2CG4A

Structure of e.coli asnc
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords REGULATORY PROTEIN ASNC
publication title Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cg4A01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cg4A02
3ZN0A 4LJZF 5H6RA 4WXCA 1F5TA 5AIPA 1V3FA 1BM9A 4KIFA 2EFWA 1ZN2A 1LDKB 2GQQA 1BC7C 1Z9CA 2COMA 2D45A 5DD8A 5H6QA 1TQIA 4A6EA 1T98A 3CO6C 3GXOA 5FO5A 5ILVA 3HUGA 2EJRA 1J5YA 1LQ1A 5AIQA 1BC8C 2IT0A 5LRSA 3K0LA 1LDJA 5FFXA 3GFMA 1B4AA 4ESJA 2E1CA 5BPDA 3E6BA 1YS6A 1UB9A 3BPVA 3KP5A 4U7BA 3WTSC 1Y0UA 1KU9A 1E2XA 5L3CA 4I98B 2L4MA 4EM2A 4CXFA 1YIOA 3BP8A 1F4KA 3TDZC 4RB2C 4HZFA 2A68F 4HV5A 4KUMA 4ETSA 2STTA 3RKYA 5D5XB 1UHWA 4M6YA 1IUYA 4A5MA 1T39A 2D2WA 1J7KA 3E6DA 4UV9A 2VBYA 4IHSA 5TJJA 2DK8A 4FX4A 5L3GA 3K1PA 1W7PD 2PLYA 3VODA 1ZLKA 1BN5A 2PFBA 3L00A 2VN2A 3M8EA 3TQNA 3HIFA 3L9FA 4G9YA 3WE2A 5D5VB 3I59A 3IRQA 3O6BB 3TOAA 4L18B 2IVMA 2Q0OA 1XSDA 1J9IA 4Y15A 3HSRA 3G3ZA 3P7NA 2A07F 5LBQA 3WTZA 4MEYF 2CVIA 5ILUA 4M9ZA 4RAYA 3Q5FA 1YLFA 1FBSA 3DF8A 3E3VA 1S7OA 4EVIA 2OA4A 1FC3A 2JSXA 2V1DA 2LSOA 1GVJA 2JRTA 2Z4PA 2J5PA 2KJCA 5K1YA 1RUOA 1YTYA 4CO8A 2EV6A 1SD6A 5BS6A 2WWYA 2BBYA 1HBXG 3KP2A 5KK1A 1BIAA 4GGGA 4OU0A 2DW4A 2E1NA 4YFXF 2BE5F 1IXRC 1WWXA 2IJLA 2HOEA 4HAMA 4KT5C 4LLNA 5HS9A 4L9TA 1U5TC 1J75A 5D4SA 5CVIA 2XKOA 4WCGA 3QOPA 1RIOH 3CUQB 2ZBCA 2F2EA 4IRGA 2YSRA 4KNYA 2QQBA 4BQAA 1DPRA 4HQEA 4PDKA 1ZG1A 3KP3A 3ZMVA 4NB5A 2HTSA 4H0EA 4MQ9F 4BHPA 4LB6B 3E5UA 2P7CB 4KMFA 1R36A 2FSWA 3WGIA 3VOEA 5ERIA 3J80K 1ZGAA 1WSUA 1ZG3A 4KIGA 1ZRFA 3R0AA 4ESFA 4AWXB 3ERED 2FRHA 2IA0A 4UNOA 3S2WA 5L3FA 3M1EA 4HF0A 3W6KB 1X3UA 2QWWA 4O5VA 3TGNA 1FP1D 3REOA 3CLOA 3FHZA 1Z1DA 2EFOA 4KIBA 5CVUA 1B9NA 4EGYA 3GFLA 2P5LC 3RYRA 2L3DA 3I0TA 4RB3C 3ECHA 4XLPF 1FLIA 2DTRA 1ZGJA 3V8JA 2QBYB 1TLHB 4ZYDA 5HLGA 4XSZF 3J7AO 2QVOA 3EYYA 4Y13A 2VXZA 3I71A 5FD6A 2K4JA 3D5LA 4CGZA 4MQVA 4A2UA 3M7GA 4M9SA 2NAZA 1IN4A 2H6CA 5E1ZB 4GXOA 5E18F 1B59A 1MDMB 3TDUC 4R1HA 5ICCA 1W4MA 4M6XA 2VT3A 1ONVA 5HS8A 4EJVA 2VBXA 1KYWA 4A0XA 3T1BA 1ZREA 3DPTA 2F5FA 1PUEE 4ZYHA 4FT8A 3K69A 1Z7UA 5BOXA 4EJWA 2DQRA 4EM1A 1LDDA 1W5TA 3BJAA 2DU9A 5LHGA 3SXYA 3F21A 4ASNA 4BAYA 3RI4A 4PGHA 2FMLA 4BNCA 1U5TA 2FU4A 1LB2A 2PJPA 2FBKA 3IKVA 2A5YB 3F8BA 4HV6A 3ULQB 2G7HA 1KQ0A 1KA8A 2NS0A 3HTSB 2DBBA 4LK0F 2UXNA 2DFIA 3AAFA 3V7CA 4Q4ZF 2EA2A 5DUKA 4ENMA 3N4MA 2G9WA 1A04A 1ZARA 4I0AA 2H27A 3FXUA 2KRFA 4KN4X 2F5EA 1FY7A 3GFJA 4OIPF 1O3SA 3HSFA 3KEQA 1P6RA 1FBUA 4DNCA 2OZUA 4MHGA 4Y17A 4L0YB 2WV0A 2A69F 3PQJA 4BHBA 4PZJA 4Q48A 3K2ZA 1IAWA 2F5DA 4XRFA 3I5UA 3CDHA 4HDVA 1J59A 5FGMA 1UFMA 4PGGA 2O61A 3RYPA 2EFNA 1XD7A 1R1VA 1XGNA 3OOPA 3QAHA 2AS5F 3LQQA 2FOKA 2L4AA 1C0WA 5L3EA 3SHFA 1L3LA 3TOBA 4YFKF 1B9MA 2TDXA 3I53A 5DYMA 4EQQA 2Y48A 3K1MA 1AWCA 3KFWX 2QM3A 3I58A 2ELHA 1YW7A 2PN6A 3DKWA 3ISPA 4ZH4F 4OIOF 2EA4A 3O2PE 1B1BA 4BH9A 3KP7A 5D5UB 2LF8A 2PEXA 4EJOA 4RB0A 1FZPB 1ZYRF 1K78B 3QPHA 2Z99A 5FFZA 4IRIA 3EYIA 5CJ9A 4P96A 4GYIA 2BGCA 4KDPA 3RIRA 2JSCA 3HSEA 2M1BA 4RB1A 4IVNA 2W57A 1PP7U 3GF2A 4O6JA 1FX7A 3FZVA 4EJTA 2IA1A 1REPC 5D8LB 1FSEA 3GZ6A 1IRFA 4L5IA 4S04A 3I64A 3RKXA 3WTXC 5F6FA 5LGTA 2IPQX 2CW0F 2XV4S 1YG2A 2DK5A 5JHUA 1G3WA 1R5HA 2NRAC 4KMUX 5HVQC 1FYKA 2IA2A 5L3BA 4L9VA 4OIQF 2GZWA 1BI0A 2ZMEA 3SZTA 2GA1A 2MBFA 4ON0A 3KP4A 4JQFA 3SFZA 3BDDA 3NRVA 5D6EA 2IP2A 2CWEA 2P4WA 1SFEA 4YIFA 1D3YA 1H0MA 4EMSA 2O0YA 2K7LA 4AIJA 2EV0A 2HQNA 5BPIA 3RTRA 1Z91A 3C18A 3IWZA 1HKSA 1EH7A 3F8CA 3V7SA 1H9TA 1HSJA 1ZH5A 5HLHA 4MTDA 3L09A 1IN6A 1KQ9A 2BEOA 4N9HA 3O3KA 5H20A 1GXPA 2P5KA 1I1GA 3MEXA 2ESNA 1PDNC 3P9KA 2G7UA 3M8FA 1I27A 5E1WA 4YIIA 2EV5A 2XAFA 3GW2A 4HOBA 5D4RA 3BROA 1SMYF 4IF4A 4RS8A 2CFXA 3HTUA 3LA7A 1R1TA 2Z5UA 1BIBA 3ELKA 1KU7A 4HX8A 2XUBA 1I1SA 2B0LA 3GO5A 4HA8A 3WTWC 1IW7F 2XKPA 3R61A 3E5QA 1T6SA 1XSVA 3WTYC 3T8TA 2JTVA 2FNPA 4IPAA 1CF7A 2XGXA 4P55A 3KE2A 4A6DA 1O57A 4LK1F 3QP5A 4ZYGA 4CZZA 5ICFA 3WTTC 3PFIA 4KFCA 4QLCU 1XDUA 5CVRA 3GUDA 1O7LA 1UHMA 2BV6A 2CSOA 3MAJA 2QQ9A 3HRMA 1ZAOA 4D0PA 2ZBKA 2EFPA 4CYDA 3FM5A 2O6GE 4EJUA 5TRDA 4HX4A 2XAJA 1T0FA 4XSXF 3ROUA 4MNUA 4DQ2A 2ACJA 4WWCA 1XGSA 1TW2A 4Q5SF 1Q1HA 3I59B 1OKRA 1OYYA 3FXQA 2FMYA 2HFHA 2BYVE 3K9TA 3HHHA 4A5NA 2ZJ2A 1YYVA 4P5OA 3K1NA 2CGPA 3ZMUA 2OD5A 1FBQA 1BJAA 2V6CA 2QYOA 5JVTA 4WXDA 2PMHA 4M72A 1FNNA 5JI6A 1CGPA 1TQMA 3BOQA 3JTHA 2M5WA 4HF1A 1P4XA 1ZRDA 1JHFA 2Y0MA 1QPMA 3WU0A 4LMYA 2FNAA 1T38A 4ZZDA 1XGMA 3IC7A 2QZ8A 3MWMA 3P9CA 2VOOA 3F8MA 3I4PA 2ZNZA 3LQRA 3GWZA 2DO7A 3H3ZA 1ZRCA 4F7ZA 3HYIA 2VT2A 1JE8A 1UCRA 2K4BA 4U0WA 2Z9OA 4UXNA 2CQKA 3C1DA 2ADUA 2RV8A 3RPUA 4I09A 2LNBA 4AIHA 4P9UA 3T0YA 3BZ6A 3F23A 4XBFA 1WRJA 5FLXK 4N9IA 1R1UA 2PBIA 1QO0D 1IN5A 1EV7A 5EEGA 2STWA 3C7JA 3HOTA 1S7AA 1S8NA 5E20A 2M8EA 2PI0A 2V1UA 1SD7A 1YO5C 1LJ9A 1KU2A 1YW9A 4UVAA 1GHCA 2GIVA 4M74A 2Q2EA 3KEOA 2F5CA 3V8KA 2E1AA 4ESBA 3RPQA 2D1VA 1ZLJA 2V1XA 3GYHX 4LLLA 2ESHA 3FM3A 5J6XA 5ED4A 4G94A 1QZYA 2CG4A 3LAJA 1ZG5A 3IRRA 3ZMTA 1E17A 4RGRA 5DCMA 2VE9A 4NHJA 1D8KA 3F6OA 1MJ9A 1IN7A 1G6NA 5K5RA 4S05A 3RKWA 3WTUC 5IT9K 4UVCA 3L2CA 5F1RA 3G73A 1JGSA 1J2XA 1Z6RA 2ZO4A 5FLXZ 1XCBA 2ZXJA 1DP7P 2XAGA 1K6OA 1R22A 2NNYA 1TNSA 5ILSA 2WTEA 2MH2A 5BQTA 4LG0A 1T2KA 1TBXA 5HDGA 2HQRA 1O3QA 3MFKA 5HDKA 3J81K 3D0SA 4P9FA 3ML6A 4NQWA 3JSOA 5ICGA 4A0ZA 1R00A 2X4HA 2P7VB 3IWFA 1ZHFA 3COAC 4LB5A 1TTYA 2KKOA 4OINF 1GXQA 1QQIA 1R5GA 1D5VA 2VC0A 3GEZA 2DQLA 1VTNC 5FB2A 1KGSA 4HLYA 4U7DA 4UVBA 4L5JA 3ZPLA 4LGWA 5FD5A 5DCFA 1KYZA 1S3JA 4TV7A 5IT9Z 3E6MA 1HKQA 2MC3A 2P6TA 4ENNA 3GZ5A 2UWMA 1W7PA 4XLNF 5E1XA 2L54A 4FHTA 1LEBA 2RC4A 2HDCA 1I6XA 2K02A 1PP8F 4G6QA 1SFXA 4L9NA 2FEZA 5K5OA 3DPLC 3J81Z 3R6SA 4E70A 1U78A 4G7OF 4GYGA 2OZ6A 3WGHA 4BXUA 2V79A 4HBLA 2L02A 1U5TB 3FMRA 3RJPA 3DQVC 4M71A 3HRUA 4UV8A 3TO9A 3E6CC 1EH6A 3FMQA 4I02A 4BHCA 5DDGA 4I01A 3R4KA 1SD4A 2MLGA 1WQ2A 4OMZA 2Z33A 5HLIA 4LFUA 2VBZA 1IF1A 3VB2A 1MD0A 1RZ4A 3CUQC 1H9GA 3KCCA 3JTGA 3WG9A 3RDIA 3GLXA 4HLXA 2OAZA 3DXJF 5D5WB 2ZCWA 2GWRA 3KLOA 2VBWA 2RKHA 1G3YA 4YG2F 1G3SA 2R7FA 2HTJA 3ABUA 1STZA 1AOYA 2A61A 1LEAA 1OR7A 3WGGA 1G4DA 1B6AA 1FP2A 1OPCA 1KQ8A 1FWZA 1D8JA 2R3SA 2QUFA 4O3MA 3C3WA 2HS5A 2HEOA 1FPQA 1Z6TA 5F64A 4UHTA 3WTVC 2HR3A 3FMSA 3LFKA 3LWFA 4CDGA 5A2QK 3WODF 2HZTA 3I54A 3U1DA 3KP6A 3JSPA 2MH9A 4RAZA 1DUXC 2YR2A 1K79A 3B73A 1MJAA 1OYIA 5HOOA 1F9NA 5DEQA 2KIUA 1HW2A 2JPCA 4RGXA 3H3UA 2EFQA 3QPTA 4IHTA 4RGUA 1BBYA 3KZYA 2GXGA 2ZKZA 2K86A 2HYFA 3B02A 2A3SA 5K5QA 4OMYA 2LF7A 2V9VA 1U2WA 3F8FA 1SD5A 3ZMDA 3MCZA 3CJNA 2H09A 2W84A 4I0BA 3VFZA 5LEKA 2PG4A 2DLLA 1O3TA 2GAUA 2GA2A 1ODDA 4IRHA 5AONA 2XROA 4R8HA 4ENJA 5A2QZ 3E5XA 3QRFF 3W6JB 3E97A 4QWQA 3BJ6A 2LKPA 2FXAA 2AXLA 2Z3YA 3FX3A 2O8XA 1O3RA 2OBPA 1K7AA 1WI9A 2P8TA 2ZMEB 2P6SA 1P2FA 3QU6A 1QGPA 1MZBA 3V4GA 3V7RA 2OQRA 3R0JA 4R79A 1BI1A 5J8FA 2RN7A 4PCQA 1YQAA 1U3EM 1LVAA 3IHUA 4I2OA 2H6BA 4M73A 4HDUA 3OV8A 3CUQA 2RVCA 3F8NA 4Q47A 3LAPA 3ECOA 2FQ3A 3U2RA 1U6GA 2C6YA 4IXAA 2DI3A 1RI7A 1HKTA 4LLGF 1BI3A 2NNNA 3F22A 4HF2A 1P4WA 3PQKA 3LA2A 2XRNA 5DD4A 1QBJA 2MD5A 2VC1A 3L7WA 3V8LA 2IW5A 1RNLA 3H92A 1XB4A 3QU3A 1JXSA 1WKMA 3EDPA 1F1ZA 3IL2A 2PMUA 4WX9A 1YW8A 2PQ8A 3ZMSA 3N97A 5LHHA 4B8XA 3ZN1A 4HW0A 2QQAA 2R7DA 2Y75A 4Z2YA 1CF7B 4KN7X 3WU1B 2GXBA 3U9GA 1USSA 1DPUA 4JBAA 1IXCA 3HOSA 2QBYA 2XAHA 1XGOA 3EUHA 2XASA 4A0YA 2M87A 1DDNA 3TO7A 4EM0B 2VONA 2P5VA 3M9AA 4HX7A 1U8RA 4K2EA 2HYGD 1FYMA 2W25A 1XCVA 2Q8KA 5BMZA 2WC2A 2A6EF 2JZYA 1MDMA 4U0YA 1S6LA 2W24A 2FBHA 2KIMA 4CICA 2FBIA 3ABTA 3BJOA 4G6DA 4AD9A 1L0OC 5CVJA 4UUVA 1OMIA 5LGNA 2KJBA 1O7FA 1LNWA 5E8IA 3GFIA 3DV8A 2E7WA 4A12A 2ETHA 1P92A 2VOPA 5E8GA 4KYWA 3R60A 2O03A 2HKOA 2QLZA 3VEPA 3KLNA 1XDSA 1R7JA 1P4AA 1RUNA 5D6FA 1TW3A 1HSTA 4ZZLA 2FF4A 1HXDA 1W5SA 3GVAA 4WK8F 1MGTA 4GO1A 2XAQA 3LA3A 5IT3A 5LLQA 5LHIA 1BOAA 3QP6A 4KA4A 1MKMA 1ULYA 4U88A 1QNTA 5LRRA 2L01A 4GCVA 2UZKA 2X0LA 2OU2A 3J80Z 1SFUA 5L3DA 5CVVA 3F6VA 2RGVA 2UXXA 1USTA 4EGZA 1MJBA 3SQNA 4AIKA 2LDUA 1S29A 3LSTA 3KETA 4G7ZF 2XIGA 2DJWA 2KIFA 3NQOA 1YS7A 3ZMZA 1XSXA 1IRGA 5HS7A 2NYXA 3EQLF 1XMAA 3FF5A 1R23A 1BI2A 3DP7A 5KVRA 2E7XA 4G7HF 2XVCA 3HHGA 4IJAA 4CHUA 4AVPA 1V4RA 2D1HA 2ZNYA 4YFNF 3CO7C 3DEUA 1FOKA 3WE3A 2VODA 1G3TA 5LEJA 3DFGA 2W85A 1EH8A 1OYWA 1YFHA 5LGUA 1HW5A 1XMKA 2JPBA 2VE8A 2CO5A 2YU3A 5HDNA 3ZP5A 5EEHA 2IRFG 3FXRA 1JHHA 1XN7A 4EV0A 2XHKA 2H94A 2DT5A 6PAXA 1R58A 3IKTA 3HRSA 3ZQ7A 5E17F 5JFRA 5DV5A 5JR3A 3BPXA 1NHAA 3TO6A 1IXSB 4U0VA 5D8KB 1KU3A 1TNTA 2RQPA 4OOIA 4MGRA 2HKXA 2MLKA 1I5ZA 1J0RA 2M45A 1K78A 5DCMB 1Z05A 2FE3A 2YPRA 3SZPA 5CYVA 3CTAA 2YX7A 2RDPA 2OQGA 2DPDA 4B09A 3Q9VA 3JAMK 4HYEA 3F72A 3F3XA 3TKYA 4G8XA 4WXHA 1FSHA 5DUIA 1HW1A 2FA5A 4I7HA 3EETA 5CLSA 3GX4X 4LG0B 1TQPA 2MA3A 4ENKA 3CUOA 1IN8A 4JK1X 2ZFWA 1SMTA 2M30A 1FT9A 3KZZA 2DPUA 4L0ZB 3T8RA 4N0BA 2J5OA 3JW4A 4L9JA 2ISYA 3MZHA 4FX0A 2DAOA 1IZ1A 2YX4A 4WF2A 4LD5A 1SAXA 5J8CA 2EB7A 4KICA 3BWGA 3NEUA 2ISZA 5ICEA 3JAMZ 2CYYA 2O3FA 4BYYA 3BY6A 1W7PB 2EK5A 4RGSA 3MQ0A 1FYLA 4MEXF 2HWVA 2EWNA 2K27A 3HRTA 2A6HF 4ZYEA 3Q9SA 2JT1A 4M9XA 2HGCA 3FWEA 3T5XA 2RNJA 1HQCA 2QENA 4MTEA 3MZYA 1ON1A 1QZZA 1ON2A 3P9IA 4HQMA 4OIRF
chains in the Genus database with same CATH superfamily
2JRMA 1V3SA 3G8QA 2XMWA 5H6RA 2VUMJ 3IAM2 2FQ4A 1JX4A 1F5TA 4OZ0A 4YMEA 1KHWA 2XB2D 2MYSA 2HHUA 1VQKI 1VI7A 1BM9A 1ZN2A 2AW0A 1LDKB 2GQQA 2HFSA 1NJZA 2D45A 5H6QA 1S77D 2YNGA 3EVWA 4ZVEA 3NOGA 4A6EA 1MROB 2HDDA 1P1TA 3CO6C 4HI1A 5DG7A 2M8DB 5IOYA 3IAM9 1TL4A 3A3OB 3NNAA 1R7IA 3T5HA 4IFYB 1WVRA 4LSLA 3K0LA 3D66A 3GFMA 1X60A 5FROA 4Y2MA 1WNEA 3PEJA 2K3FA 2CUEA 4DLEA 4ESJA 4XIUA 2IS4A 3TI0A 2HPUA 3OSGA 3RTVA 3E6BA 3HMJG 3KP5A 4U7BA 2IMWP 3THTA 1UVLA 3PTWA 4Z2XA 3RRHA 1JLEB 3QJLA 3TZZA 3MD3A 3GBGA 3ELHA 3VAHA 1HI0P 3VPRA 3TDZC 2J8AA 2ZXIA 2R2UA 4CYUA 4K4ZA 2A68F 1FVSA 3RKYA 1IUYA 2M52A 2V4JB 1T03B 2F8HA 2VU5A 4FKYA 5ETNA 1D0XA 2D69A 2VBYA 3OYFA 1TL3B 4TNOA 2DFHA 3LH2S 2HRYA 1S49A 4FX4A 3LAKA 1XR7A 1W7PD 2AYEA 2CV1A 1ZLKA 5EWEA 3L00A 3J7ZI 2VN2A 2RH3A 4NA1A 3TQNA 2HK2A 4QIGA 4DUZJ 3L9FA 2W9BB 2VDHA 2KKHA 2W9AA 1NH3A 3WE2A 2HQFA 2ZE2A 2CJXB 2GV1A 3HXLA 3S3MA 2QT7A 5KNLA 3HG9A 1S76D 2ZXWH 2FC8A 1BJZA 4Q2LA 5DG8A 1RT6B 3OD2A 5KFIA 3Q0WA 1NJYA 2I5JB 3EGNA 2ZBRA 1V6HA 2JQ7A 4QIFA 3IRXA 3G3ZA 2DR7A 1K0VA 4KITB 3KYCB 1K47A 5BXIA 2ZFUA 5ILUA 5D0EA 4RWWA 2LY1A 1R8BA 1FBSA 1EJ7L 4ZIVA 2D3OR 1S7OA 4UOFA 1VQPS 5IOLA 2XYHB 1NO8A 2GQ2A 3OPKA 1G4CA 4ANJA 3BGFA 5IM0A 3E51A 3DGVA 2V1DA 2F3JA 5MAOA 3N6MA 2CNOB 3A12A 1Y0HA 1YG0A 2AJ2A 1T05B 1U6ZA 3D6TB 1RUOA 2LQ5A 2ZH5A 4K50A 5J1EA 3CCSI 3EE3A 2YH0A 1KZHA 4F3QA 5CABA 4MFEA 1E6VA 3X2QH 2VKEA 5BS6A 2WWYA 3NLCA 2KFNA 1H0HB 2P81A 4ZDLA 2DIUA 4P2SA 4M5NA 4B4CA 4RWXA 3IO1A 3KP2A 1VQ6S 4N77A 2MLYA 2DW4A 4DN9A 1HR0J 1N48A 2M9KA 4URSA 1IXRC 1ZR2A 1WWXA 2IJLA 2XS2A 1YDLA 2KMUA 2O67A 1S72S 3DRRA 4DUTA 1WELA 1HBMA 4GKJJ 5HS9A 3P8BB 3HVAA 3KTQA 1OY9A 5IS2A 1U1OA 4DR4F 2RS2A 1J75A 3KNAA 5HBMA 3MPWA 3GJSB 1ZR4A 3H5XA 5B0DA 3QIPA 1RAIB 2BY2A 3MCOA 3CMAS 1IGNA 2RRBA 3PG9A 4RBUA 3CUQB 4IRGA 2L7KA 4U87A 3FDSA 2VICA 2CJBA 4WKRA 1DHMA 3OR1B 4BHPA 1IBCB 2P7CB 3WG7H 4KMFA 2CWXA 2OH2A 4BY7J 1R36A 2Y1IA 3EJMA 3OYIA 1VIXA 4FS2A 3CDIA 4U9RA 4OYXA 2EILH 1JUSA 2KJWA 2FB0A 1FD8A 1V55H 2JUGA 1ZRFA 2E9TA 2KZGA 2R7WA 1N32F 3R0AA 4ESFA 5KHDA 3BTJA 3ERED 2HDWA 1VQSA 3D6FB 5L3FA 3G1MA 3W6KB 2QWWA 4S0MA 4MKAA 2EFGA 4AM3A 3G1OA 3MEGB 3REOA 3CLOA 4N76A 4L5EA 1N54B 1Z1DA 2M9HA 4KIBA 3GTLJ 1B9NA 3L7OA 4P73A 4EGYA 1EKRA 1GQEA 2L3DA 1IM6A 1XTZA 1K61A 4L73A 4TLQA 1ETKA 4ZVHA 5KT7A 4IG0A 3ECHA 2WSCC 4QCLA 2DTRA 2QBYB 1ZK8A 1FD2A 3CJRA 4RW9A 4ZYDA 4XSZF 3QGHA 5F0CA 4JI5F 2WOMA 3DLJA 4IUFA 3B4DA 4Y13A 2MEWA 3BH7B 2K4JA 3I5AA 2XI2A 3D6HB 4WCEQ 3M7GA 4KB7A 4BE0A 1VRTA 3S2HJ 1WC4A 1OPZA 2EZHA 4GXOA 1OS5A 2HOAA 3KK1A 5B5EC 4B47A 3CP8A 1FNXH 3FMWA 2H5EA 4I2PA 3OL8A 1JKHA 2CJYB 3Q86A 1VYAA 2VQFF 3FXOA 5T7LB 2JL9A 2O7OA 3NY0A 5HS8A 4C3KA 3VSKA 4EJVA 3BSNA 2LKSA 3BR9A 4GC6A 4FNHA 1KYWA 2IBDA 5EG0B 1ZREA 3L9ZA 3HSDA 4ED0A 3QFHA 3HOZJ 4DOZA 1PUEE 2JH3A 4DSJA 4QPOA 3B8HA 2B4VA 4DZ6A 4ZYHA 1OY8A 2A05A 4EATA 3Q0UA 4X4OA 1X5SA 2WVCA 4LFCF 4J9UE 2Y9YA 1S1VB 4QU6A 2IC3A 2C2KB 3RQ4A 3CGIA 2V9KA 4J91A 5FRNA 2RKIB 2LEAA 5C42A 2ASLA 2FZCB 3HO1A 4BAYA 3IWLA 1N5QA 4QYRA 3MURP 2FMLA 2LR8A 1Z4UA 4DSIA 4CIOA 3PO5A 1YX2A 3CCRI 3KLGB 4CLYA 5C7PA 2A5YB 4GKKF 3ULQB 1LFBA 4HV6A 1Z2ZA 2G7HA 2HG4A 3OXGA 5KFLA 3PW5A 1KA8A 3FNNA 2N4CA 4LK0F 1SUQB 1N0VC 3V7CA 4OJHA 4Q4ZF 2W48A 4ZP7A 3OFGA 1ZKGA 4C8MA 3FRZA 5CA5A 1LE8B 4C9YA 4CA0A 2LEBA 4QWBA 2F5EA 2I2YA 1O3SA 2LYVA 3HSFA 3TA0A 5EN1A 1YWXA 4WFNQ 5KT6A 3GWCA 1P6RA 1TKTA 3FFIA 1FBUA 1K6YA 1QSSA 4Y33A 2VKZG 5JXSA 2WV0A 3MTJA 4BQOA 2A69F 3MF5A 3GTJJ 3S01A 1UWBA 4KISA 8ATCB 5HODA 2KP6A 2YNIA 2FPHX 1MMNA 3I5UA 1D09B 4E8UA 3H40A 4RNHA 2ZH9A 1QUVA 3G4SI 4PJJA 4HDVA 1IR2A 2UU9F 1KKHA 1LWFA 4G65A 2OELA 1FTRA 1N33F 3OSFA 1LWEB 3QAHA 5L38A 2QLXA 2M3AA 2P9CA 1JKOC 1IKVB 1ZA1B 4LIUA 3RBEA 2OPRB 2W1OA 4DEZA 2HFZA 3SHFA 3JRDA 3M07A 3I53A 3I31A 1WOSA 4EQQA 1FEHA 3IBCB 3K1MA 2TCTA 1AWCA 2DHXA 4R0JA 2MKYA 4G1IA 4NYZA 3VTIA 2ELHA 3O2PE 2HFNA 3C14B 4BH9A 4UUTA 3KP7A 2PDAA 4EJOA 2WBRA 3BDPA 1ZYRF 3DOMA 1K78B 4RLFA 5EDNA 2BOPA 3OTCA 1RT2B 1JLBB 3EYIA 2QLJB 5CJ9A 4LQ3A 4P96A 4QIWD 2ZZMA 5I42B 1R71A 2AYGA 3BPDA 4IO9F 4RMNA 4EYHB 3RIRA 3N05A 1M90T 1QVGR 3SDEA 2QEXS 3HSEA 1D5YA 2ATLA 1U6FA 3R6GB 1WHUA 3JTPA 1FX7A 1REPC 5JVGQ 1U1RA 1CQNA 1WHVA 2MPUA 1IUJA 3CDWA 4TKTA 4S04A 1URRA 1T0FC 3I3LA 2XV4S 4JI0F 1TELA 1R5HA 3AKZA 4OJ1A 1KQFB 5LXYA 2Y0BB 3HJEA 1I3QJ 1EKSA 3DC2A 5KFBA 1FYKA 2IGMA 3LSMA 1XPXA 3M8ZA 2IA2A 2MMYA 5L3BA 3IBFB 1MNDA 4L9VA 3SZTA 2W82A 2QSWA 3DFEA 3OTEA 4CO1A 4NXMJ 4YN3B 2CPYA 4JQFA 2GA7A 4Y0FA 3NRVA 4LJMA 1ZM4A 1BHNA 2P4WA 1R4NB 4B17A 4D7NA 1RRJA 3G2BA 3TMOA 1WH5A 4YIFA 1H0MA 1IKWA 3PW7A 3ZR8X 2EG1A 2HWIA 5B09A 3E01A 2K7LA 4AIJA 3OR2C 4USJC 2AYBA 1TKZA 5BPIA 2YH1A 2Q6BA 3QODA 3EPZA 3W64A 1HDDC 2CJ9A 2B5JA 3ZZUA 1F43A 4AL5A 3HZEA 3R1LA 3F8CA 1F2GA 3LOUA 2X3DA 4QIWN 3HD2A 3FBEA 2XF6A 4IH5A 2WAQD 3QRRA 2O01C 2Y1JA 1IN6A 3R5AA 1KQ9A 1E6YB 1JLGB 4OZNA 3LWLA 2R8HA 2F4OB 5IV3A 3AHPA 4LF9J 4JI6J 2NREA 2AMCB 5E33A 1I1GA 1RAAB 2WY8Q 3M8FA 3AD9C 4BHQA 1YBAA 4BE2A 3KDNA 3ZQHA 1I27A 2NVTJ 1HWLA 2JEFA 4YIIA 1NH7A 2IXSA 2WB1D 3A8IA 2VIHA 2EW9A 1IBKF 5CCLA 1GAOA 5IZHA 2B6AB 1S9GB 3I0SB 1N8RT 1F5BA 1SMYF 4ZP9A 2QO3A 3JRIA 4OL8A 3QPIA 2BM1A 1R1TA 2Z5UA 1BIBA 3V81B 4HACB 2BQUA 3FUYA 2XUBA 1I1SA 3WHBA 2B0LA 2L0KA 4DR4J 2G2OA 4NBQA 1SV5B 4OYOA 2FVRA 3UE2A 1HA1A 4F3OA 2A6OA 1X8DA 3BG7A 2BHYA 1CQTA 3MMBA 3M2VA 4PFOA 1Q82T 3KE2A 4KT0C 2BJ7A 1Z77A 5E3PA 3SV3A 1O57A 4LK1F 2AHQA 2R7OA 3FQLA 3QP5A 2EBGA 3WC2A 2V8VA 3P96A 2B9WA 3NGUA 3GPAA 5CQEA 1DGWY 2YWGA 2ZBPA 4M63A 4A3FJ 4QLCU 5KFEA 1U1MA 4BEHA 4ED3A 4MIAA 2Y2ZA 2BE2A 1RETA 2UXCF 3H9QA 1RT5A 1N32J 2DMNA 3R5JB 4DBRA 3JYTA 5D3GA 2AGOA 4RUCA 2WB1N 2FVCA 2IVYA 1ZAOA 2AXTC 1WI8A 5EUHA 2DHGA 5KT2A 1RYRA 3FM5A 2P0WA 2Y9ZA 5TRDA 1X9WA 1FDAA 4C7QA 1PSDA 4DFPA 3AJ2A 4Y28C 3VVUA 1T0FA 1S59A 1SKUB 2LP4A 1Y39A 1MN7A 1C0TA 3QO9B 1TW2A 2BX6A 1FO1A 1C1CA 1S9HA 1NK2P 2A0FB 1OCOH 2UVUA 2BYVE 2OPSB 5M2UA 4P5OA 3GSIA 3H0PA 2CGPA 2R3VA 4I0WA 2OD5A 3A1YA 1LKZA 3H2VE 2PMHA 4M72A 1FNNA 4ED6A 3NMRA 5B1BH 4QOTA 1TUWA 1TQMA 3OR2A 3D68A 3D0GE 3TNVA 3VZHA 1ELOA 4TVAB 3BSOA 3M05A 4ECRA 1YZ7A 4G6VB 2UV8G 4P1WA 2F4IA 2BHZA 3CCES 4LMYA 4WPAA 3IM8A 2FNAA 3CW2C 1V54H 3GJQB 5E3RA 1EIYB 2E7VA 2HYIB 2QZ8A 3P9CA 5JLXA 2E2JJ 2IGNA 1RCXB 1PGZA 3LP0B 3MCSA 2CQ0A 3T6JA 4KO0A 1Y1WJ 2DGWA 1JE8A 3LNQA 2K4BA 1FDDA 4KGMA 2Z9OA 5KFPA 2ADUA 1DTTB 2RV8A 3CMYA 2VL8A 2KG0A 1RWVB 3U21A 4TQRA 2QTWA 2YKMA 4LFCJ 2E36A 5GPCA 2LNBA 1FCAA 2ZC4A 2HNHA 4KY3A 2M2EA 3H5NA 1UTAA 3IP0A 4IKAA 4CO3A 2FGCA 5E7OB 3KK2B 1K9MT 1UPMB 5FLXK 4DUYF 1BLUA 1GT0C 4HT5A 1QO0D 2IYIA 4IR9A 1RTJA 2JVOA 3KG1A 1X4AA 4GKKJ 2STWA 3OUYB 1AA1B 3HOTA 2X6OA 3CCVI 4F7VA 1SD7A 1YHQI 3UN5A 1AKHA 3QWUA 1S6OA 5D0GA 1R0CB 3DRXA 4RL1A 4WYLA 5LJ5Y 4M74A 1VQNS 1A31A 3V8KA 4ESBA 1FI4A 3GIIA 1AUSL 1QD1A 2OUGA 5BYSA 2WAEA 2MHNA 3DCAA 2V1XA 4LLLA 1XR5A 3I5BA 3JSMB 3FM3A 1U1NA 2E34A 1QZYA 3HSZA 4A8FA 3CD6S 4C4WA 3ZTRA 1VRQC 1YGYA 4OZ5A 2XSJB 3ZMTA 5DCMA 1S6PA 2HQIA 1KLMA 3DU6A 3F6OA 1NKBA 4PQAA 4CLPA 3WTUC 4OYIA 3G73A 1PJRA 1Z6RA 1JLQA 3FVYA 2KQRA 3SYZA 4P74A 1R22A 3RSNA 1GVDA 1Q86T 1TWGJ 3IR7B 1ENHA 2UU9J 1S57A 3IG1A 2V8HA 3BGOP 3IM9A 2WTEA 2QFIA 2Z2YB 5F27A 1K1QA 3CO9A 3DRSA 2YQ3A 2OPTA 3FEXB 1NDPA 4RW8A 3VAGA 1EKEA 1O3QA 2LEPA 4CH7A 2IBKA 1KBRA 4P9FA 1FKPB 4NQWA 3PACA 5ICGA 2KL4A 1R00A 1BW5A 4A8MP 1ZHFA 4J9MA 3TRGA 2HS4A 2KL8A 1RXOB 2KKOA 4ZPDA 3HGGA 2HVRA 5CZVA 3LF0A 4JYAJ 3T19A 2JVGA 3D7SB 5F8NA 1KLNA 2LU2A 2M7SA 1VFCA 1WJ9A 3GFZA 3HGYA 1R49A 3DDIA 2V63A 3ZPLA 3OFHA 1LPQA 5FD5A 5DCFA 1CS4A 3G6EI 1KYZA 4TV7A 1LW2B 2M0CA 1RWPB 3A8EA 1AT1B 4DL2A 1Q4RA 1FRKA 1IBLJ 3GZ5A 2W01A 2KRCA 1W7PA 5E1XA 2I38A 3FMBA 2CJKA 4DSEA 2ELKA 3GV5B 3FEYB 1BWEA 3N0VA 4FHTA 2O9LA 4HSTA 2K02A 3TAQA 4MK8A 4A8OA 2BEFA 1BR1A 5FLMJ 1A36A 5KFSA 4AQYJ 1Y0NA 4R5PA 2NXNA 3DRYA 2I5UA 3ZNUA 2CUZA 4E70A 4KGKA 2GVZA 4JI0J 4UUSB 1HF0A 2GIFA 4GYGA 3H5UA 1BD6A 2V79A 3KLFA 2MQMA 4HBLA 3I55I 5CYQB 4V2GA 5KT5A 3RJPA 2AWZA 1CJUA 4YEJA 5B1AH 1HHSA 3DQVC 2VG5B 2AJFE 1S9EA 3H98A 3QJPA 3FMQA 3OIQA 1OQ6A 3Q2SC 1EQ0A 3G1LA 5E79C 4NI2A 2ZUAA 3M8RA 3ZZRA 3M32A 2NS1B 5DDGA 4I01A 4PJLA 3IS9A 1SD4A 1ZAVA 2YWHA 5GAGI 4YB5A 5M3MJ 2HOSA 2VFRA 4LSZB 2M8GX 2R4FA 3BM7A 2FLLA 3IUOA 2KO1A 2ZOGA 4IH6A 3OJSA 1NHKL 5F0WA 4GMKA 1YQHA 2X6XA 1E3HA 1T9TA 2GJ2A 3RDIA 3GLXA 1IXKA 4HLXA 1Y3JA 2Q3PA 1SJRA 2MYFA 2EG2A 3KLOA 2JMWA 1BWVA 2GJIA 5B0CA 1DQAA 5KFXA 1SJ1A 1OO0B 3HEFA 1NJWA 5J1NA 5I3UB 4CDIA 2XGPA 1ROFA 2R7FA 1QTNB 2DR6A 2FZKB 2V69A 2VJUA 3ABUA 4OIXA 3VYUB 5D8HB 5C44J 1POGA 1IN0A 1ZZFA 1RT4B 4ECSA 3K10A 4X4PA 4FXDA 2HZCA 5FJ4A 1LW0A 4NX9A 1FP2A 3SQGB 1IBKJ 3E2EA 1M5SA 1FWZA 2VFTA 2QV6A 1BGXT 2B4OA 3DYAB 1Q7YT 2X48A 3VV2B 3LFKA 4P71A 4MO7A 4NLVA 4CDGA 2DH8A 2HWHA 2XZDB 5A2QK 3DLGB 3WODF 1LWCB 3CJ4A 1Y7PA 2MH9A 3J80U 1K79A 4C8ZA 2RJZA 3TWZA 1OYIA 1M1GA 3ILIA 2XZWA 2Z58B 3D1HA 4ED2A 1SBRA 4XL9A 1DTQB 3ITHA 2DGQA 5BNGA 2HNDA 3FSXA 3OYJA 1BBYA 2GXGA 5KFZA 2MSTA 1NZ8A 2APOA 2N8GA 1H2VZ 3OTOF 3CF2A 3QATA 3ENAA 5AXKA 1NK9A 4HRIA 4II2A 4OMYA 1Q95G 3F8FA 1RUSA 1SD5A 2R8GA 3MXHP 2QKLB 3CJNA 3T9NA 2J0XA 4JI3J 1D0ZA 3A01B 4RAGA 2J9DE 4X62F 4LSNB 3W63A 1BR4A 4WIIA 1R8PA 2BQRA 2DLLA 2GAUA 3OQ2A 5HLFB 4IRHA 3G6XA 5AONA 5J1YA 1UAAA 2ZDOA 1HQUB 2CQBA 4R8HA 4RNFA 3FISA 2W4SA 3K6GA 4I2QA 4OQJA 4QWQA 5KFAA 5J40A 2FHKA 1ETOA 2XSJC 1TL1B 2PJRB 2M70A 5EX0A 1I6JA 3WZ0A 3KJNB 1WI9A 2P8TA 4HTIA 2P6SA 1P2FA 2L08A 4IYQA 2VKDA 2OSQA 2QA4S 1XNQF 2V9WA 1YKWA 2OQRA 1DARA 4PUOB 2DVIA 5J8FA 2Y9HA 3A3PB 3R7NB 1T8IA 5EEAA 2KM8B 4XK4A 3KIOA 4LR8A 2XS5A 1U3EM 1WG4A 3BPSP 4C0BA 1LVAA 4D1QA 4I2OA 4DW6A 2H48B 2EXUA 3QYBA 2H6BA 5GMEA 4CYCB 3LP2A 3F8NA 3I4NJ 3H5AA 3KEYA 3U2RA 1NPPA 1Q5YA 1U6GA 4HR2A 4PSXA 1QUPA 5K14A 4IXAA 3CCSS 3GTYX 1CJTA 2HRTA 4LLGF 1ZGWA 1RTIB 3DLEB 3FKIJ 4HF2A 3T1YF 2DHAA 2CJJA 5M5WJ 1QBJA 1CULA 4S0HB 3L7WA 1IUFA 5CYMB 1B70B 1JLAA 2WV1A 1FTZA 4PYDA 3MD1A 1UJ5A 4D3HA 5IYBJ 5KFYA 4MJKA 3CCYA 4IH7A 1SPBP 3IGNA 3QPSA 4LF5J 1VHFA 2NXCA 3EZ5A 3FHNA 3PO4A 4USWA 4EZ9A 1A5JA 2CADA 4P7TA 3GG1A 3AOBA 4J9VA 1RAEB 4DHVA 3R5GA 3CJ2A 4Z37A 4URGA 2NXEA 4Y2AA 1ETQA 3UWTA 2XTJP 3U9GA 1USSA 4LFAF 1QAXA 1KP6A 3I6PA 3PM9A 3ZQGA 2XAHA 1X1AA 3MPYA 1ZYQA 3QZ7A 3V2UC 3V4IA 2FY8A 2XASA 4A0YA 1FJEB 2DKOB 2BW3B 4ANCA 1XNRF 2BV3A 1DDNA 1NJXA 1Y3KA 3M9AA 1VC0A 1B3TA 4A3JJ 1RU2A 3ISZA 3NBPA 3OL7A 3IBWA 2W25A 1XCVA 3C8YA 2Q8KA 1DU0A 4HT7A 5DM7F 1YJ9I 1DURA 4RUAA 4U0YA 1AZSB 3KDOA 3R5BA 2FBIA 2QFJA 4C3LA 1XS9A 2IS2A 1ZELA 1VR6A 3H7HB 2DCUB 2YKNB 2BYCA 1D1CA 4XLCA 5K8NA 2XO7A 4CI0B 2ZBIA 2FC9A 3JRCA 5LGNA 2KJBA 4EO8A 1U0SA 5KFRA 4LRDA 3NXZA 2E7WA 5CHCB 4A12A 1P92A 1RBLA 3CIMA 1VMBA 2FLOA 2WONB 2MXYA 1HIYA 4ZVFA 2LYCA 4M5DB 4DV5J 2IDEA 2VDIA 2O03A 2UUCF 2HKOA 2QLZA 1TV6A 3OS2A 4KGZB 2IM0A 3MDFA 1FIAA 4Y65A 2N7CA 3HP6A 2GCFA 1W5SA 3GVAA 1JLCA 4ILRA 4GO1A 4JI1F 5IT3A 3SQOP 5LHIA 4KA4A 1R3NA 1R4MB 1QHGA 2DGOA 2DEJA 4CH1A 1N6QB 1P9QC 2MZRA 3AA8A 2OEJA 4U88A 2L01A 4PWDA 2X0LA 2OU2A 3J80Z 1B72A 3HVTB 4LFBF 3M9NB 3F6VA 2UXXA 1USTA 2EVZA 3SQNA 3UR3C 5EWGA 5GAHU 3HFKA 4ZITA 1YJNS 3P3DA 2LC2A 2DJWA 1GV5A 4A48A 3TANA 2POKA 3NQOA 5GADJ 1YS7A 1ZM2A 1HBUA 4DV1F 1XSXA 2P2CB 2N7YA 1S1WA 2KTQA 5KVRA 2E7XA 4Y2CA 3S1QJ 3S14J 4MKVA 2AJ0A 3LA0A 3RR8A 4FQGA 2D1HA 3MI7X 3WHIA 2QF7A 2ZJRF 4IRDA 5M2PA 3K4KA 4ZPTR 1S97A 2ZHAA 1WWHA 3CDEA 4QWEA 3CCRS 3LSJA 1J5EJ 1I3OB 3ETMA 4AT1B 2CQIA 1K4SA 2BJ3A 3GIMA 1ZS6A 2VG6B 1HW5A 4GC7A 5LMNF 1XC9A 3CP2A 2CO5A 1CC8A 2LY2A 3C6TA 2A1BA 3GYNA 3X1LB 3MM8B 1JHHA 1I6HJ 3MFIA 4FYYB 2TRTA 2WAQA 1YSJA 1S79A 2ROEA 4ECTA 3TEHB 3H0GJ 2DT5A 1GUUA 2W7NA 6PAXA 3IKTA 3HRSA 5DV5A 4HPQA 3TO6A 3TW6A 2IS6A 1IXSB 4EK2A 4ERDA 3PM1A 5EJCA 3ZQCA 3NP5A 5KAFC 4OHYA 1U49A 3RKQA 2RQPA 2DFEA 2OI2A 1H6KX 4MGRA 2WB1A 2NPIA 4KR0B 2M45A 1Z05A 2FE3A 3TAMA 3PYGA 1S1XB 1NBEB 1VQ4I 1G3OA 2B8PA 2XRLA 3ABKH 1FFGB 4PXDA 3SDBA 4ES3A 2RDPA 3NGRA 5GADI 4C3HJ 2EK6A 3QOEA 3G4SS 3F72A 1UHSA 4IG3B 3TKYA 1YVFA 2JC1A 4LVNP 3Q8YA 5IFMA 4XK8C 1MNEA 5C2CA 2VHGA 5L1JA 4LG0B 1G1XA 2DT9A 1U1LA 2I9SA 4ZIWA 1BMQB 4HL9A 3CUOA 4JK1X 4OZ1A 7AT1B 4IDKA 1VGYA 4C6AA 3C3LA 1HBNB 4F26A 2D41A 1FT9A 1JXEA 4XLHA 1X5TA 4C48A 3CESA 1XMOJ 5C4JJ 4N0BA 3EVMA 3MPVA 4ZVSB 4JI7F 1UVJA 1X7VA 3C2HA 1HNZJ 1M0SA 5KAIC 2D3UA 2LMIA 2DNLA 3UNYA 4OX8A 1NK0A 2YX4A 4CQ1A 4PG6A 4WF2A 3OTOJ 1I5OB 3MUMP 3CDBA 1SB6A 1PCAA 3OVSA 2EB7A 4DI6A 5IOZA 3GB0A 5A8WB 4KHRA 1ETWA 3NEUA 5FKKA 2L7ZA 4DS5A 3AY0A 3W2WB 2O3FA 3OTDA 4HHJA 3PW0A 2R5ZA 4MEXF 3OS1A 1QJHA 1S12A 3GILA 2JOQA 3TX0A 2XS7A 1W0UA 4KKOB 2HVDA 2AJ4A 3GZ7A 4PXEA 2BY0A 2LA4A 2HGCA 4PXBA 3FWEA 2DGXA 4KBIA 1HHTP 4F04B 1H2UX 2KFYA 4NLTA 5MLCV 1ON2A 1FRHA 3JCUC 2J7WA 1Y1VJ 1N25A 1SKWA 1X31C 1IKYB 1WF1A 2H5IB 2MGZB 1XR6A 2HVZA 4FE4A 4NC7A 4KRWA 4IHWA 4LJZF 3VGUA 4OV1A 4USVA 2CQ7A 2QQ8A 5DS9A 3MKYB 4EBDA 2HXIA 2VPXB 1V3FA 2EFWA 3SCIE 1XNQJ 3KLIB 3QQCD 2GJFA 1WDDA 2GHVC 3MMCB 1TZLA 3ASNH 4TN2A 3UDEA 2X1AA 8RUCA 1TQIA 3D6MB 4DCJB 3GXOA 2KIQA 5ILVA 3P4UB 3RB6A 3ZZ0A 3TEGA 4EGLA 1VS3A 1WKLA 3Q8SB 4JOUA 3HUGA 2EJRA 3J7YJ 1LQ1A 3A1YG 2NPFA 1R0AB 1S5LC 3GV8B 5IT4A 2OJ3A 1RTHA 2E1CA 4ANDA 3FZ2A 3LGHA 4J9SA 4E7JA 1UB9A 3D54A 3G2XA 3NRBA 3PYFA 4ZYAA 2JEIA 2CWKA 1KU9A 4I98B 1GXUA 2VPZB 2LECA 4MMOA 3Q24A 4EM2A 1DLOB 3CJTA 4LBHA 1EP4A 3C6UB 4O0IA 1P6TA 2EIKH 1WTBA 5K5MA 1NTCA 1UJ6A 4MTPA 4XORA 2AKWB 2LD5A 2R42A 1O8BA 2V94A 3F41A 4RB2C 5K9FA 4HZFA 2XY5A 4ETSA 3ONQA 4M5JA 4M6YA 4QTRA 2D2WA 3QYYA 2BUNA 4QWAA 1FK9A 2J0WA 4LR7A 1FDBA 3NWTA 1J5OB 2PGCA 2DK8A 5CQGA 5L3GA 3K1PA 2PLYA 3OVAA 4JV0A 3T5LA 1Q8BA 3K8VA 1BN5A 2QSHX 4ZVRB 3AL0B 4DJBA 4OMFG 3HIFA 2NLWA 1IJFB 2AEFA 4Q2MA 4X4QA 3I59A 2OD6A 3TA2A 4BQQA 3L2RA 2GGPB 4DQPA 1RKTA 3LTOA 1VBZA 3NGDA 3MMYB 3MR7A 2JJ7A 1XNRJ 2XMUA 4UUWA 3P7NA 3GJRB 5IT9Y 3N6NA 2CVIA 1MLAA 4JI4F 1U2CA 3EVOA 4DR2F 3NCQA 5A6WA 2UXBF 2RHQB 5E3QA 1TP7A 1U7LA 4EVIA 2M88A 2GHPA 2LOOA 4NLGA 3Q8UA 3UN3A 3W2VB 2ZVIA 1PYVA 1AFJA 3ZNJ1 1KVJA 3H9GA 1KHVA 4W1UA 1HBOB 4A8KA 4RW4A 4KHPJ 1IBMF 4USMA 4PFPA 1VQPI 3SFGA 1MW7A 4BKXA 1RR8C 2CQDA 4X64J 2KDZA 1C1BA 1JMTA 4Q7AA 3GTQJ 1Y11A 3V5RA 2XGQA 2E1NA 2ADBA 2F8MA 2X1GA 3GIKA 1S1TA 4B48A 2HOEA 4HAMA 3SCKE 4KT5C 4ZLJA 1MG7A 1IDYA 2D7SA 1RISA 2G9OA 3CCMI 4L9TA 1PO6A 1U5TC 1KS2A 1RBOB 5D4SA 1S5ZA 2XKOA 5HNHA 2AJ1A 2AO9A 3QOPA 4WCGA 1RIOH 1S9FA 4L75A 3CCUS 4DPYA 1R6VA 2KZMA 2ZH3A 1S72I 1RWXB 2ZBCA 2F2EA 3ZXSA 3JRAA 1MU2B 1ZG1A 4LFBJ 3E5UA 4K4WA 4NMXA 3NARA 1Q8LA 4LVOP 3S8SA 2K40A 4NXNJ 2MQLA 4D3GA 5ERIA 3J80K 1IKXB 2WHOA 4CM2A 4DV1J 1ZG3A 4KE5A 4W98A 1S6QB 3W6VA 4WZQA 2CMPA 2H54B 3AB4B 3UVJA 4IOBA 2C3PA 1FJGJ 3I4MJ 3BQ1A 1HNXJ 4NCGA 3J7YU 1Q8KA 1B7YB 3HDSA 4LG3A 3S2WA 1RHQB 4LBIA 3N5BA 2KG1A 3TGNA 5F8GA 4M3BA 2ZH6A 2V8PA 5DLFA 3MM6B 3CT9A 3P49B 3FHZA 1BQMA 2MQOA 3CCLS 3M8QB 1GT8A 4WFBQ 1UZCA 1VQYA 4A69C 2V6EA 1NH8A 3RYRA 3I0TA 3KUHA 4CTAB 3G71S 2RQKA 4JI8F 3CCVS 4B3TJ 2D3O1 5HVGA 1KQSR 4XLPF 1JLFA 4H4KC 3V8JA 2J0SD 3BV8A 3IH2A 2DODA 1H7WA 5DQHA 3VAMA 3HOVJ 1Q1VA 2LKXA 3N4WA 4HDGA 2DRDA 1TKXA 3I71A 4B9LA 3MAAA 4MQVA 1TVRB 1GH8A 1W2BR 3BF4A 3BG3A 2FX0A 3W9HA 5E1ZB 4AC0A 2BE7D 3IH3A 3MR3A 1TU0B 1U48A 2K9QA 4M6VA 1KD1T 3Q0VA 4B1RA 3DBRB 4R1HA 1RADB 3MM9A 5ICCA 1W4MA 4Y00A 4CLWA 4ECUA 2NS8A 4M6XA 3A13A 2VT3A 1CJVA 2MKHA 2XDVA 2VBXA 1HOMA 3N01A 3MTKA 3MM5B 2GVDA 4XKWA 3TARA 1S0VA 4FS1A 2HGLA 1SJ4P 4B3OA 2F5FA 1Q78A 3MM7A 3KUEA 5F8HA 2MTLA 1YRXA 3PHEA 3C15A 3K69A 3B6CA 5B3SH 2HNZA 3MECA 4CCKA 4NZ0A 2DQRA 3BO4A 4B44A 1U26A 2HURA 1OSDA 3BJAA 2A6TA 2DU9A 4DL3A 4DQIA 5HMYA 3SXYA 5KFCA 4RBOA 5HJXA 3RI4A 4JV5F 4PGHA 1HI1A 4TU9A 4BNCA 4F93B 1N52B 2BXJA 2ZMEC 1S6UA 4B3SF 4JI7J 4IEJA 1U5TA 4B9MA 1T3NA 5G4DA 2PJPA 4WTOB 2KYXA 4RAFA 3F8BA 4DZDA 1Y8QB 1AA7A 3BQYA 4Q5VA 1FXLA 3S1MJ 1KQ0A 2Z2SB 4I6AA 4Y34A 3OYKA 4AFFA 1GX5A 3GZNB 4F0HA 2M0MA 1IRZA 3BGRA 3HZJA 4ENMA 4JP0A 2G9WA 1A04A 1RTDB 3PNTA 3JRHA 4DR1F 2XULA 2H27A 5DETA 2VZ9A 2QSGX 4NNJA 1DQ9A 4A46A 4DGWB 1FY7A 2E1PA 4MH8A 1L3TA 4M95A 4RUBA 2W2QP 4OYBA 2RRAA 3KEQA 2ASDA 2DNYA 2DR9A 5FIIA 1HARA 4TY9A 3HHKA 4GVBB 5C25B 3PQJA 4BY1J 3ZTSA 2E9ZA 3SDGA 4BHBA 2CA9A 1NK6A 1S1UA 4OAYA 5FJ8J 5A8RA 5E3AA 4DV2J 4G12A 1SIZA 3TP3A 5FGMA 4JOMA 4M5KA 1OSCA 2O61A 3PYDA 4QQBA 1XIQA 1FEXA 2EFNA 1R1VA 3VSLA 3CD7A 2AS5F 3LQQA 2FOKA 1BC6A 3HI9A 1C0WA 3IFEA 4NE9C 1TT5B 4H4KA 3TOBA 1U2FA 4YFKF 2VJVA 2OMLA 2ZJPF 3OIOA 2FJBB 2KVIA 2Y48A 1RKWA 3KJQB 4XOTA 5G0RA 3OL6A 1RU1A 4OYMA 3U7JA 1PBUA 1SAUA 5DLGA 4ZH4F 1YW7A 2HU9A 1B1BA 4QBUA 1G7CB 2FY1A 2E29A 3H59A 3BREA 2A2CA 1IJWC 1RAGB 4QWDA 4ZCMA 1QE1B 4KQZA 5DM6Q 4C2MA 3NCRA 1OJ4A 3DGPA 4ED5A 4YDDB 2I10A 4WBFA 2ZITA 4GYIA 1B4SA 2QLFB 3BT9A 3KLEB 1ZA2B 4BXXJ 4DMZA 1RACB 2M1BA 4K7QA 5IWAF 5HROA 5LMUF 2F1FA 2B9XA 5M3FJ 3GF2A 3E8OA 3M8WA 1WJDA 4P2MA 2JDJA 2IA1A 3OVBA 5D8LB 2B7EA 3VYTB 4ABZA 4C8KA 2HPIA 2IPQX 2XSDC 3DRPB 3O44A 2QEXI 3GTKJ 1YG2A 4HEA2 3BC8A 3M7VA 5F8LA 1PIEA 2X6YA 2MSSA 4KMUX 4ID5A 5HVQC 3CE8A 4OJ3A 2JJ4D 1LK5A 3M8PA 3H25A 2ZMEA 1BI0A 4RW6B 2GA1A 2RE1A 1VQ8I 2XHCA 4F3MA 1I39A 1YJRA 3CLQA 1HNVA 2X51A 5D6EA 2BY3A 1UVKA 2JC0A 2IP2A 1FFWB 2CWEA 1APLC 4W90B 1SFEA 4FVCA 2MY8A 3O8HA 2O0YA 3K17A 4HEA9 4KFBB 4CCJA 4JI4J 3J7AN 2HHHF 1Z2LA 3CMES 5CZXA 1HKSA 3UD3P 2HQCA 1WEZA 2DNMA 3SBMA 4PWWA 4MTDA 5ETKA 3JREA 3K4LA 3OWTA 3NL0A 4ZPVR 2EBIA 3PDNA 4N9HA 3O3KA 1OY6A 3KJFB 5H20A 4H4OB 4C0OC 1LFPA 1IBMJ 3MEXA 1PDNC 4K5SA 2C2RA 1EX8A 3CCQS 3A4TA 1UVMA 1X4EA 4X6AJ 4BXFA 2Z56B 1UVIA 4DR7J 3FQKA 1Q53A 3GW2A 5D4RA 3MN2A 3QLHA 3BROA 1WHWA 2COBA 4IF4A 1Q79A 4RS8A 2N3LA 3RBZA 3LA7A 2YNGB 3G9CA 5LJ3Y 4M5GA 4HG2A 1HLWA 3PRDA 1HDPA 3ELKA 2R7TA 3BZQA 2PEBA 5L8RC 3VGTA 9ATCB 4WZMA 3W8PA 1T6SA 4LMZA 5HQ8A 1PKUA 3CD0A 5IT9U 4LSLB 3ASOH 2FNPA 4IOCF 2G2ZA 3GSDA 4ZK7M 5L46A 4MIWA 3G82A 1RESA 1VQ9S 4E0DA 2EFVA 4IHVA 3BS9A 1WJCA 3W2AA 1T33A 2XEXA 4OZJA 1BQXA 4Q43A 1MBHA 1F1BB 3EUKL 3CJSA 4LRFA 3P5JA 4DR3F 5C5JA 2MQ8A 2F65A 4I67A 2FTRA 1NU4A 2C3OA 4ZPAA 4CYUB 5J3LA 3HXMA 2H1YA 1SKSA 2Y3YA 4FTHA 3S3NA 2BV6A 3PX4A 2Y31A 1XK8A 1FRMA 2CSOA 3PJXA 2V8GA 4FYWB 3J7ZT 4ETZA 3HFZB 1MNMC 3MAJA 4UT4A 4D0PA 4IQ4A 4N4NB 2ZBKA 2V67A 4DPXA 3P5BP 1AHDP 3NG8A 4HX4A 4KAIA 3NS6A 3SSQA 3TA1A 4MNUA 4DQ2A 3SI8A 1VQ5S 2ACJA 4WWCA 1Q1HA 1GTEA 2ZE2B 5JUMA 4N41A 2HFHA 5GVQA 1FT8A 4L3NA 1YYVA 3ISNC 3PJRA 3W7BA 2A3JA 4X1EA 3ZMUA 5C4XJ 2M0GB 1FBQA 2DA5A 1BJAA 3DTIA 5KAKA 4RNMA 4A8SA 3DLHA 3IRXB 4DIQA 4WXDA 2C2MB 3M3YJ 4U7UK 4WYWA 2H51B 3JAMY 2NSBA 2E71A 2XB0X 3PIOQ 2HPMA 3BOQA 2M5WA 4UW2A 1YJ9S 3QAEA 3NNCA 2Y0MA 3Q89A 1QPMA 2Z57B 3QGGA 5IM0B 2HNYA 1GV2A 3WU0A 1U45A 5J2NA 3ULHA 2WRMA 1T38A 4ZZDA 2GOMA 4RM2A 2YNFA 2J6TA 2QL5B 5J1EB 3IC7A 3KPHA 1TAUA 4ZHRA 4Z6YA 1E6VB 3F8MA 2ZNZA 3GWZA 4FP9A 3BH6B 2Y0SN 2J9EA 3V6DA 3VAFA 3U02A 4IR1A 3CCEI 1N77A 1UCRA 4U0WA 1QVUA 4UXNA 4LIRA 2ACYA 4ILMA 4DYQA 1WC3A 3QRQA 4Q8FA 2HRUA 1JJ8C 1NK3P 1U47A 4I09A 3K0JA 1Z67A 2PA8D 2DNOA 3CJQA 4ZA1A 1QHHD 2OUMA 3DRRB 4ICLA 1HBMB 3T0YA 4CLKA 4FF1A 2R5YA 5HBMB 3DM2A 4DQRA 2JX2A 4B3SJ 4N9IA 4K0KJ 2PBIA 2LKZA 3QIPB 4K4UA 4K2XA 1V5VA 1XERA 3AG3H 4LRAA 4NLRA 3HHLC 5E20A 1T08B 2M8EA 2PI0A 4ZC3A 5GAEI 3I9ZA 1YO5C 1KU2A 2LVWA 2EBEA 3NGKA 3NS7B 1YW9A 4UVAA 4FE7A 4DG1A 5T14A 4DJAA 2RQCA 2FZGB 1PILA 2A18A 4Y52J 2ZUGA 1P8GA 3E7LA 2QSFX 3EDQB 4C2TA 2M8HA 1S48A 4NL5A 2ESHA 4C3JJ 5ED4A 2FJAB 4RX6A 2H5JB 2HLUA 1VQNI 2ATCB 1UG0A 4PG8A 1ZG5A 2MKIA 3KK3A 4LBPA 5ETPA 3LMMA 2VE9A 3IAS2 2X1DA 2HGMA 4NHJA 1RAJA 2F8EX 1MJ9A 1NNDA 1G6NA 4XAKA 4S05A 4UVCA 3L2CA 5F1RA 4DV3J 2ZO4A 1XCBA 3Q8VA 1L3VA 4YOEA 2XAGA 3DPUA 1SH3A 2CV2A 1CVJA 4P2FA 4F4WA 2DDAA 3MCNA 4IG0B 2R0QC 3NCPA 4ZTJA 4NPOA 3CJRB 4RW9B 2G4BA 4BU2A 3LAMA 4NCBA 1HQEA 2XHWA 2K9LA 3IAS9 3PX6A 3FXLA 5HDKA 3J81K 2WOMB 3UD4P 4RM3A 2P7VB 3IWFA 1J2VA 3COAC 4LB5A 3RBXA 4C3MA 1TTYA 4TXSA 2DA3A 4G1QA 1VRTB 1XC5A 1D5VA 1R5GA 3KX2A 3H9JA 3C66A 2VL1A 3OV7A 3KK1B 4C2UA 3HKZD 1U1PA 4HLYA 3IV5A 4U7DA 4A3MJ 3OYEA 2UUAJ 2XF7A 4L5JA 2FOWA 4I2PB 5B0GA 5JVHQ 2NVUB 1JKHB 1VQ4S 5HQLA 3LW5C 5IT9Z 1HKQA 3HX9A 1T02A 1IG7A 2UWMA 4ID8A 4CNZA 4OV6A 3OL4A 2EZKA 1N78A 4PWUA 4L76A 3CJ8A 4XDCA 5IWAJ 5LMUJ 4D5FA 2HVQA 2OC6A 4PRFA 1LEBA 3VDXA 2HIQA 3KMSA 1N34J 2ID3A 5LOQA 5L39A 2G0CA 4E2FB 3TVZA 1G8XA 3S16J 3CC7I 3QWPA 2QMWA 3DDKA 3DPLC 2IC3B 3R6SA 1OPIA 2KISA 4O44A 3DOLA 4BXUA 2V5HG 1K73T 2AHOB 4XIDA 2HHWA 3FMRA 1VQ7I 1FRLA 1VK8A 4NZ6A 4MFBA 5HVFA 3BCBA 3HRUA 3TO9A 4ECYA 2LA6A 4YELA 1LK7A 4I02A 3Q23A 3KLHA 1DFDA 1U24A 5LD2C 2FVPA 4JYKA 2BVLA 3HHLA 3H42A 1B0VA 5HO4A 4OMZA 2UXDF 5HLIA 3OBIA 5BJRA 1X1PA 2M7BA 1A7GE 5C24A 5HP1A 4G1PA 4A3LJ 2G0IA 1H9GA 3WG9A 1T3OA 3TVKA 2CPFA 5BR8F 5GP9A 4U8YA 2XMKA 4YUDA 4HI2A 4Y7NJ 3DXJF 4B3XA 2GWRA 1TKTB 5E41A 3FFIB 5J2MA 2JLEA 1G3SA 3DCFA 4J9PA 4CLFA 5KT4A 3BGLA 1UWBB 2HTJA 1X2NA 1FESA 3VAJA 3NS5A 5F41A 2YNIB 1CJKA 3S1RJ 2A61A 3TQ1A 1B6AA 4NLOA 1KQ8A 2QRRA 3AOCA 3PJ9A 1WJEA 4X4NA 4O3MA 1HYSA 1NK7A 4EO6A 1LWFB 2DPIA 2HEOA 3L2WA 1CLFA 5DJBA 1Z6TA 2AYMA 1FE0A 2W2OP 1TFWA 1FMVA 3FMSA 1OCTC 1I94F 4RBVA 2FYXA 1VRUA 2CUYA 3RZAA 2J6UA 3I0RA 4X66J 4DBQA 5KFTA 2XLIA 3AG2H 3N6LA 5DEQA 1HW2A 2HZAA 3H3UA 3FCVA 4IHTA 1QM9A 4RGUA 3ENWA 2DY1A 2NYIA 4RJVA 2EKNA 2ZKZA 3I56I 2K86A 3EUHC 5LL6d 2BANA 2A3SA 4B3RF 1OCCH 3HJFA 4W97A 3AD8C 3DOMB 3PVXA 5FKNA 3EMTA 2QMXA 2XM3A 1FTCA 3UCZP 4FNIA 3RBDA 1A0OB 5CH7B 4P72A 1TWAJ 4PPDA 2C28A 4M3DA 3SDEB 1Y5IB 2LLKA 2C3UA 4DR6J 3MEDA 2WCXA 4NDLA 3EZOA 4F0MA 2ZOFA 2PG4A 2MGQA 1WH7A 1WZ2A 4E98A 1NSAA 5D4LA 3BG6A 2DHSA 2L9RA 2XROA 4ZP6A 3M6VA 4HHUA 3K8WA 3EPGA 2B43A 4KPCA 1OCRH 2H8RA 3Q3SA 4Q0BA 3E97A 3BJ6A 2K3PA 3SEZA 2LKPA 3GCXP 2PMZD 2YVSA 4EEFG 2AXLA 1B8IA 1VCTA 1ICEB 1O3RA 1ZAXA 1TKDA 1IR0A 2D9PA 2GQCA 3M8SA 2PMWA 4BC9A 3UDVA 3R0JA 4R79A 2OO4A 3M2RA 2VG7A 1SEUA 1M5PC 2E2HJ 2V26A 5H9FJ 2CAJA 1IKWB 2O5DA 3E01B 2RN7A 4IQJA 1TKZB 3TO8A 1W7WA 4L6V3 4M3GA 4RPFA 3OTBA 4NC6A 1KFDA 1DRZA 4DX8H 1YQAA 2QA4I 4TY8A 1F3FA 1SXLA 2YU9J 2B5JB 3DHWC 1K4TA 3RCOA 5J1RA 2W8LA 2EIMH 4HDHA 2CQHA 2R7SA 3A2KA 4Q47A 3DMJA 3LAPA 2ZM6F 1WG5A 1IWGA 1M5VC 2E5HA 2C6YA 1XMQF 3M1VA 3QT5A 3BR5A 1RR7A 1P9YA 4A3IJ 1FA0A 1SC4B 3C19A 2DMUA 3SFUA 1S4EA 2MD5A 2VC1A 3V8LA 3LALA 2LFBA 5DM6F 1A6QA 1XEZA 2CS3A 3H92A 4YB1P 1XB4A 2L9SA 1WEYA 2PMZN 1HA8A 3RYLA 2Y1LB 1WKMA 1N36F 3OYBA 4CLUA 1F1ZA 3IL2A 2KH9A 1O4XA 4LIVA 5B08A 2WB4A 1WI6A 1YW8A 2PQ8A 2ZH8A 3CCMS 4C8OA 3ZMSA 2UV1A 3HVRA 3K5NA 5L1KA 2BJ1A 2YNHA 2WSEC 3ZN1A 1JJ6C 3L2VA 1S4FA 3VGSA 2R7DA 2Y75A 3MMAA 4Y3CA 1FOWA 2IEKA 3RW6A 5IXUA 4Z2YA 3JAMU 2ZHBA 3ZOBA 3VR1A 3WU1B 1X5PA 3MMBB 4DZJA 3M2VB 2ZHOA 3HOSA 4DCOB 2Q43A 3HOXJ 1KEKA 2G1HA 3F56A 1X9MA 3EUHA 2PSZA 3BKTA 3MMJA 3TO7A 3KWMA 4DX5A 4EM0B 2VONA 2VA3A 2P5VA 3CJ5A 2LQ8A 4HLBA 1X4HA 3QPLA 1RWUA 2DGVA 4M8LA 5KG2A 4K2EA 4BEHB 2HBYB 4CT8A 2BE2B 1R9TJ 1RT5B 5KG4A 4RU9A 4MK9A 3TW0A 3JYTB 2A6EF 5D3GB 2JZYA 4D7MA 1MDMA 4IOAF 1NDKA 4A8XA 1S6LA 3TUJC 1PYOB 3ABTA 4DXLA 5SZTA 1IQTA 2HQ5A 4G6DA 3SEQA 1L0OC 3PFYA 5CVJA 4UUVA 4PKDB 1OMIA 3EYZA 1KONA 2JLGA 1WF2A 1ZQ3P 2AX0A 1O7FA 1BA5A 1C0TB 3DV8A 3BEGB 3TP0A 4NA3A 1C1CB 1X1DA 2VOPA 3L7PA 3BYRA 5KFQA 1W5CC 4A47A 4XMYA 1NRKA 1EZZB 1XBWA 2C2ZB 3OLBA 3R60A 1G2HA 1OWXA 4F92B 3BSAA 2LBFA 4YY3J 5DDOC 2KU7A 3PX0A 3B54A 1MN9A 1UMQA 4NLUA 4YHHF 4ECQA 2HQAA 5I4MA 3GTPJ 1JTYA 2ZFHA 5J2QA 1MGTA 5TISC 2XAQA 2YWEA 4F91B 3OR2B 1U1QA 2H9ZA 2XCPA 4F52A 3DDNA 3BDEA 3DBLB 1QNTA 4D9JA 3BBFA 1HI8A 3NEKA 2IGKA 1PAEX 4C8NA 5L3DA 2JZ5A 4PJMA 4QZVB 1IV8A 4NEZA 1EA3A 4EGZA 3KETA 3T6BA 3DTKA 1B7FA 2XIGA 2KIFA 3FBCA 3M8JA 4KO0B 4ZJZA 3J81j 2B9SA 2ZZNA 1EHWA 3QWLA 1JKRC 1IRGA 1R23A 1U09A 4JUZA 4B3MJ 2YKMB 2XVCA 1YJNI 1V4RA 1W1WE 2ZNYA 4RBTA 4YFNF 2HXOA 2CPEA 1AUDA 1GK8A 2F7VA 2L9DA 3BR2A 4YIRX 4P75A 4U6PA 2R9LA 3DFGA 1S7HA 2Z1DA 2VJJA 3R5CA 3CQZJ 5M2RA 1EH8A 1RTJB 3B78A 4EFAC 1OYWA 5ETTA 5LGUA 1TK8A 2VE8A 3MR2A 5IYCJ 3TX8A 1JNZB 5KFDA 2BJDA 4I6ZA 5HDNA 5EEHA 1WKKA 3FXRA 1AKHB 3RB3A 3DLKA 1RT7A 1TZ0A 3NAIA 1XN7A 4JBCA 1FRJA 3K58A 2UXDJ 3BR0A 2XHKA 4IFVA 2F5GA 4ENOA 3R3TA 3SYTA 4Y2IA 4NOHA 4XR6A 1OIAA 4C8YA 1OYDA 5JFRA 3OIPA 1DAXA 2WVFA 4DV0F 1RWNB 2VF3A 3JSYA 1X1BA 3QT8A 3DWLE 2QIFA 2J9CA 2DYRH 2VQLA 4OI4A 3JB9k 1J0RA 4WF9Q 3PIOF 2GAGC 5DCMB 1S6PB 3KHLA 2YQ0A 1KLMB 2XLJA 2ERRA 2CQPA 3M9OB 2KT5A 3NAHA 2YX7A 2OQGA 1QTMA 1ZTRA 2CPXA 3QRPA 4B09A 1JLQB 3DXBA 4X65F 2ECBA 2HZDA 4XONA 3GFYA 2KT0A 1R43A 5DS7A 1D9AA 1HW1A 3UCUP 2DNPA 3IG1B 4I7HA 3KHHA 2XQCA 4PJ0C 3G86A 1NG6A 4DPOA 4EWTA 2E2IJ 3GFXA 1TQPA 2BA9A 2DB1A 3GJTB 4ENKA 3DRSB 3LSRA 1SFOJ 2CNLB 3HC7A 4RW8B 1IN8A 4XKCA 4YQWA 3POTA 1Q16B 4NQWB 3SZ2A 1SMTA 4TYAA 2HEKA 3S17J 3BN7A 4JI2F 1WFXA 3MMCA 4RW7A 3KZZA 2BBEA 2DPUA 1O51A 2MFZA 4LF4F 2J5OA 1V5EA 4LIWA 1YJWS 3MZHA 4KV8A 4WK1A 3WBZA 1ETVA 3IH4A 3C16A 1RHMB 2UZAA 2DAOA 3K70D 1KN6A 3HBLA 4LD5A 1WOOA 2RB7A 1CS4B 3KJVA 3GMGA 1OYEA 1YJTA 3JAMZ 4BYYA 3BY6A 2Y0SA 1MMSA 3D5RC 2GBYA 1W7PB 2EK5A 2CZ4A 1S0NA 1GLNA 3IC1A 3TYTA 2DA2A 3HRTA 2XWXA 2BMBA 2A6HF 4ZYEA 1LXNA 3DLBA 4LF8F 3AJDA 3OXLA 1SVLA 4ANEA 3FBNB 2BQ3A 4FBUA 4CWBA 3NGTA 4J5OA 4PAAA 5GTHC 2OPQA 3GV7B 2QENA 3NGSA 4R5PB 2NXNB 1HHQA 2IJNA 3R7SB 2HAFA 2E5JA 2I0XA 4I7FA 2GVZB 1V9OA 1U25A 4OIRF 4ED7A 3KLFB 3H5YA 2B63J 3K5MA 1NK5A 2BR0A 2XF5A 2ZD1A 2G13A 1KTQA 1VQ8S 1BL0A 1CJUB 1W26A 1F60B 4KIFA 4AU7A 3DU5A 4ZJLA 4DZPA 5L1LA 4WE1A 1S9EB 1X3ZB 1NK4A 4BBRJ 2R7UA 4NI2B 5M5YJ 2WBMA 1HCRA 3EUNA 3FJ2A 3M32B 4X4UA 4L3KA 4WTYA 4QPTA 3G8TA 5ADZA 3SXLA 3IS9B 3MR6A 2IGOA 1T98A 3I87A 5AXNA 3W1YC 1J5YA 5AIQA 3VAIA 2IT0A 5LRSA 1LDJA 5FFXA 5HNFA 3BGUA 2JEGA 3BR3A 2DHHA 2ZSIB 5BPDA 4DV4F 1YS6A 2P9GA 3WTSC 4UZCA 1NM2A 1Y0UA 2ADCA 2RREA 2AF6A 4JV2A 4ECZA 2LDIA 4OX7A 2QG9B 3HZGA 2RF2A 4CXFA 1F5CA 2XGEA 1YIOA 2DOAA 2A6MA 2W1BA 5HSPA 1F4KA 2NCKL 5DQIA 5FLXY 1Y4ZB 1OMSA 1LW0B 4HV5A 2CQNA 4O23A 2STTA 5D5XB 2MHEA 4OYZA 1UHWA 3FK4A 4A5MA 2XMJA 1NDCA 1REVA 2L2OA 3HD1A 2D5VA 3JR9A 2DA7A 4UV9A 2W7PA 2W9CA 4IHSA 1JKQC 1H74A 2JWTA 3CXCR 2QLBB 2FHJD 3HJVA 3VODA 5FDLA 3ILOA 2PIIA 4XICA 4BBYA 3GP9A 1FJ7A 4I1TA 1TK5A 1LWXA 3A02A 1NKCA 2IY5B 3ITHB 3KOAA 4G9YA 2HNDB 4LF1A 3TZXA 1TQLA 2UUTA 4W92B 1JWWA 3IRQA 1TWCJ 4ZCKA 2ZVSA 4NZ7A 3NMAA 3MKZA 4L18B 2IVMA 2GM4A 2GMHA 2O66A 2MZTA 4X4SA 1YI2S 1XSDA 4P2XA 4DSKA 3CZ6A 1KFSA 3PYEA 2VJ4A 1N5YA 3Q8RB 4AYBD 3ZQLA 5LBQA 4MEYF 4NLXA 1KDNA 4PYAA 1X0PA 2HOTA 3SV4A 1WJFA 3MHYA 2OPPA 4DSFA 1YLFA 1HNIA 1FRXA 3DF8A 2VFVA 3E3VA 1UZHA 1HFEL 1Y5LB 2DMTA 3ZTPA 2HMIA 2WAQN 2GIRA 2K9MA 2OA4A 4WK3A 2JSXA 2X3GA 3DI6A 5BYRA 2CZ9A 2CH0A 5DRKA 2IIHA 3BBCA 3D5MA 2ZZTA 1GVJA 3JQKA 2JRTA 1Q1KA 5K1YA 2YXLA 4I2QB 2DFFA 2IAJA 3HM5A 2IMOA 4GFBA 2MQNA 3DKDA 2F4VF 2QA1A 5E2QA 1HBXG 3PR4A 5KK1A 1BIAA 4GGGA 4OU0A 4BC7A 4O3PA 2AEJA 2HHPA 3CNQP 3CMMA 2MLZA 2L9WA 4DUZF 5J4YA 3K89A 4DF4A 3HKZA 4ZJQA 4YHHJ 4MIMA 1MMLA 3S1NJ 2YKOA 4J00A 1D3WA 4O3NA 3PZPA 2JFDA 4JI5J 1RC9A 2NXUA 1JJHA 3ICLA 1RQ0A 1OCPA 3LP2B 3QGIA 3R2CJ 4KNYA 4BQAA 4ELUA 1R27B 2UVVA 1NAQA 2COLA 3NOCA 3AFGA 5K14B 4HQEA 1CJTB 4NB5A 2HTSA 4H0EA 1JXLA 2K9SA 2LQJA 2OCCH 4G6TB 2LY9A 3CCUI 2GMJA 2LFVA 4HYKA 4PZVA 3MEEA 1PYTA 5ETRA 1CULB 1VK3A 2X6WA 2VQFJ 1JLAB 1WSUA 2BZ2A 3A3NB 3CB4A 3TW7A 1ITYA 4PK4A 4AWXB 2IA0A 2DOFA 4CLZA 3M1EA 1RTZA 1X3UA 1FP1D 5EHHA 3CC2I 3H3VK 1WHXA 1SVDA 1HR0F 2EFOA 3ZZYA 3M6XA 4WFAQ 4FETA 3A4CA 2XGCA 4U67Q 4DFMA 2BE9B 4KPYA 2X1FA 2WVEA 4GKJF 1RT3A 3PEHA 3PRVA 5J2PA 1ZGJA 1VNDA 2L41A 2JEJA 3LSGA 3CCLI 4JP8A 3QJJA 4BLGA 3V4IB 2L5QA 4XN3A 2CW8A 3J7AO 2QVOA 2W00A 3EXCX 2VXZA 3G71I 4BCAA 4F4ZA 2XWYA 1FF2A 1M5KC 4F67A 4IO9Q 3D5LA 3SIPB 4A2UA 4M9SA 1RCOB 4RDUA 4A93J 3NBPB 3TQEA 3RAXA 5E18F 1B59A 2Y8YA 4HH0A 2JHEA 2NUHA 1PUFA 1VDHA 3THVA 4HKQA 3PNIA 2HHTA 5A2QY 4PQUA 3O6QA 1ONVA 3OSPA 4B9SA 2BKPA 2NSCA 1YIJS 3N5FA 5K20B 4FT8A 5BOXA 2VJ5A 2EIJH 1FJCA 4A3DJ 4EM1A 4OI1A 1D1UA 1TV6B 2DNQA 1FEEA 2OFGX 3U1KA 2WW4A 4QIEA 3UQSA 5LHGA 1E0EA 4FXVA 3F21A 1N33J 4ASNA 1MWQA 1WORA 1G2EA 3S32A 1JLCB 4MKYA 3QIDA 2F63A 1RAOA 5EGOA 2JVHA 3OYLA 2B7CB 1N88A 3PUFA 4ZTFA 4M5LA 4AUXA 1ITPA 4PWDB 2E5IA 2NS0A 1FJLA 2DBBA 1B72B 1X9SA 4PR6A 2DFIA 3DEWA 3AAFA 2X7IA 3EXYA 4PABA 3KZIC 1GMUA 4KH0B 3N4MA 2EA2A 5DUKA 2YWKA 5AE3A 1UETA 2LVSA 1ZARA 1BY9A 2B56A 4I0AA 1RLCL 4B43A 2EEYA 1SIWB 2HS3A 4DLGA 1R0BG 3FXUA 5GAEU 3M2UA 3ZXWA 4KN4X 2VUGA 2IRYA 2VPWB 3GFJA 2M7AA 1HBUB 2PMZA 4ZVQB 3R8YA 4BL0B 1PC5A 4LF8J 3T9ZA 3L3CA 1S1WB 3AFHA 2X1BA 3CC7S 4DNCA 2MQQA 2OZUA 4Y17A 3NNHA 1YOVB 3EUAA 1U0JA 4BACA 4LR9A 4PZJA 2X1EA 3K2ZA 2JSPA 2HHQA 4WJBA 1NSQA 2K9NA 2XY7A 2F5DA 4XRFA 3MVPA 1VQ7S 2DRBA 1D0YA 3HVWA 2XPVA 5E0OA 4F50A 3CDHA 1TT0A 4F8RA 1JQGA 5F9NA 3MPDA 5H9EJ 1OLTA 1HMVA 3RYPA 4Y2KA 2ZBQA 4CUGA 3C6TB 3OL9A 1CPZA 1XD7A 1W2IA 1XGNA 3OOPA 5DGAA 3GU0A 2L4AA 1QDUB 2WVBA 3BQ2A 5L3EA 5TGTA 1DQUA 1F9EB 4B9VA 2CPIA 2TDXA 1U0HA 1S10A 3SJMA 4ELTA 3K7RA 5HL7Q 1U9NA 3ZGKA 3KFWX 4WU3A 2QM3A 1RT1A 4O4RA 2WK4A 3I58A 3O8WA 1C0UA 4XPEA 3ISPA 2PN6A 3DKWA 4OIOF 3VWBA 1LUJB 4N8NA 2EA4A 3QT7A 1RA6A 2GS8A 2W4DA 2DR8A 4P10A 4DV4J 4KYZA 2LF8A 2PEXA 2AGPA 3GLLA 1FZPB 2DYAA 1H3DA 2Z99A 3TAMB 3MZ8A 3GR1A 3DN9A 1Y10A 1HC8A 4IRIA 2RAEA 2Z8QA 1HKAA 3TEDA 1NSKL 1YITI 2BGCA 5K7ZA 4KDPA 2DMQA 4FYVB 5K8MA 2E5GA 2GHWA 1SVMA 2JSCA 1JK9B 2AJQA 1MSFC 3BO3A 2F9DA 2WA0A 4RB1A 4K4VA 4IVNA 5E5NA 1QVFR 3OXFA 1Y56A 1PP7U 2LMDA 4O6JA 3FZVA 4EJTA 3M30A 5DO2A 4OI0A 4C11A 3GZ6A 3QYEA 1RWOB 1IRFA 4OYAA 4ZVOB 3VCDA 5F6FA 5LGTA 3BG9A 4IDKB 3MGJA 2DK5A 2EK1A 1G3WA 2IAIA 2CDQA 1XX5A 1T94A 3D67A 4K5RA 2FVSA 5A8KA 3CTRA 3ZZOA 5HQMA 1IC8A 2NUUG 3MAHA 4GRIA 3ZQFA 3I56S 4AD6A 4KC5A 3HDDA 4MFDA 1TL8A 4ON0A 5H9FK 3BDDA 3HLUA 5EZHA 3R6LB 3OSNA 3TUIC 4R8UA 1GEHA 2BKNA 3PNVA 5HMXA 4WKYA 2QL9B 3P45B 2EV0A 3RTRA 2DO4A 4A4JA 2V4RA 2C42A 5KT3A 3C18A 1VBXA 2R5ZB 3LP1A 1SVOA 1EH7A 4QR2A 3WDOA 5HMZA 5FLXU 3V7SA 1H9TA 1VISA 3ZQIA 3EICA 5HLHA 4X4RA 1A35A 2Z2LA 2BEOA 4XO0A 4O3SA 3CCTA 2PO4A 3IN5A 2UXCJ 4K8RA 4ATNA 3VALA 3CMEI 2ESNA 3TUZC 2G7UA 3LSHA 3S7RA 2GC8A 2XY6A 4NLWA 5K8PA 5E1WA 2H1LA 2F4VJ 1WC5A 3VZIA 2EV5A 2XAFA 5IC6B 1VLOA 1TL7A 5IC4B 1WI3A 2CFXA 2P9EA 3EPIA 1K8AT 3CCWA 1EARA 3K70C 1FKOA 2LXIA 3CCQI 5B7WA 1KU7A 1QLNA 4IKFA 3VQTA 4HX8A 2D3ZA 3GO5A 2VFUA 5GAHJ 1Q0NA 5KOXA 4NXMF 3R61A 4CCHA 4KTQA 1TR0A 2FJEB 1XSVA 3HUGB 3D3CJ 5FKMA 1TWHJ 4MK7A 3MD2A 2H4YB 4IPAA 3FCHA 5U47A 1P1LA 1CF7A 1RTHB 1EETA 4WP9A 2XGXA 3QGPA 3QAUA 1UPPA 3BB5A 3B82A 3RJMB 3S8PA 4N56A 4E6KG 1RHUB 1C2PA 3CJTB 1GXLA 2VLAA 1EP4B 2KXFA 3PFIA 1VHIA 2FGOA 2BVZA 1VQ9I 1X4DA 4CLLA 2A5WA 1XDUA 3KG4A 4LF9F 2M4MA 4JI6F 4DU8A 3GUDA 2DDBA 3OHAA 1H88C 4IRKA 1FK9B 2YPZA 2QQ9A 3HRMA 3JSRA 2DPJA 1T9UA 2EFPA 3THPA 2O6GE 4EJUA 3IR6B 3EX7B 1VJWA 4OZ3A 1WJBA 2JUCA 2XAJA 4DSLA 1T11A 4XSXF 1WGXA 3MZIA 2MSYA 2QGFB 1FX2A 1A6LA 2RMLA 3TP2A 6FDRA 1XGSA 1UEVA 1MMAA 4Q5SF 2MLXA 3I59B 1VC5A 1FNOA 2F6CA 1OKRA 2GIZA 3FXQA 2FMYA 4O3OA 2EC0A 4CRJA 4E7HA 3TUPA 3B6AA 2CPDA 4KH1B 3R5DA 2ZJ2A 4DUYJ 2YTCA 5JVGF 2BW2A 2IJRA 4FDFA 2EZIA 2QC3A 5GAHI 2H8WA 1VQ5I 3ENVA 2OLWA 2QYOA 2X9DA 1Y9OA 2O8KA 4HNTA 3D9BA 4BJ6C 1W36D 4YP3A 4QPXA 1RBAA 1P4XA 3FGVA 2M4GA 1NMEB 2O1PA 1UL3A 4JB8B 1CEZA 4XRMA 2E1MC 2CZVC 1XGMA 4RW4B 2VA2A 3MOJB 3MWMA 1OISA 3I4PA 1HPZB 3S6EA 3WX8A 1X4CA 5DG9A 4KGXB 2OV7A 4ZLPA 4ZDNA 2HS0A 4QYZJ 3BZKA 3HYIA 1C1BB 1FWKA 1SQGA 5ETQA 1N75A 4J9KA 4F55A 2CQKA 4M3EA 1H7XA 1X4OA 3C1DA 3S1TA 3IWNC 4CZCA 2R7ZJ 4USH