2CG4A

Structure of e.coli asnc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords REGULATORY PROTEIN ASNC
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cg4A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cg4A02
4EGYA 4L9TA 2G9WA 4ZYHA 4IF4A 3D5LA 5JHUA 4ZZDA 3VODA 1R58A 4O6JA 1WWXA 1U6GA 2R7FA 2PG4A 2ZMEB 4LG0B 1XGOA 2P5LC 1FP1D 2CFXA 3KEQA 2ZNYA 4HDUA 2NNYA 4JBAA 2FA5A 3F8BA 4IXAA 5FD5A 4Q5SF 2DBBA 5CVUA 3GYHX 3L2CA 4L5JA 4JQFA 3BOQA 5E1XA 3MQ0A 4NHJA 4UUVA 5L3FA 5HDKA 2VODA 3RIRA 4M6YA 2F2EA 4BQAA 2GXGA 4AD9A 2FSWA 3ZMSA 2UZKA 1QQIA 4I02A 2OAZA 2MD5A 4RB1A 2F5FA 1LVAA 4ETSA 5E1WA 3GZ5A 4MEYF 2FNAA 4WX9A 3IRRA 2FBHA 4S04A 2OBPA 1XCVA 1TW2A 3EDPA 2V1XA 1RNLA 4HA8A 2BEOA 1HSTA 2CGPA 1ZAOA 2HR3A 2V1DA 1FP2A 4MEXF 4CO8A 2IP2A 5LHHA 3BJ6A 3BP8A 2HQNA 2FXAA 2P6TA 4P96A 2XKOA 1XCBA 2NAZA 1IAWA 2MC3A 3V7RA 1RUNA 3ZMUA 2A3SA 5L3DA 4EM0B 3HRSA 3P7NA 4IRHA 3WGHA 1HXDA 3K2ZA 1QZZA 1S7AA 2QM3A 2LSOA 1TQIA 1W7PD 4ZH4F 1ZHFA 1O3SA 2L4AA 3RDIA 1XGSA 1XB4A 2HZTA 2LF8A 4GGGA 3T5XA 1L3LA 1G3WA 3TQNA 2EJRA 3TOBA 1XSXA 5D5XB 3KZYA 3R60A 3ZMZA 3TOAA 2QZ8A 4Z2YA 2WC2A 4L0YB 4HX4A 3I54A 3L09A 4OINF 3ULQB 1TQPA 3P9IA 2P5KA 1JGSA 3GVAA 2RDPA 2AS5F 4M71A 2A6EF 2DFIA 1Q1HA 2VC0A 3EETA 3MWMA 1FX7A 1CGPA 1YQAA 1G3YA 2MBFA 5K5OA 5DDGA 2RC4A 1OMIA 5DUIA 5LEKA 4G9YA 1OYIA 3J80Z 2ZJ2A 1ULYA 1MKMA 2UXNA 1QBJA 3R0JA 2M1BA 2KRFA 3WE3A 1YIOA 4LLGF 5KK1A 2YX4A 3QPTA 5A2QZ 3S2WA 3WODF 2F5DA 2ACJA 3MFKA 4RGXA 2GZWA 2HTSA 2GA2A 2CVIA 5LHIA 4UVCA 3BJAA 2KIFA 3QOPA 1XDSA 4CHUA 3O2PE 4BHBA 5TJJA 3T1BA 3F23A 3HIFA 3F21A 2GAUA 3FMRA 1LDKB 2PN6A 2KJBA 4Y17A 5CVIA 3O6BB 2DT5A 5K5QA 1D5VA 3E3VA 3VOEA 4HF2A 2D1HA 3RYPA 4I98B 4P55A 2FQ3A 2L4MA 5AIPA 1B9MA 3V8KA 5F6FA 1IN4A 2AXLA 1LQ1A 3EYYA 2PEXA 1IN6A 3CJNA 2DPDA 3RKXA 2DO7A 1WSUA 5D5VB 1FYMA 4OOIA 1MGTA 3LFKA 3E97A 2HFHA 5IT3A 4G7HF 3DF8A 1R00A 3DPLC 5KVRA 4HX8A 3IHUA 4RB0A 1WKMA 5D5WB 2P5VA 1ON1A 3SFZA 4I7HA 1HW2A 2R7DA 5EEGA 2P8TA 1U2WA 3KLOA 2QYOA 2OZ6A 1HKSA 4XSZF 4KIFA 3RTRA 1RI7A 4KMFA 1YYVA 4A5NA 1T39A 4ENMA 2EV5A 3ZN1A 2Y75A 1K6OA 2MLGA 4BNCA 3QPHA 2OA4A 2M8EA 5LGTA 3DP7A 1FY7A 4AIHA 2HYGD 2NYXA 2LNBA 4IJAA 2HWVA 2V1UA 1UHMA 3CTAA 2DTRA 4HLYA 1TW3A 3BJOA 1FBSA 3BWGA 2L54A 5ILSA 1G6NA 2P4WA 1KU3A 2FEZA 2XASA 4R79A 3DFGA 3TKYA 1ZGJA 3P9KA 1ZREA 1P4XA 4GXOA 5H6QA 1O3TA 2HS5A 2YPRA 4U0VA 1UFMA 4RS8A 3HHGA 2OZUA 2VC1A 3IC7A 2HOEA 3T8TA 3DXJF 5E1ZB 2H6CA 5TRDA 2DLLA 3ZMDA 1XMAA 3KEOA 4Y15A 1IXSB 2QLZA 4ESBA 4KFCA 1FNNA 5DUKA 3WTZA 3JAMZ 5E8IA 5FB2A 2Z3YA 3DEUA 2QVOA 4BHPA 4YFKF 1BI2A 2HEOA 4MQVA 2DPUA 3KP4A 3L9FA 3G3ZA 4P5OA 1I5ZA 1G3SA 5LGUA 2QUFA 1YTYA 5HS8A 3GFLA 2VONA 1UB9A 4ON0A 3WGGA 2W25A 3V4GA 2M5WA 1B59A 1PDNC 4R1HA 3GX4X 1EV7A 5FLXZ 3H3ZA 1P92A 4HV6A 1ZRCA 1JE8A 3KE2A 3HSEA 3GW2A 3EUHA 5BPIA 3T8RA 1TBXA 2KJCA 4DQ2A 2CYYA 3CUQC 2GIVA 5ICEA 5FD6A 4I0AA 5FGMA 2EFPA 1I1GA 3N97A 1YW9A 1U78A 4L0ZB 2WTEA 3WG9A 2XAJA 5F64A 3HRUA 2PMHA 4P9FA 3C3WA 1WRJA 3KP3A 3B73A 2CSOA 3WGIA 2VBZA 3ISPA 4UNOA 1S6LA 3MZHA 3QP6A 2E7XA 2PQ8A 5LLQA 1J7KA 2GXBA 2YU3A 3FWEA 3M8FA 4OMZA 2VE9A 3JAMK 1RIOH 3DPTA 1W5SA 2XV4S 3KZZA 4RB2C 3BPVA 3E5UA 3MZYA 3ZN0A 4RB3C 4A0XA 1Z6RA 3HSFA 3NEUA 2GQQA 5LRSA 4LMYA 5HLGA 1U8RA 3TDZC 3R61A 2RVCA 3EQLF 2ZMEA 2Q8KA 3TDUC 4M9SA 1R7JA 2D45A 3ZQ7A 1G3TA 2G7UA 3NRVA 1UHWA 3MCZA 3HTUA 4HAMA 2K27A 3R4KA 3I0TA 1B9NA 1USSA 1KU7A 4CXFA 2K4BA 2HYFA 3GF2A 4WXCA 1ZYRF 5BS6A 3F3XA 4YG2F 3QP5A 2FNPA 4EV0A 1SD7A 4QWQA 2B0LA 3O3KA 3TGNA 1HKQA 4LB5A 3COAC 1HW5A 3JSPA 3ABTA 2K4JA 4TV7A 2C6YA 1BI0A 2L3DA 3VB2A 1ZGAA 3IKVA 5HLHA 4Y13A 1B1BA 4LD5A 3QAHA 5EEHA 1BI1A 5D6FA 3IKTA 2VT2A 2BE5F 3I59A 1YS6A 4A5MA 2H94A 4LGWA 2XROA 3HHHA 2O6GE 3R6SA 4YIFA 2W57A 2EV0A 4WF2A 2Z5UA 1ZH5A 4BH9A 3TO7A 4Q47A 1SMTA 1TTYA 2EFWA 5FFZA 4XRFA 4LJZF 2O61A 1CF7B 2XVCA 2K02A 1Z05A 2LKPA 4UVAA 1MJBA 2VBWA 5E20A 3ZPLA 1O7LA 5J8FA 4KA4A 1ZARA 3F6VA 4F7ZA 1SMYF 3LAJA 1L0OC 1IRFA 1D3YA 1P6RA 1Y0UA 5JFRA 2PI0A 1F9NA 3CO7C 4UV8A 1ON2A 5BOXA 1SD6A 3F6OA 1S29A 1TNTA 4Q4ZF 1U5TA 2KIUA 1FBUA 2WV0A 5FFXA 2STTA 2GA1A 1IF1A 2NS0A 3PQJA 4I0BA 4L9VA 5FLXK 2DI3A 3OOPA 2Z9OA 1MJ9A 4UV9A 4HQMA 1R36A 4I2OA 3GLXA 5D8KB 4N9HA 2EFOA 1XGMA 5IT9Z 1BIBA 4H0EA 5FO5A 2M87A 5LGNA 5ICCA 2UXXA 2EFQA 4OU0A 1YW7A 5AIQA 1I27A 1XGNA 4KMUX 3E5QA 4L9JA 3F22A 1PUEE 1CF7A 4LG0A 1A04A 3ML6A 3I53A 1J75A 4GYGA 4EJVA 1O3QA 2Z33A 3GZ6A 1FT9A 2FBIA 3ABUA 2IA2A 1B4AA 1Z7UA 2X4HA 3GFMA 4EM2A 2PBIA 2HGCA 3HRMA 4RGRA 2ZFWA 5HS7A 4G94A 2ZKZA 4EQQA 3V7SA 3GEZA 2E7WA 4EJTA 1J0RA 3SXYA 2VBXA 4BAYA 4ZYDA 4ZYEA 2ZO4A 3L00A 3RKYA 4A2UA 1YS7A 2VBYA 4M72A 3F8CA 3MAJA 1OYWA 1SFUA 4YFNF 4RGUA 1WQ2A 3JSOA 3JTHA 1XSDA 2R3SA 3E6MA 2IW5A 2QBYA 3I64A 1QNTA 3QU6A 1S8NA 4O5VA 2W24A 1IXCA 4ESJA 1EH8A 3BZ6A 3LQRA 3K0LA 4KIGA 2QBYB 3I4PA 4EM1A 2NRAC 1ZG1A 4WXDA 4E70A 2Z99A 3C18A 1ZRDA 3HTSB 2EK5A 2D1VA 2LF7A 5DD8A 1F5TA 3BDDA 1TLHB 4ESFA 4AVPA 1SFEA 3BROA 3FHZA 4PGHA 4MTDA 5IT9K 1H9TA 1STZA 2IVMA 5LBQA 4CZZA 4ENNA 4KT5C 4AWXB 3HOTA 4KN7X 3WE2A 4KICA 4Q48A 5DCFA 3B02A 2FU4A 3D0SA 4LFUA 1Z6TA 4A12A 2L02A 2OQGA 4OIOF 6PAXA 2Y0MA 3L7WA 2FMLA 1FSHA 1Z91A 5BQTA 3FMSA 3GO5A 1X3UA 1YO5C 5DYMA 3CDHA 5CJ9A 5ERIA 2YSRA 2MA3A 2IPQX 1NHAA 3F72A 2CG4A 2STWA 4HOBA 2ETHA 3IL2A 3WTSC 2HQRA 2ISZA 3G73A 4IHTA 3J7AO 2XGXA 4HLXA 3KP6A 4WWCA 2Y48A 2FMYA 5J8CA 2XKPA 3EYIA 3Q9VA 3V8JA 2DQLA 3LAPA 3HOSA 2V9VA 4GCVA 2UWMA 3KLNA 5L3EA 1P4WA 4U0WA 1G4DA 4M9XA 4KDPA 4HF0A 4XLNF 2O03A 1BBYA 5K1YA 2W84A 1U3EM 1YG2A 1PP7U 4MHGA 2FRHA 3KCCA 5D8LB 4MGRA 2RN7A 3GFJA 1FYKA 5BMZA 4IRIA 2O0YA 4LB6B 4XBFA 2RGVA 2P7CB 1KQ0A 5CVRA 3IWFA 3CLOA 2D2WA 3SHFA 2VN2A 4UVBA 1KGSA 3E6BA 2L01A 5D6EA 1FBQA 1IUYA 1S7OA 1V4RA 3HYIA 1ONVA 1J59A 2DW4A 4M73A 4M9ZA 3SZPA 4AIKA 3SQNA 4G8XA 4EVIA 1U5TC 1ODDA 2IA1A 1FC3A 3K1NA 4KUMA 3F8FA 3IRQA 4U7DA 2PJPA 3M8EA 1YFHA 5F1RA 1KQ8A 3RI4A 4EGZA 2IJLA 1IRGA 3JW4A 5HS9A 3LA2A 3OV8A 4ZZLA 2CW0F 2ZBKA 2E1AA 1JXSA 5LHGA 5L3CA 1ZN2A 2IA0A 2G7HA 1XMKA 4HZFA 1F4KA 3DQVC 2HTJA 3ZMVA 3ERED 3FM5A 4B8XA 1E2XA 2CO5A 5E18F 1EH7A 2A07F 2DAOA 1LEBA 4JK1X 3GWZA 2EA4A 4O3MA 4LLNA 2LDUA 2A68F 1QO0D 1WI9A 2PFBA 5BPDA 3AAFA 4KN4X 2KIMA 1BJAA 4A0YA 2EV6A 1T38A 4RAYA 5DCMA 2K7LA 5H6RA 2F5EA 3I58A 1GXPA 2ESNA 4OIRF 3I71A 4DNCA 3ZMTA 4FX4A 2EFNA 1FPQA 2KKOA 1U5TB 2IRFG 3W6KB 3K69A 2HKOA 2FE3A 3KETA 3RKWA 5AONA 2XAGA 4FT8A 1D8JA 1Z1DA 3RPQA 4XLPF 3H3UA 2EWNA 1BI3A 5DV5A 1BN5A 3F8NA 4LK1F 4QLCU 3N4MA 1OR7A 5H20A 1HBXG 3K1PA 1KU9A 4NQWA 3J81Z 5L3BA 1IN7A 3WTWC 3WTYC 3HUGA 2A69F 4ASNA 2RKHA 2P7VB 3HRTA 3ECOA 4KNYA 2DJWA 1W4MA 3RJPA 2H09A 1R1TA 3WTXC 1AOYA 2ISYA 1USTA 1RZ4A 1LNWA 2DK5A 1MDMB 2PMUA 3GFIA 3CUQB 3REOA 4B09A 1K78A 4WXHA 4CGZA 1R1VA 2FOKA 3LSTA 5D4SA 2ZBCA 3U9GA 1C0WA 3WTTC 3FZVA 1B6AA 4UHTA 4M74A 4GO1A 1FLIA 1W7PA 1KU2A 1TQMA 4ZYGA 2Z4PA 2JSXA 1J2XA 3Q9SA 1V3FA 2VT3A 1H9GA 1IN8A 2E1NA 1DP7P 2Q2EA 2DU9A 3LWFA 4KYWA 1FOKA 2ZNZA 4OIPF 3I5UA 1JHFA 2OU2A 3H92A 2VXZA 1HW1A 4GYIA 1QZYA 2XIGA 1T0FA 4S05A 3M7GA 3E6CC 2RQPA 1UCRA 2YR2A 1R1UA 3VFZA 2A61A 2DK8A 3BY6A 1AWCA 5CVJA 4A0ZA 3FF5A 3ZP5A 1KQ9A 4RAZA 1GVJA 1REPC 1W5TA 1R5HA 2O3FA 3QU3A 3QRFF 4G7OF 5JVTA 2XAHA 2J5PA 4G7ZF 1S3JA 1ZG5A 2YX7A 1QPMA 1SFXA 5LEJA 4IPAA 1ZLJA 4G6DA 3K1MA 4P9UA 1VTNC 3WTVC 2A5YB 1KYZA 4UXNA 1ZRFA 3J81K 1MD0A 3PQKA 1OPCA 4WCGA 4U0YA 3U2RA 3ELKA 1FZPB 4HDVA 5HVQC 1H0MA 4R8HA 4CDGA 3J80K 1BOAA 3V7CA 1I6XA 2JPBA 3GXOA 1IW7F 4MTEA 3LA3A 1IZ1A 5JI6A 4BHCA 2XRNA 1O7FA 5E17F 4CYDA 3ROUA 1LDJA 2J5OA 4AIJA 2COMA 1R5GA 5D4RA 2HKXA 3M1EA 4A6EA 1SD5A 2HDCA 3IWZA 3WU1B 2DQRA 3F8MA 2GWRA 1HSJA 5HLIA 1EH6A 2XUBA 2M45A 2O8XA 1MZBA 3U1DA 1FSEA 4L9NA 2W85A 3C7JA 1ZG3A 4NB5A 1LB2A 3M9AA 5K5RA 4ENJA 1DPUA 3RPUA 3FXQA 4BYYA 1FYLA 4XSXF 2VE8A 5ILVA 1T98A 3LQQA 2FBKA 5CLSA 2IT0A 3E5XA 4PDKA 1FWZA 1OKRA 2BYVE 2Q0OA 5JR3A 1RUOA 1SAXA 5ICFA 4I01A 3RYRA 1TNSA 4HW0A 4EJUA 1I1SA 1R22A 2JZYA 2ESHA 3GUDA 1J9IA 3FXRA 2QENA 2CQKA 4K2EA 1O57A 4G6QA 1IXRC 4HV5A 1W7PB 2VOPA 4MNUA 3BPXA 2P6SA 4OMYA 1ZLKA 1T2KA 2JPCA 1DUXC 2JRTA 3KP2A 2BBYA 4EMSA 3DKWA 3T0YA 3FM3A 2QQBA 2JT1A 4U88A 2MLKA 1YLFA 1O3RA 1MDMA 4IHSA 3VEPA 4ENKA 5LRRA 1F1ZA 1LDDA 3JTGA 4EJWA 3TO9A 1DPRA 1HQCA 3W6JB 1QGPA 2A6HF 4EJOA 5J6XA 2JTVA 5DD4A 2H27A 4L5IA 1LJ9A 5ED4A 2M30A 3P9CA 4HX7A 1K79A 1E17A 4D0PA 2BGCA 4PCQA 3LA7A 2RNJA 1P4AA 4PGGA 5ICGA 2V6CA 4FX0A 4HF1A 3I59B 4FHTA 5CYVA 3FMQA 3C1DA 3FXUA 1XD7A 4MQ9F 4PZJA 2XAFA 2WWYA 2XHKA 1J5YA 1KYWA 5DEQA 2E1CA 1XN7A 2V79A 1Z9CA 3TO6A 2TDXA 1R23A 3K9TA 1YW8A 5L3GA 4I09A 2ADUA 5HOOA 3FX3A 5ILUA 1BM9A 5CVVA 1T6SA 2F5CA 3SZTA 1MJAA 1BIAA 2QQAA 1KA8A 1SD4A 2RV8A 1JHHA 3HSRA 2QWWA 4LK0F 3NQOA 2EA2A 1OYYA 2ZCWA 1HKTA 2H6BA 2JSCA 1K78B 3CUQA 1LEAA 3PFIA 4YIIA 2VOOA 1XDUA 5D5UB 4HQEA 3DV8A 3CUOA 3ECHA 5HDNA 1P2FA 3CO6C 4N9IA 2XAQA 2OQRA 4A6DA 3R0AA 2PLYA 3KP7A 4HBLA 5A2QK 2MH2A 2QQ9A 1XSVA 4IVNA 2ELHA 1K7AA 1D8KA 5HDGA 3Q5FA 5E8GA 2MH9A 2K86A 3E6DA 1IN5A 4U7BA 2NNNA 4WK8F 3KP5A 4RGSA 3MEXA 2EB7A 3KFWX 1GHCA 4KIBA 2ZXJA 5DCMB 3V8LA 4CICA 4BXUA 1GXQA 3WTUC 2FF4A 4LLLA 4OIQF 2BV6A 4IRGA 1PP8F 1BC7C 4M6XA 4YFXF 2OD5A 2X0LA 2CWEA 4N0BA 1BC8C 4L18B 1DDNA 3WU0A 4HYEA
chains in the Genus database with same CATH superfamily
4EGYA 2QLJB 2RRNA 3DLGA 5A8KA 4ZYHA 1Z67A 4IF4A 3NY0A 4F4XA 4ZZDA 3W61A 3HGYA 3LSRA 1K0VA 3KHLA 4WYLA 4OFZA 2BJ3A 3Q89A 4DX8H 2QV6A 1D1UA 4HPQA 1WTBA 2EKYA 1VYAA 2I1RA 2X1DA 2CUEA 2BE7D 4WFYA 2DA1A 2P5LC 3LH2S 3HJEA 3MEDA 4NE9C 2UUWA 3OFFA 1UEUA 3FK7A 4HDUA 4LITA 3S1QJ 2RS2A 3AT1B 2ZEJA 1RT3B 2C3YA 5K5MA 3S3NA 1Y5IB 1JGGA 2J0WA 1N32F 4TN2A 4JX6A 1APSA 1VMBA 1HNXJ 3EVMA 4UOCA 1QTNB 2MSYA 1AKHA 3MCNA 5J1EA 2K5CA 4DQPA 2KG0A 3BGUA 4IOBA 3TAMB 1RWKB 2F5GA 4P2MA 2JSPA 5HDKA 4ZVEA 2ASYA 5DGBA 4KGZB 4ED8A 4BQAA 4AD9A 2UZKA 5IV4A 4I02A 2M8DB 2MD5A 2KHCA 1WGXA 1RTIA 1LVAA 5E1WA 1E6VB 3UN2A 5CAAA 4XORA 4ECUA 3ZTPA 4WX9A 5FDLA 2E5IA 4LRCA 1VBYA 3MAAA 1I50J 4M5HA 4OZ2A 1RNLA 1YJRA 2V1DA 3H5UA 4MEXF 4CO8A 2W9CB 3BR1A 2FXAA 3HPGA 4P96A 1OPIA 2DA5A 3NBPA 1IAWA 4I4BA 1MWZA 3ZMUA 1JKOC 4ZPVR 4USVA 3GG0A 2C2DA 5IT9U 1V5FA 1KVKA 1IBCB 3OR1B 4IRHA 3K2ZA 1QZZA 1HNZF 3DXBA 3M2VB 1TQIA 2DFFA 2DN0A 5KFRA 3NGTA 4ZH4F 2VPYB 4KO0B 3S8SA 2LEAA 3DRSB 1M90T 2HZTA 3SCLE 2LF8A 2OFGX 4GGGA 2DT9A 1L3LA 4L6V3 3SBMA 5I3UB 3FDSA 4V2FA 4RUAA 1W36D 4QWEA 1M1KT 4PUOB 1XSXA 1KSPA 2XGEA 2LVWA 4DWIA 2R5YB 3DCFA 2WC2A 1AA1B 1N0VC 1OQ6A 4E0DA 4DS5A 4Y2IA 3CCUS 3M8QA 1RADB 3CCSS 5GADI 1HIYA 3MR3A 3GVAA 5ADZA 2AS5F 4E7HA 1JUPA 1Z77A 3MWMA 3GQCA 5D4OA 5HVFA 5K5OA 2KPMA 2FLPA 1ZGWA 2RC4A 2GQCA 3A3PB 4JI8F 3GZNB 1O5JA 2DNRA 2VPXB 1ULYA 4DFMA 4OLPA 4KPYA 4W92B 1WH7A 5FKNA 5E3LA 1YX5A 5KK1A 1NH7A 1PKUA 1TV6B 1CS4B 3D5MA 1HNWJ 3QPTA 2R92J 3S2WA 4I64A 1RU2A 4DV2F 1HBNB 3CJ4A 2BOPA 1CSJA 4GC7A 2CIMA 2V8VA 2V94A 2ZHBA 4OI2A 2ZJPF 3RBXA 3TAQA 1FTTA 2HVDA 5CH7B 2UVUA 4CLLA 2GA2A 3P96A 4O4GB 3H5NA 4UVCA 3OOUA 3CJ3A 5A8WB 3KWMA 1BW5A 4CLUA 1UAAA 1TK5A 4F50A 4LIUA 4BHBA 1SKUB 2Q6CA 1Q5VA 1FMWA 2NSCA 3F23A 4BS2A 4DW6A 5GAGI 4DV6F 4F0KA 5EGOA 1SC7A 1C4AA 3PEHA 4PKDB 4JI7J 4DZJA 6FDRA 4G1IA 1I3AA 3DLEA 2WB1N 4CCOA 2KYZA 3O8GA 2YTCA 1WC1A 2CG8A 4I98B 3MMAA 4P75A 3MM6A 3OFEA 1SV5A 1B9MA 2Y1IA 2AXLA 5KT5A 4F92B 1BMQB 2R0QC 4QYZK 5E2QA 1ERDA 4CT9A 2UUAF 2HZDA 1BHNA 5KT3A 3BTLA 2ZH9A 1FYMA 1ACMB 3FQLA 4OOIA 2DHGA 5KFXA 1S1VB 1R27B 3D6TB 2A3JA 3PJWA 3DF8A 3CCEI 4X4UA 1IRZA 3I5AA 5KVRA 2HIYA 1WKMA 1UJ8A 2R7SA 2V7FA 3SFZA 4LFCJ 4HHJA 4I7HA 2B7CB 2PC6A 4WTOB 3EE3A 1RYRA 5KFYA 1UVMA 4FKXA 1FKPA 2B9XA 3PXGa 3KLOA 2R7VA 2NS7A 5IY5H 4RW4A 3ENAA 1A7GE 4XLAA 3PW4A 1FTCA 2HVRA 4PYDA 5LMNF 3TP0A 1YYVA 1T39A 2EV5A 2DKOB 4CWBA 1R71A 1QJHA 3GIMA 1TKDA 2XC9A 1SFKA 4D3GA 1RABB 3ITHB 2HYGD 1BXNA 1FO1A 3BC8A 1VQ8I 2BXYA 1UZDA 4NPOA 3GZ7A 3A8KA 3OR2C 2LBFB 1FKAF 3BWGA 2IM3A 1ZS6A 4A3MJ 3L1PA 5D15A 3ELHA 1D9AA 4YB6A 3PNIA 1D0EA 3PIPQ 3OIOA 2P4WA 4IHYA 4ZVTB 4X4TA 4NI2A 1V54H 2EILH 4JP0A 4C3LA 1S0OA 1T95A 5DM6F 3V6KA 3GTJJ 3R6GB 4B9TA 4K4VA 3DYAA 3RKQA 4IOCQ 3LSJA 5HLFA 3FMWA 1JTYA 3UCUP 3B82A 3P9KA 4GXOA 5H6QA 3L7UA 2VB6A 1NB2A 2R5ZA 1O3TA 4NXMJ 1PO6A 4IDKB 3UR0A 3NWGA 4B43A 4ZOSA 1V5EA 4F91B 5L1JA 2FDNA 5E3RA 3MURP 1SVDA 5D6GA 2CNLB 3IC7A 1BR4A 4RX6A 3T8TA 3DXJF 1R8AA 1X1BA 1NO8A 4CH0S 3HVRA 1X5PA 3BF4A 2V2QA 2DLLA 3ZMDA 1XMAA 1QVGR 1NK6A 4ZITA 5ETTA 4KFCA 2LECA 2Y9ZA 3OYHA 3A0BC 5FB2A 3D9BA 4YFUA 2LY1A 3WDOA 3MVPA 1KLMB 3R5CA 3RRHA 4FYYB 2VUMJ 5HP1A 2HEOA 4MQVA 4YN3B 5I42B 2DPUA 3KP4A 4GKJJ 3AG3H 3TA2A 2DFEA 2LQ8A 4JI7F 5A2QU 2R2RA 3LPEA 4HYKA 3GFLA 3DLHA 4B3SF 1NUEA 3WBZA 1TWCJ 3SCKE 1KEKA 4G6TB 4KJZA 3LSIA 2M5WA 3C19A 3QT8A 4R1HA 1C1BA 3GX4X 1EV7A 1U1NA 2FZGB 2ZDOA 4DDFA 5FLXZ 2CUFA 4NMXA 1P92A 1HI0P 1BQNB 1JE8A 1FWLA 2B5JB 3LAKA 3DLBA 3EUHA 3V2UC 4WFXA 1M1EB 2KJCA 1XTZA 3E1SA 1I94F 1RUSA 2CYYA 3FMBA 3CUQC 2LQJA 5ICEA 2MDAA 3MM5A 4DL0C 3JQMA 2UXBF 5HLFB 2EFPA 1I1GA 1YW9A 4K2JA 3GYGA 2MTLA 1X4FA 2YU9J 3WG9A 5F0UA 2D3O1 5LFAA 2BKNA 1JKQC 1WRJA 2W2QP 2ID6A 3IWNC 3WGIA 2XS2A 1AFJA 1LWEA 1FDBA 2PFFB 3TJAA 4IQ4A 1X1DA 1BD6A 4PG6A 2GXBA 3FWEA 2ECBA 1HHTP 2HS0A 4A3DJ 3V5RA 4TXSA 1RIOH 2WHOA 1ZAVA 3CJRB 1W5SA 2XV4S 3CMEI 3ENWA 2LMIA 4RB2C 5BYSA 3BBFA 4X64J 3VAKA 3E5UA 3GYXB 3GTQJ 4MKVA 1RWVB 3ZN0A 4RB3C 5KT6A 1K83J 1YKWA 1HA1A 3NEUA 2GQQA 4BQQA 3ILLA 3ABKH 3TDZC 2BOAA 3AOCA 2Q8KA 2VKVA 4MFEA 1FRLA 5TGTA 1DQ8A 4ZN3A 2KZGA 4M9SA 1R7JA 2D45A 2J9CA 3DRSA 1WORA 2CQIA 4DV7J 2NS1B 2M34A 2J76E 3MD1A 4ZP8A 4I6AA 2K27A 2O66A 3I0TA 1USSA 4P7VA 1HDPA 3Q0UA 5ETVA 1TMJA 2DY9A 1KQSR 1RTDB 4DYQA 2YQ3A 5BS6A 3F3XA 1RC9A 2IGNA 2GVZB 1IJWC 3BH6B 4OZJA 1DLOA 3M8QB 4Q5VA 3GIRA 2B0LA 3O3KA 1NSKL 3BQ2A 2JH3A 5C7PA 2HHTA 1S0MA 4OYZA 3JSPA 3ABTA 4DV1J 2CJXB 1CQMA 1N33J 4TV7A 2C6YA 1P1LA 4M8LA 2B3TB 4DZ6A 2B9YA 2BHZA 4Y13A 3M1VA 1NJWA 4LD5A 3ZZ0A 1LWEB 2MSSA 4A3LJ 1TTHB 4RPFA 3JRDA 3CCWA 3NWSA 3I59A 3IMQJ 3HD2A 2BABA 4DYRA 1VS3A 2MB0B 4JI5J 4PABA 1C2PA 4YIFA 2Z58B 4ED2A 3DKDA 1TAQA 1RU1A 1WUUA 4URSA 4RWXA 4CRJA 1UW9A 1IBKF 4BH9A 2EFWA 5H1SV 4XRFA 5IOZA 2EW9A 3IBFB 3QZ8A 4LJZF 4LFBF 2V4QA 3HKZA 4UZCA 3OYGA 5E3QA 2XVCA 3WU2C 5ETRA 1XNQJ 4ITSA 5E20A 4ZVSB 3ZPLA 4BL0B 4PJMA 4LIVA 4KA4A 3F6VA 3SEQA 3LAJA 4EGLA 1ZK8A 3H2UB 4A46A 1IRFA 4LF4F 1TVRA 2A2DA 1D3YA 1AUDA 4LR8A 1S77D 1RT7B 2C2NA 2PI0A 4U8VA 2E2HJ 3TUJC 1Q86T 3AL0B 2AYGA 3D0HE 2MGQA 2ELJA 2W2PP 2NVXJ 3GTGJ 1S29A 4RW9B 1OO0B 3MOJB 1MMLA 3FGVA 3P5TL 2BR0A 4UT4A 4HRIA 3HC7A 5C2CA 3MMJA 2DNYA 3PUBA 4MIWA 2BZTA 1WC4A 1XBWA 2F3JA 2KL4A 2AGPA 1PCAA 1IF1A 1RTHA 2DGVA 4JI6J 4E7IA 3NLCA 2RHQB 3JTPA 4Q7AA 2KISA 1H74A 1OJLA 3OOPA 4OYPA 1LW2A 4LF7J 2BY0A 4UV9A 4HQMA 4K0KF 5FDLB 2IRXA 3TQ1A 4OZ1A 5D8KB 4AYBA 3DTEA 1IWAA 3Q8YA 5IT9Z 2HGMA 1JXVA 4H0EA 4F8RA 2RQCA 3I87A 3U02A 2PI5A 3W2WB 1EKEA 2UXXA 2EFQA 2DHSA 4Y3OA 2OIHA 4OU0A 2NZ4A 4IR1A 5AIQA 1I27A 1K61A 1Z7LA 3BTJA 4FXWA 4ELVA 1IBMF 2QSFX 2FHMA 1K47A 2EVZA 5AT1B 1PUEE 4PXDA 4JOUA 4ZCIA 3UW1A 3UN3A 4K0KJ 1PYSB 3PYFA 4G1PA 4LG0A 5ITHA 2ABYA 4F4KA 2F8MA 2F4FA 2HLUA 3AAWB 3NOCA 1U45A 2LFBA 5KG3A 3CD7A 1FT9A 1CVJA 4P9SA 3ABUA 1Z7UA 2X4HA 1ETYA 2V8GA 4V19X 4LFAJ 3I56S 3CCSI 1CS4A 4RGRA 1FX2A 1ZAXA 5LJ3Y 3J7AN 2ZFWA 5F04A 3VYRB 3PJXA 2V6AA 3EZUA 1WF2A 1S99A 3S15J 4L74A 2GMLA 5I4MA 1X1PA 3KLEB 4O3NA 3TZYA 3FUYA 3M32B 4RW9A 2E7WA 2F6CA 2OMLA 2G2ZA 4FETA 4ZYDA 2E5GA 4A2UA 5D3GB 2ECCA 1RT4B 2B8QA 1OYWA 1SFUA 4C11B 4LF4J 3D54A 2UZAA 4YFNF 1JKPC 3GB0A 3PX0A 2E35A 1Q8KA 4ILMA 3V4IB 3I0RB 1SH2A 4PJ0C 3OTBA 1KR4A 3ENQA 2CDRB 1P9QC 4R5PB 4DL2A 2HNDB 1VRUA 3H90A 1V5IB 3QU6A 4O5VA 3BGRA 3UWTA 4KC5A 1SL1A 3C2GA 4JV1A 2KIQA 3WHBA 5DDQC 4DU8A 4X66F 2E5LJ 3K0LA 2M4KA 2D3ZA 1U1QA 1S9EB 1FK9A 1ZG1A 2LDIA 2QGUA 3PRBA 2Y1JA 3C18A 3CC4I 5LD2C 3OYAA 4CLFA 3UI3A 1F5TA 2HZVA 3BDDA 1FDNA 1CC7A 3UPFA 2NREA 3BH7B 3LP0A 4IG3B 2KDOA 3EJMA 4N47A 3UDEA 3PX4A 1WC0A 4PGHA 2RKIA 3QQCD 4RR5A 1TKTB 3VAIA 4C9YA 2IVMA 4LQ9A 2KZVA 2YNGB 4ENNA 3DHWC 3FJ2A 4NZ7A 2RQQA 1NK0A 1NK5A 4WP3A 1Z3XA 3BGRB 4KICA 1X4BA 3W65A 1SBRA 3B02A 1H7WA 2FU4A 3MM9A 2HVHA 4C8KA 4LR9A 3KJVB 5THWA 1QVTA 3LMMA 2VJVA 3L7WA 2QMWA 1K9MT 3GO5A 4MFDA 3BKFA 1X3UA 1R7IA 3R7BB 2AP6A 3KK3B 1B70B 3LGMA 1TMMA 3CDHA 5CJ9A 3W8PA 2OTLS 1FEEA 3SXLA 4WP9A 4UQTA 2XLKA 3KLIB 3ZZUA 2E2JJ 2AJ0A 2NUHA 3T6BA 3PUFA 1UFWA 3H4BA 3T3FA 4HLXA 3K5MA 2Y48A 1WHVA 1VHFA 2DD8S 3EYIA 3Q9VA 1ETOA 2CWXA 3V8JA 2G13A 4XAKA 1YJNS 5IV3A 3EVOA 1QRYA 4X64F 2XZWA 3UDCA 1UJ5A 3FXJA 2XI3A 2OSQA 4U0WA 3L2WA 4KDPA 4NC6A 2CDQA 4R8UA 4HF0A 1BBYA 2ZHAA 1WHWA 4NRTA 3UNGC 3NWRA 3ONQA 3HFZB 2FLLA 3OXLA 4BBRJ 5HNFA 4MHGA 2AJ2A 3R5BA 5GAHI 1FYKA 5E5NA 1BLUA 1VQ5I 2O0YA 2G0IA 2RGVA 2P7CB 2ZHOA 4XLCA 4OJ3A 2BACA 2V9KA 4A3IJ 4UVBA 1KGSA 3OQ2A 2RT3A 1LWCB 3I9V9 4AVZA 4ZC3A 2YNIA 3C14B 2UVRA 4M73A 1J5OA 4M9ZA 3AD9C 4ZPAA 4Y0FA 2HIQA 3SQNA 2FY8A 4DR2J 3H9GA 1U5TC 4QR1A 5J1YA 4CLTA 3T1YJ 4TY8B 1ODDA 1X58A 2BJ1A 1WKKA 4F0MA 3JTOA 2L08A 1QAJA 3F8FA 1Y11A 2PJPA 5F1RA 1U6ZA 3PHEA 4EGZA 4B3TJ 5F0HA 3JW4A 2VG5B 3LA2A 2CA9A 3OV8A 3DDKA 2EFGA 2ZBKA 2VU5A 5KFWA 2E1AA 3MMCB 1HPZA 1BQNA 4D7NA 4PUOA 4CT8A 5IT9Y 4M3GA 2KFYA 2NSBA 5HMWA 4BS9A 3N28A 3BG3A 1F4KA 3DQVC 3DM2B 3OVSA 1ETQA 3FM5A 2RU3A 2ZITA 4FE4A 5E18F 4AU7A 5E3MA 2DAOA 1V6HA 2G2YA 3G8TA 2HI3A 1XMBA 2A68F 4ECTA 1XEZA 4F2RA 2NXEA 2IMOA 2IA6A 3AAFA 2MY7A 2MQ8A 3H8YA 1U24A 1Q81T 3J7Z5 2HZAA 1KVIA 1BJAA 1HMVA 4A0YA 2DNMA 4YOEA 1SC6A 1DQUA 3KLGA 2XHCA 3FBNB 4RAYA 2W4DA 4NLGA 4D5FA 5H6RA 3GBGA 1IR0A 1S7HA 4EWTA 3BO2A 3J81Y 2E5ZA 2ZSIB 3A02A 1HCRA 4UY8T 5GAEI 2R7ZJ 2R8HA 3I71A 1D9FA 2CPYA 4M5MA 1DLOB 1A31A 2GGPB 3VAGA 1VBXA 3PFOA 2XB0X 2IRFG 1GT8A 3R5JB 2YKOA 4NCGB 2R7OA 3RKWA 2F1FA 1Y10A 2YQ1A 3BG9A 1Z1DA 1WEZA 3RPQA 4RAFA 4FISA 2YNHB 5DV5A 3F8NA 1XNQF 2LBFA 2CQ1A 3OTOJ 4LK1F 4I1TA 1ZA2B 4GC6A 3N4MA 1OR7A 2CWKA 4H4MA 2QKMB 1KU9A 1QAIA 4NQWA 3X3UA 3J81Z 2NXUA 2CQPA 2F9DA 1T9WA 3WTWC 5GADJ 1NM2A 2SXLA 3D1HA 5IWAF 1H8AC 2CNNB 5A0YB 4ASNA 1F5BA 5IYCJ 2RKHA 4F4YA 3DLLQ 3BBCA 4HDGA 1U1RA 4QIEA 1D0XA 3HKZN 2Y0SD 2XI2A 2AQFA 4KNYA 4Q2MA 4C0HA 1H38A 3CESA 4KH1B 1R1TA 1T3OA 2RDJA 4LSNB 2ISYA 1RZ4A 4C3HJ 2DK5A 3BDPA 3AA8A 3DEEA 1NH3A 6FD1A 2X51A 3WX4A 3A1YG 1GVDA 2DFHA 1GX6A 2RF2A 5FIIA 2W1BA 3V81A 2FGOA 3OL8A 1PVEA 2A6MA 1ZBTA 1C0WA 1B6AA 4M74A 1AB8A 3ZTQA 1RAEB 1KU2A 1TQMA 4ZYGA 1X4DA 1J2XA 4OI4A 4P10A 2BYCA 5C24A 2E1NA 3CJ0A 4PFPA 2IGMA 2AJFE 2YH1A 2DU9A 2PGCA 1EP4B 1EQMA 4CLWA 3O2IA 1RK8A 3EVWA 1YQHA 3JRHA 3K70D 4ZHRB 1RP5A 1DURA 3K4NA 2NYHA 1NG6A 4KH0B 2XSDC 3GYNA 1LE8A 1YSJA 4Q2LA 1T0FA 5CABA 2MG4A 4HTIA 3M9NB 2OTJS 1WI3A 1VRTB 1R1UA 5FKKA 3BY6A 3KX2A 1RBLA 3D28A 3BN7A 5CVJA 4ZP7A 3ENVA 4A0ZA 2B63J 1QPIA 3ZP5A 3X2QH 1NK7A 1W5TA 1LV5A 1R5HA 2KVQE 5M2UA 3K17A 1MMGA 2RMLA 1SC3B 3JREA 4B3RJ 3GSDA 1RWNB 3BSAA 3OL3A 2F8HA 2CH0A 4CO2A 1H88C 1SFXA 2BV3A 5LT5A 1OCCH 1QUPA 2JZ5A 4M5KA 1ITYA 3PM1A 3UNYA 4G6DA 3CMQA 1JUSA 2H48B 2XNQA 3W62A 5K7HA 3M2RB 4AXIA 4DV4J 3M2UB 1FRXA 2AX0A 4IQJA 3G6YA 2XRLA 1UEVA 2M52A 4QQBA 4B47A 4DYCA 5F0WA 3JSBA 3CC7I 2NXCA 4UB8C 2EI5A 3PQKA 3AB2B 5C5JA 3T9ZA 5F9NA 2JA7J 1WELA 1CJKA 1FZPB 2YS9A 5HVQC 2JX2A 3E2EA 2R2SA 3V7CA 4EEYA 3CE8A 2Z8QA 4DPOA 4J19A 3HXMA 1IW7F 3FKBA 2XF5A 3TP2A 1IZ1A 2JVGA 3M6XA 3KMQA 4BHCA 1T02A 4CH1A 2RNEA 1LDJA 2E5NA 2COMA 1R5GA 3WG7H 4NMLA 4PG8A 5F8NA 3SZGA 3M1EA 1E3OC 3EXCX 4IH5A 3C6TB 1SD5A 4M94A 3SQGA 3IWZA 3KDOA 2M0GB 4N41A 2DQRA 4Y52J 3RB4A 2FGCA 5HLIA 1EH6A 2KB2A 1C1CA 1UAWA 4I6WA 3A8IA 1MZBA 3K8VA 3NMAA 1DZ5A 4WKRA 1T0TV 1B0TA 4P2FA 4L9NA 3N6LA 2W85A 3C7JA 2Q1LA 4ECXA 1ENHA 3BGOP 3OS0A 1Z2LA 2C2EA 3IR6B 3G71I 4NLPA 1AA7A 1NK4A 4ENJA 4NLWA 3RPUA 3FXQA 1VQLI 1SPBP 2RSQA 5D4PA 2DO0A 1Y8QB 4XSXF 2VE8A 5ILVA 3NGKA 3ZQLA 1T98A 5FRNA 1F1BB 1X9WA 2IT0A 4NLQA 3ETMA 2VQFF 1X2MA 4CQ1A 1NG7A 2Q0OA 2XSJB 5JR3A 4OYMA 2LK2A 2VLAA 2JJ4D 2GLOA 3CCRI 3RYRA 5H9EJ 4CTAB 3LSMA 2WW8A 1C1CB 4HSTA 1I1SA 1NZ8A 2GHWA 1OFCX 5HBMB 3HVWA 2MLYA 3GUDA 1UJ4A 5DJBA 3M8WA 4R25A 2GX8A 4FBUA 2HHWA 3KJQB 4K2EA 1N77A 1EB0A 5KAIC 2CS3A 4CM2A 4G6QA 1W7PB 5U47A 4DR2F 2VOPA 4PG5A 4MNUA 5LMUJ 5IOYA 2DGXA 3MR7A 2HHHJ 2VFUA 3KLHB 2O8KA 5DDPC 1T2KA 1DUXC 1R8CA 3NKYA 4PXEA 2JRTA 2BBYA 4N4OB 4NC7A 4RU9A 2BA9A 4CZCA 1VFJA 1HNXF 1RBOB 4I2PA 3MECB 1KQGB 3THVA 3BEGB 3OVAA 2JWNA 3VGTA 1QUVA 4LIRA 5HMXA 3Q83A 4WCEQ 1FJLA 3EGNA 3GJRB 3OL6A 4NBQA 5CYMA 3MOZA 3E0JB 2XGQA 2VIXA 1KDNA 5EDWA 2YQ0A 2GA7A 3TO9A 1MBGA 2Z1DA 1XPXA 1QGPA 4W1UA 4U7UK 3MEGA 3QIDA 4ZPCA 4AL7A 5DD4A 3OUYB 4J9QA 3S1MJ 2HQFA 4MLOA 3B6AA 3T1AA 1QZEA 3FXMA 1RT5A 1VQ9I 1SIWB 4HX7A 4WPAA 2BGCA 4PCQA 2IDEA 3OXGA 1P4AA 3LO3A 1Y3JA 1HR0F 2OD4A 4ZDPA 3HKWA 1G1XA 4CNZA 2A05A 3KG0A 1I6HJ 1NPRA 2DNPA 1XD7A 4MJKA 3O8WA 3M8PB 4UOFA 3A1YA 2N82B 3IGNA 3NGSA 4PYAA 2GQ2A 3NL0A 3FRYA 3RAXA 5LOQA 4QIGA 4CP5A 2WOMA 1KZHA 2V79A 4LT6A 4NYZA 2DYSH 3WIUA 4B9LA 5KCMA 4XIUA 1YW8A 3MPWA 5DLFA 3B78A 2ADUA 3GJSB 4O3QA 2KVIA 2RUSA 1MH4A 2RKIB 4IOCF 1Q79A 2J9DE 2MY8A 3A13A 4KFBB 5ILUA 5H9EK 3SZTA 2C2RA 1DTTB 2NCKL 2Z2LA 4DV5J 1FKOB 3KJNB 3RZOJ 2H9ZA 1RZMA 1OCTC 4RW6B 4TY8A 4A8MP 2RV8A 3BR6A 1HR0J 2XPUA 1XMQF 3J81U 4U6PA 3US5A 3NQOA 3MXHP 2OI2A 1Q95G 3PW5A 1RA6A 4PG4A 3IC1A 3DBRB 3CGIA 2QKLB 4LBPA 1JJ6C 2VOOA 1V3ZA 3CUOA 4Y65A 5HDNA 1P2FA 3CO6C 8AT1B 2XAQA 3MUVP 3BQ0A 4A6DA 3LOUA 4Z6YA 2HOAA 2PLYA 2R9LA 4O4RA 3CCJI 3KP7A 5I3PA 4A8XA 1XQIA 4NLDA 2UXCJ 3GTKJ 3QGPA 2FJEB 1YRNA 4IVNA 1Y0HA 1D8KA 1ZOTA 2IMWP 4N56A 4L75A 2K86A 3E6DA 1M1HA 2K7JA 4WK8F 2BY2A 3FEZA 2WAEA 3OTOF 2KDZA 4ZKAA 5KFNA 4RZRA 3RPUD 2EB7A 4B1RA 2OCCH 4ILRA 4KIBA 3BR0A 5DCMB 4CICA 1O8BA 1JNRB 1VQYA 3NNAA 3CWJA 2LDYA 4OIQF 2E60A 1IXKA 1X9MA 5B0GA 4NUBA 2BV6A 3ULHA 1BC7C 4YFXF 4DJBA 3DGPA 4N0BA 1S72I 4FF4A 5K14B 2BJEA 3OJSA 4IHVA 4UZBA 3KXDA 1PJ7A 1RBAA 4XOTA 5K8MA 2G9WA 2R8IA 1G3OA 5IYDJ 4PG7A 3K2YA 1T94A 2BW3A 4IX7A 1AKHB 2OC6A 1R58A 4O6JA 4Y6IA 1GUUA 1U6GA 3ITHA 2R7FA 3T5JA 2HXIA 1IKXA 4JI4J 5HROA 2HHQA 2NXJA 2HNZB 4RLQA 3HPHA 1GMVA 3FBEA 5KFAA 2M4MA 3L2VA 4TU8A 1EZZB 3L2QA 1KC8T 3MPDA 3KEQA 5IQQA 2ZNYA 1NK9A 5EGOB 2YKAA 5D77A 1EF4A 2RAQA 3F8BA 4IXAA 1K4TA 3F44A 3P6YC 4L3KA 1O0PA 5CVUA 3W63A 4NL5A 4BHQA 3PX6A 4L5JA 3GFHA 4JQFA 3HHLC 2V9PA 3DOLA 4AD6A 1R0BG 3LQVA 4N77A 4YDDB 4NHJA 3H7HB 5ETKA 2DA3A 2OO4A 4UUVA 3W9HA 1BW6A 1U9OA 3RB3A 3QJJA 2CQQA 4PFOA 1N78A 2KZZA 3ZMSA 2MZSA 1QQIA 2MKYA 3KYDB 2YKMB 4RNFA 1S59A 3G4SI 3RG6A 4HNTA 2AHQA 2C28A 4LR7A 4ETSA 3W8GA 4IL6C 4E2FB 2V4RA 3H3VK 2JK3A 1T9TA 3A0HC 2LXFA 2FYXA 3H9JA 3IRRA 2FBHA 2OBPA 1GV2A 3RUBL 1SFOJ 1XCVA 1FERA 1TW2A 1S1WB 4HA8A 4OI1A 2CZ9A 4YR3A 2Y0SN 4PRFA 1HSTA 1ZAOA 3V6DA 1FP2A 3QPLA 3CVKA 3HHLA 3OD2A 3GONA 3BJ6A 4HEA9 3NCQA 1MN9A 2C2ZB 2HK2A 2QFJA 3ET6A 1TL5A 4K8RA 4FPRA 2NAZA 2MC3A 4OX9F 1RUNA 1HQ2A 4IEJA 2XSFA 2V2VA 4DG1B 4Y33A 2A3SA 3CF2A 2DA4A 3CCLS 3I56I 3L7PA 2J5AA 3HRSA 4DBRA 2U2FA 1HXDA 2M7SA 2YXLA 1HWJA 2VI6A 2G9OA 5J1PA 4XTTA 3I0SA 5A8WA 1XNRF 4N5SA 1NJIT 5K20B 1UCNA 3EXYA 1T9YA 1R8PA 3T5XA 2H8RA 1RAHB 2AHOB 3J7YU 4K4SA 1M5OC 1GXUA 1X1AA 1U7LA 4NDLA 3R60A 3CPWR 3U1MA 2QZ8A 2QSGX 1TZ0A 1SKSA 3CJKB 2M2EA 3I54A 3L09A 4YRVA 1TV6A 2APOA 3I4NJ 5M3FJ 3E3XA 5DG9A 3WC2A 3LWMA 2L2OA 2JEFA 3P9IA 2P5KA 3UN5A 2AV5A 4C30A 2A6EF 2DFIA 4W97A 1S79A 2VC0A 3EETA 1NBEB 2R3VA 3Q8VA 4LOCA 1A0OB 2MBFA 5DDGA 5KAKA 3FIWA 3G96A 1OMIA 5DUIA 5LEKA 4YHHJ 3CP8A 1N33F 2QLXA 1HWLA 2CAJA 2UXNA 3TR5A 4CCJA 3S32A 4JI0J 1RTHB 3R0JA 3K4LA 2KRFA 1VHIA 5T7LB 3WE3A 4LLGF 1F3FA 3UO0A 2ZDPA 1RCOB 3IG1B 3GFZA 3QBCA 4K4XA 3G82A 4O3OA 1QSSA 1PYVA 3ISNC 2ACJA 1MBKA 1RESA 3VTIA 3W5YA 4J9NA 2UV8G 5M5YJ 1N5VA 4HI1A 1UVLA 1IV6A 3LOCA 3QRQA 1RAGB 1FVQA 3BJAA 2NVQJ 3CDEA 2IM1A 2ACMA 4Z7YA 2KIFA 1XDSA 4DV7F 5CQEA 2DA7A 1EARA 2AU0A 2W4PA 3I0SB 3O2PE 4LRFA 4O4GA 3D6MB 3T1BA 1VK3A 3UVJB 3QZ7A 4EBEA 4ED7A 1P8GA 3FQKA 2IM2A 3FMRA 2MKSA 3TZXA 5TISC 2AT1B 2DNHA 1VLYA 2GMHA 2M88A 2DGUA 3AJ1A 4TYBA 4GKKJ 5K5QA 4OYWA 2W7PA 4JBCA 2HQGA 5J40A 2KL8A 3VOEA 4HF2A 4ECRA 3D4JA 1U4BA 3BPDA 2DK2A 3IAM2 1GV5A 3EYYA 1LQ1A 2WB1A 4BBSJ 2EIJH 2PEXA 1IN6A 1NHKL 4A8QA 3CJNA 2DPDA 2IS4A 1VQNI 3U7JA 3RKXA 1WSUA 3KMSA 4IFYA 5D5VB 1IUFA 1LKZA 1W7WA 3LFKA 3HL2A 3E97A 2O5RA 4G7HF 3K70C 3DPLC 2CUJA 4WWSA 4HX8A 4LFAF 5C25A 2IBOA 3Q8UA 4IH7A 3IHUA 4RB0A 4QWAA 3EPIA 4DSEA 2WBMA 3MKLA 2P5VA 3LNQA 2XHWA 2X1GA 2LKZA 1HLWA 2R7DA 3HVTA 5D4LA 5EEGA 3FXOA 3N6MA 3PY8A 5T14A 3DMJA 2PA3A 2DT7B 1VFCA 2V50A 3H20A 4DOZA 1HQEB 4FNIA 1TAUA 1UVKA 4BBYA 1HKSA 4XSZF 3IWLA 4ES2A 3G1OA 3RTRA 3K59A 4ABZA 5L38A 1XR7A 2RQMA 1WOPA 2UUCF 4A5NA 3DRRA 3LSHA 2KRRA 2Y75A 3AJ2A 2AJ1A 2WAFA 1UP1A 4E7ZA 3QPHA 3EGZA 2OA4A 3TBIA 5A2QY 4OQJA 5LXYA 1NPPA 2ADCA 1Y6IA 4I67A 1PSDA 2LNBA 4B17A 1V55H 3CCTA 4L73A 2NXNA 4FYVB 3PW7A 1RWMB 1UHMA 3AY0A 3CTAA 2J0SD 2GC8A 4HLYA 2UUCJ 2DMUA 5IC4B 1VQNS 3BJOA 4QBUA 1HWKA 2QIFA 2DOAA 5G4DA 1VQ6S 4JI4F 2V6EA 2J6SA 3S6EA 3H36A 2ILYA 4LG3A 3OYJA 3CCVS 2XASA 4DJAA 2DY1A 3L4BC 4PK4A 3CIMA 3DFGA 4MAKA 3O8HA 1ZR2A 1OS5A 2HBZB 1ZGJA 3C2PA 4PPDA 1A6LA 2X85A 1U1MA 5DQIA 4QPQA 1CEZA 2HS5A 2YPRA 4U0VA 1UFMA 2IPOB 1IJEB 3UKGA 3BSOA 2KRBA 4RS8A 4ECSA 4RM3A 3M6VA 2YY3A 2OZUA 2VC1A 3IH2A 5EYRA 3MKWB 2PE8A 4ED6A 2UXDF 2HOEA 5DTDA 1JX4A 1KONA 3EUKL 5TRDA 3B6BA 3CCQI 4Y15A 1IXSB 4ESBA 3QJPA 2XM3A 2WVFA 1FNNA 1SH3A 3JAMZ 1Y39A 3ZXWA 1YRTA 3P8BB 1WC6A 3QLHB 2QVOA 4BHPA 2DODA 2BRLA 4PQAA 4G3IA 1BI2A 4J7CA 1WI6A 3HSJA 1I5ZA 3A8EA 5LGUA 2L3MA 1VQOS 3SEOA 4B4CA 4LF6F 3G6XA 3MZ8A 3QGIA 4F52A 3KUGA 1CQNA 1L3VA 2LTPA 3BR8A 4JI5F 1U47A 2HMIA 3VVUA 3TUZC 1B59A 3N6NA 4PWWA 1X7VA 1IM6A 4DSIA 2N4CA 4FXVA 4O44A 1EA3A 1RKTA 2M8HA 2VQLA 3HSEA 3FKJA 4D1QA 3MAQA 3C6UB 3OL7A 2QSHX 3CSKA 4ZLNA 5AJ3J 4XOPA 4DQ2A 3A03A 1FKOA 4U95A 4DV1F 2AKWB 3HZEA 5FD6A 2LC2A 1UEKA 5FGMA 2EQRA 3ZNJ1 4FE7A 2GXAA 2L5QA 4L0ZB 2WTEA 3GMEA 1RCXB 2YKMA 1X5OA 2XAJA 4LFCF 1ZYQA 1RT2B 3ISND 5SUHA 1FESA 3HRUA 2PMHA 4P9FA 4B3OB 3C3WA 4QIWN 2VBZA 3EM1A 3S2DJ 3QAUA 1S6LA 2J9EA 3MZHA 3QP6A 3CLQA 3W3SA 2PQ8A 4D7MA 1J7KA 4GDFA 1UG0A 1BUXA 2HGNA 3M8FA 3BTCA 3BR9A 4BDPA 2XULA 4BDYA 2HFVA 2VE9A 2V67A 3CJKA 2VDIA 2B51A 5HLTA 3OHAA 1HFEL 2K40A 1NSPA 4G12A 4LBHA 5E79C 5GAHJ 3BPVA 2K3IA 3MEEA 3NEKA 3CF5Q 1T7PA 2WY8Q 5KFDA 3OVBA 1QE1B 3SDEA 2L9VA 4P2SA 4LMYA 5HLGA 4MO7A 2J8SA 1U1PA 1IBLJ 1FFGB 5DRKA 3R61A 3EQLF 3I3LA 3K2AA 2DA2A 3TO8A 2OFHX 2UUBJ 4EBDA 2YKPA 3NRVA 3L7OA 2M7AA 1MNMC 3A3OB 2A10A 1SI9A 2GJIA 3H5YA 1OY9A 3VZIA 3KLFB 1N48A 1B9NA 1XK8A 2EC0A 3PNYA 1NKCA 5F27A 1L3SA 3DRPA 4YG2F 3EMTA 3QP5A 1OJ4A 4Q0BB 1SD7A 2Y9HA 3I5BA 2HQIA 1VNDA 1ITPA 1GAOA 3PR4A 3ESWB 2K3PA 2CZ4A 1TWFJ 1HL6A 1VJWA 1BI0A 2HFOA 1MBJA 5B1AH 1JI8A 3IKVA 4TQSA 3F0CA 4KHRA 2W7AA 5EEHA 3CJQB 5D6FA 1D9DA 2DXIA 2XMAA 1X4CA 2ZH3A 3Q8RB 1YS6A 3RW7A 4LGWA 4WTYA 2HHXA 1KHVA 3WX8A 4NCBA 1SUQB 2W57A 3ASOH 3DOLB 4WF2A 3W2WA 2V63A 4XLFA 1ZH5A 3HM5A 4O23A 5M2RA 4ZIWA 3QO9B 2HHPA 4JV5F 3Q8SB 4GKJF 2C3OA 3E51A 3PSFA 2RRAA 5B0AA 2DJIA 2V8HA 4CM0A 3CD6S 3QT7A 1FXLA 2O61A 3AL0C 4K4WA 2NQPA 2LQ5A 1Y9OA 1ZARA 5CPRB 4QIWD 1A35A 4IRCA 4F7ZA 3ETOA 1SMYF 3IS9B 1P6RA 1M5VC 2MYFA 5HSPA 5EZGA 1HI1A 4XRSG 4U67Q 1XERA 1YJUA 3BT9A 1ON2A 3QWLA 2DA6A 1YI2S 4M5JA 2JVHA 2I8EA 2WB4A 3SV3A 3FCWA 2DRBA 1HWUA 4HG2A 4NA3A 4DGWB 1X5TA 2XMJA 3RW6A 3N4WA 4RAGA 1WWHA 4MYTA 1FBUA 2KFNA 2WV0A 4RBOA 4ZLPA 1R6RA 3CW2C 4IFYB 5HANA 3CMYA 4FF3A 2E34A 2BUNA 4X62F 1TL7A 2A0FB 4WK1A 2NS0A 3PQJA 1M1GA 2AYBA 4ZPBA 3TANA 4L9VA 1WJCA 5KFJA 5LM7E 4ES1A 3LP2B 4DS4A 2JA8J 2PJRA 1U48A 4DMZA 1S9GA 1LEOA 1K44A 1LK5A 2XMVA 4P6QA 4L3NA 5EWEA 3G4SS 1K73T 5LGNA 1HQEA 5IP9J 3IR7B 4WF9Q 3QO9A 1V3SA 1YW7A 3UD5A 4AIDA 2GVDA 2DT6A 1X31C 4E7SA 1T8EA 1H2TZ 1X0FA 3CQZJ 2YWGA 1UPMB 3F22A 4HR2A 2IXSA 2MZQA 1BE4A 1QHGA 3M8JA 1CF7A 2F8EX 4EATA 2G2OA 3I53A 4Z7CA 4URGA 4EJVA 1O3QA 2K9QA 1WCMJ 2Z33A 4X62J 3CC2S 5CCMA 3M8RA 1JJ8C 4CYCB 1DGWY 3CMMA 3GTLJ 3MHYA 2MFZA 1SC4B 1RTJA 2PBIA 1DTTA 3HRMA 4H54A 4MIMA 4B9MA 4KFBA 1SJ4P 4O0IA 4Q45A 1IKXB 1HBMB 2YNFB 1D1AA 3NCRA 1U2RA 1YG0A 2M0MA 2GO8A 3V7SA 5L1LA 3D1NI 2DB1A 2E5JA 2XZDB 1MMDA 2P81A 2HFUA 3QATA 1VQ9S 2HQAA 4BAYA 1FT8A 2ZO4A 3RKYA 2ASJA 2EZHA 3LA0A 2DHAA 2VBYA 3HSZA 5EDNA 1OISA 3MAJA 1FRMA 2GAHC 5CCLA 4FYDA 4USMA 4ZIVA 3O6QA 4RGUA 4LREA 1VQKS 4A93J 1B7YB 1PG5B 2BXJA 4MKAA 3HG9A 2ZH4A 1MROA 1XR6A 5ETLA 2FUG2 3OFHA 4PQUB 1YRXA 4F3MA 1DBDA 3ZGKA 2Y31A 1QAXA 1YHQS 1JLEB 3Q8PB 2JN6A 2L41A 1FTZA 1QNTA 1HBUB 3K5OA 1S8NA 1C0UA 4J5OA 2HVQA 5LL6d 3RBZA 2BX6A 4J90A 3LQRA 2OPPA 5GMEA 4WFZA 1OWXA 1L3TA 4C3JJ 4ERDA 1C0TB 4EM1A 2NRAC 1XMOJ 4AE5A 4NRUA 4AFFA 4DV6J 4E70A 3HO1A 3FSYA 3HTSB 2EK5A 3QQAA 1QY7A 1FX4A 4QCLA 1VQMI 5AXKA 3AXMA 2LF7A 4OZNA 4ETXA 2HG4A 2ZC3A 4JV0A 4BKXA 1FJ7A 1CJUB 2R8JA 4ESFA 5CYMB 1Y5LB 4USHA 4R0JA 4HKQA 3BROA 4QWBA 1OCPA 3TVYA 2AZ3A 3QAEA 4FYXB 4J9UE 1H9TA 2VQCA 3LSGA 4N4NB 3I96A 2MQQA 3VZHA 3CMAS 3O1LA 2L48A 4AWXB 3HOTA 3WE2A 2Z2SB 1EHWA 3A8JA 4DX6A 5FKMA 5K14A 2N4DA 4LFUA 3MN2A 1A6QA 3IP4B 2OQGA 4OIOF 6PAXA 2RAEA 4OHWA 5L9XA 2ZKTA 4MTPA 5HODA 2MQNA 3PRDA 5KAFC 1YO5C 3OL4A 4EI2A 3PO5A 5DYMA 3TX0A 1VC0A 1DARA 4JI8J 3MZIA 5DO2A 4GVBB 2IPQX 1NHAA 2CG4A 2STWA 4P52A 1U0JA 1ETVA 5GAEU 1RLDA 3Q23A 1MSFC 3OXFA 3VGSA 1N75A 1TKXB 2HW3A 4GRSA 3T9NA 4KGMA 4MH8A 1S76D 3IM8A 4WWCA 3K4KA 4WFBQ 5J8CA 1U0HA 3THPA 5B0CA 3AXKA 2K7KA 3JB9k 3LAPA 4CI0B 3HOSA 1O4XA 4GCVA 4FKYA 3ADAC 4F7VA 1QE1A 3SDEB 4B02A 1LUJB 3GTYX 1YI2I 1Y7PA 1G4DA 4QOTA 3ZQGA 4QIFA 2O03A 3SFGA 2ZH7A 2DTJA 1VLOA 2K3KA 4ELTA 3CCRS 2HMIB 1YG2A 2EFVA 5CKTA 3IFEA 2DH7A 3TARA 2VUGA 2A1BA 5BMZA 2M70A 2ZZNA 2YUSA 4LB6B 4F4WA 5CVRA 3SHFA 4ICLA 3E6BA 3HVAA 5KFIA 4Q43A 5D6EA 1FBQA 2ZJRF 1HHQA 5GADU 2UUZA 2XY6A 3BJYA 3RSNA 3SZPA 3M9MB 2JUGA 4EVIA 4WYWA 4TQRA 1FNMA 2AQ4A 2DRAA 1LWCA 1JXEA 3QT5A 3LAMA 3H1CA 2RNGA 3K1NA 1RT1B 4K5RA 3H5SA 3H40A 3IRQA 1WDTA 2L9WA 5F0CA 3M8SA 4CCNA 4FBTA 2BKPA 2GW8A 3BV8A 4PEOA 4P1WA 5E3PA 1S6UA 3OV7A 1F43A 2BY1A 2CUZA 3GV8B 2DDAA 5HS9A 1TVRB 2CW0F 5B0BA 4H4MB 3JSMA 2XZTB 3TJ9A 2DCLA 3H0PA 2HQ3A 3FBBA 3DLKA 3OTEA 4NI2B 1ZN2A 1F3VA 1XMKA 2OPRA 2DH8A 4DSKA 4XKVA 2Y9YA 1VOMA 2QYGA 3ERED 4B8XA 1SVLA 1U2CA 2CO5A 4E7JA 2ZUGA 5F41A 1VBZA 2VXDA 1EH7A 4FXDA 3C66A 2A07F 2P9CA 1QHHD 3GWZA 4QTRA 5IP6A 1R6YA 4B48A 2PFBA 5D3GA 5BPDA 3QWUA 1N4LA 2HHSA 2UXDJ 2KIMA 2W2MP 4N76A 4ED0A 1T38A 4BE2A 1NJYA 1S0NA 4BU2A 2GIRA 3I58A 2GAGC 1D8ZA 4DNCA 3ZMTA 2Y3YA 3EX7B 1D5YA 3OW2R 1WH5A 2EFNA 1FPQA 4IOAQ 5KTQA 4JI2J 2HKOA 3Q3SA 1ZPVA 2XG8A 3DLLF 2MPUA 5AONA 2WBRA 1HD0A 5IS2A 1XX5A 1D1BA 1KFSA 3W1YC 4ANJA 1HYSB 3H3UA 1BN5A 2CQXA 2VASA 2DNNA 2XMWA 3BBBA 4QLCU 3OTDA 1LWFB 1RT2A 1E3PA 3IAS2 3FRZA 5FLXY 2DPIA 1R0CB 1LKXA 3HGGA 2JRSA 4FS2A 3BQ1A 3CD0A 3V6HA 2M9KA 1H98A 1HLVA 2BBEA 2HNYA 2DITA 3WHCA 1IN7A 4WFNQ 1R0AA 3W2VB 4QW9A 3FNNA 4CLYA 4C8OA 3FVYA 3KG4A 4F4AA 3G8SA 3GIKA 3GILA 1Q7LB 1UPPA 2MZ1A 2X1AA 1PC4A 3KK3A 2DJWA 5C4XJ 1W4MA 4I2PB 2OAUA 1DTQA 2VJUA 1FRKA 3MFIA 2IIHA 4IKAA 1LNWA 4RLFA 3K7AJ 1SL0A 3GCWP 5F8LA 3ZZRA 4ZHRA 2EWHA 4DL6A 1R1VA 1CJKB 1WACA 2ZBCA 3WTTC 1JUMA 1W7PA 2NLWA 2YWHA 2WZ1A 3SIPB 2FQQB 2H5JB 2CJBA 1N5YB 1IN8A 5KFQA 2F5VA 1FOKA 4CIOA 3GFXA 2GNKA 1CC8A 2E9RX 1IG7A 3H92A 3T41A 3H4DA 4RUBA 4C98A 4UUWA 3S1TA 1HW1A 4GYIA 2VJJA 2GO9A 4Y2MA 5IXUA 2ZM6J 2XIGA 3HK2A 1XWLA 1RWXB 4USUA 3SQOP 2MSTA 4JYAJ 1UCRA 4YQWA 1IKWA 2YR2A 1AWCA 2FX0A 4DV0J 2LREA 1PAUB 4M5LA 3FF5A 2X1FA 1KQ9A 4ECWA 1GVJA 2WAQN 4ENOA 3QU3A 4BXXJ 4G7OF 2E44A 3IRWP 4XPCA 1VQ4I 3HM9A 3D3BJ 4A3BJ 2YX7A 1JLFB 1I5OB 1QPMA 2CRGA 2O1PA 3KNAA 3SCJE 3CIZA 3UCZP 1FOXA 1PIEA 2DGTA 1ZLJA 2XY7A 2DXDA 3AOAA 5J2NA 3GMGA 1BWVA 2A5YB 4RW7A 4ES3A 1KYZA 3MCSA 2P9EA 2JMWA 4UXNA 4OYXA 4ZVPB 1S1XB 1ZRFA 4LF7F 2GZOA 1EKSA 4W4MA 2XS7A 3PM9A 5BR8F 1N56A 2QA4S 1RT4A 3PIOQ 2M4GA 1OSCA 4HDVA 4MK8A 7FD1A 1H0MA 3PG9A 5KFLA 1BOAA 1W5CC 3BR3A 1YRUA 1I6XA 4I68A 2QF7A 2CMPA 1RAJA 4DR7F 1E6YA 3IRXA 4MTEA 4XR6A 5AJ3F 4DR4F 4C4WA 4B3AA 1IM4A 4AC0A 3I4HX 4YEJA 3S1NJ 1VK8A 4IRDA 4CYDA 2LXIA 3NS6A 2J5OA 4UTGA 3JCUC 1HOMA 1XMXA 3CCLI 2B9WA 3SV4A 2HKXA 3PO4A 4A6EA 2X6YA 2HDCA 5DGAA 3QPIA 2DO4A 1ZM9A 2C1EB 3S16J 2LA4A 3AG1H 1RA7A 5RUBA 2FJBB 2V8DA 3U1DA 4XK4A 1JLCA 2G0JA 3TAMA 4A8KA 2IDLA 4BJTA 1LB2A 3ZTSA 1LFBA 3M9AA 3P5BP 4HH1A 4LFBJ 2VQHA 5DDRC 1DPUA 2PA8D 3CTRA 1SKWA 2BEFA 1BJZA 2PIIA 3CC7S 4F3QA 4YB7A 5DS9A 2FBKA 1ETWA 4Z2XA 3E5XA 4PDKA 4NOHA 3CEDA 2GHPA 1FWZA 1RKJA 2BYVE 2DMQA 2XQCA 2F4VF 1LE8B 3HLUA 4X4OA 5EEAA 3HI9A 4X2BA 1YK9A 5K8NA 3JQKA 2YNHA 2HZCA 4AYBD 4DX5A 3DLJA 4ZVRB 3R3TA 1KS2A 1WJBA 4HW0A 5IOLA 3HHDA 2MZRA 2HEKA 4MKBA 1UWBA 3IAM9 2WVEA 4I2QA 1CPZA 2QENA 3DTKA 1TK8A 3K0JA 2RDIA 2X9DA 1UMJA 2V2KA 2LP0A 3LW5C 4M5IA 3QFHA 4B3XA 3POTB 3JSRA 3ZC4A 3OR2A 4XDCA 2YPZA 4JX4A 3CNQP 2GBYA 1U25A 2OEKA 4Y2AA 2MQMA 2GOXB 2JPCA 3NXZA 4NLOA 4CDIA 4OLOA 4HI2A 1FEXA 1Q82T 1FXDA 5K9FA 2CPDA 3D1OA 2IS2A 1KTQA 3D5RC 2MLKA 4BQNA 1HI8A 1O3RA 4IHSA 4YB1P 2K2PA 4J37A 4ENKA 1OLTA 1S7EA 1DU6A 4D5CA 2V69A 1LDDA 1RWWB 3ILOA 4ZCMA 4UUSA 5C42B 1ORKA 3SFIA 3ZQHA 4FTHA 4ZPWR 2XBPA 1UZHA 2HYIB 3FEXB 3FFIB 3W6JB 1IR2A 4KT0C 2LMDA 3H5XA 5ED4A 3W5ZA 3QNWB 2M30A 1YBAA 4BJ5C 4Q44A 5J4VA 1S1TA 1NB7A 2ZD1B 1N88A 1URRA 2E5LF 1YJWI 2V6CA 4XLHA 2CQ4A 3ZNUA 1WJEA 2Q2EB 5LSRA 4DV0F 2VJIA 2FHJA 1X60A 3FMQA 1PAEX 2B9EA 3G82B 4R0EA 1RETA 2KG1A 2ZXHA 2I2YA 1EKRA 1YJNI 3M3YJ 2ZM6F 2XHKA 1J5YA 1S9GB 3TO6A 4XRSA 3E01A 4W98A 2TDXA 1D1CA 1VQ4S 4CCHA 1FMVA 5L3GA 2JA6J 4OHZA 3VQTA 2JLEA 1OSDA 4OL8A 3BG7A 3KYCB 1EETB 1T6SA 2IAJA 4NLTA 4LJMA 2CADA 3M6UA 2GM4A 5KG0A 3K89A 5B66C 2H3EB 1R89A 5J4YA 1PUFA 1HF0A 1MBEA 4NLXA 1FJCA 2XGCA 2FUG9 3MMAB 5D0RA 2QWWA 5FLMJ 3NNHA 2DMTA 1OYYA 3P4UB 1N52B 1LQ9A 2G1HA 2H6BA 2JSCA 3M1CA 2OJED 1F0XA 1TP7A 2MEWA 1RAAB 3NS7B 5KFBA 3CUQA 1GMWD 1F2GA 2ASLA 1LEAA 2XLJA 1B72A 2RF2B 2OTLI 3ECHA 1REVB 3DU5A 4OYOA 4DR1J 2H5EA 2BKOA 3MAHA 3OS2A 3EUAA 1KKHA 4UF4A 2J0XA 3IM9A 2OPTA 4XN0A 3KOAA 3ZOBA 1JLGA 4HBLA 2ZB9A 1XG1A 1KLMA 3C15B 2AYEA 1YOVB 4Q8FA 2M9HA 1VGYA 4C2UA 4DR6F 2NZCA 4J01A 2Y2ZA 2NNNA 4NZ0A 1T3NA 4O3RA 3KP5A 1HHSA 3MPVA 2QMUB 2FC9A 2W48A 3MEXA 3KFWX 1AU7A 1GHCA 4DV3F 2I8DA 2JOQA 1YZ6A 3I9V2 3W9IA 1HBOB 1NK3P 1GXQA 4LLLA 5J2QA 1W2IA 2M5YA 2Z2MA 3D7SB 5KFKA 2WW4A 4M6XA 1VF9A 1MMSA 3LTOA 4L18B 2HKEA 2B0GA 2FVRA 1YZ7A 2ILZA 4HYEA 2HBQB 4NLVA 2DR8A 4I7FB 4L9TA 3ZTOA 1QDUB 2CW8A 3VALA 1S0VA 1BR2A 3B4MA 1IO2A 3JRCA 3CMES 1XC5A 3VODA 3MUTP 2Q66A 2L9DA 1TUWA 1JLQB 4KSEB 2M2BA 1FE0A 3DDNA 3KKFA 1KWMA 4PJNA 2CQ3A 4JOMA 3BN4A 2PG4A 1PBAA 3LALA 5FJ4A 2ZMEB 5HBMA 2C42A 5K7ZA 2B6AA 4LG0B 5JJBA 4YDXA 2BZ2A 4KAIA 1SJRA 2C2KB 1IKYB 2CFXA 2J8AA 4H4KC 3VV2B 2DRDA 3RAQA 4WXOA 2EC2A 3QSYB 3VGVA 3KTQA 2FA5A 2ALZA 2DBBA 4B3MF 2IJNA 3J7ZT 1V5GA 2MGZA 1SL2A 1TT0A 3OBIA 1BQXA 3LANA 1RT6A 5L3FA 2OPRB 5LMNJ 3RIRA 4M6YA 1NPKA 4JP8A 1YITS 4ZN1A 5EG0A 2J7UA 1YBUA 3EGVA 1R4MB 3ET6B 2H1LA 2V1NA 4EO6A 4E7LA 2QO3A 1SQFA 5AXMA 4RB1A 3PYDA 2LKSA 2F5FA 2E36A 2BW2A 4LF8F 1Y0NA 3MR2A 2HXOA 3GZ5A 3PHTA 1QTMA 4RWWA 4C2MA 5BJRA 1LNQA 1NU4A 3BR2A 1MW7A 1BWEA 2HQ5A 2KHMA 3J7YJ 1Q5YA 4PQUA 4ID5B 5KFCA 1N25A 5FKOA 3EDPA 2V1XA 1N0UA 1HBOA 4XNFA 5T7LA 2H1KA 2P8IA 4QPTA 3N01A 2XWXA 2CGPA 2HR3A 4BLGA 2QGFB 5LHHA 2HS4A 2VKZG 1IKVB 3BP8A 2HQNA 4BC7A 1T8IA 1RTZA 4HLBA 1KLNA 5IT0A 2KN4A 1Q8BA 1XCBA 5SZTA 5HNHA 3D6FB 2CQBA 5L3DA 4EM0B 2Z56B 2XSJA 2HOSA 2JHEA 1TC3C 2IVYA 2LSOA 3J7YI 2G4BA 4HEA2 1CULB 2L4AA 2AD9A 3RDIA 1XGSA 1Q8IA 4CCLA 2TRTA 2PFDA 4JB8B 1YBTA 2CPJA 2FHOB 1SXLA 3MEDB 1T9UA 4B9NA 2F4IA 2XY5A 3BGLA 2EJRA 3TOBA 4OHVA 3HX9A 5A0YA 5B0DA 2KP6A 2IJRA 4A4JA 2J7KA 3ZMZA 3VYUB 3TOAA 2LEPA 3SI8A 4Z2YA 4WK3A 1N5YA 3SSRA 4L0YB 2OPQB 1FXRA 4OINF 2JRMA 3ULQB 1TQPA 1ZZFA 4DL3A 1SJ1A 5JLXA 2XPWA 2QLWA 3KDNA 4M71A 1T56A 1Q1HA 3TEDA 3VGUA 5FKLA 1R6VA 5EG0B 1RTIB 3MCMA 4BCAA 1G3YA 4IDKA 2AIRB 1LVKA 3K5LA 1HC8A 3OPKA 2ZFUA 4LVNP 4OX8A 4C8YA 3VYTB 2KXFA 4P74A 2K06A 3NRBA 4UOHA 1FNXH 4IFVA 2V26A 4WP8A 3PIOF 2K9SA 4CA0A 2Y0BB 4I56A 3OMYA 3P49B 1YIOA 2X7IA 2DYRH 1AZSB 1VI0A 1KP6A 3VF0B 2BANB 1BQMB 3SCIE 5L8RC 3WODF 1JK9B 2CQ7A 3VDXA 1X1CA 4RGXA 2DVIA 4ANCA 1U9NA 1T05A 1VQ7S 4AUXA 2EK6A 4R8UB 4IYQA 2QLFB 3NWTA 1NDCA 1J27A 1HNVB 2DGOA 5LHIA 3BQZA 5HAOA 1Q16B 4QU6A 3QOPA 1QLNA 4M5DB 4LMZA 3T1HF 3CO9A 2VQGA 3AJDA 1ZQ3P 3D3CJ 2LH9A 4YEAA 5EZHA 4B08A 3DC2A 4OMFG 1W0UA 3U1LA 3LP0B 3ERMA 4W90B 3M30B 3HHKA 4CO1A 3HOUJ 1YWXA 5F8MA 3Q24A 2PN6A 1L3UA 1IKWB 5CVIA 3O6BB 2VFVA 3KK2A 3FBFA 5DETA 1X8DA 1H0HB 2D1HA 1JLAA 4P55A 3NAHA 1CJVB 3RBEA 5KFPA 3V8KA 3HSDA 5H9FK 1IN4A 2XSJC 3J7ZI 3AD8C 2EEYA 5HROB 4J9PA 4QPXA 2DO7A 1SV5B 2QRRA 2YWEA 4PSWA 4BY1J 4DLEA 2HFHA 3O44A 2BE2B 1R00A 4DPYA 4A47A 4YIRX 3MFHA 1RDRA 2DYAA 5D5WB 3DLEB 1S12A 3V81B 4C11A 2EH3A 3G2BA 4A48A 1Q7YT 3TNVA 2I5UA 3LPYA 2L9NA 2P8TA 1U2WA 3U21A 3IO1A 1B0PA 1G8XA 2NOGA 1HW9A 2W7OA 2QYOA 5B7WA 2ZOFA 5J1EB 4C9DA 2OZ6A 3RBDA 2MLXA 2B5JA 3F9KA 2D69A 4KIFA 3GSIA 3I5CA 4FZVA 4CUGA 1RT5B 4KMFA 2K9MA 1XR5A 4ENMA 3ZN1A 3VCDA 5M2PA 3LWLA 3MKZA 3HT0A 1K6OA 4DR3J 1JMTA 3SYTA 3LSPA 3FBCA 1SVMA 2B4PA 1FY7A 3IP0A 4C6AA 2MQPA 2JEIA 2YVSA 1EAYC 2NYXA 2MW8A 4IJAA 2CUYA 4C3KA 2V1UA 3AFHA 1TWAJ 2LEBA 2DTRA 1HBNA 3BG5A 4RW4B 1FBSA 3DFEA 2E9TA 1JLQA 5ETSA 1NHUA 2NPIA 5ILSA 1Q4RA 1KU3A 2ZH1A 4FVCA 4LQ3A 3D0GE 2VG7B 3VAMA 3NBPB 4R79A 3ZFVA 3M9OB 1B7FA 3W6VA 3IN5A 4I0WA 2JLFA 1WPKA 4U96A 3FDYA 4P2XA 3TKYA 4PPZA 3JRFA 2GIFA 4O3SA 2HGLA 4P71A 3DRXA 1TP4A 1Y4ZB 2VPZB 1TFWA 1SB6A 5J2PA 4RW6A 2D7SA 3CDUA 3F56A 3HHGA 3RQ4A 4DPUA 2DEIA 4P73A 3DKYA 5D0GA 1I6JA 1FHTA 1F9HA 2V8PA 5I3QA 4MFBB 3G86A 2DDBA 2NYIA 4HTJA 3KEOA 4B9VA 2QLZA 2DOFA 1OCZH 3KJVA 2N7CA 1WI8A 1RR7A 1CLFA 2GJ2A 2BM1A 4GO7X 2D41A 5E8IA 2CQ2A 1IDYA 4YFKF 4Q8EA 3QODA 4C2TA 2PX9A 4H4KA 3BGFA 3G3ZA 4P5OA 5F1JA 1G3SA 4YP3A 3OIQA 2O01C 2QUFA 4EUVA 1YTYA 1C4CA 5HS8A 3U1KA 3KUEA 2R2UA 2RHSB 2W25A 2W82A 2HHUA 2AEJA 4KGVB 4XDDA 1TQLA 3H3ZA 3M07A 5GTHC 4HV6A 1NEEA 1ZRCA 1QSLA 3KE2A 5HK4A 1GMUA 4CLPA 1MLAA 4UQGA 3DOKA 4OYAA 3R5DA 1N34F 4DI6A 1GFWB 5BPIA 1RKIA 3T8RA 1TBXA 4CCMA 1NAQA 3Q86A 1JT6A 1B99A 2JVOA 3GFYA 2HAFA 2A6TA 1S4EA 2K9NA 2IRUA 3DNCA 4QJVA 4WFAQ 4I0AA 2ZKUA 3DGPB 2J7WA 1U78A 2YNIB 3C14A 2FHJD 1S9FA 1TELA 1M5HA 3HBLA 2IC3A 4FDFA 1GXTA 2ME0A 3RQIA 1UELB 2DGSA 5FD1A 1J5OB 4DL5A 4XIDA 3NS5A 3KP3A 2JEGA 3B73A 2CSOA 1S1VA 2PT0A 4F3OA 4UNOA 1JXLA 2AGOA 2OP5A 3ZXSA 5KG2A 5LLQA 1ULRA 2FVQA 4BXFA 5GAGJ 3PR5B 1OPZA 1KQFB 3W66A 5DG8A 3OIPA 1UVNA 1S72S 1F36A 2OPQA 4TYAA 4USKA 2XPVA 3JAMK 3V6JA 3DDIA 3K4MA 2KT5A 4EO8A 4DQQA 1N36F 2OGUA 1X19A 1U8BA 3OSGA 3GG1A 2ME6A 2QA2A 1JWWA 3MZYA 2AO9A 4HNVA 3MTJA 2FHKA 1VQ6I 4A0XA 1NSAA 1Z6RA 3MM6B 3W2AA 1AT1B 1FRIA 1APLC 2RVCA 2WAQA 2ZMEA 3MTKA 3ISZA 4LF2A 3W64A 1U1KA 1VQLS 3GCXP 3ZQ7A 4ECYA 3PSIA 4CSWA 1X4EA 1G3TA 2G7UA 1VQSA 1NJXA 3FK4A 1UHWA 2VDHA 4JI3F 2E1PA 4HAMA 1XJWB 1RHKB 2HNHA 1SC1B 1OYEA 3BM7A 3DOMB 5D78A 4UY8I 3M7VA 3CJSA 3GR1A 4KTQA 1KU7A 5HI7A 5EJCA 4CXFA 2K4BA 2HYFA 3GF2A 4Y34A 1LW2B 5F0FA 1UJ6A 4LF5J 2RS8A 1ZYRF 1WF1A 2EPIA 5D0EA 2HHVA 3OYLA 2QL7B 3CULA 4X0GA 2HURA 2R4FA 2MJNA 1NNDA 3H5AA 2CV0A 5K8PA 3S01A 2W8LA 4CO0A 1HKQA 2J9DA 2QSFA 9ATCB 2BE2A 4LBIA 3SQGB 1I3QJ 1HW5A 3WQPA 1UTAA 3FZBA 2VV5A 4PUSA 3QSIA 2KM8B 5E33A 4BWJA 3KLGB 2HRTA 1FFSB 3C16B 3VB2A 1ZGAA 1ZTTA 5HLHA 3QAHA 2ZOGA 2H65B 1BI1A 3FK6A 2V4JC 3KK2B 4LF8J 2GGPA 2VT2A 1UL3A 2BE5F 1EJ9A 5E0OA 2KRCA 1E3HA 2O6GE 3R6SA 2PMZN 2MKCA 1FWPA 4ZJLA 2IBDA 1EIYB 3KHRA 3IH3A 2PEBA 4FN5A 2UU9F 5HN0A 3TO7A 1X3ZB 4Q47A 4IQXA 4X66J 5FFZA 4USWA 5C3EJ 3MKYB 1N32J 3H9QA 3GTMJ 1VQ8S 1WFXA 4GVBA 1CF7B 3GLLA 1MJBA 2WTFA 2K1RB 1O7LA 2FY1A 5J8FA 1YLXA 4XPEA 3GR0A 1L0OC 2X1EA 3UCGA 2FIUA 1NMEB 1XIQA 1AHDP 2Y30A 3I0RA 4A3CJ 2MJUA 5JFRA 4DF8A 2QYCA 3V4IA 1F9NA 2R93J 2BJDA 4UV8A 2AX1A 5CA5A 5FJ8J 5BOXA 3TMOA 3OFGA 3F6OA 1RT7A 1QA6A 2HPUA 1YX2A 4Q4ZF 4HL9A 2D9OA 1D0YA 3PIPF 1U5TA 3M32A 5JMNA 1HDDC 4WIQA 1S97A 4BQOA 3CC2I 4X84A 5FLXU 1OY8A 4U7CA 3O5TB 1B3TA 2D1CA 2KLOA 2STTA 1YX3A 1UVJA 3NAUA 2GA1A 2IS1A 1S1WA 3R7SB 1G2EA 5A8RB 2UVWA 3DCAA 4M63A 1D0ZA 1S1UA 2N3OA 3ASNH 3G6ES 4RDUA 2VFRA 3OHBA 1TT5B 4YUDA 2MHEA 4DV3J 4I0BA 2OEJA 4J91A 5C4JJ 2DIUA 5LXRA 2DI3A 2LP4A 1EX8A 2V9WA 2Z9OA 2XGPA 3S93A 1NH8A 1R36A 4KHPJ 4I2OA 2BJ8A 2EFOA 5EWGA 1R31A 2N3LA 1XGMA 2B9SA 1HQUA 2DISA 4WE1A 2JC0A 3Q22A 2M87A 1ZELA 1WC5A 3N0VA 4L76A 5ICCA 2VG7A 4OAZA 4CNYA 4KV8A 2MKHA 2LU2A 1XGNA 2HSEB 1WZ2A 2LLKA 2GFFA 4KMUX 3E5QA 4X4VA 5CYJA 5D4NA 2VQEJ 1VRTA 2UUTA 1Y3KA 3Q2TC 2HVIA 2W1OA 4F25A 1J75A 3H5RA 2FJWA 4LRBA 4F36A 1RE1B 2FZKB 3GZ6A 3BREA 2IA2A 2P9GA 4NEYA 2CV1A 1AYEA 5KFGA 1RR8C 4BY7J 1AZSA 2HGCA 2L7FP 3CJRA 2BANA 4A8OA 3K7RA 4HACA 5HS7A 3PNTA 5BNGA 4G94A