5EF6A

Structure of hoxb13 complex with methylated dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
61
structure length
61
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Homeobox protein Hox-B13
publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 61
sequence length 61
chains with identical sequence B, G, J
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ef6A00
1JJ6C 3S2DJ 3IV5A 4D7MA 2KT0A 2O7OA 2WB1N 2O9LA 2X6OA 5F0FA 2M8GX 1UG2A 3BR2A 1WH5A 4FE4A 1JT0A 2Y9YA 3HKZN 4MLOA 2Y31A 1H89C 1ETQA 2ELKA 4M3BA 1NK3P 3BR3A 1IG7A 2XSDC 2KDZA 4EEFG 5EG0B 1ZQ3P 1Y1WJ 1K83J 3A02A 5C4JJ 4XK4A 2FJ1A 2RAEA 3BR6A 3Q0WA 4MO7A 2HDDA 2WV1A 1IDZA 3A01A 1Z0XA 1MBKA 4L5EA 3GTQJ 3WHCA 4M3DA 3TW7A 1ZTRA 3GTGJ 4BBRJ 2DA5A 1FEXA 3HDDA 1SANA 3GTLJ 3BTLA 1GV2A 1D5YA 3BR5A 4XRSA 1TWAJ 2L7ZA 2DMNA 2R5ZB 4QIWN 1GUUA 2JA5J 5E3NA 1ETYA 3TW6A 2VKVA 3JRHA 5FKOA 3NAUA 3JREA 1ZKGA 5GP9A 2HXIA 4IHXA 2EZLA 4XICA 1APLC 2HOTA 1ORKA 4W97A 5EZHA 1AKHA 5EZGA 1ETKA 4FCYA 3TP0A 3GTMJ 2QCOA 1VI0A 1R9TJ 3IH2A 1Q1VA 3S17J 1QRYA 4BY7J 2O8KA 5C44J 4DZPA 1TWGJ 1WGXA 2EH3A 3BG5A 3BG9A 2HOSA 5FLVA 4Y7NJ 2NOGA 2LKXA 2XB5A 4NDLA 1ETVA 4X1EA 4D5FA 1OFCX 3E7LA 2P81A 1XG1A 3PM1A 1A5JA 2Y2ZA 4M3EA 2NS8A 1MBFA 1WI3A 2CRGA 5F04A 1JKPC 1IC8A 2TCTA 2XB0X 5C3EJ 1JKRC 4XRMA 2M9HA 2B63J 2LY9A 1BW5A 2WAQN 1MBHA 1JKQC 4C2MJ 2NS7A 3S1RJ 2XGEA 3K7AJ 4IHVA 2E1OA 1IV6A 5GPAA 5EG0A 3Q0VA 2R7ZJ 2FD5A 4Y52J 3JR9A 1JJ8C 1MNMC 3FISA 1RESA 2R92J 1B8IB 1LE8B 3FIWA 3RQIA 1ETWA 2R93J 5EGOB 5FKMA 4BKXA 5JLXA 1Y1VJ 3D1NI 2TRTA 4IEJA 3LSGA 2XRLA 1WCMJ 3BTIA 5IYBJ 3S14J 2LTPA 1RR7A 4BY1J 1RKWA 3M3YJ 2E2IJ 1JT6A 2R5ZA 1XC5A 2ME6A 5F08A 2ID6A 1F43A 2AO9A 2IEKA 1LFUP 1GT0C 1JKOC 5EF6A 3HM5A 5IP9J 3H3VK 4ABZA 2G0EA 4RDUA 5FJ8J 3TP3A 4I6ZA 2JMWA 1ZGWA 1F36A 1JTXA 1XS9A 3CDLA 1MH3A 1I3QJ 3TEDA 1E3OC 3S1MJ 2AHQA 3DEWA 2YU9J 5EYRA 2EZIA 1ETXA 1GDTA 2LFBA 1I50J 2DN0A 2MG4A 1T56A 2N8GA 1AU7A 3GTOJ 2QF7A 1SFOJ 3B6CA 4J19A 4A3LJ 3ZQIA 1DU6A 3FK7A 2FQ4A 2YUSA 4B4CA 5GPCA 5K7HA 3LSRA 3RZDJ 4FISA 2DJNA 5IYCJ 2W48A 1OJLA 4DYRA 4JYKA 5FKLA 1GVDA 2EZKA 2E2JJ 4QSHA 2EQRA 4A3FJ 2JA7J 2HYJA 3BQYA 3S16J 3JRAA 3QPLA 4MFDA 1IRZA 4A3KJ 2ECCA 4UUTA 1RETA 3FK6A 3A03A 1W0TA 1B8IA 4IHWA 3SDGA 2DA3A 3NARA 4MIMA 5EGOA 2L0KA 4BBSJ 4MFEA 3QPSA 3G1LA 2JWTA 5EDNA 2NVQJ 5F1JA 3S1QJ 1A6IA 2I10A 5M5WJ 1ZK8A 2PMZN 4A3DJ 5K7ZA 2COBA 4A69C 3LSJA 3O8HA 4D5CA 1OCPA 1JUSA 1AHDP 2LK2A 3RKQA 1HCRA 3W6VA 1JTYA 3MVPA 5FLMJ 1P7IA 4JP0A 4B1RA 1NK2P 2CUFA 5FKNA 5M3FJ 4C3JJ 5E3MA 3FKIJ 1X2NA 1U8BA 3HGGA 2K9SA 4JX4A 1DU0A 1ENHA 2K9NA 2JN6A 4LOCA 3SFIA 3JRCA 3OSGA 3K2AA 2XPWA 3HOVJ 5M5XJ 2LLKA 3HOUJ 1W0UA 3ZQCA 2OPTA 3JRBA 1IUFA 3PO3J 3L1PA 2X48A 1HOMA 4FTHA 1O4XA 1X2MA 4V2GA 2JJ7A 5C4XJ 3CCYA 1QPIA 1OCTC 3LOCA 2CU7A 1JUMA 4G12A 3OIOA 3ZQLA 2ZB9A 2DA2A 4CYCB 2DMTA 2DTZA 1PUFB 3IH3A 4AYBN 2LP0A 1YRNB 3BR1A 3I4NJ 1BJZA 2ME0A 2MW8A 5DS9A 2HOAA 1B72B 1HDDC 4A3BJ 2CQXA 1QVTA 1U9NA 3BQZA 1UMQA 3BTJA 1UHSA 2HI3A 4D7NA 3JRDA 2FX0A 4DYQA 2K9QA 4A93J 2XPUA 3ZQHA 3LSPA 1TWFJ 1MBEA 5HODA 1VFCA 2M2EA 3BG3A 3C2BA 4DYCA 2DMUA 2VUMJ 1U9OA 2H1KA 2Y0SN 3CMYA 5M3MJ 3BR0A 2VPRA 2GLOA 2IAIA 3LNQA 4XIDA 3H0GJ 3BTCA 3DCFA 1QVUA 3S15J 2DA6A 5DTDA 5IP7J 3B6AA 2ECBA 2OF7A 1JGGA 5F27A 1TC3C 2JA8J 2GBYA 2ID3A 3GTJJ 1MSEC 3UKGA 1IJWC 2CJJA 1POGA 3HOYJ 3QQAA 1IDYA 5F0CA 2R0QC 3MN2A 3ZQGA 4A3MJ 2Y9ZA 1GV5A 3IH4A 4X6AJ 1HDPA 3OSFA 2EBIA 3JRFA 4JX5A 5IP6A 2Y30A 1FIAA 1RKTA 3JRIA 3RZOJ 1WPKA 1H8AC 1VF9A 3GBGA 1FIPA 2R5YB 4JX6A 4XRSG 3JRGA 2JK3A 4UUSB 4A3IJ 5IOYA 3HOWJ 4S0HB 2VKEA 2CQQA 1X58A 3G1OA 1LE8A 5K7FA 2NVXJ 2XPVA 3OOUA 1ETOA 2MSYA 3HBLA 3WHBA 3BT9A 4I76A 4A3CJ 4QTRA 5EEAA 4CYCA 2D5VA 2YS9A 1ITYA 2XGDA 2K40A 3ZOBA 4AUXA 1PUFA 3S1NJ 1MBGA 1YRNA 1LFBA 5IOZA 4IHYA 1B72A 3GTKJ 1I6HJ 3Q0UA 2L9RA 3G1MA 2MGQA 4A3EJ 1MBJA 2E19A 1EF4A 2GM4A 3SJMA 2LD5A 1IGNA 3HEFA 3O8GA 4FE7A 2XGCA 4M6VA 5J3LA 5JLWA 1T33A 4RBOA 5J1RA 2VI6A 5IYDJ 4AC0A 3PO2J 4A3GJ 4C3IJ 1NTCA 4W1UA 3CQZJ 1S7EA 2LR8A 1Z77A 1MSFC 4GFBA 1TWCJ 2DMQA 2CUEA 3HGYA 4HNVA 2LVSA 1MH4A 1CQTA 5IPAA 1P7JA 2NVTJ 1ZR2A 1WH7A 3MKLA 5J1UA 2JA6J 2DA1A 1G2HA 3I4MJ 3A01B 3GTPJ 3HOZJ 1RPWA 3M4OJ 3HB9A 1ZR4A 1FJLA 1BW6A 4B3AA 1FTTA 3S2HJ 5E3OA 2HQ5A 2DA7A 3ZQFA 5J1YA 5BNGA 1HLVA 5FKKA 2M34A 1K61A 1FTZA 1H88C 1JUPA 1VNDA 2DA4A 3HOXJ 3F0CA 5M5YJ 4V2FA 3Q3SA 2H8RA 2HXOA 3VPRA 1HF0A 1AKHB 2DMPA 4A3JJ 4DZJA 2R5YA 2NVYJ 4UUSA 2E2HJ 1BA5A 2IBDA 2L7FP 4M3FA 1BL0A 5E3LA 4C3HJ 4DW6A 4BXXJ 2EZHA 2X9DA 5F0HA 2L7MP 1TWHJ 9ANTA 1U78A 2M0CA 4M3GA
chains in the Genus database with same CATH superfamily
1JJ6C 4PSXA 3IV5A 5LRSA 1KU7A 2UV1A 2KT0A 4ZYAA 1RRJA 1SD4A 2WB1N 4I0BA 1EJ9A 1T08B 2A6HF 2PFBA 2QYOA 1UG0A 3FMSA 3K4CA 4EM1A 4NQWA 3HTSB 2QWWA 2VT2A 2M8GX 1UG2A 2DFIA 3BR2A 1TNSA 4FE4A 1JT0A 2LBFA 2Y9YA 1TBXA 1ZH5A 4EMSA 3BG7A 2ELKA 5K5OA 1NK3P 3CCSI 3BR3A 1VQ5I 1G6NA 3ZMVA 3LWFA 3M8EA 1WVRA 4HOBA 1TW3A 1YLFA 4BQNA 4HZFA 1R1TA 3TO7A 3A02A 4HV6A 4Y3OA 3K70D 2FNAA 2W84A 3BR6A 4MO7A 3CJNA 3HSRA 1TNTA 5KAIC 3A01A 3H0DA 5E1ZB 1VZ0A 3TDUC 1Z21A 5EJCA 3RKWA 4GXOA 4EM2A 1R36A 3F8BA 1ZTRA 1GLNA 2DA5A 3G2BA 1F5TA 3HTUA 3H35A 3GTLJ 4LG0A 3VOEA 5J4VA 1GV2A 5L3CA 3R4KA 1T0FC 2M7BA 3ML6A 2ACJA 2A5YB 2HTSA 1W7PB 3BZKA 5BMZA 2H1LA 3K6GA 3PQKA 2R5ZB 4DNCA 5DCFA 2G7UA 5E3NA 1ETYA 1S7AA 2AQEA 4M9XA 4I7HA 5FKOA 5ICGA 1WWXA 3GCMA 3Q9SA 1ZKGA 1LKXA 2LDUA 2IS1A 1LDDA 3K0LA 2QSHX 1MNEA 1EH7A 3WG9A 1G3WA 4BL0B 3ELKA 2L54A 3GTMJ 2QCOA 3A1YA 2IRFG 5LLQA 1M1EB 1G59A 4DZPA 3BLYA 3DKXA 2LYCA 1NG6A 3BG5A 1KGSA 3BG9A 2FOKA 5AIPA 4BE2A 1TTYA 2LOOA 4X1EA 2R7SA 4KFCA 1LDJA 3JTHA 3E7LA 1SFKA 1X3WB 3RYPA 2HVQA 3PM1A 4FASD 2DK8A 3CCUI 3CP8A 3WODF 1XGNA 1IXCA 1H9GA 3OYGA 2BXZA 3CUQB 4E7HA 1WI3A 2PMHA 2VXZA 2KKOA 5F04A 3TO9A 1JKPC 1IC8A 5C3EJ 1R1VA 3HIFA 2FNPA 1JKRC 4L5IA 2LY9A 5D8LB 3CUQC 2OTJI 4GYGA 1MBHA 3G4SI 2VLAA 1SD5A 3KP7A 3ONQA 2E1OA 2LSOA 4M73A 1IN5A 3E3VA 2FD5A 3H9QA 4EQQA 2EFWA 3CCJI 2XGXA 1RESA 3CCEI 1B8IB 2F6CA 1XGMA 1JI8A 1FP1D 1LE8B 3FIWA 2EJRA 2CFOA 2L7KA 3H5NA 2ZXHA 1PUEE 2IJLA 3EETA 2STWA 2XF5A 4KICA 3D1NI 3KETA 4IX7A 1CF7A 3A0BC 1Y0NA 4IEJA 3LSGA 4XN0A 2IA0A 4ZYDA 1WCMJ 2Z99A 3LA7A 1TQMA 5IY5H 3K1PA 2Q2EA 5HLTA 1BOAA 5CVRA 4UB6C 3BC8A 2W57A 5CLSA 1ZAOA 3W6KB 2EWNA 3FX3A 1F43A 2IEKA 4WXDA 3ABUA 5GAGJ 1P9QC 4DIQA 1SVLA 2FMLA 4L9NA 2E1NA 3BJ6A 3EPZA 2HWVA 4II3A 2DXIA 1W1WE 2IW5A 4ZDOA 2AXLA 2CS3A 3QODA 5D6EA 5FJ8J 1O3RA 2IA1A 2JMWA 4UHTA 3W2WA 4G8XA 1OPCA 2JSCA 3CDLA 2DOEA 3L00A 1MH3A 1I3QJ 3V8JA 2FEZA 4BQAA 4G7OF 3IWZA 2QKMB 3DEWA 2F4OB 1D1CA 4HPQA 2OTLI 4F55A 2E5ZA 1GDTA 2XASA 4IQJA 2LFBA 2DN0A 2MG4A 2V9VA 2Z2SB 3K4MA 4J19A 4A3LJ 3E6BA 1T95A 4C30A 1V55H 2FQ4A 2MLKA 2YUSA 3CUOA 2BXYA 1X4OA 4EJOA 5IYCJ 2K5CA 4EVIA 3QU3A 2WAFA 3H3ZA 4WWCA 4LK0F 4JYKA 5FKLA 3I59A 3RTRA 1YX5A 3QPTA 5B1AH 1XGSA 1X19A 2E5NA 1C0WA 5D5UB 4OIQF 4F91B 2QEXI 3FHZA 4QSHA 4A3FJ 2IP2A 1IO2A 3WGHA 3BQYA 4G94A 2IGMA 2GOMA 2L4AA 4A3KJ 5DDGA 2Z5UA 3K1NA 1J59A 3TQNA 2HZTA 2XAFA 4IKFA 1W0TA 1U5TB 3H1CA 3PFIA 3KYCB 3DU5A 3KIOA 2IT0A 3SDGA 2KQRA 2E34A 3DBRB 5J40A 4PGGA 4MIMA 4MHGA 4HNTA 2XKPA 1U5TC 2P8TA 4MTDA 3BG6A 5LGNA 2EV0A 1G3TA 3KFWX 2UZKA 3QRFF 2ELHA 1BBYA 4RGSA 3BP8A 5EDNA 4PZJA 1V5EA 4P55A 2HZDA 1ZK8A 1BN5A 3C2GA 3PUBA 1MMAA 4L0ZB 3LSJA 3O8HA 3IP4B 4ON0A 1JUSA 1XB4A 2PX9A 3BWGA 5DUKA 1LUJB 5EEGA 4XOTA 3RKQA 1J09A 3ZGKA 1P7IA 4JP0A 2WWYA 5HS7A 3HL2A 5FKNA 2F4IA 2K85A 1SAUA 2Z3YA 3C3WA 3ZRGA 4AVPA 1MDMB 1DPRA 3ABKH 1BI2A 3HGGA 2K9SA 2RDPA 3OR1C 4RM3A 4RB3C 4YEJA 4L9JA 1E3HA 1ENHA 2K9NA 2JN6A 3SFIA 3JRCA 2XPWA 1YO5C 1FMWA 4HSRA 4EM0B 2M0MA 5M5XJ 5HDNA 3HOUJ 3FBNB 3SZPA 4P96A 3ULQB 4FX4A 1JHHA 2A07F 3AFHA 2DPUA 2M1BA 3CCYA 2RKHA 1UHWA 4KISA 3LOCA 2V26A 1X1CA 4DOZA 1YJWI 4B8XA 3ZQLA 1D1AA 1F1ZA 4X0GA 4EGYA 4LJZF 2CQNA 1YRNB 1HW2A 4NHJA 2MC3A 3BR1A 4CH7A 3VYUB 2MW8A 2KIQA 2QVOA 3KP6A 5DS9A 3R61A 2CQXA 5KHDA 1ACIA 1W7PA 3BTJA 2J5PA 3I4PA 1FYLA 3JRDA 2FX0A 2R7XA 4KN7X 4NC7A 4A93J 5J47A 1VQNI 1P92A 2CG4A 3ZQHA 3COAC 1W36D 5H2FC 4IJAA 2GA2A 2X6YA 3I71A 4D0PA 2M2EA 2F5EA 2XUBA 5TRDA 4DYCA 1TZLA 3SZTA 3OYMA 2DQLA 1QZEA 1B9NA 2H1KA 3ISPA 3FKJA 1T98A 3S3NA 1YOVB 3CMYA 1RC9A 2QQBA 2GLOA 3H5AA 4XIDA 3HRMA 3H0GJ 5GAEJ 3DCFA 1YS7A 2VJJA 2PJRA 2LKPA 2YX7A 3LSMA 4PFOA 3FM3A 1TC3C 2GBYA 2ID3A 5D4RA 1KA8A 3DXJF 3GTJJ 3K1MA 3QQAA 3K10A 4UV9A 1IDYA 3KP5A 5JI6A 2R0QC 4YFKF 1IV8A 2ISZA 3WTZA 1HC8A 3CD6I 3W6JB 1ERDA 4PJJA 3CCMI 4A0XA 4MQVA 5E8IA 3IH4A 4X6AJ 2ISYA 2EBIA 2PQ8A 4XNFA 3JRFA 1FBQA 2VBYA 3GYHX 3A2KA 1FPQA 1H8AC 3WU2C 1ZGJA 3V42A 2DDBA 2VOOA 4QWQA 3IL2A 1FIPA 2VASA 1VQPI 4UUSB 2IS2A 1SD7A 5DUIA 2BGCA 3HOWJ 1I5ZA 3IAM2 4I02A 1X58A 4G9YA 1LE8A 2ZBKA 2QBYB 4II2A 4CCKA 3ZR8X 4WK8F 2XPVA 4E70A 5ICEA 1ETOA 2BOLA 4GYIA 2D5VA 4CYCA 1T8IA 2YS9A 1A04A 2XGDA 2K40A 4AUXA 4G6DA 1BR1A 3OMYA 3ESWB 3DBHB 1E17A 2NNYA 4XLNF 4PUSA 3Q0UA 1OKRA 4NQWB 2MGQA 4DBRA 1XDUA 3F23A 4GRIA 4PFPA 2LD5A 2V4JC 5D5WB 3HEFA 1UB9A 3BPXA 2LBFB 2RQPA 4RBOA 3GZNB 3NQOA 4IRHA 2VQLA 3KEQA 4AWXB 2V1UA 3JW4A 3KX2A 1MW7A 2VBZA 3ECOA 2RC4A 5ICCA 1OQYA 1S7EA 2EK5A 1RIOH 3DEEA 1TWCJ 4OIPF 3HGYA 1QGPA 3SXYA 2ESHA 2LVSA 1MH4A 1K7AA 2CYYA 2OC6A 3MKLA 4WF2A 5J1UA 4F52A 4L0YB 3I4MJ 3A01B 3FMQA 4HYEA 3M4OJ 1EV7A 1KZHA 3K4LA 4ENNA 1R5GA 2E36A 1ZR4A 5F6FA 1FTTA 2Q0OA 3MWMA 4LG0B 2C6YA 3I53A 4KT6A 2V1DA 5J1YA 2FSWA 2CQ7A 4Z2YA 3SFZA 1BR2A 3KEYA 3KLOA 3AG1H 1H88C 3BZ6A 1ZN2A 1HKQA 1VNDA 1YJ9I 3W2AA 1GVJA 5M5YJ 4V2FA 4XM3A 2H8RA 2HXOA 2CUJA 1KYWA 2OBPA 2VODA 3OYFA 2DMPA 3KZZA 3QWLA 2W82A 5TJJA 2O5RA 4UXNA 1XCVA 2HQRA 3OWTA 2OU2A 4OINF 2R5YA 3S3OA 1JE8A 4M9SA 2NVYJ 1BA5A 2E2HJ 1IN4A 4DW6A 2HVRA 4XKWA 5DM7F 2X9DA 1IXSB 1TWHJ 1J2XA 2CQKA 3DWLE 1U78A 3S2DJ 2ADUA 3GFLA 2O7OA 4A2UA 3W3CA 2EINH 3CTAA 2O9LA 2YX4A 3DPLC 2HPMA 1XTAA 2MFZA 1WHUA 4RLFA 4EATA 3LFKA 2JRMA 2KLOA 1XMAA 1T6SA 1FZPB 1TP4A 1H89C 4IRIA 4M3BA 1IG7A 3RYRA 4EEFG 4PJMA 4WCGA 1ZQ3P 3IRQA 1O3SA 4PCQA 2M3AA 1Y1WJ 1YW9A 4LGWA 2HGCA 3GFJA 3OYBA 1R5ID 4PGHA 4MQ9F 4XK4A 4BU2A 2RAEA 2HDDA 4KDPA 1R23A 2KISA 1IDZA 2FQ3A 3GTQJ 2H8WA 2V7FA 1SD6A 3LSHA 5FFXA 3WHCA 4M3DA 1BM9A 1T2KA 3GTGJ 1FEXA 1RR8C 4FT8A 2EILH 2XHKA 3GLXA 4XSXF 1OISA 3BR5A 5CPRB 3CCVI 3AG2H 4XLAA 3AG4H 1FOYA 3MAJA 3OV8A 5CVVA 2Q2EB 1VQ9I 4LMYA 4H0EA 4BHCA 5L3DA 4AIKA 1GUUA 4XR6A 2HTJA 3JRHA 4KIBA 1ZGAA 1SFUA 3NAUA 4PK4A 5GP9A 2M45A 2V1XA 3ZMZA 4XICA 2HOTA 4XMYA 4XBFA 2K9MA 2JA2A 3LL7A 5EZHA 3E97A 3WU0A 5EZGA 1ETKA 4FCYA 1HBXG 3TP0A 3TKYA 2IS6A 1VI0A 4YIIA 4LK1F 4B3XA 1Q1VA 1REPC 1W4MA 3ZN0A 4BDZA 1G4DA 4Y7NJ 2CW8A 4LIVA 2NOGA 4YIFA 2LKXA 2XB5A 4GDFA 1J7KA 2BBYA 4OAZA 1ETVA 3IKVA 4JBAA 4JOMA 3B73A 1VQ6I 2ZMEB 4BH9A 4NUBA 1XG1A 2K86A 2QM3A 2ZFWA 1QHHD 3RKYA 1N78A 4G7ZF 2V9PA 3P7NA 5F64A 3QPHA 2NS8A 3S8PA 4JQFA 5DM6F 1MBFA 2CRGA 4CUGA 2BVMA 2XAHA 2CUZA 5KAFC 1FYMA 2DYRH 3I59B 3VEPA 2B63J 2R7VA 1FMVA 4RB0A 4NC8A 5DD4A 2ESNA 2P6TA 1UELB 1B4AA 3MEXA 3S1RJ 3WGGA 1X4PA 2R7ZJ 1WJDA 2DT5A 3PNTA 3JR9A 1O3QA 1J5YA 3DKYA 2OCEA 3FXJA 1S3JA 1JGSA 3CJQB 2R92J 4RAYA 4PJ0C 2DT6A 3T5XA 2VC1A 2MABA 2W1OA 4HSTA 3E5UA 4ZTFA 2DFFA 4CO8A 1ETWA 2VONA 3RPUD 4HA8A 5JLXA 4BKXA 3AL0B 4UY8I 5DCMB 1PDNC 3J7AY 3IAS2 2BZTA 4MEXF 4BXFA 2QBYA 2WAQA 5BPDA 3QAHA 1S72I 2QSGX 1RR7A 3QOEA 1Z6RA 2PJPA 2KIFA 3W2VA 3GX4X 1IXRC 2E2IJ 1JT6A 4H4KC 2R7UA 1XC5A 4M6YA 2FF4A 1T39A 1ZRFA 4CGZA 2VOPA 3J80K 5F08A 1SVMA 2BY1A 5TGTA 1LFUP 3WTUC 3CESA 1WJ5A 2V79A 4N0BA 2R7RA 3EUAA 2K4BA 3ASNH 3H92A 1JKOC 5EF6A 2QKLB 5IP9J 2F5VA 4ABZA 4IHTA 3KP4A 4B47A 1F36A 3VWBA 1XN7A 1MGTA 1GXQA 3FDYA 3M9AA 1WSUA 3FXLA 2Q8KA 3BZCA 1DGRM 1I50J 3RQ4A 3GTOJ 1ZYRF 3B6CA 1DU6A 1UHMA 3JSPA 3FXMA 2DOFA 5LEJA 1LDKB 2IGOA 1XX5A 2DJNA 2R7OA 1QHGA 2BEOA 1OJLA 3M07A 3L9FA 4XSZF 1X3ZB 2EA2A 2HKOA 2KJCA 3CO7C 2NAZA 4BACA 3M1CA 2E2JJ 1DUXC 1KQ8A 4FX0A 4Q4ZF 1IF1A 2HYJA 1I6XA 1WFXA 3QPLA 3OYEA 3JRAA 2ECCA 4UUTA 1RETA 3FK6A 3HHGA 3A03A 2R7FA 1WJEA 2XAUA 3CC2I 1AOYA 1YG2A 3HUGA 4BJTA 1VQ7I 3NARA 2Q1ZB 5D6FA 3CF2A 4MNUA 1YIJI 1XSXA 3F8NA 3IUOA 4HX7A 2OAZA 3G1LA 1WKMA 2KZVA 3S1QJ 2NVQJ 5IT9K 2I10A 5D5XB 2X51A 4G6TB 2PMZN 2F48A 2COBA 2PN6A 4A69C 2PJRB 1ZG3A 5CYVA 3GO5A 4Y13A 3W6VA 1NK2P 4B1RA 3AKZA 2HS5A 2W7NA 2XVCA 1TLHB 4C3JJ 1WI9A 2FUG2 3VYSB 4ESFA 3Q5FA 3J80Z 2OD5A 4NB5A 2X1EA 6PAXA 5CQGA 5H6RA 3DTIA 3MMYB 1HXDA 3K2AA 4U0YA 4HNUA 2E7XA 2UUZA 1LPQA 1HW1A 3HOVJ 4KITB 3X2QH 3DV8A 3PNYA 2OPTA 3VODA 3JRBA 2QZ8A 3WTVC 3ZQCA 2FOWA 2MD5A 1ULYA 2RV8A 2JZYA 3P9KA 2JJ7A 2NRAC 1QPIA 2JPCA 1V3FA 4PJLA 1ODDA 2COMA 2CU7A 3HRSA 4R79A 2LG4A 1DP3A 4CYCB 3OYIA 5JHUA 4BDYA 2XROA 2OQGA 3JSOA 1FOXA 3P9IA 4AYBN 2LP0A 4FHTA 3OYLA 4OMZA 5JVTA 4WX9A 3M7GA 2ME0A 4CZCA 4A3BJ 1O7LA 1QVTA 3BQZA 1UMQA 1WJBA 1UHSA 1XMKA 2HI3A 3CCQI 3WTYC 4D7NA 4BJ6C 4DYQA 2ZKZA 1NH3A 2XIGA 3FXUA 5D8KB 1L3LA 1MMNA 1WQ2A 2GWRA 3OYHA 2WAEA 4YIRX 2XPUA 4C2TA 5FB2A 2DPDA 1ON1A 1TWFJ 1KONA 3M1EA 2H6BA 3E6CC 3M8JA 4XLHA 2TDXA 3KCCA 4YELA 5B5EC 1P4XA 3LSTA 4ZYHA 3E5QA 2L01A 2Y0SN 5J6XA 1Y56A 3D5SC 2DW4A 4IO9F 3VSKA 2IAIA 4O5VA 4J00A 1BI0A 2R7DA 1S9HA 1H9TA 2VT3A 2IXSA 2ZMEA 3LQQA 2F2EA 5DTDA 1YITI 5IT9Z 2VQGA 3CO6C 2LH9A 5CVUA 5F27A 4LB6B 2DTRA 1KU2A 1MSEC 1KQ9A 2F5CA 3BJOA 1YW7A 1KYZA 2NYXA 4AIHA 3HOYJ 4XLFA 1DP7P 2KMUA 3P5JA 5F0CA 4OWRB 2WC2A 3ZQGA 3KEOA 2DLLA 1GV5A 2M8EA 4RS8A 1RKTA 3JRIA 4U7DA 1QNTA 4HQMA 3IC7A 3TO6A 3LAPA 4BGDA 2K02A 1EH6A 3GBGA 2R5YB 4JX6A 3JRGA 5D5VB 5IOYA 4S0HB 2W4SA 3G1OA 4KA4A 5E8GA 4PSWA 1MMSA 5K7FA 2HNHA 2VQCA 4A5MA 3OOUA 1MJ9A 3WHBA 2HEOA 2GIVA 5HNFA 2JTVA 2MLGA 1ITYA 5DCMA 3S1NJ 1D0ZA 1A36A 1BC8C 2KIUA 1LFBA 1UAAA 2CFXA 2LRDA 3OYJA 4IHYA 2OUMA 1B72A 1I6HJ 3ABLH 3CLQA 2BV6A 3TMOA 2L9RA 2CMPA 3G1MA 1Z7LA 2QQAA 1MBJA 5AONA 3T1BA 5F1RA 2DDAA 4E7IA 3FHNA 3KLNA 4M6VA 5J3LA 1T33A 2FBKA 1UJ8A 2LF7A 4C9YA 4UNOA 4AC0A 3G73A 2O03A 3PL8A 5LEKA 4F3QA 1EKEA 1ON2A 1VTNC 2QENA 5DV5A 2X6XA 2ZXJA 4UUVA 3QYFA 4XRFA 4K2EA 5JHFA 4UV8A 4HNVA 2M4GA 1OYYA 2MD0A 5IPAA 2XRNA 1P7JA 1MNDA 2NVTJ 4M6XA 2KFDA 3AAFA 3E5XA 4NC6A 5AIQA 2GQQA 4DQ2A 1RPWA 2ZSIB 3EYIA 3HB9A 1BW6A 3LMMA 4B3AA 4ITVA 4BNCA 2HQ5A 2DA7A 1MKMA 1N75A 1Z3XA 4GGGA 5FKKA 2M34A 1K61A 1FTZA 3CDIA 2ZSHB 4WXHA 4J01A 1X1AA 4B43A 4ZH4F 4KIGA 2HOEA 5H6QA 4ZC3A 4BE0A 3MZYA 1UZCA 1KQ0A 1HF0A 4L18B 1IN8A 3I58A 2JT1A 2XAJA 4U87A 4A3JJ 1HA8A 4DZJA 1A35A 2W24A 3H9JA 2W00A 5FO5A 2NVUB 1K79A 1TL8A 3V8KA 1IW7F 4EJTA 1Z3YA 1WRJA 2L7FP 2EA4A 3OOPA 4M3FA 3O3KA 2LREA 4KN4X 1Y0UA 3QP5A 3IKTA 1P4WA 2OV7A 5F0HA 1S5LC 3A4CA 2VE9A 4IPAA 3QU6A 1RUNA 1YI2I 3PIPF 2V9KA 4D7MA 5B3SH 4EJVA 4S04A 2M30A 3T0YA 3WE2A 4LITA 3CMAI 5GAHJ 3E6DA 2BHYA 3L2UA 2L9VA 2X6OA 5GTHC 2DFEA 5F0FA 1Y6IA 3N05A 1WH5A 4A0ZA 5KVRA 3BJAA 1Z6TA 2VKDA 3BROA 4HDVA 2NOJB 3ZMDA 2VB6A 4MLOA 1GHCA 4UVCA 4XONA 1RZ4A 3L2RA 3HJEA 4M71A 1Q1HA 2KDZA 5K5RA 1MIJA 4HF0A 4ZYEA 4BXUA 5LRRA 2HFHA 3WTSC 3F22A 1YE9A 2PMUA 2ZFUA 1U3EM 2XKOA 1IRFA 2WV0A 3RPQA 5LHIA 3CC4I 2OZUA 5C4JJ 5GADJ 4JK1X 4I99C 3F3XA 2FJ1A 1BIAA 2QGUA 2UXXA 3Q0WA 3V7SA 3PIOF 3ZMTA 2WV1A 4D1QA 3MKYB 3CJRB 2VJ5A 1Z0XA 2H6CA 1MBKA 3FXRA 4MTEA 1J75A 1J9IA 1OR7C 1UFMA 2P5VA 2VIXA 2YR2A 4RLQA 1SANA 4OAYA 4BQOA 1YTYA 2K3PA 3QYBA 2WA0A 3BTLA 1D5YA 4XRSA 4PDKA 3F6OA 1BC7C 4PJNA 4KNYA 2MH2A 2LF8A 1Z91A 4QIWN 1XMXA 2M5WA 3DTKA 3HHHA 4A6EA 3JREA 3CJTB 4U0VA 2HXIA 2FBHA 4IHXA 2CV2A 1Z7UA 5H20A 2X4HA 2KZGA 1ORKA 1AKHA 1XPXA 3SQNA 1SAXA 1R49A 1FT9A 1WJFA 1R9TJ 4HW0A 3RJPA 1ZRCA 2V1NA 2VJ4A 1QRYA 2O8KA 1E0EA 1GXPA 2X1CA 1HKTA 1TWGJ 1WGXA 5HLGA 4A6DA 2PI0A 3ZMUA 2CW7A 1P4AA 3FMRA 4NDLA 3L2VA 1W5CC 4C2UA 2NS0A 2E7WA 2P81A 4F92B 1A31A 2I8DA 1A5JA 4ENKA 4RB2C 3VYRB 1QQIA 4N4OB 4M3EA 5BS6A 1YFHA 3RSNA 2XDVA 1HSTA 5HLIA 5IT3A 4E7JA 3OYAA 5FFZA 1H0MA 5FRMA 5J8CA 3RCOA 4OOIA 3K69A 2NS7A 4C2MJ 4HF1A 2A5WA 4IXAA 1ZELA 2EIJH 1L0OC 2XGEA 5E20A 4IHVA 2BW3B 5EG0A 5FLXK 5KK1A 3OYNA 1JJ8C 1MNMC 2W25A 2GXAA 5ILVA 1I1SA 1DGWY 1ZHFA 4Y17A 4M74A 1YYVA 1ZG5A 2CH0A 3HUGB 4P5OA 1MZBA 2VL8A 4ZYGA 1HKSA 1Z05A 2KDOA 4I98B 5FKMA 1Y1VJ 2RQQA 1BOBA 4ZDPA 2TRTA 5HS9A 1IN7A 3F6VA 2MYSA 1U0JA 3A0HC 3BTIA 4BEHA 3L2CA 1K78A 3C2HA 3S14J 3E0JB 2XAQA 1RKWA 1RUOA 3M3YJ 4KT5C 2XSJC 3FF5A 1B6AA 4N9HA 2ME6A 1E3PA 1UCRA 4U88A 3L2WA 3HRUA 3F8CA 1X1DA 2FA5A 1Z67A 2FU4A 1ZRDA 3PUFA 3ZXSA 1GT0C 1FOKA 2M4KA 3V8LA 3H3VK 3HM5A 3VB2A 1OYIA 4Y15A 2VPLA 4RDUA 4N9IA 4HLYA 3LSKA 3TP3A 4I6ZA 1O7FA 1ZGWA 1JTXA 2L9NA 2KRHA 2Y48A 1FP2A 4IQ4A 5E79C 3LA3A 4AIJA 1E3OC 3S1MJ 1XD7A 1SFXA 2AHQA 4HBLA 4IVNA 2G7HA 2EZIA 3PJRA 2IGKA 2D45A 1T56A 2X6WA 2A61A 2QF7A 2Z33A 1SFOJ 3ZQIA 4CCJA 3FK7A 1IN6A 4B4CA 3V7RA 4F93B 1YJNI 1VQLI 5K7HA 3LSRA 4V19K 3RZDJ 1TT0A 4RAGA 1LJ9A 2W48A 3HKZA 1D3YA 3BOQA 3NEUA 3J7ZI 3DTEA 4FQGA 4DYRA 2QQ9A 1V5FA 4ZZDA 3DLAA 4R8HA 2HYFA 1HW5A 3LSIA 2ZXIA 2O61A 2JA7J 3UNGC 3FZVA 2MA3A 2RREA 3EUHA 4I0AA 4CICA 1XGOA 2O6GE 1SMTA 1IRZA 2P4WA 5LHGA 4XL9A 1R7JA 1OCOH 1VQOI 2R7QA 2BHZA 4IHWA 1N25A 5KCMA 5FLXZ 4RB1A 1DDNA 2PLYA 1J0RA 4RAZA 5EGOA 2EFOA 4BE1A 1R00A 4MFEA 3UR3C 2VC0A 2JWTA 1KU3A 1A6IA 1QPMA 2ELJA 5M5WJ 4A3DJ 5K7ZA 4D5CA 1OCPA 3GWZA 2WADA 1PP8F 1AHDP 2E35A 2RVCA 3MVPA 3H9GA 5FLMJ 4CHUA 2CUFA 4Y4RA 3PSFA 2ZMEC 3U1DA 5M3FJ 3U9GA 4OU0A 2HDWA 3NRVA 5E3MA 3FKIJ 3EYYA 5TISC 5FROA 2D1VA 4E4HA 4AIDA 3B02A 3H5RA 2L4MA 4LOCA 1USSA 3WG7H 4ANJA 3OYDA 2L5QA 4CCNA 2FE3A 3TBIA 2LY1A 2IGNA 1TQIA 4BUPA 4HEA2 1YQAA 3PSIA 2CWEA 1F4KA 5CJ9A 3PO3J 3L1PA 2ZJQF 2X48A 3PNVA 4V2GA 4B44A 4HLXA 1OR7A 1OCTC 4G12A 3HOTA 2XF7A 1CGPA 2DA2A 5BQTA 2DMTA 2DTZA 5L3GA 3MQ0A 2DK5A 2VXDA 3K4JA 3JAMK 4LD5A 3KZYA 1B72B 3KYDB 3AL0C 3GLLA 3DQVC 4XN3A 4S05A 1U9NA 3OY9A 4ZZLA 3OS1A 1WJCA 1IRXA 2V6CA 1T38A 1D8JA 2K9QA 2P7CB 4NBQA 2WTEA 4XKBA 4XKVA 5ED4A 2VQHA 4RGRA 3R6SA 2CV0A 2Z1DA 1ONVA 3HC7A 3LSPA 3EDPA 5HODA 1Y8QB 3F8FA 5HOOA 1VFCA 3MCZA 3CCLI 1BR4A 3R0AA 3TOBA 3KYLA 3C2BA 2HKXA 4RM2A 3HSFA 1ZLJA 3WTTC 2A6TA 2GAUA 4GCVA 4I09A 2LMDA 3TOAA 5HS8A 1TQPA 3GXOA 4O3MA 1A6QA 3DBLB 3ZP5A 1W7PD 2VN2A 4EJWA 4U7BA 2H27A 2VKHA 3BTCA 2EV6A 3HG9A 4EGZA 3S15J 2DA6A 5IP7J 1OLTA 1KU9A 3B6AA 3MZ8A 2OF7A 3LFUA 3P9CA 1JGGA 2EFPA 3I56I 2JA8J 4A12A 2JQ7A 3UKGA 1IJWC 4A0YA 2BVLA 3BCBA 4BAYA 1QO0D 2OA4A 1VQ8I 2Y0MA 2QLZA 3FBIB 4ZTJA 2Y9ZA 3CC7I 1HDPA 3DFGA 3V7CA 2M7AA 2UXNA 3C18A 3SHFA 3TDZC 1LEAA 2Y30A 5IP6A 1FIAA 3RZOJ 1VF9A 1HSJA 2BW3A 2W85A 1RNLA 3I54A 1OMIA 1OYWA 5A2QK 2WBMA 1I1GA 4HF2A 2KIMA 3WE3A 3PQJA 3WTXC 4ESJA 1QBJA 3LQRA 2MSYA 4I76A 4A3CJ 2FMYA 5EEAA 4G6QA 2PEXA 3ASOH 1PUFA 2K4JA 1MBGA 1K6YA 2DJIA 3BY6A 4GO1A 3ZN1A 2ZNYA 3T8RA 4A3EJ 1EF4A 1JHFA 4UVAA 3K70C 3JAMZ 3O8GA 4Q48A 2XGCA 5DYMA 5JLWA 4IRGA 5J1RA 2VI6A 2BYVE 5IYDJ 3PO2J 4A3GJ 1NG7A 1PJRA 2L3DA 2P5LC 3EQLF 4C3IJ 5KNLA 1NTCA 3OIPA 4W1UA 2LR8A 4L5JA 1Z77A 5L3FA 1MSFC 2DO7A 2DMQA 3I55I 1PP7U 2EIKH 3ECHA 3L2QA 3CCRI 2IPQX 1O3TA 1CQTA 2EB7A 1WZ2A 1ZR2A 2JUGA 1WH7A 2GZWA 2DA1A 1G2HA 1TT5B 1SFEA 3HOZJ 1B59A 3U2RA 3GMEA 2HU9A 5LHHA 3S2HJ 1VQ4I 1LNWA 2K9LA 3GFIA 1HLVA 2MC4A 3D0SA 5FGMA 4CCMA 3I9V2 4E7ZA 1JUPA 3I5UA 3NWTA 1R22A 3H36A 1QU3A 2AQFA 3SDBA 1FBSA 5HVQC 3VSLA 4U0WA 2A6EF 2Y69H 5DEQA 4IOCF 1AKHB 1XSVA 3VYTB 1QA6A 4BHPA 3FXQA 2RGVA 3BPVA 2P5KA 5HDGA 4QLCU 1SC7A 2DQRA 3FXKA 3J7AO 4AVZA 1BL0A 5ERIA 5E3LA 1X3UA 4RMNA 4BXXJ 2EZHA 4AD9A 2L7MP 5A2QZ 1B1BA 2HQAA 5LBQA 9ANTA 2M0CA 3OL4A 2DYSH 3E6MA 4CYDA 3N97A 1STZA 4G7HF 4ENMA 2MBFA 4EJUA 2STTA 3IWFA 2ZXWH 4IL6C 3ZQ7A 2OZ6A 4AU7A 1FNNA 5LGUA 2JVHA 1MD0A 2QSFX 3HKZN 3JTGA 2O3FA 4Q47A 2Y31A 1ETQA 2QUFA 4XOPA 1YIOA 2GOXB 2X0LA 2YPRA 3MKZA 1FX7A 4XKCA 2XSDC 3GUDA 3ZQQA 5EG0B 1DQUA 4WXCA 4BJ5C 3KP3A 3HSEA 2XV4S 3EUKL 1FBUA 1S29A 1K83J 2V6EA 1N77A 3DP7A 1I3AA 1YHQI 1K4TA 4RGUA 4QPQA 4N4NB 4L5EA 1O57A 2R4GA 4BHBA 3TL4X 3TW7A 4BBRJ 1ZG1A 3HDDA 5E18F 3C7JA 4NNJA 1FOWA 4BEHB 1LVKA 1K78B 1TWAJ 2L7ZA 3OYCA 2DMNA 1YS6A 3J7YJ 5E1WA 1IUYA 2JA5J 5E1XA 3TW6A 2VKVA 3ZPLA 3T8TA 2DCEA 1D0YA 4B48A 1U2WA 2K27A 2L9SA 2EZLA 2F4MB 1APLC 3RDIA 4ZJZA 4CZZA 4RGXA 3S2WA 4W97A 3F8MA 3MKWB 4XLCA 4DJAA 3K9TA 1QZZA 2XAGA 1FWZA 1OCZH 3IH2A 3RIRA 5LD2C 3S17J 4BY7J 5C44J 4Y33A 5LFAA 2HOSA 2EH3A 2J5OA 4QPOA 5FLVA 2JSPA 3I0TA 5ILSA 4D5FA 1OFCX 4CA0A 2CSOA 2KRCA 5LGTA 2EFQA 3D5RC 3OS0A 4LB5A 2Y2ZA 2DODA 3ABTA 3WGIA 3RPUA 2P6SA 3NWSA 2TCTA 2BY2A 2XB0X 1P6RA 4XRMA 3GEZA 4YFXF 2M9HA 1BW5A 3L7WA 4RA2A 1R58A 1WJAA 2G9WA 2WAQN 1JKQC 3FXOA 3F72A 4XQFA 3OYKA 3K7AJ 1IV6A 5GPAA 2E1MB 5K5QA 3Q0VA 4IF4A 4KYWA 2IS4A 2L2OA 2XC7A 2R7TA 4Y52J 4HV5A 3HPGA 2HQNA 3FISA 1LB2A 2DFHA 2E1MC 1MMDA 3EUHC 4L9VA 4CXFA 1X1PA 3D5LA 3RQIA 3K4NA 2R93J 5EGOB 2E1CA 2FXAA 1T0FA 1E2XA 4AM3A 2D1HA 3O6BB 4I2OA 3F21A 4UVBA 2F5FA 4L9TA 2XRLA 2ZNZA 1ZREA 5IYBJ 3RKXA 2ETHA 2LTPA 5D4SA 4BY1J 3OS2A 4HG2A 1PVEA 2HYGD 4ESBA 2R5ZA 3ROUA 1SMYF 5EEHA 2P7VB 1W5SA 2ID6A 1G3SA 2AO9A 1LEBA 3SEQA 4TV7A 1Y39A 1R5HA 5E17F 5CQEA 1V5GA 2WY8Q 3QOPA 2G0EA 1F9NA 4KUMA 2DT7B 2OJED 2BY0A 3MD2A 1LVAA 2A69F 3DPTA 1XS9A 1I27A 3TEDA 3E1SA 1Z1DA 1SEUA 2YU9J 5EYRA 5BOXA 1FC3A 1ETXA 1S6LA 4ASNA 4BS9A 1BI3A 1R71A 2N8GA 1AU7A 2VJIA 2WB1A 2ZC2A 5BPIA 2RNJA 1FYKA 3CP2A 5GPCA 2CO5A 3HYIA 2JUCA 4FISA 4HX4A 1W36C 3CUQA 2B7EA 3GF2A 2CW0F 3M8FA 2AXTC 3ERMA 5HLHA 2PBIA 4UB8C 4ZDLA 2KRFA 1GVDA 2EZKA 4KMUX 2IVMA 4RAFA 2BE5F 2RN7A 2FRHA 2EQRA 2M87A 4YFNF 1USTA 3S16J 4MFDA 4IOAF 2X1DA 2EIMH 3L09A 3PFYA 2K3FA 4KMFA 4F7ZA 2NNNA 1B8IA 4MEYF 5J4YA 2DA3A 2HPIA 1FSHA 2LKSA 1RI7A 2KJBA 2L0KA 3TGNA 2WY7Q 4BBSJ 1EA3A 1AWCA 3U1KA 3VDXA 3QPSA 3RI4A 1YW8A 1BIBA 5F1JA 2JRTA 4KJZA 4LLGF 4P9UA 2KPMA 1B9MA 5J8FA 2QA4I 3CZ6A 3GZ6A 2B9SA 3S3MA 2LK2A 2B0LA 1HCRA 3AG3H 5B66C 1JTYA 4I01A 3CF5F 4DBQA 2DAOA 1D5VA 3DF8A 1P2FA 2UWMA 1X2NA 4OMYA 2LNBA 3R0JA 1U8BA 2GXBA 2D2WA 4JX4A 3SZGA 2ZJRF 1VQMI 3N4MA 1DU0A 1EH8A 1D1BA 2R3SA 2A68F 3KE2A 3OSGA 2R7WA 4O6JA 2LLKA 2PMZA 2BY3A 1W0UA 2H09A 4LG3A 4LLLA 1YX3A 1IUFA 2DI3A 1X1BA 1HOMA 3DU6A 3F9KA 4FTHA 1O4XA 1X2MA 5C4XJ 3JCUC 2GIZA 5HNHA 3C1DA 4HDUA 1JUMA 3OIOA 2ZB9A 3HOSA 5HDKA 2AS5F 1R6RA 3HZJA 3IH3A 1PUFB 4YG2F 4OIOF 3I4NJ 1BJZA 3OIQA 1HDDC 4M9ZA 2HOAA 3R60A 4EV0A 2CV1A 3QYEA 3BDDA 4FETA 3ERED 1ZLKA 3K2ZA 2KHMA 1I39A 4CCLA 2O8XA 1D0XA 2OCCH 2ZO4A 2VBXA 4IZZA 3LA2A 3REOA 1FY7A 1OCRH 1G3YA 2EV5A 3CMEI 2Y75A 4P9FA 1MBEA 3ZCOA 5ILUA 1U5TA 2XF6A 3G6EI 2F5DA 1PYVA 1FLIA 3BG3A 3OL3A 3KZIC 4AYBA 1U8RA 1XSDA 1SVOA 2DMUA 2K7LA 2VUMJ 1NHAA 3K4KA 1U9OA 3DLLF 1K6OA 1MJAA 2P0WA 1HQCA 4E7KA 5M3MJ 3J81K 3BR0A 2FBIA 2VPRA 4YRVA 3LNQA 1DPUA 1Y8RB 3IRRA 1Z9CA 1QVUA 2H94A 3ZMSA 4R1HA 3WTWC 4A5NA 2Z9OA 2ECBA 5FRNA 2EFNA 1LQ1A 2VBWA 2HDCA 2RNGA 2E71A 1U6GA 2Z16A 5K1YA 4HX8A 3GZ5A 5JFRA 2CJJA 2GXGA 1POGA 1MDMA 5JR3A 2LY2A 2ICWG 2YU3A 2I5UA 3MN2A 2A05A 3VFZA 3V4GA 4E7LA 4A3MJ 1OCCH 4E6KG 3OSFA 3CMMA 5FD5A 2HVSA 3GW2A 3SEZA 2Y0SA 4JX5A 2E60A 1WPKA 2KL4A 1XCBA 4Q5SF 1S8NA 1V54H 2IA2A 3GVAA 5DD8A 4LLNA 4XRSG 2JK3A 4P1WA 4A3IJ 1AA7A 4BQQA 5CVIA 3S32A 2VKEA 2CQQA 1XDSA 1CF7B 3FM5A 3KP2A 3DKWA 2NVXJ 1FSEA 2JPBA 3IHUA 3HBLA 3BT9A 1MMGA 4QTRA 4BYYA 5L3BA 3ZOBA 2HR3A 2ZJ2A 4HAMA 4ETSA 1YRNA 2NXNB 2DU9A 3HXLA 5B1BH 5IOZA 3HRTA 3GTKJ 2OQRA 1W5TA 1R4MB 2EPFA 1R4NB 1BI1A 3BCAA 3WU1B 2E19A 4OIRF 2GM4A 3ABMH 3SJMA 2QQ8A 2KP6A 1IGNA 4FE7A 3Q9VA 3CDHA 4MGRA 1R1UA 1LFPA 1ZARA 4ENJA 3GFMA 4CSWA 2JVGA 1BJAA 2VE8A 1K4SA 3OR2C 4E7SA 5L3EA 3CQZJ 3H3UA 2CGPA 4GFBA 2DOAA 3G3ZA 2CUEA 3O2PE 3DEUA 4M72A 3FWEA 1G8XA 2O0YA 3K4BA 4B09A 2JA6J 3GTPJ 3SYTA 1VQKI 1TW2A 3DPUA 2LC2A 1QZYA 4HQEA 1FJLA 2A3SA 2X85A 5E3OA 4CDGA 3S93A 3ZQFA 3J81Z 5BNGA 4XORA 1IRGA 1V4RA 2GA1A 1MJBA 1JXSA 5CVJA 1S7OA 4D9JA 2DA4A 3HOXJ 3F0CA 5CKTA 3I3LA 3HPHA 4Z6YA 4DGWB 2ZJPF 2L02A 4LIUA 3MZHA 1IAWA 2YSRA 1IZ1A 4HRIA 3LAJA 4XLPF 3Q3SA 3KPHA 5ICFA 5GTIC 3VPRA 3MFKA 4XLEA 4LFUA 3I64A 3G71I 4KIFA 2PG4A 1D8KA 3U21A 5FD6A 4UUSA 2IBDA 5JVGF 3CLOA 4C3HJ 3QP6A 4CCOA 2MH9A 4IHSA 2ZCWA 2DBBA 4M3GA
chains in the Genus database with same CATH topology
1JJ6C 3S2DJ 3IV5A 4D7MA 2KT0A 2O7OA 2WB1N 2O9LA 2X6OA 5F0FA 2M8GX 1UG2A 3BR2A 1WH5A 4FE4A 1JT0A 2Y9YA 3HKZN 4MLOA 2Y31A 1H89C 1ETQA 2ELKA 4M3BA 1NK3P 3BR3A 1IG7A 2XSDC 2KDZA 4EEFG 5EG0B 1ZQ3P 1Y1WJ 1K83J 3A02A 5C4JJ 4XK4A 2FJ1A 2RAEA 3BR6A 3Q0WA 4MO7A 2HDDA 2WV1A 1IDZA 3A01A 1Z0XA 1MBKA 4L5EA 3GTQJ 3WHCA 4M3DA 3TW7A 1ZTRA 3GTGJ 4BBRJ 2DA5A 1FEXA 3HDDA 1SANA 3GTLJ 3BTLA 1GV2A 1D5YA 3BR5A 4XRSA 1TWAJ 2L7ZA 2DMNA 2R5ZB 4QIWN 1GUUA 2JA5J 5E3NA 1ETYA 3TW6A 2VKVA 3JRHA 5FKOA 3NAUA 3JREA 1ZKGA 5GP9A 2HXIA 4IHXA 2EZLA 4XICA 1APLC 2HOTA 1ORKA 4W97A 5EZHA 1AKHA 5EZGA 1ETKA 4FCYA 3TP0A 3GTMJ 2QCOA 1VI0A 1R9TJ 3IH2A 1Q1VA 3S17J 1QRYA 4BY7J 2O8KA 5C44J 4DZPA 1TWGJ 1WGXA 2EH3A 3BG5A 3BG9A 2HOSA 5FLVA 4Y7NJ 2NOGA 2LKXA 2XB5A 4NDLA 1ETVA 4X1EA 4D5FA 1OFCX 3E7LA 2P81A 1XG1A 3PM1A 1A5JA 2Y2ZA 4M3EA 2NS8A 1MBFA 1WI3A 2CRGA 5F04A 1JKPC 1IC8A 2TCTA 2XB0X 5C3EJ 1JKRC 4XRMA 2M9HA 2B63J 2LY9A 1BW5A 2WAQN 1MBHA 1JKQC 4C2MJ 2NS7A 3S1RJ 2XGEA 3K7AJ 4IHVA 2E1OA 1IV6A 5GPAA 5EG0A 3Q0VA 2R7ZJ 2FD5A 4Y52J 3JR9A 1JJ8C 1MNMC 3FISA 1RESA 2R92J 1B8IB 1LE8B 3FIWA 3RQIA 1ETWA 2R93J 5EGOB 5FKMA 4BKXA 5JLXA 1Y1VJ 3D1NI 2TRTA 4IEJA 3LSGA 2XRLA 1WCMJ 3BTIA 5IYBJ 3S14J 2LTPA 1RR7A 4BY1J 1RKWA 3M3YJ 2E2IJ 1JT6A 2R5ZA 1XC5A 2ME6A 5F08A 2ID6A 1F43A 2AO9A 2IEKA 1LFUP 1GT0C 1JKOC 5EF6A 3HM5A 5IP9J 3H3VK 4ABZA 2G0EA 4RDUA 5FJ8J 3TP3A 4I6ZA 2JMWA 1ZGWA 1F36A 1JTXA 1XS9A 3CDLA 1MH3A 1I3QJ 3TEDA 1E3OC 3S1MJ 2AHQA 3DEWA 2YU9J 5EYRA 2EZIA 1ETXA 1GDTA 2LFBA 1I50J 2DN0A 2MG4A 1T56A 2N8GA 1AU7A 3GTOJ 2QF7A 1SFOJ 3B6CA 4J19A 4A3LJ 3ZQIA 1DU6A 3FK7A 2FQ4A 2YUSA 4B4CA 5GPCA 5K7HA 3LSRA 3RZDJ 4FISA 2DJNA 5IYCJ 2W48A 1OJLA 4DYRA 4JYKA 5FKLA 1GVDA 2EZKA 2E2JJ 4QSHA 2EQRA 4A3FJ 2JA7J 2HYJA 3BQYA 3S16J 3JRAA 3QPLA 4MFDA 1IRZA 4A3KJ 2ECCA 4UUTA 1RETA 3FK6A 3A03A 1W0TA 1B8IA 4IHWA 3SDGA 2DA3A 3NARA 4MIMA 5EGOA 2L0KA 4BBSJ 4MFEA 3QPSA 3G1LA 2JWTA 5EDNA 2NVQJ 5F1JA 3S1QJ 1A6IA 2I10A 5M5WJ 1ZK8A 2PMZN 4A3DJ 5K7ZA 2COBA 4A69C 3LSJA 3O8HA 4D5CA 1OCPA 1JUSA 1AHDP 2LK2A 3RKQA 1HCRA 3W6VA 1JTYA 3MVPA 5FLMJ 1P7IA 4JP0A 4B1RA 1NK2P 2CUFA 5FKNA 5M3FJ 4C3JJ 5E3MA 3FKIJ 1X2NA 1U8BA 3HGGA 2K9SA 4JX4A 1DU0A 1ENHA 2K9NA 2JN6A 4LOCA 3SFIA 3JRCA 3OSGA 3K2AA 2XPWA 3HOVJ 5M5XJ 2LLKA 3HOUJ 1W0UA 3ZQCA 2OPTA 3JRBA 1IUFA 3PO3J 3L1PA 2X48A 1HOMA 4FTHA 1O4XA 1X2MA 4V2GA 2JJ7A 5C4XJ 3CCYA 1QPIA 1OCTC 3LOCA 2CU7A 1JUMA 4G12A 3OIOA 3ZQLA 2ZB9A 2DA2A 4CYCB 2DMTA 2DTZA 1PUFB 3IH3A 4AYBN 2LP0A 1YRNB 3BR1A 3I4NJ 1BJZA 2ME0A 2MW8A 5DS9A 2HOAA 1B72B 1HDDC 4A3BJ 2CQXA 1QVTA 1U9NA 3BQZA 1UMQA 3BTJA 1UHSA 2HI3A 4D7NA 3JRDA 2FX0A 4DYQA 2K9QA 4A93J 2XPUA 3ZQHA 3LSPA 1TWFJ 1MBEA 5HODA 1VFCA 2M2EA 3BG3A 3C2BA 4DYCA 2DMUA 2VUMJ 1U9OA 2H1KA 2Y0SN 3CMYA 5M3MJ 3BR0A 2VPRA 2GLOA 2IAIA 3LNQA 4XIDA 3H0GJ 3BTCA 3DCFA 1QVUA 3S15J 2DA6A 5DTDA 5IP7J 3B6AA 2ECBA 2OF7A 1JGGA 5F27A 1TC3C 2JA8J 2GBYA 2ID3A 3GTJJ 1MSEC 3UKGA 1IJWC 2CJJA 1POGA 3HOYJ 3QQAA 1IDYA 5F0CA 2R0QC 3MN2A 3ZQGA 4A3MJ 2Y9ZA 1GV5A 3IH4A 4X6AJ 1HDPA 3OSFA 2EBIA 3JRFA 4JX5A 5IP6A 2Y30A 1FIAA 1RKTA 3JRIA 3RZOJ 1WPKA 1H8AC 1VF9A 3GBGA 1FIPA 2R5YB 4JX6A 4XRSG 3JRGA 2JK3A 4UUSB 4A3IJ 5IOYA 3HOWJ 4S0HB 2VKEA 2CQQA 1X58A 3G1OA 1LE8A 5K7FA 2NVXJ 2XPVA 3OOUA 1ETOA 2MSYA 3HBLA 3WHBA 3BT9A 4I76A 4A3CJ 4QTRA 5EEAA 4CYCA 2D5VA 2YS9A 1ITYA 2XGDA 2K40A 3ZOBA 4AUXA 1PUFA 3S1NJ 1MBGA 1YRNA 1LFBA 5IOZA 4IHYA 1B72A 3GTKJ 1I6HJ 3Q0UA 2L9RA 3G1MA 2MGQA 4A3EJ 1MBJA 2E19A 1EF4A 2GM4A 3SJMA 2LD5A 1IGNA 3HEFA 3O8GA 4FE7A 2XGCA 4M6VA 5J3LA 5JLWA 1T33A 4RBOA 5J1RA 2VI6A 5IYDJ 4AC0A 3PO2J 4A3GJ 4C3IJ 1NTCA 4W1UA 3CQZJ 1S7EA 2LR8A 1Z77A 1MSFC 4GFBA 1TWCJ 2DMQA 2CUEA 3HGYA 4HNVA 2LVSA 1MH4A 1CQTA 5IPAA 1P7JA 2NVTJ 1ZR2A 1WH7A 3MKLA 5J1UA 2JA6J 2DA1A 1G2HA 3I4MJ 3A01B 3GTPJ 3HOZJ 1RPWA 3M4OJ 3HB9A 1ZR4A 1FJLA 1BW6A 4B3AA 1FTTA 3S2HJ 5E3OA 2HQ5A 2DA7A 3ZQFA 5J1YA 5BNGA 1HLVA 5FKKA 2M34A 1K61A 1FTZA 1H88C 1JUPA 1VNDA 2DA4A 3HOXJ 3F0CA 5M5YJ 4V2FA 3Q3SA 2H8RA 2HXOA 3VPRA 1HF0A 1AKHB 2DMPA 4A3JJ 4DZJA 2R5YA 2NVYJ 4UUSA 2E2HJ 1BA5A 2IBDA 2L7FP 4M3FA 1BL0A 5E3LA 4C3HJ 4DW6A 4BXXJ 2EZHA 2X9DA 5F0HA 2L7MP 1TWHJ 9ANTA 1U78A 2M0CA 4M3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ6 C;  3S2D J;  3IV5 A;  4D7M A;  2KT0 A;  2O7O A;  2WB1 N;  2O9L A;  2X6O A;  5F0F A;  2M8G X;  1UG2 A;  3BR2 A;  1WH5 A;  4FE4 A;  1JT0 A;  2Y9Y A;  3HKZ N;  4MLO A;  2Y31 A;  1H89 C;  1ETQ A;  2ELK A;  4M3B A;  1NK3 P;  3BR3 A;  1IG7 A;  2XSD C;  2KDZ A;  4EEF G;  5EG0 B;  1ZQ3 P;  1Y1W J;  1K83 J;  3A02 A;  5C4J J;  4XK4 A;  2FJ1 A;  2RAE A;  3BR6 A;  3Q0W A;  4MO7 A;  2HDD A;  2WV1 A;  1IDZ A;  3A01 A;  1Z0X A;  1MBK A;  4L5E A;  3GTQ J;  3WHC A;  4M3D A;  3TW7 A;  1ZTR A;  3GTG J;  4BBR J;  2DA5 A;  1FEX A;  3HDD A;  1SAN A;  3GTL J;  3BTL A;  1GV2 A;  1D5Y A;  3BR5 A;  4XRS A;  1TWA J;  2L7Z A;  2DMN A;  2R5Z B;  4QIW N;  1GUU A;  2JA5 J;  5E3N A;  1ETY A;  3TW6 A;  2VKV A;  3JRH A;  5FKO A;  3NAU A;  3JRE A;  1ZKG A;  5GP9 A;  2HXI A;  4IHX A;  2EZL A;  4XIC A;  1APL C;  2HOT A;  1ORK A;  4W97 A;  5EZH A;  1AKH A;  5EZG A;  1ETK A;  4FCY A;  3TP0 A;  3GTM J;  2QCO A;  1VI0 A;  1R9T J;  3IH2 A;  1Q1V A;  3S17 J;  1QRY A;  4BY7 J;  2O8K A;  5C44 J;  4DZP A;  1TWG J;  1WGX A;  2EH3 A;  3BG5 A;  3BG9 A;  2HOS A;  5FLV A;  4Y7N J;  2NOG A;  2LKX A;  2XB5 A;  4NDL A;  1ETV A;  4X1E A;  4D5F A;  1OFC X;  3E7L A;  2P81 A;  1XG1 A;  3PM1 A;  1A5J A;  2Y2Z A;  4M3E A;  2NS8 A;  1MBF A;  1WI3 A;  2CRG A;  5F04 A;  1JKP C;  1IC8 A;  2TCT A;  2XB0 X;  5C3E J;  1JKR C;  4XRM A;  2M9H A;  2B63 J;  2LY9 A;  1BW5 A;  2WAQ N;  1MBH A;  1JKQ C;  4C2M J;  2NS7 A;  3S1R J;  2XGE A;  3K7A J;  4IHV A;  2E1O A;  1IV6 A;  5GPA A;  5EG0 A;  3Q0V A;  2R7Z J;  2FD5 A;  4Y52 J;  3JR9 A;  1JJ8 C;  1MNM C;  3FIS A;  1RES A;  2R92 J;  1B8I B;  1LE8 B;  3FIW A;  3RQI A;  1ETW A;  2R93 J;  5EGO B;  5FKM A;  4BKX A;  5JLX A;  1Y1V J;  3D1N I;  2TRT A;  4IEJ A;  3LSG A;  2XRL A;  1WCM J;  3BTI A;  5IYB J;  3S14 J;  2LTP A;  1RR7 A;  4BY1 J;  1RKW A;  3M3Y J;  2E2I J;  1JT6 A;  2R5Z A;  1XC5 A;  2ME6 A;  5F08 A;  2ID6 A;  1F43 A;  2AO9 A;  2IEK A;  1LFU P;  1GT0 C;  1JKO C;  5EF6 A;  3HM5 A;  5IP9 J;  3H3V K;  4ABZ A;  2G0E A;  4RDU A;  5FJ8 J;  3TP3 A;  4I6Z A;  2JMW A;  1ZGW A;  1F36 A;  1JTX A;  1XS9 A;  3CDL A;  1MH3 A;  1I3Q J;  3TED A;  1E3O C;  3S1M J;  2AHQ A;  3DEW A;  2YU9 J;  5EYR A;  2EZI A;  1ETX A;  1GDT A;  2LFB A;  1I50 J;  2DN0 A;  2MG4 A;  1T56 A;  2N8G A;  1AU7 A;  3GTO J;  2QF7 A;  1SFO J;  3B6C A;  4J19 A;  4A3L J;  3ZQI A;  1DU6 A;  3FK7 A;  2FQ4 A;  2YUS A;  4B4C A;  5GPC A;  5K7H A;  3LSR A;  3RZD J;  4FIS A;  2DJN A;  5IYC J;  2W48 A;  1OJL A;  4DYR A;  4JYK A;  5FKL A;  1GVD A;  2EZK A;  2E2J J;  4QSH A;  2EQR A;  4A3F J;  2JA7 J;  2HYJ A;  3BQY A;  3S16 J;  3JRA A;  3QPL A;  4MFD A;  1IRZ A;  4A3K J;  2ECC A;  4UUT A;  1RET A;  3FK6 A;  3A03 A;  1W0T A;  1B8I A;  4IHW A;  3SDG A;  2DA3 A;  3NAR A;  4MIM A;  5EGO A;  2L0K A;  4BBS J;  4MFE A;  3QPS A;  3G1L A;  2JWT A;  5EDN A;  2NVQ J;  5F1J A;  3S1Q J;  1A6I A;  2I10 A;  5M5W J;  1ZK8 A;  2PMZ N;  4A3D J;  5K7Z A;  2COB A;  4A69 C;  3LSJ A;  3O8H A;  4D5C A;  1OCP A;  1JUS A;  1AHD P;  2LK2 A;  3RKQ A;  1HCR A;  3W6V A;  1JTY A;  3MVP A;  5FLM J;  1P7I A;  4JP0 A;  4B1R A;  1NK2 P;  2CUF A;  5FKN A;  5M3F J;  4C3J J;  5E3M A;  3FKI J;  1X2N A;  1U8B A;  3HGG A;  2K9S A;  4JX4 A;  1DU0 A;  1ENH A;  2K9N A;  2JN6 A;  4LOC A;  3SFI A;  3JRC A;  3OSG A;  3K2A A;  2XPW A;  3HOV J;  5M5X J;  2LLK A;  3HOU J;  1W0U A;  3ZQC A;  2OPT A;  3JRB A;  1IUF A;  3PO3 J;  3L1P A;  2X48 A;  1HOM A;  4FTH A;  1O4X A;  1X2M A;  4V2G A;  2JJ7 A;  5C4X J;  3CCY A;  1QPI A;  1OCT C;  3LOC A;  2CU7 A;  1JUM A;  4G12 A;  3OIO A;  3ZQL A;  2ZB9 A;  2DA2 A;  4CYC B;  2DMT A;  2DTZ A;  1PUF B;  3IH3 A;  4AYB N;  2LP0 A;  1YRN B;  3BR1 A;  3I4N J;  1BJZ A;  2ME0 A;  2MW8 A;  5DS9 A;  2HOA A;  1B72 B;  1HDD C;  4A3B J;  2CQX A;  1QVT A;  1U9N A;  3BQZ A;  1UMQ A;  3BTJ A;  1UHS A;  2HI3 A;  4D7N A;  3JRD A;  2FX0 A;  4DYQ A;  2K9Q A;  4A93 J;  2XPU A;  3ZQH A;  3LSP A;  1TWF J;  1MBE A;  5HOD A;  1VFC A;  2M2E A;  3BG3 A;  3C2B A;  4DYC A;  2DMU A;  2VUM J;  1U9O A;  2H1K A;  2Y0S N;  3CMY A;  5M3M J;  3BR0 A;  2VPR A;  2GLO A;  2IAI A;  3LNQ A;  4XID A;  3H0G J;  3BTC A;  3DCF A;  1QVU A;  3S15 J;  2DA6 A;  5DTD A;  5IP7 J;  3B6A A;  2ECB A;  2OF7 A;  1JGG A;  5F27 A;  1TC3 C;  2JA8 J;  2GBY A;  2ID3 A;  3GTJ J;  1MSE C;  3UKG A;  1IJW C;  2CJJ A;  1POG A;  3HOY J;  3QQA A;  1IDY A;  5F0C A;  2R0Q C;  3MN2 A;  3ZQG A;  4A3M J;  2Y9Z A;  1GV5 A;  3IH4 A;  4X6A J;  1HDP A;  3OSF A;  2EBI A;  3JRF A;  4JX5 A;  5IP6 A;  2Y30 A;  1FIA A;  1RKT A;  3JRI A;  3RZO J;  1WPK A;  1H8A C;  1VF9 A;  3GBG A;  1FIP A;  2R5Y B;  4JX6 A;  4XRS G;  3JRG A;  2JK3 A;  4UUS B;  4A3I J;  5IOY A;  3HOW J;  4S0H B;  2VKE A;  2CQQ A;  1X58 A;  3G1O A;  1LE8 A;  5K7F A;  2NVX J;  2XPV A;  3OOU A;  1ETO A;  2MSY A;  3HBL A;  3WHB A;  3BT9 A;  4I76 A;  4A3C J;  4QTR A;  5EEA A;  4CYC A;  2D5V A;  2YS9 A;  1ITY A;  2XGD A;  2K40 A;  3ZOB A;  4AUX A;  1PUF A;  3S1N J;  1MBG A;  1YRN A;  1LFB A;  5IOZ A;  4IHY A;  1B72 A;  3GTK J;  1I6H J;  3Q0U A;  2L9R A;  3G1M A;  2MGQ A;  4A3E J;  1MBJ A;  2E19 A;  1EF4 A;  2GM4 A;  3SJM A;  2LD5 A;  1IGN A;  3HEF A;  3O8G A;  4FE7 A;  2XGC A;  4M6V A;  5J3L A;  5JLW A;  1T33 A;  4RBO A;  5J1R A;  2VI6 A;  5IYD J;  4AC0 A;  3PO2 J;  4A3G J;  4C3I J;  1NTC A;  4W1U A;  3CQZ J;  1S7E A;  2LR8 A;  1Z77 A;  1MSF C;  4GFB A;  1TWC J;  2DMQ A;  2CUE A;  3HGY A;  4HNV A;  2LVS A;  1MH4 A;  1CQT A;  5IPA A;  1P7J A;  2NVT J;  1ZR2 A;  1WH7 A;  3MKL A;  5J1U A;  2JA6 J;  2DA1 A;  1G2H A;  3I4M J;  3A01 B;  3GTP J;  3HOZ J;  1RPW A;  3M4O J;  3HB9 A;  1ZR4 A;  1FJL A;  1BW6 A;  4B3A A;  1FTT A;  3S2H J;  5E3O A;  2HQ5 A;  2DA7 A;  3ZQF A;  5J1Y A;  5BNG A;  1HLV A;  5FKK A;  2M34 A;  1K61 A;  1FTZ A;  1H88 C;  1JUP A;  1VND A;  2DA4 A;  3HOX J;  3F0C A;  5M5Y J;  4V2F A;  3Q3S A;  2H8R A;  2HXO A;  3VPR A;  1HF0 A;  1AKH B;  2DMP A;  4A3J J;  4DZJ A;  2R5Y A;  2NVY J;  4UUS A;  2E2H J;  1BA5 A;  2IBD A;  2L7F P;  4M3F A;  1BL0 A;  5E3L A;  4C3H J;  4DW6 A;  4BXX J;  2EZH A;  2X9D A;  5F0H A;  2L7M P;  1TWH J;  9ANT A;  1U78 A;  2M0C A;  4M3G A; 
#chains in the Genus database with same CATH topology
 1JJ6 C;  4PSX A;  3IV5 A;  5LRS A;  1KU7 A;  2UV1 A;  2KT0 A;  4ZYA A;  1RRJ A;  1SD4 A;  2WB1 N;  4I0B A;  1EJ9 A;  1T08 B;  2A6H F;  2PFB A;  2QYO A;  1UG0 A;  3FMS A;  3K4C A;  4EM1 A;  4NQW A;  3HTS B;  2QWW A;  2VT2 A;  2M8G X;  1UG2 A;  2DFI A;  3BR2 A;  1TNS A;  4FE4 A;  1JT0 A;  2LBF A;  2Y9Y A;  1TBX A;  1ZH5 A;  4EMS A;  3BG7 A;  2ELK A;  5K5O A;  1NK3 P;  3CCS I;  3BR3 A;  1VQ5 I;  1G6N A;  3ZMV A;  3LWF A;  3M8E A;  1WVR A;  4HOB A;  1TW3 A;  1YLF A;  4BQN A;  4HZF A;  1R1T A;  3TO7 A;  3A02 A;  4HV6 A;  4Y3O A;  3K70 D;  2FNA A;  2W84 A;  3BR6 A;  4MO7 A;  3CJN A;  3HSR A;  1TNT A;  5KAI C;  3A01 A;  3H0D A;  5E1Z B;  1VZ0 A;  3TDU C;  1Z21 A;  5EJC A;  3RKW A;  4GXO A;  4EM2 A;  1R36 A;  3F8B A;  1ZTR A;  1GLN A;  2DA5 A;  3G2B A;  1F5T A;  3HTU A;  3H35 A;  3GTL J;  4LG0 A;  3VOE A;  5J4V A;  1GV2 A;  5L3C A;  3R4K A;  1T0F C;  2M7B A;  3ML6 A;  2ACJ A;  2A5Y B;  2HTS A;  1W7P B;  3BZK A;  5BMZ A;  2H1L A;  3K6G A;  3PQK A;  2R5Z B;  4DNC A;  5DCF A;  2G7U A;  5E3N A;  1ETY A;  1S7A A;  2AQE A;  4M9X A;  4I7H A;  5FKO A;  5ICG A;  1WWX A;  3GCM A;  3Q9S A;  1ZKG A;  1LKX A;  2LDU A;  2IS1 A;  1LDD A;  3K0L A;  2QSH X;  1MNE A;  1EH7 A;  3WG9 A;  1G3W A;  4BL0 B;  3ELK A;  2L54 A;  3GTM J;  2QCO A;  3A1Y A;  2IRF G;  5LLQ A;  1M1E B;  1G59 A;  4DZP A;  3BLY A;  3DKX A;  2LYC A;  1NG6 A;  3BG5 A;  1KGS A;  3BG9 A;  2FOK A;  5AIP A;  4BE2 A;  1TTY A;  2LOO A;  4X1E A;  2R7S A;  4KFC A;  1LDJ A;  3JTH A;  3E7L A;  1SFK A;  1X3W B;  3RYP A;  2HVQ A;  3PM1 A;  4FAS D;  2DK8 A;  3CCU I;  3CP8 A;  3WOD F;  1XGN A;  1IXC A;  1H9G A;  3OYG A;  2BXZ A;  3CUQ B;  4E7H A;  1WI3 A;  2PMH A;  2VXZ A;  2KKO A;  5F04 A;  3TO9 A;  1JKP C;  1IC8 A;  5C3E J;  1R1V A;  3HIF A;  2FNP A;  1JKR C;  4L5I A;  2LY9 A;  5D8L B;  3CUQ C;  2OTJ I;  4GYG A;  1MBH A;  3G4S I;  2VLA A;  1SD5 A;  3KP7 A;  3ONQ A;  2E1O A;  2LSO A;  4M73 A;  1IN5 A;  3E3V A;  2FD5 A;  3H9Q A;  4EQQ A;  2EFW A;  3CCJ I;  2XGX A;  1RES A;  3CCE I;  1B8I B;  2F6C A;  1XGM A;  1JI8 A;  1FP1 D;  1LE8 B;  3FIW A;  2EJR A;  2CFO A;  2L7K A;  3H5N A;  2ZXH A;  1PUE E;  2IJL A;  3EET A;  2STW A;  2XF5 A;  4KIC A;  3D1N I;  3KET A;  4IX7 A;  1CF7 A;  3A0B C;  1Y0N A;  4IEJ A;  3LSG A;  4XN0 A;  2IA0 A;  4ZYD A;  1WCM J;  2Z99 A;  3LA7 A;  1TQM A;  5IY5 H;  3K1P A;  2Q2E A;  5HLT A;  1BOA A;  5CVR A;  4UB6 C;  3BC8 A;  2W57 A;  5CLS A;  1ZAO A;  3W6K B;  2EWN A;  3FX3 A;  1F43 A;  2IEK A;  4WXD A;  3ABU A;  5GAG J;  1P9Q C;  4DIQ A;  1SVL A;  2FML A;  4L9N A;  2E1N A;  3BJ6 A;  3EPZ A;  2HWV A;  4II3 A;  2DXI A;  1W1W E;  2IW5 A;  4ZDO A;  2AXL A;  2CS3 A;  3QOD A;  5D6E A;  5FJ8 J;  1O3R A;  2IA1 A;  2JMW A;  4UHT A;  3W2W A;  4G8X A;  1OPC A;  2JSC A;  3CDL A;  2DOE A;  3L00 A;  1MH3 A;  1I3Q J;  3V8J A;  2FEZ A;  4BQA A;  4G7O F;  3IWZ A;  2QKM B;  3DEW A;  2F4O B;  1D1C A;  4HPQ A;  2OTL I;  4F55 A;  2E5Z A;  1GDT A;  2XAS A;  4IQJ A;  2LFB A;  2DN0 A;  2MG4 A;  2V9V A;  2Z2S B;  3K4M A;  4J19 A;  4A3L J;  3E6B A;  1T95 A;  4C30 A;  1V55 H;  2FQ4 A;  2MLK A;  2YUS A;  3CUO A;  2BXY A;  1X4O A;  4EJO A;  5IYC J;  2K5C A;  4EVI A;  3QU3 A;  2WAF A;  3H3Z A;  4WWC A;  4LK0 F;  4JYK A;  5FKL A;  3I59 A;  3RTR A;  1YX5 A;  3QPT A;  5B1A H;  1XGS A;  1X19 A;  2E5N A;  1C0W A;  5D5U B;  4OIQ F;  4F91 B;  2QEX I;  3FHZ A;  4QSH A;  4A3F J;  2IP2 A;  1IO2 A;  3WGH A;  3BQY A;  4G94 A;  2IGM A;  2GOM A;  2L4A A;  4A3K J;  5DDG A;  2Z5U A;  3K1N A;  1J59 A;  3TQN A;  2HZT A;  2XAF A;  4IKF A;  1W0T A;  1U5T B;  3H1C A;  3PFI A;  3KYC B;  3DU5 A;  3KIO A;  2IT0 A;  3SDG A;  2KQR A;  2E34 A;  3DBR B;  5J40 A;  4PGG A;  4MIM A;  4MHG A;  4HNT A;  2XKP A;  1U5T C;  2P8T A;  4MTD A;  3BG6 A;  5LGN A;  2EV0 A;  1G3T A;  3KFW X;  2UZK A;  3QRF F;  2ELH A;  1BBY A;  4RGS A;  3BP8 A;  5EDN A;  4PZJ A;  1V5E A;  4P55 A;  2HZD A;  1ZK8 A;  1BN5 A;  3C2G A;  3PUB A;  1MMA A;  4L0Z B;  3LSJ A;  3O8H A;  3IP4 B;  4ON0 A;  1JUS A;  1XB4 A;  2PX9 A;  3BWG A;  5DUK A;  1LUJ B;  5EEG A;  4XOT A;  3RKQ A;  1J09 A;  3ZGK A;  1P7I A;  4JP0 A;  2WWY A;  5HS7 A;  3HL2 A;  5FKN A;  2F4I A;  2K85 A;  1SAU A;  2Z3Y A;  3C3W A;  3ZRG A;  4AVP A;  1MDM B;  1DPR A;  3ABK H;  1BI2 A;  3HGG A;  2K9S A;  2RDP A;  3OR1 C;  4RM3 A;  4RB3 C;  4YEJ A;  4L9J A;  1E3H A;  1ENH A;  2K9N A;  2JN6 A;  3SFI A;  3JRC A;  2XPW A;  1YO5 C;  1FMW A;  4HSR A;  4EM0 B;  2M0M A;  5M5X J;  5HDN A;  3HOU J;  3FBN B;  3SZP A;  4P96 A;  3ULQ B;  4FX4 A;  1JHH A;  2A07 F;  3AFH A;  2DPU A;  2M1B A;  3CCY A;  2RKH A;  1UHW A;  4KIS A;  3LOC A;  2V26 A;  1X1C A;  4DOZ A;  1YJW I;  4B8X A;  3ZQL A;  1D1A A;  1F1Z A;  4X0G A;  4EGY A;  4LJZ F;  2CQN A;  1YRN B;  1HW2 A;  4NHJ A;  2MC3 A;  3BR1 A;  4CH7 A;  3VYU B;  2MW8 A;  2KIQ A;  2QVO A;  3KP6 A;  5DS9 A;  3R61 A;  2CQX A;  5KHD A;  1ACI A;  1W7P A;  3BTJ A;  2J5P A;  3I4P A;  1FYL A;  3JRD A;  2FX0 A;  2R7X A;  4KN7 X;  4NC7 A;  4A93 J;  5J47 A;  1VQN I;  1P92 A;  2CG4 A;  3ZQH A;  3COA C;  1W36 D;  5H2F C;  4IJA A;  2GA2 A;  2X6Y A;  3I71 A;  4D0P A;  2M2E A;  2F5E A;  2XUB A;  5TRD A;  4DYC A;  1TZL A;  3SZT A;  3OYM A;  2DQL A;  1QZE A;  1B9N A;  2H1K A;  3ISP A;  3FKJ A;  1T98 A;  3S3N A;  1YOV B;  3CMY A;  1RC9 A;  2QQB A;  2GLO A;  3H5A A;  4XID A;  3HRM A;  3H0G J;  5GAE J;  3DCF A;  1YS7 A;  2VJJ A;  2PJR A;  2LKP A;  2YX7 A;  3LSM A;  4PFO A;  3FM3 A;  1TC3 C;  2GBY A;  2ID3 A;  5D4R A;  1KA8 A;  3DXJ F;  3GTJ J;  3K1M A;  3QQA A;  3K10 A;  4UV9 A;  1IDY A;  3KP5 A;  5JI6 A;  2R0Q C;  4YFK F;  1IV8 A;  2ISZ A;  3WTZ A;  1HC8 A;  3CD6 I;  3W6J B;  1ERD A;  4PJJ A;  3CCM I;  4A0X A;  4MQV A;  5E8I A;  3IH4 A;  4X6A J;  2ISY A;  2EBI A;  2PQ8 A;  4XNF A;  3JRF A;  1FBQ A;  2VBY A;  3GYH X;  3A2K A;  1FPQ A;  1H8A C;  3WU2 C;  1ZGJ A;  3V42 A;  2DDB A;  2VOO A;  4QWQ A;  3IL2 A;  1FIP A;  2VAS A;  1VQP I;  4UUS B;  2IS2 A;  1SD7 A;  5DUI A;  2BGC A;  3HOW J;  1I5Z A;  3IAM 2;  4I02 A;  1X58 A;  4G9Y A;  1LE8 A;  2ZBK A;  2QBY B;  4II2 A;  4CCK A;  3ZR8 X;  4WK8 F;  2XPV A;  4E70 A;  5ICE A;  1ETO A;  2BOL A;  4GYI A;  2D5V A;  4CYC A;  1T8I A;  2YS9 A;  1A04 A;  2XGD A;  2K40 A;  4AUX A;  4G6D A;  1BR1 A;  3OMY A;  3ESW B;  3DBH B;  1E17 A;  2NNY A;  4XLN F;  4PUS A;  3Q0U A;  1OKR A;  4NQW B;  2MGQ A;  4DBR A;  1XDU A;  3F23 A;  4GRI A;  4PFP A;  2LD5 A;  2V4J C;  5D5W B;  3HEF A;  1UB9 A;  3BPX A;  2LBF B;  2RQP A;  4RBO A;  3GZN B;  3NQO A;  4IRH A;  2VQL A;  3KEQ A;  4AWX B;  2V1U A;  3JW4 A;  3KX2 A;  1MW7 A;  2VBZ A;  3ECO A;  2RC4 A;  5ICC A;  1OQY A;  1S7E A;  2EK5 A;  1RIO H;  3DEE A;  1TWC J;  4OIP F;  3HGY A;  1QGP A;  3SXY A;  2ESH A;  2LVS A;  1MH4 A;  1K7A A;  2CYY A;  2OC6 A;  3MKL A;  4WF2 A;  5J1U A;  4F52 A;  4L0Y B;  3I4M J;  3A01 B;  3FMQ A;  4HYE A;  3M4O J;  1EV7 A;  1KZH A;  3K4L A;  4ENN A;  1R5G A;  2E36 A;  1ZR4 A;  5F6F A;  1FTT A;  2Q0O A;  3MWM A;  4LG0 B;  2C6Y A;  3I53 A;  4KT6 A;  2V1D A;  5J1Y A;  2FSW A;  2CQ7 A;  4Z2Y A;  3SFZ A;  1BR2 A;  3KEY A;  3KLO A;  3AG1 H;  1H88 C;  3BZ6 A;  1ZN2 A;  1HKQ A;  1VND A;  1YJ9 I;  3W2A A;  1GVJ A;  5M5Y J;  4V2F A;  4XM3 A;  2H8R A;  2HXO A;  2CUJ A;  1KYW A;  2OBP A;  2VOD A;  3OYF A;  2DMP A;  3KZZ A;  3QWL A;  2W82 A;  5TJJ A;  2O5R A;  4UXN A;  1XCV A;  2HQR A;  3OWT A;  2OU2 A;  4OIN F;  2R5Y A;  3S3O A;  1JE8 A;  4M9S A;  2NVY J;  1BA5 A;  2E2H J;  1IN4 A;  4DW6 A;  2HVR A;  4XKW A;  5DM7 F;  2X9D A;  1IXS B;  1TWH J;  1J2X A;  2CQK A;  3DWL E;  1U78 A;  3S2D J;  2ADU A;  3GFL A;  2O7O A;  4A2U A;  3W3C A;  2EIN H;  3CTA A;  2O9L A;  2YX4 A;  3DPL C;  2HPM A;  1XTA A;  2MFZ A;  1WHU A;  4RLF A;  4EAT A;  3LFK A;  2JRM A;  2KLO A;  1XMA A;  1T6S A;  1FZP B;  1TP4 A;  1H89 C;  4IRI A;  4M3B A;  1IG7 A;  3RYR A;  4EEF G;  4PJM A;  4WCG A;  1ZQ3 P;  3IRQ A;  1O3S A;  4PCQ A;  2M3A A;  1Y1W J;  1YW9 A;  4LGW A;  2HGC A;  3GFJ A;  3OYB A;  1R5I D;  4PGH A;  4MQ9 F;  4XK4 A;  4BU2 A;  2RAE A;  2HDD A;  4KDP A;  1R23 A;  2KIS A;  1IDZ A;  2FQ3 A;  3GTQ J;  2H8W A;  2V7F A;  1SD6 A;  3LSH A;  5FFX A;  3WHC A;  4M3D A;  1BM9 A;  1T2K A;  3GTG J;  1FEX A;  1RR8 C;  4FT8 A;  2EIL H;  2XHK A;  3GLX A;  4XSX F;  1OIS A;  3BR5 A;  5CPR B;  3CCV I;  3AG2 H;  4XLA A;  3AG4 H;  1FOY A;  3MAJ A;  3OV8 A;  5CVV A;  2Q2E B;  1VQ9 I;  4LMY A;  4H0E A;  4BHC A;  5L3D A;  4AIK A;  1GUU A;  4XR6 A;  2HTJ A;  3JRH A;  4KIB A;  1ZGA A;  1SFU A;  3NAU A;  4PK4 A;  5GP9 A;  2M45 A;  2V1X A;  3ZMZ A;  4XIC A;  2HOT A;  4XMY A;  4XBF A;  2K9M A;  2JA2 A;  3LL7 A;  5EZH A;  3E97 A;  3WU0 A;  5EZG A;  1ETK A;  4FCY A;  1HBX G;  3TP0 A;  3TKY A;  2IS6 A;  1VI0 A;  4YII A;  4LK1 F;  4B3X A;  1Q1V A;  1REP C;  1W4M A;  3ZN0 A;  4BDZ A;  1G4D A;  4Y7N J;  2CW8 A;  4LIV A;  2NOG A;  4YIF A;  2LKX A;  2XB5 A;  4GDF A;  1J7K A;  2BBY A;  4OAZ A;  1ETV A;  3IKV A;  4JBA A;  4JOM A;  3B73 A;  1VQ6 I;  2ZME B;  4BH9 A;  4NUB A;  1XG1 A;  2K86 A;  2QM3 A;  2ZFW A;  1QHH D;  3RKY A;  1N78 A;  4G7Z F;  2V9P A;  3P7N A;  5F64 A;  3QPH A;  2NS8 A;  3S8P A;  4JQF A;  5DM6 F;  1MBF A;  2CRG A;  4CUG A;  2BVM A;  2XAH A;  2CUZ A;  5KAF C;  1FYM A;  2DYR H;  3I59 B;  3VEP A;  2B63 J;  2R7V A;  1FMV A;  4RB0 A;  4NC8 A;  5DD4 A;  2ESN A;  2P6T A;  1UEL B;  1B4A A;  3MEX A;  3S1R J;  3WGG A;  1X4P A;  2R7Z J;  1WJD A;  2DT5 A;  3PNT A;  3JR9 A;  1O3Q A;  1J5Y A;  3DKY A;  2OCE A;  3FXJ A;  1S3J A;  1JGS A;  3CJQ B;  2R92 J;  4RAY A;  4PJ0 C;  2DT6 A;  3T5X A;  2VC1 A;  2MAB A;  2W1O A;  4HST A;  3E5U A;  4ZTF A;  2DFF A;  4CO8 A;  1ETW A;  2VON A;  3RPU D;  4HA8 A;  5JLX A;  4BKX A;  3AL0 B;  4UY8 I;  5DCM B;  1PDN C;  3J7A Y;  3IAS 2;  2BZT A;  4MEX F;  4BXF A;  2QBY A;  2WAQ A;  5BPD A;  3QAH A;  1S72 I;  2QSG X;  1RR7 A;  3QOE A;  1Z6R A;  2PJP A;  2KIF A;  3W2V A;  3GX4 X;  1IXR C;  2E2I J;  1JT6 A;  4H4K C;  2R7U A;  1XC5 A;  4M6Y A;  2FF4 A;  1T39 A;  1ZRF A;  4CGZ A;  2VOP A;  3J80 K;  5F08 A;  1SVM A;  2BY1 A;  5TGT A;  1LFU P;  3WTU C;  3CES A;  1WJ5 A;  2V79 A;  4N0B A;  2R7R A;  3EUA A;  2K4B A;  3ASN H;  3H92 A;  1JKO C;  5EF6 A;  2QKL B;  5IP9 J;  2F5V A;  4ABZ A;  4IHT A;  3KP4 A;  4B47 A;  1F36 A;  3VWB A;  1XN7 A;  1MGT A;  1GXQ A;  3FDY A;  3M9A A;  1WSU A;  3FXL A;  2Q8K A;  3BZC A;  1DGR M;  1I50 J;  3RQ4 A;  3GTO J;  1ZYR F;  3B6C A;  1DU6 A;  1UHM A;  3JSP A;  3FXM A;  2DOF A;  5LEJ A;  1LDK B;  2IGO A;  1XX5 A;  2DJN A;  2R7O A;  1QHG A;  2BEO A;  1OJL A;  3M07 A;  3L9F A;  4XSZ F;  1X3Z B;  2EA2 A;  2HKO A;  2KJC A;  3CO7 C;  2NAZ A;  4BAC A;  3M1C A;  2E2J J;  1DUX C;  1KQ8 A;  4FX0 A;  4Q4Z F;  1IF1 A;  2HYJ A;  1I6X A;  1WFX A;  3QPL A;  3OYE A;  3JRA A;  2ECC A;  4UUT A;  1RET A;  3FK6 A;  3HHG A;  3A03 A;  2R7F A;  1WJE A;  2XAU A;  3CC2 I;  1AOY A;  1YG2 A;  3HUG A;  4BJT A;  1VQ7 I;  3NAR A;  2Q1Z B;  5D6F A;  3CF2 A;  4MNU A;  1YIJ I;  1XSX A;  3F8N A;  3IUO A;  4HX7 A;  2OAZ A;  3G1L A;  1WKM A;  2KZV A;  3S1Q J;  2NVQ J;  5IT9 K;  2I10 A;  5D5X B;  2X51 A;  4G6T B;  2PMZ N;  2F48 A;  2COB A;  2PN6 A;  4A69 C;  2PJR B;  1ZG3 A;  5CYV A;  3GO5 A;  4Y13 A;  3W6V A;  1NK2 P;  4B1R A;  3AKZ A;  2HS5 A;  2W7N A;  2XVC A;  1TLH B;  4C3J J;  1WI9 A;  2FUG 2;  3VYS B;  4ESF A;  3Q5F A;  3J80 Z;  2OD5 A;  4NB5 A;  2X1E A;  6PAX A;  5CQG A;  5H6R A;  3DTI A;  3MMY B;  1HXD A;  3K2A A;  4U0Y A;  4HNU A;  2E7X A;  2UUZ A;  1LPQ A;  1HW1 A;  3HOV J;  4KIT B;  3X2Q H;  3DV8 A;  3PNY A;  2OPT A;  3VOD A;  3JRB A;  2QZ8 A;  3WTV C;  3ZQC A;  2FOW A;  2MD5 A;  1ULY A;  2RV8 A;  2JZY A;  3P9K A;  2JJ7 A;  2NRA C;  1QPI A;  2JPC A;  1V3F A;  4PJL A;  1ODD A;  2COM A;  2CU7 A;  3HRS A;  4R79 A;  2LG4 A;  1DP3 A;  4CYC B;  3OYI A;  5JHU A;  4BDY A;  2XRO A;  2OQG A;  3JSO A;  1FOX A;  3P9I A;  4AYB N;  2LP0 A;  4FHT A;  3OYL A;  4OMZ A;  5JVT A;  4WX9 A;  3M7G A;  2ME0 A;  4CZC A;  4A3B J;  1O7L A;  1QVT A;  3BQZ A;  1UMQ A;  1WJB A;  1UHS A;  1XMK A;  2HI3 A;  3CCQ I;  3WTY C;  4D7N A;  4BJ6 C;  4DYQ A;  2ZKZ A;  1NH3 A;  2XIG A;  3FXU A;  5D8K B;  1L3L A;  1MMN A;  1WQ2 A;  2GWR A;  3OYH A;  2WAE A;  4YIR X;  2XPU A;  4C2T A;  5FB2 A;  2DPD A;  1ON1 A;  1TWF J;  1KON A;  3M1E A;  2H6B A;  3E6C C;  3M8J A;  4XLH A;  2TDX A;  3KCC A;  4YEL A;  5B5E C;  1P4X A;  3LST A;  4ZYH A;  3E5Q A;  2L01 A;  2Y0S N;  5J6X A;  1Y56 A;  3D5S C;  2DW4 A;  4IO9 F;  3VSK A;  2IAI A;  4O5V A;  4J00 A;  1BI0 A;  2R7D A;  1S9H A;  1H9T A;  2VT3 A;  2IXS A;  2ZME A;  3LQQ A;  2F2E A;  5DTD A;  1YIT I;  5IT9 Z;  2VQG A;  3CO6 C;  2LH9 A;  5CVU A;  5F27 A;  4LB6 B;  2DTR A;  1KU2 A;  1MSE C;  1KQ9 A;  2F5C A;  3BJO A;  1YW7 A;  1KYZ A;  2NYX A;  4AIH A;  3HOY J;  4XLF A;  1DP7 P;  2KMU A;  3P5J A;  5F0C A;  4OWR B;  2WC2 A;  3ZQG A;  3KEO A;  2DLL A;  1GV5 A;  2M8E A;  4RS8 A;  1RKT A;  3JRI A;  4U7D A;  1QNT A;  4HQM A;  3IC7 A;  3TO6 A;  3LAP A;  4BGD A;  2K02 A;  1EH6 A;  3GBG A;  2R5Y B;  4JX6 A;  3JRG A;  5D5V B;  5IOY A;  4S0H B;  2W4S A;  3G1O A;  4KA4 A;  5E8G A;  4PSW A;  1MMS A;  5K7F A;  2HNH A;  2VQC A;  4A5M A;  3OOU A;  1MJ9 A;  3WHB A;  2HEO A;  2GIV A;  5HNF A;  2JTV A;  2MLG A;  1ITY A;  5DCM A;  3S1N J;  1D0Z A;  1A36 A;  1BC8 C;  2KIU A;  1LFB A;  1UAA A;  2CFX A;  2LRD A;  3OYJ A;  4IHY A;  2OUM A;  1B72 A;  1I6H J;  3ABL H;  3CLQ A;  2BV6 A;  3TMO A;  2L9R A;  2CMP A;  3G1M A;  1Z7L A;  2QQA A;  1MBJ A;  5AON A;  3T1B A;  5F1R A;  2DDA A;  4E7I A;  3FHN A;  3KLN A;  4M6V A;  5J3L A;  1T33 A;  2FBK A;  1UJ8 A;  2LF7 A;  4C9Y A;  4UNO A;  4AC0 A;  3G73 A;  2O03 A;  3PL8 A;  5LEK A;  4F3Q A;  1EKE A;  1ON2 A;  1VTN C;  2QEN A;  5DV5 A;  2X6X A;  2ZXJ A;  4UUV A;  3QYF A;  4XRF A;  4K2E A;  5JHF A;  4UV8 A;  4HNV A;  2M4G A;  1OYY A;  2MD0 A;  5IPA A;  2XRN A;  1P7J A;  1MND A;  2NVT J;  4M6X A;  2KFD A;  3AAF A;  3E5X A;  4NC6 A;  5AIQ A;  2GQQ A;  4DQ2 A;  1RPW A;  2ZSI B;  3EYI A;  3HB9 A;  1BW6 A;  3LMM A;  4B3A A;  4ITV A;  4BNC A;  2HQ5 A;  2DA7 A;  1MKM A;  1N75 A;  1Z3X A;  4GGG A;  5FKK A;  2M34 A;  1K61 A;  1FTZ A;  3CDI A;  2ZSH B;  4WXH A;  4J01 A;  1X1A A;  4B43 A;  4ZH4 F;  4KIG A;  2HOE A;  5H6Q A;  4ZC3 A;  4BE0 A;  3MZY A;  1UZC A;  1KQ0 A;  1HF0 A;  4L18 B;  1IN8 A;  3I58 A;  2JT1 A;  2XAJ A;  4U87 A;  4A3J J;  1HA8 A;  4DZJ A;  1A35 A;  2W24 A;  3H9J A;  2W00 A;  5FO5 A;  2NVU B;  1K79 A;  1TL8 A;  3V8K A;  1IW7 F;  4EJT A;  1Z3Y A;  1WRJ A;  2L7F P;  2EA4 A;  3OOP A;  4M3F A;  3O3K A;  2LRE A;  4KN4 X;  1Y0U A;  3QP5 A;  3IKT A;  1P4W A;  2OV7 A;  5F0H A;  1S5L C;  3A4C A;  2VE9 A;  4IPA A;  3QU6 A;  1RUN A;  1YI2 I;  3PIP F;  2V9K A;  4D7M A;  5B3S H;  4EJV A;  4S04 A;  2M30 A;  3T0Y A;  3WE2 A;  4LIT A;  3CMA I;  5GAH J;  3E6D A;  2BHY A;  3L2U A;  2L9V A;  2X6O A;  5GTH C;  2DFE A;  5F0F A;  1Y6I A;  3N05 A;  1WH5 A;  4A0Z A;  5KVR A;  3BJA A;  1Z6T A;  2VKD A;  3BRO A;  4HDV A;  2NOJ B;  3ZMD A;  2VB6 A;  4MLO A;  1GHC A;  4UVC A;  4XON A;  1RZ4 A;  3L2R A;  3HJE A;  4M71 A;  1Q1H A;  2KDZ A;  5K5R A;  1MIJ A;  4HF0 A;  4ZYE A;  4BXU A;  5LRR A;  2HFH A;  3WTS C;  3F22 A;  1YE9 A;  2PMU A;  2ZFU A;  1U3E M;  2XKO A;  1IRF A;  2WV0 A;  3RPQ A;  5LHI A;  3CC4 I;  2OZU A;  5C4J J;  5GAD J;  4JK1 X;  4I99 C;  3F3X A;  2FJ1 A;  1BIA A;  2QGU A;  2UXX A;  3Q0W A;  3V7S A;  3PIO F;  3ZMT A;  2WV1 A;  4D1Q A;  3MKY B;  3CJR B;  2VJ5 A;  1Z0X A;  2H6C A;  1MBK A;  3FXR A;  4MTE A;  1J75 A;  1J9I A;  1OR7 C;  1UFM A;  2P5V A;  2VIX A;  2YR2 A;  4RLQ A;  1SAN A;  4OAY A;  4BQO A;  1YTY A;  2K3P A;  3QYB A;  2WA0 A;  3BTL A;  1D5Y A;  4XRS A;  4PDK A;  3F6O A;  1BC7 C;  4PJN A;  4KNY A;  2MH2 A;  2LF8 A;  1Z91 A;  4QIW N;  1XMX A;  2M5W A;  3DTK A;  3HHH A;  4A6E A;  3JRE A;  3CJT B;  4U0V A;  2HXI A;  2FBH A;  4IHX A;  2CV2 A;  1Z7U A;  5H20 A;  2X4H A;  2KZG A;  1ORK A;  1AKH A;  1XPX A;  3SQN A;  1SAX A;  1R49 A;  1FT9 A;  1WJF A;  1R9T J;  4HW0 A;  3RJP A;  1ZRC A;  2V1N A;  2VJ4 A;  1QRY A;  2O8K A;  1E0E A;  1GXP A;  2X1C A;  1HKT A;  1TWG J;  1WGX A;  5HLG A;  4A6D A;  2PI0 A;  3ZMU A;  2CW7 A;  1P4A A;  3FMR A;  4NDL A;  3L2V A;  1W5C C;  4C2U A;  2NS0 A;  2E7W A;  2P81 A;  4F92 B;  1A31 A;  2I8D A;  1A5J A;  4ENK A;  4RB2 C;  3VYR B;  1QQI A;  4N4O B;  4M3E A;  5BS6 A;  1YFH A;  3RSN A;  2XDV A;  1HST A;  5HLI A;  5IT3 A;  4E7J A;  3OYA A;  5FFZ A;  1H0M A;  5FRM A;  5J8C A;  3RCO A;  4OOI A;  3K69 A;  2NS7 A;  4C2M J;  4HF1 A;  2A5W A;  4IXA A;  1ZEL A;  2EIJ H;  1L0O C;  2XGE A;  5E20 A;  4IHV A;  2BW3 B;  5EG0 A;  5FLX K;  5KK1 A;  3OYN A;  1JJ8 C;  1MNM C;  2W25 A;  2GXA A;  5ILV A;  1I1S A;  1DGW Y;  1ZHF A;  4Y17 A;  4M74 A;  1YYV A;  1ZG5 A;  2CH0 A;  3HUG B;  4P5O A;  1MZB A;  2VL8 A;  4ZYG A;  1HKS A;  1Z05 A;  2KDO A;  4I98 B;  5FKM A;  1Y1V J;  2RQQ A;  1BOB A;  4ZDP A;  2TRT A;  5HS9 A;  1IN7 A;  3F6V A;  2MYS A;  1U0J A;  3A0H C;  3BTI A;  4BEH A;  3L2C A;  1K78 A;  3C2H A;  3S14 J;  3E0J B;  2XAQ A;  1RKW A;  1RUO A;  3M3Y J;  4KT5 C;  2XSJ C;  3FF5 A;  1B6A A;  4N9H A;  2ME6 A;  1E3P A;  1UCR A;  4U88 A;  3L2W A;  3HRU A;  3F8C A;  1X1D A;  2FA5 A;  1Z67 A;  2FU4 A;  1ZRD A;  3PUF A;  3ZXS A;  1GT0 C;  1FOK A;  2M4K A;  3V8L A;  3H3V K;  3HM5 A;  3VB2 A;  1OYI A;  4Y15 A;  2VPL A;  4RDU A;  4N9I A;  4HLY A;  3LSK A;  3TP3 A;  4I6Z A;  1O7F A;  1ZGW A;  1JTX A;  2L9N A;  2KRH A;  2Y48 A;  1FP2 A;  4IQ4 A;  5E79 C;  3LA3 A;  4AIJ A;  1E3O C;  3S1M J;  1XD7 A;  1SFX A;  2AHQ A;  4HBL A;  4IVN A;  2G7H A;  2EZI A;  3PJR A;  2IGK A;  2D45 A;  1T56 A;  2X6W A;  2A61 A;  2QF7 A;  2Z33 A;  1SFO J;  3ZQI A;  4CCJ A;  3FK7 A;  1IN6 A;  4B4C A;  3V7R A;  4F93 B;  1YJN I;  1VQL I;  5K7H A;  3LSR A;  4V19 K;  3RZD J;  1TT0 A;  4RAG A;  1LJ9 A;  2W48 A;  3HKZ A;  1D3Y A;  3BOQ A;  3NEU A;  3J7Z I;  3DTE A;  4FQG A;  4DYR A;  2QQ9 A;  1V5F A;  4ZZD A;  3DLA A;  4R8H A;  2HYF A;  1HW5 A;  3LSI A;  2ZXI A;  2O61 A;  2JA7 J;  3UNG C;  3FZV A;  2MA3 A;  2RRE A;  3EUH A;  4I0A A;  4CIC A;  1XGO A;  2O6G E;  1SMT A;  1IRZ A;  2P4W A;  5LHG A;  4XL9 A;  1R7J A;  1OCO H;  1VQO I;  2R7Q A;  2BHZ A;  4IHW A;  1N25 A;  5KCM A;  5FLX Z;  4RB1 A;  1DDN A;  2PLY A;  1J0R A;  4RAZ A;  5EGO A;  2EFO A;  4BE1 A;  1R00 A;  4MFE A;  3UR3 C;  2VC0 A;  2JWT A;  1KU3 A;  1A6I A;  1QPM A;  2ELJ A;  5M5W J;  4A3D J;  5K7Z A;  4D5C A;  1OCP A;  3GWZ A;  2WAD A;  1PP8 F;  1AHD P;  2E35 A;  2RVC A;  3MVP A;  3H9G A;  5FLM J;  4CHU A;  2CUF A;  4Y4R A;  3PSF A;  2ZME C;  3U1D A;  5M3F J;  3U9G A;  4OU0 A;  2HDW A;  3NRV A;  5E3M A;  3FKI J;  3EYY A;  5TIS C;  5FRO A;  2D1V A;  4E4H A;  4AID A;  3B02 A;  3H5R A;  2L4M A;  4LOC A;  1USS A;  3WG7 H;  4ANJ A;  3OYD A;  2L5Q A;  4CCN A;  2FE3 A;  3TBI A;  2LY1 A;  2IGN A;  1TQI A;  4BUP A;  4HEA 2;  1YQA A;  3PSI A;  2CWE A;  1F4K A;  5CJ9 A;  3PO3 J;  3L1P A;  2ZJQ F;  2X48 A;  3PNV A;  4V2G A;  4B44 A;  4HLX A;  1OR7 A;  1OCT C;  4G12 A;  3HOT A;  2XF7 A;  1CGP A;  2DA2 A;  5BQT A;  2DMT A;  2DTZ A;  5L3G A;  3MQ0 A;  2DK5 A;  2VXD A;  3K4J A;  3JAM K;  4LD5 A;  3KZY A;  1B72 B;  3KYD B;  3AL0 C;  3GLL A;  3DQV C;  4XN3 A;  4S05 A;  1U9N A;  3OY9 A;  4ZZL A;  3OS1 A;  1WJC A;  1IRX A;  2V6C A;  1T38 A;  1D8J A;  2K9Q A;  2P7C B;  4NBQ A;  2WTE A;  4XKB A;  4XKV A;  5ED4 A;  2VQH A;  4RGR A;  3R6S A;  2CV0 A;  2Z1D A;  1ONV A;  3HC7 A;  3LSP A;  3EDP A;  5HOD A;  1Y8Q B;  3F8F A;  5HOO A;  1VFC A;  3MCZ A;  3CCL I;  1BR4 A;  3R0A A;  3TOB A;  3KYL A;  3C2B A;  2HKX A;  4RM2 A;  3HSF A;  1ZLJ A;  3WTT C;  2A6T A;  2GAU A;  4GCV A;  4I09 A;  2LMD A;  3TOA A;  5HS8 A;  1TQP A;  3GXO A;  4O3M A;  1A6Q A;  3DBL B;  3ZP5 A;  1W7P D;  2VN2 A;  4EJW A;  4U7B A;  2H27 A;  2VKH A;  3BTC A;  2EV6 A;  3HG9 A;  4EGZ A;  3S15 J;  2DA6 A;  5IP7 J;  1OLT A;  1KU9 A;  3B6A A;  3MZ8 A;  2OF7 A;  3LFU A;  3P9C A;  1JGG A;  2EFP A;  3I56 I;  2JA8 J;  4A12 A;  2JQ7 A;  3UKG A;  1IJW C;  4A0Y A;  2BVL A;  3BCB A;  4BAY A;  1QO0 D;  2OA4 A;  1VQ8 I;  2Y0M A;  2QLZ A;  3FBI B;  4ZTJ A;  2Y9Z A;  3CC7 I;  1HDP A;  3DFG A;  3V7C A;  2M7A A;  2UXN A;  3C18 A;  3SHF A;  3TDZ C;  1LEA A;  2Y30 A;  5IP6 A;  1FIA A;  3RZO J;  1VF9 A;  1HSJ A;  2BW3 A;  2W85 A;  1RNL A;  3I54 A;  1OMI A;  1OYW A;  5A2Q K;  2WBM A;  1I1G A;  4HF2 A;  2KIM A;  3WE3 A;  3PQJ A;  3WTX C;  4ESJ A;  1QBJ A;  3LQR A;  2MSY A;  4I76 A;  4A3C J;  2FMY A;  5EEA A;  4G6Q A;  2PEX A;  3ASO H;  1PUF A;  2K4J A;  1MBG A;  1K6Y A;  2DJI A;  3BY6 A;  4GO1 A;  3ZN1 A;  2ZNY A;  3T8R A;  4A3E J;  1EF4 A;  1JHF A;  4UVA A;  3K70 C;  3JAM Z;  3O8G A;  4Q48 A;  2XGC A;  5DYM A;  5JLW A;  4IRG A;  5J1R A;  2VI6 A;  2BYV E;  5IYD J;  3PO2 J;  4A3G J;  1NG7 A;  1PJR A;  2L3D A;  2P5L C;  3EQL F;  4C3I J;  5KNL A;  1NTC A;  3OIP A;  4W1U A;  2LR8 A;  4L5J A;  1Z77 A;  5L3F A;  1MSF C;  2DO7 A;  2DMQ A;  3I55 I;  1PP7 U;  2EIK H;  3ECH A;  3L2Q A;  3CCR I;  2IPQ X;  1O3T A;  1CQT A;  2EB7 A;  1WZ2 A;  1ZR2 A;  2JUG A;  1WH7 A;  2GZW A;  2DA1 A;  1G2H A;  1TT5 B;  1SFE A;  3HOZ J;  1B59 A;  3U2R A;  3GME A;  2HU9 A;  5LHH A;  3S2H J;  1VQ4 I;  1LNW A;  2K9L A;  3GFI A;  1HLV A;  2MC4 A;  3D0S A;  5FGM A;  4CCM A;  3I9V 2;  4E7Z A;  1JUP A;  3I5U A;  3NWT A;  1R22 A;  3H36 A;  1QU3 A;  2AQF A;  3SDB A;  1FBS A;  5HVQ C;  3VSL A;  4U0W A;  2A6E F;  2Y69 H;  5DEQ A;  4IOC F;  1AKH B;  1XSV A;  3VYT B;  1QA6 A;  4BHP A;  3FXQ A;  2RGV A;  3BPV A;  2P5K A;  5HDG A;  4QLC U;  1SC7 A;  2DQR A;  3FXK A;  3J7A O;  4AVZ A;  1BL0 A;  5ERI A;  5E3L A;  1X3U A;  4RMN A;  4BXX J;  2EZH A;  4AD9 A;  2L7M P;  5A2Q Z;  1B1B A;  2HQA A;  5LBQ A;  9ANT A;  2M0C A;  3OL4 A;  2DYS H;  3E6M A;  4CYD A;  3N97 A;  1STZ A;  4G7H F;  4ENM A;  2MBF A;  4EJU A;  2STT A;  3IWF A;  2ZXW H;  4IL6 C;  3ZQ7 A;  2OZ6 A;  4AU7 A;  1FNN A;  5LGU A;  2JVH A;  1MD0 A;  2QSF X;  3HKZ N;  3JTG A;  2O3F A;  4Q47 A;  2Y31 A;  1ETQ A;  2QUF A;  4XOP A;  1YIO A;  2GOX B;  2X0L A;  2YPR A;  3MKZ A;  1FX7 A;  4XKC A;  2XSD C;  3GUD A;  3ZQQ A;  5EG0 B;  1DQU A;  4WXC A;  4BJ5 C;  3KP3 A;  3HSE A;  2XV4 S;  3EUK L;  1FBU A;  1S29 A;  1K83 J;  2V6E A;  1N77 A;  3DP7 A;  1I3A A;  1YHQ I;  1K4T A;  4RGU A;  4QPQ A;  4N4N B;  4L5E A;  1O57 A;  2R4G A;  4BHB A;  3TL4 X;  3TW7 A;  4BBR J;  1ZG1 A;  3HDD A;  5E18 F;  3C7J A;  4NNJ A;  1FOW A;  4BEH B;  1LVK A;  1K78 B;  1TWA J;  2L7Z A;  3OYC A;  2DMN A;  1YS6 A;  3J7Y J;  5E1W A;  1IUY A;  2JA5 J;  5E1X A;  3TW6 A;  2VKV A;  3ZPL A;  3T8T A;  2DCE A;  1D0Y A;  4B48 A;  1U2W A;  2K27 A;  2L9S A;  2EZL A;  2F4M B;  1APL C;  3RDI A;  4ZJZ A;  4CZZ A;  4RGX A;  3S2W A;  4W97 A;  3F8M A;  3MKW B;  4XLC A;  4DJA A;  3K9T A;  1QZZ A;  2XAG A;  1FWZ A;  1OCZ H;  3IH2 A;  3RIR A;  5LD2 C;  3S17 J;  4BY7 J;  5C44 J;  4Y33 A;  5LFA A;  2HOS A;  2EH3 A;  2J5O A;  4QPO A;  5FLV A;  2JSP A;  3I0T A;  5ILS A;  4D5F A;  1OFC X;  4CA0 A;  2CSO A;  2KRC A;  5LGT A;  2EFQ A;  3D5R C;  3OS0 A;  4LB5 A;  2Y2Z A;  2DOD A;  3ABT A;  3WGI A;  3RPU A;  2P6S A;  3NWS A;  2TCT A;  2BY2 A;  2XB0 X;  1P6R A;  4XRM A;  3GEZ A;  4YFX F;  2M9H A;  1BW5 A;  3L7W A;  4RA2 A;  1R58 A;  1WJA A;  2G9W A;  2WAQ N;  1JKQ C;  3FXO A;  3F72 A;  4XQF A;  3OYK A;  3K7A J;  1IV6 A;  5GPA A;  2E1M B;  5K5Q A;  3Q0V A;  4IF4 A;  4KYW A;  2IS4 A;  2L2O A;  2XC7 A;  2R7T A;  4Y52 J;  4HV5 A;  3HPG A;  2HQN A;  3FIS A;  1LB2 A;  2DFH A;  2E1M C;  1MMD A;  3EUH C;  4L9V A;  4CXF A;  1X1P A;  3D5L A;  3RQI A;  3K4N A;  2R93 J;  5EGO B;  2E1C A;  2FXA A;  1T0F A;  1E2X A;  4AM3 A;  2D1H A;  3O6B B;  4I2O A;  3F21 A;  4UVB A;  2F5F A;  4L9T A;  2XRL A;  2ZNZ A;  1ZRE A;  5IYB J;  3RKX A;  2ETH A;  2LTP A;  5D4S A;  4BY1 J;  3OS2 A;  4HG2 A;  1PVE A;  2HYG D;  4ESB A;  2R5Z A;  3ROU A;  1SMY F;  5EEH A;  2P7V B;  1W5S A;  2ID6 A;  1G3S A;  2AO9 A;  1LEB A;  3SEQ A;  4TV7 A;  1Y39 A;  1R5H A;  5E17 F;  5CQE A;  1V5G A;  2WY8 Q;  3QOP A;  2G0E A;  1F9N A;  4KUM A;  2DT7 B;  2OJE D;  2BY0 A;  3MD2 A;  1LVA A;  2A69 F;  3DPT A;  1XS9 A;  1I27 A;  3TED A;  3E1S A;  1Z1D A;  1SEU A;  2YU9 J;  5EYR A;  5BOX A;  1FC3 A;  1ETX A;  1S6L A;  4ASN A;  4BS9 A;  1BI3 A;  1R71 A;  2N8G A;  1AU7 A;  2VJI A;  2WB1 A;  2ZC2 A;  5BPI A;  2RNJ A;  1FYK A;  3CP2 A;  5GPC A;  2CO5 A;  3HYI A;  2JUC A;  4FIS A;  4HX4 A;  1W36 C;  3CUQ A;  2B7E A;  3GF2 A;  2CW0 F;  3M8F A;  2AXT C;  3ERM A;  5HLH A;  2PBI A;  4UB8 C;  4ZDL A;  2KRF A;  1GVD A;  2EZK A;  4KMU X;  2IVM A;  4RAF A;  2BE5 F;  2RN7 A;  2FRH A;  2EQR A;  2M87 A;  4YFN F;  1UST A;  3S16 J;  4MFD A;  4IOA F;  2X1D A;  2EIM H;  3L09 A;  3PFY A;  2K3F A;  4KMF A;  4F7Z A;  2NNN A;  1B8I A;  4MEY F;  5J4Y A;  2DA3 A;  2HPI A;  1FSH A;  2LKS A;  1RI7 A;  2KJB A;  2L0K A;  3TGN A;  2WY7 Q;  4BBS J;  1EA3 A;  1AWC A;  3U1K A;  3VDX A;  3QPS A;  3RI4 A;  1YW8 A;  1BIB A;  5F1J A;  2JRT A;  4KJZ A;  4LLG F;  4P9U A;  2KPM A;  1B9M A;  5J8F A;  2QA4 I;  3CZ6 A;  3GZ6 A;  2B9S A;  3S3M A;  2LK2 A;  2B0L A;  1HCR A;  3AG3 H;  5B66 C;  1JTY A;  4I01 A;  3CF5 F;  4DBQ A;  2DAO A;  1D5V A;  3DF8 A;  1P2F A;  2UWM A;  1X2N A;  4OMY A;  2LNB A;  3R0J A;  1U8B A;  2GXB A;  2D2W A;  4JX4 A;  3SZG A;  2ZJR F;  1VQM I;  3N4M A;  1DU0 A;  1EH8 A;  1D1B A;  2R3S A;  2A68 F;  3KE2 A;  3OSG A;  2R7W A;  4O6J A;  2LLK A;  2PMZ A;  2BY3 A;  1W0U A;  2H09 A;  4LG3 A;  4LLL A;  1YX3 A;  1IUF A;  2DI3 A;  1X1B A;  1HOM A;  3DU6 A;  3F9K A;  4FTH A;  1O4X A;  1X2M A;  5C4X J;  3JCU C;  2GIZ A;  5HNH A;  3C1D A;  4HDU A;  1JUM A;  3OIO A;  2ZB9 A;  3HOS A;  5HDK A;  2AS5 F;  1R6R A;  3HZJ A;  3IH3 A;  1PUF B;  4YG2 F;  4OIO F;  3I4N J;  1BJZ A;  3OIQ A;  1HDD C;  4M9Z A;  2HOA A;  3R60 A;  4EV0 A;  2CV1 A;  3QYE A;  3BDD A;  4FET A;  3ERE D;  1ZLK A;  3K2Z A;  2KHM A;  1I39 A;  4CCL A;  2O8X A;  1D0X A;  2OCC H;  2ZO4 A;  2VBX A;  4IZZ A;  3LA2 A;  3REO A;  1FY7 A;  1OCR H;  1G3Y A;  2EV5 A;  3CME I;  2Y75 A;  4P9F A;  1MBE A;  3ZCO A;  5ILU A;  1U5T A;  2XF6 A;  3G6E I;  2F5D A;  1PYV A;  1FLI A;  3BG3 A;  3OL3 A;  3KZI C;  4AYB A;  1U8R A;  1XSD A;  1SVO A;  2DMU A;  2K7L A;  2VUM J;  1NHA A;  3K4K A;  1U9O A;  3DLL F;  1K6O A;  1MJA A;  2P0W A;  1HQC A;  4E7K A;  5M3M J;  3J81 K;  3BR0 A;  2FBI A;  2VPR A;  4YRV A;  3LNQ A;  1DPU A;  1Y8R B;  3IRR A;  1Z9C A;  1QVU A;  2H94 A;  3ZMS A;  4R1H A;  3WTW C;  4A5N A;  2Z9O A;  2ECB A;  5FRN A;  2EFN A;  1LQ1 A;  2VBW A;  2HDC A;  2RNG A;  2E71 A;  1U6G A;  2Z16 A;  5K1Y A;  4HX8 A;  3GZ5 A;  5JFR A;  2CJJ A;  2GXG A;  1POG A;  1MDM A;  5JR3 A;  2LY2 A;  2ICW G;  2YU3 A;  2I5U A;  3MN2 A;  2A05 A;  3VFZ A;  3V4G A;  4E7L A;  4A3M J;  1OCC H;  4E6K G;  3OSF A;  3CMM A;  5FD5 A;  2HVS A;  3GW2 A;  3SEZ A;  2Y0S A;  4JX5 A;  2E60 A;  1WPK A;  2KL4 A;  1XCB A;  4Q5S F;  1S8N A;  1V54 H;  2IA2 A;  3GVA A;  5DD8 A;  4LLN A;  4XRS G;  2JK3 A;  4P1W A;  4A3I J;  1AA7 A;  4BQQ A;  5CVI A;  3S32 A;  2VKE A;  2CQQ A;  1XDS A;  1CF7 B;  3FM5 A;  3KP2 A;  3DKW A;  2NVX J;  1FSE A;  2JPB A;  3IHU A;  3HBL A;  3BT9 A;  1MMG A;  4QTR A;  4BYY A;  5L3B A;  3ZOB A;  2HR3 A;  2ZJ2 A;  4HAM A;  4ETS A;  1YRN A;  2NXN B;  2DU9 A;  3HXL A;  5B1B H;  5IOZ A;  3HRT A;  3GTK J;  2OQR A;  1W5T A;  1R4M B;  2EPF A;  1R4N B;  1BI1 A;  3BCA A;  3WU1 B;  2E19 A;  4OIR F;  2GM4 A;  3ABM H;  3SJM A;  2QQ8 A;  2KP6 A;  1IGN A;  4FE7 A;  3Q9V A;  3CDH A;  4MGR A;  1R1U A;  1LFP A;  1ZAR A;  4ENJ A;  3GFM A;  4CSW A;  2JVG A;  1BJA A;  2VE8 A;  1K4S A;  3OR2 C;  4E7S A;  5L3E A;  3CQZ J;  3H3U A;  2CGP A;  4GFB A;  2DOA A;  3G3Z A;  2CUE A;  3O2P E;  3DEU A;  4M72 A;  3FWE A;  1G8X A;  2O0Y A;  3K4B A;  4B09 A;  2JA6 J;  3GTP J;  3SYT A;  1VQK I;  1TW2 A;  3DPU A;  2LC2 A;  1QZY A;  4HQE A;  1FJL A;  2A3S A;  2X85 A;  5E3O A;  4CDG A;  3S93 A;  3ZQF A;  3J81 Z;  5BNG A;  4XOR A;  1IRG A;  1V4R A;  2GA1 A;  1MJB A;  1JXS A;  5CVJ A;  1S7O A;  4D9J A;  2DA4 A;  3HOX J;  3F0C A;  5CKT A;  3I3L A;  3HPH A;  4Z6Y A;  4DGW B;  2ZJP F;  2L02 A;  4LIU A;  3MZH A;  1IAW A;  2YSR A;  1IZ1 A;  4HRI A;  3LAJ A;  4XLP F;  3Q3S A;  3KPH A;  5ICF A;  5GTI C;  3VPR A;  3MFK A;  4XLE A;  4LFU A;  3I64 A;  3G71 I;  4KIF A;  2PG4 A;  1D8K A;  3U21 A;  5FD6 A;  4UUS A;  2IBD A;  5JVG F;  3CLO A;  4C3H J;  3QP6 A;  4CCO A;  2MH9 A;  4IHS A;  2ZCW A;  2DBB A;  4M3G A; 
#chains in the Genus database with same CATH homology
 1JJ6 C;  3S2D J;  3IV5 A;  4D7M A;  2KT0 A;  2O7O A;  2WB1 N;  2O9L A;  2X6O A;  5F0F A;  2M8G X;  1UG2 A;  3BR2 A;  1WH5 A;  4FE4 A;  1JT0 A;  2Y9Y A;  3HKZ N;  4MLO A;  2Y31 A;  1H89 C;  1ETQ A;  2ELK A;  4M3B A;  1NK3 P;  3BR3 A;  1IG7 A;  2XSD C;  2KDZ A;  4EEF G;  5EG0 B;  1ZQ3 P;  1Y1W J;  1K83 J;  3A02 A;  5C4J J;  4XK4 A;  2FJ1 A;  2RAE A;  3BR6 A;  3Q0W A;  4MO7 A;  2HDD A;  2WV1 A;  1IDZ A;  3A01 A;  1Z0X A;  1MBK A;  4L5E A;  3GTQ J;  3WHC A;  4M3D A;  3TW7 A;  1ZTR A;  3GTG J;  4BBR J;  2DA5 A;  1FEX A;  3HDD A;  1SAN A;  3GTL J;  3BTL A;  1GV2 A;  1D5Y A;  3BR5 A;  4XRS A;  1TWA J;  2L7Z A;  2DMN A;  2R5Z B;  4QIW N;  1GUU A;  2JA5 J;  5E3N A;  1ETY A;  3TW6 A;  2VKV A;  3JRH A;  5FKO A;  3NAU A;  3JRE A;  1ZKG A;  5GP9 A;  2HXI A;  4IHX A;  2EZL A;  4XIC A;  1APL C;  2HOT A;  1ORK A;  4W97 A;  5EZH A;  1AKH A;  5EZG A;  1ETK A;  4FCY A;  3TP0 A;  3GTM J;  2QCO A;  1VI0 A;  1R9T J;  3IH2 A;  1Q1V A;  3S17 J;  1QRY A;  4BY7 J;  2O8K A;  5C44 J;  4DZP A;  1TWG J;  1WGX A;  2EH3 A;  3BG5 A;  3BG9 A;  2HOS A;  5FLV A;  4Y7N J;  2NOG A;  2LKX A;  2XB5 A;  4NDL A;  1ETV A;  4X1E A;  4D5F A;  1OFC X;  3E7L A;  2P81 A;  1XG1 A;  3PM1 A;  1A5J A;  2Y2Z A;  4M3E A;  2NS8 A;  1MBF A;  1WI3 A;  2CRG A;  5F04 A;  1JKP C;  1IC8 A;  2TCT A;  2XB0 X;  5C3E J;  1JKR C;  4XRM A;  2M9H A;  2B63 J;  2LY9 A;  1BW5 A;  2WAQ N;  1MBH A;  1JKQ C;  4C2M J;  2NS7 A;  3S1R J;  2XGE A;  3K7A J;  4IHV A;  2E1O A;  1IV6 A;  5GPA A;  5EG0 A;  3Q0V A;  2R7Z J;  2FD5 A;  4Y52 J;  3JR9 A;  1JJ8 C;  1MNM C;  3FIS A;  1RES A;  2R92 J;  1B8I B;  1LE8 B;  3FIW A;  3RQI A;  1ETW A;  2R93 J;  5EGO B;  5FKM A;  4BKX A;  5JLX A;  1Y1V J;  3D1N I;  2TRT A;  4IEJ A;  3LSG A;  2XRL A;  1WCM J;  3BTI A;  5IYB J;  3S14 J;  2LTP A;  1RR7 A;  4BY1 J;  1RKW A;  3M3Y J;  2E2I J;  1JT6 A;  2R5Z A;  1XC5 A;  2ME6 A;  5F08 A;  2ID6 A;  1F43 A;  2AO9 A;  2IEK A;  1LFU P;  1GT0 C;  1JKO C;  5EF6 A;  3HM5 A;  5IP9 J;  3H3V K;  4ABZ A;  2G0E A;  4RDU A;  5FJ8 J;  3TP3 A;  4I6Z A;  2JMW A;  1ZGW A;  1F36 A;  1JTX A;  1XS9 A;  3CDL A;  1MH3 A;  1I3Q J;  3TED A;  1E3O C;  3S1M J;  2AHQ A;  3DEW A;  2YU9 J;  5EYR A;  2EZI A;  1ETX A;  1GDT A;  2LFB A;  1I50 J;  2DN0 A;  2MG4 A;  1T56 A;  2N8G A;  1AU7 A;  3GTO J;  2QF7 A;  1SFO J;  3B6C A;  4J19 A;  4A3L J;  3ZQI A;  1DU6 A;  3FK7 A;  2FQ4 A;  2YUS A;  4B4C A;  5GPC A;  5K7H A;  3LSR A;  3RZD J;  4FIS A;  2DJN A;  5IYC J;  2W48 A;  1OJL A;  4DYR A;  4JYK A;  5FKL A;  1GVD A;  2EZK A;  2E2J J;  4QSH A;  2EQR A;  4A3F J;  2JA7 J;  2HYJ A;  3BQY A;  3S16 J;  3JRA A;  3QPL A;  4MFD A;  1IRZ A;  4A3K J;  2ECC A;  4UUT A;  1RET A;  3FK6 A;  3A03 A;  1W0T A;  1B8I A;  4IHW A;  3SDG A;  2DA3 A;  3NAR A;  4MIM A;  5EGO A;  2L0K A;  4BBS J;  4MFE A;  3QPS A;  3G1L A;  2JWT A;  5EDN A;  2NVQ J;  5F1J A;  3S1Q J;  1A6I A;  2I10 A;  5M5W J;  1ZK8 A;  2PMZ N;  4A3D J;  5K7Z A;  2COB A;  4A69 C;  3LSJ A;  3O8H A;  4D5C A;  1OCP A;  1JUS A;  1AHD P;  2LK2 A;  3RKQ A;  1HCR A;  3W6V A;  1JTY A;  3MVP A;  5FLM J;  1P7I A;  4JP0 A;  4B1R A;  1NK2 P;  2CUF A;  5FKN A;  5M3F J;  4C3J J;  5E3M A;  3FKI J;  1X2N A;  1U8B A;  3HGG A;  2K9S A;  4JX4 A;  1DU0 A;  1ENH A;  2K9N A;  2JN6 A;  4LOC A;  3SFI A;  3JRC A;  3OSG A;  3K2A A;  2XPW A;  3HOV J;  5M5X J;  2LLK A;  3HOU J;  1W0U A;  3ZQC A;  2OPT A;  3JRB A;  1IUF A;  3PO3 J;  3L1P A;  2X48 A;  1HOM A;  4FTH A;  1O4X A;  1X2M A;  4V2G A;  2JJ7 A;  5C4X J;  3CCY A;  1QPI A;  1OCT C;  3LOC A;  2CU7 A;  1JUM A;  4G12 A;  3OIO A;  3ZQL A;  2ZB9 A;  2DA2 A;  4CYC B;  2DMT A;  2DTZ A;  1PUF B;  3IH3 A;  4AYB N;  2LP0 A;  1YRN B;  3BR1 A;  3I4N J;  1BJZ A;  2ME0 A;  2MW8 A;  5DS9 A;  2HOA A;  1B72 B;  1HDD C;  4A3B J;  2CQX A;  1QVT A;  1U9N A;  3BQZ A;  1UMQ A;  3BTJ A;  1UHS A;  2HI3 A;  4D7N A;  3JRD A;  2FX0 A;  4DYQ A;  2K9Q A;  4A93 J;  2XPU A;  3ZQH A;  3LSP A;  1TWF J;  1MBE A;  5HOD A;  1VFC A;  2M2E A;  3BG3 A;  3C2B A;  4DYC A;  2DMU A;  2VUM J;  1U9O A;  2H1K A;  2Y0S N;  3CMY A;  5M3M J;  3BR0 A;  2VPR A;  2GLO A;  2IAI A;  3LNQ A;  4XID A;  3H0G J;  3BTC A;  3DCF A;  1QVU A;  3S15 J;  2DA6 A;  5DTD A;  5IP7 J;  3B6A A;  2ECB A;  2OF7 A;  1JGG A;  5F27 A;  1TC3 C;  2JA8 J;  2GBY A;  2ID3 A;  3GTJ J;  1MSE C;  3UKG A;  1IJW C;  2CJJ A;  1POG A;  3HOY J;  3QQA A;  1IDY A;  5F0C A;  2R0Q C;  3MN2 A;  3ZQG A;  4A3M J;  2Y9Z A;  1GV5 A;  3IH4 A;  4X6A J;  1HDP A;  3OSF A;  2EBI A;  3JRF A;  4JX5 A;  5IP6 A;  2Y30 A;  1FIA A;  1RKT A;  3JRI A;  3RZO J;  1WPK A;  1H8A C;  1VF9 A;  3GBG A;  1FIP A;  2R5Y B;  4JX6 A;  4XRS G;  3JRG A;  2JK3 A;  4UUS B;  4A3I J;  5IOY A;  3HOW J;  4S0H B;  2VKE A;  2CQQ A;  1X58 A;  3G1O A;  1LE8 A;  5K7F A;  2NVX J;  2XPV A;  3OOU A;  1ETO A;  2MSY A;  3HBL A;  3WHB A;  3BT9 A;  4I76 A;  4A3C J;  4QTR A;  5EEA A;  4CYC A;  2D5V A;  2YS9 A;  1ITY A;  2XGD A;  2K40 A;  3ZOB A;  4AUX A;  1PUF A;  3S1N J;  1MBG A;  1YRN A;  1LFB A;  5IOZ A;  4IHY A;  1B72 A;  3GTK J;  1I6H J;  3Q0U A;  2L9R A;  3G1M A;  2MGQ A;  4A3E J;  1MBJ A;  2E19 A;  1EF4 A;  2GM4 A;  3SJM A;  2LD5 A;  1IGN A;  3HEF A;  3O8G A;  4FE7 A;  2XGC A;  4M6V A;  5J3L A;  5JLW A;  1T33 A;  4RBO A;  5J1R A;  2VI6 A;  5IYD J;  4AC0 A;  3PO2 J;  4A3G J;  4C3I J;  1NTC A;  4W1U A;  3CQZ J;  1S7E A;  2LR8 A;  1Z77 A;  1MSF C;  4GFB A;  1TWC J;  2DMQ A;  2CUE A;  3HGY A;  4HNV A;  2LVS A;  1MH4 A;  1CQT A;  5IPA A;  1P7J A;  2NVT J;  1ZR2 A;  1WH7 A;  3MKL A;  5J1U A;  2JA6 J;  2DA1 A;  1G2H A;  3I4M J;  3A01 B;  3GTP J;  3HOZ J;  1RPW A;  3M4O J;  3HB9 A;  1ZR4 A;  1FJL A;  1BW6 A;  4B3A A;  1FTT A;  3S2H J;  5E3O A;  2HQ5 A;  2DA7 A;  3ZQF A;  5J1Y A;  5BNG A;  1HLV A;  5FKK A;  2M34 A;  1K61 A;  1FTZ A;  1H88 C;  1JUP A;  1VND A;  2DA4 A;  3HOX J;  3F0C A;  5M5Y J;  4V2F A;  3Q3S A;  2H8R A;  2HXO A;  3VPR A;  1HF0 A;  1AKH B;  2DMP A;  4A3J J;  4DZJ A;  2R5Y A;  2NVY J;  4UUS A;  2E2H J;  1BA5 A;  2IBD A;  2L7F P;  4M3F A;  1BL0 A;  5E3L A;  4C3H J;  4DW6 A;  4BXX J;  2EZH A;  2X9D A;  5F0H A;  2L7M P;  1TWH J;  9ANT A;  1U78 A;  2M0C A;  4M3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...