2EZIA

Solution nmr structure of the igamma subdomain of the mu end dna binding domain of mu phage transposase, 30 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
MNVHKSEFDEDAWQFLIADYLRPEKPAFRKCYERLELAAREHGWSIPSRATAFRRIQQLDEAMVVACREGEHALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSPOSASE
publication title Solution structure of the I gamma subdomain of the Mu end DNA-binding domain of phage Mu transposase.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1997-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eziA00
1TWHJ 3BR1A 3HBLA 2XB5A 1MBEA 1DU0A 3BR0A 1AKHA 2E2JJ 2VPRA 4A3IJ 1FEXA 1U9OA 1U78A 2EZHA 1IJWC 4QIWN 1AKHB 3IV5A 1D5YA 2O8KA 4A3FJ 1JUMA 1RESA 5FKNA 1HCRA 2H1KA 1ETWA 5F08A 1RKWA 2DMPA 3OSFA 2LTPA 3HEFA 2M34A 2XPUA 1SFOJ 4S0HB 2JWTA 2Y30A 1QRYA 1ZGWA 1U9NA 2GBYA 3JREA 1JUPA 2HI3A 4BY7J 2DJNA 1PUFA 3BQZA 2EQRA 3BTCA 3OIOA 4M3BA 4I6ZA 1W0UA 1YRNA 1PUFB 1F43A 3BTJA 1HDPA 3HM5A 3TW7A 3LOCA 4RBOA 1W0TA 5C4XJ 1YRNB 4BBSJ 1FTTA 2DMUA 5DS9A 1WCMJ 5IYCJ 2FQ4A 4AYBN 3JR9A 5EGOA 2CRGA 5E3OA 2YS9A 1ETKA 5EGOB 3MKLA 3NAUA 1P7IA 4W97A 2R5ZA 3BG3A 2R5ZB 4W1UA 3TP3A 3BTIA 1VF9A 2JA8J 1WPKA 2QF7A 3Q3SA 1R9TJ 2M8GX 3OSGA 2NVQJ 5FKOA 4M3GA 3GTMJ 4DZJA 3IH3A 3RZOJ 5C4JJ 5IOYA 4FISA 1H89C 1GV5A 3JRFA 1CQTA 1K61A 3BT9A 1Q1VA 3QPSA 4A3JJ 2X48A 4XK4A 1ETOA 4M3EA 3D1NI 3DCFA 1FJLA 4HNVA 3S1QJ 1MBFA 1WH7A 1I3QJ 3G1OA 3DEWA 4MLOA 1H88C 1GDTA 3JRIA 1HLVA 1ZQ3P 4DYQA 2AHQA 2HDDA 1OCTC 2YUSA 2LR8A 4QTRA 3JRDA 1Y1VJ 3H3VK 2NVYJ 2CUEA 5M5WJ 4FE7A 5IYBJ 1NTCA 2OF7A 3ZQHA 1GT0C 2ZB9A 4DW6A 3BR6A 2X9DA 5FKLA 3A03A 5IP9J 5IOZA 4B4CA 3BR5A 3TP0A 1HF0A 3Q0VA 3JRHA 1OJLA 2OPTA 5EZHA 4AUXA 3FKIJ 3HOWJ 1GVDA 3FK7A 5IYDJ 2O7OA 5GPAA 3HOZJ 2DN0A 2VKVA 5F0FA 2FD5A 4ABZA 4BY1J 1ETQA 1B72A 1B72B 2DA1A 4A3LJ 5M3FJ 2LFBA 2CJJA 2KDZA 2COBA 4XRSA 2IBDA 1TWGJ 2LD5A 1LFUP 1MBGA 2XRLA 2Y2ZA 2HXOA 4A3EJ 2LK2A 2E1OA 5HODA 4XIDA 1JKPC 2JA7J 2MG4A 1MH4A 5F0CA 3TEDA 1VFCA 3OOUA 3HGGA 2DMTA 4LOCA 2KT0A 4D7NA 3S1MJ 2HXIA 1JGGA 2O9LA 2L7FP 1GUUA 5K7HA 1BA5A 1ZR2A 5EZGA 4M6VA 1AHDP 3B6CA 4FCYA 3S1NJ 2XPWA 1LFBA 4IHYA 3GTQJ 2GLOA 3WHCA 4JP0A 1Z0XA 3Q0WA 1MBJA 5K7FA 1K83J 3HOVJ 2CUFA 4C3HJ 3SDGA 4DYCA 1ETYA 1MSFC 2QCOA 5E3MA 2NVXJ 3LSRA 1HOMA 1GV2A 3GTPJ 1JKQC 2XPVA 2HOSA 1WH5A 1IG7A 2MW8A 4JYKA 2NS7A 4A3MJ 1RETA 2VKEA 1FTZA 3GTOJ 1IRZA 1IDYA 3W6VA 2EZKA 4XRSG 2JK3A 4CYCA 3L1PA 2ME6A 4IHWA 3LSGA 1IDZA 4XICA 4CYCB 3ZQGA 1NK2P 1H8AC 3GTGJ 5IP6A 1ZK8A 2M0CA 2JMWA 3H0GJ 5IPAA 5JLWA 5E3NA 2LY9A 3GBGA 1FIAA 2EZIA 2X6OA 2ECBA 2K9NA 1JKRC 2EBIA 4JX5A 4BXXJ 3M4OJ 4V2FA 4X6AJ 3HKZN 3ZQFA 5GPCA 2N8GA 1QVUA 5F04A 2R7ZJ 4GFBA 3PO3J 3S14J 3RZDJ 2YU9J 1BW6A 2JJ7A 1LE8A 1ZR4A 4UUTA 5EEAA 1Z77A 2DA6A 3S2HJ 2ECCA 2K9SA 2CQXA 1LE8B 4RDUA 2NVTJ 3VPRA 4D5FA 1SANA 4UUSA 2PMZN 4C3JJ 2HYJA 2TRTA 3O8GA 3RQIA 5M3MJ 4UUSB 2WAQN 2XB0X 5J1YA 1NK3P 3ZQIA 4A3KJ 2VUMJ 1BL0A 1ENHA 4A3GJ 1JKOC 1E3OC 3MN2A 2NS8A 4JX4A 4DYRA 2G0EA 5F27A 2DMNA 2D5VA 2JN6A 2JA6J 1T56A 1ITYA 3HOYJ 1FIPA 2L7MP 1ETVA 3LSJA 4A69C 4A3DJ 3CMYA 4IHXA 2IEKA 1RR7A 2ID6A 5J3LA 4IHVA 5E3LA 3G1LA 3PM1A 4BKXA 3FIWA 1JTYA 2CQQA 2DA7A 3HOXJ 3ZQCA 1XC5A 1A5JA 2LP0A 2L9RA 3JRBA 1OFCX 2DMQA 2E2IJ 1S7EA 4I76A 3SFIA 1AU7A 2Y31A 3BR3A 2LKXA 3S16J 2DA3A 3BG9A 1IV6A 3FK6A 2R93J 2H8RA 3B6AA 2GM4A 3BG5A 4XRMA 5FLVA 4FE4A 4NDLA 4JX6A 2DTZA 2ID3A 1XS9A 2CU7A 4MO7A 2XSDC 9ANTA 2Y9ZA 3K2AA 1WGXA 2M2EA 3PO2J 3CCYA 5FLMJ 1B8IA 2HOAA 2XGEA 5FKKA 5K7ZA 1T33A 2LLKA 1JJ6C 5F0HA 2W48A 1B8IB 1RPWA 2I10A 4V2GA 1UHSA 2VI6A 1MNMC 5M5YJ 5GP9A 4M3FA 4QSHA 1QPIA 1RKTA 3HOUJ 5C44J 1I6HJ 3C2BA 2XGDA 3CDLA 1QVTA 2R92J 1A6IA 3S2DJ 2NOGA 2K9QA 5J1UA 3A01A 1TWAJ 2WV1A 2ELKA 4X1EA 3K7AJ 4MFDA 3A01B 4BBRJ 3HDDA 1HDDC 5FJ8J 1BJZA 3MVPA 3S1RJ 4A93J 5EYRA 3I4MJ 5FKMA 3G1MA 3BQYA 1ZKGA 1XG1A 4L5EA 2K40A 3M3YJ 4A3BJ 4MIMA 3ZQLA 1X2MA 2EH3A 1F36A 5M5XJ 3JRGA 4D7MA 2IAIA 3LNQA 2JA5J 4G12A 2DA2A 2LVSA 3GTKJ 3I4NJ 3NARA 5DTDA 1BW5A 2ME0A 2R5YA 3BTLA 2MSYA 4FTHA 1ORKA 3A02A 2R5YB 3QPLA 4B3AA 1MBKA 2P81A 1VNDA 3FISA 3Q0UA 1IGNA 3ZOBA 2TCTA 2L0KA 1POGA 2L7ZA 4Y52J 1JTXA 3E7LA 2XGCA 5JLXA 3HB9A 5IP7J 3JRAA 2Y9YA 1U8BA 3F0CA 5EDNA 1APLC 1WI3A 4M3DA 5BNGA 3SJMA 1JUSA 1G2HA 3WHBA 4C2MJ 1VI0A 1OCPA 1JJ8C 2DA4A 4AC0A 1JT0A 5C3EJ 3RKQA 3CQZJ 1O4XA 1MSEC 2EZLA 3QQAA 2E2HJ 3GTLJ 4IEJA 2R0QC 3UKGA 4B1RA 5EF6A 2FJ1A 3JRCA 3IH2A 2DA5A 1EF4A 3IH4A 1IUFA 2E19A 1TWCJ 1IC8A 1TC3C 3S17J 2MGQA 1UMQA 4D5CA 5J1RA 2RAEA 4Y7NJ 2M9HA 4A3CJ 1TWFJ 3GTJJ 1P7JA 1Y1WJ 1ETXA 2FX0A 2WB1N 4MFEA 3HGYA 2Y0SN 1DU6A 1ZTRA 4DZPA 1JT6A 2HQ5A 1MBHA 1X58A 4C3IJ 4J19A 5EG0A 2AO9A 1X2NA 4EEFG 3S15J 3TW6A 1I50J 5EG0B 1UG2A 2B63J 3LSPA 2HOTA 3BR2A 5F1JA 1MH3A 3O8HA
chains in the Genus database with same CATH superfamily
2H09A 3N05A 1YO5C 1KGSA 3KZZA 4XKCA 1S9HA 3BR0A 3CJNA 1VQ8I 1D0YA 1U78A 3ELKA 3IV5A 1D5YA 3DPUA 4IF4A 2O8KA 1JUMA 5L3CA 3A0HC 4KNYA 1LDDA 3ABMH 3OYIA 3GZ6A 1O3QA 1MMNA 4ENJA 2QKMB 1MZBA 3T0YA 2DK8A 2M34A 3T8TA 2EJRA 4S0HB 3X2QH 2Y30A 2I5UA 5D8KB 2JVHA 2NNYA 4U0VA 2UUZA 2GBYA 5FRMA 1YITI 1JUPA 2HYFA 1QNTA 3DFGA 3L2WA 1H9GA 2DJNA 3FDYA 4RGSA 3FM3A 1FY7A 4M3BA 3OIOA 2A6HF 3CF5F 5D6EA 1W0TA 1HDPA 3HM5A 1RUOA 4N9HA 2VT2A 5C4XJ 1FTTA 2DMUA 5DS9A 5HNHA 1T08B 1WCMJ 2FQ4A 1K78A 2KKOA 2KIQA 3E6BA 5J8CA 3K4MA 3TO7A 1HKTA 5E3OA 4BE0A 1K78B 1ETKA 4RGRA 3NAUA 4IRHA 4ZYEA 1P7IA 5D6FA 4PK4A 4FHTA 1IXRC 2A6TA 2HZTA 2DJIA 5JI6A 3G73A 3UNGC 5GAHJ 3KEOA 2F5FA 3BWGA 5BOXA 3SZPA 4ZJZA 2Y48A 1XMKA 1KU3A 2FNPA 3GLLA 4XSZF 1A04A 3T5XA 3K70D 2QF7A 1R9TJ 4IRGA 4LB5A 2KQRA 2M8GX 3OSGA 5B5EC 2Z99A 1Q1HA 2I8DA 3HHGA 2IS4A 1H9TA 5TJJA 3LSTA 1H89C 4EQQA 3ZMSA 1GV5A 5HS9A 1CQTA 3CC4I 2K86A 3CTAA 3DPTA 2DDBA 1ETOA 4M3EA 4XK4A 1ZH5A 3HTSB 1OPCA 3OS0A 3G1OA 1P9QC 3PSIA 3T8RA 1OLTA 5DM7F 2QVOA 1X4PA 4BH9A 2VE8A 4B43A 4QTRA 4OIRF 1R5ID 1Y1VJ 4KITB 1USTA 5IYBJ 3RPUD 2OF7A 4WXDA 1U5TA 1GT0C 3TO9A 2WY8Q 2ZB9A 3WU2C 4DW6A 3WG7H 3HSEA 1FWZA 5FKLA 3OOPA 1U5TB 1DGWY 1DP7P 1E3HA 2ZNZA 3FMRA 1OJLA 3LFUA 3M1EA 2OPTA 2YR2A 3CJTB 1D0ZA 3F21A 2DDAA 2O7OA 4BL0B 4G6DA 3HOZJ 2DN0A 4Y13A 3A4CA 2OCEA 4H4KC 3RKYA 3FXKA 2IPQX 2XGXA 4XONA 1XSVA 3KIOA 1MJAA 3BC8A 2OA4A 3MWMA 3F8NA 3FX3A 1FBUA 1DQUA 3SXYA 4DBQA 2HVQA 4KISA 2B7EA 1YIOA 2LD5A 2PMUA 3BOQA 1LFUP 1P4WA 2Y2ZA 1HSJA 2QA4I 1ZYRF 5HODA 5AONA 2K3FA 5HNFA 1MH4A 5F0CA 3DLLF 1VFCA 2DMTA 3PL8A 1ZG1A 2DFIA 3QYFA 4I0AA 4XL9A 1QA6A 1JGGA 2QGUA 2VT3A 4LD5A 4OMZA 2PLYA 1BJAA 3M9AA 4DIQA 4KIBA 3QP6A 1K7AA 1Z3XA 3G3ZA 3LA3A 4CA0A 2E60A 4M6VA 5B3SH 2NXNB 3S3MA 3K2ZA 3S1NJ 3MKZA 4HPQA 4IHYA 3WHCA 2P6TA 2QSHX 3FXQA 3RQ4A 2FNAA 2A05A 5HDNA 1T0FC 4P5OA 3CLQA 3FZVA 2IP2A 4BJ5C 1UG0A 3CMEI 4I09A 4NB5A 4BJTA 2RC4A 2HVSA 2LY2A 1WJFA 4DYCA 2QCOA 5E3MA 3EYYA 1HOMA 1JKQC 3FXUA 4D1QA 2FA5A 5K5OA 3KP6A 1SFXA 3IAS2 5CVJA 2VKEA 4WXCA 1FTZA 1IDYA 3W6VA 4UB8C 2R7XA 2ME6A 3HOTA 3ROUA 1XB4A 2H27A 1NK2P 2LSOA 3DU5A 3HRSA 5KAIC 2VBYA 1F4KA 5E3NA 3FF5A 2OZUA 1A35A 4FQGA 3FBNB 4XKVA 2CFOA 4YFNF 2EBIA 2LRDA 3OYGA 4V2FA 2W57A 2WV0A 2LOOA 3E3VA 4EGZA 2WAQA 5GTIC 2LF7A 2W25A 4XKWA 1BW6A 2JJ7A 3HUGA 3OYKA 2CV0A 4UUTA 4DJAA 5EEAA 2DA6A 3S2HJ 2NAZA 3RKWA 4DNCA 3IRRA 3HUGB 2G7UA 1WFXA 2NVTJ 4D5FA 4UUSA 3COAC 3KPHA 4HV5A 1I3AA 1LDKB 4UUSB 2WAQN 4G7OF 1S29A 3E6CC 1BC7C 4PUSA 4XOPA 4EM0B 3BCBA 1V5FA 1FC3A 2VUMJ 1ENHA 1YLFA 4A3GJ 1JKOC 4UV8A 2LBFA 1FBSA 2EA4A 3VYUB 2MFZA 3JAMK 2VE9A 1TQIA 1WJDA 2LBFB 4JX4A 5D5WB 3CCRI 3IWFA 3V7RA 2YSRA 3HOYJ 2L7MP 1ETVA 5LEKA 3NWSA 4CXFA 3SZGA 4IHXA 4YIRX 2QYOA 3AFHA 4AVPA 5J3LA 4Y3OA 1XGNA 3QYBA 5FO5A 1B9NA 3F8BA 1RZ4A 3PM1A 3TDUC 3LA7A 1IN4A 1JTYA 1H0MA 2CQQA 2ESNA 2FQ3A 5GAEJ 5ICFA 1A5JA 2LP0A 3FBIB 5D5XB 2P4WA 2V1DA 2P7VB 3T1BA 2DK5A 3CUOA 3K6GA 4EJWA 4U7DA 1IV6A 5CKTA 3R61A 2W00A 2O3FA 3QWLA 2E71A 2KRCA 3WGGA 2DTZA 4CCNA 3OIPA 1EH6A 1J7KA 3V8JA 1B59A 2MABA 9ANTA 3K2AA 3ZR8X 2JTVA 3CCYA 3BP8A 5FLMJ 1B8IA 4YEJA 5FKKA 1R5GA 1T33A 2FXAA 4P9UA 1B8IB 2Q8KA 1RPWA 3LFKA 4F55A 2MH2A 2XF7A 3BLYA 3O3KA 2OAZA 4CGZA 3C7JA 4ZC3A 2GIZA 3MEXA 2DPDA 2IA1A 4MGRA 5KVRA 3ZPLA 1QPIA 4YG2F 3W3CA 3IKTA 1NG7A 1WJEA 2AXTC 2BVLA 3F72A 4FASD 4KDPA 1I27A 3KP7A 1J59A 3G2BA 1QVTA 2A5WA 2DOFA 3EETA 4UVAA 3S2DJ 1ON1A 4U0YA 2ZMEA 5CQEA 2D1HA 3A01A 3I9V2 2V1UA 2ZMEB 3CCEI 1J9IA 3A01B 3MVPA 3TO6A 3WGIA 4A93J 2GXBA 5EYRA 1X19A 3ZMUA 5LGUA 3ZCOA 4XBFA 2NYXA 4IQ4A 1XG1A 2K40A 4LK1F 4XSXF 2FEZA 2R7QA 1UELB 3E5QA 4XLHA 2EH3A 4E7LA 2HGCA 1RC9A 3R4KA 4XM3A 2HVRA 2VOOA 4GCVA 1RUNA 2DA2A 4G94A 2GWRA 3K4BA 2VIXA 2IGMA 1ZRDA 1O3SA 1W36D 4BE2A 1L0OC 2EINH 2BW3A 3PUBA 3L2RA 3W2WA 2LDUA 3OYBA 2R5YA 2EFOA 3BTLA 4BHPA 2IS6A 2BW3B 2IJLA 4FTHA 3A02A 5LGTA 4S05A 2R5YB 4AIKA 4B3AA 5B1AH 1WJ5A 2OZ6A 2HS5A 3RCOA 2W85A 2BXZA 2W84A 3ZOBA 3LA2A 4BUPA 4BU2A 4Q47A 2ZSHB 4Y52J 2QQ8A 4C2TA 4EM2A 3CCUI 1E2XA 2E7WA 2VJ4A 3M8FA 1W4MA 3SZTA 1HW2A 1MMSA 3U21A 2Y9YA 4D0PA 2RKHA 4UHTA 2DT7B 4CO8A 2K5CA 4EVIA 1WI3A 4IQJA 1U5TC 4M3DA 5HLTA 5JVGF 3CO6C 2X0LA 1OCPA 4AWXB 5JFRA 1YW7A 1JJ8C 4AC0A 4I98B 4MHGA 2GOMA 2WB1A 1ZAOA 3KFWX 5B1BH 4ASNA 3KCCA 1LEAA 3OYAA 3JRCA 1IUFA 1TWCJ 1TC3C 2JT1A 1I1GA 5J1RA 5E18F 4Y7NJ 2MA3A 3G71I 2XAJA 4EJVA 2WB1N 3M7GA 4IJAA 3ERMA 1DU6A 5FB2A 2Q2EA 4XKBA 3K1MA 1X58A 4C3IJ 1KQ0A 2Q2EB 1EH8A 2HR3A 3WE2A 5GADJ 4EV0A 2Z5UA 2VPLA 2H8WA 1Z1DA 4KUMA 5EG0A 3KYCB 2F5EA 3OYFA 1YHQI 2DT5A 2XDVA 3FXRA 1B1BA 3OR2C 5EG0B 5F1JA 1MH3A 3O8HA 2AQEA 5GAGJ 5LGNA 1TWHJ 2Q1ZB 3BR1A 3FKJA 3HBLA 1IN8A 3C18A 1AKHA 2E2JJ 2VPRA 2GA1A 1U9OA 2EZHA 1IJWC 4J01A 4QIWN 4E7KA 1WQ2A 1AKHB 4GYGA 3U2RA 1X1PA 1QZYA 1IN6A 1GXPA 5FKNA 2H1KA 1XDUA 3K0LA 3W6KB 4CZCA 2WC2A 1O57A 5ILUA 3QPHA 1RKWA 1V5EA 2GXAA 1QZZA 2FOKA 1SFOJ 1Y0UA 2JWTA 1VQPI 3OYNA 1QRYA 1U9NA 3SFZA 1G59A 4R8HA 2P5VA 4ZYHA 4HX4A 2E35A 2V4JC 4N0BA 4BY7J 3RDIA 2D45A 2W82A 2V9VA 3F9KA 4YRVA 3BTCA 2DOEA 3CJRB 3IRQA 1U3EM 1YRNA 4KMFA 3DKXA 1F43A 2O8XA 3LOCA 3WTWC 1YRNB 1WHUA 3QU6A 2JQ7A 1XSXA 3JR9A 2CRGA 2HDWA 3K4KA 2O03A 4CICA 1VQ5I 2YS9A 4OIPF 2VB6A 4EATA 3WTYC 1SVLA 2DU9A 5LLQA 5E8IA 1USSA 3OYHA 4BEHA 2JA2A 2Q0OA 4BHCA 4W97A 4HX7A 2R5ZA 3S32A 4BEHB 4MEXF 4M71A 4CCLA 2R5ZB 2K9MA 3HIFA 4XLAA 5LRSA 5LD2C 2DFEA 1VQLI 3R6SA 4Q4ZF 3PQKA 2JA8J 1WZ2A 4EGYA 4I99C 2R7TA 1YJWI 5J8FA 3ABKH 2R7DA 2LC2A 3DTIA 5FKOA 2W4SA 3GTMJ 6PAXA 2L3DA 3RZOJ 1MGTA 1SMYF 2WADA 3M1CA 3OL3A 4FISA 2P5LC 1QBJA 1FYLA 1XN7A 5CPRB 1PP7U 1TTYA 3P9CA 2YU3A 3P9KA 1BIBA 4A3JJ 2ISZA 1T95A 4XR6A 3H9JA 2ZJRF 3V7SA 1MDMA 3E6MA 2QWWA 4XNFA 3S1QJ 1TLHB 1R7JA 1I3QJ 4WK8F 1MDMB 3DEWA 1H88C 4OAYA 3SDBA 1OMIA 1HLVA 1D1AA 2KP6A 4EJUA 3WU1B 1YG2A 1CF7A 1UAAA 2AHQA 3H5NA 3Q9SA 4RA2A 1SFKA 1HKSA 4CZZA 1CF7B 2DT6A 3JRDA 5A2QZ 2Y75A 2CUEA 4MQ9F 1EKEA 4FE7A 3OYLA 1P4AA 3MMYB 2M1BA 1R1TA 3ZQHA 3JTHA 2XAGA 2HFHA 5IP9J 5IOZA 2HPMA 2BHYA 1Z7LA 4BQNA 1G4DA 4HV6A 4LB6B 1LDJA 2WAFA 5EZHA 4EMSA 1C0WA 1XSDA 3J7AO 3FKIJ 1SD4A 1WWXA 2WA0A 2O5RA 3ASOH 3U1DA 1F5TA 2XRNA 5GPAA 3GLXA 1D8KA 1ULYA 5F0FA 3F8MA 5J4YA 2DYRH 4Z6YA 2VQGA 3RPQA 3LSHA 2KIFA 3V4GA 1MMAA 3MZ8A 2DI3A 2R4GA 3I71A 3KEQA 3AG4H 4P96A 4QPOA 2KMUA 2E5NA 2RGVA 4XRSA 2NS0A 1LVKA 2XRLA 2ELHA 2HXOA 4A3EJ 4L9NA 3GMEA 3BDDA 2KLOA 4U88A 3RYRA 2L54A 4DGWB 1PJRA 2HQNA 1SMTA 4E70A 4D7NA 2L9VA 1KYWA 2L7FP 3OR1C 1FP1D 2R7WA 3OIQA 1BA5A 1ZR2A 2DYSH 2OJED 3ZMZA 5LFAA 2J5PA 5L3EA 1LB2A 1G8XA 3HG9A 4O3MA 1W5SA 5EZGA 2HQAA 3GZ5A 1BR2A 2JUCA 3LQRA 3PNVA 2FU4A 4WWCA 4IOCF 3RPUA 2LKSA 2XPWA 1LFBA 2GLOA 2KPMA 4JP0A 4HOBA 3GFLA 2M7AA 1FOWA 3Q0WA 4Y4RA 1PVEA 1X1DA 2UWMA 1SVOA 2D1VA 2LH9A 1DDNA 2CUFA 1XGSA 4KJZA 4PJNA 1M1EB 2IS1A 2ZMEC 1ETYA 1DUXC 2NVXJ 3LSRA 1V3FA 1GV2A 2CWEA 2VBWA 3PJRA 2K4BA 2XPVA 1J2XA 4BHBA 3J80Z 5J6XA 4IL6C 4S04A 1KYZA 2HOSA 1GLNA 4CH7A 1IG7A 4V19K 5FD6A 1VQKI 4A0YA 4A3MJ 1IRZA 2JK3A 2K02A 4L5JA 3LSGA 1DPUA 4CYDA 2Z33A 3EUAA 4HF2A 3H0GJ 3CCMI 3C1DA 1W7PD 4L9JA 5JLWA 2LY9A 3GBGA 1FIAA 1IF1A 2X6OA 2LKPA 2ECBA 4OIQF 2K9NA 3WG9A 1JKRC 2PMZA 4KT5C 1XDSA 4RS8A 1AA7A 3TKYA 5D5UB 5D8LB 5GPCA 2N8GA 3PO3J 2F2EA 1Y0NA 3O6BB 1TW2A 1LE8A 3W6JB 4LLLA 1Z77A 4AD9A 1ZARA 2K9SA 1LE8B 4WXHA 3S8PA 2DW4A 3GFMA 1R4MB 1YJNI 2PMZN 2V26A 3S93A 1FMWA 4C3JJ 2TRTA 1BR4A 2MC3A 2K4JA 4MEYF 1ZG3A 2TDXA 1TL8A 3LSMA 2EFNA 2M3AA 2QUFA 2L2OA 2XKPA 1BL0A 5JVTA 1Y39A 3A1YA 4UNOA 2A61A 3MN2A 3CO7C 2J5OA 4FT8A 3E6DA 4DYRA 1E0EA 2G0EA 3BY6A 5BPDA 2M8EA 2D5VA 2QM3A 3K4CA 1ITYA 4ITVA 3AKZA 2EV0A 1FIPA 3LSJA 4A69C 1ZLJA 3CMYA 2VBXA 1DGRM 2NRAC 1YTYA 1IAWA 1FSHA 1WI9A 2ID6A 2ZFUA 4YELA 3U1KA 4F3QA 1YJ9I 4Y33A 4IHVA 3HXLA 4ZTJA 2ZFWA 3FIWA 1YW8A 3HOXJ 2VKDA 1YFHA 2DAOA 3HTUA 3ISPA 4XQFA 4L0YB 3O2PE 2E2IJ 1OR7A 5D5VB 3PFYA 3M8JA 3SFIA 4UUVA 2Y31A 3BR3A 1HKQA 1G3SA 2KZVA 2DA3A 2EV5A 2MBFA 2ZXJA 2MD0A 2H8RA 3B6AA 2EB7A 2RN7A 3M07A 2E1MB 4NDLA 4A5MA 2EIKH 3GYHX 2R7RA 4BACA 1YOVB 2L4AA 2M5WA 2ID3A 3TQNA 1XS9A 1KU2A 2DO7A 3GUDA 2DOAA 4C9YA 3ZP5A 2XSDC 4IX7A 1SFUA 4IRIA 3KP2A 1YIJI 1R5HA 4XORA 4XN0A 3DXJF 2V7FA 4HLXA 2HKOA 3REOA 2LLKA 1O3RA 1JJ6C 2H6BA 3ZXSA 5F0HA 4I2OA 1HA8A 4PDKA 1FOXA 2V9PA 4V2GA 1UHSA 3BPVA 2L9NA 2RVCA 5GP9A 4AM3A 1I5ZA 2R7SA 4Y15A 1FYMA 4LIVA 1B6AA 2A5YB 4B8XA 5J4VA 2IS2A 2V6EA 2QQ9A 1EV7A 5F64A 2X4HA 3C2BA 2E36A 1YI2I 4BE1A 2R92J 2O61A 1A6IA 3V8KA 2WV1A 1ERDA 3K7AJ 3VB2A 4CSWA 3EUKL 4BBRJ 1PUEE 3P5JA 1D3YA 5CYVA 4AIHA 4CHUA 3I4MJ 3F6VA 4HYEA 3G1MA 1WJBA 1FBQA 2XF5A 1U2WA 4L5EA 2HEOA 2CFXA 4N4OB 2NOJB 3WTUC 1JHFA 2R7UA 2C6YA 3VYSB 4MIMA 4HX8A 1R23A 2P5KA 3LMMA 5HDGA 1FNNA 3QOPA 2UZKA 3CF2A 4D7MA 3S3OA 4LITA 5EJCA 5KHDA 4BDYA 1LEBA 2CQKA 1X1AA 2LVSA 1U0JA 3K10A 3I4NJ 4HNTA 2XAHA 3KLNA 3TOAA 4ANJA 1GXQA 1ORKA 1R71A 2L7KA 5K1YA 1QU3A 1MBKA 3RYPA 2ZCWA 3DEUA 2HOEA 3K4JA 3Q0UA 1R36A 1IGNA 2TCTA 4CCJA 1T8IA 2L7ZA 1XCBA 2XGCA 2XAFA 5E1WA 5JLXA 3Q9VA 3TMOA 1TNTA 5L3BA 4YFKF 4LLGF 5IP7J 4KN4X 2ZXWH 3K69A 1PYVA 1SD6A 3MD2A 1APLC 2QENA 3H5AA 4HF0A 5BNGA 3SJMA 3VODA 1G2HA 3ECOA 3H3UA 2HDCA 4GGGA 2DQLA 4M6YA 2ZBKA 3HSFA 3W2VA 3RKQA 3CQZJ 3F3XA 2EZLA 2E2HJ 2WTEA 4PGHA 1KQ8A 4IEJA 1N77A 5L3FA 3UKGA 5DDGA 3CMAI 2FJ1A 2DA5A 1EF4A 3IH4A 2BY3A 1IC8A 2PFBA 5E1XA 2MGQA 2CQ7A 2IGKA 1N25A 4A3CJ 2M9HA 4XLCA 2HYGD 1P7JA 3L2QA 1OCZH 3D5SC 2H94A 1PDNC 2KL4A 1FLIA 3BZ6A 4DZPA 5TGTA 5CVIA 2JPBA 4YIIA 3GWZA 4RB3C 3G4SI 3D5RC 4MQVA 4NC8A 2IA2A 4LMYA 4J19A 2XAQA 1OYWA 1X2NA 3P9IA 4EEFG 3Q5FA 1J0RA 1XPXA 2BZTA 2Z1DA 2CG4A 1O7LA 4PGGA 2KIMA 3JRFA 2FRHA 2BHZA 5DUKA 1A31A 2XHKA 1Z67A 1T2KA 1IN5A 1HXDA 4B47A 4Z2YA 1KA8A 3BG7A 4MTEA 2FUG2 1X1CA 4KIGA 3FMSA 2BE5F 3KYDB 4II2A 4CCOA 4A2UA 1RESA 3WTVC 2LF8A 2LG4A 4BQQA 3PSFA 5AIQA 2F4MB 4O5VA 2XPUA 3VDXA 1XCVA 1DP3A 5DD8A 1WVRA 3K1PA 4AYBA 5BQTA 3JREA 3VYTB 2V79A 2CSOA 3I53A 1IN7A 3BROA 3GXOA 3BJAA 4CDGA 2EQRA 4PJLA 4I6ZA 1W0UA 3LWFA 3BTJA 3TW7A 2CV1A 4HZFA 4AYBN 2ZC2A 2MC4A 3GZNB 4ZYAA 1YX3A 1R00A 2M4GA 2XUBA 4A5NA 3FXJA 2XAUA 3FXMA 3BG3A 1K6YA 4GYIA 3GEZA 5CLSA 2XKOA 2KZGA 5HLHA 1Z6RA 3ZMTA 4PSXA 3TP3A 3BTIA 2ICWG 1VF9A 2MLKA 3KYLA 3L2CA 4NQWA 1SFEA 1Y56A 2EFQA 2HPIA 2D2WA 5HLIA 4NQWB 4E7IA 2F48A 3P7NA 1NG6A 4MNUA 4U87A 3IH3A 1EH7A 1VQOI 4JOMA 3HPHA 2VOPA 1A6QA 5CQGA 1K61A 2M45A 1HC8A 3L7WA 2BYVE 4K2EA 1Q1VA 3QPSA 5FROA 4NNJA 4HNUA 2X48A 4LJZF 3F23A 3ZN0A 3DCFA 3CCQI 1FJLA 4M73A 5DCMA 1MBFA 1F1ZA 1R58A 2VJ5A 3HL2A 3VWBA 1CGPA 4MLOA 4G7ZF 1MMDA 1GDTA 5DCMB 4RAZA 4RLFA 3JRIA 4HAMA 1JE8A 1MD0A 3I58A 5ERIA 3IHUA 2LR8A 1BR1A 4OOIA 2CUZA 2EK5A 3H3VK 4F92B 5M5WJ 1NTCA 5DUIA 2R7FA 4OINF 4IHTA 3K4NA 1U8RA 2DXIA 3BR6A 1P2FA 2X9DA 2JUGA 1SEUA 2ZNYA 3WGHA 1VZ0A 3LSIA 1EJ9A 3BR5A 3DKYA 3SYTA 5HDKA 3TP0A 1HF0A 2OU2A 1HBXG 1IXSB 3F6OA 2CW0F 1UFMA 4OU0A 3HOWJ 1GVDA 3FK7A 4BQOA 4ZH4F 1IO2A 5IYDJ 4ESFA 3CJQB 4F52A 1T98A 3G6EI 4G8XA 4ABZA 3ZMDA 1V5GA 3AG2H 4HQMA 4BXFA 2K85A 2VC1A 1LQ1A 2DA1A 2X1CA 2MD5A 2H1LA 4A3LJ 2RQPA 4L5IA 5M3FJ 2OQGA 1P4XA 2CJJA 2KDZA 1V54H 2OBPA 4P9FA 2M7BA 2BEOA 4PSWA 2KJCA 3ERED 1D1CA 3TOBA 4KIFA 1TP4A 1TWGJ 1RRJA 1B4AA 4TV7A 1MBGA 2QSGX 1GHCA 3CCJI 2E1MC 4ESBA 2LK2A 2E1OA 2IA0A 2MG4A 3HZJA 3VSKA 2FMYA 2M87A 3OOUA 1S7AA 3HRTA 4LOCA 1VTNC 5FFZA 2CH0A 4ZDPA 2E34A 2HXIA 4E7HA 1K4SA 2O9LA 3H3ZA 3J81Z 5ILSA 1VQ9I 3MCZA 2H6CA 4G6QA 1AHDP 2QZ8A 1LNWA 3B6CA 4FCYA 2VBZA 5E79C 4QPQA 3H9QA 5H20A 3DV8A 3GTQJ 1IW7F 3SEZA 2OQRA 2X6WA 1L3LA 5K7FA 2CW8A 5HS8A 3PFIA 2PG4A 4IKFA 4IZZA 2P8TA 3H0DA 4UV9A 5LRRA 3DBLB 1X3ZB 2MYSA 1T0FA 2LREA 5CVVA 2B9SA 3E1SA 4WX9A 2F6CA 2KJBA 5FD5A 1V55H 2NS7A 4JYKA 4ZZDA 3RSNA 3N97A 3NWTA 1UJ8A 2EZKA 4XRSG 4CYCA 4IHWA 2GQQA 4PFOA 4R1HA 2E1NA 1FSEA 1MJBA 3I4PA 3PNYA 4CYCB 3ZQGA 1OKRA 3I59A 3GTGJ 1T38A 3HKZA 2VL8A 1G6NA 4HDUA 1ZK8A 2M0CA 1W5CC 1YYVA 2F4OB 2JMWA 2BGCA 2LMDA 2Z3YA 4E7ZA 1IUYA 1WJAA 3BJOA 5TISC 2EZIA 3HSRA 3LQQA 4BXUA 2XV4S 1VQNI 4BXXJ 3M4OJ 3IP4B 4X6AJ 2IT0A 2LYCA 3HKZN 5H2FC 5F04A 3LAPA 4GFBA 1TT5B 3I0TA 3RZDJ 2YU9J 4UB6C 1ZR4A 4N9IA 4LG3A 4N4NB 2ECCA 1XMXA 2BVMA 4FETA 3B02A 3VPRA 3L09A 4QLCU 4LK0F 2HYJA 3O8GA 3RQIA 3DEEA 2FBHA 3RIRA 3TBIA 2XB0X 5J1YA 2FMLA 1OQYA 3BJ6A 1NK3P 4UVCA 5JHUA 1XX5A 2PBIA 2YX4A 1BI2A 4KT6A 4AIJA 4UY8I 3HRMA 1X4OA 4RAFA 2NS8A 2WWYA 1VQ7I 3MFKA 2HU9A 2M4KA 5F27A 2HQRA 1BI0A 1XMAA 2P0WA 3SHFA 4I0BA 1OCOH 2JA6J 5KAFC 5ED4A 3IWZA 2JSPA 4RAYA 5K5QA 1Y8QB 3GFJA 1ZN2A 2P7CB 1Z3YA 2IEKA 5BPIA 4ZYDA 1BM9A 1RR7A 3AG1H 1Z6TA 5E3LA 4A0ZA 4HQEA 2AXLA 3G1LA 3LAJA 4BKXA 3DLAA 4BNCA 4ETSA 2DA7A 2KRFA 1W7PA 2VLAA 4CCKA 2Z2SB 1YE9A 3FXLA 1MMGA 1W7PB 1KQ9A 3V8LA 2R3SA 1UZCA 2DMQA 1FX7A 1S7EA 4BAYA 1AU7A 3CUQA 1BIAA 4XRFA 1U6GA 1W36C 2LKXA 1TQPA 2HNHA 3ASNH 2EFWA 3S16J 3CUQB 2E7XA 3BG9A 1FYKA 3FK6A 4HBLA 3DPLC 3QAHA 1K4TA 2GM4A 2KHMA 1S8NA 2WY7Q 3BG5A 4AU7A 4XRMA 5FLVA 2ESHA 2AQFA 5FFXA 3OL4A 3L2VA 2E1CA 3FXOA 2XF6A 4ZDOA 4B3XA 2CMPA 1LJ9A 2O0YA 4RB2C 2VXZA 4U0WA 3PO2J 1BI1A 2BY1A 2A69F 3K9TA 1MW7A 4QWQA 3CESA 2BBYA 2I10A 3J7ZI 1OYYA 1V4RA 1IXCA 4HEA2 5A2QK 4KA4A 1MNMC 1GVJA 4M3FA 1X3UA 2V6CA 5DEQA 2F4IA 4RB1A 3DKWA 1RKTA 5C44J 4PJJA 1Z7UA 1I6HJ 2GAUA 1WRJA 1O7FA 5DCFA 3WTTC 2XGDA 3CDLA 3OYJA 2X6YA 3TDZC 2NOGA 1SAUA 2K9QA 2XSJC 1Y6IA 5J1UA 3M8EA 4NUBA 3ZGKA 1SD7A 3WTXC 2HKXA 2ACJA 2RREA 4IVNA 4MFDA 1ZLKA 2ZJPF 1HDDC 2OV7A 1HSTA 1N78A 4M74A 3IKVA 3GVAA 2HTSA 1S7OA 1YW9A 2VKHA 3BQYA 4MTDA 3JW4A 1ZKGA 2EFPA 2CUJA 3CDHA 5E20A 1JXSA 5D4SA 2XROA 3HRUA 3MKWB 3JCUC 2K9LA 3WODF 1F36A 3FMQA 5M5XJ 1Z9CA 3JRGA 2IAIA 3LNQA 5F6FA 4EM1A 4G12A 2KRHA 2FE3A 5AIPA 2HTJA 5ICGA 2EWNA 1BW5A 1ZELA 3RKXA 2BY2A 2MSYA 3ABUA 3QU3A 3EUHA 5JHFA 1ON2A 3QPLA 2QQBA 1TT0A 2P81A 1VNDA 4F93B 3FISA 3OWTA 5CJ9A 4M9ZA 1G3TA 2L0KA 1POGA 1Y8RB 4L0ZB 2OD5A 1JTXA 1XD7A 3R0JA 1LFPA 1UCRA 1ZHFA 2ZXHA 2A07F 4KFCA 3HB9A 2XVCA 3QP5A 1U8BA 3ULQB 3F0CA 1YQAA 3GCMA 1IZ1A 2HZDA 2STWA 1JUSA 4C2MJ 1JT0A 5C3EJ 1O4XA 3GO5A 1Z05A 1MSEC 4P55A 3QQAA 1S3JA 2MLGA 3J80K 1PP8F 4E6KG 3S3NA 2R0QC 3KP3A 4B1RA 3IH2A 5EEHA 2PEXA 5EEGA 2E19A 4O6JA 2BY0A 2VQLA 3KZIC 3NRVA 4D5CA 4BQAA 3A0BC 3HC7A 4ON0A 3GTJJ 1Y1WJ 1P6RA 4MFEA 3HGYA 3FHZA 3KETA 2HQ5A 1MBHA 1QHHD 4KMUX 1E3PA 1NHAA 3H35A 3ESWB 1UHWA 1J5YA 4RGUA 3S15J 5DV5A 1I50J 2F5CA 4G7HF 1UG2A 3OS1A 2B63J 3BR2A 1B9MA 3HPGA 4A0XA 1QZEA 1BN5A 2CW7A 2EA2A 1LVAA 2F5VA 2R7VA 2PQ8A 2XB5A 1MBEA 1DU0A 1IRGA 1ZG5A 4A3IJ 1WKMA 1FEXA 3HJEA 3ZN1A 1K6OA 5E1ZB 3DWLE 3PUFA 2PX9A 3VOEA 1MIJA 4A3FJ 5HOOA 2IW5A 3R60A 2FBIA 1HCRA 1ETWA 4GO1A 5F08A 4JK1X 1IV8A 4AIDA 2DMPA 4C30A 1D1BA 3OSFA 2LTPA 2YPRA 3HEFA 3JTGA 3A2KA 2DCEA 3MAJA 3DTEA 1ZGWA 3L9FA 2YX7A 4KICA 1KZHA 2HI3A 2ZKZA 1PUFA 3JAMZ 2LY1A 3BQZA 4PCQA 4LFUA 4EJTA 1PUFB 3J7AY 4RBOA 3UR3C 2IXSA 4XLEA 4BBSJ 2ZSIB 5IYCJ 5KNLA 2CQNA 2ZXIA 5HVQC 5EGOA 2PJRA 3AG3H 1QPMA 3CLOA 5IT3A 4HF1A 2M0MA 5EGOB 2PJRB 3QODA 3MKLA 1ZGJA 3IAM2 5HLGA 5JR3A 2VXDA 3DBRB 3I3LA 1SD5A 2RV8A 1REPC 3DP7A 5ICEA 3IL2A 1W1WE 2DLLA 2VC0A 1EA3A 1R1UA 4I01A 3MZYA 2ETHA 4XLFA 5B66C 1QGPA 3BCAA 4W1UA 3KX2A 2KISA 2X51A 2RNJA 5D4RA 4CUGA 3V7CA 1WPKA 3SEQA 3Q3SA 4DQ2A 2F5DA 1LPQA 2QQAA 2NVQJ 3CCLI 4M3GA 2ADUA 4G9YA 4XLPF 1VQMI 4DZJA 5C4JJ 2UV1A 5IOYA 1I6XA 3OYEA 2XIGA 4L9VA 1ONVA 3KZYA 3OY9A 3BT9A 2VODA 2PI0A 3D1NI 2OTLI 4HNVA 2FF4A 3C3WA 1WH7A 4BGDA 2G7HA 5IY5H 1X1BA 3BZKA 4BS9A 2IGOA 4X0GA 1ZQ3P 5BS6A 4AVZA 4DYQA 1OCRH 1XTAA 2KIUA 4L9TA 3W2AA 2HDDA 1OCTC 1TBXA 2GA2A 2VASA 2YUSA 5LHGA 3PIOF 2BOLA 2NVYJ 3D0SA 2B0LA 3CZ6A 1I39A 3L00A 2JRMA 4FX0A 3E97A 3HHHA 1YS7A 2FSWA 3A03A 3RTRA 4RM3A 1HW1A 3ABLH 1WJCA 4B4CA 2CGPA 3CC2I 2Z16A 3Q0VA 3JRHA 3MKYB 4P1WA 4CCMA 4HW0A 1XGMA 4AUXA 2DPUA 2EPFA 1E17A 1HW5A 2VKVA 3WTSC 5H6QA 3K70C 2FD5A 3DTKA 1K79A 3F8FA 4XMYA 4BY1J 1ETQA 1B72A 5LHIA 3CCSI 1B72B 2XASA 1J09A 2QEXI 2OTJI 3LL7A 1BOAA 1QQIA 2DFFA 3WE3A 4H0EA 4M72A 3CC7I 1IRXA 2LFBA 3I5UA 3CUQC 5DM6F 2COBA 2FBKA 4RB0A 4NHJA 2IBDA 3BZCA 3PNTA 5LHHA 4HA8A 3AL0B 3KEYA 4XIDA 1JKPC 2JA7J 3DU6A 4HLYA 4E7JA 1BBYA 3TEDA 3E0JB 3HGGA 2FOWA 2UXNA 2KT0A 3S1MJ 1R4NB 5FLXZ 2P6SA 4A12A 4OMYA 1GUUA 5K7HA 3S2WA 2KFDA 4I02A 4RAGA 1BI3A 3H5RA 4Q48A 3QRFF 3IC7A 1OCCH 3DQVC 1FP2A 3GFIA 5E8GA 1Z21A 3CMMA 2IVMA 3ABTA 2W7NA 1Z0XA 2X6XA 3HOVJ 1MBJA 1BOBA 1K83J 1UHMA 4JBAA 1D0XA 4U7BA 1TQMA 3RI4A 5ILVA 2QBYA 1KU9A 2LNBA 2WBMA 4C3HJ 4IHSA 4RGXA 3SDGA 1OISA 3QPTA 2V1NA 2ZJQF 4RMNA 2QBYB 1MSFC 1FT9A 1MNDA 2VJJA 1RR8C 3DBHB 3GTPJ 3PIPF 4LLNA 1WH5A 2JZYA 3R0AA 4A6DA 5ICCA 2MW8A 3E5XA 1N75A 1RETA 3GTOJ 1LKXA 2K7LA 4HSTA 1QO0D 3L1PA 2QSFX 2L01A 2BV6A 3KE2A 2JSCA 2QLZA 1IDZA 3H1CA 4XICA 1D8JA 2DBBA 2ZO4A 5LBQA 3NQOA 4BJ6C 1H8AC 5IP6A 4IPAA 4R79A 5IPAA 1YX5A 2ISYA 3H92A 5GTHC 5CVRA 2M30A 4JX5A 1SAXA 3WTZA 4UVBA 4JQFA 1KONA 1FPQA 2BXYA 3FWEA 3ZQFA 3TL4X 1QVUA 2R7ZJ 5TRDA 4ZDLA 3S14J 2EILH 2L9SA 3EUHC 2DQRA 4IO9F 4B48A 2CQXA 4OAZA 3CD6I 3GX4X 4RDUA 2JPCA 3CDIA 1SANA 5CVUA 5FLXK 3ML6A 3GW2A 2VN2A 1R49A 4DOZA 5M3MJ 3D5LA 2GXGA 3RJPA 3B73A 2RNGA 5LEJA 4WCGA 3AAFA 4PJ0C 3ZQIA 4A3KJ 3TGNA 4ESJA 4ENKA 3DF8A 2CO5A 3IUOA 2K27A 2CV2A 1E3OC 4NC7A 2A3SA 1T39A 3ONQA 2MH9A 1TZLA 4YIFA 2O6GE 3OYDA 1LUJB 1W5TA 4HSRA 4B09A 4GXOA 2CS3A 2X85A 4F7ZA 4II3A 2DMNA 1P92A 2VONA 2JN6A 1T56A 2HWVA 1YS6A 1FMVA 2VJIA 4ZYGA 2ZJ2A 4A3DJ 1R22A 3L2UA 1S6LA 2A6EF 1HQCA 1IRFA 1RIOH 2DODA 1G3YA 2GOXB 2AS5F 4PJMA 3C2HA 3V42A 1OR7C 1JGSA 3OS2A 3ZQCA 3ZMVA 3FM5A 3HYIA 1XC5A 4HDVA 1QHGA 3PQJA 2L9RA 3JRBA 4ENNA 1OFCX 2OUMA 3H36A 4ZTFA 1FZPB 2W1OA 3C2GA 3KP4A 3EPZA 4I76A 4XN3A 2NVUB 4YFXF 1UB9A 3JSPA 5KK1A 2PJPA 4E7SA 3EQLF 1X3WB 3OYCA 4UXNA 3MZHA 2COMA 1MNEA 4E4HA 3FHNA 3BG6A 5H6RA 2R93J 1T6SA 3J7YJ 3VSLA 4LGWA 4FE4A 2IGNA 4JX6A 4DBRA 3OMYA 1FOKA 4ENMA 4XOTA 2CU7A 4MO7A 2DFHA 4GRIA 2Y9ZA 1WGXA 2M2EA 4D9JA 1F9NA 2V1XA 4A6EA 2WAEA 5DD4A 5L3DA 2HOAA 2XGEA 1SC7A 5K7ZA 3CP8A 1VQ4I 2W48A 4EJOA 3VEPA 4FX4A 2EIJH 1MKMA 2VI6A 4HG2A 4M6XA 1Z91A 2OC6A 1ZRCA 4I7HA 1XGOA 4NC6A 5M5YJ 2L4MA 1S72I 1R6RA 3ZRGA 5IT9Z 4QSHA 3OV8A 3U9GA 3GF2A 3HOUJ 3F8CA 3MQ0A 4Y17A 5E17F 2K3PA 2JVGA 4IXAA 4F91B 5FGMA 5KCMA 2XC7A 1ZREA 1TNSA 3KLOA 2G9WA 2CYYA 3I54A 1AWCA 1TWAJ 2ELKA 4X1EA 5L3GA 3EDPA 1OYIA 3CP2A 3HDDA 5FJ8J 1BJZA 3QYEA 3S1RJ 3N4MA 2NNNA 3HOSA 3EYIA 4M9SA 5FKMA 2PMHA 3H9GA 3VFZA 4L18B 4RM2A 1BC8C 3I59B 3VYRB 4OWRB 3M3YJ 1DPRA 2EV6A 4A3BJ 3ZQLA 4IOAF 1X2MA 2QKLB 2JA5J 4WF2A 3ZQ7A 1WSUA 2A68F 2ELJA 4PZJA 4KN7X 5J40A 2JRTA 1ODDA 2IRFG 1RNLA 2PN6A 1S5LC 3NARA 5DTDA 3GTKJ 2ME0A 2X1DA 4NBQA 1MJ9A 4B44A 4XLNF 2L02A 1AOYA 2Z9OA 2L5QA 3J81K 4C2UA 1TW3A 3E5UA 3QOEA 4G6TB 3JSOA 3E7LA 1SVMA 5F1RA 4BDZA 5FRNA 2GIVA 4LG0A 4J00A 1I1SA 2R7OA 3CCVI 3JRAA 4LG0B 2W24A 1G3WA 4HRIA 3OYMA 5EDNA 2KDOA 1D5VA 1JHHA 5IT9K 3WHBA 1VI0A 3I55I 1JI8A 1ZRFA 2VQHA 3ECHA 3SQNA 1A36A 2DA4A 4PFPA 1KU7A 4GDFA 2Y0SA 1STZA 3WU0A 4KYWA 3GTLJ 4RLQA 2VQCA 5EF6A 2OCCH 1FOYA 4M9XA 3S17J 5HS7A 2DTRA 1ZGAA 2UXXA 1ACIA 3BPXA 1UMQA 3KP5A 2RAEA 4OIOF 2E5ZA 1TWFJ 3I64A 1VQ6I 1ETXA 2FX0A 2X1EA 1O3TA 3LSKA 2Y0SN 1RI7A 3K1NA 4ZZLA 3NEUA 5DYMA 2V9KA 1ZTRA 5K5RA 2RQQA 1JT6A 3F22A 2GZWA 4Q5SF 3ZQQA 4LIUA 2STTA 3I56I 3AL0C 1J75A 5J47A 2AO9A 3K4LA 1NH3A 3TW6A 1R1VA 2Y0MA 2Y69H 4BYYA 2RDPA 3LSPA 5BMZA 2HOTA 2EIMH
chains in the Genus database with same CATH topology
1TWHJ 3BR1A 3HBLA 2XB5A 1MBEA 1DU0A 3BR0A 1AKHA 2E2JJ 2VPRA 4A3IJ 1FEXA 1U9OA 1U78A 2EZHA 1IJWC 4QIWN 1AKHB 3IV5A 1D5YA 2O8KA 4A3FJ 1JUMA 1RESA 5FKNA 1HCRA 2H1KA 1ETWA 5F08A 1RKWA 2DMPA 3OSFA 2LTPA 3HEFA 2M34A 2XPUA 1SFOJ 4S0HB 2JWTA 2Y30A 1QRYA 1ZGWA 1U9NA 2GBYA 3JREA 1JUPA 2HI3A 4BY7J 2DJNA 1PUFA 3BQZA 2EQRA 3BTCA 3OIOA 4M3BA 4I6ZA 1W0UA 1YRNA 1PUFB 1F43A 3BTJA 1HDPA 3HM5A 3TW7A 3LOCA 4RBOA 1W0TA 5C4XJ 1YRNB 4BBSJ 1FTTA 2DMUA 5DS9A 1WCMJ 5IYCJ 2FQ4A 4AYBN 3JR9A 5EGOA 2CRGA 5E3OA 2YS9A 1ETKA 5EGOB 3MKLA 3NAUA 1P7IA 4W97A 2R5ZA 3BG3A 2R5ZB 4W1UA 3TP3A 3BTIA 1VF9A 2JA8J 1WPKA 2QF7A 3Q3SA 1R9TJ 2M8GX 3OSGA 2NVQJ 5FKOA 4M3GA 3GTMJ 4DZJA 3IH3A 3RZOJ 5C4JJ 5IOYA 4FISA 1H89C 1GV5A 3JRFA 1CQTA 1K61A 3BT9A 1Q1VA 3QPSA 4A3JJ 2X48A 4XK4A 1ETOA 4M3EA 3D1NI 3DCFA 1FJLA 4HNVA 3S1QJ 1MBFA 1WH7A 1I3QJ 3G1OA 3DEWA 4MLOA 1H88C 1GDTA 3JRIA 1HLVA 1ZQ3P 4DYQA 2AHQA 2HDDA 1OCTC 2YUSA 2LR8A 4QTRA 3JRDA 1Y1VJ 3H3VK 2NVYJ 2CUEA 5M5WJ 4FE7A 5IYBJ 1NTCA 2OF7A 3ZQHA 1GT0C 2ZB9A 4DW6A 3BR6A 2X9DA 5FKLA 3A03A 5IP9J 5IOZA 4B4CA 3BR5A 3TP0A 1HF0A 3Q0VA 3JRHA 1OJLA 2OPTA 5EZHA 4AUXA 3FKIJ 3HOWJ 1GVDA 3FK7A 5IYDJ 2O7OA 5GPAA 3HOZJ 2DN0A 2VKVA 5F0FA 2FD5A 4ABZA 4BY1J 1ETQA 1B72A 1B72B 2DA1A 4A3LJ 5M3FJ 2LFBA 2CJJA 2KDZA 2COBA 4XRSA 2IBDA 1TWGJ 2LD5A 1LFUP 1MBGA 2XRLA 2Y2ZA 2HXOA 4A3EJ 2LK2A 2E1OA 5HODA 4XIDA 1JKPC 2JA7J 2MG4A 1MH4A 5F0CA 3TEDA 1VFCA 3OOUA 3HGGA 2DMTA 4LOCA 2KT0A 4D7NA 3S1MJ 2HXIA 1JGGA 2O9LA 2L7FP 1GUUA 5K7HA 1BA5A 1ZR2A 5EZGA 4M6VA 1AHDP 3B6CA 4FCYA 3S1NJ 2XPWA 1LFBA 4IHYA 3GTQJ 2GLOA 3WHCA 4JP0A 1Z0XA 3Q0WA 1MBJA 5K7FA 1K83J 3HOVJ 2CUFA 4C3HJ 3SDGA 4DYCA 1ETYA 1MSFC 2QCOA 5E3MA 2NVXJ 3LSRA 1HOMA 1GV2A 3GTPJ 1JKQC 2XPVA 2HOSA 1WH5A 1IG7A 2MW8A 4JYKA 2NS7A 4A3MJ 1RETA 2VKEA 1FTZA 3GTOJ 1IRZA 1IDYA 3W6VA 2EZKA 4XRSG 2JK3A 4CYCA 3L1PA 2ME6A 4IHWA 3LSGA 1IDZA 4XICA 4CYCB 3ZQGA 1NK2P 1H8AC 3GTGJ 5IP6A 1ZK8A 2M0CA 2JMWA 3H0GJ 5IPAA 5JLWA 5E3NA 2LY9A 3GBGA 1FIAA 2EZIA 2X6OA 2ECBA 2K9NA 1JKRC 2EBIA 4JX5A 4BXXJ 3M4OJ 4V2FA 4X6AJ 3HKZN 3ZQFA 5GPCA 2N8GA 1QVUA 5F04A 2R7ZJ 4GFBA 3PO3J 3S14J 3RZDJ 2YU9J 1BW6A 2JJ7A 1LE8A 1ZR4A 4UUTA 5EEAA 1Z77A 2DA6A 3S2HJ 2ECCA 2K9SA 2CQXA 1LE8B 4RDUA 2NVTJ 3VPRA 4D5FA 1SANA 4UUSA 2PMZN 4C3JJ 2HYJA 2TRTA 3O8GA 3RQIA 5M3MJ 4UUSB 2WAQN 2XB0X 5J1YA 1NK3P 3ZQIA 4A3KJ 2VUMJ 1BL0A 1ENHA 4A3GJ 1JKOC 1E3OC 3MN2A 2NS8A 4JX4A 4DYRA 2G0EA 5F27A 2DMNA 2D5VA 2JN6A 2JA6J 1T56A 1ITYA 3HOYJ 1FIPA 2L7MP 1ETVA 3LSJA 4A69C 4A3DJ 3CMYA 4IHXA 2IEKA 1RR7A 2ID6A 5J3LA 4IHVA 5E3LA 3G1LA 3PM1A 4BKXA 3FIWA 1JTYA 2CQQA 2DA7A 3HOXJ 3ZQCA 1XC5A 1A5JA 2LP0A 2L9RA 3JRBA 1OFCX 2DMQA 2E2IJ 1S7EA 4I76A 3SFIA 1AU7A 2Y31A 3BR3A 2LKXA 3S16J 2DA3A 3BG9A 1IV6A 3FK6A 2R93J 2H8RA 3B6AA 2GM4A 3BG5A 4XRMA 5FLVA 4FE4A 4NDLA 4JX6A 2DTZA 2ID3A 1XS9A 2CU7A 4MO7A 2XSDC 9ANTA 2Y9ZA 3K2AA 1WGXA 2M2EA 3PO2J 3CCYA 5FLMJ 1B8IA 2HOAA 2XGEA 5FKKA 5K7ZA 1T33A 2LLKA 1JJ6C 5F0HA 2W48A 1B8IB 1RPWA 2I10A 4V2GA 1UHSA 2VI6A 1MNMC 5M5YJ 5GP9A 4M3FA 4QSHA 1QPIA 1RKTA 3HOUJ 5C44J 1I6HJ 3C2BA 2XGDA 3CDLA 1QVTA 2R92J 1A6IA 3S2DJ 2NOGA 2K9QA 5J1UA 3A01A 1TWAJ 2WV1A 2ELKA 4X1EA 3K7AJ 4MFDA 3A01B 4BBRJ 3HDDA 1HDDC 5FJ8J 1BJZA 3MVPA 3S1RJ 4A93J 5EYRA 3I4MJ 5FKMA 3G1MA 3BQYA 1ZKGA 1XG1A 4L5EA 2K40A 3M3YJ 4A3BJ 4MIMA 3ZQLA 1X2MA 2EH3A 1F36A 5M5XJ 3JRGA 4D7MA 2IAIA 3LNQA 2JA5J 4G12A 2DA2A 2LVSA 3GTKJ 3I4NJ 3NARA 5DTDA 1BW5A 2ME0A 2R5YA 3BTLA 2MSYA 4FTHA 1ORKA 3A02A 2R5YB 3QPLA 4B3AA 1MBKA 2P81A 1VNDA 3FISA 3Q0UA 1IGNA 3ZOBA 2TCTA 2L0KA 1POGA 2L7ZA 4Y52J 1JTXA 3E7LA 2XGCA 5JLXA 3HB9A 5IP7J 3JRAA 2Y9YA 1U8BA 3F0CA 5EDNA 1APLC 1WI3A 4M3DA 5BNGA 3SJMA 1JUSA 1G2HA 3WHBA 4C2MJ 1VI0A 1OCPA 1JJ8C 2DA4A 4AC0A 1JT0A 5C3EJ 3RKQA 3CQZJ 1O4XA 1MSEC 2EZLA 3QQAA 2E2HJ 3GTLJ 4IEJA 2R0QC 3UKGA 4B1RA 5EF6A 2FJ1A 3JRCA 3IH2A 2DA5A 1EF4A 3IH4A 1IUFA 2E19A 1TWCJ 1IC8A 1TC3C 3S17J 2MGQA 1UMQA 4D5CA 5J1RA 2RAEA 4Y7NJ 2M9HA 4A3CJ 1TWFJ 3GTJJ 1P7JA 1Y1WJ 1ETXA 2FX0A 2WB1N 4MFEA 3HGYA 2Y0SN 1DU6A 1ZTRA 4DZPA 1JT6A 2HQ5A 1MBHA 1X58A 4C3IJ 4J19A 5EG0A 2AO9A 1X2NA 4EEFG 3S15J 3TW6A 1I50J 5EG0B 1UG2A 2B63J 3LSPA 2HOTA 3BR2A 5F1JA 1MH3A 3O8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH J;  3BR1 A;  3HBL A;  2XB5 A;  1MBE A;  1DU0 A;  3BR0 A;  1AKH A;  2E2J J;  2VPR A;  4A3I J;  1FEX A;  1U9O A;  1U78 A;  2EZH A;  1IJW C;  4QIW N;  1AKH B;  3IV5 A;  1D5Y A;  2O8K A;  4A3F J;  1JUM A;  1RES A;  5FKN A;  1HCR A;  2H1K A;  1ETW A;  5F08 A;  1RKW A;  2DMP A;  3OSF A;  2LTP A;  3HEF A;  2M34 A;  2XPU A;  1SFO J;  4S0H B;  2JWT A;  2Y30 A;  1QRY A;  1ZGW A;  1U9N A;  2GBY A;  3JRE A;  1JUP A;  2HI3 A;  4BY7 J;  2DJN A;  1PUF A;  3BQZ A;  2EQR A;  3BTC A;  3OIO A;  4M3B A;  4I6Z A;  1W0U A;  1YRN A;  1PUF B;  1F43 A;  3BTJ A;  1HDP A;  3HM5 A;  3TW7 A;  3LOC A;  4RBO A;  1W0T A;  5C4X J;  1YRN B;  4BBS J;  1FTT A;  2DMU A;  5DS9 A;  1WCM J;  5IYC J;  2FQ4 A;  4AYB N;  3JR9 A;  5EGO A;  2CRG A;  5E3O A;  2YS9 A;  1ETK A;  5EGO B;  3MKL A;  3NAU A;  1P7I A;  4W97 A;  2R5Z A;  3BG3 A;  2R5Z B;  4W1U A;  3TP3 A;  3BTI A;  1VF9 A;  2JA8 J;  1WPK A;  2QF7 A;  3Q3S A;  1R9T J;  2M8G X;  3OSG A;  2NVQ J;  5FKO A;  4M3G A;  3GTM J;  4DZJ A;  3IH3 A;  3RZO J;  5C4J J;  5IOY A;  4FIS A;  1H89 C;  1GV5 A;  3JRF A;  1CQT A;  1K61 A;  3BT9 A;  1Q1V A;  3QPS A;  4A3J J;  2X48 A;  4XK4 A;  1ETO A;  4M3E A;  3D1N I;  3DCF A;  1FJL A;  4HNV A;  3S1Q J;  1MBF A;  1WH7 A;  1I3Q J;  3G1O A;  3DEW A;  4MLO A;  1H88 C;  1GDT A;  3JRI A;  1HLV A;  1ZQ3 P;  4DYQ A;  2AHQ A;  2HDD A;  1OCT C;  2YUS A;  2LR8 A;  4QTR A;  3JRD A;  1Y1V J;  3H3V K;  2NVY J;  2CUE A;  5M5W J;  4FE7 A;  5IYB J;  1NTC A;  2OF7 A;  3ZQH A;  1GT0 C;  2ZB9 A;  4DW6 A;  3BR6 A;  2X9D A;  5FKL A;  3A03 A;  5IP9 J;  5IOZ A;  4B4C A;  3BR5 A;  3TP0 A;  1HF0 A;  3Q0V A;  3JRH A;  1OJL A;  2OPT A;  5EZH A;  4AUX A;  3FKI J;  3HOW J;  1GVD A;  3FK7 A;  5IYD J;  2O7O A;  5GPA A;  3HOZ J;  2DN0 A;  2VKV A;  5F0F A;  2FD5 A;  4ABZ A;  4BY1 J;  1ETQ A;  1B72 A;  1B72 B;  2DA1 A;  4A3L J;  5M3F J;  2LFB A;  2CJJ A;  2KDZ A;  2COB A;  4XRS A;  2IBD A;  1TWG J;  2LD5 A;  1LFU P;  1MBG A;  2XRL A;  2Y2Z A;  2HXO A;  4A3E J;  2LK2 A;  2E1O A;  5HOD A;  4XID A;  1JKP C;  2JA7 J;  2MG4 A;  1MH4 A;  5F0C A;  3TED A;  1VFC A;  3OOU A;  3HGG A;  2DMT A;  4LOC A;  2KT0 A;  4D7N A;  3S1M J;  2HXI A;  1JGG A;  2O9L A;  2L7F P;  1GUU A;  5K7H A;  1BA5 A;  1ZR2 A;  5EZG A;  4M6V A;  1AHD P;  3B6C A;  4FCY A;  3S1N J;  2XPW A;  1LFB A;  4IHY A;  3GTQ J;  2GLO A;  3WHC A;  4JP0 A;  1Z0X A;  3Q0W A;  1MBJ A;  5K7F A;  1K83 J;  3HOV J;  2CUF A;  4C3H J;  3SDG A;  4DYC A;  1ETY A;  1MSF C;  2QCO A;  5E3M A;  2NVX J;  3LSR A;  1HOM A;  1GV2 A;  3GTP J;  1JKQ C;  2XPV A;  2HOS A;  1WH5 A;  1IG7 A;  2MW8 A;  4JYK A;  2NS7 A;  4A3M J;  1RET A;  2VKE A;  1FTZ A;  3GTO J;  1IRZ A;  1IDY A;  3W6V A;  2EZK A;  4XRS G;  2JK3 A;  4CYC A;  3L1P A;  2ME6 A;  4IHW A;  3LSG A;  1IDZ A;  4XIC A;  4CYC B;  3ZQG A;  1NK2 P;  1H8A C;  3GTG J;  5IP6 A;  1ZK8 A;  2M0C A;  2JMW A;  3H0G J;  5IPA A;  5JLW A;  5E3N A;  2LY9 A;  3GBG A;  1FIA A;  2EZI A;  2X6O A;  2ECB A;  2K9N A;  1JKR C;  2EBI A;  4JX5 A;  4BXX J;  3M4O J;  4V2F A;  4X6A J;  3HKZ N;  3ZQF A;  5GPC A;  2N8G A;  1QVU A;  5F04 A;  2R7Z J;  4GFB A;  3PO3 J;  3S14 J;  3RZD J;  2YU9 J;  1BW6 A;  2JJ7 A;  1LE8 A;  1ZR4 A;  4UUT A;  5EEA A;  1Z77 A;  2DA6 A;  3S2H J;  2ECC A;  2K9S A;  2CQX A;  1LE8 B;  4RDU A;  2NVT J;  3VPR A;  4D5F A;  1SAN A;  4UUS A;  2PMZ N;  4C3J J;  2HYJ A;  2TRT A;  3O8G A;  3RQI A;  5M3M J;  4UUS B;  2WAQ N;  2XB0 X;  5J1Y A;  1NK3 P;  3ZQI A;  4A3K J;  2VUM J;  1BL0 A;  1ENH A;  4A3G J;  1JKO C;  1E3O C;  3MN2 A;  2NS8 A;  4JX4 A;  4DYR A;  2G0E A;  5F27 A;  2DMN A;  2D5V A;  2JN6 A;  2JA6 J;  1T56 A;  1ITY A;  3HOY J;  1FIP A;  2L7M P;  1ETV A;  3LSJ A;  4A69 C;  4A3D J;  3CMY A;  4IHX A;  2IEK A;  1RR7 A;  2ID6 A;  5J3L A;  4IHV A;  5E3L A;  3G1L A;  3PM1 A;  4BKX A;  3FIW A;  1JTY A;  2CQQ A;  2DA7 A;  3HOX J;  3ZQC A;  1XC5 A;  1A5J A;  2LP0 A;  2L9R A;  3JRB A;  1OFC X;  2DMQ A;  2E2I J;  1S7E A;  4I76 A;  3SFI A;  1AU7 A;  2Y31 A;  3BR3 A;  2LKX A;  3S16 J;  2DA3 A;  3BG9 A;  1IV6 A;  3FK6 A;  2R93 J;  2H8R A;  3B6A A;  2GM4 A;  3BG5 A;  4XRM A;  5FLV A;  4FE4 A;  4NDL A;  4JX6 A;  2DTZ A;  2ID3 A;  1XS9 A;  2CU7 A;  4MO7 A;  2XSD C;  9ANT A;  2Y9Z A;  3K2A A;  1WGX A;  2M2E A;  3PO2 J;  3CCY A;  5FLM J;  1B8I A;  2HOA A;  2XGE A;  5FKK A;  5K7Z A;  1T33 A;  2LLK A;  1JJ6 C;  5F0H A;  2W48 A;  1B8I B;  1RPW A;  2I10 A;  4V2G A;  1UHS A;  2VI6 A;  1MNM C;  5M5Y J;  5GP9 A;  4M3F A;  4QSH A;  1QPI A;  1RKT A;  3HOU J;  5C44 J;  1I6H J;  3C2B A;  2XGD A;  3CDL A;  1QVT A;  2R92 J;  1A6I A;  3S2D J;  2NOG A;  2K9Q A;  5J1U A;  3A01 A;  1TWA J;  2WV1 A;  2ELK A;  4X1E A;  3K7A J;  4MFD A;  3A01 B;  4BBR J;  3HDD A;  1HDD C;  5FJ8 J;  1BJZ A;  3MVP A;  3S1R J;  4A93 J;  5EYR A;  3I4M J;  5FKM A;  3G1M A;  3BQY A;  1ZKG A;  1XG1 A;  4L5E A;  2K40 A;  3M3Y J;  4A3B J;  4MIM A;  3ZQL A;  1X2M A;  2EH3 A;  1F36 A;  5M5X J;  3JRG A;  4D7M A;  2IAI A;  3LNQ A;  2JA5 J;  4G12 A;  2DA2 A;  2LVS A;  3GTK J;  3I4N J;  3NAR A;  5DTD A;  1BW5 A;  2ME0 A;  2R5Y A;  3BTL A;  2MSY A;  4FTH A;  1ORK A;  3A02 A;  2R5Y B;  3QPL A;  4B3A A;  1MBK A;  2P81 A;  1VND A;  3FIS A;  3Q0U A;  1IGN A;  3ZOB A;  2TCT A;  2L0K A;  1POG A;  2L7Z A;  4Y52 J;  1JTX A;  3E7L A;  2XGC A;  5JLX A;  3HB9 A;  5IP7 J;  3JRA A;  2Y9Y A;  1U8B A;  3F0C A;  5EDN A;  1APL C;  1WI3 A;  4M3D A;  5BNG A;  3SJM A;  1JUS A;  1G2H A;  3WHB A;  4C2M J;  1VI0 A;  1OCP A;  1JJ8 C;  2DA4 A;  4AC0 A;  1JT0 A;  5C3E J;  3RKQ A;  3CQZ J;  1O4X A;  1MSE C;  2EZL A;  3QQA A;  2E2H J;  3GTL J;  4IEJ A;  2R0Q C;  3UKG A;  4B1R A;  5EF6 A;  2FJ1 A;  3JRC A;  3IH2 A;  2DA5 A;  1EF4 A;  3IH4 A;  1IUF A;  2E19 A;  1TWC J;  1IC8 A;  1TC3 C;  3S17 J;  2MGQ A;  1UMQ A;  4D5C A;  5J1R A;  2RAE A;  4Y7N J;  2M9H A;  4A3C J;  1TWF J;  3GTJ J;  1P7J A;  1Y1W J;  1ETX A;  2FX0 A;  2WB1 N;  4MFE A;  3HGY A;  2Y0S N;  1DU6 A;  1ZTR A;  4DZP A;  1JT6 A;  2HQ5 A;  1MBH A;  1X58 A;  4C3I J;  4J19 A;  5EG0 A;  2AO9 A;  1X2N A;  4EEF G;  3S15 J;  3TW6 A;  1I50 J;  5EG0 B;  1UG2 A;  2B63 J;  3LSP A;  2HOT A;  3BR2 A;  5F1J A;  1MH3 A;  3O8H A; 
#chains in the Genus database with same CATH topology
 2H09 A;  3N05 A;  1YO5 C;  1KGS A;  3KZZ A;  4XKC A;  1S9H A;  3BR0 A;  3CJN A;  1VQ8 I;  1D0Y A;  1U78 A;  3ELK A;  3IV5 A;  1D5Y A;  3DPU A;  4IF4 A;  2O8K A;  1JUM A;  5L3C A;  3A0H C;  4KNY A;  1LDD A;  3ABM H;  3OYI A;  3GZ6 A;  1O3Q A;  1MMN A;  4ENJ A;  2QKM B;  1MZB A;  3T0Y A;  2DK8 A;  2M34 A;  3T8T A;  2EJR A;  4S0H B;  3X2Q H;  2Y30 A;  2I5U A;  5D8K B;  2JVH A;  2NNY A;  4U0V A;  2UUZ A;  2GBY A;  5FRM A;  1YIT I;  1JUP A;  2HYF A;  1QNT A;  3DFG A;  3L2W A;  1H9G A;  2DJN A;  3FDY A;  4RGS A;  3FM3 A;  1FY7 A;  4M3B A;  3OIO A;  2A6H F;  3CF5 F;  5D6E A;  1W0T A;  1HDP A;  3HM5 A;  1RUO A;  4N9H A;  2VT2 A;  5C4X J;  1FTT A;  2DMU A;  5DS9 A;  5HNH A;  1T08 B;  1WCM J;  2FQ4 A;  1K78 A;  2KKO A;  2KIQ A;  3E6B A;  5J8C A;  3K4M A;  3TO7 A;  1HKT A;  5E3O A;  4BE0 A;  1K78 B;  1ETK A;  4RGR A;  3NAU A;  4IRH A;  4ZYE A;  1P7I A;  5D6F A;  4PK4 A;  4FHT A;  1IXR C;  2A6T A;  2HZT A;  2DJI A;  5JI6 A;  3G73 A;  3UNG C;  5GAH J;  3KEO A;  2F5F A;  3BWG A;  5BOX A;  3SZP A;  4ZJZ A;  2Y48 A;  1XMK A;  1KU3 A;  2FNP A;  3GLL A;  4XSZ F;  1A04 A;  3T5X A;  3K70 D;  2QF7 A;  1R9T J;  4IRG A;  4LB5 A;  2KQR A;  2M8G X;  3OSG A;  5B5E C;  2Z99 A;  1Q1H A;  2I8D A;  3HHG A;  2IS4 A;  1H9T A;  5TJJ A;  3LST A;  1H89 C;  4EQQ A;  3ZMS A;  1GV5 A;  5HS9 A;  1CQT A;  3CC4 I;  2K86 A;  3CTA A;  3DPT A;  2DDB A;  1ETO A;  4M3E A;  4XK4 A;  1ZH5 A;  3HTS B;  1OPC A;  3OS0 A;  3G1O A;  1P9Q C;  3PSI A;  3T8R A;  1OLT A;  5DM7 F;  2QVO A;  1X4P A;  4BH9 A;  2VE8 A;  4B43 A;  4QTR A;  4OIR F;  1R5I D;  1Y1V J;  4KIT B;  1UST A;  5IYB J;  3RPU D;  2OF7 A;  4WXD A;  1U5T A;  1GT0 C;  3TO9 A;  2WY8 Q;  2ZB9 A;  3WU2 C;  4DW6 A;  3WG7 H;  3HSE A;  1FWZ A;  5FKL A;  3OOP A;  1U5T B;  1DGW Y;  1DP7 P;  1E3H A;  2ZNZ A;  3FMR A;  1OJL A;  3LFU A;  3M1E A;  2OPT A;  2YR2 A;  3CJT B;  1D0Z A;  3F21 A;  2DDA A;  2O7O A;  4BL0 B;  4G6D A;  3HOZ J;  2DN0 A;  4Y13 A;  3A4C A;  2OCE A;  4H4K C;  3RKY A;  3FXK A;  2IPQ X;  2XGX A;  4XON A;  1XSV A;  3KIO A;  1MJA A;  3BC8 A;  2OA4 A;  3MWM A;  3F8N A;  3FX3 A;  1FBU A;  1DQU A;  3SXY A;  4DBQ A;  2HVQ A;  4KIS A;  2B7E A;  1YIO A;  2LD5 A;  2PMU A;  3BOQ A;  1LFU P;  1P4W A;  2Y2Z A;  1HSJ A;  2QA4 I;  1ZYR F;  5HOD A;  5AON A;  2K3F A;  5HNF A;  1MH4 A;  5F0C A;  3DLL F;  1VFC A;  2DMT A;  3PL8 A;  1ZG1 A;  2DFI A;  3QYF A;  4I0A A;  4XL9 A;  1QA6 A;  1JGG A;  2QGU A;  2VT3 A;  4LD5 A;  4OMZ A;  2PLY A;  1BJA A;  3M9A A;  4DIQ A;  4KIB A;  3QP6 A;  1K7A A;  1Z3X A;  3G3Z A;  3LA3 A;  4CA0 A;  2E60 A;  4M6V A;  5B3S H;  2NXN B;  3S3M A;  3K2Z A;  3S1N J;  3MKZ A;  4HPQ A;  4IHY A;  3WHC A;  2P6T A;  2QSH X;  3FXQ A;  3RQ4 A;  2FNA A;  2A05 A;  5HDN A;  1T0F C;  4P5O A;  3CLQ A;  3FZV A;  2IP2 A;  4BJ5 C;  1UG0 A;  3CME I;  4I09 A;  4NB5 A;  4BJT A;  2RC4 A;  2HVS A;  2LY2 A;  1WJF A;  4DYC A;  2QCO A;  5E3M A;  3EYY A;  1HOM A;  1JKQ C;  3FXU A;  4D1Q A;  2FA5 A;  5K5O A;  3KP6 A;  1SFX A;  3IAS 2;  5CVJ A;  2VKE A;  4WXC A;  1FTZ A;  1IDY A;  3W6V A;  4UB8 C;  2R7X A;  2ME6 A;  3HOT A;  3ROU A;  1XB4 A;  2H27 A;  1NK2 P;  2LSO A;  3DU5 A;  3HRS A;  5KAI C;  2VBY A;  1F4K A;  5E3N A;  3FF5 A;  2OZU A;  1A35 A;  4FQG A;  3FBN B;  4XKV A;  2CFO A;  4YFN F;  2EBI A;  2LRD A;  3OYG A;  4V2F A;  2W57 A;  2WV0 A;  2LOO A;  3E3V A;  4EGZ A;  2WAQ A;  5GTI C;  2LF7 A;  2W25 A;  4XKW A;  1BW6 A;  2JJ7 A;  3HUG A;  3OYK A;  2CV0 A;  4UUT A;  4DJA A;  5EEA A;  2DA6 A;  3S2H J;  2NAZ A;  3RKW A;  4DNC A;  3IRR A;  3HUG B;  2G7U A;  1WFX A;  2NVT J;  4D5F A;  4UUS A;  3COA C;  3KPH A;  4HV5 A;  1I3A A;  1LDK B;  4UUS B;  2WAQ N;  4G7O F;  1S29 A;  3E6C C;  1BC7 C;  4PUS A;  4XOP A;  4EM0 B;  3BCB A;  1V5F A;  1FC3 A;  2VUM J;  1ENH A;  1YLF A;  4A3G J;  1JKO C;  4UV8 A;  2LBF A;  1FBS A;  2EA4 A;  3VYU B;  2MFZ A;  3JAM K;  2VE9 A;  1TQI A;  1WJD A;  2LBF B;  4JX4 A;  5D5W B;  3CCR I;  3IWF A;  3V7R A;  2YSR A;  3HOY J;  2L7M P;  1ETV A;  5LEK A;  3NWS A;  4CXF A;  3SZG A;  4IHX A;  4YIR X;  2QYO A;  3AFH A;  4AVP A;  5J3L A;  4Y3O A;  1XGN A;  3QYB A;  5FO5 A;  1B9N A;  3F8B A;  1RZ4 A;  3PM1 A;  3TDU C;  3LA7 A;  1IN4 A;  1JTY A;  1H0M A;  2CQQ A;  2ESN A;  2FQ3 A;  5GAE J;  5ICF A;  1A5J A;  2LP0 A;  3FBI B;  5D5X B;  2P4W A;  2V1D A;  2P7V B;  3T1B A;  2DK5 A;  3CUO A;  3K6G A;  4EJW A;  4U7D A;  1IV6 A;  5CKT A;  3R61 A;  2W00 A;  2O3F A;  3QWL A;  2E71 A;  2KRC A;  3WGG A;  2DTZ A;  4CCN A;  3OIP A;  1EH6 A;  1J7K A;  3V8J A;  1B59 A;  2MAB A;  9ANT A;  3K2A A;  3ZR8 X;  2JTV A;  3CCY A;  3BP8 A;  5FLM J;  1B8I A;  4YEJ A;  5FKK A;  1R5G A;  1T33 A;  2FXA A;  4P9U A;  1B8I B;  2Q8K A;  1RPW A;  3LFK A;  4F55 A;  2MH2 A;  2XF7 A;  3BLY A;  3O3K A;  2OAZ A;  4CGZ A;  3C7J A;  4ZC3 A;  2GIZ A;  3MEX A;  2DPD A;  2IA1 A;  4MGR A;  5KVR A;  3ZPL A;  1QPI A;  4YG2 F;  3W3C A;  3IKT A;  1NG7 A;  1WJE A;  2AXT C;  2BVL A;  3F72 A;  4FAS D;  4KDP A;  1I27 A;  3KP7 A;  1J59 A;  3G2B A;  1QVT A;  2A5W A;  2DOF A;  3EET A;  4UVA A;  3S2D J;  1ON1 A;  4U0Y A;  2ZME A;  5CQE A;  2D1H A;  3A01 A;  3I9V 2;  2V1U A;  2ZME B;  3CCE I;  1J9I A;  3A01 B;  3MVP A;  3TO6 A;  3WGI A;  4A93 J;  2GXB A;  5EYR A;  1X19 A;  3ZMU A;  5LGU A;  3ZCO A;  4XBF A;  2NYX A;  4IQ4 A;  1XG1 A;  2K40 A;  4LK1 F;  4XSX F;  2FEZ A;  2R7Q A;  1UEL B;  3E5Q A;  4XLH A;  2EH3 A;  4E7L A;  2HGC A;  1RC9 A;  3R4K A;  4XM3 A;  2HVR A;  2VOO A;  4GCV A;  1RUN A;  2DA2 A;  4G94 A;  2GWR A;  3K4B A;  2VIX A;  2IGM A;  1ZRD A;  1O3S A;  1W36 D;  4BE2 A;  1L0O C;  2EIN H;  2BW3 A;  3PUB A;  3L2R A;  3W2W A;  2LDU A;  3OYB A;  2R5Y A;  2EFO A;  3BTL A;  4BHP A;  2IS6 A;  2BW3 B;  2IJL A;  4FTH A;  3A02 A;  5LGT A;  4S05 A;  2R5Y B;  4AIK A;  4B3A A;  5B1A H;  1WJ5 A;  2OZ6 A;  2HS5 A;  3RCO A;  2W85 A;  2BXZ A;  2W84 A;  3ZOB A;  3LA2 A;  4BUP A;  4BU2 A;  4Q47 A;  2ZSH B;  4Y52 J;  2QQ8 A;  4C2T A;  4EM2 A;  3CCU I;  1E2X A;  2E7W A;  2VJ4 A;  3M8F A;  1W4M A;  3SZT A;  1HW2 A;  1MMS A;  3U21 A;  2Y9Y A;  4D0P A;  2RKH A;  4UHT A;  2DT7 B;  4CO8 A;  2K5C A;  4EVI A;  1WI3 A;  4IQJ A;  1U5T C;  4M3D A;  5HLT A;  5JVG F;  3CO6 C;  2X0L A;  1OCP A;  4AWX B;  5JFR A;  1YW7 A;  1JJ8 C;  4AC0 A;  4I98 B;  4MHG A;  2GOM A;  2WB1 A;  1ZAO A;  3KFW X;  5B1B H;  4ASN A;  3KCC A;  1LEA A;  3OYA A;  3JRC A;  1IUF A;  1TWC J;  1TC3 C;  2JT1 A;  1I1G A;  5J1R A;  5E18 F;  4Y7N J;  2MA3 A;  3G71 I;  2XAJ A;  4EJV A;  2WB1 N;  3M7G A;  4IJA A;  3ERM A;  1DU6 A;  5FB2 A;  2Q2E A;  4XKB A;  3K1M A;  1X58 A;  4C3I J;  1KQ0 A;  2Q2E B;  1EH8 A;  2HR3 A;  3WE2 A;  5GAD J;  4EV0 A;  2Z5U A;  2VPL A;  2H8W A;  1Z1D A;  4KUM A;  5EG0 A;  3KYC B;  2F5E A;  3OYF A;  1YHQ I;  2DT5 A;  2XDV A;  3FXR A;  1B1B A;  3OR2 C;  5EG0 B;  5F1J A;  1MH3 A;  3O8H A;  2AQE A;  5GAG J;  5LGN A;  1TWH J;  2Q1Z B;  3BR1 A;  3FKJ A;  3HBL A;  1IN8 A;  3C18 A;  1AKH A;  2E2J J;  2VPR A;  2GA1 A;  1U9O A;  2EZH A;  1IJW C;  4J01 A;  4QIW N;  4E7K A;  1WQ2 A;  1AKH B;  4GYG A;  3U2R A;  1X1P A;  1QZY A;  1IN6 A;  1GXP A;  5FKN A;  2H1K A;  1XDU A;  3K0L A;  3W6K B;  4CZC A;  2WC2 A;  1O57 A;  5ILU A;  3QPH A;  1RKW A;  1V5E A;  2GXA A;  1QZZ A;  2FOK A;  1SFO J;  1Y0U A;  2JWT A;  1VQP I;  3OYN A;  1QRY A;  1U9N A;  3SFZ A;  1G59 A;  4R8H A;  2P5V A;  4ZYH A;  4HX4 A;  2E35 A;  2V4J C;  4N0B A;  4BY7 J;  3RDI A;  2D45 A;  2W82 A;  2V9V A;  3F9K A;  4YRV A;  3BTC A;  2DOE A;  3CJR B;  3IRQ A;  1U3E M;  1YRN A;  4KMF A;  3DKX A;  1F43 A;  2O8X A;  3LOC A;  3WTW C;  1YRN B;  1WHU A;  3QU6 A;  2JQ7 A;  1XSX A;  3JR9 A;  2CRG A;  2HDW A;  3K4K A;  2O03 A;  4CIC A;  1VQ5 I;  2YS9 A;  4OIP F;  2VB6 A;  4EAT A;  3WTY C;  1SVL A;  2DU9 A;  5LLQ A;  5E8I A;  1USS A;  3OYH A;  4BEH A;  2JA2 A;  2Q0O A;  4BHC A;  4W97 A;  4HX7 A;  2R5Z A;  3S32 A;  4BEH B;  4MEX F;  4M71 A;  4CCL A;  2R5Z B;  2K9M A;  3HIF A;  4XLA A;  5LRS A;  5LD2 C;  2DFE A;  1VQL I;  3R6S A;  4Q4Z F;  3PQK A;  2JA8 J;  1WZ2 A;  4EGY A;  4I99 C;  2R7T A;  1YJW I;  5J8F A;  3ABK H;  2R7D A;  2LC2 A;  3DTI A;  5FKO A;  2W4S A;  3GTM J;  6PAX A;  2L3D A;  3RZO J;  1MGT A;  1SMY F;  2WAD A;  3M1C A;  3OL3 A;  4FIS A;  2P5L C;  1QBJ A;  1FYL A;  1XN7 A;  5CPR B;  1PP7 U;  1TTY A;  3P9C A;  2YU3 A;  3P9K A;  1BIB A;  4A3J J;  2ISZ A;  1T95 A;  4XR6 A;  3H9J A;  2ZJR F;  3V7S A;  1MDM A;  3E6M A;  2QWW A;  4XNF A;  3S1Q J;  1TLH B;  1R7J A;  1I3Q J;  4WK8 F;  1MDM B;  3DEW A;  1H88 C;  4OAY A;  3SDB A;  1OMI A;  1HLV A;  1D1A A;  2KP6 A;  4EJU A;  3WU1 B;  1YG2 A;  1CF7 A;  1UAA A;  2AHQ A;  3H5N A;  3Q9S A;  4RA2 A;  1SFK A;  1HKS A;  4CZZ A;  1CF7 B;  2DT6 A;  3JRD A;  5A2Q Z;  2Y75 A;  2CUE A;  4MQ9 F;  1EKE A;  4FE7 A;  3OYL A;  1P4A A;  3MMY B;  2M1B A;  1R1T A;  3ZQH A;  3JTH A;  2XAG A;  2HFH A;  5IP9 J;  5IOZ A;  2HPM A;  2BHY A;  1Z7L A;  4BQN A;  1G4D A;  4HV6 A;  4LB6 B;  1LDJ A;  2WAF A;  5EZH A;  4EMS A;  1C0W A;  1XSD A;  3J7A O;  3FKI J;  1SD4 A;  1WWX A;  2WA0 A;  2O5R A;  3ASO H;  3U1D A;  1F5T A;  2XRN A;  5GPA A;  3GLX A;  1D8K A;  1ULY A;  5F0F A;  3F8M A;  5J4Y A;  2DYR H;  4Z6Y A;  2VQG A;  3RPQ A;  3LSH A;  2KIF A;  3V4G A;  1MMA A;  3MZ8 A;  2DI3 A;  2R4G A;  3I71 A;  3KEQ A;  3AG4 H;  4P96 A;  4QPO A;  2KMU A;  2E5N A;  2RGV A;  4XRS A;  2NS0 A;  1LVK A;  2XRL A;  2ELH A;  2HXO A;  4A3E J;  4L9N A;  3GME A;  3BDD A;  2KLO A;  4U88 A;  3RYR A;  2L54 A;  4DGW B;  1PJR A;  2HQN A;  1SMT A;  4E70 A;  4D7N A;  2L9V A;  1KYW A;  2L7F P;  3OR1 C;  1FP1 D;  2R7W A;  3OIQ A;  1BA5 A;  1ZR2 A;  2DYS H;  2OJE D;  3ZMZ A;  5LFA A;  2J5P A;  5L3E A;  1LB2 A;  1G8X A;  3HG9 A;  4O3M A;  1W5S A;  5EZG A;  2HQA A;  3GZ5 A;  1BR2 A;  2JUC A;  3LQR A;  3PNV A;  2FU4 A;  4WWC A;  4IOC F;  3RPU A;  2LKS A;  2XPW A;  1LFB A;  2GLO A;  2KPM A;  4JP0 A;  4HOB A;  3GFL A;  2M7A A;  1FOW A;  3Q0W A;  4Y4R A;  1PVE A;  1X1D A;  2UWM A;  1SVO A;  2D1V A;  2LH9 A;  1DDN A;  2CUF A;  1XGS A;  4KJZ A;  4PJN A;  1M1E B;  2IS1 A;  2ZME C;  1ETY A;  1DUX C;  2NVX J;  3LSR A;  1V3F A;  1GV2 A;  2CWE A;  2VBW A;  3PJR A;  2K4B A;  2XPV A;  1J2X A;  4BHB A;  3J80 Z;  5J6X A;  4IL6 C;  4S04 A;  1KYZ A;  2HOS A;  1GLN A;  4CH7 A;  1IG7 A;  4V19 K;  5FD6 A;  1VQK I;  4A0Y A;  4A3M J;  1IRZ A;  2JK3 A;  2K02 A;  4L5J A;  3LSG A;  1DPU A;  4CYD A;  2Z33 A;  3EUA A;  4HF2 A;  3H0G J;  3CCM I;  3C1D A;  1W7P D;  4L9J A;  5JLW A;  2LY9 A;  3GBG A;  1FIA A;  1IF1 A;  2X6O A;  2LKP A;  2ECB A;  4OIQ F;  2K9N A;  3WG9 A;  1JKR C;  2PMZ A;  4KT5 C;  1XDS A;  4RS8 A;  1AA7 A;  3TKY A;  5D5U B;  5D8L B;  5GPC A;  2N8G A;  3PO3 J;  2F2E A;  1Y0N A;  3O6B B;  1TW2 A;  1LE8 A;  3W6J B;  4LLL A;  1Z77 A;  4AD9 A;  1ZAR A;  2K9S A;  1LE8 B;  4WXH A;  3S8P A;  2DW4 A;  3GFM A;  1R4M B;  1YJN I;  2PMZ N;  2V26 A;  3S93 A;  1FMW A;  4C3J J;  2TRT A;  1BR4 A;  2MC3 A;  2K4J A;  4MEY F;  1ZG3 A;  2TDX A;  1TL8 A;  3LSM A;  2EFN A;  2M3A A;  2QUF A;  2L2O A;  2XKP A;  1BL0 A;  5JVT A;  1Y39 A;  3A1Y A;  4UNO A;  2A61 A;  3MN2 A;  3CO7 C;  2J5O A;  4FT8 A;  3E6D A;  4DYR A;  1E0E A;  2G0E A;  3BY6 A;  5BPD A;  2M8E A;  2D5V A;  2QM3 A;  3K4C A;  1ITY A;  4ITV A;  3AKZ A;  2EV0 A;  1FIP A;  3LSJ A;  4A69 C;  1ZLJ A;  3CMY A;  2VBX A;  1DGR M;  2NRA C;  1YTY A;  1IAW A;  1FSH A;  1WI9 A;  2ID6 A;  2ZFU A;  4YEL A;  3U1K A;  4F3Q A;  1YJ9 I;  4Y33 A;  4IHV A;  3HXL A;  4ZTJ A;  2ZFW A;  3FIW A;  1YW8 A;  3HOX J;  2VKD A;  1YFH A;  2DAO A;  3HTU A;  3ISP A;  4XQF A;  4L0Y B;  3O2P E;  2E2I J;  1OR7 A;  5D5V B;  3PFY A;  3M8J A;  3SFI A;  4UUV A;  2Y31 A;  3BR3 A;  1HKQ A;  1G3S A;  2KZV A;  2DA3 A;  2EV5 A;  2MBF A;  2ZXJ A;  2MD0 A;  2H8R A;  3B6A A;  2EB7 A;  2RN7 A;  3M07 A;  2E1M B;  4NDL A;  4A5M A;  2EIK H;  3GYH X;  2R7R A;  4BAC A;  1YOV B;  2L4A A;  2M5W A;  2ID3 A;  3TQN A;  1XS9 A;  1KU2 A;  2DO7 A;  3GUD A;  2DOA A;  4C9Y A;  3ZP5 A;  2XSD C;  4IX7 A;  1SFU A;  4IRI A;  3KP2 A;  1YIJ I;  1R5H A;  4XOR A;  4XN0 A;  3DXJ F;  2V7F A;  4HLX A;  2HKO A;  3REO A;  2LLK A;  1O3R A;  1JJ6 C;  2H6B A;  3ZXS A;  5F0H A;  4I2O A;  1HA8 A;  4PDK A;  1FOX A;  2V9P A;  4V2G A;  1UHS A;  3BPV A;  2L9N A;  2RVC A;  5GP9 A;  4AM3 A;  1I5Z A;  2R7S A;  4Y15 A;  1FYM A;  4LIV A;  1B6A A;  2A5Y B;  4B8X A;  5J4V A;  2IS2 A;  2V6E A;  2QQ9 A;  1EV7 A;  5F64 A;  2X4H A;  3C2B A;  2E36 A;  1YI2 I;  4BE1 A;  2R92 J;  2O61 A;  1A6I A;  3V8K A;  2WV1 A;  1ERD A;  3K7A J;  3VB2 A;  4CSW A;  3EUK L;  4BBR J;  1PUE E;  3P5J A;  1D3Y A;  5CYV A;  4AIH A;  4CHU A;  3I4M J;  3F6V A;  4HYE A;  3G1M A;  1WJB A;  1FBQ A;  2XF5 A;  1U2W A;  4L5E A;  2HEO A;  2CFX A;  4N4O B;  2NOJ B;  3WTU C;  1JHF A;  2R7U A;  2C6Y A;  3VYS B;  4MIM A;  4HX8 A;  1R23 A;  2P5K A;  3LMM A;  5HDG A;  1FNN A;  3QOP A;  2UZK A;  3CF2 A;  4D7M A;  3S3O A;  4LIT A;  5EJC A;  5KHD A;  4BDY A;  1LEB A;  2CQK A;  1X1A A;  2LVS A;  1U0J A;  3K10 A;  3I4N J;  4HNT A;  2XAH A;  3KLN A;  3TOA A;  4ANJ A;  1GXQ A;  1ORK A;  1R71 A;  2L7K A;  5K1Y A;  1QU3 A;  1MBK A;  3RYP A;  2ZCW A;  3DEU A;  2HOE A;  3K4J A;  3Q0U A;  1R36 A;  1IGN A;  2TCT A;  4CCJ A;  1T8I A;  2L7Z A;  1XCB A;  2XGC A;  2XAF A;  5E1W A;  5JLX A;  3Q9V A;  3TMO A;  1TNT A;  5L3B A;  4YFK F;  4LLG F;  5IP7 J;  4KN4 X;  2ZXW H;  3K69 A;  1PYV A;  1SD6 A;  3MD2 A;  1APL C;  2QEN A;  3H5A A;  4HF0 A;  5BNG A;  3SJM A;  3VOD A;  1G2H A;  3ECO A;  3H3U A;  2HDC A;  4GGG A;  2DQL A;  4M6Y A;  2ZBK A;  3HSF A;  3W2V A;  3RKQ A;  3CQZ J;  3F3X A;  2EZL A;  2E2H J;  2WTE A;  4PGH A;  1KQ8 A;  4IEJ A;  1N77 A;  5L3F A;  3UKG A;  5DDG A;  3CMA I;  2FJ1 A;  2DA5 A;  1EF4 A;  3IH4 A;  2BY3 A;  1IC8 A;  2PFB A;  5E1X A;  2MGQ A;  2CQ7 A;  2IGK A;  1N25 A;  4A3C J;  2M9H A;  4XLC A;  2HYG D;  1P7J A;  3L2Q A;  1OCZ H;  3D5S C;  2H94 A;  1PDN C;  2KL4 A;  1FLI A;  3BZ6 A;  4DZP A;  5TGT A;  5CVI A;  2JPB A;  4YII A;  3GWZ A;  4RB3 C;  3G4S I;  3D5R C;  4MQV A;  4NC8 A;  2IA2 A;  4LMY A;  4J19 A;  2XAQ A;  1OYW A;  1X2N A;  3P9I A;  4EEF G;  3Q5F A;  1J0R A;  1XPX A;  2BZT A;  2Z1D A;  2CG4 A;  1O7L A;  4PGG A;  2KIM A;  3JRF A;  2FRH A;  2BHZ A;  5DUK A;  1A31 A;  2XHK A;  1Z67 A;  1T2K A;  1IN5 A;  1HXD A;  4B47 A;  4Z2Y A;  1KA8 A;  3BG7 A;  4MTE A;  2FUG 2;  1X1C A;  4KIG A;  3FMS A;  2BE5 F;  3KYD B;  4II2 A;  4CCO A;  4A2U A;  1RES A;  3WTV C;  2LF8 A;  2LG4 A;  4BQQ A;  3PSF A;  5AIQ A;  2F4M B;  4O5V A;  2XPU A;  3VDX A;  1XCV A;  1DP3 A;  5DD8 A;  1WVR A;  3K1P A;  4AYB A;  5BQT A;  3JRE A;  3VYT B;  2V79 A;  2CSO A;  3I53 A;  1IN7 A;  3BRO A;  3GXO A;  3BJA A;  4CDG A;  2EQR A;  4PJL A;  4I6Z A;  1W0U A;  3LWF A;  3BTJ A;  3TW7 A;  2CV1 A;  4HZF A;  4AYB N;  2ZC2 A;  2MC4 A;  3GZN B;  4ZYA A;  1YX3 A;  1R00 A;  2M4G A;  2XUB A;  4A5N A;  3FXJ A;  2XAU A;  3FXM A;  3BG3 A;  1K6Y A;  4GYI A;  3GEZ A;  5CLS A;  2XKO A;  2KZG A;  5HLH A;  1Z6R A;  3ZMT A;  4PSX A;  3TP3 A;  3BTI A;  2ICW G;  1VF9 A;  2MLK A;  3KYL A;  3L2C A;  4NQW A;  1SFE A;  1Y56 A;  2EFQ A;  2HPI A;  2D2W A;  5HLI A;  4NQW B;  4E7I A;  2F48 A;  3P7N A;  1NG6 A;  4MNU A;  4U87 A;  3IH3 A;  1EH7 A;  1VQO I;  4JOM A;  3HPH A;  2VOP A;  1A6Q A;  5CQG A;  1K61 A;  2M45 A;  1HC8 A;  3L7W A;  2BYV E;  4K2E A;  1Q1V A;  3QPS A;  5FRO A;  4NNJ A;  4HNU A;  2X48 A;  4LJZ F;  3F23 A;  3ZN0 A;  3DCF A;  3CCQ I;  1FJL A;  4M73 A;  5DCM A;  1MBF A;  1F1Z A;  1R58 A;  2VJ5 A;  3HL2 A;  3VWB A;  1CGP A;  4MLO A;  4G7Z F;  1MMD A;  1GDT A;  5DCM B;  4RAZ A;  4RLF A;  3JRI A;  4HAM A;  1JE8 A;  1MD0 A;  3I58 A;  5ERI A;  3IHU A;  2LR8 A;  1BR1 A;  4OOI A;  2CUZ A;  2EK5 A;  3H3V K;  4F92 B;  5M5W J;  1NTC A;  5DUI A;  2R7F A;  4OIN F;  4IHT A;  3K4N A;  1U8R A;  2DXI A;  3BR6 A;  1P2F A;  2X9D A;  2JUG A;  1SEU A;  2ZNY A;  3WGH A;  1VZ0 A;  3LSI A;  1EJ9 A;  3BR5 A;  3DKY A;  3SYT A;  5HDK A;  3TP0 A;  1HF0 A;  2OU2 A;  1HBX G;  1IXS B;  3F6O A;  2CW0 F;  1UFM A;  4OU0 A;  3HOW J;  1GVD A;  3FK7 A;  4BQO A;  4ZH4 F;  1IO2 A;  5IYD J;  4ESF A;  3CJQ B;  4F52 A;  1T98 A;  3G6E I;  4G8X A;  4ABZ A;  3ZMD A;  1V5G A;  3AG2 H;  4HQM A;  4BXF A;  2K85 A;  2VC1 A;  1LQ1 A;  2DA1 A;  2X1C A;  2MD5 A;  2H1L A;  4A3L J;  2RQP A;  4L5I A;  5M3F J;  2OQG A;  1P4X A;  2CJJ A;  2KDZ A;  1V54 H;  2OBP A;  4P9F A;  2M7B A;  2BEO A;  4PSW A;  2KJC A;  3ERE D;  1D1C A;  3TOB A;  4KIF A;  1TP4 A;  1TWG J;  1RRJ A;  1B4A A;  4TV7 A;  1MBG A;  2QSG X;  1GHC A;  3CCJ I;  2E1M C;  4ESB A;  2LK2 A;  2E1O A;  2IA0 A;  2MG4 A;  3HZJ A;  3VSK A;  2FMY A;  2M87 A;  3OOU A;  1S7A A;  3HRT A;  4LOC A;  1VTN C;  5FFZ A;  2CH0 A;  4ZDP A;  2E34 A;  2HXI A;  4E7H A;  1K4S A;  2O9L A;  3H3Z A;  3J81 Z;  5ILS A;  1VQ9 I;  3MCZ A;  2H6C A;  4G6Q A;  1AHD P;  2QZ8 A;  1LNW A;  3B6C A;  4FCY A;  2VBZ A;  5E79 C;  4QPQ A;  3H9Q A;  5H20 A;  3DV8 A;  3GTQ J;  1IW7 F;  3SEZ A;  2OQR A;  2X6W A;  1L3L A;  5K7F A;  2CW8 A;  5HS8 A;  3PFI A;  2PG4 A;  4IKF A;  4IZZ A;  2P8T A;  3H0D A;  4UV9 A;  5LRR A;  3DBL B;  1X3Z B;  2MYS A;  1T0F A;  2LRE A;  5CVV A;  2B9S A;  3E1S A;  4WX9 A;  2F6C A;  2KJB A;  5FD5 A;  1V55 H;  2NS7 A;  4JYK A;  4ZZD A;  3RSN A;  3N97 A;  3NWT A;  1UJ8 A;  2EZK A;  4XRS G;  4CYC A;  4IHW A;  2GQQ A;  4PFO A;  4R1H A;  2E1N A;  1FSE A;  1MJB A;  3I4P A;  3PNY A;  4CYC B;  3ZQG A;  1OKR A;  3I59 A;  3GTG J;  1T38 A;  3HKZ A;  2VL8 A;  1G6N A;  4HDU A;  1ZK8 A;  2M0C A;  1W5C C;  1YYV A;  2F4O B;  2JMW A;  2BGC A;  2LMD A;  2Z3Y A;  4E7Z A;  1IUY A;  1WJA A;  3BJO A;  5TIS C;  2EZI A;  3HSR A;  3LQQ A;  4BXU A;  2XV4 S;  1VQN I;  4BXX J;  3M4O J;  3IP4 B;  4X6A J;  2IT0 A;  2LYC A;  3HKZ N;  5H2F C;  5F04 A;  3LAP A;  4GFB A;  1TT5 B;  3I0T A;  3RZD J;  2YU9 J;  4UB6 C;  1ZR4 A;  4N9I A;  4LG3 A;  4N4N B;  2ECC A;  1XMX A;  2BVM A;  4FET A;  3B02 A;  3VPR A;  3L09 A;  4QLC U;  4LK0 F;  2HYJ A;  3O8G A;  3RQI A;  3DEE A;  2FBH A;  3RIR A;  3TBI A;  2XB0 X;  5J1Y A;  2FML A;  1OQY A;  3BJ6 A;  1NK3 P;  4UVC A;  5JHU A;  1XX5 A;  2PBI A;  2YX4 A;  1BI2 A;  4KT6 A;  4AIJ A;  4UY8 I;  3HRM A;  1X4O A;  4RAF A;  2NS8 A;  2WWY A;  1VQ7 I;  3MFK A;  2HU9 A;  2M4K A;  5F27 A;  2HQR A;  1BI0 A;  1XMA A;  2P0W A;  3SHF A;  4I0B A;  1OCO H;  2JA6 J;  5KAF C;  5ED4 A;  3IWZ A;  2JSP A;  4RAY A;  5K5Q A;  1Y8Q B;  3GFJ A;  1ZN2 A;  2P7C B;  1Z3Y A;  2IEK A;  5BPI A;  4ZYD A;  1BM9 A;  1RR7 A;  3AG1 H;  1Z6T A;  5E3L A;  4A0Z A;  4HQE A;  2AXL A;  3G1L A;  3LAJ A;  4BKX A;  3DLA A;  4BNC A;  4ETS A;  2DA7 A;  2KRF A;  1W7P A;  2VLA A;  4CCK A;  2Z2S B;  1YE9 A;  3FXL A;  1MMG A;  1W7P B;  1KQ9 A;  3V8L A;  2R3S A;  1UZC A;  2DMQ A;  1FX7 A;  1S7E A;  4BAY A;  1AU7 A;  3CUQ A;  1BIA A;  4XRF A;  1U6G A;  1W36 C;  2LKX A;  1TQP A;  2HNH A;  3ASN H;  2EFW A;  3S16 J;  3CUQ B;  2E7X A;  3BG9 A;  1FYK A;  3FK6 A;  4HBL A;  3DPL C;  3QAH A;  1K4T A;  2GM4 A;  2KHM A;  1S8N A;  2WY7 Q;  3BG5 A;  4AU7 A;  4XRM A;  5FLV A;  2ESH A;  2AQF A;  5FFX A;  3OL4 A;  3L2V A;  2E1C A;  3FXO A;  2XF6 A;  4ZDO A;  4B3X A;  2CMP A;  1LJ9 A;  2O0Y A;  4RB2 C;  2VXZ A;  4U0W A;  3PO2 J;  1BI1 A;  2BY1 A;  2A69 F;  3K9T A;  1MW7 A;  4QWQ A;  3CES A;  2BBY A;  2I10 A;  3J7Z I;  1OYY A;  1V4R A;  1IXC A;  4HEA 2;  5A2Q K;  4KA4 A;  1MNM C;  1GVJ A;  4M3F A;  1X3U A;  2V6C A;  5DEQ A;  2F4I A;  4RB1 A;  3DKW A;  1RKT A;  5C44 J;  4PJJ A;  1Z7U A;  1I6H J;  2GAU A;  1WRJ A;  1O7F A;  5DCF A;  3WTT C;  2XGD A;  3CDL A;  3OYJ A;  2X6Y A;  3TDZ C;  2NOG A;  1SAU A;  2K9Q A;  2XSJ C;  1Y6I A;  5J1U A;  3M8E A;  4NUB A;  3ZGK A;  1SD7 A;  3WTX C;  2HKX A;  2ACJ A;  2RRE A;  4IVN A;  4MFD A;  1ZLK A;  2ZJP F;  1HDD C;  2OV7 A;  1HST A;  1N78 A;  4M74 A;  3IKV A;  3GVA A;  2HTS A;  1S7O A;  1YW9 A;  2VKH A;  3BQY A;  4MTD A;  3JW4 A;  1ZKG A;  2EFP A;  2CUJ A;  3CDH A;  5E20 A;  1JXS A;  5D4S A;  2XRO A;  3HRU A;  3MKW B;  3JCU C;  2K9L A;  3WOD F;  1F36 A;  3FMQ A;  5M5X J;  1Z9C A;  3JRG A;  2IAI A;  3LNQ A;  5F6F A;  4EM1 A;  4G12 A;  2KRH A;  2FE3 A;  5AIP A;  2HTJ A;  5ICG A;  2EWN A;  1BW5 A;  1ZEL A;  3RKX A;  2BY2 A;  2MSY A;  3ABU A;  3QU3 A;  3EUH A;  5JHF A;  1ON2 A;  3QPL A;  2QQB A;  1TT0 A;  2P81 A;  1VND A;  4F93 B;  3FIS A;  3OWT A;  5CJ9 A;  4M9Z A;  1G3T A;  2L0K A;  1POG A;  1Y8R B;  4L0Z B;  2OD5 A;  1JTX A;  1XD7 A;  3R0J A;  1LFP A;  1UCR A;  1ZHF A;  2ZXH A;  2A07 F;  4KFC A;  3HB9 A;  2XVC A;  3QP5 A;  1U8B A;  3ULQ B;  3F0C A;  1YQA A;  3GCM A;  1IZ1 A;  2HZD A;  2STW A;  1JUS A;  4C2M J;  1JT0 A;  5C3E J;  1O4X A;  3GO5 A;  1Z05 A;  1MSE C;  4P55 A;  3QQA A;  1S3J A;  2MLG A;  3J80 K;  1PP8 F;  4E6K G;  3S3N A;  2R0Q C;  3KP3 A;  4B1R A;  3IH2 A;  5EEH A;  2PEX A;  5EEG A;  2E19 A;  4O6J A;  2BY0 A;  2VQL A;  3KZI C;  3NRV A;  4D5C A;  4BQA A;  3A0B C;  3HC7 A;  4ON0 A;  3GTJ J;  1Y1W J;  1P6R A;  4MFE A;  3HGY A;  3FHZ A;  3KET A;  2HQ5 A;  1MBH A;  1QHH D;  4KMU X;  1E3P A;  1NHA A;  3H35 A;  3ESW B;  1UHW A;  1J5Y A;  4RGU A;  3S15 J;  5DV5 A;  1I50 J;  2F5C A;  4G7H F;  1UG2 A;  3OS1 A;  2B63 J;  3BR2 A;  1B9M A;  3HPG A;  4A0X A;  1QZE A;  1BN5 A;  2CW7 A;  2EA2 A;  1LVA A;  2F5V A;  2R7V A;  2PQ8 A;  2XB5 A;  1MBE A;  1DU0 A;  1IRG A;  1ZG5 A;  4A3I J;  1WKM A;  1FEX A;  3HJE A;  3ZN1 A;  1K6O A;  5E1Z B;  3DWL E;  3PUF A;  2PX9 A;  3VOE A;  1MIJ A;  4A3F J;  5HOO A;  2IW5 A;  3R60 A;  2FBI A;  1HCR A;  1ETW A;  4GO1 A;  5F08 A;  4JK1 X;  1IV8 A;  4AID A;  2DMP A;  4C30 A;  1D1B A;  3OSF A;  2LTP A;  2YPR A;  3HEF A;  3JTG A;  3A2K A;  2DCE A;  3MAJ A;  3DTE A;  1ZGW A;  3L9F A;  2YX7 A;  4KIC A;  1KZH A;  2HI3 A;  2ZKZ A;  1PUF A;  3JAM Z;  2LY1 A;  3BQZ A;  4PCQ A;  4LFU A;  4EJT A;  1PUF B;  3J7A Y;  4RBO A;  3UR3 C;  2IXS A;  4XLE A;  4BBS J;  2ZSI B;  5IYC J;  5KNL A;  2CQN A;  2ZXI A;  5HVQ C;  5EGO A;  2PJR A;  3AG3 H;  1QPM A;  3CLO A;  5IT3 A;  4HF1 A;  2M0M A;  5EGO B;  2PJR B;  3QOD A;  3MKL A;  1ZGJ A;  3IAM 2;  5HLG A;  5JR3 A;  2VXD A;  3DBR B;  3I3L A;  1SD5 A;  2RV8 A;  1REP C;  3DP7 A;  5ICE A;  3IL2 A;  1W1W E;  2DLL A;  2VC0 A;  1EA3 A;  1R1U A;  4I01 A;  3MZY A;  2ETH A;  4XLF A;  5B66 C;  1QGP A;  3BCA A;  4W1U A;  3KX2 A;  2KIS A;  2X51 A;  2RNJ A;  5D4R A;  4CUG A;  3V7C A;  1WPK A;  3SEQ A;  3Q3S A;  4DQ2 A;  2F5D A;  1LPQ A;  2QQA A;  2NVQ J;  3CCL I;  4M3G A;  2ADU A;  4G9Y A;  4XLP F;  1VQM I;  4DZJ A;  5C4J J;  2UV1 A;  5IOY A;  1I6X A;  3OYE A;  2XIG A;  4L9V A;  1ONV A;  3KZY A;  3OY9 A;  3BT9 A;  2VOD A;  2PI0 A;  3D1N I;  2OTL I;  4HNV A;  2FF4 A;  3C3W A;  1WH7 A;  4BGD A;  2G7H A;  5IY5 H;  1X1B A;  3BZK A;  4BS9 A;  2IGO A;  4X0G A;  1ZQ3 P;  5BS6 A;  4AVZ A;  4DYQ A;  1OCR H;  1XTA A;  2KIU A;  4L9T A;  3W2A A;  2HDD A;  1OCT C;  1TBX A;  2GA2 A;  2VAS A;  2YUS A;  5LHG A;  3PIO F;  2BOL A;  2NVY J;  3D0S A;  2B0L A;  3CZ6 A;  1I39 A;  3L00 A;  2JRM A;  4FX0 A;  3E97 A;  3HHH A;  1YS7 A;  2FSW A;  3A03 A;  3RTR A;  4RM3 A;  1HW1 A;  3ABL H;  1WJC A;  4B4C A;  2CGP A;  3CC2 I;  2Z16 A;  3Q0V A;  3JRH A;  3MKY B;  4P1W A;  4CCM A;  4HW0 A;  1XGM A;  4AUX A;  2DPU A;  2EPF A;  1E17 A;  1HW5 A;  2VKV A;  3WTS C;  5H6Q A;  3K70 C;  2FD5 A;  3DTK A;  1K79 A;  3F8F A;  4XMY A;  4BY1 J;  1ETQ A;  1B72 A;  5LHI A;  3CCS I;  1B72 B;  2XAS A;  1J09 A;  2QEX I;  2OTJ I;  3LL7 A;  1BOA A;  1QQI A;  2DFF A;  3WE3 A;  4H0E A;  4M72 A;  3CC7 I;  1IRX A;  2LFB A;  3I5U A;  3CUQ C;  5DM6 F;  2COB A;  2FBK A;  4RB0 A;  4NHJ A;  2IBD A;  3BZC A;  3PNT A;  5LHH A;  4HA8 A;  3AL0 B;  3KEY A;  4XID A;  1JKP C;  2JA7 J;  3DU6 A;  4HLY A;  4E7J A;  1BBY A;  3TED A;  3E0J B;  3HGG A;  2FOW A;  2UXN A;  2KT0 A;  3S1M J;  1R4N B;  5FLX Z;  2P6S A;  4A12 A;  4OMY A;  1GUU A;  5K7H A;  3S2W A;  2KFD A;  4I02 A;  4RAG A;  1BI3 A;  3H5R A;  4Q48 A;  3QRF F;  3IC7 A;  1OCC H;  3DQV C;  1FP2 A;  3GFI A;  5E8G A;  1Z21 A;  3CMM A;  2IVM A;  3ABT A;  2W7N A;  1Z0X A;  2X6X A;  3HOV J;  1MBJ A;  1BOB A;  1K83 J;  1UHM A;  4JBA A;  1D0X A;  4U7B A;  1TQM A;  3RI4 A;  5ILV A;  2QBY A;  1KU9 A;  2LNB A;  2WBM A;  4C3H J;  4IHS A;  4RGX A;  3SDG A;  1OIS A;  3QPT A;  2V1N A;  2ZJQ F;  4RMN A;  2QBY B;  1MSF C;  1FT9 A;  1MND A;  2VJJ A;  1RR8 C;  3DBH B;  3GTP J;  3PIP F;  4LLN A;  1WH5 A;  2JZY A;  3R0A A;  4A6D A;  5ICC A;  2MW8 A;  3E5X A;  1N75 A;  1RET A;  3GTO J;  1LKX A;  2K7L A;  4HST A;  1QO0 D;  3L1P A;  2QSF X;  2L01 A;  2BV6 A;  3KE2 A;  2JSC A;  2QLZ A;  1IDZ A;  3H1C A;  4XIC A;  1D8J A;  2DBB A;  2ZO4 A;  5LBQ A;  3NQO A;  4BJ6 C;  1H8A C;  5IP6 A;  4IPA A;  4R79 A;  5IPA A;  1YX5 A;  2ISY A;  3H92 A;  5GTH C;  5CVR A;  2M30 A;  4JX5 A;  1SAX A;  3WTZ A;  4UVB A;  4JQF A;  1KON A;  1FPQ A;  2BXY A;  3FWE A;  3ZQF A;  3TL4 X;  1QVU A;  2R7Z J;  5TRD A;  4ZDL A;  3S14 J;  2EIL H;  2L9S A;  3EUH C;  2DQR A;  4IO9 F;  4B48 A;  2CQX A;  4OAZ A;  3CD6 I;  3GX4 X;  4RDU A;  2JPC A;  3CDI A;  1SAN A;  5CVU A;  5FLX K;  3ML6 A;  3GW2 A;  2VN2 A;  1R49 A;  4DOZ A;  5M3M J;  3D5L A;  2GXG A;  3RJP A;  3B73 A;  2RNG A;  5LEJ A;  4WCG A;  3AAF A;  4PJ0 C;  3ZQI A;  4A3K J;  3TGN A;  4ESJ A;  4ENK A;  3DF8 A;  2CO5 A;  3IUO A;  2K27 A;  2CV2 A;  1E3O C;  4NC7 A;  2A3S A;  1T39 A;  3ONQ A;  2MH9 A;  1TZL A;  4YIF A;  2O6G E;  3OYD A;  1LUJ B;  1W5T A;  4HSR A;  4B09 A;  4GXO A;  2CS3 A;  2X85 A;  4F7Z A;  4II3 A;  2DMN A;  1P92 A;  2VON A;  2JN6 A;  1T56 A;  2HWV A;  1YS6 A;  1FMV A;  2VJI A;  4ZYG A;  2ZJ2 A;  4A3D J;  1R22 A;  3L2U A;  1S6L A;  2A6E F;  1HQC A;  1IRF A;  1RIO H;  2DOD A;  1G3Y A;  2GOX B;  2AS5 F;  4PJM A;  3C2H A;  3V42 A;  1OR7 C;  1JGS A;  3OS2 A;  3ZQC A;  3ZMV A;  3FM5 A;  3HYI A;  1XC5 A;  4HDV A;  1QHG A;  3PQJ A;  2L9R A;  3JRB A;  4ENN A;  1OFC X;  2OUM A;  3H36 A;  4ZTF A;  1FZP B;  2W1O A;  3C2G A;  3KP4 A;  3EPZ A;  4I76 A;  4XN3 A;  2NVU B;  4YFX F;  1UB9 A;  3JSP A;  5KK1 A;  2PJP A;  4E7S A;  3EQL F;  1X3W B;  3OYC A;  4UXN A;  3MZH A;  2COM A;  1MNE A;  4E4H A;  3FHN A;  3BG6 A;  5H6R A;  2R93 J;  1T6S A;  3J7Y J;  3VSL A;  4LGW A;  4FE4 A;  2IGN A;  4JX6 A;  4DBR A;  3OMY A;  1FOK A;  4ENM A;  4XOT A;  2CU7 A;  4MO7 A;  2DFH A;  4GRI A;  2Y9Z A;  1WGX A;  2M2E A;  4D9J A;  1F9N A;  2V1X A;  4A6E A;  2WAE A;  5DD4 A;  5L3D A;  2HOA A;  2XGE A;  1SC7 A;  5K7Z A;  3CP8 A;  1VQ4 I;  2W48 A;  4EJO A;  3VEP A;  4FX4 A;  2EIJ H;  1MKM A;  2VI6 A;  4HG2 A;  4M6X A;  1Z91 A;  2OC6 A;  1ZRC A;  4I7H A;  1XGO A;  4NC6 A;  5M5Y J;  2L4M A;  1S72 I;  1R6R A;  3ZRG A;  5IT9 Z;  4QSH A;  3OV8 A;  3U9G A;  3GF2 A;  3HOU J;  3F8C A;  3MQ0 A;  4Y17 A;  5E17 F;  2K3P A;  2JVG A;  4IXA A;  4F91 B;  5FGM A;  5KCM A;  2XC7 A;  1ZRE A;  1TNS A;  3KLO A;  2G9W A;  2CYY A;  3I54 A;  1AWC A;  1TWA J;  2ELK A;  4X1E A;  5L3G A;  3EDP A;  1OYI A;  3CP2 A;  3HDD A;  5FJ8 J;  1BJZ A;  3QYE A;  3S1R J;  3N4M A;  2NNN A;  3HOS A;  3EYI A;  4M9S A;  5FKM A;  2PMH A;  3H9G A;  3VFZ A;  4L18 B;  4RM2 A;  1BC8 C;  3I59 B;  3VYR B;  4OWR B;  3M3Y J;  1DPR A;  2EV6 A;  4A3B J;  3ZQL A;  4IOA F;  1X2M A;  2QKL B;  2JA5 J;  4WF2 A;  3ZQ7 A;  1WSU A;  2A68 F;  2ELJ A;  4PZJ A;  4KN7 X;  5J40 A;  2JRT A;  1ODD A;  2IRF G;  1RNL A;  2PN6 A;  1S5L C;  3NAR A;  5DTD A;  3GTK J;  2ME0 A;  2X1D A;  4NBQ A;  1MJ9 A;  4B44 A;  4XLN F;  2L02 A;  1AOY A;  2Z9O A;  2L5Q A;  3J81 K;  4C2U A;  1TW3 A;  3E5U A;  3QOE A;  4G6T B;  3JSO A;  3E7L A;  1SVM A;  5F1R A;  4BDZ A;  5FRN A;  2GIV A;  4LG0 A;  4J00 A;  1I1S A;  2R7O A;  3CCV I;  3JRA A;  4LG0 B;  2W24 A;  1G3W A;  4HRI A;  3OYM A;  5EDN A;  2KDO A;  1D5V A;  1JHH A;  5IT9 K;  3WHB A;  1VI0 A;  3I55 I;  1JI8 A;  1ZRF A;  2VQH A;  3ECH A;  3SQN A;  1A36 A;  2DA4 A;  4PFP A;  1KU7 A;  4GDF A;  2Y0S A;  1STZ A;  3WU0 A;  4KYW A;  3GTL J;  4RLQ A;  2VQC A;  5EF6 A;  2OCC H;  1FOY A;  4M9X A;  3S17 J;  5HS7 A;  2DTR A;  1ZGA A;  2UXX A;  1ACI A;  3BPX A;  1UMQ A;  3KP5 A;  2RAE A;  4OIO F;  2E5Z A;  1TWF J;  3I64 A;  1VQ6 I;  1ETX A;  2FX0 A;  2X1E A;  1O3T A;  3LSK A;  2Y0S N;  1RI7 A;  3K1N A;  4ZZL A;  3NEU A;  5DYM A;  2V9K A;  1ZTR A;  5K5R A;  2RQQ A;  1JT6 A;  3F22 A;  2GZW A;  4Q5S F;  3ZQQ A;  4LIU A;  2STT A;  3I56 I;  3AL0 C;  1J75 A;  5J47 A;  2AO9 A;  3K4L A;  1NH3 A;  3TW6 A;  1R1V A;  2Y0M A;  2Y69 H;  4BYY A;  2RDP A;  3LSP A;  5BMZ A;  2HOT A;  2EIM H; 
#chains in the Genus database with same CATH homology
 1TWH J;  3BR1 A;  3HBL A;  2XB5 A;  1MBE A;  1DU0 A;  3BR0 A;  1AKH A;  2E2J J;  2VPR A;  4A3I J;  1FEX A;  1U9O A;  1U78 A;  2EZH A;  1IJW C;  4QIW N;  1AKH B;  3IV5 A;  1D5Y A;  2O8K A;  4A3F J;  1JUM A;  1RES A;  5FKN A;  1HCR A;  2H1K A;  1ETW A;  5F08 A;  1RKW A;  2DMP A;  3OSF A;  2LTP A;  3HEF A;  2M34 A;  2XPU A;  1SFO J;  4S0H B;  2JWT A;  2Y30 A;  1QRY A;  1ZGW A;  1U9N A;  2GBY A;  3JRE A;  1JUP A;  2HI3 A;  4BY7 J;  2DJN A;  1PUF A;  3BQZ A;  2EQR A;  3BTC A;  3OIO A;  4M3B A;  4I6Z A;  1W0U A;  1YRN A;  1PUF B;  1F43 A;  3BTJ A;  1HDP A;  3HM5 A;  3TW7 A;  3LOC A;  4RBO A;  1W0T A;  5C4X J;  1YRN B;  4BBS J;  1FTT A;  2DMU A;  5DS9 A;  1WCM J;  5IYC J;  2FQ4 A;  4AYB N;  3JR9 A;  5EGO A;  2CRG A;  5E3O A;  2YS9 A;  1ETK A;  5EGO B;  3MKL A;  3NAU A;  1P7I A;  4W97 A;  2R5Z A;  3BG3 A;  2R5Z B;  4W1U A;  3TP3 A;  3BTI A;  1VF9 A;  2JA8 J;  1WPK A;  2QF7 A;  3Q3S A;  1R9T J;  2M8G X;  3OSG A;  2NVQ J;  5FKO A;  4M3G A;  3GTM J;  4DZJ A;  3IH3 A;  3RZO J;  5C4J J;  5IOY A;  4FIS A;  1H89 C;  1GV5 A;  3JRF A;  1CQT A;  1K61 A;  3BT9 A;  1Q1V A;  3QPS A;  4A3J J;  2X48 A;  4XK4 A;  1ETO A;  4M3E A;  3D1N I;  3DCF A;  1FJL A;  4HNV A;  3S1Q J;  1MBF A;  1WH7 A;  1I3Q J;  3G1O A;  3DEW A;  4MLO A;  1H88 C;  1GDT A;  3JRI A;  1HLV A;  1ZQ3 P;  4DYQ A;  2AHQ A;  2HDD A;  1OCT C;  2YUS A;  2LR8 A;  4QTR A;  3JRD A;  1Y1V J;  3H3V K;  2NVY J;  2CUE A;  5M5W J;  4FE7 A;  5IYB J;  1NTC A;  2OF7 A;  3ZQH A;  1GT0 C;  2ZB9 A;  4DW6 A;  3BR6 A;  2X9D A;  5FKL A;  3A03 A;  5IP9 J;  5IOZ A;  4B4C A;  3BR5 A;  3TP0 A;  1HF0 A;  3Q0V A;  3JRH A;  1OJL A;  2OPT A;  5EZH A;  4AUX A;  3FKI J;  3HOW J;  1GVD A;  3FK7 A;  5IYD J;  2O7O A;  5GPA A;  3HOZ J;  2DN0 A;  2VKV A;  5F0F A;  2FD5 A;  4ABZ A;  4BY1 J;  1ETQ A;  1B72 A;  1B72 B;  2DA1 A;  4A3L J;  5M3F J;  2LFB A;  2CJJ A;  2KDZ A;  2COB A;  4XRS A;  2IBD A;  1TWG J;  2LD5 A;  1LFU P;  1MBG A;  2XRL A;  2Y2Z A;  2HXO A;  4A3E J;  2LK2 A;  2E1O A;  5HOD A;  4XID A;  1JKP C;  2JA7 J;  2MG4 A;  1MH4 A;  5F0C A;  3TED A;  1VFC A;  3OOU A;  3HGG A;  2DMT A;  4LOC A;  2KT0 A;  4D7N A;  3S1M J;  2HXI A;  1JGG A;  2O9L A;  2L7F P;  1GUU A;  5K7H A;  1BA5 A;  1ZR2 A;  5EZG A;  4M6V A;  1AHD P;  3B6C A;  4FCY A;  3S1N J;  2XPW A;  1LFB A;  4IHY A;  3GTQ J;  2GLO A;  3WHC A;  4JP0 A;  1Z0X A;  3Q0W A;  1MBJ A;  5K7F A;  1K83 J;  3HOV J;  2CUF A;  4C3H J;  3SDG A;  4DYC A;  1ETY A;  1MSF C;  2QCO A;  5E3M A;  2NVX J;  3LSR A;  1HOM A;  1GV2 A;  3GTP J;  1JKQ C;  2XPV A;  2HOS A;  1WH5 A;  1IG7 A;  2MW8 A;  4JYK A;  2NS7 A;  4A3M J;  1RET A;  2VKE A;  1FTZ A;  3GTO J;  1IRZ A;  1IDY A;  3W6V A;  2EZK A;  4XRS G;  2JK3 A;  4CYC A;  3L1P A;  2ME6 A;  4IHW A;  3LSG A;  1IDZ A;  4XIC A;  4CYC B;  3ZQG A;  1NK2 P;  1H8A C;  3GTG J;  5IP6 A;  1ZK8 A;  2M0C A;  2JMW A;  3H0G J;  5IPA A;  5JLW A;  5E3N A;  2LY9 A;  3GBG A;  1FIA A;  2EZI A;  2X6O A;  2ECB A;  2K9N A;  1JKR C;  2EBI A;  4JX5 A;  4BXX J;  3M4O J;  4V2F A;  4X6A J;  3HKZ N;  3ZQF A;  5GPC A;  2N8G A;  1QVU A;  5F04 A;  2R7Z J;  4GFB A;  3PO3 J;  3S14 J;  3RZD J;  2YU9 J;  1BW6 A;  2JJ7 A;  1LE8 A;  1ZR4 A;  4UUT A;  5EEA A;  1Z77 A;  2DA6 A;  3S2H J;  2ECC A;  2K9S A;  2CQX A;  1LE8 B;  4RDU A;  2NVT J;  3VPR A;  4D5F A;  1SAN A;  4UUS A;  2PMZ N;  4C3J J;  2HYJ A;  2TRT A;  3O8G A;  3RQI A;  5M3M J;  4UUS B;  2WAQ N;  2XB0 X;  5J1Y A;  1NK3 P;  3ZQI A;  4A3K J;  2VUM J;  1BL0 A;  1ENH A;  4A3G J;  1JKO C;  1E3O C;  3MN2 A;  2NS8 A;  4JX4 A;  4DYR A;  2G0E A;  5F27 A;  2DMN A;  2D5V A;  2JN6 A;  2JA6 J;  1T56 A;  1ITY A;  3HOY J;  1FIP A;  2L7M P;  1ETV A;  3LSJ A;  4A69 C;  4A3D J;  3CMY A;  4IHX A;  2IEK A;  1RR7 A;  2ID6 A;  5J3L A;  4IHV A;  5E3L A;  3G1L A;  3PM1 A;  4BKX A;  3FIW A;  1JTY A;  2CQQ A;  2DA7 A;  3HOX J;  3ZQC A;  1XC5 A;  1A5J A;  2LP0 A;  2L9R A;  3JRB A;  1OFC X;  2DMQ A;  2E2I J;  1S7E A;  4I76 A;  3SFI A;  1AU7 A;  2Y31 A;  3BR3 A;  2LKX A;  3S16 J;  2DA3 A;  3BG9 A;  1IV6 A;  3FK6 A;  2R93 J;  2H8R A;  3B6A A;  2GM4 A;  3BG5 A;  4XRM A;  5FLV A;  4FE4 A;  4NDL A;  4JX6 A;  2DTZ A;  2ID3 A;  1XS9 A;  2CU7 A;  4MO7 A;  2XSD C;  9ANT A;  2Y9Z A;  3K2A A;  1WGX A;  2M2E A;  3PO2 J;  3CCY A;  5FLM J;  1B8I A;  2HOA A;  2XGE A;  5FKK A;  5K7Z A;  1T33 A;  2LLK A;  1JJ6 C;  5F0H A;  2W48 A;  1B8I B;  1RPW A;  2I10 A;  4V2G A;  1UHS A;  2VI6 A;  1MNM C;  5M5Y J;  5GP9 A;  4M3F A;  4QSH A;  1QPI A;  1RKT A;  3HOU J;  5C44 J;  1I6H J;  3C2B A;  2XGD A;  3CDL A;  1QVT A;  2R92 J;  1A6I A;  3S2D J;  2NOG A;  2K9Q A;  5J1U A;  3A01 A;  1TWA J;  2WV1 A;  2ELK A;  4X1E A;  3K7A J;  4MFD A;  3A01 B;  4BBR J;  3HDD A;  1HDD C;  5FJ8 J;  1BJZ A;  3MVP A;  3S1R J;  4A93 J;  5EYR A;  3I4M J;  5FKM A;  3G1M A;  3BQY A;  1ZKG A;  1XG1 A;  4L5E A;  2K40 A;  3M3Y J;  4A3B J;  4MIM A;  3ZQL A;  1X2M A;  2EH3 A;  1F36 A;  5M5X J;  3JRG A;  4D7M A;  2IAI A;  3LNQ A;  2JA5 J;  4G12 A;  2DA2 A;  2LVS A;  3GTK J;  3I4N J;  3NAR A;  5DTD A;  1BW5 A;  2ME0 A;  2R5Y A;  3BTL A;  2MSY A;  4FTH A;  1ORK A;  3A02 A;  2R5Y B;  3QPL A;  4B3A A;  1MBK A;  2P81 A;  1VND A;  3FIS A;  3Q0U A;  1IGN A;  3ZOB A;  2TCT A;  2L0K A;  1POG A;  2L7Z A;  4Y52 J;  1JTX A;  3E7L A;  2XGC A;  5JLX A;  3HB9 A;  5IP7 J;  3JRA A;  2Y9Y A;  1U8B A;  3F0C A;  5EDN A;  1APL C;  1WI3 A;  4M3D A;  5BNG A;  3SJM A;  1JUS A;  1G2H A;  3WHB A;  4C2M J;  1VI0 A;  1OCP A;  1JJ8 C;  2DA4 A;  4AC0 A;  1JT0 A;  5C3E J;  3RKQ A;  3CQZ J;  1O4X A;  1MSE C;  2EZL A;  3QQA A;  2E2H J;  3GTL J;  4IEJ A;  2R0Q C;  3UKG A;  4B1R A;  5EF6 A;  2FJ1 A;  3JRC A;  3IH2 A;  2DA5 A;  1EF4 A;  3IH4 A;  1IUF A;  2E19 A;  1TWC J;  1IC8 A;  1TC3 C;  3S17 J;  2MGQ A;  1UMQ A;  4D5C A;  5J1R A;  2RAE A;  4Y7N J;  2M9H A;  4A3C J;  1TWF J;  3GTJ J;  1P7J A;  1Y1W J;  1ETX A;  2FX0 A;  2WB1 N;  4MFE A;  3HGY A;  2Y0S N;  1DU6 A;  1ZTR A;  4DZP A;  1JT6 A;  2HQ5 A;  1MBH A;  1X58 A;  4C3I J;  4J19 A;  5EG0 A;  2AO9 A;  1X2N A;  4EEF G;  3S15 J;  3TW6 A;  1I50 J;  5EG0 B;  1UG2 A;  2B63 J;  3LSP A;  2HOT A;  3BR2 A;  5F1J A;  1MH3 A;  3O8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...