1RIOH

Structure of bacteriophage lambda ci-ntd in complex with sigma-region4 of thermus aquaticus bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 27-MER
publication title Structure of a ternary transcription activation complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rioH00
2FRHA 4N9HA 3FXUA 1AWCA 4A0ZA 3BROA 3BY6A 1IN8A 1KU3A 3I59B 3B73A 1IRGA 2DO7A 3WTYC 3FM5A 3LA2A 5HS9A 3MZYA 4EM2A 2HKOA 2OQRA 1XGMA 5HVQC 2DK8A 1HBXG 4XLPF 1I1GA 1R23A 5K5OA 4GCVA 4JK1X 2PN6A 4UHTA 3TKYA 4Y15A 2E1CA 2XKOA 1AOYA 3WODF 1FZPB 3EETA 5BMZA 4GYGA 3IRRA 4AWXB 2E1NA 4KFCA 1H0MA 1L0OC 3I5UA 1D5VA 2DT5A 1T39A 4M6YA 3CUQA 5FFXA 5F64A 2VT3A 3H3ZA 3GFJA 2OZUA 4LK1F 1ONVA 3ZP5A 2NNYA 3J81K 2Q2EA 3WTVC 4Q47A 4A2UA 5LGUA 1U5TB 3TGNA 3V8KA 3FM3A 1T0FA 1Z9CA 4S05A 2GAUA 2M5WA 5CVJA 5ILUA 4OOIA 3BPXA 4GXOA 3HUGA 4A5NA 4WXHA 1O3TA 2R3SA 1TLHB 2RNJA 1HKQA 2Z9OA 4KNYA 1BOAA 4HLXA 3GLXA 2VBYA 3DEUA 3C3WA 2ISZA 3AAFA 3F8BA 3E5QA 2HDCA 2LSOA 1XDUA 4AIHA 3L7WA 4BAYA 3REOA 3I58A 3PQJA 1YW9A 2M30A 1R58A 2VOPA 4A12A 5DCMB 4R8HA 5D6EA 1ON2A 4NB5A 2DFIA 3HSRA 4KYWA 2TDXA 1TQPA 3WTTC 4EM1A 3DFGA 1Q1HA 3CO6C 1IXSB 4BHBA 3WE2A 4IPAA 2A61A 3LAJA 2DPUA 3I59A 2L4MA 3IWFA 4B09A 5LEJA 5K5QA 4IHTA 1ZHFA 2EFOA 1ZARA 3GFLA 1JGSA 4G6QA 4MGRA 2EWNA 4R1HA 4OU0A 3J7AO 5DD4A 2P5LC 1HW1A 3M7GA 2OD5A 3FMRA 1SFUA 3NQOA 4UVCA 2H94A 3F23A 4HF2A 3RYPA 4P9UA 4PDKA 1PUEE 3H92A 3SQNA 3ABTA 1HW2A 3KETA 4HQEA 3F72A 5CVVA 3GZ5A 3WGGA 3SZPA 1SFEA 2ACJA 5HOOA 1TW2A 1MD0A 4M9SA 4JBAA 3LFKA 3EYIA 1KA8A 3F8CA 1KGSA 1G3TA 1UFMA 1SD7A 2HFHA 1XN7A 2BYVE 5FD5A 3I71A 1FBUA 1FSHA 3I64A 4HV5A 4HBLA 2D45A 3FXQA 4A5MA 1YW7A 4UNOA 4LLGF 4KN4X 1XSVA 2FMLA 2K4JA 4G6DA 1IUYA 4EVIA 1Z05A 3E3VA 3L00A 1YIOA 2BV6A 3KP7A 2LKPA 5L3CA 1W4MA 4BH9A 2DK5A 2F2EA 4LMYA 1IXRC 2RKHA 1IN6A 4YFKF 1XSDA 4I98B 3P9KA 2H6CA 3R6SA 4HX4A 4Y17A 1SAXA 4KIBA 4EJWA 1B59A 4HZFA 5F1RA 2V79A 1C0WA 3F8MA 3HRUA 2QVOA 1XCBA 4H0EA 1XD7A 2GWRA 3CO7C 5D8KB 5DCMA 5E18F 4XSZF 4KIFA 2F5EA 3ZMSA 2PJPA 3F6OA 3KP2A 4LB6B 5L3BA 5HDKA 2ZCWA 1B6AA 1P4WA 3T0YA 5CLSA 3Q5FA 1SD6A 4EJTA 1YYVA 4PGHA 3NEUA 1ZG5A 2FA5A 3V4GA 2A6HF 3HSFA 3OOPA 4IHSA 6PAXA 4LG0B 1YQAA 3WTWC 3GWZA 2FF4A 1B4AA 3LAPA 4M72A 1YS7A 1OR7A 4R79A 1GHCA 1W7PD 2HS5A 1BIBA 1LEAA 1QPMA 3KP5A 4EGYA 4BQAA 2KIMA 2JPBA 3T5XA 1XGOA 3K69A 4U7BA 3RIRA 3HOTA 2DBBA 2XIGA 5JR3A 4ENJA 2JSCA 3K2ZA 1MJ9A 1R7JA 1HW5A 4OIOF 1SMYF 4FHTA 1SMTA 5HDNA 5AIPA 2VONA 2CFXA 5CVRA 1WQ2A 4BYYA 1I27A 4WXCA 2Y48A 2MD5A 1FBQA 2KIUA 1D3YA 3CTAA 2KJBA 2IA0A 1BI3A 4RAYA 3TOAA 3J80Z 2STWA 3DV8A 2A6EF 3I54A 2MC3A 2ESNA 2PEXA 3FMSA 3V7CA 2LDUA 2BE5F 1MZBA 3I0TA 2RVCA 3QP5A 1OYIA 5BOXA 2G7UA 5A2QZ 4Q5SF 1HKSA 4KUMA 3RPQA 3ZPLA 2FNAA 5E1WA 5ERIA 4M9ZA 2RQPA 3W6JB 2HQRA 4RS8A 4IJAA 3ZQ7A 1KYWA 4IRIA 3FWEA 4KMUX 1XSXA 4AD9A 2P8TA 5FB2A 2FE3A 1K79A 1J9IA 2Q0OA 3ZN0A 3V8JA 4NHJA 5HLGA 3GYHX 3F3XA 2HYFA 2AXLA 3F8NA 1BJAA 2QLZA 3SZTA 5E8IA 2WV0A 4RGXA 2YX7A 1H9TA 1BI1A 1ZRDA 3E6CC 1FNNA 2IRFG 1Y0UA 2K02A 3R0JA 4MHGA 5HLIA 2V9VA 1FY7A 3BP8A 4MNUA 5DEQA 4P5OA 5FLXK 5D4RA 3EQLF 1D8JA 4HX8A 3NRVA 5CVIA 2DQLA 1STZA 5HLHA 3E5UA 3LQRA 4G94A 2PI0A 3L2CA 2DLLA 4WK8F 4RGUA 4Z2YA 2VE9A 5DYMA 4KA4A 2FSWA 1ZRFA 2C6YA 1TTYA 4IRGA 4D0PA 4G7HF 2VXZA 2M87A 1TNSA 4RB1A 4HF1A 1TQMA 1OYWA 1T2KA 4O6JA 1JXSA 1ZGAA 3K9TA 4HDUA 4I2OA 1UB9A 2A69F 1O7FA 4UXNA 2O6GE 1V4RA 3PQKA 2F5DA 1B9MA 4MQVA 1YLFA 4U0VA 3F6VA 3FX3A 4FT8A 4S04A 4P9FA 1R36A 3KLNA 4CO8A 3R61A 1OMIA 1IF1A 5EEGA 2EFNA 2QBYB 1XGSA 3T1BA 3T8RA 2COMA 2D1VA 2KIFA 4CZZA 1B1BA 2QQAA 1Z7UA 1F5TA 2L54A 2VN2A 5HS8A 4HDVA 4KN7X 4HW0A 1WSUA 3K1NA 2EA4A 3ZMVA 4G8XA 2PLYA 3RKWA 2DTRA 3TQNA 2X4HA 2IVMA 2QQBA 4HA8A 1XCVA 4QLCU 2PBIA 3G73A 5ED4A 5L3FA 1BBYA 3VFZA 2V6CA 3Q9VA 2IPQX 2HWVA 3COAC 2W57A 3KZZA 4ESFA 2L01A 4CHUA 1DUXC 1W7PA 4IXAA 4KMFA 4EM0B 2VT2A 1S7AA 2ZJ2A 3DPTA 4YIFA 2ZKZA 2GXBA 2KRFA 2VC1A 1E17A 1R00A 5H6RA 3HYIA 3MZHA 3K1MA 2QENA 1D8KA 2ELHA 3EYYA 2OA4A 5DDGA 1PP7U 3MFKA 1BN5A 3LA3A 3VOEA 1F9NA 4I02A 3VODA 4CXFA 1HSTA 4MTDA 2Z3YA 3KEOA 4LLLA 5DCFA 3WU0A 2ETHA 1KQ8A 4GYIA 1FX7A 3SXYA 1LDJA 3ELKA 5E1ZB 1L3LA 2GQQA 4HAMA 3DF8A 2A5YB 3U1DA 4EQQA 4YFXF 3HHGA 2HKXA 3E6MA 1P6RA 5ILVA 2VODA 1IN5A 2GZWA 4L9VA 4HQMA 2IT0A 2J5PA 1ZN2A 5TRDA 5CYVA 4PGGA 3VB2A 1TBXA 2JPCA 1ZYRF 4U88A 1K78B 3BJOA 3OV8A 4BHPA 4L9JA 1FBSA 1PDNC 1MJBA 3QRFF 5FD6A 2HTJA 4WWCA 1XB4A 2XVCA 4BHCA 3FZVA 5BPIA 2ZFWA 3RDIA 3ZMZA 2FBIA 5E1XA 2EK5A 2YSRA 4HV6A 4WF2A 1FWZA 5JVTA 4IRHA 2OQGA 2QBYA 3RI4A 3RPUA 4EV0A 1ULYA 3ZMDA 4YG2F 3IHUA 1OYYA 3DKWA 5ICFA 4L18B 4ASNA 2AS5F 3V7RA 5DV5A 5D6FA 3WTZA 4RB3C 1H9GA 1USSA 4GO1A 5LGTA 5HS7A 1FYMA 3CUOA 3HTSB 4ZZLA 4RAZA 3DXJF 5D5UB 2LF8A 3TO6A 2VBWA 2V1XA 2XAJA 3PFIA 2YR2A 5A2QK 4XBFA 3FXRA 5LHIA 3QPTA 2HTSA 1E2XA 2UWMA 3HTUA 3IC7A 1ODDA 2EFQA 4L0ZB 2ESHA 1U5TC 4G7OF 4UVAA 4OIRF 2ISYA 1G3WA 1KU7A 1LB2A 5BS6A 2K86A 2Z33A 3ZMUA 1Z1DA 1F1ZA 4BNCA 1YW8A 1G6NA 2HR3A 1ZAOA 3JSPA 4LGWA 4RGRA 3P9IA 2BGCA 5E8GA 4XRFA 2G7HA 2HOEA 2K27A 4P55A 4ETSA 4ZH4F 3M9AA 2EV0A 5E17F 2P5KA 1KYZA 4EJOA 3CLOA 5IT9K 4I01A 1MGTA 3O6BB 2IW5A 2PMHA 1MJAA 2XUBA 2L02A 1CF7A 1RUNA 1IAWA 1Z6RA 1P4XA 5ICCA 2L4AA 3E97A 2BEOA 4I0BA 3SFZA 2VE8A 4L5IA 1K78A 3R60A 1YFHA 3GW2A 2RV8A 1XMAA 5LEKA 1R5GA 3R0AA 2RN7A 2H09A 4LFUA 3WGHA 5LLQA 1QQIA 4KICA 3H3UA 2V1UA 4LLNA 4WXDA 2UXNA 2XGXA 2HEOA 2KKOA 3E5XA 4A6DA 1S7OA 1U8RA 4OIPF 1QGPA 2VOOA 3RKXA 3FF5A 2NNNA 3F21A 2MH9A 3JSOA 2DI3A 3T8TA 1LDDA 3F8FA 4UV9A 1EH8A 4MTEA 3ZMTA 5H6QA 1Z91A 2FMYA 1J0RA 3FHZA 2XHKA 2CG4A 1REPC 3L9FA 5ICEA 3WE3A 3EDPA 1FYLA 1QNTA 1JE8A 4LK0F 3O3KA 1KU9A 2H6BA 3GFMA 3TDUC 2XROA 1LEBA 4EJVA 3GFIA 5IT3A 5K5RA 1FP1D 2A3SA 4Q4ZF 4PCQA 5LBQA 1U3EM 2RDPA 3Q9SA 2LNBA 2XAGA 4CGZA 5KVRA 1HSJA 1G3SA 2DAOA 4G7ZF 3JAMZ 3IKVA 2KJCA 3TDZC 2XAHA 4PZJA 5ICGA 1WKMA 1JHHA 3KLOA 3VEPA 1W7PB 4N0BA 4CDGA 5EEHA 1MDMA 1EV7A 3RYRA 5H20A 1GXPA 5J8FA 2XAFA 2Z99A 3ECOA 1U78A 3BPVA 2O61A 1TNTA 4OMZA 2K7LA 3ECHA 2RC4A 5E20A 4RGSA 5DD8A 2WC2A 2CO5A 4RB2C 3KP3A 1A04A 3JW4A 3C18A 4CYDA 3K0LA 3KE2A 1RIOH 2JT1A 1G3YA 1FT9A 1S3JA 3BDDA 3ISPA 2DQRA 2GIVA 2HZTA 1JHFA 4O3MA 4CICA 4A0XA 2DU9A 2HYGD 3JTGA 5J8CA 3BWGA 4U7DA 1T6SA 1G4DA 2L3DA 4NQWA 1O7LA 2PMUA 4I09A 1TQIA 3KEQA 2ZBKA 3ML6A 1QZYA 4KDPA 5KK1A 2M45A 4EMSA 3QP6A 4MEXF 2P7CB 1J7KA 1S8NA 1B9NA 5JHUA 2IP2A 4M9XA 4MEYF 2ZMEB 3L09A 2PG4A 2YU3A 3WG9A 3ULQB 2XKPA 1IW7F 3P7NA 5LRSA 4DQ2A 5JFRA 4ZYDA 2DPDA 4HYEA 3QU3A 2IA1A 1P4AA 1FP2A 3QU6A 1ZRCA 4EGZA 2CQKA 3MAJA 4I7HA 3QPHA 3QOPA 3CDHA 3GVAA 2XRNA 2EA2A 3KP4A 4FX4A 2GXGA 2X0LA 1FYKA 2P4WA 1O57A 1S6LA 2VBZA 2OU2A 1U2WA 1KQ0A 3IRQA 2UZKA 3TO9A 3TOBA 5L3EA 2FXAA 2UXXA 1SFXA 4M6XA 1LNWA 5D5XB 1XGNA 3C7JA 3M8FA 1BI0A 1IXCA 2CYYA 4Q48A 1R5HA 3WU1B 4IF4A 3IKTA 2FOKA 3CUQC 1TW3A 4QWQA 4AVPA 2OBPA 4ON0A 5BPDA 2YPRA 4XLNF 4FX0A 4EJUA 4LB5A 1R1UA 1OKRA 3QAHA 2XV4S 2FNPA 4M74A 3WTSC 2FEZA 2PQ8A 2JRTA 5DUKA 2MA3A 4ZYGA 2QZ8A 5K1YA 1DPUA 5D4SA 5J6XA 4UUVA 1XMKA 4OIQF 4WCGA 5D5VB 2E7XA 1O3RA 1W5TA 1PP8F 5CJ9A 4E70A 1BIAA 5FFZA 4A0YA 5HDGA 4L5JA 3GZ6A 1YO5C 1ZG1A 1MKMA 5FLXZ 1BC7C 1EH7A 1CGPA 3BJ6A 2M1BA 2WTEA 3GXOA 3KZYA 3N4MA 2QM3A 1BI2A 3N97A 4UVBA 1ZLJA 3SHFA 1HXDA 1YS6A 2W25A 2W84A 4AIJA 4ZZDA 4ENNA 3D5LA 3O2PE 1RNLA 1IN4A 1LQ1A 2PFBA 2P7VB 1CF7B 3KCCA 3I4PA 2O03A 3DQVC 1ON1A 2F5CA 3JTHA 3S2WA 2Q8KA 4WX9A 1I6XA 3E6BA 5L3GA 2XAQA 2VBXA 2ADUA 1DP7P 3IWZA 1K7AA 1GXQA 4K2EA 4M71A 1J5YA 1J2XA 2ZMEA 2ZO4A 1V3FA 4L0YB 4M73A 1ZH5A 4U0YA 2W85A 4MQ9F 5FO5A 2FQ3A 2EFPA 5FGMA 3LWFA 3ABUA 3D0SA 2MLGA 3LSTA 4DNCA 1QZZA 1RUOA 5JI6A 1W5SA 1J59A 2O8XA 4OINF 1OPCA 2NAZA 2W24A 5TJJA 5AIQA 1YG2A 1IN7A 3P9CA 1EH6A 1QBJA 3E6DA 5ILSA 4O5VA 4HLYA 4TV7A 2NRAC 3J80K 2RGVA 2O3FA 3J81Z 3K1PA 3W6KB 3M8EA 2ZNZA 4HF0A 3GUDA 3HIFA 5F6FA 5DUIA 1IZ1A 1FPQA 1U5TA 3ERED 2FBKA 3M1EA 1HKTA 1USTA 1X3UA 3KP6A 1R1VA 4I0AA 2EV5A 3HHHA 3GX4X 2K4BA 1UHWA 2EFWA 3MCZA 4KT5C 2B0LA 4ESJA 1U6GA 2F5FA 5BQTA 4OMYA 2Y0MA 4GGGA 3MEXA 3RTRA 2OAZA 1DDNA 3JAMK 2HQNA 1MDMB 5D8LB 3IL2A 3ROUA 3TO7A 3HRSA 1ZLKA 2JZYA 3LA7A 2CWEA 2G9WA 3HRTA 1VTNC 1R22A 5LRRA 2DW4A 3KFWX 3MQ0A 4HOBA 1WRJA 2P5VA 4L9TA 3HOSA 4B8XA 1IRFA 1BC8C 2HGCA 1KU2A 3V8LA 3I53A 2OZ6A 1ZREA 4Y13A 1Z6TA 3MWMA 1P92A 1KQ9A 1SD5A 1F4KA 2Z5UA 2A07F 2MBFA 3DPLC 4IVNA 4F7ZA 1I5ZA 2CW0F 2NS0A 1QO0D 4LJZF 1P2FA 3GF2A 2QQ9A 1S29A 4N9IA 2MH2A 5L3DA 1K6OA 1DPRA 2CGPA 4UV8A 2FBHA 4P96A 2P6SA 2YX4A 1RZ4A 2QUFA 2MLKA 4U0WA 3BJAA 2EJRA 2EV6A 3RJPA 3EUHA 1RI7A 4YFNF 1ZGJA 3HRMA 1BM9A 3WTUC 4RB0A 4JQFA 1NHAA 4G9YA 1T38A 2R7FA 2JTVA 2P6TA 2NYXA 1FLIA 2BBYA 3U9GA 5LHHA 1LVAA 1GVJA 3V7SA 2M8EA 2EB7A 1O3QA 2ZNYA 3BOQA 3CUQB 4YIIA 2XASA 1XDSA 2GA1A 4KIGA 1LJ9A 2GA2A 4A6EA 2H27A 2CSOA 2R7DA 3GO5A 3G3ZA 4HX7A 4ESBA 2QYOA 5LHGA 4XSXF 2LF7A 1YTYA 2IJLA 4ZYHA 1O3SA 2A68F 4LD5A 3DP7A 3ZN1A 1SD4A 2O0YA 3F22A 4ENKA 2STTA 1LDKB 1WI9A 2E7WA 4BXUA 1T98A 4ZYEA 4AIKA 1R1TA 3CJNA 2Y75A 3U2RA 3B02A 2ZXJA 4L9NA 5AONA 5IT9Z 2FU4A 5LGNA 2V1DA 3RKYA 2D1HA 1FC3A 3C1DA 3BZ6A 3LQQA 1ZG3A 1J75A 5CVUA 3WTXC 2J5OA 4LG0A 2IA2A 3FMQA 2WWYA 5D5WB 1WWXA 4ENMA 1HQCA 3HSEA 3R4KA 1I1SA 1UHMA 3WGIA 1FSEA 1FOKA 2D2WA 1UCRA 2QWWA 2VC0A 3GEZA
chains in the Genus database with same CATH superfamily
2FRHA 3CCYA 4N9HA 3PNTA 3FXUA 3H35A 1AWCA 4A0ZA 3BROA 3BTIA 3BY6A 1IN8A 2VJJA 1XG1A 1KU3A 3I59B 2H8RA 3B73A 1IRGA 2DO7A 4KJZA 1UAAA 1WJEA 4ZYAA 3WTYC 1VQNI 3FM5A 3LA2A 1SFKA 5HS9A 3GTGJ 2DT6A 2R7RA 3MZYA 1N78A 1VQOI 4EM2A 2M7BA 2NVQJ 2HKOA 2OQRA 1XGMA 4BQNA 5HVQC 1VQMI 2DK8A 1HBXG 2VUMJ 3OYNA 1V55H 3TEDA 2L7MP 4XLPF 1RKWA 2E1MB 5B1BH 1FOWA 3HOVJ 1I1GA 4MFEA 1R23A 1OISA 3CJTB 5K5OA 3OYLA 1KONA 4MFDA 3CCUI 4GCVA 4JK1X 2PN6A 3L2RA 4UHTA 3VYSB 4Y7NJ 3TKYA 2X1EA 4Y15A 3ABMH 4PSXA 2E1CA 2XKOA 2KZVA 2LH9A 1AOYA 1NTCA 3WODF 3JREA 3TP0A 1FZPB 3EETA 3PJRA 5FROA 5BMZA 4GYGA 1A5JA 2ID3A 3IRRA 4AWXB 2E1NA 1WFXA 4A3LJ 3CCMI 4KFCA 1U0JA 1W5CC 1H0MA 2E34A 3DLAA 1L0OC 2OTJI 2DA3A 1JUSA 1WJAA 3I5UA 5CQGA 1FOXA 5IOYA 2NS7A 1D5VA 2DT5A 4II2A 1T39A 4A3JJ 2QQ8A 4M6YA 3CUQA 1EA3A 2R7ZJ 5FFXA 3KYCB 5F64A 2VT3A 3A0BC 3H3ZA 2XPWA 3GFJA 4Y33A 5K7HA 3OYBA 3OY9A 2OZUA 2CQNA 4LK1F 1FIAA 1ONVA 3ZP5A 3RZOJ 2LY2A 3FBIB 2NNYA 3J81K 2Q2EA 3WTVC 4RMNA 4Q47A 4A2UA 5LGUA 1ETWA 1U5TB 1JT6A 3KYDB 5E3LA 3DTKA 3TGNA 3V8KA 3FM3A 1T0FA 2Z1DA 1Z9CA 4S05A 2GAUA 4GDFA 1MMGA 2M5WA 5CVJA 5ILUA 1ETKA 4OOIA 3BPXA 4GXOA 2EZHA 3HUGA 4A5NA 4JX5A 1JJ8C 4WXHA 1O3TA 2R3SA 1TLHB 2RNJA 1MSFC 2N8GA 3Q0WA 1HKQA 2Z9OA 1ETXA 4KNYA 2VI6A 3I3LA 1BOAA 4HLXA 1ZELA 2CQQA 3GLXA 2VBYA 2KRCA 3DEUA 3C3WA 2ISZA 3AAFA 1XPXA 1R4MB 3F8BA 3E5QA 2G0EA 2HDCA 2LSOA 1XDUA 4AIHA 3L7WA 5FKMA 4BAYA 3REOA 3I58A 3PQJA 1JGGA 3SEZA 1YW9A 2M30A 3CC2I 1R58A 4XLCA 2VOPA 1MBGA 3H9JA 3CLQA 4A12A 5DCMB 4R8HA 4J00A 3AG2H 4BL0B 2BHYA 5D6EA 1ON2A 4NB5A 1R71A 2DFIA 4A3FJ 4KISA 3HSRA 3CESA 2JUGA 3LSMA 3L2VA 3KZIC 2EIJH 1I6HJ 4CYCB 2HOAA 4PFOA 1HLVA 4KYWA 2VASA 3ZQIA 2TDXA 1I3AA 2XGCA 1TQPA 3WTTC 2F4IA 3K4MA 4EM1A 2WAQA 3DFGA 2E2JJ 2FUG2 1V5GA 1Q1HA 1VQKI 3CO6C 1IXSB 2HU9A 4BHBA 3WE2A 3I4MJ 4IPAA 2LFBA 2A61A 2HYJA 3LAJA 2DPUA 3I59A 2ZXHA 2L4MA 3IWFA 2KPMA 1QA6A 4B09A 5LEJA 3M3YJ 5K5QA 4IHTA 2W1OA 1ZHFA 2EFOA 1ZK8A 5IYCJ 1ZARA 2E5ZA 3GFLA 1JGSA 4G6QA 4MGRA 2EWNA 4R1HA 3W6VA 4OU0A 3J7AO 5DD4A 2CV2A 3BCBA 2P5LC 1HW1A 3BT9A 3JRCA 3M7GA 3PUBA 2OD5A 2HNHA 3FMRA 4GFBA 4E7IA 1SFUA 3A01B 5JHFA 2LBFB 2B7EA 3NQOA 4UVCA 2H94A 3F23A 1YIJI 4HF2A 3RYPA 5EG0A 3AL0B 3S15J 3BCAA 2KDOA 3BR6A 3HPGA 3TP3A 3G1MA 2DA1A 2RNGA 4HSTA 4UB6C 1X1CA 4P9UA 3CCQI 2GBYA 4PDKA 1PUEE 3S3MA 3H92A 2LR8A 5DS9A 3SQNA 3ABTA 3A1YA 4CCNA 3JRGA 1HW2A 3KETA 4HQEA 3F72A 5CVVA 3GZ5A 3WGGA 3SZPA 1SFEA 2ACJA 5HOOA 1MBJA 1TW2A 1MD0A 5K7ZA 4M9SA 5IOZA 4QTRA 2VB6A 3IH4A 3KIOA 2R7TA 5M3FJ 4JBAA 3LFKA 1OLTA 3OL3A 5GTIC 5JVGF 1KA8A 3Q0UA 3EYIA 3F8CA 4M3GA 1FMVA 2PJRB 1KGSA 3S3OA 1G3TA 2VIXA 1UFMA 1SD7A 4F93B 3F0CA 3PUFA 1HC8A 4V19K 2XB0X 2I5UA 3SYTA 2HFHA 1XN7A 3DU6A 3I9V2 2BYVE 5FD5A 1H89C 3I71A 1FBUA 1FSHA 3I64A 4HV5A 3QYFA 3EUKL 1GV2A 3LNQA 4HBLA 3HOWJ 2D45A 3FXQA 4BBRJ 4A5MA 5CKTA 2HVQA 4A3BJ 4AIDA 2R7UA 1YW7A 2CUZA 4UNOA 1IDYA 4LLGF 4XL9A 4CCMA 2KHMA 1XSVA 2FMLA 2K4JA 4KN4X 5GADJ 4G6DA 1IUYA 4EVIA 2JN6A 1Z05A 3E3VA 4J19A 3L00A 1YIOA 2BV6A 1R4NB 2EZIA 3SFIA 3S1RJ 3KP7A 5F04A 2UUZA 2LKPA 5L3CA 1OCOH 4FASD 1W4MA 4XK4A 4BH9A 2M2EA 4A3EJ 2DK5A 2F2EA 4LMYA 4D7NA 2M34A 1V54H 1IXRC 2RKHA 4XN0A 1IN6A 3CQZJ 4YFKF 1XSDA 4DZJA 1Z3XA 4I98B 2ECBA 3P9KA 2H6CA 2JK3A 2W00A 3R6SA 5M3MJ 4HX4A 4Y17A 1SAXA 1B72B 4KIBA 3A0HC 1FOYA 3FK7A 4EJWA 1B59A 4W1UA 2CUFA 4HZFA 2NXNB 2K9QA 2ME0A 1F43A 5F1RA 2V79A 4DW6A 3C2HA 1C0WA 3A03A 3F8MA 3HRUA 2QVOA 1XCBA 4H0EA 1XD7A 2ICWG 2HPIA 2GWRA 4XRSG 1HCRA 5H2FC 3CO7C 5D8KB 5DCMA 4E7KA 5E18F 2DOFA 3DPUA 4XSZF 1TZLA 3HB9A 4KIFA 2F5EA 3KPHA 3ZMSA 2PJPA 3F6OA 3KP2A 3HOYJ 3P5JA 3OMYA 4LB6B 5L3BA 4J01A 1SANA 2ZFUA 5HDKA 1WH5A 2ZCWA 1B6AA 1ZGWA 4DBQA 1P4WA 3T0YA 4CYCA 5F08A 5CLSA 3ZXSA 5KAFC 3Q5FA 1SD6A 5GTHC 4EJTA 1IGNA 1TT5B 2O8KA 3OR2C 1YYVA 3MN2A 4PGHA 3NEUA 3OIPA 1Z0XA 1W0TA 1ZG5A 2QSGX 2R5ZB 4U87A 2FA5A 2KP6A 3V4GA 1X2MA 2EQRA 2QF7A 2H8WA 3CCJI 1SEUA 2A6HF 3HSFA 3OOPA 4IHSA 6PAXA 1Z77A 4LG0B 3RQ4A 1YQAA 3WTWC 2QCOA 3GWZA 4II3A 1LPQA 2FF4A 1B4AA 1D0YA 2CUJA 3HG9A 3LAPA 4M72A 1YS7A 5IYDJ 4AVZA 1OR7A 4R79A 1IV8A 2L9RA 3VDXA 1W7PD 1LE8B 1GHCA 3VWBA 4E7SA 2HS5A 2WADA 1AU7A 1BIBA 4ZDOA 2GOMA 1LEAA 1QPMA 2ZSIB 3KP5A 3OWTA 3GTQJ 3DU5A 4EGYA 1SFOJ 4BU2A 3A01A 4BQAA 2KIMA 2JPBA 2LBFA 3T5XA 3JRBA 1XGOA 3K69A 4U7BA 1SVOA 3H9QA 3RIRA 2LP0A 4IX7A 1BL0A 3HOTA 4B47A 3HOUJ 1VQ7I 5J1UA 3CD6I 2OV7A 2DBBA 2XIGA 5KHDA 3BQYA 5JR3A 4ENJA 2JSCA 3K2ZA 1MJ9A 1R7JA 1HW5A 3HJEA 2LKXA 3PIPF 4OIOF 1QVUA 1SMYF 5EF6A 2XF6A 1TT0A 3HKZA 4RM2A 1RC9A 4FHTA 1SMTA 5HDNA 2XDVA 5AIPA 3OS0A 5DM6F 2VONA 2CFXA 5CVRA 3NWSA 3RSNA 1WQ2A 3PNVA 4BYYA 2KFDA 2HVRA 2DTZA 4JP0A 2XAUA 1I27A 4WXCA 2Y48A 4A3DJ 2MD5A 2X6YA 3BG9A 4BXFA 1FBQA 2CQXA 1APLC 3G6EI 4HRIA 2KIUA 1D3YA 3CTAA 3A2KA 2KJBA 2X48A 3JCUC 2IA0A 1BI3A 4RAYA 3TOAA 3J80Z 2V26A 2STWA 3GZNB 4DIQA 2OC6A 5FKLA 3ABLH 2AXTC 4C9YA 3DV8A 3OYEA 3DBHB 2A6EF 4N4OB 3I54A 2IS6A 4DGWB 2WAFA 4MO7A 5FKOA 2MC3A 3VYTB 2BVLA 4D5CA 2ESNA 2PEXA 3FMSA 4F52A 3V7CA 2LDUA 2DA4A 4RAGA 2BE5F 4UY8I 1MZBA 1EKEA 2XSJC 1U8BA 1E3PA 3CCEI 2BVMA 3I0TA 1JTXA 1B8IB 2RVCA 3QP5A 1OYIA 1IRXA 4ZTFA 5BOXA 4HPQA 1WH7A 2G7UA 1GVDA 5A2QZ 1W1WE 4Q5SF 1HKSA 4DYCA 4ZC3A 4KUMA 2BXZA 3RPQA 2Q1ZB 3ZPLA 5KAIC 5EEAA 2FNAA 2CV1A 3VYRB 5E1WA 2HXOA 5ERIA 2Y0SN 5LD2C 2Y2ZA 1S5LC 3FXJA 2JA5J 1IG7A 4XICA 1B72A 4M9ZA 2RQPA 5E79C 3W6JB 3OSGA 4X6AJ 2HQRA 4RS8A 4IJAA 3ZQ7A 1KYWA 4IRIA 3FWEA 4KMUX 1XSXA 4AD9A 3HUGB 1UZCA 1NK2P 2P8TA 1I39A 4BQOA 4PSWA 3OYMA 1WVRA 3J7YJ 1YITI 3RPUD 5J4VA 5FB2A 3CCVI 2FE3A 4E7ZA 1K79A 2WAQN 1J9IA 1X1BA 2Q0OA 2XGDA 3BR0A 3ZN0A 3V8JA 1HOMA 4NHJA 2HQ5A 1M1EB 5HLGA 3GYHX 3F3XA 4PJJA 2HYFA 2OCEA 1T56A 2AXLA 3F8NA 1BJAA 1X19A 2QLZA 3SZTA 3FDYA 5E8IA 2QEXI 1W0UA 3MKLA 2EZKA 2WV0A 4E4HA 3D5SC 3FXMA 2A05A 2NVUB 4RGXA 2YX7A 5KCMA 1H9TA 2V6EA 1BI1A 4ZDPA 1ZRDA 3UR3C 3E6CC 1FNNA 2XGEA 4EEFG 2IRFG 2P0WA 3Q3SA 1YOVB 1Y0UA 1Y39A 1D5YA 4IHXA 2K85A 2B63J 2K02A 3R0JA 4MHGA 2BHZA 3IAS2 2A5WA 5HLIA 1ZQ3P 2V9VA 4HG2A 1FY7A 3BP8A 4MNUA 5BNGA 1H8AC 5DEQA 4BXXJ 4A3IJ 4B1RA 1BA5A 4ZTJA 4P5OA 5FLXK 4X1EA 5D4RA 1LE8A 3HOZJ 3EQLF 1D8JA 2M9HA 2LOOA 4HX8A 3NRVA 3G4SI 5CVIA 1UHSA 2DQLA 2LTPA 4AYBN 1STZA 2R0QC 2MABA 2XPUA 4LITA 4AC0A 5HLHA 3E5UA 4KT6A 3K4NA 3LQRA 5B66C 2L0KA 2W82A 4G94A 3FIWA 3MMYB 3ZQGA 2DLLA 4WK8F 4RGUA 1RKTA 4E6KG 4Z2YA 3L2CA 2PI0A 2VE9A 3X2QH 5DYMA 4DZPA 4C3HJ 1VF9A 1FTTA 4KA4A 5DM7F 4HEA2 2FSWA 2IGMA 2LD5A 2F6CA 1TTYA 1ZRFA 2C6YA 4IRGA 4D0PA 3LSJA 4G7HF 2VXZA 2M87A 5GP9A 2DMUA 3G2BA 3S1MJ 1A36A 1HF0A 1TNSA 3O8HA 4RB1A 1IDZA 2WBMA 3DEWA 4HF1A 1TQMA 4D1QA 1OYWA 3PSFA 2DJNA 1T2KA 3L2WA 5EG0B 1WJ5A 4O6JA 2Y9YA 3BR2A 1JXSA 1ZGAA 2M4GA 3K9TA 3H5AA 3ZQHA 4HDUA 4I2OA 1YX5A 1UB9A 2A69F 1O7FA 4UXNA 2O6GE 1V4RA 2M0MA 3E7LA 4PUSA 3PQKA 2IAIA 2F5DA 1B9MA 5TGTA 4CA0A 1YJNI 1FEXA 4MQVA 1YLFA 4A3MJ 3EPZA 3H1CA 2P81A 3K70C 4U0VA 3F6VA 4XONA 3FX3A 1BW6A 4FT8A 4I6ZA 4S04A 4P9FA 1R36A 2K5CA 3K4JA 3KLNA 4CO8A 3R61A 5IP9J 1OMIA 2R7QA 1IF1A 5E3NA 5EEGA 1B8IA 2EFNA 2QBYB 1XGSA 3PSIA 3T1BA 3BG5A 4RLQA 2YU9J 3T8RA 1VQ4I 2COMA 3OYCA 2D1VA 3H3VK 2R7VA 2KIFA 4CZZA 3OYGA 1B1BA 2QQAA 2E5NA 3BQZA 1Z7UA 1K61A 1F5TA 2L54A 2VN2A 5HS8A 1TWCJ 4HDVA 4KN7X 4HW0A 1WSUA 3K1NA 3K4CA 2EA4A 4IQ4A 1JKQC 3OYIA 4G6TB 2HPMA 1MH4A 3ZMVA 4UUSA 3F9KA 4G8XA 3H5NA 1V5FA 3VSKA 2LREA 2PLYA 3GMEA 3RKWA 2VL8A 4M6VA 2DTRA 3CCLI 3WHCA 3TQNA 1VQ6I 2X4HA 1D0XA 1H88C 1ETYA 2MD0A 3SEQA 2IVMA 4AUXA 2X6WA 2QQBA 2IGNA 3ONQA 3PM1A 3L1PA 4HA8A 1XCVA 4QLCU 2PBIA 3G73A 2DODA 1U9OA 1FJLA 3H9GA 3OYFA 2ZJRF 3G1LA 5ED4A 1MBHA 1BBYA 3VFZA 5L3FA 3LSPA 2V6CA 3C2GA 3Q9VA 3ESWB 2IPQX 2HWVA 4A3KJ 4A3GJ 3COAC 2W57A 3KZZA 4ESFA 2R7WA 5J4YA 3MKZA 1TP4A 1Z7LA 3QYEA 5EZGA 2L01A 3L2QA 4CHUA 1DUXC 1W7PA 4IXAA 4CUGA 4KMFA 4XKBA 4EM0B 2VT2A 3TL4X 1S7AA 2ZJ2A 3AG1H 3MKWB 3NAUA 1Y1VJ 4BBSJ 3DPTA 4QPOA 4YIFA 5EYRA 2H1LA 2ZKZA 2IS4A 2GXBA 2KRFA 4A3CJ 2MW8A 2VC1A 2QKMB 1E17A 1R00A 5H6RA 3HYIA 5B3SH 3JR9A 3K1MA 3MZHA 3JRAA 2JWTA 2TRTA 1S72I 2QENA 1D8KA 2ELHA 4F3QA 3EYYA 2OA4A 3SDGA 1PUFA 5DDGA 4KITB 3GTJJ 1YJ9I 2CS3A 2Z16A 1PP7U 1LFUP 3MFKA 3CMEI 1BN5A 5B1AH 3LA3A 1WJCA 3VOEA 1F9NA 4I02A 1X2NA 4IOAF 3VODA 4CXFA 1HSTA 3AFHA 5IPAA 3TMOA 2WAEA 4MTDA 2Z3YA 3KEOA 4LLLA 3W2VA 4IEJA 5DCFA 3WU0A 2FQ4A 2DOAA 2ETHA 1KQ8A 2JRMA 4GYIA 1V5EA 2DYSH 1FX7A 3SXYA 1JJ6C 1XS9A 3J7AY 3HKZN 1LDJA 3ASOH 2CFOA 1S7EA 3ELKA 5EZHA 5E1ZB 3HGYA 1L3LA 2GQQA 4HAMA 3DF8A 2A5YB 3U1DA 2CQ7A 5J47A 4EQQA 1RPWA 2MSYA 4YFXF 3HHGA 5J40A 3JRIA 2HKXA 1ENHA 3E6MA 2W7NA 1P6RA 5ILVA 1X58A 2QSFX 2VODA 4YELA 3ZQLA 1IN5A 2GZWA 1POGA 4L9VA 4M3FA 4BKXA 4HQMA 2WV1A 4QPQA 2IT0A 2J5PA 2ZSHB 1ZN2A 5TRDA 3BTLA 2L9VA 2R7OA 1SC7A 5CYVA 4PGGA 3VB2A 1TBXA 2BW3A 2JPCA 1ZYRF 4U88A 1K78B 2CJJA 3BJOA 3OV8A 1Q1VA 2ID6A 5C4JJ 5M5YJ 2EIKH 4BHPA 4L9JA 3ZQFA 1VQ5I 3CMMA 2H1KA 3QWLA 1FBSA 1PDNC 1MJBA 4ABZA 4G12A 3BZCA 3CCRI 5FD6A 3QRFF 2HTJA 4LIUA 4FCYA 4WWCA 1XB4A 2XVCA 2ZJPF 4BHCA 3FZVA 3LL7A 2HVSA 5BPIA 2ZFWA 3KYLA 3RDIA 3ZMZA 2FBIA 4HNVA 5E1XA 4BGDA 2EK5A 2YSRA 3D1NI 1JUMA 3PNYA 4CZCA 4HV6A 2ZMEC 4WF2A 1FWZA 1I50J 1WGXA 5JVTA 4IRHA 2OQGA 4XORA 2QBYA 5IY5H 3CC4I 4Z6YA 3RI4A 3RPUA 2JA6J 3I55I 4EV0A 1ULYA 3AG4H 1IUFA 3LSHA 3ZMDA 4YG2F 2CV0A 3IHUA 1OYYA 4UUTA 4NUBA 3DKWA 2R4GA 5ICFA 4L18B 2VXDA 1VI0A 4ASNA 2AS5F 4NC7A 2DCEA 3V7RA 3BR3A 1UJ8A 1A31A 4C3IJ 5DV5A 5D6FA 3WTZA 3DWLE 1PYVA 4RB3C 1ETVA 1H9GA 3CF2A 1USSA 3GTPJ 4GO1A 3SZGA 2CH0A 4ITVA 3HC7A 3OSFA 1WCMJ 3WHBA 5LGTA 5HS7A 1FYMA 1VQ9I 3CUOA 3DBLB 3HTSB 3WU2C 4ZZLA 3K70D 4RAZA 1X4OA 1X1PA 2DXIA 1E3HA 3DXJF 4EATA 5D5UB 2LF8A 2WB1N 3TO6A 2VJ5A 2M4KA 1T08B 2XSDC 2VBWA 2V1XA 2XAJA 3PFIA 3CJQB 2YR2A 2NVTJ 2GXAA 4AU7A 1X3ZB 5A2QK 4XBFA 1TWFJ 4MIMA 3FXRA 4M3BA 5LHIA 3SJMA 3QPTA 2HTSA 1E2XA 2EIMH 3D5RC 3HTUA 3IC7A 1ODDA 2EFQA 3OL4A 1YHQI 4L0ZB 1GT0C 2UWMA 2ESHA 1IRZA 1U5TC 1D1AA 4G7OF 4UVAA 4IZZA 4OIRF 2ISYA 5C3EJ 4PJNA 2VPLA 1G3WA 1KU7A 1LB2A 5BS6A 3B6AA 1X1DA 4NC8A 2K86A 1MH3A 5FKNA 3TW7A 2Z33A 3ZMUA 3JRHA 2BXYA 1Z1DA 2FOWA 1QZEA 1F1ZA 3OIOA 1YW8A 4BNCA 1G6NA 2MG4A 2HR3A 3JSPA 3ZRGA 5FRNA 4LGWA 4RGRA 3CMYA 3IH3A 3HL2A 3M07A 2BGCA 3P9IA 2Y9ZA 2NOJB 3H0GJ 5E8GA 3BC8A 4XRFA 2G7HA 2HOEA 2K27A 2KZGA 5GAGJ 4P55A 4XM3A 4ETSA 4ZH4F 3ZGKA 3M9AA 3PL8A 4B3AA 4YRVA 2JQ7A 2EV0A 3CJRB 3S1NJ 2DFHA 5E17F 4FETA 1QPIA 2P5KA 1KYZA 4EJOA 3CLOA 1VQ8I 5IT9K 1Y8QB 4I01A 1MGTA 5M5XJ 3G71I 3GTKJ 3O6BB 2IW5A 2PMHA 2M3AA 1MJAA 2XUBA 4XN3A 2PMZA 4E7JA 2L02A 1CF7A 1LVKA 1RUNA 1IAWA 2OCCH 3OYKA 2RREA 4BDZA 1Z6RA 3FHNA 4D7MA 1P4XA 5ICCA 1QVTA 4B4CA 2DYRH 1OCCH 2L4AA 3E97A 2BEOA 4I0BA 2KT0A 3RCOA 2VLAA 2ZXIA 3SFZA 2VE8A 2ELJA 4L5IA 1IO2A 2AQFA 1K78A 3PFYA 5J1YA 3R60A 1YFHA 3GW2A 4B3XA 2RV8A 1MBKA 1XMAA 3CDIA 2R7SA 2L5QA 5LEKA 1R5GA 2MYSA 3OYHA 3CC7I 3R0AA 2CU7A 2RN7A 2H09A 3W2AA 1OCRH 4LFUA 4FQGA 2I8DA 2L7FP 2DOEA 1G2HA 3WGHA 4C30A 3HXLA 1QQIA 5LLQA 2XC7A 4KICA 3H3UA 2LVSA 2V1UA 4LLNA 4WXDA 5IP6A 2UXNA 2XGXA 3DBRB 2TCTA 2HEOA 4M3DA 3AL0C 2KKOA 3E5XA 4A6DA 1S7OA 3ZQQA 1U8RA 1NH3A 4OIPF 1X4PA 2KRHA 1QGPA 2HQAA 2VOOA 3H36A 2DN0A 1F36A 4DYQA 3RKXA 3V42A 3ABKH 3CP2A 2NNNA 3FF5A 2VPRA 4XKWA 2MH9A 3F21A 3JSOA 5J3LA 2DI3A 3T8TA 2R93J 1LDDA 3F8FA 4UV9A 3L2UA 2KQRA 1EH8A 4MTEA 3VSLA 3ZMTA 5H6QA 5FLMJ 1Z91A 1DU6A 2FMYA 1J0RA 3FHZA 4MLOA 2XHKA 2CG4A 3DEEA 4XOTA 1REPC 1RETA 4C2UA 1HDDC 3L9FA 3VPRA 5ICEA 3I4NJ 2F4MB 3H5RA 3RKQA 1N25A 3WE3A 3EDPA 3EUHC 2ZB9A 1ZR2A 2Y31A 1FYLA 2Y69H 1QNTA 1JE8A 4LK0F 3O3KA 1KU9A 2LC2A 2FJ1A 2H6BA 3GFMA 3TDUC 2WY8Q 2XROA 1XC5A 2B9SA 1LEBA 1NG7A 2X9DA 4EJVA 3S17J 3GFIA 5IT3A 5F0HA 1LFPA 4UUSB 5K5RA 2E35A 4HSRA 1FP1D 5HNHA 2A3SA 4Q4ZF 4PCQA 5LBQA 1Z3YA 3M8JA 2X51A 1U3EM 1UG2A 3DLLF 3FBNB 2Z2SB 2HXIA 2RDPA 4C2MJ 2Y30A 5EDNA 3Q9SA 2LNBA 2XAGA 3SDBA 5KVRA 4CGZA 4XNFA 1HSJA 3OOUA 1G3SA 2DAOA 5GPAA 3OIQA 3G1OA 4G7ZF 2COBA 3JAMZ 1A6QA 3IKVA 3CMAI 1JUPA 1QRYA 1SAUA 2KJCA 4A93J 3S93A 2XRLA 4W97A 3TDZC 2XAHA 4PZJA 5ICGA 1WKMA 1JHHA 1Y0NA 4Y3OA 3KLOA 3VEPA 5B5EC 1W7PB 3M1CA 4ZJZA 5CQEA 3QPSA 1T95A 4N0BA 1Y56A 4CDGA 5EEHA 1MDMA 1EV7A 3E1SA 4XQFA 2QGUA 3RYRA 2VKEA 2K40A 5H20A 3TW6A 1GXPA 1K83J 3DKXA 2XAFA 2Z99A 5J8FA 3FXOA 3ECOA 1U78A 1D0ZA 3LSIA 3S3NA 2JA8J 3BPVA 2O61A 2BY3A 1FTZA 1TNTA 4JX6A 5KNLA 2V1NA 1PUFB 9ANTA 4OMZA 4DJAA 2ECCA 2K7LA 3ECHA 2RC4A 5E20A 4RGSA 5DD8A 2WC2A 2V9PA 2ZXWH 4CSWA 3K4KA 2LRDA 3HBLA 1R9TJ 2CO5A 4RB2C 3KP3A 4E7HA 1A04A 1TC3C 2DMNA 3JW4A 2W4SA 1FMWA 3C18A 4BQQA 4CYDA 1PJRA 1DP3A 2CRGA 3UNGC 5HODA 3K0LA 1Y8RB 2BY2A 4NBQA 3KE2A 4F91B 1RIOH 2JT1A 4IHYA 1G3YA 1D1BA 1FT9A 1S3JA 3BDDA 1VNDA 3ISPA 1MNMC 1JTYA 1RRJA 2DQRA 2GIVA 2HZTA 4JOMA 1K4SA 1JHFA 4O3MA 2EZLA 2L2OA 3LMMA 3CCSI 3S1QJ 3BR1A 4CICA 4A0XA 1LFBA 2DU9A 2K9LA 2RQQA 2HYGD 3JTGA 2EILH 5GPCA 5J8CA 3BWGA 4U7DA 2E36A 2JVHA 2R7XA 1T6SA 1G4DA 3S14J 2JA2A 2L3DA 4NQWA 1SVLA 1O7LA 2PMUA 2RAEA 3S32A 1VQPI 4I09A 1TQIA 3KEQA 2ZBKA 1Y6IA 2QKLB 3ML6A 1QZYA 1WJBA 2HDDA 4KDPA 2BW3B 4LG3A 2XF7A 1EJ9A 3FXLA 2F5VA 1X3WB 4BY7J 4JX4A 4XIDA 5KK1A 2M45A 4LIVA 4EMSA 3QP6A 3PIOF 1G59A 4MEXF 4IOCF 3BG6A 2P7CB 2XPVA 1J7KA 1S8NA 1B9NA 5JHUA 2IP2A 1KZHA 2EPFA 3S8PA 4M9XA 1ETOA 4MEYF 3BLYA 2ZMEB 3L09A 4NNJA 4D5FA 3IV5A 2PG4A 2HZDA 2YU3A 3WG9A 3ULQB 2XKPA 1IW7F 2IBDA 3P7NA 5LRSA 3QODA 4DQ2A 1N77A 5JFRA 2K3PA 4ZYDA 4BEHA 1BOBA 3OS2A 3N05A 2DPDA 2VQHA 4CCJA 1YRNB 1OCZH 4C2TA 5IP7J 4HYEA 1BR4A 3I56I 3QU3A 1GDTA 2IA1A 2QSHX 1P4AA 4XLEA 3RQIA 1FP2A 4RM3A 2AHQA 4XKCA 2JJ7A 2LY9A 2GOXB 3NARA 3QU6A 1ZRCA 4EGZA 2CQKA 3MAJA 4PJMA 3S16J 4I7HA 1BW5A 1ZR4A 3QPHA 4M3EA 2EINH 5FJ8J 3QOPA 2E2IJ 3CDHA 3GVAA 2XRNA 2EA2A 2M7AA 4XLAA 2E2HJ 3KP4A 2IGOA 2DMQA 2GXGA 4FX4A 2X0LA 1FYKA 2DDBA 2P4WA 1O57A 3U1KA 1U9NA 1NK3P 1S6LA 2VBZA 2OU2A 1U2WA 2CUEA 1KQ0A 3IRQA 2UZKA 2IGKA 3TO9A 3RZDJ 3TOBA 5L3EA 2FXAA 1QHHD 1A35A 4XKVA 1IJWC 2UXXA 1SFXA 4M6XA 5GAEJ 1LNWA 4BUPA 1MNEA 3HZJA 5D5XB 3PO2J 1XGNA 2PX9A 2VQLA 3C7JA 3CDLA 3K7AJ 3M8FA 1BI0A 1IXCA 2V7FA 2BOLA 2CYYA 1R5HA 4Q48A 3WU1B 3QPLA 4IF4A 3IKTA 2FOKA 3CUQC 1TW3A 4QWQA 4AVPA 3JRDA 2OBPA 1VZ0A 2R5YB 3W2WA 4ON0A 5BPDA 2YPRA 2UV1A 4XLNF 4FX0A 3GCMA 4EJUA 4LB5A 1R1UA 3C2BA 1OKRA 3QAHA 2XV4S 2JA7J 2FNPA 4M74A 3WTSC 4B43A 1MMNA 2FEZA 1Y1WJ 2PQ8A 2MC4A 4Y52J 2JRTA 3BR5A 5DUKA 2MA3A 4FISA 2E1OA 4ZYGA 3ZOBA 2LK2A 2QZ8A 3DTIA 5K1YA 1T0FC 1DPUA 3GLLA 5D4SA 5J6XA 2KISA 3MD2A 3HOXJ 4UUVA 5J1RA 1XMKA 2NOGA 2PMZN 4OIQF 4WCGA 5D5VB 4DBRA 2E7XA 4JYKA 1ACIA 3IUOA 2DA7A 1YE9A 1Z67A 1O3RA 2NS8A 1W5TA 3JRFA 1PP8F 5CJ9A 4X0GA 4E70A 1BIAA 5FFZA 4A0YA 1VQLI 5HDGA 1YI2I 4HNUA 4L5JA 3GTMJ 3GZ6A 2Y0SA 1YO5C 1R5ID 3TBIA 1ZG1A 1MKMA 1J09A 5FLXZ 1BC7C 3K2AA 1EH7A 2K9SA 2O9LA 4BDYA 1MMAA 3BJ6A 2M1BA 1CGPA 2WTEA 3GXOA 3KZYA 2W48A 3N4MA 2QM3A 1BI2A 3N97A 4UVBA 4F92B 1ZLJA 3A02A 3SHFA 2VKVA 2XB5A 2JSPA 3PO3J 1HXDA 1YS6A 2W25A 3QQAA 4FE4A 1AKHA 2W84A 4AIJA 1YJWI 4ZZDA 1ITYA 4ENNA 2KIQA 3D5LA 3O2PE 1RNLA 3GTOJ 1IN4A 4PK4A 1LQ1A 2LG4A 2BY1A 4XMYA 2PFBA 2P7VB 3E0JB 1CF7B 3OYJA 3KCCA 5K7FA 4FTHA 3I4PA 2O03A 2DA2A 4N4NB 3DQVC 3LSRA 1ON1A 3CP8A 2F5CA 3JTHA 1DGWY 1BR2A 2Q8KA 3S2WA 2D5VA 2E19A 4WX9A 1I6XA 3QYBA 4V2GA 3ASNH 3E6BA 5L3GA 4ZDLA 4IO9F 2EH3A 3EUAA 1FIPA 2KLOA 2ME6A 2XAQA 1WJFA 1W36C 2VBXA 4IHVA 2ADUA 1DP7P 3IWZA 1K7AA 1GXQA 2DJIA 4K2EA 4M71A 3ZR8X 4NDLA 1J5YA 1J2XA 1MMSA 2ZMEA 1E0EA 2ZO4A 1V3FA 5F1JA 4L0YB 4NC6A 4M73A 1ZH5A 4YIRX 2O5RA 4CCLA 1PVEA 4U0YA 3HM5A 2IEKA 2W85A 3K6GA 2OTLI 2V4JC 4MQ9F 3MVPA 1YRNA 2L7KA 2VQCA 5FO5A 1HDPA 2FQ3A 2EFPA 5FGMA 4L5EA 3LWFA 4HNTA 4IL6C 4AYBA 3ABUA 3D0SA 5HNFA 2MLGA 2OUMA 3NWTA 1D1CA 3LSTA 5C4XJ 2E1MC 4H4KC 4DNCA 1RR7A 1SVMA 3M4OJ 1QZZA 1RUOA 3OR1C 5JI6A 1W5SA 2FX0A 4RAFA 1J59A 1AA7A 2O8XA 4QSHA 4OINF 3GTLJ 2HI3A 1OPCA 1ERDA 2NAZA 5C44J 2W24A 2DMTA 3S2DJ 5TJJA 5AIQA 1DQUA 1P7IA 1YG2A 1IN7A 3P9CA 1EH6A 1QBJA 3E6DA 5ILSA 4O5VA 4HLYA 4TV7A 2NRAC 3J80K 2RGVA 2O3FA 2DFEA 3J81Z 2LKSA 3K1PA 1JI8A 3W6KB 2NVXJ 3GBGA 5FRMA 3VYUB 3M8EA 2ZJQF 4DYRA 2VJIA 5M5WJ 4A69C 1MBEA 2ZNZA 4HF0A 3GUDA 3HIFA 5F6FA 5DUIA 1EF4A 2BZTA 3KEYA 1IZ1A 1Z21A 2X6XA 4BJ5C 1JKPC 1FPQA 1U5TA 3ERED 4AM3A 2R5YA 2FBKA 3M1EA 1HKTA 2DA5A 3HPHA 1USTA 1X3UA 3KP6A 3B6CA 1R1VA 4I0AA 2EV5A 3HHHA 2CW7A 3GX4X 1CQTA 1BR1A 2K4BA 1LKXA 1UHWA 2EFWA 3MCZA 2GLOA 3GEZA 4KT5C 1K6YA 5FKKA 2B0LA 2DT7B 4ESJA 4C3JJ 4ANJA 1OQYA 1U6GA 3LSGA 3LSKA 2IXSA 1RESA 2F5FA 3IH2A 5BQTA 2X85A 1WZ2A 4OMYA 2Y0MA 1BJZA 2VJ4A 4BS9A 1GUUA 4GGGA 1TWAJ 3MEXA 3RTRA 1I3QJ 5F0FA 3OS1A 1XX5A 2OAZA 1OCPA 2WA0A 2AO9A 4B48A 3ZQCA 4QIWN 2KMUA 2FD5A 4RDUA 1DDNA 5JLWA 3JAMK 2HQNA 4FE7A 1MDMB 3WG7H 2CW8A 5D8LB 3IL2A 3ROUA 2IS2A 3TO7A 3HRSA 1ZLKA 2XF5A 2JZYA 3O8GA 3LA7A 2MGQA 2KL4A 2CWEA 1O4XA 2G9WA 2GM4A 3HRTA 1VTNC 4CCOA 4RA2A 1R22A 4LOCA 2L7ZA 5LRRA 1IV6A 2VKHA 4I99C 4Y4RA 3DCFA 1DU0A 2DW4A 3KFWX 3BG7A 2JMWA 3MQ0A 1T8IA 2X1DA 1UELB 4HOBA 1WRJA 2P5VA 2QA4I 4L9TA 3HOSA 4B8XA 1IRFA 1BC8C 2LYCA 1QU3A 1YX3A 2HGCA 1KU2A 3V8LA 1S9HA 3I53A 2OZ6A 1ZREA 1ZTRA 5EJCA 4Y13A 5EGOB 1Z6TA 1WJDA 1P92A 3MWMA 1JKOC 1T33A 1KQ9A 1SD5A 3Q0VA 5LFAA 1F4KA 1NG6A 2NVYJ 2M0CA 2Z5UA 2A07F 1UG0A 3ERMA 5E3MA 2MBFA 2K9NA 2AQEA 2E60A 3DPLC 4PFPA 4IHWA 4IVNA 4F7ZA 1I5ZA 4XLFA 2CW0F 2NS0A 3BTJA 2YS9A 5CPRB 2K9MA 2MFZA 2YUSA 1QO0D 3FXKA 1OR7C 4LJZF 4PJLA 1P2FA 3MZ8A 3K10A 4NQWB 3GF2A 1MW7A 1VFCA 2QQ9A 1S29A 1GLNA 4XR6A 4BJ6C 2LMDA 1XMXA 4N9IA 4UB8C 2DDAA 2F48A 2MH2A 3HGGA 5F0CA 5L3DA 1K6OA 2LY1A 1DPRA 2CGPA 4UV8A 3BZKA 2FBHA 1WPKA 4P96A 3UKGA 1TWGJ 3ZCOA 2P6SA 2YX4A 2F4OB 1RZ4A 2QUFA 4XLHA 5HLTA 4IKFA 1P7JA 2MLKA 1MMDA 1OJLA 1MSEC 5DTDA 4BJTA 2O7OA 1LUJB 3BJAA 2EJRA 4U0WA 3H0DA 2EV6A 4YEJA 1K4TA 3RJPA 2PJRA 1JKRC 3EUHA 1RI7A 4OAYA 4BEHB 1ZGJA 4D9JA 4YFNF 2OF7A 3HRMA 1BM9A 1WHUA 3WTUC 4RB0A 3QOEA 1A6IA 2A6TA 4JQFA 1W36D 3FKJA 4CH7A 3DKYA 1RR8C 1NHAA 1MNDA 4G9YA 4V2FA 1T38A 2R7FA 3AG3H 2WY7Q 2DFFA 4BY1J 2JTVA 2P6TA 5GAHJ 4S0HB 4XRSA 2NYXA 1FLIA 2EBIA 2OJED 2BBYA 2R92J 3U9GA 2ZC2A 4BACA 5LHHA 2DA6A 5JLXA 5IYBJ 1LVAA 4PJ0C 3BTCA 1GVJA 1XTAA 3V7SA 1OCTC 2E71A 4XOPA 4XRMA 2HDWA 3BG3A 2M8EA 4B44A 2EB7A 1O3QA 2ZNYA 1G8XA 3BOQA 3CUQB 4YIIA 3S2HJ 5TISC 4BE1A 2HOSA 2XASA 1XDSA 3IP4B 1TL8A 1E3OC 2GA1A 4KIGA 1LJ9A 2VKDA 2GA2A 4A6EA 2H27A 1R6RA 4RBOA 2BY0A 3CF5F 2Q2EB 2CSOA 2R7DA 3GO5A 3G3ZA 2VQGA 4HX7A 1GV5A 3LFUA 4ESBA 2QYOA 2V9KA 3KX2A 3LOCA 4XSXF 4F55A 5LHGA 4GRIA 2LF7A 1YTYA 5F27A 2IJLA 4ZYHA 1O3SA 1QHGA 2A68F 3HDDA 2HOTA 2JUCA 4LD5A 3DP7A 1MBFA 3ZN1A 1DGRM 1SD4A 2O0YA 3F22A 4ENKA 2OPTA 2X6OA 2STTA 2KDZA 2CMPA 1LDKB 1WI9A 2DMPA 2E7WA 1AHDP 4BXUA 4RLFA 1ETQA 1P9QC 1R49A 1T98A 2I10A 4ZYEA 4AIKA 1R1TA 3CJNA 2Y75A 3OYAA 3U2RA 3J7ZI 3AKZA 2L9SA 3DTEA 3B02A 2ZXJA 5E3OA 1HA8A 2GIZA 4OWRB 4DOZA 3FKIJ 3HEFA 4L9NA 2WB1A 4P1WA 2LLKA 5AONA 3A4CA 5IT9Z 2JVGA 2FU4A 5LGNA 3K4LA 2IS1A 2M8GX 3W3CA 2V1DA 2R5ZA 3RKYA 2D1HA 2K3FA 1FC3A 4CCKA 3C1DA 1MIJA 1UMQA 3BZ6A 3LQQA 5FLVA 4IQJA 1ZG3A 1J75A 5CVUA 3WTXC 1ZKGA 4I76A 3CZ6A 2J5OA 4LG0A 2ELKA 3IAM2 2IA2A 5EGOA 1OFCX 3FISA 3FMQA 1N75A 1WI3A 2WWYA 5D5WB 3U21A 1WWXA 4ENMA 1JT0A 3K4BA 1HQCA 2X1CA 3HSEA 3R4KA 4E7LA 4BE2A 4OAZA 1AKHB 2L9NA 1I1SA 1UHMA 1X1AA 3WGIA 1FSEA 3OYDA 4BE0A 1FOKA 2D2WA 1UCRA 2QWWA 1IC8A 1ORKA 2VC0A 3FK6A 1ZAOA 1TWHJ 3MKYB
chains in the Genus database with same CATH topology
2FRHA 4N9HA 3FXUA 1AWCA 4A0ZA 3BROA 3BY6A 1IN8A 1KU3A 3I59B 3B73A 1IRGA 2DO7A 3WTYC 3FM5A 3LA2A 5HS9A 3MZYA 4EM2A 2HKOA 2OQRA 1XGMA 5HVQC 2DK8A 1HBXG 4XLPF 1I1GA 1R23A 5K5OA 4GCVA 4JK1X 2PN6A 4UHTA 3TKYA 4Y15A 2E1CA 2XKOA 1AOYA 3WODF 1FZPB 3EETA 5BMZA 4GYGA 3IRRA 4AWXB 2E1NA 4KFCA 1H0MA 1L0OC 3I5UA 1D5VA 2DT5A 1T39A 4M6YA 3CUQA 5FFXA 5F64A 2VT3A 3H3ZA 3GFJA 2OZUA 4LK1F 1ONVA 3ZP5A 2NNYA 3J81K 2Q2EA 3WTVC 4Q47A 4A2UA 5LGUA 1U5TB 3TGNA 3V8KA 3FM3A 1T0FA 1Z9CA 4S05A 2GAUA 2M5WA 5CVJA 5ILUA 4OOIA 3BPXA 4GXOA 3HUGA 4A5NA 4WXHA 1O3TA 2R3SA 1TLHB 2RNJA 1HKQA 2Z9OA 4KNYA 1BOAA 4HLXA 3GLXA 2VBYA 3DEUA 3C3WA 2ISZA 3AAFA 3F8BA 3E5QA 2HDCA 2LSOA 1XDUA 4AIHA 3L7WA 4BAYA 3REOA 3I58A 3PQJA 1YW9A 2M30A 1R58A 2VOPA 4A12A 5DCMB 4R8HA 5D6EA 1ON2A 4NB5A 2DFIA 3HSRA 4KYWA 2TDXA 1TQPA 3WTTC 4EM1A 3DFGA 1Q1HA 3CO6C 1IXSB 4BHBA 3WE2A 4IPAA 2A61A 3LAJA 2DPUA 3I59A 2L4MA 3IWFA 4B09A 5LEJA 5K5QA 4IHTA 1ZHFA 2EFOA 1ZARA 3GFLA 1JGSA 4G6QA 4MGRA 2EWNA 4R1HA 4OU0A 3J7AO 5DD4A 2P5LC 1HW1A 3M7GA 2OD5A 3FMRA 1SFUA 3NQOA 4UVCA 2H94A 3F23A 4HF2A 3RYPA 4P9UA 4PDKA 1PUEE 3H92A 3SQNA 3ABTA 1HW2A 3KETA 4HQEA 3F72A 5CVVA 3GZ5A 3WGGA 3SZPA 1SFEA 2ACJA 5HOOA 1TW2A 1MD0A 4M9SA 4JBAA 3LFKA 3EYIA 1KA8A 3F8CA 1KGSA 1G3TA 1UFMA 1SD7A 2HFHA 1XN7A 2BYVE 5FD5A 3I71A 1FBUA 1FSHA 3I64A 4HV5A 4HBLA 2D45A 3FXQA 4A5MA 1YW7A 4UNOA 4LLGF 4KN4X 1XSVA 2FMLA 2K4JA 4G6DA 1IUYA 4EVIA 1Z05A 3E3VA 3L00A 1YIOA 2BV6A 3KP7A 2LKPA 5L3CA 1W4MA 4BH9A 2DK5A 2F2EA 4LMYA 1IXRC 2RKHA 1IN6A 4YFKF 1XSDA 4I98B 3P9KA 2H6CA 3R6SA 4HX4A 4Y17A 1SAXA 4KIBA 4EJWA 1B59A 4HZFA 5F1RA 2V79A 1C0WA 3F8MA 3HRUA 2QVOA 1XCBA 4H0EA 1XD7A 2GWRA 3CO7C 5D8KB 5DCMA 5E18F 4XSZF 4KIFA 2F5EA 3ZMSA 2PJPA 3F6OA 3KP2A 4LB6B 5L3BA 5HDKA 2ZCWA 1B6AA 1P4WA 3T0YA 5CLSA 3Q5FA 1SD6A 4EJTA 1YYVA 4PGHA 3NEUA 1ZG5A 2FA5A 3V4GA 2A6HF 3HSFA 3OOPA 4IHSA 6PAXA 4LG0B 1YQAA 3WTWC 3GWZA 2FF4A 1B4AA 3LAPA 4M72A 1YS7A 1OR7A 4R79A 1GHCA 1W7PD 2HS5A 1BIBA 1LEAA 1QPMA 3KP5A 4EGYA 4BQAA 2KIMA 2JPBA 3T5XA 1XGOA 3K69A 4U7BA 3RIRA 3HOTA 2DBBA 2XIGA 5JR3A 4ENJA 2JSCA 3K2ZA 1MJ9A 1R7JA 1HW5A 4OIOF 1SMYF 4FHTA 1SMTA 5HDNA 5AIPA 2VONA 2CFXA 5CVRA 1WQ2A 4BYYA 1I27A 4WXCA 2Y48A 2MD5A 1FBQA 2KIUA 1D3YA 3CTAA 2KJBA 2IA0A 1BI3A 4RAYA 3TOAA 3J80Z 2STWA 3DV8A 2A6EF 3I54A 2MC3A 2ESNA 2PEXA 3FMSA 3V7CA 2LDUA 2BE5F 1MZBA 3I0TA 2RVCA 3QP5A 1OYIA 5BOXA 2G7UA 5A2QZ 4Q5SF 1HKSA 4KUMA 3RPQA 3ZPLA 2FNAA 5E1WA 5ERIA 4M9ZA 2RQPA 3W6JB 2HQRA 4RS8A 4IJAA 3ZQ7A 1KYWA 4IRIA 3FWEA 4KMUX 1XSXA 4AD9A 2P8TA 5FB2A 2FE3A 1K79A 1J9IA 2Q0OA 3ZN0A 3V8JA 4NHJA 5HLGA 3GYHX 3F3XA 2HYFA 2AXLA 3F8NA 1BJAA 2QLZA 3SZTA 5E8IA 2WV0A 4RGXA 2YX7A 1H9TA 1BI1A 1ZRDA 3E6CC 1FNNA 2IRFG 1Y0UA 2K02A 3R0JA 4MHGA 5HLIA 2V9VA 1FY7A 3BP8A 4MNUA 5DEQA 4P5OA 5FLXK 5D4RA 3EQLF 1D8JA 4HX8A 3NRVA 5CVIA 2DQLA 1STZA 5HLHA 3E5UA 3LQRA 4G94A 2PI0A 3L2CA 2DLLA 4WK8F 4RGUA 4Z2YA 2VE9A 5DYMA 4KA4A 2FSWA 1ZRFA 2C6YA 1TTYA 4IRGA 4D0PA 4G7HF 2VXZA 2M87A 1TNSA 4RB1A 4HF1A 1TQMA 1OYWA 1T2KA 4O6JA 1JXSA 1ZGAA 3K9TA 4HDUA 4I2OA 1UB9A 2A69F 1O7FA 4UXNA 2O6GE 1V4RA 3PQKA 2F5DA 1B9MA 4MQVA 1YLFA 4U0VA 3F6VA 3FX3A 4FT8A 4S04A 4P9FA 1R36A 3KLNA 4CO8A 3R61A 1OMIA 1IF1A 5EEGA 2EFNA 2QBYB 1XGSA 3T1BA 3T8RA 2COMA 2D1VA 2KIFA 4CZZA 1B1BA 2QQAA 1Z7UA 1F5TA 2L54A 2VN2A 5HS8A 4HDVA 4KN7X 4HW0A 1WSUA 3K1NA 2EA4A 3ZMVA 4G8XA 2PLYA 3RKWA 2DTRA 3TQNA 2X4HA 2IVMA 2QQBA 4HA8A 1XCVA 4QLCU 2PBIA 3G73A 5ED4A 5L3FA 1BBYA 3VFZA 2V6CA 3Q9VA 2IPQX 2HWVA 3COAC 2W57A 3KZZA 4ESFA 2L01A 4CHUA 1DUXC 1W7PA 4IXAA 4KMFA 4EM0B 2VT2A 1S7AA 2ZJ2A 3DPTA 4YIFA 2ZKZA 2GXBA 2KRFA 2VC1A 1E17A 1R00A 5H6RA 3HYIA 3MZHA 3K1MA 2QENA 1D8KA 2ELHA 3EYYA 2OA4A 5DDGA 1PP7U 3MFKA 1BN5A 3LA3A 3VOEA 1F9NA 4I02A 3VODA 4CXFA 1HSTA 4MTDA 2Z3YA 3KEOA 4LLLA 5DCFA 3WU0A 2ETHA 1KQ8A 4GYIA 1FX7A 3SXYA 1LDJA 3ELKA 5E1ZB 1L3LA 2GQQA 4HAMA 3DF8A 2A5YB 3U1DA 4EQQA 4YFXF 3HHGA 2HKXA 3E6MA 1P6RA 5ILVA 2VODA 1IN5A 2GZWA 4L9VA 4HQMA 2IT0A 2J5PA 1ZN2A 5TRDA 5CYVA 4PGGA 3VB2A 1TBXA 2JPCA 1ZYRF 4U88A 1K78B 3BJOA 3OV8A 4BHPA 4L9JA 1FBSA 1PDNC 1MJBA 3QRFF 5FD6A 2HTJA 4WWCA 1XB4A 2XVCA 4BHCA 3FZVA 5BPIA 2ZFWA 3RDIA 3ZMZA 2FBIA 5E1XA 2EK5A 2YSRA 4HV6A 4WF2A 1FWZA 5JVTA 4IRHA 2OQGA 2QBYA 3RI4A 3RPUA 4EV0A 1ULYA 3ZMDA 4YG2F 3IHUA 1OYYA 3DKWA 5ICFA 4L18B 4ASNA 2AS5F 3V7RA 5DV5A 5D6FA 3WTZA 4RB3C 1H9GA 1USSA 4GO1A 5LGTA 5HS7A 1FYMA 3CUOA 3HTSB 4ZZLA 4RAZA 3DXJF 5D5UB 2LF8A 3TO6A 2VBWA 2V1XA 2XAJA 3PFIA 2YR2A 5A2QK 4XBFA 3FXRA 5LHIA 3QPTA 2HTSA 1E2XA 2UWMA 3HTUA 3IC7A 1ODDA 2EFQA 4L0ZB 2ESHA 1U5TC 4G7OF 4UVAA 4OIRF 2ISYA 1G3WA 1KU7A 1LB2A 5BS6A 2K86A 2Z33A 3ZMUA 1Z1DA 1F1ZA 4BNCA 1YW8A 1G6NA 2HR3A 1ZAOA 3JSPA 4LGWA 4RGRA 3P9IA 2BGCA 5E8GA 4XRFA 2G7HA 2HOEA 2K27A 4P55A 4ETSA 4ZH4F 3M9AA 2EV0A 5E17F 2P5KA 1KYZA 4EJOA 3CLOA 5IT9K 4I01A 1MGTA 3O6BB 2IW5A 2PMHA 1MJAA 2XUBA 2L02A 1CF7A 1RUNA 1IAWA 1Z6RA 1P4XA 5ICCA 2L4AA 3E97A 2BEOA 4I0BA 3SFZA 2VE8A 4L5IA 1K78A 3R60A 1YFHA 3GW2A 2RV8A 1XMAA 5LEKA 1R5GA 3R0AA 2RN7A 2H09A 4LFUA 3WGHA 5LLQA 1QQIA 4KICA 3H3UA 2V1UA 4LLNA 4WXDA 2UXNA 2XGXA 2HEOA 2KKOA 3E5XA 4A6DA 1S7OA 1U8RA 4OIPF 1QGPA 2VOOA 3RKXA 3FF5A 2NNNA 3F21A 2MH9A 3JSOA 2DI3A 3T8TA 1LDDA 3F8FA 4UV9A 1EH8A 4MTEA 3ZMTA 5H6QA 1Z91A 2FMYA 1J0RA 3FHZA 2XHKA 2CG4A 1REPC 3L9FA 5ICEA 3WE3A 3EDPA 1FYLA 1QNTA 1JE8A 4LK0F 3O3KA 1KU9A 2H6BA 3GFMA 3TDUC 2XROA 1LEBA 4EJVA 3GFIA 5IT3A 5K5RA 1FP1D 2A3SA 4Q4ZF 4PCQA 5LBQA 1U3EM 2RDPA 3Q9SA 2LNBA 2XAGA 4CGZA 5KVRA 1HSJA 1G3SA 2DAOA 4G7ZF 3JAMZ 3IKVA 2KJCA 3TDZC 2XAHA 4PZJA 5ICGA 1WKMA 1JHHA 3KLOA 3VEPA 1W7PB 4N0BA 4CDGA 5EEHA 1MDMA 1EV7A 3RYRA 5H20A 1GXPA 5J8FA 2XAFA 2Z99A 3ECOA 1U78A 3BPVA 2O61A 1TNTA 4OMZA 2K7LA 3ECHA 2RC4A 5E20A 4RGSA 5DD8A 2WC2A 2CO5A 4RB2C 3KP3A 1A04A 3JW4A 3C18A 4CYDA 3K0LA 3KE2A 1RIOH 2JT1A 1G3YA 1FT9A 1S3JA 3BDDA 3ISPA 2DQRA 2GIVA 2HZTA 1JHFA 4O3MA 4CICA 4A0XA 2DU9A 2HYGD 3JTGA 5J8CA 3BWGA 4U7DA 1T6SA 1G4DA 2L3DA 4NQWA 1O7LA 2PMUA 4I09A 1TQIA 3KEQA 2ZBKA 3ML6A 1QZYA 4KDPA 5KK1A 2M45A 4EMSA 3QP6A 4MEXF 2P7CB 1J7KA 1S8NA 1B9NA 5JHUA 2IP2A 4M9XA 4MEYF 2ZMEB 3L09A 2PG4A 2YU3A 3WG9A 3ULQB 2XKPA 1IW7F 3P7NA 5LRSA 4DQ2A 5JFRA 4ZYDA 2DPDA 4HYEA 3QU3A 2IA1A 1P4AA 1FP2A 3QU6A 1ZRCA 4EGZA 2CQKA 3MAJA 4I7HA 3QPHA 3QOPA 3CDHA 3GVAA 2XRNA 2EA2A 3KP4A 4FX4A 2GXGA 2X0LA 1FYKA 2P4WA 1O57A 1S6LA 2VBZA 2OU2A 1U2WA 1KQ0A 3IRQA 2UZKA 3TO9A 3TOBA 5L3EA 2FXAA 2UXXA 1SFXA 4M6XA 1LNWA 5D5XB 1XGNA 3C7JA 3M8FA 1BI0A 1IXCA 2CYYA 4Q48A 1R5HA 3WU1B 4IF4A 3IKTA 2FOKA 3CUQC 1TW3A 4QWQA 4AVPA 2OBPA 4ON0A 5BPDA 2YPRA 4XLNF 4FX0A 4EJUA 4LB5A 1R1UA 1OKRA 3QAHA 2XV4S 2FNPA 4M74A 3WTSC 2FEZA 2PQ8A 2JRTA 5DUKA 2MA3A 4ZYGA 2QZ8A 5K1YA 1DPUA 5D4SA 5J6XA 4UUVA 1XMKA 4OIQF 4WCGA 5D5VB 2E7XA 1O3RA 1W5TA 1PP8F 5CJ9A 4E70A 1BIAA 5FFZA 4A0YA 5HDGA 4L5JA 3GZ6A 1YO5C 1ZG1A 1MKMA 5FLXZ 1BC7C 1EH7A 1CGPA 3BJ6A 2M1BA 2WTEA 3GXOA 3KZYA 3N4MA 2QM3A 1BI2A 3N97A 4UVBA 1ZLJA 3SHFA 1HXDA 1YS6A 2W25A 2W84A 4AIJA 4ZZDA 4ENNA 3D5LA 3O2PE 1RNLA 1IN4A 1LQ1A 2PFBA 2P7VB 1CF7B 3KCCA 3I4PA 2O03A 3DQVC 1ON1A 2F5CA 3JTHA 3S2WA 2Q8KA 4WX9A 1I6XA 3E6BA 5L3GA 2XAQA 2VBXA 2ADUA 1DP7P 3IWZA 1K7AA 1GXQA 4K2EA 4M71A 1J5YA 1J2XA 2ZMEA 2ZO4A 1V3FA 4L0YB 4M73A 1ZH5A 4U0YA 2W85A 4MQ9F 5FO5A 2FQ3A 2EFPA 5FGMA 3LWFA 3ABUA 3D0SA 2MLGA 3LSTA 4DNCA 1QZZA 1RUOA 5JI6A 1W5SA 1J59A 2O8XA 4OINF 1OPCA 2NAZA 2W24A 5TJJA 5AIQA 1YG2A 1IN7A 3P9CA 1EH6A 1QBJA 3E6DA 5ILSA 4O5VA 4HLYA 4TV7A 2NRAC 3J80K 2RGVA 2O3FA 3J81Z 3K1PA 3W6KB 3M8EA 2ZNZA 4HF0A 3GUDA 3HIFA 5F6FA 5DUIA 1IZ1A 1FPQA 1U5TA 3ERED 2FBKA 3M1EA 1HKTA 1USTA 1X3UA 3KP6A 1R1VA 4I0AA 2EV5A 3HHHA 3GX4X 2K4BA 1UHWA 2EFWA 3MCZA 4KT5C 2B0LA 4ESJA 1U6GA 2F5FA 5BQTA 4OMYA 2Y0MA 4GGGA 3MEXA 3RTRA 2OAZA 1DDNA 3JAMK 2HQNA 1MDMB 5D8LB 3IL2A 3ROUA 3TO7A 3HRSA 1ZLKA 2JZYA 3LA7A 2CWEA 2G9WA 3HRTA 1VTNC 1R22A 5LRRA 2DW4A 3KFWX 3MQ0A 4HOBA 1WRJA 2P5VA 4L9TA 3HOSA 4B8XA 1IRFA 1BC8C 2HGCA 1KU2A 3V8LA 3I53A 2OZ6A 1ZREA 4Y13A 1Z6TA 3MWMA 1P92A 1KQ9A 1SD5A 1F4KA 2Z5UA 2A07F 2MBFA 3DPLC 4IVNA 4F7ZA 1I5ZA 2CW0F 2NS0A 1QO0D 4LJZF 1P2FA 3GF2A 2QQ9A 1S29A 4N9IA 2MH2A 5L3DA 1K6OA 1DPRA 2CGPA 4UV8A 2FBHA 4P96A 2P6SA 2YX4A 1RZ4A 2QUFA 2MLKA 4U0WA 3BJAA 2EJRA 2EV6A 3RJPA 3EUHA 1RI7A 4YFNF 1ZGJA 3HRMA 1BM9A 3WTUC 4RB0A 4JQFA 1NHAA 4G9YA 1T38A 2R7FA 2JTVA 2P6TA 2NYXA 1FLIA 2BBYA 3U9GA 5LHHA 1LVAA 1GVJA 3V7SA 2M8EA 2EB7A 1O3QA 2ZNYA 3BOQA 3CUQB 4YIIA 2XASA 1XDSA 2GA1A 4KIGA 1LJ9A 2GA2A 4A6EA 2H27A 2CSOA 2R7DA 3GO5A 3G3ZA 4HX7A 4ESBA 2QYOA 5LHGA 4XSXF 2LF7A 1YTYA 2IJLA 4ZYHA 1O3SA 2A68F 4LD5A 3DP7A 3ZN1A 1SD4A 2O0YA 3F22A 4ENKA 2STTA 1LDKB 1WI9A 2E7WA 4BXUA 1T98A 4ZYEA 4AIKA 1R1TA 3CJNA 2Y75A 3U2RA 3B02A 2ZXJA 4L9NA 5AONA 5IT9Z 2FU4A 5LGNA 2V1DA 3RKYA 2D1HA 1FC3A 3C1DA 3BZ6A 3LQQA 1ZG3A 1J75A 5CVUA 3WTXC 2J5OA 4LG0A 2IA2A 3FMQA 2WWYA 5D5WB 1WWXA 4ENMA 1HQCA 3HSEA 3R4KA 1I1SA 1UHMA 3WGIA 1FSEA 1FOKA 2D2WA 1UCRA 2QWWA 2VC0A 3GEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRH A;  4N9H A;  3FXU A;  1AWC A;  4A0Z A;  3BRO A;  3BY6 A;  1IN8 A;  1KU3 A;  3I59 B;  3B73 A;  1IRG A;  2DO7 A;  3WTY C;  3FM5 A;  3LA2 A;  5HS9 A;  3MZY A;  4EM2 A;  2HKO A;  2OQR A;  1XGM A;  5HVQ C;  2DK8 A;  1HBX G;  4XLP F;  1I1G A;  1R23 A;  5K5O A;  4GCV A;  4JK1 X;  2PN6 A;  4UHT A;  3TKY A;  4Y15 A;  2E1C A;  2XKO A;  1AOY A;  3WOD F;  1FZP B;  3EET A;  5BMZ A;  4GYG A;  3IRR A;  4AWX B;  2E1N A;  4KFC A;  1H0M A;  1L0O C;  3I5U A;  1D5V A;  2DT5 A;  1T39 A;  4M6Y A;  3CUQ A;  5FFX A;  5F64 A;  2VT3 A;  3H3Z A;  3GFJ A;  2OZU A;  4LK1 F;  1ONV A;  3ZP5 A;  2NNY A;  3J81 K;  2Q2E A;  3WTV C;  4Q47 A;  4A2U A;  5LGU A;  1U5T B;  3TGN A;  3V8K A;  3FM3 A;  1T0F A;  1Z9C A;  4S05 A;  2GAU A;  2M5W A;  5CVJ A;  5ILU A;  4OOI A;  3BPX A;  4GXO A;  3HUG A;  4A5N A;  4WXH A;  1O3T A;  2R3S A;  1TLH B;  2RNJ A;  1HKQ A;  2Z9O A;  4KNY A;  1BOA A;  4HLX A;  3GLX A;  2VBY A;  3DEU A;  3C3W A;  2ISZ A;  3AAF A;  3F8B A;  3E5Q A;  2HDC A;  2LSO A;  1XDU A;  4AIH A;  3L7W A;  4BAY A;  3REO A;  3I58 A;  3PQJ A;  1YW9 A;  2M30 A;  1R58 A;  2VOP A;  4A12 A;  5DCM B;  4R8H A;  5D6E A;  1ON2 A;  4NB5 A;  2DFI A;  3HSR A;  4KYW A;  2TDX A;  1TQP A;  3WTT C;  4EM1 A;  3DFG A;  1Q1H A;  3CO6 C;  1IXS B;  4BHB A;  3WE2 A;  4IPA A;  2A61 A;  3LAJ A;  2DPU A;  3I59 A;  2L4M A;  3IWF A;  4B09 A;  5LEJ A;  5K5Q A;  4IHT A;  1ZHF A;  2EFO A;  1ZAR A;  3GFL A;  1JGS A;  4G6Q A;  4MGR A;  2EWN A;  4R1H A;  4OU0 A;  3J7A O;  5DD4 A;  2P5L C;  1HW1 A;  3M7G A;  2OD5 A;  3FMR A;  1SFU A;  3NQO A;  4UVC A;  2H94 A;  3F23 A;  4HF2 A;  3RYP A;  4P9U A;  4PDK A;  1PUE E;  3H92 A;  3SQN A;  3ABT A;  1HW2 A;  3KET A;  4HQE A;  3F72 A;  5CVV A;  3GZ5 A;  3WGG A;  3SZP A;  1SFE A;  2ACJ A;  5HOO A;  1TW2 A;  1MD0 A;  4M9S A;  4JBA A;  3LFK A;  3EYI A;  1KA8 A;  3F8C A;  1KGS A;  1G3T A;  1UFM A;  1SD7 A;  2HFH A;  1XN7 A;  2BYV E;  5FD5 A;  3I71 A;  1FBU A;  1FSH A;  3I64 A;  4HV5 A;  4HBL A;  2D45 A;  3FXQ A;  4A5M A;  1YW7 A;  4UNO A;  4LLG F;  4KN4 X;  1XSV A;  2FML A;  2K4J A;  4G6D A;  1IUY A;  4EVI A;  1Z05 A;  3E3V A;  3L00 A;  1YIO A;  2BV6 A;  3KP7 A;  2LKP A;  5L3C A;  1W4M A;  4BH9 A;  2DK5 A;  2F2E A;  4LMY A;  1IXR C;  2RKH A;  1IN6 A;  4YFK F;  1XSD A;  4I98 B;  3P9K A;  2H6C A;  3R6S A;  4HX4 A;  4Y17 A;  1SAX A;  4KIB A;  4EJW A;  1B59 A;  4HZF A;  5F1R A;  2V79 A;  1C0W A;  3F8M A;  3HRU A;  2QVO A;  1XCB A;  4H0E A;  1XD7 A;  2GWR A;  3CO7 C;  5D8K B;  5DCM A;  5E18 F;  4XSZ F;  4KIF A;  2F5E A;  3ZMS A;  2PJP A;  3F6O A;  3KP2 A;  4LB6 B;  5L3B A;  5HDK A;  2ZCW A;  1B6A A;  1P4W A;  3T0Y A;  5CLS A;  3Q5F A;  1SD6 A;  4EJT A;  1YYV A;  4PGH A;  3NEU A;  1ZG5 A;  2FA5 A;  3V4G A;  2A6H F;  3HSF A;  3OOP A;  4IHS A;  6PAX A;  4LG0 B;  1YQA A;  3WTW C;  3GWZ A;  2FF4 A;  1B4A A;  3LAP A;  4M72 A;  1YS7 A;  1OR7 A;  4R79 A;  1GHC A;  1W7P D;  2HS5 A;  1BIB A;  1LEA A;  1QPM A;  3KP5 A;  4EGY A;  4BQA A;  2KIM A;  2JPB A;  3T5X A;  1XGO A;  3K69 A;  4U7B A;  3RIR A;  3HOT A;  2DBB A;  2XIG A;  5JR3 A;  4ENJ A;  2JSC A;  3K2Z A;  1MJ9 A;  1R7J A;  1HW5 A;  4OIO F;  1SMY F;  4FHT A;  1SMT A;  5HDN A;  5AIP A;  2VON A;  2CFX A;  5CVR A;  1WQ2 A;  4BYY A;  1I27 A;  4WXC A;  2Y48 A;  2MD5 A;  1FBQ A;  2KIU A;  1D3Y A;  3CTA A;  2KJB A;  2IA0 A;  1BI3 A;  4RAY A;  3TOA A;  3J80 Z;  2STW A;  3DV8 A;  2A6E F;  3I54 A;  2MC3 A;  2ESN A;  2PEX A;  3FMS A;  3V7C A;  2LDU A;  2BE5 F;  1MZB A;  3I0T A;  2RVC A;  3QP5 A;  1OYI A;  5BOX A;  2G7U A;  5A2Q Z;  4Q5S F;  1HKS A;  4KUM A;  3RPQ A;  3ZPL A;  2FNA A;  5E1W A;  5ERI A;  4M9Z A;  2RQP A;  3W6J B;  2HQR A;  4RS8 A;  4IJA A;  3ZQ7 A;  1KYW A;  4IRI A;  3FWE A;  4KMU X;  1XSX A;  4AD9 A;  2P8T A;  5FB2 A;  2FE3 A;  1K79 A;  1J9I A;  2Q0O A;  3ZN0 A;  3V8J A;  4NHJ A;  5HLG A;  3GYH X;  3F3X A;  2HYF A;  2AXL A;  3F8N A;  1BJA A;  2QLZ A;  3SZT A;  5E8I A;  2WV0 A;  4RGX A;  2YX7 A;  1H9T A;  1BI1 A;  1ZRD A;  3E6C C;  1FNN A;  2IRF G;  1Y0U A;  2K02 A;  3R0J A;  4MHG A;  5HLI A;  2V9V A;  1FY7 A;  3BP8 A;  4MNU A;  5DEQ A;  4P5O A;  5FLX K;  5D4R A;  3EQL F;  1D8J A;  4HX8 A;  3NRV A;  5CVI A;  2DQL A;  1STZ A;  5HLH A;  3E5U A;  3LQR A;  4G94 A;  2PI0 A;  3L2C A;  2DLL A;  4WK8 F;  4RGU A;  4Z2Y A;  2VE9 A;  5DYM A;  4KA4 A;  2FSW A;  1ZRF A;  2C6Y A;  1TTY A;  4IRG A;  4D0P A;  4G7H F;  2VXZ A;  2M87 A;  1TNS A;  4RB1 A;  4HF1 A;  1TQM A;  1OYW A;  1T2K A;  4O6J A;  1JXS A;  1ZGA A;  3K9T A;  4HDU A;  4I2O A;  1UB9 A;  2A69 F;  1O7F A;  4UXN A;  2O6G E;  1V4R A;  3PQK A;  2F5D A;  1B9M A;  4MQV A;  1YLF A;  4U0V A;  3F6V A;  3FX3 A;  4FT8 A;  4S04 A;  4P9F A;  1R36 A;  3KLN A;  4CO8 A;  3R61 A;  1OMI A;  1IF1 A;  5EEG A;  2EFN A;  2QBY B;  1XGS A;  3T1B A;  3T8R A;  2COM A;  2D1V A;  2KIF A;  4CZZ A;  1B1B A;  2QQA A;  1Z7U A;  1F5T A;  2L54 A;  2VN2 A;  5HS8 A;  4HDV A;  4KN7 X;  4HW0 A;  1WSU A;  3K1N A;  2EA4 A;  3ZMV A;  4G8X A;  2PLY A;  3RKW A;  2DTR A;  3TQN A;  2X4H A;  2IVM A;  2QQB A;  4HA8 A;  1XCV A;  4QLC U;  2PBI A;  3G73 A;  5ED4 A;  5L3F A;  1BBY A;  3VFZ A;  2V6C A;  3Q9V A;  2IPQ X;  2HWV A;  3COA C;  2W57 A;  3KZZ A;  4ESF A;  2L01 A;  4CHU A;  1DUX C;  1W7P A;  4IXA A;  4KMF A;  4EM0 B;  2VT2 A;  1S7A A;  2ZJ2 A;  3DPT A;  4YIF A;  2ZKZ A;  2GXB A;  2KRF A;  2VC1 A;  1E17 A;  1R00 A;  5H6R A;  3HYI A;  3MZH A;  3K1M A;  2QEN A;  1D8K A;  2ELH A;  3EYY A;  2OA4 A;  5DDG A;  1PP7 U;  3MFK A;  1BN5 A;  3LA3 A;  3VOE A;  1F9N A;  4I02 A;  3VOD A;  4CXF A;  1HST A;  4MTD A;  2Z3Y A;  3KEO A;  4LLL A;  5DCF A;  3WU0 A;  2ETH A;  1KQ8 A;  4GYI A;  1FX7 A;  3SXY A;  1LDJ A;  3ELK A;  5E1Z B;  1L3L A;  2GQQ A;  4HAM A;  3DF8 A;  2A5Y B;  3U1D A;  4EQQ A;  4YFX F;  3HHG A;  2HKX A;  3E6M A;  1P6R A;  5ILV A;  2VOD A;  1IN5 A;  2GZW A;  4L9V A;  4HQM A;  2IT0 A;  2J5P A;  1ZN2 A;  5TRD A;  5CYV A;  4PGG A;  3VB2 A;  1TBX A;  2JPC A;  1ZYR F;  4U88 A;  1K78 B;  3BJO A;  3OV8 A;  4BHP A;  4L9J A;  1FBS A;  1PDN C;  1MJB A;  3QRF F;  5FD6 A;  2HTJ A;  4WWC A;  1XB4 A;  2XVC A;  4BHC A;  3FZV A;  5BPI A;  2ZFW A;  3RDI A;  3ZMZ A;  2FBI A;  5E1X A;  2EK5 A;  2YSR A;  4HV6 A;  4WF2 A;  1FWZ A;  5JVT A;  4IRH A;  2OQG A;  2QBY A;  3RI4 A;  3RPU A;  4EV0 A;  1ULY A;  3ZMD A;  4YG2 F;  3IHU A;  1OYY A;  3DKW A;  5ICF A;  4L18 B;  4ASN A;  2AS5 F;  3V7R A;  5DV5 A;  5D6F A;  3WTZ A;  4RB3 C;  1H9G A;  1USS A;  4GO1 A;  5LGT A;  5HS7 A;  1FYM A;  3CUO A;  3HTS B;  4ZZL A;  4RAZ A;  3DXJ F;  5D5U B;  2LF8 A;  3TO6 A;  2VBW A;  2V1X A;  2XAJ A;  3PFI A;  2YR2 A;  5A2Q K;  4XBF A;  3FXR A;  5LHI A;  3QPT A;  2HTS A;  1E2X A;  2UWM A;  3HTU A;  3IC7 A;  1ODD A;  2EFQ A;  4L0Z B;  2ESH A;  1U5T C;  4G7O F;  4UVA A;  4OIR F;  2ISY A;  1G3W A;  1KU7 A;  1LB2 A;  5BS6 A;  2K86 A;  2Z33 A;  3ZMU A;  1Z1D A;  1F1Z A;  4BNC A;  1YW8 A;  1G6N A;  2HR3 A;  1ZAO A;  3JSP A;  4LGW A;  4RGR A;  3P9I A;  2BGC A;  5E8G A;  4XRF A;  2G7H A;  2HOE A;  2K27 A;  4P55 A;  4ETS A;  4ZH4 F;  3M9A A;  2EV0 A;  5E17 F;  2P5K A;  1KYZ A;  4EJO A;  3CLO A;  5IT9 K;  4I01 A;  1MGT A;  3O6B B;  2IW5 A;  2PMH A;  1MJA A;  2XUB A;  2L02 A;  1CF7 A;  1RUN A;  1IAW A;  1Z6R A;  1P4X A;  5ICC A;  2L4A A;  3E97 A;  2BEO A;  4I0B A;  3SFZ A;  2VE8 A;  4L5I A;  1K78 A;  3R60 A;  1YFH A;  3GW2 A;  2RV8 A;  1XMA A;  5LEK A;  1R5G A;  3R0A A;  2RN7 A;  2H09 A;  4LFU A;  3WGH A;  5LLQ A;  1QQI A;  4KIC A;  3H3U A;  2V1U A;  4LLN A;  4WXD A;  2UXN A;  2XGX A;  2HEO A;  2KKO A;  3E5X A;  4A6D A;  1S7O A;  1U8R A;  4OIP F;  1QGP A;  2VOO A;  3RKX A;  3FF5 A;  2NNN A;  3F21 A;  2MH9 A;  3JSO A;  2DI3 A;  3T8T A;  1LDD A;  3F8F A;  4UV9 A;  1EH8 A;  4MTE A;  3ZMT A;  5H6Q A;  1Z91 A;  2FMY A;  1J0R A;  3FHZ A;  2XHK A;  2CG4 A;  1REP C;  3L9F A;  5ICE A;  3WE3 A;  3EDP A;  1FYL A;  1QNT A;  1JE8 A;  4LK0 F;  3O3K A;  1KU9 A;  2H6B A;  3GFM A;  3TDU C;  2XRO A;  1LEB A;  4EJV A;  3GFI A;  5IT3 A;  5K5R A;  1FP1 D;  2A3S A;  4Q4Z F;  4PCQ A;  5LBQ A;  1U3E M;  2RDP A;  3Q9S A;  2LNB A;  2XAG A;  4CGZ A;  5KVR A;  1HSJ A;  1G3S A;  2DAO A;  4G7Z F;  3JAM Z;  3IKV A;  2KJC A;  3TDZ C;  2XAH A;  4PZJ A;  5ICG A;  1WKM A;  1JHH A;  3KLO A;  3VEP A;  1W7P B;  4N0B A;  4CDG A;  5EEH A;  1MDM A;  1EV7 A;  3RYR A;  5H20 A;  1GXP A;  5J8F A;  2XAF A;  2Z99 A;  3ECO A;  1U78 A;  3BPV A;  2O61 A;  1TNT A;  4OMZ A;  2K7L A;  3ECH A;  2RC4 A;  5E20 A;  4RGS A;  5DD8 A;  2WC2 A;  2CO5 A;  4RB2 C;  3KP3 A;  1A04 A;  3JW4 A;  3C18 A;  4CYD A;  3K0L A;  3KE2 A;  1RIO H;  2JT1 A;  1G3Y A;  1FT9 A;  1S3J A;  3BDD A;  3ISP A;  2DQR A;  2GIV A;  2HZT A;  1JHF A;  4O3M A;  4CIC A;  4A0X A;  2DU9 A;  2HYG D;  3JTG A;  5J8C A;  3BWG A;  4U7D A;  1T6S A;  1G4D A;  2L3D A;  4NQW A;  1O7L A;  2PMU A;  4I09 A;  1TQI A;  3KEQ A;  2ZBK A;  3ML6 A;  1QZY A;  4KDP A;  5KK1 A;  2M45 A;  4EMS A;  3QP6 A;  4MEX F;  2P7C B;  1J7K A;  1S8N A;  1B9N A;  5JHU A;  2IP2 A;  4M9X A;  4MEY F;  2ZME B;  3L09 A;  2PG4 A;  2YU3 A;  3WG9 A;  3ULQ B;  2XKP A;  1IW7 F;  3P7N A;  5LRS A;  4DQ2 A;  5JFR A;  4ZYD A;  2DPD A;  4HYE A;  3QU3 A;  2IA1 A;  1P4A A;  1FP2 A;  3QU6 A;  1ZRC A;  4EGZ A;  2CQK A;  3MAJ A;  4I7H A;  3QPH A;  3QOP A;  3CDH A;  3GVA A;  2XRN A;  2EA2 A;  3KP4 A;  4FX4 A;  2GXG A;  2X0L A;  1FYK A;  2P4W A;  1O57 A;  1S6L A;  2VBZ A;  2OU2 A;  1U2W A;  1KQ0 A;  3IRQ A;  2UZK A;  3TO9 A;  3TOB A;  5L3E A;  2FXA A;  2UXX A;  1SFX A;  4M6X A;  1LNW A;  5D5X B;  1XGN A;  3C7J A;  3M8F A;  1BI0 A;  1IXC A;  2CYY A;  4Q48 A;  1R5H A;  3WU1 B;  4IF4 A;  3IKT A;  2FOK A;  3CUQ C;  1TW3 A;  4QWQ A;  4AVP A;  2OBP A;  4ON0 A;  5BPD A;  2YPR A;  4XLN F;  4FX0 A;  4EJU A;  4LB5 A;  1R1U A;  1OKR A;  3QAH A;  2XV4 S;  2FNP A;  4M74 A;  3WTS C;  2FEZ A;  2PQ8 A;  2JRT A;  5DUK A;  2MA3 A;  4ZYG A;  2QZ8 A;  5K1Y A;  1DPU A;  5D4S A;  5J6X A;  4UUV A;  1XMK A;  4OIQ F;  4WCG A;  5D5V B;  2E7X A;  1O3R A;  1W5T A;  1PP8 F;  5CJ9 A;  4E70 A;  1BIA A;  5FFZ A;  4A0Y A;  5HDG A;  4L5J A;  3GZ6 A;  1YO5 C;  1ZG1 A;  1MKM A;  5FLX Z;  1BC7 C;  1EH7 A;  1CGP A;  3BJ6 A;  2M1B A;  2WTE A;  3GXO A;  3KZY A;  3N4M A;  2QM3 A;  1BI2 A;  3N97 A;  4UVB A;  1ZLJ A;  3SHF A;  1HXD A;  1YS6 A;  2W25 A;  2W84 A;  4AIJ A;  4ZZD A;  4ENN A;  3D5L A;  3O2P E;  1RNL A;  1IN4 A;  1LQ1 A;  2PFB A;  2P7V B;  1CF7 B;  3KCC A;  3I4P A;  2O03 A;  3DQV C;  1ON1 A;  2F5C A;  3JTH A;  3S2W A;  2Q8K A;  4WX9 A;  1I6X A;  3E6B A;  5L3G A;  2XAQ A;  2VBX A;  2ADU A;  1DP7 P;  3IWZ A;  1K7A A;  1GXQ A;  4K2E A;  4M71 A;  1J5Y A;  1J2X A;  2ZME A;  2ZO4 A;  1V3F A;  4L0Y B;  4M73 A;  1ZH5 A;  4U0Y A;  2W85 A;  4MQ9 F;  5FO5 A;  2FQ3 A;  2EFP A;  5FGM A;  3LWF A;  3ABU A;  3D0S A;  2MLG A;  3LST A;  4DNC A;  1QZZ A;  1RUO A;  5JI6 A;  1W5S A;  1J59 A;  2O8X A;  4OIN F;  1OPC A;  2NAZ A;  2W24 A;  5TJJ A;  5AIQ A;  1YG2 A;  1IN7 A;  3P9C A;  1EH6 A;  1QBJ A;  3E6D A;  5ILS A;  4O5V A;  4HLY A;  4TV7 A;  2NRA C;  3J80 K;  2RGV A;  2O3F A;  3J81 Z;  3K1P A;  3W6K B;  3M8E A;  2ZNZ A;  4HF0 A;  3GUD A;  3HIF A;  5F6F A;  5DUI A;  1IZ1 A;  1FPQ A;  1U5T A;  3ERE D;  2FBK A;  3M1E A;  1HKT A;  1UST A;  1X3U A;  3KP6 A;  1R1V A;  4I0A A;  2EV5 A;  3HHH A;  3GX4 X;  2K4B A;  1UHW A;  2EFW A;  3MCZ A;  4KT5 C;  2B0L A;  4ESJ A;  1U6G A;  2F5F A;  5BQT A;  4OMY A;  2Y0M A;  4GGG A;  3MEX A;  3RTR A;  2OAZ A;  1DDN A;  3JAM K;  2HQN A;  1MDM B;  5D8L B;  3IL2 A;  3ROU A;  3TO7 A;  3HRS A;  1ZLK A;  2JZY A;  3LA7 A;  2CWE A;  2G9W A;  3HRT A;  1VTN C;  1R22 A;  5LRR A;  2DW4 A;  3KFW X;  3MQ0 A;  4HOB A;  1WRJ A;  2P5V A;  4L9T A;  3HOS A;  4B8X A;  1IRF A;  1BC8 C;  2HGC A;  1KU2 A;  3V8L A;  3I53 A;  2OZ6 A;  1ZRE A;  4Y13 A;  1Z6T A;  3MWM A;  1P92 A;  1KQ9 A;  1SD5 A;  1F4K A;  2Z5U A;  2A07 F;  2MBF A;  3DPL C;  4IVN A;  4F7Z A;  1I5Z A;  2CW0 F;  2NS0 A;  1QO0 D;  4LJZ F;  1P2F A;  3GF2 A;  2QQ9 A;  1S29 A;  4N9I A;  2MH2 A;  5L3D A;  1K6O A;  1DPR A;  2CGP A;  4UV8 A;  2FBH A;  4P96 A;  2P6S A;  2YX4 A;  1RZ4 A;  2QUF A;  2MLK A;  4U0W A;  3BJA A;  2EJR A;  2EV6 A;  3RJP A;  3EUH A;  1RI7 A;  4YFN F;  1ZGJ A;  3HRM A;  1BM9 A;  3WTU C;  4RB0 A;  4JQF A;  1NHA A;  4G9Y A;  1T38 A;  2R7F A;  2JTV A;  2P6T A;  2NYX A;  1FLI A;  2BBY A;  3U9G A;  5LHH A;  1LVA A;  1GVJ A;  3V7S A;  2M8E A;  2EB7 A;  1O3Q A;  2ZNY A;  3BOQ A;  3CUQ B;  4YII A;  2XAS A;  1XDS A;  2GA1 A;  4KIG A;  1LJ9 A;  2GA2 A;  4A6E A;  2H27 A;  2CSO A;  2R7D A;  3GO5 A;  3G3Z A;  4HX7 A;  4ESB A;  2QYO A;  5LHG A;  4XSX F;  2LF7 A;  1YTY A;  2IJL A;  4ZYH A;  1O3S A;  2A68 F;  4LD5 A;  3DP7 A;  3ZN1 A;  1SD4 A;  2O0Y A;  3F22 A;  4ENK A;  2STT A;  1LDK B;  1WI9 A;  2E7W A;  4BXU A;  1T98 A;  4ZYE A;  4AIK A;  1R1T A;  3CJN A;  2Y75 A;  3U2R A;  3B02 A;  2ZXJ A;  4L9N A;  5AON A;  5IT9 Z;  2FU4 A;  5LGN A;  2V1D A;  3RKY A;  2D1H A;  1FC3 A;  3C1D A;  3BZ6 A;  3LQQ A;  1ZG3 A;  1J75 A;  5CVU A;  3WTX C;  2J5O A;  4LG0 A;  2IA2 A;  3FMQ A;  2WWY A;  5D5W B;  1WWX A;  4ENM A;  1HQC A;  3HSE A;  3R4K A;  1I1S A;  1UHM A;  3WGI A;  1FSE A;  1FOK A;  2D2W A;  1UCR A;  2QWW A;  2VC0 A;  3GEZ A; 
#chains in the Genus database with same CATH topology
 2FRH A;  3CCY A;  4N9H A;  3PNT A;  3FXU A;  3H35 A;  1AWC A;  4A0Z A;  3BRO A;  3BTI A;  3BY6 A;  1IN8 A;  2VJJ A;  1XG1 A;  1KU3 A;  3I59 B;  2H8R A;  3B73 A;  1IRG A;  2DO7 A;  4KJZ A;  1UAA A;  1WJE A;  4ZYA A;  3WTY C;  1VQN I;  3FM5 A;  3LA2 A;  1SFK A;  5HS9 A;  3GTG J;  2DT6 A;  2R7R A;  3MZY A;  1N78 A;  1VQO I;  4EM2 A;  2M7B A;  2NVQ J;  2HKO A;  2OQR A;  1XGM A;  4BQN A;  5HVQ C;  1VQM I;  2DK8 A;  1HBX G;  2VUM J;  3OYN A;  1V55 H;  3TED A;  2L7M P;  4XLP F;  1RKW A;  2E1M B;  5B1B H;  1FOW A;  3HOV J;  1I1G A;  4MFE A;  1R23 A;  1OIS A;  3CJT B;  5K5O A;  3OYL A;  1KON A;  4MFD A;  3CCU I;  4GCV A;  4JK1 X;  2PN6 A;  3L2R A;  4UHT A;  3VYS B;  4Y7N J;  3TKY A;  2X1E A;  4Y15 A;  3ABM H;  4PSX A;  2E1C A;  2XKO A;  2KZV A;  2LH9 A;  1AOY A;  1NTC A;  3WOD F;  3JRE A;  3TP0 A;  1FZP B;  3EET A;  3PJR A;  5FRO A;  5BMZ A;  4GYG A;  1A5J A;  2ID3 A;  3IRR A;  4AWX B;  2E1N A;  1WFX A;  4A3L J;  3CCM I;  4KFC A;  1U0J A;  1W5C C;  1H0M A;  2E34 A;  3DLA A;  1L0O C;  2OTJ I;  2DA3 A;  1JUS A;  1WJA A;  3I5U A;  5CQG A;  1FOX A;  5IOY A;  2NS7 A;  1D5V A;  2DT5 A;  4II2 A;  1T39 A;  4A3J J;  2QQ8 A;  4M6Y A;  3CUQ A;  1EA3 A;  2R7Z J;  5FFX A;  3KYC B;  5F64 A;  2VT3 A;  3A0B C;  3H3Z A;  2XPW A;  3GFJ A;  4Y33 A;  5K7H A;  3OYB A;  3OY9 A;  2OZU A;  2CQN A;  4LK1 F;  1FIA A;  1ONV A;  3ZP5 A;  3RZO J;  2LY2 A;  3FBI B;  2NNY A;  3J81 K;  2Q2E A;  3WTV C;  4RMN A;  4Q47 A;  4A2U A;  5LGU A;  1ETW A;  1U5T B;  1JT6 A;  3KYD B;  5E3L A;  3DTK A;  3TGN A;  3V8K A;  3FM3 A;  1T0F A;  2Z1D A;  1Z9C A;  4S05 A;  2GAU A;  4GDF A;  1MMG A;  2M5W A;  5CVJ A;  5ILU A;  1ETK A;  4OOI A;  3BPX A;  4GXO A;  2EZH A;  3HUG A;  4A5N A;  4JX5 A;  1JJ8 C;  4WXH A;  1O3T A;  2R3S A;  1TLH B;  2RNJ A;  1MSF C;  2N8G A;  3Q0W A;  1HKQ A;  2Z9O A;  1ETX A;  4KNY A;  2VI6 A;  3I3L A;  1BOA A;  4HLX A;  1ZEL A;  2CQQ A;  3GLX A;  2VBY A;  2KRC A;  3DEU A;  3C3W A;  2ISZ A;  3AAF A;  1XPX A;  1R4M B;  3F8B A;  3E5Q A;  2G0E A;  2HDC A;  2LSO A;  1XDU A;  4AIH A;  3L7W A;  5FKM A;  4BAY A;  3REO A;  3I58 A;  3PQJ A;  1JGG A;  3SEZ A;  1YW9 A;  2M30 A;  3CC2 I;  1R58 A;  4XLC A;  2VOP A;  1MBG A;  3H9J A;  3CLQ A;  4A12 A;  5DCM B;  4R8H A;  4J00 A;  3AG2 H;  4BL0 B;  2BHY A;  5D6E A;  1ON2 A;  4NB5 A;  1R71 A;  2DFI A;  4A3F J;  4KIS A;  3HSR A;  3CES A;  2JUG A;  3LSM A;  3L2V A;  3KZI C;  2EIJ H;  1I6H J;  4CYC B;  2HOA A;  4PFO A;  1HLV A;  4KYW A;  2VAS A;  3ZQI A;  2TDX A;  1I3A A;  2XGC A;  1TQP A;  3WTT C;  2F4I A;  3K4M A;  4EM1 A;  2WAQ A;  3DFG A;  2E2J J;  2FUG 2;  1V5G A;  1Q1H A;  1VQK I;  3CO6 C;  1IXS B;  2HU9 A;  4BHB A;  3WE2 A;  3I4M J;  4IPA A;  2LFB A;  2A61 A;  2HYJ A;  3LAJ A;  2DPU A;  3I59 A;  2ZXH A;  2L4M A;  3IWF A;  2KPM A;  1QA6 A;  4B09 A;  5LEJ A;  3M3Y J;  5K5Q A;  4IHT A;  2W1O A;  1ZHF A;  2EFO A;  1ZK8 A;  5IYC J;  1ZAR A;  2E5Z A;  3GFL A;  1JGS A;  4G6Q A;  4MGR A;  2EWN A;  4R1H A;  3W6V A;  4OU0 A;  3J7A O;  5DD4 A;  2CV2 A;  3BCB A;  2P5L C;  1HW1 A;  3BT9 A;  3JRC A;  3M7G A;  3PUB A;  2OD5 A;  2HNH A;  3FMR A;  4GFB A;  4E7I A;  1SFU A;  3A01 B;  5JHF A;  2LBF B;  2B7E A;  3NQO A;  4UVC A;  2H94 A;  3F23 A;  1YIJ I;  4HF2 A;  3RYP A;  5EG0 A;  3AL0 B;  3S15 J;  3BCA A;  2KDO A;  3BR6 A;  3HPG A;  3TP3 A;  3G1M A;  2DA1 A;  2RNG A;  4HST A;  4UB6 C;  1X1C A;  4P9U A;  3CCQ I;  2GBY A;  4PDK A;  1PUE E;  3S3M A;  3H92 A;  2LR8 A;  5DS9 A;  3SQN A;  3ABT A;  3A1Y A;  4CCN A;  3JRG A;  1HW2 A;  3KET A;  4HQE A;  3F72 A;  5CVV A;  3GZ5 A;  3WGG A;  3SZP A;  1SFE A;  2ACJ A;  5HOO A;  1MBJ A;  1TW2 A;  1MD0 A;  5K7Z A;  4M9S A;  5IOZ A;  4QTR A;  2VB6 A;  3IH4 A;  3KIO A;  2R7T A;  5M3F J;  4JBA A;  3LFK A;  1OLT A;  3OL3 A;  5GTI C;  5JVG F;  1KA8 A;  3Q0U A;  3EYI A;  3F8C A;  4M3G A;  1FMV A;  2PJR B;  1KGS A;  3S3O A;  1G3T A;  2VIX A;  1UFM A;  1SD7 A;  4F93 B;  3F0C A;  3PUF A;  1HC8 A;  4V19 K;  2XB0 X;  2I5U A;  3SYT A;  2HFH A;  1XN7 A;  3DU6 A;  3I9V 2;  2BYV E;  5FD5 A;  1H89 C;  3I71 A;  1FBU A;  1FSH A;  3I64 A;  4HV5 A;  3QYF A;  3EUK L;  1GV2 A;  3LNQ A;  4HBL A;  3HOW J;  2D45 A;  3FXQ A;  4BBR J;  4A5M A;  5CKT A;  2HVQ A;  4A3B J;  4AID A;  2R7U A;  1YW7 A;  2CUZ A;  4UNO A;  1IDY A;  4LLG F;  4XL9 A;  4CCM A;  2KHM A;  1XSV A;  2FML A;  2K4J A;  4KN4 X;  5GAD J;  4G6D A;  1IUY A;  4EVI A;  2JN6 A;  1Z05 A;  3E3V A;  4J19 A;  3L00 A;  1YIO A;  2BV6 A;  1R4N B;  2EZI A;  3SFI A;  3S1R J;  3KP7 A;  5F04 A;  2UUZ A;  2LKP A;  5L3C A;  1OCO H;  4FAS D;  1W4M A;  4XK4 A;  4BH9 A;  2M2E A;  4A3E J;  2DK5 A;  2F2E A;  4LMY A;  4D7N A;  2M34 A;  1V54 H;  1IXR C;  2RKH A;  4XN0 A;  1IN6 A;  3CQZ J;  4YFK F;  1XSD A;  4DZJ A;  1Z3X A;  4I98 B;  2ECB A;  3P9K A;  2H6C A;  2JK3 A;  2W00 A;  3R6S A;  5M3M J;  4HX4 A;  4Y17 A;  1SAX A;  1B72 B;  4KIB A;  3A0H C;  1FOY A;  3FK7 A;  4EJW A;  1B59 A;  4W1U A;  2CUF A;  4HZF A;  2NXN B;  2K9Q A;  2ME0 A;  1F43 A;  5F1R A;  2V79 A;  4DW6 A;  3C2H A;  1C0W A;  3A03 A;  3F8M A;  3HRU A;  2QVO A;  1XCB A;  4H0E A;  1XD7 A;  2ICW G;  2HPI A;  2GWR A;  4XRS G;  1HCR A;  5H2F C;  3CO7 C;  5D8K B;  5DCM A;  4E7K A;  5E18 F;  2DOF A;  3DPU A;  4XSZ F;  1TZL A;  3HB9 A;  4KIF A;  2F5E A;  3KPH A;  3ZMS A;  2PJP A;  3F6O A;  3KP2 A;  3HOY J;  3P5J A;  3OMY A;  4LB6 B;  5L3B A;  4J01 A;  1SAN A;  2ZFU A;  5HDK A;  1WH5 A;  2ZCW A;  1B6A A;  1ZGW A;  4DBQ A;  1P4W A;  3T0Y A;  4CYC A;  5F08 A;  5CLS A;  3ZXS A;  5KAF C;  3Q5F A;  1SD6 A;  5GTH C;  4EJT A;  1IGN A;  1TT5 B;  2O8K A;  3OR2 C;  1YYV A;  3MN2 A;  4PGH A;  3NEU A;  3OIP A;  1Z0X A;  1W0T A;  1ZG5 A;  2QSG X;  2R5Z B;  4U87 A;  2FA5 A;  2KP6 A;  3V4G A;  1X2M A;  2EQR A;  2QF7 A;  2H8W A;  3CCJ I;  1SEU A;  2A6H F;  3HSF A;  3OOP A;  4IHS A;  6PAX A;  1Z77 A;  4LG0 B;  3RQ4 A;  1YQA A;  3WTW C;  2QCO A;  3GWZ A;  4II3 A;  1LPQ A;  2FF4 A;  1B4A A;  1D0Y A;  2CUJ A;  3HG9 A;  3LAP A;  4M72 A;  1YS7 A;  5IYD J;  4AVZ A;  1OR7 A;  4R79 A;  1IV8 A;  2L9R A;  3VDX A;  1W7P D;  1LE8 B;  1GHC A;  3VWB A;  4E7S A;  2HS5 A;  2WAD A;  1AU7 A;  1BIB A;  4ZDO A;  2GOM A;  1LEA A;  1QPM A;  2ZSI B;  3KP5 A;  3OWT A;  3GTQ J;  3DU5 A;  4EGY A;  1SFO J;  4BU2 A;  3A01 A;  4BQA A;  2KIM A;  2JPB A;  2LBF A;  3T5X A;  3JRB A;  1XGO A;  3K69 A;  4U7B A;  1SVO A;  3H9Q A;  3RIR A;  2LP0 A;  4IX7 A;  1BL0 A;  3HOT A;  4B47 A;  3HOU J;  1VQ7 I;  5J1U A;  3CD6 I;  2OV7 A;  2DBB A;  2XIG A;  5KHD A;  3BQY A;  5JR3 A;  4ENJ A;  2JSC A;  3K2Z A;  1MJ9 A;  1R7J A;  1HW5 A;  3HJE A;  2LKX A;  3PIP F;  4OIO F;  1QVU A;  1SMY F;  5EF6 A;  2XF6 A;  1TT0 A;  3HKZ A;  4RM2 A;  1RC9 A;  4FHT A;  1SMT A;  5HDN A;  2XDV A;  5AIP A;  3OS0 A;  5DM6 F;  2VON A;  2CFX A;  5CVR A;  3NWS A;  3RSN A;  1WQ2 A;  3PNV A;  4BYY A;  2KFD A;  2HVR A;  2DTZ A;  4JP0 A;  2XAU A;  1I27 A;  4WXC A;  2Y48 A;  4A3D J;  2MD5 A;  2X6Y A;  3BG9 A;  4BXF A;  1FBQ A;  2CQX A;  1APL C;  3G6E I;  4HRI A;  2KIU A;  1D3Y A;  3CTA A;  3A2K A;  2KJB A;  2X48 A;  3JCU C;  2IA0 A;  1BI3 A;  4RAY A;  3TOA A;  3J80 Z;  2V26 A;  2STW A;  3GZN B;  4DIQ A;  2OC6 A;  5FKL A;  3ABL H;  2AXT C;  4C9Y A;  3DV8 A;  3OYE A;  3DBH B;  2A6E F;  4N4O B;  3I54 A;  2IS6 A;  4DGW B;  2WAF A;  4MO7 A;  5FKO A;  2MC3 A;  3VYT B;  2BVL A;  4D5C A;  2ESN A;  2PEX A;  3FMS A;  4F52 A;  3V7C A;  2LDU A;  2DA4 A;  4RAG A;  2BE5 F;  4UY8 I;  1MZB A;  1EKE A;  2XSJ C;  1U8B A;  1E3P A;  3CCE I;  2BVM A;  3I0T A;  1JTX A;  1B8I B;  2RVC A;  3QP5 A;  1OYI A;  1IRX A;  4ZTF A;  5BOX A;  4HPQ A;  1WH7 A;  2G7U A;  1GVD A;  5A2Q Z;  1W1W E;  4Q5S F;  1HKS A;  4DYC A;  4ZC3 A;  4KUM A;  2BXZ A;  3RPQ A;  2Q1Z B;  3ZPL A;  5KAI C;  5EEA A;  2FNA A;  2CV1 A;  3VYR B;  5E1W A;  2HXO A;  5ERI A;  2Y0S N;  5LD2 C;  2Y2Z A;  1S5L C;  3FXJ A;  2JA5 J;  1IG7 A;  4XIC A;  1B72 A;  4M9Z A;  2RQP A;  5E79 C;  3W6J B;  3OSG A;  4X6A J;  2HQR A;  4RS8 A;  4IJA A;  3ZQ7 A;  1KYW A;  4IRI A;  3FWE A;  4KMU X;  1XSX A;  4AD9 A;  3HUG B;  1UZC A;  1NK2 P;  2P8T A;  1I39 A;  4BQO A;  4PSW A;  3OYM A;  1WVR A;  3J7Y J;  1YIT I;  3RPU D;  5J4V A;  5FB2 A;  3CCV I;  2FE3 A;  4E7Z A;  1K79 A;  2WAQ N;  1J9I A;  1X1B A;  2Q0O A;  2XGD A;  3BR0 A;  3ZN0 A;  3V8J A;  1HOM A;  4NHJ A;  2HQ5 A;  1M1E B;  5HLG A;  3GYH X;  3F3X A;  4PJJ A;  2HYF A;  2OCE A;  1T56 A;  2AXL A;  3F8N A;  1BJA A;  1X19 A;  2QLZ A;  3SZT A;  3FDY A;  5E8I A;  2QEX I;  1W0U A;  3MKL A;  2EZK A;  2WV0 A;  4E4H A;  3D5S C;  3FXM A;  2A05 A;  2NVU B;  4RGX A;  2YX7 A;  5KCM A;  1H9T A;  2V6E A;  1BI1 A;  4ZDP A;  1ZRD A;  3UR3 C;  3E6C C;  1FNN A;  2XGE A;  4EEF G;  2IRF G;  2P0W A;  3Q3S A;  1YOV B;  1Y0U A;  1Y39 A;  1D5Y A;  4IHX A;  2K85 A;  2B63 J;  2K02 A;  3R0J A;  4MHG A;  2BHZ A;  3IAS 2;  2A5W A;  5HLI A;  1ZQ3 P;  2V9V A;  4HG2 A;  1FY7 A;  3BP8 A;  4MNU A;  5BNG A;  1H8A C;  5DEQ A;  4BXX J;  4A3I J;  4B1R A;  1BA5 A;  4ZTJ A;  4P5O A;  5FLX K;  4X1E A;  5D4R A;  1LE8 A;  3HOZ J;  3EQL F;  1D8J A;  2M9H A;  2LOO A;  4HX8 A;  3NRV A;  3G4S I;  5CVI A;  1UHS A;  2DQL A;  2LTP A;  4AYB N;  1STZ A;  2R0Q C;  2MAB A;  2XPU A;  4LIT A;  4AC0 A;  5HLH A;  3E5U A;  4KT6 A;  3K4N A;  3LQR A;  5B66 C;  2L0K A;  2W82 A;  4G94 A;  3FIW A;  3MMY B;  3ZQG A;  2DLL A;  4WK8 F;  4RGU A;  1RKT A;  4E6K G;  4Z2Y A;  3L2C A;  2PI0 A;  2VE9 A;  3X2Q H;  5DYM A;  4DZP A;  4C3H J;  1VF9 A;  1FTT A;  4KA4 A;  5DM7 F;  4HEA 2;  2FSW A;  2IGM A;  2LD5 A;  2F6C A;  1TTY A;  1ZRF A;  2C6Y A;  4IRG A;  4D0P A;  3LSJ A;  4G7H F;  2VXZ A;  2M87 A;  5GP9 A;  2DMU A;  3G2B A;  3S1M J;  1A36 A;  1HF0 A;  1TNS A;  3O8H A;  4RB1 A;  1IDZ A;  2WBM A;  3DEW A;  4HF1 A;  1TQM A;  4D1Q A;  1OYW A;  3PSF A;  2DJN A;  1T2K A;  3L2W A;  5EG0 B;  1WJ5 A;  4O6J A;  2Y9Y A;  3BR2 A;  1JXS A;  1ZGA A;  2M4G A;  3K9T A;  3H5A A;  3ZQH A;  4HDU A;  4I2O A;  1YX5 A;  1UB9 A;  2A69 F;  1O7F A;  4UXN A;  2O6G E;  1V4R A;  2M0M A;  3E7L A;  4PUS A;  3PQK A;  2IAI A;  2F5D A;  1B9M A;  5TGT A;  4CA0 A;  1YJN I;  1FEX A;  4MQV A;  1YLF A;  4A3M J;  3EPZ A;  3H1C A;  2P81 A;  3K70 C;  4U0V A;  3F6V A;  4XON A;  3FX3 A;  1BW6 A;  4FT8 A;  4I6Z A;  4S04 A;  4P9F A;  1R36 A;  2K5C A;  3K4J A;  3KLN A;  4CO8 A;  3R61 A;  5IP9 J;  1OMI A;  2R7Q A;  1IF1 A;  5E3N A;  5EEG A;  1B8I A;  2EFN A;  2QBY B;  1XGS A;  3PSI A;  3T1B A;  3BG5 A;  4RLQ A;  2YU9 J;  3T8R A;  1VQ4 I;  2COM A;  3OYC A;  2D1V A;  3H3V K;  2R7V A;  2KIF A;  4CZZ A;  3OYG A;  1B1B A;  2QQA A;  2E5N A;  3BQZ A;  1Z7U A;  1K61 A;  1F5T A;  2L54 A;  2VN2 A;  5HS8 A;  1TWC J;  4HDV A;  4KN7 X;  4HW0 A;  1WSU A;  3K1N A;  3K4C A;  2EA4 A;  4IQ4 A;  1JKQ C;  3OYI A;  4G6T B;  2HPM A;  1MH4 A;  3ZMV A;  4UUS A;  3F9K A;  4G8X A;  3H5N A;  1V5F A;  3VSK A;  2LRE A;  2PLY A;  3GME A;  3RKW A;  2VL8 A;  4M6V A;  2DTR A;  3CCL I;  3WHC A;  3TQN A;  1VQ6 I;  2X4H A;  1D0X A;  1H88 C;  1ETY A;  2MD0 A;  3SEQ A;  2IVM A;  4AUX A;  2X6W A;  2QQB A;  2IGN A;  3ONQ A;  3PM1 A;  3L1P A;  4HA8 A;  1XCV A;  4QLC U;  2PBI A;  3G73 A;  2DOD A;  1U9O A;  1FJL A;  3H9G A;  3OYF A;  2ZJR F;  3G1L A;  5ED4 A;  1MBH A;  1BBY A;  3VFZ A;  5L3F A;  3LSP A;  2V6C A;  3C2G A;  3Q9V A;  3ESW B;  2IPQ X;  2HWV A;  4A3K J;  4A3G J;  3COA C;  2W57 A;  3KZZ A;  4ESF A;  2R7W A;  5J4Y A;  3MKZ A;  1TP4 A;  1Z7L A;  3QYE A;  5EZG A;  2L01 A;  3L2Q A;  4CHU A;  1DUX C;  1W7P A;  4IXA A;  4CUG A;  4KMF A;  4XKB A;  4EM0 B;  2VT2 A;  3TL4 X;  1S7A A;  2ZJ2 A;  3AG1 H;  3MKW B;  3NAU A;  1Y1V J;  4BBS J;  3DPT A;  4QPO A;  4YIF A;  5EYR A;  2H1L A;  2ZKZ A;  2IS4 A;  2GXB A;  2KRF A;  4A3C J;  2MW8 A;  2VC1 A;  2QKM B;  1E17 A;  1R00 A;  5H6R A;  3HYI A;  5B3S H;  3JR9 A;  3K1M A;  3MZH A;  3JRA A;  2JWT A;  2TRT A;  1S72 I;  2QEN A;  1D8K A;  2ELH A;  4F3Q A;  3EYY A;  2OA4 A;  3SDG A;  1PUF A;  5DDG A;  4KIT B;  3GTJ J;  1YJ9 I;  2CS3 A;  2Z16 A;  1PP7 U;  1LFU P;  3MFK A;  3CME I;  1BN5 A;  5B1A H;  3LA3 A;  1WJC A;  3VOE A;  1F9N A;  4I02 A;  1X2N A;  4IOA F;  3VOD A;  4CXF A;  1HST A;  3AFH A;  5IPA A;  3TMO A;  2WAE A;  4MTD A;  2Z3Y A;  3KEO A;  4LLL A;  3W2V A;  4IEJ A;  5DCF A;  3WU0 A;  2FQ4 A;  2DOA A;  2ETH A;  1KQ8 A;  2JRM A;  4GYI A;  1V5E A;  2DYS H;  1FX7 A;  3SXY A;  1JJ6 C;  1XS9 A;  3J7A Y;  3HKZ N;  1LDJ A;  3ASO H;  2CFO A;  1S7E A;  3ELK A;  5EZH A;  5E1Z B;  3HGY A;  1L3L A;  2GQQ A;  4HAM A;  3DF8 A;  2A5Y B;  3U1D A;  2CQ7 A;  5J47 A;  4EQQ A;  1RPW A;  2MSY A;  4YFX F;  3HHG A;  5J40 A;  3JRI A;  2HKX A;  1ENH A;  3E6M A;  2W7N A;  1P6R A;  5ILV A;  1X58 A;  2QSF X;  2VOD A;  4YEL A;  3ZQL A;  1IN5 A;  2GZW A;  1POG A;  4L9V A;  4M3F A;  4BKX A;  4HQM A;  2WV1 A;  4QPQ A;  2IT0 A;  2J5P A;  2ZSH B;  1ZN2 A;  5TRD A;  3BTL A;  2L9V A;  2R7O A;  1SC7 A;  5CYV A;  4PGG A;  3VB2 A;  1TBX A;  2BW3 A;  2JPC A;  1ZYR F;  4U88 A;  1K78 B;  2CJJ A;  3BJO A;  3OV8 A;  1Q1V A;  2ID6 A;  5C4J J;  5M5Y J;  2EIK H;  4BHP A;  4L9J A;  3ZQF A;  1VQ5 I;  3CMM A;  2H1K A;  3QWL A;  1FBS A;  1PDN C;  1MJB A;  4ABZ A;  4G12 A;  3BZC A;  3CCR I;  5FD6 A;  3QRF F;  2HTJ A;  4LIU A;  4FCY A;  4WWC A;  1XB4 A;  2XVC A;  2ZJP F;  4BHC A;  3FZV A;  3LL7 A;  2HVS A;  5BPI A;  2ZFW A;  3KYL A;  3RDI A;  3ZMZ A;  2FBI A;  4HNV A;  5E1X A;  4BGD A;  2EK5 A;  2YSR A;  3D1N I;  1JUM A;  3PNY A;  4CZC A;  4HV6 A;  2ZME C;  4WF2 A;  1FWZ A;  1I50 J;  1WGX A;  5JVT A;  4IRH A;  2OQG A;  4XOR A;  2QBY A;  5IY5 H;  3CC4 I;  4Z6Y A;  3RI4 A;  3RPU A;  2JA6 J;  3I55 I;  4EV0 A;  1ULY A;  3AG4 H;  1IUF A;  3LSH A;  3ZMD A;  4YG2 F;  2CV0 A;  3IHU A;  1OYY A;  4UUT A;  4NUB A;  3DKW A;  2R4G A;  5ICF A;  4L18 B;  2VXD A;  1VI0 A;  4ASN A;  2AS5 F;  4NC7 A;  2DCE A;  3V7R A;  3BR3 A;  1UJ8 A;  1A31 A;  4C3I J;  5DV5 A;  5D6F A;  3WTZ A;  3DWL E;  1PYV A;  4RB3 C;  1ETV A;  1H9G A;  3CF2 A;  1USS A;  3GTP J;  4GO1 A;  3SZG A;  2CH0 A;  4ITV A;  3HC7 A;  3OSF A;  1WCM J;  3WHB A;  5LGT A;  5HS7 A;  1FYM A;  1VQ9 I;  3CUO A;  3DBL B;  3HTS B;  3WU2 C;  4ZZL A;  3K70 D;  4RAZ A;  1X4O A;  1X1P A;  2DXI A;  1E3H A;  3DXJ F;  4EAT A;  5D5U B;  2LF8 A;  2WB1 N;  3TO6 A;  2VJ5 A;  2M4K A;  1T08 B;  2XSD C;  2VBW A;  2V1X A;  2XAJ A;  3PFI A;  3CJQ B;  2YR2 A;  2NVT J;  2GXA A;  4AU7 A;  1X3Z B;  5A2Q K;  4XBF A;  1TWF J;  4MIM A;  3FXR A;  4M3B A;  5LHI A;  3SJM A;  3QPT A;  2HTS A;  1E2X A;  2EIM H;  3D5R C;  3HTU A;  3IC7 A;  1ODD A;  2EFQ A;  3OL4 A;  1YHQ I;  4L0Z B;  1GT0 C;  2UWM A;  2ESH A;  1IRZ A;  1U5T C;  1D1A A;  4G7O F;  4UVA A;  4IZZ A;  4OIR F;  2ISY A;  5C3E J;  4PJN A;  2VPL A;  1G3W A;  1KU7 A;  1LB2 A;  5BS6 A;  3B6A A;  1X1D A;  4NC8 A;  2K86 A;  1MH3 A;  5FKN A;  3TW7 A;  2Z33 A;  3ZMU A;  3JRH A;  2BXY A;  1Z1D A;  2FOW A;  1QZE A;  1F1Z A;  3OIO A;  1YW8 A;  4BNC A;  1G6N A;  2MG4 A;  2HR3 A;  3JSP A;  3ZRG A;  5FRN A;  4LGW A;  4RGR A;  3CMY A;  3IH3 A;  3HL2 A;  3M07 A;  2BGC A;  3P9I A;  2Y9Z A;  2NOJ B;  3H0G J;  5E8G A;  3BC8 A;  4XRF A;  2G7H A;  2HOE A;  2K27 A;  2KZG A;  5GAG J;  4P55 A;  4XM3 A;  4ETS A;  4ZH4 F;  3ZGK A;  3M9A A;  3PL8 A;  4B3A A;  4YRV A;  2JQ7 A;  2EV0 A;  3CJR B;  3S1N J;  2DFH A;  5E17 F;  4FET A;  1QPI A;  2P5K A;  1KYZ A;  4EJO A;  3CLO A;  1VQ8 I;  5IT9 K;  1Y8Q B;  4I01 A;  1MGT A;  5M5X J;  3G71 I;  3GTK J;  3O6B B;  2IW5 A;  2PMH A;  2M3A A;  1MJA A;  2XUB A;  4XN3 A;  2PMZ A;  4E7J A;  2L02 A;  1CF7 A;  1LVK A;  1RUN A;  1IAW A;  2OCC H;  3OYK A;  2RRE A;  4BDZ A;  1Z6R A;  3FHN A;  4D7M A;  1P4X A;  5ICC A;  1QVT A;  4B4C A;  2DYR H;  1OCC H;  2L4A A;  3E97 A;  2BEO A;  4I0B A;  2KT0 A;  3RCO A;  2VLA A;  2ZXI A;  3SFZ A;  2VE8 A;  2ELJ A;  4L5I A;  1IO2 A;  2AQF A;  1K78 A;  3PFY A;  5J1Y A;  3R60 A;  1YFH A;  3GW2 A;  4B3X A;  2RV8 A;  1MBK A;  1XMA A;  3CDI A;  2R7S A;  2L5Q A;  5LEK A;  1R5G A;  2MYS A;  3OYH A;  3CC7 I;  3R0A A;  2CU7 A;  2RN7 A;  2H09 A;  3W2A A;  1OCR H;  4LFU A;  4FQG A;  2I8D A;  2L7F P;  2DOE A;  1G2H A;  3WGH A;  4C30 A;  3HXL A;  1QQI A;  5LLQ A;  2XC7 A;  4KIC A;  3H3U A;  2LVS A;  2V1U A;  4LLN A;  4WXD A;  5IP6 A;  2UXN A;  2XGX A;  3DBR B;  2TCT A;  2HEO A;  4M3D A;  3AL0 C;  2KKO A;  3E5X A;  4A6D A;  1S7O A;  3ZQQ A;  1U8R A;  1NH3 A;  4OIP F;  1X4P A;  2KRH A;  1QGP A;  2HQA A;  2VOO A;  3H36 A;  2DN0 A;  1F36 A;  4DYQ A;  3RKX A;  3V42 A;  3ABK H;  3CP2 A;  2NNN A;  3FF5 A;  2VPR A;  4XKW A;  2MH9 A;  3F21 A;  3JSO A;  5J3L A;  2DI3 A;  3T8T A;  2R93 J;  1LDD A;  3F8F A;  4UV9 A;  3L2U A;  2KQR A;  1EH8 A;  4MTE A;  3VSL A;  3ZMT A;  5H6Q A;  5FLM J;  1Z91 A;  1DU6 A;  2FMY A;  1J0R A;  3FHZ A;  4MLO A;  2XHK A;  2CG4 A;  3DEE A;  4XOT A;  1REP C;  1RET A;  4C2U A;  1HDD C;  3L9F A;  3VPR A;  5ICE A;  3I4N J;  2F4M B;  3H5R A;  3RKQ A;  1N25 A;  3WE3 A;  3EDP A;  3EUH C;  2ZB9 A;  1ZR2 A;  2Y31 A;  1FYL A;  2Y69 H;  1QNT A;  1JE8 A;  4LK0 F;  3O3K A;  1KU9 A;  2LC2 A;  2FJ1 A;  2H6B A;  3GFM A;  3TDU C;  2WY8 Q;  2XRO A;  1XC5 A;  2B9S A;  1LEB A;  1NG7 A;  2X9D A;  4EJV A;  3S17 J;  3GFI A;  5IT3 A;  5F0H A;  1LFP A;  4UUS B;  5K5R A;  2E35 A;  4HSR A;  1FP1 D;  5HNH A;  2A3S A;  4Q4Z F;  4PCQ A;  5LBQ A;  1Z3Y A;  3M8J A;  2X51 A;  1U3E M;  1UG2 A;  3DLL F;  3FBN B;  2Z2S B;  2HXI A;  2RDP A;  4C2M J;  2Y30 A;  5EDN A;  3Q9S A;  2LNB A;  2XAG A;  3SDB A;  5KVR A;  4CGZ A;  4XNF A;  1HSJ A;  3OOU A;  1G3S A;  2DAO A;  5GPA A;  3OIQ A;  3G1O A;  4G7Z F;  2COB A;  3JAM Z;  1A6Q A;  3IKV A;  3CMA I;  1JUP A;  1QRY A;  1SAU A;  2KJC A;  4A93 J;  3S93 A;  2XRL A;  4W97 A;  3TDZ C;  2XAH A;  4PZJ A;  5ICG A;  1WKM A;  1JHH A;  1Y0N A;  4Y3O A;  3KLO A;  3VEP A;  5B5E C;  1W7P B;  3M1C A;  4ZJZ A;  5CQE A;  3QPS A;  1T95 A;  4N0B A;  1Y56 A;  4CDG A;  5EEH A;  1MDM A;  1EV7 A;  3E1S A;  4XQF A;  2QGU A;  3RYR A;  2VKE A;  2K40 A;  5H20 A;  3TW6 A;  1GXP A;  1K83 J;  3DKX A;  2XAF A;  2Z99 A;  5J8F A;  3FXO A;  3ECO A;  1U78 A;  1D0Z A;  3LSI A;  3S3N A;  2JA8 J;  3BPV A;  2O61 A;  2BY3 A;  1FTZ A;  1TNT A;  4JX6 A;  5KNL A;  2V1N A;  1PUF B;  9ANT A;  4OMZ A;  4DJA A;  2ECC A;  2K7L A;  3ECH A;  2RC4 A;  5E20 A;  4RGS A;  5DD8 A;  2WC2 A;  2V9P A;  2ZXW H;  4CSW A;  3K4K A;  2LRD A;  3HBL A;  1R9T J;  2CO5 A;  4RB2 C;  3KP3 A;  4E7H A;  1A04 A;  1TC3 C;  2DMN A;  3JW4 A;  2W4S A;  1FMW A;  3C18 A;  4BQQ A;  4CYD A;  1PJR A;  1DP3 A;  2CRG A;  3UNG C;  5HOD A;  3K0L A;  1Y8R B;  2BY2 A;  4NBQ A;  3KE2 A;  4F91 B;  1RIO H;  2JT1 A;  4IHY A;  1G3Y A;  1D1B A;  1FT9 A;  1S3J A;  3BDD A;  1VND A;  3ISP A;  1MNM C;  1JTY A;  1RRJ A;  2DQR A;  2GIV A;  2HZT A;  4JOM A;  1K4S A;  1JHF A;  4O3M A;  2EZL A;  2L2O A;  3LMM A;  3CCS I;  3S1Q J;  3BR1 A;  4CIC A;  4A0X A;  1LFB A;  2DU9 A;  2K9L A;  2RQQ A;  2HYG D;  3JTG A;  2EIL H;  5GPC A;  5J8C A;  3BWG A;  4U7D A;  2E36 A;  2JVH A;  2R7X A;  1T6S A;  1G4D A;  3S14 J;  2JA2 A;  2L3D A;  4NQW A;  1SVL A;  1O7L A;  2PMU A;  2RAE A;  3S32 A;  1VQP I;  4I09 A;  1TQI A;  3KEQ A;  2ZBK A;  1Y6I A;  2QKL B;  3ML6 A;  1QZY A;  1WJB A;  2HDD A;  4KDP A;  2BW3 B;  4LG3 A;  2XF7 A;  1EJ9 A;  3FXL A;  2F5V A;  1X3W B;  4BY7 J;  4JX4 A;  4XID A;  5KK1 A;  2M45 A;  4LIV A;  4EMS A;  3QP6 A;  3PIO F;  1G59 A;  4MEX F;  4IOC F;  3BG6 A;  2P7C B;  2XPV A;  1J7K A;  1S8N A;  1B9N A;  5JHU A;  2IP2 A;  1KZH A;  2EPF A;  3S8P A;  4M9X A;  1ETO A;  4MEY F;  3BLY A;  2ZME B;  3L09 A;  4NNJ A;  4D5F A;  3IV5 A;  2PG4 A;  2HZD A;  2YU3 A;  3WG9 A;  3ULQ B;  2XKP A;  1IW7 F;  2IBD A;  3P7N A;  5LRS A;  3QOD A;  4DQ2 A;  1N77 A;  5JFR A;  2K3P A;  4ZYD A;  4BEH A;  1BOB A;  3OS2 A;  3N05 A;  2DPD A;  2VQH A;  4CCJ A;  1YRN B;  1OCZ H;  4C2T A;  5IP7 J;  4HYE A;  1BR4 A;  3I56 I;  3QU3 A;  1GDT A;  2IA1 A;  2QSH X;  1P4A A;  4XLE A;  3RQI A;  1FP2 A;  4RM3 A;  2AHQ A;  4XKC A;  2JJ7 A;  2LY9 A;  2GOX B;  3NAR A;  3QU6 A;  1ZRC A;  4EGZ A;  2CQK A;  3MAJ A;  4PJM A;  3S16 J;  4I7H A;  1BW5 A;  1ZR4 A;  3QPH A;  4M3E A;  2EIN H;  5FJ8 J;  3QOP A;  2E2I J;  3CDH A;  3GVA A;  2XRN A;  2EA2 A;  2M7A A;  4XLA A;  2E2H J;  3KP4 A;  2IGO A;  2DMQ A;  2GXG A;  4FX4 A;  2X0L A;  1FYK A;  2DDB A;  2P4W A;  1O57 A;  3U1K A;  1U9N A;  1NK3 P;  1S6L A;  2VBZ A;  2OU2 A;  1U2W A;  2CUE A;  1KQ0 A;  3IRQ A;  2UZK A;  2IGK A;  3TO9 A;  3RZD J;  3TOB A;  5L3E A;  2FXA A;  1QHH D;  1A35 A;  4XKV A;  1IJW C;  2UXX A;  1SFX A;  4M6X A;  5GAE J;  1LNW A;  4BUP A;  1MNE A;  3HZJ A;  5D5X B;  3PO2 J;  1XGN A;  2PX9 A;  2VQL A;  3C7J A;  3CDL A;  3K7A J;  3M8F A;  1BI0 A;  1IXC A;  2V7F A;  2BOL A;  2CYY A;  1R5H A;  4Q48 A;  3WU1 B;  3QPL A;  4IF4 A;  3IKT A;  2FOK A;  3CUQ C;  1TW3 A;  4QWQ A;  4AVP A;  3JRD A;  2OBP A;  1VZ0 A;  2R5Y B;  3W2W A;  4ON0 A;  5BPD A;  2YPR A;  2UV1 A;  4XLN F;  4FX0 A;  3GCM A;  4EJU A;  4LB5 A;  1R1U A;  3C2B A;  1OKR A;  3QAH A;  2XV4 S;  2JA7 J;  2FNP A;  4M74 A;  3WTS C;  4B43 A;  1MMN A;  2FEZ A;  1Y1W J;  2PQ8 A;  2MC4 A;  4Y52 J;  2JRT A;  3BR5 A;  5DUK A;  2MA3 A;  4FIS A;  2E1O A;  4ZYG A;  3ZOB A;  2LK2 A;  2QZ8 A;  3DTI A;  5K1Y A;  1T0F C;  1DPU A;  3GLL A;  5D4S A;  5J6X A;  2KIS A;  3MD2 A;  3HOX J;  4UUV A;  5J1R A;  1XMK A;  2NOG A;  2PMZ N;  4OIQ F;  4WCG A;  5D5V B;  4DBR A;  2E7X A;  4JYK A;  1ACI A;  3IUO A;  2DA7 A;  1YE9 A;  1Z67 A;  1O3R A;  2NS8 A;  1W5T A;  3JRF A;  1PP8 F;  5CJ9 A;  4X0G A;  4E70 A;  1BIA A;  5FFZ A;  4A0Y A;  1VQL I;  5HDG A;  1YI2 I;  4HNU A;  4L5J A;  3GTM J;  3GZ6 A;  2Y0S A;  1YO5 C;  1R5I D;  3TBI A;  1ZG1 A;  1MKM A;  1J09 A;  5FLX Z;  1BC7 C;  3K2A A;  1EH7 A;  2K9S A;  2O9L A;  4BDY A;  1MMA A;  3BJ6 A;  2M1B A;  1CGP A;  2WTE A;  3GXO A;  3KZY A;  2W48 A;  3N4M A;  2QM3 A;  1BI2 A;  3N97 A;  4UVB A;  4F92 B;  1ZLJ A;  3A02 A;  3SHF A;  2VKV A;  2XB5 A;  2JSP A;  3PO3 J;  1HXD A;  1YS6 A;  2W25 A;  3QQA A;  4FE4 A;  1AKH A;  2W84 A;  4AIJ A;  1YJW I;  4ZZD A;  1ITY A;  4ENN A;  2KIQ A;  3D5L A;  3O2P E;  1RNL A;  3GTO J;  1IN4 A;  4PK4 A;  1LQ1 A;  2LG4 A;  2BY1 A;  4XMY A;  2PFB A;  2P7V B;  3E0J B;  1CF7 B;  3OYJ A;  3KCC A;  5K7F A;  4FTH A;  3I4P A;  2O03 A;  2DA2 A;  4N4N B;  3DQV C;  3LSR A;  1ON1 A;  3CP8 A;  2F5C A;  3JTH A;  1DGW Y;  1BR2 A;  2Q8K A;  3S2W A;  2D5V A;  2E19 A;  4WX9 A;  1I6X A;  3QYB A;  4V2G A;  3ASN H;  3E6B A;  5L3G A;  4ZDL A;  4IO9 F;  2EH3 A;  3EUA A;  1FIP A;  2KLO A;  2ME6 A;  2XAQ A;  1WJF A;  1W36 C;  2VBX A;  4IHV A;  2ADU A;  1DP7 P;  3IWZ A;  1K7A A;  1GXQ A;  2DJI A;  4K2E A;  4M71 A;  3ZR8 X;  4NDL A;  1J5Y A;  1J2X A;  1MMS A;  2ZME A;  1E0E A;  2ZO4 A;  1V3F A;  5F1J A;  4L0Y B;  4NC6 A;  4M73 A;  1ZH5 A;  4YIR X;  2O5R A;  4CCL A;  1PVE A;  4U0Y A;  3HM5 A;  2IEK A;  2W85 A;  3K6G A;  2OTL I;  2V4J C;  4MQ9 F;  3MVP A;  1YRN A;  2L7K A;  2VQC A;  5FO5 A;  1HDP A;  2FQ3 A;  2EFP A;  5FGM A;  4L5E A;  3LWF A;  4HNT A;  4IL6 C;  4AYB A;  3ABU A;  3D0S A;  5HNF A;  2MLG A;  2OUM A;  3NWT A;  1D1C A;  3LST A;  5C4X J;  2E1M C;  4H4K C;  4DNC A;  1RR7 A;  1SVM A;  3M4O J;  1QZZ A;  1RUO A;  3OR1 C;  5JI6 A;  1W5S A;  2FX0 A;  4RAF A;  1J59 A;  1AA7 A;  2O8X A;  4QSH A;  4OIN F;  3GTL J;  2HI3 A;  1OPC A;  1ERD A;  2NAZ A;  5C44 J;  2W24 A;  2DMT A;  3S2D J;  5TJJ A;  5AIQ A;  1DQU A;  1P7I A;  1YG2 A;  1IN7 A;  3P9C A;  1EH6 A;  1QBJ A;  3E6D A;  5ILS A;  4O5V A;  4HLY A;  4TV7 A;  2NRA C;  3J80 K;  2RGV A;  2O3F A;  2DFE A;  3J81 Z;  2LKS A;  3K1P A;  1JI8 A;  3W6K B;  2NVX J;  3GBG A;  5FRM A;  3VYU B;  3M8E A;  2ZJQ F;  4DYR A;  2VJI A;  5M5W J;  4A69 C;  1MBE A;  2ZNZ A;  4HF0 A;  3GUD A;  3HIF A;  5F6F A;  5DUI A;  1EF4 A;  2BZT A;  3KEY A;  1IZ1 A;  1Z21 A;  2X6X A;  4BJ5 C;  1JKP C;  1FPQ A;  1U5T A;  3ERE D;  4AM3 A;  2R5Y A;  2FBK A;  3M1E A;  1HKT A;  2DA5 A;  3HPH A;  1UST A;  1X3U A;  3KP6 A;  3B6C A;  1R1V A;  4I0A A;  2EV5 A;  3HHH A;  2CW7 A;  3GX4 X;  1CQT A;  1BR1 A;  2K4B A;  1LKX A;  1UHW A;  2EFW A;  3MCZ A;  2GLO A;  3GEZ A;  4KT5 C;  1K6Y A;  5FKK A;  2B0L A;  2DT7 B;  4ESJ A;  4C3J J;  4ANJ A;  1OQY A;  1U6G A;  3LSG A;  3LSK A;  2IXS A;  1RES A;  2F5F A;  3IH2 A;  5BQT A;  2X85 A;  1WZ2 A;  4OMY A;  2Y0M A;  1BJZ A;  2VJ4 A;  4BS9 A;  1GUU A;  4GGG A;  1TWA J;  3MEX A;  3RTR A;  1I3Q J;  5F0F A;  3OS1 A;  1XX5 A;  2OAZ A;  1OCP A;  2WA0 A;  2AO9 A;  4B48 A;  3ZQC A;  4QIW N;  2KMU A;  2FD5 A;  4RDU A;  1DDN A;  5JLW A;  3JAM K;  2HQN A;  4FE7 A;  1MDM B;  3WG7 H;  2CW8 A;  5D8L B;  3IL2 A;  3ROU A;  2IS2 A;  3TO7 A;  3HRS A;  1ZLK A;  2XF5 A;  2JZY A;  3O8G A;  3LA7 A;  2MGQ A;  2KL4 A;  2CWE A;  1O4X A;  2G9W A;  2GM4 A;  3HRT A;  1VTN C;  4CCO A;  4RA2 A;  1R22 A;  4LOC A;  2L7Z A;  5LRR A;  1IV6 A;  2VKH A;  4I99 C;  4Y4R A;  3DCF A;  1DU0 A;  2DW4 A;  3KFW X;  3BG7 A;  2JMW A;  3MQ0 A;  1T8I A;  2X1D A;  1UEL B;  4HOB A;  1WRJ A;  2P5V A;  2QA4 I;  4L9T A;  3HOS A;  4B8X A;  1IRF A;  1BC8 C;  2LYC A;  1QU3 A;  1YX3 A;  2HGC A;  1KU2 A;  3V8L A;  1S9H A;  3I53 A;  2OZ6 A;  1ZRE A;  1ZTR A;  5EJC A;  4Y13 A;  5EGO B;  1Z6T A;  1WJD A;  1P92 A;  3MWM A;  1JKO C;  1T33 A;  1KQ9 A;  1SD5 A;  3Q0V A;  5LFA A;  1F4K A;  1NG6 A;  2NVY J;  2M0C A;  2Z5U A;  2A07 F;  1UG0 A;  3ERM A;  5E3M A;  2MBF A;  2K9N A;  2AQE A;  2E60 A;  3DPL C;  4PFP A;  4IHW A;  4IVN A;  4F7Z A;  1I5Z A;  4XLF A;  2CW0 F;  2NS0 A;  3BTJ A;  2YS9 A;  5CPR B;  2K9M A;  2MFZ A;  2YUS A;  1QO0 D;  3FXK A;  1OR7 C;  4LJZ F;  4PJL A;  1P2F A;  3MZ8 A;  3K10 A;  4NQW B;  3GF2 A;  1MW7 A;  1VFC A;  2QQ9 A;  1S29 A;  1GLN A;  4XR6 A;  4BJ6 C;  2LMD A;  1XMX A;  4N9I A;  4UB8 C;  2DDA A;  2F48 A;  2MH2 A;  3HGG A;  5F0C A;  5L3D A;  1K6O A;  2LY1 A;  1DPR A;  2CGP A;  4UV8 A;  3BZK A;  2FBH A;  1WPK A;  4P96 A;  3UKG A;  1TWG J;  3ZCO A;  2P6S A;  2YX4 A;  2F4O B;  1RZ4 A;  2QUF A;  4XLH A;  5HLT A;  4IKF A;  1P7J A;  2MLK A;  1MMD A;  1OJL A;  1MSE C;  5DTD A;  4BJT A;  2O7O A;  1LUJ B;  3BJA A;  2EJR A;  4U0W A;  3H0D A;  2EV6 A;  4YEJ A;  1K4T A;  3RJP A;  2PJR A;  1JKR C;  3EUH A;  1RI7 A;  4OAY A;  4BEH B;  1ZGJ A;  4D9J A;  4YFN F;  2OF7 A;  3HRM A;  1BM9 A;  1WHU A;  3WTU C;  4RB0 A;  3QOE A;  1A6I A;  2A6T A;  4JQF A;  1W36 D;  3FKJ A;  4CH7 A;  3DKY A;  1RR8 C;  1NHA A;  1MND A;  4G9Y A;  4V2F A;  1T38 A;  2R7F A;  3AG3 H;  2WY7 Q;  2DFF A;  4BY1 J;  2JTV A;  2P6T A;  5GAH J;  4S0H B;  4XRS A;  2NYX A;  1FLI A;  2EBI A;  2OJE D;  2BBY A;  2R92 J;  3U9G A;  2ZC2 A;  4BAC A;  5LHH A;  2DA6 A;  5JLX A;  5IYB J;  1LVA A;  4PJ0 C;  3BTC A;  1GVJ A;  1XTA A;  3V7S A;  1OCT C;  2E71 A;  4XOP A;  4XRM A;  2HDW A;  3BG3 A;  2M8E A;  4B44 A;  2EB7 A;  1O3Q A;  2ZNY A;  1G8X A;  3BOQ A;  3CUQ B;  4YII A;  3S2H J;  5TIS C;  4BE1 A;  2HOS A;  2XAS A;  1XDS A;  3IP4 B;  1TL8 A;  1E3O C;  2GA1 A;  4KIG A;  1LJ9 A;  2VKD A;  2GA2 A;  4A6E A;  2H27 A;  1R6R A;  4RBO A;  2BY0 A;  3CF5 F;  2Q2E B;  2CSO A;  2R7D A;  3GO5 A;  3G3Z A;  2VQG A;  4HX7 A;  1GV5 A;  3LFU A;  4ESB A;  2QYO A;  2V9K A;  3KX2 A;  3LOC A;  4XSX F;  4F55 A;  5LHG A;  4GRI A;  2LF7 A;  1YTY A;  5F27 A;  2IJL A;  4ZYH A;  1O3S A;  1QHG A;  2A68 F;  3HDD A;  2HOT A;  2JUC A;  4LD5 A;  3DP7 A;  1MBF A;  3ZN1 A;  1DGR M;  1SD4 A;  2O0Y A;  3F22 A;  4ENK A;  2OPT A;  2X6O A;  2STT A;  2KDZ A;  2CMP A;  1LDK B;  1WI9 A;  2DMP A;  2E7W A;  1AHD P;  4BXU A;  4RLF A;  1ETQ A;  1P9Q C;  1R49 A;  1T98 A;  2I10 A;  4ZYE A;  4AIK A;  1R1T A;  3CJN A;  2Y75 A;  3OYA A;  3U2R A;  3J7Z I;  3AKZ A;  2L9S A;  3DTE A;  3B02 A;  2ZXJ A;  5E3O A;  1HA8 A;  2GIZ A;  4OWR B;  4DOZ A;  3FKI J;  3HEF A;  4L9N A;  2WB1 A;  4P1W A;  2LLK A;  5AON A;  3A4C A;  5IT9 Z;  2JVG A;  2FU4 A;  5LGN A;  3K4L A;  2IS1 A;  2M8G X;  3W3C A;  2V1D A;  2R5Z A;  3RKY A;  2D1H A;  2K3F A;  1FC3 A;  4CCK A;  3C1D A;  1MIJ A;  1UMQ A;  3BZ6 A;  3LQQ A;  5FLV A;  4IQJ A;  1ZG3 A;  1J75 A;  5CVU A;  3WTX C;  1ZKG A;  4I76 A;  3CZ6 A;  2J5O A;  4LG0 A;  2ELK A;  3IAM 2;  2IA2 A;  5EGO A;  1OFC X;  3FIS A;  3FMQ A;  1N75 A;  1WI3 A;  2WWY A;  5D5W B;  3U21 A;  1WWX A;  4ENM A;  1JT0 A;  3K4B A;  1HQC A;  2X1C A;  3HSE A;  3R4K A;  4E7L A;  4BE2 A;  4OAZ A;  1AKH B;  2L9N A;  1I1S A;  1UHM A;  1X1A A;  3WGI A;  1FSE A;  3OYD A;  4BE0 A;  1FOK A;  2D2W A;  1UCR A;  2QWW A;  1IC8 A;  1ORK A;  2VC0 A;  3FK6 A;  1ZAO A;  1TWH J;  3MKY B; 
#chains in the Genus database with same CATH homology
 2FRH A;  4N9H A;  3FXU A;  1AWC A;  4A0Z A;  3BRO A;  3BY6 A;  1IN8 A;  1KU3 A;  3I59 B;  3B73 A;  1IRG A;  2DO7 A;  3WTY C;  3FM5 A;  3LA2 A;  5HS9 A;  3MZY A;  4EM2 A;  2HKO A;  2OQR A;  1XGM A;  5HVQ C;  2DK8 A;  1HBX G;  4XLP F;  1I1G A;  1R23 A;  5K5O A;  4GCV A;  4JK1 X;  2PN6 A;  4UHT A;  3TKY A;  4Y15 A;  2E1C A;  2XKO A;  1AOY A;  3WOD F;  1FZP B;  3EET A;  5BMZ A;  4GYG A;  3IRR A;  4AWX B;  2E1N A;  4KFC A;  1H0M A;  1L0O C;  3I5U A;  1D5V A;  2DT5 A;  1T39 A;  4M6Y A;  3CUQ A;  5FFX A;  5F64 A;  2VT3 A;  3H3Z A;  3GFJ A;  2OZU A;  4LK1 F;  1ONV A;  3ZP5 A;  2NNY A;  3J81 K;  2Q2E A;  3WTV C;  4Q47 A;  4A2U A;  5LGU A;  1U5T B;  3TGN A;  3V8K A;  3FM3 A;  1T0F A;  1Z9C A;  4S05 A;  2GAU A;  2M5W A;  5CVJ A;  5ILU A;  4OOI A;  3BPX A;  4GXO A;  3HUG A;  4A5N A;  4WXH A;  1O3T A;  2R3S A;  1TLH B;  2RNJ A;  1HKQ A;  2Z9O A;  4KNY A;  1BOA A;  4HLX A;  3GLX A;  2VBY A;  3DEU A;  3C3W A;  2ISZ A;  3AAF A;  3F8B A;  3E5Q A;  2HDC A;  2LSO A;  1XDU A;  4AIH A;  3L7W A;  4BAY A;  3REO A;  3I58 A;  3PQJ A;  1YW9 A;  2M30 A;  1R58 A;  2VOP A;  4A12 A;  5DCM B;  4R8H A;  5D6E A;  1ON2 A;  4NB5 A;  2DFI A;  3HSR A;  4KYW A;  2TDX A;  1TQP A;  3WTT C;  4EM1 A;  3DFG A;  1Q1H A;  3CO6 C;  1IXS B;  4BHB A;  3WE2 A;  4IPA A;  2A61 A;  3LAJ A;  2DPU A;  3I59 A;  2L4M A;  3IWF A;  4B09 A;  5LEJ A;  5K5Q A;  4IHT A;  1ZHF A;  2EFO A;  1ZAR A;  3GFL A;  1JGS A;  4G6Q A;  4MGR A;  2EWN A;  4R1H A;  4OU0 A;  3J7A O;  5DD4 A;  2P5L C;  1HW1 A;  3M7G A;  2OD5 A;  3FMR A;  1SFU A;  3NQO A;  4UVC A;  2H94 A;  3F23 A;  4HF2 A;  3RYP A;  4P9U A;  4PDK A;  1PUE E;  3H92 A;  3SQN A;  3ABT A;  1HW2 A;  3KET A;  4HQE A;  3F72 A;  5CVV A;  3GZ5 A;  3WGG A;  3SZP A;  1SFE A;  2ACJ A;  5HOO A;  1TW2 A;  1MD0 A;  4M9S A;  4JBA A;  3LFK A;  3EYI A;  1KA8 A;  3F8C A;  1KGS A;  1G3T A;  1UFM A;  1SD7 A;  2HFH A;  1XN7 A;  2BYV E;  5FD5 A;  3I71 A;  1FBU A;  1FSH A;  3I64 A;  4HV5 A;  4HBL A;  2D45 A;  3FXQ A;  4A5M A;  1YW7 A;  4UNO A;  4LLG F;  4KN4 X;  1XSV A;  2FML A;  2K4J A;  4G6D A;  1IUY A;  4EVI A;  1Z05 A;  3E3V A;  3L00 A;  1YIO A;  2BV6 A;  3KP7 A;  2LKP A;  5L3C A;  1W4M A;  4BH9 A;  2DK5 A;  2F2E A;  4LMY A;  1IXR C;  2RKH A;  1IN6 A;  4YFK F;  1XSD A;  4I98 B;  3P9K A;  2H6C A;  3R6S A;  4HX4 A;  4Y17 A;  1SAX A;  4KIB A;  4EJW A;  1B59 A;  4HZF A;  5F1R A;  2V79 A;  1C0W A;  3F8M A;  3HRU A;  2QVO A;  1XCB A;  4H0E A;  1XD7 A;  2GWR A;  3CO7 C;  5D8K B;  5DCM A;  5E18 F;  4XSZ F;  4KIF A;  2F5E A;  3ZMS A;  2PJP A;  3F6O A;  3KP2 A;  4LB6 B;  5L3B A;  5HDK A;  2ZCW A;  1B6A A;  1P4W A;  3T0Y A;  5CLS A;  3Q5F A;  1SD6 A;  4EJT A;  1YYV A;  4PGH A;  3NEU A;  1ZG5 A;  2FA5 A;  3V4G A;  2A6H F;  3HSF A;  3OOP A;  4IHS A;  6PAX A;  4LG0 B;  1YQA A;  3WTW C;  3GWZ A;  2FF4 A;  1B4A A;  3LAP A;  4M72 A;  1YS7 A;  1OR7 A;  4R79 A;  1GHC A;  1W7P D;  2HS5 A;  1BIB A;  1LEA A;  1QPM A;  3KP5 A;  4EGY A;  4BQA A;  2KIM A;  2JPB A;  3T5X A;  1XGO A;  3K69 A;  4U7B A;  3RIR A;  3HOT A;  2DBB A;  2XIG A;  5JR3 A;  4ENJ A;  2JSC A;  3K2Z A;  1MJ9 A;  1R7J A;  1HW5 A;  4OIO F;  1SMY F;  4FHT A;  1SMT A;  5HDN A;  5AIP A;  2VON A;  2CFX A;  5CVR A;  1WQ2 A;  4BYY A;  1I27 A;  4WXC A;  2Y48 A;  2MD5 A;  1FBQ A;  2KIU A;  1D3Y A;  3CTA A;  2KJB A;  2IA0 A;  1BI3 A;  4RAY A;  3TOA A;  3J80 Z;  2STW A;  3DV8 A;  2A6E F;  3I54 A;  2MC3 A;  2ESN A;  2PEX A;  3FMS A;  3V7C A;  2LDU A;  2BE5 F;  1MZB A;  3I0T A;  2RVC A;  3QP5 A;  1OYI A;  5BOX A;  2G7U A;  5A2Q Z;  4Q5S F;  1HKS A;  4KUM A;  3RPQ A;  3ZPL A;  2FNA A;  5E1W A;  5ERI A;  4M9Z A;  2RQP A;  3W6J B;  2HQR A;  4RS8 A;  4IJA A;  3ZQ7 A;  1KYW A;  4IRI A;  3FWE A;  4KMU X;  1XSX A;  4AD9 A;  2P8T A;  5FB2 A;  2FE3 A;  1K79 A;  1J9I A;  2Q0O A;  3ZN0 A;  3V8J A;  4NHJ A;  5HLG A;  3GYH X;  3F3X A;  2HYF A;  2AXL A;  3F8N A;  1BJA A;  2QLZ A;  3SZT A;  5E8I A;  2WV0 A;  4RGX A;  2YX7 A;  1H9T A;  1BI1 A;  1ZRD A;  3E6C C;  1FNN A;  2IRF G;  1Y0U A;  2K02 A;  3R0J A;  4MHG A;  5HLI A;  2V9V A;  1FY7 A;  3BP8 A;  4MNU A;  5DEQ A;  4P5O A;  5FLX K;  5D4R A;  3EQL F;  1D8J A;  4HX8 A;  3NRV A;  5CVI A;  2DQL A;  1STZ A;  5HLH A;  3E5U A;  3LQR A;  4G94 A;  2PI0 A;  3L2C A;  2DLL A;  4WK8 F;  4RGU A;  4Z2Y A;  2VE9 A;  5DYM A;  4KA4 A;  2FSW A;  1ZRF A;  2C6Y A;  1TTY A;  4IRG A;  4D0P A;  4G7H F;  2VXZ A;  2M87 A;  1TNS A;  4RB1 A;  4HF1 A;  1TQM A;  1OYW A;  1T2K A;  4O6J A;  1JXS A;  1ZGA A;  3K9T A;  4HDU A;  4I2O A;  1UB9 A;  2A69 F;  1O7F A;  4UXN A;  2O6G E;  1V4R A;  3PQK A;  2F5D A;  1B9M A;  4MQV A;  1YLF A;  4U0V A;  3F6V A;  3FX3 A;  4FT8 A;  4S04 A;  4P9F A;  1R36 A;  3KLN A;  4CO8 A;  3R61 A;  1OMI A;  1IF1 A;  5EEG A;  2EFN A;  2QBY B;  1XGS A;  3T1B A;  3T8R A;  2COM A;  2D1V A;  2KIF A;  4CZZ A;  1B1B A;  2QQA A;  1Z7U A;  1F5T A;  2L54 A;  2VN2 A;  5HS8 A;  4HDV A;  4KN7 X;  4HW0 A;  1WSU A;  3K1N A;  2EA4 A;  3ZMV A;  4G8X A;  2PLY A;  3RKW A;  2DTR A;  3TQN A;  2X4H A;  2IVM A;  2QQB A;  4HA8 A;  1XCV A;  4QLC U;  2PBI A;  3G73 A;  5ED4 A;  5L3F A;  1BBY A;  3VFZ A;  2V6C A;  3Q9V A;  2IPQ X;  2HWV A;  3COA C;  2W57 A;  3KZZ A;  4ESF A;  2L01 A;  4CHU A;  1DUX C;  1W7P A;  4IXA A;  4KMF A;  4EM0 B;  2VT2 A;  1S7A A;  2ZJ2 A;  3DPT A;  4YIF A;  2ZKZ A;  2GXB A;  2KRF A;  2VC1 A;  1E17 A;  1R00 A;  5H6R A;  3HYI A;  3MZH A;  3K1M A;  2QEN A;  1D8K A;  2ELH A;  3EYY A;  2OA4 A;  5DDG A;  1PP7 U;  3MFK A;  1BN5 A;  3LA3 A;  3VOE A;  1F9N A;  4I02 A;  3VOD A;  4CXF A;  1HST A;  4MTD A;  2Z3Y A;  3KEO A;  4LLL A;  5DCF A;  3WU0 A;  2ETH A;  1KQ8 A;  4GYI A;  1FX7 A;  3SXY A;  1LDJ A;  3ELK A;  5E1Z B;  1L3L A;  2GQQ A;  4HAM A;  3DF8 A;  2A5Y B;  3U1D A;  4EQQ A;  4YFX F;  3HHG A;  2HKX A;  3E6M A;  1P6R A;  5ILV A;  2VOD A;  1IN5 A;  2GZW A;  4L9V A;  4HQM A;  2IT0 A;  2J5P A;  1ZN2 A;  5TRD A;  5CYV A;  4PGG A;  3VB2 A;  1TBX A;  2JPC A;  1ZYR F;  4U88 A;  1K78 B;  3BJO A;  3OV8 A;  4BHP A;  4L9J A;  1FBS A;  1PDN C;  1MJB A;  3QRF F;  5FD6 A;  2HTJ A;  4WWC A;  1XB4 A;  2XVC A;  4BHC A;  3FZV A;  5BPI A;  2ZFW A;  3RDI A;  3ZMZ A;  2FBI A;  5E1X A;  2EK5 A;  2YSR A;  4HV6 A;  4WF2 A;  1FWZ A;  5JVT A;  4IRH A;  2OQG A;  2QBY A;  3RI4 A;  3RPU A;  4EV0 A;  1ULY A;  3ZMD A;  4YG2 F;  3IHU A;  1OYY A;  3DKW A;  5ICF A;  4L18 B;  4ASN A;  2AS5 F;  3V7R A;  5DV5 A;  5D6F A;  3WTZ A;  4RB3 C;  1H9G A;  1USS A;  4GO1 A;  5LGT A;  5HS7 A;  1FYM A;  3CUO A;  3HTS B;  4ZZL A;  4RAZ A;  3DXJ F;  5D5U B;  2LF8 A;  3TO6 A;  2VBW A;  2V1X A;  2XAJ A;  3PFI A;  2YR2 A;  5A2Q K;  4XBF A;  3FXR A;  5LHI A;  3QPT A;  2HTS A;  1E2X A;  2UWM A;  3HTU A;  3IC7 A;  1ODD A;  2EFQ A;  4L0Z B;  2ESH A;  1U5T C;  4G7O F;  4UVA A;  4OIR F;  2ISY A;  1G3W A;  1KU7 A;  1LB2 A;  5BS6 A;  2K86 A;  2Z33 A;  3ZMU A;  1Z1D A;  1F1Z A;  4BNC A;  1YW8 A;  1G6N A;  2HR3 A;  1ZAO A;  3JSP A;  4LGW A;  4RGR A;  3P9I A;  2BGC A;  5E8G A;  4XRF A;  2G7H A;  2HOE A;  2K27 A;  4P55 A;  4ETS A;  4ZH4 F;  3M9A A;  2EV0 A;  5E17 F;  2P5K A;  1KYZ A;  4EJO A;  3CLO A;  5IT9 K;  4I01 A;  1MGT A;  3O6B B;  2IW5 A;  2PMH A;  1MJA A;  2XUB A;  2L02 A;  1CF7 A;  1RUN A;  1IAW A;  1Z6R A;  1P4X A;  5ICC A;  2L4A A;  3E97 A;  2BEO A;  4I0B A;  3SFZ A;  2VE8 A;  4L5I A;  1K78 A;  3R60 A;  1YFH A;  3GW2 A;  2RV8 A;  1XMA A;  5LEK A;  1R5G A;  3R0A A;  2RN7 A;  2H09 A;  4LFU A;  3WGH A;  5LLQ A;  1QQI A;  4KIC A;  3H3U A;  2V1U A;  4LLN A;  4WXD A;  2UXN A;  2XGX A;  2HEO A;  2KKO A;  3E5X A;  4A6D A;  1S7O A;  1U8R A;  4OIP F;  1QGP A;  2VOO A;  3RKX A;  3FF5 A;  2NNN A;  3F21 A;  2MH9 A;  3JSO A;  2DI3 A;  3T8T A;  1LDD A;  3F8F A;  4UV9 A;  1EH8 A;  4MTE A;  3ZMT A;  5H6Q A;  1Z91 A;  2FMY A;  1J0R A;  3FHZ A;  2XHK A;  2CG4 A;  1REP C;  3L9F A;  5ICE A;  3WE3 A;  3EDP A;  1FYL A;  1QNT A;  1JE8 A;  4LK0 F;  3O3K A;  1KU9 A;  2H6B A;  3GFM A;  3TDU C;  2XRO A;  1LEB A;  4EJV A;  3GFI A;  5IT3 A;  5K5R A;  1FP1 D;  2A3S A;  4Q4Z F;  4PCQ A;  5LBQ A;  1U3E M;  2RDP A;  3Q9S A;  2LNB A;  2XAG A;  4CGZ A;  5KVR A;  1HSJ A;  1G3S A;  2DAO A;  4G7Z F;  3JAM Z;  3IKV A;  2KJC A;  3TDZ C;  2XAH A;  4PZJ A;  5ICG A;  1WKM A;  1JHH A;  3KLO A;  3VEP A;  1W7P B;  4N0B A;  4CDG A;  5EEH A;  1MDM A;  1EV7 A;  3RYR A;  5H20 A;  1GXP A;  5J8F A;  2XAF A;  2Z99 A;  3ECO A;  1U78 A;  3BPV A;  2O61 A;  1TNT A;  4OMZ A;  2K7L A;  3ECH A;  2RC4 A;  5E20 A;  4RGS A;  5DD8 A;  2WC2 A;  2CO5 A;  4RB2 C;  3KP3 A;  1A04 A;  3JW4 A;  3C18 A;  4CYD A;  3K0L A;  3KE2 A;  1RIO H;  2JT1 A;  1G3Y A;  1FT9 A;  1S3J A;  3BDD A;  3ISP A;  2DQR A;  2GIV A;  2HZT A;  1JHF A;  4O3M A;  4CIC A;  4A0X A;  2DU9 A;  2HYG D;  3JTG A;  5J8C A;  3BWG A;  4U7D A;  1T6S A;  1G4D A;  2L3D A;  4NQW A;  1O7L A;  2PMU A;  4I09 A;  1TQI A;  3KEQ A;  2ZBK A;  3ML6 A;  1QZY A;  4KDP A;  5KK1 A;  2M45 A;  4EMS A;  3QP6 A;  4MEX F;  2P7C B;  1J7K A;  1S8N A;  1B9N A;  5JHU A;  2IP2 A;  4M9X A;  4MEY F;  2ZME B;  3L09 A;  2PG4 A;  2YU3 A;  3WG9 A;  3ULQ B;  2XKP A;  1IW7 F;  3P7N A;  5LRS A;  4DQ2 A;  5JFR A;  4ZYD A;  2DPD A;  4HYE A;  3QU3 A;  2IA1 A;  1P4A A;  1FP2 A;  3QU6 A;  1ZRC A;  4EGZ A;  2CQK A;  3MAJ A;  4I7H A;  3QPH A;  3QOP A;  3CDH A;  3GVA A;  2XRN A;  2EA2 A;  3KP4 A;  4FX4 A;  2GXG A;  2X0L A;  1FYK A;  2P4W A;  1O57 A;  1S6L A;  2VBZ A;  2OU2 A;  1U2W A;  1KQ0 A;  3IRQ A;  2UZK A;  3TO9 A;  3TOB A;  5L3E A;  2FXA A;  2UXX A;  1SFX A;  4M6X A;  1LNW A;  5D5X B;  1XGN A;  3C7J A;  3M8F A;  1BI0 A;  1IXC A;  2CYY A;  4Q48 A;  1R5H A;  3WU1 B;  4IF4 A;  3IKT A;  2FOK A;  3CUQ C;  1TW3 A;  4QWQ A;  4AVP A;  2OBP A;  4ON0 A;  5BPD A;  2YPR A;  4XLN F;  4FX0 A;  4EJU A;  4LB5 A;  1R1U A;  1OKR A;  3QAH A;  2XV4 S;  2FNP A;  4M74 A;  3WTS C;  2FEZ A;  2PQ8 A;  2JRT A;  5DUK A;  2MA3 A;  4ZYG A;  2QZ8 A;  5K1Y A;  1DPU A;  5D4S A;  5J6X A;  4UUV A;  1XMK A;  4OIQ F;  4WCG A;  5D5V B;  2E7X A;  1O3R A;  1W5T A;  1PP8 F;  5CJ9 A;  4E70 A;  1BIA A;  5FFZ A;  4A0Y A;  5HDG A;  4L5J A;  3GZ6 A;  1YO5 C;  1ZG1 A;  1MKM A;  5FLX Z;  1BC7 C;  1EH7 A;  1CGP A;  3BJ6 A;  2M1B A;  2WTE A;  3GXO A;  3KZY A;  3N4M A;  2QM3 A;  1BI2 A;  3N97 A;  4UVB A;  1ZLJ A;  3SHF A;  1HXD A;  1YS6 A;  2W25 A;  2W84 A;  4AIJ A;  4ZZD A;  4ENN A;  3D5L A;  3O2P E;  1RNL A;  1IN4 A;  1LQ1 A;  2PFB A;  2P7V B;  1CF7 B;  3KCC A;  3I4P A;  2O03 A;  3DQV C;  1ON1 A;  2F5C A;  3JTH A;  3S2W A;  2Q8K A;  4WX9 A;  1I6X A;  3E6B A;  5L3G A;  2XAQ A;  2VBX A;  2ADU A;  1DP7 P;  3IWZ A;  1K7A A;  1GXQ A;  4K2E A;  4M71 A;  1J5Y A;  1J2X A;  2ZME A;  2ZO4 A;  1V3F A;  4L0Y B;  4M73 A;  1ZH5 A;  4U0Y A;  2W85 A;  4MQ9 F;  5FO5 A;  2FQ3 A;  2EFP A;  5FGM A;  3LWF A;  3ABU A;  3D0S A;  2MLG A;  3LST A;  4DNC A;  1QZZ A;  1RUO A;  5JI6 A;  1W5S A;  1J59 A;  2O8X A;  4OIN F;  1OPC A;  2NAZ A;  2W24 A;  5TJJ A;  5AIQ A;  1YG2 A;  1IN7 A;  3P9C A;  1EH6 A;  1QBJ A;  3E6D A;  5ILS A;  4O5V A;  4HLY A;  4TV7 A;  2NRA C;  3J80 K;  2RGV A;  2O3F A;  3J81 Z;  3K1P A;  3W6K B;  3M8E A;  2ZNZ A;  4HF0 A;  3GUD A;  3HIF A;  5F6F A;  5DUI A;  1IZ1 A;  1FPQ A;  1U5T A;  3ERE D;  2FBK A;  3M1E A;  1HKT A;  1UST A;  1X3U A;  3KP6 A;  1R1V A;  4I0A A;  2EV5 A;  3HHH A;  3GX4 X;  2K4B A;  1UHW A;  2EFW A;  3MCZ A;  4KT5 C;  2B0L A;  4ESJ A;  1U6G A;  2F5F A;  5BQT A;  4OMY A;  2Y0M A;  4GGG A;  3MEX A;  3RTR A;  2OAZ A;  1DDN A;  3JAM K;  2HQN A;  1MDM B;  5D8L B;  3IL2 A;  3ROU A;  3TO7 A;  3HRS A;  1ZLK A;  2JZY A;  3LA7 A;  2CWE A;  2G9W A;  3HRT A;  1VTN C;  1R22 A;  5LRR A;  2DW4 A;  3KFW X;  3MQ0 A;  4HOB A;  1WRJ A;  2P5V A;  4L9T A;  3HOS A;  4B8X A;  1IRF A;  1BC8 C;  2HGC A;  1KU2 A;  3V8L A;  3I53 A;  2OZ6 A;  1ZRE A;  4Y13 A;  1Z6T A;  3MWM A;  1P92 A;  1KQ9 A;  1SD5 A;  1F4K A;  2Z5U A;  2A07 F;  2MBF A;  3DPL C;  4IVN A;  4F7Z A;  1I5Z A;  2CW0 F;  2NS0 A;  1QO0 D;  4LJZ F;  1P2F A;  3GF2 A;  2QQ9 A;  1S29 A;  4N9I A;  2MH2 A;  5L3D A;  1K6O A;  1DPR A;  2CGP A;  4UV8 A;  2FBH A;  4P96 A;  2P6S A;  2YX4 A;  1RZ4 A;  2QUF A;  2MLK A;  4U0W A;  3BJA A;  2EJR A;  2EV6 A;  3RJP A;  3EUH A;  1RI7 A;  4YFN F;  1ZGJ A;  3HRM A;  1BM9 A;  3WTU C;  4RB0 A;  4JQF A;  1NHA A;  4G9Y A;  1T38 A;  2R7F A;  2JTV A;  2P6T A;  2NYX A;  1FLI A;  2BBY A;  3U9G A;  5LHH A;  1LVA A;  1GVJ A;  3V7S A;  2M8E A;  2EB7 A;  1O3Q A;  2ZNY A;  3BOQ A;  3CUQ B;  4YII A;  2XAS A;  1XDS A;  2GA1 A;  4KIG A;  1LJ9 A;  2GA2 A;  4A6E A;  2H27 A;  2CSO A;  2R7D A;  3GO5 A;  3G3Z A;  4HX7 A;  4ESB A;  2QYO A;  5LHG A;  4XSX F;  2LF7 A;  1YTY A;  2IJL A;  4ZYH A;  1O3S A;  2A68 F;  4LD5 A;  3DP7 A;  3ZN1 A;  1SD4 A;  2O0Y A;  3F22 A;  4ENK A;  2STT A;  1LDK B;  1WI9 A;  2E7W A;  4BXU A;  1T98 A;  4ZYE A;  4AIK A;  1R1T A;  3CJN A;  2Y75 A;  3U2R A;  3B02 A;  2ZXJ A;  4L9N A;  5AON A;  5IT9 Z;  2FU4 A;  5LGN A;  2V1D A;  3RKY A;  2D1H A;  1FC3 A;  3C1D A;  3BZ6 A;  3LQQ A;  1ZG3 A;  1J75 A;  5CVU A;  3WTX C;  2J5O A;  4LG0 A;  2IA2 A;  3FMQ A;  2WWY A;  5D5W B;  1WWX A;  4ENM A;  1HQC A;  3HSE A;  3R4K A;  1I1S A;  1UHM A;  3WGI A;  1FSE A;  1FOK A;  2D2W A;  1UCR A;  2QWW A;  2VC0 A;  3GEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...