5EF6A

Structure of hoxb13 complex with methylated dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
61
structure length
61
Chain Sequence
b'RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Hox-B13
publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 61
sequence length 61
chains with identical sequence B, G, J
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ef6A00
1FIAA 2ME0A 3GBGA 3MVPA 4JX6A 3JR9A 1GT0C 1AKHA 3HOXJ 1MBGA 3O8HA 2O7OA 4M3GA 1GV2A 1WPKA 3FIWA 5F08A 4A69C 1ZKGA 3S1RJ 4A3IJ 4NDLA 3TW7A 2X48A 4C3IJ 4AYBN 4UUSA 2GLOA 1HDDC 1MSFC 4DW6A 2DMNA 4MIMA 5J1RA 2XSDC 3BR2A 4DYRA 1ETQA 3HDDA 3HOZJ 1JGGA 3QPSA 1ENHA 1JKRC 2EQRA 1D5YA 2H1KA 2ELKA 3HOVJ 4X1EA 2JA7J 5FKNA 1W0TA 1U9OA 5M3MJ 1AHDP 2E2IJ 5M3FJ 2E2JJ 3S14J 1NTCA 1F36A 2VKVA 3G1OA 5BNGA 4DYCA 1WI3A 3BTIA 4B1RA 1OJLA 1SANA 2OPTA 1Y1WJ 4A3JJ 3LOCA 3BR1A 1MBEA 3IH2A 1T33A 2ECBA 5GPCA 4D5FA 3VPRA 3UKGA 3DEWA 1FEXA 3Q0VA 1WCMJ 2EZKA 1VFCA 4Y7NJ 2YUSA 4RBOA 1FTTA 3BTLA 3GTGJ 3FISA 9ANTA 1ETYA 4A3EJ 3GTOJ 5F1JA 3K7AJ 3S2DJ 4QTRA 3C2BA 2O8KA 1JT0A 2EH3A 3OOUA 3Q0WA 2DA4A 1HF0A 1ETXA 3Q3SA 1YRNB 3BT9A 3S17J 3BG9A 2DMUA 3G1LA 2L9RA 3PO2J 1RKTA 1OFCX 2LY9A 5JLXA 4B3AA 5DS9A 2QF7A 3IH3A 4A3MJ 1H8AC 3BG5A 2JA8J 1W0UA 4C3HJ 3BR6A 2VI6A 4BBSJ 4FISA 4L5EA 2HYJA 1VI0A 4M3EA 3CQZJ 4M3FA 2Y0SN 3JRBA 4XICA 2HOTA 5GP9A 1YRNA 1B8IB 4A3CJ 2P81A 1TWHJ 5E3LA 1I6HJ 1ETKA 1K61A 1XC5A 1EF4A 4FE7A 1IC8A 3M3YJ 1IRZA 3BR3A 2XPVA 2HOAA 4GFBA 1TC3C 1WGXA 1UMQA 2M0CA 5IP6A 2E2HJ 2ME6A 1GVDA 3A02A 4D7NA 1JKQC 1ZGWA 4M6VA 2XRLA 4W1UA 5EYRA 1JTYA 1ZTRA 1HOMA 3PO3J 1B8IA 3F0CA 1UG2A 2RAEA 2XPWA 4JP0A 5J3LA 2HOSA 1LE8B 1H89C 2FD5A 2LVSA 1OCPA 1X2MA 2VKEA 2R5ZB 1MBHA 1A6IA 1FIPA 2DA7A 3JRCA 3TEDA 2R0QC 1DU0A 1BA5A 3Q0UA 2K9NA 2LLKA 4JYKA 1ETOA 3HOWJ 4A3FJ 1BJZA 3JRIA 4BKXA 3JRFA 5E3MA 4MLOA 2E1OA 2JA5J 4DZJA 4IHYA 1QVUA 5F27A 5K7ZA 1WH5A 4IHVA 3FK7A 3BTCA 4ABZA 4C3JJ 1LE8A 1MH4A 4S0HB 1TWGJ 1U78A 3TP0A 2R5ZA 2EZLA 3SFIA 5C4XJ 2HI3A 1P7JA 1RESA 1CQTA 1GUUA 2Y2ZA 2COBA 2LFBA 1Q1VA 2M2EA 4UUTA 3S2HJ 4A3GJ 3A03A 2LD5A 2JK3A 3OSFA 2LP0A 1P7IA 3GTPJ 1XG1A 1JJ6C 3G1MA 1R9TJ 2HQ5A 4W97A 2JWTA 1APLC 4G12A 1BL0A 1JUPA 4DYQA 2QCOA 3LSRA 4JX5A 1TWFJ 3NAUA 3S1NJ 4M3DA 5F0HA 1ORKA 2WAQN 3OSGA 1MNMC 5FKLA 2GM4A 3SJMA 2YU9J 1RPWA 3NARA 4MFEA 4EEFG 2LK2A 1IGNA 1LFUP 2YS9A 2R92J 2MSYA 1U8BA 3RQIA 2HDDA 1QRYA 2L7FP 3B6CA 4A3KJ 1FJLA 5M5YJ 2O9LA 1ETVA 2OF7A 1MH3A 4FE4A 2TRTA 5E3NA 5JLWA 4XRMA 3ZQGA 1NK2P 3I4MJ 5HODA 1VNDA 5F0FA 3BG3A 2X6OA 1MBFA 2CQXA 2H8RA 2CUFA 1HCRA 1IUFA 3HB9A 5E3OA 3IH4A 3H0GJ 3ZQLA 1XS9A 1A5JA 2KT0A 4XIDA 2M34A 2XB0X 3RZOJ 1QPIA 2L7MP 1Y1VJ 2Y31A 2CRGA 2DA5A 2JJ7A 3QPLA 3O8GA 2IAIA 2NS8A 2EBIA 2VUMJ 2XGEA 3HBLA 4CYCB 1S7EA 5IYDJ 2ID3A 1IG7A 4Y52J 3RKQA 3CDLA 5GPAA 2FQ4A 4I76A 2NVTJ 3RZDJ 2DA3A 1WH7A 3BQZA 5K7FA 2X9DA 4IHWA 3LSGA 2K9QA 4AC0A 5EGOB 2DTZA 2I10A 4XRSG 4XRSA 1E3OC 1IDZA 4XK4A 3WHCA 1GV5A 2E19A 3TW6A 5C44J 3GTQJ 2NVYJ 4CYCA 2M8GX 1ZQ3P 4IEJA 3LSJA 3IV5A 1I3QJ 2NOGA 1B72B 3BR0A 3BTJA 4V2FA 5M5XJ 2HXOA 3QQAA 5FKMA 3HOUJ 1FTZA 2L0KA 5EEAA 5EF6A 5FJ8J 1T56A 2TCTA 3ZQCA 3GTKJ 2XPUA 1RETA 1Z77A 2D5VA 1IJWC 3I4NJ 2LKXA 1UHSA 2JN6A 2ID6A 5EGOA 3MN2A 4FCYA 4A3BJ 3LNQA 1POGA 3H3VK 3JRGA 1JUMA 3HGYA 3CCYA 1IV6A 1MSEC 2GBYA 1JJ8C 1B72A 2JA6J 1G2HA 5EDNA 1HDPA 1BW5A 2B63J 3K2AA 4MO7A 1F43A 5DTDA 4D7MA 2CJJA 4M3BA 4D5CA 5IOYA 2R5YB 2EZIA 4DZPA 5C4JJ 4A3LJ 2DMPA 1RKWA 4I6ZA 2Y9YA 2HXIA 5J1UA 2NS7A 4HNVA 5EZGA 3FKIJ 5FKKA 4RDUA 1H88C 3HOYJ 2DN0A 3JREA 3B6AA 3A01B 5IPAA 5M5WJ 2K9SA 2DA6A 4LOCA 1JKPC 5K7HA 3HGGA 4QSHA 5FLVA 2CUEA 1NK3P 1HLVA 5EZHA 4BXXJ 2AO9A 4A3DJ 2DJNA 2PMZN 2NVXJ 2R5YA 5F04A 5IP9J 2DA2A 3ZQIA 2JMWA 1TWCJ 2MGQA 5EG0B 1LFBA 1U9NA 5IP7J 3GTJJ 2LTPA 3HEFA 5C3EJ 4B4CA 2W48A 3A01A 1BW6A 3HM5A 2MW8A 1AU7A 2AHQA 1X2NA 3JRHA 2IEKA 1JT6A 3S1MJ 2KDZA 2MG4A 1OCTC 2CQQA 3TP3A 2LR8A 2DA1A 1GDTA 5FKOA 1Z0XA 4C2MJ 4IHXA 1K83J 2R93J 2FX0A 4MFDA 1DU6A 3L1PA 5EG0A 1MBKA 5FLMJ 3BR5A 3D1NI 1QVTA 3JRDA 4FTHA 3GTMJ 2IBDA 2M9HA 3JRAA 3ZQFA 2Y9ZA 3M4OJ 1SFOJ 1MBJA 2XGDA 3ZOBA 5F0CA 2WB1N 1ZR2A 2L7ZA 1ETWA 3BQYA 3S15J 4QIWN 3GTLJ 3CMYA 1JTXA 1JKOC 2Y30A 5J1YA 1PUFB 3WHBA 2ECCA 2N8GA 2EZHA 3ZQHA 2CU7A 4J19A 2DMQA 1I50J 1IDYA 2ZB9A 4BBRJ 1AKHB 5IYBJ 3LSPA 1TWAJ 1ZR4A 4JX4A 1X58A 2NVQJ 1VF9A 5IOZA 1ZK8A 2DMTA 2K40A 3SDGA 4UUSB 4BY7J 1O4XA 1ITYA 1RR7A 2FJ1A 5IYCJ 4V2GA 2R7ZJ 2XB5A 3PM1A 3OIOA 1PUFA 1JUSA 3S1QJ 3HKZN 2WV1A 3FK6A 4BY1J 2G0EA 4X6AJ 4AUXA 2VPRA 3MKLA 3W6VA 4A93J 3E7LA 3DCFA 2XGCA 3S16J
chains in the Genus database with same CATH superfamily
1Y0NA 1TP4A 2ME0A 3MVPA 3BCAA 2IVMA 5ILSA 2F2EA 1ZKGA 1IZ1A 4NDLA 3TW7A 1EJ9A 4CSWA 2LREA 2GLOA 5J1RA 4MIMA 2PMZA 3HSEA 3BR2A 3HDDA 3LA3A 3QPSA 4YG2F 1ENHA 2V1UA 2OBPA 4FT8A 4HDUA 4MEYF 1J59A 5KNLA 3JSPA 2VXDA 4X1EA 2R7WA 5IY5H 3WTYC 3I56I 5FKNA 1BR4A 3DBRB 2QQ8A 1AHDP 2DYRH 2E2IJ 4UB6C 2HWVA 4G94A 5M3FJ 2VT2A 2LDUA 4AIHA 3F23A 1WI3A 4B1RA 4KIFA 3J7YJ 1ZAOA 3A0HC 2RNGA 4A3JJ 3LOCA 2DCEA 3BR1A 2M7AA 2ECBA 3TDUC 4E4HA 5ILVA 2CS3A 1MMNA 5GPCA 4ESBA 2VKDA 3E97A 3QOEA 3BROA 1WCMJ 3LSHA 4I09A 1VFCA 1T0FA 3OYHA 3HRTA 3GTGJ 3FISA 2E1MB 4A3EJ 2FU4A 3CJQB 3ZMSA 1WSUA 2QYOA 5K5OA 2OAZA 1ZN2A 4PJJA 3SXYA 3K4CA 2O8KA 2NXNB 1S3JA 3GW2A 4BACA 5LRSA 3VYSB 1LVAA 1JE8A 3EDPA 4NUBA 2Y48A 2E1NA 3CMEI 3CLQA 5ICCA 3P9KA 4XLPF 1Q1HA 2DA4A 4CCMA 1HF0A 3MQ0A 3Q3SA 2O61A 4BQNA 3BG9A 1UG0A 4XONA 2E5ZA 2VLAA 1DPUA 3L2CA 1WWXA 1XN7A 3SQNA 2V79A 4B3AA 1RZ4A 2P6SA 3ASNH 3V7SA 2ZNZA 3IH3A 3K4NA 1H8AC 2H6CA 4C3HJ 1YFHA 3M1EA 2KIQA 3R6SA 5E18F 4KMFA 2VI6A 2XF6A 1QHGA 2KQRA 5DYMA 4NNJA 4KT5C 4EM0B 4PUSA 4M3FA 3HG9A 3RTRA 4XICA 2ZSHB 3GMEA 2A6EF 4OAYA 3K70C 2ZMEA 5E1ZB 4A3CJ 5FFZA 5E3LA 4BE2A 5CVIA 1K61A 2Y0MA 2EILH 4IKFA 3CZ6A 1EF4A 2CMPA 3M3YJ 3W2VA 1IRZA 3KP4A 2MH9A 2EIKH 2M0CA 1QQIA 1IXRC 3GWZA 2X85A 4BYYA 1PP7U 1WI9A 1FBUA 3I3LA 4B43A 1D0YA 1OQYA 3KEQA 4UVAA 3V7CA 3CJTB 3T0YA 1O3SA 4IOAF 2Z3YA 4M6VA 2MLGA 3F8NA 2ZXWH 1A31A 4U87A 5EYRA 5J47A 1KYWA 1U8RA 3A0BC 1B8IA 3KP5A 3J80Z 5J3LA 1LE8B 4PJLA 3F21A 1H89C 1Z7UA 3HTUA 1OCPA 3CC4I 4RLQA 1J5YA 1D8JA 1A6IA 2R3SA 4OMZA 1DU0A 2CW0F 3TKYA 1SD6A 1RNLA 1VQKI 5IT9Z 2XHKA 2EFWA 3ISPA 1X1CA 1XD7A 2DTRA 5E3MA 1OR7C 1WJAA 3J7ZI 3TO7A 4WF2A 4P5OA 1JXSA 2K4JA 4MTEA 2F5VA 3KZYA 4L9TA 3MCZA 3FHNA 3E6MA 3TP0A 4LLNA 3W3CA 5C4XJ 2HI3A 2UZKA 1P7JA 3L2QA 2PEXA 3FXQA 1S7AA 4U7BA 3S2HJ 1YJ9I 2RREA 4C30A 3ZP5A 2D45A 3OSFA 2BY3A 3F3XA 2ZCWA 5FD6A 3GYHX 2P7VB 3PFIA 3R61A 4M73A 2HDCA 1JJ6C 2J5OA 5BS6A 2EFPA 4Y4RA 2EPFA 1R5GA 2ZXJA 2JWTA 4GGGA 4KYWA 3GF2A 3ASOH 1JUPA 1Y39A 5FD5A 3LSRA 4JX5A 3PQKA 1HXDA 4I98B 4EVIA 1OLTA 4M3DA 1P6RA 2MA3A 3OSGA 5FKLA 2L9SA 3SEZA 4J00A 2X1DA 3K6GA 3NARA 1O3TA 1IGNA 2YS9A 2MSYA 2XGXA 3PL8A 1U8BA 1YJNI 4U0VA 4ZYGA 2VC0A 3E5QA 5D5VB 1FJLA 1S8NA 4JQFA 4LK0F 1ETVA 2W82A 1OPCA 2OF7A 1Y6IA 4PGHA 2V1NA 1VQLI 3VB2A 5F0FA 1ZREA 4JOMA 1VTNC 1MBFA 1SEUA 1VQ5I 2M5WA 1Z67A 1HSTA 5BPIA 2IS2A 1J7KA 1SVMA 4HF2A 2UWMA 5E3OA 3IH4A 1F5TA 3KYDB 1XSDA 2JRMA 4MQ9F 2I5UA 5BPDA 1PDNC 1FOKA 4B44A 1X3ZB 3E1SA 4XIDA 1G8XA 3SFZA 1KGSA 1I27A 2MD5A 2XKOA 4UUVA 1R22A 2HGCA 1ZRFA 1XDUA 1O57A 2DFFA 3OYAA 4OWRB 1SVLA 2KZGA 1VQ7I 2BXYA 2BHYA 5ICGA 3TO6A 3GZNB 3QPHA 2ID3A 3OYFA 1E0EA 4YFKF 3RSNA 5H6QA 3RKQA 5DDGA 3WTTC 2HS5A 5K1YA 1WJFA 3BY6A 4I76A 5LFAA 1OYYA 4BJTA 3BQZA 2X6YA 2X9DA 3RQ4A 1Z3YA 3D5LA 3LSGA 2DPDA 3WU1B 1WHUA 4HV6A 2RQQA 2JSCA 4BEHB 2CSOA 2L9VA 3CCQI 5HNFA 2DTZA 2I10A 3S3OA 1BBYA 3J81K 4XRSA 2DJIA 1IDZA 2HDWA 3WHCA 1P4XA 3LA2A 1ZH5A 2D2WA 4E6KG 2NVYJ 2AXTC 4CYCA 1XX5A 4BNCA 1E2XA 4XKVA 3IV5A 1K4TA 1S6LA 2F4MB 4KITB 1FYLA 2KFDA 3KX2A 1LDJA 1XCVA 1TQIA 2Q1ZB 2KPMA 3D0SA 1BC8C 3HOUJ 2XKPA 3MZYA 4BE0A 5FJ8J 3KPHA 1LDDA 4M9ZA 3GTKJ 1Z77A 3I4NJ 1SFXA 2JN6A 4GRIA 1TNSA 2HR3A 2NS0A 3LNQA 1C0WA 3H3ZA 1I6XA 3OYGA 2QUFA 2A6HF 4II2A 2PBIA 3OS0A 2IGKA 1XSVA 3AL0B 1G2HA 3ZN0A 4G6TB 2XASA 1ZLKA 1OYIA 3KEOA 4M3BA 4IHSA 4PFOA 2B0LA 4A12A 3BOQA 2EA2A 4LGWA 4P9FA 1YS6A 3ZMTA 2FF4A 5C4JJ 3MD2A 4B09A 1GXPA 1R6RA 2GQQA 3K10A 5D4SA 2QSGX 2KRCA 3ERED 4HQMA 1K78B 5EZGA 4L0ZB 3BZ6A 3FKIJ 3R60A 3CC2I 3JREA 3B6AA 1ZG5A 1STZA 4B48A 1OR7A 1B1BA 2CUEA 4G6DA 4LD5A 1NK3P 3IC7A 2XVCA 5EZHA 2AO9A 3DLLF 4A3DJ 1VQOI 4DOZA 4BDYA 5IP9J 2DA2A 5BMZA 4NC8A 1BI2A 2K3PA 1T8IA 3T1BA 1NG7A 2PN6A 1LFBA 1U9NA 3K9TA 1KONA 1ZG1A 1U5TB 5IP7J 1KQ0A 4UVBA 3HJEA 2W48A 1JHFA 2FE3A 3HYIA 2AHQA 2IEKA 1JT6A 3G2BA 3R0JA 2KDZA 2MG4A 2FOKA 4WX9A 4I01A 2VQCA 3TP3A 3CP8A 1XB4A 1Z0XA 1LB2A 2BVMA 2R7QA 3QYBA 3TQNA 1KQ8A 2R93J 3GEZA 4MFDA 2CV0A 3L1PA 2GXBA 3B73A 4DQ2A 2PMUA 5FLMJ 3G73A 2R7RA 1PUEE 2LRDA 3BR5A 3JRDA 1AOYA 1V4RA 2DLLA 2ETHA 3JTGA 3GTMJ 5E20A 2M45A 2LKSA 5F0CA 3MZHA 1ETWA 4G9YA 2NNYA 3FBNB 4QIWN 3CMYA 4KUMA 2BE5F 3KP3A 3X2QH 5J1YA 3EETA 1PUFB 1MJBA 1DPRA 2N8GA 3OYNA 1H9TA 2EZHA 1NG6A 2GZWA 1LPQA 2KMUA 1KU2A 3DTKA 3CD6I 3RPQA 4S05A 4FHTA 3IUOA 4ITVA 1IDYA 2ZB9A 1XMAA 3ERMA 2CUZA 4Y33A 4AVPA 5J4YA 4IO9F 1BI1A 2XSJC 4RB0A 2W4SA 3QODA 1GLNA 4BHBA 2YX7A 1UB9A 2K40A 4Y13A 3KZZA 4BY7J 1FWZA 2DW4A 1GXQA 2FMLA 1O3QA 2EV5A 2OC6A 3DPTA 3HOTA 1DP7P 1FC3A 3DEUA 3CMAI 5FRNA 4XKBA 4BY1J 3FK6A 2PI0A 2Z99A 3OYJA 3C1DA 3L7WA 4AUXA 2IGOA 4A6EA 3DCFA 1YJWI 2YX4A 3KP6A 2WC2A 1FIAA 2X51A 3GBGA 5LLQA 3L2VA 1GT0C 4CO8A 1AKHA 3HOXJ 3WTUC 1MBGA 4HSTA 4CCKA 1BIAA 2O7OA 1HW1A 2STWA 1GV2A 2MC3A 3FIWA 2WAFA 2V6EA 3I64A 5B3SH 1HW5A 2OD5A 1V3FA 3UNGC 2O6GE 2DMNA 2HTSA 2KL4A 1YW7A 3HOZJ 1ETQA 1JGGA 3AG4H 4RS8A 1AA7A 1JKRC 3KETA 4RAZA 3GUDA 4XOTA 2QM3A 1MNDA 2ELKA 3CJNA 2Q2EA 1RUOA 2LBFA 3QOPA 2UV1A 1W0TA 3FXRA 1U9OA 1FYMA 5M3MJ 2BZTA 1UJ8A 3RKXA 4EJOA 4HV5A 4BU2A 2LY1A 3ZMUA 1J09A 3ESWB 3H5NA 2VKVA 3G1OA 3VOEA 1RRJA 3HC7A 1Y8RB 3GZ6A 5TISC 3H1CA 1SANA 3ABTA 4WWCA 4A0YA 3DU5A 4IRGA 1FP1D 4PCQA 2NYXA 3IH2A 2R7SA 4IQJA 1FBSA 6PAXA 4CA0A 4OIRF 4JK1X 2EJRA 2YUSA 1USTA 1U6GA 4ZYAA 2KKOA 9ANTA 3SYTA 1ETYA 3OOPA 1LVKA 3A2KA 3GTOJ 3C2BA 4LG0A 1R58A 4FX0A 2EH3A 3FMQA 3Q0WA 1Z91A 2FRHA 3K1NA 1TTYA 3BT9A 3REOA 3S17J 2ZMEB 1QZEA 2L9RA 2F5DA 4MQVA 2XAGA 4RB1A 3CMMA 1RKTA 1XMXA 3QYFA 1MMSA 3I4PA 2LY9A 5ILUA 4A3MJ 3T8RA 3BG5A 1VQ8I 3PNTA 3ABLH 1W0UA 3M8JA 1HKQA 2JTVA 4BBSJ 4FISA 3HRSA 1FLIA 4L5EA 1J75A 4XLAA 2HYJA 1YTYA 2AS5F 1MDMA 3ZMDA 4WXHA 1ODDA 3PUBA 1D1CA 2Y0SN 3JRBA 3NQOA 2NNNA 4XLHA 1UFMA 2HOTA 4NHJA 5GP9A 1YRNA 1R7JA 1XDSA 2DPUA 2RDPA 1ZG3A 1B8IB 1WJDA 2F4OB 1PYVA 4DNCA 1ETKA 1XC5A 2ZFWA 1FPQA 1TL8A 1G59A 1IC8A 1T95A 4KDPA 5E1WA 4F55A 4TV7A 4CCOA 2VL8A 3LFUA 3ZXSA 3TOAA 4HLYA 3I55I 3QWLA 5LGUA 5IT9K 2QQBA 4L18B 3E5UA 2XRLA 3E5XA 5KCMA 3C2HA 3RDIA 3OS1A 5HNHA 4C2TA 3PO3J 2V1DA 4R79A 3CCMI 2IS4A 3PIOF 4JP0A 2HOSA 3JW4A 4GCVA 4BQQA 1D0XA 2LVSA 1QO0D 5CLSA 2IS1A 1FIPA 1R49A 3JRCA 3P5JA 2R0QC 3TEDA 1WZ2A 1H0MA 1BA5A 3Q0UA 2LLKA 3HPGA 4JYKA 4PJNA 4A3FJ 1BJZA 2KJBA 3A1YA 2L54A 2YPRA 3JRFA 3JRIA 1KU3A 5L3GA 4MLOA 3MFKA 1F1ZA 4E7HA 4DZJA 4IHYA 4HF0A 3ABKH 4V19K 3L00A 5K7ZA 2X6WA 4CH7A 3FXJA 2FQ3A 4IHVA 2K9LA 2RGVA 3FK7A 4ABZA 1ULYA 4S0HB 2L9NA 2KJCA 1U78A 1PJRA 2R5ZA 4AIDA 2EZLA 3L09A 5GTHC 3R4KA 1RESA 3V7RA 1GUUA 3WU2C 4OIOF 1Q1VA 2M2EA 3C2GA 4UUTA 4A3GJ 1DUXC 1USSA 4HF1A 4QPOA 2LD5A 4RMNA 1J2XA 1XCBA 2LP0A 1X1BA 3GTPJ 4DBQA 2Q8KA 1OMIA 3F8FA 3G1MA 1S9HA 1R9TJ 4CYDA 2HFHA 2EA4A 1TW3A 5DM6F 4P55A 3JAMZ 2PQ8A 4N9IA 2CV1A 4HLXA 1MMDA 3CUQC 3GLXA 2V7FA 1TWFJ 3FBIB 3C18A 3ZGKA 5HOOA 2E1MC 3Q5FA 4D9JA 2JT1A 3S93A 2WAQN 2JVGA 2XAJA 2GM4A 4XLNF 3OIPA 5ICEA 3SJMA 1SAXA 1J0RA 1K7AA 1IUYA 1K4SA 1LUJB 3T5XA 2Y0SA 2EK5A 4EEFG 5JVTA 5D5WB 4HBLA 5DM7F 2EB7A 3LAJA 3ZQ7A 1HKSA 2QGUA 3BC8A 3RKWA 2L7KA 1W5TA 1G6NA 3B6CA 3EUAA 5HLIA 1ERDA 2ZSIB 2L5QA 1YITI 1IW7F 3SEQA 1MH3A 4FE4A 4XLCA 5KHDA 3DXJF 4XRMA 1G3YA 3I4MJ 4XL9A 2V9VA 2GA1A 4PJ0C 5EEGA 3NRVA 3U2RA 1UHMA 4G7HF 1A6QA 2VJIA 2VJ4A 4CCNA 3QU6A 1MIJA 2I8DA 4Z6YA 1HCRA 4RGUA 2E7XA 5CQGA 1W5SA 4I2OA 3H0GJ 5B1BH 3S2WA 1NH3A 5LEJA 1DGWY 3ZQLA 3V8LA 1QGPA 1W36C 3IHUA 3NEUA 2WWYA 3IWFA 2WA0A 1N25A 2WY8Q 4IZZA 1R23A 3M9AA 2DOEA 2X0LA 4AD9A 2CRGA 2STTA 3W2AA 2DA5A 2JJ7A 3I5UA 1MZBA 1OCOH 1LNWA 2GIZA 2ISZA 1Z7LA 2EBIA 2XROA 2XGEA 3HBLA 4CYCB 2MBFA 1W1WE 2DT6A 4Y52J 2GAUA 2R7TA 2EIJH 4I0AA 4ANJA 2FQ4A 2DXIA 3RZDJ 2DA3A 1IRFA 4XBFA 5K7FA 5HS9A 4IHWA 2ISYA 2K9QA 1JHHA 3ZPLA 3D5SC 1OISA 4RLFA 2NAZA 2X1EA 4BXUA 2DYSH 2BXZA 2VN2A 4UV8A 3K4KA 3FXOA 4IJAA 4RM3A 4RB3C 4BUPA 1ZQ3P 1YG2A 3LSJA 2PG4A 5FFXA 3VFZA 3BTJA 2OZ6A 2NVUB 2DAOA 4HRIA 4KICA 2DI3A 3PSIA 1FTZA 2L0KA 2LY2A 1LKXA 1T56A 4KT6A 3ZQCA 5HVQC 1BR1A 4XKCA 1VZ0A 2R7VA 4F91B 4NC7A 2XPUA 4GYGA 1REPC 3M7GA 3RPUA 3K70D 2LKXA 3SHFA 4A3BJ 2GOMA 4L9JA 2WAQA 4O3MA 1POGA 4YELA 3H3VK 4YIFA 2E5NA 4IHTA 1JUMA 3HGYA 4BS9A 3MKZA 3VODA 1VQ4I 1BOBA 1MSEC 2WADA 2EINH 1R4MB 2GBYA 3I71A 4ENKA 2JA6J 5EDNA 1IN6A 1HDPA 3M1CA 4XNFA 1YE9A 3K2AA 5DTDA 1EH6A 4ETSA 2EZIA 2DK5A 4A3LJ 3PJRA 4RA2A 3CC7I 1RR8C 1U2WA 1RKWA 4I6ZA 2HXIA 3OV8A 5J1UA 2X4HA 2B9SA 2R7DA 3CCEI 5FO5A 2K9SA 4A2UA 1FMVA 3MZ8A 2PJPA 3HGGA 3JSOA 4E7LA 1YO5C 2RV8A 4IF4A 3F72A 2A07F 1HKTA 3FXKA 3WGGA 4EM1A 2AXLA 5LHGA 3OY9A 1TWCJ 2DFIA 2D1HA 2MGQA 4L5JA 5DV5A 5LRRA 2JUGA 1P4WA 3I54A 1MD0A 5LD2C 5C3EJ 3EPZA 4GXOA 3E6BA 3A01A 4HG2A 1BW6A 1Y8QB 4A5NA 3HM5A 1AU7A 5FLXK 1QA6A 2K9MA 2ESHA 3VYRB 2M3AA 3S1MJ 4H4KC 4RM2A 5J8FA 2CQQA 2IT0A 5JR3A 1GDTA 1FT9A 4C2MJ 2GWRA 4KIGA 2G7UA 2OTLI 4R8HA 4HYEA 3M8EA 4UB8C 3CUQA 4BJ5C 1MBKA 4RGXA 1TW2A 4MTDA 3D1NI 1IN8A 2ZBKA 3WE2A 3ECHA 2Y9ZA 3M4OJ 4K2EA 2DT7B 3VWBA 3ZOBA 4CGZA 1ZR2A 1H9GA 3BQYA 3S15J 4P1WA 1ONVA 5FGMA 5HDKA 1BJAA 4ZTFA 1OCRH 2P6TA 4NQWA 1QPMA 2ECCA 1ZYRF 1L0OC 3ZQHA 3IRQA 4J19A 1XGNA 2UUZA 2DMQA 3CESA 3LQQA 2KP6A 2GXAA 2K86A 3IP4B 4OU0A 1AKHB 2HQNA 1ZR4A 5E8GA 4CXFA 4JX4A 1QZZA 3H9QA 2E1CA 1ZK8A 5CQEA 3SDGA 3OMYA 1O4XA 1ITYA 5IYCJ 2CV2A 2VC1A 4DBRA 4GDFA 2R7ZJ 3PM1A 1VQ6I 3AG3H 3OIOA 1ZARA 3RCOA 1JUSA 5F1RA 4NBQA 2DO7A 2G0EA 2PLYA 2Q2EB 3DTIA 3OS2A 1WKMA 2LNBA 2MD0A 3F6OA 3G4SI 4LJZF 2LBFB 1IN7A 1WVRA 2VQHA 2BW3B 4JX6A 4PSWA 2DDAA 3W6JB 1VQNI 3AG2H 2E34A 1WPKA 5L3FA 3SZGA 2Z1DA 3S1RJ 4M72A 2C6YA 3DKYA 3MKWB 2X48A 4AYBN 2EFQA 3CP2A 4Z2YA 5BOXA 2HQRA 4A0XA 2P8TA 3ABMH 4N4OB 4DW6A 2XSDC 3H5AA 1MSFC 2FNAA 3K1MA 1JI8A 1X1PA 3V8JA 1Z05A 5ED4A 4FQGA 3GFLA 3TDZC 4EJWA 5K5QA 2P5LC 3H36A 2NOJB 2EQRA 2R4GA 1D5YA 2O5RA 3HOVJ 1W4MA 3TOBA 1O7LA 2JA7J 1X3WB 1TT0A 4IRHA 4AWXB 3QU3A 4XR6A 1D1AA 2E2JJ 1QHHD 4HX8A 4YIIA 4C2UA 5TJJA 4LG0B 5CKTA 2RKHA 4A0ZA 5BNGA 4BL0B 3BTIA 1OJLA 3CDIA 1Z1DA 2OPTA 2Y69H 3DF8A 5CVVA 4ON0A 3BG6A 3BG7A 5EJCA 1AWCA 2K7LA 1MMGA 1T33A 2HVRA 2FXAA 3QPTA 3FM3A 5AONA 4KNYA 3VPRA 3UKGA 1HA8A 2YU3A 3Q0VA 2EZKA 4YFXF 4Y7NJ 2A68F 1FTTA 1YX5A 3BTLA 2QSHX 3HPHA 3EYIA 3H5RA 4ASNA 1MJ9A 5CVRA 5F1JA 3WTSC 4Q47A 2KHMA 4QTRA 3S2DJ 1R1TA 1UCRA 1XMKA 1QBJA 1R5ID 4XORA 2COMA 3U9GA 5DD4A 4HEA2 1XGMA 4MNUA 1MDMB 4BGDA 2P5VA 3N4MA 5TGTA 4H0EA 4ZJZA 4IOCF 1YRNB 3WGIA 1FY7A 2DMUA 3G1LA 3H9JA 3PO2J 3FHZA 2CQNA 1LEAA 1OFCX 1Z21A 1D5VA 1X1AA 5JLXA 2F4IA 2R7UA 1E17A 1HSJA 1X4OA 2IA2A 3CCRI 2CQ7A 1X3UA 3BR6A 1BN5A 5FLXZ 3HHHA 2VBZA 3C3WA 4I0BA 3ZR8X 4HNTA 3BPVA 1VI0A 3DWLE 5CVJA 2MYSA 3CLOA 3AG1H 2OCCH 2XAFA 4O6JA 2V6CA 3K1PA 3A4CA 2ZNYA 3P7NA 3NWSA 4PK4A 3VYUB 2F48A 3TGNA 2O03A 4Y3OA 3L2WA 1I6HJ 3EUHC 3FXUA 2HZDA 3OYIA 2GOXB 4FE7A 1VQMI 2H09A 1N77A 3J7AO 3BR3A 4GFBA 5GADJ 4IPAA 1UMQA 3WODF 1T98A 4LFUA 2EWNA 1DP3A 2GIVA 2BY1A 5IP6A 2E2HJ 2QBYA 3U1KA 4L9VA 4AYBA 1GVDA 1KA8A 3I59A 3A02A 1FP2A 1JKQC 3ROUA 3KYCB 2L3DA 3FF5A 3L9FA 1ZGWA 4OIQF 4RAYA 4W1UA 1YX3A 1ZTRA 4EATA 3HRUA 3F9KA 3F0CA 2VJJA 3U21A 1UG2A 1SFEA 2RAEA 3IAM2 2FD5A 2KRFA 2ZFUA 2Z33A 3VYTB 2R5ZB 1MBHA 3OL4A 4Y17A 2DA7A 5HLTA 3WTVC 2HKOA 5J8CA 1EH7A 4KJZA 1MNEA 2JVHA 3I53A 4AU7A 4ZZDA 2K9NA 4CCJA 1ETOA 1RC9A 4BKXA 4X0GA 1XTAA 4P96A 2ZJPF 3CF5F 2E1OA 2JA5J 3W2WA 4WXDA 1WH5A 3K4JA 4UVCA 2O0YA 4CUGA 2HU9A 5HDGA 3SZPA 3LL7A 3BTCA 3AFHA 1FNNA 4C3JJ 2HNHA 1N75A 5GAHJ 1BR2A 1YW9A 3SDBA 3SFIA 2K5CA 1I1GA 2JZYA 5HDNA 3JAMK 3DLAA 2BW3A 2R7XA 1CQTA 2LFBA 4BDZA 1R4NB 2M87A 3UR3C 1ZRCA 2E35A 1Z6RA 4GYIA 2L02A 3A03A 1O7FA 4P9UA 4ZDOA 2JK3A 4C9YA 2K02A 1P7IA 3IKVA 2IRFG 1XG1A 5EEHA 3FM5A 2DOFA 2BBYA 2HPIA 4RGRA 3MKYB 1CF7A 2HQ5A 2BOLA 4W97A 1IRGA 2CW7A 4RAGA 1APLC 1IAWA 1E3PA 1G3TA 1BL0A 4CICA 2RQPA 4ZH4F 3NAUA 4WXCA 3OYLA 2HPMA 1SD5A 3CUOA 2LKPA 5F0HA 1MKMA 2VBXA 4ESJA 1MNMC 5E79C 3GVAA 2HYGD 1X19A 3VSKA 2WY7Q 2YU9J 4Q4ZF 4CHUA 4MFEA 4ENMA 1RI7A 2LK2A 1I39A 5HS8A 3N05A 2AQFA 3K4MA 2HDDA 1QRYA 2ZMEC 2VQLA 1IRXA 4A3KJ 2M8EA 3CCLI 3KP2A 4HSRA 2O9LA 5HLGA 2RC4A 3OYCA 3LSKA 4PDKA 5HODA 2VODA 5FROA 5L3CA 4LIVA 4BJ6C 1U0JA 2X6OA 5K5RA 1DGRM 3Q9VA 3QYEA 4LG3A 1FOWA 5F6FA 2VBWA 3GX4X 2XF7A 1UAAA 5LGNA 5KAIC 1T2KA 4CCLA 2CUFA 3K4LA 1V55H 3CCUI 5E17F 3GXOA 5JFRA 3S3NA 1IUFA 3HB9A 3OYDA 2H1LA 5H2FC 3WE3A 3FWEA 1XS9A 1A5JA 3CCSI 2KT0A 3I58A 5L3EA 3ZRGA 1TBXA 4OMYA 1LJ9A 2EIMH 2KISA 3KP7A 1QPIA 2ACJA 4IVNA 1Y1VJ 3ZCOA 2LF7A 4L9NA 2A5WA 1P2FA 4MGRA 1LEBA 1HW2A 4N4NB 3KEYA 1BC7C 2IAIA 2FOWA 1UZCA 4NB5A 1S7EA 3PFYA 3VSLA 5GAEJ 4M71A 2M4GA 5DCMA 3F8MA 2YR2A 4DJAA 1ON1A 4BHPA 3B02A 4XSXF 3I9V2 5AIPA 2FBIA 1I3AA 1D3YA 5DUIA 4XN0A 3WU0A 3V8KA 3DTEA 2XAQA 2L4MA 3F8BA 1D8KA 2EV0A 4MHGA 3JTHA 1LQ1A 4XRSG 2B7EA 3KYLA 3DBLB 2H94A 4HPQA 4XK4A 5C44J 2XRNA 3GTQJ 5H6RA 2BV6A 2F5FA 1X1DA 4IEJA 4ZTJA 2NOGA 2O3FA 1R1VA 1SVOA 1MMAA 2JSPA 3RJPA 1Y56A 5E8IA 2BGCA 1MGTA 3IRRA 2PJRA 5LHHA 2HXOA 5EEAA 5EF6A 2TCTA 4XMYA 2E71A 5D6FA 2GA2A 2OA4A 5LGTA 2DFHA 4A6DA 3OYMA 1IJWC 1UHSA 2ID6A 5EGOA 3MN2A 4FCYA 2BHZA 2VONA 1KU9A 3GZ5A 3QP6A 3JRGA 4OINF 2QKLB 4N9HA 3RPUD 1BI0A 3CCYA 2ZJRF 5J40A 1EKEA 2X6XA 2QZ8A 4EM2A 1B72A 2HEOA 2HYFA 1IN4A 3DPUA 4D7MA 2CJJA 3CDHA 5IOYA 1YI2I 2L01A 2VE8A 2LH9A 4S04A 3HIFA 1HC8A 3LMMA 1OCZH 2NS7A 3HL2A 1I1SA 1IV8A 1G4DA 3ULQB 5FKKA 3HOYJ 4RDUA 1H88C 2W25A 3A01B 5GAGJ 4KIBA 3L2UA 2A5YB 4XKWA 4CDGA 4BHCA 4LOCA 2JPBA 5K7HA 4Q48A 3P9CA 3E0JB 5FLVA 4IXAA 3CO7C 3E3VA 2OQGA 1WJBA 3L2RA 4BXXJ 2VASA 3MAJA 2NVXJ 2R5YA 1FX7A 4ZDPA 4HZFA 3ZQIA 2DOAA 2P7CB 2P4WA 5FRMA 3ONQA 4QWQA 3EUKL 5DEQA 3CUQB 2E36A 1Z6TA 3MWMA 4D0PA 3EQLF 5DCFA 3KIOA 5CJ9A 3RKYA 3GTJJ 2LTPA 3HEFA 1WJEA 3G3ZA 3AAFA 4B4CA 4XRFA 2VPLA 4E70A 1T6SA 2EFNA 1OKRA 1IF1A 2KZVA 3JRHA 2V9KA 3OYEA 1OCTC 2WBMA 2FUG2 2LR8A 1S5LC 2TDXA 1FZPB 5FKOA 3OIQA 4NQWB 1K83J 5IT3A 2AQEA 5BQTA 4EGYA 3HUGA 2QQ9A 5EG0A 5HS7A 1Z3XA 2M4KA 1QVTA 4CZCA 3NWTA 2DQRA 2M9HA 4OOIA 1RUNA 3JRAA 4OIPF 3ZQFA 4LLGF 4L0YB 1SFOJ 1MBJA 2DQLA 2WB1N 2L7ZA 2XAHA 2JPCA 2RVCA 1A04A 2JRTA 2QA4I 3MEXA 4WK8F 2ZC2A 4LITA 2VIXA 2Y30A 1DQUA 2KRHA 2G9WA 1ZGJA 3WHBA 3LAPA 3O6BB 4EV0A 4U0YA 2GXGA 5B66C 1ZRDA 1B59A 2G7HA 4BBRJ 5D5UB 2HVQA 1SAUA 4LLLA 3ZMZA 5IYBJ 3LSPA 3WTZA 1TWAJ 2H6BA 4U88A 5ERIA 1X58A 2XUBA 1G3SA 2H27A 4MEXF 2XF5A 2VOOA 1YHQI 2FJ1A 3GFJA 4V2GA 2X1CA 2KIFA 5D5XB 1EH8A 1W7PA 3BWGA 3HSRA 1KYZA 2P5KA 1RIOH 2VE9A 1B4AA 3IAS2 3S1QJ 3T8TA 2LC2A 3HKZN 2WV1A 2LG4A 4X6AJ 2VPRA 3K0LA 3MKLA 3W6VA 2CQKA 3CTAA 2XGCA 2FBKA 3DV8A 3G6EI 4BAYA 1SD7A 3RYRA 1W36D 3JR9A 2J5PA 2OTJI 2ZXIA 3O2PE 3O8HA 4M3GA 2HOEA 4A69C 2O8XA 5F08A 3LSMA 1FMWA 2CFXA 1V5EA 4C3IJ 4UUSA 4AIKA 2LOOA 2OJED 4A3IJ 1S29A 4B8XA 1HDDC 5J4VA 1J9IA 3PNVA 4CZZA 4ZYDA 1BM9A 4QPQA 3ECOA 1E3HA 4DYRA 4XSZF 1A35A 2JQ7A 1SC7A 4M9SA 4XLEA 3QP5A 2A05A 2H1KA 2MFZA 4BE1A 1D1BA 3Q9SA 4EGZA 5D6EA 4HX7A 2KDOA 4KFCA 3VDXA 1EA3A 4KMUX 4E7SA 1Z9CA 2CO5A 4BQAA 3S14J 1NTCA 1F36A 3KCCA 4DYCA 1KQ9A 3PSFA 2OQRA 5ICFA 4G6QA 1Y1WJ 1G3WA 2HZTA 4HOBA 3M8FA 5L3DA 1IXSB 1MBEA 1XPXA 3OR2C 4AIJA 4D5FA 5FB2A 2VKHA 3DEWA 1FEXA 4F7ZA 4G7OF 3LFKA 1S7OA 4RBOA 2CUJA 3FX3A 3OR1C 3RYPA 5F64A 2F5EA 4QLCU 3FZVA 2K3FA 3H0DA 3K7AJ 2DBBA 3TL4X 2WB1A 3KFWX 2OZUA 3V4GA 3WG7H 4YFNF 2ZJ2A 3HOSA 3QRFF 1JT0A 1KZHA 3OOUA 3WTXC 1PP8F 3BZCA 4FASD 2L2OA 1YOVB 1SMYF 3CF2A 3VEPA 1GHCA 1IO2A 1SMTA 1OYWA 1ETXA 2VXZA 4UXNA 1O3RA 1YS7A 4F52A 3S3MA 4XQFA 4N0BA 2PFBA 2LYCA 2QLZA 1FBQA 5DS9A 3GCMA 2QF7A 3DBHB 4KA4A 3SZTA 5D8LB 2JA8J 1I5ZA 2QBYB 1V54H 2K27A 3KLOA 2W7NA 3I59B 4M3EA 3ELKA 3CQZJ 2F5CA 3H9GA 1MW7A 4YIRX 2WTEA 3LSTA 2XC7A 2IA1A 3HKZA 2P81A 1TWHJ 4LMYA 1A36A 4FX4A 4IQ4A 3V42A 4F92B 2XPVA 2HQAA 2HOAA 2VOPA 1TC3C 1WGXA 1VQ9I 4XLFA 4DGWB 3HZJA 2ME6A 4I02A 2W1OA 2EFOA 3BPXA 2M0MA 4D7NA 3EYYA 4PFPA 1YLFA 1B9MA 2RNJA 4KISA 3OL3A 1JTYA 1HOMA 3DQVC 2BEOA 2V26A 4A5MA 4IX7A 4UY8I 3E6CC 2XPWA 2IP2A 2QKMB 4I99C 5JI6A 1X2MA 2VKEA 3IL2A 3HSFA 5GTIC 3HOWJ 4J01A 3OWTA 2JA2A 2DFEA 2R7FA 3AL0C 3W6KB 1QVUA 5F27A 2PMHA 2KLOA 3F8CA 3S8PA 5A2QK 1LDKB 4IRIA 1CF7B 3ZN1A 3OYBA 3P9IA 1SFKA 3F6VA 4WCGA 1LE8A 1MH4A 1FOYA 1TWGJ 1LFPA 4KN7X 3FMSA 4G8XA 1XGSA 4PZJA 2Y2ZA 2COBA 1V5FA 5E1XA 2ADUA 2V9PA 3BCBA 5D4RA 1P9QC 2CWEA 2IXSA 3BLYA 5LHIA 3D5RC 4HDVA 3S32A 3IWZA 3HTSB 3CCJI 1VQPI 4G12A 2VBYA 3DKXA 2JUCA 2PX9A 2XDVA 4DYQA 2DT5A 1D0ZA 2QCOA 1U5TC 2DDBA 3S1NJ 4E7IA 1ORKA 2YSRA 5KVRA 2CGPA 2HVSA 1UELB 3LSIA 4F93B 2ESNA 1RPWA 1UHWA 4AVZA 4EJUA 3BP8A 4PJMA 2MABA 4HQEA 5JHUA 1LFUP 2R92J 2BYVE 1IXCA 3KLNA 3WTWC 3RQIA 2CG4A 2MH2A 2IW5A 2L7FP 4ENJA 4EJTA 3GLLA 2MLKA 1CGPA 5M5YJ 2IS6A 3K4BA 4ESFA 1WJCA 1JGSA 2TRTA 5E3NA 5JLWA 1NK2P 3ZQGA 4E7ZA 1R36A 3ZQQA 2VQGA 1TQMA 1VNDA 2V4JC 4L5IA 4O5VA 4UHTA 3BG3A 1B6AA 2QVOA 2CQXA 1FOXA 2H8RA 2WAEA 2OU2A 3M07A 4XM3A 3DEEA 2H8WA 3C7JA 4BH9A 3PIPF 1R00A 3K69A 5DCMB 1HBXG 1BIBA 1T08B 2ZO4A 1P92A 4HW0A 4E7KA 1WRJA 2M34A 3KE2A 2XB0X 3LWFA 3RZOJ 3ML6A 5L3BA 2IJLA 4BQOA 2QENA 2L7MP 5DUKA 3U1DA 2Y31A 4EJVA 3RI4A 3J7AY 3QPLA 3O8GA 2HTJA 4G7ZF 5CYVA 2ELHA 2NS8A 2E7WA 2QSFX 2VUMJ 2ELJA 5CVUA 1FYKA 1S72I 5IYDJ 2FEZA 1R71A 1WFXA 1BI3A 5KK1A 4EMSA 1IG7A 4Q5SF 4RB2C 2IGNA 3CDLA 5GPAA 3H3UA 2PJRB 2QEXI 2UXXA 1WJ5A 4B3XA 4M74A 3N97A 1R1UA 2NVTJ 1NHAA 2Y75A 3DP7A 1TQPA 1WH7A 3BZKA 3CJRB 2EV6A 1SD4A 4AC0A 3HXLA 2DK8A 3BJAA 3ZMVA 4DIQA 5EGOB 1IN5A 2V1XA 2RN7A 2L4AA 1E3OC 1ZELA 2UXNA 1GV5A 1YQAA 2E19A 2ZXHA 2VB6A 3TW6A 1SFUA 2K4BA 2IPQX 2KIMA 2M8GX 2LSOA 4KN4X 5B1AH 1I3QJ 1B72B 2OCEA 5HLHA 3BR0A 4YRVA 3FXMA 2ZJQF 4V2FA 5M5XJ 3QQAA 5FKMA 3TO9A 4HNUA 1TZLA 3JCUC 1RETA 3WGHA 3J81Z 1T0FC 2D5VA 1F4KA 4LB6B 4BEHA 1GVJA 4HAMA 3TBIA 4M9XA 2WV0A 2OV7A 1L3LA 3BDDA 3LQRA 2Z16A 4ZC3A 1ZLJA 1BOAA 2FMYA 2QQAA 3WG9A 5KAFC 4OAZA 1IV6A 4U0WA 2A6TA 1JJ8C 1QZYA 5A2QZ 4JBAA 3GFIA 1BW5A 2IA0A 2FA5A 1B9NA 4LK1F 5AIQA 2B63J 4MO7A 2VJ5A 1F43A 3O3KA 4ZYEA 4D5CA 3COAC 2R5YB 2ZKZA 1YW8A 4I7HA 4HA8A 1T38A 4DZPA 3R0AA 4U7DA 2F6CA 3I0TA 5J6XA 1TNTA 3DU6A 2DMPA 2P0WA 2Y9YA 2CW8A 2E60A 2BVLA 4ENNA 3FXLA 1U3EM 2W57A 4HNVA 4XN3A 2R7OA 2DN0A 3MMYB 1W5CC 5IPAA 3CCVI 5M5WJ 4GO1A 2QWWA 2ICWG 2DA6A 1JKPC 1KU7A 3RIRA 1P4AA 4RGSA 4QSHA 2W85A 2A61A 1FSEA 3E6DA 1HLVA 3GFMA 3GO5A 2DJNA 2PMZN 2FBHA 2W24A 5F04A 3ABUA 3FKJA 3PUFA 2JMWA 1K6OA 1R5HA 3HUGB 2M30A 4ZYHA 3QAHA 2XV4S 4ZDLA 5EG0B 1TT5B 3HRMA 3PQJA 1K6YA 4M6YA 2CH0A 2FSWA 2K85A 4M6XA 1K78A 3LA7A 2LF8A 2M1BA 4B47A 4R1HA 1WQ2A 2MW8A 1DDNA 1ZHFA 3FMRA 1X2NA 3TMOA 1EV7A 2OUMA 4BXFA 5B5EC 3BJOA 1X4PA 1QU3A 2W84A 1V5GA 2DA1A 3BJ6A 4PGGA 4IHXA 5LEKA 1TLHB 1ACIA 2FX0A 5LBQA 3DPLC 1MJAA 5DD8A 1DU6A 4RAFA 4NC6A 2Z5UA 5D8KB 1Y0UA 2W00A 5H20A 3DKWA 1XGOA 4D1QA 3F22A 1U5TA 2FNPA 2MC4A 5JVGF 4AM3A 4FTHA 2IBDA 2HKXA 3DFGA 2BY0A 4Y15A 2DU9A 3HHGA 2A3SA 4F3QA 4ZZLA 3AKZA 3PNYA 2NRAC 2KIUA 2XGDA 3H92A 4HX4A 1YYVA 3GTLJ 1XSXA 1JTXA 1OCCH 2IGMA 5CPRB 3IKTA 1JKOC 1W7PB 4LIUA 2D1VA 4IL6C 5JHFA 2XIGA 2Z9OA 2XAUA 1F9NA 3K2ZA 2CU7A 1K79A 4UNOA 4E7JA 3J80K 1ZGAA 1T39A 2M7BA 1I50J 1N78A 1YIJI 1QNTA 3KZIC 4PSXA 4XOPA 3G71I 2A69F 4II3A 1FSHA 2LMDA 1HQCA 2Q0OA 2NVQJ 2BY2A 1VF9A 2VT3A 4UV9A 4FETA 2CYYA 5IOZA 4UUSB 2DMTA 4YEJA 1RR7A 1PVEA 3FDYA 1YIOA 2CFOA 1ON2A 1M1EB 2DODA 2XB5A 4LB5A 2Z2SB 1PUFA 3H35A 4EQQA 5TRDA 3EUHA 4A93J 3E7LA 3CO6C 3OYKA 1W7PD 3S16J
chains in the Genus database with same CATH topology
1FIAA 2ME0A 3GBGA 3MVPA 4JX6A 3JR9A 1GT0C 1AKHA 3HOXJ 1MBGA 3O8HA 2O7OA 4M3GA 1GV2A 1WPKA 3FIWA 5F08A 4A69C 1ZKGA 3S1RJ 4A3IJ 4NDLA 3TW7A 2X48A 4C3IJ 4AYBN 4UUSA 2GLOA 1HDDC 1MSFC 4DW6A 2DMNA 4MIMA 5J1RA 2XSDC 3BR2A 4DYRA 1ETQA 3HDDA 3HOZJ 1JGGA 3QPSA 1ENHA 1JKRC 2EQRA 1D5YA 2H1KA 2ELKA 3HOVJ 4X1EA 2JA7J 5FKNA 1W0TA 1U9OA 5M3MJ 1AHDP 2E2IJ 5M3FJ 2E2JJ 3S14J 1NTCA 1F36A 2VKVA 3G1OA 5BNGA 4DYCA 1WI3A 3BTIA 4B1RA 1OJLA 1SANA 2OPTA 1Y1WJ 4A3JJ 3LOCA 3BR1A 1MBEA 3IH2A 1T33A 2ECBA 5GPCA 4D5FA 3VPRA 3UKGA 3DEWA 1FEXA 3Q0VA 1WCMJ 2EZKA 1VFCA 4Y7NJ 2YUSA 4RBOA 1FTTA 3BTLA 3GTGJ 3FISA 9ANTA 1ETYA 4A3EJ 3GTOJ 5F1JA 3K7AJ 3S2DJ 4QTRA 3C2BA 2O8KA 1JT0A 2EH3A 3OOUA 3Q0WA 2DA4A 1HF0A 1ETXA 3Q3SA 1YRNB 3BT9A 3S17J 3BG9A 2DMUA 3G1LA 2L9RA 3PO2J 1RKTA 1OFCX 2LY9A 5JLXA 4B3AA 5DS9A 2QF7A 3IH3A 4A3MJ 1H8AC 3BG5A 2JA8J 1W0UA 4C3HJ 3BR6A 2VI6A 4BBSJ 4FISA 4L5EA 2HYJA 1VI0A 4M3EA 3CQZJ 4M3FA 2Y0SN 3JRBA 4XICA 2HOTA 5GP9A 1YRNA 1B8IB 4A3CJ 2P81A 1TWHJ 5E3LA 1I6HJ 1ETKA 1K61A 1XC5A 1EF4A 4FE7A 1IC8A 3M3YJ 1IRZA 3BR3A 2XPVA 2HOAA 4GFBA 1TC3C 1WGXA 1UMQA 2M0CA 5IP6A 2E2HJ 2ME6A 1GVDA 3A02A 4D7NA 1JKQC 1ZGWA 4M6VA 2XRLA 4W1UA 5EYRA 1JTYA 1ZTRA 1HOMA 3PO3J 1B8IA 3F0CA 1UG2A 2RAEA 2XPWA 4JP0A 5J3LA 2HOSA 1LE8B 1H89C 2FD5A 2LVSA 1OCPA 1X2MA 2VKEA 2R5ZB 1MBHA 1A6IA 1FIPA 2DA7A 3JRCA 3TEDA 2R0QC 1DU0A 1BA5A 3Q0UA 2K9NA 2LLKA 4JYKA 1ETOA 3HOWJ 4A3FJ 1BJZA 3JRIA 4BKXA 3JRFA 5E3MA 4MLOA 2E1OA 2JA5J 4DZJA 4IHYA 1QVUA 5F27A 5K7ZA 1WH5A 4IHVA 3FK7A 3BTCA 4ABZA 4C3JJ 1LE8A 1MH4A 4S0HB 1TWGJ 1U78A 3TP0A 2R5ZA 2EZLA 3SFIA 5C4XJ 2HI3A 1P7JA 1RESA 1CQTA 1GUUA 2Y2ZA 2COBA 2LFBA 1Q1VA 2M2EA 4UUTA 3S2HJ 4A3GJ 3A03A 2LD5A 2JK3A 3OSFA 2LP0A 1P7IA 3GTPJ 1XG1A 1JJ6C 3G1MA 1R9TJ 2HQ5A 4W97A 2JWTA 1APLC 4G12A 1BL0A 1JUPA 4DYQA 2QCOA 3LSRA 4JX5A 1TWFJ 3NAUA 3S1NJ 4M3DA 5F0HA 1ORKA 2WAQN 3OSGA 1MNMC 5FKLA 2GM4A 3SJMA 2YU9J 1RPWA 3NARA 4MFEA 4EEFG 2LK2A 1IGNA 1LFUP 2YS9A 2R92J 2MSYA 1U8BA 3RQIA 2HDDA 1QRYA 2L7FP 3B6CA 4A3KJ 1FJLA 5M5YJ 2O9LA 1ETVA 2OF7A 1MH3A 4FE4A 2TRTA 5E3NA 5JLWA 4XRMA 3ZQGA 1NK2P 3I4MJ 5HODA 1VNDA 5F0FA 3BG3A 2X6OA 1MBFA 2CQXA 2H8RA 2CUFA 1HCRA 1IUFA 3HB9A 5E3OA 3IH4A 3H0GJ 3ZQLA 1XS9A 1A5JA 2KT0A 4XIDA 2M34A 2XB0X 3RZOJ 1QPIA 2L7MP 1Y1VJ 2Y31A 2CRGA 2DA5A 2JJ7A 3QPLA 3O8GA 2IAIA 2NS8A 2EBIA 2VUMJ 2XGEA 3HBLA 4CYCB 1S7EA 5IYDJ 2ID3A 1IG7A 4Y52J 3RKQA 3CDLA 5GPAA 2FQ4A 4I76A 2NVTJ 3RZDJ 2DA3A 1WH7A 3BQZA 5K7FA 2X9DA 4IHWA 3LSGA 2K9QA 4AC0A 5EGOB 2DTZA 2I10A 4XRSG 4XRSA 1E3OC 1IDZA 4XK4A 3WHCA 1GV5A 2E19A 3TW6A 5C44J 3GTQJ 2NVYJ 4CYCA 2M8GX 1ZQ3P 4IEJA 3LSJA 3IV5A 1I3QJ 2NOGA 1B72B 3BR0A 3BTJA 4V2FA 5M5XJ 2HXOA 3QQAA 5FKMA 3HOUJ 1FTZA 2L0KA 5EEAA 5EF6A 5FJ8J 1T56A 2TCTA 3ZQCA 3GTKJ 2XPUA 1RETA 1Z77A 2D5VA 1IJWC 3I4NJ 2LKXA 1UHSA 2JN6A 2ID6A 5EGOA 3MN2A 4FCYA 4A3BJ 3LNQA 1POGA 3H3VK 3JRGA 1JUMA 3HGYA 3CCYA 1IV6A 1MSEC 2GBYA 1JJ8C 1B72A 2JA6J 1G2HA 5EDNA 1HDPA 1BW5A 2B63J 3K2AA 4MO7A 1F43A 5DTDA 4D7MA 2CJJA 4M3BA 4D5CA 5IOYA 2R5YB 2EZIA 4DZPA 5C4JJ 4A3LJ 2DMPA 1RKWA 4I6ZA 2Y9YA 2HXIA 5J1UA 2NS7A 4HNVA 5EZGA 3FKIJ 5FKKA 4RDUA 1H88C 3HOYJ 2DN0A 3JREA 3B6AA 3A01B 5IPAA 5M5WJ 2K9SA 2DA6A 4LOCA 1JKPC 5K7HA 3HGGA 4QSHA 5FLVA 2CUEA 1NK3P 1HLVA 5EZHA 4BXXJ 2AO9A 4A3DJ 2DJNA 2PMZN 2NVXJ 2R5YA 5F04A 5IP9J 2DA2A 3ZQIA 2JMWA 1TWCJ 2MGQA 5EG0B 1LFBA 1U9NA 5IP7J 3GTJJ 2LTPA 3HEFA 5C3EJ 4B4CA 2W48A 3A01A 1BW6A 3HM5A 2MW8A 1AU7A 2AHQA 1X2NA 3JRHA 2IEKA 1JT6A 3S1MJ 2KDZA 2MG4A 1OCTC 2CQQA 3TP3A 2LR8A 2DA1A 1GDTA 5FKOA 1Z0XA 4C2MJ 4IHXA 1K83J 2R93J 2FX0A 4MFDA 1DU6A 3L1PA 5EG0A 1MBKA 5FLMJ 3BR5A 3D1NI 1QVTA 3JRDA 4FTHA 3GTMJ 2IBDA 2M9HA 3JRAA 3ZQFA 2Y9ZA 3M4OJ 1SFOJ 1MBJA 2XGDA 3ZOBA 5F0CA 2WB1N 1ZR2A 2L7ZA 1ETWA 3BQYA 3S15J 4QIWN 3GTLJ 3CMYA 1JTXA 1JKOC 2Y30A 5J1YA 1PUFB 3WHBA 2ECCA 2N8GA 2EZHA 3ZQHA 2CU7A 4J19A 2DMQA 1I50J 1IDYA 2ZB9A 4BBRJ 1AKHB 5IYBJ 3LSPA 1TWAJ 1ZR4A 4JX4A 1X58A 2NVQJ 1VF9A 5IOZA 1ZK8A 2DMTA 2K40A 3SDGA 4UUSB 4BY7J 1O4XA 1ITYA 1RR7A 2FJ1A 5IYCJ 4V2GA 2R7ZJ 2XB5A 3PM1A 3OIOA 1PUFA 1JUSA 3S1QJ 3HKZN 2WV1A 3FK6A 4BY1J 2G0EA 4X6AJ 4AUXA 2VPRA 3MKLA 3W6VA 4A93J 3E7LA 3DCFA 2XGCA 3S16J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIA A;  2ME0 A;  3GBG A;  3MVP A;  4JX6 A;  3JR9 A;  1GT0 C;  1AKH A;  3HOX J;  1MBG A;  3O8H A;  2O7O A;  4M3G A;  1GV2 A;  1WPK A;  3FIW A;  5F08 A;  4A69 C;  1ZKG A;  3S1R J;  4A3I J;  4NDL A;  3TW7 A;  2X48 A;  4C3I J;  4AYB N;  4UUS A;  2GLO A;  1HDD C;  1MSF C;  4DW6 A;  2DMN A;  4MIM A;  5J1R A;  2XSD C;  3BR2 A;  4DYR A;  1ETQ A;  3HDD A;  3HOZ J;  1JGG A;  3QPS A;  1ENH A;  1JKR C;  2EQR A;  1D5Y A;  2H1K A;  2ELK A;  3HOV J;  4X1E A;  2JA7 J;  5FKN A;  1W0T A;  1U9O A;  5M3M J;  1AHD P;  2E2I J;  5M3F J;  2E2J J;  3S14 J;  1NTC A;  1F36 A;  2VKV A;  3G1O A;  5BNG A;  4DYC A;  1WI3 A;  3BTI A;  4B1R A;  1OJL A;  1SAN A;  2OPT A;  1Y1W J;  4A3J J;  3LOC A;  3BR1 A;  1MBE A;  3IH2 A;  1T33 A;  2ECB A;  5GPC A;  4D5F A;  3VPR A;  3UKG A;  3DEW A;  1FEX A;  3Q0V A;  1WCM J;  2EZK A;  1VFC A;  4Y7N J;  2YUS A;  4RBO A;  1FTT A;  3BTL A;  3GTG J;  3FIS A;  9ANT A;  1ETY A;  4A3E J;  3GTO J;  5F1J A;  3K7A J;  3S2D J;  4QTR A;  3C2B A;  2O8K A;  1JT0 A;  2EH3 A;  3OOU A;  3Q0W A;  2DA4 A;  1HF0 A;  1ETX A;  3Q3S A;  1YRN B;  3BT9 A;  3S17 J;  3BG9 A;  2DMU A;  3G1L A;  2L9R A;  3PO2 J;  1RKT A;  1OFC X;  2LY9 A;  5JLX A;  4B3A A;  5DS9 A;  2QF7 A;  3IH3 A;  4A3M J;  1H8A C;  3BG5 A;  2JA8 J;  1W0U A;  4C3H J;  3BR6 A;  2VI6 A;  4BBS J;  4FIS A;  4L5E A;  2HYJ A;  1VI0 A;  4M3E A;  3CQZ J;  4M3F A;  2Y0S N;  3JRB A;  4XIC A;  2HOT A;  5GP9 A;  1YRN A;  1B8I B;  4A3C J;  2P81 A;  1TWH J;  5E3L A;  1I6H J;  1ETK A;  1K61 A;  1XC5 A;  1EF4 A;  4FE7 A;  1IC8 A;  3M3Y J;  1IRZ A;  3BR3 A;  2XPV A;  2HOA A;  4GFB A;  1TC3 C;  1WGX A;  1UMQ A;  2M0C A;  5IP6 A;  2E2H J;  2ME6 A;  1GVD A;  3A02 A;  4D7N A;  1JKQ C;  1ZGW A;  4M6V A;  2XRL A;  4W1U A;  5EYR A;  1JTY A;  1ZTR A;  1HOM A;  3PO3 J;  1B8I A;  3F0C A;  1UG2 A;  2RAE A;  2XPW A;  4JP0 A;  5J3L A;  2HOS A;  1LE8 B;  1H89 C;  2FD5 A;  2LVS A;  1OCP A;  1X2M A;  2VKE A;  2R5Z B;  1MBH A;  1A6I A;  1FIP A;  2DA7 A;  3JRC A;  3TED A;  2R0Q C;  1DU0 A;  1BA5 A;  3Q0U A;  2K9N A;  2LLK A;  4JYK A;  1ETO A;  3HOW J;  4A3F J;  1BJZ A;  3JRI A;  4BKX A;  3JRF A;  5E3M A;  4MLO A;  2E1O A;  2JA5 J;  4DZJ A;  4IHY A;  1QVU A;  5F27 A;  5K7Z A;  1WH5 A;  4IHV A;  3FK7 A;  3BTC A;  4ABZ A;  4C3J J;  1LE8 A;  1MH4 A;  4S0H B;  1TWG J;  1U78 A;  3TP0 A;  2R5Z A;  2EZL A;  3SFI A;  5C4X J;  2HI3 A;  1P7J A;  1RES A;  1CQT A;  1GUU A;  2Y2Z A;  2COB A;  2LFB A;  1Q1V A;  2M2E A;  4UUT A;  3S2H J;  4A3G J;  3A03 A;  2LD5 A;  2JK3 A;  3OSF A;  2LP0 A;  1P7I A;  3GTP J;  1XG1 A;  1JJ6 C;  3G1M A;  1R9T J;  2HQ5 A;  4W97 A;  2JWT A;  1APL C;  4G12 A;  1BL0 A;  1JUP A;  4DYQ A;  2QCO A;  3LSR A;  4JX5 A;  1TWF J;  3NAU A;  3S1N J;  4M3D A;  5F0H A;  1ORK A;  2WAQ N;  3OSG A;  1MNM C;  5FKL A;  2GM4 A;  3SJM A;  2YU9 J;  1RPW A;  3NAR A;  4MFE A;  4EEF G;  2LK2 A;  1IGN A;  1LFU P;  2YS9 A;  2R92 J;  2MSY A;  1U8B A;  3RQI A;  2HDD A;  1QRY A;  2L7F P;  3B6C A;  4A3K J;  1FJL A;  5M5Y J;  2O9L A;  1ETV A;  2OF7 A;  1MH3 A;  4FE4 A;  2TRT A;  5E3N A;  5JLW A;  4XRM A;  3ZQG A;  1NK2 P;  3I4M J;  5HOD A;  1VND A;  5F0F A;  3BG3 A;  2X6O A;  1MBF A;  2CQX A;  2H8R A;  2CUF A;  1HCR A;  1IUF A;  3HB9 A;  5E3O A;  3IH4 A;  3H0G J;  3ZQL A;  1XS9 A;  1A5J A;  2KT0 A;  4XID A;  2M34 A;  2XB0 X;  3RZO J;  1QPI A;  2L7M P;  1Y1V J;  2Y31 A;  2CRG A;  2DA5 A;  2JJ7 A;  3QPL A;  3O8G A;  2IAI A;  2NS8 A;  2EBI A;  2VUM J;  2XGE A;  3HBL A;  4CYC B;  1S7E A;  5IYD J;  2ID3 A;  1IG7 A;  4Y52 J;  3RKQ A;  3CDL A;  5GPA A;  2FQ4 A;  4I76 A;  2NVT J;  3RZD J;  2DA3 A;  1WH7 A;  3BQZ A;  5K7F A;  2X9D A;  4IHW A;  3LSG A;  2K9Q A;  4AC0 A;  5EGO B;  2DTZ A;  2I10 A;  4XRS G;  4XRS A;  1E3O C;  1IDZ A;  4XK4 A;  3WHC A;  1GV5 A;  2E19 A;  3TW6 A;  5C44 J;  3GTQ J;  2NVY J;  4CYC A;  2M8G X;  1ZQ3 P;  4IEJ A;  3LSJ A;  3IV5 A;  1I3Q J;  2NOG A;  1B72 B;  3BR0 A;  3BTJ A;  4V2F A;  5M5X J;  2HXO A;  3QQA A;  5FKM A;  3HOU J;  1FTZ A;  2L0K A;  5EEA A;  5EF6 A;  5FJ8 J;  1T56 A;  2TCT A;  3ZQC A;  3GTK J;  2XPU A;  1RET A;  1Z77 A;  2D5V A;  1IJW C;  3I4N J;  2LKX A;  1UHS A;  2JN6 A;  2ID6 A;  5EGO A;  3MN2 A;  4FCY A;  4A3B J;  3LNQ A;  1POG A;  3H3V K;  3JRG A;  1JUM A;  3HGY A;  3CCY A;  1IV6 A;  1MSE C;  2GBY A;  1JJ8 C;  1B72 A;  2JA6 J;  1G2H A;  5EDN A;  1HDP A;  1BW5 A;  2B63 J;  3K2A A;  4MO7 A;  1F43 A;  5DTD A;  4D7M A;  2CJJ A;  4M3B A;  4D5C A;  5IOY A;  2R5Y B;  2EZI A;  4DZP A;  5C4J J;  4A3L J;  2DMP A;  1RKW A;  4I6Z A;  2Y9Y A;  2HXI A;  5J1U A;  2NS7 A;  4HNV A;  5EZG A;  3FKI J;  5FKK A;  4RDU A;  1H88 C;  3HOY J;  2DN0 A;  3JRE A;  3B6A A;  3A01 B;  5IPA A;  5M5W J;  2K9S A;  2DA6 A;  4LOC A;  1JKP C;  5K7H A;  3HGG A;  4QSH A;  5FLV A;  2CUE A;  1NK3 P;  1HLV A;  5EZH A;  4BXX J;  2AO9 A;  4A3D J;  2DJN A;  2PMZ N;  2NVX J;  2R5Y A;  5F04 A;  5IP9 J;  2DA2 A;  3ZQI A;  2JMW A;  1TWC J;  2MGQ A;  5EG0 B;  1LFB A;  1U9N A;  5IP7 J;  3GTJ J;  2LTP A;  3HEF A;  5C3E J;  4B4C A;  2W48 A;  3A01 A;  1BW6 A;  3HM5 A;  2MW8 A;  1AU7 A;  2AHQ A;  1X2N A;  3JRH A;  2IEK A;  1JT6 A;  3S1M J;  2KDZ A;  2MG4 A;  1OCT C;  2CQQ A;  3TP3 A;  2LR8 A;  2DA1 A;  1GDT A;  5FKO A;  1Z0X A;  4C2M J;  4IHX A;  1K83 J;  2R93 J;  2FX0 A;  4MFD A;  1DU6 A;  3L1P A;  5EG0 A;  1MBK A;  5FLM J;  3BR5 A;  3D1N I;  1QVT A;  3JRD A;  4FTH A;  3GTM J;  2IBD A;  2M9H A;  3JRA A;  3ZQF A;  2Y9Z A;  3M4O J;  1SFO J;  1MBJ A;  2XGD A;  3ZOB A;  5F0C A;  2WB1 N;  1ZR2 A;  2L7Z A;  1ETW A;  3BQY A;  3S15 J;  4QIW N;  3GTL J;  3CMY A;  1JTX A;  1JKO C;  2Y30 A;  5J1Y A;  1PUF B;  3WHB A;  2ECC A;  2N8G A;  2EZH A;  3ZQH A;  2CU7 A;  4J19 A;  2DMQ A;  1I50 J;  1IDY A;  2ZB9 A;  4BBR J;  1AKH B;  5IYB J;  3LSP A;  1TWA J;  1ZR4 A;  4JX4 A;  1X58 A;  2NVQ J;  1VF9 A;  5IOZ A;  1ZK8 A;  2DMT A;  2K40 A;  3SDG A;  4UUS B;  4BY7 J;  1O4X A;  1ITY A;  1RR7 A;  2FJ1 A;  5IYC J;  4V2G A;  2R7Z J;  2XB5 A;  3PM1 A;  3OIO A;  1PUF A;  1JUS A;  3S1Q J;  3HKZ N;  2WV1 A;  3FK6 A;  4BY1 J;  2G0E A;  4X6A J;  4AUX A;  2VPR A;  3MKL A;  3W6V A;  4A93 J;  3E7L A;  3DCF A;  2XGC A;  3S16 J; 
#chains in the Genus database with same CATH topology
 1Y0N A;  1TP4 A;  2ME0 A;  3MVP A;  3BCA A;  2IVM A;  5ILS A;  2F2E A;  1ZKG A;  1IZ1 A;  4NDL A;  3TW7 A;  1EJ9 A;  4CSW A;  2LRE A;  2GLO A;  5J1R A;  4MIM A;  2PMZ A;  3HSE A;  3BR2 A;  3HDD A;  3LA3 A;  3QPS A;  4YG2 F;  1ENH A;  2V1U A;  2OBP A;  4FT8 A;  4HDU A;  4MEY F;  1J59 A;  5KNL A;  3JSP A;  2VXD A;  4X1E A;  2R7W A;  5IY5 H;  3WTY C;  3I56 I;  5FKN A;  1BR4 A;  3DBR B;  2QQ8 A;  1AHD P;  2DYR H;  2E2I J;  4UB6 C;  2HWV A;  4G94 A;  5M3F J;  2VT2 A;  2LDU A;  4AIH A;  3F23 A;  1WI3 A;  4B1R A;  4KIF A;  3J7Y J;  1ZAO A;  3A0H C;  2RNG A;  4A3J J;  3LOC A;  2DCE A;  3BR1 A;  2M7A A;  2ECB A;  3TDU C;  4E4H A;  5ILV A;  2CS3 A;  1MMN A;  5GPC A;  4ESB A;  2VKD A;  3E97 A;  3QOE A;  3BRO A;  1WCM J;  3LSH A;  4I09 A;  1VFC A;  1T0F A;  3OYH A;  3HRT A;  3GTG J;  3FIS A;  2E1M B;  4A3E J;  2FU4 A;  3CJQ B;  3ZMS A;  1WSU A;  2QYO A;  5K5O A;  2OAZ A;  1ZN2 A;  4PJJ A;  3SXY A;  3K4C A;  2O8K A;  2NXN B;  1S3J A;  3GW2 A;  4BAC A;  5LRS A;  3VYS B;  1LVA A;  1JE8 A;  3EDP A;  4NUB A;  2Y48 A;  2E1N A;  3CME I;  3CLQ A;  5ICC A;  3P9K A;  4XLP F;  1Q1H A;  2DA4 A;  4CCM A;  1HF0 A;  3MQ0 A;  3Q3S A;  2O61 A;  4BQN A;  3BG9 A;  1UG0 A;  4XON A;  2E5Z A;  2VLA A;  1DPU A;  3L2C A;  1WWX A;  1XN7 A;  3SQN A;  2V79 A;  4B3A A;  1RZ4 A;  2P6S A;  3ASN H;  3V7S A;  2ZNZ A;  3IH3 A;  3K4N A;  1H8A C;  2H6C A;  4C3H J;  1YFH A;  3M1E A;  2KIQ A;  3R6S A;  5E18 F;  4KMF A;  2VI6 A;  2XF6 A;  1QHG A;  2KQR A;  5DYM A;  4NNJ A;  4KT5 C;  4EM0 B;  4PUS A;  4M3F A;  3HG9 A;  3RTR A;  4XIC A;  2ZSH B;  3GME A;  2A6E F;  4OAY A;  3K70 C;  2ZME A;  5E1Z B;  4A3C J;  5FFZ A;  5E3L A;  4BE2 A;  5CVI A;  1K61 A;  2Y0M A;  2EIL H;  4IKF A;  3CZ6 A;  1EF4 A;  2CMP A;  3M3Y J;  3W2V A;  1IRZ A;  3KP4 A;  2MH9 A;  2EIK H;  2M0C A;  1QQI A;  1IXR C;  3GWZ A;  2X85 A;  4BYY A;  1PP7 U;  1WI9 A;  1FBU A;  3I3L A;  4B43 A;  1D0Y A;  1OQY A;  3KEQ A;  4UVA A;  3V7C A;  3CJT B;  3T0Y A;  1O3S A;  4IOA F;  2Z3Y A;  4M6V A;  2MLG A;  3F8N A;  2ZXW H;  1A31 A;  4U87 A;  5EYR A;  5J47 A;  1KYW A;  1U8R A;  3A0B C;  1B8I A;  3KP5 A;  3J80 Z;  5J3L A;  1LE8 B;  4PJL A;  3F21 A;  1H89 C;  1Z7U A;  3HTU A;  1OCP A;  3CC4 I;  4RLQ A;  1J5Y A;  1D8J A;  1A6I A;  2R3S A;  4OMZ A;  1DU0 A;  2CW0 F;  3TKY A;  1SD6 A;  1RNL A;  1VQK I;  5IT9 Z;  2XHK A;  2EFW A;  3ISP A;  1X1C A;  1XD7 A;  2DTR A;  5E3M A;  1OR7 C;  1WJA A;  3J7Z I;  3TO7 A;  4WF2 A;  4P5O A;  1JXS A;  2K4J A;  4MTE A;  2F5V A;  3KZY A;  4L9T A;  3MCZ A;  3FHN A;  3E6M A;  3TP0 A;  4LLN A;  3W3C A;  5C4X J;  2HI3 A;  2UZK A;  1P7J A;  3L2Q A;  2PEX A;  3FXQ A;  1S7A A;  4U7B A;  3S2H J;  1YJ9 I;  2RRE A;  4C30 A;  3ZP5 A;  2D45 A;  3OSF A;  2BY3 A;  3F3X A;  2ZCW A;  5FD6 A;  3GYH X;  2P7V B;  3PFI A;  3R61 A;  4M73 A;  2HDC A;  1JJ6 C;  2J5O A;  5BS6 A;  2EFP A;  4Y4R A;  2EPF A;  1R5G A;  2ZXJ A;  2JWT A;  4GGG A;  4KYW A;  3GF2 A;  3ASO H;  1JUP A;  1Y39 A;  5FD5 A;  3LSR A;  4JX5 A;  3PQK A;  1HXD A;  4I98 B;  4EVI A;  1OLT A;  4M3D A;  1P6R A;  2MA3 A;  3OSG A;  5FKL A;  2L9S A;  3SEZ A;  4J00 A;  2X1D A;  3K6G A;  3NAR A;  1O3T A;  1IGN A;  2YS9 A;  2MSY A;  2XGX A;  3PL8 A;  1U8B A;  1YJN I;  4U0V A;  4ZYG A;  2VC0 A;  3E5Q A;  5D5V B;  1FJL A;  1S8N A;  4JQF A;  4LK0 F;  1ETV A;  2W82 A;  1OPC A;  2OF7 A;  1Y6I A;  4PGH A;  2V1N A;  1VQL I;  3VB2 A;  5F0F A;  1ZRE A;  4JOM A;  1VTN C;  1MBF A;  1SEU A;  1VQ5 I;  2M5W A;  1Z67 A;  1HST A;  5BPI A;  2IS2 A;  1J7K A;  1SVM A;  4HF2 A;  2UWM A;  5E3O A;  3IH4 A;  1F5T A;  3KYD B;  1XSD A;  2JRM A;  4MQ9 F;  2I5U A;  5BPD A;  1PDN C;  1FOK A;  4B44 A;  1X3Z B;  3E1S A;  4XID A;  1G8X A;  3SFZ A;  1KGS A;  1I27 A;  2MD5 A;  2XKO A;  4UUV A;  1R22 A;  2HGC A;  1ZRF A;  1XDU A;  1O57 A;  2DFF A;  3OYA A;  4OWR B;  1SVL A;  2KZG A;  1VQ7 I;  2BXY A;  2BHY A;  5ICG A;  3TO6 A;  3GZN B;  3QPH A;  2ID3 A;  3OYF A;  1E0E A;  4YFK F;  3RSN A;  5H6Q A;  3RKQ A;  5DDG A;  3WTT C;  2HS5 A;  5K1Y A;  1WJF A;  3BY6 A;  4I76 A;  5LFA A;  1OYY A;  4BJT A;  3BQZ A;  2X6Y A;  2X9D A;  3RQ4 A;  1Z3Y A;  3D5L A;  3LSG A;  2DPD A;  3WU1 B;  1WHU A;  4HV6 A;  2RQQ A;  2JSC A;  4BEH B;  2CSO A;  2L9V A;  3CCQ I;  5HNF A;  2DTZ A;  2I10 A;  3S3O A;  1BBY A;  3J81 K;  4XRS A;  2DJI A;  1IDZ A;  2HDW A;  3WHC A;  1P4X A;  3LA2 A;  1ZH5 A;  2D2W A;  4E6K G;  2NVY J;  2AXT C;  4CYC A;  1XX5 A;  4BNC A;  1E2X A;  4XKV A;  3IV5 A;  1K4T A;  1S6L A;  2F4M B;  4KIT B;  1FYL A;  2KFD A;  3KX2 A;  1LDJ A;  1XCV A;  1TQI A;  2Q1Z B;  2KPM A;  3D0S A;  1BC8 C;  3HOU J;  2XKP A;  3MZY A;  4BE0 A;  5FJ8 J;  3KPH A;  1LDD A;  4M9Z A;  3GTK J;  1Z77 A;  3I4N J;  1SFX A;  2JN6 A;  4GRI A;  1TNS A;  2HR3 A;  2NS0 A;  3LNQ A;  1C0W A;  3H3Z A;  1I6X A;  3OYG A;  2QUF A;  2A6H F;  4II2 A;  2PBI A;  3OS0 A;  2IGK A;  1XSV A;  3AL0 B;  1G2H A;  3ZN0 A;  4G6T B;  2XAS A;  1ZLK A;  1OYI A;  3KEO A;  4M3B A;  4IHS A;  4PFO A;  2B0L A;  4A12 A;  3BOQ A;  2EA2 A;  4LGW A;  4P9F A;  1YS6 A;  3ZMT A;  2FF4 A;  5C4J J;  3MD2 A;  4B09 A;  1GXP A;  1R6R A;  2GQQ A;  3K10 A;  5D4S A;  2QSG X;  2KRC A;  3ERE D;  4HQM A;  1K78 B;  5EZG A;  4L0Z B;  3BZ6 A;  3FKI J;  3R60 A;  3CC2 I;  3JRE A;  3B6A A;  1ZG5 A;  1STZ A;  4B48 A;  1OR7 A;  1B1B A;  2CUE A;  4G6D A;  4LD5 A;  1NK3 P;  3IC7 A;  2XVC A;  5EZH A;  2AO9 A;  3DLL F;  4A3D J;  1VQO I;  4DOZ A;  4BDY A;  5IP9 J;  2DA2 A;  5BMZ A;  4NC8 A;  1BI2 A;  2K3P A;  1T8I A;  3T1B A;  1NG7 A;  2PN6 A;  1LFB A;  1U9N A;  3K9T A;  1KON A;  1ZG1 A;  1U5T B;  5IP7 J;  1KQ0 A;  4UVB A;  3HJE A;  2W48 A;  1JHF A;  2FE3 A;  3HYI A;  2AHQ A;  2IEK A;  1JT6 A;  3G2B A;  3R0J A;  2KDZ A;  2MG4 A;  2FOK A;  4WX9 A;  4I01 A;  2VQC A;  3TP3 A;  3CP8 A;  1XB4 A;  1Z0X A;  1LB2 A;  2BVM A;  2R7Q A;  3QYB A;  3TQN A;  1KQ8 A;  2R93 J;  3GEZ A;  4MFD A;  2CV0 A;  3L1P A;  2GXB A;  3B73 A;  4DQ2 A;  2PMU A;  5FLM J;  3G73 A;  2R7R A;  1PUE E;  2LRD A;  3BR5 A;  3JRD A;  1AOY A;  1V4R A;  2DLL A;  2ETH A;  3JTG A;  3GTM J;  5E20 A;  2M45 A;  2LKS A;  5F0C A;  3MZH A;  1ETW A;  4G9Y A;  2NNY A;  3FBN B;  4QIW N;  3CMY A;  4KUM A;  2BE5 F;  3KP3 A;  3X2Q H;  5J1Y A;  3EET A;  1PUF B;  1MJB A;  1DPR A;  2N8G A;  3OYN A;  1H9T A;  2EZH A;  1NG6 A;  2GZW A;  1LPQ A;  2KMU A;  1KU2 A;  3DTK A;  3CD6 I;  3RPQ A;  4S05 A;  4FHT A;  3IUO A;  4ITV A;  1IDY A;  2ZB9 A;  1XMA A;  3ERM A;  2CUZ A;  4Y33 A;  4AVP A;  5J4Y A;  4IO9 F;  1BI1 A;  2XSJ C;  4RB0 A;  2W4S A;  3QOD A;  1GLN A;  4BHB A;  2YX7 A;  1UB9 A;  2K40 A;  4Y13 A;  3KZZ A;  4BY7 J;  1FWZ A;  2DW4 A;  1GXQ A;  2FML A;  1O3Q A;  2EV5 A;  2OC6 A;  3DPT A;  3HOT A;  1DP7 P;  1FC3 A;  3DEU A;  3CMA I;  5FRN A;  4XKB A;  4BY1 J;  3FK6 A;  2PI0 A;  2Z99 A;  3OYJ A;  3C1D A;  3L7W A;  4AUX A;  2IGO A;  4A6E A;  3DCF A;  1YJW I;  2YX4 A;  3KP6 A;  2WC2 A;  1FIA A;  2X51 A;  3GBG A;  5LLQ A;  3L2V A;  1GT0 C;  4CO8 A;  1AKH A;  3HOX J;  3WTU C;  1MBG A;  4HST A;  4CCK A;  1BIA A;  2O7O A;  1HW1 A;  2STW A;  1GV2 A;  2MC3 A;  3FIW A;  2WAF A;  2V6E A;  3I64 A;  5B3S H;  1HW5 A;  2OD5 A;  1V3F A;  3UNG C;  2O6G E;  2DMN A;  2HTS A;  2KL4 A;  1YW7 A;  3HOZ J;  1ETQ A;  1JGG A;  3AG4 H;  4RS8 A;  1AA7 A;  1JKR C;  3KET A;  4RAZ A;  3GUD A;  4XOT A;  2QM3 A;  1MND A;  2ELK A;  3CJN A;  2Q2E A;  1RUO A;  2LBF A;  3QOP A;  2UV1 A;  1W0T A;  3FXR A;  1U9O A;  1FYM A;  5M3M J;  2BZT A;  1UJ8 A;  3RKX A;  4EJO A;  4HV5 A;  4BU2 A;  2LY1 A;  3ZMU A;  1J09 A;  3ESW B;  3H5N A;  2VKV A;  3G1O A;  3VOE A;  1RRJ A;  3HC7 A;  1Y8R B;  3GZ6 A;  5TIS C;  3H1C A;  1SAN A;  3ABT A;  4WWC A;  4A0Y A;  3DU5 A;  4IRG A;  1FP1 D;  4PCQ A;  2NYX A;  3IH2 A;  2R7S A;  4IQJ A;  1FBS A;  6PAX A;  4CA0 A;  4OIR F;  4JK1 X;  2EJR A;  2YUS A;  1UST A;  1U6G A;  4ZYA A;  2KKO A;  9ANT A;  3SYT A;  1ETY A;  3OOP A;  1LVK A;  3A2K A;  3GTO J;  3C2B A;  4LG0 A;  1R58 A;  4FX0 A;  2EH3 A;  3FMQ A;  3Q0W A;  1Z91 A;  2FRH A;  3K1N A;  1TTY A;  3BT9 A;  3REO A;  3S17 J;  2ZME B;  1QZE A;  2L9R A;  2F5D A;  4MQV A;  2XAG A;  4RB1 A;  3CMM A;  1RKT A;  1XMX A;  3QYF A;  1MMS A;  3I4P A;  2LY9 A;  5ILU A;  4A3M J;  3T8R A;  3BG5 A;  1VQ8 I;  3PNT A;  3ABL H;  1W0U A;  3M8J A;  1HKQ A;  2JTV A;  4BBS J;  4FIS A;  3HRS A;  1FLI A;  4L5E A;  1J75 A;  4XLA A;  2HYJ A;  1YTY A;  2AS5 F;  1MDM A;  3ZMD A;  4WXH A;  1ODD A;  3PUB A;  1D1C A;  2Y0S N;  3JRB A;  3NQO A;  2NNN A;  4XLH A;  1UFM A;  2HOT A;  4NHJ A;  5GP9 A;  1YRN A;  1R7J A;  1XDS A;  2DPU A;  2RDP A;  1ZG3 A;  1B8I B;  1WJD A;  2F4O B;  1PYV A;  4DNC A;  1ETK A;  1XC5 A;  2ZFW A;  1FPQ A;  1TL8 A;  1G59 A;  1IC8 A;  1T95 A;  4KDP A;  5E1W A;  4F55 A;  4TV7 A;  4CCO A;  2VL8 A;  3LFU A;  3ZXS A;  3TOA A;  4HLY A;  3I55 I;  3QWL A;  5LGU A;  5IT9 K;  2QQB A;  4L18 B;  3E5U A;  2XRL A;  3E5X A;  5KCM A;  3C2H A;  3RDI A;  3OS1 A;  5HNH A;  4C2T A;  3PO3 J;  2V1D A;  4R79 A;  3CCM I;  2IS4 A;  3PIO F;  4JP0 A;  2HOS A;  3JW4 A;  4GCV A;  4BQQ A;  1D0X A;  2LVS A;  1QO0 D;  5CLS A;  2IS1 A;  1FIP A;  1R49 A;  3JRC A;  3P5J A;  2R0Q C;  3TED A;  1WZ2 A;  1H0M A;  1BA5 A;  3Q0U A;  2LLK A;  3HPG A;  4JYK A;  4PJN A;  4A3F J;  1BJZ A;  2KJB A;  3A1Y A;  2L54 A;  2YPR A;  3JRF A;  3JRI A;  1KU3 A;  5L3G A;  4MLO A;  3MFK A;  1F1Z A;  4E7H A;  4DZJ A;  4IHY A;  4HF0 A;  3ABK H;  4V19 K;  3L00 A;  5K7Z A;  2X6W A;  4CH7 A;  3FXJ A;  2FQ3 A;  4IHV A;  2K9L A;  2RGV A;  3FK7 A;  4ABZ A;  1ULY A;  4S0H B;  2L9N A;  2KJC A;  1U78 A;  1PJR A;  2R5Z A;  4AID A;  2EZL A;  3L09 A;  5GTH C;  3R4K A;  1RES A;  3V7R A;  1GUU A;  3WU2 C;  4OIO F;  1Q1V A;  2M2E A;  3C2G A;  4UUT A;  4A3G J;  1DUX C;  1USS A;  4HF1 A;  4QPO A;  2LD5 A;  4RMN A;  1J2X A;  1XCB A;  2LP0 A;  1X1B A;  3GTP J;  4DBQ A;  2Q8K A;  1OMI A;  3F8F A;  3G1M A;  1S9H A;  1R9T J;  4CYD A;  2HFH A;  2EA4 A;  1TW3 A;  5DM6 F;  4P55 A;  3JAM Z;  2PQ8 A;  4N9I A;  2CV1 A;  4HLX A;  1MMD A;  3CUQ C;  3GLX A;  2V7F A;  1TWF J;  3FBI B;  3C18 A;  3ZGK A;  5HOO A;  2E1M C;  3Q5F A;  4D9J A;  2JT1 A;  3S93 A;  2WAQ N;  2JVG A;  2XAJ A;  2GM4 A;  4XLN F;  3OIP A;  5ICE A;  3SJM A;  1SAX A;  1J0R A;  1K7A A;  1IUY A;  1K4S A;  1LUJ B;  3T5X A;  2Y0S A;  2EK5 A;  4EEF G;  5JVT A;  5D5W B;  4HBL A;  5DM7 F;  2EB7 A;  3LAJ A;  3ZQ7 A;  1HKS A;  2QGU A;  3BC8 A;  3RKW A;  2L7K A;  1W5T A;  1G6N A;  3B6C A;  3EUA A;  5HLI A;  1ERD A;  2ZSI B;  2L5Q A;  1YIT I;  1IW7 F;  3SEQ A;  1MH3 A;  4FE4 A;  4XLC A;  5KHD A;  3DXJ F;  4XRM A;  1G3Y A;  3I4M J;  4XL9 A;  2V9V A;  2GA1 A;  4PJ0 C;  5EEG A;  3NRV A;  3U2R A;  1UHM A;  4G7H F;  1A6Q A;  2VJI A;  2VJ4 A;  4CCN A;  3QU6 A;  1MIJ A;  2I8D A;  4Z6Y A;  1HCR A;  4RGU A;  2E7X A;  5CQG A;  1W5S A;  4I2O A;  3H0G J;  5B1B H;  3S2W A;  1NH3 A;  5LEJ A;  1DGW Y;  3ZQL A;  3V8L A;  1QGP A;  1W36 C;  3IHU A;  3NEU A;  2WWY A;  3IWF A;  2WA0 A;  1N25 A;  2WY8 Q;  4IZZ A;  1R23 A;  3M9A A;  2DOE A;  2X0L A;  4AD9 A;  2CRG A;  2STT A;  3W2A A;  2DA5 A;  2JJ7 A;  3I5U A;  1MZB A;  1OCO H;  1LNW A;  2GIZ A;  2ISZ A;  1Z7L A;  2EBI A;  2XRO A;  2XGE A;  3HBL A;  4CYC B;  2MBF A;  1W1W E;  2DT6 A;  4Y52 J;  2GAU A;  2R7T A;  2EIJ H;  4I0A A;  4ANJ A;  2FQ4 A;  2DXI A;  3RZD J;  2DA3 A;  1IRF A;  4XBF A;  5K7F A;  5HS9 A;  4IHW A;  2ISY A;  2K9Q A;  1JHH A;  3ZPL A;  3D5S C;  1OIS A;  4RLF A;  2NAZ A;  2X1E A;  4BXU A;  2DYS H;  2BXZ A;  2VN2 A;  4UV8 A;  3K4K A;  3FXO A;  4IJA A;  4RM3 A;  4RB3 C;  4BUP A;  1ZQ3 P;  1YG2 A;  3LSJ A;  2PG4 A;  5FFX A;  3VFZ A;  3BTJ A;  2OZ6 A;  2NVU B;  2DAO A;  4HRI A;  4KIC A;  2DI3 A;  3PSI A;  1FTZ A;  2L0K A;  2LY2 A;  1LKX A;  1T56 A;  4KT6 A;  3ZQC A;  5HVQ C;  1BR1 A;  4XKC A;  1VZ0 A;  2R7V A;  4F91 B;  4NC7 A;  2XPU A;  4GYG A;  1REP C;  3M7G A;  3RPU A;  3K70 D;  2LKX A;  3SHF A;  4A3B J;  2GOM A;  4L9J A;  2WAQ A;  4O3M A;  1POG A;  4YEL A;  3H3V K;  4YIF A;  2E5N A;  4IHT A;  1JUM A;  3HGY A;  4BS9 A;  3MKZ A;  3VOD A;  1VQ4 I;  1BOB A;  1MSE C;  2WAD A;  2EIN H;  1R4M B;  2GBY A;  3I71 A;  4ENK A;  2JA6 J;  5EDN A;  1IN6 A;  1HDP A;  3M1C A;  4XNF A;  1YE9 A;  3K2A A;  5DTD A;  1EH6 A;  4ETS A;  2EZI A;  2DK5 A;  4A3L J;  3PJR A;  4RA2 A;  3CC7 I;  1RR8 C;  1U2W A;  1RKW A;  4I6Z A;  2HXI A;  3OV8 A;  5J1U A;  2X4H A;  2B9S A;  2R7D A;  3CCE I;  5FO5 A;  2K9S A;  4A2U A;  1FMV A;  3MZ8 A;  2PJP A;  3HGG A;  3JSO A;  4E7L A;  1YO5 C;  2RV8 A;  4IF4 A;  3F72 A;  2A07 F;  1HKT A;  3FXK A;  3WGG A;  4EM1 A;  2AXL A;  5LHG A;  3OY9 A;  1TWC J;  2DFI A;  2D1H A;  2MGQ A;  4L5J A;  5DV5 A;  5LRR A;  2JUG A;  1P4W A;  3I54 A;  1MD0 A;  5LD2 C;  5C3E J;  3EPZ A;  4GXO A;  3E6B A;  3A01 A;  4HG2 A;  1BW6 A;  1Y8Q B;  4A5N A;  3HM5 A;  1AU7 A;  5FLX K;  1QA6 A;  2K9M A;  2ESH A;  3VYR B;  2M3A A;  3S1M J;  4H4K C;  4RM2 A;  5J8F A;  2CQQ A;  2IT0 A;  5JR3 A;  1GDT A;  1FT9 A;  4C2M J;  2GWR A;  4KIG A;  2G7U A;  2OTL I;  4R8H A;  4HYE A;  3M8E A;  4UB8 C;  3CUQ A;  4BJ5 C;  1MBK A;  4RGX A;  1TW2 A;  4MTD A;  3D1N I;  1IN8 A;  2ZBK A;  3WE2 A;  3ECH A;  2Y9Z A;  3M4O J;  4K2E A;  2DT7 B;  3VWB A;  3ZOB A;  4CGZ A;  1ZR2 A;  1H9G A;  3BQY A;  3S15 J;  4P1W A;  1ONV A;  5FGM A;  5HDK A;  1BJA A;  4ZTF A;  1OCR H;  2P6T A;  4NQW A;  1QPM A;  2ECC A;  1ZYR F;  1L0O C;  3ZQH A;  3IRQ A;  4J19 A;  1XGN A;  2UUZ A;  2DMQ A;  3CES A;  3LQQ A;  2KP6 A;  2GXA A;  2K86 A;  3IP4 B;  4OU0 A;  1AKH B;  2HQN A;  1ZR4 A;  5E8G A;  4CXF A;  4JX4 A;  1QZZ A;  3H9Q A;  2E1C A;  1ZK8 A;  5CQE A;  3SDG A;  3OMY A;  1O4X A;  1ITY A;  5IYC J;  2CV2 A;  2VC1 A;  4DBR A;  4GDF A;  2R7Z J;  3PM1 A;  1VQ6 I;  3AG3 H;  3OIO A;  1ZAR A;  3RCO A;  1JUS A;  5F1R A;  4NBQ A;  2DO7 A;  2G0E A;  2PLY A;  2Q2E B;  3DTI A;  3OS2 A;  1WKM A;  2LNB A;  2MD0 A;  3F6O A;  3G4S I;  4LJZ F;  2LBF B;  1IN7 A;  1WVR A;  2VQH A;  2BW3 B;  4JX6 A;  4PSW A;  2DDA A;  3W6J B;  1VQN I;  3AG2 H;  2E34 A;  1WPK A;  5L3F A;  3SZG A;  2Z1D A;  3S1R J;  4M72 A;  2C6Y A;  3DKY A;  3MKW B;  2X48 A;  4AYB N;  2EFQ A;  3CP2 A;  4Z2Y A;  5BOX A;  2HQR A;  4A0X A;  2P8T A;  3ABM H;  4N4O B;  4DW6 A;  2XSD C;  3H5A A;  1MSF C;  2FNA A;  3K1M A;  1JI8 A;  1X1P A;  3V8J A;  1Z05 A;  5ED4 A;  4FQG A;  3GFL A;  3TDZ C;  4EJW A;  5K5Q A;  2P5L C;  3H36 A;  2NOJ B;  2EQR A;  2R4G A;  1D5Y A;  2O5R A;  3HOV J;  1W4M A;  3TOB A;  1O7L A;  2JA7 J;  1X3W B;  1TT0 A;  4IRH A;  4AWX B;  3QU3 A;  4XR6 A;  1D1A A;  2E2J J;  1QHH D;  4HX8 A;  4YII A;  4C2U A;  5TJJ A;  4LG0 B;  5CKT A;  2RKH A;  4A0Z A;  5BNG A;  4BL0 B;  3BTI A;  1OJL A;  3CDI A;  1Z1D A;  2OPT A;  2Y69 H;  3DF8 A;  5CVV A;  4ON0 A;  3BG6 A;  3BG7 A;  5EJC A;  1AWC A;  2K7L A;  1MMG A;  1T33 A;  2HVR A;  2FXA A;  3QPT A;  3FM3 A;  5AON A;  4KNY A;  3VPR A;  3UKG A;  1HA8 A;  2YU3 A;  3Q0V A;  2EZK A;  4YFX F;  4Y7N J;  2A68 F;  1FTT A;  1YX5 A;  3BTL A;  2QSH X;  3HPH A;  3EYI A;  3H5R A;  4ASN A;  1MJ9 A;  5CVR A;  5F1J A;  3WTS C;  4Q47 A;  2KHM A;  4QTR A;  3S2D J;  1R1T A;  1UCR A;  1XMK A;  1QBJ A;  1R5I D;  4XOR A;  2COM A;  3U9G A;  5DD4 A;  4HEA 2;  1XGM A;  4MNU A;  1MDM B;  4BGD A;  2P5V A;  3N4M A;  5TGT A;  4H0E A;  4ZJZ A;  4IOC F;  1YRN B;  3WGI A;  1FY7 A;  2DMU A;  3G1L A;  3H9J A;  3PO2 J;  3FHZ A;  2CQN A;  1LEA A;  1OFC X;  1Z21 A;  1D5V A;  1X1A A;  5JLX A;  2F4I A;  2R7U A;  1E17 A;  1HSJ A;  1X4O A;  2IA2 A;  3CCR I;  2CQ7 A;  1X3U A;  3BR6 A;  1BN5 A;  5FLX Z;  3HHH A;  2VBZ A;  3C3W A;  4I0B A;  3ZR8 X;  4HNT A;  3BPV A;  1VI0 A;  3DWL E;  5CVJ A;  2MYS A;  3CLO A;  3AG1 H;  2OCC H;  2XAF A;  4O6J A;  2V6C A;  3K1P A;  3A4C A;  2ZNY A;  3P7N A;  3NWS A;  4PK4 A;  3VYU B;  2F48 A;  3TGN A;  2O03 A;  4Y3O A;  3L2W A;  1I6H J;  3EUH C;  3FXU A;  2HZD A;  3OYI A;  2GOX B;  4FE7 A;  1VQM I;  2H09 A;  1N77 A;  3J7A O;  3BR3 A;  4GFB A;  5GAD J;  4IPA A;  1UMQ A;  3WOD F;  1T98 A;  4LFU A;  2EWN A;  1DP3 A;  2GIV A;  2BY1 A;  5IP6 A;  2E2H J;  2QBY A;  3U1K A;  4L9V A;  4AYB A;  1GVD A;  1KA8 A;  3I59 A;  3A02 A;  1FP2 A;  1JKQ C;  3ROU A;  3KYC B;  2L3D A;  3FF5 A;  3L9F A;  1ZGW A;  4OIQ F;  4RAY A;  4W1U A;  1YX3 A;  1ZTR A;  4EAT A;  3HRU A;  3F9K A;  3F0C A;  2VJJ A;  3U21 A;  1UG2 A;  1SFE A;  2RAE A;  3IAM 2;  2FD5 A;  2KRF A;  2ZFU A;  2Z33 A;  3VYT B;  2R5Z B;  1MBH A;  3OL4 A;  4Y17 A;  2DA7 A;  5HLT A;  3WTV C;  2HKO A;  5J8C A;  1EH7 A;  4KJZ A;  1MNE A;  2JVH A;  3I53 A;  4AU7 A;  4ZZD A;  2K9N A;  4CCJ A;  1ETO A;  1RC9 A;  4BKX A;  4X0G A;  1XTA A;  4P96 A;  2ZJP F;  3CF5 F;  2E1O A;  2JA5 J;  3W2W A;  4WXD A;  1WH5 A;  3K4J A;  4UVC A;  2O0Y A;  4CUG A;  2HU9 A;  5HDG A;  3SZP A;  3LL7 A;  3BTC A;  3AFH A;  1FNN A;  4C3J J;  2HNH A;  1N75 A;  5GAH J;  1BR2 A;  1YW9 A;  3SDB A;  3SFI A;  2K5C A;  1I1G A;  2JZY A;  5HDN A;  3JAM K;  3DLA A;  2BW3 A;  2R7X A;  1CQT A;  2LFB A;  4BDZ A;  1R4N B;  2M87 A;  3UR3 C;  1ZRC A;  2E35 A;  1Z6R A;  4GYI A;  2L02 A;  3A03 A;  1O7F A;  4P9U A;  4ZDO A;  2JK3 A;  4C9Y A;  2K02 A;  1P7I A;  3IKV A;  2IRF G;  1XG1 A;  5EEH A;  3FM5 A;  2DOF A;  2BBY A;  2HPI A;  4RGR A;  3MKY B;  1CF7 A;  2HQ5 A;  2BOL A;  4W97 A;  1IRG A;  2CW7 A;  4RAG A;  1APL C;  1IAW A;  1E3P A;  1G3T A;  1BL0 A;  4CIC A;  2RQP A;  4ZH4 F;  3NAU A;  4WXC A;  3OYL A;  2HPM A;  1SD5 A;  3CUO A;  2LKP A;  5F0H A;  1MKM A;  2VBX A;  4ESJ A;  1MNM C;  5E79 C;  3GVA A;  2HYG D;  1X19 A;  3VSK A;  2WY7 Q;  2YU9 J;  4Q4Z F;  4CHU A;  4MFE A;  4ENM A;  1RI7 A;  2LK2 A;  1I39 A;  5HS8 A;  3N05 A;  2AQF A;  3K4M A;  2HDD A;  1QRY A;  2ZME C;  2VQL A;  1IRX A;  4A3K J;  2M8E A;  3CCL I;  3KP2 A;  4HSR A;  2O9L A;  5HLG A;  2RC4 A;  3OYC A;  3LSK A;  4PDK A;  5HOD A;  2VOD A;  5FRO A;  5L3C A;  4LIV A;  4BJ6 C;  1U0J A;  2X6O A;  5K5R A;  1DGR M;  3Q9V A;  3QYE A;  4LG3 A;  1FOW A;  5F6F A;  2VBW A;  3GX4 X;  2XF7 A;  1UAA A;  5LGN A;  5KAI C;  1T2K A;  4CCL A;  2CUF A;  3K4L A;  1V55 H;  3CCU I;  5E17 F;  3GXO A;  5JFR A;  3S3N A;  1IUF A;  3HB9 A;  3OYD A;  2H1L A;  5H2F C;  3WE3 A;  3FWE A;  1XS9 A;  1A5J A;  3CCS I;  2KT0 A;  3I58 A;  5L3E A;  3ZRG A;  1TBX A;  4OMY A;  1LJ9 A;  2EIM H;  2KIS A;  3KP7 A;  1QPI A;  2ACJ A;  4IVN A;  1Y1V J;  3ZCO A;  2LF7 A;  4L9N A;  2A5W A;  1P2F A;  4MGR A;  1LEB A;  1HW2 A;  4N4N B;  3KEY A;  1BC7 C;  2IAI A;  2FOW A;  1UZC A;  4NB5 A;  1S7E A;  3PFY A;  3VSL A;  5GAE J;  4M71 A;  2M4G A;  5DCM A;  3F8M A;  2YR2 A;  4DJA A;  1ON1 A;  4BHP A;  3B02 A;  4XSX F;  3I9V 2;  5AIP A;  2FBI A;  1I3A A;  1D3Y A;  5DUI A;  4XN0 A;  3WU0 A;  3V8K A;  3DTE A;  2XAQ A;  2L4M A;  3F8B A;  1D8K A;  2EV0 A;  4MHG A;  3JTH A;  1LQ1 A;  4XRS G;  2B7E A;  3KYL A;  3DBL B;  2H94 A;  4HPQ A;  4XK4 A;  5C44 J;  2XRN A;  3GTQ J;  5H6R A;  2BV6 A;  2F5F A;  1X1D A;  4IEJ A;  4ZTJ A;  2NOG A;  2O3F A;  1R1V A;  1SVO A;  1MMA A;  2JSP A;  3RJP A;  1Y56 A;  5E8I A;  2BGC A;  1MGT A;  3IRR A;  2PJR A;  5LHH A;  2HXO A;  5EEA A;  5EF6 A;  2TCT A;  4XMY A;  2E71 A;  5D6F A;  2GA2 A;  2OA4 A;  5LGT A;  2DFH A;  4A6D A;  3OYM A;  1IJW C;  1UHS A;  2ID6 A;  5EGO A;  3MN2 A;  4FCY A;  2BHZ A;  2VON A;  1KU9 A;  3GZ5 A;  3QP6 A;  3JRG A;  4OIN F;  2QKL B;  4N9H A;  3RPU D;  1BI0 A;  3CCY A;  2ZJR F;  5J40 A;  1EKE A;  2X6X A;  2QZ8 A;  4EM2 A;  1B72 A;  2HEO A;  2HYF A;  1IN4 A;  3DPU A;  4D7M A;  2CJJ A;  3CDH A;  5IOY A;  1YI2 I;  2L01 A;  2VE8 A;  2LH9 A;  4S04 A;  3HIF A;  1HC8 A;  3LMM A;  1OCZ H;  2NS7 A;  3HL2 A;  1I1S A;  1IV8 A;  1G4D A;  3ULQ B;  5FKK A;  3HOY J;  4RDU A;  1H88 C;  2W25 A;  3A01 B;  5GAG J;  4KIB A;  3L2U A;  2A5Y B;  4XKW A;  4CDG A;  4BHC A;  4LOC A;  2JPB A;  5K7H A;  4Q48 A;  3P9C A;  3E0J B;  5FLV A;  4IXA A;  3CO7 C;  3E3V A;  2OQG A;  1WJB A;  3L2R A;  4BXX J;  2VAS A;  3MAJ A;  2NVX J;  2R5Y A;  1FX7 A;  4ZDP A;  4HZF A;  3ZQI A;  2DOA A;  2P7C B;  2P4W A;  5FRM A;  3ONQ A;  4QWQ A;  3EUK L;  5DEQ A;  3CUQ B;  2E36 A;  1Z6T A;  3MWM A;  4D0P A;  3EQL F;  5DCF A;  3KIO A;  5CJ9 A;  3RKY A;  3GTJ J;  2LTP A;  3HEF A;  1WJE A;  3G3Z A;  3AAF A;  4B4C A;  4XRF A;  2VPL A;  4E70 A;  1T6S A;  2EFN A;  1OKR A;  1IF1 A;  2KZV A;  3JRH A;  2V9K A;  3OYE A;  1OCT C;  2WBM A;  2FUG 2;  2LR8 A;  1S5L C;  2TDX A;  1FZP B;  5FKO A;  3OIQ A;  4NQW B;  1K83 J;  5IT3 A;  2AQE A;  5BQT A;  4EGY A;  3HUG A;  2QQ9 A;  5EG0 A;  5HS7 A;  1Z3X A;  2M4K A;  1QVT A;  4CZC A;  3NWT A;  2DQR A;  2M9H A;  4OOI A;  1RUN A;  3JRA A;  4OIP F;  3ZQF A;  4LLG F;  4L0Y B;  1SFO J;  1MBJ A;  2DQL A;  2WB1 N;  2L7Z A;  2XAH A;  2JPC A;  2RVC A;  1A04 A;  2JRT A;  2QA4 I;  3MEX A;  4WK8 F;  2ZC2 A;  4LIT A;  2VIX A;  2Y30 A;  1DQU A;  2KRH A;  2G9W A;  1ZGJ A;  3WHB A;  3LAP A;  3O6B B;  4EV0 A;  4U0Y A;  2GXG A;  5B66 C;  1ZRD A;  1B59 A;  2G7H A;  4BBR J;  5D5U B;  2HVQ A;  1SAU A;  4LLL A;  3ZMZ A;  5IYB J;  3LSP A;  3WTZ A;  1TWA J;  2H6B A;  4U88 A;  5ERI A;  1X58 A;  2XUB A;  1G3S A;  2H27 A;  4MEX F;  2XF5 A;  2VOO A;  1YHQ I;  2FJ1 A;  3GFJ A;  4V2G A;  2X1C A;  2KIF A;  5D5X B;  1EH8 A;  1W7P A;  3BWG A;  3HSR A;  1KYZ A;  2P5K A;  1RIO H;  2VE9 A;  1B4A A;  3IAS 2;  3S1Q J;  3T8T A;  2LC2 A;  3HKZ N;  2WV1 A;  2LG4 A;  4X6A J;  2VPR A;  3K0L A;  3MKL A;  3W6V A;  2CQK A;  3CTA A;  2XGC A;  2FBK A;  3DV8 A;  3G6E I;  4BAY A;  1SD7 A;  3RYR A;  1W36 D;  3JR9 A;  2J5P A;  2OTJ I;  2ZXI A;  3O2P E;  3O8H A;  4M3G A;  2HOE A;  4A69 C;  2O8X A;  5F08 A;  3LSM A;  1FMW A;  2CFX A;  1V5E A;  4C3I J;  4UUS A;  4AIK A;  2LOO A;  2OJE D;  4A3I J;  1S29 A;  4B8X A;  1HDD C;  5J4V A;  1J9I A;  3PNV A;  4CZZ A;  4ZYD A;  1BM9 A;  4QPQ A;  3ECO A;  1E3H A;  4DYR A;  4XSZ F;  1A35 A;  2JQ7 A;  1SC7 A;  4M9S A;  4XLE A;  3QP5 A;  2A05 A;  2H1K A;  2MFZ A;  4BE1 A;  1D1B A;  3Q9S A;  4EGZ A;  5D6E A;  4HX7 A;  2KDO A;  4KFC A;  3VDX A;  1EA3 A;  4KMU X;  4E7S A;  1Z9C A;  2CO5 A;  4BQA A;  3S14 J;  1NTC A;  1F36 A;  3KCC A;  4DYC A;  1KQ9 A;  3PSF A;  2OQR A;  5ICF A;  4G6Q A;  1Y1W J;  1G3W A;  2HZT A;  4HOB A;  3M8F A;  5L3D A;  1IXS B;  1MBE A;  1XPX A;  3OR2 C;  4AIJ A;  4D5F A;  5FB2 A;  2VKH A;  3DEW A;  1FEX A;  4F7Z A;  4G7O F;  3LFK A;  1S7O A;  4RBO A;  2CUJ A;  3FX3 A;  3OR1 C;  3RYP A;  5F64 A;  2F5E A;  4QLC U;  3FZV A;  2K3F A;  3H0D A;  3K7A J;  2DBB A;  3TL4 X;  2WB1 A;  3KFW X;  2OZU A;  3V4G A;  3WG7 H;  4YFN F;  2ZJ2 A;  3HOS A;  3QRF F;  1JT0 A;  1KZH A;  3OOU A;  3WTX C;  1PP8 F;  3BZC A;  4FAS D;  2L2O A;  1YOV B;  1SMY F;  3CF2 A;  3VEP A;  1GHC A;  1IO2 A;  1SMT A;  1OYW A;  1ETX A;  2VXZ A;  4UXN A;  1O3R A;  1YS7 A;  4F52 A;  3S3M A;  4XQF A;  4N0B A;  2PFB A;  2LYC A;  2QLZ A;  1FBQ A;  5DS9 A;  3GCM A;  2QF7 A;  3DBH B;  4KA4 A;  3SZT A;  5D8L B;  2JA8 J;  1I5Z A;  2QBY B;  1V54 H;  2K27 A;  3KLO A;  2W7N A;  3I59 B;  4M3E A;  3ELK A;  3CQZ J;  2F5C A;  3H9G A;  1MW7 A;  4YIR X;  2WTE A;  3LST A;  2XC7 A;  2IA1 A;  3HKZ A;  2P81 A;  1TWH J;  4LMY A;  1A36 A;  4FX4 A;  4IQ4 A;  3V42 A;  4F92 B;  2XPV A;  2HQA A;  2HOA A;  2VOP A;  1TC3 C;  1WGX A;  1VQ9 I;  4XLF A;  4DGW B;  3HZJ A;  2ME6 A;  4I02 A;  2W1O A;  2EFO A;  3BPX A;  2M0M A;  4D7N A;  3EYY A;  4PFP A;  1YLF A;  1B9M A;  2RNJ A;  4KIS A;  3OL3 A;  1JTY A;  1HOM A;  3DQV C;  2BEO A;  2V26 A;  4A5M A;  4IX7 A;  4UY8 I;  3E6C C;  2XPW A;  2IP2 A;  2QKM B;  4I99 C;  5JI6 A;  1X2M A;  2VKE A;  3IL2 A;  3HSF A;  5GTI C;  3HOW J;  4J01 A;  3OWT A;  2JA2 A;  2DFE A;  2R7F A;  3AL0 C;  3W6K B;  1QVU A;  5F27 A;  2PMH A;  2KLO A;  3F8C A;  3S8P A;  5A2Q K;  1LDK B;  4IRI A;  1CF7 B;  3ZN1 A;  3OYB A;  3P9I A;  1SFK A;  3F6V A;  4WCG A;  1LE8 A;  1MH4 A;  1FOY A;  1TWG J;  1LFP A;  4KN7 X;  3FMS A;  4G8X A;  1XGS A;  4PZJ A;  2Y2Z A;  2COB A;  1V5F A;  5E1X A;  2ADU A;  2V9P A;  3BCB A;  5D4R A;  1P9Q C;  2CWE A;  2IXS A;  3BLY A;  5LHI A;  3D5R C;  4HDV A;  3S32 A;  3IWZ A;  3HTS B;  3CCJ I;  1VQP I;  4G12 A;  2VBY A;  3DKX A;  2JUC A;  2PX9 A;  2XDV A;  4DYQ A;  2DT5 A;  1D0Z A;  2QCO A;  1U5T C;  2DDB A;  3S1N J;  4E7I A;  1ORK A;  2YSR A;  5KVR A;  2CGP A;  2HVS A;  1UEL B;  3LSI A;  4F93 B;  2ESN A;  1RPW A;  1UHW A;  4AVZ A;  4EJU A;  3BP8 A;  4PJM A;  2MAB A;  4HQE A;  5JHU A;  1LFU P;  2R92 J;  2BYV E;  1IXC A;  3KLN A;  3WTW C;  3RQI A;  2CG4 A;  2MH2 A;  2IW5 A;  2L7F P;  4ENJ A;  4EJT A;  3GLL A;  2MLK A;  1CGP A;  5M5Y J;  2IS6 A;  3K4B A;  4ESF A;  1WJC A;  1JGS A;  2TRT A;  5E3N A;  5JLW A;  1NK2 P;  3ZQG A;  4E7Z A;  1R36 A;  3ZQQ A;  2VQG A;  1TQM A;  1VND A;  2V4J C;  4L5I A;  4O5V A;  4UHT A;  3BG3 A;  1B6A A;  2QVO A;  2CQX A;  1FOX A;  2H8R A;  2WAE A;  2OU2 A;  3M07 A;  4XM3 A;  3DEE A;  2H8W A;  3C7J A;  4BH9 A;  3PIP F;  1R00 A;  3K69 A;  5DCM B;  1HBX G;  1BIB A;  1T08 B;  2ZO4 A;  1P92 A;  4HW0 A;  4E7K A;  1WRJ A;  2M34 A;  3KE2 A;  2XB0 X;  3LWF A;  3RZO J;  3ML6 A;  5L3B A;  2IJL A;  4BQO A;  2QEN A;  2L7M P;  5DUK A;  3U1D A;  2Y31 A;  4EJV A;  3RI4 A;  3J7A Y;  3QPL A;  3O8G A;  2HTJ A;  4G7Z F;  5CYV A;  2ELH A;  2NS8 A;  2E7W A;  2QSF X;  2VUM J;  2ELJ A;  5CVU A;  1FYK A;  1S72 I;  5IYD J;  2FEZ A;  1R71 A;  1WFX A;  1BI3 A;  5KK1 A;  4EMS A;  1IG7 A;  4Q5S F;  4RB2 C;  2IGN A;  3CDL A;  5GPA A;  3H3U A;  2PJR B;  2QEX I;  2UXX A;  1WJ5 A;  4B3X A;  4M74 A;  3N97 A;  1R1U A;  2NVT J;  1NHA A;  2Y75 A;  3DP7 A;  1TQP A;  1WH7 A;  3BZK A;  3CJR B;  2EV6 A;  1SD4 A;  4AC0 A;  3HXL A;  2DK8 A;  3BJA A;  3ZMV A;  4DIQ A;  5EGO B;  1IN5 A;  2V1X A;  2RN7 A;  2L4A A;  1E3O C;  1ZEL A;  2UXN A;  1GV5 A;  1YQA A;  2E19 A;  2ZXH A;  2VB6 A;  3TW6 A;  1SFU A;  2K4B A;  2IPQ X;  2KIM A;  2M8G X;  2LSO A;  4KN4 X;  5B1A H;  1I3Q J;  1B72 B;  2OCE A;  5HLH A;  3BR0 A;  4YRV A;  3FXM A;  2ZJQ F;  4V2F A;  5M5X J;  3QQA A;  5FKM A;  3TO9 A;  4HNU A;  1TZL A;  3JCU C;  1RET A;  3WGH A;  3J81 Z;  1T0F C;  2D5V A;  1F4K A;  4LB6 B;  4BEH A;  1GVJ A;  4HAM A;  3TBI A;  4M9X A;  2WV0 A;  2OV7 A;  1L3L A;  3BDD A;  3LQR A;  2Z16 A;  4ZC3 A;  1ZLJ A;  1BOA A;  2FMY A;  2QQA A;  3WG9 A;  5KAF C;  4OAZ A;  1IV6 A;  4U0W A;  2A6T A;  1JJ8 C;  1QZY A;  5A2Q Z;  4JBA A;  3GFI A;  1BW5 A;  2IA0 A;  2FA5 A;  1B9N A;  4LK1 F;  5AIQ A;  2B63 J;  4MO7 A;  2VJ5 A;  1F43 A;  3O3K A;  4ZYE A;  4D5C A;  3COA C;  2R5Y B;  2ZKZ A;  1YW8 A;  4I7H A;  4HA8 A;  1T38 A;  4DZP A;  3R0A A;  4U7D A;  2F6C A;  3I0T A;  5J6X A;  1TNT A;  3DU6 A;  2DMP A;  2P0W A;  2Y9Y A;  2CW8 A;  2E60 A;  2BVL A;  4ENN A;  3FXL A;  1U3E M;  2W57 A;  4HNV A;  4XN3 A;  2R7O A;  2DN0 A;  3MMY B;  1W5C C;  5IPA A;  3CCV I;  5M5W J;  4GO1 A;  2QWW A;  2ICW G;  2DA6 A;  1JKP C;  1KU7 A;  3RIR A;  1P4A A;  4RGS A;  4QSH A;  2W85 A;  2A61 A;  1FSE A;  3E6D A;  1HLV A;  3GFM A;  3GO5 A;  2DJN A;  2PMZ N;  2FBH A;  2W24 A;  5F04 A;  3ABU A;  3FKJ A;  3PUF A;  2JMW A;  1K6O A;  1R5H A;  3HUG B;  2M30 A;  4ZYH A;  3QAH A;  2XV4 S;  4ZDL A;  5EG0 B;  1TT5 B;  3HRM A;  3PQJ A;  1K6Y A;  4M6Y A;  2CH0 A;  2FSW A;  2K85 A;  4M6X A;  1K78 A;  3LA7 A;  2LF8 A;  2M1B A;  4B47 A;  4R1H A;  1WQ2 A;  2MW8 A;  1DDN A;  1ZHF A;  3FMR A;  1X2N A;  3TMO A;  1EV7 A;  2OUM A;  4BXF A;  5B5E C;  3BJO A;  1X4P A;  1QU3 A;  2W84 A;  1V5G A;  2DA1 A;  3BJ6 A;  4PGG A;  4IHX A;  5LEK A;  1TLH B;  1ACI A;  2FX0 A;  5LBQ A;  3DPL C;  1MJA A;  5DD8 A;  1DU6 A;  4RAF A;  4NC6 A;  2Z5U A;  5D8K B;  1Y0U A;  2W00 A;  5H20 A;  3DKW A;  1XGO A;  4D1Q A;  3F22 A;  1U5T A;  2FNP A;  2MC4 A;  5JVG F;  4AM3 A;  4FTH A;  2IBD A;  2HKX A;  3DFG A;  2BY0 A;  4Y15 A;  2DU9 A;  3HHG A;  2A3S A;  4F3Q A;  4ZZL A;  3AKZ A;  3PNY A;  2NRA C;  2KIU A;  2XGD A;  3H92 A;  4HX4 A;  1YYV A;  3GTL J;  1XSX A;  1JTX A;  1OCC H;  2IGM A;  5CPR B;  3IKT A;  1JKO C;  1W7P B;  4LIU A;  2D1V A;  4IL6 C;  5JHF A;  2XIG A;  2Z9O A;  2XAU A;  1F9N A;  3K2Z A;  2CU7 A;  1K79 A;  4UNO A;  4E7J A;  3J80 K;  1ZGA A;  1T39 A;  2M7B A;  1I50 J;  1N78 A;  1YIJ I;  1QNT A;  3KZI C;  4PSX A;  4XOP A;  3G71 I;  2A69 F;  4II3 A;  1FSH A;  2LMD A;  1HQC A;  2Q0O A;  2NVQ J;  2BY2 A;  1VF9 A;  2VT3 A;  4UV9 A;  4FET A;  2CYY A;  5IOZ A;  4UUS B;  2DMT A;  4YEJ A;  1RR7 A;  1PVE A;  3FDY A;  1YIO A;  2CFO A;  1ON2 A;  1M1E B;  2DOD A;  2XB5 A;  4LB5 A;  2Z2S B;  1PUF A;  3H35 A;  4EQQ A;  5TRD A;  3EUH A;  4A93 J;  3E7L A;  3CO6 C;  3OYK A;  1W7P D;  3S16 J; 
#chains in the Genus database with same CATH homology
 1FIA A;  2ME0 A;  3GBG A;  3MVP A;  4JX6 A;  3JR9 A;  1GT0 C;  1AKH A;  3HOX J;  1MBG A;  3O8H A;  2O7O A;  4M3G A;  1GV2 A;  1WPK A;  3FIW A;  5F08 A;  4A69 C;  1ZKG A;  3S1R J;  4A3I J;  4NDL A;  3TW7 A;  2X48 A;  4C3I J;  4AYB N;  4UUS A;  2GLO A;  1HDD C;  1MSF C;  4DW6 A;  2DMN A;  4MIM A;  5J1R A;  2XSD C;  3BR2 A;  4DYR A;  1ETQ A;  3HDD A;  3HOZ J;  1JGG A;  3QPS A;  1ENH A;  1JKR C;  2EQR A;  1D5Y A;  2H1K A;  2ELK A;  3HOV J;  4X1E A;  2JA7 J;  5FKN A;  1W0T A;  1U9O A;  5M3M J;  1AHD P;  2E2I J;  5M3F J;  2E2J J;  3S14 J;  1NTC A;  1F36 A;  2VKV A;  3G1O A;  5BNG A;  4DYC A;  1WI3 A;  3BTI A;  4B1R A;  1OJL A;  1SAN A;  2OPT A;  1Y1W J;  4A3J J;  3LOC A;  3BR1 A;  1MBE A;  3IH2 A;  1T33 A;  2ECB A;  5GPC A;  4D5F A;  3VPR A;  3UKG A;  3DEW A;  1FEX A;  3Q0V A;  1WCM J;  2EZK A;  1VFC A;  4Y7N J;  2YUS A;  4RBO A;  1FTT A;  3BTL A;  3GTG J;  3FIS A;  9ANT A;  1ETY A;  4A3E J;  3GTO J;  5F1J A;  3K7A J;  3S2D J;  4QTR A;  3C2B A;  2O8K A;  1JT0 A;  2EH3 A;  3OOU A;  3Q0W A;  2DA4 A;  1HF0 A;  1ETX A;  3Q3S A;  1YRN B;  3BT9 A;  3S17 J;  3BG9 A;  2DMU A;  3G1L A;  2L9R A;  3PO2 J;  1RKT A;  1OFC X;  2LY9 A;  5JLX A;  4B3A A;  5DS9 A;  2QF7 A;  3IH3 A;  4A3M J;  1H8A C;  3BG5 A;  2JA8 J;  1W0U A;  4C3H J;  3BR6 A;  2VI6 A;  4BBS J;  4FIS A;  4L5E A;  2HYJ A;  1VI0 A;  4M3E A;  3CQZ J;  4M3F A;  2Y0S N;  3JRB A;  4XIC A;  2HOT A;  5GP9 A;  1YRN A;  1B8I B;  4A3C J;  2P81 A;  1TWH J;  5E3L A;  1I6H J;  1ETK A;  1K61 A;  1XC5 A;  1EF4 A;  4FE7 A;  1IC8 A;  3M3Y J;  1IRZ A;  3BR3 A;  2XPV A;  2HOA A;  4GFB A;  1TC3 C;  1WGX A;  1UMQ A;  2M0C A;  5IP6 A;  2E2H J;  2ME6 A;  1GVD A;  3A02 A;  4D7N A;  1JKQ C;  1ZGW A;  4M6V A;  2XRL A;  4W1U A;  5EYR A;  1JTY A;  1ZTR A;  1HOM A;  3PO3 J;  1B8I A;  3F0C A;  1UG2 A;  2RAE A;  2XPW A;  4JP0 A;  5J3L A;  2HOS A;  1LE8 B;  1H89 C;  2FD5 A;  2LVS A;  1OCP A;  1X2M A;  2VKE A;  2R5Z B;  1MBH A;  1A6I A;  1FIP A;  2DA7 A;  3JRC A;  3TED A;  2R0Q C;  1DU0 A;  1BA5 A;  3Q0U A;  2K9N A;  2LLK A;  4JYK A;  1ETO A;  3HOW J;  4A3F J;  1BJZ A;  3JRI A;  4BKX A;  3JRF A;  5E3M A;  4MLO A;  2E1O A;  2JA5 J;  4DZJ A;  4IHY A;  1QVU A;  5F27 A;  5K7Z A;  1WH5 A;  4IHV A;  3FK7 A;  3BTC A;  4ABZ A;  4C3J J;  1LE8 A;  1MH4 A;  4S0H B;  1TWG J;  1U78 A;  3TP0 A;  2R5Z A;  2EZL A;  3SFI A;  5C4X J;  2HI3 A;  1P7J A;  1RES A;  1CQT A;  1GUU A;  2Y2Z A;  2COB A;  2LFB A;  1Q1V A;  2M2E A;  4UUT A;  3S2H J;  4A3G J;  3A03 A;  2LD5 A;  2JK3 A;  3OSF A;  2LP0 A;  1P7I A;  3GTP J;  1XG1 A;  1JJ6 C;  3G1M A;  1R9T J;  2HQ5 A;  4W97 A;  2JWT A;  1APL C;  4G12 A;  1BL0 A;  1JUP A;  4DYQ A;  2QCO A;  3LSR A;  4JX5 A;  1TWF J;  3NAU A;  3S1N J;  4M3D A;  5F0H A;  1ORK A;  2WAQ N;  3OSG A;  1MNM C;  5FKL A;  2GM4 A;  3SJM A;  2YU9 J;  1RPW A;  3NAR A;  4MFE A;  4EEF G;  2LK2 A;  1IGN A;  1LFU P;  2YS9 A;  2R92 J;  2MSY A;  1U8B A;  3RQI A;  2HDD A;  1QRY A;  2L7F P;  3B6C A;  4A3K J;  1FJL A;  5M5Y J;  2O9L A;  1ETV A;  2OF7 A;  1MH3 A;  4FE4 A;  2TRT A;  5E3N A;  5JLW A;  4XRM A;  3ZQG A;  1NK2 P;  3I4M J;  5HOD A;  1VND A;  5F0F A;  3BG3 A;  2X6O A;  1MBF A;  2CQX A;  2H8R A;  2CUF A;  1HCR A;  1IUF A;  3HB9 A;  5E3O A;  3IH4 A;  3H0G J;  3ZQL A;  1XS9 A;  1A5J A;  2KT0 A;  4XID A;  2M34 A;  2XB0 X;  3RZO J;  1QPI A;  2L7M P;  1Y1V J;  2Y31 A;  2CRG A;  2DA5 A;  2JJ7 A;  3QPL A;  3O8G A;  2IAI A;  2NS8 A;  2EBI A;  2VUM J;  2XGE A;  3HBL A;  4CYC B;  1S7E A;  5IYD J;  2ID3 A;  1IG7 A;  4Y52 J;  3RKQ A;  3CDL A;  5GPA A;  2FQ4 A;  4I76 A;  2NVT J;  3RZD J;  2DA3 A;  1WH7 A;  3BQZ A;  5K7F A;  2X9D A;  4IHW A;  3LSG A;  2K9Q A;  4AC0 A;  5EGO B;  2DTZ A;  2I10 A;  4XRS G;  4XRS A;  1E3O C;  1IDZ A;  4XK4 A;  3WHC A;  1GV5 A;  2E19 A;  3TW6 A;  5C44 J;  3GTQ J;  2NVY J;  4CYC A;  2M8G X;  1ZQ3 P;  4IEJ A;  3LSJ A;  3IV5 A;  1I3Q J;  2NOG A;  1B72 B;  3BR0 A;  3BTJ A;  4V2F A;  5M5X J;  2HXO A;  3QQA A;  5FKM A;  3HOU J;  1FTZ A;  2L0K A;  5EEA A;  5EF6 A;  5FJ8 J;  1T56 A;  2TCT A;  3ZQC A;  3GTK J;  2XPU A;  1RET A;  1Z77 A;  2D5V A;  1IJW C;  3I4N J;  2LKX A;  1UHS A;  2JN6 A;  2ID6 A;  5EGO A;  3MN2 A;  4FCY A;  4A3B J;  3LNQ A;  1POG A;  3H3V K;  3JRG A;  1JUM A;  3HGY A;  3CCY A;  1IV6 A;  1MSE C;  2GBY A;  1JJ8 C;  1B72 A;  2JA6 J;  1G2H A;  5EDN A;  1HDP A;  1BW5 A;  2B63 J;  3K2A A;  4MO7 A;  1F43 A;  5DTD A;  4D7M A;  2CJJ A;  4M3B A;  4D5C A;  5IOY A;  2R5Y B;  2EZI A;  4DZP A;  5C4J J;  4A3L J;  2DMP A;  1RKW A;  4I6Z A;  2Y9Y A;  2HXI A;  5J1U A;  2NS7 A;  4HNV A;  5EZG A;  3FKI J;  5FKK A;  4RDU A;  1H88 C;  3HOY J;  2DN0 A;  3JRE A;  3B6A A;  3A01 B;  5IPA A;  5M5W J;  2K9S A;  2DA6 A;  4LOC A;  1JKP C;  5K7H A;  3HGG A;  4QSH A;  5FLV A;  2CUE A;  1NK3 P;  1HLV A;  5EZH A;  4BXX J;  2AO9 A;  4A3D J;  2DJN A;  2PMZ N;  2NVX J;  2R5Y A;  5F04 A;  5IP9 J;  2DA2 A;  3ZQI A;  2JMW A;  1TWC J;  2MGQ A;  5EG0 B;  1LFB A;  1U9N A;  5IP7 J;  3GTJ J;  2LTP A;  3HEF A;  5C3E J;  4B4C A;  2W48 A;  3A01 A;  1BW6 A;  3HM5 A;  2MW8 A;  1AU7 A;  2AHQ A;  1X2N A;  3JRH A;  2IEK A;  1JT6 A;  3S1M J;  2KDZ A;  2MG4 A;  1OCT C;  2CQQ A;  3TP3 A;  2LR8 A;  2DA1 A;  1GDT A;  5FKO A;  1Z0X A;  4C2M J;  4IHX A;  1K83 J;  2R93 J;  2FX0 A;  4MFD A;  1DU6 A;  3L1P A;  5EG0 A;  1MBK A;  5FLM J;  3BR5 A;  3D1N I;  1QVT A;  3JRD A;  4FTH A;  3GTM J;  2IBD A;  2M9H A;  3JRA A;  3ZQF A;  2Y9Z A;  3M4O J;  1SFO J;  1MBJ A;  2XGD A;  3ZOB A;  5F0C A;  2WB1 N;  1ZR2 A;  2L7Z A;  1ETW A;  3BQY A;  3S15 J;  4QIW N;  3GTL J;  3CMY A;  1JTX A;  1JKO C;  2Y30 A;  5J1Y A;  1PUF B;  3WHB A;  2ECC A;  2N8G A;  2EZH A;  3ZQH A;  2CU7 A;  4J19 A;  2DMQ A;  1I50 J;  1IDY A;  2ZB9 A;  4BBR J;  1AKH B;  5IYB J;  3LSP A;  1TWA J;  1ZR4 A;  4JX4 A;  1X58 A;  2NVQ J;  1VF9 A;  5IOZ A;  1ZK8 A;  2DMT A;  2K40 A;  3SDG A;  4UUS B;  4BY7 J;  1O4X A;  1ITY A;  1RR7 A;  2FJ1 A;  5IYC J;  4V2G A;  2R7Z J;  2XB5 A;  3PM1 A;  3OIO A;  1PUF A;  1JUS A;  3S1Q J;  3HKZ N;  2WV1 A;  3FK6 A;  4BY1 J;  2G0E A;  4X6A J;  4AUX A;  2VPR A;  3MKL A;  3W6V A;  4A93 J;  3E7L A;  3DCF A;  2XGC A;  3S16 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...