4J00 A;  2JVG A;  2VI6 A;  3H0G J;  1XMX A;  1SMY F;  4YEL A;  3KP3 A;  1H0M A;  3I59 B;  5L3C A;  2R5Z B;  3ZMS A;  3WE2 A;  1I50 J;  3K4B A;  2BZT A;  1Z0X A;  3VYT B;  1MZB A;  5DEQ A;  5HDG A;  2R7F A;  3ABT A;  1T2K A;  1B72 B;  1MIJ A;  5E3M A;  2KIQ A;  5FO5 A;  4N4O B;  4EAT A;  2P7V B;  2QGU A;  2Q8K A;  2MLK A;  2XVC A;  1N77 A;  1S29 A;  3BG6 A;  2E1M C;  1I5Z A;  2DYR H;  2MH2 A;  1MSE C;  2VKV A;  2XAS A;  3O8G A;  3RCO A;  4RB1 A;  1VF9 A;  1YJW I;  2XGX A;  3FXU A;  4A0X A;  2STW A;  4MEX F;  3LFU A;  1DPU A;  3WGG A;  3JRI A;  1TT5 B;  3GLL A;  4H4K C;  4CGZ A;  4G6D A;  3HB9 A;  1DPR A;  1WJF A;  2MSY A;  2F48 A;  2GA2 A;  2BHZ A;  1NG6 A;  1JKR C;  3KCC A;  2FOW A;  4JBA A;  4LG3 A;  4HW0 A;  1PUE E;  4YII A;  2OQG A;  2LBF B;  4BE1 A;  3FF5 A;  3SYT A;  2R92 J;  1E2X A;  2WA0 A;  3TKY A;  1S6L A;  5F0H A;  2V9V A;  3ELK A;  1B8I A;  1WQ2 A;  2NVT J;  2HYG D;  4PGG A;  4BJT A;  1FYM A;  1WZ2 A;  3VSL A;  3DFG A;  5EDN A;  3DKY A;  3NWS A;  1MMS A;  1T33 A;  1RZ4 A;  1UJ8 A;  2XHK A;  3HJE A;  1X1B A;  1R00 A;  1R71 A;  1MSF C;  4KIF A;  4OIN F;  2HOT A;  3ESW B;  3B02 A;  4DGW B;  9ANT A;  2HNH A;  1BI2 A;  2Q2E B;  2NNY A;  2WV1 A;  4D5C A;  2X9D A;  2IVM A;  4CUG A;  1SD4 A;  1XDS A;  4WXH A;  2EB7 A;  3C7J A;  1IV6 A;  2LC2 A;  3ZQC A;  2WV0 A;  3WTX C;  2H94 A;  3HUG A;  2ECC A;  1EH7 A;  2JN6 A;  1BL0 A;  2HS5 A;  4B1R A;  2X6O A;  1JJ6 C;  1XN7 A;  1Z3X A;  4C9Y A;  2XF5 A;  2KL4 A;  1ETY A;  1W0U A;  4M9X A;  1OCP A;  4G94 A;  2L7M P;  5FKO A;  3TGN A;  5JVT A;  1U9O A;  5DYM A;  1SMT A;  2XAQ A;  3SEZ A;  3OYN A;  2ME0 A;  4RLQ A;  5CVJ A;  4BDY A;  1E0E A;  4ZYE A;  1BM9 A;  1H88 C;  3IAM 2;  4F3Q A;  2E1M B;  4UHT A;  1A6Q A;  1D8J A;  5JVG F;  2FJ1 A;  2ID3 A;  4HX8 A;  5DS9 A;  1YTY A;  2RN7 A;  2X51 A;  1MMG A;  4ASN A;  2XC7 A;  4P55 A;  1B1B A;  4AIH A;  1IC8 A;  3PNV A;  3ZGK A;  1ZEL A;  3KZZ A;  4ITV A;  4XOP A;  3HOY J;  4G7Z F;  2KT0 A;  2XPV A;  4L5I A;  4ENM A;  2PMZ A;  5KNL A;  1SFO J;  4HQM A;  2IJL A;  2CQK A;  2OJE D;  5J6X A;  1YRN A;  3Q0V A;  2RQP A;  1HCR A;  2OC6 A;  2MH9 A;  4QPO A;  2H6B A;  3IC7 A;  3ZCO A;  2VQC A;  4XL9 A;  5F1J A;  4HZF A;  2EFW A;  4CIC A;  2DBB A;  1FT9 A;  3JRE A;  1LFB A;  1EV7 A;  1FTT A;  2K3P A;  5D5U B;  3WTV C;  4XLF A;  3F23 A;  2DFE A;  3QP6 A;  3VWB A;  3RKQ A;  4V2F A;  1HC8 A;  3QRF F;  1D0Z A;  2LK2 A;  3QPS A;  1ETK A;  4BUP A;  1S7A A;  3T1B A;  1ON2 A;  2JT1 A;  1EH6 A;  1X19 A;  3BTC A;  4PK4 A;  1G4D A;  3FM5 A;  5GP9 A;  1WFX A;  3BTJ A;  4A0Y A;  4XLP F;  1X3U A;  3BQZ A;  2LOO A;  5GTI C;  1UHS A;  2QUF A;  1RIO H;  2QSG X;  4EVI A;  4IKF A;  4XKC A;  1R1T A;  2HVS A;  4UVC A;  2P5L C;  4G12 A;  1MW7 A;  4A3K J;  2ZJ2 A;  3GEZ A;  4QLC U;  3BPV A;  3RI4 A;  1YIO A;  1QRY A;  3OMY A;  3TMO A;  1S5L C;  4KDP A;  2IT0 A;  5ED4 A;  4ZTJ A;  2A07 F;  4ESJ A;  2LKP A;  2DFH A;  2HXI A;  3L00 A;  3T0Y A;  2L54 A;  3FKI J;  2B63 J;  6PAX A;  2GWR A;  1W1W E;  3FZV A;  2WY8 Q;  3RZO J;  4FAS D;  1EF4 A;  2MA3 A;  1Z77 A;  3CJN A;  1Z3Y A;  3KZY A;  1QVU A;  4IF4 A;  2RGV A;  1OR7 C;  2OA4 A;  1UG2 A;  4HDV A;  2COM A;  2F4O B;  4CCM A;  2H1L A;  3ABM H;  1LB2 A;  1LDK B;  3CLO A;  3HOX J;  1VQ7 I;  1Y0U A;  1P4X A;  1CF7 A;  2BE5 F;  1ZR2 A;  4BHB A;  3H1C A;  4U7B A;  1YO5 C;  2V7F A;  3CCY A;  2IS1 A;  4F93 B;  1JGG A;  4M6Y A;  4ESB A;  3CCE I;  2WAD A;  1K78 B;  3G1M A;  3R6S A;  3F8M A;  4BJ5 C;  5BOX A;  2DT7 B;  3ONQ A;  2RRE A;  3KEY A;  1HQC A;  5GTH C;  1SD7 A;  3RKY A;  2R7R A;  1WCM J;  1I27 A;  2DLL A;  1XG1 A;  4YIF A;  2ZME A;  2UUZ A;  3ZMV A;  3KP6 A;  2AXT C;  2MC3 A;  3PNT A;  4ZYD A;  4XLC A;  2K3F A;  3DCF A;  3OL4 A;  2VOP A;  2QSH X;  2JA8 J;  1ETW A;  4WWC A;  3DKX A;  2VKE A;  4IRG A;  1IXR C;  4WCG A;  4OMY A;  3HBL A;  4IO9 F;  1IV8 A;  3S2D J;  1QZE A;  2M9H A;  3SZG A;  4CZC A;  1U8R A;  2E2J J;  3A01 A;  4N9H A;  1G3Y A;  3HRU A;  5D6F A;  2HZD A;  2QLZ A;  2W84 A;  1PDN C;  4XRS G;  1G8X A;  4UB8 C;  4L5J A;  2RDP A;  2EIM H;  2CMP A;  2XV4 S;  2VC0 A;  4XRF A;  4RB0 A;  3O8H A;  2ZO4 A;  5F64 A;  3T8T A;  5A2Q Z;  2HOS A;  2F4I A;  3I55 I;  1QZZ A;  1HSJ A;  5GPC A;  5DM7 F;  2VOO A;  3QPH A;  2EWN A;  3F3X A;  3QP5 A;  4XLN F;  3BR2 A;  1FC3 A;  5J3L A;  5EF6 A;  3J7A O;  2VBZ A;  3HPH A;  4QTR A;  2JWT A;  2OTJ I;  1OLT A;  3OIP A;  1T95 A;  3X2Q H;  3D0S A;  1JHH A;  3CJQ B;  3BG9 A;  2DA5 A;  3CP8 A;  5A2Q K;  2H27 A;  3LSI A;  1ON1 A;  2LP0 A;  3RKX A;  3OIQ A;  2XRL A;  1YX5 A;  3MAJ A;  1ZG1 A;  4CZZ A;  4KMF A;  2KP6 A;  3FXO A;  3L09 A;  4ZC3 A;  5HOO A;  3CO7 C;  3FXL A;  1YW9 A;  4IHW A;  2FUG 2;  1O4X A;  1E17 A;  2RVC A;  3PUF A;  4XNF A;  2V4J C;  4LLL A;  4B3A A;  4EM0 B;  5K7Z A;  5K1Y A;  3G3Z A;  5HOD A;  3JRC A;  1Y1W J;  2MAB A;  3ABU A;  3K4J A;  5CQG A;  2CQX A;  1AKH B;  3GTL J;  3SEQ A;  3OR2 C;  4JOM A;  3FMQ A;  3KEQ A;  2MD5 A;  2XGE A;  3Q3S A;  2NS8 A;  1EA3 A;  1A35 A;  1P7I A;  1BC8 C;  1ZLJ A;  2OV7 A;  5D8L B;  2PJP A;  2Y75 A;  2EFN A;  5FKN A;  1ZAR A;  2FMY A;  3HHG A;  2W85 A;  3HEF A;  3I4P A;  1FEX A;  2GOX B;  2KMU A;  2L01 A;  2Y0M A;  4LIV A;  5HS8 A;  3FX3 A;  2JUG A;  4D7N A;  4XRM A;  3F0C A;  4D1Q A;  2VPR A;  5D5V B;  1LFP A;  3BTL A;  3FK6 A;  4XKW A;  3F72 A;  4H0E A;  2EZK A;  4Y17 A;  2MYS A;  3G73 A;  1ONV A;  4M71 A;  2KJB A;  4OWR B;  1BR4 A;  2VE8 A;  3ECH A;  1FLI A;  4M3D A;  5IOY A;  2QBY B;  3A0B C;  4M9Z A;  3MKW B;  1X4P A;  1SFU A;  4IRI A;  4EGY A;  3B6A A;  3ZQI A;  1ZG3 A;  3BZC A;  2BW3 A;  2LKS A;  4EJT A;  2PBI A;  3DPU A;  2GXB A;  1FSH A;  2IRF G;  4LK1 F;  3ZP5 A;  1J5Y A;  4Y33 A;  3GTJ J;  3F8F A;  5K7F A;  3WU2 C;  1YIJ I;  2LMD A;  3KEO A;  2O0Y A;  2RC4 A;  2F6C A;  3FK7 A;  3ROU A;  4HG2 A;  1W7P B;  4G7H F;  2DT6 A;  4ANJ A;  2K85 A;  4KNY A;  2COB A;  3RQI A;  1YOV B;  2OAZ A;  3MZH A;  2R93 J;  1M1E B;  2EH3 A;  2P5K A;  2P8T A;  1JKO C;  3OSG A;  1R22 A;  3K0L A;  1JXS A;  2Y48 A;  1DP3 A;  4PSW A;  1WHU A;  4RAY A;  1IAW A;  1Y8R B;  5E3L A;  2X0L A;  3F9K A;  4M3F A;  2OD5 A;  3KET A;  4O3M A;  3BR5 A;  3I59 A;  3TO6 A;  2V79 A;  5B3S H;  3CUQ C;  2BY1 A;  3B6C A;  2DOD A;  3JTG A;  3OYJ A;  4KYW A;  3QOE A;  2GA1 A;  1ZRE A;  1T0F C;  2KHM A;  3Q9V A;  1POG A;  4ESF A;  5H2F C;  1DDN A;  2V9P A;  1TNT A;  4L18 B;  2ZKZ A;  1K6Y A;  4XOR A;  2GXG A;  2K9N A;  2FD5 A;  2VC1 A;  3OYA A;  2E7W A;  3PL8 A;  1P7J A;  2F2E A;  2Y2Z A;  3E0J B;  1R1U A;  4BE2 A;  3K70 D;  2J5O A;  5FJ8 J;  2IW5 A;  2ZJQ F;  3E7L A;  1HBX G;  2LLK A;  4HA8 A;  2DPU A;  1YQA A;  2XGC A;  4DOZ A;  4CCK A;  1OCT C;  3S1N J;  3GLX A;  3D1N I;  3EUH C;  2R7V A;  3FIS A;  3QU6 A;  3NAU A;  4NC6 A;  3IP4 B;  1R49 A;  1XX5 A;  2LBF A;  4EM2 A;  2IS6 A;  1SVM A;  2B0L A;  3F8C A;  1FX7 A;  1R1V A;  5CLS A;  4A3B J;  3IH3 A;  4IX7 A;  4D0P A;  1VTN C;  1K83 J;  3EQL F;  2L9R A;  2V1U A;  1LDJ A;  3H5R A;  1ENH A;  3WGI A;  5HLH A;  2HQN A;  3FMS A;  3R0A A;  1OFC X;  5L3B A;  4KFC A;  2UXN A;  4CCL A;  2TRT A;  2L5Q A;  1TQP A;  4PJM A;  3FKJ A;  2DTZ A;  1FOX A;  2KIS A;  4I99 C;  1XGM A;  1PUF B;  1X2N A;  1P9Q C;  2EZH A;  5LLQ A;  2W1O A;  1RUN A;  4Y52 J;  3CDH A;  5K5O A;  5KK1 A;  3IH4 A;  2D1H A;  2FQ4 A;  3CUQ B;  1VQO I;  1ETO A;  3HOS A;  1RC9 A;  1IGN A;  1F4K A;  2VQG A;  2LY1 A;  1ZRC A;  4YFX F;  4A2U A;  4R79 A;  2OF7 A;  1OCZ H;  2WAQ N;  1XGO A;  3KZI C;  4LD5 A;  3IUO A;  1K4S A;  4E7J A;  3OSF A;  4U0V A;  1KU2 A;  4JYK A;  2QQ9 A;  1VQP I;  2IA2 A;  4ZTF A;  2DCE A;  2FA5 A;  1JGS A; 
#chains in the Genus database with same CATH homology
 2HXO A;  2L0K A;  1ETQ A;  1MH3 A;  5F27 A;  3S15 J;  2R92 J;  4A3M J;  2HOA A;  5F0H A;  4DZP A;  4DYC A;  5EGO A;  1B8I A;  2NVT J;  3HOW J;  4DYQ A;  1DU6 A;  1G2H A;  5IP9 J;  5EDN A;  2W48 A;  3LOC A;  1T33 A;  3TED A;  2Y0S N;  5M5X J;  1RET A;  4MIM A;  1MSF C;  4DZJ A;  2HOT A;  3K7A J;  4FTH A;  2KDZ A;  9ANT A;  2DMP A;  2WV1 A;  4D5C A;  2L7F P;  4RDU A;  2X9D A;  2NS7 A;  3JRG A;  2GBY A;  3GTG J;  2M8G X;  4C3I J;  1IV6 A;  3ZQC A;  4NDL A;  2K9Q A;  2ECC A;  1RKW A;  4EEF G;  2R5Z A;  5FKL A;  3CMY A;  1GV5 A;  1IDY A;  2JN6 A;  1BL0 A;  3A02 A;  1BW5 A;  4B1R A;  2QF7 A;  3RZD J;  2X6O A;  1JJ6 C;  1MNM C;  2EZI A;  1B72 A;  1ETY A;  1ORK A;  1W0U A;  2CJJ A;  1OCP A;  4FCY A;  3GTQ J;  4XID A;  1PUF A;  2K40 A;  2L7M P;  3PM1 A;  4QSH A;  1U9O A;  5FKO A;  3JRA A;  5F04 A;  4XK4 A;  2DMU A;  2ME0 A;  4B4C A;  3ZQF A;  4W1U A;  2GLO A;  1H88 C;  5JLW A;  4M6V A;  2CRG A;  2FJ1 A;  2ID3 A;  3HKZ N;  3Q0W A;  4JP0 A;  3ZOB A;  5DS9 A;  2DN0 A;  1ZQ3 P;  3LSP A;  1HF0 A;  2WB1 N;  2E1O A;  5J1U A;  1IC8 A;  3HOY J;  3S17 J;  1GVD A;  2KT0 A;  3JRF A;  2XPV A;  4BY1 J;  3HM5 A;  1MBH A;  5EGO B;  3BR0 A;  1SFO J;  1RKT A;  5FKK A;  3IV5 A;  1B8I B;  3W6V A;  4MFD A;  2ID6 A;  1YRN A;  2LY9 A;  4J19 A;  3Q0V A;  1ZGW A;  1HCR A;  3TP0 A;  4ABZ A;  2E2H J;  1H8A C;  5F1J A;  2DMT A;  2LR8 A;  4DYR A;  3SDG A;  3S1Q J;  3JRE A;  1LFB A;  1FTT A;  4A3L J;  3I4M J;  3MKL A;  3HGG A;  3Q0U A;  2R0Q C;  3G1O A;  3CQZ J;  4V2F A;  1WPK A;  2R5Y A;  3RKQ A;  1VI0 A;  2LK2 A;  3QPS A;  1ETK A;  2PMZ N;  1U8B A;  1FIA A;  4I6Z A;  3BTC A;  2Y31 A;  5GP9 A;  5F0C A;  1FIP A;  5DTD A;  1IG7 A;  1T56 A;  3BTJ A;  1JTY A;  3BQZ A;  1ITY A;  2DMN A;  1UHS A;  3LSJ A;  1MBK A;  2H8R A;  2GM4 A;  1U78 A;  1BW6 A;  2G0E A;  5K7H A;  3H3V K;  4A3K J;  4G12 A;  2E2I J;  5JLX A;  1GUU A;  1QRY A;  3SFI A;  4IEJ A;  3ZQG A;  5IYB J;  2AO9 A;  2HXI A;  1ZKG A;  3LSG A;  3IH2 A;  3FKI J;  1D5Y A;  2B63 J;  3GTP J;  3GTM J;  1JTX A;  4BXX J;  3RZO J;  1EF4 A;  3JRH A;  2H1K A;  1Z77 A;  2MGQ A;  2M2E A;  4AC0 A;  1QVU A;  3BQY A;  3VPR A;  1H89 C;  2HI3 A;  4BY7 J;  1UG2 A;  1BA5 A;  2LFB A;  1QPI A;  2LVS A;  2M0C A;  5FKM A;  1W0T A;  4D7M A;  1QVT A;  4MFE A;  2CU7 A;  1HDP A;  3HOX J;  4IHY A;  2HDD A;  1MBE A;  1ZR2 A;  2AHQ A;  2R5Y B;  3UKG A;  3CCY A;  1JGG A;  2XPW A;  3BR1 A;  3G1M A;  1RR7 A;  1RES A;  4X1E A;  1JT6 A;  3GTO J;  1TWF J;  2OPT A;  3S14 J;  3MN2 A;  1WCM J;  1XG1 A;  3HGY A;  3BR3 A;  5F08 A;  2E19 A;  1JUM A;  5C4J J;  1UMQ A;  3DCF A;  3BR6 A;  1IUF A;  3A03 A;  4MLO A;  1WH5 A;  2JA8 J;  1ETW A;  4HNV A;  2VKE A;  4IHX A;  4A69 C;  3PO2 J;  1TWC J;  3HBL A;  3S2D J;  1U9N A;  2M9H A;  1E3O C;  2E2J J;  1HDD C;  3A01 A;  3MVP A;  2X48 A;  4A3J J;  1ETX A;  4A3D J;  3S1R J;  2DA1 A;  2ECB A;  4XRS G;  5M3F J;  3OOU A;  4A3C J;  5EG0 B;  2IEK A;  1AU7 A;  1K61 A;  2DA7 A;  1A5J A;  3GTK J;  1LFU P;  3O8H A;  2HOS A;  5IP7 J;  5FLM J;  2IAI A;  3NAR A;  1A6I A;  5GPC A;  3BTI A;  3TP3 A;  1GDT A;  4M3E A;  3BR2 A;  5J3L A;  2DA2 A;  5EF6 A;  4XRS A;  3S1M J;  4C3J J;  4QTR A;  4I76 A;  2JWT A;  4RBO A;  1GT0 C;  3TW6 A;  5FLV A;  4CYC A;  3BG9 A;  2DA5 A;  4C3H J;  2RAE A;  3K2A A;  1WH7 A;  2LP0 A;  3S16 J;  2Y30 A;  4A93 J;  1IDZ A;  2XRL A;  4LOC A;  1IRZ A;  4IHW A;  5IYD J;  1O4X A;  5M5Y J;  3BG3 A;  1MH4 A;  4B3A A;  5K7Z A;  2ZB9 A;  5HOD A;  3JRC A;  1Y1W J;  3GTL J;  1AKH B;  2CQX A;  1I3Q J;  3WHB A;  1NK2 P;  2EQR A;  5EYR A;  1HOM A;  2XGE A;  3Q3S A;  5BNG A;  2NS8 A;  1I6H J;  1S7E A;  1P7I A;  2Y9Z A;  3A01 B;  3I4N J;  4MO7 A;  4BBS J;  4AYB N;  5M3M J;  3FIW A;  5FKN A;  2P81 A;  2LD5 A;  1SAN A;  3HEF A;  1FEX A;  5J1Y A;  5E3O A;  1NK3 P;  1MBJ A;  2JA7 J;  1R9T J;  3G1L A;  4FIS A;  2DMQ A;  5IP6 A;  1NTC A;  3BT9 A;  1TWA J;  4D7N A;  4GFB A;  4XRM A;  1X2M A;  3F0C A;  3WHC A;  2EBI A;  2VPR A;  1LE8 B;  1F43 A;  2O7O A;  1X58 A;  3BTL A;  3FK6 A;  3HOV J;  2EZK A;  5EG0 A;  2XGD A;  3LNQ A;  2DA6 A;  4A3I J;  5M5W J;  4M3D A;  4JX5 A;  5IOY A;  4CYC B;  2QCO A;  2D5V A;  3B6A A;  3ZQI A;  3LSR A;  4A3E J;  1RPW A;  1IJW C;  3JRB A;  1MBG A;  5IYC J;  3QQA A;  2DA3 A;  1APL C;  2R7Z J;  4FE4 A;  2NVY J;  3GTJ J;  1DU0 A;  5K7F A;  4IHV A;  1FTZ A;  1JUS A;  2LKX A;  5IOZ A;  3FK7 A;  3CDL A;  4L5E A;  5C44 J;  1FJL A;  2YUS A;  3HDD A;  2COB A;  3RQI A;  1Q1V A;  4BKX A;  2JMW A;  1ETV A;  4QIW N;  2R93 J;  2EH3 A;  2DJN A;  1JKO C;  3OSG A;  5EZH A;  1BJZ A;  3TW7 A;  2XB5 A;  5E3L A;  4S0H B;  1AKH A;  2LTP A;  2MG4 A;  2HQ5 A;  4M3F A;  2JJ7 A;  2JA6 J;  5E3N A;  3M4O J;  3BR5 A;  2K9S A;  2CUF A;  5C4X J;  2ME6 A;  4FE7 A;  1WI3 A;  1XS9 A;  3B6C A;  4DW6 A;  2I10 A;  2FX0 A;  2O8K A;  1XC5 A;  2N8G A;  1OJL A;  4JX6 A;  2O9L A;  3JR9 A;  1POG A;  1CQT A;  2YS9 A;  4V2G A;  1JKP C;  1TC3 C;  2YU9 J;  2Y9Y A;  4BBR J;  2NVX J;  4M3B A;  3GBG A;  1LE8 A;  2JK3 A;  1JUP A;  3ZQL A;  2K9N A;  4UUS A;  2L7Z A;  2FD5 A;  4A3F J;  5GPA A;  1P7J A;  2Y2Z A;  3QPL A;  1F36 A;  1JKQ C;  3L1P A;  5IPA A;  5FJ8 J;  1VND A;  4M3G A;  2IBD A;  1JJ8 C;  1MBF A;  4D5F A;  1VFC A;  3E7L A;  2LLK A;  1GV2 A;  2XGC A;  1OCT C;  3S1N J;  2EZL A;  3D1N I;  2DA4 A;  4Y7N J;  2HYJ A;  2JA5 J;  4X6A J;  2CQQ A;  3JRD A;  3FIS A;  1ZTR A;  3NAU A;  2XSD C;  3HOU J;  3ZQH A;  3C2B A;  5J1R A;  2VI6 A;  5F0F A;  4XIC A;  3H0G J;  4A3B J;  3IH3 A;  3M3Y J;  1ZR4 A;  3S2H J;  5C3E J;  1K83 J;  2L9R A;  2MW8 A;  2R5Z B;  2NOG A;  1AHD P;  1ENH A;  1I50 J;  1OFC X;  1Z0X A;  2TRT A;  4JX4 A;  1B72 B;  2DTZ A;  5E3M A;  1PUF B;  1X2N A;  2EZH A;  1JT0 A;  4Y52 J;  3BG5 A;  3IH4 A;  1HLV A;  1Y1V J;  2FQ4 A;  1MSE C;  2VKV A;  3O8G A;  2TCT A;  1ETO A;  5EZG A;  1IGN A;  1TWH J;  1VF9 A;  2XB0 X;  5EEA A;  2NVQ J;  4UUS B;  3DEW A;  3PO3 J;  2OF7 A;  4W97 A;  4AUX A;  3JRI A;  2WAQ N;  4UUT A;  1TWG J;  3HOZ J;  4A3G J;  1ZK8 A;  3HB9 A;  3OSF A;  2CUE A;  2M34 A;  3OIO A;  4JYK A;  2MSY A;  1YRN B;  2VUM J;  3SJM A;  4C2M J;  2XPU A;  1WGX A;  1JKR C;  2ELK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...