4ENNA

Crystal structure of s. pombe atl1 in complex with damaged dna containing o6-carboxymethylguanine
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
molecule tags Dna binding protein/dna
molecule keywords Alkyltransferase-like protein 1
total genus 33
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ennA00
4KN7X 4QWQA 4EJOA 4HDUA 2FOKA 4GO1A 3DP7A 5IT9Z 2F5EA 1BC8C 3I53A 2Z9OA 3ELKA 2JT1A 1G3TA 2QUFA 2IRFG 1S7AA 1BI2A 4JK1X 4HX8A 2HQRA 2JPBA 2RVCA 5FB2A 5JR3A 5HDKA 3SFZA 6PAXA 3ZMTA 2K86A 1SD6A 5HOOA 1ZRCA 4B09A 2BGCA 4O5VA 2UWMA 3EYIA 5D4RA 4A0XA 3ZMVA 1HSTA 1U5TC 2CYYA 4LFUA 1QZZA 2RV8A 4ON0A 1XCBA 1AOYA 1BN5A 5LEKA 4Q5SF 4MTDA 4A0ZA 4LG0B 4KIFA 4XLPF 1ON1A 2XVCA 1U5TB 2K4JA 2P6TA 2EK5A 4G8XA 4XSZF 3ECOA 5CVVA 2VE8A 4M6YA 3T8TA 3KP4A 2RNJA 2D2WA 2ZXJA 4BYYA 2Q0OA 2F5DA 2TDXA 1IAWA 1SFEA 4ENJA 3D0SA 2F5CA 2HQNA 5DCFA 2IA1A 5CVIA 3VEPA 3GW2A 2PLYA 2Y75A 4FX0A 5L3DA 1YG2A 4RGRA 1RNLA 3LQQA 4EQQA 2W84A 2W25A 4I02A 1YLFA 5ICFA 2FMLA 2A3SA 2LF8A 3J81Z 1I1GA 3GF2A 1P4AA 5HLIA 4D0PA 2OZUA 2HR3A 2P5VA 1R23A 2BE5F 1SFXA 2JRTA 3F6VA 1HBXG 3E6CC 4HF2A 3TKYA 5L3GA 2W57A 1R1TA 5KK1A 1OYIA 3BJAA 4Q47A 2CW0F 3JSOA 3ABTA 1W5TA 3QU3A 4L5IA 1ZGJA 1ZG3A 3KLNA 2GXGA 2FBHA 1Z6RA 2XHKA 3EYYA 3RDIA 1KGSA 5K5QA 5FGMA 1STZA 2H27A 3R0JA 4I09A 4UUVA 4WF2A 2ZFWA 4A6EA 1LNWA 3J81K 3HRTA 2VT3A 1WQ2A 3TO6A 3K2ZA 2R7FA 5LBQA 5A2QZ 4BXUA 2DW4A 5DEQA 4CGZA 1B1BA 3U9GA 1GXPA 1ULYA 4AIKA 3PQKA 2V9VA 1XSXA 5H6QA 2HDCA 4KICA 3GVAA 3LA7A 5F64A 3WE3A 1UB9A 2X4HA 2DT5A 1R7JA 4N9IA 1I6XA 2MC3A 3E5XA 2JZYA 4O3MA 4OMYA 1U5TA 1YFHA 3C7JA 2KRFA 2Z5UA 3T8RA 4OIPF 1W7PA 4P5OA 1Z91A 3EETA 3MZHA 1HQCA 1LDJA 2YPRA 2QZ8A 2QQBA 5LGTA 5DUIA 2EV6A 2VBWA 3I5UA 1H9TA 4R1HA 1J75A 3SZPA 2GA1A 5LRSA 5DCMB 2V6CA 3P9KA 4OIRF 2HYGD 1DP7P 2OU2A 3GX4X 2GIVA 3HHGA 4MQ9F 3KZZA 3CDHA 1S3JA 2L4MA 1G3YA 3U1DA 2ISZA 2FQ3A 2BEOA 2DQLA 2Q2EA 3FXRA 2O8XA 1O7FA 2XRNA 4L5JA 5EEGA 1ZG1A 4A5NA 5ICGA 1EH8A 2EA2A 2HTSA 2XAQA 4OIQF 4DQ2A 5K1YA 5BPDA 4Y15A 4I0BA 1QO0D 1XCVA 3HSFA 4EM0B 3GFMA 2IA0A 2Q8KA 2HEOA 1FX7A 3E3VA 2XAJA 3JW4A 4Q48A 3B73A 2A61A 2JPCA 5FFZA 4U0VA 3I59A 3KCCA 1HW5A 1T98A 3MAJA 4IF4A 5KVRA 1P4WA 2VN2A 4LK1F 2M1BA 3IHUA 1O3TA 1D8KA 3WGGA 2GZWA 4G7HF 1B9NA 3I58A 2BYVE 3NRVA 4I2OA 3TO9A 5E8GA 1FSEA 3L09A 3KFWX 4YIIA 1B9MA 3EQLF 5J8FA 2A6EF 3WTTC 2VT2A 2R7DA 2E7XA 3QP5A 4IRHA 2VC1A 1JE8A 3MCZA 2QQ9A 3IC7A 5LHGA 1FYMA 3KE2A 3KP5A 1ZLJA 1IXRC 2VE9A 1IN4A 1EH7A 1SD5A 4EGYA 2M5WA 1ZHFA 2L3DA 4ESJA 3SZTA 5ICCA 3I59B 1U2WA 1FYKA 1FP2A 1Z6TA 4LB5A 2G7UA 5L3BA 4HZFA 3F8CA 3C18A 2O0YA 3HHHA 1AWCA 1W4MA 5DD8A 2H09A 4M72A 1IN6A 2O6GE 2QWWA 3V7RA 3QRFF 4HOBA 1DPUA 1WWXA 3MWMA 3G3ZA 4BAYA 2PG4A 1A04A 5HVQC 1KU3A 2DBBA 1HKQA 3WU0A 3WE2A 1FSHA 4I98B 3EDPA 1OMIA 3BPVA 4LGWA 2LSOA 2VOPA 1IN5A 2HKOA 3ROUA 3FMRA 3ZMZA 3KP3A 5HS9A 2XASA 1K79A 5JI6A 1BM9A 4I01A 2E1CA 1LEBA 2CG4A 5BOXA 2RN7A 1OR7A 5AIQA 2ETHA 4WK8F 3KP2A 3RTRA 4HV5A 1MJ9A 2ZBKA 3HSRA 1P4XA 4I7HA 4BQAA 2YU3A 1Q1HA 4EJWA 4P9UA 3HRSA 3IRQA 3TOBA 1F1ZA 1ZGAA 4MEXF 1XDSA 4LJZF 1USSA 5DYMA 4I0AA 1LEAA 1J7KA 2FNPA 4N0BA 1FBQA 1U78A 4ESFA 2FU4A 4OIOF 4HLXA 1JHFA 3RKYA 5E20A 3SXYA 4RGUA 2NS0A 3HTUA 4MQVA 4MGRA 3ZP5A 4HQMA 1B59A 4LK0F 3ZN1A 1QZYA 1FWZA 3ZMDA 3SHFA 1MJBA 2K4BA 1YYVA 1S8NA 1XGOA 2A68F 2EJRA 4IXAA 2DO7A 1VTNC 3MEXA 4EMSA 4OOIA 1BBYA 1WRJA 1KQ0A 3K1NA 3BPXA 3ZMSA 3ABUA 2K7LA 2Y0MA 4IPAA 4S04A 5J6XA 4BNCA 2D1HA 2K02A 2P4WA 3O3KA 1BJAA 1P92A 2C6YA 2EFNA 2ZNYA 4RAZA 4U0YA 4P55A 5ED4A 5AIPA 1J9IA 3M9AA 3GEZA 1KYWA 4QLCU 4IRGA 3F21A 1QGPA 2J5PA 4HYEA 2GWRA 2GXBA 1W7PD 5D5XB 4XBFA 1S6LA 3BWGA 4HW0A 1YO5C 4FX4A 2XIGA 3SQNA 2IA2A 1IUYA 2O3FA 3R60A 1QBJA 1JGSA 3KETA 1B4AA 1R00A 4M73A 2YX7A 2VBYA 5HS7A 3I71A 2VBXA 3TOAA 4KMUX 4PGHA 1TNTA 4R79A 1FZPB 2EV0A 4UV9A 3BDDA 1L3LA 4RS8A 4Q4ZF 4U7BA 4HF1A 1R1UA 2JTVA 1XDUA 2DLLA 2NAZA 4HV6A 3QP6A 5D5WB 1IF1A 4MEYF 5K5OA 1IN7A 2P5LC 2EV5A 3N4MA 1C0WA 4CDGA 5E8IA 5HLHA 2NRAC 3H3ZA 4IHSA 1XMAA 3AAFA 4WXDA 1PP8F 2NNYA 2XKOA 4MTEA 3P9IA 4G6DA 4KIBA 5L3EA 2R3SA 1XN7A 2A5YB 2ZMEA 1TBXA 4KDPA 2CO5A 2UXXA 2XAFA 1I27A 1GVJA 1KU9A 4H0EA 2XAHA 5ILVA 1BI0A 1MZBA 1ODDA 4MHGA 3P9CA 5FD6A 1XD7A 4M9XA 2XROA 1G3WA 1SD4A 4HX7A 4HLYA 3N97A 3FZVA 1ONVA 1TTYA 2DK5A 1Z05A 4Y13A 2H94A 1F9NA 3BJ6A 1DDNA 1RUOA 3CUQB 3TO7A 3W6KB 3HRUA 4OINF 5DCMA 4WCGA 2K27A 3GFLA 1XGNA 1JHHA 5CVJA 1TW2A 2PMHA 3T1BA 3LA2A 3FF5A 1F5TA 2A69F 1IRGA 3GO5A 2OZ6A 4M74A 3VFZA 1XGSA 4IHTA 3GFIA 3KZYA 3KEOA 2ESHA 1ZRFA 1KQ9A 3F3XA 1FNNA 3JSPA 3K0LA 4JQFA 5E1ZB 2CFXA 3Q9SA 3J7AO 2CWEA 4IVNA 2ZCWA 4P9FA 5BQTA 2PJPA 1BI1A 1KU7A 3DPLC 5HDGA 5LHHA 1R1VA 4YIFA 1LVAA 5TJJA 2ELHA 4M6XA 3REOA 4M71A 2EFPA 3V8JA 2V79A 3LFKA 1K6OA 3WODF 5HDNA 1PDNC 1YS6A 1S7OA 3P7NA 2LF7A 4IJAA 1HW2A 2PBIA 2OQGA 1Y0UA 1WSUA 5FFXA 3Q9VA 2XV4S 5BPIA 5F6FA 2QLZA 2VONA 1BC7C 1FPQA 4Z2YA 5L3FA 1MGTA 5H20A 2CSOA 2W85A 3TQNA 2OAZA 3FWEA 3WTVC 3GYHX 1E17A 2B0LA 1J0RA 4BHBA 2ZJ2A 3H3UA 1ZAOA 1ZN2A 4ZYGA 5BS6A 5LGUA 1F4KA 1G3SA 5ILUA 5E17F 2FBIA 3EUHA 3FMSA 2P7CB 3FMQA 1W7PB 4LMYA 2DI3A 5L3CA 4U0WA 2ZNZA 2EWNA 5LLQA 5LEJA 2X0LA 2YX4A 4RAYA 2DPDA 3COAC 2GA2A 4JBAA 3HOTA 5EEHA 1BOAA 2FA5A 4CHUA 3DFGA 2MH9A 1MDMA 2L4AA 2VODA 5CJ9A 4BHCA 2FNAA 4IRIA 1DPRA 3VOEA 4GYIA 1MJAA 1ZH5A 4HDVA 3QPHA 2P7VB 4YFXF 1K7AA 3F22A 2DFIA 3WTSC 1ON2A 3OOPA 1OPCA 1GHCA 4UVBA 2LKPA 1YTYA 2G9WA 5FLXZ 2HYFA 3DF8A 3KLOA 5DD4A 3S2WA 3CO6C 3QPTA 2MA3A 1O3RA 4WXCA 4HQEA 1R36A 1SD7A 2PQ8A 2FEZA 2KIUA 5IT3A 1TW3A 4ETSA 3DEUA 3F8MA 1IXSB 3MZYA 2O61A 3WTUC 3ZN0A 4E70A 4ZZDA 5JFRA 1HXDA 2FBKA 1W5SA 4UNOA 1V3FA 1XMKA 5D6EA 4A0YA 1IZ1A 4WXHA 5FLXK 4EV0A 1K78A 1YQAA 1V4RA 5D4SA 1D5VA 4NHJA 1I1SA 2FE3A 4ZYDA 3B02A 4U7DA 1LDDA 2RC4A 2ISYA 3CJNA 2OD5A 2IP2A 3GXOA 1T38A 3IKTA 4KN4X 3QU6A 3IWFA 3RPUA 2AXLA 1ZREA 2M30A 3M8EA 1IXCA 1J5YA 2QQAA 1XB4A 1TQPA 1TLHB 4G94A 2L02A 5D6FA 2D45A 5E1XA 3LAPA 2WV0A 4KA4A 1XSVA 5BMZA 3DXJF 2ESNA 3IRRA 2EFOA 1QQIA 3BJOA 2ZKZA 3ECHA 5TRDA 4G7ZF 2PFBA 4HAMA 3IKVA 3RIRA 3GZ5A 4KMFA 4EM2A 3FM5A 1O57A 5ERIA 4P96A 1ZYRF 1L0OC 2LDUA 2QVOA 2V1DA 1REPC 3JTHA 1FYLA 3CUQA 3FM3A 2ACJA 2NYXA 3FHZA 2UZKA 1BI3A 4TV7A 2W24A 3Q5FA 1MKMA 5K5RA 5D8KB 1TQIA 3ZMUA 4GCVA 3TGNA 2IT0A 3WTWC 4ENKA 3F8NA 1BIAA 2P6SA 3CO7C 2A07F 2KKOA 2HGCA 5FD5A 1CF7A 3KP6A 4HX4A 1I5ZA 2A6HF 2JSCA 4L9VA 3E6DA 4FT8A 1IW7F 1RIOH 3QOPA 3VB2A 5E18F 3NEUA 4UHTA 1WI9A 5E1WA 2E7WA 1KYZA 2Z99A 4G7OF 4S05A 3C3WA 5LRRA 2EFWA 4XRFA 4AVPA 1FC3A 2QENA 4LLLA 4NQWA 2NNNA 3M8FA 3T0YA 1HSJA 4L18B 3DV8A 1QNTA 4HBLA 1LB2A 1ZG5A 1E2XA 2PEXA 2STWA 2J5OA 1HKSA 4A2UA 1MD0A 4LLNA 4R8HA 2STTA 3F72A 4AWXB 2RGVA 2FF4A 1IN8A 3BZ6A 3RKWA 2OBPA 5LGNA 2G7HA 3HYIA 4WWCA 1O3SA 1UFMA 3BROA 2FRHA 1T2KA 3I64A 2IW5A 2KIMA 1P6RA 1XGMA 2CGPA 3ZPLA 2D1VA 1R5GA 4CXFA 3RKXA 5FO5A 3E5UA 4KYWA 2VC0A 4EGZA 1KU2A 2P5KA 4KNYA 2GQQA 2HZTA 2ADUA 4LG0A 1TNSA 4A6DA 5CVRA 4Y17A 1P2FA 3GUDA 2DK8A 1U6GA 1X3UA 4KT5C 1WKMA 5JHUA 2V1UA 5CLSA 3V7SA 3PFIA 1EH6A 3E5QA 3HSEA 2UXNA 4CZZA 1CGPA 4U88A 3JTGA 1FY7A 3DQVC 1LDKB 3F8BA 3WU1B 5DUKA 4RGXA 5F1RA 3MFKA 3ML6A 2EB7A 2MLGA 3BP8A 3RYRA 1R22A 3F23A 4GYGA 4B8XA 2HOEA 3I54A 2M87A 3HOSA 2ZMEB 3JAMZ 2FMYA 1UCRA 4MNUA 3KP7A 2MLKA 2EFQA 3G73A 1UHMA 1HW1A 2IVMA 4F7ZA 3J80K 4LB6B 2E1NA 1YS7A 1MDMB 2QBYB 1OYWA 5D8LB 3KEQA 3PQJA 2VBZA 1UHWA 2HFHA 2COMA 1G6NA 4ZH4F 1G4DA 4PZJA 2F5FA 4CO8A 1FBSA 4EJUA 2YR2A 2L54A 3CUOA 3RPQA 4LD5A 3C1DA 3CLOA 5A2QK 4XLNF 1ZRDA 1D8JA 3I4PA 3U2RA 1S29A 1YW8A 3IWZA 2DTRA 2XKPA 3JAMK 1Z9CA 2V1XA 4ASNA 1O7LA 1R58A 1YW9A 3FXQA 3ZQ7A 2O03A 3TDUC 1U8RA 3HUGA 4O6JA 3V8KA 4OMZA 4G9YA 2Z3YA 4K2EA 2OA4A 2PN6A 1OYYA 3HIFA 4YFNF 3E6BA 4BH9A 4PDKA 3RYPA 2XUBA 3WTYC 2AS5F 4EM1A 1FBUA 2FXAA 3F6OA 3H92A 2Y48A 3HRMA 4NB5A 1OKRA 3GFJA 5AONA 1PUEE 3RI4A 2Z33A 2IPQX 2QBYA 2H6CA 4UV8A 2VXZA 1T0FA 4AIJA 4WX9A 3WGIA 2DAOA 3L9FA 1Z1DA 5DV5A 3CUQC 1HKTA 5IT9K 4CYDA 1IRFA 4RGSA 4GGGA 4ENNA 1O3QA 3M7GA 1BIBA 2P8TA 4L9JA 3WTXC 3LWFA 2CQKA 3NQOA 3E6MA 4M9SA 3K1MA 2KJBA 2XGXA 2GAUA 4BHPA 4N9HA 5HLGA 3DKWA 1NHAA 4M9ZA 2QM3A 4L0ZB 3FXUA 3L2CA 3WTZA 3LA3A 2YSRA 3K69A 2H6BA 4DNCA 1RZ4A 4A5MA 3CTAA 1TQMA 3BY6A 4RB0A 2RQPA 5CYVA 4UVAA 3ERED 2DU9A 3W6JB 1FT9A 4HA8A 2VOOA 2OQRA 2BBYA 1T39A 4ENMA 3LQRA 1CF7B 3O2PE 4A12A 2M8EA 2QYOA 3RJPA 2LNBA 3WG9A 4PGGA 4YG2F 1FOKA 1T6SA 4AD9A 3K1PA 3I0TA 1XSDA 3HTSB 2F2EA 4XSXF 4AIHA 1J2XA 5LHIA 3OV8A 3GZ6A 5D5VB 4RB2C 4L0YB 1R5HA 4L9TA 3DPTA 4ZYEA 3WGHA 2ZO4A 1YW7A 4EJTA 5DDGA 1U3EM 4OU0A 5D5UB 2RKHA 3R61A 4ESBA 2IJLA 3T5XA 2L01A 5CVUA 2PMUA 1ZARA 4YFKF 1K78B 1J59A 2HKXA 1FP1D 3ULQB 1GXQA 3MQ0A 4FHTA 1KA8A 2FSWA 2MD5A 2XAGA 3LSTA 3GLXA 1ZLKA 2HWVA 5H6RA 3BOQA 1QPMA 3GWZA 5JVTA 4RB1A 2WWYA 1YIOA 4KUMA 4RB3C 4KFCA 4UVCA 3F8FA 2PI0A 3R6SA 3J80Z 1H9GA 5ICEA 3V8LA 4LLGF 3D5LA 3V4GA 4UXNA 3VODA 4G6QA 4KIGA 3ISPA 1RUNA 1RI7A 1H0MA 4GXOA 1PP7U 2RDPA 2EA4A 1B6AA 1EV7A 4CICA 1D3YA 3QAHA 5ILSA 3L00A 3O6BB 2BV6A 4L9NA 1SMYF 2KJCA 3R0AA 3FX3A 4ZYHA 2KIFA 1FLIA 3V7CA 3TDZC 1DUXC 1USTA 2HS5A 5HS8A 2MH2A 1LJ9A 1LQ1A 3LAJA 2WC2A 4EVIA 1SFUA 2M45A 1JXSA 3K9TA 2DQRA 2MBFA 1KQ8A 3R4KA 1Z7UA 4ZZLA 1SMTA 5J8CA 4EJVA 2WTEA 3L7WA 3E97A 4HF0A 4PCQA 2DPUA 1SAXA 2HTJA 3M1EA 3IL2A
chains in the Genus database with same CATH superfamily
4KN7X 4QWQA 2E35A 4EJOA 4HDUA 2FOKA 4GO1A 3DP7A 1HLVA 4C3HJ 2E1MB 1RETA 5IT9Z 4E6KG 2F5EA 1TWAJ 1BC8C 1ZR2A 1MIJA 3DEEA 2OF7A 3I53A 2Z9OA 3A01B 4CYCA 3ELKA 2E5ZA 2JT1A 3OIQA 2M34A 1G3TA 2XF5A 3LMMA 2QUFA 2IRFG 1S7AA 2HQAA 1OISA 1Y56A 1BI2A 4JK1X 5DM6F 4HX8A 5GTHC 2HQRA 2JPBA 2RVCA 4ZDOA 2GXAA 5FB2A 5JR3A 4D9JA 1IRZA 1YJWI 5HDKA 3SFZA 1NH3A 1TT0A 6PAXA 2B7EA 4A3MJ 2MFZA 4QSHA 3ZMTA 2X51A 2K86A 1SD6A 5HOOA 3BR0A 1ZRCA 4B09A 3ABLH 4B43A 2BGCA 4O5VA 2UWMA 3EYIA 5D4RA 4XORA 1TT5B 3GCMA 4A0XA 2HDDA 2L7ZA 3ZMVA 1OCCH 3BCAA 5FKOA 2Y9ZA 1HSTA 2DOEA 5CQEA 5EGOA 1JTYA 1U5TC 2CYYA 3HGYA 2G0EA 4LFUA 1QZZA 2ECCA 2RV8A 1FOYA 1QHHD 4ON0A 1XCBA 2LREA 3BC8A 4DYCA 4ITVA 1AOYA 1E0EA 2OCCH 2XC7A 1BN5A 3ZCOA 3CMAI 5LEKA 3ZOBA 4Q5SF 3S1MJ 4MTDA 2ZFUA 4A0ZA 4LG0B 1S5LC 1FOWA 2IGKA 1RKTA 4KIFA 4NUBA 4XLPF 2I8DA 3JRDA 1ON1A 2XVCA 3IV5A 3HM5A 1G59A 4DW6A 1U5TB 3IUOA 2K4JA 4E7KA 2CV2A 4ZTJA 2P6TA 1T95A 2EK5A 3OSGA 4C30A 4G8XA 1IDZA 4XSZF 1K83J 3ZR8X 3ECOA 5CVVA 2VE8A 3DBHB 4M6YA 3T8TA 1GV5A 3LSRA 1ZQ3P 3KP4A 4BUPA 2RNJA 4HNUA 4M3FA 2LKXA 2D2WA 2ZXJA 4BYYA 2Q0OA 2F5DA 3GTJJ 2TDXA 1IAWA 2XAUA 1YX5A 4PFOA 1SFEA 2WADA 1ORKA 4G12A 1QHGA 4ENJA 3D0SA 2F5CA 2HQNA 5DCFA 4F3QA 1XC5A 2IA1A 5CVIA 3VEPA 3GW2A 5J1RA 2PLYA 2Y75A 2CQNA 4FX0A 4X1EA 5L3DA 3HC7A 1VQ8I 1I3QJ 1YG2A 4BS9A 1W0TA 4RGRA 1RNLA 3LQQA 4EQQA 2W84A 2Y9YA 2W25A 5GPAA 3LFUA 4I02A 2CUZA 1XPXA 2E71A 1YLFA 1R9TJ 5ICFA 4AU7A 2WY7Q 2FMLA 2A3SA 2LF8A 3J81Z 2R5YA 3IH2A 1I1GA 1V5EA 3GF2A 3K70D 4KJZA 3SZGA 1FIAA 1P4AA 2R7WA 5IP9J 5HLIA 4D0PA 1WH7A 2OZUA 2HR3A 2P5VA 4IQ4A 1R23A 2BE5F 1SFXA 2JRTA 3TMOA 3F6VA 3OMYA 2E2JJ 3OYAA 1HBXG 3DTKA 2F6CA 3CZ6A 3E6CC 1Y0NA 4HF2A 3TKYA 1VF9A 5L3GA 2W57A 1OQYA 1R1TA 5KK1A 1OYIA 3BJAA 4Q47A 2VXDA 2CW0F 3JSOA 3E0JB 3ABTA 1W5TA 3QU3A 4L5IA 2JA8J 2JN6A 2ZJRF 1ZGJA 1ZG3A 3KLNA 4G6TB 3S14J 2GXGA 2DFFA 2FBHA 2IEKA 1Z6RA 1MMAA 2XHKA 4N4NB 3H0DA 3EYYA 1D0ZA 3RDIA 4B44A 1KGSA 1MBJA 1VI0A 3HGGA 5K5QA 3FXJA 5FGMA 1STZA 3OYKA 2H27A 3R0JA 2KPMA 4I09A 4A3LJ 4UUVA 4WF2A 2ZFWA 4A6EA 1LNWA 2BY1A 5F27A 3S93A 3J81K 1GVDA 1R71A 1R6RA 4A3EJ 3BR2A 3HRTA 1TWFJ 2VT3A 1WQ2A 3TO6A 3K2ZA 3SEQA 2R7FA 5LBQA 1UJ8A 5A2QZ 4BXUA 5GAHJ 5KNLA 1O4XA 2DW4A 5DEQA 2R92J 3H36A 5EZHA 3PL8A 3VSLA 4CGZA 1B1BA 3U9GA 1GXPA 1DQUA 5E3NA 3OYJA 1ULYA 2KZGA 4AIKA 1MNEA 1LFBA 1TZLA 3PQKA 3H5NA 2V9VA 3F0CA 1XSXA 2ZXHA 4FTHA 3CESA 5H6QA 2HDCA 4KICA 3X2QH 3GVAA 3LA7A 1MMDA 5F64A 4ZC3A 3WE3A 4B48A 2EPFA 1UB9A 3BTLA 2MD0A 4AIDA 1H89C 2X4HA 2DT5A 1ETXA 1R7JA 3MZ8A 4PJMA 3U1KA 1WZ2A 4N9IA 1I6XA 2MC3A 1UMQA 3E5XA 1WJDA 2JZYA 4O3MA 1S9HA 4CCJA 4PSWA 4OMYA 1VQNI 1I3AA 1U5TA 1YFHA 2CJJA 3C7JA 1LKXA 2KRFA 2Z5UA 5HNFA 1Z77A 2LP0A 3T8RA 3CF5F 3L2VA 4OIPF 2KISA 4AC0A 3B6CA 1W7PA 4P5OA 1Z91A 3EETA 3MZHA 1HQCA 1LDJA 1PYVA 3ZQQA 3ZQIA 3CCJI 2YPRA 2QZ8A 1MH3A 2ELKA 2FOWA 1Z3YA 2RAEA 2QQBA 5LGTA 5DUIA 2EV6A 2VBWA 3I5UA 3OR2C 4R1HA 1P7IA 5FKLA 1H9TA 1J75A 3SZPA 2AXTC 2V9PA 2GA1A 3A02A 5LRSA 3OY9A 2L7KA 5DCMB 2V6CA 3P9KA 4OIRF 2JUGA 3AG4H 2XSJC 2WAQA 1CQTA 2X85A 2HYGD 1KZHA 3K4JA 2HOAA 1DP7P 3HL2A 3DLLF 2OU2A 3JRFA 3GX4X 4LITA 2GIVA 3HHGA 4MQ9F 3KZZA 4B3XA 2UUZA 3CDHA 1S3JA 2DYRH 2L4MA 1G3YA 3PO2J 4LIUA 1E3PA 3A1YA 3U1DA 2ISZA 3EUHC 2FQ3A 2W4SA 2BEOA 1A31A 2DQLA 2Q2EA 1VQOI 4B1RA 3FXRA 4UB6C 1BR4A 2O8XA 1O7FA 3OSFA 1IRXA 2XRNA 4L5JA 2AHQA 5EEGA 1N78A 4KITB 3D5RC 4A5NA 3ESWB 1ZG1A 5ICGA 1EH8A 2EA2A 4BQQA 2E1MC 2HTSA 2XAQA 5EJCA 1X1PA 4OIQF 4DQ2A 3VSKA 5K1YA 1B72B 1SFOJ 1Q1VA 2H8WA 4YEJA 5BPDA 4Y15A 5M3FJ 4I0BA 1QO0D 1XCVA 3HSFA 3F9KA 3GFMA 4EM0B 1JTXA 2IA0A 2OUMA 3CJQB 1LUJB 2BZTA 4XQFA 3TEDA 1X4PA 2Q8KA 4UY8I 2XGEA 1LFUP 3A4CA 3KYLA 2K9LA 2HEOA 2R7XA 2JA7J 4F91B 1FX7A 3E3VA 2XAJA 3JW4A 4Q48A 3B73A 3GTOJ 2A61A 3QYEA 2JPCA 5FFZA 4IKFA 4U0VA 1R49A 3I59A 1E3HA 3KCCA 1HW5A 1T98A 3MAJA 2ZMEC 1Z0XA 2NS7A 4IF4A 1X4OA 5KVRA 1P4WA 2VN2A 4LK1F 4C3JJ 4XRSA 2LTPA 2M1BA 3IHUA 1O3TA 1D8KA 3EUAA 1WI3A 3WGGA 2GZWA 2VL8A 4G7HF 3IAS2 1H88C 2GM4A 3H9QA 1B9NA 3I58A 2BYVE 1D0XA 2DOAA 3NRVA 3SJMA 5CKTA 3CCSI 2HVQA 3NWSA 2LOOA 4I2OA 3TO9A 1OCZH 3BR6A 5E8GA 1FSEA 3WG7H 3L09A 4IOCF 3KFWX 4GDFA 4YIIA 1B9MA 3EQLF 5J8FA 2XF6A 2A6EF 2DYSH 4M3BA 2VT2A 2R7DA 3WTTC 3QPLA 2E7XA 3OYFA 4XOPA 3QP5A 4IRHA 2LYCA 4QTRA 2VC1A 1JE8A 4NDLA 3MCZA 2QQ9A 3IC7A 5LHGA 1FYMA 4IHYA 1JT6A 4IZZA 2CW7A 3KE2A 2JVHA 4BKXA 2JK3A 2JUCA 5E3LA 1RESA 3N05A 3KP5A 1ZLJA 1IXRC 2KL4A 4IX7A 2VE9A 1BR2A 4BEHA 1IN4A 1WJBA 2XGCA 4DBRA 2BOLA 1EH7A 1SD5A 4EGYA 1MMSA 2VJ5A 5GAEJ 2M5WA 1V5GA 1ZHFA 2HI3A 2L3DA 4ESJA 1OJLA 2PJRB 2MC4A 2GOXB 2AO9A 2I10A 3SZTA 5ICCA 3I59B 3G4SI 1U2WA 1FYKA 1FP2A 1Z6TA 4BXFA 4LB5A 3ZXSA 2G7UA 1NG7A 4II2A 2X9DA 5L3BA 2PMZA 3I4MJ 4HZFA 4B47A 3F8CA 1YJNI 3KYCB 3FKIJ 3C18A 1AHDP 4FE4A 3ZQGA 2O0YA 2K85A 3HHHA 1VQ5I 1A6IA 3TL4X 4ANJA 1U8BA 1AWCA 1W4MA 5DD8A 5TGTA 3A0HC 2H09A 2P0WA 1B8IB 1ERDA 1TWCJ 4M72A 1IN6A 2IS4A 1WPKA 1MH4A 3LSHA 2O6GE 3HKZA 2QWWA 3GTLJ 3V7RA 1YX3A 3QRFF 2VUMJ 4HOBA 5GAGJ 1DPUA 1EJ9A 1WWXA 1ETQA 3MWMA 3G3ZA 4BAYA 1IO2A 2PG4A 2DMTA 1X1AA 2M4GA 1SVMA 1A04A 2VQHA 5HVQC 5EYRA 1KU3A 1HKQA 2DBBA 1R5ID 3WU0A 3D1NI 5FLMJ 2LR8A 4II3A 4V2FA 3WE2A 2WAQN 1FSHA 2X1DA 2E36A 3BTCA 4I98B 3EDPA 4PFPA 4ZDLA 1OMIA 1X58A 2DA7A 3BPVA 4LGWA 2LSOA 2VOPA 2LVSA 1IN5A 2HNHA 3PM1A 2HKOA 3ROUA 4RBOA 3FMRA 4EATA 3ZMZA 3KP3A 5HS9A 2B63J 2DODA 2GBYA 1POGA 2XASA 5M5WJ 5EF6A 2WAEA 4XLAA 1K79A 5JI6A 1BM9A 2DCEA 2BVLA 4I01A 2E1CA 5IP6A 1LEBA 2CG4A 1Z3XA 5BOXA 2RN7A 2W82A 1OR7A 3CC7I 5AIQA 2ETHA 3HZJA 1DGRM 4WK8F 5GTIC 3KP2A 2IS6A 3RTRA 4HV5A 1MJ9A 3S32A 2ZBKA 3HSRA 1P4XA 4I7HA 4BQAA 2YU3A 1ETOA 1Q1HA 2CUFA 4EJWA 4U87A 2V7FA 4P9UA 3HRSA 3FK7A 2M7AA 3BR1A 3IRQA 2X6OA 2EIKH 3TOBA 1F1ZA 1ZGAA 4E7IA 2W48A 2XF7A 5F0CA 4MEXF 1ZTRA 1X3ZB 1YRNA 2K40A 5GADJ 1W36D 2VPLA 1UZCA 2V26A 3BZCA 4X6AJ 1XDSA 4LJZF 1USSA 3PUBA 5DYMA 4I0AA 3MN2A 4Y4RA 1LEAA 1J7KA 4DZJA 2FNPA 3HEFA 3ZQHA 3ZRGA 4N0BA 2NVTJ 1FBQA 2KZVA 2LY9A 1U78A 4ESFA 3BQZA 2FU4A 3CCEI 4OIOF 4HLXA 1JHFA 4BDYA 3RKYA 5E20A 3SXYA 3S3MA 3CMYA 4RGUA 2WA0A 3BG3A 2NS0A 5EZGA 3HTUA 3CF2A 4MQVA 4MGRA 5CQGA 3ZP5A 4HQMA 1B59A 4D7NA 4LK0F 3ZN1A 2O8KA 1QZYA 1FWZA 3DKYA 1I50J 1VQPI 3ZMDA 1X1CA 3SHFA 4XLCA 1MJBA 2K4BA 1YYVA 3ZQLA 1S8NA 1XGOA 2A68F 2EJRA 2CU7A 1VNDA 2AQFA 4IXAA 2DO7A 3W6VA 1VTNC 2QQ8A 2BY0A 3MEXA 5F0FA 4EMSA 2MYSA 4OOIA 1BBYA 1SAUA 1KQ0A 1WRJA 2VQCA 1JKPC 3K1NA 3BPXA 3ZMSA 3ABUA 1FMVA 2KQRA 1WGXA 2K7LA 2Y0MA 4IPAA 4S04A 5J6XA 4OAYA 1Z67A 4BNCA 2A6TA 1JUMA 2D1HA 2KT0A 3J7ZI 2K02A 2QSGX 2X1CA 2COBA 2P4WA 3O3KA 3CD6I 1BJAA 3IH3A 1P92A 2L0KA 3I3LA 2C6YA 2EFNA 4F52A 2ZNYA 2W00A 4RAZA 3H3VK 4U0YA 4P55A 5ED4A 3K4KA 3CCVI 5AIPA 2E60A 1J9IA 3M9AA 5J47A 3GEZA 1KYWA 4QLCU 3AG2H 4IRGA 3F21A 1QGPA 2J5PA 3HJEA 1YIJI 4HYEA 3O8GA 4A3FJ 2GWRA 2GXBA 1W7PD 5D5XB 1DU6A 2EZIA 3UKGA 3G1LA 3CCYA 3H1CA 4XBFA 5B1BH 1OR7C 5K7FA 4RLQA 3L2RA 1S6LA 3BWGA 3W2WA 4HW0A 2XGDA 2CH0A 4FX4A 1YO5C 4BBSJ 4UUSA 2XIGA 3SQNA 2OJED 2IA2A 2MW8A 1IUYA 2HVRA 1WH5A 5J1UA 3OIPA 2O3FA 3R60A 1H8AC 1QBJA 1JGSA 5E79C 3KETA 1WJFA 1B4AA 1R00A 2DA1A 2YX7A 3AG1H 2VBYA 3AFHA 4M73A 1OCOH 5KCMA 1IC8A 5HS7A 4KT6A 1ZR4A 3I71A 2VBXA 1FJLA 3TOAA 2HVSA 4KMUX 2DTZA 1JKQC 4PGHA 3K4CA 1TNTA 4R79A 1FZPB 5GP9A 2EV0A 4UV9A 4Y7NJ 2HDWA 4MIMA 3BDDA 1L3LA 1TC3C 3QYBA 1T33A 2QKLB 4RS8A 4Q4ZF 4UUSB 4U7BA 4HF1A 3J7AY 1TL8A 1R1UA 2K9NA 2JTVA 3DWLE 3K70C 4RAGA 1XDUA 2DLLA 5KHDA 1VFCA 4IHVA 3GBGA 2NAZA 3CCLI 4HV6A 2H1KA 3QP6A 5D5WB 1IF1A 4MEYF 1MNDA 1IGNA 1W0UA 4PSXA 5K5OA 1IN7A 2P5LC 3TW7A 2EV5A 3N4MA 2WY8Q 2JRMA 1C0WA 2PJRA 4CDGA 5E8IA 3VDXA 5HLHA 2NRAC 3H3ZA 3OYGA 1LVKA 3BR5A 1RR7A 3D5SC 4IHSA 3E1SA 1XMAA 3AAFA 4WXDA 2NVYJ 1PP8F 3BT9A 2NNYA 2XKOA 4MTEA 2Y0SN 3P9IA 5HNHA 4G6DA 4KIBA 2B9SA 3HB9A 2R3SA 2LBFB 5L3EA 1IJWC 1XN7A 2A5YB 2ZMEA 3CP8A 2K9SA 2ID6A 2QSFX 1TBXA 1ZK8A 2H1LA 4J19A 4PJNA 4KDPA 2CO5A 1QZEA 3G1OA 2EINH 4IL6C 3OYCA 1U9OA 5FKMA 4C2MJ 4HNTA 1X2NA 2UXXA 4BY7J 2XAFA 3EUKL 1I27A 5C3EJ 3HOVJ 1MSEC 3BQYA 1GVJA 1KU9A 2VKHA 4E7LA 2VB6A 3IP4B 4H0EA 2XAHA 1BW6A 5ILVA 1BI0A 1MZBA 1ODDA 4MHGA 3P9CA 5FD6A 1RRJA 1DU0A 1VQ4I 5EEAA 1XD7A 3FK6A 3J7YJ 4M9XA 4XKBA 3DLAA 3GZNB 2R7UA 1R4NB 2XROA 4A3GJ 4UB8C 1G3WA 4BJ6C 4BL0B 3TW6A 4CZCA 1SD4A 4HX7A 4HLYA 3N97A 3DKXA 4DIQA 5EDNA 3FZVA 1ONVA 1TTYA 2DK5A 1Z05A 3U21A 4E7JA 2VPRA 1JJ8C 4Y13A 2IXSA 2H94A 3S8PA 1F9NA 1XS9A 3BJ6A 3C2GA 4AUXA 1DDNA 3LL7A 3S1RJ 1RUOA 1DGWY 4RM3A 3CUQB 1VQ7I 1HDPA 3TO7A 3A01A 3W6KB 2L7FP 3HRUA 1P7JA 2JA5J 3H5RA 4OINF 5DCMA 4WCGA 4FQGA 2K27A 3GFLA 1AKHA 2HPIA 1XGNA 5IOZA 1JHHA 5JVGF 5FRMA 5CVJA 1TW2A 2PMHA 3T1BA 1QPIA 4RDUA 3LA2A 3FF5A 1F5TA 4YIRX 2A69F 1IRGA 2ME0A 3GO5A 3HG9A 2DDBA 1HC8A 2IBDA 3GMEA 2ZJQF 3Q3SA 4W1UA 2OZ6A 4M74A 3VFZA 2OTJI 1XGSA 1A5JA 3K4LA 4IHTA 3GFIA 3WU2C 1BL0A 2DN0A 3KZYA 2M0MA 3OYNA 3KZIC 3KEOA 3MD2A 1P9QC 5FJ8J 2ESHA 4HSTA 1ZRFA 2Z16A 3S1QJ 2XB5A 1KQ9A 3F3XA 1FNNA 3JSPA 3L2UA 2ELJA 3K0LA 4FCYA 4JQFA 5B66C 5TISC 4C9YA 2LFBA 3HOXJ 1A6QA 5E1ZB 3RQIA 2CFXA 3KYDB 3Q9SA 3ZGKA 3BG5A 3J7AO 2CWEA 3QYFA 4CCNA 1MBGA 4IVNA 2ZCWA 1YOVB 4P9FA 2M3AA 3CDIA 2O9LA 2XSDC 3CCQI 5BQTA 2PJPA 1BI1A 1KU7A 3MKZA 2MSYA 3DPLC 3OYEA 1W36C 2CV1A 5HDGA 4Y3OA 5LHHA 1R1VA 4YIFA 2DMPA 4DJAA 1LVAA 4NC6A 3GTKJ 3K4NA 3WHCA 5TJJA 1JUPA 5DTDA 1RKWA 2ELHA 4M6XA 3REOA 4F55A 4M71A 4JX6A 4NBQA 3ASOH 4JYKA 2EFPA 3V8JA 3PFYA 2V79A 3LFKA 4A3JJ 1K6OA 2O5RA 3CDLA 3WODF 2M9HA 2F5VA 3LSJA 5HDNA 2R7VA 3HOZJ 2LC2A 3C2BA 1VQKI 3BG9A 3S17J 1PDNC 1MBHA 1YS6A 2PMZN 1S7OA 5B1AH 3I4NJ 3P7NA 1N77A 3IH4A 1XX5A 2LF7A 4IJAA 1HW2A 1UG2A 2PBIA 5H2FC 2OQGA 5C4XJ 1Y0UA 1WSUA 5FFXA 3Q9VA 2XV4S 2K3FA 2DFEA 2Y0SA 5F6FA 2GOMA 4QIWN 2QLZA 4BDZA 5BPIA 2BHZA 1Z21A 2VONA 1BC7C 4IQJA 5DM7F 1FPQA 4HPQA 1GUUA 4Z2YA 5L3FA 3GTMJ 3DU6A 4XIDA 1MGTA 1K4SA 5H20A 2CSOA 2W85A 3TQNA 5F1JA 1DP3A 2OAZA 2Y31A 4B3AA 3LSGA 4FETA 1T56A 2ID3A 2VIXA 5JHFA 3GLLA 3FWEA 5KAIC 1W1WE 3ABKH 2TCTA 2QA4I 1F43A 1YITI 3WTVC 1V55H 3S1NJ 1FIPA 1XG1A 3GYHX 1E17A 3MVPA 2DMQA 1YI2I 2B0LA 3PUFA 5LFAA 1J0RA 2HZDA 1VQ9I 2DOFA 4BHBA 2I5UA 2ZJ2A 3H3UA 1M1EB 3G6EI 1ZAOA 4MFEA 1LE8A 1ZN2A 1MSFC 2LG4A 2DA6A 1RC9A 3BR3A 4ZYGA 5BS6A 5LGUA 2M2EA 1F4KA 3RPUD 1G3SA 5ILUA 4D1QA 5E17F 2FBIA 3G1MA 3Q0UA 2QSHX 2R93J 3EUHA 3FMSA 2EZKA 3VPRA 1EKEA 2WAFA 5FKNA 2P7CB 4S0HB 2BXZA 3EPZA 3FMQA 3L1PA 1W7PB 2HYJA 3BG6A 4LMYA 2DI3A 4UUTA 5L3CA 3JRIA 4U0WA 5HODA 1V5FA 2ZNZA 2EWNA 3A03A 5LLQA 4XICA 5LEJA 2X0LA 2YX4A 3UR3C 2EIMH 2QF7A 2IAIA 2F4OB 4RAYA 1J09A 4F93B 1Z7LA 3DEWA 4ZDPA 3VYUB 1FOXA 2DPDA 3COAC 3JREA 2GA2A 4JBAA 3HOTA 5EEHA 5K7ZA 2PX9A 1BOAA 3V42A 2FD5A 4Y52J 1YE9A 2FA5A 4CHUA 3PNVA 2LLKA 3K4MA 2VKEA 3M4OJ 1NTCA 1APLC 3DFGA 2MH9A 3FXLA 2L5QA 4IEJA 2JSPA 4A3IJ 4NQWB 1MDMA 2L4AA 2VODA 2DMNA 2LRDA 2KIQA 3SDGA 5CJ9A 4BHCA 2QKMB 2FNAA 4IRIA 2V4JC 1PVEA 2MABA 4W97A 1DPRA 3VOEA 4DYQA 4GYIA 3OYHA 9ANTA 3OYLA 1MJAA 4E4HA 1ZH5A 4HDVA 3QPHA 2P7VB 2IGOA 4YFXF 2DA2A 1RPWA 1K7AA 2CW8A 3F22A 3PIPF 2DFIA 2MGQA 3WTSC 4ZTFA 2ME6A 1ON2A 3OOPA 4QPQA 1T8IA 1OPCA 1GHCA 1HCRA 3DBLB 4UVBA 2LKPA 1YTYA 4AM3A 2G9WA 2CS3A 3AKZA 2M0CA 5FLXZ 2HYFA 3S2HJ 2L9NA 2X6YA 2ZB9A 3DF8A 3KLOA 5DD4A 2BW3B 3FKJA 3PNTA 4LIVA 3FIWA 3BTJA 4Z6YA 3S2WA 3CO6C 1GT0C 4DGWB 3QPTA 2MA3A 1O3RA 4WXCA 4LG3A 1U9NA 4HQEA 1R36A 1SD7A 2PQ8A 1UELB 2FEZA 1X2MA 2TRTA 4BJTA 2Y2ZA 2Z2SB 3DTEA 2KIUA 1YJ9I 5IT3A 1WJ5A 1TW3A 4BJ5C 4ETSA 3DEUA 1QVUA 2EBIA 2F48A 1I6HJ 3TP0A 1GLNA 3F8MA 2DA5A 1IXSB 2V6EA 1S7EA 3MZYA 2O61A 3VYSB 2BHYA 3WTUC 3ZN0A 1JT0A 4E70A 3LSIA 4MFDA 4ZZDA 4CSWA 1HXDA 5JFRA 1TWGJ 1W5SA 2FBKA 4UNOA 2KDZA 1V3FA 2RQQA 1SEUA 1XMKA 5F04A 5D6EA 4A0YA 3QPSA 1IZ1A 4WXHA 1OCPA 1QVTA 5FLXK 1MW7A 4EV0A 5HLTA 1BR1A 3PSFA 1K78A 2R4GA 1ETWA 1YQAA 1V4RA 2JWTA 2OTLI 5D4SA 5IPAA 2VJJA 3M1CA 1D5VA 2ICWG 4NHJA 4JP0A 4IHXA 1I1SA 2FE3A 2XPUA 4ZYDA 3B02A 4U7DA 3DPUA 1LDDA 5J1YA 3CCMI 2RC4A 2ISYA 4XKCA 3CJNA 2OD5A 2IP2A 2IS2A 3GXOA 1BA5A 1T38A 1MBEA 5JLXA 3IKTA 4KN4X 3QU6A 3IWFA 4FISA 3RPUA 2AXLA 1ZREA 2M30A 4RAFA 2DFHA 3M8EA 1IXCA 1J5YA 4PJJA 2QQAA 1XB4A 2P81A 1TQPA 4CCMA 1TLHB 4G94A 2L02A 4XKVA 5D6FA 2D45A 5E1XA 3LAPA 3JRAA 2WV0A 4KA4A 1XSVA 3NARA 3DXJF 5BMZA 1IV6A 5IOYA 2ESNA 4A3BJ 3SYTA 3IRRA 2EFOA 4DYRA 1QQIA 2GIZA 3BJOA 3ASNH 3IAM2 3PNYA 5IYDJ 2ZKZA 2X1EA 3ECHA 5TRDA 3DBRB 3DU5A 4G7ZF 2DMUA 2PFBA 2EIJH 3FBIB 1NG6A 4HAMA 3IKVA 2XB0X 3RIRA 2VLAA 3GZ5A 4KMFA 4EM2A 3HOUJ 3FM5A 1O57A 5ERIA 4P96A 2D5VA 1ZYRF 3GTQJ 1L0OC 2LDUA 4EEFG 2L2OA 2QVOA 4XONA 4PJ0C 2V1DA 4PUSA 3O8HA 5F0HA 3OS0A 3MMYB 5F08A 1REPC 4YRVA 3JTHA 1FYLA 2NS8A 5J40A 3CUQA 1SVOA 2JQ7A 3FM3A 2EILH 4BE1A 2ACJA 3VYRB 2NYXA 3FHZA 4BE0A 2UZKA 1BI3A 4HNVA 4TV7A 2JVGA 2W24A 3Q5FA 1MKMA 5K5RA 4ZYAA 5D8KB 1TWHJ 1TQIA 3ZMUA 4GCVA 1VQ6I 3HKZN 3TGNA 3BCBA 2LMDA 2CQ7A 2DT7B 4M3EA 3WTWC 4ENKA 1RR8C 2BXYA 2IT0A 3F8NA 1BIAA 2P6SA 2EZHA 5B5EC 3CO7C 2KKOA 2A07F 2FJ1A 2HGCA 1XMXA 4C2TA 2AQEA 4AYBN 5FD5A 1ETYA 1CF7A 3KP6A 4RMNA 4HX4A 2YUSA 2R7ZJ 4D5CA 1I5ZA 2A6HF 2JSCA 4DZPA 4L9VA 4A3CJ 1B8IA 3E6DA 3BTIA 4FT8A 4F92B 4A3DJ 1IW7F 1RIOH 3QOPA 3VB2A 2ZXIA 4AVZA 1A35A 3JR9A 1HF0A 5FRNA 5E18F 2R5YB 4JOMA 2CUJA 2VKDA 3NEUA 4UHTA 4N4OB 1WI9A 3SEZA 5E1WA 3HOYJ 2E7WA 1KYZA 2Z99A 4G7OF 3K7AJ 4S05A 3C3WA 1QA6A 4XOTA 5LRRA 3AL0C 2EFWA 4XRFA 5IYBJ 4M3DA 4AVPA 1FC3A 2QENA 1D1AA 4LLLA 3MKLA 3A2KA 4NQWA 3QOEA 2NNNA 3M8FA 3H9GA 3ONQA 3T0YA 1HSJA 3DV8A 1QNTA 4L18B 2YS9A 4HBLA 3OS2A 4XMYA 2R5ZB 1LB2A 1E2XA 1ZG5A 2PEXA 2MG4A 3FISA 2F4MB 1WHUA 2J5OA 1HKSA 4A2UA 2STWA 1MD0A 5B3SH 2N8GA 2QGUA 4LLNA 1ZGWA 1OLTA 3F72A 4R8HA 2STTA 4AWXB 3HBLA 5K7HA 3GTGJ 2RGVA 2FF4A 4XLEA 1IN8A 3TP3A 4E7ZA 2GLOA 3BZ6A 3RKWA 2OBPA 5LGNA 3E7LA 5GPCA 4CA0A 5J4VA 2G7HA 3HYIA 2XRLA 3BLYA 4WWCA 1O3SA 3W2VA 1UFMA 4CCOA 1VQMI 1K61A 3DCFA 2R7OA 3BROA 2ZSHB 2FRHA 5M5XJ 1T2KA 3I64A 2IW5A 1VQLI 2KIMA 1P6RA 1XGMA 1OFCX 4XK4A 2CGPA 3ZPLA 3FXOA 1MBFA 2KHMA 2D1VA 1R5GA 5C44J 4RLFA 1GV2A 1SFKA 4CXFA 3RKXA 4D5FA 5FO5A 3E5UA 3K10A 4KYWA 2VC0A 4EGZA 1KU2A 2L9SA 2P5KA 4KNYA 2GQQA 2HZTA 2ADUA 1AU7A 3S16J 3HDDA 4LG0A 1TNSA 3KX2A 4A6DA 3M3YJ 2LY1A 4Y17A 5CVRA 2V9KA 1P2FA 3GUDA 2DK8A 3CCRI 1U6GA 2HOTA 5FKKA 1X3UA 1WCMJ 4KT5C 4XNFA 1WKMA 5JHUA 3KEYA 5LD2C 2V1UA 5CLSA 3V7SA 1ITYA 4XRSG 3PFIA 3M8JA 3PJRA 1EH6A 1HA8A 1T08B 1WVRA 4RM2A 3E5QA 4M6VA 5IP7J 1D1CA 1MNMC 3HSEA 2UXNA 4CZZA 4IHWA 3RQ4A 1CGPA 4U88A 3QODA 1X1BA 4BBRJ 1FY7A 3DQVC 3JTGA 2W7NA 1LDKB 3F8BA 2E2IJ 3WU1B 1OCTC 2Y69H 5DUKA 2BW3A 4RGXA 4DOZA 5F1RA 3MFKA 3ML6A 4FE7A 4CCLA 2EB7A 2M7BA 2VQGA 1JGGA 2MLGA 3S2DJ 3BP8A 3G71I 5DS9A 2HXOA 4BEHB 2IGMA 3CP2A 5M3MJ 5JLWA 3RYRA 1R22A 3F23A 4J00A 4GYGA 2JJ7A 2K5CA 4V2GA 4XKWA 4B8XA 3OS1A 1LE8B 3FDYA 1YRNB 1VZ0A 2NVQJ 2HOEA 1XTAA 4CYCB 1AA7A 3I54A 2QEXI 2LK2A 2M87A 2CUEA 3LSPA 3ZQFA 3HOSA 3JRGA 2ZMEB 3JAMZ 2FMYA 5IY5H 5EGOB 3S15J 1UCRA 1NK2P 3OOUA 4MNUA 3KP7A 5E3MA 2MLKA 1MBKA 2EFQA 1UHMA 3G73A 1HW1A 2IVMA 4F7ZA 3J80K 1UG0A 2JMWA 4LB6B 1PUFA 2E1NA 1F36A 1YS7A 1MDMB 2BVMA 2WV1A 3FBNB 2DT6A 3BZKA 3HPGA 2QBYB 1OYWA 5D8LB 3KEQA 3PQJA 1IV8A 4E7HA 1WJAA 2VBZA 1UHWA 2HFHA 2COMA 4C3IJ 4IO9F 4V19K 1WJCA 4XLFA 3WHBA 1G6NA 3MKYB 4ZH4F 1G4DA 4PZJA 2M4KA 2F5FA 4CO8A 2XDVA 1FBSA 4EJUA 1K6YA 2NOJB 2YR2A 3H35A 2L54A 1Y8RB 1EA3A 5EG0A 1JKOC 3HOWJ 3CUOA 3RPQA 3ERMA 4LD5A 3C1DA 5IYCJ 3CLOA 5A2QK 4XLNF 1ZRDA 1D8JA 4CH7A 2BY3A 3I4PA 3U2RA 4NNJA 3FXKA 1JJ6C 1S29A 2VJIA 2KRCA 1YW8A 3IWZA 3KIOA 2DTRA 2ZSIB 3PSIA 2XKPA 3JAMK 3L2QA 2R7RA 3HXLA 1Z9CA 3AG3H 2KP6A 4H4KC 2V1XA 4QPOA 4ASNA 3RKQA 1O7LA 4BY1J 1R58A 1YW9A 4GFBA 4D7MA 3FXQA 3ZQ7A 3CC4I 2O03A 1EF4A 3TDUC 1U8RA 3HUGA 1KONA 3SDBA 4O6JA 2VJ4A 4E7SA 3V8KA 4BXXJ 2OC6A 4XLHA 4OMZA 4XR6A 4G9YA 2Z3YA 4K2EA 2OA4A 2PN6A 1OYYA 3HIFA 4YFNF 3E6BA 4BH9A 3OYBA 3K4BA 3VWBA 1Y39A 3ABMH 4XN0A 2HPMA 3OWTA 2VKVA 1QU3A 1G8XA 4PDKA 3RYPA 4MO7A 2E19A 3SFIA 1Y6IA 2XUBA 3WTYC 2AS5F 2OV7A 1ETVA 4EM1A 2L9RA 2CQXA 1FBUA 1V54H 2FXAA 2Y30A 3F6OA 3H92A 1BW5A 1MMNA 2X6WA 3CLQA 2Y48A 3HRMA 4NB5A 1OKRA 3GFJA 5AONA 2VI6A 3CJRB 4I76A 3OYDA 1PUEE 3RI4A 2ZC2A 2Z33A 1ENHA 2IPQX 3OYMA 2QBYA 2KLOA 2H6CA 4UV8A 2VXZA 1T0FA 1T0FC 3K6GA 2CQQA 2DJIA 4AIJA 3OR1C 4WX9A 2NXNB 2EQRA 5M5YJ 3WGIA 2DAOA 3L9FA 3P5JA 2YU9J 4ABZA 4PJLA 1Z1DA 4IOAF 5DV5A 3PIOF 3CUQC 4GRIA 1HKTA 5IT9K 1AKHB 4CYDA 4BU2A 1IRFA 4RGSA 4GGGA 4RA2A 4ENNA 3H5AA 3TBIA 3RCOA 2LBFA 2JA6J 2NVUB 1O3QA 3CCUI 3PO3J 3FXMA 3M7GA 1BIBA 2ECBA 2E2HJ 2FQ4A 1Y1WJ 2Q2EB 2P8TA 3JRHA 4L9JA 3H9JA 3WTXC 3LWFA 1A36A 2E1OA 2LH9A 2CQKA 1ETKA 1IG7A 4HSRA 5BNGA 3NQOA 4AYBA 2VQLA 3E6MA 2Q1ZB 2QCOA 4M9SA 5FROA 3H0GJ 3I55I 4HG2A 3K1MA 2KJBA 2XGXA 2WB1N 4I6ZA 2GAUA 4BHPA 1X19A 1OCRH 4N9HA 5HLGA 3FHNA 3DKWA 3OL3A 1NHAA 4M9ZA 3RSNA 2QM3A 4L0ZB 3FXUA 4KISA 3L2CA 3WTZA 1SVLA 3LA3A 5E3OA 2YSRA 3K69A 2H6BA 4DNCA 1RZ4A 3Q0WA 3KPHA 4A5MA 2CFOA 3CTAA 1I39A 1TQMA 1IUFA 3BY6A 2H8RA 4HRIA 1JI8A 4RB0A 2OCEA 1SC7A 1ACIA 2RQPA 5CYVA 4UVAA 3DTIA 3ERED 1S72I 2DU9A 1TP4A 3W6JB 1FT9A 1LFPA 3CJTB 3W2AA 3JCUC 4HA8A 4C2UA 2VOOA 2OQRA 2DA3A 2DJNA 2V1NA 4X0GA 2BBYA 1T39A 4ENMA 5FLVA 3LQRA 3G2BA 4B4CA 4P1WA 1CF7B 4MLOA 3NWTA 5CPRB 3W3CA 4J01A 3CC2I 3O2PE 4A12A 1Y8QB 2M8EA 2QYOA 1GDTA 3RJPA 2LNBA 3WG9A 4PGGA 4YG2F 3B6AA 1FOKA 1T6SA 4A93J 4AD9A 3K1PA 2IGNA 3I0TA 2F4IA 1XSDA 1W5CC 3HTSB 2F2EA 4I99C 2KDOA 3Q0VA 4XM3A 4XSXF 4AIHA 1J2XA 5LHIA 3OV8A 3GZ6A 5D5VB 1PJRA 4RB2C 4L0YB 1R5HA 4CCKA 5J4YA 5EG0B 2DXIA 4L9TA 4BACA 2RNGA 1ZKGA 1D5YA 3DPTA 4JX5A 4ZYEA 3WGHA 2K3PA 2ZO4A 4OWRB 2WBMA 1YW7A 4EJTA 2EZLA 4XRMA 1UAAA 1E3OC 3CMEI 3NAUA 5DDGA 4OU0A 1U3EM 2JA2A 5D5UB 2R0QC 2RKHA 2R5ZA 3R61A 4Y33A 5C4JJ 4ESBA 1HDDC 2IJLA 3T5XA 2L01A 5CVUA 1U0JA 2PMUA 1ZARA 4BE2A 4YFKF 3QQAA 1K78B 1J59A 2O7OA 2HKXA 3LSMA 1FP1D 3S3NA 3ULQB 2NVXJ 1GXQA 2R7QA 2R7TA 1N75A 2KRHA 3K2AA 1JKRC 3MQ0A 4FHTA 1KA8A 2FSWA 2MD5A 2XAGA 3LSTA 3GLXA 2XPVA 1ZLKA 2HWVA 2KMUA 4A3KJ 5H6RA 4PK4A 2BY2A 3BOQA 5J3LA 2NOGA 2HOSA 1X1DA 2A05A 2A5WA 2M8GX 4XL9A 4ZJZA 1R4MB 3JRBA 3S3OA 1QPMA 3GWZA 5JVTA 2ZXWH 4RB1A 2FUG2 2WWYA 1YIOA 1D1BA 4LOCA 4KUMA 2LKSA 4A69C 4NC8A 4RB3C 3OYIA 1FTTA 4KFCA 2WB1A 4UVCA 1YHQI 3C2HA 3F8FA 2PI0A 3R6SA 3J80Z 1H9GA 2FX0A 3L2WA 4YELA 2RREA 2X6XA 2VASA 2R7SA 3I9V2 3VYTB 5ICEA 1ZELA 3V8LA 4LLGF 3QWLA 1X3WB 2HU9A 1JUSA 3D5LA 4JX4A 3V4GA 2K9MA 4UXNA 3VODA 1BJZA 3A0BC 1SANA 3LOCA 4G6QA 4KIGA 3ISPA 1RUNA 4FASD 2K9QA 2IS1A 1LPQA 1RI7A 1H0MA 2HQ5A 4GXOA 1PP7U 1Y1VJ 2RDPA 1FTZA 2EA4A 1B6AA 2E5NA 2W1OA 1EV7A 4L5EA 4BGDA 4CICA 3RZDJ 1FMWA 1D3YA 1WJEA 2XPWA 2CV0A 3QAHA 2CMPA 3ZQCA 5KAFC 5ILSA 1PUFB 1FEXA 3L00A 3O6BB 3OL4A 2BV6A 1HOMA 1MMGA 1IDYA 1B72A 4L9NA 1SMYF 1WFXA 2DA4A 2LD5A 2X48A 4XN3A 2EH3A 3LNQA 1NK3P 2LY2A 4BQNA 4CUGA 3CQZJ 2KJCA 3R0AA 4DBQA 1D0YA 3FX3A 3HPHA 1BOBA 4ZYHA 1N25A 2KIFA 2DDAA 4HEA2 3LSKA 1FLIA 3V7CA 2KFDA 2OPTA 3TDZC 1DUXC 1USTA 3CMMA 1QRYA 3AL0B 3GTPJ 2HS5A 5HS8A 2MH2A 1LJ9A 1LQ1A 3LAJA 2WC2A 4BQOA 3BG7A 4EVIA 1SFUA 2HXIA 2M45A 1JXSA 4OAZA 3OIOA 3MKWB 2L7MP 2DQRA 3K9TA 1K4TA 2MBFA 2E34A 1KQ8A 3R4KA 1UHSA 3JRCA 3M07A 1Z7UA 2UV1A 1SMTA 4M3GA 2L9VA 3UNGC 4ZZLA 4EJVA 5J8CA 3I56I 2WTEA 3L7WA 2CRGA 3E97A 1G2HA 4HF0A 4PCQA 3HUGB 2DPUA 2ZJPF 3RZOJ 2Z1DA 1SAXA 2HTJA 3M1EA 4NC7A 3IL2A
chains in the Genus database with same CATH topology
4KN7X 4QWQA 4EJOA 4HDUA 2FOKA 4GO1A 3DP7A 5IT9Z 2F5EA 1BC8C 3I53A 2Z9OA 3ELKA 2JT1A 1G3TA 2QUFA 2IRFG 1S7AA 1BI2A 4JK1X 4HX8A 2HQRA 2JPBA 2RVCA 5FB2A 5JR3A 5HDKA 3SFZA 6PAXA 3ZMTA 2K86A 1SD6A 5HOOA 1ZRCA 4B09A 2BGCA 4O5VA 2UWMA 3EYIA 5D4RA 4A0XA 3ZMVA 1HSTA 1U5TC 2CYYA 4LFUA 1QZZA 2RV8A 4ON0A 1XCBA 1AOYA 1BN5A 5LEKA 4Q5SF 4MTDA 4A0ZA 4LG0B 4KIFA 4XLPF 1ON1A 2XVCA 1U5TB 2K4JA 2P6TA 2EK5A 4G8XA 4XSZF 3ECOA 5CVVA 2VE8A 4M6YA 3T8TA 3KP4A 2RNJA 2D2WA 2ZXJA 4BYYA 2Q0OA 2F5DA 2TDXA 1IAWA 1SFEA 4ENJA 3D0SA 2F5CA 2HQNA 5DCFA 2IA1A 5CVIA 3VEPA 3GW2A 2PLYA 2Y75A 4FX0A 5L3DA 1YG2A 4RGRA 1RNLA 3LQQA 4EQQA 2W84A 2W25A 4I02A 1YLFA 5ICFA 2FMLA 2A3SA 2LF8A 3J81Z 1I1GA 3GF2A 1P4AA 5HLIA 4D0PA 2OZUA 2HR3A 2P5VA 1R23A 2BE5F 1SFXA 2JRTA 3F6VA 1HBXG 3E6CC 4HF2A 3TKYA 5L3GA 2W57A 1R1TA 5KK1A 1OYIA 3BJAA 4Q47A 2CW0F 3JSOA 3ABTA 1W5TA 3QU3A 4L5IA 1ZGJA 1ZG3A 3KLNA 2GXGA 2FBHA 1Z6RA 2XHKA 3EYYA 3RDIA 1KGSA 5K5QA 5FGMA 1STZA 2H27A 3R0JA 4I09A 4UUVA 4WF2A 2ZFWA 4A6EA 1LNWA 3J81K 3HRTA 2VT3A 1WQ2A 3TO6A 3K2ZA 2R7FA 5LBQA 5A2QZ 4BXUA 2DW4A 5DEQA 4CGZA 1B1BA 3U9GA 1GXPA 1ULYA 4AIKA 3PQKA 2V9VA 1XSXA 5H6QA 2HDCA 4KICA 3GVAA 3LA7A 5F64A 3WE3A 1UB9A 2X4HA 2DT5A 1R7JA 4N9IA 1I6XA 2MC3A 3E5XA 2JZYA 4O3MA 4OMYA 1U5TA 1YFHA 3C7JA 2KRFA 2Z5UA 3T8RA 4OIPF 1W7PA 4P5OA 1Z91A 3EETA 3MZHA 1HQCA 1LDJA 2YPRA 2QZ8A 2QQBA 5LGTA 5DUIA 2EV6A 2VBWA 3I5UA 1H9TA 4R1HA 1J75A 3SZPA 2GA1A 5LRSA 5DCMB 2V6CA 3P9KA 4OIRF 2HYGD 1DP7P 2OU2A 3GX4X 2GIVA 3HHGA 4MQ9F 3KZZA 3CDHA 1S3JA 2L4MA 1G3YA 3U1DA 2ISZA 2FQ3A 2BEOA 2DQLA 2Q2EA 3FXRA 2O8XA 1O7FA 2XRNA 4L5JA 5EEGA 1ZG1A 4A5NA 5ICGA 1EH8A 2EA2A 2HTSA 2XAQA 4OIQF 4DQ2A 5K1YA 5BPDA 4Y15A 4I0BA 1QO0D 1XCVA 3HSFA 4EM0B 3GFMA 2IA0A 2Q8KA 2HEOA 1FX7A 3E3VA 2XAJA 3JW4A 4Q48A 3B73A 2A61A 2JPCA 5FFZA 4U0VA 3I59A 3KCCA 1HW5A 1T98A 3MAJA 4IF4A 5KVRA 1P4WA 2VN2A 4LK1F 2M1BA 3IHUA 1O3TA 1D8KA 3WGGA 2GZWA 4G7HF 1B9NA 3I58A 2BYVE 3NRVA 4I2OA 3TO9A 5E8GA 1FSEA 3L09A 3KFWX 4YIIA 1B9MA 3EQLF 5J8FA 2A6EF 3WTTC 2VT2A 2R7DA 2E7XA 3QP5A 4IRHA 2VC1A 1JE8A 3MCZA 2QQ9A 3IC7A 5LHGA 1FYMA 3KE2A 3KP5A 1ZLJA 1IXRC 2VE9A 1IN4A 1EH7A 1SD5A 4EGYA 2M5WA 1ZHFA 2L3DA 4ESJA 3SZTA 5ICCA 3I59B 1U2WA 1FYKA 1FP2A 1Z6TA 4LB5A 2G7UA 5L3BA 4HZFA 3F8CA 3C18A 2O0YA 3HHHA 1AWCA 1W4MA 5DD8A 2H09A 4M72A 1IN6A 2O6GE 2QWWA 3V7RA 3QRFF 4HOBA 1DPUA 1WWXA 3MWMA 3G3ZA 4BAYA 2PG4A 1A04A 5HVQC 1KU3A 2DBBA 1HKQA 3WU0A 3WE2A 1FSHA 4I98B 3EDPA 1OMIA 3BPVA 4LGWA 2LSOA 2VOPA 1IN5A 2HKOA 3ROUA 3FMRA 3ZMZA 3KP3A 5HS9A 2XASA 1K79A 5JI6A 1BM9A 4I01A 2E1CA 1LEBA 2CG4A 5BOXA 2RN7A 1OR7A 5AIQA 2ETHA 4WK8F 3KP2A 3RTRA 4HV5A 1MJ9A 2ZBKA 3HSRA 1P4XA 4I7HA 4BQAA 2YU3A 1Q1HA 4EJWA 4P9UA 3HRSA 3IRQA 3TOBA 1F1ZA 1ZGAA 4MEXF 1XDSA 4LJZF 1USSA 5DYMA 4I0AA 1LEAA 1J7KA 2FNPA 4N0BA 1FBQA 1U78A 4ESFA 2FU4A 4OIOF 4HLXA 1JHFA 3RKYA 5E20A 3SXYA 4RGUA 2NS0A 3HTUA 4MQVA 4MGRA 3ZP5A 4HQMA 1B59A 4LK0F 3ZN1A 1QZYA 1FWZA 3ZMDA 3SHFA 1MJBA 2K4BA 1YYVA 1S8NA 1XGOA 2A68F 2EJRA 4IXAA 2DO7A 1VTNC 3MEXA 4EMSA 4OOIA 1BBYA 1WRJA 1KQ0A 3K1NA 3BPXA 3ZMSA 3ABUA 2K7LA 2Y0MA 4IPAA 4S04A 5J6XA 4BNCA 2D1HA 2K02A 2P4WA 3O3KA 1BJAA 1P92A 2C6YA 2EFNA 2ZNYA 4RAZA 4U0YA 4P55A 5ED4A 5AIPA 1J9IA 3M9AA 3GEZA 1KYWA 4QLCU 4IRGA 3F21A 1QGPA 2J5PA 4HYEA 2GWRA 2GXBA 1W7PD 5D5XB 4XBFA 1S6LA 3BWGA 4HW0A 1YO5C 4FX4A 2XIGA 3SQNA 2IA2A 1IUYA 2O3FA 3R60A 1QBJA 1JGSA 3KETA 1B4AA 1R00A 4M73A 2YX7A 2VBYA 5HS7A 3I71A 2VBXA 3TOAA 4KMUX 4PGHA 1TNTA 4R79A 1FZPB 2EV0A 4UV9A 3BDDA 1L3LA 4RS8A 4Q4ZF 4U7BA 4HF1A 1R1UA 2JTVA 1XDUA 2DLLA 2NAZA 4HV6A 3QP6A 5D5WB 1IF1A 4MEYF 5K5OA 1IN7A 2P5LC 2EV5A 3N4MA 1C0WA 4CDGA 5E8IA 5HLHA 2NRAC 3H3ZA 4IHSA 1XMAA 3AAFA 4WXDA 1PP8F 2NNYA 2XKOA 4MTEA 3P9IA 4G6DA 4KIBA 5L3EA 2R3SA 1XN7A 2A5YB 2ZMEA 1TBXA 4KDPA 2CO5A 2UXXA 2XAFA 1I27A 1GVJA 1KU9A 4H0EA 2XAHA 5ILVA 1BI0A 1MZBA 1ODDA 4MHGA 3P9CA 5FD6A 1XD7A 4M9XA 2XROA 1G3WA 1SD4A 4HX7A 4HLYA 3N97A 3FZVA 1ONVA 1TTYA 2DK5A 1Z05A 4Y13A 2H94A 1F9NA 3BJ6A 1DDNA 1RUOA 3CUQB 3TO7A 3W6KB 3HRUA 4OINF 5DCMA 4WCGA 2K27A 3GFLA 1XGNA 1JHHA 5CVJA 1TW2A 2PMHA 3T1BA 3LA2A 3FF5A 1F5TA 2A69F 1IRGA 3GO5A 2OZ6A 4M74A 3VFZA 1XGSA 4IHTA 3GFIA 3KZYA 3KEOA 2ESHA 1ZRFA 1KQ9A 3F3XA 1FNNA 3JSPA 3K0LA 4JQFA 5E1ZB 2CFXA 3Q9SA 3J7AO 2CWEA 4IVNA 2ZCWA 4P9FA 5BQTA 2PJPA 1BI1A 1KU7A 3DPLC 5HDGA 5LHHA 1R1VA 4YIFA 1LVAA 5TJJA 2ELHA 4M6XA 3REOA 4M71A 2EFPA 3V8JA 2V79A 3LFKA 1K6OA 3WODF 5HDNA 1PDNC 1YS6A 1S7OA 3P7NA 2LF7A 4IJAA 1HW2A 2PBIA 2OQGA 1Y0UA 1WSUA 5FFXA 3Q9VA 2XV4S 5BPIA 5F6FA 2QLZA 2VONA 1BC7C 1FPQA 4Z2YA 5L3FA 1MGTA 5H20A 2CSOA 2W85A 3TQNA 2OAZA 3FWEA 3WTVC 3GYHX 1E17A 2B0LA 1J0RA 4BHBA 2ZJ2A 3H3UA 1ZAOA 1ZN2A 4ZYGA 5BS6A 5LGUA 1F4KA 1G3SA 5ILUA 5E17F 2FBIA 3EUHA 3FMSA 2P7CB 3FMQA 1W7PB 4LMYA 2DI3A 5L3CA 4U0WA 2ZNZA 2EWNA 5LLQA 5LEJA 2X0LA 2YX4A 4RAYA 2DPDA 3COAC 2GA2A 4JBAA 3HOTA 5EEHA 1BOAA 2FA5A 4CHUA 3DFGA 2MH9A 1MDMA 2L4AA 2VODA 5CJ9A 4BHCA 2FNAA 4IRIA 1DPRA 3VOEA 4GYIA 1MJAA 1ZH5A 4HDVA 3QPHA 2P7VB 4YFXF 1K7AA 3F22A 2DFIA 3WTSC 1ON2A 3OOPA 1OPCA 1GHCA 4UVBA 2LKPA 1YTYA 2G9WA 5FLXZ 2HYFA 3DF8A 3KLOA 5DD4A 3S2WA 3CO6C 3QPTA 2MA3A 1O3RA 4WXCA 4HQEA 1R36A 1SD7A 2PQ8A 2FEZA 2KIUA 5IT3A 1TW3A 4ETSA 3DEUA 3F8MA 1IXSB 3MZYA 2O61A 3WTUC 3ZN0A 4E70A 4ZZDA 5JFRA 1HXDA 2FBKA 1W5SA 4UNOA 1V3FA 1XMKA 5D6EA 4A0YA 1IZ1A 4WXHA 5FLXK 4EV0A 1K78A 1YQAA 1V4RA 5D4SA 1D5VA 4NHJA 1I1SA 2FE3A 4ZYDA 3B02A 4U7DA 1LDDA 2RC4A 2ISYA 3CJNA 2OD5A 2IP2A 3GXOA 1T38A 3IKTA 4KN4X 3QU6A 3IWFA 3RPUA 2AXLA 1ZREA 2M30A 3M8EA 1IXCA 1J5YA 2QQAA 1XB4A 1TQPA 1TLHB 4G94A 2L02A 5D6FA 2D45A 5E1XA 3LAPA 2WV0A 4KA4A 1XSVA 5BMZA 3DXJF 2ESNA 3IRRA 2EFOA 1QQIA 3BJOA 2ZKZA 3ECHA 5TRDA 4G7ZF 2PFBA 4HAMA 3IKVA 3RIRA 3GZ5A 4KMFA 4EM2A 3FM5A 1O57A 5ERIA 4P96A 1ZYRF 1L0OC 2LDUA 2QVOA 2V1DA 1REPC 3JTHA 1FYLA 3CUQA 3FM3A 2ACJA 2NYXA 3FHZA 2UZKA 1BI3A 4TV7A 2W24A 3Q5FA 1MKMA 5K5RA 5D8KB 1TQIA 3ZMUA 4GCVA 3TGNA 2IT0A 3WTWC 4ENKA 3F8NA 1BIAA 2P6SA 3CO7C 2A07F 2KKOA 2HGCA 5FD5A 1CF7A 3KP6A 4HX4A 1I5ZA 2A6HF 2JSCA 4L9VA 3E6DA 4FT8A 1IW7F 1RIOH 3QOPA 3VB2A 5E18F 3NEUA 4UHTA 1WI9A 5E1WA 2E7WA 1KYZA 2Z99A 4G7OF 4S05A 3C3WA 5LRRA 2EFWA 4XRFA 4AVPA 1FC3A 2QENA 4LLLA 4NQWA 2NNNA 3M8FA 3T0YA 1HSJA 4L18B 3DV8A 1QNTA 4HBLA 1LB2A 1ZG5A 1E2XA 2PEXA 2STWA 2J5OA 1HKSA 4A2UA 1MD0A 4LLNA 4R8HA 2STTA 3F72A 4AWXB 2RGVA 2FF4A 1IN8A 3BZ6A 3RKWA 2OBPA 5LGNA 2G7HA 3HYIA 4WWCA 1O3SA 1UFMA 3BROA 2FRHA 1T2KA 3I64A 2IW5A 2KIMA 1P6RA 1XGMA 2CGPA 3ZPLA 2D1VA 1R5GA 4CXFA 3RKXA 5FO5A 3E5UA 4KYWA 2VC0A 4EGZA 1KU2A 2P5KA 4KNYA 2GQQA 2HZTA 2ADUA 4LG0A 1TNSA 4A6DA 5CVRA 4Y17A 1P2FA 3GUDA 2DK8A 1U6GA 1X3UA 4KT5C 1WKMA 5JHUA 2V1UA 5CLSA 3V7SA 3PFIA 1EH6A 3E5QA 3HSEA 2UXNA 4CZZA 1CGPA 4U88A 3JTGA 1FY7A 3DQVC 1LDKB 3F8BA 3WU1B 5DUKA 4RGXA 5F1RA 3MFKA 3ML6A 2EB7A 2MLGA 3BP8A 3RYRA 1R22A 3F23A 4GYGA 4B8XA 2HOEA 3I54A 2M87A 3HOSA 2ZMEB 3JAMZ 2FMYA 1UCRA 4MNUA 3KP7A 2MLKA 2EFQA 3G73A 1UHMA 1HW1A 2IVMA 4F7ZA 3J80K 4LB6B 2E1NA 1YS7A 1MDMB 2QBYB 1OYWA 5D8LB 3KEQA 3PQJA 2VBZA 1UHWA 2HFHA 2COMA 1G6NA 4ZH4F 1G4DA 4PZJA 2F5FA 4CO8A 1FBSA 4EJUA 2YR2A 2L54A 3CUOA 3RPQA 4LD5A 3C1DA 3CLOA 5A2QK 4XLNF 1ZRDA 1D8JA 3I4PA 3U2RA 1S29A 1YW8A 3IWZA 2DTRA 2XKPA 3JAMK 1Z9CA 2V1XA 4ASNA 1O7LA 1R58A 1YW9A 3FXQA 3ZQ7A 2O03A 3TDUC 1U8RA 3HUGA 4O6JA 3V8KA 4OMZA 4G9YA 2Z3YA 4K2EA 2OA4A 2PN6A 1OYYA 3HIFA 4YFNF 3E6BA 4BH9A 4PDKA 3RYPA 2XUBA 3WTYC 2AS5F 4EM1A 1FBUA 2FXAA 3F6OA 3H92A 2Y48A 3HRMA 4NB5A 1OKRA 3GFJA 5AONA 1PUEE 3RI4A 2Z33A 2IPQX 2QBYA 2H6CA 4UV8A 2VXZA 1T0FA 4AIJA 4WX9A 3WGIA 2DAOA 3L9FA 1Z1DA 5DV5A 3CUQC 1HKTA 5IT9K 4CYDA 1IRFA 4RGSA 4GGGA 4ENNA 1O3QA 3M7GA 1BIBA 2P8TA 4L9JA 3WTXC 3LWFA 2CQKA 3NQOA 3E6MA 4M9SA 3K1MA 2KJBA 2XGXA 2GAUA 4BHPA 4N9HA 5HLGA 3DKWA 1NHAA 4M9ZA 2QM3A 4L0ZB 3FXUA 3L2CA 3WTZA 3LA3A 2YSRA 3K69A 2H6BA 4DNCA 1RZ4A 4A5MA 3CTAA 1TQMA 3BY6A 4RB0A 2RQPA 5CYVA 4UVAA 3ERED 2DU9A 3W6JB 1FT9A 4HA8A 2VOOA 2OQRA 2BBYA 1T39A 4ENMA 3LQRA 1CF7B 3O2PE 4A12A 2M8EA 2QYOA 3RJPA 2LNBA 3WG9A 4PGGA 4YG2F 1FOKA 1T6SA 4AD9A 3K1PA 3I0TA 1XSDA 3HTSB 2F2EA 4XSXF 4AIHA 1J2XA 5LHIA 3OV8A 3GZ6A 5D5VB 4RB2C 4L0YB 1R5HA 4L9TA 3DPTA 4ZYEA 3WGHA 2ZO4A 1YW7A 4EJTA 5DDGA 1U3EM 4OU0A 5D5UB 2RKHA 3R61A 4ESBA 2IJLA 3T5XA 2L01A 5CVUA 2PMUA 1ZARA 4YFKF 1K78B 1J59A 2HKXA 1FP1D 3ULQB 1GXQA 3MQ0A 4FHTA 1KA8A 2FSWA 2MD5A 2XAGA 3LSTA 3GLXA 1ZLKA 2HWVA 5H6RA 3BOQA 1QPMA 3GWZA 5JVTA 4RB1A 2WWYA 1YIOA 4KUMA 4RB3C 4KFCA 4UVCA 3F8FA 2PI0A 3R6SA 3J80Z 1H9GA 5ICEA 3V8LA 4LLGF 3D5LA 3V4GA 4UXNA 3VODA 4G6QA 4KIGA 3ISPA 1RUNA 1RI7A 1H0MA 4GXOA 1PP7U 2RDPA 2EA4A 1B6AA 1EV7A 4CICA 1D3YA 3QAHA 5ILSA 3L00A 3O6BB 2BV6A 4L9NA 1SMYF 2KJCA 3R0AA 3FX3A 4ZYHA 2KIFA 1FLIA 3V7CA 3TDZC 1DUXC 1USTA 2HS5A 5HS8A 2MH2A 1LJ9A 1LQ1A 3LAJA 2WC2A 4EVIA 1SFUA 2M45A 1JXSA 3K9TA 2DQRA 2MBFA 1KQ8A 3R4KA 1Z7UA 4ZZLA 1SMTA 5J8CA 4EJVA 2WTEA 3L7WA 3E97A 4HF0A 4PCQA 2DPUA 1SAXA 2HTJA 3M1EA 3IL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 X;  4QWQ A;  4EJO A;  4HDU A;  2FOK A;  4GO1 A;  3DP7 A;  5IT9 Z;  2F5E A;  1BC8 C;  3I53 A;  2Z9O A;  3ELK A;  2JT1 A;  1G3T A;  2QUF A;  2IRF G;  1S7A A;  1BI2 A;  4JK1 X;  4HX8 A;  2HQR A;  2JPB A;  2RVC A;  5FB2 A;  5JR3 A;  5HDK A;  3SFZ A;  6PAX A;  3ZMT A;  2K86 A;  1SD6 A;  5HOO A;  1ZRC A;  4B09 A;  2BGC A;  4O5V A;  2UWM A;  3EYI A;  5D4R A;  4A0X A;  3ZMV A;  1HST A;  1U5T C;  2CYY A;  4LFU A;  1QZZ A;  2RV8 A;  4ON0 A;  1XCB A;  1AOY A;  1BN5 A;  5LEK A;  4Q5S F;  4MTD A;  4A0Z A;  4LG0 B;  4KIF A;  4XLP F;  1ON1 A;  2XVC A;  1U5T B;  2K4J A;  2P6T A;  2EK5 A;  4G8X A;  4XSZ F;  3ECO A;  5CVV A;  2VE8 A;  4M6Y A;  3T8T A;  3KP4 A;  2RNJ A;  2D2W A;  2ZXJ A;  4BYY A;  2Q0O A;  2F5D A;  2TDX A;  1IAW A;  1SFE A;  4ENJ A;  3D0S A;  2F5C A;  2HQN A;  5DCF A;  2IA1 A;  5CVI A;  3VEP A;  3GW2 A;  2PLY A;  2Y75 A;  4FX0 A;  5L3D A;  1YG2 A;  4RGR A;  1RNL A;  3LQQ A;  4EQQ A;  2W84 A;  2W25 A;  4I02 A;  1YLF A;  5ICF A;  2FML A;  2A3S A;  2LF8 A;  3J81 Z;  1I1G A;  3GF2 A;  1P4A A;  5HLI A;  4D0P A;  2OZU A;  2HR3 A;  2P5V A;  1R23 A;  2BE5 F;  1SFX A;  2JRT A;  3F6V A;  1HBX G;  3E6C C;  4HF2 A;  3TKY A;  5L3G A;  2W57 A;  1R1T A;  5KK1 A;  1OYI A;  3BJA A;  4Q47 A;  2CW0 F;  3JSO A;  3ABT A;  1W5T A;  3QU3 A;  4L5I A;  1ZGJ A;  1ZG3 A;  3KLN A;  2GXG A;  2FBH A;  1Z6R A;  2XHK A;  3EYY A;  3RDI A;  1KGS A;  5K5Q A;  5FGM A;  1STZ A;  2H27 A;  3R0J A;  4I09 A;  4UUV A;  4WF2 A;  2ZFW A;  4A6E A;  1LNW A;  3J81 K;  3HRT A;  2VT3 A;  1WQ2 A;  3TO6 A;  3K2Z A;  2R7F A;  5LBQ A;  5A2Q Z;  4BXU A;  2DW4 A;  5DEQ A;  4CGZ A;  1B1B A;  3U9G A;  1GXP A;  1ULY A;  4AIK A;  3PQK A;  2V9V A;  1XSX A;  5H6Q A;  2HDC A;  4KIC A;  3GVA A;  3LA7 A;  5F64 A;  3WE3 A;  1UB9 A;  2X4H A;  2DT5 A;  1R7J A;  4N9I A;  1I6X A;  2MC3 A;  3E5X A;  2JZY A;  4O3M A;  4OMY A;  1U5T A;  1YFH A;  3C7J A;  2KRF A;  2Z5U A;  3T8R A;  4OIP F;  1W7P A;  4P5O A;  1Z91 A;  3EET A;  3MZH A;  1HQC A;  1LDJ A;  2YPR A;  2QZ8 A;  2QQB A;  5LGT A;  5DUI A;  2EV6 A;  2VBW A;  3I5U A;  1H9T A;  4R1H A;  1J75 A;  3SZP A;  2GA1 A;  5LRS A;  5DCM B;  2V6C A;  3P9K A;  4OIR F;  2HYG D;  1DP7 P;  2OU2 A;  3GX4 X;  2GIV A;  3HHG A;  4MQ9 F;  3KZZ A;  3CDH A;  1S3J A;  2L4M A;  1G3Y A;  3U1D A;  2ISZ A;  2FQ3 A;  2BEO A;  2DQL A;  2Q2E A;  3FXR A;  2O8X A;  1O7F A;  2XRN A;  4L5J A;  5EEG A;  1ZG1 A;  4A5N A;  5ICG A;  1EH8 A;  2EA2 A;  2HTS A;  2XAQ A;  4OIQ F;  4DQ2 A;  5K1Y A;  5BPD A;  4Y15 A;  4I0B A;  1QO0 D;  1XCV A;  3HSF A;  4EM0 B;  3GFM A;  2IA0 A;  2Q8K A;  2HEO A;  1FX7 A;  3E3V A;  2XAJ A;  3JW4 A;  4Q48 A;  3B73 A;  2A61 A;  2JPC A;  5FFZ A;  4U0V A;  3I59 A;  3KCC A;  1HW5 A;  1T98 A;  3MAJ A;  4IF4 A;  5KVR A;  1P4W A;  2VN2 A;  4LK1 F;  2M1B A;  3IHU A;  1O3T A;  1D8K A;  3WGG A;  2GZW A;  4G7H F;  1B9N A;  3I58 A;  2BYV E;  3NRV A;  4I2O A;  3TO9 A;  5E8G A;  1FSE A;  3L09 A;  3KFW X;  4YII A;  1B9M A;  3EQL F;  5J8F A;  2A6E F;  3WTT C;  2VT2 A;  2R7D A;  2E7X A;  3QP5 A;  4IRH A;  2VC1 A;  1JE8 A;  3MCZ A;  2QQ9 A;  3IC7 A;  5LHG A;  1FYM A;  3KE2 A;  3KP5 A;  1ZLJ A;  1IXR C;  2VE9 A;  1IN4 A;  1EH7 A;  1SD5 A;  4EGY A;  2M5W A;  1ZHF A;  2L3D A;  4ESJ A;  3SZT A;  5ICC A;  3I59 B;  1U2W A;  1FYK A;  1FP2 A;  1Z6T A;  4LB5 A;  2G7U A;  5L3B A;  4HZF A;  3F8C A;  3C18 A;  2O0Y A;  3HHH A;  1AWC A;  1W4M A;  5DD8 A;  2H09 A;  4M72 A;  1IN6 A;  2O6G E;  2QWW A;  3V7R A;  3QRF F;  4HOB A;  1DPU A;  1WWX A;  3MWM A;  3G3Z A;  4BAY A;  2PG4 A;  1A04 A;  5HVQ C;  1KU3 A;  2DBB A;  1HKQ A;  3WU0 A;  3WE2 A;  1FSH A;  4I98 B;  3EDP A;  1OMI A;  3BPV A;  4LGW A;  2LSO A;  2VOP A;  1IN5 A;  2HKO A;  3ROU A;  3FMR A;  3ZMZ A;  3KP3 A;  5HS9 A;  2XAS A;  1K79 A;  5JI6 A;  1BM9 A;  4I01 A;  2E1C A;  1LEB A;  2CG4 A;  5BOX A;  2RN7 A;  1OR7 A;  5AIQ A;  2ETH A;  4WK8 F;  3KP2 A;  3RTR A;  4HV5 A;  1MJ9 A;  2ZBK A;  3HSR A;  1P4X A;  4I7H A;  4BQA A;  2YU3 A;  1Q1H A;  4EJW A;  4P9U A;  3HRS A;  3IRQ A;  3TOB A;  1F1Z A;  1ZGA A;  4MEX F;  1XDS A;  4LJZ F;  1USS A;  5DYM A;  4I0A A;  1LEA A;  1J7K A;  2FNP A;  4N0B A;  1FBQ A;  1U78 A;  4ESF A;  2FU4 A;  4OIO F;  4HLX A;  1JHF A;  3RKY A;  5E20 A;  3SXY A;  4RGU A;  2NS0 A;  3HTU A;  4MQV A;  4MGR A;  3ZP5 A;  4HQM A;  1B59 A;  4LK0 F;  3ZN1 A;  1QZY A;  1FWZ A;  3ZMD A;  3SHF A;  1MJB A;  2K4B A;  1YYV A;  1S8N A;  1XGO A;  2A68 F;  2EJR A;  4IXA A;  2DO7 A;  1VTN C;  3MEX A;  4EMS A;  4OOI A;  1BBY A;  1WRJ A;  1KQ0 A;  3K1N A;  3BPX A;  3ZMS A;  3ABU A;  2K7L A;  2Y0M A;  4IPA A;  4S04 A;  5J6X A;  4BNC A;  2D1H A;  2K02 A;  2P4W A;  3O3K A;  1BJA A;  1P92 A;  2C6Y A;  2EFN A;  2ZNY A;  4RAZ A;  4U0Y A;  4P55 A;  5ED4 A;  5AIP A;  1J9I A;  3M9A A;  3GEZ A;  1KYW A;  4QLC U;  4IRG A;  3F21 A;  1QGP A;  2J5P A;  4HYE A;  2GWR A;  2GXB A;  1W7P D;  5D5X B;  4XBF A;  1S6L A;  3BWG A;  4HW0 A;  1YO5 C;  4FX4 A;  2XIG A;  3SQN A;  2IA2 A;  1IUY A;  2O3F A;  3R60 A;  1QBJ A;  1JGS A;  3KET A;  1B4A A;  1R00 A;  4M73 A;  2YX7 A;  2VBY A;  5HS7 A;  3I71 A;  2VBX A;  3TOA A;  4KMU X;  4PGH A;  1TNT A;  4R79 A;  1FZP B;  2EV0 A;  4UV9 A;  3BDD A;  1L3L A;  4RS8 A;  4Q4Z F;  4U7B A;  4HF1 A;  1R1U A;  2JTV A;  1XDU A;  2DLL A;  2NAZ A;  4HV6 A;  3QP6 A;  5D5W B;  1IF1 A;  4MEY F;  5K5O A;  1IN7 A;  2P5L C;  2EV5 A;  3N4M A;  1C0W A;  4CDG A;  5E8I A;  5HLH A;  2NRA C;  3H3Z A;  4IHS A;  1XMA A;  3AAF A;  4WXD A;  1PP8 F;  2NNY A;  2XKO A;  4MTE A;  3P9I A;  4G6D A;  4KIB A;  5L3E A;  2R3S A;  1XN7 A;  2A5Y B;  2ZME A;  1TBX A;  4KDP A;  2CO5 A;  2UXX A;  2XAF A;  1I27 A;  1GVJ A;  1KU9 A;  4H0E A;  2XAH A;  5ILV A;  1BI0 A;  1MZB A;  1ODD A;  4MHG A;  3P9C A;  5FD6 A;  1XD7 A;  4M9X A;  2XRO A;  1G3W A;  1SD4 A;  4HX7 A;  4HLY A;  3N97 A;  3FZV A;  1ONV A;  1TTY A;  2DK5 A;  1Z05 A;  4Y13 A;  2H94 A;  1F9N A;  3BJ6 A;  1DDN A;  1RUO A;  3CUQ B;  3TO7 A;  3W6K B;  3HRU A;  4OIN F;  5DCM A;  4WCG A;  2K27 A;  3GFL A;  1XGN A;  1JHH A;  5CVJ A;  1TW2 A;  2PMH A;  3T1B A;  3LA2 A;  3FF5 A;  1F5T A;  2A69 F;  1IRG A;  3GO5 A;  2OZ6 A;  4M74 A;  3VFZ A;  1XGS A;  4IHT A;  3GFI A;  3KZY A;  3KEO A;  2ESH A;  1ZRF A;  1KQ9 A;  3F3X A;  1FNN A;  3JSP A;  3K0L A;  4JQF A;  5E1Z B;  2CFX A;  3Q9S A;  3J7A O;  2CWE A;  4IVN A;  2ZCW A;  4P9F A;  5BQT A;  2PJP A;  1BI1 A;  1KU7 A;  3DPL C;  5HDG A;  5LHH A;  1R1V A;  4YIF A;  1LVA A;  5TJJ A;  2ELH A;  4M6X A;  3REO A;  4M71 A;  2EFP A;  3V8J A;  2V79 A;  3LFK A;  1K6O A;  3WOD F;  5HDN A;  1PDN C;  1YS6 A;  1S7O A;  3P7N A;  2LF7 A;  4IJA A;  1HW2 A;  2PBI A;  2OQG A;  1Y0U A;  1WSU A;  5FFX A;  3Q9V A;  2XV4 S;  5BPI A;  5F6F A;  2QLZ A;  2VON A;  1BC7 C;  1FPQ A;  4Z2Y A;  5L3F A;  1MGT A;  5H20 A;  2CSO A;  2W85 A;  3TQN A;  2OAZ A;  3FWE A;  3WTV C;  3GYH X;  1E17 A;  2B0L A;  1J0R A;  4BHB A;  2ZJ2 A;  3H3U A;  1ZAO A;  1ZN2 A;  4ZYG A;  5BS6 A;  5LGU A;  1F4K A;  1G3S A;  5ILU A;  5E17 F;  2FBI A;  3EUH A;  3FMS A;  2P7C B;  3FMQ A;  1W7P B;  4LMY A;  2DI3 A;  5L3C A;  4U0W A;  2ZNZ A;  2EWN A;  5LLQ A;  5LEJ A;  2X0L A;  2YX4 A;  4RAY A;  2DPD A;  3COA C;  2GA2 A;  4JBA A;  3HOT A;  5EEH A;  1BOA A;  2FA5 A;  4CHU A;  3DFG A;  2MH9 A;  1MDM A;  2L4A A;  2VOD A;  5CJ9 A;  4BHC A;  2FNA A;  4IRI A;  1DPR A;  3VOE A;  4GYI A;  1MJA A;  1ZH5 A;  4HDV A;  3QPH A;  2P7V B;  4YFX F;  1K7A A;  3F22 A;  2DFI A;  3WTS C;  1ON2 A;  3OOP A;  1OPC A;  1GHC A;  4UVB A;  2LKP A;  1YTY A;  2G9W A;  5FLX Z;  2HYF A;  3DF8 A;  3KLO A;  5DD4 A;  3S2W A;  3CO6 C;  3QPT A;  2MA3 A;  1O3R A;  4WXC A;  4HQE A;  1R36 A;  1SD7 A;  2PQ8 A;  2FEZ A;  2KIU A;  5IT3 A;  1TW3 A;  4ETS A;  3DEU A;  3F8M A;  1IXS B;  3MZY A;  2O61 A;  3WTU C;  3ZN0 A;  4E70 A;  4ZZD A;  5JFR A;  1HXD A;  2FBK A;  1W5S A;  4UNO A;  1V3F A;  1XMK A;  5D6E A;  4A0Y A;  1IZ1 A;  4WXH A;  5FLX K;  4EV0 A;  1K78 A;  1YQA A;  1V4R A;  5D4S A;  1D5V A;  4NHJ A;  1I1S A;  2FE3 A;  4ZYD A;  3B02 A;  4U7D A;  1LDD A;  2RC4 A;  2ISY A;  3CJN A;  2OD5 A;  2IP2 A;  3GXO A;  1T38 A;  3IKT A;  4KN4 X;  3QU6 A;  3IWF A;  3RPU A;  2AXL A;  1ZRE A;  2M30 A;  3M8E A;  1IXC A;  1J5Y A;  2QQA A;  1XB4 A;  1TQP A;  1TLH B;  4G94 A;  2L02 A;  5D6F A;  2D45 A;  5E1X A;  3LAP A;  2WV0 A;  4KA4 A;  1XSV A;  5BMZ A;  3DXJ F;  2ESN A;  3IRR A;  2EFO A;  1QQI A;  3BJO A;  2ZKZ A;  3ECH A;  5TRD A;  4G7Z F;  2PFB A;  4HAM A;  3IKV A;  3RIR A;  3GZ5 A;  4KMF A;  4EM2 A;  3FM5 A;  1O57 A;  5ERI A;  4P96 A;  1ZYR F;  1L0O C;  2LDU A;  2QVO A;  2V1D A;  1REP C;  3JTH A;  1FYL A;  3CUQ A;  3FM3 A;  2ACJ A;  2NYX A;  3FHZ A;  2UZK A;  1BI3 A;  4TV7 A;  2W24 A;  3Q5F A;  1MKM A;  5K5R A;  5D8K B;  1TQI A;  3ZMU A;  4GCV A;  3TGN A;  2IT0 A;  3WTW C;  4ENK A;  3F8N A;  1BIA A;  2P6S A;  3CO7 C;  2A07 F;  2KKO A;  2HGC A;  5FD5 A;  1CF7 A;  3KP6 A;  4HX4 A;  1I5Z A;  2A6H F;  2JSC A;  4L9V A;  3E6D A;  4FT8 A;  1IW7 F;  1RIO H;  3QOP A;  3VB2 A;  5E18 F;  3NEU A;  4UHT A;  1WI9 A;  5E1W A;  2E7W A;  1KYZ A;  2Z99 A;  4G7O F;  4S05 A;  3C3W A;  5LRR A;  2EFW A;  4XRF A;  4AVP A;  1FC3 A;  2QEN A;  4LLL A;  4NQW A;  2NNN A;  3M8F A;  3T0Y A;  1HSJ A;  4L18 B;  3DV8 A;  1QNT A;  4HBL A;  1LB2 A;  1ZG5 A;  1E2X A;  2PEX A;  2STW A;  2J5O A;  1HKS A;  4A2U A;  1MD0 A;  4LLN A;  4R8H A;  2STT A;  3F72 A;  4AWX B;  2RGV A;  2FF4 A;  1IN8 A;  3BZ6 A;  3RKW A;  2OBP A;  5LGN A;  2G7H A;  3HYI A;  4WWC A;  1O3S A;  1UFM A;  3BRO A;  2FRH A;  1T2K A;  3I64 A;  2IW5 A;  2KIM A;  1P6R A;  1XGM A;  2CGP A;  3ZPL A;  2D1V A;  1R5G A;  4CXF A;  3RKX A;  5FO5 A;  3E5U A;  4KYW A;  2VC0 A;  4EGZ A;  1KU2 A;  2P5K A;  4KNY A;  2GQQ A;  2HZT A;  2ADU A;  4LG0 A;  1TNS A;  4A6D A;  5CVR A;  4Y17 A;  1P2F A;  3GUD A;  2DK8 A;  1U6G A;  1X3U A;  4KT5 C;  1WKM A;  5JHU A;  2V1U A;  5CLS A;  3V7S A;  3PFI A;  1EH6 A;  3E5Q A;  3HSE A;  2UXN A;  4CZZ A;  1CGP A;  4U88 A;  3JTG A;  1FY7 A;  3DQV C;  1LDK B;  3F8B A;  3WU1 B;  5DUK A;  4RGX A;  5F1R A;  3MFK A;  3ML6 A;  2EB7 A;  2MLG A;  3BP8 A;  3RYR A;  1R22 A;  3F23 A;  4GYG A;  4B8X A;  2HOE A;  3I54 A;  2M87 A;  3HOS A;  2ZME B;  3JAM Z;  2FMY A;  1UCR A;  4MNU A;  3KP7 A;  2MLK A;  2EFQ A;  3G73 A;  1UHM A;  1HW1 A;  2IVM A;  4F7Z A;  3J80 K;  4LB6 B;  2E1N A;  1YS7 A;  1MDM B;  2QBY B;  1OYW A;  5D8L B;  3KEQ A;  3PQJ A;  2VBZ A;  1UHW A;  2HFH A;  2COM A;  1G6N A;  4ZH4 F;  1G4D A;  4PZJ A;  2F5F A;  4CO8 A;  1FBS A;  4EJU A;  2YR2 A;  2L54 A;  3CUO A;  3RPQ A;  4LD5 A;  3C1D A;  3CLO A;  5A2Q K;  4XLN F;  1ZRD A;  1D8J A;  3I4P A;  3U2R A;  1S29 A;  1YW8 A;  3IWZ A;  2DTR A;  2XKP A;  3JAM K;  1Z9C A;  2V1X A;  4ASN A;  1O7L A;  1R58 A;  1YW9 A;  3FXQ A;  3ZQ7 A;  2O03 A;  3TDU C;  1U8R A;  3HUG A;  4O6J A;  3V8K A;  4OMZ A;  4G9Y A;  2Z3Y A;  4K2E A;  2OA4 A;  2PN6 A;  1OYY A;  3HIF A;  4YFN F;  3E6B A;  4BH9 A;  4PDK A;  3RYP A;  2XUB A;  3WTY C;  2AS5 F;  4EM1 A;  1FBU A;  2FXA A;  3F6O A;  3H92 A;  2Y48 A;  3HRM A;  4NB5 A;  1OKR A;  3GFJ A;  5AON A;  1PUE E;  3RI4 A;  2Z33 A;  2IPQ X;  2QBY A;  2H6C A;  4UV8 A;  2VXZ A;  1T0F A;  4AIJ A;  4WX9 A;  3WGI A;  2DAO A;  3L9F A;  1Z1D A;  5DV5 A;  3CUQ C;  1HKT A;  5IT9 K;  4CYD A;  1IRF A;  4RGS A;  4GGG A;  4ENN A;  1O3Q A;  3M7G A;  1BIB A;  2P8T A;  4L9J A;  3WTX C;  3LWF A;  2CQK A;  3NQO A;  3E6M A;  4M9S A;  3K1M A;  2KJB A;  2XGX A;  2GAU A;  4BHP A;  4N9H A;  5HLG A;  3DKW A;  1NHA A;  4M9Z A;  2QM3 A;  4L0Z B;  3FXU A;  3L2C A;  3WTZ A;  3LA3 A;  2YSR A;  3K69 A;  2H6B A;  4DNC A;  1RZ4 A;  4A5M A;  3CTA A;  1TQM A;  3BY6 A;  4RB0 A;  2RQP A;  5CYV A;  4UVA A;  3ERE D;  2DU9 A;  3W6J B;  1FT9 A;  4HA8 A;  2VOO A;  2OQR A;  2BBY A;  1T39 A;  4ENM A;  3LQR A;  1CF7 B;  3O2P E;  4A12 A;  2M8E A;  2QYO A;  3RJP A;  2LNB A;  3WG9 A;  4PGG A;  4YG2 F;  1FOK A;  1T6S A;  4AD9 A;  3K1P A;  3I0T A;  1XSD A;  3HTS B;  2F2E A;  4XSX F;  4AIH A;  1J2X A;  5LHI A;  3OV8 A;  3GZ6 A;  5D5V B;  4RB2 C;  4L0Y B;  1R5H A;  4L9T A;  3DPT A;  4ZYE A;  3WGH A;  2ZO4 A;  1YW7 A;  4EJT A;  5DDG A;  1U3E M;  4OU0 A;  5D5U B;  2RKH A;  3R61 A;  4ESB A;  2IJL A;  3T5X A;  2L01 A;  5CVU A;  2PMU A;  1ZAR A;  4YFK F;  1K78 B;  1J59 A;  2HKX A;  1FP1 D;  3ULQ B;  1GXQ A;  3MQ0 A;  4FHT A;  1KA8 A;  2FSW A;  2MD5 A;  2XAG A;  3LST A;  3GLX A;  1ZLK A;  2HWV A;  5H6R A;  3BOQ A;  1QPM A;  3GWZ A;  5JVT A;  4RB1 A;  2WWY A;  1YIO A;  4KUM A;  4RB3 C;  4KFC A;  4UVC A;  3F8F A;  2PI0 A;  3R6S A;  3J80 Z;  1H9G A;  5ICE A;  3V8L A;  4LLG F;  3D5L A;  3V4G A;  4UXN A;  3VOD A;  4G6Q A;  4KIG A;  3ISP A;  1RUN A;  1RI7 A;  1H0M A;  4GXO A;  1PP7 U;  2RDP A;  2EA4 A;  1B6A A;  1EV7 A;  4CIC A;  1D3Y A;  3QAH A;  5ILS A;  3L00 A;  3O6B B;  2BV6 A;  4L9N A;  1SMY F;  2KJC A;  3R0A A;  3FX3 A;  4ZYH A;  2KIF A;  1FLI A;  3V7C A;  3TDZ C;  1DUX C;  1UST A;  2HS5 A;  5HS8 A;  2MH2 A;  1LJ9 A;  1LQ1 A;  3LAJ A;  2WC2 A;  4EVI A;  1SFU A;  2M45 A;  1JXS A;  3K9T A;  2DQR A;  2MBF A;  1KQ8 A;  3R4K A;  1Z7U A;  4ZZL A;  1SMT A;  5J8C A;  4EJV A;  2WTE A;  3L7W A;  3E97 A;  4HF0 A;  4PCQ A;  2DPU A;  1SAX A;  2HTJ A;  3M1E A;  3IL2 A; 
#chains in the Genus database with same CATH topology
 4KN7 X;  4QWQ A;  2E35 A;  4EJO A;  4HDU A;  2FOK A;  4GO1 A;  3DP7 A;  1HLV A;  4C3H J;  2E1M B;  1RET A;  5IT9 Z;  4E6K G;  2F5E A;  1TWA J;  1BC8 C;  1ZR2 A;  1MIJ A;  3DEE A;  2OF7 A;  3I53 A;  2Z9O A;  3A01 B;  4CYC A;  3ELK A;  2E5Z A;  2JT1 A;  3OIQ A;  2M34 A;  1G3T A;  2XF5 A;  3LMM A;  2QUF A;  2IRF G;  1S7A A;  2HQA A;  1OIS A;  1Y56 A;  1BI2 A;  4JK1 X;  5DM6 F;  4HX8 A;  5GTH C;  2HQR A;  2JPB A;  2RVC A;  4ZDO A;  2GXA A;  5FB2 A;  5JR3 A;  4D9J A;  1IRZ A;  1YJW I;  5HDK A;  3SFZ A;  1NH3 A;  1TT0 A;  6PAX A;  2B7E A;  4A3M J;  2MFZ A;  4QSH A;  3ZMT A;  2X51 A;  2K86 A;  1SD6 A;  5HOO A;  3BR0 A;  1ZRC A;  4B09 A;  3ABL H;  4B43 A;  2BGC A;  4O5V A;  2UWM A;  3EYI A;  5D4R A;  4XOR A;  1TT5 B;  3GCM A;  4A0X A;  2HDD A;  2L7Z A;  3ZMV A;  1OCC H;  3BCA A;  5FKO A;  2Y9Z A;  1HST A;  2DOE A;  5CQE A;  5EGO A;  1JTY A;  1U5T C;  2CYY A;  3HGY A;  2G0E A;  4LFU A;  1QZZ A;  2ECC A;  2RV8 A;  1FOY A;  1QHH D;  4ON0 A;  1XCB A;  2LRE A;  3BC8 A;  4DYC A;  4ITV A;  1AOY A;  1E0E A;  2OCC H;  2XC7 A;  1BN5 A;  3ZCO A;  3CMA I;  5LEK A;  3ZOB A;  4Q5S F;  3S1M J;  4MTD A;  2ZFU A;  4A0Z A;  4LG0 B;  1S5L C;  1FOW A;  2IGK A;  1RKT A;  4KIF A;  4NUB A;  4XLP F;  2I8D A;  3JRD A;  1ON1 A;  2XVC A;  3IV5 A;  3HM5 A;  1G59 A;  4DW6 A;  1U5T B;  3IUO A;  2K4J A;  4E7K A;  2CV2 A;  4ZTJ A;  2P6T A;  1T95 A;  2EK5 A;  3OSG A;  4C30 A;  4G8X A;  1IDZ A;  4XSZ F;  1K83 J;  3ZR8 X;  3ECO A;  5CVV A;  2VE8 A;  3DBH B;  4M6Y A;  3T8T A;  1GV5 A;  3LSR A;  1ZQ3 P;  3KP4 A;  4BUP A;  2RNJ A;  4HNU A;  4M3F A;  2LKX A;  2D2W A;  2ZXJ A;  4BYY A;  2Q0O A;  2F5D A;  3GTJ J;  2TDX A;  1IAW A;  2XAU A;  1YX5 A;  4PFO A;  1SFE A;  2WAD A;  1ORK A;  4G12 A;  1QHG A;  4ENJ A;  3D0S A;  2F5C A;  2HQN A;  5DCF A;  4F3Q A;  1XC5 A;  2IA1 A;  5CVI A;  3VEP A;  3GW2 A;  5J1R A;  2PLY A;  2Y75 A;  2CQN A;  4FX0 A;  4X1E A;  5L3D A;  3HC7 A;  1VQ8 I;  1I3Q J;  1YG2 A;  4BS9 A;  1W0T A;  4RGR A;  1RNL A;  3LQQ A;  4EQQ A;  2W84 A;  2Y9Y A;  2W25 A;  5GPA A;  3LFU A;  4I02 A;  2CUZ A;  1XPX A;  2E71 A;  1YLF A;  1R9T J;  5ICF A;  4AU7 A;  2WY7 Q;  2FML A;  2A3S A;  2LF8 A;  3J81 Z;  2R5Y A;  3IH2 A;  1I1G A;  1V5E A;  3GF2 A;  3K70 D;  4KJZ A;  3SZG A;  1FIA A;  1P4A A;  2R7W A;  5IP9 J;  5HLI A;  4D0P A;  1WH7 A;  2OZU A;  2HR3 A;  2P5V A;  4IQ4 A;  1R23 A;  2BE5 F;  1SFX A;  2JRT A;  3TMO A;  3F6V A;  3OMY A;  2E2J J;  3OYA A;  1HBX G;  3DTK A;  2F6C A;  3CZ6 A;  3E6C C;  1Y0N A;  4HF2 A;  3TKY A;  1VF9 A;  5L3G A;  2W57 A;  1OQY A;  1R1T A;  5KK1 A;  1OYI A;  3BJA A;  4Q47 A;  2VXD A;  2CW0 F;  3JSO A;  3E0J B;  3ABT A;  1W5T A;  3QU3 A;  4L5I A;  2JA8 J;  2JN6 A;  2ZJR F;  1ZGJ A;  1ZG3 A;  3KLN A;  4G6T B;  3S14 J;  2GXG A;  2DFF A;  2FBH A;  2IEK A;  1Z6R A;  1MMA A;  2XHK A;  4N4N B;  3H0D A;  3EYY A;  1D0Z A;  3RDI A;  4B44 A;  1KGS A;  1MBJ A;  1VI0 A;  3HGG A;  5K5Q A;  3FXJ A;  5FGM A;  1STZ A;  3OYK A;  2H27 A;  3R0J A;  2KPM A;  4I09 A;  4A3L J;  4UUV A;  4WF2 A;  2ZFW A;  4A6E A;  1LNW A;  2BY1 A;  5F27 A;  3S93 A;  3J81 K;  1GVD A;  1R71 A;  1R6R A;  4A3E J;  3BR2 A;  3HRT A;  1TWF J;  2VT3 A;  1WQ2 A;  3TO6 A;  3K2Z A;  3SEQ A;  2R7F A;  5LBQ A;  1UJ8 A;  5A2Q Z;  4BXU A;  5GAH J;  5KNL A;  1O4X A;  2DW4 A;  5DEQ A;  2R92 J;  3H36 A;  5EZH A;  3PL8 A;  3VSL A;  4CGZ A;  1B1B A;  3U9G A;  1GXP A;  1DQU A;  5E3N A;  3OYJ A;  1ULY A;  2KZG A;  4AIK A;  1MNE A;  1LFB A;  1TZL A;  3PQK A;  3H5N A;  2V9V A;  3F0C A;  1XSX A;  2ZXH A;  4FTH A;  3CES A;  5H6Q A;  2HDC A;  4KIC A;  3X2Q H;  3GVA A;  3LA7 A;  1MMD A;  5F64 A;  4ZC3 A;  3WE3 A;  4B48 A;  2EPF A;  1UB9 A;  3BTL A;  2MD0 A;  4AID A;  1H89 C;  2X4H A;  2DT5 A;  1ETX A;  1R7J A;  3MZ8 A;  4PJM A;  3U1K A;  1WZ2 A;  4N9I A;  1I6X A;  2MC3 A;  1UMQ A;  3E5X A;  1WJD A;  2JZY A;  4O3M A;  1S9H A;  4CCJ A;  4PSW A;  4OMY A;  1VQN I;  1I3A A;  1U5T A;  1YFH A;  2CJJ A;  3C7J A;  1LKX A;  2KRF A;  2Z5U A;  5HNF A;  1Z77 A;  2LP0 A;  3T8R A;  3CF5 F;  3L2V A;  4OIP F;  2KIS A;  4AC0 A;  3B6C A;  1W7P A;  4P5O A;  1Z91 A;  3EET A;  3MZH A;  1HQC A;  1LDJ A;  1PYV A;  3ZQQ A;  3ZQI A;  3CCJ I;  2YPR A;  2QZ8 A;  1MH3 A;  2ELK A;  2FOW A;  1Z3Y A;  2RAE A;  2QQB A;  5LGT A;  5DUI A;  2EV6 A;  2VBW A;  3I5U A;  3OR2 C;  4R1H A;  1P7I A;  5FKL A;  1H9T A;  1J75 A;  3SZP A;  2AXT C;  2V9P A;  2GA1 A;  3A02 A;  5LRS A;  3OY9 A;  2L7K A;  5DCM B;  2V6C A;  3P9K A;  4OIR F;  2JUG A;  3AG4 H;  2XSJ C;  2WAQ A;  1CQT A;  2X85 A;  2HYG D;  1KZH A;  3K4J A;  2HOA A;  1DP7 P;  3HL2 A;  3DLL F;  2OU2 A;  3JRF A;  3GX4 X;  4LIT A;  2GIV A;  3HHG A;  4MQ9 F;  3KZZ A;  4B3X A;  2UUZ A;  3CDH A;  1S3J A;  2DYR H;  2L4M A;  1G3Y A;  3PO2 J;  4LIU A;  1E3P A;  3A1Y A;  3U1D A;  2ISZ A;  3EUH C;  2FQ3 A;  2W4S A;  2BEO A;  1A31 A;  2DQL A;  2Q2E A;  1VQO I;  4B1R A;  3FXR A;  4UB6 C;  1BR4 A;  2O8X A;  1O7F A;  3OSF A;  1IRX A;  2XRN A;  4L5J A;  2AHQ A;  5EEG A;  1N78 A;  4KIT B;  3D5R C;  4A5N A;  3ESW B;  1ZG1 A;  5ICG A;  1EH8 A;  2EA2 A;  4BQQ A;  2E1M C;  2HTS A;  2XAQ A;  5EJC A;  1X1P A;  4OIQ F;  4DQ2 A;  3VSK A;  5K1Y A;  1B72 B;  1SFO J;  1Q1V A;  2H8W A;  4YEJ A;  5BPD A;  4Y15 A;  5M3F J;  4I0B A;  1QO0 D;  1XCV A;  3HSF A;  3F9K A;  3GFM A;  4EM0 B;  1JTX A;  2IA0 A;  2OUM A;  3CJQ B;  1LUJ B;  2BZT A;  4XQF A;  3TED A;  1X4P A;  2Q8K A;  4UY8 I;  2XGE A;  1LFU P;  3A4C A;  3KYL A;  2K9L A;  2HEO A;  2R7X A;  2JA7 J;  4F91 B;  1FX7 A;  3E3V A;  2XAJ A;  3JW4 A;  4Q48 A;  3B73 A;  3GTO J;  2A61 A;  3QYE A;  2JPC A;  5FFZ A;  4IKF A;  4U0V A;  1R49 A;  3I59 A;  1E3H A;  3KCC A;  1HW5 A;  1T98 A;  3MAJ A;  2ZME C;  1Z0X A;  2NS7 A;  4IF4 A;  1X4O A;  5KVR A;  1P4W A;  2VN2 A;  4LK1 F;  4C3J J;  4XRS A;  2LTP A;  2M1B A;  3IHU A;  1O3T A;  1D8K A;  3EUA A;  1WI3 A;  3WGG A;  2GZW A;  2VL8 A;  4G7H F;  3IAS 2;  1H88 C;  2GM4 A;  3H9Q A;  1B9N A;  3I58 A;  2BYV E;  1D0X A;  2DOA A;  3NRV A;  3SJM A;  5CKT A;  3CCS I;  2HVQ A;  3NWS A;  2LOO A;  4I2O A;  3TO9 A;  1OCZ H;  3BR6 A;  5E8G A;  1FSE A;  3WG7 H;  3L09 A;  4IOC F;  3KFW X;  4GDF A;  4YII A;  1B9M A;  3EQL F;  5J8F A;  2XF6 A;  2A6E F;  2DYS H;  4M3B A;  2VT2 A;  2R7D A;  3WTT C;  3QPL A;  2E7X A;  3OYF A;  4XOP A;  3QP5 A;  4IRH A;  2LYC A;  4QTR A;  2VC1 A;  1JE8 A;  4NDL A;  3MCZ A;  2QQ9 A;  3IC7 A;  5LHG A;  1FYM A;  4IHY A;  1JT6 A;  4IZZ A;  2CW7 A;  3KE2 A;  2JVH A;  4BKX A;  2JK3 A;  2JUC A;  5E3L A;  1RES A;  3N05 A;  3KP5 A;  1ZLJ A;  1IXR C;  2KL4 A;  4IX7 A;  2VE9 A;  1BR2 A;  4BEH A;  1IN4 A;  1WJB A;  2XGC A;  4DBR A;  2BOL A;  1EH7 A;  1SD5 A;  4EGY A;  1MMS A;  2VJ5 A;  5GAE J;  2M5W A;  1V5G A;  1ZHF A;  2HI3 A;  2L3D A;  4ESJ A;  1OJL A;  2PJR B;  2MC4 A;  2GOX B;  2AO9 A;  2I10 A;  3SZT A;  5ICC A;  3I59 B;  3G4S I;  1U2W A;  1FYK A;  1FP2 A;  1Z6T A;  4BXF A;  4LB5 A;  3ZXS A;  2G7U A;  1NG7 A;  4II2 A;  2X9D A;  5L3B A;  2PMZ A;  3I4M J;  4HZF A;  4B47 A;  3F8C A;  1YJN I;  3KYC B;  3FKI J;  3C18 A;  1AHD P;  4FE4 A;  3ZQG A;  2O0Y A;  2K85 A;  3HHH A;  1VQ5 I;  1A6I A;  3TL4 X;  4ANJ A;  1U8B A;  1AWC A;  1W4M A;  5DD8 A;  5TGT A;  3A0H C;  2H09 A;  2P0W A;  1B8I B;  1ERD A;  1TWC J;  4M72 A;  1IN6 A;  2IS4 A;  1WPK A;  1MH4 A;  3LSH A;  2O6G E;  3HKZ A;  2QWW A;  3GTL J;  3V7R A;  1YX3 A;  3QRF F;  2VUM J;  4HOB A;  5GAG J;  1DPU A;  1EJ9 A;  1WWX A;  1ETQ A;  3MWM A;  3G3Z A;  4BAY A;  1IO2 A;  2PG4 A;  2DMT A;  1X1A A;  2M4G A;  1SVM A;  1A04 A;  2VQH A;  5HVQ C;  5EYR A;  1KU3 A;  1HKQ A;  2DBB A;  1R5I D;  3WU0 A;  3D1N I;  5FLM J;  2LR8 A;  4II3 A;  4V2F A;  3WE2 A;  2WAQ N;  1FSH A;  2X1D A;  2E36 A;  3BTC A;  4I98 B;  3EDP A;  4PFP A;  4ZDL A;  1OMI A;  1X58 A;  2DA7 A;  3BPV A;  4LGW A;  2LSO A;  2VOP A;  2LVS A;  1IN5 A;  2HNH A;  3PM1 A;  2HKO A;  3ROU A;  4RBO A;  3FMR A;  4EAT A;  3ZMZ A;  3KP3 A;  5HS9 A;  2B63 J;  2DOD A;  2GBY A;  1POG A;  2XAS A;  5M5W J;  5EF6 A;  2WAE A;  4XLA A;  1K79 A;  5JI6 A;  1BM9 A;  2DCE A;  2BVL A;  4I01 A;  2E1C A;  5IP6 A;  1LEB A;  2CG4 A;  1Z3X A;  5BOX A;  2RN7 A;  2W82 A;  1OR7 A;  3CC7 I;  5AIQ A;  2ETH A;  3HZJ A;  1DGR M;  4WK8 F;  5GTI C;  3KP2 A;  2IS6 A;  3RTR A;  4HV5 A;  1MJ9 A;  3S32 A;  2ZBK A;  3HSR A;  1P4X A;  4I7H A;  4BQA A;  2YU3 A;  1ETO A;  1Q1H A;  2CUF A;  4EJW A;  4U87 A;  2V7F A;  4P9U A;  3HRS A;  3FK7 A;  2M7A A;  3BR1 A;  3IRQ A;  2X6O A;  2EIK H;  3TOB A;  1F1Z A;  1ZGA A;  4E7I A;  2W48 A;  2XF7 A;  5F0C A;  4MEX F;  1ZTR A;  1X3Z B;  1YRN A;  2K40 A;  5GAD J;  1W36 D;  2VPL A;  1UZC A;  2V26 A;  3BZC A;  4X6A J;  1XDS A;  4LJZ F;  1USS A;  3PUB A;  5DYM A;  4I0A A;  3MN2 A;  4Y4R A;  1LEA A;  1J7K A;  4DZJ A;  2FNP A;  3HEF A;  3ZQH A;  3ZRG A;  4N0B A;  2NVT J;  1FBQ A;  2KZV A;  2LY9 A;  1U78 A;  4ESF A;  3BQZ A;  2FU4 A;  3CCE I;  4OIO F;  4HLX A;  1JHF A;  4BDY A;  3RKY A;  5E20 A;  3SXY A;  3S3M A;  3CMY A;  4RGU A;  2WA0 A;  3BG3 A;  2NS0 A;  5EZG A;  3HTU A;  3CF2 A;  4MQV A;  4MGR A;  5CQG A;  3ZP5 A;  4HQM A;  1B59 A;  4D7N A;  4LK0 F;  3ZN1 A;  2O8K A;  1QZY A;  1FWZ A;  3DKY A;  1I50 J;  1VQP I;  3ZMD A;  1X1C A;  3SHF A;  4XLC A;  1MJB A;  2K4B A;  1YYV A;  3ZQL A;  1S8N A;  1XGO A;  2A68 F;  2EJR A;  2CU7 A;  1VND A;  2AQF A;  4IXA A;  2DO7 A;  3W6V A;  1VTN C;  2QQ8 A;  2BY0 A;  3MEX A;  5F0F A;  4EMS A;  2MYS A;  4OOI A;  1BBY A;  1SAU A;  1KQ0 A;  1WRJ A;  2VQC A;  1JKP C;  3K1N A;  3BPX A;  3ZMS A;  3ABU A;  1FMV A;  2KQR A;  1WGX A;  2K7L A;  2Y0M A;  4IPA A;  4S04 A;  5J6X A;  4OAY A;  1Z67 A;  4BNC A;  2A6T A;  1JUM A;  2D1H A;  2KT0 A;  3J7Z I;  2K02 A;  2QSG X;  2X1C A;  2COB A;  2P4W A;  3O3K A;  3CD6 I;  1BJA A;  3IH3 A;  1P92 A;  2L0K A;  3I3L A;  2C6Y A;  2EFN A;  4F52 A;  2ZNY A;  2W00 A;  4RAZ A;  3H3V K;  4U0Y A;  4P55 A;  5ED4 A;  3K4K A;  3CCV I;  5AIP A;  2E60 A;  1J9I A;  3M9A A;  5J47 A;  3GEZ A;  1KYW A;  4QLC U;  3AG2 H;  4IRG A;  3F21 A;  1QGP A;  2J5P A;  3HJE A;  1YIJ I;  4HYE A;  3O8G A;  4A3F J;  2GWR A;  2GXB A;  1W7P D;  5D5X B;  1DU6 A;  2EZI A;  3UKG A;  3G1L A;  3CCY A;  3H1C A;  4XBF A;  5B1B H;  1OR7 C;  5K7F A;  4RLQ A;  3L2R A;  1S6L A;  3BWG A;  3W2W A;  4HW0 A;  2XGD A;  2CH0 A;  4FX4 A;  1YO5 C;  4BBS J;  4UUS A;  2XIG A;  3SQN A;  2OJE D;  2IA2 A;  2MW8 A;  1IUY A;  2HVR A;  1WH5 A;  5J1U A;  3OIP A;  2O3F A;  3R60 A;  1H8A C;  1QBJ A;  1JGS A;  5E79 C;  3KET A;  1WJF A;  1B4A A;  1R00 A;  2DA1 A;  2YX7 A;  3AG1 H;  2VBY A;  3AFH A;  4M73 A;  1OCO H;  5KCM A;  1IC8 A;  5HS7 A;  4KT6 A;  1ZR4 A;  3I71 A;  2VBX A;  1FJL A;  3TOA A;  2HVS A;  4KMU X;  2DTZ A;  1JKQ C;  4PGH A;  3K4C A;  1TNT A;  4R79 A;  1FZP B;  5GP9 A;  2EV0 A;  4UV9 A;  4Y7N J;  2HDW A;  4MIM A;  3BDD A;  1L3L A;  1TC3 C;  3QYB A;  1T33 A;  2QKL B;  4RS8 A;  4Q4Z F;  4UUS B;  4U7B A;  4HF1 A;  3J7A Y;  1TL8 A;  1R1U A;  2K9N A;  2JTV A;  3DWL E;  3K70 C;  4RAG A;  1XDU A;  2DLL A;  5KHD A;  1VFC A;  4IHV A;  3GBG A;  2NAZ A;  3CCL I;  4HV6 A;  2H1K A;  3QP6 A;  5D5W B;  1IF1 A;  4MEY F;  1MND A;  1IGN A;  1W0U A;  4PSX A;  5K5O A;  1IN7 A;  2P5L C;  3TW7 A;  2EV5 A;  3N4M A;  2WY8 Q;  2JRM A;  1C0W A;  2PJR A;  4CDG A;  5E8I A;  3VDX A;  5HLH A;  2NRA C;  3H3Z A;  3OYG A;  1LVK A;  3BR5 A;  1RR7 A;  3D5S C;  4IHS A;  3E1S A;  1XMA A;  3AAF A;  4WXD A;  2NVY J;  1PP8 F;  3BT9 A;  2NNY A;  2XKO A;  4MTE A;  2Y0S N;  3P9I A;  5HNH A;  4G6D A;  4KIB A;  2B9S A;  3HB9 A;  2R3S A;  2LBF B;  5L3E A;  1IJW C;  1XN7 A;  2A5Y B;  2ZME A;  3CP8 A;  2K9S A;  2ID6 A;  2QSF X;  1TBX A;  1ZK8 A;  2H1L A;  4J19 A;  4PJN A;  4KDP A;  2CO5 A;  1QZE A;  3G1O A;  2EIN H;  4IL6 C;  3OYC A;  1U9O A;  5FKM A;  4C2M J;  4HNT A;  1X2N A;  2UXX A;  4BY7 J;  2XAF A;  3EUK L;  1I27 A;  5C3E J;  3HOV J;  1MSE C;  3BQY A;  1GVJ A;  1KU9 A;  2VKH A;  4E7L A;  2VB6 A;  3IP4 B;  4H0E A;  2XAH A;  1BW6 A;  5ILV A;  1BI0 A;  1MZB A;  1ODD A;  4MHG A;  3P9C A;  5FD6 A;  1RRJ A;  1DU0 A;  1VQ4 I;  5EEA A;  1XD7 A;  3FK6 A;  3J7Y J;  4M9X A;  4XKB A;  3DLA A;  3GZN B;  2R7U A;  1R4N B;  2XRO A;  4A3G J;  4UB8 C;  1G3W A;  4BJ6 C;  4BL0 B;  3TW6 A;  4CZC A;  1SD4 A;  4HX7 A;  4HLY A;  3N97 A;  3DKX A;  4DIQ A;  5EDN A;  3FZV A;  1ONV A;  1TTY A;  2DK5 A;  1Z05 A;  3U21 A;  4E7J A;  2VPR A;  1JJ8 C;  4Y13 A;  2IXS A;  2H94 A;  3S8P A;  1F9N A;  1XS9 A;  3BJ6 A;  3C2G A;  4AUX A;  1DDN A;  3LL7 A;  3S1R J;  1RUO A;  1DGW Y;  4RM3 A;  3CUQ B;  1VQ7 I;  1HDP A;  3TO7 A;  3A01 A;  3W6K B;  2L7F P;  3HRU A;  1P7J A;  2JA5 J;  3H5R A;  4OIN F;  5DCM A;  4WCG A;  4FQG A;  2K27 A;  3GFL A;  1AKH A;  2HPI A;  1XGN A;  5IOZ A;  1JHH A;  5JVG F;  5FRM A;  5CVJ A;  1TW2 A;  2PMH A;  3T1B A;  1QPI A;  4RDU A;  3LA2 A;  3FF5 A;  1F5T A;  4YIR X;  2A69 F;  1IRG A;  2ME0 A;  3GO5 A;  3HG9 A;  2DDB A;  1HC8 A;  2IBD A;  3GME A;  2ZJQ F;  3Q3S A;  4W1U A;  2OZ6 A;  4M74 A;  3VFZ A;  2OTJ I;  1XGS A;  1A5J A;  3K4L A;  4IHT A;  3GFI A;  3WU2 C;  1BL0 A;  2DN0 A;  3KZY A;  2M0M A;  3OYN A;  3KZI C;  3KEO A;  3MD2 A;  1P9Q C;  5FJ8 J;  2ESH A;  4HST A;  1ZRF A;  2Z16 A;  3S1Q J;  2XB5 A;  1KQ9 A;  3F3X A;  1FNN A;  3JSP A;  3L2U A;  2ELJ A;  3K0L A;  4FCY A;  4JQF A;  5B66 C;  5TIS C;  4C9Y A;  2LFB A;  3HOX J;  1A6Q A;  5E1Z B;  3RQI A;  2CFX A;  3KYD B;  3Q9S A;  3ZGK A;  3BG5 A;  3J7A O;  2CWE A;  3QYF A;  4CCN A;  1MBG A;  4IVN A;  2ZCW A;  1YOV B;  4P9F A;  2M3A A;  3CDI A;  2O9L A;  2XSD C;  3CCQ I;  5BQT A;  2PJP A;  1BI1 A;  1KU7 A;  3MKZ A;  2MSY A;  3DPL C;  3OYE A;  1W36 C;  2CV1 A;  5HDG A;  4Y3O A;  5LHH A;  1R1V A;  4YIF A;  2DMP A;  4DJA A;  1LVA A;  4NC6 A;  3GTK J;  3K4N A;  3WHC A;  5TJJ A;  1JUP A;  5DTD A;  1RKW A;  2ELH A;  4M6X A;  3REO A;  4F55 A;  4M71 A;  4JX6 A;  4NBQ A;  3ASO H;  4JYK A;  2EFP A;  3V8J A;  3PFY A;  2V79 A;  3LFK A;  4A3J J;  1K6O A;  2O5R A;  3CDL A;  3WOD F;  2M9H A;  2F5V A;  3LSJ A;  5HDN A;  2R7V A;  3HOZ J;  2LC2 A;  3C2B A;  1VQK I;  3BG9 A;  3S17 J;  1PDN C;  1MBH A;  1YS6 A;  2PMZ N;  1S7O A;  5B1A H;  3I4N J;  3P7N A;  1N77 A;  3IH4 A;  1XX5 A;  2LF7 A;  4IJA A;  1HW2 A;  1UG2 A;  2PBI A;  5H2F C;  2OQG A;  5C4X J;  1Y0U A;  1WSU A;  5FFX A;  3Q9V A;  2XV4 S;  2K3F A;  2DFE A;  2Y0S A;  5F6F A;  2GOM A;  4QIW N;  2QLZ A;  4BDZ A;  5BPI A;  2BHZ A;  1Z21 A;  2VON A;  1BC7 C;  4IQJ A;  5DM7 F;  1FPQ A;  4HPQ A;  1GUU A;  4Z2Y A;  5L3F A;  3GTM J;  3DU6 A;  4XID A;  1MGT A;  1K4S A;  5H20 A;  2CSO A;  2W85 A;  3TQN A;  5F1J A;  1DP3 A;  2OAZ A;  2Y31 A;  4B3A A;  3LSG A;  4FET A;  1T56 A;  2ID3 A;  2VIX A;  5JHF A;  3GLL A;  3FWE A;  5KAI C;  1W1W E;  3ABK H;  2TCT A;  2QA4 I;  1F43 A;  1YIT I;  3WTV C;  1V55 H;  3S1N J;  1FIP A;  1XG1 A;  3GYH X;  1E17 A;  3MVP A;  2DMQ A;  1YI2 I;  2B0L A;  3PUF A;  5LFA A;  1J0R A;  2HZD A;  1VQ9 I;  2DOF A;  4BHB A;  2I5U A;  2ZJ2 A;  3H3U A;  1M1E B;  3G6E I;  1ZAO A;  4MFE A;  1LE8 A;  1ZN2 A;  1MSF C;  2LG4 A;  2DA6 A;  1RC9 A;  3BR3 A;  4ZYG A;  5BS6 A;  5LGU A;  2M2E A;  1F4K A;  3RPU D;  1G3S A;  5ILU A;  4D1Q A;  5E17 F;  2FBI A;  3G1M A;  3Q0U A;  2QSH X;  2R93 J;  3EUH A;  3FMS A;  2EZK A;  3VPR A;  1EKE A;  2WAF A;  5FKN A;  2P7C B;  4S0H B;  2BXZ A;  3EPZ A;  3FMQ A;  3L1P A;  1W7P B;  2HYJ A;  3BG6 A;  4LMY A;  2DI3 A;  4UUT A;  5L3C A;  3JRI A;  4U0W A;  5HOD A;  1V5F A;  2ZNZ A;  2EWN A;  3A03 A;  5LLQ A;  4XIC A;  5LEJ A;  2X0L A;  2YX4 A;  3UR3 C;  2EIM H;  2QF7 A;  2IAI A;  2F4O B;  4RAY A;  1J09 A;  4F93 B;  1Z7L A;  3DEW A;  4ZDP A;  3VYU B;  1FOX A;  2DPD A;  3COA C;  3JRE A;  2GA2 A;  4JBA A;  3HOT A;  5EEH A;  5K7Z A;  2PX9 A;  1BOA A;  3V42 A;  2FD5 A;  4Y52 J;  1YE9 A;  2FA5 A;  4CHU A;  3PNV A;  2LLK A;  3K4M A;  2VKE A;  3M4O J;  1NTC A;  1APL C;  3DFG A;  2MH9 A;  3FXL A;  2L5Q A;  4IEJ A;  2JSP A;  4A3I J;  4NQW B;  1MDM A;  2L4A A;  2VOD A;  2DMN A;  2LRD A;  2KIQ A;  3SDG A;  5CJ9 A;  4BHC A;  2QKM B;  2FNA A;  4IRI A;  2V4J C;  1PVE A;  2MAB A;  4W97 A;  1DPR A;  3VOE A;  4DYQ A;  4GYI A;  3OYH A;  9ANT A;  3OYL A;  1MJA A;  4E4H A;  1ZH5 A;  4HDV A;  3QPH A;  2P7V B;  2IGO A;  4YFX F;  2DA2 A;  1RPW A;  1K7A A;  2CW8 A;  3F22 A;  3PIP F;  2DFI A;  2MGQ A;  3WTS C;  4ZTF A;  2ME6 A;  1ON2 A;  3OOP A;  4QPQ A;  1T8I A;  1OPC A;  1GHC A;  1HCR A;  3DBL B;  4UVB A;  2LKP A;  1YTY A;  4AM3 A;  2G9W A;  2CS3 A;  3AKZ A;  2M0C A;  5FLX Z;  2HYF A;  3S2H J;  2L9N A;  2X6Y A;  2ZB9 A;  3DF8 A;  3KLO A;  5DD4 A;  2BW3 B;  3FKJ A;  3PNT A;  4LIV A;  3FIW A;  3BTJ A;  4Z6Y A;  3S2W A;  3CO6 C;  1GT0 C;  4DGW B;  3QPT A;  2MA3 A;  1O3R A;  4WXC A;  4LG3 A;  1U9N A;  4HQE A;  1R36 A;  1SD7 A;  2PQ8 A;  1UEL B;  2FEZ A;  1X2M A;  2TRT A;  4BJT A;  2Y2Z A;  2Z2S B;  3DTE A;  2KIU A;  1YJ9 I;  5IT3 A;  1WJ5 A;  1TW3 A;  4BJ5 C;  4ETS A;  3DEU A;  1QVU A;  2EBI A;  2F48 A;  1I6H J;  3TP0 A;  1GLN A;  3F8M A;  2DA5 A;  1IXS B;  2V6E A;  1S7E A;  3MZY A;  2O61 A;  3VYS B;  2BHY A;  3WTU C;  3ZN0 A;  1JT0 A;  4E70 A;  3LSI A;  4MFD A;  4ZZD A;  4CSW A;  1HXD A;  5JFR A;  1TWG J;  1W5S A;  2FBK A;  4UNO A;  2KDZ A;  1V3F A;  2RQQ A;  1SEU A;  1XMK A;  5F04 A;  5D6E A;  4A0Y A;  3QPS A;  1IZ1 A;  4WXH A;  1OCP A;  1QVT A;  5FLX K;  1MW7 A;  4EV0 A;  5HLT A;  1BR1 A;  3PSF A;  1K78 A;  2R4G A;  1ETW A;  1YQA A;  1V4R A;  2JWT A;  2OTL I;  5D4S A;  5IPA A;  2VJJ A;  3M1C A;  1D5V A;  2ICW G;  4NHJ A;  4JP0 A;  4IHX A;  1I1S A;  2FE3 A;  2XPU A;  4ZYD A;  3B02 A;  4U7D A;  3DPU A;  1LDD A;  5J1Y A;  3CCM I;  2RC4 A;  2ISY A;  4XKC A;  3CJN A;  2OD5 A;  2IP2 A;  2IS2 A;  3GXO A;  1BA5 A;  1T38 A;  1MBE A;  5JLX A;  3IKT A;  4KN4 X;  3QU6 A;  3IWF A;  4FIS A;  3RPU A;  2AXL A;  1ZRE A;  2M30 A;  4RAF A;  2DFH A;  3M8E A;  1IXC A;  1J5Y A;  4PJJ A;  2QQA A;  1XB4 A;  2P81 A;  1TQP A;  4CCM A;  1TLH B;  4G94 A;  2L02 A;  4XKV A;  5D6F A;  2D45 A;  5E1X A;  3LAP A;  3JRA A;  2WV0 A;  4KA4 A;  1XSV A;  3NAR A;  3DXJ F;  5BMZ A;  1IV6 A;  5IOY A;  2ESN A;  4A3B J;  3SYT A;  3IRR A;  2EFO A;  4DYR A;  1QQI A;  2GIZ A;  3BJO A;  3ASN H;  3IAM 2;  3PNY A;  5IYD J;  2ZKZ A;  2X1E A;  3ECH A;  5TRD A;  3DBR B;  3DU5 A;  4G7Z F;  2DMU A;  2PFB A;  2EIJ H;  3FBI B;  1NG6 A;  4HAM A;  3IKV A;  2XB0 X;  3RIR A;  2VLA A;  3GZ5 A;  4KMF A;  4EM2 A;  3HOU J;  3FM5 A;  1O57 A;  5ERI A;  4P96 A;  2D5V A;  1ZYR F;  3GTQ J;  1L0O C;  2LDU A;  4EEF G;  2L2O A;  2QVO A;  4XON A;  4PJ0 C;  2V1D A;  4PUS A;  3O8H A;  5F0H A;  3OS0 A;  3MMY B;  5F08 A;  1REP C;  4YRV A;  3JTH A;  1FYL A;  2NS8 A;  5J40 A;  3CUQ A;  1SVO A;  2JQ7 A;  3FM3 A;  2EIL H;  4BE1 A;  2ACJ A;  3VYR B;  2NYX A;  3FHZ A;  4BE0 A;  2UZK A;  1BI3 A;  4HNV A;  4TV7 A;  2JVG A;  2W24 A;  3Q5F A;  1MKM A;  5K5R A;  4ZYA A;  5D8K B;  1TWH J;  1TQI A;  3ZMU A;  4GCV A;  1VQ6 I;  3HKZ N;  3TGN A;  3BCB A;  2LMD A;  2CQ7 A;  2DT7 B;  4M3E A;  3WTW C;  4ENK A;  1RR8 C;  2BXY A;  2IT0 A;  3F8N A;  1BIA A;  2P6S A;  2EZH A;  5B5E C;  3CO7 C;  2KKO A;  2A07 F;  2FJ1 A;  2HGC A;  1XMX A;  4C2T A;  2AQE A;  4AYB N;  5FD5 A;  1ETY A;  1CF7 A;  3KP6 A;  4RMN A;  4HX4 A;  2YUS A;  2R7Z J;  4D5C A;  1I5Z A;  2A6H F;  2JSC A;  4DZP A;  4L9V A;  4A3C J;  1B8I A;  3E6D A;  3BTI A;  4FT8 A;  4F92 B;  4A3D J;  1IW7 F;  1RIO H;  3QOP A;  3VB2 A;  2ZXI A;  4AVZ A;  1A35 A;  3JR9 A;  1HF0 A;  5FRN A;  5E18 F;  2R5Y B;  4JOM A;  2CUJ A;  2VKD A;  3NEU A;  4UHT A;  4N4O B;  1WI9 A;  3SEZ A;  5E1W A;  3HOY J;  2E7W A;  1KYZ A;  2Z99 A;  4G7O F;  3K7A J;  4S05 A;  3C3W A;  1QA6 A;  4XOT A;  5LRR A;  3AL0 C;  2EFW A;  4XRF A;  5IYB J;  4M3D A;  4AVP A;  1FC3 A;  2QEN A;  1D1A A;  4LLL A;  3MKL A;  3A2K A;  4NQW A;  3QOE A;  2NNN A;  3M8F A;  3H9G A;  3ONQ A;  3T0Y A;  1HSJ A;  3DV8 A;  1QNT A;  4L18 B;  2YS9 A;  4HBL A;  3OS2 A;  4XMY A;  2R5Z B;  1LB2 A;  1E2X A;  1ZG5 A;  2PEX A;  2MG4 A;  3FIS A;  2F4M B;  1WHU A;  2J5O A;  1HKS A;  4A2U A;  2STW A;  1MD0 A;  5B3S H;  2N8G A;  2QGU A;  4LLN A;  1ZGW A;  1OLT A;  3F72 A;  4R8H A;  2STT A;  4AWX B;  3HBL A;  5K7H A;  3GTG J;  2RGV A;  2FF4 A;  4XLE A;  1IN8 A;  3TP3 A;  4E7Z A;  2GLO A;  3BZ6 A;  3RKW A;  2OBP A;  5LGN A;  3E7L A;  5GPC A;  4CA0 A;  5J4V A;  2G7H A;  3HYI A;  2XRL A;  3BLY A;  4WWC A;  1O3S A;  3W2V A;  1UFM A;  4CCO A;  1VQM I;  1K61 A;  3DCF A;  2R7O A;  3BRO A;  2ZSH B;  2FRH A;  5M5X J;  1T2K A;  3I64 A;  2IW5 A;  1VQL I;  2KIM A;  1P6R A;  1XGM A;  1OFC X;  4XK4 A;  2CGP A;  3ZPL A;  3FXO A;  1MBF A;  2KHM A;  2D1V A;  1R5G A;  5C44 J;  4RLF A;  1GV2 A;  1SFK A;  4CXF A;  3RKX A;  4D5F A;  5FO5 A;  3E5U A;  3K10 A;  4KYW A;  2VC0 A;  4EGZ A;  1KU2 A;  2L9S A;  2P5K A;  4KNY A;  2GQQ A;  2HZT A;  2ADU A;  1AU7 A;  3S16 J;  3HDD A;  4LG0 A;  1TNS A;  3KX2 A;  4A6D A;  3M3Y J;  2LY1 A;  4Y17 A;  5CVR A;  2V9K A;  1P2F A;  3GUD A;  2DK8 A;  3CCR I;  1U6G A;  2HOT A;  5FKK A;  1X3U A;  1WCM J;  4KT5 C;  4XNF A;  1WKM A;  5JHU A;  3KEY A;  5LD2 C;  2V1U A;  5CLS A;  3V7S A;  1ITY A;  4XRS G;  3PFI A;  3M8J A;  3PJR A;  1EH6 A;  1HA8 A;  1T08 B;  1WVR A;  4RM2 A;  3E5Q A;  4M6V A;  5IP7 J;  1D1C A;  1MNM C;  3HSE A;  2UXN A;  4CZZ A;  4IHW A;  3RQ4 A;  1CGP A;  4U88 A;  3QOD A;  1X1B A;  4BBR J;  1FY7 A;  3DQV C;  3JTG A;  2W7N A;  1LDK B;  3F8B A;  2E2I J;  3WU1 B;  1OCT C;  2Y69 H;  5DUK A;  2BW3 A;  4RGX A;  4DOZ A;  5F1R A;  3MFK A;  3ML6 A;  4FE7 A;  4CCL A;  2EB7 A;  2M7B A;  2VQG A;  1JGG A;  2MLG A;  3S2D J;  3BP8 A;  3G71 I;  5DS9 A;  2HXO A;  4BEH B;  2IGM A;  3CP2 A;  5M3M J;  5JLW A;  3RYR A;  1R22 A;  3F23 A;  4J00 A;  4GYG A;  2JJ7 A;  2K5C A;  4V2G A;  4XKW A;  4B8X A;  3OS1 A;  1LE8 B;  3FDY A;  1YRN B;  1VZ0 A;  2NVQ J;  2HOE A;  1XTA A;  4CYC B;  1AA7 A;  3I54 A;  2QEX I;  2LK2 A;  2M87 A;  2CUE A;  3LSP A;  3ZQF A;  3HOS A;  3JRG A;  2ZME B;  3JAM Z;  2FMY A;  5IY5 H;  5EGO B;  3S15 J;  1UCR A;  1NK2 P;  3OOU A;  4MNU A;  3KP7 A;  5E3M A;  2MLK A;  1MBK A;  2EFQ A;  1UHM A;  3G73 A;  1HW1 A;  2IVM A;  4F7Z A;  3J80 K;  1UG0 A;  2JMW A;  4LB6 B;  1PUF A;  2E1N A;  1F36 A;  1YS7 A;  1MDM B;  2BVM A;  2WV1 A;  3FBN B;  2DT6 A;  3BZK A;  3HPG A;  2QBY B;  1OYW A;  5D8L B;  3KEQ A;  3PQJ A;  1IV8 A;  4E7H A;  1WJA A;  2VBZ A;  1UHW A;  2HFH A;  2COM A;  4C3I J;  4IO9 F;  4V19 K;  1WJC A;  4XLF A;  3WHB A;  1G6N A;  3MKY B;  4ZH4 F;  1G4D A;  4PZJ A;  2M4K A;  2F5F A;  4CO8 A;  2XDV A;  1FBS A;  4EJU A;  1K6Y A;  2NOJ B;  2YR2 A;  3H35 A;  2L54 A;  1Y8R B;  1EA3 A;  5EG0 A;  1JKO C;  3HOW J;  3CUO A;  3RPQ A;  3ERM A;  4LD5 A;  3C1D A;  5IYC J;  3CLO A;  5A2Q K;  4XLN F;  1ZRD A;  1D8J A;  4CH7 A;  2BY3 A;  3I4P A;  3U2R A;  4NNJ A;  3FXK A;  1JJ6 C;  1S29 A;  2VJI A;  2KRC A;  1YW8 A;  3IWZ A;  3KIO A;  2DTR A;  2ZSI B;  3PSI A;  2XKP A;  3JAM K;  3L2Q A;  2R7R A;  3HXL A;  1Z9C A;  3AG3 H;  2KP6 A;  4H4K C;  2V1X A;  4QPO A;  4ASN A;  3RKQ A;  1O7L A;  4BY1 J;  1R58 A;  1YW9 A;  4GFB A;  4D7M A;  3FXQ A;  3ZQ7 A;  3CC4 I;  2O03 A;  1EF4 A;  3TDU C;  1U8R A;  3HUG A;  1KON A;  3SDB A;  4O6J A;  2VJ4 A;  4E7S A;  3V8K A;  4BXX J;  2OC6 A;  4XLH A;  4OMZ A;  4XR6 A;  4G9Y A;  2Z3Y A;  4K2E A;  2OA4 A;  2PN6 A;  1OYY A;  3HIF A;  4YFN F;  3E6B A;  4BH9 A;  3OYB A;  3K4B A;  3VWB A;  1Y39 A;  3ABM H;  4XN0 A;  2HPM A;  3OWT A;  2VKV A;  1QU3 A;  1G8X A;  4PDK A;  3RYP A;  4MO7 A;  2E19 A;  3SFI A;  1Y6I A;  2XUB A;  3WTY C;  2AS5 F;  2OV7 A;  1ETV A;  4EM1 A;  2L9R A;  2CQX A;  1FBU A;  1V54 H;  2FXA A;  2Y30 A;  3F6O A;  3H92 A;  1BW5 A;  1MMN A;  2X6W A;  3CLQ A;  2Y48 A;  3HRM A;  4NB5 A;  1OKR A;  3GFJ A;  5AON A;  2VI6 A;  3CJR B;  4I76 A;  3OYD A;  1PUE E;  3RI4 A;  2ZC2 A;  2Z33 A;  1ENH A;  2IPQ X;  3OYM A;  2QBY A;  2KLO A;  2H6C A;  4UV8 A;  2VXZ A;  1T0F A;  1T0F C;  3K6G A;  2CQQ A;  2DJI A;  4AIJ A;  3OR1 C;  4WX9 A;  2NXN B;  2EQR A;  5M5Y J;  3WGI A;  2DAO A;  3L9F A;  3P5J A;  2YU9 J;  4ABZ A;  4PJL A;  1Z1D A;  4IOA F;  5DV5 A;  3PIO F;  3CUQ C;  4GRI A;  1HKT A;  5IT9 K;  1AKH B;  4CYD A;  4BU2 A;  1IRF A;  4RGS A;  4GGG A;  4RA2 A;  4ENN A;  3H5A A;  3TBI A;  3RCO A;  2LBF A;  2JA6 J;  2NVU B;  1O3Q A;  3CCU I;  3PO3 J;  3FXM A;  3M7G A;  1BIB A;  2ECB A;  2E2H J;  2FQ4 A;  1Y1W J;  2Q2E B;  2P8T A;  3JRH A;  4L9J A;  3H9J A;  3WTX C;  3LWF A;  1A36 A;  2E1O A;  2LH9 A;  2CQK A;  1ETK A;  1IG7 A;  4HSR A;  5BNG A;  3NQO A;  4AYB A;  2VQL A;  3E6M A;  2Q1Z B;  2QCO A;  4M9S A;  5FRO A;  3H0G J;  3I55 I;  4HG2 A;  3K1M A;  2KJB A;  2XGX A;  2WB1 N;  4I6Z A;  2GAU A;  4BHP A;  1X19 A;  1OCR H;  4N9H A;  5HLG A;  3FHN A;  3DKW A;  3OL3 A;  1NHA A;  4M9Z A;  3RSN A;  2QM3 A;  4L0Z B;  3FXU A;  4KIS A;  3L2C A;  3WTZ A;  1SVL A;  3LA3 A;  5E3O A;  2YSR A;  3K69 A;  2H6B A;  4DNC A;  1RZ4 A;  3Q0W A;  3KPH A;  4A5M A;  2CFO A;  3CTA A;  1I39 A;  1TQM A;  1IUF A;  3BY6 A;  2H8R A;  4HRI A;  1JI8 A;  4RB0 A;  2OCE A;  1SC7 A;  1ACI A;  2RQP A;  5CYV A;  4UVA A;  3DTI A;  3ERE D;  1S72 I;  2DU9 A;  1TP4 A;  3W6J B;  1FT9 A;  1LFP A;  3CJT B;  3W2A A;  3JCU C;  4HA8 A;  4C2U A;  2VOO A;  2OQR A;  2DA3 A;  2DJN A;  2V1N A;  4X0G A;  2BBY A;  1T39 A;  4ENM A;  5FLV A;  3LQR A;  3G2B A;  4B4C A;  4P1W A;  1CF7 B;  4MLO A;  3NWT A;  5CPR B;  3W3C A;  4J01 A;  3CC2 I;  3O2P E;  4A12 A;  1Y8Q B;  2M8E A;  2QYO A;  1GDT A;  3RJP A;  2LNB A;  3WG9 A;  4PGG A;  4YG2 F;  3B6A A;  1FOK A;  1T6S A;  4A93 J;  4AD9 A;  3K1P A;  2IGN A;  3I0T A;  2F4I A;  1XSD A;  1W5C C;  3HTS B;  2F2E A;  4I99 C;  2KDO A;  3Q0V A;  4XM3 A;  4XSX F;  4AIH A;  1J2X A;  5LHI A;  3OV8 A;  3GZ6 A;  5D5V B;  1PJR A;  4RB2 C;  4L0Y B;  1R5H A;  4CCK A;  5J4Y A;  5EG0 B;  2DXI A;  4L9T A;  4BAC A;  2RNG A;  1ZKG A;  1D5Y A;  3DPT A;  4JX5 A;  4ZYE A;  3WGH A;  2K3P A;  2ZO4 A;  4OWR B;  2WBM A;  1YW7 A;  4EJT A;  2EZL A;  4XRM A;  1UAA A;  1E3O C;  3CME I;  3NAU A;  5DDG A;  4OU0 A;  1U3E M;  2JA2 A;  5D5U B;  2R0Q C;  2RKH A;  2R5Z A;  3R61 A;  4Y33 A;  5C4J J;  4ESB A;  1HDD C;  2IJL A;  3T5X A;  2L01 A;  5CVU A;  1U0J A;  2PMU A;  1ZAR A;  4BE2 A;  4YFK F;  3QQA A;  1K78 B;  1J59 A;  2O7O A;  2HKX A;  3LSM A;  1FP1 D;  3S3N A;  3ULQ B;  2NVX J;  1GXQ A;  2R7Q A;  2R7T A;  1N75 A;  2KRH A;  3K2A A;  1JKR C;  3MQ0 A;  4FHT A;  1KA8 A;  2FSW A;  2MD5 A;  2XAG A;  3LST A;  3GLX A;  2XPV A;  1ZLK A;  2HWV A;  2KMU A;  4A3K J;  5H6R A;  4PK4 A;  2BY2 A;  3BOQ A;  5J3L A;  2NOG A;  2HOS A;  1X1D A;  2A05 A;  2A5W A;  2M8G X;  4XL9 A;  4ZJZ A;  1R4M B;  3JRB A;  3S3O A;  1QPM A;  3GWZ A;  5JVT A;  2ZXW H;  4RB1 A;  2FUG 2;  2WWY A;  1YIO A;  1D1B A;  4LOC A;  4KUM A;  2LKS A;  4A69 C;  4NC8 A;  4RB3 C;  3OYI A;  1FTT A;  4KFC A;  2WB1 A;  4UVC A;  1YHQ I;  3C2H A;  3F8F A;  2PI0 A;  3R6S A;  3J80 Z;  1H9G A;  2FX0 A;  3L2W A;  4YEL A;  2RRE A;  2X6X A;  2VAS A;  2R7S A;  3I9V 2;  3VYT B;  5ICE A;  1ZEL A;  3V8L A;  4LLG F;  3QWL A;  1X3W B;  2HU9 A;  1JUS A;  3D5L A;  4JX4 A;  3V4G A;  2K9M A;  4UXN A;  3VOD A;  1BJZ A;  3A0B C;  1SAN A;  3LOC A;  4G6Q A;  4KIG A;  3ISP A;  1RUN A;  4FAS D;  2K9Q A;  2IS1 A;  1LPQ A;  1RI7 A;  1H0M A;  2HQ5 A;  4GXO A;  1PP7 U;  1Y1V J;  2RDP A;  1FTZ A;  2EA4 A;  1B6A A;  2E5N A;  2W1O A;  1EV7 A;  4L5E A;  4BGD A;  4CIC A;  3RZD J;  1FMW A;  1D3Y A;  1WJE A;  2XPW A;  2CV0 A;  3QAH A;  2CMP A;  3ZQC A;  5KAF C;  5ILS A;  1PUF B;  1FEX A;  3L00 A;  3O6B B;  3OL4 A;  2BV6 A;  1HOM A;  1MMG A;  1IDY A;  1B72 A;  4L9N A;  1SMY F;  1WFX A;  2DA4 A;  2LD5 A;  2X48 A;  4XN3 A;  2EH3 A;  3LNQ A;  1NK3 P;  2LY2 A;  4BQN A;  4CUG A;  3CQZ J;  2KJC A;  3R0A A;  4DBQ A;  1D0Y A;  3FX3 A;  3HPH A;  1BOB A;  4ZYH A;  1N25 A;  2KIF A;  2DDA A;  4HEA 2;  3LSK A;  1FLI A;  3V7C A;  2KFD A;  2OPT A;  3TDZ C;  1DUX C;  1UST A;  3CMM A;  1QRY A;  3AL0 B;  3GTP J;  2HS5 A;  5HS8 A;  2MH2 A;  1LJ9 A;  1LQ1 A;  3LAJ A;  2WC2 A;  4BQO A;  3BG7 A;  4EVI A;  1SFU A;  2HXI A;  2M45 A;  1JXS A;  4OAZ A;  3OIO A;  3MKW B;  2L7M P;  2DQR A;  3K9T A;  1K4T A;  2MBF A;  2E34 A;  1KQ8 A;  3R4K A;  1UHS A;  3JRC A;  3M07 A;  1Z7U A;  2UV1 A;  1SMT A;  4M3G A;  2L9V A;  3UNG C;  4ZZL A;  4EJV A;  5J8C A;  3I56 I;  2WTE A;  3L7W A;  2CRG A;  3E97 A;  1G2H A;  4HF0 A;  4PCQ A;  3HUG B;  2DPU A;  2ZJP F;  3RZO J;  2Z1D A;  1SAX A;  2HTJ A;  3M1E A;  4NC7 A;  3IL2 A; 
#chains in the Genus database with same CATH homology
 4KN7 X;  4QWQ A;  4EJO A;  4HDU A;  2FOK A;  4GO1 A;  3DP7 A;  5IT9 Z;  2F5E A;  1BC8 C;  3I53 A;  2Z9O A;  3ELK A;  2JT1 A;  1G3T A;  2QUF A;  2IRF G;  1S7A A;  1BI2 A;  4JK1 X;  4HX8 A;  2HQR A;  2JPB A;  2RVC A;  5FB2 A;  5JR3 A;  5HDK A;  3SFZ A;  6PAX A;  3ZMT A;  2K86 A;  1SD6 A;  5HOO A;  1ZRC A;  4B09 A;  2BGC A;  4O5V A;  2UWM A;  3EYI A;  5D4R A;  4A0X A;  3ZMV A;  1HST A;  1U5T C;  2CYY A;  4LFU A;  1QZZ A;  2RV8 A;  4ON0 A;  1XCB A;  1AOY A;  1BN5 A;  5LEK A;  4Q5S F;  4MTD A;  4A0Z A;  4LG0 B;  4KIF A;  4XLP F;  1ON1 A;  2XVC A;  1U5T B;  2K4J A;  2P6T A;  2EK5 A;  4G8X A;  4XSZ F;  3ECO A;  5CVV A;  2VE8 A;  4M6Y A;  3T8T A;  3KP4 A;  2RNJ A;  2D2W A;  2ZXJ A;  4BYY A;  2Q0O A;  2F5D A;  2TDX A;  1IAW A;  1SFE A;  4ENJ A;  3D0S A;  2F5C A;  2HQN A;  5DCF A;  2IA1 A;  5CVI A;  3VEP A;  3GW2 A;  2PLY A;  2Y75 A;  4FX0 A;  5L3D A;  1YG2 A;  4RGR A;  1RNL A;  3LQQ A;  4EQQ A;  2W84 A;  2W25 A;  4I02 A;  1YLF A;  5ICF A;  2FML A;  2A3S A;  2LF8 A;  3J81 Z;  1I1G A;  3GF2 A;  1P4A A;  5HLI A;  4D0P A;  2OZU A;  2HR3 A;  2P5V A;  1R23 A;  2BE5 F;  1SFX A;  2JRT A;  3F6V A;  1HBX G;  3E6C C;  4HF2 A;  3TKY A;  5L3G A;  2W57 A;  1R1T A;  5KK1 A;  1OYI A;  3BJA A;  4Q47 A;  2CW0 F;  3JSO A;  3ABT A;  1W5T A;  3QU3 A;  4L5I A;  1ZGJ A;  1ZG3 A;  3KLN A;  2GXG A;  2FBH A;  1Z6R A;  2XHK A;  3EYY A;  3RDI A;  1KGS A;  5K5Q A;  5FGM A;  1STZ A;  2H27 A;  3R0J A;  4I09 A;  4UUV A;  4WF2 A;  2ZFW A;  4A6E A;  1LNW A;  3J81 K;  3HRT A;  2VT3 A;  1WQ2 A;  3TO6 A;  3K2Z A;  2R7F A;  5LBQ A;  5A2Q Z;  4BXU A;  2DW4 A;  5DEQ A;  4CGZ A;  1B1B A;  3U9G A;  1GXP A;  1ULY A;  4AIK A;  3PQK A;  2V9V A;  1XSX A;  5H6Q A;  2HDC A;  4KIC A;  3GVA A;  3LA7 A;  5F64 A;  3WE3 A;  1UB9 A;  2X4H A;  2DT5 A;  1R7J A;  4N9I A;  1I6X A;  2MC3 A;  3E5X A;  2JZY A;  4O3M A;  4OMY A;  1U5T A;  1YFH A;  3C7J A;  2KRF A;  2Z5U A;  3T8R A;  4OIP F;  1W7P A;  4P5O A;  1Z91 A;  3EET A;  3MZH A;  1HQC A;  1LDJ A;  2YPR A;  2QZ8 A;  2QQB A;  5LGT A;  5DUI A;  2EV6 A;  2VBW A;  3I5U A;  1H9T A;  4R1H A;  1J75 A;  3SZP A;  2GA1 A;  5LRS A;  5DCM B;  2V6C A;  3P9K A;  4OIR F;  2HYG D;  1DP7 P;  2OU2 A;  3GX4 X;  2GIV A;  3HHG A;  4MQ9 F;  3KZZ A;  3CDH A;  1S3J A;  2L4M A;  1G3Y A;  3U1D A;  2ISZ A;  2FQ3 A;  2BEO A;  2DQL A;  2Q2E A;  3FXR A;  2O8X A;  1O7F A;  2XRN A;  4L5J A;  5EEG A;  1ZG1 A;  4A5N A;  5ICG A;  1EH8 A;  2EA2 A;  2HTS A;  2XAQ A;  4OIQ F;  4DQ2 A;  5K1Y A;  5BPD A;  4Y15 A;  4I0B A;  1QO0 D;  1XCV A;  3HSF A;  4EM0 B;  3GFM A;  2IA0 A;  2Q8K A;  2HEO A;  1FX7 A;  3E3V A;  2XAJ A;  3JW4 A;  4Q48 A;  3B73 A;  2A61 A;  2JPC A;  5FFZ A;  4U0V A;  3I59 A;  3KCC A;  1HW5 A;  1T98 A;  3MAJ A;  4IF4 A;  5KVR A;  1P4W A;  2VN2 A;  4LK1 F;  2M1B A;  3IHU A;  1O3T A;  1D8K A;  3WGG A;  2GZW A;  4G7H F;  1B9N A;  3I58 A;  2BYV E;  3NRV A;  4I2O A;  3TO9 A;  5E8G A;  1FSE A;  3L09 A;  3KFW X;  4YII A;  1B9M A;  3EQL F;  5J8F A;  2A6E F;  3WTT C;  2VT2 A;  2R7D A;  2E7X A;  3QP5 A;  4IRH A;  2VC1 A;  1JE8 A;  3MCZ A;  2QQ9 A;  3IC7 A;  5LHG A;  1FYM A;  3KE2 A;  3KP5 A;  1ZLJ A;  1IXR C;  2VE9 A;  1IN4 A;  1EH7 A;  1SD5 A;  4EGY A;  2M5W A;  1ZHF A;  2L3D A;  4ESJ A;  3SZT A;  5ICC A;  3I59 B;  1U2W A;  1FYK A;  1FP2 A;  1Z6T A;  4LB5 A;  2G7U A;  5L3B A;  4HZF A;  3F8C A;  3C18 A;  2O0Y A;  3HHH A;  1AWC A;  1W4M A;  5DD8 A;  2H09 A;  4M72 A;  1IN6 A;  2O6G E;  2QWW A;  3V7R A;  3QRF F;  4HOB A;  1DPU A;  1WWX A;  3MWM A;  3G3Z A;  4BAY A;  2PG4 A;  1A04 A;  5HVQ C;  1KU3 A;  2DBB A;  1HKQ A;  3WU0 A;  3WE2 A;  1FSH A;  4I98 B;  3EDP A;  1OMI A;  3BPV A;  4LGW A;  2LSO A;  2VOP A;  1IN5 A;  2HKO A;  3ROU A;  3FMR A;  3ZMZ A;  3KP3 A;  5HS9 A;  2XAS A;  1K79 A;  5JI6 A;  1BM9 A;  4I01 A;  2E1C A;  1LEB A;  2CG4 A;  5BOX A;  2RN7 A;  1OR7 A;  5AIQ A;  2ETH A;  4WK8 F;  3KP2 A;  3RTR A;  4HV5 A;  1MJ9 A;  2ZBK A;  3HSR A;  1P4X A;  4I7H A;  4BQA A;  2YU3 A;  1Q1H A;  4EJW A;  4P9U A;  3HRS A;  3IRQ A;  3TOB A;  1F1Z A;  1ZGA A;  4MEX F;  1XDS A;  4LJZ F;  1USS A;  5DYM A;  4I0A A;  1LEA A;  1J7K A;  2FNP A;  4N0B A;  1FBQ A;  1U78 A;  4ESF A;  2FU4 A;  4OIO F;  4HLX A;  1JHF A;  3RKY A;  5E20 A;  3SXY A;  4RGU A;  2NS0 A;  3HTU A;  4MQV A;  4MGR A;  3ZP5 A;  4HQM A;  1B59 A;  4LK0 F;  3ZN1 A;  1QZY A;  1FWZ A;  3ZMD A;  3SHF A;  1MJB A;  2K4B A;  1YYV A;  1S8N A;  1XGO A;  2A68 F;  2EJR A;  4IXA A;  2DO7 A;  1VTN C;  3MEX A;  4EMS A;  4OOI A;  1BBY A;  1WRJ A;  1KQ0 A;  3K1N A;  3BPX A;  3ZMS A;  3ABU A;  2K7L A;  2Y0M A;  4IPA A;  4S04 A;  5J6X A;  4BNC A;  2D1H A;  2K02 A;  2P4W A;  3O3K A;  1BJA A;  1P92 A;  2C6Y A;  2EFN A;  2ZNY A;  4RAZ A;  4U0Y A;  4P55 A;  5ED4 A;  5AIP A;  1J9I A;  3M9A A;  3GEZ A;  1KYW A;  4QLC U;  4IRG A;  3F21 A;  1QGP A;  2J5P A;  4HYE A;  2GWR A;  2GXB A;  1W7P D;  5D5X B;  4XBF A;  1S6L A;  3BWG A;  4HW0 A;  1YO5 C;  4FX4 A;  2XIG A;  3SQN A;  2IA2 A;  1IUY A;  2O3F A;  3R60 A;  1QBJ A;  1JGS A;  3KET A;  1B4A A;  1R00 A;  4M73 A;  2YX7 A;  2VBY A;  5HS7 A;  3I71 A;  2VBX A;  3TOA A;  4KMU X;  4PGH A;  1TNT A;  4R79 A;  1FZP B;  2EV0 A;  4UV9 A;  3BDD A;  1L3L A;  4RS8 A;  4Q4Z F;  4U7B A;  4HF1 A;  1R1U A;  2JTV A;  1XDU A;  2DLL A;  2NAZ A;  4HV6 A;  3QP6 A;  5D5W B;  1IF1 A;  4MEY F;  5K5O A;  1IN7 A;  2P5L C;  2EV5 A;  3N4M A;  1C0W A;  4CDG A;  5E8I A;  5HLH A;  2NRA C;  3H3Z A;  4IHS A;  1XMA A;  3AAF A;  4WXD A;  1PP8 F;  2NNY A;  2XKO A;  4MTE A;  3P9I A;  4G6D A;  4KIB A;  5L3E A;  2R3S A;  1XN7 A;  2A5Y B;  2ZME A;  1TBX A;  4KDP A;  2CO5 A;  2UXX A;  2XAF A;  1I27 A;  1GVJ A;  1KU9 A;  4H0E A;  2XAH A;  5ILV A;  1BI0 A;  1MZB A;  1ODD A;  4MHG A;  3P9C A;  5FD6 A;  1XD7 A;  4M9X A;  2XRO A;  1G3W A;  1SD4 A;  4HX7 A;  4HLY A;  3N97 A;  3FZV A;  1ONV A;  1TTY A;  2DK5 A;  1Z05 A;  4Y13 A;  2H94 A;  1F9N A;  3BJ6 A;  1DDN A;  1RUO A;  3CUQ B;  3TO7 A;  3W6K B;  3HRU A;  4OIN F;  5DCM A;  4WCG A;  2K27 A;  3GFL A;  1XGN A;  1JHH A;  5CVJ A;  1TW2 A;  2PMH A;  3T1B A;  3LA2 A;  3FF5 A;  1F5T A;  2A69 F;  1IRG A;  3GO5 A;  2OZ6 A;  4M74 A;  3VFZ A;  1XGS A;  4IHT A;  3GFI A;  3KZY A;  3KEO A;  2ESH A;  1ZRF A;  1KQ9 A;  3F3X A;  1FNN A;  3JSP A;  3K0L A;  4JQF A;  5E1Z B;  2CFX A;  3Q9S A;  3J7A O;  2CWE A;  4IVN A;  2ZCW A;  4P9F A;  5BQT A;  2PJP A;  1BI1 A;  1KU7 A;  3DPL C;  5HDG A;  5LHH A;  1R1V A;  4YIF A;  1LVA A;  5TJJ A;  2ELH A;  4M6X A;  3REO A;  4M71 A;  2EFP A;  3V8J A;  2V79 A;  3LFK A;  1K6O A;  3WOD F;  5HDN A;  1PDN C;  1YS6 A;  1S7O A;  3P7N A;  2LF7 A;  4IJA A;  1HW2 A;  2PBI A;  2OQG A;  1Y0U A;  1WSU A;  5FFX A;  3Q9V A;  2XV4 S;  5BPI A;  5F6F A;  2QLZ A;  2VON A;  1BC7 C;  1FPQ A;  4Z2Y A;  5L3F A;  1MGT A;  5H20 A;  2CSO A;  2W85 A;  3TQN A;  2OAZ A;  3FWE A;  3WTV C;  3GYH X;  1E17 A;  2B0L A;  1J0R A;  4BHB A;  2ZJ2 A;  3H3U A;  1ZAO A;  1ZN2 A;  4ZYG A;  5BS6 A;  5LGU A;  1F4K A;  1G3S A;  5ILU A;  5E17 F;  2FBI A;  3EUH A;  3FMS A;  2P7C B;  3FMQ A;  1W7P B;  4LMY A;  2DI3 A;  5L3C A;  4U0W A;  2ZNZ A;  2EWN A;  5LLQ A;  5LEJ A;  2X0L A;  2YX4 A;  4RAY A;  2DPD A;  3COA C;  2GA2 A;  4JBA A;  3HOT A;  5EEH A;  1BOA A;  2FA5 A;  4CHU A;  3DFG A;  2MH9 A;  1MDM A;  2L4A A;  2VOD A;  5CJ9 A;  4BHC A;  2FNA A;  4IRI A;  1DPR A;  3VOE A;  4GYI A;  1MJA A;  1ZH5 A;  4HDV A;  3QPH A;  2P7V B;  4YFX F;  1K7A A;  3F22 A;  2DFI A;  3WTS C;  1ON2 A;  3OOP A;  1OPC A;  1GHC A;  4UVB A;  2LKP A;  1YTY A;  2G9W A;  5FLX Z;  2HYF A;  3DF8 A;  3KLO A;  5DD4 A;  3S2W A;  3CO6 C;  3QPT A;  2MA3 A;  1O3R A;  4WXC A;  4HQE A;  1R36 A;  1SD7 A;  2PQ8 A;  2FEZ A;  2KIU A;  5IT3 A;  1TW3 A;  4ETS A;  3DEU A;  3F8M A;  1IXS B;  3MZY A;  2O61 A;  3WTU C;  3ZN0 A;  4E70 A;  4ZZD A;  5JFR A;  1HXD A;  2FBK A;  1W5S A;  4UNO A;  1V3F A;  1XMK A;  5D6E A;  4A0Y A;  1IZ1 A;  4WXH A;  5FLX K;  4EV0 A;  1K78 A;  1YQA A;  1V4R A;  5D4S A;  1D5V A;  4NHJ A;  1I1S A;  2FE3 A;  4ZYD A;  3B02 A;  4U7D A;  1LDD A;  2RC4 A;  2ISY A;  3CJN A;  2OD5 A;  2IP2 A;  3GXO A;  1T38 A;  3IKT A;  4KN4 X;  3QU6 A;  3IWF A;  3RPU A;  2AXL A;  1ZRE A;  2M30 A;  3M8E A;  1IXC A;  1J5Y A;  2QQA A;  1XB4 A;  1TQP A;  1TLH B;  4G94 A;  2L02 A;  5D6F A;  2D45 A;  5E1X A;  3LAP A;  2WV0 A;  4KA4 A;  1XSV A;  5BMZ A;  3DXJ F;  2ESN A;  3IRR A;  2EFO A;  1QQI A;  3BJO A;  2ZKZ A;  3ECH A;  5TRD A;  4G7Z F;  2PFB A;  4HAM A;  3IKV A;  3RIR A;  3GZ5 A;  4KMF A;  4EM2 A;  3FM5 A;  1O57 A;  5ERI A;  4P96 A;  1ZYR F;  1L0O C;  2LDU A;  2QVO A;  2V1D A;  1REP C;  3JTH A;  1FYL A;  3CUQ A;  3FM3 A;  2ACJ A;  2NYX A;  3FHZ A;  2UZK A;  1BI3 A;  4TV7 A;  2W24 A;  3Q5F A;  1MKM A;  5K5R A;  5D8K B;  1TQI A;  3ZMU A;  4GCV A;  3TGN A;  2IT0 A;  3WTW C;  4ENK A;  3F8N A;  1BIA A;  2P6S A;  3CO7 C;  2A07 F;  2KKO A;  2HGC A;  5FD5 A;  1CF7 A;  3KP6 A;  4HX4 A;  1I5Z A;  2A6H F;  2JSC A;  4L9V A;  3E6D A;  4FT8 A;  1IW7 F;  1RIO H;  3QOP A;  3VB2 A;  5E18 F;  3NEU A;  4UHT A;  1WI9 A;  5E1W A;  2E7W A;  1KYZ A;  2Z99 A;  4G7O F;  4S05 A;  3C3W A;  5LRR A;  2EFW A;  4XRF A;  4AVP A;  1FC3 A;  2QEN A;  4LLL A;  4NQW A;  2NNN A;  3M8F A;  3T0Y A;  1HSJ A;  4L18 B;  3DV8 A;  1QNT A;  4HBL A;  1LB2 A;  1ZG5 A;  1E2X A;  2PEX A;  2STW A;  2J5O A;  1HKS A;  4A2U A;  1MD0 A;  4LLN A;  4R8H A;  2STT A;  3F72 A;  4AWX B;  2RGV A;  2FF4 A;  1IN8 A;  3BZ6 A;  3RKW A;  2OBP A;  5LGN A;  2G7H A;  3HYI A;  4WWC A;  1O3S A;  1UFM A;  3BRO A;  2FRH A;  1T2K A;  3I64 A;  2IW5 A;  2KIM A;  1P6R A;  1XGM A;  2CGP A;  3ZPL A;  2D1V A;  1R5G A;  4CXF A;  3RKX A;  5FO5 A;  3E5U A;  4KYW A;  2VC0 A;  4EGZ A;  1KU2 A;  2P5K A;  4KNY A;  2GQQ A;  2HZT A;  2ADU A;  4LG0 A;  1TNS A;  4A6D A;  5CVR A;  4Y17 A;  1P2F A;  3GUD A;  2DK8 A;  1U6G A;  1X3U A;  4KT5 C;  1WKM A;  5JHU A;  2V1U A;  5CLS A;  3V7S A;  3PFI A;  1EH6 A;  3E5Q A;  3HSE A;  2UXN A;  4CZZ A;  1CGP A;  4U88 A;  3JTG A;  1FY7 A;  3DQV C;  1LDK B;  3F8B A;  3WU1 B;  5DUK A;  4RGX A;  5F1R A;  3MFK A;  3ML6 A;  2EB7 A;  2MLG A;  3BP8 A;  3RYR A;  1R22 A;  3F23 A;  4GYG A;  4B8X A;  2HOE A;  3I54 A;  2M87 A;  3HOS A;  2ZME B;  3JAM Z;  2FMY A;  1UCR A;  4MNU A;  3KP7 A;  2MLK A;  2EFQ A;  3G73 A;  1UHM A;  1HW1 A;  2IVM A;  4F7Z A;  3J80 K;  4LB6 B;  2E1N A;  1YS7 A;  1MDM B;  2QBY B;  1OYW A;  5D8L B;  3KEQ A;  3PQJ A;  2VBZ A;  1UHW A;  2HFH A;  2COM A;  1G6N A;  4ZH4 F;  1G4D A;  4PZJ A;  2F5F A;  4CO8 A;  1FBS A;  4EJU A;  2YR2 A;  2L54 A;  3CUO A;  3RPQ A;  4LD5 A;  3C1D A;  3CLO A;  5A2Q K;  4XLN F;  1ZRD A;  1D8J A;  3I4P A;  3U2R A;  1S29 A;  1YW8 A;  3IWZ A;  2DTR A;  2XKP A;  3JAM K;  1Z9C A;  2V1X A;  4ASN A;  1O7L A;  1R58 A;  1YW9 A;  3FXQ A;  3ZQ7 A;  2O03 A;  3TDU C;  1U8R A;  3HUG A;  4O6J A;  3V8K A;  4OMZ A;  4G9Y A;  2Z3Y A;  4K2E A;  2OA4 A;  2PN6 A;  1OYY A;  3HIF A;  4YFN F;  3E6B A;  4BH9 A;  4PDK A;  3RYP A;  2XUB A;  3WTY C;  2AS5 F;  4EM1 A;  1FBU A;  2FXA A;  3F6O A;  3H92 A;  2Y48 A;  3HRM A;  4NB5 A;  1OKR A;  3GFJ A;  5AON A;  1PUE E;  3RI4 A;  2Z33 A;  2IPQ X;  2QBY A;  2H6C A;  4UV8 A;  2VXZ A;  1T0F A;  4AIJ A;  4WX9 A;  3WGI A;  2DAO A;  3L9F A;  1Z1D A;  5DV5 A;  3CUQ C;  1HKT A;  5IT9 K;  4CYD A;  1IRF A;  4RGS A;  4GGG A;  4ENN A;  1O3Q A;  3M7G A;  1BIB A;  2P8T A;  4L9J A;  3WTX C;  3LWF A;  2CQK A;  3NQO A;  3E6M A;  4M9S A;  3K1M A;  2KJB A;  2XGX A;  2GAU A;  4BHP A;  4N9H A;  5HLG A;  3DKW A;  1NHA A;  4M9Z A;  2QM3 A;  4L0Z B;  3FXU A;  3L2C A;  3WTZ A;  3LA3 A;  2YSR A;  3K69 A;  2H6B A;  4DNC A;  1RZ4 A;  4A5M A;  3CTA A;  1TQM A;  3BY6 A;  4RB0 A;  2RQP A;  5CYV A;  4UVA A;  3ERE D;  2DU9 A;  3W6J B;  1FT9 A;  4HA8 A;  2VOO A;  2OQR A;  2BBY A;  1T39 A;  4ENM A;  3LQR A;  1CF7 B;  3O2P E;  4A12 A;  2M8E A;  2QYO A;  3RJP A;  2LNB A;  3WG9 A;  4PGG A;  4YG2 F;  1FOK A;  1T6S A;  4AD9 A;  3K1P A;  3I0T A;  1XSD A;  3HTS B;  2F2E A;  4XSX F;  4AIH A;  1J2X A;  5LHI A;  3OV8 A;  3GZ6 A;  5D5V B;  4RB2 C;  4L0Y B;  1R5H A;  4L9T A;  3DPT A;  4ZYE A;  3WGH A;  2ZO4 A;  1YW7 A;  4EJT A;  5DDG A;  1U3E M;  4OU0 A;  5D5U B;  2RKH A;  3R61 A;  4ESB A;  2IJL A;  3T5X A;  2L01 A;  5CVU A;  2PMU A;  1ZAR A;  4YFK F;  1K78 B;  1J59 A;  2HKX A;  1FP1 D;  3ULQ B;  1GXQ A;  3MQ0 A;  4FHT A;  1KA8 A;  2FSW A;  2MD5 A;  2XAG A;  3LST A;  3GLX A;  1ZLK A;  2HWV A;  5H6R A;  3BOQ A;  1QPM A;  3GWZ A;  5JVT A;  4RB1 A;  2WWY A;  1YIO A;  4KUM A;  4RB3 C;  4KFC A;  4UVC A;  3F8F A;  2PI0 A;  3R6S A;  3J80 Z;  1H9G A;  5ICE A;  3V8L A;  4LLG F;  3D5L A;  3V4G A;  4UXN A;  3VOD A;  4G6Q A;  4KIG A;  3ISP A;  1RUN A;  1RI7 A;  1H0M A;  4GXO A;  1PP7 U;  2RDP A;  2EA4 A;  1B6A A;  1EV7 A;  4CIC A;  1D3Y A;  3QAH A;  5ILS A;  3L00 A;  3O6B B;  2BV6 A;  4L9N A;  1SMY F;  2KJC A;  3R0A A;  3FX3 A;  4ZYH A;  2KIF A;  1FLI A;  3V7C A;  3TDZ C;  1DUX C;  1UST A;  2HS5 A;  5HS8 A;  2MH2 A;  1LJ9 A;  1LQ1 A;  3LAJ A;  2WC2 A;  4EVI A;  1SFU A;  2M45 A;  1JXS A;  3K9T A;  2DQR A;  2MBF A;  1KQ8 A;  3R4K A;  1Z7U A;  4ZZL A;  1SMT A;  5J8C A;  4EJV A;  2WTE A;  3L7W A;  3E97 A;  4HF0 A;  4PCQ A;  2DPU A;  1SAX A;  2HTJ A;  3M1E A;  3IL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...