1RIOH

Structure of bacteriophage lambda ci-ntd in complex with sigma-region4 of thermus aquaticus bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 27-MER
publication title Structure of a ternary transcription activation complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rioH00
1MGTA 1ZGAA 4U7BA 3M1EA 1R7JA 4ZYHA 4M74A 4OIQF 2L02A 4GGGA 2CWEA 3WTVC 3QU6A 5AONA 1ZARA 4ZYGA 3I5UA 4NHJA 1LEAA 2WV0A 2D1HA 3I64A 2H6BA 5E1ZB 2FRHA 5DD4A 4HV5A 1LQ1A 2MH9A 2DI3A 3V8KA 2K4BA 1ZYRF 3DFGA 1D8JA 1R1TA 2OAZA 2FSWA 4HAMA 4EJWA 1FBUA 3KFWX 1XSVA 1B9NA 6PAXA 2BV6A 1ZG3A 5ILUA 5JR3A 1WKMA 1TW2A 4ZYEA 2ZO4A 4PDKA 1LB2A 4G94A 1HW1A 1WSUA 3SFZA 4ZZLA 4AIKA 3QU3A 2QENA 1IXSB 1BIAA 3M8FA 3EETA 3HRTA 4CGZA 5BPDA 2OBPA 1XSXA 2O0YA 4XSXF 2Z5UA 4GYGA 2O6GE 2A07F 3SZTA 4A12A 1VTNC 1SD7A 4A5MA 1P4AA 4ESJA 1H0MA 4IRGA 2VC1A 3IRRA 1RI7A 2KIMA 4LFUA 2CG4A 3E5UA 5LHIA 4NB5A 1SFUA 3J7AO 3TQNA 1QZYA 1D3YA 4KIFA 5CVJA 2EFOA 2YU3A 4Q47A 4ETSA 4XSZF 2QM3A 5F6FA 3F6VA 3KP6A 3CO6C 4S05A 2HKXA 3WGIA 2H27A 2K02A 2GA2A 1ZHFA 1WWXA 1KYZA 3TO9A 3AAFA 4CDGA 1OPCA 1UFMA 2VT3A 3DEUA 3RTRA 1BBYA 1XSDA 3WTUC 3GFJA 1XB4A 2JSCA 2ZNYA 1JXSA 1S8NA 4ASNA 1TQPA 2UZKA 4HZFA 2RC4A 1T98A 2W57A 4FT8A 5L3FA 2EV6A 1T6SA 2HOEA 1YW9A 1R58A 2P7VB 3BROA 3G3ZA 2O3FA 4HLYA 2QQAA 4BHCA 4OU0A 4G7ZF 3SZPA 2L3DA 1IN4A 2EFPA 2HQNA 4IF4A 2WWYA 2IP2A 3FXQA 1FC3A 2XUBA 3KP5A 2ESNA 1YLFA 3TDZC 4IVNA 3N4MA 2YR2A 2QUFA 3K0LA 1W7PB 4MQVA 2K4JA 3FXUA 2BBYA 5DUIA 1ZRFA 2G7HA 1Q1HA 3B73A 2W84A 4U88A 3HTUA 1U78A 3WODF 3LFKA 5D6EA 3GVAA 4K2EA 3GYHX 2EK5A 4HF2A 4GCVA 4YFKF 2IPQX 1S29A 3GXOA 2V1XA 1NHAA 2R7FA 4DNCA 4HYEA 1USSA 2ESHA 4AIJA 1J7KA 3E97A 3QPHA 2MLKA 3K69A 3EDPA 3F3XA 2J5OA 2L4AA 2TDXA 4Z2YA 4M9ZA 4UVBA 2ELHA 2RN7A 2Z99A 2KKOA 3NQOA 3B02A 1F9NA 4U0YA 4G6QA 2VOPA 3NRVA 1G3SA 5H6RA 4GYIA 2R7DA 1LDDA 3VB2A 1ON2A 1DP7P 2EFWA 4M71A 2GA1A 3FMSA 2P7CB 1FBSA 4U0WA 1YG2A 2W24A 1BI0A 3HTSB 4YFNF 3F6OA 2GZWA 2Z3YA 4HA8A 3U2RA 2E1CA 1KQ9A 1MJ9A 1WQ2A 2RQPA 1YS6A 2MA3A 3EYYA 4AVPA 1ZRDA 4XBFA 3TDUC 4RB3C 4EM2A 1QO0D 3LSTA 2GXGA 2XAJA 3BY6A 4U7DA 4IPAA 3COAC 1LEBA 1FSHA 1R1VA 4XRFA 1X3UA 3U1DA 2DK8A 2VONA 1BC8C 1OYIA 2FBIA 1MDMB 2MLGA 3GEZA 2VBXA 3VODA 4PGGA 2XV4S 2VN2A 3RJPA 2V9VA 4I2OA 1JHFA 1W7PD 4RAZA 5HS9A 2XAGA 1I5ZA 2GIVA 4M9SA 1IN7A 2XIGA 4WXCA 1UHMA 2CQKA 5E20A 3SQNA 2PJPA 3R6SA 4HW0A 3L7WA 1IRFA 2M1BA 4HQMA 3LQQA 3IKVA 5FB2A 1R1UA 3DV8A 4KMFA 5FLXZ 1BM9A 3CLOA 2EJRA 3M7GA 5HLGA 4G7OF 2KIFA 3I59B 4WK8F 2FU4A 2M87A 5D8LB 5E1XA 3JSPA 3HSFA 2P6TA 4DQ2A 4WF2A 4L0ZB 1SD5A 4JK1X 2A61A 1QGPA 1Z9CA 1LVAA 4EJOA 3HOTA 2PBIA 4YIFA 4LK0F 2P5LC 3ZMVA 2LNBA 3QP6A 3MWMA 2NNYA 4CYDA 1EH7A 1YTYA 1CGPA 1P4WA 3H3ZA 4LLNA 3BJOA 2OZ6A 1Y0UA 4Q48A 1G3YA 4RB1A 1GHCA 2H09A 4OMYA 3D0SA 3Q9VA 2IJLA 3QOPA 1IAWA 4IRIA 4M6XA 1R00A 2P8TA 3I59A 1GXQA 4UVAA 3GFMA 4QLCU 1W4MA 2YX7A 3LWFA 1ZG1A 1U3EM 1P6RA 5HDGA 3GO5A 1XDUA 5HLIA 1YIOA 4HF1A 3V4GA 4ZH4F 1U5TA 3F8MA 1UHWA 1S7AA 2XGXA 3K1MA 2DO7A 2P4WA 3BDDA 3MEXA 3KZYA 1SFXA 5DYMA 3SHFA 2IA1A 2DW4A 3HRMA 1S7OA 3R0AA 4ESBA 1FP1D 4EVIA 2NYXA 2DT5A 1FWZA 4P5OA 2FQ3A 1I1GA 1DPUA 1L0OC 3HHGA 3WTYC 2ZBKA 2FEZA 3HSEA 2OZUA 5EEGA 1OMIA 4IRHA 4A6EA 1Z1DA 4NQWA 2BEOA 2RNJA 5L3DA 2PMHA 3C3WA 2DLLA 2XAHA 4LD5A 1K6OA 1IF1A 4EMSA 4RGXA 2HEOA 4EGYA 2A3SA 4JQFA 1SFEA 1SD4A 1E17A 3E6CC 2EV5A 4KMUX 3ML6A 4HLXA 5FLXK 1XN7A 1ZRCA 1O3SA 4LK1F 3ELKA 1O3RA 1XCVA 2DTRA 5DUKA 2QQBA 1HXDA 3BWGA 3I4PA 3KP4A 5DV5A 2JTVA 1BIBA 4MTDA 3WTTC 2F5FA 2FBKA 1GVJA 4BXUA 3CUQB 3FM3A 1QQIA 1TQMA 1HW5A 2X4HA 4G8XA 5HLHA 1IW7F 3TO6A 2M8EA 4HDVA 2ZMEA 3EYIA 4R1HA 3JW4A 2BE5F 1PP8F 3REOA 2XKPA 4LLLA 2VE8A 1ZAOA 1BC7C 5H20A 3GX4X 3W6JB 2MH2A 2HWVA 2ISZA 2HR3A 3I53A 1BI3A 2P5VA 4LGWA 3TOAA 4CZZA 1MKMA 3BJAA 1EV7A 5CVRA 3GWZA 1B6AA 1AWCA 3KZZA 1XGMA 3IRQA 4R79A 3FF5A 3PFIA 1TQIA 3QRFF 3CUQA 4XLPF 1IUYA 1PDNC 3I71A 5D5WB 4L9VA 2LF7A 1JE8A 1HQCA 2V79A 3T0YA 2OD5A 4I0BA 5ILSA 3Q5FA 1F5TA 2C6YA 3HRSA 2RDPA 4KICA 3J80Z 4N9IA 5DCMB 5FFXA 3EUHA 4JBAA 5AIQA 2VXZA 1JHHA 1ZG5A 3G73A 1B4AA 2Y75A 4A5NA 5L3GA 1ODDA 2FMYA 2JT1A 1MJAA 3LAJA 4B09A 3DP7A 1FYKA 1F1ZA 4PCQA 3WU0A 4UV8A 3F8CA 5A2QZ 4P96A 1BI2A 1RUOA 1L3LA 2CFXA 2VBYA 5LHGA 5D6FA 3F23A 4BNCA 3WU1B 1XCBA 3RKYA 3K1NA 5FO5A 3RDIA 3E5XA 1FSEA 3IL2A 1QPMA 3ROUA 2EFNA 2RVCA 3BPVA 2COMA 1HBXG 5DCMA 4KUMA 5F64A 5K5OA 2BYVE 1K78A 1HSJA 2X0LA 5J6XA 2IA2A 2MBFA 3GZ6A 2IA0A 1PUEE 2NAZA 1D5VA 1WRJA 3IWZA 2A69F 2A5YB 2CGPA 1UCRA 2UXNA 1G4DA 1DUXC 3WTZA 2CSOA 4G7HF 4HX4A 2F5CA 2D1VA 3LA7A 2PI0A 4L9NA 3CJNA 2XHKA 3KEOA 1ZGJA 4RGRA 2FOKA 3DPLC 2HFHA 3FZVA 1XD7A 1ON1A 3VOEA 2Z33A 1YW8A 2R3SA 2ZXJA 5E1WA 2LKPA 2F5DA 3FMRA 1HW2A 1MZBA 3KLOA 4FX4A 4Y13A 4P9UA 2XVCA 3ZMDA 3HHHA 3RYRA 2D45A 1FNNA 5TRDA 4PGHA 3IHUA 3QAHA 3P7NA 5LLQA 3KP3A 1P92A 4WWCA 5CLSA 3V7CA 3C7JA 4EJUA 1K79A 4HV6A 1JGSA 5KVRA 4MHGA 3J80K 4R8HA 2DU9A 4ZYDA 3HRUA 3T8TA 1ZLJA 4CO8A 2KIUA 2OQGA 5E8GA 4BQAA 3MAJA 3WTWC 1ZLKA 3PQKA 2NRAC 4EM0B 4F7ZA 5K5RA 4HF0A 2E7XA 4IJAA 3GLXA 4EQQA 1XGNA 2UWMA 2XRNA 1B9MA 1FT9A 1D8KA 3H92A 5A2QK 1LJ9A 2E1NA 3FHZA 3F8NA 3WE2A 5ED4A 4HX8A 1OKRA 1GXPA 4OMZA 4YFXF 3MZHA 5IT9Z 4TV7A 5AIPA 3RKWA 2QBYA 1CF7A 1HSTA 5FD6A 3TOBA 4LG0B 3HYIA 3WGGA 5CVUA 4L9JA 4A6DA 2KRFA 3V8LA 1T39A 1Z91A 2CYYA 4I7HA 3ZMSA 3ZQ7A 3W6KB 4EV0A 3RPUA 5HDKA 2VODA 5K1YA 1ZREA 1Z7UA 3FM5A 5TJJA 1SD6A 2MC3A 3E5QA 2YX4A 2A6EF 3KCCA 3FMQA 1TW3A 2JRTA 4N9HA 1FP2A 5LRSA 3IWFA 3MQ0A 4ENNA 4Y15A 2NNNA 4ENKA 2KJCA 2NS0A 4UV9A 4Q5SF 3HUGA 4OINF 4Y17A 2GQQA 1A04A 4UNOA 2GXBA 2J5PA 1XMKA 1PP7U 4LG0A 2XAFA 1XGOA 4A0ZA 1U5TB 3T1BA 4A0YA 2QWWA 2W85A 4A0XA 3TKYA 4MQ9F 3VFZA 1TBXA 4RB0A 4IHTA 2ADUA 2FXAA 2Y0MA 5ICEA 1TLHB 2XAQA 5E8IA 1UB9A 3L2CA 2O8XA 3T8RA 3CO7C 4O5VA 5ILVA 3FXRA 5BQTA 2HTJA 1J0RA 4RAYA 4KN7X 4LLGF 5ICFA 1FZPB 1QNTA 2M30A 3BPXA 3RPQA 4HQEA 2A68F 3P9CA 2FE3A 5DD8A 3OV8A 3RIRA 2EB7A 4BHBA 2WC2A 4N0BA 1ONVA 3ECHA 3ZN1A 5D8KB 3JAMZ 4A2UA 2W25A 2STTA 2QQ9A 1S3JA 5LGNA 2QVOA 1ZH5A 3BZ6A 4FX0A 1USTA 2XASA 2RGVA 4OIRF 2FF4A 3ZMZA 1G3WA 2Q0OA 3SXYA 1G6NA 1XMAA 4B8XA 4WX9A 3NEUA 4YIIA 2HQRA 5IT3A 1K7AA 2QYOA 4KN4X 2E7WA 5LEKA 1HKTA 3QP5A 3R4KA 3ECOA 1J2XA 2IRFG 4BYYA 1T2KA 4CHUA 2B0LA 2PG4A 1WI9A 2PQ8A 2VBZA 1U2WA 3N97A 4I02A 3KLNA 5D5XB 4UUVA 4P9FA 4L5JA 3I0TA 4LJZF 2AXLA 3V7SA 4MEYF 2D2WA 2ZMEB 1TNTA 4KIBA 3L9FA 1REPC 1YYVA 2VOOA 4EJTA 3E6MA 1FYMA 1B1BA 1U8RA 1IXRC 4L9TA 1KQ8A 2WTEA 5KK1A 3T5XA 2G7UA 5HOOA 2OU2A 3RI4A 1SAXA 2DPUA 4CXFA 2L01A 3F22A 4M73A 2OQRA 2Z9OA 3ZP5A 3VEPA 1IXCA 2F5EA 1FX7A 4E70A 2O03A 3KEQA 1XDSA 1T0FA 3P9KA 3OOPA 2ISYA 1TNSA 3I54A 1E2XA 4FHTA 2JPBA 4D0PA 3F21A 2HGCA 2K86A 1S6LA 2ZNZA 3J81Z 2DFIA 1XGSA 5DCFA 2STWA 4L5IA 3IKTA 5HVQC 5JI6A 2ETHA 2P5KA 2HS5A 3ZN0A 1YFHA 1FLIA 1KQ0A 1OYYA 4HX7A 3ZMTA 4WCGA 3FX3A 3DQVC 4L0YB 1RUNA 1EH6A 1YO5C 3QPTA 3JAMK 3MFKA 3P9IA 3E6DA 5LEJA 4I0AA 2BGCA 3IC7A 4M72A 1O3QA 2V6CA 3KP2A 2CW0F 1BI1A 2GAUA 5J8FA 5D5UB 5CVVA 1FYLA 3GFLA 3R0JA 1K78B 3TGNA 1BN5A 4RB2C 3L00A 4HDUA 5ICGA 5BOXA 4HOBA 4I01A 5D4RA 3WTXC 3HIFA 1O3TA 2P6SA 5DDGA 2EFQA 4KT5C 3GW2A 1IN5A 1ULYA 5D4SA 1DPRA 1YQAA 3K2ZA 1RNLA 2OA4A 5LRRA 4RGSA 3DXJF 2DQLA 2QZ8A 4IXAA 2DBBA 2FNPA 1OYWA 3KETA 5FFZA 4GXOA 2VBWA 3V8JA 4OIOF 4P55A 2QLZA 2HZTA 1U5TC 1FBQA 3WE3A 1P2FA 5K5QA 4OOIA 2ZJ2A 5JFRA 3MCZA 1H9GA 1YS7A 4KA4A 4O3MA 4Q4ZF 1R22A 1R36A 2PMUA 3K1PA 2Q8KA 1O7FA 5CVIA 1FOKA 1SMTA 1IRGA 3LA3A 3ZPLA 3TO7A 2DPDA 1EH8A 5HDNA 4ENMA 1YW7A 3JTHA 3ERED 4WXDA 3H3UA 1HKSA 3F8BA 2FA5A 3E6BA 4AD9A 4IHSA 2RV8A 5ERIA 4KDPA 3J81K 2IVMA 3M8EA 2VT2A 1KU2A 2DK5A 2EV0A 4AWXB 3L09A 1Z05A 3HOSA 4WXHA 2Y48A 2YSRA 1J59A 3O6BB 2EWNA 2V1UA 4U0VA 2XROA 2GWRA 4MTEA 5L3CA 1ZN2A 4MEXF 3RYPA 4MNUA 1C0WA 3C18A 4ESFA 3CTAA 4UHTA 5EEHA 1OR7A 3GF2A 3ULQB 1IN8A 2HKOA 3WGHA 5F1RA 4QWQA 2O61A 3JTGA 3LA2A 4KYWA 2G9WA 4BH9A 4XLNF 1RIOH 1V3FA 4L18B 1LNWA 4M9XA 5L3BA 2FBHA 2DAOA 5L3EA 1W7PA 2CO5A 4HBLA 2QBYB 4UVCA 1CF7B 1MJBA 3F72A 4M6YA 5H6QA 5LBQA 1TTYA 5E18F 2IT0A 2FNAA 3MZYA 3ABUA 5BMZA 1KU9A 3ZMUA 5JHUA 5J8CA 4H0EA 1W5SA 2K7LA 3O2PE 1R23A 1KGSA 3R61A 3CUOA 2M5WA 2H94A 3C1DA 1LDKB 1HKQA 2RKHA 2MD5A 3CUQC 3E3VA 3JSOA 1V4RA 5LGTA 5CYVA 2ZCWA 4CICA 1KU3A 3ABTA 5CJ9A 4I98B 1G3TA 1Z6TA 3DF8A 2M45A 5HS7A 3ISPA 4I09A 5FGMA 2A6HF 3I58A 3EQLF 2KJBA 2YPRA 4GO1A 2VC0A 2PFBA 3DPTA 3R60A 2HYFA 2LF8A 5BS6A 3PQJA 1O7LA 3V7RA 2Q2EA 3GFIA 2PN6A 3DKWA 3F8FA 4RGUA 1STZA 2PEXA 4EJVA 4LB6B 4G6DA 4AIHA 4S04A 4ON0A 2H6CA 1FPQA 2L4MA 1J9IA 1QZZA 4KNYA 3HSRA 4ZZDA 1I6XA 1KA8A 5LGUA 1J5YA 1P4XA 2UXXA 5LHHA 1BOAA 2EA2A 3WTSC 2HYGD 4MGRA 1IN6A 1MDMA 5D5VB 1H9TA 2ZKZA 3BJ6A 2JZYA 4BAYA 2DQRA 1R5HA 3O3KA 1FY7A 3S2WA 2LDUA 1KU7A 4PZJA 1DDNA 1O57A 1U6GA 4EM1A 5HS8A 3LQRA 4BHPA 2K27A 4EGZA 5ICCA 1SMYF 4KFCA 3LAPA 2XKOA 2AS5F 1AOYA 5FD5A 3K9TA 2VE9A 3BP8A 1KYWA 3KP7A 1Z6RA 1T38A 5JVTA 5BPIA 1I27A 1IZ1A 1RZ4A 3CDHA 3KE2A 5E17F 2EA4A 2F2EA 3M9AA 4O6JA 3RKXA 3Q9SA 3GUDA 2PLYA 3D5LA 4OIPF 2HTSA 1R5GA 1F4KA 4UXNA 4YG2F 1I1SA 3U9GA 2V1DA 1QBJA 4KIGA 1LDJA 1W5TA 1BJAA 1B59A 3WG9A 4G9YA 2FMLA 5IT9K 1MD0A 2ZFWA 4LB5A 3FWEA 2JPCA 2HDCA 1J75A 2LSOA 2IW5A 4RS8A 3GZ5A 4LMYA 4ENJA 3BOQA 5DEQA 2L54A 2ACJA
chains in the Genus database with same CATH superfamily
3LSGA 1MGTA 1ZGAA 4B3XA 4U7BA 3M1EA 4RAGA 1R7JA 1HOMA 4ZYHA 4M74A 3S93A 4OIQF 3HKZN 2BHZA 2L02A 4OAZA 2WY7Q 4LITA 4GGGA 2CWEA 1MH3A 3WTVC 3QU6A 5AONA 1ZARA 4ZYGA 3I5UA 3HDDA 4NHJA 2LC2A 3OMYA 4XMYA 4BUPA 1LEAA 3MD2A 2WV0A 4PJJA 2D1HA 3K2AA 2L9NA 1RRJA 3I64A 2WBMA 2VQHA 2H6BA 4HNTA 5E1ZB 2EIKH 2FRHA 5DD4A 3FDYA 2DOEA 4HV5A 1LQ1A 2MH9A 2DI3A 1UG2A 2CQXA 3V8KA 2K4BA 1GUUA 1ZYRF 3DFGA 1D8JA 1R1TA 3S1MJ 4BY7J 2OAZA 2FSWA 2HVRA 3ZQCA 1R71A 4HAMA 4EJWA 1FBUA 3E1SA 3KFWX 1XSVA 1B9NA 6PAXA 2OF7A 2M7BA 2BV6A 3Q0VA 1X4PA 1JTXA 1ZG3A 5ILUA 2DA6A 1BW6A 1DU6A 3QWLA 4BE1A 3K70C 5JR3A 5C4JJ 2FD5A 4E7JA 1WKMA 2XPUA 3OR1C 4IHYA 3H0GJ 3LSMA 1TW2A 4ZDLA 1HA8A 1WH5A 3FBIB 2DA1A 2VKDA 1IO2A 4RLQA 3JRGA 4ZYEA 4LIVA 2CUZA 3DPUA 1T08B 2ZO4A 3M4OJ 4PDKA 1LB2A 2F4MB 4G94A 1HW1A 2V6EA 1WSUA 3SFZA 4ZZLA 4AIKA 3QU3A 3OS1A 2F4IA 2QENA 3BT9A 3FBNB 1IXSB 1BIAA 3M8FA 1X1CA 3CC7I 3EETA 4X1EA 3HRTA 1ZTRA 4F92B 1N75A 4CGZA 4RM3A 1PVEA 3FHNA 2HDDA 5BPDA 2OBPA 1XSXA 2O0YA 4XSXF 5J1YA 3KYCB 2XF7A 2UUZA 2Z5UA 4GYGA 2O6GE 2A07F 3SZTA 4A12A 1YIJI 1VTNC 1SD7A 4A5MA 1SVLA 5FKOA 2B7EA 2HU9A 2E2IJ 1DGWY 3OYEA 1P4AA 2X1CA 5IOZA 4ESJA 1H0MA 3A2KA 4BQNA 4G6TB 3HGGA 4XLCA 4IRGA 2VC1A 3G1OA 3IRRA 1RI7A 2KIMA 4LFUA 1IDZA 2CG4A 3E5UA 5LHIA 4NB5A 1SFUA 3J7AO 4PSWA 4NUBA 3TQNA 2Y2ZA 4N4OB 1M1EB 1QZYA 1TZLA 5FLMJ 1D3YA 3OYNA 4KIFA 5CVJA 3PNYA 2EFOA 2XB0X 2YU3A 2JA7J 3IP4B 4HEA2 5JHFA 3G1LA 3DBHB 4FISA 4Q47A 4ETSA 4XSZF 2QM3A 5F6FA 5FKMA 3OYMA 4C2MJ 2W48A 4D5FA 3F6VA 5EYRA 3KP6A 1K4SA 3CO6C 1N25A 4S05A 1UHSA 2HKXA 3G1MA 2DODA 2IGMA 3RCOA 3WGIA 2H27A 2K02A 3MVPA 1XMXA 2E36A 2GA2A 1ZHFA 1WWXA 1WJAA 1KYZA 4E7LA 4ZC3A 5FRNA 3TO9A 3AAFA 4CDGA 2JUGA 1OPCA 1UFMA 1BA5A 2VT3A 3DEUA 3RTRA 1MNMC 1BBYA 1XSDA 4I76A 1SEUA 1T95A 3KZIC 3WTUC 3OYDA 3GFJA 2OUMA 3H35A 1XB4A 2CH0A 4BJ5C 2JSCA 2ZNYA 3ZQHA 3IH3A 3K4CA 1JXSA 1S8NA 4ASNA 1TQPA 3H0DA 2UZKA 5LFAA 4HZFA 2RC4A 1T98A 2E1OA 1JKRC 2W57A 4FT8A 5F1JA 3OS0A 5L3FA 1FIAA 1E3OC 2EV6A 4MO7A 1T6SA 2L7KA 2EIJH 2HOEA 3RQ4A 4BL0B 1YW9A 1R58A 2L9VA 1R4NB 3S8PA 2P7VB 3BROA 2EIMH 3AG1H 3G3ZA 2O3FA 4HLYA 2QQAA 2BZTA 1Y8RB 2F4OB 3ONQA 4OU0A 4BHCA 4CCNA 4G7ZF 3SZPA 2QKLB 4NC7A 3KIOA 4C3HJ 1DGRM 2L3DA 1IN4A 1I3AA 2EFPA 1GV2A 2HQNA 4JX6A 4IF4A 3U1KA 2N8GA 1NH3A 5E3NA 2WWYA 2IP2A 3FXQA 3CCMI 1FC3A 1OCCH 1LUJB 2DMPA 2XUBA 4RLFA 3CC2I 2OCEA 4Y3OA 1MSFC 3KP5A 2ESNA 1G59A 1YLFA 4A93J 1VQ4I 5IYCJ 4AU7A 4ITVA 3HXLA 3TDZC 1AU7A 2KFDA 5J4VA 2HQAA 4A3KJ 1D0XA 1U8BA 4IVNA 3N4MA 2YR2A 2QUFA 2R7ZJ 3K0LA 1JT0A 2K5CA 2COBA 1VQ7I 2DXIA 1W7PB 4MQVA 1K6YA 2K4JA 3FXUA 3DKXA 2BBYA 5DUIA 4HSTA 3HC7A 3QPSA 1ZRFA 4F91B 3VYSB 1FMWA 2G7HA 2FQ4A 1Q1HA 3C2BA 3B73A 5J4YA 2W84A 4U88A 2K9NA 3HTUA 1U78A 1Y0NA 3WODF 3LFKA 5D6EA 2A6TA 3GVAA 4K2EA 3ZQQA 1RETA 3B6CA 3GYHX 2EK5A 4HF2A 3OL3A 3L2QA 4GCVA 4YFKF 2K9LA 2IPQX 1S29A 2ECBA 3GXOA 2V1XA 1ETOA 1NHAA 3TMOA 2IS1A 3FXOA 3OWTA 2GLOA 2XF5A 3S16J 2R7FA 4DNCA 4HYEA 1USSA 1EKEA 2ESHA 2M3AA 4AIJA 3BZCA 3BQYA 1JUPA 1J7KA 3TW7A 1VQLI 1D0YA 2IS4A 1IUFA 4RAFA 2BY1A 2BHYA 3L2VA 3E97A 3QPHA 2M34A 3G71I 1T0FC 2MLKA 3K69A 2K85A 3EDPA 3F3XA 4MIMA 3MKWB 2J5OA 2DT6A 2L4AA 2TDXA 1JUSA 1OFCX 4Z2YA 4XONA 4M9ZA 3SEQA 4UVBA 4XRSG 2ELHA 3CCVI 2RN7A 2Z99A 2KKOA 3NQOA 3B02A 1F9NA 4U0YA 3DCFA 3B6AA 1A6IA 4NDLA 4G6QA 4RA2A 3NRVA 2VOPA 1G3SA 5H6RA 4GYIA 2R7DA 2H1KA 1LDDA 4KJZA 3SDGA 3VB2A 4AM3A 1ON2A 3FKJA 1DP7P 2WB1N 2EFWA 2NOJB 4M71A 3CCYA 2I10A 2DA3A 2HVQA 4AYBA 3KEYA 2RQQA 2R7XA 1OCTC 1Z0XA 2GA1A 4YELA 3PL8A 5J3LA 2VASA 3I9V2 3FMSA 2P7CB 1FBSA 4U0WA 2KPMA 1YG2A 1TWCJ 2VQLA 2W24A 2Q2EB 3PFYA 2CV0A 1YITI 2CU7A 5B3SH 3GTMJ 1BI0A 4I6ZA 4C9YA 3HTSB 4YFNF 3F6OA 3QOEA 2GZWA 5HNFA 1UG0A 2Z3YA 4HA8A 3EPZA 2DN0A 3U2RA 1IGNA 3IUOA 4S0HB 5EF6A 3S17J 4PJ0C 4XKVA 3JCUC 2E1CA 1KQ9A 1MJ9A 5KHDA 1WQ2A 2F5VA 2RQPA 1YS6A 1JJ6C 4HG2A 2MA3A 3EYYA 4AVPA 3BR1A 1ZRDA 2DCEA 1VF9A 1WVRA 2LFBA 3AL0B 4XBFA 3TDUC 4BKXA 2VJ4A 3W6VA 4RB3C 4EM2A 1QO0D 2V9KA 2GXGA 2XAJA 3LSTA 4M3BA 2BY0A 1W36D 3BY6A 2AQFA 2DMTA 1OQYA 3H3VK 4U7DA 2EQRA 4IPAA 3COAC 1LEBA 1FSHA 1R1VA 4XRFA 1X3UA 3U1DA 2DK8A 2HOAA 2VONA 1BC8C 1OYIA 2FBIA 3ZQFA 4BXXJ 1MDMB 2MLGA 1ZKGA 1MBHA 3GEZA 3CP8A 2VBXA 4BBRJ 3VODA 4PGGA 2CJJA 3DLAA 2XV4S 4BY1J 2IS2A 3EUHC 2LOOA 3E7LA 2VN2A 3RJPA 2V9VA 4I2OA 1V5EA 2IGOA 1JHFA 1W7PD 4RAZA 3ZCOA 5HS9A 2XAGA 1VFCA 1I5ZA 2K9SA 2GIVA 4M9SA 1IN7A 1BR4A 2XIGA 2ZB9A 4WXCA 2ME0A 1UHMA 2CQKA 5E20A 2IAIA 3SQNA 2PJPA 3VDXA 2NXNB 5IP7J 1VQ5I 3R6SA 2L7MP 2LH9A 5EEAA 4HW0A 3LSHA 2R7OA 4GRIA 1XG1A 4J01A 2ZXHA 3J7ZI 3O8GA 3L7WA 1IRFA 2M1BA 1IV6A 2RNGA 4HQMA 3OYCA 3K10A 4UB6C 1QU3A 3LQQA 3IKVA 5FB2A 5M5XJ 1R1UA 1E3PA 3DV8A 2R5YA 1UAAA 5EDNA 4KMFA 5FLXZ 2BXZA 4II2A 1OJLA 1N78A 3JREA 1BM9A 3CLOA 4XK4A 2PMZA 1PUFA 2EJRA 3M7GA 5HLGA 4G7OF 4YIRX 3JR9A 3GBGA 3OS2A 4ZDPA 2KIFA 3OYBA 4DGWB 3S3OA 3I59B 2F6CA 4WK8F 1IC8A 2FU4A 2M87A 5D8LB 5E1XA 4QPOA 3JSPA 4XN3A 3HSFA 4XKBA 2P6TA 5IOYA 3HOYJ 2MYSA 4WF2A 4DQ2A 3TP0A 4L0ZB 1SD5A 4B48A 5C3EJ 3A02A 3FXJA 2HOSA 4UUTA 3S3NA 2DJNA 4JK1X 1JKQC 3ZRGA 2A61A 1K83J 1QGPA 1Z9CA 1LVAA 1SANA 4EJOA 3K4KA 3HOTA 2PBIA 1AKHA 2V7FA 3I56I 4YIFA 4LK0F 2DDBA 2H8RA 4DBQA 3CCLI 2P5LC 2L9RA 4KITB 1POGA 2VL8A 3L2RA 3L2WA 1ERDA 1R6RA 3ZMVA 2LNBA 3QP6A 3MWMA 2NNYA 2YUSA 3FK7A 4CYDA 1EH7A 1YTYA 2LY9A 1FJLA 3CQZJ 1CGPA 1VQ9I 2OV7A 1P4WA 2ZXIA 3H3ZA 4LLNA 3BJOA 2OZ6A 1Y0UA 1QZEA 4Q48A 1G3YA 1Z77A 4RB1A 1GHCA 2H09A 4CCLA 4OMYA 3IAS2 2QEXI 1WJEA 3D0SA 3OSGA 2FOWA 2IJLA 3DWLE 3Q9VA 3QOPA 3CMEI 1IAWA 3FXMA 1X1AA 3CJQB 1R9TJ 4IRIA 4M6XA 1TT5B 1X2MA 3BTJA 1R00A 2WAQA 2P8TA 2E5ZA 3HZJA 1BL0A 3S3MA 3HOXJ 4B4CA 3I59A 1GXQA 2Z2SB 4UVAA 1X4OA 3GFMA 4QLCU 2MFZA 1W4MA 2W1OA 1Y1WJ 2YX7A 1B8IB 2DFEA 3LWFA 1V5GA 4IKFA 3MZ8A 4UUSB 1ZG1A 4IOCF 3WG7H 4F93B 3W2AA 2JVHA 4D1QA 1I39A 1U3EM 3OY9A 1P6RA 5HDGA 4MFDA 1SVMA 3GO5A 1XDUA 5HLIA 1YIOA 4PJMA 2HOTA 4HF1A 3V4GA 1OR7C 2Z16A 2EINH 3BG3A 4ZH4F 2PMZN 4DOZA 3OYIA 3N05A 1U5TA 2XSDC 1QVTA 2DA4A 1UHWA 3F8MA 1S7AA 2XGXA 3UR3C 3K1MA 1FOYA 2ELKA 4B47A 2R7TA 2DO7A 2P4WA 3BDDA 3H9JA 3MEXA 3KZYA 1SFXA 3AG4H 3OL4A 5DYMA 2IA1A 2DW4A 3SHFA 1FIPA 3HRMA 1S7OA 2LRDA 2LY1A 3HBLA 1FP1D 3R0AA 4ESBA 4EVIA 1PJRA 4XICA 2NYXA 2DT5A 1FWZA 4P5OA 2FQ3A 1I1GA 1DPUA 1L0OC 1ETWA 3HHGA 3OSFA 1A5JA 1LFUP 3WTYC 1GLNA 2ZBKA 2BW3B 2FEZA 3HSEA 2OZUA 5EEGA 1OMIA 4IRHA 4A6EA 1Z1DA 3LSJA 2E1MC 4NQWA 1B8IA 2LK2A 5GTHC 2BEOA 4F52A 3BG5A 3I4NJ 2RNJA 2WADA 2CV1A 4UUSA 5L3DA 2PMHA 3C3WA 2DLLA 2XAHA 4LD5A 2PX9A 1K6OA 4BBSJ 1IF1A 4EMSA 3PJRA 2K9QA 4RGXA 2HEOA 5F27A 2A3SA 4JQFA 4EGYA 1SFEA 4ANJA 4N4NB 1SD4A 1JKPC 3E6CC 1E17A 2EV5A 3JRDA 2E2JJ 2V9PA 3K4LA 3X2QH 4KMUX 1HF0A 3V42A 2WAQN 4W1UA 1Z21A 4NBQA 3CZ6A 3ZQGA 3ML6A 1LKXA 4HLXA 2Y0SA 5FLXK 2ZFUA 1VQPI 2Y31A 1XN7A 2VB6A 1ZRCA 1O3SA 3LL7A 4LK1F 3JRHA 3ELKA 3MKLA 5EG0A 1O3RA 1XCVA 2R7UA 3M1CA 2DTRA 5DUKA 2X85A 3A4CA 1Y56A 4LG3A 2RAEA 4XOTA 2QQBA 2KDZA 3AFHA 4JP0A 1HXDA 3BWGA 3GCMA 3I4PA 3KP4A 1VQOI 4DIQA 2BW3A 1R49A 4PJLA 5DV5A 4ZTFA 2JTVA 1BIBA 4MTDA 2ZJPF 3WTTC 2JA2A 1D5YA 2F5FA 1H88C 2FBKA 1GVJA 4BXUA 4KISA 3H9GA 1IJWC 3OR2C 3CUQB 3FM3A 1QQIA 2GM4A 1HW5A 1TQMA 4E7SA 1EJ9A 2X4HA 4G8XA 5IPAA 2QA4I 3G4SI 3JRIA 4CCKA 5HLHA 3D5SC 1G8XA 3CF2A 4AUXA 2LR8A 1IW7F 3TO6A 2WV1A 2IGKA 2M8EA 5GAGJ 2JK3A 5JLWA 4HDVA 2ZMEA 5GAEJ 1CQTA 3CMYA 2I8DA 3EYIA 2R0QC 4R1HA 3JW4A 3S1QJ 2O8KA 2BE5F 4E7KA 1PP8F 3EUAA 3AL0C 3REOA 1K4TA 2ELJA 2CFOA 3BG6A 2XKPA 3NWSA 4IQ4A 4LLLA 2R7VA 2VE8A 1ZAOA 3TL4X 2OTLI 1BC7C 5H20A 3GX4X 1VQ8I 5KAIC 2XF6A 3HPHA 3W6JB 5FRMA 2MH2A 2HWVA 5CKTA 3CCRI 2ISZA 2HR3A 3I53A 1BI3A 2P5VA 4LGWA 3TOAA 5EZGA 4CZZA 1MKMA 3BJAA 1EV7A 5KNLA 5CVRA 5IYDJ 4X6AJ 3GWZA 1B6AA 2E60A 4B3AA 1AWCA 3KZZA 1XGMA 3J7YJ 9ANTA 3L1PA 4LOCA 2LBFB 3IRQA 1WI3A 4R79A 3FF5A 3PFIA 2Y0SN 1TQIA 3QRFF 3OYAA 1X3WB 2XPWA 3S1RJ 2QCOA 3CUQA 4XLPF 2VKHA 1IUYA 4RM2A 3M07A 5GPAA 1PDNC 4M3DA 3I71A 3CJRB 5D5WB 1ZK8A 4L9VA 2LF7A 4RDUA 1HQCA 2V79A 1JE8A 3T0YA 2OD5A 4I0BA 5ILSA 1YE9A 3Q5FA 5KCMA 1F5TA 2C6YA 3G6EI 4A3DJ 3HRSA 2RDPA 5K7FA 5M3FJ 1VQKI 4KICA 3J80Z 1QA6A 4N9IA 5DCMB 5FFXA 3EUHA 4JBAA 4A3IJ 5AIQA 4BS9A 4B1RA 2VXZA 4U87A 1JHHA 2AQEA 2AO9A 1ZG5A 3G73A 2KRCA 1B4AA 2Y75A 1Z7LA 2XAUA 4NNJA 4A5NA 5L3GA 1ODDA 4V19K 2FMYA 2JT1A 1MJAA 3SJMA 2HVSA 3CDLA 3FK6A 3LAJA 3SDBA 2CQNA 3QYFA 2L7ZA 4B09A 3DP7A 1FYKA 1F1ZA 4PCQA 4DYQA 1YX3A 3WU0A 5B1AH 4C3JJ 3AG3H 3F8CA 4UV8A 5FKNA 5A2QZ 2ID6A 4P96A 2DOAA 3A1YA 3OYKA 1BI2A 3BLYA 1UMQA 1L3LA 2CFXA 1RUOA 1Z3YA 2LBFA 5CQGA 2VBYA 3HM5A 2GOMA 5LHGA 3S15J 3SEZA 1VQMI 1MNEA 2WA0A 5D6FA 2GIZA 3F23A 2JA8J 4E7HA 4BNCA 3BR6A 3WU1B 3H9QA 1XCBA 2JVGA 3RKYA 3K1NA 5FO5A 3RDIA 1S7EA 3E5XA 4KT6A 1NTCA 2VXDA 1FSEA 3IL2A 3A01B 5EGOB 1QPMA 2VKVA 5GTIC 3TEDA 4A3GJ 2E35A 3ROUA 3AKZA 2EFNA 3G2BA 2RVCA 3BPVA 1ZR4A 4BQOA 2HXOA 2COMA 1HBXG 5DCMA 3LOCA 2X9DA 4KUMA 5F64A 5K5OA 2BYVE 3OIQA 1K78A 1U0JA 3CCEI 3PIPF 3HOZJ 1D0ZA 3CCSI 1F36A 1HSJA 5EJCA 2X0LA 5J6XA 2IA2A 2MBFA 3GZ6A 2IA0A 1PUEE 2JA5J 2NAZA 1MBJA 1D5VA 2LY2A 3BC8A 1WRJA 3IWZA 1SC7A 2A69F 2A5YB 2CGPA 4XORA 4D7NA 1UCRA 2UXNA 3PUFA 2V1NA 4FETA 1G4DA 1W0UA 4JOMA 1DUXC 2IEKA 2VQCA 3WTZA 1WCMJ 2TCTA 2CSOA 1JTYA 2P81A 5DTDA 1JKOC 4G7HF 1VQNI 4HX4A 2I5UA 3DU5A 2F5CA 1A35A 2D1VA 3LA7A 3PSIA 2HYJA 2EILH 2PI0A 4AIDA 1JJ8C 2ICWG 4L9NA 3GTQJ 1XX5A 3S1NJ 3A01A 5EGOA 3CJNA 1ETXA 1OCOH 2L9SA 3KX2A 1E3HA 3HPGA 3QODA 3FIWA 3WHCA 2XHKA 3KEOA 1ZGJA 2JRMA 1J09A 4RGRA 3PO3J 1FTTA 5K7HA 2FOKA 3DPLC 2UV1A 1NK3P 2HFHA 1EA3A 3VSLA 2CQ7A 2LKXA 3BR3A 3FZVA 1XD7A 1LPQA 1ON1A 3VOEA 3OYLA 1TL8A 2Z33A 1YW8A 3MN2A 2R3SA 2ZXJA 5E1WA 2Z1DA 2LKPA 4QTRA 4D5CA 2LD5A 2F5DA 3FMRA 1HW2A 1MZBA 3KLOA 2O9LA 2ZC2A 4FX4A 5IP9J 1MBFA 5BNGA 4Y13A 2CUEA 5B1BH 4P9UA 3LSPA 2XVCA 1XTAA 3ZMDA 2FX0A 3DTIA 3HHHA 3RYRA 2HNHA 3ZQIA 2D45A 2BXYA 1FNNA 4DYCA 3O8HA 5TRDA 4PGHA 3VYRB 3IHUA 4YEJA 3QAHA 3P7NA 5LLQA 3KP3A 1P92A 4ABZA 4WWCA 5CLSA 3V7CA 3C7JA 4EJUA 1K79A 2BY2A 4HV6A 1JGSA 5KVRA 4MHGA 2VI6A 4CH7A 3J80K 2K40A 4R8HA 1TT0A 1BJZA 2DU9A 3D5RC 4ZYDA 3HRUA 3T8TA 1ZLJA 4CO8A 1TWGJ 4C30A 2R93J 1D1CA 1YJ9I 1HDPA 2KIUA 2OQGA 5E8GA 4BQAA 1MBKA 3MAJA 3WTWC 1SVOA 2KISA 1WZ2A 1ZLKA 5K7ZA 3PQKA 1B72B 2NRAC 4EM0B 5JVGF 4A3FJ 4F7ZA 5K5RA 4HF0A 1DU0A 2E7XA 4IJAA 4BU2A 1GV5A 2R5YB 3GLXA 4ZYAA 4E7ZA 4EQQA 1XGNA 2UWMA 2XRNA 1B9MA 1FT9A 1W5CC 3ZGKA 1D8KA 2LVSA 3H92A 1V55H 5A2QK 1PUFB 1LJ9A 2E1NA 4DZPA 3BCAA 1HC8A 1D1BA 3FHZA 3HJEA 4MLOA 3F8NA 3WE2A 2OPTA 5ED4A 4HX8A 2X6YA 2CV2A 1OKRA 2VJIA 1RKTA 2HI3A 5B66C 1GXPA 2E19A 3S14J 2O7OA 4OMZA 4YFXF 3MZHA 5IT9Z 4TV7A 1YI2I 5AIPA 5J1UA 3RKWA 1S72I 2FUG2 2QBYA 2M0CA 1CF7A 1HSTA 5GPCA 5FD6A 3TOBA 1AKHB 4LG0B 1XS9A 1F43A 3HYIA 3WGGA 1QVUA 5CVUA 5F04A 2B9SA 3EUKL 1T33A 2HDWA 3HOWJ 4L9JA 4A6DA 2KRFA 3OYJA 3HGYA 3V8LA 4AYBN 4DBRA 1T39A 1Z91A 4PSXA 1LVKA 2CYYA 4I7HA 3ZMSA 3ZQ7A 3HOVJ 3W6KB 4EV0A 3RPUA 5HDKA 5M5YJ 2R7SA 1B72A 2EZKA 2VODA 5K1YA 2L7FP 1ZREA 1Z7UA 1JI8A 3FM5A 5TJJA 1FEXA 1SD6A 2MC3A 2ZSIB 1MBGA 3E5QA 2YX4A 4BE2A 2A6EF 3KCCA 3FMQA 1TW3A 2JRTA 2L0KA 2CUFA 3QQAA 3A0HC 4N9HA 1FP2A 5LRSA 1WH7A 1W0TA 5F0FA 3IWFA 2M7AA 5B5EC 3MQ0A 4ENNA 3H1CA 4Y15A 1ENHA 2IGNA 3ZOBA 2NNNA 4C2UA 4ENKA 2KQRA 2KZVA 2KJCA 2NS0A 2DTZA 4UV9A 4Q5SF 3HUGA 4OINF 1NG7A 4Y17A 2TRTA 2GQQA 1A04A 1WHUA 3BTLA 4UNOA 2GXBA 2VPLA 2J5PA 2DYSH 2CQQA 1XMKA 1R5ID 1XPXA 1PP7U 2QQ8A 3K4MA 3ASNH 3GLLA 4D7MA 2OCCH 4LG0A 2XAFA 1XGOA 4BEHA 5DM6F 4A0ZA 3D1NI 2LKSA 4UY8I 4A3EJ 1U5TB 3T1BA 4A0YA 2QWWA 2W85A 2WY8Q 2VJ5A 4A0XA 1KONA 3TKYA 1RR7A 4MQ9F 3VFZA 3K4BA 1TBXA 4RB0A 3MKZA 2M4GA 2ADUA 4IHTA 2FXAA 2Y0MA 5ICEA 1N77A 1Y1VJ 1TLHB 1X1BA 2XAQA 1VQ6I 3CF5F 5E8IA 1UB9A 1IV8A 3M8JA 1Q1VA 3HB9A 3L2CA 2O8XA 3T8RA 1MMAA 3CO7C 4O5VA 3PNTA 5ILVA 1BOBA 3FXRA 4XN0A 5BQTA 2HTJA 1J0RA 2M0MA 4KN7X 4LLGF 4RAYA 1IRXA 5ICFA 1ZELA 1FZPB 1QNTA 1ACIA 2M30A 3GTOJ 3BPXA 1NG6A 4IZZA 3RPQA 4B43A 2R7QA 5KAFC 2M8GX 3HKZA 4HQEA 2A68F 3HOUJ 3P9CA 1Y39A 2FE3A 3OV8A 5DD8A 3RIRA 2X6XA 4NQWB 5GAHJ 2VLAA 5IP6A 1V5FA 2EB7A 2XB5A 1FMVA 4OWRB 4BHBA 2XC7A 3S2DJ 1BR1A 2WC2A 4N0BA 1ONVA 3ECHA 3GTJJ 5HNHA 3ZN1A 3NARA 5M3MJ 1W36C 5D8KB 3I4MJ 3JAMZ 1ZR2A 4A69C 4A2UA 2W25A 3ZR8X 2STTA 3K7AJ 2QQ9A 2X48A 3Q0UA 4M6VA 4EEFG 3PO2J 2QSFX 2NOGA 2QKMB 1PYVA 2L5QA 1S3JA 4E7IA 5LGNA 2QVOA 1ZH5A 3BR2A 2X6OA 4C3IJ 1A6QA 2OTJI 1LE8B 2G0EA 3LFUA 2W7NA 5IYBJ 4DW6A 3BZ6A 4FX0A 1RR8C 1USTA 2XASA 3RKQA 2AXTC 2R92J 2H8WA 2IBDA 1MW7A 2RGVA 3CCQI 1MIJA 4XL9A 2NS8A 4OIRF 2FF4A 2YS9A 1APLC 3ZMZA 2KRHA 1G3WA 2Q0OA 3SXYA 5EG0B 1G6NA 1AHDP 1XMAA 2EZLA 1Z3XA 2V26A 4B8XA 4WX9A 2BVLA 3UNGC 3NEUA 2B63J 2DOFA 4YIIA 2HQRA 1A36A 5IT3A 3S32A 3OIOA 1K7AA 5E79C 1JUMA 2QYOA 3M3YJ 1RESA 4KN4X 2KLOA 2E7WA 3KYDB 4ZJZA 5LEKA 1HKTA 2X1EA 3QP5A 3R4KA 3ECOA 4F55A 2DFHA 3DTEA 1J2XA 4JX5A 4IL6C 2IRFG 4BYYA 1T2KA 5TISC 4CHUA 2B0LA 2PG4A 1WI9A 2PQ8A 2R5ZB 2VBZA 1U2WA 3N97A 4I02A 3KLNA 2Q1ZB 4GDFA 4P1WA 1X1PA 5D5XB 4UUVA 3GTPJ 1FTZA 4CZCA 4P9FA 2GXAA 4L5JA 5H2FC 3J7AY 3CCJI 3I0TA 1YRNA 4LJZF 2AXLA 3ERMA 3V7SA 4MEYF 2D2WA 2ZMEB 1TNTA 4KIBA 3L9FA 4XOPA 1REPC 2MSYA 2LYCA 1YYVA 3DU6A 2VOOA 3WHBA 5F0CA 4EJTA 4IEJA 2CW8A 3OYFA 4CYCA 1LE8A 3E6MA 3TP3A 1B1BA 4XLHA 2X1DA 1IXRC 1OCZH 4XR6A 1U8RA 1UELB 1FYMA 4L9TA 2QSHX 3BTCA 2MABA 1KQ8A 1VI0A 4Y4RA 2WTEA 5KK1A 2ZJRF 1O4XA 3T5XA 2VUMJ 2G7UA 5HOOA 2OU2A 3RI4A 1SAXA 2DPUA 4CXFA 2L01A 2JMWA 4XKWA 1HDDC 3F22A 2R7WA 4M73A 2OQRA 2Z9OA 3PNVA 2DA7A 1E0EA 3ZP5A 3VEPA 1IXCA 2F5EA 1FX7A 4W97A 4E70A 1I50J 1UZCA 2O03A 3KEQA 1DP3A 1XDSA 1T0FA 1X58A 1WJBA 3VSKA 4Y7NJ 2NVQJ 1Y6IA 3K4JA 3P9KA 3OOPA 2ISYA 2DFFA 3HG9A 1TWAJ 2R5ZA 1TNSA 3I54A 1E2XA 4FHTA 3TBIA 3PSFA 4A3JJ 3PIOF 2JPBA 4D0PA 1I6HJ 3F21A 2FJ1A 1I3QJ 4CSWA 2HGCA 2K86A 5DM7F 1S6LA 2EZIA 2ZNZA 3J81Z 4HRIA 3NWTA 2DFIA 2EBIA 1XGSA 1JGGA 1S5LC 5DCFA 2STWA 4L5IA 1G2HA 3IKTA 3GTLJ 1S9HA 3IH4A 3LNQA 5HVQC 2Y9YA 2DJIA 5JI6A 2LTPA 2ETHA 2M9HA 2P5KA 3C2HA 2HS5A 3F0CA 2HZDA 3ZN0A 1YFHA 1FLIA 2MC4A 1KQ0A 1OYYA 4HX7A 3ZMTA 3S2HJ 4WCGA 3FX3A 1X19A 3DQVC 4L0YB 1BW5A 3FXKA 2PJRB 2MG4A 1RUNA 1EH6A 2LG4A 1YO5C 1MH4A 3QPTA 2M2EA 1ITYA 2VPRA 1T8IA 4H4KC 3JAMK 3MFKA 2HPMA 3RSNA 3P9IA 2QF7A 3CC4I 3E6DA 5LEJA 4B44A 4I0AA 2JWTA 2MD0A 1YHQI 2XSJC 2KIQA 2GBYA 2BGCA 3IC7A 4FASD 4M72A 1RC9A 3TW6A 4CCOA 1GVDA 1O3QA 3C2GA 3DEEA 4LIUA 2V6CA 3KP2A 1MMGA 2CW0F 1BI1A 2GAUA 3BR0A 2LP0A 5J8FA 2D5VA 4XM3A 3LSRA 1QPIA 2A05A 2JN6A 5D5UB 5CPRB 5CVVA 1QHHD 2KP6A 5J1RA 1FYLA 3GFLA 3R0JA 3SYTA 3TGNA 1ORKA 1K78B 1BN5A 4XKCA 4RB2C 3L00A 4HDUA 3BCBA 2NVTJ 4FQGA 5ICGA 5BOXA 1Z67A 3CCUI 4HOBA 4I01A 4GFBA 2DA5A 5D4RA 3WTXC 3HIFA 3DEWA 1A31A 3CMMA 4IO9F 4V2GA 1O3TA 3H5NA 2P6SA 5DDGA 2EFQA 4ZDOA 4KT5C 2PJRA 3GW2A 1IN5A 1SAUA 1ULYA 1WJDA 5D4SA 1DPRA 2QGUA 1YQAA 3JRBA 2DMNA 3K2ZA 4AC0A 1RNLA 2OA4A 5LRRA 4RGSA 3W2VA 3DXJF 1WJ5A 2DQLA 5HODA 2QZ8A 1YX5A 2BOLA 4IXAA 2DBBA 2FNPA 1OYWA 3KETA 5FFZA 4GXOA 2VBWA 5FROA 3V8JA 4P55A 2QLZA 2HZTA 4OIOF 1U5TC 3I3LA 5E3LA 5GADJ 1FBQA 2K9MA 3WE3A 1MMSA 1P2FA 3ABKH 5K5QA 4OOIA 2WAEA 3IAM2 4DJAA 4XLFA 1U9NA 2ZJ2A 4PFOA 1YOVB 5JFRA 3MCZA 1NK2P 1H9GA 4A3LJ 1YS7A 4FE7A 3GZNB 4KA4A 4O3MA 4Q4ZF 1R22A 1R36A 2PMUA 2XGEA 3K1PA 2Q8KA 2JSPA 3I55I 1O7FA 5CVIA 5DS9A 2WB1A 3H5AA 2OC6A 2A5WA 3IH2A 5EZHA 4AVZA 4IX7A 1FOKA 1SMTA 5GP9A 1IRGA 3LA3A 3ZPLA 1K61A 4QIWN 3TO7A 2WAFA 2DPDA 1EH8A 3Q3SA 5HDNA 4ENMA 1YW7A 4A3BJ 3JTHA 3ERED 4WXDA 3K4NA 3H3UA 1HKSA 3PUBA 3F8BA 2FA5A 3E6BA 4NC6A 3OYGA 2DMQA 3JRFA 1FOXA 4AD9A 4IHSA 2RV8A 1V54H 2RREA 4QPQA 5LD2C 3A0BC 4XIDA 2JJ7A 3H5RA 5ERIA 1VZ0A 4KDPA 3J81K 2KT0A 2IVMA 3M8EA 2VT2A 1KU2A 1HLVA 2DK5A 3QYBA 2EV0A 2IXSA 4AWXB 2X6WA 3L09A 2R7RA 4PK4A 4II3A 1GT0C 3P5JA 1Z05A 2H1LA 3HOSA 4NC8A 1WJCA 5F0HA 4WXHA 2Y48A 2E1MB 2YSRA 2DDAA 3QPLA 2W4SA 5J40A 1U9OA 1J59A 3O6BB 1OISA 2EWNA 3JRAA 2V1UA 4U0VA 2XROA 2GWRA 4FE4A 2MGQA 4MTEA 5L3CA 2M4KA 1ZN2A 1WJFA 2XGDA 4MEXF 4Y33A 3BQZA 4BDYA 3RYPA 3F9KA 1RPWA 2VJJA 4MNUA 3L2UA 1C0WA 3C18A 2DYRH 3LSKA 4ESFA 3CTAA 1HCRA 4UHTA 5EEHA 1H8AC 3W3CA 1OR7A 3GF2A 3ULQB 1IN8A 2HKOA 3WGHA 5F1RA 4QWQA 1H89C 4A3MJ 5FJ8J 4XQFA 2O61A 2HQ5A 3U21A 3JTGA 2Y9ZA 3RQIA 2VQGA 3LA2A 4JYKA 3MMYB 2G9WA 2ME6A 4XLNF 4BH9A 1V3FA 1RIOH 4KYWA 4L18B 2K3PA 1LNWA 4M9XA 4XNFA 4C2TA 2NVYJ 3SFIA 5L3BA 2QSGX 2FBHA 4J00A 2DAOA 5L3EA 2HPIA 1W7PA 2CO5A 4HBLA 1MSEC 2QBYB 2X51A 4PUSA 4UVCA 1WFXA 3FISA 3ZXSA 3IV5A 1QRYA 1CF7B 1IDYA 2ZMEC 3UKGA 2IS6A 2CW7A 1MJBA 3F72A 4M6YA 5H6QA 3K6GA 4BQQA 5LBQA 1TTYA 1GDTA 5E18F 2IT0A 2FNAA 3MZYA 3ABUA 2E71A 3WU2C 5BMZA 1KU9A 3ZMUA 5JHUA 5J8CA 3VPRA 4H0EA 3CMAI 4A3CJ 1W5SA 3OOUA 4J19A 2K7LA 3GMEA 3O2PE 4D9JA 1LFBA 4EATA 2YU9J 3DBRB 3RZOJ 1R23A 1TC3C 1KGSA 3R61A 4E6KG 1WPKA 2M5WA 2H94A 2NS7A 3CUOA 4HSRA 2LREA 3C1DA 1LDKB 4BGDA 1HKQA 2RKHA 2CUJA 2MD5A 4M3EA 1BR2A 1R4MB 1SFKA 3CUQC 4FTHA 2LMDA 3E3VA 1MMDA 3JSOA 3RZDJ 3FXLA 2KZGA 3H36A 1V4RA 5LGTA 5CYVA 3ABMH 2ZCWA 3JRCA 4PJNA 4CICA 1KU3A 1ETQA 3ABTA 3HUGB 1TWHJ 1ETKA 4MFEA 4I98B 1G3TA 1Z6TA 3DF8A 5CJ9A 4IQJA 4XLAA 3BG9A 2M45A 5HS7A 3ISPA 4I09A 5FGMA 2A6HF 4F3QA 2DT7B 3I58A 3EQLF 2XDVA 5FLVA 2Y69H 2JQ7A 2KJBA 4HNUA 4Y52J 2YPRA 4GO1A 5FKKA 4V2FA 4BEHB 1YJNI 2VC0A 2PFBA 3DPTA 2ZXWH 1XC5A 2CS3A 3DLLF 3R60A 2HYFA 2LF8A 5FKLA 2VKEA 5BS6A 1QHGA 1KZHA 1TWFJ 3PQJA 1O7LA 2MW8A 1MMNA 2BVMA 2Q2EA 4M3GA 3V7RA 4BJTA 2JUCA 3GFIA 3AG2H 2PN6A 3DKWA 2E2HJ 5M5WJ 1VNDA 2XRLA 3W2WA 4CUGA 2ZJQF 3F8FA 4RGUA 1STZA 2PEXA 4EJVA 4LB6B 4G6DA 4AIHA 1WGXA 4S04A 1OCRH 4ON0A 3CESA 3LSIA 1ETVA 2H6CA 1FPQA 2L4MA 2XPVA 1J9IA 1QZZA 2P0WA 4HPQA 4KNYA 2EZHA 3HSRA 4ZZDA 3BR5A 1I6XA 4HNVA 1KA8A 3CP2A 1TP4A 4L5EA 5LGUA 5IY5H 3FKIJ 1J5YA 4ZTJA 1P4XA 3BG7A 2UXXA 5LHHA 1X3ZB 3ZQLA 2EH3A 1X1DA 1IG7A 4OAYA 4BJ6C 2JA6J 1BOAA 2EA2A 3GTKJ 3WTSC 3PM1A 2HYGD 4BDZA 4MGRA 1EF4A 2E34A 2BY3A 2XGCA 1IN6A 2ID3A 2ZSHB 1MDMA 5D5VB 1H9TA 4IHVA 1ETYA 3ABLH 2ZKZA 3BZKA 3BJ6A 3ESWB 2ECCA 2JZYA 4BAYA 1IRZA 2DQRA 1R5HA 1YJWI 3O3KA 1W1WE 1T56A 1FY7A 3S2WA 3KYLA 1P7IA 2LDUA 1KU7A 1P9QC 4PZJA 4PFPA 4Z6YA 1DDNA 1O57A 1U6GA 5F08A 4EM1A 3HL2A 5HS8A 1D1AA 1DQUA 4FCYA 3LQRA 4IHXA 3DBLB 4BHPA 3KPHA 2K27A 4XRSA 4EGZA 1SFOJ 5ICCA 4BXFA 1SMYF 1RKWA 3CDIA 4X0GA 3LAPA 4KFCA 2KMUA 4CCJA 1JT6A 2XKOA 2E5NA 3K70D 4M3FA 3A03A 2AS5F 1X2NA 5FD5A 1AOYA 4XRMA 3OIPA 3K9TA 3Q0WA 2F48A 4CA0A 3BP8A 2VE9A 1KYWA 5TGTA 3KP7A 1Z6RA 3RPUD 1T38A 5JVTA 4RMNA 4BACA 1LFPA 3LMMA 5BPIA 1I27A 2LLKA 1IZ1A 1RZ4A 3CDHA 2NVUB 3KE2A 4BE0A 1FOWA 3VWBA 2EA4A 5E17F 2DA2A 4YRVA 2F2EA 4JX4A 3M9AA 4O6JA 2OJED 3RKXA 3Q9SA 1OCPA 3GUDA 2PLYA 1ZGWA 3D5LA 3DTKA 1YRNB 4OIPF 2HTSA 2DMUA 3NAUA 1OLTA 2GOXB 5C4XJ 5JLXA 4XLEA 4QSHA 5HLTA 5C44J 2NVXJ 4I99C 1R5GA 1F4KA 4UXNA 4YG2F 1I1SA 2KHMA 4CYCB 2VIXA 5E3MA 2HXIA 5E3OA 4E4HA 1UJ8A 3QYEA 2L2OA 3U9GA 4IHWA 3MKYB 2V1DA 2O5RA 3SZGA 1QBJA 1ZQ3P 3OYHA 2Y30A 4KIGA 1Y8QB 1LDJA 4G12A 5J47A 2CRGA 2KDOA 1W5TA 1BJAA 2KL4A 3VYUB 1B59A 1AA7A 1MNDA 3WG9A 2R4GA 4G9YA 5CQEA 4CCMA 3BTIA 4IOAF 3HEFA 3ASOH 3E0JB 2FMLA 2W82A 3GTGJ 1MBEA 5IT9K 1MD0A 1P7JA 2ZFWA 2W00A 4LB5A 3CJTB 3CLQA 3FWEA 2JPCA 3VYTB 2CMPA 2HDCA 1J75A 4DZJA 2V4JC 2LSOA 3CD6I 2K3FA 4RBOA 2IW5A 2AHQA 3GZ5A 4LMYA 4RS8A 3BOQA 2EPFA 4UB8C 4ENJA 5DEQA 4DYRA 3DKYA 2L54A 2ACJA
chains in the Genus database with same CATH topology
1MGTA 1ZGAA 4U7BA 3M1EA 1R7JA 4ZYHA 4M74A 4OIQF 2L02A 4GGGA 2CWEA 3WTVC 3QU6A 5AONA 1ZARA 4ZYGA 3I5UA 4NHJA 1LEAA 2WV0A 2D1HA 3I64A 2H6BA 5E1ZB 2FRHA 5DD4A 4HV5A 1LQ1A 2MH9A 2DI3A 3V8KA 2K4BA 1ZYRF 3DFGA 1D8JA 1R1TA 2OAZA 2FSWA 4HAMA 4EJWA 1FBUA 3KFWX 1XSVA 1B9NA 6PAXA 2BV6A 1ZG3A 5ILUA 5JR3A 1WKMA 1TW2A 4ZYEA 2ZO4A 4PDKA 1LB2A 4G94A 1HW1A 1WSUA 3SFZA 4ZZLA 4AIKA 3QU3A 2QENA 1IXSB 1BIAA 3M8FA 3EETA 3HRTA 4CGZA 5BPDA 2OBPA 1XSXA 2O0YA 4XSXF 2Z5UA 4GYGA 2O6GE 2A07F 3SZTA 4A12A 1VTNC 1SD7A 4A5MA 1P4AA 4ESJA 1H0MA 4IRGA 2VC1A 3IRRA 1RI7A 2KIMA 4LFUA 2CG4A 3E5UA 5LHIA 4NB5A 1SFUA 3J7AO 3TQNA 1QZYA 1D3YA 4KIFA 5CVJA 2EFOA 2YU3A 4Q47A 4ETSA 4XSZF 2QM3A 5F6FA 3F6VA 3KP6A 3CO6C 4S05A 2HKXA 3WGIA 2H27A 2K02A 2GA2A 1ZHFA 1WWXA 1KYZA 3TO9A 3AAFA 4CDGA 1OPCA 1UFMA 2VT3A 3DEUA 3RTRA 1BBYA 1XSDA 3WTUC 3GFJA 1XB4A 2JSCA 2ZNYA 1JXSA 1S8NA 4ASNA 1TQPA 2UZKA 4HZFA 2RC4A 1T98A 2W57A 4FT8A 5L3FA 2EV6A 1T6SA 2HOEA 1YW9A 1R58A 2P7VB 3BROA 3G3ZA 2O3FA 4HLYA 2QQAA 4BHCA 4OU0A 4G7ZF 3SZPA 2L3DA 1IN4A 2EFPA 2HQNA 4IF4A 2WWYA 2IP2A 3FXQA 1FC3A 2XUBA 3KP5A 2ESNA 1YLFA 3TDZC 4IVNA 3N4MA 2YR2A 2QUFA 3K0LA 1W7PB 4MQVA 2K4JA 3FXUA 2BBYA 5DUIA 1ZRFA 2G7HA 1Q1HA 3B73A 2W84A 4U88A 3HTUA 1U78A 3WODF 3LFKA 5D6EA 3GVAA 4K2EA 3GYHX 2EK5A 4HF2A 4GCVA 4YFKF 2IPQX 1S29A 3GXOA 2V1XA 1NHAA 2R7FA 4DNCA 4HYEA 1USSA 2ESHA 4AIJA 1J7KA 3E97A 3QPHA 2MLKA 3K69A 3EDPA 3F3XA 2J5OA 2L4AA 2TDXA 4Z2YA 4M9ZA 4UVBA 2ELHA 2RN7A 2Z99A 2KKOA 3NQOA 3B02A 1F9NA 4U0YA 4G6QA 2VOPA 3NRVA 1G3SA 5H6RA 4GYIA 2R7DA 1LDDA 3VB2A 1ON2A 1DP7P 2EFWA 4M71A 2GA1A 3FMSA 2P7CB 1FBSA 4U0WA 1YG2A 2W24A 1BI0A 3HTSB 4YFNF 3F6OA 2GZWA 2Z3YA 4HA8A 3U2RA 2E1CA 1KQ9A 1MJ9A 1WQ2A 2RQPA 1YS6A 2MA3A 3EYYA 4AVPA 1ZRDA 4XBFA 3TDUC 4RB3C 4EM2A 1QO0D 3LSTA 2GXGA 2XAJA 3BY6A 4U7DA 4IPAA 3COAC 1LEBA 1FSHA 1R1VA 4XRFA 1X3UA 3U1DA 2DK8A 2VONA 1BC8C 1OYIA 2FBIA 1MDMB 2MLGA 3GEZA 2VBXA 3VODA 4PGGA 2XV4S 2VN2A 3RJPA 2V9VA 4I2OA 1JHFA 1W7PD 4RAZA 5HS9A 2XAGA 1I5ZA 2GIVA 4M9SA 1IN7A 2XIGA 4WXCA 1UHMA 2CQKA 5E20A 3SQNA 2PJPA 3R6SA 4HW0A 3L7WA 1IRFA 2M1BA 4HQMA 3LQQA 3IKVA 5FB2A 1R1UA 3DV8A 4KMFA 5FLXZ 1BM9A 3CLOA 2EJRA 3M7GA 5HLGA 4G7OF 2KIFA 3I59B 4WK8F 2FU4A 2M87A 5D8LB 5E1XA 3JSPA 3HSFA 2P6TA 4DQ2A 4WF2A 4L0ZB 1SD5A 4JK1X 2A61A 1QGPA 1Z9CA 1LVAA 4EJOA 3HOTA 2PBIA 4YIFA 4LK0F 2P5LC 3ZMVA 2LNBA 3QP6A 3MWMA 2NNYA 4CYDA 1EH7A 1YTYA 1CGPA 1P4WA 3H3ZA 4LLNA 3BJOA 2OZ6A 1Y0UA 4Q48A 1G3YA 4RB1A 1GHCA 2H09A 4OMYA 3D0SA 3Q9VA 2IJLA 3QOPA 1IAWA 4IRIA 4M6XA 1R00A 2P8TA 3I59A 1GXQA 4UVAA 3GFMA 4QLCU 1W4MA 2YX7A 3LWFA 1ZG1A 1U3EM 1P6RA 5HDGA 3GO5A 1XDUA 5HLIA 1YIOA 4HF1A 3V4GA 4ZH4F 1U5TA 3F8MA 1UHWA 1S7AA 2XGXA 3K1MA 2DO7A 2P4WA 3BDDA 3MEXA 3KZYA 1SFXA 5DYMA 3SHFA 2IA1A 2DW4A 3HRMA 1S7OA 3R0AA 4ESBA 1FP1D 4EVIA 2NYXA 2DT5A 1FWZA 4P5OA 2FQ3A 1I1GA 1DPUA 1L0OC 3HHGA 3WTYC 2ZBKA 2FEZA 3HSEA 2OZUA 5EEGA 1OMIA 4IRHA 4A6EA 1Z1DA 4NQWA 2BEOA 2RNJA 5L3DA 2PMHA 3C3WA 2DLLA 2XAHA 4LD5A 1K6OA 1IF1A 4EMSA 4RGXA 2HEOA 4EGYA 2A3SA 4JQFA 1SFEA 1SD4A 1E17A 3E6CC 2EV5A 4KMUX 3ML6A 4HLXA 5FLXK 1XN7A 1ZRCA 1O3SA 4LK1F 3ELKA 1O3RA 1XCVA 2DTRA 5DUKA 2QQBA 1HXDA 3BWGA 3I4PA 3KP4A 5DV5A 2JTVA 1BIBA 4MTDA 3WTTC 2F5FA 2FBKA 1GVJA 4BXUA 3CUQB 3FM3A 1QQIA 1TQMA 1HW5A 2X4HA 4G8XA 5HLHA 1IW7F 3TO6A 2M8EA 4HDVA 2ZMEA 3EYIA 4R1HA 3JW4A 2BE5F 1PP8F 3REOA 2XKPA 4LLLA 2VE8A 1ZAOA 1BC7C 5H20A 3GX4X 3W6JB 2MH2A 2HWVA 2ISZA 2HR3A 3I53A 1BI3A 2P5VA 4LGWA 3TOAA 4CZZA 1MKMA 3BJAA 1EV7A 5CVRA 3GWZA 1B6AA 1AWCA 3KZZA 1XGMA 3IRQA 4R79A 3FF5A 3PFIA 1TQIA 3QRFF 3CUQA 4XLPF 1IUYA 1PDNC 3I71A 5D5WB 4L9VA 2LF7A 1JE8A 1HQCA 2V79A 3T0YA 2OD5A 4I0BA 5ILSA 3Q5FA 1F5TA 2C6YA 3HRSA 2RDPA 4KICA 3J80Z 4N9IA 5DCMB 5FFXA 3EUHA 4JBAA 5AIQA 2VXZA 1JHHA 1ZG5A 3G73A 1B4AA 2Y75A 4A5NA 5L3GA 1ODDA 2FMYA 2JT1A 1MJAA 3LAJA 4B09A 3DP7A 1FYKA 1F1ZA 4PCQA 3WU0A 4UV8A 3F8CA 5A2QZ 4P96A 1BI2A 1RUOA 1L3LA 2CFXA 2VBYA 5LHGA 5D6FA 3F23A 4BNCA 3WU1B 1XCBA 3RKYA 3K1NA 5FO5A 3RDIA 3E5XA 1FSEA 3IL2A 1QPMA 3ROUA 2EFNA 2RVCA 3BPVA 2COMA 1HBXG 5DCMA 4KUMA 5F64A 5K5OA 2BYVE 1K78A 1HSJA 2X0LA 5J6XA 2IA2A 2MBFA 3GZ6A 2IA0A 1PUEE 2NAZA 1D5VA 1WRJA 3IWZA 2A69F 2A5YB 2CGPA 1UCRA 2UXNA 1G4DA 1DUXC 3WTZA 2CSOA 4G7HF 4HX4A 2F5CA 2D1VA 3LA7A 2PI0A 4L9NA 3CJNA 2XHKA 3KEOA 1ZGJA 4RGRA 2FOKA 3DPLC 2HFHA 3FZVA 1XD7A 1ON1A 3VOEA 2Z33A 1YW8A 2R3SA 2ZXJA 5E1WA 2LKPA 2F5DA 3FMRA 1HW2A 1MZBA 3KLOA 4FX4A 4Y13A 4P9UA 2XVCA 3ZMDA 3HHHA 3RYRA 2D45A 1FNNA 5TRDA 4PGHA 3IHUA 3QAHA 3P7NA 5LLQA 3KP3A 1P92A 4WWCA 5CLSA 3V7CA 3C7JA 4EJUA 1K79A 4HV6A 1JGSA 5KVRA 4MHGA 3J80K 4R8HA 2DU9A 4ZYDA 3HRUA 3T8TA 1ZLJA 4CO8A 2KIUA 2OQGA 5E8GA 4BQAA 3MAJA 3WTWC 1ZLKA 3PQKA 2NRAC 4EM0B 4F7ZA 5K5RA 4HF0A 2E7XA 4IJAA 3GLXA 4EQQA 1XGNA 2UWMA 2XRNA 1B9MA 1FT9A 1D8KA 3H92A 5A2QK 1LJ9A 2E1NA 3FHZA 3F8NA 3WE2A 5ED4A 4HX8A 1OKRA 1GXPA 4OMZA 4YFXF 3MZHA 5IT9Z 4TV7A 5AIPA 3RKWA 2QBYA 1CF7A 1HSTA 5FD6A 3TOBA 4LG0B 3HYIA 3WGGA 5CVUA 4L9JA 4A6DA 2KRFA 3V8LA 1T39A 1Z91A 2CYYA 4I7HA 3ZMSA 3ZQ7A 3W6KB 4EV0A 3RPUA 5HDKA 2VODA 5K1YA 1ZREA 1Z7UA 3FM5A 5TJJA 1SD6A 2MC3A 3E5QA 2YX4A 2A6EF 3KCCA 3FMQA 1TW3A 2JRTA 4N9HA 1FP2A 5LRSA 3IWFA 3MQ0A 4ENNA 4Y15A 2NNNA 4ENKA 2KJCA 2NS0A 4UV9A 4Q5SF 3HUGA 4OINF 4Y17A 2GQQA 1A04A 4UNOA 2GXBA 2J5PA 1XMKA 1PP7U 4LG0A 2XAFA 1XGOA 4A0ZA 1U5TB 3T1BA 4A0YA 2QWWA 2W85A 4A0XA 3TKYA 4MQ9F 3VFZA 1TBXA 4RB0A 4IHTA 2ADUA 2FXAA 2Y0MA 5ICEA 1TLHB 2XAQA 5E8IA 1UB9A 3L2CA 2O8XA 3T8RA 3CO7C 4O5VA 5ILVA 3FXRA 5BQTA 2HTJA 1J0RA 4RAYA 4KN7X 4LLGF 5ICFA 1FZPB 1QNTA 2M30A 3BPXA 3RPQA 4HQEA 2A68F 3P9CA 2FE3A 5DD8A 3OV8A 3RIRA 2EB7A 4BHBA 2WC2A 4N0BA 1ONVA 3ECHA 3ZN1A 5D8KB 3JAMZ 4A2UA 2W25A 2STTA 2QQ9A 1S3JA 5LGNA 2QVOA 1ZH5A 3BZ6A 4FX0A 1USTA 2XASA 2RGVA 4OIRF 2FF4A 3ZMZA 1G3WA 2Q0OA 3SXYA 1G6NA 1XMAA 4B8XA 4WX9A 3NEUA 4YIIA 2HQRA 5IT3A 1K7AA 2QYOA 4KN4X 2E7WA 5LEKA 1HKTA 3QP5A 3R4KA 3ECOA 1J2XA 2IRFG 4BYYA 1T2KA 4CHUA 2B0LA 2PG4A 1WI9A 2PQ8A 2VBZA 1U2WA 3N97A 4I02A 3KLNA 5D5XB 4UUVA 4P9FA 4L5JA 3I0TA 4LJZF 2AXLA 3V7SA 4MEYF 2D2WA 2ZMEB 1TNTA 4KIBA 3L9FA 1REPC 1YYVA 2VOOA 4EJTA 3E6MA 1FYMA 1B1BA 1U8RA 1IXRC 4L9TA 1KQ8A 2WTEA 5KK1A 3T5XA 2G7UA 5HOOA 2OU2A 3RI4A 1SAXA 2DPUA 4CXFA 2L01A 3F22A 4M73A 2OQRA 2Z9OA 3ZP5A 3VEPA 1IXCA 2F5EA 1FX7A 4E70A 2O03A 3KEQA 1XDSA 1T0FA 3P9KA 3OOPA 2ISYA 1TNSA 3I54A 1E2XA 4FHTA 2JPBA 4D0PA 3F21A 2HGCA 2K86A 1S6LA 2ZNZA 3J81Z 2DFIA 1XGSA 5DCFA 2STWA 4L5IA 3IKTA 5HVQC 5JI6A 2ETHA 2P5KA 2HS5A 3ZN0A 1YFHA 1FLIA 1KQ0A 1OYYA 4HX7A 3ZMTA 4WCGA 3FX3A 3DQVC 4L0YB 1RUNA 1EH6A 1YO5C 3QPTA 3JAMK 3MFKA 3P9IA 3E6DA 5LEJA 4I0AA 2BGCA 3IC7A 4M72A 1O3QA 2V6CA 3KP2A 2CW0F 1BI1A 2GAUA 5J8FA 5D5UB 5CVVA 1FYLA 3GFLA 3R0JA 1K78B 3TGNA 1BN5A 4RB2C 3L00A 4HDUA 5ICGA 5BOXA 4HOBA 4I01A 5D4RA 3WTXC 3HIFA 1O3TA 2P6SA 5DDGA 2EFQA 4KT5C 3GW2A 1IN5A 1ULYA 5D4SA 1DPRA 1YQAA 3K2ZA 1RNLA 2OA4A 5LRRA 4RGSA 3DXJF 2DQLA 2QZ8A 4IXAA 2DBBA 2FNPA 1OYWA 3KETA 5FFZA 4GXOA 2VBWA 3V8JA 4OIOF 4P55A 2QLZA 2HZTA 1U5TC 1FBQA 3WE3A 1P2FA 5K5QA 4OOIA 2ZJ2A 5JFRA 3MCZA 1H9GA 1YS7A 4KA4A 4O3MA 4Q4ZF 1R22A 1R36A 2PMUA 3K1PA 2Q8KA 1O7FA 5CVIA 1FOKA 1SMTA 1IRGA 3LA3A 3ZPLA 3TO7A 2DPDA 1EH8A 5HDNA 4ENMA 1YW7A 3JTHA 3ERED 4WXDA 3H3UA 1HKSA 3F8BA 2FA5A 3E6BA 4AD9A 4IHSA 2RV8A 5ERIA 4KDPA 3J81K 2IVMA 3M8EA 2VT2A 1KU2A 2DK5A 2EV0A 4AWXB 3L09A 1Z05A 3HOSA 4WXHA 2Y48A 2YSRA 1J59A 3O6BB 2EWNA 2V1UA 4U0VA 2XROA 2GWRA 4MTEA 5L3CA 1ZN2A 4MEXF 3RYPA 4MNUA 1C0WA 3C18A 4ESFA 3CTAA 4UHTA 5EEHA 1OR7A 3GF2A 3ULQB 1IN8A 2HKOA 3WGHA 5F1RA 4QWQA 2O61A 3JTGA 3LA2A 4KYWA 2G9WA 4BH9A 4XLNF 1RIOH 1V3FA 4L18B 1LNWA 4M9XA 5L3BA 2FBHA 2DAOA 5L3EA 1W7PA 2CO5A 4HBLA 2QBYB 4UVCA 1CF7B 1MJBA 3F72A 4M6YA 5H6QA 5LBQA 1TTYA 5E18F 2IT0A 2FNAA 3MZYA 3ABUA 5BMZA 1KU9A 3ZMUA 5JHUA 5J8CA 4H0EA 1W5SA 2K7LA 3O2PE 1R23A 1KGSA 3R61A 3CUOA 2M5WA 2H94A 3C1DA 1LDKB 1HKQA 2RKHA 2MD5A 3CUQC 3E3VA 3JSOA 1V4RA 5LGTA 5CYVA 2ZCWA 4CICA 1KU3A 3ABTA 5CJ9A 4I98B 1G3TA 1Z6TA 3DF8A 2M45A 5HS7A 3ISPA 4I09A 5FGMA 2A6HF 3I58A 3EQLF 2KJBA 2YPRA 4GO1A 2VC0A 2PFBA 3DPTA 3R60A 2HYFA 2LF8A 5BS6A 3PQJA 1O7LA 3V7RA 2Q2EA 3GFIA 2PN6A 3DKWA 3F8FA 4RGUA 1STZA 2PEXA 4EJVA 4LB6B 4G6DA 4AIHA 4S04A 4ON0A 2H6CA 1FPQA 2L4MA 1J9IA 1QZZA 4KNYA 3HSRA 4ZZDA 1I6XA 1KA8A 5LGUA 1J5YA 1P4XA 2UXXA 5LHHA 1BOAA 2EA2A 3WTSC 2HYGD 4MGRA 1IN6A 1MDMA 5D5VB 1H9TA 2ZKZA 3BJ6A 2JZYA 4BAYA 2DQRA 1R5HA 3O3KA 1FY7A 3S2WA 2LDUA 1KU7A 4PZJA 1DDNA 1O57A 1U6GA 4EM1A 5HS8A 3LQRA 4BHPA 2K27A 4EGZA 5ICCA 1SMYF 4KFCA 3LAPA 2XKOA 2AS5F 1AOYA 5FD5A 3K9TA 2VE9A 3BP8A 1KYWA 3KP7A 1Z6RA 1T38A 5JVTA 5BPIA 1I27A 1IZ1A 1RZ4A 3CDHA 3KE2A 5E17F 2EA4A 2F2EA 3M9AA 4O6JA 3RKXA 3Q9SA 3GUDA 2PLYA 3D5LA 4OIPF 2HTSA 1R5GA 1F4KA 4UXNA 4YG2F 1I1SA 3U9GA 2V1DA 1QBJA 4KIGA 1LDJA 1W5TA 1BJAA 1B59A 3WG9A 4G9YA 2FMLA 5IT9K 1MD0A 2ZFWA 4LB5A 3FWEA 2JPCA 2HDCA 1J75A 2LSOA 2IW5A 4RS8A 3GZ5A 4LMYA 4ENJA 3BOQA 5DEQA 2L54A 2ACJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGT A;  1ZGA A;  4U7B A;  3M1E A;  1R7J A;  4ZYH A;  4M74 A;  4OIQ F;  2L02 A;  4GGG A;  2CWE A;  3WTV C;  3QU6 A;  5AON A;  1ZAR A;  4ZYG A;  3I5U A;  4NHJ A;  1LEA A;  2WV0 A;  2D1H A;  3I64 A;  2H6B A;  5E1Z B;  2FRH A;  5DD4 A;  4HV5 A;  1LQ1 A;  2MH9 A;  2DI3 A;  3V8K A;  2K4B A;  1ZYR F;  3DFG A;  1D8J A;  1R1T A;  2OAZ A;  2FSW A;  4HAM A;  4EJW A;  1FBU A;  3KFW X;  1XSV A;  1B9N A;  6PAX A;  2BV6 A;  1ZG3 A;  5ILU A;  5JR3 A;  1WKM A;  1TW2 A;  4ZYE A;  2ZO4 A;  4PDK A;  1LB2 A;  4G94 A;  1HW1 A;  1WSU A;  3SFZ A;  4ZZL A;  4AIK A;  3QU3 A;  2QEN A;  1IXS B;  1BIA A;  3M8F A;  3EET A;  3HRT A;  4CGZ A;  5BPD A;  2OBP A;  1XSX A;  2O0Y A;  4XSX F;  2Z5U A;  4GYG A;  2O6G E;  2A07 F;  3SZT A;  4A12 A;  1VTN C;  1SD7 A;  4A5M A;  1P4A A;  4ESJ A;  1H0M A;  4IRG A;  2VC1 A;  3IRR A;  1RI7 A;  2KIM A;  4LFU A;  2CG4 A;  3E5U A;  5LHI A;  4NB5 A;  1SFU A;  3J7A O;  3TQN A;  1QZY A;  1D3Y A;  4KIF A;  5CVJ A;  2EFO A;  2YU3 A;  4Q47 A;  4ETS A;  4XSZ F;  2QM3 A;  5F6F A;  3F6V A;  3KP6 A;  3CO6 C;  4S05 A;  2HKX A;  3WGI A;  2H27 A;  2K02 A;  2GA2 A;  1ZHF A;  1WWX A;  1KYZ A;  3TO9 A;  3AAF A;  4CDG A;  1OPC A;  1UFM A;  2VT3 A;  3DEU A;  3RTR A;  1BBY A;  1XSD A;  3WTU C;  3GFJ A;  1XB4 A;  2JSC A;  2ZNY A;  1JXS A;  1S8N A;  4ASN A;  1TQP A;  2UZK A;  4HZF A;  2RC4 A;  1T98 A;  2W57 A;  4FT8 A;  5L3F A;  2EV6 A;  1T6S A;  2HOE A;  1YW9 A;  1R58 A;  2P7V B;  3BRO A;  3G3Z A;  2O3F A;  4HLY A;  2QQA A;  4BHC A;  4OU0 A;  4G7Z F;  3SZP A;  2L3D A;  1IN4 A;  2EFP A;  2HQN A;  4IF4 A;  2WWY A;  2IP2 A;  3FXQ A;  1FC3 A;  2XUB A;  3KP5 A;  2ESN A;  1YLF A;  3TDZ C;  4IVN A;  3N4M A;  2YR2 A;  2QUF A;  3K0L A;  1W7P B;  4MQV A;  2K4J A;  3FXU A;  2BBY A;  5DUI A;  1ZRF A;  2G7H A;  1Q1H A;  3B73 A;  2W84 A;  4U88 A;  3HTU A;  1U78 A;  3WOD F;  3LFK A;  5D6E A;  3GVA A;  4K2E A;  3GYH X;  2EK5 A;  4HF2 A;  4GCV A;  4YFK F;  2IPQ X;  1S29 A;  3GXO A;  2V1X A;  1NHA A;  2R7F A;  4DNC A;  4HYE A;  1USS A;  2ESH A;  4AIJ A;  1J7K A;  3E97 A;  3QPH A;  2MLK A;  3K69 A;  3EDP A;  3F3X A;  2J5O A;  2L4A A;  2TDX A;  4Z2Y A;  4M9Z A;  4UVB A;  2ELH A;  2RN7 A;  2Z99 A;  2KKO A;  3NQO A;  3B02 A;  1F9N A;  4U0Y A;  4G6Q A;  2VOP A;  3NRV A;  1G3S A;  5H6R A;  4GYI A;  2R7D A;  1LDD A;  3VB2 A;  1ON2 A;  1DP7 P;  2EFW A;  4M71 A;  2GA1 A;  3FMS A;  2P7C B;  1FBS A;  4U0W A;  1YG2 A;  2W24 A;  1BI0 A;  3HTS B;  4YFN F;  3F6O A;  2GZW A;  2Z3Y A;  4HA8 A;  3U2R A;  2E1C A;  1KQ9 A;  1MJ9 A;  1WQ2 A;  2RQP A;  1YS6 A;  2MA3 A;  3EYY A;  4AVP A;  1ZRD A;  4XBF A;  3TDU C;  4RB3 C;  4EM2 A;  1QO0 D;  3LST A;  2GXG A;  2XAJ A;  3BY6 A;  4U7D A;  4IPA A;  3COA C;  1LEB A;  1FSH A;  1R1V A;  4XRF A;  1X3U A;  3U1D A;  2DK8 A;  2VON A;  1BC8 C;  1OYI A;  2FBI A;  1MDM B;  2MLG A;  3GEZ A;  2VBX A;  3VOD A;  4PGG A;  2XV4 S;  2VN2 A;  3RJP A;  2V9V A;  4I2O A;  1JHF A;  1W7P D;  4RAZ A;  5HS9 A;  2XAG A;  1I5Z A;  2GIV A;  4M9S A;  1IN7 A;  2XIG A;  4WXC A;  1UHM A;  2CQK A;  5E20 A;  3SQN A;  2PJP A;  3R6S A;  4HW0 A;  3L7W A;  1IRF A;  2M1B A;  4HQM A;  3LQQ A;  3IKV A;  5FB2 A;  1R1U A;  3DV8 A;  4KMF A;  5FLX Z;  1BM9 A;  3CLO A;  2EJR A;  3M7G A;  5HLG A;  4G7O F;  2KIF A;  3I59 B;  4WK8 F;  2FU4 A;  2M87 A;  5D8L B;  5E1X A;  3JSP A;  3HSF A;  2P6T A;  4DQ2 A;  4WF2 A;  4L0Z B;  1SD5 A;  4JK1 X;  2A61 A;  1QGP A;  1Z9C A;  1LVA A;  4EJO A;  3HOT A;  2PBI A;  4YIF A;  4LK0 F;  2P5L C;  3ZMV A;  2LNB A;  3QP6 A;  3MWM A;  2NNY A;  4CYD A;  1EH7 A;  1YTY A;  1CGP A;  1P4W A;  3H3Z A;  4LLN A;  3BJO A;  2OZ6 A;  1Y0U A;  4Q48 A;  1G3Y A;  4RB1 A;  1GHC A;  2H09 A;  4OMY A;  3D0S A;  3Q9V A;  2IJL A;  3QOP A;  1IAW A;  4IRI A;  4M6X A;  1R00 A;  2P8T A;  3I59 A;  1GXQ A;  4UVA A;  3GFM A;  4QLC U;  1W4M A;  2YX7 A;  3LWF A;  1ZG1 A;  1U3E M;  1P6R A;  5HDG A;  3GO5 A;  1XDU A;  5HLI A;  1YIO A;  4HF1 A;  3V4G A;  4ZH4 F;  1U5T A;  3F8M A;  1UHW A;  1S7A A;  2XGX A;  3K1M A;  2DO7 A;  2P4W A;  3BDD A;  3MEX A;  3KZY A;  1SFX A;  5DYM A;  3SHF A;  2IA1 A;  2DW4 A;  3HRM A;  1S7O A;  3R0A A;  4ESB A;  1FP1 D;  4EVI A;  2NYX A;  2DT5 A;  1FWZ A;  4P5O A;  2FQ3 A;  1I1G A;  1DPU A;  1L0O C;  3HHG A;  3WTY C;  2ZBK A;  2FEZ A;  3HSE A;  2OZU A;  5EEG A;  1OMI A;  4IRH A;  4A6E A;  1Z1D A;  4NQW A;  2BEO A;  2RNJ A;  5L3D A;  2PMH A;  3C3W A;  2DLL A;  2XAH A;  4LD5 A;  1K6O A;  1IF1 A;  4EMS A;  4RGX A;  2HEO A;  4EGY A;  2A3S A;  4JQF A;  1SFE A;  1SD4 A;  1E17 A;  3E6C C;  2EV5 A;  4KMU X;  3ML6 A;  4HLX A;  5FLX K;  1XN7 A;  1ZRC A;  1O3S A;  4LK1 F;  3ELK A;  1O3R A;  1XCV A;  2DTR A;  5DUK A;  2QQB A;  1HXD A;  3BWG A;  3I4P A;  3KP4 A;  5DV5 A;  2JTV A;  1BIB A;  4MTD A;  3WTT C;  2F5F A;  2FBK A;  1GVJ A;  4BXU A;  3CUQ B;  3FM3 A;  1QQI A;  1TQM A;  1HW5 A;  2X4H A;  4G8X A;  5HLH A;  1IW7 F;  3TO6 A;  2M8E A;  4HDV A;  2ZME A;  3EYI A;  4R1H A;  3JW4 A;  2BE5 F;  1PP8 F;  3REO A;  2XKP A;  4LLL A;  2VE8 A;  1ZAO A;  1BC7 C;  5H20 A;  3GX4 X;  3W6J B;  2MH2 A;  2HWV A;  2ISZ A;  2HR3 A;  3I53 A;  1BI3 A;  2P5V A;  4LGW A;  3TOA A;  4CZZ A;  1MKM A;  3BJA A;  1EV7 A;  5CVR A;  3GWZ A;  1B6A A;  1AWC A;  3KZZ A;  1XGM A;  3IRQ A;  4R79 A;  3FF5 A;  3PFI A;  1TQI A;  3QRF F;  3CUQ A;  4XLP F;  1IUY A;  1PDN C;  3I71 A;  5D5W B;  4L9V A;  2LF7 A;  1JE8 A;  1HQC A;  2V79 A;  3T0Y A;  2OD5 A;  4I0B A;  5ILS A;  3Q5F A;  1F5T A;  2C6Y A;  3HRS A;  2RDP A;  4KIC A;  3J80 Z;  4N9I A;  5DCM B;  5FFX A;  3EUH A;  4JBA A;  5AIQ A;  2VXZ A;  1JHH A;  1ZG5 A;  3G73 A;  1B4A A;  2Y75 A;  4A5N A;  5L3G A;  1ODD A;  2FMY A;  2JT1 A;  1MJA A;  3LAJ A;  4B09 A;  3DP7 A;  1FYK A;  1F1Z A;  4PCQ A;  3WU0 A;  4UV8 A;  3F8C A;  5A2Q Z;  4P96 A;  1BI2 A;  1RUO A;  1L3L A;  2CFX A;  2VBY A;  5LHG A;  5D6F A;  3F23 A;  4BNC A;  3WU1 B;  1XCB A;  3RKY A;  3K1N A;  5FO5 A;  3RDI A;  3E5X A;  1FSE A;  3IL2 A;  1QPM A;  3ROU A;  2EFN A;  2RVC A;  3BPV A;  2COM A;  1HBX G;  5DCM A;  4KUM A;  5F64 A;  5K5O A;  2BYV E;  1K78 A;  1HSJ A;  2X0L A;  5J6X A;  2IA2 A;  2MBF A;  3GZ6 A;  2IA0 A;  1PUE E;  2NAZ A;  1D5V A;  1WRJ A;  3IWZ A;  2A69 F;  2A5Y B;  2CGP A;  1UCR A;  2UXN A;  1G4D A;  1DUX C;  3WTZ A;  2CSO A;  4G7H F;  4HX4 A;  2F5C A;  2D1V A;  3LA7 A;  2PI0 A;  4L9N A;  3CJN A;  2XHK A;  3KEO A;  1ZGJ A;  4RGR A;  2FOK A;  3DPL C;  2HFH A;  3FZV A;  1XD7 A;  1ON1 A;  3VOE A;  2Z33 A;  1YW8 A;  2R3S A;  2ZXJ A;  5E1W A;  2LKP A;  2F5D A;  3FMR A;  1HW2 A;  1MZB A;  3KLO A;  4FX4 A;  4Y13 A;  4P9U A;  2XVC A;  3ZMD A;  3HHH A;  3RYR A;  2D45 A;  1FNN A;  5TRD A;  4PGH A;  3IHU A;  3QAH A;  3P7N A;  5LLQ A;  3KP3 A;  1P92 A;  4WWC A;  5CLS A;  3V7C A;  3C7J A;  4EJU A;  1K79 A;  4HV6 A;  1JGS A;  5KVR A;  4MHG A;  3J80 K;  4R8H A;  2DU9 A;  4ZYD A;  3HRU A;  3T8T A;  1ZLJ A;  4CO8 A;  2KIU A;  2OQG A;  5E8G A;  4BQA A;  3MAJ A;  3WTW C;  1ZLK A;  3PQK A;  2NRA C;  4EM0 B;  4F7Z A;  5K5R A;  4HF0 A;  2E7X A;  4IJA A;  3GLX A;  4EQQ A;  1XGN A;  2UWM A;  2XRN A;  1B9M A;  1FT9 A;  1D8K A;  3H92 A;  5A2Q K;  1LJ9 A;  2E1N A;  3FHZ A;  3F8N A;  3WE2 A;  5ED4 A;  4HX8 A;  1OKR A;  1GXP A;  4OMZ A;  4YFX F;  3MZH A;  5IT9 Z;  4TV7 A;  5AIP A;  3RKW A;  2QBY A;  1CF7 A;  1HST A;  5FD6 A;  3TOB A;  4LG0 B;  3HYI A;  3WGG A;  5CVU A;  4L9J A;  4A6D A;  2KRF A;  3V8L A;  1T39 A;  1Z91 A;  2CYY A;  4I7H A;  3ZMS A;  3ZQ7 A;  3W6K B;  4EV0 A;  3RPU A;  5HDK A;  2VOD A;  5K1Y A;  1ZRE A;  1Z7U A;  3FM5 A;  5TJJ A;  1SD6 A;  2MC3 A;  3E5Q A;  2YX4 A;  2A6E F;  3KCC A;  3FMQ A;  1TW3 A;  2JRT A;  4N9H A;  1FP2 A;  5LRS A;  3IWF A;  3MQ0 A;  4ENN A;  4Y15 A;  2NNN A;  4ENK A;  2KJC A;  2NS0 A;  4UV9 A;  4Q5S F;  3HUG A;  4OIN F;  4Y17 A;  2GQQ A;  1A04 A;  4UNO A;  2GXB A;  2J5P A;  1XMK A;  1PP7 U;  4LG0 A;  2XAF A;  1XGO A;  4A0Z A;  1U5T B;  3T1B A;  4A0Y A;  2QWW A;  2W85 A;  4A0X A;  3TKY A;  4MQ9 F;  3VFZ A;  1TBX A;  4RB0 A;  4IHT A;  2ADU A;  2FXA A;  2Y0M A;  5ICE A;  1TLH B;  2XAQ A;  5E8I A;  1UB9 A;  3L2C A;  2O8X A;  3T8R A;  3CO7 C;  4O5V A;  5ILV A;  3FXR A;  5BQT A;  2HTJ A;  1J0R A;  4RAY A;  4KN7 X;  4LLG F;  5ICF A;  1FZP B;  1QNT A;  2M30 A;  3BPX A;  3RPQ A;  4HQE A;  2A68 F;  3P9C A;  2FE3 A;  5DD8 A;  3OV8 A;  3RIR A;  2EB7 A;  4BHB A;  2WC2 A;  4N0B A;  1ONV A;  3ECH A;  3ZN1 A;  5D8K B;  3JAM Z;  4A2U A;  2W25 A;  2STT A;  2QQ9 A;  1S3J A;  5LGN A;  2QVO A;  1ZH5 A;  3BZ6 A;  4FX0 A;  1UST A;  2XAS A;  2RGV A;  4OIR F;  2FF4 A;  3ZMZ A;  1G3W A;  2Q0O A;  3SXY A;  1G6N A;  1XMA A;  4B8X A;  4WX9 A;  3NEU A;  4YII A;  2HQR A;  5IT3 A;  1K7A A;  2QYO A;  4KN4 X;  2E7W A;  5LEK A;  1HKT A;  3QP5 A;  3R4K A;  3ECO A;  1J2X A;  2IRF G;  4BYY A;  1T2K A;  4CHU A;  2B0L A;  2PG4 A;  1WI9 A;  2PQ8 A;  2VBZ A;  1U2W A;  3N97 A;  4I02 A;  3KLN A;  5D5X B;  4UUV A;  4P9F A;  4L5J A;  3I0T A;  4LJZ F;  2AXL A;  3V7S A;  4MEY F;  2D2W A;  2ZME B;  1TNT A;  4KIB A;  3L9F A;  1REP C;  1YYV A;  2VOO A;  4EJT A;  3E6M A;  1FYM A;  1B1B A;  1U8R A;  1IXR C;  4L9T A;  1KQ8 A;  2WTE A;  5KK1 A;  3T5X A;  2G7U A;  5HOO A;  2OU2 A;  3RI4 A;  1SAX A;  2DPU A;  4CXF A;  2L01 A;  3F22 A;  4M73 A;  2OQR A;  2Z9O A;  3ZP5 A;  3VEP A;  1IXC A;  2F5E A;  1FX7 A;  4E70 A;  2O03 A;  3KEQ A;  1XDS A;  1T0F A;  3P9K A;  3OOP A;  2ISY A;  1TNS A;  3I54 A;  1E2X A;  4FHT A;  2JPB A;  4D0P A;  3F21 A;  2HGC A;  2K86 A;  1S6L A;  2ZNZ A;  3J81 Z;  2DFI A;  1XGS A;  5DCF A;  2STW A;  4L5I A;  3IKT A;  5HVQ C;  5JI6 A;  2ETH A;  2P5K A;  2HS5 A;  3ZN0 A;  1YFH A;  1FLI A;  1KQ0 A;  1OYY A;  4HX7 A;  3ZMT A;  4WCG A;  3FX3 A;  3DQV C;  4L0Y B;  1RUN A;  1EH6 A;  1YO5 C;  3QPT A;  3JAM K;  3MFK A;  3P9I A;  3E6D A;  5LEJ A;  4I0A A;  2BGC A;  3IC7 A;  4M72 A;  1O3Q A;  2V6C A;  3KP2 A;  2CW0 F;  1BI1 A;  2GAU A;  5J8F A;  5D5U B;  5CVV A;  1FYL A;  3GFL A;  3R0J A;  1K78 B;  3TGN A;  1BN5 A;  4RB2 C;  3L00 A;  4HDU A;  5ICG A;  5BOX A;  4HOB A;  4I01 A;  5D4R A;  3WTX C;  3HIF A;  1O3T A;  2P6S A;  5DDG A;  2EFQ A;  4KT5 C;  3GW2 A;  1IN5 A;  1ULY A;  5D4S A;  1DPR A;  1YQA A;  3K2Z A;  1RNL A;  2OA4 A;  5LRR A;  4RGS A;  3DXJ F;  2DQL A;  2QZ8 A;  4IXA A;  2DBB A;  2FNP A;  1OYW A;  3KET A;  5FFZ A;  4GXO A;  2VBW A;  3V8J A;  4OIO F;  4P55 A;  2QLZ A;  2HZT A;  1U5T C;  1FBQ A;  3WE3 A;  1P2F A;  5K5Q A;  4OOI A;  2ZJ2 A;  5JFR A;  3MCZ A;  1H9G A;  1YS7 A;  4KA4 A;  4O3M A;  4Q4Z F;  1R22 A;  1R36 A;  2PMU A;  3K1P A;  2Q8K A;  1O7F A;  5CVI A;  1FOK A;  1SMT A;  1IRG A;  3LA3 A;  3ZPL A;  3TO7 A;  2DPD A;  1EH8 A;  5HDN A;  4ENM A;  1YW7 A;  3JTH A;  3ERE D;  4WXD A;  3H3U A;  1HKS A;  3F8B A;  2FA5 A;  3E6B A;  4AD9 A;  4IHS A;  2RV8 A;  5ERI A;  4KDP A;  3J81 K;  2IVM A;  3M8E A;  2VT2 A;  1KU2 A;  2DK5 A;  2EV0 A;  4AWX B;  3L09 A;  1Z05 A;  3HOS A;  4WXH A;  2Y48 A;  2YSR A;  1J59 A;  3O6B B;  2EWN A;  2V1U A;  4U0V A;  2XRO A;  2GWR A;  4MTE A;  5L3C A;  1ZN2 A;  4MEX F;  3RYP A;  4MNU A;  1C0W A;  3C18 A;  4ESF A;  3CTA A;  4UHT A;  5EEH A;  1OR7 A;  3GF2 A;  3ULQ B;  1IN8 A;  2HKO A;  3WGH A;  5F1R A;  4QWQ A;  2O61 A;  3JTG A;  3LA2 A;  4KYW A;  2G9W A;  4BH9 A;  4XLN F;  1RIO H;  1V3F A;  4L18 B;  1LNW A;  4M9X A;  5L3B A;  2FBH A;  2DAO A;  5L3E A;  1W7P A;  2CO5 A;  4HBL A;  2QBY B;  4UVC A;  1CF7 B;  1MJB A;  3F72 A;  4M6Y A;  5H6Q A;  5LBQ A;  1TTY A;  5E18 F;  2IT0 A;  2FNA A;  3MZY A;  3ABU A;  5BMZ A;  1KU9 A;  3ZMU A;  5JHU A;  5J8C A;  4H0E A;  1W5S A;  2K7L A;  3O2P E;  1R23 A;  1KGS A;  3R61 A;  3CUO A;  2M5W A;  2H94 A;  3C1D A;  1LDK B;  1HKQ A;  2RKH A;  2MD5 A;  3CUQ C;  3E3V A;  3JSO A;  1V4R A;  5LGT A;  5CYV A;  2ZCW A;  4CIC A;  1KU3 A;  3ABT A;  5CJ9 A;  4I98 B;  1G3T A;  1Z6T A;  3DF8 A;  2M45 A;  5HS7 A;  3ISP A;  4I09 A;  5FGM A;  2A6H F;  3I58 A;  3EQL F;  2KJB A;  2YPR A;  4GO1 A;  2VC0 A;  2PFB A;  3DPT A;  3R60 A;  2HYF A;  2LF8 A;  5BS6 A;  3PQJ A;  1O7L A;  3V7R A;  2Q2E A;  3GFI A;  2PN6 A;  3DKW A;  3F8F A;  4RGU A;  1STZ A;  2PEX A;  4EJV A;  4LB6 B;  4G6D A;  4AIH A;  4S04 A;  4ON0 A;  2H6C A;  1FPQ A;  2L4M A;  1J9I A;  1QZZ A;  4KNY A;  3HSR A;  4ZZD A;  1I6X A;  1KA8 A;  5LGU A;  1J5Y A;  1P4X A;  2UXX A;  5LHH A;  1BOA A;  2EA2 A;  3WTS C;  2HYG D;  4MGR A;  1IN6 A;  1MDM A;  5D5V B;  1H9T A;  2ZKZ A;  3BJ6 A;  2JZY A;  4BAY A;  2DQR A;  1R5H A;  3O3K A;  1FY7 A;  3S2W A;  2LDU A;  1KU7 A;  4PZJ A;  1DDN A;  1O57 A;  1U6G A;  4EM1 A;  5HS8 A;  3LQR A;  4BHP A;  2K27 A;  4EGZ A;  5ICC A;  1SMY F;  4KFC A;  3LAP A;  2XKO A;  2AS5 F;  1AOY A;  5FD5 A;  3K9T A;  2VE9 A;  3BP8 A;  1KYW A;  3KP7 A;  1Z6R A;  1T38 A;  5JVT A;  5BPI A;  1I27 A;  1IZ1 A;  1RZ4 A;  3CDH A;  3KE2 A;  5E17 F;  2EA4 A;  2F2E A;  3M9A A;  4O6J A;  3RKX A;  3Q9S A;  3GUD A;  2PLY A;  3D5L A;  4OIP F;  2HTS A;  1R5G A;  1F4K A;  4UXN A;  4YG2 F;  1I1S A;  3U9G A;  2V1D A;  1QBJ A;  4KIG A;  1LDJ A;  1W5T A;  1BJA A;  1B59 A;  3WG9 A;  4G9Y A;  2FML A;  5IT9 K;  1MD0 A;  2ZFW A;  4LB5 A;  3FWE A;  2JPC A;  2HDC A;  1J75 A;  2LSO A;  2IW5 A;  4RS8 A;  3GZ5 A;  4LMY A;  4ENJ A;  3BOQ A;  5DEQ A;  2L54 A;  2ACJ A; 
#chains in the Genus database with same CATH topology
 3LSG A;  1MGT A;  1ZGA A;  4B3X A;  4U7B A;  3M1E A;  4RAG A;  1R7J A;  1HOM A;  4ZYH A;  4M74 A;  3S93 A;  4OIQ F;  3HKZ N;  2BHZ A;  2L02 A;  4OAZ A;  2WY7 Q;  4LIT A;  4GGG A;  2CWE A;  1MH3 A;  3WTV C;  3QU6 A;  5AON A;  1ZAR A;  4ZYG A;  3I5U A;  3HDD A;  4NHJ A;  2LC2 A;  3OMY A;  4XMY A;  4BUP A;  1LEA A;  3MD2 A;  2WV0 A;  4PJJ A;  2D1H A;  3K2A A;  2L9N A;  1RRJ A;  3I64 A;  2WBM A;  2VQH A;  2H6B A;  4HNT A;  5E1Z B;  2EIK H;  2FRH A;  5DD4 A;  3FDY A;  2DOE A;  4HV5 A;  1LQ1 A;  2MH9 A;  2DI3 A;  1UG2 A;  2CQX A;  3V8K A;  2K4B A;  1GUU A;  1ZYR F;  3DFG A;  1D8J A;  1R1T A;  3S1M J;  4BY7 J;  2OAZ A;  2FSW A;  2HVR A;  3ZQC A;  1R71 A;  4HAM A;  4EJW A;  1FBU A;  3E1S A;  3KFW X;  1XSV A;  1B9N A;  6PAX A;  2OF7 A;  2M7B A;  2BV6 A;  3Q0V A;  1X4P A;  1JTX A;  1ZG3 A;  5ILU A;  2DA6 A;  1BW6 A;  1DU6 A;  3QWL A;  4BE1 A;  3K70 C;  5JR3 A;  5C4J J;  2FD5 A;  4E7J A;  1WKM A;  2XPU A;  3OR1 C;  4IHY A;  3H0G J;  3LSM A;  1TW2 A;  4ZDL A;  1HA8 A;  1WH5 A;  3FBI B;  2DA1 A;  2VKD A;  1IO2 A;  4RLQ A;  3JRG A;  4ZYE A;  4LIV A;  2CUZ A;  3DPU A;  1T08 B;  2ZO4 A;  3M4O J;  4PDK A;  1LB2 A;  2F4M B;  4G94 A;  1HW1 A;  2V6E A;  1WSU A;  3SFZ A;  4ZZL A;  4AIK A;  3QU3 A;  3OS1 A;  2F4I A;  2QEN A;  3BT9 A;  3FBN B;  1IXS B;  1BIA A;  3M8F A;  1X1C A;  3CC7 I;  3EET A;  4X1E A;  3HRT A;  1ZTR A;  4F92 B;  1N75 A;  4CGZ A;  4RM3 A;  1PVE A;  3FHN A;  2HDD A;  5BPD A;  2OBP A;  1XSX A;  2O0Y A;  4XSX F;  5J1Y A;  3KYC B;  2XF7 A;  2UUZ A;  2Z5U A;  4GYG A;  2O6G E;  2A07 F;  3SZT A;  4A12 A;  1YIJ I;  1VTN C;  1SD7 A;  4A5M A;  1SVL A;  5FKO A;  2B7E A;  2HU9 A;  2E2I J;  1DGW Y;  3OYE A;  1P4A A;  2X1C A;  5IOZ A;  4ESJ A;  1H0M A;  3A2K A;  4BQN A;  4G6T B;  3HGG A;  4XLC A;  4IRG A;  2VC1 A;  3G1O A;  3IRR A;  1RI7 A;  2KIM A;  4LFU A;  1IDZ A;  2CG4 A;  3E5U A;  5LHI A;  4NB5 A;  1SFU A;  3J7A O;  4PSW A;  4NUB A;  3TQN A;  2Y2Z A;  4N4O B;  1M1E B;  1QZY A;  1TZL A;  5FLM J;  1D3Y A;  3OYN A;  4KIF A;  5CVJ A;  3PNY A;  2EFO A;  2XB0 X;  2YU3 A;  2JA7 J;  3IP4 B;  4HEA 2;  5JHF A;  3G1L A;  3DBH B;  4FIS A;  4Q47 A;  4ETS A;  4XSZ F;  2QM3 A;  5F6F A;  5FKM A;  3OYM A;  4C2M J;  2W48 A;  4D5F A;  3F6V A;  5EYR A;  3KP6 A;  1K4S A;  3CO6 C;  1N25 A;  4S05 A;  1UHS A;  2HKX A;  3G1M A;  2DOD A;  2IGM A;  3RCO A;  3WGI A;  2H27 A;  2K02 A;  3MVP A;  1XMX A;  2E36 A;  2GA2 A;  1ZHF A;  1WWX A;  1WJA A;  1KYZ A;  4E7L A;  4ZC3 A;  5FRN A;  3TO9 A;  3AAF A;  4CDG A;  2JUG A;  1OPC A;  1UFM A;  1BA5 A;  2VT3 A;  3DEU A;  3RTR A;  1MNM C;  1BBY A;  1XSD A;  4I76 A;  1SEU A;  1T95 A;  3KZI C;  3WTU C;  3OYD A;  3GFJ A;  2OUM A;  3H35 A;  1XB4 A;  2CH0 A;  4BJ5 C;  2JSC A;  2ZNY A;  3ZQH A;  3IH3 A;  3K4C A;  1JXS A;  1S8N A;  4ASN A;  1TQP A;  3H0D A;  2UZK A;  5LFA A;  4HZF A;  2RC4 A;  1T98 A;  2E1O A;  1JKR C;  2W57 A;  4FT8 A;  5F1J A;  3OS0 A;  5L3F A;  1FIA A;  1E3O C;  2EV6 A;  4MO7 A;  1T6S A;  2L7K A;  2EIJ H;  2HOE A;  3RQ4 A;  4BL0 B;  1YW9 A;  1R58 A;  2L9V A;  1R4N B;  3S8P A;  2P7V B;  3BRO A;  2EIM H;  3AG1 H;  3G3Z A;  2O3F A;  4HLY A;  2QQA A;  2BZT A;  1Y8R B;  2F4O B;  3ONQ A;  4OU0 A;  4BHC A;  4CCN A;  4G7Z F;  3SZP A;  2QKL B;  4NC7 A;  3KIO A;  4C3H J;  1DGR M;  2L3D A;  1IN4 A;  1I3A A;  2EFP A;  1GV2 A;  2HQN A;  4JX6 A;  4IF4 A;  3U1K A;  2N8G A;  1NH3 A;  5E3N A;  2WWY A;  2IP2 A;  3FXQ A;  3CCM I;  1FC3 A;  1OCC H;  1LUJ B;  2DMP A;  2XUB A;  4RLF A;  3CC2 I;  2OCE A;  4Y3O A;  1MSF C;  3KP5 A;  2ESN A;  1G59 A;  1YLF A;  4A93 J;  1VQ4 I;  5IYC J;  4AU7 A;  4ITV A;  3HXL A;  3TDZ C;  1AU7 A;  2KFD A;  5J4V A;  2HQA A;  4A3K J;  1D0X A;  1U8B A;  4IVN A;  3N4M A;  2YR2 A;  2QUF A;  2R7Z J;  3K0L A;  1JT0 A;  2K5C A;  2COB A;  1VQ7 I;  2DXI A;  1W7P B;  4MQV A;  1K6Y A;  2K4J A;  3FXU A;  3DKX A;  2BBY A;  5DUI A;  4HST A;  3HC7 A;  3QPS A;  1ZRF A;  4F91 B;  3VYS B;  1FMW A;  2G7H A;  2FQ4 A;  1Q1H A;  3C2B A;  3B73 A;  5J4Y A;  2W84 A;  4U88 A;  2K9N A;  3HTU A;  1U78 A;  1Y0N A;  3WOD F;  3LFK A;  5D6E A;  2A6T A;  3GVA A;  4K2E A;  3ZQQ A;  1RET A;  3B6C A;  3GYH X;  2EK5 A;  4HF2 A;  3OL3 A;  3L2Q A;  4GCV A;  4YFK F;  2K9L A;  2IPQ X;  1S29 A;  2ECB A;  3GXO A;  2V1X A;  1ETO A;  1NHA A;  3TMO A;  2IS1 A;  3FXO A;  3OWT A;  2GLO A;  2XF5 A;  3S16 J;  2R7F A;  4DNC A;  4HYE A;  1USS A;  1EKE A;  2ESH A;  2M3A A;  4AIJ A;  3BZC A;  3BQY A;  1JUP A;  1J7K A;  3TW7 A;  1VQL I;  1D0Y A;  2IS4 A;  1IUF A;  4RAF A;  2BY1 A;  2BHY A;  3L2V A;  3E97 A;  3QPH A;  2M34 A;  3G71 I;  1T0F C;  2MLK A;  3K69 A;  2K85 A;  3EDP A;  3F3X A;  4MIM A;  3MKW B;  2J5O A;  2DT6 A;  2L4A A;  2TDX A;  1JUS A;  1OFC X;  4Z2Y A;  4XON A;  4M9Z A;  3SEQ A;  4UVB A;  4XRS G;  2ELH A;  3CCV I;  2RN7 A;  2Z99 A;  2KKO A;  3NQO A;  3B02 A;  1F9N A;  4U0Y A;  3DCF A;  3B6A A;  1A6I A;  4NDL A;  4G6Q A;  4RA2 A;  3NRV A;  2VOP A;  1G3S A;  5H6R A;  4GYI A;  2R7D A;  2H1K A;  1LDD A;  4KJZ A;  3SDG A;  3VB2 A;  4AM3 A;  1ON2 A;  3FKJ A;  1DP7 P;  2WB1 N;  2EFW A;  2NOJ B;  4M71 A;  3CCY A;  2I10 A;  2DA3 A;  2HVQ A;  4AYB A;  3KEY A;  2RQQ A;  2R7X A;  1OCT C;  1Z0X A;  2GA1 A;  4YEL A;  3PL8 A;  5J3L A;  2VAS A;  3I9V 2;  3FMS A;  2P7C B;  1FBS A;  4U0W A;  2KPM A;  1YG2 A;  1TWC J;  2VQL A;  2W24 A;  2Q2E B;  3PFY A;  2CV0 A;  1YIT I;  2CU7 A;  5B3S H;  3GTM J;  1BI0 A;  4I6Z A;  4C9Y A;  3HTS B;  4YFN F;  3F6O A;  3QOE A;  2GZW A;  5HNF A;  1UG0 A;  2Z3Y A;  4HA8 A;  3EPZ A;  2DN0 A;  3U2R A;  1IGN A;  3IUO A;  4S0H B;  5EF6 A;  3S17 J;  4PJ0 C;  4XKV A;  3JCU C;  2E1C A;  1KQ9 A;  1MJ9 A;  5KHD A;  1WQ2 A;  2F5V A;  2RQP A;  1YS6 A;  1JJ6 C;  4HG2 A;  2MA3 A;  3EYY A;  4AVP A;  3BR1 A;  1ZRD A;  2DCE A;  1VF9 A;  1WVR A;  2LFB A;  3AL0 B;  4XBF A;  3TDU C;  4BKX A;  2VJ4 A;  3W6V A;  4RB3 C;  4EM2 A;  1QO0 D;  2V9K A;  2GXG A;  2XAJ A;  3LST A;  4M3B A;  2BY0 A;  1W36 D;  3BY6 A;  2AQF A;  2DMT A;  1OQY A;  3H3V K;  4U7D A;  2EQR A;  4IPA A;  3COA C;  1LEB A;  1FSH A;  1R1V A;  4XRF A;  1X3U A;  3U1D A;  2DK8 A;  2HOA A;  2VON A;  1BC8 C;  1OYI A;  2FBI A;  3ZQF A;  4BXX J;  1MDM B;  2MLG A;  1ZKG A;  1MBH A;  3GEZ A;  3CP8 A;  2VBX A;  4BBR J;  3VOD A;  4PGG A;  2CJJ A;  3DLA A;  2XV4 S;  4BY1 J;  2IS2 A;  3EUH C;  2LOO A;  3E7L A;  2VN2 A;  3RJP A;  2V9V A;  4I2O A;  1V5E A;  2IGO A;  1JHF A;  1W7P D;  4RAZ A;  3ZCO A;  5HS9 A;  2XAG A;  1VFC A;  1I5Z A;  2K9S A;  2GIV A;  4M9S A;  1IN7 A;  1BR4 A;  2XIG A;  2ZB9 A;  4WXC A;  2ME0 A;  1UHM A;  2CQK A;  5E20 A;  2IAI A;  3SQN A;  2PJP A;  3VDX A;  2NXN B;  5IP7 J;  1VQ5 I;  3R6S A;  2L7M P;  2LH9 A;  5EEA A;  4HW0 A;  3LSH A;  2R7O A;  4GRI A;  1XG1 A;  4J01 A;  2ZXH A;  3J7Z I;  3O8G A;  3L7W A;  1IRF A;  2M1B A;  1IV6 A;  2RNG A;  4HQM A;  3OYC A;  3K10 A;  4UB6 C;  1QU3 A;  3LQQ A;  3IKV A;  5FB2 A;  5M5X J;  1R1U A;  1E3P A;  3DV8 A;  2R5Y A;  1UAA A;  5EDN A;  4KMF A;  5FLX Z;  2BXZ A;  4II2 A;  1OJL A;  1N78 A;  3JRE A;  1BM9 A;  3CLO A;  4XK4 A;  2PMZ A;  1PUF A;  2EJR A;  3M7G A;  5HLG A;  4G7O F;  4YIR X;  3JR9 A;  3GBG A;  3OS2 A;  4ZDP A;  2KIF A;  3OYB A;  4DGW B;  3S3O A;  3I59 B;  2F6C A;  4WK8 F;  1IC8 A;  2FU4 A;  2M87 A;  5D8L B;  5E1X A;  4QPO A;  3JSP A;  4XN3 A;  3HSF A;  4XKB A;  2P6T A;  5IOY A;  3HOY J;  2MYS A;  4WF2 A;  4DQ2 A;  3TP0 A;  4L0Z B;  1SD5 A;  4B48 A;  5C3E J;  3A02 A;  3FXJ A;  2HOS A;  4UUT A;  3S3N A;  2DJN A;  4JK1 X;  1JKQ C;  3ZRG A;  2A61 A;  1K83 J;  1QGP A;  1Z9C A;  1LVA A;  1SAN A;  4EJO A;  3K4K A;  3HOT A;  2PBI A;  1AKH A;  2V7F A;  3I56 I;  4YIF A;  4LK0 F;  2DDB A;  2H8R A;  4DBQ A;  3CCL I;  2P5L C;  2L9R A;  4KIT B;  1POG A;  2VL8 A;  3L2R A;  3L2W A;  1ERD A;  1R6R A;  3ZMV A;  2LNB A;  3QP6 A;  3MWM A;  2NNY A;  2YUS A;  3FK7 A;  4CYD A;  1EH7 A;  1YTY A;  2LY9 A;  1FJL A;  3CQZ J;  1CGP A;  1VQ9 I;  2OV7 A;  1P4W A;  2ZXI A;  3H3Z A;  4LLN A;  3BJO A;  2OZ6 A;  1Y0U A;  1QZE A;  4Q48 A;  1G3Y A;  1Z77 A;  4RB1 A;  1GHC A;  2H09 A;  4CCL A;  4OMY A;  3IAS 2;  2QEX I;  1WJE A;  3D0S A;  3OSG A;  2FOW A;  2IJL A;  3DWL E;  3Q9V A;  3QOP A;  3CME I;  1IAW A;  3FXM A;  1X1A A;  3CJQ B;  1R9T J;  4IRI A;  4M6X A;  1TT5 B;  1X2M A;  3BTJ A;  1R00 A;  2WAQ A;  2P8T A;  2E5Z A;  3HZJ A;  1BL0 A;  3S3M A;  3HOX J;  4B4C A;  3I59 A;  1GXQ A;  2Z2S B;  4UVA A;  1X4O A;  3GFM A;  4QLC U;  2MFZ A;  1W4M A;  2W1O A;  1Y1W J;  2YX7 A;  1B8I B;  2DFE A;  3LWF A;  1V5G A;  4IKF A;  3MZ8 A;  4UUS B;  1ZG1 A;  4IOC F;  3WG7 H;  4F93 B;  3W2A A;  2JVH A;  4D1Q A;  1I39 A;  1U3E M;  3OY9 A;  1P6R A;  5HDG A;  4MFD A;  1SVM A;  3GO5 A;  1XDU A;  5HLI A;  1YIO A;  4PJM A;  2HOT A;  4HF1 A;  3V4G A;  1OR7 C;  2Z16 A;  2EIN H;  3BG3 A;  4ZH4 F;  2PMZ N;  4DOZ A;  3OYI A;  3N05 A;  1U5T A;  2XSD C;  1QVT A;  2DA4 A;  1UHW A;  3F8M A;  1S7A A;  2XGX A;  3UR3 C;  3K1M A;  1FOY A;  2ELK A;  4B47 A;  2R7T A;  2DO7 A;  2P4W A;  3BDD A;  3H9J A;  3MEX A;  3KZY A;  1SFX A;  3AG4 H;  3OL4 A;  5DYM A;  2IA1 A;  2DW4 A;  3SHF A;  1FIP A;  3HRM A;  1S7O A;  2LRD A;  2LY1 A;  3HBL A;  1FP1 D;  3R0A A;  4ESB A;  4EVI A;  1PJR A;  4XIC A;  2NYX A;  2DT5 A;  1FWZ A;  4P5O A;  2FQ3 A;  1I1G A;  1DPU A;  1L0O C;  1ETW A;  3HHG A;  3OSF A;  1A5J A;  1LFU P;  3WTY C;  1GLN A;  2ZBK A;  2BW3 B;  2FEZ A;  3HSE A;  2OZU A;  5EEG A;  1OMI A;  4IRH A;  4A6E A;  1Z1D A;  3LSJ A;  2E1M C;  4NQW A;  1B8I A;  2LK2 A;  5GTH C;  2BEO A;  4F52 A;  3BG5 A;  3I4N J;  2RNJ A;  2WAD A;  2CV1 A;  4UUS A;  5L3D A;  2PMH A;  3C3W A;  2DLL A;  2XAH A;  4LD5 A;  2PX9 A;  1K6O A;  4BBS J;  1IF1 A;  4EMS A;  3PJR A;  2K9Q A;  4RGX A;  2HEO A;  5F27 A;  2A3S A;  4JQF A;  4EGY A;  1SFE A;  4ANJ A;  4N4N B;  1SD4 A;  1JKP C;  3E6C C;  1E17 A;  2EV5 A;  3JRD A;  2E2J J;  2V9P A;  3K4L A;  3X2Q H;  4KMU X;  1HF0 A;  3V42 A;  2WAQ N;  4W1U A;  1Z21 A;  4NBQ A;  3CZ6 A;  3ZQG A;  3ML6 A;  1LKX A;  4HLX A;  2Y0S A;  5FLX K;  2ZFU A;  1VQP I;  2Y31 A;  1XN7 A;  2VB6 A;  1ZRC A;  1O3S A;  3LL7 A;  4LK1 F;  3JRH A;  3ELK A;  3MKL A;  5EG0 A;  1O3R A;  1XCV A;  2R7U A;  3M1C A;  2DTR A;  5DUK A;  2X85 A;  3A4C A;  1Y56 A;  4LG3 A;  2RAE A;  4XOT A;  2QQB A;  2KDZ A;  3AFH A;  4JP0 A;  1HXD A;  3BWG A;  3GCM A;  3I4P A;  3KP4 A;  1VQO I;  4DIQ A;  2BW3 A;  1R49 A;  4PJL A;  5DV5 A;  4ZTF A;  2JTV A;  1BIB A;  4MTD A;  2ZJP F;  3WTT C;  2JA2 A;  1D5Y A;  2F5F A;  1H88 C;  2FBK A;  1GVJ A;  4BXU A;  4KIS A;  3H9G A;  1IJW C;  3OR2 C;  3CUQ B;  3FM3 A;  1QQI A;  2GM4 A;  1HW5 A;  1TQM A;  4E7S A;  1EJ9 A;  2X4H A;  4G8X A;  5IPA A;  2QA4 I;  3G4S I;  3JRI A;  4CCK A;  5HLH A;  3D5S C;  1G8X A;  3CF2 A;  4AUX A;  2LR8 A;  1IW7 F;  3TO6 A;  2WV1 A;  2IGK A;  2M8E A;  5GAG J;  2JK3 A;  5JLW A;  4HDV A;  2ZME A;  5GAE J;  1CQT A;  3CMY A;  2I8D A;  3EYI A;  2R0Q C;  4R1H A;  3JW4 A;  3S1Q J;  2O8K A;  2BE5 F;  4E7K A;  1PP8 F;  3EUA A;  3AL0 C;  3REO A;  1K4T A;  2ELJ A;  2CFO A;  3BG6 A;  2XKP A;  3NWS A;  4IQ4 A;  4LLL A;  2R7V A;  2VE8 A;  1ZAO A;  3TL4 X;  2OTL I;  1BC7 C;  5H20 A;  3GX4 X;  1VQ8 I;  5KAI C;  2XF6 A;  3HPH A;  3W6J B;  5FRM A;  2MH2 A;  2HWV A;  5CKT A;  3CCR I;  2ISZ A;  2HR3 A;  3I53 A;  1BI3 A;  2P5V A;  4LGW A;  3TOA A;  5EZG A;  4CZZ A;  1MKM A;  3BJA A;  1EV7 A;  5KNL A;  5CVR A;  5IYD J;  4X6A J;  3GWZ A;  1B6A A;  2E60 A;  4B3A A;  1AWC A;  3KZZ A;  1XGM A;  3J7Y J;  9ANT A;  3L1P A;  4LOC A;  2LBF B;  3IRQ A;  1WI3 A;  4R79 A;  3FF5 A;  3PFI A;  2Y0S N;  1TQI A;  3QRF F;  3OYA A;  1X3W B;  2XPW A;  3S1R J;  2QCO A;  3CUQ A;  4XLP F;  2VKH A;  1IUY A;  4RM2 A;  3M07 A;  5GPA A;  1PDN C;  4M3D A;  3I71 A;  3CJR B;  5D5W B;  1ZK8 A;  4L9V A;  2LF7 A;  4RDU A;  1HQC A;  2V79 A;  1JE8 A;  3T0Y A;  2OD5 A;  4I0B A;  5ILS A;  1YE9 A;  3Q5F A;  5KCM A;  1F5T A;  2C6Y A;  3G6E I;  4A3D J;  3HRS A;  2RDP A;  5K7F A;  5M3F J;  1VQK I;  4KIC A;  3J80 Z;  1QA6 A;  4N9I A;  5DCM B;  5FFX A;  3EUH A;  4JBA A;  4A3I J;  5AIQ A;  4BS9 A;  4B1R A;  2VXZ A;  4U87 A;  1JHH A;  2AQE A;  2AO9 A;  1ZG5 A;  3G73 A;  2KRC A;  1B4A A;  2Y75 A;  1Z7L A;  2XAU A;  4NNJ A;  4A5N A;  5L3G A;  1ODD A;  4V19 K;  2FMY A;  2JT1 A;  1MJA A;  3SJM A;  2HVS A;  3CDL A;  3FK6 A;  3LAJ A;  3SDB A;  2CQN A;  3QYF A;  2L7Z A;  4B09 A;  3DP7 A;  1FYK A;  1F1Z A;  4PCQ A;  4DYQ A;  1YX3 A;  3WU0 A;  5B1A H;  4C3J J;  3AG3 H;  3F8C A;  4UV8 A;  5FKN A;  5A2Q Z;  2ID6 A;  4P96 A;  2DOA A;  3A1Y A;  3OYK A;  1BI2 A;  3BLY A;  1UMQ A;  1L3L A;  2CFX A;  1RUO A;  1Z3Y A;  2LBF A;  5CQG A;  2VBY A;  3HM5 A;  2GOM A;  5LHG A;  3S15 J;  3SEZ A;  1VQM I;  1MNE A;  2WA0 A;  5D6F A;  2GIZ A;  3F23 A;  2JA8 J;  4E7H A;  4BNC A;  3BR6 A;  3WU1 B;  3H9Q A;  1XCB A;  2JVG A;  3RKY A;  3K1N A;  5FO5 A;  3RDI A;  1S7E A;  3E5X A;  4KT6 A;  1NTC A;  2VXD A;  1FSE A;  3IL2 A;  3A01 B;  5EGO B;  1QPM A;  2VKV A;  5GTI C;  3TED A;  4A3G J;  2E35 A;  3ROU A;  3AKZ A;  2EFN A;  3G2B A;  2RVC A;  3BPV A;  1ZR4 A;  4BQO A;  2HXO A;  2COM A;  1HBX G;  5DCM A;  3LOC A;  2X9D A;  4KUM A;  5F64 A;  5K5O A;  2BYV E;  3OIQ A;  1K78 A;  1U0J A;  3CCE I;  3PIP F;  3HOZ J;  1D0Z A;  3CCS I;  1F36 A;  1HSJ A;  5EJC A;  2X0L A;  5J6X A;  2IA2 A;  2MBF A;  3GZ6 A;  2IA0 A;  1PUE E;  2JA5 J;  2NAZ A;  1MBJ A;  1D5V A;  2LY2 A;  3BC8 A;  1WRJ A;  3IWZ A;  1SC7 A;  2A69 F;  2A5Y B;  2CGP A;  4XOR A;  4D7N A;  1UCR A;  2UXN A;  3PUF A;  2V1N A;  4FET A;  1G4D A;  1W0U A;  4JOM A;  1DUX C;  2IEK A;  2VQC A;  3WTZ A;  1WCM J;  2TCT A;  2CSO A;  1JTY A;  2P81 A;  5DTD A;  1JKO C;  4G7H F;  1VQN I;  4HX4 A;  2I5U A;  3DU5 A;  2F5C A;  1A35 A;  2D1V A;  3LA7 A;  3PSI A;  2HYJ A;  2EIL H;  2PI0 A;  4AID A;  1JJ8 C;  2ICW G;  4L9N A;  3GTQ J;  1XX5 A;  3S1N J;  3A01 A;  5EGO A;  3CJN A;  1ETX A;  1OCO H;  2L9S A;  3KX2 A;  1E3H A;  3HPG A;  3QOD A;  3FIW A;  3WHC A;  2XHK A;  3KEO A;  1ZGJ A;  2JRM A;  1J09 A;  4RGR A;  3PO3 J;  1FTT A;  5K7H A;  2FOK A;  3DPL C;  2UV1 A;  1NK3 P;  2HFH A;  1EA3 A;  3VSL A;  2CQ7 A;  2LKX A;  3BR3 A;  3FZV A;  1XD7 A;  1LPQ A;  1ON1 A;  3VOE A;  3OYL A;  1TL8 A;  2Z33 A;  1YW8 A;  3MN2 A;  2R3S A;  2ZXJ A;  5E1W A;  2Z1D A;  2LKP A;  4QTR A;  4D5C A;  2LD5 A;  2F5D A;  3FMR A;  1HW2 A;  1MZB A;  3KLO A;  2O9L A;  2ZC2 A;  4FX4 A;  5IP9 J;  1MBF A;  5BNG A;  4Y13 A;  2CUE A;  5B1B H;  4P9U A;  3LSP A;  2XVC A;  1XTA A;  3ZMD A;  2FX0 A;  3DTI A;  3HHH A;  3RYR A;  2HNH A;  3ZQI A;  2D45 A;  2BXY A;  1FNN A;  4DYC A;  3O8H A;  5TRD A;  4PGH A;  3VYR B;  3IHU A;  4YEJ A;  3QAH A;  3P7N A;  5LLQ A;  3KP3 A;  1P92 A;  4ABZ A;  4WWC A;  5CLS A;  3V7C A;  3C7J A;  4EJU A;  1K79 A;  2BY2 A;  4HV6 A;  1JGS A;  5KVR A;  4MHG A;  2VI6 A;  4CH7 A;  3J80 K;  2K40 A;  4R8H A;  1TT0 A;  1BJZ A;  2DU9 A;  3D5R C;  4ZYD A;  3HRU A;  3T8T A;  1ZLJ A;  4CO8 A;  1TWG J;  4C30 A;  2R93 J;  1D1C A;  1YJ9 I;  1HDP A;  2KIU A;  2OQG A;  5E8G A;  4BQA A;  1MBK A;  3MAJ A;  3WTW C;  1SVO A;  2KIS A;  1WZ2 A;  1ZLK A;  5K7Z A;  3PQK A;  1B72 B;  2NRA C;  4EM0 B;  5JVG F;  4A3F J;  4F7Z A;  5K5R A;  4HF0 A;  1DU0 A;  2E7X A;  4IJA A;  4BU2 A;  1GV5 A;  2R5Y B;  3GLX A;  4ZYA A;  4E7Z A;  4EQQ A;  1XGN A;  2UWM A;  2XRN A;  1B9M A;  1FT9 A;  1W5C C;  3ZGK A;  1D8K A;  2LVS A;  3H92 A;  1V55 H;  5A2Q K;  1PUF B;  1LJ9 A;  2E1N A;  4DZP A;  3BCA A;  1HC8 A;  1D1B A;  3FHZ A;  3HJE A;  4MLO A;  3F8N A;  3WE2 A;  2OPT A;  5ED4 A;  4HX8 A;  2X6Y A;  2CV2 A;  1OKR A;  2VJI A;  1RKT A;  2HI3 A;  5B66 C;  1GXP A;  2E19 A;  3S14 J;  2O7O A;  4OMZ A;  4YFX F;  3MZH A;  5IT9 Z;  4TV7 A;  1YI2 I;  5AIP A;  5J1U A;  3RKW A;  1S72 I;  2FUG 2;  2QBY A;  2M0C A;  1CF7 A;  1HST A;  5GPC A;  5FD6 A;  3TOB A;  1AKH B;  4LG0 B;  1XS9 A;  1F43 A;  3HYI A;  3WGG A;  1QVU A;  5CVU A;  5F04 A;  2B9S A;  3EUK L;  1T33 A;  2HDW A;  3HOW J;  4L9J A;  4A6D A;  2KRF A;  3OYJ A;  3HGY A;  3V8L A;  4AYB N;  4DBR A;  1T39 A;  1Z91 A;  4PSX A;  1LVK A;  2CYY A;  4I7H A;  3ZMS A;  3ZQ7 A;  3HOV J;  3W6K B;  4EV0 A;  3RPU A;  5HDK A;  5M5Y J;  2R7S A;  1B72 A;  2EZK A;  2VOD A;  5K1Y A;  2L7F P;  1ZRE A;  1Z7U A;  1JI8 A;  3FM5 A;  5TJJ A;  1FEX A;  1SD6 A;  2MC3 A;  2ZSI B;  1MBG A;  3E5Q A;  2YX4 A;  4BE2 A;  2A6E F;  3KCC A;  3FMQ A;  1TW3 A;  2JRT A;  2L0K A;  2CUF A;  3QQA A;  3A0H C;  4N9H A;  1FP2 A;  5LRS A;  1WH7 A;  1W0T A;  5F0F A;  3IWF A;  2M7A A;  5B5E C;  3MQ0 A;  4ENN A;  3H1C A;  4Y15 A;  1ENH A;  2IGN A;  3ZOB A;  2NNN A;  4C2U A;  4ENK A;  2KQR A;  2KZV A;  2KJC A;  2NS0 A;  2DTZ A;  4UV9 A;  4Q5S F;  3HUG A;  4OIN F;  1NG7 A;  4Y17 A;  2TRT A;  2GQQ A;  1A04 A;  1WHU A;  3BTL A;  4UNO A;  2GXB A;  2VPL A;  2J5P A;  2DYS H;  2CQQ A;  1XMK A;  1R5I D;  1XPX A;  1PP7 U;  2QQ8 A;  3K4M A;  3ASN H;  3GLL A;  4D7M A;  2OCC H;  4LG0 A;  2XAF A;  1XGO A;  4BEH A;  5DM6 F;  4A0Z A;  3D1N I;  2LKS A;  4UY8 I;  4A3E J;  1U5T B;  3T1B A;  4A0Y A;  2QWW A;  2W85 A;  2WY8 Q;  2VJ5 A;  4A0X A;  1KON A;  3TKY A;  1RR7 A;  4MQ9 F;  3VFZ A;  3K4B A;  1TBX A;  4RB0 A;  3MKZ A;  2M4G A;  2ADU A;  4IHT A;  2FXA A;  2Y0M A;  5ICE A;  1N77 A;  1Y1V J;  1TLH B;  1X1B A;  2XAQ A;  1VQ6 I;  3CF5 F;  5E8I A;  1UB9 A;  1IV8 A;  3M8J A;  1Q1V A;  3HB9 A;  3L2C A;  2O8X A;  3T8R A;  1MMA A;  3CO7 C;  4O5V A;  3PNT A;  5ILV A;  1BOB A;  3FXR A;  4XN0 A;  5BQT A;  2HTJ A;  1J0R A;  2M0M A;  4KN7 X;  4LLG F;  4RAY A;  1IRX A;  5ICF A;  1ZEL A;  1FZP B;  1QNT A;  1ACI A;  2M30 A;  3GTO J;  3BPX A;  1NG6 A;  4IZZ A;  3RPQ A;  4B43 A;  2R7Q A;  5KAF C;  2M8G X;  3HKZ A;  4HQE A;  2A68 F;  3HOU J;  3P9C A;  1Y39 A;  2FE3 A;  3OV8 A;  5DD8 A;  3RIR A;  2X6X A;  4NQW B;  5GAH J;  2VLA A;  5IP6 A;  1V5F A;  2EB7 A;  2XB5 A;  1FMV A;  4OWR B;  4BHB A;  2XC7 A;  3S2D J;  1BR1 A;  2WC2 A;  4N0B A;  1ONV A;  3ECH A;  3GTJ J;  5HNH A;  3ZN1 A;  3NAR A;  5M3M J;  1W36 C;  5D8K B;  3I4M J;  3JAM Z;  1ZR2 A;  4A69 C;  4A2U A;  2W25 A;  3ZR8 X;  2STT A;  3K7A J;  2QQ9 A;  2X48 A;  3Q0U A;  4M6V A;  4EEF G;  3PO2 J;  2QSF X;  2NOG A;  2QKM B;  1PYV A;  2L5Q A;  1S3J A;  4E7I A;  5LGN A;  2QVO A;  1ZH5 A;  3BR2 A;  2X6O A;  4C3I J;  1A6Q A;  2OTJ I;  1LE8 B;  2G0E A;  3LFU A;  2W7N A;  5IYB J;  4DW6 A;  3BZ6 A;  4FX0 A;  1RR8 C;  1UST A;  2XAS A;  3RKQ A;  2AXT C;  2R92 J;  2H8W A;  2IBD A;  1MW7 A;  2RGV A;  3CCQ I;  1MIJ A;  4XL9 A;  2NS8 A;  4OIR F;  2FF4 A;  2YS9 A;  1APL C;  3ZMZ A;  2KRH A;  1G3W A;  2Q0O A;  3SXY A;  5EG0 B;  1G6N A;  1AHD P;  1XMA A;  2EZL A;  1Z3X A;  2V26 A;  4B8X A;  4WX9 A;  2BVL A;  3UNG C;  3NEU A;  2B63 J;  2DOF A;  4YII A;  2HQR A;  1A36 A;  5IT3 A;  3S32 A;  3OIO A;  1K7A A;  5E79 C;  1JUM A;  2QYO A;  3M3Y J;  1RES A;  4KN4 X;  2KLO A;  2E7W A;  3KYD B;  4ZJZ A;  5LEK A;  1HKT A;  2X1E A;  3QP5 A;  3R4K A;  3ECO A;  4F55 A;  2DFH A;  3DTE A;  1J2X A;  4JX5 A;  4IL6 C;  2IRF G;  4BYY A;  1T2K A;  5TIS C;  4CHU A;  2B0L A;  2PG4 A;  1WI9 A;  2PQ8 A;  2R5Z B;  2VBZ A;  1U2W A;  3N97 A;  4I02 A;  3KLN A;  2Q1Z B;  4GDF A;  4P1W A;  1X1P A;  5D5X B;  4UUV A;  3GTP J;  1FTZ A;  4CZC A;  4P9F A;  2GXA A;  4L5J A;  5H2F C;  3J7A Y;  3CCJ I;  3I0T A;  1YRN A;  4LJZ F;  2AXL A;  3ERM A;  3V7S A;  4MEY F;  2D2W A;  2ZME B;  1TNT A;  4KIB A;  3L9F A;  4XOP A;  1REP C;  2MSY A;  2LYC A;  1YYV A;  3DU6 A;  2VOO A;  3WHB A;  5F0C A;  4EJT A;  4IEJ A;  2CW8 A;  3OYF A;  4CYC A;  1LE8 A;  3E6M A;  3TP3 A;  1B1B A;  4XLH A;  2X1D A;  1IXR C;  1OCZ H;  4XR6 A;  1U8R A;  1UEL B;  1FYM A;  4L9T A;  2QSH X;  3BTC A;  2MAB A;  1KQ8 A;  1VI0 A;  4Y4R A;  2WTE A;  5KK1 A;  2ZJR F;  1O4X A;  3T5X A;  2VUM J;  2G7U A;  5HOO A;  2OU2 A;  3RI4 A;  1SAX A;  2DPU A;  4CXF A;  2L01 A;  2JMW A;  4XKW A;  1HDD C;  3F22 A;  2R7W A;  4M73 A;  2OQR A;  2Z9O A;  3PNV A;  2DA7 A;  1E0E A;  3ZP5 A;  3VEP A;  1IXC A;  2F5E A;  1FX7 A;  4W97 A;  4E70 A;  1I50 J;  1UZC A;  2O03 A;  3KEQ A;  1DP3 A;  1XDS A;  1T0F A;  1X58 A;  1WJB A;  3VSK A;  4Y7N J;  2NVQ J;  1Y6I A;  3K4J A;  3P9K A;  3OOP A;  2ISY A;  2DFF A;  3HG9 A;  1TWA J;  2R5Z A;  1TNS A;  3I54 A;  1E2X A;  4FHT A;  3TBI A;  3PSF A;  4A3J J;  3PIO F;  2JPB A;  4D0P A;  1I6H J;  3F21 A;  2FJ1 A;  1I3Q J;  4CSW A;  2HGC A;  2K86 A;  5DM7 F;  1S6L A;  2EZI A;  2ZNZ A;  3J81 Z;  4HRI A;  3NWT A;  2DFI A;  2EBI A;  1XGS A;  1JGG A;  1S5L C;  5DCF A;  2STW A;  4L5I A;  1G2H A;  3IKT A;  3GTL J;  1S9H A;  3IH4 A;  3LNQ A;  5HVQ C;  2Y9Y A;  2DJI A;  5JI6 A;  2LTP A;  2ETH A;  2M9H A;  2P5K A;  3C2H A;  2HS5 A;  3F0C A;  2HZD A;  3ZN0 A;  1YFH A;  1FLI A;  2MC4 A;  1KQ0 A;  1OYY A;  4HX7 A;  3ZMT A;  3S2H J;  4WCG A;  3FX3 A;  1X19 A;  3DQV C;  4L0Y B;  1BW5 A;  3FXK A;  2PJR B;  2MG4 A;  1RUN A;  1EH6 A;  2LG4 A;  1YO5 C;  1MH4 A;  3QPT A;  2M2E A;  1ITY A;  2VPR A;  1T8I A;  4H4K C;  3JAM K;  3MFK A;  2HPM A;  3RSN A;  3P9I A;  2QF7 A;  3CC4 I;  3E6D A;  5LEJ A;  4B44 A;  4I0A A;  2JWT A;  2MD0 A;  1YHQ I;  2XSJ C;  2KIQ A;  2GBY A;  2BGC A;  3IC7 A;  4FAS D;  4M72 A;  1RC9 A;  3TW6 A;  4CCO A;  1GVD A;  1O3Q A;  3C2G A;  3DEE A;  4LIU A;  2V6C A;  3KP2 A;  1MMG A;  2CW0 F;  1BI1 A;  2GAU A;  3BR0 A;  2LP0 A;  5J8F A;  2D5V A;  4XM3 A;  3LSR A;  1QPI A;  2A05 A;  2JN6 A;  5D5U B;  5CPR B;  5CVV A;  1QHH D;  2KP6 A;  5J1R A;  1FYL A;  3GFL A;  3R0J A;  3SYT A;  3TGN A;  1ORK A;  1K78 B;  1BN5 A;  4XKC A;  4RB2 C;  3L00 A;  4HDU A;  3BCB A;  2NVT J;  4FQG A;  5ICG A;  5BOX A;  1Z67 A;  3CCU I;  4HOB A;  4I01 A;  4GFB A;  2DA5 A;  5D4R A;  3WTX C;  3HIF A;  3DEW A;  1A31 A;  3CMM A;  4IO9 F;  4V2G A;  1O3T A;  3H5N A;  2P6S A;  5DDG A;  2EFQ A;  4ZDO A;  4KT5 C;  2PJR A;  3GW2 A;  1IN5 A;  1SAU A;  1ULY A;  1WJD A;  5D4S A;  1DPR A;  2QGU A;  1YQA A;  3JRB A;  2DMN A;  3K2Z A;  4AC0 A;  1RNL A;  2OA4 A;  5LRR A;  4RGS A;  3W2V A;  3DXJ F;  1WJ5 A;  2DQL A;  5HOD A;  2QZ8 A;  1YX5 A;  2BOL A;  4IXA A;  2DBB A;  2FNP A;  1OYW A;  3KET A;  5FFZ A;  4GXO A;  2VBW A;  5FRO A;  3V8J A;  4P55 A;  2QLZ A;  2HZT A;  4OIO F;  1U5T C;  3I3L A;  5E3L A;  5GAD J;  1FBQ A;  2K9M A;  3WE3 A;  1MMS A;  1P2F A;  3ABK H;  5K5Q A;  4OOI A;  2WAE A;  3IAM 2;  4DJA A;  4XLF A;  1U9N A;  2ZJ2 A;  4PFO A;  1YOV B;  5JFR A;  3MCZ A;  1NK2 P;  1H9G A;  4A3L J;  1YS7 A;  4FE7 A;  3GZN B;  4KA4 A;  4O3M A;  4Q4Z F;  1R22 A;  1R36 A;  2PMU A;  2XGE A;  3K1P A;  2Q8K A;  2JSP A;  3I55 I;  1O7F A;  5CVI A;  5DS9 A;  2WB1 A;  3H5A A;  2OC6 A;  2A5W A;  3IH2 A;  5EZH A;  4AVZ A;  4IX7 A;  1FOK A;  1SMT A;  5GP9 A;  1IRG A;  3LA3 A;  3ZPL A;  1K61 A;  4QIW N;  3TO7 A;  2WAF A;  2DPD A;  1EH8 A;  3Q3S A;  5HDN A;  4ENM A;  1YW7 A;  4A3B J;  3JTH A;  3ERE D;  4WXD A;  3K4N A;  3H3U A;  1HKS A;  3PUB A;  3F8B A;  2FA5 A;  3E6B A;  4NC6 A;  3OYG A;  2DMQ A;  3JRF A;  1FOX A;  4AD9 A;  4IHS A;  2RV8 A;  1V54 H;  2RRE A;  4QPQ A;  5LD2 C;  3A0B C;  4XID A;  2JJ7 A;  3H5R A;  5ERI A;  1VZ0 A;  4KDP A;  3J81 K;  2KT0 A;  2IVM A;  3M8E A;  2VT2 A;  1KU2 A;  1HLV A;  2DK5 A;  3QYB A;  2EV0 A;  2IXS A;  4AWX B;  2X6W A;  3L09 A;  2R7R A;  4PK4 A;  4II3 A;  1GT0 C;  3P5J A;  1Z05 A;  2H1L A;  3HOS A;  4NC8 A;  1WJC A;  5F0H A;  4WXH A;  2Y48 A;  2E1M B;  2YSR A;  2DDA A;  3QPL A;  2W4S A;  5J40 A;  1U9O A;  1J59 A;  3O6B B;  1OIS A;  2EWN A;  3JRA A;  2V1U A;  4U0V A;  2XRO A;  2GWR A;  4FE4 A;  2MGQ A;  4MTE A;  5L3C A;  2M4K A;  1ZN2 A;  1WJF A;  2XGD A;  4MEX F;  4Y33 A;  3BQZ A;  4BDY A;  3RYP A;  3F9K A;  1RPW A;  2VJJ A;  4MNU A;  3L2U A;  1C0W A;  3C18 A;  2DYR H;  3LSK A;  4ESF A;  3CTA A;  1HCR A;  4UHT A;  5EEH A;  1H8A C;  3W3C A;  1OR7 A;  3GF2 A;  3ULQ B;  1IN8 A;  2HKO A;  3WGH A;  5F1R A;  4QWQ A;  1H89 C;  4A3M J;  5FJ8 J;  4XQF A;  2O61 A;  2HQ5 A;  3U21 A;  3JTG A;  2Y9Z A;  3RQI A;  2VQG A;  3LA2 A;  4JYK A;  3MMY B;  2G9W A;  2ME6 A;  4XLN F;  4BH9 A;  1V3F A;  1RIO H;  4KYW A;  4L18 B;  2K3P A;  1LNW A;  4M9X A;  4XNF A;  4C2T A;  2NVY J;  3SFI A;  5L3B A;  2QSG X;  2FBH A;  4J00 A;  2DAO A;  5L3E A;  2HPI A;  1W7P A;  2CO5 A;  4HBL A;  1MSE C;  2QBY B;  2X51 A;  4PUS A;  4UVC A;  1WFX A;  3FIS A;  3ZXS A;  3IV5 A;  1QRY A;  1CF7 B;  1IDY A;  2ZME C;  3UKG A;  2IS6 A;  2CW7 A;  1MJB A;  3F72 A;  4M6Y A;  5H6Q A;  3K6G A;  4BQQ A;  5LBQ A;  1TTY A;  1GDT A;  5E18 F;  2IT0 A;  2FNA A;  3MZY A;  3ABU A;  2E71 A;  3WU2 C;  5BMZ A;  1KU9 A;  3ZMU A;  5JHU A;  5J8C A;  3VPR A;  4H0E A;  3CMA I;  4A3C J;  1W5S A;  3OOU A;  4J19 A;  2K7L A;  3GME A;  3O2P E;  4D9J A;  1LFB A;  4EAT A;  2YU9 J;  3DBR B;  3RZO J;  1R23 A;  1TC3 C;  1KGS A;  3R61 A;  4E6K G;  1WPK A;  2M5W A;  2H94 A;  2NS7 A;  3CUO A;  4HSR A;  2LRE A;  3C1D A;  1LDK B;  4BGD A;  1HKQ A;  2RKH A;  2CUJ A;  2MD5 A;  4M3E A;  1BR2 A;  1R4M B;  1SFK A;  3CUQ C;  4FTH A;  2LMD A;  3E3V A;  1MMD A;  3JSO A;  3RZD J;  3FXL A;  2KZG A;  3H36 A;  1V4R A;  5LGT A;  5CYV A;  3ABM H;  2ZCW A;  3JRC A;  4PJN A;  4CIC A;  1KU3 A;  1ETQ A;  3ABT A;  3HUG B;  1TWH J;  1ETK A;  4MFE A;  4I98 B;  1G3T A;  1Z6T A;  3DF8 A;  5CJ9 A;  4IQJ A;  4XLA A;  3BG9 A;  2M45 A;  5HS7 A;  3ISP A;  4I09 A;  5FGM A;  2A6H F;  4F3Q A;  2DT7 B;  3I58 A;  3EQL F;  2XDV A;  5FLV A;  2Y69 H;  2JQ7 A;  2KJB A;  4HNU A;  4Y52 J;  2YPR A;  4GO1 A;  5FKK A;  4V2F A;  4BEH B;  1YJN I;  2VC0 A;  2PFB A;  3DPT A;  2ZXW H;  1XC5 A;  2CS3 A;  3DLL F;  3R60 A;  2HYF A;  2LF8 A;  5FKL A;  2VKE A;  5BS6 A;  1QHG A;  1KZH A;  1TWF J;  3PQJ A;  1O7L A;  2MW8 A;  1MMN A;  2BVM A;  2Q2E A;  4M3G A;  3V7R A;  4BJT A;  2JUC A;  3GFI A;  3AG2 H;  2PN6 A;  3DKW A;  2E2H J;  5M5W J;  1VND A;  2XRL A;  3W2W A;  4CUG A;  2ZJQ F;  3F8F A;  4RGU A;  1STZ A;  2PEX A;  4EJV A;  4LB6 B;  4G6D A;  4AIH A;  1WGX A;  4S04 A;  1OCR H;  4ON0 A;  3CES A;  3LSI A;  1ETV A;  2H6C A;  1FPQ A;  2L4M A;  2XPV A;  1J9I A;  1QZZ A;  2P0W A;  4HPQ A;  4KNY A;  2EZH A;  3HSR A;  4ZZD A;  3BR5 A;  1I6X A;  4HNV A;  1KA8 A;  3CP2 A;  1TP4 A;  4L5E A;  5LGU A;  5IY5 H;  3FKI J;  1J5Y A;  4ZTJ A;  1P4X A;  3BG7 A;  2UXX A;  5LHH A;  1X3Z B;  3ZQL A;  2EH3 A;  1X1D A;  1IG7 A;  4OAY A;  4BJ6 C;  2JA6 J;  1BOA A;  2EA2 A;  3GTK J;  3WTS C;  3PM1 A;  2HYG D;  4BDZ A;  4MGR A;  1EF4 A;  2E34 A;  2BY3 A;  2XGC A;  1IN6 A;  2ID3 A;  2ZSH B;  1MDM A;  5D5V B;  1H9T A;  4IHV A;  1ETY A;  3ABL H;  2ZKZ A;  3BZK A;  3BJ6 A;  3ESW B;  2ECC A;  2JZY A;  4BAY A;  1IRZ A;  2DQR A;  1R5H A;  1YJW I;  3O3K A;  1W1W E;  1T56 A;  1FY7 A;  3S2W A;  3KYL A;  1P7I A;  2LDU A;  1KU7 A;  1P9Q C;  4PZJ A;  4PFP A;  4Z6Y A;  1DDN A;  1O57 A;  1U6G A;  5F08 A;  4EM1 A;  3HL2 A;  5HS8 A;  1D1A A;  1DQU A;  4FCY A;  3LQR A;  4IHX A;  3DBL B;  4BHP A;  3KPH A;  2K27 A;  4XRS A;  4EGZ A;  1SFO J;  5ICC A;  4BXF A;  1SMY F;  1RKW A;  3CDI A;  4X0G A;  3LAP A;  4KFC A;  2KMU A;  4CCJ A;  1JT6 A;  2XKO A;  2E5N A;  3K70 D;  4M3F A;  3A03 A;  2AS5 F;  1X2N A;  5FD5 A;  1AOY A;  4XRM A;  3OIP A;  3K9T A;  3Q0W A;  2F48 A;  4CA0 A;  3BP8 A;  2VE9 A;  1KYW A;  5TGT A;  3KP7 A;  1Z6R A;  3RPU D;  1T38 A;  5JVT A;  4RMN A;  4BAC A;  1LFP A;  3LMM A;  5BPI A;  1I27 A;  2LLK A;  1IZ1 A;  1RZ4 A;  3CDH A;  2NVU B;  3KE2 A;  4BE0 A;  1FOW A;  3VWB A;  2EA4 A;  5E17 F;  2DA2 A;  4YRV A;  2F2E A;  4JX4 A;  3M9A A;  4O6J A;  2OJE D;  3RKX A;  3Q9S A;  1OCP A;  3GUD A;  2PLY A;  1ZGW A;  3D5L A;  3DTK A;  1YRN B;  4OIP F;  2HTS A;  2DMU A;  3NAU A;  1OLT A;  2GOX B;  5C4X J;  5JLX A;  4XLE A;  4QSH A;  5HLT A;  5C44 J;  2NVX J;  4I99 C;  1R5G A;  1F4K A;  4UXN A;  4YG2 F;  1I1S A;  2KHM A;  4CYC B;  2VIX A;  5E3M A;  2HXI A;  5E3O A;  4E4H A;  1UJ8 A;  3QYE A;  2L2O A;  3U9G A;  4IHW A;  3MKY B;  2V1D A;  2O5R A;  3SZG A;  1QBJ A;  1ZQ3 P;  3OYH A;  2Y30 A;  4KIG A;  1Y8Q B;  1LDJ A;  4G12 A;  5J47 A;  2CRG A;  2KDO A;  1W5T A;  1BJA A;  2KL4 A;  3VYU B;  1B59 A;  1AA7 A;  1MND A;  3WG9 A;  2R4G A;  4G9Y A;  5CQE A;  4CCM A;  3BTI A;  4IOA F;  3HEF A;  3ASO H;  3E0J B;  2FML A;  2W82 A;  3GTG J;  1MBE A;  5IT9 K;  1MD0 A;  1P7J A;  2ZFW A;  2W00 A;  4LB5 A;  3CJT B;  3CLQ A;  3FWE A;  2JPC A;  3VYT B;  2CMP A;  2HDC A;  1J75 A;  4DZJ A;  2V4J C;  2LSO A;  3CD6 I;  2K3F A;  4RBO A;  2IW5 A;  2AHQ A;  3GZ5 A;  4LMY A;  4RS8 A;  3BOQ A;  2EPF A;  4UB8 C;  4ENJ A;  5DEQ A;  4DYR A;  3DKY A;  2L54 A;  2ACJ A; 
#chains in the Genus database with same CATH homology
 1MGT A;  1ZGA A;  4U7B A;  3M1E A;  1R7J A;  4ZYH A;  4M74 A;  4OIQ F;  2L02 A;  4GGG A;  2CWE A;  3WTV C;  3QU6 A;  5AON A;  1ZAR A;  4ZYG A;  3I5U A;  4NHJ A;  1LEA A;  2WV0 A;  2D1H A;  3I64 A;  2H6B A;  5E1Z B;  2FRH A;  5DD4 A;  4HV5 A;  1LQ1 A;  2MH9 A;  2DI3 A;  3V8K A;  2K4B A;  1ZYR F;  3DFG A;  1D8J A;  1R1T A;  2OAZ A;  2FSW A;  4HAM A;  4EJW A;  1FBU A;  3KFW X;  1XSV A;  1B9N A;  6PAX A;  2BV6 A;  1ZG3 A;  5ILU A;  5JR3 A;  1WKM A;  1TW2 A;  4ZYE A;  2ZO4 A;  4PDK A;  1LB2 A;  4G94 A;  1HW1 A;  1WSU A;  3SFZ A;  4ZZL A;  4AIK A;  3QU3 A;  2QEN A;  1IXS B;  1BIA A;  3M8F A;  3EET A;  3HRT A;  4CGZ A;  5BPD A;  2OBP A;  1XSX A;  2O0Y A;  4XSX F;  2Z5U A;  4GYG A;  2O6G E;  2A07 F;  3SZT A;  4A12 A;  1VTN C;  1SD7 A;  4A5M A;  1P4A A;  4ESJ A;  1H0M A;  4IRG A;  2VC1 A;  3IRR A;  1RI7 A;  2KIM A;  4LFU A;  2CG4 A;  3E5U A;  5LHI A;  4NB5 A;  1SFU A;  3J7A O;  3TQN A;  1QZY A;  1D3Y A;  4KIF A;  5CVJ A;  2EFO A;  2YU3 A;  4Q47 A;  4ETS A;  4XSZ F;  2QM3 A;  5F6F A;  3F6V A;  3KP6 A;  3CO6 C;  4S05 A;  2HKX A;  3WGI A;  2H27 A;  2K02 A;  2GA2 A;  1ZHF A;  1WWX A;  1KYZ A;  3TO9 A;  3AAF A;  4CDG A;  1OPC A;  1UFM A;  2VT3 A;  3DEU A;  3RTR A;  1BBY A;  1XSD A;  3WTU C;  3GFJ A;  1XB4 A;  2JSC A;  2ZNY A;  1JXS A;  1S8N A;  4ASN A;  1TQP A;  2UZK A;  4HZF A;  2RC4 A;  1T98 A;  2W57 A;  4FT8 A;  5L3F A;  2EV6 A;  1T6S A;  2HOE A;  1YW9 A;  1R58 A;  2P7V B;  3BRO A;  3G3Z A;  2O3F A;  4HLY A;  2QQA A;  4BHC A;  4OU0 A;  4G7Z F;  3SZP A;  2L3D A;  1IN4 A;  2EFP A;  2HQN A;  4IF4 A;  2WWY A;  2IP2 A;  3FXQ A;  1FC3 A;  2XUB A;  3KP5 A;  2ESN A;  1YLF A;  3TDZ C;  4IVN A;  3N4M A;  2YR2 A;  2QUF A;  3K0L A;  1W7P B;  4MQV A;  2K4J A;  3FXU A;  2BBY A;  5DUI A;  1ZRF A;  2G7H A;  1Q1H A;  3B73 A;  2W84 A;  4U88 A;  3HTU A;  1U78 A;  3WOD F;  3LFK A;  5D6E A;  3GVA A;  4K2E A;  3GYH X;  2EK5 A;  4HF2 A;  4GCV A;  4YFK F;  2IPQ X;  1S29 A;  3GXO A;  2V1X A;  1NHA A;  2R7F A;  4DNC A;  4HYE A;  1USS A;  2ESH A;  4AIJ A;  1J7K A;  3E97 A;  3QPH A;  2MLK A;  3K69 A;  3EDP A;  3F3X A;  2J5O A;  2L4A A;  2TDX A;  4Z2Y A;  4M9Z A;  4UVB A;  2ELH A;  2RN7 A;  2Z99 A;  2KKO A;  3NQO A;  3B02 A;  1F9N A;  4U0Y A;  4G6Q A;  2VOP A;  3NRV A;  1G3S A;  5H6R A;  4GYI A;  2R7D A;  1LDD A;  3VB2 A;  1ON2 A;  1DP7 P;  2EFW A;  4M71 A;  2GA1 A;  3FMS A;  2P7C B;  1FBS A;  4U0W A;  1YG2 A;  2W24 A;  1BI0 A;  3HTS B;  4YFN F;  3F6O A;  2GZW A;  2Z3Y A;  4HA8 A;  3U2R A;  2E1C A;  1KQ9 A;  1MJ9 A;  1WQ2 A;  2RQP A;  1YS6 A;  2MA3 A;  3EYY A;  4AVP A;  1ZRD A;  4XBF A;  3TDU C;  4RB3 C;  4EM2 A;  1QO0 D;  3LST A;  2GXG A;  2XAJ A;  3BY6 A;  4U7D A;  4IPA A;  3COA C;  1LEB A;  1FSH A;  1R1V A;  4XRF A;  1X3U A;  3U1D A;  2DK8 A;  2VON A;  1BC8 C;  1OYI A;  2FBI A;  1MDM B;  2MLG A;  3GEZ A;  2VBX A;  3VOD A;  4PGG A;  2XV4 S;  2VN2 A;  3RJP A;  2V9V A;  4I2O A;  1JHF A;  1W7P D;  4RAZ A;  5HS9 A;  2XAG A;  1I5Z A;  2GIV A;  4M9S A;  1IN7 A;  2XIG A;  4WXC A;  1UHM A;  2CQK A;  5E20 A;  3SQN A;  2PJP A;  3R6S A;  4HW0 A;  3L7W A;  1IRF A;  2M1B A;  4HQM A;  3LQQ A;  3IKV A;  5FB2 A;  1R1U A;  3DV8 A;  4KMF A;  5FLX Z;  1BM9 A;  3CLO A;  2EJR A;  3M7G A;  5HLG A;  4G7O F;  2KIF A;  3I59 B;  4WK8 F;  2FU4 A;  2M87 A;  5D8L B;  5E1X A;  3JSP A;  3HSF A;  2P6T A;  4DQ2 A;  4WF2 A;  4L0Z B;  1SD5 A;  4JK1 X;  2A61 A;  1QGP A;  1Z9C A;  1LVA A;  4EJO A;  3HOT A;  2PBI A;  4YIF A;  4LK0 F;  2P5L C;  3ZMV A;  2LNB A;  3QP6 A;  3MWM A;  2NNY A;  4CYD A;  1EH7 A;  1YTY A;  1CGP A;  1P4W A;  3H3Z A;  4LLN A;  3BJO A;  2OZ6 A;  1Y0U A;  4Q48 A;  1G3Y A;  4RB1 A;  1GHC A;  2H09 A;  4OMY A;  3D0S A;  3Q9V A;  2IJL A;  3QOP A;  1IAW A;  4IRI A;  4M6X A;  1R00 A;  2P8T A;  3I59 A;  1GXQ A;  4UVA A;  3GFM A;  4QLC U;  1W4M A;  2YX7 A;  3LWF A;  1ZG1 A;  1U3E M;  1P6R A;  5HDG A;  3GO5 A;  1XDU A;  5HLI A;  1YIO A;  4HF1 A;  3V4G A;  4ZH4 F;  1U5T A;  3F8M A;  1UHW A;  1S7A A;  2XGX A;  3K1M A;  2DO7 A;  2P4W A;  3BDD A;  3MEX A;  3KZY A;  1SFX A;  5DYM A;  3SHF A;  2IA1 A;  2DW4 A;  3HRM A;  1S7O A;  3R0A A;  4ESB A;  1FP1 D;  4EVI A;  2NYX A;  2DT5 A;  1FWZ A;  4P5O A;  2FQ3 A;  1I1G A;  1DPU A;  1L0O C;  3HHG A;  3WTY C;  2ZBK A;  2FEZ A;  3HSE A;  2OZU A;  5EEG A;  1OMI A;  4IRH A;  4A6E A;  1Z1D A;  4NQW A;  2BEO A;  2RNJ A;  5L3D A;  2PMH A;  3C3W A;  2DLL A;  2XAH A;  4LD5 A;  1K6O A;  1IF1 A;  4EMS A;  4RGX A;  2HEO A;  4EGY A;  2A3S A;  4JQF A;  1SFE A;  1SD4 A;  1E17 A;  3E6C C;  2EV5 A;  4KMU X;  3ML6 A;  4HLX A;  5FLX K;  1XN7 A;  1ZRC A;  1O3S A;  4LK1 F;  3ELK A;  1O3R A;  1XCV A;  2DTR A;  5DUK A;  2QQB A;  1HXD A;  3BWG A;  3I4P A;  3KP4 A;  5DV5 A;  2JTV A;  1BIB A;  4MTD A;  3WTT C;  2F5F A;  2FBK A;  1GVJ A;  4BXU A;  3CUQ B;  3FM3 A;  1QQI A;  1TQM A;  1HW5 A;  2X4H A;  4G8X A;  5HLH A;  1IW7 F;  3TO6 A;  2M8E A;  4HDV A;  2ZME A;  3EYI A;  4R1H A;  3JW4 A;  2BE5 F;  1PP8 F;  3REO A;  2XKP A;  4LLL A;  2VE8 A;  1ZAO A;  1BC7 C;  5H20 A;  3GX4 X;  3W6J B;  2MH2 A;  2HWV A;  2ISZ A;  2HR3 A;  3I53 A;  1BI3 A;  2P5V A;  4LGW A;  3TOA A;  4CZZ A;  1MKM A;  3BJA A;  1EV7 A;  5CVR A;  3GWZ A;  1B6A A;  1AWC A;  3KZZ A;  1XGM A;  3IRQ A;  4R79 A;  3FF5 A;  3PFI A;  1TQI A;  3QRF F;  3CUQ A;  4XLP F;  1IUY A;  1PDN C;  3I71 A;  5D5W B;  4L9V A;  2LF7 A;  1JE8 A;  1HQC A;  2V79 A;  3T0Y A;  2OD5 A;  4I0B A;  5ILS A;  3Q5F A;  1F5T A;  2C6Y A;  3HRS A;  2RDP A;  4KIC A;  3J80 Z;  4N9I A;  5DCM B;  5FFX A;  3EUH A;  4JBA A;  5AIQ A;  2VXZ A;  1JHH A;  1ZG5 A;  3G73 A;  1B4A A;  2Y75 A;  4A5N A;  5L3G A;  1ODD A;  2FMY A;  2JT1 A;  1MJA A;  3LAJ A;  4B09 A;  3DP7 A;  1FYK A;  1F1Z A;  4PCQ A;  3WU0 A;  4UV8 A;  3F8C A;  5A2Q Z;  4P96 A;  1BI2 A;  1RUO A;  1L3L A;  2CFX A;  2VBY A;  5LHG A;  5D6F A;  3F23 A;  4BNC A;  3WU1 B;  1XCB A;  3RKY A;  3K1N A;  5FO5 A;  3RDI A;  3E5X A;  1FSE A;  3IL2 A;  1QPM A;  3ROU A;  2EFN A;  2RVC A;  3BPV A;  2COM A;  1HBX G;  5DCM A;  4KUM A;  5F64 A;  5K5O A;  2BYV E;  1K78 A;  1HSJ A;  2X0L A;  5J6X A;  2IA2 A;  2MBF A;  3GZ6 A;  2IA0 A;  1PUE E;  2NAZ A;  1D5V A;  1WRJ A;  3IWZ A;  2A69 F;  2A5Y B;  2CGP A;  1UCR A;  2UXN A;  1G4D A;  1DUX C;  3WTZ A;  2CSO A;  4G7H F;  4HX4 A;  2F5C A;  2D1V A;  3LA7 A;  2PI0 A;  4L9N A;  3CJN A;  2XHK A;  3KEO A;  1ZGJ A;  4RGR A;  2FOK A;  3DPL C;  2HFH A;  3FZV A;  1XD7 A;  1ON1 A;  3VOE A;  2Z33 A;  1YW8 A;  2R3S A;  2ZXJ A;  5E1W A;  2LKP A;  2F5D A;  3FMR A;  1HW2 A;  1MZB A;  3KLO A;  4FX4 A;  4Y13 A;  4P9U A;  2XVC A;  3ZMD A;  3HHH A;  3RYR A;  2D45 A;  1FNN A;  5TRD A;  4PGH A;  3IHU A;  3QAH A;  3P7N A;  5LLQ A;  3KP3 A;  1P92 A;  4WWC A;  5CLS A;  3V7C A;  3C7J A;  4EJU A;  1K79 A;  4HV6 A;  1JGS A;  5KVR A;  4MHG A;  3J80 K;  4R8H A;  2DU9 A;  4ZYD A;  3HRU A;  3T8T A;  1ZLJ A;  4CO8 A;  2KIU A;  2OQG A;  5E8G A;  4BQA A;  3MAJ A;  3WTW C;  1ZLK A;  3PQK A;  2NRA C;  4EM0 B;  4F7Z A;  5K5R A;  4HF0 A;  2E7X A;  4IJA A;  3GLX A;  4EQQ A;  1XGN A;  2UWM A;  2XRN A;  1B9M A;  1FT9 A;  1D8K A;  3H92 A;  5A2Q K;  1LJ9 A;  2E1N A;  3FHZ A;  3F8N A;  3WE2 A;  5ED4 A;  4HX8 A;  1OKR A;  1GXP A;  4OMZ A;  4YFX F;  3MZH A;  5IT9 Z;  4TV7 A;  5AIP A;  3RKW A;  2QBY A;  1CF7 A;  1HST A;  5FD6 A;  3TOB A;  4LG0 B;  3HYI A;  3WGG A;  5CVU A;  4L9J A;  4A6D A;  2KRF A;  3V8L A;  1T39 A;  1Z91 A;  2CYY A;  4I7H A;  3ZMS A;  3ZQ7 A;  3W6K B;  4EV0 A;  3RPU A;  5HDK A;  2VOD A;  5K1Y A;  1ZRE A;  1Z7U A;  3FM5 A;  5TJJ A;  1SD6 A;  2MC3 A;  3E5Q A;  2YX4 A;  2A6E F;  3KCC A;  3FMQ A;  1TW3 A;  2JRT A;  4N9H A;  1FP2 A;  5LRS A;  3IWF A;  3MQ0 A;  4ENN A;  4Y15 A;  2NNN A;  4ENK A;  2KJC A;  2NS0 A;  4UV9 A;  4Q5S F;  3HUG A;  4OIN F;  4Y17 A;  2GQQ A;  1A04 A;  4UNO A;  2GXB A;  2J5P A;  1XMK A;  1PP7 U;  4LG0 A;  2XAF A;  1XGO A;  4A0Z A;  1U5T B;  3T1B A;  4A0Y A;  2QWW A;  2W85 A;  4A0X A;  3TKY A;  4MQ9 F;  3VFZ A;  1TBX A;  4RB0 A;  4IHT A;  2ADU A;  2FXA A;  2Y0M A;  5ICE A;  1TLH B;  2XAQ A;  5E8I A;  1UB9 A;  3L2C A;  2O8X A;  3T8R A;  3CO7 C;  4O5V A;  5ILV A;  3FXR A;  5BQT A;  2HTJ A;  1J0R A;  4RAY A;  4KN7 X;  4LLG F;  5ICF A;  1FZP B;  1QNT A;  2M30 A;  3BPX A;  3RPQ A;  4HQE A;  2A68 F;  3P9C A;  2FE3 A;  5DD8 A;  3OV8 A;  3RIR A;  2EB7 A;  4BHB A;  2WC2 A;  4N0B A;  1ONV A;  3ECH A;  3ZN1 A;  5D8K B;  3JAM Z;  4A2U A;  2W25 A;  2STT A;  2QQ9 A;  1S3J A;  5LGN A;  2QVO A;  1ZH5 A;  3BZ6 A;  4FX0 A;  1UST A;  2XAS A;  2RGV A;  4OIR F;  2FF4 A;  3ZMZ A;  1G3W A;  2Q0O A;  3SXY A;  1G6N A;  1XMA A;  4B8X A;  4WX9 A;  3NEU A;  4YII A;  2HQR A;  5IT3 A;  1K7A A;  2QYO A;  4KN4 X;  2E7W A;  5LEK A;  1HKT A;  3QP5 A;  3R4K A;  3ECO A;  1J2X A;  2IRF G;  4BYY A;  1T2K A;  4CHU A;  2B0L A;  2PG4 A;  1WI9 A;  2PQ8 A;  2VBZ A;  1U2W A;  3N97 A;  4I02 A;  3KLN A;  5D5X B;  4UUV A;  4P9F A;  4L5J A;  3I0T A;  4LJZ F;  2AXL A;  3V7S A;  4MEY F;  2D2W A;  2ZME B;  1TNT A;  4KIB A;  3L9F A;  1REP C;  1YYV A;  2VOO A;  4EJT A;  3E6M A;  1FYM A;  1B1B A;  1U8R A;  1IXR C;  4L9T A;  1KQ8 A;  2WTE A;  5KK1 A;  3T5X A;  2G7U A;  5HOO A;  2OU2 A;  3RI4 A;  1SAX A;  2DPU A;  4CXF A;  2L01 A;  3F22 A;  4M73 A;  2OQR A;  2Z9O A;  3ZP5 A;  3VEP A;  1IXC A;  2F5E A;  1FX7 A;  4E70 A;  2O03 A;  3KEQ A;  1XDS A;  1T0F A;  3P9K A;  3OOP A;  2ISY A;  1TNS A;  3I54 A;  1E2X A;  4FHT A;  2JPB A;  4D0P A;  3F21 A;  2HGC A;  2K86 A;  1S6L A;  2ZNZ A;  3J81 Z;  2DFI A;  1XGS A;  5DCF A;  2STW A;  4L5I A;  3IKT A;  5HVQ C;  5JI6 A;  2ETH A;  2P5K A;  2HS5 A;  3ZN0 A;  1YFH A;  1FLI A;  1KQ0 A;  1OYY A;  4HX7 A;  3ZMT A;  4WCG A;  3FX3 A;  3DQV C;  4L0Y B;  1RUN A;  1EH6 A;  1YO5 C;  3QPT A;  3JAM K;  3MFK A;  3P9I A;  3E6D A;  5LEJ A;  4I0A A;  2BGC A;  3IC7 A;  4M72 A;  1O3Q A;  2V6C A;  3KP2 A;  2CW0 F;  1BI1 A;  2GAU A;  5J8F A;  5D5U B;  5CVV A;  1FYL A;  3GFL A;  3R0J A;  1K78 B;  3TGN A;  1BN5 A;  4RB2 C;  3L00 A;  4HDU A;  5ICG A;  5BOX A;  4HOB A;  4I01 A;  5D4R A;  3WTX C;  3HIF A;  1O3T A;  2P6S A;  5DDG A;  2EFQ A;  4KT5 C;  3GW2 A;  1IN5 A;  1ULY A;  5D4S A;  1DPR A;  1YQA A;  3K2Z A;  1RNL A;  2OA4 A;  5LRR A;  4RGS A;  3DXJ F;  2DQL A;  2QZ8 A;  4IXA A;  2DBB A;  2FNP A;  1OYW A;  3KET A;  5FFZ A;  4GXO A;  2VBW A;  3V8J A;  4OIO F;  4P55 A;  2QLZ A;  2HZT A;  1U5T C;  1FBQ A;  3WE3 A;  1P2F A;  5K5Q A;  4OOI A;  2ZJ2 A;  5JFR A;  3MCZ A;  1H9G A;  1YS7 A;  4KA4 A;  4O3M A;  4Q4Z F;  1R22 A;  1R36 A;  2PMU A;  3K1P A;  2Q8K A;  1O7F A;  5CVI A;  1FOK A;  1SMT A;  1IRG A;  3LA3 A;  3ZPL A;  3TO7 A;  2DPD A;  1EH8 A;  5HDN A;  4ENM A;  1YW7 A;  3JTH A;  3ERE D;  4WXD A;  3H3U A;  1HKS A;  3F8B A;  2FA5 A;  3E6B A;  4AD9 A;  4IHS A;  2RV8 A;  5ERI A;  4KDP A;  3J81 K;  2IVM A;  3M8E A;  2VT2 A;  1KU2 A;  2DK5 A;  2EV0 A;  4AWX B;  3L09 A;  1Z05 A;  3HOS A;  4WXH A;  2Y48 A;  2YSR A;  1J59 A;  3O6B B;  2EWN A;  2V1U A;  4U0V A;  2XRO A;  2GWR A;  4MTE A;  5L3C A;  1ZN2 A;  4MEX F;  3RYP A;  4MNU A;  1C0W A;  3C18 A;  4ESF A;  3CTA A;  4UHT A;  5EEH A;  1OR7 A;  3GF2 A;  3ULQ B;  1IN8 A;  2HKO A;  3WGH A;  5F1R A;  4QWQ A;  2O61 A;  3JTG A;  3LA2 A;  4KYW A;  2G9W A;  4BH9 A;  4XLN F;  1RIO H;  1V3F A;  4L18 B;  1LNW A;  4M9X A;  5L3B A;  2FBH A;  2DAO A;  5L3E A;  1W7P A;  2CO5 A;  4HBL A;  2QBY B;  4UVC A;  1CF7 B;  1MJB A;  3F72 A;  4M6Y A;  5H6Q A;  5LBQ A;  1TTY A;  5E18 F;  2IT0 A;  2FNA A;  3MZY A;  3ABU A;  5BMZ A;  1KU9 A;  3ZMU A;  5JHU A;  5J8C A;  4H0E A;  1W5S A;  2K7L A;  3O2P E;  1R23 A;  1KGS A;  3R61 A;  3CUO A;  2M5W A;  2H94 A;  3C1D A;  1LDK B;  1HKQ A;  2RKH A;  2MD5 A;  3CUQ C;  3E3V A;  3JSO A;  1V4R A;  5LGT A;  5CYV A;  2ZCW A;  4CIC A;  1KU3 A;  3ABT A;  5CJ9 A;  4I98 B;  1G3T A;  1Z6T A;  3DF8 A;  2M45 A;  5HS7 A;  3ISP A;  4I09 A;  5FGM A;  2A6H F;  3I58 A;  3EQL F;  2KJB A;  2YPR A;  4GO1 A;  2VC0 A;  2PFB A;  3DPT A;  3R60 A;  2HYF A;  2LF8 A;  5BS6 A;  3PQJ A;  1O7L A;  3V7R A;  2Q2E A;  3GFI A;  2PN6 A;  3DKW A;  3F8F A;  4RGU A;  1STZ A;  2PEX A;  4EJV A;  4LB6 B;  4G6D A;  4AIH A;  4S04 A;  4ON0 A;  2H6C A;  1FPQ A;  2L4M A;  1J9I A;  1QZZ A;  4KNY A;  3HSR A;  4ZZD A;  1I6X A;  1KA8 A;  5LGU A;  1J5Y A;  1P4X A;  2UXX A;  5LHH A;  1BOA A;  2EA2 A;  3WTS C;  2HYG D;  4MGR A;  1IN6 A;  1MDM A;  5D5V B;  1H9T A;  2ZKZ A;  3BJ6 A;  2JZY A;  4BAY A;  2DQR A;  1R5H A;  3O3K A;  1FY7 A;  3S2W A;  2LDU A;  1KU7 A;  4PZJ A;  1DDN A;  1O57 A;  1U6G A;  4EM1 A;  5HS8 A;  3LQR A;  4BHP A;  2K27 A;  4EGZ A;  5ICC A;  1SMY F;  4KFC A;  3LAP A;  2XKO A;  2AS5 F;  1AOY A;  5FD5 A;  3K9T A;  2VE9 A;  3BP8 A;  1KYW A;  3KP7 A;  1Z6R A;  1T38 A;  5JVT A;  5BPI A;  1I27 A;  1IZ1 A;  1RZ4 A;  3CDH A;  3KE2 A;  5E17 F;  2EA4 A;  2F2E A;  3M9A A;  4O6J A;  3RKX A;  3Q9S A;  3GUD A;  2PLY A;  3D5L A;  4OIP F;  2HTS A;  1R5G A;  1F4K A;  4UXN A;  4YG2 F;  1I1S A;  3U9G A;  2V1D A;  1QBJ A;  4KIG A;  1LDJ A;  1W5T A;  1BJA A;  1B59 A;  3WG9 A;  4G9Y A;  2FML A;  5IT9 K;  1MD0 A;  2ZFW A;  4LB5 A;  3FWE A;  2JPC A;  2HDC A;  1J75 A;  2LSO A;  2IW5 A;  4RS8 A;  3GZ5 A;  4LMY A;  4ENJ A;  3BOQ A;  5DEQ A;  2L54 A;  2ACJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...