5FB2A

S. aureus mepr f27l mutant bound to oligodeoxyribonucleotide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords MarR family regulatory protein
publication title S. aureus MepR F27L Mutant bound to oligodeoxyribonucleotide
rcsb
source organism Staphylococcus aureus
total genus 53
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5fb2A00
1I6XA 4OIPF 1EH7A 1ZGJA 1R22A 3KFWX 5LHHA 1LVAA 5CVRA 2ZXJA 2NYXA 1U3EM 4HX8A 4WF2A 2M30A 1R36A 4N9HA 5KK1A 4L5IA 3E97A 4JBAA 3ZMDA 2COMA 4CHUA 2AXLA 2P5LC 4L0ZB 3R0JA 4G7OF 4ON0A 2KKOA 1U5TB 2IJLA 2WTEA 5FO5A 3E6DA 3V7SA 4L9TA 2ETHA 4EQQA 2OAZA 5E1WA 3QU3A 3HOSA 4HV5A 3FMRA 2P4WA 4A6EA 1XDSA 2GZWA 3PQKA 5HLIA 2CWEA 1R58A 1YLFA 5CYVA 1S3JA 1E2XA 5DDGA 3ZMUA 2DPUA 1A04A 3CUQC 1BM9A 3ZMSA 2F5EA 4ZZLA 2XAGA 4KMUX 4HAMA 4LG0B 1G4DA 2MA3A 2DAOA 2YPRA 1ZYRF 5ILUA 2JPBA 3MWMA 1RIOH 5HDKA 2DLLA 1FX7A 3QOPA 5D8KB 1ULYA 3QRFF 1HQCA 1WI9A 3BROA 3KP4A 2X0LA 3GFIA 5ILSA 2QQAA 1R1TA 1FBSA 3D5LA 1IXSB 3DV8A 3E5XA 1PDNC 5K5OA 5E17F 4I7HA 5DCMA 3QAHA 4HDUA 3HUGA 2M87A 1BIAA 1K7AA 2KIFA 4FX0A 4U0WA 3BOQA 3MFKA 5BPIA 1IN7A 1R5HA 1KU3A 3JAMK 1B9NA 3LA2A 2H27A 2BE5F 1ONVA 4UVBA 1RI7A 3I54A 3FHZA 2XASA 1ZRFA 2XAJA 4I98B 5BOXA 3FXQA 1OR7A 2RGVA 2LKPA 4ESBA 2HKOA 1L0OC 5HDNA 3JTGA 1BI0A 2HR3A 1UHWA 1ZRDA 2FXAA 4BNCA 4PDKA 2DTRA 3EYYA 5E20A 1FZPB 3K1MA 3KZYA 4EJTA 1HXDA 5E1XA 3I58A 4I01A 1MZBA 4CO8A 4EJOA 1USTA 1FY7A 2A6HF 2UXNA 1JGSA 4XRFA 3GYHX 1YTYA 1USSA 1J0RA 1TQIA 1YW8A 4RGUA 3FXRA 2DK8A 3ULQB 1LQ1A 1WWXA 4KDPA 1SD5A 2GIVA 5E1ZB 4F7ZA 5LRSA 3WG9A 1YW9A 3FZVA 4MEXF 1XD7A 2EV5A 4PGGA 3RJPA 1ZG1A 4KN4X 3J7AO 5L3EA 2A68F 1T6SA 1MD0A 2NS0A 1TNTA 4WXDA 1PP7U 3GW2A 1YFHA 1G3WA 2GXGA 5IT9Z 3G73A 4GGGA 1HW1A 3O3KA 3ZMVA 2FOKA 2K4BA 2EV6A 2ACJA 4L9NA 3TO7A 3CDHA 1CF7A 1V4RA 2V1DA 1FWZA 4UVAA 4M71A 2K02A 1GVJA 1XMAA 2HTSA 2RDPA 4AVPA 3ROUA 1JE8A 2XKOA 2ZO4A 5JFRA 3P7NA 3I53A 4A0ZA 4BHCA 4RB0A 2DT5A 1FBQA 1SD6A 4M6YA 5K1YA 3VB2A 1F9NA 3F6OA 4QWQA 2OQRA 1IAWA 3VOEA 4A5MA 4KYWA 3ML6A 3IWFA 2QVOA 2YX4A 4YIFA 1Z6RA 2A6EF 2FMLA 2KIMA 3QP5A 4LLLA 2DK5A 5LRRA 3HRSA 3RDIA 1TQMA 4YG2F 2NAZA 1HSJA 4M9ZA 2YU3A 3E6MA 2IVMA 1XGOA 2L3DA 2CSOA 3I0TA 1SD4A 2VC0A 2F5CA 1ZRCA 4KUMA 3K1PA 3DFGA 2RKHA 2OU2A 4KICA 5ICCA 2HEOA 3GX4X 1XSVA 2XKPA 1FC3A 1FT9A 3HRMA 3KLOA 4ENNA 3FWEA 3F21A 1MGTA 4Z2YA 1G3SA 3F8NA 2FQ3A 2MLGA 4ZYDA 5FD5A 1UB9A 1XB4A 4LLGF 2M8EA 3VODA 1OYWA 3M8EA 3R6SA 2EWNA 1FNNA 2EFNA 2K4JA 3I4PA 1XSXA 3MCZA 5CVUA 1QGPA 1ZG3A 3M1EA 4A2UA 1FP1D 1WKMA 1X3UA 2QLZA 3KETA 1UCRA 2FMYA 5HDGA 1BC8C 1HSTA 3WTYC 2P5KA 5J8FA 2J5OA 2HFHA 1XSDA 3GWZA 3AAFA 3K69A 1F4KA 1MJBA 2DFIA 3E6BA 2HQRA 3KLNA 4ESFA 4D0PA 1SAXA 3WODF 1XGNA 4U0VA 1RUOA 4MQVA 2H94A 3L09A 1CF7B 3PQJA 1HKQA 1H9TA 2F5DA 3LA3A 2QYOA 3L00A 3F3XA 4PCQA 5FLXZ 3TDZC 4B8XA 3IKVA 1J7KA 2EK5A 4NHJA 1LDKB 3IC7A 2XROA 2VBXA 5F64A 3SQNA 1VTNC 1XCVA 3B73A 4YFKF 2FBHA 5BS6A 2HGCA 2RQPA 4QLCU 3LAPA 2ZNYA 4ZYHA 2CW0F 2QWWA 3WTVC 2VT3A 2JT1A 2FEZA 1SMTA 2ISZA 3QPTA 1WQ2A 3DKWA 3Q9SA 1FSHA 2XV4S 3P9IA 2DU9A 3V8KA 4EM0B 1Z7UA 3WTXC 4BAYA 1FYMA 4I02A 3HRUA 4FHTA 2EFQA 4P96A 4HV6A 3E3VA 3KP3A 1IN4A 2STWA 3C1DA 2XAFA 1U6GA 2QBYA 1T2KA 3FXUA 5EEHA 1OMIA 5CLSA 2FSWA 4NQWA 2BEOA 3L2CA 2V6CA 3KE2A 1XCBA 1TW3A 4HBLA 5HVQC 4CZZA 5CVJA 2ZKZA 1MKMA 2O6GE 5LEJA 5D6EA 5A2QK 1Z05A 5E18F 5CJ9A 2BYVE 5DD8A 2DBBA 4M74A 2P7VB 5BPDA 2HZTA 2NNYA 3K2ZA 1YW7A 4O3MA 5DV5A 3BJAA 3O6BB 4MHGA 5F6FA 5HS8A 5K5RA 1CGPA 3RIRA 5ICEA 3DF8A 5DYMA 2UZKA 1P4WA 4G94A 2FBIA 1KQ8A 5LGTA 1Z6TA 3ZPLA 3H92A 4MGRA 2M5WA 1BOAA 2VXZA 4K2EA 2AS5F 2HDCA 3EQLF 3MZHA 1T38A 1KYWA 3W6KB 3GUDA 2Z5UA 3WTZA 3QPHA 1G3TA 1J5YA 2EFPA 4IRGA 5HS9A 3GFLA 2W57A 1STZA 2VE9A 3TDUC 3J80Z 5DUIA 1LJ9A 1L3LA 5LBQA 2QUFA 2GWRA 1I5ZA 2ADUA 1G6NA 1IXRC 4I2OA 4L0YB 3NRVA 3RYRA 3J81K 3DP7A 5AONA 2ZBKA 3R4KA 5DD4A 2E7WA 3F22A 1W4MA 1W5TA 3ECOA 2A5YB 2A3SA 4N9IA 3FM3A 3ZQ7A 2R3SA 2P6TA 4G7HF 4I0AA 1YQAA 4O6JA 3K9TA 4XSXF 4HX7A 4LK1F 1KU2A 3GFMA 5CVIA 3CUQB 4R79A 1O7FA 1D5VA 3Q5FA 5CVVA 1C0WA 3COAC 1ZLJA 3U1DA 1S8NA 1OYIA 2XRNA 2P6SA 2WC2A 4FT8A 3BJ6A 3FM5A 5FB2A 1ZAOA 1ON1A 4KIBA 4HA8A 4ASNA 3WTUC 5LLQA 2B0LA 3V4GA 2D45A 4O5VA 5E8IA 2UWMA 3SXYA 2IA2A 2XIGA 4RS8A 4M9SA 4ZZDA 3WGGA 5D5VB 4LFUA 5J8CA 2QBYB 2PMHA 3NEUA 1WRJA 3GXOA 5FFXA 1FPQA 2RNJA 3DXJF 2OZ6A 1K78A 2L02A 1EH8A 2ZJ2A 1LDJA 2EFOA 2PMUA 4GYGA 3IKTA 3HYIA 2JZYA 3KEQA 3PFIA 1ZREA 5H6QA 3HSEA 3F72A 3E6CC 1P2FA 1ZHFA 4U7BA 2RC4A 2OBPA 3BP8A 4LMYA 2O0YA 4RAZA 2F5FA 5AIQA 4ZYGA 4IHSA 1YS6A 4XBFA 4NB5A 2PQ8A 3EYIA 2YR2A 5JI6A 5EEGA 2Y75A 2P8TA 2V1XA 1K6OA 1XMKA 2XGXA 4KT5C 5F1RA 4A0YA 2DPDA 3KEOA 4IHTA 3ZMZA 2Q0OA 3VEPA 3IL2A 4GYIA 1P92A 1YS7A 2Q2EA 2KRFA 1MJAA 4KA4A 1YO5C 2DQLA 4A6DA 1HW2A 5IT3A 2ZFWA 3GZ5A 1GHCA 2JTVA 1O3TA 3I59A 2H09A 4BH9A 2BBYA 5DCMB 4XSZF 1F5TA 5L3FA 1LDDA 1T98A 4EVIA 3RKWA 1J9IA 4LJZF 2RV8A 2QZ8A 3F8MA 3WGHA 4ZH4F 4H0EA 5IT9K 1YYVA 2H6BA 3SFZA 2RN7A 2PBIA 3V8LA 4A12A 4P9UA 4Y17A 1P4XA 2EFWA 2KJCA 1K79A 1XGMA 4M6XA 1B6AA 1KYZA 1ZN2A 4HOBA 1IUYA 1FYLA 2OQGA 2C6YA 4S04A 2CO5A 2PEXA 5JR3A 3RPUA 1TTYA 3HHGA 4YIIA 2BV6A 1S29A 2ZMEA 3JSPA 4EV0A 3D0SA 4UV9A 4BHPA 1K78B 3GFJA 3DPTA 2FE3A 3ZMTA 1OYYA 5ILVA 3HHHA 3M9AA 2YX7A 2QQBA 2P7CB 4R8HA 1G3YA 1H9GA 1Z1DA 3BY6A 4AIJA 1U2WA 3GF2A 5JHUA 5LGUA 1FBUA 2OD5A 1ODDA 5L3CA 1IN8A 4LLNA 1W7PA 4IRIA 1FLIA 1LEBA 1IF1A 1BJAA 1TW2A 4ETSA 1DPUA 4RGSA 4HLYA 2E7XA 2K86A 1XDUA 1OKRA 4HX4A 2PI0A 2W25A 4ZYEA 2CQKA 3JTHA 1U5TA 3O2PE 4RGXA 1ZH5A 4M9XA 3RYPA 3BJOA 4KFCA 3HOTA 2L54A 3E5UA 5BQTA 1TLHB 1IN6A 3ECHA 3KP7A 3IHUA 2VOPA 1W5SA 3T1BA 1ZGAA 4MTDA 4L18B 3GLXA 4LG0A 3LWFA 2V79A 2M1BA 2DI3A 4EJWA 2Y48A 2QQ9A 4HDVA 1U78A 5L3DA 5L3BA 3ZN1A 4OU0A 3RKYA 3ZN0A 4M73A 4S05A 5ICFA 4CYDA 1KQ9A 1Z9CA 1KU7A 3QU6A 3KCCA 3KZZA 3CO7C 2H6CA 3BZ6A 1QPMA 1SFUA 1O3QA 1S6LA 4B09A 1R1VA 1I1SA 4LB5A 1KA8A 3Q9VA 4IRHA 1J59A 5FLXK 2G7UA 1I27A 1B9MA 6PAXA 2G7HA 3REOA 4PZJA 2L4MA 2FA5A 4MQ9F 1U5TC 1IN5A 4KIGA 1T0FA 4G6DA 2A69F 3TO9A 5LGNA 2L01A 3BWGA 2DQRA 4UVCA 4BXUA 4EJVA 1ZLKA 4KNYA 2CFXA 5K5QA 3IWZA 3KP6A 1AOYA 3N4MA 5D5WB 3DEUA 2FF4A 3L9FA 2IT0A 2HOEA 2Z9OA 3IRQA 1R00A 5D6FA 1PUEE 4JK1X 2ESHA 5JVTA 3DQVC 3MQ0A 2CYYA 5D4RA 4G6QA 1J75A 1H0MA 4HQMA 4RB3C 3TOBA 1QBJA 3U2RA 3HRTA 5H20A 3G3ZA 4WK8F 1W7PB 5D5XB 3GEZA 3C7JA 4GO1A 3GZ6A 2M45A 4RAYA 4EJUA 4XLNF 1O3SA 2HYFA 1EH6A 4ENJA 2IRFG 1J2XA 1W7PD 3ZP5A 1B1BA 2R7DA 4HF0A 3HTUA 2F2EA 4Q48A 4LB6B 4BQAA 1Q1HA 1BI2A 2X4HA 5E8GA 3C3WA 2JRTA 2XUBA 3ELKA 3TO6A 5D4SA 1ZG5A 3F23A 1R1UA 1BN5A 3H3UA 5TRDA 3J81Z 5H6RA 2NNNA 4EM1A 4I0BA 1DUXC 1QQIA 2QENA 1OPCA 5ED4A 2UXXA 3GO5A 2HWVA 5J6XA 3T8RA 4LD5A 3H3ZA 3MEXA 3CTAA 2DO7A 4OIRF 4RB2C 2O3FA 2Z33A 2GAUA 4Y13A 1V3FA 4OINF 3C18A 3DPLC 5D5UB 5DEQA 4AD9A 3E5QA 2KJBA 2EA2A 2LF8A 1FOKA 2KIUA 4WXHA 2E1CA 2VONA 3CO6C 3SZTA 1BIBA 3JAMZ 1O57A 2Y0MA 4A0XA 1JXSA 4CXFA 4OIOF 2Q8KA 4OMZA 3V8JA 2W24A 1KQ0A 3ABUA 3J80K 3F6VA 4YFNF 3FF5A 2ESNA 3P9CA 3T5XA 5LHIA 3RKXA 1SFEA 3TOAA 2LDUA 3BDDA 4LK0F 2YSRA 4HF2A 3LQQA 3R60A 2FNPA 2OA4A 3WE2A 2IA0A 2VBYA 4CGZA 2PN6A 3P9KA 2HS5A 4Q5SF 3I71A 4AWXB 2R7FA 1I1GA 3M8FA 4UNOA 3W6JB 4UV8A 3R61A 2VODA 1P4AA 2PG4A 3ISPA 1O7LA 3HIFA 2D2WA 2VOOA 1GXQA 2DW4A 3R0AA 3WE3A 2CG4A 3EUHA 5ICGA 1GXPA 3WU0A 4HW0A 1BBYA 2QM3A 3MAJA 3KP5A 5DUKA 2OZUA 4A5NA 1Y0UA 2MD5A 4KIFA 4Q4ZF 4IJAA 1D8KA 1D8JA 3EETA 1DP7P 3OOPA 4BYYA 3WGIA 4G7ZF 4P55A 5HLHA 3HSFA 4HF1A 2HYGD 4GCVA 2ZNZA 1NHAA 2FU4A 3NQOA 4U7DA 4OIQF 4MEYF 2MH9A 5FFZA 1TQPA 2XAHA 4YFXF 3TQNA 1S7OA 4U88A 1UHMA 1T39A 1P6RA 2VBWA 1JHFA 2HQNA 1QNTA 2ISYA 2G9WA 3QP6A 1EV7A 1YG2A 3T8TA 1DDNA 2MC3A 1SFXA 1ON2A 2O03A 1FSEA 2IA1A 4GXOA 2GXBA 3RTRA 1QZYA 1IZ1A 4ENKA 2HKXA 3CJNA 2VT2A 1RUNA 2EV0A 2V9VA 3LQRA 4WCGA 4TV7A 4IXAA 2LNBA 5D8LB 3JW4A 3HTSB 5AIPA 1KGSA 3FX3A 3WTTC 4BHBA 1IRGA 1S7AA 4EMSA 1IRFA 4G8XA 4EGZA 4RGRA 4CICA 2JPCA 3BPVA 1MDMA 3I5UA 1U8RA 3ABTA 2W84A 3EDPA 3IRRA 3LAJA 5DCFA 4LGWA 4OMYA 3LSTA 3L7WA 5L3GA 3M7GA 4M72A 2XHKA 4L9JA 1SMYF 1D3YA 3LFKA 1KU9A 4MTEA 4WXCA 2EJRA 4U0YA 3V7CA 2CGPA 1TNSA 2E1NA 2MBFA 1R5GA 1HW5A 1UFMA 3CUOA 1R23A 1QO0D 2W85A 2VE8A 3S2WA 3F8FA 2MH2A 2GA1A 2J5PA 1B4AA 1XGSA 4OOIA 4DQ2A 2O8XA 2ZCWA 4EGYA 2A61A 2XVCA 4XLPF 3B02A 2FNAA 3SZPA 2GQQA 2RVCA 3BPXA 2VBZA 1B59A 4CDGA 3FMSA 2V1UA 2IPQX 2K7LA 4EM2A 4HLXA 3U9GA 3HSRA 1HKSA 3GVAA 1Z91A 2XAQA 2EB7A 4AIHA 3WTWC 5HOOA 2PLYA 2IW5A 4FX4A 5TJJA 2P5VA 4MNUA 3OV8A 4UHTA 1F1ZA 4HQEA 3WTSC 4IPAA 3RI4A 1BI3A 3KP2A 2BGCA 3WU1B 1IXCA 4WX9A 1XN7A 4L9VA 5FD6A 3SHFA 2WWYA 1JHHA 3TKYA 2MLKA 1WSUA 3VFZA 1BC7C 2FBKA 1FP2A 4R1HA 4KN7X 3K0LA 1AWCA 2D1HA 2EA4A 4E70A 4ENMA 5LEKA 1RNLA 4AIKA 2GA2A 2LSOA 3RPQA 1TBXA 4I09A 1LB2A 3K1NA 2D1VA 1E17A 3JSOA 5LHGA 5FGMA 2FRHA 1HKTA 2VN2A 4Y15A 2TDXA 1QZZA 2HTJA 1PP8F 2IP2A 3F8BA 1BI1A 3FMQA 1O3RA 1REPC 1MDMB 3F8CA 2L4AA 3I59B 4N0BA 3I64A 4UUVA 3ERED 5HLGA 1DPRA 2O61A 5KVRA 4DNCA 4P9FA 4L5JA 3T0YA 4HYEA 1LNWA 1MJ9A 2PFBA 2WV0A 4UXNA 1FYKA 2JSCA 4Q47A 4JQFA 2PJPA 3V7RA 4ESJA 1R7JA 2LF7A 4HZFA 2NRAC 3TGNA 2ELHA 4RB1A 1HBXG 5ERIA 3CLOA 1ZARA 5HS7A 2VC1A 3LA7A 1LEAA 3CUQA 2STTA 2K27A 1RZ4A 4WWCA 1IW7F 3N97A 4IF4A 2Z3YA 4G9YA 2ZMEB 1SD7A 2Z99A 3MZYA 1YIOA 2A07F 4KMFA 4IVNA 5BMZA 4P5OA 5A2QZ 4PGHA
chains in the Genus database with same CATH superfamily
5K7FA 4X0GA 1I6XA 4OIPF 3JRIA 1EH7A 3KX2A 1ZGJA 1R22A 1WJAA 3KFWX 5LHHA 1LVAA 2M34A 2DOAA 3ZGKA 1QHHD 5CVRA 2HQ5A 2ZXJA 2NYXA 3DU6A 5FKNA 4HX8A 1U3EM 4WF2A 2M30A 4BXXJ 4ZDOA 1R36A 4N9HA 1ETYA 1DGWY 3NARA 1NK2P 5KK1A 4NDLA 1I39A 1HDDC 2FQ4A 4L5IA 2GOXB 2CS3A 2DA3A 2W00A 3L2QA 4HNTA 4EATA 3E97A 4JBAA 3ZMDA 2COMA 2Y9ZA 4CHUA 1FIAA 2AXLA 1SVLA 1X1BA 2XGCA 4UB6C 2P5LC 5CKTA 1F36A 4L0ZB 3R0JA 4G7OF 4HRIA 4ON0A 2KKOA 2Y31A 3BTLA 1Y8RB 2BY3A 4PJNA 1U5TB 2IJLA 1ENHA 2ID6A 2WTEA 5FO5A 3E6DA 2CUJA 1VQ8I 3V7SA 4A3FJ 4L9TA 2ETHA 4EQQA 3ERMA 2OAZA 5E1WA 3QU3A 3WHCA 3HOSA 4HV5A 2QQ8A 2L7ZA 3FMRA 3ESWB 3D5SC 4C2UA 5JHFA 2P4WA 2VL8A 2FJ1A 1XDSA 2GZWA 3JCUC 4A6EA 3HZJA 1NH3A 1FEXA 3PQKA 5HLIA 2CWEA 1R58A 1YLFA 3PO2J 3L2WA 5CYVA 1S3JA 1VZ0A 3L2VA 4XRMA 2IXSA 1E2XA 5DDGA 3ZMUA 2DPUA 1A04A 1D0XA 3CUQC 1ZGWA 1BM9A 2X1DA 3FXMA 2ELJA 3ZMSA 3FHNA 2F5EA 4ZZLA 5J4YA 1X2NA 2MC4A 2XAGA 5LFAA 4KMUX 4HAMA 3BR6A 4PK4A 2VJIA 1FOYA 5K7HA 4LG0B 2F6CA 4LITA 1G4DA 2MA3A 3A01A 2DAOA 2YPRA 5BNGA 1ZYRF 4AUXA 5ILUA 2JPBA 4XRSA 3MWMA 2VJ5A 1RIOH 5HDKA 2DLLA 3CMAI 4XL9A 2DA6A 4XKCA 1ZKGA 1FX7A 3OIPA 2L9RA 1JI8A 3CCMI 3IP4B 4E7ZA 2E5NA 3QOPA 5D8KB 4D9JA 5IYDJ 3QWLA 2Y0SN 3SJMA 1ULYA 4PJJA 4RA2A 3JRDA 3QRFF 1HQCA 1WI9A 3BROA 1E3PA 3A03A 3KP4A 2I5UA 2X0LA 3BTCA 2JUGA 2R5YB 3GFIA 4C2TA 1T95A 5ILSA 2QQAA 2I8DA 3ZQCA 1R1TA 3HOZJ 1FBSA 3D5LA 4A3JJ 1E3OC 1IXSB 3PNVA 3DV8A 3E5XA 3RKQA 4QSHA 3FBIB 1PDNC 5K5OA 5E17F 4I7HA 5GTHC 5DCMA 3BR0A 1SANA 2ICWG 3IUOA 3E0JB 3IV5A 4I99C 1QHGA 2EIKH 3QAHA 4HDUA 2R92J 2ZSHB 2XC7A 3HUGA 3RZDJ 2M87A 2ZC2A 3BTJA 1BIAA 2WV1A 5JVGF 2HXIA 2Y0SA 1K7AA 2KIFA 4FX0A 4IOCF 4U0WA 1SVMA 5M5WJ 1OCCH 2XB5A 3HEFA 1RPWA 1Y1VJ 3BOQA 3MFKA 5BPIA 1IN7A 3RQIA 2JA5J 1R5HA 4A3KJ 4QPQA 2CV2A 3WG7H 3BQYA 1KU3A 3LSIA 3JAMK 1B9NA 1X19A 4BEHB 2W82A 3LA2A 4BBRJ 2H27A 2BE5F 1ONVA 1OJLA 4UVBA 3SDGA 1RI7A 3I54A 2K9SA 3FHZA 2XASA 3PL8A 3H9GA 3GTLJ 1ZRFA 3L2UA 2Z1DA 2XAJA 4I98B 4V2GA 3PO3J 1MNMC 4JX5A 3BCAA 2JVHA 5BOXA 3ZQFA 3A0BC 3FXQA 1OR7A 2RGVA 4QPOA 4AYBN 4G6TB 1SAUA 2KDOA 4ZJZA 2LKPA 3SZGA 2HKOA 4ESBA 1L0OC 2CRGA 5HDNA 3ZQLA 4D7MA 5E3MA 3JTGA 1BI0A 1RETA 2HR3A 4W97A 5F08A 5EDNA 1UHWA 3A2KA 1ZRDA 2FXAA 2AHQA 4BNCA 4PDKA 3RCOA 4CYCA 4XONA 2DTRA 2BW3B 1ETKA 2IBDA 2OPTA 4CZCA 2R7TA 3OYGA 3EYYA 4IHXA 1VQOI 4YRVA 3BCBA 3FXLA 5E20A 1FZPB 3ZQQA 3K1MA 1VF9A 1T8IA 2R7ZJ 1BR4A 1T08B 3KZYA 4EJTA 1HXDA 1B72B 5E1XA 1WJFA 3I58A 4I01A 3SYTA 3K4LA 1MZBA 3CP8A 4CO8A 4N4NB 5CQEA 4AYBA 4EJOA 4XOPA 1USTA 4HEA2 3H35A 2NS8A 1FY7A 2KFDA 2A6HF 2UXNA 2LFBA 3HOWJ 3G2BA 1JGSA 4ZDLA 1JKOC 3K2AA 4PJ0C 1MBFA 4XRFA 5EYRA 3GYHX 2LR8A 5IY5H 1YTYA 3P5JA 1USSA 1J0RA 1N78A 1TQIA 1XC5A 3K4JA 1IGNA 1ETOA 2ZSIB 1YW8A 2L2OA 4RGUA 3FXRA 1BW6A 2GLOA 1LFUP 3JRCA 2DK8A 2XGEA 4DBQA 3ULQB 2MW8A 1LQ1A 1WWXA 4KDPA 3U21A 4B48A 1SD5A 2GIVA 2JSPA 5E1ZB 3VYRB 4F7ZA 4UUTA 5LRSA 3LMMA 3A01B 4BQOA 3WG9A 1YW9A 2DN0A 3FZVA 3QQAA 4MEXF 2DXIA 1A6IA 1XD7A 2JWTA 4Y52J 2EV5A 4OWRB 4PGGA 3RJPA 1ZG1A 4KN4X 3J7AO 5L3EA 2LC2A 5GAHJ 5KNLA 3CCUI 2A68F 4AM3A 3K4KA 3HGGA 1T6SA 1MD0A 2NS0A 1TNTA 1S5LC 4WXDA 1FTZA 1PP7U 3CJQB 3PSIA 2O5RA 4S0HB 3GW2A 2DYRH 1TP4A 3S93A 1YFHA 1G3WA 2GXGA 5IT9Z 5J47A 3G73A 4GGGA 1HW1A 3O3KA 3ZMVA 2FOKA 2K4BA 2EV6A 2ACJA 4L9NA 3TO7A 3CDHA 1DU0A 1CF7A 4MFDA 1V4RA 4B3XA 1YJ9I 4A3CJ 2EILH 4BL0B 2HDDA 5DM7F 4BBSJ 2V1DA 1FWZA 3S32A 4II3A 4UVAA 4M71A 2K02A 1GVJA 1XMAA 2HTSA 2RDPA 4AVPA 5E79C 3ROUA 3K4NA 4CCNA 1JE8A 2XKOA 2ZO4A 4JOMA 1R71A 2W4SA 5JFRA 3ZXSA 3P7NA 1XMXA 2LREA 3RZOJ 4BXFA 3I53A 4JP0A 4A0ZA 2M4KA 4RB0A 4BHCA 3I4MJ 1WPKA 2DT5A 1FBQA 1SD6A 3HUGB 4M6YA 4D1QA 3M07A 5K1YA 4Y7NJ 3TP3A 3VB2A 5F0HA 1F9NA 4CCMA 2XSDC 3F6OA 4QWQA 2OQRA 1IAWA 3PIOF 3VOEA 4A5MA 4KYWA 3ML6A 3IWFA 1B8IA 2QVOA 2YX4A 3BZCA 4YIFA 1Z6RA 2A6EF 1FOWA 1IV6A 2FMLA 2KIMA 3QP5A 1MW7A 4LLLA 2DK5A 3M8JA 5LRRA 3HRSA 3RDIA 1TQMA 4YG2F 2NAZA 1HSJA 4M9ZA 2X6XA 4JX4A 5B1BH 3KZIC 1A6QA 1S72I 2YU3A 3E6MA 2IVMA 3DPUA 1XGOA 2L3DA 2XDVA 2HVQA 2CSOA 2OCCH 2DCEA 3I0TA 1SD4A 3J7ZI 2VC0A 4OAYA 2F5CA 3ASOH 2LBFB 1W0TA 4KUMA 1ZRCA 1T33A 3K1PA 1HA8A 3OYFA 4M3DA 2CJJA 3DFGA 2RKHA 1MBGA 2OU2A 4KICA 5ICCA 2HEOA 3GX4X 2LYCA 1XSVA 1ZELA 1XTAA 4YELA 2XKPA 1FC3A 1FT9A 3HRMA 2PJRB 3KLOA 1DQUA 1GLNA 4ENNA 3FWEA 3K6GA 2QSGX 4DZJA 3F21A 1MGTA 1QRYA 4Z2YA 4PJLA 2KHMA 1G3SA 3F8NA 1Z67A 2HDWA 4P1WA 2FQ3A 2MLGA 4ZYDA 5FD5A 1UB9A 1PUFB 2EIJH 1XB4A 2QKMB 4LLGF 3OS1A 4A3DJ 3BR3A 2M8EA 2B9SA 3HB9A 4AIDA 1DU6A 4NNJA 3VODA 1OYWA 3M8EA 3R6SA 5HLTA 2EWNA 3SEZA 1FNNA 3HG9A 2EFNA 1MMDA 3CMMA 4NUBA 2DT6A 2WY7Q 2K4JA 3I4PA 1XSXA 2KP6A 3MCZA 3MKWB 3CC7I 3I55I 5CVUA 5F0FA 2DDAA 1QGPA 1ZG3A 2QA4I 3M1EA 4A2UA 1FP1D 3FXOA 1WKMA 1X3UA 3CDLA 2QLZA 3QYBA 3KETA 4V2FA 1Z77A 3DKYA 1UCRA 3OIQA 2FMYA 5HDGA 2EZHA 4EEFG 4CUGA 1BC8C 4E4HA 5EG0A 3H1CA 2DJIA 1HSTA 3WTYC 3BLYA 2OTLI 2P5KA 5J8FA 1FIPA 2J5OA 2GOMA 2HFHA 4RMNA 1A5JA 1XSDA 1X3ZB 3GWZA 2HOTA 3AAFA 3M1CA 2IS4A 3K69A 1VQMI 1MJBA 2DFIA 3PNYA 1F4KA 4E7JA 3E6BA 2HQRA 2A5WA 3KLNA 5F0CA 4ESFA 5FRNA 4G12A 1JKPC 4D0PA 1SAXA 3WODF 1XGNA 1MBEA 4IHWA 4U0VA 1HLVA 2R7WA 4MQVA 1RUOA 3VYUB 3ZRGA 2H94A 3OYCA 3W2WA 3L09A 1CF7B 1Z21A 3PQJA 1HKQA 1H9TA 2F5DA 2DMQA 2OF7A 3LA3A 2QYOA 1JUSA 1D1AA 2LY1A 3L00A 3LOCA 3F3XA 4PCQA 5HNFA 5FLXZ 1YITI 3TDZC 5HNHA 4FASD 3G4SI 4B8XA 3IKVA 4BUPA 1K6YA 5B3SH 1J7KA 2EK5A 4NHJA 1LDKB 3IC7A 4C2MJ 2VBXA 1FMWA 2Y30A 5F64A 5M3MJ 3SQNA 2XROA 1VTNC 4UY8I 1XCVA 3B73A 3U1KA 4YFKF 2FBHA 1UJ8A 5BS6A 3CMEI 2HGCA 2RQPA 4QLCU 2G0EA 4A3GJ 1HDPA 3LAPA 4DW6A 1ERDA 2ZNYA 3UR3C 4ZYHA 1G2HA 3LSKA 2CW0F 3BG9A 1ZTRA 4XR6A 2QWWA 3AG4H 4Y33A 4QIWN 3WTVC 2KISA 2JT1A 2VT3A 1LE8A 2FEZA 1SMTA 5GAEJ 2X6WA 1WGXA 4C30A 2ISZA 3QPTA 1WQ2A 3KIOA 3DKWA 3Q9SA 2L5QA 1FSHA 3IAS2 2XV4S 3P9IA 3RSNA 2DU9A 3V8KA 4EM0B 1Z7UA 5KAIC 1D5YA 3S1MJ 3WTXC 3FXKA 4BAYA 4HPQA 2CQNA 3LSPA 2R0QC 5GAGJ 4A93J 1FTTA 2A6TA 1GV2A 2DFHA 1QZEA 2DMTA 1FYMA 4HNVA 4I02A 1QPIA 1S9HA 3LL7A 2OV7A 3S3NA 3HRUA 4FHTA 4M3FA 2EFQA 1I3QJ 2NXNB 4P96A 4FTHA 1JT0A 4HV6A 3E3VA 3GTQJ 3KP3A 4E6KG 1VQ9I 1IN4A 4LG3A 4XORA 2STWA 2HVSA 3C1DA 2XAFA 1U6GA 2VKEA 2QBYA 3HOUJ 1T2KA 3ABLH 3FXUA 5EEHA 1OMIA 4MIMA 5CLSA 2FSWA 1YJWI 4NQWA 2BEOA 2DTZA 3L2CA 4KISA 2V6CA 3KE2A 3RQ4A 1NG6A 1BW5A 4A3LJ 1XCBA 1TW3A 3LSMA 4HBLA 5HVQC 4CZZA 5CVJA 3UKGA 2O9LA 3L1PA 1A31A 2ZKZA 5FJ8J 2M4GA 4J01A 3BG7A 3JRBA 1MKMA 3JR9A 1VQ6I 4BDYA 2VJJA 2O6GE 1D0ZA 3G6EI 2OTJI 4M3EA 5LEJA 2X1EA 1OISA 5FKMA 5D6EA 5A2QK 2XAUA 3PM1A 2DMUA 1Z05A 3K4BA 5E18F 5CJ9A 2BYVE 3HXLA 2DA1A 4DIQA 3CJRB 1AKHA 5DD8A 3PFYA 2DBBA 4M74A 2P7VB 2QF7A 3CMYA 5BPDA 2DFFA 2HZTA 2NNYA 3K2ZA 1YW7A 4O3MA 3GTMJ 5DV5A 1BOBA 2NOJB 3BJAA 3O6BB 4MHGA 5F6FA 2CFOA 5HS8A 5K5RA 2EZIA 2Y2ZA 1CGPA 2CUZA 3NAUA 4RLQA 3DF8A 3RIRA 5ICEA 2KPMA 1K4TA 5DYMA 2UZKA 5EF6A 1YX5A 1P4WA 4G94A 2AO9A 4XLFA 2FBIA 2M7BA 1KQ8A 5LGTA 1Z6TA 1VQKI 3ZPLA 3H92A 4BJ6C 4MGRA 2M5WA 1BOAA 2VXZA 4K2EA 3MKZA 3DEWA 2AS5F 5B5EC 3ABMH 4II2A 1R4MB 2HDCA 3SEQA 2KT0A 3EQLF 5GP9A 3MZHA 2GIZA 1U0JA 1T38A 1KYWA 3W6KB 2DDBA 3GUDA 1OCTC 1TWGJ 2Z5UA 3WTZA 3QPHA 1G3TA 2HPIA 1J5YA 2EFPA 4IRGA 4YEJA 3H36A 1XPXA 3DCFA 3MN2A 5HS9A 2NVXJ 3GFLA 2W57A 1MIJA 4NC8A 1STZA 1V54H 2VE9A 4RM2A 1W1WE 2L9NA 2JA8J 3TDUC 2V9KA 3J80Z 5DUIA 1LJ9A 4BJ5C 1L3LA 5LBQA 2E19A 1U9NA 2QUFA 2GWRA 1YIJI 1VI0A 3DLAA 1UELB 5LD2C 1I5ZA 2ADUA 1G6NA 1IXRC 1X1CA 4CCLA 4I2OA 4L0YB 3NRVA 2ID3A 3RYRA 2ELKA 3J81K 3DP7A 3JREA 5AONA 4M6VA 3TL4X 1E3HA 2ZBKA 3R4KA 3S14J 5DD4A 2E7WA 4XK4A 3F22A 5H2FC 1W4MA 1W5TA 3ECOA 1ORKA 2R7UA 2A5YB 3OWTA 2A3SA 1YJNI 1JUPA 2IGKA 4N9IA 3FM3A 1R6RA 1BA5A 3ZQ7A 2R3SA 3D5RC 2P6TA 4G7HF 4I0AA 1YQAA 1CQTA 4O6JA 2COBA 3K9TA 4XSXF 2OUMA 4HX7A 4LK1F 1JJ6C 1LE8B 5DM6F 3GMEA 1N25A 3VYTB 5FLMJ 1KU2A 3OS0A 2LKSA 3GFMA 5CVIA 3CZ6A 3CUQB 4R79A 1O7FA 3ASNH 1D5VA 3Q5FA 5CVVA 1C0WA 3COAC 1Y39A 2K3PA 1LPQA 1X4OA 4F91B 1ZLJA 3U1DA 1S8NA 1OYIA 2V26A 2XRNA 4XMYA 2P6SA 2WC2A 1PVEA 4IQJA 4FT8A 3H5AA 3BJ6A 3FM5A 5FB2A 1U8BA 1ZAOA 1ON1A 4KIBA 2NVTJ 4HA8A 4ASNA 1LKXA 3WTUC 2DOFA 2B0LA 3V4GA 5LLQA 2LD5A 2D45A 2E1OA 4O5VA 5E8IA 2UWMA 1ETVA 1RRJA 3SXYA 2IA2A 2XIGA 2VQCA 1VQNI 4RS8A 3S15J 4M9SA 4ZZDA 9ANTA 3WGGA 1QVUA 4LFUA 5D5VB 5J8CA 2QBYB 1BL0A 3ABKH 2PMHA 2L9SA 3NEUA 4BDZA 1WRJA 2JA2A 1AU7A 3GXOA 5FFXA 5EGOA 1FPQA 2RNJA 3O8HA 3TEDA 4CH7A 3DXJF 2OZ6A 1K78A 2L02A 1EH8A 2MSYA 2IS1A 2ZJ2A 2CQXA 1LDJA 2EFOA 1IC8A 1G8XA 2PMUA 4GYGA 3IKTA 2E5ZA 2RAEA 3HYIA 5F04A 4NC7A 3L2RA 2JZYA 3KEQA 2X9DA 3PFIA 2EH3A 3OS2A 1FOXA 1ZREA 2BVLA 2NS7A 5H6QA 3HSEA 3K70C 2GXAA 3F72A 3E6CC 5B1AH 1XS9A 1P2FA 4NC6A 1ZHFA 1AKHB 4U7BA 3OYMA 2RC4A 2OBPA 1XG1A 3BP8A 4LMYA 2O0YA 4MFEA 4RAZA 1UG0A 1X4PA 2F5FA 1RR7A 2KL4A 5AIQA 1MNEA 2ZB9A 4ZYGA 2UUZA 3OIOA 4IHSA 1YS6A 4XBFA 4E7IA 3S3OA 3FK6A 4NB5A 2PQ8A 3EYIA 2YR2A 5CQGA 5JI6A 2ECCA 5EEGA 2N8GA 5C3EJ 4XLHA 1V55H 3DTEA 4MO7A 3VSLA 2Y75A 2P8TA 1PJRA 1H8AC 2HZDA 4KJZA 2V1XA 1K6OA 2VIXA 2BY1A 1XMKA 2EZKA 2XGXA 3EPZA 1SVOA 4KT5C 1JKRC 5F1RA 4A0YA 1BJZA 4DBRA 4B43A 2DPDA 2Y9YA 3KEOA 3M4OJ 2HOSA 4IHTA 2FUG2 3WHBA 3ZMZA 2Q0OA 1RR8C 3VEPA 3IL2A 3FKJA 4ZTFA 1H88C 4GYIA 4BE2A 3H5RA 1P92A 3CCVI 3TP0A 1SEUA 1YS7A 2Q2EA 3DBLB 2KRFA 2VB6A 3DBRB 1Y1WJ 1MJAA 4DYRA 2GBYA 2VLAA 4KA4A 3AL0C 2OCEA 5FKOA 1YO5C 2DQLA 2IAIA 3BC8A 4A6DA 2RREA 1SFOJ 2DA2A 4D5FA 3KYLA 5IT3A 1HW2A 2ZFWA 2KQRA 3GZ5A 2UV1A 2DOEA 2CMPA 3CCSI 1OCOH 2W48A 1TWHJ 3QPSA 2QEXI 1GHCA 2E60A 2VQHA 1TWFJ 1Z0XA 4V19K 5E3LA 2KIQA 2JTVA 4I6ZA 3G1LA 1O3TA 3I59A 4XIDA 2H09A 2MG4A 3Q3SA 1R49A 4BH9A 2VPRA 2BBYA 5DCMB 4XSZF 1F5TA 3K70D 1JJ8C 3H0DA 2CQ7A 5L3FA 1LDDA 1T98A 3QOEA 4EVIA 3I9V2 3RKWA 3OL3A 1J9IA 1MMNA 1I3AA 4LJZF 2Z2SB 1V5FA 1IO2A 2RV8A 3HPGA 2QZ8A 3F8MA 3WGHA 4ZH4F 4H0EA 2LKXA 5IT9K 1YYVA 2H6BA 3GZNB 3MZ8A 3SFZA 1LVKA 2PMZN 2V9PA 2HXOA 2RN7A 1GV5A 3MD2A 1EA3A 1P7IA 2PBIA 2ZXHA 3H3VK 3V8LA 4RBOA 4A12A 3Q0WA 5J3LA 1ITYA 4P9UA 4Y17A 1P4XA 2EFWA 3VWBA 1HOMA 2KJCA 1K79A 1OCPA 5FKKA 1R5ID 1XGMA 4M6XA 1ZQ3P 3CF5F 1ETXA 1B6AA 1KYZA 1ZN2A 4HOBA 4IKFA 2XPVA 1IUYA 1FYLA 2OQGA 2X85A 2C6YA 2M9HA 2TCTA 4S04A 2BZTA 1VQLI 4B4CA 3DLLF 4BY1J 4Y3OA 2CO5A 2PEXA 4FE7A 1TT5B 3IH2A 5JR3A 3RPUA 1TTYA 3LFUA 5EGOB 2AXTC 2L0KA 4CYCB 3HHGA 3I4NJ 3S3MA 4YIIA 1HF0A 2BV6A 1S29A 3GTGJ 3PUBA 2IS6A 1UHSA 2LY2A 2PMZA 2ZMEA 3JSPA 3K4CA 4EV0A 2K9NA 3D0SA 1MH3A 4UV9A 4BHPA 1Y56A 2E34A 1K78B 5FLVA 2F4IA 1N75A 2WAEA 1A35A 1FMVA 3BZKA 3GFJA 3DPTA 2FE3A 3ZMTA 1OYYA 5ILVA 3HHHA 3M9AA 2YX7A 4BS9A 1SC7A 2QQBA 2P7CB 2I10A 2M2EA 3IH4A 1G3YA 1H9GA 1Z1DA 3BY6A 4R8HA 4AC0A 3CCJI 4AIJA 4NBQA 4UUSA 1U2WA 3GF2A 1X3WB 3BG5A 5JHUA 3OY9A 5LGUA 1FBUA 2HVRA 3H5NA 2OD5A 3TW7A 1ODDA 4OAZA 1GDTA 5L3CA 1NTCA 1IN8A 4RLFA 4LLNA 5FRMA 3S17J 4M3GA 2K9QA 1QU3A 2DA7A 1W7PA 4IRIA 1FLIA 5F1JA 3C2GA 1POGA 1IF1A 5EEAA 1LEBA 2B63J 2JA7J 1BJAA 1TW2A 2KLOA 4ETSA 2JQ7A 4RAFA 1Z3YA 2K85A 5IYBJ 1DPUA 1VQ7I 2NVUB 4RGSA 4HNUA 2NVYJ 4HLYA 2E7XA 5IYCJ 1I6HJ 2K86A 1XDUA 1OKRA 4HX4A 2ME6A 3FK7A 1SFKA 2VQGA 3F9KA 4IZZA 2PI0A 1R4NB 5IPAA 2KDZA 4PJMA 2W25A 2LMDA 2CQKA 4XOTA 4ZYEA 4I76A 2E36A 4IQ4A 3JTHA 2CW8A 5IOZA 1U5TA 5EJCA 5E3NA 3O2PE 1MBJA 4RGXA 4B47A 1ZH5A 2R93J 1OCZH 3S8PA 1D1BA 3FXJA 1EF4A 4JYKA 3OMYA 4M9XA 3RYPA 3BJOA 2WBMA 4KFCA 4CSWA 2LVSA 5CPRB 3HOTA 4XNFA 2L54A 3CJTB 1R9TJ 2KZGA 3PIPF 3SDBA 3E5UA 5BQTA 2E1MC 1TLHB 1IN6A 3MKLA 3ECHA 1VFCA 1FJLA 3KP7A 4IHYA 2EINH 3IHUA 1W5SA 2VOPA 2XPUA 2FD5A 2ZMEC 3T1BA 1ZGAA 4CCJA 4MTDA 2W1OA 4L18B 3CC4I 1X2MA 3GLXA 3H9JA 3K10A 4LG0A 4F3QA 3LWFA 2V79A 2D5VA 5FKLA 1TZLA 2M1BA 4PFOA 2DI3A 3CP2A 2Y48A 4EJWA 2QQ9A 3DTKA 1YE9A 3VYSB 2R7OA 4FETA 2R5ZA 4HDVA 3S2DJ 2H8RA 1U78A 5L3DA 2DA4A 2IEKA 5L3BA 3OL4A 4GFBA 3ZN1A 1WJDA 4OU0A 3RKYA 3ZN0A 1IG7A 4Y4RA 4M73A 1NG7A 4S05A 5ICFA 4CYDA 1KQ9A 3DTIA 5J40A 4BE1A 3HGYA 2H8WA 4RDUA 4AVZA 4GRIA 1Z9CA 1B8IB 1KU7A 3QU6A 2BVMA 3KCCA 3KZZA 3CO7C 2H6CA 2MGQA 3BZ6A 1QPMA 1SFUA 1O3QA 3HPHA 2E35A 2XRLA 1S6LA 4B09A 1JUMA 1R1VA 4BE0A 1I1SA 4LB5A 1KA8A 3Q9VA 4IL6C 2R4GA 4XN0A 4IRHA 1J59A 5FLXK 1X1PA 2G7UA 3QYEA 1I27A 1B9MA 4F92B 6PAXA 1GVDA 2G7HA 3REOA 4PZJA 2P0WA 2L4MA 2FA5A 2A05A 4MQ9F 1K4SA 1U5TC 1IN5A 4KIGA 1T0FA 3MMYB 4G6DA 2ECBA 2A69F 3TO9A 5LGNA 2L01A 4IHVA 4KT6A 3BWGA 4PSXA 2DQRA 3OSGA 4UVCA 4BXUA 1WJ5A 4EJVA 3W6VA 2DODA 2ZFUA 3A1YA 1ZLKA 4KNYA 2CFXA 5K5QA 5GADJ 3IWZA 2EZLA 5HODA 2R7XA 1QA6A 2X6OA 3KP6A 3CCLI 3S16J 3BT9A 1HC8A 1W0UA 1WZ2A 1AOYA 3N4MA 3RPUD 1YI2I 4IX7A 5D5WB 3DEUA 2FF4A 1W36C 3L9FA 4C3IJ 2IT0A 2HOEA 2HU9A 2Z9OA 3IRQA 1R00A 2K9LA 5D6FA 3SFIA 2WB1N 4FISA 4UUSB 1PUEE 4JK1X 2CH0A 2ESHA 5JVTA 3OYEA 3DQVC 1IV8A 3MQ0A 2EIMH 2BHYA 2CYYA 2LRDA 2VI6A 4DOZA 4G6QA 5IP9J 3I3LA 5D4RA 3OYJA 1J75A 1H0MA 5E3OA 5EZGA 3AG3H 5TGTA 2LH9A 4HQMA 2V1NA 4RB3C 5M5YJ 3TOBA 1QBJA 3U2RA 3HRTA 2BXZA 5H20A 3G3ZA 4WK8F 1W7PB 2BW3A 3C7JA 2QSFX 3GEZA 5D5XB 3ZR8X 5J4VA 4GO1A 2R7VA 3GZ6A 2M45A 2EQRA 2XF6A 2KZVA 3GTJJ 4XKWA 3S1NJ 2R7QA 2JK3A 4RAYA 4BQNA 4EJUA 1Z7LA 2XF5A 4XLNF 2HYFA 1EH6A 4ENJA 1O3SA 2NVQJ 5M3FJ 2IRFG 1J2XA 1W7PD 3ZP5A 1B1BA 1B72A 2R7DA 1A36A 2WB1A 2BY0A 4HF0A 3HTUA 2JMWA 1WJEA 2F2EA 4Q48A 5EG0B 3TBIA 4LB6B 1P9QC 2HQAA 1Q1HA 4BQAA 1BI2A 2CUFA 2X4HA 5E8GA 2JA6J 2M7AA 5KHDA 3C3WA 2JRTA 2XUBA 3ELKA 3FISA 3TO6A 3CCQI 1MMAA 1M1EB 2VKDA 2OJED 5D4SA 1ZG5A 2LLKA 2X1CA 3F23A 1R1UA 1UAAA 1BN5A 3H3UA 3LSRA 5TISC 3CCEI 1T0FC 5TRDA 4IO9F 3J81Z 3Q0VA 3NWSA 5H6RA 4F93B 2NNNA 4EM1A 1V5GA 4I0BA 1DUXC 1QQIA 2QENA 3OYIA 2RNGA 1OPCA 4ZDPA 1RKTA 3EUKL 5ED4A 2UXXA 3GO5A 1MBHA 2HWVA 1V5EA 5J6XA 3T8RA 2LG4A 1W5CC 4ZYAA 4LD5A 3AG2H 3DKXA 1KZHA 4BKXA 1MH4A 4B3AA 3H3ZA 4J00A 1W36D 3MEXA 1TWCJ 2VKVA 4E7HA 2R5ZB 3CTAA 2DO7A 3A4CA 4OIRF 4RB2C 1E0EA 1JKQC 2O3FA 1NK3P 2Z33A 2GAUA 4Y13A 4JX6A 1V3FA 4OINF 3C18A 5C4XJ 3DPLC 3WU2C 3MKYB 1ZR4A 5D5UB 3K4MA 3GBGA 5DEQA 3UNGC 1WHUA 2IS2A 4AD9A 3CCYA 3E5QA 2WAQN 2KJBA 3BR1A 2EA2A 2LF8A 4ZTJA 2KIUA 4WXHA 1FOKA 2E1CA 2VONA 3CO6C 3SZTA 1BIBA 2CU7A 3E1SA 3JAMZ 1O57A 2Y0MA 3OYAA 1IJWC 4BY7J 3BQZA 3H0GJ 4A0XA 1JXSA 2X51A 4FE4A 4CXFA 4OIOF 2Q8KA 4OMZA 3V8JA 2VJ4A 2LOOA 1XX5A 1KQ0A 2W24A 3ABUA 4C3HJ 3S1QJ 3J80K 2CUEA 3F6VA 3OR1C 4YFNF 2BOLA 2ESNA 3FF5A 3P9CA 4ZC3A 3T5XA 3LSJA 5LHIA 3DEEA 2VASA 1SFEA 3RKXA 3TOAA 4XQFA 4C9YA 2LDUA 3BDDA 2F4MB 3KYCB 3QODA 4LK0F 2YSRA 4A3EJ 1YHQI 2WAQA 4HF2A 2XB0X 3LQQA 3R60A 2FNPA 3OYBA 2OA4A 3WE2A 2HYJA 2IA0A 2VBYA 3ZCOA 3BG3A 3PSFA 4CGZA 4X6AJ 4N4OB 2PN6A 3P9KA 2L7MP 4A3IJ 2HS5A 4Q5SF 1APLC 3QPLA 3I71A 2E2JJ 4AWXB 4AU7A 2R7FA 1I1GA 3M8FA 2WADA 4Z6YA 4UNOA 3W6JB 4UV8A 1AHDP 1YRNA 3R61A 2VODA 4ITVA 1P4AA 2PG4A 3ISPA 1O7LA 2VXDA 4LIVA 1DGRM 1RC9A 3HIFA 3OOUA 2D2WA 2VOOA 1EKEA 1GXQA 3W2VA 1ACIA 1K83J 2DW4A 4NQWB 3JRGA 3R0AA 2AQEA 3WE3A 3H9QA 1MMSA 2CG4A 3EUHA 3VSKA 1DP3A 5ICGA 1GXPA 2L9VA 1OLTA 3WU0A 4HW0A 1BBYA 3IAM2 3X2QH 2QM3A 3MAJA 3KP5A 1TWAJ 3IH3A 2LBFA 5DUKA 3V42A 3BG6A 3BTIA 2OZUA 4A5NA 3JRFA 2X48A 4CA0A 1Y0UA 1GUUA 2MD5A 2M3AA 4KIFA 4Q4ZF 4E7KA 1KONA 4IJAA 2ZJQF 1D8KA 1D8JA 3EETA 1DP7P 1WI3A 3OOPA 1JT6A 2IGNA 2FX0A 4BYYA 3WGIA 4G7ZF 1O4XA 2DMPA 2CQQA 4P55A 2QKLB 5HLHA 3S1RJ 4GDFA 4J19A 2QGUA 3HSFA 5KAFC 1IRXA 4HF1A 3ZOBA 1IUFA 4DZPA 3ONQA 3G71I 2PJRA 2HYGD 4GCVA 2P81A 2ZNZA 1NHAA 2FU4A 2MYSA 3NQOA 3D1NI 3FDYA 2JRMA 4U7DA 4OIQF 4MEYF 2Y69H 2MH9A 5FFZA 1TQPA 2XAHA 3OYHA 3ZQGA 4YFXF 3CLQA 3GCMA 2XPWA 3N05A 3HL2A 3ZQIA 4BU2A 3TQNA 5FROA 3VPRA 1PUFA 1S7OA 4U88A 1UHMA 4C3JJ 1T39A 1P6RA 3CESA 4FQGA 3CD6I 2VBWA 3HC7A 1U9OA 1JHFA 2HQNA 3OR2C 1QNTA 2ISYA 2G9WA 3PNTA 5KCMA 3QP6A 1TT0A 2V7FA 1EV7A 3G1MA 1YG2A 3BR2A 3T8TA 1DDNA 2H1KA 3A0HC 3J7AY 2MC3A 1SFXA 1ETQA 1ON2A 4XKVA 2O03A 1FSEA 4W1UA 2IA1A 2W7NA 4GXOA 2GXBA 2Z16A 3OYNA 3RTRA 2M0MA 1VQ5I 2LP0A 2DA5A 2LTPA 4XKBA 2HPMA 1QZYA 2VQLA 1IZ1A 2VPLA 4ENKA 4DJAA 1EJ9A 3JRHA 2HKXA 4D5CA 3CJNA 5F27A 2VT2A 1RUNA 2EV0A 4HSRA 4BACA 2V9VA 3LQRA 4WCGA 4TV7A 2GM4A 2WY8Q 3LNQA 4IXAA 2LNBA 5D8LB 3JW4A 3HTSB 1TL8A 3VDXA 2BY2A 1Y6IA 1QVTA 2ZJPF 1MMGA 5AIPA 3NWTA 1KGSA 3FX3A 5JLXA 5GPAA 3EUHC 2H1LA 4BHBA 3WTTC 1IRGA 1S7AA 4BQQA 4IOAF 5EZHA 1UMQA 1IRFA 1ZK8A 4G8XA 2MFZA 4EMSA 4EGZA 3W3CA 4RGRA 3BR5A 1OR7C 1MSFC 1IRZA 4D7NA 4CICA 2JPCA 5B66C 2L7FP 2DT7B 5IP7J 2AQFA 1LFBA 3BPVA 1MDMA 2E2IJ 3I5UA 3HOXJ 3HDDA 4DGWB 2EPFA 1U8RA 3ABTA 3TMOA 2W84A 3EDPA 4RM3A 3IRRA 1AA7A 2WA0A 3LAJA 5DCFA 3AKZA 4LGWA 4OMYA 3LSTA 3B6CA 2QCOA 5J1UA 3L7WA 2EBIA 3M7GA 5L3GA 4U87A 4M72A 2XHKA 4L9JA 2K5CA 1SMYF 1D3YA 2KMUA 3LFKA 1KU9A 2TRTA 4MTEA 3Q0UA 4WXCA 2EJRA 1IDYA 4U0YA 3AFHA 5J1YA 3V7CA 2CW7A 2CGPA 1TNSA 3KEYA 2E1NA 2M8GX 2MBFA 5JLWA 1R5GA 5IOYA 2DFEA 4H4KC 1HW5A 1UFMA 2K40A 3CUOA 1R23A 2ZXWH 3OYLA 2NOGA 1QO0D 1JTXA 2W85A 3OSFA 2VE8A 3S2WA 1G59A 3CCRI 1X1AA 3F8FA 2MH2A 1BR1A 2GA1A 2YU9J 1Z3XA 2J5PA 2O7OA 1B4AA 1LUJB 1XGSA 3GLLA 4OOIA 1YRNB 3W2AA 2V4JC 4DQ2A 2E71A 2HNHA 2O8XA 2ZCWA 3KYDB 4B1RA 3FIWA 4EGYA 2A61A 2XVCA 5GTIC 1GT0C 2X6YA 3AL0B 1MSEC 3C2HA 3B6AA 2PX9A 4XLPF 1YX3A 2YS9A 3B02A 3K7AJ 2YUSA 2FNAA 4E7LA 4F52A 3SZPA 2GQQA 2RVCA 2F48A 3BPXA 2K9MA 4ANJA 3DBHB 2HI3A 2F5VA 4PUSA 2IGMA 2VBZA 1B59A 2O8KA 4CDGA 4XICA 3FMSA 3J7YJ 2CV0A 2V1UA 2IPQX 5J1RA 2K7LA 4EM2A 1WCMJ 2R7SA 4HLXA 4CCOA 3U9GA 3HSRA 1MBKA 1HKSA 3LSHA 1YOVB 3GVAA 2XAQA 1Z91A 2EB7A 4PSWA 1K61A 1VQPI 4XLCA 3ZQHA 4AIHA 3WTWC 1F43A 3HM5A 4XM3A 5HOOA 2PLYA 2IW5A 4XN3A 4FX4A 5TJJA 1MNDA 1Q1VA 2P5VA 4L5EA 4MNUA 5DS9A 3OV8A 2Q1ZB 1H89C 1PYVA 1OCRH 1F1ZA 4UHTA 4HQEA 1IDZA 2VKHA 3WTSC 1OFCX 4IPAA 1RESA 4CCKA 5M5XJ 3RI4A 1BI3A 3KP2A 2BGCA 4A3BJ 3WU1B 2RQQA 1IXCA 5IP6A 3HBLA 2ZXIA 4WX9A 1XN7A 2XF7A 4L9VA 5FD6A 3SHFA 2WWYA 1JHHA 3TKYA 2MLKA 2XGDA 1WSUA 1ZR2A 3VFZA 1BC7C 3LSGA 2FBKA 4B44A 3S2HJ 5DTDA 5C4JJ 4YIRX 1FP2A 2ME0A 4R1HA 3CF2A 4DYQA 4KN7X 1RKWA 1X58A 3K0LA 3I56I 3EUAA 2DYSH 3QYFA 1N77A 1AWCA 3OYDA 2XSJC 3E7LA 2D1HA 1TC3C 2MD0A 4FCYA 2EA4A 4E70A 3MVPA 4ENMA 3GTPJ 5LEKA 4XRSG 1RNLA 2Q2EB 2LK2A 4AIKA 3KPHA 4F55A 2GA2A 2E2HJ 2LSOA 3RPQA 4RAGA 1TBXA 3A02A 2JVGA 4I09A 1LB2A 1JGGA 1Y8QB 3K1NA 2D1VA 1E17A 3GTKJ 3JSOA 5LHGA 1OQYA 2FOWA 5FGMA 2FRHA 4BJTA 2V6EA 2F4OB 1VQ4I 1HKTA 1WH7A 2VN2A 1JTYA 2OC6A 4Y15A 4UB8C 2TDXA 1QZZA 2HTJA 1PP8F 3CC2I 1UZCA 2IP2A 3F8BA 3HKZN 1BI1A 2KRHA 3FBNB 2BXYA 3FMQA 2R7RA 1O3RA 1BR2A 1REPC 1WJBA 1MDMB 1T56A 1D0YA 3F8CA 2L4AA 3OYKA 3I59B 4N0BA 1HCRA 3I64A 4UUVA 2WAFA 4IEJA 3ERED 3M3YJ 3DWLE 1Y0NA 4BGDA 1VNDA 4HSTA 2JUCA 5HLGA 1DPRA 2BHZA 2O61A 5KVRA 4DNCA 4P9FA 4L5JA 3T0YA 4HYEA 3CDIA 4X1EA 1LNWA 1MJ9A 2PFBA 3PUFA 3HOYJ 2WV0A 3CQZJ 3HJEA 4LOCA 4UXNA 1FYKA 2JSCA 4Q47A 4JQFA 3JRAA 4MLOA 2PJPA 3V7RA 4ESJA 1R7JA 4HG2A 4PFPA 1WJCA 2R5YA 2LF7A 4LIUA 4HZFA 1D1CA 1X1DA 1LFPA 2NRAC 3DU5A 5C44J 1UG2A 4E7SA 3HKZA 3TGNA 2MABA 4M3BA 2L7KA 2M0CA 2JJ7A 2ELHA 4RB1A 1HBXG 1I50J 2KRCA 5ERIA 1ETWA 2JN6A 4KITB 4XLEA 3HOVJ 3F0CA 3CLOA 1ZARA 2DMNA 2CV1A 5HS7A 2HOAA 2LY9A 4A69C 4A3MJ 3PJRA 2VC1A 3GTOJ 3LA7A 2IGOA 4ABZA 2VUMJ 1LEAA 2E1MB 3AG1H 3CUQA 2ZJRF 2STTA 2K27A 3G1OA 5K7ZA 1RZ4A 1IW7F 1WH5A 4WWCA 3N97A 4DYCA 1J09A 2DJNA 4IF4A 2Z3YA 3C2BA 4G9YA 2ZMEB 1SD7A 2B7EA 2Z99A 3MZYA 1YIOA 4BEHA 1WFXA 2A07F 2QSHX 3FKIJ 4QTRA 1WVRA 4XLAA 4KMFA 3O8GA 4IVNA 3TW6A 1S7EA 5GPCA 1P7JA 2K3FA 5BMZA 4P5OA 5A2QZ 4PGHA
chains in the Genus database with same CATH topology
1I6XA 4OIPF 1EH7A 1ZGJA 1R22A 3KFWX 5LHHA 1LVAA 5CVRA 2ZXJA 2NYXA 1U3EM 4HX8A 4WF2A 2M30A 1R36A 4N9HA 5KK1A 4L5IA 3E97A 4JBAA 3ZMDA 2COMA 4CHUA 2AXLA 2P5LC 4L0ZB 3R0JA 4G7OF 4ON0A 2KKOA 1U5TB 2IJLA 2WTEA 5FO5A 3E6DA 3V7SA 4L9TA 2ETHA 4EQQA 2OAZA 5E1WA 3QU3A 3HOSA 4HV5A 3FMRA 2P4WA 4A6EA 1XDSA 2GZWA 3PQKA 5HLIA 2CWEA 1R58A 1YLFA 5CYVA 1S3JA 1E2XA 5DDGA 3ZMUA 2DPUA 1A04A 3CUQC 1BM9A 3ZMSA 2F5EA 4ZZLA 2XAGA 4KMUX 4HAMA 4LG0B 1G4DA 2MA3A 2DAOA 2YPRA 1ZYRF 5ILUA 2JPBA 3MWMA 1RIOH 5HDKA 2DLLA 1FX7A 3QOPA 5D8KB 1ULYA 3QRFF 1HQCA 1WI9A 3BROA 3KP4A 2X0LA 3GFIA 5ILSA 2QQAA 1R1TA 1FBSA 3D5LA 1IXSB 3DV8A 3E5XA 1PDNC 5K5OA 5E17F 4I7HA 5DCMA 3QAHA 4HDUA 3HUGA 2M87A 1BIAA 1K7AA 2KIFA 4FX0A 4U0WA 3BOQA 3MFKA 5BPIA 1IN7A 1R5HA 1KU3A 3JAMK 1B9NA 3LA2A 2H27A 2BE5F 1ONVA 4UVBA 1RI7A 3I54A 3FHZA 2XASA 1ZRFA 2XAJA 4I98B 5BOXA 3FXQA 1OR7A 2RGVA 2LKPA 4ESBA 2HKOA 1L0OC 5HDNA 3JTGA 1BI0A 2HR3A 1UHWA 1ZRDA 2FXAA 4BNCA 4PDKA 2DTRA 3EYYA 5E20A 1FZPB 3K1MA 3KZYA 4EJTA 1HXDA 5E1XA 3I58A 4I01A 1MZBA 4CO8A 4EJOA 1USTA 1FY7A 2A6HF 2UXNA 1JGSA 4XRFA 3GYHX 1YTYA 1USSA 1J0RA 1TQIA 1YW8A 4RGUA 3FXRA 2DK8A 3ULQB 1LQ1A 1WWXA 4KDPA 1SD5A 2GIVA 5E1ZB 4F7ZA 5LRSA 3WG9A 1YW9A 3FZVA 4MEXF 1XD7A 2EV5A 4PGGA 3RJPA 1ZG1A 4KN4X 3J7AO 5L3EA 2A68F 1T6SA 1MD0A 2NS0A 1TNTA 4WXDA 1PP7U 3GW2A 1YFHA 1G3WA 2GXGA 5IT9Z 3G73A 4GGGA 1HW1A 3O3KA 3ZMVA 2FOKA 2K4BA 2EV6A 2ACJA 4L9NA 3TO7A 3CDHA 1CF7A 1V4RA 2V1DA 1FWZA 4UVAA 4M71A 2K02A 1GVJA 1XMAA 2HTSA 2RDPA 4AVPA 3ROUA 1JE8A 2XKOA 2ZO4A 5JFRA 3P7NA 3I53A 4A0ZA 4BHCA 4RB0A 2DT5A 1FBQA 1SD6A 4M6YA 5K1YA 3VB2A 1F9NA 3F6OA 4QWQA 2OQRA 1IAWA 3VOEA 4A5MA 4KYWA 3ML6A 3IWFA 2QVOA 2YX4A 4YIFA 1Z6RA 2A6EF 2FMLA 2KIMA 3QP5A 4LLLA 2DK5A 5LRRA 3HRSA 3RDIA 1TQMA 4YG2F 2NAZA 1HSJA 4M9ZA 2YU3A 3E6MA 2IVMA 1XGOA 2L3DA 2CSOA 3I0TA 1SD4A 2VC0A 2F5CA 1ZRCA 4KUMA 3K1PA 3DFGA 2RKHA 2OU2A 4KICA 5ICCA 2HEOA 3GX4X 1XSVA 2XKPA 1FC3A 1FT9A 3HRMA 3KLOA 4ENNA 3FWEA 3F21A 1MGTA 4Z2YA 1G3SA 3F8NA 2FQ3A 2MLGA 4ZYDA 5FD5A 1UB9A 1XB4A 4LLGF 2M8EA 3VODA 1OYWA 3M8EA 3R6SA 2EWNA 1FNNA 2EFNA 2K4JA 3I4PA 1XSXA 3MCZA 5CVUA 1QGPA 1ZG3A 3M1EA 4A2UA 1FP1D 1WKMA 1X3UA 2QLZA 3KETA 1UCRA 2FMYA 5HDGA 1BC8C 1HSTA 3WTYC 2P5KA 5J8FA 2J5OA 2HFHA 1XSDA 3GWZA 3AAFA 3K69A 1F4KA 1MJBA 2DFIA 3E6BA 2HQRA 3KLNA 4ESFA 4D0PA 1SAXA 3WODF 1XGNA 4U0VA 1RUOA 4MQVA 2H94A 3L09A 1CF7B 3PQJA 1HKQA 1H9TA 2F5DA 3LA3A 2QYOA 3L00A 3F3XA 4PCQA 5FLXZ 3TDZC 4B8XA 3IKVA 1J7KA 2EK5A 4NHJA 1LDKB 3IC7A 2XROA 2VBXA 5F64A 3SQNA 1VTNC 1XCVA 3B73A 4YFKF 2FBHA 5BS6A 2HGCA 2RQPA 4QLCU 3LAPA 2ZNYA 4ZYHA 2CW0F 2QWWA 3WTVC 2VT3A 2JT1A 2FEZA 1SMTA 2ISZA 3QPTA 1WQ2A 3DKWA 3Q9SA 1FSHA 2XV4S 3P9IA 2DU9A 3V8KA 4EM0B 1Z7UA 3WTXC 4BAYA 1FYMA 4I02A 3HRUA 4FHTA 2EFQA 4P96A 4HV6A 3E3VA 3KP3A 1IN4A 2STWA 3C1DA 2XAFA 1U6GA 2QBYA 1T2KA 3FXUA 5EEHA 1OMIA 5CLSA 2FSWA 4NQWA 2BEOA 3L2CA 2V6CA 3KE2A 1XCBA 1TW3A 4HBLA 5HVQC 4CZZA 5CVJA 2ZKZA 1MKMA 2O6GE 5LEJA 5D6EA 5A2QK 1Z05A 5E18F 5CJ9A 2BYVE 5DD8A 2DBBA 4M74A 2P7VB 5BPDA 2HZTA 2NNYA 3K2ZA 1YW7A 4O3MA 5DV5A 3BJAA 3O6BB 4MHGA 5F6FA 5HS8A 5K5RA 1CGPA 3RIRA 5ICEA 3DF8A 5DYMA 2UZKA 1P4WA 4G94A 2FBIA 1KQ8A 5LGTA 1Z6TA 3ZPLA 3H92A 4MGRA 2M5WA 1BOAA 2VXZA 4K2EA 2AS5F 2HDCA 3EQLF 3MZHA 1T38A 1KYWA 3W6KB 3GUDA 2Z5UA 3WTZA 3QPHA 1G3TA 1J5YA 2EFPA 4IRGA 5HS9A 3GFLA 2W57A 1STZA 2VE9A 3TDUC 3J80Z 5DUIA 1LJ9A 1L3LA 5LBQA 2QUFA 2GWRA 1I5ZA 2ADUA 1G6NA 1IXRC 4I2OA 4L0YB 3NRVA 3RYRA 3J81K 3DP7A 5AONA 2ZBKA 3R4KA 5DD4A 2E7WA 3F22A 1W4MA 1W5TA 3ECOA 2A5YB 2A3SA 4N9IA 3FM3A 3ZQ7A 2R3SA 2P6TA 4G7HF 4I0AA 1YQAA 4O6JA 3K9TA 4XSXF 4HX7A 4LK1F 1KU2A 3GFMA 5CVIA 3CUQB 4R79A 1O7FA 1D5VA 3Q5FA 5CVVA 1C0WA 3COAC 1ZLJA 3U1DA 1S8NA 1OYIA 2XRNA 2P6SA 2WC2A 4FT8A 3BJ6A 3FM5A 5FB2A 1ZAOA 1ON1A 4KIBA 4HA8A 4ASNA 3WTUC 5LLQA 2B0LA 3V4GA 2D45A 4O5VA 5E8IA 2UWMA 3SXYA 2IA2A 2XIGA 4RS8A 4M9SA 4ZZDA 3WGGA 5D5VB 4LFUA 5J8CA 2QBYB 2PMHA 3NEUA 1WRJA 3GXOA 5FFXA 1FPQA 2RNJA 3DXJF 2OZ6A 1K78A 2L02A 1EH8A 2ZJ2A 1LDJA 2EFOA 2PMUA 4GYGA 3IKTA 3HYIA 2JZYA 3KEQA 3PFIA 1ZREA 5H6QA 3HSEA 3F72A 3E6CC 1P2FA 1ZHFA 4U7BA 2RC4A 2OBPA 3BP8A 4LMYA 2O0YA 4RAZA 2F5FA 5AIQA 4ZYGA 4IHSA 1YS6A 4XBFA 4NB5A 2PQ8A 3EYIA 2YR2A 5JI6A 5EEGA 2Y75A 2P8TA 2V1XA 1K6OA 1XMKA 2XGXA 4KT5C 5F1RA 4A0YA 2DPDA 3KEOA 4IHTA 3ZMZA 2Q0OA 3VEPA 3IL2A 4GYIA 1P92A 1YS7A 2Q2EA 2KRFA 1MJAA 4KA4A 1YO5C 2DQLA 4A6DA 1HW2A 5IT3A 2ZFWA 3GZ5A 1GHCA 2JTVA 1O3TA 3I59A 2H09A 4BH9A 2BBYA 5DCMB 4XSZF 1F5TA 5L3FA 1LDDA 1T98A 4EVIA 3RKWA 1J9IA 4LJZF 2RV8A 2QZ8A 3F8MA 3WGHA 4ZH4F 4H0EA 5IT9K 1YYVA 2H6BA 3SFZA 2RN7A 2PBIA 3V8LA 4A12A 4P9UA 4Y17A 1P4XA 2EFWA 2KJCA 1K79A 1XGMA 4M6XA 1B6AA 1KYZA 1ZN2A 4HOBA 1IUYA 1FYLA 2OQGA 2C6YA 4S04A 2CO5A 2PEXA 5JR3A 3RPUA 1TTYA 3HHGA 4YIIA 2BV6A 1S29A 2ZMEA 3JSPA 4EV0A 3D0SA 4UV9A 4BHPA 1K78B 3GFJA 3DPTA 2FE3A 3ZMTA 1OYYA 5ILVA 3HHHA 3M9AA 2YX7A 2QQBA 2P7CB 4R8HA 1G3YA 1H9GA 1Z1DA 3BY6A 4AIJA 1U2WA 3GF2A 5JHUA 5LGUA 1FBUA 2OD5A 1ODDA 5L3CA 1IN8A 4LLNA 1W7PA 4IRIA 1FLIA 1LEBA 1IF1A 1BJAA 1TW2A 4ETSA 1DPUA 4RGSA 4HLYA 2E7XA 2K86A 1XDUA 1OKRA 4HX4A 2PI0A 2W25A 4ZYEA 2CQKA 3JTHA 1U5TA 3O2PE 4RGXA 1ZH5A 4M9XA 3RYPA 3BJOA 4KFCA 3HOTA 2L54A 3E5UA 5BQTA 1TLHB 1IN6A 3ECHA 3KP7A 3IHUA 2VOPA 1W5SA 3T1BA 1ZGAA 4MTDA 4L18B 3GLXA 4LG0A 3LWFA 2V79A 2M1BA 2DI3A 4EJWA 2Y48A 2QQ9A 4HDVA 1U78A 5L3DA 5L3BA 3ZN1A 4OU0A 3RKYA 3ZN0A 4M73A 4S05A 5ICFA 4CYDA 1KQ9A 1Z9CA 1KU7A 3QU6A 3KCCA 3KZZA 3CO7C 2H6CA 3BZ6A 1QPMA 1SFUA 1O3QA 1S6LA 4B09A 1R1VA 1I1SA 4LB5A 1KA8A 3Q9VA 4IRHA 1J59A 5FLXK 2G7UA 1I27A 1B9MA 6PAXA 2G7HA 3REOA 4PZJA 2L4MA 2FA5A 4MQ9F 1U5TC 1IN5A 4KIGA 1T0FA 4G6DA 2A69F 3TO9A 5LGNA 2L01A 3BWGA 2DQRA 4UVCA 4BXUA 4EJVA 1ZLKA 4KNYA 2CFXA 5K5QA 3IWZA 3KP6A 1AOYA 3N4MA 5D5WB 3DEUA 2FF4A 3L9FA 2IT0A 2HOEA 2Z9OA 3IRQA 1R00A 5D6FA 1PUEE 4JK1X 2ESHA 5JVTA 3DQVC 3MQ0A 2CYYA 5D4RA 4G6QA 1J75A 1H0MA 4HQMA 4RB3C 3TOBA 1QBJA 3U2RA 3HRTA 5H20A 3G3ZA 4WK8F 1W7PB 5D5XB 3GEZA 3C7JA 4GO1A 3GZ6A 2M45A 4RAYA 4EJUA 4XLNF 1O3SA 2HYFA 1EH6A 4ENJA 2IRFG 1J2XA 1W7PD 3ZP5A 1B1BA 2R7DA 4HF0A 3HTUA 2F2EA 4Q48A 4LB6B 4BQAA 1Q1HA 1BI2A 2X4HA 5E8GA 3C3WA 2JRTA 2XUBA 3ELKA 3TO6A 5D4SA 1ZG5A 3F23A 1R1UA 1BN5A 3H3UA 5TRDA 3J81Z 5H6RA 2NNNA 4EM1A 4I0BA 1DUXC 1QQIA 2QENA 1OPCA 5ED4A 2UXXA 3GO5A 2HWVA 5J6XA 3T8RA 4LD5A 3H3ZA 3MEXA 3CTAA 2DO7A 4OIRF 4RB2C 2O3FA 2Z33A 2GAUA 4Y13A 1V3FA 4OINF 3C18A 3DPLC 5D5UB 5DEQA 4AD9A 3E5QA 2KJBA 2EA2A 2LF8A 1FOKA 2KIUA 4WXHA 2E1CA 2VONA 3CO6C 3SZTA 1BIBA 3JAMZ 1O57A 2Y0MA 4A0XA 1JXSA 4CXFA 4OIOF 2Q8KA 4OMZA 3V8JA 2W24A 1KQ0A 3ABUA 3J80K 3F6VA 4YFNF 3FF5A 2ESNA 3P9CA 3T5XA 5LHIA 3RKXA 1SFEA 3TOAA 2LDUA 3BDDA 4LK0F 2YSRA 4HF2A 3LQQA 3R60A 2FNPA 2OA4A 3WE2A 2IA0A 2VBYA 4CGZA 2PN6A 3P9KA 2HS5A 4Q5SF 3I71A 4AWXB 2R7FA 1I1GA 3M8FA 4UNOA 3W6JB 4UV8A 3R61A 2VODA 1P4AA 2PG4A 3ISPA 1O7LA 3HIFA 2D2WA 2VOOA 1GXQA 2DW4A 3R0AA 3WE3A 2CG4A 3EUHA 5ICGA 1GXPA 3WU0A 4HW0A 1BBYA 2QM3A 3MAJA 3KP5A 5DUKA 2OZUA 4A5NA 1Y0UA 2MD5A 4KIFA 4Q4ZF 4IJAA 1D8KA 1D8JA 3EETA 1DP7P 3OOPA 4BYYA 3WGIA 4G7ZF 4P55A 5HLHA 3HSFA 4HF1A 2HYGD 4GCVA 2ZNZA 1NHAA 2FU4A 3NQOA 4U7DA 4OIQF 4MEYF 2MH9A 5FFZA 1TQPA 2XAHA 4YFXF 3TQNA 1S7OA 4U88A 1UHMA 1T39A 1P6RA 2VBWA 1JHFA 2HQNA 1QNTA 2ISYA 2G9WA 3QP6A 1EV7A 1YG2A 3T8TA 1DDNA 2MC3A 1SFXA 1ON2A 2O03A 1FSEA 2IA1A 4GXOA 2GXBA 3RTRA 1QZYA 1IZ1A 4ENKA 2HKXA 3CJNA 2VT2A 1RUNA 2EV0A 2V9VA 3LQRA 4WCGA 4TV7A 4IXAA 2LNBA 5D8LB 3JW4A 3HTSB 5AIPA 1KGSA 3FX3A 3WTTC 4BHBA 1IRGA 1S7AA 4EMSA 1IRFA 4G8XA 4EGZA 4RGRA 4CICA 2JPCA 3BPVA 1MDMA 3I5UA 1U8RA 3ABTA 2W84A 3EDPA 3IRRA 3LAJA 5DCFA 4LGWA 4OMYA 3LSTA 3L7WA 5L3GA 3M7GA 4M72A 2XHKA 4L9JA 1SMYF 1D3YA 3LFKA 1KU9A 4MTEA 4WXCA 2EJRA 4U0YA 3V7CA 2CGPA 1TNSA 2E1NA 2MBFA 1R5GA 1HW5A 1UFMA 3CUOA 1R23A 1QO0D 2W85A 2VE8A 3S2WA 3F8FA 2MH2A 2GA1A 2J5PA 1B4AA 1XGSA 4OOIA 4DQ2A 2O8XA 2ZCWA 4EGYA 2A61A 2XVCA 4XLPF 3B02A 2FNAA 3SZPA 2GQQA 2RVCA 3BPXA 2VBZA 1B59A 4CDGA 3FMSA 2V1UA 2IPQX 2K7LA 4EM2A 4HLXA 3U9GA 3HSRA 1HKSA 3GVAA 1Z91A 2XAQA 2EB7A 4AIHA 3WTWC 5HOOA 2PLYA 2IW5A 4FX4A 5TJJA 2P5VA 4MNUA 3OV8A 4UHTA 1F1ZA 4HQEA 3WTSC 4IPAA 3RI4A 1BI3A 3KP2A 2BGCA 3WU1B 1IXCA 4WX9A 1XN7A 4L9VA 5FD6A 3SHFA 2WWYA 1JHHA 3TKYA 2MLKA 1WSUA 3VFZA 1BC7C 2FBKA 1FP2A 4R1HA 4KN7X 3K0LA 1AWCA 2D1HA 2EA4A 4E70A 4ENMA 5LEKA 1RNLA 4AIKA 2GA2A 2LSOA 3RPQA 1TBXA 4I09A 1LB2A 3K1NA 2D1VA 1E17A 3JSOA 5LHGA 5FGMA 2FRHA 1HKTA 2VN2A 4Y15A 2TDXA 1QZZA 2HTJA 1PP8F 2IP2A 3F8BA 1BI1A 3FMQA 1O3RA 1REPC 1MDMB 3F8CA 2L4AA 3I59B 4N0BA 3I64A 4UUVA 3ERED 5HLGA 1DPRA 2O61A 5KVRA 4DNCA 4P9FA 4L5JA 3T0YA 4HYEA 1LNWA 1MJ9A 2PFBA 2WV0A 4UXNA 1FYKA 2JSCA 4Q47A 4JQFA 2PJPA 3V7RA 4ESJA 1R7JA 2LF7A 4HZFA 2NRAC 3TGNA 2ELHA 4RB1A 1HBXG 5ERIA 3CLOA 1ZARA 5HS7A 2VC1A 3LA7A 1LEAA 3CUQA 2STTA 2K27A 1RZ4A 4WWCA 1IW7F 3N97A 4IF4A 2Z3YA 4G9YA 2ZMEB 1SD7A 2Z99A 3MZYA 1YIOA 2A07F 4KMFA 4IVNA 5BMZA 4P5OA 5A2QZ 4PGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6X A;  4OIP F;  1EH7 A;  1ZGJ A;  1R22 A;  3KFW X;  5LHH A;  1LVA A;  5CVR A;  2ZXJ A;  2NYX A;  1U3E M;  4HX8 A;  4WF2 A;  2M30 A;  1R36 A;  4N9H A;  5KK1 A;  4L5I A;  3E97 A;  4JBA A;  3ZMD A;  2COM A;  4CHU A;  2AXL A;  2P5L C;  4L0Z B;  3R0J A;  4G7O F;  4ON0 A;  2KKO A;  1U5T B;  2IJL A;  2WTE A;  5FO5 A;  3E6D A;  3V7S A;  4L9T A;  2ETH A;  4EQQ A;  2OAZ A;  5E1W A;  3QU3 A;  3HOS A;  4HV5 A;  3FMR A;  2P4W A;  4A6E A;  1XDS A;  2GZW A;  3PQK A;  5HLI A;  2CWE A;  1R58 A;  1YLF A;  5CYV A;  1S3J A;  1E2X A;  5DDG A;  3ZMU A;  2DPU A;  1A04 A;  3CUQ C;  1BM9 A;  3ZMS A;  2F5E A;  4ZZL A;  2XAG A;  4KMU X;  4HAM A;  4LG0 B;  1G4D A;  2MA3 A;  2DAO A;  2YPR A;  1ZYR F;  5ILU A;  2JPB A;  3MWM A;  1RIO H;  5HDK A;  2DLL A;  1FX7 A;  3QOP A;  5D8K B;  1ULY A;  3QRF F;  1HQC A;  1WI9 A;  3BRO A;  3KP4 A;  2X0L A;  3GFI A;  5ILS A;  2QQA A;  1R1T A;  1FBS A;  3D5L A;  1IXS B;  3DV8 A;  3E5X A;  1PDN C;  5K5O A;  5E17 F;  4I7H A;  5DCM A;  3QAH A;  4HDU A;  3HUG A;  2M87 A;  1BIA A;  1K7A A;  2KIF A;  4FX0 A;  4U0W A;  3BOQ A;  3MFK A;  5BPI A;  1IN7 A;  1R5H A;  1KU3 A;  3JAM K;  1B9N A;  3LA2 A;  2H27 A;  2BE5 F;  1ONV A;  4UVB A;  1RI7 A;  3I54 A;  3FHZ A;  2XAS A;  1ZRF A;  2XAJ A;  4I98 B;  5BOX A;  3FXQ A;  1OR7 A;  2RGV A;  2LKP A;  4ESB A;  2HKO A;  1L0O C;  5HDN A;  3JTG A;  1BI0 A;  2HR3 A;  1UHW A;  1ZRD A;  2FXA A;  4BNC A;  4PDK A;  2DTR A;  3EYY A;  5E20 A;  1FZP B;  3K1M A;  3KZY A;  4EJT A;  1HXD A;  5E1X A;  3I58 A;  4I01 A;  1MZB A;  4CO8 A;  4EJO A;  1UST A;  1FY7 A;  2A6H F;  2UXN A;  1JGS A;  4XRF A;  3GYH X;  1YTY A;  1USS A;  1J0R A;  1TQI A;  1YW8 A;  4RGU A;  3FXR A;  2DK8 A;  3ULQ B;  1LQ1 A;  1WWX A;  4KDP A;  1SD5 A;  2GIV A;  5E1Z B;  4F7Z A;  5LRS A;  3WG9 A;  1YW9 A;  3FZV A;  4MEX F;  1XD7 A;  2EV5 A;  4PGG A;  3RJP A;  1ZG1 A;  4KN4 X;  3J7A O;  5L3E A;  2A68 F;  1T6S A;  1MD0 A;  2NS0 A;  1TNT A;  4WXD A;  1PP7 U;  3GW2 A;  1YFH A;  1G3W A;  2GXG A;  5IT9 Z;  3G73 A;  4GGG A;  1HW1 A;  3O3K A;  3ZMV A;  2FOK A;  2K4B A;  2EV6 A;  2ACJ A;  4L9N A;  3TO7 A;  3CDH A;  1CF7 A;  1V4R A;  2V1D A;  1FWZ A;  4UVA A;  4M71 A;  2K02 A;  1GVJ A;  1XMA A;  2HTS A;  2RDP A;  4AVP A;  3ROU A;  1JE8 A;  2XKO A;  2ZO4 A;  5JFR A;  3P7N A;  3I53 A;  4A0Z A;  4BHC A;  4RB0 A;  2DT5 A;  1FBQ A;  1SD6 A;  4M6Y A;  5K1Y A;  3VB2 A;  1F9N A;  3F6O A;  4QWQ A;  2OQR A;  1IAW A;  3VOE A;  4A5M A;  4KYW A;  3ML6 A;  3IWF A;  2QVO A;  2YX4 A;  4YIF A;  1Z6R A;  2A6E F;  2FML A;  2KIM A;  3QP5 A;  4LLL A;  2DK5 A;  5LRR A;  3HRS A;  3RDI A;  1TQM A;  4YG2 F;  2NAZ A;  1HSJ A;  4M9Z A;  2YU3 A;  3E6M A;  2IVM A;  1XGO A;  2L3D A;  2CSO A;  3I0T A;  1SD4 A;  2VC0 A;  2F5C A;  1ZRC A;  4KUM A;  3K1P A;  3DFG A;  2RKH A;  2OU2 A;  4KIC A;  5ICC A;  2HEO A;  3GX4 X;  1XSV A;  2XKP A;  1FC3 A;  1FT9 A;  3HRM A;  3KLO A;  4ENN A;  3FWE A;  3F21 A;  1MGT A;  4Z2Y A;  1G3S A;  3F8N A;  2FQ3 A;  2MLG A;  4ZYD A;  5FD5 A;  1UB9 A;  1XB4 A;  4LLG F;  2M8E A;  3VOD A;  1OYW A;  3M8E A;  3R6S A;  2EWN A;  1FNN A;  2EFN A;  2K4J A;  3I4P A;  1XSX A;  3MCZ A;  5CVU A;  1QGP A;  1ZG3 A;  3M1E A;  4A2U A;  1FP1 D;  1WKM A;  1X3U A;  2QLZ A;  3KET A;  1UCR A;  2FMY A;  5HDG A;  1BC8 C;  1HST A;  3WTY C;  2P5K A;  5J8F A;  2J5O A;  2HFH A;  1XSD A;  3GWZ A;  3AAF A;  3K69 A;  1F4K A;  1MJB A;  2DFI A;  3E6B A;  2HQR A;  3KLN A;  4ESF A;  4D0P A;  1SAX A;  3WOD F;  1XGN A;  4U0V A;  1RUO A;  4MQV A;  2H94 A;  3L09 A;  1CF7 B;  3PQJ A;  1HKQ A;  1H9T A;  2F5D A;  3LA3 A;  2QYO A;  3L00 A;  3F3X A;  4PCQ A;  5FLX Z;  3TDZ C;  4B8X A;  3IKV A;  1J7K A;  2EK5 A;  4NHJ A;  1LDK B;  3IC7 A;  2XRO A;  2VBX A;  5F64 A;  3SQN A;  1VTN C;  1XCV A;  3B73 A;  4YFK F;  2FBH A;  5BS6 A;  2HGC A;  2RQP A;  4QLC U;  3LAP A;  2ZNY A;  4ZYH A;  2CW0 F;  2QWW A;  3WTV C;  2VT3 A;  2JT1 A;  2FEZ A;  1SMT A;  2ISZ A;  3QPT A;  1WQ2 A;  3DKW A;  3Q9S A;  1FSH A;  2XV4 S;  3P9I A;  2DU9 A;  3V8K A;  4EM0 B;  1Z7U A;  3WTX C;  4BAY A;  1FYM A;  4I02 A;  3HRU A;  4FHT A;  2EFQ A;  4P96 A;  4HV6 A;  3E3V A;  3KP3 A;  1IN4 A;  2STW A;  3C1D A;  2XAF A;  1U6G A;  2QBY A;  1T2K A;  3FXU A;  5EEH A;  1OMI A;  5CLS A;  2FSW A;  4NQW A;  2BEO A;  3L2C A;  2V6C A;  3KE2 A;  1XCB A;  1TW3 A;  4HBL A;  5HVQ C;  4CZZ A;  5CVJ A;  2ZKZ A;  1MKM A;  2O6G E;  5LEJ A;  5D6E A;  5A2Q K;  1Z05 A;  5E18 F;  5CJ9 A;  2BYV E;  5DD8 A;  2DBB A;  4M74 A;  2P7V B;  5BPD A;  2HZT A;  2NNY A;  3K2Z A;  1YW7 A;  4O3M A;  5DV5 A;  3BJA A;  3O6B B;  4MHG A;  5F6F A;  5HS8 A;  5K5R A;  1CGP A;  3RIR A;  5ICE A;  3DF8 A;  5DYM A;  2UZK A;  1P4W A;  4G94 A;  2FBI A;  1KQ8 A;  5LGT A;  1Z6T A;  3ZPL A;  3H92 A;  4MGR A;  2M5W A;  1BOA A;  2VXZ A;  4K2E A;  2AS5 F;  2HDC A;  3EQL F;  3MZH A;  1T38 A;  1KYW A;  3W6K B;  3GUD A;  2Z5U A;  3WTZ A;  3QPH A;  1G3T A;  1J5Y A;  2EFP A;  4IRG A;  5HS9 A;  3GFL A;  2W57 A;  1STZ A;  2VE9 A;  3TDU C;  3J80 Z;  5DUI A;  1LJ9 A;  1L3L A;  5LBQ A;  2QUF A;  2GWR A;  1I5Z A;  2ADU A;  1G6N A;  1IXR C;  4I2O A;  4L0Y B;  3NRV A;  3RYR A;  3J81 K;  3DP7 A;  5AON A;  2ZBK A;  3R4K A;  5DD4 A;  2E7W A;  3F22 A;  1W4M A;  1W5T A;  3ECO A;  2A5Y B;  2A3S A;  4N9I A;  3FM3 A;  3ZQ7 A;  2R3S A;  2P6T A;  4G7H F;  4I0A A;  1YQA A;  4O6J A;  3K9T A;  4XSX F;  4HX7 A;  4LK1 F;  1KU2 A;  3GFM A;  5CVI A;  3CUQ B;  4R79 A;  1O7F A;  1D5V A;  3Q5F A;  5CVV A;  1C0W A;  3COA C;  1ZLJ A;  3U1D A;  1S8N A;  1OYI A;  2XRN A;  2P6S A;  2WC2 A;  4FT8 A;  3BJ6 A;  3FM5 A;  5FB2 A;  1ZAO A;  1ON1 A;  4KIB A;  4HA8 A;  4ASN A;  3WTU C;  5LLQ A;  2B0L A;  3V4G A;  2D45 A;  4O5V A;  5E8I A;  2UWM A;  3SXY A;  2IA2 A;  2XIG A;  4RS8 A;  4M9S A;  4ZZD A;  3WGG A;  5D5V B;  4LFU A;  5J8C A;  2QBY B;  2PMH A;  3NEU A;  1WRJ A;  3GXO A;  5FFX A;  1FPQ A;  2RNJ A;  3DXJ F;  2OZ6 A;  1K78 A;  2L02 A;  1EH8 A;  2ZJ2 A;  1LDJ A;  2EFO A;  2PMU A;  4GYG A;  3IKT A;  3HYI A;  2JZY A;  3KEQ A;  3PFI A;  1ZRE A;  5H6Q A;  3HSE A;  3F72 A;  3E6C C;  1P2F A;  1ZHF A;  4U7B A;  2RC4 A;  2OBP A;  3BP8 A;  4LMY A;  2O0Y A;  4RAZ A;  2F5F A;  5AIQ A;  4ZYG A;  4IHS A;  1YS6 A;  4XBF A;  4NB5 A;  2PQ8 A;  3EYI A;  2YR2 A;  5JI6 A;  5EEG A;  2Y75 A;  2P8T A;  2V1X A;  1K6O A;  1XMK A;  2XGX A;  4KT5 C;  5F1R A;  4A0Y A;  2DPD A;  3KEO A;  4IHT A;  3ZMZ A;  2Q0O A;  3VEP A;  3IL2 A;  4GYI A;  1P92 A;  1YS7 A;  2Q2E A;  2KRF A;  1MJA A;  4KA4 A;  1YO5 C;  2DQL A;  4A6D A;  1HW2 A;  5IT3 A;  2ZFW A;  3GZ5 A;  1GHC A;  2JTV A;  1O3T A;  3I59 A;  2H09 A;  4BH9 A;  2BBY A;  5DCM B;  4XSZ F;  1F5T A;  5L3F A;  1LDD A;  1T98 A;  4EVI A;  3RKW A;  1J9I A;  4LJZ F;  2RV8 A;  2QZ8 A;  3F8M A;  3WGH A;  4ZH4 F;  4H0E A;  5IT9 K;  1YYV A;  2H6B A;  3SFZ A;  2RN7 A;  2PBI A;  3V8L A;  4A12 A;  4P9U A;  4Y17 A;  1P4X A;  2EFW A;  2KJC A;  1K79 A;  1XGM A;  4M6X A;  1B6A A;  1KYZ A;  1ZN2 A;  4HOB A;  1IUY A;  1FYL A;  2OQG A;  2C6Y A;  4S04 A;  2CO5 A;  2PEX A;  5JR3 A;  3RPU A;  1TTY A;  3HHG A;  4YII A;  2BV6 A;  1S29 A;  2ZME A;  3JSP A;  4EV0 A;  3D0S A;  4UV9 A;  4BHP A;  1K78 B;  3GFJ A;  3DPT A;  2FE3 A;  3ZMT A;  1OYY A;  5ILV A;  3HHH A;  3M9A A;  2YX7 A;  2QQB A;  2P7C B;  4R8H A;  1G3Y A;  1H9G A;  1Z1D A;  3BY6 A;  4AIJ A;  1U2W A;  3GF2 A;  5JHU A;  5LGU A;  1FBU A;  2OD5 A;  1ODD A;  5L3C A;  1IN8 A;  4LLN A;  1W7P A;  4IRI A;  1FLI A;  1LEB A;  1IF1 A;  1BJA A;  1TW2 A;  4ETS A;  1DPU A;  4RGS A;  4HLY A;  2E7X A;  2K86 A;  1XDU A;  1OKR A;  4HX4 A;  2PI0 A;  2W25 A;  4ZYE A;  2CQK A;  3JTH A;  1U5T A;  3O2P E;  4RGX A;  1ZH5 A;  4M9X A;  3RYP A;  3BJO A;  4KFC A;  3HOT A;  2L54 A;  3E5U A;  5BQT A;  1TLH B;  1IN6 A;  3ECH A;  3KP7 A;  3IHU A;  2VOP A;  1W5S A;  3T1B A;  1ZGA A;  4MTD A;  4L18 B;  3GLX A;  4LG0 A;  3LWF A;  2V79 A;  2M1B A;  2DI3 A;  4EJW A;  2Y48 A;  2QQ9 A;  4HDV A;  1U78 A;  5L3D A;  5L3B A;  3ZN1 A;  4OU0 A;  3RKY A;  3ZN0 A;  4M73 A;  4S05 A;  5ICF A;  4CYD A;  1KQ9 A;  1Z9C A;  1KU7 A;  3QU6 A;  3KCC A;  3KZZ A;  3CO7 C;  2H6C A;  3BZ6 A;  1QPM A;  1SFU A;  1O3Q A;  1S6L A;  4B09 A;  1R1V A;  1I1S A;  4LB5 A;  1KA8 A;  3Q9V A;  4IRH A;  1J59 A;  5FLX K;  2G7U A;  1I27 A;  1B9M A;  6PAX A;  2G7H A;  3REO A;  4PZJ A;  2L4M A;  2FA5 A;  4MQ9 F;  1U5T C;  1IN5 A;  4KIG A;  1T0F A;  4G6D A;  2A69 F;  3TO9 A;  5LGN A;  2L01 A;  3BWG A;  2DQR A;  4UVC A;  4BXU A;  4EJV A;  1ZLK A;  4KNY A;  2CFX A;  5K5Q A;  3IWZ A;  3KP6 A;  1AOY A;  3N4M A;  5D5W B;  3DEU A;  2FF4 A;  3L9F A;  2IT0 A;  2HOE A;  2Z9O A;  3IRQ A;  1R00 A;  5D6F A;  1PUE E;  4JK1 X;  2ESH A;  5JVT A;  3DQV C;  3MQ0 A;  2CYY A;  5D4R A;  4G6Q A;  1J75 A;  1H0M A;  4HQM A;  4RB3 C;  3TOB A;  1QBJ A;  3U2R A;  3HRT A;  5H20 A;  3G3Z A;  4WK8 F;  1W7P B;  5D5X B;  3GEZ A;  3C7J A;  4GO1 A;  3GZ6 A;  2M45 A;  4RAY A;  4EJU A;  4XLN F;  1O3S A;  2HYF A;  1EH6 A;  4ENJ A;  2IRF G;  1J2X A;  1W7P D;  3ZP5 A;  1B1B A;  2R7D A;  4HF0 A;  3HTU A;  2F2E A;  4Q48 A;  4LB6 B;  4BQA A;  1Q1H A;  1BI2 A;  2X4H A;  5E8G A;  3C3W A;  2JRT A;  2XUB A;  3ELK A;  3TO6 A;  5D4S A;  1ZG5 A;  3F23 A;  1R1U A;  1BN5 A;  3H3U A;  5TRD A;  3J81 Z;  5H6R A;  2NNN A;  4EM1 A;  4I0B A;  1DUX C;  1QQI A;  2QEN A;  1OPC A;  5ED4 A;  2UXX A;  3GO5 A;  2HWV A;  5J6X A;  3T8R A;  4LD5 A;  3H3Z A;  3MEX A;  3CTA A;  2DO7 A;  4OIR F;  4RB2 C;  2O3F A;  2Z33 A;  2GAU A;  4Y13 A;  1V3F A;  4OIN F;  3C18 A;  3DPL C;  5D5U B;  5DEQ A;  4AD9 A;  3E5Q A;  2KJB A;  2EA2 A;  2LF8 A;  1FOK A;  2KIU A;  4WXH A;  2E1C A;  2VON A;  3CO6 C;  3SZT A;  1BIB A;  3JAM Z;  1O57 A;  2Y0M A;  4A0X A;  1JXS A;  4CXF A;  4OIO F;  2Q8K A;  4OMZ A;  3V8J A;  2W24 A;  1KQ0 A;  3ABU A;  3J80 K;  3F6V A;  4YFN F;  3FF5 A;  2ESN A;  3P9C A;  3T5X A;  5LHI A;  3RKX A;  1SFE A;  3TOA A;  2LDU A;  3BDD A;  4LK0 F;  2YSR A;  4HF2 A;  3LQQ A;  3R60 A;  2FNP A;  2OA4 A;  3WE2 A;  2IA0 A;  2VBY A;  4CGZ A;  2PN6 A;  3P9K A;  2HS5 A;  4Q5S F;  3I71 A;  4AWX B;  2R7F A;  1I1G A;  3M8F A;  4UNO A;  3W6J B;  4UV8 A;  3R61 A;  2VOD A;  1P4A A;  2PG4 A;  3ISP A;  1O7L A;  3HIF A;  2D2W A;  2VOO A;  1GXQ A;  2DW4 A;  3R0A A;  3WE3 A;  2CG4 A;  3EUH A;  5ICG A;  1GXP A;  3WU0 A;  4HW0 A;  1BBY A;  2QM3 A;  3MAJ A;  3KP5 A;  5DUK A;  2OZU A;  4A5N A;  1Y0U A;  2MD5 A;  4KIF A;  4Q4Z F;  4IJA A;  1D8K A;  1D8J A;  3EET A;  1DP7 P;  3OOP A;  4BYY A;  3WGI A;  4G7Z F;  4P55 A;  5HLH A;  3HSF A;  4HF1 A;  2HYG D;  4GCV A;  2ZNZ A;  1NHA A;  2FU4 A;  3NQO A;  4U7D A;  4OIQ F;  4MEY F;  2MH9 A;  5FFZ A;  1TQP A;  2XAH A;  4YFX F;  3TQN A;  1S7O A;  4U88 A;  1UHM A;  1T39 A;  1P6R A;  2VBW A;  1JHF A;  2HQN A;  1QNT A;  2ISY A;  2G9W A;  3QP6 A;  1EV7 A;  1YG2 A;  3T8T A;  1DDN A;  2MC3 A;  1SFX A;  1ON2 A;  2O03 A;  1FSE A;  2IA1 A;  4GXO A;  2GXB A;  3RTR A;  1QZY A;  1IZ1 A;  4ENK A;  2HKX A;  3CJN A;  2VT2 A;  1RUN A;  2EV0 A;  2V9V A;  3LQR A;  4WCG A;  4TV7 A;  4IXA A;  2LNB A;  5D8L B;  3JW4 A;  3HTS B;  5AIP A;  1KGS A;  3FX3 A;  3WTT C;  4BHB A;  1IRG A;  1S7A A;  4EMS A;  1IRF A;  4G8X A;  4EGZ A;  4RGR A;  4CIC A;  2JPC A;  3BPV A;  1MDM A;  3I5U A;  1U8R A;  3ABT A;  2W84 A;  3EDP A;  3IRR A;  3LAJ A;  5DCF A;  4LGW A;  4OMY A;  3LST A;  3L7W A;  5L3G A;  3M7G A;  4M72 A;  2XHK A;  4L9J A;  1SMY F;  1D3Y A;  3LFK A;  1KU9 A;  4MTE A;  4WXC A;  2EJR A;  4U0Y A;  3V7C A;  2CGP A;  1TNS A;  2E1N A;  2MBF A;  1R5G A;  1HW5 A;  1UFM A;  3CUO A;  1R23 A;  1QO0 D;  2W85 A;  2VE8 A;  3S2W A;  3F8F A;  2MH2 A;  2GA1 A;  2J5P A;  1B4A A;  1XGS A;  4OOI A;  4DQ2 A;  2O8X A;  2ZCW A;  4EGY A;  2A61 A;  2XVC A;  4XLP F;  3B02 A;  2FNA A;  3SZP A;  2GQQ A;  2RVC A;  3BPX A;  2VBZ A;  1B59 A;  4CDG A;  3FMS A;  2V1U A;  2IPQ X;  2K7L A;  4EM2 A;  4HLX A;  3U9G A;  3HSR A;  1HKS A;  3GVA A;  1Z91 A;  2XAQ A;  2EB7 A;  4AIH A;  3WTW C;  5HOO A;  2PLY A;  2IW5 A;  4FX4 A;  5TJJ A;  2P5V A;  4MNU A;  3OV8 A;  4UHT A;  1F1Z A;  4HQE A;  3WTS C;  4IPA A;  3RI4 A;  1BI3 A;  3KP2 A;  2BGC A;  3WU1 B;  1IXC A;  4WX9 A;  1XN7 A;  4L9V A;  5FD6 A;  3SHF A;  2WWY A;  1JHH A;  3TKY A;  2MLK A;  1WSU A;  3VFZ A;  1BC7 C;  2FBK A;  1FP2 A;  4R1H A;  4KN7 X;  3K0L A;  1AWC A;  2D1H A;  2EA4 A;  4E70 A;  4ENM A;  5LEK A;  1RNL A;  4AIK A;  2GA2 A;  2LSO A;  3RPQ A;  1TBX A;  4I09 A;  1LB2 A;  3K1N A;  2D1V A;  1E17 A;  3JSO A;  5LHG A;  5FGM A;  2FRH A;  1HKT A;  2VN2 A;  4Y15 A;  2TDX A;  1QZZ A;  2HTJ A;  1PP8 F;  2IP2 A;  3F8B A;  1BI1 A;  3FMQ A;  1O3R A;  1REP C;  1MDM B;  3F8C A;  2L4A A;  3I59 B;  4N0B A;  3I64 A;  4UUV A;  3ERE D;  5HLG A;  1DPR A;  2O61 A;  5KVR A;  4DNC A;  4P9F A;  4L5J A;  3T0Y A;  4HYE A;  1LNW A;  1MJ9 A;  2PFB A;  2WV0 A;  4UXN A;  1FYK A;  2JSC A;  4Q47 A;  4JQF A;  2PJP A;  3V7R A;  4ESJ A;  1R7J A;  2LF7 A;  4HZF A;  2NRA C;  3TGN A;  2ELH A;  4RB1 A;  1HBX G;  5ERI A;  3CLO A;  1ZAR A;  5HS7 A;  2VC1 A;  3LA7 A;  1LEA A;  3CUQ A;  2STT A;  2K27 A;  1RZ4 A;  4WWC A;  1IW7 F;  3N97 A;  4IF4 A;  2Z3Y A;  4G9Y A;  2ZME B;  1SD7 A;  2Z99 A;  3MZY A;  1YIO A;  2A07 F;  4KMF A;  4IVN A;  5BMZ A;  4P5O A;  5A2Q Z;  4PGH A; 
#chains in the Genus database with same CATH topology
 5K7F A;  4X0G A;  1I6X A;  4OIP F;  3JRI A;  1EH7 A;  3KX2 A;  1ZGJ A;  1R22 A;  1WJA A;  3KFW X;  5LHH A;  1LVA A;  2M34 A;  2DOA A;  3ZGK A;  1QHH D;  5CVR A;  2HQ5 A;  2ZXJ A;  2NYX A;  3DU6 A;  5FKN A;  4HX8 A;  1U3E M;  4WF2 A;  2M30 A;  4BXX J;  4ZDO A;  1R36 A;  4N9H A;  1ETY A;  1DGW Y;  3NAR A;  1NK2 P;  5KK1 A;  4NDL A;  1I39 A;  1HDD C;  2FQ4 A;  4L5I A;  2GOX B;  2CS3 A;  2DA3 A;  2W00 A;  3L2Q A;  4HNT A;  4EAT A;  3E97 A;  4JBA A;  3ZMD A;  2COM A;  2Y9Z A;  4CHU A;  1FIA A;  2AXL A;  1SVL A;  1X1B A;  2XGC A;  4UB6 C;  2P5L C;  5CKT A;  1F36 A;  4L0Z B;  3R0J A;  4G7O F;  4HRI A;  4ON0 A;  2KKO A;  2Y31 A;  3BTL A;  1Y8R B;  2BY3 A;  4PJN A;  1U5T B;  2IJL A;  1ENH A;  2ID6 A;  2WTE A;  5FO5 A;  3E6D A;  2CUJ A;  1VQ8 I;  3V7S A;  4A3F J;  4L9T A;  2ETH A;  4EQQ A;  3ERM A;  2OAZ A;  5E1W A;  3QU3 A;  3WHC A;  3HOS A;  4HV5 A;  2QQ8 A;  2L7Z A;  3FMR A;  3ESW B;  3D5S C;  4C2U A;  5JHF A;  2P4W A;  2VL8 A;  2FJ1 A;  1XDS A;  2GZW A;  3JCU C;  4A6E A;  3HZJ A;  1NH3 A;  1FEX A;  3PQK A;  5HLI A;  2CWE A;  1R58 A;  1YLF A;  3PO2 J;  3L2W A;  5CYV A;  1S3J A;  1VZ0 A;  3L2V A;  4XRM A;  2IXS A;  1E2X A;  5DDG A;  3ZMU A;  2DPU A;  1A04 A;  1D0X A;  3CUQ C;  1ZGW A;  1BM9 A;  2X1D A;  3FXM A;  2ELJ A;  3ZMS A;  3FHN A;  2F5E A;  4ZZL A;  5J4Y A;  1X2N A;  2MC4 A;  2XAG A;  5LFA A;  4KMU X;  4HAM A;  3BR6 A;  4PK4 A;  2VJI A;  1FOY A;  5K7H A;  4LG0 B;  2F6C A;  4LIT A;  1G4D A;  2MA3 A;  3A01 A;  2DAO A;  2YPR A;  5BNG A;  1ZYR F;  4AUX A;  5ILU A;  2JPB A;  4XRS A;  3MWM A;  2VJ5 A;  1RIO H;  5HDK A;  2DLL A;  3CMA I;  4XL9 A;  2DA6 A;  4XKC A;  1ZKG A;  1FX7 A;  3OIP A;  2L9R A;  1JI8 A;  3CCM I;  3IP4 B;  4E7Z A;  2E5N A;  3QOP A;  5D8K B;  4D9J A;  5IYD J;  3QWL A;  2Y0S N;  3SJM A;  1ULY A;  4PJJ A;  4RA2 A;  3JRD A;  3QRF F;  1HQC A;  1WI9 A;  3BRO A;  1E3P A;  3A03 A;  3KP4 A;  2I5U A;  2X0L A;  3BTC A;  2JUG A;  2R5Y B;  3GFI A;  4C2T A;  1T95 A;  5ILS A;  2QQA A;  2I8D A;  3ZQC A;  1R1T A;  3HOZ J;  1FBS A;  3D5L A;  4A3J J;  1E3O C;  1IXS B;  3PNV A;  3DV8 A;  3E5X A;  3RKQ A;  4QSH A;  3FBI B;  1PDN C;  5K5O A;  5E17 F;  4I7H A;  5GTH C;  5DCM A;  3BR0 A;  1SAN A;  2ICW G;  3IUO A;  3E0J B;  3IV5 A;  4I99 C;  1QHG A;  2EIK H;  3QAH A;  4HDU A;  2R92 J;  2ZSH B;  2XC7 A;  3HUG A;  3RZD J;  2M87 A;  2ZC2 A;  3BTJ A;  1BIA A;  2WV1 A;  5JVG F;  2HXI A;  2Y0S A;  1K7A A;  2KIF A;  4FX0 A;  4IOC F;  4U0W A;  1SVM A;  5M5W J;  1OCC H;  2XB5 A;  3HEF A;  1RPW A;  1Y1V J;  3BOQ A;  3MFK A;  5BPI A;  1IN7 A;  3RQI A;  2JA5 J;  1R5H A;  4A3K J;  4QPQ A;  2CV2 A;  3WG7 H;  3BQY A;  1KU3 A;  3LSI A;  3JAM K;  1B9N A;  1X19 A;  4BEH B;  2W82 A;  3LA2 A;  4BBR J;  2H27 A;  2BE5 F;  1ONV A;  1OJL A;  4UVB A;  3SDG A;  1RI7 A;  3I54 A;  2K9S A;  3FHZ A;  2XAS A;  3PL8 A;  3H9G A;  3GTL J;  1ZRF A;  3L2U A;  2Z1D A;  2XAJ A;  4I98 B;  4V2G A;  3PO3 J;  1MNM C;  4JX5 A;  3BCA A;  2JVH A;  5BOX A;  3ZQF A;  3A0B C;  3FXQ A;  1OR7 A;  2RGV A;  4QPO A;  4AYB N;  4G6T B;  1SAU A;  2KDO A;  4ZJZ A;  2LKP A;  3SZG A;  2HKO A;  4ESB A;  1L0O C;  2CRG A;  5HDN A;  3ZQL A;  4D7M A;  5E3M A;  3JTG A;  1BI0 A;  1RET A;  2HR3 A;  4W97 A;  5F08 A;  5EDN A;  1UHW A;  3A2K A;  1ZRD A;  2FXA A;  2AHQ A;  4BNC A;  4PDK A;  3RCO A;  4CYC A;  4XON A;  2DTR A;  2BW3 B;  1ETK A;  2IBD A;  2OPT A;  4CZC A;  2R7T A;  3OYG A;  3EYY A;  4IHX A;  1VQO I;  4YRV A;  3BCB A;  3FXL A;  5E20 A;  1FZP B;  3ZQQ A;  3K1M A;  1VF9 A;  1T8I A;  2R7Z J;  1BR4 A;  1T08 B;  3KZY A;  4EJT A;  1HXD A;  1B72 B;  5E1X A;  1WJF A;  3I58 A;  4I01 A;  3SYT A;  3K4L A;  1MZB A;  3CP8 A;  4CO8 A;  4N4N B;  5CQE A;  4AYB A;  4EJO A;  4XOP A;  1UST A;  4HEA 2;  3H35 A;  2NS8 A;  1FY7 A;  2KFD A;  2A6H F;  2UXN A;  2LFB A;  3HOW J;  3G2B A;  1JGS A;  4ZDL A;  1JKO C;  3K2A A;  4PJ0 C;  1MBF A;  4XRF A;  5EYR A;  3GYH X;  2LR8 A;  5IY5 H;  1YTY A;  3P5J A;  1USS A;  1J0R A;  1N78 A;  1TQI A;  1XC5 A;  3K4J A;  1IGN A;  1ETO A;  2ZSI B;  1YW8 A;  2L2O A;  4RGU A;  3FXR A;  1BW6 A;  2GLO A;  1LFU P;  3JRC A;  2DK8 A;  2XGE A;  4DBQ A;  3ULQ B;  2MW8 A;  1LQ1 A;  1WWX A;  4KDP A;  3U21 A;  4B48 A;  1SD5 A;  2GIV A;  2JSP A;  5E1Z B;  3VYR B;  4F7Z A;  4UUT A;  5LRS A;  3LMM A;  3A01 B;  4BQO A;  3WG9 A;  1YW9 A;  2DN0 A;  3FZV A;  3QQA A;  4MEX F;  2DXI A;  1A6I A;  1XD7 A;  2JWT A;  4Y52 J;  2EV5 A;  4OWR B;  4PGG A;  3RJP A;  1ZG1 A;  4KN4 X;  3J7A O;  5L3E A;  2LC2 A;  5GAH J;  5KNL A;  3CCU I;  2A68 F;  4AM3 A;  3K4K A;  3HGG A;  1T6S A;  1MD0 A;  2NS0 A;  1TNT A;  1S5L C;  4WXD A;  1FTZ A;  1PP7 U;  3CJQ B;  3PSI A;  2O5R A;  4S0H B;  3GW2 A;  2DYR H;  1TP4 A;  3S93 A;  1YFH A;  1G3W A;  2GXG A;  5IT9 Z;  5J47 A;  3G73 A;  4GGG A;  1HW1 A;  3O3K A;  3ZMV A;  2FOK A;  2K4B A;  2EV6 A;  2ACJ A;  4L9N A;  3TO7 A;  3CDH A;  1DU0 A;  1CF7 A;  4MFD A;  1V4R A;  4B3X A;  1YJ9 I;  4A3C J;  2EIL H;  4BL0 B;  2HDD A;  5DM7 F;  4BBS J;  2V1D A;  1FWZ A;  3S32 A;  4II3 A;  4UVA A;  4M71 A;  2K02 A;  1GVJ A;  1XMA A;  2HTS A;  2RDP A;  4AVP A;  5E79 C;  3ROU A;  3K4N A;  4CCN A;  1JE8 A;  2XKO A;  2ZO4 A;  4JOM A;  1R71 A;  2W4S A;  5JFR A;  3ZXS A;  3P7N A;  1XMX A;  2LRE A;  3RZO J;  4BXF A;  3I53 A;  4JP0 A;  4A0Z A;  2M4K A;  4RB0 A;  4BHC A;  3I4M J;  1WPK A;  2DT5 A;  1FBQ A;  1SD6 A;  3HUG B;  4M6Y A;  4D1Q A;  3M07 A;  5K1Y A;  4Y7N J;  3TP3 A;  3VB2 A;  5F0H A;  1F9N A;  4CCM A;  2XSD C;  3F6O A;  4QWQ A;  2OQR A;  1IAW A;  3PIO F;  3VOE A;  4A5M A;  4KYW A;  3ML6 A;  3IWF A;  1B8I A;  2QVO A;  2YX4 A;  3BZC A;  4YIF A;  1Z6R A;  2A6E F;  1FOW A;  1IV6 A;  2FML A;  2KIM A;  3QP5 A;  1MW7 A;  4LLL A;  2DK5 A;  3M8J A;  5LRR A;  3HRS A;  3RDI A;  1TQM A;  4YG2 F;  2NAZ A;  1HSJ A;  4M9Z A;  2X6X A;  4JX4 A;  5B1B H;  3KZI C;  1A6Q A;  1S72 I;  2YU3 A;  3E6M A;  2IVM A;  3DPU A;  1XGO A;  2L3D A;  2XDV A;  2HVQ A;  2CSO A;  2OCC H;  2DCE A;  3I0T A;  1SD4 A;  3J7Z I;  2VC0 A;  4OAY A;  2F5C A;  3ASO H;  2LBF B;  1W0T A;  4KUM A;  1ZRC A;  1T33 A;  3K1P A;  1HA8 A;  3OYF A;  4M3D A;  2CJJ A;  3DFG A;  2RKH A;  1MBG A;  2OU2 A;  4KIC A;  5ICC A;  2HEO A;  3GX4 X;  2LYC A;  1XSV A;  1ZEL A;  1XTA A;  4YEL A;  2XKP A;  1FC3 A;  1FT9 A;  3HRM A;  2PJR B;  3KLO A;  1DQU A;  1GLN A;  4ENN A;  3FWE A;  3K6G A;  2QSG X;  4DZJ A;  3F21 A;  1MGT A;  1QRY A;  4Z2Y A;  4PJL A;  2KHM A;  1G3S A;  3F8N A;  1Z67 A;  2HDW A;  4P1W A;  2FQ3 A;  2MLG A;  4ZYD A;  5FD5 A;  1UB9 A;  1PUF B;  2EIJ H;  1XB4 A;  2QKM B;  4LLG F;  3OS1 A;  4A3D J;  3BR3 A;  2M8E A;  2B9S A;  3HB9 A;  4AID A;  1DU6 A;  4NNJ A;  3VOD A;  1OYW A;  3M8E A;  3R6S A;  5HLT A;  2EWN A;  3SEZ A;  1FNN A;  3HG9 A;  2EFN A;  1MMD A;  3CMM A;  4NUB A;  2DT6 A;  2WY7 Q;  2K4J A;  3I4P A;  1XSX A;  2KP6 A;  3MCZ A;  3MKW B;  3CC7 I;  3I55 I;  5CVU A;  5F0F A;  2DDA A;  1QGP A;  1ZG3 A;  2QA4 I;  3M1E A;  4A2U A;  1FP1 D;  3FXO A;  1WKM A;  1X3U A;  3CDL A;  2QLZ A;  3QYB A;  3KET A;  4V2F A;  1Z77 A;  3DKY A;  1UCR A;  3OIQ A;  2FMY A;  5HDG A;  2EZH A;  4EEF G;  4CUG A;  1BC8 C;  4E4H A;  5EG0 A;  3H1C A;  2DJI A;  1HST A;  3WTY C;  3BLY A;  2OTL I;  2P5K A;  5J8F A;  1FIP A;  2J5O A;  2GOM A;  2HFH A;  4RMN A;  1A5J A;  1XSD A;  1X3Z B;  3GWZ A;  2HOT A;  3AAF A;  3M1C A;  2IS4 A;  3K69 A;  1VQM I;  1MJB A;  2DFI A;  3PNY A;  1F4K A;  4E7J A;  3E6B A;  2HQR A;  2A5W A;  3KLN A;  5F0C A;  4ESF A;  5FRN A;  4G12 A;  1JKP C;  4D0P A;  1SAX A;  3WOD F;  1XGN A;  1MBE A;  4IHW A;  4U0V A;  1HLV A;  2R7W A;  4MQV A;  1RUO A;  3VYU B;  3ZRG A;  2H94 A;  3OYC A;  3W2W A;  3L09 A;  1CF7 B;  1Z21 A;  3PQJ A;  1HKQ A;  1H9T A;  2F5D A;  2DMQ A;  2OF7 A;  3LA3 A;  2QYO A;  1JUS A;  1D1A A;  2LY1 A;  3L00 A;  3LOC A;  3F3X A;  4PCQ A;  5HNF A;  5FLX Z;  1YIT I;  3TDZ C;  5HNH A;  4FAS D;  3G4S I;  4B8X A;  3IKV A;  4BUP A;  1K6Y A;  5B3S H;  1J7K A;  2EK5 A;  4NHJ A;  1LDK B;  3IC7 A;  4C2M J;  2VBX A;  1FMW A;  2Y30 A;  5F64 A;  5M3M J;  3SQN A;  2XRO A;  1VTN C;  4UY8 I;  1XCV A;  3B73 A;  3U1K A;  4YFK F;  2FBH A;  1UJ8 A;  5BS6 A;  3CME I;  2HGC A;  2RQP A;  4QLC U;  2G0E A;  4A3G J;  1HDP A;  3LAP A;  4DW6 A;  1ERD A;  2ZNY A;  3UR3 C;  4ZYH A;  1G2H A;  3LSK A;  2CW0 F;  3BG9 A;  1ZTR A;  4XR6 A;  2QWW A;  3AG4 H;  4Y33 A;  4QIW N;  3WTV C;  2KIS A;  2JT1 A;  2VT3 A;  1LE8 A;  2FEZ A;  1SMT A;  5GAE J;  2X6W A;  1WGX A;  4C30 A;  2ISZ A;  3QPT A;  1WQ2 A;  3KIO A;  3DKW A;  3Q9S A;  2L5Q A;  1FSH A;  3IAS 2;  2XV4 S;  3P9I A;  3RSN A;  2DU9 A;  3V8K A;  4EM0 B;  1Z7U A;  5KAI C;  1D5Y A;  3S1M J;  3WTX C;  3FXK A;  4BAY A;  4HPQ A;  2CQN A;  3LSP A;  2R0Q C;  5GAG J;  4A93 J;  1FTT A;  2A6T A;  1GV2 A;  2DFH A;  1QZE A;  2DMT A;  1FYM A;  4HNV A;  4I02 A;  1QPI A;  1S9H A;  3LL7 A;  2OV7 A;  3S3N A;  3HRU A;  4FHT A;  4M3F A;  2EFQ A;  1I3Q J;  2NXN B;  4P96 A;  4FTH A;  1JT0 A;  4HV6 A;  3E3V A;  3GTQ J;  3KP3 A;  4E6K G;  1VQ9 I;  1IN4 A;  4LG3 A;  4XOR A;  2STW A;  2HVS A;  3C1D A;  2XAF A;  1U6G A;  2VKE A;  2QBY A;  3HOU J;  1T2K A;  3ABL H;  3FXU A;  5EEH A;  1OMI A;  4MIM A;  5CLS A;  2FSW A;  1YJW I;  4NQW A;  2BEO A;  2DTZ A;  3L2C A;  4KIS A;  2V6C A;  3KE2 A;  3RQ4 A;  1NG6 A;  1BW5 A;  4A3L J;  1XCB A;  1TW3 A;  3LSM A;  4HBL A;  5HVQ C;  4CZZ A;  5CVJ A;  3UKG A;  2O9L A;  3L1P A;  1A31 A;  2ZKZ A;  5FJ8 J;  2M4G A;  4J01 A;  3BG7 A;  3JRB A;  1MKM A;  3JR9 A;  1VQ6 I;  4BDY A;  2VJJ A;  2O6G E;  1D0Z A;  3G6E I;  2OTJ I;  4M3E A;  5LEJ A;  2X1E A;  1OIS A;  5FKM A;  5D6E A;  5A2Q K;  2XAU A;  3PM1 A;  2DMU A;  1Z05 A;  3K4B A;  5E18 F;  5CJ9 A;  2BYV E;  3HXL A;  2DA1 A;  4DIQ A;  3CJR B;  1AKH A;  5DD8 A;  3PFY A;  2DBB A;  4M74 A;  2P7V B;  2QF7 A;  3CMY A;  5BPD A;  2DFF A;  2HZT A;  2NNY A;  3K2Z A;  1YW7 A;  4O3M A;  3GTM J;  5DV5 A;  1BOB A;  2NOJ B;  3BJA A;  3O6B B;  4MHG A;  5F6F A;  2CFO A;  5HS8 A;  5K5R A;  2EZI A;  2Y2Z A;  1CGP A;  2CUZ A;  3NAU A;  4RLQ A;  3DF8 A;  3RIR A;  5ICE A;  2KPM A;  1K4T A;  5DYM A;  2UZK A;  5EF6 A;  1YX5 A;  1P4W A;  4G94 A;  2AO9 A;  4XLF A;  2FBI A;  2M7B A;  1KQ8 A;  5LGT A;  1Z6T A;  1VQK I;  3ZPL A;  3H92 A;  4BJ6 C;  4MGR A;  2M5W A;  1BOA A;  2VXZ A;  4K2E A;  3MKZ A;  3DEW A;  2AS5 F;  5B5E C;  3ABM H;  4II2 A;  1R4M B;  2HDC A;  3SEQ A;  2KT0 A;  3EQL F;  5GP9 A;  3MZH A;  2GIZ A;  1U0J A;  1T38 A;  1KYW A;  3W6K B;  2DDB A;  3GUD A;  1OCT C;  1TWG J;  2Z5U A;  3WTZ A;  3QPH A;  1G3T A;  2HPI A;  1J5Y A;  2EFP A;  4IRG A;  4YEJ A;  3H36 A;  1XPX A;  3DCF A;  3MN2 A;  5HS9 A;  2NVX J;  3GFL A;  2W57 A;  1MIJ A;  4NC8 A;  1STZ A;  1V54 H;  2VE9 A;  4RM2 A;  1W1W E;  2L9N A;  2JA8 J;  3TDU C;  2V9K A;  3J80 Z;  5DUI A;  1LJ9 A;  4BJ5 C;  1L3L A;  5LBQ A;  2E19 A;  1U9N A;  2QUF A;  2GWR A;  1YIJ I;  1VI0 A;  3DLA A;  1UEL B;  5LD2 C;  1I5Z A;  2ADU A;  1G6N A;  1IXR C;  1X1C A;  4CCL A;  4I2O A;  4L0Y B;  3NRV A;  2ID3 A;  3RYR A;  2ELK A;  3J81 K;  3DP7 A;  3JRE A;  5AON A;  4M6V A;  3TL4 X;  1E3H A;  2ZBK A;  3R4K A;  3S14 J;  5DD4 A;  2E7W A;  4XK4 A;  3F22 A;  5H2F C;  1W4M A;  1W5T A;  3ECO A;  1ORK A;  2R7U A;  2A5Y B;  3OWT A;  2A3S A;  1YJN I;  1JUP A;  2IGK A;  4N9I A;  3FM3 A;  1R6R A;  1BA5 A;  3ZQ7 A;  2R3S A;  3D5R C;  2P6T A;  4G7H F;  4I0A A;  1YQA A;  1CQT A;  4O6J A;  2COB A;  3K9T A;  4XSX F;  2OUM A;  4HX7 A;  4LK1 F;  1JJ6 C;  1LE8 B;  5DM6 F;  3GME A;  1N25 A;  3VYT B;  5FLM J;  1KU2 A;  3OS0 A;  2LKS A;  3GFM A;  5CVI A;  3CZ6 A;  3CUQ B;  4R79 A;  1O7F A;  3ASN H;  1D5V A;  3Q5F A;  5CVV A;  1C0W A;  3COA C;  1Y39 A;  2K3P A;  1LPQ A;  1X4O A;  4F91 B;  1ZLJ A;  3U1D A;  1S8N A;  1OYI A;  2V26 A;  2XRN A;  4XMY A;  2P6S A;  2WC2 A;  1PVE A;  4IQJ A;  4FT8 A;  3H5A A;  3BJ6 A;  3FM5 A;  5FB2 A;  1U8B A;  1ZAO A;  1ON1 A;  4KIB A;  2NVT J;  4HA8 A;  4ASN A;  1LKX A;  3WTU C;  2DOF A;  2B0L A;  3V4G A;  5LLQ A;  2LD5 A;  2D45 A;  2E1O A;  4O5V A;  5E8I A;  2UWM A;  1ETV A;  1RRJ A;  3SXY A;  2IA2 A;  2XIG A;  2VQC A;  1VQN I;  4RS8 A;  3S15 J;  4M9S A;  4ZZD A;  9ANT A;  3WGG A;  1QVU A;  4LFU A;  5D5V B;  5J8C A;  2QBY B;  1BL0 A;  3ABK H;  2PMH A;  2L9S A;  3NEU A;  4BDZ A;  1WRJ A;  2JA2 A;  1AU7 A;  3GXO A;  5FFX A;  5EGO A;  1FPQ A;  2RNJ A;  3O8H A;  3TED A;  4CH7 A;  3DXJ F;  2OZ6 A;  1K78 A;  2L02 A;  1EH8 A;  2MSY A;  2IS1 A;  2ZJ2 A;  2CQX A;  1LDJ A;  2EFO A;  1IC8 A;  1G8X A;  2PMU A;  4GYG A;  3IKT A;  2E5Z A;  2RAE A;  3HYI A;  5F04 A;  4NC7 A;  3L2R A;  2JZY A;  3KEQ A;  2X9D A;  3PFI A;  2EH3 A;  3OS2 A;  1FOX A;  1ZRE A;  2BVL A;  2NS7 A;  5H6Q A;  3HSE A;  3K70 C;  2GXA A;  3F72 A;  3E6C C;  5B1A H;  1XS9 A;  1P2F A;  4NC6 A;  1ZHF A;  1AKH B;  4U7B A;  3OYM A;  2RC4 A;  2OBP A;  1XG1 A;  3BP8 A;  4LMY A;  2O0Y A;  4MFE A;  4RAZ A;  1UG0 A;  1X4P A;  2F5F A;  1RR7 A;  2KL4 A;  5AIQ A;  1MNE A;  2ZB9 A;  4ZYG A;  2UUZ A;  3OIO A;  4IHS A;  1YS6 A;  4XBF A;  4E7I A;  3S3O A;  3FK6 A;  4NB5 A;  2PQ8 A;  3EYI A;  2YR2 A;  5CQG A;  5JI6 A;  2ECC A;  5EEG A;  2N8G A;  5C3E J;  4XLH A;  1V55 H;  3DTE A;  4MO7 A;  3VSL A;  2Y75 A;  2P8T A;  1PJR A;  1H8A C;  2HZD A;  4KJZ A;  2V1X A;  1K6O A;  2VIX A;  2BY1 A;  1XMK A;  2EZK A;  2XGX A;  3EPZ A;  1SVO A;  4KT5 C;  1JKR C;  5F1R A;  4A0Y A;  1BJZ A;  4DBR A;  4B43 A;  2DPD A;  2Y9Y A;  3KEO A;  3M4O J;  2HOS A;  4IHT A;  2FUG 2;  3WHB A;  3ZMZ A;  2Q0O A;  1RR8 C;  3VEP A;  3IL2 A;  3FKJ A;  4ZTF A;  1H88 C;  4GYI A;  4BE2 A;  3H5R A;  1P92 A;  3CCV I;  3TP0 A;  1SEU A;  1YS7 A;  2Q2E A;  3DBL B;  2KRF A;  2VB6 A;  3DBR B;  1Y1W J;  1MJA A;  4DYR A;  2GBY A;  2VLA A;  4KA4 A;  3AL0 C;  2OCE A;  5FKO A;  1YO5 C;  2DQL A;  2IAI A;  3BC8 A;  4A6D A;  2RRE A;  1SFO J;  2DA2 A;  4D5F A;  3KYL A;  5IT3 A;  1HW2 A;  2ZFW A;  2KQR A;  3GZ5 A;  2UV1 A;  2DOE A;  2CMP A;  3CCS I;  1OCO H;  2W48 A;  1TWH J;  3QPS A;  2QEX I;  1GHC A;  2E60 A;  2VQH A;  1TWF J;  1Z0X A;  4V19 K;  5E3L A;  2KIQ A;  2JTV A;  4I6Z A;  3G1L A;  1O3T A;  3I59 A;  4XID A;  2H09 A;  2MG4 A;  3Q3S A;  1R49 A;  4BH9 A;  2VPR A;  2BBY A;  5DCM B;  4XSZ F;  1F5T A;  3K70 D;  1JJ8 C;  3H0D A;  2CQ7 A;  5L3F A;  1LDD A;  1T98 A;  3QOE A;  4EVI A;  3I9V 2;  3RKW A;  3OL3 A;  1J9I A;  1MMN A;  1I3A A;  4LJZ F;  2Z2S B;  1V5F A;  1IO2 A;  2RV8 A;  3HPG A;  2QZ8 A;  3F8M A;  3WGH A;  4ZH4 F;  4H0E A;  2LKX A;  5IT9 K;  1YYV A;  2H6B A;  3GZN B;  3MZ8 A;  3SFZ A;  1LVK A;  2PMZ N;  2V9P A;  2HXO A;  2RN7 A;  1GV5 A;  3MD2 A;  1EA3 A;  1P7I A;  2PBI A;  2ZXH A;  3H3V K;  3V8L A;  4RBO A;  4A12 A;  3Q0W A;  5J3L A;  1ITY A;  4P9U A;  4Y17 A;  1P4X A;  2EFW A;  3VWB A;  1HOM A;  2KJC A;  1K79 A;  1OCP A;  5FKK A;  1R5I D;  1XGM A;  4M6X A;  1ZQ3 P;  3CF5 F;  1ETX A;  1B6A A;  1KYZ A;  1ZN2 A;  4HOB A;  4IKF A;  2XPV A;  1IUY A;  1FYL A;  2OQG A;  2X85 A;  2C6Y A;  2M9H A;  2TCT A;  4S04 A;  2BZT A;  1VQL I;  4B4C A;  3DLL F;  4BY1 J;  4Y3O A;  2CO5 A;  2PEX A;  4FE7 A;  1TT5 B;  3IH2 A;  5JR3 A;  3RPU A;  1TTY A;  3LFU A;  5EGO B;  2AXT C;  2L0K A;  4CYC B;  3HHG A;  3I4N J;  3S3M A;  4YII A;  1HF0 A;  2BV6 A;  1S29 A;  3GTG J;  3PUB A;  2IS6 A;  1UHS A;  2LY2 A;  2PMZ A;  2ZME A;  3JSP A;  3K4C A;  4EV0 A;  2K9N A;  3D0S A;  1MH3 A;  4UV9 A;  4BHP A;  1Y56 A;  2E34 A;  1K78 B;  5FLV A;  2F4I A;  1N75 A;  2WAE A;  1A35 A;  1FMV A;  3BZK A;  3GFJ A;  3DPT A;  2FE3 A;  3ZMT A;  1OYY A;  5ILV A;  3HHH A;  3M9A A;  2YX7 A;  4BS9 A;  1SC7 A;  2QQB A;  2P7C B;  2I10 A;  2M2E A;  3IH4 A;  1G3Y A;  1H9G A;  1Z1D A;  3BY6 A;  4R8H A;  4AC0 A;  3CCJ I;  4AIJ A;  4NBQ A;  4UUS A;  1U2W A;  3GF2 A;  1X3W B;  3BG5 A;  5JHU A;  3OY9 A;  5LGU A;  1FBU A;  2HVR A;  3H5N A;  2OD5 A;  3TW7 A;  1ODD A;  4OAZ A;  1GDT A;  5L3C A;  1NTC A;  1IN8 A;  4RLF A;  4LLN A;  5FRM A;  3S17 J;  4M3G A;  2K9Q A;  1QU3 A;  2DA7 A;  1W7P A;  4IRI A;  1FLI A;  5F1J A;  3C2G A;  1POG A;  1IF1 A;  5EEA A;  1LEB A;  2B63 J;  2JA7 J;  1BJA A;  1TW2 A;  2KLO A;  4ETS A;  2JQ7 A;  4RAF A;  1Z3Y A;  2K85 A;  5IYB J;  1DPU A;  1VQ7 I;  2NVU B;  4RGS A;  4HNU A;  2NVY J;  4HLY A;  2E7X A;  5IYC J;  1I6H J;  2K86 A;  1XDU A;  1OKR A;  4HX4 A;  2ME6 A;  3FK7 A;  1SFK A;  2VQG A;  3F9K A;  4IZZ A;  2PI0 A;  1R4N B;  5IPA A;  2KDZ A;  4PJM A;  2W25 A;  2LMD A;  2CQK A;  4XOT A;  4ZYE A;  4I76 A;  2E36 A;  4IQ4 A;  3JTH A;  2CW8 A;  5IOZ A;  1U5T A;  5EJC A;  5E3N A;  3O2P E;  1MBJ A;  4RGX A;  4B47 A;  1ZH5 A;  2R93 J;  1OCZ H;  3S8P A;  1D1B A;  3FXJ A;  1EF4 A;  4JYK A;  3OMY A;  4M9X A;  3RYP A;  3BJO A;  2WBM A;  4KFC A;  4CSW A;  2LVS A;  5CPR B;  3HOT A;  4XNF A;  2L54 A;  3CJT B;  1R9T J;  2KZG A;  3PIP F;  3SDB A;  3E5U A;  5BQT A;  2E1M C;  1TLH B;  1IN6 A;  3MKL A;  3ECH A;  1VFC A;  1FJL A;  3KP7 A;  4IHY A;  2EIN H;  3IHU A;  1W5S A;  2VOP A;  2XPU A;  2FD5 A;  2ZME C;  3T1B A;  1ZGA A;  4CCJ A;  4MTD A;  2W1O A;  4L18 B;  3CC4 I;  1X2M A;  3GLX A;  3H9J A;  3K10 A;  4LG0 A;  4F3Q A;  3LWF A;  2V79 A;  2D5V A;  5FKL A;  1TZL A;  2M1B A;  4PFO A;  2DI3 A;  3CP2 A;  2Y48 A;  4EJW A;  2QQ9 A;  3DTK A;  1YE9 A;  3VYS B;  2R7O A;  4FET A;  2R5Z A;  4HDV A;  3S2D J;  2H8R A;  1U78 A;  5L3D A;  2DA4 A;  2IEK A;  5L3B A;  3OL4 A;  4GFB A;  3ZN1 A;  1WJD A;  4OU0 A;  3RKY A;  3ZN0 A;  1IG7 A;  4Y4R A;  4M73 A;  1NG7 A;  4S05 A;  5ICF A;  4CYD A;  1KQ9 A;  3DTI A;  5J40 A;  4BE1 A;  3HGY A;  2H8W A;  4RDU A;  4AVZ A;  4GRI A;  1Z9C A;  1B8I B;  1KU7 A;  3QU6 A;  2BVM A;  3KCC A;  3KZZ A;  3CO7 C;  2H6C A;  2MGQ A;  3BZ6 A;  1QPM A;  1SFU A;  1O3Q A;  3HPH A;  2E35 A;  2XRL A;  1S6L A;  4B09 A;  1JUM A;  1R1V A;  4BE0 A;  1I1S A;  4LB5 A;  1KA8 A;  3Q9V A;  4IL6 C;  2R4G A;  4XN0 A;  4IRH A;  1J59 A;  5FLX K;  1X1P A;  2G7U A;  3QYE A;  1I27 A;  1B9M A;  4F92 B;  6PAX A;  1GVD A;  2G7H A;  3REO A;  4PZJ A;  2P0W A;  2L4M A;  2FA5 A;  2A05 A;  4MQ9 F;  1K4S A;  1U5T C;  1IN5 A;  4KIG A;  1T0F A;  3MMY B;  4G6D A;  2ECB A;  2A69 F;  3TO9 A;  5LGN A;  2L01 A;  4IHV A;  4KT6 A;  3BWG A;  4PSX A;  2DQR A;  3OSG A;  4UVC A;  4BXU A;  1WJ5 A;  4EJV A;  3W6V A;  2DOD A;  2ZFU A;  3A1Y A;  1ZLK A;  4KNY A;  2CFX A;  5K5Q A;  5GAD J;  3IWZ A;  2EZL A;  5HOD A;  2R7X A;  1QA6 A;  2X6O A;  3KP6 A;  3CCL I;  3S16 J;  3BT9 A;  1HC8 A;  1W0U A;  1WZ2 A;  1AOY A;  3N4M A;  3RPU D;  1YI2 I;  4IX7 A;  5D5W B;  3DEU A;  2FF4 A;  1W36 C;  3L9F A;  4C3I J;  2IT0 A;  2HOE A;  2HU9 A;  2Z9O A;  3IRQ A;  1R00 A;  2K9L A;  5D6F A;  3SFI A;  2WB1 N;  4FIS A;  4UUS B;  1PUE E;  4JK1 X;  2CH0 A;  2ESH A;  5JVT A;  3OYE A;  3DQV C;  1IV8 A;  3MQ0 A;  2EIM H;  2BHY A;  2CYY A;  2LRD A;  2VI6 A;  4DOZ A;  4G6Q A;  5IP9 J;  3I3L A;  5D4R A;  3OYJ A;  1J75 A;  1H0M A;  5E3O A;  5EZG A;  3AG3 H;  5TGT A;  2LH9 A;  4HQM A;  2V1N A;  4RB3 C;  5M5Y J;  3TOB A;  1QBJ A;  3U2R A;  3HRT A;  2BXZ A;  5H20 A;  3G3Z A;  4WK8 F;  1W7P B;  2BW3 A;  3C7J A;  2QSF X;  3GEZ A;  5D5X B;  3ZR8 X;  5J4V A;  4GO1 A;  2R7V A;  3GZ6 A;  2M45 A;  2EQR A;  2XF6 A;  2KZV A;  3GTJ J;  4XKW A;  3S1N J;  2R7Q A;  2JK3 A;  4RAY A;  4BQN A;  4EJU A;  1Z7L A;  2XF5 A;  4XLN F;  2HYF A;  1EH6 A;  4ENJ A;  1O3S A;  2NVQ J;  5M3F J;  2IRF G;  1J2X A;  1W7P D;  3ZP5 A;  1B1B A;  1B72 A;  2R7D A;  1A36 A;  2WB1 A;  2BY0 A;  4HF0 A;  3HTU A;  2JMW A;  1WJE A;  2F2E A;  4Q48 A;  5EG0 B;  3TBI A;  4LB6 B;  1P9Q C;  2HQA A;  1Q1H A;  4BQA A;  1BI2 A;  2CUF A;  2X4H A;  5E8G A;  2JA6 J;  2M7A A;  5KHD A;  3C3W A;  2JRT A;  2XUB A;  3ELK A;  3FIS A;  3TO6 A;  3CCQ I;  1MMA A;  1M1E B;  2VKD A;  2OJE D;  5D4S A;  1ZG5 A;  2LLK A;  2X1C A;  3F23 A;  1R1U A;  1UAA A;  1BN5 A;  3H3U A;  3LSR A;  5TIS C;  3CCE I;  1T0F C;  5TRD A;  4IO9 F;  3J81 Z;  3Q0V A;  3NWS A;  5H6R A;  4F93 B;  2NNN A;  4EM1 A;  1V5G A;  4I0B A;  1DUX C;  1QQI A;  2QEN A;  3OYI A;  2RNG A;  1OPC A;  4ZDP A;  1RKT A;  3EUK L;  5ED4 A;  2UXX A;  3GO5 A;  1MBH A;  2HWV A;  1V5E A;  5J6X A;  3T8R A;  2LG4 A;  1W5C C;  4ZYA A;  4LD5 A;  3AG2 H;  3DKX A;  1KZH A;  4BKX A;  1MH4 A;  4B3A A;  3H3Z A;  4J00 A;  1W36 D;  3MEX A;  1TWC J;  2VKV A;  4E7H A;  2R5Z B;  3CTA A;  2DO7 A;  3A4C A;  4OIR F;  4RB2 C;  1E0E A;  1JKQ C;  2O3F A;  1NK3 P;  2Z33 A;  2GAU A;  4Y13 A;  4JX6 A;  1V3F A;  4OIN F;  3C18 A;  5C4X J;  3DPL C;  3WU2 C;  3MKY B;  1ZR4 A;  5D5U B;  3K4M A;  3GBG A;  5DEQ A;  3UNG C;  1WHU A;  2IS2 A;  4AD9 A;  3CCY A;  3E5Q A;  2WAQ N;  2KJB A;  3BR1 A;  2EA2 A;  2LF8 A;  4ZTJ A;  2KIU A;  4WXH A;  1FOK A;  2E1C A;  2VON A;  3CO6 C;  3SZT A;  1BIB A;  2CU7 A;  3E1S A;  3JAM Z;  1O57 A;  2Y0M A;  3OYA A;  1IJW C;  4BY7 J;  3BQZ A;  3H0G J;  4A0X A;  1JXS A;  2X51 A;  4FE4 A;  4CXF A;  4OIO F;  2Q8K A;  4OMZ A;  3V8J A;  2VJ4 A;  2LOO A;  1XX5 A;  1KQ0 A;  2W24 A;  3ABU A;  4C3H J;  3S1Q J;  3J80 K;  2CUE A;  3F6V A;  3OR1 C;  4YFN F;  2BOL A;  2ESN A;  3FF5 A;  3P9C A;  4ZC3 A;  3T5X A;  3LSJ A;  5LHI A;  3DEE A;  2VAS A;  1SFE A;  3RKX A;  3TOA A;  4XQF A;  4C9Y A;  2LDU A;  3BDD A;  2F4M B;  3KYC B;  3QOD A;  4LK0 F;  2YSR A;  4A3E J;  1YHQ I;  2WAQ A;  4HF2 A;  2XB0 X;  3LQQ A;  3R60 A;  2FNP A;  3OYB A;  2OA4 A;  3WE2 A;  2HYJ A;  2IA0 A;  2VBY A;  3ZCO A;  3BG3 A;  3PSF A;  4CGZ A;  4X6A J;  4N4O B;  2PN6 A;  3P9K A;  2L7M P;  4A3I J;  2HS5 A;  4Q5S F;  1APL C;  3QPL A;  3I71 A;  2E2J J;  4AWX B;  4AU7 A;  2R7F A;  1I1G A;  3M8F A;  2WAD A;  4Z6Y A;  4UNO A;  3W6J B;  4UV8 A;  1AHD P;  1YRN A;  3R61 A;  2VOD A;  4ITV A;  1P4A A;  2PG4 A;  3ISP A;  1O7L A;  2VXD A;  4LIV A;  1DGR M;  1RC9 A;  3HIF A;  3OOU A;  2D2W A;  2VOO A;  1EKE A;  1GXQ A;  3W2V A;  1ACI A;  1K83 J;  2DW4 A;  4NQW B;  3JRG A;  3R0A A;  2AQE A;  3WE3 A;  3H9Q A;  1MMS A;  2CG4 A;  3EUH A;  3VSK A;  1DP3 A;  5ICG A;  1GXP A;  2L9V A;  1OLT A;  3WU0 A;  4HW0 A;  1BBY A;  3IAM 2;  3X2Q H;  2QM3 A;  3MAJ A;  3KP5 A;  1TWA J;  3IH3 A;  2LBF A;  5DUK A;  3V42 A;  3BG6 A;  3BTI A;  2OZU A;  4A5N A;  3JRF A;  2X48 A;  4CA0 A;  1Y0U A;  1GUU A;  2MD5 A;  2M3A A;  4KIF A;  4Q4Z F;  4E7K A;  1KON A;  4IJA A;  2ZJQ F;  1D8K A;  1D8J A;  3EET A;  1DP7 P;  1WI3 A;  3OOP A;  1JT6 A;  2IGN A;  2FX0 A;  4BYY A;  3WGI A;  4G7Z F;  1O4X A;  2DMP A;  2CQQ A;  4P55 A;  2QKL B;  5HLH A;  3S1R J;  4GDF A;  4J19 A;  2QGU A;  3HSF A;  5KAF C;  1IRX A;  4HF1 A;  3ZOB A;  1IUF A;  4DZP A;  3ONQ A;  3G71 I;  2PJR A;  2HYG D;  4GCV A;  2P81 A;  2ZNZ A;  1NHA A;  2FU4 A;  2MYS A;  3NQO A;  3D1N I;  3FDY A;  2JRM A;  4U7D A;  4OIQ F;  4MEY F;  2Y69 H;  2MH9 A;  5FFZ A;  1TQP A;  2XAH A;  3OYH A;  3ZQG A;  4YFX F;  3CLQ A;  3GCM A;  2XPW A;  3N05 A;  3HL2 A;  3ZQI A;  4BU2 A;  3TQN A;  5FRO A;  3VPR A;  1PUF A;  1S7O A;  4U88 A;  1UHM A;  4C3J J;  1T39 A;  1P6R A;  3CES A;  4FQG A;  3CD6 I;  2VBW A;  3HC7 A;  1U9O A;  1JHF A;  2HQN A;  3OR2 C;  1QNT A;  2ISY A;  2G9W A;  3PNT A;  5KCM A;  3QP6 A;  1TT0 A;  2V7F A;  1EV7 A;  3G1M A;  1YG2 A;  3BR2 A;  3T8T A;  1DDN A;  2H1K A;  3A0H C;  3J7A Y;  2MC3 A;  1SFX A;  1ETQ A;  1ON2 A;  4XKV A;  2O03 A;  1FSE A;  4W1U A;  2IA1 A;  2W7N A;  4GXO A;  2GXB A;  2Z16 A;  3OYN A;  3RTR A;  2M0M A;  1VQ5 I;  2LP0 A;  2DA5 A;  2LTP A;  4XKB A;  2HPM A;  1QZY A;  2VQL A;  1IZ1 A;  2VPL A;  4ENK A;  4DJA A;  1EJ9 A;  3JRH A;  2HKX A;  4D5C A;  3CJN A;  5F27 A;  2VT2 A;  1RUN A;  2EV0 A;  4HSR A;  4BAC A;  2V9V A;  3LQR A;  4WCG A;  4TV7 A;  2GM4 A;  2WY8 Q;  3LNQ A;  4IXA A;  2LNB A;  5D8L B;  3JW4 A;  3HTS B;  1TL8 A;  3VDX A;  2BY2 A;  1Y6I A;  1QVT A;  2ZJP F;  1MMG A;  5AIP A;  3NWT A;  1KGS A;  3FX3 A;  5JLX A;  5GPA A;  3EUH C;  2H1L A;  4BHB A;  3WTT C;  1IRG A;  1S7A A;  4BQQ A;  4IOA F;  5EZH A;  1UMQ A;  1IRF A;  1ZK8 A;  4G8X A;  2MFZ A;  4EMS A;  4EGZ A;  3W3C A;  4RGR A;  3BR5 A;  1OR7 C;  1MSF C;  1IRZ A;  4D7N A;  4CIC A;  2JPC A;  5B66 C;  2L7F P;  2DT7 B;  5IP7 J;  2AQF A;  1LFB A;  3BPV A;  1MDM A;  2E2I J;  3I5U A;  3HOX J;  3HDD A;  4DGW B;  2EPF A;  1U8R A;  3ABT A;  3TMO A;  2W84 A;  3EDP A;  4RM3 A;  3IRR A;  1AA7 A;  2WA0 A;  3LAJ A;  5DCF A;  3AKZ A;  4LGW A;  4OMY A;  3LST A;  3B6C A;  2QCO A;  5J1U A;  3L7W A;  2EBI A;  3M7G A;  5L3G A;  4U87 A;  4M72 A;  2XHK A;  4L9J A;  2K5C A;  1SMY F;  1D3Y A;  2KMU A;  3LFK A;  1KU9 A;  2TRT A;  4MTE A;  3Q0U A;  4WXC A;  2EJR A;  1IDY A;  4U0Y A;  3AFH A;  5J1Y A;  3V7C A;  2CW7 A;  2CGP A;  1TNS A;  3KEY A;  2E1N A;  2M8G X;  2MBF A;  5JLW A;  1R5G A;  5IOY A;  2DFE A;  4H4K C;  1HW5 A;  1UFM A;  2K40 A;  3CUO A;  1R23 A;  2ZXW H;  3OYL A;  2NOG A;  1QO0 D;  1JTX A;  2W85 A;  3OSF A;  2VE8 A;  3S2W A;  1G59 A;  3CCR I;  1X1A A;  3F8F A;  2MH2 A;  1BR1 A;  2GA1 A;  2YU9 J;  1Z3X A;  2J5P A;  2O7O A;  1B4A A;  1LUJ B;  1XGS A;  3GLL A;  4OOI A;  1YRN B;  3W2A A;  2V4J C;  4DQ2 A;  2E71 A;  2HNH A;  2O8X A;  2ZCW A;  3KYD B;  4B1R A;  3FIW A;  4EGY A;  2A61 A;  2XVC A;  5GTI C;  1GT0 C;  2X6Y A;  3AL0 B;  1MSE C;  3C2H A;  3B6A A;  2PX9 A;  4XLP F;  1YX3 A;  2YS9 A;  3B02 A;  3K7A J;  2YUS A;  2FNA A;  4E7L A;  4F52 A;  3SZP A;  2GQQ A;  2RVC A;  2F48 A;  3BPX A;  2K9M A;  4ANJ A;  3DBH B;  2HI3 A;  2F5V A;  4PUS A;  2IGM A;  2VBZ A;  1B59 A;  2O8K A;  4CDG A;  4XIC A;  3FMS A;  3J7Y J;  2CV0 A;  2V1U A;  2IPQ X;  5J1R A;  2K7L A;  4EM2 A;  1WCM J;  2R7S A;  4HLX A;  4CCO A;  3U9G A;  3HSR A;  1MBK A;  1HKS A;  3LSH A;  1YOV B;  3GVA A;  2XAQ A;  1Z91 A;  2EB7 A;  4PSW A;  1K61 A;  1VQP I;  4XLC A;  3ZQH A;  4AIH A;  3WTW C;  1F43 A;  3HM5 A;  4XM3 A;  5HOO A;  2PLY A;  2IW5 A;  4XN3 A;  4FX4 A;  5TJJ A;  1MND A;  1Q1V A;  2P5V A;  4L5E A;  4MNU A;  5DS9 A;  3OV8 A;  2Q1Z B;  1H89 C;  1PYV A;  1OCR H;  1F1Z A;  4UHT A;  4HQE A;  1IDZ A;  2VKH A;  3WTS C;  1OFC X;  4IPA A;  1RES A;  4CCK A;  5M5X J;  3RI4 A;  1BI3 A;  3KP2 A;  2BGC A;  4A3B J;  3WU1 B;  2RQQ A;  1IXC A;  5IP6 A;  3HBL A;  2ZXI A;  4WX9 A;  1XN7 A;  2XF7 A;  4L9V A;  5FD6 A;  3SHF A;  2WWY A;  1JHH A;  3TKY A;  2MLK A;  2XGD A;  1WSU A;  1ZR2 A;  3VFZ A;  1BC7 C;  3LSG A;  2FBK A;  4B44 A;  3S2H J;  5DTD A;  5C4J J;  4YIR X;  1FP2 A;  2ME0 A;  4R1H A;  3CF2 A;  4DYQ A;  4KN7 X;  1RKW A;  1X58 A;  3K0L A;  3I56 I;  3EUA A;  2DYS H;  3QYF A;  1N77 A;  1AWC A;  3OYD A;  2XSJ C;  3E7L A;  2D1H A;  1TC3 C;  2MD0 A;  4FCY A;  2EA4 A;  4E70 A;  3MVP A;  4ENM A;  3GTP J;  5LEK A;  4XRS G;  1RNL A;  2Q2E B;  2LK2 A;  4AIK A;  3KPH A;  4F55 A;  2GA2 A;  2E2H J;  2LSO A;  3RPQ A;  4RAG A;  1TBX A;  3A02 A;  2JVG A;  4I09 A;  1LB2 A;  1JGG A;  1Y8Q B;  3K1N A;  2D1V A;  1E17 A;  3GTK J;  3JSO A;  5LHG A;  1OQY A;  2FOW A;  5FGM A;  2FRH A;  4BJT A;  2V6E A;  2F4O B;  1VQ4 I;  1HKT A;  1WH7 A;  2VN2 A;  1JTY A;  2OC6 A;  4Y15 A;  4UB8 C;  2TDX A;  1QZZ A;  2HTJ A;  1PP8 F;  3CC2 I;  1UZC A;  2IP2 A;  3F8B A;  3HKZ N;  1BI1 A;  2KRH A;  3FBN B;  2BXY A;  3FMQ A;  2R7R A;  1O3R A;  1BR2 A;  1REP C;  1WJB A;  1MDM B;  1T56 A;  1D0Y A;  3F8C A;  2L4A A;  3OYK A;  3I59 B;  4N0B A;  1HCR A;  3I64 A;  4UUV A;  2WAF A;  4IEJ A;  3ERE D;  3M3Y J;  3DWL E;  1Y0N A;  4BGD A;  1VND A;  4HST A;  2JUC A;  5HLG A;  1DPR A;  2BHZ A;  2O61 A;  5KVR A;  4DNC A;  4P9F A;  4L5J A;  3T0Y A;  4HYE A;  3CDI A;  4X1E A;  1LNW A;  1MJ9 A;  2PFB A;  3PUF A;  3HOY J;  2WV0 A;  3CQZ J;  3HJE A;  4LOC A;  4UXN A;  1FYK A;  2JSC A;  4Q47 A;  4JQF A;  3JRA A;  4MLO A;  2PJP A;  3V7R A;  4ESJ A;  1R7J A;  4HG2 A;  4PFP A;  1WJC A;  2R5Y A;  2LF7 A;  4LIU A;  4HZF A;  1D1C A;  1X1D A;  1LFP A;  2NRA C;  3DU5 A;  5C44 J;  1UG2 A;  4E7S A;  3HKZ A;  3TGN A;  2MAB A;  4M3B A;  2L7K A;  2M0C A;  2JJ7 A;  2ELH A;  4RB1 A;  1HBX G;  1I50 J;  2KRC A;  5ERI A;  1ETW A;  2JN6 A;  4KIT B;  4XLE A;  3HOV J;  3F0C A;  3CLO A;  1ZAR A;  2DMN A;  2CV1 A;  5HS7 A;  2HOA A;  2LY9 A;  4A69 C;  4A3M J;  3PJR A;  2VC1 A;  3GTO J;  3LA7 A;  2IGO A;  4ABZ A;  2VUM J;  1LEA A;  2E1M B;  3AG1 H;  3CUQ A;  2ZJR F;  2STT A;  2K27 A;  3G1O A;  5K7Z A;  1RZ4 A;  1IW7 F;  1WH5 A;  4WWC A;  3N97 A;  4DYC A;  1J09 A;  2DJN A;  4IF4 A;  2Z3Y A;  3C2B A;  4G9Y A;  2ZME B;  1SD7 A;  2B7E A;  2Z99 A;  3MZY A;  1YIO A;  4BEH A;  1WFX A;  2A07 F;  2QSH X;  3FKI J;  4QTR A;  1WVR A;  4XLA A;  4KMF A;  3O8G A;  4IVN A;  3TW6 A;  1S7E A;  5GPC A;  1P7J A;  2K3F A;  5BMZ A;  4P5O A;  5A2Q Z;  4PGH A; 
#chains in the Genus database with same CATH homology
 1I6X A;  4OIP F;  1EH7 A;  1ZGJ A;  1R22 A;  3KFW X;  5LHH A;  1LVA A;  5CVR A;  2ZXJ A;  2NYX A;  1U3E M;  4HX8 A;  4WF2 A;  2M30 A;  1R36 A;  4N9H A;  5KK1 A;  4L5I A;  3E97 A;  4JBA A;  3ZMD A;  2COM A;  4CHU A;  2AXL A;  2P5L C;  4L0Z B;  3R0J A;  4G7O F;  4ON0 A;  2KKO A;  1U5T B;  2IJL A;  2WTE A;  5FO5 A;  3E6D A;  3V7S A;  4L9T A;  2ETH A;  4EQQ A;  2OAZ A;  5E1W A;  3QU3 A;  3HOS A;  4HV5 A;  3FMR A;  2P4W A;  4A6E A;  1XDS A;  2GZW A;  3PQK A;  5HLI A;  2CWE A;  1R58 A;  1YLF A;  5CYV A;  1S3J A;  1E2X A;  5DDG A;  3ZMU A;  2DPU A;  1A04 A;  3CUQ C;  1BM9 A;  3ZMS A;  2F5E A;  4ZZL A;  2XAG A;  4KMU X;  4HAM A;  4LG0 B;  1G4D A;  2MA3 A;  2DAO A;  2YPR A;  1ZYR F;  5ILU A;  2JPB A;  3MWM A;  1RIO H;  5HDK A;  2DLL A;  1FX7 A;  3QOP A;  5D8K B;  1ULY A;  3QRF F;  1HQC A;  1WI9 A;  3BRO A;  3KP4 A;  2X0L A;  3GFI A;  5ILS A;  2QQA A;  1R1T A;  1FBS A;  3D5L A;  1IXS B;  3DV8 A;  3E5X A;  1PDN C;  5K5O A;  5E17 F;  4I7H A;  5DCM A;  3QAH A;  4HDU A;  3HUG A;  2M87 A;  1BIA A;  1K7A A;  2KIF A;  4FX0 A;  4U0W A;  3BOQ A;  3MFK A;  5BPI A;  1IN7 A;  1R5H A;  1KU3 A;  3JAM K;  1B9N A;  3LA2 A;  2H27 A;  2BE5 F;  1ONV A;  4UVB A;  1RI7 A;  3I54 A;  3FHZ A;  2XAS A;  1ZRF A;  2XAJ A;  4I98 B;  5BOX A;  3FXQ A;  1OR7 A;  2RGV A;  2LKP A;  4ESB A;  2HKO A;  1L0O C;  5HDN A;  3JTG A;  1BI0 A;  2HR3 A;  1UHW A;  1ZRD A;  2FXA A;  4BNC A;  4PDK A;  2DTR A;  3EYY A;  5E20 A;  1FZP B;  3K1M A;  3KZY A;  4EJT A;  1HXD A;  5E1X A;  3I58 A;  4I01 A;  1MZB A;  4CO8 A;  4EJO A;  1UST A;  1FY7 A;  2A6H F;  2UXN A;  1JGS A;  4XRF A;  3GYH X;  1YTY A;  1USS A;  1J0R A;  1TQI A;  1YW8 A;  4RGU A;  3FXR A;  2DK8 A;  3ULQ B;  1LQ1 A;  1WWX A;  4KDP A;  1SD5 A;  2GIV A;  5E1Z B;  4F7Z A;  5LRS A;  3WG9 A;  1YW9 A;  3FZV A;  4MEX F;  1XD7 A;  2EV5 A;  4PGG A;  3RJP A;  1ZG1 A;  4KN4 X;  3J7A O;  5L3E A;  2A68 F;  1T6S A;  1MD0 A;  2NS0 A;  1TNT A;  4WXD A;  1PP7 U;  3GW2 A;  1YFH A;  1G3W A;  2GXG A;  5IT9 Z;  3G73 A;  4GGG A;  1HW1 A;  3O3K A;  3ZMV A;  2FOK A;  2K4B A;  2EV6 A;  2ACJ A;  4L9N A;  3TO7 A;  3CDH A;  1CF7 A;  1V4R A;  2V1D A;  1FWZ A;  4UVA A;  4M71 A;  2K02 A;  1GVJ A;  1XMA A;  2HTS A;  2RDP A;  4AVP A;  3ROU A;  1JE8 A;  2XKO A;  2ZO4 A;  5JFR A;  3P7N A;  3I53 A;  4A0Z A;  4BHC A;  4RB0 A;  2DT5 A;  1FBQ A;  1SD6 A;  4M6Y A;  5K1Y A;  3VB2 A;  1F9N A;  3F6O A;  4QWQ A;  2OQR A;  1IAW A;  3VOE A;  4A5M A;  4KYW A;  3ML6 A;  3IWF A;  2QVO A;  2YX4 A;  4YIF A;  1Z6R A;  2A6E F;  2FML A;  2KIM A;  3QP5 A;  4LLL A;  2DK5 A;  5LRR A;  3HRS A;  3RDI A;  1TQM A;  4YG2 F;  2NAZ A;  1HSJ A;  4M9Z A;  2YU3 A;  3E6M A;  2IVM A;  1XGO A;  2L3D A;  2CSO A;  3I0T A;  1SD4 A;  2VC0 A;  2F5C A;  1ZRC A;  4KUM A;  3K1P A;  3DFG A;  2RKH A;  2OU2 A;  4KIC A;  5ICC A;  2HEO A;  3GX4 X;  1XSV A;  2XKP A;  1FC3 A;  1FT9 A;  3HRM A;  3KLO A;  4ENN A;  3FWE A;  3F21 A;  1MGT A;  4Z2Y A;  1G3S A;  3F8N A;  2FQ3 A;  2MLG A;  4ZYD A;  5FD5 A;  1UB9 A;  1XB4 A;  4LLG F;  2M8E A;  3VOD A;  1OYW A;  3M8E A;  3R6S A;  2EWN A;  1FNN A;  2EFN A;  2K4J A;  3I4P A;  1XSX A;  3MCZ A;  5CVU A;  1QGP A;  1ZG3 A;  3M1E A;  4A2U A;  1FP1 D;  1WKM A;  1X3U A;  2QLZ A;  3KET A;  1UCR A;  2FMY A;  5HDG A;  1BC8 C;  1HST A;  3WTY C;  2P5K A;  5J8F A;  2J5O A;  2HFH A;  1XSD A;  3GWZ A;  3AAF A;  3K69 A;  1F4K A;  1MJB A;  2DFI A;  3E6B A;  2HQR A;  3KLN A;  4ESF A;  4D0P A;  1SAX A;  3WOD F;  1XGN A;  4U0V A;  1RUO A;  4MQV A;  2H94 A;  3L09 A;  1CF7 B;  3PQJ A;  1HKQ A;  1H9T A;  2F5D A;  3LA3 A;  2QYO A;  3L00 A;  3F3X A;  4PCQ A;  5FLX Z;  3TDZ C;  4B8X A;  3IKV A;  1J7K A;  2EK5 A;  4NHJ A;  1LDK B;  3IC7 A;  2XRO A;  2VBX A;  5F64 A;  3SQN A;  1VTN C;  1XCV A;  3B73 A;  4YFK F;  2FBH A;  5BS6 A;  2HGC A;  2RQP A;  4QLC U;  3LAP A;  2ZNY A;  4ZYH A;  2CW0 F;  2QWW A;  3WTV C;  2VT3 A;  2JT1 A;  2FEZ A;  1SMT A;  2ISZ A;  3QPT A;  1WQ2 A;  3DKW A;  3Q9S A;  1FSH A;  2XV4 S;  3P9I A;  2DU9 A;  3V8K A;  4EM0 B;  1Z7U A;  3WTX C;  4BAY A;  1FYM A;  4I02 A;  3HRU A;  4FHT A;  2EFQ A;  4P96 A;  4HV6 A;  3E3V A;  3KP3 A;  1IN4 A;  2STW A;  3C1D A;  2XAF A;  1U6G A;  2QBY A;  1T2K A;  3FXU A;  5EEH A;  1OMI A;  5CLS A;  2FSW A;  4NQW A;  2BEO A;  3L2C A;  2V6C A;  3KE2 A;  1XCB A;  1TW3 A;  4HBL A;  5HVQ C;  4CZZ A;  5CVJ A;  2ZKZ A;  1MKM A;  2O6G E;  5LEJ A;  5D6E A;  5A2Q K;  1Z05 A;  5E18 F;  5CJ9 A;  2BYV E;  5DD8 A;  2DBB A;  4M74 A;  2P7V B;  5BPD A;  2HZT A;  2NNY A;  3K2Z A;  1YW7 A;  4O3M A;  5DV5 A;  3BJA A;  3O6B B;  4MHG A;  5F6F A;  5HS8 A;  5K5R A;  1CGP A;  3RIR A;  5ICE A;  3DF8 A;  5DYM A;  2UZK A;  1P4W A;  4G94 A;  2FBI A;  1KQ8 A;  5LGT A;  1Z6T A;  3ZPL A;  3H92 A;  4MGR A;  2M5W A;  1BOA A;  2VXZ A;  4K2E A;  2AS5 F;  2HDC A;  3EQL F;  3MZH A;  1T38 A;  1KYW A;  3W6K B;  3GUD A;  2Z5U A;  3WTZ A;  3QPH A;  1G3T A;  1J5Y A;  2EFP A;  4IRG A;  5HS9 A;  3GFL A;  2W57 A;  1STZ A;  2VE9 A;  3TDU C;  3J80 Z;  5DUI A;  1LJ9 A;  1L3L A;  5LBQ A;  2QUF A;  2GWR A;  1I5Z A;  2ADU A;  1G6N A;  1IXR C;  4I2O A;  4L0Y B;  3NRV A;  3RYR A;  3J81 K;  3DP7 A;  5AON A;  2ZBK A;  3R4K A;  5DD4 A;  2E7W A;  3F22 A;  1W4M A;  1W5T A;  3ECO A;  2A5Y B;  2A3S A;  4N9I A;  3FM3 A;  3ZQ7 A;  2R3S A;  2P6T A;  4G7H F;  4I0A A;  1YQA A;  4O6J A;  3K9T A;  4XSX F;  4HX7 A;  4LK1 F;  1KU2 A;  3GFM A;  5CVI A;  3CUQ B;  4R79 A;  1O7F A;  1D5V A;  3Q5F A;  5CVV A;  1C0W A;  3COA C;  1ZLJ A;  3U1D A;  1S8N A;  1OYI A;  2XRN A;  2P6S A;  2WC2 A;  4FT8 A;  3BJ6 A;  3FM5 A;  5FB2 A;  1ZAO A;  1ON1 A;  4KIB A;  4HA8 A;  4ASN A;  3WTU C;  5LLQ A;  2B0L A;  3V4G A;  2D45 A;  4O5V A;  5E8I A;  2UWM A;  3SXY A;  2IA2 A;  2XIG A;  4RS8 A;  4M9S A;  4ZZD A;  3WGG A;  5D5V B;  4LFU A;  5J8C A;  2QBY B;  2PMH A;  3NEU A;  1WRJ A;  3GXO A;  5FFX A;  1FPQ A;  2RNJ A;  3DXJ F;  2OZ6 A;  1K78 A;  2L02 A;  1EH8 A;  2ZJ2 A;  1LDJ A;  2EFO A;  2PMU A;  4GYG A;  3IKT A;  3HYI A;  2JZY A;  3KEQ A;  3PFI A;  1ZRE A;  5H6Q A;  3HSE A;  3F72 A;  3E6C C;  1P2F A;  1ZHF A;  4U7B A;  2RC4 A;  2OBP A;  3BP8 A;  4LMY A;  2O0Y A;  4RAZ A;  2F5F A;  5AIQ A;  4ZYG A;  4IHS A;  1YS6 A;  4XBF A;  4NB5 A;  2PQ8 A;  3EYI A;  2YR2 A;  5JI6 A;  5EEG A;  2Y75 A;  2P8T A;  2V1X A;  1K6O A;  1XMK A;  2XGX A;  4KT5 C;  5F1R A;  4A0Y A;  2DPD A;  3KEO A;  4IHT A;  3ZMZ A;  2Q0O A;  3VEP A;  3IL2 A;  4GYI A;  1P92 A;  1YS7 A;  2Q2E A;  2KRF A;  1MJA A;  4KA4 A;  1YO5 C;  2DQL A;  4A6D A;  1HW2 A;  5IT3 A;  2ZFW A;  3GZ5 A;  1GHC A;  2JTV A;  1O3T A;  3I59 A;  2H09 A;  4BH9 A;  2BBY A;  5DCM B;  4XSZ F;  1F5T A;  5L3F A;  1LDD A;  1T98 A;  4EVI A;  3RKW A;  1J9I A;  4LJZ F;  2RV8 A;  2QZ8 A;  3F8M A;  3WGH A;  4ZH4 F;  4H0E A;  5IT9 K;  1YYV A;  2H6B A;  3SFZ A;  2RN7 A;  2PBI A;  3V8L A;  4A12 A;  4P9U A;  4Y17 A;  1P4X A;  2EFW A;  2KJC A;  1K79 A;  1XGM A;  4M6X A;  1B6A A;  1KYZ A;  1ZN2 A;  4HOB A;  1IUY A;  1FYL A;  2OQG A;  2C6Y A;  4S04 A;  2CO5 A;  2PEX A;  5JR3 A;  3RPU A;  1TTY A;  3HHG A;  4YII A;  2BV6 A;  1S29 A;  2ZME A;  3JSP A;  4EV0 A;  3D0S A;  4UV9 A;  4BHP A;  1K78 B;  3GFJ A;  3DPT A;  2FE3 A;  3ZMT A;  1OYY A;  5ILV A;  3HHH A;  3M9A A;  2YX7 A;  2QQB A;  2P7C B;  4R8H A;  1G3Y A;  1H9G A;  1Z1D A;  3BY6 A;  4AIJ A;  1U2W A;  3GF2 A;  5JHU A;  5LGU A;  1FBU A;  2OD5 A;  1ODD A;  5L3C A;  1IN8 A;  4LLN A;  1W7P A;  4IRI A;  1FLI A;  1LEB A;  1IF1 A;  1BJA A;  1TW2 A;  4ETS A;  1DPU A;  4RGS A;  4HLY A;  2E7X A;  2K86 A;  1XDU A;  1OKR A;  4HX4 A;  2PI0 A;  2W25 A;  4ZYE A;  2CQK A;  3JTH A;  1U5T A;  3O2P E;  4RGX A;  1ZH5 A;  4M9X A;  3RYP A;  3BJO A;  4KFC A;  3HOT A;  2L54 A;  3E5U A;  5BQT A;  1TLH B;  1IN6 A;  3ECH A;  3KP7 A;  3IHU A;  2VOP A;  1W5S A;  3T1B A;  1ZGA A;  4MTD A;  4L18 B;  3GLX A;  4LG0 A;  3LWF A;  2V79 A;  2M1B A;  2DI3 A;  4EJW A;  2Y48 A;  2QQ9 A;  4HDV A;  1U78 A;  5L3D A;  5L3B A;  3ZN1 A;  4OU0 A;  3RKY A;  3ZN0 A;  4M73 A;  4S05 A;  5ICF A;  4CYD A;  1KQ9 A;  1Z9C A;  1KU7 A;  3QU6 A;  3KCC A;  3KZZ A;  3CO7 C;  2H6C A;  3BZ6 A;  1QPM A;  1SFU A;  1O3Q A;  1S6L A;  4B09 A;  1R1V A;  1I1S A;  4LB5 A;  1KA8 A;  3Q9V A;  4IRH A;  1J59 A;  5FLX K;  2G7U A;  1I27 A;  1B9M A;  6PAX A;  2G7H A;  3REO A;  4PZJ A;  2L4M A;  2FA5 A;  4MQ9 F;  1U5T C;  1IN5 A;  4KIG A;  1T0F A;  4G6D A;  2A69 F;  3TO9 A;  5LGN A;  2L01 A;  3BWG A;  2DQR A;  4UVC A;  4BXU A;  4EJV A;  1ZLK A;  4KNY A;  2CFX A;  5K5Q A;  3IWZ A;  3KP6 A;  1AOY A;  3N4M A;  5D5W B;  3DEU A;  2FF4 A;  3L9F A;  2IT0 A;  2HOE A;  2Z9O A;  3IRQ A;  1R00 A;  5D6F A;  1PUE E;  4JK1 X;  2ESH A;  5JVT A;  3DQV C;  3MQ0 A;  2CYY A;  5D4R A;  4G6Q A;  1J75 A;  1H0M A;  4HQM A;  4RB3 C;  3TOB A;  1QBJ A;  3U2R A;  3HRT A;  5H20 A;  3G3Z A;  4WK8 F;  1W7P B;  5D5X B;  3GEZ A;  3C7J A;  4GO1 A;  3GZ6 A;  2M45 A;  4RAY A;  4EJU A;  4XLN F;  1O3S A;  2HYF A;  1EH6 A;  4ENJ A;  2IRF G;  1J2X A;  1W7P D;  3ZP5 A;  1B1B A;  2R7D A;  4HF0 A;  3HTU A;  2F2E A;  4Q48 A;  4LB6 B;  4BQA A;  1Q1H A;  1BI2 A;  2X4H A;  5E8G A;  3C3W A;  2JRT A;  2XUB A;  3ELK A;  3TO6 A;  5D4S A;  1ZG5 A;  3F23 A;  1R1U A;  1BN5 A;  3H3U A;  5TRD A;  3J81 Z;  5H6R A;  2NNN A;  4EM1 A;  4I0B A;  1DUX C;  1QQI A;  2QEN A;  1OPC A;  5ED4 A;  2UXX A;  3GO5 A;  2HWV A;  5J6X A;  3T8R A;  4LD5 A;  3H3Z A;  3MEX A;  3CTA A;  2DO7 A;  4OIR F;  4RB2 C;  2O3F A;  2Z33 A;  2GAU A;  4Y13 A;  1V3F A;  4OIN F;  3C18 A;  3DPL C;  5D5U B;  5DEQ A;  4AD9 A;  3E5Q A;  2KJB A;  2EA2 A;  2LF8 A;  1FOK A;  2KIU A;  4WXH A;  2E1C A;  2VON A;  3CO6 C;  3SZT A;  1BIB A;  3JAM Z;  1O57 A;  2Y0M A;  4A0X A;  1JXS A;  4CXF A;  4OIO F;  2Q8K A;  4OMZ A;  3V8J A;  2W24 A;  1KQ0 A;  3ABU A;  3J80 K;  3F6V A;  4YFN F;  3FF5 A;  2ESN A;  3P9C A;  3T5X A;  5LHI A;  3RKX A;  1SFE A;  3TOA A;  2LDU A;  3BDD A;  4LK0 F;  2YSR A;  4HF2 A;  3LQQ A;  3R60 A;  2FNP A;  2OA4 A;  3WE2 A;  2IA0 A;  2VBY A;  4CGZ A;  2PN6 A;  3P9K A;  2HS5 A;  4Q5S F;  3I71 A;  4AWX B;  2R7F A;  1I1G A;  3M8F A;  4UNO A;  3W6J B;  4UV8 A;  3R61 A;  2VOD A;  1P4A A;  2PG4 A;  3ISP A;  1O7L A;  3HIF A;  2D2W A;  2VOO A;  1GXQ A;  2DW4 A;  3R0A A;  3WE3 A;  2CG4 A;  3EUH A;  5ICG A;  1GXP A;  3WU0 A;  4HW0 A;  1BBY A;  2QM3 A;  3MAJ A;  3KP5 A;  5DUK A;  2OZU A;  4A5N A;  1Y0U A;  2MD5 A;  4KIF A;  4Q4Z F;  4IJA A;  1D8K A;  1D8J A;  3EET A;  1DP7 P;  3OOP A;  4BYY A;  3WGI A;  4G7Z F;  4P55 A;  5HLH A;  3HSF A;  4HF1 A;  2HYG D;  4GCV A;  2ZNZ A;  1NHA A;  2FU4 A;  3NQO A;  4U7D A;  4OIQ F;  4MEY F;  2MH9 A;  5FFZ A;  1TQP A;  2XAH A;  4YFX F;  3TQN A;  1S7O A;  4U88 A;  1UHM A;  1T39 A;  1P6R A;  2VBW A;  1JHF A;  2HQN A;  1QNT A;  2ISY A;  2G9W A;  3QP6 A;  1EV7 A;  1YG2 A;  3T8T A;  1DDN A;  2MC3 A;  1SFX A;  1ON2 A;  2O03 A;  1FSE A;  2IA1 A;  4GXO A;  2GXB A;  3RTR A;  1QZY A;  1IZ1 A;  4ENK A;  2HKX A;  3CJN A;  2VT2 A;  1RUN A;  2EV0 A;  2V9V A;  3LQR A;  4WCG A;  4TV7 A;  4IXA A;  2LNB A;  5D8L B;  3JW4 A;  3HTS B;  5AIP A;  1KGS A;  3FX3 A;  3WTT C;  4BHB A;  1IRG A;  1S7A A;  4EMS A;  1IRF A;  4G8X A;  4EGZ A;  4RGR A;  4CIC A;  2JPC A;  3BPV A;  1MDM A;  3I5U A;  1U8R A;  3ABT A;  2W84 A;  3EDP A;  3IRR A;  3LAJ A;  5DCF A;  4LGW A;  4OMY A;  3LST A;  3L7W A;  5L3G A;  3M7G A;  4M72 A;  2XHK A;  4L9J A;  1SMY F;  1D3Y A;  3LFK A;  1KU9 A;  4MTE A;  4WXC A;  2EJR A;  4U0Y A;  3V7C A;  2CGP A;  1TNS A;  2E1N A;  2MBF A;  1R5G A;  1HW5 A;  1UFM A;  3CUO A;  1R23 A;  1QO0 D;  2W85 A;  2VE8 A;  3S2W A;  3F8F A;  2MH2 A;  2GA1 A;  2J5P A;  1B4A A;  1XGS A;  4OOI A;  4DQ2 A;  2O8X A;  2ZCW A;  4EGY A;  2A61 A;  2XVC A;  4XLP F;  3B02 A;  2FNA A;  3SZP A;  2GQQ A;  2RVC A;  3BPX A;  2VBZ A;  1B59 A;  4CDG A;  3FMS A;  2V1U A;  2IPQ X;  2K7L A;  4EM2 A;  4HLX A;  3U9G A;  3HSR A;  1HKS A;  3GVA A;  1Z91 A;  2XAQ A;  2EB7 A;  4AIH A;  3WTW C;  5HOO A;  2PLY A;  2IW5 A;  4FX4 A;  5TJJ A;  2P5V A;  4MNU A;  3OV8 A;  4UHT A;  1F1Z A;  4HQE A;  3WTS C;  4IPA A;  3RI4 A;  1BI3 A;  3KP2 A;  2BGC A;  3WU1 B;  1IXC A;  4WX9 A;  1XN7 A;  4L9V A;  5FD6 A;  3SHF A;  2WWY A;  1JHH A;  3TKY A;  2MLK A;  1WSU A;  3VFZ A;  1BC7 C;  2FBK A;  1FP2 A;  4R1H A;  4KN7 X;  3K0L A;  1AWC A;  2D1H A;  2EA4 A;  4E70 A;  4ENM A;  5LEK A;  1RNL A;  4AIK A;  2GA2 A;  2LSO A;  3RPQ A;  1TBX A;  4I09 A;  1LB2 A;  3K1N A;  2D1V A;  1E17 A;  3JSO A;  5LHG A;  5FGM A;  2FRH A;  1HKT A;  2VN2 A;  4Y15 A;  2TDX A;  1QZZ A;  2HTJ A;  1PP8 F;  2IP2 A;  3F8B A;  1BI1 A;  3FMQ A;  1O3R A;  1REP C;  1MDM B;  3F8C A;  2L4A A;  3I59 B;  4N0B A;  3I64 A;  4UUV A;  3ERE D;  5HLG A;  1DPR A;  2O61 A;  5KVR A;  4DNC A;  4P9F A;  4L5J A;  3T0Y A;  4HYE A;  1LNW A;  1MJ9 A;  2PFB A;  2WV0 A;  4UXN A;  1FYK A;  2JSC A;  4Q47 A;  4JQF A;  2PJP A;  3V7R A;  4ESJ A;  1R7J A;  2LF7 A;  4HZF A;  2NRA C;  3TGN A;  2ELH A;  4RB1 A;  1HBX G;  5ERI A;  3CLO A;  1ZAR A;  5HS7 A;  2VC1 A;  3LA7 A;  1LEA A;  3CUQ A;  2STT A;  2K27 A;  1RZ4 A;  4WWC A;  1IW7 F;  3N97 A;  4IF4 A;  2Z3Y A;  4G9Y A;  2ZME B;  1SD7 A;  2Z99 A;  3MZY A;  1YIO A;  2A07 F;  4KMF A;  4IVN A;  5BMZ A;  4P5O A;  5A2Q Z;  4PGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...