2CG4A

Structure of e.coli asnc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords REGULATORY PROTEIN ASNC
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cg4A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cg4A02
3HRTA 1P92A 2GA2A 5TJJA 3T8TA 3E5QA 1MDMB 3I0TA 2OAZA 2PJPA 1ZLJA 4P55A 2LNBA 3DKWA 2W24A 2D2WA 1XMKA 2W25A 2AS5F 4OMZA 2ESNA 2PEXA 1P6RA 3SZTA 3R0AA 1QO0D 3R6SA 3ERED 1U3EM 2HS5A 2FE3A 4UVCA 3KEQA 2EWNA 3K1MA 4LG0B 3L00A 4YFKF 4R8HA 5K1YA 1R1VA 5ICFA 2Z33A 2FF4A 4PZJA 1TTYA 3LSTA 1B9MA 2Y75A 1YTYA 4HAMA 5LHHA 2DPDA 1R5HA 2QQAA 2J5OA 2L54A 1S3JA 2P6TA 3RIRA 2VC1A 2OQRA 4GO1A 4IXAA 2OA4A 2JZYA 3HRMA 4EQQA 2EK5A 4RB1A 1ZREA 2H6BA 3R61A 2ZNYA 2P4WA 1ZYRF 4AVPA 3ZMVA 1MD0A 3TO6A 3SZPA 3E6DA 1KQ8A 3RYRA 3O3KA 2DO7A 3KLNA 5H20A 3FXUA 3V8LA 2NAZA 2VBZA 5FGMA 1U5TA 4LB6B 1LDDA 1ZRDA 3TQNA 4GCVA 2HKXA 2B0LA 4FX0A 1J0RA 3HHGA 2GXBA 2A3SA 3SXYA 1IW7F 3I53A 2E7XA 4U0YA 1ZG1A 1K78B 1RNLA 4HLXA 4G7HF 2P8TA 4N9IA 5FO5A 3VOEA 2FMLA 3B02A 3T1BA 4HX7A 2Q2EA 2NNNA 3EYIA 3I54A 3WTSC 1D3YA 1J5YA 4DQ2A 3KP7A 4IJAA 1F5TA 2IT0A 1AOYA 3HTUA 5LEKA 4ESJA 3SQNA 2IVMA 1GXQA 3BY6A 2IPQX 4U88A 1TNSA 4KIFA 2IW5A 2R3SA 5BOXA 3VODA 1T6SA 2IRFG 4EVIA 2H27A 1WSUA 5TRDA 4OIOF 4WWCA 2PMHA 1S7AA 1REPC 4E70A 4XLNF 3NRVA 1XCBA 2HZTA 4CGZA 3GX4X 3SFZA 3J7AO 1FSHA 4NQWA 2WC2A 5D6EA 2XAFA 1L0OC 2F2EA 5FD5A 3KZYA 1QZZA 3F8BA 3O6BB 1SD4A 1XN7A 4L9JA 2FBKA 3ECHA 4A6EA 1LDJA 1S8NA 4UUVA 3IRRA 2TDXA 4ENMA 1Z6RA 3QP6A 4MQVA 3WTXC 2L01A 5ERIA 2DU9A 3ZN1A 2K4JA 1MJBA 2G7HA 3J80K 3TDZC 4FHTA 1XB4A 1Z91A 4Y17A 3GXOA 4I02A 4A2UA 2NNYA 2QM3A 2W85A 1ZLKA 5D5WB 2EFNA 4UXNA 2ETHA 3BJ6A 3F6OA 4L0YB 2R7DA 1FWZA 4YFNF 2ZMEA 1PDNC 1FX7A 2D1HA 2HYFA 1OKRA 2DBBA 2M1BA 1CF7A 1XGNA 5E8IA 2IA2A 3K2ZA 4G8XA 1G3WA 2P5KA 4O3MA 2PI0A 3CUQC 4WF2A 4YIFA 2A5YB 1G3SA 3FMRA 3TKYA 3D5LA 4A12A 2O0YA 3TO7A 3CDHA 1IZ1A 1TNTA 1Z05A 4M72A 1LB2A 4MEXF 1O3TA 3WGIA 1U5TC 4CHUA 1YLFA 2YSRA 5L3GA 3LAJA 2QUFA 2PFBA 4ESFA 4M73A 1FSEA 1XDSA 5CVRA 4G9YA 3V4GA 4L18B 3GFLA 4PGHA 5E1ZB 1ZARA 3BJAA 5IT9Z 3LA3A 3RTRA 3DF8A 5AONA 1QNTA 5CVVA 1BIAA 3CUQB 1R58A 4AD9A 5HOOA 5K5OA 3U1DA 3RDIA 2UXNA 4LK0F 3LA7A 2L3DA 2NRAC 2QQ9A 4LFUA 5LGNA 2EV0A 1EH8A 1UFMA 5E20A 3RJPA 4KMFA 2MC3A 4AIKA 3QAHA 4WXDA 3CUOA 3GW2A 4RB3C 1XGMA 1V4RA 2JRTA 2VT3A 5D5UB 2V1XA 4O6JA 3KLOA 2CG4A 3I71A 4M6XA 1ZG3A 4NB5A 2VONA 2FA5A 4ASNA 1RI7A 2XIGA 3BROA 3QPHA 3DV8A 3QPTA 1HQCA 2RC4A 3DFGA 2DPUA 3JAMZ 2H6CA 1HKQA 1STZA 5HS9A 3H3ZA 2Y48A 1IN5A 3J80Z 1DPUA 5DCMA 2JPCA 1EH7A 2ZMEB 4A5NA 5ILVA 2CVIA 3LWFA 1IN4A 3HYIA 1KGSA 2CYYA 4YIIA 2MA3A 3GUDA 3WE2A 2STTA 4N9HA 4KN4X 1R00A 2K86A 1ZG5A 3K0LA 3K69A 2JSXA 3LFKA 1FY7A 1HSTA 5J6XA 4LLGF 5LBQA 3M9AA 5LLQA 1KU3A 1OPCA 3W6JB 4PDKA 2UZKA 2EFWA 1HXDA 2ZBCA 5ICGA 2HGCA 2EV6A 5CLSA 1LQ1A 1FOKA 2MD5A 2QYOA 4CYDA 1UCRA 4RS8A 4EMSA 2C6YA 4WK8F 4Q48A 1PP8F 2M45A 2GQQA 2GAUA 4CDGA 2RGVA 4OOIA 2XAQA 5DV5A 2CQKA 2DAOA 2A07F 1LDKB 1ZAOA 1W5SA 2QLZA 1HW1A 1USSA 2ESHA 2ZKZA 5HS8A 2RV8A 5CJ9A 2VXZA 4HA8A 1TBXA 3V8JA 5HLGA 1IF1A 5FLXZ 2BE5F 5A2QK 4A0ZA 1MZBA 2IP2A 2ZFWA 1O3QA 2P7VB 2EA2A 1E17A 4HF0A 1KA8A 3P7NA 1B1BA 4CXFA 1OR7A 3DPLC 4MTEA 5L3CA 3WU1B 3V7SA 1EH6A 1YFHA 2G7UA 1IXCA 1Y0UA 2L02A 3B73A 4RAYA 2V79A 1IUYA 3RPQA 2FEZA 3M8FA 3ZPLA 4Q4ZF 1GVJA 4AIHA 1FZPB 2A68F 3W6KB 1BC7C 3H3UA 1S6LA 3PFIA 4G6DA 2V9VA 1F4KA 3M7GA 3MEXA 1XDUA 4H0EA 1I1SA 2M5WA 4LGWA 5E17F 2ISZA 4HQMA 4F7ZA 4ZZLA 3Q9VA 2CW0F 4DNCA 1QQIA 1BC8C 3IRQA 2RVCA 3O2PE 4RGSA 2XUBA 2WV0A 2M8EA 3IWZA 1D5VA 1RZ4A 1TQMA 4LB5A 4ZH4F 1P4XA 3JTHA 4N0BA 1YO5C 1P4AA 5H6RA 3F8FA 3FF5A 4P96A 5DCFA 4M9ZA 5BMZA 5DUKA 1FT9A 3ROUA 3WGGA 2DW4A 3KETA 2Z99A 4HDUA 5D5XB 4M9XA 1G3YA 4HQEA 1ZGAA 4IRHA 2KRFA 3MAJA 1O3RA 3FXRA 4WX9A 5F64A 2MBFA 4YG2F 2EJRA 3KE2A 5JFRA 5FFZA 5E18F 2WTEA 1WRJA 2LF7A 3L7WA 1ZN2A 4BAYA 4ENNA 2UWMA 2MH2A 3E3VA 2GWRA 2O3FA 1F1ZA 4EM0B 3F8CA 3E6BA 3QOPA 1JHHA 1ZRCA 3BPVA 3K1PA 5HVQC 3MWMA 1BI3A 2YX7A 1IRFA 2HOEA 3OOPA 3GZ5A 3FZVA 4K2EA 2ZNZA 5DYMA 3ZP5A 1U78A 1U2WA 3C3WA 1DUXC 1K6OA 3N97A 3V7RA 1RUNA 2FOKA 1BJAA 2FSWA 5J8FA 1HKSA 3F6VA 4MNUA 5ED4A 2JSCA 1UB9A 1MGTA 2E1AA 4EJWA 2QENA 3F3XA 2DQRA 3HTSB 1XSDA 3ML6A 3KP4A 4L9TA 2ZCWA 1YW9A 2GXGA 2NYXA 3GLXA 1RUOA 3ZN0A 5E1WA 3Q5FA 1FNNA 1WI9A 1WQ2A 4OINF 2HTSA 2Q8KA 2VN2A 1WKMA 3JSOA 3KCCA 4Y13A 5DDGA 1JE8A 4A0YA 4R79A 1G6NA 2K4BA 1TLHB 2FU4A 2FBIA 3T8RA 4CICA 2FMYA 1ONVA 3GZ6A 3TOAA 4KA4A 4P9FA 5HDNA 2V6CA 2VOPA 2DT5A 1UHWA 2XROA 2FXAA 3ELKA 1H0MA 5IT3A 3F8NA 2CFXA 4PCQA 3KZZA 4ON0A 4PGGA 2IJLA 4HV5A 5E1XA 4JQFA 1D8JA 5ICCA 1SFXA 2PN6A 2M30A 2O03A 2HYGD 4I09A 1JHFA 3MCZA 1J9IA 3AAFA 4TV7A 1XSVA 4Y15A 4EM1A 5F1RA 1D8KA 2E1CA 2ISYA 1SFEA 2BGCA 4XRFA 2O61A 5CVIA 3R0JA 3EQLF 3DXJF 4Q47A 4M9SA 3KEOA 5LEJA 3JAMK 1YW8A 3QU6A 1WWXA 1X3UA 1FYMA 4LLNA 2PQ8A 3IC7A 2EV5A 1U5TB 1QGPA 3HOTA 3V7CA 3JSPA 3D0SA 2VBWA 4HBLA 3CTAA 4CO8A 1R1UA 2D1VA 3J81K 4ZYDA 2Z9OA 3MZYA 4RGUA 2W57A 2PMUA 5DEQA 5F6FA 4JBAA 2STWA 3F8MA 4WCGA 2Z5UA 1P4WA 1CGPA 1KU7A 1KU9A 3U9GA 2F5EA 3ZMUA 1TW2A 4UHTA 3L9FA 1KYWA 3GFIA 2XHKA 1LEAA 5HLIA 5JHUA 2HDCA 2E1NA 1YYVA 4XSZF 5J8CA 4L5JA 1H9GA 1TQIA 1YG2A 2EFQA 1MKMA 2BEOA 3WGHA 4RB0A 1SMYF 2QZ8A 3R4KA 3K9TA 3LA2A 5L3EA 2VBYA 2XVCA 1CF7B 4FT8A 1FYKA 2ZXJA 2XASA 1SD5A 2Q0OA 3GVAA 3WG9A 2ZBKA 2HTJA 4OIQF 4O5VA 4EGYA 1AWCA 1L3LA 3M8EA 3REOA 1BI0A 1J2XA 4IHTA 5A2QZ 1LNWA 4ENKA 5HLHA 2OZUA 2HQNA 3G73A 4BH9A 5FB2A 4HW0A 4M6YA 3IHUA 5FFXA 2OD5A 1HKTA 4P9UA 3FHZA 2GA1A 3FX3A 5AIPA 3GEZA 1BM9A 4KT5C 5DD4A 4S04A 1KU2A 4NHJA 1B59A 1Z6TA 4ESBA 5LRSA 3COAC 3E5UA 3C18A 3FMQA 4LLLA 1Z9CA 3HHHA 1HSJA 4IVNA 2XAHA 1PUEE 1H9TA 5KVRA 1ZHFA 1OYWA 3L09A 5DCMB 3ECOA 3CLOA 5ILSA 4GYGA 2A61A 3RKXA 1BOAA 2D45A 1LJ9A 3ULQB 2L4MA 2A69F 4Z2YA 4A5MA 4RGRA 4AIJA 3MQ0A 3QU3A 2PBIA 4EJVA 4G6QA 2F5CA 4FX4A 4HV6A 2COMA 2K7LA 4LMYA 4GGGA 1OMIA 5BPDA 3BP8A 2FRHA 4YFXF 1Q1HA 3KP2A 2G9WA 1IAWA 3QP5A 1T39A 1HBXG 2KIMA 3MZHA 1G3TA 1YQAA 2O8XA 4KIBA 3E97A 2YX4A 1XCVA 1LVAA 4BQAA 1J59A 4HOBA 3EDPA 3WODF 4XLPF 2QBYA 3EETA 2Z4PA 1BI1A 1IRGA 4G7OF 2JTVA 3L2CA 3G3ZA 5E8GA 1YW7A 2QVOA 3U2RA 4ZYEA 2XV4S 1TW3A 1ON1A 5EEHA 3RPUA 1SD6A 2CSOA 4L9NA 2WWYA 4S05A 2ZJ2A 2P5LC 2HQRA 4LK1F 1BIBA 3CO6C 1XD7A 2KIFA 1C0WA 1I27A 4ENJA 3IL2A 3E6MA 1R22A 5ICEA 2KIUA 2OBPA 2OZ6A 3HSFA 4A0XA 5H6QA 4U7BA 4UV9A 1E2XA 3CJNA 4HYEA 3FWEA 1T0FA 1QZYA 3KP3A 3FMSA 3RKYA 3SHFA 4G7ZF 3BDDA 1YIOA 2ELHA 2K02A 5K5QA 5FD6A 2DFIA 2LDUA 2JT1A 3PQKA 4RAZA 3ZMZA 3GF2A 4M71A 2F5FA 2FNPA 3R60A 1ZH5A 4UNOA 5JR3A 4ZYHA 3TGNA 2EB7A 2F5DA 1NHAA 1W7PA 4B8XA 3MFKA 4EJTA 5D8LB 1T98A 3VEPA 1W5TA 4MGRA 3C7JA 4CZZA 5D4SA 2IA1A 1A04A 2OQGA 2VT2A 3TOBA 1QBJA 4HF2A 5K5RA 3LQQA 2KKOA 1USTA 1VTNC 3JTGA 2DQLA 1J7KA 4I98B 4KDPA 1YS7A 2PLYA 2O6GE 5L3DA 1B9NA 6PAXA 4MHGA 5JVTA 1BBYA 3IWFA 2R7FA 1I5ZA 3Q9SA 1O3SA 5HDGA 4ZYGA 5BQTA 3I58A 1IN7A 3HUGA 3BWGA 3IKTA 3T5XA 1IN8A 1IXSB 4EGZA 2UXXA 1TQPA 1XGSA 5CYVA 2RQPA 3BJOA 2JPBA 2HEOA 1IXRC 2QQBA 3RI4A 2OU2A 2CWEA 3JW4A 5LRRA 4L0ZB 1O7FA 4LJZF 2H09A 4I7HA 3DPTA 2XRNA 1DPRA 2ADUA 1W4MA 4IRGA 1MDMA 1MJ9A 4HF1A 3IKVA 1JGSA 5CVJA 3BOQA 5DUIA 2RKHA 2CO5A 1V3FA 2LSOA 2VC0A 3ABUA 4I2OA 1YS6A 2GIVA 4G94A 3I59A 1KQ0A 1HW5A 2YPRA 5HS7A 1B6AA 2H94A 5D6FA 4HLYA 2KJCA 3NEUA 1FLIA 1ULYA 2FNAA 4KN7X 1SAXA 3OV8A 3J81Z 4IF4A 1PP7U 3H92A 3GWZA 3E5XA 4I0AA 2EFOA 5EEGA 2DI3A 1Z7UA 3EUHA 4BHPA 3E6CC 4XSXF 3KP6A 1SFUA 1R7JA 4IPAA 5FLXK 1U6GA 4BHCA 1KQ9A 3P9IA 3ABTA 3GYHX 4BYYA 2KJBA 2MLGA 3QRFF 1FPQA 2AXLA 2EA4A 2MLKA 1P2FA 1K78A 4EM2A 4D0PA 4HZFA 5LHIA 3HOSA 2GZWA 3HSRA 3HRUA 4GYIA 1R36A 2P6SA 2V1UA 4MQ9F 4U0WA 3KP5A 4QLCU 3CUQA 2DJWA 3RKWA 5LHGA 4HX4A 4WXHA 4MTDA 4RB2C 1IN6A 3BZ6A 2J5PA 4LG0A 4IRIA 3WTUC 4KYWA 4I0BA 1R1TA 4OMYA 3WE3A 3WTVC 3F21A 2W84A 3HIFA 1LEBA 1Z1DA 4EV0A 1W7PB 4ETSA 3DEUA 3FXQA 3N4MA 1T38A 1I1GA 2XAJA 1BI2A 1FC3A 4LD5A 1FBSA 3FM3A 1G4DA 2HFHA 4ZZDA 2HR3A 5HDKA 4I01A 1XMAA 3DP7A 2L4AA 4KUMA 3ZQ7A 1W7PD 1SD7A 3RYPA 2X4HA 1FP1D 3I64A 3P9CA 4IHSA 2IA0A 3T0YA 4KIGA 2LF8A 1K79A 1K7AA 3LQRA 2HWVA 4A6DA 1FP2A 4KMUX 1JXSA 1R23A 1O57A 2PG4A 3HRSA 2YR2A 2VE8A 1BN5A 2VBXA 4R1HA 2Y0MA 5D5VB 5DD8A 5LGUA 1O7LA 2DK8A 4UVAA 4UV8A 1OYIA 2NS0A 2ZO4A 3TDUC 4BNCA 1FBQA 2DK5A 3F72A 2RNJA 2M87A 1T2KA 2FQ3A 2P5VA 1XSXA 2A6HF 1U8RA 4KNYA 2CGPA 5L3FA 5L3BA 2BYVE 3GFMA 5BPIA 2EFPA 1S7OA 3GO5A 3DQVC 2QBYB 2XGXA 3EYYA 2K27A 1OYYA 3NQOA 3FM5A 4WXCA 2RN7A 4BXUA 3F23A 2BBYA 2VOOA 4QWQA 3HSEA 3LAPA 4B09A 3GFJA 2DTRA 1DP7P 4GXOA 2BV6A 3C1DA 2VE9A 4KFCA 5LGTA 4KICA 1FYLA 1EV7A 4UVBA 2YU3A 3WU0A 4L9VA 1ZRFA 3WTZA 3V8KA 2XAGA 4HX8A 4P5OA 1HW2A 1FBUA 5JI6A 3ZMSA 1J75A 1R5GA 1RIOH 1I6XA 1ODDA 4HDVA 4M74A 2QWWA 2MH9A 2XKOA 3BPXA 3M1EA 3I5UA 2VODA 5CVUA 3ZMDA 1ON2A 3KFWX 1MJAA 4OU0A 3PQJA 5IT9K 2ACJA 4EJOA 4EJUA 1QPMA 2RDPA 4XBFA 3I4PA 1UHMA 2HKOA 2X0LA 3ZMTA 1GHCA 4OIPF 1F9NA 3P9KA 1ZGJA 4BHBA 4MEYF 5D4RA 1B4AA 4OIRF 3WTTC 4U7DA 4JK1X 1S29A 4RGXA 2E7WA 4U0VA 3VB2A 2DLLA 2XKPA 3K1NA 2A6EF 3CO7C 2Z3YA 2V1DA 4Q5SF 1SMTA 1XGOA 4AWXB 5BS6A 5D8KB 5AIQA 3S2WA 4L5IA 3ISPA 3F22A 2LKPA 3WTYC 2FBHA 5KK1A 3WTWC 3I59B 2P7CB 1KYZA 1GXPA 1DDNA 3TO9A 5ILUA 3VFZA
chains in the Genus database with same CATH superfamily
3HRTA 4DV0F 3EVOA 2GA2A 2XZDB 4OV1A 4YIRX 5TJJA 1HMVA 1GVDA 3E5QA 2VZ9A 3GZ7A 1MDMB 5KG5A 3C6TA 3FSXA 2X9DA 1OCPA 2OAZA 3BR5A 3D7SB 1NHVA 3BQ0A 1S0VA 4P55A 3D5MA 3QGHA 2HRTA 2QYGA 2HYIB 3I56S 1LWEA 1QVUA 2IJFA 1W2BR 1Y5NB 4KPYA 1P6RA 1ZM4A 3SZTA 3X3UA 4W98A 1JLQA 2GJIA 1N32F 1R0AA 3VF0B 5CHCB 5C2CA 2X1AA 3Q0AA 2G2YA 1D1AA 4LG0B 4YFKF 5K1YA 4LF5J 5GAHI 4MFEA 4Y34A 2Z33A 4DLEA 2XI2A 4F50A 3OQ2A 2BR0A 3CMQA 2Y75A 2R4GA 1HHQA 3M9NB 2YQ3A 2KN4A 3H5UA 3CD6I 4C0BA 3BM7A 3D3BJ 5GAEJ 4GVBA 4E2FB 2GNKA 3FCWA 2GQ2A 2CADA 2IY5B 5E7OB 3HOVJ 2IFXA 1JJCB 1VK3A 2IHR1 4FXWA 1I5OB 3T5HA 3FISA 1EB0A 4GO1A 2OA4A 2CH0A 4EQQA 4OJHA 1U6BA 5KAIC 1HF0A 1NJYA 2H6BA 3R61A 1XNRF 5THWA 1ZYRF 4AVPA 3MF5A 2M2EA 2YPZA 3DHXA 4P7VA 3RYRA 4WU3A 5KT5A 3QOEA 3Q8SB 3DRPB 5H20A 4NEYA 4LFCF 5DS9A 1YJ9S 3DMJB 2RU3A 1U5TA 3M4OJ 1VQMI 1K4SA 2IC3B 3LP2B 3U1LA 4V19K 4U95A 1WKKA 1SANA 3BO3A 3CJSA 1SKRA 2VKEA 3DBRB 1QD1A 1V5FA 1HWLA 4U7CA 2CPYA 5FRMA 3MD2A 1NAQA 2E7XA 1ZG1A 1Q82T 3CCLS 2AMCB 2YH1A 3KUGA 2PDAA 3IBCB 3MM5A 1U1MA 2GIRA 4X66J 4DUYJ 5FO5A 2OPRB 1RWWB 3EGZA 1ETQA 3B02A 2CQIA 3POTB 4IQMA 3GMEA 4O4GB 1R49A 1KSPA 2HDWA 4Y6IA 3BGFA 3IG1B 3LANA 5D6GA 3NAHA 3WTSC 1HBUB 1HI0P 4D9JA 2M8DB 5F0UA 4AD6A 4U96A 4N47A 2MZJA 4MAKA 3SQNA 5T41A 3JSMB 1GXQA 3BY6A 1Q79A 2IPQX 2BY3A 1WORA 4HDGA 2GM4A 4KIFA 2IW5A 3ZTPA 2XNQA 4F0MA 1CQTA 3W2AA 5CYMB 4EVIA 4PG6A 3WZ0A 2H27A 4MIBA 1WSUA 5TRDA 4OIOF 4WWCA 4ELUA 5C24B 5DDRC 3SI8A 2HNDB 3C15B 1X58A 2KVQE 3FKJA 2W82A 2HZTA 4BDPA 2B3TB 2RDJA 3C2PA 1T0TV 3DM2B 1FSHA 2WC2A 3BGUA 4A3FJ 4JB8B 4ZCMA 2CW8A 1M1EB 3BYRA 2A18A 4RMNA 1SFKA 4Y2MA 1EETB 1XN7A 5JVGQ 2XHWA 1VYAA 1LDJA 3OR1A 1YRNA 4OL8A 4BJ6C 3IRRA 4UUVA 2E71A 4ENMA 1Z6RA 1HI1A 2L01A 5ERIA 5F27A 2GV1A 2G7HA 4CCMA 3J80K 1GMUA 3TDZC 3DLLQ 2NUUG 1NK9A 3T5JA 3GXOA 3M30A 5J4YA 4I02A 2NNYA 2QM3A 3BN4A 2DEIA 4CM2A 5BR8F 2CMPA 2ZZTA 3IGVA 2BM0A 3AD7C 3R2DJ 5HQLA 5D5WB 4XLEA 3Q0UA 2IS6A 1FTCA 3F6OA 3GYNA 3SXLA 4EBCA 3UNGC 3PW7A 4OYAA 4DV4F 1MBJA 2W4PA 4L0YB 1ETVA 4A3GJ 4YFNF 3GTYX 3MKYB 1VQSA 2JLEA 4KGVB 3OSFA 1SQGA 3FDYA 1SJQA 4C8KA 2DBBA 2M1BA 3QPLA 4JX6A 2M5YA 3MEEA 1HD0A 2DXEA 1XGNA 4DV2F 1ZA1B 3HI9A 5ETSA 1G3WA 2P5KA 1P1TA 3FEYB 4DIQA 1K1SA 4NQWB 2EZIA 3CUQC 2Z2MA 1XNRJ 3OL4A 2A5YB 1CSJA 1BQNB 2ZH8A 2FVPA 3BKUA 1G3SA 2JNJA 3FMRA 3TKYA 1WC0A 5I42A 4A12A 4RO0A 3G8TA 2WV1A 2J6UA 2G4BA 3TO7A 4BDYA 4DYQA 3SIPB 1JGGA 2VJIA 1LB2A 1HQUB 1YBUA 3D0HE 1WJAA 2BKPA 1I3AA 3GSIA 2C2EA 4CCKA 2OPSA 3FXKA 3H59A 3M2UA 1NZ8A 3IBWA 4LF5F 3HFKA 3TJ8A 2IYIA 2JK3A 4MTPA 3BQZA 2AQ4A 1FSEA 4RLQA 4NOHA 2PMZA 1ZTTA 3BR0A 2OTJS 4G9YA 4TVAB 3V4GA 3PO5A 4RR5A 5E1ZB 1D09B 1ZARA 2Y1JA 3RKQA 5IT9Z 1S12A 3MUTP 3DF8A 2BOPA 3CUQB 5HOOA 2HQ5A 3R5AA 3U1DA 4ZYAA 1LWEB 2IYGA 1Z0XA 4NA1A 4WE1A 5B0DA 3RDIA 3GTMJ 2OKQA 5F3TA 2UXNA 2ZSIB 1WG4A 5TGTA 2MQQA 3G8QA 2VB6A 2HQDA 1EH8A 1X5SA 2IMOA 1UFMA 2QA4I 3OY9A 2MC3A 2JMWA 4DEZA 3GW2A 4RB3C 2BJ1A 5T14A 4M5HA 4I6WA 2FGOA 1XGMA 3O2IA 2HIYA 3R27A 1V4RA 3H42A 1LW0A 4L76A 3P96A 3TWZA 4O6JA 4DSLA 3TJ9A 4ATNA 3U02A 4H4OA 1CVJA 3KKFA 1IVZA 2CG4A 5JVHQ 3QQAA 3E1SA 1SEUA 2R7WA 4CT8A 2Z58B 2FA5A 1NJWA 3K5LA 2J7KA 3MPUB 1YG0A 2G0EA 4KAIA 1RI7A 4XAKA 3DV8A 2AGPA 4ZPTR 3QPTA 5KTQA 1RAOA 2DPUA 2H8WA 2OEJA 2RREA 2Y9ZA 3MTJA 1CQNA 4I76A 2WHOA 3H3ZA 8ATCB 1MBFA 3QPSA 1DPUA 3S1TA 4I7FB 1QSYA 5DCMA 2JPCA 1A6QA 4OYZA 1IQZA 2NXNB 2ZMEB 5ILVA 2E1MB 2OPPA 5L46A 4DV1F 1X9MA 3QAUA 4DI6A 1IN4A 5J2NA 2FLPA 4YB7A 1ZELA 1UCNA 3JRCA 4N9HA 5K7FA 1R00A 4HACB 3KHRA 2HNHA 1ZG5A 3FSIA 3K0LA 1FRHA 4C8NA 1ZAVA 3N9UC 2RB7A 2VQHA 1JXEA 2UXDJ 3VAFA 3D2WA 2RUSA 5KT4A 3RBXA 4DPTA 5GPAA 3I87A 1NH7A 2HQAA 2OFGX 4DSKA 2DO4A 3W6JB 4PDKA 4XONA 1T9TA 4UZBA 3H40A 1HXDA 5LSOA 2XBPA 2HGCA 4CYUA 3LP0B 4EZ9A 4UUWA 4KKOA 1LQ1A 4LR7A 4TYBA 2B4OA 1ZPWX 4N77A 3I0SB 4CQ1A 4EMSA 4CCJA 3IC1A 1GDTA 4WK8F 4Q48A 3K4LA 4ZDOA 2XF7A 2GAUA 4C3IJ 3LOCA 1W7WA 1W25A 4EBEA 2RGVA 2H48B 3DTEA 4FDFA 1HBNA 4PUSA 1AUSL 1RA7A 1WVRA 2HQFA 4R8UA 4KKOB 4LRDA 4ZVEA 2KRBA 3L95X 3IWNC 1B7FA 1ZAOA 4JBCA 2ZH6A 1USSA 2CZ9A 2F8MA 2ZKZA 3HKWA 3DRYA 4QJVA 3PIOF 1ETKA 2VXZA 3GV5B 3V8JA 5E0OA 2KIQA 4BQNA 4AXJA 1N33J 2DH9A 1S59A 5A2QK 1OSCA 3KWMA 3KXDA 1NCLA 3PCOB 2XGEA 2NS8A 4Y3OA 2F65A 4DR7F 1BLUA 3OLAA 2R8IA 5AXMA 1CC7A 2EA2A 3ZFVA 1E17A 3BEGB 3G71S 1HYSB 4DFPA 1FRMA 1R8BA 3T5LA 4DL3A 5L8RC 1S9EB 4M63A 3UPFA 1OR7A 2YNFA 4JV5F 3CUNA 3DPLC 2QMWA 5KFMA 4NEZA 4QQBA 4QR1A 2A05A 5A8RA 3ZZYA 3CCWA 3V7SA 1VBKA 1EH6A 3GJRB 2G7UA 2AYBA 3UWTA 2L02A 1L3UA 5HO4A 1Y3KA 3DLBA 3RPQA 1V54H 2Z2ZA 3TVKA 3M8FA 3OS1A 1N88A 3LP1B 4UB8C 3ZPLA 3RUBL 2GO9A 1B72A 4P6QA 2L9NA 2YXLA 2FJXA 1RJJA 3K8WA 2DT9A 1GT0C 3W6KB 2ZBPA 4QSHA 4A3MJ 4Q2LA 4PWUA 2Y0SA 3BF4A 5K8OA 4YEAA 3CCMI 4L3KA 3MEXA 2KISA 5GTHC 4H0EA 1LNQA 1I1SA 2JL9A 3OOUA 2ISZA 4HQMA 1FK9A 4X4UA 4F8RA 1NK4A 3Q9VA 4DNCA 1WF1A 3EZUA 1VHIA 2RVCA 3RCOA 3FKBA 3O2PE 2X1CA 2XUBA 5CD4H 1N77A 4OYPA 2EEYA 5GAGJ 3MR2A 1D5VA 3HHEA 1RZ4A 3HOZJ 1W1WE 3R3TA 1TZ0A 5DCFA 3LAKA 3DC2A 1IV6A 2OMLA 4ED4A 1FNOA 3CQZJ 5DUKA 4F93B 2I38A 4K4XA 4IQJA 2Z99A 5CAAA 3DLJA 5ETTA 4HDUA 2EBEA 3QNWB 2LFVA 2NS7A 2KZZA 4FQGA 4KB7A 4I99C 1ZGAA 2DNLA 4IRHA 3MAJA 1O3RA 3MM9B 3FXRA 4WX9A 4RL1A 2XCAA 3SFUA 4YG2F 1HNWJ 2EJRA 4IH6A 3KE2A 3IGNA 4IUFA 4B9TA 4TU9A 5JFRA 5FFZA 2KXFA 2WTEA 5F9LA 4C0HA 3C14B 3CJ0A 1KQGB 3CIMA 1RAEB 2GQCA 1GTHA 4B3SJ 1JHHA 4XN0A 4WK1A 1V5GA 2QA1A 5HVQC 2XQCA 1NEEA 4A8QA 3KJQB 4NYPA 4IRDA 4ZLNA 4URSA 1N36F 4G1QB 1SV5B 1CULB 4YN3B 1IRFA 1TVRB 3OOPA 1FX2A 1S1VA 4CLSA 1QLNA 5J2PA 4KY3A 2ZNZA 4ZVSB 4UF4A 2FD5A 3CF5F 1U2WA 3BC8A 4B1RA 2KPMA 2LEPA 3P4UB 3NXZA 3WDOA 1CJTA 1FNMA 1BJAA 3B6AA 2FSWA 2LR8A 2JEJA 3GCMA 1KHWA 1Q16B 1O4XA 1JLFA 1RT2A 2R42A 3KLIA 1WC3A 2QENA 2K9QA 1F3VA 5I42B 3O1LA 1NRKA 4K59A 4KJIA 3QZ7A 3KP4A 4L9TA 4MO7A 4UOCA 3WC0A 2W2MP 3ZQFA 4DFMA 3NMAA 1ITYA 4KISA 4DS4A 2OUGA 1RESA 1WQ2A 4OINF 2HTSA 2XMJA 2RQKA 1EA3A 2VN2A 3HULA 3OTCA 4OX6A 5DDGA 2ZZNA 1G6NA 2D3ZA 4Z6YA 4N56A 3MR5A 3SEOA 1FI4A 1YX2A 2FBIA 4HEA2 2KMUA 1RYRA 4P74A 4OHVA 2JVRA 5ETKA 4FASD 4FYWB 4CICA 1SJ4P 5IC6B 2BXJA 1U1RA 4LIUA 4YMEA 5FKNA 4HHJA 4DR6J 3QT5A 5L39A 3CCMS 4KA4A 5HDNA 3DRSA 2K40A 1LK5A 2DT5A 5KFNA 2VA3A 1E6VB 3G2BA 4P2SA 2Z56B 3DU6A 1WHYA 2GMLA 4ON0A 4OI3A 3A3PB 3PNIA 1S0NA 1DLOA 2VPWB 4JQFA 1SL1A 2UXBJ 3HHKA 3SMZA 2NYIA 2HYGD 1P8GA 3M3YJ 3D54A 1J9IA 4Z2XA 2BABA 3KK3B 4ZP7A 4LF8F 3AAFA 1HBOB 1XSVA 4EM1A 3UVJA 2ISYA 1J5OB 1SFEA 5GAHJ 4Y28C 4LREA 3Q89A 3DXJF 1MROB 3QLHB 3NS6A 3JAMK 1TUVA 1X3UA 3TW6A 1FYMA 2PQ8A 2V68A 5HI7A 3IC7A 3MM7A 5KFGA 2EV5A 3TO8A 4IO9Q 2LD5A 3D0SA 4B48A 2B43A 3IP4B 4HBLA 3IAS2 4PAAA 1VLYA 4XLAA 3TX8A 2EI5A 2ASDA 3SCJE 1W36D 4J5OA 1F0XA 5L1JA 1FFGB 3LPYA 3FCHA 3KK1B 2XMVA 1F60B 5DEQA 5F6FA 4IFYA 3KYDB 4XKWA 2X3DA 2M7BA 2Z5UA 4NLXA 1NH3A 4RNNA 3GFHA 2DFFA 4KHPF 3VQSA 1TW2A 2VG7B 3G82A 1YHQI 2UXCJ 3H5NA 3GFIA 3JAMY 2HDCA 3IMQJ 2KRHA 2E1NA 4ZVOB 4M3FA 5HAOA 4XSZF 2XPUA 3S8PA 1TQIA 1NTCA 1YG2A 1MKMA 3WGHA 4DUZJ 1WC5A 1IV8A 2WSFC 4JI1F 4EEFG 4ZPBA 1SMYF 3KPHA 1YZ6A 2QZ8A 5I3UA 3G6VA 2CJBA 1S7EA 3HXLA 3LA2A 3MMYB 4F52A 4FVMA 2RD5C 1CF7B 3FJ2A 1WJEA 4NC8A 3R5GA 2CPJA 2EBIA 2HAFA 3A4CA 3X1LB 1REVA 2ZZMA 1RK8A 2NSCA 2XASA 3ETOA 5M3FJ 4HL9A 2FZGB 1GMWD 4K2JA 4LUBA 5L9XA 1FJGF 3PG9A 2BANB 2NXUA 2ZBKA 5CABA 3GTQJ 2NXCA 3RQIA 1AWCA 1RHMB 1L3LA 1NK0A 1J2XA 1Q0NA 3M8YA 3E7LA 3K17A 2G1HA 3KIOA 5M3MJ 2OZUA 1NPRA 1NZAA 5B0FA 5HROB 3MPYA 4M6YA 3PX4A 4KH1B 2CS3A 2ZJRF 1N4LA 2PGCA 3H5YA 2K3IA 2ZVSA 1DZ5A 1U09A 2XPVA 1VJWA 2L5QA 3VHQA 4MK8A 5FFXA 1C0TB 3J7AN 2AJFE 2J9DA 3CD7A 2EQRA 4F4KA 4A3JJ 2M9KA 4GO5X 1JLBB 2DA7A 4C8YA 1RLDA 4U8VA 3PX6A 1Z21A 4ZVUB 3M9OB 4CH7A 3I5CA 5LRSA 2V4JC 1YK9A 1C0TA 3COAC 5BXIA 3C18A 1WTBA 1XWLA 4C4WA 3J7Z5 3OIPA 4PKDB 3HHHA 4LIVA 5GTIC 3AD8C 1PUEE 4M5DB 3EWGA 5B0EA 1OYWA 3VQTA 1M5OC 2CQBA 4GYGA 2DR9A 4ELVA 2R9LA 2DGUA 1IM4A 4LIRA 4JI0J 3M9MB 2D45A 4OIXA 1LJ9A 2L4MA 1Q1KA 4Z2YA 5K14A 3HSDA 2RVJA 4OHZA 2IA6A 5IYBJ 1CG2A 4KBIA 3OYFA 3OTEA 4RDUA 2XGCA 3MQ0A 3KK2A 3QU3A 1OJLA 4J9VA 3MOJB 1R9TJ 1JQGA 3PJRA 4J9SA 3MMAB 2COMA 4XKBA 3PIPF 3LSPA 4LMYA 4GGGA 2VFUA 5BPDA 1QUPA 3BP8A 1VQ4S 4YFXF 4FTHA 5FKLA 1IAWA 2ACMA 2EBGA 5F9NA 3HM5A 1YQAA 1D1CA 1FA0A 2TRTA 2M0MA 2HZAA 3S1NJ 2HK2A 1WELA 5KFRA 3PYGA 4OFZA 4V1Ak 4BQAA 3LMMA 5GVQA 1XS9A 3IR5B 3S32A 3EDPA 1SL2A 3LGHA 3IRXB 3PUFA 2M4MA 1U1OA 2LU2A 2ACYA 1FK9B 2YNFB 2JTVA 3TX0A 1JTYA 3DLAA 2BJ9A 4BCAA 2QVOA 1BQNA 1RAFB 5KFHA 3CCJI 4KIAA 1TW3A 3RPUA 2IRUA 3OYJA 3RPUD 4IFYB 4L9NA 2WWYA 2D3UA 4RX6A 2HQRA 3TUPA 3FRYA 2V9WA 1S48A 3QBCA 3DI6B 2UUAJ 4KT6A 3GE9A 4ED6A 3J81j 4ZJZA 1CS4A 3I4MJ 2KHDA 4D1QA 3VVTA 3ZZOA 5HATA 3D3CJ 2OBPA 2AXTC 3V4IA 4DQIA 4A0XA 3HPOA 4U7BA 3A8EA 5KFXA 5DTDA 3ZZZA 5A8RB 4HR2A 2QFIA 1S7HA 1QZYA 1I39A 3FMSA 4AL5A 3SHFA 2QGFB 5FKKA 3BDPA 3CC4I 1AYEA 3TAQA 2ELHA 2MSTA 3KJVB 3UNYA 3EDQB 3KLFA 2MPUA 2OV7A 3GF2A 2YWFA 1ULRA 5KG0A 5F8GA 1VQ5S 5B1AH 5JR3A 4ZYHA 2EPFA 2F1FA 1RLCL 4TYAA 3TGNA 2EB7A 1G6BA 3N01A 1VQKS 4C8ZA 3MFKA 3NWRA 4CH1A 4MGRA 3BG5A 3LOUA 3FVYA 4CZZA 4F92B 5D4SA 2IA1A 5M5XJ 2WVFA 1TL1A 2B9XA 1PKUA 5LJ3Y 1GMWA 1Y7PA 4ER8A 1HW8A 5DLGA 4PJLA 4R25A 1GEHA 2GZOA 4IOBA 2KKOA 2NUHA 1KFDA 1YZ7A 4NLYA 2DQLA 3I55I 3OL7A 4OI4A 5J2NB 3BH7B 5JJBA 4DR4J 2Y8YA 4H4KC 1S1TB 4JP8A 2PLYA 1S0OA 1FKOA 2X51A 3TR5A 1T11A 1N6QA 1VIXA 3NP5A 4Y2IA 5JVTA 2XF6A 5E3MA 2RS2A 3QT7A 3IWFA 1I5ZA 2ZM6F 1WHXA 2WCXA 1FF2A 4NUBA 1NK3P 1UETA 5BQTA 3PIPQ 4U7UK 2R2RA 3HUGA 4MH8A 3C6UB 3DFEA 4CA0A 5DQGA 3IKTA 2WB4A 1IN8A 3QATA 3N05A 2UXXA 1XGSA 2V9KA 1AKHB 2RNEA 2MY8A 2CV2A 3HOYJ 2KYXA 4KE5A 4R5PA 1VC5A 3C2BA 3JQMA 3JW4A 1NPPA 3CJ8A 4JI3F 3CXCR 1K83J 5BYSA 4I7HA 3OJUA 1S6OA 1CJTB 1G2HA 2XLJA 3R1HA 1J2VA 3JCUC 4DQRA 1W4MA 3BV8A 3CNQP 3OD2A 1WF0A 1MJ9A 2EXUA 4HF1A 3HG9A 2BW3B 2RKHA 3PTWA 3ZNUA 4GVLA 3PYFA 2V69A 4QIFA 4J01A 2LCWA 2QCOA 3CCLI 3OVAA 5CA5A 3CDAA 5BR8J 5EWFA 2JVHA 1MU2B 2M70A 5HS7A 3GPAA 4F4WA 1UJ6A 3S1RJ 1D9FA 4LSZB 4LOCA 3S3NA 3NEUA 4K4SA 4OYXA 5E3NA 5L9NA 3HB9A 5GPCA 2CJ9A 3VVUA 3W2VB 3ENWA 3EUHC 1AROP 1JLFB 3OR2A 4QWEA 3GWZA 2N3OA 3M1VA 2N4DA 5IT0A 5FJ4A 4RAGA 2KFNA 3E6CC 3I82A 3RZDJ 4IPAA 2DOAA 4B9VA 4DL4A 4BHCA 2BQUA 3M1CA 1SVOA 5CQEA 1R43A 3U1KA 2LLZA 3ABTA 3A8IA 1CJKA 3TZWA 2VQFF 3TP3A 2LVWA 3CCSI 5E3CA 3CWJA 4R0JA 5LL6d 3B4MA 5CKTA 3QRFF 5DQHA 4UOHA 1RWVB 3CO0P 1IGNA 2MLKA 1P2FA 2LOOA 1K78A 1FO1A 4USWA 1EKSA 2RAEA 3E01B 3SSRA 2GZWA 5JLXA 3H25A 2K8GA 3RTVA 2FVSA 1NHKL 2FDNA 3HRUA 5J40A 1VI7A 3S2HJ 4LRCA 4WF9Q 1FE0A 2M4GA 4LBHA 2FLOA 2I1RA 4UQTA 3D9BA 2PMZN 5JVGF 3CUQA 4NLTA 2DJWA 2BXZA 3B54A 1JNRB 4HX4A 3T9ZA 2AKWB 1WJ9A 4YDXA 3LGNA 1IN6A 3BZ6A 3QWLA 1TL1B 1ZA2B 4B4CA 2V4RA 2VJJA 2X6YA 4UQGA 2PSZA 5GADU 3F21A 3HIFA 1J5EJ 1Z1DA 1POGA 4RW6A 3RRGA 4A4JA 3JSRA 2D3O1 2ZWPA 3TYTA 5KG2A 2DO0A 3M8SA 1EP4B 4ZP8A 1UVKA 3FM3A 3SDEA 1G4DA 2NR0A 2HFHA 4ZZDA 5HQMA 4ANJA 3SFIA 3GTJJ 3L3CA 1ZM3A 1BGXT 1W7PD 1SD7A 2KB2A 1FP1D 4E7KA 2ERRA 2GCFA 3I64A 4ZIVA 3UN5A 4II2A 1VQNS 3AA8A 1K7AA 1YX3A 2WW4A 3DLGB 1EP4A 5IT9U 4A8OA 1FP2A 3CCYA 3M8PB 2QG9B 4USTA 5D4LA 3VGTA 2HNDA 3C15A 1YJNS 4QW8A 3MR6A 3MECA 1I6JA 4OYOA 2BZ2A 2WONA 2MKSA 5LGUA 1O7LA 2JSPA 1IBMJ 2KLOA 4UVAA 4UV8A 4RWWA 2V6EA 2MTLA 1QTNB 3GILA 3LPEA 1X0PA 1KOOA 1NMEB 3TDUC 5K7HA 3F72A 2KT0A 4JI8F 2WSCC 3CD0A 2F9JA 4NZ7A 1PG5B 1U49A 4CCOA 4NLRA 3VWSA 4B44A 5CYQB 4X6AJ 3S2DJ 4MLOA 3G6ES 1S7OA 2JLGA 3H2VE 1WKLA 1N75A 3KLIB 4Y3CA 2IVYA 3FM5A 1N25A 4IG3A 4LQ3A 2I8DA 5T7LA 2X1GA 3IR6B 1AFIA 2KP6A 2E2IJ 1IJFB 2PX9A 1SPBP 5EX0A 2YS9A 2ILZA 1HR0J 1O0PA 3F23A 1OSDA 3IV5A 2JJ7A 4H54A 4BLGA 3L2WA 3G86A 2XB0X 3C1DA 5DRKA 2Y8WA 4LF4F 1FYLA 4DV1J 4UVBA 3QIDA 3LSHA 3WU0A 2XC7A 4NX9A 1YJTA 4CTAA 1ZRFA 2X1BA 2C22A 1UVMA 3CESA 1YJNI 1QY7A 4HX8A 2BVLA 5EG0A 3MEGB 4PEOA 2OI2A 3Q8UA 5A8WB 2OSRA 9ANTA 2VKDA 2Y1IA 4FCYA 1R5GA 3GR0A 1G1XA 1PC4A 3AG2H 2K9SA 1D0YA 1U26A 2BE2A 1PAEX 5C3EJ 2ZJPQ 1QSSA 4P2XA 1M90T 3M1EA 2LTPA 3LSKA 5LMUF 3CDEA 1BQMB 4CWBA 4C2MA 3DOLA 3KFWX 1MJAA 2EIMH 2FJEB 2KYZA 2EH3A 4C7QA 2M4KA 2ACJA 2AU0A 1OWXA 4K4WA 3ENAA 4XBFA 4OAZA 3GWCA 4F4ZA 2GVZB 1VQOI 1R27B 2AJQA 3VTIA 2C1EB 2R7QA 3OT9A 2BMBA 4ECTA 1RTJA 3OR2C 2LMDA 3DBHB 3F9KA 2L0KA 4X4NA 5J1EB 3GTPJ 4LF8J 4O23A 2XF5A 2GW8A 4PWDA 2DHSA 2W2QP 4FVCA 3WTTC 4A47A 1U24A 1DJ0A 2QIFA 5F08A 2X6OA 1S6QA 4NYZA 2NXEA 2QJ3A 1SVLA 2VPRA 4TY8A 4U0VA 5J47A 1R7IA 3VB2A 1KZHA 4NLQA 4F4XA 2Y30A 2QC3A 2CAJA 5D4OA 2MGZA 2DJNA 3PFEA 2CG8A 2HXIA 2R7RA 4K2XA 3SEQA 4YB6A 1FEEA 4AWXB 3UE2A 4B9SA 1TKTB 2FBHA 5KK1A 1AB8A 2DNOA 2GHVC 3VAKA 2M7SA 2P81A 3I59B 1DDNA 5G4DA 2V4JA 1N54B 3DLLF 1VQ9I 3BT9A 3GYGA 2FVRA 4K4UA 1SQEA 4PJ0C 3CCUS 2DXFA 1T9UA 4JI7F 2QO3A 2IBKA 4FF4A 3MWBA 1FVSA 3I0TA 1ZR2A 1ZPVA 2F3JA 3ZNJ1 3ITHA 2HZVA 5FDLA 2D2WA 4FKXA 2IIHA 3NGUA 2F63A 4C9DA 4LF7F 2H3EB 1LW2B 2B6AA 1S6QB 5H9FK 3FDSA 3R6SA 1Q95G 2I0XA 5G0RA 1U3EM 2Q6BA 3BBCA 3KEQA 3IAS9 2NSBA 1KKHA 1UEVA 1LXNA 2LLKA 3ZTSA 1TWGJ 5HMYA 3HUGB 3L00A 4IQ4A 1R1VA 1Y56A 1L3KA 1TELA 3THPA 2B5JA 2W4SA 1TTYA 2P2CB 4NMLA 2BANA 4HAMA 3CC2I 3CDWA 5LHHA 2DPDA 1R5HA 2KJVA 5JLWA 2QQAA 4FF1A 1MWZA 4ECQA 4JOMA 1HNIB 1YITS 3RIRA 1AZSB 2VC1A 5CH7B 1RDRA 4E7LA 1BHNA 2B4PA 3D6FB 1FXRA 4YUDA 1FOYA 4IXAA 1QHGA 2JZYA 2F9DA 3DN9A 1S57A 1HNZF 3PM9A 4RB1A 1ZREA 1Q8KA 2HZDA 2ZNYA 3CJRA 4LR8A 2XMAA 3ZMVA 3IG1A 3TO6A 2YNGB 2HI3A 2ID3A 2Q66A 2DO7A 2HVQA 2Q2EB 1TFYA 3JRIA 3UDCA 1FD8A 5B1BH 5SUHA 2Q79A 5DGBA 1HDDC 2HGLA 4FX0A 1HHSA 4F67A 1WPKA 2FLNA 1U25A 2WADA 3PJWA 1TL5A 3SXYA 1IW7F 1NH8A 3ZZRA 2J7WA 3GG0A 4FPRA 4N8NA 4WTOB 2VL1A 4X84A 3VOEA 2RILA 2FMLA 4N7TA 3FEZA 2CPZA 1P27B 4D3HA 2B51A 3T1BA 4HX7A 3VALA 4KITB 1YBTA 5K8MA 3BH6B 3ZXSA 2HGMA 3OVSA 2MQPA 1HLWA 1J5YA 4DQ2A 2LK2A 1NJXA 4IJAA 3PW4A 1VQNI 5A0YB 1ZBTA 1AOYA 2C3MA 3ZZ0A 2XULA 3TZZA 2CFOA 1EJ9A 3ZRGA 5A76A 3OJSA 1UW9A 2ALYB 2V34A 1X4OA 5D0EA 2K85A 4ZVRB 2B4UA 2YKMB 3V42A 2R3SA 4ILRA 1VQ5I 1Y5IB 3VSLA 5M5WJ 1W0UA 3IR7B 2GGPA 4OYMA 1H74A 2RF2B 1REPC 4E70A 3WIVA 4XLNF 4F7VA 1A5JA 1LWCA 3B6CA 3RBDA 1JXLA 2R7XA 4ZPVR 3OR1C 1X31C 3JRDA 1L0OC 3AODA 1TWAJ 3TA2A 3F8BA 2Y0SD 4XTTA 4LVOP 1K61A 2O5DA 1VBZA 1Y5LB 4DQPA 2CQ4A 2QN6B 1S8NA 5KFFA 2NVUB 4I69A 2IC3A 1JKHB 1AT1B 2J9EA 4USHA 2DT6A 1LQ9A 2DU9A 3ZN1A 2K4JA 2BEFA 3LTOA 3HDDA 3TMOA 3MMJA 4FHTA 2DXDA 2HPIA 1Z91A 2VHGA 4Y17A 3BZQA 1MBKA 5IQ6A 3V81A 4URGA 3SCLE 3H0DA 4LFBJ 1LVKA 4FP9A 1ZLKA 1IR0A 3CJTA 2E5LF 2K3FA 4OZ2A 4TLRA 4DZ6A 4J90A 4CCHA 4DL5A 2R7DA 4O3PA 4NZ0A 1VRUB 3CE8A 2ZMEA 2NXNA 1PDNC 2IAIA 2D1HA 2O9LA 2CVEA 3D0GE 1VMBA 4DJAA 1CF7A 2MGZB 3R9LA 3HZGA 1X1CA 1UW4A 2E1RA 5EDWA 2XNRA 4ANDA 2XS5A 4NC6A 5E8IA 4D7NA 1BWEA 3KHLA 1IBCB 4O3MA 4KGMA 2DGWA 2C2RA 4WF2A 4YIFA 5U47A 4P10A 1VISA 1F9FA 2ZOGA 1SFOJ 1RAAB 1G7CB 3D28A 4IOAF 4BEHB 3LALA 2O0YA 2RIJA 1GXUA 1Z05A 3WBZA 5L38A 4RBVA 4XLHA 1JUPA 1S5ZA 2J0XA 3NEKA 4P52A 3AH6A 2RHSB 5EZHA 4AU7A 1SJ1A 1U5TC 3EZOA 4X62F 1YLFA 3LAJA 4BUPA 2PFBA 4ESFA 1XDSA 1S99A 5CVRA 2F5VA 3DRXA 4WFAQ 1DU0A 4L18B 3O8WA 3A1YA 3D1NI 3GFLA 3BG7A 3BJAA 2HHHJ 2CNLB 1OCZH 3L2UA 4I2QA 3RTRA 3W2VA 2HSEB 5AJ3F 2F4VJ 3PJXA 3MR3A 2MLYA 5CVVA 3D1HA 1BIAA 4AD9A 5KOXA 4PK4A 4LF1A 3CDIA 1RBLA 1T8EA 4U87A 2E5JA 2DFHA 4K4YA 2IJRA 2NZ4A 3LA7A 5K8NA 1A7GE 3A8JA 2GS8A 3DTIA 2BY2A 5A0YA 2NRAC 4KSEB 4X66F 2EV0A 4ID5A 2HVIA 3K5NA 4NLOA 1FE4A 2C28A 2HMIB 5DDPC 4LF4J 2BW3A 2XRLA 4FZVA 1TUGB 4WXDA 3CUOA 4ES1A 1WH7A 5D15A 2PEHA 1X9SA 1QDUB 3RB6A 3CEDA 4CZCA 4B3TJ 4DV7F 1QA6A 3IP0A 3HDSA 3W61A 4XICA 1LWXA 2MZRA 1JLCA 2WVCA 3I71A 4ZDPA 4NB5A 1FRJA 1AKHA 1KVIA 2RE1A 4KFBA 1IR2A 4NA2A 1XPXA 4QIWD 4E7ZA 2RC4A 2XMWA 2HHSA 1U1KA 2W7NA 3UKGA 3JAMZ 4YHHJ 1XX5A 2H6CA 4WTYA 1U47A 4LJMA 3AG4H 4I6ZA 1BE4A 3FXLA 3HVTA 1STZA 2OO4A 1MMDA 2BRLA 1IN5A 3E0JB 1RPWA 3L7OA 4CT9A 1ZM2A 2LY1A 4B3OA 2Q1ZB 3LSGA 4A5NA 2O3DA 2ELJA 5J1RA 3WG7H 1IBMF 4ITVA 4NL5A 4Y65A 3GMGA 1QTMA 4F3MA 2CQ3A 4YIIA 3WE2A 3BO2A 5ETNA 2DPIA 1MH3A 4DSFA 5GAEI 2K86A 1K8AT 4BXXJ 3EPZA 1X5TA 3K7AJ 4LT6A 1X1AA 4LLGF 4KTQA 1U0HB 4PYAA 2YVSA 4JI2F 3M9AA 1DAXA 4GDFA 4GKKF 2GHPA 2DA5A 5GP9A 1OPCA 2XEXA 3HBLA 4BE0A 3B82A 4QU6A 2ZBCA 4DFKA 3ET6B 3FQKA 5ICGA 2HFOA 3C46A 4RUCA 4RW6B 3I96A 3ZOBA 2MD5A 4IL6C 5ETVA 3TNVA 1LW2A 5H9EK 2V63A 4RS8A 3RAQA 4FETA 2C6YA 2X48A 1OCRH 3A3NB 1ITPA 2YBVA 4QWCA 4CDGA 1NPKA 3IS9B 5DM6Q 1WWHA 3HZEA 2J6SA 4A8SA 3CCRS 1RT3A 2CQKA 2A07F 1LUJB 2L3MA 5C2GA 3W5XA 1U2FA 2APOA 4FYYB 4ABZA 4JYAF 4CNZA 4CH0S 2ESHA 3V4IB 4GFBA 2K1RB 5HS8A 3G6EI 5HP1B 3LUYA 4TY8B 4B3RF 3MD3A 1RR8C 1SV5A 2VJUA 3R5CA 3W6VA 4GRSA 1SC1B 3NLCA 1HNXF 3KOAA 2KVIA 2IP2A 4PWDB 4OJ1A 1O3QA 2P7VB 1S9HA 4HF0A 1KA8A 3QT8A 2ASJA 3BJYA 1RT2B 3H1CA 3DKYA 1U45A 3K4KA 4CXFA 3CCSS 2G2OA 4OI6A 5L3CA 1CJVB 1HQEA 1VBYA 2PA8D 4MKVA 4IHVA 1YJ7A 1Y0UA 2VQEF 4RAYA 4HEA9 1IUYA 3FK6A 4YR3A 4I7FA 1T3OA 2FEZA 2C3OA 1R8CA 4ES3A 2HMIA 2BKNA 4AIHA 1M5KC 4X4RA 2CDQA 2F8HA 3U21A 2ZMEC 2A68F 2E1MC 3SCIE 1HNVA 3H3UA 4F0KA 2D41A 2E5IA 3PFIA 3TW0A 3SBMA 4DDFA 3QRQA 1XMQF 3MEDB 1O51A 2V9VA 4XRMA 1HPZA 1F4KA 2BOAA 5F3ZA 4ZPWR 3M7GA 4B08A 1UG0A 2HBRB 3CO9A 1U8SA 3PW0A 2CQGA 3W2WB 4USMA 4ZZLA 2CW0F 4ENOA 1HNVB 3IRQA 4RGSA 1VNDA 4TU7A 4F25A 3HHNB 3QT6A 4MFBA 2M2BA 5IXUA 1X9WA 4LB5A 2FHJA 4ZH4F 1P4XA 1P4AA 4P96A 4X4OA 1YJRA 4M9ZA 1JUMA 2Z2SB 3OFEA 1RTJB 3ROUA 4LFBF 2LKSA 3BREA 2ZXHA 2UU9J 3BG9A 4YELA 3AB2B 2VIHA 4MYTA 4XN3A 5EZGA 2I5JA 1SBRA 1U4BA 1KEKA 2OPQA 2VV5A 2W9AA 4KGXB 3VZIA 2LEBA 3CGIA 1D0ZA 5IFMA 4BBSJ 2EILH 3N6NA 1PYSB 2XLIA 1X4FA 2LA6A 2P9GA 1URRA 1WRJA 5LFAA 1ETOA 1ZN2A 4ENNA 2WOMB 2JH3A 3PSIA 2UWMA 4ID8A 4P7TA 2GWRA 1APSA 4FF2A 5MLCV 4ECRA 3PFOA 3W60A 3DDKA 2QSHX 2O7OA 4UY8I 2IGKA 1HYSA 4ZKAA 2KM8C 3FEXB 3KLFB 5IM0A 1N0UA 3QOPA 4ZMMA 3EVWA 3A03A 3VAIA 2LVSA 3SYZA 1X19A 3MWMA 5KFQA 1XJWB 3B8HA 4M5GA 3C2GA 3BBBA 4L3NA 3QLHA 3ZQQA 4XOPA 4DCPB 1BI3A 2YX7A 3PIOQ 3OHAA 4DSIA 3GZ5A 2R7OA 3RB4A 1JLAA 3VSKA 2LY9A 4QWAA 3HKZA 3K10A 3C3WA 1VQYA 3D1QA 1DUXC 2F4FA 3KLEA 3JYTB 1SL0A 2Y1RI 1RUNA 4ZVFA 5J8FA 1TUWA 3M8QA 4N8OA 1HLVA 1MGTA 1FIAA 1R0CB 2V1NA 4QPQA 4CLUA 1VBXA 4LFCJ 3W64A 1TKZB 2CV0A 1E0EA 1HWKA 5KT7A 2R7SA 1YW9A 4D5CA 5GAGU 1MN7A 2QMUB 2NYXA 3GLXA 4OX9J 1UVNA 1WI8A 5E1WA 4USJC 3BS9A 3UI3A 1FNNA 2MLZA 3HX9A 4OZ1A 1PJ5A 1RR7A 3GB0A 5KT3A 3BZCA 2L08A 4NI2A 2XDVA 2BQ3A 4Y13A 1U02A 1U0HA 4HSRA 1TLHB 2O1PA 2FU4A 3FSYA 2HWHA 4ZPDA 1WJ5A 3GP9A 4DV6F 3TW7A 4UOFA 4RNMA 4JOUA 1S1UB 2B7CB 2QLJB 2HIQA 1LKXA 3QWPA 2DGVA 4J9NA 2XMKA 2FMYA 1SUQB 1ONVA 2CJKA 4PXDA 1W26A 3GZ6A 3H0GJ 4HHHA 5LJ5Y 1N5YB 3OYNA 3MURP 3WX4A 3S01A 3HMJG 1RTZA 2VOPA 3LGMA 5I3QA 1FJGJ 1B99A 2FXAA 3ELKA 1H0MA 4MYUA 2ZBQA 4WIIA 2AP6A 4AUKA 3SSQA 3PO4A 2JA2A 2W2PP 4B3RJ 1RTDA 2PN6A 1MH4A 2M30A 3HT0A 1QVTA 4QR0A 4LFAJ 5A8KB 8AT1B 5KFVA 1JB0C 2H1KA 3AFHA 3E01A 2EK6A 4EFAC 5F1RA 1A6LA 3LSIA 1S5LC 3L4BC 3EE3A 2JC1A 2O61A 3J7ZT 4H4OB 3HSJA 3ABLH 2DA1A 4Q47A 4M9SA 3F44A 3KEOA 1HDPA 5LEJA 5AXKA 3QQCD 4OHWA 2R7UA 1RBAA 3SQOP 1RKWA 4IKAA 1FJ7A 3C8YA 3AL0B 4U9RA 1QGPA 3EM1A 4C48A 3V7CA 2QQ8A 3JSPA 2VBWA 4I0WA 1I6HJ 3CTAA 4CO8A 2GAHC 3HSGA 3JRAA 4I1TA 2YNIA 2W1OA 1YRXA 2OPTA 4J9OA 3MZYA 3SSSA 1SQFA 4RGUA 3HT3A 4NCGB 4ED8A 4JI8J 1S1XB 1QAIA 2HKEA 3KK2B 1MMGA 1IXKA 1S9GB 2STWA 2BVZA 4QPTA 4DF4A 2WTFA 2VKVA 4C9YA 1KU9A 1R8PA 3U9GA 2XC9A 3MEDA 1R6VA 1M1GA 4FKYA 3POTA 1JLCB 4RKUC 4Y33A 3P5TL 2YY3A 2XHKA 1FEXA 1ZS6A 4Y0FA 1LEAA 5HLIA 2JRSA 5SZTA 2CJQA 5JHUA 4DPUA 2AQEA 5IWAF 4CO5A 1R89A 1OISA 4JV5J 3IH2A 4IO9F 2Q1LA 3I0RB 4QW9A 1H9GA 2EFQA 2OPSB 1K1QA 5DG7A 4RB0A 3NNHA 4DPOA 1SH2A 1VK8A 1MMSA 3HHLD 3I5BA 2KL4A 3QWUA 3AT1B 4O3QA 4BACA 2R5ZA 4C2TA 5L3EA 5HODA 4I2PB 2YWGA 3G1OA 1D8ZA 4FT8A 3OYMA 4ETZA 4FNHA 1ACIA 2M8GX 1U2CA 1NK8A 3H90A 3GJTB 2ADBA 4DR3F 1SD5A 2CQCA 1IUFA 1REGX 3GVAA 4BJ5C 3L2QA 2HTJA 4O5VA 2FY1A 5IZHA 4HDHA 4EGYA 2BM1A 4O3SA 5KFJA 3MHYA 3S8SA 2Y0SN 5A2QZ 2CPEA 2QMXA 4HI2A 4ILLA 3QYEA 4GMKA 5LMUJ 4Y2KA 4A8FA 5FB2A 4I6YA 4OZLA 3CC4S 1R0AB 5BYQA 4FISA 1HQUA 1L3VA 1PYTA 2R2SA 2YKPA 5KFTA 3CMYA 4WK3A 2CQ2A 4UY8T 2FVCA 1WSVA 3GEZA 3UDLA 1BM9A 1R0BG 1Y8RB 4P75A 4S04A 1X5PA 4XQFA 1MG7A 4NHJA 1KTVA 4H4KA 4ZP6A 5E3PA 4Q8EA 4KPCA 4YS2A 1I94J 4CYCA 3OTOF 1S4EA 3G1MA 3BPSP 1R6YA 3NCPA 1JLQB 2ZUGA 3H20A 1DY3A 1YBAA 4PXCA 5B0AA 4LLLA 3CJKA 2IEKA 2VJ5A 1NG6A 2XAHA 4IVNA 3N5FA 3CJQA 1UMJA 3L09A 5F1JA 2N3LA 4DGWB 2BE9B 1ZYQA 3MAAB 1ZK8A 2UVUA 2M52A 1Y4ZB 4HNVA 4QIGA 4NI2B 3R5BA 2AX0A 1FJCA 2E1OA 3P8BB 1WC1A 4ICLB 4J9KA 4A5MA 2AD9A 5C24A 2HS3A 3K2YA 3VAHA 3KK1A 1HBUA 4BXFA 2V5HG 3CD6S 5H9FJ 2PBIA 3KX2A 3GTLJ 2HLUA 2E7VA 3ONQA 4ZVTB 1TK5A 4X4PA 4HV6A 2IM1A 1U6FA 1OQ3A 1HBMB 2VFRA 1H8AC 2ABYA 1SKUB 3OHBA 2K7LA 1UAAA 1DBDA 1WACA 3ZQGA 4X64J 2EG2A 4N4OB 3BTCA 3KLHB 1T9WA 3AY0A 2G9WA 1IKXA 1K73T 3KYCB 5EG0B 2KIMA 2WW8A 1G3TA 3BTIA 2HOAA 3O8GA 2O8XA 1KVJA 5FKOA 3CP8A 4KIBA 2VUGA 3M8ZA 1LVAA 3ZQLA 4E7JA 2IAJB 5D3GA 1ZTRA 3JXOA 2GHWA 3LW5C 1RAJA 1RE1B 2KZVA 4BGDA 4C11A 2VQEJ 2VQGA 2V2VA 3WODF 4ECUA 3A2KA 4RBOA 1X4EA 3EETA 2R3VA 5EN1A 3WIUA 4G7OF 3L2CA 3PV8A 3FBFA 3FNNA 4CYCB 3J80Y 5E8GA 3U2RA 5J3LA 2R4FA 1JNZB 1AHDP 5EEHA 2OD4A 4DX7A 2CSOA 2ZB9A 4S05A 4X65F 2P5LC 1U48A 1BIBA 4H4MB 2DA4A 1E3PA 1B64A 2KFYA 3FMBA 1C0WA 4A48A 3IL2A 4BQQA 4GVBB 4LF9F 2UP1A 2ZJQQ 4IFVA 1W36C 2YNGA 4ECZA 1G3OA 2X7IA 3Q2SC 1T94A 4UV9A 1M1KT 1E2XA 3CT9A 1S1VB 1RA6A 4HYEA 3LH2S 4JYAJ 2JLFA 2LC2A 2A1BA 4M5MA 4G7ZF 2NXJA 4NBQA 1YIOA 1S97A 4LF9J 2N7YA 4C8OA 1RAHB 3Q2TC 3AOAA 2DFIA 3PQKA 1OO0B 4QYZK 5LT5A 1X4PA 2DEJA 3D67A 1TR0A 1VF9A 4M71A 3W5ZA 2F5FA 2FNPA 3R60A 2OCCH 5HLFA 4J9QA 4UNOA 2VDHA 3G1LA 4ZVGA 1S7IA 3BR6A 1T98A 2KZGA 2CQ1A 2PEBA 1IM6A 5GADJ 4DBRA 1HPZB 1A04A 4M5JA 2A2DA 2QX0A 1WJBA 4PYDA 3I9V2 5M2UA 4CCLA 4KGZB 4RBTA 4LMZA 1F5CA 5K5RA 3ZR8X 4ZVQB 3LQQA 4HRIA 1USTA 1NJZA 3VZHA 4CM0A 1VTNC 3QYBA 4EI2A 1U0SA 2PJRA 1NU4A 3T1AA 1J7KA 3HP6A 2KG1A 4B47A 2A6OA 5BNGA 1YS7A 1GT8A 4QBUA 1N48A 1FXDA 4LBIA 4NNJA 3AHPA 2ZVIA 3R97A 1WTFA 4QWDA 5L3DA 2DA6A 6PAXA 4PSXA 2PJRB 2HBZB 4PFOA 1GXTA 2RAQA 2CQNA 1BBYA 3TL4X 2DA2A 2DISA 2CNOB 4ZOSA 3Q9SA 2L9RA 1RHQB 3M05A 1O3SA 5HDGA 2D7SA 2KT5A 4ECYA 5F0HA 4E8UA 1GMVA 1WG1A 2MY7A 1Y9OA 4CLFA 3G8SA 2C3YA 4EGZA 2YKAA 5CYVA 1XC9A 3NL0A 2D9OA 3K57A 2ZITA 1IXRC 3H2LA 4CUGA 1TWCJ 3RI4A 5LRRA 2B9EA 3DRRB 4L0ZB 2KDOA 3AQPA 4DYCA 5HP1A 1RCXB 2XGPA 1O7FA 3O8HA 2UXDF 1S1TA 4LIWA 2XRNA 1V3SA 4HI1A 3ETMA 5HROA 2NOGA 2ADUA 1MSFC 2HYJA 4L72B 1ZAWA 3PX0A 3EJMA 2L9SA 2JFDA 1X60A 1JGSA 2PIIA 3BOQA 2ZH3A 5DUIA 3M07A 3Q8PB 4K4TA 1V3FA 4X2BA 3PM1A 2QKMB 2W9BA 4FBTA 2AV5A 2VC0A 3ABUA 4A8KA 1YS6A 3GTOJ 1PJ6A 2GIVA 1OCOH 4G94A 3I59A 1YHQS 3G82B 2EFGA 2YPRA 3M8WA 5CQGA 1DFDA 4ZJOA 1SKWA 2H94A 4CO0A 2JA7J 2Q43A 2KJCA 3PO3J 5KFUA 1IJEB 1ULYA 2FNAA 2CQHA 2LDIA 1SAXA 2AEFA 1TL8A 4YQWA 3OV8A 4QU7A 1PUFA 2YX1A 2KO1A 2ZC2A 3W8PA 4IF4A 3H92A 1RZMA 2DY9A 4I0AA 2EFOA 1MROA 1HIYA 2RSQA 1JT6A 1DGWY 3MKZA 4BS9A 1SFUA 2Z0GA 3HFVA 1RAGB 3E51A 3F73A 4P73A 5LMNJ 1FDAA 1HI8A 1SJ3P 5C25A 3JQKA 4BYYA 4EZ6A 1HOMA 2BW2A 3NRBA 3BB5A 2EFVA 3BTLA 5CYMA 5HSPA 4DQSA 2EA4A 4B3MJ 5FIIA 2O8KA 3HD1A 4ELTA 1F9HA 4CYUB 1FMVA 1RHKB 3GG1A 4GYIA 3LQVA 4WFNQ 2DTJA 2QLXA 1B0VA 1VDHA 4ZLJA 2DK2A 1JT0A 2TCTA 4M3BA 3EZ5A 3KP5A 3FZBA 3MAHA 1RWKB 4QLCU 2HQ3A 4AC0A 1K0VA 2BHYA 1WSRA 2XZWA 5AT1B 2MLXA 4RW9B 1XR5A 2NPFA 2C2DA 2POKA 3VPRA 2W7OA 4NCAA 4X4TA 1TFWA 5E33A 2ZJRQ 2H1YA 3AA9A 1GLNA 4M8LA 1JXVA 2L2OA 1RXOB 4OMYA 3WE3A 1VQ4I 2D69A 1EQMA 1HA1A 1YI2S 5D4NA 4CLTA 4TXSA 3OL3A 2DYRH 1T33A 3FXQA 3M8QB 2I5UA 3HVTB 1NG7A 1I1GA 2OFHX 1K44A 3K5OA 3T1YJ 3IA0A 4LD5A 1S4FA 1FWPA 1QUVA 3DU5A 2J6TA 2WB1A 3DCAA 5AXNA 1S9EA 3MEKA 2WB1D 3DP7A 4KUMA 3CJRB 3ZQ7A 2RH3A 1FTRA 2X4HA 2G0IA 2NZCA 1M1HA 4DU7A 3P9CA 2W9CB 3OYBA 3T0YA 2LQ5A 5KT6A 4LQ9A 2LF8A 4E98A 1K4TA 1XNQF 1TMMA 2J5AA 2NOJB 2CQ0A 4A8YA 3RRHA 4A6DA 4EU0A 4KMUX 1JXSA 1R23A 2CWKA 1QPIA 2VE8A 1JK9B 2DCUB 3UDVA 2Y0MA 1BW6A 2L9WA 4YB1P 5DD8A 2E5ZA 5LMNF 3B78A 3OFHA 1OJ4A 3DLKA 2F4MB 2AEJA 3F41A 2KI2A 4DZDA 2ZO4A 3TARA 1YDLA 2OEKA 3J7ZI 3U1MA 2IBDA 4BNCA 1H89C 2DK5A 1BD6A 1T2KA 2FQ3A 3IAM2 4USUA 3M1VB 4ZHRA 2QSFX 1MSWD 1WNEA 1U8RA 2QFJA 4C3KA 4KNYA 2CGPA 2ZD1A 5L3BA 4RU2A 1HC8A 3GO5A 2GIQA 3DQVC 2QBYB 3EYYA 3OYIA 4ZTJA 1R4MB 5HLTA 1S6PA 3EPGA 3BQ2A 4FYVB 4ZS6A 1N0VC 5KG6A 2HS4A 4C2UA 3NQOA 4IR9A 2HRUA 3CZ6A 3OSNA 3T1HF 1UP1A 2AHOB 1R4NB 1CJKB 4DV5F 3SV4A 1VQPI 3QJPA 1Z2LA 2W01A 2E5HA 2LP4A 1IR1A 1IO2A 4QWQA 3HSEA 2DTRA 4U6PA 2LKZA 4GXOA 2BV6A 2VE9A 1D0XA 3KUHA 4OX8A 5GMDA 3ASNH 2CIMA 1EV7A 3JTNA 2K2PA 3D5SC 3D5RC 2ZUAA 3QRPA 1RGVA 3GU0A 3G6YA 2H9ZA 3PHEA 4QPXA 4IH5A 1D9DA 3DRPA 1BC6A 2KDZA 3ZMSA 1RIOH 1I6XA 4HDVA 2QWWA 5B5EC 2MH9A 2FJBB 1J5EF 3I4NJ 3I5UA 1VLOA 2VODA 2RRNA 4ZP9A 4GC7A 1IBKF 1YLXA 2JEGA 2JUCA 3WU2C 4F0HA 1RWPB 4A3CJ 4FN5A 1N78A 3I55S 2GX8A 4WWSA 1D9AA 4EJOA 4GKJJ 2AJ1A 1QPMA 4MIWA 2CUYA 3IN5A 2X0LA 3DKXA 4KV8A 4DR1F 3RBEA 2DGSA 3P9KA 5AE2A 1OIAA 1V5IB 1ZGJA 1UTAA 2HZCA 5J1YA 4BEHA 1B4AA 4ECSA 3BR2A 1RU2A 2LKXA 1LFWA 5KFIA 5B3SH 2ZHBA 3A01A 1X4BA 3TUZC 1H0HB 1T02A 1YSJA 3QFHA 2ELKA 4LF7J 3K1NA 2A6EF 1VQ6I 1DTTB 3CO7C 3H3VK 2WONB 1MSEC 2FJAB 4ECWA 4J00A 1SMTA 2ZJQF 3IUOA 5D8KB 3U7JA 2V8VA 5E3RA 3FMWA 4M1KA 3ISPA 2LKPA 3F22A 2U2FA 3WTWC 3PRVA 3BO4A 4UY85 2VF3A 1GXPA 3I0SA 3LSJA 3G87A 5ILUA 4P9SA 1ZZFA 1VGYA 3PR4A 1N6QB 4Q44A 5GADI 3ELHA 1P92A 3KK3A 2XY5A 2L9DA 4BQOA 1QVFR 4WP3A 3OVBA 2MHEA 1X3WB 1HBNB 1BY9A 3VAMA 1F43A 1NSKL 3QMQA 3S1QJ 3L2VA 2W24A 2ASLA 1TL7A 2Y0BB 1VFJA 4NLWA 1XMKA 2MXYA 5AE1A 3CLQA 3A13A 1ETYA 1DLOB 3LWLA 3CCTA 2ESNA 2PEXA 5IT4A 4C30A 1QO0D 1H73A 4IOAQ 3ERED 3VAJA 2HS5A 1P9YA 3EXCX 3K5PA 3CF2A 2EWNA 4C3LA 1H2TZ 1M5VC 3V6DA 4MK7A 2W7PA 4L75A 2VFSA 2FF4A 1FRKA 3W9IA 4HH1A 3RRKA 2UUZA 1VQLS 5CZVA 1B9MA 1YTYA 4JI4J 1F9EB 2HBQB 3HHLB 2FUG9 2XS2A 4P1WA 1JKOC 1DTQB 3EX7B 2L54A 4KH0B 1S3JA 1YJVA 3AAWB 5L1KA 1BWVA 1F3FA 2OQRA 2IM2A 2C2MB 4NXMF 1C1BB 1PYOB 2R8JA 3VYRB 2AYEA 1H72C 2DDAA 2EK5A 4DN0A 2E35A 2UUAF 5E3LA 1C4CA 3DMJA 1WEZA 1BL0A 3KLHA 3FUYA 3RB3A 2CU7A 1MD0A 4AYBD 4F4YA 3E6DA 4FE7A 3M4XA 4Y2AA 4PUOA 5IM0B 4AT1B 2OUMA 4OHYA 1B70B 1UVIA 3KLNA 4ZJQA 1OS5A 2L7KA 5EGOA 4LB6B 1TP7A 3MM5B 3TQNA 2HKXA 3OR1B 2B0LA 3M2RB 3PNTA 2CPFA 2FTRA 4O3OA 2JUGA 3UD4P 1OY8A 1K78B 4XL9A 4RW7B 1RNLA 4UTGA 4G7HF 2CJJA 1F6TA 2P8TA 2BRKA 4N9IA 5F8JA 2WVBA 3KLVA 3MUVP 2OD6A 3P3DA 2Y1LB 4E7HA 3W62A 2CA9A 2FGCA 2XMMA 2HVRA 4DL2A 1D1UA 2Q2EA 2NNNA 4JI5J 2QSGX 1RC9A 3TOQA 1HHTP 4DV3J 1T03A 4ED5A 1F5TA 3DBLB 3QJJA 2IT0A 3U27A 3HTUA 4B9MA 1YOVB 2HRYA 3OYLA 5LEKA 1LFPA 4QR2A 4ESJA 3DDIA 3V6JA 2PFDA 3J7YU 4U88A 1U1PA 4C97A 5RUBA 2GBYA 2UUWA 3VODA 1T6SA 2I8EA 2FY8A 2YQ0A 2WAQA 1VRUA 2EKYA 2GFFA 3MM9A 2IRFG 3V5RA 2J8SA 2ZHAA 2EK1A 1W0TA 1G2EA 2F4OB 5FKMA 5HANA 2PMHA 3EDRB 3CJTB 1DQAA 3Q0WA 2QYCA 5M5YJ 2W8KA 1VC0A 1VRQC 3SFZA 2VKHA 2GXAA 1IWAA 1Q4RA 4Y52J 2XAFA 1V3RA 2F2EA 5FD5A 2NCKL 4ED7A 1JJ6C 2H51B 4O0NA 5IYDJ 2BA9A 4L9JA 2FQQB 4GO7X 2FBKA 3MPVA 1VQPS 2WA0A 3VGSA 3PEJA 3OW2R 3QP6A 3WTXC 4UUSB 2LBFB 3TBIA 3R6LB 1QSLA 2DIVA 1QE1B 1IJWC 2CXEA 2MMYA 1XB4A 3D66A 4CO3A 2VG5B 3MMAA 3GR1A 4K4ZA 4A2UA 1SI9A 1XR6A 1H7WA 1EZZB 3HVWA 4DZJA 2HNZB 1LE8B 2B9WA 2OTJI 1WI6A 2EFNA 4UXNA 2ETHA 3J7AY 2I9SA 2K9LA 4RLFA 3TI0A 4LRBA 1FWZA 4I4BA 4ES2A 2DHXA 4XORA 4IX7A 5HJXA 1FX7A 5HQ8A 2LG4A 1OKRA 4ZCLA 2G0JA 4RWXA 1K6YA 1TV6B 4M5DA 3DGPA 1J27A 2CQXA 3FRZA 3OWTA 3ZQIA 4TNOA 2IA2A 2ICWG 2LXUA 5BJRA 4MK9A 2AZ3A 1U2RA 2MKHA 4RW8B 2AHQA 4M5IA 4DG1B 2PI0A 2ZXWH 2W9CA 2B9YA 2MGQA 3KNGA 1QU3A 3GSDA 1F1BB 4ZJLA 3CVKA 1JLBA 1IQTA 2DMUA 4KGKA 1RT5A 1TNTA 4LRFA 2DXIA 3JRGA 3GTKJ 4P2MA 2RQCA 3G96A 3ICLA 3OYEA 4B3OB 4J19A 4Y2CA 2G2ZA 4MEXF 1M0SA 1O3TA 3WGIA 2JQ7A 4XKVA 5E41A 2OMOA 4CHUA 2YSRA 3IS9A 5KAFC 4K7QA 1SJFA 4DMZA 1RTIA 4ECXA 4DPXA 3LAMA 4OJGA 3MUMP 5L1IA 4PGHA 3AG1H 3LA3A 3ERMA 4EO8A 5J1UA 5AONA 3G4SI 3OTDA 3K89A 2HG4A 3BBFA 5K5OA 4FXDA 4IEJA 2DHAA 2LRDA 1U1LA 1X4CA 2QL7B 2UV8G 3J81U 1Q86T 2ZXIA 2LECA 2FIUA 4LK0F 3NBPB 1KVKA 2YQ1A 1CPZA 5F41A 3HOUJ 3LL7A 5J1NA 2G13A 4LFUA 5LGNA 3Q23A 5E20A 3RJPA 4KMFA 1RABB 2F5GA 3QAHA 2VU5A 2EZKA 3JB9k 5DZ7A 4WCEQ 4K0KF 2DR6A 3V6HA 2CWXA 1JKRC 1TL4A 2K7KA 2VT3A 2V1XA 5DS7A 4LF6J 4CO2A 4IZZA 1ELOA 4M6XA 2JVGA 1CBKA 5B7WA 1K9MT 2VONA 4J9UE 3HM9A 4ASNA 1ZR4A 5IPAA 2XIGA 5FLXY 4HLBA 1HQCA 3SDBA 2B7EA 1SC6A 3DFGA 4ICLA 9ATCB 3ZZPA 5KFAA 4DX6A 4G3IA 1TWFJ 1L3SA 1PUFB 1S72I 3K7RA 2Y48A 2F6CA 3B4DA 1VQLI 3F56A 2AEMA 2H5JB 3J80Z 4FNIA 5LOQA 1VI0A 4I2QB 1Z67A 2L9VA 1EH7A 2CVIA 2DA3A 2FD2A 4V2FA 1M5HA 3LWFA 5CZXA 3HYIA 2NREA 1A0OB 2CYYA 5K14B 2L48A 1WCMJ 4EBDA 2MA3A 2OEMA 2HFZA 4NXNF 2N8GA 4JI6F 3OYCA 2HVDA 2XI3A 4PXBA 3G6XA 4Z7YA 3GYXB 5E5NA 4EMDA 5B08A 3HL2A 4DWIA 2JSXA 4ID5B 1XQIA 5A6WA 1VCTA 3DXSX 3K6GA 5J6XA 2AO9A 4DSEA 2ZC4A 1S9FA 3CSKA 2D3OR 2UVRA 3Q8RB 2ALZA 4E7SA 4W4MA 4QIEA 1VC6A 4N76A 1KU3A 1X3ZB 4C3MA 1TV6A 1IBKJ 4QZVB 4I2PA 3TAMA 4EUVA 3A0HC 1V5VA 5CLSA 1FOKA 4L74A 4CYDA 4RW4A 3W3CA 2FC8A 1CULA 1RAIB 1PP8F 4J9MA 1TC3C 1XMBA 3ITHB 3EUKL 2UU9F 5CCMA 2XAQA 5DV5A 1CJUA 3M7VA 2MJUA 4RW4B 3C6TB 2CUEA 1RWNB 1WJCA 2XGDA 2M0GB 3PEHA 1EAYC 4CNYA 1LDKB 4N4NB 4JI7J 1X1PA 2QLZA 5EF6A 4DCJB 2P8IA 3W9HA 2HVEA 4RNFA 5CJ9A 3I9V9 3TEGA 3J7YJ 3SV3A 4HA8A 1W5CC 5B0GA 2BHZA 4IR1A 3JSYA 3Q83A 2ATCB 2RUGA 5FLXZ 4B3SF 2HNZA 2BE5F 3FBIB 4WIQA 3MM6B 1L5UA 3BSOA 2HNYA 1L3TA 4ZCIA 4IRCA 4F2SA 2OGUA 3DHWC 1YJWS 1MZBA 4CLKA 3VWBA 1VQ6S 5E3AA 4XPEA 2QA2A 3I0RA 1OR7C 3MPWA 1S72S 2PI4A 4USKA 4X1EA 2Y9YA 4ZHRB 5J2QB 4QYRA 3ILJA 4EWTA 5C42B 3EVMA 3MXHP 2XYHB 3HKZD 3S14J 1D8YA 3FBBA 2L7FP 1NDKA 1HMVB 2BJ3A 4I64A 1RWOB 1IXCA 3B73A 4OV6A 1X4GA 2IDLA 1NSAA 4JI6J 2UZAA 1C1CA 2LDYA 5J1EA 1GVJA 2Y9HA 3CD5A 4M5KA 1N5SA 2DRAA 2RF2A 2MJNA 4X65J 3I9ZA 3CDLA 2GGPB 2PO4A 4E0DA 2MSYA 1WZ2A 1WDDA 2EINH 4XIUA 1REVB 1X7VA 3ILIA 3I6PA 5KFWA 1XDUA 2M5WA 1IN0A 5E17F 2CKWA 1I94F 3TP2A 2YKMA 3SZ2A 4KYZA 2KXHA 5D78A 1ETWA 2ZD1B 1BC8C 3MD1A 3IWZA 4DR4F 3FFIB 2E60A 3QIPB 2K7JA 1RB0A 1TQMA 3Q3SA 1NBEB 2VKRA 4DU8A 2UVVA 3F8FA 3FF5A 1Q5YA 2DYAA 3OYDA 3PXGa 1S1UA 2Y3YA 1FT9A 3WGGA 1ORKA 2DW4A 3CMMA 2LEAA 3I3LA 1X2NA 1HL6A 1UEUA 4CO1A 4LF2A 3MZIA 1FVQA 4BC9A 2HU9A 4M9XA 3NBPA 1G3YA 4HQEA 3AOBA 3M8PA 4K4VA 2K06A 3LSRA 1ZZNA 3HK2A 1TT0A 5F64A 2MBFA 3W65A 1SJRA 3JAMU 5EX3A 2HHXA 4Q0BA 2FPHX 4ANCA 5E18F 1ZQ3P 4ED3A 3PKMA 3L7WA 3SCKE 2IS4A 2JEIA 3M2RA 3FIWA 2PC6A 2MH2A 2WZ1A 1H7XA 3E3VA 1Q53A 3BLYA 2O3FA 1IDYA 1M5SA 5KFBA 1N32J 3FBEA 4FS2A 2BZTA 4KHMA 2KH9A 2XAUA 3HHDA 1Y1VJ 3HC7A 1VRTA 4K8RA 2NS1B 2QLFB 1JKQC 2KRCA 4B3TF 4V19X 4J91A 2MKKA 2HFUA 1IBLJ 1VFCA 2MQLA 2HOEA 5HN0A 4B17A 3FZVA 4DPYA 2ZH2A 5EGYA 5DYMA 1U78A 1WEXA 1G59A 3MAAA 2U1AA 3N97A 3V7RA 2HWTA 2FJDB 2DGXA 4U7UD 1WC4A 2KHMA 9RUBA 1NB7A 2VPZB 3F6VA 5ED4A 1H2VZ 2JSCA 3GIKA 4EJWA 3F3XA 3VDXA 5GAGI 2DQRA 1ZTWA 3HTSB 1GV2A 3A01B 2ZCWA 5L1LA 2HVHA 2GXGA 2E2HJ 5LSLA 3H5AA 1RUOA 3SQGB 3G4SS 3Q5FA 4RW8A 3ZXWA 2HLTA 1Y6IA 3AL0C 1PIEA 2ROPA 5LSRA 1WKMA 4DUZF 3KCCA 5KG4A 3AJ1A 2FJ1A 2H4WB 1WUUA 1JE8A 4O4RA 4AE5A 4R79A 3NGKA 3DEEA 3A0BC 5EJCA 4TKTA 1WJDA 4A3KJ 4F91B 2O66A 3J80U 5I3PA 3TOAA 2BQRA 3M8JA 2E36A 2H65B 3WHCA 2WOMA 2WRMA 4P9FA 2VFVA 3OR2B 1KHVA 2LREA 1UHWA 2XROA 5IT3A 2DOFA 3F8NA 2CFXA 4PCQA 1NB2A 3KZZA 2LP0A 5JMNA 1S1WB 5K5MA 2UV1A 1Q8BA 2HHHF 2BJ8A 2XYPB 4HV5A 5E1XA 2ATLA 4BL0B 5ICCA