4HW0A

Crystal structure of sso10a-2, a dna-binding protein from sulfolobus solfataricus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
98
structure length
98
Chain Sequence
KRGTMEIMFDILRNCEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDRKIYEITEKGKLLRTHIEEFIKIRENLYSAKEKVSELLRTDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse architectural properties of Sso10a proteins: Evidence for a role in chromatin compaction and organization.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
molecule keywords DNA-binding protein Sso10a-2
total genus 36
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14947 HTH_45 Winged helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hw0A00
2Q2EA 1EV7A 4L9VA 5JR3A 3SHFA 1F1ZA 3HSRA 5HDNA 3BPVA 5TRDA 2FNPA 4I98B 2Y0MA 1TLHB 2NAZA 2K7LA 1E2XA 3CTAA 3LSTA 3F6OA 1KQ0A 1EH8A 1P4WA 2QM3A 2LDUA 3QPHA 4YFKF 1P4XA 1W7PA 4YFXF 4M72A 3EYYA 4WCGA 5LHGA 1RNLA 3IKTA 1D5VA 1CF7B 3ZMDA 2OZUA 4KA4A 1ON1A 3F3XA 1UHMA 4A0ZA 2K4JA 1B59A 3GWZA 3I0TA 3ABTA 1O3RA 3EUHA 3KEQA 1MDMA 2P4WA 4E70A 3HRSA 1PP8F 2YPRA 3GEZA 3HRMA 3RIRA 1IRFA 5AIPA 4IRGA 2EV0A 3GFIA 1S6LA 3SQNA 1C0WA 2V6CA 3R60A 4Y17A 1HW1A 2DW4A 4AVPA 1HKQA 2HS5A 2RKHA 2V1XA 2L3DA 1NHAA 4ASNA 2XAGA 2XKPA 1XGSA 3O6BB 4M9XA 1XDSA 5DUIA 2P5KA 1FBSA 1QZYA 2VBZA 2EWNA 2AS5F 3FX3A 5DEQA 4RGUA 4IXAA 2NNYA 1XGMA 1R1UA 1S7AA 3K2ZA 4ESBA 3BP8A 1PDNC 3JAMZ 4PCQA 2RV8A 5DUKA 2GXBA 2M30A 4MQ9F 4HZFA 4UV9A 1IXCA 1KQ8A 3OV8A 1MJAA 2CGPA 1MGTA 3V8JA 2D1HA 1IN6A 3ZP5A 1P4AA 1OYIA 4GO1A 3IRQA 4A0YA 2Z99A 2GWRA 2VOOA 1FOKA 4N0BA 5HLGA 3J80K 3WTWC 5BPIA 4OIRF 1IN4A 1YLFA 3LA3A 3H92A 3I71A 5CYVA 1XMKA 4FT8A 1ZREA 2QVOA 5LRSA 1LQ1A 2NNNA 1OKRA 3F8NA 3ZMUA 4OU0A 5JVTA 1WRJA 3W6KB 3CDHA 4CZZA 2BEOA 5HS7A 1O3SA 1Z05A 2M5WA 4ESFA 4A5NA 2IP2A 2HFHA 3WU0A 2UWMA 3K69A 2IA1A 1TQPA 2Y75A 5J8FA 1B1BA 1I6XA 4HOBA 1RIOH 2L02A 1HKSA 3NRVA 5ILUA 3KLOA 2FQ3A 5H6QA 1ULYA 4MQVA 3P9IA 4RB2C 3M8FA 3DF8A 4HA8A 2PG4A 2Y48A 2FE3A 4HX4A 3FMSA 4MNUA 4EMSA 2OBPA 3FF5A 2WC2A 1XGNA 1FBQA 3ECHA 3MWMA 4BYYA 4YIFA 4S05A 3ZQ7A 1I27A 5FGMA 4ON0A 3BY6A 2FBKA 1Z7UA 4B09A 5K5OA 2Z9OA 1GVJA 4RB3C 1ON2A 4HLXA 4DQ2A 5L3FA 3Q9VA 2VE9A 2A61A 1R58A 2EA2A 3PQJA 1DPRA 1T39A 3O2PE 4IVNA 3WGGA 2MA3A 2PLYA 2MH9A 5H6RA 1WQ2A 2PEXA 3WGHA 4HV6A 1BI2A 3KEOA 4CYDA 3K0LA 5CVUA 1Y0UA 4KMUX 2PI0A 2F5CA 2IPQX 1R00A 2E7WA 4R79A 3EYIA 1Z6RA 3HOTA 4N9HA 2OZ6A 3LAPA 3I54A 5F6FA 1BN5A 2XRNA 2CSOA 2XROA 4ETSA 1QO0D 2DK5A 1OYYA 3JSPA 4Y15A 1ZG5A 1O3TA 2WTEA 3GVAA 2RGVA 2XAJA 3COAC 4LG0B 2V79A 3QU6A 2Z5UA 1HW5A 2F5FA 1BIBA 2IRFG 3LQRA 2Q0OA 1U3EM 2ESHA 1FZPB 3TQNA 3BROA 3TOAA 1FPQA 3U1DA 4LD5A 3H3ZA 4AIHA 1ZRCA 4ZYHA 4WXHA 2QWWA 3C1DA 1RUOA 3ECOA 2RC4A 5D4RA 3P9CA 5E8IA 2HDCA 4HF1A 3DXJF 1YG2A 2PQ8A 3DPLC 3F8CA 3L09A 2DFIA 3DFGA 4G7OF 4HX7A 3DP7A 1S29A 4RAZA 3M8EA 2VT3A 1DUXC 1U5TB 5E1WA 3TOBA 1TW2A 2R3SA 2CWEA 3ABUA 3E5XA 3GO5A 3EQLF 5D8KB 3J81Z 2GA2A 3K9TA 2HTSA 5CVRA 3FHZA 3IL2A 3ZMVA 4PDKA 5EEHA 3FWEA 2VOPA 3NEUA 1P92A 3E6CC 3WTVC 4UVAA 1XD7A 1R22A 4XLNF 4LK0F 1IXSB 1FX7A 2QZ8A 1W5SA 2B0LA 1IAWA 3F72A 2GA1A 1QNTA 3DQVC 4Q5SF 2R7DA 1G3YA 2GXGA 3GF2A 1WI9A 4EM1A 3I59A 4QWQA 2FSWA 3RI4A 4KNYA 2ESNA 4HBLA 4XLPF 3FXUA 3CO7C 3KFWX 4RB1A 1MKMA 4PZJA 2O61A 4CDGA 2KIFA 4Z2YA 2ZJ2A 4BH9A 2FNAA 1GXPA 1J2XA 1QGPA 1LJ9A 2ACJA 2W24A 2CQKA 2FOKA 2MD5A 4MEXF 1T0FA 2BE5F 1FWZA 2DLLA 4TV7A 2TDXA 4WXDA 4NB5A 4O6JA 1J0RA 2IJLA 3R61A 4BHBA 2YU3A 3LAJA 3F21A 1IN5A 4UHTA 2XAFA 3MZYA 5CVJA 5D6EA 1ZARA 1ZN2A 3DV8A 5FFXA 5CLSA 3W6JB 4A6DA 4WXCA 2HKXA 3MFKA 2ZMEB 2HEOA 2R7FA 5ICCA 5HVQC 2VN2A 2GIVA 2IT0A 2VXZA 2XGXA 3ULQB 1XDUA 5LEKA 2HQRA 3T8RA 1FBUA 1WWXA 2BBYA 4ZH4F 3E6BA 1TW3A 3RPQA 2HTJA 4O3MA 2E1NA 5D5XB 3I4PA 3J7AO 1STZA 1MDMB 3MAJA 1AOYA 4H0EA 4UVCA 1KYWA 4OMYA 3K1PA 2YSRA 5FLXK 2JSCA 1YW9A 3QP6A 3J81K 3V7CA 3RYRA 3P7NA 5D6FA 4I09A 2OD5A 3BZ6A 4KT5C 4I0AA 4L18B 2IW5A 1QBJA 1KGSA 2JPCA 5LRRA 1E17A 2EA4A 2DPDA 1KA8A 3TDZC 5IT9Z 2W57A 4GYIA 2EV6A 3HTUA 3QPTA 4K2EA 2O6GE 1FY7A 4IRHA 4HLYA 2H94A 1U8RA 3QRFF 2O3FA 5FO5A 2EFNA 3JSOA 4LG0A 1QZZA 2KRFA 2ZO4A 3VEPA 2ZMEA 2VBXA 1HXDA 3HYIA 4O5VA 3I53A 3EDPA 1R5HA 1YW8A 3RTRA 3RPUA 2DI3A 4P55A 4M6XA 1HSJA 3GFMA 1BC8C 2FBIA 4ZYGA 2ZNZA 4HYEA 1MZBA 2ZCWA 1IF1A 3ZPLA 3T1BA 3ERED 2OQGA 4B8XA 5LHIA 4ESJA 5D5WB 4M74A 2ETHA 2OU2A 3GFLA 1ZLJA 1KU9A 2FU4A 1BI0A 5D8LB 3JTHA 4GCVA 4LGWA 1P6RA 1TNTA 5AONA 1J7KA 3LWFA 2JZYA 3TO9A 2EFOA 4RAYA 2DQLA 1Z91A 4CICA 1JXSA 3M9AA 4G7ZF 3SZPA 3GYHX 4ZZLA 4EQQA 3BJAA 1V3FA 3R0JA 3V7RA 3QAHA 4F7ZA 2CYYA 2QBYA 2A69F 2YR2A 1J59A 2L01A 4I02A 1YYVA 2A3SA 1F5TA 3CUOA 4G8XA 2E1CA 3GW2A 3VOEA 5ICEA 4EJOA 3MCZA 5D5VB 4A6EA 4RGRA 3JAMK 1ONVA 4CHUA 2JRTA 3GZ5A 2VBWA 4BNCA 4M6YA 3KP3A 2JT1A 2W84A 3FMRA 1R23A 4I7HA 3R4KA 2LKPA 5J8CA 2A07F 1K78A 4G94A 4IRIA 5D5UB 3GUDA 3F6VA 4BXUA 1QQIA 1G3WA 4L0YB 1YFHA 1OPCA 5FB2A 4CXFA 4AIKA 3KZZA 5IT3A 2OQRA 4ZYDA 5D4SA 2XKOA 3OOPA 3BDDA 2C6YA 3F22A 1OMIA 3MZHA 4FX4A 1O57A 1JE8A 2ZKZA 4I01A 1LNWA 1ZGJA 3LFKA 3HSFA 4UVBA 1R7JA 3C7JA 3KP6A 1JHFA 2UXNA 1UB9A 1XGOA 3BPXA 1QPMA 4ENKA 5LEJA 2F5DA 4DNCA 1IRGA 3PQKA 3WE2A 2BYVE 2QBYB 3HIFA 2HOEA 4G9YA 4S04A 1A04A 4HDVA 4KFCA 3KE2A 3C18A 1WSUA 2EJRA 2HZTA 5CJ9A 5ICGA 1LDJA 3HRUA 3ML6A 4IHTA 2BV6A 1K78B 4LFUA 3HRTA 2P8TA 4EGZA 1GHCA 1X3UA 2ZBKA 1SMTA 4M9ZA 3I59B 4IJAA 2O8XA 1T38A 4L9NA 1YW7A 3F23A 2VC0A 4G7HF 1ZRFA 5K5QA 1USTA 3CLOA 2VONA 2RNJA 4ENMA 1T2KA 4GXOA 4BAYA 2FXAA 1LEAA 4EGYA 4N9IA 1LB2A 2KIMA 1EH7A 4OINF 4MHGA 3CJNA 2KJCA 1J9IA 4R8HA 4U0YA 2AXLA 4HX8A 1ZG1A 1P2FA 3F8FA 2Z3YA 4XBFA 2P7VB 2MLKA 1TBXA 3ZMZA 1HSTA 4HAMA 4JK1X 1BBYA 1DDNA 2FBHA 2IA0A 2K02A 1YS7A 5BPDA 4LK1F 1SD4A 5E1XA 3IWZA 4KUMA 5F1RA 2LSOA 1ZLKA 3KP4A 2QQ9A 2VC1A 4M71A 1PUEE 1B4AA 2EFWA 3FXRA 2WV0A 5F64A 2K4BA 3E5QA 4G6QA 4P96A 3TO6A 4HF2A 2HYGD 1HKTA 2KIUA 2V9VA 2STWA 4EJWA 4IHSA 1UCRA 5BOXA 2H27A 4L0ZB 2GQQA 5L3BA 1G6NA 1ZG3A 3MEXA 4AD9A 5L3GA 3T0YA 4LMYA 4L9JA 1I5ZA 2Q8KA 3T8TA 1KYZA 1BJAA 5HDKA 3HUGA 2DO7A 1SD7A 4MTDA 3K1NA 2L54A 4IPAA 4Y13A 6PAXA 4YG2F 1R1TA 2ELHA 2HYFA 1IN8A 1I1GA 2PBIA 3GX4X 4EJUA 2P6SA 3HSEA 2XVCA 1YQAA 4KIGA 5CVIA 3QP5A 1HQCA 4LLNA 3RKWA 1BOAA 5FD6A 4UV8A 3L00A 2YX7A 3WE3A 3SFZA 3WTUC 1Z1DA 2CG4A 3L2CA 1XB4A 2K86A 2XAQA 4M73A 1V4RA 4GYGA 1L3LA 5HS9A 2ZFWA 1SAXA 3BWGA 5DYMA 1AWCA 3HHHA 1Q1HA 4HV5A 3Q5FA 4Q4ZF 5L3DA 3V8LA 4PGHA 2A6EF 1XSDA 1FP2A 1T98A 2H6CA 4UUVA 4RGSA 2MC3A 3DPTA 4UXNA 2P6TA 4L5JA 4JBAA 1ZYRF 1ODDA 2A68F 3LQQA 1OR7A 5KVRA 4KYWA 2ADUA 3D5LA 1DPUA 2NS0A 2HKOA 1BM9A 5E8GA 3NQOA 2CO5A 3REOA 3RJPA 1MJBA 2RVCA 3WTXC 2O03A 2EK5A 1U6GA 5AIQA 2G7HA 4WWCA 4LJZF 2STTA 1B9NA 1BI3A 1ZRDA 4BQAA 5K5RA 5DV5A 2GZWA 2QQBA 1KQ9A 4XSZF 3ZMTA 4AWXB 2DBBA 3H3UA 4FX0A 1FT9A 3VFZA 1IN7A 3WTZA 1JHHA 3MQ0A 5HOOA 3E97A 5DCMA 1FYMA 1ZAOA 2J5OA 5BQTA 5FFZA 5LHHA 2A6HF 2P7CB 1W4MA 2CW0F 2DU9A 5JI6A 1U2WA 2DAOA 4KMFA 1YS6A 3FMQA 5EEGA 1LEBA 2VODA 4R1HA 3V8KA 1W7PD 4EM0B 3FM5A 3FZVA 1K7AA 1XCVA 1YIOA 2X0LA 2RN7A 4OMZA 3KLNA 1PP7U 2PMHA 5H20A 4A0XA 3WU1B 3HTSB 3N4MA 4RS8A 2RDPA 3QOPA 1O7FA 1XN7A 3JTGA 2DQRA 5JFRA 1BC7C 1IW7F 3F8MA 1D8JA 3WTYC 1LVAA 5LGNA 5DDGA 3LA7A 2LF8A 4LLLA 1OYWA 2EB7A 5ED4A 3I5UA 3ZN1A 1TQMA 3M1EA 2FEZA 5FLXZ 1YO5C 2CFXA 3HHGA 3ELKA 2DT5A 4D0PA 4L5IA 2DPUA 3ZMSA 2FMYA 1XMAA 4QLCU 3TGNA 2MBFA 5E17F 2ISYA 4NHJA 4KIFA 2LNBA 4ENJA 5K1YA 1XCBA 1KU3A 1VTNC 4KDPA 4UNOA 2MH2A 4MGRA 4P5OA 4ZYEA 3CUQB 4P9UA 5BMZA 4WK8F 4KN4X 1O7LA 1FLIA 1L0OC 2XUBA 4EV0A 2FF4A 2F5EA 1HW2A 1G3SA 3WG9A 2GAUA 4HF0A 1SFUA 4P9FA 4A5MA 1W5TA 4WX9A 2D45A 2L4MA 1REPC 4LB6B 3IKVA 3U9GA 1Z6TA 4HW0A 3QU3A 4EJVA 5A2QZ 3AAFA 2D1VA 2NRAC 3RYPA 4MEYF 1RZ4A 4OIOF 3IHUA 3G73A 4AIJA 3JW4A 1K79A 2QLZA 3CUQC 3DEUA 1DP7P 5L3EA 2M45A 1FP1D 4ENNA 5LLQA 5CVVA 3KP5A 1IXRC 3E6MA 3GLXA 1IUYA 1LDDA 3KP2A 3ISPA 2JTVA 2M87A 1G4DA 3KCCA 3SXYA 4I0BA 3G3ZA 3FXQA 4A2UA 1SFXA 1U78A 5LGUA 1BIAA 2VT2A 5BS6A 2D2WA 3KZYA 3TDUC 5KK1A 1WKMA 2HR3A 2FA5A 3PFIA 4YIIA 1YTYA 2HGCA 1GXQA 3KETA 2WWYA 3ZN0A 1HBXG 1I1SA 1S8NA 3VODA 4L9TA 3U2RA 2DK8A 4EVIA 2P5VA 4CO8A 3RKXA 3GFJA 3C3WA 4PGGA 1T6SA 5A2QK 2KKOA 3CUQA 1R1VA 2M1BA 5J6XA 2XHKA 1U5TC 2OA4A 2XASA 4IF4A 3GZ6A 4MTEA 4HQMA 2PMUA 2QUFA 1LDKB 4U7BA 5E20A 3V7SA 3VB2A 5LBQA 1KU7A 4EJTA 4OIPF 2IA2A 1SD5A 2A5YB 3IC7A 4A12A 5E18F 1CF7A 2X4HA 1RUNA 4KN7X 5DCFA 1IZ1A 2W85A 3O3KA 1EH6A 3IRRA 4GGGA 1ZH5A 3RKYA 1FSHA 3FM3A 4U88A 2QENA 2PFBA 2KJBA 3IWFA 1F9NA 5JHUA 2LF7A 2FMLA 3S2WA 3T5XA 2V1UA 4EM2A 4OIQF 5TJJA 3SZTA 2H09A 3Q9SA 2PN6A 3I64A 4OOIA 3J80Z 4WF2A 2E7XA 2HQNA 3WODF 2G9WA 5ILVA 1XSVA 4U0VA 3L7WA 2VE8A 5E1ZB 1UFMA 2DTRA 2K27A 5DD8A 3V4GA 2ZXJA 3CO6C 2UXXA 4ZZDA 3TKYA 3BJ6A 4HDUA 2IVMA 1R5GA 2H6BA 2ISZA 1MJ9A 3BJOA 3EETA 4HQEA 4I2OA 2XV4S 3TO7A 1CGPA 2EFQA 4U0WA 1UHWA 1TQIA 3P9KA 3HOSA 1FNNA 1R36A 1TTYA 5IT9K 1SMYF 5FD5A 1Z9CA 1BI1A 4LB5A 2G7UA 1D8KA 3K1MA 4U7DA 1FSEA 3M7GA 1H9GA 3I58A 2JPBA 2XAHA 2M8EA 3BOQA 3DKWA 3WTTC 3WGIA 2FRHA 2OAZA 5HS8A 1K6OA 2MLGA 3GXOA 3L9FA 4XSXF 4CGZA 1SFEA 2O0YA 1FYLA 2UZKA 3N97A 1SD6A 2V1DA 1FC3A 1S3JA 2EV5A 2J5PA 5ILSA 2QQAA 1J75A 5DCMB 5DD4A 1ZGAA 4FHTA 4KIBA 2QYOA 2COMA 4BHCA 5HLHA 3D0SA 4LLGF 1S7OA 3B02A 3R0AA 4XRFA 3RDIA 1H0MA 1J5YA 3WTSC 2BGCA 3E5UA 3KP7A 4BHPA 2ZNYA 1XSXA 1FYKA 2EFPA 5ERIA 1USSA 1W7PB 2P5LC 1KU2A 1B9MA 2RQPA 3LA2A 1U5TA 4NQWA 2F2EA 3ROUA 2Z33A 5LGTA 2HWVA 2NYXA 5HLIA 1H9TA 3R6SA 1ZHFA 5ICFA 2VBYA 3F8BA 5HDGA 4RGXA 1MD0A 2XIGA 2W25A 3B73A 3E6DA 1JGSA 2L4AA 1B6AA 3E3VA 1F4KA 1RI7A 1TNSA 4JQFA 1D3YA 1G3TA 2YX4A 4M9SA 4G6DA 4Q47A 5L3CA 2PJPA 1O3QA 4Q48A 4YFNF 4RB0A 4KICA
chains in the Genus database with same CATH superfamily
3PIPF 5F27A 2Q2EA 1EV7A 2O7OA 3BR6A 4L9VA 5JR3A 2Y9ZA 1F43A 4DZJA 4AYBN 3SHFA 1F1ZA 3HSRA 4IZZA 5HDNA 1I3AA 2Y0SN 3BPVA 5TRDA 2KZGA 2FNPA 4I98B 3FXOA 2Y0MA 4B4CA 1TLHB 2NAZA 2K7LA 2JA2A 1E2XA 3CTAA 3LSTA 3F6OA 4BDYA 2E2HJ 3CCQI 1KQ0A 1EH8A 2LY9A 1P4WA 2QM3A 2LDUA 1X4OA 2E1MB 3QPHA 2W00A 4YFKF 1P4XA 1W7PA 1GV5A 4YFXF 1LFPA 4M72A 3EYYA 2JA5J 2V1NA 4WCGA 5LHGA 1RNLA 3HM5A 2DA2A 3IKTA 4XMYA 1D1AA 3ZQHA 1T08B 1H89C 1D5VA 1CF7B 2H8RA 3ZMDA 2XGEA 2OZUA 4HNTA 4KA4A 4LOCA 1ON1A 3GCMA 3F3XA 3O8HA 1JJ6C 1UHMA 2K3PA 4A0ZA 2K4JA 1FTTA 1B59A 3GWZA 3I0TA 3ABTA 5E3OA 3HZJA 1O3RA 3EUHA 3KEQA 1OISA 5J4YA 1MDMA 5J1YA 2BXYA 2P4WA 5KCMA 1WJDA 2DXIA 5HODA 4E70A 3HRSA 1PP8F 3D5SC 2M7AA 2YPRA 3GEZA 3HG9A 5HNFA 1EA3A 2HQAA 1R6RA 3HRMA 4J00A 3RIRA 1IRFA 5J40A 5AIPA 2E35A 4IRGA 4BUPA 1Q1VA 2EV0A 3GFIA 1S6LA 3Q0WA 3SQNA 1C0WA 2V6CA 3R60A 1MBJA 4Y17A 4CCLA 1HW1A 2DW4A 4AVPA 1HKQA 2HS5A 2RKHA 2V1XA 1YRNB 2L3DA 1NHAA 2MSYA 2M8GX 4ASNA 2XAGA 1MNEA 2XKPA 4X6AJ 1XGSA 2HPIA 3O6BB 4HPQA 5EYRA 4M9XA 1XDSA 5DUIA 2P5KA 2MD0A 1IO2A 3BG3A 4G6TB 2DYSH 1B8IB 3LSMA 3JRAA 1FBSA 2V26A 1QZYA 1DQUA 4MFDA 1ORKA 2EIKH 1MBGA 3SDBA 4IQJA 2VBZA 2EWNA 2AS5F 2EZHA 2KP6A 3FX3A 5DEQA 3CLQA 4RGUA 4IXAA 3PM1A 2NNYA 1XGMA 2VKEA 1R1UA 1S7AA 3K2ZA 4ESBA 3A1YA 3BP8A 2JUCA 3A0BC 3V42A 1PDNC 2ME0A 4PCQA 3JAMZ 3L2WA 5EEAA 4W97A 2F48A 3S2DJ 2RV8A 5DUKA 3IH3A 2BW3A 2BY3A 3WG7H 2AXTC 3FXLA 2GXBA 1D0ZA 3H5RA 2M30A 4MQ9F 4HZFA 4UV9A 4Y33A 1IXCA 2R5YB 3OV8A 1KQ8A 4C30A 1WJ5A 1IV6A 1MJAA 2QGUA 1MGTA 1E3PA 3V8JA 2CGPA 4NC8A 4V2GA 1FMVA 1S9HA 2D1HA 2HOAA 2KZVA 1IN6A 5EZGA 2R5YA 1SC7A 3ZP5A 1P4AA 1OYIA 4GO1A 3IRQA 4A0YA 3DLAA 2Z99A 3OOUA 2HDWA 2GWRA 2VOOA 3TBIA 1BR1A 5FKLA 1FOKA 2AHQA 4N0BA 5HLGA 2KRCA 3J80K 4FASD 2K3FA 5FROA 3WTWC 2E1OA 5BPIA 2VKVA 1IN4A 1YLFA 4OIRF 3LA3A 3H92A 2DA7A 3FIWA 1EKEA 4IEJA 4JYKA 3I71A 4BY1J 5CYVA 1XMKA 2G0EA 3FXKA 4FT8A 1ZREA 2K40A 2R7ZJ 3FHNA 2QVOA 5LRSA 1LQ1A 2NNNA 1YOVB 2XGCA 1OKRA 2XAUA 3F8NA 3Q3SA 5IP6A 3ZMUA 4OU0A 5JVTA 1WRJA 5M3MJ 3W6KB 3CDHA 4Y3OA 4CZZA 2BEOA 3L2UA 5HS7A 3PNYA 1K83J 2BVMA 1O3SA 4C2MJ 3GTKJ 1Z05A 3WHCA 4B48A 1Z7LA 4J01A 2M5WA 4ESFA 1LE8B 1ITYA 4A5NA 1MW7A 3AKZA 2IP2A 4AVZA 2AQFA 2HFHA 3WU0A 2H1KA 3SDGA 3K69A 4HRIA 2UWMA 4CYCB 2IA1A 2R92J 2CUFA 1PVEA 3HKZN 1TQPA 2DCEA 2Y75A 5J8FA 4CCMA 1B1BA 2AO9A 3OIOA 1I6XA 3BCAA 4HOBA 1RIOH 3A03A 2L02A 1HKSA 3NRVA 4XLCA 5ILUA 4IO9F 3KLOA 3GTGJ 3OYHA 3VSKA 2FQ3A 2HXOA 5GTHC 1DU6A 2RREA 1MMAA 2B7EA 5H6QA 5GAGJ 1ULYA 4MQVA 3P9IA 3M8FA 2OC6A 4RB2C 3DF8A 4HA8A 2PG4A 3TEDA 4AM3A 4FQGA 2IS1A 4E7LA 2Y48A 3CD6I 2FE3A 4HX4A 3OYKA 3FMSA 4MNUA 4EMSA 1JKQC 1APLC 2OBPA 4CZCA 2L9RA 3FF5A 4DBQA 4DIQA 3L2QA 3UR3C 1RPWA 2WC2A 1XGNA 1FBQA 3ECHA 2XC7A 2ELJA 3MWMA 3LSPA 2IXSA 3ZQFA 2EH3A 4BYYA 2Z16A 2KPMA 4YIFA 4S05A 1B72B 3ZQ7A 2E36A 1I27A 3S1QJ 1FOYA 4ZTFA 4BQOA 1K6YA 3BLYA 2JK3A 1QHGA 5FGMA 3CQZJ 4ON0A 2PJRA 2RAEA 3BY6A 2HPMA 1SAUA 2FBKA 1XMXA 1Z7UA 4B09A 5K5OA 3G4SI 4BDZA 2MW8A 1RKTA 2P0WA 2DA6A 2Z9OA 1GVJA 4AU7A 4RB3C 2GBYA 1ON2A 4HLXA 4DQ2A 4BXXJ 1BW6A 2VPRA 1FEXA 5L3FA 2V6EA 1I39A 4RMNA 1U8BA 2K5CA 2X6XA 2X51A 2NVUB 4XRMA 3Q9VA 2VE9A 2A61A 1R58A 4EATA 2EA2A 3F0CA 3PQJA 1DPRA 2M7BA 3BR2A 4IL6C 1T39A 3O2PE 4IVNA 4XLAA 3WGGA 2R5ZB 1IJWC 2MA3A 2PLYA 3CMYA 2MH9A 5H6RA 1WQ2A 2PEXA 3DTEA 2DA1A 3WGHA 1T56A 3D1NI 5M5XJ 3PNTA 1WGXA 4HV6A 4LIVA 4ANJA 1BI2A 2LP0A 3KEOA 3S16J 4CYDA 3K0LA 4F93B 3FBIB 1Y0UA 4KMUX 5CVUA 4CCKA 1AU7A 2PI0A 4Z6YA 2F5CA 4A3CJ 4NBQA 2IPQX 1R00A 2E7WA 4R79A 2GM4A 3EYIA 1Z6RA 2XF6A 3HOTA 4N9HA 1UZCA 2OZ6A 3LAPA 3I54A 5F6FA 4BJTA 4EEFG 1BN5A 3AG1H 2XRNA 2X85A 2MC4A 3J7AY 2CSOA 1Y56A 2XROA 4ETSA 1QO0D 2DK5A 3HPHA 3QOEA 1JUSA 3S93A 1OYYA 3JSPA 2QSFX 4XR6A 4Y15A 1ZG5A 1O3TA 2OCCH 4XN3A 1I3QJ 2WTEA 1JKPC 3GVAA 3X2QH 1VQNI 3EUKL 2RGVA 1MBEA 3OS1A 2IS2A 4M3BA 2XF7A 3JRIA 3HJEA 2XAJA 2CFOA 2ICWG 3COAC 2IEKA 2V79A 3S32A 3QU6A 4LG0B 2Z5UA 1HW5A 1Z3XA 2F5FA 1BIBA 2IRFG 4IOCF 3LQRA 1VQ8I 2Q0OA 1U3EM 3MKYB 2ZJPF 1OCOH 1QVTA 2ESHA 1XPXA 2Y0SA 1X4PA 1FZPB 3TQNA 1ACIA 3BROA 2V9KA 3TOAA 2D5VA 1FPQA 4C9YA 2IGOA 3U1DA 4LD5A 2WBMA 3H3ZA 3IAM2 4Y7NJ 3S3OA 1HA8A 4AIHA 3FK6A 4A93J 5GAEJ 3CZ6A 3JRBA 1ZRCA 4E7KA 3CC7I 1Z67A 4ZYHA 1MMNA 3OYLA 4WXHA 2X1DA 2QWWA 3C1DA 5HNHA 1RUOA 3ECOA 2X9DA 4II2A 2RC4A 1OCCH 2Y69H 3QYFA 5D4RA 5EG0A 3P9CA 2QA4I 5E8IA 1B72A 2OTJI 2HDCA 1X2NA 1Y1WJ 4HF1A 3DXJF 4BJ6C 1YG2A 2PQ8A 3DPLC 3F8CA 3L09A 5FKKA 2DFIA 4A69C 3DFGA 1ZR4A 4G7OF 4HX7A 4D5CA 4YIRX 3DP7A 1S29A 4KJZA 4RAZA 1Y8RB 3M8EA 5B1AH 2VT3A 1DUXC 2XPUA 1U5TB 5IOZA 5E1WA 3TOBA 3GTPJ 1TW2A 2R3SA 2L7MP 2CWEA 4C3JJ 3ABUA 3E5XA 3GO5A 4F3QA 3OSGA 3EQLF 3GTJJ 3EPZA 5D8KB 3J81Z 2GA2A 1U9OA 3K9TA 3NAUA 2HTSA 3HBLA 5CVRA 3FHZA 2F5VA 1AKHB 3IL2A 3ZMVA 2IS6A 3JR9A 2OPTA 3H9JA 5B66C 3BTIA 5M5WJ 4PDKA 5EEHA 3J7YJ 4HSTA 3TP3A 1MBKA 3FWEA 2LY2A 2KLOA 2VOPA 3M1CA 2BVLA 4B3XA 3NEUA 1P92A 3E6CC 3DBLB 2RNGA 2E34A 3BTJA 3DKXA 3WTVC 4XLHA 4UVAA 1XD7A 1R22A 4XLNF 3GTMJ 4LK0F 3ZR8X 1IXSB 3SFIA 1FX7A 2QZ8A 1W5SA 2B0LA 3ZOBA 1IAWA 1OQYA 3F72A 2JA8J 2GA1A 2DYRH 1QNTA 3DQVC 2LVSA 4Q5SF 2CUJA 3BZCA 2R7QA 2R7DA 3JRFA 1X1CA 1G3YA 2GXGA 3GF2A 5F0FA 1WI9A 1T95A 3HOUJ 3CJTB 1OCZH 4EM1A 3I59A 4JX6A 4QWQA 3HDDA 2EIMH 5TGTA 3HL2A 5FKMA 2FSWA 3RI4A 2LFBA 1FOWA 1VQLI 4KNYA 3CCRI 3BR5A 3QWLA 2ESNA 3P5JA 5CQGA 3I4MJ 1LFUP 1DU0A 1WJEA 2MYSA 4HBLA 1BOBA 2CS3A 4XLPF 3FXUA 3CO7C 3KFWX 4B1RA 5IYCJ 4RB1A 1MKMA 4PZJA 4E7IA 1S5LC 2DDBA 2O61A 4N4NB 4BE0A 5CQEA 3RPUD 4CDGA 2KIFA 3RQIA 2O8KA 4Z2YA 5FLMJ 2ZJ2A 3K4CA 4BH9A 3MD2A 2K9MA 1IV8A 2FNAA 1GXPA 3RKQA 1RR8C 1J2XA 3ABKH 5GADJ 2KQRA 1QGPA 2MABA 1LJ9A 1DP3A 1PUFA 2ACJA 1JT0A 2W24A 1TWAJ 2CQKA 2FOKA 3DKYA 2MD5A 2JQ7A 4MEXF 1T0FA 1IDYA 2BE5F 2NVYJ 2ZJQF 1NK2P 3CMEI 3DBRB 4PK4A 1FWZA 2CQNA 2DLLA 4TV7A 3JCUC 2TDXA 3GTOJ 4XRSG 4WXDA 1R4MB 3LFUA 4NB5A 3PL8A 2DMQA 2BZTA 2Q2EB 4BBRJ 4O6JA 1J0RA 2IJLA 1JUPA 4X0GA 1D0YA 4PJ0C 3R61A 2M34A 1ETXA 3UKGA 4BHBA 2YU3A 3LAJA 2ZJRF 5KHDA 3F21A 3AL0B 1IN5A 4A3MJ 4UHTA 2XAFA 2CQ7A 3MZYA 5CVJA 5D6EA 3QPSA 1ENHA 1ZARA 1ZN2A 2XDVA 1JTYA 3DEEA 3DV8A 3PUBA 3BTCA 5FFXA 5CLSA 3W6JB 4A6DA 4E4HA 4ZDPA 4WXCA 5FRNA 3A01B 4LITA 2HKXA 3MFKA 2ZMEB 3LOCA 2HEOA 1YHQI 2R7FA 5F0CA 5ICCA 5HVQC 2VN2A 4BE1A 1NG6A 2GIVA 4CA0A 5JHFA 2IT0A 1OJLA 2VXZA 3BTLA 2OTLI 2XGXA 1K4SA 5LD2C 3ULQB 2H8WA 5DM7F 1XDUA 2DJIA 3W2VA 5LEKA 1T8IA 2HQRA 3S17J 2OJED 3T8RA 2H1LA 2ID3A 1FBUA 1WWXA 4V2FA 2VB6A 2BBYA 3LSGA 1Y6IA 4ZH4F 3E6BA 1TW3A 3CMAI 2P81A 1D0XA 3RPQA 1YJNI 4KITB 2Q1ZB 2ZXIA 2HTJA 4O3MA 4UUTA 4BL0B 2E1NA 5D5XB 3I4PA 3J7AO 3LSHA 1STZA 1MDMB 1MNMC 3MAJA 4CSWA 3PJRA 1AOYA 4XN0A 4H0EA 1PUFB 1RRJA 2GOXB 4UVCA 1KYWA 4OMYA 3K1PA 2YSRA 5FLXK 4HNUA 2CUEA 2L7FP 4C3HJ 1S7EA 2BY1A 3BR3A 2JSCA 3PSIA 2LLKA 4I6ZA 1YW9A 2B9SA 3QP6A 3J81K 2EPFA 1FMWA 2K9QA 3V7CA 2W4SA 1YJ9I 1SFOJ 4IHVA 3RYRA 3CCVI 2R5ZA 3P7NA 5D6FA 4I09A 1YRNA 2JN6A 2OD5A 3BZ6A 3HXLA 4KT5C 1VQMI 1H88C 2BY2A 2WAEA 4I0AA 2NOGA 3W2WA 4L18B 2Z2SB 2IW5A 1QBJA 2W7NA 1KGSA 3I56I 1UG2A 1VFCA 3F9KA 2JPCA 5LRRA 1E17A 2EA4A 5FKOA 2DPDA 1KA8A 1M1EB 3IV5A 2PX9A 3OMYA 4GFBA 3TDZC 5IT9Z 2W57A 4XL9A 4GYIA 3ZQIA 2EQRA 1DGRM 2EV6A 2GOMA 5FRMA 3HTUA 3QPTA 2E2IJ 4K2EA 3OSFA 2IGMA 1FY7A 1E3OC 2O6GE 4IRHA 1MMGA 4HLYA 2H94A 1U8RA 1YE9A 3QRFF 4A3JJ 2ZXHA 2O3FA 5FO5A 2EFNA 1E0EA 5K7ZA 4PJLA 3JSOA 5JLXA 1LE8A 4LG0A 1QZZA 1UJ8A 2KRFA 3K4LA 4FETA 2ZO4A 3A01A 3VEPA 2ZMEA 3I55I 2CV0A 1X1PA 2VBXA 1HXDA 1X1BA 2CW7A 3OS2A 4XOTA 3HYIA 4O5VA 3I53A 3EDPA 3JREA 1R5HA 2DA5A 2HI3A 1YW8A 3RTRA 3RPUA 1EJ9A 3PSFA 2DI3A 4P55A 4M6XA 1HSJA 3GFMA 1BC8C 2FBIA 4ZYGA 3KYLA 2PJRB 2ZNZA 1YIJI 4HYEA 1MZBA 2ZCWA 1IF1A 1X1AA 3ZPLA 3T1BA 3ERED 2CQQA 1A5JA 2OQGA 4B8XA 5LHIA 4ESJA 5D5WB 4M74A 2ETHA 2JSPA 1WI3A 2OU2A 3GFLA 3GTQJ 3CCJI 3PIOF 1LKXA 1ZLJA 3PFYA 1KU9A 2FU4A 4CCJA 1BI0A 3G1MA 5D8LB 2K9LA 3JTHA 4GCVA 4LGWA 4JP0A 4BKXA 1ERDA 2DFFA 1P6RA 3DTIA 2DMNA 1W1WE 2R7XA 3LMMA 1TNTA 1VF9A 1W36D 1ETVA 2FOWA 4BGDA 5AONA 5J4VA 4IOAF 3KYCB 4XNFA 1J7KA 3LWFA 2JZYA 3TO9A 3MVPA 3ZQQA 5B1BH 4AYBA 1IRZA 4FE4A 4BEHA 1A6IA 2EFOA 4RAYA 4C3IJ 1AHDP 2DQLA 4RLQA 1TWHJ 1Z91A 4CICA 1JXSA 3S3MA 1WJBA 3GLLA 3M9AA 4G7ZF 2LY1A 1ZELA 4E7ZA 3SZPA 3GYHX 4ZZLA 4XONA 1VQ4I 4PJMA 1H8AC 4EQQA 3K4JA 2X1EA 3BJAA 2DA4A 3NARA 1V55H 1V3FA 3R0JA 3V7RA 3ZXSA 2ZSHB 3QAHA 4F7ZA 2CYYA 1QPIA 4PFPA 2A69F 2YR2A 1J59A 2QBYA 2L01A 4I02A 1YYVA 1QA6A 2WY8Q 2A3SA 1OCTC 1F5TA 2IBDA 4S0HB 3CUOA 1RC9A 2WADA 4G8XA 2E1CA 3GW2A 1XC5A 4HNVA 2ZB9A 3VOEA 5ICEA 4BS9A 4A3DJ 2Y30A 4DOZA 4XLFA 4HEA2 4ZDLA 5FKNA 2L7KA 5GP9A 3RCOA 4EJOA 3OYIA 4E7HA 2XSDC 3MCZA 2L2OA 5D5VB 2XGDA 3RZDJ 4A6EA 5BNGA 1N75A 4RGRA 3JAMK 4BXFA 3ZQLA 2PMZN 1ONVA 4CHUA 2WY7Q 4PFOA 2JRTA 3OYNA 3GZ5A 4XRSA 2W48A 2W1OA 1FJLA 2VBWA 2A6TA 5E3NA 2KFDA 1W0UA 4M6YA 4BNCA 1HCRA 2X6WA 3KP3A 2JT1A 2VI6A 2W84A 3FMRA 3W6VA 1R23A 5EF6A 3KIOA 3H36A 4I7HA 3MKLA 3OYMA 2L9VA 4J19A 3R4KA 2LKPA 5J8CA 2A07F 1I50J 1K78A 4G94A 4FE7A 4IRIA 1VQ6I 1U9NA 5H2FC 2K85A 3H9QA 5E79C 5D5UB 3GUDA 3KX2A 4M3GA 3F6VA 4FTHA 4ZYAA 2CUZA 4BXUA 2L0KA 2BOLA 2HOTA 1QQIA 1G3WA 1JKRC 4XKBA 4L0YB 2R7TA 5M3FJ 2M0MA 1YFHA 2F4MB 1AKHA 1ETKA 1IUFA 3QYEA 1OPCA 4IX7A 5FB2A 4XM3A 4X1EA 2NS7A 4CXFA 4AIKA 3KZZA 5IT3A 4U87A 2OQRA 4ZYDA 5D4SA 2XKOA 3BQZA 3OOPA 4UUSA 2R7WA 2WAQN 3BDDA 4NQWB 2C6YA 3F22A 1OMIA 4M3EA 4F55A 3MZHA 4FX4A 1FIPA 3K4MA 1O57A 1SEUA 1JE8A 3S1NJ 1BA5A 2ZKZA 4I01A 1LNWA 1R71A 1ZGJA 2FUG2 2OV7A 3LFKA 3HSFA 2DOAA 4UVBA 5IP7J 2HVSA 1R7JA 3C7JA 3KP6A 1JHFA 2UXNA 5B3SH 5J47A 3MN2A 2HOSA 1ZTRA 4NDLA 4BE2A 3GZNB 4M3FA 3S14J 1UB9A 1XGOA 3BPXA 1QPMA 4ENKA 5LEJA 2F5DA 4DNCA 1IRGA 4RLFA 1NTCA 3PQKA 3WE2A 2BYVE 2QBYB 5C4JJ 2HZDA 2HOEA 3HIFA 1T33A 4G9YA 4ABZA 1A04A 4S04A 4HDVA 3KE2A 4KFCA 4E7JA 3BG9A 4IHWA 3C18A 1WSUA 2EJRA 2HZTA 5CJ9A 5ICGA 5FJ8J 1LDJA 3BQYA 3HRUA 5JLWA 3ML6A 2XPVA 4B44A 2BV6A 4IHTA 4A3LJ 1K78B 1PJRA 1OCRH 4LFUA 3HRTA 3H5AA 9ANTA 1TP4A 4AC0A 3CCLI 1ZR2A 2E71A 2P8TA 3H0DA 4EGZA 1GHCA 2QCOA 1X3UA 2ZBKA 4XIDA 2VQGA 3LNQA 1SMTA 3ABMH 4M9ZA 3I59B 2BHZA 2DT6A 4IJAA 2OF7A 4D7MA 2O8XA 1T38A 4OAZA 4L9NA 3A4CA 1YW7A 3LSJA 3F23A 5F0HA 5EJCA 2VC0A 4G7HF 1ZRFA 2JUGA 2HU9A 5K5QA 1USTA 4C2UA 4ZC3A 1X3WB 1VQ5I 3CLOA 1R4NB 4DYQA 2VONA 2RNJA 4ENMA 1T2KA 4GXOA 3A02A 3MKWB 2DODA 4KISA 5J3LA 4BAYA 1X3ZB 1MSEC 5GPCA 2FXAA 1LEAA 2KT0A 4EGYA 1BJZA 1Z3YA 4KT6A 4N9IA 1LB2A 2KIMA 1EH7A 1R5ID 4OINF 4MHGA 3RSNA 2CJJA 3L1PA 3CJNA 4IHXA 2KJCA 3CC2I 1J9IA 4R8HA 4U0YA 2LC2A 2AXLA 2EILH 2DOFA 3O8GA 4HX8A 1ZG1A 1P2FA 3FXMA 3F8FA 2E1MC 2Z3YA 1I6HJ 2KMUA 2EINH 1QRYA 4XBFA 4CH7A 3PUFA 2FQ4A 3VWBA 2P7VB 2MLKA 1TBXA 3ZMZA 2OUMA 1HSTA 4HAMA 3CP8A 1WPKA 1KONA 1EF4A 4JK1X 5C3EJ 1BBYA 1DDNA 3OYEA 3DU5A 1PYVA 4M3DA 5EDNA 2W82A 2L9NA 4QPQA 2FBHA 2R7VA 2IA0A 2K02A 2VJIA 1YS7A 5BPDA 4B3AA 1HDPA 3IH2A 4LK1F 1SD4A 3FXJA 4D5FA 5E1XA 1JTXA 3AG3H 4LIUA 3PO3J 2ME6A 3IWZA 4KUMA 2K9NA 4BQQA 5F1RA 2LSOA 1ZLKA 3KP4A 2QQ9A 2VC1A 4XORA 4A3GJ 4M71A 1PUEE 1B4AA 2ZSIB 2DA3A 3W2AA 2DOEA 2EFWA 3FXRA 2WV0A 1YJWI 2YU9J 5F64A 2K4BA 3E5QA 3TL4X 3EUHC 4G6QA 4P96A 3TO6A 4HF2A 2HYGD 1HKTA 1IDZA 4A3IJ 3OS0A 2KIUA 4MO7A 2V9VA 2STWA 2DMUA 4EJWA 4IHSA 1UCRA 5BOXA 2H27A 1YITI 3QYBA 4L0ZB 1TWFJ 2GQQA 5L3BA 4ZDOA 1G6NA 1ZG3A 3MEXA 1VQOI 1N77A 1JJ8C 4AD9A 1OFCX 2IGKA 5L3GA 2GLOA 1WHUA 3T0YA 4LMYA 3OYAA 4L9JA 4XQFA 5LFAA 2XB5A 1K4TA 1I5ZA 1W36C 2TRTA 3HEFA 3CJQB 4CCOA 2Q8KA 2M4GA 3M07A 3T8TA 1MNDA 1KYZA 1BJAA 1NH3A 2JA6J 5HDKA 3HUGA 2DO7A 1SD7A 4MTDA 3K1NA 2L54A 2E60A 4IPAA 4Y13A 3LSKA 6PAXA 4YG2F 3NWSA 1R1TA 2ELHA 2HYFA 1K61A 1IN8A 1I1GA 2PBIA 2M4KA 3AG4H 4F91B 3GX4X 3PNVA 4EJUA 2I5UA 2P6SA 3HSEA 4ITVA 2L5QA 2XVCA 1YQAA 4KIGA 5CVIA 3QP5A 4JX4A 1HQCA 1XX5A 4LLNA 1LVKA 1Y39A 3RKWA 1BOAA 5FD6A 4UV8A 4DYRA 3L00A 3L2VA 2YX7A 2XB0X 4HG2A 3WE3A 3DTKA 1G59A 3SFZA 4A3BJ 3WTUC 2DTZA 2EZIA 1Z1DA 2CG4A 3L2CA 3DEWA 4PSXA 1XB4A 2K86A 5F1JA 2XAQA 4M73A 4XICA 1AA7A 1V4RA 4GYGA 5DTDA 4XKCA 1L3LA 5HS9A 2ZFWA 3C2HA 2HDDA 1SAXA 4D1QA 3BWGA 5DYMA 1AWCA 3HHHA 4XKWA 1Z0XA 5F08A 4RA2A 4ZJZA 1Q1HA 4HV5A 3Q5FA 4Q4ZF 5L3DA 3V8LA 3HOWJ 4PGHA 3VSLA 1XG1A 2A6EF 2ZMEC 1XSDA 4BBSJ 1FP2A 4JX5A 1T98A 2JVHA 2MFZA 2H6CA 1ZK8A 2CMPA 3BCBA 4UUVA 4RGSA 2MC3A 3L2RA 3DPTA 3ABLH 4MIMA 4UXNA 2P6TA 3CESA 4L5JA 4UB6C 3ZGKA 1YX5A 1A35A 3IUOA 5DM6F 1FTZA 4JBAA 1P7IA 1ZYRF 2EBIA 1FOXA 1ODDA 4NC6A 1ETQA 4D7NA 2QKLB 2XPWA 2A68F 2KDZA 3LQQA 1OR7A 2GIZA 5KVRA 1NK3P 4KYWA 1Y0NA 2ADUA 4DBRA 3D5LA 3Q0VA 4BEHB 2NS0A 1LPQA 1DPUA 2HKOA 1BM9A 5CPRB 4Y52J 5E8GA 3NQOA 1YI2I 2R93J 2CO5A 3REOA 3RJPA 1MJBA 2RVCA 3WTXC 2O03A 3HOYJ 3DU6A 4PSWA 2EK5A 2VKHA 2QSHX 1U6GA 1R49A 2UV1A 4NUBA 2G7HA 5AIQA 5KAIC 4WWCA 4LJZF 2STTA 1B9NA 1WVRA 1BI3A 1ZRDA 2M0CA 2V4JC 4BQAA 5K5RA 4RDUA 2WA0A 1Y8QB 1MMSA 2Y31A 3JRCA 5DV5A 1VQPI 2GZWA 2K9SA 1W0TA 2QQBA 1GT0C 1TT0A 3S1MJ 5IYDJ 2HNHA 1P7JA 3FKJA 1KQ9A 4XSZF 3ZMTA 1N78A 3B6CA 4AWXB 1VQ9I 2DBBA 3I4NJ 2NVXJ 3H3UA 3MZ8A 2O5RA 4FX0A 1FT9A 1OLTA 2DDAA 3TW6A 3VFZA 5C4XJ 1IN7A 3KYDB 2XRLA 3BC8A 1WZ2A 3WTZA 3VYUB 1JHHA 3MQ0A 5HOOA 2A5WA 3E97A 2OCEA 1ZQ3P 1KZHA 5DCMA 2MG4A 1FYMA 1ZAOA 2J5OA 3ASNH 3OYJA 1JUMA 4L5EA 5BQTA 5FFZA 1SVMA 5LHHA 3E1SA 2A6HF 5TISC 4P1WA 5CKTA 2P7CB 2VJ4A 4PJNA 5IYBJ 1W4MA 3HGGA 3FDYA 1TC3C 2CW0F 4B47A 2DU9A 3OYBA 5JI6A 1U2WA 1VNDA 2DAOA 4RAGA 3H9GA 4NNJA 4KMFA 1YS6A 3FMQA 3IH4A 5EEGA 2VODA 1LEBA 4R1HA 3V8KA 4BACA 1BW5A 1W7PD 4EM0B 5E3LA 1YX3A 2VQHA 3RZOJ 3CJRB 2L9SA 3QODA 3TW7A 2CRGA 3FM5A 3FZVA 3OWTA 2LYCA 1K7AA 3WHBA 4IQ4A 1XCVA 4YELA 3KPHA 1VI0A 1A31A 1YIOA 2ID6A 2RN7A 2X0LA 2ZXWH 1UHSA 4OMZA 3MKZA 2X6OA 3KLNA 1PP7U 2PMHA 5H20A 4A0XA 3WU1B 2QEXI 3HTSB 3N4MA 5GPAA 3G2BA 2RDPA 4RS8A 3QOPA 1O7FA 1XN7A 3SYTA 1VQKI 4UB8C 3JTGA 1UAAA 2IGNA 1JGGA 3BG7A 2DQRA 5JFRA 1SVOA 1RKWA 1BC7C 2WAQA 3K4KA 2A05A 2LREA 2E5NA 1IRXA 1IW7F 3F8MA 1D8JA 1JKOC 3HB9A 3WTYC 1LVAA 3N05A 1QZEA 2Y9YA 5LGNA 5DDGA 2E2JJ 3DLLF 3LA7A 1T0FC 2HVQA 2LF8A 4LLLA 1QVUA 3BG6A 1OYWA 2EB7A 5ED4A 2I8DA 1X58A 3I5UA 1GDTA 3ZN1A 1TQMA 3M1EA 2FEZA 1TZLA 5FLXZ 1YO5C 5EG0B 3CMMA 2QSGX 4AIDA 2CFXA 3HHGA 3ELKA 2DT5A 4D0PA 3RQ4A 2QQ8A 4L5IA 2DPUA 2KRHA 5J1UA 3ZMSA 2FMYA 4CUGA 1XMAA 3AG2H 4QLCU 4E7SA 3TGNA 2M9HA 5C44J 2CQXA 5J1RA 2MBFA 3CCUI 4OAYA 5E17F 2ISYA 4NHJA 1SFKA 4KIFA 2LNBA 3H5NA 4F92B 1DGWY 3GMEA 4ENJA 5HLTA 4FCYA 5K1YA 2DJNA 1TL8A 1XCBA 3M4OJ 1UG0A 4NC7A 1X1DA 2LMDA 3JRHA 3QQAA 2WV1A 1KU3A 1VTNC 3CF5F 4KDPA 4UNOA 4FISA 2MH2A 3C2BA 4MGRA 3OYDA 1E3HA 2R4GA 2NVTJ 4P5OA 4ZYEA 3CUQB 4P9UA 2HYJA 5BMZA 4WK8F 1FIAA 3LSRA 4KN4X 1OCPA 1O7LA 3ESWB 4DJAA 1FLIA 3SZGA 4RM2A 1L0OC 2XUBA 5IP9J 2KHMA 4EV0A 2FF4A 2F5EA 1HW2A 1IGNA 1G3SA 3WG9A 2GAUA 4HF0A 3J7ZI 1SFUA 4ZTJA 4P9FA 1ETOA 4A5MA 1W5TA 2LBFA 4WX9A 1RETA 3BR0A 3KZIC 3B6AA 2D45A 1TWGJ 2L4MA 1REPC 1BR4A 5KNLA 4LB6B 3IKVA 3GTLJ 3E7LA 3U9GA 1Z6TA 1WH7A 4HW0A 3QU3A 2R7RA 3SJMA 4EJVA 3SEZA 5A2QZ 3AAFA 2D1VA 3ONQA 2NRAC 3KEYA 3RYPA 1A6QA 3HKZA 4MEYF 1RZ4A 3HC7A 4OIOF 3OY9A 1BR2A 3IHUA 3OL4A 4MFEA 3G73A 4AIJA 5GTIC 1TWCJ 3JW4A 4C2TA 5IOYA 3A0HC 1K79A 2QLZA 3CUQC 3DEUA 3FISA 3K4NA 1DP7P 5L3EA 2M45A 1FP1D 2RQQA 4ENNA 4DYCA 4YEJA 2ECBA 1GUUA 2DT7B 5CVVA 5LLQA 2JWTA 2E19A 3A2KA 2F4OB 3KP5A 2LD5A 1IXRC 1SANA 3E6MA 3GLXA 2L7ZA 2EZLA 1IUYA 1ETYA 1LDDA 3KP2A 3ISPA 2JTVA 2M87A 2LK2A 1G4DA 1UMQA 3IAS2 1GLNA 3KCCA 3SXYA 4I0BA 3G3ZA 5IY5H 1A36A 2VL8A 3FXQA 4A2UA 5GAHJ 4F52A 1SFXA 4QIWN 1U78A 5LGUA 4GDFA 3K70D 1MSFC 2VPLA 1BIAA 2VT2A 4XLEA 5BS6A 2D2WA 3KZYA 3OR1C 1V5GA 1IG7A 3TDUC 2NS8A 5KK1A 2EZKA 2LR8A 1HF0A 1WKMA 2HR3A 3BZKA 3LSIA 2FA5A 1MH4A 3PFIA 4YIIA 1WJAA 1YTYA 3BT9A 2HGCA 3IP4B 1GXQA 3KETA 2WWYA 2Y2ZA 3ZN0A 1HOMA 4JOMA 1HBXG 1WJCA 1I1SA 1S8NA 3DBHB 3VODA 4L9TA 3U2RA 2BW3B 2DK8A 3OIQA 1HC8A 4EVIA 2P5VA 3DPUA 2YUSA 4CO8A 3RKXA 3GFJA 1D5YA 3H1CA 2XF5A 3H0GJ 4A3KJ 4I99C 3K7AJ 2ELKA 2VLAA 3C3WA 4PGGA 3G1LA 3OYGA 1W5CC 1IC8A 2DN0A 1LUJB 1T6SA 5A2QK 3K70C 2X1CA 2KKOA 4BJ5C 3CUQA 4IKFA 1R1VA 2M1BA 5J6XA 2Z1DA 2XHKA 1U5TC 2R0QC 2BY0A 3HUGB 2R7SA 5FLVA 2OA4A 2XASA 3S3NA 4IF4A 3OYFA 3H3VK 3GZ6A 4MTEA 4HQMA 2PMUA 2QUFA 3JRGA 2FD5A 1LDKB 4U7BA 5E20A 2M2EA 3BR1A 3V7SA 3VB2A 5LBQA 1KU7A 2F4IA 2BHYA 4EJTA 4G12A 4OIPF 2IA2A 1V54H 2CW8A 1G8XA 1SD5A 2A5YB 2KISA 3IC7A 4A12A 5E18F 3G71I 1CF7A 3U21A 2X4HA 3Q0UA 1RUNA 3MMYB 4UY8I 2QF7A 4KN7X 5DCFA 1IZ1A 2W85A 3PO2J 3O3KA 1EH6A 3IRRA 4GGGA 2JA7J 2NOJB 1RR7A 2E5ZA 1ZH5A 3RKYA 1FSHA 1ZKGA 3FM3A 4QPOA 2QENA 2PFBA 3OR2C 4U88A 2F6CA 3WU2C 2KJBA 2JMWA 3HGYA 1F9NA 3IWFA 5KAFC 2CH0A 5JVGF 3NWTA 3S15J 2VKDA 5JHUA 1GVDA 1RESA 3FK7A 2LF7A 1SVLA 1WJFA 1XS9A 2FMLA 3S2WA 5EZHA 3T5XA 2IAIA 2V1UA 1WCMJ 3CCMI 4M6VA 4EM2A 4OIQF 5TJJA 2X6YA 4IHYA 3VYSB 3K4BA 2ZC2A 4RM3A 1MBHA 2H09A 3SZTA 3Q9SA 2PN6A 2LOOA 3I64A 3K6GA 3SEQA 3VYTB 2KIQA 5K7HA 4OOIA 3J80Z 4WF2A 2E7XA 2JJ7A 2HQNA 3K2AA 3WODF 5F04A 2G9WA 4H4KC 4DZPA 1XSVA 4U0VA 3UNGC 5ILVA 3L7WA 2VE8A 3OL3A 5E1ZB 1POGA 1UFMA 1LFBA 2DTRA 3LL7A 2K27A 3I3LA 3G1OA 1HDDC 4XOPA 5DD8A 4W1UA 1Y1VJ 3V4GA 2ZXJA 3CO6C 2UXXA 3ERMA 4ZZDA 3CCYA 1QU3A 3TKYA 3BJ6A 4XK4A 4HDUA 1HLVA 2GXAA 1X2MA 1G2HA 3I9V2 2N8GA 2IVMA 1O4XA 1R5GA 1N25A 5K7FA 3BG5A 1U0JA 2H6BA 2DFEA 1Z21A 2ISZA 1MJ9A 3BJOA 1MH3A 3EETA 2MGQA 3CC4I 5EGOB 2CV2A 2JVGA 1ZGWA 3ZQCA 3DWLE 4HQEA 2LTPA 5IPAA 4I2OA 1X19A 3JRDA 2XV4S 3TO7A 3CDLA 1CGPA 4DGWB 5DS9A 2EFQA 4U0WA 3ZCOA 1V5FA 2DMTA 4DW6A 4RAFA 1UHWA 1TQIA 3D5RC 3P9KA 3HOSA 3ZRGA 2B63J 3CF2A 1FNNA 2JRMA 1BL0A 1CQTA 2CU7A 1R36A 1TTYA 2VUMJ 5IT9K 1SMYF 5FD5A 1Z9CA 2LH9A 1BI1A 2V9PA 1JT6A 4LB5A 2G7UA 2VASA 3H35A 2VIXA 2QKMB 1WH5A 4XKVA 2LKXA 3AL0C 1D8KA 5M5YJ 3GBGA 3K1MA 4U7DA 1FSEA 3E0JB 3HOZJ 2YS9A 4N4OB 4AUXA 3M7GA 1H9GA 1MMDA 3I58A 1V5EA 1XTAA 2JPBA 2TCTA 4II3A 2XAHA 2VJ5A 2M8EA 4A3EJ 3VDXA 2BXZA 3BOQA 4PUSA 3DKWA 3WTTC 3WGIA 3S8PA 2WB1N 2FRHA 2OAZA 5HS8A 1K6OA 3U1KA 1S72I 2MLGA 3HPGA 3GXOA 3L9FA 1F36A 4XSXF 5E3MA 4CGZA 1SFEA 2O0YA 1FYLA 2UZKA 2HXIA 1D1CA 2R7OA 3N97A 2DMPA 3G6EI 3C2GA 1SD6A 4D9JA 2V1DA 1FC3A 3DCFA 1S3JA 2X48A 5B5EC 3W3CA 2EV5A 1QHHD 3S2HJ 2J5PA 5ILSA 1WFXA 4A3FJ 4CYCA 2QQAA 4HSRA 5EGOA 2HVRA 2COBA 1J75A 5DCMB 3CP2A 3CCSI 5DD4A 2LBFB 1ZGAA 2VXDA 4FHTA 4KIBA 2HQ5A 2O9LA 2QYOA 4BY7J 1R9TJ 2COMA 3K10A 4BHCA 2CV1A 1MBFA 4LG3A 5HLHA 1GV2A 3D0SA 4LLGF 1S7OA 3B02A 3R0AA 1MIJA 4XRFA 2LKSA 3FBNB 3RDIA 3EUAA 2WAFA 1D1BA 3HOXJ 4I76A 1H0MA 1J5YA 2IS4A 3WTSC 1NG7A 1VZ0A 1Z77A 2VQLA 1OR7C 2ZFUA 4YRVA 1VQ7I 2BGCA 3E5UA 3KP7A 3ASOH 4BHPA 3FKIJ 4BQNA 2ZNYA 3S1RJ 1XSXA 4QTRA 1FYKA 2EFPA 2UUZA 5ERIA 2AQEA 2VQCA 3M8JA 3CCEI 4Y4RA 1USSA 1P9QC 2EIJH 2PMZA 4E6KG 4QSHA 1UELB 1W7PB 2P5LC 4RBOA 1KU2A 2WB1A 2DFHA 4UUSB 1B9MA 2RQPA 3LA2A 1J09A 2FJ1A 4CCNA 1U5TA 4NQWA 2F2EA 4MLOA 3ROUA 5LGTA 2Z33A 2HWVA 3CDIA 4PJJA 2NYXA 5HLIA 2I10A 1JI8A 3AFHA 1H9TA 2ECCA 3HOVJ 4GRIA 3R6SA 1ZHFA 4OWRB 2R7UA 5ICFA 3ZQGA 2VBYA 3F8BA 2VJJA 2KL4A 2KDOA 5HDGA 3OYCA 2FX0A 4B43A 4RGXA 1MD0A 3QPLA 2XIGA 2W25A 3B73A 3E6DA 2NVQJ 1JGSA 3TMOA 1B8IA 4BU2A 2L4AA 1B6AA 4V19K 2V7FA 3E3VA 1F4KA 3M3YJ 2NXNB 3VYRB 3OIPA 1RI7A 1TNSA 4JQFA 1D3YA 1G3TA 2M3AA 2YX4A 2XSJC 1TT5B 3TP0A 4M9SA 4G6DA 3VPRA 4Q47A 2LRDA 5L3CA 2PJPA 1O3QA 2LG4A 4Q48A 4YFNF 4RB0A 1ETWA 4KICA
chains in the Genus database with same CATH topology
2Q2EA 1EV7A 4L9VA 5JR3A 3SHFA 1F1ZA 3HSRA 5HDNA 3BPVA 5TRDA 2FNPA 4I98B 2Y0MA 1TLHB 2NAZA 2K7LA 1E2XA 3CTAA 3LSTA 3F6OA 1KQ0A 1EH8A 1P4WA 2QM3A 2LDUA 3QPHA 4YFKF 1P4XA 1W7PA 4YFXF 4M72A 3EYYA 4WCGA 5LHGA 1RNLA 3IKTA 1D5VA 1CF7B 3ZMDA 2OZUA 4KA4A 1ON1A 3F3XA 1UHMA 4A0ZA 2K4JA 1B59A 3GWZA 3I0TA 3ABTA 1O3RA 3EUHA 3KEQA 1MDMA 2P4WA 4E70A 3HRSA 1PP8F 2YPRA 3GEZA 3HRMA 3RIRA 1IRFA 5AIPA 4IRGA 2EV0A 3GFIA 1S6LA 3SQNA 1C0WA 2V6CA 3R60A 4Y17A 1HW1A 2DW4A 4AVPA 1HKQA 2HS5A 2RKHA 2V1XA 2L3DA 1NHAA 4ASNA 2XAGA 2XKPA 1XGSA 3O6BB 4M9XA 1XDSA 5DUIA 2P5KA 1FBSA 1QZYA 2VBZA 2EWNA 2AS5F 3FX3A 5DEQA 4RGUA 4IXAA 2NNYA 1XGMA 1R1UA 1S7AA 3K2ZA 4ESBA 3BP8A 1PDNC 3JAMZ 4PCQA 2RV8A 5DUKA 2GXBA 2M30A 4MQ9F 4HZFA 4UV9A 1IXCA 1KQ8A 3OV8A 1MJAA 2CGPA 1MGTA 3V8JA 2D1HA 1IN6A 3ZP5A 1P4AA 1OYIA 4GO1A 3IRQA 4A0YA 2Z99A 2GWRA 2VOOA 1FOKA 4N0BA 5HLGA 3J80K 3WTWC 5BPIA 4OIRF 1IN4A 1YLFA 3LA3A 3H92A 3I71A 5CYVA 1XMKA 4FT8A 1ZREA 2QVOA 5LRSA 1LQ1A 2NNNA 1OKRA 3F8NA 3ZMUA 4OU0A 5JVTA 1WRJA 3W6KB 3CDHA 4CZZA 2BEOA 5HS7A 1O3SA 1Z05A 2M5WA 4ESFA 4A5NA 2IP2A 2HFHA 3WU0A 2UWMA 3K69A 2IA1A 1TQPA 2Y75A 5J8FA 1B1BA 1I6XA 4HOBA 1RIOH 2L02A 1HKSA 3NRVA 5ILUA 3KLOA 2FQ3A 5H6QA 1ULYA 4MQVA 3P9IA 4RB2C 3M8FA 3DF8A 4HA8A 2PG4A 2Y48A 2FE3A 4HX4A 3FMSA 4MNUA 4EMSA 2OBPA 3FF5A 2WC2A 1XGNA 1FBQA 3ECHA 3MWMA 4BYYA 4YIFA 4S05A 3ZQ7A 1I27A 5FGMA 4ON0A 3BY6A 2FBKA 1Z7UA 4B09A 5K5OA 2Z9OA 1GVJA 4RB3C 1ON2A 4HLXA 4DQ2A 5L3FA 3Q9VA 2VE9A 2A61A 1R58A 2EA2A 3PQJA 1DPRA 1T39A 3O2PE 4IVNA 3WGGA 2MA3A 2PLYA 2MH9A 5H6RA 1WQ2A 2PEXA 3WGHA 4HV6A 1BI2A 3KEOA 4CYDA 3K0LA 5CVUA 1Y0UA 4KMUX 2PI0A 2F5CA 2IPQX 1R00A 2E7WA 4R79A 3EYIA 1Z6RA 3HOTA 4N9HA 2OZ6A 3LAPA 3I54A 5F6FA 1BN5A 2XRNA 2CSOA 2XROA 4ETSA 1QO0D 2DK5A 1OYYA 3JSPA 4Y15A 1ZG5A 1O3TA 2WTEA 3GVAA 2RGVA 2XAJA 3COAC 4LG0B 2V79A 3QU6A 2Z5UA 1HW5A 2F5FA 1BIBA 2IRFG 3LQRA 2Q0OA 1U3EM 2ESHA 1FZPB 3TQNA 3BROA 3TOAA 1FPQA 3U1DA 4LD5A 3H3ZA 4AIHA 1ZRCA 4ZYHA 4WXHA 2QWWA 3C1DA 1RUOA 3ECOA 2RC4A 5D4RA 3P9CA 5E8IA 2HDCA 4HF1A 3DXJF 1YG2A 2PQ8A 3DPLC 3F8CA 3L09A 2DFIA 3DFGA 4G7OF 4HX7A 3DP7A 1S29A 4RAZA 3M8EA 2VT3A 1DUXC 1U5TB 5E1WA 3TOBA 1TW2A 2R3SA 2CWEA 3ABUA 3E5XA 3GO5A 3EQLF 5D8KB 3J81Z 2GA2A 3K9TA 2HTSA 5CVRA 3FHZA 3IL2A 3ZMVA 4PDKA 5EEHA 3FWEA 2VOPA 3NEUA 1P92A 3E6CC 3WTVC 4UVAA 1XD7A 1R22A 4XLNF 4LK0F 1IXSB 1FX7A 2QZ8A 1W5SA 2B0LA 1IAWA 3F72A 2GA1A 1QNTA 3DQVC 4Q5SF 2R7DA 1G3YA 2GXGA 3GF2A 1WI9A 4EM1A 3I59A 4QWQA 2FSWA 3RI4A 4KNYA 2ESNA 4HBLA 4XLPF 3FXUA 3CO7C 3KFWX 4RB1A 1MKMA 4PZJA 2O61A 4CDGA 2KIFA 4Z2YA 2ZJ2A 4BH9A 2FNAA 1GXPA 1J2XA 1QGPA 1LJ9A 2ACJA 2W24A 2CQKA 2FOKA 2MD5A 4MEXF 1T0FA 2BE5F 1FWZA 2DLLA 4TV7A 2TDXA 4WXDA 4NB5A 4O6JA 1J0RA 2IJLA 3R61A 4BHBA 2YU3A 3LAJA 3F21A 1IN5A 4UHTA 2XAFA 3MZYA 5CVJA 5D6EA 1ZARA 1ZN2A 3DV8A 5FFXA 5CLSA 3W6JB 4A6DA 4WXCA 2HKXA 3MFKA 2ZMEB 2HEOA 2R7FA 5ICCA 5HVQC 2VN2A 2GIVA 2IT0A 2VXZA 2XGXA 3ULQB 1XDUA 5LEKA 2HQRA 3T8RA 1FBUA 1WWXA 2BBYA 4ZH4F 3E6BA 1TW3A 3RPQA 2HTJA 4O3MA 2E1NA 5D5XB 3I4PA 3J7AO 1STZA 1MDMB 3MAJA 1AOYA 4H0EA 4UVCA 1KYWA 4OMYA 3K1PA 2YSRA 5FLXK 2JSCA 1YW9A 3QP6A 3J81K 3V7CA 3RYRA 3P7NA 5D6FA 4I09A 2OD5A 3BZ6A 4KT5C 4I0AA 4L18B 2IW5A 1QBJA 1KGSA 2JPCA 5LRRA 1E17A 2EA4A 2DPDA 1KA8A 3TDZC 5IT9Z 2W57A 4GYIA 2EV6A 3HTUA 3QPTA 4K2EA 2O6GE 1FY7A 4IRHA 4HLYA 2H94A 1U8RA 3QRFF 2O3FA 5FO5A 2EFNA 3JSOA 4LG0A 1QZZA 2KRFA 2ZO4A 3VEPA 2ZMEA 2VBXA 1HXDA 3HYIA 4O5VA 3I53A 3EDPA 1R5HA 1YW8A 3RTRA 3RPUA 2DI3A 4P55A 4M6XA 1HSJA 3GFMA 1BC8C 2FBIA 4ZYGA 2ZNZA 4HYEA 1MZBA 2ZCWA 1IF1A 3ZPLA 3T1BA 3ERED 2OQGA 4B8XA 5LHIA 4ESJA 5D5WB 4M74A 2ETHA 2OU2A 3GFLA 1ZLJA 1KU9A 2FU4A 1BI0A 5D8LB 3JTHA 4GCVA 4LGWA 1P6RA 1TNTA 5AONA 1J7KA 3LWFA 2JZYA 3TO9A 2EFOA 4RAYA 2DQLA 1Z91A 4CICA 1JXSA 3M9AA 4G7ZF 3SZPA 3GYHX 4ZZLA 4EQQA 3BJAA 1V3FA 3R0JA 3V7RA 3QAHA 4F7ZA 2CYYA 2QBYA 2A69F 2YR2A 1J59A 2L01A 4I02A 1YYVA 2A3SA 1F5TA 3CUOA 4G8XA 2E1CA 3GW2A 3VOEA 5ICEA 4EJOA 3MCZA 5D5VB 4A6EA 4RGRA 3JAMK 1ONVA 4CHUA 2JRTA 3GZ5A 2VBWA 4BNCA 4M6YA 3KP3A 2JT1A 2W84A 3FMRA 1R23A 4I7HA 3R4KA 2LKPA 5J8CA 2A07F 1K78A 4G94A 4IRIA 5D5UB 3GUDA 3F6VA 4BXUA 1QQIA 1G3WA 4L0YB 1YFHA 1OPCA 5FB2A 4CXFA 4AIKA 3KZZA 5IT3A 2OQRA 4ZYDA 5D4SA 2XKOA 3OOPA 3BDDA 2C6YA 3F22A 1OMIA 3MZHA 4FX4A 1O57A 1JE8A 2ZKZA 4I01A 1LNWA 1ZGJA 3LFKA 3HSFA 4UVBA 1R7JA 3C7JA 3KP6A 1JHFA 2UXNA 1UB9A 1XGOA 3BPXA 1QPMA 4ENKA 5LEJA 2F5DA 4DNCA 1IRGA 3PQKA 3WE2A 2BYVE 2QBYB 3HIFA 2HOEA 4G9YA 4S04A 1A04A 4HDVA 4KFCA 3KE2A 3C18A 1WSUA 2EJRA 2HZTA 5CJ9A 5ICGA 1LDJA 3HRUA 3ML6A 4IHTA 2BV6A 1K78B 4LFUA 3HRTA 2P8TA 4EGZA 1GHCA 1X3UA 2ZBKA 1SMTA 4M9ZA 3I59B 4IJAA 2O8XA 1T38A 4L9NA 1YW7A 3F23A 2VC0A 4G7HF 1ZRFA 5K5QA 1USTA 3CLOA 2VONA 2RNJA 4ENMA 1T2KA 4GXOA 4BAYA 2FXAA 1LEAA 4EGYA 4N9IA 1LB2A 2KIMA 1EH7A 4OINF 4MHGA 3CJNA 2KJCA 1J9IA 4R8HA 4U0YA 2AXLA 4HX8A 1ZG1A 1P2FA 3F8FA 2Z3YA 4XBFA 2P7VB 2MLKA 1TBXA 3ZMZA 1HSTA 4HAMA 4JK1X 1BBYA 1DDNA 2FBHA 2IA0A 2K02A 1YS7A 5BPDA 4LK1F 1SD4A 5E1XA 3IWZA 4KUMA 5F1RA 2LSOA 1ZLKA 3KP4A 2QQ9A 2VC1A 4M71A 1PUEE 1B4AA 2EFWA 3FXRA 2WV0A 5F64A 2K4BA 3E5QA 4G6QA 4P96A 3TO6A 4HF2A 2HYGD 1HKTA 2KIUA 2V9VA 2STWA 4EJWA 4IHSA 1UCRA 5BOXA 2H27A 4L0ZB 2GQQA 5L3BA 1G6NA 1ZG3A 3MEXA 4AD9A 5L3GA 3T0YA 4LMYA 4L9JA 1I5ZA 2Q8KA 3T8TA 1KYZA 1BJAA 5HDKA 3HUGA 2DO7A 1SD7A 4MTDA 3K1NA 2L54A 4IPAA 4Y13A 6PAXA 4YG2F 1R1TA 2ELHA 2HYFA 1IN8A 1I1GA 2PBIA 3GX4X 4EJUA 2P6SA 3HSEA 2XVCA 1YQAA 4KIGA 5CVIA 3QP5A 1HQCA 4LLNA 3RKWA 1BOAA 5FD6A 4UV8A 3L00A 2YX7A 3WE3A 3SFZA 3WTUC 1Z1DA 2CG4A 3L2CA 1XB4A 2K86A 2XAQA 4M73A 1V4RA 4GYGA 1L3LA 5HS9A 2ZFWA 1SAXA 3BWGA 5DYMA 1AWCA 3HHHA 1Q1HA 4HV5A 3Q5FA 4Q4ZF 5L3DA 3V8LA 4PGHA 2A6EF 1XSDA 1FP2A 1T98A 2H6CA 4UUVA 4RGSA 2MC3A 3DPTA 4UXNA 2P6TA 4L5JA 4JBAA 1ZYRF 1ODDA 2A68F 3LQQA 1OR7A 5KVRA 4KYWA 2ADUA 3D5LA 1DPUA 2NS0A 2HKOA 1BM9A 5E8GA 3NQOA 2CO5A 3REOA 3RJPA 1MJBA 2RVCA 3WTXC 2O03A 2EK5A 1U6GA 5AIQA 2G7HA 4WWCA 4LJZF 2STTA 1B9NA 1BI3A 1ZRDA 4BQAA 5K5RA 5DV5A 2GZWA 2QQBA 1KQ9A 4XSZF 3ZMTA 4AWXB 2DBBA 3H3UA 4FX0A 1FT9A 3VFZA 1IN7A 3WTZA 1JHHA 3MQ0A 5HOOA 3E97A 5DCMA 1FYMA 1ZAOA 2J5OA 5BQTA 5FFZA 5LHHA 2A6HF 2P7CB 1W4MA 2CW0F 2DU9A 5JI6A 1U2WA 2DAOA 4KMFA 1YS6A 3FMQA 5EEGA 1LEBA 2VODA 4R1HA 3V8KA 1W7PD 4EM0B 3FM5A 3FZVA 1K7AA 1XCVA 1YIOA 2X0LA 2RN7A 4OMZA 3KLNA 1PP7U 2PMHA 5H20A 4A0XA 3WU1B 3HTSB 3N4MA 4RS8A 2RDPA 3QOPA 1O7FA 1XN7A 3JTGA 2DQRA 5JFRA 1BC7C 1IW7F 3F8MA 1D8JA 3WTYC 1LVAA 5LGNA 5DDGA 3LA7A 2LF8A 4LLLA 1OYWA 2EB7A 5ED4A 3I5UA 3ZN1A 1TQMA 3M1EA 2FEZA 5FLXZ 1YO5C 2CFXA 3HHGA 3ELKA 2DT5A 4D0PA 4L5IA 2DPUA 3ZMSA 2FMYA 1XMAA 4QLCU 3TGNA 2MBFA 5E17F 2ISYA 4NHJA 4KIFA 2LNBA 4ENJA 5K1YA 1XCBA 1KU3A 1VTNC 4KDPA 4UNOA 2MH2A 4MGRA 4P5OA 4ZYEA 3CUQB 4P9UA 5BMZA 4WK8F 4KN4X 1O7LA 1FLIA 1L0OC 2XUBA 4EV0A 2FF4A 2F5EA 1HW2A 1G3SA 3WG9A 2GAUA 4HF0A 1SFUA 4P9FA 4A5MA 1W5TA 4WX9A 2D45A 2L4MA 1REPC 4LB6B 3IKVA 3U9GA 1Z6TA 4HW0A 3QU3A 4EJVA 5A2QZ 3AAFA 2D1VA 2NRAC 3RYPA 4MEYF 1RZ4A 4OIOF 3IHUA 3G73A 4AIJA 3JW4A 1K79A 2QLZA 3CUQC 3DEUA 1DP7P 5L3EA 2M45A 1FP1D 4ENNA 5LLQA 5CVVA 3KP5A 1IXRC 3E6MA 3GLXA 1IUYA 1LDDA 3KP2A 3ISPA 2JTVA 2M87A 1G4DA 3KCCA 3SXYA 4I0BA 3G3ZA 3FXQA 4A2UA 1SFXA 1U78A 5LGUA 1BIAA 2VT2A 5BS6A 2D2WA 3KZYA 3TDUC 5KK1A 1WKMA 2HR3A 2FA5A 3PFIA 4YIIA 1YTYA 2HGCA 1GXQA 3KETA 2WWYA 3ZN0A 1HBXG 1I1SA 1S8NA 3VODA 4L9TA 3U2RA 2DK8A 4EVIA 2P5VA 4CO8A 3RKXA 3GFJA 3C3WA 4PGGA 1T6SA 5A2QK 2KKOA 3CUQA 1R1VA 2M1BA 5J6XA 2XHKA 1U5TC 2OA4A 2XASA 4IF4A 3GZ6A 4MTEA 4HQMA 2PMUA 2QUFA 1LDKB 4U7BA 5E20A 3V7SA 3VB2A 5LBQA 1KU7A 4EJTA 4OIPF 2IA2A 1SD5A 2A5YB 3IC7A 4A12A 5E18F 1CF7A 2X4HA 1RUNA 4KN7X 5DCFA 1IZ1A 2W85A 3O3KA 1EH6A 3IRRA 4GGGA 1ZH5A 3RKYA 1FSHA 3FM3A 4U88A 2QENA 2PFBA 2KJBA 3IWFA 1F9NA 5JHUA 2LF7A 2FMLA 3S2WA 3T5XA 2V1UA 4EM2A 4OIQF 5TJJA 3SZTA 2H09A 3Q9SA 2PN6A 3I64A 4OOIA 3J80Z 4WF2A 2E7XA 2HQNA 3WODF 2G9WA 5ILVA 1XSVA 4U0VA 3L7WA 2VE8A 5E1ZB 1UFMA 2DTRA 2K27A 5DD8A 3V4GA 2ZXJA 3CO6C 2UXXA 4ZZDA 3TKYA 3BJ6A 4HDUA 2IVMA 1R5GA 2H6BA 2ISZA 1MJ9A 3BJOA 3EETA 4HQEA 4I2OA 2XV4S 3TO7A 1CGPA 2EFQA 4U0WA 1UHWA 1TQIA 3P9KA 3HOSA 1FNNA 1R36A 1TTYA 5IT9K 1SMYF 5FD5A 1Z9CA 1BI1A 4LB5A 2G7UA 1D8KA 3K1MA 4U7DA 1FSEA 3M7GA 1H9GA 3I58A 2JPBA 2XAHA 2M8EA 3BOQA 3DKWA 3WTTC 3WGIA 2FRHA 2OAZA 5HS8A 1K6OA 2MLGA 3GXOA 3L9FA 4XSXF 4CGZA 1SFEA 2O0YA 1FYLA 2UZKA 3N97A 1SD6A 2V1DA 1FC3A 1S3JA 2EV5A 2J5PA 5ILSA 2QQAA 1J75A 5DCMB 5DD4A 1ZGAA 4FHTA 4KIBA 2QYOA 2COMA 4BHCA 5HLHA 3D0SA 4LLGF 1S7OA 3B02A 3R0AA 4XRFA 3RDIA 1H0MA 1J5YA 3WTSC 2BGCA 3E5UA 3KP7A 4BHPA 2ZNYA 1XSXA 1FYKA 2EFPA 5ERIA 1USSA 1W7PB 2P5LC 1KU2A 1B9MA 2RQPA 3LA2A 1U5TA 4NQWA 2F2EA 3ROUA 2Z33A 5LGTA 2HWVA 2NYXA 5HLIA 1H9TA 3R6SA 1ZHFA 5ICFA 2VBYA 3F8BA 5HDGA 4RGXA 1MD0A 2XIGA 2W25A 3B73A 3E6DA 1JGSA 2L4AA 1B6AA 3E3VA 1F4KA 1RI7A 1TNSA 4JQFA 1D3YA 1G3TA 2YX4A 4M9SA 4G6DA 4Q47A 5L3CA 2PJPA 1O3QA 4Q48A 4YFNF 4RB0A 4KICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E A;  1EV7 A;  4L9V A;  5JR3 A;  3SHF A;  1F1Z A;  3HSR A;  5HDN A;  3BPV A;  5TRD A;  2FNP A;  4I98 B;  2Y0M A;  1TLH B;  2NAZ A;  2K7L A;  1E2X A;  3CTA A;  3LST A;  3F6O A;  1KQ0 A;  1EH8 A;  1P4W A;  2QM3 A;  2LDU A;  3QPH A;  4YFK F;  1P4X A;  1W7P A;  4YFX F;  4M72 A;  3EYY A;  4WCG A;  5LHG A;  1RNL A;  3IKT A;  1D5V A;  1CF7 B;  3ZMD A;  2OZU A;  4KA4 A;  1ON1 A;  3F3X A;  1UHM A;  4A0Z A;  2K4J A;  1B59 A;  3GWZ A;  3I0T A;  3ABT A;  1O3R A;  3EUH A;  3KEQ A;  1MDM A;  2P4W A;  4E70 A;  3HRS A;  1PP8 F;  2YPR A;  3GEZ A;  3HRM A;  3RIR A;  1IRF A;  5AIP A;  4IRG A;  2EV0 A;  3GFI A;  1S6L A;  3SQN A;  1C0W A;  2V6C A;  3R60 A;  4Y17 A;  1HW1 A;  2DW4 A;  4AVP A;  1HKQ A;  2HS5 A;  2RKH A;  2V1X A;  2L3D A;  1NHA A;  4ASN A;  2XAG A;  2XKP A;  1XGS A;  3O6B B;  4M9X A;  1XDS A;  5DUI A;  2P5K A;  1FBS A;  1QZY A;  2VBZ A;  2EWN A;  2AS5 F;  3FX3 A;  5DEQ A;  4RGU A;  4IXA A;  2NNY A;  1XGM A;  1R1U A;  1S7A A;  3K2Z A;  4ESB A;  3BP8 A;  1PDN C;  3JAM Z;  4PCQ A;  2RV8 A;  5DUK A;  2GXB A;  2M30 A;  4MQ9 F;  4HZF A;  4UV9 A;  1IXC A;  1KQ8 A;  3OV8 A;  1MJA A;  2CGP A;  1MGT A;  3V8J A;  2D1H A;  1IN6 A;  3ZP5 A;  1P4A A;  1OYI A;  4GO1 A;  3IRQ A;  4A0Y A;  2Z99 A;  2GWR A;  2VOO A;  1FOK A;  4N0B A;  5HLG A;  3J80 K;  3WTW C;  5BPI A;  4OIR F;  1IN4 A;  1YLF A;  3LA3 A;  3H92 A;  3I71 A;  5CYV A;  1XMK A;  4FT8 A;  1ZRE A;  2QVO A;  5LRS A;  1LQ1 A;  2NNN A;  1OKR A;  3F8N A;  3ZMU A;  4OU0 A;  5JVT A;  1WRJ A;  3W6K B;  3CDH A;  4CZZ A;  2BEO A;  5HS7 A;  1O3S A;  1Z05 A;  2M5W A;  4ESF A;  4A5N A;  2IP2 A;  2HFH A;  3WU0 A;  2UWM A;  3K69 A;  2IA1 A;  1TQP A;  2Y75 A;  5J8F A;  1B1B A;  1I6X A;  4HOB A;  1RIO H;  2L02 A;  1HKS A;  3NRV A;  5ILU A;  3KLO A;  2FQ3 A;  5H6Q A;  1ULY A;  4MQV A;  3P9I A;  4RB2 C;  3M8F A;  3DF8 A;  4HA8 A;  2PG4 A;  2Y48 A;  2FE3 A;  4HX4 A;  3FMS A;  4MNU A;  4EMS A;  2OBP A;  3FF5 A;  2WC2 A;  1XGN A;  1FBQ A;  3ECH A;  3MWM A;  4BYY A;  4YIF A;  4S05 A;  3ZQ7 A;  1I27 A;  5FGM A;  4ON0 A;  3BY6 A;  2FBK A;  1Z7U A;  4B09 A;  5K5O A;  2Z9O A;  1GVJ A;  4RB3 C;  1ON2 A;  4HLX A;  4DQ2 A;  5L3F A;  3Q9V A;  2VE9 A;  2A61 A;  1R58 A;  2EA2 A;  3PQJ A;  1DPR A;  1T39 A;  3O2P E;  4IVN A;  3WGG A;  2MA3 A;  2PLY A;  2MH9 A;  5H6R A;  1WQ2 A;  2PEX A;  3WGH A;  4HV6 A;  1BI2 A;  3KEO A;  4CYD A;  3K0L A;  5CVU A;  1Y0U A;  4KMU X;  2PI0 A;  2F5C A;  2IPQ X;  1R00 A;  2E7W A;  4R79 A;  3EYI A;  1Z6R A;  3HOT A;  4N9H A;  2OZ6 A;  3LAP A;  3I54 A;  5F6F A;  1BN5 A;  2XRN A;  2CSO A;  2XRO A;  4ETS A;  1QO0 D;  2DK5 A;  1OYY A;  3JSP A;  4Y15 A;  1ZG5 A;  1O3T A;  2WTE A;  3GVA A;  2RGV A;  2XAJ A;  3COA C;  4LG0 B;  2V79 A;  3QU6 A;  2Z5U A;  1HW5 A;  2F5F A;  1BIB A;  2IRF G;  3LQR A;  2Q0O A;  1U3E M;  2ESH A;  1FZP B;  3TQN A;  3BRO A;  3TOA A;  1FPQ A;  3U1D A;  4LD5 A;  3H3Z A;  4AIH A;  1ZRC A;  4ZYH A;  4WXH A;  2QWW A;  3C1D A;  1RUO A;  3ECO A;  2RC4 A;  5D4R A;  3P9C A;  5E8I A;  2HDC A;  4HF1 A;  3DXJ F;  1YG2 A;  2PQ8 A;  3DPL C;  3F8C A;  3L09 A;  2DFI A;  3DFG A;  4G7O F;  4HX7 A;  3DP7 A;  1S29 A;  4RAZ A;  3M8E A;  2VT3 A;  1DUX C;  1U5T B;  5E1W A;  3TOB A;  1TW2 A;  2R3S A;  2CWE A;  3ABU A;  3E5X A;  3GO5 A;  3EQL F;  5D8K B;  3J81 Z;  2GA2 A;  3K9T A;  2HTS A;  5CVR A;  3FHZ A;  3IL2 A;  3ZMV A;  4PDK A;  5EEH A;  3FWE A;  2VOP A;  3NEU A;  1P92 A;  3E6C C;  3WTV C;  4UVA A;  1XD7 A;  1R22 A;  4XLN F;  4LK0 F;  1IXS B;  1FX7 A;  2QZ8 A;  1W5S A;  2B0L A;  1IAW A;  3F72 A;  2GA1 A;  1QNT A;  3DQV C;  4Q5S F;  2R7D A;  1G3Y A;  2GXG A;  3GF2 A;  1WI9 A;  4EM1 A;  3I59 A;  4QWQ A;  2FSW A;  3RI4 A;  4KNY A;  2ESN A;  4HBL A;  4XLP F;  3FXU A;  3CO7 C;  3KFW X;  4RB1 A;  1MKM A;  4PZJ A;  2O61 A;  4CDG A;  2KIF A;  4Z2Y A;  2ZJ2 A;  4BH9 A;  2FNA A;  1GXP A;  1J2X A;  1QGP A;  1LJ9 A;  2ACJ A;  2W24 A;  2CQK A;  2FOK A;  2MD5 A;  4MEX F;  1T0F A;  2BE5 F;  1FWZ A;  2DLL A;  4TV7 A;  2TDX A;  4WXD A;  4NB5 A;  4O6J A;  1J0R A;  2IJL A;  3R61 A;  4BHB A;  2YU3 A;  3LAJ A;  3F21 A;  1IN5 A;  4UHT A;  2XAF A;  3MZY A;  5CVJ A;  5D6E A;  1ZAR A;  1ZN2 A;  3DV8 A;  5FFX A;  5CLS A;  3W6J B;  4A6D A;  4WXC A;  2HKX A;  3MFK A;  2ZME B;  2HEO A;  2R7F A;  5ICC A;  5HVQ C;  2VN2 A;  2GIV A;  2IT0 A;  2VXZ A;  2XGX A;  3ULQ B;  1XDU A;  5LEK A;  2HQR A;  3T8R A;  1FBU A;  1WWX A;  2BBY A;  4ZH4 F;  3E6B A;  1TW3 A;  3RPQ A;  2HTJ A;  4O3M A;  2E1N A;  5D5X B;  3I4P A;  3J7A O;  1STZ A;  1MDM B;  3MAJ A;  1AOY A;  4H0E A;  4UVC A;  1KYW A;  4OMY A;  3K1P A;  2YSR A;  5FLX K;  2JSC A;  1YW9 A;  3QP6 A;  3J81 K;  3V7C A;  3RYR A;  3P7N A;  5D6F A;  4I09 A;  2OD5 A;  3BZ6 A;  4KT5 C;  4I0A A;  4L18 B;  2IW5 A;  1QBJ A;  1KGS A;  2JPC A;  5LRR A;  1E17 A;  2EA4 A;  2DPD A;  1KA8 A;  3TDZ C;  5IT9 Z;  2W57 A;  4GYI A;  2EV6 A;  3HTU A;  3QPT A;  4K2E A;  2O6G E;  1FY7 A;  4IRH A;  4HLY A;  2H94 A;  1U8R A;  3QRF F;  2O3F A;  5FO5 A;  2EFN A;  3JSO A;  4LG0 A;  1QZZ A;  2KRF A;  2ZO4 A;  3VEP A;  2ZME A;  2VBX A;  1HXD A;  3HYI A;  4O5V A;  3I53 A;  3EDP A;  1R5H A;  1YW8 A;  3RTR A;  3RPU A;  2DI3 A;  4P55 A;  4M6X A;  1HSJ A;  3GFM A;  1BC8 C;  2FBI A;  4ZYG A;  2ZNZ A;  4HYE A;  1MZB A;  2ZCW A;  1IF1 A;  3ZPL A;  3T1B A;  3ERE D;  2OQG A;  4B8X A;  5LHI A;  4ESJ A;  5D5W B;  4M74 A;  2ETH A;  2OU2 A;  3GFL A;  1ZLJ A;  1KU9 A;  2FU4 A;  1BI0 A;  5D8L B;  3JTH A;  4GCV A;  4LGW A;  1P6R A;  1TNT A;  5AON A;  1J7K A;  3LWF A;  2JZY A;  3TO9 A;  2EFO A;  4RAY A;  2DQL A;  1Z91 A;  4CIC A;  1JXS A;  3M9A A;  4G7Z F;  3SZP A;  3GYH X;  4ZZL A;  4EQQ A;  3BJA A;  1V3F A;  3R0J A;  3V7R A;  3QAH A;  4F7Z A;  2CYY A;  2QBY A;  2A69 F;  2YR2 A;  1J59 A;  2L01 A;  4I02 A;  1YYV A;  2A3S A;  1F5T A;  3CUO A;  4G8X A;  2E1C A;  3GW2 A;  3VOE A;  5ICE A;  4EJO A;  3MCZ A;  5D5V B;  4A6E A;  4RGR A;  3JAM K;  1ONV A;  4CHU A;  2JRT A;  3GZ5 A;  2VBW A;  4BNC A;  4M6Y A;  3KP3 A;  2JT1 A;  2W84 A;  3FMR A;  1R23 A;  4I7H A;  3R4K A;  2LKP A;  5J8C A;  2A07 F;  1K78 A;  4G94 A;  4IRI A;  5D5U B;  3GUD A;  3F6V A;  4BXU A;  1QQI A;  1G3W A;  4L0Y B;  1YFH A;  1OPC A;  5FB2 A;  4CXF A;  4AIK A;  3KZZ A;  5IT3 A;  2OQR A;  4ZYD A;  5D4S A;  2XKO A;  3OOP A;  3BDD A;  2C6Y A;  3F22 A;  1OMI A;  3MZH A;  4FX4 A;  1O57 A;  1JE8 A;  2ZKZ A;  4I01 A;  1LNW A;  1ZGJ A;  3LFK A;  3HSF A;  4UVB A;  1R7J A;  3C7J A;  3KP6 A;  1JHF A;  2UXN A;  1UB9 A;  1XGO A;  3BPX A;  1QPM A;  4ENK A;  5LEJ A;  2F5D A;  4DNC A;  1IRG A;  3PQK A;  3WE2 A;  2BYV E;  2QBY B;  3HIF A;  2HOE A;  4G9Y A;  4S04 A;  1A04 A;  4HDV A;  4KFC A;  3KE2 A;  3C18 A;  1WSU A;  2EJR A;  2HZT A;  5CJ9 A;  5ICG A;  1LDJ A;  3HRU A;  3ML6 A;  4IHT A;  2BV6 A;  1K78 B;  4LFU A;  3HRT A;  2P8T A;  4EGZ A;  1GHC A;  1X3U A;  2ZBK A;  1SMT A;  4M9Z A;  3I59 B;  4IJA A;  2O8X A;  1T38 A;  4L9N A;  1YW7 A;  3F23 A;  2VC0 A;  4G7H F;  1ZRF A;  5K5Q A;  1UST A;  3CLO A;  2VON A;  2RNJ A;  4ENM A;  1T2K A;  4GXO A;  4BAY A;  2FXA A;  1LEA A;  4EGY A;  4N9I A;  1LB2 A;  2KIM A;  1EH7 A;  4OIN F;  4MHG A;  3CJN A;  2KJC A;  1J9I A;  4R8H A;  4U0Y A;  2AXL A;  4HX8 A;  1ZG1 A;  1P2F A;  3F8F A;  2Z3Y A;  4XBF A;  2P7V B;  2MLK A;  1TBX A;  3ZMZ A;  1HST A;  4HAM A;  4JK1 X;  1BBY A;  1DDN A;  2FBH A;  2IA0 A;  2K02 A;  1YS7 A;  5BPD A;  4LK1 F;  1SD4 A;  5E1X A;  3IWZ A;  4KUM A;  5F1R A;  2LSO A;  1ZLK A;  3KP4 A;  2QQ9 A;  2VC1 A;  4M71 A;  1PUE E;  1B4A A;  2EFW A;  3FXR A;  2WV0 A;  5F64 A;  2K4B A;  3E5Q A;  4G6Q A;  4P96 A;  3TO6 A;  4HF2 A;  2HYG D;  1HKT A;  2KIU A;  2V9V A;  2STW A;  4EJW A;  4IHS A;  1UCR A;  5BOX A;  2H27 A;  4L0Z B;  2GQQ A;  5L3B A;  1G6N A;  1ZG3 A;  3MEX A;  4AD9 A;  5L3G A;  3T0Y A;  4LMY A;  4L9J A;  1I5Z A;  2Q8K A;  3T8T A;  1KYZ A;  1BJA A;  5HDK A;  3HUG A;  2DO7 A;  1SD7 A;  4MTD A;  3K1N A;  2L54 A;  4IPA A;  4Y13 A;  6PAX A;  4YG2 F;  1R1T A;  2ELH A;  2HYF A;  1IN8 A;  1I1G A;  2PBI A;  3GX4 X;  4EJU A;  2P6S A;  3HSE A;  2XVC A;  1YQA A;  4KIG A;  5CVI A;  3QP5 A;  1HQC A;  4LLN A;  3RKW A;  1BOA A;  5FD6 A;  4UV8 A;  3L00 A;  2YX7 A;  3WE3 A;  3SFZ A;  3WTU C;  1Z1D A;  2CG4 A;  3L2C A;  1XB4 A;  2K86 A;  2XAQ A;  4M73 A;  1V4R A;  4GYG A;  1L3L A;  5HS9 A;  2ZFW A;  1SAX A;  3BWG A;  5DYM A;  1AWC A;  3HHH A;  1Q1H A;  4HV5 A;  3Q5F A;  4Q4Z F;  5L3D A;  3V8L A;  4PGH A;  2A6E F;  1XSD A;  1FP2 A;  1T98 A;  2H6C A;  4UUV A;  4RGS A;  2MC3 A;  3DPT A;  4UXN A;  2P6T A;  4L5J A;  4JBA A;  1ZYR F;  1ODD A;  2A68 F;  3LQQ A;  1OR7 A;  5KVR A;  4KYW A;  2ADU A;  3D5L A;  1DPU A;  2NS0 A;  2HKO A;  1BM9 A;  5E8G A;  3NQO A;  2CO5 A;  3REO A;  3RJP A;  1MJB A;  2RVC A;  3WTX C;  2O03 A;  2EK5 A;  1U6G A;  5AIQ A;  2G7H A;  4WWC A;  4LJZ F;  2STT A;  1B9N A;  1BI3 A;  1ZRD A;  4BQA A;  5K5R A;  5DV5 A;  2GZW A;  2QQB A;  1KQ9 A;  4XSZ F;  3ZMT A;  4AWX B;  2DBB A;  3H3U A;  4FX0 A;  1FT9 A;  3VFZ A;  1IN7 A;  3WTZ A;  1JHH A;  3MQ0 A;  5HOO A;  3E97 A;  5DCM A;  1FYM A;  1ZAO A;  2J5O A;  5BQT A;  5FFZ A;  5LHH A;  2A6H F;  2P7C B;  1W4M A;  2CW0 F;  2DU9 A;  5JI6 A;  1U2W A;  2DAO A;  4KMF A;  1YS6 A;  3FMQ A;  5EEG A;  1LEB A;  2VOD A;  4R1H A;  3V8K A;  1W7P D;  4EM0 B;  3FM5 A;  3FZV A;  1K7A A;  1XCV A;  1YIO A;  2X0L A;  2RN7 A;  4OMZ A;  3KLN A;  1PP7 U;  2PMH A;  5H20 A;  4A0X A;  3WU1 B;  3HTS B;  3N4M A;  4RS8 A;  2RDP A;  3QOP A;  1O7F A;  1XN7 A;  3JTG A;  2DQR A;  5JFR A;  1BC7 C;  1IW7 F;  3F8M A;  1D8J A;  3WTY C;  1LVA A;  5LGN A;  5DDG A;  3LA7 A;  2LF8 A;  4LLL A;  1OYW A;  2EB7 A;  5ED4 A;  3I5U A;  3ZN1 A;  1TQM A;  3M1E A;  2FEZ A;  5FLX Z;  1YO5 C;  2CFX A;  3HHG A;  3ELK A;  2DT5 A;  4D0P A;  4L5I A;  2DPU A;  3ZMS A;  2FMY A;  1XMA A;  4QLC U;  3TGN A;  2MBF A;  5E17 F;  2ISY A;  4NHJ A;  4KIF A;  2LNB A;  4ENJ A;  5K1Y A;  1XCB A;  1KU3 A;  1VTN C;  4KDP A;  4UNO A;  2MH2 A;  4MGR A;  4P5O A;  4ZYE A;  3CUQ B;  4P9U A;  5BMZ A;  4WK8 F;  4KN4 X;  1O7L A;  1FLI A;  1L0O C;  2XUB A;  4EV0 A;  2FF4 A;  2F5E A;  1HW2 A;  1G3S A;  3WG9 A;  2GAU A;  4HF0 A;  1SFU A;  4P9F A;  4A5M A;  1W5T A;  4WX9 A;  2D45 A;  2L4M A;  1REP C;  4LB6 B;  3IKV A;  3U9G A;  1Z6T A;  4HW0 A;  3QU3 A;  4EJV A;  5A2Q Z;  3AAF A;  2D1V A;  2NRA C;  3RYP A;  4MEY F;  1RZ4 A;  4OIO F;  3IHU A;  3G73 A;  4AIJ A;  3JW4 A;  1K79 A;  2QLZ A;  3CUQ C;  3DEU A;  1DP7 P;  5L3E A;  2M45 A;  1FP1 D;  4ENN A;  5LLQ A;  5CVV A;  3KP5 A;  1IXR C;  3E6M A;  3GLX A;  1IUY A;  1LDD A;  3KP2 A;  3ISP A;  2JTV A;  2M87 A;  1G4D A;  3KCC A;  3SXY A;  4I0B A;  3G3Z A;  3FXQ A;  4A2U A;  1SFX A;  1U78 A;  5LGU A;  1BIA A;  2VT2 A;  5BS6 A;  2D2W A;  3KZY A;  3TDU C;  5KK1 A;  1WKM A;  2HR3 A;  2FA5 A;  3PFI A;  4YII A;  1YTY A;  2HGC A;  1GXQ A;  3KET A;  2WWY A;  3ZN0 A;  1HBX G;  1I1S A;  1S8N A;  3VOD A;  4L9T A;  3U2R A;  2DK8 A;  4EVI A;  2P5V A;  4CO8 A;  3RKX A;  3GFJ A;  3C3W A;  4PGG A;  1T6S A;  5A2Q K;  2KKO A;  3CUQ A;  1R1V A;  2M1B A;  5J6X A;  2XHK A;  1U5T C;  2OA4 A;  2XAS A;  4IF4 A;  3GZ6 A;  4MTE A;  4HQM A;  2PMU A;  2QUF A;  1LDK B;  4U7B A;  5E20 A;  3V7S A;  3VB2 A;  5LBQ A;  1KU7 A;  4EJT A;  4OIP F;  2IA2 A;  1SD5 A;  2A5Y B;  3IC7 A;  4A12 A;  5E18 F;  1CF7 A;  2X4H A;  1RUN A;  4KN7 X;  5DCF A;  1IZ1 A;  2W85 A;  3O3K A;  1EH6 A;  3IRR A;  4GGG A;  1ZH5 A;  3RKY A;  1FSH A;  3FM3 A;  4U88 A;  2QEN A;  2PFB A;  2KJB A;  3IWF A;  1F9N A;  5JHU A;  2LF7 A;  2FML A;  3S2W A;  3T5X A;  2V1U A;  4EM2 A;  4OIQ F;  5TJJ A;  3SZT A;  2H09 A;  3Q9S A;  2PN6 A;  3I64 A;  4OOI A;  3J80 Z;  4WF2 A;  2E7X A;  2HQN A;  3WOD F;  2G9W A;  5ILV A;  1XSV A;  4U0V A;  3L7W A;  2VE8 A;  5E1Z B;  1UFM A;  2DTR A;  2K27 A;  5DD8 A;  3V4G A;  2ZXJ A;  3CO6 C;  2UXX A;  4ZZD A;  3TKY A;  3BJ6 A;  4HDU A;  2IVM A;  1R5G A;  2H6B A;  2ISZ A;  1MJ9 A;  3BJO A;  3EET A;  4HQE A;  4I2O A;  2XV4 S;  3TO7 A;  1CGP A;  2EFQ A;  4U0W A;  1UHW A;  1TQI A;  3P9K A;  3HOS A;  1FNN A;  1R36 A;  1TTY A;  5IT9 K;  1SMY F;  5FD5 A;  1Z9C A;  1BI1 A;  4LB5 A;  2G7U A;  1D8K A;  3K1M A;  4U7D A;  1FSE A;  3M7G A;  1H9G A;  3I58 A;  2JPB A;  2XAH A;  2M8E A;  3BOQ A;  3DKW A;  3WTT C;  3WGI A;  2FRH A;  2OAZ A;  5HS8 A;  1K6O A;  2MLG A;  3GXO A;  3L9F A;  4XSX F;  4CGZ A;  1SFE A;  2O0Y A;  1FYL A;  2UZK A;  3N97 A;  1SD6 A;  2V1D A;  1FC3 A;  1S3J A;  2EV5 A;  2J5P A;  5ILS A;  2QQA A;  1J75 A;  5DCM B;  5DD4 A;  1ZGA A;  4FHT A;  4KIB A;  2QYO A;  2COM A;  4BHC A;  5HLH A;  3D0S A;  4LLG F;  1S7O A;  3B02 A;  3R0A A;  4XRF A;  3RDI A;  1H0M A;  1J5Y A;  3WTS C;  2BGC A;  3E5U A;  3KP7 A;  4BHP A;  2ZNY A;  1XSX A;  1FYK A;  2EFP A;  5ERI A;  1USS A;  1W7P B;  2P5L C;  1KU2 A;  1B9M A;  2RQP A;  3LA2 A;  1U5T A;  4NQW A;  2F2E A;  3ROU A;  2Z33 A;  5LGT A;  2HWV A;  2NYX A;  5HLI A;  1H9T A;  3R6S A;  1ZHF A;  5ICF A;  2VBY A;  3F8B A;  5HDG A;  4RGX A;  1MD0 A;  2XIG A;  2W25 A;  3B73 A;  3E6D A;  1JGS A;  2L4A A;  1B6A A;  3E3V A;  1F4K A;  1RI7 A;  1TNS A;  4JQF A;  1D3Y A;  1G3T A;  2YX4 A;  4M9S A;  4G6D A;  4Q47 A;  5L3C A;  2PJP A;  1O3Q A;  4Q48 A;  4YFN F;  4RB0 A;  4KIC A; 
#chains in the Genus database with same CATH topology
 3PIP F;  5F27 A;  2Q2E A;  1EV7 A;  2O7O A;  3BR6 A;  4L9V A;  5JR3 A;  2Y9Z A;  1F43 A;  4DZJ A;  4AYB N;  3SHF A;  1F1Z A;  3HSR A;  4IZZ A;  5HDN A;  1I3A A;  2Y0S N;  3BPV A;  5TRD A;  2KZG A;  2FNP A;  4I98 B;  3FXO A;  2Y0M A;  4B4C A;  1TLH B;  2NAZ A;  2K7L A;  2JA2 A;  1E2X A;  3CTA A;  3LST A;  3F6O A;  4BDY A;  2E2H J;  3CCQ I;  1KQ0 A;  1EH8 A;  2LY9 A;  1P4W A;  2QM3 A;  2LDU A;  1X4O A;  2E1M B;  3QPH A;  2W00 A;  4YFK F;  1P4X A;  1W7P A;  1GV5 A;  4YFX F;  1LFP A;  4M72 A;  3EYY A;  2JA5 J;  2V1N A;  4WCG A;  5LHG A;  1RNL A;  3HM5 A;  2DA2 A;  3IKT A;  4XMY A;  1D1A A;  3ZQH A;  1T08 B;  1H89 C;  1D5V A;  1CF7 B;  2H8R A;  3ZMD A;  2XGE A;  2OZU A;  4HNT A;  4KA4 A;  4LOC A;  1ON1 A;  3GCM A;  3F3X A;  3O8H A;  1JJ6 C;  1UHM A;  2K3P A;  4A0Z A;  2K4J A;  1FTT A;  1B59 A;  3GWZ A;  3I0T A;  3ABT A;  5E3O A;  3HZJ A;  1O3R A;  3EUH A;  3KEQ A;  1OIS A;  5J4Y A;  1MDM A;  5J1Y A;  2BXY A;  2P4W A;  5KCM A;  1WJD A;  2DXI A;  5HOD A;  4E70 A;  3HRS A;  1PP8 F;  3D5S C;  2M7A A;  2YPR A;  3GEZ A;  3HG9 A;  5HNF A;  1EA3 A;  2HQA A;  1R6R A;  3HRM A;  4J00 A;  3RIR A;  1IRF A;  5J40 A;  5AIP A;  2E35 A;  4IRG A;  4BUP A;  1Q1V A;  2EV0 A;  3GFI A;  1S6L A;  3Q0W A;  3SQN A;  1C0W A;  2V6C A;  3R60 A;  1MBJ A;  4Y17 A;  4CCL A;  1HW1 A;  2DW4 A;  4AVP A;  1HKQ A;  2HS5 A;  2RKH A;  2V1X A;  1YRN B;  2L3D A;  1NHA A;  2MSY A;  2M8G X;  4ASN A;  2XAG A;  1MNE A;  2XKP A;  4X6A J;  1XGS A;  2HPI A;  3O6B B;  4HPQ A;  5EYR A;  4M9X A;  1XDS A;  5DUI A;  2P5K A;  2MD0 A;  1IO2 A;  3BG3 A;  4G6T B;  2DYS H;  1B8I B;  3LSM A;  3JRA A;  1FBS A;  2V26 A;  1QZY A;  1DQU A;  4MFD A;  1ORK A;  2EIK H;  1MBG A;  3SDB A;  4IQJ A;  2VBZ A;  2EWN A;  2AS5 F;  2EZH A;  2KP6 A;  3FX3 A;  5DEQ A;  3CLQ A;  4RGU A;  4IXA A;  3PM1 A;  2NNY A;  1XGM A;  2VKE A;  1R1U A;  1S7A A;  3K2Z A;  4ESB A;  3A1Y A;  3BP8 A;  2JUC A;  3A0B C;  3V42 A;  1PDN C;  2ME0 A;  4PCQ A;  3JAM Z;  3L2W A;  5EEA A;  4W97 A;  2F48 A;  3S2D J;  2RV8 A;  5DUK A;  3IH3 A;  2BW3 A;  2BY3 A;  3WG7 H;  2AXT C;  3FXL A;  2GXB A;  1D0Z A;  3H5R A;  2M30 A;  4MQ9 F;  4HZF A;  4UV9 A;  4Y33 A;  1IXC A;  2R5Y B;  3OV8 A;  1KQ8 A;  4C30 A;  1WJ5 A;  1IV6 A;  1MJA A;  2QGU A;  1MGT A;  1E3P A;  3V8J A;  2CGP A;  4NC8 A;  4V2G A;  1FMV A;  1S9H A;  2D1H A;  2HOA A;  2KZV A;  1IN6 A;  5EZG A;  2R5Y A;  1SC7 A;  3ZP5 A;  1P4A A;  1OYI A;  4GO1 A;  3IRQ A;  4A0Y A;  3DLA A;  2Z99 A;  3OOU A;  2HDW A;  2GWR A;  2VOO A;  3TBI A;  1BR1 A;  5FKL A;  1FOK A;  2AHQ A;  4N0B A;  5HLG A;  2KRC A;  3J80 K;  4FAS D;  2K3F A;  5FRO A;  3WTW C;  2E1O A;  5BPI A;  2VKV A;  1IN4 A;  1YLF A;  4OIR F;  3LA3 A;  3H92 A;  2DA7 A;  3FIW A;  1EKE A;  4IEJ A;  4JYK A;  3I71 A;  4BY1 J;  5CYV A;  1XMK A;  2G0E A;  3FXK A;  4FT8 A;  1ZRE A;  2K40 A;  2R7Z J;  3FHN A;  2QVO A;  5LRS A;  1LQ1 A;  2NNN A;  1YOV B;  2XGC A;  1OKR A;  2XAU A;  3F8N A;  3Q3S A;  5IP6 A;  3ZMU A;  4OU0 A;  5JVT A;  1WRJ A;  5M3M J;  3W6K B;  3CDH A;  4Y3O A;  4CZZ A;  2BEO A;  3L2U A;  5HS7 A;  3PNY A;  1K83 J;  2BVM A;  1O3S A;  4C2M J;  3GTK J;  1Z05 A;  3WHC A;  4B48 A;  1Z7L A;  4J01 A;  2M5W A;  4ESF A;  1LE8 B;  1ITY A;  4A5N A;  1MW7 A;  3AKZ A;  2IP2 A;  4AVZ A;  2AQF A;  2HFH A;  3WU0 A;  2H1K A;  3SDG A;  3K69 A;  4HRI A;  2UWM A;  4CYC B;  2IA1 A;  2R92 J;  2CUF A;  1PVE A;  3HKZ N;  1TQP A;  2DCE A;  2Y75 A;  5J8F A;  4CCM A;  1B1B A;  2AO9 A;  3OIO A;  1I6X A;  3BCA A;  4HOB A;  1RIO H;  3A03 A;  2L02 A;  1HKS A;  3NRV A;  4XLC A;  5ILU A;  4IO9 F;  3KLO A;  3GTG J;  3OYH A;  3VSK A;  2FQ3 A;  2HXO A;  5GTH C;  1DU6 A;  2RRE A;  1MMA A;  2B7E A;  5H6Q A;  5GAG J;  1ULY A;  4MQV A;  3P9I A;  3M8F A;  2OC6 A;  4RB2 C;  3DF8 A;  4HA8 A;  2PG4 A;  3TED A;  4AM3 A;  4FQG A;  2IS1 A;  4E7L A;  2Y48 A;  3CD6 I;  2FE3 A;  4HX4 A;  3OYK A;  3FMS A;  4MNU A;  4EMS A;  1JKQ C;  1APL C;  2OBP A;  4CZC A;  2L9R A;  3FF5 A;  4DBQ A;  4DIQ A;  3L2Q A;  3UR3 C;  1RPW A;  2WC2 A;  1XGN A;  1FBQ A;  3ECH A;  2XC7 A;  2ELJ A;  3MWM A;  3LSP A;  2IXS A;  3ZQF A;  2EH3 A;  4BYY A;  2Z16 A;  2KPM A;  4YIF A;  4S05 A;  1B72 B;  3ZQ7 A;  2E36 A;  1I27 A;  3S1Q J;  1FOY A;  4ZTF A;  4BQO A;  1K6Y A;  3BLY A;  2JK3 A;  1QHG A;  5FGM A;  3CQZ J;  4ON0 A;  2PJR A;  2RAE A;  3BY6 A;  2HPM A;  1SAU A;  2FBK A;  1XMX A;  1Z7U A;  4B09 A;  5K5O A;  3G4S I;  4BDZ A;  2MW8 A;  1RKT A;  2P0W A;  2DA6 A;  2Z9O A;  1GVJ A;  4AU7 A;  4RB3 C;  2GBY A;  1ON2 A;  4HLX A;  4DQ2 A;  4BXX J;  1BW6 A;  2VPR A;  1FEX A;  5L3F A;  2V6E A;  1I39 A;  4RMN A;  1U8B A;  2K5C A;  2X6X A;  2X51 A;  2NVU B;  4XRM A;  3Q9V A;  2VE9 A;  2A61 A;  1R58 A;  4EAT A;  2EA2 A;  3F0C A;  3PQJ A;  1DPR A;  2M7B A;  3BR2 A;  4IL6 C;  1T39 A;  3O2P E;  4IVN A;  4XLA A;  3WGG A;  2R5Z B;  1IJW C;  2MA3 A;  2PLY A;  3CMY A;  2MH9 A;  5H6R A;  1WQ2 A;  2PEX A;  3DTE A;  2DA1 A;  3WGH A;  1T56 A;  3D1N I;  5M5X J;  3PNT A;  1WGX A;  4HV6 A;  4LIV A;  4ANJ A;  1BI2 A;  2LP0 A;  3KEO A;  3S16 J;  4CYD A;  3K0L A;  4F93 B;  3FBI B;  1Y0U A;  4KMU X;  5CVU A;  4CCK A;  1AU7 A;  2PI0 A;  4Z6Y A;  2F5C A;  4A3C J;  4NBQ A;  2IPQ X;  1R00 A;  2E7W A;  4R79 A;  2GM4 A;  3EYI A;  1Z6R A;  2XF6 A;  3HOT A;  4N9H A;  1UZC A;  2OZ6 A;  3LAP A;  3I54 A;  5F6F A;  4BJT A;  4EEF G;  1BN5 A;  3AG1 H;  2XRN A;  2X85 A;  2MC4 A;  3J7A Y;  2CSO A;  1Y56 A;  2XRO A;  4ETS A;  1QO0 D;  2DK5 A;  3HPH A;  3QOE A;  1JUS A;  3S93 A;  1OYY A;  3JSP A;  2QSF X;  4XR6 A;  4Y15 A;  1ZG5 A;  1O3T A;  2OCC H;  4XN3 A;  1I3Q J;  2WTE A;  1JKP C;  3GVA A;  3X2Q H;  1VQN I;  3EUK L;  2RGV A;  1MBE A;  3OS1 A;  2IS2 A;  4M3B A;  2XF7 A;  3JRI A;  3HJE A;  2XAJ A;  2CFO A;  2ICW G;  3COA C;  2IEK A;  2V79 A;  3S32 A;  3QU6 A;  4LG0 B;  2Z5U A;  1HW5 A;  1Z3X A;  2F5F A;  1BIB A;  2IRF G;  4IOC F;  3LQR A;  1VQ8 I;  2Q0O A;  1U3E M;  3MKY B;  2ZJP F;  1OCO H;  1QVT A;  2ESH A;  1XPX A;  2Y0S A;  1X4P A;  1FZP B;  3TQN A;  1ACI A;  3BRO A;  2V9K A;  3TOA A;  2D5V A;  1FPQ A;  4C9Y A;  2IGO A;  3U1D A;  4LD5 A;  2WBM A;  3H3Z A;  3IAM 2;  4Y7N J;  3S3O A;  1HA8 A;  4AIH A;  3FK6 A;  4A93 J;  5GAE J;  3CZ6 A;  3JRB A;  1ZRC A;  4E7K A;  3CC7 I;  1Z67 A;  4ZYH A;  1MMN A;  3OYL A;  4WXH A;  2X1D A;  2QWW A;  3C1D A;  5HNH A;  1RUO A;  3ECO A;  2X9D A;  4II2 A;  2RC4 A;  1OCC H;  2Y69 H;  3QYF A;  5D4R A;  5EG0 A;  3P9C A;  2QA4 I;  5E8I A;  1B72 A;  2OTJ I;  2HDC A;  1X2N A;  1Y1W J;  4HF1 A;  3DXJ F;  4BJ6 C;  1YG2 A;  2PQ8 A;  3DPL C;  3F8C A;  3L09 A;  5FKK A;  2DFI A;  4A69 C;  3DFG A;  1ZR4 A;  4G7O F;  4HX7 A;  4D5C A;  4YIR X;  3DP7 A;  1S29 A;  4KJZ A;  4RAZ A;  1Y8R B;  3M8E A;  5B1A H;  2VT3 A;  1DUX C;  2XPU A;  1U5T B;  5IOZ A;  5E1W A;  3TOB A;  3GTP J;  1TW2 A;  2R3S A;  2L7M P;  2CWE A;  4C3J J;  3ABU A;  3E5X A;  3GO5 A;  4F3Q A;  3OSG A;  3EQL F;  3GTJ J;  3EPZ A;  5D8K B;  3J81 Z;  2GA2 A;  1U9O A;  3K9T A;  3NAU A;  2HTS A;  3HBL A;  5CVR A;  3FHZ A;  2F5V A;  1AKH B;  3IL2 A;  3ZMV A;  2IS6 A;  3JR9 A;  2OPT A;  3H9J A;  5B66 C;  3BTI A;  5M5W J;  4PDK A;  5EEH A;  3J7Y J;  4HST A;  3TP3 A;  1MBK A;  3FWE A;  2LY2 A;  2KLO A;  2VOP A;  3M1C A;  2BVL A;  4B3X A;  3NEU A;  1P92 A;  3E6C C;  3DBL B;  2RNG A;  2E34 A;  3BTJ A;  3DKX A;  3WTV C;  4XLH A;  4UVA A;  1XD7 A;  1R22 A;  4XLN F;  3GTM J;  4LK0 F;  3ZR8 X;  1IXS B;  3SFI A;  1FX7 A;  2QZ8 A;  1W5S A;  2B0L A;  3ZOB A;  1IAW A;  1OQY A;  3F72 A;  2JA8 J;  2GA1 A;  2DYR H;  1QNT A;  3DQV C;  2LVS A;  4Q5S F;  2CUJ A;  3BZC A;  2R7Q A;  2R7D A;  3JRF A;  1X1C A;  1G3Y A;  2GXG A;  3GF2 A;  5F0F A;  1WI9 A;  1T95 A;  3HOU J;  3CJT B;  1OCZ H;  4EM1 A;  3I59 A;  4JX6 A;  4QWQ A;  3HDD A;  2EIM H;  5TGT A;  3HL2 A;  5FKM A;  2FSW A;  3RI4 A;  2LFB A;  1FOW A;  1VQL I;  4KNY A;  3CCR I;  3BR5 A;  3QWL A;  2ESN A;  3P5J A;  5CQG A;  3I4M J;  1LFU P;  1DU0 A;  1WJE A;  2MYS A;  4HBL A;  1BOB A;  2CS3 A;  4XLP F;  3FXU A;  3CO7 C;  3KFW X;  4B1R A;  5IYC J;  4RB1 A;  1MKM A;  4PZJ A;  4E7I A;  1S5L C;  2DDB A;  2O61 A;  4N4N B;  4BE0 A;  5CQE A;  3RPU D;  4CDG A;  2KIF A;  3RQI A;  2O8K A;  4Z2Y A;  5FLM J;  2ZJ2 A;  3K4C A;  4BH9 A;  3MD2 A;  2K9M A;  1IV8 A;  2FNA A;  1GXP A;  3RKQ A;  1RR8 C;  1J2X A;  3ABK H;  5GAD J;  2KQR A;  1QGP A;  2MAB A;  1LJ9 A;  1DP3 A;  1PUF A;  2ACJ A;  1JT0 A;  2W24 A;  1TWA J;  2CQK A;  2FOK A;  3DKY A;  2MD5 A;  2JQ7 A;  4MEX F;  1T0F A;  1IDY A;  2BE5 F;  2NVY J;  2ZJQ F;  1NK2 P;  3CME I;  3DBR B;  4PK4 A;  1FWZ A;  2CQN A;  2DLL A;  4TV7 A;  3JCU C;  2TDX A;  3GTO J;  4XRS G;  4WXD A;  1R4M B;  3LFU A;  4NB5 A;  3PL8 A;  2DMQ A;  2BZT A;  2Q2E B;  4BBR J;  4O6J A;  1J0R A;  2IJL A;  1JUP A;  4X0G A;  1D0Y A;  4PJ0 C;  3R61 A;  2M34 A;  1ETX A;  3UKG A;  4BHB A;  2YU3 A;  3LAJ A;  2ZJR F;  5KHD A;  3F21 A;  3AL0 B;  1IN5 A;  4A3M J;  4UHT A;  2XAF A;  2CQ7 A;  3MZY A;  5CVJ A;  5D6E A;  3QPS A;  1ENH A;  1ZAR A;  1ZN2 A;  2XDV A;  1JTY A;  3DEE A;  3DV8 A;  3PUB A;  3BTC A;  5FFX A;  5CLS A;  3W6J B;  4A6D A;  4E4H A;  4ZDP A;  4WXC A;  5FRN A;  3A01 B;  4LIT A;  2HKX A;  3MFK A;  2ZME B;  3LOC A;  2HEO A;  1YHQ I;  2R7F A;  5F0C A;  5ICC A;  5HVQ C;  2VN2 A;  4BE1 A;  1NG6 A;  2GIV A;  4CA0 A;  5JHF A;  2IT0 A;  1OJL A;  2VXZ A;  3BTL A;  2OTL I;  2XGX A;  1K4S A;  5LD2 C;  3ULQ B;  2H8W A;  5DM7 F;  1XDU A;  2DJI A;  3W2V A;  5LEK A;  1T8I A;  2HQR A;  3S17 J;  2OJE D;  3T8R A;  2H1L A;  2ID3 A;  1FBU A;  1WWX A;  4V2F A;  2VB6 A;  2BBY A;  3LSG A;  1Y6I A;  4ZH4 F;  3E6B A;  1TW3 A;  3CMA I;  2P81 A;  1D0X A;  3RPQ A;  1YJN I;  4KIT B;  2Q1Z B;  2ZXI A;  2HTJ A;  4O3M A;  4UUT A;  4BL0 B;  2E1N A;  5D5X B;  3I4P A;  3J7A O;  3LSH A;  1STZ A;  1MDM B;  1MNM C;  3MAJ A;  4CSW A;  3PJR A;  1AOY A;  4XN0 A;  4H0E A;  1PUF B;  1RRJ A;  2GOX B;  4UVC A;  1KYW A;  4OMY A;  3K1P A;  2YSR A;  5FLX K;  4HNU A;  2CUE A;  2L7F P;  4C3H J;  1S7E A;  2BY1 A;  3BR3 A;  2JSC A;  3PSI A;  2LLK A;  4I6Z A;  1YW9 A;  2B9S A;  3QP6 A;  3J81 K;  2EPF A;  1FMW A;  2K9Q A;  3V7C A;  2W4S A;  1YJ9 I;  1SFO J;  4IHV A;  3RYR A;  3CCV I;  2R5Z A;  3P7N A;  5D6F A;  4I09 A;  1YRN A;  2JN6 A;  2OD5 A;  3BZ6 A;  3HXL A;  4KT5 C;  1VQM I;  1H88 C;  2BY2 A;  2WAE A;  4I0A A;  2NOG A;  3W2W A;  4L18 B;  2Z2S B;  2IW5 A;  1QBJ A;  2W7N A;  1KGS A;  3I56 I;  1UG2 A;  1VFC A;  3F9K A;  2JPC A;  5LRR A;  1E17 A;  2EA4 A;  5FKO A;  2DPD A;  1KA8 A;  1M1E B;  3IV5 A;  2PX9 A;  3OMY A;  4GFB A;  3TDZ C;  5IT9 Z;  2W57 A;  4XL9 A;  4GYI A;  3ZQI A;  2EQR A;  1DGR M;  2EV6 A;  2GOM A;  5FRM A;  3HTU A;  3QPT A;  2E2I J;  4K2E A;  3OSF A;  2IGM A;  1FY7 A;  1E3O C;  2O6G E;  4IRH A;  1MMG A;  4HLY A;  2H94 A;  1U8R A;  1YE9 A;  3QRF F;  4A3J J;  2ZXH A;  2O3F A;  5FO5 A;  2EFN A;  1E0E A;  5K7Z A;  4PJL A;  3JSO A;  5JLX A;  1LE8 A;  4LG0 A;  1QZZ A;  1UJ8 A;  2KRF A;  3K4L A;  4FET A;  2ZO4 A;  3A01 A;  3VEP A;  2ZME A;  3I55 I;  2CV0 A;  1X1P A;  2VBX A;  1HXD A;  1X1B A;  2CW7 A;  3OS2 A;  4XOT A;  3HYI A;  4O5V A;  3I53 A;  3EDP A;  3JRE A;  1R5H A;  2DA5 A;  2HI3 A;  1YW8 A;  3RTR A;  3RPU A;  1EJ9 A;  3PSF A;  2DI3 A;  4P55 A;  4M6X A;  1HSJ A;  3GFM A;  1BC8 C;  2FBI A;  4ZYG A;  3KYL A;  2PJR B;  2ZNZ A;  1YIJ I;  4HYE A;  1MZB A;  2ZCW A;  1IF1 A;  1X1A A;  3ZPL A;  3T1B A;  3ERE D;  2CQQ A;  1A5J A;  2OQG A;  4B8X A;  5LHI A;  4ESJ A;  5D5W B;  4M74 A;  2ETH A;  2JSP A;  1WI3 A;  2OU2 A;  3GFL A;  3GTQ J;  3CCJ I;  3PIO F;  1LKX A;  1ZLJ A;  3PFY A;  1KU9 A;  2FU4 A;  4CCJ A;  1BI0 A;  3G1M A;  5D8L B;  2K9L A;  3JTH A;  4GCV A;  4LGW A;  4JP0 A;  4BKX A;  1ERD A;  2DFF A;  1P6R A;  3DTI A;  2DMN A;  1W1W E;  2R7X A;  3LMM A;  1TNT A;  1VF9 A;  1W36 D;  1ETV A;  2FOW A;  4BGD A;  5AON A;  5J4V A;  4IOA F;  3KYC B;  4XNF A;  1J7K A;  3LWF A;  2JZY A;  3TO9 A;  3MVP A;  3ZQQ A;  5B1B H;  4AYB A;  1IRZ A;  4FE4 A;  4BEH A;  1A6I A;  2EFO A;  4RAY A;  4C3I J;  1AHD P;  2DQL A;  4RLQ A;  1TWH J;  1Z91 A;  4CIC A;  1JXS A;  3S3M A;  1WJB A;  3GLL A;  3M9A A;  4G7Z F;  2LY1 A;  1ZEL A;  4E7Z A;  3SZP A;  3GYH X;  4ZZL A;  4XON A;  1VQ4 I;  4PJM A;  1H8A C;  4EQQ A;  3K4J A;  2X1E A;  3BJA A;  2DA4 A;  3NAR A;  1V55 H;  1V3F A;  3R0J A;  3V7R A;  3ZXS A;  2ZSH B;  3QAH A;  4F7Z A;  2CYY A;  1QPI A;  4PFP A;  2A69 F;  2YR2 A;  1J59 A;  2QBY A;  2L01 A;  4I02 A;  1YYV A;  1QA6 A;  2WY8 Q;  2A3S A;  1OCT C;  1F5T A;  2IBD A;  4S0H B;  3CUO A;  1RC9 A;  2WAD A;  4G8X A;  2E1C A;  3GW2 A;  1XC5 A;  4HNV A;  2ZB9 A;  3VOE A;  5ICE A;  4BS9 A;  4A3D J;  2Y30 A;  4DOZ A;  4XLF A;  4HEA 2;  4ZDL A;  5FKN A;  2L7K A;  5GP9 A;  3RCO A;  4EJO A;  3OYI A;  4E7H A;  2XSD C;  3MCZ A;  2L2O A;  5D5V B;  2XGD A;  3RZD J;  4A6E A;  5BNG A;  1N75 A;  4RGR A;  3JAM K;  4BXF A;  3ZQL A;  2PMZ N;  1ONV A;  4CHU A;  2WY7 Q;  4PFO A;  2JRT A;  3OYN A;  3GZ5 A;  4XRS A;  2W48 A;  2W1O A;  1FJL A;  2VBW A;  2A6T A;  5E3N A;  2KFD A;  1W0U A;  4M6Y A;  4BNC A;  1HCR A;  2X6W A;  3KP3 A;  2JT1 A;  2VI6 A;  2W84 A;  3FMR A;  3W6V A;  1R23 A;  5EF6 A;  3KIO A;  3H36 A;  4I7H A;  3MKL A;  3OYM A;  2L9V A;  4J19 A;  3R4K A;  2LKP A;  5J8C A;  2A07 F;  1I50 J;  1K78 A;  4G94 A;  4FE7 A;  4IRI A;  1VQ6 I;  1U9N A;  5H2F C;  2K85 A;  3H9Q A;  5E79 C;  5D5U B;  3GUD A;  3KX2 A;  4M3G A;  3F6V A;  4FTH A;  4ZYA A;  2CUZ A;  4BXU A;  2L0K A;  2BOL A;  2HOT A;  1QQI A;  1G3W A;  1JKR C;  4XKB A;  4L0Y B;  2R7T A;  5M3F J;  2M0M A;  1YFH A;  2F4M B;  1AKH A;  1ETK A;  1IUF A;  3QYE A;  1OPC A;  4IX7 A;  5FB2 A;  4XM3 A;  4X1E A;  2NS7 A;  4CXF A;  4AIK A;  3KZZ A;  5IT3 A;  4U87 A;  2OQR A;  4ZYD A;  5D4S A;  2XKO A;  3BQZ A;  3OOP A;  4UUS A;  2R7W A;  2WAQ N;  3BDD A;  4NQW B;  2C6Y A;  3F22 A;  1OMI A;  4M3E A;  4F55 A;  3MZH A;  4FX4 A;  1FIP A;  3K4M A;  1O57 A;  1SEU A;  1JE8 A;  3S1N J;  1BA5 A;  2ZKZ A;  4I01 A;  1LNW A;  1R71 A;  1ZGJ A;  2FUG 2;  2OV7 A;  3LFK A;  3HSF A;  2DOA A;  4UVB A;  5IP7 J;  2HVS A;  1R7J A;  3C7J A;  3KP6 A;  1JHF A;  2UXN A;  5B3S H;  5J47 A;  3MN2 A;  2HOS A;  1ZTR A;  4NDL A;  4BE2 A;  3GZN B;  4M3F A;  3S14 J;  1UB9 A;  1XGO A;  3BPX A;  1QPM A;  4ENK A;  5LEJ A;  2F5D A;  4DNC A;  1IRG A;  4RLF A;  1NTC A;  3PQK A;  3WE2 A;  2BYV E;  2QBY B;  5C4J J;  2HZD A;  2HOE A;  3HIF A;  1T33 A;  4G9Y A;  4ABZ A;  1A04 A;  4S04 A;  4HDV A;  3KE2 A;  4KFC A;  4E7J A;  3BG9 A;  4IHW A;  3C18 A;  1WSU A;  2EJR A;  2HZT A;  5CJ9 A;  5ICG A;  5FJ8 J;  1LDJ A;  3BQY A;  3HRU A;  5JLW A;  3ML6 A;  2XPV A;  4B44 A;  2BV6 A;  4IHT A;  4A3L J;  1K78 B;  1PJR A;  1OCR H;  4LFU A;  3HRT A;  3H5A A;  9ANT A;  1TP4 A;  4AC0 A;  3CCL I;  1ZR2 A;  2E71 A;  2P8T A;  3H0D A;  4EGZ A;  1GHC A;  2QCO A;  1X3U A;  2ZBK A;  4XID A;  2VQG A;  3LNQ A;  1SMT A;  3ABM H;  4M9Z A;  3I59 B;  2BHZ A;  2DT6 A;  4IJA A;  2OF7 A;  4D7M A;  2O8X A;  1T38 A;  4OAZ A;  4L9N A;  3A4C A;  1YW7 A;  3LSJ A;  3F23 A;  5F0H A;  5EJC A;  2VC0 A;  4G7H F;  1ZRF A;  2JUG A;  2HU9 A;  5K5Q A;  1UST A;  4C2U A;  4ZC3 A;  1X3W B;  1VQ5 I;  3CLO A;  1R4N B;  4DYQ A;  2VON A;  2RNJ A;  4ENM A;  1T2K A;  4GXO A;  3A02 A;  3MKW B;  2DOD A;  4KIS A;  5J3L A;  4BAY A;  1X3Z B;  1MSE C;  5GPC A;  2FXA A;  1LEA A;  2KT0 A;  4EGY A;  1BJZ A;  1Z3Y A;  4KT6 A;  4N9I A;  1LB2 A;  2KIM A;  1EH7 A;  1R5I D;  4OIN F;  4MHG A;  3RSN A;  2CJJ A;  3L1P A;  3CJN A;  4IHX A;  2KJC A;  3CC2 I;  1J9I A;  4R8H A;  4U0Y A;  2LC2 A;  2AXL A;  2EIL H;  2DOF A;  3O8G A;  4HX8 A;  1ZG1 A;  1P2F A;  3FXM A;  3F8F A;  2E1M C;  2Z3Y A;  1I6H J;  2KMU A;  2EIN H;  1QRY A;  4XBF A;  4CH7 A;  3PUF A;  2FQ4 A;  3VWB A;  2P7V B;  2MLK A;  1TBX A;  3ZMZ A;  2OUM A;  1HST A;  4HAM A;  3CP8 A;  1WPK A;  1KON A;  1EF4 A;  4JK1 X;  5C3E J;  1BBY A;  1DDN A;  3OYE A;  3DU5 A;  1PYV A;  4M3D A;  5EDN A;  2W82 A;  2L9N A;  4QPQ A;  2FBH A;  2R7V A;  2IA0 A;  2K02 A;  2VJI A;  1YS7 A;  5BPD A;  4B3A A;  1HDP A;  3IH2 A;  4LK1 F;  1SD4 A;  3FXJ A;  4D5F A;  5E1X A;  1JTX A;  3AG3 H;  4LIU A;  3PO3 J;  2ME6 A;  3IWZ A;  4KUM A;  2K9N A;  4BQQ A;  5F1R A;  2LSO A;  1ZLK A;  3KP4 A;  2QQ9 A;  2VC1 A;  4XOR A;  4A3G J;  4M71 A;  1PUE E;  1B4A A;  2ZSI B;  2DA3 A;  3W2A A;  2DOE A;  2EFW A;  3FXR A;  2WV0 A;  1YJW I;  2YU9 J;  5F64 A;  2K4B A;  3E5Q A;  3TL4 X;  3EUH C;  4G6Q A;  4P96 A;  3TO6 A;  4HF2 A;  2HYG D;  1HKT A;  1IDZ A;  4A3I J;  3OS0 A;  2KIU A;  4MO7 A;  2V9V A;  2STW A;  2DMU A;  4EJW A;  4IHS A;  1UCR A;  5BOX A;  2H27 A;  1YIT I;  3QYB A;  4L0Z B;  1TWF J;  2GQQ A;  5L3B A;  4ZDO A;  1G6N A;  1ZG3 A;  3MEX A;  1VQO I;  1N77 A;  1JJ8 C;  4AD9 A;  1OFC X;  2IGK A;  5L3G A;  2GLO A;  1WHU A;  3T0Y A;  4LMY A;  3OYA A;  4L9J A;  4XQF A;  5LFA A;  2XB5 A;  1K4T A;  1I5Z A;  1W36 C;  2TRT A;  3HEF A;  3CJQ B;  4CCO A;  2Q8K A;  2M4G A;  3M07 A;  3T8T A;  1MND A;  1KYZ A;  1BJA A;  1NH3 A;  2JA6 J;  5HDK A;  3HUG A;  2DO7 A;  1SD7 A;  4MTD A;  3K1N A;  2L54 A;  2E60 A;  4IPA A;  4Y13 A;  3LSK A;  6PAX A;  4YG2 F;  3NWS A;  1R1T A;  2ELH A;  2HYF A;  1K61 A;  1IN8 A;  1I1G A;  2PBI A;  2M4K A;  3AG4 H;  4F91 B;  3GX4 X;  3PNV A;  4EJU A;  2I5U A;  2P6S A;  3HSE A;  4ITV A;  2L5Q A;  2XVC A;  1YQA A;  4KIG A;  5CVI A;  3QP5 A;  4JX4 A;  1HQC A;  1XX5 A;  4LLN A;  1LVK A;  1Y39 A;  3RKW A;  1BOA A;  5FD6 A;  4UV8 A;  4DYR A;  3L00 A;  3L2V A;  2YX7 A;  2XB0 X;  4HG2 A;  3WE3 A;  3DTK A;  1G59 A;  3SFZ A;  4A3B J;  3WTU C;  2DTZ A;  2EZI A;  1Z1D A;  2CG4 A;  3L2C A;  3DEW A;  4PSX A;  1XB4 A;  2K86 A;  5F1J A;  2XAQ A;  4M73 A;  4XIC A;  1AA7 A;  1V4R A;  4GYG A;  5DTD A;  4XKC A;  1L3L A;  5HS9 A;  2ZFW A;  3C2H A;  2HDD A;  1SAX A;  4D1Q A;  3BWG A;  5DYM A;  1AWC A;  3HHH A;  4XKW A;  1Z0X A;  5F08 A;  4RA2 A;  4ZJZ A;  1Q1H A;  4HV5 A;  3Q5F A;  4Q4Z F;  5L3D A;  3V8L A;  3HOW J;  4PGH A;  3VSL A;  1XG1 A;  2A6E F;  2ZME C;  1XSD A;  4BBS J;  1FP2 A;  4JX5 A;  1T98 A;  2JVH A;  2MFZ A;  2H6C A;  1ZK8 A;  2CMP A;  3BCB A;  4UUV A;  4RGS A;  2MC3 A;  3L2R A;  3DPT A;  3ABL H;  4MIM A;  4UXN A;  2P6T A;  3CES A;  4L5J A;  4UB6 C;  3ZGK A;  1YX5 A;  1A35 A;  3IUO A;  5DM6 F;  1FTZ A;  4JBA A;  1P7I A;  1ZYR F;  2EBI A;  1FOX A;  1ODD A;  4NC6 A;  1ETQ A;  4D7N A;  2QKL B;  2XPW A;  2A68 F;  2KDZ A;  3LQQ A;  1OR7 A;  2GIZ A;  5KVR A;  1NK3 P;  4KYW A;  1Y0N A;  2ADU A;  4DBR A;  3D5L A;  3Q0V A;  4BEH B;  2NS0 A;  1LPQ A;  1DPU A;  2HKO A;  1BM9 A;  5CPR B;  4Y52 J;  5E8G A;  3NQO A;  1YI2 I;  2R93 J;  2CO5 A;  3REO A;  3RJP A;  1MJB A;  2RVC A;  3WTX C;  2O03 A;  3HOY J;  3DU6 A;  4PSW A;  2EK5 A;  2VKH A;  2QSH X;  1U6G A;  1R49 A;  2UV1 A;  4NUB A;  2G7H A;  5AIQ A;  5KAI C;  4WWC A;  4LJZ F;  2STT A;  1B9N A;  1WVR A;  1BI3 A;  1ZRD A;  2M0C A;  2V4J C;  4BQA A;  5K5R A;  4RDU A;  2WA0 A;  1Y8Q B;  1MMS A;  2Y31 A;  3JRC A;  5DV5 A;  1VQP I;  2GZW A;  2K9S A;  1W0T A;  2QQB A;  1GT0 C;  1TT0 A;  3S1M J;  5IYD J;  2HNH A;  1P7J A;  3FKJ A;  1KQ9 A;  4XSZ F;  3ZMT A;  1N78 A;  3B6C A;  4AWX B;  1VQ9 I;  2DBB A;  3I4N J;  2NVX J;  3H3U A;  3MZ8 A;  2O5R A;  4FX0 A;  1FT9 A;  1OLT A;  2DDA A;  3TW6 A;  3VFZ A;  5C4X J;  1IN7 A;  3KYD B;  2XRL A;  3BC8 A;  1WZ2 A;  3WTZ A;  3VYU B;  1JHH A;  3MQ0 A;  5HOO A;  2A5W A;  3E97 A;  2OCE A;  1ZQ3 P;  1KZH A;  5DCM A;  2MG4 A;  1FYM A;  1ZAO A;  2J5O A;  3ASN H;  3OYJ A;  1JUM A;  4L5E A;  5BQT A;  5FFZ A;  1SVM A;  5LHH A;  3E1S A;  2A6H F;  5TIS C;  4P1W A;  5CKT A;  2P7C B;  2VJ4 A;  4PJN A;  5IYB J;  1W4M A;  3HGG A;  3FDY A;  1TC3 C;  2CW0 F;  4B47 A;  2DU9 A;  3OYB A;  5JI6 A;  1U2W A;  1VND A;  2DAO A;  4RAG A;  3H9G A;  4NNJ A;  4KMF A;  1YS6 A;  3FMQ A;  3IH4 A;  5EEG A;  2VOD A;  1LEB A;  4R1H A;  3V8K A;  4BAC A;  1BW5 A;  1W7P D;  4EM0 B;  5E3L A;  1YX3 A;  2VQH A;  3RZO J;  3CJR B;  2L9S A;  3QOD A;  3TW7 A;  2CRG A;  3FM5 A;  3FZV A;  3OWT A;  2LYC A;  1K7A A;  3WHB A;  4IQ4 A;  1XCV A;  4YEL A;  3KPH A;  1VI0 A;  1A31 A;  1YIO A;  2ID6 A;  2RN7 A;  2X0L A;  2ZXW H;  1UHS A;  4OMZ A;  3MKZ A;  2X6O A;  3KLN A;  1PP7 U;  2PMH A;  5H20 A;  4A0X A;  3WU1 B;  2QEX I;  3HTS B;  3N4M A;  5GPA A;  3G2B A;  2RDP A;  4RS8 A;  3QOP A;  1O7F A;  1XN7 A;  3SYT A;  1VQK I;  4UB8 C;  3JTG A;  1UAA A;  2IGN A;  1JGG A;  3BG7 A;  2DQR A;  5JFR A;  1SVO A;  1RKW A;  1BC7 C;  2WAQ A;  3K4K A;  2A05 A;  2LRE A;  2E5N A;  1IRX A;  1IW7 F;  3F8M A;  1D8J A;  1JKO C;  3HB9 A;  3WTY C;  1LVA A;  3N05 A;  1QZE A;  2Y9Y A;  5LGN A;  5DDG A;  2E2J J;  3DLL F;  3LA7 A;  1T0F C;  2HVQ A;  2LF8 A;  4LLL A;  1QVU A;  3BG6 A;  1OYW A;  2EB7 A;  5ED4 A;  2I8D A;  1X58 A;  3I5U A;  1GDT A;  3ZN1 A;  1TQM A;  3M1E A;  2FEZ A;  1TZL A;  5FLX Z;  1YO5 C;  5EG0 B;  3CMM A;  2QSG X;  4AID A;  2CFX A;  3HHG A;  3ELK A;  2DT5 A;  4D0P A;  3RQ4 A;  2QQ8 A;  4L5I A;  2DPU A;  2KRH A;  5J1U A;  3ZMS A;  2FMY A;  4CUG A;  1XMA A;  3AG2 H;  4QLC U;  4E7S A;  3TGN A;  2M9H A;  5C44 J;  2CQX A;  5J1R A;  2MBF A;  3CCU I;  4OAY A;  5E17 F;  2ISY A;  4NHJ A;  1SFK A;  4KIF A;  2LNB A;  3H5N A;  4F92 B;  1DGW Y;  3GME A;  4ENJ A;  5HLT A;  4FCY A;  5K1Y A;  2DJN A;  1TL8 A;  1XCB A;  3M4O J;  1UG0 A;  4NC7 A;  1X1D A;  2LMD A;  3JRH A;  3QQA A;  2WV1 A;  1KU3 A;  1VTN C;  3CF5 F;  4KDP A;  4UNO A;  4FIS A;  2MH2 A;  3C2B A;  4MGR A;  3OYD A;  1E3H A;  2R4G A;  2NVT J;  4P5O A;  4ZYE A;  3CUQ B;  4P9U A;  2HYJ A;  5BMZ A;  4WK8 F;  1FIA A;  3LSR A;  4KN4 X;  1OCP A;  1O7L A;  3ESW B;  4DJA A;  1FLI A;  3SZG A;  4RM2 A;  1L0O C;  2XUB A;  5IP9 J;  2KHM A;  4EV0 A;  2FF4 A;  2F5E A;  1HW2 A;  1IGN A;  1G3S A;  3WG9 A;  2GAU A;  4HF0 A;  3J7Z I;  1SFU A;  4ZTJ A;  4P9F A;  1ETO A;  4A5M A;  1W5T A;  2LBF A;  4WX9 A;  1RET A;  3BR0 A;  3KZI C;  3B6A A;  2D45 A;  1TWG J;  2L4M A;  1REP C;  1BR4 A;  5KNL A;  4LB6 B;  3IKV A;  3GTL J;  3E7L A;  3U9G A;  1Z6T A;  1WH7 A;  4HW0 A;  3QU3 A;  2R7R A;  3SJM A;  4EJV A;  3SEZ A;  5A2Q Z;  3AAF A;  2D1V A;  3ONQ A;  2NRA C;  3KEY A;  3RYP A;  1A6Q A;  3HKZ A;  4MEY F;  1RZ4 A;  3HC7 A;  4OIO F;  3OY9 A;  1BR2 A;  3IHU A;  3OL4 A;  4MFE A;  3G73 A;  4AIJ A;  5GTI C;  1TWC J;  3JW4 A;  4C2T A;  5IOY A;  3A0H C;  1K79 A;  2QLZ A;  3CUQ C;  3DEU A;  3FIS A;  3K4N A;  1DP7 P;  5L3E A;  2M45 A;  1FP1 D;  2RQQ A;  4ENN A;  4DYC A;  4YEJ A;  2ECB A;  1GUU A;  2DT7 B;  5CVV A;  5LLQ A;  2JWT A;  2E19 A;  3A2K A;  2F4O B;  3KP5 A;  2LD5 A;  1IXR C;  1SAN A;  3E6M A;  3GLX A;  2L7Z A;  2EZL A;  1IUY A;  1ETY A;  1LDD A;  3KP2 A;  3ISP A;  2JTV A;  2M87 A;  2LK2 A;  1G4D A;  1UMQ A;  3IAS 2;  1GLN A;  3KCC A;  3SXY A;  4I0B A;  3G3Z A;  5IY5 H;  1A36 A;  2VL8 A;  3FXQ A;  4A2U A;  5GAH J;  4F52 A;  1SFX A;  4QIW N;  1U78 A;  5LGU A;  4GDF A;  3K70 D;  1MSF C;  2VPL A;  1BIA A;  2VT2 A;  4XLE A;  5BS6 A;  2D2W A;  3KZY A;  3OR1 C;  1V5G A;  1IG7 A;  3TDU C;  2NS8 A;  5KK1 A;  2EZK A;  2LR8 A;  1HF0 A;  1WKM A;  2HR3 A;  3BZK A;  3LSI A;  2FA5 A;  1MH4 A;  3PFI A;  4YII A;  1WJA A;  1YTY A;  3BT9 A;  2HGC A;  3IP4 B;  1GXQ A;  3KET A;  2WWY A;  2Y2Z A;  3ZN0 A;  1HOM A;  4JOM A;  1HBX G;  1WJC A;  1I1S A;  1S8N A;  3DBH B;  3VOD A;  4L9T A;  3U2R A;  2BW3 B;  2DK8 A;  3OIQ A;  1HC8 A;  4EVI A;  2P5V A;  3DPU A;  2YUS A;  4CO8 A;  3RKX A;  3GFJ A;  1D5Y A;  3H1C A;  2XF5 A;  3H0G J;  4A3K J;  4I99 C;  3K7A J;  2ELK A;  2VLA A;  3C3W A;  4PGG A;  3G1L A;  3OYG A;  1W5C C;  1IC8 A;  2DN0 A;  1LUJ B;  1T6S A;  5A2Q K;  3K70 C;  2X1C A;  2KKO A;  4BJ5 C;  3CUQ A;  4IKF A;  1R1V A;  2M1B A;  5J6X A;  2Z1D A;  2XHK A;  1U5T C;  2R0Q C;  2BY0 A;  3HUG B;  2R7S A;  5FLV A;  2OA4 A;  2XAS A;  3S3N A;  4IF4 A;  3OYF A;  3H3V K;  3GZ6 A;  4MTE A;  4HQM A;  2PMU A;  2QUF A;  3JRG A;  2FD5 A;  1LDK B;  4U7B A;  5E20 A;  2M2E A;  3BR1 A;  3V7S A;  3VB2 A;  5LBQ A;  1KU7 A;  2F4I A;  2BHY A;  4EJT A;  4G12 A;  4OIP F;  2IA2 A;  1V54 H;  2CW8 A;  1G8X A;  1SD5 A;  2A5Y B;  2KIS A;  3IC7 A;  4A12 A;  5E18 F;  3G71 I;  1CF7 A;  3U21 A;  2X4H A;  3Q0U A;  1RUN A;  3MMY B;  4UY8 I;  2QF7 A;  4KN7 X;  5DCF A;  1IZ1 A;  2W85 A;  3PO2 J;  3O3K A;  1EH6 A;  3IRR A;  4GGG A;  2JA7 J;  2NOJ B;  1RR7 A;  2E5Z A;  1ZH5 A;  3RKY A;  1FSH A;  1ZKG A;  3FM3 A;  4QPO A;  2QEN A;  2PFB A;  3OR2 C;  4U88 A;  2F6C A;  3WU2 C;  2KJB A;  2JMW A;  3HGY A;  1F9N A;  3IWF A;  5KAF C;  2CH0 A;  5JVG F;  3NWT A;  3S15 J;  2VKD A;  5JHU A;  1GVD A;  1RES A;  3FK7 A;  2LF7 A;  1SVL A;  1WJF A;  1XS9 A;  2FML A;  3S2W A;  5EZH A;  3T5X A;  2IAI A;  2V1U A;  1WCM J;  3CCM I;  4M6V A;  4EM2 A;  4OIQ F;  5TJJ A;  2X6Y A;  4IHY A;  3VYS B;  3K4B A;  2ZC2 A;  4RM3 A;  1MBH A;  2H09 A;  3SZT A;  3Q9S A;  2PN6 A;  2LOO A;  3I64 A;  3K6G A;  3SEQ A;  3VYT B;  2KIQ A;  5K7H A;  4OOI A;  3J80 Z;  4WF2 A;  2E7X A;  2JJ7 A;  2HQN A;  3K2A A;  3WOD F;  5F04 A;  2G9W A;  4H4K C;  4DZP A;  1XSV A;  4U0V A;  3UNG C;  5ILV A;  3L7W A;  2VE8 A;  3OL3 A;  5E1Z B;  1POG A;  1UFM A;  1LFB A;  2DTR A;  3LL7 A;  2K27 A;  3I3L A;  3G1O A;  1HDD C;  4XOP A;  5DD8 A;  4W1U A;  1Y1V J;  3V4G A;  2ZXJ A;  3CO6 C;  2UXX A;  3ERM A;  4ZZD A;  3CCY A;  1QU3 A;  3TKY A;  3BJ6 A;  4XK4 A;  4HDU A;  1HLV A;  2GXA A;  1X2M A;  1G2H A;  3I9V 2;  2N8G A;  2IVM A;  1O4X A;  1R5G A;  1N25 A;  5K7F A;  3BG5 A;  1U0J A;  2H6B A;  2DFE A;  1Z21 A;  2ISZ A;  1MJ9 A;  3BJO A;  1MH3 A;  3EET A;  2MGQ A;  3CC4 I;  5EGO B;  2CV2 A;  2JVG A;  1ZGW A;  3ZQC A;  3DWL E;  4HQE A;  2LTP A;  5IPA A;  4I2O A;  1X19 A;  3JRD A;  2XV4 S;  3TO7 A;  3CDL A;  1CGP A;  4DGW B;  5DS9 A;  2EFQ A;  4U0W A;  3ZCO A;  1V5F A;  2DMT A;  4DW6 A;  4RAF A;  1UHW A;  1TQI A;  3D5R C;  3P9K A;  3HOS A;  3ZRG A;  2B63 J;  3CF2 A;  1FNN A;  2JRM A;  1BL0 A;  1CQT A;  2CU7 A;  1R36 A;  1TTY A;  2VUM J;  5IT9 K;  1SMY F;  5FD5 A;  1Z9C A;  2LH9 A;  1BI1 A;  2V9P A;  1JT6 A;  4LB5 A;  2G7U A;  2VAS A;  3H35 A;  2VIX A;  2QKM B;  1WH5 A;  4XKV A;  2LKX A;  3AL0 C;  1D8K A;  5M5Y J;  3GBG A;  3K1M A;  4U7D A;  1FSE A;  3E0J B;  3HOZ J;  2YS9 A;  4N4O B;  4AUX A;  3M7G A;  1H9G A;  1MMD A;  3I58 A;  1V5E A;  1XTA A;  2JPB A;  2TCT A;  4II3 A;  2XAH A;  2VJ5 A;  2M8E A;  4A3E J;  3VDX A;  2BXZ A;  3BOQ A;  4PUS A;  3DKW A;  3WTT C;  3WGI A;  3S8P A;  2WB1 N;  2FRH A;  2OAZ A;  5HS8 A;  1K6O A;  3U1K A;  1S72 I;  2MLG A;  3HPG A;  3GXO A;  3L9F A;  1F36 A;  4XSX F;  5E3M A;  4CGZ A;  1SFE A;  2O0Y A;  1FYL A;  2UZK A;  2HXI A;  1D1C A;  2R7O A;  3N97 A;  2DMP A;  3G6E I;  3C2G A;  1SD6 A;  4D9J A;  2V1D A;  1FC3 A;  3DCF A;  1S3J A;  2X48 A;  5B5E C;  3W3C A;  2EV5 A;  1QHH D;  3S2H J;  2J5P A;  5ILS A;  1WFX A;  4A3F J;  4CYC A;  2QQA A;  4HSR A;  5EGO A;  2HVR A;  2COB A;  1J75 A;  5DCM B;  3CP2 A;  3CCS I;  5DD4 A;  2LBF B;  1ZGA A;  2VXD A;  4FHT A;  4KIB A;  2HQ5 A;  2O9L A;  2QYO A;  4BY7 J;  1R9T J;  2COM A;  3K10 A;  4BHC A;  2CV1 A;  1MBF A;  4LG3 A;  5HLH A;  1GV2 A;  3D0S A;  4LLG F;  1S7O A;  3B02 A;  3R0A A;  1MIJ A;  4XRF A;  2LKS A;  3FBN B;  3RDI A;  3EUA A;  2WAF A;  1D1B A;  3HOX J;  4I76 A;  1H0M A;  1J5Y A;  2IS4 A;  3WTS C;  1NG7 A;  1VZ0 A;  1Z77 A;  2VQL A;  1OR7 C;  2ZFU A;  4YRV A;  1VQ7 I;  2BGC A;  3E5U A;  3KP7 A;  3ASO H;  4BHP A;  3FKI J;  4BQN A;  2ZNY A;  3S1R J;  1XSX A;  4QTR A;  1FYK A;  2EFP A;  2UUZ A;  5ERI A;  2AQE A;  2VQC A;  3M8J A;  3CCE I;  4Y4R A;  1USS A;  1P9Q C;  2EIJ H;  2PMZ A;  4E6K G;  4QSH A;  1UEL B;  1W7P B;  2P5L C;  4RBO A;  1KU2 A;  2WB1 A;  2DFH A;  4UUS B;  1B9M A;  2RQP A;  3LA2 A;  1J09 A;  2FJ1 A;  4CCN A;  1U5T A;  4NQW A;  2F2E A;  4MLO A;  3ROU A;  5LGT A;  2Z33 A;  2HWV A;  3CDI A;  4PJJ A;  2NYX A;  5HLI A;  2I10 A;  1JI8 A;  3AFH A;  1H9T A;  2ECC A;  3HOV J;  4GRI A;  3R6S A;  1ZHF A;  4OWR B;  2R7U A;  5ICF A;  3ZQG A;  2VBY A;  3F8B A;  2VJJ A;  2KL4 A;  2KDO A;  5HDG A;  3OYC A;  2FX0 A;  4B43 A;  4RGX A;  1MD0 A;  3QPL A;  2XIG A;  2W25 A;  3B73 A;  3E6D A;  2NVQ J;  1JGS A;  3TMO A;  1B8I A;  4BU2 A;  2L4A A;  1B6A A;  4V19 K;  2V7F A;  3E3V A;  1F4K A;  3M3Y J;  2NXN B;  3VYR B;  3OIP A;  1RI7 A;  1TNS A;  4JQF A;  1D3Y A;  1G3T A;  2M3A A;  2YX4 A;  2XSJ C;  1TT5 B;  3TP0 A;  4M9S A;  4G6D A;  3VPR A;  4Q47 A;  2LRD A;  5L3C A;  2PJP A;  1O3Q A;  2LG4 A;  4Q48 A;  4YFN F;  4RB0 A;  1ETW A;  4KIC A; 
#chains in the Genus database with same CATH homology
 2Q2E A;  1EV7 A;  4L9V A;  5JR3 A;  3SHF A;  1F1Z A;  3HSR A;  5HDN A;  3BPV A;  5TRD A;  2FNP A;  4I98 B;  2Y0M A;  1TLH B;  2NAZ A;  2K7L A;  1E2X A;  3CTA A;  3LST A;  3F6O A;  1KQ0 A;  1EH8 A;  1P4W A;  2QM3 A;  2LDU A;  3QPH A;  4YFK F;  1P4X A;  1W7P A;  4YFX F;  4M72 A;  3EYY A;  4WCG A;  5LHG A;  1RNL A;  3IKT A;  1D5V A;  1CF7 B;  3ZMD A;  2OZU A;  4KA4 A;  1ON1 A;  3F3X A;  1UHM A;  4A0Z A;  2K4J A;  1B59 A;  3GWZ A;  3I0T A;  3ABT A;  1O3R A;  3EUH A;  3KEQ A;  1MDM A;  2P4W A;  4E70 A;  3HRS A;  1PP8 F;  2YPR A;  3GEZ A;  3HRM A;  3RIR A;  1IRF A;  5AIP A;  4IRG A;  2EV0 A;  3GFI A;  1S6L A;  3SQN A;  1C0W A;  2V6C A;  3R60 A;  4Y17 A;  1HW1 A;  2DW4 A;  4AVP A;  1HKQ A;  2HS5 A;  2RKH A;  2V1X A;  2L3D A;  1NHA A;  4ASN A;  2XAG A;  2XKP A;  1XGS A;  3O6B B;  4M9X A;  1XDS A;  5DUI A;  2P5K A;  1FBS A;  1QZY A;  2VBZ A;  2EWN A;  2AS5 F;  3FX3 A;  5DEQ A;  4RGU A;  4IXA A;  2NNY A;  1XGM A;  1R1U A;  1S7A A;  3K2Z A;  4ESB A;  3BP8 A;  1PDN C;  3JAM Z;  4PCQ A;  2RV8 A;  5DUK A;  2GXB A;  2M30 A;  4MQ9 F;  4HZF A;  4UV9 A;  1IXC A;  1KQ8 A;  3OV8 A;  1MJA A;  2CGP A;  1MGT A;  3V8J A;  2D1H A;  1IN6 A;  3ZP5 A;  1P4A A;  1OYI A;  4GO1 A;  3IRQ A;  4A0Y A;  2Z99 A;  2GWR A;  2VOO A;  1FOK A;  4N0B A;  5HLG A;  3J80 K;  3WTW C;  5BPI A;  4OIR F;  1IN4 A;  1YLF A;  3LA3 A;  3H92 A;  3I71 A;  5CYV A;  1XMK A;  4FT8 A;  1ZRE A;  2QVO A;  5LRS A;  1LQ1 A;  2NNN A;  1OKR A;  3F8N A;  3ZMU A;  4OU0 A;  5JVT A;  1WRJ A;  3W6K B;  3CDH A;  4CZZ A;  2BEO A;  5HS7 A;  1O3S A;  1Z05 A;  2M5W A;  4ESF A;  4A5N A;  2IP2 A;  2HFH A;  3WU0 A;  2UWM A;  3K69 A;  2IA1 A;  1TQP A;  2Y75 A;  5J8F A;  1B1B A;  1I6X A;  4HOB A;  1RIO H;  2L02 A;  1HKS A;  3NRV A;  5ILU A;  3KLO A;  2FQ3 A;  5H6Q A;  1ULY A;  4MQV A;  3P9I A;  4RB2 C;  3M8F A;  3DF8 A;  4HA8 A;  2PG4 A;  2Y48 A;  2FE3 A;  4HX4 A;  3FMS A;  4MNU A;  4EMS A;  2OBP A;  3FF5 A;  2WC2 A;  1XGN A;  1FBQ A;  3ECH A;  3MWM A;  4BYY A;  4YIF A;  4S05 A;  3ZQ7 A;  1I27 A;  5FGM A;  4ON0 A;  3BY6 A;  2FBK A;  1Z7U A;  4B09 A;  5K5O A;  2Z9O A;  1GVJ A;  4RB3 C;  1ON2 A;  4HLX A;  4DQ2 A;  5L3F A;  3Q9V A;  2VE9 A;  2A61 A;  1R58 A;  2EA2 A;  3PQJ A;  1DPR A;  1T39 A;  3O2P E;  4IVN A;  3WGG A;  2MA3 A;  2PLY A;  2MH9 A;  5H6R A;  1WQ2 A;  2PEX A;  3WGH A;  4HV6 A;  1BI2 A;  3KEO A;  4CYD A;  3K0L A;  5CVU A;  1Y0U A;  4KMU X;  2PI0 A;  2F5C A;  2IPQ X;  1R00 A;  2E7W A;  4R79 A;  3EYI A;  1Z6R A;  3HOT A;  4N9H A;  2OZ6 A;  3LAP A;  3I54 A;  5F6F A;  1BN5 A;  2XRN A;  2CSO A;  2XRO A;  4ETS A;  1QO0 D;  2DK5 A;  1OYY A;  3JSP A;  4Y15 A;  1ZG5 A;  1O3T A;  2WTE A;  3GVA A;  2RGV A;  2XAJ A;  3COA C;  4LG0 B;  2V79 A;  3QU6 A;  2Z5U A;  1HW5 A;  2F5F A;  1BIB A;  2IRF G;  3LQR A;  2Q0O A;  1U3E M;  2ESH A;  1FZP B;  3TQN A;  3BRO A;  3TOA A;  1FPQ A;  3U1D A;  4LD5 A;  3H3Z A;  4AIH A;  1ZRC A;  4ZYH A;  4WXH A;  2QWW A;  3C1D A;  1RUO A;  3ECO A;  2RC4 A;  5D4R A;  3P9C A;  5E8I A;  2HDC A;  4HF1 A;  3DXJ F;  1YG2 A;  2PQ8 A;  3DPL C;  3F8C A;  3L09 A;  2DFI A;  3DFG A;  4G7O F;  4HX7 A;  3DP7 A;  1S29 A;  4RAZ A;  3M8E A;  2VT3 A;  1DUX C;  1U5T B;  5E1W A;  3TOB A;  1TW2 A;  2R3S A;  2CWE A;  3ABU A;  3E5X A;  3GO5 A;  3EQL F;  5D8K B;  3J81 Z;  2GA2 A;  3K9T A;  2HTS A;  5CVR A;  3FHZ A;  3IL2 A;  3ZMV A;  4PDK A;  5EEH A;  3FWE A;  2VOP A;  3NEU A;  1P92 A;  3E6C C;  3WTV C;  4UVA A;  1XD7 A;  1R22 A;  4XLN F;  4LK0 F;  1IXS B;  1FX7 A;  2QZ8 A;  1W5S A;  2B0L A;  1IAW A;  3F72 A;  2GA1 A;  1QNT A;  3DQV C;  4Q5S F;  2R7D A;  1G3Y A;  2GXG A;  3GF2 A;  1WI9 A;  4EM1 A;  3I59 A;  4QWQ A;  2FSW A;  3RI4 A;  4KNY A;  2ESN A;  4HBL A;  4XLP F;  3FXU A;  3CO7 C;  3KFW X;  4RB1 A;  1MKM A;  4PZJ A;  2O61 A;  4CDG A;  2KIF A;  4Z2Y A;  2ZJ2 A;  4BH9 A;  2FNA A;  1GXP A;  1J2X A;  1QGP A;  1LJ9 A;  2ACJ A;  2W24 A;  2CQK A;  2FOK A;  2MD5 A;  4MEX F;  1T0F A;  2BE5 F;  1FWZ A;  2DLL A;  4TV7 A;  2TDX A;  4WXD A;  4NB5 A;  4O6J A;  1J0R A;  2IJL A;  3R61 A;  4BHB A;  2YU3 A;  3LAJ A;  3F21 A;  1IN5 A;  4UHT A;  2XAF A;  3MZY A;  5CVJ A;  5D6E A;  1ZAR A;  1ZN2 A;  3DV8 A;  5FFX A;  5CLS A;  3W6J B;  4A6D A;  4WXC A;  2HKX A;  3MFK A;  2ZME B;  2HEO A;  2R7F A;  5ICC A;  5HVQ C;  2VN2 A;  2GIV A;  2IT0 A;  2VXZ A;  2XGX A;  3ULQ B;  1XDU A;  5LEK A;  2HQR A;  3T8R A;  1FBU A;  1WWX A;  2BBY A;  4ZH4 F;  3E6B A;  1TW3 A;  3RPQ A;  2HTJ A;  4O3M A;  2E1N A;  5D5X B;  3I4P A;  3J7A O;  1STZ A;  1MDM B;  3MAJ A;  1AOY A;  4H0E A;  4UVC A;  1KYW A;  4OMY A;  3K1P A;  2YSR A;  5FLX K;  2JSC A;  1YW9 A;  3QP6 A;  3J81 K;  3V7C A;  3RYR A;  3P7N A;  5D6F A;  4I09 A;  2OD5 A;  3BZ6 A;  4KT5 C;  4I0A A;  4L18 B;  2IW5 A;  1QBJ A;  1KGS A;  2JPC A;  5LRR A;  1E17 A;  2EA4 A;  2DPD A;  1KA8 A;  3TDZ C;  5IT9 Z;  2W57 A;  4GYI A;  2EV6 A;  3HTU A;  3QPT A;  4K2E A;  2O6G E;  1FY7 A;  4IRH A;  4HLY A;  2H94 A;  1U8R A;  3QRF F;  2O3F A;  5FO5 A;  2EFN A;  3JSO A;  4LG0 A;  1QZZ A;  2KRF A;  2ZO4 A;  3VEP A;  2ZME A;  2VBX A;  1HXD A;  3HYI A;  4O5V A;  3I53 A;  3EDP A;  1R5H A;  1YW8 A;  3RTR A;  3RPU A;  2DI3 A;  4P55 A;  4M6X A;  1HSJ A;  3GFM A;  1BC8 C;  2FBI A;  4ZYG A;  2ZNZ A;  4HYE A;  1MZB A;  2ZCW A;  1IF1 A;  3ZPL A;  3T1B A;  3ERE D;  2OQG A;  4B8X A;  5LHI A;  4ESJ A;  5D5W B;  4M74 A;  2ETH A;  2OU2 A;  3GFL A;  1ZLJ A;  1KU9 A;  2FU4 A;  1BI0 A;  5D8L B;  3JTH A;  4GCV A;  4LGW A;  1P6R A;  1TNT A;  5AON A;  1J7K A;  3LWF A;  2JZY A;  3TO9 A;  2EFO A;  4RAY A;  2DQL A;  1Z91 A;  4CIC A;  1JXS A;  3M9A A;  4G7Z F;  3SZP A;  3GYH X;  4ZZL A;  4EQQ A;  3BJA A;  1V3F A;  3R0J A;  3V7R A;  3QAH A;  4F7Z A;  2CYY A;  2QBY A;  2A69 F;  2YR2 A;  1J59 A;  2L01 A;  4I02 A;  1YYV A;  2A3S A;  1F5T A;  3CUO A;  4G8X A;  2E1C A;  3GW2 A;  3VOE A;  5ICE A;  4EJO A;  3MCZ A;  5D5V B;  4A6E A;  4RGR A;  3JAM K;  1ONV A;  4CHU A;  2JRT A;  3GZ5 A;  2VBW A;  4BNC A;  4M6Y A;  3KP3 A;  2JT1 A;  2W84 A;  3FMR A;  1R23 A;  4I7H A;  3R4K A;  2LKP A;  5J8C A;  2A07 F;  1K78 A;  4G94 A;  4IRI A;  5D5U B;  3GUD A;  3F6V A;  4BXU A;  1QQI A;  1G3W A;  4L0Y B;  1YFH A;  1OPC A;  5FB2 A;  4CXF A;  4AIK A;  3KZZ A;  5IT3 A;  2OQR A;  4ZYD A;  5D4S A;  2XKO A;  3OOP A;  3BDD A;  2C6Y A;  3F22 A;  1OMI A;  3MZH A;  4FX4 A;  1O57 A;  1JE8 A;  2ZKZ A;  4I01 A;  1LNW A;  1ZGJ A;  3LFK A;  3HSF A;  4UVB A;  1R7J A;  3C7J A;  3KP6 A;  1JHF A;  2UXN A;  1UB9 A;  1XGO A;  3BPX A;  1QPM A;  4ENK A;  5LEJ A;  2F5D A;  4DNC A;  1IRG A;  3PQK A;  3WE2 A;  2BYV E;  2QBY B;  3HIF A;  2HOE A;  4G9Y A;  4S04 A;  1A04 A;  4HDV A;  4KFC A;  3KE2 A;  3C18 A;  1WSU A;  2EJR A;  2HZT A;  5CJ9 A;  5ICG A;  1LDJ A;  3HRU A;  3ML6 A;  4IHT A;  2BV6 A;  1K78 B;  4LFU A;  3HRT A;  2P8T A;  4EGZ A;  1GHC A;  1X3U A;  2ZBK A;  1SMT A;  4M9Z A;  3I59 B;  4IJA A;  2O8X A;  1T38 A;  4L9N A;  1YW7 A;  3F23 A;  2VC0 A;  4G7H F;  1ZRF A;  5K5Q A;  1UST A;  3CLO A;  2VON A;  2RNJ A;  4ENM A;  1T2K A;  4GXO A;  4BAY A;  2FXA A;  1LEA A;  4EGY A;  4N9I A;  1LB2 A;  2KIM A;  1EH7 A;  4OIN F;  4MHG A;  3CJN A;  2KJC A;  1J9I A;  4R8H A;  4U0Y A;  2AXL A;  4HX8 A;  1ZG1 A;  1P2F A;  3F8F A;  2Z3Y A;  4XBF A;  2P7V B;  2MLK A;  1TBX A;  3ZMZ A;  1HST A;  4HAM A;  4JK1 X;  1BBY A;  1DDN A;  2FBH A;  2IA0 A;  2K02 A;  1YS7 A;  5BPD A;  4LK1 F;  1SD4 A;  5E1X A;  3IWZ A;  4KUM A;  5F1R A;  2LSO A;  1ZLK A;  3KP4 A;  2QQ9 A;  2VC1 A;  4M71 A;  1PUE E;  1B4A A;  2EFW A;  3FXR A;  2WV0 A;  5F64 A;  2K4B A;  3E5Q A;  4G6Q A;  4P96 A;  3TO6 A;  4HF2 A;  2HYG D;  1HKT A;  2KIU A;  2V9V A;  2STW A;  4EJW A;  4IHS A;  1UCR A;  5BOX A;  2H27 A;  4L0Z B;  2GQQ A;  5L3B A;  1G6N A;  1ZG3 A;  3MEX A;  4AD9 A;  5L3G A;  3T0Y A;  4LMY A;  4L9J A;  1I5Z A;  2Q8K A;  3T8T A;  1KYZ A;  1BJA A;  5HDK A;  3HUG A;  2DO7 A;  1SD7 A;  4MTD A;  3K1N A;  2L54 A;  4IPA A;  4Y13 A;  6PAX A;  4YG2 F;  1R1T A;  2ELH A;  2HYF A;  1IN8 A;  1I1G A;  2PBI A;  3GX4 X;  4EJU A;  2P6S A;  3HSE A;  2XVC A;  1YQA A;  4KIG A;  5CVI A;  3QP5 A;  1HQC A;  4LLN A;  3RKW A;  1BOA A;  5FD6 A;  4UV8 A;  3L00 A;  2YX7 A;  3WE3 A;  3SFZ A;  3WTU C;  1Z1D A;  2CG4 A;  3L2C A;  1XB4 A;  2K86 A;  2XAQ A;  4M73 A;  1V4R A;  4GYG A;  1L3L A;  5HS9 A;  2ZFW A;  1SAX A;  3BWG A;  5DYM A;  1AWC A;  3HHH A;  1Q1H A;  4HV5 A;  3Q5F A;  4Q4Z F;  5L3D A;  3V8L A;  4PGH A;  2A6E F;  1XSD A;  1FP2 A;  1T98 A;  2H6C A;  4UUV A;  4RGS A;  2MC3 A;  3DPT A;  4UXN A;  2P6T A;  4L5J A;  4JBA A;  1ZYR F;  1ODD A;  2A68 F;  3LQQ A;  1OR7 A;  5KVR A;  4KYW A;  2ADU A;  3D5L A;  1DPU A;  2NS0 A;  2HKO A;  1BM9 A;  5E8G A;  3NQO A;  2CO5 A;  3REO A;  3RJP A;  1MJB A;  2RVC A;  3WTX C;  2O03 A;  2EK5 A;  1U6G A;  5AIQ A;  2G7H A;  4WWC A;  4LJZ F;  2STT A;  1B9N A;  1BI3 A;  1ZRD A;  4BQA A;  5K5R A;  5DV5 A;  2GZW A;  2QQB A;  1KQ9 A;  4XSZ F;  3ZMT A;  4AWX B;  2DBB A;  3H3U A;  4FX0 A;  1FT9 A;  3VFZ A;  1IN7 A;  3WTZ A;  1JHH A;  3MQ0 A;  5HOO A;  3E97 A;  5DCM A;  1FYM A;  1ZAO A;  2J5O A;  5BQT A;  5FFZ A;  5LHH A;  2A6H F;  2P7C B;  1W4M A;  2CW0 F;  2DU9 A;  5JI6 A;  1U2W A;  2DAO A;  4KMF A;  1YS6 A;  3FMQ A;  5EEG A;  1LEB A;  2VOD A;  4R1H A;  3V8K A;  1W7P D;  4EM0 B;  3FM5 A;  3FZV A;  1K7A A;  1XCV A;  1YIO A;  2X0L A;  2RN7 A;  4OMZ A;  3KLN A;  1PP7 U;  2PMH A;  5H20 A;  4A0X A;  3WU1 B;  3HTS B;  3N4M A;  4RS8 A;  2RDP A;  3QOP A;  1O7F A;  1XN7 A;  3JTG A;  2DQR A;  5JFR A;  1BC7 C;  1IW7 F;  3F8M A;  1D8J A;  3WTY C;  1LVA A;  5LGN A;  5DDG A;  3LA7 A;  2LF8 A;  4LLL A;  1OYW A;  2EB7 A;  5ED4 A;  3I5U A;  3ZN1 A;  1TQM A;  3M1E A;  2FEZ A;  5FLX Z;  1YO5 C;  2CFX A;  3HHG A;  3ELK A;  2DT5 A;  4D0P A;  4L5I A;  2DPU A;  3ZMS A;  2FMY A;  1XMA A;  4QLC U;  3TGN A;  2MBF A;  5E17 F;  2ISY A;  4NHJ A;  4KIF A;  2LNB A;  4ENJ A;  5K1Y A;  1XCB A;  1KU3 A;  1VTN C;  4KDP A;  4UNO A;  2MH2 A;  4MGR A;  4P5O A;  4ZYE A;  3CUQ B;  4P9U A;  5BMZ A;  4WK8 F;  4KN4 X;  1O7L A;  1FLI A;  1L0O C;  2XUB A;  4EV0 A;  2FF4 A;  2F5E A;  1HW2 A;  1G3S A;  3WG9 A;  2GAU A;  4HF0 A;  1SFU A;  4P9F A;  4A5M A;  1W5T A;  4WX9 A;  2D45 A;  2L4M A;  1REP C;  4LB6 B;  3IKV A;  3U9G A;  1Z6T A;  4HW0 A;  3QU3 A;  4EJV A;  5A2Q Z;  3AAF A;  2D1V A;  2NRA C;  3RYP A;  4MEY F;  1RZ4 A;  4OIO F;  3IHU A;  3G73 A;  4AIJ A;  3JW4 A;  1K79 A;  2QLZ A;  3CUQ C;  3DEU A;  1DP7 P;  5L3E A;  2M45 A;  1FP1 D;  4ENN A;  5LLQ A;  5CVV A;  3KP5 A;  1IXR C;  3E6M A;  3GLX A;  1IUY A;  1LDD A;  3KP2 A;  3ISP A;  2JTV A;  2M87 A;  1G4D A;  3KCC A;  3SXY A;  4I0B A;  3G3Z A;  3FXQ A;  4A2U A;  1SFX A;  1U78 A;  5LGU A;  1BIA A;  2VT2 A;  5BS6 A;  2D2W A;  3KZY A;  3TDU C;  5KK1 A;  1WKM A;  2HR3 A;  2FA5 A;  3PFI A;  4YII A;  1YTY A;  2HGC A;  1GXQ A;  3KET A;  2WWY A;  3ZN0 A;  1HBX G;  1I1S A;  1S8N A;  3VOD A;  4L9T A;  3U2R A;  2DK8 A;  4EVI A;  2P5V A;  4CO8 A;  3RKX A;  3GFJ A;  3C3W A;  4PGG A;  1T6S A;  5A2Q K;  2KKO A;  3CUQ A;  1R1V A;  2M1B A;  5J6X A;  2XHK A;  1U5T C;  2OA4 A;  2XAS A;  4IF4 A;  3GZ6 A;  4MTE A;  4HQM A;  2PMU A;  2QUF A;  1LDK B;  4U7B A;  5E20 A;  3V7S A;  3VB2 A;  5LBQ A;  1KU7 A;  4EJT A;  4OIP F;  2IA2 A;  1SD5 A;  2A5Y B;  3IC7 A;  4A12 A;  5E18 F;  1CF7 A;  2X4H A;  1RUN A;  4KN7 X;  5DCF A;  1IZ1 A;  2W85 A;  3O3K A;  1EH6 A;  3IRR A;  4GGG A;  1ZH5 A;  3RKY A;  1FSH A;  3FM3 A;  4U88 A;  2QEN A;  2PFB A;  2KJB A;  3IWF A;  1F9N A;  5JHU A;  2LF7 A;  2FML A;  3S2W A;  3T5X A;  2V1U A;  4EM2 A;  4OIQ F;  5TJJ A;  3SZT A;  2H09 A;  3Q9S A;  2PN6 A;  3I64 A;  4OOI A;  3J80 Z;  4WF2 A;  2E7X A;  2HQN A;  3WOD F;  2G9W A;  5ILV A;  1XSV A;  4U0V A;  3L7W A;  2VE8 A;  5E1Z B;  1UFM A;  2DTR A;  2K27 A;  5DD8 A;  3V4G A;  2ZXJ A;  3CO6 C;  2UXX A;  4ZZD A;  3TKY A;  3BJ6 A;  4HDU A;  2IVM A;  1R5G A;  2H6B A;  2ISZ A;  1MJ9 A;  3BJO A;  3EET A;  4HQE A;  4I2O A;  2XV4 S;  3TO7 A;  1CGP A;  2EFQ A;  4U0W A;  1UHW A;  1TQI A;  3P9K A;  3HOS A;  1FNN A;  1R36 A;  1TTY A;  5IT9 K;  1SMY F;  5FD5 A;  1Z9C A;  1BI1 A;  4LB5 A;  2G7U A;  1D8K A;  3K1M A;  4U7D A;  1FSE A;  3M7G A;  1H9G A;  3I58 A;  2JPB A;  2XAH A;  2M8E A;  3BOQ A;  3DKW A;  3WTT C;  3WGI A;  2FRH A;  2OAZ A;  5HS8 A;  1K6O A;  2MLG A;  3GXO A;  3L9F A;  4XSX F;  4CGZ A;  1SFE A;  2O0Y A;  1FYL A;  2UZK A;  3N97 A;  1SD6 A;  2V1D A;  1FC3 A;  1S3J A;  2EV5 A;  2J5P A;  5ILS A;  2QQA A;  1J75 A;  5DCM B;  5DD4 A;  1ZGA A;  4FHT A;  4KIB A;  2QYO A;  2COM A;  4BHC A;  5HLH A;  3D0S A;  4LLG F;  1S7O A;  3B02 A;  3R0A A;  4XRF A;  3RDI A;  1H0M A;  1J5Y A;  3WTS C;  2BGC A;  3E5U A;  3KP7 A;  4BHP A;  2ZNY A;  1XSX A;  1FYK A;  2EFP A;  5ERI A;  1USS A;  1W7P B;  2P5L C;  1KU2 A;  1B9M A;  2RQP A;  3LA2 A;  1U5T A;  4NQW A;  2F2E A;  3ROU A;  2Z33 A;  5LGT A;  2HWV A;  2NYX A;  5HLI A;  1H9T A;  3R6S A;  1ZHF A;  5ICF A;  2VBY A;  3F8B A;  5HDG A;  4RGX A;  1MD0 A;  2XIG A;  2W25 A;  3B73 A;  3E6D A;  1JGS A;  2L4A A;  1B6A A;  3E3V A;  1F4K A;  1RI7 A;  1TNS A;  4JQF A;  1D3Y A;  1G3T A;  2YX4 A;  4M9S A;  4G6D A;  4Q47 A;  5L3C A;  2PJP A;  1O3Q A;  4Q48 A;  4YFN F;  4RB0 A;  4KIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...