4ENNA

Crystal structure of s. pombe atl1 in complex with damaged dna containing o6-carboxymethylguanine
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Alkyltransferase-like protein 1
publication title Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
total genus 33
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ennA00
2CYYA 1TQIA 2DT5A 1WKMA 2V1XA 1IRFA 5FFXA 3HHGA 1B9NA 1GHCA 1S7OA 3DQVC 4HV5A 5D5XB 1SFXA 2WC2A 4M71A 2X0LA 5ILVA 5DUIA 1YW9A 4U0YA 5IT9Z 3OV8A 2R7FA 2WV0A 1MDMA 4PGGA 3WU0A 2QQBA 2FBIA 1B1BA 4A6EA 1ZN2A 2XAJA 4IF4A 2RNJA 4AVPA 1SMTA 5E1ZB 1DPRA 1FT9A 2ISZA 2FXAA 2PQ8A 4K2EA 1T0FA 3C18A 2K7LA 1YTYA 1MJBA 2IPQX 3M8EA 2OZUA 4UXNA 1XCBA 4CDGA 1HSTA 2O3FA 1J9IA 4KIGA 2E7WA 5LLQA 2CFXA 3TO6A 1O3RA 4ESBA 1PUEE 5H20A 2M45A 2VXZA 1XMAA 2VOOA 3CUOA 5E8GA 3E6DA 1ODDA 1IN5A 1HKSA 5BPDA 3B73A 4KDPA 3T8RA 1FSEA 5D5VB 2FOKA 4MTEA 3U2RA 4KN4X 2K02A 1R1VA 1D5VA 1K78B 2JTVA 3D5LA 4KT5C 1BJAA 3TO7A 3J81Z 3LQRA 3U1DA 4ZZDA 4NB5A 1UHWA 4JK1X 1OYWA 2HKOA 1B9MA 3WGHA 3CO6C 1JGSA 1KU9A 3TOAA 3NQOA 1KYZA 1KQ8A 2QENA 4BAYA 1K7AA 1KQ9A 3FX3A 1ZG3A 1LNWA 2P5VA 5BPIA 4RGXA 3EYIA 1I5ZA 4ESJA 4UHTA 2OZ6A 3KETA 4ETSA 3GZ6A 1BI1A 1R00A 5CLSA 3H92A 2NYXA 4S05A 1K78A 1TQMA 3ZMSA 5JFRA 1RZ4A 4HA8A 1Y0UA 3ZMVA 4YIIA 3LSTA 2K4JA 2A3SA 4LB6B 2FBHA 1R36A 2GQQA 1ZRDA 3JAMK 5D8LB 1I1GA 4FX4A 2B0LA 1L0OC 3EDPA 4EM1A 2VODA 4G6DA 1SD7A 4EM2A 1U2WA 3WGIA 1YG2A 1YS6A 4A0YA 1KA8A 3S2WA 3JTGA 5EEHA 1J5YA 1F4KA 2W24A 4ZYEA 2ZBKA 3BY6A 1SMYF 1W5SA 2G9WA 5A2QK 1ON1A 1S8NA 3MFKA 2V9VA 2VT2A 4U7DA 4HAMA 2PJPA 3RKXA 3T1BA 3DV8A 4LG0B 2FNPA 3E3VA 1ZG1A 5FB2A 4IHSA 1IN6A 3CUQC 1ZLJA 3KEOA 2EV5A 2MD5A 2VBXA 1XSXA 4FHTA 1QZZA 2JT1A 2O0YA 2M5WA 2O61A 2QQ9A 4P55A 1QBJA 2A5YB 4G7OF 2IA1A 2P4WA 3ROUA 1FWZA 2D2WA 3GLXA 5D8KB 1FOKA 1JE8A 2STWA 4L9NA 4HF1A 3WE2A 3CDHA 5ED4A 4I0BA 1WRJA 2IVMA 3WTSC 3V7CA 1KYWA 1O7LA 3U9GA 2PLYA 1H0MA 2C6YA 2H6CA 4XLPF 4LG0A 5ICEA 4WXDA 1BIBA 5HDKA 1YYVA 4IRGA 3GXOA 2DBBA 2ADUA 1Z6RA 2L02A 4O5VA 2FE3A 1ON2A 3RTRA 1XDSA 1J7KA 4A5NA 4HX7A 1GVJA 3P9IA 2KJCA 4M6XA 2ZJ2A 1JXSA 3P9CA 2W57A 2F2EA 2HS5A 3OOPA 2G7UA 2VN2A 3CLOA 4LB5A 1ZHFA 1LDJA 5F1RA 2Q8KA 5FGMA 1SFUA 3IRRA 1B4AA 2FSWA 4RB0A 1K79A 2EFWA 2NS0A 4EQQA 3FHZA 3DPTA 3I59B 3BZ6A 3K69A 5LRSA 5JR3A 1ZAOA 5TRDA 3FMRA 4N0BA 5HS9A 2ETHA 4Q5SF 5K1YA 4IVNA 5JHUA 1KQ0A 5BOXA 1XDUA 1IN4A 1S7AA 4Z2YA 4EVIA 1V3FA 2FRHA 3DPLC 2K86A 3VOEA 3HRUA 5J6XA 4OIOF 2VC0A 1XGSA 2ZXJA 2OD5A 2ZNYA 1XGMA 1EH6A 2HTSA 4CHUA 2NAZA 4HDVA 3KCCA 4BH9A 3V7RA 4LFUA 1OKRA 2HTJA 3WTXC 2O8XA 1ZG5A 3QOPA 2HEOA 2EB7A 3FZVA 4N9IA 3SHFA 1HQCA 4ENNA 1ULYA 1AWCA 2LSOA 4KICA 2MH2A 2EA2A 1I6XA 1U78A 2VONA 1I1SA 1YO5C 2LNBA 5F64A 3NRVA 3KLNA 4B8XA 4BXUA 3GWZA 1EV7A 1QO0D 2VBZA 2IA2A 4HBLA 4S04A 3ZMUA 4A0ZA 1QPMA 1SD4A 3MCZA 3TDZC 3I59A 1H9GA 4EJTA 3IWFA 1ZRFA 3BJ6A 4MEXF 1MGTA 1C0WA 4L0ZB 4RGUA 2MH9A 4CGZA 1SFEA 1P4XA 3I5UA 5CYVA 3BJOA 3B02A 1KU7A 3ZMDA 2STTA 2PN6A 3HTUA 3IWZA 2RQPA 1U6GA 4KUMA 5ILSA 2CWEA 5LGNA 4IPAA 3HSRA 4AIHA 4MGRA 2ZMEB 1ZREA 2CO5A 4M9XA 5K5RA 3DXJF 1W5TA 2GWRA 4I01A 4XSZF 4AD9A 4ON0A 3H3ZA 5FO5A 3TQNA 2LDUA 5L3BA 1OMIA 5H6RA 2A07F 2Z9OA 1FY7A 2ZFWA 4LLLA 4HLYA 2EJRA 3KP3A 5DCFA 2Z3YA 2DI3A 2EK5A 1G4DA 3F8FA 2H6BA 3F3XA 1ZGJA 1BI2A 4M74A 2DK5A 3G3ZA 5HVQC 1E17A 5KK1A 3F6VA 4EGZA 4HYEA 1U8RA 2FNAA 4HF2A 2M1BA 3ABUA 1IXSB 1R22A 3GO5A 3LAJA 1T39A 5L3FA 1NHAA 3P7NA 3BDDA 3SXYA 2BBYA 1U5TC 3V7SA 1O3TA 3I53A 2DFIA 3BROA 1J75A 1IUYA 4A2UA 4L18B 1UFMA 2DQRA 5LRRA 2XAHA 4L9JA 3RDIA 2D45A 3CUQA 3E5QA 2Z5UA 5CVJA 3BWGA 3RYPA 3EETA 1LQ1A 4MQ9F 3LWFA 2ESHA 2IRFG 3MZHA 2JPCA 4BYYA 1FYLA 2Y0MA 3REOA 4AIJA 2GA2A 3ZN0A 3TGNA 3DKWA 5BQTA 2XAFA 3RYRA 1YIOA 2F5FA 2QLZA 1FYKA 3JSPA 5CVIA 1FBQA 2W25A 3ZMZA 1FYMA 2WTEA 1H9TA 4ENMA 1Z6TA 1PDNC 2GXGA 1OYYA 2QUFA 4UNOA 3ERED 2OQGA 4GCVA 3SZTA 3J80Z 5L3EA 3LA3A 4Q47A 4WXCA 3I0TA 2Y48A 5KVRA 2MBFA 3VB2A 1R58A 3C1DA 3C3WA 3FMQA 2OU2A 4WWCA 2P7CB 2COMA 4UV8A 1O3QA 5FLXK 5L3GA 1HXDA 4L9VA 1GXPA 3TO9A 1CF7B 1Z1DA 2HQRA 2VBYA 1K6OA 4KIBA 5TJJA 2YPRA 2D1VA 3I4PA 1HW2A 3R60A 3FXQA 4H0EA 1Z9CA 5D6EA 3KLOA 1V4RA 2YX7A 3WGGA 4E70A 3F23A 3I54A 3HRMA 3M9AA 5E1WA 4GXOA 4KFCA 2ACJA 4RAYA 2ZCWA 4IRHA 1IN7A 2VE9A 2RN7A 1FPQA 1TQPA 2OQRA 2YX4A 2BE5F 1X3UA 3WE3A 2D1HA 3H3UA 2UXNA 1IXRC 3MQ0A 2KIMA 2IA0A 5AIQA 2XAQA 3CO7C 3VODA 4UVCA 1XSDA 2XASA 4IXAA 4KYWA 1R5HA 1CF7A 4G6QA 5LHIA 3BPVA 3V4GA 3ZN1A 3F72A 4EJOA 2M30A 2L3DA 3O3KA 3R6SA 6PAXA 2PG4A 2F5DA 2EA4A 3NEUA 4KA4A 3F8CA 2L54A 5LHGA 5JI6A 5CVVA 3E6BA 4KMFA 4M73A 4XSXF 1HKQA 3QPHA 3MAJA 1ZGAA 4M9SA 2UZKA 4Y17A 3DEUA 4I98B 1EH8A 2JPBA 4RS8A 3E6MA 2VE8A 4LD5A 3BJAA 1PP8F 1QNTA 1ZH5A 1USSA 2KRFA 2HR3A 3VFZA 2FF4A 4XBFA 3CTAA 1IZ1A 1JHFA 1U5TB 3MEXA 4A6DA 3PQKA 2CSOA 1S3JA 2Y75A 1FP2A 1WQ2A 2XHKA 2HZTA 2JRTA 4LMYA 4Q4ZF 1TLHB 2HGCA 2HQNA 2K27A 1LVAA 2XUBA 1SD5A 1SD6A 1BOAA 3SQNA 3HHHA 5FLXZ 2ZKZA 3HOTA 4UVAA 4I0AA 2NNNA 3ISPA 1J59A 4KMUX 5LBQA 4EM0B 1T2KA 3N4MA 1XGNA 4P9FA 3KP2A 1IW7F 5HLHA 1XCVA 4U7BA 1WSUA 4PDKA 4ASNA 2DPDA 1WI9A 4OU0A 2IP2A 2P5KA 1B59A 3GX4X 3O6BB 4WX9A 1EH7A 2FEZA 4IRIA 3ECHA 3AAFA 1XMKA 4A5MA 3F8MA 4LK1F 5D4SA 4UVBA 3SFZA 1U5TA 5F6FA 4LGWA 2VC1A 5J8FA 5CVUA 4BHPA 1D8KA 1USTA 1BI0A 2V1UA 3I64A 2PBIA 1MJAA 1RUNA 2O03A 3JAMZ 2E7XA 3HSEA 1XB4A 4EV0A 1O3SA 3LAPA 1ZARA 2HDCA 2F5EA 2BEOA 3BOQA 3WODF 3L7WA 1W7PB 2RGVA 4R8HA 5BS6A 3T8TA 4QLCU 5HOOA 1TW3A 3E97A 1MKMA 1G3SA 4FX0A 3F21A 5ICFA 4HLXA 1MJ9A 1R1UA 2L4MA 2RC4A 4L5IA 1O7FA 2GAUA 5A2QZ 1UB9A 4WF2A 4RB1A 4U0WA 1PP7U 3Q9SA 1STZA 1Q1HA 4HDUA 1KU3A 3V8KA 1F9NA 5K5QA 5J8CA 3FM3A 3KP5A 2GXBA 3SZPA 1HKTA 3K1MA 1LEAA 5E8IA 3I58A 1Z7UA 2P7VB 2V1DA 2FMYA 2IW5A 1TNTA 3WTYC 5IT9K 2LKPA 4CICA 1D8JA 2K4BA 3KE2A 4OMYA 1ZYRF 3ML6A 2CQKA 4G94A 4XLNF 1YQAA 1W7PA 4M72A 4WXHA 4L0YB 1YFHA 2P6SA 3QP6A 4BHBA 3K9TA 4GYIA 4R79A 2M8EA 1DDNA 2J5PA 1P92A 3RJPA 1FLIA 3FM5A 4LK0F 1UCRA 4R1HA 2A6HF 4FT8A 3ABTA 1REPC 1UHMA 2A68F 4U0VA 2HOEA 4L9TA 2BYVE 5D6FA 3D0SA 4DQ2A 2ESNA 3WTTC 1FSHA 2JSCA 3HRTA 2UWMA 1L3LA 1FX7A 1P4AA 3FF5A 1LJ9A 3Q9VA 1RIOH 3ZMTA 3R4KA 2YSRA 5DD4A 2NRAC 1YLFA 5CVRA 2W85A 2H27A 3HUGA 3M1EA 4Q48A 1BIAA 3J81K 2FU4A 2G7HA 5K5OA 1MDMB 2XV4S 2BV6A 3W6JB 2JZYA 4HW0A 2OA4A 3C7JA 3FMSA 5H6QA 4G9YA 1LDDA 2XKOA 3R0AA 5E1XA 4MTDA 2CW0F 2GIVA 3TOBA 1MZBA 1XGOA 2XAGA 3JTHA 1Z91A 4ZYDA 3M8FA 3IL2A 4YFXF 4WCGA 3RPQA 4OIRF 5HLGA 3ULQB 2E1CA 4ENKA 2ZMEA 4A12A 5D5WB 1HBXG 2KIUA 1RI7A 1AOYA 3HIFA 4B09A 1IAWA 2DW4A 4HQMA 5IT3A 5ERIA 2EFNA 3K1PA 2QYOA 4MEYF 1T38A 4ESFA 2CGPA 3KZYA 3LA2A 1LB2A 2Z33A 2F5CA 2PI0A 4P9UA 3KP7A 3KFWX 3IHUA 1FBUA 1RNLA 3E6CC 5E18F 1F5TA 3I71A 4F7ZA 1FZPB 5HS8A 1IF1A 2UXXA 4MNUA 2Q2EA 4HX4A 2PFBA 4HQEA 1D3YA 4L5JA 3DFGA 1OPCA 4PCQA 1G3TA 3HSFA 4IJAA 4O6JA 4GGGA 3QPTA 5LEKA 1IXCA 1KGSA 3R61A 3IKVA 1S6LA 2EWNA 1XN7A 4BQAA 2AS5F 2MLKA 3L2CA 3HTSB 2HYFA 2GA1A 5L3DA 4RGSA 2H09A 4I02A 5HLIA 3PQJA 4HV6A 3HRSA 3RKWA 4YFNF 5FD5A 2X4HA 3K2ZA 3GW2A 2FBKA 5ICCA 4RGRA 2O6GE 4UUVA 2LF7A 4ZZLA 3ELKA 4P5OA 2CG4A 1IRGA 2EFQA 1W7PD 3HOSA 2KKOA 2RDPA 2A6EF 3BP8A 5DUKA 3GVAA 1Z05A 4N9HA 1HW1A 4GYGA 3WTZA 1P6RA 2PMHA 5BMZA 1DPUA 4EJVA 3EQLF 1DP7P 4HX8A 4KIFA 1A04A 4D0PA 1R23A 1KU2A 3ECOA 2AXLA 4G8XA 4ENJA 3KP4A 4NQWA 2DPUA 3Q5FA 3KZZA 4HF0A 4CYDA 4OMZA 3GYHX 4KN7X 3ZP5A 1BM9A 4ZYGA 2HYGD 1R5GA 5DD8A 5EEGA 5DCMB 3TDUC 4ZH4F 2OBPA 3GEZA 2QBYB 1G6NA 4UV9A 3K1NA 1U3EM 5D4RA 2Q0OA 1JHHA 1DUXC 3WU1B 4ZYHA 4JQFA 4Y13A 2R7DA 5AIPA 2PMUA 1G3YA 5LHHA 1BC8C 2IT0A 2P6TA 3PFIA 2IJLA 1FBSA 3L9FA 1T6SA 2ELHA 5LEJA 3KP6A 2MA3A 3FWEA 3FXRA 4M9ZA 3DF8A 2FA5A 3LQQA 1SAXA 4IHTA 3JW4A 4BNCA 3F22A 2HFHA 2R3SA 3RPUA 1G3WA 3CJNA 4EMSA 4G7ZF 1YW7A 4CXFA 2QWWA 1O57A 2LF8A 2EV6A 1RUOA 4OIQF 4O3MA 3QP5A 1BBYA 3GFMA 3G73A 1TTYA 5ILUA 5ICGA 3T5XA 2ISYA 3K0LA 3MZYA 5DCMA 3LA7A 1WWXA 4HZFA 4KNYA 4LLNA 2QBYA 5L3CA 1OYIA 5FD6A 4BHCA 4RAZA 3QU3A 1YW8A 4NHJA 3GZ5A 1TBXA 4I7HA 5AONA 3M7GA 5LGUA 4I2OA 2XKPA 4AWXB 1I27A 4YFKF 5DV5A 2QVOA 4PGHA 4YG2F 3RI4A 3E5UA 3EUHA 1J0RA 1IN8A 2FQ3A 1LDKB 1ZLKA 2DAOA 2YU3A 2V6CA 2ZNZA 4G7HF 4CZZA 1YS7A 4JBAA 1OR7A 1VTNC 1W4MA 2XROA 2TDXA 2MC3A 5E17F 4MHGA 3MWMA 2FMLA 2EV0A 4A0XA 2KIFA 3RKYA 1FC3A 2HKXA 3WG9A 5LGTA 2DLLA 1P2FA 5HS7A 3QU6A 3TKYA 3GFIA 1P4WA 2DO7A 4TV7A 4LJZF 2PEXA 1HW5A 2KJBA 3N97A 1ZRCA 2L4AA 3WTVC 3EYYA 5JVTA 1GXQA 3COAC 1TW2A 2DK8A 3QAHA 4OIPF 2P8TA 2L01A 2P5LC 4Y15A 2QZ8A 2V79A 1FNNA 1T98A 5DEQA 3P9KA 2WWYA 4XRFA 3R0JA 2DU9A 2RVCA 3T0YA 2MLGA 4OINF 2H94A 3VEPA 2QQAA 2QM3A 3GFLA 2VOPA 2W84A 3KEQA 1R7JA 2RKHA 3V8JA 1FP1D 3FXUA 4WK8F 2XIGA 3IRQA 1BC7C 3L00A 4YIFA 1ONVA 2A61A 4PZJA 5E20A 3BPXA 2GZWA 2RV8A 1CGPA 2XRNA 4P96A 1LEBA 2A69F 1BN5A 3WTUC 1J2XA 4RB2C 1S29A 2NNYA 2J5OA 5CJ9A 2EFOA 1TNSA 2M87A 5HDNA 4EJUA 5DYMA 3HYIA 4M6YA 3WTWC 3GUDA 4OOIA 1QQIA 3RIRA 3O2PE 4QWQA 2YR2A 2XVCA 1R1TA 2VBWA 4HOBA 3GF2A 3JSOA 1F1ZA 4EGYA 1B6AA 4U88A 3J80K 3DP7A 2EFPA 3L09A 1QZYA 4I09A 1E2XA 2BGCA 2HWVA 2ZO4A 2Z99A 2DTRA 3F6OA 3ZQ7A 3J7AO 2VT3A 3IKTA 1HSJA 4CO8A 3V8LA 2E1NA 3W6KB 5D5UB 4RB3C 3CUQB 2XGXA 4DNCA 5FFZA 4EJWA 1XD7A 3QRFF 4MQVA 3F8BA 1MD0A 2OAZA 1QGPA 1BI3A 3E5XA 3LFKA 1XSVA 5HDGA 3GFJA 3IC7A 3F8NA 4LLGF 5DDGA 2DQLA 4AIKA 4GO1A 3ZPLA
chains in the Genus database with same CATH superfamily
2VQHA 2Z16A 2CYYA 1TQIA 3LSGA 2DT5A 2JUCA 1WKMA 2V1XA 4IHYA 2GXAA 2NVTJ 1IRFA 5FFXA 1MNDA 3E7LA 1UG2A 3HHGA 1B9NA 4NBQA 3MKYB 1GHCA 1S7OA 3DQVC 3ZOBA 4HV5A 5D5XB 3OYLA 1SFXA 2WC2A 4M71A 2X0LA 5ILVA 5DUIA 4XN3A 1YW9A 2CH0A 4U0YA 3D1NI 1Z0XA 3W2AA 3BQZA 5IT9Z 3OV8A 2R7FA 2WV0A 3QPLA 1MDMA 3Q0WA 4BDYA 4UUSB 4FQGA 2XPWA 4PGGA 3WU0A 2QQBA 4Y52J 3BG5A 3NWTA 2FBIA 1B1BA 5DS9A 2NVXJ 1OQYA 4A6EA 2KLOA 1ZN2A 3S16J 4XKBA 2XAJA 4IF4A 2RNJA 1IGNA 1IC8A 4AVPA 4ABZA 2UUZA 3PSFA 4S0HB 1SMTA 5E1ZB 2HVSA 2QQ8A 1DPRA 2ICWG 3K70D 1MSFC 1FT9A 2ISZA 2FXAA 1Z3YA 2PQ8A 1BL0A 1X3WB 5KAFC 4K2EA 1T0FA 3C18A 2XF7A 2O7OA 2PMZA 3J7YJ 4RLFA 1VQ9I 4OWRB 2K7LA 3K4KA 4HSRA 1YTYA 1YHQI 1MJBA 2IPQX 3M8EA 2DA6A 2OZUA 1QU3A 1BR4A 2KRCA 4UXNA 1HF0A 1XCBA 1A5JA 2UV1A 3KIOA 3VYSB 3A02A 3CCYA 4CDGA 3A0BC 1HSTA 1WHUA 2O3FA 2VI6A 3AKZA 2H1KA 2LD5A 3CDIA 1J9IA 2BY1A 4KIGA 3H1CA 2E7WA 3OIQA 5LLQA 5EZGA 2W82A 2W7NA 2CFXA 1E3OC 2E36A 3TO6A 2ZC2A 2Y9ZA 1O3RA 4ESBA 2ZXIA 1PUEE 5H20A 4IZZA 3QODA 2M45A 4B4CA 2AQFA 1CQTA 2VXZA 4F55A 1XMAA 5EJCA 2VOOA 2IGNA 3CUOA 4QIWN 4BXXJ 2GIZA 5E8GA 3G6EI 3E6DA 3PO3J 3BTIA 1ODDA 4JX6A 2KP6A 1IN5A 1HKSA 1Z3XA 2KRHA 3BG9A 4UUSA 2R0QC 4Y3OA 4KITB 5BPDA 3B73A 4KDPA 5HLTA 3T8RA 1Z7LA 1FSEA 2FOKA 4MTEA 3FXJA 5D5VB 5C44J 2XF6A 3U2RA 4LIVA 4KN4X 2K02A 5CQEA 1R1VA 1D5VA 1K78B 2JTVA 3D5LA 5J4YA 4KT5C 1BJAA 3TO7A 4B1RA 4D5FA 5GTIC 1G8XA 1SANA 2ID6A 3J81Z 3LQRA 3CCEI 3ZQLA 4JX5A 3U1DA 3O8HA 4ZZDA 4KJZA 4NB5A 1OCZH 4BBRJ 1UHWA 1ZKGA 2CW7A 4GRIA 2XC7A 4RDUA 3S2DJ 1D5YA 2JRMA 2R5YB 4JK1X 4C2TA 2KZVA 2QSFX 1OYWA 2HKOA 1B9MA 3WGHA 3CO6C 4ZTJA 1JGSA 1D0YA 2MABA 1KU9A 3TOAA 3MKWB 3NQOA 1KYZA 2V9PA 1KQ8A 2JWTA 2DYSH 2QENA 5TGTA 3IH2A 4BAYA 1DGRM 2B63J 3I4MJ 2X6OA 3ABMH 5IP7J 1KQ9A 3FX3A 1ZG3A 1Y56A 3WU2C 1VFCA 1K7AA 1W1WE 1LNWA 4B44A 2P5VA 3K6GA 5BPIA 4RGXA 2CQNA 3EYIA 1OCRH 1I5ZA 1TWFJ 3GLLA 2CW8A 2OZ6A 4UHTA 4XLHA 2HDWA 4ESJA 5FKNA 1I6HJ 1JUMA 4UB8C 2WY7Q 2EIJH 4F93B 3KETA 2EZHA 1TT5B 3A01A 4A69C 4ETSA 1A6QA 3GZ6A 2HU9A 3CCUI 1BI1A 4Y7NJ 1FOXA 1R00A 5GAGJ 4BUPA 2R5ZB 5CLSA 3CJTB 1F43A 3H92A 4F52A 1V5GA 2NYXA 3ZRGA 3K4NA 4S05A 1HDPA 2O8KA 2WBMA 1K78A 1U0JA 1Q1VA 3CDLA 1TQMA 3ZMSA 5JFRA 1RZ4A 4HA8A 4XK4A 1Y0UA 3ZMVA 2X1DA 4YIIA 2A5WA 3IH4A 3LSTA 4FASD 2K4JA 2A3SA 4LB6B 2FBHA 5M5XJ 2NXNB 1R36A 2GQQA 1ZRDA 3JAMK 5D8LB 1I1GA 1WJEA 1D1CA 2LK2A 3K4LA 2B0LA 2R5YA 4FX4A 1L0OC 3KEYA 1GUUA 3ESWB 3VDXA 1W0UA 3EDPA 4EM1A 4PSXA 1RPWA 2K9LA 3FK7A 2VODA 4XMYA 4G6DA 1SD7A 4EM2A 1U2WA 3WGIA 1YG2A 1YS6A 1JJ6C 2BXYA 1X2MA 1YRNA 4A0YA 1KA8A 3S2WA 3JTGA 3DEEA 5EEHA 4DZPA 4OAYA 1J5YA 5FLMJ 2KQRA 1F4KA 2W24A 2R4GA 4ZYEA 2MYSA 2ZBKA 3BY6A 1SMYF 1W5SA 2R7ZJ 1P7JA 2G9WA 1K4SA 2NVQJ 3TP0A 4XRMA 4RM3A 5A2QK 1ON1A 1S8NA 2K9MA 3MFKA 4HNTA 2DA1A 2V9VA 2VT2A 2LKSA 1B72B 4U7DA 3FXLA 4HAMA 4DZJA 2PJPA 2K40A 3RKXA 1D1BA 3T1BA 3DV8A 3G1OA 3TL4X 4LG0B 2FNPA 1PJRA 3E3VA 5J4VA 2L0KA 4BU2A 1ZG1A 3A03A 2DMPA 3BTLA 5FB2A 3FXKA 4BEHB 3OS0A 4IHSA 1IN6A 3RKQA 2BXZA 1Y6IA 4F91B 3JRGA 1LFPA 2JVGA 3CUQC 1ZLJA 5KAIC 1QHGA 1X1PA 2M0MA 4M3DA 1QHHD 3KEOA 2EV5A 4XRSA 2MD5A 2VBXA 1GV2A 2HVQA 1XSXA 4FHTA 1QZZA 3OS1A 3S1RJ 2JT1A 2O0YA 3BZCA 2M5WA 3KZIC 4BBSJ 3SDBA 4BXFA 2QQ9A 4P55A 1QBJA 2O61A 3IAM2 2A5YB 3KX2A 4G7OF 2IA1A 5EGOB 2P4WA 2VL8A 3ROUA 1FWZA 1EF4A 2D2WA 3GLXA 5D8KB 1FOKA 3QYEA 1JE8A 4C9YA 2VKEA 2STWA 4L9NA 4HF1A 3WE2A 3CDHA 4PJLA 5ED4A 2CUFA 4CCJA 4I0BA 3AL0B 1XMXA 1WRJA 5DM7F 3PJRA 2IVMA 2GOXB 2CQXA 3WTSC 3V7CA 1YOVB 1KYWA 3OOUA 1O7LA 2BVLA 3U9GA 1K61A 4EATA 2PLYA 1XG1A 1H0MA 1YX5A 3DBRB 4JYKA 1B72A 2C6YA 2H6CA 4XLPF 3SZGA 4BQNA 2Y9YA 1VQ6I 4LG0A 5H2FC 1K83J 5ICEA 2R7UA 4WXDA 2DA7A 1BIBA 4RBOA 2A05A 2M4GA 4BKXA 3S32A 5HDKA 1YYVA 4IRGA 3GXOA 4BEHA 2DBBA 2ADUA 2EZIA 1Z6RA 2NOJB 5JHFA 4BY1J 2L02A 5J1RA 4O5VA 3TMOA 1VNDA 1OCOH 4IHVA 2IGMA 2L7ZA 1BW6A 2FE3A 1ON2A 3RTRA 1IUFA 1XDSA 2MG4A 1SFKA 3FIWA 1J7KA 2FX0A 4A5NA 4BE1A 2R93J 2E19A 4HX7A 1GVJA 3P9IA 5JLWA 2R7XA 4A3EJ 2KJCA 4M6XA 2ZJ2A 4NC7A 2GM4A 4IQJA 1JXSA 3GZNB 2DMUA 3I3LA 2IS4A 3P9CA 2W57A 1WZ2A 2I8DA 5F04A 2F2EA 2HS5A 3OOPA 2G7UA 2VN2A 3CMAI 3CLOA 4LB5A 1ZHFA 5EF6A 1LDJA 5F1RA 2Q8KA 5FGMA 4YIRX 3CCVI 2JA8J 1SFUA 2DFFA 1ITYA 3IRRA 4XN0A 1B4AA 2HOAA 5B1AH 2ME6A 2EILH 3HC7A 1GVDA 3QYFA 1ZK8A 2FSWA 4NDLA 1UZCA 4RB0A 3Q0UA 3DLAA 2LBFB 1K79A 1I3AA 2EFWA 2NS0A 3S3NA 1LPQA 2E35A 1EKEA 4C3JJ 4EQQA 1T56A 3FHZA 1E3PA 3DPTA 3I59B 3BZ6A 3K69A 5LRSA 5JR3A 2CU7A 1ZAOA 3DKXA 1FTTA 5TRDA 3FMRA 2BHYA 4N0BA 4CCLA 5HS9A 2ETHA 5CPRB 1Y1WJ 4Q5SF 2JMWA 1VQPI 2L9VA 2L7FP 5K1YA 2X1CA 4RA2A 2KT0A 4IVNA 5JHUA 1KQ0A 2QF7A 4PFPA 5BOXA 4CCOA 2WV1A 2NVYJ 2WA0A 4DYCA 1XDUA 1IN4A 1S7AA 4D9JA 4Z2YA 4EVIA 1V3FA 2FRHA 3DPLC 2K86A 4A3JJ 3ABKH 3VOEA 3ZQQA 3HRUA 5J6XA 4OIOF 2VC0A 2I10A 1XGSA 2ZXJA 2LLKA 2GBYA 2OD5A 2ZNYA 1XGMA 1EH6A 2HTSA 5JVGF 1OLTA 4RLQA 4CHUA 2NAZA 1UAAA 3KCCA 4HDVA 4BH9A 3V7RA 3UKGA 4LFUA 1OKRA 2KMUA 2HTJA 3WTXC 2O8XA 5B1BH 1ZG5A 3WHBA 4XRSG 2RQQA 3QOPA 4HNUA 2HEOA 2EB7A 3FZVA 4ITVA 3LSHA 4N9IA 3SHFA 1HQCA 2K9NA 4CZCA 4ENNA 1ULYA 4UY8I 1AWCA 2LSOA 4KICA 2MH2A 2L9NA 3DLLF 2EA2A 3OYJA 2CV2A 1I6XA 1B8IA 1U78A 4PFOA 3HUGB 1YO5C 2VONA 1I1SA 3PL8A 2LNBA 5F64A 3NRVA 3KLNA 5F0HA 4B8XA 3K7AJ 3VYRB 4BXUA 3GWZA 1EV7A 1QO0D 2VBZA 2IA2A 4HBLA 4S04A 3ZMUA 4A0ZA 1QPMA 1SD4A 2BW3B 3MCZA 2V4JC 3H0DA 5IYBJ 3TDZC 2X9DA 3I59A 3BTJA 4F3QA 3CESA 2VQGA 4AYBN 2VJ4A 2Y31A 1H9GA 4EJTA 3IWFA 1ZRFA 2LTPA 3BJ6A 4MEXF 1BW5A 4C30A 1MGTA 1N75A 1C0WA 4L0ZB 4RGUA 1LFBA 4UUTA 3I56I 2MH9A 4CGZA 1SFEA 1P4XA 3I5UA 5CYVA 3BJOA 2X6YA 1R6RA 3B02A 1KU7A 3ZMDA 2STTA 1UG0A 2PN6A 3HTUA 3IWZA 2RQPA 3CCJI 1U6GA 4KUMA 5ILSA 3TBIA 2CWEA 5LGNA 2D5VA 4IPAA 2AQEA 1U8BA 3HSRA 4AIHA 4D7MA 4MGRA 2ZMEB 1KONA 2CO5A 2KDOA 2WAQA 3DXJF 4M9XA 4AVZA 1W5TA 2KFDA 5K5RA 3MVPA 2GWRA 3RPUD 4I01A 3QOEA 4XSZF 4AD9A 2HYJA 3DTKA 4ON0A 5HNFA 4CYCA 3H3ZA 5FO5A 1HOMA 3TQNA 2LDUA 5L3BA 2ECCA 1OMIA 4B3XA 5H6RA 2ID3A 2A07F 2IS2A 2R7TA 2Z9OA 1MMSA 1H88C 2ZJRF 1FY7A 1Y8QB 1YE9A 2ZFWA 2L9RA 3OYGA 4LLLA 4HLYA 2A6TA 2EJRA 3KP3A 5DCFA 2LP0A 2Z3YA 3GTKJ 4ZDOA 1RR7A 2DI3A 2EK5A 1YJ9I 1G4DA 2F4IA 3F8FA 3OYHA 2H6BA 3F3XA 1ZGJA 1BI2A 4M74A 3LFUA 2DK5A 3G3ZA 5HVQC 4AM3A 1E17A 5KK1A 2BW3A 3F6VA 1D0XA 4EGZA 4BS9A 5DTDA 4HYEA 4G12A 1U8RA 2FNAA 3CMYA 5F0CA 1OCPA 4HF2A 3CJRB 2M1BA 3ABUA 5GAEJ 4ZTFA 1IXSB 1R22A 3GO5A 3RQ4A 3LAJA 1WJ5A 3FHNA 2M7AA 1T39A 4CCKA 4YEJA 3ERMA 5L3FA 4AYBA 1NHAA 2LR8A 3MKZA 3H35A 3P7NA 3BDDA 3SXYA 1DP3A 2BBYA 1U5TC 1W5CC 3V7SA 1O3TA 1JUPA 3ZR8X 3I53A 3UR3C 3K4CA 2DFIA 4DBRA 3BROA 3V42A 1J75A 4IOAF 1IUYA 3PUBA 4JOMA 4A2UA 4L18B 1OJLA 1X2NA 5E3LA 1UFMA 2DQRA 3VPRA 5LRRA 2XAHA 3AFHA 3HZJA 5KCMA 2XPUA 4L9JA 4M3EA 1UHSA 1MBJA 1X58A 3RDIA 2D45A 5FLVA 2CJJA 3RSNA 3A0HC 1AKHB 3CUQA 3E5QA 1ZR2A 2Z5UA 5CVJA 3BWGA 3RYPA 2FQ4A 3G2BA 2XSDC 2HVRA 4F92B 4AIDA 1Y8RB 5B3SH 3SFIA 3OIPA 1EA3A 3EETA 3BLYA 1LQ1A 4MQ9F 3LWFA 2ESHA 2L7MP 5M3MJ 2E1MB 2IRFG 3MZHA 4XOPA 3AL0C 1DU6A 4JP0A 2JPCA 4BYYA 1H8AC 2W4SA 5FRNA 2BVMA 3PUFA 1FYLA 4CA0A 5K7HA 2Y0MA 3REOA 4AIJA 3K4MA 3ZQIA 4BGDA 2GA2A 3ZN0A 2E71A 3LSIA 3TGNA 3ZQFA 3DKWA 5BQTA 2XAFA 4N4NB 1JJ8C 3RYRA 4B43A 4PK4A 1YIOA 2F5FA 2QLZA 1FYKA 2H8RA 2VUMJ 1V54H 3JSPA 5CVIA 4D1QA 2CUZA 1WH5A 1FBQA 2W25A 3D5RC 1MH3A 3ZMZA 2DT6A 3F9KA 2HXIA 1FYMA 1J09A 2WTEA 1H9TA 1VQNI 1UJ8A 2V9KA 4ENMA 1V55H 1Z6TA 1PDNC 1Y0NA 3JRHA 2GXGA 5FRMA 2M8GX 1GV5A 4D7NA 1OYYA 2QUFA 4UNOA 2RNGA 3ERED 2OQGA 4GCVA 3SZTA 1I39A 3J80Z 5L3EA 2DA2A 3LA3A 3S1MJ 4Q47A 4WXCA 1NG6A 4KISA 3C2GA 4A3GJ 2DOEA 3CD6I 3I0TA 1AKHA 2Y48A 1AA7A 2ZXWH 5KNLA 5KVRA 2MBFA 3VB2A 3BR2A 1R58A 3C1DA 4DJAA 3C3WA 4C3HJ 3FMQA 2OU2A 4WWCA 2P7CB 1BJZA 2COMA 4UV8A 1O3QA 5FLXK 2JK3A 3DKYA 5L3GA 1HXDA 5KHDA 4NQWB 1E0EA 1T33A 4L9VA 1GXPA 3TO9A 1CF7B 1K4TA 1Z1DA 2HQRA 2VBYA 1K6OA 4KIBA 1BOBA 2XRLA 1QVUA 4XLFA 5TJJA 2YPRA 2D1VA 3I4PA 1HW2A 3R60A 3FXQA 2DT7B 4Y4RA 1WJAA 4H0EA 1FTZA 5EZHA 1SAUA 4MO7A 4ANJA 1Z9CA 5D6EA 3KLOA 1V4RA 2YX7A 4D5CA 2BZTA 1JGGA 1Y1VJ 3F0CA 3WGGA 2DXIA 4E70A 3F23A 2F6CA 2R7OA 3I54A 2XSJC 3HRMA 3M9AA 2NOGA 5E1WA 3BG6A 4GXOA 3PIOF 3RCOA 2L5QA 3OYCA 4KFCA 2ACJA 4RAYA 2ZCWA 1LUJB 4IRHA 1IV6A 1IN7A 4M6VA 1RR8C 1UMQA 5BNGA 4UB6C 2VE9A 1JTXA 2RN7A 1FPQA 1TQPA 3S3OA 3OYFA 2OQRA 2YX4A 2XB0X 2BE5F 1X3UA 3WE3A 2D1HA 4AC0A 3H3UA 4BE2A 2UXNA 3MZ8A 1IXRC 3MQ0A 2HNHA 2KIMA 3CQZJ 3L2VA 4X0GA 2VXDA 2IA0A 2FOWA 5AIQA 1HCRA 2XAQA 3CO7C 2NS8A 3VODA 4UVCA 1XSDA 2XASA 4IXAA 3TW6A 2HOSA 5K7ZA 2AXTC 1OCCH 1QRYA 2HOTA 3DTIA 3KYDB 2IBDA 4KYWA 1R5HA 1S9HA 1CF7A 2WAFA 4G6QA 5LHIA 3BPVA 3VWBA 4A3FJ 3M1CA 2OV7A 2CQ7A 3V4GA 3ZN1A 2EIMH 3F72A 3CZ6A 2M3AA 4EJOA 1R49A 2M30A 5LD2C 2K3FA 4DW6A 4IKFA 2XAUA 2L3DA 2ZB9A 3QWLA 3O3KA 5GP9A 3R6SA 6PAXA 2PG4A 2YU9J 2F5DA 2CV1A 3HOYJ 2EA4A 3NEUA 4KA4A 2ZSIB 3F8CA 2L54A 3LOCA 5JI6A 5LHGA 1OCTC 2Z1DA 5C4JJ 1VF9A 1X19A 5CVVA 3E6BA 2OTLI 4KMFA 3S1NJ 1JKPC 4M73A 4XSXF 1WJCA 1BA5A 1HKQA 1JT0A 4JX4A 3QPHA 5F1JA 3MAJA 3IAS2 2EBIA 1ZGAA 2MW8A 4CCMA 4M9SA 4C2MJ 2UZKA 4Y17A 3HXLA 4II2A 3DEUA 5IP9J 2L7KA 2GLOA 4I98B 1EH8A 2JPBA 2R5ZA 4RS8A 3JRFA 3E6MA 1PVEA 4XOTA 4QPQA 1GDTA 2VE8A 4LD5A 3BJAA 1PP8F 1QNTA 1X1DA 2ZMEC 1VQKI 2R7SA 1ZH5A 5GADJ 1USSA 2KRFA 3LSRA 3CC2I 4DGWB 2HR3A 3VFZA 3PSIA 3S93A 2R92J 2FF4A 4XBFA 1Y39A 2VB6A 1IDZA 3LSPA 3CTAA 1IZ1A 1JHFA 1U5TB 4NNJA 3MEXA 4A93J 4A6DA 3PQKA 2CSOA 1S3JA 1YITI 2Y75A 1FP2A 1WQ2A 4OAZA 3Q3SA 2XHKA 2HZTA 2JRTA 2BHZA 2DCEA 4LMYA 4Q4ZF 1TLHB 2HGCA 2HQNA 2K27A 3H9GA 2LKXA 1LVAA 2LH9A 4IHWA 4W1UA 2LG4A 3ZQHA 3JCUC 4LITA 2XUBA 1SD5A 1WJDA 4BACA 3HDDA 2OF7A 5CKTA 1SD6A 1BOAA 3SQNA 3HHHA 4J19A 5FLXZ 2ZKZA 1MNMC 3HOTA 4UVAA 4I0AA 1VQ4I 3OL3A 2MSYA 2EPFA 2NNNA 3ISPA 3CP2A 4IO9F 1J59A 2HXOA 4HNVA 2DTZA 3ABLH 4KMUX 5LBQA 4EM0B 1T2KA 3N4MA 1XGNA 2F5VA 4MIMA 4P9FA 2RREA 1WPKA 3KP2A 3H5AA 1IW7F 3DBLB 5HLHA 2QSGX 4BQOA 5C4XJ 1S7EA 1XCVA 2QA4I 1I50J 2MD0A 1ENHA 4U7BA 1WSUA 4PDKA 4ASNA 2DPDA 1WI9A 4OU0A 2KISA 2IP2A 2P5KA 3FK6A 4BJ5C 1O4XA 1B59A 4LG3A 2JVHA 3MD2A 3GX4X 3O6BB 4WX9A 1EH7A 1IG7A 3W3CA 3HM5A 2FEZA 4IRIA 3ECHA 3AAFA 1XMKA 2AHQA 4YELA 3CP8A 4A5MA 4XLCA 4PSWA 3F8MA 4E7IA 4XICA 4IL6C 4LK1F 5TISC 2CUEA 2VJIA 5D4SA 4UVBA 3SFZA 1TWAJ 4QTRA 1U5TA 4XIDA 5F6FA 2VKVA 4DYRA 4LGWA 2VC1A 2P81A 1FOWA 2VIXA 3CMMA 5GTHC 5J8FA 5CVUA 3CCLI 4BHPA 1D8KA 2ZJPF 4G6TB 2Q1ZB 2B7EA 3FKIJ 5M3FJ 2E1MC 3LSJA 1USTA 2H1LA 1BI0A 2V1UA 3IUOA 3I64A 4II3A 1X4PA 2PBIA 2QKMB 5EGOA 1MJAA 4E7SA 3OSGA 1RUNA 3JRDA 5FKMA 3OSFA 2O03A 3JAMZ 2E7XA 3HSEA 1XB4A 4EV0A 3L2QA 3KYLA 1O3SA 1LE8B 1MMDA 3HB9A 2VPLA 3JRBA 3HJEA 2ZXHA 3LAPA 1ZARA 2HDCA 2F5EA 2BEOA 3BOQA 3WODF 1VQLI 3L7WA 1W7PB 2RGVA 4R8HA 5BS6A 3T8TA 2KPMA 4QLCU 5HOOA 1TW3A 3C2HA 3FBNB 5FKLA 2VJ5A 3E97A 2HQ5A 1MKMA 1UELB 3G4SI 4IOCF 4CUGA 1G3SA 4FX0A 3HPGA 3F21A 1YI2I 5ICFA 3CLQA 3MKLA 2W48A 4HLXA 4Y33A 1X1AA 3BR5A 1MJ9A 1MMAA 1R1UA 2R7WA 2L4MA 1P7IA 1TWHJ 2RC4A 4L5IA 1O7FA 2GAUA 5A2QZ 1UB9A 4WF2A 2O9LA 4RB1A 3G1LA 4U0WA 1PP7U 1ETVA 3AG4H 3Q9SA 2CS3A 2ECBA 1STZA 3DEWA 5IOZA 1Q1HA 4HDUA 1JKRC 3CCQI 1KU3A 3V8KA 1F9NA 2DA5A 4J00A 2ME0A 5K5QA 3C2BA 5J8CA 2E5ZA 3FM3A 3KP5A 2GXBA 3DCFA 2ZJQF 3S8PA 3SZPA 1HKTA 2EZLA 3OWTA 4RAFA 3K1MA 4I76A 1MSEC 1LEAA 4Z6YA 1WH7A 5E8IA 3I58A 1W36C 1Z7UA 2QCOA 3WG7H 3J7ZI 2P7VB 2V1DA 2FMYA 4CSWA 2IW5A 1TNTA 2EH3A 3WTYC 3ZCOA 2WY8Q 4B3AA 1HA8A 5IT9K 1XS9A 4U87A 2LKPA 3LL7A 4CICA 1D8JA 4ZDLA 3QYBA 3OYEA 3GTJJ 2K4BA 4I99C 4A3DJ 2XPVA 3KE2A 1LE8A 1R71A 3OR1C 4OMYA 3OYIA 1ZYRF 3ML6A 3E0JB 5JLXA 2CQKA 4G94A 3ZQCA 1APLC 1NK3P 1HDDC 2DDBA 4XLNF 1YQAA 1W7PA 2EIKH 2VQLA 4M72A 3IV5A 4WXHA 1T08B 2MC4A 4BJ6C 3SEZA 4L0YB 1VQOI 1YFHA 2LBFA 1A6IA 4A3BJ 2I5UA 2P6SA 2RAEA 2VKHA 3QP6A 4BHBA 5B66C 3K9TA 4GYIA 1M1EB 4R79A 2M8EA 4PJNA 2N8GA 3DPUA 4I6ZA 1DDNA 2VKDA 4L5EA 2R7VA 3S17J 2J5PA 1P92A 1NH3A 3RJPA 3H3VK 3FDYA 1FLIA 2JJ7A 3FM5A 4LK0F 1UCRA 4R1HA 2A6HF 4IX7A 4FT8A 3S2HJ 3ABTA 1REPC 1XTAA 2KL4A 1ORKA 1UHMA 1MBEA 2A68F 4U0VA 2HOEA 4L9TA 2BYVE 5D6FA 2COBA 3GCMA 3IH3A 3D0SA 4DQ2A 3HPHA 1H89C 2ESNA 1IV8A 2OUMA 2Y30A 3WTTC 4XQFA 1FSHA 2JSCA 1U9OA 3HRTA 1WI3A 2UWMA 1A35A 1L3LA 1FX7A 2YUSA 5K7FA 1P4AA 2F4MB 3KPHA 3DBHB 1LJ9A 3FF5A 3Q9VA 1RIOH 3ZMTA 1D1AA 3R4KA 2YSRA 3JRCA 5DD4A 2NRAC 1YLFA 3TEDA 5CVRA 2W85A 2H27A 1LKXA 2ELJA 3HUGA 4PJ0C 3M1EA 3S14J 4FCYA 4Q48A 1Z77A 4XM3A 4BY7J 1BIAA 3J81K 2FU4A 2G7HA 5K5OA 1XC5A 4RAGA 1MDMB 2XV4S 3HGYA 2E2IJ 3GTPJ 3HOVJ 2BV6A 1WFXA 3OL4A 3W6JB 4FETA 2JZYA 4HW0A 3TW7A 2JA2A 2OA4A 3C7JA 3GTLJ 3FMSA 5H6QA 2G0EA 2XB5A 2KDZA 3BR6A 4G9YA 1LDDA 1SC7A 2XKOA 3R0AA 2NVUB 2PMZN 5E1XA 2IGOA 4MTDA 2CW0F 2GIVA 4A3KJ 3TOBA 1W0TA 1MBKA 4QPOA 1MZBA 3LSMA 2Q2EB 4FISA 1XGOA 2BY2A 2XAGA 3RZOJ 3JTHA 3W6VA 1Z91A 2FUG2 3OYAA 4ZYDA 3M8FA 2PJRB 3QQAA 3IL2A 3GMEA 3M07A 4YFXF 2IAIA 4WCGA 4H4KC 1ZQ3P 4HEA2 3RPQA 4OIRF 3GTOJ 3K4BA 5IYCJ 3U21A 5HLGA 3ULQB 2E1CA 5E3NA 1ETKA 1VQMI 3HEFA 4ENKA 2ZMEA 5HODA 4A12A 3DU5A 5GPCA 5D5WB 1HBXG 2KIUA 4MLOA 1RI7A 3PIPF 1AOYA 1R4MB 4BQQA 1POGA 2CQQA 2DOAA 3HIFA 4B09A 2ZSHB 1IAWA 1N78A 1SVLA 2E5NA 2DW4A 4BL0B 4HQMA 5IT3A 5ERIA 2EFNA 1I3QJ 3K1PA 1GT0C 2QYOA 1HC8A 4MEYF 1T38A 2DJNA 1DU0A 3GTMJ 1BR2A 3PNTA 3FISA 4ESFA 3Q0VA 2CGPA 3KZYA 3LA2A 1LB2A 1WJFA 5LFAA 3H36A 1EJ9A 2F48A 2X51A 2YS9A 3K2AA 5FJ8J 2Z33A 1NK2P 2F5CA 2PI0A 1ETYA 4P9UA 3K70C 2E2HJ 3QPSA 3KP7A 5GAHJ 3KFWX 4XKCA 3IHUA 1FBUA 3LMMA 1RNLA 2CMPA 4DIQA 3E6CC 5E18F 1WGXA 1F5TA 2XF5A 3I71A 4F7ZA 3GTGJ 1BR1A 2K3PA 4HPQA 1FZPB 5HS8A 1IF1A 4MFEA 2UXXA 4DBQA 2LRDA 4MNUA 3HOWJ 4QSHA 5FKOA 2H8WA 2Q2EA 1MMGA 5DM6F 1VQ8I 4J01A 1ETOA 4HX4A 1S5LC 2PFBA 2XGDA 2PJRA 4FE4A 4HQEA 5J40A 1D3YA 5E3MA 3VYTB 4L5JA 1K6YA 3SYTA 2CRGA 1JI8A 3DFGA 5J3LA 4NC8A 1OPCA 3OYDA 4PCQA 2IXSA 1G3TA 4ZC3A 1AHDP 3OYBA 3HSFA 4IJAA 4O6JA 1KZHA 5IY5H 3BC8A 2VPRA 5E79C 4GGGA 1FIAA 2TCTA 4E6KG 4YRVA 3G71I 3QPTA 5J47A 1ACIA 5LEKA 1GLNA 1FJLA 1IXCA 4DYQA 1KGSA 3R61A 2JA5J 3IKVA 1S6LA 2EWNA 5F27A 1XN7A 2HQAA 4BQAA 4BJTA 2AS5F 2MGQA 2EZKA 2MLKA 3SEQA 3L2CA 3HTSB 3VSKA 2HYFA 2GA1A 3WHCA 2E2JJ 5L3DA 4RGSA 2H09A 4I02A 1X1BA 5HLIA 3A01B 3PQJA 4HV6A 4XORA 2K85A 1RETA 3H5RA 3HRSA 1Z21A 3RKWA 3UNGC 3BZKA 4YFNF 3NAUA 5FD5A 2X4HA 2DDAA 1OISA 3K2ZA 1IJWC 4HG2A 2HI3A 3GW2A 2FBKA 1TT0A 4PJJA 5ICCA 3ASOH 4RGRA 1DGWY 3BR0A 3CCSI 3L2WA 2O6GE 3A2KA 3S15J 4A3LJ 4UUVA 4V2GA 4E7KA 2LF7A 5C3EJ 4ZZLA 5M5YJ 3ELKA 4P5OA 3ZQGA 2CG4A 1IRGA 2LMDA 1SVMA 3OIOA 4BE0A 3H9JA 5GPAA 4RM2A 2EFQA 1W7PD 2KKOA 3G1MA 3HOSA 2RDPA 2A6EF 3PM1A 3X2QH 3BP8A 2O5RA 1FMWA 2KZGA 1F36A 5DUKA 2CUJA 3HGGA 1YX3A 3GVAA 3HKZN 1Z05A 4N9HA 2M34A 1JKOC 2WAEA 1HW1A 1YRNB 1G59A 2BOLA 1OFCX 2V1NA 1ZGWA 2X6XA 4GYGA 3WTZA 2XGEA 5FKKA 3BG3A 3LSKA 3BG7A 2DMNA 1T95A 1P6RA 2PMHA 5BMZA 1DPUA 3DWLE 2Y0SN 5IOYA 4EJVA 3EQLF 4XR6A 3CF5F 1DP7P 4HSTA 4HX8A 3A4CA 3K10A 4KIFA 1JT6A 1A04A 3PNVA 4D0PA 1WCMJ 1R23A 2DJIA 1KU2A 3ECOA 2AXLA 4G8XA 4ENJA 1ETQA 3KP4A 4NQWA 4MFDA 4NC6A 2DFEA 2NS7A 2DPUA 2M4KA 1RC9A 3Q5FA 3ZXSA 3OYNA 3BR3A 3PFYA 3KZZA 4HF0A 4CYDA 2X48A 4OMZA 3GYHX 4KN7X 2XGCA 3ZP5A 3BR1A 2F4OB 1BM9A 4ZYGA 2HYGD 1R5GA 3M3YJ 1G2HA 2HZDA 3FKJA 4B47A 5DD8A 5EEGA 1X4OA 4P1WA 5DCMB 3TDUC 1MIJA 4ZH4F 2OBPA 3GEZA 1X1CA 2BY0A 2QBYB 1G6NA 4UV9A 3CCMI 1VZ0A 3J7AY 1XPXA 2IGKA 3K1NA 1U3EM 2IS6A 4M3BA 5D4RA 2Q0OA 2MFZA 1JHHA 1DUXC 3WU1B 4ZYHA 4N4OB 4JQFA 3HBLA 4Y13A 1E3HA 1V5FA 5IPAA 2IS1A 3EPZA 2R7DA 5AIPA 2LOOA 2PMUA 3CCRI 1G3YA 5LHHA 3H5NA 3GTQJ 3HKZA 2VQCA 3TP3A 1BC8C 2IT0A 2P6TA 3PFIA 4IEJA 2IJLA 2VJJA 1FBSA 4KT6A 3W2VA 3L9FA 2R7QA 1T6SA 1SEUA 2ELHA 5LEJA 3KP6A 2MA3A 3FWEA 2EINH 2M7BA 3FXRA 4M9ZA 3DF8A 4M3FA 2FA5A 2M2EA 3LQQA 1SAXA 5J1UA 4IHTA 2B9SA 4E7LA 3JW4A 4BNCA 2BY3A 3F22A 2HFHA 2L2OA 2R3SA 2Y0SA 1NG7A 3FBIB 3S1QJ 3RPUA 1G3WA 3H0GJ 3BCAA 3CJNA 4EMSA 4G7ZF 1YW7A 4CXFA 2QWWA 1O57A 1JKQC 4DOZA 4FTHA 2LF8A 2EV6A 1RUOA 1QPIA 4OIQF 2K9QA 5EG0B 3CF2A 4XLAA 4O3MA 3QP5A 5CQGA 1BBYA 3GFMA 3G73A 1TTYA 2FJ1A 5ILUA 1N77A 5ICGA 1N25A 3I55I 3T5XA 3L1PA 2ISYA 3K0LA 1MBFA 4XNFA 3JRIA 3MZYA 5DCMA 3LA7A 1A36A 1DQUA 1WWXA 3BT9A 4ZJZA 4HZFA 4KNYA 4LLNA 5IYDJ 2QBYA 3M8JA 3VYUB 5L3CA 1PYVA 1OYIA 1YJWI 1R5ID 5FD6A 4BHCA 4RAZA 3QU3A 2VASA 2Z2SB 1R9TJ 2JQ7A 2LY1A 2DMQA 1YW8A 3RZDJ 4NHJA 1T0FC 3GZ5A 3SDGA 1TBXA 2OCCH 4I7HA 4PUSA 5AONA 4C3IJ 2LREA 3M7GA 3B6AA 5EYRA 5LGUA 2XKPA 4I2OA 2LYCA 4AWXB 1I27A 3BCBA 4YFKF 1IDYA 1D0ZA 5DV5A 4GDFA 2P0WA 2QVOA 4PGHA 4YG2F 3E5UA 3RI4A 3EUHA 1J0RA 1IN8A 2FQ3A 2V26A 1LDKB 2V7FA 1ZLKA 4ZDPA 2DAOA 2YU3A 1WVRA 2K5CA 2V6CA 2ZNZA 3VSLA 2DA3A 1ETXA 2DFHA 3E1SA 1P9QC 4G7HF 4CZZA 1YS7A 2W1OA 3DU6A 1YIJI 4JBAA 1OR7A 2JUGA 3JREA 3I9V2 1VTNC 1W4MA 2XROA 4B48A 3U1KA 2TDXA 2MC3A 5E17F 4MHGA 4W97A 3AG1H 2DA4A 4A3CJ 3OMYA 4XLEA 4XONA 1RKWA 3MWMA 4EEFG 2QSHX 2FMLA 1TZLA 4AUXA 2QGUA 2EV0A 5M5WJ 3BQYA 5EG0A 3AG3H 4A0XA 1MMNA 3HL2A 2KIFA 4CCNA 4ZYAA 3RKYA 1QA6A 1FC3A 2HKXA 3WG9A 3H9QA 5LGTA 2JA7J 2DLLA 1P2FA 2OTJI 3AG2H 5HS7A 3JRAA 3QU6A 4E7HA 3TKYA 3PNYA 3CC7I 3GFIA 1P4WA 2DO7A 2KIQA 4TV7A 2W00A 1ZELA 4LJZF 5FROA 1QVTA 2PEXA 1HW5A 3HOZJ 2KJBA 3EUAA 2IEKA 4E7JA 3BTCA 3N97A 4IQ4A 2ZFUA 1ZRCA 4E7ZA 2L4AA 2L9SA 4HRIA 3RQIA 3WTVC 3A1YA 3EYYA 5JVTA 1GXQA 3COAC 1B8IB 1FOYA 1FMVA 1TW2A 1IRZA 5B5EC 2DK8A 3QAHA 4OIPF 2P8TA 4GFBA 1FIPA 2HPMA 2L01A 2P5LC 4Y15A 2QZ8A 1SVOA 2LFBA 3LNQA 3L2UA 1TL8A 2HDDA 1T8IA 2V79A 1FNNA 1T98A 2CFOA 5DEQA 3P9KA 1TWGJ 1FEXA 2WWYA 1Z67A 1X3ZB 2LVSA 1NTCA 2DYRH 4XRFA 3CMEI 3R0JA 1ETWA 2DU9A 2RVCA 4A3IJ 3T0YA 2MLGA 3HOUJ 1IO2A 3CJQB 2OC6A 4FE7A 2H94A 4OINF 3VEPA 2WB1N 2QQAA 2QM3A 3MMYB 3GFLA 3N05A 4IHXA 2VOPA 1IRXA 1ZTRA 2W84A 3KEQA 3DTEA 1RESA 2WAQN 1R7JA 2LC2A 2RKHA 3V8JA 1LVKA 2ELKA 4NUBA 1SFOJ 1FP1D 1S72I 3FXUA 4E4HA 1JTYA 4WK8F 3CC4I 2CV0A 2WADA 2DOFA 1MW7A 2XIGA 3IRQA 1BC7C 1MH4A 3L00A 4YIFA 1W36D 1ONVA 3L2RA 1AU7A 2A61A 4PZJA 5E20A 3BPXA 2GZWA 2RV8A 3B6CA 3GBGA 5E3OA 3I4NJ 3OYKA 2DODA 3OYMA 9ANTA 3SJMA 1CGPA 2XRNA 5EEAA 4P96A 3IP4B 4CYCB 1LEBA 2A69F 1ZREA 1BN5A 1TP4A 3WTUC 1J2XA 4X6AJ 4RB2C 1S29A 1RKTA 2TRTA 2NNYA 2KHMA 1QZEA 2X6WA 2J5OA 5CJ9A 2EFOA 1TNSA 1LFUP 2M87A 2AO9A 4X1EA 5HDNA 1PUFB 4EJUA 1XX5A 5J1YA 5DYMA 3HYIA 3OY9A 4M6YA 3WTWC 3GUDA 4OOIA 1QQIA 3RIRA 1MBHA 5HNHA 3O2PE 3OR2C 2OPTA 4QWQA 3W2WA 2K9SA 2YR2A 3M4OJ 2XVCA 1R1TA 2VBWA 4HOBA 1R4NB 4C2UA 3EUKL 3KYCB 3GF2A 4PJMA 5EDNA 4AU7A 2OCEA 3JSOA 2GOMA 2LY2A 2DMTA 1F1ZA 2OJED 1TWCJ 4CH7A 4EGYA 3MN2A 1B6AA 4U88A 2JN6A 2E60A 3D5SC 3DP7A 3J80K 3PO2J 2EFPA 3FXOA 2M9HA 2QEXI 3L09A 1QZYA 4I09A 4XKVA 1E2XA 2BGCA 2HWVA 3OS2A 2EQRA 4V2FA 2WB1A 2ZO4A 4V19K 2X1EA 2X85A 1V5EA 2PX9A 2LY9A 3FXMA 3ASNH 3O8GA 2Z99A 1ERDA 2DTRA 3F6OA 2Y2ZA 3ZQ7A 1YJNI 3K4JA 3J7AO 2M0CA 2VT3A 1WJBA 2E34A 2E1OA 3HG9A 4LIUA 1TC3C 3IKTA 3ZGKA 2JSPA 1HSJA 4CO8A 3V8LA 2E1NA 3W6KB 3S3MA 4RMNA 5D5UB 4M3GA 5IP6A 4RB3C 3CUQB 2XGXA 1ZR4A 4DNCA 1JUSA 5FFZA 4EJWA 5F08A 1XD7A 4XL9A 3QRFF 4A3MJ 1MNEA 4MQVA 4BDZA 3F8BA 2XDVA 3ONQA 1PUFA 3P5JA 2VLAA 1MD0A 1VQ7I 2OAZA 1QGPA 1BI3A 3EUHC 2HPIA 5F0FA 1A31A 3E5XA 3HOXJ 4XKWA 3LFKA 2QKLB 1XSVA 3NWSA 1VI0A 2Y69H 4LOCA 5HDGA 1MBGA 3JR9A 3GFJA 3IC7A 2V6EA 1HLVA 1VQ5I 3F8NA 4LLGF 5DDGA 1U9NA 2DN0A 2DQLA 2JA6J 4AIKA 2FD5A 4GO1A 2R7RA 3NARA 1OR7C 1RRJA 3ZPLA
chains in the Genus database with same CATH topology
2CYYA 1TQIA 2DT5A 1WKMA 2V1XA 1IRFA 5FFXA 3HHGA 1B9NA 1GHCA 1S7OA 3DQVC 4HV5A 5D5XB 1SFXA 2WC2A 4M71A 2X0LA 5ILVA 5DUIA 1YW9A 4U0YA 5IT9Z 3OV8A 2R7FA 2WV0A 1MDMA 4PGGA 3WU0A 2QQBA 2FBIA 1B1BA 4A6EA 1ZN2A 2XAJA 4IF4A 2RNJA 4AVPA 1SMTA 5E1ZB 1DPRA 1FT9A 2ISZA 2FXAA 2PQ8A 4K2EA 1T0FA 3C18A 2K7LA 1YTYA 1MJBA 2IPQX 3M8EA 2OZUA 4UXNA 1XCBA 4CDGA 1HSTA 2O3FA 1J9IA 4KIGA 2E7WA 5LLQA 2CFXA 3TO6A 1O3RA 4ESBA 1PUEE 5H20A 2M45A 2VXZA 1XMAA 2VOOA 3CUOA 5E8GA 3E6DA 1ODDA 1IN5A 1HKSA 5BPDA 3B73A 4KDPA 3T8RA 1FSEA 5D5VB 2FOKA 4MTEA 3U2RA 4KN4X 2K02A 1R1VA 1D5VA 1K78B 2JTVA 3D5LA 4KT5C 1BJAA 3TO7A 3J81Z 3LQRA 3U1DA 4ZZDA 4NB5A 1UHWA 4JK1X 1OYWA 2HKOA 1B9MA 3WGHA 3CO6C 1JGSA 1KU9A 3TOAA 3NQOA 1KYZA 1KQ8A 2QENA 4BAYA 1K7AA 1KQ9A 3FX3A 1ZG3A 1LNWA 2P5VA 5BPIA 4RGXA 3EYIA 1I5ZA 4ESJA 4UHTA 2OZ6A 3KETA 4ETSA 3GZ6A 1BI1A 1R00A 5CLSA 3H92A 2NYXA 4S05A 1K78A 1TQMA 3ZMSA 5JFRA 1RZ4A 4HA8A 1Y0UA 3ZMVA 4YIIA 3LSTA 2K4JA 2A3SA 4LB6B 2FBHA 1R36A 2GQQA 1ZRDA 3JAMK 5D8LB 1I1GA 4FX4A 2B0LA 1L0OC 3EDPA 4EM1A 2VODA 4G6DA 1SD7A 4EM2A 1U2WA 3WGIA 1YG2A 1YS6A 4A0YA 1KA8A 3S2WA 3JTGA 5EEHA 1J5YA 1F4KA 2W24A 4ZYEA 2ZBKA 3BY6A 1SMYF 1W5SA 2G9WA 5A2QK 1ON1A 1S8NA 3MFKA 2V9VA 2VT2A 4U7DA 4HAMA 2PJPA 3RKXA 3T1BA 3DV8A 4LG0B 2FNPA 3E3VA 1ZG1A 5FB2A 4IHSA 1IN6A 3CUQC 1ZLJA 3KEOA 2EV5A 2MD5A 2VBXA 1XSXA 4FHTA 1QZZA 2JT1A 2O0YA 2M5WA 2O61A 2QQ9A 4P55A 1QBJA 2A5YB 4G7OF 2IA1A 2P4WA 3ROUA 1FWZA 2D2WA 3GLXA 5D8KB 1FOKA 1JE8A 2STWA 4L9NA 4HF1A 3WE2A 3CDHA 5ED4A 4I0BA 1WRJA 2IVMA 3WTSC 3V7CA 1KYWA 1O7LA 3U9GA 2PLYA 1H0MA 2C6YA 2H6CA 4XLPF 4LG0A 5ICEA 4WXDA 1BIBA 5HDKA 1YYVA 4IRGA 3GXOA 2DBBA 2ADUA 1Z6RA 2L02A 4O5VA 2FE3A 1ON2A 3RTRA 1XDSA 1J7KA 4A5NA 4HX7A 1GVJA 3P9IA 2KJCA 4M6XA 2ZJ2A 1JXSA 3P9CA 2W57A 2F2EA 2HS5A 3OOPA 2G7UA 2VN2A 3CLOA 4LB5A 1ZHFA 1LDJA 5F1RA 2Q8KA 5FGMA 1SFUA 3IRRA 1B4AA 2FSWA 4RB0A 1K79A 2EFWA 2NS0A 4EQQA 3FHZA 3DPTA 3I59B 3BZ6A 3K69A 5LRSA 5JR3A 1ZAOA 5TRDA 3FMRA 4N0BA 5HS9A 2ETHA 4Q5SF 5K1YA 4IVNA 5JHUA 1KQ0A 5BOXA 1XDUA 1IN4A 1S7AA 4Z2YA 4EVIA 1V3FA 2FRHA 3DPLC 2K86A 3VOEA 3HRUA 5J6XA 4OIOF 2VC0A 1XGSA 2ZXJA 2OD5A 2ZNYA 1XGMA 1EH6A 2HTSA 4CHUA 2NAZA 4HDVA 3KCCA 4BH9A 3V7RA 4LFUA 1OKRA 2HTJA 3WTXC 2O8XA 1ZG5A 3QOPA 2HEOA 2EB7A 3FZVA 4N9IA 3SHFA 1HQCA 4ENNA 1ULYA 1AWCA 2LSOA 4KICA 2MH2A 2EA2A 1I6XA 1U78A 2VONA 1I1SA 1YO5C 2LNBA 5F64A 3NRVA 3KLNA 4B8XA 4BXUA 3GWZA 1EV7A 1QO0D 2VBZA 2IA2A 4HBLA 4S04A 3ZMUA 4A0ZA 1QPMA 1SD4A 3MCZA 3TDZC 3I59A 1H9GA 4EJTA 3IWFA 1ZRFA 3BJ6A 4MEXF 1MGTA 1C0WA 4L0ZB 4RGUA 2MH9A 4CGZA 1SFEA 1P4XA 3I5UA 5CYVA 3BJOA 3B02A 1KU7A 3ZMDA 2STTA 2PN6A 3HTUA 3IWZA 2RQPA 1U6GA 4KUMA 5ILSA 2CWEA 5LGNA 4IPAA 3HSRA 4AIHA 4MGRA 2ZMEB 1ZREA 2CO5A 4M9XA 5K5RA 3DXJF 1W5TA 2GWRA 4I01A 4XSZF 4AD9A 4ON0A 3H3ZA 5FO5A 3TQNA 2LDUA 5L3BA 1OMIA 5H6RA 2A07F 2Z9OA 1FY7A 2ZFWA 4LLLA 4HLYA 2EJRA 3KP3A 5DCFA 2Z3YA 2DI3A 2EK5A 1G4DA 3F8FA 2H6BA 3F3XA 1ZGJA 1BI2A 4M74A 2DK5A 3G3ZA 5HVQC 1E17A 5KK1A 3F6VA 4EGZA 4HYEA 1U8RA 2FNAA 4HF2A 2M1BA 3ABUA 1IXSB 1R22A 3GO5A 3LAJA 1T39A 5L3FA 1NHAA 3P7NA 3BDDA 3SXYA 2BBYA 1U5TC 3V7SA 1O3TA 3I53A 2DFIA 3BROA 1J75A 1IUYA 4A2UA 4L18B 1UFMA 2DQRA 5LRRA 2XAHA 4L9JA 3RDIA 2D45A 3CUQA 3E5QA 2Z5UA 5CVJA 3BWGA 3RYPA 3EETA 1LQ1A 4MQ9F 3LWFA 2ESHA 2IRFG 3MZHA 2JPCA 4BYYA 1FYLA 2Y0MA 3REOA 4AIJA 2GA2A 3ZN0A 3TGNA 3DKWA 5BQTA 2XAFA 3RYRA 1YIOA 2F5FA 2QLZA 1FYKA 3JSPA 5CVIA 1FBQA 2W25A 3ZMZA 1FYMA 2WTEA 1H9TA 4ENMA 1Z6TA 1PDNC 2GXGA 1OYYA 2QUFA 4UNOA 3ERED 2OQGA 4GCVA 3SZTA 3J80Z 5L3EA 3LA3A 4Q47A 4WXCA 3I0TA 2Y48A 5KVRA 2MBFA 3VB2A 1R58A 3C1DA 3C3WA 3FMQA 2OU2A 4WWCA 2P7CB 2COMA 4UV8A 1O3QA 5FLXK 5L3GA 1HXDA 4L9VA 1GXPA 3TO9A 1CF7B 1Z1DA 2HQRA 2VBYA 1K6OA 4KIBA 5TJJA 2YPRA 2D1VA 3I4PA 1HW2A 3R60A 3FXQA 4H0EA 1Z9CA 5D6EA 3KLOA 1V4RA 2YX7A 3WGGA 4E70A 3F23A 3I54A 3HRMA 3M9AA 5E1WA 4GXOA 4KFCA 2ACJA 4RAYA 2ZCWA 4IRHA 1IN7A 2VE9A 2RN7A 1FPQA 1TQPA 2OQRA 2YX4A 2BE5F 1X3UA 3WE3A 2D1HA 3H3UA 2UXNA 1IXRC 3MQ0A 2KIMA 2IA0A 5AIQA 2XAQA 3CO7C 3VODA 4UVCA 1XSDA 2XASA 4IXAA 4KYWA 1R5HA 1CF7A 4G6QA 5LHIA 3BPVA 3V4GA 3ZN1A 3F72A 4EJOA 2M30A 2L3DA 3O3KA 3R6SA 6PAXA 2PG4A 2F5DA 2EA4A 3NEUA 4KA4A 3F8CA 2L54A 5LHGA 5JI6A 5CVVA 3E6BA 4KMFA 4M73A 4XSXF 1HKQA 3QPHA 3MAJA 1ZGAA 4M9SA 2UZKA 4Y17A 3DEUA 4I98B 1EH8A 2JPBA 4RS8A 3E6MA 2VE8A 4LD5A 3BJAA 1PP8F 1QNTA 1ZH5A 1USSA 2KRFA 2HR3A 3VFZA 2FF4A 4XBFA 3CTAA 1IZ1A 1JHFA 1U5TB 3MEXA 4A6DA 3PQKA 2CSOA 1S3JA 2Y75A 1FP2A 1WQ2A 2XHKA 2HZTA 2JRTA 4LMYA 4Q4ZF 1TLHB 2HGCA 2HQNA 2K27A 1LVAA 2XUBA 1SD5A 1SD6A 1BOAA 3SQNA 3HHHA 5FLXZ 2ZKZA 3HOTA 4UVAA 4I0AA 2NNNA 3ISPA 1J59A 4KMUX 5LBQA 4EM0B 1T2KA 3N4MA 1XGNA 4P9FA 3KP2A 1IW7F 5HLHA 1XCVA 4U7BA 1WSUA 4PDKA 4ASNA 2DPDA 1WI9A 4OU0A 2IP2A 2P5KA 1B59A 3GX4X 3O6BB 4WX9A 1EH7A 2FEZA 4IRIA 3ECHA 3AAFA 1XMKA 4A5MA 3F8MA 4LK1F 5D4SA 4UVBA 3SFZA 1U5TA 5F6FA 4LGWA 2VC1A 5J8FA 5CVUA 4BHPA 1D8KA 1USTA 1BI0A 2V1UA 3I64A 2PBIA 1MJAA 1RUNA 2O03A 3JAMZ 2E7XA 3HSEA 1XB4A 4EV0A 1O3SA 3LAPA 1ZARA 2HDCA 2F5EA 2BEOA 3BOQA 3WODF 3L7WA 1W7PB 2RGVA 4R8HA 5BS6A 3T8TA 4QLCU 5HOOA 1TW3A 3E97A 1MKMA 1G3SA 4FX0A 3F21A 5ICFA 4HLXA 1MJ9A 1R1UA 2L4MA 2RC4A 4L5IA 1O7FA 2GAUA 5A2QZ 1UB9A 4WF2A 4RB1A 4U0WA 1PP7U 3Q9SA 1STZA 1Q1HA 4HDUA 1KU3A 3V8KA 1F9NA 5K5QA 5J8CA 3FM3A 3KP5A 2GXBA 3SZPA 1HKTA 3K1MA 1LEAA 5E8IA 3I58A 1Z7UA 2P7VB 2V1DA 2FMYA 2IW5A 1TNTA 3WTYC 5IT9K 2LKPA 4CICA 1D8JA 2K4BA 3KE2A 4OMYA 1ZYRF 3ML6A 2CQKA 4G94A 4XLNF 1YQAA 1W7PA 4M72A 4WXHA 4L0YB 1YFHA 2P6SA 3QP6A 4BHBA 3K9TA 4GYIA 4R79A 2M8EA 1DDNA 2J5PA 1P92A 3RJPA 1FLIA 3FM5A 4LK0F 1UCRA 4R1HA 2A6HF 4FT8A 3ABTA 1REPC 1UHMA 2A68F 4U0VA 2HOEA 4L9TA 2BYVE 5D6FA 3D0SA 4DQ2A 2ESNA 3WTTC 1FSHA 2JSCA 3HRTA 2UWMA 1L3LA 1FX7A 1P4AA 3FF5A 1LJ9A 3Q9VA 1RIOH 3ZMTA 3R4KA 2YSRA 5DD4A 2NRAC 1YLFA 5CVRA 2W85A 2H27A 3HUGA 3M1EA 4Q48A 1BIAA 3J81K 2FU4A 2G7HA 5K5OA 1MDMB 2XV4S 2BV6A 3W6JB 2JZYA 4HW0A 2OA4A 3C7JA 3FMSA 5H6QA 4G9YA 1LDDA 2XKOA 3R0AA 5E1XA 4MTDA 2CW0F 2GIVA 3TOBA 1MZBA 1XGOA 2XAGA 3JTHA 1Z91A 4ZYDA 3M8FA 3IL2A 4YFXF 4WCGA 3RPQA 4OIRF 5HLGA 3ULQB 2E1CA 4ENKA 2ZMEA 4A12A 5D5WB 1HBXG 2KIUA 1RI7A 1AOYA 3HIFA 4B09A 1IAWA 2DW4A 4HQMA 5IT3A 5ERIA 2EFNA 3K1PA 2QYOA 4MEYF 1T38A 4ESFA 2CGPA 3KZYA 3LA2A 1LB2A 2Z33A 2F5CA 2PI0A 4P9UA 3KP7A 3KFWX 3IHUA 1FBUA 1RNLA 3E6CC 5E18F 1F5TA 3I71A 4F7ZA 1FZPB 5HS8A 1IF1A 2UXXA 4MNUA 2Q2EA 4HX4A 2PFBA 4HQEA 1D3YA 4L5JA 3DFGA 1OPCA 4PCQA 1G3TA 3HSFA 4IJAA 4O6JA 4GGGA 3QPTA 5LEKA 1IXCA 1KGSA 3R61A 3IKVA 1S6LA 2EWNA 1XN7A 4BQAA 2AS5F 2MLKA 3L2CA 3HTSB 2HYFA 2GA1A 5L3DA 4RGSA 2H09A 4I02A 5HLIA 3PQJA 4HV6A 3HRSA 3RKWA 4YFNF 5FD5A 2X4HA 3K2ZA 3GW2A 2FBKA 5ICCA 4RGRA 2O6GE 4UUVA 2LF7A 4ZZLA 3ELKA 4P5OA 2CG4A 1IRGA 2EFQA 1W7PD 3HOSA 2KKOA 2RDPA 2A6EF 3BP8A 5DUKA 3GVAA 1Z05A 4N9HA 1HW1A 4GYGA 3WTZA 1P6RA 2PMHA 5BMZA 1DPUA 4EJVA 3EQLF 1DP7P 4HX8A 4KIFA 1A04A 4D0PA 1R23A 1KU2A 3ECOA 2AXLA 4G8XA 4ENJA 3KP4A 4NQWA 2DPUA 3Q5FA 3KZZA 4HF0A 4CYDA 4OMZA 3GYHX 4KN7X 3ZP5A 1BM9A 4ZYGA 2HYGD 1R5GA 5DD8A 5EEGA 5DCMB 3TDUC 4ZH4F 2OBPA 3GEZA 2QBYB 1G6NA 4UV9A 3K1NA 1U3EM 5D4RA 2Q0OA 1JHHA 1DUXC 3WU1B 4ZYHA 4JQFA 4Y13A 2R7DA 5AIPA 2PMUA 1G3YA 5LHHA 1BC8C 2IT0A 2P6TA 3PFIA 2IJLA 1FBSA 3L9FA 1T6SA 2ELHA 5LEJA 3KP6A 2MA3A 3FWEA 3FXRA 4M9ZA 3DF8A 2FA5A 3LQQA 1SAXA 4IHTA 3JW4A 4BNCA 3F22A 2HFHA 2R3SA 3RPUA 1G3WA 3CJNA 4EMSA 4G7ZF 1YW7A 4CXFA 2QWWA 1O57A 2LF8A 2EV6A 1RUOA 4OIQF 4O3MA 3QP5A 1BBYA 3GFMA 3G73A 1TTYA 5ILUA 5ICGA 3T5XA 2ISYA 3K0LA 3MZYA 5DCMA 3LA7A 1WWXA 4HZFA 4KNYA 4LLNA 2QBYA 5L3CA 1OYIA 5FD6A 4BHCA 4RAZA 3QU3A 1YW8A 4NHJA 3GZ5A 1TBXA 4I7HA 5AONA 3M7GA 5LGUA 4I2OA 2XKPA 4AWXB 1I27A 4YFKF 5DV5A 2QVOA 4PGHA 4YG2F 3RI4A 3E5UA 3EUHA 1J0RA 1IN8A 2FQ3A 1LDKB 1ZLKA 2DAOA 2YU3A 2V6CA 2ZNZA 4G7HF 4CZZA 1YS7A 4JBAA 1OR7A 1VTNC 1W4MA 2XROA 2TDXA 2MC3A 5E17F 4MHGA 3MWMA 2FMLA 2EV0A 4A0XA 2KIFA 3RKYA 1FC3A 2HKXA 3WG9A 5LGTA 2DLLA 1P2FA 5HS7A 3QU6A 3TKYA 3GFIA 1P4WA 2DO7A 4TV7A 4LJZF 2PEXA 1HW5A 2KJBA 3N97A 1ZRCA 2L4AA 3WTVC 3EYYA 5JVTA 1GXQA 3COAC 1TW2A 2DK8A 3QAHA 4OIPF 2P8TA 2L01A 2P5LC 4Y15A 2QZ8A 2V79A 1FNNA 1T98A 5DEQA 3P9KA 2WWYA 4XRFA 3R0JA 2DU9A 2RVCA 3T0YA 2MLGA 4OINF 2H94A 3VEPA 2QQAA 2QM3A 3GFLA 2VOPA 2W84A 3KEQA 1R7JA 2RKHA 3V8JA 1FP1D 3FXUA 4WK8F 2XIGA 3IRQA 1BC7C 3L00A 4YIFA 1ONVA 2A61A 4PZJA 5E20A 3BPXA 2GZWA 2RV8A 1CGPA 2XRNA 4P96A 1LEBA 2A69F 1BN5A 3WTUC 1J2XA 4RB2C 1S29A 2NNYA 2J5OA 5CJ9A 2EFOA 1TNSA 2M87A 5HDNA 4EJUA 5DYMA 3HYIA 4M6YA 3WTWC 3GUDA 4OOIA 1QQIA 3RIRA 3O2PE 4QWQA 2YR2A 2XVCA 1R1TA 2VBWA 4HOBA 3GF2A 3JSOA 1F1ZA 4EGYA 1B6AA 4U88A 3J80K 3DP7A 2EFPA 3L09A 1QZYA 4I09A 1E2XA 2BGCA 2HWVA 2ZO4A 2Z99A 2DTRA 3F6OA 3ZQ7A 3J7AO 2VT3A 3IKTA 1HSJA 4CO8A 3V8LA 2E1NA 3W6KB 5D5UB 4RB3C 3CUQB 2XGXA 4DNCA 5FFZA 4EJWA 1XD7A 3QRFF 4MQVA 3F8BA 1MD0A 2OAZA 1QGPA 1BI3A 3E5XA 3LFKA 1XSVA 5HDGA 3GFJA 3IC7A 3F8NA 4LLGF 5DDGA 2DQLA 4AIKA 4GO1A 3ZPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CYY A;  1TQI A;  2DT5 A;  1WKM A;  2V1X A;  1IRF A;  5FFX A;  3HHG A;  1B9N A;  1GHC A;  1S7O A;  3DQV C;  4HV5 A;  5D5X B;  1SFX A;  2WC2 A;  4M71 A;  2X0L A;  5ILV A;  5DUI A;  1YW9 A;  4U0Y A;  5IT9 Z;  3OV8 A;  2R7F A;  2WV0 A;  1MDM A;  4PGG A;  3WU0 A;  2QQB A;  2FBI A;  1B1B A;  4A6E A;  1ZN2 A;  2XAJ A;  4IF4 A;  2RNJ A;  4AVP A;  1SMT A;  5E1Z B;  1DPR A;  1FT9 A;  2ISZ A;  2FXA A;  2PQ8 A;  4K2E A;  1T0F A;  3C18 A;  2K7L A;  1YTY A;  1MJB A;  2IPQ X;  3M8E A;  2OZU A;  4UXN A;  1XCB A;  4CDG A;  1HST A;  2O3F A;  1J9I A;  4KIG A;  2E7W A;  5LLQ A;  2CFX A;  3TO6 A;  1O3R A;  4ESB A;  1PUE E;  5H20 A;  2M45 A;  2VXZ A;  1XMA A;  2VOO A;  3CUO A;  5E8G A;  3E6D A;  1ODD A;  1IN5 A;  1HKS A;  5BPD A;  3B73 A;  4KDP A;  3T8R A;  1FSE A;  5D5V B;  2FOK A;  4MTE A;  3U2R A;  4KN4 X;  2K02 A;  1R1V A;  1D5V A;  1K78 B;  2JTV A;  3D5L A;  4KT5 C;  1BJA A;  3TO7 A;  3J81 Z;  3LQR A;  3U1D A;  4ZZD A;  4NB5 A;  1UHW A;  4JK1 X;  1OYW A;  2HKO A;  1B9M A;  3WGH A;  3CO6 C;  1JGS A;  1KU9 A;  3TOA A;  3NQO A;  1KYZ A;  1KQ8 A;  2QEN A;  4BAY A;  1K7A A;  1KQ9 A;  3FX3 A;  1ZG3 A;  1LNW A;  2P5V A;  5BPI A;  4RGX A;  3EYI A;  1I5Z A;  4ESJ A;  4UHT A;  2OZ6 A;  3KET A;  4ETS A;  3GZ6 A;  1BI1 A;  1R00 A;  5CLS A;  3H92 A;  2NYX A;  4S05 A;  1K78 A;  1TQM A;  3ZMS A;  5JFR A;  1RZ4 A;  4HA8 A;  1Y0U A;  3ZMV A;  4YII A;  3LST A;  2K4J A;  2A3S A;  4LB6 B;  2FBH A;  1R36 A;  2GQQ A;  1ZRD A;  3JAM K;  5D8L B;  1I1G A;  4FX4 A;  2B0L A;  1L0O C;  3EDP A;  4EM1 A;  2VOD A;  4G6D A;  1SD7 A;  4EM2 A;  1U2W A;  3WGI A;  1YG2 A;  1YS6 A;  4A0Y A;  1KA8 A;  3S2W A;  3JTG A;  5EEH A;  1J5Y A;  1F4K A;  2W24 A;  4ZYE A;  2ZBK A;  3BY6 A;  1SMY F;  1W5S A;  2G9W A;  5A2Q K;  1ON1 A;  1S8N A;  3MFK A;  2V9V A;  2VT2 A;  4U7D A;  4HAM A;  2PJP A;  3RKX A;  3T1B A;  3DV8 A;  4LG0 B;  2FNP A;  3E3V A;  1ZG1 A;  5FB2 A;  4IHS A;  1IN6 A;  3CUQ C;  1ZLJ A;  3KEO A;  2EV5 A;  2MD5 A;  2VBX A;  1XSX A;  4FHT A;  1QZZ A;  2JT1 A;  2O0Y A;  2M5W A;  2O61 A;  2QQ9 A;  4P55 A;  1QBJ A;  2A5Y B;  4G7O F;  2IA1 A;  2P4W A;  3ROU A;  1FWZ A;  2D2W A;  3GLX A;  5D8K B;  1FOK A;  1JE8 A;  2STW A;  4L9N A;  4HF1 A;  3WE2 A;  3CDH A;  5ED4 A;  4I0B A;  1WRJ A;  2IVM A;  3WTS C;  3V7C A;  1KYW A;  1O7L A;  3U9G A;  2PLY A;  1H0M A;  2C6Y A;  2H6C A;  4XLP F;  4LG0 A;  5ICE A;  4WXD A;  1BIB A;  5HDK A;  1YYV A;  4IRG A;  3GXO A;  2DBB A;  2ADU A;  1Z6R A;  2L02 A;  4O5V A;  2FE3 A;  1ON2 A;  3RTR A;  1XDS A;  1J7K A;  4A5N A;  4HX7 A;  1GVJ A;  3P9I A;  2KJC A;  4M6X A;  2ZJ2 A;  1JXS A;  3P9C A;  2W57 A;  2F2E A;  2HS5 A;  3OOP A;  2G7U A;  2VN2 A;  3CLO A;  4LB5 A;  1ZHF A;  1LDJ A;  5F1R A;  2Q8K A;  5FGM A;  1SFU A;  3IRR A;  1B4A A;  2FSW A;  4RB0 A;  1K79 A;  2EFW A;  2NS0 A;  4EQQ A;  3FHZ A;  3DPT A;  3I59 B;  3BZ6 A;  3K69 A;  5LRS A;  5JR3 A;  1ZAO A;  5TRD A;  3FMR A;  4N0B A;  5HS9 A;  2ETH A;  4Q5S F;  5K1Y A;  4IVN A;  5JHU A;  1KQ0 A;  5BOX A;  1XDU A;  1IN4 A;  1S7A A;  4Z2Y A;  4EVI A;  1V3F A;  2FRH A;  3DPL C;  2K86 A;  3VOE A;  3HRU A;  5J6X A;  4OIO F;  2VC0 A;  1XGS A;  2ZXJ A;  2OD5 A;  2ZNY A;  1XGM A;  1EH6 A;  2HTS A;  4CHU A;  2NAZ A;  4HDV A;  3KCC A;  4BH9 A;  3V7R A;  4LFU A;  1OKR A;  2HTJ A;  3WTX C;  2O8X A;  1ZG5 A;  3QOP A;  2HEO A;  2EB7 A;  3FZV A;  4N9I A;  3SHF A;  1HQC A;  4ENN A;  1ULY A;  1AWC A;  2LSO A;  4KIC A;  2MH2 A;  2EA2 A;  1I6X A;  1U78 A;  2VON A;  1I1S A;  1YO5 C;  2LNB A;  5F64 A;  3NRV A;  3KLN A;  4B8X A;  4BXU A;  3GWZ A;  1EV7 A;  1QO0 D;  2VBZ A;  2IA2 A;  4HBL A;  4S04 A;  3ZMU A;  4A0Z A;  1QPM A;  1SD4 A;  3MCZ A;  3TDZ C;  3I59 A;  1H9G A;  4EJT A;  3IWF A;  1ZRF A;  3BJ6 A;  4MEX F;  1MGT A;  1C0W A;  4L0Z B;  4RGU A;  2MH9 A;  4CGZ A;  1SFE A;  1P4X A;  3I5U A;  5CYV A;  3BJO A;  3B02 A;  1KU7 A;  3ZMD A;  2STT A;  2PN6 A;  3HTU A;  3IWZ A;  2RQP A;  1U6G A;  4KUM A;  5ILS A;  2CWE A;  5LGN A;  4IPA A;  3HSR A;  4AIH A;  4MGR A;  2ZME B;  1ZRE A;  2CO5 A;  4M9X A;  5K5R A;  3DXJ F;  1W5T A;  2GWR A;  4I01 A;  4XSZ F;  4AD9 A;  4ON0 A;  3H3Z A;  5FO5 A;  3TQN A;  2LDU A;  5L3B A;  1OMI A;  5H6R A;  2A07 F;  2Z9O A;  1FY7 A;  2ZFW A;  4LLL A;  4HLY A;  2EJR A;  3KP3 A;  5DCF A;  2Z3Y A;  2DI3 A;  2EK5 A;  1G4D A;  3F8F A;  2H6B A;  3F3X A;  1ZGJ A;  1BI2 A;  4M74 A;  2DK5 A;  3G3Z A;  5HVQ C;  1E17 A;  5KK1 A;  3F6V A;  4EGZ A;  4HYE A;  1U8R A;  2FNA A;  4HF2 A;  2M1B A;  3ABU A;  1IXS B;  1R22 A;  3GO5 A;  3LAJ A;  1T39 A;  5L3F A;  1NHA A;  3P7N A;  3BDD A;  3SXY A;  2BBY A;  1U5T C;  3V7S A;  1O3T A;  3I53 A;  2DFI A;  3BRO A;  1J75 A;  1IUY A;  4A2U A;  4L18 B;  1UFM A;  2DQR A;  5LRR A;  2XAH A;  4L9J A;  3RDI A;  2D45 A;  3CUQ A;  3E5Q A;  2Z5U A;  5CVJ A;  3BWG A;  3RYP A;  3EET A;  1LQ1 A;  4MQ9 F;  3LWF A;  2ESH A;  2IRF G;  3MZH A;  2JPC A;  4BYY A;  1FYL A;  2Y0M A;  3REO A;  4AIJ A;  2GA2 A;  3ZN0 A;  3TGN A;  3DKW A;  5BQT A;  2XAF A;  3RYR A;  1YIO A;  2F5F A;  2QLZ A;  1FYK A;  3JSP A;  5CVI A;  1FBQ A;  2W25 A;  3ZMZ A;  1FYM A;  2WTE A;  1H9T A;  4ENM A;  1Z6T A;  1PDN C;  2GXG A;  1OYY A;  2QUF A;  4UNO A;  3ERE D;  2OQG A;  4GCV A;  3SZT A;  3J80 Z;  5L3E A;  3LA3 A;  4Q47 A;  4WXC A;  3I0T A;  2Y48 A;  5KVR A;  2MBF A;  3VB2 A;  1R58 A;  3C1D A;  3C3W A;  3FMQ A;  2OU2 A;  4WWC A;  2P7C B;  2COM A;  4UV8 A;  1O3Q A;  5FLX K;  5L3G A;  1HXD A;  4L9V A;  1GXP A;  3TO9 A;  1CF7 B;  1Z1D A;  2HQR A;  2VBY A;  1K6O A;  4KIB A;  5TJJ A;  2YPR A;  2D1V A;  3I4P A;  1HW2 A;  3R60 A;  3FXQ A;  4H0E A;  1Z9C A;  5D6E A;  3KLO A;  1V4R A;  2YX7 A;  3WGG A;  4E70 A;  3F23 A;  3I54 A;  3HRM A;  3M9A A;  5E1W A;  4GXO A;  4KFC A;  2ACJ A;  4RAY A;  2ZCW A;  4IRH A;  1IN7 A;  2VE9 A;  2RN7 A;  1FPQ A;  1TQP A;  2OQR A;  2YX4 A;  2BE5 F;  1X3U A;  3WE3 A;  2D1H A;  3H3U A;  2UXN A;  1IXR C;  3MQ0 A;  2KIM A;  2IA0 A;  5AIQ A;  2XAQ A;  3CO7 C;  3VOD A;  4UVC A;  1XSD A;  2XAS A;  4IXA A;  4KYW A;  1R5H A;  1CF7 A;  4G6Q A;  5LHI A;  3BPV A;  3V4G A;  3ZN1 A;  3F72 A;  4EJO A;  2M30 A;  2L3D A;  3O3K A;  3R6S A;  6PAX A;  2PG4 A;  2F5D A;  2EA4 A;  3NEU A;  4KA4 A;  3F8C A;  2L54 A;  5LHG A;  5JI6 A;  5CVV A;  3E6B A;  4KMF A;  4M73 A;  4XSX F;  1HKQ A;  3QPH A;  3MAJ A;  1ZGA A;  4M9S A;  2UZK A;  4Y17 A;  3DEU A;  4I98 B;  1EH8 A;  2JPB A;  4RS8 A;  3E6M A;  2VE8 A;  4LD5 A;  3BJA A;  1PP8 F;  1QNT A;  1ZH5 A;  1USS A;  2KRF A;  2HR3 A;  3VFZ A;  2FF4 A;  4XBF A;  3CTA A;  1IZ1 A;  1JHF A;  1U5T B;  3MEX A;  4A6D A;  3PQK A;  2CSO A;  1S3J A;  2Y75 A;  1FP2 A;  1WQ2 A;  2XHK A;  2HZT A;  2JRT A;  4LMY A;  4Q4Z F;  1TLH B;  2HGC A;  2HQN A;  2K27 A;  1LVA A;  2XUB A;  1SD5 A;  1SD6 A;  1BOA A;  3SQN A;  3HHH A;  5FLX Z;  2ZKZ A;  3HOT A;  4UVA A;  4I0A A;  2NNN A;  3ISP A;  1J59 A;  4KMU X;  5LBQ A;  4EM0 B;  1T2K A;  3N4M A;  1XGN A;  4P9F A;  3KP2 A;  1IW7 F;  5HLH A;  1XCV A;  4U7B A;  1WSU A;  4PDK A;  4ASN A;  2DPD A;  1WI9 A;  4OU0 A;  2IP2 A;  2P5K A;  1B59 A;  3GX4 X;  3O6B B;  4WX9 A;  1EH7 A;  2FEZ A;  4IRI A;  3ECH A;  3AAF A;  1XMK A;  4A5M A;  3F8M A;  4LK1 F;  5D4S A;  4UVB A;  3SFZ A;  1U5T A;  5F6F A;  4LGW A;  2VC1 A;  5J8F A;  5CVU A;  4BHP A;  1D8K A;  1UST A;  1BI0 A;  2V1U A;  3I64 A;  2PBI A;  1MJA A;  1RUN A;  2O03 A;  3JAM Z;  2E7X A;  3HSE A;  1XB4 A;  4EV0 A;  1O3S A;  3LAP A;  1ZAR A;  2HDC A;  2F5E A;  2BEO A;  3BOQ A;  3WOD F;  3L7W A;  1W7P B;  2RGV A;  4R8H A;  5BS6 A;  3T8T A;  4QLC U;  5HOO A;  1TW3 A;  3E97 A;  1MKM A;  1G3S A;  4FX0 A;  3F21 A;  5ICF A;  4HLX A;  1MJ9 A;  1R1U A;  2L4M A;  2RC4 A;  4L5I A;  1O7F A;  2GAU A;  5A2Q Z;  1UB9 A;  4WF2 A;  4RB1 A;  4U0W A;  1PP7 U;  3Q9S A;  1STZ A;  1Q1H A;  4HDU A;  1KU3 A;  3V8K A;  1F9N A;  5K5Q A;  5J8C A;  3FM3 A;  3KP5 A;  2GXB A;  3SZP A;  1HKT A;  3K1M A;  1LEA A;  5E8I A;  3I58 A;  1Z7U A;  2P7V B;  2V1D A;  2FMY A;  2IW5 A;  1TNT A;  3WTY C;  5IT9 K;  2LKP A;  4CIC A;  1D8J A;  2K4B A;  3KE2 A;  4OMY A;  1ZYR F;  3ML6 A;  2CQK A;  4G94 A;  4XLN F;  1YQA A;  1W7P A;  4M72 A;  4WXH A;  4L0Y B;  1YFH A;  2P6S A;  3QP6 A;  4BHB A;  3K9T A;  4GYI A;  4R79 A;  2M8E A;  1DDN A;  2J5P A;  1P92 A;  3RJP A;  1FLI A;  3FM5 A;  4LK0 F;  1UCR A;  4R1H A;  2A6H F;  4FT8 A;  3ABT A;  1REP C;  1UHM A;  2A68 F;  4U0V A;  2HOE A;  4L9T A;  2BYV E;  5D6F A;  3D0S A;  4DQ2 A;  2ESN A;  3WTT C;  1FSH A;  2JSC A;  3HRT A;  2UWM A;  1L3L A;  1FX7 A;  1P4A A;  3FF5 A;  1LJ9 A;  3Q9V A;  1RIO H;  3ZMT A;  3R4K A;  2YSR A;  5DD4 A;  2NRA C;  1YLF A;  5CVR A;  2W85 A;  2H27 A;  3HUG A;  3M1E A;  4Q48 A;  1BIA A;  3J81 K;  2FU4 A;  2G7H A;  5K5O A;  1MDM B;  2XV4 S;  2BV6 A;  3W6J B;  2JZY A;  4HW0 A;  2OA4 A;  3C7J A;  3FMS A;  5H6Q A;  4G9Y A;  1LDD A;  2XKO A;  3R0A A;  5E1X A;  4MTD A;  2CW0 F;  2GIV A;  3TOB A;  1MZB A;  1XGO A;  2XAG A;  3JTH A;  1Z91 A;  4ZYD A;  3M8F A;  3IL2 A;  4YFX F;  4WCG A;  3RPQ A;  4OIR F;  5HLG A;  3ULQ B;  2E1C A;  4ENK A;  2ZME A;  4A12 A;  5D5W B;  1HBX G;  2KIU A;  1RI7 A;  1AOY A;  3HIF A;  4B09 A;  1IAW A;  2DW4 A;  4HQM A;  5IT3 A;  5ERI A;  2EFN A;  3K1P A;  2QYO A;  4MEY F;  1T38 A;  4ESF A;  2CGP A;  3KZY A;  3LA2 A;  1LB2 A;  2Z33 A;  2F5C A;  2PI0 A;  4P9U A;  3KP7 A;  3KFW X;  3IHU A;  1FBU A;  1RNL A;  3E6C C;  5E18 F;  1F5T A;  3I71 A;  4F7Z A;  1FZP B;  5HS8 A;  1IF1 A;  2UXX A;  4MNU A;  2Q2E A;  4HX4 A;  2PFB A;  4HQE A;  1D3Y A;  4L5J A;  3DFG A;  1OPC A;  4PCQ A;  1G3T A;  3HSF A;  4IJA A;  4O6J A;  4GGG A;  3QPT A;  5LEK A;  1IXC A;  1KGS A;  3R61 A;  3IKV A;  1S6L A;  2EWN A;  1XN7 A;  4BQA A;  2AS5 F;  2MLK A;  3L2C A;  3HTS B;  2HYF A;  2GA1 A;  5L3D A;  4RGS A;  2H09 A;  4I02 A;  5HLI A;  3PQJ A;  4HV6 A;  3HRS A;  3RKW A;  4YFN F;  5FD5 A;  2X4H A;  3K2Z A;  3GW2 A;  2FBK A;  5ICC A;  4RGR A;  2O6G E;  4UUV A;  2LF7 A;  4ZZL A;  3ELK A;  4P5O A;  2CG4 A;  1IRG A;  2EFQ A;  1W7P D;  3HOS A;  2KKO A;  2RDP A;  2A6E F;  3BP8 A;  5DUK A;  3GVA A;  1Z05 A;  4N9H A;  1HW1 A;  4GYG A;  3WTZ A;  1P6R A;  2PMH A;  5BMZ A;  1DPU A;  4EJV A;  3EQL F;  1DP7 P;  4HX8 A;  4KIF A;  1A04 A;  4D0P A;  1R23 A;  1KU2 A;  3ECO A;  2AXL A;  4G8X A;  4ENJ A;  3KP4 A;  4NQW A;  2DPU A;  3Q5F A;  3KZZ A;  4HF0 A;  4CYD A;  4OMZ A;  3GYH X;  4KN7 X;  3ZP5 A;  1BM9 A;  4ZYG A;  2HYG D;  1R5G A;  5DD8 A;  5EEG A;  5DCM B;  3TDU C;  4ZH4 F;  2OBP A;  3GEZ A;  2QBY B;  1G6N A;  4UV9 A;  3K1N A;  1U3E M;  5D4R A;  2Q0O A;  1JHH A;  1DUX C;  3WU1 B;  4ZYH A;  4JQF A;  4Y13 A;  2R7D A;  5AIP A;  2PMU A;  1G3Y A;  5LHH A;  1BC8 C;  2IT0 A;  2P6T A;  3PFI A;  2IJL A;  1FBS A;  3L9F A;  1T6S A;  2ELH A;  5LEJ A;  3KP6 A;  2MA3 A;  3FWE A;  3FXR A;  4M9Z A;  3DF8 A;  2FA5 A;  3LQQ A;  1SAX A;  4IHT A;  3JW4 A;  4BNC A;  3F22 A;  2HFH A;  2R3S A;  3RPU A;  1G3W A;  3CJN A;  4EMS A;  4G7Z F;  1YW7 A;  4CXF A;  2QWW A;  1O57 A;  2LF8 A;  2EV6 A;  1RUO A;  4OIQ F;  4O3M A;  3QP5 A;  1BBY A;  3GFM A;  3G73 A;  1TTY A;  5ILU A;  5ICG A;  3T5X A;  2ISY A;  3K0L A;  3MZY A;  5DCM A;  3LA7 A;  1WWX A;  4HZF A;  4KNY A;  4LLN A;  2QBY A;  5L3C A;  1OYI A;  5FD6 A;  4BHC A;  4RAZ A;  3QU3 A;  1YW8 A;  4NHJ A;  3GZ5 A;  1TBX A;  4I7H A;  5AON A;  3M7G A;  5LGU A;  4I2O A;  2XKP A;  4AWX B;  1I27 A;  4YFK F;  5DV5 A;  2QVO A;  4PGH A;  4YG2 F;  3RI4 A;  3E5U A;  3EUH A;  1J0R A;  1IN8 A;  2FQ3 A;  1LDK B;  1ZLK A;  2DAO A;  2YU3 A;  2V6C A;  2ZNZ A;  4G7H F;  4CZZ A;  1YS7 A;  4JBA A;  1OR7 A;  1VTN C;  1W4M A;  2XRO A;  2TDX A;  2MC3 A;  5E17 F;  4MHG A;  3MWM A;  2FML A;  2EV0 A;  4A0X A;  2KIF A;  3RKY A;  1FC3 A;  2HKX A;  3WG9 A;  5LGT A;  2DLL A;  1P2F A;  5HS7 A;  3QU6 A;  3TKY A;  3GFI A;  1P4W A;  2DO7 A;  4TV7 A;  4LJZ F;  2PEX A;  1HW5 A;  2KJB A;  3N97 A;  1ZRC A;  2L4A A;  3WTV C;  3EYY A;  5JVT A;  1GXQ A;  3COA C;  1TW2 A;  2DK8 A;  3QAH A;  4OIP F;  2P8T A;  2L01 A;  2P5L C;  4Y15 A;  2QZ8 A;  2V79 A;  1FNN A;  1T98 A;  5DEQ A;  3P9K A;  2WWY A;  4XRF A;  3R0J A;  2DU9 A;  2RVC A;  3T0Y A;  2MLG A;  4OIN F;  2H94 A;  3VEP A;  2QQA A;  2QM3 A;  3GFL A;  2VOP A;  2W84 A;  3KEQ A;  1R7J A;  2RKH A;  3V8J A;  1FP1 D;  3FXU A;  4WK8 F;  2XIG A;  3IRQ A;  1BC7 C;  3L00 A;  4YIF A;  1ONV A;  2A61 A;  4PZJ A;  5E20 A;  3BPX A;  2GZW A;  2RV8 A;  1CGP A;  2XRN A;  4P96 A;  1LEB A;  2A69 F;  1BN5 A;  3WTU C;  1J2X A;  4RB2 C;  1S29 A;  2NNY A;  2J5O A;  5CJ9 A;  2EFO A;  1TNS A;  2M87 A;  5HDN A;  4EJU A;  5DYM A;  3HYI A;  4M6Y A;  3WTW C;  3GUD A;  4OOI A;  1QQI A;  3RIR A;  3O2P E;  4QWQ A;  2YR2 A;  2XVC A;  1R1T A;  2VBW A;  4HOB A;  3GF2 A;  3JSO A;  1F1Z A;  4EGY A;  1B6A A;  4U88 A;  3J80 K;  3DP7 A;  2EFP A;  3L09 A;  1QZY A;  4I09 A;  1E2X A;  2BGC A;  2HWV A;  2ZO4 A;  2Z99 A;  2DTR A;  3F6O A;  3ZQ7 A;  3J7A O;  2VT3 A;  3IKT A;  1HSJ A;  4CO8 A;  3V8L A;  2E1N A;  3W6K B;  5D5U B;  4RB3 C;  3CUQ B;  2XGX A;  4DNC A;  5FFZ A;  4EJW A;  1XD7 A;  3QRF F;  4MQV A;  3F8B A;  1MD0 A;  2OAZ A;  1QGP A;  1BI3 A;  3E5X A;  3LFK A;  1XSV A;  5HDG A;  3GFJ A;  3IC7 A;  3F8N A;  4LLG F;  5DDG A;  2DQL A;  4AIK A;  4GO1 A;  3ZPL A; 
#chains in the Genus database with same CATH topology
 2VQH A;  2Z16 A;  2CYY A;  1TQI A;  3LSG A;  2DT5 A;  2JUC A;  1WKM A;  2V1X A;  4IHY A;  2GXA A;  2NVT J;  1IRF A;  5FFX A;  1MND A;  3E7L A;  1UG2 A;  3HHG A;  1B9N A;  4NBQ A;  3MKY B;  1GHC A;  1S7O A;  3DQV C;  3ZOB A;  4HV5 A;  5D5X B;  3OYL A;  1SFX A;  2WC2 A;  4M71 A;  2X0L A;  5ILV A;  5DUI A;  4XN3 A;  1YW9 A;  2CH0 A;  4U0Y A;  3D1N I;  1Z0X A;  3W2A A;  3BQZ A;  5IT9 Z;  3OV8 A;  2R7F A;  2WV0 A;  3QPL A;  1MDM A;  3Q0W A;  4BDY A;  4UUS B;  4FQG A;  2XPW A;  4PGG A;  3WU0 A;  2QQB A;  4Y52 J;  3BG5 A;  3NWT A;  2FBI A;  1B1B A;  5DS9 A;  2NVX J;  1OQY A;  4A6E A;  2KLO A;  1ZN2 A;  3S16 J;  4XKB A;  2XAJ A;  4IF4 A;  2RNJ A;  1IGN A;  1IC8 A;  4AVP A;  4ABZ A;  2UUZ A;  3PSF A;  4S0H B;  1SMT A;  5E1Z B;  2HVS A;  2QQ8 A;  1DPR A;  2ICW G;  3K70 D;  1MSF C;  1FT9 A;  2ISZ A;  2FXA A;  1Z3Y A;  2PQ8 A;  1BL0 A;  1X3W B;  5KAF C;  4K2E A;  1T0F A;  3C18 A;  2XF7 A;  2O7O A;  2PMZ A;  3J7Y J;  4RLF A;  1VQ9 I;  4OWR B;  2K7L A;  3K4K A;  4HSR A;  1YTY A;  1YHQ I;  1MJB A;  2IPQ X;  3M8E A;  2DA6 A;  2OZU A;  1QU3 A;  1BR4 A;  2KRC A;  4UXN A;  1HF0 A;  1XCB A;  1A5J A;  2UV1 A;  3KIO A;  3VYS B;  3A02 A;  3CCY A;  4CDG A;  3A0B C;  1HST A;  1WHU A;  2O3F A;  2VI6 A;  3AKZ A;  2H1K A;  2LD5 A;  3CDI A;  1J9I A;  2BY1 A;  4KIG A;  3H1C A;  2E7W A;  3OIQ A;  5LLQ A;  5EZG A;  2W82 A;  2W7N A;  2CFX A;  1E3O C;  2E36 A;  3TO6 A;  2ZC2 A;  2Y9Z A;  1O3R A;  4ESB A;  2ZXI A;  1PUE E;  5H20 A;  4IZZ A;  3QOD A;  2M45 A;  4B4C A;  2AQF A;  1CQT A;  2VXZ A;  4F55 A;  1XMA A;  5EJC A;  2VOO A;  2IGN A;  3CUO A;  4QIW N;  4BXX J;  2GIZ A;  5E8G A;  3G6E I;  3E6D A;  3PO3 J;  3BTI A;  1ODD A;  4JX6 A;  2KP6 A;  1IN5 A;  1HKS A;  1Z3X A;  2KRH A;  3BG9 A;  4UUS A;  2R0Q C;  4Y3O A;  4KIT B;  5BPD A;  3B73 A;  4KDP A;  5HLT A;  3T8R A;  1Z7L A;  1FSE A;  2FOK A;  4MTE A;  3FXJ A;  5D5V B;  5C44 J;  2XF6 A;  3U2R A;  4LIV A;  4KN4 X;  2K02 A;  5CQE A;  1R1V A;  1D5V A;  1K78 B;  2JTV A;  3D5L A;  5J4Y A;  4KT5 C;  1BJA A;  3TO7 A;  4B1R A;  4D5F A;  5GTI C;  1G8X A;  1SAN A;  2ID6 A;  3J81 Z;  3LQR A;  3CCE I;  3ZQL A;  4JX5 A;  3U1D A;  3O8H A;  4ZZD A;  4KJZ A;  4NB5 A;  1OCZ H;  4BBR J;  1UHW A;  1ZKG A;  2CW7 A;  4GRI A;  2XC7 A;  4RDU A;  3S2D J;  1D5Y A;  2JRM A;  2R5Y B;  4JK1 X;  4C2T A;  2KZV A;  2QSF X;  1OYW A;  2HKO A;  1B9M A;  3WGH A;  3CO6 C;  4ZTJ A;  1JGS A;  1D0Y A;  2MAB A;  1KU9 A;  3TOA A;  3MKW B;  3NQO A;  1KYZ A;  2V9P A;  1KQ8 A;  2JWT A;  2DYS H;  2QEN A;  5TGT A;  3IH2 A;  4BAY A;  1DGR M;  2B63 J;  3I4M J;  2X6O A;  3ABM H;  5IP7 J;  1KQ9 A;  3FX3 A;  1ZG3 A;  1Y56 A;  3WU2 C;  1VFC A;  1K7A A;  1W1W E;  1LNW A;  4B44 A;  2P5V A;  3K6G A;  5BPI A;  4RGX A;  2CQN A;  3EYI A;  1OCR H;  1I5Z A;  1TWF J;  3GLL A;  2CW8 A;  2OZ6 A;  4UHT A;  4XLH A;  2HDW A;  4ESJ A;  5FKN A;  1I6H J;  1JUM A;  4UB8 C;  2WY7 Q;  2EIJ H;  4F93 B;  3KET A;  2EZH A;  1TT5 B;  3A01 A;  4A69 C;  4ETS A;  1A6Q A;  3GZ6 A;  2HU9 A;  3CCU I;  1BI1 A;  4Y7N J;  1FOX A;  1R00 A;  5GAG J;  4BUP A;  2R5Z B;  5CLS A;  3CJT B;  1F43 A;  3H92 A;  4F52 A;  1V5G A;  2NYX A;  3ZRG A;  3K4N A;  4S05 A;  1HDP A;  2O8K A;  2WBM A;  1K78 A;  1U0J A;  1Q1V A;  3CDL A;  1TQM A;  3ZMS A;  5JFR A;  1RZ4 A;  4HA8 A;  4XK4 A;  1Y0U A;  3ZMV A;  2X1D A;  4YII A;  2A5W A;  3IH4 A;  3LST A;  4FAS D;  2K4J A;  2A3S A;  4LB6 B;  2FBH A;  5M5X J;  2NXN B;  1R36 A;  2GQQ A;  1ZRD A;  3JAM K;  5D8L B;  1I1G A;  1WJE A;  1D1C A;  2LK2 A;  3K4L A;  2B0L A;  2R5Y A;  4FX4 A;  1L0O C;  3KEY A;  1GUU A;  3ESW B;  3VDX A;  1W0U A;  3EDP A;  4EM1 A;  4PSX A;  1RPW A;  2K9L A;  3FK7 A;  2VOD A;  4XMY A;  4G6D A;  1SD7 A;  4EM2 A;  1U2W A;  3WGI A;  1YG2 A;  1YS6 A;  1JJ6 C;  2BXY A;  1X2M A;  1YRN A;  4A0Y A;  1KA8 A;  3S2W A;  3JTG A;  3DEE A;  5EEH A;  4DZP A;  4OAY A;  1J5Y A;  5FLM J;  2KQR A;  1F4K A;  2W24 A;  2R4G A;  4ZYE A;  2MYS A;  2ZBK A;  3BY6 A;  1SMY F;  1W5S A;  2R7Z J;  1P7J A;  2G9W A;  1K4S A;  2NVQ J;  3TP0 A;  4XRM A;  4RM3 A;  5A2Q K;  1ON1 A;  1S8N A;  2K9M A;  3MFK A;  4HNT A;  2DA1 A;  2V9V A;  2VT2 A;  2LKS A;  1B72 B;  4U7D A;  3FXL A;  4HAM A;  4DZJ A;  2PJP A;  2K40 A;  3RKX A;  1D1B A;  3T1B A;  3DV8 A;  3G1O A;  3TL4 X;  4LG0 B;  2FNP A;  1PJR A;  3E3V A;  5J4V A;  2L0K A;  4BU2 A;  1ZG1 A;  3A03 A;  2DMP A;  3BTL A;  5FB2 A;  3FXK A;  4BEH B;  3OS0 A;  4IHS A;  1IN6 A;  3RKQ A;  2BXZ A;  1Y6I A;  4F91 B;  3JRG A;  1LFP A;  2JVG A;  3CUQ C;  1ZLJ A;  5KAI C;  1QHG A;  1X1P A;  2M0M A;  4M3D A;  1QHH D;  3KEO A;  2EV5 A;  4XRS A;  2MD5 A;  2VBX A;  1GV2 A;  2HVQ A;  1XSX A;  4FHT A;  1QZZ A;  3OS1 A;  3S1R J;  2JT1 A;  2O0Y A;  3BZC A;  2M5W A;  3KZI C;  4BBS J;  3SDB A;  4BXF A;  2QQ9 A;  4P55 A;  1QBJ A;  2O61 A;  3IAM 2;  2A5Y B;  3KX2 A;  4G7O F;  2IA1 A;  5EGO B;  2P4W A;  2VL8 A;  3ROU A;  1FWZ A;  1EF4 A;  2D2W A;  3GLX A;  5D8K B;  1FOK A;  3QYE A;  1JE8 A;  4C9Y A;  2VKE A;  2STW A;  4L9N A;  4HF1 A;  3WE2 A;  3CDH A;  4PJL A;  5ED4 A;  2CUF A;  4CCJ A;  4I0B A;  3AL0 B;  1XMX A;  1WRJ A;  5DM7 F;  3PJR A;  2IVM A;  2GOX B;  2CQX A;  3WTS C;  3V7C A;  1YOV B;  1KYW A;  3OOU A;  1O7L A;  2BVL A;  3U9G A;  1K61 A;  4EAT A;  2PLY A;  1XG1 A;  1H0M A;  1YX5 A;  3DBR B;  4JYK A;  1B72 A;  2C6Y A;  2H6C A;  4XLP F;  3SZG A;  4BQN A;  2Y9Y A;  1VQ6 I;  4LG0 A;  5H2F C;  1K83 J;  5ICE A;  2R7U A;  4WXD A;  2DA7 A;  1BIB A;  4RBO A;  2A05 A;  2M4G A;  4BKX A;  3S32 A;  5HDK A;  1YYV A;  4IRG A;  3GXO A;  4BEH A;  2DBB A;  2ADU A;  2EZI A;  1Z6R A;  2NOJ B;  5JHF A;  4BY1 J;  2L02 A;  5J1R A;  4O5V A;  3TMO A;  1VND A;  1OCO H;  4IHV A;  2IGM A;  2L7Z A;  1BW6 A;  2FE3 A;  1ON2 A;  3RTR A;  1IUF A;  1XDS A;  2MG4 A;  1SFK A;  3FIW A;  1J7K A;  2FX0 A;  4A5N A;  4BE1 A;  2R93 J;  2E19 A;  4HX7 A;  1GVJ A;  3P9I A;  5JLW A;  2R7X A;  4A3E J;  2KJC A;  4M6X A;  2ZJ2 A;  4NC7 A;  2GM4 A;  4IQJ A;  1JXS A;  3GZN B;  2DMU A;  3I3L A;  2IS4 A;  3P9C A;  2W57 A;  1WZ2 A;  2I8D A;  5F04 A;  2F2E A;  2HS5 A;  3OOP A;  2G7U A;  2VN2 A;  3CMA I;  3CLO A;  4LB5 A;  1ZHF A;  5EF6 A;  1LDJ A;  5F1R A;  2Q8K A;  5FGM A;  4YIR X;  3CCV I;  2JA8 J;  1SFU A;  2DFF A;  1ITY A;  3IRR A;  4XN0 A;  1B4A A;  2HOA A;  5B1A H;  2ME6 A;  2EIL H;  3HC7 A;  1GVD A;  3QYF A;  1ZK8 A;  2FSW A;  4NDL A;  1UZC A;  4RB0 A;  3Q0U A;  3DLA A;  2LBF B;  1K79 A;  1I3A A;  2EFW A;  2NS0 A;  3S3N A;  1LPQ A;  2E35 A;  1EKE A;  4C3J J;  4EQQ A;  1T56 A;  3FHZ A;  1E3P A;  3DPT A;  3I59 B;  3BZ6 A;  3K69 A;  5LRS A;  5JR3 A;  2CU7 A;  1ZAO A;  3DKX A;  1FTT A;  5TRD A;  3FMR A;  2BHY A;  4N0B A;  4CCL A;  5HS9 A;  2ETH A;  5CPR B;  1Y1W J;  4Q5S F;  2JMW A;  1VQP I;  2L9V A;  2L7F P;  5K1Y A;  2X1C A;  4RA2 A;  2KT0 A;  4IVN A;  5JHU A;  1KQ0 A;  2QF7 A;  4PFP A;  5BOX A;  4CCO A;  2WV1 A;  2NVY J;  2WA0 A;  4DYC A;  1XDU A;  1IN4 A;  1S7A A;  4D9J A;  4Z2Y A;  4EVI A;  1V3F A;  2FRH A;  3DPL C;  2K86 A;  4A3J J;  3ABK H;  3VOE A;  3ZQQ A;  3HRU A;  5J6X A;  4OIO F;  2VC0 A;  2I10 A;  1XGS A;  2ZXJ A;  2LLK A;  2GBY A;  2OD5 A;  2ZNY A;  1XGM A;  1EH6 A;  2HTS A;  5JVG F;  1OLT A;  4RLQ A;  4CHU A;  2NAZ A;  1UAA A;  3KCC A;  4HDV A;  4BH9 A;  3V7R A;  3UKG A;  4LFU A;  1OKR A;  2KMU A;  2HTJ A;  3WTX C;  2O8X A;  5B1B H;  1ZG5 A;  3WHB A;  4XRS G;  2RQQ A;  3QOP A;  4HNU A;  2HEO A;  2EB7 A;  3FZV A;  4ITV A;  3LSH A;  4N9I A;  3SHF A;  1HQC A;  2K9N A;  4CZC A;  4ENN A;  1ULY A;  4UY8 I;  1AWC A;  2LSO A;  4KIC A;  2MH2 A;  2L9N A;  3DLL F;  2EA2 A;  3OYJ A;  2CV2 A;  1I6X A;  1B8I A;  1U78 A;  4PFO A;  3HUG B;  1YO5 C;  2VON A;  1I1S A;  3PL8 A;  2LNB A;  5F64 A;  3NRV A;  3KLN A;  5F0H A;  4B8X A;  3K7A J;  3VYR B;  4BXU A;  3GWZ A;  1EV7 A;  1QO0 D;  2VBZ A;  2IA2 A;  4HBL A;  4S04 A;  3ZMU A;  4A0Z A;  1QPM A;  1SD4 A;  2BW3 B;  3MCZ A;  2V4J C;  3H0D A;  5IYB J;  3TDZ C;  2X9D A;  3I59 A;  3BTJ A;  4F3Q A;  3CES A;  2VQG A;  4AYB N;  2VJ4 A;  2Y31 A;  1H9G A;  4EJT A;  3IWF A;  1ZRF A;  2LTP A;  3BJ6 A;  4MEX F;  1BW5 A;  4C30 A;  1MGT A;  1N75 A;  1C0W A;  4L0Z B;  4RGU A;  1LFB A;  4UUT A;  3I56 I;  2MH9 A;  4CGZ A;  1SFE A;  1P4X A;  3I5U A;  5CYV A;  3BJO A;  2X6Y A;  1R6R A;  3B02 A;  1KU7 A;  3ZMD A;  2STT A;  1UG0 A;  2PN6 A;  3HTU A;  3IWZ A;  2RQP A;  3CCJ I;  1U6G A;  4KUM A;  5ILS A;  3TBI A;  2CWE A;  5LGN A;  2D5V A;  4IPA A;  2AQE A;  1U8B A;  3HSR A;  4AIH A;  4D7M A;  4MGR A;  2ZME B;  1KON A;  2CO5 A;  2KDO A;  2WAQ A;  3DXJ F;  4M9X A;  4AVZ A;  1W5T A;  2KFD A;  5K5R A;  3MVP A;  2GWR A;  3RPU D;  4I01 A;  3QOE A;  4XSZ F;  4AD9 A;  2HYJ A;  3DTK A;  4ON0 A;  5HNF A;  4CYC A;  3H3Z A;  5FO5 A;  1HOM A;  3TQN A;  2LDU A;  5L3B A;  2ECC A;  1OMI A;  4B3X A;  5H6R A;  2ID3 A;  2A07 F;  2IS2 A;  2R7T A;  2Z9O A;  1MMS A;  1H88 C;  2ZJR F;  1FY7 A;  1Y8Q B;  1YE9 A;  2ZFW A;  2L9R A;  3OYG A;  4LLL A;  4HLY A;  2A6T A;  2EJR A;  3KP3 A;  5DCF A;  2LP0 A;  2Z3Y A;  3GTK J;  4ZDO A;  1RR7 A;  2DI3 A;  2EK5 A;  1YJ9 I;  1G4D A;  2F4I A;  3F8F A;  3OYH A;  2H6B A;  3F3X A;  1ZGJ A;  1BI2 A;  4M74 A;  3LFU A;  2DK5 A;  3G3Z A;  5HVQ C;  4AM3 A;  1E17 A;  5KK1 A;  2BW3 A;  3F6V A;  1D0X A;  4EGZ A;  4BS9 A;  5DTD A;  4HYE A;  4G12 A;  1U8R A;  2FNA A;  3CMY A;  5F0C A;  1OCP A;  4HF2 A;  3CJR B;  2M1B A;  3ABU A;  5GAE J;  4ZTF A;  1IXS B;  1R22 A;  3GO5 A;  3RQ4 A;  3LAJ A;  1WJ5 A;  3FHN A;  2M7A A;  1T39 A;  4CCK A;  4YEJ A;  3ERM A;  5L3F A;  4AYB A;  1NHA A;  2LR8 A;  3MKZ A;  3H35 A;  3P7N A;  3BDD A;  3SXY A;  1DP3 A;  2BBY A;  1U5T C;  1W5C C;  3V7S A;  1O3T A;  1JUP A;  3ZR8 X;  3I53 A;  3UR3 C;  3K4C A;  2DFI A;  4DBR A;  3BRO A;  3V42 A;  1J75 A;  4IOA F;  1IUY A;  3PUB A;  4JOM A;  4A2U A;  4L18 B;  1OJL A;  1X2N A;  5E3L A;  1UFM A;  2DQR A;  3VPR A;  5LRR A;  2XAH A;  3AFH A;  3HZJ A;  5KCM A;  2XPU A;  4L9J A;  4M3E A;  1UHS A;  1MBJ A;  1X58 A;  3RDI A;  2D45 A;  5FLV A;  2CJJ A;  3RSN A;  3A0H C;  1AKH B;  3CUQ A;  3E5Q A;  1ZR2 A;  2Z5U A;  5CVJ A;  3BWG A;  3RYP A;  2FQ4 A;  3G2B A;  2XSD C;  2HVR A;  4F92 B;  4AID A;  1Y8R B;  5B3S H;  3SFI A;  3OIP A;  1EA3 A;  3EET A;  3BLY A;  1LQ1 A;  4MQ9 F;  3LWF A;  2ESH A;  2L7M P;  5M3M J;  2E1M B;  2IRF G;  3MZH A;  4XOP A;  3AL0 C;  1DU6 A;  4JP0 A;  2JPC A;  4BYY A;  1H8A C;  2W4S A;  5FRN A;  2BVM A;  3PUF A;  1FYL A;  4CA0 A;  5K7H A;  2Y0M A;  3REO A;  4AIJ A;  3K4M A;  3ZQI A;  4BGD A;  2GA2 A;  3ZN0 A;  2E71 A;  3LSI A;  3TGN A;  3ZQF A;  3DKW A;  5BQT A;  2XAF A;  4N4N B;  1JJ8 C;  3RYR A;  4B43 A;  4PK4 A;  1YIO A;  2F5F A;  2QLZ A;  1FYK A;  2H8R A;  2VUM J;  1V54 H;  3JSP A;  5CVI A;  4D1Q A;  2CUZ A;  1WH5 A;  1FBQ A;  2W25 A;  3D5R C;  1MH3 A;  3ZMZ A;  2DT6 A;  3F9K A;  2HXI A;  1FYM A;  1J09 A;  2WTE A;  1H9T A;  1VQN I;  1UJ8 A;  2V9K A;  4ENM A;  1V55 H;  1Z6T A;  1PDN C;  1Y0N A;  3JRH A;  2GXG A;  5FRM A;  2M8G X;  1GV5 A;  4D7N A;  1OYY A;  2QUF A;  4UNO A;  2RNG A;  3ERE D;  2OQG A;  4GCV A;  3SZT A;  1I39 A;  3J80 Z;  5L3E A;  2DA2 A;  3LA3 A;  3S1M J;  4Q47 A;  4WXC A;  1NG6 A;  4KIS A;  3C2G A;  4A3G J;  2DOE A;  3CD6 I;  3I0T A;  1AKH A;  2Y48 A;  1AA7 A;  2ZXW H;  5KNL A;  5KVR A;  2MBF A;  3VB2 A;  3BR2 A;  1R58 A;  3C1D A;  4DJA A;  3C3W A;  4C3H J;  3FMQ A;  2OU2 A;  4WWC A;  2P7C B;  1BJZ A;  2COM A;  4UV8 A;  1O3Q A;  5FLX K;  2JK3 A;  3DKY A;  5L3G A;  1HXD A;  5KHD A;  4NQW B;  1E0E A;  1T33 A;  4L9V A;  1GXP A;  3TO9 A;  1CF7 B;  1K4T A;  1Z1D A;  2HQR A;  2VBY A;  1K6O A;  4KIB A;  1BOB A;  2XRL A;  1QVU A;  4XLF A;  5TJJ A;  2YPR A;  2D1V A;  3I4P A;  1HW2 A;  3R60 A;  3FXQ A;  2DT7 B;  4Y4R A;  1WJA A;  4H0E A;  1FTZ A;  5EZH A;  1SAU A;  4MO7 A;  4ANJ A;  1Z9C A;  5D6E A;  3KLO A;  1V4R A;  2YX7 A;  4D5C A;  2BZT A;  1JGG A;  1Y1V J;  3F0C A;  3WGG A;  2DXI A;  4E70 A;  3F23 A;  2F6C A;  2R7O A;  3I54 A;  2XSJ C;  3HRM A;  3M9A A;  2NOG A;  5E1W A;  3BG6 A;  4GXO A;  3PIO F;  3RCO A;  2L5Q A;  3OYC A;  4KFC A;  2ACJ A;  4RAY A;  2ZCW A;  1LUJ B;  4IRH A;  1IV6 A;  1IN7 A;  4M6V A;  1RR8 C;  1UMQ A;  5BNG A;  4UB6 C;  2VE9 A;  1JTX A;  2RN7 A;  1FPQ A;  1TQP A;  3S3O A;  3OYF A;  2OQR A;  2YX4 A;  2XB0 X;  2BE5 F;  1X3U A;  3WE3 A;  2D1H A;  4AC0 A;  3H3U A;  4BE2 A;  2UXN A;  3MZ8 A;  1IXR C;  3MQ0 A;  2HNH A;  2KIM A;  3CQZ J;  3L2V A;  4X0G A;  2VXD A;  2IA0 A;  2FOW A;  5AIQ A;  1HCR A;  2XAQ A;  3CO7 C;  2NS8 A;  3VOD A;  4UVC A;  1XSD A;  2XAS A;  4IXA A;  3TW6 A;  2HOS A;  5K7Z A;  2AXT C;  1OCC H;  1QRY A;  2HOT A;  3DTI A;  3KYD B;  2IBD A;  4KYW A;  1R5H A;  1S9H A;  1CF7 A;  2WAF A;  4G6Q A;  5LHI A;  3BPV A;  3VWB A;  4A3F J;  3M1C A;  2OV7 A;  2CQ7 A;  3V4G A;  3ZN1 A;  2EIM H;  3F72 A;  3CZ6 A;  2M3A A;  4EJO A;  1R49 A;  2M30 A;  5LD2 C;  2K3F A;  4DW6 A;  4IKF A;  2XAU A;  2L3D A;  2ZB9 A;  3QWL A;  3O3K A;  5GP9 A;  3R6S A;  6PAX A;  2PG4 A;  2YU9 J;  2F5D A;  2CV1 A;  3HOY J;  2EA4 A;  3NEU A;  4KA4 A;  2ZSI B;  3F8C A;  2L54 A;  3LOC A;  5JI6 A;  5LHG A;  1OCT C;  2Z1D A;  5C4J J;  1VF9 A;  1X19 A;  5CVV A;  3E6B A;  2OTL I;  4KMF A;  3S1N J;  1JKP C;  4M73 A;  4XSX F;  1WJC A;  1BA5 A;  1HKQ A;  1JT0 A;  4JX4 A;  3QPH A;  5F1J A;  3MAJ A;  3IAS 2;  2EBI A;  1ZGA A;  2MW8 A;  4CCM A;  4M9S A;  4C2M J;  2UZK A;  4Y17 A;  3HXL A;  4II2 A;  3DEU A;  5IP9 J;  2L7K A;  2GLO A;  4I98 B;  1EH8 A;  2JPB A;  2R5Z A;  4RS8 A;  3JRF A;  3E6M A;  1PVE A;  4XOT A;  4QPQ A;  1GDT A;  2VE8 A;  4LD5 A;  3BJA A;  1PP8 F;  1QNT A;  1X1D A;  2ZME C;  1VQK I;  2R7S A;  1ZH5 A;  5GAD J;  1USS A;  2KRF A;  3LSR A;  3CC2 I;  4DGW B;  2HR3 A;  3VFZ A;  3PSI A;  3S93 A;  2R92 J;  2FF4 A;  4XBF A;  1Y39 A;  2VB6 A;  1IDZ A;  3LSP A;  3CTA A;  1IZ1 A;  1JHF A;  1U5T B;  4NNJ A;  3MEX A;  4A93 J;  4A6D A;  3PQK A;  2CSO A;  1S3J A;  1YIT I;  2Y75 A;  1FP2 A;  1WQ2 A;  4OAZ A;  3Q3S A;  2XHK A;  2HZT A;  2JRT A;  2BHZ A;  2DCE A;  4LMY A;  4Q4Z F;  1TLH B;  2HGC A;  2HQN A;  2K27 A;  3H9G A;  2LKX A;  1LVA A;  2LH9 A;  4IHW A;  4W1U A;  2LG4 A;  3ZQH A;  3JCU C;  4LIT A;  2XUB A;  1SD5 A;  1WJD A;  4BAC A;  3HDD A;  2OF7 A;  5CKT A;  1SD6 A;  1BOA A;  3SQN A;  3HHH A;  4J19 A;  5FLX Z;  2ZKZ A;  1MNM C;  3HOT A;  4UVA A;  4I0A A;  1VQ4 I;  3OL3 A;  2MSY A;  2EPF A;  2NNN A;  3ISP A;  3CP2 A;  4IO9 F;  1J59 A;  2HXO A;  4HNV A;  2DTZ A;  3ABL H;  4KMU X;  5LBQ A;  4EM0 B;  1T2K A;  3N4M A;  1XGN A;  2F5V A;  4MIM A;  4P9F A;  2RRE A;  1WPK A;  3KP2 A;  3H5A A;  1IW7 F;  3DBL B;  5HLH A;  2QSG X;  4BQO A;  5C4X J;  1S7E A;  1XCV A;  2QA4 I;  1I50 J;  2MD0 A;  1ENH A;  4U7B A;  1WSU A;  4PDK A;  4ASN A;  2DPD A;  1WI9 A;  4OU0 A;  2KIS A;  2IP2 A;  2P5K A;  3FK6 A;  4BJ5 C;  1O4X A;  1B59 A;  4LG3 A;  2JVH A;  3MD2 A;  3GX4 X;  3O6B B;  4WX9 A;  1EH7 A;  1IG7 A;  3W3C A;  3HM5 A;  2FEZ A;  4IRI A;  3ECH A;  3AAF A;  1XMK A;  2AHQ A;  4YEL A;  3CP8 A;  4A5M A;  4XLC A;  4PSW A;  3F8M A;  4E7I A;  4XIC A;  4IL6 C;  4LK1 F;  5TIS C;  2CUE A;  2VJI A;  5D4S A;  4UVB A;  3SFZ A;  1TWA J;  4QTR A;  1U5T A;  4XID A;  5F6F A;  2VKV A;  4DYR A;  4LGW A;  2VC1 A;  2P81 A;  1FOW A;  2VIX A;  3CMM A;  5GTH C;  5J8F A;  5CVU A;  3CCL I;  4BHP A;  1D8K A;  2ZJP F;  4G6T B;  2Q1Z B;  2B7E A;  3FKI J;  5M3F J;  2E1M C;  3LSJ A;  1UST A;  2H1L A;  1BI0 A;  2V1U A;  3IUO A;  3I64 A;  4II3 A;  1X4P A;  2PBI A;  2QKM B;  5EGO A;  1MJA A;  4E7S A;  3OSG A;  1RUN A;  3JRD A;  5FKM A;  3OSF A;  2O03 A;  3JAM Z;  2E7X A;  3HSE A;  1XB4 A;  4EV0 A;  3L2Q A;  3KYL A;  1O3S A;  1LE8 B;  1MMD A;  3HB9 A;  2VPL A;  3JRB A;  3HJE A;  2ZXH A;  3LAP A;  1ZAR A;  2HDC A;  2F5E A;  2BEO A;  3BOQ A;  3WOD F;  1VQL I;  3L7W A;  1W7P B;  2RGV A;  4R8H A;  5BS6 A;  3T8T A;  2KPM A;  4QLC U;  5HOO A;  1TW3 A;  3C2H A;  3FBN B;  5FKL A;  2VJ5 A;  3E97 A;  2HQ5 A;  1MKM A;  1UEL B;  3G4S I;  4IOC F;  4CUG A;  1G3S A;  4FX0 A;  3HPG A;  3F21 A;  1YI2 I;  5ICF A;  3CLQ A;  3MKL A;  2W48 A;  4HLX A;  4Y33 A;  1X1A A;  3BR5 A;  1MJ9 A;  1MMA A;  1R1U A;  2R7W A;  2L4M A;  1P7I A;  1TWH J;  2RC4 A;  4L5I A;  1O7F A;  2GAU A;  5A2Q Z;  1UB9 A;  4WF2 A;  2O9L A;  4RB1 A;  3G1L A;  4U0W A;  1PP7 U;  1ETV A;  3AG4 H;  3Q9S A;  2CS3 A;  2ECB A;  1STZ A;  3DEW A;  5IOZ A;  1Q1H A;  4HDU A;  1JKR C;  3CCQ I;  1KU3 A;  3V8K A;  1F9N A;  2DA5 A;  4J00 A;  2ME0 A;  5K5Q A;  3C2B A;  5J8C A;  2E5Z A;  3FM3 A;  3KP5 A;  2GXB A;  3DCF A;  2ZJQ F;  3S8P A;  3SZP A;  1HKT A;  2EZL A;  3OWT A;  4RAF A;  3K1M A;  4I76 A;  1MSE C;  1LEA A;  4Z6Y A;  1WH7 A;  5E8I A;  3I58 A;  1W36 C;  1Z7U A;  2QCO A;  3WG7 H;  3J7Z I;  2P7V B;  2V1D A;  2FMY A;  4CSW A;  2IW5 A;  1TNT A;  2EH3 A;  3WTY C;  3ZCO A;  2WY8 Q;  4B3A A;  1HA8 A;  5IT9 K;  1XS9 A;  4U87 A;  2LKP A;  3LL7 A;  4CIC A;  1D8J A;  4ZDL A;  3QYB A;  3OYE A;  3GTJ J;  2K4B A;  4I99 C;  4A3D J;  2XPV A;  3KE2 A;  1LE8 A;  1R71 A;  3OR1 C;  4OMY A;  3OYI A;  1ZYR F;  3ML6 A;  3E0J B;  5JLX A;  2CQK A;  4G94 A;  3ZQC A;  1APL C;  1NK3 P;  1HDD C;  2DDB A;  4XLN F;  1YQA A;  1W7P A;  2EIK H;  2VQL A;  4M72 A;  3IV5 A;  4WXH A;  1T08 B;  2MC4 A;  4BJ6 C;  3SEZ A;  4L0Y B;  1VQO I;  1YFH A;  2LBF A;  1A6I A;  4A3B J;  2I5U A;  2P6S A;  2RAE A;  2VKH A;  3QP6 A;  4BHB A;  5B66 C;  3K9T A;  4GYI A;  1M1E B;  4R79 A;  2M8E A;  4PJN A;  2N8G A;  3DPU A;  4I6Z A;  1DDN A;  2VKD A;  4L5E A;  2R7V A;  3S17 J;  2J5P A;  1P92 A;  1NH3 A;  3RJP A;  3H3V K;  3FDY A;  1FLI A;  2JJ7 A;  3FM5 A;  4LK0 F;  1UCR A;  4R1H A;  2A6H F;  4IX7 A;  4FT8 A;  3S2H J;  3ABT A;  1REP C;  1XTA A;  2KL4 A;  1ORK A;  1UHM A;  1MBE A;  2A68 F;  4U0V A;  2HOE A;  4L9T A;  2BYV E;  5D6F A;  2COB A;  3GCM A;  3IH3 A;  3D0S A;  4DQ2 A;  3HPH A;  1H89 C;  2ESN A;  1IV8 A;  2OUM A;  2Y30 A;  3WTT C;  4XQF A;  1FSH A;  2JSC A;  1U9O A;  3HRT A;  1WI3 A;  2UWM A;  1A35 A;  1L3L A;  1FX7 A;  2YUS A;  5K7F A;  1P4A A;  2F4M B;  3KPH A;  3DBH B;  1LJ9 A;  3FF5 A;  3Q9V A;  1RIO H;  3ZMT A;  1D1A A;  3R4K A;  2YSR A;  3JRC A;  5DD4 A;  2NRA C;  1YLF A;  3TED A;  5CVR A;  2W85 A;  2H27 A;  1LKX A;  2ELJ A;  3HUG A;  4PJ0 C;  3M1E A;  3S14 J;  4FCY A;  4Q48 A;  1Z77 A;  4XM3 A;  4BY7 J;  1BIA A;  3J81 K;  2FU4 A;  2G7H A;  5K5O A;  1XC5 A;  4RAG A;  1MDM B;  2XV4 S;  3HGY A;  2E2I J;  3GTP J;  3HOV J;  2BV6 A;  1WFX A;  3OL4 A;  3W6J B;  4FET A;  2JZY A;  4HW0 A;  3TW7 A;  2JA2 A;  2OA4 A;  3C7J A;  3GTL J;  3FMS A;  5H6Q A;  2G0E A;  2XB5 A;  2KDZ A;  3BR6 A;  4G9Y A;  1LDD A;  1SC7 A;  2XKO A;  3R0A A;  2NVU B;  2PMZ N;  5E1X A;  2IGO A;  4MTD A;  2CW0 F;  2GIV A;  4A3K J;  3TOB A;  1W0T A;  1MBK A;  4QPO A;  1MZB A;  3LSM A;  2Q2E B;  4FIS A;  1XGO A;  2BY2 A;  2XAG A;  3RZO J;  3JTH A;  3W6V A;  1Z91 A;  2FUG 2;  3OYA A;  4ZYD A;  3M8F A;  2PJR B;  3QQA A;  3IL2 A;  3GME A;  3M07 A;  4YFX F;  2IAI A;  4WCG A;  4H4K C;  1ZQ3 P;  4HEA 2;  3RPQ A;  4OIR F;  3GTO J;  3K4B A;  5IYC J;  3U21 A;  5HLG A;  3ULQ B;  2E1C A;  5E3N A;  1ETK A;  1VQM I;  3HEF A;  4ENK A;  2ZME A;  5HOD A;  4A12 A;  3DU5 A;  5GPC A;  5D5W B;  1HBX G;  2KIU A;  4MLO A;  1RI7 A;  3PIP F;  1AOY A;  1R4M B;  4BQQ A;  1POG A;  2CQQ A;  2DOA A;  3HIF A;  4B09 A;  2ZSH B;  1IAW A;  1N78 A;  1SVL A;  2E5N A;  2DW4 A;  4BL0 B;  4HQM A;  5IT3 A;  5ERI A;  2EFN A;  1I3Q J;  3K1P A;  1GT0 C;  2QYO A;  1HC8 A;  4MEY F;  1T38 A;  2DJN A;  1DU0 A;  3GTM J;  1BR2 A;  3PNT A;  3FIS A;  4ESF A;  3Q0V A;  2CGP A;  3KZY A;  3LA2 A;  1LB2 A;  1WJF A;  5LFA A;  3H36 A;  1EJ9 A;  2F48 A;  2X51 A;  2YS9 A;  3K2A A;  5FJ8 J;  2Z33 A;  1NK2 P;  2F5C A;  2PI0 A;  1ETY A;  4P9U A;  3K70 C;  2E2H J;  3QPS A;  3KP7 A;  5GAH J;  3KFW X;  4XKC A;  3IHU A;  1FBU A;  3LMM A;  1RNL A;  2CMP A;  4DIQ A;  3E6C C;  5E18 F;  1WGX A;  1F5T A;  2XF5 A;  3I71 A;  4F7Z A;  3GTG J;  1BR1 A;  2K3P A;  4HPQ A;  1FZP B;  5HS8 A;  1IF1 A;  4MFE A;  2UXX A;  4DBQ A;  2LRD A;  4MNU A;  3HOW J;  4QSH A;  5FKO A;  2H8W A;  2Q2E A;  1MMG A;  5DM6 F;  1VQ8 I;  4J01 A;  1ETO A;  4HX4 A;  1S5L C;  2PFB A;  2XGD A;  2PJR A;  4FE4 A;  4HQE A;  5J40 A;  1D3Y A;  5E3M A;  3VYT B;  4L5J A;  1K6Y A;  3SYT A;  2CRG A;  1JI8 A;  3DFG A;  5J3L A;  4NC8 A;  1OPC A;  3OYD A;  4PCQ A;  2IXS A;  1G3T A;  4ZC3 A;  1AHD P;  3OYB A;  3HSF A;  4IJA A;  4O6J A;  1KZH A;  5IY5 H;  3BC8 A;  2VPR A;  5E79 C;  4GGG A;  1FIA A;  2TCT A;  4E6K G;  4YRV A;  3G71 I;  3QPT A;  5J47 A;  1ACI A;  5LEK A;  1GLN A;  1FJL A;  1IXC A;  4DYQ A;  1KGS A;  3R61 A;  2JA5 J;  3IKV A;  1S6L A;  2EWN A;  5F27 A;  1XN7 A;  2HQA A;  4BQA A;  4BJT A;  2AS5 F;  2MGQ A;  2EZK A;  2MLK A;  3SEQ A;  3L2C A;  3HTS B;  3VSK A;  2HYF A;  2GA1 A;  3WHC A;  2E2J J;  5L3D A;  4RGS A;  2H09 A;  4I02 A;  1X1B A;  5HLI A;  3A01 B;  3PQJ A;  4HV6 A;  4XOR A;  2K85 A;  1RET A;  3H5R A;  3HRS A;  1Z21 A;  3RKW A;  3UNG C;  3BZK A;  4YFN F;  3NAU A;  5FD5 A;  2X4H A;  2DDA A;  1OIS A;  3K2Z A;  1IJW C;  4HG2 A;  2HI3 A;  3GW2 A;  2FBK A;  1TT0 A;  4PJJ A;  5ICC A;  3ASO H;  4RGR A;  1DGW Y;  3BR0 A;  3CCS I;  3L2W A;  2O6G E;  3A2K A;  3S15 J;  4A3L J;  4UUV A;  4V2G A;  4E7K A;  2LF7 A;  5C3E J;  4ZZL A;  5M5Y J;  3ELK A;  4P5O A;  3ZQG A;  2CG4 A;  1IRG A;  2LMD A;  1SVM A;  3OIO A;  4BE0 A;  3H9J A;  5GPA A;  4RM2 A;  2EFQ A;  1W7P D;  2KKO A;  3G1M A;  3HOS A;  2RDP A;  2A6E F;  3PM1 A;  3X2Q H;  3BP8 A;  2O5R A;  1FMW A;  2KZG A;  1F36 A;  5DUK A;  2CUJ A;  3HGG A;  1YX3 A;  3GVA A;  3HKZ N;  1Z05 A;  4N9H A;  2M34 A;  1JKO C;  2WAE A;  1HW1 A;  1YRN B;  1G59 A;  2BOL A;  1OFC X;  2V1N A;  1ZGW A;  2X6X A;  4GYG A;  3WTZ A;  2XGE A;  5FKK A;  3BG3 A;  3LSK A;  3BG7 A;  2DMN A;  1T95 A;  1P6R A;  2PMH A;  5BMZ A;  1DPU A;  3DWL E;  2Y0S N;  5IOY A;  4EJV A;  3EQL F;  4XR6 A;  3CF5 F;  1DP7 P;  4HST A;  4HX8 A;  3A4C A;  3K10 A;  4KIF A;  1JT6 A;  1A04 A;  3PNV A;  4D0P A;  1WCM J;  1R23 A;  2DJI A;  1KU2 A;  3ECO A;  2AXL A;  4G8X A;  4ENJ A;  1ETQ A;  3KP4 A;  4NQW A;  4MFD A;  4NC6 A;  2DFE A;  2NS7 A;  2DPU A;  2M4K A;  1RC9 A;  3Q5F A;  3ZXS A;  3OYN A;  3BR3 A;  3PFY A;  3KZZ A;  4HF0 A;  4CYD A;  2X48 A;  4OMZ A;  3GYH X;  4KN7 X;  2XGC A;  3ZP5 A;  3BR1 A;  2F4O B;  1BM9 A;  4ZYG A;  2HYG D;  1R5G A;  3M3Y J;  1G2H A;  2HZD A;  3FKJ A;  4B47 A;  5DD8 A;  5EEG A;  1X4O A;  4P1W A;  5DCM B;  3TDU C;  1MIJ A;  4ZH4 F;  2OBP A;  3GEZ A;  1X1C A;  2BY0 A;  2QBY B;  1G6N A;  4UV9 A;  3CCM I;  1VZ0 A;  3J7A Y;  1XPX A;  2IGK A;  3K1N A;  1U3E M;  2IS6 A;  4M3B A;  5D4R A;  2Q0O A;  2MFZ A;  1JHH A;  1DUX C;  3WU1 B;  4ZYH A;  4N4O B;  4JQF A;  3HBL A;  4Y13 A;  1E3H A;  1V5F A;  5IPA A;  2IS1 A;  3EPZ A;  2R7D A;  5AIP A;  2LOO A;  2PMU A;  3CCR I;  1G3Y A;  5LHH A;  3H5N A;  3GTQ J;  3HKZ A;  2VQC A;  3TP3 A;  1BC8 C;  2IT0 A;  2P6T A;  3PFI A;  4IEJ A;  2IJL A;  2VJJ A;  1FBS A;  4KT6 A;  3W2V A;  3L9F A;  2R7Q A;  1T6S A;  1SEU A;  2ELH A;  5LEJ A;  3KP6 A;  2MA3 A;  3FWE A;  2EIN H;  2M7B A;  3FXR A;  4M9Z A;  3DF8 A;  4M3F A;  2FA5 A;  2M2E A;  3LQQ A;  1SAX A;  5J1U A;  4IHT A;  2B9S A;  4E7L A;  3JW4 A;  4BNC A;  2BY3 A;  3F22 A;  2HFH A;  2L2O A;  2R3S A;  2Y0S A;  1NG7 A;  3FBI B;  3S1Q J;  3RPU A;  1G3W A;  3H0G J;  3BCA A;  3CJN A;  4EMS A;  4G7Z F;  1YW7 A;  4CXF A;  2QWW A;  1O57 A;  1JKQ C;  4DOZ A;  4FTH A;  2LF8 A;  2EV6 A;  1RUO A;  1QPI A;  4OIQ F;  2K9Q A;  5EG0 B;  3CF2 A;  4XLA A;  4O3M A;  3QP5 A;  5CQG A;  1BBY A;  3GFM A;  3G73 A;  1TTY A;  2FJ1 A;  5ILU A;  1N77 A;  5ICG A;  1N25 A;  3I55 I;  3T5X A;  3L1P A;  2ISY A;  3K0L A;  1MBF A;  4XNF A;  3JRI A;  3MZY A;  5DCM A;  3LA7 A;  1A36 A;  1DQU A;  1WWX A;  3BT9 A;  4ZJZ A;  4HZF A;  4KNY A;  4LLN A;  5IYD J;  2QBY A;  3M8J A;  3VYU B;  5L3C A;  1PYV A;  1OYI A;  1YJW I;  1R5I D;  5FD6 A;  4BHC A;  4RAZ A;  3QU3 A;  2VAS A;  2Z2S B;  1R9T J;  2JQ7 A;  2LY1 A;  2DMQ A;  1YW8 A;  3RZD J;  4NHJ A;  1T0F C;  3GZ5 A;  3SDG A;  1TBX A;  2OCC H;  4I7H A;  4PUS A;  5AON A;  4C3I J;  2LRE A;  3M7G A;  3B6A A;  5EYR A;  5LGU A;  2XKP A;  4I2O A;  2LYC A;  4AWX B;  1I27 A;  3BCB A;  4YFK F;  1IDY A;  1D0Z A;  5DV5 A;  4GDF A;  2P0W A;  2QVO A;  4PGH A;  4YG2 F;  3E5U A;  3RI4 A;  3EUH A;  1J0R A;  1IN8 A;  2FQ3 A;  2V26 A;  1LDK B;  2V7F A;  1ZLK A;  4ZDP A;  2DAO A;  2YU3 A;  1WVR A;  2K5C A;  2V6C A;  2ZNZ A;  3VSL A;  2DA3 A;  1ETX A;  2DFH A;  3E1S A;  1P9Q C;  4G7H F;  4CZZ A;  1YS7 A;  2W1O A;  3DU6 A;  1YIJ I;  4JBA A;  1OR7 A;  2JUG A;  3JRE A;  3I9V 2;  1VTN C;  1W4M A;  2XRO A;  4B48 A;  3U1K A;  2TDX A;  2MC3 A;  5E17 F;  4MHG A;  4W97 A;  3AG1 H;  2DA4 A;  4A3C J;  3OMY A;  4XLE A;  4XON A;  1RKW A;  3MWM A;  4EEF G;  2QSH X;  2FML A;  1TZL A;  4AUX A;  2QGU A;  2EV0 A;  5M5W J;  3BQY A;  5EG0 A;  3AG3 H;  4A0X A;  1MMN A;  3HL2 A;  2KIF A;  4CCN A;  4ZYA A;  3RKY A;  1QA6 A;  1FC3 A;  2HKX A;  3WG9 A;  3H9Q A;  5LGT A;  2JA7 J;  2DLL A;  1P2F A;  2OTJ I;  3AG2 H;  5HS7 A;  3JRA A;  3QU6 A;  4E7H A;  3TKY A;  3PNY A;  3CC7 I;  3GFI A;  1P4W A;  2DO7 A;  2KIQ A;  4TV7 A;  2W00 A;  1ZEL A;  4LJZ F;  5FRO A;  1QVT A;  2PEX A;  1HW5 A;  3HOZ J;  2KJB A;  3EUA A;  2IEK A;  4E7J A;  3BTC A;  3N97 A;  4IQ4 A;  2ZFU A;  1ZRC A;  4E7Z A;  2L4A A;  2L9S A;  4HRI A;  3RQI A;  3WTV C;  3A1Y A;  3EYY A;  5JVT A;  1GXQ A;  3COA C;  1B8I B;  1FOY A;  1FMV A;  1TW2 A;  1IRZ A;  5B5E C;  2DK8 A;  3QAH A;  4OIP F;  2P8T A;  4GFB A;  1FIP A;  2HPM A;  2L01 A;  2P5L C;  4Y15 A;  2QZ8 A;  1SVO A;  2LFB A;  3LNQ A;  3L2U A;  1TL8 A;  2HDD A;  1T8I A;  2V79 A;  1FNN A;  1T98 A;  2CFO A;  5DEQ A;  3P9K A;  1TWG J;  1FEX A;  2WWY A;  1Z67 A;  1X3Z B;  2LVS A;  1NTC A;  2DYR H;  4XRF A;  3CME I;  3R0J A;  1ETW A;  2DU9 A;  2RVC A;  4A3I J;  3T0Y A;  2MLG A;  3HOU J;  1IO2 A;  3CJQ B;  2OC6 A;  4FE7 A;  2H94 A;  4OIN F;  3VEP A;  2WB1 N;  2QQA A;  2QM3 A;  3MMY B;  3GFL A;  3N05 A;  4IHX A;  2VOP A;  1IRX A;  1ZTR A;  2W84 A;  3KEQ A;  3DTE A;  1RES A;  2WAQ N;  1R7J A;  2LC2 A;  2RKH A;  3V8J A;  1LVK A;  2ELK A;  4NUB A;  1SFO J;  1FP1 D;  1S72 I;  3FXU A;  4E4H A;  1JTY A;  4WK8 F;  3CC4 I;  2CV0 A;  2WAD A;  2DOF A;  1MW7 A;  2XIG A;  3IRQ A;  1BC7 C;  1MH4 A;  3L00 A;  4YIF A;  1W36 D;  1ONV A;  3L2R A;  1AU7 A;  2A61 A;  4PZJ A;  5E20 A;  3BPX A;  2GZW A;  2RV8 A;  3B6C A;  3GBG A;  5E3O A;  3I4N J;  3OYK A;  2DOD A;  3OYM A;  9ANT A;  3SJM A;  1CGP A;  2XRN A;  5EEA A;  4P96 A;  3IP4 B;  4CYC B;  1LEB A;  2A69 F;  1ZRE A;  1BN5 A;  1TP4 A;  3WTU C;  1J2X A;  4X6A J;  4RB2 C;  1S29 A;  1RKT A;  2TRT A;  2NNY A;  2KHM A;  1QZE A;  2X6W A;  2J5O A;  5CJ9 A;  2EFO A;  1TNS A;  1LFU P;  2M87 A;  2AO9 A;  4X1E A;  5HDN A;  1PUF B;  4EJU A;  1XX5 A;  5J1Y A;  5DYM A;  3HYI A;  3OY9 A;  4M6Y A;  3WTW C;  3GUD A;  4OOI A;  1QQI A;  3RIR A;  1MBH A;  5HNH A;  3O2P E;  3OR2 C;  2OPT A;  4QWQ A;  3W2W A;  2K9S A;  2YR2 A;  3M4O J;  2XVC A;  1R1T A;  2VBW A;  4HOB A;  1R4N B;  4C2U A;  3EUK L;  3KYC B;  3GF2 A;  4PJM A;  5EDN A;  4AU7 A;  2OCE A;  3JSO A;  2GOM A;  2LY2 A;  2DMT A;  1F1Z A;  2OJE D;  1TWC J;  4CH7 A;  4EGY A;  3MN2 A;  1B6A A;  4U88 A;  2JN6 A;  2E60 A;  3D5S C;  3DP7 A;  3J80 K;  3PO2 J;  2EFP A;  3FXO A;  2M9H A;  2QEX I;  3L09 A;  1QZY A;  4I09 A;  4XKV A;  1E2X A;  2BGC A;  2HWV A;  3OS2 A;  2EQR A;  4V2F A;  2WB1 A;  2ZO4 A;  4V19 K;  2X1E A;  2X85 A;  1V5E A;  2PX9 A;  2LY9 A;  3FXM A;  3ASN H;  3O8G A;  2Z99 A;  1ERD A;  2DTR A;  3F6O A;  2Y2Z A;  3ZQ7 A;  1YJN I;  3K4J A;  3J7A O;  2M0C A;  2VT3 A;  1WJB A;  2E34 A;  2E1O A;  3HG9 A;  4LIU A;  1TC3 C;  3IKT A;  3ZGK A;  2JSP A;  1HSJ A;  4CO8 A;  3V8L A;  2E1N A;  3W6K B;  3S3M A;  4RMN A;  5D5U B;  4M3G A;  5IP6 A;  4RB3 C;  3CUQ B;  2XGX A;  1ZR4 A;  4DNC A;  1JUS A;  5FFZ A;  4EJW A;  5F08 A;  1XD7 A;  4XL9 A;  3QRF F;  4A3M J;  1MNE A;  4MQV A;  4BDZ A;  3F8B A;  2XDV A;  3ONQ A;  1PUF A;  3P5J A;  2VLA A;  1MD0 A;  1VQ7 I;  2OAZ A;  1QGP A;  1BI3 A;  3EUH C;  2HPI A;  5F0F A;  1A31 A;  3E5X A;  3HOX J;  4XKW A;  3LFK A;  2QKL B;  1XSV A;  3NWS A;  1VI0 A;  2Y69 H;  4LOC A;  5HDG A;  1MBG A;  3JR9 A;  3GFJ A;  3IC7 A;  2V6E A;  1HLV A;  1VQ5 I;  3F8N A;  4LLG F;  5DDG A;  1U9N A;  2DN0 A;  2DQL A;  2JA6 J;  4AIK A;  2FD5 A;  4GO1 A;  2R7R A;  3NAR A;  1OR7 C;  1RRJ A;  3ZPL A; 
#chains in the Genus database with same CATH homology
 2CYY A;  1TQI A;  2DT5 A;  1WKM A;  2V1X A;  1IRF A;  5FFX A;  3HHG A;  1B9N A;  1GHC A;  1S7O A;  3DQV C;  4HV5 A;  5D5X B;  1SFX A;  2WC2 A;  4M71 A;  2X0L A;  5ILV A;  5DUI A;  1YW9 A;  4U0Y A;  5IT9 Z;  3OV8 A;  2R7F A;  2WV0 A;  1MDM A;  4PGG A;  3WU0 A;  2QQB A;  2FBI A;  1B1B A;  4A6E A;  1ZN2 A;  2XAJ A;  4IF4 A;  2RNJ A;  4AVP A;  1SMT A;  5E1Z B;  1DPR A;  1FT9 A;  2ISZ A;  2FXA A;  2PQ8 A;  4K2E A;  1T0F A;  3C18 A;  2K7L A;  1YTY A;  1MJB A;  2IPQ X;  3M8E A;  2OZU A;  4UXN A;  1XCB A;  4CDG A;  1HST A;  2O3F A;  1J9I A;  4KIG A;  2E7W A;  5LLQ A;  2CFX A;  3TO6 A;  1O3R A;  4ESB A;  1PUE E;  5H20 A;  2M45 A;  2VXZ A;  1XMA A;  2VOO A;  3CUO A;  5E8G A;  3E6D A;  1ODD A;  1IN5 A;  1HKS A;  5BPD A;  3B73 A;  4KDP A;  3T8R A;  1FSE A;  5D5V B;  2FOK A;  4MTE A;  3U2R A;  4KN4 X;  2K02 A;  1R1V A;  1D5V A;  1K78 B;  2JTV A;  3D5L A;  4KT5 C;  1BJA A;  3TO7 A;  3J81 Z;  3LQR A;  3U1D A;  4ZZD A;  4NB5 A;  1UHW A;  4JK1 X;  1OYW A;  2HKO A;  1B9M A;  3WGH A;  3CO6 C;  1JGS A;  1KU9 A;  3TOA A;  3NQO A;  1KYZ A;  1KQ8 A;  2QEN A;  4BAY A;  1K7A A;  1KQ9 A;  3FX3 A;  1ZG3 A;  1LNW A;  2P5V A;  5BPI A;  4RGX A;  3EYI A;  1I5Z A;  4ESJ A;  4UHT A;  2OZ6 A;  3KET A;  4ETS A;  3GZ6 A;  1BI1 A;  1R00 A;  5CLS A;  3H92 A;  2NYX A;  4S05 A;  1K78 A;  1TQM A;  3ZMS A;  5JFR A;  1RZ4 A;  4HA8 A;  1Y0U A;  3ZMV A;  4YII A;  3LST A;  2K4J A;  2A3S A;  4LB6 B;  2FBH A;  1R36 A;  2GQQ A;  1ZRD A;  3JAM K;  5D8L B;  1I1G A;  4FX4 A;  2B0L A;  1L0O C;  3EDP A;  4EM1 A;  2VOD A;  4G6D A;  1SD7 A;  4EM2 A;  1U2W A;  3WGI A;  1YG2 A;  1YS6 A;  4A0Y A;  1KA8 A;  3S2W A;  3JTG A;  5EEH A;  1J5Y A;  1F4K A;  2W24 A;  4ZYE A;  2ZBK A;  3BY6 A;  1SMY F;  1W5S A;  2G9W A;  5A2Q K;  1ON1 A;  1S8N A;  3MFK A;  2V9V A;  2VT2 A;  4U7D A;  4HAM A;  2PJP A;  3RKX A;  3T1B A;  3DV8 A;  4LG0 B;  2FNP A;  3E3V A;  1ZG1 A;  5FB2 A;  4IHS A;  1IN6 A;  3CUQ C;  1ZLJ A;  3KEO A;  2EV5 A;  2MD5 A;  2VBX A;  1XSX A;  4FHT A;  1QZZ A;  2JT1 A;  2O0Y A;  2M5W A;  2O61 A;  2QQ9 A;  4P55 A;  1QBJ A;  2A5Y B;  4G7O F;  2IA1 A;  2P4W A;  3ROU A;  1FWZ A;  2D2W A;  3GLX A;  5D8K B;  1FOK A;  1JE8 A;  2STW A;  4L9N A;  4HF1 A;  3WE2 A;  3CDH A;  5ED4 A;  4I0B A;  1WRJ A;  2IVM A;  3WTS C;  3V7C A;  1KYW A;  1O7L A;  3U9G A;  2PLY A;  1H0M A;  2C6Y A;  2H6C A;  4XLP F;  4LG0 A;  5ICE A;  4WXD A;  1BIB A;  5HDK A;  1YYV A;  4IRG A;  3GXO A;  2DBB A;  2ADU A;  1Z6R A;  2L02 A;  4O5V A;  2FE3 A;  1ON2 A;  3RTR A;  1XDS A;  1J7K A;  4A5N A;  4HX7 A;  1GVJ A;  3P9I A;  2KJC A;  4M6X A;  2ZJ2 A;  1JXS A;  3P9C A;  2W57 A;  2F2E A;  2HS5 A;  3OOP A;  2G7U A;  2VN2 A;  3CLO A;  4LB5 A;  1ZHF A;  1LDJ A;  5F1R A;  2Q8K A;  5FGM A;  1SFU A;  3IRR A;  1B4A A;  2FSW A;  4RB0 A;  1K79 A;  2EFW A;  2NS0 A;  4EQQ A;  3FHZ A;  3DPT A;  3I59 B;  3BZ6 A;  3K69 A;  5LRS A;  5JR3 A;  1ZAO A;  5TRD A;  3FMR A;  4N0B A;  5HS9 A;  2ETH A;  4Q5S F;  5K1Y A;  4IVN A;  5JHU A;  1KQ0 A;  5BOX A;  1XDU A;  1IN4 A;  1S7A A;  4Z2Y A;  4EVI A;  1V3F A;  2FRH A;  3DPL C;  2K86 A;  3VOE A;  3HRU A;  5J6X A;  4OIO F;  2VC0 A;  1XGS A;  2ZXJ A;  2OD5 A;  2ZNY A;  1XGM A;  1EH6 A;  2HTS A;  4CHU A;  2NAZ A;  4HDV A;  3KCC A;  4BH9 A;  3V7R A;  4LFU A;  1OKR A;  2HTJ A;  3WTX C;  2O8X A;  1ZG5 A;  3QOP A;  2HEO A;  2EB7 A;  3FZV A;  4N9I A;  3SHF A;  1HQC A;  4ENN A;  1ULY A;  1AWC A;  2LSO A;  4KIC A;  2MH2 A;  2EA2 A;  1I6X A;  1U78 A;  2VON A;  1I1S A;  1YO5 C;  2LNB A;  5F64 A;  3NRV A;  3KLN A;  4B8X A;  4BXU A;  3GWZ A;  1EV7 A;  1QO0 D;  2VBZ A;  2IA2 A;  4HBL A;  4S04 A;  3ZMU A;  4A0Z A;  1QPM A;  1SD4 A;  3MCZ A;  3TDZ C;  3I59 A;  1H9G A;  4EJT A;  3IWF A;  1ZRF A;  3BJ6 A;  4MEX F;  1MGT A;  1C0W A;  4L0Z B;  4RGU A;  2MH9 A;  4CGZ A;  1SFE A;  1P4X A;  3I5U A;  5CYV A;  3BJO A;  3B02 A;  1KU7 A;  3ZMD A;  2STT A;  2PN6 A;  3HTU A;  3IWZ A;  2RQP A;  1U6G A;  4KUM A;  5ILS A;  2CWE A;  5LGN A;  4IPA A;  3HSR A;  4AIH A;  4MGR A;  2ZME B;  1ZRE A;  2CO5 A;  4M9X A;  5K5R A;  3DXJ F;  1W5T A;  2GWR A;  4I01 A;  4XSZ F;  4AD9 A;  4ON0 A;  3H3Z A;  5FO5 A;  3TQN A;  2LDU A;  5L3B A;  1OMI A;  5H6R A;  2A07 F;  2Z9O A;  1FY7 A;  2ZFW A;  4LLL A;  4HLY A;  2EJR A;  3KP3 A;  5DCF A;  2Z3Y A;  2DI3 A;  2EK5 A;  1G4D A;  3F8F A;  2H6B A;  3F3X A;  1ZGJ A;  1BI2 A;  4M74 A;  2DK5 A;  3G3Z A;  5HVQ C;  1E17 A;  5KK1 A;  3F6V A;  4EGZ A;  4HYE A;  1U8R A;  2FNA A;  4HF2 A;  2M1B A;  3ABU A;  1IXS B;  1R22 A;  3GO5 A;  3LAJ A;  1T39 A;  5L3F A;  1NHA A;  3P7N A;  3BDD A;  3SXY A;  2BBY A;  1U5T C;  3V7S A;  1O3T A;  3I53 A;  2DFI A;  3BRO A;  1J75 A;  1IUY A;  4A2U A;  4L18 B;  1UFM A;  2DQR A;  5LRR A;  2XAH A;  4L9J A;  3RDI A;  2D45 A;  3CUQ A;  3E5Q A;  2Z5U A;  5CVJ A;  3BWG A;  3RYP A;  3EET A;  1LQ1 A;  4MQ9 F;  3LWF A;  2ESH A;  2IRF G;  3MZH A;  2JPC A;  4BYY A;  1FYL A;  2Y0M A;  3REO A;  4AIJ A;  2GA2 A;  3ZN0 A;  3TGN A;  3DKW A;  5BQT A;  2XAF A;  3RYR A;  1YIO A;  2F5F A;  2QLZ A;  1FYK A;  3JSP A;  5CVI A;  1FBQ A;  2W25 A;  3ZMZ A;  1FYM A;  2WTE A;  1H9T A;  4ENM A;  1Z6T A;  1PDN C;  2GXG A;  1OYY A;  2QUF A;  4UNO A;  3ERE D;  2OQG A;  4GCV A;  3SZT A;  3J80 Z;  5L3E A;  3LA3 A;  4Q47 A;  4WXC A;  3I0T A;  2Y48 A;  5KVR A;  2MBF A;  3VB2 A;  1R58 A;  3C1D A;  3C3W A;  3FMQ A;  2OU2 A;  4WWC A;  2P7C B;  2COM A;  4UV8 A;  1O3Q A;  5FLX K;  5L3G A;  1HXD A;  4L9V A;  1GXP A;  3TO9 A;  1CF7 B;  1Z1D A;  2HQR A;  2VBY A;  1K6O A;  4KIB A;  5TJJ A;  2YPR A;  2D1V A;  3I4P A;  1HW2 A;  3R60 A;  3FXQ A;  4H0E A;  1Z9C A;  5D6E A;  3KLO A;  1V4R A;  2YX7 A;  3WGG A;  4E70 A;  3F23 A;  3I54 A;  3HRM A;  3M9A A;  5E1W A;  4GXO A;  4KFC A;  2ACJ A;  4RAY A;  2ZCW A;  4IRH A;  1IN7 A;  2VE9 A;  2RN7 A;  1FPQ A;  1TQP A;  2OQR A;  2YX4 A;  2BE5 F;  1X3U A;  3WE3 A;  2D1H A;  3H3U A;  2UXN A;  1IXR C;  3MQ0 A;  2KIM A;  2IA0 A;  5AIQ A;  2XAQ A;  3CO7 C;  3VOD A;  4UVC A;  1XSD A;  2XAS A;  4IXA A;  4KYW A;  1R5H A;  1CF7 A;  4G6Q A;  5LHI A;  3BPV A;  3V4G A;  3ZN1 A;  3F72 A;  4EJO A;  2M30 A;  2L3D A;  3O3K A;  3R6S A;  6PAX A;  2PG4 A;  2F5D A;  2EA4 A;  3NEU A;  4KA4 A;  3F8C A;  2L54 A;  5LHG A;  5JI6 A;  5CVV A;  3E6B A;  4KMF A;  4M73 A;  4XSX F;  1HKQ A;  3QPH A;  3MAJ A;  1ZGA A;  4M9S A;  2UZK A;  4Y17 A;  3DEU A;  4I98 B;  1EH8 A;  2JPB A;  4RS8 A;  3E6M A;  2VE8 A;  4LD5 A;  3BJA A;  1PP8 F;  1QNT A;  1ZH5 A;  1USS A;  2KRF A;  2HR3 A;  3VFZ A;  2FF4 A;  4XBF A;  3CTA A;  1IZ1 A;  1JHF A;  1U5T B;  3MEX A;  4A6D A;  3PQK A;  2CSO A;  1S3J A;  2Y75 A;  1FP2 A;  1WQ2 A;  2XHK A;  2HZT A;  2JRT A;  4LMY A;  4Q4Z F;  1TLH B;  2HGC A;  2HQN A;  2K27 A;  1LVA A;  2XUB A;  1SD5 A;  1SD6 A;  1BOA A;  3SQN A;  3HHH A;  5FLX Z;  2ZKZ A;  3HOT A;  4UVA A;  4I0A A;  2NNN A;  3ISP A;  1J59 A;  4KMU X;  5LBQ A;  4EM0 B;  1T2K A;  3N4M A;  1XGN A;  4P9F A;  3KP2 A;  1IW7 F;  5HLH A;  1XCV A;  4U7B A;  1WSU A;  4PDK A;  4ASN A;  2DPD A;  1WI9 A;  4OU0 A;  2IP2 A;  2P5K A;  1B59 A;  3GX4 X;  3O6B B;  4WX9 A;  1EH7 A;  2FEZ A;  4IRI A;  3ECH A;  3AAF A;  1XMK A;  4A5M A;  3F8M A;  4LK1 F;  5D4S A;  4UVB A;  3SFZ A;  1U5T A;  5F6F A;  4LGW A;  2VC1 A;  5J8F A;  5CVU A;  4BHP A;  1D8K A;  1UST A;  1BI0 A;  2V1U A;  3I64 A;  2PBI A;  1MJA A;  1RUN A;  2O03 A;  3JAM Z;  2E7X A;  3HSE A;  1XB4 A;  4EV0 A;  1O3S A;  3LAP A;  1ZAR A;  2HDC A;  2F5E A;  2BEO A;  3BOQ A;  3WOD F;  3L7W A;  1W7P B;  2RGV A;  4R8H A;  5BS6 A;  3T8T A;  4QLC U;  5HOO A;  1TW3 A;  3E97 A;  1MKM A;  1G3S A;  4FX0 A;  3F21 A;  5ICF A;  4HLX A;  1MJ9 A;  1R1U A;  2L4M A;  2RC4 A;  4L5I A;  1O7F A;  2GAU A;  5A2Q Z;  1UB9 A;  4WF2 A;  4RB1 A;  4U0W A;  1PP7 U;  3Q9S A;  1STZ A;  1Q1H A;  4HDU A;  1KU3 A;  3V8K A;  1F9N A;  5K5Q A;  5J8C A;  3FM3 A;  3KP5 A;  2GXB A;  3SZP A;  1HKT A;  3K1M A;  1LEA A;  5E8I A;  3I58 A;  1Z7U A;  2P7V B;  2V1D A;  2FMY A;  2IW5 A;  1TNT A;  3WTY C;  5IT9 K;  2LKP A;  4CIC A;  1D8J A;  2K4B A;  3KE2 A;  4OMY A;  1ZYR F;  3ML6 A;  2CQK A;  4G94 A;  4XLN F;  1YQA A;  1W7P A;  4M72 A;  4WXH A;  4L0Y B;  1YFH A;  2P6S A;  3QP6 A;  4BHB A;  3K9T A;  4GYI A;  4R79 A;  2M8E A;  1DDN A;  2J5P A;  1P92 A;  3RJP A;  1FLI A;  3FM5 A;  4LK0 F;  1UCR A;  4R1H A;  2A6H F;  4FT8 A;  3ABT A;  1REP C;  1UHM A;  2A68 F;  4U0V A;  2HOE A;  4L9T A;  2BYV E;  5D6F A;  3D0S A;  4DQ2 A;  2ESN A;  3WTT C;  1FSH A;  2JSC A;  3HRT A;  2UWM A;  1L3L A;  1FX7 A;  1P4A A;  3FF5 A;  1LJ9 A;  3Q9V A;  1RIO H;  3ZMT A;  3R4K A;  2YSR A;  5DD4 A;  2NRA C;  1YLF A;  5CVR A;  2W85 A;  2H27 A;  3HUG A;  3M1E A;  4Q48 A;  1BIA A;  3J81 K;  2FU4 A;  2G7H A;  5K5O A;  1MDM B;  2XV4 S;  2BV6 A;  3W6J B;  2JZY A;  4HW0 A;  2OA4 A;  3C7J A;  3FMS A;  5H6Q A;  4G9Y A;  1LDD A;  2XKO A;  3R0A A;  5E1X A;  4MTD A;  2CW0 F;  2GIV A;  3TOB A;  1MZB A;  1XGO A;  2XAG A;  3JTH A;  1Z91 A;  4ZYD A;  3M8F A;  3IL2 A;  4YFX F;  4WCG A;  3RPQ A;  4OIR F;  5HLG A;  3ULQ B;  2E1C A;  4ENK A;  2ZME A;  4A12 A;  5D5W B;  1HBX G;  2KIU A;  1RI7 A;  1AOY A;  3HIF A;  4B09 A;  1IAW A;  2DW4 A;  4HQM A;  5IT3 A;  5ERI A;  2EFN A;  3K1P A;  2QYO A;  4MEY F;  1T38 A;  4ESF A;  2CGP A;  3KZY A;  3LA2 A;  1LB2 A;  2Z33 A;  2F5C A;  2PI0 A;  4P9U A;  3KP7 A;  3KFW X;  3IHU A;  1FBU A;  1RNL A;  3E6C C;  5E18 F;  1F5T A;  3I71 A;  4F7Z A;  1FZP B;  5HS8 A;  1IF1 A;  2UXX A;  4MNU A;  2Q2E A;  4HX4 A;  2PFB A;  4HQE A;  1D3Y A;  4L5J A;  3DFG A;  1OPC A;  4PCQ A;  1G3T A;  3HSF A;  4IJA A;  4O6J A;  4GGG A;  3QPT A;  5LEK A;  1IXC A;  1KGS A;  3R61 A;  3IKV A;  1S6L A;  2EWN A;  1XN7 A;  4BQA A;  2AS5 F;  2MLK A;  3L2C A;  3HTS B;  2HYF A;  2GA1 A;  5L3D A;  4RGS A;  2H09 A;  4I02 A;  5HLI A;  3PQJ A;  4HV6 A;  3HRS A;  3RKW A;  4YFN F;  5FD5 A;  2X4H A;  3K2Z A;  3GW2 A;  2FBK A;  5ICC A;  4RGR A;  2O6G E;  4UUV A;  2LF7 A;  4ZZL A;  3ELK A;  4P5O A;  2CG4 A;  1IRG A;  2EFQ A;  1W7P D;  3HOS A;  2KKO A;  2RDP A;  2A6E F;  3BP8 A;  5DUK A;  3GVA A;  1Z05 A;  4N9H A;  1HW1 A;  4GYG A;  3WTZ A;  1P6R A;  2PMH A;  5BMZ A;  1DPU A;  4EJV A;  3EQL F;  1DP7 P;  4HX8 A;  4KIF A;  1A04 A;  4D0P A;  1R23 A;  1KU2 A;  3ECO A;  2AXL A;  4G8X A;  4ENJ A;  3KP4 A;  4NQW A;  2DPU A;  3Q5F A;  3KZZ A;  4HF0 A;  4CYD A;  4OMZ A;  3GYH X;  4KN7 X;  3ZP5 A;  1BM9 A;  4ZYG A;  2HYG D;  1R5G A;  5DD8 A;  5EEG A;  5DCM B;  3TDU C;  4ZH4 F;  2OBP A;  3GEZ A;  2QBY B;  1G6N A;  4UV9 A;  3K1N A;  1U3E M;  5D4R A;  2Q0O A;  1JHH A;  1DUX C;  3WU1 B;  4ZYH A;  4JQF A;  4Y13 A;  2R7D A;  5AIP A;  2PMU A;  1G3Y A;  5LHH A;  1BC8 C;  2IT0 A;  2P6T A;  3PFI A;  2IJL A;  1FBS A;  3L9F A;  1T6S A;  2ELH A;  5LEJ A;  3KP6 A;  2MA3 A;  3FWE A;  3FXR A;  4M9Z A;  3DF8 A;  2FA5 A;  3LQQ A;  1SAX A;  4IHT A;  3JW4 A;  4BNC A;  3F22 A;  2HFH A;  2R3S A;  3RPU A;  1G3W A;  3CJN A;  4EMS A;  4G7Z F;  1YW7 A;  4CXF A;  2QWW A;  1O57 A;  2LF8 A;  2EV6 A;  1RUO A;  4OIQ F;  4O3M A;  3QP5 A;  1BBY A;  3GFM A;  3G73 A;  1TTY A;  5ILU A;  5ICG A;  3T5X A;  2ISY A;  3K0L A;  3MZY A;  5DCM A;  3LA7 A;  1WWX A;  4HZF A;  4KNY A;  4LLN A;  2QBY A;  5L3C A;  1OYI A;  5FD6 A;  4BHC A;  4RAZ A;  3QU3 A;  1YW8 A;  4NHJ A;  3GZ5 A;  1TBX A;  4I7H A;  5AON A;  3M7G A;  5LGU A;  4I2O A;  2XKP A;  4AWX B;  1I27 A;  4YFK F;  5DV5 A;  2QVO A;  4PGH A;  4YG2 F;  3RI4 A;  3E5U A;  3EUH A;  1J0R A;  1IN8 A;  2FQ3 A;  1LDK B;  1ZLK A;  2DAO A;  2YU3 A;  2V6C A;  2ZNZ A;  4G7H F;  4CZZ A;  1YS7 A;  4JBA A;  1OR7 A;  1VTN C;  1W4M A;  2XRO A;  2TDX A;  2MC3 A;  5E17 F;  4MHG A;  3MWM A;  2FML A;  2EV0 A;  4A0X A;  2KIF A;  3RKY A;  1FC3 A;  2HKX A;  3WG9 A;  5LGT A;  2DLL A;  1P2F A;  5HS7 A;  3QU6 A;  3TKY A;  3GFI A;  1P4W A;  2DO7 A;  4TV7 A;  4LJZ F;  2PEX A;  1HW5 A;  2KJB A;  3N97 A;  1ZRC A;  2L4A A;  3WTV C;  3EYY A;  5JVT A;  1GXQ A;  3COA C;  1TW2 A;  2DK8 A;  3QAH A;  4OIP F;  2P8T A;  2L01 A;  2P5L C;  4Y15 A;  2QZ8 A;  2V79 A;  1FNN A;  1T98 A;  5DEQ A;  3P9K A;  2WWY A;  4XRF A;  3R0J A;  2DU9 A;  2RVC A;  3T0Y A;  2MLG A;  4OIN F;  2H94 A;  3VEP A;  2QQA A;  2QM3 A;  3GFL A;  2VOP A;  2W84 A;  3KEQ A;  1R7J A;  2RKH A;  3V8J A;  1FP1 D;  3FXU A;  4WK8 F;  2XIG A;  3IRQ A;  1BC7 C;  3L00 A;  4YIF A;  1ONV A;  2A61 A;  4PZJ A;  5E20 A;  3BPX A;  2GZW A;  2RV8 A;  1CGP A;  2XRN A;  4P96 A;  1LEB A;  2A69 F;  1BN5 A;  3WTU C;  1J2X A;  4RB2 C;  1S29 A;  2NNY A;  2J5O A;  5CJ9 A;  2EFO A;  1TNS A;  2M87 A;  5HDN A;  4EJU A;  5DYM A;  3HYI A;  4M6Y A;  3WTW C;  3GUD A;  4OOI A;  1QQI A;  3RIR A;  3O2P E;  4QWQ A;  2YR2 A;  2XVC A;  1R1T A;  2VBW A;  4HOB A;  3GF2 A;  3JSO A;  1F1Z A;  4EGY A;  1B6A A;  4U88 A;  3J80 K;  3DP7 A;  2EFP A;  3L09 A;  1QZY A;  4I09 A;  1E2X A;  2BGC A;  2HWV A;  2ZO4 A;  2Z99 A;  2DTR A;  3F6O A;  3ZQ7 A;  3J7A O;  2VT3 A;  3IKT A;  1HSJ A;  4CO8 A;  3V8L A;  2E1N A;  3W6K B;  5D5U B;  4RB3 C;  3CUQ B;  2XGX A;  4DNC A;  5FFZ A;  4EJW A;  1XD7 A;  3QRF F;  4MQV A;  3F8B A;  1MD0 A;  2OAZ A;  1QGP A;  1BI3 A;  3E5X A;  3LFK A;  1XSV A;  5HDG A;  3GFJ A;  3IC7 A;  3F8N A;  4LLG F;  5DDG A;  2DQL A;  4AIK A;  4GO1 A;  3ZPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...