2CG4A

Structure of e.coli asnc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
b'YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN ASNC
publication title Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cg4A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cg4A02
1L0OC 5DCMB 1ZLJA 4L5JA 3HIFA 3KP5A 1KQ0A 1J5YA 2H09A 2NAZA 3ECHA 2OA4A 2QM3A 3FX3A 3I5UA 4BAYA 4HX7A 2A5YB 2XGXA 4RGSA 5JHUA 4HW0A 1MD0A 4A0ZA 4YIIA 2ZMEB 1BBYA 2JTVA 1I1SA 2BE5F 4ENNA 3IWZA 2CVIA 2QYOA 4LD5A 1D3YA 1MJ9A 2JT1A 4LLLA 4KDPA 2STTA 1TW3A 1IN8A 4HX4A 3ZMTA 5CVVA 1FNNA 4ZYDA 2FBHA 1O3SA 3F3XA 4MTDA 2JPCA 4E70A 2PMHA 2RC4A 5ERIA 2A69F 5FLXZ 2FMLA 3H3ZA 1UFMA 3MCZA 1TNSA 4MGRA 2XAHA 2R3SA 1GXQA 2E1AA 2EFOA 1D8JA 3W6JB 4YFKF 1G4DA 2A6HF 3CUQB 4AVPA 1TW2A 2JSCA 4KYWA 4GGGA 3FXRA 4M72A 1XGMA 2L01A 5AIQA 5ICGA 3GVAA 4HF2A 2GIVA 5E8IA 2G7UA 3R0AA 4Y17A 2OU2A 3F8MA 3ABTA 2DQRA 1I27A 3K1PA 4H0EA 5KVRA 2P7CB 3IRRA 3GZ6A 1FSHA 2UWMA 4B09A 1BI0A 1J9IA 3M8EA 4MTEA 4CICA 2ZNYA 1ZARA 5D5XB 2V9VA 1FP1D 4U88A 1CF7B 4QWQA 4HF1A 2HDCA 1Z05A 2IA2A 3HSRA 2O03A 4AD9A 1I5ZA 2OAZA 4HZFA 1QQIA 1USTA 2O8XA 4Y13A 2XIGA 4YFNF 5BS6A 3ZPLA 4XLPF 4ON0A 1FY7A 4GYGA 1Q1HA 5HDKA 1YG2A 1Z91A 2Z5UA 1KYWA 1Z9CA 1XSVA 2DT5A 5H6QA 3P7NA 3Q9VA 5DD4A 4A6EA 4WWCA 4YIFA 2FQ3A 4WF2A 2IJLA 2K4BA 4CGZA 2VE8A 4M9SA 1SD7A 1SFEA 2XKPA 1RNLA 1FSEA 3CO6C 4IRGA 4ZYHA 1IN4A 3LAPA 4OIQF 1P4AA 3N97A 3RDIA 5CYVA 1DP7P 3WTSC 1BOAA 4I02A 4RGRA 3BOQA 1BN5A 2UXNA 4WCGA 3BZ6A 1IRFA 1IN6A 3K0LA 3V7RA 4CHUA 3DXJF 4S05A 3VEPA 2ISZA 1FLIA 1EH8A 3KP2A 2BYVE 5ILVA 1JGSA 1GVJA 3SXYA 3JSOA 2AXLA 5A2QK 2DK8A 1F4KA 2F5DA 1T98A 2IP2A 4BH9A 2V6CA 4LG0B 4K2EA 1ZGJA 5HS8A 1KU3A 3TOAA 1LVAA 1ZRFA 1JXSA 1XB4A 2MH9A 5FD5A 1E2XA 1FYLA 2EWNA 1WWXA 5LEKA 2L3DA 4HF0A 3I0TA 3K2ZA 2HKXA 1D8KA 4XRFA 1J2XA 5FO5A 3HRMA 1IXCA 2ACJA 3C7JA 2O61A 2FSWA 2K27A 3BWGA 1XCVA 3FMRA 4U0YA 5BPDA 4OIPF 2ZJ2A 3MWMA 2LF7A 3C3WA 1LNWA 2E7XA 1K6OA 5H20A 2ZKZA 4EQQA 5E18F 4AIKA 5CVJA 1MJAA 5EEHA 2HGCA 3RYPA 2HQNA 2GWRA 1T38A 4MEXF 1A04A 4IPAA 4XBFA 2W84A 3GZ5A 4R8HA 4M71A 2L54A 4U7DA 3WTYC 4A12A 5JR3A 4EM1A 4IVNA 3TOBA 2MD5A 4ETSA 1RUNA 3M8FA 2P5LC 2QQBA 3R4KA 1JHFA 4IRHA 1XSDA 3M7GA 1RI7A 2KJBA 4OINF 4QLCU 4HDVA 1XGNA 2Y0MA 3TKYA 5D4SA 3V4GA 2W57A 5BPIA 1PP8F 2VT3A 2V1XA 4EGZA 3HSEA 3HSFA 4ENMA 1O3RA 2CO5A 5K5RA 3HHGA 1FPQA 2DI3A 1ZAOA 3QOPA 1J75A 4HDUA 1SD6A 3SFZA 1KQ9A 3FXQA 2DLLA 2EV0A 1R7JA 2UXXA 3REOA 4ZYGA 5LRSA 3I59A 2EJRA 4Z2YA 4Y15A 3F21A 3FF5A 1VTNC 2VXZA 4HYEA 3QAHA 3J80K 2V79A 4BHPA 2XAQA 2DTRA 2P6TA 2V1DA 4IHSA 3OOPA 4EJTA 2EK5A 3EETA 2L02A 2IVMA 4A5MA 1S8NA 1Y0UA 4HLXA 2B0LA 1BIBA 3GUDA 4RAYA 1LQ1A 1HXDA 4O6JA 2LSOA 1KU2A 1B1BA 2KIUA 4I2OA 3GF2A 5IT9Z 2EB7A 2UZKA 4I01A 6PAXA 2ZMEA 1UHMA 4PCQA 3WE2A 4YFXF 3R60A 1LB2A 1TQPA 1ZREA 2Z4PA 2X4HA 1SAXA 4M9ZA 4P55A 3JW4A 4ENJA 3DFGA 2QBYA 5E20A 1Z1DA 5LHGA 5CVUA 4ESJA 3SHFA 1YFHA 2TDXA 2H94A 1R1TA 2HTSA 1B6AA 4FT8A 1V4RA 1QBJA 3L2CA 2PLYA 3WTWC 1LDJA 1I1GA 4EMSA 4KMUX 5LEJA 2MLKA 1KQ8A 4IF4A 2Z99A 5FFXA 3ZN0A 4N0BA 2Z9OA 3BPVA 1T0FA 1BIAA 5CVIA 2A6EF 1XDUA 1XGOA 3E6DA 2HYGD 2O3FA 3COAC 3KZZA 1P2FA 4GXOA 3DQVC 5E1XA 2VODA 2HS5A 1R58A 2R7DA 2GA2A 3K1MA 1SFUA 4KFCA 3CUQA 4A0XA 3IKVA 2DO7A 3FHZA 4LK0F 1ONVA 4G7HF 4RB2C 3F23A 4HX8A 1W7PD 3GW2A 2MH2A 1YYVA 1T39A 4I98B 2R7FA 1SMYF 3DP7A 1QZYA 2DPUA 1IXSB 4KIGA 3ZMDA 4EGYA 3L7WA 4L9NA 5BOXA 1EH7A 3V7SA 3ML6A 5E8GA 1HSJA 3WGGA 1DPRA 1P6RA 3I4PA 5AIPA 1KA8A 1CF7A 3QU3A 1G3SA 1XCBA 3K9TA 3SQNA 2KRFA 1XMAA 4KICA 4RGUA 1K78A 1OYWA 2CW0F 2P7VB 3RTRA 3L09A 1WQ2A 2F5CA 2CGPA 2Z33A 2ZO4A 3E5UA 3FXUA 4MNUA 1JE8A 3GLXA 1SD4A 3K69A 4UVAA 2DAOA 5K1YA 3W6KB 3HRSA 4BQAA 2A68F 1WRJA 3LA3A 4WX9A 4L0ZB 4I09A 2PI0A 1J59A 3MEXA 3L00A 1EV7A 3R61A 4IXAA 4LLNA 3T1BA 2IA1A 2PN6A 2Q8KA 3KZYA 3LQRA 4MHGA 3H3UA 1MDMB 1U78A 3KLOA 2XVCA 4HV5A 3V8JA 5AONA 3OV8A 2HZTA 5DUIA 2MLGA 2IT0A 2M30A 1BM9A 3IRQA 2OZUA 3CLOA 4L5IA 2QQ9A 3E6MA 1BI1A 3ZP5A 2IRFG 2DK5A 4LG0A 3PQKA 5IT3A 4JBAA 2D1VA 2OD5A 5HDNA 3RIRA 4R1HA 2FNPA 3F6VA 1U3EM 4N9HA 4ZZDA 3KP6A 1WKMA 5L3BA 4AIHA 4L9TA 2E7WA 3GXOA 2XUBA 3LAJA 1G3WA 1LEAA 1TQMA 3FM3A 1BC7C 1W4MA 3SZPA 2JPBA 2LDUA 5BMZA 2ZCWA 1H9GA 3M9AA 1ZLKA 3WGHA 3V7CA 2WC2A 3IKTA 4AIJA 2FBKA 2FXAA 5K5OA 2EFNA 3BROA 4PDKA 2M87A 4EJVA 1FT9A 4P5OA 1W5TA 2QENA 2VC0A 3DV8A 2E1NA 3F6OA 3WTXC 2Y48A 1PUEE 1K79A 2Y75A 1SMTA 4A6DA 4D0PA 5DUKA 2VBWA 3BY6A 1G6NA 4BXUA 4RGXA 1P92A 1ZHFA 2RN7A 4L9JA 5JVTA 2PJPA 4DNCA 3GFLA 2EV5A 2CYYA 3RKXA 1FC3A 1UCRA 3C1DA 5H6RA 2VBZA 4Q48A 2A3SA 3VODA 3EYYA 1AWCA 4EM2A 5D6EA 3TDZC 4A0YA 2RVCA 3QP5A 2EV6A 3GFJA 2PEXA 4G7ZF 4HQEA 1X3UA 2EFQA 4G9YA 4G94A 1R1VA 5LGTA 1G3YA 2HKOA 2OZ6A 1ZG3A 4I0AA 1AOYA 3RPUA 3I54A 2A61A 3U9GA 4UVBA 5JI6A 3T8TA 1U5TC 1YS6A 5HLIA 5D8KB 1B9MA 2CWEA 4U0VA 1BI2A 5FFZA 1IAWA 1DPUA 2ZBCA 1R5GA 2XAFA 1YIOA 1T6SA 1FOKA 5DV5A 4LFUA 4M6XA 4ESBA 1IN7A 5F6FA 3H92A 2WWYA 4RS8A 5ICEA 3LWFA 2M5WA 4HQMA 2AS5F 3P9IA 2H6CA 3BP8A 1JHHA 3WTZA 1YW7A 2O0YA 5D4RA 1ZGAA 2RV8A 5K5QA 1ZN2A 5LGNA 3HTUA 2ZFWA 1SFXA 2H27A 1R00A 3U1DA 2IPQX 4NQWA 1BJAA 3HHHA 4OIRF 4DQ2A 3WGIA 5E17F 3ULQB 3O2PE 5TRDA 4HOBA 3IL2A 3J81K 3ZMVA 2V1UA 3WTUC 1KU7A 2BGCA 1R36A 4PZJA 3KLNA 3TO9A 5A2QZ 2JRTA 2VE9A 4KIFA 2DJWA 5HDGA 3IWFA 1GHCA 2KJCA 3R0JA 2L4AA 3GFIA 3K1NA 1ZRCA 2DFIA 3Q9SA 3RYRA 1WSUA 1O57A 1HSTA 4FX0A 2LKPA 2DQLA 3HOSA 2RKHA 1YS7A 5HLHA 4ESFA 3QRFF 1OMIA 4RB1A 2GXBA 4UUVA 3ELKA 1U5TB 3GEZA 3JAMK 1GXPA 3CO7C 1PDNC 3V8LA 4OU0A 3HYIA 3LA7A 4UHTA 5DCMA 5CJ9A 4U0WA 1XD7A 4CO8A 4KIBA 1P4WA 2OQRA 4MQVA 4NHJA 4UVCA 1Z6RA 4LLGF 3HRTA 2BV6A 4HLYA 2D45A 5HVQC 3HUGA 2YPRA 3G3ZA 1YTYA 2GA1A 2DPDA 5D6FA 1IZ1A 4CDGA 3NRVA 3KP4A 4MQ9F 4LGWA 1F9NA 2XRNA 3BDDA 2D2WA 2RGVA 2K86A 3S2WA 4Q47A 2HTJA 1PP7U 3RI4A 3J7AO 2KIMA 1O3TA 3Q5FA 2M8EA 4PGHA 5J8FA 5L3CA 4UXNA 3ABUA 3CDHA 1RIOH 3FMQA 1J0RA 1ZRDA 2XAJA 2C6YA 2CG4A 5ICFA 2EA4A 2OBPA 2K02A 3QPHA 5HOOA 2ELHA 2PG4A 4RAZA 2P8TA 4ZH4F 1REPC 2CQKA 2VOPA 2ADUA 1B9NA 5CLSA 3JTHA 3BJOA 5FLXK 1L3LA 3ZQ7A 3NQOA 4RB0A 5LLQA 1YW9A 3ZMSA 1MDMA 3GYHX 3J80Z 1W7PB 2NS0A 2WTEA 3F8CA 2G9WA 2JSXA 4GCVA 2HWVA 1XMKA 1ON1A 3BJAA 2RDPA 1IXRC 2CSOA 4GYIA 4EV0A 1IN5A 1HW5A 3L9FA 4S04A 2J5PA 4FX4A 1YO5C 1S29A 5HS9A 5DDGA 4CXFA 5LGUA 3E3VA 5J8CA 3DF8A 2PMUA 1HKSA 4FHTA 4KN7X 1ON2A 2M45A 1R23A 2GAUA 3FZVA 4O5VA 1H9TA 4WXHA 3KEOA 2F5EA 3D0SA 2XAGA 3O3KA 2ZXJA 5LHIA 3CUOA 4HBLA 1MGTA 3MZYA 5ICCA 5D5UB 4LB6B 2LNBA 4L18B 2QQAA 4HAMA 1S7OA 2QLZA 2MC3A 2M1BA 1S7AA 1TQIA 1ULYA 4BNCA 3MFKA 4GO1A 3ERED 2KIFA 4KMFA 2QBYB 3KP7A 2P6SA 1HW2A 3KP3A 3WTVC 5TJJA 1W5SA 3KETA 3KCCA 1XN7A 4CZZA 5JFRA 3RKWA 2P5KA 1P4XA 2VOOA 4G7OF 4G8XA 2F2EA 1TBXA 4IRIA 4A2UA 1K7AA 1RZ4A 1LDDA 5L3GA 1TTYA 3ROUA 1E17A 5BQTA 2YR2A 3MZHA 2IW5A 2ZBKA 2A07F 1ZH5A 4OMZA 4EM0B 1H0MA 2Q0OA 2XROA 5L3DA 3VFZA 1I6XA 1S3JA 2MBFA 3T5XA 1CGPA 1MKMA 4KN4X 3TDUC 1KGSA 2GQQA 5F64A 5ILSA 3SZTA 1XGSA 4KNYA 4L9VA 2YSRA 4LMYA 4ENKA 2MA3A 1HBXG 2XV4S 5DEQA 2LF8A 1OYIA 2F5FA 5F1RA 3B02A 1FYKA 4XLNF 4ASNA 4O3MA 5HLGA 3CJNA 4LK1F 2VT2A 2FEZA 1BI3A 3ZN1A 4MEYF 2NYXA 1LDKB 4M9XA 1QO0D 3EUHA 2NRAC 3RKYA 3WE3A 2VONA 2ZNZA 1WI9A 4UV9A 1QGPA 2FBIA 3G73A 3LFKA 1K78B 4U7BA 1C0WA 1EH6A 1FYMA 5DYMA 3F22A 1O7FA 1LEBA 5LBQA 3IC7A 1DDNA 3EDPA 3RJPA 3P9KA 2FF4A 2ESNA 3P9CA 3WTTC 2K4JA 1O7LA 3N4MA 2PQ8A 4EJOA 5D5VB 1U6GA 3TQNA 2VBYA 3ZMZA 2DW4A 2YX7A 3WODF 4ZYEA 4OIOF 4BYYA 1R5HA 3QPTA 3O6BB 4WXCA 3TGNA 2P4WA 1KYZA 3AAFA 2L4MA 3DEUA 5D8LB 2ETHA 3I53A 3E5QA 3RPQA 2FOKA 1NHAA 2CFXA 2HOEA 1SD5A 3CTAA 2FA5A 4IJAA 3BJ6A 2G7HA 3GO5A 3EYIA 3F72A 2D1HA 1OR7A 3DKWA 5ED4A 4OOIA 2COMA 2W25A 4WXDA 4NB5A 1TLHB 1LJ9A 4M73A 3LSTA 1U2WA 1HKQA 1FBUA 1D5VA 5DCFA 2RQPA 1O3QA 3WG9A 2GZWA 5ILUA 2WV0A 3TO7A 4B8XA 2Q2EA 3E6BA 1U5TA 3BPXA 3ZMUA 3WU1B 1V3FA 3EQLF 3HRUA 4HV6A 4TV7A 3FM5A 2XHKA 2VBXA 1Z7UA 2HR3A 4I0BA 3GX4X 1RUOA 1TNTA 2JZYA 1R22A 1UB9A 2XASA 4G6DA 3F8BA 4HA8A 5D5WB 1ZG5A 4ZZLA 1J7KA 1QZZA 1DUXC 5IT9K 2NNNA 3T8RA 2Z3YA 1S6LA 1XSXA 2PBIA 3HOTA 2FU4A 1STZA 4LB5A 4AWXB 4WK8F 3E6CC 3KEQA 2BBYA 2H6BA 1UHWA 1QPMA 4PGGA 3ECOA 4KA4A 2DBBA 2K7LA 1OPCA 3I58A 3F8NA 2RNJA 4M6YA 4F7ZA 2BEOA 2QZ8A 1MJBA 4JK1X 4RB3C 3KFWX 2VN2A 3JSPA 4KUMA 1F5TA 1ZYRF 4XSZF 4YG2F 2P5VA 3FMSA 5CVRA 1R1UA 3C18A 2EFPA 2E1CA 4KT5C 2PFBA 1G3TA 2FE3A 1Z6TA 3R6SA 3MQ0A 1USSA 5LRRA 3PFIA 2W24A 4R79A 3VB2A 2EA2A 4L0YB 4OMYA 3QP6A 1W7PA 1IW7F 2X0LA 2YX4A 1HW1A 1FZPB 3E5XA 1B59A 2FRHA 2GXGA 5DD8A 4XSXF 5FGMA 3DPTA 1FWZA 4M74A 2QUFA 2YU3A 4JQFA 4LJZF 3GWZA 5EEGA 4EVIA 3WU0A 1ZG1A 4UNOA 3VOEA 2HYFA 1FP2A 1T2KA 1OYYA 3GFMA 2KKOA 5FB2A 1XDSA 2XKOA 1FBSA 4EJWA 3PQJA 3I64A 2ESHA 1QNTA 5HS7A 2IA0A 3U2RA 2EFWA 3KE2A 3B73A 5E1ZB 3E97A 3DPLC 4UV8A 1IF1A 5L3FA 1FX7A 3J81Z 5L3EA 2HEOA 1MZBA 2OQGA 3T0YA 2STWA 2O6GE 4CYDA 1YLFA 1BC8C 3IHUA 4EJUA 1HKTA 2J5OA 4N9IA 3I71A 3MAJA 5FD6A 1YQAA 3ISPA 3LA2A 4BHBA 1YW8A 5KK1A 4Q4ZF 1U8RA 2DU9A 1F1ZA 4P96A 1OKRA 3V8KA 2W85A 2ISYA 3LQQA 2QVOA 3FWEA 1ODDA 3CUQC 5E1WA 3D5LA 4IHTA 4Q5SF 1FBQA 2HQRA 3I59B 1HQCA 3QU6A 4G6QA 3M1EA 1IUYA 1KU9A 3JAMZ 5J6XA 2HFHA 4P9UA 4BHCA 1B4AA 4I7HA 5LHHA 1IRGA 2FMYA 2NNYA 3NEUA 3F8FA 3HTSB 3JTGA 4A5NA 2FNAA 4P9FA 2VC1A 2QWWA 3TO6A
chains in the Genus database with same CATH superfamily
3CD6I 1L0OC 1ZLJA 1S9EA 2H5EA 1LEOA 2DO4A 2H09A 4JX5A 3ECHA 5A6PA 4BAYA 2LBFB 3BGRA 3S01A 1I5OB 3S3NA 4ZS6A 1CULB 4CYCA 3LP0A 2UXDF 3HUGB 4YIIA 1PBUA 2X6OA 4QU7A 2RQ4A 2VQFJ 3THTA 3PXGa 2E19A 4ZPWR 3PYEA 4CM2A 4ECQA 2FY1A 2H3EB 2CVIA 5KAKA 1N33J 3C14B 3VGUA 5IP6A 4JI8J 2BZTA 1KRPA 2VQGA 1VQ5I 3H4BA 2GFFA 1TT5B 1J09A 1O8BA 4DR7J 2ZHBA 4KDPA 4FPIA 1GX5A 3VAJA 1M1KT 2VQCA 2V50A 3OTCA 5FROA 1IN8A 3S1MJ 3JSRA 5A0YB 2HFUA 4TU7A 5CVVA 4ZVUB 4Y2AA 4EBEA 1VR6A 4UY85 1O3SA 2QLBB 3LGHA 1X5SA 2L48A 2Z2YB 4MTDA 1RKTA 4FXVA 3CJQA 2DNLA 2HOTA 2A69F 1EB0A 3DRSA 4OQJA 1RLDA 2NR0A 1E0EA 4MGRA 2MGZB 4RZRA 2EFOA 1XNRJ 1B72A 4JOMA 2BRKA 3V2UC 2MPUA 4YFKF 3AKZA 3JRBA 2A6HF 3PX0A 3CUQB 1JKHB 1KQKA 1G7CB 3OR2A 1IJWC 2QL7B 2WB1D 4OYZA 2I6WA 3TAQA 2L01A 4QTRA 3G6EI 3IRXB 1MNMC 4CTAB 4DPXA 4C48A 4XRSA 2M70A 5DM6F 2GIVA 2WOMB 1X8DA 3CCJI 4LREA 2P0WA 2FZCB 4RLQA 4ANJA 5KVRA 1ZA2B 4JI7F 3K17A 2RDIA 3GZ6A 1AUDA 3OXLA 4M3FA 1FSHA 3DGPA 4MH8A 4CCHA 1J9IA 3M8EA 3RR7A 2ZNYA 3C2HA 2EZIA 4EFAC 3X3UA 3KJFB 2IYGA 2V9VA 3T5KA 3C2GA 4A8YA 4MFBB 4RR5A 2RS2A 4LRCA 2NLWA 4K4SA 4ANCA 4I6ZA 2VKRA 2IA2A 4ZP7A 4DFJA 1I5ZA 2W00A 2OAZA 3QWLA 1RTZA 1YJVA 3JRIA 1XK8A 3BPSP 1X19A 1T9UA 3EWGA 4A3MJ 3ZPLA 1U47A 1AYEA 4XLPF 1IQTA 1FY7A 3AODA 2NXUA 1T9WA 3M8QA 4HDGA 5A2QU 2B0GA 1TP7A 5J1RA 1YG2A 3HOXJ 1HNXJ 2Z5UA 5HP1A 5HL7Q 3GSIA 1Z9CA 3LOUA 1N4LA 3DPUA 3QWPA 2XGPA 1FEEA 1R8AA 3BR2A 1HHSA 3Q9VA 4NL5A 2QKLB 2RSQA 4KBIA 5KFJA 3MM8A 2MKHA 2IJLA 2K4BA 5KG7A 2XC9A 2VE8A 3G4SI 3J7A1 1KEKA 3U02A 1KOOA 3QT7A 5A8WB 4DFMA 1FSEA 3CO6C 4IRGA 2VFVA 4I2PA 4IFVB 4LT6A 2ACYA 5J2NA 1YZ6A 1X2NA 3QGIA 4BC7A 5K8PA 3GIMA 2W9CB 3RDIA 5CYVA 2GXAA 1BOAA 4I02A 2OSRA 2IGKA 3MECB 4KT6A 4WCGA 3I0SA 1TKZB 3C6TB 3BZ6A 3K70C 3ICLA 2OGUA 4IG0B 3K0LA 5CABA 3V7RA 3GLJA 3C66A 3DXJF 4ZP9A 4S05A 1DARA 2WW8A 4LG3A 1RTIB 5CXTA 4ZLJA 1SVOA 3DYAB 5ILVA 4B3AA 5GAEJ 2R2SA 5A2QK 4TLRA 3BTJA 2YNIA 2FLPA 4BJTA 4HT5A 2FQQB 2F5DA 1D0YA 3SCJE 2DNOA 3PSIA 2V6CA 4LG0B 4K2EA 1ACIA 5HS8A 1LVAA 4K5SA 1FJEB 1PYOB 1ZRFA 1SQEA 1XB4A 3K5PA 4A47A 1RWMB 2L9NA 4C8KA 2MH9A 5FD5A 4BEHA 4X66F 3C46A 4C30A 4DW6A 3TYTA 3HHDA 3U7JA 3RU0A 2EWNA 1Q82T 4KRWA 1X1PA 3CSKA 4DR3F 4HF0A 2CWXA 3I0TA 5AJ3F 2BM0A 1OSDA 1J2XA 1OQ3A 2F4IA 3BREA 2CPZA 1IXCA 4FVMA 5BR8J 4NE9C 2LMIA 5FKOA 2JOQA 4U0YA 2K3KA 2R5YA 2DPJA 4A8SA 2LF7A 2OJED 2DNHA 3DBRB 3JYTB 2E7XA 1WHVA 2K7KA 4AQYJ 2ZKZA 2DGSA 4EQQA 2ZBIA 2YWGA 3E01B 4Y3OA 5EJCA 4AIKA 3MF5A 2ACMA 4XN0A 1MJAA 1UA0A 5D0HA 2ZD1A 1X4PA 4PAAA 5C4XJ 1U0SA 1EETB 2MKKA 2PA3A 3SMZA 4LF7F 1A04A 3VVUA 2R5ZB 1RR7A 3ZZPA 2EFGA 2LLKA 1KTQA 2L54A 3VV2B 3I87A 2WONB 4KGZB 2PJRA 2ZE2B 4U7DA 4A12A 4RUAA 3WG7H 2DNYA 3TOBA 4B9MA 1RUNA 1N5YA 1REGX 4ECRA 2P5LC 2AYMA 4K4WA 5CQEA 2QQBA 5DTDA 3N9UC 3W3SA 3C2BA 2YNGA 1QY7A 1JWWA 2DMPA 1IBMJ 2CUEA 1HI1A 2YKNA 1V5EA 3JAMU 1XSDA 1Z21A 2KJBA 3ZTSA 1EQMA 3MCMA 4HDVA 5D4SA 3DKYA 2IRUA 1RT7B 2XCPA 3V4GA 2YNFA 2W57A 3F73A 2HBZB 2VT3A 1JKQC 4P71A 3IH4A 3J7ZT 3HSEA 3HSFA 2HMIB 5KFEA 3WBZA 4N41A 1KKHA 3FQLA 3HHGA 2F5GA 5EGOA 4MKYA 3QOPA 2AEFA 1NNDA 4DUTA 3CCMI 1HWKA 3VCDA 1LNQA 4I6YA 4Q8EA 2DA6A 2PI4A 2FJ1A 1YG0A 2OV7A 3FISA 5LRSA 1TU0B 3S6EA 5F9NA 4KC5A 1MNDA 4LVNP 4M5DA 4PJ0C 1SIZA 1TZ0A 2BY1A 1O4XA 3QAHA 1PUFA 1LFPA 2V79A 2XAQA 2EKYA 1IR1A 2CPFA 2DTRA 2P6TA 3OS1A 2XMAA 1YOVB 3CESA 2H65B 5HODA 1D0ZA 3QIPA 4L3KA 1QAXA 3CC4S 4PG5A 1X60A 3NBPB 2R2TA 5CZVA 2L02A 4HI2A 2HVSA 4X62F 3ZQFA 2HWHA 1HDPA 1NB7A 2WSEC 4DX8H 3K0JA 1U8SA 4OJHA 2YBVA 2GO9A 3NL0A 1LQ1A 1HXDA 4O6JA 4C3KA 4BXXJ 4GO7X 4KKOA 2GVZB 2OPSB 2KPMA 1ZM4A 1K8AT 1FTCA 1B1BA 3SBMA 2XI3A 1E6VA 2NQPA 2D3OR 5FLXU 2GIZA 4WFBQ 3WE2A 4YFXF 2JH3A 4ZVPB 1ZREA 3GZNB 2RDJA 3FBBA 5IT4A 3K7AJ 2Z4PA 2LY1A 3PVXA 2QX0A 1SUQB 3L2RA 4GFBA 4P55A 2B7CB 3RGIA 5E20A 2BOAA 3MTJA 1I6HJ 3L2VA 3MM5A 2DHHA 3LTOA 4KJIA 3RKQA 1O6XA 3N79A 2NPIA 2NSCA 3Q8YA 5K7ZA 4O3OA 1EJ7L 1BXNA 2JDJA 5E33A 1HI0P 5ETMA 3W5ZA 2BACA 4PPZA 1HC8A 4G12A 3L2CA 3FBIB 1IKYA 1H73A 1I1GA 1VRUB 1WDDA 2FLLA 4LF4F 2KH9A 5LEJA 2VZ9A 4IF4A 3OT9A 3AD8C 2R7WA 2AJ0A 2KO1A 4EWTA 1T0FA 1ULRA 2A6EF 2O3FA 3KZZA 2RB7A 4CCLA 1FE4A 3BH6B 2F4FA 3PDNA 4A3CJ 4DPUA 5KOWA 2GA2A 3CW2C 2E5HA 3W6VA 2IHR1 3HHLC 4E7LA 4A0XA 1FRJA 2DO7A 4I4BA 4LK0F 1UEVA 2XY5A 1FVQA 4NASA 1M1GA 1ZOTA 3GW2A 2D74B 2R7UA 4I7FA 4ZITA 4I98B 1L5UA 1WFXA 2OPRA 3OR1C 4H4OB 3EDRB 3LOCA 4ID8A 3DP7A 1QZYA 1VC6A 4Y33A 4KIGA 4EGYA 3BLYA 2EQRA 4Z37A 1ETXA 2R7OA 1XEZA 4X4SA 1AT1B 3MMYB 1NK8A 2CQCA 3SZGA 2QRRA 2DDBA 3UN2A 1KA8A 2DFHA 3RJMB 2CQDA 2K7JA 2RU3A 2QT7A 3SEQA 4GC6A 4JI1J 3LGNA 2V7FA 4DYQA 4V19J 1DHMA 1W2IA 4KICA 3BM7A 3AFGA 1TVRA 2QLWA 1NMEB 2NVXJ 2CW0F 4WP3A 2WVDA 1VQOS 1XJWB 5HQLA 3H90A 3CC2S 4DL6A 3FKIJ 1CQMA 3M6XA 4NLUA 2ZO4A 3OTEA 3R8YA 5GMEA 3D5SC 2IJNA 4F55A 4IHVA 2JA7J 2CNNB 4UVAA 2IC3A 4AE5A 2DAOA 4UT4A 3GP9A 5CYJA 5EX3A 3V6DA 1VQ4I 3HZEA 2Q43A 4WX9A 4B47A 4BE1A 4L0ZB 4I09A 2C3MA 1J59A 3I9ZA 5A76A 3T19A 3KK3B 4WE1B 3MEXA 2H4WB 3R61A 3ITHB 1FFSB 3L2WA 2HOSA 4XIDA 5GPAA 3SDEB 1GT8A 2PN6A 1TL3B 1Y0HA 2KL8A 4LSNA 3KZIC 2E66A 5JVGF 1MBKA 1XERA 4AUKA 1U78A 1RKWA 3KLOA 3WC0A 2VLAA 2XVCA 1W36C 4NYPA 4ED4A 4YELA 2EZKA 3DLAA 5F8JA 5L39A 5HMXA 4F92B 4NMXA 3F44A 3TX0A 2I0XA 3POTB 4U9RA 1IG7A 2Z16A 2IT0A 5RUBA 2OZUA 1LXJA 3CLOA 3U1KA 4U96A 2QQ9A 2WAQN 2AEMA 2OD4A 3IXQA 2KP6A 3HKWA 4QR2A 5IOZA 3RIRA 4R1HA 1CS4B 4L74A 2FNPA 1JI8A 5GTHC 1S6QB 1U3EM 1HBMB 2OMLA 4ZZDA 4DF4A 1Y11A 3D6MB 4PEOA 1WGXA 2Y0BB 1VOMA 1Z7LA 3F9KA 4RNOA 1FJGJ 2DN0A 4ZTFA 5DZ7A 1VIXA 2HHQA 4NNJA 2XB2D 1W7WA 5DG8A 4L9TA 1ZTWA 5IPAA 3LAJA 1T03A 3JTOA 1M90T 1RJJA 1LEAA 2IRYA 4LBIA 4LQ9A 4DUZJ 1IKXA 2NVTJ 1TQMA 4C7QA 4DV2J 1BC7C 2CQ3A 1K73T 3CJ4A 5CH7B 2RRAA 2DR6A 1W4MA 1VQKI 4USKA 2LDUA 2ZCWA 1UCNA 1H9GA 4C8NA 3BCBA 4CO3A 1ZLKA 3NNAA 3V7CA 5K14B 2DA5A 4J00A 2FBKA 2FXAA 2EFNA 4XLFA 1U1MA 5GMDA 3MPYA 2KVIA 1NKEA 3NP5A 2VC0A 1SH3A 2KZVA 2NXJA 2L9WA 3SQGA 3WTXC 3FZBA 1TKXA 1MH3A 1N52B 2CV0A 4G6VB 4X62J 3WC2A 2PDAA 4MT1A 3VAHA 3JRAA 5KT4A 3QOEA 4NEYA 2FVSA 1ZHFA 4BCAA 2KDZA 3KK2B 2W9AA 1YLXA 2MSSA 4DNCA 2EIKH 2HBYB 3RKXA 1FC3A 4ZOSA 3C1DA 4K4UA 2J76E 2N3LA 2NVQJ 4ITVA 2Y30A 1AWCA 5E3RA 5D6EA 4C8OA 3QP5A 1NKBA 2EV6A 1M1HA 4HQEA 4G9YA 3OL3A 1U25A 4WU3A 1K9MT 1OR7C 2HKOA 3D5RC 2GBYA 4JYKA 1AOYA 2MHEA 3RPUA 4OL8A 4DEZA 3QYEA 1M0SA 3FEXB 2UUCJ 2DEIA 4ECVA 1JMTA 1VJWA 1HWLA 2ZXWH 2YXLA 4EGLA 1Q5YA 4DF8A 5JI6A 4KFBA 3DOLA 5FKMA 3ZQCA 3NS6A 3MMJA 3ZZYA 4USJC 5FFZA 2HS0A 2OAUA 2H54B 1IAWA 1K1SA 2WHOA 3MEGB 3AJ2A 3VYTB 2B5JB 1GTEA 2N7CA 4PQAA 1UZHA 4LSLA 3IR7B 4PQUB 4KO0A 3LWFA 2LP4A 4RW9B 5F1JA 1QSYA 1DQAA 4AYBN 1X1BA 2AS5F 3K5OA 3NS5A 3MTKA 4PWDA 3QYYA 4W4MA 4HTIA 1YW7A 1M5HA 3ET6A 1AZSB 1AW0A 1ZGAA 3GTKJ 3BSCA 5KG6A 4E7IA 1U6ZA 3CUNA 4BL0B 5K5QA 3QGPA 5LGNA 4Y0FA 1SFXA 1R00A 4USTA 4NQWA 4RKUC 4XLAA 3EPGA 4N7TA 5HAOA 5HANA 4GVLA 4BBRJ 3PYDA 2XMTA 2XO6A 3TUJC 1SJQA 2N3OA 4IOAQ 2V4JA 2XSJA 2HQGA 2V1UA 4LF2A 5F3ZA 2BGCA 3GFXA 4ZLPA 3NCQA 3CJKB 4LR8A 1O0PA 3FSYA 3PL8A 1N34F 1ZGWA 4LFAJ 5A2QZ 1NK4A 1X4DA 4DQSA 2JRTA 4V1Ak 4B3OA 2F4VF 2KJCA 2M0GB 2L4AA 4CWBA 2X6YA 1JLGB 3DNCA 1V55H 2CUZA 1WSUA 4II3A 3GTGJ 1HSTA 5LXRA 4FX0A 5B1AH 1JT0A 1YK9A 4X65J 3LH2S 3BC8A 1T8EA 5HLHA 2OD6A 4OZ0A 1LK7A 3D7SB 1OMIA 3PO2J 4L5EA 3FJ2A 3HSGA 5IYCJ 3FUYA 4PYAA 3ELKA 2Q2EB 3H2LA 4YY3F 1X0PA 3PYFA 2H51B 2C3YA 1M5VC 1WD6A 1PDNC 1W26A 5A8KB 3V8LA 4OU0A 1HF0A 2ZHAA 3LA7A 3C3LA 5ETLA 3KLIB 1XD7A 4KIBA 1P4WA 1QRYA 2DDAA 4MQVA 3RB6A 3P5JA 4OJ3A 4MTPA 1S10A 2QGFB 3KG4A 2CS3A 2CQPA 2EBGA 4GRSA 2X6WA 1APLC 1G59A 2CA9A 3VAMA 4PG7A 3QT8A 4J01A 1G6BA 1CULA 1N32J 2FQ4A 3HUGA 3G3ZA 1YTYA 3LNQA 3BB5A 2DPDA 5D0GA 3JSYA 1P9YA 1JJCB 5D6FA 2ZXHA 3T6BA 1OPZA 1RHMB 4FDFA 1POGA 4M63A 2FLOA 1LW0A 5F0CA 3KHHA 4ZJQA 1JKRC 4C11B 2ZBPA 1F9NA 2CQXA 3RAXA 4W90B 2DJNA 2RGVA 4GRIA 1Y5LB 2QCOA 5GVQA 1PP7U 3CC7I 2DGOA 2JVOA 4IOCQ 4JI3F 4I68A 2KIMA 3OS2A 3PO3J 5A0YA 3G8QA 2CV1A 4PGHA 5L3CA 1S6UA 2VXDA 5L1KA 3HKZN 3GMEA 5KFKA 1J0RA 4U95A 4FKYA 2XAJA 2BUNA 2CG4A 5ICFA 1T3NA 5ETRA 3W1YC 4U8VA 4WZMA 1KLNA 3NWSA 4IFYB 3QPHA 2ELHA 4ZPTR 2DRDA 4RAZA 4XK8C 4I76A 2CQKA 2VOPA 2ADUA 5IXUA 3JTHA 2ZUAA 5EDNA 3KNGA 5EWFA 1I6JA 3BJOA 2HRYA 3NQOA 5LLQA 3ZMSA 1MDMA 2WAQA 3DGVA 4OX8A 3K5NA 2DGQA 5HJXA 3GE9A 4PUOB 1XMKA 3OVAA 1X4HA 2WOMA 2RDPA 3AHPA 1MSFC 1LWXA 2E2IJ 4WFAQ 1IN5A 3IUOA 1U4BA 1RWVB 4WPAA 5AXKA 4Y2CA 5HS9A 1YJRA 4PFPA 5LGUA 5HJYA 3PO5A 3V81A 3WZ0A 3Q0UA 5J8CA 3DF8A 1NHUA 1RT3B 2IDEA 5L1IA 2E1MB 2MQMA 4XOTA 1R23A 2GAUA 3MMCB 3PHEA 1WSRA 4MFBA 1U1LA 2VASA 3D0SA 3MFIA 1HHTP 3JR9A 2Y9HA 2BW2A 4U7UD 1NH7A 2GOXB 5ICCA 2UU9J 2AV5A 3PW4A 1WDTA 5D5UB 4RDUA 2L0KA 4L18B 1F6TA 2LFBA 2QLZA 1BQMB 5GAEU 3ZQIA 4ZPAA 1AHDP 5H9FK 3TUZC 3IP0A 3P4UB 4CI0B 1ULYA 3TQ1A 2U2FA 3BGFA 3FBCA 5AE1A 2QBYB 3ABLH 3KP7A 1HW2A 2BJ9A 1N54B 2O5DA 4QPTA 2JEFA 4Y52J 1Q78A 4Q43A 4LF9J 1NKCA 3AQPA 1W5SA 5FIIA 3UI3A 5KFCA 1RE1B 1KWMA 1U2RA 4NA2A 3KCCA 2M7SA 1WZ2A 1VK3A 2YWKA 3KNAA 4S0HB 3CCWA 4NWBA 4J9PA 4XTTA 3OFGA 2W7AA 4OIXA 3CP8A 2GC8A 4CQ1A 4IRIA 4WFZA 1K7AA 3D0IE 3MURP 1UAAA 2W2PP 5CYQB 4LVOP 1TTYA 1WH5A 1E17A 2ZBKA 3PY8A 4OMZA 2W9CA 3DM2B 1H0MA 1E3PA 3G1LA 1SL2A 3MECA 2OEMA 3VFZA 1TKZA 3C6TA 3HPGA 2K9QA 2MBFA 1NG6A 5KT5A 5IM0B 4IG0A 5IZHA 1YBTA 2GMHA 4QYZK 1IBKF 1F3VA 1RTIA 3DYAA 1VRTA 5I4MA 1L3KA 3VZHA 4FN5A 5F64A 2W1BA 5ILSA 3DMJB 4ITSA 1RUSA 4NA3A 1XGSA 4KNYA 2AT1B 4BDZA 2YSRA 3A4TA 2ASDA 2XV4S 1IBLJ 5DEQA 1EHWA 1OYIA 1WC5A 2F5FA 1F43A 4IZZA 1PGZA 2DA3A 3ZZTA 3BJYA 2OLWA 2RE1A 3CJNA 4LK1F 4MKVA 4DDFA 2ASLA 4C0BA 1N34J 3QSYB 4OV6A 5B09A 2GNKA 4AYBA 5IC6B 4EK2A 1VBZA 3UFCX 1LDKB 2CFOA 1WNEA 2C2KB 2KXHA 4DQIA 2A6TA 3Q8PB 3PIPF 3NEKA 1FOYA 3JRDA 5JHFA 1LKZA 1TL8A 1WI9A 4UV9A 1XMQF 2FBIA 1V3ZA 5KFHA 3EE3A 3JYTA 3LFKA 1K78B 4LUBA 3NCPA 4U7BA 5I3PA 2J0XA 1SXLA 1OCOH 1FRIA 5DDRC 1D0EA 5C2GA 4CLUA 2LR8A 4KH1B 5F8HA 1EETA 4YR2A 3FEZA 1WSVA 1LEBA 4YOEA 3TX8A 3K89A 1IR0A 2IEKA 1U1PA 3RJPA 2JRSA 2WRMA 3P9KA 1GFWB 1FT8A 2ESNA 1LW2B 2ZE2A 5K7FA 3WTTC 2K4JA 2J9DE 3FHNA 4DSLA 2DNQA 3TA0A 4U67Q 3E7LA 2V8GA 2AYEA 1YX3A 5D5VB 5F08A 1U9OA 2UUTA 2J8AA 3TQNA 2H5IB 4WJBA 3QIDA 4ZYEA 2J0WA 3QPTA 1Z67A 3O6BB 3RCOA 4WXCA 1KYZA 2DOAA 4KISA 2Y1RI 3CIMA 2VQEF 3K8WA 1RT7A 1SJ3P 3LP1A 2ETHA 3I53A 1VQ9I 1BQNB 4CSWA 4CH0S 2HMIA 1JLQB 3VVTA 3CMES 3A0BC 1DLOB 2HVEA 4NCAA 4OI6A 1SV5B 1EIYB 2W48A 4QIWN 4LF5J 3CTAA 3E3XA 4IHWA 1OCZH 2L7MP 2IGMA 3GIRA 2E2JJ 1JKOC 3GO5A 4DQQA 3QNWB 1UHSA 1A0OB 4DJBA 1OLTA 3LANA 4J9VA 3LPYA 2VB6A 3TL4X 2JUGA 4OOIA 4NB5A 1XWLA 2CXEA 1IC8A 3CJRA 5ETOA 3PR4A 1FBUA 3VQTA 2RQPA 4BE0A 3VGSA 2GZWA 5ILUA 2C22A 4AC0A 2WV0A 3PZPA 3TO7A 5FJ4A 5A8RB 5J1PA 1U5TA 4NUBA 3O5TB 3NBPA 4GVBA 4UOHA 3CDAA 2BBEA 3HRUA 2KZMA 3UR0A 1ITYA 3MOJB 2XHKA 4BJ5C 3HGGA 3S3MA 1NK3P 3DWLE 1CJUB 3CCUI 4ED6A 2HS3A 1DQ9A 3GX4X 1UVLA 4DR4J 3RRGA 4USMA 2KVQE 4PG8A 3S93A 4ZVOB 2UUZA 4QBUA 2JZYA 2QYCA 2ZJPQ 5LMUJ 3C8YA 2B9WA 4HA8A 3TI0A 5D5WB 1VQNI 3M8YA 4ZIVA 1J7KA 3I56S 3PACA 3AH6A 2CQHA 1JK9B 5IT9K 4QR1A 4DV7J 1VQ7S 2QMWA 2Z3YA 3VSLA 2ZJRF 1VRQC 4C8LA 3HOTA 4A8QA 5J1UA 3HKZA 1JTXA 1STZA 4LB5A 4OLOA 4WK8F 5E79C 3E6CC 5J1EB 2DR9A 2BBYA 4I0WA 5IFMA 1YRNB 1HNWJ 2HGNA 1FDDA 2HQCA 2YVSA 1TK5A 3MAHA 4USHA 4MFEA 1RAJA 1VRUA 4ZHRB 1OPCA 1NLKL 2EWHA 1N25A 2X48A 3WIUA 2OTLS 2JA8J 2AD9A 5E2QA 2BEOA 1PJRA 1HNZF 1MJBA 2ZJQF 3KFWX 3JSPA 2CPIA 3H35A 2ZFUA 2XG8A 3I5CA 2MSYA 4ELVA 1BL0A 4N47A 4XSZF 4YG2F 5I3UB 2P5VA 1SFOJ 1MMSA 3FMSA 1CBKA 3HG9A 1PG5B 1XMXA 3OVSA 4LFCJ 1SQGA 3CJTA 2FE3A 3R6SA 4DV6F 1Z2LA 4IHXA 1GMWD 5LRRA 3CJ0A 3C15B 3CJ8A 2EA2A 5DJBA 1TR0A 2W7PA 5C24B 3Q86A 2CW7A 2MQPA 4Q0BB 1RDRA 1S1WA 4RU9A 2BXJA 1IRZA 2F4OB 3GYNA 2FRHA 5SUHA 3TP3A 3CDIA 2IVYA 4XSXF 5FGMA 2JWNA 2NOGA 2ELKA 4H4OA 2B43A 2BY3A 3H36A 4OYPA 4UZBA 4M74A 3TVKA 4OYOA 2ZEJA 2X3GA 1W5CC 2CJAA 1V3SA 5L8RC 4EVIA 1J5OB 3W3CA 3CTRA 1WHWA 1D9DA 1IBKJ 3MMBA 4ICLB 1FP2A 4YDXA 4R5PB 3KMQA 1OYYA 1LOUA 5FB2A 1XDSA 3KJQB 5G0RB 4EJWA 4DMZA 2PSZA 3PQJA 2HFOA 1FK9B 4Q7AA 1R71A 3RG6A 1FDBA 3ISND 3B73A 5HBMB 1JJ2R 3E97A 5DDPC 3UD3P 1NDKA 4ZVSB 3DPLC 2W2NP 1U1QA 4UV8A 1IF1A 4OYIA 3CIZA 2VFRA 3MVPA 3EUKL 3RBXA 5AT1B 5IWAJ 2C2DA 1MMGA 2VI6A 2CJJA 1N75A 5L3EA 2HEOA 1MZBA 2ROGA 2MQLA 2STWA 2RHSB 3S8SA 2O6GE 4EBCA 5LD2C 4CO2A 2J5OA 1T05B 4OZJA 5DLGA 5KK1A 3W8PA 2E9TA 3H98A 4E98A 2I2YA 4C3JJ 1DGRM 2VFTA 2W2MP 2W82A 3SEZA 1ZR4A 4WE1A 1OKRA 3D54A 4YEJA 2NVUB 1IJFB 3ITHA 2KT3A 4ZJLA 3LQQA 1SAUA 1NHVA 2ZB9A 3FWEA 3SDEA 3CUQC 5DS9A 3M32A 1G3OA 2ZH2A 1F0XA 1D8YA 2N7YA 2YKOA 1GUUA 3M8JA 1V3RA 1VNDA 4Q5SF 4BUPA 2GCFA 4BS9A 3HVRA 1QHHD 2BW3A 4Q45A 5LMNF 2AU0A 2Z58B 4NOHA 1S9GB 4CCNA 2FHMA 1HQCA 4ZPBA 4DSFA 3QU6A 2VD3A 1IUYA 4GDFA 3HT3A 1NK2P 5KFAA 1MN9A 4P9UA 2GA7A 4BHCA 2OHDA 1B4AA 1BOBA 3NEUA 2DNRA 1I51B 1D9FA 2Q3PA 4P9FA 4IHYA 2U1AA 4B9NA 3NKYA 1KZHA 3K4KA 2VC1A 1RAHB 1S6QA 1XPXA 1HBMA 2XDVA 2C2NA 4KTQA 2GLOA 5H9EJ 2DGWA 3HXMA 1FWLA 3WX8A 4H4MB 1KQ0A 1J5YA 3NNCA 3HSDA 2AO9A 3JAMY 1NK9A 1RTHB 1S9HA 2M9HA 1HBUB 5D3GA 2HGLA 4V2FA 2DK2A 2XGXA 4RGSA 3ISZA 5JHUA 2XC7A 4ANEA 5LL6d 2ECCA 4A0ZA 1BQXA 4YEAA 3RB0A 2DXEA 3PKYA 3E1SA 1RT5A 2L7ZA 2DT6A 1UFKA 4FXWA 3IWZA 1WOOA 2H5JB 4TY8B 2JNJA 5K14A 3ENVA 2QYOA 4LD5A 1LWCA 4LIUA 2K3FA 5M5YJ 2F9JA 4G1PA 3CJ3A 2XZTB 1TW3A 3T1AA 3RYLA 2YPZA 3QT6A 4HX4A 1OY8A 1JLEA 3M7VA 1VZ0A 1JLCA 2EG2A 1SJRA 2FBHA 5G4DA 3UCUP 3SEOA 4O23A 3KDOA 1QE1B 2IXSA 2E36A 3F3XA 5IOLA 2JPCA 3DLGB 1RAFB 2PMHA 4BDYA 1IN0A 2ATLA 5ERIA 2J8SA 2GHVC 5E3PA 1Q86T 2FMLA 3H3ZA 4DU7A 3KUEA 4RMNA 1TNSA 1XX5A 2CQNA 1VQMI 3THPA 1FDAA 1RBLA 1GXQA 2IA6A 3ILOA 2HWTA 3QAEA 2LKXA 4KHMA 1JJ8C 2OPPB 2FJEB 3SQOP 3ONQA 3P6YC 1CC8A 2PE8A 4HRIA 3LAMA 4F0MA 2GX8A 3QO9A 3FXRA 2VFSA 1XGMA 5FLXY 2VPZB 3OS0A 1QPIA 3GVAA 2LKSA 1V5FA 3M6UA 1U49A 2KDOA 4F02A 1RHQB 2XGCA 1VQLI 3DDIA 3HT0A 3GTYX 3KYLA 1HNIA 2DQRA 4HYKA 1I27A 4RLEA 2XBPA 1HLVA 1WH7A 3IRRA 3GPAA 4RX6A 3OY9A 2UWMA 2G0JA 3QLHB 4UQGA 2DR7A 2M5YA 1GVDA 2KKHA 3W64A 2OC6A 5GAHI 2CUJA 5D5XB 3MEGA 2LU1A 3OYEA 4XQFA 4U88A 1H3DA 4AVZA 3K5LA 1EA3A 3HSRA 5J4VA 2WA0A 4PQUA 4QWAA 3PFEA 1QQIA 2OIHA 3LSGA 1SC4B 2XM3A 2CG8A 1TT0A 3ZQHA 4X6AJ 3BGUA 4HPQA 1PYTA 2BJ8A 3HGYA 2LDYA 5HMZA 1V5IB 1UAWA 1Z91A 3FZ2A 4CDIA 1WF2A 1KYWA 3BT9A 1XSVA 2DT5A 4BKXA 3P7NA 3QFHA 5HATA 4WYWA 2UUAJ 1Y5NB 3KXDA 4YIFA 3UPFA 4WF2A 3H59A 3R3TA 4XKWA 3MM9A 2JLGA 1SD7A 2DRAA 3F0CA 1GX6A 1TMJA 2QE5A 3RZDJ 4FP9A 1SC3B 2EK1A 1IN4A 3I0RB 4IKAA 4OHZA 7FDRA 3CCSS 1DP7P 5EDWA 3IWNC 4P52A 1NK7A 1H8AC 3CJKA 1Q5VA 4C2MJ 3DLBA 2KB2A 2UXNA 4ZDOA 1YJ9S 4FBUA 3HOYJ 2B56A 2AHQA 2BOPA 4CLSA 3TANA 3VEPA 2ISZA 3Q23A 3HM5A 2BYVE 3A8KA 2BXYA 4OI0A 5J2PB 2GAHC 3JSOA 1I3QJ 2AXLA 3OTOF 1JLGA 4NYOA 3V4IB 2WAEA 2V1NA 2M8GX 2DTZA 3OD2A 2AF6A 5T7LB 4FF1A 2EPIA 4OYXA 1X4AA 2VPLA 4NCBA 1E2XA 1FYLA 1GT0C 4TQRA 1WF1A 1VGYA 1WWXA 4QIVA 3H40A 1RCOB 3PV8A 1FKAF 3K2ZA 2I5JB 1F36A 4DHVA 2BW7A 4I69A 5FO5A 3DI6B 3HXLA 1TUGB 5A8KA 1ZM9A 3QGHA 2HURA 3KLIA 2QSGX 1T9TA 3H7HB 4Y00A 4CH1A 2O61A 4DFKA 3W5YA 1TFWA 1M5KC 4HDHA 2DR5A 3H5YA 4M5GA 4NC6A 3IWLA 1LNWA 2KLOA 3M8PB 1K6OA 2RILA 1JQGA 2RNEA 1S1TB 5E18F 3CF5F 1RHUB 2XYGB 2J9DA 2NXCA 3UN3A 3A02A 5CVJA 3IA0A 4DL0C 1JXEA 1U1OA 1TWGJ 3VF0B 3RYPA 2XULA 4RBOA 4X4NA 2XPUA 1T38A 2D1CA 3GIJA 4B3SJ 1LE8B 4C11A 4WU2A 1RTJB 3B6AA 4YQWA 2W84A 1R43A 4R8HA 4K5RA 4M71A 1Y3JA 3AJDA 3PHTA 3CCVS 5CHCB 2ASJA 5JR3A 3BKTA 4EM1A 4ZJZA 4YDDB 2N82B 4XLCA 4C3MA 2CJBA 4DL2A 1FIPA 3BO4A 2OMOA 4IRHA 4YHHJ 4A8WA 2E1PA 3L7OA 1BE4A 1P7JA 2Y0MA 3PEJA 1PP8F 2DD8S 4IFYA 4DR5F 1M5OC 3ZTRA 4ENMA 5K5RA 2Y9YA 1FPQA 1ZAOA 1J75A 1L3SA 4JV1A 3HOVJ 5BJRA 4MKBA 2UUBJ 4P2MA 3T1HJ 5HSPA 2DLLA 2JEGA 5KFWA 3FBFA 1R7JA 1X9MA 4PSXA 1WORA 1TL7A 3LALA 5J2QB 2UXBF 3REOA 4ZYGA 2DXDA 3EPIA 4NLGA 2EJRA 2YH0A 4PUOA 3F21A 1FVSA 2DGXA 2E71A 2FTRA 2VXZA 3J80K 3BR3A 1BA5A 4HSRA 4BHPA 3OLBA 1RWUA 3BSNA 1PJ5A 3ZQGA 4IHSA 1ERDA 1XTZA 2EK5A 5B1BH 4B9LA 4RWXA 3TVYA 4DJAA 3D68A 2Y69H 1YIJS 1UPPA 2IVMA 4A5MA 5GAHJ 1P27B 3MMCA 4DV0F 4RJVA 2Z2LA 4Y3CA 2JRMA 4FZVA 3BCAA 1UPMB 2CVEA 1R6VA 3P3DA 1Y0NA 2Y3YA 1TWHJ 2J6UA 1NPRA 2EI5A 3G6VA 5HVFA 3D66A 5IT9Z 2ZH7A 2BV3A 4O4GB 4DZ6A 6PAXA 2QC3A 4RAGA 2ZMEA 2X1CA 2V2QA 1MROB 1GV5A 2NPFA 5DQHA 1TQPA 2WBRA 3OYBA 2Z30B 3WDOA 3OBIA 3BG6A 3JW4A 3DFGA 3F56A 2QBYA 1Y4ZB 1RESA 1SPBP 5LHGA 4BJ6C 4ESJA 1YFHA 2W4PA 3MEDB 2CJKA 5F3TA 4GKKF 2ZC2A 3T1YF 2HTSA 2AJFE 4FT8A 1V4RA 1CQTA 1CLFA 5LJ5Y 2PLYA 4UOGA 2J7WA 3OL7A 5B0FA 4F4WA 4KMUX 2ZUGA 5CYQA 5FFXA 2LU2A 4WCEQ 1Y5IB 2PGCA 4DSJA 2R8IA 1BIAA 5THWA 2F5VA 1R0CB 3MR5A 4U7CA 3COAC 1S0NA 1P2FA 2E60A 3D4JA 3L7PA 1S76D 1KVJA 5IM0A 4A3BJ 1JJ6C 4XNFA 2BKOA 5KFUA 2ZH9A 4O3PA 1JNRB 5IC4B 3RZOJ 3PCOB 2B9XA 3DMJA 1ONVA 2DH7A 1KS2A 3F23A 5IV3A 4M3EA 4OFZA 4HX8A 3PFOA 1FF2A 2YQ1A 1NDLA 2LVSA 4H4KC 4HH1A 4D9JA 4Y28C 1MSEC 1FFWB 2DTJA 2XF7A 2XEXA 3NGKA 2ZM6F 2DNKA 3RW6A 2DMUA 1DAXA 5D77A 2E34A 4E7KA 1SMYF 2DPUA 1IXSB 2HK2A 5HMWA 3ZMDA 1LQ9A 2DA7A 3CCLS 3HBLA 3HVAA 3HVTB 3F41A 4B9VA 4L72B 1EQ0A 5E8GA 3IFEA 3QPIA 3TWZA 2HHVA 2EZLA 2M8DB 3JRHA 3I4PA 3T5JA 4KGVB 3ZC4A 1CF7A 2WVBA 3CC4I 1OCRH 1P7IA 1G3SA 3O8HA 1XCBA 3BTCA 1HPZB 4Z6YA 1VI0A 4X4UA 1R89A 5K5MA 3KJNB 2HHWA 2A6OA 3V6HA 3PRBA 4RGUA 3TZYA 5J3LA 1K78A 1OYWA 2UVUA 1LKXA 5DS7A 2P7VB 5CQGA 1N36J 5B3SH 1HL6A 3L09A 1YZ7A 1TFYA 2F5CA 1RPWA 2CGPA 2CPHA 5FLMJ 2Z33A 1CJKB 1G2EA 1SD4A 3KWMA 2LEPA 2NSBA 1ETKA 2CNKB 3W6KB 4YR0A 2HHHJ 4B3XA 2A68F 5GPCA 3K4BA 1WRJA 1J5EJ 4CYUB 1LW2A 5LFAA 2XLIA 3H1CA 3M6WA 1Z3YA 3CDLA 4YUDA 2FHJD 1UMQA 3GFYA 3G87A 1UVIA 1VS3A 4DL7A 3L00A 4AD6A 3P8BB 4OJGA 4C8YA 2FC9A 3E51A 5DO2A 2JVHA 4DV5F 2QQ8A 1U02A 4QWCA 1S0MA 4MHGA 3H3UA 4MIBA 4BC9A 4ED0A 4XR6A 4Q2LA 1BQNA 5D4LA 4HKQA 1DLOA 3V8JA 4JBCA 1SV5A 2UVWA 1RAIB 3OV8A 2HZTA 3AQOA 2M30A 3GG0A 1BM9A 3LSRA 4L5IA 4IO9Q 3HHLD 1S6PB 3E6MA 1D1AA 1B99A 3DRYA 3TZXA 1BI1A 2IRFG 3PNTA 3K4NA 4CNYA 4TN2A 2QYGA 5F8NA 3NAIA 4CUGA 4JBAA 1FERA 3J7YI 5HDNA 3EUHC 3OL6A 3A4CA 3MUVP 4K4ZA 1IM6A 4C0HA 4GKJF 2VJ5A 4N9HA 1I39A 2FOWA 1DBDA 2Y9ZA 4ED5A 2TCTA 3PUBA 1WKMA 1SH0A 2J9CA 4WTYA 5A8RA 3DLJA 2HDWA 1U8WA 3C16B 4UB8C 9ATCB 2HNDB 1EX8A 2H8WA 3LPEA 2HQDA 3Q83A 3FXOA 1CJUA 2ROEA 4PG6A 3FM3A 3PYGA 5IY5H 3CVKA 3SZPA 2JPBA 5D78A 2HRTA 2EBIA 3ESWB 1K47A 4AIJA 3NY0A 3M2UB 4AUXA 2QFJA 4PDKA 1FJLA 2M87A 4C8ZA 5GADU 3SZ2A 2AP6A 4IKFA 2X9DA 2H1KA 2M3DA 1UETA 1BMQB 2GIQA 4V2GA 5FJ8J 5TGTA 1Q8BA 3RTVA 3F6OA 1VQOI 4ED2A 3GTMJ 5KFVA 2Y48A 1RR8C 1KR4A 1P6TA 1K1QA 5A6WA 1K79A 1T7PA 4JP8A 1GAOA 1S57A 3CC2I 3EJMA 4O3NA 3PW7A 5C42B 3V6KA 3HULA 5JLXA 4A6DA 2V9PA 5J1EA 2K3IA 3BY6A 1D1BA 2HNHA 4F67A 4L9JA 1YRNA 1Q16B 2R7RA 5K8MA 4ZVTB 9RUBA 3AB4B 3PJXA 3HD1A 2NYHA 3CCMS 1LFBA 2VBZA 3VODA 4ZHRA 4M5KA 1F5CA 1Y39A 2LY2A 4HNTA 4MK8A 4G7ZF 2AX0A 3FEYB 2JA2A 1UZDA 5E41A 2AQEA 2M4KA 4I0AA 2HHSA 1NJWA 4E7ZA 4DL4A 1SI9A 1OSCA 4DR2J 2DYSH 2HWIA 1QVTA 5CCLA 4ZN3A 1K44A 2C2EA 1FFGB 2LMDA 2VQFF 4BQQA 3U9GA 4JI6J 4F7VA 2GIRA 2B7EA 1RU1A 1QHGA 1YS6A 5HLIA 5D8KB 2CWEA 1N33F 3BBBA 1NO8A 5DLFA 1HD0A 4DQRA 1DPUA 3ZQLA 3FMWA 4JI8F 3IBWA 3BG9A 1N0VC 1XNQJ 4A8KA 4LFUA 2LQ8A 4DR7F 4NXMJ 2LY9A 1HIYA 2IFXA 5F0FA 1BHNA 4ZCKA 2CU7A 2WWYA 4RS8A 5LOQA 4J5OA 1J5OA 5ICEA 4NLPA 3H42A 1DRZA 6AT1B 1FKPB 2HNYB 3R6GB 4K8RA 2HLTA 1UJ6A 2X51A 2ME0A 2JJ4D 4JI2J 1KBRA 4KHPF 4ICLA 2FZKB 3P9IA 3TEGA 1N5QA 2JWTA 5LSLA 4QU6A 2KJWA 2R0QC 1RGVA 1FK9A 1PJ7A 4A8MP 2O0YA 5D4RA 5MAOA 1R8HA 4OHWA 4OLPA 3QATA 1S1VA 2B9YA 4M5HA 3EVWA 5AE3A 1SJ1A 2HEKA 3UDCA 1XNRF 1G2HA 4M8LA 1QUVA 3KK1B 1N6QB 2ZM6J 1YJUA 2IPQX 4AL6A 3ASNH 2C1EB 2LECA 4DQ2A 3GTOJ 4FASD 1G4CA 1T94A 1XR7A 4P73A 3HFZB 2WB4A 3M2VA 3G2XA 3O2PE 3GMGA 2ZKTA 1JTYA 3MKZA 2QMUB 4USIA 4HOBA 1T05A 3J81K 3ZMVA 5KFXA 4X4OA 2A1BA 3WTUC 3GFZA 1PBAA 5F41A 1YHQS 3SXLA 4LRBA 3QRRA 3TO9A 1WJCA 3GYGA 2KL4A 3CQZJ 2VJUA 5GTIC 3KLHA 2VE9A 4KIFA 1WF0A 1ZM3A 2EBEA 4F52A 1GHCA 2HBQB 2UXCJ 2V8DA 5I42A 3GFIA 1JLAA 1HR0J 3K1NA 4MK7A 1HFEL 4DXLA 1XMOJ 1B70B 3ENWA 2RDDA 1K61A 4RW6B 3Q8VA 5FKKA 1WKJA 4DUYJ 1SKRA 5SZTA 3PW2A 2RKHA 4C2MA 1GH8A 2E1OA 1Q0NA 1ZKGA 4B3MJ 2FUG2 3KKFA 2R7XA 1WEZA 3JQMA 4PSWA 1ROFA 3HI9A 2BOLA 2B9EA 2I9SA 2V4QA 4A3GJ 1HNXF 2BZ2A 1HCRA 1HBNA 1GXPA 2BR0A 1Q53A 3IR6B 3J7YJ 4LMZA 4OZ2A 3HYIA 4UHTA 1QVUA 5CJ9A 5KCMA 1KFSA 4U0WA 2KISA 4CO8A 2J0SD 1JLBB 2IMOA 4NHJA 1NAQA 4UVCA 4FS1A 4YB1P 2LK2A 3IC1A 1MMDA 4DYRA 1RTHA 2B6AB 1GLNA 2F6CA 4A3FJ 2BV6A 4HLYA 2H1YA 1TWCJ 2CJ9A 2YPRA 1UFWA 2JK3A 2W2QP 3WX4A 2OELA 5EG0B 3HCXA 4I2QA 2MZJA 3W62A 3QRQA 4TY8A 4DLEA 2ZH8A 1RAOA 1NK0A 1RTDB 3GZ7A 4QCLA 1U0HB 2J0QD 3FMBA 2K85A 2K86A 4WWSA 2OFGX 2DOFA 3AJ1A 4NZ6A 1LPQA 2XMVA 2SXLA 3KLGB 4LSZB 3Q5FA 5TISC 3L4BC 4UXNA 3ABUA 5F27A 4JUZA 1QE1A 2DR8A 3BBCA 1Q1KA 2OUMA 1ZRDA 3DLGA 2VA2A 2K2PA 4B48A 1NZ8A 2EA4A 4EZ9A 5HVHA 3R27A 4PPDA 1VFJA 5JXSA 2K02A 2FPHX 4RA2A 4Z2XA 2PG4A 2DNMA 1HLWA 2FVQA 1B64A 2UUWA 2DGTA 2XF6A 2HZVA 5J2MA 4NA1A 1B9NA 4C9DA 1ZYQA 2EPFA 2IBDA 1FCAA 5GAEI 2GS8A 1L3LA 2FUG9 4RB0A 2OPPA 1SKUB 3CULA 3TJ9A 4PR6A 2VHGA 3J80Z 5E0OA 2WTEA 2HWVA 1S59A 3HHNB 3IM8A 3KJVB 3VGTA 4AQYF 2RS8A 4E7HA 1U1NA 1WVRA 4DSEA 3IG1B 3L7UA 1ZBTA 1IXRC 2R8JA 4GYIA 1HW5A 3RRHA 5LSRA 2LKZA 3OTDA 3CGIA 3AAWB 5DDGA 3QLHA 4CXFA 2Y31A 3E3VA 5B0DA 1U26A 1UVMA 2C3UA 1HKSA 3FKBA 4O4RA 2M45A 1RT6A 1AKHB 3OR1A 1X31C 4WXHA 4BS2A 4QPQA 4D7MA 5B5EC 2XAGA 3OYHA 3VAKA 3RUBL 3DOKA 3O3KA 1IBMF 3K2AA 2FGCA 3CUOA 2ZOFA 2Y1JA 5DRKA 1NRKA 3MZYA 3MOZA 2YKQA 4FBTA 3B54A 2QQAA 1HMVA 2HVIA 1KLMB 4XAKA 4M5MA 2MD0A 1GMUA 4Q8FA 3AG2H 1S7AA 4XORA 1TQIA 1S12A 5DG9A 3FQKA 4RW4A 4GO1A 1TK0A 2KIFA 1R8CA 5HQ8A 4F3OA 2GJIA 2P6SA 4OZNA 2XYHB 2K8GA 2OCCH 2WVFA 5JUMA 4F36A 2ZSIB 2GIFA 2ICWG 5DQGA 3F0NA 1HNVB 3FDYA 2YNHB 3A1YG 4BDPA 2VOOA 1S1UB 2ZZMA 1FTRA 1TBXA 4CCMA 3W2AA 3R7BB 2XY7A 2JX2A 2AJQA 3BS9A 1LDDA 2VG7A 5L3GA 1OQYA 3I0RA 2W8KA 4KHPJ 3Q22A 5BQTA 2YR2A 3R7NB 2F7VA 1QDUB 2Q0OA 1N5SA 3NGRA 4X84A 2P2CB 5KOXA 3T5XA 4KV8B 4B3RJ 1PJ6A 2HVDA 4KN4X 2XMUA 2EKNA 3TDUC 1C4AA 4RUHA 3OVBA 2GQQA 2R2UA 3ZCOA 2BQRA 5J2PA 3MFHA 2NS8A 4DCPB 4RNNA 4X4QA 3V4IA 3SZTA 1JJHA 2H4YB 5T7LA 4L9VA 4LMYA 3I9V2 4X64J 5E3AA 2MA3A 4ENKA 2P81A 1HBXG 4RNMA 2EW9A 4ZK7M 2NVYJ 5KTQA 4CCKA 5F1RA 3DDKA 1S9EB 4ASNA 3HM9A 2QEXS 3HSZA 1S77D 4U7UK 3SFGA 1Y9OA 2O66A 1ZAWA 2FEZA 2MMYA 1JGGA 2UV8G 4EEFG 3S7RA 3PW0A 1BI3A 3H5SA 4MEYF 2NYXA 2I5UA 1PO6A 3VAFA 4LIRA 4UOCA 3RKYA 4CO1A 2BY0A 1FJ7A 4QWBA 1R5ID 1Q7LB 4DBQA 5E5NA 4TLQA 1ZTTA 3QPSA 3AG1H 3S14J 4XDDA 1ZETA 5KFGA 4HI1A 1RYRA 2PMZN 3FIWA 1S1TA 4OZ1A 1EH6A 1WC1A 5H9FJ 2CZ9A 4RM3A 1O7FA 1UVJA 5LBQA 1LE8A 3THVA 3NWRA 4LIVA 3IC7A 1RTJA 3EDPA 2QA1A 3TMOA 4QQBA 3GILA 5H2FC 3C6UA 4B3TJ 2KU7A 4OWRB 3EVMA 1S0VA 2V68A 1NU4A 3R5AA 2H8RA 4S0MA 2M0CA 5D4NA 3ZMZA 2AKWB 2DW4A 2AJ4A 3WODF 5KG3A 1UW9A 1UTAA 3GCMA 4U8YA 2IAJB 2KRBA 3TGNA 2F48A 2IY5B 2MGQA 5GAHU 3OR2B 1NPKA 2R8KA 4O3RA 1B0VA 1WELA 4ETZA 1WJFA 3BQYA 4EU0A 3PJ9A 2KXFA 3I9V9 4QYZJ 1NHAA 2CFXA 4ZP8A 1B4SA 1A9NB 3JS9A 1TMMA 2NOJB 1RADB 1SD5A 2R4FA 3BO3A 3KHGA 3TOQA 4J9UE 4JI1F 3KLEB 4ECYA 3B82A 3EYIA 3IAM2 4CM0A 5EGYA 1OR7A 5J2QA 3FBNB 3BF4A 2D69A 2APOA 4OJ1A 2W25A 1TLHB 1NSAA 3N0VA 3OSNA 1DTQA 2HS4A 3QRPA 1U2WA 2Q6CA 3MCSA 1D5VA 2CV2A 5DCFA 2BANA 4QWEA 3LSJA 2JL9A 2AHOB 3T3FA 1P8GA 2XMMA 1YJNS 2YS9A 4XLEA 3WU1B 3IMQJ 1V3FA 1XG1A 2DRBA 4HV6A 2ZC3A 4TV7A 1UL3A 2MJNA 4QIGA 4FYDA 2CQ0A 3IN5A 4ZVQB 1TAUA 4I0BA 2QL5B 1KDNA 2HVHA 5JMNA 2WAFA 2VDIA 4B9TA 1S48A 2ZVIA 1F9HA 2KZGA 3DCAA 2LYCA 3A01B 2K06A 1R22A 1UB9A 2KJVA 2XASA 4ECXA 2JUCA 4G6DA 1ZG5A 1DUXC 4LQ3A 2VPRA 3W5XA 1T0TV 1RACB 2VG5B 1IWGA 3G71S 1YJWS 2Y1LB 3RSNA 1MBGA 1E3OC 3T8RA 1DZ5A 4EBDA 1S6LA 2B9SA 4N56A 2PBIA 1VQ6S 1SEUA 2PEHA 2FU4A 1NXIA 4W98A 1S5LC 2KRHA 1FE0A 4AWXB 3MEDA 1GQEA 4Y2KA 4MO7A 2H6BA 3GIIA 3OIQA 1N0UA 2EC0A 3I0SB 3N05A 3RW7A 2DBBA 3J7ZI 1IGNA 4OI2A 4XLHA 2E9RX 2AWZA 4NMLA 4UUWA 3F8NA 4HLBA 2HBRB 3R5CA 5KFIA 1MMAA 4M6YA 1UJ8A 4F7ZA 1FX2A 2QZ8A 4O0IA 3NOCA 2YNIB 3Q8UA 3IAM9 4DG1B 1FJGF 5M3MJ 2MJUA 4C98A 3BKUA 2PEBA 2B7BB 4U6PA 4N4OB 3FKJA 3FNNA 1D09B 3C18A 5KT2A 1G3TA 1Z6TA 1FJCA 3RPUD 3R7SB 4BEHB 3VB2A 3CMEI 4DUZF 4L0YB 4DV2F 4DV1F 2KFNA 3H5XA 1W7PA 4LITA 2FHOB 1YVFA 4ECUA 1RKIA 2X0LA 1P9QC 2YPYA 1B59A 3BSOA 2Y1IA 2QLXA 1H2UX 3K4MA 3OWTA 2GXGA 4KHRA 4OZ3A 5K7HA 2HFNA 2DXIA 2NCKL 4HL9A 4MIMA 1H72C 1MSWD 3EGWB 4LJZF 3GWZA 5EEGA 2R5YB 2JLEA 1DTTB 3HVTA 5D8HB 5CPRB 4UNOA 3OFEA 1WG1A 3TW0A 2HYFA 1T2KA 4DR1J 1FDNA 1IV6A 3GFMA 2X1GA 5KFSA 3NOGA 2XKOA 1T02A 2PFDA 3AOBA 1HPZA 2ESHA 5FLVA 4PYDA 2IA0A 1QU3A 3EUAA 1WC4A 4BLGA 2O8KA 2ID6A 1UW4A 3P5TL 3J81Z 1A5JA 3LSKA 4XRMA 3K58A 2LQBA 1N5YB 1RWKB 3IHUA 2DO0A 1BW6A 4EJUA 4N9IA 3I56I 4AT1B 1O5JA 4FNHA 3LA2A 2YKNB 2UUCF 5B0CA 4BHBA 1JB0C 4CYUA 4Q4ZF 1HW9A 1VQ7I 1JT6A 3DRPA 1F1ZA 4P96A 1VIOA 2VUGA 3HDDA 1KQSR 3OQ2A 2FZGB 3M2RB 3E0JB 2E5IA 3FC9A 1MBFA 2ISYA 4JI0J 1OFCX 2NXEA 2BJ7A 1MBEA 3CCRS 1X4CA 2KFZA 3PIOQ 3S17J 1IXKA 1Y8RB 2CPDA 5E1WA 5EYRA 1U1RA 2BYCA 5EF6A 1IUJA 5EUHA 1UWBA 1APSA 2R7TA 1FBQA 2BJ1A 1TKDA 1NSKL 4G6QA 2I38A 2GGPA 5J6XA 1EARA 1FXDA 2HFHA 1CJVB 4QSHA 2BABA 3BG7A 2C42A 2FMYA 2W4DA 2EIJH 3HTSB 2MYFA 4A5NA 2FNAA 2NREA 1Z1ZA 1KVIA 1F2GA 5J40A 1D0XA 3HIFA 3Q3SA 1NG7A 2O7OA 1QSSA 1S6OA 2VKEA 2DB1A 4R0JA 2XWYA 4NBQA 2NAZA 2OA4A 2QM3A 3C16A 3T9NA 3FX3A 3GB0A 2MZRA 5EZHA 1B0PA 2HNDA 1SB6A 4R0EA 2G13A 2PMZA 1UJ5A 1B7FA 4HW0A 1M5PC 1BBYA 4M94A 4DR6J 2CIMA 2KYXA 2JTVA 1U2FA 2BE5F 2W7OA 1KFDA 3MKYB 3OMYA 4ENNA 5E3CA 3TAMB 3KHRA 4DV4J 3W9HA 4LFAF 1WOPA 2COLA 5KFTA 5CCMA 1TV6B 3M2UA 5E3NA 2CWKA 3W7BA 2F3JA 4LLLA 2A3JA 4L73A 2STTA 3JQJA 3N01A 3SV3A 3ZMTA 4X65F 3O8WA 5DETA 4P9SA 1DP3A 2HAIA 3FK7A 5C42A 3M1VB 1WJ5A 1H0HB 4E70A 3CD0A 1A6QA 3BPDA 5BYSA 1WJ9A 2RC4A 4ED8A 3OJUA 1WOSA 1RT1A 1UFMA 5CAAA 3MCZA 2LQ9A 4B9UA 4DS5A 1KHVA 3Q24A 2VICA 5HO4A 2XAHA 3UKGA 4IQJA 4IO1A 3K7RA 5BNGA 3TR5A 4C6AA 5BXIA 4F50A 1GDTA 4AVPA 3HJEA 4J9NA 1N48A 3FCVA 8ATCB 4WXWA 4KYWA 3CCYA 4CA0A 2Y0SN 3PM1A 4GGGA 2XMJA 5HMYA 2WAQD 4KY3A 2V8HA 3NAUA 4M72A 3H20A 3NAHA 5AIQA 1BW5A 3LA0A 5ITHA 1T3OA 4HF2A 4ES1A 1N32F 5E8IA 2G7UA 3Q0VA 3BTLA 3R0AA 2DGVA 2PD1A 4YR3A 4Y17A 3B4DA 2OU2A 3B4MA 3ABTA 2M2BA 4ZVFA 2DHXA 2G1HA 3K1PA 3CCTA 4NCGA 3CZ6A 2P7CB 5GP9A 3ULHA 4TNOA 1M1EB 3RB3A 1BI0A 2EFVA 3JRCA 1AB8A 3ELHA 1KQFB 5IQ6A 3MPDA 1RRJA 3BQ2A 2MDAA 1N5VA 2HDCA 5EX0A 1Z05A 4KE5A 4UY8T 3ABMH 1TWAJ 4AD9A 4IOBA 4NLWA 1H88C 4JI4J 1RT4A 1HOMA 2N4DA 1USTA 1FKPA 3ILIA 1RT2B 4BQNA 3MHYA 4HHJA 1VBKA 5BS6A 1TP4A 3VZIA 1Q1HA 4DV1J 1HWJA 1FWPA 2DPIA 4LIWA 5KFNA 1Y1WJ 5CKTA 1YX5A 1FNOA 3V6DB 3D1QA 4FETA 2WBMA 3KK1A 4ZVEA 3RBDA 1N6QA 4A6EA 2Z57B 5B08A 4PRFA 1DQUA 2G0EA 1RWOB 3ETMA 4M9SA 1VC5A 3VALA 4J91A 2XS5A 2XKPA 2HOAA 5IYBJ 1WKKA 3S15J 2HNZB 4OIQF 3K8VA 3R2CJ 2LVWA 1P4AA 5B0GA 2J5AA 2MSTA 4LSNB 2R7SA 3J7YU 4BWMA 4JOUA 1U0JA 5FRMA 2WSFC 1VF9A 3BOQA 1BN5A 3ZOBA 4DIQA 4L75A 2GMLA 3RBZA 2MKSA 4Y2IA 1DY3A 1IRFA 1HARA 1IN6A 3IV5A 4IUFA 2DITA 3PNVA 1FLIA 2GJ2A 4ZDPA 5D4OA 1JGSA 3BR8A 4DN9A 5EWEA 1F4KA 4RW6A 4JI5J 2GHPA 2IP2A 4BH9A 2RIJA 4OAZA 2LFVA 1KU3A 4XKVA 2YQ3A 1MNEA 2UU9F 2VPWB 1HWIA 1BD6A 1AFJA 1K4TA 5LEKA 3BSAA 3EZUA 4LBPA 4HSTA 2KZZA 3PX4A 1N78A 4WXOA 1O51A 1D8KA 1IDZA 4MK9A 4XRFA 4KR0B 1DURA 3HRMA 1HYSB 4LF9F 3J7Z5 4AYBD 2ACJA 1JLBA 2FSWA 2K27A 3BWGA 2ZH3A 1XCVA 3FMRA 3SV4A 2LP0A 5BPDA 4I1TA 4OIPF 2AGOA 2B6AA 3PM9A 1Z3XA 3MWMA 2W2OP 4IEJA 4B44A 4CT8A 3HP6A 5H20A 3SCIE 3ZTPA 1AU7A 1UEKA 2VL1A 3HDSA 1S97A 1MW7A 1FXRA 2WK4A 5EG0A 2MQOA 4P7TA 1TL1B 4DZPA 2HGCA 1Y00A 3SQGB 2HQNA 2DYRH 4OYMA 4MEXF 4X4PA 4IPAA 2EXUA 2VH7A 1RTDA 1SQFA 3K59A 2R8HA 4N77A 4TXSA 3MEKA 3MEEA 4USVA 1WJEA 3WTYC 2HVRA 4XRSG 3R5DA 2F40A 4IVNA 2MD5A 4ETSA 1Z77A 2RAQA 3M8FA 1SVDA 1NK6A 1MBHA 3ZZOA 2CKWA 1JHFA 1D8ZA 3BGOP 3L3CA 1D9AA 2AXTC 1IBLF 4PK4A 1RI7A 4CIOA 4OINF 4QLCU 2HQIA 4F2RA 3TKYA 4IOAF 5BPIA 3EM1A 5KG1A 3SYTA 1B3TA 4F4XA 2V1XA 3N5FA 2B8QA 2DA2A 3CCSI 1GK8A 5IV4A 4IQMA 2PC6A 2CO5A 4IRCA 1IKVB 3R5GA 3HOZJ 3RRKA 1YJ9I 2PA8D 4HDUA 1SD6A 1VQPS 1SL0A 5ETNA 4CO0A 5ETPA 3DLEB 3FXQA 4C2UA 2FIUA 1SC1B 4RNFA 5F9LA 3UO0A 1FWKA 4KFBB 2OF7A 4YFUA 3VAGA 2E5LJ 3I59A 3HVWA 4Z2YA 4DN0A 3FF5A 1QZEA 3VAIA 1VHFA 1MWYA 2RU9A 4JV2A 5E3MA 3CJ2A 2CZ4A 4K2XA 5H9EK 3SSSA 4EJTA 3CCQS 4LSLB 3FBEA 3I32A 2B4OA 2WVCA 4IDKB 2Z2SB 3A0HC 1SANA 4BHQA 3MWBA 1S8NA 2X1EA 4RBVA 3DTIA 3OTBA 1BIBA 4HNVA 1QUPA 3Q8RB 1C1BB 3S1TA 4ZTJA 5ETVA 2HQ5A 5F0HA 1YDLA 2LBFA 2ROPA 1KU2A 3OYAA 3KG1A 2CAJA 1HHQA 3GF2A 3AA9A 2VG6B 2YWFA 3H9JA 5KFDA 3GV8B 4FYVB 4LBHA 1UHMA 4PCQA 2MKCA 3R60A 2F8EX 5E7OB 1LB2A 1KLMA 1H7XA 3H5AA 1HKAA 1U1KA 2XF5A 1X4OA 3O8GA 1SAXA 2V67A 3H0PA 4M9ZA 2DODA 3DRRB 3OHBA 1DJ0A 2CADA 3AFHA 4WFNQ 1Z1DA 3C14A 3E2EA 2FD5A 4LF5F 5FRNA 1OISA 3SHFA 2RJZA 3HKZD 1JLFB 2YKAA 2R42A 3I55S 1HNVA 1W0TA 3IGNA 1B6AA 2YNHA 1Q8IA 1Q8KA 4EO8A 1S1UA 1LWEB 1X1CA 4XDCA 4XO0A 1LDJA 1ETQA 1BR2A 3CCVI 2ZH4A 2DH9A 2GMJA 4BXFA 4URGA 4G1QB 4IOCF 1HD1A 1ETOA 4B3OB 4JB8B 1UWAA 3ZN0A 3DC2A 5M2PA 4KIAA 4Q2MA 2IS2A 2ZZTA 2E2HJ 4YMEA 3IR5B 1XGOA 3OYFA 2Y0SA 4GXOA 3HX9A 2V6EA 5E1XA 1VQ8S 2VODA 4KV8A 1OPIA 1XIQA 3HFVA 2MGZA 2HS5A 4W97A 1R58A 4DV3J 4C97A 2P9EA 1DFDA 2HIYA 2R7DA 2VV5A 3CF2A 3K1MA 3JRGA 4ECWA 3BGLA 1GXUA 2BE2B 3WIVA 3CUQA 2EINH 3IKVA 1JKHA 1Q79A 1Z2ZA 4NPOA 2MG4A 5ETTA 5DM7Q 3FHZA 3LO3A 4DZJA 3BV8A 1YRUA 2DH8A 4DR4F 4G7HF 4RB2C 1FNXH 4NXNJ 3GYXB 1AA1B 2ZITA 3RAMA 3IRXA 4CTAA 5LMUF 4CLWA 3MN2A 5M5WJ 2DY1A 3CP2A 4NC8A 1K4SA 5CYMB 4LF6J 3CMQA 1I50J 1E6YB 3Q89A 4E0DA 1NDPA 4OMFG 3G6XA 2R8GA 5IYDJ 3QODA 5LT5A 1D1CA 1TWFJ 4DV7F 5BOXA 1EH7A 2YU9J 2E7VA 2RT3A 3V7SA 3FFIB 3K4CA 1V54H 3ML6A 1YX2A 1HSJA 3KPHA 3B6BA 2ELJA 1BY9A 1R8BA 4K0KJ 2HSEB 2CQQA 5AIPA 3VYSB 3UVJB 4WBFA 2LQ5A 3DRXA 2XO7A 3HPOA 1HNWF 2XMWA 1TAQA 3FSXA 1VI7A 1QVFR 3K9TA 1YIJI 3SQNA 2KRFA 1HA8A 1XMAA 4PJJA 1K0VA 3QPLA 3BEGB 2KTQA 1LW0B 3A3PB 1FEXA 8RUCA 3QZ8A 2K9LA 3LWLA 2COBA 3CNQP 2NZ4A 4EYIB 1BLUA 4WP9A 3QQAA 4NLTA 2IS4A 2E5NA 1OJ4A 2OH2A 3NARA 3E5UA 1UA1A 5IOYA 3FXUA 2FJAB 1JE8A 3GLXA 5DZ6A 5K1YA 3M05A 4LFCF 2M3AA 3I96A 4EO6A 2O5RA 3HRSA 2G1DA 4BQAA 4PXDA 5KFZA 2GO8A 3R5JB 3HFKA 3L95X 2QSFA 2VKDA 3LA3A 3MUMP 2DVIA 3IBFB 1YJTA 4MJKA 3VR1A 5F04A 4ZVRB 5A8WA 2FJWA 4KPYA 2XS7A 4J9SA 4IXAA 3G86A 4LLNA 4TY9A 3O44A 1K6YA 3T1BA 4IFVA 2IA1A 2HFZA 3DOMB 2IAJA 2Q1ZB 1ZR2A 4LF8J 3ILJA 4BE2A 3KZYA 3LQRA 1MDMB 2JA5J 2Z8QA 5DM6Q 4KH0B 4X2BA 3N4WA 4E4HA 2CNOB 5GADI 4DZDA 5AONA 3L2QA 2CPEA 2HFVA 2WCXA 5DUIA 3KTQA 2MLGA 4WKRA 3N6MA 3D1HA 4RM2A 2WB1N 3KLEA 2QA4G 1VLOA 4J7CA 3K4JA 1RB0A 2DK5A 3DU6A 4LG0A 2QSWA 3PQKA 3G1MA 3V81B 2D1VA 2OD5A 2ZDOA 3QGGA 5HVGA 4NC7A 4DX6A 1NPPA 5IWAF 2ABYA 1F5AA 3BDPA 4DQPA 3RZAA 1FA0A 3V6JA 3AL0C 3CCES 2KHMA 2GJFA 4RW8B 2IYIA 1Z0XA 4LFBJ 2HZDA 3HZJA 2AZ3A 2K1RB 5KT3A 2JA6J 5T41A 4K4TA 2E7WA 3GXOA 4II2A 3CCLI 3QYBA 3J7AN 1G3WA 3P96A 2JZ5A 4U87A 2HFSA 2DCUB 2DIVA 5BMZA 3A01A 2BQ3A 2ZWPA 3M9AA 3IKTA 5K5OA 3SCKE 4MAKA 3BROA 1ORKA 1FNMA 3E01A 3ILLA 4QJVA 1FT9A 1L3VA 2GHWA 2C3PA 1R0BG 2VG5A 2E1NA 4XKCA 2JEIA 1IO2A 2A2CA 2R5ZA 1PUEE 3IP4B 3KEYA 3S2DJ 2Y75A 1AXQA 1FTZA 1NUEA 3DKDA 1NSPA 2WONA 4TQSA 1ITPA 5DUKA 2VBWA 2RN7A 2PJPA 1F3FA 3Q8SB 3ENAA 3HSJA 3GFLA 3OHAA 1MIJA 3HB9A 4PG4A 4ZKAA 2EV5A 2CYYA 1UCRA 3MR7A 1RABB 4YN3B 2QL9B 5H6RA 4Q48A 2A3SA 2EK6A 3EYYA 2KHDA 4PXBA 3ZXWA 1HBOB 4EM2A