3K6GA

Crystal structure of rap1 and trf2 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
VSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomeric repeat-binding factor 2-interacting protein 1
publication title A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3k6gA00
4BJ6C 3OWTA 4BJTA 3K6GA 3CZ6A 4BJ5C
chains in the Genus database with same CATH superfamily
4UV8A 3K10A 4UUVA 5DS9A 3H9GA 2R7SA 1MNEA 1O57A 1U6GA 2COMA 2FD5A 2ZCWA 5B1AH 1WI3A 5E3LA 2IW5A 1FOKA 5DEQA 2WV1A 4EGZA 2D2WA 3FMQA 2O9LA 3CLQA 1MKMA 1ZLJA 4YRVA 4RAFA 2DA3A 2XPVA 3KLNA 2NVUB 3G1OA 4LG3A 4E7IA 4BY7J 3G1MA 2ECBA 3QPSA 1P92A 2ELJA 3CQZJ 4EEFG 2E35A 4IKFA 4A3EJ 2A69F 2CUEA 1Z21A 2OCEA 2OTLI 4H0EA 4XLNF 1V3FA 4P9FA 4RM2A 1PUEE 3HOVJ 2J5PA 3M9AA 4HYEA 4G7ZF 1L3LA 5J1RA 2R7DA 5DD8A 3HSFA 3DTKA 3GW2A 3ABMH 3AG1H 4NDLA 1JHHA 1PJRA 2DPDA 1OCTC 2H1KA 3K1MA 1W7PD 3S8PA 2M0MA 1IGNA 3HTSB 1IXSB 2QEXI 4A0YA 1TL8A 2OC6A 4HF1A 1B4AA 3OIQA 4QWQA 2M45A 2JWTA 1ZELA 4QLCU 4I09A 3BPXA 4PJNA 3OYLA 2I10A 3IRRA 1XSXA 3HUGB 1W5TA 4XR6A 3TW6A 4EJVA 2IRFG 3GTKJ 4NC8A 2L7MP 1FTTA 1B8IB 4YFKF 3PNYA 1X4PA 1IDYA 5DCFA 1CQTA 1XDUA 4RAGA 2CSOA 1Q1HA 1DPRA 1G2HA 2XAUA 3S3NA 1I5ZA 1FBSA 3FISA 2EFOA 4OOIA 2JVGA 2QKMB 2QF7A 3H5NA 3RDIA 3ZGKA 4A3FJ 2BE5F 3ZQIA 3SZPA 1RI7A 2DOFA 2LFBA 4BHBA 3I56I 1MZBA 3ZMTA 3A03A 1J09A 4HQEA 2RDPA 3VSKA 4LOCA 2KIFA 2HDDA 2Y31A 4RM3A 2A05A 3MWMA 2MLKA 4HF0A 3BG9A 3BZCA 3PQJA 2BY0A 3CCYA 1E3PA 4LIUA 5M3MJ 1ZLKA 2M4GA 5CQEA 3A4CA 5C4JJ 4KDPA 3LA2A 5FGMA 4MQVA 4E7ZA 1Z05A 3IL2A 2R5ZA 2HVQA 2X4HA 1FBQA 4ZZLA 3JRGA 1D5YA 1F5TA 3BWGA 1U3EM 3L2CA 1I39A 3UKGA 2OZ6A 2V9VA 4RB2C 5A2QZ 5CVUA 4A3KJ 1R6RA 4EM2A 4ZTFA 5E17F 3A1YA 4Y15A 1FJLA 4CYCA 3OYNA 2VIXA 4EMSA 3ECHA 1FMVA 3CC4I 2OTJI 1TQPA 2Y30A 5F08A 2XAHA 2UV1A 5AIQA 4G7HF 4HZFA 4A93J 4QPOA 2FUG2 3OYGA 1RPWA 2QQ9A 3ASOH 5FFXA 3OS1A 4IO9F 4PFOA 4O3MA 4II3A 3B02A 2I5UA 3GTLJ 3V7SA 3WTYC 2P6TA 2HOSA 1LEBA 3WTUC 3PUFA 3OSGA 2X1CA 4PUSA 3FBIB 3LFUA 4OAZA 1JGSA 1GV5A 1S3JA 5DYMA 2Z9OA 2ZMEA 3DU5A 1NTCA 3J81Z 4HSTA 3HOSA 4EJTA 2NVQJ 3HJEA 3HXLA 1I50J 2A6HF 5F1JA 1QHGA 2FRHA 2OAZA 1F1ZA 4CCMA 3TO9A 1XCVA 2ZKZA 4LIVA 1MMGA 2K9LA 2CQKA 2VBZA 4FHTA 3ISPA 2FSWA 2ZBKA 3CJRB 5D8KB 5M5XJ 3BG7A 5A2QK 2H09A 2LH9A 3JR9A 2VBYA 1A6QA 4E7SA 2ELKA 1P4XA 1WJDA 2NVYJ 1SFEA 1TZLA 2W24A 1LDKB 3PL8A 5DDGA 1P7JA 4E6KG 2BXZA 2XRNA 4BQOA 5EGOA 1G59A 3H0GJ 3L2UA 1XGNA 3QPTA 1YLFA 2E2IJ 2IBDA 1R71A 1LE8B 4KT6A 2JA2A 3RPUA 2MGQA 3U1DA 3AG3H 4BEHB 4CCJA 5ICCA 4XLPF 3S16J 2IS1A 1WHUA 1DGWY 3FHZA 2K02A 2FE3A 3SFIA 3GMEA 5BNGA 2UXXA 4P5OA 1DUXC 1FMWA 5GADJ 1X1DA 3W2VA 5CVVA 4C3JJ 1TT0A 2A6EF 2ZB9A 3RIRA 4F3QA 3OY9A 5D5XB 4G7OF 1UELB 1RR8C 1R1UA 2VT2A 2XPUA 3HRSA 4JYKA 4BAYA 4XRMA 4IOCF 3HG9A 1Q1VA 2KIUA 5KVRA 1WWXA 4XN3A 1A31A 2M7BA 1IO2A 5IYDJ 3I4PA 1LVAA 1HDDC 3C2HA 2KKOA 1TQIA 2GXAA 3GWZA 1YO5C 1ACIA 4GYIA 1YX5A 5D6FA 1BM9A 1R5GA 2R7FA 3M8FA 3WG7H 2Z16A 1K6YA 1GDTA 5GTHC 2R5YA 1BC7C 3CC7I 1TW3A 1YS7A 3WTXC 1I6XA 2L54A 4F91B 2YU9J 2RREA 2LMDA 2AS5F 1QHHD 1SD4A 3CLOA 1RR7A 4HOBA 4XONA 1BOBA 5CVIA 3RKYA 1W0UA 5C3EJ 3B73A 4HSRA 4NUBA 5H20A 1H8AC 5DCMB 1QBJA 3JAMZ 2A3SA 1ZKGA 4C2MJ 5IT3A 1FYLA 2DTRA 5D8LB 5LFAA 2HKXA 1U5TC 5J3LA 1ETQA 1KA8A 2LLKA 3CCMI 3HB9A 3DLAA 1FYMA 2ZXJA 5GP9A 4LB5A 3REOA 4LG0A 1LVKA 5DUIA 5ICGA 1SVOA 2HZTA 2DN0A 1ODDA 3F21A 1J7KA 5TGTA 1LNWA 3LQQA 4PJ0C 4RAZA 2IS6A 4DJAA 2QSFX 5HS9A 1VNDA 3L7WA 4G12A 4XKCA 3SYTA 3RZOJ 2F4OB 5CJ9A 4D7NA 4AM3A 2Y0MA 4M9ZA 5FKNA 1GVJA 2QKLB 3K4CA 5CPRB 4ASNA 2VC0A 2LTPA 4Y4RA 4LITA 1X4OA 2XIGA 3BTJA 4AYBA 1HBXG 4XM3A 2R3SA 4M73A 3KYLA 3HM5A 4B47A 1ON1A 1WVRA 3U21A 3VDXA 2XROA 2HTJA 3W6KB 1U8RA 2FQ4A 3DBHB 5E1WA 5DD4A 4M9SA 4ENNA 2DQLA 3CF5F 1SVLA 1YE9A 1X2MA 2XGEA 3ZN0A 4BH9A 3L2RA 2V6EA 1QRYA 3JAMK 2TCTA 3FXMA 4DBQA 4UUSA 1AKHB 2DK5A 3CO6C 4HRIA 1YOVB 2GA2A 1YW8A 1SFOJ 4BDZA 2F2EA 5TRDA 2HFHA 3V8LA 3TDUC 2DO7A 4B3XA 3HPGA 3F8NA 4NC7A 2DA2A 2L01A 4HNVA 2DW4A 3MKZA 5JHFA 5EZGA 1HC8A 1YW7A 3WGGA 5HLIA 2XGDA 1LEAA 4WF2A 2DYSH 1J75A 1V4RA 4NBQA 2DAOA 5JR3A 1CF7A 4DYCA 1YJNI 1U9OA 1SD5A 2Y2ZA 3QP6A 4ANJA 5LD2C 1MJBA 5BQTA 1FC3A 3DBRB 3T8RA 1OFCX 2IS2A 3E5UA 5BS6A 1QU3A 1Z6RA 2HEOA 1RRJA 3VPRA 2KRCA 2X85A 4YFXF 3ZMUA 2YU3A 1XMXA 1VQ8I 2V1UA 4IRHA 2K40A 1KQ0A 4LGWA 3KPHA 4BU2A 4FE7A 1QO0D 3MVPA 1FZPB 4HQMA 1FEXA 1N25A 2E5NA 3V42A 1YTYA 1USSA 3MMYB 3KZZA 1R23A 1ZHFA 5FD6A 1ZRDA 3UR3C 3S17J 3DU6A 3I53A 1D1AA 3HOUJ 2IGOA 3MZHA 3IUOA 2HQNA 1EH8A 1B9NA 2NRAC 2DU9A 2HKOA 4CYDA 2WTEA 2P5VA 1SVMA 2HYGD 4IHSA 4A3BJ 3BR6A 3NWTA 3K6GA 1LQ1A 2Q8KA 4CUGA 3PM1A 4RAYA 2VKEA 1ZAOA 2LKXA 3TEDA 4OIOF 1N75A 4U0WA 2OA4A 2HI3A 3J7YJ 4CGZA 3O3KA 4D7MA 3VODA 4G6QA 3JSPA 1ONVA 2B63J 1UG2A 3HKZA 4XRSG 5HDKA 3I59A 1MMAA 2JK3A 4FQGA 2LYCA 3OYAA 2A61A 2F5VA 2DTZA 3B6AA 4A0ZA 2O61A 2VQGA 4IZZA 4AD9A 2HQRA 3PO2J 4RA2A 5L3FA 2G9WA 3JTGA 1LPQA 2Z2SB 1E0EA 1O7LA 1S9HA 2Y9ZA 4ETSA 2R5ZB 3WTSC 3MN2A 3CUOA 1UJ8A 4KFCA 1QPMA 2KFDA 3MKYB 1BOAA 4LLLA 3WU1B 2F4MB 4L0YB 1IDZA 4IRIA 2CQXA 1SFKA 2FNPA 1U8BA 2W25A 5J8CA 1AA7A 1OISA 1S7OA 5EG0A 3LNQA 3WGHA 2F5FA 2Q2EA 4HAMA 3PFYA 1U5TA 5BPDA 3U9GA 1POGA 2PFBA 4M72A 4AU7A 1P6RA 2IT0A 4NB5A 4PDKA 4CYCB 1QZZA 2R7XA 2FMYA 2PMZA 4AIJA 1UFMA 4O5VA 1CGPA 1JJ8C 1DU6A 6PAXA 1HLVA 2JMWA 1MBEA 2EZHA 4P1WA 4OINF 1ZGJA 4I02A 3EETA 2ZJPF 2IS4A 1OCOH 2LY9A 5CYVA 3TOAA 1L0OC 3ABUA 3FXLA 2E7WA 4CZZA 2L9NA 5M3FJ 1HKTA 2HOTA 3MQ0A 2KDOA 4AYBN 5LBQA 2MSYA 4BXXJ 4M6YA 2EZLA 1MD0A 3KP7A 3MKLA 2ZMEB 3AFHA 2M8GX 3J7ZI 4A3LJ 3K70D 2NS8A 1G3YA 4IEJA 4KJZA 3S3OA 4ON0A 3COAC 5FKOA 2TRTA 4XICA 1Y56A 3DQVC 2XAGA 4A3GJ 4OWRB 1V55H 1VQ6I 4X1EA 1QVTA 5KAIC 1WJFA 1GLNA 3QPLA 2DFEA 4G6DA 2A07F 3E97A 2IA1A 2LKSA 4F52A 4BJ6C 3NEUA 2JA8J 1JTYA 2STTA 2WY8Q 2VKHA 5KK1A 4ZYHA 4NNJA 2GQQA 4MLOA 4CCOA 3UNGC 1B72A 3KP3A 3CCQI 2IGKA 3D5SC 3FMRA 2WWYA 4HX8A 3JRIA 5FKKA 4ENKA 4RMNA 2DA5A 1P4WA 1XMKA 1Y6IA 2HDWA 4IQ4A 5EGOB 3QYEA 4A12A 2P4WA 1OYYA 3OIPA 1D1BA 3SEZA 5L3CA 3RI4A 4HF2A 1PDNC 2X6OA 3L09A 3M1CA 2QQ8A 4HX7A 5BOXA 4KICA 4Y17A 3VFZA 4YIIA 5F1RA 5J4YA 4UHTA 1S8NA 2B7EA 2G7UA 3QODA 3GX4X 3JRBA 1TP4A 4BE0A 2ID6A 3FXQA 5JLWA 3G73A 2KISA 4K2EA 1MJ9A 5IOYA 2XB0X 2E1CA 1U0JA 4ZDPA 1RETA 2BY2A 5CLSA 2ZMEC 4OIPF 1Y0UA 5JHUA 3SDGA 2EA2A 2VXZA 1FP2A 1KU9A 4LFUA 1H9GA 4IXAA 3TP0A 4XLCA 4CXFA 3TDZC 4L9JA 1OJLA 4YIFA 1Z7UA 2LP0A 4WK8F 5J1UA 3LAJA 5DV5A 1HDPA 3F8MA 5F6FA 3FKIJ 3HDDA 3GZ5A 2JA7J 2KPMA 2EFQA 2M87A 3TO7A 4CICA 5ED4A 2DMNA 4PJMA 3DKWA 2ZO4A 1S72I 3K9TA 3HOZJ 2BVMA 1R4MB 1FSHA 4Y52J 2R7VA 3O8GA 2Z5UA 5TJJA 3RSNA 3AL0C 2XVCA 1S6LA 3OWTA 3P9IA 4ZDOA 1HQCA 2LG4A 2DMQA 4RGUA 1BI2A 3LAPA 2R5YB 4PK4A 5LEKA 1IXRC 2EQRA 2PI0A 2LSOA 3DEEA 4BUPA 3GFIA 4D5CA 1E17A 4BXUA 1LKXA 3R4KA 1MGTA 4C3HJ 4DZJA 1PUFA 1KU7A 2DQRA 2CJJA 4QTRA 5IPAA 5L3BA 1BR1A 3MZYA 3J80K 2KHMA 1H9TA 2NNNA 1G8XA 4J00A 1W36D 1TWCJ 4A3IJ 3QRFF 5K5QA 5E8IA 3GTJJ 1V5GA 3M8EA 1VQ4I 4II2A 3EDPA 4BS9A 4ZTJA 2CFXA 3HKZN 4E7LA 2ZNZA 3T8TA 1W7PA 2BHZA 1FIPA 2JRMA 2ZFUA 3OS0A 1UHWA 1GVDA 3CC2I 3ABTA 4LG0B 4XSZF 2H8WA 3GTPJ 1TW2A 1JKPC 1WSUA 3T5XA 2EFPA 3GLXA 3ERED 4N4NB 1V5FA 1ZR4A 4IHTA 2X51A 1JKOC 2VQCA 4S05A 2O03A 2PJRA 1WJCA 1SD6A 2QSGX 2FX0A 1ITYA 2VL8A 1FX7A 2VQHA 2JSPA 1ZG1A 3QYFA 3C2GA 4M3FA 2GBYA 1D8KA 1KU2A 5CVRA 1RNLA 2O8KA 2XKPA 3S2HJ 3F72A 4UXNA 2ELHA 3EUKL 1D0YA 4IX7A 3DBLB 5EF6A 2PMZN 4JQFA 1JGGA 1QQIA 1EF4A 1OPCA 3IC7A 2ZNYA 5HLHA 1S29A 5M5WJ 3M07A 2NNYA 2E1NA 2DDBA 2X9DA 4UUSB 2KDZA 1W5SA 2CMPA 3EUHC 4KT5C 1JI8A 1MW7A 2QZ8A 1SC7A 2CS3A 2EV6A 3GXOA 1O3SA 1K78A 2YUSA 5K5OA 3DPUA 2LR8A 3S32A 1XPXA 3I5UA 2WAEA 4ABZA 3BG6A 3O6BB 2Z99A 5HDGA 3L00A 5EEGA 1R1TA 5DM7F 4PGHA 1XN7A 2DK8A 2E2JJ 2HQAA 3E1SA 2JZYA 5ILSA 2XSJC 2MC3A 2NVTJ 1ZGAA 1IAWA 1IUFA 4BDYA 4M3DA 1TC3C 1GHCA 5B3SH 1SAXA 1CF7B 3IH3A 5FLMJ 2GOMA 1FPQA 3K4JA 3LL7A 4KA4A 2W7NA 1REPC 5F64A 1A36A 1JUMA 4WWCA 2DT7B 3W2WA 2P0WA 2XASA 3OS2A 3FWEA 4MTEA 1PP7U 4X6AJ 3TGNA 3A01A 1TNSA 4DYRA 4EM1A 2HXIA 4GO1A 1T8IA 4HW0A 3ZRGA 4U0VA 4N0BA 4JP0A 3QU6A 3HGGA 2FNAA 2VB6A 4BBRJ 2H94A 3KFWX 5DM6F 3IKTA 1IJWC 1YG2A 1R00A 5J40A 2QQAA 3ABLH 4C2UA 1XTAA 1D0ZA 2H8RA 4IHXA 2COBA 3IH4A 3K4MA 1S7EA 4L5JA 3CCSI 2E1MB 1FTZA 1UZCA 2GXGA 1LJ9A 1OR7C 1YQAA 3N05A 4LLGF 2FBKA 1ZREA 1XMAA 3RKXA 3IAS2 2HZDA 3OYEA 1TTYA 4EV0A 1NG6A 2CQNA 4LD5A 4BKXA 2IGMA 1IN4A 4B4CA 3M1EA 2LREA 3WE2A 1Y8QB 1WPKA 1FT9A 1MBJA 1TT5B 2KRFA 1Z91A 2X6YA 2L9RA 3PSFA 1MMDA 2M30A 1JJ6C 3BY6A 3F0CA 3OIOA 1MMNA 3QP5A 4J01A 4KMUX 1NH3A 3I58A 3E5QA 3OSFA 3C18A 5HLGA 3MAJA 2VE9A 3RKQA 5K1YA 2DA1A 2B9SA 2HNHA 2IVMA 1DP3A 2EFWA 4QIWN 3ZOBA 3HRTA 3QPHA 1A6IA 3HEFA 1RUOA 3OYHA 2HGCA 2LBFA 4LJZF 1ETOA 3I59B 2OZUA 5E1ZB 5EYRA 2DMPA 4KNYA 1ORKA 5B1BH 2EIKH 3N4MA 3U2RA 3O8HA 3GYHX 2M5WA 4Y7NJ 1IZ1A 2H6BA 3G2BA 4NHJA 3RYRA 3W3CA 1FOXA 3OOPA 2ME0A 2LF8A 4RGRA 2VI6A 4CCLA 4Q5SF 4U88A 1SANA 3BDDA 2R7RA 2E1MC 3KEYA 1YITI 2MA3A 2GZWA 1W1WE 2NYXA 4KIGA 1VQ5I 3F23A 3CD6I 3FXUA 5LGNA 3HYIA 3KP2A 1BJZA 2G7HA 2V6CA 2CYYA 1ETWA 3CMAI 4CA0A 2XAFA 3KEQA 1VZ0A 1X58A 1YW9A 3HPHA 2MG4A 3FXOA 2KRHA 3VYRB 2Q2EB 5EG0B 3J81K 4AIKA 1YRNA 1STZA 1U5TB 4HG2A 3LSMA 1FP1D 4BQAA 5FFZA 3K69A 5CVJA 3C2BA 5H2FC 5F0CA 3NARA 5FRNA 2XF5A 3IWFA 1WQ2A 1I3AA 5FD5A 4CH7A 3CCLI 3SJMA 1EH7A 3KX2A 3BC8A 2ZC2A 1Z77A 4A6EA 1I3QJ 3M3YJ 3Q3SA 4QSHA 1VTNC 3T1BA 1H88C 2IPQX 2XAJA 1WH7A 2GLOA 2QQBA 1YHQI 1JXSA 1RC9A 1IN5A 1LFBA 2GIVA 5K7FA 5EEHA 4IOAF 1X3ZB 3SQNA 3D1NI 1T0FC 1X19A 5F0HA 5L3DA 4I0BA 2QCOA 3MZ8A 2L2OA 2XF6A 3KE2A 4CZCA 2RC4A 3WG9A 1DP7P 3QU3A 4BXFA 4XL9A 3VB2A 1VQKI 2JA5J 2ZJRF 4O6JA 3LMMA 4E4HA 2XGXA 2KT0A 5J8FA 2P81A 3PQKA 2W48A 1TLHB 2DOEA 2OU2A 1JHFA 2ISZA 3CCVI 1FYKA 2EJRA 2L5QA 2H6CA 2KQRA 2MW8A 2UXNA 3SDBA 1D5VA 4I99C 2IA2A 2M4KA 3CUQC 2G0EA 4B43A 4B8XA 5K5RA 2C6YA 2IA0A 4A5NA 2OF7A 1GXPA 3EUHA 3F8CA 3JREA 3GCMA 3IAM2 1TWHJ 3CMYA 3S1RJ 1V54H 2CU7A 2JPBA 1B72B 3AG4H 2L4AA 2KMUA 3V7CA 4MFDA 5HS8A 3K70C 1WGXA 2CUZA 3IV5A 3RTRA 2VUMJ 2LY1A 3GBGA 2OPTA 3ESWB 2BHYA 1R49A 2EB7A 4QPQA 3Q0WA 4KUMA 1LFUP 1UHSA 1YYVA 1U9NA 1XSVA 3H1CA 1X1BA 3E6CC 4PZJA 2VN2A 3JRHA 2Y0SA 3RJPA 3ZR8X 3ZQFA 3P7NA 2JT1A 1ZTRA 4F55A 3F6VA 2ACJA 5CQGA 1J9IA 2HS5A 2W1OA 3HTUA 3WODF 2FXAA 1K4SA 4GCVA 3WTZA 5JI6A 2W82A 2HYFA 3G4SI 3PO3J 4ZYGA 1WJAA 2XSDC 3DPTA 4ESFA 4XRSA 1ON2A 3BQYA 2JUGA 4M3BA 1XG1A 3GFJA 3KYCB 2DT5A 3F9KA 2MYSA 1W5CC 1EJ9A 1LUJB 3DKYA 4GRIA 2EBIA 5IYCJ 2QA4I 4L5EA 3F8FA 3ZXSA 3ZMVA 1FOWA 1VQPI 1HA8A 5AONA 2JJ7A 2BY3A 1BIBA 1ERDA 1OR7A 2P7CB 2CUFA 4XSXF 5HOOA 1T98A 1APLC 3I55I 3ZQQA 4YG2F 1Z9CA 4ZYDA 1PUFB 4IRGA 5IOZA 1TWAJ 1D8JA 4HA8A 1SFXA 3PIPF 4A3DJ 4ITVA 1J0RA 1WZ2A 3LA7A 3OV8A 1DPUA 4IPAA 1G4DA 3S2WA 1Y39A 3BROA 2YR2A 4GXOA 2O7OA 4N9HA 1HKQA 1LB2A 4HBLA 1KZHA 2AO9A 4EATA 4HDUA 1NG7A 2JA6J 1MNMC 4L0ZB 4R1HA 3QYBA 2CW7A 1W7PB 4P9UA 4YFNF 4PJJA 3ZPLA 4FTHA 1BI1A 1YX3A 3MFKA 4XN0A 1SFUA 1H0MA 2V26A 3SZGA 2FBHA 2WY7Q 2RNJA 3K1PA 4L9NA 2GM4A 1R1VA 2Y69H 3OYFA 1IG7A 4MQ9F 5KCMA 3NWSA 3C7JA 4XLEA 1DQUA 3DKXA 2PJRB 3E0JB 2VOOA 1EH6A 1KYWA 3V7RA 2EPFA 1W36C 1Z3XA 3W6JB 1FOYA 3B6CA 3PNTA 1HW2A 1VQNI 3FIWA 1HOMA 1D1CA 1O7FA 2A68F 4YIRX 1MMSA 3KCCA 3E6BA 4PFPA 4WXCA 3IKVA 5FO5A 3ZN1A 1RESA 3OL3A 3K2AA 2CUJA 1FNNA 3DEWA 2XKOA 4HDVA 2WA0A 4FE4A 4KIFA 4U87A 5JFRA 2DI3A 5E3OA 4KN7X 4G94A 5E3NA 1KQ9A 3FBNB 3HC7A 3PNVA 3F22A 5E1XA 1NK2P 3JRFA 4RGSA 5LHIA 2EV5A 3RCOA 2QYOA 3E7LA 5B66C 3H35A 5FKMA 4LB6B 1VQ9I 4D0PA 1AU7A 3HL2A 1ZQ3P 5EDNA 3NQOA 1WJEA 5IP6A 3QOPA 4KYWA 4ZYAA 4FX4A 2EINH 5H6RA 1K78B 3WU2C 4AVPA 5J47A 3GZ6A 4MEXF 2KP6A 2M7AA 1T0FA 2ZFWA 1MSFC 2F5CA 1P9QC 3LSPA 4EJUA 4RLQA 2OQGA 2VJJA 2PQ8A 3GFMA 1KGSA 5DUKA 4CSWA 2QBYA 2ZSIB 2K9NA 4BNCA 1UB9A 1TQMA 2CH0A 1HF0A 3L9FA 2X0LA 3OOUA 3I64A 3DWLE 4XQFA 1OCRH 4MGRA 2R7OA 5FLVA 3G3ZA 2O3FA 3CUQA 3EQLF 4PSWA 4U0YA 3LSRA 4FCYA 1IV6A 3SXYA 3A01B 2JRTA 2UUZA 1IN8A 3HRUA 2DOAA 2LF7A 2OQRA 4UVCA 1ZRFA 3WE3A 2EH3A 3CJTB 3SEQA 4EJOA 4IQJA 3BZ6A 3GO5A 4M3GA 2Q1ZB 3HHGA 3TP3A 2D1HA 2TDXA 4RB1A 2MFZA 1P2FA 3WHBA 5JVTA 1K83J 4FASD 4UB6C 1ENHA 2W57A 5GPCA 5K7HA 2BXYA 4L18B 1F9NA 3BLYA 2VODA 2BGCA 4BHPA 3W6VA 4Q4ZF 3JW4A 1I6HJ 1LDDA 2MBFA 2K9SA 2ZSHB 4N4OB 2R92J 3ZMZA 2ZXIA 2R7TA 2Y0SN 1R7JA 3DCFA 3BPVA 2PJPA 4P55A 3S15J 2KIQA 1JUPA 4C30A 2R7QA 3ASNH 4R79A 4BBSJ 3E6DA 4D1QA 2F6CA 3OYCA 3HOWJ 4UVAA 2YX7A 3DP7A 2NVXJ 2HPIA 4MFEA 3CCJI 2HDCA 3I4NJ 5FROA 3WHCA 1IW7F 2LD5A 1T08B 4KMFA 2W4SA 3ML6A 1QNTA 1UMQA 1WH5A 2O6GE 1IUYA 1E2XA 5D4SA 4IL6C 1UCRA 1USTA 2HQ5A 3CESA 1J5YA 3HRMA 1IN6A 1SAUA 1Z7LA 4BHCA 3ZQLA 1BJAA 2FJ1A 2KLOA 3FXRA 4FETA 3WTTC 4NC6A 1WCMJ 5LRRA 2Z1DA 3W2AA 2KZGA 4JX5A 2LBFB 3AL0B 5ICFA 1X1AA 2H1LA 2M2EA 3BT9A 3ZMSA 3WGIA 3H3VK 3RKWA 1KONA 2L7KA 1P4AA 4A3CJ 3GFLA 3IRQA 2RV8A 1T6SA 1QZEA 2FBIA 3CO7C 1IRGA 2R7ZJ 1U2WA 2K3FA 3EUAA 3LSJA 1ULYA 1XGMA 1FIAA 2K4BA 3SZTA 4CCNA 1K6OA 1V5EA 5D5WB 4C2TA 3BR5A 5HODA 9ANTA 1OCZH 2K27A 4BJ5C 4E70A 4IJAA 4AVZA 1O3QA 2Z33A 2DFHA 1YRNB 4ENJA 2HWVA 2YS9A 2AHQA 4MEYF 2EFNA 4CCKA 1MNDA 1Z67A 4HLXA 1ZG3A 1K7AA 3J7AO 2JUCA 1AOYA 3QOEA 3S93A 3F3XA 3H5AA 1S5LC 3DEUA 3FF5A 2QSHX 3BJ6A 4DQ2A 2M3AA 1BW5A 2XB5A 5J1YA 2K4JA 3D5RC 3M7GA 4RDUA 3FZVA 2NS7A 3CF2A 2Z3YA 5IY5H 2MD5A 4IF4A 5ILVA 1E3HA 1MBKA 3RPQA 5GAHJ 2ESHA 3C1DA 2ID3A 2R7UA 3KYDB 4J19A 2K85A 2WB1A 2PN6A 2FQ3A 4BL0B 4EM0B 3ZP5A 2JVHA 5LGTA 1FSEA 2HYJA 2R4GA 1MSEC 3HZJA 4OU0A 1Y8RB 1B1BA 4PJLA 4M6VA 4ESBA 3VYSB 1IC8A 1OYWA 2D1VA 3OYIA 3E6MA 2FOWA 2AXTC 4Q47A 3K4NA 3CCRI 2YSRA 2UZKA 3BJOA 2MABA 4A2UA 3DLLF 1SEUA 2CWEA 1BR4A 1VI0A 3OYJA 2NAZA 3A2KA 2VBWA 4B3AA 1G3SA 3Q9SA 1ZGWA 1ZR2A 4TV7A 3A0BC 2VASA 3GLLA 3TMOA 4Z6YA 4Y3OA 2LC2A 2OCCH 2HVRA 5E79C 2EZIA 5DTDA 1R5ID 1WRJA 3RZDJ 1RUNA 2VJIA 1WFXA 3DTEA 2F4IA 4EJWA 4D5FA 3F8BA 1B59A 3AG2H 3OYMA 2VBXA 2XUBA 3ZQGA 5GTIC 2IP2A 2LY2A 3FMSA 2PMUA 5GAEJ 2R93J 1XDSA 2LDUA 4I7HA 3TL4X 2HOEA 3CTAA 2PLYA 2K5CA 4A3MJ 3LOCA 4XOPA 2DA7A 4RS8A 1HKSA 3VSLA 1GV2A 3TKYA 2RN7A 3HOYJ 3QQAA 4KISA 2EIMH 1IRZA 3P5JA 1VFCA 4A6DA 3HOXJ 1SD7A 2BW3A 1JUSA 1Y0NA 2JTVA 3TQNA 1K61A 2EZKA 2D5VA 2WBMA 4Q48A 2X6XA 2I8DA 3ZQHA 2XC7A 1XS9A 1JKRC 3I0TA 4X0GA 1U78A 3Q0VA 2Y9YA 3GF2A 4GYGA 3BR1A 2L0KA 1BI0A 3ZQCA 2CV0A 2VC1A 3JRCA 2O0YA 2OD5A 2VXDA 2DMUA 3CZ6A 1OYIA 1YIOA 4RLFA 4XKBA 2E36A 3BCBA 3LWFA 3P9CA 2RQPA 4M3EA 1XC5A 1YIJI 3OL4A 2RKHA 3BJAA 3Q0UA 2V79A 1D0XA 5D6EA 1JE8A 4EQQA 4C9YA 1MDMA 1BW6A 1MBHA 2DYRH 4CO8A 5EEAA 5F27A 1Y1WJ 5FJ8J 2F5DA 2V7FA 4XOTA 2ADUA 2CGPA 2VOPA 1YJ9I 1WKMA 2BEOA 4FT8A 4I01A 2W00A 4AUXA 3OYDA 2P6SA 3LQRA 2YX4A 2ZXHA 3R0AA 1VQMI 3CJQB 1AWCA 3H36A 2A5WA 2CV2A 2LRDA 5KHDA 2KL4A 2VLAA 4F7ZA 4A5MA 3GZNB 2O8XA 3F6OA 1JKQC 1ZG5A 2OV7A 2VQLA 3ROUA 4EVIA 5KAFC 2CW0F 5LGUA 3MCZA 4XLFA 3KP5A 3M4OJ 1DDNA 1XD7A 4I76A 3HBLA 2YPRA 1XGOA 2MD0A 2DJIA 3ONQA 1Z1DA 3K2ZA 4XNFA 3VYUB 4G8XA 5JLXA 5HVQC 2CG4A 4LK1F 3K4KA 4YELA 4YEJA 4BQQA 4KN4X 4FISA 4E7KA 2IEKA 3KEOA 3GVAA 3GTOJ 1Z6TA 2XPWA 4PCQA 4OIRF 1KYZA 3N97A 2RNGA 3CDLA 2E2HJ 2ICWG 1ZRCA 1R5HA 1DU0A 3L2VA 3O2PE 4U7BA 3JRDA 2AXLA 3LFKA 3BTCA 2MH2A 3KZYA 1BA5A 1UG0A 2E34A 3BQZA 2V4JC 2AQFA 2WV0A 3S1NJ 4DIQA 2OUMA 4XRFA 3E3VA 1IXCA 1MH4A 1NK3P 2JN6A 3KP6A 3BCAA 3ZQ7A 2WB1N 4C3IJ 1EV7A 3GTGJ 2IGNA 2IAIA 1UAAA 2EK5A 2N8GA 2HOAA 2QM3A 3BTLA 1G6NA 1VF9A 2QBYB 1GT0C 4NQWA 2BY1A 2PMHA 5EJCA 3L1PA 2KZVA 4MO7A 4XLAA 1OQYA 2EV0A 5IP7J 3R6SA 4HNUA 1Y1VJ 2H27A 1B9MA 1T95A 3WU0A 3EYIA 5HNFA 4IHVA 4HNTA 3A02A 3CUQB 5L3GA 1OKRA 2NS0A 2FMLA 3LSTA 4WXHA 1IN7A 3QWLA 1FY7A 2GA1A 3DFGA 4B44A 1LDJA 2QENA 2EILH 2GWRA 3S1MJ 1KQ8A 5FB2A 3M8JA 3K1NA 3WTWC 3LSKA 3JTHA 3VYTB 3LA3A 5J6XA 1J2XA 4L5IA 1RKWA 3GTMJ 2DODA 4I98B 3GTQJ 3VWBA 2BBYA 1VQLI 1IV8A 4HX4A 4UUTA 2K3PA 4XKVA 3H3ZA 3CMMA 2VT3A 5BMZA 1X2NA 4DGWB 3RPUD 4MTDA 1UHMA 1HSTA 3CJNA 1BR2A 2KJCA 3HSRA 5LLQA 3H5RA 4BQNA 4V2FA 1LFPA 1JTXA 2CQ7A 2L7FP 2L3DA 4UV9A 4R8HA 5FRMA 3FHNA 4ZJZA 5CKTA 3OYBA 4BYYA 4A3JJ 2NOJB 4BE2A 2DFIA 3I9V2 1IF1A 4XMYA 4BJTA 1AHDP 1HSJA 2XAQA 4B09A 2M34A 4M6XA 1M1EB 2DA6A 3NAUA 2LOOA 1MJAA 2RQQA 4XIDA 1W4MA 2E19A 2IXSA 2HTSA 2BYVE 2V9KA 2CRGA 4OMYA 1ETYA 2XGCA 4JOMA 5HDNA 2QVOA 1T38A 1I27A 2ZXWH 3FX3A 1SMTA 2WAQA 1QPIA 4AIHA 1ETVA 4XKWA 1T33A 4ESJA 3S3MA 1HXDA 4KIBA 1PP8F 5AIPA 1K79A 2GAUA 3K0LA 2Y75A 5HNHA 2LKPA 3H9QA 5H6QA 1FWZA 3KP4A 1WI9A 2X1DA 2FA5A 1F36A 2K9QA 4ZYEA 3DPLC 2ME6A 1A04A 2EWNA 3CDHA 4FX0A 1T39A 2FF4A 2WAFA 1N78A 1MBGA 4M74A 3U1KA 3LSHA 3L2WA 2VONA 2X1EA 3CP8A 2VKVA 3DXJF 4HV6A 3VOEA 3S14J 1BL0A 2RGVA 1B6AA 1VQOI 4F92B 2X48A 3H0DA 4DZPA 2K86A 3PIOF 4L9TA 1XSDA 2HPMA 3JCUC 2GXBA 1O3RA 3C3WA 2DDAA 2CV1A 5E8GA 4Z2YA 2DT6A 1YS6A 2J5OA 4WXDA 3JRAA 1H89C 2XF7A 3CP2A 2CQQA 4XK4A 3VEPA 1FBUA 3BOQA 2M8EA 3HUGA 3QAHA 5FKLA 2E7XA 3KIOA 2MC4A 1B8IA 1PVEA 1X3UA 3E5XA 5IP9J 2LNBA 2VE8A 4I0AA 1YI2I 2NOGA 4BY1J 2VPLA 1TWGJ 4B48A 1X1PA 4DBRA 2E71A 2ISYA 3ZMDA 5D5VB 4ZZDA 2PEXA 4HV5A 2DJNA 1GUUA 5LHHA 5C4XJ 3FXKA 4F93B 5JVGF 3X2QH 4IHYA 1TBXA 3I3LA 4PSXA 3G71I 4V2GA 3HIFA 3S1QJ 2BV6A 4RBOA 1MH3A 3TBIA 1A5JA 2L9SA 2P7VB 5FLXZ 4W1UA 2DXIA 4CDGA 1YJWI 1XB4A 4RB0A 1EKEA 3IHUA 2QLZA 3J7AY 5GPAA 1EA3A 4W97A 5ERIA 4CHUA 3BR3A 2Y48A 2JQ7A 1T56A 3K7AJ 4LMYA 3L2QA 3EPZA 4ZC3A 3Q5FA 3H92A 1OLTA 1O3TA 1ZK8A 4S0HB 4N9IA 3IH2A 2WADA 2NXNB 2GIZA 3ABKH 3IP4B 1QVUA 2EIJH 3BZKA 3PUBA 2PBIA 2Q0OA 2XRLA 4DYQA 5E18F 3BP8A 1MBFA 5D5UB 4HPQA 2OJED 5F0FA 2V1XA 3WTVC 3OYKA 1G3WA 2FEZA 3PSIA 1ZYRF 3V8JA 4GGGA 5M5YJ 1K4TA 5KNLA 2HVSA 2A5YB 2M0CA 4WX9A 1X3WB 2BW3B 1BN5A 1BBYA 2CO5A 3FK6A 2D45A 4IVNA 3SFZA 3BG3A 4M71A 1GXQA 4G6TB 4M9XA 1OCPA 3K4LA 3LSGA 1VQ7I 2HXOA 3H3UA 3CCUI 1RZ4A 1OMIA 3KETA 1R4NB 4BE1A 1QGPA 3OR2C 2JPCA 4XORA 2ZJQF 5FLXK 4JK1X 3LSIA 1QZYA 1WJBA 1I1GA 2ESNA 5LEJA 1P7IA 3A0HC 1N77A 3HGYA 1MIJA 2L9VA 4ZH4F 3EYYA 4E7HA 4PGGA 4AC0A 3FM3A 3KLOA 4B1RA 4D9JA 2VJ5A 1ZH5A 5D4RA 4XBFA 1I1SA 1XGSA 3MD2A 4Y33A 1MDMB 3T0YA 4ZDLA 4U7DA 2B0LA 1ETXA 3ULQB 1HCRA 1IRXA 3K4BA 1E3OC 4UVBA 3OR1C 1TWFJ 3FDYA 1R22A 2P8TA 3MEXA 2FU4A 3HSEA 3FKJA 3RQ4A 4OAYA 3ZCOA 5J4VA 5ICEA 3I71A 1R58A 1RKTA 3G6EI 2DA4A 1R36A 1ETKA 2ETHA 5BPIA 2OBPA 1LE8A 2W85A 3BR0A 1BIAA 4BEHA 2R0QC 2IJLA 1HW5A 2WAQN 3BTIA 3FXJA 4LK0F 2UWMA 2KIMA 2V1DA 1FLIA 3FK7A 5E3MA 4GFBA 2L4MA 3I54A 1J59A 4AIDA 1G3TA 2FOKA 1DGRM 5TISC 3DV8A 4KITB 5LRSA 5ILUA 5B5EC 2AQEA 2GOXB 5E20A 1W0TA 3ELKA 1NHAA 1T2KA 3PJRA 3OMYA 3PFIA 4H4KC 2X6WA 1BC8C 5IT9Z 3V8KA 1F43A 3R0JA 2STWA 4MHGA 3R60A 4JX6A 1JT0A 4UNOA 5GAGJ 2DCEA 4XLHA 2HU9A 4V19K 1PYVA 2R7WA 3BR2A 3S2DJ 2E1OA 2RAEA 3D5LA 1OCCH 1WJ5A 4GDFA 3IWZA 3ECOA 4EGYA 3DTIA 4A0XA 3TOBA 2PX9A 2XV4S 4I2OA 4E7JA 2VPRA 2QWWA 1O4XA 1QA6A 1XX5A 1S7AA 1HW1A 1ZN2A 2DFFA 2VJ4A 5LHGA 4JX4A 2A6TA 4OMZA 3RYPA 5HS7A 2F48A 2BOLA 2ECCA 2KJBA 1XCBA 5DCMA 4MIMA 1KU3A 3G1LA 3FM5A 4NQWB 3CMEI 3HHHA 4L9VA 1R9TJ 2MLGA 2DBBA 2LVSA 1C0WA 2EA4A 2K7LA 2O5RA 4A69C 3Q9VA 1SMYF 4RB3C 3CCEI 4P96A 2E5ZA 5IYBJ 3ERMA 1YFHA 4S04A 1Z3YA 4AWXB 4ENMA 2LK2A 2CFOA 4MNUA 5IT9K 3RQIA 2JSCA 5F04A 2P5LC 3JSOA 4IHWA 3GUDA 4BACA 3V4GA 2K9MA 5EZHA 4UY8I 2M9HA 3KZIC 1X1CA 2XDVA 2QGUA 5HLTA 2HR3A 2RVCA 3J80Z 3CDIA 3TW7A 3HOTA 2VKDA 2CW8A 3TO6A 3H9JA 4UB8C 2BZTA 1RIOH 1JT6A 2ZJ2A 4OIQF 2DPUA 2F5EA 3MKWB 2W84A 4BGDA 2BVLA 5L3EA 3D0SA 2V9PA 4G9YA 4DOZA 4Y13A 3DF8A 4JBAA 5K7ZA 2M1BA 3SHFA 3NRVA 2V1NA 5C44J 4HLYA 1A35A 1Z0XA 2L02A 4RGXA 2PG4A 2QUFA 4DW6A 1AKHA 1F4KA 2P5KA 3GEZA 2XHKA 4LLNA 2WC2A 2DLLA 2DMTA 3I4MJ 2MH9A 3P9KA 4DNCA 1ZARA 4HEA2 3AKZA 1IRFA 1D3YA 4I6ZA 3R61A 4WCGA 2L7ZA 3BG5A 3AAFA 1TNTA 1BI3A 2E60A
chains in the Genus database with same CATH topology
2AQFA 1S9HA 2W1OA 3K10A 3H9GA 2R7SA 1MNEA 4DIQA 2OUMA 3MKYB 2W82A 1SFKA 1AA7A 1WJAA 3DPTA 3PFYA 3BCAA 2JUGA 4YRVA 3F9KA 4AU7A 2MYSA 2IGNA 1UAAA 4LG3A 4E7IA 3DKYA 4GRIA 2R7XA 2PMZA 2ELJA 3ZXSA 4IKFA 1HA8A 4P1WA 1Z21A 2IS4A 1ERDA 2KZVA 4RM2A 4XLAA 5HOOA 4HNUA 3ZQQA 1T95A 2L9NA 5HNFA 2KDOA 4HNTA 3DTKA 4ITVA 3AFHA 3K70D 1PJRA 4KJZA 4B44A 3S8PA 3S3OA 2M0MA 1Y56A 3DQVC 2OC6A 4EATA 4OWRB 3M8JA 1NG7A 3LSKA 3OIQA 3VYTB 1WJFA 1GLNA 2CW7A 3QYBA 1ZELA 4PJNA 3OYLA 4F52A 4PJJA 3HUGB 4BJ6C 4XR6A 4NC8A 2WY8Q 1YX3A 2VKHA 4XN0A 3VWBA 4NNJA 3PNYA 1X4PA 2V26A 3SZGA 2WY7Q 4MLOA 4CCOA 3UNGC 2IGKA 2K3PA 2XAUA 4XKVA 3D5SC 3S3NA 3OYFA 5KCMA 3NWSA 3CMMA 4RMNA 2JVGA 1DQUA 1Y6IA 3DKXA 2QKMB 2HDWA 3E0JB 3H5NA 3QYEA 4IQ4A 3ZGKA 4DGWB 1W36C 3RPUD 3OIPA 1D1BA 1Z3XA 3SEZA 1BR2A 3M1CA 3PNTA 3H5RA 1D1CA 4BQNA 1J09A 1LFPA 4PFPA 5FRMA 3VSKA 3OL3A 3FHNA 4ZJZA 2CUJA 5CKTA 3OYBA 3QODA 2WA0A 4BE0A 2NOJB 4RM3A 4BE2A 4U87A 3I9V2 4XMYA 1U0JA 4ZDPA 4LIUA 4BJTA 3FBNB 3PNVA 3HC7A 2M4GA 5CQEA 3A4CA 2VXZA 2LOOA 4E7ZA 3RCOA 2RQQA 2HVQA 3H35A 4XLCA 2IXSA 3HL2A 2V9KA 4JOMA 1WJEA 4ZYAA 1R6RA 4ZTFA 3A1YA 2KPMA 2KP6A 2M7AA 2WAQA 3OYNA 2VIXA 4XKWA 1P9QC 4PJMA 3S3MA 1FMVA 2BVMA 4RLQA 2R7VA 2UV1A 3RSNA 3AL0C 2VJJA 4CSWA 3OWTA 4ZDOA 2ZSIB 4QPOA 2FUG2 5HNHA 3OYGA 2LG4A 3OS1A 4PFOA 4II3A 3H9QA 2CH0A 2X1DA 4PK4A 3DEEA 3DPLC 3OOUA 4BUPA 3DWLE 1LKXA 2X1CA 1N78A 2WAFA 4PUSA 3FBIB 4XQFA 3LFUA 4OAZA 3LSHA 2R7OA 3L2WA 4PSWA 2X1EA 3CP8A 3DU5A 2UUZA 4HSTA 1BR1A 3HOSA 2DOAA 4IQJA 1QU3A 3SEQA 2KHMA 4F92B 1G8XA 3HXLA 3H0DA 4J00A 1W36D 2Q1ZB 1QHGA 2HPMA 1V5GA 4CCMA 4II2A 4BS9A 2MFZA 2CV1A 4ZTJA 4LIVA 1MMGA 4FASD 4E7LA 2DT6A 2K9LA 3BLYA 2XF7A 3CP2A 2ZFUA 3OS0A 2PJRB 1E0EA 2ZSHB 4N4OB 2MC4A 3CJRB 2ZXIA 3BG7A 2R7TA 2LH9A 4E7SA 4N4NB 1V5FA 1WJDA 1TZLA 1LDKB 2R7QA 3PL8A 4C30A 4R79A 2X51A 4D1QA 4B48A 2VPLA 2F6CA 3OYCA 4E6KG 2VQCA 4BQOA 2PJRA 1WJCA 4DBRA 1G59A 2HPIA 2VL8A 3L2UA 2VQHA 2JSPA 3QYFA 5FROA 3C2GA 4F93B 2W4SA 3I3LA 4KT6A 2JA2A 4PSXA 3EUKL 1D0YA 4BEHB 4IX7A 4CCJA 3TBIA 3CESA 2L9SA 2IS1A 2DXIA 1SAUA 4JQFA 1Z7LA 2KLOA 4FETA 1DGWY 3J7AY 2Z1DA 1EA3A 4P5OA 3W2AA 2LBFB 3AL0B 1FMWA 1X1DA 3W2VA 1X1AA 1TT0A 3L2QA 2CMPA 3EUHC 3EPZA 4ZC3A 4F3QA 3OY9A 1MW7A 1OLTA 1KONA 1JI8A 2CS3A 2L7KA 1UELB 3DPUA 3S32A 2WADA 3HG9A 2WAEA 3BG6A 3IP4B 4XN3A 3EUAA 3PUBA 2M7BA 4CCNA 3C2HA 4HPQA 1V5EA 2HQAA 4C2TA 3E1SA 3OYKA 3PSIA 1YX5A 4BJ5C 4AVZA 2XSJC 2Z16A 1K6YA 5KNLA 4BDYA 2HVSA 2BW3B 4F91B 4CCKA 1MNDA 2GOMA 3K4JA 3LL7A 2RREA 2W7NA 4G6TB 1QHHD 2DT7B 3K4LA 2P0WA 3LSGA 3QOEA 3S93A 3W2WA 3H5AA 3OS2A 4XONA 1BOBA 2M3AA 3ZRGA 4BE1A 3OR2C 3D5RC 4HSRA 4NUBA 4XORA 3CF2A 2VB6A 3LSIA 1WJBA 5LFAA 4C2UA 1D0ZA 1N77A 4E7HA 3DLAA 2R7UA 3K4MA 2WB1A 4BL0B 4D9JA 2JVHA 2VJ5A 1LVKA 3MD2A 2E1MB 4Y33A 4ZDLA 5TGTA 2R4GA 2IS6A 4DJAA 1IRXA 3K4BA 4PJLA 3OR1C 1OR7C 3N05A 3FDYA 3VYSB 4XKCA 3SYTA 3OYIA 3FKJA 3RQ4A 3IAS2 4OAYA 2HZDA 3ZCOA 3OYEA 2QKLB 1NG6A 3K4CA 3K4NA 2IGMA 5CPRB 2LREA 2MABA 4Y4RA 1BR4A 4LITA 1X4OA 3OYJA 2X6YA 3A2KA 4AYBA 3PSFA 1MMDA 4XM3A 3KYLA 4BEHA 1MMNA 4B47A 4J01A 2VASA 3TMOA 3U21A 4Y3OA 3VDXA 2LC2A 2HVRA 2UWMA 2HNHA 2VJIA 1DP3A 1WFXA 3DTEA 2F4IA 1YE9A 3L2RA 2V6EA 1DGRM 3OYHA 2LBFA 4KITB 4DBQA 3OYMA 2AQEA 2GOXB 4HRIA 3PJRA 3OMYA 2LY2A 3G2BA 4H4KC 4BDZA 2X6WA 3W3CA 4XLEA 4CCLA 4B3XA 3TL4X 3HPGA 2R7RA 2E1MC 3KEYA 4NC7A 2K5CA 2DCEA 4XLHA 2HU9A 4XOPA 3MKZA 5JHFA 1PYVA 2R7WA 3VSLA 4KISA 4CA0A 1VZ0A 3D5LA 3HPHA 3VYRB 2KRHA 2Q2EB 2BW3A 1WJ5A 3LSMA 4HG2A 2WBMA 2X6XA 3DTIA 2I8DA 2XC7A 4ANJA 5LD2C 5FRNA 2XF5A 4X0GA 4E7JA 4CH7A 3KX2A 3BC8A 2VJ4A 2IS2A 2A6TA 2CV0A 2BOLA 2KRCA 2VXDA 2X85A 4NQWB 3CZ6A 4RLFA 4XKBA 3BCBA 2O5RA 4BU2A 3OL4A 1T0FC 1X19A 2E5ZA 1D0XA 2L2OA 2XF6A 4CZCA 1Z3YA 2E5NA 4C9YA 3V42A 2CFOA 4BXFA 4XL9A 2V7FA 3MMYB 4XOTA 4BACA 3UR3C 2K9MA 3LMMA 3DU6A 4E4HA 1D1AA 2IGOA 2W00A 3IUOA 3OYDA 1X1CA 2XDVA 2ZXHA 5HLTA 3CJQB 2L5QA 2KQRA 2A5WA 3SDBA 2CV2A 2LRDA 2M4KA 5KHDA 2KL4A 3HOTA 2VLAA 3NWTA 2VKDA 4B43A 3K6GA 2CW8A 4CUGA 3H9JA 2OV7A 2VQLA 3IAM2 4XLFA 3MKWB 1N75A 4BGDA 2BVLA 2KMUA 2MD0A 2DJIA 4DOZA 3ONQA 2CUZA 3K70C 4XNFA 3RTRA 3VYUB 5HVQC 2V1NA 4YEJA 2LY1A 3GBGA 3K4KA 4YELA 4BQQA 3HKZA 4E7KA 4QPQA 1MMAA 2LYCA 2RNGA 3OYAA 2F5VA 1X1BA 2VQGA 4HEA2 3AKZA 3L2VA 4IZZA 4U7BA 2Y0SA 3ZR8X 1UG0A 4F55A 2Z2SB 2V4JC 2E60A 5CQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJ6 C;  3OWT A;  4BJT A;  3K6G A;  3CZ6 A;  4BJ5 C; 
#chains in the Genus database with same CATH topology
 4UV8 A;  3K10 A;  4UUV A;  5DS9 A;  3H9G A;  2R7S A;  1MNE A;  1O57 A;  1U6G A;  2COM A;  2FD5 A;  2ZCW A;  5B1A H;  1WI3 A;  5E3L A;  2IW5 A;  1FOK A;  5DEQ A;  2WV1 A;  4EGZ A;  2D2W A;  3FMQ A;  2O9L A;  3CLQ A;  1MKM A;  1ZLJ A;  4YRV A;  4RAF A;  2DA3 A;  2XPV A;  3KLN A;  2NVU B;  3G1O A;  4LG3 A;  4E7I A;  4BY7 J;  3G1M A;  2ECB A;  3QPS A;  1P92 A;  2ELJ A;  3CQZ J;  4EEF G;  2E35 A;  4IKF A;  4A3E J;  2A69 F;  2CUE A;  1Z21 A;  2OCE A;  2OTL I;  4H0E A;  4XLN F;  1V3F A;  4P9F A;  4RM2 A;  1PUE E;  3HOV J;  2J5P A;  3M9A A;  4HYE A;  4G7Z F;  1L3L A;  5J1R A;  2R7D A;  5DD8 A;  3HSF A;  3DTK A;  3GW2 A;  3ABM H;  3AG1 H;  4NDL A;  1JHH A;  1PJR A;  2DPD A;  1OCT C;  2H1K A;  3K1M A;  1W7P D;  3S8P A;  2M0M A;  1IGN A;  3HTS B;  1IXS B;  2QEX I;  4A0Y A;  1TL8 A;  2OC6 A;  4HF1 A;  1B4A A;  3OIQ A;  4QWQ A;  2M45 A;  2JWT A;  1ZEL A;  4QLC U;  4I09 A;  3BPX A;  4PJN A;  3OYL A;  2I10 A;  3IRR A;  1XSX A;  3HUG B;  1W5T A;  4XR6 A;  3TW6 A;  4EJV A;  2IRF G;  3GTK J;  4NC8 A;  2L7M P;  1FTT A;  1B8I B;  4YFK F;  3PNY A;  1X4P A;  1IDY A;  5DCF A;  1CQT A;  1XDU A;  4RAG A;  2CSO A;  1Q1H A;  1DPR A;  1G2H A;  2XAU A;  3S3N A;  1I5Z A;  1FBS A;  3FIS A;  2EFO A;  4OOI A;  2JVG A;  2QKM B;  2QF7 A;  3H5N A;  3RDI A;  3ZGK A;  4A3F J;  2BE5 F;  3ZQI A;  3SZP A;  1RI7 A;  2DOF A;  2LFB A;  4BHB A;  3I56 I;  1MZB A;  3ZMT A;  3A03 A;  1J09 A;  4HQE A;  2RDP A;  3VSK A;  4LOC A;  2KIF A;  2HDD A;  2Y31 A;  4RM3 A;  2A05 A;  3MWM A;  2MLK A;  4HF0 A;  3BG9 A;  3BZC A;  3PQJ A;  2BY0 A;  3CCY A;  1E3P A;  4LIU A;  5M3M J;  1ZLK A;  2M4G A;  5CQE A;  3A4C A;  5C4J J;  4KDP A;  3LA2 A;  5FGM A;  4MQV A;  4E7Z A;  1Z05 A;  3IL2 A;  2R5Z A;  2HVQ A;  2X4H A;  1FBQ A;  4ZZL A;  3JRG A;  1D5Y A;  1F5T A;  3BWG A;  1U3E M;  3L2C A;  1I39 A;  3UKG A;  2OZ6 A;  2V9V A;  4RB2 C;  5A2Q Z;  5CVU A;  4A3K J;  1R6R A;  4EM2 A;  4ZTF A;  5E17 F;  3A1Y A;  4Y15 A;  1FJL A;  4CYC A;  3OYN A;  2VIX A;  4EMS A;  3ECH A;  1FMV A;  3CC4 I;  2OTJ I;  1TQP A;  2Y30 A;  5F08 A;  2XAH A;  2UV1 A;  5AIQ A;  4G7H F;  4HZF A;  4A93 J;  4QPO A;  2FUG 2;  3OYG A;  1RPW A;  2QQ9 A;  3ASO H;  5FFX A;  3OS1 A;  4IO9 F;  4PFO A;  4O3M A;  4II3 A;  3B02 A;  2I5U A;  3GTL J;  3V7S A;  3WTY C;  2P6T A;  2HOS A;  1LEB A;  3WTU C;  3PUF A;  3OSG A;  2X1C A;  4PUS A;  3FBI B;  3LFU A;  4OAZ A;  1JGS A;  1GV5 A;  1S3J A;  5DYM A;  2Z9O A;  2ZME A;  3DU5 A;  1NTC A;  3J81 Z;  4HST A;  3HOS A;  4EJT A;  2NVQ J;  3HJE A;  3HXL A;  1I50 J;  2A6H F;  5F1J A;  1QHG A;  2FRH A;  2OAZ A;  1F1Z A;  4CCM A;  3TO9 A;  1XCV A;  2ZKZ A;  4LIV A;  1MMG A;  2K9L A;  2CQK A;  2VBZ A;  4FHT A;  3ISP A;  2FSW A;  2ZBK A;  3CJR B;  5D8K B;  5M5X J;  3BG7 A;  5A2Q K;  2H09 A;  2LH9 A;  3JR9 A;  2VBY A;  1A6Q A;  4E7S A;  2ELK A;  1P4X A;  1WJD A;  2NVY J;  1SFE A;  1TZL A;  2W24 A;  1LDK B;  3PL8 A;  5DDG A;  1P7J A;  4E6K G;  2BXZ A;  2XRN A;  4BQO A;  5EGO A;  1G59 A;  3H0G J;  3L2U A;  1XGN A;  3QPT A;  1YLF A;  2E2I J;  2IBD A;  1R71 A;  1LE8 B;  4KT6 A;  2JA2 A;  3RPU A;  2MGQ A;  3U1D A;  3AG3 H;  4BEH B;  4CCJ A;  5ICC A;  4XLP F;  3S16 J;  2IS1 A;  1WHU A;  1DGW Y;  3FHZ A;  2K02 A;  2FE3 A;  3SFI A;  3GME A;  5BNG A;  2UXX A;  4P5O A;  1DUX C;  1FMW A;  5GAD J;  1X1D A;  3W2V A;  5CVV A;  4C3J J;  1TT0 A;  2A6E F;  2ZB9 A;  3RIR A;  4F3Q A;  3OY9 A;  5D5X B;  4G7O F;  1UEL B;  1RR8 C;  1R1U A;  2VT2 A;  2XPU A;  3HRS A;  4JYK A;  4BAY A;  4XRM A;  4IOC F;  3HG9 A;  1Q1V A;  2KIU A;  5KVR A;  1WWX A;  4XN3 A;  1A31 A;  2M7B A;  1IO2 A;  5IYD J;  3I4P A;  1LVA A;  1HDD C;  3C2H A;  2KKO A;  1TQI A;  2GXA A;  3GWZ A;  1YO5 C;  1ACI A;  4GYI A;  1YX5 A;  5D6F A;  1BM9 A;  1R5G A;  2R7F A;  3M8F A;  3WG7 H;  2Z16 A;  1K6Y A;  1GDT A;  5GTH C;  2R5Y A;  1BC7 C;  3CC7 I;  1TW3 A;  1YS7 A;  3WTX C;  1I6X A;  2L54 A;  4F91 B;  2YU9 J;  2RRE A;  2LMD A;  2AS5 F;  1QHH D;  1SD4 A;  3CLO A;  1RR7 A;  4HOB A;  4XON A;  1BOB A;  5CVI A;  3RKY A;  1W0U A;  5C3E J;  3B73 A;  4HSR A;  4NUB A;  5H20 A;  1H8A C;  5DCM B;  1QBJ A;  3JAM Z;  2A3S A;  1ZKG A;  4C2M J;  5IT3 A;  1FYL A;  2DTR A;  5D8L B;  5LFA A;  2HKX A;  1U5T C;  5J3L A;  1ETQ A;  1KA8 A;  2LLK A;  3CCM I;  3HB9 A;  3DLA A;  1FYM A;  2ZXJ A;  5GP9 A;  4LB5 A;  3REO A;  4LG0 A;  1LVK A;  5DUI A;  5ICG A;  1SVO A;  2HZT A;  2DN0 A;  1ODD A;  3F21 A;  1J7K A;  5TGT A;  1LNW A;  3LQQ A;  4PJ0 C;  4RAZ A;  2IS6 A;  4DJA A;  2QSF X;  5HS9 A;  1VND A;  3L7W A;  4G12 A;  4XKC A;  3SYT A;  3RZO J;  2F4O B;  5CJ9 A;  4D7N A;  4AM3 A;  2Y0M A;  4M9Z A;  5FKN A;  1GVJ A;  2QKL B;  3K4C A;  5CPR B;  4ASN A;  2VC0 A;  2LTP A;  4Y4R A;  4LIT A;  1X4O A;  2XIG A;  3BTJ A;  4AYB A;  1HBX G;  4XM3 A;  2R3S A;  4M73 A;  3KYL A;  3HM5 A;  4B47 A;  1ON1 A;  1WVR A;  3U21 A;  3VDX A;  2XRO A;  2HTJ A;  3W6K B;  1U8R A;  2FQ4 A;  3DBH B;  5E1W A;  5DD4 A;  4M9S A;  4ENN A;  2DQL A;  3CF5 F;  1SVL A;  1YE9 A;  1X2M A;  2XGE A;  3ZN0 A;  4BH9 A;  3L2R A;  2V6E A;  1QRY A;  3JAM K;  2TCT A;  3FXM A;  4DBQ A;  4UUS A;  1AKH B;  2DK5 A;  3CO6 C;  4HRI A;  1YOV B;  2GA2 A;  1YW8 A;  1SFO J;  4BDZ A;  2F2E A;  5TRD A;  2HFH A;  3V8L A;  3TDU C;  2DO7 A;  4B3X A;  3HPG A;  3F8N A;  4NC7 A;  2DA2 A;  2L01 A;  4HNV A;  2DW4 A;  3MKZ A;  5JHF A;  5EZG A;  1HC8 A;  1YW7 A;  3WGG A;  5HLI A;  2XGD A;  1LEA A;  4WF2 A;  2DYS H;  1J75 A;  1V4R A;  4NBQ A;  2DAO A;  5JR3 A;  1CF7 A;  4DYC A;  1YJN I;  1U9O A;  1SD5 A;  2Y2Z A;  3QP6 A;  4ANJ A;  5LD2 C;  1MJB A;  5BQT A;  1FC3 A;  3DBR B;  3T8R A;  1OFC X;  2IS2 A;  3E5U A;  5BS6 A;  1QU3 A;  1Z6R A;  2HEO A;  1RRJ A;  3VPR A;  2KRC A;  2X85 A;  4YFX F;  3ZMU A;  2YU3 A;  1XMX A;  1VQ8 I;  2V1U A;  4IRH A;  2K40 A;  1KQ0 A;  4LGW A;  3KPH A;  4BU2 A;  4FE7 A;  1QO0 D;  3MVP A;  1FZP B;  4HQM A;  1FEX A;  1N25 A;  2E5N A;  3V42 A;  1YTY A;  1USS A;  3MMY B;  3KZZ A;  1R23 A;  1ZHF A;  5FD6 A;  1ZRD A;  3UR3 C;  3S17 J;  3DU6 A;  3I53 A;  1D1A A;  3HOU J;  2IGO A;  3MZH A;  3IUO A;  2HQN A;  1EH8 A;  1B9N A;  2NRA C;  2DU9 A;  2HKO A;  4CYD A;  2WTE A;  2P5V A;  1SVM A;  2HYG D;  4IHS A;  4A3B J;  3BR6 A;  3NWT A;  3K6G A;  1LQ1 A;  2Q8K A;  4CUG A;  3PM1 A;  4RAY A;  2VKE A;  1ZAO A;  2LKX A;  3TED A;  4OIO F;  1N75 A;  4U0W A;  2OA4 A;  2HI3 A;  3J7Y J;  4CGZ A;  3O3K A;  4D7M A;  3VOD A;  4G6Q A;  3JSP A;  1ONV A;  2B63 J;  1UG2 A;  3HKZ A;  4XRS G;  5HDK A;  3I59 A;  1MMA A;  2JK3 A;  4FQG A;  2LYC A;  3OYA A;  2A61 A;  2F5V A;  2DTZ A;  3B6A A;  4A0Z A;  2O61 A;  2VQG A;  4IZZ A;  4AD9 A;  2HQR A;  3PO2 J;  4RA2 A;  5L3F A;  2G9W A;  3JTG A;  1LPQ A;  2Z2S B;  1E0E A;  1O7L A;  1S9H A;  2Y9Z A;  4ETS A;  2R5Z B;  3WTS C;  3MN2 A;  3CUO A;  1UJ8 A;  4KFC A;  1QPM A;  2KFD A;  3MKY B;  1BOA A;  4LLL A;  3WU1 B;  2F4M B;  4L0Y B;  1IDZ A;  4IRI A;  2CQX A;  1SFK A;  2FNP A;  1U8B A;  2W25 A;  5J8C A;  1AA7 A;  1OIS A;  1S7O A;  5EG0 A;  3LNQ A;  3WGH A;  2F5F A;  2Q2E A;  4HAM A;  3PFY A;  1U5T A;  5BPD A;  3U9G A;  1POG A;  2PFB A;  4M72 A;  4AU7 A;  1P6R A;  2IT0 A;  4NB5 A;  4PDK A;  4CYC B;  1QZZ A;  2R7X A;  2FMY A;  2PMZ A;  4AIJ A;  1UFM A;  4O5V A;  1CGP A;  1JJ8 C;  1DU6 A;  6PAX A;  1HLV A;  2JMW A;  1MBE A;  2EZH A;  4P1W A;  4OIN F;  1ZGJ A;  4I02 A;  3EET A;  2ZJP F;  2IS4 A;  1OCO H;  2LY9 A;  5CYV A;  3TOA A;  1L0O C;  3ABU A;  3FXL A;  2E7W A;  4CZZ A;  2L9N A;  5M3F J;  1HKT A;  2HOT A;  3MQ0 A;  2KDO A;  4AYB N;  5LBQ A;  2MSY A;  4BXX J;  4M6Y A;  2EZL A;  1MD0 A;  3KP7 A;  3MKL A;  2ZME B;  3AFH A;  2M8G X;  3J7Z I;  4A3L J;  3K70 D;  2NS8 A;  1G3Y A;  4IEJ A;  4KJZ A;  3S3O A;  4ON0 A;  3COA C;  5FKO A;  2TRT A;  4XIC A;  1Y56 A;  3DQV C;  2XAG A;  4A3G J;  4OWR B;  1V55 H;  1VQ6 I;  4X1E A;  1QVT A;  5KAI C;  1WJF A;  1GLN A;  3QPL A;  2DFE A;  4G6D A;  2A07 F;  3E97 A;  2IA1 A;  2LKS A;  4F52 A;  4BJ6 C;  3NEU A;  2JA8 J;  1JTY A;  2STT A;  2WY8 Q;  2VKH A;  5KK1 A;  4ZYH A;  4NNJ A;  2GQQ A;  4MLO A;  4CCO A;  3UNG C;  1B72 A;  3KP3 A;  3CCQ I;  2IGK A;  3D5S C;  3FMR A;  2WWY A;  4HX8 A;  3JRI A;  5FKK A;  4ENK A;  4RMN A;  2DA5 A;  1P4W A;  1XMK A;  1Y6I A;  2HDW A;  4IQ4 A;  5EGO B;  3QYE A;  4A12 A;  2P4W A;  1OYY A;  3OIP A;  1D1B A;  3SEZ A;  5L3C A;  3RI4 A;  4HF2 A;  1PDN C;  2X6O A;  3L09 A;  3M1C A;  2QQ8 A;  4HX7 A;  5BOX A;  4KIC A;  4Y17 A;  3VFZ A;  4YII A;  5F1R A;  5J4Y A;  4UHT A;  1S8N A;  2B7E A;  2G7U A;  3QOD A;  3GX4 X;  3JRB A;  1TP4 A;  4BE0 A;  2ID6 A;  3FXQ A;  5JLW A;  3G73 A;  2KIS A;  4K2E A;  1MJ9 A;  5IOY A;  2XB0 X;  2E1C A;  1U0J A;  4ZDP A;  1RET A;  2BY2 A;  5CLS A;  2ZME C;  4OIP F;  1Y0U A;  5JHU A;  3SDG A;  2EA2 A;  2VXZ A;  1FP2 A;  1KU9 A;  4LFU A;  1H9G A;  4IXA A;  3TP0 A;  4XLC A;  4CXF A;  3TDZ C;  4L9J A;  1OJL A;  4YIF A;  1Z7U A;  2LP0 A;  4WK8 F;  5J1U A;  3LAJ A;  5DV5 A;  1HDP A;  3F8M A;  5F6F A;  3FKI J;  3HDD A;  3GZ5 A;  2JA7 J;  2KPM A;  2EFQ A;  2M87 A;  3TO7 A;  4CIC A;  5ED4 A;  2DMN A;  4PJM A;  3DKW A;  2ZO4 A;  1S72 I;  3K9T A;  3HOZ J;  2BVM A;  1R4M B;  1FSH A;  4Y52 J;  2R7V A;  3O8G A;  2Z5U A;  5TJJ A;  3RSN A;  3AL0 C;  2XVC A;  1S6L A;  3OWT A;  3P9I A;  4ZDO A;  1HQC A;  2LG4 A;  2DMQ A;  4RGU A;  1BI2 A;  3LAP A;  2R5Y B;  4PK4 A;  5LEK A;  1IXR C;  2EQR A;  2PI0 A;  2LSO A;  3DEE A;  4BUP A;  3GFI A;  4D5C A;  1E17 A;  4BXU A;  1LKX A;  3R4K A;  1MGT A;  4C3H J;  4DZJ A;  1PUF A;  1KU7 A;  2DQR A;  2CJJ A;  4QTR A;  5IPA A;  5L3B A;  1BR1 A;  3MZY A;  3J80 K;  2KHM A;  1H9T A;  2NNN A;  1G8X A;  4J00 A;  1W36 D;  1TWC J;  4A3I J;  3QRF F;  5K5Q A;  5E8I A;  3GTJ J;  1V5G A;  3M8E A;  1VQ4 I;  4II2 A;  3EDP A;  4BS9 A;  4ZTJ A;  2CFX A;  3HKZ N;  4E7L A;  2ZNZ A;  3T8T A;  1W7P A;  2BHZ A;  1FIP A;  2JRM A;  2ZFU A;  3OS0 A;  1UHW A;  1GVD A;  3CC2 I;  3ABT A;  4LG0 B;  4XSZ F;  2H8W A;  3GTP J;  1TW2 A;  1JKP C;  1WSU A;  3T5X A;  2EFP A;  3GLX A;  3ERE D;  4N4N B;  1V5F A;  1ZR4 A;  4IHT A;  2X51 A;  1JKO C;  2VQC A;  4S05 A;  2O03 A;  2PJR A;  1WJC A;  1SD6 A;  2QSG X;  2FX0 A;  1ITY A;  2VL8 A;  1FX7 A;  2VQH A;  2JSP A;  1ZG1 A;  3QYF A;  3C2G A;  4M3F A;  2GBY A;  1D8K A;  1KU2 A;  5CVR A;  1RNL A;  2O8K A;  2XKP A;  3S2H J;  3F72 A;  4UXN A;  2ELH A;  3EUK L;  1D0Y A;  4IX7 A;  3DBL B;  5EF6 A;  2PMZ N;  4JQF A;  1JGG A;  1QQI A;  1EF4 A;  1OPC A;  3IC7 A;  2ZNY A;  5HLH A;  1S29 A;  5M5W J;  3M07 A;  2NNY A;  2E1N A;  2DDB A;  2X9D A;  4UUS B;  2KDZ A;  1W5S A;  2CMP A;  3EUH C;  4KT5 C;  1JI8 A;  1MW7 A;  2QZ8 A;  1SC7 A;  2CS3 A;  2EV6 A;  3GXO A;  1O3S A;  1K78 A;  2YUS A;  5K5O A;  3DPU A;  2LR8 A;  3S32 A;  1XPX A;  3I5U A;  2WAE A;  4ABZ A;  3BG6 A;  3O6B B;  2Z99 A;  5HDG A;  3L00 A;  5EEG A;  1R1T A;  5DM7 F;  4PGH A;  1XN7 A;  2DK8 A;  2E2J J;  2HQA A;  3E1S A;  2JZY A;  5ILS A;  2XSJ C;  2MC3 A;  2NVT J;  1ZGA A;  1IAW A;  1IUF A;  4BDY A;  4M3D A;  1TC3 C;  1GHC A;  5B3S H;  1SAX A;  1CF7 B;  3IH3 A;  5FLM J;  2GOM A;  1FPQ A;  3K4J A;  3LL7 A;  4KA4 A;  2W7N A;  1REP C;  5F64 A;  1A36 A;  1JUM A;  4WWC A;  2DT7 B;  3W2W A;  2P0W A;  2XAS A;  3OS2 A;  3FWE A;  4MTE A;  1PP7 U;  4X6A J;  3TGN A;  3A01 A;  1TNS A;  4DYR A;  4EM1 A;  2HXI A;  4GO1 A;  1T8I A;  4HW0 A;  3ZRG A;  4U0V A;  4N0B A;  4JP0 A;  3QU6 A;  3HGG A;  2FNA A;  2VB6 A;  4BBR J;  2H94 A;  3KFW X;  5DM6 F;  3IKT A;  1IJW C;  1YG2 A;  1R00 A;  5J40 A;  2QQA A;  3ABL H;  4C2U A;  1XTA A;  1D0Z A;  2H8R A;  4IHX A;  2COB A;  3IH4 A;  3K4M A;  1S7E A;  4L5J A;  3CCS I;  2E1M B;  1FTZ A;  1UZC A;  2GXG A;  1LJ9 A;  1OR7 C;  1YQA A;  3N05 A;  4LLG F;  2FBK A;  1ZRE A;  1XMA A;  3RKX A;  3IAS 2;  2HZD A;  3OYE A;  1TTY A;  4EV0 A;  1NG6 A;  2CQN A;  4LD5 A;  4BKX A;  2IGM A;  1IN4 A;  4B4C A;  3M1E A;  2LRE A;  3WE2 A;  1Y8Q B;  1WPK A;  1FT9 A;  1MBJ A;  1TT5 B;  2KRF A;  1Z91 A;  2X6Y A;  2L9R A;  3PSF A;  1MMD A;  2M30 A;  1JJ6 C;  3BY6 A;  3F0C A;  3OIO A;  1MMN A;  3QP5 A;  4J01 A;  4KMU X;  1NH3 A;  3I58 A;  3E5Q A;  3OSF A;  3C18 A;  5HLG A;  3MAJ A;  2VE9 A;  3RKQ A;  5K1Y A;  2DA1 A;  2B9S A;  2HNH A;  2IVM A;  1DP3 A;  2EFW A;  4QIW N;  3ZOB A;  3HRT A;  3QPH A;  1A6I A;  3HEF A;  1RUO A;  3OYH A;  2HGC A;  2LBF A;  4LJZ F;  1ETO A;  3I59 B;  2OZU A;  5E1Z B;  5EYR A;  2DMP A;  4KNY A;  1ORK A;  5B1B H;  2EIK H;  3N4M A;  3U2R A;  3O8H A;  3GYH X;  2M5W A;  4Y7N J;  1IZ1 A;  2H6B A;  3G2B A;  4NHJ A;  3RYR A;  3W3C A;  1FOX A;  3OOP A;  2ME0 A;  2LF8 A;  4RGR A;  2VI6 A;  4CCL A;  4Q5S F;  4U88 A;  1SAN A;  3BDD A;  2R7R A;  2E1M C;  3KEY A;  1YIT I;  2MA3 A;  2GZW A;  1W1W E;  2NYX A;  4KIG A;  1VQ5 I;  3F23 A;  3CD6 I;  3FXU A;  5LGN A;  3HYI A;  3KP2 A;  1BJZ A;  2G7H A;  2V6C A;  2CYY A;  1ETW A;  3CMA I;  4CA0 A;  2XAF A;  3KEQ A;  1VZ0 A;  1X58 A;  1YW9 A;  3HPH A;  2MG4 A;  3FXO A;  2KRH A;  3VYR B;  2Q2E B;  5EG0 B;  3J81 K;  4AIK A;  1YRN A;  1STZ A;  1U5T B;  4HG2 A;  3LSM A;  1FP1 D;  4BQA A;  5FFZ A;  3K69 A;  5CVJ A;  3C2B A;  5H2F C;  5F0C A;  3NAR A;  5FRN A;  2XF5 A;  3IWF A;  1WQ2 A;  1I3A A;  5FD5 A;  4CH7 A;  3CCL I;  3SJM A;  1EH7 A;  3KX2 A;  3BC8 A;  2ZC2 A;  1Z77 A;  4A6E A;  1I3Q J;  3M3Y J;  3Q3S A;  4QSH A;  1VTN C;  3T1B A;  1H88 C;  2IPQ X;  2XAJ A;  1WH7 A;  2GLO A;  2QQB A;  1YHQ I;  1JXS A;  1RC9 A;  1IN5 A;  1LFB A;  2GIV A;  5K7F A;  5EEH A;  4IOA F;  1X3Z B;  3SQN A;  3D1N I;  1T0F C;  1X19 A;  5F0H A;  5L3D A;  4I0B A;  2QCO A;  3MZ8 A;  2L2O A;  2XF6 A;  3KE2 A;  4CZC A;  2RC4 A;  3WG9 A;  1DP7 P;  3QU3 A;  4BXF A;  4XL9 A;  3VB2 A;  1VQK I;  2JA5 J;  2ZJR F;  4O6J A;  3LMM A;  4E4H A;  2XGX A;  2KT0 A;  5J8F A;  2P81 A;  3PQK A;  2W48 A;  1TLH B;  2DOE A;  2OU2 A;  1JHF A;  2ISZ A;  3CCV I;  1FYK A;  2EJR A;  2L5Q A;  2H6C A;  2KQR A;  2MW8 A;  2UXN A;  3SDB A;  1D5V A;  4I99 C;  2IA2 A;  2M4K A;  3CUQ C;  2G0E A;  4B43 A;  4B8X A;  5K5R A;  2C6Y A;  2IA0 A;  4A5N A;  2OF7 A;  1GXP A;  3EUH A;  3F8C A;  3JRE A;  3GCM A;  3IAM 2;  1TWH J;  3CMY A;  3S1R J;  1V54 H;  2CU7 A;  2JPB A;  1B72 B;  3AG4 H;  2L4A A;  2KMU A;  3V7C A;  4MFD A;  5HS8 A;  3K70 C;  1WGX A;  2CUZ A;  3IV5 A;  3RTR A;  2VUM J;  2LY1 A;  3GBG A;  2OPT A;  3ESW B;  2BHY A;  1R49 A;  2EB7 A;  4QPQ A;  3Q0W A;  4KUM A;  1LFU P;  1UHS A;  1YYV A;  1U9N A;  1XSV A;  3H1C A;  1X1B A;  3E6C C;  4PZJ A;  2VN2 A;  3JRH A;  2Y0S A;  3RJP A;  3ZR8 X;  3ZQF A;  3P7N A;  2JT1 A;  1ZTR A;  4F55 A;  3F6V A;  2ACJ A;  5CQG A;  1J9I A;  2HS5 A;  2W1O A;  3HTU A;  3WOD F;  2FXA A;  1K4S A;  4GCV A;  3WTZ A;  5JI6 A;  2W82 A;  2HYF A;  3G4S I;  3PO3 J;  4ZYG A;  1WJA A;  2XSD C;  3DPT A;  4ESF A;  4XRS A;  1ON2 A;  3BQY A;  2JUG A;  4M3B A;  1XG1 A;  3GFJ A;  3KYC B;  2DT5 A;  3F9K A;  2MYS A;  1W5C C;  1EJ9 A;  1LUJ B;  3DKY A;  4GRI A;  2EBI A;  5IYC J;  2QA4 I;  4L5E A;  3F8F A;  3ZXS A;  3ZMV A;  1FOW A;  1VQP I;  1HA8 A;  5AON A;  2JJ7 A;  2BY3 A;  1BIB A;  1ERD A;  1OR7 A;  2P7C B;  2CUF A;  4XSX F;  5HOO A;  1T98 A;  1APL C;  3I55 I;  3ZQQ A;  4YG2 F;  1Z9C A;  4ZYD A;  1PUF B;  4IRG A;  5IOZ A;  1TWA J;  1D8J A;  4HA8 A;  1SFX A;  3PIP F;  4A3D J;  4ITV A;  1J0R A;  1WZ2 A;  3LA7 A;  3OV8 A;  1DPU A;  4IPA A;  1G4D A;  3S2W A;  1Y39 A;  3BRO A;  2YR2 A;  4GXO A;  2O7O A;  4N9H A;  1HKQ A;  1LB2 A;  4HBL A;  1KZH A;  2AO9 A;  4EAT A;  4HDU A;  1NG7 A;  2JA6 J;  1MNM C;  4L0Z B;  4R1H A;  3QYB A;  2CW7 A;  1W7P B;  4P9U A;  4YFN F;  4PJJ A;  3ZPL A;  4FTH A;  1BI1 A;  1YX3 A;  3MFK A;  4XN0 A;  1SFU A;  1H0M A;  2V26 A;  3SZG A;  2FBH A;  2WY7 Q;  2RNJ A;  3K1P A;  4L9N A;  2GM4 A;  1R1V A;  2Y69 H;  3OYF A;  1IG7 A;  4MQ9 F;  5KCM A;  3NWS A;  3C7J A;  4XLE A;  1DQU A;  3DKX A;  2PJR B;  3E0J B;  2VOO A;  1EH6 A;  1KYW A;  3V7R A;  2EPF A;  1W36 C;  1Z3X A;  3W6J B;  1FOY A;  3B6C A;  3PNT A;  1HW2 A;  1VQN I;  3FIW A;  1HOM A;  1D1C A;  1O7F A;  2A68 F;  4YIR X;  1MMS A;  3KCC A;  3E6B A;  4PFP A;  4WXC A;  3IKV A;  5FO5 A;  3ZN1 A;  1RES A;  3OL3 A;  3K2A A;  2CUJ A;  1FNN A;  3DEW A;  2XKO A;  4HDV A;  2WA0 A;  4FE4 A;  4KIF A;  4U87 A;  5JFR A;  2DI3 A;  5E3O A;  4KN7 X;  4G94 A;  5E3N A;  1KQ9 A;  3FBN B;  3HC7 A;  3PNV A;  3F22 A;  5E1X A;  1NK2 P;  3JRF A;  4RGS A;  5LHI A;  2EV5 A;  3RCO A;  2QYO A;  3E7L A;  5B66 C;  3H35 A;  5FKM A;  4LB6 B;  1VQ9 I;  4D0P A;  1AU7 A;  3HL2 A;  1ZQ3 P;  5EDN A;  3NQO A;  1WJE A;  5IP6 A;  3QOP A;  4KYW A;  4ZYA A;  4FX4 A;  2EIN H;  5H6R A;  1K78 B;  3WU2 C;  4AVP A;  5J47 A;  3GZ6 A;  4MEX F;  2KP6 A;  2M7A A;  1T0F A;  2ZFW A;  1MSF C;  2F5C A;  1P9Q C;  3LSP A;  4EJU A;  4RLQ A;  2OQG A;  2VJJ A;  2PQ8 A;  3GFM A;  1KGS A;  5DUK A;  4CSW A;  2QBY A;  2ZSI B;  2K9N A;  4BNC A;  1UB9 A;  1TQM A;  2CH0 A;  1HF0 A;  3L9F A;  2X0L A;  3OOU A;  3I64 A;  3DWL E;  4XQF A;  1OCR H;  4MGR A;  2R7O A;  5FLV A;  3G3Z A;  2O3F A;  3CUQ A;  3EQL F;  4PSW A;  4U0Y A;  3LSR A;  4FCY A;  1IV6 A;  3SXY A;  3A01 B;  2JRT A;  2UUZ A;  1IN8 A;  3HRU A;  2DOA A;  2LF7 A;  2OQR A;  4UVC A;  1ZRF A;  3WE3 A;  2EH3 A;  3CJT B;  3SEQ A;  4EJO A;  4IQJ A;  3BZ6 A;  3GO5 A;  4M3G A;  2Q1Z B;  3HHG A;  3TP3 A;  2D1H A;  2TDX A;  4RB1 A;  2MFZ A;  1P2F A;  3WHB A;  5JVT A;  1K83 J;  4FAS D;  4UB6 C;  1ENH A;  2W57 A;  5GPC A;  5K7H A;  2BXY A;  4L18 B;  1F9N A;  3BLY A;  2VOD A;  2BGC A;  4BHP A;  3W6V A;  4Q4Z F;  3JW4 A;  1I6H J;  1LDD A;  2MBF A;  2K9S A;  2ZSH B;  4N4O B;  2R92 J;  3ZMZ A;  2ZXI A;  2R7T A;  2Y0S N;  1R7J A;  3DCF A;  3BPV A;  2PJP A;  4P55 A;  3S15 J;  2KIQ A;  1JUP A;  4C30 A;  2R7Q A;  3ASN H;  4R79 A;  4BBS J;  3E6D A;  4D1Q A;  2F6C A;  3OYC A;  3HOW J;  4UVA A;  2YX7 A;  3DP7 A;  2NVX J;  2HPI A;  4MFE A;  3CCJ I;  2HDC A;  3I4N J;  5FRO A;  3WHC A;  1IW7 F;  2LD5 A;  1T08 B;  4KMF A;  2W4S A;  3ML6 A;  1QNT A;  1UMQ A;  1WH5 A;  2O6G E;  1IUY A;  1E2X A;  5D4S A;  4IL6 C;  1UCR A;  1UST A;  2HQ5 A;  3CES A;  1J5Y A;  3HRM A;  1IN6 A;  1SAU A;  1Z7L A;  4BHC A;  3ZQL A;  1BJA A;  2FJ1 A;  2KLO A;  3FXR A;  4FET A;  3WTT C;  4NC6 A;  1WCM J;  5LRR A;  2Z1D A;  3W2A A;  2KZG A;  4JX5 A;  2LBF B;  3AL0 B;  5ICF A;  1X1A A;  2H1L A;  2M2E A;  3BT9 A;  3ZMS A;  3WGI A;  3H3V K;  3RKW A;  1KON A;  2L7K A;  1P4A A;  4A3C J;  3GFL A;  3IRQ A;  2RV8 A;  1T6S A;  1QZE A;  2FBI A;  3CO7 C;  1IRG A;  2R7Z J;  1U2W A;  2K3F A;  3EUA A;  3LSJ A;  1ULY A;  1XGM A;  1FIA A;  2K4B A;  3SZT A;  4CCN A;  1K6O A;  1V5E A;  5D5W B;  4C2T A;  3BR5 A;  5HOD A;  9ANT A;  1OCZ H;  2K27 A;  4BJ5 C;  4E70 A;  4IJA A;  4AVZ A;  1O3Q A;  2Z33 A;  2DFH A;  1YRN B;  4ENJ A;  2HWV A;  2YS9 A;  2AHQ A;  4MEY F;  2EFN A;  4CCK A;  1MND A;  1Z67 A;  4HLX A;  1ZG3 A;  1K7A A;  3J7A O;  2JUC A;  1AOY A;  3QOE A;  3S93 A;  3F3X A;  3H5A A;  1S5L C;  3DEU A;  3FF5 A;  2QSH X;  3BJ6 A;  4DQ2 A;  2M3A A;  1BW5 A;  2XB5 A;  5J1Y A;  2K4J A;  3D5R C;  3M7G A;  4RDU A;  3FZV A;  2NS7 A;  3CF2 A;  2Z3Y A;  5IY5 H;  2MD5 A;  4IF4 A;  5ILV A;  1E3H A;  1MBK A;  3RPQ A;  5GAH J;  2ESH A;  3C1D A;  2ID3 A;  2R7U A;  3KYD B;  4J19 A;  2K85 A;  2WB1 A;  2PN6 A;  2FQ3 A;  4BL0 B;  4EM0 B;  3ZP5 A;  2JVH A;  5LGT A;  1FSE A;  2HYJ A;  2R4G A;  1MSE C;  3HZJ A;  4OU0 A;  1Y8R B;  1B1B A;  4PJL A;  4M6V A;  4ESB A;  3VYS B;  1IC8 A;  1OYW A;  2D1V A;  3OYI A;  3E6M A;  2FOW A;  2AXT C;  4Q47 A;  3K4N A;  3CCR I;  2YSR A;  2UZK A;  3BJO A;  2MAB A;  4A2U A;  3DLL F;  1SEU A;  2CWE A;  1BR4 A;  1VI0 A;  3OYJ A;  2NAZ A;  3A2K A;  2VBW A;  4B3A A;  1G3S A;  3Q9S A;  1ZGW A;  1ZR2 A;  4TV7 A;  3A0B C;  2VAS A;  3GLL A;  3TMO A;  4Z6Y A;  4Y3O A;  2LC2 A;  2OCC H;  2HVR A;  5E79 C;  2EZI A;  5DTD A;  1R5I D;  1WRJ A;  3RZD J;  1RUN A;  2VJI A;  1WFX A;  3DTE A;  2F4I A;  4EJW A;  4D5F A;  3F8B A;  1B59 A;  3AG2 H;  3OYM A;  2VBX A;  2XUB A;  3ZQG A;  5GTI C;  2IP2 A;  2LY2 A;  3FMS A;  2PMU A;  5GAE J;  2R93 J;  1XDS A;  2LDU A;  4I7H A;  3TL4 X;  2HOE A;  3CTA A;  2PLY A;  2K5C A;  4A3M J;  3LOC A;  4XOP A;  2DA7 A;  4RS8 A;  1HKS A;  3VSL A;  1GV2 A;  3TKY A;  2RN7 A;  3HOY J;  3QQA A;  4KIS A;  2EIM H;  1IRZ A;  3P5J A;  1VFC A;  4A6D A;  3HOX J;  1SD7 A;  2BW3 A;  1JUS A;  1Y0N A;  2JTV A;  3TQN A;  1K61 A;  2EZK A;  2D5V A;  2WBM A;  4Q48 A;  2X6X A;  2I8D A;  3ZQH A;  2XC7 A;  1XS9 A;  1JKR C;  3I0T A;  4X0G A;  1U78 A;  3Q0V A;  2Y9Y A;  3GF2 A;  4GYG A;  3BR1 A;  2L0K A;  1BI0 A;  3ZQC A;  2CV0 A;  2VC1 A;  3JRC A;  2O0Y A;  2OD5 A;  2VXD A;  2DMU A;  3CZ6 A;  1OYI A;  1YIO A;  4RLF A;  4XKB A;  2E36 A;  3BCB A;  3LWF A;  3P9C A;  2RQP A;  4M3E A;  1XC5 A;  1YIJ I;  3OL4 A;  2RKH A;  3BJA A;  3Q0U A;  2V79 A;  1D0X A;  5D6E A;  1JE8 A;  4EQQ A;  4C9Y A;  1MDM A;  1BW6 A;  1MBH A;  2DYR H;  4CO8 A;  5EEA A;  5F27 A;  1Y1W J;  5FJ8 J;  2F5D A;  2V7F A;  4XOT A;  2ADU A;  2CGP A;  2VOP A;  1YJ9 I;  1WKM A;  2BEO A;  4FT8 A;  4I01 A;  2W00 A;  4AUX A;  3OYD A;  2P6S A;  3LQR A;  2YX4 A;  2ZXH A;  3R0A A;  1VQM I;  3CJQ B;  1AWC A;  3H36 A;  2A5W A;  2CV2 A;  2LRD A;  5KHD A;  2KL4 A;  2VLA A;  4F7Z A;  4A5M A;  3GZN B;  2O8X A;  3F6O A;  1JKQ C;  1ZG5 A;  2OV7 A;  2VQL A;  3ROU A;  4EVI A;  5KAF C;  2CW0 F;  5LGU A;  3MCZ A;  4XLF A;  3KP5 A;  3M4O J;  1DDN A;  1XD7 A;  4I76 A;  3HBL A;  2YPR A;  1XGO A;  2MD0 A;  2DJI A;  3ONQ A;  1Z1D A;  3K2Z A;  4XNF A;  3VYU B;  4G8X A;  5JLX A;  5HVQ C;  2CG4 A;  4LK1 F;  3K4K A;  4YEL A;  4YEJ A;  4BQQ A;  4KN4 X;  4FIS A;  4E7K A;  2IEK A;  3KEO A;  3GVA A;  3GTO J;  1Z6T A;  2XPW A;  4PCQ A;  4OIR F;  1KYZ A;  3N97 A;  2RNG A;  3CDL A;  2E2H J;  2ICW G;  1ZRC A;  1R5H A;  1DU0 A;  3L2V A;  3O2P E;  4U7B A;  3JRD A;  2AXL A;  3LFK A;  3BTC A;  2MH2 A;  3KZY A;  1BA5 A;  1UG0 A;  2E34 A;  3BQZ A;  2V4J C;  2AQF A;  2WV0 A;  3S1N J;  4DIQ A;  2OUM A;  4XRF A;  3E3V A;  1IXC A;  1MH4 A;  1NK3 P;  2JN6 A;  3KP6 A;  3BCA A;  3ZQ7 A;  2WB1 N;  4C3I J;  1EV7 A;  3GTG J;  2IGN A;  2IAI A;  1UAA A;  2EK5 A;  2N8G A;  2HOA A;  2QM3 A;  3BTL A;  1G6N A;  1VF9 A;  2QBY B;  1GT0 C;  4NQW A;  2BY1 A;  2PMH A;  5EJC A;  3L1P A;  2KZV A;  4MO7 A;  4XLA A;  1OQY A;  2EV0 A;  5IP7 J;  3R6S A;  4HNU A;  1Y1V J;  2H27 A;  1B9M A;  1T95 A;  3WU0 A;  3EYI A;  5HNF A;  4IHV A;  4HNT A;  3A02 A;  3CUQ B;  5L3G A;  1OKR A;  2NS0 A;  2FML A;  3LST A;  4WXH A;  1IN7 A;  3QWL A;  1FY7 A;  2GA1 A;  3DFG A;  4B44 A;  1LDJ A;  2QEN A;  2EIL H;  2GWR A;  3S1M J;  1KQ8 A;  5FB2 A;  3M8J A;  3K1N A;  3WTW C;  3LSK A;  3JTH A;  3VYT B;  3LA3 A;  5J6X A;  1J2X A;  4L5I A;  1RKW A;  3GTM J;  2DOD A;  4I98 B;  3GTQ J;  3VWB A;  2BBY A;  1VQL I;  1IV8 A;  4HX4 A;  4UUT A;  2K3P A;  4XKV A;  3H3Z A;  3CMM A;  2VT3 A;  5BMZ A;  1X2N A;  4DGW B;  3RPU D;  4MTD A;  1UHM A;  1HST A;  3CJN A;  1BR2 A;  2KJC A;  3HSR A;  5LLQ A;  3H5R A;  4BQN A;  4V2F A;  1LFP A;  1JTX A;  2CQ7 A;  2L7F P;  2L3D A;  4UV9 A;  4R8H A;  5FRM A;  3FHN A;  4ZJZ A;  5CKT A;  3OYB A;  4BYY A;  4A3J J;  2NOJ B;  4BE2 A;  2DFI A;  3I9V 2;  1IF1 A;  4XMY A;  4BJT A;  1AHD P;  1HSJ A;  2XAQ A;  4B09 A;  2M34 A;  4M6X A;  1M1E B;  2DA6 A;  3NAU A;  2LOO A;  1MJA A;  2RQQ A;  4XID A;  1W4M A;  2E19 A;  2IXS A;  2HTS A;  2BYV E;  2V9K A;  2CRG A;  4OMY A;  1ETY A;  2XGC A;  4JOM A;  5HDN A;  2QVO A;  1T38 A;  1I27 A;  2ZXW H;  3FX3 A;  1SMT A;  2WAQ A;  1QPI A;  4AIH A;  1ETV A;  4XKW A;  1T33 A;  4ESJ A;  3S3M A;  1HXD A;  4KIB A;  1PP8 F;  5AIP A;  1K79 A;  2GAU A;  3K0L A;  2Y75 A;  5HNH A;  2LKP A;  3H9Q A;  5H6Q A;  1FWZ A;  3KP4 A;  1WI9 A;  2X1D A;  2FA5 A;  1F36 A;  2K9Q A;  4ZYE A;  3DPL C;  2ME6 A;  1A04 A;  2EWN A;  3CDH A;  4FX0 A;  1T39 A;  2FF4 A;  2WAF A;  1N78 A;  1MBG A;  4M74 A;  3U1K A;  3LSH A;  3L2W A;  2VON A;  2X1E A;  3CP8 A;  2VKV A;  3DXJ F;  4HV6 A;  3VOE A;  3S14 J;  1BL0 A;  2RGV A;  1B6A A;  1VQO I;  4F92 B;  2X48 A;  3H0D A;  4DZP A;  2K86 A;  3PIO F;  4L9T A;  1XSD A;  2HPM A;  3JCU C;  2GXB A;  1O3R A;  3C3W A;  2DDA A;  2CV1 A;  5E8G A;  4Z2Y A;  2DT6 A;  1YS6 A;  2J5O A;  4WXD A;  3JRA A;  1H89 C;  2XF7 A;  3CP2 A;  2CQQ A;  4XK4 A;  3VEP A;  1FBU A;  3BOQ A;  2M8E A;  3HUG A;  3QAH A;  5FKL A;  2E7X A;  3KIO A;  2MC4 A;  1B8I A;  1PVE A;  1X3U A;  3E5X A;  5IP9 J;  2LNB A;  2VE8 A;  4I0A A;  1YI2 I;  2NOG A;  4BY1 J;  2VPL A;  1TWG J;  4B48 A;  1X1P A;  4DBR A;  2E71 A;  2ISY A;  3ZMD A;  5D5V B;  4ZZD A;  2PEX A;  4HV5 A;  2DJN A;  1GUU A;  5LHH A;  5C4X J;  3FXK A;  4F93 B;  5JVG F;  3X2Q H;  4IHY A;  1TBX A;  3I3L A;  4PSX A;  3G71 I;  4V2G A;  3HIF A;  3S1Q J;  2BV6 A;  4RBO A;  1MH3 A;  3TBI A;  1A5J A;  2L9S A;  2P7V B;  5FLX Z;  4W1U A;  2DXI A;  4CDG A;  1YJW I;  1XB4 A;  4RB0 A;  1EKE A;  3IHU A;  2QLZ A;  3J7A Y;  5GPA A;  1EA3 A;  4W97 A;  5ERI A;  4CHU A;  3BR3 A;  2Y48 A;  2JQ7 A;  1T56 A;  3K7A J;  4LMY A;  3L2Q A;  3EPZ A;  4ZC3 A;  3Q5F A;  3H92 A;  1OLT A;  1O3T A;  1ZK8 A;  4S0H B;  4N9I A;  3IH2 A;  2WAD A;  2NXN B;  2GIZ A;  3ABK H;  3IP4 B;  1QVU A;  2EIJ H;  3BZK A;  3PUB A;  2PBI A;  2Q0O A;  2XRL A;  4DYQ A;  5E18 F;  3BP8 A;  1MBF A;  5D5U B;  4HPQ A;  2OJE D;  5F0F A;  2V1X A;  3WTV C;  3OYK A;  1G3W A;  2FEZ A;  3PSI A;  1ZYR F;  3V8J A;  4GGG A;  5M5Y J;  1K4T A;  5KNL A;  2HVS A;  2A5Y B;  2M0C A;  4WX9 A;  1X3W B;  2BW3 B;  1BN5 A;  1BBY A;  2CO5 A;  3FK6 A;  2D45 A;  4IVN A;  3SFZ A;  3BG3 A;  4M71 A;  1GXQ A;  4G6T B;  4M9X A;  1OCP A;  3K4L A;  3LSG A;  1VQ7 I;  2HXO A;  3H3U A;  3CCU I;  1RZ4 A;  1OMI A;  3KET A;  1R4N B;  4BE1 A;  1QGP A;  3OR2 C;  2JPC A;  4XOR A;  2ZJQ F;  5FLX K;  4JK1 X;  3LSI A;  1QZY A;  1WJB A;  1I1G A;  2ESN A;  5LEJ A;  1P7I A;  3A0H C;  1N77 A;  3HGY A;  1MIJ A;  2L9V A;  4ZH4 F;  3EYY A;  4E7H A;  4PGG A;  4AC0 A;  3FM3 A;  3KLO A;  4B1R A;  4D9J A;  2VJ5 A;  1ZH5 A;  5D4R A;  4XBF A;  1I1S A;  1XGS A;  3MD2 A;  4Y33 A;  1MDM B;  3T0Y A;  4ZDL A;  4U7D A;  2B0L A;  1ETX A;  3ULQ B;  1HCR A;  1IRX A;  3K4B A;  1E3O C;  4UVB A;  3OR1 C;  1TWF J;  3FDY A;  1R22 A;  2P8T A;  3MEX A;  2FU4 A;  3HSE A;  3FKJ A;  3RQ4 A;  4OAY A;  3ZCO A;  5J4V A;  5ICE A;  3I71 A;  1R58 A;  1RKT A;  3G6E I;  2DA4 A;  1R36 A;  1ETK A;  2ETH A;  5BPI A;  2OBP A;  1LE8 A;  2W85 A;  3BR0 A;  1BIA A;  4BEH A;  2R0Q C;  2IJL A;  1HW5 A;  2WAQ N;  3BTI A;  3FXJ A;  4LK0 F;  2UWM A;  2KIM A;  2V1D A;  1FLI A;  3FK7 A;  5E3M A;  4GFB A;  2L4M A;  3I54 A;  1J59 A;  4AID A;  1G3T A;  2FOK A;  1DGR M;  5TIS C;  3DV8 A;  4KIT B;  5LRS A;  5ILU A;  5B5E C;  2AQE A;  2GOX B;  5E20 A;  1W0T A;  3ELK A;  1NHA A;  1T2K A;  3PJR A;  3OMY A;  3PFI A;  4H4K C;  2X6W A;  1BC8 C;  5IT9 Z;  3V8K A;  1F43 A;  3R0J A;  2STW A;  4MHG A;  3R60 A;  4JX6 A;  1JT0 A;  4UNO A;  5GAG J;  2DCE A;  4XLH A;  2HU9 A;  4V19 K;  1PYV A;  2R7W A;  3BR2 A;  3S2D J;  2E1O A;  2RAE A;  3D5L A;  1OCC H;  1WJ5 A;  4GDF A;  3IWZ A;  3ECO A;  4EGY A;  3DTI A;  4A0X A;  3TOB A;  2PX9 A;  2XV4 S;  4I2O A;  4E7J A;  2VPR A;  2QWW A;  1O4X A;  1QA6 A;  1XX5 A;  1S7A A;  1HW1 A;  1ZN2 A;  2DFF A;  2VJ4 A;  5LHG A;  4JX4 A;  2A6T A;  4OMZ A;  3RYP A;  5HS7 A;  2F48 A;  2BOL A;  2ECC A;  2KJB A;  1XCB A;  5DCM A;  4MIM A;  1KU3 A;  3G1L A;  3FM5 A;  4NQW B;  3CME I;  3HHH A;  4L9V A;  1R9T J;  2MLG A;  2DBB A;  2LVS A;  1C0W A;  2EA4 A;  2K7L A;  2O5R A;  4A69 C;  3Q9V A;  1SMY F;  4RB3 C;  3CCE I;  4P96 A;  2E5Z A;  5IYB J;  3ERM A;  1YFH A;  4S04 A;  1Z3Y A;  4AWX B;  4ENM A;  2LK2 A;  2CFO A;  4MNU A;  5IT9 K;  3RQI A;  2JSC A;  5F04 A;  2P5L C;  3JSO A;  4IHW A;  3GUD A;  4BAC A;  3V4G A;  2K9M A;  5EZH A;  4UY8 I;  2M9H A;  3KZI C;  1X1C A;  2XDV A;  2QGU A;  5HLT A;  2HR3 A;  2RVC A;  3J80 Z;  3CDI A;  3TW7 A;  3HOT A;  2VKD A;  2CW8 A;  3TO6 A;  3H9J A;  4UB8 C;  2BZT A;  1RIO H;  1JT6 A;  2ZJ2 A;  4OIQ F;  2DPU A;  2F5E A;  3MKW B;  2W84 A;  4BGD A;  2BVL A;  5L3E A;  3D0S A;  2V9P A;  4G9Y A;  4DOZ A;  4Y13 A;  3DF8 A;  4JBA A;  5K7Z A;  2M1B A;  3SHF A;  3NRV A;  2V1N A;  5C44 J;  4HLY A;  1A35 A;  1Z0X A;  2L02 A;  4RGX A;  2PG4 A;  2QUF A;  4DW6 A;  1AKH A;  1F4K A;  2P5K A;  3GEZ A;  2XHK A;  4LLN A;  2WC2 A;  2DLL A;  2DMT A;  3I4M J;  2MH9 A;  3P9K A;  4DNC A;  1ZAR A;  4HEA 2;  3AKZ A;  1IRF A;  1D3Y A;  4I6Z A;  3R61 A;  4WCG A;  2L7Z A;  3BG5 A;  3AAF A;  1TNT A;  1BI3 A;  2E60 A; 
#chains in the Genus database with same CATH homology
 2AQF A;  1S9H A;  2W1O A;  3K10 A;  3H9G A;  2R7S A;  1MNE A;  4DIQ A;  2OUM A;  3MKY B;  2W82 A;  1SFK A;  1AA7 A;  1WJA A;  3DPT A;  3PFY A;  3BCA A;  2JUG A;  4YRV A;  3F9K A;  4AU7 A;  2MYS A;  2IGN A;  1UAA A;  4LG3 A;  4E7I A;  3DKY A;  4GRI A;  2R7X A;  2PMZ A;  2ELJ A;  3ZXS A;  4IKF A;  1HA8 A;  4P1W A;  1Z21 A;  2IS4 A;  1ERD A;  2KZV A;  4RM2 A;  4XLA A;  5HOO A;  4HNU A;  3ZQQ A;  1T95 A;  2L9N A;  5HNF A;  2KDO A;  4HNT A;  3DTK A;  4ITV A;  3AFH A;  3K70 D;  1PJR A;  4KJZ A;  4B44 A;  3S8P A;  3S3O A;  2M0M A;  1Y56 A;  3DQV C;  2OC6 A;  4EAT A;  4OWR B;  3M8J A;  1NG7 A;  3LSK A;  3OIQ A;  3VYT B;  1WJF A;  1GLN A;  2CW7 A;  3QYB A;  1ZEL A;  4PJN A;  3OYL A;  4F52 A;  4PJJ A;  3HUG B;  4BJ6 C;  4XR6 A;  4NC8 A;  2WY8 Q;  1YX3 A;  2VKH A;  4XN0 A;  3VWB A;  4NNJ A;  3PNY A;  1X4P A;  2V26 A;  3SZG A;  2WY7 Q;  4MLO A;  4CCO A;  3UNG C;  2IGK A;  2K3P A;  2XAU A;  4XKV A;  3D5S C;  3S3N A;  3OYF A;  5KCM A;  3NWS A;  3CMM A;  4RMN A;  2JVG A;  1DQU A;  1Y6I A;  3DKX A;  2QKM B;  2HDW A;  3E0J B;  3H5N A;  3QYE A;  4IQ4 A;  3ZGK A;  4DGW B;  1W36 C;  3RPU D;  3OIP A;  1D1B A;  1Z3X A;  3SEZ A;  1BR2 A;  3M1C A;  3PNT A;  3H5R A;  1D1C A;  4BQN A;  1J09 A;  1LFP A;  4PFP A;  5FRM A;  3VSK A;  3OL3 A;  3FHN A;  4ZJZ A;  2CUJ A;  5CKT A;  3OYB A;  3QOD A;  2WA0 A;  4BE0 A;  2NOJ B;  4RM3 A;  4BE2 A;  4U87 A;  3I9V 2;  4XMY A;  1U0J A;  4ZDP A;  4LIU A;  4BJT A;  3FBN B;  3PNV A;  3HC7 A;  2M4G A;  5CQE A;  3A4C A;  2VXZ A;  2LOO A;  4E7Z A;  3RCO A;  2RQQ A;  2HVQ A;  3H35 A;  4XLC A;  2IXS A;  3HL2 A;  2V9K A;  4JOM A;  1WJE A;  4ZYA A;  1R6R A;  4ZTF A;  3A1Y A;  2KPM A;  2KP6 A;  2M7A A;  2WAQ A;  3OYN A;  2VIX A;  4XKW A;  1P9Q C;  4PJM A;  3S3M A;  1FMV A;  2BVM A;  4RLQ A;  2R7V A;  2UV1 A;  3RSN A;  3AL0 C;  2VJJ A;  4CSW A;  3OWT A;  4ZDO A;  2ZSI B;  4QPO A;  2FUG 2;  5HNH A;  3OYG A;  2LG4 A;  3OS1 A;  4PFO A;  4II3 A;  3H9Q A;  2CH0 A;  2X1D A;  4PK4 A;  3DEE A;  3DPL C;  3OOU A;  4BUP A;  3DWL E;  1LKX A;  2X1C A;  1N78 A;  2WAF A;  4PUS A;  3FBI B;  4XQF A;  3LFU A;  4OAZ A;  3LSH A;  2R7O A;  3L2W A;  4PSW A;  2X1E A;  3CP8 A;  3DU5 A;  2UUZ A;  4HST A;  1BR1 A;  3HOS A;  2DOA A;  4IQJ A;  1QU3 A;  3SEQ A;  2KHM A;  4F92 B;  1G8X A;  3HXL A;  3H0D A;  4J00 A;  1W36 D;  2Q1Z B;  1QHG A;  2HPM A;  1V5G A;  4CCM A;  4II2 A;  4BS9 A;  2MFZ A;  2CV1 A;  4ZTJ A;  4LIV A;  1MMG A;  4FAS D;  4E7L A;  2DT6 A;  2K9L A;  3BLY A;  2XF7 A;  3CP2 A;  2ZFU A;  3OS0 A;  2PJR B;  1E0E A;  2ZSH B;  4N4O B;  2MC4 A;  3CJR B;  2ZXI A;  3BG7 A;  2R7T A;  2LH9 A;  4E7S A;  4N4N B;  1V5F A;  1WJD A;  1TZL A;  1LDK B;  2R7Q A;  3PL8 A;  4C30 A;  4R79 A;  2X51 A;  4D1Q A;  4B48 A;  2VPL A;  2F6C A;  3OYC A;  4E6K G;  2VQC A;  4BQO A;  2PJR A;  1WJC A;  4DBR A;  1G59 A;  2HPI A;  2VL8 A;  3L2U A;  2VQH A;  2JSP A;  3QYF A;  5FRO A;  3C2G A;  4F93 B;  2W4S A;  3I3L A;  4KT6 A;  2JA2 A;  4PSX A;  3EUK L;  1D0Y A;  4BEH B;  4IX7 A;  4CCJ A;  3TBI A;  3CES A;  2L9S A;  2IS1 A;  2DXI A;  1SAU A;  4JQF A;  1Z7L A;  2KLO A;  4FET A;  1DGW Y;  3J7A Y;  2Z1D A;  1EA3 A;  4P5O A;  3W2A A;  2LBF B;  3AL0 B;  1FMW A;  1X1D A;  3W2V A;  1X1A A;  1TT0 A;  3L2Q A;  2CMP A;  3EUH C;  3EPZ A;  4ZC3 A;  4F3Q A;  3OY9 A;  1MW7 A;  1OLT A;  1KON A;  1JI8 A;  2CS3 A;  2L7K A;  1UEL B;  3DPU A;  3S32 A;  2WAD A;  3HG9 A;  2WAE A;  3BG6 A;  3IP4 B;  4XN3 A;  3EUA A;  3PUB A;  2M7B A;  4CCN A;  3C2H A;  4HPQ A;  1V5E A;  2HQA A;  4C2T A;  3E1S A;  3OYK A;  3PSI A;  1YX5 A;  4BJ5 C;  4AVZ A;  2XSJ C;  2Z16 A;  1K6Y A;  5KNL A;  4BDY A;  2HVS A;  2BW3 B;  4F91 B;  4CCK A;  1MND A;  2GOM A;  3K4J A;  3LL7 A;  2RRE A;  2W7N A;  4G6T B;  1QHH D;  2DT7 B;  3K4L A;  2P0W A;  3LSG A;  3QOE A;  3S93 A;  3W2W A;  3H5A A;  3OS2 A;  4XON A;  1BOB A;  2M3A A;  3ZRG A;  4BE1 A;  3OR2 C;  3D5R C;  4HSR A;  4NUB A;  4XOR A;  3CF2 A;  2VB6 A;  3LSI A;  1WJB A;  5LFA A;  4C2U A;  1D0Z A;  1N77 A;  4E7H A;  3DLA A;  2R7U A;  3K4M A;  2WB1 A;  4BL0 B;  4D9J A;  2JVH A;  2VJ5 A;  1LVK A;  3MD2 A;  2E1M B;  4Y33 A;  4ZDL A;  5TGT A;  2R4G A;  2IS6 A;  4DJA A;  1IRX A;  3K4B A;  4PJL A;  3OR1 C;  1OR7 C;  3N05 A;  3FDY A;  3VYS B;  4XKC A;  3SYT A;  3OYI A;  3FKJ A;  3RQ4 A;  3IAS 2;  4OAY A;  2HZD A;  3ZCO A;  3OYE A;  2QKL B;  1NG6 A;  3K4C A;  3K4N A;  2IGM A;  5CPR B;  2LRE A;  2MAB A;  4Y4R A;  1BR4 A;  4LIT A;  1X4O A;  3OYJ A;  2X6Y A;  3A2K A;  4AYB A;  3PSF A;  1MMD A;  4XM3 A;  3KYL A;  4BEH A;  1MMN A;  4B47 A;  4J01 A;  2VAS A;  3TMO A;  3U21 A;  4Y3O A;  3VDX A;  2LC2 A;  2HVR A;  2UWM A;  2HNH A;  2VJI A;  1DP3 A;  1WFX A;  3DTE A;  2F4I A;  1YE9 A;  3L2R A;  2V6E A;  1DGR M;  3OYH A;  2LBF A;  4KIT B;  4DBQ A;  3OYM A;  2AQE A;  2GOX B;  4HRI A;  3PJR A;  3OMY A;  2LY2 A;  3G2B A;  4H4K C;  4BDZ A;  2X6W A;  3W3C A;  4XLE A;  4CCL A;  4B3X A;  3TL4 X;  3HPG A;  2R7R A;  2E1M C;  3KEY A;  4NC7 A;  2K5C A;  2DCE A;  4XLH A;  2HU9 A;  4XOP A;  3MKZ A;  5JHF A;  1PYV A;  2R7W A;  3VSL A;  4KIS A;  4CA0 A;  1VZ0 A;  3D5L A;  3HPH A;  3VYR B;  2KRH A;  2Q2E B;  2BW3 A;  1WJ5 A;  3LSM A;  4HG2 A;  2WBM A;  2X6X A;  3DTI A;  2I8D A;  2XC7 A;  4ANJ A;  5LD2 C;  5FRN A;  2XF5 A;  4X0G A;  4E7J A;  4CH7 A;  3KX2 A;  3BC8 A;  2VJ4 A;  2IS2 A;  2A6T A;  2CV0 A;  2BOL A;  2KRC A;  2VXD A;  2X85 A;  4NQW B;  3CZ6 A;  4RLF A;  4XKB A;  3BCB A;  2O5R A;  4BU2 A;  3OL4 A;  1T0F C;  1X19 A;  2E5Z A;  1D0X A;  2L2O A;  2XF6 A;  4CZC A;  1Z3Y A;  2E5N A;  4C9Y A;  3V42 A;  2CFO A;  4BXF A;  4XL9 A;  2V7F A;  3MMY B;  4XOT A;  4BAC A;  3UR3 C;  2K9M A;  3LMM A;  3DU6 A;  4E4H A;  1D1A A;  2IGO A;  2W00 A;  3IUO A;  3OYD A;  1X1C A;  2XDV A;  2ZXH A;  5HLT A;  3CJQ B;  2L5Q A;  2KQR A;  2A5W A;  3SDB A;  2CV2 A;  2LRD A;  2M4K A;  5KHD A;  2KL4 A;  3HOT A;  2VLA A;  3NWT A;  2VKD A;  4B43 A;  3K6G A;  2CW8 A;  4CUG A;  3H9J A;  2OV7 A;  2VQL A;  3IAM 2;  4XLF A;  3MKW B;  1N75 A;  4BGD A;  2BVL A;  2KMU A;  2MD0 A;  2DJI A;  4DOZ A;  3ONQ A;  2CUZ A;  3K70 C;  4XNF A;  3RTR A;  3VYU B;  5HVQ C;  2V1N A;  4YEJ A;  2LY1 A;  3GBG A;  3K4K A;  4YEL A;  4BQQ A;  3HKZ A;  4E7K A;  4QPQ A;  1MMA A;  2LYC A;  2RNG A;  3OYA A;  2F5V A;  1X1B A;  2VQG A;  4HEA 2;  3AKZ A;  3L2V A;  4IZZ A;  4U7B A;  2Y0S A;  3ZR8 X;  1UG0 A;  4F55 A;  2Z2S B;  2V4J C;  2E60 A;  5CQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...