3K6GA

Crystal structure of rap1 and trf2 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
VSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Telomeric repeat-binding factor 2-interacting protein 1
publication title A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3k6gA00
4BJTA 3K6GA 4BJ5C 3CZ6A 4BJ6C 3OWTA
chains in the Genus database with same CATH superfamily
2Z1DA 3T8RA 5EGOA 1ZRDA 1UHSA 1YOVB 3LOCA 2XAGA 2K40A 1IUFA 2R5ZB 3ZPLA 1F1ZA 5KK1A 5JLXA 3ZQ7A 3MZHA 4BYYA 4IJAA 1EH6A 1WJ5A 2X6XA 3L2VA 1IG7A 2M2EA 1SD4A 4DOZA 3CJRB 4JOMA 2HOEA 3MKZA 3IL2A 1DP3A 3ZQFA 3HC7A 2FD5A 5CVRA 2DPUA 1SMYF 1ZQ3P 2M34A 1S6LA 4WF2A 2CQKA 1ACIA 1WFXA 4UXNA 3CCEI 1W5SA 4ZTFA 2LH9A 4X6AJ 2CRGA 2ZC2A 4FX0A 1S72I 4OIRF 2FBHA 3SQNA 1OFCX 3E1SA 3JAMZ 4BBSJ 4KN4X 4P1WA 3GTOJ 1SFEA 4XKWA 2KPMA 1C0WA 3KYCB 3BTJA 3N05A 3O2PE 3GMEA 4HA8A 5D5WB 1I6HJ 1WJFA 3W6VA 1NK3P 3K1PA 1V3FA 1X1DA 1LDDA 1HDDC 2I5UA 2D1HA 2XGDA 3BR1A 3MN2A 3HGYA 5K5QA 1SAXA 4YFKF 4L9VA 4I0BA 1SFOJ 3ABLH 2CV0A 2ZJQF 3E5XA 4Z2YA 1FC3A 2L7MP 2R93J 1RESA 2B7EA 3HL2A 3GFLA 2RREA 3SFZA 4NC7A 2WV1A 1BC8C 2ZMEA 4GRIA 4HX4A 1Y39A 1Y1VJ 2M4KA 2K9QA 1W5CC 2GAUA 2CG4A 2X1CA 2Y31A 3COAC 3K9TA 2ZSIB 4O5VA 3HZJA 1DUXC 4CYDA 1VQ6I 2HXOA 2FNPA 1X1CA 2L02A 5M5XJ 4A0XA 4I09A 1LUJB 2K27A 2HGCA 1Z9CA 4KFCA 2B9SA 4UUSA 1UCRA 2R7XA 4V19K 1ZN2A 3GTPJ 2W24A 2KIQA 1FLIA 1E2XA 4J19A 1B8IB 4PCQA 3CLQA 4BNCA 2H27A 1EH7A 4RGUA 2X0LA 2Y30A 4JK1X 3HM5A 2PQ8A 1W7PD 1B6AA 1O3RA 2P6TA 5J6XA 4BL0B 3I55I 1QRYA 2QZ8A 4ENMA 5KHDA 3KPHA 1RUNA 3WODF 2JUGA 1PJRA 4JQFA 1V54H 2DA3A 2ACJA 2G7HA 5AIPA 3J81Z 1T39A 2A6TA 1V55H 3QOPA 2DFHA 5DM6F 2VT2A 3KZZA 3L2RA 1TQIA 4BY7J 4G9YA 5ILVA 3KYLA 3PFYA 3WGHA 1BW6A 2L54A 3HOXJ 3HKZA 2E60A 2RKHA 1ZG5A 1STZA 1WQ2A 1W0TA 3TO6A 4E7SA 1B72B 5BNGA 4MQ9F 2IP2A 2XKOA 3S15J 1ETWA 3D5LA 3KZYA 1NH3A 1K79A 1A6QA 2ZCWA 3EPZA 3CCVI 1Z6TA 2XGXA 5J8FA 2A07F 1FP1D 1G3SA 4J00A 3CMEI 1WKMA 3LA7A 2Y0SA 2DFEA 1IGNA 5D6FA 3V8KA 2ZJ2A 1BOAA 2LSOA 4F93B 3FBNB 3FXOA 3ZR8X 2L7ZA 3LSPA 5HS8A 2VT3A 4XOTA 1BW5A 1KA8A 1JUMA 2CFOA 5JHFA 1HQCA 2E19A 4A0ZA 3WTZA 2DDBA 5FKOA 2JA8J 3S3NA 1GLNA 1K61A 4HYEA 4Y3OA 1KU2A 5DTDA 3KETA 4ABZA 3J80K 2G7UA 4WXHA 1JTYA 2WAQN 2GQQA 3DCFA 4XORA 1ONVA 1K6YA 1U0JA 5IYBJ 4O6JA 3DTEA 4BEHA 4L0YB 3HOSA 3BTLA 3A0BC 3F8MA 4IXAA 3CJNA 3E5QA 3FK6A 5F27A 1MNEA 2LKXA 3Q0VA 2Z33A 4YELA 1TT0A 1ZG3A 3HSEA 1HKTA 4B8XA 5K1YA 1G59A 3S14J 2CFXA 3G4SI 4U7DA 1E3OC 3RPQA 5E1WA 2EFOA 2HFHA 1IV6A 1X1PA 3HUGB 3CF5F 2VPLA 2RC4A 1X1BA 1YE9A 1J9IA 1JKPC 4KJZA 2E34A 5F6FA 1YI2I 2CUZA 2R7DA 4OU0A 1I6XA 2COBA 2P81A 2ZXIA 1JKQC 2AQFA 3PIPF 1IC8A 1DGRM 1NG7A 3B02A 5EG0B 3OY9A 2FXAA 2V9PA 4OAZA 2XF6A 1TP4A 2DAOA 2IXSA 1NG6A 5AIQA 1GVDA 3WTSC 4XN3A 3O8GA 2QQ8A 2IGKA 2CV1A 3DPLC 3IKVA 4L9TA 1P6RA 1X4PA 4XLNF 1FJLA 1Z3XA 4BAYA 3C18A 3HBLA 2CUJA 2OUMA 1G6NA 3O3KA 1QU3A 2X48A 3JW4A 4CZCA 1TL8A 4EM1A 4V2FA 4P9UA 2H09A 2BW3B 4HQMA 4UB6C 1YRNB 1XD7A 4BKXA 2RDPA 1GV5A 2VQLA 2ZNYA 3WTYC 4D0PA 3IWZA 5EJCA 5L3GA 4IOCF 4E6KG 1Z91A 2PFBA 1XGOA 2KISA 2O3FA 2UXXA 3G1OA 1F36A 4BJTA 2F5FA 4GGGA 1BIAA 4CCOA 3IH4A 1FSEA 1ODDA 4M6VA 2JA7J 2OC6A 4LD5A 4Y13A 3E7LA 2L9SA 4U88A 2FQ4A 5GPAA 3ELKA 4BDZA 4S04A 5DM7F 3OYGA 3BY6A 5ERIA 5LRSA 1V5GA 5LGTA 3VYTB 3F8FA 2EK5A 3DU5A 4M72A 3KEYA 1VTNC 4S0HB 2L2OA 4LLGF 2FX0A 3C2BA 1SFXA 4XR6A 2Q0OA 3OL3A 2NVYJ 1ZR4A 2QM3A 3KCCA 2OZ6A 1Z1DA 2DN0A 4L5IA 3MCZA 2VC0A 3MVPA 3WE2A 3K70D 2PI0A 3NAUA 4M3FA 4BH9A 4GFBA 3M1EA 2KRFA 2VXZA 3MZ8A 1VQ4I 5IP9J 1TZLA 3OL4A 2XSJC 3HTUA 2FA5A 2PMUA 5LHGA 3CMYA 2BHYA 4UHTA 2OTJI 2JT1A 3F8NA 4B09A 2UWMA 2NNYA 1LJ9A 2ZSHB 1W0UA 3MFKA 5EEGA 2VL8A 1X3UA 2EZHA 2NNNA 5HOOA 2F6CA 2PLYA 2JRMA 3C2GA 1PUEE 1S5LC 2XRNA 1DDNA 1IV8A 3CCYA 3HOWJ 5CVUA 4A2UA 2CYYA 1Z3YA 4A5NA 5IT9K 1BBYA 3LWFA 3P9IA 1T56A 3T0YA 1N75A 1RC9A 3V4GA 2H1KA 2BVMA 2P5VA 5J40A 4A3EJ 1FOWA 4AD9A 2R7RA 1HSTA 4ZYDA 4HSRA 1I3AA 1HDPA 3TGNA 3KEOA 4G7ZF 3N97A 5DCMB 2EFWA 5C4XJ 2EV6A 2M9HA 2LKPA 3ZN1A 1EF4A 3BR0A 3KX2A 2BOLA 1X58A 3ULQB 5FRNA 2BEOA 1QVUA 3S8PA 1PUFA 3CMMA 4AYBA 3P5JA 2AXLA 1VQLI 5DEQA 3TDUC 2VODA 1KU9A 4CDGA 3NWTA 1LEAA 4DJAA 1YW8A 2DU9A 4II2A 4UV9A 3GXOA 2QBYB 4N9HA 3LSJA 3JSOA 3ABMH 3A01B 1R1UA 3JCUC 3S3OA 2JA6J 3KP4A 1R22A 2DJIA 2KLOA 2VJIA 3GTKJ 2HVRA 4RB1A 3ZMZA 1U5TA 3PSIA 1TC3C 3SZPA 1MMDA 4Y7NJ 2P4WA 2XDVA 1ENHA 4E7HA 1LFUP 3JRGA 2A6HF 2HNHA 5JI6A 2W48A 3E6BA 2BZTA 5TGTA 3FHZA 1V4RA 1SD7A 3MD2A 1TQPA 1FYKA 2M1BA 2VB6A 1FBSA 2GBYA 4S05A 1T38A 1FOKA 2E5NA 3BR2A 4IX7A 5M3MJ 1XMKA 1WJDA 4LLLA 3GVAA 4XKVA 1OR7C 2HQNA 2KP6A 3ZMVA 2FSWA 2R5YB 2DFFA 2DK8A 1D1AA 2ICWG 3PIOF 5CVIA 2WADA 3Q3SA 1QQIA 3IH2A 2KRHA 2EZKA 2HYGD 4M74A 3HEFA 4AU7A 2FMYA 4BXUA 3S16J 2EZLA 3F8BA 1IRXA 1JHFA 2MYSA 4XSZF 2YU9J 4AIKA 3PFIA 3S1NJ 4D5FA 1OCRH 4G6TB 1T95A 3W3CA 1SD6A 2NAZA 3SXYA 4PGHA 3CMAI 1WJAA 2EPFA 1W7PB 2EH3A 2DA4A 1MMNA 1P4WA 4HPQA 5HNHA 3ZP5A 2RNJA 1KU7A 2AQEA 1HKQA 4KMUX 5E3MA 3F6VA 1VQOI 4RAZA 1Y6IA 1LFBA 1QPMA 3X2QH 2FEZA 3LSKA 2QF7A 3RPUA 4BGDA 3I3LA 4AIDA 4IOAF 5JVTA 1R71A 3LQQA 4RB0A 2VBYA 2LC2A 3LA2A 4P9FA 1ZKGA 4E4HA 3B6CA 2BXZA 2FOWA 1D1CA 1KONA 1MH3A 2BY0A 3EUAA 4OMYA 3F6OA 1YX3A 4XRSA 3GTJJ 5GTHC 4ZDOA 2BE5F 4IVNA 4KDPA 3Q0UA 3QWLA 2ETHA 2EWNA 1Z6RA 4MQVA 2L3DA 5IOYA 1O7FA 3W6KB 1U8RA 4BE1A 2K3FA 3PUBA 3RYRA 3AKZA 2BXYA 2XC7A 3K4BA 4MTDA 2R0QC 2P6SA 4EGYA 3L1PA 3PSFA 4HNUA 1H9GA 1S7AA 1GXPA 3S2DJ 2CW7A 2CW0F 1WWXA 4BHPA 2GIVA 1O57A 2I10A 1USTA 2IGOA 3EUHA 3I64A 4IPAA 3BJ6A 3DU6A 4P55A 3S32A 5EZGA 1MDMA 5JVGF 4N9IA 5ICGA 2B63J 3EQLF 5F08A 5K5OA 4HNVA 5CYVA 5LFAA 4FQGA 3SEQA 1I1GA 2ZXWH 1ON1A 2J5PA 1MMSA 1MIJA 1MNDA 3AG3H 1S3JA 5DCFA 5BPIA 4EGZA 3PQJA 4LFUA 3M8JA 3RI4A 1VQPI 1T0FC 5GP9A 2O9LA 2V6EA 1TW2A 2NOGA 4O3MA 1MJ9A 2VOPA 1H88C 2QQ9A 4C2UA 1P2FA 1RR8C 4M3GA 4DBQA 1KGSA 2CJJA 2RV8A 1F5TA 3D0SA 2O8XA 1B9NA 2V9KA 2EBIA 2EFNA 3DWLE 4HX8A 1FY7A 3WGIA 1WHUA 2VONA 2WAFA 3K1NA 4PZJA 3ERMA 2DQLA 4FT8A 4LK0F 2MGQA 1TBXA 2X51A 2DO7A 1YX5A 2FBIA 5KVRA 3AFHA 2XAJA 4CO8A 3F9KA 2CQXA 5E8GA 4MGRA 4CGZA 4EATA 5M5YJ 4LLNA 3T1BA 3CJQB 1LKXA 1YHQI 5E17F 5E1XA 1BJAA 3FMSA 1ZRCA 3ZMUA 3WHCA 2Q2EA 1QHHD 2FJ1A 2R7ZJ 1X19A 1AA7A 4HX7A 1ZGJA 4DGWB 3M07A 1UHWA 3QPHA 3HIFA 2F5DA 5E3OA 2HXIA 2L4MA 3I0TA 3R0AA 1U2WA 1H0MA 2O5RA 2O61A 2LNBA 1D8JA 5LD2C 5ILSA 4LG0A 3KP5A 1PP8F 2FUG2 4ZJZA 3H5NA 5FRMA 3O8HA 1FIPA 1YITI 2QKLB 1WI3A 2VASA 1R49A 2IRFG 1R1TA 4MEXF 3GTQJ 4IHTA 1OQYA 2E2IJ 1UB9A 4GYGA 5K5RA 1J7KA 1IDZA 2P7VB 1HLVA 1Z05A 2P5KA 5F64A 4NNJA 2FOKA 4LITA 3M3YJ 2Z9OA 2Z16A 4XICA 4LGWA 2LF7A 1JTXA 3CDIA 3CC2I 4BS9A 1QGPA 1ZK8A 3BTIA 4HSTA 1YYVA 3BR6A 3ZMSA 4KIGA 3ROUA 1RR7A 5CVJA 5F0CA 3PNVA 5F1RA 2OPTA 1WCMJ 4RAGA 3CQZJ 2KDOA 3E97A 5J4YA 5HODA 1CGPA 3JAMK 2P8TA 3HG9A 2CS3A 1ZREA 1Y0UA 3I59B 3JRDA 5HDNA 1FIAA 2L01A 4EMSA 3CDHA 1MZBA 5CVVA 1ZGWA 1MNMC 3DEUA 3BROA 1V5EA 1K6OA 1HOMA 4D7NA 5LGUA 2VKHA 3H9QA 3OYCA 1R6RA 2A05A 2EA4A 4BU2A 1WZ2A 3GZ5A 2F5EA 2UUZA 1B4AA 4AVPA 1J09A 1B59A 2R92J 2LBFA 3CUQC 2MD0A 2BY2A 2JQ7A 4QWQA 1A6IA 4D9JA 4I01A 3E6MA 3C1DA 4I98B 3N4MA 1E3HA 4HF0A 4M3DA 3ECOA 3LSRA 1AWCA 1SAUA 1PYVA 3S1MJ 4Z6YA 3SHFA 1LFPA 2ELKA 2JZYA 2PMZA 5FLVA 2K7LA 3QQAA 4LG3A 3M8FA 1ZLJA 2M45A 1D8KA 3AAFA 2ID3A 1SVLA 1J75A 2STTA 4ESJA 4UV8A 2W4SA 2DFIA 2VN2A 5HS9A 4U0WA 5CKTA 1X4OA 2L7FP 4PJLA 3OYAA 2P5LC 4Y4RA 2DMUA 1W1WE 3FKIJ 1TW3A 3H9JA 2OV7A 3VODA 5LGNA 3SYTA 2PJRB 2H8RA 2ECBA 3GEZA 5HDKA 3J81K 4P5OA 4GO1A 1IAWA 5M3FJ 2QENA 4MO7A 1QVTA 2DBBA 4CYCA 2K9MA 3G71I 2I8DA 1LNWA 2XB5A 3LA3A 1ZHFA 4RB3C 3PJRA 3E0JB 4ZYGA 1ON2A 2W1OA 1ZARA 2E71A 4M73A 5ILUA 1IN7A 1BR4A 3IH3A 1WRJA 4FTHA 4HLXA 3ZOBA 1S8NA 2OTLI 2Y48A 2NVXJ 1Y56A 1AKHA 4BHBA 2EV5A 1XMAA 3UR3C 1XDUA 3HRUA 5FFZA 4ZYEA 1OMIA 3NRVA 1JI8A 2ZXHA 3Q0WA 2ADUA 1IF1A 4CCNA 3J7YJ 3OS2A 1H9TA 2YSRA 3HPHA 2CGPA 3EYIA 3R4KA 2PN6A 4M3BA 5F0HA 4UNOA 2L0KA 4Y15A 2FMLA 3E6DA 4ETSA 1Y8RB 2AO9A 4WK8F 3KLNA 3FXRA 2E1MB 1G8XA 1R7JA 3GLLA 4EJWA 2XUBA 3OYEA 2LY2A 2R7OA 2DT7B 2HS5A 4MLOA 1FOYA 2OCCH 4HAMA 4M9XA 5EEAA 3MKWB 4IHXA 4ZTJA 4KT5C 3MWMA 1UFMA 1P7JA 3JSPA 1AHDP 1MBEA 2JPCA 4A3JJ 1ORKA 3K4KA 3S2HJ 2FE3A 3ECHA 2AXTC 4RLFA 2DA2A 3U1KA 2DMQA 2R7UA 1G4DA 1T8IA 3DP7A 1VFCA 3QODA 4M71A 2A6EF 2DOAA 2OF7A 3FDYA 2LRDA 4EM2A 2OBPA 1YJWI 2IJLA 2L9VA 2HVSA 4TV7A 4CUGA 2X1EA 5L3FA 3HXLA 4DYQA 5LEKA 2WB1A 3KP3A 5B5EC 2ESHA 1UAAA 5DD8A 5D5VB 2F4IA 5E79C 1R58A 2O6GE 4N4NB 1IXSB 4Q48A 3HHGA 1WGXA 3TEDA 4R79A 4LB5A 1R36A 1RKTA 3FBIB 1SFUA 2DODA 1ZYRF 1YLFA 3CJTB 4XM3A 4F52A 4E70A 2FF4A 4XONA 5DDGA 4A3GJ 3JRCA 4XSXF 5FFXA 3GYHX 1FOXA 2EA2A 2LREA 1POGA 1BC7C 1TWGJ 4DZPA 1RKWA 1UELB 1FYLA 3QYFA 3JRHA 2FBKA 2Y9ZA 3GCMA 5L3BA 2XAFA 3RIRA 2E1CA 3ABTA 3SZGA 5GADJ 3HB9A 5DD4A 1SD5A 5J47A 3ZQGA 1IO2A 3CUQA 1IRFA 3CCQI 2LYCA 3OYMA 2R7QA 3TW6A 4EV0A 3DF8A 4FE7A 2DW4A 3ABUA 5DS9A 2R7SA 1T33A 5IP7J 5DV5A 4XBFA 4I76A 4RS8A 3IUOA 3BR3A 1T2KA 3ZCOA 4YIFA 2A69F 4OINF 4ZZDA 3DEEA 4IZZA 4ESFA 4UVCA 1IRZA 1HW1A 4KICA 3HOVJ 1KQ9A 3I53A 5DYMA 4C2MJ 1HC8A 2MC4A 3D1NI 3G1MA 2YPRA 4NQWA 4QLCU 2DA5A 4DYCA 2JUCA 4IHYA 3W2WA 1K78A 1R00A 2F4MB 3OWTA 1PVEA 3I4PA 3EUKL 3IRRA 1FEXA 2PX9A 3P7NA 4NBQA 3RKWA 2EZIA 3G73A 3L9FA 2NVUB 3HSFA 1BR1A 1REPC 3AG2H 1BL0A 1YO5C 1J0RA 2PEXA 4IO9F 3BWGA 4RM3A 1O3QA 4UY8I 2KZVA 3C3WA 3TDZC 1F4KA 3DXJF 3WG7H 1D5YA 3WG9A 3WU2C 3F23A 1YTYA 4IHVA 1VQ8I 2VQHA 2E1MC 3VB2A 4I99C 2Y0MA 4ZYHA 3BZCA 1HXDA 1LE8A 3BZKA 3LNQA 2GXGA 4KITB 2QGUA 3IAM2 2QUFA 4BACA 1DQUA 2ECCA 3KFWX 3S17J 2JA5J 1CF7A 4U0VA 2GXAA 3SZTA 1GHCA 1XCBA 1Y1WJ 3H0GJ 3LSTA 4A6DA 1LB2A 2FRHA 2X6OA 4II3A 2CSOA 1ZGAA 5CQGA 4PK4A 4CHUA 1BIBA 4EJTA 1E3PA 2K5CA 3DQVC 4ZDPA 3LSIA 1A31A 2VE9A 1OCCH 2P0WA 4EQQA 5E3LA 4BXXJ 1BI3A 3QU6A 2DI3A 4A3FJ 2OAZA 2ZJPF 5IP6A 1UMQA 3TBIA 1MSFC 4RM2A 4QTRA 2OJED 2V9VA 4HV6A 2ZBKA 2DTRA 1YJNI 2IW5A 4OMZA 3JRAA 1LQ1A 5F0FA 1TQMA 3M7GA 1QNTA 2GA2A 2QQAA 2DMTA 4Q5SF 3JR9A 2R5ZA 3FHNA 3VSLA 5EGOB 1R23A 2WY8Q 3OYKA 2OA4A 1TWHJ 1E0EA 4R1HA 5GAEJ 3ML6A 2MABA 4XLFA 1X1AA 3SEZA 2V7FA 1EA3A 5J4VA 3FZVA 3E3VA 3FXLA 1B9MA 2IPQX 5J1UA 4K2EA 1UG2A 1OCZH 5LHIA 2W85A 4HV5A 3M9AA 3HRTA 1VQMI 3L2WA 2QEXI 3AL0B 2MG4A 2TDXA 2XRLA 1BI1A 1JT6A 3RYPA 3QOEA 2QCOA 3OR1C 5FD6A 2K3PA 1FTZA 4IRIA 2FU4A 2X6WA 4GCVA 4L5JA 3CO6C 1RIOH 3I5UA 3H9GA 1OCTC 2LBFB 2JVGA 3G2BA 1YS7A 2R7TA 2XF5A 3DV8A 2K85A 4HNTA 2EQRA 2DOEA 2MFZA 5IT3A 1IN6A 4Y52J 1IXCA 2D2WA 1SVOA 2IA1A 2L9RA 4B3XA 3ERED 2E7WA 3J7ZI 5EYRA 1LPQA 1QA6A 3HHHA 1L0OC 4A69C 4A5MA 2LOOA 2HDDA 1VQ7I 2HZTA 4BHCA 1DU0A 4I6ZA 1YW9A 4DIQA 5ICFA 4LMYA 2E36A 2ZXJA 1W5TA 3BOQA 5CLSA 4YIIA 2ISYA 3U9GA 1FBQA 2E7XA 2GA1A 4B43A 1K83J 4GDFA 2ZMEB 1BM9A 4XIDA 3BQZA 2V1DA 3G1LA 4ZYAA 4M9SA 3NARA 3JRBA 4BY1J 4M6XA 4A3MJ 2GWRA 1FX7A 1FSHA 3LAPA 2KDZA 4U0YA 4JBAA 2VQCA 3OS1A 2HWVA 5ICEA 2O0YA 3OMYA 4UUSB 1B8IA 1R5GA 1JKRC 4E7JA 1MBFA 2XSDC 2BBYA 2L4AA 1MBHA 3MMYB 1UHMA 4BE0A 3KZIC 1PP7U 1HKSA 3TP3A 1JKOC 5HLHA 1VQ9I 3WTVC 4FHTA 3FF5A 3JRIA 4CSWA 2VJ4A 3PM1A 3L7WA 3QP5A 4XN0A 2QA4I 3MEXA 1ZG1A 1W36C 3GFIA 4B3AA 2E35A 3HKZN 2W57A 3BG5A 3K0LA 4LJZF 3RCOA 1ULYA 3DKXA 2DLLA 4WX9A 1LVKA 2ESNA 2D5VA 3RPUD 2EJRA 2IS6A 1ZTRA 1ETYA 1WPKA 2XKPA 4XK4A 1JJ6C 1I39A 1B72A 1LEBA 2LR8A 3WU1B 4KT6A 3H35A 2DTZA 2JN6A 5FLXZ 4KA4A 2Y0SN 2ZJRF 5BMZA 1D3YA 3QAHA 2G9WA 2NS8A 3ISPA 4JP0A 5A2QZ 4KISA 4HOBA 1D0XA 4G7HF 4HZFA 4CH7A 2Q8KA 4LIVA 4NC6A 1K4SA 1ZAOA 2XPUA 4AVZA 2K86A 3F3XA 2XASA 3BG3A 3WGGA 2KL4A 4XLAA 3RKYA 3HOUJ 2IA0A 4HG2A 3PO2J 1WJEA 1EH8A 3CDLA 3Q5FA 3MKLA 2BY1A 5B1BH 2BHZA 1KQ8A 3IAS2 1OISA 2EB7A 2B0LA 2TCTA 3AL0C 1VNDA 4PJJA 4RLQA 3BT9A 2VUMJ 1GVJA 1XSDA 2IVMA 4AWXB 2YX7A 3CO7C 3RZOJ 4YEJA 2XHKA 1JJ8C 4L5EA 2HZDA 4PSXA 5E8IA 2F2EA 5D5XB 3CCJI 2W00A 4XL9A 1G3TA 3I56I 2W84A 4BEHB 1S7EA 2CMPA 5AONA 1DU6A 2PG4A 5K7HA 1Z7UA 2QSHX 4CCKA 2YUSA 2WAQA 5HLGA 3K4MA 2XV4S 3S3MA 3ZMDA 2GOMA 3HUGA 2KIUA 4BXFA 3REOA 2LLKA 3CTAA 2VXDA 2K9NA 5IOZA 4ANJA 3JREA 1I5ZA 4OWRB 2ZKZA 3K4JA 4EVIA 1ITYA 3LFUA 3I4NJ 2Y9YA 3V7CA 3LAJA 1KYZA 3BCBA 3KIOA 5EG0A 2WAEA 2D45A 2X9DA 1GXQA 3WU0A 2STWA 2ZMEC 2ISZA 5TJJA 1AU7A 3MZYA 3FK7A 3IWFA 5FD5A 1YS6A 3GUDA 3Q9SA 1KYWA 4HRIA 2QSFX 3K6GA 2ELJA 2N8GA 4BJ6C 4HF1A 2K02A 2NYXA 4B1RA 1H89C 3W2VA 3BQYA 3QRFF 1FTTA 3V7SA 1APLC 2O03A 3IC7A 4MEYF 3HGGA 3J7AY 2EIKH 4DW6A 4RDUA 4XRFA 3GLXA 1K4TA 1I3QJ 3RSNA 2VOOA 1MH4A 3BZ6A 5C4JJ 2HQ5A 3VYUB 3P9CA 5H6RA 2BW3A 3OYNA 3O6BB 4EJOA 3JTGA 1QO0D 4YIRX 3ZN0A 1YRNA 4G6DA 4PSWA 3RDIA 3GF2A 4RGSA 4WXDA 1JGGA 1EKEA 4PJNA 1MSEC 1OR7A 3VPRA 4D5CA 1VQNI 2Z3YA 5EEHA 4I02A 1XC5A 2UXNA 2DA1A 3V42A 5IYDJ 1D5VA 1R4MB 1USSA 3OYHA 3FXJA 1FNNA 1N25A 2F48A 4FE4A 3SFIA 3GBGA 2X6YA 2RQPA 1FZPB 3KYDB 4XLCA 4AIJA 4XLHA 2KMUA 3AG4H 4UUVA 5ICCA 4XKCA 5E18F 3RQIA 3G6EI 3T5XA 2OQRA 1TWAJ 1S9HA 2O8KA 2PMHA 5FKKA 2QSGX 2MSYA 3ZQIA 3DKWA 2NVTJ 4PJ0C 4KN7X 3WHBA 2VI6A 3I71A 2L5QA 3KP7A 3DBLB 5FJ8J 2NVQJ 1YIOA 4BDYA 1RRJA 3TW7A 1M1EB 1H8AC 3MAJA 4NB5A 3HRSA 4XQFA 3V7RA 4HQEA 4ENKA 3CD6I 3WTXC 3CC7I 2KHMA 3LFKA 4GYIA 1P4XA 1KU3A 3DTIA 1I50J 1R5ID 3M4OJ 4PUSA 2HPMA 5B66C 3KP2A 2EV0A 3F72A 3PNYA 2HOTA 2HKXA 3KEQA 1BJZA 4BQNA 4HEA2 3GO5A 1UG0A 3RTRA 2D1VA 5L3DA 2CWEA 5GTIC 3H0DA 4WXCA 3GTGJ 3ZQQA 2BV6A 1J59A 2HI3A 4BJ5C 5J1RA 2GLOA 1Z0XA 3T8TA 1A36A 2HYJA 1TLHB 3ZXSA 1IZ1A 1A5JA 2ELHA 2EILH 2YS9A 5DUKA 2BGCA 1WSUA 2WWYA 1UZCA 1G2HA 3L2CA 5B1AH 3H1CA 4C3JJ 2ME0A 1XGSA 4AYBN 5DCMA 1GUUA 4XRSG 4I2OA 2HDWA 4AIHA 4IF4A 4F55A 3TKYA 1HCRA 2DT6A 1EJ9A 4JX5A 3CUOA 3TOBA 4QIWN 3K4NA 2DDAA 1IJWC 1MBGA 2MH2A 2E1OA 3A03A 5IYCJ 2VJJA 3QPTA 1PDNC 2P7CB 5CPRB 2KIMA 4ON0A 5D4SA 1PUFB 3OOPA 3VOEA 2QBYA 1DGWY 1VZ0A 2HKOA 2Z5UA 3FISA 5EF6A 5DUIA 3E6CC 1XPXA 4F3QA 3A01A 3RZDJ 4HF2A 4MNUA 1W4MA 1T0FA 2M8GX 4XKBA 1OLTA 2BYVE 3CP8A 3NEUA 4IHSA 5FGMA 4A3DJ 1FT9A 3OSGA 1FMVA 5KNLA 3OIOA 5L3CA 1T98A 4IKFA 4W1UA 3U1DA 4KNYA 2IBDA 3LSMA 3C7JA 1XDSA 4R8HA 4F91B 4A3IJ 1U5TB 2RNGA 3DPTA 2MC3A 1R1VA 2A68F 4YRVA 4QPOA 3R0JA 4QPQA 4DNCA 1KQ0A 2M7BA 4L9NA 4HBLA 2FQ3A 4N4OB 5KCMA 1GT0C 2VKDA 3BJOA 2XPWA 3HDDA 2UV1A 3HOZJ 3ONQA 3OYBA 3FXMA 1QPIA 1OKRA 2VJ5A 4XOPA 1XGMA 2HEOA 2R5YA 1XX5A 2DA7A 2QKMB 3EDPA 1LDJA 3BCAA 3KE2A 1DP7P 4RAYA 1O3TA 1JE8A 5LEJA 4HW0A 1RETA 1RUOA 3H3VK 3W2AA 1OYYA 1YW7A 3A4CA 2JVHA 1Q1HA 2WY7Q 6PAXA 1S29A 3LQRA 2CUFA 5JR3A 2VIXA 1OYWA 2LMDA 4WWCA 1BA5A 1FP2A 2DPDA 2IS4A 1OYIA 1MBKA 1MJAA 1J2XA 2HQRA 2QLZA 1IRGA 3U2RA 5D5UB 4A3LJ 1SFKA 1T08B 2LD5A 3GTMJ 4WCGA 2DK5A 4IQ4A 3GWZA 1W7PA 4IL6C 4XRMA 2FNAA 2XF7A 4KIFA 3QYEA 2XAQA 1RI7A 3TOAA 4GXOA 1U78A 5E20A 4LK1F 2DYSH 4FX4A 1MMGA 3RKQA 1XCVA 5F04A 1L3LA 1N77A 2X85A 3VDXA 3DBHB 2V26A 2Y2ZA 3FM5A 5FROA 1JXSA 5GPCA 3HOTA 1IN8A 2IAIA 2A5WA 3ASNH 4C9YA 4BE2A 1FPQA 3K70C 3K2ZA 2K4JA 5LLQA 3BP8A 1QZYA 3K1MA 3L2QA 4ENNA 4IHWA 1ZELA 4JX4A 1U8BA 2NS7A 4F7ZA 4C3IJ 1HF0A 3S1RJ 5HDGA 2OQGA 1LDKB 5E1ZB 1CQTA 5HS7A 2HU9A 2DMPA 1OCOH 2M4GA 2Z2SB 3F8CA 4G94A 1QBJA 4OIQF 4A3CJ 5KAIC 4ZC3A 1XSXA 3I9V2 3FM3A 3VSKA 1UJ8A 3S1QJ 4B47A 2L7KA 1BN5A 4FCYA 1WI9A 1A04A 1E17A 3UNGC 1MD0A 3TMOA 1MDMB 5B3SH 1MGTA 3ZGKA 4J01A 5J8CA 5TISC 4DBRA 4XLPF 3RQ4A 4B4CA 2HDCA 2LDUA 2RGVA 4G6QA 5LHHA 5E3NA 4F92B 2DT5A 3WE3A 2XGEA 1DPRA 3L09A 3M8EA 1JUSA 3CCLI 4CZZA 3OYDA 2HQAA 2E1NA 2V1XA 4NHJA 5BQTA 4CCJA 3OYLA 4RGRA 2R7WA 2NOJB 3CESA 5D6EA 1O4XA 3A2KA 3HJEA 3J80Z 1U5TC 2W25A 5D8LB 3PO3J 1XSVA 4A0YA 4B44A 2LY9A 3GX4X 2ZFWA 3FWEA 3RJPA 2XVCA 4RAFA 1Z67A 2Y69H 2CO5A 3PL8A 1G3YA 2CQ7A 4UB8C 1I27A 5LRRA 4EEFG 1X2NA 2K9SA 1MJBA 2KIFA 1IN4A 2G0EA 2OZUA 2H94A 3VWBA 1ETQA 2MBFA 2HTJA 5H20A 5H2FC 3QU3A 2BY3A 1D1BA 2L9NA 2CUEA 5EDNA 2JJ7A 4NC8A 2H6BA 1ZRFA 1IN5A 5D4RA 4P96A 4EJUA 4XNFA 3BG6A 2PJPA 4IRGA 5J3LA 2MH9A 4ENJA 4X1EA 1U9NA 1TNSA 3OIPA 3SJMA 2CV2A 2V1NA 1VF9A 2H1LA 2Q2EB 1SMTA 2CQNA 2JMWA 1YIJI 3B6AA 4CCLA 5K7FA 4ITVA 1EV7A 2WBMA 3ZRGA 1P92A 1TWFJ 2DYRH 1B1BA 1MW7A 2VC1A 2XAHA 3DEWA 3H36A 5FKNA 1BI2A 3KP6A 2R7VA 1XTAA 2ZB9A 1U3EM 2E2JJ 3J7AO 5CJ9A 3GW2A 1IW7F 3DBRB 4AUXA 3BR5A 3BDDA 3I54A 4RB2C 1ETVA 2LF8A 2RN7A 1HBXG 4LG0B 3BC8A 1P9QC 1OCPA 2CQQA 2OU2A 2QWWA 2M7AA 2R3SA 3LMMA 4M6YA 4I0AA 1T6SA 2K4BA 3Q9VA 2COMA 2KRCA 2LY1A 3EETA 2JK3A 4KUMA 3B73A 3V8JA 2KT0A 3CP2A 4EM0B 5BOXA 4L9JA 2AS5F 2LK2A 4ASNA 4I7HA 3VEPA 1ZR2A 4IRHA 4PDKA 4W97A 2BVLA 2DOFA 4KMFA 1R4NB 2VKEA 2Y75A 3VYRB 1V5FA 4HDVA 4KIBA 4XMYA 2VKVA 2NRAC 2K9LA 3CCMI 3DPUA 5JHUA 3AG1H 2LKSA 2GZWA 4E7IA 3L2UA 2Z99A 3F0CA 1FBUA 5GAHJ 2JPBA 4A12A 3HOYJ 3I59A 4ZDLA 4QSHA 1RZ4A 2Q1ZB 4E7ZA 3HYIA 3BLYA 5CQEA 1ERDA 2EIJH 3TO7A 2F5CA 3NQOA 1SVMA 3G3ZA 4A93J 4V2GA 4NDLA 3OS0A 1TNTA 4U87A 3OYIA 5JFRA 1NTCA 4YG2F 5L3EA 1YQAA 3FXUA 3EUHC 2AHQA 1HW2A 4L0ZB 4U7BA 1TWCJ 3ZQHA 2JWTA 2ZNZA 3BPXA 4DYRA 1SC7A 1WJCA 3ESWB 2PMZN 4NUBA 5FKLA 3OR2C 1R5HA 2HR3A 3MQ0A 1WJBA 3I4MJ 2X4HA 2VQGA 3TL4X 3IHUA 1JUPA 2DQRA 1HW5A 4MFEA 2WC2A 3TO9A 2IS2A 3D5SC 4MIMA 3FXQA 2ME6A 1DPUA 3ZQCA 4KYWA 4PFOA 2MW8A 1KZHA 4H0EA 2HPIA 1ZLKA 4EJVA 1Y0NA 2E5ZA 2NXNB 1O7LA 2KJBA 2RAEA 2F4OB 1JGSA 1MMAA 2LFBA 4D7MA 3OSFA 3A02A 1D0YA 2JA2A 3K7AJ 3QP6A 5C3EJ 3S93A 2MLGA 4UUTA 1RNLA 4BBRJ 2VE8A 2VPRA 3F21A 5IT9Z 2MD5A 2PJRA 1OPCA 3PUFA 4A3KJ 3GZ6A 4CCMA 1F43A 1D0ZA 2VLAA 2C6YA 1Z77A 2M87A 1QHGA 2JSPA 3CC4I 1IUYA 3DKYA 2IT0A 1BR2A 3A0HC 5HNFA 5C44J 3SDGA 2A5YB 3HPGA 5TRDA 1YJ9I 3K10A 3GTLJ 1BI0A 5IY5H 4CYCB 4E7LA 3OYJA 4OIPF 5F1JA 3PQKA 4AC0A 4D1QA 3K69A 1N78A 4YFNF 1HSJA 3TQNA 2VBZA 2HVQA 5FLXK 1JHHA 5EZHA 3M1CA 2X1DA 2EINH 4FETA 4ZH4F 4AM3A 3FMQA 3K4CA 1F9NA 5A2QK 3CLOA 3E5UA 3IV5A 4C30A 1AKHB 1VQ5I 2M0CA 1TTYA 3WTTC 4E7KA 3TP0A 1LVAA 2W7NA 2V1UA 2WA0A 2XIGA 1Y8QB 3LSHA 1X3ZB 5LBQA 3FIWA 4M9ZA 3MKYB 2M5WA 1A35A 4UVBA 5K7ZA 3BG7A 3JRFA 2JSCA 1GDTA 4DZJA 2NS0A 2ZFUA 4MFDA 3OYFA 3VFZA 2R7FA 1RPWA 3DLAA 3C2HA 5H6QA 4N0BA 5FB2A 3H3ZA 4Y33A 2V4JC 3UKGA 2WV0A 2MLKA 5FKMA 5J1YA 4JYKA 1I1SA 4IEJA 1R9TJ 4JX6A 3A1YA 2PBIA 4G7OF 2M30A 3R61A 2IS1A 2KFDA 3JTHA 2WB1N 1S7OA 2W82A 2GM4A 4DQ2A 1SANA 4FASD 2LVSA 3NWSA 2ZO4A 1TT5B 3ASOH 4MTEA 3CCSI 2CW8A 1QZEA 1XG1A 1WH7A 4BQQA 2H6CA 4Q4ZF 1SEUA 3QYBA 4IQJA 3R60A 2QVOA 2QYOA 2IGMA 2LG4A 2V79A 4RMNA 3W6JB 3H92A 3KLOA 4C3HJ 3GFMA 3FX3A 1IXRC 1OJLA 1Q1VA 2M8EA 3QPLA 4C2TA 5FO5A 1NK2P 2UZKA 4A3BJ 2WTEA 2IGNA 1ETOA 2DMNA 2EFQA 3VYSB 2A61A 2XPVA 3FXKA 2EIMH 2CU7A 2OD5A 3BJAA 1FMWA 2M0MA 4OOIA 3CF2A 1Z7LA 4M3EA 2XGCA 3H5AA 2RVCA 2ID6A 1VQKI 3HTSB 1XMXA 2DA6A 1J5YA 2KJCA 4UVAA 4LB6B 4CICA 3GFJA 3GZNB 4ESBA 2XROA 3U21A 3DTKA 4PFPA 4OIOF 2E2HJ 2LP0A 3ZQLA 2YX4A 3CCUI 9ANTA 5BS6A 4L18B 4G12A 5KAFC 4X0GA 2GOXB 2HYFA 3I58A 4ZZLA 4BUPA 5FLMJ 3CUQB 3K4LA 2GIZA 3LL7A 3WTUC 3F22A 3P9KA 1WH5A 4B48A 1GV2A 2DCEA 2KZGA 3BPVA 1XGNA 1XN7A 3R6SA 2YU3A 1FYMA 1X2MA 1JT0A 4A6EA 5D8KB 1X3WB 3RKXA 3LSGA 2KKOA 4RBOA 1K7AA 3OV8A 1Z21A 1NHAA 4Y17A 2LTPA 2HTSA 5IPAA 4XLEA 3L00A 1U9OA 2YR2A 3HSRA 4Q47A 4NQWB 4HLYA 3S2WA 3CZ6A 3DLLF 2R4GA 1K78B 2HOSA 2XB0X 2CH0A 5HLIA 3OOUA 2GXBA 1HA8A 2MA3A 4PJMA 1MBJA 3BTCA 4LOCA 3ZMTA 2J5OA 3EYYA 4YFXF 1WVRA 1YFHA 1W36D 4CXFA 2RQQA 3ABKH 4CA0A 4FISA 1VI0A 4PGGA 3WTWC 4BQAA 3H3UA 2M3AA 2OCEA 2KQRA 4G8XA 5ED4A 3HRMA 5GAGJ 3BG9A 2HOAA 3QPSA 1LE8B 3FMRA 2IA2A 5HLTA 3SDBA 4LIUA 5BPDA 2QQBA 1CF7B 2O7OA 4MHGA 3CCRI 2EFPA 3IKTA 1P7IA 2VBWA 2H8WA 2XAUA 3V8LA 3H5RA 4BQOA 5JLWA 1G3WA 2F5VA 4RGXA 2JTVA 2JRTA 2TRTA 3IRQA 1QZZA 4HDUA 3D5RC 2V6CA 1BOBA 2IEKA 1P4AA 1XB4A 2DJNA 4OAYA 1O3SA 1ETXA 3OIQA 5HVQC 1ZH5A 1ETKA 1YG2A 2VBXA 1AOYA 2A3SA 1IDYA 3FKJA 3IP4B 4RA2A 1MKMA 4H4KC 1U6GA 3DFGA 5M5WJ 1FWZA 1XS9A 2DXIA 3PNTA 3K2AA
chains in the Genus database with same CATH topology
1KONA 3EUAA 3L2QA 2Z1DA 1ZELA 1YX3A 4ZDOA 3FHNA 3VSLA 1LDKB 2WY8Q 3OYKA 1E0EA 2HU9A 4XLFA 2MABA 1X1AA 3SEZA 2M4GA 2V7FA 2Z2SB 4BE1A 3PUBA 1EA3A 3AKZA 4ZC3A 1WJ5A 2X6XA 3K4BA 2XC7A 3L2VA 3PSFA 3CJRB 3I9V2 4DOZA 4JOMA 3VSKA 4HNUA 3MKZA 2CW7A 1DP3A 4B47A 2L7KA 3HC7A 3L2WA 3AL0B 2IGOA 3S32A 3DU6A 3UNGC 3TMOA 3QOEA 3OR1C 3ZGKA 2K3PA 1WFXA 2X6WA 4J01A 5LFAA 4ZTFA 2LH9A 3SEQA 4DBRA 3RQ4A 3H9GA 2LBFB 2JVGA 3G2BA 2R7TA 2XF5A 3E1SA 4F92B 1MNDA 4HNTA 4P1WA 4XKWA 2MFZA 2KPMA 4B3XA 3N05A 3M8JA 3OYDA 2HQAA 1WJFA 1T0FC 2V6EA 4CCJA 3OYLA 2R7WA 1X1DA 2NOJB 3CESA 2LOOA 4C2UA 3A2KA 4DIQA 2CV0A 4DBQA 4B44A 3HL2A 4B43A 2RREA 4NC7A 2V9KA 3PL8A 4GRIA 3DWLE 2WAFA 2M4KA 4ZYAA 2X1CA 3VWBA 2X51A 1YX5A 2ZSIB 3AFHA 3F9KA 1X1CA 1D1BA 2L9NA 2VQCA 4EATA 4NC8A 2R7XA 3OS1A 3CJQB 1LKXA 3OMYA 4XNFA 4E7JA 3BG6A 3MMYB 4BE0A 3OIPA 2CV2A 2V1NA 2Q2EB 1QHHD 4CSWA 2VJ4A 1X19A 4XN0A 1AA7A 4CCLA 4ITVA 3ZRGA 2WBMA 1W36C 4DGWB 4BL0B 1MW7A 5KHDA 2JUGA 1PJRA 4JQFA 3RCOA 2R7VA 3DKXA 2O5RA 2A6TA 5LD2C 1LVKA 3L2RA 3RPUD 2FUG2 3KYLA 4ZJZA 3H5NA 3PFYA 5FRMA 2IS6A 2QKLB 2E60A 1P9QC 2VASA 3BC8A 3HKZA 2M7AA 3LMMA 4KT6A 4E7SA 2KRCA 2LY1A 3H35A 4NNJA 3CP2A 4LITA 2Z16A 3D5LA 2BVLA 3EPZA 4BS9A 4KISA 1D0XA 3VYRB 1V5FA 4HSTA 4XMYA 4CH7A 4LIVA 2K9LA 3DPUA 4AVZA 4J00A 4E7IA 2KL4A 4XLAA 3PNVA 2Y0SA 3L2UA 4HG2A 1WJEA 2KDOA 4ZDLA 4F93B 3FBNB 4E7ZA 2Q1ZB 3HG9A 3ZR8X 2CS3A 3IAS2 3BLYA 5CQEA 1ERDA 4XOTA 2CFOA 5JHFA 3OS0A 3AL0C 4U87A 4PJJA 3OYIA 4RLQA 1V5EA 1GLNA 3S3NA 4Y3OA 3EUHC 2VKHA 4U7BA 3H9QA 3OYCA 1R6RA 4XORA 4YEJA 1K6YA 1U0JA 4BU2A 2HZDA 2UUZA 4PSXA 3DTEA 1WJCA 4BEHA 2W00A 4XL9A 4NUBA 3HOSA 1J09A 3OR2C 2LBFA 4BEHB 1WJBA 2VQGA 2MD0A 3TL4X 2CMPA 1MNEA 4D9JA 4YELA 4CCKA 1TT0A 2WAQA 2IS2A 3D5SC 3K4MA 1G59A 1SAUA 1PYVA 3S3MA 1LFPA 2PMZA 4PFOA 2GOMA 4BXFA 2HPIA 4LG3A 2VXDA 3HUGB 4ANJA 2VPLA 1X1BA 1YE9A 4OWRB 2E5ZA 3K4JA 4KJZA 3LFUA 1MMAA 2CUZA 2W4SA 1D0YA 2JA2A 2ZXIA 3BCBA 1X4OA 4PJLA 5CKTA 3S93A 2AQFA 2WAEA 3OYAA 4Y4RA 1DGRM 3H9JA 1NG7A 3OY9A 2PJRA 2OV7A 4OAZA 2XF6A 2IXSA 1NG6A 4CCMA 3SYTA 2PJRB 1D0ZA 2VLAA 4XN3A 4HRIA 4P5OA 1QHGA 2JSPA 3K6GA 2ELJA 2IGKA 3DKYA 4BJ6C 2CV1A 1BR2A 3DPLC 5HNFA 3W2VA 3HPGA 2K9MA 2I8DA 3K10A 3J7AY 1X4PA 4E7LA 3PJRA 3E0JB 1Z3XA 3OYJA 3RSNA 2W1OA 4D1QA 2CUJA 2OUMA 1N78A 3VYUB 2BW3A 3OYNA 1QU3A 4CZCA 1BR4A 2HVQA 2BW3B 3M1CA 2X1DA 4FETA 4PSWA 1Y56A 3K4CA 4PJNA 2VQLA 4C30A 3UR3C 4E7KA 4E6KG 2W7NA 1JI8A 2ZXHA 2WA0A 3V42A 4CCNA 3OS2A 3LSHA 3HPHA 4BJTA 3OYHA 3MKYB 4CCOA 3BG7A 3GBGA 2OC6A 2X6YA 2E1MB 1G8XA 2L9SA 4XLCA 2ZFUA 3OYFA 4BDZA 3OYEA 3DLAA 2LY2A 2R7OA 2DT7B 3C2HA 2KMUA 4XLHA 3OYGA 1V5GA 4XKCA 4MLOA 3VYTB 3DU5A 3MKWB 4Y33A 4ZTJA 2V4JC 1S9HA 3KEYA 2L2OA 4XR6A 3A1YA 2L5QA 3OL3A 3K4KA 4BDYA 2IS1A 4RLFA 2W82A 4FASD 4XQFA 3K70D 2R7UA 3NWSA 3QODA 2KHMA 2CW8A 2DOAA 2VXZA 3DTIA 3FDYA 2LRDA 1TZLA 3OL4A 2XSJC 4BQQA 4PUSA 2HPMA 2HVSA 3PNYA 4CUGA 3QYBA 4BQNA 4IQJA 2X1EA 4HEA2 3HXLA 1UG0A 2IGMA 2LG4A 4RMNA 2WB1A 3RTRA 2UWMA 1UAAA 2ZSHB 3H0DA 3ZQQA 4C2TA 2VL8A 2F4IA 4BJ5C 2F6CA 2IGNA 5HOOA 3C2GA 3VYSB 4N4NB 1FMWA 2M0MA 3ZXSA 4R79A 3CF2A 1Z3YA 1Z7LA 3FBIB 3H5AA 4XM3A 4F52A 1N75A 4XONA 2BVMA 2LREA 2R7RA 4HSRA 3U21A 1UELB 3DTKA 3QYFA 4PFPA 2HDWA 4F55A 2DT6A 3SZGA 4X0GA 2GOXB 3K4NA 3KX2A 2BOLA 4BUPA 5FRNA 3S8PA 2LYCA 2VJJA 2R7QA 3CMMA 3OYMA 3K4LA 3LL7A 5CPRB 4AYBA 4B48A 2R7SA 3NWTA 4DJAA 2DCEA 1DGWY 1VZ0A 4II2A 4F3QA 3IUOA 3ZCOA 4XKBA 1OLTA 3S3OA 3CP8A 4IZZA 3DEEA 2DJIA 2KLOA 3LSGA 2VJIA 1FMVA 2HVRA 1Z21A 5KNLA 4IKFA 3PSIA 3LSMA 1MMDA 2MC4A 4F91B 2XDVA 4XLEA 4E7HA 2RNGA 3DPTA 4NQWB 4YRVA 3CZ6A 3W2WA 2HNHA 4QPOA 5TGTA 2R4GA 3OWTA 4QPQA 2M7BA 3MD2A 2VB6A 3EUKL 4N4OB 5KCMA 2VKDA 2UV1A 3ONQA 3OYBA 2CH0A 2E5NA 4IX7A 2VJ5A 1BR1A 1WJDA 3OOUA 4XOPA 1HA8A 4XKVA 1OR7C 2QKMB 2KP6A 4PJMA 3BCAA 4RM3A 2KZVA 1D1AA 1W36D 3W2AA 3A4CA 2JVHA 2WY7Q 2RQQA 4CA0A 2VQHA 2E1MC 2WADA 2KRHA 2M3AA 2KQRA 2VIXA 4KITB 3IAM2 4AU7A 4BACA 1DQUA 2IS4A 5HLTA 3SDBA 4LIUA 1IRXA 2MYSA 4II3A 4G6TB 5CQGA 1SFKA 4PK4A 1T95A 3W3CA 2XAUA 2K5CA 4IQ4A 3DQVC 3H5RA 3LSIA 4ZDPA 4BQOA 1WJAA 2P0WA 2XF7A 2F5VA 3QYEA 5HNHA 1MMNA 4HPQA 3TBIA 3D5RC 1BOBA 2AQEA 4RM2A 1MMGA 4OAYA 1Y6IA 1N77A 2X85A 3LSKA 3VDXA 3OIQA 5HVQC 4BGDA 2V26A 3I3LA 5FROA 3HOTA 3FKJA 3IP4B 2LC2A 2A5WA 4H4KC 4C9YA 4E4HA 4BE2A 2DXIA 3K70C 3PNTA 1D1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJT A;  3K6G A;  4BJ5 C;  3CZ6 A;  4BJ6 C;  3OWT A; 
#chains in the Genus database with same CATH topology
 2Z1D A;  3T8R A;  5EGO A;  1ZRD A;  1UHS A;  1YOV B;  3LOC A;  2XAG A;  2K40 A;  1IUF A;  2R5Z B;  3ZPL A;  1F1Z A;  5KK1 A;  5JLX A;  3ZQ7 A;  3MZH A;  4BYY A;  4IJA A;  1EH6 A;  1WJ5 A;  2X6X A;  3L2V A;  1IG7 A;  2M2E A;  1SD4 A;  4DOZ A;  3CJR B;  4JOM A;  2HOE A;  3MKZ A;  3IL2 A;  1DP3 A;  3ZQF A;  3HC7 A;  2FD5 A;  5CVR A;  2DPU A;  1SMY F;  1ZQ3 P;  2M34 A;  1S6L A;  4WF2 A;  2CQK A;  1ACI A;  1WFX A;  4UXN A;  3CCE I;  1W5S A;  4ZTF A;  2LH9 A;  4X6A J;  2CRG A;  2ZC2 A;  4FX0 A;  1S72 I;  4OIR F;  2FBH A;  3SQN A;  1OFC X;  3E1S A;  3JAM Z;  4BBS J;  4KN4 X;  4P1W A;  3GTO J;  1SFE A;  4XKW A;  2KPM A;  1C0W A;  3KYC B;  3BTJ A;  3N05 A;  3O2P E;  3GME A;  4HA8 A;  5D5W B;  1I6H J;  1WJF A;  3W6V A;  1NK3 P;  3K1P A;  1V3F A;  1X1D A;  1LDD A;  1HDD C;  2I5U A;  2D1H A;  2XGD A;  3BR1 A;  3MN2 A;  3HGY A;  5K5Q A;  1SAX A;  4YFK F;  4L9V A;  4I0B A;  1SFO J;  3ABL H;  2CV0 A;  2ZJQ F;  3E5X A;  4Z2Y A;  1FC3 A;  2L7M P;  2R93 J;  1RES A;  2B7E A;  3HL2 A;  3GFL A;  2RRE A;  3SFZ A;  4NC7 A;  2WV1 A;  1BC8 C;  2ZME A;  4GRI A;  4HX4 A;  1Y39 A;  1Y1V J;  2M4K A;  2K9Q A;  1W5C C;  2GAU A;  2CG4 A;  2X1C A;  2Y31 A;  3COA C;  3K9T A;  2ZSI B;  4O5V A;  3HZJ A;  1DUX C;  4CYD A;  1VQ6 I;  2HXO A;  2FNP A;  1X1C A;  2L02 A;  5M5X J;  4A0X A;  4I09 A;  1LUJ B;  2K27 A;  2HGC A;  1Z9C A;  4KFC A;  2B9S A;  4UUS A;  1UCR A;  2R7X A;  4V19 K;  1ZN2 A;  3GTP J;  2W24 A;  2KIQ A;  1FLI A;  1E2X A;  4J19 A;  1B8I B;  4PCQ A;  3CLQ A;  4BNC A;  2H27 A;  1EH7 A;  4RGU A;  2X0L A;  2Y30 A;  4JK1 X;  3HM5 A;  2PQ8 A;  1W7P D;  1B6A A;  1O3R A;  2P6T A;  5J6X A;  4BL0 B;  3I55 I;  1QRY A;  2QZ8 A;  4ENM A;  5KHD A;  3KPH A;  1RUN A;  3WOD F;  2JUG A;  1PJR A;  4JQF A;  1V54 H;  2DA3 A;  2ACJ A;  2G7H A;  5AIP A;  3J81 Z;  1T39 A;  2A6T A;  1V55 H;  3QOP A;  2DFH A;  5DM6 F;  2VT2 A;  3KZZ A;  3L2R A;  1TQI A;  4BY7 J;  4G9Y A;  5ILV A;  3KYL A;  3PFY A;  3WGH A;  1BW6 A;  2L54 A;  3HOX J;  3HKZ A;  2E60 A;  2RKH A;  1ZG5 A;  1STZ A;  1WQ2 A;  1W0T A;  3TO6 A;  4E7S A;  1B72 B;  5BNG A;  4MQ9 F;  2IP2 A;  2XKO A;  3S15 J;  1ETW A;  3D5L A;  3KZY A;  1NH3 A;  1K79 A;  1A6Q A;  2ZCW A;  3EPZ A;  3CCV I;  1Z6T A;  2XGX A;  5J8F A;  2A07 F;  1FP1 D;  1G3S A;  4J00 A;  3CME I;  1WKM A;  3LA7 A;  2Y0S A;  2DFE A;  1IGN A;  5D6F A;  3V8K A;  2ZJ2 A;  1BOA A;  2LSO A;  4F93 B;  3FBN B;  3FXO A;  3ZR8 X;  2L7Z A;  3LSP A;  5HS8 A;  2VT3 A;  4XOT A;  1BW5 A;  1KA8 A;  1JUM A;  2CFO A;  5JHF A;  1HQC A;  2E19 A;  4A0Z A;  3WTZ A;  2DDB A;  5FKO A;  2JA8 J;  3S3N A;  1GLN A;  1K61 A;  4HYE A;  4Y3O A;  1KU2 A;  5DTD A;  3KET A;  4ABZ A;  3J80 K;  2G7U A;  4WXH A;  1JTY A;  2WAQ N;  2GQQ A;  3DCF A;  4XOR A;  1ONV A;  1K6Y A;  1U0J A;  5IYB J;  4O6J A;  3DTE A;  4BEH A;  4L0Y B;  3HOS A;  3BTL A;  3A0B C;  3F8M A;  4IXA A;  3CJN A;  3E5Q A;  3FK6 A;  5F27 A;  1MNE A;  2LKX A;  3Q0V A;  2Z33 A;  4YEL A;  1TT0 A;  1ZG3 A;  3HSE A;  1HKT A;  4B8X A;  5K1Y A;  1G59 A;  3S14 J;  2CFX A;  3G4S I;  4U7D A;  1E3O C;  3RPQ A;  5E1W A;  2EFO A;  2HFH A;  1IV6 A;  1X1P A;  3HUG B;  3CF5 F;  2VPL A;  2RC4 A;  1X1B A;  1YE9 A;  1J9I A;  1JKP C;  4KJZ A;  2E34 A;  5F6F A;  1YI2 I;  2CUZ A;  2R7D A;  4OU0 A;  1I6X A;  2COB A;  2P81 A;  2ZXI A;  1JKQ C;  2AQF A;  3PIP F;  1IC8 A;  1DGR M;  1NG7 A;  3B02 A;  5EG0 B;  3OY9 A;  2FXA A;  2V9P A;  4OAZ A;  2XF6 A;  1TP4 A;  2DAO A;  2IXS A;  1NG6 A;  5AIQ A;  1GVD A;  3WTS C;  4XN3 A;  3O8G A;  2QQ8 A;  2IGK A;  2CV1 A;  3DPL C;  3IKV A;  4L9T A;  1P6R A;  1X4P A;  4XLN F;  1FJL A;  1Z3X A;  4BAY A;  3C18 A;  3HBL A;  2CUJ A;  2OUM A;  1G6N A;  3O3K A;  1QU3 A;  2X48 A;  3JW4 A;  4CZC A;  1TL8 A;  4EM1 A;  4V2F A;  4P9U A;  2H09 A;  2BW3 B;  4HQM A;  4UB6 C;  1YRN B;  1XD7 A;  4BKX A;  2RDP A;  1GV5 A;  2VQL A;  2ZNY A;  3WTY C;  4D0P A;  3IWZ A;  5EJC A;  5L3G A;  4IOC F;  4E6K G;  1Z91 A;  2PFB A;  1XGO A;  2KIS A;  2O3F A;  2UXX A;  3G1O A;  1F36 A;  4BJT A;  2F5F A;  4GGG A;  1BIA A;  4CCO A;  3IH4 A;  1FSE A;  1ODD A;  4M6V A;  2JA7 J;  2OC6 A;  4LD5 A;  4Y13 A;  3E7L A;  2L9S A;  4U88 A;  2FQ4 A;  5GPA A;  3ELK A;  4BDZ A;  4S04 A;  5DM7 F;  3OYG A;  3BY6 A;  5ERI A;  5LRS A;  1V5G A;  5LGT A;  3VYT B;  3F8F A;  2EK5 A;  3DU5 A;  4M72 A;  3KEY A;  1VTN C;  4S0H B;  2L2O A;  4LLG F;  2FX0 A;  3C2B A;  1SFX A;  4XR6 A;  2Q0O A;  3OL3 A;  2NVY J;  1ZR4 A;  2QM3 A;  3KCC A;  2OZ6 A;  1Z1D A;  2DN0 A;  4L5I A;  3MCZ A;  2VC0 A;  3MVP A;  3WE2 A;  3K70 D;  2PI0 A;  3NAU A;  4M3F A;  4BH9 A;  4GFB A;  3M1E A;  2KRF A;  2VXZ A;  3MZ8 A;  1VQ4 I;  5IP9 J;  1TZL A;  3OL4 A;  2XSJ C;  3HTU A;  2FA5 A;  2PMU A;  5LHG A;  3CMY A;  2BHY A;  4UHT A;  2OTJ I;  2JT1 A;  3F8N A;  4B09 A;  2UWM A;  2NNY A;  1LJ9 A;  2ZSH B;  1W0U A;  3MFK A;  5EEG A;  2VL8 A;  1X3U A;  2EZH A;  2NNN A;  5HOO A;  2F6C A;  2PLY A;  2JRM A;  3C2G A;  1PUE E;  1S5L C;  2XRN A;  1DDN A;  1IV8 A;  3CCY A;  3HOW J;  5CVU A;  4A2U A;  2CYY A;  1Z3Y A;  4A5N A;  5IT9 K;  1BBY A;  3LWF A;  3P9I A;  1T56 A;  3T0Y A;  1N75 A;  1RC9 A;  3V4G A;  2H1K A;  2BVM A;  2P5V A;  5J40 A;  4A3E J;  1FOW A;  4AD9 A;  2R7R A;  1HST A;  4ZYD A;  4HSR A;  1I3A A;  1HDP A;  3TGN A;  3KEO A;  4G7Z F;  3N97 A;  5DCM B;  2EFW A;  5C4X J;  2EV6 A;  2M9H A;  2LKP A;  3ZN1 A;  1EF4 A;  3BR0 A;  3KX2 A;  2BOL A;  1X58 A;  3ULQ B;  5FRN A;  2BEO A;  1QVU A;  3S8P A;  1PUF A;  3CMM A;  4AYB A;  3P5J A;  2AXL A;  1VQL I;  5DEQ A;  3TDU C;  2VOD A;  1KU9 A;  4CDG A;  3NWT A;  1LEA A;  4DJA A;  1YW8 A;  2DU9 A;  4II2 A;  4UV9 A;  3GXO A;  2QBY B;  4N9H A;  3LSJ A;  3JSO A;  3ABM H;  3A01 B;  1R1U A;  3JCU C;  3S3O A;  2JA6 J;  3KP4 A;  1R22 A;  2DJI A;  2KLO A;  2VJI A;  3GTK J;  2HVR A;  4RB1 A;  3ZMZ A;  1U5T A;  3PSI A;  1TC3 C;  3SZP A;  1MMD A;  4Y7N J;  2P4W A;  2XDV A;  1ENH A;  4E7H A;  1LFU P;  3JRG A;  2A6H F;  2HNH A;  5JI6 A;  2W48 A;  3E6B A;  2BZT A;  5TGT A;  3FHZ A;  1V4R A;  1SD7 A;  3MD2 A;  1TQP A;  1FYK A;  2M1B A;  2VB6 A;  1FBS A;  2GBY A;  4S05 A;  1T38 A;  1FOK A;  2E5N A;  3BR2 A;  4IX7 A;  5M3M J;  1XMK A;  1WJD A;  4LLL A;  3GVA A;  4XKV A;  1OR7 C;  2HQN A;  2KP6 A;  3ZMV A;  2FSW A;  2R5Y B;  2DFF A;  2DK8 A;  1D1A A;  2ICW G;  3PIO F;  5CVI A;  2WAD A;  3Q3S A;  1QQI A;  3IH2 A;  2KRH A;  2EZK A;  2HYG D;  4M74 A;  3HEF A;  4AU7 A;  2FMY A;  4BXU A;  3S16 J;  2EZL A;  3F8B A;  1IRX A;  1JHF A;  2MYS A;  4XSZ F;  2YU9 J;  4AIK A;  3PFI A;  3S1N J;  4D5F A;  1OCR H;  4G6T B;  1T95 A;  3W3C A;  1SD6 A;  2NAZ A;  3SXY A;  4PGH A;  3CMA I;  1WJA A;  2EPF A;  1W7P B;  2EH3 A;  2DA4 A;  1MMN A;  1P4W A;  4HPQ A;  5HNH A;  3ZP5 A;  2RNJ A;  1KU7 A;  2AQE A;  1HKQ A;  4KMU X;  5E3M A;  3F6V A;  1VQO I;  4RAZ A;  1Y6I A;  1LFB A;  1QPM A;  3X2Q H;  2FEZ A;  3LSK A;  2QF7 A;  3RPU A;  4BGD A;  3I3L A;  4AID A;  4IOA F;  5JVT A;  1R71 A;  3LQQ A;  4RB0 A;  2VBY A;  2LC2 A;  3LA2 A;  4P9F A;  1ZKG A;  4E4H A;  3B6C A;  2BXZ A;  2FOW A;  1D1C A;  1KON A;  1MH3 A;  2BY0 A;  3EUA A;  4OMY A;  3F6O A;  1YX3 A;  4XRS A;  3GTJ J;  5GTH C;  4ZDO A;  2BE5 F;  4IVN A;  4KDP A;  3Q0U A;  3QWL A;  2ETH A;  2EWN A;  1Z6R A;  4MQV A;  2L3D A;  5IOY A;  1O7F A;  3W6K B;  1U8R A;  4BE1 A;  2K3F A;  3PUB A;  3RYR A;  3AKZ A;  2BXY A;  2XC7 A;  3K4B A;  4MTD A;  2R0Q C;  2P6S A;  4EGY A;  3L1P A;  3PSF A;  4HNU A;  1H9G A;  1S7A A;  1GXP A;  3S2D J;  2CW7 A;  2CW0 F;  1WWX A;  4BHP A;  2GIV A;  1O57 A;  2I10 A;  1UST A;  2IGO A;  3EUH A;  3I64 A;  4IPA A;  3BJ6 A;  3DU6 A;  4P55 A;  3S32 A;  5EZG A;  1MDM A;  5JVG F;  4N9I A;  5ICG A;  2B63 J;  3EQL F;  5F08 A;  5K5O A;  4HNV A;  5CYV A;  5LFA A;  4FQG A;  3SEQ A;  1I1G A;  2ZXW H;  1ON1 A;  2J5P A;  1MMS A;  1MIJ A;  1MND A;  3AG3 H;  1S3J A;  5DCF A;  5BPI A;  4EGZ A;  3PQJ A;  4LFU A;  3M8J A;  3RI4 A;  1VQP I;  1T0F C;  5GP9 A;  2O9L A;  2V6E A;  1TW2 A;  2NOG A;  4O3M A;  1MJ9 A;  2VOP A;  1H88 C;  2QQ9 A;  4C2U A;  1P2F A;  1RR8 C;  4M3G A;  4DBQ A;  1KGS A;  2CJJ A;  2RV8 A;  1F5T A;  3D0S A;  2O8X A;  1B9N A;  2V9K A;  2EBI A;  2EFN A;  3DWL E;  4HX8 A;  1FY7 A;  3WGI A;  1WHU A;  2VON A;  2WAF A;  3K1N A;  4PZJ A;  3ERM A;  2DQL A;  4FT8 A;  4LK0 F;  2MGQ A;  1TBX A;  2X51 A;  2DO7 A;  1YX5 A;  2FBI A;  5KVR A;  3AFH A;  2XAJ A;  4CO8 A;  3F9K A;  2CQX A;  5E8G A;  4MGR A;  4CGZ A;  4EAT A;  5M5Y J;  4LLN A;  3T1B A;  3CJQ B;  1LKX A;  1YHQ I;  5E17 F;  5E1X A;  1BJA A;  3FMS A;  1ZRC A;  3ZMU A;  3WHC A;  2Q2E A;  1QHH D;  2FJ1 A;  2R7Z J;  1X19 A;  1AA7 A;  4HX7 A;  1ZGJ A;  4DGW B;  3M07 A;  1UHW A;  3QPH A;  3HIF A;  2F5D A;  5E3O A;  2HXI A;  2L4M A;  3I0T A;  3R0A A;  1U2W A;  1H0M A;  2O5R A;  2O61 A;  2LNB A;  1D8J A;  5LD2 C;  5ILS A;  4LG0 A;  3KP5 A;  1PP8 F;  2FUG 2;  4ZJZ A;  3H5N A;  5FRM A;  3O8H A;  1FIP A;  1YIT I;  2QKL B;  1WI3 A;  2VAS A;  1R49 A;  2IRF G;  1R1T A;  4MEX F;  3GTQ J;  4IHT A;  1OQY A;  2E2I J;  1UB9 A;  4GYG A;  5K5R A;  1J7K A;  1IDZ A;  2P7V B;  1HLV A;  1Z05 A;  2P5K A;  5F64 A;  4NNJ A;  2FOK A;  4LIT A;  3M3Y J;  2Z9O A;  2Z16 A;  4XIC A;  4LGW A;  2LF7 A;  1JTX A;  3CDI A;  3CC2 I;  4BS9 A;  1QGP A;  1ZK8 A;  3BTI A;  4HST A;  1YYV A;  3BR6 A;  3ZMS A;  4KIG A;  3ROU A;  1RR7 A;  5CVJ A;  5F0C A;  3PNV A;  5F1R A;  2OPT A;  1WCM J;  4RAG A;  3CQZ J;  2KDO A;  3E97 A;  5J4Y A;  5HOD A;  1CGP A;  3JAM K;  2P8T A;  3HG9 A;  2CS3 A;  1ZRE A;  1Y0U A;  3I59 B;  3JRD A;  5HDN A;  1FIA A;  2L01 A;  4EMS A;  3CDH A;  1MZB A;  5CVV A;  1ZGW A;  1MNM C;  3DEU A;  3BRO A;  1V5E A;  1K6O A;  1HOM A;  4D7N A;  5LGU A;  2VKH A;  3H9Q A;  3OYC A;  1R6R A;  2A05 A;  2EA4 A;  4BU2 A;  1WZ2 A;  3GZ5 A;  2F5E A;  2UUZ A;  1B4A A;  4AVP A;  1J09 A;  1B59 A;  2R92 J;  2LBF A;  3CUQ C;  2MD0 A;  2BY2 A;  2JQ7 A;  4QWQ A;  1A6I A;  4D9J A;  4I01 A;  3E6M A;  3C1D A;  4I98 B;  3N4M A;  1E3H A;  4HF0 A;  4M3D A;  3ECO A;  3LSR A;  1AWC A;  1SAU A;  1PYV A;  3S1M J;  4Z6Y A;  3SHF A;  1LFP A;  2ELK A;  2JZY A;  2PMZ A;  5FLV A;  2K7L A;  3QQA A;  4LG3 A;  3M8F A;  1ZLJ A;  2M45 A;  1D8K A;  3AAF A;  2ID3 A;  1SVL A;  1J75 A;  2STT A;  4ESJ A;  4UV8 A;  2W4S A;  2DFI A;  2VN2 A;  5HS9 A;  4U0W A;  5CKT A;  1X4O A;  2L7F P;  4PJL A;  3OYA A;  2P5L C;  4Y4R A;  2DMU A;  1W1W E;  3FKI J;  1TW3 A;  3H9J A;  2OV7 A;  3VOD A;  5LGN A;  3SYT A;  2PJR B;  2H8R A;  2ECB A;  3GEZ A;  5HDK A;  3J81 K;  4P5O A;  4GO1 A;  1IAW A;  5M3F J;  2QEN A;  4MO7 A;  1QVT A;  2DBB A;  4CYC A;  2K9M A;  3G71 I;  2I8D A;  1LNW A;  2XB5 A;  3LA3 A;  1ZHF A;  4RB3 C;  3PJR A;  3E0J B;  4ZYG A;  1ON2 A;  2W1O A;  1ZAR A;  2E71 A;  4M73 A;  5ILU A;  1IN7 A;  1BR4 A;  3IH3 A;  1WRJ A;  4FTH A;  4HLX A;  3ZOB A;  1S8N A;  2OTL I;  2Y48 A;  2NVX J;  1Y56 A;  1AKH A;  4BHB A;  2EV5 A;  1XMA A;  3UR3 C;  1XDU A;  3HRU A;  5FFZ A;  4ZYE A;  1OMI A;  3NRV A;  1JI8 A;  2ZXH A;  3Q0W A;  2ADU A;  1IF1 A;  4CCN A;  3J7Y J;  3OS2 A;  1H9T A;  2YSR A;  3HPH A;  2CGP A;  3EYI A;  3R4K A;  2PN6 A;  4M3B A;  5F0H A;  4UNO A;  2L0K A;  4Y15 A;  2FML A;  3E6D A;  4ETS A;  1Y8R B;  2AO9 A;  4WK8 F;  3KLN A;  3FXR A;  2E1M B;  1G8X A;  1R7J A;  3GLL A;  4EJW A;  2XUB A;  3OYE A;  2LY2 A;  2R7O A;  2DT7 B;  2HS5 A;  4MLO A;  1FOY A;  2OCC H;  4HAM A;  4M9X A;  5EEA A;  3MKW B;  4IHX A;  4ZTJ A;  4KT5 C;  3MWM A;  1UFM A;  1P7J A;  3JSP A;  1AHD P;  1MBE A;  2JPC A;  4A3J J;  1ORK A;  3K4K A;  3S2H J;  2FE3 A;  3ECH A;  2AXT C;  4RLF A;  2DA2 A;  3U1K A;  2DMQ A;  2R7U A;  1G4D A;  1T8I A;  3DP7 A;  1VFC A;  3QOD A;  4M71 A;  2A6E F;  2DOA A;  2OF7 A;  3FDY A;  2LRD A;  4EM2 A;  2OBP A;  1YJW I;  2IJL A;  2L9V A;  2HVS A;  4TV7 A;  4CUG A;  2X1E A;  5L3F A;  3HXL A;  4DYQ A;  5LEK A;  2WB1 A;  3KP3 A;  5B5E C;  2ESH A;  1UAA A;  5DD8 A;  5D5V B;  2F4I A;  5E79 C;  1R58 A;  2O6G E;  4N4N B;  1IXS B;  4Q48 A;  3HHG A;  1WGX A;  3TED A;  4R79 A;  4LB5 A;  1R36 A;  1RKT A;  3FBI B;  1SFU A;  2DOD A;  1ZYR F;  1YLF A;  3CJT B;  4XM3 A;  4F52 A;  4E70 A;  2FF4 A;  4XON A;  5DDG A;  4A3G J;  3JRC A;  4XSX F;  5FFX A;  3GYH X;  1FOX A;  2EA2 A;  2LRE A;  1POG A;  1BC7 C;  1TWG J;  4DZP A;  1RKW A;  1UEL B;  1FYL A;  3QYF A;  3JRH A;  2FBK A;  2Y9Z A;  3GCM A;  5L3B A;  2XAF A;  3RIR A;  2E1C A;  3ABT A;  3SZG A;  5GAD J;  3HB9 A;  5DD4 A;  1SD5 A;  5J47 A;  3ZQG A;  1IO2 A;  3CUQ A;  1IRF A;  3CCQ I;  2LYC A;  3OYM A;  2R7Q A;  3TW6 A;  4EV0 A;  3DF8 A;  4FE7 A;  2DW4 A;  3ABU A;  5DS9 A;  2R7S A;  1T33 A;  5IP7 J;  5DV5 A;  4XBF A;  4I76 A;  4RS8 A;  3IUO A;  3BR3 A;  1T2K A;  3ZCO A;  4YIF A;  2A69 F;  4OIN F;  4ZZD A;  3DEE A;  4IZZ A;  4ESF A;  4UVC A;  1IRZ A;  1HW1 A;  4KIC A;  3HOV J;  1KQ9 A;  3I53 A;  5DYM A;  4C2M J;  1HC8 A;  2MC4 A;  3D1N I;  3G1M A;  2YPR A;  4NQW A;  4QLC U;  2DA5 A;  4DYC A;  2JUC A;  4IHY A;  3W2W A;  1K78 A;  1R00 A;  2F4M B;  3OWT A;  1PVE A;  3I4P A;  3EUK L;  3IRR A;  1FEX A;  2PX9 A;  3P7N A;  4NBQ A;  3RKW A;  2EZI A;  3G73 A;  3L9F A;  2NVU B;  3HSF A;  1BR1 A;  1REP C;  3AG2 H;  1BL0 A;  1YO5 C;  1J0R A;  2PEX A;  4IO9 F;  3BWG A;  4RM3 A;  1O3Q A;  4UY8 I;  2KZV A;  3C3W A;  3TDZ C;  1F4K A;  3DXJ F;  3WG7 H;  1D5Y A;  3WG9 A;  3WU2 C;  3F23 A;  1YTY A;  4IHV A;  1VQ8 I;  2VQH A;  2E1M C;  3VB2 A;  4I99 C;  2Y0M A;  4ZYH A;  3BZC A;  1HXD A;  1LE8 A;  3BZK A;  3LNQ A;  2GXG A;  4KIT B;  2QGU A;  3IAM 2;  2QUF A;  4BAC A;  1DQU A;  2ECC A;  3KFW X;  3S17 J;  2JA5 J;  1CF7 A;  4U0V A;  2GXA A;  3SZT A;  1GHC A;  1XCB A;  1Y1W J;  3H0G J;  3LST A;  4A6D A;  1LB2 A;  2FRH A;  2X6O A;  4II3 A;  2CSO A;  1ZGA A;  5CQG A;  4PK4 A;  4CHU A;  1BIB A;  4EJT A;  1E3P A;  2K5C A;  3DQV C;  4ZDP A;  3LSI A;  1A31 A;  2VE9 A;  1OCC H;  2P0W A;  4EQQ A;  5E3L A;  4BXX J;  1BI3 A;  3QU6 A;  2DI3 A;  4A3F J;  2OAZ A;  2ZJP F;  5IP6 A;  1UMQ A;  3TBI A;  1MSF C;  4RM2 A;  4QTR A;  2OJE D;  2V9V A;  4HV6 A;  2ZBK A;  2DTR A;  1YJN I;  2IW5 A;  4OMZ A;  3JRA A;  1LQ1 A;  5F0F A;  1TQM A;  3M7G A;  1QNT A;  2GA2 A;  2QQA A;  2DMT A;  4Q5S F;  3JR9 A;  2R5Z A;  3FHN A;  3VSL A;  5EGO B;  1R23 A;  2WY8 Q;  3OYK A;  2OA4 A;  1TWH J;  1E0E A;  4R1H A;  5GAE J;  3ML6 A;  2MAB A;  4XLF A;  1X1A A;  3SEZ A;  2V7F A;  1EA3 A;  5J4V A;  3FZV A;  3E3V A;  3FXL A;  1B9M A;  2IPQ X;  5J1U A;  4K2E A;  1UG2 A;  1OCZ H;  5LHI A;  2W85 A;  4HV5 A;  3M9A A;  3HRT A;  1VQM I;  3L2W A;  2QEX I;  3AL0 B;  2MG4 A;  2TDX A;  2XRL A;  1BI1 A;  1JT6 A;  3RYP A;  3QOE A;  2QCO A;  3OR1 C;  5FD6 A;  2K3P A;  1FTZ A;  4IRI A;  2FU4 A;  2X6W A;  4GCV A;  4L5J A;  3CO6 C;  1RIO H;  3I5U A;  3H9G A;  1OCT C;  2LBF B;  2JVG A;  3G2B A;  1YS7 A;  2R7T A;  2XF5 A;  3DV8 A;  2K85 A;  4HNT A;  2EQR A;  2DOE A;  2MFZ A;  5IT3 A;  1IN6 A;  4Y52 J;  1IXC A;  2D2W A;  1SVO A;  2IA1 A;  2L9R A;  4B3X A;  3ERE D;  2E7W A;  3J7Z I;  5EYR A;  1LPQ A;  1QA6 A;  3HHH A;  1L0O C;  4A69 C;  4A5M A;  2LOO A;  2HDD A;  1VQ7 I;  2HZT A;  4BHC A;  1DU0 A;  4I6Z A;  1YW9 A;  4DIQ A;  5ICF A;  4LMY A;  2E36 A;  2ZXJ A;  1W5T A;  3BOQ A;  5CLS A;  4YII A;  2ISY A;  3U9G A;  1FBQ A;  2E7X A;  2GA1 A;  4B43 A;  1K83 J;  4GDF A;  2ZME B;  1BM9 A;  4XID A;  3BQZ A;  2V1D A;  3G1L A;  4ZYA A;  4M9S A;  3NAR A;  3JRB A;  4BY1 J;  4M6X A;  4A3M J;  2GWR A;  1FX7 A;  1FSH A;  3LAP A;  2KDZ A;  4U0Y A;  4JBA A;  2VQC A;  3OS1 A;  2HWV A;  5ICE A;  2O0Y A;  3OMY A;  4UUS B;  1B8I A;  1R5G A;  1JKR C;  4E7J A;  1MBF A;  2XSD C;  2BBY A;  2L4A A;  1MBH A;  3MMY B;  1UHM A;  4BE0 A;  3KZI C;  1PP7 U;  1HKS A;  3TP3 A;  1JKO C;  5HLH A;  1VQ9 I;  3WTV C;  4FHT A;  3FF5 A;  3JRI A;  4CSW A;  2VJ4 A;  3PM1 A;  3L7W A;  3QP5 A;  4XN0 A;  2QA4 I;  3MEX A;  1ZG1 A;  1W36 C;  3GFI A;  4B3A A;  2E35 A;  3HKZ N;  2W57 A;  3BG5 A;  3K0L A;  4LJZ F;  3RCO A;  1ULY A;  3DKX A;  2DLL A;  4WX9 A;  1LVK A;  2ESN A;  2D5V A;  3RPU D;  2EJR A;  2IS6 A;  1ZTR A;  1ETY A;  1WPK A;  2XKP A;  4XK4 A;  1JJ6 C;  1I39 A;  1B72 A;  1LEB A;  2LR8 A;  3WU1 B;  4KT6 A;  3H35 A;  2DTZ A;  2JN6 A;  5FLX Z;  4KA4 A;  2Y0S N;  2ZJR F;  5BMZ A;  1D3Y A;  3QAH A;  2G9W A;  2NS8 A;  3ISP A;  4JP0 A;  5A2Q Z;  4KIS A;  4HOB A;  1D0X A;  4G7H F;  4HZF A;  4CH7 A;  2Q8K A;  4LIV A;  4NC6 A;  1K4S A;  1ZAO A;  2XPU A;  4AVZ A;  2K86 A;  3F3X A;  2XAS A;  3BG3 A;  3WGG A;  2KL4 A;  4XLA A;  3RKY A;  3HOU J;  2IA0 A;  4HG2 A;  3PO2 J;  1WJE A;  1EH8 A;  3CDL A;  3Q5F A;  3MKL A;  2BY1 A;  5B1B H;  2BHZ A;  1KQ8 A;  3IAS 2;  1OIS A;  2EB7 A;  2B0L A;  2TCT A;  3AL0 C;  1VND A;  4PJJ A;  4RLQ A;  3BT9 A;  2VUM J;  1GVJ A;  1XSD A;  2IVM A;  4AWX B;  2YX7 A;  3CO7 C;  3RZO J;  4YEJ A;  2XHK A;  1JJ8 C;  4L5E A;  2HZD A;  4PSX A;  5E8I A;  2F2E A;  5D5X B;  3CCJ I;  2W00 A;  4XL9 A;  1G3T A;  3I56 I;  2W84 A;  4BEH B;  1S7E A;  2CMP A;  5AON A;  1DU6 A;  2PG4 A;  5K7H A;  1Z7U A;  2QSH X;  4CCK A;  2YUS A;  2WAQ A;  5HLG A;  3K4M A;  2XV4 S;  3S3M A;  3ZMD A;  2GOM A;  3HUG A;  2KIU A;  4BXF A;  3REO A;  2LLK A;  3CTA A;  2VXD A;  2K9N A;  5IOZ A;  4ANJ A;  3JRE A;  1I5Z A;  4OWR B;  2ZKZ A;  3K4J A;  4EVI A;  1ITY A;  3LFU A;  3I4N J;  2Y9Y A;  3V7C A;  3LAJ A;  1KYZ A;  3BCB A;  3KIO A;  5EG0 A;  2WAE A;  2D45 A;  2X9D A;  1GXQ A;  3WU0 A;  2STW A;  2ZME C;  2ISZ A;  5TJJ A;  1AU7 A;  3MZY A;  3FK7 A;  3IWF A;  5FD5 A;  1YS6 A;  3GUD A;  3Q9S A;  1KYW A;  4HRI A;  2QSF X;  3K6G A;  2ELJ A;  2N8G A;  4BJ6 C;  4HF1 A;  2K02 A;  2NYX A;  4B1R A;  1H89 C;  3W2V A;  3BQY A;  3QRF F;  1FTT A;  3V7S A;  1APL C;  2O03 A;  3IC7 A;  4MEY F;  3HGG A;  3J7A Y;  2EIK H;  4DW6 A;  4RDU A;  4XRF A;  3GLX A;  1K4T A;  1I3Q J;  3RSN A;  2VOO A;  1MH4 A;  3BZ6 A;  5C4J J;  2HQ5 A;  3VYU B;  3P9C A;  5H6R A;  2BW3 A;  3OYN A;  3O6B B;  4EJO A;  3JTG A;  1QO0 D;  4YIR X;  3ZN0 A;  1YRN A;  4G6D A;  4PSW A;  3RDI A;  3GF2 A;  4RGS A;  4WXD A;  1JGG A;  1EKE A;  4PJN A;  1MSE C;  1OR7 A;  3VPR A;  4D5C A;  1VQN I;  2Z3Y A;  5EEH A;  4I02 A;  1XC5 A;  2UXN A;  2DA1 A;  3V42 A;  5IYD J;  1D5V A;  1R4M B;  1USS A;  3OYH A;  3FXJ A;  1FNN A;  1N25 A;  2F48 A;  4FE4 A;  3SFI A;  3GBG A;  2X6Y A;  2RQP A;  1FZP B;  3KYD B;  4XLC A;  4AIJ A;  4XLH A;  2KMU A;  3AG4 H;  4UUV A;  5ICC A;  4XKC A;  5E18 F;  3RQI A;  3G6E I;  3T5X A;  2OQR A;  1TWA J;  1S9H A;  2O8K A;  2PMH A;  5FKK A;  2QSG X;  2MSY A;  3ZQI A;  3DKW A;  2NVT J;  4PJ0 C;  4KN7 X;  3WHB A;  2VI6 A;  3I71 A;  2L5Q A;  3KP7 A;  3DBL B;  5FJ8 J;  2NVQ J;  1YIO A;  4BDY A;  1RRJ A;  3TW7 A;  1M1E B;  1H8A C;  3MAJ A;  4NB5 A;  3HRS A;  4XQF A;  3V7R A;  4HQE A;  4ENK A;  3CD6 I;  3WTX C;  3CC7 I;  2KHM A;  3LFK A;  4GYI A;  1P4X A;  1KU3 A;  3DTI A;  1I50 J;  1R5I D;  3M4O J;  4PUS A;  2HPM A;  5B66 C;  3KP2 A;  2EV0 A;  3F72 A;  3PNY A;  2HOT A;  2HKX A;  3KEQ A;  1BJZ A;  4BQN A;  4HEA 2;  3GO5 A;  1UG0 A;  3RTR A;  2D1V A;  5L3D A;  2CWE A;  5GTI C;  3H0D A;  4WXC A;  3GTG J;  3ZQQ A;  2BV6 A;  1J59 A;  2HI3 A;  4BJ5 C;  5J1R A;  2GLO A;  1Z0X A;  3T8T A;  1A36 A;  2HYJ A;  1TLH B;  3ZXS A;  1IZ1 A;  1A5J A;  2ELH A;  2EIL H;  2YS9 A;  5DUK A;  2BGC A;  1WSU A;  2WWY A;  1UZC A;  1G2H A;  3L2C A;  5B1A H;  3H1C A;  4C3J J;  2ME0 A;  1XGS A;  4AYB N;  5DCM A;  1GUU A;  4XRS G;  4I2O A;  2HDW A;  4AIH A;  4IF4 A;  4F55 A;  3TKY A;  1HCR A;  2DT6 A;  1EJ9 A;  4JX5 A;  3CUO A;  3TOB A;  4QIW N;  3K4N A;  2DDA A;  1IJW C;  1MBG A;  2MH2 A;  2E1O A;  3A03 A;  5IYC J;  2VJJ A;  3QPT A;  1PDN C;  2P7C B;  5CPR B;  2KIM A;  4ON0 A;  5D4S A;  1PUF B;  3OOP A;  3VOE A;  2QBY A;  1DGW Y;  1VZ0 A;  2HKO A;  2Z5U A;  3FIS A;  5EF6 A;  5DUI A;  3E6C C;  1XPX A;  4F3Q A;  3A01 A;  3RZD J;  4HF2 A;  4MNU A;  1W4M A;  1T0F A;  2M8G X;  4XKB A;  1OLT A;  2BYV E;  3CP8 A;  3NEU A;  4IHS A;  5FGM A;  4A3D J;  1FT9 A;  3OSG A;  1FMV A;  5KNL A;  3OIO A;  5L3C A;  1T98 A;  4IKF A;  4W1U A;  3U1D A;  4KNY A;  2IBD A;  3LSM A;  3C7J A;  1XDS A;  4R8H A;  4F91 B;  4A3I J;  1U5T B;  2RNG A;  3DPT A;  2MC3 A;  1R1V A;  2A68 F;  4YRV A;  4QPO A;  3R0J A;  4QPQ A;  4DNC A;  1KQ0 A;  2M7B A;  4L9N A;  4HBL A;  2FQ3 A;  4N4O B;  5KCM A;  1GT0 C;  2VKD A;  3BJO A;  2XPW A;  3HDD A;  2UV1 A;  3HOZ J;  3ONQ A;  3OYB A;  3FXM A;  1QPI A;  1OKR A;  2VJ5 A;  4XOP A;  1XGM A;  2HEO A;  2R5Y A;  1XX5 A;  2DA7 A;  2QKM B;  3EDP A;  1LDJ A;  3BCA A;  3KE2 A;  1DP7 P;  4RAY A;  1O3T A;  1JE8 A;  5LEJ A;  4HW0 A;  1RET A;  1RUO A;  3H3V K;  3W2A A;  1OYY A;  1YW7 A;  3A4C A;  2JVH A;  1Q1H A;  2WY7 Q;  6PAX A;  1S29 A;  3LQR A;  2CUF A;  5JR3 A;  2VIX A;  1OYW A;  2LMD A;  4WWC A;  1BA5 A;  1FP2 A;  2DPD A;  2IS4 A;  1OYI A;  1MBK A;  1MJA A;  1J2X A;  2HQR A;  2QLZ A;  1IRG A;  3U2R A;  5D5U B;  4A3L J;  1SFK A;  1T08 B;  2LD5 A;  3GTM J;  4WCG A;  2DK5 A;  4IQ4 A;  3GWZ A;  1W7P A;  4IL6 C;  4XRM A;  2FNA A;  2XF7 A;  4KIF A;  3QYE A;  2XAQ A;  1RI7 A;  3TOA A;  4GXO A;  1U78 A;  5E20 A;  4LK1 F;  2DYS H;  4FX4 A;  1MMG A;  3RKQ A;  1XCV A;  5F04 A;  1L3L A;  1N77 A;  2X85 A;  3VDX A;  3DBH B;  2V26 A;  2Y2Z A;  3FM5 A;  5FRO A;  1JXS A;  5GPC A;  3HOT A;  1IN8 A;  2IAI A;  2A5W A;  3ASN H;  4C9Y A;  4BE2 A;  1FPQ A;  3K70 C;  3K2Z A;  2K4J A;  5LLQ A;  3BP8 A;  1QZY A;  3K1M A;  3L2Q A;  4ENN A;  4IHW A;  1ZEL A;  4JX4 A;  1U8B A;  2NS7 A;  4F7Z A;  4C3I J;  1HF0 A;  3S1R J;  5HDG A;  2OQG A;  1LDK B;  5E1Z B;  1CQT A;  5HS7 A;  2HU9 A;  2DMP A;  1OCO H;  2M4G A;  2Z2S B;  3F8C A;  4G94 A;  1QBJ A;  4OIQ F;  4A3C J;  5KAI C;  4ZC3 A;  1XSX A;  3I9V 2;  3FM3 A;  3VSK A;  1UJ8 A;  3S1Q J;  4B47 A;  2L7K A;  1BN5 A;  4FCY A;  1WI9 A;  1A04 A;  1E17 A;  3UNG C;  1MD0 A;  3TMO A;  1MDM B;  5B3S H;  1MGT A;  3ZGK A;  4J01 A;  5J8C A;  5TIS C;  4DBR A;  4XLP F;  3RQ4 A;  4B4C A;  2HDC A;  2LDU A;  2RGV A;  4G6Q A;  5LHH A;  5E3N A;  4F92 B;  2DT5 A;  3WE3 A;  2XGE A;  1DPR A;  3L09 A;  3M8E A;  1JUS A;  3CCL I;  4CZZ A;  3OYD A;  2HQA A;  2E1N A;  2V1X A;  4NHJ A;  5BQT A;  4CCJ A;  3OYL A;  4RGR A;  2R7W A;  2NOJ B;  3CES A;  5D6E A;  1O4X A;  3A2K A;  3HJE A;  3J80 Z;  1U5T C;  2W25 A;  5D8L B;  3PO3 J;  1XSV A;  4A0Y A;  4B44 A;  2LY9 A;  3GX4 X;  2ZFW A;  3FWE A;  3RJP A;  2XVC A;  4RAF A;  1Z67 A;  2Y69 H;  2CO5 A;  3PL8 A;  1G3Y A;  2CQ7 A;  4UB8 C;  1I27 A;  5LRR A;  4EEF G;  1X2N A;  2K9S A;  1MJB A;  2KIF A;  1IN4 A;  2G0E A;  2OZU A;  2H94 A;  3VWB A;  1ETQ A;  2MBF A;  2HTJ A;  5H20 A;  5H2F C;  3QU3 A;  2BY3 A;  1D1B A;  2L9N A;  2CUE A;  5EDN A;  2JJ7 A;  4NC8 A;  2H6B A;  1ZRF A;  1IN5 A;  5D4R A;  4P96 A;  4EJU A;  4XNF A;  3BG6 A;  2PJP A;  4IRG A;  5J3L A;  2MH9 A;  4ENJ A;  4X1E A;  1U9N A;  1TNS A;  3OIP A;  3SJM A;  2CV2 A;  2V1N A;  1VF9 A;  2H1L A;  2Q2E B;  1SMT A;  2CQN A;  2JMW A;  1YIJ I;  3B6A A;  4CCL A;  5K7F A;  4ITV A;  1EV7 A;  2WBM A;  3ZRG A;  1P92 A;  1TWF J;  2DYR H;  1B1B A;  1MW7 A;  2VC1 A;  2XAH A;  3DEW A;  3H36 A;  5FKN A;  1BI2 A;  3KP6 A;  2R7V A;  1XTA A;  2ZB9 A;  1U3E M;  2E2J J;  3J7A O;  5CJ9 A;  3GW2 A;  1IW7 F;  3DBR B;  4AUX A;  3BR5 A;  3BDD A;  3I54 A;  4RB2 C;  1ETV A;  2LF8 A;  2RN7 A;  1HBX G;  4LG0 B;  3BC8 A;  1P9Q C;  1OCP A;  2CQQ A;  2OU2 A;  2QWW A;  2M7A A;  2R3S A;  3LMM A;  4M6Y A;  4I0A A;  1T6S A;  2K4B A;  3Q9V A;  2COM A;  2KRC A;  2LY1 A;  3EET A;  2JK3 A;  4KUM A;  3B73 A;  3V8J A;  2KT0 A;  3CP2 A;  4EM0 B;  5BOX A;  4L9J A;  2AS5 F;  2LK2 A;  4ASN A;  4I7H A;  3VEP A;  1ZR2 A;  4IRH A;  4PDK A;  4W97 A;  2BVL A;  2DOF A;  4KMF A;  1R4N B;  2VKE A;  2Y75 A;  3VYR B;  1V5F A;  4HDV A;  4KIB A;  4XMY A;  2VKV A;  2NRA C;  2K9L A;  3CCM I;  3DPU A;  5JHU A;  3AG1 H;  2LKS A;  2GZW A;  4E7I A;  3L2U A;  2Z99 A;  3F0C A;  1FBU A;  5GAH J;  2JPB A;  4A12 A;  3HOY J;  3I59 A;  4ZDL A;  4QSH A;  1RZ4 A;  2Q1Z B;  4E7Z A;  3HYI A;  3BLY A;  5CQE A;  1ERD A;  2EIJ H;  3TO7 A;  2F5C A;  3NQO A;  1SVM A;  3G3Z A;  4A93 J;  4V2G A;  4NDL A;  3OS0 A;  1TNT A;  4U87 A;  3OYI A;  5JFR A;  1NTC A;  4YG2 F;  5L3E A;  1YQA A;  3FXU A;  3EUH C;  2AHQ A;  1HW2 A;  4L0Z B;  4U7B A;  1TWC J;  3ZQH A;  2JWT A;  2ZNZ A;  3BPX A;  4DYR A;  1SC7 A;  1WJC A;  3ESW B;  2PMZ N;  4NUB A;  5FKL A;  3OR2 C;  1R5H A;  2HR3 A;  3MQ0 A;  1WJB A;  3I4M J;  2X4H A;  2VQG A;  3TL4 X;  3IHU A;  1JUP A;  2DQR A;  1HW5 A;  4MFE A;  2WC2 A;  3TO9 A;  2IS2 A;  3D5S C;  4MIM A;  3FXQ A;  2ME6 A;  1DPU A;  3ZQC A;  4KYW A;  4PFO A;  2MW8 A;  1KZH A;  4H0E A;  2HPI A;  1ZLK A;  4EJV A;  1Y0N A;  2E5Z A;  2NXN B;  1O7L A;  2KJB A;  2RAE A;  2F4O B;  1JGS A;  1MMA A;  2LFB A;  4D7M A;  3OSF A;  3A02 A;  1D0Y A;  2JA2 A;  3K7A J;  3QP6 A;  5C3E J;  3S93 A;  2MLG A;  4UUT A;  1RNL A;  4BBR J;  2VE8 A;  2VPR A;  3F21 A;  5IT9 Z;  2MD5 A;  2PJR A;  1OPC A;  3PUF A;  4A3K J;  3GZ6 A;  4CCM A;  1F43 A;  1D0Z A;  2VLA A;  2C6Y A;  1Z77 A;  2M87 A;  1QHG A;  2JSP A;  3CC4 I;  1IUY A;  3DKY A;  2IT0 A;  1BR2 A;  3A0H C;  5HNF A;  5C44 J;  3SDG A;  2A5Y B;  3HPG A;  5TRD A;  1YJ9 I;  3K10 A;  3GTL J;  1BI0 A;  5IY5 H;  4CYC B;  4E7L A;  3OYJ A;  4OIP F;  5F1J A;  3PQK A;  4AC0 A;  4D1Q A;  3K69 A;  1N78 A;  4YFN F;  1HSJ A;  3TQN A;  2VBZ A;  2HVQ A;  5FLX K;  1JHH A;  5EZH A;  3M1C A;  2X1D A;  2EIN H;  4FET A;  4ZH4 F;  4AM3 A;  3FMQ A;  3K4C A;  1F9N A;  5A2Q K;  3CLO A;  3E5U A;  3IV5 A;  4C30 A;  1AKH B;  1VQ5 I;  2M0C A;  1TTY A;  3WTT C;  4E7K A;  3TP0 A;  1LVA A;  2W7N A;  2V1U A;  2WA0 A;  2XIG A;  1Y8Q B;  3LSH A;  1X3Z B;  5LBQ A;  3FIW A;  4M9Z A;  3MKY B;  2M5W A;  1A35 A;  4UVB A;  5K7Z A;  3BG7 A;  3JRF A;  2JSC A;  1GDT A;  4DZJ A;  2NS0 A;  2ZFU A;  4MFD A;  3OYF A;  3VFZ A;  2R7F A;  1RPW A;  3DLA A;  3C2H A;  5H6Q A;  4N0B A;  5FB2 A;  3H3Z A;  4Y33 A;  2V4J C;  3UKG A;  2WV0 A;  2MLK A;  5FKM A;  5J1Y A;  4JYK A;  1I1S A;  4IEJ A;  1R9T J;  4JX6 A;  3A1Y A;  2PBI A;  4G7O F;  2M30 A;  3R61 A;  2IS1 A;  2KFD A;  3JTH A;  2WB1 N;  1S7O A;  2W82 A;  2GM4 A;  4DQ2 A;  1SAN A;  4FAS D;  2LVS A;  3NWS A;  2ZO4 A;  1TT5 B;  3ASO H;  4MTE A;  3CCS I;  2CW8 A;  1QZE A;  1XG1 A;  1WH7 A;  4BQQ A;  2H6C A;  4Q4Z F;  1SEU A;  3QYB A;  4IQJ A;  3R60 A;  2QVO A;  2QYO A;  2IGM A;  2LG4 A;  2V79 A;  4RMN A;  3W6J B;  3H92 A;  3KLO A;  4C3H J;  3GFM A;  3FX3 A;  1IXR C;  1OJL A;  1Q1V A;  2M8E A;  3QPL A;  4C2T A;  5FO5 A;  1NK2 P;  2UZK A;  4A3B J;  2WTE A;  2IGN A;  1ETO A;  2DMN A;  2EFQ A;  3VYS B;  2A61 A;  2XPV A;  3FXK A;  2EIM H;  2CU7 A;  2OD5 A;  3BJA A;  1FMW A;  2M0M A;  4OOI A;  3CF2 A;  1Z7L A;  4M3E A;  2XGC A;  3H5A A;  2RVC A;  2ID6 A;  1VQK I;  3HTS B;  1XMX A;  2DA6 A;  1J5Y A;  2KJC A;  4UVA A;  4LB6 B;  4CIC A;  3GFJ A;  3GZN B;  4ESB A;  2XRO A;  3U21 A;  3DTK A;  4PFP A;  4OIO F;  2E2H J;  2LP0 A;  3ZQL A;  2YX4 A;  3CCU I;  9ANT A;  5BS6 A;  4L18 B;  4G12 A;  5KAF C;  4X0G A;  2GOX B;  2HYF A;  3I58 A;  4ZZL A;  4BUP A;  5FLM J;  3CUQ B;  3K4L A;  2GIZ A;  3LL7 A;  3WTU C;  3F22 A;  3P9K A;  1WH5 A;  4B48 A;  1GV2 A;  2DCE A;  2KZG A;  3BPV A;  1XGN A;  1XN7 A;  3R6S A;  2YU3 A;  1FYM A;  1X2M A;  1JT0 A;  4A6E A;  5D8K B;  1X3W B;  3RKX A;  3LSG A;  2KKO A;  4RBO A;  1K7A A;  3OV8 A;  1Z21 A;  1NHA A;  4Y17 A;  2LTP A;  2HTS A;  5IPA A;  4XLE A;  3L00 A;  1U9O A;  2YR2 A;  3HSR A;  4Q47 A;  4NQW B;  4HLY A;  3S2W A;  3CZ6 A;  3DLL F;  2R4G A;  1K78 B;  2HOS A;  2XB0 X;  2CH0 A;  5HLI A;  3OOU A;  2GXB A;  1HA8 A;  2MA3 A;  4PJM A;  1MBJ A;  3BTC A;  4LOC A;  3ZMT A;  2J5O A;  3EYY A;  4YFX F;  1WVR A;  1YFH A;  1W36 D;  4CXF A;  2RQQ A;  3ABK H;  4CA0 A;  4FIS A;  1VI0 A;  4PGG A;  3WTW C;  4BQA A;  3H3U A;  2M3A A;  2OCE A;  2KQR A;  4G8X A;  5ED4 A;  3HRM A;  5GAG J;  3BG9 A;  2HOA A;  3QPS A;  1LE8 B;  3FMR A;  2IA2 A;  5HLT A;  3SDB A;  4LIU A;  5BPD A;  2QQB A;  1CF7 B;  2O7O A;  4MHG A;  3CCR I;  2EFP A;  3IKT A;  1P7I A;  2VBW A;  2H8W A;  2XAU A;  3V8L A;  3H5R A;  4BQO A;  5JLW A;  1G3W A;  2F5V A;  4RGX A;  2JTV A;  2JRT A;  2TRT A;  3IRQ A;  1QZZ A;  4HDU A;  3D5R C;  2V6C A;  1BOB A;  2IEK A;  1P4A A;  1XB4 A;  2DJN A;  4OAY A;  1O3S A;  1ETX A;  3OIQ A;  5HVQ C;  1ZH5 A;  1ETK A;  1YG2 A;  2VBX A;  1AOY A;  2A3S A;  1IDY A;  3FKJ A;  3IP4 B;  4RA2 A;  1MKM A;  4H4K C;  1U6G A;  3DFG A;  5M5W J;  1FWZ A;  1XS9 A;  2DXI A;  3PNT A;  3K2A A; 
#chains in the Genus database with same CATH homology
 1KON A;  3EUA A;  3L2Q A;  2Z1D A;  1ZEL A;  1YX3 A;  4ZDO A;  3FHN A;  3VSL A;  1LDK B;  2WY8 Q;  3OYK A;  1E0E A;  2HU9 A;  4XLF A;  2MAB A;  1X1A A;  3SEZ A;  2M4G A;  2V7F A;  2Z2S B;  4BE1 A;  3PUB A;  1EA3 A;  3AKZ A;  4ZC3 A;  1WJ5 A;  2X6X A;  3K4B A;  2XC7 A;  3L2V A;  3PSF A;  3CJR B;  3I9V 2;  4DOZ A;  4JOM A;  3VSK A;  4HNU A;  3MKZ A;  2CW7 A;  1DP3 A;  4B47 A;  2L7K A;  3HC7 A;  3L2W A;  3AL0 B;  2IGO A;  3S32 A;  3DU6 A;  3UNG C;  3TMO A;  3QOE A;  3OR1 C;  3ZGK A;  2K3P A;  1WFX A;  2X6W A;  4J01 A;  5LFA A;  4ZTF A;  2LH9 A;  3SEQ A;  4DBR A;  3RQ4 A;  3H9G A;  2LBF B;  2JVG A;  3G2B A;  2R7T A;  2XF5 A;  3E1S A;  4F92 B;  1MND A;  4HNT A;  4P1W A;  4XKW A;  2MFZ A;  2KPM A;  4B3X A;  3N05 A;  3M8J A;  3OYD A;  2HQA A;  1WJF A;  1T0F C;  2V6E A;  4CCJ A;  3OYL A;  2R7W A;  1X1D A;  2NOJ B;  3CES A;  2LOO A;  4C2U A;  3A2K A;  4DIQ A;  2CV0 A;  4DBQ A;  4B44 A;  3HL2 A;  4B43 A;  2RRE A;  4NC7 A;  2V9K A;  3PL8 A;  4GRI A;  3DWL E;  2WAF A;  2M4K A;  4ZYA A;  2X1C A;  3VWB A;  2X51 A;  1YX5 A;  2ZSI B;  3AFH A;  3F9K A;  1X1C A;  1D1B A;  2L9N A;  2VQC A;  4EAT A;  4NC8 A;  2R7X A;  3OS1 A;  3CJQ B;  1LKX A;  3OMY A;  4XNF A;  4E7J A;  3BG6 A;  3MMY B;  4BE0 A;  3OIP A;  2CV2 A;  2V1N A;  2Q2E B;  1QHH D;  4CSW A;  2VJ4 A;  1X19 A;  4XN0 A;  1AA7 A;  4CCL A;  4ITV A;  3ZRG A;  2WBM A;  1W36 C;  4DGW B;  4BL0 B;  1MW7 A;  5KHD A;  2JUG A;  1PJR A;  4JQF A;  3RCO A;  2R7V A;  3DKX A;  2O5R A;  2A6T A;  5LD2 C;  1LVK A;  3L2R A;  3RPU D;  2FUG 2;  3KYL A;  4ZJZ A;  3H5N A;  3PFY A;  5FRM A;  2IS6 A;  2QKL B;  2E60 A;  1P9Q C;  2VAS A;  3BC8 A;  3HKZ A;  2M7A A;  3LMM A;  4KT6 A;  4E7S A;  2KRC A;  2LY1 A;  3H35 A;  4NNJ A;  3CP2 A;  4LIT A;  2Z16 A;  3D5L A;  2BVL A;  3EPZ A;  4BS9 A;  4KIS A;  1D0X A;  3VYR B;  1V5F A;  4HST A;  4XMY A;  4CH7 A;  4LIV A;  2K9L A;  3DPU A;  4AVZ A;  4J00 A;  4E7I A;  2KL4 A;  4XLA A;  3PNV A;  2Y0S A;  3L2U A;  4HG2 A;  1WJE A;  2KDO A;  4ZDL A;  4F93 B;  3FBN B;  4E7Z A;  2Q1Z B;  3HG9 A;  3ZR8 X;  2CS3 A;  3IAS 2;  3BLY A;  5CQE A;  1ERD A;  4XOT A;  2CFO A;  5JHF A;  3OS0 A;  3AL0 C;  4U87 A;  4PJJ A;  3OYI A;  4RLQ A;  1V5E A;  1GLN A;  3S3N A;  4Y3O A;  3EUH C;  2VKH A;  4U7B A;  3H9Q A;  3OYC A;  1R6R A;  4XOR A;  4YEJ A;  1K6Y A;  1U0J A;  4BU2 A;  2HZD A;  2UUZ A;  4PSX A;  3DTE A;  1WJC A;  4BEH A;  2W00 A;  4XL9 A;  4NUB A;  3HOS A;  1J09 A;  3OR2 C;  2LBF A;  4BEH B;  1WJB A;  2VQG A;  2MD0 A;  3TL4 X;  2CMP A;  1MNE A;  4D9J A;  4YEL A;  4CCK A;  1TT0 A;  2WAQ A;  2IS2 A;  3D5S C;  3K4M A;  1G59 A;  1SAU A;  1PYV A;  3S3M A;  1LFP A;  2PMZ A;  4PFO A;  2GOM A;  4BXF A;  2HPI A;  4LG3 A;  2VXD A;  3HUG B;  4ANJ A;  2VPL A;  1X1B A;  1YE9 A;  4OWR B;  2E5Z A;  3K4J A;  4KJZ A;  3LFU A;  1MMA A;  2CUZ A;  2W4S A;  1D0Y A;  2JA2 A;  2ZXI A;  3BCB A;  1X4O A;  4PJL A;  5CKT A;  3S93 A;  2AQF A;  2WAE A;  3OYA A;  4Y4R A;  1DGR M;  3H9J A;  1NG7 A;  3OY9 A;  2PJR A;  2OV7 A;  4OAZ A;  2XF6 A;  2IXS A;  1NG6 A;  4CCM A;  3SYT A;  2PJR B;  1D0Z A;  2VLA A;  4XN3 A;  4HRI A;  4P5O A;  1QHG A;  2JSP A;  3K6G A;  2ELJ A;  2IGK A;  3DKY A;  4BJ6 C;  2CV1 A;  1BR2 A;  3DPL C;  5HNF A;  3W2V A;  3HPG A;  2K9M A;  2I8D A;  3K10 A;  3J7A Y;  1X4P A;  4E7L A;  3PJR A;  3E0J B;  1Z3X A;  3OYJ A;  3RSN A;  2W1O A;  4D1Q A;  2CUJ A;  2OUM A;  1N78 A;  3VYU B;  2BW3 A;  3OYN A;  1QU3 A;  4CZC A;  1BR4 A;  2HVQ A;  2BW3 B;  3M1C A;  2X1D A;  4FET A;  4PSW A;  1Y56 A;  3K4C A;  4PJN A;  2VQL A;  4C30 A;  3UR3 C;  4E7K A;  4E6K G;  2W7N A;  1JI8 A;  2ZXH A;  2WA0 A;  3V42 A;  4CCN A;  3OS2 A;  3LSH A;  3HPH A;  4BJT A;  3OYH A;  3MKY B;  4CCO A;  3BG7 A;  3GBG A;  2OC6 A;  2X6Y A;  2E1M B;  1G8X A;  2L9S A;  4XLC A;  2ZFU A;  3OYF A;  4BDZ A;  3OYE A;  3DLA A;  2LY2 A;  2R7O A;  2DT7 B;  3C2H A;  2KMU A;  4XLH A;  3OYG A;  1V5G A;  4XKC A;  4MLO A;  3VYT B;  3DU5 A;  3MKW B;  4Y33 A;  4ZTJ A;  2V4J C;  1S9H A;  3KEY A;  2L2O A;  4XR6 A;  3A1Y A;  2L5Q A;  3OL3 A;  3K4K A;  4BDY A;  2IS1 A;  4RLF A;  2W82 A;  4FAS D;  4XQF A;  3K70 D;  2R7U A;  3NWS A;  3QOD A;  2KHM A;  2CW8 A;  2DOA A;  2VXZ A;  3DTI A;  3FDY A;  2LRD A;  1TZL A;  3OL4 A;  2XSJ C;  4BQQ A;  4PUS A;  2HPM A;  2HVS A;  3PNY A;  4CUG A;  3QYB A;  4BQN A;  4IQJ A;  2X1E A;  4HEA 2;  3HXL A;  1UG0 A;  2IGM A;  2LG4 A;  4RMN A;  2WB1 A;  3RTR A;  2UWM A;  1UAA A;  2ZSH B;  3H0D A;  3ZQQ A;  4C2T A;  2VL8 A;  2F4I A;  4BJ5 C;  2F6C A;  2IGN A;  5HOO A;  3C2G A;  3VYS B;  4N4N B;  1FMW A;  2M0M A;  3ZXS A;  4R79 A;  3CF2 A;  1Z3Y A;  1Z7L A;  3FBI B;  3H5A A;  4XM3 A;  4F52 A;  1N75 A;  4XON A;  2BVM A;  2LRE A;  2R7R A;  4HSR A;  3U21 A;  1UEL B;  3DTK A;  3QYF A;  4PFP A;  2HDW A;  4F55 A;  2DT6 A;  3SZG A;  4X0G A;  2GOX B;  3K4N A;  3KX2 A;  2BOL A;  4BUP A;  5FRN A;  3S8P A;  2LYC A;  2VJJ A;  2R7Q A;  3CMM A;  3OYM A;  3K4L A;  3LL7 A;  5CPR B;  4AYB A;  4B48 A;  2R7S A;  3NWT A;  4DJA A;  2DCE A;  1DGW Y;  1VZ0 A;  4II2 A;  4F3Q A;  3IUO A;  3ZCO A;  4XKB A;  1OLT A;  3S3O A;  3CP8 A;  4IZZ A;  3DEE A;  2DJI A;  2KLO A;  3LSG A;  2VJI A;  1FMV A;  2HVR A;  1Z21 A;  5KNL A;  4IKF A;  3PSI A;  3LSM A;  1MMD A;  2MC4 A;  4F91 B;  2XDV A;  4XLE A;  4E7H A;  2RNG A;  3DPT A;  4NQW B;  4YRV A;  3CZ6 A;  3W2W A;  2HNH A;  4QPO A;  5TGT A;  2R4G A;  3OWT A;  4QPQ A;  2M7B A;  3MD2 A;  2VB6 A;  3EUK L;  4N4O B;  5KCM A;  2VKD A;  2UV1 A;  3ONQ A;  3OYB A;  2CH0 A;  2E5N A;  4IX7 A;  2VJ5 A;  1BR1 A;  1WJD A;  3OOU A;  4XOP A;  1HA8 A;  4XKV A;  1OR7 C;  2QKM B;  2KP6 A;  4PJM A;  3BCA A;  4RM3 A;  2KZV A;  1D1A A;  1W36 D;  3W2A A;  3A4C A;  2JVH A;  2WY7 Q;  2RQQ A;  4CA0 A;  2VQH A;  2E1M C;  2WAD A;  2KRH A;  2M3A A;  2KQR A;  2VIX A;  4KIT B;  3IAM 2;  4AU7 A;  4BAC A;  1DQU A;  2IS4 A;  5HLT A;  3SDB A;  4LIU A;  1IRX A;  2MYS A;  4II3 A;  4G6T B;  5CQG A;  1SFK A;  4PK4 A;  1T95 A;  3W3C A;  2XAU A;  2K5C A;  4IQ4 A;  3DQV C;  3H5R A;  3LSI A;  4ZDP A;  4BQO A;  1WJA A;  2P0W A;  2XF7 A;  2F5V A;  3QYE A;  5HNH A;  1MMN A;  4HPQ A;  3TBI A;  3D5R C;  1BOB A;  2AQE A;  4RM2 A;  1MMG A;  4OAY A;  1Y6I A;  1N77 A;  2X85 A;  3LSK A;  3VDX A;  3OIQ A;  5HVQ C;  4BGD A;  2V26 A;  3I3L A;  5FRO A;  3HOT A;  3FKJ A;  3IP4 B;  2LC2 A;  2A5W A;  4H4K C;  4C9Y A;  4E4H A;  4BE2 A;  2DXI A;  3K70 C;  3PNT A;  1D1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...