3K6GA

Crystal structure of rap1 and trf2 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
VSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Telomeric repeat-binding factor 2-interacting protein 1
total genus 31
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3k6gA00
4BJTA 3K6GA 4BJ6C 3CZ6A 3OWTA 4BJ5C
chains in the Genus database with same CATH superfamily
4WX9A 1BR2A 3NAUA 4XOPA 3L2UA 4EV0A 2IRFG 3Q5FA 4XLCA 3HRTA 4HBLA 2RNJA 3NRVA 3VSKA 3F6OA 3VYSB 5IT3A 5TISC 2EIJH 4GXOA 3ZQ7A 1ZN2A 3CCJI 4U0WA 4ZDOA 3AG3H 4JP0A 4A12A 1FBSA 3OYAA 3V7CA 4MQ9F 1GV5A 4LLGF 4IOAF 1MMDA 1ETYA 4L9VA 1W7PA 2H1LA 1B6AA 3GTQJ 2ECBA 1BBYA 3E5QA 2DYRH 2A6HF 2D2WA 2WB1A 3SQNA 5HNFA 3FZVA 4MFDA 1R23A 4L0ZB 1VQ5I 4P96A 4CCOA 5L3EA 2JSPA 3BZCA 2GA1A 2K27A 4A3FJ 2WA0A 1X3WB 3I56I 3DBLB 3KLOA 1IRGA 2DO7A 2GXGA 2K9MA 2RC4A 1U9NA 4ZTJA 3RQIA 2VQHA 1U2WA 1Y56A 2XHKA 4MHGA 1PYVA 5CYVA 4CA0A 2Z5UA 3LAPA 4CCLA 4EQQA 3I4NJ 1BOBA 2P7CB 2O6GE 5C4XJ 3GLLA 3I59A 1LQ1A 3DU6A 5HLHA 4MFEA 4LJZF 4UY8I 2JA6J 1FOXA 1WJEA 4NQWA 1S5LC 3G3ZA 2XSJC 4LK0F 5C44J 5IP9J 1M1EB 2YS9A 1QRYA 3H1CA 4BAYA 3CESA 3S16J 3K10A 1GVJA 2QQ8A 4B47A 3G1LA 1HW1A 1P7IA 2F4OB 2KL4A 2XSDC 2EJRA 1RKWA 4YFNF 1FT9A 1OQYA 4PJMA 3SZTA 3IV5A 3M1CA 2CQNA 4IPAA 1LKXA 4G7OF 1YQAA 4HW0A 1R49A 5BPIA 4KMFA 3MFKA 3BR5A 4PFPA 2ELKA 3A03A 1X1PA 3CTAA 3BTIA 1ETKA 4Z6YA 2J5OA 2DOFA 2ZFWA 2DMTA 2HS5A 4A3BJ 2X9DA 3ONQA 2O7OA 5E20A 3RKYA 1WQ2A 2ZXWH 1YLFA 4EEFG 1MBEA 3HKZN 2HNHA 3MZHA 5EZHA 2MH2A 4M3EA 5FRMA 1ZYRF 4KA4A 2CFOA 2EINH 4LITA 2MBFA 5L3GA 3BZ6A 1MMNA 1WJBA 4XM3A 1U5TC 5CVUA 2HPIA 4MQVA 3RDIA 3RYPA 2WAEA 3JAMK 2IA2A 2XB5A 3I5UA 3TQNA 1TNTA 3HHGA 3CCYA 4UUVA 1BJAA 2VKEA 5D8LB 3BWGA 4KN4X 3LWFA 2E60A 3BG6A 3OOUA 2DT6A 1W4MA 1NG6A 3I64A 2V1DA 1V54H 4MO7A 1JUSA 5B5EC 1TW3A 1MKMA 1F9NA 1LDJA 2FOWA 2Z16A 3S8PA 3AAFA 2JSCA 4Q48A 5LEJA 2LKPA 4FCYA 1XSVA 3MD2A 4C3IJ 2AXLA 1UCRA 4DYRA 1P2FA 3FKJA 1MMGA 2BY2A 2R7QA 2K9SA 4KDPA 3H36A 4IXAA 1SFXA 2IBDA 2HU9A 4I99C 5HOOA 4DYQA 1TQIA 3PNVA 5TRDA 3GTJJ 2TDXA 3OR2C 2OCCH 1V4RA 4RDUA 1SAXA 4GDFA 1TWGJ 2WWYA 3CC7I 1MDMB 2ISZA 2AQFA 4CDGA 4RA2A 2W57A 2E2HJ 2H8WA 4MTEA 4RB1A 4G6DA 2X1EA 1HOMA 4BE0A 1Z05A 3FK6A 3TOBA 3FBNB 3LAJA 3CUQC 2IXSA 3HTUA 3GWZA 2L5QA 3OSFA 1J2XA 2W1OA 3PQKA 3CJTB 1I1SA 1VZ0A 3J80K 2ID6A 3COAC 3JSPA 2FOKA 1A36A 4RGUA 4EMSA 4L5EA 2TRTA 4F7ZA 2XAHA 2L4AA 2H94A 2P6SA 1MNEA 3VYTB 3LSJA 4M74A 1D0ZA 5J40A 1ON2A 1XCBA 4M9SA 5JFRA 3ELKA 2ZMEB 3H35A 4UV8A 4A2UA 4A5NA 5B1BH 4A3LJ 3BR3A 2B7EA 3FXUA 3IP4B 4E7SA 3CCSI 4C3JJ 3LQRA 4CCNA 3ISPA 4M3GA 4CCMA 4L0YB 3WHCA 1I27A 4PFOA 2I8DA 2HZTA 2K40A 3CF5F 4KMUX 2V6EA 1W5CC 1E17A 3W6VA 1R9TJ 3GTLJ 4D5CA 3IWFA 1HSJA 3GEZA 4BJTA 2BXYA 1W36D 3FHZA 1LFPA 2Y69H 3ECOA 3S1MJ 1G4DA 1FSEA 2CV1A 1K6OA 5ILVA 1LFUP 2X1CA 1B1BA 2BV6A 2HFHA 3K4BA 3BC8A 3OL3A 3M8JA 2NNNA 2HYGD 2QQ9A 3ZQCA 3F8MA 4CICA 3S1NJ 1RZ4A 4O5VA 1QGPA 4B4CA 2LDUA 4AU7A 1JKPC 1BL0A 3EYYA 4XK4A 3MZ8A 4LIUA 3VWBA 2UZKA 4EATA 4ENKA 1RIOH 2VQLA 5IT9Z 5F1JA 3MAJA 2PQ8A 1TL8A 2NVYJ 1K4SA 2DODA 2WY7Q 4HSTA 4N4OB 2M30A 4FTHA 2BGCA 2WV0A 3K4NA 3OYEA 2PJRB 2XKOA 2BVLA 3DWLE 3HIFA 2X0LA 3OSGA 3JRCA 2E19A 1XMAA 3HSEA 4BH9A 1S72I 3RJPA 1IAWA 4KYWA 4D9JA 1XN7A 4W97A 1VQ8I 3BQYA 2H09A 1IGNA 1EA3A 3H0GJ 3P9CA 2DYSH 4ON0A 1XCVA 4JX6A 2Y31A 2CG4A 5KVRA 5TGTA 4UNOA 3IH4A 2G9WA 3CJQB 3DBRB 1SFEA 1KU3A 4HPQA 5GP9A 2HQ5A 3M7GA 3L2RA 2ZJ2A 3WODF 4G9YA 4D7NA 1VI0A 1SVMA 3HG9A 2CJJA 4I09A 3S93A 4S04A 3D1NI 2ZC2A 2EK5A 4X1EA 2P81A 2CUJA 1K78A 3ZP5A 5F27A 1XSXA 4ZC3A 3GUDA 4P9FA 2OTLI 4CO8A 1USTA 3HDDA 4OMYA 1MNDA 1IXSB 4AYBN 3E3VA 1RR7A 1W5SA 2XIGA 4ZJZA 5C4JJ 4HQEA 2HVSA 1S3JA 2COMA 2EZKA 2XRLA 2R7ZJ 3RZOJ 3I53A 2ZNYA 1DDNA 1K7AA 3V7RA 2QSGX 5IYCJ 3J7AO 3K6GA 2H1KA 4ZYDA 1UMQA 3GFMA 1STZA 2JUCA 2BZTA 2IP2A 1ETXA 5LD2C 2QZ8A 3TP3A 3E1SA 1FBQA 5E3LA 4BEHB 1Z9CA 3I54A 4A0XA 3DPTA 1TWFJ 3FXJA 3QAHA 5EG0A 3HL2A 3BR1A 4PJJA 5DV5A 3LSKA 2DU9A 3OYLA 3W2AA 1Y0NA 2X1DA 1N78A 5FKOA 2MD5A 3C3WA 3GVAA 5EYRA 1T8IA 3VFZA 3A02A 5J3LA 1ZG1A 1DP7P 1L0OC 3H9QA 1A04A 3TW7A 1W0UA 3H5NA 2VODA 5LFAA 4BBSJ 2ZB9A 2L7FP 2LREA 4KJZA 4YEJA 2LTPA 1QPMA 1X1BA 3EUAA 1OLTA 3F23A 4XRSA 4BJ5C 2Z33A 3GZ5A 2N8GA 2BEOA 1JGSA 3KYDB 3DV8A 3RI4A 1IZ1A 1BI1A 4XRFA 1YX3A 5CQEA 3HOWJ 1S7OA 1DGWY 4ESJA 3OY9A 3GFJA 3GTOJ 1TT0A 3ZR8X 4M72A 1YFHA 2KKOA 3T8RA 4IHXA 2BW3B 4LGWA 3D0SA 3SDGA 4NC7A 1R71A 2PX9A 1LVKA 2VE8A 2KRFA 1FEXA 2LK2A 4RGRA 2LBFB 2HOTA 3DCFA 4BXXJ 3MKLA 2EPFA 2E7XA 1KA8A 2JPCA 3OYNA 1LB2A 3HRMA 3AG4H 4A3MJ 1P4XA 2M4KA 2QQBA 4FT8A 5CVRA 1NK2P 2EV6A 1JKOC 2DT5A 3ZMDA 4YFKF 3N4MA 5DUKA 1A6QA 5IY5H 5ED4A 2Q2EA 1D1BA 4MLOA 1WJCA 3ASOH 2R7VA 4Y15A 2FBHA 3LSGA 3Q3SA 1B8IB 2BYVE 4ABZA 4DZJA 1T2KA 4U87A 4BHBA 1O4XA 3W2VA 4LIVA 4EGZA 4HF0A 3PUBA 3ZMTA 1KU2A 4M6XA 3JRHA 3S14J 2DMUA 4I6ZA 1RR8C 2DOAA 2E71A 3F21A 1FP2A 3BTCA 2W25A 4KT6A 4B43A 4EM0B 1USSA 3K2AA 2FA5A 3S3OA 4QLCU 3L1PA 2ECCA 3M3YJ 1BOAA 2GOMA 2V1NA 3IAM2 1I6HJ 2HR3A 4BDYA 3NWSA 5L3FA 4NNJA 1FWZA 1ZG3A 4DW6A 1YJNI 5M5YJ 2DQRA 3UKGA 2CS3A 2DTRA 2DFHA 3JAMZ 5ILSA 4BQAA 1MBFA 1KQ8A 2VPLA 1D5VA 5J8FA 2HKOA 4OIQF 1D3YA 2Y9YA 2P5LC 4K2EA 3IH2A 4ZZDA 4X0GA 4LMYA 1V3FA 1KZHA 4KNYA 3DPLC 3CC2I 4E6KG 3A2KA 2LYCA 4B48A 1FIAA 2AXTC 1H9GA 3H9JA 4GO1A 1EF4A 2LR8A 3BLYA 3OIQA 2COBA 4JK1X 4ETSA 2GIZA 2VJJA 1QQIA 2W84A 2NAZA 1LDKB 1X2MA 2HZDA 3WGIA 2XPUA 2NVTJ 4A3EJ 3RZDJ 3H9GA 2JT1A 4Y17A 3TO9A 5H2FC 5LBQA 2BBYA 2PFBA 3B73A 3PFIA 4DJAA 2F4IA 1IW7F 3EUKL 1T0FC 1OCPA 3S2HJ 2M8EA 1IN6A 2XB0X 5HODA 1TC3C 4HYEA 3O6BB 3J7ZI 3EDPA 2ACJA 2IS2A 3HSRA 1Q1VA 3BTLA 2JVHA 2CYYA 1XGOA 5KCMA 5IYBJ 2RDPA 2DLLA 2O0YA 3BG5A 3HTSB 4WXDA 3GTGJ 3HJEA 3N97A 1Y6IA 1R5HA 4NUBA 4ZDLA 4WXCA 2EFNA 5J4VA 2R5YA 1MSEC 4XN0A 5JVTA 4HRIA 2CV0A 3Q0UA 3OS2A 3WTYC 2M1BA 2BY1A 2E2IJ 5GPCA 1UELB 3ZCOA 3VSLA 1X19A 5LHGA 1D1AA 3DP7A 2M7BA 3OYHA 3BJ6A 4UUTA 2DK5A 3IWZA 3EYIA 4V2FA 4IKFA 2CW7A 3BG9A 1ZR4A 2VKHA 3S1RJ 1VQKI 2K02A 1ONVA 2QVOA 4Q47A 3JR9A 1IV6A 1T0FA 2AQEA 1XB4A 2LKXA 4A93J 2HXIA 4BQQA 1NK3P 3BCBA 2ZMEA 3Q0WA 3DTEA 3C7JA 1E3HA 3HC7A 3QOPA 2Y48A 2HXOA 2LBFA 5K5QA 4U0YA 2UXXA 2DFEA 4L5JA 1YW7A 1S6LA 3KX2A 4YG2F 5M5XJ 3QPHA 3R60A 3I9V2 1B4AA 5F6FA 5K7FA 3F0CA 1NH3A 2R5ZA 2CW0F 3CZ6A 4YIRX 3MVPA 4BHCA 3MKZA 4Q4ZF 1U78A 5E79C 3GFIA 2F48A 2QYOA 1RKTA 2C6YA 1Y1VJ 1HQCA 2NOGA 3TO6A 4PGGA 3DEUA 3HRSA 2ESHA 1SMTA 1WI3A 4HOBA 5CVIA 4AD9A 1T56A 1GLNA 3FHNA 3HUGB 2XUBA 3V8JA 5IP7J 4AIKA 1Z3YA 2B63J 1ERDA 3KP5A 1ZREA 1SVLA 2IJLA 1F1ZA 4BACA 2L7ZA 2CQXA 1YI2I 1R58A 4UVBA 4EM2A 4BS9A 2ZMEC 1DP3A 4AWXB 3FM5A 5KHDA 1HDDC 2FNAA 3L09A 3ZGKA 2ZJRF 3GF2A 1LE8A 1FC3A 1XX5A 4XOTA 1GHCA 5BS6A 3S1QJ 4BU2A 2G0EA 4LLNA 3WTSC 2O61A 3TDZC 3CCVI 3KLNA 3SEZA 2HQRA 2OQRA 1GXQA 3OYIA 3K4KA 2JK3A 2M2EA 3B6CA 4JBAA 3O2PE 2G7HA 5C3EJ 1PUEE 3PUFA 1FSHA 2P4WA 2JMWA 3HKZA 2EZHA 4M6VA 4XLPF 1BR1A 4PK4A 2KDOA 2WBMA 2GAUA 3C2BA 3VODA 2IAIA 1PDNC 5E8IA 1VQ4I 4IO9F 5GAGJ 4XICA 4PJ0C 4A6EA 4J01A 3GYHX 2QENA 1FYMA 1OCOH 3R0JA 4G7HF 2XGCA 5HLGA 4H0EA 2VBZA 3LSPA 2DA5A 2JN6A 1YW9A 2LNBA 1JKRC 3HHHA 4MEXF 1ETVA 4IHWA 4FX0A 2VASA 5FGMA 4KT5C 2M3AA 2HYFA 2VBWA 2CV2A 3A4CA 4MTDA 1B72B 4KIBA 4A3IJ 4UXNA 2XVCA 2DDBA 1MJ9A 5L3DA 2LF8A 3J7AY 1V5EA 1Z6TA 2F2EA 3OYBA 1BW5A 4BE1A 2HTJA 3WTWC 1DGRM 1ZKGA 1HKTA 5H20A 1J5YA 1P4WA 5LHHA 2DK8A 4A69C 4HDUA 1TBXA 3F6VA 4BDZA 1FX7A 2EIKH 2PN6A 1LVAA 3ZN1A 4BBRJ 1S8NA 5J1UA 2L4MA 2VT2A 3X2QH 4RB3C 3KZYA 4FX4A 1P92A 5CVJA 3HOTA 2R7RA 3PSIA 5EGOA 2L7KA 2OC6A 1ZRFA 4HAMA 3FMQA 4IJAA 4BHPA 3BR6A 4XKCA 1X4OA 1A31A 1Y8QB 2PG4A 3DEWA 1FYKA 2UUZA 1G3TA 4BXUA 2ELJA 3ZN0A 1W36C 3J81Z 2E5NA 5HNHA 4B44A 1WFXA 3FXRA 3GW2A 3UR3C 3CJNA 4A0ZA 1WJAA 1SFUA 1DPRA 1UHMA 2Y0MA 3ERED 3TEDA 4D1QA 1Z91A 1F4KA 3CLQA 2FX0A 5J47A 1FJLA 2JZYA 2M45A 5ERIA 3HOUJ 1XG1A 1EH6A 2R7TA 2WADA 1VQMI 3P7NA 5BQTA 1MBHA 3JRGA 2BE5F 5EEHA 2E1NA 1ZTRA 2KRHA 3ULQB 5LRSA 2VOPA 2L9VA 2YX4A 2YU3A 1ZHFA 1R4MB 2OBPA 2YR2A 4Y33A 1EH8A 2ZNZA 2NS0A 5LHIA 1O3RA 1L3LA 4ZYAA 2E2JJ 1OPCA 4UB6C 1SANA 4D7MA 5K5OA 2E36A 3HGGA 1FLIA 3H92A 3I71A 3GFLA 3KYLA 3OYDA 2LVSA 2QCOA 4B09A 1RUOA 4II3A 4HF1A 1WPKA 2ZJPF 3AKZA 4YRVA 1HA8A 3WU1B 1HBXG 4NBQA 3SEQA 4GCVA 2MABA 1ZAOA 4EVIA 3IUOA 4EGYA 1IC8A 4IHTA 1IF1A 5BMZA 2MC4A 3KYCB 2PBIA 2YX7A 5E3OA 2CW8A 4ZZLA 5FRNA 2E7WA 3TKYA 2L2OA 3V4GA 5GADJ 3KCCA 3CCEI 2VC0A 1MSFC 3ZQQA 1PP8F 1K79A 1B9MA 2KZVA 4CYCA 2EFWA 2MH9A 4KN7X 5D5WB 3WU0A 4L9JA 2DA1A 2E1CA 1JKQC 4IHSA 3I55I 2HDDA 2D45A 2EILH 2MLKA 2H27A 1KGSA 3BJOA 4I98B 2V9PA 2EZIA 2P8TA 3KP3A 3TP0A 1N25A 3OR1C 2VJIA 3HPHA 1HW2A 2VIXA 4ZYGA 4C2UA 2IT0A 2Y9ZA 2P0WA 1F5TA 2MFZA 3C2HA 3DFGA 2YSRA 4GYGA 2A68F 5J8CA 3CCLI 5LRRA 4D0PA 5F0CA 3PSFA 3HXLA 3RKQA 2QWWA 1AOYA 2R7UA 2X6XA 3GCMA 2VBYA 1UZCA 1ZGAA 1XDSA 1HKSA 3ZMSA 3CF2A 1DU0A 5EGOB 1KQ0A 4AVZA 3ZQLA 3PNTA 2Z9OA 2R7DA 2EFPA 1H8AC 1WVRA 3HEFA 1E0EA 4RBOA 1SD7A 1HKQA 2X51A 4F55A 5KAFC 3I4PA 3WHBA 1R00A 4HZFA 2FMYA 2XPWA 1H9TA 1U6GA 1W7PD 3KP2A 2K9QA 1Z1DA 4OWRB 2L7MP 3AL0C 2OA4A 2DTZA 1BI2A 1XGSA 3HOZJ 5EEGA 1FZPB 5ICFA 2DA4A 4PJNA 2WB1N 1XGMA 4FQGA 1Z6RA 3WGHA 5DS9A 4RM2A 1QA6A 3CC4I 2BHZA 3HOXJ 4NHJA 3H5RA 2CQKA 4GGGA 1TWHJ 3RTRA 2JPBA 2BY3A 1SFKA 1P6RA 2NYXA 3G4SI 2W00A 4R1HA 2QF7A 5E8GA 2V1UA 1MW7A 4IEJA 4R79A 1SFOJ 4RS8A 3PO3J 1D0YA 2CSOA 3IRQA 3TO7A 2XF5A 2XROA 2E1MB 4A3GJ 2EA2A 5J1YA 4PZJA 4DOZA 3MEXA 2A3SA 2STWA 4ANJA 3JTGA 1ZQ3P 4RAFA 2JRTA 4UVAA 1N75A 1P4AA 4RLFA 4G8XA 1B8IA 3U21A 2KT0A 4A0YA 4XSXF 4LG0B 4QPOA 4EJUA 1MBGA 3LA2A 4ENJA 1VQPI 9ANTA 4QTRA 5IP6A 3D5LA 2Y30A 4E7LA 4AIDA 2HDWA 2O5RA 2XPVA 1MIJA 3L2VA 1WJ5A 1GDTA 2K4JA 5LGTA 1LE8B 3U1DA 1GXPA 3WGGA 3QQAA 2GOXB 2DA2A 1WWXA 2PMUA 2BOLA 2H6CA 1FOYA 2X48A 3NWTA 2VC1A 3K69A 2DJIA 1E3PA 2BHYA 3TW6A 4DNCA 3GZNB 3ZQIA 2L9RA 2W82A 5DD8A 3K1NA 3DKWA 3L2QA 5M3MJ 3CDIA 3HBLA 1IDYA 4WXHA 1P9QC 1RNLA 3FXQA 3BG3A 4HX4A 2F5DA 3NEUA 3WTTC 3GTMJ 1LEBA 1FTZA 3E6MA 2EIMH 4IRIA 2LC2A 4JQFA 1E2XA 2W48A 1A35A 3E5XA 1ULYA 4HNVA 5HLTA 3FISA 4BUPA 2XGXA 3J7YJ 4I2OA 4OAYA 2A6EF 3GXOA 2L02A 3KZIC 3BR2A 4GRIA 4EJOA 2L54A 3S17J 5HDGA 4FE7A 1LUJB 3MZYA 5DUIA 3K0LA 4G6QA 2OAZA 4HEA2 1MMAA 2VBXA 4GYIA 1CF7A 1SC7A 3FMRA 3BCAA 3CUOA 3CCRI 2EFOA 2E34A 2M7AA 4LD5A 1OCTC 1BW6A 2H6BA 5BOXA 3DLAA 1QNTA 3CP2A 3K7AJ 4HV6A 2ZBKA 2HWVA 3ERMA 5E1WA 1FMVA 2KFDA 3QYEA 2VKDA 2O8KA 1HC8A 3DPUA 2UWMA 2ZXIA 1HXDA 2VB6A 1YOVB 2WY8Q 2Z3YA 1SAUA 2QLZA 5A2QK 4LFUA 4ENNA 4QSHA 1MMSA 4OAZA 3OS0A 3IRRA 1WGXA 3KFWX 3M9AA 2G7UA 5E3NA 3JRIA 2E35A 2V6CA 2B0LA 2EB7A 4ZYHA 1T95A 4XQFA 3RPUA 2F5FA 1BC8C 2MSYA 4C2TA 4E7IA 1IDZA 1FNNA 1YRNA 3P5JA 1CGPA 1T38A 1J0RA 3JSOA 2ZXJA 3G71I 3GTKJ 1W0TA 3VEPA 1J75A 1AHDP 3SDBA 2PJPA 3VB2A 3K2ZA 2DFIA 2ME0A 1G2HA 1WRJA 3HB9A 4J19A 4CCKA 4HG2A 3ABLH 4U7BA 1YTYA 1R36A 5FO5A 2W24A 3CLOA 3O8HA 1VQ6I 1OKRA 1EH7A 2L3DA 4R8HA 2IPQX 2FE3A 2XAUA 2JUGA 4G6TB 1J59A 1R1TA 3BOQA 4JYKA 4PJLA 2DOEA 1IN5A 2F5VA 3DTIA 4NB5A 1G3YA 4AUXA 4IQ4A 3I4MJ 2PI0A 1XSDA 1TQPA 1D1CA 4NQWB 3KZZA 2E5ZA 4IOCF 2Y2ZA 3E0JB 1JUPA 2Q2EB 2P5VA 2A5YB 1R1VA 3OIPA 3EQLF 5D6FA 4FISA 1WJDA 4XSZF 4G7ZF 3S15J 2ESNA 2ZKZA 2NVQJ 1V55H 3TL4X 5B3SH 2E1MC 3E6BA 4IL6C 2XF6A 5B66C 2CQ7A 2L9SA 3G6EI 3P9IA 1R6RA 1J7KA 1ETOA 4P1WA 3GTPJ 1HLVA 5FKLA 4E7JA 4ITVA 3QP6A 1W7PB 4BQOA 1D8KA 2IA0A 2K86A 1RI7A 2O03A 2VN2A 2MA3A 3KIOA 3QPSA 4PDKA 4PSWA 4UV9A 4XR6A 2STTA 2VKVA 5EF6A 3KP6A 3RKWA 1YO5C 2DMQA 4Y3OA 4ASNA 5FB2A 2R7XA 2M8GX 4BL0B 3FMSA 3WTZA 2O9LA 2KMUA 1S29A 3O8GA 4I7HA 3VDXA 1JJ6C 2Z2SB 3FDYA 3AL0B 2D5VA 2A61A 1SVOA 3PQJA 3CD6I 5FKMA 3CCMI 2CGPA 5D4SA 1JHHA 4E70A 3F22A 4YFXF 3BP8A 1QZEA 2JWTA 2L0KA 3U9GA 2CU7A 1BIBA 1OCRH 2BY0A 1MJAA 3F8FA 2IS4A 4O6JA 1Z7LA 3L00A 3IC7A 1VQLI 3S2DJ 5FKNA 1DUXC 3CJRB 3CMEI 5FD5A 2K3PA 1X58A 3TDUC 4ESBA 4IHYA 3HZJA 1XD7A 2K9NA 3DBHB 4HLXA 2AS5F 1Y39A 1Z7UA 3E5UA 5FFZA 1Z3XA 3ASNH 1U9OA 2GA2A 2ELHA 3OOPA 3HRUA 5LEKA 2BVMA 2FU4A 4IHVA 2JTVA 1OR7C 5BNGA 5LGUA 5LLQA 3LSTA 2ZXHA 2Q8KA 2CFXA 3WG7H 4EM1A 1SEUA 1IRXA 3JRDA 2HVQA 5E17F 4L9NA 2WAFA 5IOZA 3K4CA 4IVNA 4RAGA 2HDCA 2R5YB 1ENHA 4KICA 4C2MJ 3FXLA 4OINF 1UAAA 1R5ID 4M9ZA 1JTYA 1X3ZB 5ICCA 2LMDA 2RVCA 2EV5A 2OD5A 5EDNA 1OISA 3QYFA 3CDHA 1R7JA 2H8RA 3V8LA 1HF0A 3ABUA 1K78B 2E1OA 1G8XA 2Q1ZB 5DDGA 1AWCA 3CUQA 4ZTFA 5HDKA 5IYDJ 1XC5A 2ETHA 1X1AA 2ICWG 4BGDA 2GXAA 3K1PA 2CH0A 2Y0SA 4ENMA 4Y13A 1BC7C 2A69F 2K85A 4YELA 1CQTA 1QZZA 2CUZA 1YG2A 3NARA 1T39A 2KIQA 2JA7J 4U7DA 4OIPF 2LY1A 1X2NA 2CUEA 1WHUA 4DBQA 5DCMB 5GPAA 4RB2C 5J6XA 2L9NA 2QBYB 3I3LA 5D5VB 3PJRA 5D5XB 3ZMUA 4BQNA 4RMNA 1ETQA 2V7FA 1TTYA 3C2GA 4CYDA 1Z0XA 4BKXA 4XBFA 2HPMA 1IRFA 3ZQHA 1G3SA 3SFIA 2JA8J 1LDDA 1Y8RB 2M4GA 2VXDA 1FBUA 1D8JA 1QPIA 1MBJA 3F8CA 2HOAA 4A3JJ 1BN5A 2FBKA 2W4SA 4XNFA 1LNWA 5H6RA 2LG4A 1I5ZA 3QPLA 3S3MA 1S7AA 2WTEA 4CHUA 2XAGA 1MJBA 1YIOA 3FWEA 1TW2A 2XAFA 4B3XA 2A5WA 4IF4A 2LKSA 2XC7A 1BI3A 2KISA 3FXOA 4M6YA 3H0DA 1ZLJA 1RRJA 1RC9A 2KIFA 1U5TA 3GMEA 3KP7A 3ECHA 4RAZA 2M5WA 3ABMH 4I0AA 3QPTA 3H3VK 1KU9A 2M0CA 4RB0A 4AM3A 3IL2A 2OJED 4XKVA 3LOCA 2QM3A 4HA8A 2O8XA 4M71A 3ZOBA 5FLXK 2IA1A 3D5SC 4BYYA 3PNYA 3LMMA 3T1BA 5E1ZB 3EUHC 2CWEA 1DU6A 3ABKH 2OPTA 2VOOA 1S9HA 1JTXA 2VI6A 1TLHB 1ODDA 1R4NB 2DQLA 4F91B 4P55A 3IKVA 2XRNA 3QP5A 5F04A 2VE9A 1NG7A 3PFYA 1BA5A 2EBIA 1U8BA 4XORA 2KJBA 1ORKA 4M9XA 1KONA 1EKEA 4LOCA 1LFBA 3PM1A 1YS6A 2RQQA 3R4KA 3OWTA 3QYBA 1SD6A 4PUSA 4BY7J 2R7WA 2PLYA 3PO2J 3L7WA 2DA6A 3MQ0A 1H89C 3L9FA 4CGZA 1JXSA 4HV5A 1PUFB 4QWQA 1CF7B 2PJRA 1AKHA 2VJ4A 1XS9A 3LSIA 3T5XA 1OYYA 4DIQA 1PJRA 2WAQA 2HOSA 4OIRF 3SXYA 4V2GA 4CSWA 2DPDA 1C0WA 3W6JB 4UHTA 2OTJI 1WCMJ 4N9HA 1GUUA 2NXNB 3HOVJ 3LL7A 2MLGA 3DXJF 3DKXA 4KFCA 1IUFA 4B3AA 4DZPA 5LGNA 2DMNA 1IV8A 2KRCA 4C3HJ 3E6CC 2YPRA 5IOYA 1I1GA 2VPRA 4HQMA 4IX7A 2X6OA 3K70C 4Y4RA 3FIWA 2XKPA 5DYMA 3W3CA 4P9UA 1IUYA 3E7LA 3FM3A 4ESFA 4CYCB 3PIPF 2GWRA 3BY6A 1K6YA 3KEQA 2HQAA 4DGWB 2Y75A 5M5WJ 3JREA 2HEOA 1UB9A 3JCUC 3CP8A 2VQGA 3KP4A 2IGMA 4BEHA 3O3KA 1REPC 1ZRCA 5EJCA 2HGCA 2Y0SN 1RUNA 1IG7A 1LEAA 1YIJI 2XAJA 2PEXA 1E3OC 1VQNI 2R4GA 1FOWA 3N05A 1QZYA 3R61A 2IS6A 4JX5A 1OYIA 5F08A 1X1CA 2CO5A 4I02A 3DQVC 5J4YA 1GV2A 3FXKA 1QHHD 1Y1WJ 3BPVA 5F0HA 1XTAA 2PMHA 5J1RA 3LSHA 2JQ7A 3LA3A 5IT9K 3SYTA 4C30A 2XF7A 5A2QZ 3V8KA 2RKHA 1HSTA 2XGEA 1J09A 3UNGC 2MYSA 4D5FA 3F8NA 5HDNA 4BY1J 3SFZA 1KQ9A 2XAQA 4WCGA 1S7EA 1DQUA 1FP1D 1FPQA 3L2WA 3LFKA 4CZZA 2B9SA 3K9TA 2DW4A 1IN7A 4BXFA 1LPQA 1RETA 3ESWB 1HW5A 4FETA 3RKXA 4Q5SF 1TZLA 1UG2A 4M3FA 1FTTA 2M87A 3ZXSA 3A1YA 1WH5A 2A07F 1ZG5A 2ME6A 5D4RA 4A3DJ 1N77A 4XLFA 1BM9A 2A6TA 3F3XA 3WE3A 5JI6A 1PVEA 1UHWA 3FBIB 1J9IA 2QUFA 4RGXA 4YIIA 4LB5A 4B8XA 2RQPA 1TWCJ 4HX8A 1WZ2A 2FRHA 1K61A 1IXCA 5CJ9A 2CUFA 4XKWA 5L3BA 5HS7A 5GTIC 3HGYA 2FQ4A 1I6XA 2ADUA 3IHUA 5H6QA 4E4HA 5L3CA 3WU2C 1RESA 3H3ZA 2L01A 2KZGA 1XDUA 1MZBA 4OU0A 3F9KA 1K83J 4KISA 1ZK8A 1QU3A 5CQGA 1G6NA 2VQCA 2X4HA 1ETWA 4I76A 4AIHA 4A5MA 3MKWB 1O7LA 1YS7A 3MWMA 2I5UA 1OJLA 1ACIA 1B9NA 2DA7A 5ICGA 4LG3A 4M73A 4LB6B 2DXIA 2R93J 1GVDA 2D1HA 3WE2A 5CLSA 3MN2A 4JOMA 1ZELA 1MD0A 4P5OA 2RAEA 1T08B 1BJZA 5KNLA 3QU6A 2LRDA 2EZLA 1RPWA 4CXFA 1AU7A 2OCEA 5GTHC 5JHFA 3OV8A 2EWNA 2K5CA 5CKTA 4IRHA 2HQNA 3K1MA 3HUGA 3D5RC 4BE2A 2RGVA 2FF4A 1BI0A 3F8BA 5JR3A 3HOSA 1I39A 1FMWA 2LF7A 3TGNA 4FHTA 3GX4X 5D8KB 3R0AA 3GLXA 4A3CJ 1T98A 2D1VA 2Z1DA 5JLXA 3G1OA 5ILUA 1EJ9A 1JT0A 1ON1A 3MMYB 4N4NB 4Z2YA 4HSRA 4N0BA 1FIPA 1YYVA 4U88A 2JA5J 2X85A 1SMYF 3KEYA 1IXRC 3C18A 2JA2A 3U1KA 3AG2H 5DTDA 3CQZJ 2QQAA 4DQ2A 5E1XA 2P5KA 1I50J 3F72A 4XLHA 1YJ9I 1U8RA 2ZCWA 2R7FA 1QBJA 3E6DA 2WC2A 3JW4A 3GZ6A 3VPRA 1VQ9I 5DEQA 1BR4A 3SZGA 3Q9VA 4U0VA 3DKYA 5FLMJ 2GBYA 3OYGA 2NRAC 1HCRA 4RM3A 1I3QJ 2Q0OA 2V26A 3I59B 3OYJA 1MDMA 3HOYJ 2M34A 3M1EA 3CCQI 1TNSA 2K4BA 3W2WA 2RN7A 2R0QC 1U5TB 3PL8A 3AFHA 4NC8A 4S05A 3K70D 2AHQA 3A01B 3CO7C 3K4MA 5E18F 5CVVA 3BJAA 1IO2A 2VT3A 4L18B 3AG1H 1XMXA 4AC0A 5BPDA 4II2A 1H0MA 3HYIA 3S2WA 3DEEA 2W85A 3JRBA 1VFCA 3EUHA 3A0BC 2OZ6A 2DI3A 1MH3A 3CDLA 1V5GA 3T8TA 2F5EA 3EETA 5GAEJ 1UG0A 2J5PA 2V1XA 1OCZH 3CMMA 3JRFA 1KYWA 2IEKA 3VYUB 2OU2A 4NC6A 3ZQFA 1AKHB 3BZKA 4FE4A 3CO6C 1JE8A 2UV1A 2XGDA 4ZH4F 3C1DA 2JVGA 4WF2A 1ZGJA 1MGTA 4EJVA 3K4JA 2ZSIB 1O57A 1OR7A 3CCUI 2PMZA 4GFBA 4G94A 1F36A 1OCCH 1W1WE 3KE2A 4KIGA 2GLOA 1XMKA 3JTHA 1F43A 2LP0A 3RPUD 1JT6A 2DCEA 2I10A 3QU3A 3LSMA 1PUFA 1YX5A 2QKMB 5DCFA 5TJJA 3WTXC 4HF2A 4F3QA 1GT0C 1NTCA 5HLIA 1BIAA 2K3FA 4J00A 3PIOF 2VL8A 4CH7A 2VONA 3J80Z 1B72A 1K4TA 4HNTA 1EV7A 3ABTA 4IRGA 5M3FJ 3FKIJ 2EV0A 1YJWI 4JX4A 2P7VB 2OF7A 3H3UA 5KK1A 2IGNA 3RSNA 5KAIC 2MGQA 1IRZA 3I0TA 3M8EA 1HDPA 2NVUB 2FUG2 4XMYA 2ID3A 4MNUA 5K5RA 2OV7A 2WV1A 2ZO4A 2DT7B 4FASD 1IJWC 1T6SA 2EA4A 1APLC 1DPUA 3A0HC 4ZDPA 5GAHJ 2HI3A 1JI8A 1Z77A 2FSWA 1ZLKA 4XRMA 4Y7NJ 2GQQA 3MCZA 2V4JC 2IGKA 1ZRDA 3V42A 2QKLB 3T0YA 1R22A 4IZZA 1JHFA 3M8FA 4LLLA 3RPQA 4A6DA 2RNGA 2MW8A 4QIWN 2NNYA 1VQ7I 2IS1A 3DLLF 2NVXJ 2OZUA 3RCOA 2CQQA 2YU9J 1X3UA 2IVMA 3KETA 1MBKA 2VJ5A 4LK1F 3ZQGA 2QEXI 3CMAI 2HKXA 4TV7A 5FROA 1Y0UA 2FD5A 4G12A 3L2CA 2NS7A 1QO0D 1NHAA 2RREA 1YHQI 2DAOA 1R1UA 3E97A 2ZSHB 5D5UB 4UVCA 1UFMA 2LD5A 2KHMA 2DJNA 2MG4A 1ZH5A 2BW3A 3TOAA 2YUSA 5IPAA 2QBYA 1TP4A 4KITB 3QODA 6PAXA 4AYBA 4E7HA 2KP6A 5DCMA 3OYCA 1FYLA 2KQRA 2TCTA 3OIOA 4AIJA 2DN0A 2LSOA 2P6TA 3LFUA 2ZJQF 1X4PA 3BPXA 5CPRB 3LSRA 1ITYA 3DTKA 4AVPA 2QSFX 3TBIA 1D0XA 1QHGA 4CCJA 2HTSA 1Z21A 1R5GA 1OFCX 1A6IA 3M07A 4B1RA 3CMYA 4F93B 1AA7A 2VUMJ 2RV8A 1VTNC 4V19K 1FY7A 4HNUA 3ZMZA 4E7ZA 2FJ1A 3FX3A 2HVRA 1G3WA 2LLKA 5K1YA 2R92J 2M9HA 2EFQA 1D5YA 1WKMA 1I3AA 1QVUA 1A5JA 1LJ9A 4I01A 1YW8A 4HX7A 5HVQC 4XONA 4KUMA 3Q9SA 5K7HA 3A01A 1POGA 2K9LA 2FQ3A 4MIMA 5B1AH 3B6AA 3MKYB 2XASA 1UHSA 2DA3A 4MGRA 3SZPA 4OOIA 3BT9A 3I58A 5FLVA 1KYZA 1TWAJ 4C9YA 5FD6A 2HOEA 2V9KA 4XIDA 2X6YA 3V7SA 1B59A 1IN4A 4BJ6C 2LFBA 3BROA 1UJ8A 3BG7A 2R5ZB 3BR0A 1G59A 5DM7F 3P9KA 3ML6A 5FLXZ 1JUMA 2LOOA 4XLAA 4RAYA 2R7OA 2R7SA 3LA7A 2X6WA 3QOEA 5EG0B 1VQOI 2FNPA 2PMZN 5EZGA 4X6AJ 5DD4A 2FEZA 1O3TA 2LH9A 4YIFA 2MD0A 4L5IA 4PCQA 4UUSB 4WK8F 2AO9A 4XL9A 2KJCA 4IQJA 1XGNA 1FOKA 3OYFA 2IGOA 3OS1A 2KIMA 2OQGA 2HYJA 2R3SA 2ZFUA 5EEAA 1VF9A 3B02A 3R6SA 3U2RA 2VLAA 2MC3A 2XV4S 2K7LA 1WSUA 1Q1HA 1U3EM 3M4OJ 3OL4A 3W6KB 3ZPLA 3S32A 2JRMA 2KPMA 4EJWA 4F52A 2CMPA 3H5AA 2XDVA 5ICEA 2QSHX 3FK7A 5F64A 1JJ8C 3LNQA 2QA4I 4WWCA 4A3KJ 4BNCA 3G73A 2DDAA 3DF8A 5F0FA 3BQZA 4O3MA 3HSFA 4Y52J 4HDVA 2BXZA 1WH7A 1MNMC 3WTVC 5AIQA 3S3NA 2VXZA 5D6EA 3SHFA 4DBRA 2CRGA 1P7JA 5K7ZA 2GM4A 2UXNA 4F92B 1TQMA 4CZCA 3Q0VA 1U0JA 4L9TA 1O7FA 2F6CA 4CUGA 4EJTA 1OYWA 5FFXA 2F5CA 4QPQA 4OMZA 1X1DA 3GBGA 5AONA 3G1MA 3DU5A 2FMLA 4RLQA 3FF5A 1YITI 1SD5A 3RQ4A 3RYRA 2OUMA 3VOEA 2EQRA 4XLNF 1W5TA 1KU7A 5DM6F 3QRFF 1WJFA 3WTUC 3OYMA 5FKKA 2V79A 1ZARA 3BDDA 3RIRA 2KDZA 1ZGWA 2DPUA 4MEYF 3K4LA 2GZWA 3LQQA 5HS9A 5HS8A 5FJ8J 2EH3A 3ZMVA 4OIOF 4I0BA 1YRNB 1Z67A 2DMPA 4N9IA 3CUQB 3QWLA 1OMIA 3EPZA 3ROUA 4H4KC 1QVTA 3IKTA 3G2BA 3JRAA 2GIVA 1O3QA 3FXMA 2M0MA 4RGSA 5JVGF 3WG9A 4UB8C 2IW5A 1IN8A 3KEOA 4HLYA 4XN3A 2NS8A 5JLWA 4ZYEA 1PP7U 1SD4A 4XKBA 1V5FA 3HPGA 5JHUA 3ZRGA 5F1RA 2KLOA 2DFFA 4PSXA 2F4MB 3J81K 1XPXA 4DYCA 2JJ7A 5E3MA 4XRSG 3GO5A 1YE9A 4KIFA 3KPHA 1JGGA 2QGUA 1VNDA 4PGHA 4XLEA 2O3FA 2NOJB 4UUSA 2V9VA 3SJMA 3HM5A 4M3DA 2WAQN 1O3SA 5AIPA 3REOA 3OMYA 3TMOA 1T33A 2LY2A 3OYKA 4LG0A 2W7NA 3BTJA 4M3BA 2LY9A 2A05A 1H88C 2Z99A 1ZR2A 1WI9A 3VYRB 4E7KA 3IAS2 2GXBA 1TT5B 2KIUA 4NDLA 4S0HB 2FBIA 2ISYA 2FXAA 4W1UA 1MH4A 3IH3A 2DBBA 3NQOA
chains in the Genus database with same CATH topology
4BXFA 1BR2A 4XOPA 4FETA 3L2UA 3D5LA 2VPLA 1TZLA 4XLCA 4E7LA 3ZXSA 3A1YA 2HDWA 2O5RA 3VSKA 3VYSB 3L2VA 4X0GA 1WJ5A 1N77A 4ZDOA 3DPLC 4E6KG 3A2KA 2LYCA 4XLFA 2A6TA 4B48A 3FBIB 3H9JA 3OYAA 2GOXB 3BLYA 1MMDA 3OIQA 2BOLA 2VJJA 1LDKB 2HZDA 3NWTA 4XKWA 2WB1A 2DJIA 5HNFA 3H9GA 4CCOA 2JSPA 2W82A 2WA0A 4E4HA 4DJAA 3L2QA 2F4IA 3F9KA 1P9QC 3EUKL 4KISA 2K9MA 5CQGA 1QU3A 2VQCA 1T0FC 4ZTJA 2LC2A 4JQFA 2VQHA 3MKWB 1Y56A 1PYVA 2IS2A 4CA0A 5HLTA 4LG3A 4BUPA 4CCLA 4OAYA 1BOBA 2DXIA 2JVHA 4GRIA 3DU6A 5KCMA 4JOMA 1ZELA 1WJEA 4P5OA 2XSJC 1Y6IA 4NUBA 4ZDLA 5KNLA 2LRDA 4HEA2 1MMAA 3CESA 4XN0A 5JHFA 3K10A 2K5CA 5CKTA 4HRIA 3BCAA 3D5RC 4B47A 4BE2A 2CV0A 2M7AA 3OS2A 2KL4A 1UELB 3ZCOA 3DLAA 3HOSA 3VSLA 1X19A 3CP2A 1D1AA 1FMWA 1FMVA 3QYEA 2VKDA 3DPUA 2UWMA 2M7BA 4PJMA 3OYHA 2ZXIA 3M1CA 2VB6A 2WY8Q 2Z1DA 4IKFA 1SAUA 1LKXA 2CW7A 2VKHA 4OAZA 3OS0A 3MMYB 4N4NB 4HSRA 2AQEA 2X85A 3KEYA 4BQQA 4PFPA 1T95A 3BCBA 2JA2A 4XQFA 3DTEA 3HC7A 4C2TA 4E7IA 2LBFA 4XLHA 3ONQA 3KX2A 2HNHA 3I9V2 1BR4A 3SDBA 5FRMA 3SZGA 3DKYA 3OYGA 2CFOA 3CZ6A 4LITA 4CCKA 4RM3A 4HG2A 1MMNA 2V26A 4U7BA 1WJBA 3OYJA 3MKZA 4XM3A 2HPIA 3W2WA 2WAEA 3PL8A 3AFHA 4NC8A 3K70D 2XAUA 2JUGA 3K4MA 4G6TB 4PJLA 2F5VA 3DTIA 4II2A 4IQ4A 3DEEA 3BG6A 1D1CA 2E60A 3OOUA 4NQWB 2DT6A 1GLNA 3FHNA 3HUGB 1ERDA 2E5ZA 1Z3YA 3E0JB 1NG6A 1V5GA 1UG0A 3CMMA 2Q2EB 4BACA 3VYUB 3OIPA 1WJDA 2UV1A 4BS9A 1DP3A 2Z16A 3S8PA 2JVGA 3TL4X 2E1MC 5KHDA 2XF6A 3ZGKA 2L9SA 3MD2A 3K4JA 2ZSIB 4XOTA 3FKJA 1R6RA 2PMZA 1MMGA 4BU2A 2R7QA 4P1WA 5HOOA 2HU9A 4E7JA 3RPUD 4ITVA 2DCEA 3PNVA 3SEZA 3LSMA 4BQOA 3OR2C 4PSWA 1YX5A 3K4KA 4XR6A 3OYIA 2QKMB 4Y3OA 2AQFA 2R7XA 4BL0B 4F3QA 2KMUA 2X1EA 3HKZA 3VDXA 4J00A 4BE0A 1BR1A 2Z2SB 3FDYA 4PK4A 2KDOA 2VL8A 3AL0B 2WBMA 4CH7A 3FBNB 2IXSA 4HNTA 2L5QA 4J01A 2W1OA 1VZ0A 2IGNA 2IS4A 3RSNA 1Z7LA 2FUG2 4XMYA 3CJRB 2OV7A 2K3PA 1MNEA 2DT7B 3VYTB 4FASD 1D0ZA 2VASA 4ZDPA 2M3AA 2CV2A 1JI8A 3A4CA 3H35A 1Z3XA 3IP4B 4E7SA 2V4JC 2IGKA 2BVMA 1OR7C 3V42A 4CCNA 2QKLB 4IZZA 2ZXHA 3J7AY 4CCMA 2IS1A 1V5EA 2RNGA 4PFOA 3OYBA 1IRXA 3RCOA 2I8DA 4BE1A 1DGRM 2HVQA 2V6EA 2VJ5A 2WAFA 3K4CA 5FROA 1UAAA 4BDZA 4BJTA 1W36D 1LFPA 2RREA 2CV1A 3QYFA 2ZSHB 2X1CA 3HOTA 3K4BA 3PSIA 2L7KA 2OC6A 2R7RA 3BC8A 1G8XA 2Q1ZB 2KHMA 3OL3A 3M8JA 4ZTFA 2BW3A 4XKCA 1X4OA 1X1AA 4BGDA 4AU7A 2CH0A 2Y0SA 2UUZA 4KITB 3QODA 4AYBA 4E7HA 2ELJA 2KP6A 3OYCA 1W36C 2KQRA 4LIUA 2E5NA 4YELA 3VWBA 4EATA 2CUZA 2VQLA 5HNHA 3LFUA 4B44A 1X4PA 1WFXA 5CPRB 3UR3C 3DTKA 2LY1A 1WJAA 3TBIA 1D0XA 4DBQA 1QHGA 4CCJA 1Z21A 2L9NA 2WY7Q 4HSTA 4N4OB 4D1QA 4F93B 3K4NA 1AA7A 3OYEA 2PJRB 3I3LA 2BVLA 3PJRA 3DWLE 4HNUA 4E7ZA 4BQNA 4RMNA 2HVRA 2V7FA 3C2GA 2HPMA 2R7TA 2WADA 2M4GA 2VXDA 4D9JA 5HVQC 4XONA 3S3MA 2K9LA 4XNFA 2W4SA 3MKYB 2KRHA 2LG4A 1EA3A 4C9YA 4Y33A 5TGTA 2V9KA 4B3XA 2A5WA 2X6YA 4ZYAA 3CJQB 4BJ6C 4HPQA 3BG7A 2XC7A 3L2RA 1G59A 3HG9A 3H0DA 3S93A 3KYLA 2LOOA 4XLAA 2R7SA 2R7OA 3OYDA 2X6WA 4II3A 2CUJA 3QOEA 3AKZA 4XKVA 4YRVA 2LH9A 1HA8A 2MD0A 3D5SC 4XL9A 3SEQA 4IQJA 3PNYA 2MABA 4ZC3A 3LMMA 3IUOA 3OYFA 3EUHC 2IGOA 3OS1A 1MNDA 2MC4A 2HVSA 4ZJZA 2CW8A 2ZFUA 5FRNA 1S9HA 4F91B 2L2OA 2VLAA 3K6GA 1NG7A 3ZQQA 3PFYA 2KZVA 4XORA 3OL4A 3S32A 5LD2C 1KONA 2KPMA 4F52A 2CMPA 3E1SA 2RQQA 4BEHB 3OWTA 3QYBA 3H5AA 2XDVA 3DPTA 4PUSA 2R7WA 3HL2A 4PJJA 3LSKA 3OYLA 3W2AA 2X1DA 2PJRA 1N78A 2VJ4A 3LSIA 3OR1C 2VJIA 4DIQA 3HPHA 3H9QA 1PJRA 2WAQA 2VIXA 3S3NA 4C2UA 4CSWA 2VXZA 3H5NA 5LFAA 2P0WA 4DBRA 2MFZA 3C2HA 2LREA 4KJZA 4YEJA 4F92B 1X1BA 3EUAA 4CZCA 3PSFA 1U0JA 3HXLA 1OLTA 3LL7A 3DKXA 4BJ5C 2F6CA 2X6XA 4CUGA 2R7UA 4QPQA 2KRCA 3CF2A 1X1DA 3GBGA 3DU5A 4RLQA 1YX3A 5CQEA 4AVZA 1DGWY 3RQ4A 4IX7A 2OUMA 3PNTA 3OY9A 3K70C 4Y4RA 3W3CA 1TT0A 1WJFA 3ZR8X 1E0EA 3OYMA 2BW3B 2X51A 4NC7A 1K6YA 4F55A 3K4LA 1LVKA 2HQAA 4DGWB 2LBFB 3CP8A 2VQGA 4OWRB 3EPZA 3OYNA 4H4KC 3AL0C 2IGMA 4BEHA 3G2BA 2M4KA 2M0MA 4PJNA 4XN3A 4RM2A 1D1BA 1V5FA 4MLOA 1WJCA 2R4GA 4XKBA 3N05A 3HPGA 2R7VA 3H5RA 3ZRGA 3RTRA 2IS6A 3LSGA 1SFKA 2KLOA 4PSXA 4U87A 2W00A 1X1CA 3W2VA 4LIVA 1MW7A 3DQVC 3PUBA 1YE9A 4R79A 4XLEA 1D0YA 1QHHD 2DOAA 2NOJB 4KT6A 2XF5A 3LSHA 2E1MB 4B43A 4DOZA 3SYTA 3OMYA 4C30A 2XF7A 3TMOA 2LY2A 3S3OA 3OYKA 2W7NA 4ANJA 3UNGC 1J09A 2GOMA 2MYSA 2V1NA 3IAM2 1N75A 3VYRB 4E7KA 3IAS2 4BDYA 3NWSA 4RLFA 1DQUA 4NNJA 3U21A 3L2WA 4QPOA 2CS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJT A;  3K6G A;  4BJ6 C;  3CZ6 A;  3OWT A;  4BJ5 C; 
#chains in the Genus database with same CATH topology
 4WX9 A;  1BR2 A;  3NAU A;  4XOP A;  3L2U A;  4EV0 A;  2IRF G;  3Q5F A;  4XLC A;  3HRT A;  4HBL A;  2RNJ A;  3NRV A;  3VSK A;  3F6O A;  3VYS B;  5IT3 A;  5TIS C;  2EIJ H;  4GXO A;  3ZQ7 A;  1ZN2 A;  3CCJ I;  4U0W A;  4ZDO A;  3AG3 H;  4JP0 A;  4A12 A;  1FBS A;  3OYA A;  3V7C A;  4MQ9 F;  1GV5 A;  4LLG F;  4IOA F;  1MMD A;  1ETY A;  4L9V A;  1W7P A;  2H1L A;  1B6A A;  3GTQ J;  2ECB A;  1BBY A;  3E5Q A;  2DYR H;  2A6H F;  2D2W A;  2WB1 A;  3SQN A;  5HNF A;  3FZV A;  4MFD A;  1R23 A;  4L0Z B;  1VQ5 I;  4P96 A;  4CCO A;  5L3E A;  2JSP A;  3BZC A;  2GA1 A;  2K27 A;  4A3F J;  2WA0 A;  1X3W B;  3I56 I;  3DBL B;  3KLO A;  1IRG A;  2DO7 A;  2GXG A;  2K9M A;  2RC4 A;  1U9N A;  4ZTJ A;  3RQI A;  2VQH A;  1U2W A;  1Y56 A;  2XHK A;  4MHG A;  1PYV A;  5CYV A;  4CA0 A;  2Z5U A;  3LAP A;  4CCL A;  4EQQ A;  3I4N J;  1BOB A;  2P7C B;  2O6G E;  5C4X J;  3GLL A;  3I59 A;  1LQ1 A;  3DU6 A;  5HLH A;  4MFE A;  4LJZ F;  4UY8 I;  2JA6 J;  1FOX A;  1WJE A;  4NQW A;  1S5L C;  3G3Z A;  2XSJ C;  4LK0 F;  5C44 J;  5IP9 J;  1M1E B;  2YS9 A;  1QRY A;  3H1C A;  4BAY A;  3CES A;  3S16 J;  3K10 A;  1GVJ A;  2QQ8 A;  4B47 A;  3G1L A;  1HW1 A;  1P7I A;  2F4O B;  2KL4 A;  2XSD C;  2EJR A;  1RKW A;  4YFN F;  1FT9 A;  1OQY A;  4PJM A;  3SZT A;  3IV5 A;  3M1C A;  2CQN A;  4IPA A;  1LKX A;  4G7O F;  1YQA A;  4HW0 A;  1R49 A;  5BPI A;  4KMF A;  3MFK A;  3BR5 A;  4PFP A;  2ELK A;  3A03 A;  1X1P A;  3CTA A;  3BTI A;  1ETK A;  4Z6Y A;  2J5O A;  2DOF A;  2ZFW A;  2DMT A;  2HS5 A;  4A3B J;  2X9D A;  3ONQ A;  2O7O A;  5E20 A;  3RKY A;  1WQ2 A;  2ZXW H;  1YLF A;  4EEF G;  1MBE A;  3HKZ N;  2HNH A;  3MZH A;  5EZH A;  2MH2 A;  4M3E A;  5FRM A;  1ZYR F;  4KA4 A;  2CFO A;  2EIN H;  4LIT A;  2MBF A;  5L3G A;  3BZ6 A;  1MMN A;  1WJB A;  4XM3 A;  1U5T C;  5CVU A;  2HPI A;  4MQV A;  3RDI A;  3RYP A;  2WAE A;  3JAM K;  2IA2 A;  2XB5 A;  3I5U A;  3TQN A;  1TNT A;  3HHG A;  3CCY A;  4UUV A;  1BJA A;  2VKE A;  5D8L B;  3BWG A;  4KN4 X;  3LWF A;  2E60 A;  3BG6 A;  3OOU A;  2DT6 A;  1W4M A;  1NG6 A;  3I64 A;  2V1D A;  1V54 H;  4MO7 A;  1JUS A;  5B5E C;  1TW3 A;  1MKM A;  1F9N A;  1LDJ A;  2FOW A;  2Z16 A;  3S8P A;  3AAF A;  2JSC A;  4Q48 A;  5LEJ A;  2LKP A;  4FCY A;  1XSV A;  3MD2 A;  4C3I J;  2AXL A;  1UCR A;  4DYR A;  1P2F A;  3FKJ A;  1MMG A;  2BY2 A;  2R7Q A;  2K9S A;  4KDP A;  3H36 A;  4IXA A;  1SFX A;  2IBD A;  2HU9 A;  4I99 C;  5HOO A;  4DYQ A;  1TQI A;  3PNV A;  5TRD A;  3GTJ J;  2TDX A;  3OR2 C;  2OCC H;  1V4R A;  4RDU A;  1SAX A;  4GDF A;  1TWG J;  2WWY A;  3CC7 I;  1MDM B;  2ISZ A;  2AQF A;  4CDG A;  4RA2 A;  2W57 A;  2E2H J;  2H8W A;  4MTE A;  4RB1 A;  4G6D A;  2X1E A;  1HOM A;  4BE0 A;  1Z05 A;  3FK6 A;  3TOB A;  3FBN B;  3LAJ A;  3CUQ C;  2IXS A;  3HTU A;  3GWZ A;  2L5Q A;  3OSF A;  1J2X A;  2W1O A;  3PQK A;  3CJT B;  1I1S A;  1VZ0 A;  3J80 K;  2ID6 A;  3COA C;  3JSP A;  2FOK A;  1A36 A;  4RGU A;  4EMS A;  4L5E A;  2TRT A;  4F7Z A;  2XAH A;  2L4A A;  2H94 A;  2P6S A;  1MNE A;  3VYT B;  3LSJ A;  4M74 A;  1D0Z A;  5J40 A;  1ON2 A;  1XCB A;  4M9S A;  5JFR A;  3ELK A;  2ZME B;  3H35 A;  4UV8 A;  4A2U A;  4A5N A;  5B1B H;  4A3L J;  3BR3 A;  2B7E A;  3FXU A;  3IP4 B;  4E7S A;  3CCS I;  4C3J J;  3LQR A;  4CCN A;  3ISP A;  4M3G A;  4CCM A;  4L0Y B;  3WHC A;  1I27 A;  4PFO A;  2I8D A;  2HZT A;  2K40 A;  3CF5 F;  4KMU X;  2V6E A;  1W5C C;  1E17 A;  3W6V A;  1R9T J;  3GTL J;  4D5C A;  3IWF A;  1HSJ A;  3GEZ A;  4BJT A;  2BXY A;  1W36 D;  3FHZ A;  1LFP A;  2Y69 H;  3ECO A;  3S1M J;  1G4D A;  1FSE A;  2CV1 A;  1K6O A;  5ILV A;  1LFU P;  2X1C A;  1B1B A;  2BV6 A;  2HFH A;  3K4B A;  3BC8 A;  3OL3 A;  3M8J A;  2NNN A;  2HYG D;  2QQ9 A;  3ZQC A;  3F8M A;  4CIC A;  3S1N J;  1RZ4 A;  4O5V A;  1QGP A;  4B4C A;  2LDU A;  4AU7 A;  1JKP C;  1BL0 A;  3EYY A;  4XK4 A;  3MZ8 A;  4LIU A;  3VWB A;  2UZK A;  4EAT A;  4ENK A;  1RIO H;  2VQL A;  5IT9 Z;  5F1J A;  3MAJ A;  2PQ8 A;  1TL8 A;  2NVY J;  1K4S A;  2DOD A;  2WY7 Q;  4HST A;  4N4O B;  2M30 A;  4FTH A;  2BGC A;  2WV0 A;  3K4N A;  3OYE A;  2PJR B;  2XKO A;  2BVL A;  3DWL E;  3HIF A;  2X0L A;  3OSG A;  3JRC A;  2E19 A;  1XMA A;  3HSE A;  4BH9 A;  1S72 I;  3RJP A;  1IAW A;  4KYW A;  4D9J A;  1XN7 A;  4W97 A;  1VQ8 I;  3BQY A;  2H09 A;  1IGN A;  1EA3 A;  3H0G J;  3P9C A;  2DYS H;  4ON0 A;  1XCV A;  4JX6 A;  2Y31 A;  2CG4 A;  5KVR A;  5TGT A;  4UNO A;  3IH4 A;  2G9W A;  3CJQ B;  3DBR B;  1SFE A;  1KU3 A;  4HPQ A;  5GP9 A;  2HQ5 A;  3M7G A;  3L2R A;  2ZJ2 A;  3WOD F;  4G9Y A;  4D7N A;  1VI0 A;  1SVM A;  3HG9 A;  2CJJ A;  4I09 A;  3S93 A;  4S04 A;  3D1N I;  2ZC2 A;  2EK5 A;  4X1E A;  2P81 A;  2CUJ A;  1K78 A;  3ZP5 A;  5F27 A;  1XSX A;  4ZC3 A;  3GUD A;  4P9F A;  2OTL I;  4CO8 A;  1UST A;  3HDD A;  4OMY A;  1MND A;  1IXS B;  4AYB N;  3E3V A;  1RR7 A;  1W5S A;  2XIG A;  4ZJZ A;  5C4J J;  4HQE A;  2HVS A;  1S3J A;  2COM A;  2EZK A;  2XRL A;  2R7Z J;  3RZO J;  3I53 A;  2ZNY A;  1DDN A;  1K7A A;  3V7R A;  2QSG X;  5IYC J;  3J7A O;  3K6G A;  2H1K A;  4ZYD A;  1UMQ A;  3GFM A;  1STZ A;  2JUC A;  2BZT A;  2IP2 A;  1ETX A;  5LD2 C;  2QZ8 A;  3TP3 A;  3E1S A;  1FBQ A;  5E3L A;  4BEH B;  1Z9C A;  3I54 A;  4A0X A;  3DPT A;  1TWF J;  3FXJ A;  3QAH A;  5EG0 A;  3HL2 A;  3BR1 A;  4PJJ A;  5DV5 A;  3LSK A;  2DU9 A;  3OYL A;  3W2A A;  1Y0N A;  2X1D A;  1N78 A;  5FKO A;  2MD5 A;  3C3W A;  3GVA A;  5EYR A;  1T8I A;  3VFZ A;  3A02 A;  5J3L A;  1ZG1 A;  1DP7 P;  1L0O C;  3H9Q A;  1A04 A;  3TW7 A;  1W0U A;  3H5N A;  2VOD A;  5LFA A;  4BBS J;  2ZB9 A;  2L7F P;  2LRE A;  4KJZ A;  4YEJ A;  2LTP A;  1QPM A;  1X1B A;  3EUA A;  1OLT A;  3F23 A;  4XRS A;  4BJ5 C;  2Z33 A;  3GZ5 A;  2N8G A;  2BEO A;  1JGS A;  3KYD B;  3DV8 A;  3RI4 A;  1IZ1 A;  1BI1 A;  4XRF A;  1YX3 A;  5CQE A;  3HOW J;  1S7O A;  1DGW Y;  4ESJ A;  3OY9 A;  3GFJ A;  3GTO J;  1TT0 A;  3ZR8 X;  4M72 A;  1YFH A;  2KKO A;  3T8R A;  4IHX A;  2BW3 B;  4LGW A;  3D0S A;  3SDG A;  4NC7 A;  1R71 A;  2PX9 A;  1LVK A;  2VE8 A;  2KRF A;  1FEX A;  2LK2 A;  4RGR A;  2LBF B;  2HOT A;  3DCF A;  4BXX J;  3MKL A;  2EPF A;  2E7X A;  1KA8 A;  2JPC A;  3OYN A;  1LB2 A;  3HRM A;  3AG4 H;  4A3M J;  1P4X A;  2M4K A;  2QQB A;  4FT8 A;  5CVR A;  1NK2 P;  2EV6 A;  1JKO C;  2DT5 A;  3ZMD A;  4YFK F;  3N4M A;  5DUK A;  1A6Q A;  5IY5 H;  5ED4 A;  2Q2E A;  1D1B A;  4MLO A;  1WJC A;  3ASO H;  2R7V A;  4Y15 A;  2FBH A;  3LSG A;  3Q3S A;  1B8I B;  2BYV E;  4ABZ A;  4DZJ A;  1T2K A;  4U87 A;  4BHB A;  1O4X A;  3W2V A;  4LIV A;  4EGZ A;  4HF0 A;  3PUB A;  3ZMT A;  1KU2 A;  4M6X A;  3JRH A;  3S14 J;  2DMU A;  4I6Z A;  1RR8 C;  2DOA A;  2E71 A;  3F21 A;  1FP2 A;  3BTC A;  2W25 A;  4KT6 A;  4B43 A;  4EM0 B;  1USS A;  3K2A A;  2FA5 A;  3S3O A;  4QLC U;  3L1P A;  2ECC A;  3M3Y J;  1BOA A;  2GOM A;  2V1N A;  3IAM 2;  1I6H J;  2HR3 A;  4BDY A;  3NWS A;  5L3F A;  4NNJ A;  1FWZ A;  1ZG3 A;  4DW6 A;  1YJN I;  5M5Y J;  2DQR A;  3UKG A;  2CS3 A;  2DTR A;  2DFH A;  3JAM Z;  5ILS A;  4BQA A;  1MBF A;  1KQ8 A;  2VPL A;  1D5V A;  5J8F A;  2HKO A;  4OIQ F;  1D3Y A;  2Y9Y A;  2P5L C;  4K2E A;  3IH2 A;  4ZZD A;  4X0G A;  4LMY A;  1V3F A;  1KZH A;  4KNY A;  3DPL C;  3CC2 I;  4E6K G;  3A2K A;  2LYC A;  4B48 A;  1FIA A;  2AXT C;  1H9G A;  3H9J A;  4GO1 A;  1EF4 A;  2LR8 A;  3BLY A;  3OIQ A;  2COB A;  4JK1 X;  4ETS A;  2GIZ A;  2VJJ A;  1QQI A;  2W84 A;  2NAZ A;  1LDK B;  1X2M A;  2HZD A;  3WGI A;  2XPU A;  2NVT J;  4A3E J;  3RZD J;  3H9G A;  2JT1 A;  4Y17 A;  3TO9 A;  5H2F C;  5LBQ A;  2BBY A;  2PFB A;  3B73 A;  3PFI A;  4DJA A;  2F4I A;  1IW7 F;  3EUK L;  1T0F C;  1OCP A;  3S2H J;  2M8E A;  1IN6 A;  2XB0 X;  5HOD A;  1TC3 C;  4HYE A;  3O6B B;  3J7Z I;  3EDP A;  2ACJ A;  2IS2 A;  3HSR A;  1Q1V A;  3BTL A;  2JVH A;  2CYY A;  1XGO A;  5KCM A;  5IYB J;  2RDP A;  2DLL A;  2O0Y A;  3BG5 A;  3HTS B;  4WXD A;  3GTG J;  3HJE A;  3N97 A;  1Y6I A;  1R5H A;  4NUB A;  4ZDL A;  4WXC A;  2EFN A;  5J4V A;  2R5Y A;  1MSE C;  4XN0 A;  5JVT A;  4HRI A;  2CV0 A;  3Q0U A;  3OS2 A;  3WTY C;  2M1B A;  2BY1 A;  2E2I J;  5GPC A;  1UEL B;  3ZCO A;  3VSL A;  1X19 A;  5LHG A;  1D1A A;  3DP7 A;  2M7B A;  3OYH A;  3BJ6 A;  4UUT A;  2DK5 A;  3IWZ A;  3EYI A;  4V2F A;  4IKF A;  2CW7 A;  3BG9 A;  1ZR4 A;  2VKH A;  3S1R J;  1VQK I;  2K02 A;  1ONV A;  2QVO A;  4Q47 A;  3JR9 A;  1IV6 A;  1T0F A;  2AQE A;  1XB4 A;  2LKX A;  4A93 J;  2HXI A;  4BQQ A;  1NK3 P;  3BCB A;  2ZME A;  3Q0W A;  3DTE A;  3C7J A;  1E3H A;  3HC7 A;  3QOP A;  2Y48 A;  2HXO A;  2LBF A;  5K5Q A;  4U0Y A;  2UXX A;  2DFE A;  4L5J A;  1YW7 A;  1S6L A;  3KX2 A;  4YG2 F;  5M5X J;  3QPH A;  3R60 A;  3I9V 2;  1B4A A;  5F6F A;  5K7F A;  3F0C A;  1NH3 A;  2R5Z A;  2CW0 F;  3CZ6 A;  4YIR X;  3MVP A;  4BHC A;  3MKZ A;  4Q4Z F;  1U78 A;  5E79 C;  3GFI A;  2F48 A;  2QYO A;  1RKT A;  2C6Y A;  1Y1V J;  1HQC A;  2NOG A;  3TO6 A;  4PGG A;  3DEU A;  3HRS A;  2ESH A;  1SMT A;  1WI3 A;  4HOB A;  5CVI A;  4AD9 A;  1T56 A;  1GLN A;  3FHN A;  3HUG B;  2XUB A;  3V8J A;  5IP7 J;  4AIK A;  1Z3Y A;  2B63 J;  1ERD A;  3KP5 A;  1ZRE A;  1SVL A;  2IJL A;  1F1Z A;  4BAC A;  2L7Z A;  2CQX A;  1YI2 I;  1R58 A;  4UVB A;  4EM2 A;  4BS9 A;  2ZME C;  1DP3 A;  4AWX B;  3FM5 A;  5KHD A;  1HDD C;  2FNA A;  3L09 A;  3ZGK A;  2ZJR F;  3GF2 A;  1LE8 A;  1FC3 A;  1XX5 A;  4XOT A;  1GHC A;  5BS6 A;  3S1Q J;  4BU2 A;  2G0E A;  4LLN A;  3WTS C;  2O61 A;  3TDZ C;  3CCV I;  3KLN A;  3SEZ A;  2HQR A;  2OQR A;  1GXQ A;  3OYI A;  3K4K A;  2JK3 A;  2M2E A;  3B6C A;  4JBA A;  3O2P E;  2G7H A;  5C3E J;  1PUE E;  3PUF A;  1FSH A;  2P4W A;  2JMW A;  3HKZ A;  2EZH A;  4M6V A;  4XLP F;  1BR1 A;  4PK4 A;  2KDO A;  2WBM A;  2GAU A;  3C2B A;  3VOD A;  2IAI A;  1PDN C;  5E8I A;  1VQ4 I;  4IO9 F;  5GAG J;  4XIC A;  4PJ0 C;  4A6E A;  4J01 A;  3GYH X;  2QEN A;  1FYM A;  1OCO H;  3R0J A;  4G7H F;  2XGC A;  5HLG A;  4H0E A;  2VBZ A;  3LSP A;  2DA5 A;  2JN6 A;  1YW9 A;  2LNB A;  1JKR C;  3HHH A;  4MEX F;  1ETV A;  4IHW A;  4FX0 A;  2VAS A;  5FGM A;  4KT5 C;  2M3A A;  2HYF A;  2VBW A;  2CV2 A;  3A4C A;  4MTD A;  1B72 B;  4KIB A;  4A3I J;  4UXN A;  2XVC A;  2DDB A;  1MJ9 A;  5L3D A;  2LF8 A;  3J7A Y;  1V5E A;  1Z6T A;  2F2E A;  3OYB A;  1BW5 A;  4BE1 A;  2HTJ A;  3WTW C;  1DGR M;  1ZKG A;  1HKT A;  5H20 A;  1J5Y A;  1P4W A;  5LHH A;  2DK8 A;  4A69 C;  4HDU A;  1TBX A;  3F6V A;  4BDZ A;  1FX7 A;  2EIK H;  2PN6 A;  1LVA A;  3ZN1 A;  4BBR J;  1S8N A;  5J1U A;  2L4M A;  2VT2 A;  3X2Q H;  4RB3 C;  3KZY A;  4FX4 A;  1P92 A;  5CVJ A;  3HOT A;  2R7R A;  3PSI A;  5EGO A;  2L7K A;  2OC6 A;  1ZRF A;  4HAM A;  3FMQ A;  4IJA A;  4BHP A;  3BR6 A;  4XKC A;  1X4O A;  1A31 A;  1Y8Q B;  2PG4 A;  3DEW A;  1FYK A;  2UUZ A;  1G3T A;  4BXU A;  2ELJ A;  3ZN0 A;  1W36 C;  3J81 Z;  2E5N A;  5HNH A;  4B44 A;  1WFX A;  3FXR A;  3GW2 A;  3UR3 C;  3CJN A;  4A0Z A;  1WJA A;  1SFU A;  1DPR A;  1UHM A;  2Y0M A;  3ERE D;  3TED A;  4D1Q A;  1Z91 A;  1F4K A;  3CLQ A;  2FX0 A;  5J47 A;  1FJL A;  2JZY A;  2M45 A;  5ERI A;  3HOU J;  1XG1 A;  1EH6 A;  2R7T A;  2WAD A;  1VQM I;  3P7N A;  5BQT A;  1MBH A;  3JRG A;  2BE5 F;  5EEH A;  2E1N A;  1ZTR A;  2KRH A;  3ULQ B;  5LRS A;  2VOP A;  2L9V A;  2YX4 A;  2YU3 A;  1ZHF A;  1R4M B;  2OBP A;  2YR2 A;  4Y33 A;  1EH8 A;  2ZNZ A;  2NS0 A;  5LHI A;  1O3R A;  1L3L A;  4ZYA A;  2E2J J;  1OPC A;  4UB6 C;  1SAN A;  4D7M A;  5K5O A;  2E36 A;  3HGG A;  1FLI A;  3H92 A;  3I71 A;  3GFL A;  3KYL A;  3OYD A;  2LVS A;  2QCO A;  4B09 A;  1RUO A;  4II3 A;  4HF1 A;  1WPK A;  2ZJP F;  3AKZ A;  4YRV A;  1HA8 A;  3WU1 B;  1HBX G;  4NBQ A;  3SEQ A;  4GCV A;  2MAB A;  1ZAO A;  4EVI A;  3IUO A;  4EGY A;  1IC8 A;  4IHT A;  1IF1 A;  5BMZ A;  2MC4 A;  3KYC B;  2PBI A;  2YX7 A;  5E3O A;  2CW8 A;  4ZZL A;  5FRN A;  2E7W A;  3TKY A;  2L2O A;  3V4G A;  5GAD J;  3KCC A;  3CCE I;  2VC0 A;  1MSF C;  3ZQQ A;  1PP8 F;  1K79 A;  1B9M A;  2KZV A;  4CYC A;  2EFW A;  2MH9 A;  4KN7 X;  5D5W B;  3WU0 A;  4L9J A;  2DA1 A;  2E1C A;  1JKQ C;  4IHS A;  3I55 I;  2HDD A;  2D45 A;  2EIL H;  2MLK A;  2H27 A;  1KGS A;  3BJO A;  4I98 B;  2V9P A;  2EZI A;  2P8T A;  3KP3 A;  3TP0 A;  1N25 A;  3OR1 C;  2VJI A;  3HPH A;  1HW2 A;  2VIX A;  4ZYG A;  4C2U A;  2IT0 A;  2Y9Z A;  2P0W A;  1F5T A;  2MFZ A;  3C2H A;  3DFG A;  2YSR A;  4GYG A;  2A68 F;  5J8C A;  3CCL I;  5LRR A;  4D0P A;  5F0C A;  3PSF A;  3HXL A;  3RKQ A;  2QWW A;  1AOY A;  2R7U A;  2X6X A;  3GCM A;  2VBY A;  1UZC A;  1ZGA A;  1XDS A;  1HKS A;  3ZMS A;  3CF2 A;  1DU0 A;  5EGO B;  1KQ0 A;  4AVZ A;  3ZQL A;  3PNT A;  2Z9O A;  2R7D A;  2EFP A;  1H8A C;  1WVR A;  3HEF A;  1E0E A;  4RBO A;  1SD7 A;  1HKQ A;  2X51 A;  4F55 A;  5KAF C;  3I4P A;  3WHB A;  1R00 A;  4HZF A;  2FMY A;  2XPW A;  1H9T A;  1U6G A;  1W7P D;  3KP2 A;  2K9Q A;  1Z1D A;  4OWR B;  2L7M P;  3AL0 C;  2OA4 A;  2DTZ A;  1BI2 A;  1XGS A;  3HOZ J;  5EEG A;  1FZP B;  5ICF A;  2DA4 A;  4PJN A;  2WB1 N;  1XGM A;  4FQG A;  1Z6R A;  3WGH A;  5DS9 A;  4RM2 A;  1QA6 A;  3CC4 I;  2BHZ A;  3HOX J;  4NHJ A;  3H5R A;  2CQK A;  4GGG A;  1TWH J;  3RTR A;  2JPB A;  2BY3 A;  1SFK A;  1P6R A;  2NYX A;  3G4S I;  2W00 A;  4R1H A;  2QF7 A;  5E8G A;  2V1U A;  1MW7 A;  4IEJ A;  4R79 A;  1SFO J;  4RS8 A;  3PO3 J;  1D0Y A;  2CSO A;  3IRQ A;  3TO7 A;  2XF5 A;  2XRO A;  2E1M B;  4A3G J;  2EA2 A;  5J1Y A;  4PZJ A;  4DOZ A;  3MEX A;  2A3S A;  2STW A;  4ANJ A;  3JTG A;  1ZQ3 P;  4RAF A;  2JRT A;  4UVA A;  1N75 A;  1P4A A;  4RLF A;  4G8X A;  1B8I A;  3U21 A;  2KT0 A;  4A0Y A;  4XSX F;  4LG0 B;  4QPO A;  4EJU A;  1MBG A;  3LA2 A;  4ENJ A;  1VQP I;  9ANT A;  4QTR A;  5IP6 A;  3D5L A;  2Y30 A;  4E7L A;  4AID A;  2HDW A;  2O5R A;  2XPV A;  1MIJ A;  3L2V A;  1WJ5 A;  1GDT A;  2K4J A;  5LGT A;  1LE8 B;  3U1D A;  1GXP A;  3WGG A;  3QQA A;  2GOX B;  2DA2 A;  1WWX A;  2PMU A;  2BOL A;  2H6C A;  1FOY A;  2X48 A;  3NWT A;  2VC1 A;  3K69 A;  2DJI A;  1E3P A;  2BHY A;  3TW6 A;  4DNC A;  3GZN B;  3ZQI A;  2L9R A;  2W82 A;  5DD8 A;  3K1N A;  3DKW A;  3L2Q A;  5M3M J;  3CDI A;  3HBL A;  1IDY A;  4WXH A;  1P9Q C;  1RNL A;  3FXQ A;  3BG3 A;  4HX4 A;  2F5D A;  3NEU A;  3WTT C;  3GTM J;  1LEB A;  1FTZ A;  3E6M A;  2EIM H;  4IRI A;  2LC2 A;  4JQF A;  1E2X A;  2W48 A;  1A35 A;  3E5X A;  1ULY A;  4HNV A;  5HLT A;  3FIS A;  4BUP A;  2XGX A;  3J7Y J;  4I2O A;  4OAY A;  2A6E F;  3GXO A;  2L02 A;  3KZI C;  3BR2 A;  4GRI A;  4EJO A;  2L54 A;  3S17 J;  5HDG A;  4FE7 A;  1LUJ B;  3MZY A;  5DUI A;  3K0L A;  4G6Q A;  2OAZ A;  4HEA 2;  1MMA A;  2VBX A;  4GYI A;  1CF7 A;  1SC7 A;  3FMR A;  3BCA A;  3CUO A;  3CCR I;  2EFO A;  2E34 A;  2M7A A;  4LD5 A;  1OCT C;  1BW6 A;  2H6B A;  5BOX A;  3DLA A;  1QNT A;  3CP2 A;  3K7A J;  4HV6 A;  2ZBK A;  2HWV A;  3ERM A;  5E1W A;  1FMV A;  2KFD A;  3QYE A;  2VKD A;  2O8K A;  1HC8 A;  3DPU A;  2UWM A;  2ZXI A;  1HXD A;  2VB6 A;  1YOV B;  2WY8 Q;  2Z3Y A;  1SAU A;  2QLZ A;  5A2Q K;  4LFU A;  4ENN A;  4QSH A;  1MMS A;  4OAZ A;  3OS0 A;  3IRR A;  1WGX A;  3KFW X;  3M9A A;  2G7U A;  5E3N A;  3JRI A;  2E35 A;  2V6C A;  2B0L A;  2EB7 A;  4ZYH A;  1T95 A;  4XQF A;  3RPU A;  2F5F A;  1BC8 C;  2MSY A;  4C2T A;  4E7I A;  1IDZ A;  1FNN A;  1YRN A;  3P5J A;  1CGP A;  1T38 A;  1J0R A;  3JSO A;  2ZXJ A;  3G71 I;  3GTK J;  1W0T A;  3VEP A;  1J75 A;  1AHD P;  3SDB A;  2PJP A;  3VB2 A;  3K2Z A;  2DFI A;  2ME0 A;  1G2H A;  1WRJ A;  3HB9 A;  4J19 A;  4CCK A;  4HG2 A;  3ABL H;  4U7B A;  1YTY A;  1R36 A;  5FO5 A;  2W24 A;  3CLO A;  3O8H A;  1VQ6 I;  1OKR A;  1EH7 A;  2L3D A;  4R8H A;  2IPQ X;  2FE3 A;  2XAU A;  2JUG A;  4G6T B;  1J59 A;  1R1T A;  3BOQ A;  4JYK A;  4PJL A;  2DOE A;  1IN5 A;  2F5V A;  3DTI A;  4NB5 A;  1G3Y A;  4AUX A;  4IQ4 A;  3I4M J;  2PI0 A;  1XSD A;  1TQP A;  1D1C A;  4NQW B;  3KZZ A;  2E5Z A;  4IOC F;  2Y2Z A;  3E0J B;  1JUP A;  2Q2E B;  2P5V A;  2A5Y B;  1R1V A;  3OIP A;  3EQL F;  5D6F A;  4FIS A;  1WJD A;  4XSZ F;  4G7Z F;  3S15 J;  2ESN A;  2ZKZ A;  2NVQ J;  1V55 H;  3TL4 X;  5B3S H;  2E1M C;  3E6B A;  4IL6 C;  2XF6 A;  5B66 C;  2CQ7 A;  2L9S A;  3G6E I;  3P9I A;  1R6R A;  1J7K A;  1ETO A;  4P1W A;  3GTP J;  1HLV A;  5FKL A;  4E7J A;  4ITV A;  3QP6 A;  1W7P B;  4BQO A;  1D8K A;  2IA0 A;  2K86 A;  1RI7 A;  2O03 A;  2VN2 A;  2MA3 A;  3KIO A;  3QPS A;  4PDK A;  4PSW A;  4UV9 A;  4XR6 A;  2STT A;  2VKV A;  5EF6 A;  3KP6 A;  3RKW A;  1YO5 C;  2DMQ A;  4Y3O A;  4ASN A;  5FB2 A;  2R7X A;  2M8G X;  4BL0 B;  3FMS A;  3WTZ A;  2O9L A;  2KMU A;  1S29 A;  3O8G A;  4I7H A;  3VDX A;  1JJ6 C;  2Z2S B;  3FDY A;  3AL0 B;  2D5V A;  2A61 A;  1SVO A;  3PQJ A;  3CD6 I;  5FKM A;  3CCM I;  2CGP A;  5D4S A;  1JHH A;  4E70 A;  3F22 A;  4YFX F;  3BP8 A;  1QZE A;  2JWT A;  2L0K A;  3U9G A;  2CU7 A;  1BIB A;  1OCR H;  2BY0 A;  1MJA A;  3F8F A;  2IS4 A;  4O6J A;  1Z7L A;  3L00 A;  3IC7 A;  1VQL I;  3S2D J;  5FKN A;  1DUX C;  3CJR B;  3CME I;  5FD5 A;  2K3P A;  1X58 A;  3TDU C;  4ESB A;  4IHY A;  3HZJ A;  1XD7 A;  2K9N A;  3DBH B;  4HLX A;  2AS5 F;  1Y39 A;  1Z7U A;  3E5U A;  5FFZ A;  1Z3X A;  3ASN H;  1U9O A;  2GA2 A;  2ELH A;  3OOP A;  3HRU A;  5LEK A;  2BVM A;  2FU4 A;  4IHV A;  2JTV A;  1OR7 C;  5BNG A;  5LGU A;  5LLQ A;  3LST A;  2ZXH A;  2Q8K A;  2CFX A;  3WG7 H;  4EM1 A;  1SEU A;  1IRX A;  3JRD A;  2HVQ A;  5E17 F;  4L9N A;  2WAF A;  5IOZ A;  3K4C A;  4IVN A;  4RAG A;  2HDC A;  2R5Y B;  1ENH A;  4KIC A;  4C2M J;  3FXL A;  4OIN F;  1UAA A;  1R5I D;  4M9Z A;  1JTY A;  1X3Z B;  5ICC A;  2LMD A;  2RVC A;  2EV5 A;  2OD5 A;  5EDN A;  1OIS A;  3QYF A;  3CDH A;  1R7J A;  2H8R A;  3V8L A;  1HF0 A;  3ABU A;  1K78 B;  2E1O A;  1G8X A;  2Q1Z B;  5DDG A;  1AWC A;  3CUQ A;  4ZTF A;  5HDK A;  5IYD J;  1XC5 A;  2ETH A;  1X1A A;  2ICW G;  4BGD A;  2GXA A;  3K1P A;  2CH0 A;  2Y0S A;  4ENM A;  4Y13 A;  1BC7 C;  2A69 F;  2K85 A;  4YEL A;  1CQT A;  1QZZ A;  2CUZ A;  1YG2 A;  3NAR A;  1T39 A;  2KIQ A;  2JA7 J;  4U7D A;  4OIP F;  2LY1 A;  1X2N A;  2CUE A;  1WHU A;  4DBQ A;  5DCM B;  5GPA A;  4RB2 C;  5J6X A;  2L9N A;  2QBY B;  3I3L A;  5D5V B;  3PJR A;  5D5X B;  3ZMU A;  4BQN A;  4RMN A;  1ETQ A;  2V7F A;  1TTY A;  3C2G A;  4CYD A;  1Z0X A;  4BKX A;  4XBF A;  2HPM A;  1IRF A;  3ZQH A;  1G3S A;  3SFI A;  2JA8 J;  1LDD A;  1Y8R B;  2M4G A;  2VXD A;  1FBU A;  1D8J A;  1QPI A;  1MBJ A;  3F8C A;  2HOA A;  4A3J J;  1BN5 A;  2FBK A;  2W4S A;  4XNF A;  1LNW A;  5H6R A;  2LG4 A;  1I5Z A;  3QPL A;  3S3M A;  1S7A A;  2WTE A;  4CHU A;  2XAG A;  1MJB A;  1YIO A;  3FWE A;  1TW2 A;  2XAF A;  4B3X A;  2A5W A;  4IF4 A;  2LKS A;  2XC7 A;  1BI3 A;  2KIS A;  3FXO A;  4M6Y A;  3H0D A;  1ZLJ A;  1RRJ A;  1RC9 A;  2KIF A;  1U5T A;  3GME A;  3KP7 A;  3ECH A;  4RAZ A;  2M5W A;  3ABM H;  4I0A A;  3QPT A;  3H3V K;  1KU9 A;  2M0C A;  4RB0 A;  4AM3 A;  3IL2 A;  2OJE D;  4XKV A;  3LOC A;  2QM3 A;  4HA8 A;  2O8X A;  4M71 A;  3ZOB A;  5FLX K;  2IA1 A;  3D5S C;  4BYY A;  3PNY A;  3LMM A;  3T1B A;  5E1Z B;  3EUH C;  2CWE A;  1DU6 A;  3ABK H;  2OPT A;  2VOO A;  1S9H A;  1JTX A;  2VI6 A;  1TLH B;  1ODD A;  1R4N B;  2DQL A;  4F91 B;  4P55 A;  3IKV A;  2XRN A;  3QP5 A;  5F04 A;  2VE9 A;  1NG7 A;  3PFY A;  1BA5 A;  2EBI A;  1U8B A;  4XOR A;  2KJB A;  1ORK A;  4M9X A;  1KON A;  1EKE A;  4LOC A;  1LFB A;  3PM1 A;  1YS6 A;  2RQQ A;  3R4K A;  3OWT A;  3QYB A;  1SD6 A;  4PUS A;  4BY7 J;  2R7W A;  2PLY A;  3PO2 J;  3L7W A;  2DA6 A;  3MQ0 A;  1H89 C;  3L9F A;  4CGZ A;  1JXS A;  4HV5 A;  1PUF B;  4QWQ A;  1CF7 B;  2PJR A;  1AKH A;  2VJ4 A;  1XS9 A;  3LSI A;  3T5X A;  1OYY A;  4DIQ A;  1PJR A;  2WAQ A;  2HOS A;  4OIR F;  3SXY A;  4V2G A;  4CSW A;  2DPD A;  1C0W A;  3W6J B;  4UHT A;  2OTJ I;  1WCM J;  4N9H A;  1GUU A;  2NXN B;  3HOV J;  3LL7 A;  2MLG A;  3DXJ F;  3DKX A;  4KFC A;  1IUF A;  4B3A A;  4DZP A;  5LGN A;  2DMN A;  1IV8 A;  2KRC A;  4C3H J;  3E6C C;  2YPR A;  5IOY A;  1I1G A;  2VPR A;  4HQM A;  4IX7 A;  2X6O A;  3K70 C;  4Y4R A;  3FIW A;  2XKP A;  5DYM A;  3W3C A;  4P9U A;  1IUY A;  3E7L A;  3FM3 A;  4ESF A;  4CYC B;  3PIP F;  2GWR A;  3BY6 A;  1K6Y A;  3KEQ A;  2HQA A;  4DGW B;  2Y75 A;  5M5W J;  3JRE A;  2HEO A;  1UB9 A;  3JCU C;  3CP8 A;  2VQG A;  3KP4 A;  2IGM A;  4BEH A;  3O3K A;  1REP C;  1ZRC A;  5EJC A;  2HGC A;  2Y0S N;  1RUN A;  1IG7 A;  1LEA A;  1YIJ I;  2XAJ A;  2PEX A;  1E3O C;  1VQN I;  2R4G A;  1FOW A;  3N05 A;  1QZY A;  3R61 A;  2IS6 A;  4JX5 A;  1OYI A;  5F08 A;  1X1C A;  2CO5 A;  4I02 A;  3DQV C;  5J4Y A;  1GV2 A;  3FXK A;  1QHH D;  1Y1W J;  3BPV A;  5F0H A;  1XTA A;  2PMH A;  5J1R A;  3LSH A;  2JQ7 A;  3LA3 A;  5IT9 K;  3SYT A;  4C30 A;  2XF7 A;  5A2Q Z;  3V8K A;  2RKH A;  1HST A;  2XGE A;  1J09 A;  3UNG C;  2MYS A;  4D5F A;  3F8N A;  5HDN A;  4BY1 J;  3SFZ A;  1KQ9 A;  2XAQ A;  4WCG A;  1S7E A;  1DQU A;  1FP1 D;  1FPQ A;  3L2W A;  3LFK A;  4CZZ A;  2B9S A;  3K9T A;  2DW4 A;  1IN7 A;  4BXF A;  1LPQ A;  1RET A;  3ESW B;  1HW5 A;  4FET A;  3RKX A;  4Q5S F;  1TZL A;  1UG2 A;  4M3F A;  1FTT A;  2M87 A;  3ZXS A;  3A1Y A;  1WH5 A;  2A07 F;  1ZG5 A;  2ME6 A;  5D4R A;  4A3D J;  1N77 A;  4XLF A;  1BM9 A;  2A6T A;  3F3X A;  3WE3 A;  5JI6 A;  1PVE A;  1UHW A;  3FBI B;  1J9I A;  2QUF A;  4RGX A;  4YII A;  4LB5 A;  4B8X A;  2RQP A;  1TWC J;  4HX8 A;  1WZ2 A;  2FRH A;  1K61 A;  1IXC A;  5CJ9 A;  2CUF A;  4XKW A;  5L3B A;  5HS7 A;  5GTI C;  3HGY A;  2FQ4 A;  1I6X A;  2ADU A;  3IHU A;  5H6Q A;  4E4H A;  5L3C A;  3WU2 C;  1RES A;  3H3Z A;  2L01 A;  2KZG A;  1XDU A;  1MZB A;  4OU0 A;  3F9K A;  1K83 J;  4KIS A;  1ZK8 A;  1QU3 A;  5CQG A;  1G6N A;  2VQC A;  2X4H A;  1ETW A;  4I76 A;  4AIH A;  4A5M A;  3MKW B;  1O7L A;  1YS7 A;  3MWM A;  2I5U A;  1OJL A;  1ACI A;  1B9N A;  2DA7 A;  5ICG A;  4LG3 A;  4M73 A;  4LB6 B;  2DXI A;  2R93 J;  1GVD A;  2D1H A;  3WE2 A;  5CLS A;  3MN2 A;  4JOM A;  1ZEL A;  1MD0 A;  4P5O A;  2RAE A;  1T08 B;  1BJZ A;  5KNL A;  3QU6 A;  2LRD A;  2EZL A;  1RPW A;  4CXF A;  1AU7 A;  2OCE A;  5GTH C;  5JHF A;  3OV8 A;  2EWN A;  2K5C A;  5CKT A;  4IRH A;  2HQN A;  3K1M A;  3HUG A;  3D5R C;  4BE2 A;  2RGV A;  2FF4 A;  1BI0 A;  3F8B A;  5JR3 A;  3HOS A;  1I39 A;  1FMW A;  2LF7 A;  3TGN A;  4FHT A;  3GX4 X;  5D8K B;  3R0A A;  3GLX A;  4A3C J;  1T98 A;  2D1V A;  2Z1D A;  5JLX A;  3G1O A;  5ILU A;  1EJ9 A;  1JT0 A;  1ON1 A;  3MMY B;  4N4N B;  4Z2Y A;  4HSR A;  4N0B A;  1FIP A;  1YYV A;  4U88 A;  2JA5 J;  2X85 A;  1SMY F;  3KEY A;  1IXR C;  3C18 A;  2JA2 A;  3U1K A;  3AG2 H;  5DTD A;  3CQZ J;  2QQA A;  4DQ2 A;  5E1X A;  2P5K A;  1I50 J;  3F72 A;  4XLH A;  1YJ9 I;  1U8R A;  2ZCW A;  2R7F A;  1QBJ A;  3E6D A;  2WC2 A;  3JW4 A;  3GZ6 A;  3VPR A;  1VQ9 I;  5DEQ A;  1BR4 A;  3SZG A;  3Q9V A;  4U0V A;  3DKY A;  5FLM J;  2GBY A;  3OYG A;  2NRA C;  1HCR A;  4RM3 A;  1I3Q J;  2Q0O A;  2V26 A;  3I59 B;  3OYJ A;  1MDM A;  3HOY J;  2M34 A;  3M1E A;  3CCQ I;  1TNS A;  2K4B A;  3W2W A;  2RN7 A;  2R0Q C;  1U5T B;  3PL8 A;  3AFH A;  4NC8 A;  4S05 A;  3K70 D;  2AHQ A;  3A01 B;  3CO7 C;  3K4M A;  5E18 F;  5CVV A;  3BJA A;  1IO2 A;  2VT3 A;  4L18 B;  3AG1 H;  1XMX A;  4AC0 A;  5BPD A;  4II2 A;  1H0M A;  3HYI A;  3S2W A;  3DEE A;  2W85 A;  3JRB A;  1VFC A;  3EUH A;  3A0B C;  2OZ6 A;  2DI3 A;  1MH3 A;  3CDL A;  1V5G A;  3T8T A;  2F5E A;  3EET A;  5GAE J;  1UG0 A;  2J5P A;  2V1X A;  1OCZ H;  3CMM A;  3JRF A;  1KYW A;  2IEK A;  3VYU B;  2OU2 A;  4NC6 A;  3ZQF A;  1AKH B;  3BZK A;  4FE4 A;  3CO6 C;  1JE8 A;  2UV1 A;  2XGD A;  4ZH4 F;  3C1D A;  2JVG A;  4WF2 A;  1ZGJ A;  1MGT A;  4EJV A;  3K4J A;  2ZSI B;  1O57 A;  1OR7 A;  3CCU I;  2PMZ A;  4GFB A;  4G94 A;  1F36 A;  1OCC H;  1W1W E;  3KE2 A;  4KIG A;  2GLO A;  1XMK A;  3JTH A;  1F43 A;  2LP0 A;  3RPU D;  1JT6 A;  2DCE A;  2I10 A;  3QU3 A;  3LSM A;  1PUF A;  1YX5 A;  2QKM B;  5DCF A;  5TJJ A;  3WTX C;  4HF2 A;  4F3Q A;  1GT0 C;  1NTC A;  5HLI A;  1BIA A;  2K3F A;  4J00 A;  3PIO F;  2VL8 A;  4CH7 A;  2VON A;  3J80 Z;  1B72 A;  1K4T A;  4HNT A;  1EV7 A;  3ABT A;  4IRG A;  5M3F J;  3FKI J;  2EV0 A;  1YJW I;  4JX4 A;  2P7V B;  2OF7 A;  3H3U A;  5KK1 A;  2IGN A;  3RSN A;  5KAI C;  2MGQ A;  1IRZ A;  3I0T A;  3M8E A;  1HDP A;  2NVU B;  2FUG 2;  4XMY A;  2ID3 A;  4MNU A;  5K5R A;  2OV7 A;  2WV1 A;  2ZO4 A;  2DT7 B;  4FAS D;  1IJW C;  1T6S A;  2EA4 A;  1APL C;  1DPU A;  3A0H C;  4ZDP A;  5GAH J;  2HI3 A;  1JI8 A;  1Z77 A;  2FSW A;  1ZLK A;  4XRM A;  4Y7N J;  2GQQ A;  3MCZ A;  2V4J C;  2IGK A;  1ZRD A;  3V42 A;  2QKL B;  3T0Y A;  1R22 A;  4IZZ A;  1JHF A;  3M8F A;  4LLL A;  3RPQ A;  4A6D A;  2RNG A;  2MW8 A;  4QIW N;  2NNY A;  1VQ7 I;  2IS1 A;  3DLL F;  2NVX J;  2OZU A;  3RCO A;  2CQQ A;  2YU9 J;  1X3U A;  2IVM A;  3KET A;  1MBK A;  2VJ5 A;  4LK1 F;  3ZQG A;  2QEX I;  3CMA I;  2HKX A;  4TV7 A;  5FRO A;  1Y0U A;  2FD5 A;  4G12 A;  3L2C A;  2NS7 A;  1QO0 D;  1NHA A;  2RRE A;  1YHQ I;  2DAO A;  1R1U A;  3E97 A;  2ZSH B;  5D5U B;  4UVC A;  1UFM A;  2LD5 A;  2KHM A;  2DJN A;  2MG4 A;  1ZH5 A;  2BW3 A;  3TOA A;  2YUS A;  5IPA A;  2QBY A;  1TP4 A;  4KIT B;  3QOD A;  6PAX A;  4AYB A;  4E7H A;  2KP6 A;  5DCM A;  3OYC A;  1FYL A;  2KQR A;  2TCT A;  3OIO A;  4AIJ A;  2DN0 A;  2LSO A;  2P6T A;  3LFU A;  2ZJQ F;  1X4P A;  3BPX A;  5CPR B;  3LSR A;  1ITY A;  3DTK A;  4AVP A;  2QSF X;  3TBI A;  1D0X A;  1QHG A;  4CCJ A;  2HTS A;  1Z21 A;  1R5G A;  1OFC X;  1A6I A;  3M07 A;  4B1R A;  3CMY A;  4F93 B;  1AA7 A;  2VUM J;  2RV8 A;  1VTN C;  4V19 K;  1FY7 A;  4HNU A;  3ZMZ A;  4E7Z A;  2FJ1 A;  3FX3 A;  2HVR A;  1G3W A;  2LLK A;  5K1Y A;  2R92 J;  2M9H A;  2EFQ A;  1D5Y A;  1WKM A;  1I3A A;  1QVU A;  1A5J A;  1LJ9 A;  4I01 A;  1YW8 A;  4HX7 A;  5HVQ C;  4XON A;  4KUM A;  3Q9S A;  5K7H A;  3A01 A;  1POG A;  2K9L A;  2FQ3 A;  4MIM A;  5B1A H;  3B6A A;  3MKY B;  2XAS A;  1UHS A;  2DA3 A;  4MGR A;  3SZP A;  4OOI A;  3BT9 A;  3I58 A;  5FLV A;  1KYZ A;  1TWA J;  4C9Y A;  5FD6 A;  2HOE A;  2V9K A;  4XID A;  2X6Y A;  3V7S A;  1B59 A;  1IN4 A;  4BJ6 C;  2LFB A;  3BRO A;  1UJ8 A;  3BG7 A;  2R5Z B;  3BR0 A;  1G59 A;  5DM7 F;  3P9K A;  3ML6 A;  5FLX Z;  1JUM A;  2LOO A;  4XLA A;  4RAY A;  2R7O A;  2R7S A;  3LA7 A;  2X6W A;  3QOE A;  5EG0 B;  1VQO I;  2FNP A;  2PMZ N;  5EZG A;  4X6A J;  5DD4 A;  2FEZ A;  1O3T A;  2LH9 A;  4YIF A;  2MD0 A;  4L5I A;  4PCQ A;  4UUS B;  4WK8 F;  2AO9 A;  4XL9 A;  2KJC A;  4IQJ A;  1XGN A;  1FOK A;  3OYF A;  2IGO A;  3OS1 A;  2KIM A;  2OQG A;  2HYJ A;  2R3S A;  2ZFU A;  5EEA A;  1VF9 A;  3B02 A;  3R6S A;  3U2R A;  2VLA A;  2MC3 A;  2XV4 S;  2K7L A;  1WSU A;  1Q1H A;  1U3E M;  3M4O J;  3OL4 A;  3W6K B;  3ZPL A;  3S32 A;  2JRM A;  2KPM A;  4EJW A;  4F52 A;  2CMP A;  3H5A A;  2XDV A;  5ICE A;  2QSH X;  3FK7 A;  5F64 A;  1JJ8 C;  3LNQ A;  2QA4 I;  4WWC A;  4A3K J;  4BNC A;  3G73 A;  2DDA A;  3DF8 A;  5F0F A;  3BQZ A;  4O3M A;  3HSF A;  4Y52 J;  4HDV A;  2BXZ A;  1WH7 A;  1MNM C;  3WTV C;  5AIQ A;  3S3N A;  2VXZ A;  5D6E A;  3SHF A;  4DBR A;  2CRG A;  1P7J A;  5K7Z A;  2GM4 A;  2UXN A;  4F92 B;  1TQM A;  4CZC A;  3Q0V A;  1U0J A;  4L9T A;  1O7F A;  2F6C A;  4CUG A;  4EJT A;  1OYW A;  5FFX A;  2F5C A;  4QPQ A;  4OMZ A;  1X1D A;  3GBG A;  5AON A;  3G1M A;  3DU5 A;  2FML A;  4RLQ A;  3FF5 A;  1YIT I;  1SD5 A;  3RQ4 A;  3RYR A;  2OUM A;  3VOE A;  2EQR A;  4XLN F;  1W5T A;  1KU7 A;  5DM6 F;  3QRF F;  1WJF A;  3WTU C;  3OYM A;  5FKK A;  2V79 A;  1ZAR A;  3BDD A;  3RIR A;  2KDZ A;  1ZGW A;  2DPU A;  4MEY F;  3K4L A;  2GZW A;  3LQQ A;  5HS9 A;  5HS8 A;  5FJ8 J;  2EH3 A;  3ZMV A;  4OIO F;  4I0B A;  1YRN B;  1Z67 A;  2DMP A;  4N9I A;  3CUQ B;  3QWL A;  1OMI A;  3EPZ A;  3ROU A;  4H4K C;  1QVT A;  3IKT A;  3G2B A;  3JRA A;  2GIV A;  1O3Q A;  3FXM A;  2M0M A;  4RGS A;  5JVG F;  3WG9 A;  4UB8 C;  2IW5 A;  1IN8 A;  3KEO A;  4HLY A;  4XN3 A;  2NS8 A;  5JLW A;  4ZYE A;  1PP7 U;  1SD4 A;  4XKB A;  1V5F A;  3HPG A;  5JHU A;  3ZRG A;  5F1R A;  2KLO A;  2DFF A;  4PSX A;  2F4M B;  3J81 K;  1XPX A;  4DYC A;  2JJ7 A;  5E3M A;  4XRS G;  3GO5 A;  1YE9 A;  4KIF A;  3KPH A;  1JGG A;  2QGU A;  1VND A;  4PGH A;  4XLE A;  2O3F A;  2NOJ B;  4UUS A;  2V9V A;  3SJM A;  3HM5 A;  4M3D A;  2WAQ N;  1O3S A;  5AIP A;  3REO A;  3OMY A;  3TMO A;  1T33 A;  2LY2 A;  3OYK A;  4LG0 A;  2W7N A;  3BTJ A;  4M3B A;  2LY9 A;  2A05 A;  1H88 C;  2Z99 A;  1ZR2 A;  1WI9 A;  3VYR B;  4E7K A;  3IAS 2;  2GXB A;  1TT5 B;  2KIU A;  4NDL A;  4S0H B;  2FBI A;  2ISY A;  2FXA A;  4W1U A;  1MH4 A;  3IH3 A;  2DBB A;  3NQO A; 
#chains in the Genus database with same CATH homology
 4BXF A;  1BR2 A;  4XOP A;  4FET A;  3L2U A;  3D5L A;  2VPL A;  1TZL A;  4XLC A;  4E7L A;  3ZXS A;  3A1Y A;  2HDW A;  2O5R A;  3VSK A;  3VYS B;  3L2V A;  4X0G A;  1WJ5 A;  1N77 A;  4ZDO A;  3DPL C;  4E6K G;  3A2K A;  2LYC A;  4XLF A;  2A6T A;  4B48 A;  3FBI B;  3H9J A;  3OYA A;  2GOX B;  3BLY A;  1MMD A;  3OIQ A;  2BOL A;  2VJJ A;  1LDK B;  2HZD A;  3NWT A;  4XKW A;  2WB1 A;  2DJI A;  5HNF A;  3H9G A;  4CCO A;  2JSP A;  2W82 A;  2WA0 A;  4E4H A;  4DJA A;  3L2Q A;  2F4I A;  3F9K A;  1P9Q C;  3EUK L;  4KIS A;  2K9M A;  5CQG A;  1QU3 A;  2VQC A;  1T0F C;  4ZTJ A;  2LC2 A;  4JQF A;  2VQH A;  3MKW B;  1Y56 A;  1PYV A;  2IS2 A;  4CA0 A;  5HLT A;  4LG3 A;  4BUP A;  4CCL A;  4OAY A;  1BOB A;  2DXI A;  2JVH A;  4GRI A;  3DU6 A;  5KCM A;  4JOM A;  1ZEL A;  1WJE A;  4P5O A;  2XSJ C;  1Y6I A;  4NUB A;  4ZDL A;  5KNL A;  2LRD A;  4HEA 2;  1MMA A;  3CES A;  4XN0 A;  5JHF A;  3K10 A;  2K5C A;  5CKT A;  4HRI A;  3BCA A;  3D5R C;  4B47 A;  4BE2 A;  2CV0 A;  2M7A A;  3OS2 A;  2KL4 A;  1UEL B;  3ZCO A;  3DLA A;  3HOS A;  3VSL A;  1X19 A;  3CP2 A;  1D1A A;  1FMW A;  1FMV A;  3QYE A;  2VKD A;  3DPU A;  2UWM A;  2M7B A;  4PJM A;  3OYH A;  2ZXI A;  3M1C A;  2VB6 A;  2WY8 Q;  2Z1D A;  4IKF A;  1SAU A;  1LKX A;  2CW7 A;  2VKH A;  4OAZ A;  3OS0 A;  3MMY B;  4N4N B;  4HSR A;  2AQE A;  2X85 A;  3KEY A;  4BQQ A;  4PFP A;  1T95 A;  3BCB A;  2JA2 A;  4XQF A;  3DTE A;  3HC7 A;  4C2T A;  4E7I A;  2LBF A;  4XLH A;  3ONQ A;  3KX2 A;  2HNH A;  3I9V 2;  1BR4 A;  3SDB A;  5FRM A;  3SZG A;  3DKY A;  3OYG A;  2CFO A;  3CZ6 A;  4LIT A;  4CCK A;  4RM3 A;  4HG2 A;  1MMN A;  2V26 A;  4U7B A;  1WJB A;  3OYJ A;  3MKZ A;  4XM3 A;  2HPI A;  3W2W A;  2WAE A;  3PL8 A;  3AFH A;  4NC8 A;  3K70 D;  2XAU A;  2JUG A;  3K4M A;  4G6T B;  4PJL A;  2F5V A;  3DTI A;  4II2 A;  4IQ4 A;  3DEE A;  3BG6 A;  1D1C A;  2E60 A;  3OOU A;  4NQW B;  2DT6 A;  1GLN A;  3FHN A;  3HUG B;  1ERD A;  2E5Z A;  1Z3Y A;  3E0J B;  1NG6 A;  1V5G A;  1UG0 A;  3CMM A;  2Q2E B;  4BAC A;  3VYU B;  3OIP A;  1WJD A;  2UV1 A;  4BS9 A;  1DP3 A;  2Z16 A;  3S8P A;  2JVG A;  3TL4 X;  2E1M C;  5KHD A;  2XF6 A;  3ZGK A;  2L9S A;  3MD2 A;  3K4J A;  2ZSI B;  4XOT A;  3FKJ A;  1R6R A;  2PMZ A;  1MMG A;  4BU2 A;  2R7Q A;  4P1W A;  5HOO A;  2HU9 A;  4E7J A;  3RPU D;  4ITV A;  2DCE A;  3PNV A;  3SEZ A;  3LSM A;  4BQO A;  3OR2 C;  4PSW A;  1YX5 A;  3K4K A;  4XR6 A;  3OYI A;  2QKM B;  4Y3O A;  2AQF A;  2R7X A;  4BL0 B;  4F3Q A;  2KMU A;  2X1E A;  3HKZ A;  3VDX A;  4J00 A;  4BE0 A;  1BR1 A;  2Z2S B;  3FDY A;  4PK4 A;  2KDO A;  2VL8 A;  3AL0 B;  2WBM A;  4CH7 A;  3FBN B;  2IXS A;  4HNT A;  2L5Q A;  4J01 A;  2W1O A;  1VZ0 A;  2IGN A;  2IS4 A;  3RSN A;  1Z7L A;  2FUG 2;  4XMY A;  3CJR B;  2OV7 A;  2K3P A;  1MNE A;  2DT7 B;  3VYT B;  4FAS D;  1D0Z A;  2VAS A;  4ZDP A;  2M3A A;  2CV2 A;  1JI8 A;  3A4C A;  3H35 A;  1Z3X A;  3IP4 B;  4E7S A;  2V4J C;  2IGK A;  2BVM A;  1OR7 C;  3V42 A;  4CCN A;  2QKL B;  4IZZ A;  2ZXH A;  3J7A Y;  4CCM A;  2IS1 A;  1V5E A;  2RNG A;  4PFO A;  3OYB A;  1IRX A;  3RCO A;  2I8D A;  4BE1 A;  1DGR M;  2HVQ A;  2V6E A;  2VJ5 A;  2WAF A;  3K4C A;  5FRO A;  1UAA A;  4BDZ A;  4BJT A;  1W36 D;  1LFP A;  2RRE A;  2CV1 A;  3QYF A;  2ZSH B;  2X1C A;  3HOT A;  3K4B A;  3PSI A;  2L7K A;  2OC6 A;  2R7R A;  3BC8 A;  1G8X A;  2Q1Z B;  2KHM A;  3OL3 A;  3M8J A;  4ZTF A;  2BW3 A;  4XKC A;  1X4O A;  1X1A A;  4BGD A;  4AU7 A;  2CH0 A;  2Y0S A;  2UUZ A;  4KIT B;  3QOD A;  4AYB A;  4E7H A;  2ELJ A;  2KP6 A;  3OYC A;  1W36 C;  2KQR A;  4LIU A;  2E5N A;  4YEL A;  3VWB A;  4EAT A;  2CUZ A;  2VQL A;  5HNH A;  3LFU A;  4B44 A;  1X4P A;  1WFX A;  5CPR B;  3UR3 C;  3DTK A;  2LY1 A;  1WJA A;  3TBI A;  1D0X A;  4DBQ A;  1QHG A;  4CCJ A;  1Z21 A;  2L9N A;  2WY7 Q;  4HST A;  4N4O B;  4D1Q A;  4F93 B;  3K4N A;  1AA7 A;  3OYE A;  2PJR B;  3I3L A;  2BVL A;  3PJR A;  3DWL E;  4HNU A;  4E7Z A;  4BQN A;  4RMN A;  2HVR A;  2V7F A;  3C2G A;  2HPM A;  2R7T A;  2WAD A;  2M4G A;  2VXD A;  4D9J A;  5HVQ C;  4XON A;  3S3M A;  2K9L A;  4XNF A;  2W4S A;  3MKY B;  2KRH A;  2LG4 A;  1EA3 A;  4C9Y A;  4Y33 A;  5TGT A;  2V9K A;  4B3X A;  2A5W A;  2X6Y A;  4ZYA A;  3CJQ B;  4BJ6 C;  4HPQ A;  3BG7 A;  2XC7 A;  3L2R A;  1G59 A;  3HG9 A;  3H0D A;  3S93 A;  3KYL A;  2LOO A;  4XLA A;  2R7S A;  2R7O A;  3OYD A;  2X6W A;  4II3 A;  2CUJ A;  3QOE A;  3AKZ A;  4XKV A;  4YRV A;  2LH9 A;  1HA8 A;  2MD0 A;  3D5S C;  4XL9 A;  3SEQ A;  4IQJ A;  3PNY A;  2MAB A;  4ZC3 A;  3LMM A;  3IUO A;  3OYF A;  3EUH C;  2IGO A;  3OS1 A;  1MND A;  2MC4 A;  2HVS A;  4ZJZ A;  2CW8 A;  2ZFU A;  5FRN A;  1S9H A;  4F91 B;  2L2O A;  2VLA A;  3K6G A;  1NG7 A;  3ZQQ A;  3PFY A;  2KZV A;  4XOR A;  3OL4 A;  3S32 A;  5LD2 C;  1KON A;  2KPM A;  4F52 A;  2CMP A;  3E1S A;  2RQQ A;  4BEH B;  3OWT A;  3QYB A;  3H5A A;  2XDV A;  3DPT A;  4PUS A;  2R7W A;  3HL2 A;  4PJJ A;  3LSK A;  3OYL A;  3W2A A;  2X1D A;  2PJR A;  1N78 A;  2VJ4 A;  3LSI A;  3OR1 C;  2VJI A;  4DIQ A;  3HPH A;  3H9Q A;  1PJR A;  2WAQ A;  2VIX A;  3S3N A;  4C2U A;  4CSW A;  2VXZ A;  3H5N A;  5LFA A;  2P0W A;  4DBR A;  2MFZ A;  3C2H A;  2LRE A;  4KJZ A;  4YEJ A;  4F92 B;  1X1B A;  3EUA A;  4CZC A;  3PSF A;  1U0J A;  3HXL A;  1OLT A;  3LL7 A;  3DKX A;  4BJ5 C;  2F6C A;  2X6X A;  4CUG A;  2R7U A;  4QPQ A;  2KRC A;  3CF2 A;  1X1D A;  3GBG A;  3DU5 A;  4RLQ A;  1YX3 A;  5CQE A;  4AVZ A;  1DGW Y;  3RQ4 A;  4IX7 A;  2OUM A;  3PNT A;  3OY9 A;  3K70 C;  4Y4R A;  3W3C A;  1TT0 A;  1WJF A;  3ZR8 X;  1E0E A;  3OYM A;  2BW3 B;  2X51 A;  4NC7 A;  1K6Y A;  4F55 A;  3K4L A;  1LVK A;  2HQA A;  4DGW B;  2LBF B;  3CP8 A;  2VQG A;  4OWR B;  3EPZ A;  3OYN A;  4H4K C;  3AL0 C;  2IGM A;  4BEH A;  3G2B A;  2M4K A;  2M0M A;  4PJN A;  4XN3 A;  4RM2 A;  1D1B A;  1V5F A;  4MLO A;  1WJC A;  2R4G A;  4XKB A;  3N05 A;  3HPG A;  2R7V A;  3H5R A;  3ZRG A;  3RTR A;  2IS6 A;  3LSG A;  1SFK A;  2KLO A;  4PSX A;  4U87 A;  2W00 A;  1X1C A;  3W2V A;  4LIV A;  1MW7 A;  3DQV C;  3PUB A;  1YE9 A;  4R79 A;  4XLE A;  1D0Y A;  1QHH D;  2DOA A;  2NOJ B;  4KT6 A;  2XF5 A;  3LSH A;  2E1M B;  4B43 A;  4DOZ A;  3SYT A;  3OMY A;  4C30 A;  2XF7 A;  3TMO A;  2LY2 A;  3S3O A;  3OYK A;  2W7N A;  4ANJ A;  3UNG C;  1J09 A;  2GOM A;  2MYS A;  2V1N A;  3IAM 2;  1N75 A;  3VYR B;  4E7K A;  3IAS 2;  4BDY A;  3NWS A;  4RLF A;  1DQU A;  4NNJ A;  3U21 A;  3L2W A;  4QPO A;  2CS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...