5EF6A

Structure of hoxb13 complex with methylated dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
61
structure length
61
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Hox-B13
publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 61
sequence length 61
chains with identical sequence B, G, J
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ef6A00
2L9RA 1JUPA 3GTPJ 5E3OA 4A3BJ 1WCMJ 2HOTA 2CUFA 3BG3A 2K9SA 1JJ8C 2O9LA 3S2DJ 4I76A 1JT6A 2LR8A 3WHCA 2Y9ZA 4XRMA 2CQXA 1GV2A 1BW5A 2FD5A 3S1NJ 5K7HA 1G2HA 2M34A 1WPKA 4UUSA 1TWAJ 3TW7A 4D5CA 1YRNA 4JYKA 1IUFA 3LNQA 2JA7J 1MH4A 2TCTA 2MW8A 3IH3A 3WHBA 3JRDA 4UUSB 4XIDA 2X48A 3GTOJ 1YRNB 3QPSA 5JLXA 1TWCJ 3ZOBA 2M9HA 3TW6A 1JKOC 3FK6A 1ETYA 2HXOA 1HOMA 4DYQA 2DTZA 2XB0X 4JX4A 2EBIA 2VKVA 3FK7A 2DJNA 3IH2A 3GTLJ 1MH3A 3B6CA 1FEXA 3QPLA 3S15J 2CRGA 2ZB9A 4RBOA 2NVXJ 2DA2A 5FKMA 1T33A 3TEDA 3ZQIA 3TP0A 1RR7A 2R5YB 3MN2A 1P7IA 1A5JA 3IV5A 1IG7A 5F0FA 4XRSA 5GPCA 1WI3A 2ELKA 4B4CA 4V2FA 3RKQA 1POGA 1VFCA 2DA6A 4G12A 5EF6A 2DA1A 3CDLA 1FIPA 3UKGA 4LOCA 1MBGA 4FISA 1RKTA 2HOAA 1FTTA 1R9TJ 2JN6A 2VPRA 1JKPC 2NVTJ 2ME0A 5JLWA 3LOCA 1CQTA 4B1RA 2W48A 2GM4A 2FJ1A 2NOGA 2Y31A 1H8AC 2LFBA 2M8GX 9ANTA 1ZR4A 1MSEC 2L7MP 1MBFA 5IYDJ 2FQ4A 2LTPA 3LSJA 3OOUA 3MVPA 1BJZA 3CCYA 2TRTA 3FKIJ 5EZHA 2ECBA 4X6AJ 3FIWA 2K9QA 3S17J 1UG2A 3B6AA 1EF4A 2JA8J 3MKLA 2K40A 2CJJA 3HM5A 2G0EA 5FKKA 5EG0B 1AKHA 2R92J 1JT0A 3HOXJ 2DA5A 5E3NA 3HOUJ 4J19A 2HI3A 4JP0A 1AKHB 5E3MA 3BTJA 5EGOB 1GT0C 4JX6A 4I6ZA 1FIAA 4BXXJ 5FKOA 3S1MJ 2M0CA 2Y30A 2LY9A 5K7FA 3HGGA 3PM1A 1Z77A 2O7OA 1U8BA 3BR6A 3D1NI 3SFIA 1PUFB 4DZPA 3JRAA 4FCYA 1P7JA 4CYCA 2XPWA 2E19A 2JJ7A 2ID3A 1RPWA 4NDLA 3HOVJ 3RQIA 4CYCB 1BA5A 1ETVA 1I3QJ 2EZLA 2DMQA 3GTJJ 3H0GJ 3BTIA 4BKXA 1IDYA 2HDDA 2JWTA 4Y52J 1ZKGA 1JKRC 1OJLA 5E3LA 1IC8A 3Q0UA 2LK2A 4MO7A 1IJWC 3JRHA 1IRZA 5IP6A 2CQQA 1QVUA 2HOSA 3K7AJ 1LE8B 4D5FA 5M3MJ 4BBSJ 3BQZA 3HEFA 1H88C 1WH7A 1WH5A 2DA3A 3DCFA 4FTHA 1TC3C 2XGCA 2LD5A 4IHWA 5HODA 2E2IJ 1IGNA 3HOWJ 4GFBA 4A3IJ 3NAUA 3BR2A 4QTRA 3ZQCA 1IDZA 3A02A 5J1YA 3RZOJ 1I6HJ 4A3MJ 1ETQA 5F08A 2JK3A 1APLC 2R5YA 2JMWA 1RESA 3BR0A 2R5ZA 1HCRA 1FTZA 3GBGA 3HOZJ 5C4JJ 3BG5A 2R0QC 3A03A 2R5ZB 1U78A 4Y7NJ 2ME6A 4DZJA 1HF0A 1XG1A 5IP9J 4A3LJ 2XGEA 2B63J 5F04A 3GTQJ 5F0CA 5IP7J 1S7EA 3HKZN 5FLVA 4M3DA 1XC5A 1SFOJ 4A3CJ 1I50J 3CQZJ 2QCOA 1JTYA 1JTXA 2KT0A 2WAQN 4IHXA 2NS8A 4A3KJ 4W97A 5J1RA 2YUSA 1OFCX 4FE7A 2PMZN 3S1QJ 3ZQLA 5C3EJ 1NK3P 2E2HJ 4IEJA 3JRBA 1HLVA 1NTCA 2I10A 1D5YA 1X2MA 3O8HA 1BL0A 4QSHA 2VI6A 2NS7A 2DMPA 4A3DJ 3LSPA 1UHSA 3ZQGA 1XS9A 1DU0A 3H3VK 1VI0A 3M4OJ 5EG0A 2P81A 4B3AA 4A3EJ 2JA5J 2D5VA 1ETWA 2GLOA 3K2AA 1X58A 5IOZA 4AYBN 5EGOA 1MBJA 2EZIA 4A93J 2MSYA 2Y0SN 1F36A 4A3FJ 3GTMJ 1LFBA 5EEAA 3M3YJ 3W6VA 2RAEA 3GTKJ 5IPAA 3OSGA 2DA7A 4DW6A 2XRLA 2DMNA 1B72A 1U9NA 3JRCA 2AO9A 2GBYA 3BG9A 1ENHA 1Y1VJ 3G1OA 4M3EA 1B72B 1E3OC 5FKNA 1PUFA 3HGYA 4C3IJ 3PO2J 3HBLA 3LSGA 4D7MA 3BTCA 1B8IA 1ORKA 2Y2ZA 2R7ZJ 1T56A 3OSFA 2OF7A 2R93J 2LVSA 2WV1A 3Q3SA 1B8IB 1SANA 3S14J 4HNVA 1DU6A 1TWGJ 2CUEA 3G1MA 5EZGA 4DYRA 4AC0A 2DA4A 3OIOA 1LE8A 4RDUA 2YS9A 5EYRA 4A3GJ 2E1OA 1O4XA 2JA6J 5J3LA 4M3GA 5FJ8J 2VKEA 5IYCJ 5M5WJ 1JGGA 1HDDC 2XPUA 2XSDC 5BNGA 2LP0A 1GUUA 4D7NA 2E2JJ 3ZQFA 3LSRA 2L7ZA 4XRSG 1ITYA 2MG4A 2H8RA 5DTDA 3BR3A 5M5XJ 3C2BA 3G1LA 2XPVA 1GDTA 1RETA 3QQAA 3CMYA 4IHYA 3BT9A 2HYJA 2LKXA 2COBA 4V2GA 1VF9A 2X9DA 3PO3J 3JRGA 1ETKA 1MSFC 2H1KA 5IOYA 3S2HJ 2EZKA 1ETXA 5F0HA 3HOYJ 3FISA 1MBHA 1H89C 1K83J 4JX5A 5F27A 1Y1WJ 4AUXA 2XGDA 1AU7A 3I4MJ 1QRYA 5J1UA 2AHQA 2FX0A 1F43A 5FLMJ 3Q0WA 3GTGJ 4M3BA 2DN0A 5K7ZA 1ZR2A 3BTLA 4S0HB 1ZGWA 3VPRA 1WGXA 3JRIA 5C44J 2CU7A 3DEWA 3F0CA 3TP3A 4C3HJ 4C2MJ 1MBKA 1TWFJ 2L0KA 2YU9J 4QIWN 1A6IA 2IBDA 3I4NJ 4W1UA 2MGQA 3IH4A 2HQ5A 2IAIA 4M3FA 3BR1A 2XB5A 1X2NA 5FKLA 1OCTC 2Y9YA 5IYBJ 3HB9A 1UMQA 1ZTRA 1W0UA 2WB1N 2K9NA 4BY7J 2IEKA 4XK4A 4EEFG 1MBEA 1Z0XA 1NK2P 1JUMA 4IHVA 3RZDJ 2NVYJ 4MLOA 5GP9A 3JREA 2L7FP 3HDDA 3SDGA 5EDNA 1JKQC 2EH3A 4FE4A 1HDPA 2EZHA 2X6OA 4MIMA 4MFDA 4ABZA 4A3JJ 1RKWA 3Q0VA 2DMUA 1VNDA 4X1EA 2ID6A 2NVQJ 5M3FJ 1BW6A 4UUTA 1QPIA 4DYCA 3S16J 2VUMJ 1LFUP 2KDZA 1JUSA 3A01A 1IV6A 2N8GA 3ZQHA 3S1RJ 3SJMA 3BR5A 1U9OA 5F1JA 1W0TA 3A01B 2DMTA 3NARA 5C4XJ 3BQYA 1K61A 2QF7A 2O8KA 2HXIA 1AHDP 1GV5A 2ECCA 5DS9A 1QVTA 4L5EA 4A69C 4BBRJ 2M2EA 4MFEA 1Q1VA 2EQRA 1ETOA 1TWHJ 4C3JJ 5M5YJ 4BY1J 5GPAA 2OPTA 1OCPA 3E7LA 4M6VA 1GVDA 2LLKA 3L1PA 3O8GA 3JRFA 1JJ6C 1ZK8A 1ZQ3P 1MNMC 3JR9A 1FJLA 4XICA
chains in the Genus database with same CATH superfamily
2L9RA 2XAGA 4XSXF 5GAEJ 3GWZA 2QQAA 2MBFA 2IW5A 1WCMJ 2QSGX 5DM7F 2K9SA 1JJ8C 2HTSA 5ILUA 1JT6A 4HSTA 1UHWA 4F91B 1ON2A 3WHCA 2Y9ZA 2CV1A 4BHPA 2CQXA 1GV2A 2GWRA 2FD5A 3ML6A 5D4RA 1BW5A 1J5YA 4PDKA 4ZDLA 1G2HA 1WPKA 4UB6C 3F3XA 2QLZA 4D5CA 2HVQA 1G59A 2OJED 4KFCA 4JYKA 3LNQA 3SZGA 3GLLA 2TCTA 3IH3A 3JRDA 3M1CA 3JAMK 4UUSB 1W7PD 3VFZA 2X4HA 3GX4X 3GTOJ 3RKXA 3F8FA 3ZOBA 2MA3A 3V8LA 3TW6A 4CHUA 2JSPA 1EV7A 4DYQA 2DODA 2E35A 2XB0X 2XKOA 3ECOA 4N9HA 3CJQB 2ZNZA 1B9NA 1B59A 2CRGA 4KT6A 1YYVA 2A07F 5L3BA 2DA2A 5FKMA 2F5VA 3TEDA 2BOLA 3ZQIA 4HNUA 3MD2A 4E7HA 1DP7P 2V1UA 2R5YB 3KFWX 3PQKA 1FYLA 3AL0C 2W82A 1WKMA 3BP8A 1FSEA 2VONA 1LFPA 1Y56A 2QQ8A 4B4CA 1VFCA 3CJNA 1D1AA 1UZCA 4WX9A 5EF6A 4CXFA 3Q9VA 2HOAA 1SVOA 2ZXWH 1U5TC 5HS9A 3SFZA 4ZYGA 4QWQA 2JQ7A 5J4YA 4ZYEA 2HPIA 1H8AC 2DYRH 2M8GX 3SXYA 1ZR4A 3HTSB 2CV2A 2JRMA 1TW2A 3RPUD 4I02A 3FXOA 4L0YB 5DD4A 3ASOH 5E17F 3MVPA 5CQEA 4C2TA 3M8FA 2GAUA 1ZH5A 1W5CC 4X6AJ 2X1EA 2KJCA 3FIWA 3S17J 4G94A 1UG2A 1WJAA 2GOMA 1EF4A 1OISA 2VJIA 1P2FA 3HRUA 3GFLA 2VPLA 1T08B 3SEQA 1JT0A 3TMOA 2Z1DA 2P4WA 2KFDA 1LB2A 4CZCA 4ZTJA 1MMAA 4OMYA 3OL4A 3ZMVA 4HYEA 5LGTA 4IRIA 1YQAA 1T39A 3WTSC 3S1MJ 3S32A 3VYSB 3ZMZA 1S72I 1TZLA 3OYAA 3E6CC 1HC8A 2C6YA 3FXMA 3MAJA 2VE9A 4R1HA 2LMDA 3D1NI 1ZRDA 1PUFB 4RAYA 2EIMH 3IC7A 1S5LC 3CC2I 3Q9SA 3ABLH 5H6QA 2XHKA 1RPWA 4CYCB 4OU0A 4E7SA 2R7TA 2WA0A 2EZLA 4IPAA 3BWGA 5J6XA 3HPGA 3S93A 1BI1A 3BTIA 2HDDA 1JKRC 5K5OA 4XL9A 1KU2A 1IAWA 3W6JB 4XLNF 3Q0UA 2H09A 1IJWC 5KHDA 4CCOA 4WWCA 3JRHA 4EJUA 5HDGA 2M5WA 2HOSA 2QYOA 3K7AJ 1SAXA 2PLYA 5E1ZB 1WJBA 1MJ9A 3CTAA 1CGPA 3CCQI 4MQ9F 1YW7A 5D5WB 1YO5C 5HODA 4CA0A 4HF2A 2NNNA 4BQQA 5A2QK 1W4MA 2A6TA 3EDPA 3WGHA 1K4SA 3CESA 4RM3A 2D1VA 2E1MC 3A0BC 4EM0B 2E71A 3A02A 4B8XA 5J1YA 2IP2A 3WTUC 5JFRA 2HOEA 1ETQA 3V8JA 2HQAA 1A36A 2HU9A 3R0AA 2R5YA 2JMWA 2A61A 2ESHA 3BR0A 4XKBA 3KP5A 5H6RA 1HCRA 1SD7A 2TDXA 3GBGA 3WU0A 2QEXI 5C4JJ 1MJBA 2VL8A 3A03A 3RPUA 3LAPA 1TL8A 1O7FA 1XG1A 4IZZA 1VQ8I 2K4BA 4H0EA 2B63J 1PYVA 4AVZA 1FOWA 3LSHA 1KGSA 2IGKA 2KIUA 2LKSA 5ICFA 2RQPA 2VC0A 1SFOJ 2X85A 2H94A 2QCOA 1RZ4A 3CQZJ 2MLKA 1RUOA 4A3CJ 1QO0D 5LEJA 1XDUA 2KIMA 3RCOA 4W97A 3K0LA 2ZKZA 4FX4A 4FE7A 3H9QA 4N9IA 2NNYA 2E2HJ 1IW7F 1ZARA 4XONA 2DJIA 2Y75A 3FXJA 5JVGF 2BEOA 4JBAA 4LFUA 2H6BA 3WTXC 3S3OA 2DMPA 1XMXA 1E17A 3LSPA 1UHSA 2A68F 2L3DA 3ABMH 2IGNA 1XS9A 1EKEA 1MNDA 3TOBA 4DOZA 4M6XA 1T38A 1R5HA 2P81A 4A3EJ 3D5SC 3KLOA 4U87A 2D5VA 1ETWA 1B4AA 1T6SA 2VBZA 1D0XA 3KZIC 5CKTA 5FROA 2CW8A 2EZIA 4A93J 2BW3B 1G4DA 3OYIA 3RI4A 1F36A 5CVIA 4A3FJ 3FBNB 4OWRB 5EEAA 4LITA 1QHGA 2DA7A 2VQHA 3AG3H 4UHTA 3A4CA 1B72A 1T0FA 1IF1A 1FOKA 1RUNA 1PUEE 1LJ9A 2WAQA 2AO9A 3BG9A 3G71I 3T8TA 1ENHA 1XGNA 1PUFA 1XPXA 3L2CA 2GXAA 1QPMA 2MD5A 4C3IJ 2BXYA 4Y17A 2I8DA 2HDCA 4MTEA 4BEHB 1BM9A 2OCCH 3D0SA 4AU7A 2Y2ZA 3L09A 2R7ZJ 3L7WA 2EIKH 2QM3A 3LA2A 1HW5A 3DEEA 3GCMA 2UXXA 2HKXA 3K69A 4IRHA 3H35A 5EEGA 3ZMSA 3S14J 3CC7I 4HNVA 2XKPA 1C0WA 5DUKA 3MKYB 1DU6A 1ZELA 4L9TA 2KISA 2ZXHA 2X1CA 3S8PA 4DYRA 4GYIA 3LQRA 1FBQA 2FXAA 2ZXJA 4S04A 2P8TA 1ZLJA 3CUQC 2DA4A 4RDUA 4OINF 3GEZA 3J80K 2OTJI 3ZMTA 1IRGA 2VKHA 1O4XA 2RV8A 1MDMB 1HKQA 2A05A 2Y0SA 2X51A 3JW4A 3T1BA 1YJWI 4PCQA 2CGPA 3K4JA 1GUUA 2H6CA 4D7NA 2ZCWA 4LG0B 4HX7A 5LRSA 1TT0A 1K78A 2V26A 1IUYA 1MD0A 5DTDA 1RRJA 2H8RA 4DGWB 1WSUA 2XPVA 1GDTA 3U1DA 5CVRA 2QSHX 3DTEA 1RETA 1I39A 2LRDA 3N97A 4EMSA 5E1XA 2LREA 2JA2A 2RNGA 4IHYA 2HYJA 4GCVA 2COBA 3MWMA 3K1PA 1HXDA 3QPTA 5FLXK 3R60A 1MMDA 1RNLA 1ZG1A 1XTAA 4RA2A 1FWZA 3S2HJ 2R7QA 1ETXA 3A1YA 1XGMA 2IS4A 1VQ5I 3HIFA 3G2BA 4MGRA 4EJTA 4BE2A 4D0PA 3V42A 1XSVA 1X1BA 3TDZC 1AU7A 2KRFA 3RPQA 5J1UA 3MZ8A 5ED4A 4NC6A 1OQYA 1W36D 1YOVB 3DU5A 1EJ9A 2NAZA 1ZGWA 4L9VA 2CSOA 1SD4A 2CU7A 1O57A 1SMYF 1ZGJA 3QU6A 4Y15A 3RDIA 2L2OA 2HYGD 3RJPA 1MBKA 4C2MJ 2L0KA 3WODF 1A6IA 4EGYA 5FFZA 5GAHJ 3OS2A 2BE5F 4RB1A 2MGQA 5DCFA 1Z91A 5E8IA 4Y3OA 1G3SA 4A0ZA 2XAFA 5IYBJ 3HB9A 5HLTA 2IS6A 2GZWA 2E1NA 4XK4A 1Q1HA 4A0YA 3BZKA 1Z0XA 3CF2A 2KDOA 1YFHA 2WWYA 2BW3A 4HA8A 2AS5F 3JREA 2ZJQF 3HSRA 5EDNA 3OY9A 1JKQC 2LYCA 3K9TA 4FQGA 3E6MA 2R4GA 1AWCA 3IP4B 4XLPF 2L9NA 4X1EA 5F64A 4UUTA 5D4SA 4BHCA 2P6TA 2VUMJ 1LFUP 4BEHA 3A01A 3TOAA 3CDIA 3ZQHA 3BOQA 3EPZA 4P9FA 5F1JA 3E6DA 2DU9A 5GTHC 4AM3A 4EJOA 3BQYA 1HW2A 4KDPA 4CICA 2JSCA 2QF7A 1V5FA 3P9CA 1GV5A 3VEPA 1SEUA 5TGTA 3J81Z 3ZMUA 1M1EB 3NWSA 3OIQA 3J7AO 2HVRA 2PN6A 3FF5A 2CFXA 4KMFA 2D2WA 3T8RA 5M5YJ 2ELHA 3PIOF 1YS6A 2K5CA 2OPTA 1OCPA 5DEQA 2PQ8A 2KKOA 2JUGA 4M6VA 2PFBA 1K79A 2LLKA 3AG4H 3DKYA 3AG1H 5E79C 1YG2A 3ZPLA 3ROUA 2RC4A 2RN7A 1ZQ3P 2CV0A 4EQQA 4IRGA 2UZKA 1F5TA 1JXSA 3BPXA 1ON1A 1H9GA 3FHNA 4U88A 4XKCA 1JUPA 4D1QA 5E3OA 4A3BJ 2VBWA 3CCJI 3KX2A 1RIOH 2CO5A 4AD9A 1K7AA 3BG3A 5CYVA 3WE3A 4M9ZA 1J09A 4YELA 3KP4A 1E3PA 1XD7A 1FPQA 2B7EA 2CQNA 4XOPA 4XRMA 4YFXF 2VIXA 1DDNA 4G7HF 4M9XA 3DXJF 3FDYA 3QYEA 2KRHA 1Z7LA 4IO9F 4LK0F 2XASA 3WHBA 3WTVC 3LA3A 5J40A 4CUGA 1TWCJ 4XKWA 4E4HA 2WBMA 1DUXC 3OIPA 2W85A 3FK6A 2HXOA 4XLEA 4Z6YA 3BG7A 1K4TA 1DGRM 2KQRA 1OCOH 3L2UA 2RQQA 2E7WA 3H3UA 3E5XA 2EBIA 1ZHFA 4RLQA 5B66C 2QQ9A 1FEXA 2DAOA 3BLYA 3S15J 1GVJA 2ZB9A 3BZCA 2Z9OA 4U0YA 1G8XA 4I09A 3ASNH 2K9MA 4ESJA 3TP0A 1JI8A 3MN2A 2O6GE 4UXNA 3TGNA 3GYHX 5F0FA 4XRSA 5GPCA 2VODA 1WI3A 2ELKA 4BQOA 3ZP5A 2VKDA 4OMZA 2DW4A 1I27A 4G8XA 2CG4A 4NHJA 4G12A 4N4NB 2DCEA 1O3SA 4ON0A 1MBGA 3H9GA 3L2VA 2YX7A 2COMA 2VPRA 3LOCA 3DLLF 4G7ZF 5KAFC 2EV0A 4XMYA 2Y31A 1TP4A 2OC6A 3KCCA 2BHZA 1MSEC 1FMVA 4ZTFA 4RB0A 2L7MP 5CVJA 1EA3A 2P7CB 2FQ4A 2LTPA 3EYYA 2UV1A 3W2WA 4G7OF 2BVLA 3CCYA 3CMMA 5HNHA 2RVCA 3FKIJ 1Z1DA 2Z16A 4DNCA 2ECBA 2D1HA 2G9WA 2NOJB 2O8XA 3F22A 1MMNA 2K9QA 3MKZA 4RGSA 3GZ5A 2JA8J 3MKLA 2K40A 3I59A 3HM5A 2W24A 2R92J 1N75A 2FNPA 4ENKA 2LC2A 3HOXJ 4UY8I 1KQ8A 3KP7A 3QOPA 3BTJA 5EGOB 2DDAA 1V5GA 2R7OA 1GT0C 1OR7C 1BOAA 3NEUA 4B47A 2EFOA 1FIAA 1OYYA 5FKOA 2XAJA 1TT5B 2Y30A 2LY9A 2OQRA 5K7FA 3HGGA 3ULQB 4BU2A 1WHUA 1G3WA 1Z77A 3BY6A 2O7OA 1T8IA 2PMZA 1U8BA 4C2UA 2J5PA 4G6TB 5IT9Z 3MCZA 3PNVA 3GFJA 2A5YB 4TV7A 1BI0A 2Y69H 3DQVC 1Y8QB 2E19A 3OYHA 2CQKA 2ID3A 3AAFA 2L7KA 2ZXIA 1D8KA 3GTJJ 5BQTA 1W7PB 3ZR8X 5L3CA 3E1SA 1WJFA 2JWTA 1BN5A 4LIVA 3HOSA 2JVHA 1R23A 4UVAA 2LK2A 3HUGB 3W6KB 1QVUA 5ERIA 3ECHA 2M3AA 2NYXA 2JTVA 3W2VA 4Q4ZF 3HEFA 1IXCA 1H88C 1VQLI 2R7VA 1AA7A 1XDSA 4E7JA 5E18F 1Y6IA 3DPUA 2K3FA 2O3FA 4IHWA 4E70A 2E2IJ 2WY8Q 2FNAA 2XAHA 4IOAF 4A3IJ 2V6CA 3NAUA 4BJTA 4QTRA 2GQQA 1MMGA 4HBLA 4A12A 1YW8A 2GIZA 2HEOA 5BS6A 3GW2A 3B02A 1TNTA 3RZOJ 1I6HJ 2XF7A 2YPRA 4LB6B 3LSMA 2R3SA 5F08A 4F7ZA 1ZG5A 1APLC 4PJMA 2E5ZA 2GXBA 1FTZA 4IL6C 3BG5A 3ERMA 3ZQ7A 5HLGA 2QKLB 3OOPA 2ZJPF 3CUOA 3R61A 2LKPA 1WJEA 4ZZLA 3WE2A 3QPHA 2VC1A 4WK8F 4A3LJ 2K7LA 4A2UA 1S7EA 1ONVA 3HKZN 4HLXA 3QP5A 1X3WB 4AVPA 4M3DA 2WV0A 4G6QA 3MZYA 1XC5A 1IN7A 1Y39A 1VQ9I 4U0VA 1D8JA 3VWBA 3HHGA 2V1NA 4KIGA 4KMUX 4A3KJ 3O3KA 4DIQA 3DTIA 5J1RA 5CPRB 1OFCX 3IRRA 5ILSA 2PMZN 3LMMA 2IA0A 1ODDA 3VSLA 3DLAA 3V7RA 3JRBA 2HKOA 1NTCA 2I10A 1Z3XA 2E60A 3PSFA 2GA2A 3GXOA 2IVMA 2CYYA 4QSHA 2NS7A 1USTA 2QGUA 3KZZA 4M72A 5DD8A 3F21A 1FLIA 1DU0A 1F9NA 2ZMEA 3H3VK 1U0JA 1D0ZA 1WQ2A 1VI0A 2UWMA 5D5VB 3M4OJ 5J4VA 2ZSHB 2JA5J 2YU3A 5L3GA 1L3LA 4ANJA 4RGUA 5DM6F 2W00A 2ZJ2A 3K2AA 3ZXSA 1X58A 5IOZA 3E3VA 4RGRA 2FBHA 5EGOA 2CQ7A 2XIGA 4BJ6C 4YFNF 3O6BB 1N78A 2MSYA 4LB5A 1YX3A 1LDJA 5LEKA 3GTMJ 3K4LA 1HA8A 1QHHD 1IXRC 1T98A 4LLGF 5AONA 1TW3A 5IPAA 4DW6A 2XRLA 4RM2A 3GO5A 3I9V2 4E7IA 2GBYA 4KICA 1QZZA 1WJ5A 1XCVA 5CLSA 1BC7C 1B72B 1BBYA 5FKNA 1X3ZB 3CP2A 3P9KA 4CCJA 5DCMA 1WJDA 4BE0A 4IHTA 3LSGA 4D7MA 3L2RA 4BNCA 1ORKA 1SFXA 1T56A 4PJJA 4UUVA 3OYFA 2R93J 3IAS2 3FMRA 1W7PA 4BYYA 1Z3YA 1HQCA 1I1SA 2X1DA 3G1MA 2FBIA 2HQNA 2UUZA 3U9GA 2V9VA 4HG2A 3HUGA 4O5VA 2YX4A 3OIOA 1FOXA 3N4MA 3LFUA 3DF8A 3ABTA 1D0YA 3ABKH 2GXGA 5EYRA 4KIFA 2AQFA 5J3LA 5IYCJ 4Y33A 3EUHC 4P5OA 1UB9A 2BY1A 4KNYA 2FMYA 2W25A 1IN8A 2PMHA 2H27A 4NC7A 2M87A 2VXDA 3F8MA 1ZN2A 3VODA 4XRSG 2MG4A 5KNLA 3BR3A 4I98B 4FT8A 4B09A 1GLNA 2X0LA 1OLTA 2VOOA 1K78B 4RMNA 2CWEA 3QQAA 3CMYA 2F4IA 1VQ6I 3DU6A 1OCRH 4V2GA 1FP1D 1VF9A 1TLHB 2QUFA 5E1WA 3ZMDA 1MSFC 2VOPA 2MYSA 4U7BA 3K4CA 1A31A 5LFAA 3KYDB 2WC2A 1FBSA 1Z9CA 4JX5A 1X1CA 4IJAA 1FC3A 1WFXA 3IKVA 3B73A 5CVUA 3RKYA 3V4GA 4BUPA 3TO6A 2DTRA 1VQ7I 5GAGJ 1QRYA 3MFKA 2OU2A 4Y13A 2AHQA 3IKTA 1F43A 1P92A 4L9NA 5FLMJ 1ZG3A 3Q0WA 5LHHA 4O3MA 5K7ZA 4DJAA 3GF2A 5L3DA 3VPRA 1WGXA 2DT6A 2VJJA 4KITB 1U5TB 4ASNA 2YU9J 5ICGA 1XGSA 1BI3A 5FFXA 5GTIC 2HQ5A 2IAIA 3BR1A 5FKLA 1X2NA 3HPHA 5LGNA 2Y9YA 4YIRX 4DBRA 1UG0A 5F1RA 1ZTRA 3I3LA 2V9KA 3BDDA 1QA6A 3I4PA 4IVNA 1K6OA 1FX7A 4BY7J 4EEFG 5JR3A 1E0EA 2YR2A 3H3ZA 4O6JA 4MEXF 1S7OA 3RTRA 1MMSA 1JUMA 5D6EA 4MLOA 1WRJA 4M71A 4XN3A 3SDGA 2XC7A 4YRVA 4FE4A 2X6OA 1YJ9I 3LSIA 3PUBA 3WTTC 3L2QA 1P4WA 3IAM2 1MZBA 1ULYA 3Q0VA 4PJ0C 4PJLA 3V7CA 1U3EM 2MLGA 2R7UA 3QP6A 1OYWA 1BJAA 3GFIA 2LDUA 3CCEI 2PJPA 2W4SA 4AIJA 1R22A 2ACJA 3LAJA 3HHHA 2XSJC 2Z2SB 2VE8A 2NVUB 5EEHA 2M1BA 2KLOA 3PFIA 1U9OA 5LBQA 1KA8A 4OIOF 3A01B 4EVIA 2M4KA 3J81K 3O2PE 2EB7A 3OS1A 2HXIA 2E36A 3FZVA 1EH8A 2ECCA 5DS9A 2KZVA 2WAFA 1QVTA 1TQMA 3SQNA 3G3ZA 4A69C 4HSRA 1F4KA 2M2EA 2O0YA 4GGGA 3H1CA 4Z2YA 1Q1VA 4ZC3A 3JTGA 3F23A 1N77A 4J01A 3FXLA 1TWHJ 4C3JJ 1YJNI 2MC3A 1ZLKA 2HGCA 3CLOA 3EQLF 4PSXA 3KYLA 2W57A 4CO8A 3OYMA 1O3QA 4HQMA 3L1PA 3O8GA 1SD6A 1R36A 3JRFA 1BR1A 1JJ6C 4BDZA 1VTNC 3JR9A 4I01A 1P4AA 2CMPA 3QOEA 2BHYA 1MIJA 2VJ5A 1YW9A 3H36A 4YFKF 1HKSA 3BCBA 1ZAOA 4XBFA 1X4PA 2HZDA 3S2DJ 2O9LA 3BC8A 4I76A 3CMEI 4LJZF 4PSWA 2HNHA 1YI2I 2EV5A 4RS8A 1SFEA 1FMWA 2DFFA 5BOXA 2DFIA 2M34A 4KIBA 1TWAJ 3TW7A 1YRNA 1IUFA 1MH4A 2MW8A 4N4OB 3CCVI 2JPBA 4XIDA 1UFMA 3TQNA 2QBYA 3QPSA 2Q0OA 5JLXA 3ZCOA 1Z67A 2M9HA 2K9LA 4CH7A 1JKOC 1ETYA 1HOMA 3COAC 3FXKA 4XN0A 2KMUA 3OYLA 1F1ZA 2DQLA 2VKVA 3FK7A 3I0TA 2DJNA 3GTLJ 1MH3A 2F5FA 4GRIA 3FX3A 3J7YJ 3QPLA 1FNNA 1FBUA 2BV6A 1E2XA 3KYCB 3H5NA 1U5TA 2Z3YA 4RBOA 2IA2A 3TDUC 5HDNA 3JSOA 2DFEA 2BXZA 2F5EA 4M73A 1RR7A 4IF4A 1A5JA 4LK1F 5ICEA 3IV5A 1IG7A 1RI7A 4V2FA 2G7UA 4B3XA 3KPHA 1K6YA 2DA6A 1N25A 4PJNA 4PFPA 3MKWB 3DP7A 2ELJA 1UJ8A 2DA1A 1LVKA 1T95A 3UKGA 3GMEA 4FISA 4ZYAA 1HSJA 1VQPI 2M7BA 4RLFA 4XKVA 4NNJA 1JKPC 1J2XA 4BAYA 3ONQA 4LGWA 1CQTA 3H5RA 2W48A 4EGZA 2A69F 2OZ6A 3CMAI 3K4BA 3DWLE 3DV8A 2Y0MA 9ANTA 3P7NA 5J8CA 4XORA 2Z33A 1PP8F 1A35A 2CUJA 1MBFA 3ERED 5IYDJ 3LSJA 2FOKA 1S7AA 1BJZA 2TRTA 2IRFG 4V19K 1Z05A 2WY7Q 1S6LA 2PEXA 1ERDA 2QSFX 2HWVA 1JHFA 2EFQA 3M8EA 3B6AA 2HR3A 2HFHA 2QWWA 2CJJA 5EG0B 1AKHA 1ZYRF 2AQEA 2LBFA 1VQOI 4KUMA 3I59B 2DA5A 2EIJH 1Z6RA 3IWZA 3REOA 3Q5FA 1Y0NA 5E3MA 1S3JA 1B1BA 4BXXJ 2P5KA 2M0CA 5IT9K 4BS9A 4PGHA 4KYWA 1B9MA 3PM1A 5DYMA 3E0JB 4FASD 4F93B 2JUCA 5IT3A 2V6EA 3IHUA 2L9VA 1CF7B 1QZEA 4DZPA 4FCYA 1P7JA 4KA4A 2XPWA 2F48A 6PAXA 3F6OA 1I5ZA 5FRMA 1KONA 2IPQX 2ZNYA 2V7FA 3J7AY 1I3QJ 1OCZH 3T5XA 3P9IA 3H0GJ 4BL0B 4BKXA 1IDYA 4IOCF 3KLNA 1ZKGA 2VN2A 3E5QA 1OJLA 2XDVA 1IXSB 1YIOA 4MO7A 1JHHA 4ITVA 4ENNA 2VJ4A 1IRZA 2DBBA 1LE8B 4II2A 2EFPA 3I5UA 3TL4X 4BBSJ 3BQZA 1X1AA 4L9JA 2W84A 4AIHA 3TO9A 1XB4A 3PL8A 3DKXA 3DCFA 4CDGA 3SZPA 1TC3C 2RKHA 3QODA 5HOOA 1IZ1A 3HOWJ 2DK5A 2EJRA 1BOBA 2DO7A 4GFBA 4B44A 2KL4A 3IL2A 3CLQA 2RGVA 5AIQA 1IO2A 1SC7A 2H1LA 2VB6A 4IQJA 2EINH 2XF6A 1JE8A 3U1KA 2ICWG 2JK3A 4MHGA 3PIPF 3OS0A 4GXOA 2R5ZA 4LLNA 1R1UA 3VDXA 3HOZJ 5J47A 1U2WA 4RGXA 3QYFA 4WXDA 4UVCA 2BBYA 2KIFA 1U78A 4Y7NJ 2EWNA 4DZJA 1HF0A 2VXZA 3ZGKA 5IP9J 5F04A 4WXHA 5F0CA 2ISYA 5IP7J 3OYEA 1WVRA 5BPDA 2KP6A 5FLVA 1V3FA 5B1AH 4BQAA 1I50J 4BHBA 1JTYA 2K4JA 3L9FA 1JTXA 1G3YA 5FGMA 2KT0A 4QPOA 1LDKB 3HZJA 1KQ0A 2IXSA 2FA5A 2HYFA 4E7ZA 2ETHA 4ZYHA 3EETA 3ZQLA 1MGTA 2STTA 4IEJA 1EH6A 1D5YA 3O8HA 4HOBA 1Z7UA 1BL0A 1G6NA 4A3DJ 1LEBA 2VT2A 3M1EA 3DPLC 3QWLA 3FMSA 2IGOA 5CJ9A 1J7KA 4MEYF 3CP8A 4C30A 4ZJZA 2FUG2 3GVAA 5EG0A 2KHMA 1FYMA 2V9PA 3TO7A 4M74A 3U2RA 1KU7A 2ZMEB 4KJZA 2R7DA 2FOWA 1PDNC 1QBJA 2GLOA 2FU4A 4NBQA 4ZYDA 3OYCA 1MBJA 3DKWA 1FY7A 4CSWA 3SHFA 1LFBA 3HKZA 3PFYA 3M3YJ 1U8RA 3W6VA 3LWFA 3OSGA 4CCNA 1HKTA 2DMNA 2M4GA 1XGOA 2L02A 3JRCA 1Y1VJ 3G1OA 4M3EA 2A3SA 3CUQA 4HX4A 1CF7A 2JVGA 3H9JA 1GXQA 3HRSA 4P55A 1ZRFA 1BR2A 1X1DA 3S3NA 5JI6A 3K10A 3T0YA 3BTCA 3OR1C 1B8IA 4UNOA 1IV8A 3OR2C 2E5NA 2BGCA 3OSFA 1R7JA 3OV8A 5DCMB 1ZRCA 2LVSA 2WV1A 3Q3SA 4CCMA 3CCUI 5HS8A 1O3TA 1TWGJ 4HX8A 2CUEA 1VQNI 1QZYA 5EZGA 2MFZA 1T0FC 2LF8A 4RAGA 4IX7A 3H5AA 4AIDA 2IJLA 4AC0A 4XR6A 4HRIA 2XAQA 4E7KA 2AXTC 2L01A 2XF5A 5KVRA 1YITI 3CCRI 1LE8A 1WZ2A 2EILH 4GO1A 3V8KA 3CO7C 4BACA 1ACIA 1WJCA 2YS9A 3SEZA 2HTJA 1R6RA 4G6DA 4M3GA 5FJ8J 2VKEA 1JGGA 2VQGA 4UVBA 4CYDA 2R7WA 1HDDC 1SMTA 4BJ5C 4IKFA 4I0BA 5D5UB 2Q2EB 2XPUA 3HSEA 3VSKA 3A0HC 4FETA 4A0XA 1J59A 2E2JJ 3CC4I 3VOEA 4KN7X 1STZA 1W5TA 1OKRA 4A5MA 2NXNB 5M5XJ 1WI9A 3C2BA 1NG7A 3OYBA 4EM2A 1V4RA 5FD6A 1X1PA 2O61A 3GZNB 2KPMA 3BT9A 4WF2A 4GDFA 5TRDA 4BE1A 3JRGA 3LA7A 2DT5A 2M0MA 3ISPA 4XLCA 2H1KA 1B6AA 2P7VB 5F0HA 2OQGA 3OWTA 1KQ9A 3HOYJ 3FISA 1H89C 1LKXA 1K83J 2Z5UA 4JOMA 3WU2C 1YX5A 5H20A 3KP3A 5F27A 4B48A 4F55A 1Y1WJ 2OD5A 4PK4A 3JTHA 2XGDA 2DOAA 1J9IA 2HVSA 3I4MJ 4OOIA 3N05A 2XROA 3BPVA 3E5UA 2FX0A 1PVEA 1R00A 2PG4A 2RREA 4M3BA 2FQ3A 2DN0A 1ZR2A 4HDVA 1I6XA 4A6DA 4JK1X 5F6FA 3F8BA 3JRIA 3BZ6A 3DEWA 5E20A 2HDWA 2FEZA 5TISC 2K3PA 4QIWN 4ZH4F 4HW0A 3I4NJ 5ICCA 1FOYA 5DDGA 2OV7A 1DQUA 1YE9A 2F4MB 3GUDA 3ESWB 4M3FA 4K2EA 1OCTC 2ZSIB 1NH3A 4HQEA 4EV0A 3HOTA 3FXQA 3I58A 1W0UA 2WB1N 2IS2A 3MQ0A 4ESBA 2K9NA 2IEKA 2QZ8A 2LY1A 4P96A 4YEJA 2VQCA 5JHFA 2Y48A 3G73A 1D3YA 1NK2P 2G7HA 1EH7A 2OBPA 2L7FP 1KYZA 2HPMA 1R71A 5K5RA 1HBXG 2EH3A 4MIMA 4MFDA 2ZO4A 1T2KA 4ABZA 4A3JJ 1SAUA 3FXRA 2E34A 1ZREA 4L5IA 2OAZA 1X3UA 2DMUA 3FXUA 5K5QA 2ID6A 3K6GA 4I2OA 1QPIA 4HV5A 3S16J 3WGIA 1O3RA 2VT3A 1FSHA 2KDZA 1IV6A 2DPDA 2N8GA 3CCSI 3LSKA 2M8EA 3C2GA 1SVLA 3BR5A 1W0TA 2DMTA 5AIPA 3NARA 2LF7A 5C4XJ 3RQ4A 2L9SA 1K61A 3EYIA 1DGWY 2O8KA 1AHDP 1JGSA 1YHQI 3R4KA 2PJRA 2DOEA 4N0BA 1RR8C 3BROA 4L5EA 1WWXA 4NQWB 3DEUA 4MFEA 3BJOA 1OPCA 3FMQA 1UELB 1QU3A 1XN7A 3V7SA 1ETOA 5K1YA 3I64A 4XRFA 4F52A 4BY1J 2XGXA 3E7LA 1GVDA 3PSIA 2F4OB 2Q2EA 1XMAA 2L4MA 1BR4A 3SZTA 1ZK8A 3E97A 3ZN1A 3AG2H 2VBXA 4XSZF 1FJLA 2RNJA 2A6EF 1YTYA 3K1NA 3G4SI 3GTPJ 4LD5A 4R79A 4UV9A 4HAMA 2HOTA 4XQFA 1R49A 1X4OA 2CUFA 2B9SA 2IGMA 2L4AA 5D6FA 3PNTA 1TTYA 1U6GA 1Y0UA 5LGUA 1TQIA 2LR8A 3OYJA 4AWXB 2RDPA 1R1TA 2DQRA 2KJBA 2PBIA 2LNBA 3S1NJ 3WTYC 2DYSH 4ZZDA 5K7HA 3ZRGA 2LSOA 4UUSA 2XAUA 4ENMA 1LEAA 3CZ6A 2ZFWA 2JA7J 2DFHA 2QVOA 4R8HA 3X2QH 2X48A 1YRNB 2XV4S 4BH9A 4WCGA 2JRTA 2OUMA 4PGGA 2HS5A 3JAMZ 3S3MA 3PUFA 3H0DA 5LHGA 1SD5A 1MKMA 2QBYB 2DTZA 3AL0B 4D9JA 4JX4A 4LIUA 5JHUA 2WTEA 5L3FA 3IH2A 2DOFA 3B6CA 1OCCH 1W36C 3C3WA 4OIPF 2GIVA 2DK8A 2VASA 3MMYB 2YSRA 2F5CA 3K70C 2NVXJ 1Y8RB 1R5ID 3FBIB 1T33A 4XLFA 1VQ4I 2I5UA 1KU3A 5L3EA 3I56I 1REPC 4YIIA 1XSXA 3F8CA 5B5EC 2JT1A 2V1XA 4XICA 1V54H 2R7FA 1P7IA 4PUSA 3I55I 2M45A 2QA4I 4G9YA 2FMLA 4EM1A 4MQVA 3RKQA 4EJVA 3F6VA 1POGA 1X19A 3EUAA 4XM3A 5HLHA 5ILVA 3IUOA 3ZN0A 2KRCA 2PMUA 3WTWC 1VQMI 3CDLA 1FIPA 2OTLI 2OA4A 4LOCA 3ABUA 1RKTA 1QGPA 4NC8A 2ESNA 4QLCU 1FTTA 1R9TJ 4IQ4A 3CCMI 2JN6A 2NVTJ 2ME0A 5JLWA 3BCAA 3CJTB 3U21A 4NB5A 2JZYA 4B1RA 2GM4A 2FJ1A 2NOGA 2KIQA 2ADUA 4L5JA 4F3QA 2E1CA 5HNFA 2LFBA 2HQRA 2HZTA 2K86A 1S29A 1OR7A 3FKJA 5TJJA 3OOUA 2P0WA 2CH0A 3DFGA 3KEYA 4FHTA 5EZHA 1Z6TA 2ZFUA 5DUIA 3FM5A 1VQKI 3F8NA 2B0LA 2IA1A 5CVVA 4BGDA 1MJAA 4XNFA 4HEA2 4M9SA 3RKWA 2G0EA 5FKKA 4ZDOA 3FHZA 3VB2A 2FE3A 5E3NA 3HOUJ 4J19A 2HI3A 5BPIA 1H9TA 4JP0A 1AKHB 2PI0A 2LBFB 3LL7A 4P9UA 2H8WA 4NQWA 3KE2A 4JX6A 4I6ZA 2E7XA 1IRXA 2ISZA 1DP3A 5D8LB 3AFHA 3RYRA 4OAZA 2L54A 4WXCA 1A6QA 1BIBA 3GLXA 4RAFA 1IN5A 1KYWA 2BZTA 4I0AA 3BR6A 3SFIA 3JRAA 3F9KA 4GYGA 3QU3A 3A2KA 4CYCA 4KT5C 3W2AA 5KK1A 2EPFA 3KP6A 2STWA 1LPQA 2JJ7A 4RB3C 4NDLA 1DPRA 3HOVJ 3RQIA 1BA5A 2ZJRF 3OYKA 1ETVA 3C7JA 1FZPB 2DMQA 4Y52J 4U0WA 3LFKA 2NS0A 3PNYA 5E3LA 4MTDA 1R4MB 3CCLI 4QPQA 4HDUA 1IC8A 1SFKA 4KN4X 3M9AA 4U7DA 1R1VA 5IP6A 2CQQA 4AYBA 3D5LA 3WG9A 1D5VA 4D5FA 2QENA 3CO6C 1TBXA 3RIRA 2Q8KA 5M3MJ 3MEXA 2E1MB 2LOOA 5FRNA 2R7RA 1D1CA 4LG3A 1LUJB 2V79A 3MZHA 3WGGA 1WH7A 1LQ1A 4OAYA 4P1WA 4BDYA 1WH5A 3BJAA 2DA3A 4HNTA 4FTHA 3PJRA 3I54A 2XGCA 3CJRB 4I99C 1I3AA 2LD5A 1MW7A 2M30A 2W7NA 3UR3C 1V55H 1LVAA 3M7GA 2FF4A 1J75A 1IGNA 4HV6A 2W1OA 2X6YA 1LDDA 4HF0A 5HLIA 3ZQCA 3BR2A 1IDZA 1NHAA 1W5SA 5A2QZ 4H4KC 4A3MJ 3CF5F 3KZYA 3RYPA 1TQPA 3KEOA 1RESA 2MH9A 3DPTA 2R0QC 5HDKA 2LG4A 1RC9A 4UB8C 2R5ZB 2M7AA 2ME6A 4RB2C 4II3A 2XGEA 3VYUB 3GTQJ 3HSFA 3C1DA 3DBRB 2EA4A 3GZ6A 3WG7H 3DTKA 4OIRF 5JVTA 1YS7A 2AXLA 1NG6A 3ELKA 1BC8C 3HTUA 2WAQN 4IHXA 4YG2F 2NS8A 1OMIA 3K70D 3W3CA 2YUSA 2WADA 2DDBA 3S1QJ 4XOTA 4A6EA 5C3EJ 1NK3P 2GA1A 3M07A 2MD0A 2A6HF 3HRTA 3K4NA 4AIKA 1HLVA 4X0GA 3HL2A 1IN6A 1X2MA 1KU9A 2QKMB 2V4JC 1FYKA 2ZBKA 2VI6A 5FB2A 5HS7A 4UV8A 1P6RA 2EFWA 5KCMA 3ZQGA 5FO5A 2XVCA 2VLAA 5E8GA 2EK5A 2KZGA 3OL3A 2BY0A 2PX9A 4B3AA 1P4XA 2F2EA 2EA2A 2A5WA 1XSDA 3HJEA 4AYBN 4CCLA 1PJRA 4XLAA 4ETSA 5LD2C 4CGZA 4LLLA 2LH9A 2OZUA 2Y0SN 5H2FC 1XCBA 3CDHA 1BIAA 2F6CA 2RAEA 3GTKJ 4Y4RA 3JSPA 3S2WA 5D8KB 1U9NA 4IXAA 4E6KG 4L0ZB 1IRFA 5LLQA 2CUZA 2DT7B 2ZMEC 3BG6A 2FRHA 4DBQA 3LSTA 1W1WE 3KIOA 1E3OC 2CS3A 2O03A 4ZDPA 3HGYA 2D45A 3PO2J 4DQ2A 2X6WA 3CUQB 3HBLA 3K1MA 4B43A 3QYBA 1KZHA 3SDBA 3D5RC 2EFNA 1PP7U 3UNGC 1UCRA 2OF7A 3EUHA 1O7LA 4ESFA 1I1GA 1B8IB 1SANA 3NQOA 2CW0F 5B3SH 2VQLA 3KP2A 3K2ZA 3NRVA 4PFOA 3DBLB 1XMKA 3QRFF 1MNEA 1YIJI 2DPUA 1D1BA 2P5VA 4I7HA 4YIFA 2DLLA 2FBKA 4OIQF 1MDMA 4MNUA 3QAHA 4A3GJ 2E1OA 2P6SA 3IRQA 2JA6J 3FWEA 1P9QC 1VZ0A 4NUBA 2MABA 3C18A 2F5DA 3TKYA 3J80Z 5M5WJ 2LY2A 1AOYA 3H92A 4Q47A 2CW7A 4KISA 4Q5SF 4HPQA 4LG0A 2CFOA 4A5NA 2XSDC 2JPCA 5BNGA 5D5XB 1USSA 2LP0A 3IWFA 4BXFA 5J8FA 3ZQFA 3TBIA 3K4KA 3LSRA 2L7ZA 1A04A 1ITYA 5KAIC 1BI2A 1R58A 1XX5A 1GHCA 1SFUA 2R7XA 2XUBA 3G1LA 1FT9A 2GOXB 1J0RA 4J00A 5HVQC 3DBHB 2MC4A 1QNTA 2LKXA 3I71A 2X9DA 3PO3J 3R0JA 3E6BA 1ETKA 3I53A 4L18B 1LNWA 5IOYA 2EZKA 1MBHA 5FLXZ 5LHIA 3OYNA 3L00A 2Q1ZB 3M8JA 4AUXA 1L0OC 2BY3A 2NRAC 3WU1B 5B1BH 3KEQA 4CZZA 5BMZA 1QQIA 2IS1A 2OCEA 3J7ZI 1Z21A 3GTGJ 3BTLA 4S0HB 4HLYA 3OYDA 2VBYA 4BQNA 2K27A 4FX0A 5C44J 3P5JA 2K02A 5CQGA 3CD6I 3F0CA 1S8NA 3TP3A 4C3HJ 1TWFJ 2L5QA 1G3TA 3ZQQA 4PZJA 2IBDA 1R5GA 4ENJA 3HG9A 4W1UA 3IH4A 4HZFA 2XB5A 3KETA 2EV6A 2WAEA 2Z99A 3HC7A 1UMQA 3SYTA 2UXNA 1H0MA 2XRNA 3RSNA 1IN4A 4E7LA 3K4MA 1MBEA 3C2HA 2O5RA 1UAAA 4BXUA 4XLHA 5FD5A 1V5EA 3R6SA 4IHVA 3OYGA 1TNSA 2NVYJ 3RZDJ 5GP9A 3HDDA 1SVMA 3LQQA 4S05A 1HDPA 2EZHA 1RKWA 1E3HA 2V1DA 2BY2A 3F72A 2BVMA 2QQBA 4M6YA 4EJWA 1VNDA 3PQJA 4EATA 2NVQJ 3HXLA 5M3FJ 1BW6A 2J5OA 3HRMA 3NWTA 2BYVE 4DYCA 3G6EI 3BJ6A 1OYIA 1JUSA 3WTZA 4RAZA 3L2WA 3S1RJ 3SJMA 1S9HA 5EJCA 3FM3A 4Q48A 4CCKA 2K85A 3VYRB 1UHMA 2IT0A 1HSTA 1R4NB 3VYTB 4C9YA 3AKZA 2WB1A 4BBRJ 4HF1A 5IY5H 1DPUA 2EQRA 2PJRB 5GADJ 2DI3A 2P5LC 1GXPA 2FSWA 2DXIA 3HYIA 4IHSA 1HW1A 2R7SA 5GPAA 3EUKL 4LMYA 1FP2A 2MH2A 2ZC2A 2X6XA 3GFMA 1ZGAA 3OMYA 5DV5A 4JQFA 1MNMC 3JCUC 4F92B 1YLFA 5LRRA
chains in the Genus database with same CATH topology
2L9RA 1JUPA 3GTPJ 5E3OA 4A3BJ 1WCMJ 2HOTA 2CUFA 3BG3A 2K9SA 1JJ8C 2O9LA 3S2DJ 4I76A 1JT6A 2LR8A 3WHCA 2Y9ZA 4XRMA 2CQXA 1GV2A 1BW5A 2FD5A 3S1NJ 5K7HA 1G2HA 2M34A 1WPKA 4UUSA 1TWAJ 3TW7A 4D5CA 1YRNA 4JYKA 1IUFA 3LNQA 2JA7J 1MH4A 2TCTA 2MW8A 3IH3A 3WHBA 3JRDA 4UUSB 4XIDA 2X48A 3GTOJ 1YRNB 3QPSA 5JLXA 1TWCJ 3ZOBA 2M9HA 3TW6A 1JKOC 3FK6A 1ETYA 2HXOA 1HOMA 4DYQA 2DTZA 2XB0X 4JX4A 2EBIA 2VKVA 3FK7A 2DJNA 3IH2A 3GTLJ 1MH3A 3B6CA 1FEXA 3QPLA 3S15J 2CRGA 2ZB9A 4RBOA 2NVXJ 2DA2A 5FKMA 1T33A 3TEDA 3ZQIA 3TP0A 1RR7A 2R5YB 3MN2A 1P7IA 1A5JA 3IV5A 1IG7A 5F0FA 4XRSA 5GPCA 1WI3A 2ELKA 4B4CA 4V2FA 3RKQA 1POGA 1VFCA 2DA6A 4G12A 5EF6A 2DA1A 3CDLA 1FIPA 3UKGA 4LOCA 1MBGA 4FISA 1RKTA 2HOAA 1FTTA 1R9TJ 2JN6A 2VPRA 1JKPC 2NVTJ 2ME0A 5JLWA 3LOCA 1CQTA 4B1RA 2W48A 2GM4A 2FJ1A 2NOGA 2Y31A 1H8AC 2LFBA 2M8GX 9ANTA 1ZR4A 1MSEC 2L7MP 1MBFA 5IYDJ 2FQ4A 2LTPA 3LSJA 3OOUA 3MVPA 1BJZA 3CCYA 2TRTA 3FKIJ 5EZHA 2ECBA 4X6AJ 3FIWA 2K9QA 3S17J 1UG2A 3B6AA 1EF4A 2JA8J 3MKLA 2K40A 2CJJA 3HM5A 2G0EA 5FKKA 5EG0B 1AKHA 2R92J 1JT0A 3HOXJ 2DA5A 5E3NA 3HOUJ 4J19A 2HI3A 4JP0A 1AKHB 5E3MA 3BTJA 5EGOB 1GT0C 4JX6A 4I6ZA 1FIAA 4BXXJ 5FKOA 3S1MJ 2M0CA 2Y30A 2LY9A 5K7FA 3HGGA 3PM1A 1Z77A 2O7OA 1U8BA 3BR6A 3D1NI 3SFIA 1PUFB 4DZPA 3JRAA 4FCYA 1P7JA 4CYCA 2XPWA 2E19A 2JJ7A 2ID3A 1RPWA 4NDLA 3HOVJ 3RQIA 4CYCB 1BA5A 1ETVA 1I3QJ 2EZLA 2DMQA 3GTJJ 3H0GJ 3BTIA 4BKXA 1IDYA 2HDDA 2JWTA 4Y52J 1ZKGA 1JKRC 1OJLA 5E3LA 1IC8A 3Q0UA 2LK2A 4MO7A 1IJWC 3JRHA 1IRZA 5IP6A 2CQQA 1QVUA 2HOSA 3K7AJ 1LE8B 4D5FA 5M3MJ 4BBSJ 3BQZA 3HEFA 1H88C 1WH7A 1WH5A 2DA3A 3DCFA 4FTHA 1TC3C 2XGCA 2LD5A 4IHWA 5HODA 2E2IJ 1IGNA 3HOWJ 4GFBA 4A3IJ 3NAUA 3BR2A 4QTRA 3ZQCA 1IDZA 3A02A 5J1YA 3RZOJ 1I6HJ 4A3MJ 1ETQA 5F08A 2JK3A 1APLC 2R5YA 2JMWA 1RESA 3BR0A 2R5ZA 1HCRA 1FTZA 3GBGA 3HOZJ 5C4JJ 3BG5A 2R0QC 3A03A 2R5ZB 1U78A 4Y7NJ 2ME6A 4DZJA 1HF0A 1XG1A 5IP9J 4A3LJ 2XGEA 2B63J 5F04A 3GTQJ 5F0CA 5IP7J 1S7EA 3HKZN 5FLVA 4M3DA 1XC5A 1SFOJ 4A3CJ 1I50J 3CQZJ 2QCOA 1JTYA 1JTXA 2KT0A 2WAQN 4IHXA 2NS8A 4A3KJ 4W97A 5J1RA 2YUSA 1OFCX 4FE7A 2PMZN 3S1QJ 3ZQLA 5C3EJ 1NK3P 2E2HJ 4IEJA 3JRBA 1HLVA 1NTCA 2I10A 1D5YA 1X2MA 3O8HA 1BL0A 4QSHA 2VI6A 2NS7A 2DMPA 4A3DJ 3LSPA 1UHSA 3ZQGA 1XS9A 1DU0A 3H3VK 1VI0A 3M4OJ 5EG0A 2P81A 4B3AA 4A3EJ 2JA5J 2D5VA 1ETWA 2GLOA 3K2AA 1X58A 5IOZA 4AYBN 5EGOA 1MBJA 2EZIA 4A93J 2MSYA 2Y0SN 1F36A 4A3FJ 3GTMJ 1LFBA 5EEAA 3M3YJ 3W6VA 2RAEA 3GTKJ 5IPAA 3OSGA 2DA7A 4DW6A 2XRLA 2DMNA 1B72A 1U9NA 3JRCA 2AO9A 2GBYA 3BG9A 1ENHA 1Y1VJ 3G1OA 4M3EA 1B72B 1E3OC 5FKNA 1PUFA 3HGYA 4C3IJ 3PO2J 3HBLA 3LSGA 4D7MA 3BTCA 1B8IA 1ORKA 2Y2ZA 2R7ZJ 1T56A 3OSFA 2OF7A 2R93J 2LVSA 2WV1A 3Q3SA 1B8IB 1SANA 3S14J 4HNVA 1DU6A 1TWGJ 2CUEA 3G1MA 5EZGA 4DYRA 4AC0A 2DA4A 3OIOA 1LE8A 4RDUA 2YS9A 5EYRA 4A3GJ 2E1OA 1O4XA 2JA6J 5J3LA 4M3GA 5FJ8J 2VKEA 5IYCJ 5M5WJ 1JGGA 1HDDC 2XPUA 2XSDC 5BNGA 2LP0A 1GUUA 4D7NA 2E2JJ 3ZQFA 3LSRA 2L7ZA 4XRSG 1ITYA 2MG4A 2H8RA 5DTDA 3BR3A 5M5XJ 3C2BA 3G1LA 2XPVA 1GDTA 1RETA 3QQAA 3CMYA 4IHYA 3BT9A 2HYJA 2LKXA 2COBA 4V2GA 1VF9A 2X9DA 3PO3J 3JRGA 1ETKA 1MSFC 2H1KA 5IOYA 3S2HJ 2EZKA 1ETXA 5F0HA 3HOYJ 3FISA 1MBHA 1H89C 1K83J 4JX5A 5F27A 1Y1WJ 4AUXA 2XGDA 1AU7A 3I4MJ 1QRYA 5J1UA 2AHQA 2FX0A 1F43A 5FLMJ 3Q0WA 3GTGJ 4M3BA 2DN0A 5K7ZA 1ZR2A 3BTLA 4S0HB 1ZGWA 3VPRA 1WGXA 3JRIA 5C44J 2CU7A 3DEWA 3F0CA 3TP3A 4C3HJ 4C2MJ 1MBKA 1TWFJ 2L0KA 2YU9J 4QIWN 1A6IA 2IBDA 3I4NJ 4W1UA 2MGQA 3IH4A 2HQ5A 2IAIA 4M3FA 3BR1A 2XB5A 1X2NA 5FKLA 1OCTC 2Y9YA 5IYBJ 3HB9A 1UMQA 1ZTRA 1W0UA 2WB1N 2K9NA 4BY7J 2IEKA 4XK4A 4EEFG 1MBEA 1Z0XA 1NK2P 1JUMA 4IHVA 3RZDJ 2NVYJ 4MLOA 5GP9A 3JREA 2L7FP 3HDDA 3SDGA 5EDNA 1JKQC 2EH3A 4FE4A 1HDPA 2EZHA 2X6OA 4MIMA 4MFDA 4ABZA 4A3JJ 1RKWA 3Q0VA 2DMUA 1VNDA 4X1EA 2ID6A 2NVQJ 5M3FJ 1BW6A 4UUTA 1QPIA 4DYCA 3S16J 2VUMJ 1LFUP 2KDZA 1JUSA 3A01A 1IV6A 2N8GA 3ZQHA 3S1RJ 3SJMA 3BR5A 1U9OA 5F1JA 1W0TA 3A01B 2DMTA 3NARA 5C4XJ 3BQYA 1K61A 2QF7A 2O8KA 2HXIA 1AHDP 1GV5A 2ECCA 5DS9A 1QVTA 4L5EA 4A69C 4BBRJ 2M2EA 4MFEA 1Q1VA 2EQRA 1ETOA 1TWHJ 4C3JJ 5M5YJ 4BY1J 5GPAA 2OPTA 1OCPA 3E7LA 4M6VA 1GVDA 2LLKA 3L1PA 3O8GA 3JRFA 1JJ6C 1ZK8A 1ZQ3P 1MNMC 3JR9A 1FJLA 4XICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9R A;  1JUP A;  3GTP J;  5E3O A;  4A3B J;  1WCM J;  2HOT A;  2CUF A;  3BG3 A;  2K9S A;  1JJ8 C;  2O9L A;  3S2D J;  4I76 A;  1JT6 A;  2LR8 A;  3WHC A;  2Y9Z A;  4XRM A;  2CQX A;  1GV2 A;  1BW5 A;  2FD5 A;  3S1N J;  5K7H A;  1G2H A;  2M34 A;  1WPK A;  4UUS A;  1TWA J;  3TW7 A;  4D5C A;  1YRN A;  4JYK A;  1IUF A;  3LNQ A;  2JA7 J;  1MH4 A;  2TCT A;  2MW8 A;  3IH3 A;  3WHB A;  3JRD A;  4UUS B;  4XID A;  2X48 A;  3GTO J;  1YRN B;  3QPS A;  5JLX A;  1TWC J;  3ZOB A;  2M9H A;  3TW6 A;  1JKO C;  3FK6 A;  1ETY A;  2HXO A;  1HOM A;  4DYQ A;  2DTZ A;  2XB0 X;  4JX4 A;  2EBI A;  2VKV A;  3FK7 A;  2DJN A;  3IH2 A;  3GTL J;  1MH3 A;  3B6C A;  1FEX A;  3QPL A;  3S15 J;  2CRG A;  2ZB9 A;  4RBO A;  2NVX J;  2DA2 A;  5FKM A;  1T33 A;  3TED A;  3ZQI A;  3TP0 A;  1RR7 A;  2R5Y B;  3MN2 A;  1P7I A;  1A5J A;  3IV5 A;  1IG7 A;  5F0F A;  4XRS A;  5GPC A;  1WI3 A;  2ELK A;  4B4C A;  4V2F A;  3RKQ A;  1POG A;  1VFC A;  2DA6 A;  4G12 A;  5EF6 A;  2DA1 A;  3CDL A;  1FIP A;  3UKG A;  4LOC A;  1MBG A;  4FIS A;  1RKT A;  2HOA A;  1FTT A;  1R9T J;  2JN6 A;  2VPR A;  1JKP C;  2NVT J;  2ME0 A;  5JLW A;  3LOC A;  1CQT A;  4B1R A;  2W48 A;  2GM4 A;  2FJ1 A;  2NOG A;  2Y31 A;  1H8A C;  2LFB A;  2M8G X;  9ANT A;  1ZR4 A;  1MSE C;  2L7M P;  1MBF A;  5IYD J;  2FQ4 A;  2LTP A;  3LSJ A;  3OOU A;  3MVP A;  1BJZ A;  3CCY A;  2TRT A;  3FKI J;  5EZH A;  2ECB A;  4X6A J;  3FIW A;  2K9Q A;  3S17 J;  1UG2 A;  3B6A A;  1EF4 A;  2JA8 J;  3MKL A;  2K40 A;  2CJJ A;  3HM5 A;  2G0E A;  5FKK A;  5EG0 B;  1AKH A;  2R92 J;  1JT0 A;  3HOX J;  2DA5 A;  5E3N A;  3HOU J;  4J19 A;  2HI3 A;  4JP0 A;  1AKH B;  5E3M A;  3BTJ A;  5EGO B;  1GT0 C;  4JX6 A;  4I6Z A;  1FIA A;  4BXX J;  5FKO A;  3S1M J;  2M0C A;  2Y30 A;  2LY9 A;  5K7F A;  3HGG A;  3PM1 A;  1Z77 A;  2O7O A;  1U8B A;  3BR6 A;  3D1N I;  3SFI A;  1PUF B;  4DZP A;  3JRA A;  4FCY A;  1P7J A;  4CYC A;  2XPW A;  2E19 A;  2JJ7 A;  2ID3 A;  1RPW A;  4NDL A;  3HOV J;  3RQI A;  4CYC B;  1BA5 A;  1ETV A;  1I3Q J;  2EZL A;  2DMQ A;  3GTJ J;  3H0G J;  3BTI A;  4BKX A;  1IDY A;  2HDD A;  2JWT A;  4Y52 J;  1ZKG A;  1JKR C;  1OJL A;  5E3L A;  1IC8 A;  3Q0U A;  2LK2 A;  4MO7 A;  1IJW C;  3JRH A;  1IRZ A;  5IP6 A;  2CQQ A;  1QVU A;  2HOS A;  3K7A J;  1LE8 B;  4D5F A;  5M3M J;  4BBS J;  3BQZ A;  3HEF A;  1H88 C;  1WH7 A;  1WH5 A;  2DA3 A;  3DCF A;  4FTH A;  1TC3 C;  2XGC A;  2LD5 A;  4IHW A;  5HOD A;  2E2I J;  1IGN A;  3HOW J;  4GFB A;  4A3I J;  3NAU A;  3BR2 A;  4QTR A;  3ZQC A;  1IDZ A;  3A02 A;  5J1Y A;  3RZO J;  1I6H J;  4A3M J;  1ETQ A;  5F08 A;  2JK3 A;  1APL C;  2R5Y A;  2JMW A;  1RES A;  3BR0 A;  2R5Z A;  1HCR A;  1FTZ A;  3GBG A;  3HOZ J;  5C4J J;  3BG5 A;  2R0Q C;  3A03 A;  2R5Z B;  1U78 A;  4Y7N J;  2ME6 A;  4DZJ A;  1HF0 A;  1XG1 A;  5IP9 J;  4A3L J;  2XGE A;  2B63 J;  5F04 A;  3GTQ J;  5F0C A;  5IP7 J;  1S7E A;  3HKZ N;  5FLV A;  4M3D A;  1XC5 A;  1SFO J;  4A3C J;  1I50 J;  3CQZ J;  2QCO A;  1JTY A;  1JTX A;  2KT0 A;  2WAQ N;  4IHX A;  2NS8 A;  4A3K J;  4W97 A;  5J1R A;  2YUS A;  1OFC X;  4FE7 A;  2PMZ N;  3S1Q J;  3ZQL A;  5C3E J;  1NK3 P;  2E2H J;  4IEJ A;  3JRB A;  1HLV A;  1NTC A;  2I10 A;  1D5Y A;  1X2M A;  3O8H A;  1BL0 A;  4QSH A;  2VI6 A;  2NS7 A;  2DMP A;  4A3D J;  3LSP A;  1UHS A;  3ZQG A;  1XS9 A;  1DU0 A;  3H3V K;  1VI0 A;  3M4O J;  5EG0 A;  2P81 A;  4B3A A;  4A3E J;  2JA5 J;  2D5V A;  1ETW A;  2GLO A;  3K2A A;  1X58 A;  5IOZ A;  4AYB N;  5EGO A;  1MBJ A;  2EZI A;  4A93 J;  2MSY A;  2Y0S N;  1F36 A;  4A3F J;  3GTM J;  1LFB A;  5EEA A;  3M3Y J;  3W6V A;  2RAE A;  3GTK J;  5IPA A;  3OSG A;  2DA7 A;  4DW6 A;  2XRL A;  2DMN A;  1B72 A;  1U9N A;  3JRC A;  2AO9 A;  2GBY A;  3BG9 A;  1ENH A;  1Y1V J;  3G1O A;  4M3E A;  1B72 B;  1E3O C;  5FKN A;  1PUF A;  3HGY A;  4C3I J;  3PO2 J;  3HBL A;  3LSG A;  4D7M A;  3BTC A;  1B8I A;  1ORK A;  2Y2Z A;  2R7Z J;  1T56 A;  3OSF A;  2OF7 A;  2R93 J;  2LVS A;  2WV1 A;  3Q3S A;  1B8I B;  1SAN A;  3S14 J;  4HNV A;  1DU6 A;  1TWG J;  2CUE A;  3G1M A;  5EZG A;  4DYR A;  4AC0 A;  2DA4 A;  3OIO A;  1LE8 A;  4RDU A;  2YS9 A;  5EYR A;  4A3G J;  2E1O A;  1O4X A;  2JA6 J;  5J3L A;  4M3G A;  5FJ8 J;  2VKE A;  5IYC J;  5M5W J;  1JGG A;  1HDD C;  2XPU A;  2XSD C;  5BNG A;  2LP0 A;  1GUU A;  4D7N A;  2E2J J;  3ZQF A;  3LSR A;  2L7Z A;  4XRS G;  1ITY A;  2MG4 A;  2H8R A;  5DTD A;  3BR3 A;  5M5X J;  3C2B A;  3G1L A;  2XPV A;  1GDT A;  1RET A;  3QQA A;  3CMY A;  4IHY A;  3BT9 A;  2HYJ A;  2LKX A;  2COB A;  4V2G A;  1VF9 A;  2X9D A;  3PO3 J;  3JRG A;  1ETK A;  1MSF C;  2H1K A;  5IOY A;  3S2H J;  2EZK A;  1ETX A;  5F0H A;  3HOY J;  3FIS A;  1MBH A;  1H89 C;  1K83 J;  4JX5 A;  5F27 A;  1Y1W J;  4AUX A;  2XGD A;  1AU7 A;  3I4M J;  1QRY A;  5J1U A;  2AHQ A;  2FX0 A;  1F43 A;  5FLM J;  3Q0W A;  3GTG J;  4M3B A;  2DN0 A;  5K7Z A;  1ZR2 A;  3BTL A;  4S0H B;  1ZGW A;  3VPR A;  1WGX A;  3JRI A;  5C44 J;  2CU7 A;  3DEW A;  3F0C A;  3TP3 A;  4C3H J;  4C2M J;  1MBK A;  1TWF J;  2L0K A;  2YU9 J;  4QIW N;  1A6I A;  2IBD A;  3I4N J;  4W1U A;  2MGQ A;  3IH4 A;  2HQ5 A;  2IAI A;  4M3F A;  3BR1 A;  2XB5 A;  1X2N A;  5FKL A;  1OCT C;  2Y9Y A;  5IYB J;  3HB9 A;  1UMQ A;  1ZTR A;  1W0U A;  2WB1 N;  2K9N A;  4BY7 J;  2IEK A;  4XK4 A;  4EEF G;  1MBE A;  1Z0X A;  1NK2 P;  1JUM A;  4IHV A;  3RZD J;  2NVY J;  4MLO A;  5GP9 A;  3JRE A;  2L7F P;  3HDD A;  3SDG A;  5EDN A;  1JKQ C;  2EH3 A;  4FE4 A;  1HDP A;  2EZH A;  2X6O A;  4MIM A;  4MFD A;  4ABZ A;  4A3J J;  1RKW A;  3Q0V A;  2DMU A;  1VND A;  4X1E A;  2ID6 A;  2NVQ J;  5M3F J;  1BW6 A;  4UUT A;  1QPI A;  4DYC A;  3S16 J;  2VUM J;  1LFU P;  2KDZ A;  1JUS A;  3A01 A;  1IV6 A;  2N8G A;  3ZQH A;  3S1R J;  3SJM A;  3BR5 A;  1U9O A;  5F1J A;  1W0T A;  3A01 B;  2DMT A;  3NAR A;  5C4X J;  3BQY A;  1K61 A;  2QF7 A;  2O8K A;  2HXI A;  1AHD P;  1GV5 A;  2ECC A;  5DS9 A;  1QVT A;  4L5E A;  4A69 C;  4BBR J;  2M2E A;  4MFE A;  1Q1V A;  2EQR A;  1ETO A;  1TWH J;  4C3J J;  5M5Y J;  4BY1 J;  5GPA A;  2OPT A;  1OCP A;  3E7L A;  4M6V A;  1GVD A;  2LLK A;  3L1P A;  3O8G A;  3JRF A;  1JJ6 C;  1ZK8 A;  1ZQ3 P;  1MNM C;  3JR9 A;  1FJL A;  4XIC A; 
#chains in the Genus database with same CATH topology
 2L9R A;  2XAG A;  4XSX F;  5GAE J;  3GWZ A;  2QQA A;  2MBF A;  2IW5 A;  1WCM J;  2QSG X;  5DM7 F;  2K9S A;  1JJ8 C;  2HTS A;  5ILU A;  1JT6 A;  4HST A;  1UHW A;  4F91 B;  1ON2 A;  3WHC A;  2Y9Z A;  2CV1 A;  4BHP A;  2CQX A;  1GV2 A;  2GWR A;  2FD5 A;  3ML6 A;  5D4R A;  1BW5 A;  1J5Y A;  4PDK A;  4ZDL A;  1G2H A;  1WPK A;  4UB6 C;  3F3X A;  2QLZ A;  4D5C A;  2HVQ A;  1G59 A;  2OJE D;  4KFC A;  4JYK A;  3LNQ A;  3SZG A;  3GLL A;  2TCT A;  3IH3 A;  3JRD A;  3M1C A;  3JAM K;  4UUS B;  1W7P D;  3VFZ A;  2X4H A;  3GX4 X;  3GTO J;  3RKX A;  3F8F A;  3ZOB A;  2MA3 A;  3V8L A;  3TW6 A;  4CHU A;  2JSP A;  1EV7 A;  4DYQ A;  2DOD A;  2E35 A;  2XB0 X;  2XKO A;  3ECO A;  4N9H A;  3CJQ B;  2ZNZ A;  1B9N A;  1B59 A;  2CRG A;  4KT6 A;  1YYV A;  2A07 F;  5L3B A;  2DA2 A;  5FKM A;  2F5V A;  3TED A;  2BOL A;  3ZQI A;  4HNU A;  3MD2 A;  4E7H A;  1DP7 P;  2V1U A;  2R5Y B;  3KFW X;  3PQK A;  1FYL A;  3AL0 C;  2W82 A;  1WKM A;  3BP8 A;  1FSE A;  2VON A;  1LFP A;  1Y56 A;  2QQ8 A;  4B4C A;  1VFC A;  3CJN A;  1D1A A;  1UZC A;  4WX9 A;  5EF6 A;  4CXF A;  3Q9V A;  2HOA A;  1SVO A;  2ZXW H;  1U5T C;  5HS9 A;  3SFZ A;  4ZYG A;  4QWQ A;  2JQ7 A;  5J4Y A;  4ZYE A;  2HPI A;  1H8A C;  2DYR H;  2M8G X;  3SXY A;  1ZR4 A;  3HTS B;  2CV2 A;  2JRM A;  1TW2 A;  3RPU D;  4I02 A;  3FXO A;  4L0Y B;  5DD4 A;  3ASO H;  5E17 F;  3MVP A;  5CQE A;  4C2T A;  3M8F A;  2GAU A;  1ZH5 A;  1W5C C;  4X6A J;  2X1E A;  2KJC A;  3FIW A;  3S17 J;  4G94 A;  1UG2 A;  1WJA A;  2GOM A;  1EF4 A;  1OIS A;  2VJI A;  1P2F A;  3HRU A;  3GFL A;  2VPL A;  1T08 B;  3SEQ A;  1JT0 A;  3TMO A;  2Z1D A;  2P4W A;  2KFD A;  1LB2 A;  4CZC A;  4ZTJ A;  1MMA A;  4OMY A;  3OL4 A;  3ZMV A;  4HYE A;  5LGT A;  4IRI A;  1YQA A;  1T39 A;  3WTS C;  3S1M J;  3S32 A;  3VYS B;  3ZMZ A;  1S72 I;  1TZL A;  3OYA A;  3E6C C;  1HC8 A;  2C6Y A;  3FXM A;  3MAJ A;  2VE9 A;  4R1H A;  2LMD A;  3D1N I;  1ZRD A;  1PUF B;  4RAY A;  2EIM H;  3IC7 A;  1S5L C;  3CC2 I;  3Q9S A;  3ABL H;  5H6Q A;  2XHK A;  1RPW A;  4CYC B;  4OU0 A;  4E7S A;  2R7T A;  2WA0 A;  2EZL A;  4IPA A;  3BWG A;  5J6X A;  3HPG A;  3S93 A;  1BI1 A;  3BTI A;  2HDD A;  1JKR C;  5K5O A;  4XL9 A;  1KU2 A;  1IAW A;  3W6J B;  4XLN F;  3Q0U A;  2H09 A;  1IJW C;  5KHD A;  4CCO A;  4WWC A;  3JRH A;  4EJU A;  5HDG A;  2M5W A;  2HOS A;  2QYO A;  3K7A J;  1SAX A;  2PLY A;  5E1Z B;  1WJB A;  1MJ9 A;  3CTA A;  1CGP A;  3CCQ I;  4MQ9 F;  1YW7 A;  5D5W B;  1YO5 C;  5HOD A;  4CA0 A;  4HF2 A;  2NNN A;  4BQQ A;  5A2Q K;  1W4M A;  2A6T A;  3EDP A;  3WGH A;  1K4S A;  3CES A;  4RM3 A;  2D1V A;  2E1M C;  3A0B C;  4EM0 B;  2E71 A;  3A02 A;  4B8X A;  5J1Y A;  2IP2 A;  3WTU C;  5JFR A;  2HOE A;  1ETQ A;  3V8J A;  2HQA A;  1A36 A;  2HU9 A;  3R0A A;  2R5Y A;  2JMW A;  2A61 A;  2ESH A;  3BR0 A;  4XKB A;  3KP5 A;  5H6R A;  1HCR A;  1SD7 A;  2TDX A;  3GBG A;  3WU0 A;  2QEX I;  5C4J J;  1MJB A;  2VL8 A;  3A03 A;  3RPU A;  3LAP A;  1TL8 A;  1O7F A;  1XG1 A;  4IZZ A;  1VQ8 I;  2K4B A;  4H0E A;  2B63 J;  1PYV A;  4AVZ A;  1FOW A;  3LSH A;  1KGS A;  2IGK A;  2KIU A;  2LKS A;  5ICF A;  2RQP A;  2VC0 A;  1SFO J;  2X85 A;  2H94 A;  2QCO A;  1RZ4 A;  3CQZ J;  2MLK A;  1RUO A;  4A3C J;  1QO0 D;  5LEJ A;  1XDU A;  2KIM A;  3RCO A;  4W97 A;  3K0L A;  2ZKZ A;  4FX4 A;  4FE7 A;  3H9Q A;  4N9I A;  2NNY A;  2E2H J;  1IW7 F;  1ZAR A;  4XON A;  2DJI A;  2Y75 A;  3FXJ A;  5JVG F;  2BEO A;  4JBA A;  4LFU A;  2H6B A;  3WTX C;  3S3O A;  2DMP A;  1XMX A;  1E17 A;  3LSP A;  1UHS A;  2A68 F;  2L3D A;  3ABM H;  2IGN A;  1XS9 A;  1EKE A;  1MND A;  3TOB A;  4DOZ A;  4M6X A;  1T38 A;  1R5H A;  2P81 A;  4A3E J;  3D5S C;  3KLO A;  4U87 A;  2D5V A;  1ETW A;  1B4A A;  1T6S A;  2VBZ A;  1D0X A;  3KZI C;  5CKT A;  5FRO A;  2CW8 A;  2EZI A;  4A93 J;  2BW3 B;  1G4D A;  3OYI A;  3RI4 A;  1F36 A;  5CVI A;  4A3F J;  3FBN B;  4OWR B;  5EEA A;  4LIT A;  1QHG A;  2DA7 A;  2VQH A;  3AG3 H;  4UHT A;  3A4C A;  1B72 A;  1T0F A;  1IF1 A;  1FOK A;  1RUN A;  1PUE E;  1LJ9 A;  2WAQ A;  2AO9 A;  3BG9 A;  3G71 I;  3T8T A;  1ENH A;  1XGN A;  1PUF A;  1XPX A;  3L2C A;  2GXA A;  1QPM A;  2MD5 A;  4C3I J;  2BXY A;  4Y17 A;  2I8D A;  2HDC A;  4MTE A;  4BEH B;  1BM9 A;  2OCC H;  3D0S A;  4AU7 A;  2Y2Z A;  3L09 A;  2R7Z J;  3L7W A;  2EIK H;  2QM3 A;  3LA2 A;  1HW5 A;  3DEE A;  3GCM A;  2UXX A;  2HKX A;  3K69 A;  4IRH A;  3H35 A;  5EEG A;  3ZMS A;  3S14 J;  3CC7 I;  4HNV A;  2XKP A;  1C0W A;  5DUK A;  3MKY B;  1DU6 A;  1ZEL A;  4L9T A;  2KIS A;  2ZXH A;  2X1C A;  3S8P A;  4DYR A;  4GYI A;  3LQR A;  1FBQ A;  2FXA A;  2ZXJ A;  4S04 A;  2P8T A;  1ZLJ A;  3CUQ C;  2DA4 A;  4RDU A;  4OIN F;  3GEZ A;  3J80 K;  2OTJ I;  3ZMT A;  1IRG A;  2VKH A;  1O4X A;  2RV8 A;  1MDM B;  1HKQ A;  2A05 A;  2Y0S A;  2X51 A;  3JW4 A;  3T1B A;  1YJW I;  4PCQ A;  2CGP A;  3K4J A;  1GUU A;  2H6C A;  4D7N A;  2ZCW A;  4LG0 B;  4HX7 A;  5LRS A;  1TT0 A;  1K78 A;  2V26 A;  1IUY A;  1MD0 A;  5DTD A;  1RRJ A;  2H8R A;  4DGW B;  1WSU A;  2XPV A;  1GDT A;  3U1D A;  5CVR A;  2QSH X;  3DTE A;  1RET A;  1I39 A;  2LRD A;  3N97 A;  4EMS A;  5E1X A;  2LRE A;  2JA2 A;  2RNG A;  4IHY A;  2HYJ A;  4GCV A;  2COB A;  3MWM A;  3K1P A;  1HXD A;  3QPT A;  5FLX K;  3R60 A;  1MMD A;  1RNL A;  1ZG1 A;  1XTA A;  4RA2 A;  1FWZ A;  3S2H J;  2R7Q A;  1ETX A;  3A1Y A;  1XGM A;  2IS4 A;  1VQ5 I;  3HIF A;  3G2B A;  4MGR A;  4EJT A;  4BE2 A;  4D0P A;  3V42 A;  1XSV A;  1X1B A;  3TDZ C;  1AU7 A;  2KRF A;  3RPQ A;  5J1U A;  3MZ8 A;  5ED4 A;  4NC6 A;  1OQY A;  1W36 D;  1YOV B;  3DU5 A;  1EJ9 A;  2NAZ A;  1ZGW A;  4L9V A;  2CSO A;  1SD4 A;  2CU7 A;  1O57 A;  1SMY F;  1ZGJ A;  3QU6 A;  4Y15 A;  3RDI A;  2L2O A;  2HYG D;  3RJP A;  1MBK A;  4C2M J;  2L0K A;  3WOD F;  1A6I A;  4EGY A;  5FFZ A;  5GAH J;  3OS2 A;  2BE5 F;  4RB1 A;  2MGQ A;  5DCF A;  1Z91 A;  5E8I A;  4Y3O A;  1G3S A;  4A0Z A;  2XAF A;  5IYB J;  3HB9 A;  5HLT A;  2IS6 A;  2GZW A;  2E1N A;  4XK4 A;  1Q1H A;  4A0Y A;  3BZK A;  1Z0X A;  3CF2 A;  2KDO A;  1YFH A;  2WWY A;  2BW3 A;  4HA8 A;  2AS5 F;  3JRE A;  2ZJQ F;  3HSR A;  5EDN A;  3OY9 A;  1JKQ C;  2LYC A;  3K9T A;  4FQG A;  3E6M A;  2R4G A;  1AWC A;  3IP4 B;  4XLP F;  2L9N A;  4X1E A;  5F64 A;  4UUT A;  5D4S A;  4BHC A;  2P6T A;  2VUM J;  1LFU P;  4BEH A;  3A01 A;  3TOA A;  3CDI A;  3ZQH A;  3BOQ A;  3EPZ A;  4P9F A;  5F1J A;  3E6D A;  2DU9 A;  5GTH C;  4AM3 A;  4EJO A;  3BQY A;  1HW2 A;  4KDP A;  4CIC A;  2JSC A;  2QF7 A;  1V5F A;  3P9C A;  1GV5 A;  3VEP A;  1SEU A;  5TGT A;  3J81 Z;  3ZMU A;  1M1E B;  3NWS A;  3OIQ A;  3J7A O;  2HVR A;  2PN6 A;  3FF5 A;  2CFX A;  4KMF A;  2D2W A;  3T8R A;  5M5Y J;  2ELH A;  3PIO F;  1YS6 A;  2K5C A;  2OPT A;  1OCP A;  5DEQ A;  2PQ8 A;  2KKO A;  2JUG A;  4M6V A;  2PFB A;  1K79 A;  2LLK A;  3AG4 H;  3DKY A;  3AG1 H;  5E79 C;  1YG2 A;  3ZPL A;  3ROU A;  2RC4 A;  2RN7 A;  1ZQ3 P;  2CV0 A;  4EQQ A;  4IRG A;  2UZK A;  1F5T A;  1JXS A;  3BPX A;  1ON1 A;  1H9G A;  3FHN A;  4U88 A;  4XKC A;  1JUP A;  4D1Q A;  5E3O A;  4A3B J;  2VBW A;  3CCJ I;  3KX2 A;  1RIO H;  2CO5 A;  4AD9 A;  1K7A A;  3BG3 A;  5CYV A;  3WE3 A;  4M9Z A;  1J09 A;  4YEL A;  3KP4 A;  1E3P A;  1XD7 A;  1FPQ A;  2B7E A;  2CQN A;  4XOP A;  4XRM A;  4YFX F;  2VIX A;  1DDN A;  4G7H F;  4M9X A;  3DXJ F;  3FDY A;  3QYE A;  2KRH A;  1Z7L A;  4IO9 F;  4LK0 F;  2XAS A;  3WHB A;  3WTV C;  3LA3 A;  5J40 A;  4CUG A;  1TWC J;  4XKW A;  4E4H A;  2WBM A;  1DUX C;  3OIP A;  2W85 A;  3FK6 A;  2HXO A;  4XLE A;  4Z6Y A;  3BG7 A;  1K4T A;  1DGR M;  2KQR A;  1OCO H;  3L2U A;  2RQQ A;  2E7W A;  3H3U A;  3E5X A;  2EBI A;  1ZHF A;  4RLQ A;  5B66 C;  2QQ9 A;  1FEX A;  2DAO A;  3BLY A;  3S15 J;  1GVJ A;  2ZB9 A;  3BZC A;  2Z9O A;  4U0Y A;  1G8X A;  4I09 A;  3ASN H;  2K9M A;  4ESJ A;  3TP0 A;  1JI8 A;  3MN2 A;  2O6G E;  4UXN A;  3TGN A;  3GYH X;  5F0F A;  4XRS A;  5GPC A;  2VOD A;  1WI3 A;  2ELK A;  4BQO A;  3ZP5 A;  2VKD A;  4OMZ A;  2DW4 A;  1I27 A;  4G8X A;  2CG4 A;  4NHJ A;  4G12 A;  4N4N B;  2DCE A;  1O3S A;  4ON0 A;  1MBG A;  3H9G A;  3L2V A;  2YX7 A;  2COM A;  2VPR A;  3LOC A;  3DLL F;  4G7Z F;  5KAF C;  2EV0 A;  4XMY A;  2Y31 A;  1TP4 A;  2OC6 A;  3KCC A;  2BHZ A;  1MSE C;  1FMV A;  4ZTF A;  4RB0 A;  2L7M P;  5CVJ A;  1EA3 A;  2P7C B;  2FQ4 A;  2LTP A;  3EYY A;  2UV1 A;  3W2W A;  4G7O F;  2BVL A;  3CCY A;  3CMM A;  5HNH A;  2RVC A;  3FKI J;  1Z1D A;  2Z16 A;  4DNC A;  2ECB A;  2D1H A;  2G9W A;  2NOJ B;  2O8X A;  3F22 A;  1MMN A;  2K9Q A;  3MKZ A;  4RGS A;  3GZ5 A;  2JA8 J;  3MKL A;  2K40 A;  3I59 A;  3HM5 A;  2W24 A;  2R92 J;  1N75 A;  2FNP A;  4ENK A;  2LC2 A;  3HOX J;  4UY8 I;  1KQ8 A;  3KP7 A;  3QOP A;  3BTJ A;  5EGO B;  2DDA A;  1V5G A;  2R7O A;  1GT0 C;  1OR7 C;  1BOA A;  3NEU A;  4B47 A;  2EFO A;  1FIA A;  1OYY A;  5FKO A;  2XAJ A;  1TT5 B;  2Y30 A;  2LY9 A;  2OQR A;  5K7F A;  3HGG A;  3ULQ B;  4BU2 A;  1WHU A;  1G3W A;  1Z77 A;  3BY6 A;  2O7O A;  1T8I A;  2PMZ A;  1U8B A;  4C2U A;  2J5P A;  4G6T B;  5IT9 Z;  3MCZ A;  3PNV A;  3GFJ A;  2A5Y B;  4TV7 A;  1BI0 A;  2Y69 H;  3DQV C;  1Y8Q B;  2E19 A;  3OYH A;  2CQK A;  2ID3 A;  3AAF A;  2L7K A;  2ZXI A;  1D8K A;  3GTJ J;  5BQT A;  1W7P B;  3ZR8 X;  5L3C A;  3E1S A;  1WJF A;  2JWT A;  1BN5 A;  4LIV A;  3HOS A;  2JVH A;  1R23 A;  4UVA A;  2LK2 A;  3HUG B;  3W6K B;  1QVU A;  5ERI A;  3ECH A;  2M3A A;  2NYX A;  2JTV A;  3W2V A;  4Q4Z F;  3HEF A;  1IXC A;  1H88 C;  1VQL I;  2R7V A;  1AA7 A;  1XDS A;  4E7J A;  5E18 F;  1Y6I A;  3DPU A;  2K3F A;  2O3F A;  4IHW A;  4E70 A;  2E2I J;  2WY8 Q;  2FNA A;  2XAH A;  4IOA F;  4A3I J;  2V6C A;  3NAU A;  4BJT A;  4QTR A;  2GQQ A;  1MMG A;  4HBL A;  4A12 A;  1YW8 A;  2GIZ A;  2HEO A;  5BS6 A;  3GW2 A;  3B02 A;  1TNT A;  3RZO J;  1I6H J;  2XF7 A;  2YPR A;  4LB6 B;  3LSM A;  2R3S A;  5F08 A;  4F7Z A;  1ZG5 A;  1APL C;  4PJM A;  2E5Z A;  2GXB A;  1FTZ A;  4IL6 C;  3BG5 A;  3ERM A;  3ZQ7 A;  5HLG A;  2QKL B;  3OOP A;  2ZJP F;  3CUO A;  3R61 A;  2LKP A;  1WJE A;  4ZZL A;  3WE2 A;  3QPH A;  2VC1 A;  4WK8 F;  4A3L J;  2K7L A;  4A2U A;  1S7E A;  1ONV A;  3HKZ N;  4HLX A;  3QP5 A;  1X3W B;  4AVP A;  4M3D A;  2WV0 A;  4G6Q A;  3MZY A;  1XC5 A;  1IN7 A;  1Y39 A;  1VQ9 I;  4U0V A;  1D8J A;  3VWB A;  3HHG A;  2V1N A;  4KIG A;  4KMU X;  4A3K J;  3O3K A;  4DIQ A;  3DTI A;  5J1R A;  5CPR B;  1OFC X;  3IRR A;  5ILS A;  2PMZ N;  3LMM A;  2IA0 A;  1ODD A;  3VSL A;  3DLA A;  3V7R A;  3JRB A;  2HKO A;  1NTC A;  2I10 A;  1Z3X A;  2E60 A;  3PSF A;  2GA2 A;  3GXO A;  2IVM A;  2CYY A;  4QSH A;  2NS7 A;  1UST A;  2QGU A;  3KZZ A;  4M72 A;  5DD8 A;  3F21 A;  1FLI A;  1DU0 A;  1F9N A;  2ZME A;  3H3V K;  1U0J A;  1D0Z A;  1WQ2 A;  1VI0 A;  2UWM A;  5D5V B;  3M4O J;  5J4V A;  2ZSH B;  2JA5 J;  2YU3 A;  5L3G A;  1L3L A;  4ANJ A;  4RGU A;  5DM6 F;  2W00 A;  2ZJ2 A;  3K2A A;  3ZXS A;  1X58 A;  5IOZ A;  3E3V A;  4RGR A;  2FBH A;  5EGO A;  2CQ7 A;  2XIG A;  4BJ6 C;  4YFN F;  3O6B B;  1N78 A;  2MSY A;  4LB5 A;  1YX3 A;  1LDJ A;  5LEK A;  3GTM J;  3K4L A;  1HA8 A;  1QHH D;  1IXR C;  1T98 A;  4LLG F;  5AON A;  1TW3 A;  5IPA A;  4DW6 A;  2XRL A;  4RM2 A;  3GO5 A;  3I9V 2;  4E7I A;  2GBY A;  4KIC A;  1QZZ A;  1WJ5 A;  1XCV A;  5CLS A;  1BC7 C;  1B72 B;  1BBY A;  5FKN A;  1X3Z B;  3CP2 A;  3P9K A;  4CCJ A;  5DCM A;  1WJD A;  4BE0 A;  4IHT A;  3LSG A;  4D7M A;  3L2R A;  4BNC A;  1ORK A;  1SFX A;  1T56 A;  4PJJ A;  4UUV A;  3OYF A;  2R93 J;  3IAS 2;  3FMR A;  1W7P A;  4BYY A;  1Z3Y A;  1HQC A;  1I1S A;  2X1D A;  3G1M A;  2FBI A;  2HQN A;  2UUZ A;  3U9G A;  2V9V A;  4HG2 A;  3HUG A;  4O5V A;  2YX4 A;  3OIO A;  1FOX A;  3N4M A;  3LFU A;  3DF8 A;  3ABT A;  1D0Y A;  3ABK H;  2GXG A;  5EYR A;  4KIF A;  2AQF A;  5J3L A;  5IYC J;  4Y33 A;  3EUH C;  4P5O A;  1UB9 A;  2BY1 A;  4KNY A;  2FMY A;  2W25 A;  1IN8 A;  2PMH A;  2H27 A;  4NC7 A;  2M87 A;  2VXD A;  3F8M A;  1ZN2 A;  3VOD A;  4XRS G;  2MG4 A;  5KNL A;  3BR3 A;  4I98 B;  4FT8 A;  4B09 A;  1GLN A;  2X0L A;  1OLT A;  2VOO A;  1K78 B;  4RMN A;  2CWE A;  3QQA A;  3CMY A;  2F4I A;  1VQ6 I;  3DU6 A;  1OCR H;  4V2G A;  1FP1 D;  1VF9 A;  1TLH B;  2QUF A;  5E1W A;  3ZMD A;  1MSF C;  2VOP A;  2MYS A;  4U7B A;  3K4C A;  1A31 A;  5LFA A;  3KYD B;  2WC2 A;  1FBS A;  1Z9C A;  4JX5 A;  1X1C A;  4IJA A;  1FC3 A;  1WFX A;  3IKV A;  3B73 A;  5CVU A;  3RKY A;  3V4G A;  4BUP A;  3TO6 A;  2DTR A;  1VQ7 I;  5GAG J;  1QRY A;  3MFK A;  2OU2 A;  4Y13 A;  2AHQ A;  3IKT A;  1F43 A;  1P92 A;  4L9N A;  5FLM J;  1ZG3 A;  3Q0W A;  5LHH A;  4O3M A;  5K7Z A;  4DJA A;  3GF2 A;  5L3D A;  3VPR A;  1WGX A;  2DT6 A;  2VJJ A;  4KIT B;  1U5T B;  4ASN A;  2YU9 J;  5ICG A;  1XGS A;  1BI3 A;  5FFX A;  5GTI C;  2HQ5 A;  2IAI A;  3BR1 A;  5FKL A;  1X2N A;  3HPH A;  5LGN A;  2Y9Y A;  4YIR X;  4DBR A;  1UG0 A;  5F1R A;  1ZTR A;  3I3L A;  2V9K A;  3BDD A;  1QA6 A;  3I4P A;  4IVN A;  1K6O A;  1FX7 A;  4BY7 J;  4EEF G;  5JR3 A;  1E0E A;  2YR2 A;  3H3Z A;  4O6J A;  4MEX F;  1S7O A;  3RTR A;  1MMS A;  1JUM A;  5D6E A;  4MLO A;  1WRJ A;  4M71 A;  4XN3 A;  3SDG A;  2XC7 A;  4YRV A;  4FE4 A;  2X6O A;  1YJ9 I;  3LSI A;  3PUB A;  3WTT C;  3L2Q A;  1P4W A;  3IAM 2;  1MZB A;  1ULY A;  3Q0V A;  4PJ0 C;  4PJL A;  3V7C A;  1U3E M;  2MLG A;  2R7U A;  3QP6 A;  1OYW A;  1BJA A;  3GFI A;  2LDU A;  3CCE I;  2PJP A;  2W4S A;  4AIJ A;  1R22 A;  2ACJ A;  3LAJ A;  3HHH A;  2XSJ C;  2Z2S B;  2VE8 A;  2NVU B;  5EEH A;  2M1B A;  2KLO A;  3PFI A;  1U9O A;  5LBQ A;  1KA8 A;  4OIO F;  3A01 B;  4EVI A;  2M4K A;  3J81 K;  3O2P E;  2EB7 A;  3OS1 A;  2HXI A;  2E36 A;  3FZV A;  1EH8 A;  2ECC A;  5DS9 A;  2KZV A;  2WAF A;  1QVT A;  1TQM A;  3SQN A;  3G3Z A;  4A69 C;  4HSR A;  1F4K A;  2M2E A;  2O0Y A;  4GGG A;  3H1C A;  4Z2Y A;  1Q1V A;  4ZC3 A;  3JTG A;  3F23 A;  1N77 A;  4J01 A;  3FXL A;  1TWH J;  4C3J J;  1YJN I;  2MC3 A;  1ZLK A;  2HGC A;  3CLO A;  3EQL F;  4PSX A;  3KYL A;  2W57 A;  4CO8 A;  3OYM A;  1O3Q A;  4HQM A;  3L1P A;  3O8G A;  1SD6 A;  1R36 A;  3JRF A;  1BR1 A;  1JJ6 C;  4BDZ A;  1VTN C;  3JR9 A;  4I01 A;  1P4A A;  2CMP A;  3QOE A;  2BHY A;  1MIJ A;  2VJ5 A;  1YW9 A;  3H36 A;  4YFK F;  1HKS A;  3BCB A;  1ZAO A;  4XBF A;  1X4P A;  2HZD A;  3S2D J;  2O9L A;  3BC8 A;  4I76 A;  3CME I;  4LJZ F;  4PSW A;  2HNH A;  1YI2 I;  2EV5 A;  4RS8 A;  1SFE A;  1FMW A;  2DFF A;  5BOX A;  2DFI A;  2M34 A;  4KIB A;  1TWA J;  3TW7 A;  1YRN A;  1IUF A;  1MH4 A;  2MW8 A;  4N4O B;  3CCV I;  2JPB A;  4XID A;  1UFM A;  3TQN A;  2QBY A;  3QPS A;  2Q0O A;  5JLX A;  3ZCO A;  1Z67 A;  2M9H A;  2K9L A;  4CH7 A;  1JKO C;  1ETY A;  1HOM A;  3COA C;  3FXK A;  4XN0 A;  2KMU A;  3OYL A;  1F1Z A;  2DQL A;  2VKV A;  3FK7 A;  3I0T A;  2DJN A;  3GTL J;  1MH3 A;  2F5F A;  4GRI A;  3FX3 A;  3J7Y J;  3QPL A;  1FNN A;  1FBU A;  2BV6 A;  1E2X A;  3KYC B;  3H5N A;  1U5T A;  2Z3Y A;  4RBO A;  2IA2 A;  3TDU C;  5HDN A;  3JSO A;  2DFE A;  2BXZ A;  2F5E A;  4M73 A;  1RR7 A;  4IF4 A;  1A5J A;  4LK1 F;  5ICE A;  3IV5 A;  1IG7 A;  1RI7 A;  4V2F A;  2G7U A;  4B3X A;  3KPH A;  1K6Y A;  2DA6 A;  1N25 A;  4PJN A;  4PFP A;  3MKW B;  3DP7 A;  2ELJ A;  1UJ8 A;  2DA1 A;  1LVK A;  1T95 A;  3UKG A;  3GME A;  4FIS A;  4ZYA A;  1HSJ A;  1VQP I;  2M7B A;  4RLF A;  4XKV A;  4NNJ A;  1JKP C;  1J2X A;  4BAY A;  3ONQ A;  4LGW A;  1CQT A;  3H5R A;  2W48 A;  4EGZ A;  2A69 F;  2OZ6 A;  3CMA I;  3K4B A;  3DWL E;  3DV8 A;  2Y0M A;  9ANT A;  3P7N A;  5J8C A;  4XOR A;  2Z33 A;  1PP8 F;  1A35 A;  2CUJ A;  1MBF A;  3ERE D;  5IYD J;  3LSJ A;  2FOK A;  1S7A A;  1BJZ A;  2TRT A;  2IRF G;  4V19 K;  1Z05 A;  2WY7 Q;  1S6L A;  2PEX A;  1ERD A;  2QSF X;  2HWV A;  1JHF A;  2EFQ A;  3M8E A;  3B6A A;  2HR3 A;  2HFH A;  2QWW A;  2CJJ A;  5EG0 B;  1AKH A;  1ZYR F;  2AQE A;  2LBF A;  1VQO I;  4KUM A;  3I59 B;  2DA5 A;  2EIJ H;  1Z6R A;  3IWZ A;  3REO A;  3Q5F A;  1Y0N A;  5E3M A;  1S3J A;  1B1B A;  4BXX J;  2P5K A;  2M0C A;  5IT9 K;  4BS9 A;  4PGH A;  4KYW A;  1B9M A;  3PM1 A;  5DYM A;  3E0J B;  4FAS D;  4F93 B;  2JUC A;  5IT3 A;  2V6E A;  3IHU A;  2L9V A;  1CF7 B;  1QZE A;  4DZP A;  4FCY A;  1P7J A;  4KA4 A;  2XPW A;  2F48 A;  6PAX A;  3F6O A;  1I5Z A;  5FRM A;  1KON A;  2IPQ X;  2ZNY A;  2V7F A;  3J7A Y;  1I3Q J;  1OCZ H;  3T5X A;  3P9I A;  3H0G J;  4BL0 B;  4BKX A;  1IDY A;  4IOC F;  3KLN A;  1ZKG A;  2VN2 A;  3E5Q A;  1OJL A;  2XDV A;  1IXS B;  1YIO A;  4MO7 A;  1JHH A;  4ITV A;  4ENN A;  2VJ4 A;  1IRZ A;  2DBB A;  1LE8 B;  4II2 A;  2EFP A;  3I5U A;  3TL4 X;  4BBS J;  3BQZ A;  1X1A A;  4L9J A;  2W84 A;  4AIH A;  3TO9 A;  1XB4 A;  3PL8 A;  3DKX A;  3DCF A;  4CDG A;  3SZP A;  1TC3 C;  2RKH A;  3QOD A;  5HOO A;  1IZ1 A;  3HOW J;  2DK5 A;  2EJR A;  1BOB A;  2DO7 A;  4GFB A;  4B44 A;  2KL4 A;  3IL2 A;  3CLQ A;  2RGV A;  5AIQ A;  1IO2 A;  1SC7 A;  2H1L A;  2VB6 A;  4IQJ A;  2EIN H;  2XF6 A;  1JE8 A;  3U1K A;  2ICW G;  2JK3 A;  4MHG A;  3PIP F;  3OS0 A;  4GXO A;  2R5Z A;  4LLN A;  1R1U A;  3VDX A;  3HOZ J;  5J47 A;  1U2W A;  4RGX A;  3QYF A;  4WXD A;  4UVC A;  2BBY A;  2KIF A;  1U78 A;  4Y7N J;  2EWN A;  4DZJ A;  1HF0 A;  2VXZ A;  3ZGK A;  5IP9 J;  5F04 A;  4WXH A;  5F0C A;  2ISY A;  5IP7 J;  3OYE A;  1WVR A;  5BPD A;  2KP6 A;  5FLV A;  1V3F A;  5B1A H;  4BQA A;  1I50 J;  4BHB A;  1JTY A;  2K4J A;  3L9F A;  1JTX A;  1G3Y A;  5FGM A;  2KT0 A;  4QPO A;  1LDK B;  3HZJ A;  1KQ0 A;  2IXS A;  2FA5 A;  2HYF A;  4E7Z A;  2ETH A;  4ZYH A;  3EET A;  3ZQL A;  1MGT A;  2STT A;  4IEJ A;  1EH6 A;  1D5Y A;  3O8H A;  4HOB A;  1Z7U A;  1BL0 A;  1G6N A;  4A3D J;  1LEB A;  2VT2 A;  3M1E A;  3DPL C;  3QWL A;  3FMS A;  2IGO A;  5CJ9 A;  1J7K A;  4MEY F;  3CP8 A;  4C30 A;  4ZJZ A;  2FUG 2;  3GVA A;  5EG0 A;  2KHM A;  1FYM A;  2V9P A;  3TO7 A;  4M74 A;  3U2R A;  1KU7 A;  2ZME B;  4KJZ A;  2R7D A;  2FOW A;  1PDN C;  1QBJ A;  2GLO A;  2FU4 A;  4NBQ A;  4ZYD A;  3OYC A;  1MBJ A;  3DKW A;  1FY7 A;  4CSW A;  3SHF A;  1LFB A;  3HKZ A;  3PFY A;  3M3Y J;  1U8R A;  3W6V A;  3LWF A;  3OSG A;  4CCN A;  1HKT A;  2DMN A;  2M4G A;  1XGO A;  2L02 A;  3JRC A;  1Y1V J;  3G1O A;  4M3E A;  2A3S A;  3CUQ A;  4HX4 A;  1CF7 A;  2JVG A;  3H9J A;  1GXQ A;  3HRS A;  4P55 A;  1ZRF A;  1BR2 A;  1X1D A;  3S3N A;  5JI6 A;  3K10 A;  3T0Y A;  3BTC A;  3OR1 C;  1B8I A;  4UNO A;  1IV8 A;  3OR2 C;  2E5N A;  2BGC A;  3OSF A;  1R7J A;  3OV8 A;  5DCM B;  1ZRC A;  2LVS A;  2WV1 A;  3Q3S A;  4CCM A;  3CCU I;  5HS8 A;  1O3T A;  1TWG J;  4HX8 A;  2CUE A;  1VQN I;  1QZY A;  5EZG A;  2MFZ A;  1T0F C;  2LF8 A;  4RAG A;  4IX7 A;  3H5A A;  4AID A;  2IJL A;  4AC0 A;  4XR6 A;  4HRI A;  2XAQ A;  4E7K A;  2AXT C;  2L01 A;  2XF5 A;  5KVR A;  1YIT I;  3CCR I;  1LE8 A;  1WZ2 A;  2EIL H;  4GO1 A;  3V8K A;  3CO7 C;  4BAC A;  1ACI A;  1WJC A;  2YS9 A;  3SEZ A;  2HTJ A;  1R6R A;  4G6D A;  4M3G A;  5FJ8 J;  2VKE A;  1JGG A;  2VQG A;  4UVB A;  4CYD A;  2R7W A;  1HDD C;  1SMT A;  4BJ5 C;  4IKF A;  4I0B A;  5D5U B;  2Q2E B;  2XPU A;  3HSE A;  3VSK A;  3A0H C;  4FET A;  4A0X A;  1J59 A;  2E2J J;  3CC4 I;  3VOE A;  4KN7 X;  1STZ A;  1W5T A;  1OKR A;  4A5M A;  2NXN B;  5M5X J;  1WI9 A;  3C2B A;  1NG7 A;  3OYB A;  4EM2 A;  1V4R A;  5FD6 A;  1X1P A;  2O61 A;  3GZN B;  2KPM A;  3BT9 A;  4WF2 A;  4GDF A;  5TRD A;  4BE1 A;  3JRG A;  3LA7 A;  2DT5 A;  2M0M A;  3ISP A;  4XLC A;  2H1K A;  1B6A A;  2P7V B;  5F0H A;  2OQG A;  3OWT A;  1KQ9 A;  3HOY J;  3FIS A;  1H89 C;  1LKX A;  1K83 J;  2Z5U A;  4JOM A;  3WU2 C;  1YX5 A;  5H20 A;  3KP3 A;  5F27 A;  4B48 A;  4F55 A;  1Y1W J;  2OD5 A;  4PK4 A;  3JTH A;  2XGD A;  2DOA A;  1J9I A;  2HVS A;  3I4M J;  4OOI A;  3N05 A;  2XRO A;  3BPV A;  3E5U A;  2FX0 A;  1PVE A;  1R00 A;  2PG4 A;  2RRE A;  4M3B A;  2FQ3 A;  2DN0 A;  1ZR2 A;  4HDV A;  1I6X A;  4A6D A;  4JK1 X;  5F6F A;  3F8B A;  3JRI A;  3BZ6 A;  3DEW A;  5E20 A;  2HDW A;  2FEZ A;  5TIS C;  2K3P A;  4QIW N;  4ZH4 F;  4HW0 A;  3I4N J;  5ICC A;  1FOY A;  5DDG A;  2OV7 A;  1DQU A;  1YE9 A;  2F4M B;  3GUD A;  3ESW B;  4M3F A;  4K2E A;  1OCT C;  2ZSI B;  1NH3 A;  4HQE A;  4EV0 A;  3HOT A;  3FXQ A;  3I58 A;  1W0U A;  2WB1 N;  2IS2 A;  3MQ0 A;  4ESB A;  2K9N A;  2IEK A;  2QZ8 A;  2LY1 A;  4P96 A;  4YEJ A;  2VQC A;  5JHF A;  2Y48 A;  3G73 A;  1D3Y A;  1NK2 P;  2G7H A;  1EH7 A;  2OBP A;  2L7F P;  1KYZ A;  2HPM A;  1R71 A;  5K5R A;  1HBX G;  2EH3 A;  4MIM A;  4MFD A;  2ZO4 A;  1T2K A;  4ABZ A;  4A3J J;  1SAU A;  3FXR A;  2E34 A;  1ZRE A;  4L5I A;  2OAZ A;  1X3U A;  2DMU A;  3FXU A;  5K5Q A;  2ID6 A;  3K6G A;  4I2O A;  1QPI A;  4HV5 A;  3S16 J;  3WGI A;  1O3R A;  2VT3 A;  1FSH A;  2KDZ A;  1IV6 A;  2DPD A;  2N8G A;  3CCS I;  3LSK A;  2M8E A;  3C2G A;  1SVL A;  3BR5 A;  1W0T A;  2DMT A;  5AIP A;  3NAR A;  2LF7 A;  5C4X J;  3RQ4 A;  2L9S A;  1K61 A;  3EYI A;  1DGW Y;  2O8K A;  1AHD P;  1JGS A;  1YHQ I;  3R4K A;  2PJR A;  2DOE A;  4N0B A;  1RR8 C;  3BRO A;  4L5E A;  1WWX A;  4NQW B;  3DEU A;  4MFE A;  3BJO A;  1OPC A;  3FMQ A;  1UEL B;  1QU3 A;  1XN7 A;  3V7S A;  1ETO A;  5K1Y A;  3I64 A;  4XRF A;  4F52 A;  4BY1 J;  2XGX A;  3E7L A;  1GVD A;  3PSI A;  2F4O B;  2Q2E A;  1XMA A;  2L4M A;  1BR4 A;  3SZT A;  1ZK8 A;  3E97 A;  3ZN1 A;  3AG2 H;  2VBX A;  4XSZ F;  1FJL A;  2RNJ A;  2A6E F;  1YTY A;  3K1N A;  3G4S I;  3GTP J;  4LD5 A;  4R79 A;  4UV9 A;  4HAM A;  2HOT A;  4XQF A;  1R49 A;  1X4O A;  2CUF A;  2B9S A;  2IGM A;  2L4A A;  5D6F A;  3PNT A;  1TTY A;  1U6G A;  1Y0U A;  5LGU A;  1TQI A;  2LR8 A;  3OYJ A;  4AWX B;  2RDP A;  1R1T A;  2DQR A;  2KJB A;  2PBI A;  2LNB A;  3S1N J;  3WTY C;  2DYS H;  4ZZD A;  5K7H A;  3ZRG A;  2LSO A;  4UUS A;  2XAU A;  4ENM A;  1LEA A;  3CZ6 A;  2ZFW A;  2JA7 J;  2DFH A;  2QVO A;  4R8H A;  3X2Q H;  2X48 A;  1YRN B;  2XV4 S;  4BH9 A;  4WCG A;  2JRT A;  2OUM A;  4PGG A;  2HS5 A;  3JAM Z;  3S3M A;  3PUF A;  3H0D A;  5LHG A;  1SD5 A;  1MKM A;  2QBY B;  2DTZ A;  3AL0 B;  4D9J A;  4JX4 A;  4LIU A;  5JHU A;  2WTE A;  5L3F A;  3IH2 A;  2DOF A;  3B6C A;  1OCC H;  1W36 C;  3C3W A;  4OIP F;  2GIV A;  2DK8 A;  2VAS A;  3MMY B;  2YSR A;  2F5C A;  3K70 C;  2NVX J;  1Y8R B;  1R5I D;  3FBI B;  1T33 A;  4XLF A;  1VQ4 I;  2I5U A;  1KU3 A;  5L3E A;  3I56 I;  1REP C;  4YII A;  1XSX A;  3F8C A;  5B5E C;  2JT1 A;  2V1X A;  4XIC A;  1V54 H;  2R7F A;  1P7I A;  4PUS A;  3I55 I;  2M45 A;  2QA4 I;  4G9Y A;  2FML A;  4EM1 A;  4MQV A;  3RKQ A;  4EJV A;  3F6V A;  1POG A;  1X19 A;  3EUA A;  4XM3 A;  5HLH A;  5ILV A;  3IUO A;  3ZN0 A;  2KRC A;  2PMU A;  3WTW C;  1VQM I;  3CDL A;  1FIP A;  2OTL I;  2OA4 A;  4LOC A;  3ABU A;  1RKT A;  1QGP A;  4NC8 A;  2ESN A;  4QLC U;  1FTT A;  1R9T J;  4IQ4 A;  3CCM I;  2JN6 A;  2NVT J;  2ME0 A;  5JLW A;  3BCA A;  3CJT B;  3U21 A;  4NB5 A;  2JZY A;  4B1R A;  2GM4 A;  2FJ1 A;  2NOG A;  2KIQ A;  2ADU A;  4L5J A;  4F3Q A;  2E1C A;  5HNF A;  2LFB A;  2HQR A;  2HZT A;  2K86 A;  1S29 A;  1OR7 A;  3FKJ A;  5TJJ A;  3OOU A;  2P0W A;  2CH0 A;  3DFG A;  3KEY A;  4FHT A;  5EZH A;  1Z6T A;  2ZFU A;  5DUI A;  3FM5 A;  1VQK I;  3F8N A;  2B0L A;  2IA1 A;  5CVV A;  4BGD A;  1MJA A;  4XNF A;  4HEA 2;  4M9S A;  3RKW A;  2G0E A;  5FKK A;  4ZDO A;  3FHZ A;  3VB2 A;  2FE3 A;  5E3N A;  3HOU J;  4J19 A;  2HI3 A;  5BPI A;  1H9T A;  4JP0 A;  1AKH B;  2PI0 A;  2LBF B;  3LL7 A;  4P9U A;  2H8W A;  4NQW A;  3KE2 A;  4JX6 A;  4I6Z A;  2E7X A;  1IRX A;  2ISZ A;  1DP3 A;  5D8L B;  3AFH A;  3RYR A;  4OAZ A;  2L54 A;  4WXC A;  1A6Q A;  1BIB A;  3GLX A;  4RAF A;  1IN5 A;  1KYW A;  2BZT A;  4I0A A;  3BR6 A;  3SFI A;  3JRA A;  3F9K A;  4GYG A;  3QU3 A;  3A2K A;  4CYC A;  4KT5 C;  3W2A A;  5KK1 A;  2EPF A;  3KP6 A;  2STW A;  1LPQ A;  2JJ7 A;  4RB3 C;  4NDL A;  1DPR A;  3HOV J;  3RQI A;  1BA5 A;  2ZJR F;  3OYK A;  1ETV A;  3C7J A;  1FZP B;  2DMQ A;  4Y52 J;  4U0W A;  3LFK A;  2NS0 A;  3PNY A;  5E3L A;  4MTD A;  1R4M B;  3CCL I;  4QPQ A;  4HDU A;  1IC8 A;  1SFK A;  4KN4 X;  3M9A A;  4U7D A;  1R1V A;  5IP6 A;  2CQQ A;  4AYB A;  3D5L A;  3WG9 A;  1D5V A;  4D5F A;  2QEN A;  3CO6 C;  1TBX A;  3RIR A;  2Q8K A;  5M3M J;  3MEX A;  2E1M B;  2LOO A;  5FRN A;  2R7R A;  1D1C A;  4LG3 A;  1LUJ B;  2V79 A;  3MZH A;  3WGG A;  1WH7 A;  1LQ1 A;  4OAY A;  4P1W A;  4BDY A;  1WH5 A;  3BJA A;  2DA3 A;  4HNT A;  4FTH A;  3PJR A;  3I54 A;  2XGC A;  3CJR B;  4I99 C;  1I3A A;  2LD5 A;  1MW7 A;  2M30 A;  2W7N A;  3UR3 C;  1V55 H;  1LVA A;  3M7G A;  2FF4 A;  1J75 A;  1IGN A;  4HV6 A;  2W1O A;  2X6Y A;  1LDD A;  4HF0 A;  5HLI A;  3ZQC A;  3BR2 A;  1IDZ A;  1NHA A;  1W5S A;  5A2Q Z;  4H4K C;  4A3M J;  3CF5 F;  3KZY A;  3RYP A;  1TQP A;  3KEO A;  1RES A;  2MH9 A;  3DPT A;  2R0Q C;  5HDK A;  2LG4 A;  1RC9 A;  4UB8 C;  2R5Z B;  2M7A A;  2ME6 A;  4RB2 C;  4II3 A;  2XGE A;  3VYU B;  3GTQ J;  3HSF A;  3C1D A;  3DBR B;  2EA4 A;  3GZ6 A;  3WG7 H;  3DTK A;  4OIR F;  5JVT A;  1YS7 A;  2AXL A;  1NG6 A;  3ELK A;  1BC8 C;  3HTU A;  2WAQ N;  4IHX A;  4YG2 F;  2NS8 A;  1OMI A;  3K70 D;  3W3C A;  2YUS A;  2WAD A;  2DDB A;  3S1Q J;  4XOT A;  4A6E A;  5C3E J;  1NK3 P;  2GA1 A;  3M07 A;  2MD0 A;  2A6H F;  3HRT A;  3K4N A;  4AIK A;  1HLV A;  4X0G A;  3HL2 A;  1IN6 A;  1X2M A;  1KU9 A;  2QKM B;  2V4J C;  1FYK A;  2ZBK A;  2VI6 A;  5FB2 A;  5HS7 A;  4UV8 A;  1P6R A;  2EFW A;  5KCM A;  3ZQG A;  5FO5 A;  2XVC A;  2VLA A;  5E8G A;  2EK5 A;  2KZG A;  3OL3 A;  2BY0 A;  2PX9 A;  4B3A A;  1P4X A;  2F2E A;  2EA2 A;  2A5W A;  1XSD A;  3HJE A;  4AYB N;  4CCL A;  1PJR A;  4XLA A;  4ETS A;  5LD2 C;  4CGZ A;  4LLL A;  2LH9 A;  2OZU A;  2Y0S N;  5H2F C;  1XCB A;  3CDH A;  1BIA A;  2F6C A;  2RAE A;  3GTK J;  4Y4R A;  3JSP A;  3S2W A;  5D8K B;  1U9N A;  4IXA A;  4E6K G;  4L0Z B;  1IRF A;  5LLQ A;  2CUZ A;  2DT7 B;  2ZME C;  3BG6 A;  2FRH A;  4DBQ A;  3LST A;  1W1W E;  3KIO A;  1E3O C;  2CS3 A;  2O03 A;  4ZDP A;  3HGY A;  2D45 A;  3PO2 J;  4DQ2 A;  2X6W A;  3CUQ B;  3HBL A;  3K1M A;  4B43 A;  3QYB A;  1KZH A;  3SDB A;  3D5R C;  2EFN A;  1PP7 U;  3UNG C;  1UCR A;  2OF7 A;  3EUH A;  1O7L A;  4ESF A;  1I1G A;  1B8I B;  1SAN A;  3NQO A;  2CW0 F;  5B3S H;  2VQL A;  3KP2 A;  3K2Z A;  3NRV A;  4PFO A;  3DBL B;  1XMK A;  3QRF F;  1MNE A;  1YIJ I;  2DPU A;  1D1B A;  2P5V A;  4I7H A;  4YIF A;  2DLL A;  2FBK A;  4OIQ F;  1MDM A;  4MNU A;  3QAH A;  4A3G J;  2E1O A;  2P6S A;  3IRQ A;  2JA6 J;  3FWE A;  1P9Q C;  1VZ0 A;  4NUB A;  2MAB A;  3C18 A;  2F5D A;  3TKY A;  3J80 Z;  5M5W J;  2LY2 A;  1AOY A;  3H92 A;  4Q47 A;  2CW7 A;  4KIS A;  4Q5S F;  4HPQ A;  4LG0 A;  2CFO A;  4A5N A;  2XSD C;  2JPC A;  5BNG A;  5D5X B;  1USS A;  2LP0 A;  3IWF A;  4BXF A;  5J8F A;  3ZQF A;  3TBI A;  3K4K A;  3LSR A;  2L7Z A;  1A04 A;  1ITY A;  5KAI C;  1BI2 A;  1R58 A;  1XX5 A;  1GHC A;  1SFU A;  2R7X A;  2XUB A;  3G1L A;  1FT9 A;  2GOX B;  1J0R A;  4J00 A;  5HVQ C;  3DBH B;  2MC4 A;  1QNT A;  2LKX A;  3I71 A;  2X9D A;  3PO3 J;  3R0J A;  3E6B A;  1ETK A;  3I53 A;  4L18 B;  1LNW A;  5IOY A;  2EZK A;  1MBH A;  5FLX Z;  5LHI A;  3OYN A;  3L00 A;  2Q1Z B;  3M8J A;  4AUX A;  1L0O C;  2BY3 A;  2NRA C;  3WU1 B;  5B1B H;  3KEQ A;  4CZZ A;  5BMZ A;  1QQI A;  2IS1 A;  2OCE A;  3J7Z I;  1Z21 A;  3GTG J;  3BTL A;  4S0H B;  4HLY A;  3OYD A;  2VBY A;  4BQN A;  2K27 A;  4FX0 A;  5C44 J;  3P5J A;  2K02 A;  5CQG A;  3CD6 I;  3F0C A;  1S8N A;  3TP3 A;  4C3H J;  1TWF J;  2L5Q A;  1G3T A;  3ZQQ A;  4PZJ A;  2IBD A;  1R5G A;  4ENJ A;  3HG9 A;  4W1U A;  3IH4 A;  4HZF A;  2XB5 A;  3KET A;  2EV6 A;  2WAE A;  2Z99 A;  3HC7 A;  1UMQ A;  3SYT A;  2UXN A;  1H0M A;  2XRN A;  3RSN A;  1IN4 A;  4E7L A;  3K4M A;  1MBE A;  3C2H A;  2O5R A;  1UAA A;  4BXU A;  4XLH A;  5FD5 A;  1V5E A;  3R6S A;  4IHV A;  3OYG A;  1TNS A;  2NVY J;  3RZD J;  5GP9 A;  3HDD A;  1SVM A;  3LQQ A;  4S05 A;  1HDP A;  2EZH A;  1RKW A;  1E3H A;  2V1D A;  2BY2 A;  3F72 A;  2BVM A;  2QQB A;  4M6Y A;  4EJW A;  1VND A;  3PQJ A;  4EAT A;  2NVQ J;  3HXL A;  5M3F J;  1BW6 A;  2J5O A;  3HRM A;  3NWT A;  2BYV E;  4DYC A;  3G6E I;  3BJ6 A;  1OYI A;  1JUS A;  3WTZ A;  4RAZ A;  3L2W A;  3S1R J;  3SJM A;  1S9H A;  5EJC A;  3FM3 A;  4Q48 A;  4CCK A;  2K85 A;  3VYR B;  1UHM A;  2IT0 A;  1HST A;  1R4N B;  3VYT B;  4C9Y A;  3AKZ A;  2WB1 A;  4BBR J;  4HF1 A;  5IY5 H;  1DPU A;  2EQR A;  2PJR B;  5GAD J;  2DI3 A;  2P5L C;  1GXP A;  2FSW A;  2DXI A;  3HYI A;  4IHS A;  1HW1 A;  2R7S A;  5GPA A;  3EUK L;  4LMY A;  1FP2 A;  2MH2 A;  2ZC2 A;  2X6X A;  3GFM A;  1ZGA A;  3OMY A;  5DV5 A;  4JQF A;  1MNM C;  3JCU C;  4F92 B;  1YLF A;  5LRR A; 
#chains in the Genus database with same CATH homology
 2L9R A;  1JUP A;  3GTP J;  5E3O A;  4A3B J;  1WCM J;  2HOT A;  2CUF A;  3BG3 A;  2K9S A;  1JJ8 C;  2O9L A;  3S2D J;  4I76 A;  1JT6 A;  2LR8 A;  3WHC A;  2Y9Z A;  4XRM A;  2CQX A;  1GV2 A;  1BW5 A;  2FD5 A;  3S1N J;  5K7H A;  1G2H A;  2M34 A;  1WPK A;  4UUS A;  1TWA J;  3TW7 A;  4D5C A;  1YRN A;  4JYK A;  1IUF A;  3LNQ A;  2JA7 J;  1MH4 A;  2TCT A;  2MW8 A;  3IH3 A;  3WHB A;  3JRD A;  4UUS B;  4XID A;  2X48 A;  3GTO J;  1YRN B;  3QPS A;  5JLX A;  1TWC J;  3ZOB A;  2M9H A;  3TW6 A;  1JKO C;  3FK6 A;  1ETY A;  2HXO A;  1HOM A;  4DYQ A;  2DTZ A;  2XB0 X;  4JX4 A;  2EBI A;  2VKV A;  3FK7 A;  2DJN A;  3IH2 A;  3GTL J;  1MH3 A;  3B6C A;  1FEX A;  3QPL A;  3S15 J;  2CRG A;  2ZB9 A;  4RBO A;  2NVX J;  2DA2 A;  5FKM A;  1T33 A;  3TED A;  3ZQI A;  3TP0 A;  1RR7 A;  2R5Y B;  3MN2 A;  1P7I A;  1A5J A;  3IV5 A;  1IG7 A;  5F0F A;  4XRS A;  5GPC A;  1WI3 A;  2ELK A;  4B4C A;  4V2F A;  3RKQ A;  1POG A;  1VFC A;  2DA6 A;  4G12 A;  5EF6 A;  2DA1 A;  3CDL A;  1FIP A;  3UKG A;  4LOC A;  1MBG A;  4FIS A;  1RKT A;  2HOA A;  1FTT A;  1R9T J;  2JN6 A;  2VPR A;  1JKP C;  2NVT J;  2ME0 A;  5JLW A;  3LOC A;  1CQT A;  4B1R A;  2W48 A;  2GM4 A;  2FJ1 A;  2NOG A;  2Y31 A;  1H8A C;  2LFB A;  2M8G X;  9ANT A;  1ZR4 A;  1MSE C;  2L7M P;  1MBF A;  5IYD J;  2FQ4 A;  2LTP A;  3LSJ A;  3OOU A;  3MVP A;  1BJZ A;  3CCY A;  2TRT A;  3FKI J;  5EZH A;  2ECB A;  4X6A J;  3FIW A;  2K9Q A;  3S17 J;  1UG2 A;  3B6A A;  1EF4 A;  2JA8 J;  3MKL A;  2K40 A;  2CJJ A;  3HM5 A;  2G0E A;  5FKK A;  5EG0 B;  1AKH A;  2R92 J;  1JT0 A;  3HOX J;  2DA5 A;  5E3N A;  3HOU J;  4J19 A;  2HI3 A;  4JP0 A;  1AKH B;  5E3M A;  3BTJ A;  5EGO B;  1GT0 C;  4JX6 A;  4I6Z A;  1FIA A;  4BXX J;  5FKO A;  3S1M J;  2M0C A;  2Y30 A;  2LY9 A;  5K7F A;  3HGG A;  3PM1 A;  1Z77 A;  2O7O A;  1U8B A;  3BR6 A;  3D1N I;  3SFI A;  1PUF B;  4DZP A;  3JRA A;  4FCY A;  1P7J A;  4CYC A;  2XPW A;  2E19 A;  2JJ7 A;  2ID3 A;  1RPW A;  4NDL A;  3HOV J;  3RQI A;  4CYC B;  1BA5 A;  1ETV A;  1I3Q J;  2EZL A;  2DMQ A;  3GTJ J;  3H0G J;  3BTI A;  4BKX A;  1IDY A;  2HDD A;  2JWT A;  4Y52 J;  1ZKG A;  1JKR C;  1OJL A;  5E3L A;  1IC8 A;  3Q0U A;  2LK2 A;  4MO7 A;  1IJW C;  3JRH A;  1IRZ A;  5IP6 A;  2CQQ A;  1QVU A;  2HOS A;  3K7A J;  1LE8 B;  4D5F A;  5M3M J;  4BBS J;  3BQZ A;  3HEF A;  1H88 C;  1WH7 A;  1WH5 A;  2DA3 A;  3DCF A;  4FTH A;  1TC3 C;  2XGC A;  2LD5 A;  4IHW A;  5HOD A;  2E2I J;  1IGN A;  3HOW J;  4GFB A;  4A3I J;  3NAU A;  3BR2 A;  4QTR A;  3ZQC A;  1IDZ A;  3A02 A;  5J1Y A;  3RZO J;  1I6H J;  4A3M J;  1ETQ A;  5F08 A;  2JK3 A;  1APL C;  2R5Y A;  2JMW A;  1RES A;  3BR0 A;  2R5Z A;  1HCR A;  1FTZ A;  3GBG A;  3HOZ J;  5C4J J;  3BG5 A;  2R0Q C;  3A03 A;  2R5Z B;  1U78 A;  4Y7N J;  2ME6 A;  4DZJ A;  1HF0 A;  1XG1 A;  5IP9 J;  4A3L J;  2XGE A;  2B63 J;  5F04 A;  3GTQ J;  5F0C A;  5IP7 J;  1S7E A;  3HKZ N;  5FLV A;  4M3D A;  1XC5 A;  1SFO J;  4A3C J;  1I50 J;  3CQZ J;  2QCO A;  1JTY A;  1JTX A;  2KT0 A;  2WAQ N;  4IHX A;  2NS8 A;  4A3K J;  4W97 A;  5J1R A;  2YUS A;  1OFC X;  4FE7 A;  2PMZ N;  3S1Q J;  3ZQL A;  5C3E J;  1NK3 P;  2E2H J;  4IEJ A;  3JRB A;  1HLV A;  1NTC A;  2I10 A;  1D5Y A;  1X2M A;  3O8H A;  1BL0 A;  4QSH A;  2VI6 A;  2NS7 A;  2DMP A;  4A3D J;  3LSP A;  1UHS A;  3ZQG A;  1XS9 A;  1DU0 A;  3H3V K;  1VI0 A;  3M4O J;  5EG0 A;  2P81 A;  4B3A A;  4A3E J;  2JA5 J;  2D5V A;  1ETW A;  2GLO A;  3K2A A;  1X58 A;  5IOZ A;  4AYB N;  5EGO A;  1MBJ A;  2EZI A;  4A93 J;  2MSY A;  2Y0S N;  1F36 A;  4A3F J;  3GTM J;  1LFB A;  5EEA A;  3M3Y J;  3W6V A;  2RAE A;  3GTK J;  5IPA A;  3OSG A;  2DA7 A;  4DW6 A;  2XRL A;  2DMN A;  1B72 A;  1U9N A;  3JRC A;  2AO9 A;  2GBY A;  3BG9 A;  1ENH A;  1Y1V J;  3G1O A;  4M3E A;  1B72 B;  1E3O C;  5FKN A;  1PUF A;  3HGY A;  4C3I J;  3PO2 J;  3HBL A;  3LSG A;  4D7M A;  3BTC A;  1B8I A;  1ORK A;  2Y2Z A;  2R7Z J;  1T56 A;  3OSF A;  2OF7 A;  2R93 J;  2LVS A;  2WV1 A;  3Q3S A;  1B8I B;  1SAN A;  3S14 J;  4HNV A;  1DU6 A;  1TWG J;  2CUE A;  3G1M A;  5EZG A;  4DYR A;  4AC0 A;  2DA4 A;  3OIO A;  1LE8 A;  4RDU A;  2YS9 A;  5EYR A;  4A3G J;  2E1O A;  1O4X A;  2JA6 J;  5J3L A;  4M3G A;  5FJ8 J;  2VKE A;  5IYC J;  5M5W J;  1JGG A;  1HDD C;  2XPU A;  2XSD C;  5BNG A;  2LP0 A;  1GUU A;  4D7N A;  2E2J J;  3ZQF A;  3LSR A;  2L7Z A;  4XRS G;  1ITY A;  2MG4 A;  2H8R A;  5DTD A;  3BR3 A;  5M5X J;  3C2B A;  3G1L A;  2XPV A;  1GDT A;  1RET A;  3QQA A;  3CMY A;  4IHY A;  3BT9 A;  2HYJ A;  2LKX A;  2COB A;  4V2G A;  1VF9 A;  2X9D A;  3PO3 J;  3JRG A;  1ETK A;  1MSF C;  2H1K A;  5IOY A;  3S2H J;  2EZK A;  1ETX A;  5F0H A;  3HOY J;  3FIS A;  1MBH A;  1H89 C;  1K83 J;  4JX5 A;  5F27 A;  1Y1W J;  4AUX A;  2XGD A;  1AU7 A;  3I4M J;  1QRY A;  5J1U A;  2AHQ A;  2FX0 A;  1F43 A;  5FLM J;  3Q0W A;  3GTG J;  4M3B A;  2DN0 A;  5K7Z A;  1ZR2 A;  3BTL A;  4S0H B;  1ZGW A;  3VPR A;  1WGX A;  3JRI A;  5C44 J;  2CU7 A;  3DEW A;  3F0C A;  3TP3 A;  4C3H J;  4C2M J;  1MBK A;  1TWF J;  2L0K A;  2YU9 J;  4QIW N;  1A6I A;  2IBD A;  3I4N J;  4W1U A;  2MGQ A;  3IH4 A;  2HQ5 A;  2IAI A;  4M3F A;  3BR1 A;  2XB5 A;  1X2N A;  5FKL A;  1OCT C;  2Y9Y A;  5IYB J;  3HB9 A;  1UMQ A;  1ZTR A;  1W0U A;  2WB1 N;  2K9N A;  4BY7 J;  2IEK A;  4XK4 A;  4EEF G;  1MBE A;  1Z0X A;  1NK2 P;  1JUM A;  4IHV A;  3RZD J;  2NVY J;  4MLO A;  5GP9 A;  3JRE A;  2L7F P;  3HDD A;  3SDG A;  5EDN A;  1JKQ C;  2EH3 A;  4FE4 A;  1HDP A;  2EZH A;  2X6O A;  4MIM A;  4MFD A;  4ABZ A;  4A3J J;  1RKW A;  3Q0V A;  2DMU A;  1VND A;  4X1E A;  2ID6 A;  2NVQ J;  5M3F J;  1BW6 A;  4UUT A;  1QPI A;  4DYC A;  3S16 J;  2VUM J;  1LFU P;  2KDZ A;  1JUS A;  3A01 A;  1IV6 A;  2N8G A;  3ZQH A;  3S1R J;  3SJM A;  3BR5 A;  1U9O A;  5F1J A;  1W0T A;  3A01 B;  2DMT A;  3NAR A;  5C4X J;  3BQY A;  1K61 A;  2QF7 A;  2O8K A;  2HXI A;  1AHD P;  1GV5 A;  2ECC A;  5DS9 A;  1QVT A;  4L5E A;  4A69 C;  4BBR J;  2M2E A;  4MFE A;  1Q1V A;  2EQR A;  1ETO A;  1TWH J;  4C3J J;  5M5Y J;  4BY1 J;  5GPA A;  2OPT A;  1OCP A;  3E7L A;  4M6V A;  1GVD A;  2LLK A;  3L1P A;  3O8G A;  3JRF A;  1JJ6 C;  1ZK8 A;  1ZQ3 P;  1MNM C;  3JR9 A;  1FJL A;  4XIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...