4HW0A

Crystal structure of sso10a-2, a dna-binding protein from sulfolobus solfataricus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
98
structure length
98
Chain Sequence
KRGTMEIMFDILRNCEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDRKIYEITEKGKLLRTHIEEFIKIRENLYSAKEKVSELLRTDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse architectural properties of Sso10a proteins: Evidence for a role in chromatin compaction and organization.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
molecule keywords DNA-binding protein Sso10a-2
total genus 36
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14947 HTH_45 Winged helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hw0A00
3LA7A 4DQ2A 5HVQC 1W7PA 2IRFG 4M72A 4LLLA 3RI4A 3LA2A 3GFLA 3SFZA 4A0ZA 1LEAA 2VT2A 2G7UA 2L54A 3HHHA 2E7XA 2A6EF 4WK8F 3KP6A 1D5VA 4L9TA 3IRRA 3EETA 2HGCA 2EWNA 4IF4A 5FB2A 2RGVA 1W7PB 2X4HA 2EV6A 3LFKA 4ETSA 3KFWX 4ENJA 4G7ZF 2KKOA 5E8GA 3O3KA 2EFQA 3ML6A 2RKHA 3MQ0A 6PAXA 3WTYC 4IXAA 2P8TA 3I59B 4HQMA 1T6SA 1TLHB 2DT5A 1MDMB 2W85A 2V9VA 3L00A 4NB5A 1WSUA 1XMAA 3ECHA 2CWEA 4KMUX 1XGOA 1I1SA 3VODA 2GQQA 1D3YA 2MLGA 4LG0A 1O3QA 2V1DA 1UB9A 2BYVE 3KLOA 3JAMZ 2VBXA 3T8TA 2KJCA 5EEHA 3ELKA 1QQIA 1YYVA 4HX8A 4A5NA 4PDKA 1R58A 3VOEA 3QU3A 1F5TA 2P4WA 2VN2A 4Y15A 5LGNA 3GXOA 2JRTA 2PLYA 3M9AA 4L0ZB 1O7LA 1Z6TA 1ZHFA 1J7KA 1FWZA 2KRFA 3R0JA 3WTTC 4RAZA 2M1BA 1ZRCA 5H20A 4UVAA 2LDUA 1OKRA 2VBWA 2STTA 2OZUA 2QYOA 3DPTA 3D0SA 3P9CA 3WGHA 3TOBA 1G3SA 4HW0A 1ZGJA 2P6TA 1GVJA 2OD5A 1SAXA 4IRGA 4HQEA 2V6CA 1NHAA 4GGGA 1IZ1A 3O6BB 5LBQA 1XDUA 4EJVA 1FBQA 3P9IA 1XN7A 4WWCA 2ESHA 3MZYA 2RN7A 4LFUA 1IXRC 2IW5A 3R0AA 5DV5A 1UHMA 1KU9A 5AONA 3N97A 3PFIA 1DUXC 1R1UA 1FZPB 1ZRDA 4WF2A 3FM3A 3L7WA 3PQJA 1QGPA 1YTYA 5KVRA 1S8NA 1K78B 3QRFF 2X0LA 3KP3A 3WODF 1MJ9A 1O57A 5CVVA 1IXCA 1FYLA 5LEKA 1TW2A 3T1BA 1SFXA 3LQQA 1IAWA 4U0WA 5HS9A 4G7OF 5CVJA 3F21A 2J5OA 2M45A 3R61A 2B0LA 1YFHA 4L18B 3RDIA 3JSPA 4A2UA 5F1RA 2ADUA 4OOIA 3JW4A 3IWFA 3J81Z 2MC3A 4GXOA 1WI9A 4O5VA 2YR2A 3M8FA 1YG2A 5HLHA 4GYGA 4LLGF 4I0BA 3TO6A 4IRIA 4O3MA 3I58A 5LLQA 4HOBA 4KMFA 2DW4A 2HZTA 1HW5A 1LQ1A 4ESJA 4FHTA 2O6GE 4HA8A 3V4GA 2NAZA 4XLPF 2JSCA 3SZPA 1BOAA 4XBFA 2PMUA 3EUHA 3V7CA 5LHIA 4RB1A 1LDKB 3ZMZA 3KE2A 2E1CA 3JTHA 4S05A 1EH7A 1XDSA 4PCQA 2D1HA 5FLXK 5F64A 4IPAA 5H6QA 4HF1A 2FMYA 2LF8A 1K78A 1KA8A 5D5UB 2IPQX 2GZWA 1FYMA 3GX4X 2CG4A 3CTAA 4EJWA 2CYYA 5DEQA 1XCVA 1BC8C 1R5HA 2DU9A 1HBXG 3HOSA 2RQPA 5J8FA 1BN5A 2FA5A 4EJOA 2LKPA 5JHUA 4MQ9F 2R7DA 5JI6A 4HAMA 3QP6A 2O0YA 5TRDA 3E5QA 2A61A 3IRQA 3FXRA 4IRHA 1T2KA 3IWZA 1O3RA 1F1ZA 2CO5A 2VE9A 3GFMA 4LB6B 1U6GA 1TBXA 3MAJA 2HEOA 3ZMVA 4YFXF 2XASA 1ZGAA 3DKWA 1ZH5A 2A5YB 5K1YA 1R1VA 4LB5A 4OIOF 4M74A 3Q5FA 5ILUA 1K6OA 5D5WB 3IKTA 4HYEA 2DQRA 4IHSA 4I7HA 2CQKA 5JVTA 5K5QA 1FSEA 4OMYA 3K1NA 4HV5A 3U9GA 4R79A 4I98B 4OU0A 2UXXA 4U7DA 2XV4S 1ZRFA 3HIFA 3GUDA 3P9KA 1A04A 3K2ZA 4CZZA 2FBKA 1BC7C 2COMA 3CO6C 2IA0A 3I71A 4P55A 1G4DA 4UVBA 1SD7A 3MZHA 3IKVA 1WWXA 2D45A 4LK0F 1OYWA 4HZFA 2IVMA 2PEXA 5BPDA 2VOOA 3BPXA 1C0WA 2DK8A 3VEPA 3VFZA 4Q4ZF 3DEUA 2PQ8A 1FBSA 4D0PA 4YIIA 4HDVA 4OIRF 2VODA 4CGZA 3BOQA 3GEZA 1UFMA 2ZXJA 4AIJA 4BNCA 4ZYHA 3D5LA 5A2QK 1IUYA 2EA4A 2H94A 4CHUA 2QLZA 3NRVA 4GCVA 3RYPA 1V4RA 2VC1A 4ZZLA 2M30A 3TKYA 5L3FA 3E5UA 5DUKA 5ICCA 1E17A 3HYIA 1LVAA 3ABTA 1XSXA 3TGNA 1ZLJA 3GZ5A 5CYVA 4TV7A 5FO5A 1UHWA 3FX3A 3WG9A 1VTNC 2K4JA 3RYRA 3BWGA 1ODDA 4F7ZA 3DQVC 2W24A 5HOOA 1R22A 2UXNA 3G73A 2FOKA 2K7LA 4ESFA 1YS7A 4L5IA 4KIBA 1FX7A 2KIFA 1MD0A 2F5FA 1FLIA 4MNUA 2P5VA 1SFUA 3WGIA 3BPVA 3L2CA 4EV0A 4EM1A 1DP7P 1J9IA 3DPLC 2IA1A 1CF7A 2LF7A 2CW0F 4IJAA 3E6CC 3BJOA 3W6JB 4G6QA 3HOTA 2M87A 1ONVA 3L9FA 1J75A 4N0BA 2H09A 3GZ6A 1P4AA 4BHCA 2Q0OA 4HLXA 3E97A 4RGXA 3AAFA 4UV9A 2FBHA 2FNPA 2PN6A 3R4KA 3H3ZA 3TDZC 3WU0A 3VB2A 2GA1A 1S7AA 2DFIA 5ICFA 1ZG1A 5AIQA 5FGMA 5FFZA 3JSOA 4R1HA 2Q8KA 4EQQA 4AWXB 3BZ6A 2PG4A 2MH2A 2ZFWA 3F8FA 2Z9OA 2Y0MA 2W57A 1HSJA 5L3DA 2YSRA 3LAPA 1KU7A 2XUBA 3KZYA 3CO7C 3HTSB 3QP5A 1P2FA 4A0XA 4PGHA 1RIOH 1WRJA 5D6EA 2Z99A 5CJ9A 4KIFA 2AS5F 1BI3A 1L3LA 4L9VA 3M7GA 2H27A 3R6SA 5LRRA 2FF4A 2YPRA 2HTJA 4DNCA 4ESBA 3QAHA 4UV8A 2VT3A 2DBBA 4HX4A 2OAZA 5E1WA 5E17F 1I1GA 1ZLKA 1B9MA 5HS7A 3BJAA 2XHKA 4QWQA 2A3SA 3K1PA 2DTRA 2CGPA 2TDXA 1YW8A 3V7RA 5CLSA 2XGXA 4RGSA 1BIBA 4L5JA 4P9UA 3WTWC 3FF5A 2RVCA 1XGNA 3TO9A 3DF8A 1AWCA 3ZN1A 4E70A 3BDDA 3V7SA 1OYYA 3HUGA 1TNSA 3C1DA 3WGGA 1RZ4A 1STZA 3M8EA 1MGTA 2EFPA 4MHGA 4P5OA 2FQ3A 4YFKF 1R36A 3WE2A 1USSA 2F5EA 2JPBA 5F6FA 1J5YA 2BGCA 1O3TA 3LAJA 5ILVA 3HHGA 2D1VA 4LK1F 2IJLA 1P6RA 1P4WA 3FMRA 1UCRA 2WTEA 2NNYA 5E20A 2DI3A 2STWA 1W5SA 1O3SA 2LSOA 3M1EA 4BHBA 1TQMA 3I53A 5D6FA 3F6OA 2F5CA 1H9TA 2F2EA 2W25A 3HSEA 2PJPA 4KA4A 3I0TA 4WX9A 3K1MA 3LA3A 2OA4A 4ZYEA 3R60A 2ISYA 5IT9K 5LGTA 3GO5A 4A0YA 2Y75A 2G9WA 3BROA 1SD4A 2RDPA 1ZAOA 1EH6A 2DAOA 5HDNA 3NEUA 1LJ9A 2UZKA 1OYIA 4A5MA 4RGUA 3WU1B 2L4MA 1B59A 2OZ6A 2WC2A 1T38A 3EDPA 3KLNA 4HBLA 3J81K 3V8JA 1YLFA 5J6XA 3HRTA 4EMSA 3SZTA 2FE3A 2VBYA 4WXHA 2Y48A 3CJNA 3KCCA 2E1NA 3BJ6A 4LD5A 5L3GA 1MDMA 2Z33A 1BI2A 3H3UA 3CUQA 3L09A 2K4BA 4UUVA 2BBYA 1QBJA 1RUOA 3ECOA 3DV8A 1W7PD 2XKOA 1GXPA 4KT5C 2XAHA 4FX0A 3MFKA 3U1DA 3HSFA 3ZN0A 3EYIA 3WE3A 2BEOA 1LB2A 4G94A 4BAYA 5K5RA 3MEXA 4NQWA 1YO5C 1EV7A 3OV8A 2HR3A 4A6DA 3CUQC 1QPMA 5DDGA 2OQRA 4ASNA 5DUIA 2HTSA 5ICEA 5DCFA 1QO0D 1ZG3A 4MTEA 2WV0A 2YX7A 3N4MA 4BQAA 4KFCA 5AIPA 1K7AA 3S2WA 1TQIA 3FHZA 3B73A 3OOPA 1ON2A 2HYGD 3Q9VA 4KUMA 1T39A 1AOYA 2H6BA 3DFGA 2DLLA 4R8HA 4L9JA 1IN8A 2HS5A 4HF0A 2FMLA 3DXJF 3GFIA 2P6SA 4BYYA 3TDUC 4HV6A 3TO7A 3ERED 2XVCA 2A68F 1JGSA 1ZG5A 3C3WA 2PMHA 2LNBA 2HDCA 2RV8A 1U5TC 1FOKA 2VE8A 1H9GA 1D8KA 1S29A 3H92A 1IF1A 4BH9A 4M6YA 2ISZA 3RJPA 4MQVA 3WTZA 1XD7A 3LQRA 5HS8A 2F5DA 4RB3C 1CF7B 5LHHA 3GWZA 4ENMA 4M9ZA 4B8XA 2ELHA 3GW2A 3BY6A 3F3XA 2UWMA 1Z1DA 1ON1A 1T98A 5E8IA 2A69F 3W6KB 3KEOA 1HSTA 3KP7A 4AVPA 4AD9A 3BP8A 4KICA 3SXYA 4A12A 3FMQA 1I27A 5D5VB 4U0YA 1XMKA 1J2XA 2V79A 1E2XA 2K27A 3I59A 5KK1A 1G3YA 1U3EM 1TW3A 2QQBA 2AXLA 3T8RA 4H0EA 5IT9Z 3KZZA 4ENKA 1JHFA 3E6MA 2M5WA 4M6XA 1LNWA 1ZARA 3ISPA 1Z7UA 3NQOA 1TQPA 3QPTA 2QBYA 2XROA 4GO1A 3C7JA 4KYWA 3I4PA 1XB4A 3JAMK 3CLOA 3IHUA 2DPUA 5DD8A 5BOXA 3HTUA 2QBYB 1YW9A 2XRNA 3E6BA 1JXSA 1IN5A 2QENA 2HOEA 2IA2A 1HKSA 1IW7F 1BJAA 2KIUA 1X3UA 2OQGA 1TNTA 5LGUA 3RKXA 3LSTA 2FSWA 2EFWA 3ZPLA 2QVOA 5DD4A 3EYYA 1KQ0A 4K2EA 2YX4A 3MCZA 3CDHA 3I5UA 1Z05A 4IVNA 2PBIA 4BHPA 1R5GA 3RIRA 3J80Z 4NHJA 2ETHA 3O2PE 3WTXC 1ZN2A 3MWMA 4AIHA 1Q1HA 4XRFA 1TTYA 1YS6A 1W5TA 2R7FA 2ESNA 3QU6A 2Z3YA 2QZ8A 2NYXA 4I0AA 3F8BA 4XSXF 3J7AO 1U8RA 4P96A 1HKQA 1MJBA 2DPDA 3ULQB 5TJJA 1S6LA 3V8KA 2JZYA 2JPCA 1FY7A 1QNTA 2YU3A 4RB0A 4RGRA 4WCGA 4QLCU 3E5XA 2O8XA 3E6DA 5L3CA 4P9FA 2MD5A 1S3JA 3RKYA 1HKTA 2DQLA 1Z91A 2HYFA 2GA2A 4EVIA 4U7BA 2WWYA 4Y17A 1Y0UA 1SD6A 5L3EA 2QQAA 4KIGA 5K5OA 2V1UA 1I5ZA 3FWEA 2VXZA 4G9YA 3CUQB 4CDGA 1U2WA 4OIPF 1W4MA 1FP1D 1FP2A 2ZNYA 1F4KA 1IN7A 3GF2A 1XGMA 2E7WA 2XIGA 1RNLA 4KN4X 1G6NA 4ENNA 2EJRA 4EGYA 1RUNA 2L01A 4N9IA 4ON0A 2ZNZA 5DYMA 2ZCWA 4IHTA 1MJAA 2OBPA 3TQNA 2VONA 2QM3A 4LG0B 2HKXA 3KP2A 1GHCA 1FSHA 4N9HA 5JR3A 4JBAA 1PP7U 5L3BA 4I2OA 1ZYRF 3HRMA 1D8JA 2P7CB 5D4SA 4EGZA 1JHHA 2BV6A 1YQAA 3HRSA 4CYDA 2HQNA 2MA3A 2EFOA 2NS0A 2P7VB 1FPQA 1G3WA 3CUOA 2O3FA 4LMYA 2CSOA 1GXQA 1BBYA 2EV5A 2L4AA 3JTGA 1KU2A 3PQKA 3QPHA 1V3FA 4KN7X 2PI0A 1PP8F 4XSZF 3ZMDA 4XLNF 2FXAA 5IT3A 1FBUA 3LWFA 4Q48A 4MGRA 2L3DA 1Z6RA 3GVAA 3F22A 1Z9CA 4MEYF 1S7OA 2OU2A 4RS8A 4A6EA 2GXGA 2HFHA 1WKMA 2A6HF 2XKPA 3U2RA 4FT8A 4UXNA 4I09A 3WTVC 4HDUA 2MLKA 1HW1A 2IT0A 1B9NA 5H6RA 1HW2A 5E1ZB 1B4AA 2DO7A 5E18F 1REPC 1IN4A 1LEBA 2HKOA 5FD6A 5LHGA 2XAGA 3KETA 4M73A 3RTRA 1B1BA 2J5PA 4JK1X 1IRGA 5D5XB 4LLNA 2M8EA 1SFEA 3F8MA 3K9TA 4EM0B 5LRSA 3KP4A 2MH9A 4CXFA 3FZVA 1R7JA 3F8CA 3ZMTA 1FC3A 5DCMB 3ABUA 1LDJA 2QWWA 1HQCA 5LEJA 3K69A 2VOPA 2O03A 4G6DA 3KP5A 3WTUC 4CICA 2KIMA 1IXSB 3FMSA 3GFJA 2L02A 1B6AA 1QZYA 2VC0A 5CVUA 4WXDA 4G7HF 3WTSC 2DK5A 1YIOA 4EM2A 1OR7A 3KEQA 3P7NA 2PFBA 2EV0A 3ZQ7A 5DCMA 5ICGA 3C18A 2ZO4A 5BQTA 4UNOA 4AIKA 4MEXF 3GYHX 2XAQA 2H6CA 2RNJA 3G3ZA 5E1XA 5BS6A 1MKMA 3FM5A 5HDGA 2D2WA 5BMZA 2ACJA 2EB7A 5CVRA 4HLYA 4EJTA 3HSRA 1BI0A 1EH8A 2ZJ2A 4RAYA 1IRFA 5ED4A 4L0YB 3DP7A 2RC4A 2GIVA 5BPIA 3IC7A 1J0RA 2NNNA 1U5TA 4L9NA 2MBFA 2HWVA 5HLGA 4YFNF 2EFNA 1XSVA 4PZJA 5JFRA 1SMYF 1KGSA 1MZBA 1IN6A 2P5LC 4MTDA 4ZYDA 4M9SA 3EQLF 1T0FA 2FEZA 4YIFA 4OINF 2ZMEB 4EJUA 1HXDA 1RI7A 2QUFA 5EEGA 2FU4A 1H0MA 2XAFA 3T0YA 1R23A 3RKWA 1PDNC 2P5KA 5CVIA 2O61A 1KYZA 1L0OC 2CFXA 3COAC 4JQFA 1P92A 4OMZA 3REOA 5ERIA 2A07F 2C6YA 3RPUA 4GYIA 3SHFA 2W84A 4Q5SF 1SD5A 2V1XA 1FT9A 1USTA 2VBZA 4WXCA 3B02A 5A2QZ 3GLXA 1K79A 2EK5A 4M71A 2EA2A 1PUEE 3F23A 1P4XA 3I64A 1KQ8A 3FXQA 5D8LB 2FBIA 4O6JA 3ZP5A 3Q9SA 5D4RA 5ILSA 4ZYGA 3F6VA 1R00A 4U88A 5J8CA 1U5TB 4M9XA 5FLXZ 2QQ9A 1G3TA 4HF2A 5HLIA 3T5XA 2G7HA 3SQNA 5FD5A 2JTVA 4Y13A 4Z2YA 1KYWA 4YG2F 1QZZA 4S04A 2GWRA 1XSDA 1FYKA 2HQRA 3QOPA 4KDPA 2Q2EA 2BE5F 4LGWA 4HX7A 3ZMSA 4CO8A 2FNAA 2IP2A 2JT1A 3TOAA 1LDDA 2ZBKA 3FXUA 2R3SA 3ZMUA 4Q47A 4UVCA 1U78A 5D8KB 4ZZDA 3I54A 1OPCA 1BIAA 3IL2A 1JE8A 4KNYA 4I01A 1SMTA 3V8LA 4G8XA 1J59A 1ZREA 4PGGA 2GXBA 4UHTA 3E3VA 1BI1A 1FNNA 2KJBA 1XGSA 5HDKA 1KQ9A 4BXUA 3F72A 3F8NA 1KU3A 1DPUA 2Z5UA 1F9NA 1BM9A 4RB2C 2FRHA 4OIQF 2GAUA 1OMIA 2ZKZA 1CGPA 3ROUA 2NRAC 4I02A 4LJZF 4FX4A 3HRUA 1WQ2A 3RPQA 1ULYA 2XAJA 1O7FA 4B09A 2K86A 3J80K 5FFXA 1DDNA 1I6XA 1R1TA 1YW7A 3K0LA 2K02A 1XCBA 2ZMEA 4U0VA 4ZH4F 1DPRA
chains in the Genus database with same CATH superfamily
3KYCB 3PSIA 3LA7A 4DQ2A 5HVQC 1W7PA 2IRFG 4M72A 1I50J 4LLLA 3RI4A 3LA2A 2EZLA 2MG4A 3GFLA 3SFZA 4A0ZA 1VQOI 1LEAA 2VT2A 2YU9J 2G7UA 2L54A 2UUZA 2DFHA 3HHHA 4XLFA 3DU5A 2E7XA 1V54H 1NG6A 2A6EF 1D5YA 3S2DJ 2R7RA 3HEFA 4WK8F 2HOAA 3KP6A 3OYKA 5IYCJ 1U9NA 1D5VA 4L9TA 3IRRA 2NVXJ 3EETA 2HGCA 1SAUA 1GV5A 2EWNA 4IF4A 5FB2A 1WH7A 2M0MA 1JGGA 2RGVA 1W7PB 1V5EA 2X4HA 2GIZA 4CCLA 2EV6A 2DDBA 2K9QA 3LFKA 4ETSA 3KFWX 4ENJA 2IGOA 4G7ZF 4C9YA 2KKOA 1U8BA 2HZDA 5E8GA 1UG0A 1OCZH 3EUAA 3FKJA 3O3KA 2EFQA 1Z21A 2CU7A 3LSKA 3OR1C 3ML6A 1WVRA 4AYBN 2RKHA 3MQ0A 6PAXA 2MGQA 3WTYC 4IXAA 2P8TA 3I59B 4HQMA 3ASOH 3A1YA 2NVUB 3CC4I 4XLEA 1VF9A 5KCMA 1T6SA 2DODA 1TLHB 2DT5A 1MDMB 4CCMA 2W85A 1IDZA 2V9VA 4A3JJ 2VLAA 3L00A 4DYCA 3GTOJ 4C2MJ 4NB5A 1WSUA 2H8WA 4AIDA 1XMAA 3ECHA 2CWEA 4KMUX 3CC7I 1ZTRA 1XGOA 1I1SA 2QKMB 4ZYAA 3VODA 2GQQA 1D3YA 1MH4A 1UJ8A 2MLGA 2HPIA 2WBMA 4LG0A 2V1DA 1O3QA 1UB9A 3E1SA 1D0XA 2BYVE 3FISA 1X3ZB 3KLOA 3G6EI 2CV0A 2VPLA 2R7TA 3JAMZ 2VBXA 3T8TA 2KJCA 5EEHA 4Y7NJ 3DEEA 3ELKA 3BLYA 3S14J 3MZ8A 1QQIA 1YYVA 4HX8A 3WHCA 4A5NA 1BOBA 2KZGA 1FOXA 4PDKA 1RR8C 1Z3YA 1R58A 3HOXJ 3RPUD 3VOEA 5FKKA 3QU3A 1YJNI 1F5TA 2P4WA 2FJ1A 2VN2A 4FASD 4Y15A 2M3AA 3CLQA 2OTLI 1T95A 2I8DA 1ETOA 5LGNA 3FXMA 3GXOA 2JRTA 1MBJA 4HRIA 3AKZA 2PLYA 3K2AA 3DEWA 1Y1VJ 4FISA 3M9AA 3RQ4A 4BU2A 4L0ZB 1O7LA 1Z6TA 1ZHFA 3GTJJ 1J7KA 2LD5A 1WPKA 2E35A 1FIPA 1FWZA 2KRFA 1BA5A 4I99C 3R0JA 3WTTC 3CP2A 1YRNA 4RAZA 2M1BA 3MKZA 3CF5F 1ZRCA 5H20A 4UVAA 2DMNA 2LDUA 3FHNA 1OKRA 1ZQ3P 4X6AJ 2VBWA 2BY3A 2STTA 2OZUA 3C2BA 4NDLA 1Y0NA 3DU6A 2QYOA 1JKRC 5J1RA 3DPTA 3FDYA 3D0SA 2RNGA 3P9CA 4DYRA 1M1EB 4CYCB 3ESWB 4PJMA 1FTTA 3WGHA 4Y52J 3TOBA 1G3SA 4HW0A 1BR1A 1ZGJA 1K6YA 2P6TA 1GVJA 2OD5A 1SAXA 3PO3J 2CQNA 4IRGA 4HQEA 5HNFA 1HOMA 2BHYA 3P5JA 1VZ0A 2V6CA 1NHAA 5M3MJ 4GGGA 1IZ1A 3O6BB 1SVLA 5BNGA 5LBQA 4IHXA 1XDUA 4EJVA 3CCLI 1FBQA 5CPRB 3CCYA 4ZDPA 3HOWJ 1P9QC 2WY8Q 2DN0A 2E1MB 1W36C 3P9IA 1XN7A 4XIDA 4WWCA 4QSHA 3A01A 1N25A 2ESHA 2JA8J 4CGZA 3MZYA 2COBA 1E3PA 5KAIC 1G59A 2RN7A 3F9KA 3LSRA 2A5WA 4LFUA 1IXRC 2R4GA 1XX5A 2IW5A 2X9DA 3R0AA 4F52A 5C4XJ 1IGNA 5DV5A 1GUUA 1UHMA 3M1CA 4V2FA 1KU9A 4NC8A 3Q3SA 1BW6A 5AONA 3N97A 3AG3H 2AO9A 3DTKA 2ID3A 3Q0WA 1DGWY 3PFIA 1DUXC 2WAEA 2F5VA 3KPHA 1R1UA 1FZPB 2LOOA 1ZRDA 4WF2A 2L9SA 2LMDA 2FQ4A 3FM3A 3L7WA 3PQJA 4AU7A 2GOXB 1QGPA 1YTYA 2M34A 5KVRA 1EKEA 1S8NA 1K78B 3QRFF 2X0LA 3KP3A 3WODF 3FXJA 1O4XA 3HC7A 4UB6C 1MJ9A 2R0QC 3GTLJ 2DA7A 1FIAA 1O57A 5CVVA 1IXCA 3K4NA 1RESA 5E3MA 1FYLA 2X51A 5LEKA 3JREA 1YOVB 3A4CA 1TW2A 1WJFA 3T1BA 1SFXA 3LQQA 1IAWA 4U0WA 5HS9A 3LSGA 4G7OF 5CVJA 4XK4A 3ZOBA 2E2HJ 4F55A 3M07A 3F21A 2J5OA 2M45A 3R61A 1GVDA 2B0LA 1YFHA 1R9TJ 4L18B 3RDIA 3JSPA 2VJIA 4BEHA 3EUHC 4A2UA 3ONQA 4YEJA 5EG0B 5F1RA 3I3LA 2ADUA 1NK3P 4OOIA 3JW4A 4X1EA 3IWFA 2MC3A 4O5VA 4GXOA 1WI9A 3J81Z 4J01A 1PJRA 2YR2A 3M8FA 5IY5H 1YG2A 5HLHA 2F4IA 4I76A 4GYGA 4LLGF 4RLFA 4I0BA 2DMUA 3TO6A 2X6YA 3S16J 4IRIA 2WAQN 3H9QA 4O3MA 3I58A 5LLQA 4HOBA 4QPOA 2ZFUA 5LFAA 1G8XA 3SDGA 4KMFA 2DW4A 2LKXA 2DDAA 2HZTA 1HW5A 3MMYB 1LQ1A 4ESJA 4FHTA 2O6GE 4DJAA 3PNTA 2E60A 1ACIA 2X6OA 2KRHA 2L0KA 4HA8A 3QYEA 3IH3A 1ETWA 3V4GA 2NAZA 4XLPF 3D5SC 2JSCA 3SZPA 1BOAA 2AXTC 2BVMA 4XBFA 5GAEJ 2EPFA 2PMUA 3EUHA 3BR5A 4U87A 3V7CA 5LHIA 1JKQC 4RB1A 1VQ4I 4PJJA 1LDKB 3ZMZA 5KAFC 2XSDC 3VSLA 3KE2A 2E1CA 3JTHA 4S05A 1EH7A 3S1NJ 2CS3A 4L5EA 4A3FJ 1XDSA 2ZJRF 3S17J 2GOMA 2KPMA 4PCQA 2D1HA 2DYRH 3RZDJ 1JTXA 5FLXK 5F64A 3QQAA 4IPAA 3TMOA 5H6QA 2DTZA 2FMYA 5GPCA 4HF1A 4IHWA 2LF8A 1K78A 3HG9A 1KA8A 1MBKA 2NXNB 1WI3A 4BE2A 1ZK8A 1HLVA 4J00A 5D5UB 1VFCA 2IPQX 3OYHA 2IS6A 1TT5B 4D9JA 2GZWA 1FYMA 2DOFA 2XPUA 3GX4X 2CG4A 3CTAA 4EJWA 2CYYA 5DEQA 1XCVA 4FCYA 1BC8C 3HUGB 1JTYA 1R5HA 3QYBA 2DU9A 2LR8A 2BXZA 1AKHB 4C2TA 3W2VA 3OL3A 3CDLA 3VYUB 2W4SA 2OJED 3BT9A 1HBXG 2EZIA 2LLKA 2V1NA 4DBRA 3HOSA 2BY2A 2RQPA 2BVLA 2DA3A 2Y9YA 1Z3XA 1BN5A 2FA5A 4EJOA 2LKPA 5J8FA 5JHUA 4MQ9F 4A69C 3M4OJ 2IGKA 1H89C 2R7DA 5JI6A 4HAMA 3QP6A 2VUMJ 2O0YA 4U0VA 5TRDA 5IPAA 3E5QA 2A61A 2ECCA 2VJ4A 4XLAA 3IRQA 2W7NA 3FXRA 4IRHA 4XMYA 2R5ZA 1T2KA 2R5YA 3IWZA 4UUTA 1UMQA 3CMMA 1O3RA 1F1ZA 2CO5A 2VE9A 3FKIJ 1H8AC 4IL6C 3HOVJ 2W00A 3GFMA 4LB6B 1U6GA 1G2HA 1TBXA 3MAJA 2V7FA 2HEOA 3ZMVA 3K4JA 3WHBA 4XICA 1K4TA 4HNTA 3FK7A 2XASA 4YFXF 1ZGAA 3DKWA 2VI6A 1ZH5A 2A5YB 5K1YA 1R1VA 1WFXA 1BW5A 3U1KA 4LB5A 4OIOF 4M74A 3ZQGA 1LFBA 3Q5FA 2O9LA 5ILUA 1K6OA 2H1KA 3BCAA 2IAIA 3Q0VA 4F91B 5D5WB 5GTHC 3IKTA 4HYEA 2DQRA 4IHSA 1JKOC 4MLOA 3K4KA 1BR4A 1WJAA 4I7HA 2CQKA 1W0UA 1A6IA 3BG7A 1EJ9A 5JVTA 5K5QA 2HU9A 1AHDP 2EINH 1FSEA 4OMYA 3K1NA 4HV5A 3SEZA 1F36A 1SFOJ 2CUJA 3M3YJ 4Y4RA 3U9GA 4R79A 2LRDA 4I98B 4OU0A 1QVUA 2UXXA 4U7DA 2XV4S 2X48A 1OCRH 5TGTA 1ZRFA 3HIFA 4C3HJ 2ELKA 5EG0A 4IOAF 1AKHA 3GUDA 3P9KA 2ZSHB 1A04A 1XG1A 1YX5A 3K2ZA 4ZDLA 3CCEI 4CZZA 3S93A 2FBKA 2BOLA 2JMWA 3CCSI 1BC7C 4Z6YA 2OPTA 2COMA 3CO6C 1QRYA 2IA0A 1IO2A 3I71A 2NS7A 2JVGA 1UG2A 3IP4B 4P55A 4UVBA 1G4DA 1SD7A 5M3FJ 3IKVA 3MZHA 4E7HA 1WJEA 2FOWA 3SYTA 1WWXA 2TCTA 2D45A 4LK0F 1OYWA 4N4NB 4HZFA 2IVMA 2PEXA 2X1CA 1CQTA 5BPDA 2VOOA 3BPXA 4II2A 1C0WA 2DK8A 4E7SA 3VEPA 2M7BA 3VFZA 4ANJA 4BBSJ 3OS2A 2JVHA 4Q4ZF 3DEUA 1XTAA 2PQ8A 1Y56A 3JR9A 2BW3A 2OV7A 2XF7A 1FBSA 2XDVA 1OFCX 4PJLA 1MSFC 4D0PA 1RRJA 2M4GA 4YIIA 4HDVA 4OIRF 2VODA 1W0TA 2KFDA 3BOQA 3H0DA 3OSFA 3GEZA 2PJRB 1UFMA 2ZXJA 4AIJA 3AFHA 1OLTA 3L2UA 5IOZA 3RZOJ 3A2KA 1HDPA 4IZZA 4BNCA 3PSFA 4ZYHA 3EUKL 3D5LA 5A2QK 1IUYA 2EA4A 2IGNA 1QZEA 1W1WE 2CMPA 2H94A 2XGEA 5TISC 1TZLA 4CHUA 2Z1DA 2QLZA 3NRVA 4GCVA 3RYPA 3HB9A 3KYDB 3PNYA 2QEXI 3A0BC 3BG3A 1V4RA 5EZHA 2VC1A 2IS1A 4ZZLA 2M30A 2QKLB 2OC6A 3TKYA 1TWCJ 5L3FA 2R7ZJ 1OCTC 3E5UA 1QU3A 5DUKA 5ICCA 3HOUJ 2CW7A 1E17A 3HYIA 2JUGA 1LVAA 3ABTA 1XSXA 1MMAA 3TGNA 1ZLJA 3GZ5A 5CYVA 1ITYA 4TV7A 3BG6A 5FO5A 1UHWA 1RPWA 3FX3A 2HQ5A 3WG9A 3RKQA 4CCKA 3TEDA 1VTNC 2K4JA 2Z16A 3RYRA 3BWGA 1ODDA 4E7IA 4F7ZA 2RREA 4XN0A 5B1BH 1A6QA 3DQVC 2W24A 3L1PA 5HOOA 1R22A 2UXNA 3G73A 2FOKA 3DPUA 5B3SH 3JRHA 2K7LA 4ESFA 1YS7A 4L5IA 1HDDC 4KIBA 5J47A 1NG7A 1ZR4A 1FX7A 1FOYA 2KIFA 2OCCH 1MD0A 2F5FA 3OYBA 1FLIA 4E7LA 1UELB 4MNUA 2P5VA 3GMEA 4QPQA 1SFUA 5FLVA 3WGIA 2WB1N 5CKTA 3BPVA 3L2CA 4EV0A 4EM1A 1P7IA 4CCNA 1DP7P 1J9IA 1RETA 4B3AA 3F0CA 3DPLC 5EYRA 2IA1A 1CF7A 2LF7A 2CW0F 4IJAA 3E6CC 1UAAA 3BJOA 3HKZN 3W6JB 3OYCA 3ABMH 2X1EA 4G6QA 1JJ6C 2UV1A 3HOTA 2ELJA 3PUBA 1X2NA 5K7FA 2M87A 4IQ4A 4JYKA 2YS9A 3JRAA 3SDBA 5IP7J 1JUPA 1ONVA 2V9PA 3L9FA 1ETVA 1XPXA 1QA6A 1J75A 4N0BA 5JHFA 2H09A 3GZ6A 1P4AA 4BHCA 4FQGA 1J09A 3LSHA 4FE7A 3A01B 3GTQJ 2Q0OA 2Y2ZA 4HLXA 2EBIA 2YUSA 3E97A 4RDUA 3VDXA 2PJRA 4RGXA 4BL0B 2HXOA 2E36A 3AAFA 2IEKA 2JSPA 4UV9A 4BKXA 2FBHA 2EZHA 2FNPA 4BY7J 2DT6A 2V6EA 3TW6A 2PN6A 3R4KA 1V55H 1X1BA 3H3ZA 1YJ9I 4A3DJ 3TDZC 2KRCA 3LL7A 2LBFA 3WU0A 5FRMA 3VB2A 2GA1A 2WADA 3FIWA 1S7AA 3ZXSA 2DFIA 5ICFA 2XC7A 1ZG1A 3FK6A 1MNDA 4XKCA 4C3JJ 5AIQA 5FGMA 1Y8RB 2O5RA 5FFZA 3DLLF 5GTIC 3QWLA 1LFUP 3S1MJ 2QQ8A 3JSOA 4R1HA 1HA8A 2Q8KA 5B1AH 2E5NA 4EQQA 4ZTJA 3GTMJ 2X6WA 4AWXB 4IO9F 2E2IJ 3D1NI 2E19A 1MNEA 3BZ6A 3CMAI 2VL8A 1YIJI 2PG4A 2MH2A 2ZFWA 3F8FA 4B47A 1TC3C 2Z9OA 2Y0MA 4E7JA 3S2HJ 2W57A 2CQQA 1HSJA 4YELA 5L3DA 4ZC3A 2YSRA 3LAPA 1KU7A 2XUBA 1B72A 3KZYA 3QPSA 3CD6I 4PK4A 3CO7C 1GV2A 4KITB 3MD2A 3HTSB 1I3AA 1SC7A 4LG3A 2CFOA 1OCCH 2LYCA 2DCEA 5EJCA 1RKTA 3QP5A 1P2FA 4A0XA 2H1LA 4KISA 2JN6A 1X3WB 1IRXA 4PGHA 2XPWA 1RIOH 1WRJA 4EATA 4C2UA 3GTPJ 5D6EA 2Z99A 5CJ9A 4KIFA 5GPAA 2AS5F 1BI3A 1L3LA 3OS1A 3LSIA 4L9VA 3M7GA 3K4CA 5IYBJ 2H27A 2ZSIB 3R6SA 5LRRA 1K61A 2GBYA 2K40A 2LH9A 2KDOA 2FF4A 1D1CA 1PYVA 2FUG2 2YPRA 4EEFG 2HTJA 1SANA 4DNCA 4ESBA 3OIOA 3QAHA 4UV8A 2VT3A 2DBBA 2KIQA 2OAZA 3BR0A 3BZKA 4HX4A 3TL4X 5E1WA 5E17F 1I1GA 2CUZA 3OYLA 1ZLKA 1B9MA 5HS7A 4BQQA 3LSJA 3BJAA 4E7KA 2M7AA 2XHKA 2A3SA 4QWQA 3K1PA 2DTRA 4CUGA 5C44J 2CGPA 1ZR2A 1ETKA 3L2WA 2TDXA 1YW8A 1LVKA 3V7RA 4BJ5C 5CLSA 4I6ZA 3CC2I 3BQYA 2XGXA 1OJLA 3LSPA 1A5JA 3LNQA 4RGSA 2N8GA 4KT6A 4MFEA 4B3XA 1BIBA 4L5JA 2XAUA 2K5CA 4M3BA 1IJWC 2VKEA 3W6VA 3MVPA 2DJNA 3HM5A 4P9UA 3WTWC 3FF5A 2I5UA 5EGOB 2RVCA 1XGNA 2XF5A 3TO9A 2R93J 3DF8A 1AWCA 3ZN1A 1FMVA 2GXAA 4YRVA 3VSKA 3O8HA 4E70A 2DA6A 3BDDA 3V7SA 1OYYA 1ZELA 3HUGA 2B63J 3AG1H 3C1DA 1TNSA 3WGGA 5IYDJ 1RZ4A 1STZA 3M8EA 4JP0A 2ID6A 3ABKH 2VQGA 1K83J 4HSTA 4XLCA 1MGTA 4HNUA 2EFPA 2HPMA 3OYNA 2JRMA 1GT0C 4MHGA 4P5OA 2FQ3A 1POGA 3ABLH 1JI8A 4YFKF 1R36A 3WE2A 1USSA 2F5EA 2JPBA 2R7WA 5F6FA 4B48A 1J5YA 4DYQA 2MABA 2BGCA 1O3TA 3LAJA 4Y33A 5ILVA 2KMUA 3HHGA 2D1VA 4LK1F 2IJLA 3VYTB 3DCFA 1P6RA 1P4WA 5GAHJ 3WG7H 2DMTA 2VQLA 3FMRA 1UCRA 5FKOA 2WTEA 1I3QJ 2NNYA 2QCOA 3BR3A 5E3NA 4BDYA 5E20A 2W82A 4CCJA 4KJZA 2DI3A 3K4LA 2STWA 1WZ2A 4JX5A 3FXLA 1W5SA 1O3SA 2LSOA 3M1EA 4RMNA 4BHBA 1TWHJ 4XM3A 4GFBA 1TQMA 2DA1A 3I53A 5D6FA 3JRBA 3F6OA 2F5CA 4A3MJ 2F2EA 1H9TA 2W25A 3HSEA 2CUEA 4PJNA 2PJPA 4KA4A 4J19A 3I0TA 4WX9A 2A6TA 4II3A 3K1MA 3LA3A 2OA4A 2AQFA 2CRGA 3R60A 2ISYA 4ZYEA 5LGTA 5IT9K 3GO5A 1R4MB 2KQRA 4A0YA 2Y75A 1APLC 3BG9A 2G9WA 3BROA 4FE4A 3AG4H 1SD4A 2DA2A 2RDPA 5F0HA 4BQNA 5JLWA 1ZAOA 2MW8A 1EH6A 2O7OA 2DAOA 2K9LA 5HDNA 3NEUA 4M3FA 2WV1A 2BY1A 1LJ9A 5FKLA 2EZKA 3W2WA 2UZKA 1OYIA 4PFOA 4A5MA 4MFDA 2JA5J 3K4BA 4RGUA 3WU1B 2L4MA 3S3NA 1B59A 2OZ6A 2WC2A 4OAZA 3Q0UA 1T38A 4A93J 3EDPA 1S5LC 2PX9A 3KLNA 4HBLA 3J81K 3V8JA 1YLFA 5J6XA 3HRTA 4EMSA 3SZTA 5DM7F 1A31A 2FE3A 4A3KJ 2VBYA 3H1CA 4DGWB 2VXDA 3BR6A 3CMEI 4WXHA 1X1AA 3G1MA 2WY7Q 2Y48A 3FXOA 1A36A 3CJNA 3KCCA 2MYSA 2E1NA 3BJ6A 4LD5A 5L3GA 1MDMA 2Z33A 5FROA 1BI2A 1W5CC 2ZMEC 3CUQA 3H3UA 1FEXA 4LIUA 1BR2A 3L09A 4UUSA 2ZJPF 4Y3OA 3AL0B 2K4BA 1D1AA 4UUVA 2BBYA 2DT7B 4A3LJ 4D5FA 2MFZA 1QBJA 1RUOA 3ECOA 3QOEA 4JX6A 1S72I 3DV8A 1W7PD 1T08B 2XKOA 3ZQIA 2KDZA 1GXPA 4KT5C 2XAHA 3IAS2 4FX0A 3MFKA 3U1DA 3DTEA 3H9JA 3HSFA 3ZN0A 3SFIA 2HOTA 3EYIA 3WE3A 5IP9J 2JA7J 3CJRB 4NBQA 3S8PA 1VQNI 2BEOA 1LB2A 4G94A 4BAYA 3OYDA 2M0CA 5K5RA 1YITI 3MEXA 1MMGA 2XB0X 4NQWA 1YO5C 4GDFA 3OYIA 4XORA 2L9RA 1EV7A 4DOZA 3OV8A 2HR3A 2VB6A 4A6DA 2VASA 2VKVA 4CH7A 3CUQC 1X4PA 5HLTA 2NVQJ 1QPMA 5DDGA 1FJLA 5CQGA 2OQRA 4ASNA 5DUIA 2HTSA 5ICEA 2LY9A 5EDNA 4LITA 1WH5A 5DCFA 1IV6A 3VYSB 1QO0D 1ZG3A 1XMXA 4MTEA 2WV0A 5E3LA 2YX7A 2EIMH 1LE8B 2Y69H 1LUJB 3E0JB 3N4MA 5B66C 4M3DA 4BQAA 2HXIA 2HI3A 4KFCA 1Y1WJ 3X2QH 5AIPA 1K7AA 2DOAA 1JKPC 1VI0A 3NWSA 3S2WA 1TQIA 3CF2A 3FHZA 3B73A 3OOPA 1ON2A 2HYGD 3Q9VA 4KUMA 4RM3A 1T39A 1AOYA 2XPVA 3I9V2 3ZGKA 2H6BA 3DFGA 5IP6A 2DLLA 2R7XA 3QYFA 4R8HA 4L9JA 5F0CA 1IN8A 2HS5A 1MIJA 4HF0A 1MSEC 2FMLA 1I39A 3ZR8X 1WJCA 3CP8A 3DXJF 3GFIA 3ZQLA 2P6SA 4BYYA 3GLLA 5FKNA 3TDUC 4CA0A 4HV6A 3TO7A 3ERED 2OUMA 2XVCA 2A68F 1JGSA 1ZG5A 3C3WA 3H9GA 2PMHA 3K70D 1QPIA 2LNBA 2V26A 2K9SA 1X1CA 2HDCA 2RV8A 4BACA 1U5TC 4G12A 5FRNA 5E3OA 2NOJB 1FOKA 3BTIA 2VE8A 1H9GA 1D8KA 1S29A 3H92A 1IF1A 4BH9A 3HPHA 4XONA 4PUSA 5K7HA 4A3EJ 4M6YA 1VQLI 2ISZA 3L2QA 4XRSA 3RJPA 3H3VK 4MQVA 3WTZA 2DXIA 4A3CJ 1DP3A 1XD7A 3OL4A 4QIWN 4XR6A 3LQRA 5HS8A 3HKZA 2F5DA 4D7NA 3PO2J 4RB3C 1CF7B 2HVSA 5LHHA 3GWZA 3IH4A 1X58A 4BUPA 4ENMA 4M9ZA 1E0EA 2E34A 1OISA 4B8XA 3CCQI 2ELHA 3HBLA 1PUFA 1E3HA 3GW2A 3BY6A 3F3XA 2HNHA 2UWMA 1Z1DA 1U0JA 1ON1A 1T98A 5E8IA 1DU0A 2FX0A 2A69F 3W6KB 3KEOA 2ZB9A 1HSTA 3KP7A 4AVPA 3OSGA 1IG7A 5HODA 5FLMJ 4AD9A 3BP8A 4KICA 3SXYA 4NC7A 3H5AA 4A12A 3FMQA 2DYSH 1I27A 1T56A 5D5VB 4U0YA 3OYMA 1XMKA 1J2XA 2EIJH 2V79A 1E2XA 4ZDOA 2K27A 2O8KA 3I59A 5KK1A 3L2VA 1G3YA 4AYBA 3PIPF 1U3EM 1TW3A 4W1UA 1X2MA 1MW7A 2Y9ZA 4BS9A 3CCVI 3C2HA 2QQBA 2AXLA 2OF7A 3JCUC 3T8RA 4H0EA 5IT9Z 3KZZA 5F08A 4ENKA 2R7OA 1JHFA 2F4MB 3E6MA 4BE1A 4PJ0C 2QSHX 2M5WA 1VQ9I 5GP9A 3PIOF 4M6XA 1LNWA 5J4VA 1ZARA 3ISPA 1Z7UA 3NQOA 3CCRI 1TQPA 3QPTA 2QBYA 2XROA 4GO1A 4B43A 2IS2A 2LKSA 3C7JA 1IUFA 1ORKA 3VPRA 4KYWA 2EIKH 3I4PA 1XB4A 5EF6A 3JAMK 3CLOA 3RCOA 4BXFA 3IHUA 2ZJQF 2DPUA 2LK2A 5DD8A 2B7EA 5BOXA 2F6CA 4AUXA 1B8IB 5EGOA 3HTUA 3ERMA 2GM4A 2QBYB 2K3PA 1YW9A 4IHYA 4LIVA 2WAFA 4BBRJ 2XRNA 4M6VA 1K4SA 1Y8QB 1W36D 3E6BA 4D1QA 4JOMA 2H8RA 1JXSA 1XS9A 4XN3A 1IN5A 3GTKJ 3H5NA 2TRTA 2QENA 2HOEA 2HVQA 2IA2A 1HKSA 1IW7F 1BJAA 1RC9A 2KIUA 2VQHA 1X3UA 2JJ7A 2MSYA 2PMZN 2F48A 5E79C 4CCOA 2OQGA 3HL2A 4G6TB 1SEUA 1NK2P 1TNTA 3MN2A 5LGUA 3RKXA 3LSTA 4PSWA 4E7ZA 3ZQQA 2HDWA 2BW3B 2XB5A 2FSWA 4F93B 3PUFA 1Z7LA 1T0FC 2EFWA 2DMQA 3ZPLA 4DW6A 2JA2A 5HNHA 2QVOA 5DD4A 4ZTFA 3EYYA 2VKHA 1KQ0A 2QGUA 3OWTA 2YX4A 3MCZA 4K2EA 2MD0A 3DBLB 1LFPA 3CDHA 3I5UA 1Z05A 4IVNA 2PBIA 4BHPA 1R5GA 3RIRA 5J1YA 2ZXIA 3J80Z 4NHJA 3A03A 1MBEA 3PNVA 2ETHA 3O2PE 5DTDA 3WTXC 3JRIA 2E2JJ 2WAQA 2B9SA 1ZN2A 3MWMA 2ME0A 5EEAA 4AIHA 2W48A 4RBOA 1Q1HA 4W97A 4XRFA 1TTYA 1YS6A 1Z0XA 2DA4A 4B4CA 1W5TA 2R7FA 2ESNA 2JUCA 2XRLA 2Z3YA 2KT0A 2K85A 3QU6A 1BL0A 2R7VA 2QZ8A 2NYXA 4I0AA 1H88C 3CESA 1HC8A 2JA6J 2HQAA 2ZXHA 3F8BA 3FBIB 4XSXF 3ZQCA 2VJ5A 3J7AO 1NTCA 1U8RA 4P96A 4UB8C 4ABZA 2D5VA 5F0FA 1HKQA 1MJBA 4MO7A 2DPDA 3C2GA 4A3IJ 3JRCA 3ULQB 1QVTA 5TJJA 1S6LA 3OIQA 3L2RA 3V8KA 1ERDA 3FBNB 1U9OA 4ITVA 1R4NB 4HSRA 2R7SA 1TWGJ 2JZYA 2JPCA 5JVGF 3CZ6A 1FY7A 2K9MA 3TW7A 1QNTA 3G4SI 2YU3A 1DQUA 4RB0A 2LY1A 4RGRA 4WCGA 4QLCU 2DOEA 3E5XA 2O8XA 3E6DA 5L3CA 1DU6A 2E1MC 4M3GA 4P9FA 2MD5A 1S3JA 3RKYA 4XNFA 4UY8I 1HKTA 2DQLA 1Z91A 1S9HA 2HYFA 3I56I 4S0HB 2GA2A 3BTLA 4EVIA 4U7BA 2WWYA 4Y17A 1SFKA 1Y0UA 3VYRB 3A02A 1SD6A 2M2EA 5L3EA 2QQAA 4KIGA 4IHVA 5K5OA 1JUMA 4DZJA 1FMWA 1I5ZA 2V1UA 3B6AA 2VXZA 3FWEA 4G9YA 5GADJ 4UUSB 1TL8A 2IS4A 3CUQB 4CDGA 1U2WA 4OIPF 1MH3A 1W4MA 4E4HA 4XRSG 2R5YB 1FP1D 2QF7A 4XOPA 1FP2A 2ZNYA 3M8JA 9ANTA 2EH3A 1R71A 3LMMA 1F4KA 2XGCA 1IN7A 2QSFX 3GF2A 2ZXWH 1XGMA 2E7WA 4NUBA 2XIGA 4XLHA 1RNLA 3HGYA 4KN4X 4OWRB 1G6NA 4A3GJ 5DM6F 4ENNA 2EJRA 4EGYA 1RUNA 4FTHA 3SJMA 2L01A 3VWBA 4N9IA 4ON0A 2ZNZA 5DYMA 3BC8A 2R7UA 2ZCWA 3BTJA 3K4MA 4IHTA 2G0EA 1MJAA 2OBPA 3TQNA 1N78A 2VONA 2KZVA 3CCJI 3S1QJ 2CW8A 3ZCOA 2QM3A 4LG0B 2HKXA 4F3QA 3KP2A 1GHCA 3AL0C 5H2FC 2L9VA 1FSHA 4N9HA 5JR3A 4JBAA 1PP7U 2HYJA 5L3BA 2LFBA 1ZGWA 4I2OA 1ZYRF 3HRMA 1D8JA 3D5RC 2P7CB 5D4SA 3KZIC 3GTGJ 4EGZA 3PJRA 1VQ8I 2KL4A 2BY0A 1JHHA 2BV6A 2W1OA 1XC5A 2CQ7A 1E3OC 4RAGA 1MBFA 1VQMI 1YQAA 1LKXA 3HRSA 4CYDA 2LVSA 2HQNA 2MA3A 1JT0A 1WJDA 2EFOA 3DBHB 3J7ZI 1EF4A 1R6RA 2NS0A 2P7VB 1FPQA 1G3WA 3CUOA 2O3FA 4LMYA 5CQEA 2CSOA 1GXQA 5J40A 1BBYA 3RSNA 2EV5A 4CZCA 2L4AA 3JTGA 1KU2A 3PQKA 2EILH 2CUFA 3QPHA 1V3FA 4KN7X 3NAUA 2JQ7A 2PI0A 5J1UA 1PP8F 1VQ5I 4XSZF 3OYGA 3ZMDA 1FOWA 2IBDA 4XLNF 2FXAA 5IT3A 4RM2A 4D7MA 1FBUA 3LWFA 4Q48A 3DBRB 4MGRA 2L3DA 1Z6RA 4HG2A 1T8IA 3GVAA 1BJZA 3F22A 2LREA 3MKLA 1Z9CA 4BXXJ 4MEYF 4D5CA 1S7OA 2OU2A 4RS8A 2LG4A 3QPLA 4A6EA 2GXGA 4X0GA 2HOSA 2HFHA 3OY9A 1WKMA 4NQWB 4IKFA 1YRNB 2A6HF 2CH0A 4PFPA 4IEJA 2R92J 2XKPA 3KX2A 3U2RA 4FT8A 3SEQA 1TT0A 4UXNA 3S15J 4NC6A 1YJWI 1MMNA 3EPZA 1D1BA 2L2OA 1X4OA 4I09A 3WTVC 3I4MJ 2L7MP 4HDUA 2MLKA 4BJTA 1HW1A 1VNDA 5IOYA 5M5WJ 2IT0A 2KHMA 1B9NA 5H6RA 3DWLE 1HW2A 1N75A 5E1ZB 4CSWA 1B4AA 2DO7A 5E18F 2XSJC 1AA7A 1MNMC 1REPC 1IN4A 2ICWG 3CJTB 1LEBA 1Y6IA 3BTCA 3CJQB 1N77A 4MIMA 2HKOA 5J4YA 5FD6A 5LHGA 4AC0A 2XAGA 3BR2A 3E7LA 3IAM2 3HDDA 3KETA 4M73A 3RTRA 1B1BA 2FD5A 4OAYA 2J5PA 4JK1X 4BGDA 2VJJA 1IRGA 1ZKGA 5D5XB 4LLNA 4IOCF 2M8EA 1SFEA 5KNLA 3F8MA 3K9TA 4EM0B 5LRSA 1DGRM 3KP4A 2MH9A 2K9NA 4CXFA 3FZVA 1R7JA 2M4KA 3F8CA 2VQCA 3ZMTA 1FC3A 3CQZJ 5DCMB 3TP0A 3ABUA 1LDJA 1QHGA 2QWWA 4XL9A 1MMSA 1HQCA 3TBIA 2VPRA 3H36A 5LEJA 3K69A 3KYLA 3S3MA 2VOPA 3CCMI 1UZCA 2O03A 3KP5A 3PL8A 4G6DA 3WTUC 4CICA 2KIMA 1IXSB 2L7KA 3JRFA 3GBGA 2QSGX 3FMSA 1D0ZA 3GFJA 4V2GA 3G71I 2L02A 1B6AA 2ZC2A 1QZYA 2VC0A 3BZCA 5CVUA 1R5ID 4WXDA 4G7HF 1TP4A 3WTSC 1V5FA 2DK5A 1YIOA 3ZQFA 4QTRA 1X1DA 1X1PA 3N05A 3BCBA 4EM2A 5C4JJ 2OCEA 4B1RA 5KHDA 1Q1VA 2GLOA 1OR7A 1SVMA 2ECBA 2DFFA 3HGGA 3LSMA 4XQFA 1YHQI 3KEQA 3P7NA 2PFBA 3OMYA 2EV0A 5JLXA 2CJJA 3ZQ7A 2KP6A 1TWAJ 5DCMA 5ICGA 1MBGA 2MC4A 1AU7A 2Y31A 1IDYA 2P0WA 3ZRGA 2I10A 4P1WA 2P81A 4BY1J 3C18A 1X19A 1OR7C 3O8GA 2ZO4A 5BQTA 4UNOA 4AIKA 2RQQA 4MEXF 3GCMA 3GYHX 2XAQA 2JK3A 2E1OA 2NVTJ 2CV1A 2H6CA 2RNJA 2EQRA 3G3ZA 2LY2A 5E1XA 1MMDA 5FJ8J 4RLQA 3WU2C 3CDIA 5BS6A 3OYFA 1MKMA 1LE8A 3FM5A 1NH3A 4V19K 4E6KG 5HDGA 2NOGA 2D2WA 5BMZA 1IC8A 2ACJA 2EB7A 5CVRA 4HLYA 4EJTA 4NNJA 4CYCA 1VQ6I 2KISA 3HSRA 4AM3A 2X85A 1BI0A 2DA5A 1EH8A 5C3EJ 4YIRX 3QODA 3JRDA 1R49A 2K3FA 2DJIA 2ZJ2A 4RAYA 1OQYA 4BE0A 1IRFA 1RKWA 5ED4A 3U21A 2NS8A 3DP7A 4L0YB 2RC4A 4F92B 5LD2C 2CQXA 3J7AY 2GIVA 5BPIA 1F43A 3IC7A 1J0RA 2NNNA 2Y0SA 3RQIA 1U5TA 4XKVA 3S32A 1KZHA 4L9NA 2MBFA 2HWVA 1RR7A 3J7YJ 1OCPA 2NVYJ 3NARA 5HLGA 4YFNF 1QHHD 2EFNA 1XSVA 4PZJA 5JFRA 1SVOA 4N4OB 1SMYF 2OTJI 4PSXA 3IUOA 4BJ6C 2JWTA 1KGSA 1MZBA 2V4JC 1S7EA 3IV5A 1IN6A 2P5LC 1VQPI 4MTDA 1WJ5A 3K7AJ 4ZYDA 4M9SA 3EQLF 3MKWB 2F4OB 1T0FA 2FEZA 4YIFA 4OINF 2M9HA 1JJ8C 2ZMEB 3DLAA 4EJUA 1HXDA 1RI7A 1EA3A 2QUFA 5EEGA 2FU4A 1H0MA 4H4KC 4IX7A 2XAFA 3T0YA 4BEHB 1R23A 1YX3A 3RKWA 1PDNC 2P5KA 5CVIA 3DKYA 3LOCA 2O61A 5EZGA 3HOYJ 1KYZA 1IRZA 1L0OC 2CFXA 4JQFA 3COAC 1P92A 1FTZA 3GZNB 2CV2A 1MBHA 4OMZA 2IXSA 3REOA 5ERIA 2A07F 2C6YA 4HEA2 1D0YA 1LPQA 2KLOA 3RPUA 4GYIA 2PMZA 3SHFA 2W84A 4Q5SF 1SD5A 2V1XA 5F27A 3MKYB 1UHSA 3HXLA 4JX4A 3IH2A 1T33A 2R5ZB 1FT9A 2XGDA 3HOZJ 1USTA 2VBZA 2Y30A 4LOCA 2LBFB 4WXCA 2VKDA 2V9KA 2IGMA 3B02A 5A2QZ 2RAEA 3GLXA 1K79A 2EK5A 3DKXA 4M71A 2EA2A 1PUEE 3F23A 1P4XA 2Q1ZB 1KONA 5GAGJ 4C3IJ 3I64A 1KQ8A 3G2BA 3FXQA 2QA4I 5D8LB 2FBIA 3OS0A 3CMYA 4O6JA 3ZP5A 1PUFB 2AQEA 3Q9SA 1HF0A 3S1RJ 5D4RA 1Z67A 5ILSA 5M5XJ 4ZYGA 2X6XA 4B44A 3OOUA 3UNGC 3BQZA 3F6VA 1R00A 4U88A 5J8CA 1U5TB 4ZJZA 4M9XA 5FLXZ 1B8IA 2QQ9A 1ETYA 1B72B 1G3TA 5M5YJ 3I55I 4HF2A 5HLIA 3T5XA 2G7HA 3BR1A 1GLNA 3SQNA 3K70C 3K6GA 1YI2I 5FD5A 1WHUA 3NWTA 4RA2A 2JTVA 3G1OA 1HCRA 4Y13A 4XKBA 3OYEA 3S3OA 4Z2YA 5J3LA 1KYWA 1Z77A 1A35A 4YG2F 2HDDA 2A05A 3W2AA 4BQOA 1VQKI 1QZZA 2Y0SN 4S04A 2WB1A 4DZPA 4XRMA 1TWFJ 2GWRA 5F04A 1XSDA 1FYKA 2HQRA 3QOPA 4KDPA 2Q2EB 4IQJA 2Q2EA 3HJEA 2BE5F 4DIQA 2E5ZA 4LGWA 4HX7A 5B5EC 3OYAA 1JT6A 2Z2SB 3K10A 2BHZA 3ZMSA 3OR2C 5FKMA 4AVZA 3OYJA 4CO8A 1YE9A 2FNAA 1VQ7I 2L9NA 5DS9A 1WCMJ 2IP2A 2JT1A 2L5QA 3HPGA 3TOAA 1LDDA 2ZBKA 3FXUA 1ETXA 2R3SA 3SZGA 2DFEA 3ZMUA 4Q47A 4UVCA 3CCUI 1U78A 1V5GA 5D8KB 2HVRA 5K7ZA 1Y39A 4ZZDA 4XOTA 1IV8A 1OCOH 3I54A 1OPCA 3A0HC 4A3BJ 1BIAA 3IL2A 2R7QA 4GRIA 3B6CA 1JE8A 4KNYA 3PFYA 4I01A 1SMTA 3V8LA 4G8XA 3ASNH 3V42A 2L7FP 4RAFA 1J59A 1ZREA 2LP0A 4C30A 1PVEA 4PGGA 3KEYA 3PM1A 4UHTA 2GXBA 3BG5A 2LC2A 3E3VA 1BI1A 1FNNA 2KJBA 1XGSA 5HDKA 1KQ9A 3W3CA 3UR3C 1ETQA 3JRGA 4BXUA 2X1DA 3F72A 2DMPA 3F8NA 1KU3A 4XKWA 1DPUA 2Z5UA 1F9NA 1BM9A 4RB2C 2FRHA 1I6HJ 4OIQF 2M8GX 2GAUA 4DBQA 1OMIA 2ZKZA 1JUSA 1CGPA 3ROUA 2NRAC 4I02A 3TP3A 3G1LA 2BXYA 2WA0A 2XF6A 4LJZF 2L7ZA 3HZJA 4FX4A 3HRUA 3KIOA 1WQ2A 2E71A 2ME6A 1P7JA 3RPQA 3UKGA 3H35A 1ULYA 2XAJA 1O7FA 2AHQA 3ZQHA 4B09A 2K86A 3J80K 3OIPA 3H5RA 5FFXA 2LTPA 1DDNA 5F1JA 1I6XA 3H0GJ 1WJBA 4FETA 3DTIA 1R1TA 1YW7A 3FXKA 1GDTA 1WGXA 3K0LA 2K02A 3AG2H 2BZTA 1XCBA 2ZMEA 4BDZA 1ENHA 3LFUA 2VIXA 4HPQA 4ZH4F 3I4NJ 1DPRA 4M3EA 4HNVA
chains in the Genus database with same CATH topology
3LA7A 4DQ2A 5HVQC 1W7PA 2IRFG 4M72A 4LLLA 3RI4A 3LA2A 3GFLA 3SFZA 4A0ZA 1LEAA 2VT2A 2G7UA 2L54A 3HHHA 2E7XA 2A6EF 4WK8F 3KP6A 1D5VA 4L9TA 3IRRA 3EETA 2HGCA 2EWNA 4IF4A 5FB2A 2RGVA 1W7PB 2X4HA 2EV6A 3LFKA 4ETSA 3KFWX 4ENJA 4G7ZF 2KKOA 5E8GA 3O3KA 2EFQA 3ML6A 2RKHA 3MQ0A 6PAXA 3WTYC 4IXAA 2P8TA 3I59B 4HQMA 1T6SA 1TLHB 2DT5A 1MDMB 2W85A 2V9VA 3L00A 4NB5A 1WSUA 1XMAA 3ECHA 2CWEA 4KMUX 1XGOA 1I1SA 3VODA 2GQQA 1D3YA 2MLGA 4LG0A 1O3QA 2V1DA 1UB9A 2BYVE 3KLOA 3JAMZ 2VBXA 3T8TA 2KJCA 5EEHA 3ELKA 1QQIA 1YYVA 4HX8A 4A5NA 4PDKA 1R58A 3VOEA 3QU3A 1F5TA 2P4WA 2VN2A 4Y15A 5LGNA 3GXOA 2JRTA 2PLYA 3M9AA 4L0ZB 1O7LA 1Z6TA 1ZHFA 1J7KA 1FWZA 2KRFA 3R0JA 3WTTC 4RAZA 2M1BA 1ZRCA 5H20A 4UVAA 2LDUA 1OKRA 2VBWA 2STTA 2OZUA 2QYOA 3DPTA 3D0SA 3P9CA 3WGHA 3TOBA 1G3SA 4HW0A 1ZGJA 2P6TA 1GVJA 2OD5A 1SAXA 4IRGA 4HQEA 2V6CA 1NHAA 4GGGA 1IZ1A 3O6BB 5LBQA 1XDUA 4EJVA 1FBQA 3P9IA 1XN7A 4WWCA 2ESHA 3MZYA 2RN7A 4LFUA 1IXRC 2IW5A 3R0AA 5DV5A 1UHMA 1KU9A 5AONA 3N97A 3PFIA 1DUXC 1R1UA 1FZPB 1ZRDA 4WF2A 3FM3A 3L7WA 3PQJA 1QGPA 1YTYA 5KVRA 1S8NA 1K78B 3QRFF 2X0LA 3KP3A 3WODF 1MJ9A 1O57A 5CVVA 1IXCA 1FYLA 5LEKA 1TW2A 3T1BA 1SFXA 3LQQA 1IAWA 4U0WA 5HS9A 4G7OF 5CVJA 3F21A 2J5OA 2M45A 3R61A 2B0LA 1YFHA 4L18B 3RDIA 3JSPA 4A2UA 5F1RA 2ADUA 4OOIA 3JW4A 3IWFA 3J81Z 2MC3A 4GXOA 1WI9A 4O5VA 2YR2A 3M8FA 1YG2A 5HLHA 4GYGA 4LLGF 4I0BA 3TO6A 4IRIA 4O3MA 3I58A 5LLQA 4HOBA 4KMFA 2DW4A 2HZTA 1HW5A 1LQ1A 4ESJA 4FHTA 2O6GE 4HA8A 3V4GA 2NAZA 4XLPF 2JSCA 3SZPA 1BOAA 4XBFA 2PMUA 3EUHA 3V7CA 5LHIA 4RB1A 1LDKB 3ZMZA 3KE2A 2E1CA 3JTHA 4S05A 1EH7A 1XDSA 4PCQA 2D1HA 5FLXK 5F64A 4IPAA 5H6QA 4HF1A 2FMYA 2LF8A 1K78A 1KA8A 5D5UB 2IPQX 2GZWA 1FYMA 3GX4X 2CG4A 3CTAA 4EJWA 2CYYA 5DEQA 1XCVA 1BC8C 1R5HA 2DU9A 1HBXG 3HOSA 2RQPA 5J8FA 1BN5A 2FA5A 4EJOA 2LKPA 5JHUA 4MQ9F 2R7DA 5JI6A 4HAMA 3QP6A 2O0YA 5TRDA 3E5QA 2A61A 3IRQA 3FXRA 4IRHA 1T2KA 3IWZA 1O3RA 1F1ZA 2CO5A 2VE9A 3GFMA 4LB6B 1U6GA 1TBXA 3MAJA 2HEOA 3ZMVA 4YFXF 2XASA 1ZGAA 3DKWA 1ZH5A 2A5YB 5K1YA 1R1VA 4LB5A 4OIOF 4M74A 3Q5FA 5ILUA 1K6OA 5D5WB 3IKTA 4HYEA 2DQRA 4IHSA 4I7HA 2CQKA 5JVTA 5K5QA 1FSEA 4OMYA 3K1NA 4HV5A 3U9GA 4R79A 4I98B 4OU0A 2UXXA 4U7DA 2XV4S 1ZRFA 3HIFA 3GUDA 3P9KA 1A04A 3K2ZA 4CZZA 2FBKA 1BC7C 2COMA 3CO6C 2IA0A 3I71A 4P55A 1G4DA 4UVBA 1SD7A 3MZHA 3IKVA 1WWXA 2D45A 4LK0F 1OYWA 4HZFA 2IVMA 2PEXA 5BPDA 2VOOA 3BPXA 1C0WA 2DK8A 3VEPA 3VFZA 4Q4ZF 3DEUA 2PQ8A 1FBSA 4D0PA 4YIIA 4HDVA 4OIRF 2VODA 4CGZA 3BOQA 3GEZA 1UFMA 2ZXJA 4AIJA 4BNCA 4ZYHA 3D5LA 5A2QK 1IUYA 2EA4A 2H94A 4CHUA 2QLZA 3NRVA 4GCVA 3RYPA 1V4RA 2VC1A 4ZZLA 2M30A 3TKYA 5L3FA 3E5UA 5DUKA 5ICCA 1E17A 3HYIA 1LVAA 3ABTA 1XSXA 3TGNA 1ZLJA 3GZ5A 5CYVA 4TV7A 5FO5A 1UHWA 3FX3A 3WG9A 1VTNC 2K4JA 3RYRA 3BWGA 1ODDA 4F7ZA 3DQVC 2W24A 5HOOA 1R22A 2UXNA 3G73A 2FOKA 2K7LA 4ESFA 1YS7A 4L5IA 4KIBA 1FX7A 2KIFA 1MD0A 2F5FA 1FLIA 4MNUA 2P5VA 1SFUA 3WGIA 3BPVA 3L2CA 4EV0A 4EM1A 1DP7P 1J9IA 3DPLC 2IA1A 1CF7A 2LF7A 2CW0F 4IJAA 3E6CC 3BJOA 3W6JB 4G6QA 3HOTA 2M87A 1ONVA 3L9FA 1J75A 4N0BA 2H09A 3GZ6A 1P4AA 4BHCA 2Q0OA 4HLXA 3E97A 4RGXA 3AAFA 4UV9A 2FBHA 2FNPA 2PN6A 3R4KA 3H3ZA 3TDZC 3WU0A 3VB2A 2GA1A 1S7AA 2DFIA 5ICFA 1ZG1A 5AIQA 5FGMA 5FFZA 3JSOA 4R1HA 2Q8KA 4EQQA 4AWXB 3BZ6A 2PG4A 2MH2A 2ZFWA 3F8FA 2Z9OA 2Y0MA 2W57A 1HSJA 5L3DA 2YSRA 3LAPA 1KU7A 2XUBA 3KZYA 3CO7C 3HTSB 3QP5A 1P2FA 4A0XA 4PGHA 1RIOH 1WRJA 5D6EA 2Z99A 5CJ9A 4KIFA 2AS5F 1BI3A 1L3LA 4L9VA 3M7GA 2H27A 3R6SA 5LRRA 2FF4A 2YPRA 2HTJA 4DNCA 4ESBA 3QAHA 4UV8A 2VT3A 2DBBA 4HX4A 2OAZA 5E1WA 5E17F 1I1GA 1ZLKA 1B9MA 5HS7A 3BJAA 2XHKA 4QWQA 2A3SA 3K1PA 2DTRA 2CGPA 2TDXA 1YW8A 3V7RA 5CLSA 2XGXA 4RGSA 1BIBA 4L5JA 4P9UA 3WTWC 3FF5A 2RVCA 1XGNA 3TO9A 3DF8A 1AWCA 3ZN1A 4E70A 3BDDA 3V7SA 1OYYA 3HUGA 1TNSA 3C1DA 3WGGA 1RZ4A 1STZA 3M8EA 1MGTA 2EFPA 4MHGA 4P5OA 2FQ3A 4YFKF 1R36A 3WE2A 1USSA 2F5EA 2JPBA 5F6FA 1J5YA 2BGCA 1O3TA 3LAJA 5ILVA 3HHGA 2D1VA 4LK1F 2IJLA 1P6RA 1P4WA 3FMRA 1UCRA 2WTEA 2NNYA 5E20A 2DI3A 2STWA 1W5SA 1O3SA 2LSOA 3M1EA 4BHBA 1TQMA 3I53A 5D6FA 3F6OA 2F5CA 1H9TA 2F2EA 2W25A 3HSEA 2PJPA 4KA4A 3I0TA 4WX9A 3K1MA 3LA3A 2OA4A 4ZYEA 3R60A 2ISYA 5IT9K 5LGTA 3GO5A 4A0YA 2Y75A 2G9WA 3BROA 1SD4A 2RDPA 1ZAOA 1EH6A 2DAOA 5HDNA 3NEUA 1LJ9A 2UZKA 1OYIA 4A5MA 4RGUA 3WU1B 2L4MA 1B59A 2OZ6A 2WC2A 1T38A 3EDPA 3KLNA 4HBLA 3J81K 3V8JA 1YLFA 5J6XA 3HRTA 4EMSA 3SZTA 2FE3A 2VBYA 4WXHA 2Y48A 3CJNA 3KCCA 2E1NA 3BJ6A 4LD5A 5L3GA 1MDMA 2Z33A 1BI2A 3H3UA 3CUQA 3L09A 2K4BA 4UUVA 2BBYA 1QBJA 1RUOA 3ECOA 3DV8A 1W7PD 2XKOA 1GXPA 4KT5C 2XAHA 4FX0A 3MFKA 3U1DA 3HSFA 3ZN0A 3EYIA 3WE3A 2BEOA 1LB2A 4G94A 4BAYA 5K5RA 3MEXA 4NQWA 1YO5C 1EV7A 3OV8A 2HR3A 4A6DA 3CUQC 1QPMA 5DDGA 2OQRA 4ASNA 5DUIA 2HTSA 5ICEA 5DCFA 1QO0D 1ZG3A 4MTEA 2WV0A 2YX7A 3N4MA 4BQAA 4KFCA 5AIPA 1K7AA 3S2WA 1TQIA 3FHZA 3B73A 3OOPA 1ON2A 2HYGD 3Q9VA 4KUMA 1T39A 1AOYA 2H6BA 3DFGA 2DLLA 4R8HA 4L9JA 1IN8A 2HS5A 4HF0A 2FMLA 3DXJF 3GFIA 2P6SA 4BYYA 3TDUC 4HV6A 3TO7A 3ERED 2XVCA 2A68F 1JGSA 1ZG5A 3C3WA 2PMHA 2LNBA 2HDCA 2RV8A 1U5TC 1FOKA 2VE8A 1H9GA 1D8KA 1S29A 3H92A 1IF1A 4BH9A 4M6YA 2ISZA 3RJPA 4MQVA 3WTZA 1XD7A 3LQRA 5HS8A 2F5DA 4RB3C 1CF7B 5LHHA 3GWZA 4ENMA 4M9ZA 4B8XA 2ELHA 3GW2A 3BY6A 3F3XA 2UWMA 1Z1DA 1ON1A 1T98A 5E8IA 2A69F 3W6KB 3KEOA 1HSTA 3KP7A 4AVPA 4AD9A 3BP8A 4KICA 3SXYA 4A12A 3FMQA 1I27A 5D5VB 4U0YA 1XMKA 1J2XA 2V79A 1E2XA 2K27A 3I59A 5KK1A 1G3YA 1U3EM 1TW3A 2QQBA 2AXLA 3T8RA 4H0EA 5IT9Z 3KZZA 4ENKA 1JHFA 3E6MA 2M5WA 4M6XA 1LNWA 1ZARA 3ISPA 1Z7UA 3NQOA 1TQPA 3QPTA 2QBYA 2XROA 4GO1A 3C7JA 4KYWA 3I4PA 1XB4A 3JAMK 3CLOA 3IHUA 2DPUA 5DD8A 5BOXA 3HTUA 2QBYB 1YW9A 2XRNA 3E6BA 1JXSA 1IN5A 2QENA 2HOEA 2IA2A 1HKSA 1IW7F 1BJAA 2KIUA 1X3UA 2OQGA 1TNTA 5LGUA 3RKXA 3LSTA 2FSWA 2EFWA 3ZPLA 2QVOA 5DD4A 3EYYA 1KQ0A 4K2EA 2YX4A 3MCZA 3CDHA 3I5UA 1Z05A 4IVNA 2PBIA 4BHPA 1R5GA 3RIRA 3J80Z 4NHJA 2ETHA 3O2PE 3WTXC 1ZN2A 3MWMA 4AIHA 1Q1HA 4XRFA 1TTYA 1YS6A 1W5TA 2R7FA 2ESNA 3QU6A 2Z3YA 2QZ8A 2NYXA 4I0AA 3F8BA 4XSXF 3J7AO 1U8RA 4P96A 1HKQA 1MJBA 2DPDA 3ULQB 5TJJA 1S6LA 3V8KA 2JZYA 2JPCA 1FY7A 1QNTA 2YU3A 4RB0A 4RGRA 4WCGA 4QLCU 3E5XA 2O8XA 3E6DA 5L3CA 4P9FA 2MD5A 1S3JA 3RKYA 1HKTA 2DQLA 1Z91A 2HYFA 2GA2A 4EVIA 4U7BA 2WWYA 4Y17A 1Y0UA 1SD6A 5L3EA 2QQAA 4KIGA 5K5OA 2V1UA 1I5ZA 3FWEA 2VXZA 4G9YA 3CUQB 4CDGA 1U2WA 4OIPF 1W4MA 1FP1D 1FP2A 2ZNYA 1F4KA 1IN7A 3GF2A 1XGMA 2E7WA 2XIGA 1RNLA 4KN4X 1G6NA 4ENNA 2EJRA 4EGYA 1RUNA 2L01A 4N9IA 4ON0A 2ZNZA 5DYMA 2ZCWA 4IHTA 1MJAA 2OBPA 3TQNA 2VONA 2QM3A 4LG0B 2HKXA 3KP2A 1GHCA 1FSHA 4N9HA 5JR3A 4JBAA 1PP7U 5L3BA 4I2OA 1ZYRF 3HRMA 1D8JA 2P7CB 5D4SA 4EGZA 1JHHA 2BV6A 1YQAA 3HRSA 4CYDA 2HQNA 2MA3A 2EFOA 2NS0A 2P7VB 1FPQA 1G3WA 3CUOA 2O3FA 4LMYA 2CSOA 1GXQA 1BBYA 2EV5A 2L4AA 3JTGA 1KU2A 3PQKA 3QPHA 1V3FA 4KN7X 2PI0A 1PP8F 4XSZF 3ZMDA 4XLNF 2FXAA 5IT3A 1FBUA 3LWFA 4Q48A 4MGRA 2L3DA 1Z6RA 3GVAA 3F22A 1Z9CA 4MEYF 1S7OA 2OU2A 4RS8A 4A6EA 2GXGA 2HFHA 1WKMA 2A6HF 2XKPA 3U2RA 4FT8A 4UXNA 4I09A 3WTVC 4HDUA 2MLKA 1HW1A 2IT0A 1B9NA 5H6RA 1HW2A 5E1ZB 1B4AA 2DO7A 5E18F 1REPC 1IN4A 1LEBA 2HKOA 5FD6A 5LHGA 2XAGA 3KETA 4M73A 3RTRA 1B1BA 2J5PA 4JK1X 1IRGA 5D5XB 4LLNA 2M8EA 1SFEA 3F8MA 3K9TA 4EM0B 5LRSA 3KP4A 2MH9A 4CXFA 3FZVA 1R7JA 3F8CA 3ZMTA 1FC3A 5DCMB 3ABUA 1LDJA 2QWWA 1HQCA 5LEJA 3K69A 2VOPA 2O03A 4G6DA 3KP5A 3WTUC 4CICA 2KIMA 1IXSB 3FMSA 3GFJA 2L02A 1B6AA 1QZYA 2VC0A 5CVUA 4WXDA 4G7HF 3WTSC 2DK5A 1YIOA 4EM2A 1OR7A 3KEQA 3P7NA 2PFBA 2EV0A 3ZQ7A 5DCMA 5ICGA 3C18A 2ZO4A 5BQTA 4UNOA 4AIKA 4MEXF 3GYHX 2XAQA 2H6CA 2RNJA 3G3ZA 5E1XA 5BS6A 1MKMA 3FM5A 5HDGA 2D2WA 5BMZA 2ACJA 2EB7A 5CVRA 4HLYA 4EJTA 3HSRA 1BI0A 1EH8A 2ZJ2A 4RAYA 1IRFA 5ED4A 4L0YB 3DP7A 2RC4A 2GIVA 5BPIA 3IC7A 1J0RA 2NNNA 1U5TA 4L9NA 2MBFA 2HWVA 5HLGA 4YFNF 2EFNA 1XSVA 4PZJA 5JFRA 1SMYF 1KGSA 1MZBA 1IN6A 2P5LC 4MTDA 4ZYDA 4M9SA 3EQLF 1T0FA 2FEZA 4YIFA 4OINF 2ZMEB 4EJUA 1HXDA 1RI7A 2QUFA 5EEGA 2FU4A 1H0MA 2XAFA 3T0YA 1R23A 3RKWA 1PDNC 2P5KA 5CVIA 2O61A 1KYZA 1L0OC 2CFXA 3COAC 4JQFA 1P92A 4OMZA 3REOA 5ERIA 2A07F 2C6YA 3RPUA 4GYIA 3SHFA 2W84A 4Q5SF 1SD5A 2V1XA 1FT9A 1USTA 2VBZA 4WXCA 3B02A 5A2QZ 3GLXA 1K79A 2EK5A 4M71A 2EA2A 1PUEE 3F23A 1P4XA 3I64A 1KQ8A 3FXQA 5D8LB 2FBIA 4O6JA 3ZP5A 3Q9SA 5D4RA 5ILSA 4ZYGA 3F6VA 1R00A 4U88A 5J8CA 1U5TB 4M9XA 5FLXZ 2QQ9A 1G3TA 4HF2A 5HLIA 3T5XA 2G7HA 3SQNA 5FD5A 2JTVA 4Y13A 4Z2YA 1KYWA 4YG2F 1QZZA 4S04A 2GWRA 1XSDA 1FYKA 2HQRA 3QOPA 4KDPA 2Q2EA 2BE5F 4LGWA 4HX7A 3ZMSA 4CO8A 2FNAA 2IP2A 2JT1A 3TOAA 1LDDA 2ZBKA 3FXUA 2R3SA 3ZMUA 4Q47A 4UVCA 1U78A 5D8KB 4ZZDA 3I54A 1OPCA 1BIAA 3IL2A 1JE8A 4KNYA 4I01A 1SMTA 3V8LA 4G8XA 1J59A 1ZREA 4PGGA 2GXBA 4UHTA 3E3VA 1BI1A 1FNNA 2KJBA 1XGSA 5HDKA 1KQ9A 4BXUA 3F72A 3F8NA 1KU3A 1DPUA 2Z5UA 1F9NA 1BM9A 4RB2C 2FRHA 4OIQF 2GAUA 1OMIA 2ZKZA 1CGPA 3ROUA 2NRAC 4I02A 4LJZF 4FX4A 3HRUA 1WQ2A 3RPQA 1ULYA 2XAJA 1O7FA 4B09A 2K86A 3J80K 5FFXA 1DDNA 1I6XA 1R1TA 1YW7A 3K0LA 2K02A 1XCBA 2ZMEA 4U0VA 4ZH4F 1DPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LA7 A;  4DQ2 A;  5HVQ C;  1W7P A;  2IRF G;  4M72 A;  4LLL A;  3RI4 A;  3LA2 A;  3GFL A;  3SFZ A;  4A0Z A;  1LEA A;  2VT2 A;  2G7U A;  2L54 A;  3HHH A;  2E7X A;  2A6E F;  4WK8 F;  3KP6 A;  1D5V A;  4L9T A;  3IRR A;  3EET A;  2HGC A;  2EWN A;  4IF4 A;  5FB2 A;  2RGV A;  1W7P B;  2X4H A;  2EV6 A;  3LFK A;  4ETS A;  3KFW X;  4ENJ A;  4G7Z F;  2KKO A;  5E8G A;  3O3K A;  2EFQ A;  3ML6 A;  2RKH A;  3MQ0 A;  6PAX A;  3WTY C;  4IXA A;  2P8T A;  3I59 B;  4HQM A;  1T6S A;  1TLH B;  2DT5 A;  1MDM B;  2W85 A;  2V9V A;  3L00 A;  4NB5 A;  1WSU A;  1XMA A;  3ECH A;  2CWE A;  4KMU X;  1XGO A;  1I1S A;  3VOD A;  2GQQ A;  1D3Y A;  2MLG A;  4LG0 A;  1O3Q A;  2V1D A;  1UB9 A;  2BYV E;  3KLO A;  3JAM Z;  2VBX A;  3T8T A;  2KJC A;  5EEH A;  3ELK A;  1QQI A;  1YYV A;  4HX8 A;  4A5N A;  4PDK A;  1R58 A;  3VOE A;  3QU3 A;  1F5T A;  2P4W A;  2VN2 A;  4Y15 A;  5LGN A;  3GXO A;  2JRT A;  2PLY A;  3M9A A;  4L0Z B;  1O7L A;  1Z6T A;  1ZHF A;  1J7K A;  1FWZ A;  2KRF A;  3R0J A;  3WTT C;  4RAZ A;  2M1B A;  1ZRC A;  5H20 A;  4UVA A;  2LDU A;  1OKR A;  2VBW A;  2STT A;  2OZU A;  2QYO A;  3DPT A;  3D0S A;  3P9C A;  3WGH A;  3TOB A;  1G3S A;  4HW0 A;  1ZGJ A;  2P6T A;  1GVJ A;  2OD5 A;  1SAX A;  4IRG A;  4HQE A;  2V6C A;  1NHA A;  4GGG A;  1IZ1 A;  3O6B B;  5LBQ A;  1XDU A;  4EJV A;  1FBQ A;  3P9I A;  1XN7 A;  4WWC A;  2ESH A;  3MZY A;  2RN7 A;  4LFU A;  1IXR C;  2IW5 A;  3R0A A;  5DV5 A;  1UHM A;  1KU9 A;  5AON A;  3N97 A;  3PFI A;  1DUX C;  1R1U A;  1FZP B;  1ZRD A;  4WF2 A;  3FM3 A;  3L7W A;  3PQJ A;  1QGP A;  1YTY A;  5KVR A;  1S8N A;  1K78 B;  3QRF F;  2X0L A;  3KP3 A;  3WOD F;  1MJ9 A;  1O57 A;  5CVV A;  1IXC A;  1FYL A;  5LEK A;  1TW2 A;  3T1B A;  1SFX A;  3LQQ A;  1IAW A;  4U0W A;  5HS9 A;  4G7O F;  5CVJ A;  3F21 A;  2J5O A;  2M45 A;  3R61 A;  2B0L A;  1YFH A;  4L18 B;  3RDI A;  3JSP A;  4A2U A;  5F1R A;  2ADU A;  4OOI A;  3JW4 A;  3IWF A;  3J81 Z;  2MC3 A;  4GXO A;  1WI9 A;  4O5V A;  2YR2 A;  3M8F A;  1YG2 A;  5HLH A;  4GYG A;  4LLG F;  4I0B A;  3TO6 A;  4IRI A;  4O3M A;  3I58 A;  5LLQ A;  4HOB A;  4KMF A;  2DW4 A;  2HZT A;  1HW5 A;  1LQ1 A;  4ESJ A;  4FHT A;  2O6G E;  4HA8 A;  3V4G A;  2NAZ A;  4XLP F;  2JSC A;  3SZP A;  1BOA A;  4XBF A;  2PMU A;  3EUH A;  3V7C A;  5LHI A;  4RB1 A;  1LDK B;  3ZMZ A;  3KE2 A;  2E1C A;  3JTH A;  4S05 A;  1EH7 A;  1XDS A;  4PCQ A;  2D1H A;  5FLX K;  5F64 A;  4IPA A;  5H6Q A;  4HF1 A;  2FMY A;  2LF8 A;  1K78 A;  1KA8 A;  5D5U B;  2IPQ X;  2GZW A;  1FYM A;  3GX4 X;  2CG4 A;  3CTA A;  4EJW A;  2CYY A;  5DEQ A;  1XCV A;  1BC8 C;  1R5H A;  2DU9 A;  1HBX G;  3HOS A;  2RQP A;  5J8F A;  1BN5 A;  2FA5 A;  4EJO A;  2LKP A;  5JHU A;  4MQ9 F;  2R7D A;  5JI6 A;  4HAM A;  3QP6 A;  2O0Y A;  5TRD A;  3E5Q A;  2A61 A;  3IRQ A;  3FXR A;  4IRH A;  1T2K A;  3IWZ A;  1O3R A;  1F1Z A;  2CO5 A;  2VE9 A;  3GFM A;  4LB6 B;  1U6G A;  1TBX A;  3MAJ A;  2HEO A;  3ZMV A;  4YFX F;  2XAS A;  1ZGA A;  3DKW A;  1ZH5 A;  2A5Y B;  5K1Y A;  1R1V A;  4LB5 A;  4OIO F;  4M74 A;  3Q5F A;  5ILU A;  1K6O A;  5D5W B;  3IKT A;  4HYE A;  2DQR A;  4IHS A;  4I7H A;  2CQK A;  5JVT A;  5K5Q A;  1FSE A;  4OMY A;  3K1N A;  4HV5 A;  3U9G A;  4R79 A;  4I98 B;  4OU0 A;  2UXX A;  4U7D A;  2XV4 S;  1ZRF A;  3HIF A;  3GUD A;  3P9K A;  1A04 A;  3K2Z A;  4CZZ A;  2FBK A;  1BC7 C;  2COM A;  3CO6 C;  2IA0 A;  3I71 A;  4P55 A;  1G4D A;  4UVB A;  1SD7 A;  3MZH A;  3IKV A;  1WWX A;  2D45 A;  4LK0 F;  1OYW A;  4HZF A;  2IVM A;  2PEX A;  5BPD A;  2VOO A;  3BPX A;  1C0W A;  2DK8 A;  3VEP A;  3VFZ A;  4Q4Z F;  3DEU A;  2PQ8 A;  1FBS A;  4D0P A;  4YII A;  4HDV A;  4OIR F;  2VOD A;  4CGZ A;  3BOQ A;  3GEZ A;  1UFM A;  2ZXJ A;  4AIJ A;  4BNC A;  4ZYH A;  3D5L A;  5A2Q K;  1IUY A;  2EA4 A;  2H94 A;  4CHU A;  2QLZ A;  3NRV A;  4GCV A;  3RYP A;  1V4R A;  2VC1 A;  4ZZL A;  2M30 A;  3TKY A;  5L3F A;  3E5U A;  5DUK A;  5ICC A;  1E17 A;  3HYI A;  1LVA A;  3ABT A;  1XSX A;  3TGN A;  1ZLJ A;  3GZ5 A;  5CYV A;  4TV7 A;  5FO5 A;  1UHW A;  3FX3 A;  3WG9 A;  1VTN C;  2K4J A;  3RYR A;  3BWG A;  1ODD A;  4F7Z A;  3DQV C;  2W24 A;  5HOO A;  1R22 A;  2UXN A;  3G73 A;  2FOK A;  2K7L A;  4ESF A;  1YS7 A;  4L5I A;  4KIB A;  1FX7 A;  2KIF A;  1MD0 A;  2F5F A;  1FLI A;  4MNU A;  2P5V A;  1SFU A;  3WGI A;  3BPV A;  3L2C A;  4EV0 A;  4EM1 A;  1DP7 P;  1J9I A;  3DPL C;  2IA1 A;  1CF7 A;  2LF7 A;  2CW0 F;  4IJA A;  3E6C C;  3BJO A;  3W6J B;  4G6Q A;  3HOT A;  2M87 A;  1ONV A;  3L9F A;  1J75 A;  4N0B A;  2H09 A;  3GZ6 A;  1P4A A;  4BHC A;  2Q0O A;  4HLX A;  3E97 A;  4RGX A;  3AAF A;  4UV9 A;  2FBH A;  2FNP A;  2PN6 A;  3R4K A;  3H3Z A;  3TDZ C;  3WU0 A;  3VB2 A;  2GA1 A;  1S7A A;  2DFI A;  5ICF A;  1ZG1 A;  5AIQ A;  5FGM A;  5FFZ A;  3JSO A;  4R1H A;  2Q8K A;  4EQQ A;  4AWX B;  3BZ6 A;  2PG4 A;  2MH2 A;  2ZFW A;  3F8F A;  2Z9O A;  2Y0M A;  2W57 A;  1HSJ A;  5L3D A;  2YSR A;  3LAP A;  1KU7 A;  2XUB A;  3KZY A;  3CO7 C;  3HTS B;  3QP5 A;  1P2F A;  4A0X A;  4PGH A;  1RIO H;  1WRJ A;  5D6E A;  2Z99 A;  5CJ9 A;  4KIF A;  2AS5 F;  1BI3 A;  1L3L A;  4L9V A;  3M7G A;  2H27 A;  3R6S A;  5LRR A;  2FF4 A;  2YPR A;  2HTJ A;  4DNC A;  4ESB A;  3QAH A;  4UV8 A;  2VT3 A;  2DBB A;  4HX4 A;  2OAZ A;  5E1W A;  5E17 F;  1I1G A;  1ZLK A;  1B9M A;  5HS7 A;  3BJA A;  2XHK A;  4QWQ A;  2A3S A;  3K1P A;  2DTR A;  2CGP A;  2TDX A;  1YW8 A;  3V7R A;  5CLS A;  2XGX A;  4RGS A;  1BIB A;  4L5J A;  4P9U A;  3WTW C;  3FF5 A;  2RVC A;  1XGN A;  3TO9 A;  3DF8 A;  1AWC A;  3ZN1 A;  4E70 A;  3BDD A;  3V7S A;  1OYY A;  3HUG A;  1TNS A;  3C1D A;  3WGG A;  1RZ4 A;  1STZ A;  3M8E A;  1MGT A;  2EFP A;  4MHG A;  4P5O A;  2FQ3 A;  4YFK F;  1R36 A;  3WE2 A;  1USS A;  2F5E A;  2JPB A;  5F6F A;  1J5Y A;  2BGC A;  1O3T A;  3LAJ A;  5ILV A;  3HHG A;  2D1V A;  4LK1 F;  2IJL A;  1P6R A;  1P4W A;  3FMR A;  1UCR A;  2WTE A;  2NNY A;  5E20 A;  2DI3 A;  2STW A;  1W5S A;  1O3S A;  2LSO A;  3M1E A;  4BHB A;  1TQM A;  3I53 A;  5D6F A;  3F6O A;  2F5C A;  1H9T A;  2F2E A;  2W25 A;  3HSE A;  2PJP A;  4KA4 A;  3I0T A;  4WX9 A;  3K1M A;  3LA3 A;  2OA4 A;  4ZYE A;  3R60 A;  2ISY A;  5IT9 K;  5LGT A;  3GO5 A;  4A0Y A;  2Y75 A;  2G9W A;  3BRO A;  1SD4 A;  2RDP A;  1ZAO A;  1EH6 A;  2DAO A;  5HDN A;  3NEU A;  1LJ9 A;  2UZK A;  1OYI A;  4A5M A;  4RGU A;  3WU1 B;  2L4M A;  1B59 A;  2OZ6 A;  2WC2 A;  1T38 A;  3EDP A;  3KLN A;  4HBL A;  3J81 K;  3V8J A;  1YLF A;  5J6X A;  3HRT A;  4EMS A;  3SZT A;  2FE3 A;  2VBY A;  4WXH A;  2Y48 A;  3CJN A;  3KCC A;  2E1N A;  3BJ6 A;  4LD5 A;  5L3G A;  1MDM A;  2Z33 A;  1BI2 A;  3H3U A;  3CUQ A;  3L09 A;  2K4B A;  4UUV A;  2BBY A;  1QBJ A;  1RUO A;  3ECO A;  3DV8 A;  1W7P D;  2XKO A;  1GXP A;  4KT5 C;  2XAH A;  4FX0 A;  3MFK A;  3U1D A;  3HSF A;  3ZN0 A;  3EYI A;  3WE3 A;  2BEO A;  1LB2 A;  4G94 A;  4BAY A;  5K5R A;  3MEX A;  4NQW A;  1YO5 C;  1EV7 A;  3OV8 A;  2HR3 A;  4A6D A;  3CUQ C;  1QPM A;  5DDG A;  2OQR A;  4ASN A;  5DUI A;  2HTS A;  5ICE A;  5DCF A;  1QO0 D;  1ZG3 A;  4MTE A;  2WV0 A;  2YX7 A;  3N4M A;  4BQA A;  4KFC A;  5AIP A;  1K7A A;  3S2W A;  1TQI A;  3FHZ A;  3B73 A;  3OOP A;  1ON2 A;  2HYG D;  3Q9V A;  4KUM A;  1T39 A;  1AOY A;  2H6B A;  3DFG A;  2DLL A;  4R8H A;  4L9J A;  1IN8 A;  2HS5 A;  4HF0 A;  2FML A;  3DXJ F;  3GFI A;  2P6S A;  4BYY A;  3TDU C;  4HV6 A;  3TO7 A;  3ERE D;  2XVC A;  2A68 F;  1JGS A;  1ZG5 A;  3C3W A;  2PMH A;  2LNB A;  2HDC A;  2RV8 A;  1U5T C;  1FOK A;  2VE8 A;  1H9G A;  1D8K A;  1S29 A;  3H92 A;  1IF1 A;  4BH9 A;  4M6Y A;  2ISZ A;  3RJP A;  4MQV A;  3WTZ A;  1XD7 A;  3LQR A;  5HS8 A;  2F5D A;  4RB3 C;  1CF7 B;  5LHH A;  3GWZ A;  4ENM A;  4M9Z A;  4B8X A;  2ELH A;  3GW2 A;  3BY6 A;  3F3X A;  2UWM A;  1Z1D A;  1ON1 A;  1T98 A;  5E8I A;  2A69 F;  3W6K B;  3KEO A;  1HST A;  3KP7 A;  4AVP A;  4AD9 A;  3BP8 A;  4KIC A;  3SXY A;  4A12 A;  3FMQ A;  1I27 A;  5D5V B;  4U0Y A;  1XMK A;  1J2X A;  2V79 A;  1E2X A;  2K27 A;  3I59 A;  5KK1 A;  1G3Y A;  1U3E M;  1TW3 A;  2QQB A;  2AXL A;  3T8R A;  4H0E A;  5IT9 Z;  3KZZ A;  4ENK A;  1JHF A;  3E6M A;  2M5W A;  4M6X A;  1LNW A;  1ZAR A;  3ISP A;  1Z7U A;  3NQO A;  1TQP A;  3QPT A;  2QBY A;  2XRO A;  4GO1 A;  3C7J A;  4KYW A;  3I4P A;  1XB4 A;  3JAM K;  3CLO A;  3IHU A;  2DPU A;  5DD8 A;  5BOX A;  3HTU A;  2QBY B;  1YW9 A;  2XRN A;  3E6B A;  1JXS A;  1IN5 A;  2QEN A;  2HOE A;  2IA2 A;  1HKS A;  1IW7 F;  1BJA A;  2KIU A;  1X3U A;  2OQG A;  1TNT A;  5LGU A;  3RKX A;  3LST A;  2FSW A;  2EFW A;  3ZPL A;  2QVO A;  5DD4 A;  3EYY A;  1KQ0 A;  4K2E A;  2YX4 A;  3MCZ A;  3CDH A;  3I5U A;  1Z05 A;  4IVN A;  2PBI A;  4BHP A;  1R5G A;  3RIR A;  3J80 Z;  4NHJ A;  2ETH A;  3O2P E;  3WTX C;  1ZN2 A;  3MWM A;  4AIH A;  1Q1H A;  4XRF A;  1TTY A;  1YS6 A;  1W5T A;  2R7F A;  2ESN A;  3QU6 A;  2Z3Y A;  2QZ8 A;  2NYX A;  4I0A A;  3F8B A;  4XSX F;  3J7A O;  1U8R A;  4P96 A;  1HKQ A;  1MJB A;  2DPD A;  3ULQ B;  5TJJ A;  1S6L A;  3V8K A;  2JZY A;  2JPC A;  1FY7 A;  1QNT A;  2YU3 A;  4RB0 A;  4RGR A;  4WCG A;  4QLC U;  3E5X A;  2O8X A;  3E6D A;  5L3C A;  4P9F A;  2MD5 A;  1S3J A;  3RKY A;  1HKT A;  2DQL A;  1Z91 A;  2HYF A;  2GA2 A;  4EVI A;  4U7B A;  2WWY A;  4Y17 A;  1Y0U A;  1SD6 A;  5L3E A;  2QQA A;  4KIG A;  5K5O A;  2V1U A;  1I5Z A;  3FWE A;  2VXZ A;  4G9Y A;  3CUQ B;  4CDG A;  1U2W A;  4OIP F;  1W4M A;  1FP1 D;  1FP2 A;  2ZNY A;  1F4K A;  1IN7 A;  3GF2 A;  1XGM A;  2E7W A;  2XIG A;  1RNL A;  4KN4 X;  1G6N A;  4ENN A;  2EJR A;  4EGY A;  1RUN A;  2L01 A;  4N9I A;  4ON0 A;  2ZNZ A;  5DYM A;  2ZCW A;  4IHT A;  1MJA A;  2OBP A;  3TQN A;  2VON A;  2QM3 A;  4LG0 B;  2HKX A;  3KP2 A;  1GHC A;  1FSH A;  4N9H A;  5JR3 A;  4JBA A;  1PP7 U;  5L3B A;  4I2O A;  1ZYR F;  3HRM A;  1D8J A;  2P7C B;  5D4S A;  4EGZ A;  1JHH A;  2BV6 A;  1YQA A;  3HRS A;  4CYD A;  2HQN A;  2MA3 A;  2EFO A;  2NS0 A;  2P7V B;  1FPQ A;  1G3W A;  3CUO A;  2O3F A;  4LMY A;  2CSO A;  1GXQ A;  1BBY A;  2EV5 A;  2L4A A;  3JTG A;  1KU2 A;  3PQK A;  3QPH A;  1V3F A;  4KN7 X;  2PI0 A;  1PP8 F;  4XSZ F;  3ZMD A;  4XLN F;  2FXA A;  5IT3 A;  1FBU A;  3LWF A;  4Q48 A;  4MGR A;  2L3D A;  1Z6R A;  3GVA A;  3F22 A;  1Z9C A;  4MEY F;  1S7O A;  2OU2 A;  4RS8 A;  4A6E A;  2GXG A;  2HFH A;  1WKM A;  2A6H F;  2XKP A;  3U2R A;  4FT8 A;  4UXN A;  4I09 A;  3WTV C;  4HDU A;  2MLK A;  1HW1 A;  2IT0 A;  1B9N A;  5H6R A;  1HW2 A;  5E1Z B;  1B4A A;  2DO7 A;  5E18 F;  1REP C;  1IN4 A;  1LEB A;  2HKO A;  5FD6 A;  5LHG A;  2XAG A;  3KET A;  4M73 A;  3RTR A;  1B1B A;  2J5P A;  4JK1 X;  1IRG A;  5D5X B;  4LLN A;  2M8E A;  1SFE A;  3F8M A;  3K9T A;  4EM0 B;  5LRS A;  3KP4 A;  2MH9 A;  4CXF A;  3FZV A;  1R7J A;  3F8C A;  3ZMT A;  1FC3 A;  5DCM B;  3ABU A;  1LDJ A;  2QWW A;  1HQC A;  5LEJ A;  3K69 A;  2VOP A;  2O03 A;  4G6D A;  3KP5 A;  3WTU C;  4CIC A;  2KIM A;  1IXS B;  3FMS A;  3GFJ A;  2L02 A;  1B6A A;  1QZY A;  2VC0 A;  5CVU A;  4WXD A;  4G7H F;  3WTS C;  2DK5 A;  1YIO A;  4EM2 A;  1OR7 A;  3KEQ A;  3P7N A;  2PFB A;  2EV0 A;  3ZQ7 A;  5DCM A;  5ICG A;  3C18 A;  2ZO4 A;  5BQT A;  4UNO A;  4AIK A;  4MEX F;  3GYH X;  2XAQ A;  2H6C A;  2RNJ A;  3G3Z A;  5E1X A;  5BS6 A;  1MKM A;  3FM5 A;  5HDG A;  2D2W A;  5BMZ A;  2ACJ A;  2EB7 A;  5CVR A;  4HLY A;  4EJT A;  3HSR A;  1BI0 A;  1EH8 A;  2ZJ2 A;  4RAY A;  1IRF A;  5ED4 A;  4L0Y B;  3DP7 A;  2RC4 A;  2GIV A;  5BPI A;  3IC7 A;  1J0R A;  2NNN A;  1U5T A;  4L9N A;  2MBF A;  2HWV A;  5HLG A;  4YFN F;  2EFN A;  1XSV A;  4PZJ A;  5JFR A;  1SMY F;  1KGS A;  1MZB A;  1IN6 A;  2P5L C;  4MTD A;  4ZYD A;  4M9S A;  3EQL F;  1T0F A;  2FEZ A;  4YIF A;  4OIN F;  2ZME B;  4EJU A;  1HXD A;  1RI7 A;  2QUF A;  5EEG A;  2FU4 A;  1H0M A;  2XAF A;  3T0Y A;  1R23 A;  3RKW A;  1PDN C;  2P5K A;  5CVI A;  2O61 A;  1KYZ A;  1L0O C;  2CFX A;  3COA C;  4JQF A;  1P92 A;  4OMZ A;  3REO A;  5ERI A;  2A07 F;  2C6Y A;  3RPU A;  4GYI A;  3SHF A;  2W84 A;  4Q5S F;  1SD5 A;  2V1X A;  1FT9 A;  1UST A;  2VBZ A;  4WXC A;  3B02 A;  5A2Q Z;  3GLX A;  1K79 A;  2EK5 A;  4M71 A;  2EA2 A;  1PUE E;  3F23 A;  1P4X A;  3I64 A;  1KQ8 A;  3FXQ A;  5D8L B;  2FBI A;  4O6J A;  3ZP5 A;  3Q9S A;  5D4R A;  5ILS A;  4ZYG A;  3F6V A;  1R00 A;  4U88 A;  5J8C A;  1U5T B;  4M9X A;  5FLX Z;  2QQ9 A;  1G3T A;  4HF2 A;  5HLI A;  3T5X A;  2G7H A;  3SQN A;  5FD5 A;  2JTV A;  4Y13 A;  4Z2Y A;  1KYW A;  4YG2 F;  1QZZ A;  4S04 A;  2GWR A;  1XSD A;  1FYK A;  2HQR A;  3QOP A;  4KDP A;  2Q2E A;  2BE5 F;  4LGW A;  4HX7 A;  3ZMS A;  4CO8 A;  2FNA A;  2IP2 A;  2JT1 A;  3TOA A;  1LDD A;  2ZBK A;  3FXU A;  2R3S A;  3ZMU A;  4Q47 A;  4UVC A;  1U78 A;  5D8K B;  4ZZD A;  3I54 A;  1OPC A;  1BIA A;  3IL2 A;  1JE8 A;  4KNY A;  4I01 A;  1SMT A;  3V8L A;  4G8X A;  1J59 A;  1ZRE A;  4PGG A;  2GXB A;  4UHT A;  3E3V A;  1BI1 A;  1FNN A;  2KJB A;  1XGS A;  5HDK A;  1KQ9 A;  4BXU A;  3F72 A;  3F8N A;  1KU3 A;  1DPU A;  2Z5U A;  1F9N A;  1BM9 A;  4RB2 C;  2FRH A;  4OIQ F;  2GAU A;  1OMI A;  2ZKZ A;  1CGP A;  3ROU A;  2NRA C;  4I02 A;  4LJZ F;  4FX4 A;  3HRU A;  1WQ2 A;  3RPQ A;  1ULY A;  2XAJ A;  1O7F A;  4B09 A;  2K86 A;  3J80 K;  5FFX A;  1DDN A;  1I6X A;  1R1T A;  1YW7 A;  3K0L A;  2K02 A;  1XCB A;  2ZME A;  4U0V A;  4ZH4 F;  1DPR A; 
#chains in the Genus database with same CATH topology
 3KYC B;  3PSI A;  3LA7 A;  4DQ2 A;  5HVQ C;  1W7P A;  2IRF G;  4M72 A;  1I50 J;  4LLL A;  3RI4 A;  3LA2 A;  2EZL A;  2MG4 A;  3GFL A;  3SFZ A;  4A0Z A;  1VQO I;  1LEA A;  2VT2 A;  2YU9 J;  2G7U A;  2L54 A;  2UUZ A;  2DFH A;  3HHH A;  4XLF A;  3DU5 A;  2E7X A;  1V54 H;  1NG6 A;  2A6E F;  1D5Y A;  3S2D J;  2R7R A;  3HEF A;  4WK8 F;  2HOA A;  3KP6 A;  3OYK A;  5IYC J;  1U9N A;  1D5V A;  4L9T A;  3IRR A;  2NVX J;  3EET A;  2HGC A;  1SAU A;  1GV5 A;  2EWN A;  4IF4 A;  5FB2 A;  1WH7 A;  2M0M A;  1JGG A;  2RGV A;  1W7P B;  1V5E A;  2X4H A;  2GIZ A;  4CCL A;  2EV6 A;  2DDB A;  2K9Q A;  3LFK A;  4ETS A;  3KFW X;  4ENJ A;  2IGO A;  4G7Z F;  4C9Y A;  2KKO A;  1U8B A;  2HZD A;  5E8G A;  1UG0 A;  1OCZ H;  3EUA A;  3FKJ A;  3O3K A;  2EFQ A;  1Z21 A;  2CU7 A;  3LSK A;  3OR1 C;  3ML6 A;  1WVR A;  4AYB N;  2RKH A;  3MQ0 A;  6PAX A;  2MGQ A;  3WTY C;  4IXA A;  2P8T A;  3I59 B;  4HQM A;  3ASO H;  3A1Y A;  2NVU B;  3CC4 I;  4XLE A;  1VF9 A;  5KCM A;  1T6S A;  2DOD A;  1TLH B;  2DT5 A;  1MDM B;  4CCM A;  2W85 A;  1IDZ A;  2V9V A;  4A3J J;  2VLA A;  3L00 A;  4DYC A;  3GTO J;  4C2M J;  4NB5 A;  1WSU A;  2H8W A;  4AID A;  1XMA A;  3ECH A;  2CWE A;  4KMU X;  3CC7 I;  1ZTR A;  1XGO A;  1I1S A;  2QKM B;  4ZYA A;  3VOD A;  2GQQ A;  1D3Y A;  1MH4 A;  1UJ8 A;  2MLG A;  2HPI A;  2WBM A;  4LG0 A;  2V1D A;  1O3Q A;  1UB9 A;  3E1S A;  1D0X A;  2BYV E;  3FIS A;  1X3Z B;  3KLO A;  3G6E I;  2CV0 A;  2VPL A;  2R7T A;  3JAM Z;  2VBX A;  3T8T A;  2KJC A;  5EEH A;  4Y7N J;  3DEE A;  3ELK A;  3BLY A;  3S14 J;  3MZ8 A;  1QQI A;  1YYV A;  4HX8 A;  3WHC A;  4A5N A;  1BOB A;  2KZG A;  1FOX A;  4PDK A;  1RR8 C;  1Z3Y A;  1R58 A;  3HOX J;  3RPU D;  3VOE A;  5FKK A;  3QU3 A;  1YJN I;  1F5T A;  2P4W A;  2FJ1 A;  2VN2 A;  4FAS D;  4Y15 A;  2M3A A;  3CLQ A;  2OTL I;  1T95 A;  2I8D A;  1ETO A;  5LGN A;  3FXM A;  3GXO A;  2JRT A;  1MBJ A;  4HRI A;  3AKZ A;  2PLY A;  3K2A A;  3DEW A;  1Y1V J;  4FIS A;  3M9A A;  3RQ4 A;  4BU2 A;  4L0Z B;  1O7L A;  1Z6T A;  1ZHF A;  3GTJ J;  1J7K A;  2LD5 A;  1WPK A;  2E35 A;  1FIP A;  1FWZ A;  2KRF A;  1BA5 A;  4I99 C;  3R0J A;  3WTT C;  3CP2 A;  1YRN A;  4RAZ A;  2M1B A;  3MKZ A;  3CF5 F;  1ZRC A;  5H20 A;  4UVA A;  2DMN A;  2LDU A;  3FHN A;  1OKR A;  1ZQ3 P;  4X6A J;  2VBW A;  2BY3 A;  2STT A;  2OZU A;  3C2B A;  4NDL A;  1Y0N A;  3DU6 A;  2QYO A;  1JKR C;  5J1R A;  3DPT A;  3FDY A;  3D0S A;  2RNG A;  3P9C A;  4DYR A;  1M1E B;  4CYC B;  3ESW B;  4PJM A;  1FTT A;  3WGH A;  4Y52 J;  3TOB A;  1G3S A;  4HW0 A;  1BR1 A;  1ZGJ A;  1K6Y A;  2P6T A;  1GVJ A;  2OD5 A;  1SAX A;  3PO3 J;  2CQN A;  4IRG A;  4HQE A;  5HNF A;  1HOM A;  2BHY A;  3P5J A;  1VZ0 A;  2V6C A;  1NHA A;  5M3M J;  4GGG A;  1IZ1 A;  3O6B B;  1SVL A;  5BNG A;  5LBQ A;  4IHX A;  1XDU A;  4EJV A;  3CCL I;  1FBQ A;  5CPR B;  3CCY A;  4ZDP A;  3HOW J;  1P9Q C;  2WY8 Q;  2DN0 A;  2E1M B;  1W36 C;  3P9I A;  1XN7 A;  4XID A;  4WWC A;  4QSH A;  3A01 A;  1N25 A;  2ESH A;  2JA8 J;  4CGZ A;  3MZY A;  2COB A;  1E3P A;  5KAI C;  1G59 A;  2RN7 A;  3F9K A;  3LSR A;  2A5W A;  4LFU A;  1IXR C;  2R4G A;  1XX5 A;  2IW5 A;  2X9D A;  3R0A A;  4F52 A;  5C4X J;  1IGN A;  5DV5 A;  1GUU A;  1UHM A;  3M1C A;  4V2F A;  1KU9 A;  4NC8 A;  3Q3S A;  1BW6 A;  5AON A;  3N97 A;  3AG3 H;  2AO9 A;  3DTK A;  2ID3 A;  3Q0W A;  1DGW Y;  3PFI A;  1DUX C;  2WAE A;  2F5V A;  3KPH A;  1R1U A;  1FZP B;  2LOO A;  1ZRD A;  4WF2 A;  2L9S A;  2LMD A;  2FQ4 A;  3FM3 A;  3L7W A;  3PQJ A;  4AU7 A;  2GOX B;  1QGP A;  1YTY A;  2M34 A;  5KVR A;  1EKE A;  1S8N A;  1K78 B;  3QRF F;  2X0L A;  3KP3 A;  3WOD F;  3FXJ A;  1O4X A;  3HC7 A;  4UB6 C;  1MJ9 A;  2R0Q C;  3GTL J;  2DA7 A;  1FIA A;  1O57 A;  5CVV A;  1IXC A;  3K4N A;  1RES A;  5E3M A;  1FYL A;  2X51 A;  5LEK A;  3JRE A;  1YOV B;  3A4C A;  1TW2 A;  1WJF A;  3T1B A;  1SFX A;  3LQQ A;  1IAW A;  4U0W A;  5HS9 A;  3LSG A;  4G7O F;  5CVJ A;  4XK4 A;  3ZOB A;  2E2H J;  4F55 A;  3M07 A;  3F21 A;  2J5O A;  2M45 A;  3R61 A;  1GVD A;  2B0L A;  1YFH A;  1R9T J;  4L18 B;  3RDI A;  3JSP A;  2VJI A;  4BEH A;  3EUH C;  4A2U A;  3ONQ A;  4YEJ A;  5EG0 B;  5F1R A;  3I3L A;  2ADU A;  1NK3 P;  4OOI A;  3JW4 A;  4X1E A;  3IWF A;  2MC3 A;  4O5V A;  4GXO A;  1WI9 A;  3J81 Z;  4J01 A;  1PJR A;  2YR2 A;  3M8F A;  5IY5 H;  1YG2 A;  5HLH A;  2F4I A;  4I76 A;  4GYG A;  4LLG F;  4RLF A;  4I0B A;  2DMU A;  3TO6 A;  2X6Y A;  3S16 J;  4IRI A;  2WAQ N;  3H9Q A;  4O3M A;  3I58 A;  5LLQ A;  4HOB A;  4QPO A;  2ZFU A;  5LFA A;  1G8X A;  3SDG A;  4KMF A;  2DW4 A;  2LKX A;  2DDA A;  2HZT A;  1HW5 A;  3MMY B;  1LQ1 A;  4ESJ A;  4FHT A;  2O6G E;  4DJA A;  3PNT A;  2E60 A;  1ACI A;  2X6O A;  2KRH A;  2L0K A;  4HA8 A;  3QYE A;  3IH3 A;  1ETW A;  3V4G A;  2NAZ A;  4XLP F;  3D5S C;  2JSC A;  3SZP A;  1BOA A;  2AXT C;  2BVM A;  4XBF A;  5GAE J;  2EPF A;  2PMU A;  3EUH A;  3BR5 A;  4U87 A;  3V7C A;  5LHI A;  1JKQ C;  4RB1 A;  1VQ4 I;  4PJJ A;  1LDK B;  3ZMZ A;  5KAF C;  2XSD C;  3VSL A;  3KE2 A;  2E1C A;  3JTH A;  4S05 A;  1EH7 A;  3S1N J;  2CS3 A;  4L5E A;  4A3F J;  1XDS A;  2ZJR F;  3S17 J;  2GOM A;  2KPM A;  4PCQ A;  2D1H A;  2DYR H;  3RZD J;  1JTX A;  5FLX K;  5F64 A;  3QQA A;  4IPA A;  3TMO A;  5H6Q A;  2DTZ A;  2FMY A;  5GPC A;  4HF1 A;  4IHW A;  2LF8 A;  1K78 A;  3HG9 A;  1KA8 A;  1MBK A;  2NXN B;  1WI3 A;  4BE2 A;  1ZK8 A;  1HLV A;  4J00 A;  5D5U B;  1VFC A;  2IPQ X;  3OYH A;  2IS6 A;  1TT5 B;  4D9J A;  2GZW A;  1FYM A;  2DOF A;  2XPU A;  3GX4 X;  2CG4 A;  3CTA A;  4EJW A;  2CYY A;  5DEQ A;  1XCV A;  4FCY A;  1BC8 C;  3HUG B;  1JTY A;  1R5H A;  3QYB A;  2DU9 A;  2LR8 A;  2BXZ A;  1AKH B;  4C2T A;  3W2V A;  3OL3 A;  3CDL A;  3VYU B;  2W4S A;  2OJE D;  3BT9 A;  1HBX G;  2EZI A;  2LLK A;  2V1N A;  4DBR A;  3HOS A;  2BY2 A;  2RQP A;  2BVL A;  2DA3 A;  2Y9Y A;  1Z3X A;  1BN5 A;  2FA5 A;  4EJO A;  2LKP A;  5J8F A;  5JHU A;  4MQ9 F;  4A69 C;  3M4O J;  2IGK A;  1H89 C;  2R7D A;  5JI6 A;  4HAM A;  3QP6 A;  2VUM J;  2O0Y A;  4U0V A;  5TRD A;  5IPA A;  3E5Q A;  2A61 A;  2ECC A;  2VJ4 A;  4XLA A;  3IRQ A;  2W7N A;  3FXR A;  4IRH A;  4XMY A;  2R5Z A;  1T2K A;  2R5Y A;  3IWZ A;  4UUT A;  1UMQ A;  3CMM A;  1O3R A;  1F1Z A;  2CO5 A;  2VE9 A;  3FKI J;  1H8A C;  4IL6 C;  3HOV J;  2W00 A;  3GFM A;  4LB6 B;  1U6G A;  1G2H A;  1TBX A;  3MAJ A;  2V7F A;  2HEO A;  3ZMV A;  3K4J A;  3WHB A;  4XIC A;  1K4T A;  4HNT A;  3FK7 A;  2XAS A;  4YFX F;  1ZGA A;  3DKW A;  2VI6 A;  1ZH5 A;  2A5Y B;  5K1Y A;  1R1V A;  1WFX A;  1BW5 A;  3U1K A;  4LB5 A;  4OIO F;  4M74 A;  3ZQG A;  1LFB A;  3Q5F A;  2O9L A;  5ILU A;  1K6O A;  2H1K A;  3BCA A;  2IAI A;  3Q0V A;  4F91 B;  5D5W B;  5GTH C;  3IKT A;  4HYE A;  2DQR A;  4IHS A;  1JKO C;  4MLO A;  3K4K A;  1BR4 A;  1WJA A;  4I7H A;  2CQK A;  1W0U A;  1A6I A;  3BG7 A;  1EJ9 A;  5JVT A;  5K5Q A;  2HU9 A;  1AHD P;  2EIN H;  1FSE A;  4OMY A;  3K1N A;  4HV5 A;  3SEZ A;  1F36 A;  1SFO J;  2CUJ A;  3M3Y J;  4Y4R A;  3U9G A;  4R79 A;  2LRD A;  4I98 B;  4OU0 A;  1QVU A;  2UXX A;  4U7D A;  2XV4 S;  2X48 A;  1OCR H;  5TGT A;  1ZRF A;  3HIF A;  4C3H J;  2ELK A;  5EG0 A;  4IOA F;  1AKH A;  3GUD A;  3P9K A;  2ZSH B;  1A04 A;  1XG1 A;  1YX5 A;  3K2Z A;  4ZDL A;  3CCE I;  4CZZ A;  3S93 A;  2FBK A;  2BOL A;  2JMW A;  3CCS I;  1BC7 C;  4Z6Y A;  2OPT A;  2COM A;  3CO6 C;  1QRY A;  2IA0 A;  1IO2 A;  3I71 A;  2NS7 A;  2JVG A;  1UG2 A;  3IP4 B;  4P55 A;  4UVB A;  1G4D A;  1SD7 A;  5M3F J;  3IKV A;  3MZH A;  4E7H A;  1WJE A;  2FOW A;  3SYT A;  1WWX A;  2TCT A;  2D45 A;  4LK0 F;  1OYW A;  4N4N B;  4HZF A;  2IVM A;  2PEX A;  2X1C A;  1CQT A;  5BPD A;  2VOO A;  3BPX A;  4II2 A;  1C0W A;  2DK8 A;  4E7S A;  3VEP A;  2M7B A;  3VFZ A;  4ANJ A;  4BBS J;  3OS2 A;  2JVH A;  4Q4Z F;  3DEU A;  1XTA A;  2PQ8 A;  1Y56 A;  3JR9 A;  2BW3 A;  2OV7 A;  2XF7 A;  1FBS A;  2XDV A;  1OFC X;  4PJL A;  1MSF C;  4D0P A;  1RRJ A;  2M4G A;  4YII A;  4HDV A;  4OIR F;  2VOD A;  1W0T A;  2KFD A;  3BOQ A;  3H0D A;  3OSF A;  3GEZ A;  2PJR B;  1UFM A;  2ZXJ A;  4AIJ A;  3AFH A;  1OLT A;  3L2U A;  5IOZ A;  3RZO J;  3A2K A;  1HDP A;  4IZZ A;  4BNC A;  3PSF A;  4ZYH A;  3EUK L;  3D5L A;  5A2Q K;  1IUY A;  2EA4 A;  2IGN A;  1QZE A;  1W1W E;  2CMP A;  2H94 A;  2XGE A;  5TIS C;  1TZL A;  4CHU A;  2Z1D A;  2QLZ A;  3NRV A;  4GCV A;  3RYP A;  3HB9 A;  3KYD B;  3PNY A;  2QEX I;  3A0B C;  3BG3 A;  1V4R A;  5EZH A;  2VC1 A;  2IS1 A;  4ZZL A;  2M30 A;  2QKL B;  2OC6 A;  3TKY A;  1TWC J;  5L3F A;  2R7Z J;  1OCT C;  3E5U A;  1QU3 A;  5DUK A;  5ICC A;  3HOU J;  2CW7 A;  1E17 A;  3HYI A;  2JUG A;  1LVA A;  3ABT A;  1XSX A;  1MMA A;  3TGN A;  1ZLJ A;  3GZ5 A;  5CYV A;  1ITY A;  4TV7 A;  3BG6 A;  5FO5 A;  1UHW A;  1RPW A;  3FX3 A;  2HQ5 A;  3WG9 A;  3RKQ A;  4CCK A;  3TED A;  1VTN C;  2K4J A;  2Z16 A;  3RYR A;  3BWG A;  1ODD A;  4E7I A;  4F7Z A;  2RRE A;  4XN0 A;  5B1B H;  1A6Q A;  3DQV C;  2W24 A;  3L1P A;  5HOO A;  1R22 A;  2UXN A;  3G73 A;  2FOK A;  3DPU A;  5B3S H;  3JRH A;  2K7L A;  4ESF A;  1YS7 A;  4L5I A;  1HDD C;  4KIB A;  5J47 A;  1NG7 A;  1ZR4 A;  1FX7 A;  1FOY A;  2KIF A;  2OCC H;  1MD0 A;  2F5F A;  3OYB A;  1FLI A;  4E7L A;  1UEL B;  4MNU A;  2P5V A;  3GME A;  4QPQ A;  1SFU A;  5FLV A;  3WGI A;  2WB1 N;  5CKT A;  3BPV A;  3L2C A;  4EV0 A;  4EM1 A;  1P7I A;  4CCN A;  1DP7 P;  1J9I A;  1RET A;  4B3A A;  3F0C A;  3DPL C;  5EYR A;  2IA1 A;  1CF7 A;  2LF7 A;  2CW0 F;  4IJA A;  3E6C C;  1UAA A;  3BJO A;  3HKZ N;  3W6J B;  3OYC A;  3ABM H;  2X1E A;  4G6Q A;  1JJ6 C;  2UV1 A;  3HOT A;  2ELJ A;  3PUB A;  1X2N A;  5K7F A;  2M87 A;  4IQ4 A;  4JYK A;  2YS9 A;  3JRA A;  3SDB A;  5IP7 J;  1JUP A;  1ONV A;  2V9P A;  3L9F A;  1ETV A;  1XPX A;  1QA6 A;  1J75 A;  4N0B A;  5JHF A;  2H09 A;  3GZ6 A;  1P4A A;  4BHC A;  4FQG A;  1J09 A;  3LSH A;  4FE7 A;  3A01 B;  3GTQ J;  2Q0O A;  2Y2Z A;  4HLX A;  2EBI A;  2YUS A;  3E97 A;  4RDU A;  3VDX A;  2PJR A;  4RGX A;  4BL0 B;  2HXO A;  2E36 A;  3AAF A;  2IEK A;  2JSP A;  4UV9 A;  4BKX A;  2FBH A;  2EZH A;  2FNP A;  4BY7 J;  2DT6 A;  2V6E A;  3TW6 A;  2PN6 A;  3R4K A;  1V55 H;  1X1B A;  3H3Z A;  1YJ9 I;  4A3D J;  3TDZ C;  2KRC A;  3LL7 A;  2LBF A;  3WU0 A;  5FRM A;  3VB2 A;  2GA1 A;  2WAD A;  3FIW A;  1S7A A;  3ZXS A;  2DFI A;  5ICF A;  2XC7 A;  1ZG1 A;  3FK6 A;  1MND A;  4XKC A;  4C3J J;  5AIQ A;  5FGM A;  1Y8R B;  2O5R A;  5FFZ A;  3DLL F;  5GTI C;  3QWL A;  1LFU P;  3S1M J;  2QQ8 A;  3JSO A;  4R1H A;  1HA8 A;  2Q8K A;  5B1A H;  2E5N A;  4EQQ A;  4ZTJ A;  3GTM J;  2X6W A;  4AWX B;  4IO9 F;  2E2I J;  3D1N I;  2E19 A;  1MNE A;  3BZ6 A;  3CMA I;  2VL8 A;  1YIJ I;  2PG4 A;  2MH2 A;  2ZFW A;  3F8F A;  4B47 A;  1TC3 C;  2Z9O A;  2Y0M A;  4E7J A;  3S2H J;  2W57 A;  2CQQ A;  1HSJ A;  4YEL A;  5L3D A;  4ZC3 A;  2YSR A;  3LAP A;  1KU7 A;  2XUB A;  1B72 A;  3KZY A;  3QPS A;  3CD6 I;  4PK4 A;  3CO7 C;  1GV2 A;  4KIT B;  3MD2 A;  3HTS B;  1I3A A;  1SC7 A;  4LG3 A;  2CFO A;  1OCC H;  2LYC A;  2DCE A;  5EJC A;  1RKT A;  3QP5 A;  1P2F A;  4A0X A;  2H1L A;  4KIS A;  2JN6 A;  1X3W B;  1IRX A;  4PGH A;  2XPW A;  1RIO H;  1WRJ A;  4EAT A;  4C2U A;  3GTP J;  5D6E A;  2Z99 A;  5CJ9 A;  4KIF A;  5GPA A;  2AS5 F;  1BI3 A;  1L3L A;  3OS1 A;  3LSI A;  4L9V A;  3M7G A;  3K4C A;  5IYB J;  2H27 A;  2ZSI B;  3R6S A;  5LRR A;  1K61 A;  2GBY A;  2K40 A;  2LH9 A;  2KDO A;  2FF4 A;  1D1C A;  1PYV A;  2FUG 2;  2YPR A;  4EEF G;  2HTJ A;  1SAN A;  4DNC A;  4ESB A;  3OIO A;  3QAH A;  4UV8 A;  2VT3 A;  2DBB A;  2KIQ A;  2OAZ A;  3BR0 A;  3BZK A;  4HX4 A;  3TL4 X;  5E1W A;  5E17 F;  1I1G A;  2CUZ A;  3OYL A;  1ZLK A;  1B9M A;  5HS7 A;  4BQQ A;  3LSJ A;  3BJA A;  4E7K A;  2M7A A;  2XHK A;  2A3S A;  4QWQ A;  3K1P A;  2DTR A;  4CUG A;  5C44 J;  2CGP A;  1ZR2 A;  1ETK A;  3L2W A;  2TDX A;  1YW8 A;  1LVK A;  3V7R A;  4BJ5 C;  5CLS A;  4I6Z A;  3CC2 I;  3BQY A;  2XGX A;  1OJL A;  3LSP A;  1A5J A;  3LNQ A;  4RGS A;  2N8G A;  4KT6 A;  4MFE A;  4B3X A;  1BIB A;  4L5J A;  2XAU A;  2K5C A;  4M3B A;  1IJW C;  2VKE A;  3W6V A;  3MVP A;  2DJN A;  3HM5 A;  4P9U A;  3WTW C;  3FF5 A;  2I5U A;  5EGO B;  2RVC A;  1XGN A;  2XF5 A;  3TO9 A;  2R93 J;  3DF8 A;  1AWC A;  3ZN1 A;  1FMV A;  2GXA A;  4YRV A;  3VSK A;  3O8H A;  4E70 A;  2DA6 A;  3BDD A;  3V7S A;  1OYY A;  1ZEL A;  3HUG A;  2B63 J;  3AG1 H;  3C1D A;  1TNS A;  3WGG A;  5IYD J;  1RZ4 A;  1STZ A;  3M8E A;  4JP0 A;  2ID6 A;  3ABK H;  2VQG A;  1K83 J;  4HST A;  4XLC A;  1MGT A;  4HNU A;  2EFP A;  2HPM A;  3OYN A;  2JRM A;  1GT0 C;  4MHG A;  4P5O A;  2FQ3 A;  1POG A;  3ABL H;  1JI8 A;  4YFK F;  1R36 A;  3WE2 A;  1USS A;  2F5E A;  2JPB A;  2R7W A;  5F6F A;  4B48 A;  1J5Y A;  4DYQ A;  2MAB A;  2BGC A;  1O3T A;  3LAJ A;  4Y33 A;  5ILV A;  2KMU A;  3HHG A;  2D1V A;  4LK1 F;  2IJL A;  3VYT B;  3DCF A;  1P6R A;  1P4W A;  5GAH J;  3WG7 H;  2DMT A;  2VQL A;  3FMR A;  1UCR A;  5FKO A;  2WTE A;  1I3Q J;  2NNY A;  2QCO A;  3BR3 A;  5E3N A;  4BDY A;  5E20 A;  2W82 A;  4CCJ A;  4KJZ A;  2DI3 A;  3K4L A;  2STW A;  1WZ2 A;  4JX5 A;  3FXL A;  1W5S A;  1O3S A;  2LSO A;  3M1E A;  4RMN A;  4BHB A;  1TWH J;  4XM3 A;  4GFB A;  1TQM A;  2DA1 A;  3I53 A;  5D6F A;  3JRB A;  3F6O A;  2F5C A;  4A3M J;  2F2E A;  1H9T A;  2W25 A;  3HSE A;  2CUE A;  4PJN A;  2PJP A;  4KA4 A;  4J19 A;  3I0T A;  4WX9 A;  2A6T A;  4II3 A;  3K1M A;  3LA3 A;  2OA4 A;  2AQF A;  2CRG A;  3R60 A;  2ISY A;  4ZYE A;  5LGT A;  5IT9 K;  3GO5 A;  1R4M B;  2KQR A;  4A0Y A;  2Y75 A;  1APL C;  3BG9 A;  2G9W A;  3BRO A;  4FE4 A;  3AG4 H;  1SD4 A;  2DA2 A;  2RDP A;  5F0H A;  4BQN A;  5JLW A;  1ZAO A;  2MW8 A;  1EH6 A;  2O7O A;  2DAO A;  2K9L A;  5HDN A;  3NEU A;  4M3F A;  2WV1 A;  2BY1 A;  1LJ9 A;  5FKL A;  2EZK A;  3W2W A;  2UZK A;  1OYI A;  4PFO A;  4A5M A;  4MFD A;  2JA5 J;  3K4B A;  4RGU A;  3WU1 B;  2L4M A;  3S3N A;  1B59 A;  2OZ6 A;  2WC2 A;  4OAZ A;  3Q0U A;  1T38 A;  4A93 J;  3EDP A;  1S5L C;  2PX9 A;  3KLN A;  4HBL A;  3J81 K;  3V8J A;  1YLF A;  5J6X A;  3HRT A;  4EMS A;  3SZT A;  5DM7 F;  1A31 A;  2FE3 A;  4A3K J;  2VBY A;  3H1C A;  4DGW B;  2VXD A;  3BR6 A;  3CME I;  4WXH A;  1X1A A;  3G1M A;  2WY7 Q;  2Y48 A;  3FXO A;  1A36 A;  3CJN A;  3KCC A;  2MYS A;  2E1N A;  3BJ6 A;  4LD5 A;  5L3G A;  1MDM A;  2Z33 A;  5FRO A;  1BI2 A;  1W5C C;  2ZME C;  3CUQ A;  3H3U A;  1FEX A;  4LIU A;  1BR2 A;  3L09 A;  4UUS A;  2ZJP F;  4Y3O A;  3AL0 B;  2K4B A;  1D1A A;  4UUV A;  2BBY A;  2DT7 B;  4A3L J;  4D5F A;  2MFZ A;  1QBJ A;  1RUO A;  3ECO A;  3QOE A;  4JX6 A;  1S72 I;  3DV8 A;  1W7P D;  1T08 B;  2XKO A;  3ZQI A;  2KDZ A;  1GXP A;  4KT5 C;  2XAH A;  3IAS 2;  4FX0 A;  3MFK A;  3U1D A;  3DTE A;  3H9J A;  3HSF A;  3ZN0 A;  3SFI A;  2HOT A;  3EYI A;  3WE3 A;  5IP9 J;  2JA7 J;  3CJR B;  4NBQ A;  3S8P A;  1VQN I;  2BEO A;  1LB2 A;  4G94 A;  4BAY A;  3OYD A;  2M0C A;  5K5R A;  1YIT I;  3MEX A;  1MMG A;  2XB0 X;  4NQW A;  1YO5 C;  4GDF A;  3OYI A;  4XOR A;  2L9R A;  1EV7 A;  4DOZ A;  3OV8 A;  2HR3 A;  2VB6 A;  4A6D A;  2VAS A;  2VKV A;  4CH7 A;  3CUQ C;  1X4P A;  5HLT A;  2NVQ J;  1QPM A;  5DDG A;  1FJL A;  5CQG A;  2OQR A;  4ASN A;  5DUI A;  2HTS A;  5ICE A;  2LY9 A;  5EDN A;  4LIT A;  1WH5 A;  5DCF A;  1IV6 A;  3VYS B;  1QO0 D;  1ZG3 A;  1XMX A;  4MTE A;  2WV0 A;  5E3L A;  2YX7 A;  2EIM H;  1LE8 B;  2Y69 H;  1LUJ B;  3E0J B;  3N4M A;  5B66 C;  4M3D A;  4BQA A;  2HXI A;  2HI3 A;  4KFC A;  1Y1W J;  3X2Q H;  5AIP A;  1K7A A;  2DOA A;  1JKP C;  1VI0 A;  3NWS A;  3S2W A;  1TQI A;  3CF2 A;  3FHZ A;  3B73 A;  3OOP A;  1ON2 A;  2HYG D;  3Q9V A;  4KUM A;  4RM3 A;  1T39 A;  1AOY A;  2XPV A;  3I9V 2;  3ZGK A;  2H6B A;  3DFG A;  5IP6 A;  2DLL A;  2R7X A;  3QYF A;  4R8H A;  4L9J A;  5F0C A;  1IN8 A;  2HS5 A;  1MIJ A;  4HF0 A;  1MSE C;  2FML A;  1I39 A;  3ZR8 X;  1WJC A;  3CP8 A;  3DXJ F;  3GFI A;  3ZQL A;  2P6S A;  4BYY A;  3GLL A;  5FKN A;  3TDU C;  4CA0 A;  4HV6 A;  3TO7 A;  3ERE D;  2OUM A;  2XVC A;  2A68 F;  1JGS A;  1ZG5 A;  3C3W A;  3H9G A;  2PMH A;  3K70 D;  1QPI A;  2LNB A;  2V26 A;  2K9S A;  1X1C A;  2HDC A;  2RV8 A;  4BAC A;  1U5T C;  4G12 A;  5FRN A;  5E3O A;  2NOJ B;  1FOK A;  3BTI A;  2VE8 A;  1H9G A;  1D8K A;  1S29 A;  3H92 A;  1IF1 A;  4BH9 A;  3HPH A;  4XON A;  4PUS A;  5K7H A;  4A3E J;  4M6Y A;  1VQL I;  2ISZ A;  3L2Q A;  4XRS A;  3RJP A;  3H3V K;  4MQV A;  3WTZ A;  2DXI A;  4A3C J;  1DP3 A;  1XD7 A;  3OL4 A;  4QIW N;  4XR6 A;  3LQR A;  5HS8 A;  3HKZ A;  2F5D A;  4D7N A;  3PO2 J;  4RB3 C;  1CF7 B;  2HVS A;  5LHH A;  3GWZ A;  3IH4 A;  1X58 A;  4BUP A;  4ENM A;  4M9Z A;  1E0E A;  2E34 A;  1OIS A;  4B8X A;  3CCQ I;  2ELH A;  3HBL A;  1PUF A;  1E3H A;  3GW2 A;  3BY6 A;  3F3X A;  2HNH A;  2UWM A;  1Z1D A;  1U0J A;  1ON1 A;  1T98 A;  5E8I A;  1DU0 A;  2FX0 A;  2A69 F;  3W6K B;  3KEO A;  2ZB9 A;  1HST A;  3KP7 A;  4AVP A;  3OSG A;  1IG7 A;  5HOD A;  5FLM J;  4AD9 A;  3BP8 A;  4KIC A;  3SXY A;  4NC7 A;  3H5A A;  4A12 A;  3FMQ A;  2DYS H;  1I27 A;  1T56 A;  5D5V B;  4U0Y A;  3OYM A;  1XMK A;  1J2X A;  2EIJ H;  2V79 A;  1E2X A;  4ZDO A;  2K27 A;  2O8K A;  3I59 A;  5KK1 A;  3L2V A;  1G3Y A;  4AYB A;  3PIP F;  1U3E M;  1TW3 A;  4W1U A;  1X2M A;  1MW7 A;  2Y9Z A;  4BS9 A;  3CCV I;  3C2H A;  2QQB A;  2AXL A;  2OF7 A;  3JCU C;  3T8R A;  4H0E A;  5IT9 Z;  3KZZ A;  5F08 A;  4ENK A;  2R7O A;  1JHF A;  2F4M B;  3E6M A;  4BE1 A;  4PJ0 C;  2QSH X;  2M5W A;  1VQ9 I;  5GP9 A;  3PIO F;  4M6X A;  1LNW A;  5J4V A;  1ZAR A;  3ISP A;  1Z7U A;  3NQO A;  3CCR I;  1TQP A;  3QPT A;  2QBY A;  2XRO A;  4GO1 A;  4B43 A;  2IS2 A;  2LKS A;  3C7J A;  1IUF A;  1ORK A;  3VPR A;  4KYW A;  2EIK H;  3I4P A;  1XB4 A;  5EF6 A;  3JAM K;  3CLO A;  3RCO A;  4BXF A;  3IHU A;  2ZJQ F;  2DPU A;  2LK2 A;  5DD8 A;  2B7E A;  5BOX A;  2F6C A;  4AUX A;  1B8I B;  5EGO A;  3HTU A;  3ERM A;  2GM4 A;  2QBY B;  2K3P A;  1YW9 A;  4IHY A;  4LIV A;  2WAF A;  4BBR J;  2XRN A;  4M6V A;  1K4S A;  1Y8Q B;  1W36 D;  3E6B A;  4D1Q A;  4JOM A;  2H8R A;  1JXS A;  1XS9 A;  4XN3 A;  1IN5 A;  3GTK J;  3H5N A;  2TRT A;  2QEN A;  2HOE A;  2HVQ A;  2IA2 A;  1HKS A;  1IW7 F;  1BJA A;  1RC9 A;  2KIU A;  2VQH A;  1X3U A;  2JJ7 A;  2MSY A;  2PMZ N;  2F48 A;  5E79 C;  4CCO A;  2OQG A;  3HL2 A;  4G6T B;  1SEU A;  1NK2 P;  1TNT A;  3MN2 A;  5LGU A;  3RKX A;  3LST A;  4PSW A;  4E7Z A;  3ZQQ A;  2HDW A;  2BW3 B;  2XB5 A;  2FSW A;  4F93 B;  3PUF A;  1Z7L A;  1T0F C;  2EFW A;  2DMQ A;  3ZPL A;  4DW6 A;  2JA2 A;  5HNH A;  2QVO A;  5DD4 A;  4ZTF A;  3EYY A;  2VKH A;  1KQ0 A;  2QGU A;  3OWT A;  2YX4 A;  3MCZ A;  4K2E A;  2MD0 A;  3DBL B;  1LFP A;  3CDH A;  3I5U A;  1Z05 A;  4IVN A;  2PBI A;  4BHP A;  1R5G A;  3RIR A;  5J1Y A;  2ZXI A;  3J80 Z;  4NHJ A;  3A03 A;  1MBE A;  3PNV A;  2ETH A;  3O2P E;  5DTD A;  3WTX C;  3JRI A;  2E2J J;  2WAQ A;  2B9S A;  1ZN2 A;  3MWM A;  2ME0 A;  5EEA A;  4AIH A;  2W48 A;  4RBO A;  1Q1H A;  4W97 A;  4XRF A;  1TTY A;  1YS6 A;  1Z0X A;  2DA4 A;  4B4C A;  1W5T A;  2R7F A;  2ESN A;  2JUC A;  2XRL A;  2Z3Y A;  2KT0 A;  2K85 A;  3QU6 A;  1BL0 A;  2R7V A;  2QZ8 A;  2NYX A;  4I0A A;  1H88 C;  3CES A;  1HC8 A;  2JA6 J;  2HQA A;  2ZXH A;  3F8B A;  3FBI B;  4XSX F;  3ZQC A;  2VJ5 A;  3J7A O;  1NTC A;  1U8R A;  4P96 A;  4UB8 C;  4ABZ A;  2D5V A;  5F0F A;  1HKQ A;  1MJB A;  4MO7 A;  2DPD A;  3C2G A;  4A3I J;  3JRC A;  3ULQ B;  1QVT A;  5TJJ A;  1S6L A;  3OIQ A;  3L2R A;  3V8K A;  1ERD A;  3FBN B;  1U9O A;  4ITV A;  1R4N B;  4HSR A;  2R7S A;  1TWG J;  2JZY A;  2JPC A;  5JVG F;  3CZ6 A;  1FY7 A;  2K9M A;  3TW7 A;  1QNT A;  3G4S I;  2YU3 A;  1DQU A;  4RB0 A;  2LY1 A;  4RGR A;  4WCG A;  4QLC U;  2DOE A;  3E5X A;  2O8X A;  3E6D A;  5L3C A;  1DU6 A;  2E1M C;  4M3G A;  4P9F A;  2MD5 A;  1S3J A;  3RKY A;  4XNF A;  4UY8 I;  1HKT A;  2DQL A;  1Z91 A;  1S9H A;  2HYF A;  3I56 I;  4S0H B;  2GA2 A;  3BTL A;  4EVI A;  4U7B A;  2WWY A;  4Y17 A;  1SFK A;  1Y0U A;  3VYR B;  3A02 A;  1SD6 A;  2M2E A;  5L3E A;  2QQA A;  4KIG A;  4IHV A;  5K5O A;  1JUM A;  4DZJ A;  1FMW A;  1I5Z A;  2V1U A;  3B6A A;  2VXZ A;  3FWE A;  4G9Y A;  5GAD J;  4UUS B;  1TL8 A;  2IS4 A;  3CUQ B;  4CDG A;  1U2W A;  4OIP F;  1MH3 A;  1W4M A;  4E4H A;  4XRS G;  2R5Y B;  1FP1 D;  2QF7 A;  4XOP A;  1FP2 A;  2ZNY A;  3M8J A;  9ANT A;  2EH3 A;  1R71 A;  3LMM A;  1F4K A;  2XGC A;  1IN7 A;  2QSF X;  3GF2 A;  2ZXW H;  1XGM A;  2E7W A;  4NUB A;  2XIG A;  4XLH A;  1RNL A;  3HGY A;  4KN4 X;  4OWR B;  1G6N A;  4A3G J;  5DM6 F;  4ENN A;  2EJR A;  4EGY A;  1RUN A;  4FTH A;  3SJM A;  2L01 A;  3VWB A;  4N9I A;  4ON0 A;  2ZNZ A;  5DYM A;  3BC8 A;  2R7U A;  2ZCW A;  3BTJ A;  3K4M A;  4IHT A;  2G0E A;  1MJA A;  2OBP A;  3TQN A;  1N78 A;  2VON A;  2KZV A;  3CCJ I;  3S1Q J;  2CW8 A;  3ZCO A;  2QM3 A;  4LG0 B;  2HKX A;  4F3Q A;  3KP2 A;  1GHC A;  3AL0 C;  5H2F C;  2L9V A;  1FSH A;  4N9H A;  5JR3 A;  4JBA A;  1PP7 U;  2HYJ A;  5L3B A;  2LFB A;  1ZGW A;  4I2O A;  1ZYR F;  3HRM A;  1D8J A;  3D5R C;  2P7C B;  5D4S A;  3KZI C;  3GTG J;  4EGZ A;  3PJR A;  1VQ8 I;  2KL4 A;  2BY0 A;  1JHH A;  2BV6 A;  2W1O A;  1XC5 A;  2CQ7 A;  1E3O C;  4RAG A;  1MBF A;  1VQM I;  1YQA A;  1LKX A;  3HRS A;  4CYD A;  2LVS A;  2HQN A;  2MA3 A;  1JT0 A;  1WJD A;  2EFO A;  3DBH B;  3J7Z I;  1EF4 A;  1R6R A;  2NS0 A;  2P7V B;  1FPQ A;  1G3W A;  3CUO A;  2O3F A;  4LMY A;  5CQE A;  2CSO A;  1GXQ A;  5J40 A;  1BBY A;  3RSN A;  2EV5 A;  4CZC A;  2L4A A;  3JTG A;  1KU2 A;  3PQK A;  2EIL H;  2CUF A;  3QPH A;  1V3F A;  4KN7 X;  3NAU A;  2JQ7 A;  2PI0 A;  5J1U A;  1PP8 F;  1VQ5 I;  4XSZ F;  3OYG A;  3ZMD A;  1FOW A;  2IBD A;  4XLN F;  2FXA A;  5IT3 A;  4RM2 A;  4D7M A;  1FBU A;  3LWF A;  4Q48 A;  3DBR B;  4MGR A;  2L3D A;  1Z6R A;  4HG2 A;  1T8I A;  3GVA A;  1BJZ A;  3F22 A;  2LRE A;  3MKL A;  1Z9C A;  4BXX J;  4MEY F;  4D5C A;  1S7O A;  2OU2 A;  4RS8 A;  2LG4 A;  3QPL A;  4A6E A;  2GXG A;  4X0G A;  2HOS A;  2HFH A;  3OY9 A;  1WKM A;  4NQW B;  4IKF A;  1YRN B;  2A6H F;  2CH0 A;  4PFP A;  4IEJ A;  2R92 J;  2XKP A;  3KX2 A;  3U2R A;  4FT8 A;  3SEQ A;  1TT0 A;  4UXN A;  3S15 J;  4NC6 A;  1YJW I;  1MMN A;  3EPZ A;  1D1B A;  2L2O A;  1X4O A;  4I09 A;  3WTV C;  3I4M J;  2L7M P;  4HDU A;  2MLK A;  4BJT A;  1HW1 A;  1VND A;  5IOY A;  5M5W J;  2IT0 A;  2KHM A;  1B9N A;  5H6R A;  3DWL E;  1HW2 A;  1N75 A;  5E1Z B;  4CSW A;  1B4A A;  2DO7 A;  5E18 F;  2XSJ C;  1AA7 A;  1MNM C;  1REP C;  1IN4 A;  2ICW G;  3CJT B;  1LEB A;  1Y6I A;  3BTC A;  3CJQ B;  1N77 A;  4MIM A;  2HKO A;  5J4Y A;  5FD6 A;  5LHG A;  4AC0 A;  2XAG A;  3BR2 A;  3E7L A;  3IAM 2;  3HDD A;  3KET A;  4M73 A;  3RTR A;  1B1B A;  2FD5 A;  4OAY A;  2J5P A;  4JK1 X;  4BGD A;  2VJJ A;  1IRG A;  1ZKG A;  5D5X B;  4LLN A;  4IOC F;  2M8E A;  1SFE A;  5KNL A;  3F8M A;  3K9T A;  4EM0 B;  5LRS A;  1DGR M;  3KP4 A;  2MH9 A;  2K9N A;  4CXF A;  3FZV A;  1R7J A;  2M4K A;  3F8C A;  2VQC A;  3ZMT A;  1FC3 A;  3CQZ J;  5DCM B;  3TP0 A;  3ABU A;  1LDJ A;  1QHG A;  2QWW A;  4XL9 A;  1MMS A;  1HQC A;  3TBI A;  2VPR A;  3H36 A;  5LEJ A;  3K69 A;  3KYL A;  3S3M A;  2VOP A;  3CCM I;  1UZC A;  2O03 A;  3KP5 A;  3PL8 A;  4G6D A;  3WTU C;  4CIC A;  2KIM A;  1IXS B;  2L7K A;  3JRF A;  3GBG A;  2QSG X;  3FMS A;  1D0Z A;  3GFJ A;  4V2G A;  3G71 I;  2L02 A;  1B6A A;  2ZC2 A;  1QZY A;  2VC0 A;  3BZC A;  5CVU A;  1R5I D;  4WXD A;  4G7H F;  1TP4 A;  3WTS C;  1V5F A;  2DK5 A;  1YIO A;  3ZQF A;  4QTR A;  1X1D A;  1X1P A;  3N05 A;  3BCB A;  4EM2 A;  5C4J J;  2OCE A;  4B1R A;  5KHD A;  1Q1V A;  2GLO A;  1OR7 A;  1SVM A;  2ECB A;  2DFF A;  3HGG A;  3LSM A;  4XQF A;  1YHQ I;  3KEQ A;  3P7N A;  2PFB A;  3OMY A;  2EV0 A;  5JLX A;  2CJJ A;  3ZQ7 A;  2KP6 A;  1TWA J;  5DCM A;  5ICG A;  1MBG A;  2MC4 A;  1AU7 A;  2Y31 A;  1IDY A;  2P0W A;  3ZRG A;  2I10 A;  4P1W A;  2P81 A;  4BY1 J;  3C18 A;  1X19 A;  1OR7 C;  3O8G A;  2ZO4 A;  5BQT A;  4UNO A;  4AIK A;  2RQQ A;  4MEX F;  3GCM A;  3GYH X;  2XAQ A;  2JK3 A;  2E1O A;  2NVT J;  2CV1 A;  2H6C A;  2RNJ A;  2EQR A;  3G3Z A;  2LY2 A;  5E1X A;  1MMD A;  5FJ8 J;  4RLQ A;  3WU2 C;  3CDI A;  5BS6 A;  3OYF A;  1MKM A;  1LE8 A;  3FM5 A;  1NH3 A;  4V19 K;  4E6K G;  5HDG A;  2NOG A;  2D2W A;  5BMZ A;  1IC8 A;  2ACJ A;  2EB7 A;  5CVR A;  4HLY A;  4EJT A;  4NNJ A;  4CYC A;  1VQ6 I;  2KIS A;  3HSR A;  4AM3 A;  2X85 A;  1BI0 A;  2DA5 A;  1EH8 A;  5C3E J;  4YIR X;  3QOD A;  3JRD A;  1R49 A;  2K3F A;  2DJI A;  2ZJ2 A;  4RAY A;  1OQY A;  4BE0 A;  1IRF A;  1RKW A;  5ED4 A;  3U21 A;  2NS8 A;  3DP7 A;  4L0Y B;  2RC4 A;  4F92 B;  5LD2 C;  2CQX A;  3J7A Y;  2GIV A;  5BPI A;  1F43 A;  3IC7 A;  1J0R A;  2NNN A;  2Y0S A;  3RQI A;  1U5T A;  4XKV A;  3S32 A;  1KZH A;  4L9N A;  2MBF A;  2HWV A;  1RR7 A;  3J7Y J;  1OCP A;  2NVY J;  3NAR A;  5HLG A;  4YFN F;  1QHH D;  2EFN A;  1XSV A;  4PZJ A;  5JFR A;  1SVO A;  4N4O B;  1SMY F;  2OTJ I;  4PSX A;  3IUO A;  4BJ6 C;  2JWT A;  1KGS A;  1MZB A;  2V4J C;  1S7E A;  3IV5 A;  1IN6 A;  2P5L C;  1VQP I;  4MTD A;  1WJ5 A;  3K7A J;  4ZYD A;  4M9S A;  3EQL F;  3MKW B;  2F4O B;  1T0F A;  2FEZ A;  4YIF A;  4OIN F;  2M9H A;  1JJ8 C;  2ZME B;  3DLA A;  4EJU A;  1HXD A;  1RI7 A;  1EA3 A;  2QUF A;  5EEG A;  2FU4 A;  1H0M A;  4H4K C;  4IX7 A;  2XAF A;  3T0Y A;  4BEH B;  1R23 A;  1YX3 A;  3RKW A;  1PDN C;  2P5K A;  5CVI A;  3DKY A;  3LOC A;  2O61 A;  5EZG A;  3HOY J;  1KYZ A;  1IRZ A;  1L0O C;  2CFX A;  4JQF A;  3COA C;  1P92 A;  1FTZ A;  3GZN B;  2CV2 A;  1MBH A;  4OMZ A;  2IXS A;  3REO A;  5ERI A;  2A07 F;  2C6Y A;  4HEA 2;  1D0Y A;  1LPQ A;  2KLO A;  3RPU A;  4GYI A;  2PMZ A;  3SHF A;  2W84 A;  4Q5S F;  1SD5 A;  2V1X A;  5F27 A;  3MKY B;  1UHS A;  3HXL A;  4JX4 A;  3IH2 A;  1T33 A;  2R5Z B;  1FT9 A;  2XGD A;  3HOZ J;  1UST A;  2VBZ A;  2Y30 A;  4LOC A;  2LBF B;  4WXC A;  2VKD A;  2V9K A;  2IGM A;  3B02 A;  5A2Q Z;  2RAE A;  3GLX A;  1K79 A;  2EK5 A;  3DKX A;  4M71 A;  2EA2 A;  1PUE E;  3F23 A;  1P4X A;  2Q1Z B;  1KON A;  5GAG J;  4C3I J;  3I64 A;  1KQ8 A;  3G2B A;  3FXQ A;  2QA4 I;  5D8L B;  2FBI A;  3OS0 A;  3CMY A;  4O6J A;  3ZP5 A;  1PUF B;  2AQE A;  3Q9S A;  1HF0 A;  3S1R J;  5D4R A;  1Z67 A;  5ILS A;  5M5X J;  4ZYG A;  2X6X A;  4B44 A;  3OOU A;  3UNG C;  3BQZ A;  3F6V A;  1R00 A;  4U88 A;  5J8C A;  1U5T B;  4ZJZ A;  4M9X A;  5FLX Z;  1B8I A;  2QQ9 A;  1ETY A;  1B72 B;  1G3T A;  5M5Y J;  3I55 I;  4HF2 A;  5HLI A;  3T5X A;  2G7H A;  3BR1 A;  1GLN A;  3SQN A;  3K70 C;  3K6G A;  1YI2 I;  5FD5 A;  1WHU A;  3NWT A;  4RA2 A;  2JTV A;  3G1O A;  1HCR A;  4Y13 A;  4XKB A;  3OYE A;  3S3O A;  4Z2Y A;  5J3L A;  1KYW A;  1Z77 A;  1A35 A;  4YG2 F;  2HDD A;  2A05 A;  3W2A A;  4BQO A;  1VQK I;  1QZZ A;  2Y0S N;  4S04 A;  2WB1 A;  4DZP A;  4XRM A;  1TWF J;  2GWR A;  5F04 A;  1XSD A;  1FYK A;  2HQR A;  3QOP A;  4KDP A;  2Q2E B;  4IQJ A;  2Q2E A;  3HJE A;  2BE5 F;  4DIQ A;  2E5Z A;  4LGW A;  4HX7 A;  5B5E C;  3OYA A;  1JT6 A;  2Z2S B;  3K10 A;  2BHZ A;  3ZMS A;  3OR2 C;  5FKM A;  4AVZ A;  3OYJ A;  4CO8 A;  1YE9 A;  2FNA A;  1VQ7 I;  2L9N A;  5DS9 A;  1WCM J;  2IP2 A;  2JT1 A;  2L5Q A;  3HPG A;  3TOA A;  1LDD A;  2ZBK A;  3FXU A;  1ETX A;  2R3S A;  3SZG A;  2DFE A;  3ZMU A;  4Q47 A;  4UVC A;  3CCU I;  1U78 A;  1V5G A;  5D8K B;  2HVR A;  5K7Z A;  1Y39 A;  4ZZD A;  4XOT A;  1IV8 A;  1OCO H;  3I54 A;  1OPC A;  3A0H C;  4A3B J;  1BIA A;  3IL2 A;  2R7Q A;  4GRI A;  3B6C A;  1JE8 A;  4KNY A;  3PFY A;  4I01 A;  1SMT A;  3V8L A;  4G8X A;  3ASN H;  3V42 A;  2L7F P;  4RAF A;  1J59 A;  1ZRE A;  2LP0 A;  4C30 A;  1PVE A;  4PGG A;  3KEY A;  3PM1 A;  4UHT A;  2GXB A;  3BG5 A;  2LC2 A;  3E3V A;  1BI1 A;  1FNN A;  2KJB A;  1XGS A;  5HDK A;  1KQ9 A;  3W3C A;  3UR3 C;  1ETQ A;  3JRG A;  4BXU A;  2X1D A;  3F72 A;  2DMP A;  3F8N A;  1KU3 A;  4XKW A;  1DPU A;  2Z5U A;  1F9N A;  1BM9 A;  4RB2 C;  2FRH A;  1I6H J;  4OIQ F;  2M8G X;  2GAU A;  4DBQ A;  1OMI A;  2ZKZ A;  1JUS A;  1CGP A;  3ROU A;  2NRA C;  4I02 A;  3TP3 A;  3G1L A;  2BXY A;  2WA0 A;  2XF6 A;  4LJZ F;  2L7Z A;  3HZJ A;  4FX4 A;  3HRU A;  3KIO A;  1WQ2 A;  2E71 A;  2ME6 A;  1P7J A;  3RPQ A;  3UKG A;  3H35 A;  1ULY A;  2XAJ A;  1O7F A;  2AHQ A;  3ZQH A;  4B09 A;  2K86 A;  3J80 K;  3OIP A;  3H5R A;  5FFX A;  2LTP A;  1DDN A;  5F1J A;  1I6X A;  3H0G J;  1WJB A;  4FET A;  3DTI A;  1R1T A;  1YW7 A;  3FXK A;  1GDT A;  1WGX A;  3K0L A;  2K02 A;  3AG2 H;  2BZT A;  1XCB A;  2ZME A;  4BDZ A;  1ENH A;  3LFU A;  2VIX A;  4HPQ A;  4ZH4 F;  3I4N J;  1DPR A;  4M3E A;  4HNV A; 
#chains in the Genus database with same CATH homology
 3LA7 A;  4DQ2 A;  5HVQ C;  1W7P A;  2IRF G;  4M72 A;  4LLL A;  3RI4 A;  3LA2 A;  3GFL A;  3SFZ A;  4A0Z A;  1LEA A;  2VT2 A;  2G7U A;  2L54 A;  3HHH A;  2E7X A;  2A6E F;  4WK8 F;  3KP6 A;  1D5V A;  4L9T A;  3IRR A;  3EET A;  2HGC A;  2EWN A;  4IF4 A;  5FB2 A;  2RGV A;  1W7P B;  2X4H A;  2EV6 A;  3LFK A;  4ETS A;  3KFW X;  4ENJ A;  4G7Z F;  2KKO A;  5E8G A;  3O3K A;  2EFQ A;  3ML6 A;  2RKH A;  3MQ0 A;  6PAX A;  3WTY C;  4IXA A;  2P8T A;  3I59 B;  4HQM A;  1T6S A;  1TLH B;  2DT5 A;  1MDM B;  2W85 A;  2V9V A;  3L00 A;  4NB5 A;  1WSU A;  1XMA A;  3ECH A;  2CWE A;  4KMU X;  1XGO A;  1I1S A;  3VOD A;  2GQQ A;  1D3Y A;  2MLG A;  4LG0 A;  1O3Q A;  2V1D A;  1UB9 A;  2BYV E;  3KLO A;  3JAM Z;  2VBX A;  3T8T A;  2KJC A;  5EEH A;  3ELK A;  1QQI A;  1YYV A;  4HX8 A;  4A5N A;  4PDK A;  1R58 A;  3VOE A;  3QU3 A;  1F5T A;  2P4W A;  2VN2 A;  4Y15 A;  5LGN A;  3GXO A;  2JRT A;  2PLY A;  3M9A A;  4L0Z B;  1O7L A;  1Z6T A;  1ZHF A;  1J7K A;  1FWZ A;  2KRF A;  3R0J A;  3WTT C;  4RAZ A;  2M1B A;  1ZRC A;  5H20 A;  4UVA A;  2LDU A;  1OKR A;  2VBW A;  2STT A;  2OZU A;  2QYO A;  3DPT A;  3D0S A;  3P9C A;  3WGH A;  3TOB A;  1G3S A;  4HW0 A;  1ZGJ A;  2P6T A;  1GVJ A;  2OD5 A;  1SAX A;  4IRG A;  4HQE A;  2V6C A;  1NHA A;  4GGG A;  1IZ1 A;  3O6B B;  5LBQ A;  1XDU A;  4EJV A;  1FBQ A;  3P9I A;  1XN7 A;  4WWC A;  2ESH A;  3MZY A;  2RN7 A;  4LFU A;  1IXR C;  2IW5 A;  3R0A A;  5DV5 A;  1UHM A;  1KU9 A;  5AON A;  3N97 A;  3PFI A;  1DUX C;  1R1U A;  1FZP B;  1ZRD A;  4WF2 A;  3FM3 A;  3L7W A;  3PQJ A;  1QGP A;  1YTY A;  5KVR A;  1S8N A;  1K78 B;  3QRF F;  2X0L A;  3KP3 A;  3WOD F;  1MJ9 A;  1O57 A;  5CVV A;  1IXC A;  1FYL A;  5LEK A;  1TW2 A;  3T1B A;  1SFX A;  3LQQ A;  1IAW A;  4U0W A;  5HS9 A;  4G7O F;  5CVJ A;  3F21 A;  2J5O A;  2M45 A;  3R61 A;  2B0L A;  1YFH A;  4L18 B;  3RDI A;  3JSP A;  4A2U A;  5F1R A;  2ADU A;  4OOI A;  3JW4 A;  3IWF A;  3J81 Z;  2MC3 A;  4GXO A;  1WI9 A;  4O5V A;  2YR2 A;  3M8F A;  1YG2 A;  5HLH A;  4GYG A;  4LLG F;  4I0B A;  3TO6 A;  4IRI A;  4O3M A;  3I58 A;  5LLQ A;  4HOB A;  4KMF A;  2DW4 A;  2HZT A;  1HW5 A;  1LQ1 A;  4ESJ A;  4FHT A;  2O6G E;  4HA8 A;  3V4G A;  2NAZ A;  4XLP F;  2JSC A;  3SZP A;  1BOA A;  4XBF A;  2PMU A;  3EUH A;  3V7C A;  5LHI A;  4RB1 A;  1LDK B;  3ZMZ A;  3KE2 A;  2E1C A;  3JTH A;  4S05 A;  1EH7 A;  1XDS A;  4PCQ A;  2D1H A;  5FLX K;  5F64 A;  4IPA A;  5H6Q A;  4HF1 A;  2FMY A;  2LF8 A;  1K78 A;  1KA8 A;  5D5U B;  2IPQ X;  2GZW A;  1FYM A;  3GX4 X;  2CG4 A;  3CTA A;  4EJW A;  2CYY A;  5DEQ A;  1XCV A;  1BC8 C;  1R5H A;  2DU9 A;  1HBX G;  3HOS A;  2RQP A;  5J8F A;  1BN5 A;  2FA5 A;  4EJO A;  2LKP A;  5JHU A;  4MQ9 F;  2R7D A;  5JI6 A;  4HAM A;  3QP6 A;  2O0Y A;  5TRD A;  3E5Q A;  2A61 A;  3IRQ A;  3FXR A;  4IRH A;  1T2K A;  3IWZ A;  1O3R A;  1F1Z A;  2CO5 A;  2VE9 A;  3GFM A;  4LB6 B;  1U6G A;  1TBX A;  3MAJ A;  2HEO A;  3ZMV A;  4YFX F;  2XAS A;  1ZGA A;  3DKW A;  1ZH5 A;  2A5Y B;  5K1Y A;  1R1V A;  4LB5 A;  4OIO F;  4M74 A;  3Q5F A;  5ILU A;  1K6O A;  5D5W B;  3IKT A;  4HYE A;  2DQR A;  4IHS A;  4I7H A;  2CQK A;  5JVT A;  5K5Q A;  1FSE A;  4OMY A;  3K1N A;  4HV5 A;  3U9G A;  4R79 A;  4I98 B;  4OU0 A;  2UXX A;  4U7D A;  2XV4 S;  1ZRF A;  3HIF A;  3GUD A;  3P9K A;  1A04 A;  3K2Z A;  4CZZ A;  2FBK A;  1BC7 C;  2COM A;  3CO6 C;  2IA0 A;  3I71 A;  4P55 A;  1G4D A;  4UVB A;  1SD7 A;  3MZH A;  3IKV A;  1WWX A;  2D45 A;  4LK0 F;  1OYW A;  4HZF A;  2IVM A;  2PEX A;  5BPD A;  2VOO A;  3BPX A;  1C0W A;  2DK8 A;  3VEP A;  3VFZ A;  4Q4Z F;  3DEU A;  2PQ8 A;  1FBS A;  4D0P A;  4YII A;  4HDV A;  4OIR F;  2VOD A;  4CGZ A;  3BOQ A;  3GEZ A;  1UFM A;  2ZXJ A;  4AIJ A;  4BNC A;  4ZYH A;  3D5L A;  5A2Q K;  1IUY A;  2EA4 A;  2H94 A;  4CHU A;  2QLZ A;  3NRV A;  4GCV A;  3RYP A;  1V4R A;  2VC1 A;  4ZZL A;  2M30 A;  3TKY A;  5L3F A;  3E5U A;  5DUK A;  5ICC A;  1E17 A;  3HYI A;  1LVA A;  3ABT A;  1XSX A;  3TGN A;  1ZLJ A;  3GZ5 A;  5CYV A;  4TV7 A;  5FO5 A;  1UHW A;  3FX3 A;  3WG9 A;  1VTN C;  2K4J A;  3RYR A;  3BWG A;  1ODD A;  4F7Z A;  3DQV C;  2W24 A;  5HOO A;  1R22 A;  2UXN A;  3G73 A;  2FOK A;  2K7L A;  4ESF A;  1YS7 A;  4L5I A;  4KIB A;  1FX7 A;  2KIF A;  1MD0 A;  2F5F A;  1FLI A;  4MNU A;  2P5V A;  1SFU A;  3WGI A;  3BPV A;  3L2C A;  4EV0 A;  4EM1 A;  1DP7 P;  1J9I A;  3DPL C;  2IA1 A;  1CF7 A;  2LF7 A;  2CW0 F;  4IJA A;  3E6C C;  3BJO A;  3W6J B;  4G6Q A;  3HOT A;  2M87 A;  1ONV A;  3L9F A;  1J75 A;  4N0B A;  2H09 A;  3GZ6 A;  1P4A A;  4BHC A;  2Q0O A;  4HLX A;  3E97 A;  4RGX A;  3AAF A;  4UV9 A;  2FBH A;  2FNP A;  2PN6 A;  3R4K A;  3H3Z A;  3TDZ C;  3WU0 A;  3VB2 A;  2GA1 A;  1S7A A;  2DFI A;  5ICF A;  1ZG1 A;  5AIQ A;  5FGM A;  5FFZ A;  3JSO A;  4R1H A;  2Q8K A;  4EQQ A;  4AWX B;  3BZ6 A;  2PG4 A;  2MH2 A;  2ZFW A;  3F8F A;  2Z9O A;  2Y0M A;  2W57 A;  1HSJ A;  5L3D A;  2YSR A;  3LAP A;  1KU7 A;  2XUB A;  3KZY A;  3CO7 C;  3HTS B;  3QP5 A;  1P2F A;  4A0X A;  4PGH A;  1RIO H;  1WRJ A;  5D6E A;  2Z99 A;  5CJ9 A;  4KIF A;  2AS5 F;  1BI3 A;  1L3L A;  4L9V A;  3M7G A;  2H27 A;  3R6S A;  5LRR A;  2FF4 A;  2YPR A;  2HTJ A;  4DNC A;  4ESB A;  3QAH A;  4UV8 A;  2VT3 A;  2DBB A;  4HX4 A;  2OAZ A;  5E1W A;  5E17 F;  1I1G A;  1ZLK A;  1B9M A;  5HS7 A;  3BJA A;  2XHK A;  4QWQ A;  2A3S A;  3K1P A;  2DTR A;  2CGP A;  2TDX A;  1YW8 A;  3V7R A;  5CLS A;  2XGX A;  4RGS A;  1BIB A;  4L5J A;  4P9U A;  3WTW C;  3FF5 A;  2RVC A;  1XGN A;  3TO9 A;  3DF8 A;  1AWC A;  3ZN1 A;  4E70 A;  3BDD A;  3V7S A;  1OYY A;  3HUG A;  1TNS A;  3C1D A;  3WGG A;  1RZ4 A;  1STZ A;  3M8E A;  1MGT A;  2EFP A;  4MHG A;  4P5O A;  2FQ3 A;  4YFK F;  1R36 A;  3WE2 A;  1USS A;  2F5E A;  2JPB A;  5F6F A;  1J5Y A;  2BGC A;  1O3T A;  3LAJ A;  5ILV A;  3HHG A;  2D1V A;  4LK1 F;  2IJL A;  1P6R A;  1P4W A;  3FMR A;  1UCR A;  2WTE A;  2NNY A;  5E20 A;  2DI3 A;  2STW A;  1W5S A;  1O3S A;  2LSO A;  3M1E A;  4BHB A;  1TQM A;  3I53 A;  5D6F A;  3F6O A;  2F5C A;  1H9T A;  2F2E A;  2W25 A;  3HSE A;  2PJP A;  4KA4 A;  3I0T A;  4WX9 A;  3K1M A;  3LA3 A;  2OA4 A;  4ZYE A;  3R60 A;  2ISY A;  5IT9 K;  5LGT A;  3GO5 A;  4A0Y A;  2Y75 A;  2G9W A;  3BRO A;  1SD4 A;  2RDP A;  1ZAO A;  1EH6 A;  2DAO A;  5HDN A;  3NEU A;  1LJ9 A;  2UZK A;  1OYI A;  4A5M A;  4RGU A;  3WU1 B;  2L4M A;  1B59 A;  2OZ6 A;  2WC2 A;  1T38 A;  3EDP A;  3KLN A;  4HBL A;  3J81 K;  3V8J A;  1YLF A;  5J6X A;  3HRT A;  4EMS A;  3SZT A;  2FE3 A;  2VBY A;  4WXH A;  2Y48 A;  3CJN A;  3KCC A;  2E1N A;  3BJ6 A;  4LD5 A;  5L3G A;  1MDM A;  2Z33 A;  1BI2 A;  3H3U A;  3CUQ A;  3L09 A;  2K4B A;  4UUV A;  2BBY A;  1QBJ A;  1RUO A;  3ECO A;  3DV8 A;  1W7P D;  2XKO A;  1GXP A;  4KT5 C;  2XAH A;  4FX0 A;  3MFK A;  3U1D A;  3HSF A;  3ZN0 A;  3EYI A;  3WE3 A;  2BEO A;  1LB2 A;  4G94 A;  4BAY A;  5K5R A;  3MEX A;  4NQW A;  1YO5 C;  1EV7 A;  3OV8 A;  2HR3 A;  4A6D A;  3CUQ C;  1QPM A;  5DDG A;  2OQR A;  4ASN A;  5DUI A;  2HTS A;  5ICE A;  5DCF A;  1QO0 D;  1ZG3 A;  4MTE A;  2WV0 A;  2YX7 A;  3N4M A;  4BQA A;  4KFC A;  5AIP A;  1K7A A;  3S2W A;  1TQI A;  3FHZ A;  3B73 A;  3OOP A;  1ON2 A;  2HYG D;  3Q9V A;  4KUM A;  1T39 A;  1AOY A;  2H6B A;  3DFG A;  2DLL A;  4R8H A;  4L9J A;  1IN8 A;  2HS5 A;  4HF0 A;  2FML A;  3DXJ F;  3GFI A;  2P6S A;  4BYY A;  3TDU C;  4HV6 A;  3TO7 A;  3ERE D;  2XVC A;  2A68 F;  1JGS A;  1ZG5 A;  3C3W A;  2PMH A;  2LNB A;  2HDC A;  2RV8 A;  1U5T C;  1FOK A;  2VE8 A;  1H9G A;  1D8K A;  1S29 A;  3H92 A;  1IF1 A;  4BH9 A;  4M6Y A;  2ISZ A;  3RJP A;  4MQV A;  3WTZ A;  1XD7 A;  3LQR A;  5HS8 A;  2F5D A;  4RB3 C;  1CF7 B;  5LHH A;  3GWZ A;  4ENM A;  4M9Z A;  4B8X A;  2ELH A;  3GW2 A;  3BY6 A;  3F3X A;  2UWM A;  1Z1D A;  1ON1 A;  1T98 A;  5E8I A;  2A69 F;  3W6K B;  3KEO A;  1HST A;  3KP7 A;  4AVP A;  4AD9 A;  3BP8 A;  4KIC A;  3SXY A;  4A12 A;  3FMQ A;  1I27 A;  5D5V B;  4U0Y A;  1XMK A;  1J2X A;  2V79 A;  1E2X A;  2K27 A;  3I59 A;  5KK1 A;  1G3Y A;  1U3E M;  1TW3 A;  2QQB A;  2AXL A;  3T8R A;  4H0E A;  5IT9 Z;  3KZZ A;  4ENK A;  1JHF A;  3E6M A;  2M5W A;  4M6X A;  1LNW A;  1ZAR A;  3ISP A;  1Z7U A;  3NQO A;  1TQP A;  3QPT A;  2QBY A;  2XRO A;  4GO1 A;  3C7J A;  4KYW A;  3I4P A;  1XB4 A;  3JAM K;  3CLO A;  3IHU A;  2DPU A;  5DD8 A;  5BOX A;  3HTU A;  2QBY B;  1YW9 A;  2XRN A;  3E6B A;  1JXS A;  1IN5 A;  2QEN A;  2HOE A;  2IA2 A;  1HKS A;  1IW7 F;  1BJA A;  2KIU A;  1X3U A;  2OQG A;  1TNT A;  5LGU A;  3RKX A;  3LST A;  2FSW A;  2EFW A;  3ZPL A;  2QVO A;  5DD4 A;  3EYY A;  1KQ0 A;  4K2E A;  2YX4 A;  3MCZ A;  3CDH A;  3I5U A;  1Z05 A;  4IVN A;  2PBI A;  4BHP A;  1R5G A;  3RIR A;  3J80 Z;  4NHJ A;  2ETH A;  3O2P E;  3WTX C;  1ZN2 A;  3MWM A;  4AIH A;  1Q1H A;  4XRF A;  1TTY A;  1YS6 A;  1W5T A;  2R7F A;  2ESN A;  3QU6 A;  2Z3Y A;  2QZ8 A;  2NYX A;  4I0A A;  3F8B A;  4XSX F;  3J7A O;  1U8R A;  4P96 A;  1HKQ A;  1MJB A;  2DPD A;  3ULQ B;  5TJJ A;  1S6L A;  3V8K A;  2JZY A;  2JPC A;  1FY7 A;  1QNT A;  2YU3 A;  4RB0 A;  4RGR A;  4WCG A;  4QLC U;  3E5X A;  2O8X A;  3E6D A;  5L3C A;  4P9F A;  2MD5 A;  1S3J A;  3RKY A;  1HKT A;  2DQL A;  1Z91 A;  2HYF A;  2GA2 A;  4EVI A;  4U7B A;  2WWY A;  4Y17 A;  1Y0U A;  1SD6 A;  5L3E A;  2QQA A;  4KIG A;  5K5O A;  2V1U A;  1I5Z A;  3FWE A;  2VXZ A;  4G9Y A;  3CUQ B;  4CDG A;  1U2W A;  4OIP F;  1W4M A;  1FP1 D;  1FP2 A;  2ZNY A;  1F4K A;  1IN7 A;  3GF2 A;  1XGM A;  2E7W A;  2XIG A;  1RNL A;  4KN4 X;  1G6N A;  4ENN A;  2EJR A;  4EGY A;  1RUN A;  2L01 A;  4N9I A;  4ON0 A;  2ZNZ A;  5DYM A;  2ZCW A;  4IHT A;  1MJA A;  2OBP A;  3TQN A;  2VON A;  2QM3 A;  4LG0 B;  2HKX A;  3KP2 A;  1GHC A;  1FSH A;  4N9H A;  5JR3 A;  4JBA A;  1PP7 U;  5L3B A;  4I2O A;  1ZYR F;  3HRM A;  1D8J A;  2P7C B;  5D4S A;  4EGZ A;  1JHH A;  2BV6 A;  1YQA A;  3HRS A;  4CYD A;  2HQN A;  2MA3 A;  2EFO A;  2NS0 A;  2P7V B;  1FPQ A;  1G3W A;  3CUO A;  2O3F A;  4LMY A;  2CSO A;  1GXQ A;  1BBY A;  2EV5 A;  2L4A A;  3JTG A;  1KU2 A;  3PQK A;  3QPH A;  1V3F A;  4KN7 X;  2PI0 A;  1PP8 F;  4XSZ F;  3ZMD A;  4XLN F;  2FXA A;  5IT3 A;  1FBU A;  3LWF A;  4Q48 A;  4MGR A;  2L3D A;  1Z6R A;  3GVA A;  3F22 A;  1Z9C A;  4MEY F;  1S7O A;  2OU2 A;  4RS8 A;  4A6E A;  2GXG A;  2HFH A;  1WKM A;  2A6H F;  2XKP A;  3U2R A;  4FT8 A;  4UXN A;  4I09 A;  3WTV C;  4HDU A;  2MLK A;  1HW1 A;  2IT0 A;  1B9N A;  5H6R A;  1HW2 A;  5E1Z B;  1B4A A;  2DO7 A;  5E18 F;  1REP C;  1IN4 A;  1LEB A;  2HKO A;  5FD6 A;  5LHG A;  2XAG A;  3KET A;  4M73 A;  3RTR A;  1B1B A;  2J5P A;  4JK1 X;  1IRG A;  5D5X B;  4LLN A;  2M8E A;  1SFE A;  3F8M A;  3K9T A;  4EM0 B;  5LRS A;  3KP4 A;  2MH9 A;  4CXF A;  3FZV A;  1R7J A;  3F8C A;  3ZMT A;  1FC3 A;  5DCM B;  3ABU A;  1LDJ A;  2QWW A;  1HQC A;  5LEJ A;  3K69 A;  2VOP A;  2O03 A;  4G6D A;  3KP5 A;  3WTU C;  4CIC A;  2KIM A;  1IXS B;  3FMS A;  3GFJ A;  2L02 A;  1B6A A;  1QZY A;  2VC0 A;  5CVU A;  4WXD A;  4G7H F;  3WTS C;  2DK5 A;  1YIO A;  4EM2 A;  1OR7 A;  3KEQ A;  3P7N A;  2PFB A;  2EV0 A;  3ZQ7 A;  5DCM A;  5ICG A;  3C18 A;  2ZO4 A;  5BQT A;  4UNO A;  4AIK A;  4MEX F;  3GYH X;  2XAQ A;  2H6C A;  2RNJ A;  3G3Z A;  5E1X A;  5BS6 A;  1MKM A;  3FM5 A;  5HDG A;  2D2W A;  5BMZ A;  2ACJ A;  2EB7 A;  5CVR A;  4HLY A;  4EJT A;  3HSR A;  1BI0 A;  1EH8 A;  2ZJ2 A;  4RAY A;  1IRF A;  5ED4 A;  4L0Y B;  3DP7 A;  2RC4 A;  2GIV A;  5BPI A;  3IC7 A;  1J0R A;  2NNN A;  1U5T A;  4L9N A;  2MBF A;  2HWV A;  5HLG A;  4YFN F;  2EFN A;  1XSV A;  4PZJ A;  5JFR A;  1SMY F;  1KGS A;  1MZB A;  1IN6 A;  2P5L C;  4MTD A;  4ZYD A;  4M9S A;  3EQL F;  1T0F A;  2FEZ A;  4YIF A;  4OIN F;  2ZME B;  4EJU A;  1HXD A;  1RI7 A;  2QUF A;  5EEG A;  2FU4 A;  1H0M A;  2XAF A;  3T0Y A;  1R23 A;  3RKW A;  1PDN C;  2P5K A;  5CVI A;  2O61 A;  1KYZ A;  1L0O C;  2CFX A;  3COA C;  4JQF A;  1P92 A;  4OMZ A;  3REO A;  5ERI A;  2A07 F;  2C6Y A;  3RPU A;  4GYI A;  3SHF A;  2W84 A;  4Q5S F;  1SD5 A;  2V1X A;  1FT9 A;  1UST A;  2VBZ A;  4WXC A;  3B02 A;  5A2Q Z;  3GLX A;  1K79 A;  2EK5 A;  4M71 A;  2EA2 A;  1PUE E;  3F23 A;  1P4X A;  3I64 A;  1KQ8 A;  3FXQ A;  5D8L B;  2FBI A;  4O6J A;  3ZP5 A;  3Q9S A;  5D4R A;  5ILS A;  4ZYG A;  3F6V A;  1R00 A;  4U88 A;  5J8C A;  1U5T B;  4M9X A;  5FLX Z;  2QQ9 A;  1G3T A;  4HF2 A;  5HLI A;  3T5X A;  2G7H A;  3SQN A;  5FD5 A;  2JTV A;  4Y13 A;  4Z2Y A;  1KYW A;  4YG2 F;  1QZZ A;  4S04 A;  2GWR A;  1XSD A;  1FYK A;  2HQR A;  3QOP A;  4KDP A;  2Q2E A;  2BE5 F;  4LGW A;  4HX7 A;  3ZMS A;  4CO8 A;  2FNA A;  2IP2 A;  2JT1 A;  3TOA A;  1LDD A;  2ZBK A;  3FXU A;  2R3S A;  3ZMU A;  4Q47 A;  4UVC A;  1U78 A;  5D8K B;  4ZZD A;  3I54 A;  1OPC A;  1BIA A;  3IL2 A;  1JE8 A;  4KNY A;  4I01 A;  1SMT A;  3V8L A;  4G8X A;  1J59 A;  1ZRE A;  4PGG A;  2GXB A;  4UHT A;  3E3V A;  1BI1 A;  1FNN A;  2KJB A;  1XGS A;  5HDK A;  1KQ9 A;  4BXU A;  3F72 A;  3F8N A;  1KU3 A;  1DPU A;  2Z5U A;  1F9N A;  1BM9 A;  4RB2 C;  2FRH A;  4OIQ F;  2GAU A;  1OMI A;  2ZKZ A;  1CGP A;  3ROU A;  2NRA C;  4I02 A;  4LJZ F;  4FX4 A;  3HRU A;  1WQ2 A;  3RPQ A;  1ULY A;  2XAJ A;  1O7F A;  4B09 A;  2K86 A;  3J80 K;  5FFX A;  1DDN A;  1I6X A;  1R1T A;  1YW7 A;  3K0L A;  2K02 A;  1XCB A;  2ZME A;  4U0V A;  4ZH4 F;  1DPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...