4HW0A

Crystal structure of sso10a-2, a dna-binding protein from sulfolobus solfataricus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
98
structure length
98
Chain Sequence
KRGTMEIMFDILRNCEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDRKIYEITEKGKLLRTHIEEFIKIRENLYSAKEKVSELLRTDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA-binding protein Sso10a-2
publication title Diverse architectural properties of Sso10a proteins: Evidence for a role in chromatin compaction and organization.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 36
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14947 HTH_45 Winged helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hw0A00
5LEKA 4HYEA 3SQNA 3IWZA 2K86A 3PQJA 3SZPA 3F21A 2PI0A 1BIBA 4XSZF 4EJTA 5F64A 3GF2A 3GXOA 1STZA 2CFXA 3WG9A 1ZRFA 3F8BA 4KIBA 2QYOA 1FBUA 3P9CA 1MKMA 3TQNA 2QM3A 1TW3A 3NRVA 1BI3A 1X3UA 2UZKA 4HAMA 3WE3A 4WK8F 3F6OA 4RB3C 1R1TA 1G3WA 4BH9A 3RKWA 1IXRC 3I64A 2HYFA 4M72A 1R22A 3DPLC 3ZMZA 1J7KA 1FC3A 5L3BA 5ED4A 2EV0A 1J0RA 1E2XA 4CHUA 3FX3A 5DUKA 1B1BA 1Z1DA 1O7FA 2XIGA 2W84A 2RC4A 1UB9A 3HSEA 3DPTA 4EV0A 3KP2A 2FBHA 3EYYA 4I0AA 4LB5A 2OZUA 4XBFA 2RGVA 1DUXC 3LA7A 1B59A 3F8CA 2CW0F 1U5TB 1UHMA 3WTXC 3TO7A 2VBZA 2C6YA 2VBXA 2D1HA 2OQRA 3CUQB 3VB2A 2ZXJA 1R1UA 5ERIA 3HHHA 5AIPA 1VTNC 3IWFA 3I4PA 4Z2YA 4LMYA 5D4SA 5D6EA 2QQAA 4U7BA 1YS6A 2IW5A 5DV5A 3C1DA 1IRGA 1H9TA 2DK5A 3IRQA 1K78B 1XGMA 2VONA 4G7OF 2A5YB 4KMUX 3F3XA 1HKTA 2O8XA 2K27A 1ZHFA 1D5VA 2UWMA 4UNOA 2XV4S 1S6LA 4GO1A 2OZ6A 3HIFA 2XAJA 3K1PA 3E5XA 3KP5A 3ELKA 1BN5A 4YFKF 1KU2A 4G8XA 4CYDA 1IXSB 2EA2A 4ON0A 3FMRA 1ZYRF 1HBXG 4RS8A 3CJNA 2H94A 1J5YA 5KVRA 1FBQA 3LA3A 2GQQA 2Q8KA 2ADUA 2ELHA 1LEAA 3TKYA 3ZMVA 3RTRA 3VEPA 1QZYA 2F2EA 2ZBKA 1UCRA 1TLHB 1QNTA 5F1RA 1B4AA 3HRUA 4L0ZB 3L2CA 5E17F 4BXUA 5ILVA 2DFIA 2P7CB 4Q5SF 1F4KA 3M8EA 2RN7A 2EFWA 3DQVC 3LSTA 4A12A 2FF4A 2GA1A 2V79A 4G7HF 3W6JB 2P7VB 3F8MA 2EFOA 1J9IA 2V1XA 1R5GA 1G3YA 2LSOA 3TGNA 4I7HA 1SAXA 1P4WA 3KZYA 3E6MA 5E20A 1JXSA 3E3VA 1FSEA 3DXJF 4S05A 1ZAOA 5DEQA 3FF5A 3WTWC 2IP2A 4LLGF 4EVIA 1RUNA 4RGUA 1ON1A 3DP7A 3I53A 4AIKA 3FM3A 3LWFA 3LFKA 2CGPA 1Z91A 1JE8A 4L5IA 2VE9A 4I0BA 3WTTC 2QQBA 3TO9A 3K2ZA 4HLYA 1KYWA 1A04A 1O7LA 2XROA 1IAWA 4Y13A 2L54A 4L9JA 3MQ0A 1R7JA 4RB0A 3I54A 1AOYA 4M9ZA 5ILUA 4HDUA 2VXZA 4IHTA 1F5TA 3BY6A 2GWRA 5D5XB 4Q4ZF 4YG2F 2BV6A 5HLHA 4HX4A 2RVCA 4BQAA 4WCGA 2BYVE 2A68F 1T6SA 4AIHA 5D5VB 1KQ0A 1OYYA 2QBYB 3HTSB 2HFHA 3T0YA 1I5ZA 3GFLA 2GZWA 1FYKA 1IUYA 3GFMA 2XVCA 2WV0A 3ZMSA 2G9WA 3LQRA 1U5TA 4EJVA 3GUDA 3I71A 3CUQA 4OIPF 2K02A 1P4XA 2K4JA 4ESJA 3QP5A 2DO7A 4R79A 3RDIA 3QRFF 5E1XA 5E8GA 2BE5F 2O6GE 4XRFA 2DTRA 3DF8A 1FSHA 5IT9Z 4P9FA 4I2OA 1XCVA 1R1VA 2J5PA 3KEOA 1K78A 4FX0A 1KA8A 1G6NA 1XSVA 4NB5A 2KIFA 2R7DA 1TQMA 2RQPA 2PLYA 4DNCA 2W57A 3WGHA 1IRFA 4CO8A 2D1VA 4HX8A 4LK0F 1QO0D 2DQRA 2IPQX 3R60A 2F5EA 1MDMB 2P5KA 5CVUA 4EM2A 3JW4A 2EFNA 1LNWA 1Q1HA 1Y0UA 2FOKA 1KU7A 1FY7A 2XAHA 2HQRA 3ECHA 4A6EA 4ZYEA 3TO6A 2YX4A 3MFKA 1XGOA 4EJWA 2FNAA 4CGZA 5BOXA 2DBBA 1BC8C 1YS7A 3ROUA 4KN4X 2FMLA 3SFZA 4UVCA 2FXAA 1S29A 5CVVA 2KIUA 2YPRA 2VBWA 3J80K 4U0YA 1BI1A 1T98A 2RDPA 3M9AA 3B73A 4HX7A 2GA2A 5K5QA 1I27A 5FB2A 3FM5A 2QENA 2RKHA 2M8EA 2X0LA 3FHZA 3H3ZA 4O6JA 1H0MA 3CO6C 5LHHA 1L0OC 1ZGJA 3CDHA 5JHUA 5DD4A 1OR7A 2F5FA 4GYGA 4FX4A 2H27A 2QZ8A 2XUBA 1ONVA 3EQLF 3KCCA 2PN6A 3WE2A 4ZYDA 2LNBA 4MNUA 4PCQA 1YW8A 5D8LB 2ZCWA 4G6DA 1REPC 2M45A 5DDGA 3C18A 2Z5UA 4KN7X 1J75A 3KP4A 4E70A 3LA2A 2DPDA 1S3JA 2FBKA 1KU3A 1U3EM 5E1WA 2EJRA 4PDKA 4ZZDA 4KA4A 4R8HA 3SHFA 5JFRA 5LEJA 5DCMB 4U88A 3QU6A 1IN6A 3JAMZ 4MHGA 4G7ZF 3OV8A 4LD5A 2ZO4A 2FNPA 5K1YA 3MEXA 5KK1A 3BJAA 3HRMA 3D0SA 3QP6A 1DPUA 2KJCA 4M9XA 2CO5A 1TNSA 2NRAC 1C0WA 4P5OA 5HVQC 2VT3A 3GW2A 4MTEA 4PGGA 3KZZA 3WTYC 4G9YA 2GXBA 1U8RA 4WXCA 2QBYA 2JZYA 3VODA 1QZZA 1OKRA 3LAPA 5A2QK 1T39A 3COAC 4KIFA 4HDVA 3BP8A 4UHTA 4HW0A 1ZLKA 3W6KB 1U6GA 1I1GA 5J6XA 3DKWA 1FBSA 3CLOA 3IRRA 2L01A 1HQCA 1H9GA 4EGZA 1QBJA 2DK8A 4TV7A 2AS5F 1GXQA 2QLZA 5FLXK 5E1ZB 4I01A 4P9UA 4CXFA 2XAFA 5DD8A 4IXAA 1JHHA 2V1DA 1HW1A 3KEQA 3VOEA 3P7NA 2WTEA 5JR3A 1XGNA 1ZH5A 3K9TA 4BHPA 3GZ6A 2EWNA 1P6RA 2VOPA 1MDMA 1WSUA 3MZHA 2OBPA 4A2UA 3N4MA 1FNNA 2DU9A 5D4RA 3L9FA 4LLLA 3ZMTA 1W5SA 4XSXF 5LLQA 1HXDA 1U2WA 3SXYA 3HRSA 5F6FA 1R23A 2FQ3A 4KIGA 3M8FA 1O57A 4IRIA 5JVTA 3WTUC 2L4AA 4A5NA 3E6DA 4GGGA 3VFZA 1O3RA 4ZH4F 1R5HA 1HKSA 3V7SA 2K7LA 4A6DA 2FSWA 2Y48A 3WTZA 3AAFA 2TDXA 1MGTA 1GVJA 1IN4A 2P8TA 2QUFA 3I59B 1TQPA 3V7RA 2PG4A 5J8CA 2Y0MA 4L0YB 3HSFA 4EM0B 2KJBA 2HYGD 2FBIA 3M1EA 5CVRA 2CG4A 4KUMA 4GCVA 3WU0A 4KYWA 3V8JA 3T8TA 5IT3A 5LHIA 3J81K 2BEOA 1B9MA 3MAJA 3IKVA 1W7PD 2NNNA 2CSOA 3ZP5A 4RGRA 1ZRDA 2FE3A 5L3EA 2MC3A 1T38A 4FT8A 1FLIA 4GYIA 1ZG5A 3NQOA 1U5TC 1IN7A 1XDSA 3ABTA 2BBYA 4ZZLA 1SD4A 3CUQC 1DP7P 3I5UA 5DCFA 1TQIA 1V3FA 4G6QA 4OIRF 2DLLA 4I98B 4KFCA 1SMYF 2OAZA 1QQIA 2V9VA 5DCMA 2ZNYA 1BI2A 3F8NA 1BBYA 4IF4A 4UVBA 4OINF 1G3TA 2P6SA 2H09A 2EB7A 1HSJA 2XAGA 3U2RA 1MZBA 1O3SA 4IRGA 4HA8A 4LB6B 3V4GA 4EGYA 1EH7A 3F8FA 1YQAA 2Z99A 3R0AA 1SFXA 2ETHA 4AWXB 4ENNA 2Z33A 3KP3A 2VN2A 1W7PB 5HDGA 5LGUA 3RYRA 2YU3A 2OU2A 3WGIA 4N9IA 1R00A 1WRJA 2M30A 5LRRA 3ULQB 5BPDA 4IHSA 3GFIA 4CICA 3R6SA 1F9NA 2B0LA 2MH2A 3PQKA 3K1NA 4Y17A 4JBAA 3RPUA 1FPQA 2W24A 4GXOA 3BZ6A 3IC7A 2LF7A 3M7GA 3C7JA 1HW2A 3DV8A 2VT2A 5HOOA 2E7XA 1PP8F 2CYYA 2HR3A 4RGXA 3ABUA 5BS6A 1XMAA 1R36A 1SD7A 2M1BA 1XDUA 4KDPA 1IN8A 3ZPLA 3HRTA 1W5TA 3FZVA 3RI4A 1SFEA 3FXQA 1P2FA 2O3FA 3GLXA 4IJAA 2MA3A 4K2EA 1U78A 4NHJA 3C3WA 3E6CC 1LDJA 4XLPF 3RKXA 1O3QA 2HKOA 3EDPA 4MQ9F 2HTJA 2LDUA 2ISYA 2Q2EA 2RNJA 3QPTA 2EFPA 2GAUA 3GWZA 2DW4A 4EMSA 2GIVA 2OA4A 4YFNF 1XCBA 1DPRA 2JPCA 3I59A 4N9HA 4Q47A 2D2WA 5LGNA 3WTVC 1WQ2A 1PDNC 3QU3A 2G7HA 3R61A 4B8XA 2DI3A 4HQEA 5ICFA 4M6XA 2CWEA 3FMQA 5D5WB 4EM1A 3V8KA 3G3ZA 2JPBA 2DAOA 4UV9A 4LG0B 1J59A 2YR2A 1Z9CA 1XMKA 2HOEA 3CO7C 4BHCA 1ZGAA 2EV5A 1LDKB 1JHFA 2OD5A 3B02A 1K6OA 2NS0A 5CLSA 4F7ZA 5BPIA 2Q0OA 1XSDA 3GYHX 1KGSA 4UUVA 2DPUA 4HV5A 2ZFWA 1B6AA 3BPVA 3HOTA 4RGSA 4A0ZA 3JTGA 3DEUA 4Q48A 1V4RA 2IVMA 1I1SA 4HF2A 3ZN0A 4CZZA 6PAXA 4L5JA 1D3YA 1ZRCA 2Y75A 4ENMA 3MWMA 1J2XA 1ZN2A 1EH6A 2UXXA 3R4KA 2E1NA 3HTUA 3FXRA 1IF1A 1P92A 1MJAA 4QLCU 4RB2C 1RI7A 2F5DA 4PZJA 1UFMA 1YLFA 4ENJA 1FP1D 1XGSA 1SFUA 3E5QA 4HQMA 5TRDA 1ZG3A 4YIIA 2L4MA 1RUOA 1G4DA 3F22A 3QAHA 2V6CA 3TOAA 1AWCA 3GO5A 3T1BA 2ZKZA 2MBFA 1K79A 2O61A 3Q9SA 4UVAA 3REOA 3H3UA 3O2PE 3H92A 3BDDA 1T0FA 3BROA 3GFJA 4PGHA 4WWCA 4JQFA 2L3DA 1D8KA 1KYZA 2BGCA 5E18F 5EEGA 3V7CA 2FEZA 5D8KB 4BAYA 1IN5A 3ZQ7A 1RZ4A 1HW5A 4R1HA 1XB4A 1XN7A 1KQ8A 5L3FA 1R58A 4U7DA 2MH9A 4QWQA 5EEHA 5FD6A 3SZTA 2W25A 4YFXF 5H6RA 4BNCA 1IXCA 5LHGA 2IRFG 1ZG1A 2PQ8A 2KKOA 3I0TA 1BC7C 4IRHA 3ECOA 2ISZA 3F23A 3L7WA 1K7AA 1FT9A 5HLGA 2H6BA 3T8RA 5HLIA 3HYIA 3ZMUA 1W4MA 4O3MA 3OOPA 4B09A 1GXPA 5CVJA 2A69F 3ISPA 1BIAA 3I58A 4MGRA 5AONA 2MLGA 3WU1B 2NNYA 4HOBA 1FYMA 2HWVA 3JTHA 1L3LA 5K5OA 3KFWX 3EUHA 3MCZA 5FD5A 5HS7A 2JTVA 3J80Z 2YSRA 4M73A 2EK5A 3GX4X 1YO5C 2HGCA 2IT0A 4D0PA 1CGPA 4A0XA 3CTAA 4ZYHA 2WWYA 3ERED 4P96A 4H0EA 4HBLA 3P9IA 3GVAA 3KLNA 2HTSA 3FXUA 2QWWA 1SMTA 1OPCA 1NHAA 4JK1X 3F72A 2QVOA 2PFBA 1LQ1A 1SD6A 4BYYA 3Q5FA 3TDUC 3EETA 3IL2A 2L02A 1KQ9A 2D45A 5K5RA 1MD0A 4ESBA 1LEBA 4ZYGA 2EV6A 3FWEA 1QPMA 1BOAA 2XKOA 3HOSA 2A6HF 1USTA 4LG0A 1ULYA 4OOIA 1Z7UA 2VE8A 3D5LA 3N97A 3F6VA 1FOKA 2PEXA 2COMA 5DYMA 1IZ1A 1UHWA 1PP7U 1LVAA 3L09A 1CF7B 1RNLA 4MQVA 4XLNF 2FA5A 2A3SA 5FO5A 1XD7A 4KT5C 2VC0A 1D8JA 1TTYA 4M71A 2XGXA 2GXGA 1I6XA 2AXLA 1LB2A 4M9SA 2XAQA 4WXHA 1SD5A 2LF8A 5LGTA 4MTDA 1XSXA 1OYWA 5CJ9A 4HZFA 3JSPA 2HKXA 2XHKA 2MD5A 4AIJA 3LAJA 5IT9K 1FYLA 1YW7A 2MLKA 1DDNA 2EFQA 2ZJ2A 1WKMA 1JGSA 1USSA 2ESHA 3V8LA 5A2QZ 5FGMA 4S04A 4EJUA 5DUIA 4IVNA 5H6QA 3BJ6A 1O3TA 3E97A 2ZMEB 1YFHA 1YIOA 2M87A 4ENKA 1Z6RA 4OU0A 3K1MA 2JRTA 4RAYA 1TW2A 2HDCA 4A5MA 1ON2A 1TBXA 4KMFA 4OIOF 3WTSC 2A61A 5FLXZ 3HHGA 3O6BB 4U0WA 4HLXA 3NEUA 3U1DA 4AVPA 3HUGA 1BJAA 1BI0A 4BHBA 3TOBA 2F5CA 2KIMA 4I09A 2V1UA 3S2WA 3ZMDA 2H6CA 4WXDA 5FFZA 3P9KA 3WGGA 1FWZA 5ICCA 4U0VA 5D5UB 2CQKA 5LBQA 1GHCA 2A07F 2NAZA 1MJBA 4EQQA 1T2KA 4M6YA 2Z9OA 2P4WA 3IKTA 1F1ZA 4LFUA 4G94A 2FU4A 5D6FA 2UXNA 1LJ9A 2JSCA 1ODDA 5FFXA 3K0LA 5HS8A 4HF0A 2DQLA 3BPXA 2O0YA 2XRNA 1E17A 1S7AA 2HS5A 5LRSA 3BWGA 3E6BA 2IA1A 2IA2A 4I02A 4LLNA 4OMYA 1B9NA 1MJ9A 5L3GA 4LJZF 4OMZA 5CVIA 4P55A 2KRFA 2XKPA 3JSOA 2PBIA 4WF2A 3MZYA 4N0BA 3EYIA 4OIQF 1YTYA 2VOOA 2PMHA 3E5UA 2EA4A 4L9VA 3QPHA 3KE2A 1HKQA 2STTA 5L3DA 4NQWA 3J81Z 4EJOA 5HDKA 2Z3YA 4FHTA 4AD9A 3JAMK 3RPQA 2X4HA 3RYPA 4RAZA 1OYIA 3R0JA 5E8IA 4HF1A 3GZ5A 2PMUA 4LGWA 4ETSA 1S7OA 4KICA 2ZNZA 2IJLA 1FZPB 3L00A 3GEZA 2XASA 3KP7A 3CUOA 1FP2A 5H20A 2FRHA 3ZN1A 1CF7A 2A6EF 2DT5A 3PFIA 3DFGA 2HEOA 1HSTA 3WODF 2P5LC 4WX9A 4Y15A 3KP6A 2IA0A 2P6TA 3RKYA 3ML6A 2E1CA 5ILSA 5AIQA 2G7UA 2R3SA 2HQNA 2J5OA 1ZREA 1TNTA 4M74A 4CDGA 2P5VA 3K69A 4MEXF 2LKPA 2QQ9A 1ZARA 1P4AA 4L9NA 2PJPA 3G73A 2WC2A 2ACJA 1G3SA 2E7WA 1EH8A 3KLOA 2ZMEA 1WI9A 2STWA 3O3KA 4A0YA 3KETA 4DQ2A 2K4BA 3J7AO 4YIFA 4IPAA 2VBYA 5L3CA 2R7FA 2YX7A 3BOQA 5ICEA 5HS9A 1IW7F 2W85A 1EV7A 1Z05A 5HDNA 1BM9A 5J8FA 3TDZC 1WWXA 4UV8A 2M5WA 4MEYF 4LK1F 3HSRA 1OMIA 2JT1A 1ZLJA 5BMZA 3BJOA 1RIOH 4L9TA 1LDDA 2NYXA 1S8NA 4L18B 1YG2A 2VODA 5JI6A 2RV8A 3IHUA 1FX7A 1KU9A 4ESFA 4O5VA 5BQTA 1W7PA 1YYVA 4RB1A 3T5XA 1PUEE 1YW9A 4HV6A 1QGPA 5CYVA 2ESNA 2OQGA 4UXNA 3LQQA 2O03A 4KNYA 3QOPA 5TJJA 3FMSA 3RIRA 4ASNA 2FMYA 1Z6TA 2HZTA 5ICGA 3U9GA 2VC1A 3RJPA 3Q9VA
chains in the Genus database with same CATH superfamily
5LEKA 1QHGA 1GUUA 4F52A 5M5WJ 3SDGA 1X1AA 4HYEA 3SQNA 1G59A 5F0HA 2EBIA 3IWZA 5GTIC 3LSRA 1GVDA 3CESA 2K86A 3IAS2 3PQJA 2KISA 3SZPA 3BTJA 3E7LA 3F21A 1BIBA 2PI0A 4XSZF 3IH3A 4EJTA 3DBRB 1RC9A 3PSIA 5F64A 3K4BA 3GF2A 3GXOA 1JUSA 1STZA 3OS1A 2CFXA 2M4KA 3WG9A 1ZRFA 3CC4I 2BZTA 3F8BA 4KIBA 2QYOA 2BHYA 1FBUA 1BR4A 3P9CA 1MKMA 3TQNA 1QA6A 2QM3A 2HVRA 1TW3A 3NRVA 1BI3A 4DYCA 5EZGA 3SJMA 3AL0B 3G6EI 1X3UA 3CC2I 4XLHA 5GPCA 4HNUA 4HAMA 2UZKA 3WE3A 4WK8F 3C2BA 3F6OA 2CQ7A 4RB3C 1R1TA 4RAGA 2LD5A 1G3WA 4BH9A 2RQQA 3TL4X 3RKWA 1BOBA 1IXRC 3I64A 3K70C 2HYFA 3QYEA 1FIPA 4M72A 1R22A 4J00A 1SANA 2HI3A 3DPLC 1TT5B 3OYFA 3OYGA 1EF4A 1TWGJ 2KLOA 3ZQFA 3ZMZA 1J7KA 2CV2A 2OV7A 1FC3A 2V9KA 1K4TA 5L3BA 5ED4A 1MMGA 2EV0A 4AUXA 1J0RA 1HLVA 3H9QA 1E2XA 2R7SA 4CHUA 1MH4A 3FX3A 5DUKA 3VYRB 2BW3B 1B1BA 1Z1DA 3FISA 1O7FA 2XIGA 2W84A 3ABMH 2RC4A 1UB9A 3HSEA 4A3DJ 2EIKH 1E3PA 3DPTA 4A3MJ 2WA0A 4EV0A 3Q3SA 3KP2A 2FBHA 3EYYA 3HJEA 4I0AA 4LB5A 2OZUA 4XBFA 2RGVA 3S32A 3H36A 1DUXC 1QRYA 3LA7A 1EKEA 5FKKA 1B59A 3IP4B 3F8CA 2CW0F 1U5TB 1UHMA 2WY8Q 2NS7A 3PNYA 3WTXC 3TO7A 2VBZA 1ETWA 2C6YA 2VBXA 2D1HA 2MGQA 2OQRA 3CUQB 2O7OA 3VB2A 1ETQA 2ZXJA 1R1UA 1Y56A 5ERIA 3HHHA 5AIPA 2XGEA 3IWFA 4PK4A 2EZKA 2AO9A 3I4PA 4FETA 4P1WA 2M0CA 5CQEA 1VQMI 3H0GJ 4Z2YA 4LMYA 5D4SA 2BXYA 5D6EA 3JRFA 2E2HJ 2QQAA 4NDLA 2E36A 2HNHA 4U7BA 1VQ4I 2W7NA 4E7KA 1YS6A 5IPAA 2IW5A 2DJNA 1SC7A 5CKTA 5EG0A 5DV5A 3C1DA 1ZELA 1H9TA 1IRGA 3CJQB 2Y69H 4NUBA 2L9NA 2DK5A 3IRQA 1K78B 3N05A 2LY9A 1XGMA 2VONA 4G7OF 2A5YB 4KMUX 3F3XA 1HKTA 5EGOA 2O8XA 3EPZA 4CCMA 2K27A 1GLNA 1ZHFA 1U9OA 1FJLA 1K4SA 1D5VA 2UWMA 4OAYA 4UNOA 1UG0A 2XV4S 1S6LA 2LBFB 4GO1A 4DZJA 2OZ6A 3HIFA 3S14J 2M7AA 2XAJA 3K1PA 2HDWA 3E5XA 3KP5A 2AXTC 3ELKA 5DTDA 1BN5A 1JKPC 4YFKF 1KU2A 4G8XA 1IXSB 4CYDA 2EA2A 3OYJA 4KISA 4ON0A 3FMRA 2ZFUA 3CP2A 2LKXA 1ZYRF 1HBXG 4RS8A 3CJNA 2H94A 1MNDA 1J5YA 2Y9ZA 5KVRA 1HOMA 1FBQA 3LA3A 2CW8A 2WV1A 3L2WA 4A3KJ 2NVTJ 2GQQA 3VDXA 1V5EA 1YX3A 3LFUA 2Q8KA 2ADUA 5JLXA 3HPHA 3BT9A 2ELHA 1LEAA 3TKYA 3ZMVA 3AG3H 3RTRA 4KT6A 4BACA 4Y3OA 2JVGA 1QZYA 3VEPA 2F2EA 2ZBKA 1UCRA 1Z67A 2X85A 3K7AJ 3CF5F 4D5CA 3H3VK 3DLAA 1TLHB 1QNTA 5F1RA 1B4AA 3HRUA 4F91B 2DA7A 4L0ZB 2MYSA 2WAFA 3L2CA 1OCZH 2X1EA 2IGKA 2N8GA 1SFKA 5E17F 1ETVA 4BXUA 3CCVI 5ILVA 2HOSA 2DFIA 4C2MJ 2P7CB 5HNFA 4Q5SF 2RNGA 1F4KA 2KFDA 3M8EA 2RN7A 2LVSA 2EFWA 3DQVC 4Z6YA 5GAEJ 3FBIB 2R7WA 3OYAA 1VQOI 1I3QJ 3V42A 5E3NA 3LSTA 2R92J 1YJ9I 4A12A 2FF4A 1Z7LA 5KAIC 1JT0A 2GA1A 2MG4A 2V79A 4G7HF 1XG1A 2D5VA 3W6JB 2P7VB 3A01B 3F8MA 2EFOA 1OCOH 2FQ4A 3FIWA 3X2QH 3M1CA 2YS9A 3DU6A 1J9IA 2V1XA 1R5GA 2XB0X 1G3YA 2LSOA 1BL0A 3TGNA 4I7HA 5KAFC 4XM3A 1SAXA 3SEZA 3HBLA 4XL9A 4B48A 3W3CA 1MSEC 3Q0WA 1P4WA 5K7HA 1IG7A 1X3WB 3D5RC 3KZYA 3E6MA 5E20A 2L5QA 3HOXJ 1JXSA 3E3VA 1FSEA 2B7EA 5B1BH 3DXJF 4S05A 1JJ6C 1S7EA 1MW7A 1ZAOA 2BY1A 5DEQA 2HQ5A 3WHCA 3FF5A 3WTWC 2IP2A 4LLGF 4LOCA 4EVIA 1RETA 1RUNA 2ZXIA 4RGUA 1ON1A 1VQLI 2LMDA 3DP7A 3I53A 4PSXA 2XC7A 4AIKA 3FM3A 4BE1A 3CCYA 2ZJRF 3LWFA 2H8RA 3LFKA 2EQRA 2F6CA 2CGPA 3LMMA 1Z91A 1XTAA 1JE8A 4L5IA 1HCRA 2CUEA 2VE9A 4I0BA 4QTRA 3W2VA 3WTTC 3I4MJ 2QQBA 4B4CA 3TO9A 3K2ZA 4X6AJ 4HLYA 1KYWA 1APLC 1BW5A 1A04A 1O7LA 5TGTA 2XROA 3IH4A 2WB1N 1IAWA 2R7XA 4Y13A 2L54A 2ZSIB 4L9JA 3S3OA 1FTTA 4BDZA 3MQ0A 1R7JA 4RB0A 2HXIA 3LSKA 3I54A 1FTZA 2E60A 2P0WA 1AOYA 4M9ZA 5F04A 5ILUA 2RREA 4HDUA 4ZTFA 2VXZA 4BQOA 4IHTA 1F5TA 2CS3A 3BY6A 2R5ZB 2GWRA 1A6IA 2E1OA 4GFBA 3LSGA 2MD0A 3JREA 3G4SI 5D5XB 3QYFA 2CQQA 1SFOJ 4Q4ZF 4YG2F 2EZIA 2BV6A 5HLHA 4HX4A 3DKYA 3F9KA 2RVCA 1WJ5A 2DOEA 2L0KA 1NK3P 4BQAA 1W0UA 4WCGA 1X19A 1D5YA 1YRNB 2DDBA 2P81A 2BYVE 2BW3A 2A68F 2X1DA 1T6SA 2I8DA 3BR1A 4AIHA 3SYTA 5D5VB 1KQ0A 2Z2SB 3L2RA 3DTIA 1OYYA 2QBYB 3HTSB 2E1MB 2HFHA 4A3BJ 3T0YA 1I5ZA 2ZMEC 2K3FA 3GFLA 1W0TA 2KPMA 2GZWA 5IYDJ 1FYKA 1IUYA 2ICWG 3GFMA 2XVCA 2WV0A 2IEKA 3ZMSA 1HA8A 4PSWA 4M3EA 1G2HA 3BG9A 4CCOA 4JP0A 3S1NJ 2G9WA 4RLFA 1EJ9A 3PO3J 3LQRA 1U5TA 4EJVA 3JRIA 1UJ8A 3GUDA 3MKZA 1K6YA 1VI0A 2I5UA 2Y0SA 3I71A 4ZTJA 4XLEA 3CUQA 4OIPF 1PYVA 2K02A 1P4XA 4A3CJ 2K4JA 4ZYAA 4ESJA 2AHQA 1LPQA 5B3SH 3QP5A 3GTGJ 2DO7A 2LTPA 1VNDA 4R79A 3RDIA 1IO2A 1POGA 1P7IA 2CUFA 1N78A 3OSFA 3QRFF 5E1XA 5E8GA 2BE5F 2O6GE 4XRFA 3MKWB 1ZGWA 2DTRA 3DF8A 1FSHA 4BJ5C 4P9FA 5IT9Z 4I2OA 1XCVA 1R1VA 2WY7Q 2J5PA 1BA5A 4YEJA 3PO2J 4PJNA 4EATA 2M8GX 1T08B 4HPQA 3S1QJ 2XGCA 3KEOA 5DS9A 3GTLJ 1K78A 4FX0A 1NK2P 1KA8A 1G6NA 1XSVA 4NB5A 1JKQC 2KIFA 4HEA2 2R7DA 4OWRB 1TQMA 2RQPA 2PLYA 4DNCA 2W57A 3WGHA 2LBFA 1TC3C 1IRFA 2DYSH 4CO8A 1B8IB 2D1VA 5JLWA 4HX8A 4ZDLA 4LK0F 1QO0D 2DQRA 2IPQX 3R60A 2ELJA 2F5EA 3FK6A 1MDMB 3DTKA 3LOCA 2P5KA 5CVUA 4EM2A 3JW4A 1MMNA 2EFNA 3K6GA 3K4KA 1IDYA 3RKQA 2JA2A 1LNWA 1Q1HA 3K4NA 3K4JA 5J4YA 3OYIA 2QEXI 2R7RA 1Y0UA 2FOKA 1KU7A 4XQFA 1FY7A 2XAHA 5EZHA 2KRCA 4CZCA 2HQRA 3I55I 3TMOA 2VXDA 3CCSI 3ECHA 4A6EA 2CQXA 4ZYEA 3TO6A 2YX4A 2HVQA 2PX9A 3MFKA 1XGOA 4EJWA 2FNAA 4CGZA 5H2FC 4M3BA 1UMQA 1DQUA 5BOXA 4KJZA 1HDPA 2DBBA 2BY2A 1BC8C 1YS7A 5GPAA 4E7JA 3LSJA 5FLVA 2W4SA 2V7FA 3ROUA 1MBGA 1W36C 2JN6A 4KN4X 3M4OJ 2HDDA 3E1SA 2O9LA 2WBMA 1NTCA 2FMLA 3SFZA 4UVCA 2FXAA 3BZKA 1S29A 5CVVA 2KIUA 2YPRA 1ERDA 2VBWA 3J80K 5HODA 1YJNI 4U0YA 5DM6F 1BI1A 1T98A 3BR6A 2RDPA 3M9AA 3VYUB 3B73A 2JQ7A 4HX7A 2GA2A 5K5QA 2OCCH 3VYTB 2K9NA 4G6TB 1IJWC 1I27A 1OCTC 3A01A 4RAFA 5FB2A 2BXZA 3FM5A 3PL8A 1D1BA 2F4OB 2QENA 2RKHA 2Y0SN 2M8EA 4LIUA 1RKWA 4N4NB 3CJTB 3DLLF 1OCRH 3L2UA 4IHYA 2X0LA 2E35A 3FHZA 1Q1VA 2H1LA 1FOWA 3H3ZA 4O6JA 1H0MA 3CO6C 5LHHA 3PIPF 1L0OC 1ZGJA 3CDHA 2CV0A 5JHUA 5DD4A 4BEHB 1IC8A 1OR7A 2F5FA 2W82A 4GYGA 3S2DJ 3ZQGA 4FX4A 2H27A 2QZ8A 2XUBA 4D7MA 1ONVA 3EQLF 3HOZJ 3KCCA 4C9YA 4BE2A 1NG6A 2PN6A 3OSGA 3HB9A 3FKIJ 4AU7A 3WE2A 1VQ6I 2IS6A 1PVEA 4ZYDA 2LNBA 1D0YA 4MNUA 4PCQA 1YW8A 5D8LB 3Q0VA 3I9V2 2ZCWA 3KZIC 4XNFA 3W2WA 5C3EJ 2GLOA 4G6DA 1J09A 1REPC 2M45A 4BDYA 3PIOF 5DDGA 3QYBA 3C18A 4HNVA 2Z5UA 3AFHA 5J1RA 4KN7X 3OYKA 1J75A 3KP4A 1MMAA 4E70A 1W5CC 2DDAA 3LA2A 3RPUD 1GV5A 2DPDA 1S3JA 2COBA 4MFEA 2FBKA 3TP0A 1KU3A 2XDVA 1BW6A 3BTCA 1DGWY 1U3EM 5E1WA 2EJRA 3BR3A 1WJCA 1I50J 4PDKA 4ZZDA 5C44J 4KA4A 4R8HA 3SHFA 2X48A 2OUMA 3C2HA 3ABLH 5JFRA 5LEJA 1TT0A 2NVUB 5DCMB 2VKVA 4U88A 3QU6A 1IN6A 3JAMZ 3P5JA 4MHGA 4G7ZF 1JUMA 1NH3A 3M07A 3OV8A 3CCEI 4LD5A 2ZO4A 4AVZA 1RRJA 4CYCB 2FNPA 5K1YA 3MEXA 5FKOA 5KK1A 2R5ZA 3BJAA 3HRMA 4QPQA 3D0SA 3QP6A 2X6WA 2HXOA 2LYCA 5IOYA 1DPUA 2KJCA 2R7QA 2H1KA 3CD6I 4M9XA 2CO5A 2DFFA 1TNSA 2FUG2 2LOOA 2GOXB 1MBEA 1ZTRA 4OAZA 2NRAC 1C0WA 4P5OA 5HVQC 4AM3A 2VT3A 1YRNA 3GW2A 4MTEA 1HF0A 4PGGA 2PJRB 3J7ZI 3CF2A 3KZZA 3WTYC 4G9YA 3GTMJ 2GXBA 3UKGA 1U8RA 3QWLA 4EEFG 4WXCA 2QBYA 2JZYA 3G71I 2KT0A 3VODA 1QZZA 3BQZA 4U87A 4N4OB 5EF6A 1OKRA 2KMUA 3LAPA 3H5NA 4IOCF 2L7ZA 3GLLA 5A2QK 1T39A 4DGWB 3COAC 2IS1A 4KIFA 5TISC 2VJJA 1F36A 4HDVA 3BP8A 1UAAA 4UHTA 1OJLA 4HW0A 1WH7A 1ZLKA 4CH7A 3W6KB 3KX2A 1U6GA 3J7YJ 2ELKA 5IYCJ 1QVUA 1Z21A 3BG7A 1I1GA 2L7MP 1E3HA 5J6XA 3NARA 3DKWA 3MN2A 1FBSA 3CLOA 1NG7A 3IRRA 1Z77A 2L01A 4CSWA 1HQCA 3ZQLA 5GTHC 1H9GA 2K9QA 4EGZA 4IKFA 1X1DA 2NVYJ 1QBJA 2DK8A 4TV7A 4E7ZA 2AS5F 1GXQA 2QLZA 5FLXK 2VQLA 5E1ZB 4I01A 4P9UA 4CXFA 2ZB9A 2XAFA 1YX5A 3A2KA 3BC8A 2VPRA 5DD8A 3W6VA 4IXAA 1JHHA 2V1DA 1VQNI 1W1WE 1RPWA 4ITVA 1HW1A 3KEQA 1VF9A 3S8PA 3VOEA 3P7NA 2KL4A 1B8IA 2WTEA 2RAEA 5JR3A 1XGNA 1ZH5A 3K9TA 2Y31A 1IV8A 1TZLA 5EEAA 4BHPA 1ZK8A 3GZ6A 2EWNA 2IS2A 2QSHX 1P6RA 5LFAA 1VQ7I 1MDMA 2VOPA 3KYCB 1WSUA 3MZHA 2OBPA 2UUZA 4A2UA 3N4MA 4H4KC 5KHDA 1FNNA 2I10A 2DU9A 5D4RA 3BG3A 3L9FA 3RQ4A 4LLLA 3ZMTA 3OMYA 4HRIA 1W5SA 4XSXF 2DN0A 4IHXA 4XLCA 5LLQA 1HXDA 5BNGA 3VPRA 1U2WA 1XS9A 2E2IJ 3SXYA 2KZVA 4ZDPA 4QPOA 3VYSB 1DP3A 1FMWA 3HRSA 3OYLA 4UB6C 4E6KG 2F5VA 1V5FA 5F6FA 3CJRB 1R23A 2FQ3A 3PUBA 2KP6A 4B3XA 4KIGA 3M8FA 1O57A 1WJAA 1ETKA 4IRIA 3S16J 5JVTA 3WTUC 2L4AA 5GAGJ 4A5NA 3E6DA 4GGGA 3VFZA 2TRTA 1O3RA 4ZH4F 2IGMA 2VJ5A 2CW7A 3H5RA 1JUPA 1R5HA 3FHNA 1RKTA 2A05A 2ECCA 4XRSG 5IOZA 2YU9J 1HKSA 3Q0UA 3QQAA 2Q2EB 2LR8A 2LH9A 3SZGA 3V7SA 2K7LA 3MKYB 3BTIA 4A6DA 4AYBN 2F4IA 2FSWA 2L9SA 1QU3A 1T33A 2Y48A 3MVPA 3AL0C 1WJFA 4II3A 3WTZA 3AAFA 2TDXA 3B6AA 3DU5A 3CCJI 3H9JA 4Y52J 2CU7A 1MGTA 2F48A 1GVJA 1IN4A 1MNEA 2P8TA 2WB1A 1FEXA 3M8JA 2QUFA 2Y2ZA 4XLFA 1OISA 3I59B 1TQPA 3BG5A 3V7RA 3CCLI 2PG4A 5J8CA 5IP6A 2Y0MA 4L0YB 1S5LC 4PJMA 3HSFA 4EM0B 2KJBA 2R7ZJ 2HYGD 2Z1DA 4NC6A 1WH5A 1AU7A 2FBIA 2O5RA 3M1EA 2DYRH 1R4NB 3BQYA 3TW7A 5CVRA 3JRBA 2CG4A 4KUMA 4MLOA 3G1LA 4GCVA 4JX4A 3HG9A 3WU0A 4BEHA 4KYWA 3LSPA 3V8JA 3NAUA 4M3GA 3T8TA 4RM3A 4Y7NJ 5IT3A 5LHIA 2GM4A 3ZQIA 3DTEA 3GTJJ 3J81K 3ZXSA 2BEOA 1B9MA 2E5ZA 3MAJA 3IKVA 1W7PD 3ESWB 2NNNA 2Q1ZB 3HGYA 2CUJA 2JRMA 4M6VA 2CSOA 3ZP5A 1YHQI 3S1RJ 4RGRA 3OYDA 2FE3A 1ZRDA 1T95A 3HPGA 2MC3A 5L3EA 1T38A 1WGXA 3BLYA 4FT8A 1FLIA 4GYIA 1ZG5A 3NQOA 5IP9J 2MFZA 3PM1A 1IUFA 3GTOJ 2EPFA 1MMDA 1U5TC 1IN7A 1OCCH 1XDSA 3SDBA 1TL8A 3ABTA 2BBYA 4ZZLA 1SD4A 3CUQC 2R7TA 4KITB 1DP7P 3I5UA 5DCFA 1TQIA 2DA1A 4I76A 1V3FA 2JWTA 2VPLA 2ZXWH 3E0JB 4G6QA 4OIRF 4DBRA 2DLLA 3LL7A 4I98B 4KFCA 1SMYF 2B9SA 1X2MA 2OAZA 3K10A 1QQIA 2V9VA 2HPMA 5DCMA 2ZNYA 1BI2A 4QIWN 2OF7A 1DU6A 3F8NA 4D5FA 3TEDA 3DEEA 1BBYA 4IF4A 2VUMJ 4UVBA 3HOWJ 1N25A 2QKLB 4OINF 1G3TA 2P6SA 4CYCA 2H09A 5F1JA 3A1YA 2M7BA 2EB7A 1HSJA 4BY7J 4UB8C 1MMSA 2XAGA 3U2RA 2KHMA 2XSDC 1MZBA 4C3IJ 1O3SA 2VASA 4IRGA 4HA8A 4LB6B 1WFXA 2L7KA 3V4GA 2K3PA 5KNLA 1X1CA 4EGYA 1EH7A 3OIQA 3F8FA 2XGDA 2PJRA 5FRNA 3MZ8A 4LITA 4CCKA 2LRDA 1YQAA 2Z99A 3R0AA 3MMYB 5EDNA 2DCEA 2IAIA 2H8WA 3A4CA 1MNMC 1SFXA 2ETHA 4HSRA 1MBHA 4AWXB 3A02A 4ENNA 1Y1WJ 4E4HA 4JOMA 5KCMA 2Z33A 3OIPA 3IV5A 2QKMB 3JCUC 3U21A 3GTQJ 4CUGA 3KP3A 4XONA 1Y8QB 2R4GA 2VN2A 1W7PB 2ECBA 1MBKA 5HDGA 5LGUA 3RYRA 3JRHA 2YU3A 5F27A 2OU2A 1TWAJ 3WGIA 5K7FA 4IQ4A 2BVLA 2DTZA 4V2FA 2K40A 4N9IA 4CCJA 2V6EA 3DKXA 1R00A 1WRJA 2M30A 5LRRA 3ULQB 5BPDA 4IHSA 3GFIA 4LG3A 1HDDC 3CP8A 1I6HJ 4CICA 3R6SA 3OYHA 4XKBA 1F9NA 2B0LA 2MH2A 3KYDB 1I3AA 1VQPI 1P9QC 3PQKA 3OYEA 3K1NA 2VKHA 2DXIA 4Y17A 4JBAA 3RPUA 1FPQA 2W24A 3SEQA 3NWTA 4GRIA 3S93A 1Y1VJ 2QF7A 4GXOA 1WHUA 3BZ6A 2G0EA 3IC7A 5FKLA 2LF7A 4C3JJ 2R7UA 3M7GA 4I6ZA 1WZ2A 3C7JA 1HW2A 1SAUA 3LSHA 1JTYA 3DV8A 3A03A 1WPKA 1JKRC 2LY1A 2VT2A 5HOOA 4J19A 4A3FJ 4C3HJ 1Y39A 2E7XA 3ONQA 3OY9A 1PP8F 2CYYA 4Y4RA 2HR3A 4RGXA 2JUCA 2ZC2A 3AG1H 3ABUA 2X6XA 5BS6A 1XMAA 1R36A 4W97A 1SD7A 2M1BA 3L2QA 1XDUA 1A6QA 2E5NA 4KDPA 5F0CA 2BOLA 1IN8A 1A35A 3ZPLA 3FXJA 1FOXA 5GADJ 3HRTA 1W5TA 2NOJB 4JX6A 3FZVA 3RI4A 1SFEA 2BHZA 4ZC3A 3FXQA 1P2FA 3GTKJ 2V1NA 5F0FA 2O3FA 1OR7C 1S9HA 2L7FP 4B47A 4XIDA 1IV6A 3GLXA 4IJAA 2A6TA 2MA3A 1PUFB 4K2EA 3BCBA 1U78A 2KDZA 3S3NA 4FE7A 1GT0C 4NHJA 3C3WA 1Z3YA 2CUZA 4IL6C 3QOEA 1AHDP 1IDZA 3E6CC 1DGRM 1LDJA 4XLPF 2HOTA 3RKXA 1O3QA 5EJCA 4XORA 3KIOA 2HKOA 2LK2A 3PNVA 3EDPA 4MQ9F 2EIJH 2HTJA 3CCRI 2LDUA 4BU2A 2QA4I 2ISYA 2Q2EA 3K70D 4F93B 2RNJA 3QPTA 2VJIA 2EFPA 2GAUA 3GWZA 2DW4A 3HXLA 3FXOA 5LD2C 4EMSA 2GIVA 4DYRA 2OA4A 4BBSJ 3U1KA 4YFNF 2W48A 1XCBA 1OQYA 1S72I 3G1MA 1DPRA 2JPCA 3I59A 4N9HA 3LNQA 4Q47A 5M5YJ 2D2WA 2VI6A 5LGNA 3WTVC 3HOYJ 1WQ2A 1PDNC 1M1EB 2LP0A 3QU3A 4XMYA 4IO9F 2G7HA 3R61A 4UUTA 3HC7A 3QPSA 2NXNB 4V2GA 4PJJA 4B3AA 2DI3A 4B8XA 4BQQA 4XICA 5ICFA 4HQEA 4V19K 4M6XA 2F4MB 1GV2A 1TWFJ 2CWEA 3FMQA 3JRDA 3CMAI 1N77A 5D5WB 4EM1A 2DJIA 1YOVB 3V8KA 3G3ZA 1H8AC 2JPBA 2DMNA 3ZQQA 2DAOA 4UV9A 1UHSA 2MW8A 1SVOA 2LREA 4LG0B 1J59A 2YR2A 2IXSA 3ZRGA 1Z9CA 4M3DA 3FKJA 4A3LJ 2JMWA 1SVLA 2IBDA 3NWSA 2FX0A 1XMKA 2E1MC 2HOEA 3CO7C 4BHCA 1ZGAA 1RR7A 2EV5A 2HOAA 1LDKB 1JHFA 2OD5A 2DFEA 2PMZN 3B02A 2QQ8A 1K6OA 2NS0A 3K4CA 5CLSA 1IRXA 4B1RA 3S1MJ 2O8KA 4F7ZA 5BPIA 4BQNA 4DYQA 3CCMI 2JA7J 4XLAA 4M3FA 5CQGA 2Q0OA 2JA5J 2XB5A 4PJ0C 4DOZA 1XSDA 3GYHX 1KGSA 3HGGA 4UUVA 2R93J 4D1QA 3DBHB 2DPUA 2OJED 2BVMA 3BCAA 4HV5A 5J3LA 1I39A 2YUSA 2ZFWA 1B6AA 3BPVA 3HOTA 4RGSA 4A0ZA 3JTGA 3DEUA 4Q48A 1AKHB 1IRZA 1CQTA 1OFCX 3I56I 1V4RA 2IVMA 4CCNA 1BR1A 3W2AA 2VKDA 4HF2A 1I1SA 3ZN0A 3LSMA 4CZZA 5FRMA 1ENHA 4XKWA 1A31A 1E3OC 6PAXA 2KRHA 4L5JA 2X9DA 3DPUA 1D3YA 2IGOA 1ZRCA 2Y75A 4ENMA 4A3EJ 3MWMA 1J2XA 1UELB 2LLKA 2E2JJ 1ZN2A 5J4VA 1EH6A 2UXXA 1LFBA 5E79C 3R4KA 1YITI 2E1NA 1D0XA 3S17J 3HTUA 3WHBA 3FXRA 1IF1A 1P92A 1MJAA 4QLCU 3HZJA 4DJAA 3GCMA 1RI7A 4RB2C 2GXAA 4PJLA 2F5DA 4PZJA 1UFMA 3S15J 3ZCOA 1YLFA 4RM2A 4ENJA 1FP1D 1XGSA 3S3MA 1U8BA 3L1PA 3E5QA 4HQMA 1SFUA 5TRDA 1ZG3A 4YIIA 2L4MA 1RUOA 3TW6A 1G4DA 4BBRJ 4RA2A 3OL4A 4HNTA 3KPHA 2VB6A 3F22A 1F43A 3S2HJ 2EH3A 3JRGA 3WG7H 3QAHA 2V6CA 4BXFA 2IS4A 3KEYA 3BR2A 3TOAA 4AIDA 2R7VA 1AWCA 4JYKA 3GO5A 3T1BA 2ZKZA 2MBFA 4E7SA 1K79A 3BTLA 3GMEA 2O61A 2X6YA 5J40A 2LG4A 3Q9SA 4UVAA 3REOA 3H3UA 4XKVA 3O2PE 2Z16A 3H92A 3BDDA 1MBJA 1T0FA 3BROA 3GFJA 4PGHA 1TP4A 3EUKL 3K2AA 2DA2A 3HUGB 4WWCA 4JQFA 1FMVA 2L3DA 1JI8A 1D8KA 1KYZA 2BGCA 2JA8J 3HKZN 5E18F 5B5EC 5EEGA 2ME0A 3V7CA 5J47A 3A0HC 2FEZA 4AYBA 4UY8I 5D8KB 1B72B 4BAYA 1IN5A 4JX5A 3ZGKA 3ZQ7A 1RZ4A 3OS2A 1XPXA 1HW5A 4R1HA 3OWTA 1XB4A 1XN7A 3CCQI 5L3FA 1D0ZA 1KQ8A 3AKZA 1R58A 4E7LA 4FCYA 4U7DA 5FROA 2MH9A 4QWQA 2M0MA 5EEHA 3CMEI 1VQ8I 4FQGA 5FD6A 3A0BC 3SZTA 3C2GA 2XPUA 2K9SA 1ACIA 2W25A 2KIQA 2Y9YA 5FLMJ 4YFXF 2MABA 5H6RA 4BNCA 1IXCA 5LHGA 2IRFG 1ZG1A 2PQ8A 2OPTA 1A5JA 5E3MA 2KKOA 4NBQA 4F55A 3I0TA 1BC7C 1VZ0A 4IRHA 3ECOA 1KZHA 2ISZA 3GZNB 3K4MA 1X1BA 3F23A 3L7WA 1K7AA 1FT9A 5HLGA 2H6BA 4XN0A 3T8RA 1Y0NA 5HLIA 3HYIA 4C2TA 3ZMUA 4IX7A 1W4MA 4O3MA 4YELA 3OOPA 4B09A 1GXPA 2EIMH 3DWLE 5CVJA 4ANJA 2A69F 3ISPA 1BIAA 1PUFA 4LIVA 3I58A 2R5YB 3GTPJ 1ZR2A 4MGRA 2IGNA 5AONA 2MLGA 3WU1B 2NNYA 4HOBA 2L2OA 1FYMA 2HWVA 3JTHA 1L3LA 5K5OA 3KFWX 2EILH 3EUHA 2V9PA 3FXMA 3CMYA 4D9JA 3MCZA 5FD5A 5HS7A 2DMPA 2JTVA 3MD2A 2DMUA 3J80Z 3GBGA 2YSRA 4M73A 2EK5A 3GX4X 1YO5C 2DOAA 2HGCA 2IT0A 4D0PA 1CGPA 3I3LA 3EUAA 2OTLI 2DT6A 3G1OA 4A0XA 5JVGF 3CTAA 4ZYHA 2WWYA 1VQ9I 3ERED 4P96A 4H0EA 4BE0A 1VQ5I 4UUSB 4HBLA 1D1CA 2VQCA 3P9IA 4A3GJ 1ETYA 3GVAA 3KLNA 2HTSA 3PFYA 2WAQN 3FXUA 1MBFA 1E0EA 2K5CA 2QWWA 1VQKI 2AQFA 2DA3A 1SMTA 5IP7J 1OPCA 2OC6A 1NHAA 4JK1X 3JRAA 2DA5A 3F72A 1ZQ3P 2QVOA 2PFBA 3O8GA 3H9GA 1LQ1A 1SD6A 2VL8A 4BYYA 1R71A 3H5AA 5C4XJ 2FD5A 2NS8A 3Q5FA 3LSIA 3TDUC 3EETA 3FDYA 1OLTA 2L02A 3IL2A 1JKOC 1KQ9A 2D45A 5K5RA 1MD0A 4NQWB 2WAEA 4ESBA 1LEBA 2MSYA 4ZYGA 4J01A 3TP3A 1RESA 2EV6A 3FWEA 3CC7I 1QPMA 1BOAA 1UG2A 2XKOA 2XRLA 3HOSA 1HC8A 1AA7A 1T8IA 2A6HF 4FISA 5M3FJ 3QPLA 1N75A 4DIQA 1USTA 4LG0A 1ULYA 4OOIA 1Z7UA 3OL3A 1R49A 2VE8A 3D5LA 3HOUJ 3J7AY 2GIZA 4MIMA 4FASD 2ID6A 3KYLA 3N97A 3F6VA 1FOKA 2PEXA 2CJJA 2NVQJ 2CV1A 2CQNA 2COMA 3ZQCA 5DYMA 3RZDJ 3PJRA 4RDUA 1IZ1A 2EINH 1UHWA 1PP7U 1LVAA 5EYRA 3L09A 1CF7B 1RNLA 4MQVA 4XN3A 2FA5A 3ERMA 4XLNF 1MSFC 4IOAF 2A3SA 2EZHA 3PUFA 5FO5A 1XD7A 2DOFA 4KT5C 2JJ7A 3FXKA 2VC0A 4C2UA 1D8JA 1TTYA 4M71A 2XGXA 5B1AH 2GXGA 1I6XA 1PJRA 2E71A 2K9LA 1ORKA 2AXLA 4XRSA 3JR9A 1VTNC 2HVSA 1LB2A 2W00A 2XAQA 3PSFA 4M9SA 1SD5A 4WXHA 2VQGA 2LF8A 5LGTA 1V5GA 1JT6A 4MTDA 3DEWA 1R6RA 1XSXA 4ZDOA 1OYWA 1AKHA 5CJ9A 4HZFA 1FOYA 3H0DA 5FKNA 3JSPA 2E19A 2HKXA 2XHKA 2MD5A 4AIJA 3LAJA 1WJEA 5IT9K 1QPIA 1FYLA 1YW7A 2MLKA 4B43A 2EFQA 2ZJ2A 1DDNA 3VWBA 3HOVJ 1D1AA 1ITYA 5J1YA 1TWCJ 1XC5A 1WKMA 1JGSA 1USSA 2B63J 3D5SC 4GDFA 5JHFA 2ESHA 3V8LA 5A2QZ 5FGMA 4S04A 4EJUA 5DUIA 4IVNA 5GP9A 2X6OA 3OR2C 4RMNA 3BJ6A 5H6QA 5IYBJ 1O3TA 3E97A 2WADA 4XK4A 4YRVA 2QSGX 1QVTA 4II2A 3HL2A 3RZOJ 2HPIA 2ZMEB 3MKLA 4PUSA 4XRMA 1YFHA 1YIOA 2M87A 4ENKA 1Z6RA 4OU0A 4PFPA 2JA6J 3K1MA 1W36D 2JRTA 2V26A 3ABKH 1LVKA 1TW2A 4IEJA 4RAYA 4B44A 2VLAA 2HDCA 1Y8RB 3VSKA 2XSJC 1R9TJ 4A5MA 4S0HB 1ON2A 1TBXA 4KMFA 4NNJA 4F92B 4OIOF 3WTSC 2A61A 5FLXZ 3HHGA 3O6BB 4W1UA 5IY5H 4U0WA 4HLXA 3NEUA 4XOPA 2FOWA 3U1DA 4BKXA 4DZPA 4AVPA 4IHWA 4AC0A 3HUGA 1BJAA 1BI0A 4BHBA 1U9NA 2JVHA 3TBIA 5C4JJ 3OYCA 2DT7B 3TOBA 2F5CA 1MH3A 2ZJQF 2MC4A 2KIMA 3CDIA 4I09A 2V1UA 3S2WA 3ZMDA 3G2BA 4PFOA 1B72A 4IQJA 2H6CA 4IZZA 4WXDA 4Y33A 5FFZA 3P9KA 3WGGA 4BL0B 4G12A 1FWZA 5ICCA 4X0GA 4U0VA 5D5UB 2CQKA 1WI3A 5LBQA 2ME6A 1GHCA 2KQRA 2A07F 2NAZA 1MJBA 4EQQA 1YIJI 2QSFX 1T2KA 2ZSHB 2XPVA 3OS0A 4A93J 5E3OA 2NOGA 4M6YA 2Z9OA 4CCLA 3ASNH 2XF5A 1BJZA 2P4WA 3IKTA 2VJ4A 1F1ZA 5J1UA 3CDLA 4LFUA 2LC2A 4G94A 2DMQA 1XMXA 2FU4A 2V4JC 1YI2I 5D6FA 2M2EA 2DMTA 1ZR4A 2UXNA 1LJ9A 3HM5A 1T56A 2EZLA 1A36A 2BY0A 2JSCA 1V55H 1ODDA 3QODA 1LE8B 1OCPA 2DODA 2R5YA 5FFXA 3K0LA 5HS8A 3O8HA 1LFUP 2HYJA 3D1NI 4HF0A 2DQLA 3BPXA 2O0YA 4BS9A 4A3IJ 3B6CA 2XRNA 1E17A 1S7AA 4HSTA 4ZJZA 4NC8A 1K61A 2HQAA 2HS5A 1ETXA 2M3AA 2ID3A 3HDDA 5LRSA 1QZEA 3BWGA 1P7JA 2X1CA 3E6BA 2IA1A 2HZDA 2IA2A 4I02A 2QCOA 2JUGA 3M3YJ 1MIJA 2PMZA 2X51A 4LLNA 4CA0A 4OMYA 1B9NA 5E3LA 1MJ9A 4UUSA 5L3GA 4HG2A 4LJZF 5F08A 1EA3A 1XX5A 4OMZA 4P55A 5CVIA 2KRFA 5DM7F 2XKPA 2QGUA 3JSOA 2PBIA 3CCUI 1YE9A 4WF2A 1G8XA 3MZYA 3SFIA 5CPRB 4N0BA 3EYIA 4OIQF 1YTYA 2CMPA 1VFCA 2VOOA 2PMHA 2BY3A 2HU9A 2EA4A 2LY2A 3E5UA 1LUJB 1WJBA 1X4OA 4L5EA 4L9VA 4YIRX 1IGNA 1JJ8C 5FKMA 3QPHA 4A3JJ 2TCTA 3F0CA 3KE2A 1HKQA 2STTA 5L3DA 4IHVA 4NQWA 3J81Z 4EJOA 5HDKA 1LKXA 1DU0A 2Z3YA 5HNHA 4FHTA 2ZXHA 3FK7A 4AD9A 3JAMK 3RPQA 1WVRA 2XF6A 2X4HA 1JTXA 3RYPA 4RAZA 3OOUA 1OYIA 3IUOA 4D7NA 3L2VA 2Y30A 4BUPA 3R0JA 2XAUA 2L9VA 4RBOA 4DBQA 1ETOA 2JSPA 5E8IA 1H89C 4HF1A 4XKCA 3GZ5A 1GDTA 2PMUA 4LGWA 4ETSA 1S7OA 4KICA 4F3QA 2OTJI 2ZNZA 1QHHD 2IJLA 3BR5A 3K4LA 1SVMA 3L00A 1FZPB 3GEZA 2DA6A 2XASA 3CUOA 3KP7A 3ZQHA 1FP2A 1Z3XA 5H20A 2FRHA 3ZN1A 3PNTA 1CF7A 2A6EF 2DT5A 3OYMA 5K7ZA 5B66C 3PFIA 3DFGA 2HEOA 1HSTA 2JK3A 2R7OA 3WODF 2P5LC 1R5ID 4WX9A 4Y15A 3KP6A 2IA0A 3AG4H 4I99C 2P6TA 1V54H 4NC7A 3RKYA 3ML6A 1T0FC 1WCMJ 3IH2A 2CH0A 3CMMA 3HEFA 2E1CA 5ILSA 5HLTA 5AIQA 2XF7A 2G7UA 5EG0B 3FXLA 2R3SA 4ABZA 2HQNA 2J5OA 3ZOBA 3WU2C 3HKZA 1ZREA 1JGGA 1R4MB 1TNTA 3BZCA 5FJ8J 2LKSA 5EGOB 4MFDA 3UR3C 4BJTA 4M74A 3RCOA 4CDGA 4FTHA 4BY1J 2P5VA 3K69A 2GOMA 3H1CA 4FE4A 4MEXF 2LKPA 1U0JA 4A69C 3OIOA 3H35A 2QQ9A 1ZARA 3AG2H 4X1EA 1P4AA 3OYBA 1SEUA 4L9NA 1Y6IA 2PJPA 3OYNA 3G73A 2WC2A 1H88C 2XPWA 2ACJA 1G3SA 4RLQA 2LFBA 4E7IA 1ZKGA 3DCFA 2E7WA 1EH8A 2L9RA 3KLOA 1BR2A 3UNGC 2ZMEA 2FJ1A 1WI9A 2NVXJ 4QSHA 2STWA 3O3KA 1FIAA 4A0YA 3KETA 4DQ2A 3VSLA 3I4NJ 2K4BA 3ZR8X 2W1OA 2UV1A 3J7AO 1X2NA 4BGDA 4YIFA 4IPAA 4BXXJ 3FBNB 2VBYA 5M5XJ 2DA4A 2A5WA 1X4PA 5L3CA 1X3ZB 2M9HA 5GAHJ 3EUHC 1RR8C 2R7FA 2KDOA 1K83J 2YX7A 9ANTA 3BOQA 5ICEA 3OR1C 5HS9A 1IW7F 3CLQA 1WJDA 2W85A 2VKEA 1EV7A 2CRGA 1Z05A 1UZCA 2E34A 4DW6A 4XR6A 2ZJPF 5HDNA 1BM9A 5J8FA 3RQIA 3TDZC 3DBLB 1WWXA 1TWHJ 4UV8A 2M5WA 1X1PA 2VQHA 1LFPA 4MEYF 2GBYA 4LK1F 1KONA 3HSRA 2K9MA 1OMIA 2DFHA 4C30A 5M3MJ 2JT1A 1ZLJA 5BMZA 2WAQA 3JRCA 1YJWI 4BJ6C 3BJOA 2VIXA 1RIOH 4L9TA 1LDDA 2M4GA 1S8NA 2NYXA 1YG2A 4L18B 2VODA 2CFOA 3ASOH 4MO7A 5JI6A 2RV8A 3IHUA 2M34A 1X58A 1FX7A 1KU9A 3BG6A 4ESFA 4E7HA 4O5VA 5BQTA 1W7PA 1YYVA 2KZGA 4RB1A 3IAM2 3T5XA 2AQEA 1PUEE 1O4XA 1YW9A 3CZ6A 4HV6A 1QGPA 5CYVA 2ESNA 2OQGA 3BR0A 4UXNA 3LQQA 4XOTA 2O03A 2OCEA 4KNYA 3RSNA 3QOPA 5TJJA 3FMSA 3RIRA 4ASNA 2FMYA 2K85A 2R0QC 1Z6TA 1LE8A 1Z0XA 2HZTA 5ICGA 3U9GA 2VC1A 3RJPA 3CQZJ 3Q9VA
chains in the Genus database with same CATH topology
5LEKA 4HYEA 3SQNA 3IWZA 2K86A 3PQJA 3SZPA 3F21A 2PI0A 1BIBA 4XSZF 4EJTA 5F64A 3GF2A 3GXOA 1STZA 2CFXA 3WG9A 1ZRFA 3F8BA 4KIBA 2QYOA 1FBUA 3P9CA 1MKMA 3TQNA 2QM3A 1TW3A 3NRVA 1BI3A 1X3UA 2UZKA 4HAMA 3WE3A 4WK8F 3F6OA 4RB3C 1R1TA 1G3WA 4BH9A 3RKWA 1IXRC 3I64A 2HYFA 4M72A 1R22A 3DPLC 3ZMZA 1J7KA 1FC3A 5L3BA 5ED4A 2EV0A 1J0RA 1E2XA 4CHUA 3FX3A 5DUKA 1B1BA 1Z1DA 1O7FA 2XIGA 2W84A 2RC4A 1UB9A 3HSEA 3DPTA 4EV0A 3KP2A 2FBHA 3EYYA 4I0AA 4LB5A 2OZUA 4XBFA 2RGVA 1DUXC 3LA7A 1B59A 3F8CA 2CW0F 1U5TB 1UHMA 3WTXC 3TO7A 2VBZA 2C6YA 2VBXA 2D1HA 2OQRA 3CUQB 3VB2A 2ZXJA 1R1UA 5ERIA 3HHHA 5AIPA 1VTNC 3IWFA 3I4PA 4Z2YA 4LMYA 5D4SA 5D6EA 2QQAA 4U7BA 1YS6A 2IW5A 5DV5A 3C1DA 1IRGA 1H9TA 2DK5A 3IRQA 1K78B 1XGMA 2VONA 4G7OF 2A5YB 4KMUX 3F3XA 1HKTA 2O8XA 2K27A 1ZHFA 1D5VA 2UWMA 4UNOA 2XV4S 1S6LA 4GO1A 2OZ6A 3HIFA 2XAJA 3K1PA 3E5XA 3KP5A 3ELKA 1BN5A 4YFKF 1KU2A 4G8XA 4CYDA 1IXSB 2EA2A 4ON0A 3FMRA 1ZYRF 1HBXG 4RS8A 3CJNA 2H94A 1J5YA 5KVRA 1FBQA 3LA3A 2GQQA 2Q8KA 2ADUA 2ELHA 1LEAA 3TKYA 3ZMVA 3RTRA 3VEPA 1QZYA 2F2EA 2ZBKA 1UCRA 1TLHB 1QNTA 5F1RA 1B4AA 3HRUA 4L0ZB 3L2CA 5E17F 4BXUA 5ILVA 2DFIA 2P7CB 4Q5SF 1F4KA 3M8EA 2RN7A 2EFWA 3DQVC 3LSTA 4A12A 2FF4A 2GA1A 2V79A 4G7HF 3W6JB 2P7VB 3F8MA 2EFOA 1J9IA 2V1XA 1R5GA 1G3YA 2LSOA 3TGNA 4I7HA 1SAXA 1P4WA 3KZYA 3E6MA 5E20A 1JXSA 3E3VA 1FSEA 3DXJF 4S05A 1ZAOA 5DEQA 3FF5A 3WTWC 2IP2A 4LLGF 4EVIA 1RUNA 4RGUA 1ON1A 3DP7A 3I53A 4AIKA 3FM3A 3LWFA 3LFKA 2CGPA 1Z91A 1JE8A 4L5IA 2VE9A 4I0BA 3WTTC 2QQBA 3TO9A 3K2ZA 4HLYA 1KYWA 1A04A 1O7LA 2XROA 1IAWA 4Y13A 2L54A 4L9JA 3MQ0A 1R7JA 4RB0A 3I54A 1AOYA 4M9ZA 5ILUA 4HDUA 2VXZA 4IHTA 1F5TA 3BY6A 2GWRA 5D5XB 4Q4ZF 4YG2F 2BV6A 5HLHA 4HX4A 2RVCA 4BQAA 4WCGA 2BYVE 2A68F 1T6SA 4AIHA 5D5VB 1KQ0A 1OYYA 2QBYB 3HTSB 2HFHA 3T0YA 1I5ZA 3GFLA 2GZWA 1FYKA 1IUYA 3GFMA 2XVCA 2WV0A 3ZMSA 2G9WA 3LQRA 1U5TA 4EJVA 3GUDA 3I71A 3CUQA 4OIPF 2K02A 1P4XA 2K4JA 4ESJA 3QP5A 2DO7A 4R79A 3RDIA 3QRFF 5E1XA 5E8GA 2BE5F 2O6GE 4XRFA 2DTRA 3DF8A 1FSHA 5IT9Z 4P9FA 4I2OA 1XCVA 1R1VA 2J5PA 3KEOA 1K78A 4FX0A 1KA8A 1G6NA 1XSVA 4NB5A 2KIFA 2R7DA 1TQMA 2RQPA 2PLYA 4DNCA 2W57A 3WGHA 1IRFA 4CO8A 2D1VA 4HX8A 4LK0F 1QO0D 2DQRA 2IPQX 3R60A 2F5EA 1MDMB 2P5KA 5CVUA 4EM2A 3JW4A 2EFNA 1LNWA 1Q1HA 1Y0UA 2FOKA 1KU7A 1FY7A 2XAHA 2HQRA 3ECHA 4A6EA 4ZYEA 3TO6A 2YX4A 3MFKA 1XGOA 4EJWA 2FNAA 4CGZA 5BOXA 2DBBA 1BC8C 1YS7A 3ROUA 4KN4X 2FMLA 3SFZA 4UVCA 2FXAA 1S29A 5CVVA 2KIUA 2YPRA 2VBWA 3J80K 4U0YA 1BI1A 1T98A 2RDPA 3M9AA 3B73A 4HX7A 2GA2A 5K5QA 1I27A 5FB2A 3FM5A 2QENA 2RKHA 2M8EA 2X0LA 3FHZA 3H3ZA 4O6JA 1H0MA 3CO6C 5LHHA 1L0OC 1ZGJA 3CDHA 5JHUA 5DD4A 1OR7A 2F5FA 4GYGA 4FX4A 2H27A 2QZ8A 2XUBA 1ONVA 3EQLF 3KCCA 2PN6A 3WE2A 4ZYDA 2LNBA 4MNUA 4PCQA 1YW8A 5D8LB 2ZCWA 4G6DA 1REPC 2M45A 5DDGA 3C18A 2Z5UA 4KN7X 1J75A 3KP4A 4E70A 3LA2A 2DPDA 1S3JA 2FBKA 1KU3A 1U3EM 5E1WA 2EJRA 4PDKA 4ZZDA 4KA4A 4R8HA 3SHFA 5JFRA 5LEJA 5DCMB 4U88A 3QU6A 1IN6A 3JAMZ 4MHGA 4G7ZF 3OV8A 4LD5A 2ZO4A 2FNPA 5K1YA 3MEXA 5KK1A 3BJAA 3HRMA 3D0SA 3QP6A 1DPUA 2KJCA 4M9XA 2CO5A 1TNSA 2NRAC 1C0WA 4P5OA 5HVQC 2VT3A 3GW2A 4MTEA 4PGGA 3KZZA 3WTYC 4G9YA 2GXBA 1U8RA 4WXCA 2QBYA 2JZYA 3VODA 1QZZA 1OKRA 3LAPA 5A2QK 1T39A 3COAC 4KIFA 4HDVA 3BP8A 4UHTA 4HW0A 1ZLKA 3W6KB 1U6GA 1I1GA 5J6XA 3DKWA 1FBSA 3CLOA 3IRRA 2L01A 1HQCA 1H9GA 4EGZA 1QBJA 2DK8A 4TV7A 2AS5F 1GXQA 2QLZA 5FLXK 5E1ZB 4I01A 4P9UA 4CXFA 2XAFA 5DD8A 4IXAA 1JHHA 2V1DA 1HW1A 3KEQA 3VOEA 3P7NA 2WTEA 5JR3A 1XGNA 1ZH5A 3K9TA 4BHPA 3GZ6A 2EWNA 1P6RA 2VOPA 1MDMA 1WSUA 3MZHA 2OBPA 4A2UA 3N4MA 1FNNA 2DU9A 5D4RA 3L9FA 4LLLA 3ZMTA 1W5SA 4XSXF 5LLQA 1HXDA 1U2WA 3SXYA 3HRSA 5F6FA 1R23A 2FQ3A 4KIGA 3M8FA 1O57A 4IRIA 5JVTA 3WTUC 2L4AA 4A5NA 3E6DA 4GGGA 3VFZA 1O3RA 4ZH4F 1R5HA 1HKSA 3V7SA 2K7LA 4A6DA 2FSWA 2Y48A 3WTZA 3AAFA 2TDXA 1MGTA 1GVJA 1IN4A 2P8TA 2QUFA 3I59B 1TQPA 3V7RA 2PG4A 5J8CA 2Y0MA 4L0YB 3HSFA 4EM0B 2KJBA 2HYGD 2FBIA 3M1EA 5CVRA 2CG4A 4KUMA 4GCVA 3WU0A 4KYWA 3V8JA 3T8TA 5IT3A 5LHIA 3J81K 2BEOA 1B9MA 3MAJA 3IKVA 1W7PD 2NNNA 2CSOA 3ZP5A 4RGRA 1ZRDA 2FE3A 5L3EA 2MC3A 1T38A 4FT8A 1FLIA 4GYIA 1ZG5A 3NQOA 1U5TC 1IN7A 1XDSA 3ABTA 2BBYA 4ZZLA 1SD4A 3CUQC 1DP7P 3I5UA 5DCFA 1TQIA 1V3FA 4G6QA 4OIRF 2DLLA 4I98B 4KFCA 1SMYF 2OAZA 1QQIA 2V9VA 5DCMA 2ZNYA 1BI2A 3F8NA 1BBYA 4IF4A 4UVBA 4OINF 1G3TA 2P6SA 2H09A 2EB7A 1HSJA 2XAGA 3U2RA 1MZBA 1O3SA 4IRGA 4HA8A 4LB6B 3V4GA 4EGYA 1EH7A 3F8FA 1YQAA 2Z99A 3R0AA 1SFXA 2ETHA 4AWXB 4ENNA 2Z33A 3KP3A 2VN2A 1W7PB 5HDGA 5LGUA 3RYRA 2YU3A 2OU2A 3WGIA 4N9IA 1R00A 1WRJA 2M30A 5LRRA 3ULQB 5BPDA 4IHSA 3GFIA 4CICA 3R6SA 1F9NA 2B0LA 2MH2A 3PQKA 3K1NA 4Y17A 4JBAA 3RPUA 1FPQA 2W24A 4GXOA 3BZ6A 3IC7A 2LF7A 3M7GA 3C7JA 1HW2A 3DV8A 2VT2A 5HOOA 2E7XA 1PP8F 2CYYA 2HR3A 4RGXA 3ABUA 5BS6A 1XMAA 1R36A 1SD7A 2M1BA 1XDUA 4KDPA 1IN8A 3ZPLA 3HRTA 1W5TA 3FZVA 3RI4A 1SFEA 3FXQA 1P2FA 2O3FA 3GLXA 4IJAA 2MA3A 4K2EA 1U78A 4NHJA 3C3WA 3E6CC 1LDJA 4XLPF 3RKXA 1O3QA 2HKOA 3EDPA 4MQ9F 2HTJA 2LDUA 2ISYA 2Q2EA 2RNJA 3QPTA 2EFPA 2GAUA 3GWZA 2DW4A 4EMSA 2GIVA 2OA4A 4YFNF 1XCBA 1DPRA 2JPCA 3I59A 4N9HA 4Q47A 2D2WA 5LGNA 3WTVC 1WQ2A 1PDNC 3QU3A 2G7HA 3R61A 4B8XA 2DI3A 4HQEA 5ICFA 4M6XA 2CWEA 3FMQA 5D5WB 4EM1A 3V8KA 3G3ZA 2JPBA 2DAOA 4UV9A 4LG0B 1J59A 2YR2A 1Z9CA 1XMKA 2HOEA 3CO7C 4BHCA 1ZGAA 2EV5A 1LDKB 1JHFA 2OD5A 3B02A 1K6OA 2NS0A 5CLSA 4F7ZA 5BPIA 2Q0OA 1XSDA 3GYHX 1KGSA 4UUVA 2DPUA 4HV5A 2ZFWA 1B6AA 3BPVA 3HOTA 4RGSA 4A0ZA 3JTGA 3DEUA 4Q48A 1V4RA 2IVMA 1I1SA 4HF2A 3ZN0A 4CZZA 6PAXA 4L5JA 1D3YA 1ZRCA 2Y75A 4ENMA 3MWMA 1J2XA 1ZN2A 1EH6A 2UXXA 3R4KA 2E1NA 3HTUA 3FXRA 1IF1A 1P92A 1MJAA 4QLCU 4RB2C 1RI7A 2F5DA 4PZJA 1UFMA 1YLFA 4ENJA 1FP1D 1XGSA 1SFUA 3E5QA 4HQMA 5TRDA 1ZG3A 4YIIA 2L4MA 1RUOA 1G4DA 3F22A 3QAHA 2V6CA 3TOAA 1AWCA 3GO5A 3T1BA 2ZKZA 2MBFA 1K79A 2O61A 3Q9SA 4UVAA 3REOA 3H3UA 3O2PE 3H92A 3BDDA 1T0FA 3BROA 3GFJA 4PGHA 4WWCA 4JQFA 2L3DA 1D8KA 1KYZA 2BGCA 5E18F 5EEGA 3V7CA 2FEZA 5D8KB 4BAYA 1IN5A 3ZQ7A 1RZ4A 1HW5A 4R1HA 1XB4A 1XN7A 1KQ8A 5L3FA 1R58A 4U7DA 2MH9A 4QWQA 5EEHA 5FD6A 3SZTA 2W25A 4YFXF 5H6RA 4BNCA 1IXCA 5LHGA 2IRFG 1ZG1A 2PQ8A 2KKOA 3I0TA 1BC7C 4IRHA 3ECOA 2ISZA 3F23A 3L7WA 1K7AA 1FT9A 5HLGA 2H6BA 3T8RA 5HLIA 3HYIA 3ZMUA 1W4MA 4O3MA 3OOPA 4B09A 1GXPA 5CVJA 2A69F 3ISPA 1BIAA 3I58A 4MGRA 5AONA 2MLGA 3WU1B 2NNYA 4HOBA 1FYMA 2HWVA 3JTHA 1L3LA 5K5OA 3KFWX 3EUHA 3MCZA 5FD5A 5HS7A 2JTVA 3J80Z 2YSRA 4M73A 2EK5A 3GX4X 1YO5C 2HGCA 2IT0A 4D0PA 1CGPA 4A0XA 3CTAA 4ZYHA 2WWYA 3ERED 4P96A 4H0EA 4HBLA 3P9IA 3GVAA 3KLNA 2HTSA 3FXUA 2QWWA 1SMTA 1OPCA 1NHAA 4JK1X 3F72A 2QVOA 2PFBA 1LQ1A 1SD6A 4BYYA 3Q5FA 3TDUC 3EETA 3IL2A 2L02A 1KQ9A 2D45A 5K5RA 1MD0A 4ESBA 1LEBA 4ZYGA 2EV6A 3FWEA 1QPMA 1BOAA 2XKOA 3HOSA 2A6HF 1USTA 4LG0A 1ULYA 4OOIA 1Z7UA 2VE8A 3D5LA 3N97A 3F6VA 1FOKA 2PEXA 2COMA 5DYMA 1IZ1A 1UHWA 1PP7U 1LVAA 3L09A 1CF7B 1RNLA 4MQVA 4XLNF 2FA5A 2A3SA 5FO5A 1XD7A 4KT5C 2VC0A 1D8JA 1TTYA 4M71A 2XGXA 2GXGA 1I6XA 2AXLA 1LB2A 4M9SA 2XAQA 4WXHA 1SD5A 2LF8A 5LGTA 4MTDA 1XSXA 1OYWA 5CJ9A 4HZFA 3JSPA 2HKXA 2XHKA 2MD5A 4AIJA 3LAJA 5IT9K 1FYLA 1YW7A 2MLKA 1DDNA 2EFQA 2ZJ2A 1WKMA 1JGSA 1USSA 2ESHA 3V8LA 5A2QZ 5FGMA 4S04A 4EJUA 5DUIA 4IVNA 5H6QA 3BJ6A 1O3TA 3E97A 2ZMEB 1YFHA 1YIOA 2M87A 4ENKA 1Z6RA 4OU0A 3K1MA 2JRTA 4RAYA 1TW2A 2HDCA 4A5MA 1ON2A 1TBXA 4KMFA 4OIOF 3WTSC 2A61A 5FLXZ 3HHGA 3O6BB 4U0WA 4HLXA 3NEUA 3U1DA 4AVPA 3HUGA 1BJAA 1BI0A 4BHBA 3TOBA 2F5CA 2KIMA 4I09A 2V1UA 3S2WA 3ZMDA 2H6CA 4WXDA 5FFZA 3P9KA 3WGGA 1FWZA 5ICCA 4U0VA 5D5UB 2CQKA 5LBQA 1GHCA 2A07F 2NAZA 1MJBA 4EQQA 1T2KA 4M6YA 2Z9OA 2P4WA 3IKTA 1F1ZA 4LFUA 4G94A 2FU4A 5D6FA 2UXNA 1LJ9A 2JSCA 1ODDA 5FFXA 3K0LA 5HS8A 4HF0A 2DQLA 3BPXA 2O0YA 2XRNA 1E17A 1S7AA 2HS5A 5LRSA 3BWGA 3E6BA 2IA1A 2IA2A 4I02A 4LLNA 4OMYA 1B9NA 1MJ9A 5L3GA 4LJZF 4OMZA 5CVIA 4P55A 2KRFA 2XKPA 3JSOA 2PBIA 4WF2A 3MZYA 4N0BA 3EYIA 4OIQF 1YTYA 2VOOA 2PMHA 3E5UA 2EA4A 4L9VA 3QPHA 3KE2A 1HKQA 2STTA 5L3DA 4NQWA 3J81Z 4EJOA 5HDKA 2Z3YA 4FHTA 4AD9A 3JAMK 3RPQA 2X4HA 3RYPA 4RAZA 1OYIA 3R0JA 5E8IA 4HF1A 3GZ5A 2PMUA 4LGWA 4ETSA 1S7OA 4KICA 2ZNZA 2IJLA 1FZPB 3L00A 3GEZA 2XASA 3KP7A 3CUOA 1FP2A 5H20A 2FRHA 3ZN1A 1CF7A 2A6EF 2DT5A 3PFIA 3DFGA 2HEOA 1HSTA 3WODF 2P5LC 4WX9A 4Y15A 3KP6A 2IA0A 2P6TA 3RKYA 3ML6A 2E1CA 5ILSA 5AIQA 2G7UA 2R3SA 2HQNA 2J5OA 1ZREA 1TNTA 4M74A 4CDGA 2P5VA 3K69A 4MEXF 2LKPA 2QQ9A 1ZARA 1P4AA 4L9NA 2PJPA 3G73A 2WC2A 2ACJA 1G3SA 2E7WA 1EH8A 3KLOA 2ZMEA 1WI9A 2STWA 3O3KA 4A0YA 3KETA 4DQ2A 2K4BA 3J7AO 4YIFA 4IPAA 2VBYA 5L3CA 2R7FA 2YX7A 3BOQA 5ICEA 5HS9A 1IW7F 2W85A 1EV7A 1Z05A 5HDNA 1BM9A 5J8FA 3TDZC 1WWXA 4UV8A 2M5WA 4MEYF 4LK1F 3HSRA 1OMIA 2JT1A 1ZLJA 5BMZA 3BJOA 1RIOH 4L9TA 1LDDA 2NYXA 1S8NA 4L18B 1YG2A 2VODA 5JI6A 2RV8A 3IHUA 1FX7A 1KU9A 4ESFA 4O5VA 5BQTA 1W7PA 1YYVA 4RB1A 3T5XA 1PUEE 1YW9A 4HV6A 1QGPA 5CYVA 2ESNA 2OQGA 4UXNA 3LQQA 2O03A 4KNYA 3QOPA 5TJJA 3FMSA 3RIRA 4ASNA 2FMYA 1Z6TA 2HZTA 5ICGA 3U9GA 2VC1A 3RJPA 3Q9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LEK A;  4HYE A;  3SQN A;  3IWZ A;  2K86 A;  3PQJ A;  3SZP A;  3F21 A;  2PI0 A;  1BIB A;  4XSZ F;  4EJT A;  5F64 A;  3GF2 A;  3GXO A;  1STZ A;  2CFX A;  3WG9 A;  1ZRF A;  3F8B A;  4KIB A;  2QYO A;  1FBU A;  3P9C A;  1MKM A;  3TQN A;  2QM3 A;  1TW3 A;  3NRV A;  1BI3 A;  1X3U A;  2UZK A;  4HAM A;  3WE3 A;  4WK8 F;  3F6O A;  4RB3 C;  1R1T A;  1G3W A;  4BH9 A;  3RKW A;  1IXR C;  3I64 A;  2HYF A;  4M72 A;  1R22 A;  3DPL C;  3ZMZ A;  1J7K A;  1FC3 A;  5L3B A;  5ED4 A;  2EV0 A;  1J0R A;  1E2X A;  4CHU A;  3FX3 A;  5DUK A;  1B1B A;  1Z1D A;  1O7F A;  2XIG A;  2W84 A;  2RC4 A;  1UB9 A;  3HSE A;  3DPT A;  4EV0 A;  3KP2 A;  2FBH A;  3EYY A;  4I0A A;  4LB5 A;  2OZU A;  4XBF A;  2RGV A;  1DUX C;  3LA7 A;  1B59 A;  3F8C A;  2CW0 F;  1U5T B;  1UHM A;  3WTX C;  3TO7 A;  2VBZ A;  2C6Y A;  2VBX A;  2D1H A;  2OQR A;  3CUQ B;  3VB2 A;  2ZXJ A;  1R1U A;  5ERI A;  3HHH A;  5AIP A;  1VTN C;  3IWF A;  3I4P A;  4Z2Y A;  4LMY A;  5D4S A;  5D6E A;  2QQA A;  4U7B A;  1YS6 A;  2IW5 A;  5DV5 A;  3C1D A;  1IRG A;  1H9T A;  2DK5 A;  3IRQ A;  1K78 B;  1XGM A;  2VON A;  4G7O F;  2A5Y B;  4KMU X;  3F3X A;  1HKT A;  2O8X A;  2K27 A;  1ZHF A;  1D5V A;  2UWM A;  4UNO A;  2XV4 S;  1S6L A;  4GO1 A;  2OZ6 A;  3HIF A;  2XAJ A;  3K1P A;  3E5X A;  3KP5 A;  3ELK A;  1BN5 A;  4YFK F;  1KU2 A;  4G8X A;  4CYD A;  1IXS B;  2EA2 A;  4ON0 A;  3FMR A;  1ZYR F;  1HBX G;  4RS8 A;  3CJN A;  2H94 A;  1J5Y A;  5KVR A;  1FBQ A;  3LA3 A;  2GQQ A;  2Q8K A;  2ADU A;  2ELH A;  1LEA A;  3TKY A;  3ZMV A;  3RTR A;  3VEP A;  1QZY A;  2F2E A;  2ZBK A;  1UCR A;  1TLH B;  1QNT A;  5F1R A;  1B4A A;  3HRU A;  4L0Z B;  3L2C A;  5E17 F;  4BXU A;  5ILV A;  2DFI A;  2P7C B;  4Q5S F;  1F4K A;  3M8E A;  2RN7 A;  2EFW A;  3DQV C;  3LST A;  4A12 A;  2FF4 A;  2GA1 A;  2V79 A;  4G7H F;  3W6J B;  2P7V B;  3F8M A;  2EFO A;  1J9I A;  2V1X A;  1R5G A;  1G3Y A;  2LSO A;  3TGN A;  4I7H A;  1SAX A;  1P4W A;  3KZY A;  3E6M A;  5E20 A;  1JXS A;  3E3V A;  1FSE A;  3DXJ F;  4S05 A;  1ZAO A;  5DEQ A;  3FF5 A;  3WTW C;  2IP2 A;  4LLG F;  4EVI A;  1RUN A;  4RGU A;  1ON1 A;  3DP7 A;  3I53 A;  4AIK A;  3FM3 A;  3LWF A;  3LFK A;  2CGP A;  1Z91 A;  1JE8 A;  4L5I A;  2VE9 A;  4I0B A;  3WTT C;  2QQB A;  3TO9 A;  3K2Z A;  4HLY A;  1KYW A;  1A04 A;  1O7L A;  2XRO A;  1IAW A;  4Y13 A;  2L54 A;  4L9J A;  3MQ0 A;  1R7J A;  4RB0 A;  3I54 A;  1AOY A;  4M9Z A;  5ILU A;  4HDU A;  2VXZ A;  4IHT A;  1F5T A;  3BY6 A;  2GWR A;  5D5X B;  4Q4Z F;  4YG2 F;  2BV6 A;  5HLH A;  4HX4 A;  2RVC A;  4BQA A;  4WCG A;  2BYV E;  2A68 F;  1T6S A;  4AIH A;  5D5V B;  1KQ0 A;  1OYY A;  2QBY B;  3HTS B;  2HFH A;  3T0Y A;  1I5Z A;  3GFL A;  2GZW A;  1FYK A;  1IUY A;  3GFM A;  2XVC A;  2WV0 A;  3ZMS A;  2G9W A;  3LQR A;  1U5T A;  4EJV A;  3GUD A;  3I71 A;  3CUQ A;  4OIP F;  2K02 A;  1P4X A;  2K4J A;  4ESJ A;  3QP5 A;  2DO7 A;  4R79 A;  3RDI A;  3QRF F;  5E1X A;  5E8G A;  2BE5 F;  2O6G E;  4XRF A;  2DTR A;  3DF8 A;  1FSH A;  5IT9 Z;  4P9F A;  4I2O A;  1XCV A;  1R1V A;  2J5P A;  3KEO A;  1K78 A;  4FX0 A;  1KA8 A;  1G6N A;  1XSV A;  4NB5 A;  2KIF A;  2R7D A;  1TQM A;  2RQP A;  2PLY A;  4DNC A;  2W57 A;  3WGH A;  1IRF A;  4CO8 A;  2D1V A;  4HX8 A;  4LK0 F;  1QO0 D;  2DQR A;  2IPQ X;  3R60 A;  2F5E A;  1MDM B;  2P5K A;  5CVU A;  4EM2 A;  3JW4 A;  2EFN A;  1LNW A;  1Q1H A;  1Y0U A;  2FOK A;  1KU7 A;  1FY7 A;  2XAH A;  2HQR A;  3ECH A;  4A6E A;  4ZYE A;  3TO6 A;  2YX4 A;  3MFK A;  1XGO A;  4EJW A;  2FNA A;  4CGZ A;  5BOX A;  2DBB A;  1BC8 C;  1YS7 A;  3ROU A;  4KN4 X;  2FML A;  3SFZ A;  4UVC A;  2FXA A;  1S29 A;  5CVV A;  2KIU A;  2YPR A;  2VBW A;  3J80 K;  4U0Y A;  1BI1 A;  1T98 A;  2RDP A;  3M9A A;  3B73 A;  4HX7 A;  2GA2 A;  5K5Q A;  1I27 A;  5FB2 A;  3FM5 A;  2QEN A;  2RKH A;  2M8E A;  2X0L A;  3FHZ A;  3H3Z A;  4O6J A;  1H0M A;  3CO6 C;  5LHH A;  1L0O C;  1ZGJ A;  3CDH A;  5JHU A;  5DD4 A;  1OR7 A;  2F5F A;  4GYG A;  4FX4 A;  2H27 A;  2QZ8 A;  2XUB A;  1ONV A;  3EQL F;  3KCC A;  2PN6 A;  3WE2 A;  4ZYD A;  2LNB A;  4MNU A;  4PCQ A;  1YW8 A;  5D8L B;  2ZCW A;  4G6D A;  1REP C;  2M45 A;  5DDG A;  3C18 A;  2Z5U A;  4KN7 X;  1J75 A;  3KP4 A;  4E70 A;  3LA2 A;  2DPD A;  1S3J A;  2FBK A;  1KU3 A;  1U3E M;  5E1W A;  2EJR A;  4PDK A;  4ZZD A;  4KA4 A;  4R8H A;  3SHF A;  5JFR A;  5LEJ A;  5DCM B;  4U88 A;  3QU6 A;  1IN6 A;  3JAM Z;  4MHG A;  4G7Z F;  3OV8 A;  4LD5 A;  2ZO4 A;  2FNP A;  5K1Y A;  3MEX A;  5KK1 A;  3BJA A;  3HRM A;  3D0S A;  3QP6 A;  1DPU A;  2KJC A;  4M9X A;  2CO5 A;  1TNS A;  2NRA C;  1C0W A;  4P5O A;  5HVQ C;  2VT3 A;  3GW2 A;  4MTE A;  4PGG A;  3KZZ A;  3WTY C;  4G9Y A;  2GXB A;  1U8R A;  4WXC A;  2QBY A;  2JZY A;  3VOD A;  1QZZ A;  1OKR A;  3LAP A;  5A2Q K;  1T39 A;  3COA C;  4KIF A;  4HDV A;  3BP8 A;  4UHT A;  4HW0 A;  1ZLK A;  3W6K B;  1U6G A;  1I1G A;  5J6X A;  3DKW A;  1FBS A;  3CLO A;  3IRR A;  2L01 A;  1HQC A;  1H9G A;  4EGZ A;  1QBJ A;  2DK8 A;  4TV7 A;  2AS5 F;  1GXQ A;  2QLZ A;  5FLX K;  5E1Z B;  4I01 A;  4P9U A;  4CXF A;  2XAF A;  5DD8 A;  4IXA A;  1JHH A;  2V1D A;  1HW1 A;  3KEQ A;  3VOE A;  3P7N A;  2WTE A;  5JR3 A;  1XGN A;  1ZH5 A;  3K9T A;  4BHP A;  3GZ6 A;  2EWN A;  1P6R A;  2VOP A;  1MDM A;  1WSU A;  3MZH A;  2OBP A;  4A2U A;  3N4M A;  1FNN A;  2DU9 A;  5D4R A;  3L9F A;  4LLL A;  3ZMT A;  1W5S A;  4XSX F;  5LLQ A;  1HXD A;  1U2W A;  3SXY A;  3HRS A;  5F6F A;  1R23 A;  2FQ3 A;  4KIG A;  3M8F A;  1O57 A;  4IRI A;  5JVT A;  3WTU C;  2L4A A;  4A5N A;  3E6D A;  4GGG A;  3VFZ A;  1O3R A;  4ZH4 F;  1R5H A;  1HKS A;  3V7S A;  2K7L A;  4A6D A;  2FSW A;  2Y48 A;  3WTZ A;  3AAF A;  2TDX A;  1MGT A;  1GVJ A;  1IN4 A;  2P8T A;  2QUF A;  3I59 B;  1TQP A;  3V7R A;  2PG4 A;  5J8C A;  2Y0M A;  4L0Y B;  3HSF A;  4EM0 B;  2KJB A;  2HYG D;  2FBI A;  3M1E A;  5CVR A;  2CG4 A;  4KUM A;  4GCV A;  3WU0 A;  4KYW A;  3V8J A;  3T8T A;  5IT3 A;  5LHI A;  3J81 K;  2BEO A;  1B9M A;  3MAJ A;  3IKV A;  1W7P D;  2NNN A;  2CSO A;  3ZP5 A;  4RGR A;  1ZRD A;  2FE3 A;  5L3E A;  2MC3 A;  1T38 A;  4FT8 A;  1FLI A;  4GYI A;  1ZG5 A;  3NQO A;  1U5T C;  1IN7 A;  1XDS A;  3ABT A;  2BBY A;  4ZZL A;  1SD4 A;  3CUQ C;  1DP7 P;  3I5U A;  5DCF A;  1TQI A;  1V3F A;  4G6Q A;  4OIR F;  2DLL A;  4I98 B;  4KFC A;  1SMY F;  2OAZ A;  1QQI A;  2V9V A;  5DCM A;  2ZNY A;  1BI2 A;  3F8N A;  1BBY A;  4IF4 A;  4UVB A;  4OIN F;  1G3T A;  2P6S A;  2H09 A;  2EB7 A;  1HSJ A;  2XAG A;  3U2R A;  1MZB A;  1O3S A;  4IRG A;  4HA8 A;  4LB6 B;  3V4G A;  4EGY A;  1EH7 A;  3F8F A;  1YQA A;  2Z99 A;  3R0A A;  1SFX A;  2ETH A;  4AWX B;  4ENN A;  2Z33 A;  3KP3 A;  2VN2 A;  1W7P B;  5HDG A;  5LGU A;  3RYR A;  2YU3 A;  2OU2 A;  3WGI A;  4N9I A;  1R00 A;  1WRJ A;  2M30 A;  5LRR A;  3ULQ B;  5BPD A;  4IHS A;  3GFI A;  4CIC A;  3R6S A;  1F9N A;  2B0L A;  2MH2 A;  3PQK A;  3K1N A;  4Y17 A;  4JBA A;  3RPU A;  1FPQ A;  2W24 A;  4GXO A;  3BZ6 A;  3IC7 A;  2LF7 A;  3M7G A;  3C7J A;  1HW2 A;  3DV8 A;  2VT2 A;  5HOO A;  2E7X A;  1PP8 F;  2CYY A;  2HR3 A;  4RGX A;  3ABU A;  5BS6 A;  1XMA A;  1R36 A;  1SD7 A;  2M1B A;  1XDU A;  4KDP A;  1IN8 A;  3ZPL A;  3HRT A;  1W5T A;  3FZV A;  3RI4 A;  1SFE A;  3FXQ A;  1P2F A;  2O3F A;  3GLX A;  4IJA A;  2MA3 A;  4K2E A;  1U78 A;  4NHJ A;  3C3W A;  3E6C C;  1LDJ A;  4XLP F;  3RKX A;  1O3Q A;  2HKO A;  3EDP A;  4MQ9 F;  2HTJ A;  2LDU A;  2ISY A;  2Q2E A;  2RNJ A;  3QPT A;  2EFP A;  2GAU A;  3GWZ A;  2DW4 A;  4EMS A;  2GIV A;  2OA4 A;  4YFN F;  1XCB A;  1DPR A;  2JPC A;  3I59 A;  4N9H A;  4Q47 A;  2D2W A;  5LGN A;  3WTV C;  1WQ2 A;  1PDN C;  3QU3 A;  2G7H A;  3R61 A;  4B8X A;  2DI3 A;  4HQE A;  5ICF A;  4M6X A;  2CWE A;  3FMQ A;  5D5W B;  4EM1 A;  3V8K A;  3G3Z A;  2JPB A;  2DAO A;  4UV9 A;  4LG0 B;  1J59 A;  2YR2 A;  1Z9C A;  1XMK A;  2HOE A;  3CO7 C;  4BHC A;  1ZGA A;  2EV5 A;  1LDK B;  1JHF A;  2OD5 A;  3B02 A;  1K6O A;  2NS0 A;  5CLS A;  4F7Z A;  5BPI A;  2Q0O A;  1XSD A;  3GYH X;  1KGS A;  4UUV A;  2DPU A;  4HV5 A;  2ZFW A;  1B6A A;  3BPV A;  3HOT A;  4RGS A;  4A0Z A;  3JTG A;  3DEU A;  4Q48 A;  1V4R A;  2IVM A;  1I1S A;  4HF2 A;  3ZN0 A;  4CZZ A;  6PAX A;  4L5J A;  1D3Y A;  1ZRC A;  2Y75 A;  4ENM A;  3MWM A;  1J2X A;  1ZN2 A;  1EH6 A;  2UXX A;  3R4K A;  2E1N A;  3HTU A;  3FXR A;  1IF1 A;  1P92 A;  1MJA A;  4QLC U;  4RB2 C;  1RI7 A;  2F5D A;  4PZJ A;  1UFM A;  1YLF A;  4ENJ A;  1FP1 D;  1XGS A;  1SFU A;  3E5Q A;  4HQM A;  5TRD A;  1ZG3 A;  4YII A;  2L4M A;  1RUO A;  1G4D A;  3F22 A;  3QAH A;  2V6C A;  3TOA A;  1AWC A;  3GO5 A;  3T1B A;  2ZKZ A;  2MBF A;  1K79 A;  2O61 A;  3Q9S A;  4UVA A;  3REO A;  3H3U A;  3O2P E;  3H92 A;  3BDD A;  1T0F A;  3BRO A;  3GFJ A;  4PGH A;  4WWC A;  4JQF A;  2L3D A;  1D8K A;  1KYZ A;  2BGC A;  5E18 F;  5EEG A;  3V7C A;  2FEZ A;  5D8K B;  4BAY A;  1IN5 A;  3ZQ7 A;  1RZ4 A;  1HW5 A;  4R1H A;  1XB4 A;  1XN7 A;  1KQ8 A;  5L3F A;  1R58 A;  4U7D A;  2MH9 A;  4QWQ A;  5EEH A;  5FD6 A;  3SZT A;  2W25 A;  4YFX F;  5H6R A;  4BNC A;  1IXC A;  5LHG A;  2IRF G;  1ZG1 A;  2PQ8 A;  2KKO A;  3I0T A;  1BC7 C;  4IRH A;  3ECO A;  2ISZ A;  3F23 A;  3L7W A;  1K7A A;  1FT9 A;  5HLG A;  2H6B A;  3T8R A;  5HLI A;  3HYI A;  3ZMU A;  1W4M A;  4O3M A;  3OOP A;  4B09 A;  1GXP A;  5CVJ A;  2A69 F;  3ISP A;  1BIA A;  3I58 A;  4MGR A;  5AON A;  2MLG A;  3WU1 B;  2NNY A;  4HOB A;  1FYM A;  2HWV A;  3JTH A;  1L3L A;  5K5O A;  3KFW X;  3EUH A;  3MCZ A;  5FD5 A;  5HS7 A;  2JTV A;  3J80 Z;  2YSR A;  4M73 A;  2EK5 A;  3GX4 X;  1YO5 C;  2HGC A;  2IT0 A;  4D0P A;  1CGP A;  4A0X A;  3CTA A;  4ZYH A;  2WWY A;  3ERE D;  4P96 A;  4H0E A;  4HBL A;  3P9I A;  3GVA A;  3KLN A;  2HTS A;  3FXU A;  2QWW A;  1SMT A;  1OPC A;  1NHA A;  4JK1 X;  3F72 A;  2QVO A;  2PFB A;  1LQ1 A;  1SD6 A;  4BYY A;  3Q5F A;  3TDU C;  3EET A;  3IL2 A;  2L02 A;  1KQ9 A;  2D45 A;  5K5R A;  1MD0 A;  4ESB A;  1LEB A;  4ZYG A;  2EV6 A;  3FWE A;  1QPM A;  1BOA A;  2XKO A;  3HOS A;  2A6H F;  1UST A;  4LG0 A;  1ULY A;  4OOI A;  1Z7U A;  2VE8 A;  3D5L A;  3N97 A;  3F6V A;  1FOK A;  2PEX A;  2COM A;  5DYM A;  1IZ1 A;  1UHW A;  1PP7 U;  1LVA A;  3L09 A;  1CF7 B;  1RNL A;  4MQV A;  4XLN F;  2FA5 A;  2A3S A;  5FO5 A;  1XD7 A;  4KT5 C;  2VC0 A;  1D8J A;  1TTY A;  4M71 A;  2XGX A;  2GXG A;  1I6X A;  2AXL A;  1LB2 A;  4M9S A;  2XAQ A;  4WXH A;  1SD5 A;  2LF8 A;  5LGT A;  4MTD A;  1XSX A;  1OYW A;  5CJ9 A;  4HZF A;  3JSP A;  2HKX A;  2XHK A;  2MD5 A;  4AIJ A;  3LAJ A;  5IT9 K;  1FYL A;  1YW7 A;  2MLK A;  1DDN A;  2EFQ A;  2ZJ2 A;  1WKM A;  1JGS A;  1USS A;  2ESH A;  3V8L A;  5A2Q Z;  5FGM A;  4S04 A;  4EJU A;  5DUI A;  4IVN A;  5H6Q A;  3BJ6 A;  1O3T A;  3E97 A;  2ZME B;  1YFH A;  1YIO A;  2M87 A;  4ENK A;  1Z6R A;  4OU0 A;  3K1M A;  2JRT A;  4RAY A;  1TW2 A;  2HDC A;  4A5M A;  1ON2 A;  1TBX A;  4KMF A;  4OIO F;  3WTS C;  2A61 A;  5FLX Z;  3HHG A;  3O6B B;  4U0W A;  4HLX A;  3NEU A;  3U1D A;  4AVP A;  3HUG A;  1BJA A;  1BI0 A;  4BHB A;  3TOB A;  2F5C A;  2KIM A;  4I09 A;  2V1U A;  3S2W A;  3ZMD A;  2H6C A;  4WXD A;  5FFZ A;  3P9K A;  3WGG A;  1FWZ A;  5ICC A;  4U0V A;  5D5U B;  2CQK A;  5LBQ A;  1GHC A;  2A07 F;  2NAZ A;  1MJB A;  4EQQ A;  1T2K A;  4M6Y A;  2Z9O A;  2P4W A;  3IKT A;  1F1Z A;  4LFU A;  4G94 A;  2FU4 A;  5D6F A;  2UXN A;  1LJ9 A;  2JSC A;  1ODD A;  5FFX A;  3K0L A;  5HS8 A;  4HF0 A;  2DQL A;  3BPX A;  2O0Y A;  2XRN A;  1E17 A;  1S7A A;  2HS5 A;  5LRS A;  3BWG A;  3E6B A;  2IA1 A;  2IA2 A;  4I02 A;  4LLN A;  4OMY A;  1B9N A;  1MJ9 A;  5L3G A;  4LJZ F;  4OMZ A;  5CVI A;  4P55 A;  2KRF A;  2XKP A;  3JSO A;  2PBI A;  4WF2 A;  3MZY A;  4N0B A;  3EYI A;  4OIQ F;  1YTY A;  2VOO A;  2PMH A;  3E5U A;  2EA4 A;  4L9V A;  3QPH A;  3KE2 A;  1HKQ A;  2STT A;  5L3D A;  4NQW A;  3J81 Z;  4EJO A;  5HDK A;  2Z3Y A;  4FHT A;  4AD9 A;  3JAM K;  3RPQ A;  2X4H A;  3RYP A;  4RAZ A;  1OYI A;  3R0J A;  5E8I A;  4HF1 A;  3GZ5 A;  2PMU A;  4LGW A;  4ETS A;  1S7O A;  4KIC A;  2ZNZ A;  2IJL A;  1FZP B;  3L00 A;  3GEZ A;  2XAS A;  3KP7 A;  3CUO A;  1FP2 A;  5H20 A;  2FRH A;  3ZN1 A;  1CF7 A;  2A6E F;  2DT5 A;  3PFI A;  3DFG A;  2HEO A;  1HST A;  3WOD F;  2P5L C;  4WX9 A;  4Y15 A;  3KP6 A;  2IA0 A;  2P6T A;  3RKY A;  3ML6 A;  2E1C A;  5ILS A;  5AIQ A;  2G7U A;  2R3S A;  2HQN A;  2J5O A;  1ZRE A;  1TNT A;  4M74 A;  4CDG A;  2P5V A;  3K69 A;  4MEX F;  2LKP A;  2QQ9 A;  1ZAR A;  1P4A A;  4L9N A;  2PJP A;  3G73 A;  2WC2 A;  2ACJ A;  1G3S A;  2E7W A;  1EH8 A;  3KLO A;  2ZME A;  1WI9 A;  2STW A;  3O3K A;  4A0Y A;  3KET A;  4DQ2 A;  2K4B A;  3J7A O;  4YIF A;  4IPA A;  2VBY A;  5L3C A;  2R7F A;  2YX7 A;  3BOQ A;  5ICE A;  5HS9 A;  1IW7 F;  2W85 A;  1EV7 A;  1Z05 A;  5HDN A;  1BM9 A;  5J8F A;  3TDZ C;  1WWX A;  4UV8 A;  2M5W A;  4MEY F;  4LK1 F;  3HSR A;  1OMI A;  2JT1 A;  1ZLJ A;  5BMZ A;  3BJO A;  1RIO H;  4L9T A;  1LDD A;  2NYX A;  1S8N A;  4L18 B;  1YG2 A;  2VOD A;  5JI6 A;  2RV8 A;  3IHU A;  1FX7 A;  1KU9 A;  4ESF A;  4O5V A;  5BQT A;  1W7P A;  1YYV A;  4RB1 A;  3T5X A;  1PUE E;  1YW9 A;  4HV6 A;  1QGP A;  5CYV A;  2ESN A;  2OQG A;  4UXN A;  3LQQ A;  2O03 A;  4KNY A;  3QOP A;  5TJJ A;  3FMS A;  3RIR A;  4ASN A;  2FMY A;  1Z6T A;  2HZT A;  5ICG A;  3U9G A;  2VC1 A;  3RJP A;  3Q9V A; 
#chains in the Genus database with same CATH topology
 5LEK A;  1QHG A;  1GUU A;  4F52 A;  5M5W J;  3SDG A;  1X1A A;  4HYE A;  3SQN A;  1G59 A;  5F0H A;  2EBI A;  3IWZ A;  5GTI C;  3LSR A;  1GVD A;  3CES A;  2K86 A;  3IAS 2;  3PQJ A;  2KIS A;  3SZP A;  3BTJ A;  3E7L A;  3F21 A;  1BIB A;  2PI0 A;  4XSZ F;  3IH3 A;  4EJT A;  3DBR B;  1RC9 A;  3PSI A;  5F64 A;  3K4B A;  3GF2 A;  3GXO A;  1JUS A;  1STZ A;  3OS1 A;  2CFX A;  2M4K A;  3WG9 A;  1ZRF A;  3CC4 I;  2BZT A;  3F8B A;  4KIB A;  2QYO A;  2BHY A;  1FBU A;  1BR4 A;  3P9C A;  1MKM A;  3TQN A;  1QA6 A;  2QM3 A;  2HVR A;  1TW3 A;  3NRV A;  1BI3 A;  4DYC A;  5EZG A;  3SJM A;  3AL0 B;  3G6E I;  1X3U A;  3CC2 I;  4XLH A;  5GPC A;  4HNU A;  4HAM A;  2UZK A;  3WE3 A;  4WK8 F;  3C2B A;  3F6O A;  2CQ7 A;  4RB3 C;  1R1T A;  4RAG A;  2LD5 A;  1G3W A;  4BH9 A;  2RQQ A;  3TL4 X;  3RKW A;  1BOB A;  1IXR C;  3I64 A;  3K70 C;  2HYF A;  3QYE A;  1FIP A;  4M72 A;  1R22 A;  4J00 A;  1SAN A;  2HI3 A;  3DPL C;  1TT5 B;  3OYF A;  3OYG A;  1EF4 A;  1TWG J;  2KLO A;  3ZQF A;  3ZMZ A;  1J7K A;  2CV2 A;  2OV7 A;  1FC3 A;  2V9K A;  1K4T A;  5L3B A;  5ED4 A;  1MMG A;  2EV0 A;  4AUX A;  1J0R A;  1HLV A;  3H9Q A;  1E2X A;  2R7S A;  4CHU A;  1MH4 A;  3FX3 A;  5DUK A;  3VYR B;  2BW3 B;  1B1B A;  1Z1D A;  3FIS A;  1O7F A;  2XIG A;  2W84 A;  3ABM H;  2RC4 A;  1UB9 A;  3HSE A;  4A3D J;  2EIK H;  1E3P A;  3DPT A;  4A3M J;  2WA0 A;  4EV0 A;  3Q3S A;  3KP2 A;  2FBH A;  3EYY A;  3HJE A;  4I0A A;  4LB5 A;  2OZU A;  4XBF A;  2RGV A;  3S32 A;  3H36 A;  1DUX C;  1QRY A;  3LA7 A;  1EKE A;  5FKK A;  1B59 A;  3IP4 B;  3F8C A;  2CW0 F;  1U5T B;  1UHM A;  2WY8 Q;  2NS7 A;  3PNY A;  3WTX C;  3TO7 A;  2VBZ A;  1ETW A;  2C6Y A;  2VBX A;  2D1H A;  2MGQ A;  2OQR A;  3CUQ B;  2O7O A;  3VB2 A;  1ETQ A;  2ZXJ A;  1R1U A;  1Y56 A;  5ERI A;  3HHH A;  5AIP A;  2XGE A;  3IWF A;  4PK4 A;  2EZK A;  2AO9 A;  3I4P A;  4FET A;  4P1W A;  2M0C A;  5CQE A;  1VQM I;  3H0G J;  4Z2Y A;  4LMY A;  5D4S A;  2BXY A;  5D6E A;  3JRF A;  2E2H J;  2QQA A;  4NDL A;  2E36 A;  2HNH A;  4U7B A;  1VQ4 I;  2W7N A;  4E7K A;  1YS6 A;  5IPA A;  2IW5 A;  2DJN A;  1SC7 A;  5CKT A;  5EG0 A;  5DV5 A;  3C1D A;  1ZEL A;  1H9T A;  1IRG A;  3CJQ B;  2Y69 H;  4NUB A;  2L9N A;  2DK5 A;  3IRQ A;  1K78 B;  3N05 A;  2LY9 A;  1XGM A;  2VON A;  4G7O F;  2A5Y B;  4KMU X;  3F3X A;  1HKT A;  5EGO A;  2O8X A;  3EPZ A;  4CCM A;  2K27 A;  1GLN A;  1ZHF A;  1U9O A;  1FJL A;  1K4S A;  1D5V A;  2UWM A;  4OAY A;  4UNO A;  1UG0 A;  2XV4 S;  1S6L A;  2LBF B;  4GO1 A;  4DZJ A;  2OZ6 A;  3HIF A;  3S14 J;  2M7A A;  2XAJ A;  3K1P A;  2HDW A;  3E5X A;  3KP5 A;  2AXT C;  3ELK A;  5DTD A;  1BN5 A;  1JKP C;  4YFK F;  1KU2 A;  4G8X A;  1IXS B;  4CYD A;  2EA2 A;  3OYJ A;  4KIS A;  4ON0 A;  3FMR A;  2ZFU A;  3CP2 A;  2LKX A;  1ZYR F;  1HBX G;  4RS8 A;  3CJN A;  2H94 A;  1MND A;  1J5Y A;  2Y9Z A;  5KVR A;  1HOM A;  1FBQ A;  3LA3 A;  2CW8 A;  2WV1 A;  3L2W A;  4A3K J;  2NVT J;  2GQQ A;  3VDX A;  1V5E A;  1YX3 A;  3LFU A;  2Q8K A;  2ADU A;  5JLX A;  3HPH A;  3BT9 A;  2ELH A;  1LEA A;  3TKY A;  3ZMV A;  3AG3 H;  3RTR A;  4KT6 A;  4BAC A;  4Y3O A;  2JVG A;  1QZY A;  3VEP A;  2F2E A;  2ZBK A;  1UCR A;  1Z67 A;  2X85 A;  3K7A J;  3CF5 F;  4D5C A;  3H3V K;  3DLA A;  1TLH B;  1QNT A;  5F1R A;  1B4A A;  3HRU A;  4F91 B;  2DA7 A;  4L0Z B;  2MYS A;  2WAF A;  3L2C A;  1OCZ H;  2X1E A;  2IGK A;  2N8G A;  1SFK A;  5E17 F;  1ETV A;  4BXU A;  3CCV I;  5ILV A;  2HOS A;  2DFI A;  4C2M J;  2P7C B;  5HNF A;  4Q5S F;  2RNG A;  1F4K A;  2KFD A;  3M8E A;  2RN7 A;  2LVS A;  2EFW A;  3DQV C;  4Z6Y A;  5GAE J;  3FBI B;  2R7W A;  3OYA A;  1VQO I;  1I3Q J;  3V42 A;  5E3N A;  3LST A;  2R92 J;  1YJ9 I;  4A12 A;  2FF4 A;  1Z7L A;  5KAI C;  1JT0 A;  2GA1 A;  2MG4 A;  2V79 A;  4G7H F;  1XG1 A;  2D5V A;  3W6J B;  2P7V B;  3A01 B;  3F8M A;  2EFO A;  1OCO H;  2FQ4 A;  3FIW A;  3X2Q H;  3M1C A;  2YS9 A;  3DU6 A;  1J9I A;  2V1X A;  1R5G A;  2XB0 X;  1G3Y A;  2LSO A;  1BL0 A;  3TGN A;  4I7H A;  5KAF C;  4XM3 A;  1SAX A;  3SEZ A;  3HBL A;  4XL9 A;  4B48 A;  3W3C A;  1MSE C;  3Q0W A;  1P4W A;  5K7H A;  1IG7 A;  1X3W B;  3D5R C;  3KZY A;  3E6M A;  5E20 A;  2L5Q A;  3HOX J;  1JXS A;  3E3V A;  1FSE A;  2B7E A;  5B1B H;  3DXJ F;  4S05 A;  1JJ6 C;  1S7E A;  1MW7 A;  1ZAO A;  2BY1 A;  5DEQ A;  2HQ5 A;  3WHC A;  3FF5 A;  3WTW C;  2IP2 A;  4LLG F;  4LOC A;  4EVI A;  1RET A;  1RUN A;  2ZXI A;  4RGU A;  1ON1 A;  1VQL I;  2LMD A;  3DP7 A;  3I53 A;  4PSX A;  2XC7 A;  4AIK A;  3FM3 A;  4BE1 A;  3CCY A;  2ZJR F;  3LWF A;  2H8R A;  3LFK A;  2EQR A;  2F6C A;  2CGP A;  3LMM A;  1Z91 A;  1XTA A;  1JE8 A;  4L5I A;  1HCR A;  2CUE A;  2VE9 A;  4I0B A;  4QTR A;  3W2V A;  3WTT C;  3I4M J;  2QQB A;  4B4C A;  3TO9 A;  3K2Z A;  4X6A J;  4HLY A;  1KYW A;  1APL C;  1BW5 A;  1A04 A;  1O7L A;  5TGT A;  2XRO A;  3IH4 A;  2WB1 N;  1IAW A;  2R7X A;  4Y13 A;  2L54 A;  2ZSI B;  4L9J A;  3S3O A;  1FTT A;  4BDZ A;  3MQ0 A;  1R7J A;  4RB0 A;  2HXI A;  3LSK A;  3I54 A;  1FTZ A;  2E60 A;  2P0W A;  1AOY A;  4M9Z A;  5F04 A;  5ILU A;  2RRE A;  4HDU A;  4ZTF A;  2VXZ A;  4BQO A;  4IHT A;  1F5T A;  2CS3 A;  3BY6 A;  2R5Z B;  2GWR A;  1A6I A;  2E1O A;  4GFB A;  3LSG A;  2MD0 A;  3JRE A;  3G4S I;  5D5X B;  3QYF A;  2CQQ A;  1SFO J;  4Q4Z F;  4YG2 F;  2EZI A;  2BV6 A;  5HLH A;  4HX4 A;  3DKY A;  3F9K A;  2RVC A;  1WJ5 A;  2DOE A;  2L0K A;  1NK3 P;  4BQA A;  1W0U A;  4WCG A;  1X19 A;  1D5Y A;  1YRN B;  2DDB A;  2P81 A;  2BYV E;  2BW3 A;  2A68 F;  2X1D A;  1T6S A;  2I8D A;  3BR1 A;  4AIH A;  3SYT A;  5D5V B;  1KQ0 A;  2Z2S B;  3L2R A;  3DTI A;  1OYY A;  2QBY B;  3HTS B;  2E1M B;  2HFH A;  4A3B J;  3T0Y A;  1I5Z A;  2ZME C;  2K3F A;  3GFL A;  1W0T A;  2KPM A;  2GZW A;  5IYD J;  1FYK A;  1IUY A;  2ICW G;  3GFM A;  2XVC A;  2WV0 A;  2IEK A;  3ZMS A;  1HA8 A;  4PSW A;  4M3E A;  1G2H A;  3BG9 A;  4CCO A;  4JP0 A;  3S1N J;  2G9W A;  4RLF A;  1EJ9 A;  3PO3 J;  3LQR A;  1U5T A;  4EJV A;  3JRI A;  1UJ8 A;  3GUD A;  3MKZ A;  1K6Y A;  1VI0 A;  2I5U A;  2Y0S A;  3I71 A;  4ZTJ A;  4XLE A;  3CUQ A;  4OIP F;  1PYV A;  2K02 A;  1P4X A;  4A3C J;  2K4J A;  4ZYA A;  4ESJ A;  2AHQ A;  1LPQ A;  5B3S H;  3QP5 A;  3GTG J;  2DO7 A;  2LTP A;  1VND A;  4R79 A;  3RDI A;  1IO2 A;  1POG A;  1P7I A;  2CUF A;  1N78 A;  3OSF A;  3QRF F;  5E1X A;  5E8G A;  2BE5 F;  2O6G E;  4XRF A;  3MKW B;  1ZGW A;  2DTR A;  3DF8 A;  1FSH A;  4BJ5 C;  4P9F A;  5IT9 Z;  4I2O A;  1XCV A;  1R1V A;  2WY7 Q;  2J5P A;  1BA5 A;  4YEJ A;  3PO2 J;  4PJN A;  4EAT A;  2M8G X;  1T08 B;  4HPQ A;  3S1Q J;  2XGC A;  3KEO A;  5DS9 A;  3GTL J;  1K78 A;  4FX0 A;  1NK2 P;  1KA8 A;  1G6N A;  1XSV A;  4NB5 A;  1JKQ C;  2KIF A;  4HEA 2;  2R7D A;  4OWR B;  1TQM A;  2RQP A;  2PLY A;  4DNC A;  2W57 A;  3WGH A;  2LBF A;  1TC3 C;  1IRF A;  2DYS H;  4CO8 A;  1B8I B;  2D1V A;  5JLW A;  4HX8 A;  4ZDL A;  4LK0 F;  1QO0 D;  2DQR A;  2IPQ X;  3R60 A;  2ELJ A;  2F5E A;  3FK6 A;  1MDM B;  3DTK A;  3LOC A;  2P5K A;  5CVU A;  4EM2 A;  3JW4 A;  1MMN A;  2EFN A;  3K6G A;  3K4K A;  1IDY A;  3RKQ A;  2JA2 A;  1LNW A;  1Q1H A;  3K4N A;  3K4J A;  5J4Y A;  3OYI A;  2QEX I;  2R7R A;  1Y0U A;  2FOK A;  1KU7 A;  4XQF A;  1FY7 A;  2XAH A;  5EZH A;  2KRC A;  4CZC A;  2HQR A;  3I55 I;  3TMO A;  2VXD A;  3CCS I;  3ECH A;  4A6E A;  2CQX A;  4ZYE A;  3TO6 A;  2YX4 A;  2HVQ A;  2PX9 A;  3MFK A;  1XGO A;  4EJW A;  2FNA A;  4CGZ A;  5H2F C;  4M3B A;  1UMQ A;  1DQU A;  5BOX A;  4KJZ A;  1HDP A;  2DBB A;  2BY2 A;  1BC8 C;  1YS7 A;  5GPA A;  4E7J A;  3LSJ A;  5FLV A;  2W4S A;  2V7F A;  3ROU A;  1MBG A;  1W36 C;  2JN6 A;  4KN4 X;  3M4O J;  2HDD A;  3E1S A;  2O9L A;  2WBM A;  1NTC A;  2FML A;  3SFZ A;  4UVC A;  2FXA A;  3BZK A;  1S29 A;  5CVV A;  2KIU A;  2YPR A;  1ERD A;  2VBW A;  3J80 K;  5HOD A;  1YJN I;  4U0Y A;  5DM6 F;  1BI1 A;  1T98 A;  3BR6 A;  2RDP A;  3M9A A;  3VYU B;  3B73 A;  2JQ7 A;  4HX7 A;  2GA2 A;  5K5Q A;  2OCC H;  3VYT B;  2K9N A;  4G6T B;  1IJW C;  1I27 A;  1OCT C;  3A01 A;  4RAF A;  5FB2 A;  2BXZ A;  3FM5 A;  3PL8 A;  1D1B A;  2F4O B;  2QEN A;  2RKH A;  2Y0S N;  2M8E A;  4LIU A;  1RKW A;  4N4N B;  3CJT B;  3DLL F;  1OCR H;  3L2U A;  4IHY A;  2X0L A;  2E35 A;  3FHZ A;  1Q1V A;  2H1L A;  1FOW A;  3H3Z A;  4O6J A;  1H0M A;  3CO6 C;  5LHH A;  3PIP F;  1L0O C;  1ZGJ A;  3CDH A;  2CV0 A;  5JHU A;  5DD4 A;  4BEH B;  1IC8 A;  1OR7 A;  2F5F A;  2W82 A;  4GYG A;  3S2D J;  3ZQG A;  4FX4 A;  2H27 A;  2QZ8 A;  2XUB A;  4D7M A;  1ONV A;  3EQL F;  3HOZ J;  3KCC A;  4C9Y A;  4BE2 A;  1NG6 A;  2PN6 A;  3OSG A;  3HB9 A;  3FKI J;  4AU7 A;  3WE2 A;  1VQ6 I;  2IS6 A;  1PVE A;  4ZYD A;  2LNB A;  1D0Y A;  4MNU A;  4PCQ A;  1YW8 A;  5D8L B;  3Q0V A;  3I9V 2;  2ZCW A;  3KZI C;  4XNF A;  3W2W A;  5C3E J;  2GLO A;  4G6D A;  1J09 A;  1REP C;  2M45 A;  4BDY A;  3PIO F;  5DDG A;  3QYB A;  3C18 A;  4HNV A;  2Z5U A;  3AFH A;  5J1R A;  4KN7 X;  3OYK A;  1J75 A;  3KP4 A;  1MMA A;  4E70 A;  1W5C C;  2DDA A;  3LA2 A;  3RPU D;  1GV5 A;  2DPD A;  1S3J A;  2COB A;  4MFE A;  2FBK A;  3TP0 A;  1KU3 A;  2XDV A;  1BW6 A;  3BTC A;  1DGW Y;  1U3E M;  5E1W A;  2EJR A;  3BR3 A;  1WJC A;  1I50 J;  4PDK A;  4ZZD A;  5C44 J;  4KA4 A;  4R8H A;  3SHF A;  2X48 A;  2OUM A;  3C2H A;  3ABL H;  5JFR A;  5LEJ A;  1TT0 A;  2NVU B;  5DCM B;  2VKV A;  4U88 A;  3QU6 A;  1IN6 A;  3JAM Z;  3P5J A;  4MHG A;  4G7Z F;  1JUM A;  1NH3 A;  3M07 A;  3OV8 A;  3CCE I;  4LD5 A;  2ZO4 A;  4AVZ A;  1RRJ A;  4CYC B;  2FNP A;  5K1Y A;  3MEX A;  5FKO A;  5KK1 A;  2R5Z A;  3BJA A;  3HRM A;  4QPQ A;  3D0S A;  3QP6 A;  2X6W A;  2HXO A;  2LYC A;  5IOY A;  1DPU A;  2KJC A;  2R7Q A;  2H1K A;  3CD6 I;  4M9X A;  2CO5 A;  2DFF A;  1TNS A;  2FUG 2;  2LOO A;  2GOX B;  1MBE A;  1ZTR A;  4OAZ A;  2NRA C;  1C0W A;  4P5O A;  5HVQ C;  4AM3 A;  2VT3 A;  1YRN A;  3GW2 A;  4MTE A;  1HF0 A;  4PGG A;  2PJR B;  3J7Z I;  3CF2 A;  3KZZ A;  3WTY C;  4G9Y A;  3GTM J;  2GXB A;  3UKG A;  1U8R A;  3QWL A;  4EEF G;  4WXC A;  2QBY A;  2JZY A;  3G71 I;  2KT0 A;  3VOD A;  1QZZ A;  3BQZ A;  4U87 A;  4N4O B;  5EF6 A;  1OKR A;  2KMU A;  3LAP A;  3H5N A;  4IOC F;  2L7Z A;  3GLL A;  5A2Q K;  1T39 A;  4DGW B;  3COA C;  2IS1 A;  4KIF A;  5TIS C;  2VJJ A;  1F36 A;  4HDV A;  3BP8 A;  1UAA A;  4UHT A;  1OJL A;  4HW0 A;  1WH7 A;  1ZLK A;  4CH7 A;  3W6K B;  3KX2 A;  1U6G A;  3J7Y J;  2ELK A;  5IYC J;  1QVU A;  1Z21 A;  3BG7 A;  1I1G A;  2L7M P;  1E3H A;  5J6X A;  3NAR A;  3DKW A;  3MN2 A;  1FBS A;  3CLO A;  1NG7 A;  3IRR A;  1Z77 A;  2L01 A;  4CSW A;  1HQC A;  3ZQL A;  5GTH C;  1H9G A;  2K9Q A;  4EGZ A;  4IKF A;  1X1D A;  2NVY J;  1QBJ A;  2DK8 A;  4TV7 A;  4E7Z A;  2AS5 F;  1GXQ A;  2QLZ A;  5FLX K;  2VQL A;  5E1Z B;  4I01 A;  4P9U A;  4CXF A;  2ZB9 A;  2XAF A;  1YX5 A;  3A2K A;  3BC8 A;  2VPR A;  5DD8 A;  3W6V A;  4IXA A;  1JHH A;  2V1D A;  1VQN I;  1W1W E;  1RPW A;  4ITV A;  1HW1 A;  3KEQ A;  1VF9 A;  3S8P A;  3VOE A;  3P7N A;  2KL4 A;  1B8I A;  2WTE A;  2RAE A;  5JR3 A;  1XGN A;  1ZH5 A;  3K9T A;  2Y31 A;  1IV8 A;  1TZL A;  5EEA A;  4BHP A;  1ZK8 A;  3GZ6 A;  2EWN A;  2IS2 A;  2QSH X;  1P6R A;  5LFA A;  1VQ7 I;  1MDM A;  2VOP A;  3KYC B;  1WSU A;  3MZH A;  2OBP A;  2UUZ A;  4A2U A;  3N4M A;  4H4K C;  5KHD A;  1FNN A;  2I10 A;  2DU9 A;  5D4R A;  3BG3 A;  3L9F A;  3RQ4 A;  4LLL A;  3ZMT A;  3OMY A;  4HRI A;  1W5S A;  4XSX F;  2DN0 A;  4IHX A;  4XLC A;  5LLQ A;  1HXD A;  5BNG A;  3VPR A;  1U2W A;  1XS9 A;  2E2I J;  3SXY A;  2KZV A;  4ZDP A;  4QPO A;  3VYS B;  1DP3 A;  1FMW A;  3HRS A;  3OYL A;  4UB6 C;  4E6K G;  2F5V A;  1V5F A;  5F6F A;  3CJR B;  1R23 A;  2FQ3 A;  3PUB A;  2KP6 A;  4B3X A;  4KIG A;  3M8F A;  1O57 A;  1WJA A;  1ETK A;  4IRI A;  3S16 J;  5JVT A;  3WTU C;  2L4A A;  5GAG J;  4A5N A;  3E6D A;  4GGG A;  3VFZ A;  2TRT A;  1O3R A;  4ZH4 F;  2IGM A;  2VJ5 A;  2CW7 A;  3H5R A;  1JUP A;  1R5H A;  3FHN A;  1RKT A;  2A05 A;  2ECC A;  4XRS G;  5IOZ A;  2YU9 J;  1HKS A;  3Q0U A;  3QQA A;  2Q2E B;  2LR8 A;  2LH9 A;  3SZG A;  3V7S A;  2K7L A;  3MKY B;  3BTI A;  4A6D A;  4AYB N;  2F4I A;  2FSW A;  2L9S A;  1QU3 A;  1T33 A;  2Y48 A;  3MVP A;  3AL0 C;  1WJF A;  4II3 A;  3WTZ A;  3AAF A;  2TDX A;  3B6A A;  3DU5 A;  3CCJ I;  3H9J A;  4Y52 J;  2CU7 A;  1MGT A;  2F48 A;  1GVJ A;  1IN4 A;  1MNE A;  2P8T A;  2WB1 A;  1FEX A;  3M8J A;  2QUF A;  2Y2Z A;  4XLF A;  1OIS A;  3I59 B;  1TQP A;  3BG5 A;  3V7R A;  3CCL I;  2PG4 A;  5J8C A;  5IP6 A;  2Y0M A;  4L0Y B;  1S5L C;  4PJM A;  3HSF A;  4EM0 B;  2KJB A;  2R7Z J;  2HYG D;  2Z1D A;  4NC6 A;  1WH5 A;  1AU7 A;  2FBI A;  2O5R A;  3M1E A;  2DYR H;  1R4N B;  3BQY A;  3TW7 A;  5CVR A;  3JRB A;  2CG4 A;  4KUM A;  4MLO A;  3G1L A;  4GCV A;  4JX4 A;  3HG9 A;  3WU0 A;  4BEH A;  4KYW A;  3LSP A;  3V8J A;  3NAU A;  4M3G A;  3T8T A;  4RM3 A;  4Y7N J;  5IT3 A;  5LHI A;  2GM4 A;  3ZQI A;  3DTE A;  3GTJ J;  3J81 K;  3ZXS A;  2BEO A;  1B9M A;  2E5Z A;  3MAJ A;  3IKV A;  1W7P D;  3ESW B;  2NNN A;  2Q1Z B;  3HGY A;  2CUJ A;  2JRM A;  4M6V A;  2CSO A;  3ZP5 A;  1YHQ I;  3S1R J;  4RGR A;  3OYD A;  2FE3 A;  1ZRD A;  1T95 A;  3HPG A;  2MC3 A;  5L3E A;  1T38 A;  1WGX A;  3BLY A;  4FT8 A;  1FLI A;  4GYI A;  1ZG5 A;  3NQO A;  5IP9 J;  2MFZ A;  3PM1 A;  1IUF A;  3GTO J;  2EPF A;  1MMD A;  1U5T C;  1IN7 A;  1OCC H;  1XDS A;  3SDB A;  1TL8 A;  3ABT A;  2BBY A;  4ZZL A;  1SD4 A;  3CUQ C;  2R7T A;  4KIT B;  1DP7 P;  3I5U A;  5DCF A;  1TQI A;  2DA1 A;  4I76 A;  1V3F A;  2JWT A;  2VPL A;  2ZXW H;  3E0J B;  4G6Q A;  4OIR F;  4DBR A;  2DLL A;  3LL7 A;  4I98 B;  4KFC A;  1SMY F;  2B9S A;  1X2M A;  2OAZ A;  3K10 A;  1QQI A;  2V9V A;  2HPM A;  5DCM A;  2ZNY A;  1BI2 A;  4QIW N;  2OF7 A;  1DU6 A;  3F8N A;  4D5F A;  3TED A;  3DEE A;  1BBY A;  4IF4 A;  2VUM J;  4UVB A;  3HOW J;  1N25 A;  2QKL B;  4OIN F;  1G3T A;  2P6S A;  4CYC A;  2H09 A;  5F1J A;  3A1Y A;  2M7B A;  2EB7 A;  1HSJ A;  4BY7 J;  4UB8 C;  1MMS A;  2XAG A;  3U2R A;  2KHM A;  2XSD C;  1MZB A;  4C3I J;  1O3S A;  2VAS A;  4IRG A;  4HA8 A;  4LB6 B;  1WFX A;  2L7K A;  3V4G A;  2K3P A;  5KNL A;  1X1C A;  4EGY A;  1EH7 A;  3OIQ A;  3F8F A;  2XGD A;  2PJR A;  5FRN A;  3MZ8 A;  4LIT A;  4CCK A;  2LRD A;  1YQA A;  2Z99 A;  3R0A A;  3MMY B;  5EDN A;  2DCE A;  2IAI A;  2H8W A;  3A4C A;  1MNM C;  1SFX A;  2ETH A;  4HSR A;  1MBH A;  4AWX B;  3A02 A;  4ENN A;  1Y1W J;  4E4H A;  4JOM A;  5KCM A;  2Z33 A;  3OIP A;  3IV5 A;  2QKM B;  3JCU C;  3U21 A;  3GTQ J;  4CUG A;  3KP3 A;  4XON A;  1Y8Q B;  2R4G A;  2VN2 A;  1W7P B;  2ECB A;  1MBK A;  5HDG A;  5LGU A;  3RYR A;  3JRH A;  2YU3 A;  5F27 A;  2OU2 A;  1TWA J;  3WGI A;  5K7F A;  4IQ4 A;  2BVL A;  2DTZ A;  4V2F A;  2K40 A;  4N9I A;  4CCJ A;  2V6E A;  3DKX A;  1R00 A;  1WRJ A;  2M30 A;  5LRR A;  3ULQ B;  5BPD A;  4IHS A;  3GFI A;  4LG3 A;  1HDD C;  3CP8 A;  1I6H J;  4CIC A;  3R6S A;  3OYH A;  4XKB A;  1F9N A;  2B0L A;  2MH2 A;  3KYD B;  1I3A A;  1VQP I;  1P9Q C;  3PQK A;  3OYE A;  3K1N A;  2VKH A;  2DXI A;  4Y17 A;  4JBA A;  3RPU A;  1FPQ A;  2W24 A;  3SEQ A;  3NWT A;  4GRI A;  3S93 A;  1Y1V J;  2QF7 A;  4GXO A;  1WHU A;  3BZ6 A;  2G0E A;  3IC7 A;  5FKL A;  2LF7 A;  4C3J J;  2R7U A;  3M7G A;  4I6Z A;  1WZ2 A;  3C7J A;  1HW2 A;  1SAU A;  3LSH A;  1JTY A;  3DV8 A;  3A03 A;  1WPK A;  1JKR C;  2LY1 A;  2VT2 A;  5HOO A;  4J19 A;  4A3F J;  4C3H J;  1Y39 A;  2E7X A;  3ONQ A;  3OY9 A;  1PP8 F;  2CYY A;  4Y4R A;  2HR3 A;  4RGX A;  2JUC A;  2ZC2 A;  3AG1 H;  3ABU A;  2X6X A;  5BS6 A;  1XMA A;  1R36 A;  4W97 A;  1SD7 A;  2M1B A;  3L2Q A;  1XDU A;  1A6Q A;  2E5N A;  4KDP A;  5F0C A;  2BOL A;  1IN8 A;  1A35 A;  3ZPL A;  3FXJ A;  1FOX A;  5GAD J;  3HRT A;  1W5T A;  2NOJ B;  4JX6 A;  3FZV A;  3RI4 A;  1SFE A;  2BHZ A;  4ZC3 A;  3FXQ A;  1P2F A;  3GTK J;  2V1N A;  5F0F A;  2O3F A;  1OR7 C;  1S9H A;  2L7F P;  4B47 A;  4XID A;  1IV6 A;  3GLX A;  4IJA A;  2A6T A;  2MA3 A;  1PUF B;  4K2E A;  3BCB A;  1U78 A;  2KDZ A;  3S3N A;  4FE7 A;  1GT0 C;  4NHJ A;  3C3W A;  1Z3Y A;  2CUZ A;  4IL6 C;  3QOE A;  1AHD P;  1IDZ A;  3E6C C;  1DGR M;  1LDJ A;  4XLP F;  2HOT A;  3RKX A;  1O3Q A;  5EJC A;  4XOR A;  3KIO A;  2HKO A;  2LK2 A;  3PNV A;  3EDP A;  4MQ9 F;  2EIJ H;  2HTJ A;  3CCR I;  2LDU A;  4BU2 A;  2QA4 I;  2ISY A;  2Q2E A;  3K70 D;  4F93 B;  2RNJ A;  3QPT A;  2VJI A;  2EFP A;  2GAU A;  3GWZ A;  2DW4 A;  3HXL A;  3FXO A;  5LD2 C;  4EMS A;  2GIV A;  4DYR A;  2OA4 A;  4BBS J;  3U1K A;  4YFN F;  2W48 A;  1XCB A;  1OQY A;  1S72 I;  3G1M A;  1DPR A;  2JPC A;  3I59 A;  4N9H A;  3LNQ A;  4Q47 A;  5M5Y J;  2D2W A;  2VI6 A;  5LGN A;  3WTV C;  3HOY J;  1WQ2 A;  1PDN C;  1M1E B;  2LP0 A;  3QU3 A;  4XMY A;  4IO9 F;  2G7H A;  3R61 A;  4UUT A;  3HC7 A;  3QPS A;  2NXN B;  4V2G A;  4PJJ A;  4B3A A;  2DI3 A;  4B8X A;  4BQQ A;  4XIC A;  5ICF A;  4HQE A;  4V19 K;  4M6X A;  2F4M B;  1GV2 A;  1TWF J;  2CWE A;  3FMQ A;  3JRD A;  3CMA I;  1N77 A;  5D5W B;  4EM1 A;  2DJI A;  1YOV B;  3V8K A;  3G3Z A;  1H8A C;  2JPB A;  2DMN A;  3ZQQ A;  2DAO A;  4UV9 A;  1UHS A;  2MW8 A;  1SVO A;  2LRE A;  4LG0 B;  1J59 A;  2YR2 A;  2IXS A;  3ZRG A;  1Z9C A;  4M3D A;  3FKJ A;  4A3L J;  2JMW A;  1SVL A;  2IBD A;  3NWS A;  2FX0 A;  1XMK A;  2E1M C;  2HOE A;  3CO7 C;  4BHC A;  1ZGA A;  1RR7 A;  2EV5 A;  2HOA A;  1LDK B;  1JHF A;  2OD5 A;  2DFE A;  2PMZ N;  3B02 A;  2QQ8 A;  1K6O A;  2NS0 A;  3K4C A;  5CLS A;  1IRX A;  4B1R A;  3S1M J;  2O8K A;  4F7Z A;  5BPI A;  4BQN A;  4DYQ A;  3CCM I;  2JA7 J;  4XLA A;  4M3F A;  5CQG A;  2Q0O A;  2JA5 J;  2XB5 A;  4PJ0 C;  4DOZ A;  1XSD A;  3GYH X;  1KGS A;  3HGG A;  4UUV A;  2R93 J;  4D1Q A;  3DBH B;  2DPU A;  2OJE D;  2BVM A;  3BCA A;  4HV5 A;  5J3L A;  1I39 A;  2YUS A;  2ZFW A;  1B6A A;  3BPV A;  3HOT A;  4RGS A;  4A0Z A;  3JTG A;  3DEU A;  4Q48 A;  1AKH B;  1IRZ A;  1CQT A;  1OFC X;  3I56 I;  1V4R A;  2IVM A;  4CCN A;  1BR1 A;  3W2A A;  2VKD A;  4HF2 A;  1I1S A;  3ZN0 A;  3LSM A;  4CZZ A;  5FRM A;  1ENH A;  4XKW A;  1A31 A;  1E3O C;  6PAX A;  2KRH A;  4L5J A;  2X9D A;  3DPU A;  1D3Y A;  2IGO A;  1ZRC A;  2Y75 A;  4ENM A;  4A3E J;  3MWM A;  1J2X A;  1UEL B;  2LLK A;  2E2J J;  1ZN2 A;  5J4V A;  1EH6 A;  2UXX A;  1LFB A;  5E79 C;  3R4K A;  1YIT I;  2E1N A;  1D0X A;  3S17 J;  3HTU A;  3WHB A;  3FXR A;  1IF1 A;  1P92 A;  1MJA A;  4QLC U;  3HZJ A;  4DJA A;  3GCM A;  1RI7 A;  4RB2 C;  2GXA A;  4PJL A;  2F5D A;  4PZJ A;  1UFM A;  3S15 J;  3ZCO A;  1YLF A;  4RM2 A;  4ENJ A;  1FP1 D;  1XGS A;  3S3M A;  1U8B A;  3L1P A;  3E5Q A;  4HQM A;  1SFU A;  5TRD A;  1ZG3 A;  4YII A;  2L4M A;  1RUO A;  3TW6 A;  1G4D A;  4BBR J;  4RA2 A;  3OL4 A;  4HNT A;  3KPH A;  2VB6 A;  3F22 A;  1F43 A;  3S2H J;  2EH3 A;  3JRG A;  3WG7 H;  3QAH A;  2V6C A;  4BXF A;  2IS4 A;  3KEY A;  3BR2 A;  3TOA A;  4AID A;  2R7V A;  1AWC A;  4JYK A;  3GO5 A;  3T1B A;  2ZKZ A;  2MBF A;  4E7S A;  1K79 A;  3BTL A;  3GME A;  2O61 A;  2X6Y A;  5J40 A;  2LG4 A;  3Q9S A;  4UVA A;  3REO A;  3H3U A;  4XKV A;  3O2P E;  2Z16 A;  3H92 A;  3BDD A;  1MBJ A;  1T0F A;  3BRO A;  3GFJ A;  4PGH A;  1TP4 A;  3EUK L;  3K2A A;  2DA2 A;  3HUG B;  4WWC A;  4JQF A;  1FMV A;  2L3D A;  1JI8 A;  1D8K A;  1KYZ A;  2BGC A;  2JA8 J;  3HKZ N;  5E18 F;  5B5E C;  5EEG A;  2ME0 A;  3V7C A;  5J47 A;  3A0H C;  2FEZ A;  4AYB A;  4UY8 I;  5D8K B;  1B72 B;  4BAY A;  1IN5 A;  4JX5 A;  3ZGK A;  3ZQ7 A;  1RZ4 A;  3OS2 A;  1XPX A;  1HW5 A;  4R1H A;  3OWT A;  1XB4 A;  1XN7 A;  3CCQ I;  5L3F A;  1D0Z A;  1KQ8 A;  3AKZ A;  1R58 A;  4E7L A;  4FCY A;  4U7D A;  5FRO A;  2MH9 A;  4QWQ A;  2M0M A;  5EEH A;  3CME I;  1VQ8 I;  4FQG A;  5FD6 A;  3A0B C;  3SZT A;  3C2G A;  2XPU A;  2K9S A;  1ACI A;  2W25 A;  2KIQ A;  2Y9Y A;  5FLM J;  4YFX F;  2MAB A;  5H6R A;  4BNC A;  1IXC A;  5LHG A;  2IRF G;  1ZG1 A;  2PQ8 A;  2OPT A;  1A5J A;  5E3M A;  2KKO A;  4NBQ A;  4F55 A;  3I0T A;  1BC7 C;  1VZ0 A;  4IRH A;  3ECO A;  1KZH A;  2ISZ A;  3GZN B;  3K4M A;  1X1B A;  3F23 A;  3L7W A;  1K7A A;  1FT9 A;  5HLG A;  2H6B A;  4XN0 A;  3T8R A;  1Y0N A;  5HLI A;  3HYI A;  4C2T A;  3ZMU A;  4IX7 A;  1W4M A;  4O3M A;  4YEL A;  3OOP A;  4B09 A;  1GXP A;  2EIM H;  3DWL E;  5CVJ A;  4ANJ A;  2A69 F;  3ISP A;  1BIA A;  1PUF A;  4LIV A;  3I58 A;  2R5Y B;  3GTP J;  1ZR2 A;  4MGR A;  2IGN A;  5AON A;  2MLG A;  3WU1 B;  2NNY A;  4HOB A;  2L2O A;  1FYM A;  2HWV A;  3JTH A;  1L3L A;  5K5O A;  3KFW X;  2EIL H;  3EUH A;  2V9P A;  3FXM A;  3CMY A;  4D9J A;  3MCZ A;  5FD5 A;  5HS7 A;  2DMP A;  2JTV A;  3MD2 A;  2DMU A;  3J80 Z;  3GBG A;  2YSR A;  4M73 A;  2EK5 A;  3GX4 X;  1YO5 C;  2DOA A;  2HGC A;  2IT0 A;  4D0P A;  1CGP A;  3I3L A;  3EUA A;  2OTL I;  2DT6 A;  3G1O A;  4A0X A;  5JVG F;  3CTA A;  4ZYH A;  2WWY A;  1VQ9 I;  3ERE D;  4P96 A;  4H0E A;  4BE0 A;  1VQ5 I;  4UUS B;  4HBL A;  1D1C A;  2VQC A;  3P9I A;  4A3G J;  1ETY A;  3GVA A;  3KLN A;  2HTS A;  3PFY A;  2WAQ N;  3FXU A;  1MBF A;  1E0E A;  2K5C A;  2QWW A;  1VQK I;  2AQF A;  2DA3 A;  1SMT A;  5IP7 J;  1OPC A;  2OC6 A;  1NHA A;  4JK1 X;  3JRA A;  2DA5 A;  3F72 A;  1ZQ3 P;  2QVO A;  2PFB A;  3O8G A;  3H9G A;  1LQ1 A;  1SD6 A;  2VL8 A;  4BYY A;  1R71 A;  3H5A A;  5C4X J;  2FD5 A;  2NS8 A;  3Q5F A;  3LSI A;  3TDU C;  3EET A;  3FDY A;  1OLT A;  2L02 A;  3IL2 A;  1JKO C;  1KQ9 A;  2D45 A;  5K5R A;  1MD0 A;  4NQW B;  2WAE A;  4ESB A;  1LEB A;  2MSY A;  4ZYG A;  4J01 A;  3TP3 A;  1RES A;  2EV6 A;  3FWE A;  3CC7 I;  1QPM A;  1BOA A;  1UG2 A;  2XKO A;  2XRL A;  3HOS A;  1HC8 A;  1AA7 A;  1T8I A;  2A6H F;  4FIS A;  5M3F J;  3QPL A;  1N75 A;  4DIQ A;  1UST A;  4LG0 A;  1ULY A;  4OOI A;  1Z7U A;  3OL3 A;  1R49 A;  2VE8 A;  3D5L A;  3HOU J;  3J7A Y;  2GIZ A;  4MIM A;  4FAS D;  2ID6 A;  3KYL A;  3N97 A;  3F6V A;  1FOK A;  2PEX A;  2CJJ A;  2NVQ J;  2CV1 A;  2CQN A;  2COM A;  3ZQC A;  5DYM A;  3RZD J;  3PJR A;  4RDU A;  1IZ1 A;  2EIN H;  1UHW A;  1PP7 U;  1LVA A;  5EYR A;  3L09 A;  1CF7 B;  1RNL A;  4MQV A;  4XN3 A;  2FA5 A;  3ERM A;  4XLN F;  1MSF C;  4IOA F;  2A3S A;  2EZH A;  3PUF A;  5FO5 A;  1XD7 A;  2DOF A;  4KT5 C;  2JJ7 A;  3FXK A;  2VC0 A;  4C2U A;  1D8J A;  1TTY A;  4M71 A;  2XGX A;  5B1A H;  2GXG A;  1I6X A;  1PJR A;  2E71 A;  2K9L A;  1ORK A;  2AXL A;  4XRS A;  3JR9 A;  1VTN C;  2HVS A;  1LB2 A;  2W00 A;  2XAQ A;  3PSF A;  4M9S A;  1SD5 A;  4WXH A;  2VQG A;  2LF8 A;  5LGT A;  1V5G A;  1JT6 A;  4MTD A;  3DEW A;  1R6R A;  1XSX A;  4ZDO A;  1OYW A;  1AKH A;  5CJ9 A;  4HZF A;  1FOY A;  3H0D A;  5FKN A;  3JSP A;  2E19 A;  2HKX A;  2XHK A;  2MD5 A;  4AIJ A;  3LAJ A;  1WJE A;  5IT9 K;  1QPI A;  1FYL A;  1YW7 A;  2MLK A;  4B43 A;  2EFQ A;  2ZJ2 A;  1DDN A;  3VWB A;  3HOV J;  1D1A A;  1ITY A;  5J1Y A;  1TWC J;  1XC5 A;  1WKM A;  1JGS A;  1USS A;  2B63 J;  3D5S C;  4GDF A;  5JHF A;  2ESH A;  3V8L A;  5A2Q Z;  5FGM A;  4S04 A;  4EJU A;  5DUI A;  4IVN A;  5GP9 A;  2X6O A;  3OR2 C;  4RMN A;  3BJ6 A;  5H6Q A;  5IYB J;  1O3T A;  3E97 A;  2WAD A;  4XK4 A;  4YRV A;  2QSG X;  1QVT A;  4II2 A;  3HL2 A;  3RZO J;  2HPI A;  2ZME B;  3MKL A;  4PUS A;  4XRM A;  1YFH A;  1YIO A;  2M87 A;  4ENK A;  1Z6R A;  4OU0 A;  4PFP A;  2JA6 J;  3K1M A;  1W36 D;  2JRT A;  2V26 A;  3ABK H;  1LVK A;  1TW2 A;  4IEJ A;  4RAY A;  4B44 A;  2VLA A;  2HDC A;  1Y8R B;  3VSK A;  2XSJ C;  1R9T J;  4A5M A;  4S0H B;  1ON2 A;  1TBX A;  4KMF A;  4NNJ A;  4F92 B;  4OIO F;  3WTS C;  2A61 A;  5FLX Z;  3HHG A;  3O6B B;  4W1U A;  5IY5 H;  4U0W A;  4HLX A;  3NEU A;  4XOP A;  2FOW A;  3U1D A;  4BKX A;  4DZP A;  4AVP A;  4IHW A;  4AC0 A;  3HUG A;  1BJA A;  1BI0 A;  4BHB A;  1U9N A;  2JVH A;  3TBI A;  5C4J J;  3OYC A;  2DT7 B;  3TOB A;  2F5C A;  1MH3 A;  2ZJQ F;  2MC4 A;  2KIM A;  3CDI A;  4I09 A;  2V1U A;  3S2W A;  3ZMD A;  3G2B A;  4PFO A;  1B72 A;  4IQJ A;  2H6C A;  4IZZ A;  4WXD A;  4Y33 A;  5FFZ A;  3P9K A;  3WGG A;  4BL0 B;  4G12 A;  1FWZ A;  5ICC A;  4X0G A;  4U0V A;  5D5U B;  2CQK A;  1WI3 A;  5LBQ A;  2ME6 A;  1GHC A;  2KQR A;  2A07 F;  2NAZ A;  1MJB A;  4EQQ A;  1YIJ I;  2QSF X;  1T2K A;  2ZSH B;  2XPV A;  3OS0 A;  4A93 J;  5E3O A;  2NOG A;  4M6Y A;  2Z9O A;  4CCL A;  3ASN H;  2XF5 A;  1BJZ A;  2P4W A;  3IKT A;  2VJ4 A;  1F1Z A;  5J1U A;  3CDL A;  4LFU A;  2LC2 A;  4G94 A;  2DMQ A;  1XMX A;  2FU4 A;  2V4J C;  1YI2 I;  5D6F A;  2M2E A;  2DMT A;  1ZR4 A;  2UXN A;  1LJ9 A;  3HM5 A;  1T56 A;  2EZL A;  1A36 A;  2BY0 A;  2JSC A;  1V55 H;  1ODD A;  3QOD A;  1LE8 B;  1OCP A;  2DOD A;  2R5Y A;  5FFX A;  3K0L A;  5HS8 A;  3O8H A;  1LFU P;  2HYJ A;  3D1N I;  4HF0 A;  2DQL A;  3BPX A;  2O0Y A;  4BS9 A;  4A3I J;  3B6C A;  2XRN A;  1E17 A;  1S7A A;  4HST A;  4ZJZ A;  4NC8 A;  1K61 A;  2HQA A;  2HS5 A;  1ETX A;  2M3A A;  2ID3 A;  3HDD A;  5LRS A;  1QZE A;  3BWG A;  1P7J A;  2X1C A;  3E6B A;  2IA1 A;  2HZD A;  2IA2 A;  4I02 A;  2QCO A;  2JUG A;  3M3Y J;  1MIJ A;  2PMZ A;  2X51 A;  4LLN A;  4CA0 A;  4OMY A;  1B9N A;  5E3L A;  1MJ9 A;  4UUS A;  5L3G A;  4HG2 A;  4LJZ F;  5F08 A;  1EA3 A;  1XX5 A;  4OMZ A;  4P55 A;  5CVI A;  2KRF A;  5DM7 F;  2XKP A;  2QGU A;  3JSO A;  2PBI A;  3CCU I;  1YE9 A;  4WF2 A;  1G8X A;  3MZY A;  3SFI A;  5CPR B;  4N0B A;  3EYI A;  4OIQ F;  1YTY A;  2CMP A;  1VFC A;  2VOO A;  2PMH A;  2BY3 A;  2HU9 A;  2EA4 A;  2LY2 A;  3E5U A;  1LUJ B;  1WJB A;  1X4O A;  4L5E A;  4L9V A;  4YIR X;  1IGN A;  1JJ8 C;  5FKM A;  3QPH A;  4A3J J;  2TCT A;  3F0C A;  3KE2 A;  1HKQ A;  2STT A;  5L3D A;  4IHV A;  4NQW A;  3J81 Z;  4EJO A;  5HDK A;  1LKX A;  1DU0 A;  2Z3Y A;  5HNH A;  4FHT A;  2ZXH A;  3FK7 A;  4AD9 A;  3JAM K;  3RPQ A;  1WVR A;  2XF6 A;  2X4H A;  1JTX A;  3RYP A;  4RAZ A;  3OOU A;  1OYI A;  3IUO A;  4D7N A;  3L2V A;  2Y30 A;  4BUP A;  3R0J A;  2XAU A;  2L9V A;  4RBO A;  4DBQ A;  1ETO A;  2JSP A;  5E8I A;  1H89 C;  4HF1 A;  4XKC A;  3GZ5 A;  1GDT A;  2PMU A;  4LGW A;  4ETS A;  1S7O A;  4KIC A;  4F3Q A;  2OTJ I;  2ZNZ A;  1QHH D;  2IJL A;  3BR5 A;  3K4L A;  1SVM A;  3L00 A;  1FZP B;  3GEZ A;  2DA6 A;  2XAS A;  3CUO A;  3KP7 A;  3ZQH A;  1FP2 A;  1Z3X A;  5H20 A;  2FRH A;  3ZN1 A;  3PNT A;  1CF7 A;  2A6E F;  2DT5 A;  3OYM A;  5K7Z A;  5B66 C;  3PFI A;  3DFG A;  2HEO A;  1HST A;  2JK3 A;  2R7O A;  3WOD F;  2P5L C;  1R5I D;  4WX9 A;  4Y15 A;  3KP6 A;  2IA0 A;  3AG4 H;  4I99 C;  2P6T A;  1V54 H;  4NC7 A;  3RKY A;  3ML6 A;  1T0F C;  1WCM J;  3IH2 A;  2CH0 A;  3CMM A;  3HEF A;  2E1C A;  5ILS A;  5HLT A;  5AIQ A;  2XF7 A;  2G7U A;  5EG0 B;  3FXL A;  2R3S A;  4ABZ A;  2HQN A;  2J5O A;  3ZOB A;  3WU2 C;  3HKZ A;  1ZRE A;  1JGG A;  1R4M B;  1TNT A;  3BZC A;  5FJ8 J;  2LKS A;  5EGO B;  4MFD A;  3UR3 C;  4BJT A;  4M74 A;  3RCO A;  4CDG A;  4FTH A;  4BY1 J;  2P5V A;  3K69 A;  2GOM A;  3H1C A;  4FE4 A;  4MEX F;  2LKP A;  1U0J A;  4A69 C;  3OIO A;  3H35 A;  2QQ9 A;  1ZAR A;  3AG2 H;  4X1E A;  1P4A A;  3OYB A;  1SEU A;  4L9N A;  1Y6I A;  2PJP A;  3OYN A;  3G73 A;  2WC2 A;  1H88 C;  2XPW A;  2ACJ A;  1G3S A;  4RLQ A;  2LFB A;  4E7I A;  1ZKG A;  3DCF A;  2E7W A;  1EH8 A;  2L9R A;  3KLO A;  1BR2 A;  3UNG C;  2ZME A;  2FJ1 A;  1WI9 A;  2NVX J;  4QSH A;  2STW A;  3O3K A;  1FIA A;  4A0Y A;  3KET A;  4DQ2 A;  3VSL A;  3I4N J;  2K4B A;  3ZR8 X;  2W1O A;  2UV1 A;  3J7A O;  1X2N A;  4BGD A;  4YIF A;  4IPA A;  4BXX J;  3FBN B;  2VBY A;  5M5X J;  2DA4 A;  2A5W A;  1X4P A;  5L3C A;  1X3Z B;  2M9H A;  5GAH J;  3EUH C;  1RR8 C;  2R7F A;  2KDO A;  1K83 J;  2YX7 A;  9ANT A;  3BOQ A;  5ICE A;  3OR1 C;  5HS9 A;  1IW7 F;  3CLQ A;  1WJD A;  2W85 A;  2VKE A;  1EV7 A;  2CRG A;  1Z05 A;  1UZC A;  2E34 A;  4DW6 A;  4XR6 A;  2ZJP F;  5HDN A;  1BM9 A;  5J8F A;  3RQI A;  3TDZ C;  3DBL B;  1WWX A;  1TWH J;  4UV8 A;  2M5W A;  1X1P A;  2VQH A;  1LFP A;  4MEY F;  2GBY A;  4LK1 F;  1KON A;  3HSR A;  2K9M A;  1OMI A;  2DFH A;  4C30 A;  5M3M J;  2JT1 A;  1ZLJ A;  5BMZ A;  2WAQ A;  3JRC A;  1YJW I;  4BJ6 C;  3BJO A;  2VIX A;  1RIO H;  4L9T A;  1LDD A;  2M4G A;  1S8N A;  2NYX A;  1YG2 A;  4L18 B;  2VOD A;  2CFO A;  3ASO H;  4MO7 A;  5JI6 A;  2RV8 A;  3IHU A;  2M34 A;  1X58 A;  1FX7 A;  1KU9 A;  3BG6 A;  4ESF A;  4E7H A;  4O5V A;  5BQT A;  1W7P A;  1YYV A;  2KZG A;  4RB1 A;  3IAM 2;  3T5X A;  2AQE A;  1PUE E;  1O4X A;  1YW9 A;  3CZ6 A;  4HV6 A;  1QGP A;  5CYV A;  2ESN A;  2OQG A;  3BR0 A;  4UXN A;  3LQQ A;  4XOT A;  2O03 A;  2OCE A;  4KNY A;  3RSN A;  3QOP A;  5TJJ A;  3FMS A;  3RIR A;  4ASN A;  2FMY A;  2K85 A;  2R0Q C;  1Z6T A;  1LE8 A;  1Z0X A;  2HZT A;  5ICG A;  3U9G A;  2VC1 A;  3RJP A;  3CQZ J;  3Q9V A; 
#chains in the Genus database with same CATH homology
 5LEK A;  4HYE A;  3SQN A;  3IWZ A;  2K86 A;  3PQJ A;  3SZP A;  3F21 A;  2PI0 A;  1BIB A;  4XSZ F;  4EJT A;  5F64 A;  3GF2 A;  3GXO A;  1STZ A;  2CFX A;  3WG9 A;  1ZRF A;  3F8B A;  4KIB A;  2QYO A;  1FBU A;  3P9C A;  1MKM A;  3TQN A;  2QM3 A;  1TW3 A;  3NRV A;  1BI3 A;  1X3U A;  2UZK A;  4HAM A;  3WE3 A;  4WK8 F;  3F6O A;  4RB3 C;  1R1T A;  1G3W A;  4BH9 A;  3RKW A;  1IXR C;  3I64 A;  2HYF A;  4M72 A;  1R22 A;  3DPL C;  3ZMZ A;  1J7K A;  1FC3 A;  5L3B A;  5ED4 A;  2EV0 A;  1J0R A;  1E2X A;  4CHU A;  3FX3 A;  5DUK A;  1B1B A;  1Z1D A;  1O7F A;  2XIG A;  2W84 A;  2RC4 A;  1UB9 A;  3HSE A;  3DPT A;  4EV0 A;  3KP2 A;  2FBH A;  3EYY A;  4I0A A;  4LB5 A;  2OZU A;  4XBF A;  2RGV A;  1DUX C;  3LA7 A;  1B59 A;  3F8C A;  2CW0 F;  1U5T B;  1UHM A;  3WTX C;  3TO7 A;  2VBZ A;  2C6Y A;  2VBX A;  2D1H A;  2OQR A;  3CUQ B;  3VB2 A;  2ZXJ A;  1R1U A;  5ERI A;  3HHH A;  5AIP A;  1VTN C;  3IWF A;  3I4P A;  4Z2Y A;  4LMY A;  5D4S A;  5D6E A;  2QQA A;  4U7B A;  1YS6 A;  2IW5 A;  5DV5 A;  3C1D A;  1IRG A;  1H9T A;  2DK5 A;  3IRQ A;  1K78 B;  1XGM A;  2VON A;  4G7O F;  2A5Y B;  4KMU X;  3F3X A;  1HKT A;  2O8X A;  2K27 A;  1ZHF A;  1D5V A;  2UWM A;  4UNO A;  2XV4 S;  1S6L A;  4GO1 A;  2OZ6 A;  3HIF A;  2XAJ A;  3K1P A;  3E5X A;  3KP5 A;  3ELK A;  1BN5 A;  4YFK F;  1KU2 A;  4G8X A;  4CYD A;  1IXS B;  2EA2 A;  4ON0 A;  3FMR A;  1ZYR F;  1HBX G;  4RS8 A;  3CJN A;  2H94 A;  1J5Y A;  5KVR A;  1FBQ A;  3LA3 A;  2GQQ A;  2Q8K A;  2ADU A;  2ELH A;  1LEA A;  3TKY A;  3ZMV A;  3RTR A;  3VEP A;  1QZY A;  2F2E A;  2ZBK A;  1UCR A;  1TLH B;  1QNT A;  5F1R A;  1B4A A;  3HRU A;  4L0Z B;  3L2C A;  5E17 F;  4BXU A;  5ILV A;  2DFI A;  2P7C B;  4Q5S F;  1F4K A;  3M8E A;  2RN7 A;  2EFW A;  3DQV C;  3LST A;  4A12 A;  2FF4 A;  2GA1 A;  2V79 A;  4G7H F;  3W6J B;  2P7V B;  3F8M A;  2EFO A;  1J9I A;  2V1X A;  1R5G A;  1G3Y A;  2LSO A;  3TGN A;  4I7H A;  1SAX A;  1P4W A;  3KZY A;  3E6M A;  5E20 A;  1JXS A;  3E3V A;  1FSE A;  3DXJ F;  4S05 A;  1ZAO A;  5DEQ A;  3FF5 A;  3WTW C;  2IP2 A;  4LLG F;  4EVI A;  1RUN A;  4RGU A;  1ON1 A;  3DP7 A;  3I53 A;  4AIK A;  3FM3 A;  3LWF A;  3LFK A;  2CGP A;  1Z91 A;  1JE8 A;  4L5I A;  2VE9 A;  4I0B A;  3WTT C;  2QQB A;  3TO9 A;  3K2Z A;  4HLY A;  1KYW A;  1A04 A;  1O7L A;  2XRO A;  1IAW A;  4Y13 A;  2L54 A;  4L9J A;  3MQ0 A;  1R7J A;  4RB0 A;  3I54 A;  1AOY A;  4M9Z A;  5ILU A;  4HDU A;  2VXZ A;  4IHT A;  1F5T A;  3BY6 A;  2GWR A;  5D5X B;  4Q4Z F;  4YG2 F;  2BV6 A;  5HLH A;  4HX4 A;  2RVC A;  4BQA A;  4WCG A;  2BYV E;  2A68 F;  1T6S A;  4AIH A;  5D5V B;  1KQ0 A;  1OYY A;  2QBY B;  3HTS B;  2HFH A;  3T0Y A;  1I5Z A;  3GFL A;  2GZW A;  1FYK A;  1IUY A;  3GFM A;  2XVC A;  2WV0 A;  3ZMS A;  2G9W A;  3LQR A;  1U5T A;  4EJV A;  3GUD A;  3I71 A;  3CUQ A;  4OIP F;  2K02 A;  1P4X A;  2K4J A;  4ESJ A;  3QP5 A;  2DO7 A;  4R79 A;  3RDI A;  3QRF F;  5E1X A;  5E8G A;  2BE5 F;  2O6G E;  4XRF A;  2DTR A;  3DF8 A;  1FSH A;  5IT9 Z;  4P9F A;  4I2O A;  1XCV A;  1R1V A;  2J5P A;  3KEO A;  1K78 A;  4FX0 A;  1KA8 A;  1G6N A;  1XSV A;  4NB5 A;  2KIF A;  2R7D A;  1TQM A;  2RQP A;  2PLY A;  4DNC A;  2W57 A;  3WGH A;  1IRF A;  4CO8 A;  2D1V A;  4HX8 A;  4LK0 F;  1QO0 D;  2DQR A;  2IPQ X;  3R60 A;  2F5E A;  1MDM B;  2P5K A;  5CVU A;  4EM2 A;  3JW4 A;  2EFN A;  1LNW A;  1Q1H A;  1Y0U A;  2FOK A;  1KU7 A;  1FY7 A;  2XAH A;  2HQR A;  3ECH A;  4A6E A;  4ZYE A;  3TO6 A;  2YX4 A;  3MFK A;  1XGO A;  4EJW A;  2FNA A;  4CGZ A;  5BOX A;  2DBB A;  1BC8 C;  1YS7 A;  3ROU A;  4KN4 X;  2FML A;  3SFZ A;  4UVC A;  2FXA A;  1S29 A;  5CVV A;  2KIU A;  2YPR A;  2VBW A;  3J80 K;  4U0Y A;  1BI1 A;  1T98 A;  2RDP A;  3M9A A;  3B73 A;  4HX7 A;  2GA2 A;  5K5Q A;  1I27 A;  5FB2 A;  3FM5 A;  2QEN A;  2RKH A;  2M8E A;  2X0L A;  3FHZ A;  3H3Z A;  4O6J A;  1H0M A;  3CO6 C;  5LHH A;  1L0O C;  1ZGJ A;  3CDH A;  5JHU A;  5DD4 A;  1OR7 A;  2F5F A;  4GYG A;  4FX4 A;  2H27 A;  2QZ8 A;  2XUB A;  1ONV A;  3EQL F;  3KCC A;  2PN6 A;  3WE2 A;  4ZYD A;  2LNB A;  4MNU A;  4PCQ A;  1YW8 A;  5D8L B;  2ZCW A;  4G6D A;  1REP C;  2M45 A;  5DDG A;  3C18 A;  2Z5U A;  4KN7 X;  1J75 A;  3KP4 A;  4E70 A;  3LA2 A;  2DPD A;  1S3J A;  2FBK A;  1KU3 A;  1U3E M;  5E1W A;  2EJR A;  4PDK A;  4ZZD A;  4KA4 A;  4R8H A;  3SHF A;  5JFR A;  5LEJ A;  5DCM B;  4U88 A;  3QU6 A;  1IN6 A;  3JAM Z;  4MHG A;  4G7Z F;  3OV8 A;  4LD5 A;  2ZO4 A;  2FNP A;  5K1Y A;  3MEX A;  5KK1 A;  3BJA A;  3HRM A;  3D0S A;  3QP6 A;  1DPU A;  2KJC A;  4M9X A;  2CO5 A;  1TNS A;  2NRA C;  1C0W A;  4P5O A;  5HVQ C;  2VT3 A;  3GW2 A;  4MTE A;  4PGG A;  3KZZ A;  3WTY C;  4G9Y A;  2GXB A;  1U8R A;  4WXC A;  2QBY A;  2JZY A;  3VOD A;  1QZZ A;  1OKR A;  3LAP A;  5A2Q K;  1T39 A;  3COA C;  4KIF A;  4HDV A;  3BP8 A;  4UHT A;  4HW0 A;  1ZLK A;  3W6K B;  1U6G A;  1I1G A;  5J6X A;  3DKW A;  1FBS A;  3CLO A;  3IRR A;  2L01 A;  1HQC A;  1H9G A;  4EGZ A;  1QBJ A;  2DK8 A;  4TV7 A;  2AS5 F;  1GXQ A;  2QLZ A;  5FLX K;  5E1Z B;  4I01 A;  4P9U A;  4CXF A;  2XAF A;  5DD8 A;  4IXA A;  1JHH A;  2V1D A;  1HW1 A;  3KEQ A;  3VOE A;  3P7N A;  2WTE A;  5JR3 A;  1XGN A;  1ZH5 A;  3K9T A;  4BHP A;  3GZ6 A;  2EWN A;  1P6R A;  2VOP A;  1MDM A;  1WSU A;  3MZH A;  2OBP A;  4A2U A;  3N4M A;  1FNN A;  2DU9 A;  5D4R A;  3L9F A;  4LLL A;  3ZMT A;  1W5S A;  4XSX F;  5LLQ A;  1HXD A;  1U2W A;  3SXY A;  3HRS A;  5F6F A;  1R23 A;  2FQ3 A;  4KIG A;  3M8F A;  1O57 A;  4IRI A;  5JVT A;  3WTU C;  2L4A A;  4A5N A;  3E6D A;  4GGG A;  3VFZ A;  1O3R A;  4ZH4 F;  1R5H A;  1HKS A;  3V7S A;  2K7L A;  4A6D A;  2FSW A;  2Y48 A;  3WTZ A;  3AAF A;  2TDX A;  1MGT A;  1GVJ A;  1IN4 A;  2P8T A;  2QUF A;  3I59 B;  1TQP A;  3V7R A;  2PG4 A;  5J8C A;  2Y0M A;  4L0Y B;  3HSF A;  4EM0 B;  2KJB A;  2HYG D;  2FBI A;  3M1E A;  5CVR A;  2CG4 A;  4KUM A;  4GCV A;  3WU0 A;  4KYW A;  3V8J A;  3T8T A;  5IT3 A;  5LHI A;  3J81 K;  2BEO A;  1B9M A;  3MAJ A;  3IKV A;  1W7P D;  2NNN A;  2CSO A;  3ZP5 A;  4RGR A;  1ZRD A;  2FE3 A;  5L3E A;  2MC3 A;  1T38 A;  4FT8 A;  1FLI A;  4GYI A;  1ZG5 A;  3NQO A;  1U5T C;  1IN7 A;  1XDS A;  3ABT A;  2BBY A;  4ZZL A;  1SD4 A;  3CUQ C;  1DP7 P;  3I5U A;  5DCF A;  1TQI A;  1V3F A;  4G6Q A;  4OIR F;  2DLL A;  4I98 B;  4KFC A;  1SMY F;  2OAZ A;  1QQI A;  2V9V A;  5DCM A;  2ZNY A;  1BI2 A;  3F8N A;  1BBY A;  4IF4 A;  4UVB A;  4OIN F;  1G3T A;  2P6S A;  2H09 A;  2EB7 A;  1HSJ A;  2XAG A;  3U2R A;  1MZB A;  1O3S A;  4IRG A;  4HA8 A;  4LB6 B;  3V4G A;  4EGY A;  1EH7 A;  3F8F A;  1YQA A;  2Z99 A;  3R0A A;  1SFX A;  2ETH A;  4AWX B;  4ENN A;  2Z33 A;  3KP3 A;  2VN2 A;  1W7P B;  5HDG A;  5LGU A;  3RYR A;  2YU3 A;  2OU2 A;  3WGI A;  4N9I A;  1R00 A;  1WRJ A;  2M30 A;  5LRR A;  3ULQ B;  5BPD A;  4IHS A;  3GFI A;  4CIC A;  3R6S A;  1F9N A;  2B0L A;  2MH2 A;  3PQK A;  3K1N A;  4Y17 A;  4JBA A;  3RPU A;  1FPQ A;  2W24 A;  4GXO A;  3BZ6 A;  3IC7 A;  2LF7 A;  3M7G A;  3C7J A;  1HW2 A;  3DV8 A;  2VT2 A;  5HOO A;  2E7X A;  1PP8 F;  2CYY A;  2HR3 A;  4RGX A;  3ABU A;  5BS6 A;  1XMA A;  1R36 A;  1SD7 A;  2M1B A;  1XDU A;  4KDP A;  1IN8 A;  3ZPL A;  3HRT A;  1W5T A;  3FZV A;  3RI4 A;  1SFE A;  3FXQ A;  1P2F A;  2O3F A;  3GLX A;  4IJA A;  2MA3 A;  4K2E A;  1U78 A;  4NHJ A;  3C3W A;  3E6C C;  1LDJ A;  4XLP F;  3RKX A;  1O3Q A;  2HKO A;  3EDP A;  4MQ9 F;  2HTJ A;  2LDU A;  2ISY A;  2Q2E A;  2RNJ A;  3QPT A;  2EFP A;  2GAU A;  3GWZ A;  2DW4 A;  4EMS A;  2GIV A;  2OA4 A;  4YFN F;  1XCB A;  1DPR A;  2JPC A;  3I59 A;  4N9H A;  4Q47 A;  2D2W A;  5LGN A;  3WTV C;  1WQ2 A;  1PDN C;  3QU3 A;  2G7H A;  3R61 A;  4B8X A;  2DI3 A;  4HQE A;  5ICF A;  4M6X A;  2CWE A;  3FMQ A;  5D5W B;  4EM1 A;  3V8K A;  3G3Z A;  2JPB A;  2DAO A;  4UV9 A;  4LG0 B;  1J59 A;  2YR2 A;  1Z9C A;  1XMK A;  2HOE A;  3CO7 C;  4BHC A;  1ZGA A;  2EV5 A;  1LDK B;  1JHF A;  2OD5 A;  3B02 A;  1K6O A;  2NS0 A;  5CLS A;  4F7Z A;  5BPI A;  2Q0O A;  1XSD A;  3GYH X;  1KGS A;  4UUV A;  2DPU A;  4HV5 A;  2ZFW A;  1B6A A;  3BPV A;  3HOT A;  4RGS A;  4A0Z A;  3JTG A;  3DEU A;  4Q48 A;  1V4R A;  2IVM A;  1I1S A;  4HF2 A;  3ZN0 A;  4CZZ A;  6PAX A;  4L5J A;  1D3Y A;  1ZRC A;  2Y75 A;  4ENM A;  3MWM A;  1J2X A;  1ZN2 A;  1EH6 A;  2UXX A;  3R4K A;  2E1N A;  3HTU A;  3FXR A;  1IF1 A;  1P92 A;  1MJA A;  4QLC U;  4RB2 C;  1RI7 A;  2F5D A;  4PZJ A;  1UFM A;  1YLF A;  4ENJ A;  1FP1 D;  1XGS A;  1SFU A;  3E5Q A;  4HQM A;  5TRD A;  1ZG3 A;  4YII A;  2L4M A;  1RUO A;  1G4D A;  3F22 A;  3QAH A;  2V6C A;  3TOA A;  1AWC A;  3GO5 A;  3T1B A;  2ZKZ A;  2MBF A;  1K79 A;  2O61 A;  3Q9S A;  4UVA A;  3REO A;  3H3U A;  3O2P E;  3H92 A;  3BDD A;  1T0F A;  3BRO A;  3GFJ A;  4PGH A;  4WWC A;  4JQF A;  2L3D A;  1D8K A;  1KYZ A;  2BGC A;  5E18 F;  5EEG A;  3V7C A;  2FEZ A;  5D8K B;  4BAY A;  1IN5 A;  3ZQ7 A;  1RZ4 A;  1HW5 A;  4R1H A;  1XB4 A;  1XN7 A;  1KQ8 A;  5L3F A;  1R58 A;  4U7D A;  2MH9 A;  4QWQ A;  5EEH A;  5FD6 A;  3SZT A;  2W25 A;  4YFX F;  5H6R A;  4BNC A;  1IXC A;  5LHG A;  2IRF G;  1ZG1 A;  2PQ8 A;  2KKO A;  3I0T A;  1BC7 C;  4IRH A;  3ECO A;  2ISZ A;  3F23 A;  3L7W A;  1K7A A;  1FT9 A;  5HLG A;  2H6B A;  3T8R A;  5HLI A;  3HYI A;  3ZMU A;  1W4M A;  4O3M A;  3OOP A;  4B09 A;  1GXP A;  5CVJ A;  2A69 F;  3ISP A;  1BIA A;  3I58 A;  4MGR A;  5AON A;  2MLG A;  3WU1 B;  2NNY A;  4HOB A;  1FYM A;  2HWV A;  3JTH A;  1L3L A;  5K5O A;  3KFW X;  3EUH A;  3MCZ A;  5FD5 A;  5HS7 A;  2JTV A;  3J80 Z;  2YSR A;  4M73 A;  2EK5 A;  3GX4 X;  1YO5 C;  2HGC A;  2IT0 A;  4D0P A;  1CGP A;  4A0X A;  3CTA A;  4ZYH A;  2WWY A;  3ERE D;  4P96 A;  4H0E A;  4HBL A;  3P9I A;  3GVA A;  3KLN A;  2HTS A;  3FXU A;  2QWW A;  1SMT A;  1OPC A;  1NHA A;  4JK1 X;  3F72 A;  2QVO A;  2PFB A;  1LQ1 A;  1SD6 A;  4BYY A;  3Q5F A;  3TDU C;  3EET A;  3IL2 A;  2L02 A;  1KQ9 A;  2D45 A;  5K5R A;  1MD0 A;  4ESB A;  1LEB A;  4ZYG A;  2EV6 A;  3FWE A;  1QPM A;  1BOA A;  2XKO A;  3HOS A;  2A6H F;  1UST A;  4LG0 A;  1ULY A;  4OOI A;  1Z7U A;  2VE8 A;  3D5L A;  3N97 A;  3F6V A;  1FOK A;  2PEX A;  2COM A;  5DYM A;  1IZ1 A;  1UHW A;  1PP7 U;  1LVA A;  3L09 A;  1CF7 B;  1RNL A;  4MQV A;  4XLN F;  2FA5 A;  2A3S A;  5FO5 A;  1XD7 A;  4KT5 C;  2VC0 A;  1D8J A;  1TTY A;  4M71 A;  2XGX A;  2GXG A;  1I6X A;  2AXL A;  1LB2 A;  4M9S A;  2XAQ A;  4WXH A;  1SD5 A;  2LF8 A;  5LGT A;  4MTD A;  1XSX A;  1OYW A;  5CJ9 A;  4HZF A;  3JSP A;  2HKX A;  2XHK A;  2MD5 A;  4AIJ A;  3LAJ A;  5IT9 K;  1FYL A;  1YW7 A;  2MLK A;  1DDN A;  2EFQ A;  2ZJ2 A;  1WKM A;  1JGS A;  1USS A;  2ESH A;  3V8L A;  5A2Q Z;  5FGM A;  4S04 A;  4EJU A;  5DUI A;  4IVN A;  5H6Q A;  3BJ6 A;  1O3T A;  3E97 A;  2ZME B;  1YFH A;  1YIO A;  2M87 A;  4ENK A;  1Z6R A;  4OU0 A;  3K1M A;  2JRT A;  4RAY A;  1TW2 A;  2HDC A;  4A5M A;  1ON2 A;  1TBX A;  4KMF A;  4OIO F;  3WTS C;  2A61 A;  5FLX Z;  3HHG A;  3O6B B;  4U0W A;  4HLX A;  3NEU A;  3U1D A;  4AVP A;  3HUG A;  1BJA A;  1BI0 A;  4BHB A;  3TOB A;  2F5C A;  2KIM A;  4I09 A;  2V1U A;  3S2W A;  3ZMD A;  2H6C A;  4WXD A;  5FFZ A;  3P9K A;  3WGG A;  1FWZ A;  5ICC A;  4U0V A;  5D5U B;  2CQK A;  5LBQ A;  1GHC A;  2A07 F;  2NAZ A;  1MJB A;  4EQQ A;  1T2K A;  4M6Y A;  2Z9O A;  2P4W A;  3IKT A;  1F1Z A;  4LFU A;  4G94 A;  2FU4 A;  5D6F A;  2UXN A;  1LJ9 A;  2JSC A;  1ODD A;  5FFX A;  3K0L A;  5HS8 A;  4HF0 A;  2DQL A;  3BPX A;  2O0Y A;  2XRN A;  1E17 A;  1S7A A;  2HS5 A;  5LRS A;  3BWG A;  3E6B A;  2IA1 A;  2IA2 A;  4I02 A;  4LLN A;  4OMY A;  1B9N A;  1MJ9 A;  5L3G A;  4LJZ F;  4OMZ A;  5CVI A;  4P55 A;  2KRF A;  2XKP A;  3JSO A;  2PBI A;  4WF2 A;  3MZY A;  4N0B A;  3EYI A;  4OIQ F;  1YTY A;  2VOO A;  2PMH A;  3E5U A;  2EA4 A;  4L9V A;  3QPH A;  3KE2 A;  1HKQ A;  2STT A;  5L3D A;  4NQW A;  3J81 Z;  4EJO A;  5HDK A;  2Z3Y A;  4FHT A;  4AD9 A;  3JAM K;  3RPQ A;  2X4H A;  3RYP A;  4RAZ A;  1OYI A;  3R0J A;  5E8I A;  4HF1 A;  3GZ5 A;  2PMU A;  4LGW A;  4ETS A;  1S7O A;  4KIC A;  2ZNZ A;  2IJL A;  1FZP B;  3L00 A;  3GEZ A;  2XAS A;  3KP7 A;  3CUO A;  1FP2 A;  5H20 A;  2FRH A;  3ZN1 A;  1CF7 A;  2A6E F;  2DT5 A;  3PFI A;  3DFG A;  2HEO A;  1HST A;  3WOD F;  2P5L C;  4WX9 A;  4Y15 A;  3KP6 A;  2IA0 A;  2P6T A;  3RKY A;  3ML6 A;  2E1C A;  5ILS A;  5AIQ A;  2G7U A;  2R3S A;  2HQN A;  2J5O A;  1ZRE A;  1TNT A;  4M74 A;  4CDG A;  2P5V A;  3K69 A;  4MEX F;  2LKP A;  2QQ9 A;  1ZAR A;  1P4A A;  4L9N A;  2PJP A;  3G73 A;  2WC2 A;  2ACJ A;  1G3S A;  2E7W A;  1EH8 A;  3KLO A;  2ZME A;  1WI9 A;  2STW A;  3O3K A;  4A0Y A;  3KET A;  4DQ2 A;  2K4B A;  3J7A O;  4YIF A;  4IPA A;  2VBY A;  5L3C A;  2R7F A;  2YX7 A;  3BOQ A;  5ICE A;  5HS9 A;  1IW7 F;  2W85 A;  1EV7 A;  1Z05 A;  5HDN A;  1BM9 A;  5J8F A;  3TDZ C;  1WWX A;  4UV8 A;  2M5W A;  4MEY F;  4LK1 F;  3HSR A;  1OMI A;  2JT1 A;  1ZLJ A;  5BMZ A;  3BJO A;  1RIO H;  4L9T A;  1LDD A;  2NYX A;  1S8N A;  4L18 B;  1YG2 A;  2VOD A;  5JI6 A;  2RV8 A;  3IHU A;  1FX7 A;  1KU9 A;  4ESF A;  4O5V A;  5BQT A;  1W7P A;  1YYV A;  4RB1 A;  3T5X A;  1PUE E;  1YW9 A;  4HV6 A;  1QGP A;  5CYV A;  2ESN A;  2OQG A;  4UXN A;  3LQQ A;  2O03 A;  4KNY A;  3QOP A;  5TJJ A;  3FMS A;  3RIR A;  4ASN A;  2FMY A;  1Z6T A;  2HZT A;  5ICG A;  3U9G A;  2VC1 A;  3RJP A;  3Q9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...