4HW0A

Crystal structure of sso10a-2, a dna-binding protein from sulfolobus solfataricus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
98
structure length
98
Chain Sequence
KRGTMEIMFDILRNCEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDRKIYEITEKGKLLRTHIEEFIKIRENLYSAKEKVSELLRTDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding protein Sso10a-2
publication title Diverse architectural properties of Sso10a proteins: Evidence for a role in chromatin compaction and organization.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 36
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14947 HTH_45 Winged helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hw0A00
1D8JA 1ZN2A 2NNNA 1J7KA 5F6FA 2ZO4A 1HKSA 1XGMA 1WSUA 1ZARA 4KT5C 2CYYA 4G8XA 2BYVE 2L4AA 4RGRA 2Q8KA 3PFIA 4MEXF 5DD4A 3FMQA 3WTWC 1ZG3A 1FP1D 1F9NA 1U5TC 5K5RA 4ZZLA 3TGNA 5HVQC 3WGHA 3FM3A 2YSRA 2EV6A 1WRJA 3HIFA 2P4WA 4N9HA 4CICA 2ZJ2A 2O6GE 3TO7A 4HF2A 5FB2A 2YU3A 4G6QA 4GGGA 5LHGA 2M5WA 2OAZA 3QP5A 2RKHA 3TDUC 3HRTA 4LB5A 1S7AA 3BZ6A 1P6RA 2PMHA 2E7XA 5F1RA 2MLGA 4I0BA 3CUOA 4GCVA 3HHHA 3Q5FA 1KYZA 3RKWA 1ZAOA 4RB0A 1C0WA 1FLIA 5ILSA 1IN7A 5DUKA 2CW0F 2ZXJA 2ZNZA 1SD7A 1B1BA 2E1CA 4LG0B 4HAMA 3TQNA 3GYHX 3V8LA 2P6SA 2J5PA 3P7NA 4R8HA 1A04A 2A6EF 1XGOA 2XAJA 2D1HA 2FXAA 3E3VA 5D5WB 2KIUA 2K86A 4G7OF 4F7ZA 5K5QA 2GIVA 1V3FA 3ECOA 3ZMUA 5ERIA 1LDDA 3K0LA 3GZ6A 2GXBA 1Z1DA 2H6BA 4AD9A 4OOIA 2HOEA 4Q48A 3ZP5A 5BS6A 1G3TA 3LQRA 2A07F 1ONVA 1YYVA 4U0WA 3H3UA 1PP7U 1IN5A 1CF7A 4L18B 2AXLA 5ICFA 4I98B 1EH7A 4MQ9F 1E17A 1WI9A 4LMYA 4EJTA 2ZMEB 1ZLKA 2PJPA 1LEBA 3I4PA 2QWWA 2XAFA 2HGCA 4AVPA 1RI7A 2ZKZA 5LGNA 3CTAA 5IT9K 3GXOA 3GVAA 5H20A 4DQ2A 5FD5A 1K78B 2CQKA 1FBSA 4BQAA 3H92A 1Z9CA 2GQQA 3KP2A 4ZH4F 4LJZF 5ED4A 1XDSA 1W5SA 5ICEA 2L54A 3EYIA 3CO7C 1GXPA 3LWFA 1B59A 3EUHA 2W85A 3V7SA 1GXQA 2XKPA 4CGZA 3TO9A 2L02A 4AIHA 5FFXA 4EJOA 5CVVA 3K1NA 4MTEA 4XSZF 2L4MA 1QQIA 4JK1X 4S05A 2HDCA 5HLIA 5HLGA 1MZBA 3IC7A 4O5VA 1Z7UA 2Q0OA 3IHUA 1LNWA 4HV5A 1O7FA 1Y0UA 5L3EA 4I0AA 1R22A 2P5LC 3GEZA 4LLLA 4IPAA 3JSOA 1BI0A 2W25A 4WXCA 3FM5A 1G3YA 1FT9A 3L9FA 4AWXB 2FMYA 1T98A 2DBBA 4YFXF 4OINF 5E18F 3GO5A 5ICCA 1FYKA 3HRMA 3ZMZA 2Z33A 2ELHA 1HKTA 1J75A 2HQNA 4RS8A 1JXSA 5FGMA 1J2XA 2TDXA 5IT9Z 4CHUA 4ASNA 3GFJA 1H0MA 1B6AA 1ZREA 4IVNA 2F5CA 1IN4A 5FD6A 2B0LA 1O3SA 2COMA 1LJ9A 1O7LA 3CUQC 4XBFA 2XRNA 2OA4A 3LFKA 3EETA 1YW9A 3S2WA 3WTSC 3GUDA 3KETA 4NHJA 5E8IA 2A6HF 1YS6A 2FBIA 3QPTA 4L0YB 1I27A 1U8RA 4EGZA 2HZTA 1R58A 3E6DA 2MA3A 4UV8A 4JQFA 2PBIA 4FX4A 4S04A 3JSPA 3E6CC 5L3FA 3Q9VA 2VBXA 1W7PA 3QPHA 5E1XA 3E5XA 2BV6A 4AIKA 1W7PD 3JTGA 1YFHA 4U7BA 3JAMZ 2VE9A 3DPLC 1BI2A 3L7WA 2NNYA 1U2WA 4Q47A 2K7LA 4KIGA 1HKQA 5CVJA 2YX4A 1SAXA 3KCCA 3WU0A 3ULQB 4BHCA 4MGRA 2CG4A 2FBKA 3I53A 3JTHA 3MZYA 5D5UB 3DF8A 2DLLA 5LHIA 4ENMA 4LFUA 3O6BB 1R7JA 1RUNA 2HTJA 1OKRA 3E6BA 4EJWA 3VB2A 5KK1A 2FE3A 2K02A 2CSOA 1UHMA 2UXXA 3J80K 5TRDA 1F5TA 3R6SA 3J81K 4HQEA 3AAFA 1NHAA 3DV8A 5L3DA 1QZYA 1P4AA 1DUXC 1J5YA 3BROA 4YIFA 2H6CA 2QQAA 4A0XA 1P2FA 5L3GA 2WWYA 5EEGA 4GYIA 4WWCA 1AOYA 2RN7A 5D6EA 4U7DA 1IZ1A 5DYMA 2BGCA 1WKMA 4HDUA 4M9XA 4HX7A 3MEXA 3GFIA 1RIOH 4Y17A 2JPCA 3LA2A 5E20A 2KIMA 1FYLA 4HBLA 5AIQA 3H3ZA 4A0YA 4HF1A 2QZ8A 2ZNYA 2FEZA 3RPQA 3I54A 5HDNA 3Q9SA 5A2QK 2X0LA 5E1WA 3R60A 1OMIA 3DP7A 1WWXA 3IRQA 2FQ3A 3R0AA 2VXZA 4G7HF 2DAOA 2KKOA 3M8FA 4KDPA 2FU4A 5CJ9A 3WE3A 4ZYGA 1FZPB 2BE5F 5FLXK 4QWQA 5LRSA 3RPUA 4IRGA 1R5GA 1IXSB 3GF2A 3T8TA 2KJBA 1D8KA 2PG4A 1LVAA 3IRRA 4KMFA 3RDIA 2R7FA 5ICGA 2VN2A 4LG0A 4KICA 2QUFA 3IKTA 2W84A 3HYIA 3SQNA 3QAHA 2X4HA 1ZGAA 1IW7F 1XGSA 3MWMA 3N4MA 2M8EA 4WF2A 1W5TA 2XASA 2OQRA 3HTSB 2HKXA 2WV0A 3MZHA 1STZA 1U3EM 2FA5A 1YW7A 4Q4ZF 4XRFA 4LLNA 2PN6A 1ON1A 2F5FA 2VODA 2IRFG 4RGXA 4CDGA 2ACJA 1B4AA 3K69A 4O6JA 1BI3A 1EH8A 3DQVC 1HBXG 1AWCA 2XIGA 4JBAA 2ZMEA 2O61A 1O57A 3W6KB 2VE8A 1FSEA 2DPDA 4XLPF 5JR3A 4M6XA 5AIPA 4EQQA 4KN4X 1R1VA 2EWNA 1K78A 4A2UA 2DW4A 3B02A 1R23A 3L2CA 5HS9A 1TQPA 4DNCA 5BQTA 2PLYA 2EV0A 2V1XA 5HDKA 2GA2A 3C18A 4KIFA 1FC3A 2MLKA 3V7RA 1SD5A 3FHZA 3CLOA 3V8JA 2HYFA 2QQ9A 2DPUA 1QZZA 1FY7A 3KFWX 3FXUA 3M9AA 1F1ZA 2EFNA 2P6TA 3BY6A 1BOAA 5DCMB 4CYDA 1Z05A 3WTXC 3VEPA 3QP6A 1LB2A 2H09A 1Q1HA 3TKYA 1VTNC 2Z9OA 1ZLJA 1IN6A 1TNSA 2O8XA 4IHTA 1KU9A 2L3DA 4LK1F 5D6FA 1BJAA 1ULYA 2MD5A 5LLQA 3I58A 4YG2F 1KU2A 3RKXA 1HW2A 1KU3A 1XB4A 2XROA 2A3SA 2V6CA 5L3BA 4BNCA 3P9IA 5DD8A 1BI1A 2G7HA 4KUMA 1YS7A 3CJNA 4WX9A 1J59A 4M74A 1ZYRF 3I71A 1FWZA 2QQBA 2UWMA 3DEUA 5LHHA 3SZTA 1SMYF 4PGGA 3KEOA 4RB3C 4ON0A 2VBYA 1U5TB 5D4RA 1LEAA 5D8KB 4HW0A 3WTVC 1J0RA 1LDKB 2RQPA 2H94A 5CVIA 3OOPA 3VODA 4G94A 5JHUA 2H27A 2D2WA 1KQ0A 2RDPA 5BOXA 1HW1A 3LAPA 3RYPA 3ABUA 2DO7A 1U78A 3HTUA 2UXNA 4R79A 2V1UA 3F8CA 4G7ZF 5HS7A 3WTUC 1YQAA 2XAQA 4IXAA 3WGGA 3KEQA 3GWZA 4ENNA 1SFEA 1BBYA 2IA2A 3OV8A 4PGHA 4WXHA 2STTA 4KFCA 4XSXF 2YPRA 4ZYEA 2ZBKA 2DK8A 2GAUA 2K27A 4R1HA 4KN7X 2NRAC 4PZJA 3C7JA 2EFWA 4CXFA 3VFZA 1P92A 2IW5A 2PEXA 1JHFA 3WTYC 1MGTA 1BN5A 4EM2A 3HSRA 3P9CA 2O3FA 3COAC 5LBQA 2FBHA 2FSWA 2LKPA 5EEHA 2ISZA 4M72A 3ZN0A 2QBYB 1RUOA 3EQLF 1K6OA 2BEOA 3D5LA 2C6YA 1I6XA 4HF0A 4NQWA 3KP6A 4MHGA 1J9IA 3WTTC 1BIAA 3LA3A 5DDGA 2LNBA 1P4WA 4B8XA 3K1MA 3ISPA 3BJOA 5DCFA 4E70A 4MQVA 3IWZA 2JSCA 3R4KA 1D5VA 2NAZA 1XCBA 1UCRA 3SHFA 2VT2A 3M8EA 3F23A 3T0YA 4BH9A 4KMUX 3DXJF 1T38A 3LA7A 1TQIA 2XV4S 3E6MA 3R0JA 3ZMTA 5KVRA 2HR3A 5FO5A 2IA1A 2P7CB 2R7DA 2ESNA 3V4GA 2OQGA 3N97A 3F6VA 1ZRFA 3E5QA 4L9JA 2JPBA 4I02A 2L01A 4ZYHA 3GLXA 4N0BA 2VC0A 1E2XA 3NQOA 2FRHA 2VC1A 3L09A 2XAGA 4NB5A 1YG2A 3GFLA 3EYYA 2GXGA 3JW4A 2Y75A 4KNYA 1R00A 4WK8F 1X3UA 4LLGF 1PDNC 1KGSA 1MJAA 4LD5A 1S6LA 1TW3A 2JZYA 2M30A 4N9IA 2MC3A 1ODDA 2MH2A 5LGUA 1XSDA 4UXNA 3MQ0A 2P7VB 4FX0A 4L5JA 1T2KA 2XAHA 2HKOA 4KYWA 1MD0A 5J8CA 1IXCA 3QRFF 4EMSA 1DPUA 1XDUA 1ON2A 4M73A 2EFPA 4IHSA 2OZ6A 3VOEA 1RNLA 1T39A 4WCGA 3KE2A 5D5VB 3O3KA 5D8LB 5BMZA 3FZVA 2NS0A 3G73A 3ERED 1OPCA 2FMLA 2Z3YA 3BPVA 3FXQA 3V8KA 4GO1A 3IKVA 2WC2A 3DFGA 1BM9A 1DPRA 3KP4A 4OIRF 3PQJA 3ZPLA 2KRFA 4UVBA 2OZUA 1S29A 1YIOA 2ZCWA 1MDMB 5ILVA 1TTYA 3M1EA 1HXDA 3K2ZA 2RGVA 1R5HA 3QOPA 3I0TA 4IF4A 1L3LA 3F22A 2E1NA 4BHBA 2P5KA 1JGSA 2RC4A 1DP7P 3IL2A 2HFHA 1QPMA 3ZMSA 1QGPA 2QM3A 3M7GA 1ZGJA 1HW5A 4KA4A 2HS5A 4IRHA 2J5OA 5F64A 4TV7A 2D45A 3F6OA 4M71A 2UZKA 2Y48A 2R3SA 4U88A 3HSFA 1REPC 3GW2A 3GFMA 1I1GA 1W4MA 1XN7A 1QBJA 1USTA 2VBZA 4UHTA 1G4DA 1XMKA 2W57A 2M45A 3J80Z 3LAJA 3J81Z 4IRIA 2DI3A 3T5XA 5DCMA 3SFZA 3I64A 1T0FA 1O3RA 4CZZA 2DK5A 2F2EA 4QLCU 5JFRA 1FYMA 2EA4A 1FX7A 4HZFA 2G7UA 3I5UA 2QVOA 1LQ1A 1WQ2A 4BAYA 4YFKF 1HSTA 5CVUA 3ELKA 2V9VA 3WGIA 1FNNA 2E7WA 4EV0A 1JE8A 1XSXA 5LEKA 1HQCA 2GWRA 1GVJA 2KJCA 5LRRA 1ZHFA 2IJLA 4YIIA 1B9NA 4P96A 4D0PA 2FNPA 5A2QZ 1F4KA 1OYIA 4L0ZB 4HLXA 1V4RA 5DV5A 4WXDA 5H6RA 4Y13A 3RI4A 3WODF 3TOAA 1HSJA 1SD4A 4UVAA 4ZZDA 1U5TA 4ENKA 1MJBA 3KLOA 4P9UA 1T6SA 1IXRC 2ISYA 1IAWA 2M87A 5FLXZ 1ZH5A 3EDPA 3KP7A 2JRTA 4ZYDA 3K9TA 4RGSA 3BP8A 4P5OA 1R36A 1XD7A 2Q2EA 3HRSA 1IN8A 1I1SA 4RB1A 5AONA 2HYGD 3F21A 4HV6A 5DEQA 5IT3A 1ZRDA 3TO6A 1K7AA 2HEOA 2M1BA 5HOOA 3BPXA 3C1DA 1PUEE 1EV7A 1MKMA 1LDJA 3F8BA 2GZWA 4Z2YA 5BPDA 4UVCA 4MNUA 1SFUA 4G6DA 4O3MA 1IRFA 4H0EA 2EV5A 2CFXA 1YO5C 2YR2A 4Q5SF 2V79A 2CO5A 3GZ5A 5H6QA 4A12A 1H9GA 3ZQ7A 2VBWA 3BJ6A 4EM0B 1KYWA 4UNOA 4I2OA 5BPIA 2DT5A 1PP8F 2K4JA 4P55A 4A6EA 4HX4A 4OU0A 4LGWA 1IF1A 4U0VA 1FSHA 2O0YA 2RV8A 2QBYA 3O2PE 4EM1A 1YW8A 1GHCA 2XGXA 4ESJA 2CWEA 2OD5A 2JT1A 3W6JB 4M9SA 2MBFA 4PCQA 1OR7A 3KP3A 1TQMA 1U6GA 1SFXA 3BJAA 3KP5A 3KZYA 1O3QA 2DQLA 4L9TA 2LSOA 1XGNA 2D1VA 3ROUA 2FF4A 1I5ZA 1OYYA 4P9FA 4HA8A 3F8FA 5D5XB 4BYYA 3V7CA 1BC8C 5FFZA 2O03A 3IWFA 1FBUA 2A5YB 3U1DA 1Z91A 3F72A 1FP2A 3FF5A 5LGTA 4RGUA 3HRUA 4K2EA 1XSVA 3HOSA 2Z5UA 4I01A 2DFIA 1KU7A 2XHKA 1P4XA 2EJRA 2BBYA 3DPTA 4A5NA 4HX8A 2STWA 2KIFA 2ADUA 2JTVA 3DKWA 3KLNA 1IRGA 2GA1A 4L9VA 4U0YA 3BOQA 2RNJA 2ESHA 2FNAA 5CLSA 3C3WA 2YX7A 2WTEA 1K79A 3LQQA 2PQ8A 1DDNA 3CDHA 3TDZC 3RKYA 2Y0MA 4MEYF 2DU9A 4AIJA 3ZN1A 1BIBA 4M9ZA 1TNTA 4ESFA 2HTSA 2A69F 5LEJA 4ETSA 2OU2A 4L9NA 5DUIA 3PQKA 1QO0D 5J8FA 2G9WA 1H9TA 2XKOA 2LF8A 3JAMK 4A5MA 1EH6A 2IA0A 2LDUA 3FMRA 4OIPF 4BHPA 3FMSA 1CF7B 2P5VA 3FX3A 4I09A 3ZMVA 2LF7A 5E8GA 1ZRCA 4M6YA 3RIRA 2Z99A 4OMZA 1FPQA 3T8RA 5E17F 2ETHA 5JI6A 1USSA 3ZMDA 1S8NA 3WU1B 1D3YA 5CVRA 4I7HA 4XLNF 3FXRA 4EVIA 2IVMA 4KIBA 2VOOA 4MTDA 4GXOA 5D4SA 3G3ZA 2EB7A 4IJAA 1FOKA 1YLFA 2PI0A 1MDMA 5HDGA 3P9KA 4GYGA 4HOBA 4LB6B 1S7OA 3KZZA 1JHHA 3BDDA 2EK5A 1O3TA 4OIQF 3T1BA 2ZFWA 3F3XA 3F8MA 3SXYA 4OMYA 6PAXA 3RYRA 3CUQA 2VONA 1OYWA 5L3CA 3F8NA 2W24A 4RB2C 1S3JA 4ENJA 3I59A 2IT0A 2DQRA 2QLZA 1KQ8A 3U2RA 1B9MA 1G3SA 4FT8A 1KQ9A 2IP2A 3MFKA 3CO6C 4RAZA 4EGYA 3WE2A 4UV9A 4HDVA 2QYOA 4RAYA 5CYVA 2FOKA 1TW2A 2V1DA 4FHTA 3QU6A 1SMTA 3LSTA 1BC7C 3R61A 3HSEA 2VT3A 3HHGA 1Z6TA 4A0ZA 2IPQX 1XCVA 1QNTA 5J6XA 1G6NA 3MCZA 3ECHA 4A6DA 1R1UA 3HUGA 2HQRA 1TBXA 2F5EA 2NYXA 4HLYA 5TJJA 3L00A 3GX4X 1FBQA 3E97A 1TLHB 3D0SA 2MH9A 5ILUA 3K1PA 4PDKA 3REOA 4EJVA 2A61A 1L0OC 1R1TA 4G9YA 3HOTA 1YTYA 1SD6A 4Y15A 2HWVA 2EFQA 2RVCA 2K4BA 3MAJA 3SZPA 5HLHA 2AS5F 5K5OA 2EA2A 3TOBA 3ML6A 3U9GA 4BXUA 3BWGA 2QENA 4CO8A 3RTRA 4L5IA 4B09A 3CUQB 4OIOF 1ZG1A 3QU3A 1XMAA 3FWEA 1UHWA 3I59B 1KA8A 4UUVA 2CGPA 3NEUA 5K1YA 3NRVA 2PFBA 4EJUA 3WG9A 4LK0F 2DTRA 1W7PB 5JVTA 2P8TA 1RZ4A 1UFMA 4YFNF 5HS8A 4HYEA 1MJ9A 2F5DA 4HQMA 1CGPA 3WTZA 3B73A 2XUBA 3E5UA 2EFOA 5E1ZB 3J7AO 4ESBA 3ABTA 3RJPA 2OBPA 1ZG5A 2VOPA 1UB9A 2PMUA 1IUYA 1G3WA 2A68F 2XVCA 1Z6RA
chains in the Genus database with same CATH superfamily
1D8JA 1I6HJ 4KISA 4PJNA 1ZN2A 2NNNA 1J7KA 2KIQA 2ZO4A 2ZXWH 5F6FA 4A3FJ 1HKSA 1XGMA 5K7HA 2VLAA 1WSUA 3S1NJ 1ZARA 4KT5C 2CYYA 2LK2A 3CDLA 5F04A 4G8XA 2R5YA 3CP8A 2BYVE 2L4AA 5FKMA 2NVQJ 3FHNA 4DYRA 4B3AA 4RGRA 2Q8KA 2IS2A 3PFIA 3KYLA 4MEXF 5DD4A 3FMQA 3WTWC 2XAUA 5FKLA 1ZG3A 1YE9A 5CQGA 1FP1D 2NS7A 1OISA 3F9KA 5C3EJ 3CF5F 2TCTA 1MNEA 2V6EA 1F9NA 2DODA 3KYCB 1VQ6I 1U5TC 5K5RA 1VQ5I 4PJMA 4ZZLA 3M4OJ 3TGNA 4D7NA 1J09A 5HVQC 3WGHA 1H88C 1OCTC 4BJ5C 3FM3A 2YSRA 5FRMA 2EV6A 1WRJA 2L7KA 3HIFA 3CMEI 2P4WA 3GTLJ 3VYSB 2VJ4A 3FDYA 5EF6A 4N9HA 4CICA 2ZJ2A 2VQLA 2O6GE 3UR3C 2BOLA 5F0FA 3TO7A 4UUSA 4HF2A 2CUJA 2DJIA 5FB2A 2YU3A 4G6QA 4GGGA 5LHGA 1T33A 2M5WA 4A3MJ 3K70C 2OAZA 3QP5A 4DZJA 2RKHA 2WA0A 2WAEA 5F27A 4XRSA 2EIMH 4IQ4A 3EPZA 3SDBA 3TDUC 4HNUA 3HRTA 4LB5A 2K3FA 1S7AA 2V4JC 3BZ6A 3C2HA 1P6RA 2PMHA 3BZCA 2E7XA 5F1RA 1FIPA 2MLGA 3KIOA 2HVRA 4Y52J 1Y8QB 2DCEA 3PUBA 4I0BA 3OYBA 5J3LA 3K70D 3CUOA 4GCVA 1WI3A 2L5QA 2NXNB 3LSJA 2K9NA 3HHHA 1U9NA 3AG3H 2LY9A 3Q5FA 3FBNB 2PJRA 1KYZA 3RKWA 1ZAOA 4OAYA 4RB0A 1C0WA 1PUFA 1UAAA 1FLIA 2W4SA 5ILSA 1IN7A 4CA0A 1WJBA 3S1QJ 5DUKA 3BG9A 1ETXA 4PUSA 1UMQA 1ETQA 1SAUA 2CQXA 2VPLA 1FTTA 2CW0F 2ZXJA 2ZNZA 4NUBA 3TP3A 1SD7A 1B1BA 2GIZA 2E1CA 5DS9A 5IY5H 2LD5A 3A0HC 1Y1VJ 4M3FA 4LG0B 2A5WA 4HAMA 3TQNA 2UV1A 3GYHX 3A4CA 3V8LA 2P6SA 5C44J 2R7UA 2J5PA 3P7NA 3Q0WA 4R8HA 3BQZA 3HZJA 2DMUA 2OUMA 2KDOA 4XM3A 1A04A 3CC4I 3K4LA 2A6EF 1XGOA 2XAJA 2D1HA 2FXAA 3E3VA 5D5WB 4E6KG 3G6EI 2KIUA 2K86A 4G7OF 4CUGA 1GT0C 4F7ZA 5K5QA 3MKZA 2GIVA 1V3FA 2L7ZA 3ECOA 1MBKA 5ERIA 3ZMUA 1LDDA 2OV7A 3K0LA 5IP9J 3GZ6A 2GXBA 1Z1DA 3ABLH 2H6BA 4AD9A 2VASA 4OOIA 2KZVA 2HOEA 2DYSH 4Q48A 1AHDP 3ZP5A 5BS6A 1OR7C 4A3LJ 1G3TA 3LQRA 4IEJA 4F93B 4XOTA 2A07F 2HDDA 5EEAA 1ONVA 5KAFC 3H5RA 1E3PA 1YYVA 4U0WA 3H3UA 1SC7A 3TBIA 1PP7U 2DDAA 2MG4A 4YRVA 1IN5A 2QKMB 1CF7A 4L18B 4BQNA 2AXLA 2OJED 5ICFA 4A93J 4I98B 5H2FC 1EH7A 2ME6A 1LFUP 4MQ9F 1E17A 2AQEA 3RSNA 4C3HJ 1WI9A 3A1YA 4JX4A 4LMYA 4EJTA 1NK2P 3CJTB 2ZMEB 1UELB 4XN0A 1ZLKA 1A31A 2PJPA 4IHWA 5IYCJ 1LEBA 3I4PA 2QWWA 2XAFA 4E4HA 1LPQA 4M6VA 2HGCA 5FROA 1RI7A 4AVPA 1TWGJ 2ZKZA 5LGNA 3H0GJ 1F43A 3TL4X 4FETA 2QKLB 4QTRA 3CTAA 5IT9K 3EUAA 3GXOA 3QWLA 3ASNH 3GVAA 5H20A 2HNHA 4M3GA 4DQ2A 3BT9A 5FD5A 1K78B 3HGYA 2CQKA 1FBSA 3HL2A 4BQAA 3H92A 1Z9CA 2GQQA 2HOAA 3KP2A 2V26A 4LJZF 4ZH4F 5GTHC 1XDSA 1W5SA 4MO7A 5ED4A 3BR3A 1VQKI 3VWBA 3K2AA 5ICEA 4BBSJ 2DA6A 3BG5A 2L54A 3EYIA 3AKZA 3CO7C 1GXPA 2X6OA 3LWFA 5FJ8J 3HOZJ 3FISA 1B59A 3HOYJ 3HOUJ 3EUHA 5KAIC 2XGEA 2MC4A 2W85A 1E0EA 2E19A 3V7SA 2R7RA 1GXQA 2LP0A 2XKPA 5IYDJ 4CGZA 3TO9A 2L7MP 2L02A 5M5YJ 4AIHA 1RR8C 5FFXA 1O4XA 1VQ4I 4EJOA 3OSFA 3B6AA 5CVVA 3K1NA 1JUSA 4MTEA 4XSZF 2L4MA 4N4OB 4N4NB 1KONA 2Y30A 4A3EJ 1QQIA 2M0CA 4JK1X 4S05A 2VQGA 2X1DA 2DMNA 3WHCA 3RCOA 2HDCA 3K4JA 1IRZA 1X4PA 1YI2I 3JRGA 3SZGA 2XPWA 5HLIA 5HLGA 1MZBA 1TZLA 3IC7A 2HXIA 4O5VA 1Z7UA 3DTEA 2Q0OA 1K4TA 1JT6A 3IHUA 4V19K 1LNWA 4HV5A 1O7FA 1Y0UA 2NVYJ 5L3EA 1DQUA 4I0AA 1R22A 3BTCA 2P5LC 3AL0C 2HI3A 3S15J 3GEZA 4LLLA 4CCKA 4IPAA 3JSOA 2BY3A 1BI0A 2W25A 4WXCA 3HOXJ 1OCRH 3FM5A 4C3IJ 1MMGA 1G3YA 2DA3A 3BTIA 1E3OC 3ZQCA 2X6WA 1FT9A 3L9FA 4AWXB 2WAQA 2K85A 2FMYA 1T98A 4D7MA 2DBBA 4YFXF 4OINF 1TWFJ 5E18F 4D1QA 1V5GA 2OTLI 3GO5A 4DYCA 2I5UA 5ICCA 1FYKA 3HRMA 3B6CA 3GMEA 2KZGA 3ZMZA 2Z33A 2NS8A 3BR0A 2ELHA 1HKTA 4LIUA 1J75A 3L1PA 2CRGA 3VDXA 2KHMA 4L5EA 3OYAA 2HQNA 2GXAA 3O8HA 3J7ZI 4RS8A 1JXSA 2W1OA 5FGMA 3ZR8X 1R71A 1J2XA 2DTZA 2TDXA 3D5SC 1AKHA 5IT9Z 1H89C 3PSFA 4CHUA 4CCMA 2JJ7A 3DTIA 2CW7A 1NK3P 4ASNA 3OIOA 1BW6A 3GFJA 4QSHA 1B6AA 4PJLA 1H0MA 1ZREA 3W2WA 4HPQA 4IVNA 4A3CJ 2R7QA 2KISA 2F5CA 3DKXA 1IN4A 2LRDA 4UB6C 1GDTA 1UJ8A 5FD6A 3OL3A 2B0LA 1O3SA 3I9V2 3OYGA 2COMA 1LJ9A 3CESA 1V54H 5FKKA 2K3PA 1YJWI 3UNGC 1O7LA 2DOFA 2NOGA 4BUPA 3OYFA 3CUQC 3DEEA 2XRNA 2JMWA 4XBFA 2Z1DA 1JKOC 2R93J 2OA4A 4FQGA 2LMDA 3LFKA 3EETA 1YW9A 4XLHA 4XORA 3S2WA 3WTSC 3GCMA 3S8PA 3GUDA 3GLLA 2TRTA 1GVDA 5CPRB 3BR2A 1K6YA 2JN6A 1TT0A 3KETA 1ERDA 4NHJA 5E8IA 2DFHA 2A6HF 4BE0A 1YS6A 2FBIA 3QPTA 5E79C 2XF7A 5B66C 4L0YB 1I27A 2VKVA 4M3BA 1U8RA 4EGZA 3IH3A 2HZTA 1X1DA 1B8IA 1R58A 1ZR2A 4CCJA 3E6DA 4OAZA 4PJ0C 4AUXA 2MA3A 3NAUA 4UV8A 4JQFA 2PBIA 4FX4A 4II3A 1A35A 4S04A 3JSPA 3E6CC 4ANJA 1PJRA 2VUMJ 3OS0A 5L3FA 3Q9VA 2VBXA 1W7PA 3QPHA 1Z3YA 2V9PA 5E1XA 3E5XA 2IAIA 2BV6A 1MBJA 4AIKA 1W7PD 3JTGA 1YFHA 4U7BA 2B63J 3JAMZ 2VE9A 2AHQA 3DPLC 3ESWB 3HC7A 1BI2A 3L7WA 2XF6A 5B3SH 3A01B 2F6CA 2FX0A 2NNYA 3HOVJ 1U2WA 4Q47A 2K7LA 4KIGA 4QIWN 2H1LA 1HKQA 5CVJA 1SANA 3OYNA 2CQ7A 2YX4A 1SAXA 3OYJA 3KCCA 4XL9A 3WU0A 3ULQB 5IOYA 4BHCA 1W5CC 1Z7LA 2OPTA 4MGRA 5M3FJ 2CG4A 1RKWA 2FBKA 3I53A 1XC5A 5JLWA 4C3JJ 2LBFA 1GLNA 3JTHA 3MZYA 1D0XA 5D5UB 4NQWB 3DF8A 2DLLA 5LHIA 1HC8A 4ENMA 4LFUA 3O6BB 3MKWB 1R7JA 1MIJA 2V7FA 3W3CA 1RUNA 1DGWY 2HTJA 3JRAA 1OKRA 3E6BA 4E7HA 4EJWA 3VB2A 1WPKA 5KK1A 2XRLA 2FE3A 2K02A 1P9QC 1VNDA 2CSOA 2HOSA 1UHMA 2UXXA 3J80K 5TRDA 1DU0A 1F5TA 2XDVA 1Z21A 1M1EB 2Z16A 3R6SA 3J81K 2JWTA 4HQEA 2YS9A 3AAFA 4X6AJ 1NHAA 1BR4A 1I50J 2FD5A 3DV8A 3ZQFA 1YX5A 5L3DA 3ZCOA 1QZYA 1P4AA 3LNQA 1DUXC 3BG3A 1J5YA 4HG2A 3BROA 3NARA 5M3MJ 2CUZA 2AO9A 2CQNA 4XKVA 1W0UA 3I3LA 4YIFA 2H6CA 2QQAA 1JGGA 4A0XA 1P2FA 2LC2A 5B5EC 1AA7A 5L3GA 2WWYA 5EEGA 4GYIA 4B48A 4WWCA 1AOYA 2RN7A 3IAM2 5GAGJ 5D6EA 5FLMJ 4U7DA 1IZ1A 5DYMA 5EYRA 2BGCA 1WKMA 4HDUA 3K4CA 3DBHB 4M9XA 1P7JA 4HX7A 1X1BA 3MEXA 2EIKH 2GOMA 3GFIA 4Y17A 1RIOH 3C2GA 2JPCA 3LA2A 2B7EA 2KIMA 5E20A 1B72B 1FYLA 2XB5A 4HBLA 5AIQA 5M5WJ 1D1AA 5J1RA 1ZK8A 2O7OA 4D5CA 2HXOA 3H3ZA 4A0YA 4HF1A 5HNHA 1YJNI 2QZ8A 2ZNYA 3MMYB 2FEZA 4C2MJ 1IC8A 3RPQA 3I54A 3MKYB 5HDNA 3Q9SA 2BXYA 5A2QK 2BZTA 1U9OA 2X0LA 5E1WA 1QVUA 3R60A 1OMIA 3DP7A 3IH4A 1WWXA 3G1MA 1FIAA 3IRQA 2COBA 3FXKA 2FQ3A 2E2IJ 3R0AA 2VXZA 3BG7A 4G7HF 2AXTC 4XLFA 3GBGA 2DAOA 2MW8A 2KKOA 3M8FA 4KDPA 2HZDA 2FU4A 5E3MA 1IUFA 1WH5A 5CJ9A 3SDGA 4F3QA 3WE3A 4ZYGA 3VYTB 3ABMH 4LOCA 1FZPB 1EF4A 2BE5F 5FLXK 4QWQA 4IKFA 1XPXA 5LRSA 3FBIB 3RPUA 3HGGA 4IRGA 1R5GA 4NNJA 1IXSB 3GF2A 1CQTA 3T8TA 2X85A 3PM1A 3VYRB 4BL0B 2KJBA 1D8KA 1R6RA 2PG4A 2M3AA 1LVAA 2Y31A 3S1MJ 2FQ4A 3IRRA 1PYVA 4KMFA 3PFYA 2XSDC 3RDIA 2R7FA 5ICGA 2QQ8A 1RKTA 2VN2A 4LG0A 4KICA 2QUFA 4X1EA 4DZPA 3IKTA 1BJZA 1N75A 1UG2A 2W84A 3EUKL 3HYIA 3SQNA 3QAHA 2E5ZA 2X4HA 1ZGAA 1IW7F 4HNVA 1XGSA 4RM3A 1YX3A 3PO2J 2LOOA 3MWMA 2R7ZJ 1S5LC 1JUPA 2L7FP 2L9SA 4F52A 2M8EA 3N4MA 3BG6A 1FOYA 4KT6A 2DMPA 4WF2A 5LD2C 1MBGA 1W5TA 2XASA 1BOBA 2OQRA 3HTSB 1DP3A 1WZ2A 1IG7A 2HKXA 3HPHA 2L9RA 2WV0A 3OYLA 4RDUA 3MZHA 3CCJI 2Y2ZA 1X2MA 1STZA 2LY2A 3H9JA 4BY7J 4ZDPA 3JRDA 1U3EM 2FA5A 1YW7A 4Q4ZF 2ZC2A 2A6TA 4XRFA 2PN6A 1ON1A 1VFCA 1Y1WJ 2F5FA 4LLNA 4CH7A 2VODA 3BTLA 2IRFG 4RGXA 4CDGA 3LSMA 3TP0A 5GPAA 2Z2SB 2ECBA 4GRIA 4NC6A 4J19A 2ACJA 3TMOA 3Q3SA 1B4AA 1S9HA 3K69A 4PSWA 4O6JA 2V9KA 1BI3A 1EH8A 3K6GA 4NDLA 2GBYA 1X19A 3DQVC 5TISC 3OR1C 1HBXG 1AWCA 2R7OA 1JKPC 2XIGA 3HBLA 2R7TA 4JBAA 2ZMEA 5GPCA 4BQOA 2N8GA 3DBLB 2O61A 3DEWA 1O57A 4A3IJ 2E34A 3W6KB 2VE8A 1FSEA 3PNTA 2DXIA 2DPDA 4XLPF 1Y6IA 2O8KA 1RETA 2ME0A 4XKBA 5JR3A 4M6XA 5AIPA 4EQQA 1V5FA 2JVHA 4KN4X 3BR5A 1R1VA 1D1CA 3DTKA 1XG1A 2EWNA 1HLVA 3LFUA 3JCUC 1K78A 1LFPA 2KRCA 1WJDA 4A2UA 5K7ZA 1MNMC 4I99C 5DM7F 2DW4A 3B02A 1R23A 2EZIA 2HU9A 3DLLF 3L2CA 3CD6I 5HS9A 1TQPA 4DNCA 2KMUA 3GTMJ 3FK7A 5BQTA 4X0GA 2PLYA 2EV0A 2V1XA 5HDKA 2ZJRF 2CJJA 2XSJC 5DTDA 2GA2A 3C18A 3IAS2 4KIFA 2DYRH 2X9DA 3HXLA 1FC3A 2MLKA 3V7RA 1SD5A 3FHZA 4XRSG 3CLOA 3V8JA 2HYFA 2QQ9A 4YIRX 4BU2A 2DPUA 3ERMA 3RZDJ 1QZZA 2D5VA 4MFDA 1FY7A 3KFWX 3FXUA 3K4KA 3M9AA 2OTJI 3G1LA 2R7VA 1F1ZA 2EFNA 2P6TA 3BY6A 1BOAA 5DCMB 4BBRJ 3M07A 4AU7A 4XK4A 1DU6A 4CYDA 2P0WA 1JJ8C 2ZJQF 1Z05A 3LSRA 1WGXA 3S14J 3WTXC 3VEPA 3QYEA 1QRYA 3QP6A 3QQAA 1LB2A 1A6IA 2H09A 1Q1HA 3TKYA 4RM2A 5F1JA 2QSFX 1VTNC 3MD2A 2Z9OA 4XQFA 4HSRA 5K7FA 1ZLJA 1IN6A 1VQOI 1TNSA 2ID6A 3CMMA 3IUOA 2O8XA 2VKHA 2VKDA 1R49A 1KU9A 4U87A 2L3DA 4LK1F 4IHTA 5D6FA 1BJAA 1ULYA 2MD5A 2E36A 2IXSA 5LLQA 4V2GA 2VJJA 3I58A 2M4KA 4YG2F 5FKNA 3ZQQA 3S3NA 1TP4A 1KU2A 3HG9A 4A3DJ 3RKXA 2HPMA 1UZCA 1HW2A 1K4SA 1TL8A 1KU3A 1XB4A 2XROA 2A3SA 4FCYA 2V6CA 5L3BA 4BNCA 3P9IA 5DD8A 1BI1A 3H5NA 3PNVA 2G7HA 4KUMA 2KL4A 1XMXA 2M34A 1YS7A 3CJNA 5CKTA 4YELA 1SVMA 3OY9A 5B1AH 4WX9A 1QZEA 2F48A 4M74A 1J59A 4V2FA 2EPFA 1ZYRF 3LSKA 3I71A 1IJWC 4NC8A 1FWZA 2QQBA 4PFPA 2UWMA 5GTIC 2WY7Q 3DEUA 5LHHA 3SZTA 1SMYF 4PGGA 3KEOA 4RB3C 3CC7I 4ON0A 2R5ZA 3W6VA 2VBYA 4BQQA 1WFXA 3CCSI 3QYFA 2H8WA 1U5TB 5D4RA 1LKXA 4CSWA 3L2WA 1LEAA 5D8KB 4H4KC 2JVGA 4HW0A 5KCMA 3WTVC 1J0RA 1LDKB 5FRNA 2RQPA 1IDYA 1U8BA 2H94A 2E1OA 5FLVA 5CVIA 3OOPA 2NOJB 3LSIA 3PNYA 3VODA 3EUHC 2WAQN 4IQJA 4G94A 1NTCA 5JHUA 2H27A 2D2WA 1KQ0A 1TC3C 2RDPA 2X51A 5BOXA 3HM5A 1HW1A 3D5RC 1TWAJ 3LAPA 2Q2EB 3RYPA 1JUMA 3ABUA 4PSXA 3L2VA 2JUCA 5LFAA 2DO7A 2Q1ZB 2M9HA 1U78A 4BY1J 4G12A 3TW7A 3HTUA 2UXNA 4R79A 2V1UA 2F5VA 2GOXB 3F8CA 4G7ZF 3OL4A 1R4NB 2PMZA 3ZQGA 3FKIJ 5HS7A 3WTUC 3Q0VA 3IP4B 1YQAA 3HEFA 2XAQA 3LSGA 4HEA2 4IXAA 3KEQA 4OWRB 3GWZA 3WGGA 4Y7NJ 4ENNA 3CJRB 1OLTA 1SFEA 1BBYA 2IA2A 3PL8A 4CCLA 3OV8A 4PGHA 2KDZA 4WXHA 2STTA 4KFCA 4XSXF 2ZXIA 1FEXA 2YPRA 1G8XA 4IL6C 4ZYEA 2ZBKA 2DK8A 2VB6A 3CQZJ 4LIVA 2GAUA 3GTOJ 2K27A 4R1HA 4KN7X 1LE8B 2NRAC 4PZJA 1RPWA 3C7JA 1Z67A 2EFWA 3QOEA 2QCOA 1D5YA 4CXFA 1P92A 2IW5A 3VFZA 2PEXA 1JHFA 4CYCA 3WTYC 3K4MA 3FXOA 1W36C 1ACIA 1MGTA 1BN5A 1ORKA 4EM2A 3HSRA 3P9CA 3A01A 5EZHA 2O3FA 3COAC 4BJTA 2DA5A 5LBQA 5GADJ 2FBHA 2FSWA 2LKPA 2B9SA 1UHSA 1X4OA 1SVLA 3BZKA 5EEHA 3CCQI 1XTAA 2ISZA 4M72A 3ZN0A 2EILH 2IEKA 1ETVA 2QBYB 1HOMA 1RUOA 4A69C 2XF5A 3EQLF 1ZKGA 1K6OA 1I3AA 2LR8A 2BEOA 3D5LA 2C6YA 3UKGA 1I6XA 4HF0A 4NQWA 3KP6A 4MHGA 1J9IA 3WTTC 1MMDA 4F91B 4IHXA 3SEQA 1BIAA 3LA3A 5DDGA 2LNBA 3QYBA 1P4WA 3WHBA 4B8XA 1EA3A 2KT0A 2R7WA 3K1MA 3ISPA 2R5ZB 3BJOA 5DCFA 2DT7B 4E70A 4MQVA 1JTYA 3IWZA 2WAFA 2JSCA 3H1CA 3R4KA 1D5VA 2NAZA 1XCBA 2JSPA 1WJAA 4QPQA 2YU9J 1IDZA 1I3QJ 2WB1A 1UCRA 4JX6A 3JREA 3SHFA 2E1MC 2G0EA 3JRBA 4F55A 1MH3A 2VT2A 2R7XA 3OMYA 3M8EA 3F23A 3T0YA 4XLCA 2VL8A 4BH9A 4KMUX 2ID3A 3DXJF 3CP2A 1T38A 3LA7A 1TQIA 2K9LA 2XV4S 4DJAA 3E6MA 3R0JA 1X3WB 4HNTA 3ZMTA 5KVRA 1HF0A 2HR3A 5FO5A 3ZQHA 3AG1H 1V5EA 2IA1A 2EINH 2R7DA 2ESNA 3V4GA 2P7CB 3QPLA 2OQGA 3CCLI 3N97A 4F92B 3F6VA 1ZRFA 3E5QA 2DMTA 4A3BJ 2X6XA 3D1NI 3IV5A 4L9JA 3OS2A 1VQMI 2JPBA 2IS6A 2K9MA 4RLFA 4I02A 2L01A 4ZYHA 1JT0A 3KZIC 3GLXA 1G2HA 4N0BA 2VC0A 1B72A 1T08B 1E2XA 2HVSA 4AYBA 3NQOA 2FRHA 5IP6A 2VC1A 1D1BA 1MSFC 3FXMA 4I6ZA 3L09A 2XAGA 1POGA 4NB5A 1YG2A 3LSHA 3GFLA 1OCPA 3EYYA 1X3ZB 4C2UA 1Y56A 5HODA 2GXGA 3JW4A 2Y75A 4KNYA 2JA8J 1R00A 2NVTJ 1ITYA 4WK8F 3H9QA 1U0JA 1X3UA 4LLGF 1PDNC 1TWHJ 4IOAF 3U1KA 1KGSA 4E7LA 4CYCB 1MJAA 2HQ5A 4LD5A 1S6LA 1TW3A 2JZYA 5C4JJ 3HKZN 2M30A 4BJ6C 3BCAA 2R4GA 3C2BA 3FXLA 4N9IA 2MC3A 5E3NA 3J7AY 1ODDA 2MH2A 2BHZA 5TGTA 5LGUA 1RESA 1XSDA 3M8JA 4UXNA 3MQ0A 2P7VB 2IGMA 4FX0A 4L5JA 4XIDA 1T2KA 2XAHA 1LFBA 4E7IA 2HKOA 2XGDA 4KYWA 1MD0A 5J8CA 4ZTJA 1IXCA 3QRFF 2E71A 4EMSA 1DPUA 1XDUA 2NVXJ 2MYSA 1ON2A 2E2JJ 2R7SA 4M73A 1ZQ3P 2LREA 2EFPA 3H0DA 2A05A 4IHSA 3AL0B 3I4MJ 1FOXA 2OZ6A 3OYKA 3VOEA 3OR2C 3F0CA 1RNLA 4Y33A 2CU7A 3K4BA 2DJNA 3H36A 1T39A 4WCGA 3MKLA 1IRXA 3KE2A 5D5VB 5HLTA 1OFCX 3H5AA 3DU6A 4JOMA 3O3KA 5D8LB 1BL0A 5BMZA 3PIPF 4B44A 4XOPA 4NBQA 3LMMA 3FZVA 2NS0A 2ELJA 3G73A 2LTPA 2JA6J 1IV8A 3ERED 1OPCA 2FMLA 1I39A 2BY1A 5JVGF 2Z3YA 2E60A 2Y9YA 2CV0A 1N77A 1MNDA 3BPVA 1IGNA 3FXQA 3V8KA 5EZGA 1YIJI 2ZXHA 3GTPJ 4GO1A 3IKVA 2WC2A 3DFGA 1BM9A 1DPRA 4BXXJ 3KP4A 1X58A 4OIRF 3PQJA 3ZPLA 3K10A 4HRIA 2KRFA 4UVBA 4ZDOA 1HDPA 2VXDA 1S29A 2K5CA 2EH3A 1YIOA 2OZUA 1QA6A 1A36A 2IS4A 3SFIA 2ZCWA 1MDMB 5ILVA 1TTYA 2EBIA 4BE1A 3M1EA 2HQAA 4ZC3A 3FK6A 3CJQB 4IHVA 4RMNA 1Q1VA 2DOAA 1YJ9I 2MSYA 1HXDA 3K2ZA 2RGVA 1G59A 1R5HA 3BR6A 1QHHD 1FTZA 3VSKA 3RQ4A 3BCBA 3QOPA 2QA4I 2K9QA 3I0TA 4IF4A 3H35A 4JYKA 4XMYA 1L3LA 3F22A 2DA4A 2E1NA 4BHBA 2P5KA 4A3JJ 1JGSA 2RC4A 1MMSA 1DP7P 3IL2A 2HFHA 1QPMA 3HB9A 3S93A 3ZMSA 1QGPA 2QM3A 3M7GA 1ZGJA 3NWTA 1R4MB 3BC8A 4DOZA 3S3OA 3FXJA 1HW5A 1WJFA 1SFKA 5IPAA 4KA4A 2HS5A 3MVPA 2GM4A 4IRHA 2J5OA 2QSGX 4LG3A 5F64A 4TV7A 4DBRA 2D45A 4RBOA 3F6OA 2FJ1A 4M71A 2LVSA 2UZKA 2Y48A 3SJMA 1Y0NA 2R3SA 4U88A 3HSFA 1REPC 2E5NA 1T8IA 2VJ5A 3GW2A 2XC7A 3GFMA 1I1GA 1ZR4A 1W4MA 4E7KA 3OYIA 1XN7A 2F4MB 1QBJA 1USTA 2XPVA 3RPUD 2VBZA 4UHTA 1QHGA 3ZQLA 2DA7A 4FE4A 1G4DA 1GV2A 1XMKA 2W57A 2M45A 4BEHB 3CCVI 1X1PA 1WJ5A 2X1CA 3J80Z 1Y39A 3LAJA 2XGCA 3J81Z 4IRIA 3L2RA 3E7LA 2Y9ZA 3HUGB 2DI3A 3T5XA 4BGDA 1XX5A 1W0TA 5DCMA 5J1UA 2EZLA 3HJEA 1WH7A 5GP9A 1OCOH 1KZHA 1JJ6C 2DA1A 3SFZA 2WV1A 3I64A 2VQHA 4JX5A 4PFOA 5GAEJ 1T0FA 1O3RA 1TWCJ 4CZZA 2DK5A 2L0KA 3A02A 1P7IA 1X1AA 2F2EA 4ITVA 4QLCU 5JFRA 2IS1A 1FYMA 3W2AA 2DDBA 2IGOA 2EA4A 1FX7A 2JA5J 2KP6A 4HZFA 2G7UA 3I5UA 2QVOA 1LQ1A 1WQ2A 2Y69H 4J01A 4BAYA 4ZTFA 2AQFA 4YFKF 1HSTA 1BR2A 3VYUB 5J47A 5JLXA 5CVUA 3ELKA 4E7ZA 2V9VA 3WGIA 1K83J 1FNNA 3SYTA 2E7WA 4EV0A 1JE8A 1XSXA 1RC9A 1K61A 5LEKA 1HQCA 2GWRA 2LKSA 5EGOB 5IYBJ 4QPOA 4MFEA 1WHUA 2M7AA 4EEFG 1N78A 2CH0A 2ZMEC 1GVJA 2KJCA 4JP0A 1OJLA 4FISA 1MMAA 2MD0A 5LRRA 1ZHFA 2IJLA 3CCMI 4YIIA 1B9NA 4XRMA 1ZELA 4P96A 4D0PA 2FNPA 5A2QZ 4XLEA 1F4KA 1OYIA 4L0ZB 1FJLA 4HLXA 1V4RA 5DV5A 3SEZA 1NG6A 4WXDA 5H6RA 4Y13A 3RI4A 2DFEA 2VJIA 5DM6F 3WODF 3OS1A 3TOAA 1HSJA 1SD4A 4RAGA 4UVAA 4ZZDA 2Y0SA 5C4XJ 1U5TA 2WADA 4ENKA 5JHFA 1MJBA 3KLOA 4FE7A 3RQIA 3RKQA 1T6SA 4P9UA 1IXRC 3JRIA 2ISYA 1IAWA 1MSEC 2DT6A 2M87A 2OC6A 5FLXZ 1ZH5A 4IO9F 3H3VK 3EDPA 3KP7A 2JRTA 3LOCA 2LLKA 4ZYDA 4PJJA 3K9TA 4RGSA 3BP8A 5F0HA 4P5OA 2ICWG 2MGQA 1R36A 1XD7A 2Q2EA 3HRSA 1IN8A 3L2UA 4XKCA 1I1SA 4RB1A 1VQPI 5AONA 1X2NA 2HYGD 3F21A 4HV6A 1Z0XA 5DEQA 3BTJA 5IT3A 1NG7A 1ZRDA 2DN0A 9ANTA 3CZ6A 3TO6A 1FMVA 1K7AA 1HDDC 2HEOA 2M1BA 2YUSA 3BPXA 3C1DA 3DKYA 5HOOA 1PUEE 1EV7A 1NH3A 2M0MA 4HSTA 1MKMA 2BW3B 3CC2I 3TW6A 2CUFA 1RR7A 3VSLA 1LDJA 3KEYA 3ZXSA 1EJ9A 2P81A 3F8BA 3QPSA 2GZWA 2JK3A 1GUUA 2OCCH 1WJEA 1A6QA 4UVCA 4Z2YA 4MNUA 5BPDA 4G6DA 1SFUA 4O3MA 1IRFA 3ABKH 4H0EA 1DGRM 2EV5A 2CFXA 1LE8A 1YO5C 2CV1A 4DIQA 2YR2A 5IOZA 3S32A 4Q5SF 2V79A 2CO5A 3GZ5A 5H6QA 4A12A 1H9GA 3ZQ7A 2VBWA 3BJ6A 1ZGWA 4EM0B 3M1CA 1KYWA 2VI6A 4M3DA 4UNOA 4I2OA 4A3KJ 1GV5A 5BPIA 4BACA 1BR1A 2LFBA 2DT5A 1BA5A 1PP8F 2VPRA 3JRFA 2K4JA 4P55A 2MABA 4A6EA 3CDIA 1VQ9I 4HX4A 3Q0UA 4OU0A 4LGWA 1JTXA 4BXFA 2R5YB 1IF1A 1UG0A 3HPGA 3I4NJ 3I55I 2I8DA 4U0VA 1FSHA 2PMZN 2WY8Q 2O0YA 2QEXI 2RV8A 4BKXA 2E2HJ 3H9GA 3O2PE 4W97A 3A0BC 2QBYA 4EM1A 5E3OA 3KPHA 4D5FA 1YW8A 1GHCA 4AM3A 1JKQC 3S2DJ 2XGXA 2K40A 4UB8C 3E0JB 1HCRA 2GLOA 4ESJA 3CMAI 2M8GX 2CWEA 1T56A 2CS3A 2OD5A 4B3XA 1HA8A 2JT1A 2EIJH 2KQRA 3W6JB 4M9SA 4B4CA 2EQRA 2MBFA 4PCQA 1OR7A 3KP3A 1TQMA 1U6GA 1SFXA 3BJAA 4FASD 3KP5A 4G6TB 2M2EA 1YITI 3S3MA 3MN2A 3BQYA 2L9VA 3KZYA 5M5XJ 1O3QA 2DQLA 4L9TA 1LVKA 2LSOA 2IGNA 1XGNA 1V55H 2D1VA 4UUSB 3ROUA 4M3EA 2FF4A 1I5ZA 1OYYA 4ZDLA 4P9FA 2ZJPF 4HA8A 3F8FA 5D5XB 4BYYA 2DFFA 3V7CA 1BC8C 5FFZA 2O03A 4D9JA 3J7YJ 3IWFA 4E7SA 2ZB9A 1FBUA 3CCRI 2W7NA 1FOWA 2A5YB 3U1DA 1Z91A 2X6YA 3F72A 1FP2A 3FF5A 5LGTA 3OWTA 4RGUA 3HRUA 4K2EA 1XSVA 3HOSA 2Z5UA 1BW5A 3CMYA 3U21A 4I01A 3FKJA 3AG2H 2DFIA 1WVRA 1KU7A 2PJRB 1MH4A 2K9SA 4XKWA 4GDFA 4E7JA 1PUFB 2XHKA 1MW7A 1P4XA 2EJRA 2BBYA 5FKOA 2VKEA 2QGUA 3DPTA 4A5NA 3GTGJ 4HX8A 4CCOA 1JKRC 2UUZA 3GTKJ 2STWA 2KIFA 2LG4A 2ADUA 2JTVA 2H8RA 3I56I 3DKWA 3KLNA 2WB1N 1IRGA 2F4IA 2GA1A 4L9VA 3GZNB 3PO3J 3K4NA 4U0YA 1MMNA 3BOQA 4AVZA 2RAEA 2RNJA 2RREA 3QODA 3OIQA 4AC0A 2ESHA 2FNAA 4EATA 5CLSA 4RLQA 1VF9A 3C3WA 2YX7A 2RQQA 4XN3A 2NVUB 2JA7J 1ETKA 5B1BH 3G4SI 2WTEA 1K79A 3LQQA 3OIPA 4Z6YA 1QU3A 3PUFA 2PQ8A 3KYDB 3CDHA 1DDNA 3S2HJ 3TDZC 3RKYA 4P1WA 2Y0MA 4UUTA 4MEYF 2DA2A 2DU9A 4AIJA 1D0YA 3ZN1A 3O8GA 4AIDA 1BIBA 3AG4H 4YEJA 1D0ZA 2M4GA 4M9ZA 1TNTA 2E35A 4ESFA 5IP7J 4IZZA 2HTSA 1W36D 2HOTA 3W2VA 2A69F 2QF7A 1ETOA 5LEJA 1W1WE 1RRJA 2M7BA 4ETSA 2OU2A 4L9NA 4J00A 1JI8A 5DUIA 3PQKA 1QO0D 4AYBN 4C2TA 2MFZA 5J8FA 2LKXA 2G9WA 1YRNA 1H9TA 2XKOA 2LF8A 3JAMK 2HDWA 4A5MA 4BDYA 1EH6A 4MLOA 2IA0A 2LDUA 3VPRA 3FMRA 4OIPF 4IX7A 4BHPA 3FMSA 1CF7B 1F36A 2P5VA 5BNGA 3FX3A 4I09A 3ZMVA 2LF7A 5E8GA 1ZRCA 2ZFUA 4M6YA 1R9TJ 2XB0X 3G1OA 2W82A 3RIRA 3WG7H 3ZQIA 2H1KA 1ZTRA 2BVMA 2BY0A 2F4OB 2R92J 2Z99A 4OMZA 3OSGA 1VI0A 1FPQA 5F08A 2EZKA 2VQCA 3CF2A 3T8RA 1Y8RB 5E17F 2ETHA 5JI6A 2KLOA 1USSA 3ZMDA 1S8NA 2IGKA 3WU1B 1D3YA 3LSPA 3A03A 3JRHA 3ZRGA 2BY2A 5CVRA 1VQ7I 4I7HA 3DU5A 4XLNF 5CQEA 3FXRA 4EVIA 2IVMA 4KIBA 2VOOA 4MTDA 4GXOA 5D4SA 4GFBA 3G3ZA 2EB7A 4IJAA 5J40A 1FOKA 3S1RJ 2ZSHB 2DMQA 1YLFA 2PI0A 3K7AJ 5HDGA 4CZCA 1MDMA 1E3HA 3OYEA 3P9KA 5EJCA 2X48A 4GYGA 1OCZH 3CLQA 2VIXA 4ABZA 4B43A 4HOBA 3G2BA 4LB6B 1S7OA 2CW8A 4S0HB 3BR1A 3KZZA 1JHHA 3BDDA 1OQYA 2I10A 4I76A 2EK5A 1O3TA 2JUGA 2V1NA 3OYCA 4OIQF 3T1BA 3PSIA 2HVQA 2CFOA 2ZFWA 2O5RA 2ECCA 3F3XA 3F8MA 4NC7A 2FUG2 4W1UA 5EDNA 3SXYA 4OMYA 3A2KA 6PAXA 3RYRA 2FOWA 2W00A 3CUQA 2JA2A 3CCEI 2VONA 3ZOBA 1OYWA 2XPUA 3L2QA 2LY1A 5L3CA 1R5ID 3F8NA 2W24A 4RB2C 1S3JA 4ENJA 3I59A 2OCEA 2IT0A 1APLC 3JR9A 2DQRA 2QLZA 1KQ8A 4XR6A 3U2RA 1B9MA 1G3SA 4FT8A 3GTQJ 1KQ9A 5KNLA 4BS9A 3PJRA 2IP2A 3MFKA 3CO6C 4RAZA 4EGYA 1LUJB 2RNGA 3WE2A 3WU2C 3E1SA 2LH9A 2PX9A 2JRMA 2ELKA 4UV9A 1SVOA 1AU7A 2KRHA 3KX2A 4HDVA 2JQ7A 2QYOA 3ZGKA 3RZOJ 3AFHA 4RAYA 2EZHA 3TEDA 5CYVA 4ZYAA 5KHDA 1VQLI 2FOKA 1TW2A 2V1DA 3X2QH 4FHTA 1YRNB 3QU6A 1SMTA 1QPIA 2OF7A 3LSTA 1BC7C 3R61A 2O9LA 3DBRB 4BEHA 4KITB 3HSEA 4ZJZA 2VT3A 3HHGA 1Z6TA 4A0ZA 4DYQA 5J1YA 2IPQX 3PIOF 1XCVA 2CUEA 1QNTA 5J6XA 1G6NA 3MCZA 3ECHA 4A6DA 4DBQA 3HOWJ 1R1UA 3LL7A 3HUGA 4XICA 2HQRA 1TBXA 3DLAA 2F5EA 5EG0A 2BXZA 2KFDA 3DPUA 2NYXA 4HLYA 1OCCH 2BVLA 5TJJA 4FTHA 4A3GJ 1H8AC 3L00A 4LITA 3GX4X 1FBQA 3E97A 1TLHB 3BLYA 1AKHB 3D0SA 3OYHA 3S17J 3N05A 3JRCA 1EKEA 2MH9A 4UY8I 5ILUA 3K1PA 4PDKA 3REOA 4EJVA 3ONQA 1MBEA 2R0QC 2A61A 3IH2A 5J4YA 1ETWA 2WBMA 1L0OC 2L2OA 1R1TA 4G9YA 4XLAA 4C9YA 3HOTA 4RAFA 1N25A 2QSHX 1YTYA 3S16J 1SD6A 4Y15A 3V42A 1ETYA 2HWVA 2EFQA 2RVCA 2K4BA 3GTJJ 5EGOA 2KPMA 1T95A 3M3YJ 3MAJA 3SZPA 5F0CA 3NWSA 1VQNI 5HLHA 2AS5F 1FMWA 5K5OA 2EA2A 2BHYA 2E1MB 3TOBA 3HKZA 4CCNA 3ML6A 1S72I 3U9GA 4BXUA 3BWGA 1YOVB 1VZ0A 2QENA 1Z77A 2IBDA 4CO8A 4DGWB 3RTRA 2ZSIB 4L5IA 2DOEA 4BDZA 4XONA 4B09A 3CUQB 3CCUI 4OIOF 1ZG1A 3DWLE 3FIWA 3QU3A 1XMAA 3FWEA 1UHWA 3I59B 5HNFA 1KA8A 1SEUA 4IHYA 4XNFA 1S7EA 1WJCA 1B8IB 4UUVA 1MBFA 2CGPA 3NEUA 5K1YA 5J4VA 1QVTA 2W48A 2CV2A 3NRVA 2LYCA 2PFBA 4KJZA 2CMPA 4EJUA 1X1CA 4II2A 3WG9A 3OOUA 4LK0F 1SFOJ 1ENHA 2L9NA 4RA2A 3HDDA 2DTRA 1W7PB 3MZ8A 4Y4RA 5JVTA 2P8TA 1RZ4A 1UFMA 2HPIA 3ASOH 4YFNF 4B1RA 1WCMJ 5HS8A 1XS9A 5E3LA 4HYEA 1MJ9A 2F5DA 1VQ8I 4HQMA 1CGPA 4C30A 4BE2A 3WTZA 1A5JA 1Z3XA 1IO2A 5GAHJ 1T0FC 2CQQA 3B73A 4DW6A 3P5JA 2XUBA 3E5UA 2EFOA 5E1ZB 3J7AO 2BW3A 1MBHA 2LBFB 3G71I 2Y0SN 3OYDA 3DCFA 5EG0B 3ABTA 4ESBA 3RJPA 2OBPA 1ZG5A 4PK4A 1TT5B 2VOPA 1UB9A 2PMUA 1IV6A 1IUYA 4MIMA 1PVEA 4B47A 1G3WA 2HYJA 2A68F 1YHQI 4IOCF 2X1EA 4Y3OA 2XVCA 1Z6RA 3CCYA 3OYMA
chains in the Genus database with same CATH topology
1D8JA 1ZN2A 2NNNA 1J7KA 5F6FA 2ZO4A 1HKSA 1XGMA 1WSUA 1ZARA 4KT5C 2CYYA 4G8XA 2BYVE 2L4AA 4RGRA 2Q8KA 3PFIA 4MEXF 5DD4A 3FMQA 3WTWC 1ZG3A 1FP1D 1F9NA 1U5TC 5K5RA 4ZZLA 3TGNA 5HVQC 3WGHA 3FM3A 2YSRA 2EV6A 1WRJA 3HIFA 2P4WA 4N9HA 4CICA 2ZJ2A 2O6GE 3TO7A 4HF2A 5FB2A 2YU3A 4G6QA 4GGGA 5LHGA 2M5WA 2OAZA 3QP5A 2RKHA 3TDUC 3HRTA 4LB5A 1S7AA 3BZ6A 1P6RA 2PMHA 2E7XA 5F1RA 2MLGA 4I0BA 3CUOA 4GCVA 3HHHA 3Q5FA 1KYZA 3RKWA 1ZAOA 4RB0A 1C0WA 1FLIA 5ILSA 1IN7A 5DUKA 2CW0F 2ZXJA 2ZNZA 1SD7A 1B1BA 2E1CA 4LG0B 4HAMA 3TQNA 3GYHX 3V8LA 2P6SA 2J5PA 3P7NA 4R8HA 1A04A 2A6EF 1XGOA 2XAJA 2D1HA 2FXAA 3E3VA 5D5WB 2KIUA 2K86A 4G7OF 4F7ZA 5K5QA 2GIVA 1V3FA 3ECOA 3ZMUA 5ERIA 1LDDA 3K0LA 3GZ6A 2GXBA 1Z1DA 2H6BA 4AD9A 4OOIA 2HOEA 4Q48A 3ZP5A 5BS6A 1G3TA 3LQRA 2A07F 1ONVA 1YYVA 4U0WA 3H3UA 1PP7U 1IN5A 1CF7A 4L18B 2AXLA 5ICFA 4I98B 1EH7A 4MQ9F 1E17A 1WI9A 4LMYA 4EJTA 2ZMEB 1ZLKA 2PJPA 1LEBA 3I4PA 2QWWA 2XAFA 2HGCA 4AVPA 1RI7A 2ZKZA 5LGNA 3CTAA 5IT9K 3GXOA 3GVAA 5H20A 4DQ2A 5FD5A 1K78B 2CQKA 1FBSA 4BQAA 3H92A 1Z9CA 2GQQA 3KP2A 4ZH4F 4LJZF 5ED4A 1XDSA 1W5SA 5ICEA 2L54A 3EYIA 3CO7C 1GXPA 3LWFA 1B59A 3EUHA 2W85A 3V7SA 1GXQA 2XKPA 4CGZA 3TO9A 2L02A 4AIHA 5FFXA 4EJOA 5CVVA 3K1NA 4MTEA 4XSZF 2L4MA 1QQIA 4JK1X 4S05A 2HDCA 5HLIA 5HLGA 1MZBA 3IC7A 4O5VA 1Z7UA 2Q0OA 3IHUA 1LNWA 4HV5A 1O7FA 1Y0UA 5L3EA 4I0AA 1R22A 2P5LC 3GEZA 4LLLA 4IPAA 3JSOA 1BI0A 2W25A 4WXCA 3FM5A 1G3YA 1FT9A 3L9FA 4AWXB 2FMYA 1T98A 2DBBA 4YFXF 4OINF 5E18F 3GO5A 5ICCA 1FYKA 3HRMA 3ZMZA 2Z33A 2ELHA 1HKTA 1J75A 2HQNA 4RS8A 1JXSA 5FGMA 1J2XA 2TDXA 5IT9Z 4CHUA 4ASNA 3GFJA 1H0MA 1B6AA 1ZREA 4IVNA 2F5CA 1IN4A 5FD6A 2B0LA 1O3SA 2COMA 1LJ9A 1O7LA 3CUQC 4XBFA 2XRNA 2OA4A 3LFKA 3EETA 1YW9A 3S2WA 3WTSC 3GUDA 3KETA 4NHJA 5E8IA 2A6HF 1YS6A 2FBIA 3QPTA 4L0YB 1I27A 1U8RA 4EGZA 2HZTA 1R58A 3E6DA 2MA3A 4UV8A 4JQFA 2PBIA 4FX4A 4S04A 3JSPA 3E6CC 5L3FA 3Q9VA 2VBXA 1W7PA 3QPHA 5E1XA 3E5XA 2BV6A 4AIKA 1W7PD 3JTGA 1YFHA 4U7BA 3JAMZ 2VE9A 3DPLC 1BI2A 3L7WA 2NNYA 1U2WA 4Q47A 2K7LA 4KIGA 1HKQA 5CVJA 2YX4A 1SAXA 3KCCA 3WU0A 3ULQB 4BHCA 4MGRA 2CG4A 2FBKA 3I53A 3JTHA 3MZYA 5D5UB 3DF8A 2DLLA 5LHIA 4ENMA 4LFUA 3O6BB 1R7JA 1RUNA 2HTJA 1OKRA 3E6BA 4EJWA 3VB2A 5KK1A 2FE3A 2K02A 2CSOA 1UHMA 2UXXA 3J80K 5TRDA 1F5TA 3R6SA 3J81K 4HQEA 3AAFA 1NHAA 3DV8A 5L3DA 1QZYA 1P4AA 1DUXC 1J5YA 3BROA 4YIFA 2H6CA 2QQAA 4A0XA 1P2FA 5L3GA 2WWYA 5EEGA 4GYIA 4WWCA 1AOYA 2RN7A 5D6EA 4U7DA 1IZ1A 5DYMA 2BGCA 1WKMA 4HDUA 4M9XA 4HX7A 3MEXA 3GFIA 1RIOH 4Y17A 2JPCA 3LA2A 5E20A 2KIMA 1FYLA 4HBLA 5AIQA 3H3ZA 4A0YA 4HF1A 2QZ8A 2ZNYA 2FEZA 3RPQA 3I54A 5HDNA 3Q9SA 5A2QK 2X0LA 5E1WA 3R60A 1OMIA 3DP7A 1WWXA 3IRQA 2FQ3A 3R0AA 2VXZA 4G7HF 2DAOA 2KKOA 3M8FA 4KDPA 2FU4A 5CJ9A 3WE3A 4ZYGA 1FZPB 2BE5F 5FLXK 4QWQA 5LRSA 3RPUA 4IRGA 1R5GA 1IXSB 3GF2A 3T8TA 2KJBA 1D8KA 2PG4A 1LVAA 3IRRA 4KMFA 3RDIA 2R7FA 5ICGA 2VN2A 4LG0A 4KICA 2QUFA 3IKTA 2W84A 3HYIA 3SQNA 3QAHA 2X4HA 1ZGAA 1IW7F 1XGSA 3MWMA 3N4MA 2M8EA 4WF2A 1W5TA 2XASA 2OQRA 3HTSB 2HKXA 2WV0A 3MZHA 1STZA 1U3EM 2FA5A 1YW7A 4Q4ZF 4XRFA 4LLNA 2PN6A 1ON1A 2F5FA 2VODA 2IRFG 4RGXA 4CDGA 2ACJA 1B4AA 3K69A 4O6JA 1BI3A 1EH8A 3DQVC 1HBXG 1AWCA 2XIGA 4JBAA 2ZMEA 2O61A 1O57A 3W6KB 2VE8A 1FSEA 2DPDA 4XLPF 5JR3A 4M6XA 5AIPA 4EQQA 4KN4X 1R1VA 2EWNA 1K78A 4A2UA 2DW4A 3B02A 1R23A 3L2CA 5HS9A 1TQPA 4DNCA 5BQTA 2PLYA 2EV0A 2V1XA 5HDKA 2GA2A 3C18A 4KIFA 1FC3A 2MLKA 3V7RA 1SD5A 3FHZA 3CLOA 3V8JA 2HYFA 2QQ9A 2DPUA 1QZZA 1FY7A 3KFWX 3FXUA 3M9AA 1F1ZA 2EFNA 2P6TA 3BY6A 1BOAA 5DCMB 4CYDA 1Z05A 3WTXC 3VEPA 3QP6A 1LB2A 2H09A 1Q1HA 3TKYA 1VTNC 2Z9OA 1ZLJA 1IN6A 1TNSA 2O8XA 4IHTA 1KU9A 2L3DA 4LK1F 5D6FA 1BJAA 1ULYA 2MD5A 5LLQA 3I58A 4YG2F 1KU2A 3RKXA 1HW2A 1KU3A 1XB4A 2XROA 2A3SA 2V6CA 5L3BA 4BNCA 3P9IA 5DD8A 1BI1A 2G7HA 4KUMA 1YS7A 3CJNA 4WX9A 1J59A 4M74A 1ZYRF 3I71A 1FWZA 2QQBA 2UWMA 3DEUA 5LHHA 3SZTA 1SMYF 4PGGA 3KEOA 4RB3C 4ON0A 2VBYA 1U5TB 5D4RA 1LEAA 5D8KB 4HW0A 3WTVC 1J0RA 1LDKB 2RQPA 2H94A 5CVIA 3OOPA 3VODA 4G94A 5JHUA 2H27A 2D2WA 1KQ0A 2RDPA 5BOXA 1HW1A 3LAPA 3RYPA 3ABUA 2DO7A 1U78A 3HTUA 2UXNA 4R79A 2V1UA 3F8CA 4G7ZF 5HS7A 3WTUC 1YQAA 2XAQA 4IXAA 3WGGA 3KEQA 3GWZA 4ENNA 1SFEA 1BBYA 2IA2A 3OV8A 4PGHA 4WXHA 2STTA 4KFCA 4XSXF 2YPRA 4ZYEA 2ZBKA 2DK8A 2GAUA 2K27A 4R1HA 4KN7X 2NRAC 4PZJA 3C7JA 2EFWA 4CXFA 3VFZA 1P92A 2IW5A 2PEXA 1JHFA 3WTYC 1MGTA 1BN5A 4EM2A 3HSRA 3P9CA 2O3FA 3COAC 5LBQA 2FBHA 2FSWA 2LKPA 5EEHA 2ISZA 4M72A 3ZN0A 2QBYB 1RUOA 3EQLF 1K6OA 2BEOA 3D5LA 2C6YA 1I6XA 4HF0A 4NQWA 3KP6A 4MHGA 1J9IA 3WTTC 1BIAA 3LA3A 5DDGA 2LNBA 1P4WA 4B8XA 3K1MA 3ISPA 3BJOA 5DCFA 4E70A 4MQVA 3IWZA 2JSCA 3R4KA 1D5VA 2NAZA 1XCBA 1UCRA 3SHFA 2VT2A 3M8EA 3F23A 3T0YA 4BH9A 4KMUX 3DXJF 1T38A 3LA7A 1TQIA 2XV4S 3E6MA 3R0JA 3ZMTA 5KVRA 2HR3A 5FO5A 2IA1A 2P7CB 2R7DA 2ESNA 3V4GA 2OQGA 3N97A 3F6VA 1ZRFA 3E5QA 4L9JA 2JPBA 4I02A 2L01A 4ZYHA 3GLXA 4N0BA 2VC0A 1E2XA 3NQOA 2FRHA 2VC1A 3L09A 2XAGA 4NB5A 1YG2A 3GFLA 3EYYA 2GXGA 3JW4A 2Y75A 4KNYA 1R00A 4WK8F 1X3UA 4LLGF 1PDNC 1KGSA 1MJAA 4LD5A 1S6LA 1TW3A 2JZYA 2M30A 4N9IA 2MC3A 1ODDA 2MH2A 5LGUA 1XSDA 4UXNA 3MQ0A 2P7VB 4FX0A 4L5JA 1T2KA 2XAHA 2HKOA 4KYWA 1MD0A 5J8CA 1IXCA 3QRFF 4EMSA 1DPUA 1XDUA 1ON2A 4M73A 2EFPA 4IHSA 2OZ6A 3VOEA 1RNLA 1T39A 4WCGA 3KE2A 5D5VB 3O3KA 5D8LB 5BMZA 3FZVA 2NS0A 3G73A 3ERED 1OPCA 2FMLA 2Z3YA 3BPVA 3FXQA 3V8KA 4GO1A 3IKVA 2WC2A 3DFGA 1BM9A 1DPRA 3KP4A 4OIRF 3PQJA 3ZPLA 2KRFA 4UVBA 2OZUA 1S29A 1YIOA 2ZCWA 1MDMB 5ILVA 1TTYA 3M1EA 1HXDA 3K2ZA 2RGVA 1R5HA 3QOPA 3I0TA 4IF4A 1L3LA 3F22A 2E1NA 4BHBA 2P5KA 1JGSA 2RC4A 1DP7P 3IL2A 2HFHA 1QPMA 3ZMSA 1QGPA 2QM3A 3M7GA 1ZGJA 1HW5A 4KA4A 2HS5A 4IRHA 2J5OA 5F64A 4TV7A 2D45A 3F6OA 4M71A 2UZKA 2Y48A 2R3SA 4U88A 3HSFA 1REPC 3GW2A 3GFMA 1I1GA 1W4MA 1XN7A 1QBJA 1USTA 2VBZA 4UHTA 1G4DA 1XMKA 2W57A 2M45A 3J80Z 3LAJA 3J81Z 4IRIA 2DI3A 3T5XA 5DCMA 3SFZA 3I64A 1T0FA 1O3RA 4CZZA 2DK5A 2F2EA 4QLCU 5JFRA 1FYMA 2EA4A 1FX7A 4HZFA 2G7UA 3I5UA 2QVOA 1LQ1A 1WQ2A 4BAYA 4YFKF 1HSTA 5CVUA 3ELKA 2V9VA 3WGIA 1FNNA 2E7WA 4EV0A 1JE8A 1XSXA 5LEKA 1HQCA 2GWRA 1GVJA 2KJCA 5LRRA 1ZHFA 2IJLA 4YIIA 1B9NA 4P96A 4D0PA 2FNPA 5A2QZ 1F4KA 1OYIA 4L0ZB 4HLXA 1V4RA 5DV5A 4WXDA 5H6RA 4Y13A 3RI4A 3WODF 3TOAA 1HSJA 1SD4A 4UVAA 4ZZDA 1U5TA 4ENKA 1MJBA 3KLOA 4P9UA 1T6SA 1IXRC 2ISYA 1IAWA 2M87A 5FLXZ 1ZH5A 3EDPA 3KP7A 2JRTA 4ZYDA 3K9TA 4RGSA 3BP8A 4P5OA 1R36A 1XD7A 2Q2EA 3HRSA 1IN8A 1I1SA 4RB1A 5AONA 2HYGD 3F21A 4HV6A 5DEQA 5IT3A 1ZRDA 3TO6A 1K7AA 2HEOA 2M1BA 5HOOA 3BPXA 3C1DA 1PUEE 1EV7A 1MKMA 1LDJA 3F8BA 2GZWA 4Z2YA 5BPDA 4UVCA 4MNUA 1SFUA 4G6DA 4O3MA 1IRFA 4H0EA 2EV5A 2CFXA 1YO5C 2YR2A 4Q5SF 2V79A 2CO5A 3GZ5A 5H6QA 4A12A 1H9GA 3ZQ7A 2VBWA 3BJ6A 4EM0B 1KYWA 4UNOA 4I2OA 5BPIA 2DT5A 1PP8F 2K4JA 4P55A 4A6EA 4HX4A 4OU0A 4LGWA 1IF1A 4U0VA 1FSHA 2O0YA 2RV8A 2QBYA 3O2PE 4EM1A 1YW8A 1GHCA 2XGXA 4ESJA 2CWEA 2OD5A 2JT1A 3W6JB 4M9SA 2MBFA 4PCQA 1OR7A 3KP3A 1TQMA 1U6GA 1SFXA 3BJAA 3KP5A 3KZYA 1O3QA 2DQLA 4L9TA 2LSOA 1XGNA 2D1VA 3ROUA 2FF4A 1I5ZA 1OYYA 4P9FA 4HA8A 3F8FA 5D5XB 4BYYA 3V7CA 1BC8C 5FFZA 2O03A 3IWFA 1FBUA 2A5YB 3U1DA 1Z91A 3F72A 1FP2A 3FF5A 5LGTA 4RGUA 3HRUA 4K2EA 1XSVA 3HOSA 2Z5UA 4I01A 2DFIA 1KU7A 2XHKA 1P4XA 2EJRA 2BBYA 3DPTA 4A5NA 4HX8A 2STWA 2KIFA 2ADUA 2JTVA 3DKWA 3KLNA 1IRGA 2GA1A 4L9VA 4U0YA 3BOQA 2RNJA 2ESHA 2FNAA 5CLSA 3C3WA 2YX7A 2WTEA 1K79A 3LQQA 2PQ8A 1DDNA 3CDHA 3TDZC 3RKYA 2Y0MA 4MEYF 2DU9A 4AIJA 3ZN1A 1BIBA 4M9ZA 1TNTA 4ESFA 2HTSA 2A69F 5LEJA 4ETSA 2OU2A 4L9NA 5DUIA 3PQKA 1QO0D 5J8FA 2G9WA 1H9TA 2XKOA 2LF8A 3JAMK 4A5MA 1EH6A 2IA0A 2LDUA 3FMRA 4OIPF 4BHPA 3FMSA 1CF7B 2P5VA 3FX3A 4I09A 3ZMVA 2LF7A 5E8GA 1ZRCA 4M6YA 3RIRA 2Z99A 4OMZA 1FPQA 3T8RA 5E17F 2ETHA 5JI6A 1USSA 3ZMDA 1S8NA 3WU1B 1D3YA 5CVRA 4I7HA 4XLNF 3FXRA 4EVIA 2IVMA 4KIBA 2VOOA 4MTDA 4GXOA 5D4SA 3G3ZA 2EB7A 4IJAA 1FOKA 1YLFA 2PI0A 1MDMA 5HDGA 3P9KA 4GYGA 4HOBA 4LB6B 1S7OA 3KZZA 1JHHA 3BDDA 2EK5A 1O3TA 4OIQF 3T1BA 2ZFWA 3F3XA 3F8MA 3SXYA 4OMYA 6PAXA 3RYRA 3CUQA 2VONA 1OYWA 5L3CA 3F8NA 2W24A 4RB2C 1S3JA 4ENJA 3I59A 2IT0A 2DQRA 2QLZA 1KQ8A 3U2RA 1B9MA 1G3SA 4FT8A 1KQ9A 2IP2A 3MFKA 3CO6C 4RAZA 4EGYA 3WE2A 4UV9A 4HDVA 2QYOA 4RAYA 5CYVA 2FOKA 1TW2A 2V1DA 4FHTA 3QU6A 1SMTA 3LSTA 1BC7C 3R61A 3HSEA 2VT3A 3HHGA 1Z6TA 4A0ZA 2IPQX 1XCVA 1QNTA 5J6XA 1G6NA 3MCZA 3ECHA 4A6DA 1R1UA 3HUGA 2HQRA 1TBXA 2F5EA 2NYXA 4HLYA 5TJJA 3L00A 3GX4X 1FBQA 3E97A 1TLHB 3D0SA 2MH9A 5ILUA 3K1PA 4PDKA 3REOA 4EJVA 2A61A 1L0OC 1R1TA 4G9YA 3HOTA 1YTYA 1SD6A 4Y15A 2HWVA 2EFQA 2RVCA 2K4BA 3MAJA 3SZPA 5HLHA 2AS5F 5K5OA 2EA2A 3TOBA 3ML6A 3U9GA 4BXUA 3BWGA 2QENA 4CO8A 3RTRA 4L5IA 4B09A 3CUQB 4OIOF 1ZG1A 3QU3A 1XMAA 3FWEA 1UHWA 3I59B 1KA8A 4UUVA 2CGPA 3NEUA 5K1YA 3NRVA 2PFBA 4EJUA 3WG9A 4LK0F 2DTRA 1W7PB 5JVTA 2P8TA 1RZ4A 1UFMA 4YFNF 5HS8A 4HYEA 1MJ9A 2F5DA 4HQMA 1CGPA 3WTZA 3B73A 2XUBA 3E5UA 2EFOA 5E1ZB 3J7AO 4ESBA 3ABTA 3RJPA 2OBPA 1ZG5A 2VOPA 1UB9A 2PMUA 1IUYA 1G3WA 2A68F 2XVCA 1Z6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8J A;  1ZN2 A;  2NNN A;  1J7K A;  5F6F A;  2ZO4 A;  1HKS A;  1XGM A;  1WSU A;  1ZAR A;  4KT5 C;  2CYY A;  4G8X A;  2BYV E;  2L4A A;  4RGR A;  2Q8K A;  3PFI A;  4MEX F;  5DD4 A;  3FMQ A;  3WTW C;  1ZG3 A;  1FP1 D;  1F9N A;  1U5T C;  5K5R A;  4ZZL A;  3TGN A;  5HVQ C;  3WGH A;  3FM3 A;  2YSR A;  2EV6 A;  1WRJ A;  3HIF A;  2P4W A;  4N9H A;  4CIC A;  2ZJ2 A;  2O6G E;  3TO7 A;  4HF2 A;  5FB2 A;  2YU3 A;  4G6Q A;  4GGG A;  5LHG A;  2M5W A;  2OAZ A;  3QP5 A;  2RKH A;  3TDU C;  3HRT A;  4LB5 A;  1S7A A;  3BZ6 A;  1P6R A;  2PMH A;  2E7X A;  5F1R A;  2MLG A;  4I0B A;  3CUO A;  4GCV A;  3HHH A;  3Q5F A;  1KYZ A;  3RKW A;  1ZAO A;  4RB0 A;  1C0W A;  1FLI A;  5ILS A;  1IN7 A;  5DUK A;  2CW0 F;  2ZXJ A;  2ZNZ A;  1SD7 A;  1B1B A;  2E1C A;  4LG0 B;  4HAM A;  3TQN A;  3GYH X;  3V8L A;  2P6S A;  2J5P A;  3P7N A;  4R8H A;  1A04 A;  2A6E F;  1XGO A;  2XAJ A;  2D1H A;  2FXA A;  3E3V A;  5D5W B;  2KIU A;  2K86 A;  4G7O F;  4F7Z A;  5K5Q A;  2GIV A;  1V3F A;  3ECO A;  3ZMU A;  5ERI A;  1LDD A;  3K0L A;  3GZ6 A;  2GXB A;  1Z1D A;  2H6B A;  4AD9 A;  4OOI A;  2HOE A;  4Q48 A;  3ZP5 A;  5BS6 A;  1G3T A;  3LQR A;  2A07 F;  1ONV A;  1YYV A;  4U0W A;  3H3U A;  1PP7 U;  1IN5 A;  1CF7 A;  4L18 B;  2AXL A;  5ICF A;  4I98 B;  1EH7 A;  4MQ9 F;  1E17 A;  1WI9 A;  4LMY A;  4EJT A;  2ZME B;  1ZLK A;  2PJP A;  1LEB A;  3I4P A;  2QWW A;  2XAF A;  2HGC A;  4AVP A;  1RI7 A;  2ZKZ A;  5LGN A;  3CTA A;  5IT9 K;  3GXO A;  3GVA A;  5H20 A;  4DQ2 A;  5FD5 A;  1K78 B;  2CQK A;  1FBS A;  4BQA A;  3H92 A;  1Z9C A;  2GQQ A;  3KP2 A;  4ZH4 F;  4LJZ F;  5ED4 A;  1XDS A;  1W5S A;  5ICE A;  2L54 A;  3EYI A;  3CO7 C;  1GXP A;  3LWF A;  1B59 A;  3EUH A;  2W85 A;  3V7S A;  1GXQ A;  2XKP A;  4CGZ A;  3TO9 A;  2L02 A;  4AIH A;  5FFX A;  4EJO A;  5CVV A;  3K1N A;  4MTE A;  4XSZ F;  2L4M A;  1QQI A;  4JK1 X;  4S05 A;  2HDC A;  5HLI A;  5HLG A;  1MZB A;  3IC7 A;  4O5V A;  1Z7U A;  2Q0O A;  3IHU A;  1LNW A;  4HV5 A;  1O7F A;  1Y0U A;  5L3E A;  4I0A A;  1R22 A;  2P5L C;  3GEZ A;  4LLL A;  4IPA A;  3JSO A;  1BI0 A;  2W25 A;  4WXC A;  3FM5 A;  1G3Y A;  1FT9 A;  3L9F A;  4AWX B;  2FMY A;  1T98 A;  2DBB A;  4YFX F;  4OIN F;  5E18 F;  3GO5 A;  5ICC A;  1FYK A;  3HRM A;  3ZMZ A;  2Z33 A;  2ELH A;  1HKT A;  1J75 A;  2HQN A;  4RS8 A;  1JXS A;  5FGM A;  1J2X A;  2TDX A;  5IT9 Z;  4CHU A;  4ASN A;  3GFJ A;  1H0M A;  1B6A A;  1ZRE A;  4IVN A;  2F5C A;  1IN4 A;  5FD6 A;  2B0L A;  1O3S A;  2COM A;  1LJ9 A;  1O7L A;  3CUQ C;  4XBF A;  2XRN A;  2OA4 A;  3LFK A;  3EET A;  1YW9 A;  3S2W A;  3WTS C;  3GUD A;  3KET A;  4NHJ A;  5E8I A;  2A6H F;  1YS6 A;  2FBI A;  3QPT A;  4L0Y B;  1I27 A;  1U8R A;  4EGZ A;  2HZT A;  1R58 A;  3E6D A;  2MA3 A;  4UV8 A;  4JQF A;  2PBI A;  4FX4 A;  4S04 A;  3JSP A;  3E6C C;  5L3F A;  3Q9V A;  2VBX A;  1W7P A;  3QPH A;  5E1X A;  3E5X A;  2BV6 A;  4AIK A;  1W7P D;  3JTG A;  1YFH A;  4U7B A;  3JAM Z;  2VE9 A;  3DPL C;  1BI2 A;  3L7W A;  2NNY A;  1U2W A;  4Q47 A;  2K7L A;  4KIG A;  1HKQ A;  5CVJ A;  2YX4 A;  1SAX A;  3KCC A;  3WU0 A;  3ULQ B;  4BHC A;  4MGR A;  2CG4 A;  2FBK A;  3I53 A;  3JTH A;  3MZY A;  5D5U B;  3DF8 A;  2DLL A;  5LHI A;  4ENM A;  4LFU A;  3O6B B;  1R7J A;  1RUN A;  2HTJ A;  1OKR A;  3E6B A;  4EJW A;  3VB2 A;  5KK1 A;  2FE3 A;  2K02 A;  2CSO A;  1UHM A;  2UXX A;  3J80 K;  5TRD A;  1F5T A;  3R6S A;  3J81 K;  4HQE A;  3AAF A;  1NHA A;  3DV8 A;  5L3D A;  1QZY A;  1P4A A;  1DUX C;  1J5Y A;  3BRO A;  4YIF A;  2H6C A;  2QQA A;  4A0X A;  1P2F A;  5L3G A;  2WWY A;  5EEG A;  4GYI A;  4WWC A;  1AOY A;  2RN7 A;  5D6E A;  4U7D A;  1IZ1 A;  5DYM A;  2BGC A;  1WKM A;  4HDU A;  4M9X A;  4HX7 A;  3MEX A;  3GFI A;  1RIO H;  4Y17 A;  2JPC A;  3LA2 A;  5E20 A;  2KIM A;  1FYL A;  4HBL A;  5AIQ A;  3H3Z A;  4A0Y A;  4HF1 A;  2QZ8 A;  2ZNY A;  2FEZ A;  3RPQ A;  3I54 A;  5HDN A;  3Q9S A;  5A2Q K;  2X0L A;  5E1W A;  3R60 A;  1OMI A;  3DP7 A;  1WWX A;  3IRQ A;  2FQ3 A;  3R0A A;  2VXZ A;  4G7H F;  2DAO A;  2KKO A;  3M8F A;  4KDP A;  2FU4 A;  5CJ9 A;  3WE3 A;  4ZYG A;  1FZP B;  2BE5 F;  5FLX K;  4QWQ A;  5LRS A;  3RPU A;  4IRG A;  1R5G A;  1IXS B;  3GF2 A;  3T8T A;  2KJB A;  1D8K A;  2PG4 A;  1LVA A;  3IRR A;  4KMF A;  3RDI A;  2R7F A;  5ICG A;  2VN2 A;  4LG0 A;  4KIC A;  2QUF A;  3IKT A;  2W84 A;  3HYI A;  3SQN A;  3QAH A;  2X4H A;  1ZGA A;  1IW7 F;  1XGS A;  3MWM A;  3N4M A;  2M8E A;  4WF2 A;  1W5T A;  2XAS A;  2OQR A;  3HTS B;  2HKX A;  2WV0 A;  3MZH A;  1STZ A;  1U3E M;  2FA5 A;  1YW7 A;  4Q4Z F;  4XRF A;  4LLN A;  2PN6 A;  1ON1 A;  2F5F A;  2VOD A;  2IRF G;  4RGX A;  4CDG A;  2ACJ A;  1B4A A;  3K69 A;  4O6J A;  1BI3 A;  1EH8 A;  3DQV C;  1HBX G;  1AWC A;  2XIG A;  4JBA A;  2ZME A;  2O61 A;  1O57 A;  3W6K B;  2VE8 A;  1FSE A;  2DPD A;  4XLP F;  5JR3 A;  4M6X A;  5AIP A;  4EQQ A;  4KN4 X;  1R1V A;  2EWN A;  1K78 A;  4A2U A;  2DW4 A;  3B02 A;  1R23 A;  3L2C A;  5HS9 A;  1TQP A;  4DNC A;  5BQT A;  2PLY A;  2EV0 A;  2V1X A;  5HDK A;  2GA2 A;  3C18 A;  4KIF A;  1FC3 A;  2MLK A;  3V7R A;  1SD5 A;  3FHZ A;  3CLO A;  3V8J A;  2HYF A;  2QQ9 A;  2DPU A;  1QZZ A;  1FY7 A;  3KFW X;  3FXU A;  3M9A A;  1F1Z A;  2EFN A;  2P6T A;  3BY6 A;  1BOA A;  5DCM B;  4CYD A;  1Z05 A;  3WTX C;  3VEP A;  3QP6 A;  1LB2 A;  2H09 A;  1Q1H A;  3TKY A;  1VTN C;  2Z9O A;  1ZLJ A;  1IN6 A;  1TNS A;  2O8X A;  4IHT A;  1KU9 A;  2L3D A;  4LK1 F;  5D6F A;  1BJA A;  1ULY A;  2MD5 A;  5LLQ A;  3I58 A;  4YG2 F;  1KU2 A;  3RKX A;  1HW2 A;  1KU3 A;  1XB4 A;  2XRO A;  2A3S A;  2V6C A;  5L3B A;  4BNC A;  3P9I A;  5DD8 A;  1BI1 A;  2G7H A;  4KUM A;  1YS7 A;  3CJN A;  4WX9 A;  1J59 A;  4M74 A;  1ZYR F;  3I71 A;  1FWZ A;  2QQB A;  2UWM A;  3DEU A;  5LHH A;  3SZT A;  1SMY F;  4PGG A;  3KEO A;  4RB3 C;  4ON0 A;  2VBY A;  1U5T B;  5D4R A;  1LEA A;  5D8K B;  4HW0 A;  3WTV C;  1J0R A;  1LDK B;  2RQP A;  2H94 A;  5CVI A;  3OOP A;  3VOD A;  4G94 A;  5JHU A;  2H27 A;  2D2W A;  1KQ0 A;  2RDP A;  5BOX A;  1HW1 A;  3LAP A;  3RYP A;  3ABU A;  2DO7 A;  1U78 A;  3HTU A;  2UXN A;  4R79 A;  2V1U A;  3F8C A;  4G7Z F;  5HS7 A;  3WTU C;  1YQA A;  2XAQ A;  4IXA A;  3WGG A;  3KEQ A;  3GWZ A;  4ENN A;  1SFE A;  1BBY A;  2IA2 A;  3OV8 A;  4PGH A;  4WXH A;  2STT A;  4KFC A;  4XSX F;  2YPR A;  4ZYE A;  2ZBK A;  2DK8 A;  2GAU A;  2K27 A;  4R1H A;  4KN7 X;  2NRA C;  4PZJ A;  3C7J A;  2EFW A;  4CXF A;  3VFZ A;  1P92 A;  2IW5 A;  2PEX A;  1JHF A;  3WTY C;  1MGT A;  1BN5 A;  4EM2 A;  3HSR A;  3P9C A;  2O3F A;  3COA C;  5LBQ A;  2FBH A;  2FSW A;  2LKP A;  5EEH A;  2ISZ A;  4M72 A;  3ZN0 A;  2QBY B;  1RUO A;  3EQL F;  1K6O A;  2BEO A;  3D5L A;  2C6Y A;  1I6X A;  4HF0 A;  4NQW A;  3KP6 A;  4MHG A;  1J9I A;  3WTT C;  1BIA A;  3LA3 A;  5DDG A;  2LNB A;  1P4W A;  4B8X A;  3K1M A;  3ISP A;  3BJO A;  5DCF A;  4E70 A;  4MQV A;  3IWZ A;  2JSC A;  3R4K A;  1D5V A;  2NAZ A;  1XCB A;  1UCR A;  3SHF A;  2VT2 A;  3M8E A;  3F23 A;  3T0Y A;  4BH9 A;  4KMU X;  3DXJ F;  1T38 A;  3LA7 A;  1TQI A;  2XV4 S;  3E6M A;  3R0J A;  3ZMT A;  5KVR A;  2HR3 A;  5FO5 A;  2IA1 A;  2P7C B;  2R7D A;  2ESN A;  3V4G A;  2OQG A;  3N97 A;  3F6V A;  1ZRF A;  3E5Q A;  4L9J A;  2JPB A;  4I02 A;  2L01 A;  4ZYH A;  3GLX A;  4N0B A;  2VC0 A;  1E2X A;  3NQO A;  2FRH A;  2VC1 A;  3L09 A;  2XAG A;  4NB5 A;  1YG2 A;  3GFL A;  3EYY A;  2GXG A;  3JW4 A;  2Y75 A;  4KNY A;  1R00 A;  4WK8 F;  1X3U A;  4LLG F;  1PDN C;  1KGS A;  1MJA A;  4LD5 A;  1S6L A;  1TW3 A;  2JZY A;  2M30 A;  4N9I A;  2MC3 A;  1ODD A;  2MH2 A;  5LGU A;  1XSD A;  4UXN A;  3MQ0 A;  2P7V B;  4FX0 A;  4L5J A;  1T2K A;  2XAH A;  2HKO A;  4KYW A;  1MD0 A;  5J8C A;  1IXC A;  3QRF F;  4EMS A;  1DPU A;  1XDU A;  1ON2 A;  4M73 A;  2EFP A;  4IHS A;  2OZ6 A;  3VOE A;  1RNL A;  1T39 A;  4WCG A;  3KE2 A;  5D5V B;  3O3K A;  5D8L B;  5BMZ A;  3FZV A;  2NS0 A;  3G73 A;  3ERE D;  1OPC A;  2FML A;  2Z3Y A;  3BPV A;  3FXQ A;  3V8K A;  4GO1 A;  3IKV A;  2WC2 A;  3DFG A;  1BM9 A;  1DPR A;  3KP4 A;  4OIR F;  3PQJ A;  3ZPL A;  2KRF A;  4UVB A;  2OZU A;  1S29 A;  1YIO A;  2ZCW A;  1MDM B;  5ILV A;  1TTY A;  3M1E A;  1HXD A;  3K2Z A;  2RGV A;  1R5H A;  3QOP A;  3I0T A;  4IF4 A;  1L3L A;  3F22 A;  2E1N A;  4BHB A;  2P5K A;  1JGS A;  2RC4 A;  1DP7 P;  3IL2 A;  2HFH A;  1QPM A;  3ZMS A;  1QGP A;  2QM3 A;  3M7G A;  1ZGJ A;  1HW5 A;  4KA4 A;  2HS5 A;  4IRH A;  2J5O A;  5F64 A;  4TV7 A;  2D45 A;  3F6O A;  4M71 A;  2UZK A;  2Y48 A;  2R3S A;  4U88 A;  3HSF A;  1REP C;  3GW2 A;  3GFM A;  1I1G A;  1W4M A;  1XN7 A;  1QBJ A;  1UST A;  2VBZ A;  4UHT A;  1G4D A;  1XMK A;  2W57 A;  2M45 A;  3J80 Z;  3LAJ A;  3J81 Z;  4IRI A;  2DI3 A;  3T5X A;  5DCM A;  3SFZ A;  3I64 A;  1T0F A;  1O3R A;  4CZZ A;  2DK5 A;  2F2E A;  4QLC U;  5JFR A;  1FYM A;  2EA4 A;  1FX7 A;  4HZF A;  2G7U A;  3I5U A;  2QVO A;  1LQ1 A;  1WQ2 A;  4BAY A;  4YFK F;  1HST A;  5CVU A;  3ELK A;  2V9V A;  3WGI A;  1FNN A;  2E7W A;  4EV0 A;  1JE8 A;  1XSX A;  5LEK A;  1HQC A;  2GWR A;  1GVJ A;  2KJC A;  5LRR A;  1ZHF A;  2IJL A;  4YII A;  1B9N A;  4P96 A;  4D0P A;  2FNP A;  5A2Q Z;  1F4K A;  1OYI A;  4L0Z B;  4HLX A;  1V4R A;  5DV5 A;  4WXD A;  5H6R A;  4Y13 A;  3RI4 A;  3WOD F;  3TOA A;  1HSJ A;  1SD4 A;  4UVA A;  4ZZD A;  1U5T A;  4ENK A;  1MJB A;  3KLO A;  4P9U A;  1T6S A;  1IXR C;  2ISY A;  1IAW A;  2M87 A;  5FLX Z;  1ZH5 A;  3EDP A;  3KP7 A;  2JRT A;  4ZYD A;  3K9T A;  4RGS A;  3BP8 A;  4P5O A;  1R36 A;  1XD7 A;  2Q2E A;  3HRS A;  1IN8 A;  1I1S A;  4RB1 A;  5AON A;  2HYG D;  3F21 A;  4HV6 A;  5DEQ A;  5IT3 A;  1ZRD A;  3TO6 A;  1K7A A;  2HEO A;  2M1B A;  5HOO A;  3BPX A;  3C1D A;  1PUE E;  1EV7 A;  1MKM A;  1LDJ A;  3F8B A;  2GZW A;  4Z2Y A;  5BPD A;  4UVC A;  4MNU A;  1SFU A;  4G6D A;  4O3M A;  1IRF A;  4H0E A;  2EV5 A;  2CFX A;  1YO5 C;  2YR2 A;  4Q5S F;  2V79 A;  2CO5 A;  3GZ5 A;  5H6Q A;  4A12 A;  1H9G A;  3ZQ7 A;  2VBW A;  3BJ6 A;  4EM0 B;  1KYW A;  4UNO A;  4I2O A;  5BPI A;  2DT5 A;  1PP8 F;  2K4J A;  4P55 A;  4A6E A;  4HX4 A;  4OU0 A;  4LGW A;  1IF1 A;  4U0V A;  1FSH A;  2O0Y A;  2RV8 A;  2QBY A;  3O2P E;  4EM1 A;  1YW8 A;  1GHC A;  2XGX A;  4ESJ A;  2CWE A;  2OD5 A;  2JT1 A;  3W6J B;  4M9S A;  2MBF A;  4PCQ A;  1OR7 A;  3KP3 A;  1TQM A;  1U6G A;  1SFX A;  3BJA A;  3KP5 A;  3KZY A;  1O3Q A;  2DQL A;  4L9T A;  2LSO A;  1XGN A;  2D1V A;  3ROU A;  2FF4 A;  1I5Z A;  1OYY A;  4P9F A;  4HA8 A;  3F8F A;  5D5X B;  4BYY A;  3V7C A;  1BC8 C;  5FFZ A;  2O03 A;  3IWF A;  1FBU A;  2A5Y B;  3U1D A;  1Z91 A;  3F72 A;  1FP2 A;  3FF5 A;  5LGT A;  4RGU A;  3HRU A;  4K2E A;  1XSV A;  3HOS A;  2Z5U A;  4I01 A;  2DFI A;  1KU7 A;  2XHK A;  1P4X A;  2EJR A;  2BBY A;  3DPT A;  4A5N A;  4HX8 A;  2STW A;  2KIF A;  2ADU A;  2JTV A;  3DKW A;  3KLN A;  1IRG A;  2GA1 A;  4L9V A;  4U0Y A;  3BOQ A;  2RNJ A;  2ESH A;  2FNA A;  5CLS A;  3C3W A;  2YX7 A;  2WTE A;  1K79 A;  3LQQ A;  2PQ8 A;  1DDN A;  3CDH A;  3TDZ C;  3RKY A;  2Y0M A;  4MEY F;  2DU9 A;  4AIJ A;  3ZN1 A;  1BIB A;  4M9Z A;  1TNT A;  4ESF A;  2HTS A;  2A69 F;  5LEJ A;  4ETS A;  2OU2 A;  4L9N A;  5DUI A;  3PQK A;  1QO0 D;  5J8F A;  2G9W A;  1H9T A;  2XKO A;  2LF8 A;  3JAM K;  4A5M A;  1EH6 A;  2IA0 A;  2LDU A;  3FMR A;  4OIP F;  4BHP A;  3FMS A;  1CF7 B;  2P5V A;  3FX3 A;  4I09 A;  3ZMV A;  2LF7 A;  5E8G A;  1ZRC A;  4M6Y A;  3RIR A;  2Z99 A;  4OMZ A;  1FPQ A;  3T8R A;  5E17 F;  2ETH A;  5JI6 A;  1USS A;  3ZMD A;  1S8N A;  3WU1 B;  1D3Y A;  5CVR A;  4I7H A;  4XLN F;  3FXR A;  4EVI A;  2IVM A;  4KIB A;  2VOO A;  4MTD A;  4GXO A;  5D4S A;  3G3Z A;  2EB7 A;  4IJA A;  1FOK A;  1YLF A;  2PI0 A;  1MDM A;  5HDG A;  3P9K A;  4GYG A;  4HOB A;  4LB6 B;  1S7O A;  3KZZ A;  1JHH A;  3BDD A;  2EK5 A;  1O3T A;  4OIQ F;  3T1B A;  2ZFW A;  3F3X A;  3F8M A;  3SXY A;  4OMY A;  6PAX A;  3RYR A;  3CUQ A;  2VON A;  1OYW A;  5L3C A;  3F8N A;  2W24 A;  4RB2 C;  1S3J A;  4ENJ A;  3I59 A;  2IT0 A;  2DQR A;  2QLZ A;  1KQ8 A;  3U2R A;  1B9M A;  1G3S A;  4FT8 A;  1KQ9 A;  2IP2 A;  3MFK A;  3CO6 C;  4RAZ A;  4EGY A;  3WE2 A;  4UV9 A;  4HDV A;  2QYO A;  4RAY A;  5CYV A;  2FOK A;  1TW2 A;  2V1D A;  4FHT A;  3QU6 A;  1SMT A;  3LST A;  1BC7 C;  3R61 A;  3HSE A;  2VT3 A;  3HHG A;  1Z6T A;  4A0Z A;  2IPQ X;  1XCV A;  1QNT A;  5J6X A;  1G6N A;  3MCZ A;  3ECH A;  4A6D A;  1R1U A;  3HUG A;  2HQR A;  1TBX A;  2F5E A;  2NYX A;  4HLY A;  5TJJ A;  3L00 A;  3GX4 X;  1FBQ A;  3E97 A;  1TLH B;  3D0S A;  2MH9 A;  5ILU A;  3K1P A;  4PDK A;  3REO A;  4EJV A;  2A61 A;  1L0O C;  1R1T A;  4G9Y A;  3HOT A;  1YTY A;  1SD6 A;  4Y15 A;  2HWV A;  2EFQ A;  2RVC A;  2K4B A;  3MAJ A;  3SZP A;  5HLH A;  2AS5 F;  5K5O A;  2EA2 A;  3TOB A;  3ML6 A;  3U9G A;  4BXU A;  3BWG A;  2QEN A;  4CO8 A;  3RTR A;  4L5I A;  4B09 A;  3CUQ B;  4OIO F;  1ZG1 A;  3QU3 A;  1XMA A;  3FWE A;  1UHW A;  3I59 B;  1KA8 A;  4UUV A;  2CGP A;  3NEU A;  5K1Y A;  3NRV A;  2PFB A;  4EJU A;  3WG9 A;  4LK0 F;  2DTR A;  1W7P B;  5JVT A;  2P8T A;  1RZ4 A;  1UFM A;  4YFN F;  5HS8 A;  4HYE A;  1MJ9 A;  2F5D A;  4HQM A;  1CGP A;  3WTZ A;  3B73 A;  2XUB A;  3E5U A;  2EFO A;  5E1Z B;  3J7A O;  4ESB A;  3ABT A;  3RJP A;  2OBP A;  1ZG5 A;  2VOP A;  1UB9 A;  2PMU A;  1IUY A;  1G3W A;  2A68 F;  2XVC A;  1Z6R A; 
#chains in the Genus database with same CATH topology
 1D8J A;  1I6H J;  4KIS A;  4PJN A;  1ZN2 A;  2NNN A;  1J7K A;  2KIQ A;  2ZO4 A;  2ZXW H;  5F6F A;  4A3F J;  1HKS A;  1XGM A;  5K7H A;  2VLA A;  1WSU A;  3S1N J;  1ZAR A;  4KT5 C;  2CYY A;  2LK2 A;  3CDL A;  5F04 A;  4G8X A;  2R5Y A;  3CP8 A;  2BYV E;  2L4A A;  5FKM A;  2NVQ J;  3FHN A;  4DYR A;  4B3A A;  4RGR A;  2Q8K A;  2IS2 A;  3PFI A;  3KYL A;  4MEX F;  5DD4 A;  3FMQ A;  3WTW C;  2XAU A;  5FKL A;  1ZG3 A;  1YE9 A;  5CQG A;  1FP1 D;  2NS7 A;  1OIS A;  3F9K A;  5C3E J;  3CF5 F;  2TCT A;  1MNE A;  2V6E A;  1F9N A;  2DOD A;  3KYC B;  1VQ6 I;  1U5T C;  5K5R A;  1VQ5 I;  4PJM A;  4ZZL A;  3M4O J;  3TGN A;  4D7N A;  1J09 A;  5HVQ C;  3WGH A;  1H88 C;  1OCT C;  4BJ5 C;  3FM3 A;  2YSR A;  5FRM A;  2EV6 A;  1WRJ A;  2L7K A;  3HIF A;  3CME I;  2P4W A;  3GTL J;  3VYS B;  2VJ4 A;  3FDY A;  5EF6 A;  4N9H A;  4CIC A;  2ZJ2 A;  2VQL A;  2O6G E;  3UR3 C;  2BOL A;  5F0F A;  3TO7 A;  4UUS A;  4HF2 A;  2CUJ A;  2DJI A;  5FB2 A;  2YU3 A;  4G6Q A;  4GGG A;  5LHG A;  1T33 A;  2M5W A;  4A3M J;  3K70 C;  2OAZ A;  3QP5 A;  4DZJ A;  2RKH A;  2WA0 A;  2WAE A;  5F27 A;  4XRS A;  2EIM H;  4IQ4 A;  3EPZ A;  3SDB A;  3TDU C;  4HNU A;  3HRT A;  4LB5 A;  2K3F A;  1S7A A;  2V4J C;  3BZ6 A;  3C2H A;  1P6R A;  2PMH A;  3BZC A;  2E7X A;  5F1R A;  1FIP A;  2MLG A;  3KIO A;  2HVR A;  4Y52 J;  1Y8Q B;  2DCE A;  3PUB A;  4I0B A;  3OYB A;  5J3L A;  3K70 D;  3CUO A;  4GCV A;  1WI3 A;  2L5Q A;  2NXN B;  3LSJ A;  2K9N A;  3HHH A;  1U9N A;  3AG3 H;  2LY9 A;  3Q5F A;  3FBN B;  2PJR A;  1KYZ A;  3RKW A;  1ZAO A;  4OAY A;  4RB0 A;  1C0W A;  1PUF A;  1UAA A;  1FLI A;  2W4S A;  5ILS A;  1IN7 A;  4CA0 A;  1WJB A;  3S1Q J;  5DUK A;  3BG9 A;  1ETX A;  4PUS A;  1UMQ A;  1ETQ A;  1SAU A;  2CQX A;  2VPL A;  1FTT A;  2CW0 F;  2ZXJ A;  2ZNZ A;  4NUB A;  3TP3 A;  1SD7 A;  1B1B A;  2GIZ A;  2E1C A;  5DS9 A;  5IY5 H;  2LD5 A;  3A0H C;  1Y1V J;  4M3F A;  4LG0 B;  2A5W A;  4HAM A;  3TQN A;  2UV1 A;  3GYH X;  3A4C A;  3V8L A;  2P6S A;  5C44 J;  2R7U A;  2J5P A;  3P7N A;  3Q0W A;  4R8H A;  3BQZ A;  3HZJ A;  2DMU A;  2OUM A;  2KDO A;  4XM3 A;  1A04 A;  3CC4 I;  3K4L A;  2A6E F;  1XGO A;  2XAJ A;  2D1H A;  2FXA A;  3E3V A;  5D5W B;  4E6K G;  3G6E I;  2KIU A;  2K86 A;  4G7O F;  4CUG A;  1GT0 C;  4F7Z A;  5K5Q A;  3MKZ A;  2GIV A;  1V3F A;  2L7Z A;  3ECO A;  1MBK A;  5ERI A;  3ZMU A;  1LDD A;  2OV7 A;  3K0L A;  5IP9 J;  3GZ6 A;  2GXB A;  1Z1D A;  3ABL H;  2H6B A;  4AD9 A;  2VAS A;  4OOI A;  2KZV A;  2HOE A;  2DYS H;  4Q48 A;  1AHD P;  3ZP5 A;  5BS6 A;  1OR7 C;  4A3L J;  1G3T A;  3LQR A;  4IEJ A;  4F93 B;  4XOT A;  2A07 F;  2HDD A;  5EEA A;  1ONV A;  5KAF C;  3H5R A;  1E3P A;  1YYV A;  4U0W A;  3H3U A;  1SC7 A;  3TBI A;  1PP7 U;  2DDA A;  2MG4 A;  4YRV A;  1IN5 A;  2QKM B;  1CF7 A;  4L18 B;  4BQN A;  2AXL A;  2OJE D;  5ICF A;  4A93 J;  4I98 B;  5H2F C;  1EH7 A;  2ME6 A;  1LFU P;  4MQ9 F;  1E17 A;  2AQE A;  3RSN A;  4C3H J;  1WI9 A;  3A1Y A;  4JX4 A;  4LMY A;  4EJT A;  1NK2 P;  3CJT B;  2ZME B;  1UEL B;  4XN0 A;  1ZLK A;  1A31 A;  2PJP A;  4IHW A;  5IYC J;  1LEB A;  3I4P A;  2QWW A;  2XAF A;  4E4H A;  1LPQ A;  4M6V A;  2HGC A;  5FRO A;  1RI7 A;  4AVP A;  1TWG J;  2ZKZ A;  5LGN A;  3H0G J;  1F43 A;  3TL4 X;  4FET A;  2QKL B;  4QTR A;  3CTA A;  5IT9 K;  3EUA A;  3GXO A;  3QWL A;  3ASN H;  3GVA A;  5H20 A;  2HNH A;  4M3G A;  4DQ2 A;  3BT9 A;  5FD5 A;  1K78 B;  3HGY A;  2CQK A;  1FBS A;  3HL2 A;  4BQA A;  3H92 A;  1Z9C A;  2GQQ A;  2HOA A;  3KP2 A;  2V26 A;  4LJZ F;  4ZH4 F;  5GTH C;  1XDS A;  1W5S A;  4MO7 A;  5ED4 A;  3BR3 A;  1VQK I;  3VWB A;  3K2A A;  5ICE A;  4BBS J;  2DA6 A;  3BG5 A;  2L54 A;  3EYI A;  3AKZ A;  3CO7 C;  1GXP A;  2X6O A;  3LWF A;  5FJ8 J;  3HOZ J;  3FIS A;  1B59 A;  3HOY J;  3HOU J;  3EUH A;  5KAI C;  2XGE A;  2MC4 A;  2W85 A;  1E0E A;  2E19 A;  3V7S A;  2R7R A;  1GXQ A;  2LP0 A;  2XKP A;  5IYD J;  4CGZ A;  3TO9 A;  2L7M P;  2L02 A;  5M5Y J;  4AIH A;  1RR8 C;  5FFX A;  1O4X A;  1VQ4 I;  4EJO A;  3OSF A;  3B6A A;  5CVV A;  3K1N A;  1JUS A;  4MTE A;  4XSZ F;  2L4M A;  4N4O B;  4N4N B;  1KON A;  2Y30 A;  4A3E J;  1QQI A;  2M0C A;  4JK1 X;  4S05 A;  2VQG A;  2X1D A;  2DMN A;  3WHC A;  3RCO A;  2HDC A;  3K4J A;  1IRZ A;  1X4P A;  1YI2 I;  3JRG A;  3SZG A;  2XPW A;  5HLI A;  5HLG A;  1MZB A;  1TZL A;  3IC7 A;  2HXI A;  4O5V A;  1Z7U A;  3DTE A;  2Q0O A;  1K4T A;  1JT6 A;  3IHU A;  4V19 K;  1LNW A;  4HV5 A;  1O7F A;  1Y0U A;  2NVY J;  5L3E A;  1DQU A;  4I0A A;  1R22 A;  3BTC A;  2P5L C;  3AL0 C;  2HI3 A;  3S15 J;  3GEZ A;  4LLL A;  4CCK A;  4IPA A;  3JSO A;  2BY3 A;  1BI0 A;  2W25 A;  4WXC A;  3HOX J;  1OCR H;  3FM5 A;  4C3I J;  1MMG A;  1G3Y A;  2DA3 A;  3BTI A;  1E3O C;  3ZQC A;  2X6W A;  1FT9 A;  3L9F A;  4AWX B;  2WAQ A;  2K85 A;  2FMY A;  1T98 A;  4D7M A;  2DBB A;  4YFX F;  4OIN F;  1TWF J;  5E18 F;  4D1Q A;  1V5G A;  2OTL I;  3GO5 A;  4DYC A;  2I5U A;  5ICC A;  1FYK A;  3HRM A;  3B6C A;  3GME A;  2KZG A;  3ZMZ A;  2Z33 A;  2NS8 A;  3BR0 A;  2ELH A;  1HKT A;  4LIU A;  1J75 A;  3L1P A;  2CRG A;  3VDX A;  2KHM A;  4L5E A;  3OYA A;  2HQN A;  2GXA A;  3O8H A;  3J7Z I;  4RS8 A;  1JXS A;  2W1O A;  5FGM A;  3ZR8 X;  1R71 A;  1J2X A;  2DTZ A;  2TDX A;  3D5S C;  1AKH A;  5IT9 Z;  1H89 C;  3PSF A;  4CHU A;  4CCM A;  2JJ7 A;  3DTI A;  2CW7 A;  1NK3 P;  4ASN A;  3OIO A;  1BW6 A;  3GFJ A;  4QSH A;  1B6A A;  4PJL A;  1H0M A;  1ZRE A;  3W2W A;  4HPQ A;  4IVN A;  4A3C J;  2R7Q A;  2KIS A;  2F5C A;  3DKX A;  1IN4 A;  2LRD A;  4UB6 C;  1GDT A;  1UJ8 A;  5FD6 A;  3OL3 A;  2B0L A;  1O3S A;  3I9V 2;  3OYG A;  2COM A;  1LJ9 A;  3CES A;  1V54 H;  5FKK A;  2K3P A;  1YJW I;  3UNG C;  1O7L A;  2DOF A;  2NOG A;  4BUP A;  3OYF A;  3CUQ C;  3DEE A;  2XRN A;  2JMW A;  4XBF A;  2Z1D A;  1JKO C;  2R93 J;  2OA4 A;  4FQG A;  2LMD A;  3LFK A;  3EET A;  1YW9 A;  4XLH A;  4XOR A;  3S2W A;  3WTS C;  3GCM A;  3S8P A;  3GUD A;  3GLL A;  2TRT A;  1GVD A;  5CPR B;  3BR2 A;  1K6Y A;  2JN6 A;  1TT0 A;  3KET A;  1ERD A;  4NHJ A;  5E8I A;  2DFH A;  2A6H F;  4BE0 A;  1YS6 A;  2FBI A;  3QPT A;  5E79 C;  2XF7 A;  5B66 C;  4L0Y B;  1I27 A;  2VKV A;  4M3B A;  1U8R A;  4EGZ A;  3IH3 A;  2HZT A;  1X1D A;  1B8I A;  1R58 A;  1ZR2 A;  4CCJ A;  3E6D A;  4OAZ A;  4PJ0 C;  4AUX A;  2MA3 A;  3NAU A;  4UV8 A;  4JQF A;  2PBI A;  4FX4 A;  4II3 A;  1A35 A;  4S04 A;  3JSP A;  3E6C C;  4ANJ A;  1PJR A;  2VUM J;  3OS0 A;  5L3F A;  3Q9V A;  2VBX A;  1W7P A;  3QPH A;  1Z3Y A;  2V9P A;  5E1X A;  3E5X A;  2IAI A;  2BV6 A;  1MBJ A;  4AIK A;  1W7P D;  3JTG A;  1YFH A;  4U7B A;  2B63 J;  3JAM Z;  2VE9 A;  2AHQ A;  3DPL C;  3ESW B;  3HC7 A;  1BI2 A;  3L7W A;  2XF6 A;  5B3S H;  3A01 B;  2F6C A;  2FX0 A;  2NNY A;  3HOV J;  1U2W A;  4Q47 A;  2K7L A;  4KIG A;  4QIW N;  2H1L A;  1HKQ A;  5CVJ A;  1SAN A;  3OYN A;  2CQ7 A;  2YX4 A;  1SAX A;  3OYJ A;  3KCC A;  4XL9 A;  3WU0 A;  3ULQ B;  5IOY A;  4BHC A;  1W5C C;  1Z7L A;  2OPT A;  4MGR A;  5M3F J;  2CG4 A;  1RKW A;  2FBK A;  3I53 A;  1XC5 A;  5JLW A;  4C3J J;  2LBF A;  1GLN A;  3JTH A;  3MZY A;  1D0X A;  5D5U B;  4NQW B;  3DF8 A;  2DLL A;  5LHI A;  1HC8 A;  4ENM A;  4LFU A;  3O6B B;  3MKW B;  1R7J A;  1MIJ A;  2V7F A;  3W3C A;  1RUN A;  1DGW Y;  2HTJ A;  3JRA A;  1OKR A;  3E6B A;  4E7H A;  4EJW A;  3VB2 A;  1WPK A;  5KK1 A;  2XRL A;  2FE3 A;  2K02 A;  1P9Q C;  1VND A;  2CSO A;  2HOS A;  1UHM A;  2UXX A;  3J80 K;  5TRD A;  1DU0 A;  1F5T A;  2XDV A;  1Z21 A;  1M1E B;  2Z16 A;  3R6S A;  3J81 K;  2JWT A;  4HQE A;  2YS9 A;  3AAF A;  4X6A J;  1NHA A;  1BR4 A;  1I50 J;  2FD5 A;  3DV8 A;  3ZQF A;  1YX5 A;  5L3D A;  3ZCO A;  1QZY A;  1P4A A;  3LNQ A;  1DUX C;  3BG3 A;  1J5Y A;  4HG2 A;  3BRO A;  3NAR A;  5M3M J;  2CUZ A;  2AO9 A;  2CQN A;  4XKV A;  1W0U A;  3I3L A;  4YIF A;  2H6C A;  2QQA A;  1JGG A;  4A0X A;  1P2F A;  2LC2 A;  5B5E C;  1AA7 A;  5L3G A;  2WWY A;  5EEG A;  4GYI A;  4B48 A;  4WWC A;  1AOY A;  2RN7 A;  3IAM 2;  5GAG J;  5D6E A;  5FLM J;  4U7D A;  1IZ1 A;  5DYM A;  5EYR A;  2BGC A;  1WKM A;  4HDU A;  3K4C A;  3DBH B;  4M9X A;  1P7J A;  4HX7 A;  1X1B A;  3MEX A;  2EIK H;  2GOM A;  3GFI A;  4Y17 A;  1RIO H;  3C2G A;  2JPC A;  3LA2 A;  2B7E A;  2KIM A;  5E20 A;  1B72 B;  1FYL A;  2XB5 A;  4HBL A;  5AIQ A;  5M5W J;  1D1A A;  5J1R A;  1ZK8 A;  2O7O A;  4D5C A;  2HXO A;  3H3Z A;  4A0Y A;  4HF1 A;  5HNH A;  1YJN I;  2QZ8 A;  2ZNY A;  3MMY B;  2FEZ A;  4C2M J;  1IC8 A;  3RPQ A;  3I54 A;  3MKY B;  5HDN A;  3Q9S A;  2BXY A;  5A2Q K;  2BZT A;  1U9O A;  2X0L A;  5E1W A;  1QVU A;  3R60 A;  1OMI A;  3DP7 A;  3IH4 A;  1WWX A;  3G1M A;  1FIA A;  3IRQ A;  2COB A;  3FXK A;  2FQ3 A;  2E2I J;  3R0A A;  2VXZ A;  3BG7 A;  4G7H F;  2AXT C;  4XLF A;  3GBG A;  2DAO A;  2MW8 A;  2KKO A;  3M8F A;  4KDP A;  2HZD A;  2FU4 A;  5E3M A;  1IUF A;  1WH5 A;  5CJ9 A;  3SDG A;  4F3Q A;  3WE3 A;  4ZYG A;  3VYT B;  3ABM H;  4LOC A;  1FZP B;  1EF4 A;  2BE5 F;  5FLX K;  4QWQ A;  4IKF A;  1XPX A;  5LRS A;  3FBI B;  3RPU A;  3HGG A;  4IRG A;  1R5G A;  4NNJ A;  1IXS B;  3GF2 A;  1CQT A;  3T8T A;  2X85 A;  3PM1 A;  3VYR B;  4BL0 B;  2KJB A;  1D8K A;  1R6R A;  2PG4 A;  2M3A A;  1LVA A;  2Y31 A;  3S1M J;  2FQ4 A;  3IRR A;  1PYV A;  4KMF A;  3PFY A;  2XSD C;  3RDI A;  2R7F A;  5ICG A;  2QQ8 A;  1RKT A;  2VN2 A;  4LG0 A;  4KIC A;  2QUF A;  4X1E A;  4DZP A;  3IKT A;  1BJZ A;  1N75 A;  1UG2 A;  2W84 A;  3EUK L;  3HYI A;  3SQN A;  3QAH A;  2E5Z A;  2X4H A;  1ZGA A;  1IW7 F;  4HNV A;  1XGS A;  4RM3 A;  1YX3 A;  3PO2 J;  2LOO A;  3MWM A;  2R7Z J;  1S5L C;  1JUP A;  2L7F P;  2L9S A;  4F52 A;  2M8E A;  3N4M A;  3BG6 A;  1FOY A;  4KT6 A;  2DMP A;  4WF2 A;  5LD2 C;  1MBG A;  1W5T A;  2XAS A;  1BOB A;  2OQR A;  3HTS B;  1DP3 A;  1WZ2 A;  1IG7 A;  2HKX A;  3HPH A;  2L9R A;  2WV0 A;  3OYL A;  4RDU A;  3MZH A;  3CCJ I;  2Y2Z A;  1X2M A;  1STZ A;  2LY2 A;  3H9J A;  4BY7 J;  4ZDP A;  3JRD A;  1U3E M;  2FA5 A;  1YW7 A;  4Q4Z F;  2ZC2 A;  2A6T A;  4XRF A;  2PN6 A;  1ON1 A;  1VFC A;  1Y1W J;  2F5F A;  4LLN A;  4CH7 A;  2VOD A;  3BTL A;  2IRF G;  4RGX A;  4CDG A;  3LSM A;  3TP0 A;  5GPA A;  2Z2S B;  2ECB A;  4GRI A;  4NC6 A;  4J19 A;  2ACJ A;  3TMO A;  3Q3S A;  1B4A A;  1S9H A;  3K69 A;  4PSW A;  4O6J A;  2V9K A;  1BI3 A;  1EH8 A;  3K6G A;  4NDL A;  2GBY A;  1X19 A;  3DQV C;  5TIS C;  3OR1 C;  1HBX G;  1AWC A;  2R7O A;  1JKP C;  2XIG A;  3HBL A;  2R7T A;  4JBA A;  2ZME A;  5GPC A;  4BQO A;  2N8G A;  3DBL B;  2O61 A;  3DEW A;  1O57 A;  4A3I J;  2E34 A;  3W6K B;  2VE8 A;  1FSE A;  3PNT A;  2DXI A;  2DPD A;  4XLP F;  1Y6I A;  2O8K A;  1RET A;  2ME0 A;  4XKB A;  5JR3 A;  4M6X A;  5AIP A;  4EQQ A;  1V5F A;  2JVH A;  4KN4 X;  3BR5 A;  1R1V A;  1D1C A;  3DTK A;  1XG1 A;  2EWN A;  1HLV A;  3LFU A;  3JCU C;  1K78 A;  1LFP A;  2KRC A;  1WJD A;  4A2U A;  5K7Z A;  1MNM C;  4I99 C;  5DM7 F;  2DW4 A;  3B02 A;  1R23 A;  2EZI A;  2HU9 A;  3DLL F;  3L2C A;  3CD6 I;  5HS9 A;  1TQP A;  4DNC A;  2KMU A;  3GTM J;  3FK7 A;  5BQT A;  4X0G A;  2PLY A;  2EV0 A;  2V1X A;  5HDK A;  2ZJR F;  2CJJ A;  2XSJ C;  5DTD A;  2GA2 A;  3C18 A;  3IAS 2;  4KIF A;  2DYR H;  2X9D A;  3HXL A;  1FC3 A;  2MLK A;  3V7R A;  1SD5 A;  3FHZ A;  4XRS G;  3CLO A;  3V8J A;  2HYF A;  2QQ9 A;  4YIR X;  4BU2 A;  2DPU A;  3ERM A;  3RZD J;  1QZZ A;  2D5V A;  4MFD A;  1FY7 A;  3KFW X;  3FXU A;  3K4K A;  3M9A A;  2OTJ I;  3G1L A;  2R7V A;  1F1Z A;  2EFN A;  2P6T A;  3BY6 A;  1BOA A;  5DCM B;  4BBR J;  3M07 A;  4AU7 A;  4XK4 A;  1DU6 A;  4CYD A;  2P0W A;  1JJ8 C;  2ZJQ F;  1Z05 A;  3LSR A;  1WGX A;  3S14 J;  3WTX C;  3VEP A;  3QYE A;  1QRY A;  3QP6 A;  3QQA A;  1LB2 A;  1A6I A;  2H09 A;  1Q1H A;  3TKY A;  4RM2 A;  5F1J A;  2QSF X;  1VTN C;  3MD2 A;  2Z9O A;  4XQF A;  4HSR A;  5K7F A;  1ZLJ A;  1IN6 A;  1VQO I;  1TNS A;  2ID6 A;  3CMM A;  3IUO A;  2O8X A;  2VKH A;  2VKD A;  1R49 A;  1KU9 A;  4U87 A;  2L3D A;  4LK1 F;  4IHT A;  5D6F A;  1BJA A;  1ULY A;  2MD5 A;  2E36 A;  2IXS A;  5LLQ A;  4V2G A;  2VJJ A;  3I58 A;  2M4K A;  4YG2 F;  5FKN A;  3ZQQ A;  3S3N A;  1TP4 A;  1KU2 A;  3HG9 A;  4A3D J;  3RKX A;  2HPM A;  1UZC A;  1HW2 A;  1K4S A;  1TL8 A;  1KU3 A;  1XB4 A;  2XRO A;  2A3S A;  4FCY A;  2V6C A;  5L3B A;  4BNC A;  3P9I A;  5DD8 A;  1BI1 A;  3H5N A;  3PNV A;  2G7H A;  4KUM A;  2KL4 A;  1XMX A;  2M34 A;  1YS7 A;  3CJN A;  5CKT A;  4YEL A;  1SVM A;  3OY9 A;  5B1A H;  4WX9 A;  1QZE A;  2F48 A;  4M74 A;  1J59 A;  4V2F A;  2EPF A;  1ZYR F;  3LSK A;  3I71 A;  1IJW C;  4NC8 A;  1FWZ A;  2QQB A;  4PFP A;  2UWM A;  5GTI C;  2WY7 Q;  3DEU A;  5LHH A;  3SZT A;  1SMY F;  4PGG A;  3KEO A;  4RB3 C;  3CC7 I;  4ON0 A;  2R5Z A;  3W6V A;  2VBY A;  4BQQ A;  1WFX A;  3CCS I;  3QYF A;  2H8W A;  1U5T B;  5D4R A;  1LKX A;  4CSW A;  3L2W A;  1LEA A;  5D8K B;  4H4K C;  2JVG A;  4HW0 A;  5KCM A;  3WTV C;  1J0R A;  1LDK B;  5FRN A;  2RQP A;  1IDY A;  1U8B A;  2H94 A;  2E1O A;  5FLV A;  5CVI A;  3OOP A;  2NOJ B;  3LSI A;  3PNY A;  3VOD A;  3EUH C;  2WAQ N;  4IQJ A;  4G94 A;  1NTC A;  5JHU A;  2H27 A;  2D2W A;  1KQ0 A;  1TC3 C;  2RDP A;  2X51 A;  5BOX A;  3HM5 A;  1HW1 A;  3D5R C;  1TWA J;  3LAP A;  2Q2E B;  3RYP A;  1JUM A;  3ABU A;  4PSX A;  3L2V A;  2JUC A;  5LFA A;  2DO7 A;  2Q1Z B;  2M9H A;  1U78 A;  4BY1 J;  4G12 A;  3TW7 A;  3HTU A;  2UXN A;  4R79 A;  2V1U A;  2F5V A;  2GOX B;  3F8C A;  4G7Z F;  3OL4 A;  1R4N B;  2PMZ A;  3ZQG A;  3FKI J;  5HS7 A;  3WTU C;  3Q0V A;  3IP4 B;  1YQA A;  3HEF A;  2XAQ A;  3LSG A;  4HEA 2;  4IXA A;  3KEQ A;  4OWR B;  3GWZ A;  3WGG A;  4Y7N J;  4ENN A;  3CJR B;  1OLT A;  1SFE A;  1BBY A;  2IA2 A;  3PL8 A;  4CCL A;  3OV8 A;  4PGH A;  2KDZ A;  4WXH A;  2STT A;  4KFC A;  4XSX F;  2ZXI A;  1FEX A;  2YPR A;  1G8X A;  4IL6 C;  4ZYE A;  2ZBK A;  2DK8 A;  2VB6 A;  3CQZ J;  4LIV A;  2GAU A;  3GTO J;  2K27 A;  4R1H A;  4KN7 X;  1LE8 B;  2NRA C;  4PZJ A;  1RPW A;  3C7J A;  1Z67 A;  2EFW A;  3QOE A;  2QCO A;  1D5Y A;  4CXF A;  1P92 A;  2IW5 A;  3VFZ A;  2PEX A;  1JHF A;  4CYC A;  3WTY C;  3K4M A;  3FXO A;  1W36 C;  1ACI A;  1MGT A;  1BN5 A;  1ORK A;  4EM2 A;  3HSR A;  3P9C A;  3A01 A;  5EZH A;  2O3F A;  3COA C;  4BJT A;  2DA5 A;  5LBQ A;  5GAD J;  2FBH A;  2FSW A;  2LKP A;  2B9S A;  1UHS A;  1X4O A;  1SVL A;  3BZK A;  5EEH A;  3CCQ I;  1XTA A;  2ISZ A;  4M72 A;  3ZN0 A;  2EIL H;  2IEK A;  1ETV A;  2QBY B;  1HOM A;  1RUO A;  4A69 C;  2XF5 A;  3EQL F;  1ZKG A;  1K6O A;  1I3A A;  2LR8 A;  2BEO A;  3D5L A;  2C6Y A;  3UKG A;  1I6X A;  4HF0 A;  4NQW A;  3KP6 A;  4MHG A;  1J9I A;  3WTT C;  1MMD A;  4F91 B;  4IHX A;  3SEQ A;  1BIA A;  3LA3 A;  5DDG A;  2LNB A;  3QYB A;  1P4W A;  3WHB A;  4B8X A;  1EA3 A;  2KT0 A;  2R7W A;  3K1M A;  3ISP A;  2R5Z B;  3BJO A;  5DCF A;  2DT7 B;  4E70 A;  4MQV A;  1JTY A;  3IWZ A;  2WAF A;  2JSC A;  3H1C A;  3R4K A;  1D5V A;  2NAZ A;  1XCB A;  2JSP A;  1WJA A;  4QPQ A;  2YU9 J;  1IDZ A;  1I3Q J;  2WB1 A;  1UCR A;  4JX6 A;  3JRE A;  3SHF A;  2E1M C;  2G0E A;  3JRB A;  4F55 A;  1MH3 A;  2VT2 A;  2R7X A;  3OMY A;  3M8E A;  3F23 A;  3T0Y A;  4XLC A;  2VL8 A;  4BH9 A;  4KMU X;  2ID3 A;  3DXJ F;  3CP2 A;  1T38 A;  3LA7 A;  1TQI A;  2K9L A;  2XV4 S;  4DJA A;  3E6M A;  3R0J A;  1X3W B;  4HNT A;  3ZMT A;  5KVR A;  1HF0 A;  2HR3 A;  5FO5 A;  3ZQH A;  3AG1 H;  1V5E A;  2IA1 A;  2EIN H;  2R7D A;  2ESN A;  3V4G A;  2P7C B;  3QPL A;  2OQG A;  3CCL I;  3N97 A;  4F92 B;  3F6V A;  1ZRF A;  3E5Q A;  2DMT A;  4A3B J;  2X6X A;  3D1N I;  3IV5 A;  4L9J A;  3OS2 A;  1VQM I;  2JPB A;  2IS6 A;  2K9M A;  4RLF A;  4I02 A;  2L01 A;  4ZYH A;  1JT0 A;  3KZI C;  3GLX A;  1G2H A;  4N0B A;  2VC0 A;  1B72 A;  1T08 B;  1E2X A;  2HVS A;  4AYB A;  3NQO A;  2FRH A;  5IP6 A;  2VC1 A;  1D1B A;  1MSF C;  3FXM A;  4I6Z A;  3L09 A;  2XAG A;  1POG A;  4NB5 A;  1YG2 A;  3LSH A;  3GFL A;  1OCP A;  3EYY A;  1X3Z B;  4C2U A;  1Y56 A;  5HOD A;  2GXG A;  3JW4 A;  2Y75 A;  4KNY A;  2JA8 J;  1R00 A;  2NVT J;  1ITY A;  4WK8 F;  3H9Q A;  1U0J A;  1X3U A;  4LLG F;  1PDN C;  1TWH J;  4IOA F;  3U1K A;  1KGS A;  4E7L A;  4CYC B;  1MJA A;  2HQ5 A;  4LD5 A;  1S6L A;  1TW3 A;  2JZY A;  5C4J J;  3HKZ N;  2M30 A;  4BJ6 C;  3BCA A;  2R4G A;  3C2B A;  3FXL A;  4N9I A;  2MC3 A;  5E3N A;  3J7A Y;  1ODD A;  2MH2 A;  2BHZ A;  5TGT A;  5LGU A;  1RES A;  1XSD A;  3M8J A;  4UXN A;  3MQ0 A;  2P7V B;  2IGM A;  4FX0 A;  4L5J A;  4XID A;  1T2K A;  2XAH A;  1LFB A;  4E7I A;  2HKO A;  2XGD A;  4KYW A;  1MD0 A;  5J8C A;  4ZTJ A;  1IXC A;  3QRF F;  2E71 A;  4EMS A;  1DPU A;  1XDU A;  2NVX J;  2MYS A;  1ON2 A;  2E2J J;  2R7S A;  4M73 A;  1ZQ3 P;  2LRE A;  2EFP A;  3H0D A;  2A05 A;  4IHS A;  3AL0 B;  3I4M J;  1FOX A;  2OZ6 A;  3OYK A;  3VOE A;  3OR2 C;  3F0C A;  1RNL A;  4Y33 A;  2CU7 A;  3K4B A;  2DJN A;  3H36 A;  1T39 A;  4WCG A;  3MKL A;  1IRX A;  3KE2 A;  5D5V B;  5HLT A;  1OFC X;  3H5A A;  3DU6 A;  4JOM A;  3O3K A;  5D8L B;  1BL0 A;  5BMZ A;  3PIP F;  4B44 A;  4XOP A;  4NBQ A;  3LMM A;  3FZV A;  2NS0 A;  2ELJ A;  3G73 A;  2LTP A;  2JA6 J;  1IV8 A;  3ERE D;  1OPC A;  2FML A;  1I39 A;  2BY1 A;  5JVG F;  2Z3Y A;  2E60 A;  2Y9Y A;  2CV0 A;  1N77 A;  1MND A;  3BPV A;  1IGN A;  3FXQ A;  3V8K A;  5EZG A;  1YIJ I;  2ZXH A;  3GTP J;  4GO1 A;  3IKV A;  2WC2 A;  3DFG A;  1BM9 A;  1DPR A;  4BXX J;  3KP4 A;  1X58 A;  4OIR F;  3PQJ A;  3ZPL A;  3K10 A;  4HRI A;  2KRF A;  4UVB A;  4ZDO A;  1HDP A;  2VXD A;  1S29 A;  2K5C A;  2EH3 A;  1YIO A;  2OZU A;  1QA6 A;  1A36 A;  2IS4 A;  3SFI A;  2ZCW A;  1MDM B;  5ILV A;  1TTY A;  2EBI A;  4BE1 A;  3M1E A;  2HQA A;  4ZC3 A;  3FK6 A;  3CJQ B;  4IHV A;  4RMN A;  1Q1V A;  2DOA A;  1YJ9 I;  2MSY A;  1HXD A;  3K2Z A;  2RGV A;  1G59 A;  1R5H A;  3BR6 A;  1QHH D;  1FTZ A;  3VSK A;  3RQ4 A;  3BCB A;  3QOP A;  2QA4 I;  2K9Q A;  3I0T A;  4IF4 A;  3H35 A;  4JYK A;  4XMY A;  1L3L A;  3F22 A;  2DA4 A;  2E1N A;  4BHB A;  2P5K A;  4A3J J;  1JGS A;  2RC4 A;  1MMS A;  1DP7 P;  3IL2 A;  2HFH A;  1QPM A;  3HB9 A;  3S93 A;  3ZMS A;  1QGP A;  2QM3 A;  3M7G A;  1ZGJ A;  3NWT A;  1R4M B;  3BC8 A;  4DOZ A;  3S3O A;  3FXJ A;  1HW5 A;  1WJF A;  1SFK A;  5IPA A;  4KA4 A;  2HS5 A;  3MVP A;  2GM4 A;  4IRH A;  2J5O A;  2QSG X;  4LG3 A;  5F64 A;  4TV7 A;  4DBR A;  2D45 A;  4RBO A;  3F6O A;  2FJ1 A;  4M71 A;  2LVS A;  2UZK A;  2Y48 A;  3SJM A;  1Y0N A;  2R3S A;  4U88 A;  3HSF A;  1REP C;  2E5N A;  1T8I A;  2VJ5 A;  3GW2 A;  2XC7 A;  3GFM A;  1I1G A;  1ZR4 A;  1W4M A;  4E7K A;  3OYI A;  1XN7 A;  2F4M B;  1QBJ A;  1UST A;  2XPV A;  3RPU D;  2VBZ A;  4UHT A;  1QHG A;  3ZQL A;  2DA7 A;  4FE4 A;  1G4D A;  1GV2 A;  1XMK A;  2W57 A;  2M45 A;  4BEH B;  3CCV I;  1X1P A;  1WJ5 A;  2X1C A;  3J80 Z;  1Y39 A;  3LAJ A;  2XGC A;  3J81 Z;  4IRI A;  3L2R A;  3E7L A;  2Y9Z A;  3HUG B;  2DI3 A;  3T5X A;  4BGD A;  1XX5 A;  1W0T A;  5DCM A;  5J1U A;  2EZL A;  3HJE A;  1WH7 A;  5GP9 A;  1OCO H;  1KZH A;  1JJ6 C;  2DA1 A;  3SFZ A;  2WV1 A;  3I64 A;  2VQH A;  4JX5 A;  4PFO A;  5GAE J;  1T0F A;  1O3R A;  1TWC J;  4CZZ A;  2DK5 A;  2L0K A;  3A02 A;  1P7I A;  1X1A A;  2F2E A;  4ITV A;  4QLC U;  5JFR A;  2IS1 A;  1FYM A;  3W2A A;  2DDB A;  2IGO A;  2EA4 A;  1FX7 A;  2JA5 J;  2KP6 A;  4HZF A;  2G7U A;  3I5U A;  2QVO A;  1LQ1 A;  1WQ2 A;  2Y69 H;  4J01 A;  4BAY A;  4ZTF A;  2AQF A;  4YFK F;  1HST A;  1BR2 A;  3VYU B;  5J47 A;  5JLX A;  5CVU A;  3ELK A;  4E7Z A;  2V9V A;  3WGI A;  1K83 J;  1FNN A;  3SYT A;  2E7W A;  4EV0 A;  1JE8 A;  1XSX A;  1RC9 A;  1K61 A;  5LEK A;  1HQC A;  2GWR A;  2LKS A;  5EGO B;  5IYB J;  4QPO A;  4MFE A;  1WHU A;  2M7A A;  4EEF G;  1N78 A;  2CH0 A;  2ZME C;  1GVJ A;  2KJC A;  4JP0 A;  1OJL A;  4FIS A;  1MMA A;  2MD0 A;  5LRR A;  1ZHF A;  2IJL A;  3CCM I;  4YII A;  1B9N A;  4XRM A;  1ZEL A;  4P96 A;  4D0P A;  2FNP A;  5A2Q Z;  4XLE A;  1F4K A;  1OYI A;  4L0Z B;  1FJL A;  4HLX A;  1V4R A;  5DV5 A;  3SEZ A;  1NG6 A;  4WXD A;  5H6R A;  4Y13 A;  3RI4 A;  2DFE A;  2VJI A;  5DM6 F;  3WOD F;  3OS1 A;  3TOA A;  1HSJ A;  1SD4 A;  4RAG A;  4UVA A;  4ZZD A;  2Y0S A;  5C4X J;  1U5T A;  2WAD A;  4ENK A;  5JHF A;  1MJB A;  3KLO A;  4FE7 A;  3RQI A;  3RKQ A;  1T6S A;  4P9U A;  1IXR C;  3JRI A;  2ISY A;  1IAW A;  1MSE C;  2DT6 A;  2M87 A;  2OC6 A;  5FLX Z;  1ZH5 A;  4IO9 F;  3H3V K;  3EDP A;  3KP7 A;  2JRT A;  3LOC A;  2LLK A;  4ZYD A;  4PJJ A;  3K9T A;  4RGS A;  3BP8 A;  5F0H A;  4P5O A;  2ICW G;  2MGQ A;  1R36 A;  1XD7 A;  2Q2E A;  3HRS A;  1IN8 A;  3L2U A;  4XKC A;  1I1S A;  4RB1 A;  1VQP I;  5AON A;  1X2N A;  2HYG D;  3F21 A;  4HV6 A;  1Z0X A;  5DEQ A;  3BTJ A;  5IT3 A;  1NG7 A;  1ZRD A;  2DN0 A;  9ANT A;  3CZ6 A;  3TO6 A;  1FMV A;  1K7A A;  1HDD C;  2HEO A;  2M1B A;  2YUS A;  3BPX A;  3C1D A;  3DKY A;  5HOO A;  1PUE E;  1EV7 A;  1NH3 A;  2M0M A;  4HST A;  1MKM A;  2BW3 B;  3CC2 I;  3TW6 A;  2CUF A;  1RR7 A;  3VSL A;  1LDJ A;  3KEY A;  3ZXS A;  1EJ9 A;  2P81 A;  3F8B A;  3QPS A;  2GZW A;  2JK3 A;  1GUU A;  2OCC H;  1WJE A;  1A6Q A;  4UVC A;  4Z2Y A;  4MNU A;  5BPD A;  4G6D A;  1SFU A;  4O3M A;  1IRF A;  3ABK H;  4H0E A;  1DGR M;  2EV5 A;  2CFX A;  1LE8 A;  1YO5 C;  2CV1 A;  4DIQ A;  2YR2 A;  5IOZ A;  3S32 A;  4Q5S F;  2V79 A;  2CO5 A;  3GZ5 A;  5H6Q A;  4A12 A;  1H9G A;  3ZQ7 A;  2VBW A;  3BJ6 A;  1ZGW A;  4EM0 B;  3M1C A;  1KYW A;  2VI6 A;  4M3D A;  4UNO A;  4I2O A;  4A3K J;  1GV5 A;  5BPI A;  4BAC A;  1BR1 A;  2LFB A;  2DT5 A;  1BA5 A;  1PP8 F;  2VPR A;  3JRF A;  2K4J A;  4P55 A;  2MAB A;  4A6E A;  3CDI A;  1VQ9 I;  4HX4 A;  3Q0U A;  4OU0 A;  4LGW A;  1JTX A;  4BXF A;  2R5Y B;  1IF1 A;  1UG0 A;  3HPG A;  3I4N J;  3I55 I;  2I8D A;  4U0V A;  1FSH A;  2PMZ N;  2WY8 Q;  2O0Y A;  2QEX I;  2RV8 A;  4BKX A;  2E2H J;  3H9G A;  3O2P E;  4W97 A;  3A0B C;  2QBY A;  4EM1 A;  5E3O A;  3KPH A;  4D5F A;  1YW8 A;  1GHC A;  4AM3 A;  1JKQ C;  3S2D J;  2XGX A;  2K40 A;  4UB8 C;  3E0J B;  1HCR A;  2GLO A;  4ESJ A;  3CMA I;  2M8G X;  2CWE A;  1T56 A;  2CS3 A;  2OD5 A;  4B3X A;  1HA8 A;  2JT1 A;  2EIJ H;  2KQR A;  3W6J B;  4M9S A;  4B4C A;  2EQR A;  2MBF A;  4PCQ A;  1OR7 A;  3KP3 A;  1TQM A;  1U6G A;  1SFX A;  3BJA A;  4FAS D;  3KP5 A;  4G6T B;  2M2E A;  1YIT I;  3S3M A;  3MN2 A;  3BQY A;  2L9V A;  3KZY A;  5M5X J;  1O3Q A;  2DQL A;  4L9T A;  1LVK A;  2LSO A;  2IGN A;  1XGN A;  1V55 H;  2D1V A;  4UUS B;  3ROU A;  4M3E A;  2FF4 A;  1I5Z A;  1OYY A;  4ZDL A;  4P9F A;  2ZJP F;  4HA8 A;  3F8F A;  5D5X B;  4BYY A;  2DFF A;  3V7C A;  1BC8 C;  5FFZ A;  2O03 A;  4D9J A;  3J7Y J;  3IWF A;  4E7S A;  2ZB9 A;  1FBU A;  3CCR I;  2W7N A;  1FOW A;  2A5Y B;  3U1D A;  1Z91 A;  2X6Y A;  3F72 A;  1FP2 A;  3FF5 A;  5LGT A;  3OWT A;  4RGU A;  3HRU A;  4K2E A;  1XSV A;  3HOS A;  2Z5U A;  1BW5 A;  3CMY A;  3U21 A;  4I01 A;  3FKJ A;  3AG2 H;  2DFI A;  1WVR A;  1KU7 A;  2PJR B;  1MH4 A;  2K9S A;  4XKW A;  4GDF A;  4E7J A;  1PUF B;  2XHK A;  1MW7 A;  1P4X A;  2EJR A;  2BBY A;  5FKO A;  2VKE A;  2QGU A;  3DPT A;  4A5N A;  3GTG J;  4HX8 A;  4CCO A;  1JKR C;  2UUZ A;  3GTK J;  2STW A;  2KIF A;  2LG4 A;  2ADU A;  2JTV A;  2H8R A;  3I56 I;  3DKW A;  3KLN A;  2WB1 N;  1IRG A;  2F4I A;  2GA1 A;  4L9V A;  3GZN B;  3PO3 J;  3K4N A;  4U0Y A;  1MMN A;  3BOQ A;  4AVZ A;  2RAE A;  2RNJ A;  2RRE A;  3QOD A;  3OIQ A;  4AC0 A;  2ESH A;  2FNA A;  4EAT A;  5CLS A;  4RLQ A;  1VF9 A;  3C3W A;  2YX7 A;  2RQQ A;  4XN3 A;  2NVU B;  2JA7 J;  1ETK A;  5B1B H;  3G4S I;  2WTE A;  1K79 A;  3LQQ A;  3OIP A;  4Z6Y A;  1QU3 A;  3PUF A;  2PQ8 A;  3KYD B;  3CDH A;  1DDN A;  3S2H J;  3TDZ C;  3RKY A;  4P1W A;  2Y0M A;  4UUT A;  4MEY F;  2DA2 A;  2DU9 A;  4AIJ A;  1D0Y A;  3ZN1 A;  3O8G A;  4AID A;  1BIB A;  3AG4 H;  4YEJ A;  1D0Z A;  2M4G A;  4M9Z A;  1TNT A;  2E35 A;  4ESF A;  5IP7 J;  4IZZ A;  2HTS A;  1W36 D;  2HOT A;  3W2V A;  2A69 F;  2QF7 A;  1ETO A;  5LEJ A;  1W1W E;  1RRJ A;  2M7B A;  4ETS A;  2OU2 A;  4L9N A;  4J00 A;  1JI8 A;  5DUI A;  3PQK A;  1QO0 D;  4AYB N;  4C2T A;  2MFZ A;  5J8F A;  2LKX A;  2G9W A;  1YRN A;  1H9T A;  2XKO A;  2LF8 A;  3JAM K;  2HDW A;  4A5M A;  4BDY A;  1EH6 A;  4MLO A;  2IA0 A;  2LDU A;  3VPR A;  3FMR A;  4OIP F;  4IX7 A;  4BHP A;  3FMS A;  1CF7 B;  1F36 A;  2P5V A;  5BNG A;  3FX3 A;  4I09 A;  3ZMV A;  2LF7 A;  5E8G A;  1ZRC A;  2ZFU A;  4M6Y A;  1R9T J;  2XB0 X;  3G1O A;  2W82 A;  3RIR A;  3WG7 H;  3ZQI A;  2H1K A;  1ZTR A;  2BVM A;  2BY0 A;  2F4O B;  2R92 J;  2Z99 A;  4OMZ A;  3OSG A;  1VI0 A;  1FPQ A;  5F08 A;  2EZK A;  2VQC A;  3CF2 A;  3T8R A;  1Y8R B;  5E17 F;  2ETH A;  5JI6 A;  2KLO A;  1USS A;  3ZMD A;  1S8N A;  2IGK A;  3WU1 B;  1D3Y A;  3LSP A;  3A03 A;  3JRH A;  3ZRG A;  2BY2 A;  5CVR A;  1VQ7 I;  4I7H A;  3DU5 A;  4XLN F;  5CQE A;  3FXR A;  4EVI A;  2IVM A;  4KIB A;  2VOO A;  4MTD A;  4GXO A;  5D4S A;  4GFB A;  3G3Z A;  2EB7 A;  4IJA A;  5J40 A;  1FOK A;  3S1R J;  2ZSH B;  2DMQ A;  1YLF A;  2PI0 A;  3K7A J;  5HDG A;  4CZC A;  1MDM A;  1E3H A;  3OYE A;  3P9K A;  5EJC A;  2X48 A;  4GYG A;  1OCZ H;  3CLQ A;  2VIX A;  4ABZ A;  4B43 A;  4HOB A;  3G2B A;  4LB6 B;  1S7O A;  2CW8 A;  4S0H B;  3BR1 A;  3KZZ A;  1JHH A;  3BDD A;  1OQY A;  2I10 A;  4I76 A;  2EK5 A;  1O3T A;  2JUG A;  2V1N A;  3OYC A;  4OIQ F;  3T1B A;  3PSI A;  2HVQ A;  2CFO A;  2ZFW A;  2O5R A;  2ECC A;  3F3X A;  3F8M A;  4NC7 A;  2FUG 2;  4W1U A;  5EDN A;  3SXY A;  4OMY A;  3A2K A;  6PAX A;  3RYR A;  2FOW A;  2W00 A;  3CUQ A;  2JA2 A;  3CCE I;  2VON A;  3ZOB A;  1OYW A;  2XPU A;  3L2Q A;  2LY1 A;  5L3C A;  1R5I D;  3F8N A;  2W24 A;  4RB2 C;  1S3J A;  4ENJ A;  3I59 A;  2OCE A;  2IT0 A;  1APL C;  3JR9 A;  2DQR A;  2QLZ A;  1KQ8 A;  4XR6 A;  3U2R A;  1B9M A;  1G3S A;  4FT8 A;  3GTQ J;  1KQ9 A;  5KNL A;  4BS9 A;  3PJR A;  2IP2 A;  3MFK A;  3CO6 C;  4RAZ A;  4EGY A;  1LUJ B;  2RNG A;  3WE2 A;  3WU2 C;  3E1S A;  2LH9 A;  2PX9 A;  2JRM A;  2ELK A;  4UV9 A;  1SVO A;  1AU7 A;  2KRH A;  3KX2 A;  4HDV A;  2JQ7 A;  2QYO A;  3ZGK A;  3RZO J;  3AFH A;  4RAY A;  2EZH A;  3TED A;  5CYV A;  4ZYA A;  5KHD A;  1VQL I;  2FOK A;  1TW2 A;  2V1D A;  3X2Q H;  4FHT A;  1YRN B;  3QU6 A;  1SMT A;  1QPI A;  2OF7 A;  3LST A;  1BC7 C;  3R61 A;  2O9L A;  3DBR B;  4BEH A;  4KIT B;  3HSE A;  4ZJZ A;  2VT3 A;  3HHG A;  1Z6T A;  4A0Z A;  4DYQ A;  5J1Y A;  2IPQ X;  3PIO F;  1XCV A;  2CUE A;  1QNT A;  5J6X A;  1G6N A;  3MCZ A;  3ECH A;  4A6D A;  4DBQ A;  3HOW J;  1R1U A;  3LL7 A;  3HUG A;  4XIC A;  2HQR A;  1TBX A;  3DLA A;  2F5E A;  5EG0 A;  2BXZ A;  2KFD A;  3DPU A;  2NYX A;  4HLY A;  1OCC H;  2BVL A;  5TJJ A;  4FTH A;  4A3G J;  1H8A C;  3L00 A;  4LIT A;  3GX4 X;  1FBQ A;  3E97 A;  1TLH B;  3BLY A;  1AKH B;  3D0S A;  3OYH A;  3S17 J;  3N05 A;  3JRC A;  1EKE A;  2MH9 A;  4UY8 I;  5ILU A;  3K1P A;  4PDK A;  3REO A;  4EJV A;  3ONQ A;  1MBE A;  2R0Q C;  2A61 A;  3IH2 A;  5J4Y A;  1ETW A;  2WBM A;  1L0O C;  2L2O A;  1R1T A;  4G9Y A;  4XLA A;  4C9Y A;  3HOT A;  4RAF A;  1N25 A;  2QSH X;  1YTY A;  3S16 J;  1SD6 A;  4Y15 A;  3V42 A;  1ETY A;  2HWV A;  2EFQ A;  2RVC A;  2K4B A;  3GTJ J;  5EGO A;  2KPM A;  1T95 A;  3M3Y J;  3MAJ A;  3SZP A;  5F0C A;  3NWS A;  1VQN I;  5HLH A;  2AS5 F;  1FMW A;  5K5O A;  2EA2 A;  2BHY A;  2E1M B;  3TOB A;  3HKZ A;  4CCN A;  3ML6 A;  1S72 I;  3U9G A;  4BXU A;  3BWG A;  1YOV B;  1VZ0 A;  2QEN A;  1Z77 A;  2IBD A;  4CO8 A;  4DGW B;  3RTR A;  2ZSI B;  4L5I A;  2DOE A;  4BDZ A;  4XON A;  4B09 A;  3CUQ B;  3CCU I;  4OIO F;  1ZG1 A;  3DWL E;  3FIW A;  3QU3 A;  1XMA A;  3FWE A;  1UHW A;  3I59 B;  5HNF A;  1KA8 A;  1SEU A;  4IHY A;  4XNF A;  1S7E A;  1WJC A;  1B8I B;  4UUV A;  1MBF A;  2CGP A;  3NEU A;  5K1Y A;  5J4V A;  1QVT A;  2W48 A;  2CV2 A;  3NRV A;  2LYC A;  2PFB A;  4KJZ A;  2CMP A;  4EJU A;  1X1C A;  4II2 A;  3WG9 A;  3OOU A;  4LK0 F;  1SFO J;  1ENH A;  2L9N A;  4RA2 A;  3HDD A;  2DTR A;  1W7P B;  3MZ8 A;  4Y4R A;  5JVT A;  2P8T A;  1RZ4 A;  1UFM A;  2HPI A;  3ASO H;  4YFN F;  4B1R A;  1WCM J;  5HS8 A;  1XS9 A;  5E3L A;  4HYE A;  1MJ9 A;  2F5D A;  1VQ8 I;  4HQM A;  1CGP A;  4C30 A;  4BE2 A;  3WTZ A;  1A5J A;  1Z3X A;  1IO2 A;  5GAH J;  1T0F C;  2CQQ A;  3B73 A;  4DW6 A;  3P5J A;  2XUB A;  3E5U A;  2EFO A;  5E1Z B;  3J7A O;  2BW3 A;  1MBH A;  2LBF B;  3G71 I;  2Y0S N;  3OYD A;  3DCF A;  5EG0 B;  3ABT A;  4ESB A;  3RJP A;  2OBP A;  1ZG5 A;  4PK4 A;  1TT5 B;  2VOP A;  1UB9 A;  2PMU A;  1IV6 A;  1IUY A;  4MIM A;  1PVE A;  4B47 A;  1G3W A;  2HYJ A;  2A68 F;  1YHQ I;  4IOC F;  2X1E A;  4Y3O A;  2XVC A;  1Z6R A;  3CCY A;  3OYM A; 
#chains in the Genus database with same CATH homology
 1D8J A;  1ZN2 A;  2NNN A;  1J7K A;  5F6F A;  2ZO4 A;  1HKS A;  1XGM A;  1WSU A;  1ZAR A;  4KT5 C;  2CYY A;  4G8X A;  2BYV E;  2L4A A;  4RGR A;  2Q8K A;  3PFI A;  4MEX F;  5DD4 A;  3FMQ A;  3WTW C;  1ZG3 A;  1FP1 D;  1F9N A;  1U5T C;  5K5R A;  4ZZL A;  3TGN A;  5HVQ C;  3WGH A;  3FM3 A;  2YSR A;  2EV6 A;  1WRJ A;  3HIF A;  2P4W A;  4N9H A;  4CIC A;  2ZJ2 A;  2O6G E;  3TO7 A;  4HF2 A;  5FB2 A;  2YU3 A;  4G6Q A;  4GGG A;  5LHG A;  2M5W A;  2OAZ A;  3QP5 A;  2RKH A;  3TDU C;  3HRT A;  4LB5 A;  1S7A A;  3BZ6 A;  1P6R A;  2PMH A;  2E7X A;  5F1R A;  2MLG A;  4I0B A;  3CUO A;  4GCV A;  3HHH A;  3Q5F A;  1KYZ A;  3RKW A;  1ZAO A;  4RB0 A;  1C0W A;  1FLI A;  5ILS A;  1IN7 A;  5DUK A;  2CW0 F;  2ZXJ A;  2ZNZ A;  1SD7 A;  1B1B A;  2E1C A;  4LG0 B;  4HAM A;  3TQN A;  3GYH X;  3V8L A;  2P6S A;  2J5P A;  3P7N A;  4R8H A;  1A04 A;  2A6E F;  1XGO A;  2XAJ A;  2D1H A;  2FXA A;  3E3V A;  5D5W B;  2KIU A;  2K86 A;  4G7O F;  4F7Z A;  5K5Q A;  2GIV A;  1V3F A;  3ECO A;  3ZMU A;  5ERI A;  1LDD A;  3K0L A;  3GZ6 A;  2GXB A;  1Z1D A;  2H6B A;  4AD9 A;  4OOI A;  2HOE A;  4Q48 A;  3ZP5 A;  5BS6 A;  1G3T A;  3LQR A;  2A07 F;  1ONV A;  1YYV A;  4U0W A;  3H3U A;  1PP7 U;  1IN5 A;  1CF7 A;  4L18 B;  2AXL A;  5ICF A;  4I98 B;  1EH7 A;  4MQ9 F;  1E17 A;  1WI9 A;  4LMY A;  4EJT A;  2ZME B;  1ZLK A;  2PJP A;  1LEB A;  3I4P A;  2QWW A;  2XAF A;  2HGC A;  4AVP A;  1RI7 A;  2ZKZ A;  5LGN A;  3CTA A;  5IT9 K;  3GXO A;  3GVA A;  5H20 A;  4DQ2 A;  5FD5 A;  1K78 B;  2CQK A;  1FBS A;  4BQA A;  3H92 A;  1Z9C A;  2GQQ A;  3KP2 A;  4ZH4 F;  4LJZ F;  5ED4 A;  1XDS A;  1W5S A;  5ICE A;  2L54 A;  3EYI A;  3CO7 C;  1GXP A;  3LWF A;  1B59 A;  3EUH A;  2W85 A;  3V7S A;  1GXQ A;  2XKP A;  4CGZ A;  3TO9 A;  2L02 A;  4AIH A;  5FFX A;  4EJO A;  5CVV A;  3K1N A;  4MTE A;  4XSZ F;  2L4M A;  1QQI A;  4JK1 X;  4S05 A;  2HDC A;  5HLI A;  5HLG A;  1MZB A;  3IC7 A;  4O5V A;  1Z7U A;  2Q0O A;  3IHU A;  1LNW A;  4HV5 A;  1O7F A;  1Y0U A;  5L3E A;  4I0A A;  1R22 A;  2P5L C;  3GEZ A;  4LLL A;  4IPA A;  3JSO A;  1BI0 A;  2W25 A;  4WXC A;  3FM5 A;  1G3Y A;  1FT9 A;  3L9F A;  4AWX B;  2FMY A;  1T98 A;  2DBB A;  4YFX F;  4OIN F;  5E18 F;  3GO5 A;  5ICC A;  1FYK A;  3HRM A;  3ZMZ A;  2Z33 A;  2ELH A;  1HKT A;  1J75 A;  2HQN A;  4RS8 A;  1JXS A;  5FGM A;  1J2X A;  2TDX A;  5IT9 Z;  4CHU A;  4ASN A;  3GFJ A;  1H0M A;  1B6A A;  1ZRE A;  4IVN A;  2F5C A;  1IN4 A;  5FD6 A;  2B0L A;  1O3S A;  2COM A;  1LJ9 A;  1O7L A;  3CUQ C;  4XBF A;  2XRN A;  2OA4 A;  3LFK A;  3EET A;  1YW9 A;  3S2W A;  3WTS C;  3GUD A;  3KET A;  4NHJ A;  5E8I A;  2A6H F;  1YS6 A;  2FBI A;  3QPT A;  4L0Y B;  1I27 A;  1U8R A;  4EGZ A;  2HZT A;  1R58 A;  3E6D A;  2MA3 A;  4UV8 A;  4JQF A;  2PBI A;  4FX4 A;  4S04 A;  3JSP A;  3E6C C;  5L3F A;  3Q9V A;  2VBX A;  1W7P A;  3QPH A;  5E1X A;  3E5X A;  2BV6 A;  4AIK A;  1W7P D;  3JTG A;  1YFH A;  4U7B A;  3JAM Z;  2VE9 A;  3DPL C;  1BI2 A;  3L7W A;  2NNY A;  1U2W A;  4Q47 A;  2K7L A;  4KIG A;  1HKQ A;  5CVJ A;  2YX4 A;  1SAX A;  3KCC A;  3WU0 A;  3ULQ B;  4BHC A;  4MGR A;  2CG4 A;  2FBK A;  3I53 A;  3JTH A;  3MZY A;  5D5U B;  3DF8 A;  2DLL A;  5LHI A;  4ENM A;  4LFU A;  3O6B B;  1R7J A;  1RUN A;  2HTJ A;  1OKR A;  3E6B A;  4EJW A;  3VB2 A;  5KK1 A;  2FE3 A;  2K02 A;  2CSO A;  1UHM A;  2UXX A;  3J80 K;  5TRD A;  1F5T A;  3R6S A;  3J81 K;  4HQE A;  3AAF A;  1NHA A;  3DV8 A;  5L3D A;  1QZY A;  1P4A A;  1DUX C;  1J5Y A;  3BRO A;  4YIF A;  2H6C A;  2QQA A;  4A0X A;  1P2F A;  5L3G A;  2WWY A;  5EEG A;  4GYI A;  4WWC A;  1AOY A;  2RN7 A;  5D6E A;  4U7D A;  1IZ1 A;  5DYM A;  2BGC A;  1WKM A;  4HDU A;  4M9X A;  4HX7 A;  3MEX A;  3GFI A;  1RIO H;  4Y17 A;  2JPC A;  3LA2 A;  5E20 A;  2KIM A;  1FYL A;  4HBL A;  5AIQ A;  3H3Z A;  4A0Y A;  4HF1 A;  2QZ8 A;  2ZNY A;  2FEZ A;  3RPQ A;  3I54 A;  5HDN A;  3Q9S A;  5A2Q K;  2X0L A;  5E1W A;  3R60 A;  1OMI A;  3DP7 A;  1WWX A;  3IRQ A;  2FQ3 A;  3R0A A;  2VXZ A;  4G7H F;  2DAO A;  2KKO A;  3M8F A;  4KDP A;  2FU4 A;  5CJ9 A;  3WE3 A;  4ZYG A;  1FZP B;  2BE5 F;  5FLX K;  4QWQ A;  5LRS A;  3RPU A;  4IRG A;  1R5G A;  1IXS B;  3GF2 A;  3T8T A;  2KJB A;  1D8K A;  2PG4 A;  1LVA A;  3IRR A;  4KMF A;  3RDI A;  2R7F A;  5ICG A;  2VN2 A;  4LG0 A;  4KIC A;  2QUF A;  3IKT A;  2W84 A;  3HYI A;  3SQN A;  3QAH A;  2X4H A;  1ZGA A;  1IW7 F;  1XGS A;  3MWM A;  3N4M A;  2M8E A;  4WF2 A;  1W5T A;  2XAS A;  2OQR A;  3HTS B;  2HKX A;  2WV0 A;  3MZH A;  1STZ A;  1U3E M;  2FA5 A;  1YW7 A;  4Q4Z F;  4XRF A;  4LLN A;  2PN6 A;  1ON1 A;  2F5F A;  2VOD A;  2IRF G;  4RGX A;  4CDG A;  2ACJ A;  1B4A A;  3K69 A;  4O6J A;  1BI3 A;  1EH8 A;  3DQV C;  1HBX G;  1AWC A;  2XIG A;  4JBA A;  2ZME A;  2O61 A;  1O57 A;  3W6K B;  2VE8 A;  1FSE A;  2DPD A;  4XLP F;  5JR3 A;  4M6X A;  5AIP A;  4EQQ A;  4KN4 X;  1R1V A;  2EWN A;  1K78 A;  4A2U A;  2DW4 A;  3B02 A;  1R23 A;  3L2C A;  5HS9 A;  1TQP A;  4DNC A;  5BQT A;  2PLY A;  2EV0 A;  2V1X A;  5HDK A;  2GA2 A;  3C18 A;  4KIF A;  1FC3 A;  2MLK A;  3V7R A;  1SD5 A;  3FHZ A;  3CLO A;  3V8J A;  2HYF A;  2QQ9 A;  2DPU A;  1QZZ A;  1FY7 A;  3KFW X;  3FXU A;  3M9A A;  1F1Z A;  2EFN A;  2P6T A;  3BY6 A;  1BOA A;  5DCM B;  4CYD A;  1Z05 A;  3WTX C;  3VEP A;  3QP6 A;  1LB2 A;  2H09 A;  1Q1H A;  3TKY A;  1VTN C;  2Z9O A;  1ZLJ A;  1IN6 A;  1TNS A;  2O8X A;  4IHT A;  1KU9 A;  2L3D A;  4LK1 F;  5D6F A;  1BJA A;  1ULY A;  2MD5 A;  5LLQ A;  3I58 A;  4YG2 F;  1KU2 A;  3RKX A;  1HW2 A;  1KU3 A;  1XB4 A;  2XRO A;  2A3S A;  2V6C A;  5L3B A;  4BNC A;  3P9I A;  5DD8 A;  1BI1 A;  2G7H A;  4KUM A;  1YS7 A;  3CJN A;  4WX9 A;  1J59 A;  4M74 A;  1ZYR F;  3I71 A;  1FWZ A;  2QQB A;  2UWM A;  3DEU A;  5LHH A;  3SZT A;  1SMY F;  4PGG A;  3KEO A;  4RB3 C;  4ON0 A;  2VBY A;  1U5T B;  5D4R A;  1LEA A;  5D8K B;  4HW0 A;  3WTV C;  1J0R A;  1LDK B;  2RQP A;  2H94 A;  5CVI A;  3OOP A;  3VOD A;  4G94 A;  5JHU A;  2H27 A;  2D2W A;  1KQ0 A;  2RDP A;  5BOX A;  1HW1 A;  3LAP A;  3RYP A;  3ABU A;  2DO7 A;  1U78 A;  3HTU A;  2UXN A;  4R79 A;  2V1U A;  3F8C A;  4G7Z F;  5HS7 A;  3WTU C;  1YQA A;  2XAQ A;  4IXA A;  3WGG A;  3KEQ A;  3GWZ A;  4ENN A;  1SFE A;  1BBY A;  2IA2 A;  3OV8 A;  4PGH A;  4WXH A;  2STT A;  4KFC A;  4XSX F;  2YPR A;  4ZYE A;  2ZBK A;  2DK8 A;  2GAU A;  2K27 A;  4R1H A;  4KN7 X;  2NRA C;  4PZJ A;  3C7J A;  2EFW A;  4CXF A;  3VFZ A;  1P92 A;  2IW5 A;  2PEX A;  1JHF A;  3WTY C;  1MGT A;  1BN5 A;  4EM2 A;  3HSR A;  3P9C A;  2O3F A;  3COA C;  5LBQ A;  2FBH A;  2FSW A;  2LKP A;  5EEH A;  2ISZ A;  4M72 A;  3ZN0 A;  2QBY B;  1RUO A;  3EQL F;  1K6O A;  2BEO A;  3D5L A;  2C6Y A;  1I6X A;  4HF0 A;  4NQW A;  3KP6 A;  4MHG A;  1J9I A;  3WTT C;  1BIA A;  3LA3 A;  5DDG A;  2LNB A;  1P4W A;  4B8X A;  3K1M A;  3ISP A;  3BJO A;  5DCF A;  4E70 A;  4MQV A;  3IWZ A;  2JSC A;  3R4K A;  1D5V A;  2NAZ A;  1XCB A;  1UCR A;  3SHF A;  2VT2 A;  3M8E A;  3F23 A;  3T0Y A;  4BH9 A;  4KMU X;  3DXJ F;  1T38 A;  3LA7 A;  1TQI A;  2XV4 S;  3E6M A;  3R0J A;  3ZMT A;  5KVR A;  2HR3 A;  5FO5 A;  2IA1 A;  2P7C B;  2R7D A;  2ESN A;  3V4G A;  2OQG A;  3N97 A;  3F6V A;  1ZRF A;  3E5Q A;  4L9J A;  2JPB A;  4I02 A;  2L01 A;  4ZYH A;  3GLX A;  4N0B A;  2VC0 A;  1E2X A;  3NQO A;  2FRH A;  2VC1 A;  3L09 A;  2XAG A;  4NB5 A;  1YG2 A;  3GFL A;  3EYY A;  2GXG A;  3JW4 A;  2Y75 A;  4KNY A;  1R00 A;  4WK8 F;  1X3U A;  4LLG F;  1PDN C;  1KGS A;  1MJA A;  4LD5 A;  1S6L A;  1TW3 A;  2JZY A;  2M30 A;  4N9I A;  2MC3 A;  1ODD A;  2MH2 A;  5LGU A;  1XSD A;  4UXN A;  3MQ0 A;  2P7V B;  4FX0 A;  4L5J A;  1T2K A;  2XAH A;  2HKO A;  4KYW A;  1MD0 A;  5J8C A;  1IXC A;  3QRF F;  4EMS A;  1DPU A;  1XDU A;  1ON2 A;  4M73 A;  2EFP A;  4IHS A;  2OZ6 A;  3VOE A;  1RNL A;  1T39 A;  4WCG A;  3KE2 A;  5D5V B;  3O3K A;  5D8L B;  5BMZ A;  3FZV A;  2NS0 A;  3G73 A;  3ERE D;  1OPC A;  2FML A;  2Z3Y A;  3BPV A;  3FXQ A;  3V8K A;  4GO1 A;  3IKV A;  2WC2 A;  3DFG A;  1BM9 A;  1DPR A;  3KP4 A;  4OIR F;  3PQJ A;  3ZPL A;  2KRF A;  4UVB A;  2OZU A;  1S29 A;  1YIO A;  2ZCW A;  1MDM B;  5ILV A;  1TTY A;  3M1E A;  1HXD A;  3K2Z A;  2RGV A;  1R5H A;  3QOP A;  3I0T A;  4IF4 A;  1L3L A;  3F22 A;  2E1N A;  4BHB A;  2P5K A;  1JGS A;  2RC4 A;  1DP7 P;  3IL2 A;  2HFH A;  1QPM A;  3ZMS A;  1QGP A;  2QM3 A;  3M7G A;  1ZGJ A;  1HW5 A;  4KA4 A;  2HS5 A;  4IRH A;  2J5O A;  5F64 A;  4TV7 A;  2D45 A;  3F6O A;  4M71 A;  2UZK A;  2Y48 A;  2R3S A;  4U88 A;  3HSF A;  1REP C;  3GW2 A;  3GFM A;  1I1G A;  1W4M A;  1XN7 A;  1QBJ A;  1UST A;  2VBZ A;  4UHT A;  1G4D A;  1XMK A;  2W57 A;  2M45 A;  3J80 Z;  3LAJ A;  3J81 Z;  4IRI A;  2DI3 A;  3T5X A;  5DCM A;  3SFZ A;  3I64 A;  1T0F A;  1O3R A;  4CZZ A;  2DK5 A;  2F2E A;  4QLC U;  5JFR A;  1FYM A;  2EA4 A;  1FX7 A;  4HZF A;  2G7U A;  3I5U A;  2QVO A;  1LQ1 A;  1WQ2 A;  4BAY A;  4YFK F;  1HST A;  5CVU A;  3ELK A;  2V9V A;  3WGI A;  1FNN A;  2E7W A;  4EV0 A;  1JE8 A;  1XSX A;  5LEK A;  1HQC A;  2GWR A;  1GVJ A;  2KJC A;  5LRR A;  1ZHF A;  2IJL A;  4YII A;  1B9N A;  4P96 A;  4D0P A;  2FNP A;  5A2Q Z;  1F4K A;  1OYI A;  4L0Z B;  4HLX A;  1V4R A;  5DV5 A;  4WXD A;  5H6R A;  4Y13 A;  3RI4 A;  3WOD F;  3TOA A;  1HSJ A;  1SD4 A;  4UVA A;  4ZZD A;  1U5T A;  4ENK A;  1MJB A;  3KLO A;  4P9U A;  1T6S A;  1IXR C;  2ISY A;  1IAW A;  2M87 A;  5FLX Z;  1ZH5 A;  3EDP A;  3KP7 A;  2JRT A;  4ZYD A;  3K9T A;  4RGS A;  3BP8 A;  4P5O A;  1R36 A;  1XD7 A;  2Q2E A;  3HRS A;  1IN8 A;  1I1S A;  4RB1 A;  5AON A;  2HYG D;  3F21 A;  4HV6 A;  5DEQ A;  5IT3 A;  1ZRD A;  3TO6 A;  1K7A A;  2HEO A;  2M1B A;  5HOO A;  3BPX A;  3C1D A;  1PUE E;  1EV7 A;  1MKM A;  1LDJ A;  3F8B A;  2GZW A;  4Z2Y A;  5BPD A;  4UVC A;  4MNU A;  1SFU A;  4G6D A;  4O3M A;  1IRF A;  4H0E A;  2EV5 A;  2CFX A;  1YO5 C;  2YR2 A;  4Q5S F;  2V79 A;  2CO5 A;  3GZ5 A;  5H6Q A;  4A12 A;  1H9G A;  3ZQ7 A;  2VBW A;  3BJ6 A;  4EM0 B;  1KYW A;  4UNO A;  4I2O A;  5BPI A;  2DT5 A;  1PP8 F;  2K4J A;  4P55 A;  4A6E A;  4HX4 A;  4OU0 A;  4LGW A;  1IF1 A;  4U0V A;  1FSH A;  2O0Y A;  2RV8 A;  2QBY A;  3O2P E;  4EM1 A;  1YW8 A;  1GHC A;  2XGX A;  4ESJ A;  2CWE A;  2OD5 A;  2JT1 A;  3W6J B;  4M9S A;  2MBF A;  4PCQ A;  1OR7 A;  3KP3 A;  1TQM A;  1U6G A;  1SFX A;  3BJA A;  3KP5 A;  3KZY A;  1O3Q A;  2DQL A;  4L9T A;  2LSO A;  1XGN A;  2D1V A;  3ROU A;  2FF4 A;  1I5Z A;  1OYY A;  4P9F A;  4HA8 A;  3F8F A;  5D5X B;  4BYY A;  3V7C A;  1BC8 C;  5FFZ A;  2O03 A;  3IWF A;  1FBU A;  2A5Y B;  3U1D A;  1Z91 A;  3F72 A;  1FP2 A;  3FF5 A;  5LGT A;  4RGU A;  3HRU A;  4K2E A;  1XSV A;  3HOS A;  2Z5U A;  4I01 A;  2DFI A;  1KU7 A;  2XHK A;  1P4X A;  2EJR A;  2BBY A;  3DPT A;  4A5N A;  4HX8 A;  2STW A;  2KIF A;  2ADU A;  2JTV A;  3DKW A;  3KLN A;  1IRG A;  2GA1 A;  4L9V A;  4U0Y A;  3BOQ A;  2RNJ A;  2ESH A;  2FNA A;  5CLS A;  3C3W A;  2YX7 A;  2WTE A;  1K79 A;  3LQQ A;  2PQ8 A;  1DDN A;  3CDH A;  3TDZ C;  3RKY A;  2Y0M A;  4MEY F;  2DU9 A;  4AIJ A;  3ZN1 A;  1BIB A;  4M9Z A;  1TNT A;  4ESF A;  2HTS A;  2A69 F;  5LEJ A;  4ETS A;  2OU2 A;  4L9N A;  5DUI A;  3PQK A;  1QO0 D;  5J8F A;  2G9W A;  1H9T A;  2XKO A;  2LF8 A;  3JAM K;  4A5M A;  1EH6 A;  2IA0 A;  2LDU A;  3FMR A;  4OIP F;  4BHP A;  3FMS A;  1CF7 B;  2P5V A;  3FX3 A;  4I09 A;  3ZMV A;  2LF7 A;  5E8G A;  1ZRC A;  4M6Y A;  3RIR A;  2Z99 A;  4OMZ A;  1FPQ A;  3T8R A;  5E17 F;  2ETH A;  5JI6 A;  1USS A;  3ZMD A;  1S8N A;  3WU1 B;  1D3Y A;  5CVR A;  4I7H A;  4XLN F;  3FXR A;  4EVI A;  2IVM A;  4KIB A;  2VOO A;  4MTD A;  4GXO A;  5D4S A;  3G3Z A;  2EB7 A;  4IJA A;  1FOK A;  1YLF A;  2PI0 A;  1MDM A;  5HDG A;  3P9K A;  4GYG A;  4HOB A;  4LB6 B;  1S7O A;  3KZZ A;  1JHH A;  3BDD A;  2EK5 A;  1O3T A;  4OIQ F;  3T1B A;  2ZFW A;  3F3X A;  3F8M A;  3SXY A;  4OMY A;  6PAX A;  3RYR A;  3CUQ A;  2VON A;  1OYW A;  5L3C A;  3F8N A;  2W24 A;  4RB2 C;  1S3J A;  4ENJ A;  3I59 A;  2IT0 A;  2DQR A;  2QLZ A;  1KQ8 A;  3U2R A;  1B9M A;  1G3S A;  4FT8 A;  1KQ9 A;  2IP2 A;  3MFK A;  3CO6 C;  4RAZ A;  4EGY A;  3WE2 A;  4UV9 A;  4HDV A;  2QYO A;  4RAY A;  5CYV A;  2FOK A;  1TW2 A;  2V1D A;  4FHT A;  3QU6 A;  1SMT A;  3LST A;  1BC7 C;  3R61 A;  3HSE A;  2VT3 A;  3HHG A;  1Z6T A;  4A0Z A;  2IPQ X;  1XCV A;  1QNT A;  5J6X A;  1G6N A;  3MCZ A;  3ECH A;  4A6D A;  1R1U A;  3HUG A;  2HQR A;  1TBX A;  2F5E A;  2NYX A;  4HLY A;  5TJJ A;  3L00 A;  3GX4 X;  1FBQ A;  3E97 A;  1TLH B;  3D0S A;  2MH9 A;  5ILU A;  3K1P A;  4PDK A;  3REO A;  4EJV A;  2A61 A;  1L0O C;  1R1T A;  4G9Y A;  3HOT A;  1YTY A;  1SD6 A;  4Y15 A;  2HWV A;  2EFQ A;  2RVC A;  2K4B A;  3MAJ A;  3SZP A;  5HLH A;  2AS5 F;  5K5O A;  2EA2 A;  3TOB A;  3ML6 A;  3U9G A;  4BXU A;  3BWG A;  2QEN A;  4CO8 A;  3RTR A;  4L5I A;  4B09 A;  3CUQ B;  4OIO F;  1ZG1 A;  3QU3 A;  1XMA A;  3FWE A;  1UHW A;  3I59 B;  1KA8 A;  4UUV A;  2CGP A;  3NEU A;  5K1Y A;  3NRV A;  2PFB A;  4EJU A;  3WG9 A;  4LK0 F;  2DTR A;  1W7P B;  5JVT A;  2P8T A;  1RZ4 A;  1UFM A;  4YFN F;  5HS8 A;  4HYE A;  1MJ9 A;  2F5D A;  4HQM A;  1CGP A;  3WTZ A;  3B73 A;  2XUB A;  3E5U A;  2EFO A;  5E1Z B;  3J7A O;  4ESB A;  3ABT A;  3RJP A;  2OBP A;  1ZG5 A;  2VOP A;  1UB9 A;  2PMU A;  1IUY A;  1G3W A;  2A68 F;  2XVC A;  1Z6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...