2CG4A

Structure of e.coli asnc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN ASNC
publication title Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cg4A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cg4A02
5BMZA 1UHMA 4HYEA 3E97A 3FXRA 1TQIA 2QM3A 4HX4A 3ABUA 4HV6A 1HKSA 1DPUA 2LNBA 4D0PA 4EJVA 4QLCU 1ZN2A 1ZH5A 5BPDA 3CUQB 3PFIA 5K1YA 2KIMA 5BOXA 4ZYDA 1IN8A 4AIKA 2MC3A 2H27A 1XGNA 1TQPA 4HDVA 4R8HA 1RNLA 1TQMA 1BI3A 1EH8A 4IRHA 4ESJA 1K79A 1B9MA 2FXAA 1XN7A 2FNPA 2V6CA 3WTSC 4A0YA 2G9WA 2JSCA 2DQRA 2ELHA 4I98B 2XKPA 4ZH4F 1MJ9A 4HDUA 3KP3A 5H6QA 1J2XA 5CVIA 2QBYA 2DK8A 5IT9Z 1FBQA 1RZ4A 4RS8A 1SMTA 2VC1A 3F3XA 3E5QA 3VODA 2DBBA 2Q8KA 2XGXA 4YFNF 1SD6A 4HLXA 4A0XA 2Y75A 1ZG3A 5CVUA 1J59A 4MEYF 4G6DA 2FEZA 2UWMA 2EK5A 4RB0A 4BQAA 1XSDA 2FE3A 1HKQA 5D5WB 5JVTA 1F9NA 3KZYA 2QENA 3BROA 1QQIA 4CO8A 4Z2YA 3CUQC 2M30A 1BC7C 3RPQA 4UVAA 4Y13A 3V8KA 4KIFA 2M5WA 3GFJA 3HUGA 1P4XA 5DUKA 2ZKZA 3KP4A 2Z33A 4I2OA 1MD0A 2BV6A 4EV0A 1DP7P 4AIJA 1IXSB 3IWFA 2P5LC 1PUEE 2CO5A 4KT5C 3TDUC 3N4MA 1FZPB 2KJCA 2W57A 1P4WA 1WQ2A 2GA1A 3VB2A 4A12A 4KN7X 4DNCA 4GCVA 1ZRFA 2XROA 1FP2A 3CJNA 1IZ1A 1MJAA 5E20A 3HSRA 1YS7A 1I6XA 5LRRA 2IT0A 2STTA 3L2CA 3KCCA 4I0AA 3F22A 1G3WA 4EMSA 3ISPA 3JTGA 4EM1A 1S7OA 2X0LA 4UXNA 4L9NA 4WXDA 2P6SA 4LLLA 2P6TA 5CVVA 5LBQA 4YFXF 5JI6A 1O3QA 1P2FA 4L18B 3IKVA 3H92A 1VTNC 5BS6A 5ICGA 3QU3A 3CO6C 4YIIA 4XSXF 3OOPA 1YQAA 1BBYA 2ESHA 1Z6RA 1KGSA 1U5TA 2O3FA 5E1ZB 1QBJA 1I1GA 1J0RA 2KIUA 1JXSA 3JAMK 2E1CA 1KYWA 3QU6A 2B0LA 4YFKF 1SFXA 1B6AA 4LLGF 2A07F 3V7SA 2ISZA 1FPQA 3WTZA 5E8GA 1MDMB 2KKOA 2NNYA 3WU0A 2K02A 1BI1A 2HWVA 3K69A 1XGOA 5D6EA 2WC2A 3R60A 3WTUC 4EGZA 3O3KA 4Q5SF 1R1TA 2EFQA 3FXUA 4B09A 1KQ0A 4XLPF 3HRSA 3K1MA 2O61A 3WTTC 4G8XA 2DLLA 1QO0D 4G7OF 3RKXA 5D8LB 2FSWA 1ZGJA 2NYXA 2VOPA 4RB1A 5ILUA 2ZO4A 1TTYA 1YYVA 4XBFA 3U9GA 3J81Z 2ZNZA 2OZUA 2DT5A 3GX4X 3GFLA 1BIBA 2P7CB 2VT2A 5H6RA 3FXQA 3Q9SA 1JHHA 5HDNA 4AWXB 2D2WA 2GXBA 4NQWA 2Q2EA 5J6XA 4U0VA 2K7LA 2DO7A 5DD8A 2VN2A 3BJOA 3CO7C 2VXZA 3KEQA 2GQQA 1UCRA 5CLSA 4HQMA 5ILSA 2XAHA 1YFHA 2IA2A 3E3VA 1HSJA 3KEOA 1YW9A 2AS5F 3BJ6A 1EV7A 3LA2A 1IXRC 2BE5F 1U8RA 3MWMA 4JK1X 3GFIA 4U7BA 3J80Z 2VE9A 1EH7A 3LWFA 3FM3A 4N9HA 5K5OA 2ZFWA 1T0FA 5HDGA 3DF8A 4EGYA 4M72A 4N0BA 2M8EA 4AIHA 2L3DA 2F5FA 1QZYA 2ZBCA 2G7UA 4M71A 2ZJ2A 2J5PA 5K5QA 2IVMA 2OQRA 3KE2A 3MEXA 1ZG5A 1HBXG 5BQTA 5LEKA 5E17F 2VC0A 3BOQA 4PGGA 1FWZA 3R0AA 2NS0A 3H3ZA 1XSVA 5HDKA 1G3YA 1BM9A 5CVJA 1A04A 2R3SA 5LHHA 3ML6A 5DV5A 3F8CA 4L0ZB 5A2QZ 2ETHA 3T1BA 3ZMDA 4OMYA 3TOBA 2OAZA 5TJJA 5L3EA 3RYPA 2XASA 3RI4A 4I02A 3CUQA 1WSUA 2ZXJA 2VBWA 2FA5A 1O3RA 2MBFA 4PDKA 3KP6A 2UXXA 3E6CC 2RVCA 2DK5A 4EJOA 4G7HF 3IL2A 2JSXA 4CYDA 4FX4A 1B1BA 3DPTA 2MD5A 3R4KA 2L02A 1T38A 4ON0A 3MQ0A 2A6HF 1LQ1A 3BJAA 4KMFA 4BNCA 3O2PE 1MJBA 4LK0F 2H6CA 5AIQA 2WTEA 4WXHA 4EJWA 1DPRA 4O6JA 5HVQC 5D5UB 1G4DA 2V1UA 2M87A 4CHUA 2V1DA 3GO5A 2XKOA 1YW7A 1XCVA 3HSEA 3V8JA 3HRUA 4K2EA 5LGNA 1Z91A 2RN7A 3ZMZA 3TO6A 5AIPA 4OU0A 5F64A 3E5XA 4L5JA 1B9NA 3L09A 2A69F 4HW0A 4CZZA 1J7KA 2ACJA 1HKTA 1KQ9A 2XV4S 3V4GA 2LF7A 3CLOA 1S29A 4UNOA 4P9UA 2IJLA 3I5UA 3LQRA 2YPRA 3QPHA 1D5VA 2MA3A 3TKYA 3WTYC 3WE3A 2GA2A 3LA7A 1Z05A 3ELKA 2K4JA 2OZ6A 4CICA 1OYYA 3LFKA 3K9TA 3WGIA 1BJAA 1IN6A 3PQJA 4GYIA 3B02A 3EETA 3ZP5A 2D1VA 5L3CA 4O3MA 4M9XA 4MTEA 2M1BA 3WODF 3FX3A 2PLYA 2YSRA 3TOAA 2A61A 4EQQA 5FFXA 3EDPA 4A5MA 1IN4A 1L3LA 5BPIA 4ZYEA 1XCBA 4AVPA 3QP6A 4ENKA 1OYIA 4N9IA 2V9VA 3T0YA 5E8IA 4HOBA 1MKMA 3JTHA 5DD4A 3E6MA 4FHTA 2ADUA 2WWYA 5DCMB 1FOKA 2QVOA 4KICA 3CDHA 5HOOA 3M9AA 2TDXA 3VEPA 3G73A 1ON1A 3E6BA 3ZMUA 5F1RA 1TNTA 2W24A 3CUOA 3TO7A 2FBHA 5HS9A 2CFXA 1U2WA 4OIOF 3ZMVA 3ECHA 2KRFA 1W4MA 5ICCA 1IRGA 2X4HA 5D8KB 1GVJA 3N97A 2HZTA 4S04A 2FRHA 3SHFA 3KZZA 1IN7A 1SAXA 4KNYA 4HV5A 4JQFA 3IRRA 4IPAA 4HLYA 1R00A 1YO5C 3GUDA 2FNAA 1T39A 4G94A 1J9IA 3F6VA 1BI0A 1LDKB 1YIOA 1MDMA 3I54A 1W7PB 5FFZA 1XD7A 4ZYGA 3GVAA 3ZMTA 2PI0A 2XVCA 4NB5A 3BPXA 2IP2A 3P7NA 1KU7A 2L54A 4KFCA 1I5ZA 1PP7U 2XAGA 3F8BA 1P92A 2HTSA 1HW5A 2H6BA 1K7AA 2VBZA 4UUVA 3GFMA 3H3UA 1H9GA 1B4AA 1USSA 3RJPA 2P5KA 3ZN1A 1BIAA 2BYVE 1IN5A 4H0EA 2DU9A 3QRFF 4M6XA 1ULYA 4LK1F 3I4PA 2H94A 1TW2A 2OU2A 4A6DA 4EM2A 1EH6A 3MFKA 4ZZDA 5J8FA 4I01A 2W25A 5HLHA 5L3DA 2EV5A 2Z99A 1YW8A 3R6SA 3SFZA 3WE2A 1FBSA 1LDJA 3GZ5A 4MHGA 1K78B 4A6EA 4TV7A 5LHGA 1SFEA 2Z3YA 3EUHA 1GXQA 1Q1HA 2HOEA 4MEXF 1YG2A 3ULQB 1R5HA 2KIFA 3T8TA 4LG0B 2A3SA 4HA8A 2PJPA 2F2EA 3RKYA 1RIOH 3WTVC 2O03A 2HKXA 3DXJF 3DP7A 4YIFA 1V4RA 3GYHX 2D1HA 4OIRF 1QGPA 2OBPA 1NHAA 4G7ZF 2A5YB 2EFNA 1PDNC 1JGSA 3GW2A 4U7DA 4L9VA 3L7WA 3CTAA 2QUFA 3JAMZ 2DI3A 2MH9A 4EJUA 3QOPA 3F8FA 4L5IA 2O8XA 1DDNA 1OKRA 1E2XA 2BGCA 4R1HA 3SZPA 4GO1A 3DV8A 3F72A 5L3BA 2QQAA 5ILVA 3BPVA 2JT1A 4IHTA 3KETA 4LGWA 4ZYHA 2LSOA 3GLXA 3I71A 5TRDA 1FSEA 1FC3A 2F5CA 1AWCA 1F5TA 3GWZA 4MGRA 3RYRA 4L9TA 2D45A 3D5LA 2XRNA 2IRFG 1R1UA 2LF8A 1W5SA 3HHGA 1SFUA 1HQCA 3IWZA 4Q48A 1V3FA 2JZYA 1KU2A 3IRQA 3EQLF 1MZBA 2Z5UA 4L0YB 4KDPA 2E1NA 4RAZA 5HLIA 2VODA 4OINF 3RTRA 4HF1A 2V79A 3B73A 2CQKA 5LGUA 2BEOA 1HSTA 1T6SA 2RV8A 3JW4A 2HS5A 4KIBA 3K1NA 2K4BA 1D8KA 4LB6B 1FSHA 3TQNA 4EVIA 3GZ6A 3W6KB 4I0BA 2FOKA 4RGXA 2AXLA 4ENNA 4B8XA 4HZFA 4RGRA 3R61A 2STWA 2W85A 3FM5A 2HR3A 4WX9A 2NRAC 4I09A 1WWXA 4EJTA 3KP5A 3SXYA 3LQQA 2F5EA 2RNJA 3S2WA 1ONVA 2FBKA 3I0TA 1JHFA 2O0YA 2VONA 1SD5A 2EFPA 3K1PA 3U2RA 3GEZA 4L9JA 5CYVA 3M8FA 2J5OA 2L4MA 4AD9A 2NAZA 3WTWC 2P5VA 4ESBA 2ZMEB 1KYZA 4CGZA 3V7CA 1OYWA 1G6NA 3LAPA 1S3JA 1XDUA 5FLXK 3FMRA 2PBIA 1TBXA 1B59A 1F4KA 4LJZF 1TNSA 2M45A 2RQPA 1IW7F 2Y48A 3TO9A 2ZCWA 1O7FA 2DFIA 3FMQA 4U0YA 4MQVA 5CJ9A 3KFWX 1FT9A 5DDGA 3BWGA 3F21A 5DCMA 1W7PD 3MCZA 2CVIA 3WGGA 3JSPA 1Z1DA 3ABTA 4HX8A 1SD4A 4LLNA 3RKWA 4QWQA 1ZGAA 3KLOA 2XUBA 3REOA 2BBYA 3WG9A 4CXFA 3T5XA 3IKTA 2EV6A 5HLGA 4UVBA 1PP8F 4A0ZA 1IUYA 1HW1A 4IF4A 1XB4A 1FYLA 2IA1A 3NEUA 4IRIA 1LB2A 5IT3A 4G6QA 1ZRDA 1O57A 1S7AA 3MZHA 2RGVA 2EA2A 2NNNA 2IA0A 1G3SA 1Z6TA 5AONA 2HYGD 5EEHA 2VBXA 2IW5A 4S05A 4BHCA 2FU4A 1W7PA 5FD6A 1QZZA 3ZN0A 2XHKA 2CWEA 2Y0MA 1LJ9A 5CVRA 4CDGA 3G3ZA 5D5VB 1P4AA 4Q4ZF 4LMYA 4FX0A 2CYYA 2GXGA 4ESFA 4UVCA 4ZZLA 1OR7A 2O6GE 2RKHA 1ZYRF 4ASNA 2YX4A 4MTDA 1UHWA 2RC4A 4KN4X 4ETSA 4RGUA 1ZRCA 1OPCA 1S8NA 1TW3A 3F8MA 4WK8F 3C7JA 3DQVC 2DAOA 4BH9A 1YTYA 5DYMA 4M73A 1FY7A 5FD5A 5E18F 3E5UA 2EJRA 3SQNA 5FGMA 1Z9CA 2F5DA 3U1DA 5FO5A 4NHJA 2P8TA 4P55A 1K78A 2Z4PA 1CGPA 2A68F 4UV9A 4WXCA 1FNNA 4P96A 4WCGA 4IVNA 2JTVA 3Q5FA 4MNUA 3ZQ7A 2ZBKA 3ZPLA 3LAJA 3HOSA 4LG0A 5IT9K 5H20A 4HF0A 1JE8A 3BP8A 4U88A 2FBIA 2QQ9A 1RUNA 2GZWA 1SMYF 2VT3A 3LA3A 2Q0OA 4KA4A 3M7GA 2Z9OA 3M1EA 1YLFA 1CF7B 2E7WA 1R22A 4F7ZA 3I59B 3KP2A 1I1SA 1Z7UA 1IAWA 2GWRA 1LDDA 4KIGA 3J7AO 1D3YA 4RGSA 3KLNA 2DPUA 2XAFA 1ODDA 1IRFA 5JFRA 5E1XA 3BDDA 3T8RA 3HYIA 2WV0A 2EB7A 2K27A 3ZMSA 5J8CA 5JHUA 2FMYA 2ZNYA 2ISYA 2EV0A 2LDUA 4GGGA 2PQ8A 2DW4A 3FWEA 3C18A 4ENJA 3GXOA 1WI9A 4OIPF 4GYGA 1ZG1A 3HTSB 3DKWA 5JR3A 2GIVA 1KA8A 3V8LA 2P7VB 2HQRA 3BZ6A 2L01A 2DQLA 1XMKA 2CG4A 2KJBA 1RI7A 1LEBA 2DJWA 3KP7A 3EYIA 3ROUA 2PFBA 4Y15A 3TGNA 2G7HA 2DTRA 4LB5A 2FF4A 2PEXA 1L0OC 4E70A 3IC7A 2CSOA 1YS6A 1USTA 5LEJA 1OMIA 1RUOA 2QBYB 1FP1D 3VFZA 4PZJA 1XGSA 4IRGA 1O7LA 2E1AA 2COMA 4LFUA 1XDSA 2HDCA 4XLNF 3MZYA 2RDPA 4XRFA 2FQ3A 1R1VA 3M8EA 2YX7A 1WRJA 4XSZF 3F6OA 3O6BB 1I27A 1QNTA 3Q9VA 4HBLA 3R0JA 5D5XB 4UHTA 1AOYA 2OQGA 2HFHA 2HKOA 4RAYA 4HAMA 1FYMA 1O3TA 1BC8C 2H09A 2HGCA 5L3FA 1J75A 1XMAA 5KK1A 4HQEA 1G3TA 2XAQA 5FB2A 2YR2A 2ZMEA 5DUIA 4P9FA 2PN6A 1KU9A 2XAJA 1LVAA 2HTJA 4KYWA 1H9TA 3DFGA 1SD7A 1IXCA 3J81K 1DUXC 1KQ8A 3BY6A 1T2KA 2PG4A 2L4AA 3COAC 3MAJA 3WGHA 4OIQF 4BHBA 4IXAA 3K0LA 4UV8A 4U0WA 2UZKA 2HYFA 2QLZA 4Q47A 2JRTA 2VBYA 1ZLKA 3TDZC 5D4RA 4HF2A 1ZHFA 2QQBA 1UFMA 1R23A 1LEAA 3RPUA 2HEOA 4PGHA 3HHHA 4WWCA 1XSXA 2QWWA 1GHCA 4M74A 1LNWA 1F1ZA 2IPQX 2C6YA 1O3SA 3HOTA 3J80K 3ERED 5LHIA 3NRVA 3RIRA 4A2UA 2MH2A 3PQKA 4RB2C 3I53A 5E1WA 2QYOA 3HRMA 2V1XA 1QPMA 1U5TB 4M6YA 2P4WA 1D8JA 3W6JB 2EWNA 3FF5A 2DPDA 5ED4A 3L9FA 3NQOA 3WTXC 4JBAA 3QP5A 4I7HA 1U78A 4RB3C 1TLHB 3EYYA 4P5OA 5DCFA 4BAYA 1BI2A 1U6GA 3C3WA 3HSFA 4IHSA 3P9IA 1P6RA 1T98A 2HQNA 1S6LA 3HRTA 4KMUX 3I64A 2LKPA 5L3GA 1K6OA 2PMHA 3FMSA 5HS8A 3JSOA 3FHZA 6PAXA 4IJAA 4DQ2A 5KVRA 5ERIA 5A2QK 1HXDA 2JPBA 3C1DA 1GXPA 2K86A 4ENMA 3OV8A 4YG2F 2R7FA 2MLKA 3F8NA 1ZAOA 3ECOA 2EFWA 4O5VA 3RDIA 1J5YA 2E7XA 5FLXZ 5DEQA 2A6EF 2VOOA 1R36A 4BXUA 3E6DA 1U3EM 2OA4A 4R79A 5EEGA 1IF1A 4BHPA 1KU3A 4GXOA 3DPLC 1U5TC 3GF2A 3WU1B 1ZREA 2JPCA 5LGTA 5D6FA 1Y0UA 1WKMA 2XIGA 4OMZA 3SZTA 2W84A 1XGMA 2GAUA 4EM0B 4Y17A 3I58A 1C0WA 3V7RA 3HIFA 4M9SA 1MGTA 4G9YA 1BN5A 3IHUA 4PCQA 5HS7A 3F23A 4MQ9F 1FLIA 4WF2A 1HW2A 3AAFA 1X3UA 5F6FA 1FX7A 3P9KA 1STZA 2CGPA 2YU3A 3D0SA 4A5NA 1CF7A 1H0MA 3I59A 5ICEA 5LLQA 4OOIA 2PMUA 1REPC 2EFOA 3QAHA 5ICFA 3K2ZA 3DEUA 3VOEA 2UXNA 2FMLA 3FZVA 2QZ8A 4KUMA 4M9ZA 1W5TA 4BYYA 5K5RA 1FYKA 1ZARA 1ON2A 2CW0F 1R58A 2R7DA 4LD5A 2EA4A 1R7JA 1ZLJA 2OD5A 1BOAA 1FBUA 3QPTA 4HX7A 1E17A 3P9CA 3L00A 3HTUA 4FT8A 5D4SA 1R5GA 5LRSA 1UB9A 2ESNA 3LSTA 2MLGA 2VE8A
chains in the Genus database with same CATH superfamily
1UHMA 4HYEA 3D0HE 5KFYA 2V67A 1QTMA 2NXUA 3HOUJ 2JK3A 2ZBQA 3QYBA 3ABUA 1FFSB 5GAHI 4HV6A 1HQ2A 4CLWA 1DPUA 2LNBA 3KG0A 2VXDA 4ZLLA 2WONB 4WWSA 3OTCA 3RR7A 1ZH5A 1A0OB 3CUQB 5K1YA 2WVDA 2YX1A 2EC0A 1TUGB 5KG2A 2KIMA 1YRTA 2DMPA 2J7KA 4JB8B 1IN8A 4AIKA 5DRKA 2HHPA 2N8GA 9ATCB 5ETNA 2X6XA 4F67A 1ZZFA 4E4HA 1B9MA 3R1HA 3LSJA 4DR5J 1UEUA 2KL8A 3A0BC 1SL1A 3FBBA 1X4DA 3WTSC 2LKXA 1VC0A 4C6AA 2AYEA 1LQ9A 1RADB 4OYAA 4DX6A 3HSZA 4QR2A 2M2BA 2DQRA 3M3YJ 3L3CA 2VFUA 1EIYB 1U0SA 3NS5A 1FNOA 3QYEA 4X4QA 2AO9A 2JUCA 1RT7B 4B3XA 4F02A 1B7YB 1N33F 1YJ7A 1MBJA 1RLDA 1ZZNA 2RF2B 2WV1A 5IT9Z 3DOKA 1SMTA 3BN4A 3K58A 3E5QA 1FIPA 2ABYA 3ZZYA 1D8YA 2B4UA 4HLXA 3DLEB 2Y75A 2IBKA 4LF4F 2LLKA 4CT8A 3DOMB 1FKOA 5CPRB 2EK5A 2PO4A 1XSDA 4USKA 1Q8IA 1NK3P 1SANA 1TK5A 4AM3A 3KZYA 2ZH8A 5HMXA 1C4AA 2PSZA 3OHAA 3CUQC 4ZVGA 1BA5A 1HI8A 1WC3A 3LL7A 2GMLA 4G1IA 3MZIA 1JUMA 1ZPWX 2E5JA 2V69A 4M5GA 1LEOA 2OTLI 2NXNA 2DMTA 2XCPA 3V8KA 2VJ4A 1X4HA 4FE7A 4UOHA 3AL0B 4A48A 1XC5A 2Z33A 4CCKA 2HVHA 1JTYA 3FZ2A 3NOCA 2O67A 4CO2A 5EDWA 3OYBA 3Q8SB 2BW2A 1RAOA 2OIHA 1DP7P 4RL1A 2CA9A 4WYLA 2LH9A 3WHIA 2DH9A 1C1CB 2UXCF 2DHSA 4E7KA 2LTPA 1H3DA 2QLFB 1XX5A 1JLEB 1CJVB 2C22A 4DCPB 3GG0A 1XR5A 3PFOA 4GCVA 2KISA 1ZRFA 3H90A 2AEFA 3CJNA 1MJAA 3K8WA 4GVLA 4RZRA 2HMIB 1WDTA 4ANEA 3RZOJ 4L6V3 3L2QA 3L2VA 3QSIA 2K1RA 4JX6A 3JTGA 3K17A 3PIOQ 4FXWA 4L9NA 2RKIA 3OMYA 4WXDA 2FJWA 3X2QH 1NK8A 3EGVA 3MGJA 1YBTA 3BJYA 4EMDA 4BE1A 5JI6A 1KZHA 1O3QA 1P2FA 4RLEA 4NLXA 4UQTA 1LV5A 2L0KA 4LR9A 2OSRA 1LNQA 3K10A 1TMJA 4G65A 1FE4A 4HTIA 4MIMA 4HHHA 3C2GA 3AL0C 1H74A 5ICGA 4K4VA 5E3RA 1ETKA 2D9PA 5J1EA 4XSXF 1X5PA 1JKPC 3D68A 4QPOA 5HNFA 1UFKA 3TAQA 4OX9J 1Z6RA 2X51A 1NSQA 3MKWB 1NKEA 2KIUA 4RW6A 3Q3SA 3QODA 3AXMA 4J9UE 4NUBA 3HVWA 1KYWA 3QU6A 4GDFA 2MW8A 2B0LA 1SFXA 2A07F 4F4XA 3NS7B 3CULA 2P8IA 2HLUA 2F4OB 1VQKS 1HPZB 3MOZA 1S77D 2NNYA 4XKBA 5HLFA 4QR1A 3WU0A 4L75A 5CYMA 3PNYA 4KRWA 1XGOA 3HSDA 5D6EA 3CCYA 2WC2A 2VPYB 4ALZA 3BR6A 3NMRA 4AU7A 1MMAA 1SQGA 1RHQB 1R1TA 1YX3A 2EFQA 2BDPA 1L3SA 3PFYA 5J3LA 1KS2A 1OSCA 2QQ8A 3HGGA 3GIMA 3HRSA 2FLOA 5CZXA 1F43A 1Y7PA 3I9ZA 2NVQJ 2NYXA 1RT5B 4RB1A 2HEKA 5ILUA 2BANA 3CCWA 3V6DA 2BZ2A 3J81Z 1RTJB 2UUCF 4AE5A 1BIBA 2UXBF 2P7CB 1XWLA 2LQJA 2LRDA 4ED4A 1QDUB 3EZOA 4DQRA 1UG2A 2QC3A 3DLGA 1L3TA 4N56A 2HBQB 3LA0A 3HK2A 3WQPA 1D0EA 2GLOA 3MMAB 2J7UA 3KJFB 4NLPA 2VXZA 3KEQA 1D5YA 3H5XA 2VQHA 1MBFA 1X9MA 1D1BA 4B43A 1U02A 2KJWA 1ZYQA 2WY8Q 3GYXB 3LWLA 1MN7A 4DBRA 3ELHA 4NOHA 2DIUA 3PZPA 1U8RA 1IKVB 1S49A 2KZMA 3H1CA 3GFIA 5M5YJ 2DNOA 3TZXA 4OX6A 5SUHA 3J80Z 4WU2A 2Y1JA 1X60A 1PCAA 1EH7A 2W4CA 2XMAA 5K5OA 2YKNB 2QO3A 1FF2A 3PR4A 3P5TL 5HDGA 1Q7LB 4M72A 1VK3A 3ZXWA 1ZM2A 3H3VK 3GFZA 2OC6A 3O8WA 3MWBA 4RLQA 3OTEA 5H1SV 3KUEA 4KIAA 5RUBA 4OZJA 3MD3A 1LWFB 2G7UA 3NCQA 4F8RA 4LBPA 2LG4A 5HATA 4W90B 3MM9A 2ZJ2A 4O3QA 4M95A 2CPFA 2HNZA 1HNIB 2DGOA 2V5HG 3V42A 2ZZTA 3QLHA 2F8MA 1F60B 4PQAA 2FDNA 5BQTA 3CJTA 5GP9A 5IM0B 2XGCA 2VC0A 4PGGA 1DARA 3TQ1A 1YGYA 1WDDA 4KSEB 3H3ZA 2DRAA 4NI2A 3N6MA 2PEHA 1XMXA 2OPTA 1A04A 2R3SA 5LHHA 2MLZA 4LJMA 2W7OA 3CLQA 1SV5B 2PD1A 2ETHA 3BC8A 5ETOA 1CJUB 2M7SA 2JVHA 4MFDA 2J0XA 2DISA 2BJ8A 2D9OA 2WONA 2AGOA 4F4WA 3FC9A 3RI4A 2KYZA 3KUHA 3CUQA 2F6CA 2VBWA 3OJUA 5IFMA 2A2DA 2OELA 3TO8A 2MBFA 1VI7A 1PAEX 4HSRA 4BS2A 4OI6A 2V6EA 1IBLJ 3LTOA 1M1HA 3T41A 2QKLB 3AJ1A 4K0KJ 3E6CC 3I56I 2VLAA 4JI2J 3IL2A 1I5OB 2CJQA 1GFWB 3HLUA 4AXJA 3OL8A 3OYMA 2CPDA 3DLJA 3DWLE 2MD5A 3R4KA 3JRIA 4KITB 4DV2F 3VYSB 3GSIA 3HF5A 3B8HA 2A6HF 1LQ1A 4I6WA 2IEKA 4ZVFA 5HK4A 2V9PA 2FVRA 4BNCA 3WZ0A 2H65B 5DTDA 4USUA 3OYIA 3O2PE 3BBBA 1IC8A 4ED6A 4LK0F 1RT7A 2BE2B 2B4VA 1U26A 2ZBPA 5A2QY 3MCMA 2RF2A 2W2MP 4L3NA 2Q43A 2V1UA 2DT7B 4A3MJ 2V1DA 1HA1A 3RW7A 4Y2KA 1R43A 1ZM3A 2BBEA 3DLEA 1KQKA 4K2EA 4CLPA 4A3FJ 2SXLA 2RN7A 3DOMA 3R5DA 4B9LA 3K4CA 9ANTA 2RREA 3TX0A 4OU0A 3M6UA 4PFPA 3P3DA 1B9NA 4HW0A 3D6HB 3VAMA 1UVIA 2IXSA 4UNOA 2FJEB 3I5UA 3LQRA 3DLLQ 3EGWB 1S7EA 1HBMB 2C3UA 2YPRA 3G6XA 2FLPA 2XB2D 4QIWN 1IR0A 1XBWA 1N48A 1EP4B 1EETA 3K70C 4J9VA 3WE3A 5FJ8J 3LA7A 1HNXJ 2ROGA 5M2UA 2HGNA 3MN2A 1OYYA 3K9TA 4KJZA 3K8VA 5GADJ 4F93B 4F91B 4FZVA 3TI0A 1IRXA 4K4XA 3KYCB 1I94F 1E3HA 1B70B 2R8JA 3AJDA 3VYUB 1WKLA 4XO0A 2HI3A 4O3MA 2B43A 4J01A 4I2PA 4LIVA 5JLWA 1GDTA 3OR2B 4MTEA 2M8HA 4CCOA 1ETOA 3I9V9 2PLYA 4NLVA 3KTQA 2DNRA 2LOOA 5FFXA 4A5MA 3W60A 2EBEA 4ILLA 4XK4A 3DRYA 2V8VA 3U1LA 1AA1B 4ZYEA 1XCBA 1JLEA 4AVPA 1NJWA 4O3RA 3M2RB 1CJVA 2R2UA 2LQ5A 1OYIA 2V9VA 4JV1A 3T0YA 3PJ9A 4U96A 4HOBA 2YNIB 2X1CA 1Y9OA 5DD4A 3H2VE 2DT9A 1GH8A 4FISA 2YY3A 2WWYA 1D1AA 2V2QA 3RSNA 4BC7A 2HMIA 2QVOA 2MKSA 3C19A 3IA0A 4UY85 2DH7A 1MH3A 1IUJA 2DA5A 2CZ4A 1HNWF 2UXDF 4ETXA 2JZ5A 2YWFA 4WF9Q 3E6BA 2GM4A 4BEHB 2JUGA 4LIUA 5HVGA 4WU3A 5ETLA 2L7ZA 4F55A 3L4BC 4NLUA 1X5OA 2ID6A 5K7FA 2JVRA 4LITA 4O0IA 4URQU 4YN3B 1X1DA 4X2BA 2ZHAA 2F4FA 5A8RB 4USMA 3QYYA 5ICCA 3FQLA 2G2OA 4MTPA 4Y6IA 1UETA 2JLEA 5D8KB 2PE8A 4GRSA 1GVJA 3CMES 2L7KA 3OR2C 2FRHA 4I99C 4USWA 1KTQA 4JQFA 4IPAA 4HLYA 3GUDA 2FNAA 1YJ9S 5CH7B 4WE1B 4M3BA 4G94A 1J9IA 2BA9A 3S16J 1FDNA 4D5CA 4UT4A 3SEZA 2CNOB 1S76D 1YIOA 4E7ZA 3G96A 3RRKA 4ZYGA 1HPZA 1J2VA 2GIRA 2PI0A 1V3RA 3BPXA 1KLMB 2IP2A 2DNGA 4LR8A 3P7NA 3SSRA 2E7VA 4QBUA 4JI0J 1RP5A 2PIIA 4X4TA 2POKA 2XAGA 4HR2A 1BHNA 4OLPA 3F8BA 3RQ4A 2JVOA 2QA1A 2Z57B 3UFCX 4EK2A 2VBZA 4KHPJ 4HVZA 4UUVA 4GKJF 4JI3F 1MBKA 1H9GA 5CYJA 3IAM9 3FHNA 1SH0A 3M8WA 4HH1A 2KQRA 2O7OA 3OR1B 3RJPA 3HDSA 3NGRA 3EJMA 2KZZA 1RT5A 3OTOJ 2IGMA 2XTJP 2OU2A 3CESA 3LP2B 1HDPA 4CH7A 2N4DA 3QIPB 3LMMA 4I01A 4CLUA 4KBIA 2EV5A 1Z77A 5ETMA 2Z99A 1YW8A 1WC0A 4DV7J 1Z1ZA 5HROB 3T3FA 1AT1B 2BJ1A 4P2FA 1K78B 2ZH1A 3MMAA 2FVPA 3RKQA 2UV8A 2G0JA 1M5VC 3EUHA 3ONQA 2CQGA 3DRSB 2VU5A 1YG2A 2QA4I 4O44B 1IKXA 3KIOA 2KIFA 1FRLA 3T8TA 5AJ3J 1DFDA 4UOFA 2KPMA 4A4JA 4DU7A 1Q81T 2PJPA 2WB4A 1DQ8A 2YPYA 4PWUA 1BWVA 1IKVA 1GQEA 2HKXA 5LL6d 3DXJF 2FZKB 1W36D 2AJFE 4DSJA 2UUBF 3NLCA 3V4IB 3A03A 3LPEA 3PYEA 3C6UB 2RS8A 4LIRA 2YKNA 2OBPA 3K70D 1ZETA 4P6QA 3R5BA 4O4GB 2ROPA 1S7HA 2ZZMA 3ZZTA 3Q8RB 4DEZA 3W2WB 3OR1C 5BR8J 2HPMA 2DMUA 5F0HA 5L1IA 2XDVA 3CCVI 3JAMZ 3BKFA 2DI3A 4ED3A 1LFBA 2ECBA 3DYAB 1RR7A 3CQZJ 5EZHA 3PO4A 2FTRA 1DDNA 2LQ9A 2HHXA 1RT6B 1OCPA 2VG6A 1HNIA 3WBZA 1U9OA 4IR1A 1TKXB 4KQZA 3D5MA 1E2XA 2YKAA 4Y3OA 4R1HA 3VVUA 2RUSA 3D2WA 5L39A 5IM0A 3QZ8A 4LVOP 4Y2AA 1BUXA 5ILVA 1L3UA 2ASYA 3CCLS 1JKRC 1W2IA 1NM2A 2YS9A 4F4KA 4ED7A 4LGWA 3S7RA 2Z2SB 2LSOA 1DJ0A 4S0HB 4A8FA 2TRTA 4J9PA 3J7AY 3BH6B 1SV5A 2F5CA 1EJ7L 2KU7A 3IR6B 2VKRA 3MZ8A 1CJUA 3MKYB 3OFHA 1RTIA 1X4OA 1M5SA 2OP5A 3HPHA 1VZ0A 2LF8A 4C2UA 1PYSB 4K50A 3CDBA 2K9QA 3PW0A 2FX0A 1HQCA 1U1MA 4EBDA 4OFZA 3V6JA 5KFEA 3CCSS 1ACMB 3P5BP 1MZBA 1VQOS 5GAGI 2KYXA 1MWZA 3TAMB 2V8GA 4L0YB 2Y2ZA 2OJ3A 4FYVB 3UVJB 5CCMA 3N6LA 2E1NA 4RAZA 1FX2A 3KUGA 1Z3YA 1YJWI 2ZM6F 3PUBA 4ELTA 4UF4A 2RB7A 3D1NI 1HCRA 3CCZA 1U0JA 2ZWOA 2DD8S 4MAKA 2DHXA 1AW0A 4HLBA 4NLGA 2FVCA 5IV4A 4KIBA 4IH6A 1D8KA 4LB6B 1SI9A 1FNXH 1EJ9A 3K59A 3D6TB 1KONA 5CQEA 2E34A 2FLNA 3EVMA 4QPTA 2MPUA 4I6ZA 3OYDA 3QAEA 4OI4A 3VHQA 3PJXA 2W85A 2Z2YB 3FM5A 1F0XA 3ZCOA 2NRAC 2CQDA 4CCJA 5KHDA 1WWXA 4EJTA 3CC2S 3SXYA 3CT9A 2F5EA 1HBMA 5ETSA 1WC5A 1AHDP 1SKWA 5EDNA 3MMJA 1BL0A 1LKZA 2KTQA 2R7SA 3GBGA 3ETOA 4ZVTB 2MQPA 1D0XA 1N54B 3UNYA 2I2YA 4UY8I 1T3NA 4AD9A 1ACIA 2Z2LA 3LO3A 2A6OA 2P5VA 4LQ3A 3JTPA 4CLSA 4EUVA 2K7KA 3W8PA 1RHRB 3OR2A 4IRDA 1S3JA 2IRXA 3H9GA 2RQCA 2BHYA 5DZ7A 3CVKA 3SBMA 4DPYA 1VQLI 4LSNB 2Y48A 2O9LA 4ZHRB 4IUFA 3GILA 4BXFA 1PG5B 2QA4G 3G8TA 4KE5A 2DFIA 4DR3J 1FD2A 3G71I 3M2RA 2PFFB 4AUXA 1FT9A 2YNIA 3BZQA 1B8IB 2GAHC 4OJGA 4X6AJ 2KDZA 4JBCA 4RA2A 3AD9C 2CQQA 2KXNB 3ZQCA 1ZM9A 2E5ZA 5BYSA 1SKRA 3VAFA 4NASA 1Z1DA 3ABTA 2AGQA 2DN0A 3QBCA 1N6QB 4K4TA 1JJ8C 2HYIB 5KFSA 2C3PA 3KLOA 3OFFA 2XUBA 2BBYA 3IWXA 3QRPA 4BEHA 1RAAB 4YMEA 5CA5A 4EI2A 5F0FA 3TMOA 4XTTA 4I67A 3NMAA 1O0PA 2GXAA 1HW1A 1FMWA 2CPHA 2VFVA 2HVZA 5LMNJ 4IF4A 2VASA 1D09B 1FYLA 1FJLA 5A8RA 2IA1A 3LOUA 3HCXA 4EGLA 1NTCA 1U6ZA 2HHTA 3EUKL 3GE9A 3OSNA 1O57A 4EATA 2RGVA 2EA2A 3VSLA 1N0VC 5F0WA 1G2HA 2DY9A 3HOYJ 1WC4A 2IA0A 3OPKA 1Z6TA 2W48A 4XRSA 3PKYA 4WE1A 2ZXWH 1SC7A 2D3UA 5EEHA 2VBXA 3V81B 2IW5A 4OI0A 3J7YU 3FZBA 1NSPA 1NG7A 1FXLA 4LF4J 3WX8A 1SFOJ 2KFDA 3UCUP 4HHUA 3GPAA 1KLMA 2ZC2A 3G3ZA 3PEHA 3GTJJ 3KLEB 4CM2A 2OKQA 3C2PA 1E0EA 1SL0A 3UN3A 4S0MA 3QO9B 2RKHA 2XS5A 1PGZA 1FDDA 2ZJRF 1CBKA 1VQ8S 2RE1A 2YX4A 1UHWA 1B0TA 2RC4A 1A36A 1GVDA 4KN4X 4ETSA 4DV6J 1WOSA 2DHGA 1JB0C 4X4RA 4RGUA 1GAOA 3GG1A 1ZRCA 5IZHA 1XTZA 1TW3A 5IOLA 3F8MA 3I9V2 1TL5A 1WC1A 3HM9A 3DQVC 1VQ5S 2UVVA 5F04A 2F7VA 1YTYA 5DYMA 4M73A 4DZ6A 1H89C 3LP2A 5I3QA 2R4GA 5E18F 3QIPA 3RBZA 4B9VA 1RTHB 3VF0B 1TWGJ 4ZDOA 1G1XA 4UUSA 5EZGA 5EN1A 5F0CA 2Q1LA 3BN7A 3FK4A 3U7JA 1NCLA 5I3UB 3CE8A 5HP1B 5CYQB 3CMAI 5HROA 4CNYA 2KT2A 3AG2H 2P8TA 2KJVA 1UVMA 1K78A 2A68F 3WU2C 4WXCA 2RDDA 3S6EA 2EK1A 4NNJA 2ILYA 3JYTB 2JTVA 2Q6BA 2C2ZB 4N5SA 4RBTA 2ZBKA 1A6LA 3DRSA 2W8KA 3ZPLA 3CP8A 4O44A 1X4BA 5H9EK 2OMOA 1X9WA 1UHSA 3S15J 5IT9K 4HF0A 3OJSA 1HHQA 1F5BA 4G12A 3MKZA 3KLIB 1KFDA 2QQ9A 1RUNA 2BM0A 1QVUA 1UEKA 4LMZA 3DU5A 3LA3A 3FDSA 2Y8YA 4OWRB 4ZDLA 2FQ4A 2UV8G 4RBOA 4O4GA 4ZN3A 1ZELA 1TK8A 1OY6A 2CQIA 3W2WA 1FCAA 3DMJB 2GWRA 3LGNA 3S2HJ 4KIGA 5GAHU 3J7AO 5BNGA 3CCQS 1JLCB 1D3YA 1JJ4A 1RACB 2BQRA 1FX4A 1UG0A 3DYAA 4L76A 3CJSA 1WJCA 4B3AA 2V94A 2IS6A 5D8HB 2XAFA 4FVMA 1ORKA 1IRFA 2R7XA 1RT6A 4WKYA 1NSKL 3T8RA 2MY7A 1TKXA 5DZ6A 5U47A 3H5AA 1PYTA 2MTLA 2XMVA 1PJ7A 3WX4A 2CNLB 4FETA 4PXEA 3OS2A 3OHBA 2VQEJ 1WELA 1HHTP 1N5TA 2QL7B 3AH6A 1D9FA 2XGPA 2UVUA 1AKHB 5KFJA 2YQ0A 2G13A 1TKDA 3C18A 4CZCA 3L2RA 3GXOA 1RHKB 2Z1DA 2M9KA 4MFBA 1HWLA 3O2IA 4OX7A 1CULA 1HI1A 2E2JJ 4QW8A 4RM2A 3KYDB 1MNEA 3IAM2 2MXYA 3TR5A 4R0JA 3QT6A 2QA2A 3V8LA 1TAUA 3BTJA 1WJ9A 2LYVA 4G3IA 3BZ6A 3TARA 4AL5A 3S3OA 3QIDA 2H1YA 1N77A 3DU6A 3I4MJ 3WIVA 2IRYA 2KH9A 1UJ8A 3TAMA 1DBDA 1UZDA 2KJBA 1RI7A 1HHSA 3KP7A 3ROUA 3UVJA 2V4JA 1YJNI 3TGNA 2DTRA 3CEDA 2FF4A 4CP5A 3MTKA 2UUCJ 1Y4ZB 2CJKA 3K5LA 2QFJA 3UO0A 2PEXA 4LFCJ 4CCMA 1L0OC 3J7ZT 5EWFA 2CSOA 2P9CA 2CJYB 1UJ6A 4ETZA 1YS6A 3BGLA 7FD1A 1FP1D 3ET6B 2HNYB 3POTB 4FS2A 4PPDA 2HZVA 3BM7A 4I0WA 3PJRA 1SJ1A 4YHHJ 2YKMB 2XYHB 3Q23A 1LFUP 4IRGA 1O7LA 5BXIA 4LFUA 3LSMA 1H2UX 4U87A 2E1OA 3JSRA 4KO0B 5KT2A 1U09A 3R7SB 3M8EA 8AT1B 1K4SA 4LIWA 1U1RA 3R5CA 5EUHA 1FTTA 4Y34A 2QE5A 4A3LJ 3BSCA 1WH7A 1K47A 2LKZA 2ZKTA 4BS9A 4XK8C 1JLFB 1NJYA 1SFKA 1BQMB 3T9NA 2HFHA 3M8ZA 4HAMA 1FYMA 1G8XA 3AD7C 4CT9A 3CC4I 5J1PA 3UD3P 4IHWA 1HW8A 1GTHA 3SQGB 2HGCA 2MZTA 4BBYA 1SIWB 1VBKA 2RNGA 5L3FA 3IRWP 2AJ4A 1BR4A 5EGOB 2DFHA 3K4BA 5AXLA 3FKJA 1JX4A 4HQEA 2BOLA 1HNZF 5HLTA 2BJ9A 4M94A 5FB2A 4B1RA 5LXRA 3TWZA 4ZIWA 1ZQ3P 3RB0A 1LVAA 2XWYA 1FWPA 3DFEA 4E7LA 4URSA 2QSHX 1TUWA 3I0SB 3CF5Q 3SFUA 3PACA 3DFGA 1KD1T 3J81K 5A0YB 4I76A 3QPIA 3FSIA 1YITI 4OYOA 3TA0A 2ME6A 1UVJA 4ZHRA 1OLTA 3X3UA 1T2KA 4DL6A 3FK6A 4MH8A 5KAKA 1D1CA 1WI3A 3ABMH 1NK7A 4BHQA 1B8IA 3OVBA 2YWGA 3EVOA 2MKCA 2QLZA 1NZ8A 1OCTC 2CADA 2HBZB 2JRTA 4MYUA 1IWAA 5D4RA 1ZHFA 3ETMA 1LXJA 2FYXA 3GJTB 3KXDA 2HEOA 1B0VA 4N76A 1KN6A 3P4UB 4WWCA 2VDHA 1RWMB 1HD0A 2QWWA 4DBQA 1GHCA 2BUNA 3W8GA 3VAGA 1LNWA 3HHLD 2DCUB 5KOXA 4UB6C 3V6HA 2C6YA 1TL8A 3G6VA 2R9LA 1I6JA 3GTMJ 3J80K 4E7JA 1Z2ZA 4UUWA 3ERED 4JI8J 1UA1A 1F6TA 3OSPA 4LF8F 5LOQA 4U8YA 3PQKA 2DGQA 1KWMA 2QYOA 2VKZG 1IJEB 1VGYA 4JI4J 4A69C 4DV1J 3J81Y 5EWEA 1QPMA 1U5TB 2J0QD 2IJFA 3ZTSA 2OUMA 4O23A 1SQEA 1YKWA 3M8SA 1E6YB 1XR6A 3DEEA 5ED4A 2HDDA 3CW2C 4WFXA 4C2MA 1N52B 2JWNA 4I7HA 1DHMA 4P5OA 2W8LA 1U6GA 5D15A 3PIOF 2BXJA 5F8GA 4P2XA 4IHSA 3LSGA 5K9FA 2X6YA 4XICA 3HRTA 4LQ9A 3CCMI 2HFOA 3I64A 3KLEA 1WHUA 3QQAA 4FS1A 4A8KA 1WJFA 2ZH6A 3QO9A 5B3SH 5IWAF 4XRSG 1WHYA 4ZVQB 1YRXA 1S72S 2DRDA 1U1LA 1EX8A 3J80Y 1HXDA 1HBNA 2BQ3A 2M8GX 1GXPA 1IKYB 4YB5A 1Y0NA 3SXLA 1RKWA 1NZAA 2R7FA 2MLKA 1ZAOA 4USHA 5B7WA 2EFWA 2AX1A 4O5VA 3RDIA 1S4EA 5E3MA 5IXUA 2OV7A 5DEQA 2ZOMA 5IT9U 4RW7B 4JYKA 1RQ0A 2VUGA 4FVCA 4C8NA 1RAHB 1SVDA 4ATNA 5B0CA 4BHPA 1RTHA 4IR9A 4GXOA 2JLGA 1U5TC 1VYAA 3GF2A 2CW7A 5DDPC 5L9NA 3V5RA 5I3UA 1EA3A 1JKQC 3D7SB 5HP1A 4F2RA 5KG7A 2FIUA 4K8RA 1IBMF 5I3PA 3SZTA 2W84A 2IAJB 1XGMA 4EM0B 1AROP 4Y17A 3JYTA 2RQ4A 1XNRJ 1C0WA 3ULHA 1MSFC 1IVZA 2HGLA 1MGTA 4OLOA 3LSIA 4Q2MA 4PCQA 2KT5A 4M3GA 1JJCB 3IP4B 4MQ9F 4LF9F 3ZTPA 3KLIA 4CWBA 1FLIA 4WF2A 2PC6A 1ERDA 4DUYF 3NS6A 2ZFUA 3PV8A 3P9KA 4BDZA 1IDZA 1STZA 4H4MB 4DV3J 3NGTA 3RR8A 4ZC3A 1U6BA 1TK0A 2WHOA 4I2QB 2PMUA 4J00A 3ESWB 2EFOA 3QAHA 5ICFA 3HFKA 1XTAA 4WK3A 3CPWR 2IDLA 3HSGA 1XNQJ 1WSRA 1RU1A 3CJKB 5LSRA 1S1WB 3D5SC 2I6WA 5KFUA 3MHYA 2UXNA 4C3KA 3J7YJ 4DR6F 2QZ8A 4BYYA 5K5RA 4HEA9 4IG3B 1FYKA 2EFGA 4HNVA 1ON2A 4AYBD 1K83J 1R58A 1RAIB 2PJRB 3JTNA 2EA4A 1RKTA 4IKFA 3K0JA 4LREA 3BREA 1BOAA 2AJ0A 2KM8B 3CDUA 2GX8A 1E17A 1ZK8A 2VHGA 3BYRA 3HTUA 3TZWA 1R5GA 1UB9A 1AKHA 3KYLA 3PCOB 3E97A 2KG1A 2G1DA 1RE1B 4CI0B 3HD2A 3R5GA 4CNZA 1NPRA 2CQ2A 4FKXA 4TLQA 3P5JA 2LFVA 2NXJA 3KX2A 4OAZA 5BPDA 2QGFB 1RWNB 2OUGA 5ITHA 3B4MA 2H27A 1XGNA 4Y0FA 1JWWA 4OJ3A 3NEKA 1LW2B 2CWKA 1TQMA 2MKKA 2NS8A 3KHRA 2O5DA 1C4CA 4N41A 1QE1B 4Q8FA 1XN7A 2VKVA 4M5LA 2V6CA 4M5MA 1VNDA 2CQ0A 2EXUA 5B5EC 3NARA 5LXYA 4AYBA 3D1OA 4B3SF 2YBVA 4ZH4F 5KFNA 1MJ9A 4HDUA 1I50J 5H6QA 1J2XA 4N8NA 2AZ1A 3ET6A 3KG1A 2HNYA 2DTJA 3POTA 1NK6A 3QMQA 4RS8A 2YKMA 3F3XA 2KM8C 2EBIA 3E2EA 2A6MA 3G6EI 4YFNF 3KKFA 4KO0A 3KJVB 1J59A 2VJ5A 4BQQA 1Q95G 4G6DA 1L5UA 4DN9A 2RQQA 2FEZA 4BU2A 2UWMA 2WAQN 4RB0A 4BQAA 5D5WB 1R49A 1IRZA 1RCOB 1NJIT 2P9EA 1VQ4I 2C2OB 2KN4A 2BR0A 4ILRA 2QENA 3TW0A 1QQIA 1JLFA 4F2SA 2CPXA 1BQMA 4CO8A 5HNHA 4Z2YA 2ASJA 4NMXA 2ACMA 3IBWA 4DR1J 1BC7C 3R8YA 3RPQA 2FJBB 5LMUJ 4UVAA 1FVQA 3SQGA 3BR0A 5C7PA 4QIGA 1YIJS 1R27B 2CIMA 1YX2A 3S8PA 5A8KB 3ZZZA 2X6OA 5EGOA 1XMQF 4I2OA 3O6QA 1URNA 2BJEA 4H54A 2BV6A 2KRRA 3FSYA 3BDEA 4HKQA 1U49A 1IXSB 3IWFA 2P5LC 3EVWA 4MIBA 1FRXA 4H4OB 4A8QA 4B17A 1S99A 1R8HA 2BY3A 4V2FA 3I0SA 1GT8A 4C9YA 1IWGA 2X6WA 1VQ7I 5A0YA 1W0TA 3R7BB 4XN3A 2KJCA 1TL1A 2ZUAA 4MKBA 1Q5YA 2W57A 4C0HA 1MMGA 1WQ2A 3DLLF 1RCXB 4ZTFA 2FHMA 2XROA 3G4SI 2BACA 4LFAJ 1YS7A 1Z3XA 2STTA 1JNRB 1FK9B 3HD1A 1Y3JA 3I5AA 4FYWB 1G3WA 3ISPA 4DQIA 2PX9A 4NLOA 5M5XJ 4JOMA 1H73A 1SPBP 1U47A 2G0IA 3Q2TC 1FI4A 2EG2A 4DUTA 4L18B 3H92A 2WB1D 2B9WA 3S1RJ 2AV5A 5J40A 3K7RA 4DV4F 9RUBA 1KRPA 5E3CA 1X5TA 3QU3A 4WTOB 3A2KA 5KFZA 1YQAA 4LSLB 1BBYA 5D4NA 3W6VA 4BL0B 1KGSA 1U5TA 2O3FA 5E1ZB 3E01B 4KFBA 5E79C 3GQCA 1S5LC 2HYJA 3T1HJ 1PBUA 1X31C 3JAMK 1MROB 4ZP9A 1E6YA 3T5LA 4WZMA 3VWSA 4YFKF 5KT6A 1B6AA 4LLGF 4DZDA 3IV5A 3H59A 3I6PA 2PMWA 2ISZA 2MZSA 3WTZA 2FJXA 3BG7A 4DZPA 3MEKA 3S93A 3GTYX 3FVYA 1XMOF 2ZZNA 4QWDA 2IGKA 2QGUA 3IBCB 3KK2B 4YS2A 2DIVA 3KLHB 2IJNA 3V2UC 4Q0BA 1D9DA 1OCZH 2QRRA 3WTUC 4OZ0A 2ZH3A 3GTLJ 4Q5SF 1WI6A 4B09A 3BQYA 2X3GA 4XLPF 4DR7F 4IRCA 3MR7A 5HL7Q 1IKYA 1R0BG 4EBEA 2DNKA 2DLLA 1QO0D 3JTOA 4G7OF 1MNMC 3T6JA 3P8BB 3H42A 1POGA 2FSWA 2XI3A 2W00A 1VQSA 2ZO4A 1OPIA 4P73A 4RW7A 2F4IA 4CLKA 2OZUA 2E1RA 4O3NA 1N32F 5FDLB 4PABA 4YELA 3GFLA 4B08A 1IBKF 3FXQA 5KFIA 3Q9SA 2IS4A 3L95X 1JHHA 3OL9A 5HDNA 2KVIA 4U7CA 2VB6A 3S17J 2QLJB 2LP0A 5J6XA 2CAJA 2K7LA 2DO7A 1GMUA 1C0TA 2MABA 4XLFA 4HPQA 2VN2A 5K8MA 3CJQB 3VV2B 2R8KA 4C8ZA 3PW4A 1U8BA 2L9NA 4BY7J 4LG3A 1VRTB 4A8SA 1OJ4A 5CLSA 1Q16B 1IN0A 2XMWA 3MPWA 1KLNA 3M30B 1X1AA 1ZOTA 1K61A 5D78A 2B7CB 2DO0A 4F3OA 2DTZA 3E3VA 1R4NB 3R2DJ 1HSJA 3KEOA 1OIAA 3ENWA 3BJ6A 3CO9A 1EV7A 4AXIA 4X4VA 3EMTA 2GS8A 4JK1X 3W61A 2M3DA 3BTIA 3W7BA 1VQMI 3LWFA 3CCUI 3M8YA 3DN9A 2APOA 2ZFWA 4MK9A 3X1LB 2M34A 1EF4A 4FF2A 1UVLA 1YJNS 4HACB 4I2QA 2L3DA 2OF7A 3TW7A 2J6TA 5KFXA 4LRAA 3R5JB 1JXLA 4H4KC 3LGHA 3UKGA 2ZBCA 2V63A 4II3A 3EUAA 3BGFA 4IEJA 3RW6A 3CJKA 4M71A 1KR4A 1S1WA 3IC1A 1ZTWA 2FUG9 4ITVA 4IG3A 1MWYA 2OQRA 2IS2A 3KE2A 1V54H 1UWBB 1VR6A 2PJRA 2GVDB 1RHMB 3H5YA 2VJUA 5E17F 5DETA 3BOQA 4IQJA 2LLZA 1BE4A 3PIPQ 2HRYA 1Y5NB 1WVRA 2NS0A 1XSVA 2E5LJ 1RWVB 2L41A 3QT7A 2AP6A 1G3YA 4KPCA 5KFPA 2B51A 1FHTA 1H6KX 1YI2S 3K4NA 5DV5A 3HM5A 4L0ZB 5A2QZ 3KMQA 2ECCA 3QPSA 4A46A 3TOBA 3EZ5A 1VFJA 5TJJA 4GVBB 2XASA 2VJIA 5GAEI 5DLGA 2ZXJA 1T8IA 3L7OA 5TGTA 2FA5A 1AU7A 5H9EJ 3TEGA 2DCLA 4CO1A 2DR9A 1IQZA 3K89A 1LW2A 2ZC4A 3EWGA 1UZCA 3KP6A 4F3QA 3SV4A 3GZNB 5LD2C 3OTBA 4EJOA 4BACA 1DQAA 4CYDA 2BABA 4FX4A 1B1BA 3W2AA 4KISA 1QE1A 1GX6A 3IM9A 5F3TA 2CRGA 2H5EA 1T38A 3G9CA 3RAXA 4ON0A 3MQ0A 5HANA 3SDEB 3BJAA 4M8LA 4KMFA 3DI6B 4USVA 4XKVA 4NXMJ 2H6CA 2L08A 5IT0A 3OFEA 4J37A 4ZLJA 3M9NB 1G4DA 1JLAB 3M8PB 4CHUA 4MT1A 1T94A 3GO5A 3QJLA 1SKSA 2XKOA 1N34F 4CCHA 3TOQA 2BOPA 1X3WB 4FKYA 3BZCA 1UTAA 2UVWA 2A1BA 5JHFA 3KJVA 3HRUA 5DDRC 4C0OC 2VQFF 1VQNS 3H35A 1WUUA 1Y39A 1P27B 5F64A 5KG6A 4FNIA 2HVDA 5HN0A 3N05A 5AXMA 2J9CA 2VZ9A 5DGBA 3V4GA 2LF7A 3CLOA 2R7VA 4P9UA 1OCOH 4K5RA 4XR6A 2AHOB 2JL9A 2CG8A 1T0TV 4P75A 3ABLH 5T14A 2YXLA 2MA3A 4C9DA 3G1OA 5IT4A 2VG7B 1YBAA 4DJBA 4ZPAA 1Z05A 3ELKA 2K4JA 5HMYA 1MBEA 5KG0A 2MDAA 2OZ6A 4CICA 3UQSA 3LFKA 4A3DJ 1SIZA 1GMWA 1FE0A 3D4JA 5F8LA 5A8KA 1UJ5A 1S9FA 1TWFJ 2QMUB 2Z16A 4UW2A 4NZ0A 2WVBA 4HEA2 3ZP5A 2D1VA 4A3CJ 3RBDA 5E41A 4YR3A 2M1BA 2W1OA 4ABZA 2HQCA 1JGGA 2V4RA 3FX3A 3A01B 4H4OA 4EQQA 2W9BB 4C8YA 1TAQA 1X0PA 3S8SA 2K9SA 4KYZA 1IN4A 2E5NA 1JQGA 1GXLA 2HWIA 1U45A 1T0FC 4N9IA 1S10A 1MKMA 3PO2J 2CQ3A 3JTHA 1AYEA 1CQMA 3E6MA 4A8XA 2ADUA 2F4VJ 1FOKA 3FMWA 4C3LA 4RJVA 1RAJA 2XGDA 2HS4A 3RZDJ 3OXFA 1FK9A 5HOOA 3DLHA 4WXWA 2WAQA 3M2VA 1KDNA 2M0MA 3JAMU 1GXUA 2NOJB 1QUPA 2ZITA 2DT6A 1TNTA 2W24A 2Y1RI 5J2QA 2EPIA 3VZHA 2GZOA 4MJKA 2KP6A 2GBYA 4X62J 1DGRM 1Q8BA 3C2HA 3D1HA 1BR2A 3JR9A 2M5YA 2MC4A 1U2WA 5BYRA 2E29A 3ECHA 3Q0UA 2LFBA 1W4MA 1VQKI 2X4HA 3HPGA 3BR8A 4ZP7A 3D0GE 4LSLA 1OSDA 3VZIA 1Q1KA 3UR3C 1IN7A 3E01A 1FERA 3IRRA 5B08A 5CD4A 2C3MA 4BC9A 1R00A 5J1YA 3GIRA 1MROA 1NSAA 1T39A 1AZSB 3CUNA 4M1KA 3F6VA 4DL7A 4TU9A 2BZTA 4XL9A 1BQNB 4Q45A 1U1PA 4QPXA 2CUYA 2V2VA 4KKOA 2XYPB 1NLKL 3ZZPA 4R5PB 3D3BJ 5FKLA 4QTRA 1MSEC 2DXFA 3Q24A 4NA1A 2EIJH 4BQOA 5MAOA 1RPWA 2J9DA 4I7FB 3KLHA 2EEYA 3ZXSA 2JC0A 3EE3A 2OFGX 2NPIA 4JYAF 3C14B 3K5OA 1P92A 2HTSA 3ZFVA 1HW5A 2H6BA 2W01A 3QJPA 3GZ7A 5D4PA 5IQ6A 2KKHA 3TVZA 2IM1A 1B4AA 2J9DE 1USSA 4IDKB 3HP6A 2P5KA 3ZN1A 4U8VA 1BIAA 2KVQE 1IN5A 3B54A 4BY1J 1X3ZB 5IS2A 2OTJS 2K2PA 1SC6A 1EQ0A 4I64A 1YZ7A 2H94A 1XG1A 1BOBA 4AL7A 4A6DA 3PY8A 5FDLA 3LFUA 1S1XB 1EH6A 3MFKA 4DR4J 4DFKA 5L3DA 2B5JA 4LFBJ 1IV6A 5E3LA 2EH3A 2EQRA 3DDIA 1WTFA 2IYGA 2NQPA 3I4NJ 2WSCC 4FXDA 5E3PA 2MD0A 2JN6A 3R6SA 1LFWA 5FD1A 4EZ6A 4DJAA 1FBSA 2JEIA 2ZE2B 1FDAA 2ZC3A 3WG7H 4TV7A 3DM2B 3CJQA 3LALA 4UUXA 3H36A 2JEJA 4B9SA 1VRTA 1ZR2A 2HLTA 3M30A 3ULQB 3R7NB 2WAFA 2E66A 4GC6A 3NBPB 3CDAA 3EDQB 2H8RA 1CVJA 4B3TF 2A3SA 3F9KA 3H5SA 2WVCA 2E2IJ 4DS5A 1O51A 2AU0A 3E3XA 4UY8T 2DA4A 3FRYA 2MZQA 2MKJA 2E9RX 2D1HA 4DSLA 4PXBA 1SUQB 3PNTA 4NMLA 4OIRF 4NC8A 1Q53A 2K8GA 2IM0A 4C4WA 1LK7A 2BE7D 2OD6A 3NGUA 2GQ2A 4HACA 4FF1A 3GW2A 2L3MA 3OY9A 3OYHA 4DIQA 2ZJPQ 3JSBA 3L7WA 4XLEA 4K4YA 2QUFA 4PWWA 4LF8J 4UTGA 3SZ2A 5M3MJ 2VH7A 4EJUA 4WFAQ 1N36F 3B82A 1REVB 1SJFA 3S3MA 2W7AA 2B6AB 3D67A 4PXDA 2VPWB 2FOWA 1UWBA 3PW5A 2GVDA 5A8WB 1IKWB 2MLYA 2B8PA 3M7VA 3DV8A 2QQAA 1KBRA 1FEHA 3MCNA 2DJNA 2HBRB 3TUIC 4ZYHA 1U48A 1UFLA 4D7MA 3HOZJ 1FC3A 2UUAF 1AWCA 1F5TA 5KT4A 3FK7A 1Y10A 4MGRA 4ZVRB 2G0EA 1HYSB 3PYDA 3K2YA 2DJIA 3D5LA 2X48A 2LREA 1X4FA 4UOGA 4GVBA 2RAEA 1PAUB 1SFUA 3B6CA 3IWZA 4QOTA 1ICEB 4ECTA 1V3FA 2JZYA 1ROFA 2WADA 4GKKJ 2V9KA 3IRQA 4ECWA 3AXKA 1SJ3P 4P72A 1JIHA 4P74A 4D1QA 5CCLA 1TFWA 4PJMA 1Q8KA 2IDEA 4KDPA 2L48A 2M7BA 3MCSA 2VPXB 5KFMA 5L8RC 3SDEA 4OINF 4HHJA 1RKJA 4CSWA 3DI6A 3THPA 3VDXA 4A3IJ 3B73A 4WPAA 3SSSA 3LUYA 5IOZA 2G0CA 5LGUA 2BEOA 4NLQA 1JLAA 4CTAB 1U2CA 5F41A 3OYEA 3OVSA 4UUTA 1FSHA 2ZH5A 4I0BA 1F5AA 4FNHA 1C1BA 2FOKA 2AXLA 4ENNA 2C2DA 1PO6A 1G4CA 3CMMA 1JLBA 4RGRA 4L72B 1HWUA 1KQSR 3PRDA 1NDKA 1FJGF 2MQMA 3OL7A 4LF9J 4I09A 4KV8B 4PSWA 3OQ2A 1FT8A 3S2WA 3I0TA 4DPUA 2VG7A 1I3AA 2O0YA 4E7IA 4IL6C 3CF2A 2RH3A 2W4DA 3K1PA 4ZCIA 2DEJA 5CYVA 4PYAA 3DRPB 2H5IB 3LSKA 2L4MA 1TP4A 4ILMA 4B3RF 1WJ5A 3F73A 4ESBA 1AUSL 3CCES 4CGZA 3OS0A 3V7CA 4W92B 2BMBA 3M8JA 3BR9A 3JQJA 1VOMA 1UELB 1ZM4A 3A01A 2I8EA 3PW2A 2P9GA 2W9BA 1VRQC 1F4KA 1XPXA 1WPKA 4QIEA 2M45A 2XS2A 2RQPA 1KHVA 2OPPB 2Y9HA 3JRGA 1BLUA 3PSFA 2NYHA 3FJ2A 1HARA 2JRMA 4X64F 3KFWX 5HAOA 5DDGA 2EZLA 2AEMA 2WVEA 3FRZA 2XO6A 1I3OB 3GV5B 4F4YA 3U1NA 3IWNC 2GMHA 3CMEI 3HO1A 3MCZA 3D0IE 3JSPA 3HZGA 2D41A 2XSJB 4LLNA 3RKWA 3S1QJ 3HB9A 2HNDB 1ZGAA 2PMZD 5HBMB 2VKEA 4CXFA 3T5XA 3IKTA 1VDHA 1YJ9I 6FD1A 4UVBA 4USIA 5KOWA 2M0CA 1PP8F 2BQUA 4FYXB 4K4SA 2HHQA 3ZQQA 1LXNA 1XB4A 1RR8C 2CDRB 1DRZA 1T08B 1U8SA 4DGWB 3CF5F 1NDLA 3C66A 5IC6B 3GSDA 2P0WA 1PSDA 2JA8J 3NEUA 3G2BA 2I38A 4IRIA 4IYQA 3JB9k 5IT3A 2L9DA 1ZRDA 2Z2ZA 1RRJA 1MSWD 5IP6A 2NNNA 3IM8A 2LY9A 2E35A 1S0MA 3OFGA 1AZSA 2HYGD 4DYQA 2GQCA 5K20B 5E3QA 2KO1A 3MEEB 2IGOA 4S05A 3BCBA 4R5PA 1PC4A 5DDQC 4X0GA 2Y0MA 2QFIA 5CVRA 5C4JJ 5D5VB 2HIQA 4Q7AA 2COLA 4LMYA 2CYYA 1KQGB 2XSJC 1Q8LA 4I7FA 4Y2MA 2J0WA 1OR7A 1CG2A 2Q66A 4RMNA 3C14A 4U67Q 4ASNA 3BF4A 4TU8A 1Q79A 3I55S 2YNGB 5GVQA 2HPUA 4B9TA 3AKZA 4IDKA 3GWCA 2XMMA 4G1QB 1S12A 3C7JA 3AODA 3HI9A 2EG1A 2DAOA 1F1BB 4BH9A 3VWBA 1S1XA 4X66J 2ELJA 2DH8A 3PUFA 1Z9CA 2KFZA 3U1DA 1CC8A 3G86A 5KTQA 2MKYA 3D3CJ 3L7UA 3BR2A 4XLHA 4XN0A 4KGZB 3H5UA 3BG6A 2HHHF 2ZE2A 3BO2A 4LBHA 2H54B 4UV9A 3DM2A 4Q8EA 2KHDA 4WCGA 1FWKA 3I96A 1PJRA 2HOAA 1PIEA 3PM1A 3MAHA 1WG5A 1EARA 4F92B 1NHVA 2V2ZA 3O3LA 3VAIA 3NBPA 1YX5A 2BKNA 3D54A 3K6GA 1JE8A 3GONA 3QYFA 4YRVA 1OPZA 2ZWPA 3MECB 4B44A 3FIWA 4ZCMA 4IOAQ 2I5UA 3CCRS 3A3OB 3N4WA 3TJ8A 4ZLPA 1SMYF 4KA4A 2Q0OA 1SUQA 2J9EA 5K5MA 1L3VA 3WC2A 1CF7B 2ZH2A 4F7ZA 1X9SA 2NLWA 3CCLI 1S9HA 2QEXS 4OIXA 1I1SA 2XMJA 1Z7UA 1IAWA 2HU9A 1LDDA 4F04B 4KH0B 3GIKA 1WI8A 4RGSA 1JMTA 2XLIA 4FASD 3NWTA 3NY0A 2DPUA 3G6YA 1REVA 1ODDA 1PJ6A 5E1XA 2B6AA 2EB7A 3Q0AA 4E0DA 1KKHA 2ZOFA 2M2EA 2M0GB 2QV6A 2AGPA 2XMKA 2DNLA 1N4LA 5A8WA 1IKWA 2QJ3A 3UR0A 5EG0B 5EJCA 2XGQA 3CCSI 1WF2A 3SEOA 2ZNYA 1VQOI 4GGGA 1FEEA 2XQCA 1QD1A 3W5YA 2XB0X 3CJ2A 5B0AA 4DQQA 1S59A 5K8OA 4OHXA 4BQNA 1KC8T 2BVMA 1VK8A 4ZVPB 4ECVA 4DR5F 1WI9A 3ISNC 4IG0A 4B9UA 4FTHA 3UD5A 3IFEA 4DDFA 2NYIA 4HTJA 1ZG1A 2VQLA 3HKWA 4C8KA 4Y2IA 4W97A 5KFOA 2JFKA 4C8OA 2CJXB 4ZTJA 2L01A 4OHYA 3MM8B 3FBNB 1HQEB 3I87A 4F0KA 1EAYC 2CG4A 4FQGA 3DDNA 4DYCA 1LEBA 2DJWA 4ZJOA 2PFBA 1R0CB 2F8EX 2IM2A 2A0FB 4LB5A 5F08A 3M9MB 2HFNA 4NXNJ 1TKTA 1IBKJ 4UB8C 3IC7A 5KFWA 1LWEB 2MYFA 4ECSA 3CC2I 1RUOA 4ZCLA 3MPUB 1AUDA 4B3OB 2CU7A 2M9HA 4CTAA 3N5BA 1RYSA 5DM6Q 1E6VB 2W2PP 1Y8QB 5HMWA 4J9KA 4PZJA 2MJUA 3IO1A 2LBFB 3SMZA 3JQMA 2DYAA 3PKMA 1TWCJ 2AT1B 2KMUA 2W9CA 3U1MA 2L7FP 5J2MB 4IRKA 4XRFA 2WVFA 4OV1A 3AG4H 4ZKAA 1SC3B 2YX7A 3JRHA 5HJXA 4LVNP 1ENHA 1R71A 2HHUA 1SQFA 1RT4B 3DDKA 2AHQA 1U1QA 1WEYA 4KV8A 2EW9A 1Y11A 4ANJA 4HBLA 3R0JA 1TP7A 3JS9A 2N3LA 3VALA 4UHTA 4RAYA 1KEKA 4Y4RA 2XZDB 3I32A 4DUZJ 2W2QP 1BC8C 1S9GB 3MCOA 1TU0B 3GV7B 3BLYA 3NKYA 5KFTA 3Q22A 1K9MT 2VD3A 5I4MA 2RILA 3KPHA 1XMAA 4R0EA 2B4OA 4FF4A 2QG9B 2C42A 3W9JA 2Z2MA 3QFHA 2RQKA 3VYRB 2JEFA 1UW9A 2YR2A 4YEJA 2HFUA 2XHCA 2PN6A 1KU9A 2XAJA 3NAHA 3DOLB 2EPFA 3T1YJ 3SCLE 4WZQA 1XMBA 3NAIA 4BBRJ 1RHUB 2DXIA 1YHQS 2CQXA 1SD7A 2UVRA 3GP9A 3GYNA 3C8YA 4XKCA 3IRXB 3MEGB 2W4PA 4FYDA 2DYSH 3M1CA 2KT3A 4V2GA 4ZK7M 2MGQA 4FE4A 4UV8A 1KP6A 4FPIA 1Y1VJ 2YPZA 2CZ9A 3U27A 4LF2A 2AXTC 5J2NA 3CD6S 1HR0F 4RDUA 4ICLB 2VBYA 5HQLA 4YY3J 1ZLKA 3H0DA 3VSKA 4C11B 4HF2A 2XSJA 2QQBA 2I10A 1UFMA 2ZD1B 3GB0A 1WG1A 2HXOA 4PGHA 4OX9F 4YB1P 4K7QA 5G0RA 4DV5J 2HNDA 2BV3A 5HBMA 3OVAA 3BG9A 6AT1B 3O1LA 1AA7A 2X85A 1Y6IA 4DS4A 4OZ5A 2WA0A 2JFDA 5A6WA 3NRVA 2OAUA 3Q0WA 3TBIA 4O3PA 2CS3A 4RB2C 3BBCA 5E1WA 1HL6A 2HQGA 2JJ7A 1JLGA 1RHJB 4M5JA 2KRHA 3D6MB 2R92J 3MMBB 1D8JA 1NBEB 4ZA1A 3PHEA 3MFHA 4ITSA 4JI7J 3W6JB 2LD5A 4QWBA 1VQ8I 1SKUB 3G87A 3UE2A 2MSSA 3P49B 3WTXC 3QP5A 2VF3A 1U78A 4RB3C 2J0SD 1TLHB 3EYYA 2DGTA 5DCFA 4QCLA 1F3FA 1BI2A 4DHVA 2BKOA 3P9IA 1VQ5I 3IN5A 2FZGB 3H5RA 4P2MA 5L3GA 1YK9A 4JV0A 3ISND 4DV0F 2I5JB 2XF7A 3FMSA 3FHZA 3EPZA 5KVRA 2YQ3A 5ERIA 3EX7B 2ZHBA 5A2QK 1S48A 1YG0A 2CPIA 3N5FA 2ASLA 5D6GA 3MURP 2DR8A 3DC2A 2YNGA 5C44J 2ZBRA 3GLJA 3ECOA 5F1JA 1DP3A 3A12A 4WTYA 3SDBA 1UPMB 4XKWA 4G1QA 4WYWA 5DQGA 2JSPA 2CW8A 1WJBA 4OJHA 2VOOA 1PUFB 1N5YB 1RT1B 3GYGA 4BXUA 2B9YA 2DMNA 3HZEA 2OA4A 1RTDB 3UN2A 3V4MA 3VTIA 2K3PA 1IF1A 2HOSA 1DTTB 4JI5J 4ZJZA 2QSWA 3CSKA 3F41A 4NQWB 2JJ4D 2JPCA 5LGTA 2DVIA 2QL9B 2DR7A 1W25A 4JV2A 3FXKA 2ZB9A 4ZDNA 4G9YA 4OMFG 3CZ6A 2N7CA 1BN5A 3CCQI 3IHUA 2M7AA 3SIPB 3FUYA 2XB5A 4AD6A 2HQAA 1BD6A 3F23A 3MECA 2FHKA 4ZPVR 2MQ8A 4ANDA 2A18A 3SSQA 1HW2A 2ZJQQ 3BKUA 3AAFA 1TZ0A 5IYBJ 3D0SA 1CF7A 3GV8B 1H0MA 4DSKA 3BZKA 5ICEA 4Y2CA 2ZVIA 5IYCJ 3BGRB 3SDGA 4NCGB 2V9WA 1W36C 1TUVA 2ZVSA 1FOWA 1KQFB 2CVEA 3FZVA 3FEXB 4KUMA 2AD9A 1Y00A 2CW0F 1I6HJ 4F25A 1P1LA 1BGXT 1ZLJA 3EXCX 5KFFA 2GO9A 4AL6A 4WFBQ 2FPHX 4N4NB 3L00A 4LBIA 3K4MA 1IBLF 2ESNA 5E3AA 4NCBA 2MLGA 5KFHA 2VE8A 3ILOA 4K0KF 5BMZA 3VR1A 1JTXA 3ASNH 3M8RA 1F3VA 2QM3A 1SAUA 3FXLA 4HX4A 2AKWB 3ZTOA 2LEAA 5L9XA 2BJ7A 4WFYA 3MMYB 4EJVA 4QLCU 1AFJA 1ZN2A 2BW3B 1C1CA 2PGCA 5B0FA 4LRBA 4WFNQ 4X65J 4WKRA 3TP0A 3P96A 5BOXA 4ZYDA 3R6GB 4AQYJ 3H5NA 3LW5C 4HDVA 4DF8A 4R8HA 1BI3A 1HQEA 1FIAA 1EH8A 1K79A 1YRUA 3GTKJ 2AZ3A 2WRMA 4RNOA 3HL2A 2FXAA 2NUHA 2FNPA 1GXTA 2IIHA 5L38A 2G9WA 2JSCA 3PIPF 4P7TA 2XKPA 2W1BA 2YKPA 1LWEA 3EGNA 3DXSX 3BQ1A 3HT0A 4B3OA 1RXOB 1ETXA 2KFYA 2HQIA 2BW7A 1FBQA 2VC1A 2CQHA 2LBFA 4JI1J 2AF6A 1VQ6S 1HNXF 1ZA1B 4A0XA 1Q4RA 5J2MA 2XF5A 1AXQA 4MEYF 1NB2A 3CMQA 1S6PB 2YNFB 3A8EA 4B3TJ 2A05A 1HKQA 4O4RA 5KCMA 5JVTA 1RT4A 1JK9B 1OS5A 2YKOA 2CH0A 1W0UA 1OY9A 6FDRA 1S9EB 2XEXA 2V8PA 2M30A 3AD8C 3GLLA 1S9GA 2HZDA 5KFDA 4IHVA 2K3IA 1LVKA 2W2OP 4IQMA 1ZA2B 5MLCV 3SI8A 2JA2A 2AJQA 3GFJA 4XMYA 1PJ5A 4DX8H 2ZKZA 2DGVA 5C2CA 1FFGB 2VJVA 1S6UA 2VUMJ 1RLCL 5AE2A 4J9SA 3ZZOA 5JVGQ 2PA3A 1MD0A 4E7SA 2GA7A 4NBQA 4XPEA 3IMQJ 4KGVB 2QYCA 4AIJA 4HNUA 1PUEE 2CO5A 4KT5C 2Q3PA 3TDUC 2CDQA 4M3DA 3IRXA 4E2FB 1C0UB 4D9JA 3MEGA 3N4MA 4KC5A 3PSIA 4C8MA 2M8DB 2M3AA 1RETA 1K1SA 1P4WA 2CJBA 2E9TA 2D3O1 2KL4A 2GW8A 2NSBA 4A12A 1N5VA 4CH1A 4KN7X 5EWGA 4DNCA 1RTJA 4LF7F 3A02A 3TP3A 2GOMA 1FP2A 5E20A 2MQLA 3EUNA 2MSTA 4ICLA 2VDIA 5LRRA 3DTKA 3ITHB 5F8HA 4PFOA 4RWXA 3L2CA 1DAXA 3KCCA 1RT3B 3PX4A 1V3ZA 3F22A 2ZD1A 3OIPA 2YWEA 1AFIA 4V1Ak 2X0LA 4UXNA 5AXKA 3IS9B 4LLLA 4J9MA 4M5DB 1NDPA 2P6TA 5CVVA 5LBQA 2C3OA 1VC6A 2Z0GA 5J2PB 4NC6A 2H4WB 3RU0A 4U7UK 1VIXA 4JI6F 3RBEA 1VTNC 1V5GA 4F52A 5BS6A 2CXEA 3VAKA 2D3OR 2MMYA 3CO6C 2LA6A 1WGXA 1G59A 4MFEA 2RU3A 3OOPA 3ZNUA 3FCHA 2ESHA 1NO8A 4NLWA 1U7LA 3MMBA 4ZPTR 1QBJA 2BM1A 1J0RA 3FFIB 1D8ZA 4JI0F 2R7ZJ 1JXSA 2RHQB 1UKUA 5A2QU 2OPRB 1FRMA 1S72I 1S1TB 3PRVA 4C3JJ 2XC7A 3RPUD 3KK3B 3BDPA 4NE9C 2CPEA 4KHPF 1HWKA 5KG1A 1LWFA 1FPQA 3TVKA 2J7WA 5E8GA 1MDMB 2VA3A 4TNOA 3IXQA 2BY2A 4AC0A 4A8WA 1VJQA 4ZITA 2F65A 2KKOA 2MHEA 4MMOA 1RESA 3NGDA 3ICLA 2K02A 1BI1A 3LF0A 2HWVA 3K69A 1NH7A 1XN9A 3FKBA 2KIQA 1M1KT 3A13A 5F8JA 5HQ8A 3RAQA 2I5JA 3NXZA 4EGZA 1R89A 2KT0A 3FXUA 3ZQHA 4BXXJ 2F3JA 1NK4A 1KQ0A 2GVZB 2BX6A 3K1MA 2O61A 3WTTC 2GJFA 5BYQA 2ZEJA 1X58A 1ZGJA 4ZDPA 2XSDC 1RK8A 1N78A 2HGMA 5GMEA 1XR7A 5KAIC 1YYVA 3U9GA 2ZNZA 1N5YA 2CUFA 1RT1A 3MM5B 4Z37A 2AX0A 4RW8B 3GX4X 2JVGA 1A6IA 1RTDA 1G2EA 5AJ3F 5H6RA 1DTTA 5C24B 4OYMA 4DLGA 2DYRH 4PJNA 4AWXB 2CUEA 3OT9A 2GXBA 4NQWA 3HULA 4AUKA 1QHHD 1NRKA 3HKZD 2QMWA 1S79A 3W3CA 2N4CA 3BJOA 4O3SA 2DHHA 2GQQA 4ZPDA 1UCRA 1PKUA 5IP9J 4X64J 4DL2A 3M9OB 1YFHA 1J5EJ 1IM4A 3QGHA 4KGMA 2W82A 3W5XA 1UW4A 3BR5A 3BG3A 3Q2SC 3LA2A 3OIOA 2BE2A 2BE5F 3GIJA 3MWMA 4TY9A 4B9NA 2DNHA 2YNHB 2VE9A 3IR7B 4PR6A 3FM3A 4XNFA 2XRLA 1YQHA 1VQ9S 1HOMA 2WBRA 2DDAA 3EZUA 2JH3A 4AIHA 3BGRA 1B0PA 2WY7Q 3J7ZI 1SL2A 3G8SA 1PILA 4NCGA 2KLOA 3RJMB 3K4JA 2J5PA 4OYWA 1UVNA 3AHPA 2IVMA 3JCUC 1OYDA 4KY3A 1EP4A 4ECRA 3MEXA 1PYVA 1LWCB 1ZG5A 1HBXG 3I5BA 5LEKA 4U6PA 2CUJA 2NUUG 4LRCA 1FWZA 3BH7B 3R0AA 3RGIA 5GPAA 2L9RA 3BO3A 5HDKA 2XF6A 1E3OC 1BM9A 4Q2LA 4RAFA 5CVJA 5K8PA 2HVRA 2GFFA 3BSNA 3ML6A 2M70A 2KRBA 3F8CA 3IUOA 5DLFA 1TT0A 5DGAA 2BANB 3ZMDA 4OMYA 5LJ3Y 1ITYA 2K3FA 3W2VB 5L3EA 2DXDA 4HSTA 2ZJPF 5EGYA 1K44A 2W7NA 2BE9B 2UUZA 1O3RA 4OZLA 3NG8A 4N4OB 4PDKA 1QJHA 4B3MF 2GJIA 5IV3A 3PM9A 2UXXA 3MPDA 4NRUA 1K0VA 2RVCA 4G7HF 2COBA 2JSXA 4IOCQ 2YWKA 1KOOA 4WJBA 3M32B 2DO4A 4RPFA 4LR7A 2L02A 2HK3A 3AA8A 3FNNA 2Y0SD 4CLTA 2DPIA 3EPGA 1YVFA 2CQBA 2NZ4A 4OX8A 1DPRA 1LPQA 5D5UB 2HHHJ 1X4GA 1MMDA 2M87A 1I39A 1GV5A 4LT6A 1YW7A 4F4ZA 3O44A 1YIJI 1W7WA 1QSLA 1FJCA 3V8JA 4RBUA 3ZMZA 4PWDB 3WHBA 5AIPA 1S6PA 1NMEB 2YNFA 3E5XA 2O1PA 2MZRA 2A69F 1CS4B 1J7KA 2XV4S 1HLWA 1N33J 1S29A 2UU9F 3BTLA 2IJLA 1S9EA 2HNZB 1ETQA 1D5VA 2RUGA 1Q78A 2DKOB 1XJWB 3QWUA 3OXGA 1HFEL 2CMPA 3WTYC 2GA2A 4A8YA 4TYAA 1RAFB 1WTBA 2XNRA 3WGIA 4PAAA 1BJAA 2CJAA 4GYIA 1QZEA 4DR3F 3EETA 2Y0SA 5L3CA 2MB0B 4RNHA 4M9XA 2XZWA 1P9QC 1SEUA 4OZ2A 3HHLB 2YSRA 2A61A 3EDPA 4ES2A 2XS7A 4X4UA 5BPIA 1C0UA 4BJ5C 2K7JA 2VICA 3MR2A 3OR1A 3N0VA 5C42B 5KFKA 1WEXA 4FYYB 2B3TB 3QP6A 3K5PA 1XQIA 4TYBA 5E8IA 3HG9A 2LCWA 1QHGA 2ELKA 5LMNF 5DCMB 1R9TJ 3DTEA 4KICA 4M5NA 2C2KB 3CDHA 3ITHA 4X4SA 3L2UA 2NVTJ 3LP0B 5J1NA 1RT3A 4NYZA 4IHYA 4NL5A 1RTZA 4IFYB 2KHCA 2R5ZB 3SYTA 2UXCJ 3IS9A 1W1WE 3G73A 5E7OB 3ZMUA 5F1RA 4M5DA 2DA1A 1MU2B 3F0CA 3TO7A 1LW0B 4PG4A 3RZAA 5J2PA 1HF0A 2FC8A 5HS9A 3DBLB 3HVAA 3PX0A 7FDRA 4ED8A 4OIOF 3EXYA 1X0FA 1DURA 2MG4A 3G1MA 3VYTB 3W63A 3BKTA 2HZTA 4DSEA 3MR3A 4S04A 4IZZA 1UJ4A 5FKKA 4PKDB 3V4IA 3KZZA 1HI0P 2VKDA 3HHLC 3C6UA 3FFIA 4N7TA 1R4MB 2X1FA 1CJTB 1YO5C 3S1NJ 4CO4A 2OPRA 1BR1A 2LK2A 1S1TA 1EETB 1SH2A 4AYBN 3KK3A 4BWJA 4RNFA 4QQBA 3ADAC 1VBYA 1LDKB 1KVJA 1MDMA 2H3EB 4DV6F 3I54A 4M5KA 1XD7A 1TVRB 3UDVA 4NWBA 2XVCA 4RNNA 4NB5A 3KHHA 1KU7A 4RU9A 2L54A 4I2PB 1OQ6A 4KFCA 1I5ZA 1PP7U 1M1EB 1ETVA 4M63A 3JRBA 1CJKB 2FVSA 2DFFA 5HODA 2GVZA 4DFPA 1S7IA 1WKJA 1B4SA 3H3UA 3CWJA 2R2TA 3AB2B 3JRAA 4PYDA 1W26A 2QSFA 1IV8A 4H0EA 3QRFF 2DU9A 1ZAWA 2Z8QA 3UW1A 3FGVA 3CCJS 2JDJA 1QVGR 1ULYA 3KHLA 3I4PA 3FBFA 5A6PA 3CO0P 4NX9A 3BO4A 2DGXA 2QF7A 2KZGA 3MM5A 2XM3A 1LE8B 4RW8A 1T56A 2HHWA 1RYRA 4ZZDA 1BC6A 5HLHA 2E5HA 2OCEA 3QGPA 4W4MA 5C24A 3AAWB 3H9QA 4C30A 3P6YC 2A6TA 4ZJLA 5D0HA 2L5QA 4D7NA 1FRKA 1JXVA 3G1LA 3GZ5A 3O5TB 2Y1LB 4DPWA 4A6EA 5LHGA 2UV1A 2CQ1A 3JREA 1VJWA 1KTVA 2HOEA 4MEXF 1VS3A 3JRDA 1R5HA 2UXBJ 5ETPA 4JUZA 1HNVB 4LG0B 4A8MP 4EO8A 4Z7CA 2XI2A 4HA8A 3SFIA 3NWRA 2LVWA 1HR0J 4QU7A 4OYZA 2HW3A 4DOZA 2VFTA 3RKYA 1RIOH 2O03A 2RVJA 1OWXA 1R8CA 1T05B 1F9FA 3DP7A 3M4OJ 2R8IA 4IH7A 2BVZA 4YIFA 4NCAA 2YNHA 2E1MB 3MUTP 3QNWB 5A76A 3KLFB 2FD5A 4X4PA 2O66A 3T1AA 1NHAA 2A5YB 2EFNA 5FROA 1PDNC 2GIFA 1W2BR 1JGSA 3DLKB 2VQEF 4JX5A 3GU0A 5ETRA 4L9VA 3CTRA 3CTAA 1WCMJ 2CPJA 1YI2I 3A3NB 4NLDA 2V34A 2MH9A 3QOPA 4L5IA 2VL8A 2NVYJ 3GFHA 4G6TB 4OQJA 2D7SA 4BCAA 2B8QA 2XNQA 2PFDA 2BGCA 1NHUA 1LWCA 4YB6A 4NYPA 4G1PA 4QYRA 4J9LA 3HGYA 4GO1A 2HXIA 4BE0A 4AFFA 2BHZA 2JT1A 2PT0A 4HT7A 4IOAF 5G4DA 4PQUB 2LYCA 5C25B 3GLXA 3I71A 2Z30B