1USTA

Yeast histone h1 globular domain i, hho1p gi, solution nmr structures
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
KEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HISTONE H1
publication title Two Homologous Domains of Similar Structure But Different Stability in the Yeast Linker Histone, Hho1P
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ustA00
5BMZA 1R58A 3F21A 3F8MA 1S3JA 4A0XA 2LF8A 3GLXA 3CUQC 2WV0A 2VBZA 3D5LA 3E5QA 2Z99A 4UXNA 1U2WA 3WTTC 4GYGA 2K4BA 1R1UA 4EM2A 2GAUA 3SXYA 1AWCA 4XBFA 2HEOA 2VN2A 3KP7A 3N97A 2FA5A 4IF4A 3QP5A 4E70A 4L0ZB 1SFXA 2HTJA 2KIUA 3TO7A 2A5YB 4CO8A 4BH9A 3U2RA 4CHUA 4BHBA 2RQPA 2O03A 2KJCA 2QZ8A 3WGHA 1QNTA 4OIRF 1J7KA 3TDZC 1RZ4A 4WWCA 3RKXA 2NRAC 1BJAA 4KUMA 4AD9A 5EEGA 2QENA 1FNNA 3TO6A 4ESBA 1IRGA 3MZYA 3WE3A 2JZYA 1CGPA 3HRUA 5AIQA 4TV7A 1UHWA 3B73A 4KDPA 4MQVA 2VBWA 1HBXG 1D5VA 4ENMA 1FLIA 2Y75A 5J8FA 1KGSA 1U6GA 1U5TA 1FX7A 3ULQB 1K7AA 4YFKF 5ICFA 2A61A 4M9SA 2IJLA 4MHGA 3EETA 4R1HA 3V7RA 3O2PE 4FHTA 1I6XA 1PP7U 1R5GA 3KP4A 5D5VB 3IHUA 3J80Z 1ZRCA 4P55A 1VTNC 2UZKA 2Y0MA 1IN4A 1BN5A 2MD5A 4ZYDA 2L01A 4ZZLA 4ZH4F 2F5DA 1F9NA 1X3UA 2TDXA 4LFUA 4BHCA 1IN7A 3L00A 3FXRA 2IPQX 5ICGA 1TLHB 2QLZA 3ROUA 1K6OA 2GQQA 2DT5A 4A0YA 1T38A 2ISZA 3ZMZA 1XMAA 4LB6B 1P92A 4WXCA 2HYFA 3Q9VA 4JK1X 5ICEA 2A07F 1I5ZA 1J0RA 3I0TA 3DQVC 3MCZA 1ODDA 1LDKB 1BIBA 3K69A 3V8KA 3NEUA 3J81K 4YFXF 3SFZA 3KCCA 3F6OA 3MFKA 1W4MA 2COMA 2KRFA 4BAYA 4RGUA 2ETHA 1H9TA 2J5PA 4AIKA 4KICA 4WXDA 3LFKA 2P5VA 1ZAOA 3I59B 1BBYA 1BI2A 3FM3A 1OPCA 2P4WA 3WTWC 3M8EA 1KQ9A 4ZYEA 2B0LA 1IAWA 3U9GA 1MJ9A 3BJ6A 3BP8A 1MDMB 5H6RA 3HHGA 4U0YA 3RIRA 1XSDA 1U78A 2OQGA 1TTYA 1DPRA 5D6FA 2M8EA 3BROA 2XAQA 1YO5C 3O6BB 2F2EA 2GIVA 3FXUA 1S7AA 5HS8A 4KMFA 1WWXA 4A5NA 4RAYA 4WF2A 2K7LA 3R0JA 5CVVA 2ZMEA 4IPAA 2A69F 2Z9OA 4G7HF 3JTHA 2GWRA 3BPVA 2ZJ2A 1JXSA 1XMKA 1EH6A 2BV6A 2F5EA 2X0LA 2WWYA 3ZMUA 1LB2A 2FNPA 3K9TA 1IN5A 4Q5SF 5DCMB 3RTRA 2FRHA 5K5OA 4A6DA 1RIOH 4IRGA 1BI3A 1I27A 4HBLA 1XSVA 5DDGA 3L2CA 4HDUA 2K02A 2MA3A 4ESFA 1FOKA 3ZPLA 2HDCA 4B8XA 2MBFA 3T1BA 5E8IA 2RV8A 4ZYHA 5CLSA 3VODA 3WG9A 2HQRA 3QU6A 2QM3A 2PN6A 3RJPA 1IUYA 2VONA 1TQPA 2PFBA 1JE8A 3JSPA 3I54A 3T8TA 1LQ1A 5LRSA 2NNYA 3GEZA 4HDVA 4FT8A 1D8KA 1UCRA 2MH2A 1LVAA 2MLKA 4XSXF 1QQIA 4Y15A 3H92A 1HKQA 4OIQF 1I1GA 4UV9A 3RYRA 4I7HA 2DO7A 2L54A 1BI0A 3VB2A 4IXAA 2RGVA 3ZMDA 2EFWA 3WU1B 1O3TA 2VBXA 4EGYA 5L3EA 2V1DA 2CYYA 1QZZA 2VODA 4M9XA 4P5OA 1FSEA 1MKMA 3N4MA 3E3VA 2DPDA 1XD7A 2PMUA 4MTDA 4ENJA 4HQEA 4AIJA 5LBQA 3V7CA 5DCFA 3DKWA 1J9IA 4L5JA 4RB1A 2CWEA 1ZH5A 2EWNA 3J7AO 5LGNA 3JTGA 2W24A 5FFXA 2STTA 3C18A 3RDIA 4I98B 1WSUA 5CYVA 3I64A 3U1DA 3RPQA 1WKMA 2XUBA 1Q1HA 2OA4A 3L9FA 4LLNA 1S29A 4LK1F 4KNYA 4GO1A 1KQ8A 2E7WA 3F8BA 2VE9A 2IW5A 4KYWA 1UB9A 2HOEA 2F5FA 2M45A 3WU0A 2OAZA 1B4AA 2KJBA 1W7PB 5D4SA 4B09A 2BBYA 5F6FA 3OV8A 2IRFG 1P4WA 3GZ5A 3GFLA 1MJBA 2HZTA 1E2XA 4LMYA 1XDSA 2DU9A 5F1RA 2HKXA 1F4KA 4HX7A 2EV6A 4CZZA 1IF1A 3KZYA 1W7PA 4CGZA 2BGCA 5LHHA 2YSRA 1KA8A 4L18B 1XN7A 2ZNYA 1JGSA 5F64A 3VEPA 5FLXZ 2HYGD 1Z6TA 3KP5A 4NB5A 1FWZA 5D6EA 3I58A 1IN8A 4LLGF 1SD4A 1MZBA 4FX4A 4MGRA 3T8RA 4WXHA 1ONVA 4NHJA 5E20A 3I5UA 3S2WA 1TNTA 1FC3A 2ZFWA 2A68F 4BYYA 4R79A 1T98A 1RUNA 2L4AA 1B59A 2G9WA 2HWVA 2GA1A 3HSEA 4A12A 1XGOA 2R3SA 3G3ZA 5HLHA 5LEJA 2IT0A 4K2EA 5L3DA 4OMYA 3CUOA 4HX4A 4HF0A 3CO6C 4HV6A 2IA1A 1GXPA 2LKPA 3F8FA 4PDKA 1YLFA 5FLXK 3KFWX 3TO9A 4QWQA 3WTUC 2OQRA 4EM1A 4RB0A 2Z33A 2XAGA 2R7DA 5ICCA 5DUIA 3VOEA 1O3QA 3SZPA 4KT5C 2MH9A 5D5XB 4O3MA 3SHFA 2FMYA 4BXUA 4UVAA 1HW2A 1OYWA 3P9IA 1ZRFA 5DUKA 2EJRA 2V9VA 4M9ZA 3HYIA 5TRDA 1ZREA 5FO5A 5D5WB 3CO7C 5J8CA 3IL2A 4G6QA 3IWFA 4LLLA 2IP2A 3HIFA 2DQRA 1FYMA 2FBIA 2L4MA 3H3UA 2PI0A 3V4GA 1FP2A 4EGZA 3DF8A 1YFHA 3E6BA 5DD4A 1UHMA 4YFNF 3E6DA 3LA7A 1G3YA 2CG4A 4R8HA 5LHGA 1G4DA 2EFNA 1XGNA 3IKVA 4RGXA 1O7FA 1FP1D 4KMUX 4PGHA 4YG2F 4CYDA 2YPRA 4EJOA 2RKHA 1U8RA 1YQAA 5E1XA 1D3YA 4YIFA 4ASNA 1Z6RA 2XAFA 1IXRC 5H6QA 3PQKA 5A2QK 1FYKA 2MLGA 3J81Z 3W6JB 5LEKA 1BIAA 3GZ6A 2QQ9A 4I0BA 1IN6A 4OIOF 1FBSA 1SFUA 5JHUA 1I1SA 1PDNC 3ZN1A 4H0EA 3M1EA 3WODF 1Z7UA 4BHPA 2V6CA 2KIMA 3KZZA 2FE3A 3R61A 2NYXA 1BC8C 2XGXA 2RC4A 1PP8F 4GGGA 3ZP5A 2HS5A 4RGSA 2DK8A 3CJNA 5AONA 2VOPA 4RS8A 3V7SA 1Z05A 3P9CA 3LAPA 1R36A 1K79A 1FSHA 3DXJF 1P6RA 1R00A 1MD0A 5BOXA 4U7BA 1HKTA 2OZUA 3O3KA 3GFJA 4EJUA 2V1UA 2RDPA 3LSTA 5K5RA 1XCBA 1YYVA 2FNAA 3AAFA 4PCQA 3F6VA 1S6LA 3K0LA 2L3DA 4L9TA 2DFIA 5HS7A 2P6TA 2W85A 5ERIA 4RB2C 1V3FA 4EVIA 4I02A 3BDDA 4DNCA 4HF2A 3CDHA 4OINF 2W25A 4N0BA 2CGPA 1YW7A 2H27A 3EUHA 5CVUA 3ISPA 2QVOA 3KEOA 4G9YA 3K2ZA 5HDNA 2JTVA 2CO5A 4F7ZA 3G73A 3I59A 1J5YA 4Y17A 2ZCWA 1E17A 2OD5A 1WRJA 1QZYA 1UFMA 3EYYA 1SD7A 3HUGA 1MDMA 1XCVA 2M5WA 3HTSB 3D0SA 2V1XA 2GA2A 2F5CA 3VFZA 4A0ZA 3WTVC 1B6AA 3GFIA 2O61A 3HOTA 4EJTA 1P4AA 1K78B 3PFIA 4L9NA 3R60A 1CF7B 4YIIA 4P96A 5BPDA 2VXZA 2KIFA 5DV5A 3T0YA 2P7VB 1LEBA 4O5VA 3KLNA 1KU9A 1HW1A 1W7PD 2GZWA 2UXNA 3CUQB 3GW2A 1S7OA 3DEUA 3WGGA 2FSWA 4HV5A 3REOA 5DCMA 5DYMA 3P9KA 1FYLA 3MEXA 1OYYA 1RUOA 3BPXA 5L3GA 5E17F 1U5TC 1CF7A 4RGRA 5FD6A 1HKSA 3E97A 3RPUA 2ACJA 1T39A 2PG4A 2QQBA 1OKRA 2DK5A 4U88A 3F72A 3FMQA 1R22A 5ILUA 1R23A 2LSOA 5EEHA 1J59A 1XSXA 3IRQA 4KN4X 5CVJA 1R1VA 4L5IA 1FBUA 2JPCA 4EMSA 3GF2A 3I71A 4XSZF 1USSA 1FPQA 3K1PA 2LNBA 2EFQA 3R0AA 4I09A 3QOPA 2G7HA 2STWA 4IJAA 3FZVA 4IVNA 1XGMA 3LA2A 1KYZA 2O8XA 5HOOA 4GCVA 1B9NA 1D8JA 1JHHA 2V79A 4ETSA 4AVPA 3V8LA 4U0VA 3HHHA 4XLNF 2PLYA 5CJ9A 1F1ZA 4WX9A 3M7GA 4LG0B 3RI4A 2CSOA 2EB7A 5FB2A 3E6CC 1BM9A 2A6EF 3E5XA 4MQ9F 4UNOA 3KP6A 3SQNA 4Y13A 1YW9A 5HLGA 2FEZA 4FX0A 5HVQC 3ABTA 2QUFA 1TQMA 1U3EM 3HOSA 2QQAA 3EQLF 3ABUA 2P5KA 3I53A 1L3LA 1P2FA 5LGUA 4JQFA 5FGMA 4LG0A 3HRTA 3MWMA 3RKYA 2XKOA 3WTZA 4IRIA 1FT9A 1W5TA 4G7ZF 3BZ6A 1SFEA 1H0MA 1IXSB 1BOAA 3DPLC 3T5XA 3ZQ7A 4CDGA 1TNSA 2VOOA 4AWXB 2YU3A 2IA0A 4A5MA 1SD6A 5KK1A 1WI9A 2CW0F 2H6BA 3FX3A 2XHKA 3KP2A 3P7NA 4DQ2A 4L0YB 2DW4A 1YTYA 4LGWA 3Q5FA 2C6YA 4ENNA 3ZMVA 4A6EA 4UUVA 4IHTA 2NAZA 2YX4A 1DUXC 2HQNA 1WQ2A 1ZYRF 2HR3A 4MNUA 2M87A 2Y48A 4L9VA 2O6GE 4M73A 1QPMA 2EV5A 2QWWA 4HAMA 5IT9K 1KQ0A 4EJVA 2XASA 2PEXA 2FBHA 1LJ9A 2D1HA 4RAZA 3ECHA 5CVIA 2FOKA 4M6XA 1KU7A 5HDKA 5JR3A 1DDNA 1FZPB 3EDPA 5JVTA 5BQTA 2Q0OA 5BS6A 2D2WA 2XVCA 4QLCU 1T6SA 3ZMSA 3ZN0A 1ZGJA 1DPUA 4G6DA 1L0OC 5KVRA 5CVRA 2AS5F 1S8NA 4HZFA 3DP7A 3F8CA 5K5QA 1ZHFA 4N9IA 4M72A 2ELHA 2YR2A 2W84A 3R4KA 5L3FA 1ZRDA 1YIOA 5D5UB 1ON2A 1OMIA 1W5SA 1BC7C 2O3FA 2OBPA 1EV7A 4KN7X 1SMYF 4LK0F 1BI1A 2OZ6A 4A2UA 2DBBA 1LNWA 4HLXA 3MZHA 4LD5A 3EYIA 3COAC 1T0FA 1T2KA 2KKOA 4UVBA 3PQJA 1GHCA 1R5HA 2VT3A 3LWFA 1LDJA 4PZJA 1LEAA 2FQ3A 3BWGA 4I01A 2EFPA 4KIFA 5A2QZ 2IA2A 3KLOA 3LQQA 1ZLJA 2D45A 3GFMA 2FU4A 1U5TB 4EV0A 2WC2A 3HRMA 2NS0A 5FFZA 2HFHA 1YW8A 3WTSC 2CQKA 4EM0B 4ZYGA 1HW5A 1B9MA 5LRRA 4MEXF 2M1BA 5LHIA 2P8TA 2ZBKA 1USTA 3QU3A 1HQCA 1GXQA 3C7JA 2P6SA 3K1NA 4Q48A 4EJWA 3ML6A 2AXLA 2VC0A 4Q4ZF 2X4HA 3DV8A 4WCGA 1ULYA 3C1DA 5H20A 5LGTA 2QYOA 3C3WA 4HA8A 1ZARA 3KEQA 1TQIA 2ESNA 3H3ZA 2LF7A 4HX8A 2XAJA 4G8XA 4XLPF 5HLIA 2PQ8A 3K1MA 1TW2A 2ESHA 3HSFA 1KYWA 3LAJA 2ZO4A 3GX4X 3E6MA 2WTEA 5AIPA 1HSJA 5BPIA 4G7OF 2HGCA 3IRRA 4OOIA 2UWMA 4M6YA 3IKTA 4LB5A 2UXXA 3MQ0A 3KP3A 5JFRA 4IRHA 2A6HF 3DPTA 3FM5A 4UV8A 3Q9SA 3OOPA 1LDDA 2P7CB 3MAJA 3TOBA 5HS9A 2K4JA 3QP6A 3ZMTA 1JHFA 4CXFA 4MEYF 1ZGAA 4EQQA 4HQMA 1G3WA 2ZKZA 5L3BA 4I2OA 3GUDA 3J80K 2Q8KA 5TJJA 3KE2A 2QBYB 2EK5A 3CLOA 3M9AA 3SZTA 2E1CA 5D4RA 1YS6A 4M71A 3GYHX 3DFGA 4BQAA 4Q47A 2A3SA 1FBQA 2MC3A 1EH8A 1C0WA 1P4XA 1QO0D 2PMHA 3BJOA 1Z91A 4HOBA 2RNJA 3LQRA 4L9JA 1O7LA 1MJAA 1YG2A 2ZNZA 2QBYA 1IW7F 3KETA 2ZMEB 4ON0A 3I4PA 1O3SA 3HSRA 3WTYC 2DLLA 1HXDA 1F5TA 3NRVA 2XAHA 4HLYA 1YS7A 3QPTA 4CICA 3F3XA 1V4RA 3WTXC 4BNCA 2H94A 2M30A 2ISYA 1GVJA 3L09A 2XIGA 4GYIA 1KU2A 1TBXA 2HTSA 3GO5A 4MTEA 2GXBA 1XDUA 2XRNA 2O0YA 4N9HA 3BJAA 5K1YA 2JT1A 2VC1A 3GWZA 1AOYA 2JPBA 4ENKA 2DQLA 2H09A 2GXGA 2EV0A 4OMZA 2VE8A 5JI6A 3WGIA 5LLQA 3IC7A 1K78A 3RKWA 2FXAA 2BEOA 3NQOA 4RB3C 2Z5UA 1REPC 2FF4A 3QRFF 3IWZA 1J2XA 3FXQA 3BOQA 4Z2YA 2EA2A 1QBJA 3JAMZ 1NHAA 3CUQA 2K27A 5DD8A 2PJPA 2W57A 2J5OA 1Y0UA 4OIPF 1R1TA 3BY6A 1XGSA 4AIHA 5D8KB 5DEQA 4U0WA 3TQNA 2RVCA 5D8LB 1G3TA 2R7FA 3TDUC 3JSOA 4HW0A 2E1NA 3FMRA 1G3SA 1OR7A 2HKOA 1ZG5A 4ESJA 1MGTA 2EFOA 3ECOA 3V8JA 6PAXA 1OYIA 1STZA 4KIGA 1ZG1A 1DP7P 1B1BA 1H9GA 2Z3YA 5ILSA 4KA4A 5IT3A 4HYEA 1O3RA 1RNLA 2OU2A 1ON1A 2G7UA 1PUEE 1IRFA 1Z1DA 3JAMK 4KFCA 3W6KB 1ZN2A 3WE2A 1QGPA 2EA4A 4G94A 4U7DA 2ADUA 5ILVA 2Q2EA 2RN7A 2VBYA 2H6CA 3GVAA 2PBIA 1A04A 1IXCA 1RI7A 2E7XA 3QPHA 2XROA 2FMLA 4WK8F 2D1VA 3FHZA 3R6SA 1FY7A 3HTUA 4IHSA 5IT9Z 3TOAA 3JW4A 3ELKA 2LDUA 5ED4A 4UHTA 2BYVE 1TW3A 3RYPA 4UVCA 1O57A 2XV4S 1ZG3A 2JSCA 1IZ1A 5E8GA 2CFXA 4GXOA 4KIBA 3LA3A 1XB4A 3TKYA 5L3CA 4O6JA 4JBAA 3E5UA 5E1ZB 1SD5A 4ZZDA 1Z9CA 4HF1A 2DPUA 1R7JA 1ZLKA 4I0AA 1EH7A 3QAHA 4PGGA 3TGNA 4M74A 4S05A 2K86A 2JRTA 4P9FA 4XRFA 2BE5F 3FWEA 3F22A 2XKPA 3M8FA 4NQWA 3FF5A 4D0PA 4OU0A 2NNNA 2VT2A 3FMSA 2DTRA 1SMTA 2ZXJA 5E1WA 1SAXA 2YX7A 3HRSA 1KU3A 3ERED 4S04A 2FBKA 1J75A 4P9UA 1G6NA 3F23A 5J6XA 2IVMA 2L02A 2DI3A 1HSTA 2DAOA 3CTAA 5E18F 5HDGA 3F8NA 2P5LC 3GXOA 5FD5A 3B02A 3L7WA 4LJZF
chains in the Genus database with same CATH superfamily
1JT6A 5IYCJ 5BMZA 5GPAA 2R5ZA 4M3DA 1R58A 1RETA 3HPHA 1M1EB 3F21A 3I3LA 3CP8A 3GZNB 3AKZA 3F8MA 1S3JA 4A0XA 3H5AA 2LF8A 4XKBA 2V4JC 1G8XA 3GLXA 3SJMA 3DWLE 2OV7A 3CUQC 3DBLB 4C3JJ 2WV0A 3LL7A 4B1RA 2VBZA 3RCOA 1FTTA 3D5LA 3E5QA 1MMDA 2Z99A 4UXNA 3OS0A 1U2WA 3WTTC 4GYGA 2K4BA 1QHHD 1R1UA 2X6WA 2I8DA 4EM2A 4E7IA 3DCFA 5B1BH 1LFPA 2GAUA 3SXYA 3BG3A 4B44A 1AWCA 4XBFA 2A05A 2HEOA 2VN2A 1QRYA 3KP7A 3JR9A 3N97A 1K83J 2FA5A 3CMYA 4IF4A 2K3PA 4XRMA 3QP5A 4E70A 4L0ZB 3PJRA 1SFXA 2HTJA 2KIUA 3ABMH 2DDBA 3TO7A 2A5YB 3B6AA 4CO8A 4BH9A 3U2RA 4CHUA 4IHWA 4BHBA 2RQPA 2O03A 2KJCA 2OPTA 1B72B 2QZ8A 5CQGA 1QNTA 4OIRF 1J7KA 3WGHA 1TC3C 3TDZC 1RZ4A 4WWCA 2Y30A 1N78A 3RKXA 2NRAC 1BJAA 4BE2A 4ZTFA 2LKSA 3IAM2 2F5VA 4KUMA 4AD9A 3H9GA 4KISA 5EEGA 2QENA 1FNNA 3TO6A 4ESBA 2ZSIB 1IRGA 2X1EA 3MZYA 2Z16A 3M8JA 3WE3A 4D1QA 5IP7J 2X6OA 3CJQB 4KT6A 3U1KA 2LH9A 2JZYA 3BTLA 3QYFA 1HDPA 1CGPA 3HRUA 2OCEA 1KONA 5AIQA 4TV7A 1MW7A 1UHWA 3B73A 4KDPA 2BY3A 4CYCB 3HOYJ 4MQVA 2JSPA 3EUAA 2VBWA 1P9QC 2BVMA 2P0WA 5FKLA 1HBXG 1B72A 2OF7A 1T95A 1D5VA 4ENMA 4CA0A 3ONQA 1S72I 3S1QJ 1FLIA 2Y75A 2L5QA 1DQUA 4CZCA 5F0CA 1YRNA 3B6CA 5CPRB 5J8FA 1KGSA 2LBFA 3CMAI 3OY9A 1U6GA 1U5TA 2AQEA 1FX7A 5J1YA 4IHVA 1KZHA 3TMOA 3ULQB 2BY2A 4DZPA 1MIJA 1K7AA 4YFKF 3LNQA 5ICFA 2A61A 2XPVA 4M9SA 2IJLA 3FIWA 4MHGA 3EETA 3VWBA 4R1HA 5JLXA 3V7RA 4CYCA 3O2PE 3VDXA 4FHTA 1I6XA 1WHUA 1PP7U 1R5GA 1E3HA 1E3PA 3H1CA 4DYCA 2KISA 3M07A 3Q3SA 3KP4A 2X6YA 3FBNB 5D5VB 3IHUA 3J80Z 3OYEA 1ZRCA 4P55A 4XORA 3OYBA 1VTNC 2UZKA 2Y0MA 3TW7A 3FXLA 3S3NA 1Y1WJ 1XS9A 3D1NI 5TGTA 1IN4A 1BN5A 3IH2A 2MD5A 4ZYDA 2D5VA 2CUZA 2L01A 4ZZLA 4F93B 4ZH4F 2F5DA 1YOVB 1F9NA 2M4GA 1AU7A 2DT7B 3PL8A 2BOLA 1X3UA 3K7AJ 3BQYA 2XB5A 5IOYA 2TDXA 1NTCA 3S2DJ 4LFUA 3PNTA 4LIVA 4BHCA 1ETQA 2TRTA 1IN7A 4D9JA 2DYRH 5IYDJ 3L00A 4GRIA 1R9TJ 3L2WA 5IYBJ 3FXRA 3H35A 2IPQX 1EF4A 5ICGA 1TLHB 2H1LA 3OYGA 2QLZA 3ROUA 3IH3A 4J01A 5EDNA 1K6OA 1ETOA 2GQQA 2DT5A 4A0YA 2XGDA 1HLVA 2K9QA 1T38A 2IS2A 1D1AA 2ISZA 3ZMZA 1XMAA 4LB6B 4HNVA 2VLAA 1YI2I 1P92A 1MH3A 4WXCA 2VQCA 2HYFA 3Q9VA 1LE8A 1Y56A 4X0GA 4JK1X 3JRCA 5ICEA 4QPQA 2K85A 3FK6A 2W82A 3K4JA 4J00A 3ESWB 2A07F 2HYJA 2R7UA 1I5ZA 1XC5A 4DOZA 1J0RA 3G4SI 4BDZA 2JJ7A 3I0TA 1T8IA 1WH5A 3DQVC 3WHCA 3MCZA 4Z6YA 3CF2A 2KT0A 1ODDA 1LDKB 1BIBA 3K69A 3V8KA 3W3CA 1MBFA 3NEUA 3J81K 2JA7J 4YFXF 1S7EA 4C2TA 4RA2A 2M7AA 3HXLA 3SFZA 3PFYA 3KCCA 3F6OA 3MFKA 1JUMA 1W4MA 2DOAA 2COMA 2KRFA 4BAYA 3OS1A 4RGUA 4D5CA 2ETHA 1H9TA 2J5PA 4AIKA 4KICA 3X2QH 2WA0A 3RQ4A 1UAAA 2X1CA 4BXXJ 4WXDA 3LFKA 2P5VA 3HB9A 1ZAOA 2M8GX 3I59B 1BBYA 4DZJA 1BI2A 3FM3A 1OPCA 2P4WA 4JX6A 3WTWC 4FASD 4QIWN 2IGMA 2COBA 3M8EA 4JOMA 1KQ9A 5EZGA 4ZYEA 2B0LA 3SFIA 3P5JA 1IAWA 3U9GA 5DM6F 1MJ9A 3BJ6A 3BP8A 3HUGB 4J19A 1TT0A 3A1YA 5H6RA 1MDMB 3HHGA 1HC8A 3QOEA 3UKGA 2LY1A 3KYCB 4U0YA 3RIRA 1XSDA 1U78A 2OQGA 1TTYA 1DPRA 5D6FA 2M8EA 3SDBA 5J40A 3BROA 2X1DA 2XF7A 1X1PA 4GFBA 2XAQA 2KIQA 3IH4A 2CQ7A 5FJ8J 1YO5C 3CC2I 2EQRA 3O6BB 2F2EA 2DOFA 2GIVA 4AM3A 3FXUA 1LFBA 1S7AA 4XKVA 5HS8A 3CZ6A 4KMFA 1WWXA 4NBQA 5C4XJ 4N4NB 3S93A 4A5NA 4IO9F 4RAYA 4WF2A 2K7LA 3R0JA 5CVVA 4JP0A 1NK2P 4C3HJ 2ZMEA 4IPAA 2A69F 3GBGA 4BDYA 2VPLA 2Z9OA 4G7HF 3JTHA 2GWRA 3BPVA 2ZJ2A 1JXSA 1XMKA 1Y6IA 1EH6A 2BV6A 2DMNA 3W2VA 2F5EA 2WBMA 2X0LA 3ZMUA 2WWYA 1LB2A 5F04A 1IG7A 2FNPA 3K9TA 5KHDA 4D7MA 1IN5A 2DCEA 3FISA 4Q5SF 5DCMB 3LOCA 3RTRA 1X1DA 2FRHA 5K5OA 3O8GA 4BACA 4A6DA 5EGOB 1RIOH 4IRGA 1BI3A 1I27A 1JUSA 4HBLA 2VI6A 4NDLA 1XSVA 1WCMJ 3I4NJ 2KRHA 4DW6A 5DDGA 3H36A 3L2CA 4HDUA 2K02A 1SVLA 2MA3A 2XB0X 4ESFA 1FOKA 2DOEA 3ZPLA 4F92B 3CP2A 5DM7F 2UUZA 2A5WA 2HDCA 1RPWA 4B8XA 1G59A 2GM4A 2JUCA 2MBFA 3T1BA 2E2IJ 3HOWJ 1LUJB 3BG5A 3RZOJ 5E8IA 2CUEA 2RV8A 4G12A 4ZYHA 5CLSA 3VODA 3WG9A 2XAUA 5KCMA 2HQRA 3QU6A 2VKHA 2QM3A 3OYKA 3TEDA 2PN6A 3RJPA 1IUYA 1X4PA 2VONA 1TQPA 4XONA 4CCKA 3FHNA 5EGOA 5F0HA 2PFBA 3LSKA 1A5JA 1Y0NA 1JE8A 4BS9A 3JSPA 3BG9A 3I54A 3T8TA 3BR2A 5LRSA 2NNYA 1LQ1A 2DTZA 3GTMJ 3G1LA 3ZRGA 3GEZA 4HDVA 4NNJA 3MVPA 4FT8A 1D8KA 1UCRA 2EH3A 2R7OA 2MH2A 3HZJA 2IXSA 3GCMA 1YJ9I 1LVAA 2MLKA 2VKVA 3K4KA 3JCUC 4XSXF 1Z3YA 1QQIA 4Y15A 3H92A 1HKQA 4OIQF 1I1GA 4UV9A 3RYRA 4I7HA 2DO7A 2L54A 1BI0A 3VB2A 1JJ6C 4IXAA 2RGVA 3ZMDA 2EFWA 3WU1B 2QCOA 3OSGA 5HLTA 1LKXA 1O3TA 1FIAA 2VBXA 5K7HA 2LY9A 4EGYA 5L3EA 2NOJB 1SC7A 2E2HJ 2V1DA 2WAEA 2CS3A 2CYYA 3QYEA 1QZZA 2VODA 4M9XA 1WVRA 2E36A 4XL9A 4P5OA 1N77A 1FSEA 2XF6A 1MKMA 3N4MA 3E3VA 2DPDA 1QPIA 1XD7A 2PMUA 3OYAA 5E3MA 3H5NA 4MTDA 3LFUA 1PUFB 4PFOA 1MMSA 4ENJA 1VQKI 2OC6A 2R7WA 4HQEA 4AIJA 3VYRB 2CV2A 1JJ8C 4AYBN 5LBQA 3MKWB 3V7CA 1OQYA 5DCFA 3DKWA 1J9IA 1GV5A 3ZQLA 4L5JA 4RB1A 2F6CA 2B9SA 2AXTC 2CWEA 3BZKA 1ZH5A 2EWNA 2P81A 3J7AO 5LGNA 3JTGA 1WI3A 2W24A 5FFXA 3E0JB 3C18A 2GOXB 2STTA 2VQGA 3RDIA 2HQAA 4I98B 4KITB 2NS8A 3OL4A 2Z1DA 5C44J 1WSUA 5CYVA 3I64A 1WJAA 4IEJA 3U1DA 3RPQA 1WKMA 2WB1A 2XUBA 1N75A 3ZQFA 1Q1HA 2OA4A 3L9FA 4CSWA 4LLNA 1FMVA 2HDWA 1S29A 4LK1F 2LC2A 4KNYA 4GO1A 2QSHX 1Z21A 2E7WA 3F8BA 2VE9A 1KQ8A 2IW5A 4KYWA 4BY1J 1UB9A 2HOEA 2F5FA 2M45A 3CC7I 2JK3A 3WU0A 2OAZA 1B4AA 2KJBA 1W7PB 5D4SA 2RQQA 1XG1A 2BBYA 4I76A 4B09A 1K61A 1Y8QB 3FBIB 4B3AA 5F6FA 2NVYJ 3OV8A 2HXOA 4XM3A 2IRFG 2JRMA 1MMAA 1P4WA 2X85A 3GZ5A 3K4NA 2R92J 4DBRA 3GFLA 3FKIJ 4C2UA 5IP6A 3GTPJ 1MJBA 2HZTA 4KJZA 1E2XA 4LMYA 3OIOA 1OISA 1Y8RB 3RSNA 1XDSA 2XC7A 1V5GA 1PJRA 2OCCH 1VQ8I 1QU3A 3WU2C 2DU9A 5F1RA 2HKXA 1F4KA 4F52A 4IHYA 4HX7A 5IY5H 2EV6A 3L2RA 2VQHA 2YUSA 4LITA 4CZZA 1IF1A 1MNMC 3QWLA 2KDOA 3KZYA 1AA7A 1X3WB 1W7PA 2JA2A 2DDAA 4CGZA 1EA3A 3OYCA 2ZJQF 1MBHA 9ANTA 2BGCA 1EKEA 1SVOA 4E7JA 1K4TA 5LHHA 2HPIA 2YSRA 2DFEA 5M3FJ 1KA8A 4L18B 1XN7A 3LSRA 1ETYA 3K4MA 2ZNYA 2ECCA 1B8IB 1W5CC 1JGSA 2FOWA 4IQ4A 1VQLI 3UNGC 1XTAA 3PIOF 3I9V2 5F64A 2ZMEC 3CD6I 3VEPA 3QYBA 2CUJA 2HYGD 5FLXZ 1SFOJ 1ACIA 1Z6TA 2X48A 3KP5A 4NB5A 1JGGA 3F9KA 5J1RA 2HPMA 1RESA 3L2QA 1FWZA 5D6EA 3DKYA 3I58A 1IN8A 4LLGF 4A69C 1SD4A 1DU6A 1MZBA 2W7NA 2NVXJ 4FX4A 3SYTA 4MGRA 3T8RA 5J3LA 4WXHA 5GTIC 4AUXA 3JREA 3GTOJ 5M5YJ 3DEWA 5FLMJ 1ONVA 2L7KA 1OFCX 4NHJA 5E20A 3I5UA 3S2WA 4XRSG 4PK4A 3LSIA 1TNTA 1FC3A 3AG4H 2ZFWA 2A68F 4BL0B 4BYYA 4R79A 2BXYA 3OYIA 4HNUA 2X6XA 1BW5A 1T98A 1VQ6I 1BW6A 3HOVJ 3NWTA 4RM3A 1OJLA 1UG2A 3E1SA 1RUNA 5EZHA 2L4AA 1PYVA 1UG0A 1B59A 2G9WA 2HWVA 2GA1A 3HSEA 4A12A 1UZCA 1XGOA 2R3SA 4XN0A 3G3ZA 5HLHA 3OMYA 5LEJA 2IT0A 4DYQA 1G2HA 4K2EA 5L3DA 1R71A 2IGKA 4OMYA 2E34A 4NC6A 3CUOA 4BJ5C 4BE0A 3A0BC 4HX4A 1GUUA 2DMTA 5EYRA 4HF0A 3CO6C 4HV6A 5E3NA 2IA1A 2DJIA 1VNDA 1GXPA 2LKPA 3F8FA 4PDKA 5HODA 1VQ4I 3GTQJ 1YLFA 5FLXK 2QKMB 3KFWX 3TO9A 2JN6A 2LK2A 4QWQA 1QA6A 4DYRA 3PUFA 2LFBA 3WTUC 4BE1A 2OQRA 4EM1A 1GV2A 4RB0A 2Z33A 2DODA 2XAGA 1EJ9A 1FIPA 2R7DA 4D7NA 5ICCA 5DUIA 3VOEA 3IUOA 2JA5J 2HVSA 3DTEA 1O3QA 3SZPA 4KT5C 2MH9A 5D5XB 4O3MA 2Y69H 1R5ID 3KPHA 2R0QC 3S8PA 1ERDA 1OR7C 3SHFA 4II3A 1FJLA 2FMYA 2VJ4A 4BXUA 2O9LA 4UVAA 1HW2A 1OYWA 3P9IA 2R7QA 2EZLA 1YX5A 2ECBA 1LPQA 1ZRFA 4EATA 3DTIA 1R4NB 1WJBA 1NK3P 5KAFC 5DUKA 4JX4A 2EJRA 4HPQA 3CCVI 5IP9J 2H8WA 4AVZA 2DJNA 2M34A 2V9VA 4M9ZA 3HYIA 5TRDA 4BXFA 2Y2ZA 1ZREA 1DP3A 3F0CA 5FO5A 4B4CA 5D5WB 1T08B 3CO7C 2MC4A 5J8CA 3IL2A 3WHBA 3GTGJ 5JHFA 4G6QA 3K4CA 3IWFA 4LLLA 4FETA 2IP2A 4GDFA 3HIFA 2L9SA 2DQRA 1FYMA 2FBIA 2L4MA 3H3UA 4XLCA 2R7RA 2PI0A 1UJ8A 5IOZA 4IKFA 3V4GA 3AL0C 2O7OA 1FP2A 4EGZA 3CJTB 3DF8A 1YFHA 3E6BA 5DD4A 1UHMA 4LOCA 4YFNF 3KYLA 3E6DA 3LA7A 1G3YA 2CG4A 4R8HA 3BR6A 3IV5A 1D1CA 1ENHA 1X1AA 2YU9J 2Y0SN 3SZGA 3S32A 5LHGA 1G4DA 2XPUA 2EFNA 1XGNA 2OUMA 3DLLF 1SANA 4XK4A 3IKVA 4RGXA 5GADJ 3QQAA 2DA2A 2UV1A 4H4KC 4PSWA 1O7FA 4CCMA 2WAQA 2DFHA 3NAUA 1FP1D 4KMUX 2ZC2A 4PGHA 4Y7NJ 4YG2F 4CYDA 3CCSI 2YPRA 3PNYA 4EJOA 3RZDJ 2RKHA 3HL2A 2NVTJ 2LTPA 4NC7A 3OYLA 3EPZA 2KLOA 1U8RA 1YQAA 3HBLA 5E1XA 1D3YA 4YIFA 4ASNA 1Z6RA 2XAFA 2QSGX 1IXRC 2XRLA 4FCYA 5GAGJ 5H6QA 2CJJA 3PQKA 5A2QK 2LVSA 2MLGA 1FYKA 2VASA 1ETWA 4MLOA 3S3MA 3K4BA 3JRHA 3J81Z 3W6JB 4F3QA 5LEKA 5E3LA 4BUPA 1BIAA 1BR1A 2QQ9A 4I0BA 1IN6A 3GZ6A 3S3OA 4OIOF 2HOTA 4OAYA 1FBSA 2MYSA 1T33A 1SFUA 5JHUA 1I1SA 4N4OB 1V5FA 3ZN1A 4H0EA 1PDNC 5K7FA 3M1EA 1MBGA 3WODF 4RLQA 1Z7UA 3Q0WA 4BHPA 2V6CA 2KIMA 3KZZA 3BR3A 2L0KA 2FE3A 2DA1A 3R61A 2OTLI 2NYXA 1BC8C 1D5YA 2XGXA 1JI8A 2RC4A 1PP8F 4AIDA 4GGGA 3ZP5A 2HS5A 4RGSA 4HSRA 2DK8A 2EZHA 2M2EA 3JRIA 3S2HJ 3CJNA 5AONA 2DA7A 1FTZA 5DTDA 3ZOBA 4PSXA 2VOPA 3DU6A 4RS8A 3V7SA 1Z05A 3P9CA 1HF0A 3LAPA 3L1PA 1R36A 4ITVA 2X51A 1K79A 1FSHA 3DXJF 1P6RA 2KFDA 3HOUJ 1R00A 3I56I 4CCOA 1MD0A 5BOXA 2R5YB 1HOMA 4U7BA 1HKTA 2OZUA 3O3KA 3GFJA 4EJUA 2MG4A 2V1UA 1JTXA 3DU5A 2RDPA 3LSTA 5K5RA 3FKJA 3CCRI 1XCBA 1YYVA 2FNAA 2Y9YA 3AAFA 4PCQA 4E4HA 2HXIA 1TWHJ 3F6VA 1S6LA 2L7MP 2VKDA 3JRBA 3K0LA 1A35A 1ZTRA 2VJIA 2L3DA 4L9TA 2XSDC 2DFIA 1OCRH 5HS7A 2P6TA 3CCQI 2W85A 5ERIA 4RB2C 1IUFA 1V3FA 5J1UA 4EVIA 3W2WA 4I02A 1R6RA 2QEXI 3ZQCA 3BDDA 5FKMA 4DNCA 1NG6A 1TWFJ 4HF2A 2R5YA 3CDHA 3OR2C 4OINF 2W25A 2MABA 1IO2A 4N0BA 3HC7A 3OS2A 2CGPA 1VQOI 2Y9ZA 4ZTJA 5F0FA 1YW7A 2H27A 1ITYA 3JRGA 2BY0A 4U87A 3EUHA 3I55I 5CVUA 2DN0A 3ISPA 2QVOA 1WGXA 2W00A 3KEOA 4G9YA 4IHXA 3K2ZA 5HDNA 1W0TA 3GTLJ 2JTVA 2CO5A 2NS7A 4F7ZA 2L7FP 1A31A 3G73A 3KX2A 3I59A 1J5YA 4Y17A 2ZCWA 4E7SA 2OD5A 3FXJA 1E17A 2B63J 1WRJA 5CKTA 1QZYA 5B5EC 1UFMA 4UY8I 3EYYA 1SD7A 3W6VA 1TWCJ 4UB8C 4A3BJ 3HUGA 1MDMA 3LSJA 4OAZA 1XCVA 2M5WA 3A02A 3HTSB 1Y39A 1HCRA 3D0SA 4UB6C 1ZELA 2V1XA 2EIMH 2GA2A 2F5CA 3VFZA 4A0ZA 1T56A 4RM2A 4AC0A 3WTVC 1B6AA 3VPRA 3GFIA 4S0HB 2OJED 2O61A 3HOTA 4Y52J 4EJTA 1P4AA 1QZEA 1K78B 3PFIA 4EEFG 3GTJJ 5GTHC 2W4SA 4L9NA 2AQFA 3R60A 3VSKA 3DLAA 1CF7B 3H0DA 4YIIA 4P96A 5BPDA 1H88C 2VXZA 2CV1A 3MN2A 2R4GA 2KIFA 4HNTA 5DV5A 4A3DJ 3T0YA 2P7VB 1LEBA 4O5VA 2WY7Q 2CH0A 3KLNA 1KU9A 1HW1A 1W7PD 1MBEA 2GZWA 2UXNA 2ZXHA 5M5XJ 3S1RJ 3S15J 3CUQB 3GW2A 1S7OA 3K70D 3DEUA 3WGGA 3HOZJ 2V6EA 2FSWA 2HU9A 2M0CA 4HV5A 3REOA 5DCMA 5DYMA 2PMZN 3P9KA 4V2GA 1FYLA 3BQZA 3MEXA 3PM1A 1OYYA 2ELJA 1RUOA 3BPXA 5L3GA 4XOTA 5E17F 2E1MC 2LYCA 4MFEA 1U5TC 1CF7A 4RGRA 5FD6A 2LKXA 1HKSA 2K40A 3E97A 3RPUA 2ACJA 1T39A 2PG4A 3TL4X 2QQBA 1OCOH 1P7JA 3MMYB 2W48A 1OKRA 1JUPA 2DK5A 3QODA 3FXMA 2VQLA 4JX5A 4U88A 4Y3OA 5FKNA 3OYHA 1I39A 3F72A 1AKHB 3FMQA 1R22A 3ZQGA 4DIQA 5ILUA 1R23A 2LSOA 1Y1VJ 1E3OC 1Z7LA 5EEHA 1J59A 5GP9A 1UELB 1XSXA 4M6VA 3IRQA 4RBOA 3G1MA 4KN4X 5CVJA 1R1VA 2CW8A 4L5IA 3CLQA 1FBUA 2KQRA 3OIQA 1W1WE 2JPCA 4EMSA 2KMUA 3GF2A 3I71A 4XSZF 2XGCA 1X3ZB 2L9VA 1USSA 1FPQA 3CCLI 2XSJC 3K1PA 2LNBA 2EFQA 3PO2J 3L2VA 3S14J 3R0AA 4I09A 1TL8A 1BR4A 3QOPA 2G7HA 3HKZN 2STWA 1ZR2A 4IJAA 3FZVA 4IVNA 1A36A 3AL0B 1XGMA 3LA2A 1POGA 1KYZA 1ZKGA 2O8XA 2Q2EB 3OOUA 3PNVA 5HOOA 4GCVA 1B9NA 2V26A 1VI0A 1JHHA 4V19K 1D8JA 2V79A 4ETSA 4AVPA 3V8LA 2EIKH 4PJMA 4U0VA 4F91B 2JVGA 2M3AA 3HHHA 4XLNF 1WJEA 4FTHA 2O5RA 3J7YJ 2KP6A 5FRMA 2PLYA 5CJ9A 1F1ZA 1RC9A 4WX9A 3M7GA 1S9HA 3ZQHA 1MBJA 4BQOA 3DEEA 4UUSB 1WFXA 2Y31A 5KNLA 4LG0B 2ZSHB 3RI4A 2CSOA 2EB7A 5FB2A 4BU2A 3E6CC 1PUFA 1BM9A 2KZGA 4B47A 2R7SA 2A6EF 2EZIA 2LRDA 3BR0A 3E5XA 4MQ9F 4UNOA 3MKZA 3KP6A 2ID3A 1QVTA 3CCYA 3SQNA 4Y13A 1YW9A 4E7ZA 5HLGA 2CW7A 1IJWC 2DFFA 2FQ4A 4XNFA 1YITI 2FEZA 4FX0A 4XOPA 3ABTA 2QUFA 1TQMA 2V9PA 5HVQC 4RDUA 2IAIA 1U3EM 3FK7A 3HOSA 2QQAA 2V1NA 3EQLF 2PJRB 3ABUA 2P5KA 3I53A 1L3LA 1H89C 1APLC 1ZR4A 1P2FA 5LGUA 4JQFA 2EBIA 5FGMA 1MNEA 4LG0A 3ZXSA 1VQNI 3OYMA 3BLYA 3HRTA 1MMGA 1FOYA 3MWMA 5EEAA 3RKYA 2XKOA 3WTZA 2NVQJ 4IRIA 1FT9A 1W5TA 1BOBA 4G7ZF 2DT6A 3BZ6A 1SFEA 1H0MA 1IXSB 1BOAA 3A4CA 3DPLC 4C3IJ 2OTJI 3T5XA 3ZQ7A 4CDGA 1IGNA 1TNSA 1W36D 3OYFA 2VOOA 4AWXB 2YU3A 1X58A 2IA0A 4A5MA 1SD6A 3EUHC 2M0MA 5KK1A 1WI9A 1VQ9I 2CW0F 4QSHA 2HVQA 1AHDP 2H6BA 2H8RA 3HG9A 3FX3A 4M3EA 1I6HJ 4E6KG 2PJRA 2R93J 2XHKA 2L9RA 3KP2A 4ZDLA 3P7NA 4YEJA 4DQ2A 3BG7A 4YIRX 4L0YB 2DW4A 2EPFA 2KZVA 4RMNA 4LGWA 3H0GJ 1YTYA 4I6ZA 3Q5FA 2X9DA 2C6YA 2HZDA 4ENNA 1MBKA 1LFUP 4IX7A 2VL8A 2LP0A 3PSFA 3ZMVA 4A6EA 4UUVA 4IHTA 2NAZA 2YX4A 4FE4A 1FOXA 4JYKA 2K9SA 1DUXC 1GT0C 2HQNA 3O8HA 4MFDA 3MZ8A 2RREA 1WQ2A 2K9MA 1ZYRF 2V7FA 2HR3A 3BCAA 4MNUA 2M87A 2Y48A 4L9VA 4FE7A 2O6GE 1NH3A 1MMNA 4M73A 1QPMA 4PFPA 4BBRJ 4A3CJ 2BW3B 1Z0XA 2EV5A 2QWWA 4HAMA 5IT9K 1KQ0A 4EJVA 4ZC3A 2XASA 2HI3A 2PEXA 1OCPA 1B8IA 2FBHA 1LJ9A 4ZJZA 4A3MJ 3OYDA 1XX5A 4C30A 2D1HA 4RAZA 3ECHA 3KEYA 4XKWA 3DKXA 4XR6A 5CVIA 2FOKA 2DA3A 4A3LJ 4I99C 4M6XA 4IZZA 2R5ZB 1KU7A 5HDKA 4ZYAA 2QGUA 5JR3A 3HGYA 1XMXA 1DDNA 4XLFA 1IDYA 1FZPB 1WJ5A 2VXDA 5LFAA 3CCEI 3EDPA 5JVTA 5BQTA 4W97A 5EG0B 4RLFA 2LR8A 4Y4RA 2Q0OA 5BS6A 3HM5A 5TISC 2D2WA 2XVCA 4QLCU 2BW3A 1T6SA 3ZMSA 2DMUA 3ZN0A 2NOGA 1ZGJA 2CRGA 1DPUA 4G6DA 1L0OC 1IRXA 5KVRA 1F43A 1FEXA 5CVRA 2AS5F 2XGEA 1S8NA 4HZFA 3DP7A 1X1CA 1O4XA 3F8CA 2E5NA 2AO9A 5K5QA 1ZHFA 2BHZA 4N9IA 4M72A 3CMEI 2ME0A 3OR1C 2ELHA 3HKZA 4F55A 2YR2A 2W84A 4CUGA 2CQQA 3OL3A 3R4KA 2M9HA 1GDTA 5L3FA 1PVEA 1ZRDA 3HDDA 3G71I 2KHMA 1YIOA 5D5UB 1ON2A 1OMIA 4HG2A 4AYBA 1W5SA 1BC7C 2O3FA 3M1CA 2OBPA 2Z2SB 5EG0A 4C9YA 1EV7A 1F36A 3IP4B 4KN7X 3A01B 1SMYF 3OYJA 4LK0F 1BI1A 3ABLH 2WY8Q 2LMDA 1D0ZA 4A93J 1SFKA 2OZ6A 4A2UA 1J09A 4BQQA 1HDDC 2DBBA 1LNWA 3CQZJ 4HLXA 3MZHA 2DXIA 2KRCA 3KIOA 4LD5A 3EYIA 5EJCA 3COAC 5C3EJ 4A3GJ 1T0FA 1T2KA 1TWGJ 2KKOA 4UVBA 3PQJA 2ZXIA 3SEZA 1GHCA 1R5HA 2VT3A 3CESA 3LWFA 3LSHA 1LDJA 1ZGWA 4PZJA 2CU7A 1LEAA 2FQ3A 1ORKA 2XF5A 3BWGA 4I01A 2EFPA 4E7LA 4KIFA 5A2QZ 3ABKH 4BY7J 3A0HC 3A01A 2IA2A 3KLOA 3LQQA 1ZLJA 1YRNB 2R7TA 2PX9A 1Z67A 2LBFB 2D45A 2DA4A 2E1MB 3GFMA 2FU4A 3E7LA 1U5TB 2WADA 4EV0A 4QTRA 5IPAA 2WC2A 5FKKA 3HRMA 4CCLA 2NS0A 3DTKA 4BGDA 5FFZA 2HFHA 1YW8A 3RQIA 3WTSC 4LIUA 2IGOA 2CQKA 4RAFA 4EM0B 5DS9A 4ZYGA 3HJEA 5B3SH 1WJCA 3BTJA 1YIJI 3KZIC 4HSTA 1B9MA 1HW5A 2EILH 5LRRA 4XLAA 1E0EA 4MEXF 2M1BA 2XDVA 5LHIA 3BC8A 4DBQA 2P8TA 2ZBKA 2GOMA 2A6TA 1USTA 3QU3A 1HQCA 4ABZA 1GXQA 3C7JA 1I50J 2P6SA 4BBSJ 5F08A 4LG3A 3U21A 3K1NA 2VJJA 4CCNA 4Q48A 2VB6A 4EJWA 1TP4A 3ML6A 5JVGF 2AXLA 2VC0A 4Q4ZF 2X4HA 3DV8A 4WCGA 1ULYA 1WH7A 3C1DA 3ERMA 5H20A 1VF9A 3M3YJ 1IV8A 4CH7A 4W1UA 2CMPA 5LGTA 1IV6A 2HQ5A 2QYOA 3C3WA 4HA8A 1V5EA 4ZDOA 1ZARA 4HEA2 3KEQA 2E71A 1ZK8A 1TQIA 2BHYA 2ESNA 4PJLA 1TZLA 3H3ZA 1JKOC 2IGNA 1X19A 2LF7A 3BR1A 4HX8A 2XAJA 3ZQIA 4G8XA 5FLVA 4XLPF 5HLIA 2PQ8A 3K1MA 1TW2A 2ESHA 2GIZA 2F4MB 1VQMI 1KYWA 3HSFA 3LAJA 2ZO4A 1LE8B 3GX4X 1Z77A 2RNGA 3ASNH 2AHQA 2WTEA 3E6MA 1HSJA 5AIPA 3H9QA 5BPIA 4G7OF 2HGCA 2VKEA 3Q0VA 3D5SC 3K70C 3IRRA 1A6IA 4OOIA 2UWMA 2K9LA 3RPUD 1DGWY 1V54H 4M6YA 3IKTA 4LB5A 2UXXA 3MQ0A 1TT5B 3KP3A 5JFRA 1YE9A 2A6HF 3DPTA 3GLLA 4IRHA 3FM5A 2JVHA 3CDIA 4UV8A 2FUG2 3Q9SA 3OOPA 3CDLA 1LDDA 3HPGA 3LSPA 2P7CB 3MAJA 2VPRA 3TOBA 1NG7A 5HS9A 3CCJI 2K4JA 3QP6A 3ZMTA 2Q1ZB 4CCJA 1A6QA 2WAFA 1JHFA 4XLHA 4CXFA 1P7IA 2NXNB 3PUBA 4MEYF 1ZGAA 2XPWA 2FX0A 5CQEA 4EQQA 4HQMA 1G3WA 1D0YA 1U8BA 2ZKZA 1R49A 5L3BA 2L2OA 3V42A 1ETVA 2LLKA 3PSIA 4I2OA 3ZQQA 3EUKL 2RAEA 3GUDA 5JLWA 3IAS2 2ME6A 3J80K 2Q8KA 5EF6A 1DU0A 5FROA 2KDZA 5TJJA 2K9NA 4A3EJ 3KE2A 2QBYB 1RR8C 1UMQA 3VYUB 2EK5A 3CLOA 3M9AA 3SZTA 3JRFA 2QQ8A 3ZR8X 5E79C 2E1CA 3AG1H 4IQJA 3WG7H 1JKRC 2CUFA 2QSFX 4DGWB 5J4YA 5D4RA 2HOAA 3OIPA 5GPCA 4M3BA 1YS6A 4M71A 3GYHX 3PO3J 5M5WJ 1ETXA 3DFGA 1U0JA 4BQAA 4Q47A 1WJDA 2WV1A 2A3SA 1FBQA 2MC3A 1EH8A 1C0WA 1P4XA 3DBRB 5E3OA 1QO0D 2PMHA 3BJOA 1Z91A 4HOBA 2RNJA 4C2MJ 3LQRA 4L9JA 4ANJA 2K5CA 1O7LA 1MSEC 1MJAA 5HNHA 5J47A 4BJTA 1Z3XA 1YG2A 1JKPC 2ZNZA 2QBYA 1IW7F 2E1OA 4YRVA 3KETA 2JQ7A 3HOXJ 2JA8J 2ZMEB 2WB1N 2IS4A 1U9OA 4ON0A 3VYSB 4E7HA 2VIXA 3I4PA 1SVMA 1DGRM 3RKQA 1ZQ3P 4ZDPA 1O3SA 3HSRA 1JTYA 3K10A 1RR7A 3WTYC 2VUMJ 2DLLA 3PIPF 2ZB9A 3H5RA 1HXDA 1F5TA 2K3FA 1YX3A 1XPXA 3GMEA 1IC8A 1Q1VA 2M7BA 3C2BA 2BVLA 5BNGA 3ASOH 4NC8A 3J7ZI 3NRVA 2XAHA 1GLNA 3LMMA 2MW8A 2I5UA 3TBIA 4HLYA 3MD2A 1YS7A 2GBYA 3QPTA 3MKLA 3G6EI 3HEFA 4XLEA 4CICA 3F3XA 1D0XA 1V4RA 3WTXC 1RKTA 4BNCA 2H94A 2LG4A 2M30A 3N05A 2ISYA 1GVJA 3BZCA 2ICWG 1U9NA 3L09A 2XIGA 4GYIA 1KU2A 1T0FC 1VQ5I 3H3VK 1N25A 1D1BA 1TBXA 2HTSA 4XQFA 2Y0SA 3GO5A 4MTEA 2GXBA 1HA8A 2E19A 1BJZA 1OCCH 1XDUA 2R7ZJ 3A2KA 1BA5A 1K4SA 1MSFC 4L5EA 2TCTA 3K4LA 3OYNA 2XRNA 4YELA 3CJRB 3QPLA 2ZJRF 3FXKA 2O0YA 4N9HA 1RKWA 3BJAA 3BTIA 3C2GA 5K1YA 2JT1A 2VC1A 3GWZA 1AOYA 2JPBA 4X1EA 4ENKA 2DQLA 2FD5A 2GXGA 2H09A 3SEQA 2HVRA 2EV0A 4XRSA 1W36C 4OMZA 3CMMA 4FISA 1W0UA 2VE8A 4XN3A 5JI6A 3WGIA 2MGQA 5LLQA 2N8GA 3IC7A 1YJNI 1K78A 4BJ6C 2HDDA 3RKWA 2FXAA 2BEOA 2E35A 3NQOA 3AFHA 3LSGA 3HGGA 4RB3C 2Z5UA 4OWRB 1QHGA 1REPC 2FF4A 2GLOA 3QRFF 1OLTA 4FQGA 2R7XA 3AG2H 3IWZA 1UHSA 2E2JJ 3S16J 3C2HA 1J2XA 3M4OJ 2V9KA 3FDYA 1LVKA 3FXQA 3OWTA 3BOQA 4Z2YA 4PUSA 2EA2A 1QBJA 3JAMZ 1NHAA 3CUQA 2K27A 1SEUA 2QF7A 5DD8A 2L7ZA 1OCZH 3DPUA 2W57A 5J4VA 2PJPA 2J5OA 1Y0UA 4OIPF 1R1TA 3BY6A 4M3FA 1XGSA 4AIHA 2F4IA 5D8KB 5DEQA 4A3IJ 2DMPA 4U0WA 4G6TB 2GXAA 3SDGA 4BKXA 3TQNA 2MD0A 2HOSA 2RVCA 1WJFA 5D8LB 3S17J 1G3TA 1JKQC 2G0EA 3MKYB 1IRZA 5LD2C 2LD5A 2R7FA 3TDUC 3JSOA 4HW0A 3CC4I 2IS1A 1FMWA 2E1NA 3K2AA 3ZCOA 3FMRA 5M3MJ 1SAUA 3S1NJ 1G3SA 2JMWA 3VYTB 3KYDB 4B48A 1BR2A 1OR7A 2HKOA 5B1AH 3FXOA 1ZG5A 2BY1A 4ESJA 2KPMA 2HNHA 1MGTA 2EFOA 3ECOA 4XMYA 3V8JA 6PAXA 1AKHA 1OYIA 3NWSA 1STZA 4KIGA 1X2NA 1ZG1A 1RRJA 1DP7P 1B1BA 2E5ZA 3BTCA 3I4MJ 2ELKA 3Q0UA 5KAIC 4II2A 1H9GA 2Z3YA 2MSYA 3W2AA 5ILSA 1VZ0A 5IT3A 4KA4A 4X6AJ 2QA4I 3UR3C 4HYEA 4UUTA 3D5RC 4M3GA 1RNLA 1O3RA 2MFZA 2OU2A 1ON1A 2B7EA 2DMQA 2G7UA 1PUEE 1IRFA 3CF5F 1Z1DA 2FJ1A 4DJAA 3JAMK 2ZXWH 2M4KA 2W1OA 5FRNA 2QKLB 5HNFA 4KFCA 3W6KB 4BEHB 3JRDA 4PJNA 1ZN2A 3WE2A 2EZKA 1QGPA 2EA4A 4G94A 2NVUB 3GTKJ 4U7DA 2ADUA 5ILVA 2Q2EA 2RN7A 2VBYA 1FOWA 2H6CA 2PBIA 3GVAA 1A04A 5C4JJ 1I3QJ 4MIMA 2BXZA 1H8AC 1IDZA 4XIDA 3BT9A 1S5LC 1IXCA 2BZTA 2CV0A 3CCUI 1RI7A 4A3FJ 2E7XA 2DA5A 3QPHA 2XROA 2FMLA 3S1MJ 4WK8F 4UUSA 2D1VA 2F48A 3FHZA 4A3KJ 3R6SA 1FY7A 1R4MB 2YS9A 3LSMA 4BEHA 3HTUA 3BG6A 4IHSA 5IT9Z 3TOAA 3JW4A 2IEKA 3ELKA 3J7AY 2LDUA 5ED4A 4UHTA 2DYSH 1QVUA 2BYVE 1TW3A 3RYPA 2ZJPF 1JT0A 2O8KA 4UVCA 1O57A 2I10A 2LREA 2XV4S 2ZFUA 1ZG3A 2JSCA 1IZ1A 5E8GA 2CQNA 2CFXA 4GXOA 5F27A 4KIBA 2CQXA 3LA3A 1OCTC 1XB4A 3TKYA 2H1KA 4NQWB 3G1OA 2F4OB 1X1BA 5L3CA 4O6JA 4JBAA 4PJJA 4IL6C 3AG3H 3L2UA 4A3JJ 3E5UA 5FKOA 5E1ZB 1SD5A 3ZGKA 4ZZDA 1Z9CA 3K6GA 3QPSA 4HF1A 1WPKA 2DPUA 1R7JA 4RAGA 1ZLKA 3TP3A 4I0AA 1EH7A 3QAHA 3OSFA 4PGGA 2KL4A 3G2BA 2LY2A 2WAQN 3TGNA 3DBHB 2VJ5A 1V55H 4E7KA 1YJWI 4M74A 2K86A 4S05A 2JRTA 4P9FA 4XRFA 1ETKA 4NUBA 1X2MA 3H9JA 5GAEJ 2JWTA 1WZ2A 2BE5F 2PMZA 3BCBA 3FWEA 1VQPI 3F22A 2XKPA 4MO7A 2ID6A 4P1WA 1MH4A 3M8FA 4NQWA 3FF5A 2JUGA 2E60A 3VSLA 4D0PA 5F1JA 4OU0A 1I3AA 2NNNA 2VT2A 5K7ZA 3FMSA 2DTRA 2LOOA 1SMTA 4IOAF 2ZXJA 4Y33A 5E1WA 4PJ0C 5B66C 2EINH 4IOCF 3JRAA 1SAXA 2YX7A 3HRSA 4XICA 1KU3A 2L9NA 3ERED 4S04A 2FBKA 4V2FA 1J75A 2CFOA 1GVDA 4BQNA 4P9UA 1G6NA 1YHQI 4QPOA 4B43A 3F23A 2JA6J 4HRIA 5J6XA 4AU7A 4B3XA 2IVMA 1X4OA 3BR5A 2L02A 1VFCA 3TW6A 2DI3A 1TWAJ 1HSTA 5GAHJ 2DAOA 3CTAA 5E18F 5H2FC 1BL0A 5HDGA 2R7VA 3NARA 3F8NA 2EIJH 2P5LC 1CQTA 3GXOA 2IS6A 2IBDA 1K6YA 2DA6A 5FD5A 3B02A 3TP0A 3L7WA 1VQ7I 3A03A 1MNDA 4D5FA 4XKCA 3CCMI 4LJZF
chains in the Genus database with same CATH topology
5BMZA 1R58A 3F21A 3F8MA 1S3JA 4A0XA 2LF8A 3GLXA 3CUQC 2WV0A 2VBZA 3D5LA 3E5QA 2Z99A 4UXNA 1U2WA 3WTTC 4GYGA 2K4BA 1R1UA 4EM2A 2GAUA 3SXYA 1AWCA 4XBFA 2HEOA 2VN2A 3KP7A 3N97A 2FA5A 4IF4A 3QP5A 4E70A 4L0ZB 1SFXA 2HTJA 2KIUA 3TO7A 2A5YB 4CO8A 4BH9A 3U2RA 4CHUA 4BHBA 2RQPA 2O03A 2KJCA 2QZ8A 3WGHA 1QNTA 4OIRF 1J7KA 3TDZC 1RZ4A 4WWCA 3RKXA 2NRAC 1BJAA 4KUMA 4AD9A 5EEGA 2QENA 1FNNA 3TO6A 4ESBA 1IRGA 3MZYA 3WE3A 2JZYA 1CGPA 3HRUA 5AIQA 4TV7A 1UHWA 3B73A 4KDPA 4MQVA 2VBWA 1HBXG 1D5VA 4ENMA 1FLIA 2Y75A 5J8FA 1KGSA 1U6GA 1U5TA 1FX7A 3ULQB 1K7AA 4YFKF 5ICFA 2A61A 4M9SA 2IJLA 4MHGA 3EETA 4R1HA 3V7RA 3O2PE 4FHTA 1I6XA 1PP7U 1R5GA 3KP4A 5D5VB 3IHUA 3J80Z 1ZRCA 4P55A 1VTNC 2UZKA 2Y0MA 1IN4A 1BN5A 2MD5A 4ZYDA 2L01A 4ZZLA 4ZH4F 2F5DA 1F9NA 1X3UA 2TDXA 4LFUA 4BHCA 1IN7A 3L00A 3FXRA 2IPQX 5ICGA 1TLHB 2QLZA 3ROUA 1K6OA 2GQQA 2DT5A 4A0YA 1T38A 2ISZA 3ZMZA 1XMAA 4LB6B 1P92A 4WXCA 2HYFA 3Q9VA 4JK1X 5ICEA 2A07F 1I5ZA 1J0RA 3I0TA 3DQVC 3MCZA 1ODDA 1LDKB 1BIBA 3K69A 3V8KA 3NEUA 3J81K 4YFXF 3SFZA 3KCCA 3F6OA 3MFKA 1W4MA 2COMA 2KRFA 4BAYA 4RGUA 2ETHA 1H9TA 2J5PA 4AIKA 4KICA 4WXDA 3LFKA 2P5VA 1ZAOA 3I59B 1BBYA 1BI2A 3FM3A 1OPCA 2P4WA 3WTWC 3M8EA 1KQ9A 4ZYEA 2B0LA 1IAWA 3U9GA 1MJ9A 3BJ6A 3BP8A 1MDMB 5H6RA 3HHGA 4U0YA 3RIRA 1XSDA 1U78A 2OQGA 1TTYA 1DPRA 5D6FA 2M8EA 3BROA 2XAQA 1YO5C 3O6BB 2F2EA 2GIVA 3FXUA 1S7AA 5HS8A 4KMFA 1WWXA 4A5NA 4RAYA 4WF2A 2K7LA 3R0JA 5CVVA 2ZMEA 4IPAA 2A69F 2Z9OA 4G7HF 3JTHA 2GWRA 3BPVA 2ZJ2A 1JXSA 1XMKA 1EH6A 2BV6A 2F5EA 2X0LA 2WWYA 3ZMUA 1LB2A 2FNPA 3K9TA 1IN5A 4Q5SF 5DCMB 3RTRA 2FRHA 5K5OA 4A6DA 1RIOH 4IRGA 1BI3A 1I27A 4HBLA 1XSVA 5DDGA 3L2CA 4HDUA 2K02A 2MA3A 4ESFA 1FOKA 3ZPLA 2HDCA 4B8XA 2MBFA 3T1BA 5E8IA 2RV8A 4ZYHA 5CLSA 3VODA 3WG9A 2HQRA 3QU6A 2QM3A 2PN6A 3RJPA 1IUYA 2VONA 1TQPA 2PFBA 1JE8A 3JSPA 3I54A 3T8TA 1LQ1A 5LRSA 2NNYA 3GEZA 4HDVA 4FT8A 1D8KA 1UCRA 2MH2A 1LVAA 2MLKA 4XSXF 1QQIA 4Y15A 3H92A 1HKQA 4OIQF 1I1GA 4UV9A 3RYRA 4I7HA 2DO7A 2L54A 1BI0A 3VB2A 4IXAA 2RGVA 3ZMDA 2EFWA 3WU1B 1O3TA 2VBXA 4EGYA 5L3EA 2V1DA 2CYYA 1QZZA 2VODA 4M9XA 4P5OA 1FSEA 1MKMA 3N4MA 3E3VA 2DPDA 1XD7A 2PMUA 4MTDA 4ENJA 4HQEA 4AIJA 5LBQA 3V7CA 5DCFA 3DKWA 1J9IA 4L5JA 4RB1A 2CWEA 1ZH5A 2EWNA 3J7AO 5LGNA 3JTGA 2W24A 5FFXA 2STTA 3C18A 3RDIA 4I98B 1WSUA 5CYVA 3I64A 3U1DA 3RPQA 1WKMA 2XUBA 1Q1HA 2OA4A 3L9FA 4LLNA 1S29A 4LK1F 4KNYA 4GO1A 1KQ8A 2E7WA 3F8BA 2VE9A 2IW5A 4KYWA 1UB9A 2HOEA 2F5FA 2M45A 3WU0A 2OAZA 1B4AA 2KJBA 1W7PB 5D4SA 4B09A 2BBYA 5F6FA 3OV8A 2IRFG 1P4WA 3GZ5A 3GFLA 1MJBA 2HZTA 1E2XA 4LMYA 1XDSA 2DU9A 5F1RA 2HKXA 1F4KA 4HX7A 2EV6A 4CZZA 1IF1A 3KZYA 1W7PA 4CGZA 2BGCA 5LHHA 2YSRA 1KA8A 4L18B 1XN7A 2ZNYA 1JGSA 5F64A 3VEPA 5FLXZ 2HYGD 1Z6TA 3KP5A 4NB5A 1FWZA 5D6EA 3I58A 1IN8A 4LLGF 1SD4A 1MZBA 4FX4A 4MGRA 3T8RA 4WXHA 1ONVA 4NHJA 5E20A 3I5UA 3S2WA 1TNTA 1FC3A 2ZFWA 2A68F 4BYYA 4R79A 1T98A 1RUNA 2L4AA 1B59A 2G9WA 2HWVA 2GA1A 3HSEA 4A12A 1XGOA 2R3SA 3G3ZA 5HLHA 5LEJA 2IT0A 4K2EA 5L3DA 4OMYA 3CUOA 4HX4A 4HF0A 3CO6C 4HV6A 2IA1A 1GXPA 2LKPA 3F8FA 4PDKA 1YLFA 5FLXK 3KFWX 3TO9A 4QWQA 3WTUC 2OQRA 4EM1A 4RB0A 2Z33A 2XAGA 2R7DA 5ICCA 5DUIA 3VOEA 1O3QA 3SZPA 4KT5C 2MH9A 5D5XB 4O3MA 3SHFA 2FMYA 4BXUA 4UVAA 1HW2A 1OYWA 3P9IA 1ZRFA 5DUKA 2EJRA 2V9VA 4M9ZA 3HYIA 5TRDA 1ZREA 5FO5A 5D5WB 3CO7C 5J8CA 3IL2A 4G6QA 3IWFA 4LLLA 2IP2A 3HIFA 2DQRA 1FYMA 2FBIA 2L4MA 3H3UA 2PI0A 3V4GA 1FP2A 4EGZA 3DF8A 1YFHA 3E6BA 5DD4A 1UHMA 4YFNF 3E6DA 3LA7A 1G3YA 2CG4A 4R8HA 5LHGA 1G4DA 2EFNA 1XGNA 3IKVA 4RGXA 1O7FA 1FP1D 4KMUX 4PGHA 4YG2F 4CYDA 2YPRA 4EJOA 2RKHA 1U8RA 1YQAA 5E1XA 1D3YA 4YIFA 4ASNA 1Z6RA 2XAFA 1IXRC 5H6QA 3PQKA 5A2QK 1FYKA 2MLGA 3J81Z 3W6JB 5LEKA 1BIAA 3GZ6A 2QQ9A 4I0BA 1IN6A 4OIOF 1FBSA 1SFUA 5JHUA 1I1SA 1PDNC 3ZN1A 4H0EA 3M1EA 3WODF 1Z7UA 4BHPA 2V6CA 2KIMA 3KZZA 2FE3A 3R61A 2NYXA 1BC8C 2XGXA 2RC4A 1PP8F 4GGGA 3ZP5A 2HS5A 4RGSA 2DK8A 3CJNA 5AONA 2VOPA 4RS8A 3V7SA 1Z05A 3P9CA 3LAPA 1R36A 1K79A 1FSHA 3DXJF 1P6RA 1R00A 1MD0A 5BOXA 4U7BA 1HKTA 2OZUA 3O3KA 3GFJA 4EJUA 2V1UA 2RDPA 3LSTA 5K5RA 1XCBA 1YYVA 2FNAA 3AAFA 4PCQA 3F6VA 1S6LA 3K0LA 2L3DA 4L9TA 2DFIA 5HS7A 2P6TA 2W85A 5ERIA 4RB2C 1V3FA 4EVIA 4I02A 3BDDA 4DNCA 4HF2A 3CDHA 4OINF 2W25A 4N0BA 2CGPA 1YW7A 2H27A 3EUHA 5CVUA 3ISPA 2QVOA 3KEOA 4G9YA 3K2ZA 5HDNA 2JTVA 2CO5A 4F7ZA 3G73A 3I59A 1J5YA 4Y17A 2ZCWA 1E17A 2OD5A 1WRJA 1QZYA 1UFMA 3EYYA 1SD7A 3HUGA 1MDMA 1XCVA 2M5WA 3HTSB 3D0SA 2V1XA 2GA2A 2F5CA 3VFZA 4A0ZA 3WTVC 1B6AA 3GFIA 2O61A 3HOTA 4EJTA 1P4AA 1K78B 3PFIA 4L9NA 3R60A 1CF7B 4YIIA 4P96A 5BPDA 2VXZA 2KIFA 5DV5A 3T0YA 2P7VB 1LEBA 4O5VA 3KLNA 1KU9A 1HW1A 1W7PD 2GZWA 2UXNA 3CUQB 3GW2A 1S7OA 3DEUA 3WGGA 2FSWA 4HV5A 3REOA 5DCMA 5DYMA 3P9KA 1FYLA 3MEXA 1OYYA 1RUOA 3BPXA 5L3GA 5E17F 1U5TC 1CF7A 4RGRA 5FD6A 1HKSA 3E97A 3RPUA 2ACJA 1T39A 2PG4A 2QQBA 1OKRA 2DK5A 4U88A 3F72A 3FMQA 1R22A 5ILUA 1R23A 2LSOA 5EEHA 1J59A 1XSXA 3IRQA 4KN4X 5CVJA 1R1VA 4L5IA 1FBUA 2JPCA 4EMSA 3GF2A 3I71A 4XSZF 1USSA 1FPQA 3K1PA 2LNBA 2EFQA 3R0AA 4I09A 3QOPA 2G7HA 2STWA 4IJAA 3FZVA 4IVNA 1XGMA 3LA2A 1KYZA 2O8XA 5HOOA 4GCVA 1B9NA 1D8JA 1JHHA 2V79A 4ETSA 4AVPA 3V8LA 4U0VA 3HHHA 4XLNF 2PLYA 5CJ9A 1F1ZA 4WX9A 3M7GA 4LG0B 3RI4A 2CSOA 2EB7A 5FB2A 3E6CC 1BM9A 2A6EF 3E5XA 4MQ9F 4UNOA 3KP6A 3SQNA 4Y13A 1YW9A 5HLGA 2FEZA 4FX0A 5HVQC 3ABTA 2QUFA 1TQMA 1U3EM 3HOSA 2QQAA 3EQLF 3ABUA 2P5KA 3I53A 1L3LA 1P2FA 5LGUA 4JQFA 5FGMA 4LG0A 3HRTA 3MWMA 3RKYA 2XKOA 3WTZA 4IRIA 1FT9A 1W5TA 4G7ZF 3BZ6A 1SFEA 1H0MA 1IXSB 1BOAA 3DPLC 3T5XA 3ZQ7A 4CDGA 1TNSA 2VOOA 4AWXB 2YU3A 2IA0A 4A5MA 1SD6A 5KK1A 1WI9A 2CW0F 2H6BA 3FX3A 2XHKA 3KP2A 3P7NA 4DQ2A 4L0YB 2DW4A 1YTYA 4LGWA 3Q5FA 2C6YA 4ENNA 3ZMVA 4A6EA 4UUVA 4IHTA 2NAZA 2YX4A 1DUXC 2HQNA 1WQ2A 1ZYRF 2HR3A 4MNUA 2M87A 2Y48A 4L9VA 2O6GE 4M73A 1QPMA 2EV5A 2QWWA 4HAMA 5IT9K 1KQ0A 4EJVA 2XASA 2PEXA 2FBHA 1LJ9A 2D1HA 4RAZA 3ECHA 5CVIA 2FOKA 4M6XA 1KU7A 5HDKA 5JR3A 1DDNA 1FZPB 3EDPA 5JVTA 5BQTA 2Q0OA 5BS6A 2D2WA 2XVCA 4QLCU 1T6SA 3ZMSA 3ZN0A 1ZGJA 1DPUA 4G6DA 1L0OC 5KVRA 5CVRA 2AS5F 1S8NA 4HZFA 3DP7A 3F8CA 5K5QA 1ZHFA 4N9IA 4M72A 2ELHA 2YR2A 2W84A 3R4KA 5L3FA 1ZRDA 1YIOA 5D5UB 1ON2A 1OMIA 1W5SA 1BC7C 2O3FA 2OBPA 1EV7A 4KN7X 1SMYF 4LK0F 1BI1A 2OZ6A 4A2UA 2DBBA 1LNWA 4HLXA 3MZHA 4LD5A 3EYIA 3COAC 1T0FA 1T2KA 2KKOA 4UVBA 3PQJA 1GHCA 1R5HA 2VT3A 3LWFA 1LDJA 4PZJA 1LEAA 2FQ3A 3BWGA 4I01A 2EFPA 4KIFA 5A2QZ 2IA2A 3KLOA 3LQQA 1ZLJA 2D45A 3GFMA 2FU4A 1U5TB 4EV0A 2WC2A 3HRMA 2NS0A 5FFZA 2HFHA 1YW8A 3WTSC 2CQKA 4EM0B 4ZYGA 1HW5A 1B9MA 5LRRA 4MEXF 2M1BA 5LHIA 2P8TA 2ZBKA 1USTA 3QU3A 1HQCA 1GXQA 3C7JA 2P6SA 3K1NA 4Q48A 4EJWA 3ML6A 2AXLA 2VC0A 4Q4ZF 2X4HA 3DV8A 4WCGA 1ULYA 3C1DA 5H20A 5LGTA 2QYOA 3C3WA 4HA8A 1ZARA 3KEQA 1TQIA 2ESNA 3H3ZA 2LF7A 4HX8A 2XAJA 4G8XA 4XLPF 5HLIA 2PQ8A 3K1MA 1TW2A 2ESHA 3HSFA 1KYWA 3LAJA 2ZO4A 3GX4X 3E6MA 2WTEA 5AIPA 1HSJA 5BPIA 4G7OF 2HGCA 3IRRA 4OOIA 2UWMA 4M6YA 3IKTA 4LB5A 2UXXA 3MQ0A 3KP3A 5JFRA 4IRHA 2A6HF 3DPTA 3FM5A 4UV8A 3Q9SA 3OOPA 1LDDA 2P7CB 3MAJA 3TOBA 5HS9A 2K4JA 3QP6A 3ZMTA 1JHFA 4CXFA 4MEYF 1ZGAA 4EQQA 4HQMA 1G3WA 2ZKZA 5L3BA 4I2OA 3GUDA 3J80K 2Q8KA 5TJJA 3KE2A 2QBYB 2EK5A 3CLOA 3M9AA 3SZTA 2E1CA 5D4RA 1YS6A 4M71A 3GYHX 3DFGA 4BQAA 4Q47A 2A3SA 1FBQA 2MC3A 1EH8A 1C0WA 1P4XA 1QO0D 2PMHA 3BJOA 1Z91A 4HOBA 2RNJA 3LQRA 4L9JA 1O7LA 1MJAA 1YG2A 2ZNZA 2QBYA 1IW7F 3KETA 2ZMEB 4ON0A 3I4PA 1O3SA 3HSRA 3WTYC 2DLLA 1HXDA 1F5TA 3NRVA 2XAHA 4HLYA 1YS7A 3QPTA 4CICA 3F3XA 1V4RA 3WTXC 4BNCA 2H94A 2M30A 2ISYA 1GVJA 3L09A 2XIGA 4GYIA 1KU2A 1TBXA 2HTSA 3GO5A 4MTEA 2GXBA 1XDUA 2XRNA 2O0YA 4N9HA 3BJAA 5K1YA 2JT1A 2VC1A 3GWZA 1AOYA 2JPBA 4ENKA 2DQLA 2H09A 2GXGA 2EV0A 4OMZA 2VE8A 5JI6A 3WGIA 5LLQA 3IC7A 1K78A 3RKWA 2FXAA 2BEOA 3NQOA 4RB3C 2Z5UA 1REPC 2FF4A 3QRFF 3IWZA 1J2XA 3FXQA 3BOQA 4Z2YA 2EA2A 1QBJA 3JAMZ 1NHAA 3CUQA 2K27A 5DD8A 2PJPA 2W57A 2J5OA 1Y0UA 4OIPF 1R1TA 3BY6A 1XGSA 4AIHA 5D8KB 5DEQA 4U0WA 3TQNA 2RVCA 5D8LB 1G3TA 2R7FA 3TDUC 3JSOA 4HW0A 2E1NA 3FMRA 1G3SA 1OR7A 2HKOA 1ZG5A 4ESJA 1MGTA 2EFOA 3ECOA 3V8JA 6PAXA 1OYIA 1STZA 4KIGA 1ZG1A 1DP7P 1B1BA 1H9GA 2Z3YA 5ILSA 4KA4A 5IT3A 4HYEA 1O3RA 1RNLA 2OU2A 1ON1A 2G7UA 1PUEE 1IRFA 1Z1DA 3JAMK 4KFCA 3W6KB 1ZN2A 3WE2A 1QGPA 2EA4A 4G94A 4U7DA 2ADUA 5ILVA 2Q2EA 2RN7A 2VBYA 2H6CA 3GVAA 2PBIA 1A04A 1IXCA 1RI7A 2E7XA 3QPHA 2XROA 2FMLA 4WK8F 2D1VA 3FHZA 3R6SA 1FY7A 3HTUA 4IHSA 5IT9Z 3TOAA 3JW4A 3ELKA 2LDUA 5ED4A 4UHTA 2BYVE 1TW3A 3RYPA 4UVCA 1O57A 2XV4S 1ZG3A 2JSCA 1IZ1A 5E8GA 2CFXA 4GXOA 4KIBA 3LA3A 1XB4A 3TKYA 5L3CA 4O6JA 4JBAA 3E5UA 5E1ZB 1SD5A 4ZZDA 1Z9CA 4HF1A 2DPUA 1R7JA 1ZLKA 4I0AA 1EH7A 3QAHA 4PGGA 3TGNA 4M74A 4S05A 2K86A 2JRTA 4P9FA 4XRFA 2BE5F 3FWEA 3F22A 2XKPA 3M8FA 4NQWA 3FF5A 4D0PA 4OU0A 2NNNA 2VT2A 3FMSA 2DTRA 1SMTA 2ZXJA 5E1WA 1SAXA 2YX7A 3HRSA 1KU3A 3ERED 4S04A 2FBKA 1J75A 4P9UA 1G6NA 3F23A 5J6XA 2IVMA 2L02A 2DI3A 1HSTA 2DAOA 3CTAA 5E18F 5HDGA 3F8NA 2P5LC 3GXOA 5FD5A 3B02A 3L7WA 4LJZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMZ A;  1R58 A;  3F21 A;  3F8M A;  1S3J A;  4A0X A;  2LF8 A;  3GLX A;  3CUQ C;  2WV0 A;  2VBZ A;  3D5L A;  3E5Q A;  2Z99 A;  4UXN A;  1U2W A;  3WTT C;  4GYG A;  2K4B A;  1R1U A;  4EM2 A;  2GAU A;  3SXY A;  1AWC A;  4XBF A;  2HEO A;  2VN2 A;  3KP7 A;  3N97 A;  2FA5 A;  4IF4 A;  3QP5 A;  4E70 A;  4L0Z B;  1SFX A;  2HTJ A;  2KIU A;  3TO7 A;  2A5Y B;  4CO8 A;  4BH9 A;  3U2R A;  4CHU A;  4BHB A;  2RQP A;  2O03 A;  2KJC A;  2QZ8 A;  3WGH A;  1QNT A;  4OIR F;  1J7K A;  3TDZ C;  1RZ4 A;  4WWC A;  3RKX A;  2NRA C;  1BJA A;  4KUM A;  4AD9 A;  5EEG A;  2QEN A;  1FNN A;  3TO6 A;  4ESB A;  1IRG A;  3MZY A;  3WE3 A;  2JZY A;  1CGP A;  3HRU A;  5AIQ A;  4TV7 A;  1UHW A;  3B73 A;  4KDP A;  4MQV A;  2VBW A;  1HBX G;  1D5V A;  4ENM A;  1FLI A;  2Y75 A;  5J8F A;  1KGS A;  1U6G A;  1U5T A;  1FX7 A;  3ULQ B;  1K7A A;  4YFK F;  5ICF A;  2A61 A;  4M9S A;  2IJL A;  4MHG A;  3EET A;  4R1H A;  3V7R A;  3O2P E;  4FHT A;  1I6X A;  1PP7 U;  1R5G A;  3KP4 A;  5D5V B;  3IHU A;  3J80 Z;  1ZRC A;  4P55 A;  1VTN C;  2UZK A;  2Y0M A;  1IN4 A;  1BN5 A;  2MD5 A;  4ZYD A;  2L01 A;  4ZZL A;  4ZH4 F;  2F5D A;  1F9N A;  1X3U A;  2TDX A;  4LFU A;  4BHC A;  1IN7 A;  3L00 A;  3FXR A;  2IPQ X;  5ICG A;  1TLH B;  2QLZ A;  3ROU A;  1K6O A;  2GQQ A;  2DT5 A;  4A0Y A;  1T38 A;  2ISZ A;  3ZMZ A;  1XMA A;  4LB6 B;  1P92 A;  4WXC A;  2HYF A;  3Q9V A;  4JK1 X;  5ICE A;  2A07 F;  1I5Z A;  1J0R A;  3I0T A;  3DQV C;  3MCZ A;  1ODD A;  1LDK B;  1BIB A;  3K69 A;  3V8K A;  3NEU A;  3J81 K;  4YFX F;  3SFZ A;  3KCC A;  3F6O A;  3MFK A;  1W4M A;  2COM A;  2KRF A;  4BAY A;  4RGU A;  2ETH A;  1H9T A;  2J5P A;  4AIK A;  4KIC A;  4WXD A;  3LFK A;  2P5V A;  1ZAO A;  3I59 B;  1BBY A;  1BI2 A;  3FM3 A;  1OPC A;  2P4W A;  3WTW C;  3M8E A;  1KQ9 A;  4ZYE A;  2B0L A;  1IAW A;  3U9G A;  1MJ9 A;  3BJ6 A;  3BP8 A;  1MDM B;  5H6R A;  3HHG A;  4U0Y A;  3RIR A;  1XSD A;  1U78 A;  2OQG A;  1TTY A;  1DPR A;  5D6F A;  2M8E A;  3BRO A;  2XAQ A;  1YO5 C;  3O6B B;  2F2E A;  2GIV A;  3FXU A;  1S7A A;  5HS8 A;  4KMF A;  1WWX A;  4A5N A;  4RAY A;  4WF2 A;  2K7L A;  3R0J A;  5CVV A;  2ZME A;  4IPA A;  2A69 F;  2Z9O A;  4G7H F;  3JTH A;  2GWR A;  3BPV A;  2ZJ2 A;  1JXS A;  1XMK A;  1EH6 A;  2BV6 A;  2F5E A;  2X0L A;  2WWY A;  3ZMU A;  1LB2 A;  2FNP A;  3K9T A;  1IN5 A;  4Q5S F;  5DCM B;  3RTR A;  2FRH A;  5K5O A;  4A6D A;  1RIO H;  4IRG A;  1BI3 A;  1I27 A;  4HBL A;  1XSV A;  5DDG A;  3L2C A;  4HDU A;  2K02 A;  2MA3 A;  4ESF A;  1FOK A;  3ZPL A;  2HDC A;  4B8X A;  2MBF A;  3T1B A;  5E8I A;  2RV8 A;  4ZYH A;  5CLS A;  3VOD A;  3WG9 A;  2HQR A;  3QU6 A;  2QM3 A;  2PN6 A;  3RJP A;  1IUY A;  2VON A;  1TQP A;  2PFB A;  1JE8 A;  3JSP A;  3I54 A;  3T8T A;  1LQ1 A;  5LRS A;  2NNY A;  3GEZ A;  4HDV A;  4FT8 A;  1D8K A;  1UCR A;  2MH2 A;  1LVA A;  2MLK A;  4XSX F;  1QQI A;  4Y15 A;  3H92 A;  1HKQ A;  4OIQ F;  1I1G A;  4UV9 A;  3RYR A;  4I7H A;  2DO7 A;  2L54 A;  1BI0 A;  3VB2 A;  4IXA A;  2RGV A;  3ZMD A;  2EFW A;  3WU1 B;  1O3T A;  2VBX A;  4EGY A;  5L3E A;  2V1D A;  2CYY A;  1QZZ A;  2VOD A;  4M9X A;  4P5O A;  1FSE A;  1MKM A;  3N4M A;  3E3V A;  2DPD A;  1XD7 A;  2PMU A;  4MTD A;  4ENJ A;  4HQE A;  4AIJ A;  5LBQ A;  3V7C A;  5DCF A;  3DKW A;  1J9I A;  4L5J A;  4RB1 A;  2CWE A;  1ZH5 A;  2EWN A;  3J7A O;  5LGN A;  3JTG A;  2W24 A;  5FFX A;  2STT A;  3C18 A;  3RDI A;  4I98 B;  1WSU A;  5CYV A;  3I64 A;  3U1D A;  3RPQ A;  1WKM A;  2XUB A;  1Q1H A;  2OA4 A;  3L9F A;  4LLN A;  1S29 A;  4LK1 F;  4KNY A;  4GO1 A;  1KQ8 A;  2E7W A;  3F8B A;  2VE9 A;  2IW5 A;  4KYW A;  1UB9 A;  2HOE A;  2F5F A;  2M45 A;  3WU0 A;  2OAZ A;  1B4A A;  2KJB A;  1W7P B;  5D4S A;  4B09 A;  2BBY A;  5F6F A;  3OV8 A;  2IRF G;  1P4W A;  3GZ5 A;  3GFL A;  1MJB A;  2HZT A;  1E2X A;  4LMY A;  1XDS A;  2DU9 A;  5F1R A;  2HKX A;  1F4K A;  4HX7 A;  2EV6 A;  4CZZ A;  1IF1 A;  3KZY A;  1W7P A;  4CGZ A;  2BGC A;  5LHH A;  2YSR A;  1KA8 A;  4L18 B;  1XN7 A;  2ZNY A;  1JGS A;  5F64 A;  3VEP A;  5FLX Z;  2HYG D;  1Z6T A;  3KP5 A;  4NB5 A;  1FWZ A;  5D6E A;  3I58 A;  1IN8 A;  4LLG F;  1SD4 A;  1MZB A;  4FX4 A;  4MGR A;  3T8R A;  4WXH A;  1ONV A;  4NHJ A;  5E20 A;  3I5U A;  3S2W A;  1TNT A;  1FC3 A;  2ZFW A;  2A68 F;  4BYY A;  4R79 A;  1T98 A;  1RUN A;  2L4A A;  1B59 A;  2G9W A;  2HWV A;  2GA1 A;  3HSE A;  4A12 A;  1XGO A;  2R3S A;  3G3Z A;  5HLH A;  5LEJ A;  2IT0 A;  4K2E A;  5L3D A;  4OMY A;  3CUO A;  4HX4 A;  4HF0 A;  3CO6 C;  4HV6 A;  2IA1 A;  1GXP A;  2LKP A;  3F8F A;  4PDK A;  1YLF A;  5FLX K;  3KFW X;  3TO9 A;  4QWQ A;  3WTU C;  2OQR A;  4EM1 A;  4RB0 A;  2Z33 A;  2XAG A;  2R7D A;  5ICC A;  5DUI A;  3VOE A;  1O3Q A;  3SZP A;  4KT5 C;  2MH9 A;  5D5X B;  4O3M A;  3SHF A;  2FMY A;  4BXU A;  4UVA A;  1HW2 A;  1OYW A;  3P9I A;  1ZRF A;  5DUK A;  2EJR A;  2V9V A;  4M9Z A;  3HYI A;  5TRD A;  1ZRE A;  5FO5 A;  5D5W B;  3CO7 C;  5J8C A;  3IL2 A;  4G6Q A;  3IWF A;  4LLL A;  2IP2 A;  3HIF A;  2DQR A;  1FYM A;  2FBI A;  2L4M A;  3H3U A;  2PI0 A;  3V4G A;  1FP2 A;  4EGZ A;  3DF8 A;  1YFH A;  3E6B A;  5DD4 A;  1UHM A;  4YFN F;  3E6D A;  3LA7 A;  1G3Y A;  2CG4 A;  4R8H A;  5LHG A;  1G4D A;  2EFN A;  1XGN A;  3IKV A;  4RGX A;  1O7F A;  1FP1 D;  4KMU X;  4PGH A;  4YG2 F;  4CYD A;  2YPR A;  4EJO A;  2RKH A;  1U8R A;  1YQA A;  5E1X A;  1D3Y A;  4YIF A;  4ASN A;  1Z6R A;  2XAF A;  1IXR C;  5H6Q A;  3PQK A;  5A2Q K;  1FYK A;  2MLG A;  3J81 Z;  3W6J B;  5LEK A;  1BIA A;  3GZ6 A;  2QQ9 A;  4I0B A;  1IN6 A;  4OIO F;  1FBS A;  1SFU A;  5JHU A;  1I1S A;  1PDN C;  3ZN1 A;  4H0E A;  3M1E A;  3WOD F;  1Z7U A;  4BHP A;  2V6C A;  2KIM A;  3KZZ A;  2FE3 A;  3R61 A;  2NYX A;  1BC8 C;  2XGX A;  2RC4 A;  1PP8 F;  4GGG A;  3ZP5 A;  2HS5 A;  4RGS A;  2DK8 A;  3CJN A;  5AON A;  2VOP A;  4RS8 A;  3V7S A;  1Z05 A;  3P9C A;  3LAP A;  1R36 A;  1K79 A;  1FSH A;  3DXJ F;  1P6R A;  1R00 A;  1MD0 A;  5BOX A;  4U7B A;  1HKT A;  2OZU A;  3O3K A;  3GFJ A;  4EJU A;  2V1U A;  2RDP A;  3LST A;  5K5R A;  1XCB A;  1YYV A;  2FNA A;  3AAF A;  4PCQ A;  3F6V A;  1S6L A;  3K0L A;  2L3D A;  4L9T A;  2DFI A;  5HS7 A;  2P6T A;  2W85 A;  5ERI A;  4RB2 C;  1V3F A;  4EVI A;  4I02 A;  3BDD A;  4DNC A;  4HF2 A;  3CDH A;  4OIN F;  2W25 A;  4N0B A;  2CGP A;  1YW7 A;  2H27 A;  3EUH A;  5CVU A;  3ISP A;  2QVO A;  3KEO A;  4G9Y A;  3K2Z A;  5HDN A;  2JTV A;  2CO5 A;  4F7Z A;  3G73 A;  3I59 A;  1J5Y A;  4Y17 A;  2ZCW A;  1E17 A;  2OD5 A;  1WRJ A;  1QZY A;  1UFM A;  3EYY A;  1SD7 A;  3HUG A;  1MDM A;  1XCV A;  2M5W A;  3HTS B;  3D0S A;  2V1X A;  2GA2 A;  2F5C A;  3VFZ A;  4A0Z A;  3WTV C;  1B6A A;  3GFI A;  2O61 A;  3HOT A;  4EJT A;  1P4A A;  1K78 B;  3PFI A;  4L9N A;  3R60 A;  1CF7 B;  4YII A;  4P96 A;  5BPD A;  2VXZ A;  2KIF A;  5DV5 A;  3T0Y A;  2P7V B;  1LEB A;  4O5V A;  3KLN A;  1KU9 A;  1HW1 A;  1W7P D;  2GZW A;  2UXN A;  3CUQ B;  3GW2 A;  1S7O A;  3DEU A;  3WGG A;  2FSW A;  4HV5 A;  3REO A;  5DCM A;  5DYM A;  3P9K A;  1FYL A;  3MEX A;  1OYY A;  1RUO A;  3BPX A;  5L3G A;  5E17 F;  1U5T C;  1CF7 A;  4RGR A;  5FD6 A;  1HKS A;  3E97 A;  3RPU A;  2ACJ A;  1T39 A;  2PG4 A;  2QQB A;  1OKR A;  2DK5 A;  4U88 A;  3F72 A;  3FMQ A;  1R22 A;  5ILU A;  1R23 A;  2LSO A;  5EEH A;  1J59 A;  1XSX A;  3IRQ A;  4KN4 X;  5CVJ A;  1R1V A;  4L5I A;  1FBU A;  2JPC A;  4EMS A;  3GF2 A;  3I71 A;  4XSZ F;  1USS A;  1FPQ A;  3K1P A;  2LNB A;  2EFQ A;  3R0A A;  4I09 A;  3QOP A;  2G7H A;  2STW A;  4IJA A;  3FZV A;  4IVN A;  1XGM A;  3LA2 A;  1KYZ A;  2O8X A;  5HOO A;  4GCV A;  1B9N A;  1D8J A;  1JHH A;  2V79 A;  4ETS A;  4AVP A;  3V8L A;  4U0V A;  3HHH A;  4XLN F;  2PLY A;  5CJ9 A;  1F1Z A;  4WX9 A;  3M7G A;  4LG0 B;  3RI4 A;  2CSO A;  2EB7 A;  5FB2 A;  3E6C C;  1BM9 A;  2A6E F;  3E5X A;  4MQ9 F;  4UNO A;  3KP6 A;  3SQN A;  4Y13 A;  1YW9 A;  5HLG A;  2FEZ A;  4FX0 A;  5HVQ C;  3ABT A;  2QUF A;  1TQM A;  1U3E M;  3HOS A;  2QQA A;  3EQL F;  3ABU A;  2P5K A;  3I53 A;  1L3L A;  1P2F A;  5LGU A;  4JQF A;  5FGM A;  4LG0 A;  3HRT A;  3MWM A;  3RKY A;  2XKO A;  3WTZ A;  4IRI A;  1FT9 A;  1W5T A;  4G7Z F;  3BZ6 A;  1SFE A;  1H0M A;  1IXS B;  1BOA A;  3DPL C;  3T5X A;  3ZQ7 A;  4CDG A;  1TNS A;  2VOO A;  4AWX B;  2YU3 A;  2IA0 A;  4A5M A;  1SD6 A;  5KK1 A;  1WI9 A;  2CW0 F;  2H6B A;  3FX3 A;  2XHK A;  3KP2 A;  3P7N A;  4DQ2 A;  4L0Y B;  2DW4 A;  1YTY A;  4LGW A;  3Q5F A;  2C6Y A;  4ENN A;  3ZMV A;  4A6E A;  4UUV A;  4IHT A;  2NAZ A;  2YX4 A;  1DUX C;  2HQN A;  1WQ2 A;  1ZYR F;  2HR3 A;  4MNU A;  2M87 A;  2Y48 A;  4L9V A;  2O6G E;  4M73 A;  1QPM A;  2EV5 A;  2QWW A;  4HAM A;  5IT9 K;  1KQ0 A;  4EJV A;  2XAS A;  2PEX A;  2FBH A;  1LJ9 A;  2D1H A;  4RAZ A;  3ECH A;  5CVI A;  2FOK A;  4M6X A;  1KU7 A;  5HDK A;  5JR3 A;  1DDN A;  1FZP B;  3EDP A;  5JVT A;  5BQT A;  2Q0O A;  5BS6 A;  2D2W A;  2XVC A;  4QLC U;  1T6S A;  3ZMS A;  3ZN0 A;  1ZGJ A;  1DPU A;  4G6D A;  1L0O C;  5KVR A;  5CVR A;  2AS5 F;  1S8N A;  4HZF A;  3DP7 A;  3F8C A;  5K5Q A;  1ZHF A;  4N9I A;  4M72 A;  2ELH A;  2YR2 A;  2W84 A;  3R4K A;  5L3F A;  1ZRD A;  1YIO A;  5D5U B;  1ON2 A;  1OMI A;  1W5S A;  1BC7 C;  2O3F A;  2OBP A;  1EV7 A;  4KN7 X;  1SMY F;  4LK0 F;  1BI1 A;  2OZ6 A;  4A2U A;  2DBB A;  1LNW A;  4HLX A;  3MZH A;  4LD5 A;  3EYI A;  3COA C;  1T0F A;  1T2K A;  2KKO A;  4UVB A;  3PQJ A;  1GHC A;  1R5H A;  2VT3 A;  3LWF A;  1LDJ A;  4PZJ A;  1LEA A;  2FQ3 A;  3BWG A;  4I01 A;  2EFP A;  4KIF A;  5A2Q Z;  2IA2 A;  3KLO A;  3LQQ A;  1ZLJ A;  2D45 A;  3GFM A;  2FU4 A;  1U5T B;  4EV0 A;  2WC2 A;  3HRM A;  2NS0 A;  5FFZ A;  2HFH A;  1YW8 A;  3WTS C;  2CQK A;  4EM0 B;  4ZYG A;  1HW5 A;  1B9M A;  5LRR A;  4MEX F;  2M1B A;  5LHI A;  2P8T A;  2ZBK A;  1UST A;  3QU3 A;  1HQC A;  1GXQ A;  3C7J A;  2P6S A;  3K1N A;  4Q48 A;  4EJW A;  3ML6 A;  2AXL A;  2VC0 A;  4Q4Z F;  2X4H A;  3DV8 A;  4WCG A;  1ULY A;  3C1D A;  5H20 A;  5LGT A;  2QYO A;  3C3W A;  4HA8 A;  1ZAR A;  3KEQ A;  1TQI A;  2ESN A;  3H3Z A;  2LF7 A;  4HX8 A;  2XAJ A;  4G8X A;  4XLP F;  5HLI A;  2PQ8 A;  3K1M A;  1TW2 A;  2ESH A;  3HSF A;  1KYW A;  3LAJ A;  2ZO4 A;  3GX4 X;  3E6M A;  2WTE A;  5AIP A;  1HSJ A;  5BPI A;  4G7O F;  2HGC A;  3IRR A;  4OOI A;  2UWM A;  4M6Y A;  3IKT A;  4LB5 A;  2UXX A;  3MQ0 A;  3KP3 A;  5JFR A;  4IRH A;  2A6H F;  3DPT A;  3FM5 A;  4UV8 A;  3Q9S A;  3OOP A;  1LDD A;  2P7C B;  3MAJ A;  3TOB A;  5HS9 A;  2K4J A;  3QP6 A;  3ZMT A;  1JHF A;  4CXF A;  4MEY F;  1ZGA A;  4EQQ A;  4HQM A;  1G3W A;  2ZKZ A;  5L3B A;  4I2O A;  3GUD A;  3J80 K;  2Q8K A;  5TJJ A;  3KE2 A;  2QBY B;  2EK5 A;  3CLO A;  3M9A A;  3SZT A;  2E1C A;  5D4R A;  1YS6 A;  4M71 A;  3GYH X;  3DFG A;  4BQA A;  4Q47 A;  2A3S A;  1FBQ A;  2MC3 A;  1EH8 A;  1C0W A;  1P4X A;  1QO0 D;  2PMH A;  3BJO A;  1Z91 A;  4HOB A;  2RNJ A;  3LQR A;  4L9J A;  1O7L A;  1MJA A;  1YG2 A;  2ZNZ A;  2QBY A;  1IW7 F;  3KET A;  2ZME B;  4ON0 A;  3I4P A;  1O3S A;  3HSR A;  3WTY C;  2DLL A;  1HXD A;  1F5T A;  3NRV A;  2XAH A;  4HLY A;  1YS7 A;  3QPT A;  4CIC A;  3F3X A;  1V4R A;  3WTX C;  4BNC A;  2H94 A;  2M30 A;  2ISY A;  1GVJ A;  3L09 A;  2XIG A;  4GYI A;  1KU2 A;  1TBX A;  2HTS A;  3GO5 A;  4MTE A;  2GXB A;  1XDU A;  2XRN A;  2O0Y A;  4N9H A;  3BJA A;  5K1Y A;  2JT1 A;  2VC1 A;  3GWZ A;  1AOY A;  2JPB A;  4ENK A;  2DQL A;  2H09 A;  2GXG A;  2EV0 A;  4OMZ A;  2VE8 A;  5JI6 A;  3WGI A;  5LLQ A;  3IC7 A;  1K78 A;  3RKW A;  2FXA A;  2BEO A;  3NQO A;  4RB3 C;  2Z5U A;  1REP C;  2FF4 A;  3QRF F;  3IWZ A;  1J2X A;  3FXQ A;  3BOQ A;  4Z2Y A;  2EA2 A;  1QBJ A;  3JAM Z;  1NHA A;  3CUQ A;  2K27 A;  5DD8 A;  2PJP A;  2W57 A;  2J5O A;  1Y0U A;  4OIP F;  1R1T A;  3BY6 A;  1XGS A;  4AIH A;  5D8K B;  5DEQ A;  4U0W A;  3TQN A;  2RVC A;  5D8L B;  1G3T A;  2R7F A;  3TDU C;  3JSO A;  4HW0 A;  2E1N A;  3FMR A;  1G3S A;  1OR7 A;  2HKO A;  1ZG5 A;  4ESJ A;  1MGT A;  2EFO A;  3ECO A;  3V8J A;  6PAX A;  1OYI A;  1STZ A;  4KIG A;  1ZG1 A;  1DP7 P;  1B1B A;  1H9G A;  2Z3Y A;  5ILS A;  4KA4 A;  5IT3 A;  4HYE A;  1O3R A;  1RNL A;  2OU2 A;  1ON1 A;  2G7U A;  1PUE E;  1IRF A;  1Z1D A;  3JAM K;  4KFC A;  3W6K B;  1ZN2 A;  3WE2 A;  1QGP A;  2EA4 A;  4G94 A;  4U7D A;  2ADU A;  5ILV A;  2Q2E A;  2RN7 A;  2VBY A;  2H6C A;  3GVA A;  2PBI A;  1A04 A;  1IXC A;  1RI7 A;  2E7X A;  3QPH A;  2XRO A;  2FML A;  4WK8 F;  2D1V A;  3FHZ A;  3R6S A;  1FY7 A;  3HTU A;  4IHS A;  5IT9 Z;  3TOA A;  3JW4 A;  3ELK A;  2LDU A;  5ED4 A;  4UHT A;  2BYV E;  1TW3 A;  3RYP A;  4UVC A;  1O57 A;  2XV4 S;  1ZG3 A;  2JSC A;  1IZ1 A;  5E8G A;  2CFX A;  4GXO A;  4KIB A;  3LA3 A;  1XB4 A;  3TKY A;  5L3C A;  4O6J A;  4JBA A;  3E5U A;  5E1Z B;  1SD5 A;  4ZZD A;  1Z9C A;  4HF1 A;  2DPU A;  1R7J A;  1ZLK A;  4I0A A;  1EH7 A;  3QAH A;  4PGG A;  3TGN A;  4M74 A;  4S05 A;  2K86 A;  2JRT A;  4P9F A;  4XRF A;  2BE5 F;  3FWE A;  3F22 A;  2XKP A;  3M8F A;  4NQW A;  3FF5 A;  4D0P A;  4OU0 A;  2NNN A;  2VT2 A;  3FMS A;  2DTR A;  1SMT A;  2ZXJ A;  5E1W A;  1SAX A;  2YX7 A;  3HRS A;  1KU3 A;  3ERE D;  4S04 A;  2FBK A;  1J75 A;  4P9U A;  1G6N A;  3F23 A;  5J6X A;  2IVM A;  2L02 A;  2DI3 A;  1HST A;  2DAO A;  3CTA A;  5E18 F;  5HDG A;  3F8N A;  2P5L C;  3GXO A;  5FD5 A;  3B02 A;  3L7W A;  4LJZ F; 
#chains in the Genus database with same CATH topology
 1JT6 A;  5IYC J;  5BMZ A;  5GPA A;  2R5Z A;  4M3D A;  1R58 A;  1RET A;  3HPH A;  1M1E B;  3F21 A;  3I3L A;  3CP8 A;  3GZN B;  3AKZ A;  3F8M A;  1S3J A;  4A0X A;  3H5A A;  2LF8 A;  4XKB A;  2V4J C;  1G8X A;  3GLX A;  3SJM A;  3DWL E;  2OV7 A;  3CUQ C;  3DBL B;  4C3J J;  2WV0 A;  3LL7 A;  4B1R A;  2VBZ A;  3RCO A;  1FTT A;  3D5L A;  3E5Q A;  1MMD A;  2Z99 A;  4UXN A;  3OS0 A;  1U2W A;  3WTT C;  4GYG A;  2K4B A;  1QHH D;  1R1U A;  2X6W A;  2I8D A;  4EM2 A;  4E7I A;  3DCF A;  5B1B H;  1LFP A;  2GAU A;  3SXY A;  3BG3 A;  4B44 A;  1AWC A;  4XBF A;  2A05 A;  2HEO A;  2VN2 A;  1QRY A;  3KP7 A;  3JR9 A;  3N97 A;  1K83 J;  2FA5 A;  3CMY A;  4IF4 A;  2K3P A;  4XRM A;  3QP5 A;  4E70 A;  4L0Z B;  3PJR A;  1SFX A;  2HTJ A;  2KIU A;  3ABM H;  2DDB A;  3TO7 A;  2A5Y B;  3B6A A;  4CO8 A;  4BH9 A;  3U2R A;  4CHU A;  4IHW A;  4BHB A;  2RQP A;  2O03 A;  2KJC A;  2OPT A;  1B72 B;  2QZ8 A;  5CQG A;  1QNT A;  4OIR F;  1J7K A;  3WGH A;  1TC3 C;  3TDZ C;  1RZ4 A;  4WWC A;  2Y30 A;  1N78 A;  3RKX A;  2NRA C;  1BJA A;  4BE2 A;  4ZTF A;  2LKS A;  3IAM 2;  2F5V A;  4KUM A;  4AD9 A;  3H9G A;  4KIS A;  5EEG A;  2QEN A;  1FNN A;  3TO6 A;  4ESB A;  2ZSI B;  1IRG A;  2X1E A;  3MZY A;  2Z16 A;  3M8J A;  3WE3 A;  4D1Q A;  5IP7 J;  2X6O A;  3CJQ B;  4KT6 A;  3U1K A;  2LH9 A;  2JZY A;  3BTL A;  3QYF A;  1HDP A;  1CGP A;  3HRU A;  2OCE A;  1KON A;  5AIQ A;  4TV7 A;  1MW7 A;  1UHW A;  3B73 A;  4KDP A;  2BY3 A;  4CYC B;  3HOY J;  4MQV A;  2JSP A;  3EUA A;  2VBW A;  1P9Q C;  2BVM A;  2P0W A;  5FKL A;  1HBX G;  1B72 A;  2OF7 A;  1T95 A;  1D5V A;  4ENM A;  4CA0 A;  3ONQ A;  1S72 I;  3S1Q J;  1FLI A;  2Y75 A;  2L5Q A;  1DQU A;  4CZC A;  5F0C A;  1YRN A;  3B6C A;  5CPR B;  5J8F A;  1KGS A;  2LBF A;  3CMA I;  3OY9 A;  1U6G A;  1U5T A;  2AQE A;  1FX7 A;  5J1Y A;  4IHV A;  1KZH A;  3TMO A;  3ULQ B;  2BY2 A;  4DZP A;  1MIJ A;  1K7A A;  4YFK F;  3LNQ A;  5ICF A;  2A61 A;  2XPV A;  4M9S A;  2IJL A;  3FIW A;  4MHG A;  3EET A;  3VWB A;  4R1H A;  5JLX A;  3V7R A;  4CYC A;  3O2P E;  3VDX A;  4FHT A;  1I6X A;  1WHU A;  1PP7 U;  1R5G A;  1E3H A;  1E3P A;  3H1C A;  4DYC A;  2KIS A;  3M07 A;  3Q3S A;  3KP4 A;  2X6Y A;  3FBN B;  5D5V B;  3IHU A;  3J80 Z;  3OYE A;  1ZRC A;  4P55 A;  4XOR A;  3OYB A;  1VTN C;  2UZK A;  2Y0M A;  3TW7 A;  3FXL A;  3S3N A;  1Y1W J;  1XS9 A;  3D1N I;  5TGT A;  1IN4 A;  1BN5 A;  3IH2 A;  2MD5 A;  4ZYD A;  2D5V A;  2CUZ A;  2L01 A;  4ZZL A;  4F93 B;  4ZH4 F;  2F5D A;  1YOV B;  1F9N A;  2M4G A;  1AU7 A;  2DT7 B;  3PL8 A;  2BOL A;  1X3U A;  3K7A J;  3BQY A;  2XB5 A;  5IOY A;  2TDX A;  1NTC A;  3S2D J;  4LFU A;  3PNT A;  4LIV A;  4BHC A;  1ETQ A;  2TRT A;  1IN7 A;  4D9J A;  2DYR H;  5IYD J;  3L00 A;  4GRI A;  1R9T J;  3L2W A;  5IYB J;  3FXR A;  3H35 A;  2IPQ X;  1EF4 A;  5ICG A;  1TLH B;  2H1L A;  3OYG A;  2QLZ A;  3ROU A;  3IH3 A;  4J01 A;  5EDN A;  1K6O A;  1ETO A;  2GQQ A;  2DT5 A;  4A0Y A;  2XGD A;  1HLV A;  2K9Q A;  1T38 A;  2IS2 A;  1D1A A;  2ISZ A;  3ZMZ A;  1XMA A;  4LB6 B;  4HNV A;  2VLA A;  1YI2 I;  1P92 A;  1MH3 A;  4WXC A;  2VQC A;  2HYF A;  3Q9V A;  1LE8 A;  1Y56 A;  4X0G A;  4JK1 X;  3JRC A;  5ICE A;  4QPQ A;  2K85 A;  3FK6 A;  2W82 A;  3K4J A;  4J00 A;  3ESW B;  2A07 F;  2HYJ A;  2R7U A;  1I5Z A;  1XC5 A;  4DOZ A;  1J0R A;  3G4S I;  4BDZ A;  2JJ7 A;  3I0T A;  1T8I A;  1WH5 A;  3DQV C;  3WHC A;  3MCZ A;  4Z6Y A;  3CF2 A;  2KT0 A;  1ODD A;  1LDK B;  1BIB A;  3K69 A;  3V8K A;  3W3C A;  1MBF A;  3NEU A;  3J81 K;  2JA7 J;  4YFX F;  1S7E A;  4C2T A;  4RA2 A;  2M7A A;  3HXL A;  3SFZ A;  3PFY A;  3KCC A;  3F6O A;  3MFK A;  1JUM A;  1W4M A;  2DOA A;  2COM A;  2KRF A;  4BAY A;  3OS1 A;  4RGU A;  4D5C A;  2ETH A;  1H9T A;  2J5P A;  4AIK A;  4KIC A;  3X2Q H;  2WA0 A;  3RQ4 A;  1UAA A;  2X1C A;  4BXX J;  4WXD A;  3LFK A;  2P5V A;  3HB9 A;  1ZAO A;  2M8G X;  3I59 B;  1BBY A;  4DZJ A;  1BI2 A;  3FM3 A;  1OPC A;  2P4W A;  4JX6 A;  3WTW C;  4FAS D;  4QIW N;  2IGM A;  2COB A;  3M8E A;  4JOM A;  1KQ9 A;  5EZG A;  4ZYE A;  2B0L A;  3SFI A;  3P5J A;  1IAW A;  3U9G A;  5DM6 F;  1MJ9 A;  3BJ6 A;  3BP8 A;  3HUG B;  4J19 A;  1TT0 A;  3A1Y A;  5H6R A;  1MDM B;  3HHG A;  1HC8 A;  3QOE A;  3UKG A;  2LY1 A;  3KYC B;  4U0Y A;  3RIR A;  1XSD A;  1U78 A;  2OQG A;  1TTY A;  1DPR A;  5D6F A;  2M8E A;  3SDB A;  5J40 A;  3BRO A;  2X1D A;  2XF7 A;  1X1P A;  4GFB A;  2XAQ A;  2KIQ A;  3IH4 A;  2CQ7 A;  5FJ8 J;  1YO5 C;  3CC2 I;  2EQR A;  3O6B B;  2F2E A;  2DOF A;  2GIV A;  4AM3 A;  3FXU A;  1LFB A;  1S7A A;  4XKV A;  5HS8 A;  3CZ6 A;  4KMF A;  1WWX A;  4NBQ A;  5C4X J;  4N4N B;  3S93 A;  4A5N A;  4IO9 F;  4RAY A;  4WF2 A;  2K7L A;  3R0J A;  5CVV A;  4JP0 A;  1NK2 P;  4C3H J;  2ZME A;  4IPA A;  2A69 F;  3GBG A;  4BDY A;  2VPL A;  2Z9O A;  4G7H F;  3JTH A;  2GWR A;  3BPV A;  2ZJ2 A;  1JXS A;  1XMK A;  1Y6I A;  1EH6 A;  2BV6 A;  2DMN A;  3W2V A;  2F5E A;  2WBM A;  2X0L A;  3ZMU A;  2WWY A;  1LB2 A;  5F04 A;  1IG7 A;  2FNP A;  3K9T A;  5KHD A;  4D7M A;  1IN5 A;  2DCE A;  3FIS A;  4Q5S F;  5DCM B;  3LOC A;  3RTR A;  1X1D A;  2FRH A;  5K5O A;  3O8G A;  4BAC A;  4A6D A;  5EGO B;  1RIO H;  4IRG A;  1BI3 A;  1I27 A;  1JUS A;  4HBL A;  2VI6 A;  4NDL A;  1XSV A;  1WCM J;  3I4N J;  2KRH A;  4DW6 A;  5DDG A;  3H36 A;  3L2C A;  4HDU A;  2K02 A;  1SVL A;  2MA3 A;  2XB0 X;  4ESF A;  1FOK A;  2DOE A;  3ZPL A;  4F92 B;  3CP2 A;  5DM7 F;  2UUZ A;  2A5W A;  2HDC A;  1RPW A;  4B8X A;  1G59 A;  2GM4 A;  2JUC A;  2MBF A;  3T1B A;  2E2I J;  3HOW J;  1LUJ B;  3BG5 A;  3RZO J;  5E8I A;  2CUE A;  2RV8 A;  4G12 A;  4ZYH A;  5CLS A;  3VOD A;  3WG9 A;  2XAU A;  5KCM A;  2HQR A;  3QU6 A;  2VKH A;  2QM3 A;  3OYK A;  3TED A;  2PN6 A;  3RJP A;  1IUY A;  1X4P A;  2VON A;  1TQP A;  4XON A;  4CCK A;  3FHN A;  5EGO A;  5F0H A;  2PFB A;  3LSK A;  1A5J A;  1Y0N A;  1JE8 A;  4BS9 A;  3JSP A;  3BG9 A;  3I54 A;  3T8T A;  3BR2 A;  5LRS A;  2NNY A;  1LQ1 A;  2DTZ A;  3GTM J;  3G1L A;  3ZRG A;  3GEZ A;  4HDV A;  4NNJ A;  3MVP A;  4FT8 A;  1D8K A;  1UCR A;  2EH3 A;  2R7O A;  2MH2 A;  3HZJ A;  2IXS A;  3GCM A;  1YJ9 I;  1LVA A;  2MLK A;  2VKV A;  3K4K A;  3JCU C;  4XSX F;  1Z3Y A;  1QQI A;  4Y15 A;  3H92 A;  1HKQ A;  4OIQ F;  1I1G A;  4UV9 A;  3RYR A;  4I7H A;  2DO7 A;  2L54 A;  1BI0 A;  3VB2 A;  1JJ6 C;  4IXA A;  2RGV A;  3ZMD A;  2EFW A;  3WU1 B;  2QCO A;  3OSG A;  5HLT A;  1LKX A;  1O3T A;  1FIA A;  2VBX A;  5K7H A;  2LY9 A;  4EGY A;  5L3E A;  2NOJ B;  1SC7 A;  2E2H J;  2V1D A;  2WAE A;  2CS3 A;  2CYY A;  3QYE A;  1QZZ A;  2VOD A;  4M9X A;  1WVR A;  2E36 A;  4XL9 A;  4P5O A;  1N77 A;  1FSE A;  2XF6 A;  1MKM A;  3N4M A;  3E3V A;  2DPD A;  1QPI A;  1XD7 A;  2PMU A;  3OYA A;  5E3M A;  3H5N A;  4MTD A;  3LFU A;  1PUF B;  4PFO A;  1MMS A;  4ENJ A;  1VQK I;  2OC6 A;  2R7W A;  4HQE A;  4AIJ A;  3VYR B;  2CV2 A;  1JJ8 C;  4AYB N;  5LBQ A;  3MKW B;  3V7C A;  1OQY A;  5DCF A;  3DKW A;  1J9I A;  1GV5 A;  3ZQL A;  4L5J A;  4RB1 A;  2F6C A;  2B9S A;  2AXT C;  2CWE A;  3BZK A;  1ZH5 A;  2EWN A;  2P81 A;  3J7A O;  5LGN A;  3JTG A;  1WI3 A;  2W24 A;  5FFX A;  3E0J B;  3C18 A;  2GOX B;  2STT A;  2VQG A;  3RDI A;  2HQA A;  4I98 B;  4KIT B;  2NS8 A;  3OL4 A;  2Z1D A;  5C44 J;  1WSU A;  5CYV A;  3I64 A;  1WJA A;  4IEJ A;  3U1D A;  3RPQ A;  1WKM A;  2WB1 A;  2XUB A;  1N75 A;  3ZQF A;  1Q1H A;  2OA4 A;  3L9F A;  4CSW A;  4LLN A;  1FMV A;  2HDW A;  1S29 A;  4LK1 F;  2LC2 A;  4KNY A;  4GO1 A;  2QSH X;  1Z21 A;  2E7W A;  3F8B A;  2VE9 A;  1KQ8 A;  2IW5 A;  4KYW A;  4BY1 J;  1UB9 A;  2HOE A;  2F5F A;  2M45 A;  3CC7 I;  2JK3 A;  3WU0 A;  2OAZ A;  1B4A A;  2KJB A;  1W7P B;  5D4S A;  2RQQ A;  1XG1 A;  2BBY A;  4I76 A;  4B09 A;  1K61 A;  1Y8Q B;  3FBI B;  4B3A A;  5F6F A;  2NVY J;  3OV8 A;  2HXO A;  4XM3 A;  2IRF G;  2JRM A;  1MMA A;  1P4W A;  2X85 A;  3GZ5 A;  3K4N A;  2R92 J;  4DBR A;  3GFL A;  3FKI J;  4C2U A;  5IP6 A;  3GTP J;  1MJB A;  2HZT A;  4KJZ A;  1E2X A;  4LMY A;  3OIO A;  1OIS A;  1Y8R B;  3RSN A;  1XDS A;  2XC7 A;  1V5G A;  1PJR A;  2OCC H;  1VQ8 I;  1QU3 A;  3WU2 C;  2DU9 A;  5F1R A;  2HKX A;  1F4K A;  4F52 A;  4IHY A;  4HX7 A;  5IY5 H;  2EV6 A;  3L2R A;  2VQH A;  2YUS A;  4LIT A;  4CZZ A;  1IF1 A;  1MNM C;  3QWL A;  2KDO A;  3KZY A;  1AA7 A;  1X3W B;  1W7P A;  2JA2 A;  2DDA A;  4CGZ A;  1EA3 A;  3OYC A;  2ZJQ F;  1MBH A;  9ANT A;  2BGC A;  1EKE A;  1SVO A;  4E7J A;  1K4T A;  5LHH A;  2HPI A;  2YSR A;  2DFE A;  5M3F J;  1KA8 A;  4L18 B;  1XN7 A;  3LSR A;  1ETY A;  3K4M A;  2ZNY A;  2ECC A;  1B8I B;  1W5C C;  1JGS A;  2FOW A;  4IQ4 A;  1VQL I;  3UNG C;  1XTA A;  3PIO F;  3I9V 2;  5F64 A;  2ZME C;  3CD6 I;  3VEP A;  3QYB A;  2CUJ A;  2HYG D;  5FLX Z;  1SFO J;  1ACI A;  1Z6T A;  2X48 A;  3KP5 A;  4NB5 A;  1JGG A;  3F9K A;  5J1R A;  2HPM A;  1RES A;  3L2Q A;  1FWZ A;  5D6E A;  3DKY A;  3I58 A;  1IN8 A;  4LLG F;  4A69 C;  1SD4 A;  1DU6 A;  1MZB A;  2W7N A;  2NVX J;  4FX4 A;  3SYT A;  4MGR A;  3T8R A;  5J3L A;  4WXH A;  5GTI C;  4AUX A;  3JRE A;  3GTO J;  5M5Y J;  3DEW A;  5FLM J;  1ONV A;  2L7K A;  1OFC X;  4NHJ A;  5E20 A;  3I5U A;  3S2W A;  4XRS G;  4PK4 A;  3LSI A;  1TNT A;  1FC3 A;  3AG4 H;  2ZFW A;  2A68 F;  4BL0 B;  4BYY A;  4R79 A;  2BXY A;  3OYI A;  4HNU A;  2X6X A;  1BW5 A;  1T98 A;  1VQ6 I;  1BW6 A;  3HOV J;  3NWT A;  4RM3 A;  1OJL A;  1UG2 A;  3E1S A;  1RUN A;  5EZH A;  2L4A A;  1PYV A;  1UG0 A;  1B59 A;  2G9W A;  2HWV A;  2GA1 A;  3HSE A;  4A12 A;  1UZC A;  1XGO A;  2R3S A;  4XN0 A;  3G3Z A;  5HLH A;  3OMY A;  5LEJ A;  2IT0 A;  4DYQ A;  1G2H A;  4K2E A;  5L3D A;  1R71 A;  2IGK A;  4OMY A;  2E34 A;  4NC6 A;  3CUO A;  4BJ5 C;  4BE0 A;  3A0B C;  4HX4 A;  1GUU A;  2DMT A;  5EYR A;  4HF0 A;  3CO6 C;  4HV6 A;  5E3N A;  2IA1 A;  2DJI A;  1VND A;  1GXP A;  2LKP A;  3F8F A;  4PDK A;  5HOD A;  1VQ4 I;  3GTQ J;  1YLF A;  5FLX K;  2QKM B;  3KFW X;  3TO9 A;  2JN6 A;  2LK2 A;  4QWQ A;  1QA6 A;  4DYR A;  3PUF A;  2LFB A;  3WTU C;  4BE1 A;  2OQR A;  4EM1 A;  1GV2 A;  4RB0 A;  2Z33 A;  2DOD A;  2XAG A;  1EJ9 A;  1FIP A;  2R7D A;  4D7N A;  5ICC A;  5DUI A;  3VOE A;  3IUO A;  2JA5 J;  2HVS A;  3DTE A;  1O3Q A;  3SZP A;  4KT5 C;  2MH9 A;  5D5X B;  4O3M A;  2Y69 H;  1R5I D;  3KPH A;  2R0Q C;  3S8P A;  1ERD A;  1OR7 C;  3SHF A;  4II3 A;  1FJL A;  2FMY A;  2VJ4 A;  4BXU A;  2O9L A;  4UVA A;  1HW2 A;  1OYW A;  3P9I A;  2R7Q A;  2EZL A;  1YX5 A;  2ECB A;  1LPQ A;  1ZRF A;  4EAT A;  3DTI A;  1R4N B;  1WJB A;  1NK3 P;  5KAF C;  5DUK A;  4JX4 A;  2EJR A;  4HPQ A;  3CCV I;  5IP9 J;  2H8W A;  4AVZ A;  2DJN A;  2M34 A;  2V9V A;  4M9Z A;  3HYI A;  5TRD A;  4BXF A;  2Y2Z A;  1ZRE A;  1DP3 A;  3F0C A;  5FO5 A;  4B4C A;  5D5W B;  1T08 B;  3CO7 C;  2MC4 A;  5J8C A;  3IL2 A;  3WHB A;  3GTG J;  5JHF A;  4G6Q A;  3K4C A;  3IWF A;  4LLL A;  4FET A;  2IP2 A;  4GDF A;  3HIF A;  2L9S A;  2DQR A;  1FYM A;  2FBI A;  2L4M A;  3H3U A;  4XLC A;  2R7R A;  2PI0 A;  1UJ8 A;  5IOZ A;  4IKF A;  3V4G A;  3AL0 C;  2O7O A;  1FP2 A;  4EGZ A;  3CJT B;  3DF8 A;  1YFH A;  3E6B A;  5DD4 A;  1UHM A;  4LOC A;  4YFN F;  3KYL A;  3E6D A;  3LA7 A;  1G3Y A;  2CG4 A;  4R8H A;  3BR6 A;  3IV5 A;  1D1C A;  1ENH A;  1X1A A;  2YU9 J;  2Y0S N;  3SZG A;  3S32 A;  5LHG A;  1G4D A;  2XPU A;  2EFN A;  1XGN A;  2OUM A;  3DLL F;  1SAN A;  4XK4 A;  3IKV A;  4RGX A;  5GAD J;  3QQA A;  2DA2 A;  2UV1 A;  4H4K C;  4PSW A;  1O7F A;  4CCM A;  2WAQ A;  2DFH A;  3NAU A;  1FP1 D;  4KMU X;  2ZC2 A;  4PGH A;  4Y7N J;  4YG2 F;  4CYD A;  3CCS I;  2YPR A;  3PNY A;  4EJO A;  3RZD J;  2RKH A;  3HL2 A;  2NVT J;  2LTP A;  4NC7 A;  3OYL A;  3EPZ A;  2KLO A;  1U8R A;  1YQA A;  3HBL A;  5E1X A;  1D3Y A;  4YIF A;  4ASN A;  1Z6R A;  2XAF A;  2QSG X;  1IXR C;  2XRL A;  4FCY A;  5GAG J;  5H6Q A;  2CJJ A;  3PQK A;  5A2Q K;  2LVS A;  2MLG A;  1FYK A;  2VAS A;  1ETW A;  4MLO A;  3S3M A;  3K4B A;  3JRH A;  3J81 Z;  3W6J B;  4F3Q A;  5LEK A;  5E3L A;  4BUP A;  1BIA A;  1BR1 A;  2QQ9 A;  4I0B A;  1IN6 A;  3GZ6 A;  3S3O A;  4OIO F;  2HOT A;  4OAY A;  1FBS A;  2MYS A;  1T33 A;  1SFU A;  5JHU A;  1I1S A;  4N4O B;  1V5F A;  3ZN1 A;  4H0E A;  1PDN C;  5K7F A;  3M1E A;  1MBG A;  3WOD F;  4RLQ A;  1Z7U A;  3Q0W A;  4BHP A;  2V6C A;  2KIM A;  3KZZ A;  3BR3 A;  2L0K A;  2FE3 A;  2DA1 A;  3R61 A;  2OTL I;  2NYX A;  1BC8 C;  1D5Y A;  2XGX A;  1JI8 A;  2RC4 A;  1PP8 F;  4AID A;  4GGG A;  3ZP5 A;  2HS5 A;  4RGS A;  4HSR A;  2DK8 A;  2EZH A;  2M2E A;  3JRI A;  3S2H J;  3CJN A;  5AON A;  2DA7 A;  1FTZ A;  5DTD A;  3ZOB A;  4PSX A;  2VOP A;  3DU6 A;  4RS8 A;  3V7S A;  1Z05 A;  3P9C A;  1HF0 A;  3LAP A;  3L1P A;  1R36 A;  4ITV A;  2X51 A;  1K79 A;  1FSH A;  3DXJ F;  1P6R A;  2KFD A;  3HOU J;  1R00 A;  3I56 I;  4CCO A;  1MD0 A;  5BOX A;  2R5Y B;  1HOM A;  4U7B A;  1HKT A;  2OZU A;  3O3K A;  3GFJ A;  4EJU A;  2MG4 A;  2V1U A;  1JTX A;  3DU5 A;  2RDP A;  3LST A;  5K5R A;  3FKJ A;  3CCR I;  1XCB A;  1YYV A;  2FNA A;  2Y9Y A;  3AAF A;  4PCQ A;  4E4H A;  2HXI A;  1TWH J;  3F6V A;  1S6L A;  2L7M P;  2VKD A;  3JRB A;  3K0L A;  1A35 A;  1ZTR A;  2VJI A;  2L3D A;  4L9T A;  2XSD C;  2DFI A;  1OCR H;  5HS7 A;  2P6T A;  3CCQ I;  2W85 A;  5ERI A;  4RB2 C;  1IUF A;  1V3F A;  5J1U A;  4EVI A;  3W2W A;  4I02 A;  1R6R A;  2QEX I;  3ZQC A;  3BDD A;  5FKM A;  4DNC A;  1NG6 A;  1TWF J;  4HF2 A;  2R5Y A;  3CDH A;  3OR2 C;  4OIN F;  2W25 A;  2MAB A;  1IO2 A;  4N0B A;  3HC7 A;  3OS2 A;  2CGP A;  1VQO I;  2Y9Z A;  4ZTJ A;  5F0F A;  1YW7 A;  2H27 A;  1ITY A;  3JRG A;  2BY0 A;  4U87 A;  3EUH A;  3I55 I;  5CVU A;  2DN0 A;  3ISP A;  2QVO A;  1WGX A;  2W00 A;  3KEO A;  4G9Y A;  4IHX A;  3K2Z A;  5HDN A;  1W0T A;  3GTL J;  2JTV A;  2CO5 A;  2NS7 A;  4F7Z A;  2L7F P;  1A31 A;  3G73 A;  3KX2 A;  3I59 A;  1J5Y A;  4Y17 A;  2ZCW A;  4E7S A;  2OD5 A;  3FXJ A;  1E17 A;  2B63 J;  1WRJ A;  5CKT A;  1QZY A;  5B5E C;  1UFM A;  4UY8 I;  3EYY A;  1SD7 A;  3W6V A;  1TWC J;  4UB8 C;  4A3B J;  3HUG A;  1MDM A;  3LSJ A;  4OAZ A;  1XCV A;  2M5W A;  3A02 A;  3HTS B;  1Y39 A;  1HCR A;  3D0S A;  4UB6 C;  1ZEL A;  2V1X A;  2EIM H;  2GA2 A;  2F5C A;  3VFZ A;  4A0Z A;  1T56 A;  4RM2 A;  4AC0 A;  3WTV C;  1B6A A;  3VPR A;  3GFI A;  4S0H B;  2OJE D;  2O61 A;  3HOT A;  4Y52 J;  4EJT A;  1P4A A;  1QZE A;  1K78 B;  3PFI A;  4EEF G;  3GTJ J;  5GTH C;  2W4S A;  4L9N A;  2AQF A;  3R60 A;  3VSK A;  3DLA A;  1CF7 B;  3H0D A;  4YII A;  4P96 A;  5BPD A;  1H88 C;  2VXZ A;  2CV1 A;  3MN2 A;  2R4G A;  2KIF A;  4HNT A;  5DV5 A;  4A3D J;  3T0Y A;  2P7V B;  1LEB A;  4O5V A;  2WY7 Q;  2CH0 A;  3KLN A;  1KU9 A;  1HW1 A;  1W7P D;  1MBE A;  2GZW A;  2UXN A;  2ZXH A;  5M5X J;  3S1R J;  3S15 J;  3CUQ B;  3GW2 A;  1S7O A;  3K70 D;  3DEU A;  3WGG A;  3HOZ J;  2V6E A;  2FSW A;  2HU9 A;  2M0C A;  4HV5 A;  3REO A;  5DCM A;  5DYM A;  2PMZ N;  3P9K A;  4V2G A;  1FYL A;  3BQZ A;  3MEX A;  3PM1 A;  1OYY A;  2ELJ A;  1RUO A;  3BPX A;  5L3G A;  4XOT A;  5E17 F;  2E1M C;  2LYC A;  4MFE A;  1U5T C;  1CF7 A;  4RGR A;  5FD6 A;  2LKX A;  1HKS A;  2K40 A;  3E97 A;  3RPU A;  2ACJ A;  1T39 A;  2PG4 A;  3TL4 X;  2QQB A;  1OCO H;  1P7J A;  3MMY B;  2W48 A;  1OKR A;  1JUP A;  2DK5 A;  3QOD A;  3FXM A;  2VQL A;  4JX5 A;  4U88 A;  4Y3O A;  5FKN A;  3OYH A;  1I39 A;  3F72 A;  1AKH B;  3FMQ A;  1R22 A;  3ZQG A;  4DIQ A;  5ILU A;  1R23 A;  2LSO A;  1Y1V J;  1E3O C;  1Z7L A;  5EEH A;  1J59 A;  5GP9 A;  1UEL B;  1XSX A;  4M6V A;  3IRQ A;  4RBO A;  3G1M A;  4KN4 X;  5CVJ A;  1R1V A;  2CW8 A;  4L5I A;  3CLQ A;  1FBU A;  2KQR A;  3OIQ A;  1W1W E;  2JPC A;  4EMS A;  2KMU A;  3GF2 A;  3I71 A;  4XSZ F;  2XGC A;  1X3Z B;  2L9V A;  1USS A;  1FPQ A;  3CCL I;  2XSJ C;  3K1P A;  2LNB A;  2EFQ A;  3PO2 J;  3L2V A;  3S14 J;  3R0A A;  4I09 A;  1TL8 A;  1BR4 A;  3QOP A;  2G7H A;  3HKZ N;  2STW A;  1ZR2 A;  4IJA A;  3FZV A;  4IVN A;  1A36 A;  3AL0 B;  1XGM A;  3LA2 A;  1POG A;  1KYZ A;  1ZKG A;  2O8X A;  2Q2E B;  3OOU A;  3PNV A;  5HOO A;  4GCV A;  1B9N A;  2V26 A;  1VI0 A;  1JHH A;  4V19 K;  1D8J A;  2V79 A;  4ETS A;  4AVP A;  3V8L A;  2EIK H;  4PJM A;  4U0V A;  4F91 B;  2JVG A;  2M3A A;  3HHH A;  4XLN F;  1WJE A;  4FTH A;  2O5R A;  3J7Y J;  2KP6 A;  5FRM A;  2PLY A;  5CJ9 A;  1F1Z A;  1RC9 A;  4WX9 A;  3M7G A;  1S9H A;  3ZQH A;  1MBJ A;  4BQO A;  3DEE A;  4UUS B;  1WFX A;  2Y31 A;  5KNL A;  4LG0 B;  2ZSH B;  3RI4 A;  2CSO A;  2EB7 A;  5FB2 A;  4BU2 A;  3E6C C;  1PUF A;  1BM9 A;  2KZG A;  4B47 A;  2R7S A;  2A6E F;  2EZI A;  2LRD A;  3BR0 A;  3E5X A;  4MQ9 F;  4UNO A;  3MKZ A;  3KP6 A;  2ID3 A;  1QVT A;  3CCY A;  3SQN A;  4Y13 A;  1YW9 A;  4E7Z A;  5HLG A;  2CW7 A;  1IJW C;  2DFF A;  2FQ4 A;  4XNF A;  1YIT I;  2FEZ A;  4FX0 A;  4XOP A;  3ABT A;  2QUF A;  1TQM A;  2V9P A;  5HVQ C;  4RDU A;  2IAI A;  1U3E M;  3FK7 A;  3HOS A;  2QQA A;  2V1N A;  3EQL F;  2PJR B;  3ABU A;  2P5K A;  3I53 A;  1L3L A;  1H89 C;  1APL C;  1ZR4 A;  1P2F A;  5LGU A;  4JQF A;  2EBI A;  5FGM A;  1MNE A;  4LG0 A;  3ZXS A;  1VQN I;  3OYM A;  3BLY A;  3HRT A;  1MMG A;  1FOY A;  3MWM A;  5EEA A;  3RKY A;  2XKO A;  3WTZ A;  2NVQ J;  4IRI A;  1FT9 A;  1W5T A;  1BOB A;  4G7Z F;  2DT6 A;  3BZ6 A;  1SFE A;  1H0M A;  1IXS B;  1BOA A;  3A4C A;  3DPL C;  4C3I J;  2OTJ I;  3T5X A;  3ZQ7 A;  4CDG A;  1IGN A;  1TNS A;  1W36 D;  3OYF A;  2VOO A;  4AWX B;  2YU3 A;  1X58 A;  2IA0 A;  4A5M A;  1SD6 A;  3EUH C;  2M0M A;  5KK1 A;  1WI9 A;  1VQ9 I;  2CW0 F;  4QSH A;  2HVQ A;  1AHD P;  2H6B A;  2H8R A;  3HG9 A;  3FX3 A;  4M3E A;  1I6H J;  4E6K G;  2PJR A;  2R93 J;  2XHK A;  2L9R A;  3KP2 A;  4ZDL A;  3P7N A;  4YEJ A;  4DQ2 A;  3BG7 A;  4YIR X;  4L0Y B;  2DW4 A;  2EPF A;  2KZV A;  4RMN A;  4LGW A;  3H0G J;  1YTY A;  4I6Z A;  3Q5F A;  2X9D A;  2C6Y A;  2HZD A;  4ENN A;  1MBK A;  1LFU P;  4IX7 A;  2VL8 A;  2LP0 A;  3PSF A;  3ZMV A;  4A6E A;  4UUV A;  4IHT A;  2NAZ A;  2YX4 A;  4FE4 A;  1FOX A;  4JYK A;  2K9S A;  1DUX C;  1GT0 C;  2HQN A;  3O8H A;  4MFD A;  3MZ8 A;  2RRE A;  1WQ2 A;  2K9M A;  1ZYR F;  2V7F A;  2HR3 A;  3BCA A;  4MNU A;  2M87 A;  2Y48 A;  4L9V A;  4FE7 A;  2O6G E;  1NH3 A;  1MMN A;  4M73 A;  1QPM A;  4PFP A;  4BBR J;  4A3C J;  2BW3 B;  1Z0X A;  2EV5 A;  2QWW A;  4HAM A;  5IT9 K;  1KQ0 A;  4EJV A;  4ZC3 A;  2XAS A;  2HI3 A;  2PEX A;  1OCP A;  1B8I A;  2FBH A;  1LJ9 A;  4ZJZ A;  4A3M J;  3OYD A;  1XX5 A;  4C30 A;  2D1H A;  4RAZ A;  3ECH A;  3KEY A;  4XKW A;  3DKX A;  4XR6 A;  5CVI A;  2FOK A;  2DA3 A;  4A3L J;  4I99 C;  4M6X A;  4IZZ A;  2R5Z B;  1KU7 A;  5HDK A;  4ZYA A;  2QGU A;  5JR3 A;  3HGY A;  1XMX A;  1DDN A;  4XLF A;  1IDY A;  1FZP B;  1WJ5 A;  2VXD A;  5LFA A;  3CCE I;  3EDP A;  5JVT A;  5BQT A;  4W97 A;  5EG0 B;  4RLF A;  2LR8 A;  4Y4R A;  2Q0O A;  5BS6 A;  3HM5 A;  5TIS C;  2D2W A;  2XVC A;  4QLC U;  2BW3 A;  1T6S A;  3ZMS A;  2DMU A;  3ZN0 A;  2NOG A;  1ZGJ A;  2CRG A;  1DPU A;  4G6D A;  1L0O C;  1IRX A;  5KVR A;  1F43 A;  1FEX A;  5CVR A;  2AS5 F;  2XGE A;  1S8N A;  4HZF A;  3DP7 A;  1X1C A;  1O4X A;  3F8C A;  2E5N A;  2AO9 A;  5K5Q A;  1ZHF A;  2BHZ A;  4N9I A;  4M72 A;  3CME I;  2ME0 A;  3OR1 C;  2ELH A;  3HKZ A;  4F55 A;  2YR2 A;  2W84 A;  4CUG A;  2CQQ A;  3OL3 A;  3R4K A;  2M9H A;  1GDT A;  5L3F A;  1PVE A;  1ZRD A;  3HDD A;  3G71 I;  2KHM A;  1YIO A;  5D5U B;  1ON2 A;  1OMI A;  4HG2 A;  4AYB A;  1W5S A;  1BC7 C;  2O3F A;  3M1C A;  2OBP A;  2Z2S B;  5EG0 A;  4C9Y A;  1EV7 A;  1F36 A;  3IP4 B;  4KN7 X;  3A01 B;  1SMY F;  3OYJ A;  4LK0 F;  1BI1 A;  3ABL H;  2WY8 Q;  2LMD A;  1D0Z A;  4A93 J;  1SFK A;  2OZ6 A;  4A2U A;  1J09 A;  4BQQ A;  1HDD C;  2DBB A;  1LNW A;  3CQZ J;  4HLX A;  3MZH A;  2DXI A;  2KRC A;  3KIO A;  4LD5 A;  3EYI A;  5EJC A;  3COA C;  5C3E J;  4A3G J;  1T0F A;  1T2K A;  1TWG J;  2KKO A;  4UVB A;  3PQJ A;  2ZXI A;  3SEZ A;  1GHC A;  1R5H A;  2VT3 A;  3CES A;  3LWF A;  3LSH A;  1LDJ A;  1ZGW A;  4PZJ A;  2CU7 A;  1LEA A;  2FQ3 A;  1ORK A;  2XF5 A;  3BWG A;  4I01 A;  2EFP A;  4E7L A;  4KIF A;  5A2Q Z;  3ABK H;  4BY7 J;  3A0H C;  3A01 A;  2IA2 A;  3KLO A;  3LQQ A;  1ZLJ A;  1YRN B;  2R7T A;  2PX9 A;  1Z67 A;  2LBF B;  2D45 A;  2DA4 A;  2E1M B;  3GFM A;  2FU4 A;  3E7L A;  1U5T B;  2WAD A;  4EV0 A;  4QTR A;  5IPA A;  2WC2 A;  5FKK A;  3HRM A;  4CCL A;  2NS0 A;  3DTK A;  4BGD A;  5FFZ A;  2HFH A;  1YW8 A;  3RQI A;  3WTS C;  4LIU A;  2IGO A;  2CQK A;  4RAF A;  4EM0 B;  5DS9 A;  4ZYG A;  3HJE A;  5B3S H;  1WJC A;  3BTJ A;  1YIJ I;  3KZI C;  4HST A;  1B9M A;  1HW5 A;  2EIL H;  5LRR A;  4XLA A;  1E0E A;  4MEX F;  2M1B A;  2XDV A;  5LHI A;  3BC8 A;  4DBQ A;  2P8T A;  2ZBK A;  2GOM A;  2A6T A;  1UST A;  3QU3 A;  1HQC A;  4ABZ A;  1GXQ A;  3C7J A;  1I50 J;  2P6S A;  4BBS J;  5F08 A;  4LG3 A;  3U21 A;  3K1N A;  2VJJ A;  4CCN A;  4Q48 A;  2VB6 A;  4EJW A;  1TP4 A;  3ML6 A;  5JVG F;  2AXL A;  2VC0 A;  4Q4Z F;  2X4H A;  3DV8 A;  4WCG A;  1ULY A;  1WH7 A;  3C1D A;  3ERM A;  5H20 A;  1VF9 A;  3M3Y J;  1IV8 A;  4CH7 A;  4W1U A;  2CMP A;  5LGT A;  1IV6 A;  2HQ5 A;  2QYO A;  3C3W A;  4HA8 A;  1V5E A;  4ZDO A;  1ZAR A;  4HEA 2;  3KEQ A;  2E71 A;  1ZK8 A;  1TQI A;  2BHY A;  2ESN A;  4PJL A;  1TZL A;  3H3Z A;  1JKO C;  2IGN A;  1X19 A;  2LF7 A;  3BR1 A;  4HX8 A;  2XAJ A;  3ZQI A;  4G8X A;  5FLV A;  4XLP F;  5HLI A;  2PQ8 A;  3K1M A;  1TW2 A;  2ESH A;  2GIZ A;  2F4M B;  1VQM I;  1KYW A;  3HSF A;  3LAJ A;  2ZO4 A;  1LE8 B;  3GX4 X;  1Z77 A;  2RNG A;  3ASN H;  2AHQ A;  2WTE A;  3E6M A;  1HSJ A;  5AIP A;  3H9Q A;  5BPI A;  4G7O F;  2HGC A;  2VKE A;  3Q0V A;  3D5S C;  3K70 C;  3IRR A;  1A6I A;  4OOI A;  2UWM A;  2K9L A;  3RPU D;  1DGW Y;  1V54 H;  4M6Y A;  3IKT A;  4LB5 A;  2UXX A;  3MQ0 A;  1TT5 B;  3KP3 A;  5JFR A;  1YE9 A;  2A6H F;  3DPT A;  3GLL A;  4IRH A;  3FM5 A;  2JVH A;  3CDI A;  4UV8 A;  2FUG 2;  3Q9S A;  3OOP A;  3CDL A;  1LDD A;  3HPG A;  3LSP A;  2P7C B;  3MAJ A;  2VPR A;  3TOB A;  1NG7 A;  5HS9 A;  3CCJ I;  2K4J A;  3QP6 A;  3ZMT A;  2Q1Z B;  4CCJ A;  1A6Q A;  2WAF A;  1JHF A;  4XLH A;  4CXF A;  1P7I A;  2NXN B;  3PUB A;  4MEY F;  1ZGA A;  2XPW A;  2FX0 A;  5CQE A;  4EQQ A;  4HQM A;  1G3W A;  1D0Y A;  1U8B A;  2ZKZ A;  1R49 A;  5L3B A;  2L2O A;  3V42 A;  1ETV A;  2LLK A;  3PSI A;  4I2O A;  3ZQQ A;  3EUK L;  2RAE A;  3GUD A;  5JLW A;  3IAS 2;  2ME6 A;  3J80 K;  2Q8K A;  5EF6 A;  1DU0 A;  5FRO A;  2KDZ A;  5TJJ A;  2K9N A;  4A3E J;  3KE2 A;  2QBY B;  1RR8 C;  1UMQ A;  3VYU B;  2EK5 A;  3CLO A;  3M9A A;  3SZT A;  3JRF A;  2QQ8 A;  3ZR8 X;  5E79 C;  2E1C A;  3AG1 H;  4IQJ A;  3WG7 H;  1JKR C;  2CUF A;  2QSF X;  4DGW B;  5J4Y A;  5D4R A;  2HOA A;  3OIP A;  5GPC A;  4M3B A;  1YS6 A;  4M71 A;  3GYH X;  3PO3 J;  5M5W J;  1ETX A;  3DFG A;  1U0J A;  4BQA A;  4Q47 A;  1WJD A;  2WV1 A;  2A3S A;  1FBQ A;  2MC3 A;  1EH8 A;  1C0W A;  1P4X A;  3DBR B;  5E3O A;  1QO0 D;  2PMH A;  3BJO A;  1Z91 A;  4HOB A;  2RNJ A;  4C2M J;  3LQR A;  4L9J A;  4ANJ A;  2K5C A;  1O7L A;  1MSE C;  1MJA A;  5HNH A;  5J47 A;  4BJT A;  1Z3X A;  1YG2 A;  1JKP C;  2ZNZ A;  2QBY A;  1IW7 F;  2E1O A;  4YRV A;  3KET A;  2JQ7 A;  3HOX J;  2JA8 J;  2ZME B;  2WB1 N;  2IS4 A;  1U9O A;  4ON0 A;  3VYS B;  4E7H A;  2VIX A;  3I4P A;  1SVM A;  1DGR M;  3RKQ A;  1ZQ3 P;  4ZDP A;  1O3S A;  3HSR A;  1JTY A;  3K10 A;  1RR7 A;  3WTY C;  2VUM J;  2DLL A;  3PIP F;  2ZB9 A;  3H5R A;  1HXD A;  1F5T A;  2K3F A;  1YX3 A;  1XPX A;  3GME A;  1IC8 A;  1Q1V A;  2M7B A;  3C2B A;  2BVL A;  5BNG A;  3ASO H;  4NC8 A;  3J7Z I;  3NRV A;  2XAH A;  1GLN A;  3LMM A;  2MW8 A;  2I5U A;  3TBI A;  4HLY A;  3MD2 A;  1YS7 A;  2GBY A;  3QPT A;  3MKL A;  3G6E I;  3HEF A;  4XLE A;  4CIC A;  3F3X A;  1D0X A;  1V4R A;  3WTX C;  1RKT A;  4BNC A;  2H94 A;  2LG4 A;  2M30 A;  3N05 A;  2ISY A;  1GVJ A;  3BZC A;  2ICW G;  1U9N A;  3L09 A;  2XIG A;  4GYI A;  1KU2 A;  1T0F C;  1VQ5 I;  3H3V K;  1N25 A;  1D1B A;  1TBX A;  2HTS A;  4XQF A;  2Y0S A;  3GO5 A;  4MTE A;  2GXB A;  1HA8 A;  2E19 A;  1BJZ A;  1OCC H;  1XDU A;  2R7Z J;  3A2K A;  1BA5 A;  1K4S A;  1MSF C;  4L5E A;  2TCT A;  3K4L A;  3OYN A;  2XRN A;  4YEL A;  3CJR B;  3QPL A;  2ZJR F;  3FXK A;  2O0Y A;  4N9H A;  1RKW A;  3BJA A;  3BTI A;  3C2G A;  5K1Y A;  2JT1 A;  2VC1 A;  3GWZ A;  1AOY A;  2JPB A;  4X1E A;  4ENK A;  2DQL A;  2FD5 A;  2GXG A;  2H09 A;  3SEQ A;  2HVR A;  2EV0 A;  4XRS A;  1W36 C;  4OMZ A;  3CMM A;  4FIS A;  1W0U A;  2VE8 A;  4XN3 A;  5JI6 A;  3WGI A;  2MGQ A;  5LLQ A;  2N8G A;  3IC7 A;  1YJN I;  1K78 A;  4BJ6 C;  2HDD A;  3RKW A;  2FXA A;  2BEO A;  2E35 A;  3NQO A;  3AFH A;  3LSG A;  3HGG A;  4RB3 C;  2Z5U A;  4OWR B;  1QHG A;  1REP C;  2FF4 A;  2GLO A;  3QRF F;  1OLT A;  4FQG A;  2R7X A;  3AG2 H;  3IWZ A;  1UHS A;  2E2J J;  3S16 J;  3C2H A;  1J2X A;  3M4O J;  2V9K A;  3FDY A;  1LVK A;  3FXQ A;  3OWT A;  3BOQ A;  4Z2Y A;  4PUS A;  2EA2 A;  1QBJ A;  3JAM Z;  1NHA A;  3CUQ A;  2K27 A;  1SEU A;  2QF7 A;  5DD8 A;  2L7Z A;  1OCZ H;  3DPU A;  2W57 A;  5J4V A;  2PJP A;  2J5O A;  1Y0U A;  4OIP F;  1R1T A;  3BY6 A;  4M3F A;  1XGS A;  4AIH A;  2F4I A;  5D8K B;  5DEQ A;  4A3I J;  2DMP A;  4U0W A;  4G6T B;  2GXA A;  3SDG A;  4BKX A;  3TQN A;  2MD0 A;  2HOS A;  2RVC A;  1WJF A;  5D8L B;  3S17 J;  1G3T A;  1JKQ C;  2G0E A;  3MKY B;  1IRZ A;  5LD2 C;  2LD5 A;  2R7F A;  3TDU C;  3JSO A;  4HW0 A;  3CC4 I;  2IS1 A;  1FMW A;  2E1N A;  3K2A A;  3ZCO A;  3FMR A;  5M3M J;  1SAU A;  3S1N J;  1G3S A;  2JMW A;  3VYT B;  3KYD B;  4B48 A;  1BR2 A;  1OR7 A;  2HKO A;  5B1A H;  3FXO A;  1ZG5 A;  2BY1 A;  4ESJ A;  2KPM A;  2HNH A;  1MGT A;  2EFO A;  3ECO A;  4XMY A;  3V8J A;  6PAX A;  1AKH A;  1OYI A;  3NWS A;  1STZ A;  4KIG A;  1X2N A;  1ZG1 A;  1RRJ A;  1DP7 P;  1B1B A;  2E5Z A;  3BTC A;  3I4M J;  2ELK A;  3Q0U A;  5KAI C;  4II2 A;  1H9G A;  2Z3Y A;  2MSY A;  3W2A A;  5ILS A;  1VZ0 A;  5IT3 A;  4KA4 A;  4X6A J;  2QA4 I;  3UR3 C;  4HYE A;  4UUT A;  3D5R C;  4M3G A;  1RNL A;  1O3R A;  2MFZ A;  2OU2 A;  1ON1 A;  2B7E A;  2DMQ A;  2G7U A;  1PUE E;  1IRF A;  3CF5 F;  1Z1D A;  2FJ1 A;  4DJA A;  3JAM K;  2ZXW H;  2M4K A;  2W1O A;  5FRN A;  2QKL B;  5HNF A;  4KFC A;  3W6K B;  4BEH B;  3JRD A;  4PJN A;  1ZN2 A;  3WE2 A;  2EZK A;  1QGP A;  2EA4 A;  4G94 A;  2NVU B;  3GTK J;  4U7D A;  2ADU A;  5ILV A;  2Q2E A;  2RN7 A;  2VBY A;  1FOW A;  2H6C A;  2PBI A;  3GVA A;  1A04 A;  5C4J J;  1I3Q J;  4MIM A;  2BXZ A;  1H8A C;  1IDZ A;  4XID A;  3BT9 A;  1S5L C;  1IXC A;  2BZT A;  2CV0 A;  3CCU I;  1RI7 A;  4A3F J;  2E7X A;  2DA5 A;  3QPH A;  2XRO A;  2FML A;  3S1M J;  4WK8 F;  4UUS A;  2D1V A;  2F48 A;  3FHZ A;  4A3K J;  3R6S A;  1FY7 A;  1R4M B;  2YS9 A;  3LSM A;  4BEH A;  3HTU A;  3BG6 A;  4IHS A;  5IT9 Z;  3TOA A;  3JW4 A;  2IEK A;  3ELK A;  3J7A Y;  2LDU A;  5ED4 A;  4UHT A;  2DYS H;  1QVU A;  2BYV E;  1TW3 A;  3RYP A;  2ZJP F;  1JT0 A;  2O8K A;  4UVC A;  1O57 A;  2I10 A;  2LRE A;  2XV4 S;  2ZFU A;  1ZG3 A;  2JSC A;  1IZ1 A;  5E8G A;  2CQN A;  2CFX A;  4GXO A;  5F27 A;  4KIB A;  2CQX A;  3LA3 A;  1OCT C;  1XB4 A;  3TKY A;  2H1K A;  4NQW B;  3G1O A;  2F4O B;  1X1B A;  5L3C A;  4O6J A;  4JBA A;  4PJJ A;  4IL6 C;  3AG3 H;  3L2U A;  4A3J J;  3E5U A;  5FKO A;  5E1Z B;  1SD5 A;  3ZGK A;  4ZZD A;  1Z9C A;  3K6G A;  3QPS A;  4HF1 A;  1WPK A;  2DPU A;  1R7J A;  4RAG A;  1ZLK A;  3TP3 A;  4I0A A;  1EH7 A;  3QAH A;  3OSF A;  4PGG A;  2KL4 A;  3G2B A;  2LY2 A;  2WAQ N;  3TGN A;  3DBH B;  2VJ5 A;  1V55 H;  4E7K A;  1YJW I;  4M74 A;  2K86 A;  4S05 A;  2JRT A;  4P9F A;  4XRF A;  1ETK A;  4NUB A;  1X2M A;  3H9J A;  5GAE J;  2JWT A;  1WZ2 A;  2BE5 F;  2PMZ A;  3BCB A;  3FWE A;  1VQP I;  3F22 A;  2XKP A;  4MO7 A;  2ID6 A;  4P1W A;  1MH4 A;  3M8F A;  4NQW A;  3FF5 A;  2JUG A;  2E60 A;  3VSL A;  4D0P A;  5F1J A;  4OU0 A;  1I3A A;  2NNN A;  2VT2 A;  5K7Z A;  3FMS A;  2DTR A;  2LOO A;  1SMT A;  4IOA F;  2ZXJ A;  4Y33 A;  5E1W A;  4PJ0 C;  5B66 C;  2EIN H;  4IOC F;  3JRA A;  1SAX A;  2YX7 A;  3HRS A;  4XIC A;  1KU3 A;  2L9N A;  3ERE D;  4S04 A;  2FBK A;  4V2F A;  1J75 A;  2CFO A;  1GVD A;  4BQN A;  4P9U A;  1G6N A;  1YHQ I;  4QPO A;  4B43 A;  3F23 A;  2JA6 J;  4HRI A;  5J6X A;  4AU7 A;  4B3X A;  2IVM A;  1X4O A;  3BR5 A;  2L02 A;  1VFC A;  3TW6 A;  2DI3 A;  1TWA J;  1HST A;  5GAH J;  2DAO A;  3CTA A;  5E18 F;  5H2F C;  1BL0 A;  5HDG A;  2R7V A;  3NAR A;  3F8N A;  2EIJ H;  2P5L C;  1CQT A;  3GXO A;  2IS6 A;  2IBD A;  1K6Y A;  2DA6 A;  5FD5 A;  3B02 A;  3TP0 A;  3L7W A;  1VQ7 I;  3A03 A;  1MND A;  4D5F A;  4XKC A;  3CCM I;  4LJZ F; 
#chains in the Genus database with same CATH homology
 5BMZ A;  1R58 A;  3F21 A;  3F8M A;  1S3J A;  4A0X A;  2LF8 A;  3GLX A;  3CUQ C;  2WV0 A;  2VBZ A;  3D5L A;  3E5Q A;  2Z99 A;  4UXN A;  1U2W A;  3WTT C;  4GYG A;  2K4B A;  1R1U A;  4EM2 A;  2GAU A;  3SXY A;  1AWC A;  4XBF A;  2HEO A;  2VN2 A;  3KP7 A;  3N97 A;  2FA5 A;  4IF4 A;  3QP5 A;  4E70 A;  4L0Z B;  1SFX A;  2HTJ A;  2KIU A;  3TO7 A;  2A5Y B;  4CO8 A;  4BH9 A;  3U2R A;  4CHU A;  4BHB A;  2RQP A;  2O03 A;  2KJC A;  2QZ8 A;  3WGH A;  1QNT A;  4OIR F;  1J7K A;  3TDZ C;  1RZ4 A;  4WWC A;  3RKX A;  2NRA C;  1BJA A;  4KUM A;  4AD9 A;  5EEG A;  2QEN A;  1FNN A;  3TO6 A;  4ESB A;  1IRG A;  3MZY A;  3WE3 A;  2JZY A;  1CGP A;  3HRU A;  5AIQ A;  4TV7 A;  1UHW A;  3B73 A;  4KDP A;  4MQV A;  2VBW A;  1HBX G;  1D5V A;  4ENM A;  1FLI A;  2Y75 A;  5J8F A;  1KGS A;  1U6G A;  1U5T A;  1FX7 A;  3ULQ B;  1K7A A;  4YFK F;  5ICF A;  2A61 A;  4M9S A;  2IJL A;  4MHG A;  3EET A;  4R1H A;  3V7R A;  3O2P E;  4FHT A;  1I6X A;  1PP7 U;  1R5G A;  3KP4 A;  5D5V B;  3IHU A;  3J80 Z;  1ZRC A;  4P55 A;  1VTN C;  2UZK A;  2Y0M A;  1IN4 A;  1BN5 A;  2MD5 A;  4ZYD A;  2L01 A;  4ZZL A;  4ZH4 F;  2F5D A;  1F9N A;  1X3U A;  2TDX A;  4LFU A;  4BHC A;  1IN7 A;  3L00 A;  3FXR A;  2IPQ X;  5ICG A;  1TLH B;  2QLZ A;  3ROU A;  1K6O A;  2GQQ A;  2DT5 A;  4A0Y A;  1T38 A;  2ISZ A;  3ZMZ A;  1XMA A;  4LB6 B;  1P92 A;  4WXC A;  2HYF A;  3Q9V A;  4JK1 X;  5ICE A;  2A07 F;  1I5Z A;  1J0R A;  3I0T A;  3DQV C;  3MCZ A;  1ODD A;  1LDK B;  1BIB A;  3K69 A;  3V8K A;  3NEU A;  3J81 K;  4YFX F;  3SFZ A;  3KCC A;  3F6O A;  3MFK A;  1W4M A;  2COM A;  2KRF A;  4BAY A;  4RGU A;  2ETH A;  1H9T A;  2J5P A;  4AIK A;  4KIC A;  4WXD A;  3LFK A;  2P5V A;  1ZAO A;  3I59 B;  1BBY A;  1BI2 A;  3FM3 A;  1OPC A;  2P4W A;  3WTW C;  3M8E A;  1KQ9 A;  4ZYE A;  2B0L A;  1IAW A;  3U9G A;  1MJ9 A;  3BJ6 A;  3BP8 A;  1MDM B;  5H6R A;  3HHG A;  4U0Y A;  3RIR A;  1XSD A;  1U78 A;  2OQG A;  1TTY A;  1DPR A;  5D6F A;  2M8E A;  3BRO A;  2XAQ A;  1YO5 C;  3O6B B;  2F2E A;  2GIV A;  3FXU A;  1S7A A;  5HS8 A;  4KMF A;  1WWX A;  4A5N A;  4RAY A;  4WF2 A;  2K7L A;  3R0J A;  5CVV A;  2ZME A;  4IPA A;  2A69 F;  2Z9O A;  4G7H F;  3JTH A;  2GWR A;  3BPV A;  2ZJ2 A;  1JXS A;  1XMK A;  1EH6 A;  2BV6 A;  2F5E A;  2X0L A;  2WWY A;  3ZMU A;  1LB2 A;  2FNP A;  3K9T A;  1IN5 A;  4Q5S F;  5DCM B;  3RTR A;  2FRH A;  5K5O A;  4A6D A;  1RIO H;  4IRG A;  1BI3 A;  1I27 A;  4HBL A;  1XSV A;  5DDG A;  3L2C A;  4HDU A;  2K02 A;  2MA3 A;  4ESF A;  1FOK A;  3ZPL A;  2HDC A;  4B8X A;  2MBF A;  3T1B A;  5E8I A;  2RV8 A;  4ZYH A;  5CLS A;  3VOD A;  3WG9 A;  2HQR A;  3QU6 A;  2QM3 A;  2PN6 A;  3RJP A;  1IUY A;  2VON A;  1TQP A;  2PFB A;  1JE8 A;  3JSP A;  3I54 A;  3T8T A;  1LQ1 A;  5LRS A;  2NNY A;  3GEZ A;  4HDV A;  4FT8 A;  1D8K A;  1UCR A;  2MH2 A;  1LVA A;  2MLK A;  4XSX F;  1QQI A;  4Y15 A;  3H92 A;  1HKQ A;  4OIQ F;  1I1G A;  4UV9 A;  3RYR A;  4I7H A;  2DO7 A;  2L54 A;  1BI0 A;  3VB2 A;  4IXA A;  2RGV A;  3ZMD A;  2EFW A;  3WU1 B;  1O3T A;  2VBX A;  4EGY A;  5L3E A;  2V1D A;  2CYY A;  1QZZ A;  2VOD A;  4M9X A;  4P5O A;  1FSE A;  1MKM A;  3N4M A;  3E3V A;  2DPD A;  1XD7 A;  2PMU A;  4MTD A;  4ENJ A;  4HQE A;  4AIJ A;  5LBQ A;  3V7C A;  5DCF A;  3DKW A;  1J9I A;  4L5J A;  4RB1 A;  2CWE A;  1ZH5 A;  2EWN A;  3J7A O;  5LGN A;  3JTG A;  2W24 A;  5FFX A;  2STT A;  3C18 A;  3RDI A;  4I98 B;  1WSU A;  5CYV A;  3I64 A;  3U1D A;  3RPQ A;  1WKM A;  2XUB A;  1Q1H A;  2OA4 A;  3L9F A;  4LLN A;  1S29 A;  4LK1 F;  4KNY A;  4GO1 A;  1KQ8 A;  2E7W A;  3F8B A;  2VE9 A;  2IW5 A;  4KYW A;  1UB9 A;  2HOE A;  2F5F A;  2M45 A;  3WU0 A;  2OAZ A;  1B4A A;  2KJB A;  1W7P B;  5D4S A;  4B09 A;  2BBY A;  5F6F A;  3OV8 A;  2IRF G;  1P4W A;  3GZ5 A;  3GFL A;  1MJB A;  2HZT A;  1E2X A;  4LMY A;  1XDS A;  2DU9 A;  5F1R A;  2HKX A;  1F4K A;  4HX7 A;  2EV6 A;  4CZZ A;  1IF1 A;  3KZY A;  1W7P A;  4CGZ A;  2BGC A;  5LHH A;  2YSR A;  1KA8 A;  4L18 B;  1XN7 A;  2ZNY A;  1JGS A;  5F64 A;  3VEP A;  5FLX Z;  2HYG D;  1Z6T A;  3KP5 A;  4NB5 A;  1FWZ A;  5D6E A;  3I58 A;  1IN8 A;  4LLG F;  1SD4 A;  1MZB A;  4FX4 A;  4MGR A;  3T8R A;  4WXH A;  1ONV A;  4NHJ A;  5E20 A;  3I5U A;  3S2W A;  1TNT A;  1FC3 A;  2ZFW A;  2A68 F;  4BYY A;  4R79 A;  1T98 A;  1RUN A;  2L4A A;  1B59 A;  2G9W A;  2HWV A;  2GA1 A;  3HSE A;  4A12 A;  1XGO A;  2R3S A;  3G3Z A;  5HLH A;  5LEJ A;  2IT0 A;  4K2E A;  5L3D A;  4OMY A;  3CUO A;  4HX4 A;  4HF0 A;  3CO6 C;  4HV6 A;  2IA1 A;  1GXP A;  2LKP A;  3F8F A;  4PDK A;  1YLF A;  5FLX K;  3KFW X;  3TO9 A;  4QWQ A;  3WTU C;  2OQR A;  4EM1 A;  4RB0 A;  2Z33 A;  2XAG A;  2R7D A;  5ICC A;  5DUI A;  3VOE A;  1O3Q A;  3SZP A;  4KT5 C;  2MH9 A;  5D5X B;  4O3M A;  3SHF A;  2FMY A;  4BXU A;  4UVA A;  1HW2 A;  1OYW A;  3P9I A;  1ZRF A;  5DUK A;  2EJR A;  2V9V A;  4M9Z A;  3HYI A;  5TRD A;  1ZRE A;  5FO5 A;  5D5W B;  3CO7 C;  5J8C A;  3IL2 A;  4G6Q A;  3IWF A;  4LLL A;  2IP2 A;  3HIF A;  2DQR A;  1FYM A;  2FBI A;  2L4M A;  3H3U A;  2PI0 A;  3V4G A;  1FP2 A;  4EGZ A;  3DF8 A;  1YFH A;  3E6B A;  5DD4 A;  1UHM A;  4YFN F;  3E6D A;  3LA7 A;  1G3Y A;  2CG4 A;  4R8H A;  5LHG A;  1G4D A;  2EFN A;  1XGN A;  3IKV A;  4RGX A;  1O7F A;  1FP1 D;  4KMU X;  4PGH A;  4YG2 F;  4CYD A;  2YPR A;  4EJO A;  2RKH A;  1U8R A;  1YQA A;  5E1X A;  1D3Y A;  4YIF A;  4ASN A;  1Z6R A;  2XAF A;  1IXR C;  5H6Q A;  3PQK A;  5A2Q K;  1FYK A;  2MLG A;  3J81 Z;  3W6J B;  5LEK A;  1BIA A;  3GZ6 A;  2QQ9 A;  4I0B A;  1IN6 A;  4OIO F;  1FBS A;  1SFU A;  5JHU A;  1I1S A;  1PDN C;  3ZN1 A;  4H0E A;  3M1E A;  3WOD F;  1Z7U A;  4BHP A;  2V6C A;  2KIM A;  3KZZ A;  2FE3 A;  3R61 A;  2NYX A;  1BC8 C;  2XGX A;  2RC4 A;  1PP8 F;  4GGG A;  3ZP5 A;  2HS5 A;  4RGS A;  2DK8 A;  3CJN A;  5AON A;  2VOP A;  4RS8 A;  3V7S A;  1Z05 A;  3P9C A;  3LAP A;  1R36 A;  1K79 A;  1FSH A;  3DXJ F;  1P6R A;  1R00 A;  1MD0 A;  5BOX A;  4U7B A;  1HKT A;  2OZU A;  3O3K A;  3GFJ A;  4EJU A;  2V1U A;  2RDP A;  3LST A;  5K5R A;  1XCB A;  1YYV A;  2FNA A;  3AAF A;  4PCQ A;  3F6V A;  1S6L A;  3K0L A;  2L3D A;  4L9T A;  2DFI A;  5HS7 A;  2P6T A;  2W85 A;  5ERI A;  4RB2 C;  1V3F A;  4EVI A;  4I02 A;  3BDD A;  4DNC A;  4HF2 A;  3CDH A;  4OIN F;  2W25 A;  4N0B A;  2CGP A;  1YW7 A;  2H27 A;  3EUH A;  5CVU A;  3ISP A;  2QVO A;  3KEO A;  4G9Y A;  3K2Z A;  5HDN A;  2JTV A;  2CO5 A;  4F7Z A;  3G73 A;  3I59 A;  1J5Y A;  4Y17 A;  2ZCW A;  1E17 A;  2OD5 A;  1WRJ A;  1QZY A;  1UFM A;  3EYY A;  1SD7 A;  3HUG A;  1MDM A;  1XCV A;  2M5W A;  3HTS B;  3D0S A;  2V1X A;  2GA2 A;  2F5C A;  3VFZ A;  4A0Z A;  3WTV C;  1B6A A;  3GFI A;  2O61 A;  3HOT A;  4EJT A;  1P4A A;  1K78 B;  3PFI A;  4L9N A;  3R60 A;  1CF7 B;  4YII A;  4P96 A;  5BPD A;  2VXZ A;  2KIF A;  5DV5 A;  3T0Y A;  2P7V B;  1LEB A;  4O5V A;  3KLN A;  1KU9 A;  1HW1 A;  1W7P D;  2GZW A;  2UXN A;  3CUQ B;  3GW2 A;  1S7O A;  3DEU A;  3WGG A;  2FSW A;  4HV5 A;  3REO A;  5DCM A;  5DYM A;  3P9K A;  1FYL A;  3MEX A;  1OYY A;  1RUO A;  3BPX A;  5L3G A;  5E17 F;  1U5T C;  1CF7 A;  4RGR A;  5FD6 A;  1HKS A;  3E97 A;  3RPU A;  2ACJ A;  1T39 A;  2PG4 A;  2QQB A;  1OKR A;  2DK5 A;  4U88 A;  3F72 A;  3FMQ A;  1R22 A;  5ILU A;  1R23 A;  2LSO A;  5EEH A;  1J59 A;  1XSX A;  3IRQ A;  4KN4 X;  5CVJ A;  1R1V A;  4L5I A;  1FBU A;  2JPC A;  4EMS A;  3GF2 A;  3I71 A;  4XSZ F;  1USS A;  1FPQ A;  3K1P A;  2LNB A;  2EFQ A;  3R0A A;  4I09 A;  3QOP A;  2G7H A;  2STW A;  4IJA A;  3FZV A;  4IVN A;  1XGM A;  3LA2 A;  1KYZ A;  2O8X A;  5HOO A;  4GCV A;  1B9N A;  1D8J A;  1JHH A;  2V79 A;  4ETS A;  4AVP A;  3V8L A;  4U0V A;  3HHH A;  4XLN F;  2PLY A;  5CJ9 A;  1F1Z A;  4WX9 A;  3M7G A;  4LG0 B;  3RI4 A;  2CSO A;  2EB7 A;  5FB2 A;  3E6C C;  1BM9 A;  2A6E F;  3E5X A;  4MQ9 F;  4UNO A;  3KP6 A;  3SQN A;  4Y13 A;  1YW9 A;  5HLG A;  2FEZ A;  4FX0 A;  5HVQ C;  3ABT A;  2QUF A;  1TQM A;  1U3E M;  3HOS A;  2QQA A;  3EQL F;  3ABU A;  2P5K A;  3I53 A;  1L3L A;  1P2F A;  5LGU A;  4JQF A;  5FGM A;  4LG0 A;  3HRT A;  3MWM A;  3RKY A;  2XKO A;  3WTZ A;  4IRI A;  1FT9 A;  1W5T A;  4G7Z F;  3BZ6 A;  1SFE A;  1H0M A;  1IXS B;  1BOA A;  3DPL C;  3T5X A;  3ZQ7 A;  4CDG A;  1TNS A;  2VOO A;  4AWX B;  2YU3 A;  2IA0 A;  4A5M A;  1SD6 A;  5KK1 A;  1WI9 A;  2CW0 F;  2H6B A;  3FX3 A;  2XHK A;  3KP2 A;  3P7N A;  4DQ2 A;  4L0Y B;  2DW4 A;  1YTY A;  4LGW A;  3Q5F A;  2C6Y A;  4ENN A;  3ZMV A;  4A6E A;  4UUV A;  4IHT A;  2NAZ A;  2YX4 A;  1DUX C;  2HQN A;  1WQ2 A;  1ZYR F;  2HR3 A;  4MNU A;  2M87 A;  2Y48 A;  4L9V A;  2O6G E;  4M73 A;  1QPM A;  2EV5 A;  2QWW A;  4HAM A;  5IT9 K;  1KQ0 A;  4EJV A;  2XAS A;  2PEX A;  2FBH A;  1LJ9 A;  2D1H A;  4RAZ A;  3ECH A;  5CVI A;  2FOK A;  4M6X A;  1KU7 A;  5HDK A;  5JR3 A;  1DDN A;  1FZP B;  3EDP A;  5JVT A;  5BQT A;  2Q0O A;  5BS6 A;  2D2W A;  2XVC A;  4QLC U;  1T6S A;  3ZMS A;  3ZN0 A;  1ZGJ A;  1DPU A;  4G6D A;  1L0O C;  5KVR A;  5CVR A;  2AS5 F;  1S8N A;  4HZF A;  3DP7 A;  3F8C A;  5K5Q A;  1ZHF A;  4N9I A;  4M72 A;  2ELH A;  2YR2 A;  2W84 A;  3R4K A;  5L3F A;  1ZRD A;  1YIO A;  5D5U B;  1ON2 A;  1OMI A;  1W5S A;  1BC7 C;  2O3F A;  2OBP A;  1EV7 A;  4KN7 X;  1SMY F;  4LK0 F;  1BI1 A;  2OZ6 A;  4A2U A;  2DBB A;  1LNW A;  4HLX A;  3MZH A;  4LD5 A;  3EYI A;  3COA C;  1T0F A;  1T2K A;  2KKO A;  4UVB A;  3PQJ A;  1GHC A;  1R5H A;  2VT3 A;  3LWF A;  1LDJ A;  4PZJ A;  1LEA A;  2FQ3 A;  3BWG A;  4I01 A;  2EFP A;  4KIF A;  5A2Q Z;  2IA2 A;  3KLO A;  3LQQ A;  1ZLJ A;  2D45 A;  3GFM A;  2FU4 A;  1U5T B;  4EV0 A;  2WC2 A;  3HRM A;  2NS0 A;  5FFZ A;  2HFH A;  1YW8 A;  3WTS C;  2CQK A;  4EM0 B;  4ZYG A;  1HW5 A;  1B9M A;  5LRR A;  4MEX F;  2M1B A;  5LHI A;  2P8T A;  2ZBK A;  1UST A;  3QU3 A;  1HQC A;  1GXQ A;  3C7J A;  2P6S A;  3K1N A;  4Q48 A;  4EJW A;  3ML6 A;  2AXL A;  2VC0 A;  4Q4Z F;  2X4H A;  3DV8 A;  4WCG A;  1ULY A;  3C1D A;  5H20 A;  5LGT A;  2QYO A;  3C3W A;  4HA8 A;  1ZAR A;  3KEQ A;  1TQI A;  2ESN A;  3H3Z A;  2LF7 A;  4HX8 A;  2XAJ A;  4G8X A;  4XLP F;  5HLI A;  2PQ8 A;  3K1M A;  1TW2 A;  2ESH A;  3HSF A;  1KYW A;  3LAJ A;  2ZO4 A;  3GX4 X;  3E6M A;  2WTE A;  5AIP A;  1HSJ A;  5BPI A;  4G7O F;  2HGC A;  3IRR A;  4OOI A;  2UWM A;  4M6Y A;  3IKT A;  4LB5 A;  2UXX A;  3MQ0 A;  3KP3 A;  5JFR A;  4IRH A;  2A6H F;  3DPT A;  3FM5 A;  4UV8 A;  3Q9S A;  3OOP A;  1LDD A;  2P7C B;  3MAJ A;  3TOB A;  5HS9 A;  2K4J A;  3QP6 A;  3ZMT A;  1JHF A;  4CXF A;  4MEY F;  1ZGA A;  4EQQ A;  4HQM A;  1G3W A;  2ZKZ A;  5L3B A;  4I2O A;  3GUD A;  3J80 K;  2Q8K A;  5TJJ A;  3KE2 A;  2QBY B;  2EK5 A;  3CLO A;  3M9A A;  3SZT A;  2E1C A;  5D4R A;  1YS6 A;  4M71 A;  3GYH X;  3DFG A;  4BQA A;  4Q47 A;  2A3S A;  1FBQ A;  2MC3 A;  1EH8 A;  1C0W A;  1P4X A;  1QO0 D;  2PMH A;  3BJO A;  1Z91 A;  4HOB A;  2RNJ A;  3LQR A;  4L9J A;  1O7L A;  1MJA A;  1YG2 A;  2ZNZ A;  2QBY A;  1IW7 F;  3KET A;  2ZME B;  4ON0 A;  3I4P A;  1O3S A;  3HSR A;  3WTY C;  2DLL A;  1HXD A;  1F5T A;  3NRV A;  2XAH A;  4HLY A;  1YS7 A;  3QPT A;  4CIC A;  3F3X A;  1V4R A;  3WTX C;  4BNC A;  2H94 A;  2M30 A;  2ISY A;  1GVJ A;  3L09 A;  2XIG A;  4GYI A;  1KU2 A;  1TBX A;  2HTS A;  3GO5 A;  4MTE A;  2GXB A;  1XDU A;  2XRN A;  2O0Y A;  4N9H A;  3BJA A;  5K1Y A;  2JT1 A;  2VC1 A;  3GWZ A;  1AOY A;  2JPB A;  4ENK A;  2DQL A;  2H09 A;  2GXG A;  2EV0 A;  4OMZ A;  2VE8 A;  5JI6 A;  3WGI A;  5LLQ A;  3IC7 A;  1K78 A;  3RKW A;  2FXA A;  2BEO A;  3NQO A;  4RB3 C;  2Z5U A;  1REP C;  2FF4 A;  3QRF F;  3IWZ A;  1J2X A;  3FXQ A;  3BOQ A;  4Z2Y A;  2EA2 A;  1QBJ A;  3JAM Z;  1NHA A;  3CUQ A;  2K27 A;  5DD8 A;  2PJP A;  2W57 A;  2J5O A;  1Y0U A;  4OIP F;  1R1T A;  3BY6 A;  1XGS A;  4AIH A;  5D8K B;  5DEQ A;  4U0W A;  3TQN A;  2RVC A;  5D8L B;  1G3T A;  2R7F A;  3TDU C;  3JSO A;  4HW0 A;  2E1N A;  3FMR A;  1G3S A;  1OR7 A;  2HKO A;  1ZG5 A;  4ESJ A;  1MGT A;  2EFO A;  3ECO A;  3V8J A;  6PAX A;  1OYI A;  1STZ A;  4KIG A;  1ZG1 A;  1DP7 P;  1B1B A;  1H9G A;  2Z3Y A;  5ILS A;  4KA4 A;  5IT3 A;  4HYE A;  1O3R A;  1RNL A;  2OU2 A;  1ON1 A;  2G7U A;  1PUE E;  1IRF A;  1Z1D A;  3JAM K;  4KFC A;  3W6K B;  1ZN2 A;  3WE2 A;  1QGP A;  2EA4 A;  4G94 A;  4U7D A;  2ADU A;  5ILV A;  2Q2E A;  2RN7 A;  2VBY A;  2H6C A;  3GVA A;  2PBI A;  1A04 A;  1IXC A;  1RI7 A;  2E7X A;  3QPH A;  2XRO A;  2FML A;  4WK8 F;  2D1V A;  3FHZ A;  3R6S A;  1FY7 A;  3HTU A;  4IHS A;  5IT9 Z;  3TOA A;  3JW4 A;  3ELK A;  2LDU A;  5ED4 A;  4UHT A;  2BYV E;  1TW3 A;  3RYP A;  4UVC A;  1O57 A;  2XV4 S;  1ZG3 A;  2JSC A;  1IZ1 A;  5E8G A;  2CFX A;  4GXO A;  4KIB A;  3LA3 A;  1XB4 A;  3TKY A;  5L3C A;  4O6J A;  4JBA A;  3E5U A;  5E1Z B;  1SD5 A;  4ZZD A;  1Z9C A;  4HF1 A;  2DPU A;  1R7J A;  1ZLK A;  4I0A A;  1EH7 A;  3QAH A;  4PGG A;  3TGN A;  4M74 A;  4S05 A;  2K86 A;  2JRT A;  4P9F A;  4XRF A;  2BE5 F;  3FWE A;  3F22 A;  2XKP A;  3M8F A;  4NQW A;  3FF5 A;  4D0P A;  4OU0 A;  2NNN A;  2VT2 A;  3FMS A;  2DTR A;  1SMT A;  2ZXJ A;  5E1W A;  1SAX A;  2YX7 A;  3HRS A;  1KU3 A;  3ERE D;  4S04 A;  2FBK A;  1J75 A;  4P9U A;  1G6N A;  3F23 A;  5J6X A;  2IVM A;  2L02 A;  2DI3 A;  1HST A;  2DAO A;  3CTA A;  5E18 F;  5HDG A;  3F8N A;  2P5L C;  3GXO A;  5FD5 A;  3B02 A;  3L7W A;  4LJZ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...