2CG4A

Structure of e.coli asnc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords REGULATORY PROTEIN ASNC
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cg4A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cg4A02
3SZTA 3F8FA 4CGZA 3V7CA 3I0TA 3FZVA 3K1MA 2VOOA 2NAZA 2RC4A 1W7PB 3NEUA 4I0AA 3RYPA 1YLFA 3FMRA 2HYGD 3QPHA 4ZYDA 1GXPA 2ZJ2A 3WGHA 2R7FA 4KIBA 2P4WA 3GF2A 4QWQA 3DPTA 5TRDA 4FHTA 4XSZF 3EYIA 3HRUA 3GX4X 1G4DA 1B6AA 1UB9A 5EEGA 1R7JA 4HQEA 2L4MA 1OPCA 1B1BA 3EUHA 2HOEA 2OA4A 1UFMA 5HDKA 1KQ8A 4IF4A 3F6VA 1P4WA 2ZMEB 1BN5A 4IHTA 5FO5A 1EH7A 3M8FA 1S7OA 1ZREA 2HWVA 4RB3C 2PG4A 4UVAA 2OZUA 4GYIA 3MWMA 2M5WA 1W7PA 3FHZA 2EV0A 2G7HA 1LB2A 5FLXK 3DFGA 2HS5A 5KVRA 3F22A 1XGNA 3KZZA 3QU6A 2MH9A 2QVOA 3E5UA 1T38A 5A2QK 3T8RA 4WXDA 3P9KA 5H6QA 2AS5F 4A5MA 1GXQA 3VB2A 1D8KA 3CDHA 3LFKA 1RNLA 5LBQA 1VTNC 3B02A 4Q5SF 5K1YA 2OAZA 3DXJF 1ON2A 2ZBKA 4A0YA 5IT9K 5L3GA 2EV6A 1IN6A 3E6DA 2ZBCA 1SFXA 1ULYA 2HFHA 4G6QA 4L0YB 1WSUA 5DUKA 3CO7C 1TLHB 4G94A 4R1HA 2CYYA 3GW2A 1Z91A 3F72A 4U88A 5CVJA 3ZMTA 2F5FA 1FP2A 1ZARA 2UXXA 4OIRF 3GXOA 1W5TA 2EFPA 4L18B 2IT0A 2ZNZA 3BWGA 3ABTA 3U9GA 2CSOA 2F2EA 2COMA 5ICGA 4LGWA 2PI0A 1FPQA 4M71A 2X0LA 3BDDA 1S8NA 2FSWA 1ODDA 2P8TA 1E17A 4EJUA 3M1EA 3CUQA 4RAZA 4HLYA 1CF7A 1OYWA 5DCFA 1I6XA 1T98A 3FM3A 1IN5A 4LLLA 1REPC 5DYMA 2CFXA 1O3SA 3ABUA 1H9GA 1TTYA 2Q2EA 3K2ZA 3H3ZA 3LSTA 1B4AA 1FOKA 2R7DA 1KYZA 3TGNA 2HEOA 4GGGA 2F5EA 1F9NA 1USSA 4CICA 2VE9A 2IVMA 2GWRA 5K5RA 3BP8A 5L3FA 2FOKA 3O3KA 2Z5UA 2NRAC 1L0OC 1IAWA 3GVAA 2D45A 4A6DA 2V1DA 3E6MA 3HRSA 3DP7A 1XCVA 2AXLA 5AONA 3AAFA 2UWMA 3FXUA 2EA2A 1JE8A 1BM9A 3BJOA 2NNYA 4YIFA 1LEAA 3D5LA 1Q1HA 1MGTA 4LG0A 2BEOA 4M6YA 2ESNA 4KNYA 2L3DA 1W4MA 3IC7A 1BI1A 1JHFA 1HW5A 2STTA 4IPAA 3LWFA 1L3LA 2G9WA 3DKWA 5E1WA 2GAUA 3W6KB 3SQNA 2GXBA 2VE8A 3K69A 2XROA 2P7CB 2BV6A 1FT9A 2E1CA 4U7DA 2ISZA 1I1GA 3BY6A 1P92A 1W7PD 2A61A 4Q47A 2EA4A 4L0ZB 3E97A 5FFXA 1R1TA 3WTSC 1ZN2A 3TO6A 2V1XA 4IRHA 1QO0D 3U2RA 3K1PA 1YW7A 4ZYHA 4RB2C 1OR7A 1ZH5A 2LSOA 3LA2A 1WQ2A 1E2XA 4S05A 1XSVA 4ZZLA 3F21A 1G3YA 3WTXC 2FBHA 6PAXA 4EGYA 2QLZA 1U5TB 4HX8A 4YIIA 4FX4A 5DV5A 1DDNA 4HDUA 2DK5A 3I64A 2OQRA 2O0YA 4GYGA 1QQIA 2QENA 2CG4A 4L9NA 5HS9A 3L2CA 3ECOA 5LHGA 4KYWA 3TDUC 1NHAA 2W24A 4LMYA 1S29A 4RB0A 4ASNA 2KJBA 3HOTA 2Y48A 1S7AA 3JW4A 4I98B 1F5TA 2EFQA 1YO5C 4N9HA 1QBJA 2E7XA 1FYKA 3F23A 4RAYA 2QQBA 4N0BA 2VT3A 4HOBA 1Z9CA 5LEKA 1LEBA 5E17F 2Y0MA 1O7LA 3HYIA 2IRFG 4LJZF 4O5VA 2VOPA 4R8HA 5E20A 3MAJA 4Y15A 4I2OA 2VBYA 2QM3A 1ZLJA 2W57A 2CO5A 4I0BA 2QZ8A 1T0FA 5LRSA 2ELHA 5ICCA 1LDKB 4UHTA 2ADUA 1K78A 4CHUA 2M8EA 1YYVA 3I54A 4BXUA 2L02A 4U0YA 4KN7X 1TW2A 4AWXB 2FQ3A 1KU9A 1Z7UA 3LAPA 4RS8A 3GEZA 1Y0UA 5LHHA 1S3JA 4IRGA 2GIVA 3LA3A 1XMAA 2V6CA 2VC1A 4GCVA 5DCMA 1HKSA 2RDPA 2W84A 4UXNA 1IN8A 5H6RA 1RUNA 1KGSA 1T6SA 5FLXZ 3ZMUA 4P96A 3CUQC 1IZ1A 4EJOA 2PFBA 1PP7U 5HDNA 5DCMB 4EJVA 3F8NA 3J80K 3ZMDA 4BYYA 1ZG3A 3KP6A 3BPVA 2YSRA 3FMSA 4HV6A 5BPDA 5KK1A 2LNBA 3GZ6A 5E8IA 1F4KA 3KLNA 4B09A 2XAGA 4IJAA 4MQ9F 3WODF 2ISYA 5CJ9A 4G6DA 5LHIA 4JK1X 3TO7A 2O3FA 1FX7A 1PUEE 2IA0A 5LGNA 3C3WA 4YG2F 2J5PA 3ELKA 2QQ9A 2FBIA 4I7HA 1ZAOA 3WTUC 4EM1A 1J7KA 1ONVA 5K5QA 1S6LA 1FZPB 5D6FA 2FRHA 2DI3A 3KETA 3IWZA 1KU3A 2JPCA 2DJWA 1K7AA 5AIQA 1A04A 3VEPA 4ZYGA 4ENJA 2K27A 4ETSA 1TQMA 4O6JA 1T2KA 2VXZA 4G7ZF 4OMZA 4Y13A 4OINF 2E1NA 3JAMK 2JT1A 1YQAA 4H0EA 3IWFA 1MJBA 3J81K 4NHJA 4OIOF 2FNPA 4WF2A 1SMTA 4EJWA 2FA5A 5JFRA 1ZRDA 2NNNA 2EV5A 1ON1A 4FX0A 2KIFA 2JZYA 3LQRA 3JSPA 1OYYA 2VN2A 3HRMA 4A0ZA 5E1XA 3CJNA 4Y17A 3ROUA 2F5DA 4P5OA 4BHCA 2P5VA 3ECHA 2H27A 1K78B 1F1ZA 1JHHA 1IN7A 2FNAA 3GO5A 4WX9A 1PDNC 1QPMA 3COAC 5D4RA 3DF8A 2B0LA 2O8XA 1IRFA 1BIBA 3REOA 2BE5F 2EFWA 1HW2A 2HQNA 3T0YA 1H0MA 1R23A 1I5ZA 3DPLC 2FBKA 3W6JB 4ESJA 3Q9SA 5DUIA 3O6BB 1DP7P 1FC3A 4UVBA 4WWCA 2GQQA 2PEXA 2DFIA 1K79A 3GFLA 3PQKA 4ON0A 3E6BA 3VOEA 3GLXA 4S04A 3F3XA 3F8BA 4MHGA 2G7UA 1J9IA 4M9ZA 4HW0A 3E5QA 4F7ZA 3ERED 3V7SA 1SAXA 3GUDA 4WXHA 1U8RA 1KQ0A 1BI3A 5CVVA 2A6HF 1FBUA 4M72A 4OOIA 2Y75A 1MKMA 2OBPA 2NS0A 5ICEA 2BGCA 1Z6RA 4L9JA 3KLOA 3TKYA 2HQRA 1LJ9A 1D5VA 3V8LA 4MEYF 1BI0A 3JTGA 3R60A 3ZMZA 5J8CA 3JSOA 4IRIA 2RGVA 1U5TA 2XGXA 4HQMA 4Z2YA 2JTVA 4FT8A 3CUQB 3N4MA 3RTRA 3MEXA 3C7JA 2A5YB 4PGGA 2EWNA 1KU7A 4JQFA 1KA8A 1HKTA 1EH8A 2MLGA 2HKOA 1XN7A 5L3EA 3G3ZA 5CVIA 3L7WA 3QOPA 4U0WA 3QP6A 5K5OA 4Q48A 3WTTC 5D5XB 3FM5A 4E70A 2D1HA 3KZYA 3DEUA 4RGSA 3M9AA 4A2UA 5JVTA 1R36A 5ICFA 5JHUA 3ISPA 1QZYA 2O6GE 3HSFA 4DNCA 3V4GA 3RKWA 3FF5A 4K2EA 5D5VB 2E7WA 2D1VA 4JBAA 1ZG1A 2GXGA 3R61A 3RIRA 3R6SA 5L3DA 4LFUA 4KFCA 1IUYA 2DW4A 2Q0OA 5ILUA 4ESBA 1MDMA 4MGRA 2HKXA 1ZYRF 2L4AA 1B59A 4EQQA 1SFUA 5E8GA 3SZPA 3JAMZ 4IXAA 3R0JA 4MTDA 4KICA 2DU9A 2F5CA 2H09A 1WKMA 3H92A 3FX3A 2Z99A 3QP5A 3KP3A 2A69F 1YS6A 2ETHA 1YIOA 2KIUA 5IT3A 2MC3A 2RN7A 1R58A 4EGZA 3KP4A 4A6EA 2P5LC 5F6FA 3F8MA 4KIGA 3K0LA 1BJAA 1SD6A 1O3QA 2FXAA 3ML6A 1P4XA 3WTZA 2PMUA 3KCCA 2MBFA 1YW8A 1HW1A 1U5TC 5BOXA 4KDPA 2PN6A 2VONA 1MJAA 1MD0A 5BQTA 4ESFA 4M9SA 5HLIA 2HTSA 4RGUA 2XASA 1GHCA 3DQVC 1FWZA 2L01A 2ESHA 1IXRC 2XUBA 3HSRA 3RPUA 4EMSA 1OYIA 2XIGA 4BHPA 2ACJA 2K02A 2IJLA 4P55A 3E6CC 2WV0A 2Q8KA 2H6CA 2QUFA 2PBIA 5CLSA 5D6EA 5A2QZ 4Q4ZF 2PLYA 2ZKZA 1O57A 4P9FA 5LRRA 1Z6TA 3QRFF 2BBYA 2XRNA 1SD4A 3WE3A 2C6YA 2HR3A 4O3MA 5DDGA 5DEQA 2HZTA 1XSXA 4ENNA 3FXRA 3IL2A 1IN4A 4NB5A 3IKTA 2DLLA 4A12A 1AOYA 2IA1A 3IHUA 4HYEA 1R5HA 2A07F 5DD4A 4PDKA 2CW0F 1V3FA 1UCRA 1SD5A 4ZYEA 3GWZA 3MQ0A 5FB2A 1OMIA 3WTYC 4UV8A 3M7GA 4WCGA 3I59B 1KU2A 1SMYF 3BJAA 3H3UA 3WG9A 4A5NA 4CYDA 4RGRA 2ZXJA 4CXFA 1R00A 2P6TA 5LLQA 2A3SA 2ZO4A 3L9FA 3FWEA 3MFKA 1P6RA 3E3VA 1J2XA 4B8XA 3WTWC 3CLOA 4CZZA 3RKXA 5AIPA 4EJTA 2NYXA 3I59A 4U0VA 2EJRA 1XMKA 5H20A 3HHHA 2VT2A 4OU0A 1DUXC 3I71A 1G3TA 4HDVA 2FE3A 3BROA 5CVUA 1HKQA 1UHMA 4LD5A 2YU3A 1SD7A 5D8KB 1I1SA 3RKYA 4M74A 4XLPF 1MZBA 4AIJA 3KP2A 1BOAA 3F8CA 1IXSB 4I02A 1D8JA 5L3CA 2XAQA 4UNOA 3K1NA 1IRGA 2O03A 3IRRA 4IVNA 1FYMA 2IP2A 4ZZDA 5ED4A 3NRVA 3V8JA 1FBSA 2KKOA 3J80Z 4BAYA 3KP7A 1Z1DA 3J7AO 3S2WA 1RI7A 3TO9A 1R5GA 5HOOA 3RYRA 3IRQA 2GZWA 5LGUA 1YG2A 4HX7A 5BPIA 1B9MA 2XVCA 1BI2A 3T5XA 1ZGAA 2D2WA 4M6XA 4L5IA 3R0AA 3FXQA 3L00A 2CWEA 4PCQA 2QBYB 3TOAA 5ILSA 4L9TA 3I5UA 1DPUA 1XB4A 5FFZA 3WE2A 2UXNA 3RJPA 4U7BA 3GYHX 5HS7A 2GA2A 2VODA 3P9CA 2RV8A 1Z05A 4QLCU 4PGHA 3D0SA 2JSCA 3PQJA 1ZLKA 2DQLA 1WRJA 5DD8A 3VODA 1FSHA 2OD5A 1CF7B 2JPBA 5L3BA 2K4JA 3ZN0A 3BPXA 4HLXA 2OU2A 3ZQ7A 4YFKF 3GFJA 2P7VB 1FP1D 3HRTA 3ULQB 4AVPA 1WI9A 2XKPA 1QZZA 1MDMB 2DAOA 1B9NA 2VBWA 1T39A 1SFEA 2WC2A 1XCBA 3T8TA 3ZP5A 1O7FA 3I4PA 5ERIA 1LNWA 1TQPA 1XDUA 2IPQX 1TNTA 3RI4A 5FD6A 2A6EF 1QGPA 5BS6A 4IHSA 2CVIA 3V7RA 2BYVE 3HTUA 4HA8A 3EYYA 3PFIA 3WGIA 5F64A 4YFXF 1J75A 3SXYA 3HIFA 3WGGA 4AIKA 1XSDA 1IW7F 4ZH4F 3OOPA 1TBXA 2K7LA 3R4KA 3MZHA 2VBZA 2QWWA 2YX7A 2DO7A 1TNSA 3HTSB 1G3WA 1V4RA 1EV7A 4MNUA 4EV0A 1OKRA 4ENMA 1MJ9A 2MLKA 2HYFA 2M1BA 1R22A 2STWA 3BJ6A 2FF4A 5BMZA 4MQVA 1R1UA 4RB1A 3JTHA 2FEZA 1HXDA 4XSXF 3M8EA 4LLGF 2H6BA 3ZMSA 5E18F 5CVRA 2LF7A 3GFMA 2ZNYA 1G6NA 2Z4PA 2EK5A 1KQ9A 2EFNA 5LEJA 2YR2A 3BZ6A 1RZ4A 3KEOA 2M30A 4GXOA 3NQOA 4N9IA 1HBXG 1O3RA 3FMQA 2FU4A 1FBQA 1XD7A 3F6OA 2CGPA 4UV9A 4LK1F 2PQ8A 1GVJA 3Q5FA 5D5WB 1FY7A 2E1AA 4AIHA 1G3SA 5JI6A 1HSTA 3IKVA 5CYVA 4KA4A 2XAHA 3CTAA 1ZRCA 1BC7C 2H94A 2PJPA 3BOQA 2Z3YA 1KYWA 3C1DA 3EDPA 3L09A 2XV4S 5HLHA 3OV8A 3CO6C 3LA7A 3QPTA 1XDSA 4DQ2A 4G7OF 2PMHA 5F1RA 4HAMA 3LAJA 1FLIA 4EVIA 2A68F 2RQPA 1J0RA 4OIPF 1ZG5A 2O61A 4HBLA 1U6GA 1H9TA 2XHKA 2XAJA 1EH6A 2KRFA 2K86A 4KT5C 2M45A 4M9XA 1YTYA 4XLNF 1BC8C 1FNNA 5E1ZB 1HQCA 4RGXA 4EM0B 3TQNA 2WTEA 1ZHFA 4HF0A 4ENKA 4G7HF 3LQQA 2KIMA 2DTRA 3E5XA 3G73A 2DPUA 4KMFA 2RVCA 2QBYA 1TW3A 2J5OA 1P2FA 2VBXA 5FGMA 2HGCA 1IXCA 4G8XA 3V8KA 3DV8A 4BQAA 2Z33A 3HSEA 4AD9A 4XRFA 4L5JA 2P6SA 1UHWA 2GA1A 2JSXA 3SHFA 3QU3A 3TOBA 2RKHA 5HVQC 1QNTA 4D0PA 4LG0B 1K6OA 4I09A 2DBBA 5EEHA 4L9VA 5D8LB 1DPRA 1FSEA 4LB5A 4HF1A 2L54A 2R3SA 2DT5A 4OIQF 4GO1A 3SFZA 2CQKA 1PP8F 1USTA 3TDZC 2QQAA 2HDCA 2QYOA 1JGSA 1LDDA 3WU1B 3KFWX 3P9IA 2TDXA 2FMLA 3I53A 3ZMVA 1U3EM 4LK0F 1XGOA 3RDIA 3P7NA 5ILVA 4A0XA 5JR3A 4BH9A 3O2PE 2XKOA 3GFIA 2YPRA 5D5UB 2LF8A 3MCZA 2EFOA 2IW5A 2M87A 2YX4A 3KE2A 1P4AA 4MEXF 2IA2A 3U1DA 1HSJA 2RNJA 3EQLF 2MH2A 4YFNF 1BBYA 3ZPLA 4PZJA 2DQRA 2LKPA 3WTVC 4XBFA 4LB6B 4G9YA 3KP5A 1X3UA 3C18A 4KIFA 4LLNA 2ZMEA 4P9UA 2FMYA 4EM2A 3N97A 2OZ6A 1XGSA 2KJCA 3B73A 4MTEA 1I27A 5HLGA 2W85A 1J59A 2JRTA 3EETA 1LDJA 1ZRFA 4HZFA 1U2WA 3VFZA 2XAFA 3RPQA 3HHGA 2X4HA 1D3YA 3MZYA 2ZFWA 2MD5A 4TV7A 1IF1A 3ZN1A 1ZGJA 4BNCA 1C0WA 5TJJA 5D4SA 1RIOH 1YS7A 3KEQA 4OMYA 2K4BA 1LQ1A 2V9VA 4I01A 1JXSA 1W5SA 1CGPA 1FYLA 1RUOA 1BIAA 2OQGA 2LDUA 4KMUX 3I58A 1YFHA 5J6XA 2UZKA 1U78A 4BHBA 4WK8F 2W25A 4KN4X 4M73A 4KUMA 3Q9VA 1O3TA 4CDGA 2MA3A 2VC0A 2V79A 3CUOA 1J5YA 4HV5A 4WXCA 4R79A 1R1VA 2DK8A 5HS8A 2Z9OA 5IT9Z 3K9TA 2V1UA 3HOSA 2DPDA 5HDGA 3HUGA 1WWXA 1YW9A 1AWCA 4NQWA 1LVAA 4UUVA 4HX4A 3WU0A 5FD5A 5J8FA 3J81Z 1STZA 1TQIA 4CO8A 2HTJA 1XGMA 2EB7A 5LGTA 3QAHA 4HF2A 3T1BA 4UVCA 2ZCWA 2P5KA 2WWYA 3GZ5A
chains in the Genus database with same CATH superfamily
4JX6A 3SZTA 4ECXA 3BN7A 3UR3C 4CGZA 1FRXA 2B7EA 1NU4A 4DLEA 1KVKA 3ZQGA 5H9EJ 5B66C 1URNA 4PWUA 2RF2A 3I0TA 2XMMA 4K2JA 1W7WA 2GGPA 1WC1A 1GAOA 4KJZA 2FJ1A 4BJ6C 1RTZA 2R0QC 4BACA 4BU2A 2M7AA 2CG8A 4O3PA 4M6VA 4ZPTR 2HYGD 3QPHA 4ZYDA 1GXPA 1YG0A 1QSYA 5F27A 1VJWA 1HOMA 2R7FA 2FC8A 4KIBA 2V8VA 2OEMA 2QV6A 5LXYA 3M07A 3C3LA 1UA1A 2LECA 5GAEJ 3D66A 5TRDA 5DZ6A 1B7FA 4FHTA 4XSZF 4B4CA 3HJFA 4F0KA 3H5NA 1G4DA 1KEKA 3FK4A 3ADAC 1XNRF 4YRVA 5KFZA 5KG7A 1OPCA 4N5SA 2MZQA 4Y4RA 5FLXY 4RU2A 5F8NA 3KJVA 1YRNA 2LREA 2Y2ZA 3ZZRA 2OA4A 2HVEA 2HS4A 1FTZA 2JEGA 2XGPA 3AA8A 3GIIA 1W2BR 1KQ8A 3QRRA 1BUXA 4OJ1A 3TA2A 4RPFA 5K8MA 1BN5A 2HBZB 2KP6A 1EH7A 1KTQA 5EWEA 1S7OA 2Y9YA 1EAYC 3O1LA 4KJIA 1W2IA 4URGA 2VKEA 1FI4A 3QOEA 2HVIA 4GYIA 3IRWP 4ZYAA 3MWMA 1Y3JA 3HCXA 4JP8A 4YP3A 2HS5A 5JXSA 1EETA 3H2LA 1LWEA 2HMIA 2IMWP 3QJLA 3KZZA 4O4GA 3M8ZA 5J2NB 3DRPA 1HWJA 2EBEA 4TY8A 3CC4S 1TU0B 1T38A 2UXCF 1N5YA 2G0JA 3K4MA 3A01A 2RVJA 3ISND 2IVFB 3CC2S 1CJVA 3VZIA 3QSIA 2YQ0A 1V5IB 3PX4A 1BL0A 1XJWB 2EZKA 4WXDA 2RDDA 5IWAJ 4OYMA 3GG1A 4X4PA 4OLPA 3CE8A 1TTHB 2GMJA 1GXQA 3VB2A 4PUOA 2HOAA 3CP8A 3CDHA 4C8NA 3WDOA 3LFKA 3JSBA 5LBQA 4EGLA 2CQ3A 3B02A 1TKZB 1H74A 1VBKA 5JJBA 3DXJF 4DJBA 2ZBKA 4C8LA 2EV6A 4QR1A 1IN6A 2UXDJ 1X1CA 3CUNA 1QY7A 4OX7A 2R2TA 1ULYA 4G6QA 2OO4A 4L0YB 5DO2A 2DIUA 5DUKA 3CO7C 4K5SA 3MOZA 3VGTA 2CYYA 2XLIA 4DCPB 1NUEA 2HSEB 4TLRA 5KFDA 5CVJA 1FP2A 1ZARA 3GXOA 4CLUA 1MMLA 3ZFVA 2ATLA 4L18B 4K8RA 1I3OB 2QL9B 2ZNZA 3W3CA 3C2GA 4DV0F 3ABTA 4DPXA 3T41A 4RW9A 3K59A 3TI0A 2COMA 4TU8A 3NWSA 2GVDA 4G65A 2CADA 3SDGA 2AV5A 4JOMA 4CO0A 5IV3A 3PW2A 2X0LA 4N8OA 2KFZA 3BDDA 1S8NA 2BZTA 1QUPA 3BSCA 3WHCA 3QIPA 3C46A 2P8TA 2E9TA 1ZQ3P 4EJUA 1R31A 3M1EA 3CUQA 1T11A 3NAUA 3IG1B 2H4WB 3KNGA 2Q6BA 1CF7A 1FOXA 2QC3A 4N4NB 2WA0A 1IN5A 1REPC 1GV2A 3KYLA 3DYAA 3ABUA 3D6FB 4OZ3A 3SFIA 2LOOA 3K8VA 1NPPA 1VRQC 3W66A 4DV4F 1F0XA 4NEYA 2GAHC 3MMAB 1TK8A 5KFUA 4Y6IA 2HWTA 3MM6A 1ROFA 4LF7J 4XRSG 3T1YJ 3K2ZA 2V8PA 1X1BA 1LOUA 1ZGWA 2YQ3A 1B4AA 1FOKA 2EXUA 1ZTWA 2R8IA 1KYZA 4DSEA 4NZ7A 1TT5B 2BHYA 5F8MA 2ZXIA 2HEOA 1NPKA 1HYSA 4K0KJ 3Q8RB 1C2PA 1Q86T 2OI2A 4M8LA 1F9NA 2VE9A 3OUYA 2IVMA 2NVXJ 2WHOA 3CB4A 1JKOC 1VYAA 2V4JC 4ETXA 3KLFA 1YIJI 2V8HA 3TJ9A 3S1TA 3ZZZA 4PPZA 4II2A 3GVAA 1GX6A 1RBOB 2V1DA 3J80Y 1N25A 3HRSA 3BR3A 3PX0A 4JI8F 2HEKA 2V9WA 1RWKB 2LQ5A 2Z1DA 1CEZA 2EA2A 4A3IJ 2R42A 1M5VC 4B3RJ 1Y9OA 2MQMA 1HNVB 4MJKA 1H72C 4FCYA 2WB1N 5KFKA 3D1QA 4LG0A 1U2RA 2I5UA 3PNTA 1YI2I 2ESNA 4C11B 1BR4A 3IC7A 4ZPVR 5I4MA 1N4LA 2QSHX 1JHFA 1HW5A 5E3AA 4OHXA 4IPAA 2DHAA 2LY2A 4AQYJ 3QIDA 2XDVA 4ZJQA 4O44B 3LWFA 2DHGA 1QUVA 3DKWA 2F5VA 3TEGA 4PJLA 5E1WA 1SJ1A 2A18A 1UJ5A 1K73T 3Q3SA 3GR1A 5CYMB 2VE8A 2P7CB 2M8DB 4B9LA 1X4GA 2BV6A 5EZGA 4PQAA 1MMDA 1ACMB 1FEEA 1PILA 2HFVA 1MNEA 3GTGJ 4TYAA 3W1YC 2JA7J 3OTOF 1HW8A 2N8GA 1NO8A 2R8JA 3CIMA 2X85A 2R7ZJ 2GMLA 2ZH5A 3BZQA 2V1XA 1T3OA 3NCQA 4K4TA 1QO0D 2K5CA 3K1PA 4ZYHA 1H0HB 4RB2C 1OR7A 4GMKA 1ZH5A 2LSOA 2MZJA 3K10A 2YKNA 1TFYA 1HI0P 1V54H 2PC6A 4OYOA 3UFCX 4ZP7A 5KFXA 4DUZF 5CPRB 2K85A 2HYJA 4A3DJ 4J90A 4PUOB 4LUBA 1RGVA 5HLFA 1JX4A 1RWVB 2YWKA 2MQLA 1AUDA 1QQIA 5HJXA 4U67Q 3ECOA 3K58A 2RRNA 3TDUC 2AHOB 3K0JA 3S15J 4KGMA 3LMMA 2VG6A 1EP4A 2EG1A 3HSJA 3CZ6A 1LFBA 2X1DA 1W0UA 4FVCA 2AJ4A 2GHVC 4RB0A 3PO4A 2VFTA 1HI1A 4ZVEA 2KJBA 4IOAF 1U9NA 3JW4A 1YITS 4I98B 3OYHA 3S14J 3IG1A 5E7OB 4UOGA 3H1CA 4Y2CA 2EFQA 4NZ0A 4F36A 4ED3A 4L3KA 1VLYA 3EGZA 3K5LA 2DCLA 4DG1A 2CPXA 2OTJI 3GTJJ 4HOBA 1Z9CA 2M2EA 1LEBA 3BQ1A 4LIRA 2U1AA 1WOOA 5E2QA 1QVGR 2KDOA 3R97A 3VWBA 4AL5A 3PJWA 4Y00A 4FASD 4M94A 4YB5A 1M90T 1R89A 3MMCA 1KVJA 5BYQA 2VD3A 5FKMA 3E3XA 2I8EA 4BBRJ 5ETMA 2Q66A 4F25A 4MFBA 3DXSX 1OPZA 4KHPJ 3OYBA 2GVDB 1MBKA 2NYIA 2K40A 2WVCA 2MQQA 4ZCMA 2OPTA 2DNPA 1IV8A 2HOSA 3HSGA 4RO0A 4DV6J 1LDKB 3VHQA 4F0MA 3NKYA 4KB7A 2XQCA 5D3GA 3I54A 2ZOGA 3HVAA 5KG1A 2L02A 4B9NA 2XY5A 4F4XA 3CO0P 1MBEA 1TW2A 1Z7UA 2XI3A 4NCAA 4RS8A 3SZGA 1CSJA 1TL3B 3CWJA 2FVQA 5LHHA 1WKLA 2RSQA 3I0RB 4C8YA 1T9UA 1VJQA 3VQSA 3NOGA 1XMAA 1H7WA 2V6CA 2VC1A 5DCMA 2VPLA 3FK7A 2YKOA 4NXNF 2RDPA 4UXNA 1IN8A 4RBVA 1RUNA 2MFZA 1YZ6A 2MHEA 2QRRA 4DX6A 5DG8A 2PFBA 4ZDLA 5C25A 4EJVA 5IP9J 2KZVA 3ZMDA 2F40A 2MQNA 1HNIA 5KT4A 2HQ3A 4HV6A 1SH2A 1RHUB 4USIA 4CO3A 2MD0A 1F4KA 3BTLA 3KLNA 4DU8A 3SSQA 3GLJA 3WODF 2HVHA 2YKAA 2ISYA 4G6DA 3R5BA 2JVHA 4O44A 2X6YA 2O3FA 3TO7A 2CJXB 2FLLA 3PYEA 2IA0A 1UFLA 1NHUA 3C3WA 3D9BA 4YG2F 2CWKA 2J5PA 3HFZB 3ELKA 1VBYA 2NVQJ 3ENQA 4I7HA 3X3UA 4YB1P 3WTUC 2R7UA 1HNVA 4C9DA 1LV5A 1ONVA 1S6LA 2GIRA 5D6FA 2FRHA 5GTIC 4E7HA 2PGCA 2PT0A 3KETA 3IWZA 3HD1A 5KFHA 4YEJA 3SEZA 3FSXA 1OY6A 5J1UA 1QHGA 2HXIA 3CD0A 1BGXT 3CDLA 2HHHF 1VQMI 4B3TJ 2W48A 1RHRB 4UF4A 1OCOH 1K7AA 1NK9A 5AIQA 3LWMA 1RHKB 2O5RA 4PQUA 4ETSA 1TQMA 4O6JA 5FLMJ 2K1RA 4HRIA 5ETNA 5L9NA 1FJ7A 1HDDC 2JEIA 4DR2F 1S9GA 4E98A 5LMUJ 3BM7A 2E1MC 4B47A 4BBSJ 3W7BA 1SJQA 1MJBA 4JI3J 5KFIA 4OIOF 3MM8A 3OD2A 3M2VB 1SMTA 4EJWA 5JFRA 1ON1A 4PXBA 3OYCA 2KIFA 2K3PA 3LQRA 3JSPA 2HQGA 1S6PB 1NK4A 4DV3F 3CJNA 2KL8A 2HURA 4MAKA 2KT3A 1F1ZA 1LFUP 1WC0A 1JHHA 2CDQA 3RBDA 5F0WA 1IN7A 4WX9A 1PDNC 4J01A 3COAC 3DF8A 2XSJC 2CQPA 4LR7A 2O8XA 4OZ0A 3LP1B 2ICWG 1IO2A 1ETWA 2D3UA 3NLCA 4EYHB 1QDUB 3R7BB 2HPIA 5DUIA 4Y34A 4H4OB 1OCTC 3EGNA 4B02A 2M3DA 4XORA 4KGVB 1WTFA 2VA2A 2GQQA 1SQGA 3PIPQ 1HF0A 3CJKA 3L2RA 4DR1F 3E6BA 3GLXA 1LPQA 2FJDB 2HZVA 2LTPA 3IR7B 4OZNA 4N76A 3MMJA 3AL0C 3PRBA 3B4MA 5THWA 4HT5A 1JNRB 4WXHA 2JSPA 1XNRJ 1U8RA 1KQ0A 3GYNA 2MSSA 2A6HF 1FBUA 1TELA 1F5AA 1NM2A 1MKMA 1LWCB 4ZVPB 3ZQLA 4CSWA 3HOVJ 5HBMB 5ICEA 1S1UB 4L9JA 3S8PA 3M8SA 4A8YA 1EARA 2APOA 2HRTA 4MEYF 2ZE2A 3VAMA 3JTGA 4ZVUB 4OJGA 1QSLA 5KFCA 1TWCJ 3Q8SB 2AF6A 1RAEB 2E71A 1DY3A 2I2YA 4Z2YA 3EM1A 2PDAA 3OTCA 3WIUA 1S59A 1R71A 1JLQA 3N4MA 2B0GA 1LFPA 3ZZ0A 2A5YB 1QVTA 4PGGA 1MBGA 2J76E 2VUGA 1G7CB 5LOQA 4E7JA 1LUJB 1ZR4A 1SV5B 4QW8A 1KA8A 2B3TB 3C15A 1N5VA 2LH9A 5RUBA 2HQIA 2KN4A 4QR2A 3RRHA 3G3ZA 5CVIA 3L7WA 1RCOB 4WWSA 1JXLA 3OXLA 1TMMA 3KLEB 5K5OA 3OSPA 2WW4A 5HMZA 2D1HA 2BW7A 4QW9A 3M9AA 4A2UA 2HFUA 3HVTB 3BGOP 3N5FA 3ZC4A 4OZJA 1I6HJ 4C9YA 4DN0A 2DMPA 3ISPA 3N05A 2AT1B 1ZAXA 2OPQA 4LFAJ 1K4SA 4UOCA 3HHDA 3NARA 1JLEB 2W9CB 3BR5A 5D5VB 1S1TA 2NOGA 1YZ7A 3TAQA 2E7WA 3R7NB 1VBXA 4ILMA 3TVZA 2ZM6F 3GSDA 5C4JJ 2ROGA 2CJYB 3K17A 2EZLA 3KJNB 1YDLA 3LPEA 3K5MA 5CYJA 4PYAA 4L76A 1YBUA 4ILRA 3LQVA 1B59A 1X4FA 4ZS6A 1Z77A 4XN3A 1SFUA 3OYLA 5E8GA 3SZPA 5DZ7A 3OBIA 4ITVA 1NDKA 3R0JA 3PSFA 2HNYB 3P45B 4MTDA 2CPEA 2B8QA 1YVFA 4IUFA 4MMOA 3FX3A 3P49B 2Z99A 4UB6C 3QP5A 1YHQI 1XIQA 3QT8A 3MD1A 2ETHA 1F9HA 2ECBA 1YIOA 3IFEA 4A46A 1XQIA 3RBEA 1NKCA 2PMZA 1F60B 1R58A 4UOFA 1JLBB 3MEGB 2DISA 1IG7A 5F9LA 1I5OB 3T1AA 3HPOA 2H8RA 2Z0GA 3LTOA 5E3MA 4FF4A 2WV1A 1O3QA 2BW3B 2PMUA 3LOUA 2BHZA 1N32F 1BR1A 2MBFA 1HW1A 2EFVA 4WFXA 2PN6A 2VONA 5BQTA 1LXJA 4M9SA 2RAQA 4CT9A 3IWXA 3M7VA 2XM3A 1FWZA 2L01A 4HHUA 3J7YI 2FJXA 2ACJA 2K02A 2XSDC 4KKOA 3UQSA 3E6CC 4AXJA 4XMYA 1J2VA 2R8GA 2PBIA 2E7VA 5D6EA 3OV7A 3I56S 1O57A 2J9EA 4IEJA 4AL7A 5E3NA 1U8WA 2M0CA 4I2QB 2C2EA 4Y2AA 4HT7A 3BB5A 1RHMB 3CD6S 5KCMA 4B08A 4LF2A 3AG3H 3BCAA 5TGTA 1D9FA 4FQGA 2EVZA 2KRBA 1Q53A 1JJ6C 4FF2A 1XX5A 3ABLH 4NYZA 2ME6A 1IN4A 1IVZA 3KK1A 1HA1A 4NB5A 2CJBA 1FKAF 3PNIA 4M5NA 4C8MA 4F4AA 3TZZA 4OFZA 1SEUA 1Y5NB 4PDKA 2WB4A 4LRCA 4ZMMA 1HBUB 3F9KA 2ZC2A 2MXYA 4QBUA 3TO8A 1FD8A 1H98A 1HWUA 4DR4F 4EZ6A 4AYBN 1RTIA 5LSRA 3JRHA 3WTYC 3I59B 4ZDNA 4BHQA 1Y10A 2A2CA 1N78A 3LGMA 1SVDA 4LF1A 1FWKA 3HHKA 2VB6A 4CYDA 3BN4A 4FYVB 4RGRA 5LD2C 4DSJA 4V2FA 3CESA 1U1LA 1LEOA 5DDOC 5IP7J 5LLQA 3C6TB 3MTKA 2YNFB 2L08A 3WTWC 1SXLA 3CLOA 3R1HA 4AC0A 4EJTA 4F7VA 4XKBA 4ZJZA 1HPZA 1XMKA 4A3FJ 2GCFA 2M7SA 5DM7F 5H20A 2BOLA 2DGTA 4QWEA 2DNLA 3VZHA 3BO2A 4WFZA 3ZR8X 1IR1A 3FC9A 3I71A 1JJHA 4A3CJ 2H1LA 2OJED 2GIZA 4ZTFA 1T94A 1ZETA 1DQUA 1VHIA 2PI4A 2DA7A 3FRZA 2AGPA 4DPOA 2HZDA 2Y0SD 3CEDA 5J2PB 4CLZA 4ZVQB 2OPRB 2QL7B 3CDBA 4YFUA 1I1SA 5D0GA 5HAOA 4GVBA 5KFAA 1UP1A 3BH7B 2CPJA 5B0EA 1PUFA 1MZBA 5E79C 3K5OA 3KK1B 3F8CA 5FRMA 3EXYA 1D8JA 1WJBA 1YBAA 4JV5J 1QA6A 4UNOA 5K7ZA 2OTLI 2O03A 3HGGA 1BJZA 4IVNA 2IP2A 4ZZDA 3HG9A 4DFJA 3R9LA 5IZHA 4V1Ak 1OQ3A 1EP4B 1GT0C 3H59A 1IBMF 3MECB 1Z1DA 1CC7A 3S2WA 1RI7A 2WOMB 5GAEI 1JUMA 4Y2MA 2YNIB 2V9KA 2NZ4A 4L6V3 3QMQA 3PFOA 3RYRA 2DXDA 3IRQA 5LGUA 2ZH4A 4ZVFA 1YG2A 6AT1B 3FBCA 2CAJA 4OYIA 1HIYA 1WJ5A 1RWPB 2HIQA 3RGIA 4D3GA 2XVCA 5K9FA 3VF0B 2RHSB 1BI2A 4K4UA 3GFXA 1RT3A 2I5JA 1X4BA 1SV5A 1FF2A 4HG2A 2QBYB 1MH3A 4ENOA 5AXKA 5B1AH 3I5UA 4QYZJ 1DPUA 1N54B 2ZHAA 4RLQA 3WE2A 2UXNA 1T95A 4IH7A 2K9SA 2LP0A 1UHSA 2GA2A 3P9CA 2RREA 3K6GA 3TW6A 4IL6C 5CQGA 1HMVA 1U48A 3OYEA 3MMAA 2I9SA 3A0HC 4OYBA 1DBDA 1U45A 2Q1LA 4L73A 1WTBA 4JI2F 4HH0A 3HM9A 4V19J 5DD8A 1UW4A 4HACB 2JPBA 2BE2A 4LF9F 2OU2A 3GFJA 3HJVA 2P7VB 1BQMA 1ETYA 1GT8A 4NL5A 4ZVTB 3HRTA 1G59A 1KR4A 1C1BA 1WI9A 1S4EA 1A35A 5D4LA 1L3TA 2Y30A 3E01A 5E3PA 4RBUA 2CV0A 1VQPI 2A6MA 2BY2A 5A0YA 3LO3A 1IC8A 4G3IA 2ATCB 2V69A 2CQ0A 4NCBA 4WU3A 3T8TA 4BJTA 4C0BA 4PRFA 4NLXA 5B7WA 2LK2A 1KLMB 1YK9A 1AXQA 1NJYA 2LXFA 1TQPA 2IPQX 2F1FA 3CJRA 3MCMA 2E5HA 5FD6A 3U27A 2MLYA 1X60A 3GTMJ 2PA3A 1QGPA 1N33F 4F0HA 4HDHA 4F3QA 2FY8A 1JLAA 3TQ1A 3V7RA 3Q24A 4DR7F 1AUSL 1VQPS 4UUSB 1T0TV 3HVTA 4HA8A 4DL3A 5KFYA 1ZPVA 5J4VA 4JI1J 1X9WA 3PJXA 1J75A 4S0MA 1U6BA 1GK8A 1U7LA 3OOPA 1ZYQA 3U02A 4P73A 2ZZTA 3R4KA 1HNZF 4RWXA 1WC5A 2XMTA 1IM4A 2VBZA 2QWWA 1WEXA 2DO7A 1BW5A 4OLOA 1FOWA 1NHKL 1GTEA 3G8TA 4MNUA 4DL2A 4ENMA 4YEAA 5HNFA 4XONA 4I67A 1MJ9A 3Q0UA 2KHDA 1H2VZ 3OLBA 2XY7A 2OEJA 5BMZA 1R1UA 5GAHI 3UNYA 2RRBA 4QYRA 3FUYA 4Y28C 3MPVA 2EG2A 1TWAJ 1Q78A 2MLZA 3IH3A 2KMUA 4L3NA 1JNZB 3RR7A 3S3NA 2H6BA 1SIZA 3TX0A 2HVQA 2D41A 1MROB 2EZIA 3HO1A 4B3OA 1KVIA 3PW5A 4CQ1A 1LW0A 4ZVOB 2IEKA 4V2GA 1HARA 2C3UA 2VH7A 5CVRA 7FDRA 3Q2SC 1G6NA 4ZVHA 1PAUB 4Z7CA 3D5SC 2VJJA 1HBXG 3QO9B 3G82A 3FMQA 2NREA 4EBEA 1V5FA 1FNXH 1XD7A 1MNMC 3BGUA 2QGUA 3DTKA 2PQ8A 1GVJA 4P2MA 3HZJA 5D5WB 1JKHA 2JJ7A 2KXNB 4KA4A 1AKHA 1RKIA 4NLSA 3OIPA 1BC7C 2XPVA 2H94A 4LSLA 1FVQA 3BOQA 2QT7A 1KYWA 5IYCJ 3L09A 2BKOA 4OV1A 4EBCA 2YTCA 2XV4S 4M3GA 2JLEA 3OR1C 4OX6A 2LQ8A 4YQWA 1X7VA 4KKOB 1UVNA 3QPTA 1IRXA 3M8QA 1AFIA 4F26A 4WK3A 2CH0A 3O3LA 2X7IA 1FLIA 4NASA 4EVIA 1J27A 2W1OA 2HVZA 1YSJA 3FISA 2WB1D 3UDVA 1J0RA 5KFMA 2VFVA 1D9AA 2PIIA 5B09A 1ZG5A 3OVSA 4BBYA 2J7KA 3PUFA 2W7PA 3I9V9 4BKXA 2O61A 1NB7A 1U6GA 5LL6d 3HKZD 3ABKH 1UJ6A 5B0FA 2KRFA 1JLGB 4N56A 5I3PA 5DM7Q 2M45A 4M9XA 1SC7A 1WOSA 2NQPA 1HMVB 1HQCA 4BC7A 4CTAB 3GYGA 4NQWB 1TL3A 2G1HA 2L7KA 4ENKA 2GMHA 1X5SA 3E5XA 5A8WA 1TVRA 4KMFA 2DMUA 5H2FC 2QBYA 1MH4A 4WYWA 1TW3A 2VBXA 3S16J 4FYDA 4FZVA 3AFHA 3V8KA 1U1OA 3CULA 1FEXA 4F55A 1FMWA 2Z33A 1FEHA 2QEXS 4XRFA 1WJEA 4L5JA 2AGQA 4MIAA 3H9GA 3CD6I 2JSXA 2M9HA 2RKHA 1O6XA 1MBJA 1KQGB 4ICLB 4DYQA 1QNTA 3CF5Q 2I6WA 2GHWA 3BG7A 5D8LB 4UB8C 3PFYA 4FKXA 2IAJB 3BREA 4HF1A 2L54A 2AX1A 4XR6A 1ETOA 3CP2A 2CQKA 4ZPAA 1IGNA 3ULHA 1PP8F 2RNGA 2D69A 3GMEA 4K4ZA 2C3OA 3P6YC 5BYSA 1JGSA 3KFWX 3JTOA 2K3FA 4I6WA 3FXKA 3GQCA 2Z57B 4OZLA 5F0FA 4QIWN 1U3EM 1DP3A 4CH0S 3SXLA 3RB4A 1L3UA 4DL0C 2XGDA 1A36A 1RHQB 4DX7A 5JR3A 1TKZA 3MKWB 2CJJA 2FHJD 3GFIA 2MJNA 2YPRA 1PIEA 2Q6CA 1XNQF 3AB2B 5B08A 3K4KA 2XNRA 1HD0A 2IW5A 1LWEB 2X1FA 3KE2A 1P4AA 4BWJA 3G2BA 2IA2A 3KLIA 3EPGA 5KFPA 5GPAA 4XTTA 3SYTA 4R8UB 4OX9F 2KQRA 1HSJA 1VRUB 3FFIA 2QSWA 3EQLF 4P1WA 2FY1A 3BQ0A 3C8YA 1BBYA 3KDOA 2E2IJ 1HBMB 2F4VF 2ZJPQ 4ETZA 1REGX 3JRAA 2J0XA 3NCPA 4FXDA 1WHVA 2DNNA 3KJQB 4NMLA 4LB6B 4O3OA 5A2QY 2E5ZA 3OMYA 3JQMA 1X3UA 1WC6A 2KT2A 3LNQA 2IDEA 1VK8A 2XB2D 1TV6A 3GZ7A 4ZIVA 2ZMEA 1WJAA 4P9UA 4J9SA 2CQGA 4EM2A 3MM7A 2OZ6A 3GZNB 1UWBB 3B73A 3ONQA 2GJFA 2BABA 1RR7A 1AKHB 4JI6F 5ETSA 1XTZA 3VFZA 2XAFA 1VQLS 3FZBA 2G9OA 3QWUA 1UELB 1S99A 1S0MA 3VTIA 4XKVA 3I32A 1FKOB 3ZZTA 1XEZA 2IRXA 3OS2A 1AROP 2GX8A 2LY1A 2EW9A 1YS7A 3CCQS 4I76A 3JYTA 3M1CA 2K4BA 2KH9A 5L38A 4NXMJ 1VQ7I 1FDBA 1FHTA 2MHNA 4DYRA 1JXSA 1JT0A 5T41A 1W5SA 2DD8S 4ZOSA 1A6LA 3OL8A 2N4CA 1IBKF 2DNZA 1BIAA 4ZLPA 1VQLI 2VJVA 4J00A 4MH8A 5HMXA 2J0SD 1PKUA 4WK8F 1C1BB 3M8RA 2VXDA 4A3EJ 4M73A 2R7QA 3KK3A 2PI5A 5D6GA 3A0BC 3SCJE 1JIHA 2Z8QA 1R4MB 3LUYA 4DWIA 3T5LA 1YIJS 4QYZK 1WJFA 3HD2A 4IO9F 4WP8A 3N6LA 2XMJA 2GA7A 5IT9Z 3HHLD 2E2HJ 5FD1A 3TW0A 2LG4A 4G6VB 1RWMB 3HFVA 4IOCF 3J81U 3R5CA 2LVSA 5HDGA 4P72A 5JVHQ 3CCMS 2KB2A 1NK8A 4NQWA 5U47A 2HBQB 2IGKA 1F1BB 1IR0A 5J8FA 4RNOA 3DLGB 3T5KA 3GWCA 2D5VA 1MBFA 4CO8A 5L1KA 2ACYA 2MGZB 2M88A 2WWYA 2HFOA 3S1QJ 1M1EB 3WZ0A 3F8FA 1TAUA 2HQAA 4CCHA 3QGGA 2XWXA 5FKLA 1XMQJ 1JTYA 2CPHA 2XS7A 4JB8B 1CQMA 3CTRA 2DPJA 1OFCX 4X4SA 2BANB 2RC4A 1W7PB 1X1AA 2QF7A 3DOKA 4RR5A 3NEUA 4RBOA 3RYPA 1YLFA 3S6EA 2DXFA 3WX8A 2WSFC 3VGVA 5B0DA 2ZJ2A 2EBIA 4PUSA 1ZZNA 2MKJA 3SYZA 1S9FA 3WGHA 4AYBA 4IQMA 4OZ2A 3BGLA 4XO0A 2E1MB 4I1TA 4RAGA 5GAGI 4F4ZA 3MCOA 4CRJA 3L95X 2AP6A 4HI2A 1A6IA 3GB0A 3AD9C 4MIMA 4U9RA 2I1RA 3GX4X 2G2YA 4I2PA 4YHHJ 4M3BA 2XPUA 3RRGA 3MD3A 3SBMA 4ED4A 4CA0A 4Q0BA 1B1BA 2BEFA 5K5MA 5J2PA 3PJ9A 3EUHA 2HOEA 4QU6A 2UV1A 4P75A 3DTIA 5FKOA 1HNIB 4MIBA 3F6VA 3W63A 5HROA 4P2SA 3PTWA 2AXTC 3DDNA 1UG0A 2E5LF 2P2CB 4XIUA 1SC6A 1ORKA 5DS9A 3KG1A 1ZREA 3LH2S 4B3AA 4A3GJ 2PG4A 3J7YJ 3ISZA 1R0BG 2MGZA 2M5WA 1OPIA 2EV0A 2G7HA 1LB2A 1JXEA 3F22A 2ALYB 4CCLA 2YS9A 3K4NA 3CC4I 4U7UD 1VFCA 5EF6A 1VQMS 3I5AA 2QVOA 3PIOF 3RW6A 5EWGA 2DODA 4DI6A 1FD2A 1VC6A 3MAAA 4CH1A 1SFOJ 3ENAA 3HOUJ 4OAZA 3M05A 4IHXA 3OYKA 1RT1B 5KT5A 2GM4A 2CV1A 4KY3A 5M3MJ 1XG1A 3OSGA 5H6QA 1IKVB 3VAHA 1K0TA 4NZ6A 1AU7A 3EICA 2JFDA 2AS5F 3CCVS 3NCRA 3C14B 1Q8BA 3C2PA 3BR2A 4XIDA 1CJUA 4Q5SF 5DGBA 3PKYA 5DQIA 1H2UX 4LRBA 4X66J 4NLYA 4JI4J 4A0YA 5IT9K 3R6GB 5L3GA 2QGFB 1QAIA 2QTWA 1SFXA 4WP9A 3MUTP 3OSNA 2D3O1 2ADCA 4GVLA 4ZLJA 4G94A 2KXFA 4QJVA 3GW2A 2GIQA 4C7QA 5F8JA 4W1UA 1EHWA 1Z91A 5IM0B 4CUGA 1SJ3P 4XL9A 3ZMTA 3H98A 2F5FA 2UXXA 1VQ4I 2PEBA 2H1YA 1GEHA 3OYJA 2AU0A 5C25B 4OJHA 3BWGA 3U9GA 3J7YU 1HR0F 3VVUA 5ICGA 3HP6A 4DFPA 2L41A 3R2DJ 2ZBRA 1K61A 4ICLA 4OHVA 4M71A 1Q1VA 3SQOP 2B4OA 4J37A 3CCVI 4BGDA 1MN7A 5HSPA 1OYWA 1BA5A 2GOXB 1T98A 4LLLA 5DYMA 3S3OA 2DKOB 3S3MA 2CFXA 3R5DA 1XMOJ 3DKXA 4RL1A 1SFKA 3W61A 2HDWA 1R27B 3I96A 1VRTB 2NXCA 3OXFA 3PZPA 3OJSA 1TTYA 4RNNA 1YX5A 2Q2EA 2LFBA 2EI5A 4MO7A 2GJIA 1XK8A 4X4QA 2L7FP 3LSTA 1E0EA 5FKNA 2HHXA 1CULB 1HQ2A 2O7OA 3KZIC 2BW2A 2UUCJ 2O67A 2F5EA 2WADA 5J1EB 1W36C 2F48A 3FJ2A 4ECRA 1BR2A 5K5RA 1APLC 3RUBL 2VQGA 3H5RA 3ZQIA 1KNZA 2D45A 3KPHA 3TUIC 2JRSA 1K9MT 4WKRA 3FFIB 3AAFA 2KZZA 1JE8A 2JUCA 1RAOA 2AYBA 5GMDA 3MPDA 1F5BA 3D5LA 1Q1HA 2NOJB 3CCYA 1MGTA 5JVGQ 2VQHA 1KD1T 3LP0B 3KUGA 2MLXA 4KNYA 3FQLA 3ZOBA 1FERA 2L3DA 1R8CA 1L3VA 2DY1A 4CLYA 2OGUA 4YDXA 1VI7A 4TY9A 4PWDA 4XLFA 2ZH1A 2VU5A 1JLEA 2W9CA 4Y2IA 4JYAJ 5DTDA 1L3LA 1LW2A 1S76D 1RE1B 1RXOB 3JRIA 2IM3A 4DBQA 2NS8A 1S1XB 2QMUB 2AMCB 4WXOA 3X2QH 3UKGA 3EE3A 1Y0NA 2HS3A 2A6OA 2OTJS 4YR0A 4NYOA 2E1CA 2DK2A 1TL1B 4HEA9 4U7DA 2XULA 2UZAA 4HDGA 2UUAF 1I1GA 4F91B 3GMGA 1W7PD 5K7HA 3JRFA 4J9LA 4DYCA 3E97A 1KFDA 1R3NA 4DUZJ 1B3TA 4NI2A 1R6YA 1R1TA 5KG3A 3W5ZA 2VKDA 1R49A 1ZN2A 1MROA 2PA8D 4NRUA 4MIWA 1HQEA 2AYMA 2ZFUA 5A0YB 3EPIA 1BOBA 2R7VA 5HVFA 3J7AN 3RYLA 3CT9A 1F3VA 1V5EA 4DCOB 4S05A 3MCSA 3NEKA 5HVGA 4LF6F 2FJWA 4LVOP 2F6CA 6PAXA 1NPRA 5HROB 2QLZA 4HVZA 1U5TB 4NOHA 4HX8A 2ZJQF 3C14A 4FX4A 3O6QA 4G1PA 2F4MB 2F63A 1Q8IA 3I64A 1I3QJ 1IN0A 3FSIA 2O0YA 1OS5A 2QENA 4KIAA 4ZJLA 2NSBA 2XAUA 4B9TA 3Q0WA 2X1AA 2IBKA 1RTDB 3RW7A 1IBKJ 1CS4B 2PMWA 2XEXA 4LSLB 4LMYA 1XERA 1S29A 1YQHA 1X1DA 4U7CA 5EGOA 1E3OC 3HOTA 3TZYA 2ZD1A 1DQ9A 1HHSA 4X66F 2DGQA 1WHUA 3W8PA 2YNHB 1YO5C 3D3CJ 4N9HA 1QBJA 2E7XA 5IQ6A 2K9MA 2HQCA 2QQBA 3VPRA 4N0BA 2V34A 2ROEA 4CM2A 3IBFB 2X9DA 2AYEA 3IA0A 4FBTA 3HYIA 1R4NB 2L9WA 3NBPB 1AZSA 1Y0HA 4LJZF 2E5JA 4O5VA 4CO4A 2Q43A 3E01B 2C3MA 2SXLA 5C24B 2CJ9A 4XOTA 5IOLA 2ZJRF 3MAJA 4Y15A 4I2OA 1IKXA 1KFSA 3KLEA 3SDEA 4K4WA 4HKQA 1WG5A 3GU0A 3KDNA 2QM3A 3CCES 1HR0J 1CG2A 4XKWA 3D0IE 4IDKA 3ZGKA 2QZ8A 1T0FA 2PEHA 1RBLA 5GAGJ 5GAGU 2ELHA 2C22A 2FZKB 1Y00A 2BM0A 2N3LA 2DA4A 3CCTA 3PCOB 2ADUA 4HHHA 1X4HA 2M8EA 3EYZA 4CYUB 1Z2LA 3OFHA 5IYDJ 1QE1A 3PW0A 5E3CA 2V8DA 2OPQB 4U0YA 4A8WA 4AWXB 1ZTRA 3J7ZI 5HQLA 3O5TB 1KQFB 4UTGA 1QTMA 3GEZA 3DCAA 3V4IA 1ZM9A 3UN3A 1SKUB 5KFLA 2UVWA 3LA3A 2KZMA 5IT9U 1JB0C 2Y0BB 5AJ3J 2M8GX 4FP9A 3QWLA 4C3LA 3H4BA 3KHGA 3H5UA 5E41A 5FLXZ 2V63A 4P96A 3DGVA 2E5LJ 3CUQC 1IZ1A 4RWWA 1B8IB 4XRMA 2EC2A 1PP7U 5HDNA 2DT9A 5DCMB 1WDDA 5C44J 1IDYA 2H4YB 2F7VA 4PXCA 2RE1A 3IMQJ 3J80K 2OC6A 2H9ZA 4DR5F 3BSOA 3KP6A 2OD4A 3BPVA 1NBEB 5EUHA 2CA9A 2VIHA 1OCPA 4X6AJ 3PL8A 5BPDA 4DR7J 2LNBA 4EBDA 4NX9A 4N41A 3D1HA 3DKYA 2HG4A 3KKFA 5EDNA 1O51A 3M8PB 3K70C 5A6WA 3TNVA 2B4UA 4A3LJ 1S0VA 2XAGA 3UCZP 4MQ9F 1JGGA 2RDIA 3GIRA 3TA0A 1WHWA 4ES1A 1RAFB 5F0HA 3MXHP 1FX7A 1PUEE 5KTQA 5C2CA 2IJNA 1T56A 3G1MA 3LP0A 2BOPA 2QQ9A 1TP7A 2ZJRQ 4GVBB 4RLEA 4EM1A 5KG2A 2OP5A 1FTRA 1JUSA 1FOYA 2F5GA 4J9MA 4F2SA 1HL6A 1KU3A 1VDHA 4FXWA 2LU2A 4NCGA 5D0EA 1UJ8A 2YNFA 2F4IA 2DJWA 3LANA 2XHCA 3UR0A 3M32B 3M1VB 3QPSA 3V81B 2OFHX 3L9ZA 4ZYGA 4XLEA 2VQLA 3DU6A 2HGMA 2R4FA 2NVUB 4E7LA 4OINF 2ZUAA 2V2QA 2GQ2A 3JAMK 2KDZA 3L7UA 3TBIA 7AT1B 3CQZJ 5E5NA 5ETOA 4NHJA 1QAJA 1S72S 2X51A 3ITHA 1GTHA 2NNNA 1RTDA 3H3VK 4Z6YA 2ADBA 1NDLA 1CQNA 2XMWA 3D28A 2XSFA 5GAHJ 3CF2A 4W4MA 4U6PA 2VN2A 2ZVSA 3HRMA 1Q5VA 5E1XA 2CQIA 4HHJA 4TQRA 4P5OA 3AKZA 4BHCA 2P5VA 2FJVA 4P6QA 2FHOB 4Q44A 1FCAA 2V4RA 2DDBA 3DWLE 3GJSB 4PWWA 5F3ZA 4ED2A 4YOEA 2UUTA 2VPYB 1E6VA 3D6HB 1IRFA 4Q7AA 1BIBA 1FDNA 3REOA 1HW2A 1MIJA 3K70D 5LJ5Y 1H0MA 1NMEB 3KLIB 4RUHA 1R23A 1FJGJ 3S8SA 4ESJA 3UD4P 3F44A 4MKYA 1MSWD 2DGXA 1WKJA 5DG9A 1DP7P 1Z2ZA 4A8QA 2FD2A 1FC3A 2XB5A 4BEHA 2PEXA 3QWPA 4C6AA 2CUYA 2VV5A 4LF8F 3GFLA 4TN2A 4JI0J 5KFGA 1UEVA 4ON0A 2V68A 3BTIA 3GIKA 2XMUA 3VOEA 1N6QA 3F3XA 3F8BA 4MHGA 2H3EB 1WI6A 2KT5A 1WD6A 3PDNA 4DZJA 4CCJA 4BE0A 3E5QA 5BR8F 4OYXA 1SAXA 1MN9A 3I6PA 3GTOJ 3BDPA 3GSIA 3DLGA 5KFEA 5EDWA 4M72A 2IIHA 2DDAA 2Y75A 2NUHA 1GFWB 1JLCB 3CW2C 4C8ZA 3HVWA 3OR1A 3KLOA 2ZH7A 1REVB 3AQPA 2HQRA 1U0JA 3IBWA 3PKMA 2BY0A 1FNMA 1GXUA 3OFGA 1OJ4A 4IG3B 1BI0A 3JSMB 4EK2A 3GIMA 5CAAA 3R60A 4E8UA 4WXWA 1M5OC 3ZMZA 4IRIA 2RGVA 2BANA 1U5TA 4HQMA 2F65A 2Z30B 2R5YB 4WTYA 4Y7NJ 1RJJA 2NVYJ 1I3AA 3IN5A 3RTRA 4DPWA 3AOCA 4K5RA 1SKSA 2QKMB 2A6TA 3SCKE 5GTHC 1ENHA 5CXTA 5LSLA 5CABA 1WJDA 4ELTA 4JQFA 4WZQA 3ABMH 4NLGA 1HKTA 5A8KA 3A1YA 1EH8A 3FZ2A 2MLGA 4TQSA 1JUPA 4J19A 1IUJA 3EZ5A 1XN7A 1RT3B 1MU2A 5L3EA 3AD8C 2BX6A 2JN6A 3A3PB 4U0WA 4TU7A 3M30B 1CC8A 2NXNA 3QP6A 5JLXA 2ROPA 3EDRB 5HMYA 4UZBA 1S9EA 4Q48A 5KT6A 3HHLC 2AQEA 4E70A 2BDPA 4EEFG 5H1SV 2ZKUA 4X0GA 4KYZA 5DG7A 1SQFA 1R36A 4CLLA 1VK3A 5JHUA 4USVA 1QZYA 2IYIA 4M3DA 3M3YJ 2O6GE 3HSFA 3DMJB 3THVA 5T7LB 4GKKF 4K4SA 1FXRA 3DI6B 1T9XA 5KFBA 1YRUA 1QRYA 3SQGB 2RB7A 1FK9A 2GXGA 2DGOA 2CNLB 2VQFJ 3D68A 3R61A 4TXSA 4CCKA 3TOQA 4EI2A 1IUYA 4HYKA 4B3OB 2Q0OA 3ICLA 4GFBA 4ESBA 1WZ2A 4MGRA 1BMQB 2M4KA 2HKXA 4IFYB 1Q7LB 1ZYRF 2DNMA 2L4AA 3E0JB 2N4DA 1FKPB 4AQYF 3JAMZ 4IXAA 4DFMA 2UUWA 4BC9A 1FIAA 1RAHB 2KU7A 4ER8A 2CUJA 2BE2B 1YGYA 4WBFA 2HHWA 2E2JJ 3KP3A 1VHFA 2A69F 1IJEB 4HNTA 2AQ4A 4QWCA 2KIUA 1FWLA 2KYXA 5C42B 5IT3A 4OI0A 2ZE2B 5L1JA 2IM2A 2COLA 3KP4A 3VYTB 4A6EA 1UZDA 2RQMA 1HLWA 2QFIA 5IT4A 3HJEA 2ZBIA 3IH4A 2UXCJ 4NA1A 4TLQA 3CCSI 2V4JA 4K4XA 3HKZN 2HNHA 3K0LA 4E7SA 3TYTA 1JLGA 1SD6A 3KK2A 5GAHU 1CVJA 1ZA1B 2BXJA 1U5TC 2B7CB 4KDPA 1MJAA 4KGXB 1MD0A 3BKTA 1EKSA 2CFOA 2JH3A 3CMAI 5HLIA 1LNQA 1RWOB 2HTSA 4RGUA 2HK2A 3N6NA 2ESHA 2HS0A 1IXRC 4EU0A 2XUBA 2OPPA 3DLLQ 2LEPA 3OOUA 1OYIA 2ZH8A 3CMQA 2IJLA 4P55A 2NPIA 3HSZA 1K4TA 3FXLA 1RWWB 1KC8T 2Q8KA 2M4MA 2H6CA 3QPIA 3PY8A 3SSSA 5IY5H 1SKWA 2RS2A 5LRRA 2DH8A 1Z6TA 1KHWA 1TUGB 4OV6A 2EKNA 2E9RX 1FDAA 4DOZA 3AA9A 4ED6A 1PSDA 2YWEA 2RAEA 2XYPB 2B5JA 3WE3A 2DIVA 3G8SA 4DSKA 2VKVA 3H7HB 2HZCA 1PGZA 1WF2A 2XYHB 4DV7J 5FDLA 4WIQA 5AE2A 4RM3A 1PBUA 5HLTA 3H35A 4ELVA 2BE9B 3EUKL 1LVKA 2IA1A 3IHUA 2H1KA 3A2KA 3EUNA 4KBIA 3AT1B 2DGWA 4URQU 2D74B 1Y6IA 4P2XA 3DOLA 1R5HA 2A07F 4AM3A 2J0QD 2CW0F 1V3FA 1CJUB 5JHFA 4C0HA 4TKTA 2PFDA 4K50A 2W01A 1SD5A 2W9BB 1J5EJ 3JSMA 2ZM6J 2Y3YA 3AHPA 1XWLA 3QAUA 4CYCB 3GWZA 1S1WB 3HHNB 3KIOA 1OMIA 3C16B 3I31A 1UVJA 1FJLA 3ZXWA 1RKTA 1SMYF 3FXOA 1I94F 3KHLA 2M0GB 4KSEB 3WG9A 1OCZH 1NNDA 1X4EA 3Q83A 2WTFA 1DTTB 3VR1A 3F41A 2XZDB 2WAEA 3ZTOA 3MMBB 2A3SA 3MFKA 1J2XA 1F2GA 4J9QA 1TK0A 4K0KF 3M8QB 4JI7J 2RHQB 8RUCA 3IAS2 5A8KB 2NYXA 2EJRA 4WK1A 1TP4A 4WFAQ 3F73A 4B48A 4C97A 1T08B 1NK2P 3JAMY 1IBMJ 4F2RA 4OU0A 1P7JA 3TJAA 5EG0A 8ATCB 5LSOA 5CZXA 1N33J 2VQEJ 3OYNA 3L1PA 1NJWA 5IM0A 5CHCB 1HI8A 1SD7A 2KVQE 1HNWF 2G13A 3A3NB 4ECQA 3RKYA 3M9NB 2ZZNA 4M74A 3RAXA 3DMJA 4IQXA 2CMPA 4EO6A 3UVJA 4ZP8A 1BOAA 1XR7A 1IXSB 4I02A 1DAXA 2QMWA 4OI1A 3IP4B 2XAQA 3WHIA 1X31C 3K1NA 4USTA 1V55H 1UJ4A 4M63A 1IWAA 4X2BA 4FKYA 5AE3A 4Y2KA 1GVDA 3MFHA 5ED4A 2UXBJ 2J9DE 1C4CA 4USWA 3NRVA 3V8JA 2KKOA 1RTJB 4BAYA 2CQNA 4J9OA 1TV6B 2F9JA 2B6AB 4DR6F 2PX9A 1R8PA 5LJ3Y 2CQBA 1R5GA 5HOOA 1RISA 1F9FA 4KTQA 2GZWA 2QSGX 4MFBB 2VQFF 4HX7A 4MFEA 3U1MA 4NYPA 2OPPB 3VV2B 4G12A 5BPIA 1FXLA 4OHYA 2RILA 3BO3A 3MAHA 2CIMA 4QPOA 3ETOA 4ANEA 1RAAB 4L5IA 1YJ9I 1RT4B 4AUXA 3FXQA 3T9NA 5DJBA 1VQ5S 2CQ7A 4L9TA 1B99A 1J5OA 2WB1A 2VFRA 1WJCA 3MVPA 1VISA 2C2OB 4B9SA 2W4PA 4B3TF 3V6KA 1OY8A 1R0AB 1JJ8C 2VODA 4ES2A 3CCJI 4KFBA 2GVZB 2GIFA 2Q2EB 3QAEA 3D0SA 2JSCA 4IX7A 1MSEC 3PQJA 3OR2A 1B7YB 4IOCQ 3E1SA 3H20A 3CC7I 4ZITA 4C2MA 1U0SA 2YWGA 5FJ4A 2DOEA 3LW5C 2W8KA 1FSHA 1TWFJ 1BW6A 4L72B 2K4JA 4Q2MA 2R7WA 2IVYA 2YWFA 4YFKF 1Q0NA 2PJRB 3HXLA 3DBLB 3MEKA 3W2WB 5EN1A 4AVPA 1QZZA 2XRLA 3DDIA 3H5SA 3AJDA 4DQRA 1MDMB 1B9NA 2VBWA 3AG4H 1T39A 1SFEA 3TRGA 1DHMA 2E34A 3LAKA 4RW6A 3JRDA 3P5BP 1T03B 5ERIA 1LNWA 1XDUA 1NAQA 1TNTA 3SDEB 3RI4A 1P1TA 3AL0B 1KRPA 5BS6A 1U2FA 1V3SA 3L2UA 3VYUB 3BR0A 2LQBA 5I42B 2HNDB 2E1PA 4LF5J 2JA6J 3ZTSA 4NC8A 2VIXA 5JMNA 4QCLA 2E44A 4LF4J 2J8SA 4S0HB 1GMVA 3HTUA 1FRJA 4F04B 3EYYA 3NGKA 3SZ2A 4YFXF 1UFKA 4AIKA 2B5JB 1IW7F 4ZH4F 3MEDA 3KLGB 1TBXA 2RDJA 1TQLA 2DTZA 4P52A 3M4XA 3NMRA 3FDSA 2RMLA 4DF4A 2QA4G 1ZELA 1G3WA 1V4RA 2X6XA 2M70A 3C15B 3BZKA 1OKRA 4ZIWA 3MM8B 2ZITA 3A03A 2Z2YB 2I5JB 4RAFA 3H0PA 3UWTA 4ZLLA 1H89C 4TY8B 4QIEA 3MDFA 1YRTA 2STWA 4E4HA 5KAIC 4IKAA 4PSWA 4FPRA 2VPWB 3GV5B 3Q8YA 2DYSH 2XGEA 3MUVP 1HXDA 5IYBJ 5ADZA 2YNGB 3OTDA 2BQUA 4Q45A 1S4FA 4I64A 1RB0A 4RLFA 3CCLS 1JMTA 3M32A 2BYCA 1YJ9S 3HX9A 5ETRA 3BTCA 1U25A 2QLXA 4IRCA 2DMTA 4Y3OA 4KO0A 4LIVA 2LF7A 4CIOA 3GFMA 2EK5A 1KQ9A 2YR2A 3TZXA 1RZ4A 3KEOA 3A8JA 3NGRA 2GBYA 4U95A 4GXOA 5CCLA 4DS5A 1ICEB 1FA0A 1FBQA 5AXLA 4CNZA 5K8OA 2LYVA 2K2PA 3F6OA 2M34A 2CGPA 1D8ZA 2DY9A 4FE7A 3QGHA 1FY7A 2E1AA 2ZH2A 3CJKB 1ZTTA 4AIHA 1JKQC 2VDIA 3IKVA 3GFZA 3CTAA 3CJTB 1UKUA 2X1EA 1ZRCA 4Q2LA 2G0EA 3H9QA 3ENVA 2Z3YA 4K4VA 4NLVA 4WE1B 3ILJA 1WF0A 3CPWR 2YY3A 4FDFA 5HLHA 4JI5J 3GG0A 3OV8A 3M8YA 2M2BA 3ESWB 3CO6C 3CMES 2IHR1 2V0NA 3QGPA 1XMOF 3UD3P 4PK4A 1XDSA 2QA4I 4G1QA 2CPYA 1M5SA 3M2RB 4O4GB 4FISA 2XBPA 4X65F 5M3FJ 1LK7A 1E6YA 5K14A 3PXGa 2GC8A 3T6JA 4K2XA 3OLAA 2W2PP 3D5MA 2ZSIB 3VWSA 3MD2A 1TAQA 4HBLA 3W8GA 2J6UA 3OSFA 2YBVA 2XHKA 3FKJA 4M5KA 4MT1A 5EWFA 4KT5C 2GAGC 5HP1B 1YTYA 1BLUA 5HBMA 4YB7A 1A6QA 4P10A 3CJ2A 4EM0B 3JR9A 3BDEA 3ZZOA 2WTEA 2FQQB 5KOXA 3CDAA 1ZHFA 5GP9A 3RTVA 3EUAA 2Z16A 3OL9A 2WVBA 4G7HF 3UO0A 3LQQA 3HOXJ 2JLFA 2DVIA 5M2PA 3W65A 2H5JB 3HXMA 1BY9A 1X8DA 1J5OB 1D1AA 4QZVB 1YJTA 2HGCA 2IM1A 1IXCA 4PQUB 3G6YA 2EPIA 2KHMA 4AVZA 3Q8PB 3DV8A 4BQAA 1UPPA 5T14A 4JYKA 1RLDA 2EIMH 4U96A 4AD9A 2DA3A 1HCRA 2P6SA 1UHWA 3ZQQA 2VFUA 4D0PA 3TL4X 4LG0B 4CLKA 3EXCX 2DBBA 4L9VA 2B6AA 2ZZMA 4WE1A 2ZSHB 1FSEA 4LB5A 2DT5A 2FZGB 1S6OA 4PKDB 4LF7F 4O0IA 5BXIA 2DOFA 3PM9A 4YR3A 3L3CA 4IOBA 3TDZC 3GTPJ 1F3FA 4GDFA 2DJIA 1YLXA 2C2KB 4Y33A 5KFWA 1KTVA 3CGIA 2ERRA 2TDXA 2F9DA 5CYMA 1W36D 4IFVA 3ZMVA 1RZMA 4LK0F 2RKIB 1XGOA 3MEEA 3RDIA 2JWNA 2W4DA 1S7IA 2B51A 1SJRA 3O2PE 4OI2A 2XKOA 5D0HA 3D54A 4KO0B 3MCZA 2V4QA 2EFOA 2C28A 1B0TA 2I38A 2MTLA 2MB0B 2YX4A 2AIRB 3MOJB 3UN2A 5CH7B 3G1OA 2AEFA 4O3SA 2MPUA 1WSVA 3GYXB 4RNHA 4NC7A 5F1JA 2MH2A 1S9EB 3V6JA 1EJ9A 1MMAA 1KN6A 1JJ4A 3BF4A 4XM3A 4C2MJ 4DV3J 4ID5B 2YPZA 1MLAA 3MM6B 3T19A 4DEZA 1RKJA 1YX3A 5DS7A 3NNHA 2XZWA 5J47A 1U47A 3K2YA 2KHCA 3KP5A 3S2DJ 1RP5A 3QGIA 4NPOA 5IP6A 1VQNS 4Q5VA 2WVFA 4KIFA 4LLNA 5E33A 3MPWA 2IXSA 1YJWI 2FMYA 3N97A 2QIFA 4AIDA 2KJCA 4MTEA 2LA6A 1J59A 4C4WA 4P7TA 2JRTA 1G2EA 1HWLA 4YHHF 1ZRFA 4WTOB 3R5JB 1DGWY 1S0NA 1U2WA 1R8AA 1HA8A 2X4HA 3U1KA 1D3YA 1WGXA 3J7ZT 4LR9A 2ZFWA 4CNYA 3TAMA 4TV7A 4RW4A 5D77A 4GRSA 4U8YA 3FIWA 4BNCA 3HULA 5TJJA 3IO1A 3H0GJ 1RIOH 2ZDOA 2J7WA 5KT7A 1U49A 4KT6A 1LQ1A 1CLFA 1VGYA 2QX0A 1G1XA 2V9VA 1FRMA 4JOUA 2R5ZB 3WQPA 2B9EA 3T1HJ 3L7PA 1CGPA 3DLKA 2KG1A 1UZHA 1BWVA 1ELOA 2A1BA 4XOPA 4MK7A 1U78A 3OYDA 2GJ2A 3N28A 2W25A 1S48A 4HL9A 1O3TA 3EVMA 2OMLA 3CUOA 1J5YA 3O8WA 3ZZUA 1WFXA 1UMJA 4LFCJ 1QVUA 4J9PA 1R1VA 2IYGA 3HBLA 4MK8A 2KVIA 3K89A 4NWBA 5IWAF 1D1BA 3MURP 2FVCA 4X4OA 2CZVC 2KFNA 2EEYA 1EX8A 1HQUA 2V1UA 2DPDA 4F52A 5E3QA 3UDCA 4UUVA 2DT7B 3GTQJ 2BVMA 2C1EB 1NSAA 4LIUA 4HX4A 4A47A 3CCUI 3TMOA 1EKEA 3WU0A 2HRYA 2X3DA 1TQIA 3GFYA 1YRNB 5KFNA 4CLPA 1VQOI 3T1BA 1JKPC 1S6QB 4UVCA 1Q7YT 2Y9ZA 3A02A 3VYRB 3H36A 1OLTA 3S2HJ 1IQZA 1X4OA 4KV8A 3SSRA 1D0XA 3RKQA 3V7CA 1H88C 4IHVA 4YELA 2IGMA 2C2MB 3FZVA 3CJRB 2OTLS 3GJTB 2YPYA 3K1MA 1B64A 2XG8A 2VOOA 5ETLA 1X5OA 2LA4A 3MMCB 3A8IA 4I0AA 1Y1VJ 3AG2H 2LY9A 4FNHA 4MK9A 3ELHA 1I39A 2PMZN 1Q8LA 3CJSA 4A3BJ 3CCRS 2YH1A 1LW2B 4DSIA 4UY8T 2CU7A 1OQ6A 1RT2A 4IQJA 2NXUA 2P4WA 4M5MA 5BJRA 3SV4A 3DPTA 2Z58B 5D3GB 2LYCA 2MJUA 1P9QC 2KM8B 3HRUA 1YJVA 3M9OB 3D6TB 2E5NA 5EEGA 4HQEA 1ZBTA 4XLHA 2ME0A 1TKTA 1ZM2A 2L4MA 1T3NA 1OSDA 3H8YA 3BQYA 2DT6A 4A3KJ 4CO2A 2OFGX 4IF4A 3BR1A 2PSZA 2XMKA 5AXMA 2LLZA 2ZMEB 4IHTA 5G4DA 4E2FB 1HBOB 2FLOA 2UV8G 3A01B 1UEUA 2OZUA 2ZH6A 3OIQA 4KHMA 5H9EK 3FHZA 3DFGA 5KVRA 2BJEA 3GONA 1FX4A 1V3RA 1XGNA 3W2VA 1LWXA 3QU6A 3MMBA 4E7IA 3H40A 3E5UA 3PW4A 1M1KT 3PIOQ 3H5XA 5A2QK 4ITSA 1UVKA 2VHGA 1IKYB 4II3A 3MM5A 4EUVA 3NS6A 4YY3J 1I6JA 4NNJA 2GQCA 3U7JA 4A5MA 2OUMA 1LWCA 1SL1A 1RNLA 5ETKA 1Q1KA 3QZ7A 2XYGB 1A7GE 3ZTRA 1ON2A 4ZPWR 2ZBCA 3CJ4A 1X9SA 4I0WA 4DR1J 2LKSA 4C0OC 5LMNJ 4X4NA 1RT4A 1GMWA 4V19X 4R1HA 1PJ5A 3HT3A 2M7BA 3FXMA 4FE4A 2HWIA 3HHLA 2XGCA 3MFIA 4Y52J 1RCXB 1W5TA 3OYFA 4D5FA 3MKLA 3I0SA 2OCEA 1XS9A 4ECZA 1VQ9I 2CSOA 3IWLA 3I56I 1B8IA 3CF5F 3CNQP 4IO1A 4CWBA 4I6YA 1WWHA 4I4BA 5J2MA 1P1LA 5A76A 4XAKA 1FPQA 2CNOB 3QBCA 3WC2A 1YITI 1MWZA 1ODDA 4A8XA 1E17A 2CPZA 2W7NA 5DQGA 2CQ1A 4LSZB 1S97A 4HLYA 2HAFA 2VG7A 1I6XA 3DRYA 3TP0A 4DFKA 3FM3A 2AGOA 1OYEA 3KNAA 3A8EA 2KYZA 4XKCA 3PRVA 1RAIB 1O3SA 2CQHA 4QSHA 3IC1A 5A6PA 3ZCOA 5H9FK 1W25A 3HDSA 1W1WE 2KJWA 1RYRA 2JOQA 2CV2A 3FEYB 2XCPA 1UVLA 4JI1F 2BKPA 3BGRB 2YWHA 3RBZA 3G8QA 3QIPB 3EPZA 1LQ9A 4FTHA 1RT7A 1RLCL 4NE9C 1HKAA 2L9DA 1USSA 4YUDA 2GWRA 2VKHA 5L39A 1SH0A 3BP8A 4FS2A 5L3FA 2FOKA 3QQCD 3O3KA 2R5YA 1IAWA 1Y8QB 3SCIE 2Y31A 4A6DA 4O4RA 4DV2J 3E6MA 4A93J 2VDHA 2CQQA 3DP7A 5HANA 2AXLA 4NA3A 3LGHA 2AX0A 1BM9A 3ZRGA 4ZJOA 3BJOA 4LSNB 4YIFA 2R3VA 4X64J 2IA6A 2AJ1A 2MKSA 4GC6A 3G82B 2BEOA 1W5CC 4M6YA 3DEEA 2HFSA 1W4MA 2C3YA 1PJRA 1R7IA 5D4PA 2STTA 3TQEA 1WG1A 1Z0XA 4KH0B 4B9UA 5FLVA 2HHQA 3U1NA 4ZK7M 4JI3F 2G9WA 3AXKA 2DA2A 3CMAS 3W6KB 5DDPC 2HGNA 2GFFA 2C3PA 5F0UA 3MM5B 2KLOA 3DLBA 3K69A 4PJ0C 3DXBA 5AJ3F 2RQCA 3MUMP 2NPFA 3DLEB 1VBZA 2A61A 4MKVA 1CJTB 1RBAA 1KLMA 1WJ9A 4L0ZB 1IR2A 2Q1ZB 3A1YG 2AJ0A 3BZCA 2DA1A 4W97A 3PRDA 2DFFA 4KPYA 2EH3A 2AO9A 2XF6A 2P9CA 3TP3A 1EKRA 2W4SA 2HVRA 3QRPA 1RT7B 4DSLA 1N88A 1XSVA 4DHVA 3CCUS 2VUMJ 1D9DA 2JL9A 4JV0A 5CQEA 1G3YA 3PEHA 3WTXC 2PJRA 1Q95G 1HNZJ 4X4VA 4EGYA 2MSTA 4OIXA 1IXKA 4F02A 1NK7A 1GXLA 3TX8A 3MR5A 4QQBA 5DV5A 4HDUA 1DTQB 4AXIA 1HHQA 1B72B 3CC7S 2DK5A 2LQ9A 2IAIA 4GYGA 2CG4A 4L9NA 5HS9A 3OIOA 3L2CA 4HPQA 1V5GA 2WRMA 3WX4A 5KG0A 3A8KA 4QR0A 2UU9F 3RPUD 2W24A 1JLCA 1IM6A 2CNKB 5J1YA 2J9CA 1GDTA 1T9YA 6FDRA 3M2RA 4EEYA 1XMXA 4DV1F 4O0NA 3G6VA 4HNUA 5IT9Y 2KG0A 2K7KA 4PG6A 4RAYA 2VT3A 2D9PA 3PO3J 5E17F 2WVEA 1O7LA 1FRIA 3HL2A 2IRFG 1N6QB 2VOPA 3Q0VA 3R27A 2UXBF 3U1LA 3SFUA 4AE5A 1ZA2B 1IKXB 1ZM3A 1Y11A 1EJ7L 2VL1A 2E60A 2VBYA 2BE7D 5LXRA 2XGQA 2JLGA 1G2HA 2KO1A 4I0BA 1O8BA 3K4JA 1DRZA 5LRSA 4PR6A 3Q8VA 1OWXA 4R0JA 3LL7A 1ETVA 4QWDA 4B3MF 2W7AA 2PMZD 1ITYA 6FD1A 2UUBJ 2EQRA 3ET6B 5KG4A 3FXJA 2MY8A 4HLBA 4I68A 2CJKA 1KWMA 1S49A 4CHUA 2CW7A 2HU9A 2LR8A 3OY9A 4CO1A 1FRHA 4BXUA 5T7LA 1CQTA 1DFDA 1APSA 4LFBJ 1N77A 3HI9A 4I6AA 1R43A 3C2HA 3ERMA 3DRRB 3CDEA 1KU9A 4DS4A 3I3LA 2HNZB 1IRZA 2KJVA 1Y0UA 4ID8A 1S3JA 2BW3A 2GIVA 4JBCA 2YKMA 4DPTA 3PACA 4CYUA 3QT7A 1DU6A 2FUG9 4JI0F 3ZZYA 2GZOA 1GLNA 3H4DA 2NYHA 1HKSA 1QJHA 2W84A 4TYBA 4ANCA 3AOBA 2M4GA 3W9HA 4ZCIA 2R9LA 1KGSA 1T6SA 3TA1A 3ZMUA 1VRUA 5A8RB 9ATCB 3MR2A 5EX0A 2X1BA 1FT8A 4EJOA 5IC6B 4YR2A 2WAQN 2Y69H 3RZAA 2RQQA 4QWAA 2JFKA 3POTB 2HHSA 3RB3A 1YX2A 1U1MA 4C2UA 1DTTA 3F8NA 2JRMA 2WY7Q 5CZVA 1FKPA 2HYIB 3VSKA 1ZG3A 3CJTA 3MTJA 3UPFA 1K47A 5HATA 2X1GA 3FMSA 3MEEB 4QIGA 2V94A 2AJQA 3GZ6A 4NRTA 2XWYA 4XDDA 1F2HA 4RUBA 2JQ7A 2R7SA 1U0HA 1PYOB 1TL5A 2BXYA 4B09A 3SEOA 2ZKTA 4IJAA 1UAAA 1H73A 1HD1A 1XN9A 5CJ9A 5EHHA 5LHIA 4J9KA 3H42A 3EGWB 3PEJA 3ILLA 1U9OA 2MZTA 5LGNA 2E36A 3CCRI 3N79A 5IV4A 3NGUA 2FBIA 2CQCA 2LEBA 1HNXF 3PHTA 1J7KA 4O3RA 2HLUA 2DI3A 2HHPA 2I8DA 3B6AA 3OYGA 4OYPA 2BJ7A 5IQQA 3A4TA 4ZVRB 3S32A 4Q43A 2JPCA 2K3KA 3C6TA 3THPA 4CCMA 4XN0A 1FDDA 3P3DA 1C0UB 4LG3A 1K6YA 3CDIA 1M1HA 2LLKA 4X64F 5KFQA 1EQ0A 2K27A 5C4XJ 3TR5A 4UOHA 3TAMB 2MSYA 4G7ZF 4DZPA 1IBLJ 3M8WA 2DYAA 5GADI 4DDFA 3Q2TC 4ANJA 2IBDA 5HL7Q 2AW0A 1FJCA 3DRXA 3W2AA 3IWFA 2VKRA 4DLGA 3J81K 2G2OA 2HW3A 3LFUA 3V4IB 5HP1A 4KISA 2FA5A 4DR6J 2VZ9A 4RBTA 3C19A 1JLFB 3W64A 1PYTA 5GMEA 1TKXB 2NSCA 4L75A 2IC3A 2B4VA 4A8FA 1S7HA 4Y17A 3ROUA 5HNHA 3C6UA 2YX1A 1RWNB 4LRFA 5F9NA 4OX8A 1D1CA 2QA4S 4X84A 3NWGA 2MC4A 3DOLB 4JUZA 1QPMA 4NLQA 4UUSA 1NSQA 3NXZA 2R2SA 3RR8A 3LPYA 4PG8A 1KONA 1Y8RB 3FHNA 1JLAB 3CJ3A 3LSJA 3BLYA 1I5ZA 4DSFA 2ALZA 4IR1A 1KQKA 4ZPBA 5GADU 4DR3J 3D4JA 2DITA 3O6BB 2EIKH 1SANA 4K7QA 2WONB 3LSIA 2CQ2A 1NDCA 2VF3A 4WWCA 1T7PA 3NGTA 2DFIA 1VNDA 2BRLA 4WFBQ 1VC5A 1K79A 1NK0A 1NJXA 1YJRA 9ANTA 1ZKGA 4DR5J 1IJFB 3FBBA 2M3AA 2EFGA 3GUDA 1TL7A 1ZK8A 4B9MA 5L1IA 3RZOJ 3ENWA 3GV8B 3K7AJ 3MWBA 5HO4A 4M95A 3D3BJ 3DFEA 1I94J 2FVRA 2DJNA 2OBPA 4A8OA 3E51A 4HSTA 1Z6RA 2L48A 2ZH9A 2EIJH 3TKYA 1LJ9A 2WY8Q 1AFJA 2B9WA 4C98A 2R8KA 1RAGB 1BQNB 3DHWC 3GV7B 3W3SA 4CZCA 5J8CA 3JSOA 3IP0A 2XGXA 3M6VA 3QFWA 2MY7A 2JTVA 4FT8A 3CUQB 4ILLA 3VSLA 9RUBA 2ZOFA 5KFRA 4DL5A 2L3MA 3RQ4A 2Z2SB 2L2OA 2ID3A 4BL0B 3MKYB 2J9DA 1VQ8I 4XK4A 2HKOA 2XLKA 2R2RA 4BXXJ 2OSQA 4IRKA 4UUXA 2XO6A 2HWHA 3RJMB 1T05B 3WTTC 3FM5A 2HBRB 4RGSA 2BUNA 2JEFA 5JVTA 1RYSA 2HHHJ 2JMWA 3JXOA 1UA0A 3VAKA 2CDRB 2VL8A 3P8BB 2DR5A 5J2QB 2HHUA 1ZM4A 2XPWA 4DNCA 3V4GA 3SCLE 1ETQA 3FF5A 1H7XA 3AD7C 2BM1A 4K2EA 1BD6A 1LE8A 3QQAA 2UU9J 3PYGA 2D1VA 3B54A 1OCRH 1WG4A 1KLNA 2VJUA 3E2EA 5L3DA 3IAS9 3OFEA