1RIOH

Structure of bacteriophage lambda ci-ntd in complex with sigma-region4 of thermus aquaticus bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 27-MER
publication title Structure of a ternary transcription activation complex.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rioH00
1ZG5A 1K78A 1O7LA 4MQVA 1BOAA 4GGGA 2TDXA 1H9GA 4B8XA 2ACJA 1OYYA 2M5WA 3O6BB 5LRRA 3C7JA 1XSXA 2L4AA 2ISZA 3I4PA 3DPLC 1IAWA 4Z2YA 2P8TA 2OZ6A 2JT1A 3I5UA 5DD4A 2K27A 3QPHA 3DV8A 4BQAA 3D0SA 1PUEE 5KK1A 1U3EM 2FXAA 1IXSB 5LLQA 3LSTA 3M9AA 1J5YA 1FT9A 1XMAA 5CVJA 2RC4A 4BNCA 2XAFA 2EV0A 1RUOA 4HLXA 2O03A 4UVAA 4JBAA 3I71A 4N9HA 2DPUA 2RKHA 3FHZA 3N97A 1O3QA 3FMQA 2RDPA 3F8BA 3V8LA 2Q2EA 4RGXA 5F6FA 3WTYC 1IN4A 3J80K 4RGSA 2D1HA 5BS6A 1MGTA 1GXPA 2QQBA 2F5DA 5HLGA 2STTA 3TO6A 1USTA 4PCQA 3V7SA 1E2XA 3KZZA 5ICCA 5FLXZ 3F3XA 3OV8A 2OD5A 2IW5A 2P6SA 1PDNC 3GFIA 2PN6A 1T2KA 3ERED 4RGUA 3F23A 2HQRA 4R1HA 1IN6A 2QYOA 4P5OA 4MQ9F 4KN7X 1BBYA 4A0YA 2NYXA 2F5CA 3BJ6A 4E70A 1HSJA 4AIKA 1X3UA 1KYZA 2IA0A 4EJOA 1IN7A 3DQVC 3HRUA 2IRFG 1FLIA 2KIMA 3WU0A 2G7UA 3LWFA 4JK1X 1W4MA 2HTJA 2CG4A 3MEXA 3G73A 5DD8A 2RQPA 2YR2A 2FBHA 3GF2A 3FXRA 2UXNA 3DP7A 3RKWA 1F9NA 2ZKZA 2PG4A 2FBKA 5IT9K 3IC7A 2NNYA 2KRFA 2EA4A 4HOBA 3O3KA 3JTHA 4O6JA 5JFRA 4UUVA 4MEYF 1G6NA 4HDVA 5K5RA 4OMYA 1XGMA 1ZGAA 3FF5A 1TW3A 3JSOA 3I64A 3ZN0A 2RV8A 2CGPA 2L3DA 4M74A 2XGXA 1U5TB 4L9JA 5JR3A 3ZMSA 2QUFA 1ONVA 2OAZA 2R7DA 2W24A 3GZ6A 3I58A 4R8HA 2JTVA 2HGCA 2DU9A 2FRHA 1S7OA 1ZN2A 2DAOA 1HKQA 5J8CA 3R61A 5KVRA 1TNTA 2MD5A 3ZMUA 3EETA 4U0YA 1O3TA 4RB0A 3ZMTA 1R22A 4I01A 4I09A 2Y48A 3WTWC 1OKRA 1YG2A 1G3WA 5FGMA 3J80Z 1S7AA 3P9IA 4GO1A 1FP2A 1FBQA 5LGUA 2O3FA 2FE3A 2EFNA 2EFPA 1FWZA 4S04A 4M6YA 3GXOA 2BBYA 1P92A 3E6CC 3C1DA 4A5NA 2M1BA 4U88A 4IRIA 2D2WA 1V4RA 1FC3A 3E3VA 1SAXA 1KQ9A 2VN2A 4P9UA 3HOTA 2XAJA 2KIUA 4HV6A 1R58A 3RKYA 3LA3A 3KE2A 1S3JA 3TOBA 5D4RA 5HS8A 3K1NA 3C3WA 4CDGA 2PBIA 3MZHA 2YU3A 5E8GA 3W6KB 1OR7A 1U5TA 2YX7A 3BDDA 3W6JB 3CO7C 1CGPA 2VBXA 3IKVA 5E1ZB 1W5SA 1FY7A 2HYGD 1LQ1A 4EJTA 4BHBA 3VEPA 1YFHA 2L01A 3I53A 5E18F 1ON1A 3R6SA 5ED4A 2E7WA 2FOKA 2QENA 5IT9Z 1KU9A 2ISYA 3HYIA 2ESNA 3H3UA 3TDUC 2OA4A 4EQQA 2VONA 1I27A 1S29A 4HYEA 4LG0B 1WSUA 5D5VB 2Z9OA 2M87A 4HF0A 3BROA 3RYRA 1TQPA 1FBUA 1HQCA 1KU7A 1ZGJA 4ZYHA 5D6EA 4L18B 3FZVA 4KICA 1P4WA 1J2XA 4RB2C 1FYKA 5HS7A 4LLLA 4RAZA 1K79A 4WF2A 2FF4A 4G8XA 1HBXG 4N0BA 3LAPA 3DF8A 4RAYA 3JW4A 3RPQA 4AIJA 3VFZA 1QZYA 2HQNA 4EJVA 1B4AA 4ON0A 4N9IA 3KCCA 2LF7A 4OINF 2OZUA 1WWXA 2BGCA 2V9VA 2DQLA 4M9SA 3TQNA 2WWYA 3ZPLA 3WE3A 3P7NA 3Q5FA 4LK0F 2GA2A 4OMZA 3R60A 1JHHA 3EQLF 2QWWA 2MC3A 1R1TA 1AOYA 1JE8A 3HRMA 2XUBA 3FXQA 3HSRA 3GFMA 4CXFA 2XHKA 2BV6A 1S6LA 2QVOA 4G6QA 3H92A 4OIQF 4I98B 4BXUA 3MWMA 1D8KA 4ENMA 4LJZF 2KKOA 2A5YB 3BPVA 5F1RA 1PP7U 1LEAA 3ELKA 1SFEA 1G3TA 3SXYA 3RDIA 1H0MA 1SD7A 2EWNA 2XV4S 1BC7C 5HDGA 5D5UB 2J5PA 3ZN1A 2DQRA 4PDKA 2GQQA 3CUOA 5DCMA 3FWEA 1R1VA 3HSFA 3WTTC 2E7XA 3L09A 2RNJA 3IHUA 1YTYA 1AWCA 4DNCA 2MBFA 3L7WA 5CVRA 4WWCA 2GZWA 3HHGA 1O7FA 1J0RA 1J75A 2F5FA 2CFXA 1RUNA 1LDKB 3K1MA 4KNYA 5FD6A 4EV0A 3VOEA 1FPQA 1T38A 3PQKA 1B6AA 4MGRA 1RIOH 1USSA 3V8KA 4XLPF 2J5OA 2XIGA 1U6GA 4HQMA 1ON2A 1L0OC 3MCZA 2EK5A 2XRNA 5AIPA 1TQIA 4ESBA 5L3GA 3CUQB 2MA3A 4ZZLA 4KIFA 1ZLKA 2FMYA 3TOAA 4M9ZA 3SZTA 1DUXC 1GVJA 2V1UA 1KA8A 4I0BA 4Y17A 3WE2A 3CDHA 4XLNF 3KP5A 2DI3A 4M73A 1CF7A 5E17F 1YS6A 3CLOA 2VT3A 4KN4X 4KUMA 3GYHX 3HTSB 1GHCA 3WODF 4EM2A 3IKTA 3GVAA 3DFGA 4UHTA 2F5EA 4ENJA 2ELHA 1ZARA 1G3YA 3KETA 1B59A 1NHAA 2EA2A 4HX4A 2FSWA 1XB4A 4CO8A 4RS8A 2EB7A 4G6DA 3V8JA 4CHUA 2OBPA 3BP8A 2KJBA 4ZZDA 3B02A 5ICFA 3KP4A 4U7BA 3K0LA 3P9CA 3OOPA 5BQTA 4I02A 4ZYEA 4IRGA 2LDUA 4MHGA 2IP2A 2A69F 1LB2A 2P5VA 1J7KA 3RJPA 1G4DA 5TJJA 3IRQA 4LGWA 2DK8A 3GEZA 5TRDA 2JPBA 3J81K 2FMLA 3I54A 2W84A 3F21A 4NHJA 2AS5F 2MH2A 3V4GA 4IXAA 4FX0A 4I2OA 2KJCA 3CUQA 1EH6A 1I1SA 3WG9A 3BY6A 4L9NA 3IWFA 2YSRA 4LK1F 4XBFA 2P5KA 2GWRA 5IT3A 3WGGA 1YO5C 4KIBA 2ZCWA 1FYMA 4NB5A 1XGNA 4UV9A 3HIFA 1XSVA 4KIGA 2HS5A 1U2WA 2MH9A 5LBQA 1BI3A 3T8RA 2VE9A 1P6RA 3Q9VA 1ODDA 2V6CA 2FNPA 2JZYA 3WTXC 2PI0A 1FX7A 4LMYA 2E1NA 2M30A 5D8LB 4HLYA 3KP3A 4Q4ZF 4HQEA 4ZYDA 1O57A 1SD4A 4U7DA 5H20A 4RB3C 2BEOA 4OU0A 2O61A 1D8JA 4GXOA 6PAXA 3F8CA 2DW4A 4Q48A 2BYVE 4I0AA 4WK8F 2O6GE 5LGTA 1ZHFA 2XAQA 4FHTA 4CYDA 2ZJ2A 3E6DA 2ESHA 3F6VA 1Z6TA 4NQWA 2ZNZA 1QGPA 3FM3A 3NRVA 4EGZA 3GLXA 3U1DA 3BWGA 4G7OF 4O3MA 3E5UA 1ZLJA 1IRFA 1UHWA 3K2ZA 3EYYA 3RIRA 4EM0B 2CYYA 3GX4X 3BOQA 1FBSA 5H6RA 4LB6B 3QU3A 2V79A 2YX4A 3IRRA 2DT5A 3K1PA 3FM5A 4BH9A 3T1BA 4KMFA 2HZTA 1KU2A 3DPTA 2Y75A 3I0TA 1TQMA 1P4AA 4HV5A 2FNAA 5HS9A 2XROA 3TKYA 1SD5A 3T5XA 2WC2A 4ZH4F 1DDNA 4HW0A 2K02A 4HZFA 4KYWA 4IHSA 3F72A 3GUDA 2IA2A 3QPTA 3EYIA 3T0YA 2ZXJA 1IZ1A 1Z91A 4CGZA 2R3SA 3JSPA 3H3ZA 2G9WA 2IVMA 2H94A 1BJAA 1HKTA 3L2CA 1FSHA 2PMHA 5E20A 1TTYA 2EFOA 5DUIA 3JTGA 1XCVA 5L3CA 5AONA 2GIVA 3J81Z 5K5OA 1EV7A 3COAC 2JPCA 4A12A 2UXXA 1WKMA 3QU6A 4WXCA 2VXZA 1LEBA 4MTEA 2L02A 2V1XA 2LKPA 2Q8KA 5D8KB 2EFQA 2XASA 3CO6C 5CVUA 5E8IA 4UNOA 1XN7A 1QPMA 4WXHA 1UCRA 2HR3A 3REOA 1L3LA 4WXDA 2QZ8A 4Q47A 4ESFA 4XSXF 4IVNA 2H09A 2PMUA 3R0AA 5J6XA 2VOPA 1R5HA 3QAHA 2XAHA 5DDGA 2PQ8A 5K1YA 2VOOA 3QOPA 2L4MA 1E17A 1MJ9A 2Z3YA 1IXRC 1YQAA 2CSOA 1EH7A 2F2EA 1KU3A 3TO9A 5DUKA 2PLYA 1XSDA 2NRAC 1I1GA 1IN8A 1FSEA 5HOOA 4IJAA 1Z7UA 2QLZA 2RN7A 2YPRA 2HDCA 5LRSA 5L3FA 1BI1A 5LGNA 1W7PB 5ILSA 2P4WA 1LDDA 3WGIA 3E97A 4L5IA 2L54A 5ICGA 1ZG3A 3WTVC 1Q1HA 1JHFA 5FFZA 5ILUA 3ECOA 4MEXF 3KFWX 1IRGA 3ABTA 1B9MA 1BI2A 4BHPA 3HTUA 1HKSA 4P55A 5E1XA 2ZMEB 1QNTA 3MZYA 3KEQA 2A6EF 4FT8A 4A0ZA 2UWMA 4EGYA 1ZYRF 1R00A 2XKOA 4YFXF 3R0JA 4LLGF 4A2UA 4XSZF 1U78A 2BE5F 3GZ5A 4F7ZA 2A61A 3EUHA 3DEUA 4KT5C 4PZJA 2OQRA 2XVCA 2X0LA 3E5XA 2KIFA 4P96A 3N4MA 1MZBA 2P7CB 5CVVA 4LG0A 2EV5A 1OMIA 3RPUA 1R23A 1T6SA 4HF1A 2DK5A 3WTZA 4WCGA 1D3YA 1JGSA 1TLHB 2Z5UA 3HUGA 4AWXB 3AAFA 1MD0A 3KP7A 4L0YB 1HW1A 4U0VA 2VC0A 4M9XA 3ZP5A 2P6TA 3FXUA 1O3RA 5CVIA 3LAJA 3K9TA 2VBWA 5J8FA 1STZA 3F6OA 1W7PA 4O5VA 3P9KA 2IJLA 1FZPB 5JVTA 2PEXA 2P5LC 1TW2A 2O8XA 4AVPA 1HSTA 3TGNA 2ETHA 1PP8F 5HLHA 1QBJA 1B9NA 1GXQA 3ECHA 4OIOF 4UVCA 4GYIA 2DBBA 4M72A 4BHCA 2Y0MA 2MLGA 1R36A 2OQGA 4IRHA 4OIRF 1C0WA 2JRTA 1ZRFA 3BZ6A 4R79A 1Z1DA 2ZMEA 2DTRA 3M8EA 3MAJA 4XRFA 4QWQA 2PFBA 2HTSA 2ZO4A 1P4XA 3QP5A 1A04A 3ROUA 1FP1D 3QRFF 3E6BA 3J7AO 2NS0A 5HLIA 4PGGA 1I5ZA 2GXBA 3QP6A 4YIFA 1SFUA 4A6EA 1R7JA 2GXGA 1IXCA 3ISPA 2ZBKA 3PQJA 3WGHA 3FMSA 4D0PA 3GWZA 3HRSA 2GAUA 2HWVA 4G94A 3PFIA 3CUQC 5DCFA 1LJ9A 4HAMA 3JAMK 5D5XB 1TNSA 4ENNA 2H6CA 2GA1A 5AIQA 1LNWA 2CO5A 3V7CA 3HOSA 3LA7A 1D5VA 4KA4A 1Z6RA 1YLFA 4CZZA 5F64A 2XAGA 4KFCA 3LFKA 3VODA 1IUYA 2K86A 5A2QK 4LD5A 1YYVA 5BOXA 5CYVA 4L9TA 1OYIA 1J9IA 2EV6A 2Z99A 5LEKA 1MJAA 1XMKA 3CJNA 4G7ZF 1MKMA 1XD7A 1DPRA 2QQ9A 1IN5A 3VB2A 3M8FA 3I59B 4OIPF 1FNNA 4MTDA 2HKOA 1EH8A 4U0WA 5DEQA 3WTSC 2Q0OA 3KEOA 2A68F 2D45A 1MDMB 2IPQX 3MFKA 1QO0D 1WI9A 2VT2A 4Y13A 1ZREA 2FEZA 1SMYF 4DQ2A 5JI6A 1K7AA 4HF2A 3T8TA 2K4JA 5BPIA 4RB1A 1ZG1A 1WRJA 2O0YA 2X4HA 2WTEA 4EMSA 5BPDA 1XGSA 2CQKA 3LQRA 4ESJA 3BJAA 5L3EA 4PGHA 3ZMDA 3LA2A 5L3BA 4UVBA 4L5JA 2E1CA 4LB5A 2FA5A 1QZZA 1R1UA 2ZNYA 2NNNA 1ZAOA 3HSEA 2ADUA 4HBLA 3CTAA 2COMA 3KP2A 4JQFA 3SZPA 2M8EA 3RYPA 3ULQB 4TV7A 4EVIA 1BN5A 5BMZA 2HEOA 3GFJA 5D4SA 3S2WA 1OYWA 1ZH5A 1W7PD 3GW2A 2OU2A 4YFNF 3EDPA 1HW2A 2VODA 4YFKF 2A3SA 3ABUA 4HDUA 5FFXA 3U2RA 2Z33A 4BYYA 3E5QA 2RVCA 3I59A 1P2FA 4CICA 3SHFA 1YW7A 3SQNA 3NQOA 4EM1A 4AD9A 3KLNA 2H27A 3IWZA 1UB9A 1MDMA 5ERIA 1HW5A 3JAMZ 1YW8A 2QQAA 5HDKA 5LHGA 1U5TC 4BAYA 3MQ0A 3NEUA 3TDZC 3GFLA 5HVQC 2G7HA 2DO7A 4FX4A 3RKXA 5A2QZ 1QQIA 4YG2F 4MNUA 1BIBA 3DKWA 1TBXA 1JXSA 2UZKA 3ZMVA 3SFZA 2WV0A 1O3SA 5JHUA 1R5GA 2CWEA 1F4KA 1REPC 1YIOA 3KP6A 4ETSA 2CW0F 4AIHA 2HFHA 4ASNA 5LHHA 4QLCU 1LDJA 3M7GA 2VBYA 2JSCA 1FYLA 4B09A 1F1ZA 1FOKA 1KQ0A 1XGOA 3U9GA 1RI7A 4S05A 3TO7A 1SMTA 2D1VA 3GO5A 1ZRCA 4EJWA 1BIAA 1XCBA 1OPCA 4WX9A 3FX3A 4UV8A 1MJBA 2IA1A 2B0LA 4A5MA 2H6BA 3F8FA 3RTRA 3LQQA 5FB2A 2PJPA 4IF4A 2HKXA 1LVAA 1BI0A 4GCVA 2K7LA 2W57A 1BM9A 3HHHA 3M1EA 3BPXA 3D5LA 5ILVA 3ZQ7A 1VTNC 5D5WB 4L0ZB 2MLKA 3KLOA 1YS7A 2QM3A 4I7HA 2K4BA 1S8NA 2LSOA 3KZYA 4Q5SF 1BC8C 1K6OA 2HYFA 3V7RA 4LFUA 2VC1A 2C6YA 3K69A 2R7FA 3R4KA 4HX7A 4A0XA 1WQ2A 3C18A 1I6XA 1T98A 1Z9CA 2VE8A 1Z05A 5ICEA 2RGVA 2W25A 5DCMB 2HOEA 3WTUC 3F8NA 5CLSA 4YIIA 2IT0A 3IL2A 1F5TA 1YW9A 1HXDA 5EEGA 5H6QA 3WU1B 4KMUX 2EJRA 1XDSA 3FMRA 1V3FA 2AXLA 2QBYB 3B73A 5D6FA 4HA8A 1KYWA 1RNLA 1K78B 5K5QA 2FQ3A 5EEHA 1IW7F 1B1BA 3O2PE 1J59A 4IHTA 4GYGA 2DFIA 4ENKA 1XDUA 3Q9SA 3F22A 2LF8A 1Y0UA 4HX8A 2STWA 2W85A 1W5TA 2XKPA 2NAZA 4EJUA 4M6XA 4OOIA 5DYMA 4G7HF 1U8RA 5LHIA 3G3ZA 2DPDA 1SD6A 5FD5A 1SFXA 5FLXK 4A6DA 2A6HF 5CJ9A 2FU4A 1UFMA 4H0EA 2V1DA 4K2EA 4G9YA 4KDPA 3F8MA 5DV5A 1IF1A 1RZ4A 4L9VA 2A07F 1CF7B 3ML6A 3BJOA 5FO5A 4ZYGA 4M71A 3L00A 2DLLA 1KGSA 4UXNA 1T39A 2FBIA 4Y15A 4LLNA 4IPAA 1H9TA 5E1WA 1ZRDA 3E6MA 1G3SA 2EFWA 3RI4A 3HRTA 1KQ8A 2ZFWA 5LEJA 3DXJF 1T0FA 1UHMA 2VBZA 5HDNA 4P9FA 1ULYA 5L3DA 2LNBA 2M45A 1DP7P 3L9FA 2QBYA 2P7VB 4RGRA 3ZMZA 1DPUA
chains in the Genus database with same CATH superfamily
2WB1A 2X1CA 2R5YA 1ZG5A 1K78A 3BQYA 1O7LA 3ABMH 4MQVA 1BOAA 2HU9A 3A0HC 4GGGA 2TDXA 1H9GA 4B8XA 2ACJA 1W36C 3S1NJ 3RZDJ 1Z67A 1H88C 1D1CA 2WY7Q 1OYYA 2M5WA 3EUKL 3O6BB 3FK6A 2VQLA 5LRRA 3C7JA 1XSXA 1QHGA 1VZ0A 2L4AA 1FJLA 2ISZA 4B1RA 4LIVA 1YIJI 4D5FA 4AYBN 2M4KA 3I4PA 4X1EA 2BXYA 3FKIJ 4UB6C 3DPLC 1IAWA 5KNLA 4Z2YA 1VNDA 2P8TA 1FEXA 2OZ6A 2JT1A 1MBHA 3I5UA 5BNGA 5DD4A 2EZLA 1S72I 2K27A 3P5JA 1OFCX 3QPHA 3DV8A 3MVPA 3LOCA 4BQAA 1VQ9I 3D0SA 5DTDA 2X6XA 4IOCF 1PUEE 5KK1A 4ITVA 3PIPF 1T8IA 1U3EM 2LKSA 2FXAA 1RRJA 1IXSB 2FOWA 5LLQA 3LSTA 3M9AA 4Y52J 1FIAA 1J5YA 1FT9A 3KEYA 1XMAA 5CVJA 1TT5B 4FTHA 1T33A 2RC4A 2QQ8A 4MFDA 3ZQHA 3SEZA 4BNCA 2W48A 5J1RA 5FLMJ 3OYLA 3CCJI 2BOLA 2LOOA 2XAFA 4DBRA 2EV0A 1X4PA 4HLXA 3SEQA 1GDTA 4U87A 1RUOA 2O03A 4MO7A 2JK3A 4UVAA 4B3XA 3D5RC 4JBAA 4E6KG 3CCVI 1WVRA 4C2TA 3I71A 4N9HA 3A01B 2DPUA 2RKHA 3FHZA 3N97A 1XX5A 1O3QA 3FMQA 4J19A 4CA0A 1YX3A 2RDPA 2BY3A 1JUSA 3F8BA 1DGWY 2AO9A 2VJIA 4KITB 4IX7A 2H1KA 3BTCA 3V8LA 2Q2EA 2JVGA 2E1MB 4RGXA 1WJBA 3DCFA 5F6FA 3WTYC 1IN4A 1ZELA 5GPAA 3J80K 4RGSA 2A6TA 2D1HA 5BS6A 1MGTA 2QEXI 3G1LA 1GXPA 2KRCA 2QQBA 2EPFA 2L9NA 2F5DA 5HLGA 2X6WA 1FOYA 1V5GA 2LR8A 3VYSB 2STTA 3TO6A 1USTA 3BR3A 4PCQA 2XSDC 3V7SA 5CPRB 1O4XA 1E2XA 3F9KA 5F0FA 2JSPA 1FOWA 3KZZA 5ICCA 5FLXZ 3F3XA 3OV8A 2OD5A 2IW5A 3NWSA 4ZJZA 2P6SA 2ID3A 1PDNC 4X6AJ 3GFIA 2PN6A 1T2KA 4ZDOA 1D0ZA 3ERED 2WADA 1A6IA 4RGUA 3F23A 3W3CA 2HQRA 4R1HA 1IDYA 1IN6A 4C3IJ 2QYOA 4P5OA 2DYRH 4MQ9F 4KN7X 4AYBA 4W97A 4BDYA 3I4MJ 1BBYA 4XLHA 4A0YA 4BEHA 1Y56A 2NYXA 2F5CA 3OL3A 2RAEA 2TRTA 3BJ6A 2L9RA 4E70A 1W0TA 3I3LA 1HSJA 4AIKA 1BA5A 1OJLA 5FKMA 1X3UA 1KYZA 2IA0A 4EJOA 1IN7A 2QKMB 1NG6A 3OYKA 3DQVC 3HRUA 2IRFG 1FLIA 1MMGA 4J00A 2KIMA 1D1AA 3WU0A 2MFZA 2G7UA 3LWFA 4PFPA 4ANJA 2XF7A 4JK1X 4FCYA 3O8GA 1W4MA 1TP4A 1ITYA 2HTJA 2CG4A 3MEXA 3G73A 5DD8A 2XC7A 2RQPA 2YR2A 3ASOH 3S32A 4PJMA 2FBHA 3GF2A 3FXRA 2DFFA 2UXNA 3DP7A 3RKWA 1X19A 1R5ID 3CLQA 3RPUD 4XNFA 1F9NA 1PUFB 2OTJI 2ZKZA 1MH3A 4IHXA 2PG4A 2ZJPF 1YJNI 2B9SA 2FBKA 5IT9K 2LG4A 2VUMJ 3IC7A 2NNYA 2BHZA 2KRFA 3OIQA 2EA4A 4HOBA 3OY9A 3S14J 2K9SA 5F0CA 3O3KA 1VQ8I 3W6VA 3JTHA 4O6JA 3A01A 2QSHX 5JFRA 3PNTA 5CKTA 4UUVA 2ID6A 4MEYF 1G6NA 3S3OA 4HDVA 4XRMA 5K5RA 4OMYA 2KISA 4ZC3A 3OYEA 4DGWB 1XGMA 1ZGAA 2XB5A 4BXFA 3FF5A 3UNGC 3H3VK 1TW3A 4G12A 3JSOA 3I64A 1JT0A 4E7JA 2VL8A 2P81A 3ZN0A 2YU9J 1UG0A 3EPZA 2DA7A 4B47A 2RV8A 2CGPA 2L3DA 3BG3A 4M74A 2UUZA 2XGXA 1U5TB 4L9JA 4HEA2 5K7ZA 5JR3A 3ZMSA 4XLAA 2CRGA 2QUFA 1ONVA 2OAZA 2R7DA 2W24A 3GZ6A 3I58A 3GTJJ 2ELJA 4XONA 1Z3XA 4BKXA 3JR9A 4R8HA 2JTVA 2HGCA 3K4LA 3BZCA 2DU9A 2FRHA 2I8DA 1S7OA 5EF6A 1ZN2A 1IGNA 4BQOA 2DAOA 3AG2H 4OAYA 1HKQA 5J8CA 3R61A 5KVRA 1TNTA 5M3FJ 2MD5A 2ME6A 3ZMUA 3EETA 2LREA 1JTYA 1IRXA 3OYJA 1MBGA 4U0YA 3TEDA 1O3TA 4BJ6C 4RB0A 1NK2P 1TWCJ 3K4JA 3ZMTA 1R22A 4LITA 4I01A 4BJTA 3BTIA 4I09A 3LL7A 2Y48A 2M9HA 3WTWC 2CW8A 3S17J 1HF0A 1OKRA 1YG2A 2WA0A 1G3WA 5FGMA 2HNHA 2NVUB 3J80Z 1S7AA 5J3LA 3OR1C 3P9IA 5C44J 4GO1A 1FP2A 1FBQA 2BZTA 5LGUA 2E36A 3K4BA 2VASA 3M4OJ 2LP0A 2O3FA 1S9HA 2DT7B 1B72B 2FE3A 3HBLA 3MD2A 2EFNA 1YJWI 3CP8A 4FQGA 3FK7A 2V9PA 2EFPA 2EIMH 1MIJA 3DTEA 3VWBA 1FWZA 3DLAA 3KYLA 2COBA 1AU7A 1K61A 2VB6A 4S04A 4M6YA 4ZDLA 5EZHA 3GXOA 3HOZJ 2BBYA 1P92A 2EZIA 5EG0B 3E6CC 5GADJ 3C1DA 4A5NA 1MMAA 3C2GA 3M8JA 2M1BA 4NNJA 2V1NA 4U88A 4IRIA 1WJCA 2BW3B 2D2WA 4IEJA 1V4RA 1FC3A 3E3VA 1SAXA 1T08B 1KQ9A 3HOWJ 2VN2A 1V5EA 2VLAA 4P9UA 3HOTA 3K7AJ 2XAJA 2KIUA 3M07A 4HV6A 4DYCA 1R58A 1S5LC 4XN3A 3RKYA 3LA3A 3KE2A 1S3JA 4NC8A 2KQRA 2VKHA 3TOBA 5D4RA 5HS8A 4B43A 3K1NA 3C3WA 4CDGA 4LIUA 1ACIA 2PBIA 3MZHA 2JMWA 3AG1H 2YU3A 5E8GA 2CUZA 3HJEA 2Z2SB 3W6KB 1OR7A 1U5TA 3BDDA 2YX7A 2MABA 3W6JB 3CO7C 1CGPA 1ETQA 2VIXA 2MD0A 1NH3A 2VBXA 2NOJB 3IKVA 1HLVA 5E1ZB 2ECCA 4P1WA 1W5SA 1FY7A 2HYGD 1LQ1A 2CUJA 1WGXA 4EJTA 4BHBA 4ZYAA 3VEPA 1YFHA 2L01A 3I53A 5E18F 1ON1A 2KHMA 2PX9A 1HDDC 2P0WA 3R6SA 3KYDB 5ED4A 2E7WA 3J7AY 1K6YA 2FOKA 2QENA 1VQMI 5IT9Z 1KU9A 2GLOA 2ISYA 5C4XJ 3HYIA 4M6VA 2ESNA 5FJ8J 3TP3A 3H3UA 3TDUC 1I50J 2OA4A 5EJCA 4EQQA 2VONA 1I27A 1S29A 4HYEA 4LG0B 1WSUA 5D5VB 4XRSG 5B1AH 2KMUA 4IQ4A 2Z9OA 3PO3J 2M87A 4IHVA 4HF0A 3BROA 3KZIC 3LSHA 4H4KC 3BR2A 3RYRA 1Y6IA 1TQPA 2MGQA 1FBUA 4BU2A 4PUSA 1HQCA 1YJ9I 1SVOA 4DYQA 4F92B 1KU7A 2EIJH 3K2AA 1ZGJA 4ZYHA 4I6ZA 5D6EA 1D5YA 2O9LA 4L18B 4A3CJ 3FZVA 4RM3A 3H5AA 4KICA 1GV2A 3G71I 1P4WA 1J2XA 1ETWA 2M34A 4RB2C 1X3WB 1FYKA 3OSGA 1G2HA 1IRZA 1WFXA 5HS7A 4LLLA 4RAZA 1K79A 1M1EB 1B72A 4WF2A 2FJ1A 3U21A 2FF4A 4G8XA 1HBXG 4N0BA 3LAPA 3DF8A 4RAYA 3JW4A 2B7EA 3GTQJ 3RPQA 2VQGA 3VFZA 1MW7A 4AIJA 1QZEA 1QZYA 2HQNA 4EJVA 1B4AA 4ON0A 4N9IA 3KCCA 3DU6A 3CP2A 1VQ7I 2LF7A 4OINF 1LFBA 4PK4A 2H8RA 3S93A 3OIPA 4IHYA 3HM5A 5IOZA 4E7LA 5GP9A 5EG0A 1H89C 2VJ5A 2OZUA 3H0GJ 1WWXA 2BGCA 2KT0A 2DQLA 2V9VA 4M9SA 5HODA 1SC7A 3TQNA 2WWYA 3ZPLA 1F36A 3WE3A 3P7NA 2X51A 3WG7H 4MIMA 2BW3A 2W1OA 4XM3A 3Q5FA 4LK0F 4DOZA 5EGOB 2GA2A 4OMZA 3R60A 1JHHA 2VQCA 5FKLA 3EQLF 2QWWA 2MC3A 1R1TA 1AOYA 1JE8A 3HRMA 1NG7A 2XUBA 3FXQA 1X1PA 1H8AC 3BQZA 3HSRA 1DU6A 3GFMA 4CXFA 2XHKA 4E7IA 5B66C 3AL0C 2BV6A 1A35A 4JX6A 1S6LA 3S1QJ 2QVOA 4G6QA 5J40A 2YS9A 3H92A 5GAGJ 3OYCA 4OIQF 4AM3A 3DPUA 4I98B 4BXUA 4IO9F 3MWMA 1DU0A 2IAIA 3IAM2 3K4KA 5K7HA 1D8KA 1N75A 1UHSA 2XF5A 2X85A 3HC7A 5IP6A 2ZMEC 5GAHJ 4ENMA 2DA4A 4LJZF 2KKOA 2Q1ZB 3HGGA 2A5YB 2I10A 2V7FA 3BPVA 3BG5A 1LEAA 5F1RA 1PP7U 3ELKA 1SFEA 1E0EA 2V4JC 2W00A 3ERMA 1G3TA 2VKDA 3SXYA 3RDIA 4HSTA 4BACA 1H0MA 1SD7A 4ZDPA 3PIOF 3JRDA 2EWNA 3LSMA 2VJJA 5GTIC 2XV4S 3Q0UA 1BC7C 5HDGA 5D5UB 3ZQIA 2GOMA 2J5PA 3Q3SA 4N4OB 3RQ4A 1R4MB 3ZN1A 3HOVJ 2XGEA 3LSIA 4D7MA 4BE1A 3JRFA 1E3PA 2KZVA 2DQRA 4PDKA 3K70D 2GQQA 3CUOA 2Z16A 3QWLA 3FWEA 5DCMA 4DJAA 1R1VA 3HSFA 3CC7I 2JA7J 1SFOJ 3WTTC 2R4GA 3I55I 2JVHA 2XAUA 2E7XA 1RR8C 3L2QA 1JKRC 2DMNA 3L09A 3I56I 1POGA 3MKWB 5KHDA 2RNJA 3IHUA 3G1OA 1YTYA 4JYKA 3TMOA 2L7ZA 1AWCA 1ZGWA 3IP4B 4DNCA 2MBFA 5E3OA 1ETYA 3L7WA 2DA2A 5CVRA 4WWCA 2GZWA 1OCOH 3HXLA 3HHGA 1O7FA 1J0RA 2DA1A 1J75A 2F5FA 1WPKA 2KRHA 3BTJA 2CFXA 1RUNA 3LNQA 1LDKB 4NUBA 2HXOA 3K1MA 3I9V2 4KNYA 5FD6A 4CZCA 4EV0A 4Y4RA 3VOEA 2PMZN 2CQXA 4N4NB 5IPAA 4F52A 1FPQA 1T38A 3PQKA 1UJ8A 1B6AA 5DM7F 4EATA 2OCEA 2MG4A 4MGRA 5JLXA 3SDGA 4E7KA 1RIOH 3H35A 5B5EC 1USSA 3OIOA 4A3EJ 3V8KA 2KLOA 4XLPF 2J5OA 4M3FA 4XLEA 2XIGA 3HKZA 5EGOA 2AHQA 4EEFG 1U6GA 4HQMA 1OCRH 2HDWA 1ON2A 1L0OC 2M0MA 3MCZA 2EK5A 2XRNA 1MBKA 1TQIA 5AIPA 3ZQQA 4ESBA 5L3GA 3CUQB 2MA3A 2M0CA 4ZZLA 4KIFA 2XPWA 1ZLKA 2FMYA 4XQFA 3TOAA 3DBRB 1X1BA 1CQTA 4M9ZA 3SZTA 3PNYA 1DUXC 3BC8A 1GVJA 2V1UA 1MNEA 1KA8A 2D5VA 1D1BA 4I0BA 3OYIA 1Y1VJ 2DTZA 4Y17A 1VQPI 3BLYA 3WE2A 3GTOJ 3CDHA 4XLNF 3KP5A 2DI3A 4M73A 1CF7A 2CMPA 4UUSA 4B48A 5E17F 1YS6A 2H1LA 3GTPJ 3CLOA 2A05A 2VT3A 4F93B 4KN4X 5J1YA 4KUMA 1OCTC 3GYHX 3OOUA 2HYJA 3HTSB 1WJAA 3JCUC 1GHCA 5EEAA 4BXXJ 2DMPA 3WODF 4EM2A 3IKTA 2KPMA 3GVAA 4F91B 2CUEA 3WU2C 2RREA 4KT6A 4BJ5C 2LBFB 4B4CA 1U0JA 5IYBJ 3HOUJ 3DFGA 2E2IJ 4UHTA 1ETOA 2F5EA 3CMEI 4ENJA 2ELHA 2HQ5A 1X4OA 1ZARA 2E35A 1G3YA 3JRBA 3KETA 5E3NA 3ZCOA 1B59A 1NHAA 3ZRGA 4D9JA 3CDLA 3AG3H 2BY0A 3C2HA 3AG4H 3SZGA 2EA2A 3H9QA 4IOAF 4HX4A 2FSWA 2X48A 1XB4A 2CFOA 4LG3A 4CO8A 4RS8A 1SVMA 2EB7A 3QPLA 4G6DA 2OCCH 1DGRM 1MMNA 1SANA 3FBNB 1ENHA 3V8JA 1MSFC 4CHUA 3GTMJ 3BP8A 1WHUA 2OBPA 2KJBA 4QPOA 4ZZDA 3B02A 4NQWB 5ICFA 3OYHA 3KP4A 1K83J 3QYEA 4U7BA 1ETKA 3K0LA 3P9CA 3OOPA 5BQTA 2R92J 4I02A 4MLOA 4Z6YA 1X3ZB 4ZYEA 4IRGA 1TC3C 2LDUA 1OQYA 1P9QC 2IP2A 2EILH 2ME0A 4MHGA 4E7HA 1YHQI 2A69F 1GT0C 1LB2A 2P5VA 1J7KA 3RJPA 1G4DA 5TJJA 3IRQA 3LSKA 2R7VA 4LGWA 1G8XA 5TGTA 2DK8A 3GEZA 1ZTRA 1HA8A 5TRDA 2K5CA 2JWTA 3PO2J 2JPBA 2EQRA 3B6AA 3J81K 2FMLA 3I54A 2W84A 2E1MC 5FRNA 3FDYA 3F21A 4NHJA 2AS5F 3ZQFA 5EZGA 2MH2A 3V4GA 4IXAA 2K85A 3OYFA 2O5RA 4FX0A 3CMMA 4I2OA 5GPCA 5M5WJ 3CCRI 2WY8Q 2KJCA 4RLQA 1IUFA 3CUQA 1EH6A 1I1SA 2TCTA 3CDIA 3WG9A 3BY6A 4L9NA 3IWFA 2YSRA 3FXKA 1DP3A 3HEFA 4MFEA 2LVSA 3J7ZI 1UAAA 4LK1F 1IO2A 4XBFA 4XKWA 2P5KA 2GWRA 5IT3A 3WGGA 1YO5C 1AKHB 4KIBA 4W1UA 1EJ9A 4HNVA 4Y7NJ 2ZCWA 1FYMA 4NB5A 5FRMA 1XGNA 1UMQA 4BQQA 4A69C 4UV9A 1OISA 3HIFA 1XSVA 4KIGA 2HS5A 2G0EA 1U2WA 2MH9A 2QKLB 5LBQA 1ERDA 2VKEA 1BI3A 2RQQA 4UB8C 3T8RA 2WV1A 2VE9A 4JOMA 1GV5A 1P6RA 3Q9VA 1D0XA 3JRGA 3ABLH 4A3DJ 1WZ2A 3SJMA 2NOGA 1ODDA 2V6CA 2FNPA 2JZYA 3WTXC 1LE8B 2PI0A 2M8GX 3W2AA 2XPUA 1FX7A 4LMYA 2E71A 2E1NA 5FKKA 1AA7A 2M30A 3H9JA 2Y69H 5D8LB 4Y33A 4HLYA 3KP3A 4Q4ZF 1TWGJ 1OCCH 3K70C 4V19K 4M3DA 4HQEA 4XKVA 2A5WA 4ZYDA 1O57A 1SD4A 4PJLA 4U7DA 5H20A 4RB3C 2BEOA 3Q0VA 4OU0A 2O61A 2XPVA 3OYMA 3CCEI 4NC7A 1D8JA 3CC4I 3KX2A 5K7FA 3CQZJ 4GXOA 3SFIA 6PAXA 3F8CA 2DW4A 4Q48A 2BYVE 4I0AA 4WK8F 2O6GE 5LGTA 5HNFA 1ZHFA 2DDBA 2XAQA 4II3A 4FHTA 4CYDA 5IYCJ 2ZJ2A 2QGUA 3E6DA 1ZQ3P 2ESHA 3DEWA 3F6VA 4RM2A 1Z6TA 1UELB 4NQWA 2ZNZA 1QGPA 3FM3A 3NRVA 3DLLF 2XGCA 4EGZA 2MW8A 4AVZA 3WHCA 1RETA 3GLXA 3U1DA 5LD2C 2DJNA 2CU7A 5CQEA 3BWGA 2BY2A 3RCOA 1WJFA 1JUPA 1BR2A 3IH2A 4G7OF 2L7FP 3HPHA 4RBOA 1APLC 4O3MA 3E5UA 1R71A 1ZLJA 1VQNI 4CH7A 3HOXJ 4I99C 1IRFA 1UHWA 1QHHD 4GDFA 3K2ZA 3EYYA 4PFOA 3ZR8X 4DBQA 3RIRA 4EM0B 2CYYA 3HB9A 3GX4X 1Y39A 1S7EA 3BOQA 4BL0B 1BL0A 1FBSA 5H6RA 4LB6B 1VQ6I 3QU3A 2V79A 1I6HJ 2YX4A 4RAFA 4E7ZA 2DT5A 3G1MA 3IRRA 3K1PA 1OLTA 3FM5A 4BH9A 4XICA 3T1BA 4KMFA 2HZTA 1KU2A 3DPTA 2Y75A 2MSYA 2AQFA 2QSFX 1I3AA 3I0TA 3JRHA 1TQMA 1P4AA 4HV5A 2FNAA 2KIQA 5HS9A 2XROA 1OR7C 2Y0SN 1R49A 4JP0A 2XDVA 3TKYA 1V54H 1SD5A 3T5XA 2Y9ZA 2WC2A 1YOVB 4HNTA 1AKHA 1TL8A 4ZH4F 1DDNA 3IH3A 2K02A 4HW0A 4XOPA 4NBQA 2HPIA 4HZFA 2XRLA 3K4NA 2CQNA 4KYWA 4IHSA 3F72A 3GUDA 2IA2A 3QPTA 3EYIA 2BVMA 3KYCB 3T0YA 4PJ0C 4M3GA 1FMVA 2EIKH 3HDDA 2LC2A 2ECBA 2ZXJA 3A03A 1BR1A 2X6YA 3H9GA 1IZ1A 1PUFA 1Z91A 2E2HJ 4CGZA 1TWFJ 4A3GJ 2F6CA 1R6RA 1IDZA 3OYDA 2R3SA 3CCMI 3JSPA 3BTLA 3H3ZA 3L1PA 2GIZA 5F04A 2G9WA 4D5CA 1LE8A 2IVMA 2H94A 5EYRA 1BJAA 1HKTA 3OWTA 3L2CA 1LFUP 1FSHA 2PMHA 2M7AA 4OWRB 2DT6A 5E20A 1TTYA 2EFOA 5DUIA 3MKYB 3JTGA 1XCVA 4HPQA 5L3CA 5AONA 2GIVA 2GOXB 3J81Z 1T56A 5K5OA 1EV7A 3JRAA 3COAC 2K40A 2JPCA 4A12A 2CV1A 2UXXA 1WKMA 3TL4X 3QU6A 3UR3C 4WXCA 2OC6A 2VXZA 1LEBA 2JN6A 4MTEA 2CUFA 2L02A 2V1XA 2LKPA 5J4VA 1N78A 3RQIA 3K10A 2Q8KA 5GTHC 3TBIA 5KAIC 2WAEA 3VDXA 5D8KB 4M3BA 2EFQA 2XASA 2X9DA 2BVLA 3CO6C 5F27A 1VI0A 4YRVA 2HOSA 5CVUA 1R9TJ 1IV8A 2NXNB 5E8IA 4UNOA 2LLKA 1VQLI 2K9NA 1PYVA 2F4IA 1XN7A 1QPMA 2GM4A 4WXHA 3S3MA 1UCRA 2HR3A 3REOA 4AU7A 1L3LA 3DU5A 1FOXA 4WXDA 2QZ8A 3A1YA 5JLWA 4XRSA 4Q47A 4ESFA 4XSXF 4IVNA 2L2OA 4BBRJ 2H09A 2PMUA 3A0BC 2IS4A 1P7JA 2XGDA 3R0AA 5J6XA 2VOPA 1R5HA 3OL4A 1V55H 3QAHA 2XAHA 5DDGA 2PQ8A 5K1YA 2ZXHA 2VOOA 4X0GA 4BGDA 2X1EA 3S1RJ 1Y0NA 4CCJA 4B44A 3QOPA 5E3MA 2L4MA 1E17A 4IKFA 1MJ9A 2Z3YA 5E79C 1IXRC 1YQAA 2DCEA 3BT9A 2V26A 4CUGA 2CSOA 3HGYA 1EH7A 2F2EA 3OS1A 1KU3A 4QTRA 2GXAA 4NC6A 3TO9A 3HZJA 2ZC2A 3HUGB 4L5EA 3MMYB 5DUKA 2PLYA 3CD6I 1XSDA 1K4TA 2NRAC 4XLFA 1I1GA 3BG7A 3LSPA 4KISA 1IN8A 1OCPA 2EBIA 2PJRB 1FSEA 5HOOA 4IJAA 1WJ5A 2CV2A 1Z7UA 2QLZA 1A31A 2RN7A 2YPRA 3DTIA 4PSWA 5F08A 2CQQA 3TP0A 5HLTA 2HDCA 5LRSA 2IS1A 5L3FA 1BI1A 2CS3A 1IJWC 5LGNA 3H0DA 3G2BA 3BZKA 1W7PB 4AUXA 3LSGA 5ILSA 1BR4A 2P4WA 3ZQGA 1LDDA 4QSHA 3QYFA 3WGIA 2IS2A 3OYNA 3CC2I 1BW6A 1GUUA 3FXJA 1U9OA 3E97A 2LD5A 3U1KA 4L5IA 2E5NA 4DZPA 4C3JJ 1NTCA 3HPGA 2L54A 3W2VA 5ICGA 3CCLI 4Y3OA 5LFAA 3LSRA 1ZG3A 3WTVC 5EDNA 1Q1HA 1JHFA 4M3EA 2QA4I 5FFZA 5ILUA 2NS8A 3ECOA 4MEXF 2HVSA 1T0FC 1XG1A 3KFWX 4RAGA 3HG9A 1MNDA 3OSFA 1IRGA 3ABTA 2R7SA 1B9MA 1BI2A 2M4GA 1X1CA 4BHPA 1ZR4A 3HTUA 1HKSA 4P55A 5E1XA 2ZMEB 1QNTA 2WB1N 2E34A 3MZYA 2ZXIA 3O8HA 3KEQA 2OPTA 3CCSI 2A6EF 4FT8A 4A0ZA 1W0UA 2UWMA 3ONQA 4EGYA 1ZYRF 3KPHA 1R00A 1JT6A 2XKOA 2BXZA 4YFXF 3R0JA 2DMTA 4LLGF 4A2UA 5M5YJ 2KL4A 4XSZF 2DJIA 4A3MJ 2FD5A 1U78A 2R7XA 2BE5F 3GZ5A 4CCNA 1IC8A 4F7ZA 1RPWA 2F4OB 3NWTA 2A61A 3EUHA 2Y2ZA 1YI2I 1JKPC 2MC4A 2I5UA 3DEUA 1LVKA 4CCKA 3BR0A 1A36A 4KT5C 1A5JA 4PZJA 1X2NA 2NVYJ 2OQRA 2VPRA 4B3AA 2Z1DA 2XVCA 4A3JJ 2X0LA 3E5XA 2KIFA 5B1BH 4P96A 3N4MA 2R7QA 4IZZA 1MZBA 2P7CB 1XTAA 3ASNH 2XSJC 2O8KA 3BG6A 4BDZA 1Y1WJ 5CVVA 4CCMA 4LG0A 1BW5A 2EV5A 1OMIA 3RPUA 1R23A 3CCUI 1T6SA 4HF1A 3OYGA 1LFPA 2DK5A 3WTZA 4WCGA 3DWLE 3RSNA 3BG9A 1D3YA 1JGSA 1TLHB 2Z5UA 4D7NA 3HUGA 4GFBA 4AWXB 3NAUA 1MNMC 3AAFA 3BR6A 3S8PA 1MD0A 2DYSH 3KP7A 1XPXA 3S16J 4L0YB 1HW1A 3LFUA 2E1OA 4U0VA 5J4YA 5IOYA 2VC0A 4ZTJA 2F48A 4M9XA 3ZP5A 1IG7A 2P6TA 3FXUA 1O3RA 5CVIA 3LAJA 3K9TA 2VI6A 3M3YJ 2VBWA 5J8FA 1LKXA 1IV6A 3ZXSA 1STZA 3F6OA 1W7PA 3BR5A 4O5VA 3P9KA 3S2DJ 2IJLA 1FZPB 5JVTA 4BY7J 1Z7LA 2PEXA 2P5LC 4V2FA 1Z3YA 1TW2A 1Y8QB 2O8XA 4AVPA 3JRIA 1HSTA 3TGNA 2ETHA 4A3KJ 1PP8F 5H2FC 3W2WA 2WAQN 3UKGA 5HLHA 2ZB9A 5FLVA 1JGGA 3PSFA 3FKJA 3H1CA 1QBJA 1B9NA 1GXQA 3ECHA 1T95A 5IY5H 4OIOF 4UVCA 2HI3A 2O7OA 4GYIA 2DBBA 4M72A 1NK3P 4BHCA 2Y0MA 3SYTA 2MLGA 4AIDA 1R36A 2OQGA 2ICWG 3H5NA 4IRHA 4OIRF 3IV5A 1C0WA 2JRTA 1ZRFA 3BZ6A 1SAUA 4R79A 2JA6J 1Z1DA 2ZMEA 3PL8A 2DTRA 3SDBA 3M8EA 3MAJA 3C2BA 2EZKA 2YUSA 4XRFA 4QWQA 1LUJB 3BCBA 2PFBA 2HTSA 3G4SI 4BEHB 2ZO4A 1P4XA 2MYSA 3QP5A 3QYBA 1A04A 3E0JB 3FHNA 3ROUA 2DXIA 2HVRA 3E7LA 1FP1D 3QRFF 2R7OA 3GBGA 3ZGKA 3E6BA 3J7AO 2NS0A 2HVQA 5HLIA 2XB0X 4YIRX 4PGGA 2R93J 1KZHA 1MMDA 3AFHA 1I5ZA 2GXBA 2K9MA 3QP6A 3EUAA 4YIFA 1SFUA 1MH4A 2ZXWH 2N8GA 3IAS2 4A6EA 4XIDA 1R7JA 2GXGA 4XKBA 2M3AA 2W82A 2NS7A 5M5XJ 1OCZH 1IXCA 2UV1A 2LK2A 2M2EA 2IGMA 3ISPA 2ZBKA 3PQJA 3WGHA 3FMSA 5C4JJ 4D0PA 2VKVA 2IXSA 3DKXA 2K9QA 3CCQI 3GWZA 3HRSA 2GAUA 2HWVA 2AQEA 2HXIA 3PFIA 3CUQC 3K6GA 4G94A 4KJZA 3WHBA 4C2UA 5DCFA 2R7UA 1LJ9A 4XLCA 4HAMA 5F1JA 3JAMK 5D5XB 1TNSA 4ENNA 2H6CA 1JTXA 2GA1A 3CJRB 5AIQA 4A3LJ 2BHYA 1J09A 1LNWA 2CO5A 3V7CA 3HOSA 3LA7A 2QCOA 3AKZA 3HL2A 1D5VA 2BY1A 4KA4A 4PJJA 1Z6RA 1ETVA 3IH4A 1YLFA 1JUMA 3K4CA 2DDAA 4CZZA 2L5QA 2LY2A 5F64A 3GLLA 4I76A 2E2JJ 2XAGA 4KFCA 2JUGA 3LFKA 3VODA 3PJRA 1UG2A 1IUYA 2DOAA 2E5ZA 2K86A 5A2QK 4LD5A 2R7RA 1YYVA 5BOXA 4YELA 5CYVA 4L9TA 5C3EJ 1OYIA 1J9IA 2EV6A 2L7MP 2Z99A 2PMZA 5LEKA 1MJAA 1XMKA 4XOTA 4JX5A 4DW6A 3CJNA 2WAQA 4G7ZF 1XC5A 2R7TA 1A6QA 1MKMA 1XD7A 1DPRA 1HC8A 1X1DA 2CQ7A 2QQ9A 4F55A 1IN5A 1DQUA 1I39A 1RC9A 1WJDA 3VB2A 3M8FA 2IS6A 3I59B 3N05A 4OIPF 1FNNA 4MTDA 1JKOC 2HKOA 1EH8A 4PJNA 4U0WA 5DEQA 3WTSC 2Q0OA 3OMYA 4FE7A 4ZTFA 4RMNA 1RKWA 3KEOA 2B63J 4AC0A 1ORKA 2A68F 2M7BA 2D45A 1MDMB 2CH0A 3JRCA 2LRDA 1VQOI 2IPQX 3MFKA 1QO0D 3L2WA 3GTLJ 3B6CA 3KIOA 1W1WE 2OUMA 4BQNA 1VF9A 3S2HJ 1WI9A 2VT2A 2Y30A 1F43A 4Y13A 1ZREA 1BJZA 2IGKA 1PVEA 2EINH 2FEZA 2IGOA 4CCLA 1V5FA 1SMYF 2E19A 4DQ2A 4BY1J 3ABKH 5JI6A 1K7AA 4HF2A 2HOTA 4HNUA 1LPQA 1R4NB 4UY8I 2JJ7A 4G6TB 3T8TA 2K4JA 5HNHA 5BPIA 3J7YJ 2ZSIB 4RB1A 1ZG1A 1SEUA 1EKEA 1WRJA 4RLFA 2O0YA 5TISC 2X4HA 2WTEA 2L7KA 4EMSA 5BPDA 1XGSA 2CQKA 3LQRA 1N25A 4ESJA 2V6EA 3BJAA 2XF6A 5L3EA 3LSJA 3DBLB 4PGHA 3TW6A 1Q1VA 3ZMDA 3LA2A 5L3BA 2HZDA 2OV7A 4UVBA 4L5JA 3Q0WA 2DOEA 2E1CA 2LYCA 3VYRB 4LB5A 1RR7A 5IP7J 2FA5A 1QZZA 2LBFA 1R1UA 2ZNYA 2NNNA 3VYUB 1VQ4I 4YEJA 1ZAOA 3HSEA 3OR2C 1WJEA 2ADUA 4HBLA 3CTAA 3VSKA 2OF7A 2COMA 3KP2A 4JQFA 3SZPA 1VQKI 2M8EA 3RYPA 3ULQB 4TV7A 1X58A 4EVIA 4E4HA 1W5CC 1BN5A 5BMZA 2HEOA 5FKNA 2Y9YA 3L2RA 3PFYA 3GFJA 5D4SA 3S2WA 1OYWA 4XMYA 1ZH5A 3S3NA 1MBJA 1W7PD 3VSLA 3OYBA 2WAFA 1BOBA 3GW2A 2OU2A 4YFNF 4XN0A 3H36A 3EDPA 1HW2A 2VODA 4DZJA 4YFKF 2A3SA 2DMQA 5CQGA 3ABUA 3HOYJ 4ABZA 3DTKA 4HDUA 3VPRA 5FFXA 4DYRA 3BR1A 3U2RA 2Z33A 4BYYA 2EH3A 3E5QA 2CV0A 1ZK8A 2RVCA 3I59A 1JJ6C 1ZKGA 1P2FA 4CICA 3MZ8A 2FQ4A 3SHFA 1YW7A 3SQNA 5F0HA 2CJJA 3PUBA 3NQOA 3TW7A 2L0KA 4CSWA 1G59A 4EM1A 4AD9A 3KLNA 2H27A 3IWZA 1UB9A 1WH5A 2KFDA 3A4CA 4CYCB 1QVUA 1MDMA 4UUTA 4E7SA 1AHDP 1YX5A 2VJ4A 1YRNB 3A2KA 3PSIA 5ERIA 1HW5A 3JAMZ 1I3QJ 1YW8A 2HDDA 5DM6F 2QQAA 5HDKA 5LHGA 1U5TC 4BAYA 2CW7A 3MQ0A 3NEUA 3TDZC 3GFLA 5HVQC 4C30A 3V42A 2G7HA 1GVDA 3L2UA 1Y8RB 2DO7A 4FX4A 4F3QA 4RA2A 3RKXA 1FIPA 3GZNB 1QQIA 5A2QZ 2KDZA 2HPMA 4YG2F 4FASD 4MNUA 1BIBA 3DKWA 5B3SH 1TBXA 4S0HB 1JXSA 2UZKA 3ZMVA 3SFZA 3ZOBA 2WV0A 1QRYA 1O3SA 5JHUA 1MSEC 1R5GA 1Z21A 1PJRA 2CWEA 1F4KA 2V9KA 1REPC 1QU3A 1YIOA 4FE4A 1HCRA 2GBYA 3KP6A 4ETSA 2CW0F 2KDOA 4AIHA 2HFHA 4ASNA 5LHHA 4QLCU 3GCMA 4LOCA 1LDJA 3M7GA 5JVGF 3OS2A 1EA3A 2VBYA 2LMDA 2JSCA 1SFKA 5DS9A 1MMSA 1FYLA 4B09A 1F1ZA 1FOKA 1KQ0A 1XGOA 1MBEA 3U9GA 3A02A 5KAFC 1RI7A 4S05A 3BCAA 2LKXA 1N77A 3VYTB 3TO7A 1SMTA 2F5VA 4FISA 2W7NA 2D1VA 3GO5A 3NARA 5IYDJ 3F0CA 1ZRCA 4EJWA 1BIAA 1XCBA 1OPCA 3QODA 2X1DA 4RDUA 2VPLA 3DEEA 3G6EI 5GAEJ 5IP9J 3FX3A 4WX9A 2ZJQF 9ANTA 1W36D 5J1UA 1P7IA 2DODA 2VQHA 4UV8A 1MJBA 2IA1A 1VQ5I 2H8WA 3X2QH 2B0LA 4A5MA 2H6BA 3F8FA 4XORA 4HG2A 2HQAA 3LQQA 3RTRA 5JHFA 5FB2A 1TWAJ 3H5RA 2LFBA 1TZLA 2R7ZJ 3JREA 2LH9A 3D5SC 2PJPA 4IF4A 4HSRA 2HKXA 1LVAA 1BI0A 4GCVA 2HOAA 2K7LA 2W57A 3GTKJ 1BM9A 3HHHA 3M1EA 3BPXA 2NVTJ 2OTLI 3CJQB 1Z77A 3D5LA 1QPIA 2KP6A 2FX0A 5ILVA 4II2A 4DIQA 3ZQ7A 1VTNC 5D5WB 4L0ZB 3MKZA 3FISA 2MLKA 3KLOA 4JX4A 3CF2A 4A93J 1YS7A 2QM3A 4I7HA 2K4BA 1S8NA 4A3FJ 2JA5J 4CYCA 2LSOA 3KZYA 4Q5SF 1BC8C 2DN0A 2HYFA 1K6OA 3V7RA 3CMYA 2Y0SA 4LFUA 1YRNA 1FMWA 2VC1A 2DA6A 4QPQA 1JI8A 1YITI 2C6YA 1RESA 3K69A 3DBHB 1JJ8C 1X1AA 1Z0XA 2KZGA 2R7FA 1E3OC 3R4KA 2NVXJ 4HX7A 2IEKA 4A0XA 1WQ2A 4BE2A 2LY9A 1WH7A 3C18A 3EUHC 1GLNA 1I6XA 1TT0A 1ZR2A 1T98A 2DFEA 1Z9CA 2VE8A 1ETXA 2ZJRF 4OAZA 4XKCA 4A3BJ 1Z05A 2WBMA 2F4MB 5ICEA 2R0QC 2RGVA 1KONA 1RKTA 2W25A 5DCMB 4D1QA 1MBFA 2HOEA 4BUPA 3WTUC 3F8NA 4XL9A 5CLSA 4YIIA 2IT0A 3IL2A 3QOEA 4BE0A 1F5TA 4NDLA 2R5ZB 1SVLA 1YW9A 3I4NJ 2VXDA 3GTGJ 3IUOA 1HXDA 5EEGA 2QF7A 3GMEA 5H6QA 4V2GA 3WU1B 4KMUX 5J47A 2EJRA 1XDSA 3FMRA 5M3MJ 1B8IB 3AL0B 1V3FA 2L9VA 2AXLA 2QBYB 2LY1A 3B73A 5D6FA 4HA8A 4QIWN 1KYWA 2IBDA 1RNLA 2R5YB 1K78B 3CESA 5K5QA 2FQ3A 2K3FA 3CMAI 1FTTA 3D1NI 1X2MA 2JA8J 5EEHA 3L2VA 1IW7F 1B1BA 1EF4A 3S15J 3O2PE 4HRIA 1J59A 4IHTA 4GYGA 2DFIA 4ENKA 1XDUA 3FXLA 3Q9SA 2JUCA 5FKOA 3F22A 2DOFA 2LF8A 4XR6A 2R7WA 2QSGX 1Y0UA 4HX8A 2STWA 2W85A 3CJTB 1W5TA 4XK4A 2XKPA 2NAZA 2W4SA 1D0YA 3QPSA 4EJUA 4IL6C 3S1MJ 3LMMA 4M6XA 4OOIA 2ZFUA 5DYMA 2K3PA 4G7HF 2K9LA 1U8RA 5LHIA 3HKZN 2FUG2 3G3ZA 2DPDA 2ZSHB 1SD6A 2DMUA 1FTZA 5FD5A 1SFXA 1QVTA 2E60A 3MN2A 2RNGA 2DA3A 5FLXK 2EZHA 4A6DA 4IQJA 2A6HF 3K4MA 5CJ9A 1HDPA 2FU4A 1UFMA 4H0EA 2V1DA 4K2EA 2ELKA 5FROA 2JQ7A 4G9YA 3FBIB 1UZCA 4KDPA 3F8MA 1TWHJ 1XMXA 5DV5A 1IF1A 3DKYA 4CCOA 1RZ4A 4L9VA 2A07F 1CF7B 3ML6A 2NVQJ 3BJOA 5FO5A 1K4SA 4UUSB 2LTPA 2DFHA 4ZYGA 4BBSJ 2L9SA 4M71A 3CF5F 3L00A 4A3IJ 2DLLA 3M1CA 1KGSA 3PUFA 4UXNA 1QA6A 3PM1A 1T39A 4BS9A 2PJRA 1WCMJ 2FBIA 4Y15A 4LLNA 1XS9A 4IPAA 4C3HJ 1H9TA 2Y31A 2X6OA 5E1WA 3PNVA 1ZRDA 3QQAA 4C9YA 3E6MA 3RKQA 5KCMA 4IHWA 5E3LA 1G3SA 2EFWA 2DA5A 4FETA 3OYAA 3RI4A 3HRTA 1KQ8A 1U9NA 2Q2EB 4J01A 2ZFWA 1E3HA 5LEJA 1JKQC 3FXMA 3DXJF 1T0FA 1UHMA 2VBZA 2R5ZA 2JRMA 3ESWB 3MKLA 5HDNA 3CZ6A 2IGNA 4P9FA 1VFCA 2OJED 1ULYA 1HOMA 4PSXA 5L3DA 2LNBA 3ZQCA 3CCYA 1U8BA 1WI3A 4C2MJ 2JA2A 2M45A 1YE9A 1DP7P 2AXTC 3FIWA 3E1SA 3OS0A 1B8IA 3RZOJ 3L9FA 3ZQLA 2P7VB 2QBYA 4RGRA 3ZMZA 4GRIA 1DPUA 3FXOA
chains in the Genus database with same CATH topology
1ZG5A 1K78A 1O7LA 4MQVA 1BOAA 4GGGA 2TDXA 1H9GA 4B8XA 2ACJA 1OYYA 2M5WA 3O6BB 5LRRA 3C7JA 1XSXA 2L4AA 2ISZA 3I4PA 3DPLC 1IAWA 4Z2YA 2P8TA 2OZ6A 2JT1A 3I5UA 5DD4A 2K27A 3QPHA 3DV8A 4BQAA 3D0SA 1PUEE 5KK1A 1U3EM 2FXAA 1IXSB 5LLQA 3LSTA 3M9AA 1J5YA 1FT9A 1XMAA 5CVJA 2RC4A 4BNCA 2XAFA 2EV0A 1RUOA 4HLXA 2O03A 4UVAA 4JBAA 3I71A 4N9HA 2DPUA 2RKHA 3FHZA 3N97A 1O3QA 3FMQA 2RDPA 3F8BA 3V8LA 2Q2EA 4RGXA 5F6FA 3WTYC 1IN4A 3J80K 4RGSA 2D1HA 5BS6A 1MGTA 1GXPA 2QQBA 2F5DA 5HLGA 2STTA 3TO6A 1USTA 4PCQA 3V7SA 1E2XA 3KZZA 5ICCA 5FLXZ 3F3XA 3OV8A 2OD5A 2IW5A 2P6SA 1PDNC 3GFIA 2PN6A 1T2KA 3ERED 4RGUA 3F23A 2HQRA 4R1HA 1IN6A 2QYOA 4P5OA 4MQ9F 4KN7X 1BBYA 4A0YA 2NYXA 2F5CA 3BJ6A 4E70A 1HSJA 4AIKA 1X3UA 1KYZA 2IA0A 4EJOA 1IN7A 3DQVC 3HRUA 2IRFG 1FLIA 2KIMA 3WU0A 2G7UA 3LWFA 4JK1X 1W4MA 2HTJA 2CG4A 3MEXA 3G73A 5DD8A 2RQPA 2YR2A 2FBHA 3GF2A 3FXRA 2UXNA 3DP7A 3RKWA 1F9NA 2ZKZA 2PG4A 2FBKA 5IT9K 3IC7A 2NNYA 2KRFA 2EA4A 4HOBA 3O3KA 3JTHA 4O6JA 5JFRA 4UUVA 4MEYF 1G6NA 4HDVA 5K5RA 4OMYA 1XGMA 1ZGAA 3FF5A 1TW3A 3JSOA 3I64A 3ZN0A 2RV8A 2CGPA 2L3DA 4M74A 2XGXA 1U5TB 4L9JA 5JR3A 3ZMSA 2QUFA 1ONVA 2OAZA 2R7DA 2W24A 3GZ6A 3I58A 4R8HA 2JTVA 2HGCA 2DU9A 2FRHA 1S7OA 1ZN2A 2DAOA 1HKQA 5J8CA 3R61A 5KVRA 1TNTA 2MD5A 3ZMUA 3EETA 4U0YA 1O3TA 4RB0A 3ZMTA 1R22A 4I01A 4I09A 2Y48A 3WTWC 1OKRA 1YG2A 1G3WA 5FGMA 3J80Z 1S7AA 3P9IA 4GO1A 1FP2A 1FBQA 5LGUA 2O3FA 2FE3A 2EFNA 2EFPA 1FWZA 4S04A 4M6YA 3GXOA 2BBYA 1P92A 3E6CC 3C1DA 4A5NA 2M1BA 4U88A 4IRIA 2D2WA 1V4RA 1FC3A 3E3VA 1SAXA 1KQ9A 2VN2A 4P9UA 3HOTA 2XAJA 2KIUA 4HV6A 1R58A 3RKYA 3LA3A 3KE2A 1S3JA 3TOBA 5D4RA 5HS8A 3K1NA 3C3WA 4CDGA 2PBIA 3MZHA 2YU3A 5E8GA 3W6KB 1OR7A 1U5TA 2YX7A 3BDDA 3W6JB 3CO7C 1CGPA 2VBXA 3IKVA 5E1ZB 1W5SA 1FY7A 2HYGD 1LQ1A 4EJTA 4BHBA 3VEPA 1YFHA 2L01A 3I53A 5E18F 1ON1A 3R6SA 5ED4A 2E7WA 2FOKA 2QENA 5IT9Z 1KU9A 2ISYA 3HYIA 2ESNA 3H3UA 3TDUC 2OA4A 4EQQA 2VONA 1I27A 1S29A 4HYEA 4LG0B 1WSUA 5D5VB 2Z9OA 2M87A 4HF0A 3BROA 3RYRA 1TQPA 1FBUA 1HQCA 1KU7A 1ZGJA 4ZYHA 5D6EA 4L18B 3FZVA 4KICA 1P4WA 1J2XA 4RB2C 1FYKA 5HS7A 4LLLA 4RAZA 1K79A 4WF2A 2FF4A 4G8XA 1HBXG 4N0BA 3LAPA 3DF8A 4RAYA 3JW4A 3RPQA 4AIJA 3VFZA 1QZYA 2HQNA 4EJVA 1B4AA 4ON0A 4N9IA 3KCCA 2LF7A 4OINF 2OZUA 1WWXA 2BGCA 2V9VA 2DQLA 4M9SA 3TQNA 2WWYA 3ZPLA 3WE3A 3P7NA 3Q5FA 4LK0F 2GA2A 4OMZA 3R60A 1JHHA 3EQLF 2QWWA 2MC3A 1R1TA 1AOYA 1JE8A 3HRMA 2XUBA 3FXQA 3HSRA 3GFMA 4CXFA 2XHKA 2BV6A 1S6LA 2QVOA 4G6QA 3H92A 4OIQF 4I98B 4BXUA 3MWMA 1D8KA 4ENMA 4LJZF 2KKOA 2A5YB 3BPVA 5F1RA 1PP7U 1LEAA 3ELKA 1SFEA 1G3TA 3SXYA 3RDIA 1H0MA 1SD7A 2EWNA 2XV4S 1BC7C 5HDGA 5D5UB 2J5PA 3ZN1A 2DQRA 4PDKA 2GQQA 3CUOA 5DCMA 3FWEA 1R1VA 3HSFA 3WTTC 2E7XA 3L09A 2RNJA 3IHUA 1YTYA 1AWCA 4DNCA 2MBFA 3L7WA 5CVRA 4WWCA 2GZWA 3HHGA 1O7FA 1J0RA 1J75A 2F5FA 2CFXA 1RUNA 1LDKB 3K1MA 4KNYA 5FD6A 4EV0A 3VOEA 1FPQA 1T38A 3PQKA 1B6AA 4MGRA 1RIOH 1USSA 3V8KA 4XLPF 2J5OA 2XIGA 1U6GA 4HQMA 1ON2A 1L0OC 3MCZA 2EK5A 2XRNA 5AIPA 1TQIA 4ESBA 5L3GA 3CUQB 2MA3A 4ZZLA 4KIFA 1ZLKA 2FMYA 3TOAA 4M9ZA 3SZTA 1DUXC 1GVJA 2V1UA 1KA8A 4I0BA 4Y17A 3WE2A 3CDHA 4XLNF 3KP5A 2DI3A 4M73A 1CF7A 5E17F 1YS6A 3CLOA 2VT3A 4KN4X 4KUMA 3GYHX 3HTSB 1GHCA 3WODF 4EM2A 3IKTA 3GVAA 3DFGA 4UHTA 2F5EA 4ENJA 2ELHA 1ZARA 1G3YA 3KETA 1B59A 1NHAA 2EA2A 4HX4A 2FSWA 1XB4A 4CO8A 4RS8A 2EB7A 4G6DA 3V8JA 4CHUA 2OBPA 3BP8A 2KJBA 4ZZDA 3B02A 5ICFA 3KP4A 4U7BA 3K0LA 3P9CA 3OOPA 5BQTA 4I02A 4ZYEA 4IRGA 2LDUA 4MHGA 2IP2A 2A69F 1LB2A 2P5VA 1J7KA 3RJPA 1G4DA 5TJJA 3IRQA 4LGWA 2DK8A 3GEZA 5TRDA 2JPBA 3J81K 2FMLA 3I54A 2W84A 3F21A 4NHJA 2AS5F 2MH2A 3V4GA 4IXAA 4FX0A 4I2OA 2KJCA 3CUQA 1EH6A 1I1SA 3WG9A 3BY6A 4L9NA 3IWFA 2YSRA 4LK1F 4XBFA 2P5KA 2GWRA 5IT3A 3WGGA 1YO5C 4KIBA 2ZCWA 1FYMA 4NB5A 1XGNA 4UV9A 3HIFA 1XSVA 4KIGA 2HS5A 1U2WA 2MH9A 5LBQA 1BI3A 3T8RA 2VE9A 1P6RA 3Q9VA 1ODDA 2V6CA 2FNPA 2JZYA 3WTXC 2PI0A 1FX7A 4LMYA 2E1NA 2M30A 5D8LB 4HLYA 3KP3A 4Q4ZF 4HQEA 4ZYDA 1O57A 1SD4A 4U7DA 5H20A 4RB3C 2BEOA 4OU0A 2O61A 1D8JA 4GXOA 6PAXA 3F8CA 2DW4A 4Q48A 2BYVE 4I0AA 4WK8F 2O6GE 5LGTA 1ZHFA 2XAQA 4FHTA 4CYDA 2ZJ2A 3E6DA 2ESHA 3F6VA 1Z6TA 4NQWA 2ZNZA 1QGPA 3FM3A 3NRVA 4EGZA 3GLXA 3U1DA 3BWGA 4G7OF 4O3MA 3E5UA 1ZLJA 1IRFA 1UHWA 3K2ZA 3EYYA 3RIRA 4EM0B 2CYYA 3GX4X 3BOQA 1FBSA 5H6RA 4LB6B 3QU3A 2V79A 2YX4A 3IRRA 2DT5A 3K1PA 3FM5A 4BH9A 3T1BA 4KMFA 2HZTA 1KU2A 3DPTA 2Y75A 3I0TA 1TQMA 1P4AA 4HV5A 2FNAA 5HS9A 2XROA 3TKYA 1SD5A 3T5XA 2WC2A 4ZH4F 1DDNA 4HW0A 2K02A 4HZFA 4KYWA 4IHSA 3F72A 3GUDA 2IA2A 3QPTA 3EYIA 3T0YA 2ZXJA 1IZ1A 1Z91A 4CGZA 2R3SA 3JSPA 3H3ZA 2G9WA 2IVMA 2H94A 1BJAA 1HKTA 3L2CA 1FSHA 2PMHA 5E20A 1TTYA 2EFOA 5DUIA 3JTGA 1XCVA 5L3CA 5AONA 2GIVA 3J81Z 5K5OA 1EV7A 3COAC 2JPCA 4A12A 2UXXA 1WKMA 3QU6A 4WXCA 2VXZA 1LEBA 4MTEA 2L02A 2V1XA 2LKPA 2Q8KA 5D8KB 2EFQA 2XASA 3CO6C 5CVUA 5E8IA 4UNOA 1XN7A 1QPMA 4WXHA 1UCRA 2HR3A 3REOA 1L3LA 4WXDA 2QZ8A 4Q47A 4ESFA 4XSXF 4IVNA 2H09A 2PMUA 3R0AA 5J6XA 2VOPA 1R5HA 3QAHA 2XAHA 5DDGA 2PQ8A 5K1YA 2VOOA 3QOPA 2L4MA 1E17A 1MJ9A 2Z3YA 1IXRC 1YQAA 2CSOA 1EH7A 2F2EA 1KU3A 3TO9A 5DUKA 2PLYA 1XSDA 2NRAC 1I1GA 1IN8A 1FSEA 5HOOA 4IJAA 1Z7UA 2QLZA 2RN7A 2YPRA 2HDCA 5LRSA 5L3FA 1BI1A 5LGNA 1W7PB 5ILSA 2P4WA 1LDDA 3WGIA 3E97A 4L5IA 2L54A 5ICGA 1ZG3A 3WTVC 1Q1HA 1JHFA 5FFZA 5ILUA 3ECOA 4MEXF 3KFWX 1IRGA 3ABTA 1B9MA 1BI2A 4BHPA 3HTUA 1HKSA 4P55A 5E1XA 2ZMEB 1QNTA 3MZYA 3KEQA 2A6EF 4FT8A 4A0ZA 2UWMA 4EGYA 1ZYRF 1R00A 2XKOA 4YFXF 3R0JA 4LLGF 4A2UA 4XSZF 1U78A 2BE5F 3GZ5A 4F7ZA 2A61A 3EUHA 3DEUA 4KT5C 4PZJA 2OQRA 2XVCA 2X0LA 3E5XA 2KIFA 4P96A 3N4MA 1MZBA 2P7CB 5CVVA 4LG0A 2EV5A 1OMIA 3RPUA 1R23A 1T6SA 4HF1A 2DK5A 3WTZA 4WCGA 1D3YA 1JGSA 1TLHB 2Z5UA 3HUGA 4AWXB 3AAFA 1MD0A 3KP7A 4L0YB 1HW1A 4U0VA 2VC0A 4M9XA 3ZP5A 2P6TA 3FXUA 1O3RA 5CVIA 3LAJA 3K9TA 2VBWA 5J8FA 1STZA 3F6OA 1W7PA 4O5VA 3P9KA 2IJLA 1FZPB 5JVTA 2PEXA 2P5LC 1TW2A 2O8XA 4AVPA 1HSTA 3TGNA 2ETHA 1PP8F 5HLHA 1QBJA 1B9NA 1GXQA 3ECHA 4OIOF 4UVCA 4GYIA 2DBBA 4M72A 4BHCA 2Y0MA 2MLGA 1R36A 2OQGA 4IRHA 4OIRF 1C0WA 2JRTA 1ZRFA 3BZ6A 4R79A 1Z1DA 2ZMEA 2DTRA 3M8EA 3MAJA 4XRFA 4QWQA 2PFBA 2HTSA 2ZO4A 1P4XA 3QP5A 1A04A 3ROUA 1FP1D 3QRFF 3E6BA 3J7AO 2NS0A 5HLIA 4PGGA 1I5ZA 2GXBA 3QP6A 4YIFA 1SFUA 4A6EA 1R7JA 2GXGA 1IXCA 3ISPA 2ZBKA 3PQJA 3WGHA 3FMSA 4D0PA 3GWZA 3HRSA 2GAUA 2HWVA 4G94A 3PFIA 3CUQC 5DCFA 1LJ9A 4HAMA 3JAMK 5D5XB 1TNSA 4ENNA 2H6CA 2GA1A 5AIQA 1LNWA 2CO5A 3V7CA 3HOSA 3LA7A 1D5VA 4KA4A 1Z6RA 1YLFA 4CZZA 5F64A 2XAGA 4KFCA 3LFKA 3VODA 1IUYA 2K86A 5A2QK 4LD5A 1YYVA 5BOXA 5CYVA 4L9TA 1OYIA 1J9IA 2EV6A 2Z99A 5LEKA 1MJAA 1XMKA 3CJNA 4G7ZF 1MKMA 1XD7A 1DPRA 2QQ9A 1IN5A 3VB2A 3M8FA 3I59B 4OIPF 1FNNA 4MTDA 2HKOA 1EH8A 4U0WA 5DEQA 3WTSC 2Q0OA 3KEOA 2A68F 2D45A 1MDMB 2IPQX 3MFKA 1QO0D 1WI9A 2VT2A 4Y13A 1ZREA 2FEZA 1SMYF 4DQ2A 5JI6A 1K7AA 4HF2A 3T8TA 2K4JA 5BPIA 4RB1A 1ZG1A 1WRJA 2O0YA 2X4HA 2WTEA 4EMSA 5BPDA 1XGSA 2CQKA 3LQRA 4ESJA 3BJAA 5L3EA 4PGHA 3ZMDA 3LA2A 5L3BA 4UVBA 4L5JA 2E1CA 4LB5A 2FA5A 1QZZA 1R1UA 2ZNYA 2NNNA 1ZAOA 3HSEA 2ADUA 4HBLA 3CTAA 2COMA 3KP2A 4JQFA 3SZPA 2M8EA 3RYPA 3ULQB 4TV7A 4EVIA 1BN5A 5BMZA 2HEOA 3GFJA 5D4SA 3S2WA 1OYWA 1ZH5A 1W7PD 3GW2A 2OU2A 4YFNF 3EDPA 1HW2A 2VODA 4YFKF 2A3SA 3ABUA 4HDUA 5FFXA 3U2RA 2Z33A 4BYYA 3E5QA 2RVCA 3I59A 1P2FA 4CICA 3SHFA 1YW7A 3SQNA 3NQOA 4EM1A 4AD9A 3KLNA 2H27A 3IWZA 1UB9A 1MDMA 5ERIA 1HW5A 3JAMZ 1YW8A 2QQAA 5HDKA 5LHGA 1U5TC 4BAYA 3MQ0A 3NEUA 3TDZC 3GFLA 5HVQC 2G7HA 2DO7A 4FX4A 3RKXA 5A2QZ 1QQIA 4YG2F 4MNUA 1BIBA 3DKWA 1TBXA 1JXSA 2UZKA 3ZMVA 3SFZA 2WV0A 1O3SA 5JHUA 1R5GA 2CWEA 1F4KA 1REPC 1YIOA 3KP6A 4ETSA 2CW0F 4AIHA 2HFHA 4ASNA 5LHHA 4QLCU 1LDJA 3M7GA 2VBYA 2JSCA 1FYLA 4B09A 1F1ZA 1FOKA 1KQ0A 1XGOA 3U9GA 1RI7A 4S05A 3TO7A 1SMTA 2D1VA 3GO5A 1ZRCA 4EJWA 1BIAA 1XCBA 1OPCA 4WX9A 3FX3A 4UV8A 1MJBA 2IA1A 2B0LA 4A5MA 2H6BA 3F8FA 3RTRA 3LQQA 5FB2A 2PJPA 4IF4A 2HKXA 1LVAA 1BI0A 4GCVA 2K7LA 2W57A 1BM9A 3HHHA 3M1EA 3BPXA 3D5LA 5ILVA 3ZQ7A 1VTNC 5D5WB 4L0ZB 2MLKA 3KLOA 1YS7A 2QM3A 4I7HA 2K4BA 1S8NA 2LSOA 3KZYA 4Q5SF 1BC8C 1K6OA 2HYFA 3V7RA 4LFUA 2VC1A 2C6YA 3K69A 2R7FA 3R4KA 4HX7A 4A0XA 1WQ2A 3C18A 1I6XA 1T98A 1Z9CA 2VE8A 1Z05A 5ICEA 2RGVA 2W25A 5DCMB 2HOEA 3WTUC 3F8NA 5CLSA 4YIIA 2IT0A 3IL2A 1F5TA 1YW9A 1HXDA 5EEGA 5H6QA 3WU1B 4KMUX 2EJRA 1XDSA 3FMRA 1V3FA 2AXLA 2QBYB 3B73A 5D6FA 4HA8A 1KYWA 1RNLA 1K78B 5K5QA 2FQ3A 5EEHA 1IW7F 1B1BA 3O2PE 1J59A 4IHTA 4GYGA 2DFIA 4ENKA 1XDUA 3Q9SA 3F22A 2LF8A 1Y0UA 4HX8A 2STWA 2W85A 1W5TA 2XKPA 2NAZA 4EJUA 4M6XA 4OOIA 5DYMA 4G7HF 1U8RA 5LHIA 3G3ZA 2DPDA 1SD6A 5FD5A 1SFXA 5FLXK 4A6DA 2A6HF 5CJ9A 2FU4A 1UFMA 4H0EA 2V1DA 4K2EA 4G9YA 4KDPA 3F8MA 5DV5A 1IF1A 1RZ4A 4L9VA 2A07F 1CF7B 3ML6A 3BJOA 5FO5A 4ZYGA 4M71A 3L00A 2DLLA 1KGSA 4UXNA 1T39A 2FBIA 4Y15A 4LLNA 4IPAA 1H9TA 5E1WA 1ZRDA 3E6MA 1G3SA 2EFWA 3RI4A 3HRTA 1KQ8A 2ZFWA 5LEJA 3DXJF 1T0FA 1UHMA 2VBZA 5HDNA 4P9FA 1ULYA 5L3DA 2LNBA 2M45A 1DP7P 3L9FA 2QBYA 2P7VB 4RGRA 3ZMZA 1DPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG5 A;  1K78 A;  1O7L A;  4MQV A;  1BOA A;  4GGG A;  2TDX A;  1H9G A;  4B8X A;  2ACJ A;  1OYY A;  2M5W A;  3O6B B;  5LRR A;  3C7J A;  1XSX A;  2L4A A;  2ISZ A;  3I4P A;  3DPL C;  1IAW A;  4Z2Y A;  2P8T A;  2OZ6 A;  2JT1 A;  3I5U A;  5DD4 A;  2K27 A;  3QPH A;  3DV8 A;  4BQA A;  3D0S A;  1PUE E;  5KK1 A;  1U3E M;  2FXA A;  1IXS B;  5LLQ A;  3LST A;  3M9A A;  1J5Y A;  1FT9 A;  1XMA A;  5CVJ A;  2RC4 A;  4BNC A;  2XAF A;  2EV0 A;  1RUO A;  4HLX A;  2O03 A;  4UVA A;  4JBA A;  3I71 A;  4N9H A;  2DPU A;  2RKH A;  3FHZ A;  3N97 A;  1O3Q A;  3FMQ A;  2RDP A;  3F8B A;  3V8L A;  2Q2E A;  4RGX A;  5F6F A;  3WTY C;  1IN4 A;  3J80 K;  4RGS A;  2D1H A;  5BS6 A;  1MGT A;  1GXP A;  2QQB A;  2F5D A;  5HLG A;  2STT A;  3TO6 A;  1UST A;  4PCQ A;  3V7S A;  1E2X A;  3KZZ A;  5ICC A;  5FLX Z;  3F3X A;  3OV8 A;  2OD5 A;  2IW5 A;  2P6S A;  1PDN C;  3GFI A;  2PN6 A;  1T2K A;  3ERE D;  4RGU A;  3F23 A;  2HQR A;  4R1H A;  1IN6 A;  2QYO A;  4P5O A;  4MQ9 F;  4KN7 X;  1BBY A;  4A0Y A;  2NYX A;  2F5C A;  3BJ6 A;  4E70 A;  1HSJ A;  4AIK A;  1X3U A;  1KYZ A;  2IA0 A;  4EJO A;  1IN7 A;  3DQV C;  3HRU A;  2IRF G;  1FLI A;  2KIM A;  3WU0 A;  2G7U A;  3LWF A;  4JK1 X;  1W4M A;  2HTJ A;  2CG4 A;  3MEX A;  3G73 A;  5DD8 A;  2RQP A;  2YR2 A;  2FBH A;  3GF2 A;  3FXR A;  2UXN A;  3DP7 A;  3RKW A;  1F9N A;  2ZKZ A;  2PG4 A;  2FBK A;  5IT9 K;  3IC7 A;  2NNY A;  2KRF A;  2EA4 A;  4HOB A;  3O3K A;  3JTH A;  4O6J A;  5JFR A;  4UUV A;  4MEY F;  1G6N A;  4HDV A;  5K5R A;  4OMY A;  1XGM A;  1ZGA A;  3FF5 A;  1TW3 A;  3JSO A;  3I64 A;  3ZN0 A;  2RV8 A;  2CGP A;  2L3D A;  4M74 A;  2XGX A;  1U5T B;  4L9J A;  5JR3 A;  3ZMS A;  2QUF A;  1ONV A;  2OAZ A;  2R7D A;  2W24 A;  3GZ6 A;  3I58 A;  4R8H A;  2JTV A;  2HGC A;  2DU9 A;  2FRH A;  1S7O A;  1ZN2 A;  2DAO A;  1HKQ A;  5J8C A;  3R61 A;  5KVR A;  1TNT A;  2MD5 A;  3ZMU A;  3EET A;  4U0Y A;  1O3T A;  4RB0 A;  3ZMT A;  1R22 A;  4I01 A;  4I09 A;  2Y48 A;  3WTW C;  1OKR A;  1YG2 A;  1G3W A;  5FGM A;  3J80 Z;  1S7A A;  3P9I A;  4GO1 A;  1FP2 A;  1FBQ A;  5LGU A;  2O3F A;  2FE3 A;  2EFN A;  2EFP A;  1FWZ A;  4S04 A;  4M6Y A;  3GXO A;  2BBY A;  1P92 A;  3E6C C;  3C1D A;  4A5N A;  2M1B A;  4U88 A;  4IRI A;  2D2W A;  1V4R A;  1FC3 A;  3E3V A;  1SAX A;  1KQ9 A;  2VN2 A;  4P9U A;  3HOT A;  2XAJ A;  2KIU A;  4HV6 A;  1R58 A;  3RKY A;  3LA3 A;  3KE2 A;  1S3J A;  3TOB A;  5D4R A;  5HS8 A;  3K1N A;  3C3W A;  4CDG A;  2PBI A;  3MZH A;  2YU3 A;  5E8G A;  3W6K B;  1OR7 A;  1U5T A;  2YX7 A;  3BDD A;  3W6J B;  3CO7 C;  1CGP A;  2VBX A;  3IKV A;  5E1Z B;  1W5S A;  1FY7 A;  2HYG D;  1LQ1 A;  4EJT A;  4BHB A;  3VEP A;  1YFH A;  2L01 A;  3I53 A;  5E18 F;  1ON1 A;  3R6S A;  5ED4 A;  2E7W A;  2FOK A;  2QEN A;  5IT9 Z;  1KU9 A;  2ISY A;  3HYI A;  2ESN A;  3H3U A;  3TDU C;  2OA4 A;  4EQQ A;  2VON A;  1I27 A;  1S29 A;  4HYE A;  4LG0 B;  1WSU A;  5D5V B;  2Z9O A;  2M87 A;  4HF0 A;  3BRO A;  3RYR A;  1TQP A;  1FBU A;  1HQC A;  1KU7 A;  1ZGJ A;  4ZYH A;  5D6E A;  4L18 B;  3FZV A;  4KIC A;  1P4W A;  1J2X A;  4RB2 C;  1FYK A;  5HS7 A;  4LLL A;  4RAZ A;  1K79 A;  4WF2 A;  2FF4 A;  4G8X A;  1HBX G;  4N0B A;  3LAP A;  3DF8 A;  4RAY A;  3JW4 A;  3RPQ A;  4AIJ A;  3VFZ A;  1QZY A;  2HQN A;  4EJV A;  1B4A A;  4ON0 A;  4N9I A;  3KCC A;  2LF7 A;  4OIN F;  2OZU A;  1WWX A;  2BGC A;  2V9V A;  2DQL A;  4M9S A;  3TQN A;  2WWY A;  3ZPL A;  3WE3 A;  3P7N A;  3Q5F A;  4LK0 F;  2GA2 A;  4OMZ A;  3R60 A;  1JHH A;  3EQL F;  2QWW A;  2MC3 A;  1R1T A;  1AOY A;  1JE8 A;  3HRM A;  2XUB A;  3FXQ A;  3HSR A;  3GFM A;  4CXF A;  2XHK A;  2BV6 A;  1S6L A;  2QVO A;  4G6Q A;  3H92 A;  4OIQ F;  4I98 B;  4BXU A;  3MWM A;  1D8K A;  4ENM A;  4LJZ F;  2KKO A;  2A5Y B;  3BPV A;  5F1R A;  1PP7 U;  1LEA A;  3ELK A;  1SFE A;  1G3T A;  3SXY A;  3RDI A;  1H0M A;  1SD7 A;  2EWN A;  2XV4 S;  1BC7 C;  5HDG A;  5D5U B;  2J5P A;  3ZN1 A;  2DQR A;  4PDK A;  2GQQ A;  3CUO A;  5DCM A;  3FWE A;  1R1V A;  3HSF A;  3WTT C;  2E7X A;  3L09 A;  2RNJ A;  3IHU A;  1YTY A;  1AWC A;  4DNC A;  2MBF A;  3L7W A;  5CVR A;  4WWC A;  2GZW A;  3HHG A;  1O7F A;  1J0R A;  1J75 A;  2F5F A;  2CFX A;  1RUN A;  1LDK B;  3K1M A;  4KNY A;  5FD6 A;  4EV0 A;  3VOE A;  1FPQ A;  1T38 A;  3PQK A;  1B6A A;  4MGR A;  1RIO H;  1USS A;  3V8K A;  4XLP F;  2J5O A;  2XIG A;  1U6G A;  4HQM A;  1ON2 A;  1L0O C;  3MCZ A;  2EK5 A;  2XRN A;  5AIP A;  1TQI A;  4ESB A;  5L3G A;  3CUQ B;  2MA3 A;  4ZZL A;  4KIF A;  1ZLK A;  2FMY A;  3TOA A;  4M9Z A;  3SZT A;  1DUX C;  1GVJ A;  2V1U A;  1KA8 A;  4I0B A;  4Y17 A;  3WE2 A;  3CDH A;  4XLN F;  3KP5 A;  2DI3 A;  4M73 A;  1CF7 A;  5E17 F;  1YS6 A;  3CLO A;  2VT3 A;  4KN4 X;  4KUM A;  3GYH X;  3HTS B;  1GHC A;  3WOD F;  4EM2 A;  3IKT A;  3GVA A;  3DFG A;  4UHT A;  2F5E A;  4ENJ A;  2ELH A;  1ZAR A;  1G3Y A;  3KET A;  1B59 A;  1NHA A;  2EA2 A;  4HX4 A;  2FSW A;  1XB4 A;  4CO8 A;  4RS8 A;  2EB7 A;  4G6D A;  3V8J A;  4CHU A;  2OBP A;  3BP8 A;  2KJB A;  4ZZD A;  3B02 A;  5ICF A;  3KP4 A;  4U7B A;  3K0L A;  3P9C A;  3OOP A;  5BQT A;  4I02 A;  4ZYE A;  4IRG A;  2LDU A;  4MHG A;  2IP2 A;  2A69 F;  1LB2 A;  2P5V A;  1J7K A;  3RJP A;  1G4D A;  5TJJ A;  3IRQ A;  4LGW A;  2DK8 A;  3GEZ A;  5TRD A;  2JPB A;  3J81 K;  2FML A;  3I54 A;  2W84 A;  3F21 A;  4NHJ A;  2AS5 F;  2MH2 A;  3V4G A;  4IXA A;  4FX0 A;  4I2O A;  2KJC A;  3CUQ A;  1EH6 A;  1I1S A;  3WG9 A;  3BY6 A;  4L9N A;  3IWF A;  2YSR A;  4LK1 F;  4XBF A;  2P5K A;  2GWR A;  5IT3 A;  3WGG A;  1YO5 C;  4KIB A;  2ZCW A;  1FYM A;  4NB5 A;  1XGN A;  4UV9 A;  3HIF A;  1XSV A;  4KIG A;  2HS5 A;  1U2W A;  2MH9 A;  5LBQ A;  1BI3 A;  3T8R A;  2VE9 A;  1P6R A;  3Q9V A;  1ODD A;  2V6C A;  2FNP A;  2JZY A;  3WTX C;  2PI0 A;  1FX7 A;  4LMY A;  2E1N A;  2M30 A;  5D8L B;  4HLY A;  3KP3 A;  4Q4Z F;  4HQE A;  4ZYD A;  1O57 A;  1SD4 A;  4U7D A;  5H20 A;  4RB3 C;  2BEO A;  4OU0 A;  2O61 A;  1D8J A;  4GXO A;  6PAX A;  3F8C A;  2DW4 A;  4Q48 A;  2BYV E;  4I0A A;  4WK8 F;  2O6G E;  5LGT A;  1ZHF A;  2XAQ A;  4FHT A;  4CYD A;  2ZJ2 A;  3E6D A;  2ESH A;  3F6V A;  1Z6T A;  4NQW A;  2ZNZ A;  1QGP A;  3FM3 A;  3NRV A;  4EGZ A;  3GLX A;  3U1D A;  3BWG A;  4G7O F;  4O3M A;  3E5U A;  1ZLJ A;  1IRF A;  1UHW A;  3K2Z A;  3EYY A;  3RIR A;  4EM0 B;  2CYY A;  3GX4 X;  3BOQ A;  1FBS A;  5H6R A;  4LB6 B;  3QU3 A;  2V79 A;  2YX4 A;  3IRR A;  2DT5 A;  3K1P A;  3FM5 A;  4BH9 A;  3T1B A;  4KMF A;  2HZT A;  1KU2 A;  3DPT A;  2Y75 A;  3I0T A;  1TQM A;  1P4A A;  4HV5 A;  2FNA A;  5HS9 A;  2XRO A;  3TKY A;  1SD5 A;  3T5X A;  2WC2 A;  4ZH4 F;  1DDN A;  4HW0 A;  2K02 A;  4HZF A;  4KYW A;  4IHS A;  3F72 A;  3GUD A;  2IA2 A;  3QPT A;  3EYI A;  3T0Y A;  2ZXJ A;  1IZ1 A;  1Z91 A;  4CGZ A;  2R3S A;  3JSP A;  3H3Z A;  2G9W A;  2IVM A;  2H94 A;  1BJA A;  1HKT A;  3L2C A;  1FSH A;  2PMH A;  5E20 A;  1TTY A;  2EFO A;  5DUI A;  3JTG A;  1XCV A;  5L3C A;  5AON A;  2GIV A;  3J81 Z;  5K5O A;  1EV7 A;  3COA C;  2JPC A;  4A12 A;  2UXX A;  1WKM A;  3QU6 A;  4WXC A;  2VXZ A;  1LEB A;  4MTE A;  2L02 A;  2V1X A;  2LKP A;  2Q8K A;  5D8K B;  2EFQ A;  2XAS A;  3CO6 C;  5CVU A;  5E8I A;  4UNO A;  1XN7 A;  1QPM A;  4WXH A;  1UCR A;  2HR3 A;  3REO A;  1L3L A;  4WXD A;  2QZ8 A;  4Q47 A;  4ESF A;  4XSX F;  4IVN A;  2H09 A;  2PMU A;  3R0A A;  5J6X A;  2VOP A;  1R5H A;  3QAH A;  2XAH A;  5DDG A;  2PQ8 A;  5K1Y A;  2VOO A;  3QOP A;  2L4M A;  1E17 A;  1MJ9 A;  2Z3Y A;  1IXR C;  1YQA A;  2CSO A;  1EH7 A;  2F2E A;  1KU3 A;  3TO9 A;  5DUK A;  2PLY A;  1XSD A;  2NRA C;  1I1G A;  1IN8 A;  1FSE A;  5HOO A;  4IJA A;  1Z7U A;  2QLZ A;  2RN7 A;  2YPR A;  2HDC A;  5LRS A;  5L3F A;  1BI1 A;  5LGN A;  1W7P B;  5ILS A;  2P4W A;  1LDD A;  3WGI A;  3E97 A;  4L5I A;  2L54 A;  5ICG A;  1ZG3 A;  3WTV C;  1Q1H A;  1JHF A;  5FFZ A;  5ILU A;  3ECO A;  4MEX F;  3KFW X;  1IRG A;  3ABT A;  1B9M A;  1BI2 A;  4BHP A;  3HTU A;  1HKS A;  4P55 A;  5E1X A;  2ZME B;  1QNT A;  3MZY A;  3KEQ A;  2A6E F;  4FT8 A;  4A0Z A;  2UWM A;  4EGY A;  1ZYR F;  1R00 A;  2XKO A;  4YFX F;  3R0J A;  4LLG F;  4A2U A;  4XSZ F;  1U78 A;  2BE5 F;  3GZ5 A;  4F7Z A;  2A61 A;  3EUH A;  3DEU A;  4KT5 C;  4PZJ A;  2OQR A;  2XVC A;  2X0L A;  3E5X A;  2KIF A;  4P96 A;  3N4M A;  1MZB A;  2P7C B;  5CVV A;  4LG0 A;  2EV5 A;  1OMI A;  3RPU A;  1R23 A;  1T6S A;  4HF1 A;  2DK5 A;  3WTZ A;  4WCG A;  1D3Y A;  1JGS A;  1TLH B;  2Z5U A;  3HUG A;  4AWX B;  3AAF A;  1MD0 A;  3KP7 A;  4L0Y B;  1HW1 A;  4U0V A;  2VC0 A;  4M9X A;  3ZP5 A;  2P6T A;  3FXU A;  1O3R A;  5CVI A;  3LAJ A;  3K9T A;  2VBW A;  5J8F A;  1STZ A;  3F6O A;  1W7P A;  4O5V A;  3P9K A;  2IJL A;  1FZP B;  5JVT A;  2PEX A;  2P5L C;  1TW2 A;  2O8X A;  4AVP A;  1HST A;  3TGN A;  2ETH A;  1PP8 F;  5HLH A;  1QBJ A;  1B9N A;  1GXQ A;  3ECH A;  4OIO F;  4UVC A;  4GYI A;  2DBB A;  4M72 A;  4BHC A;  2Y0M A;  2MLG A;  1R36 A;  2OQG A;  4IRH A;  4OIR F;  1C0W A;  2JRT A;  1ZRF A;  3BZ6 A;  4R79 A;  1Z1D A;  2ZME A;  2DTR A;  3M8E A;  3MAJ A;  4XRF A;  4QWQ A;  2PFB A;  2HTS A;  2ZO4 A;  1P4X A;  3QP5 A;  1A04 A;  3ROU A;  1FP1 D;  3QRF F;  3E6B A;  3J7A O;  2NS0 A;  5HLI A;  4PGG A;  1I5Z A;  2GXB A;  3QP6 A;  4YIF A;  1SFU A;  4A6E A;  1R7J A;  2GXG A;  1IXC A;  3ISP A;  2ZBK A;  3PQJ A;  3WGH A;  3FMS A;  4D0P A;  3GWZ A;  3HRS A;  2GAU A;  2HWV A;  4G94 A;  3PFI A;  3CUQ C;  5DCF A;  1LJ9 A;  4HAM A;  3JAM K;  5D5X B;  1TNS A;  4ENN A;  2H6C A;  2GA1 A;  5AIQ A;  1LNW A;  2CO5 A;  3V7C A;  3HOS A;  3LA7 A;  1D5V A;  4KA4 A;  1Z6R A;  1YLF A;  4CZZ A;  5F64 A;  2XAG A;  4KFC A;  3LFK A;  3VOD A;  1IUY A;  2K86 A;  5A2Q K;  4LD5 A;  1YYV A;  5BOX A;  5CYV A;  4L9T A;  1OYI A;  1J9I A;  2EV6 A;  2Z99 A;  5LEK A;  1MJA A;  1XMK A;  3CJN A;  4G7Z F;  1MKM A;  1XD7 A;  1DPR A;  2QQ9 A;  1IN5 A;  3VB2 A;  3M8F A;  3I59 B;  4OIP F;  1FNN A;  4MTD A;  2HKO A;  1EH8 A;  4U0W A;  5DEQ A;  3WTS C;  2Q0O A;  3KEO A;  2A68 F;  2D45 A;  1MDM B;  2IPQ X;  3MFK A;  1QO0 D;  1WI9 A;  2VT2 A;  4Y13 A;  1ZRE A;  2FEZ A;  1SMY F;  4DQ2 A;  5JI6 A;  1K7A A;  4HF2 A;  3T8T A;  2K4J A;  5BPI A;  4RB1 A;  1ZG1 A;  1WRJ A;  2O0Y A;  2X4H A;  2WTE A;  4EMS A;  5BPD A;  1XGS A;  2CQK A;  3LQR A;  4ESJ A;  3BJA A;  5L3E A;  4PGH A;  3ZMD A;  3LA2 A;  5L3B A;  4UVB A;  4L5J A;  2E1C A;  4LB5 A;  2FA5 A;  1QZZ A;  1R1U A;  2ZNY A;  2NNN A;  1ZAO A;  3HSE A;  2ADU A;  4HBL A;  3CTA A;  2COM A;  3KP2 A;  4JQF A;  3SZP A;  2M8E A;  3RYP A;  3ULQ B;  4TV7 A;  4EVI A;  1BN5 A;  5BMZ A;  2HEO A;  3GFJ A;  5D4S A;  3S2W A;  1OYW A;  1ZH5 A;  1W7P D;  3GW2 A;  2OU2 A;  4YFN F;  3EDP A;  1HW2 A;  2VOD A;  4YFK F;  2A3S A;  3ABU A;  4HDU A;  5FFX A;  3U2R A;  2Z33 A;  4BYY A;  3E5Q A;  2RVC A;  3I59 A;  1P2F A;  4CIC A;  3SHF A;  1YW7 A;  3SQN A;  3NQO A;  4EM1 A;  4AD9 A;  3KLN A;  2H27 A;  3IWZ A;  1UB9 A;  1MDM A;  5ERI A;  1HW5 A;  3JAM Z;  1YW8 A;  2QQA A;  5HDK A;  5LHG A;  1U5T C;  4BAY A;  3MQ0 A;  3NEU A;  3TDZ C;  3GFL A;  5HVQ C;  2G7H A;  2DO7 A;  4FX4 A;  3RKX A;  5A2Q Z;  1QQI A;  4YG2 F;  4MNU A;  1BIB A;  3DKW A;  1TBX A;  1JXS A;  2UZK A;  3ZMV A;  3SFZ A;  2WV0 A;  1O3S A;  5JHU A;  1R5G A;  2CWE A;  1F4K A;  1REP C;  1YIO A;  3KP6 A;  4ETS A;  2CW0 F;  4AIH A;  2HFH A;  4ASN A;  5LHH A;  4QLC U;  1LDJ A;  3M7G A;  2VBY A;  2JSC A;  1FYL A;  4B09 A;  1F1Z A;  1FOK A;  1KQ0 A;  1XGO A;  3U9G A;  1RI7 A;  4S05 A;  3TO7 A;  1SMT A;  2D1V A;  3GO5 A;  1ZRC A;  4EJW A;  1BIA A;  1XCB A;  1OPC A;  4WX9 A;  3FX3 A;  4UV8 A;  1MJB A;  2IA1 A;  2B0L A;  4A5M A;  2H6B A;  3F8F A;  3RTR A;  3LQQ A;  5FB2 A;  2PJP A;  4IF4 A;  2HKX A;  1LVA A;  1BI0 A;  4GCV A;  2K7L A;  2W57 A;  1BM9 A;  3HHH A;  3M1E A;  3BPX A;  3D5L A;  5ILV A;  3ZQ7 A;  1VTN C;  5D5W B;  4L0Z B;  2MLK A;  3KLO A;  1YS7 A;  2QM3 A;  4I7H A;  2K4B A;  1S8N A;  2LSO A;  3KZY A;  4Q5S F;  1BC8 C;  1K6O A;  2HYF A;  3V7R A;  4LFU A;  2VC1 A;  2C6Y A;  3K69 A;  2R7F A;  3R4K A;  4HX7 A;  4A0X A;  1WQ2 A;  3C18 A;  1I6X A;  1T98 A;  1Z9C A;  2VE8 A;  1Z05 A;  5ICE A;  2RGV A;  2W25 A;  5DCM B;  2HOE A;  3WTU C;  3F8N A;  5CLS A;  4YII A;  2IT0 A;  3IL2 A;  1F5T A;  1YW9 A;  1HXD A;  5EEG A;  5H6Q A;  3WU1 B;  4KMU X;  2EJR A;  1XDS A;  3FMR A;  1V3F A;  2AXL A;  2QBY B;  3B73 A;  5D6F A;  4HA8 A;  1KYW A;  1RNL A;  1K78 B;  5K5Q A;  2FQ3 A;  5EEH A;  1IW7 F;  1B1B A;  3O2P E;  1J59 A;  4IHT A;  4GYG A;  2DFI A;  4ENK A;  1XDU A;  3Q9S A;  3F22 A;  2LF8 A;  1Y0U A;  4HX8 A;  2STW A;  2W85 A;  1W5T A;  2XKP A;  2NAZ A;  4EJU A;  4M6X A;  4OOI A;  5DYM A;  4G7H F;  1U8R A;  5LHI A;  3G3Z A;  2DPD A;  1SD6 A;  5FD5 A;  1SFX A;  5FLX K;  4A6D A;  2A6H F;  5CJ9 A;  2FU4 A;  1UFM A;  4H0E A;  2V1D A;  4K2E A;  4G9Y A;  4KDP A;  3F8M A;  5DV5 A;  1IF1 A;  1RZ4 A;  4L9V A;  2A07 F;  1CF7 B;  3ML6 A;  3BJO A;  5FO5 A;  4ZYG A;  4M71 A;  3L00 A;  2DLL A;  1KGS A;  4UXN A;  1T39 A;  2FBI A;  4Y15 A;  4LLN A;  4IPA A;  1H9T A;  5E1W A;  1ZRD A;  3E6M A;  1G3S A;  2EFW A;  3RI4 A;  3HRT A;  1KQ8 A;  2ZFW A;  5LEJ A;  3DXJ F;  1T0F A;  1UHM A;  2VBZ A;  5HDN A;  4P9F A;  1ULY A;  5L3D A;  2LNB A;  2M45 A;  1DP7 P;  3L9F A;  2QBY A;  2P7V B;  4RGR A;  3ZMZ A;  1DPU A; 
#chains in the Genus database with same CATH topology
 2WB1 A;  2X1C A;  2R5Y A;  1ZG5 A;  1K78 A;  3BQY A;  1O7L A;  3ABM H;  4MQV A;  1BOA A;  2HU9 A;  3A0H C;  4GGG A;  2TDX A;  1H9G A;  4B8X A;  2ACJ A;  1W36 C;  3S1N J;  3RZD J;  1Z67 A;  1H88 C;  1D1C A;  2WY7 Q;  1OYY A;  2M5W A;  3EUK L;  3O6B B;  3FK6 A;  2VQL A;  5LRR A;  3C7J A;  1XSX A;  1QHG A;  1VZ0 A;  2L4A A;  1FJL A;  2ISZ A;  4B1R A;  4LIV A;  1YIJ I;  4D5F A;  4AYB N;  2M4K A;  3I4P A;  4X1E A;  2BXY A;  3FKI J;  4UB6 C;  3DPL C;  1IAW A;  5KNL A;  4Z2Y A;  1VND A;  2P8T A;  1FEX A;  2OZ6 A;  2JT1 A;  1MBH A;  3I5U A;  5BNG A;  5DD4 A;  2EZL A;  1S72 I;  2K27 A;  3P5J A;  1OFC X;  3QPH A;  3DV8 A;  3MVP A;  3LOC A;  4BQA A;  1VQ9 I;  3D0S A;  5DTD A;  2X6X A;  4IOC F;  1PUE E;  5KK1 A;  4ITV A;  3PIP F;  1T8I A;  1U3E M;  2LKS A;  2FXA A;  1RRJ A;  1IXS B;  2FOW A;  5LLQ A;  3LST A;  3M9A A;  4Y52 J;  1FIA A;  1J5Y A;  1FT9 A;  3KEY A;  1XMA A;  5CVJ A;  1TT5 B;  4FTH A;  1T33 A;  2RC4 A;  2QQ8 A;  4MFD A;  3ZQH A;  3SEZ A;  4BNC A;  2W48 A;  5J1R A;  5FLM J;  3OYL A;  3CCJ I;  2BOL A;  2LOO A;  2XAF A;  4DBR A;  2EV0 A;  1X4P A;  4HLX A;  3SEQ A;  1GDT A;  4U87 A;  1RUO A;  2O03 A;  4MO7 A;  2JK3 A;  4UVA A;  4B3X A;  3D5R C;  4JBA A;  4E6K G;  3CCV I;  1WVR A;  4C2T A;  3I71 A;  4N9H A;  3A01 B;  2DPU A;  2RKH A;  3FHZ A;  3N97 A;  1XX5 A;  1O3Q A;  3FMQ A;  4J19 A;  4CA0 A;  1YX3 A;  2RDP A;  2BY3 A;  1JUS A;  3F8B A;  1DGW Y;  2AO9 A;  2VJI A;  4KIT B;  4IX7 A;  2H1K A;  3BTC A;  3V8L A;  2Q2E A;  2JVG A;  2E1M B;  4RGX A;  1WJB A;  3DCF A;  5F6F A;  3WTY C;  1IN4 A;  1ZEL A;  5GPA A;  3J80 K;  4RGS A;  2A6T A;  2D1H A;  5BS6 A;  1MGT A;  2QEX I;  3G1L A;  1GXP A;  2KRC A;  2QQB A;  2EPF A;  2L9N A;  2F5D A;  5HLG A;  2X6W A;  1FOY A;  1V5G A;  2LR8 A;  3VYS B;  2STT A;  3TO6 A;  1UST A;  3BR3 A;  4PCQ A;  2XSD C;  3V7S A;  5CPR B;  1O4X A;  1E2X A;  3F9K A;  5F0F A;  2JSP A;  1FOW A;  3KZZ A;  5ICC A;  5FLX Z;  3F3X A;  3OV8 A;  2OD5 A;  2IW5 A;  3NWS A;  4ZJZ A;  2P6S A;  2ID3 A;  1PDN C;  4X6A J;  3GFI A;  2PN6 A;  1T2K A;  4ZDO A;  1D0Z A;  3ERE D;  2WAD A;  1A6I A;  4RGU A;  3F23 A;  3W3C A;  2HQR A;  4R1H A;  1IDY A;  1IN6 A;  4C3I J;  2QYO A;  4P5O A;  2DYR H;  4MQ9 F;  4KN7 X;  4AYB A;  4W97 A;  4BDY A;  3I4M J;  1BBY A;  4XLH A;  4A0Y A;  4BEH A;  1Y56 A;  2NYX A;  2F5C A;  3OL3 A;  2RAE A;  2TRT A;  3BJ6 A;  2L9R A;  4E70 A;  1W0T A;  3I3L A;  1HSJ A;  4AIK A;  1BA5 A;  1OJL A;  5FKM A;  1X3U A;  1KYZ A;  2IA0 A;  4EJO A;  1IN7 A;  2QKM B;  1NG6 A;  3OYK A;  3DQV C;  3HRU A;  2IRF G;  1FLI A;  1MMG A;  4J00 A;  2KIM A;  1D1A A;  3WU0 A;  2MFZ A;  2G7U A;  3LWF A;  4PFP A;  4ANJ A;  2XF7 A;  4JK1 X;  4FCY A;  3O8G A;  1W4M A;  1TP4 A;  1ITY A;  2HTJ A;  2CG4 A;  3MEX A;  3G73 A;  5DD8 A;  2XC7 A;  2RQP A;  2YR2 A;  3ASO H;  3S32 A;  4PJM A;  2FBH A;  3GF2 A;  3FXR A;  2DFF A;  2UXN A;  3DP7 A;  3RKW A;  1X19 A;  1R5I D;  3CLQ A;  3RPU D;  4XNF A;  1F9N A;  1PUF B;  2OTJ I;  2ZKZ A;  1MH3 A;  4IHX A;  2PG4 A;  2ZJP F;  1YJN I;  2B9S A;  2FBK A;  5IT9 K;  2LG4 A;  2VUM J;  3IC7 A;  2NNY A;  2BHZ A;  2KRF A;  3OIQ A;  2EA4 A;  4HOB A;  3OY9 A;  3S14 J;  2K9S A;  5F0C A;  3O3K A;  1VQ8 I;  3W6V A;  3JTH A;  4O6J A;  3A01 A;  2QSH X;  5JFR A;  3PNT A;  5CKT A;  4UUV A;  2ID6 A;  4MEY F;  1G6N A;  3S3O A;  4HDV A;  4XRM A;  5K5R A;  4OMY A;  2KIS A;  4ZC3 A;  3OYE A;  4DGW B;  1XGM A;  1ZGA A;  2XB5 A;  4BXF A;  3FF5 A;  3UNG C;  3H3V K;  1TW3 A;  4G12 A;  3JSO A;  3I64 A;  1JT0 A;  4E7J A;  2VL8 A;  2P81 A;  3ZN0 A;  2YU9 J;  1UG0 A;  3EPZ A;  2DA7 A;  4B47 A;  2RV8 A;  2CGP A;  2L3D A;  3BG3 A;  4M74 A;  2UUZ A;  2XGX A;  1U5T B;  4L9J A;  4HEA 2;  5K7Z A;  5JR3 A;  3ZMS A;  4XLA A;  2CRG A;  2QUF A;  1ONV A;  2OAZ A;  2R7D A;  2W24 A;  3GZ6 A;  3I58 A;  3GTJ J;  2ELJ A;  4XON A;  1Z3X A;  4BKX A;  3JR9 A;  4R8H A;  2JTV A;  2HGC A;  3K4L A;  3BZC A;  2DU9 A;  2FRH A;  2I8D A;  1S7O A;  5EF6 A;  1ZN2 A;  1IGN A;  4BQO A;  2DAO A;  3AG2 H;  4OAY A;  1HKQ A;  5J8C A;  3R61 A;  5KVR A;  1TNT A;  5M3F J;  2MD5 A;  2ME6 A;  3ZMU A;  3EET A;  2LRE A;  1JTY A;  1IRX A;  3OYJ A;  1MBG A;  4U0Y A;  3TED A;  1O3T A;  4BJ6 C;  4RB0 A;  1NK2 P;  1TWC J;  3K4J A;  3ZMT A;  1R22 A;  4LIT A;  4I01 A;  4BJT A;  3BTI A;  4I09 A;  3LL7 A;  2Y48 A;  2M9H A;  3WTW C;  2CW8 A;  3S17 J;  1HF0 A;  1OKR A;  1YG2 A;  2WA0 A;  1G3W A;  5FGM A;  2HNH A;  2NVU B;  3J80 Z;  1S7A A;  5J3L A;  3OR1 C;  3P9I A;  5C44 J;  4GO1 A;  1FP2 A;  1FBQ A;  2BZT A;  5LGU A;  2E36 A;  3K4B A;  2VAS A;  3M4O J;  2LP0 A;  2O3F A;  1S9H A;  2DT7 B;  1B72 B;  2FE3 A;  3HBL A;  3MD2 A;  2EFN A;  1YJW I;  3CP8 A;  4FQG A;  3FK7 A;  2V9P A;  2EFP A;  2EIM H;  1MIJ A;  3DTE A;  3VWB A;  1FWZ A;  3DLA A;  3KYL A;  2COB A;  1AU7 A;  1K61 A;  2VB6 A;  4S04 A;  4M6Y A;  4ZDL A;  5EZH A;  3GXO A;  3HOZ J;  2BBY A;  1P92 A;  2EZI A;  5EG0 B;  3E6C C;  5GAD J;  3C1D A;  4A5N A;  1MMA A;  3C2G A;  3M8J A;  2M1B A;  4NNJ A;  2V1N A;  4U88 A;  4IRI A;  1WJC A;  2BW3 B;  2D2W A;  4IEJ A;  1V4R A;  1FC3 A;  3E3V A;  1SAX A;  1T08 B;  1KQ9 A;  3HOW J;  2VN2 A;  1V5E A;  2VLA A;  4P9U A;  3HOT A;  3K7A J;  2XAJ A;  2KIU A;  3M07 A;  4HV6 A;  4DYC A;  1R58 A;  1S5L C;  4XN3 A;  3RKY A;  3LA3 A;  3KE2 A;  1S3J A;  4NC8 A;  2KQR A;  2VKH A;  3TOB A;  5D4R A;  5HS8 A;  4B43 A;  3K1N A;  3C3W A;  4CDG A;  4LIU A;  1ACI A;  2PBI A;  3MZH A;  2JMW A;  3AG1 H;  2YU3 A;  5E8G A;  2CUZ A;  3HJE A;  2Z2S B;  3W6K B;  1OR7 A;  1U5T A;  3BDD A;  2YX7 A;  2MAB A;  3W6J B;  3CO7 C;  1CGP A;  1ETQ A;  2VIX A;  2MD0 A;  1NH3 A;  2VBX A;  2NOJ B;  3IKV A;  1HLV A;  5E1Z B;  2ECC A;  4P1W A;  1W5S A;  1FY7 A;  2HYG D;  1LQ1 A;  2CUJ A;  1WGX A;  4EJT A;  4BHB A;  4ZYA A;  3VEP A;  1YFH A;  2L01 A;  3I53 A;  5E18 F;  1ON1 A;  2KHM A;  2PX9 A;  1HDD C;  2P0W A;  3R6S A;  3KYD B;  5ED4 A;  2E7W A;  3J7A Y;  1K6Y A;  2FOK A;  2QEN A;  1VQM I;  5IT9 Z;  1KU9 A;  2GLO A;  2ISY A;  5C4X J;  3HYI A;  4M6V A;  2ESN A;  5FJ8 J;  3TP3 A;  3H3U A;  3TDU C;  1I50 J;  2OA4 A;  5EJC A;  4EQQ A;  2VON A;  1I27 A;  1S29 A;  4HYE A;  4LG0 B;  1WSU A;  5D5V B;  4XRS G;  5B1A H;  2KMU A;  4IQ4 A;  2Z9O A;  3PO3 J;  2M87 A;  4IHV A;  4HF0 A;  3BRO A;  3KZI C;  3LSH A;  4H4K C;  3BR2 A;  3RYR A;  1Y6I A;  1TQP A;  2MGQ A;  1FBU A;  4BU2 A;  4PUS A;  1HQC A;  1YJ9 I;  1SVO A;  4DYQ A;  4F92 B;  1KU7 A;  2EIJ H;  3K2A A;  1ZGJ A;  4ZYH A;  4I6Z A;  5D6E A;  1D5Y A;  2O9L A;  4L18 B;  4A3C J;  3FZV A;  4RM3 A;  3H5A A;  4KIC A;  1GV2 A;  3G71 I;  1P4W A;  1J2X A;  1ETW A;  2M34 A;  4RB2 C;  1X3W B;  1FYK A;  3OSG A;  1G2H A;  1IRZ A;  1WFX A;  5HS7 A;  4LLL A;  4RAZ A;  1K79 A;  1M1E B;  1B72 A;  4WF2 A;  2FJ1 A;  3U21 A;  2FF4 A;  4G8X A;  1HBX G;  4N0B A;  3LAP A;  3DF8 A;  4RAY A;  3JW4 A;  2B7E A;  3GTQ J;  3RPQ A;  2VQG A;  3VFZ A;  1MW7 A;  4AIJ A;  1QZE A;  1QZY A;  2HQN A;  4EJV A;  1B4A A;  4ON0 A;  4N9I A;  3KCC A;  3DU6 A;  3CP2 A;  1VQ7 I;  2LF7 A;  4OIN F;  1LFB A;  4PK4 A;  2H8R A;  3S93 A;  3OIP A;  4IHY A;  3HM5 A;  5IOZ A;  4E7L A;  5GP9 A;  5EG0 A;  1H89 C;  2VJ5 A;  2OZU A;  3H0G J;  1WWX A;  2BGC A;  2KT0 A;  2DQL A;  2V9V A;  4M9S A;  5HOD A;  1SC7 A;  3TQN A;  2WWY A;  3ZPL A;  1F36 A;  3WE3 A;  3P7N A;  2X51 A;  3WG7 H;  4MIM A;  2BW3 A;  2W1O A;  4XM3 A;  3Q5F A;  4LK0 F;  4DOZ A;  5EGO B;  2GA2 A;  4OMZ A;  3R60 A;  1JHH A;  2VQC A;  5FKL A;  3EQL F;  2QWW A;  2MC3 A;  1R1T A;  1AOY A;  1JE8 A;  3HRM A;  1NG7 A;  2XUB A;  3FXQ A;  1X1P A;  1H8A C;  3BQZ A;  3HSR A;  1DU6 A;  3GFM A;  4CXF A;  2XHK A;  4E7I A;  5B66 C;  3AL0 C;  2BV6 A;  1A35 A;  4JX6 A;  1S6L A;  3S1Q J;  2QVO A;  4G6Q A;  5J40 A;  2YS9 A;  3H92 A;  5GAG J;  3OYC A;  4OIQ F;  4AM3 A;  3DPU A;  4I98 B;  4BXU A;  4IO9 F;  3MWM A;  1DU0 A;  2IAI A;  3IAM 2;  3K4K A;  5K7H A;  1D8K A;  1N75 A;  1UHS A;  2XF5 A;  2X85 A;  3HC7 A;  5IP6 A;  2ZME C;  5GAH J;  4ENM A;  2DA4 A;  4LJZ F;  2KKO A;  2Q1Z B;  3HGG A;  2A5Y B;  2I10 A;  2V7F A;  3BPV A;  3BG5 A;  1LEA A;  5F1R A;  1PP7 U;  3ELK A;  1SFE A;  1E0E A;  2V4J C;  2W00 A;  3ERM A;  1G3T A;  2VKD A;  3SXY A;  3RDI A;  4HST A;  4BAC A;  1H0M A;  1SD7 A;  4ZDP A;  3PIO F;  3JRD A;  2EWN A;  3LSM A;  2VJJ A;  5GTI C;  2XV4 S;  3Q0U A;  1BC7 C;  5HDG A;  5D5U B;  3ZQI A;  2GOM A;  2J5P A;  3Q3S A;  4N4O B;  3RQ4 A;  1R4M B;  3ZN1 A;  3HOV J;  2XGE A;  3LSI A;  4D7M A;  4BE1 A;  3JRF A;  1E3P A;  2KZV A;  2DQR A;  4PDK A;  3K70 D;  2GQQ A;  3CUO A;  2Z16 A;  3QWL A;  3FWE A;  5DCM A;  4DJA A;  1R1V A;  3HSF A;  3CC7 I;  2JA7 J;  1SFO J;  3WTT C;  2R4G A;  3I55 I;  2JVH A;  2XAU A;  2E7X A;  1RR8 C;  3L2Q A;  1JKR C;  2DMN A;  3L09 A;  3I56 I;  1POG A;  3MKW B;  5KHD A;  2RNJ A;  3IHU A;  3G1O A;  1YTY A;  4JYK A;  3TMO A;  2L7Z A;  1AWC A;  1ZGW A;  3IP4 B;  4DNC A;  2MBF A;  5E3O A;  1ETY A;  3L7W A;  2DA2 A;  5CVR A;  4WWC A;  2GZW A;  1OCO H;  3HXL A;  3HHG A;  1O7F A;  1J0R A;  2DA1 A;  1J75 A;  2F5F A;  1WPK A;  2KRH A;  3BTJ A;  2CFX A;  1RUN A;  3LNQ A;  1LDK B;  4NUB A;  2HXO A;  3K1M A;  3I9V 2;  4KNY A;  5FD6 A;  4CZC A;  4EV0 A;  4Y4R A;  3VOE A;  2PMZ N;  2CQX A;  4N4N B;  5IPA A;  4F52 A;  1FPQ A;  1T38 A;  3PQK A;  1UJ8 A;  1B6A A;  5DM7 F;  4EAT A;  2OCE A;  2MG4 A;  4MGR A;  5JLX A;  3SDG A;  4E7K A;  1RIO H;  3H35 A;  5B5E C;  1USS A;  3OIO A;  4A3E J;  3V8K A;  2KLO A;  4XLP F;  2J5O A;  4M3F A;  4XLE A;  2XIG A;  3HKZ A;  5EGO A;  2AHQ A;  4EEF G;  1U6G A;  4HQM A;  1OCR H;  2HDW A;  1ON2 A;  1L0O C;  2M0M A;  3MCZ A;  2EK5 A;  2XRN A;  1MBK A;  1TQI A;  5AIP A;  3ZQQ A;  4ESB A;  5L3G A;  3CUQ B;  2MA3 A;  2M0C A;  4ZZL A;  4KIF A;  2XPW A;  1ZLK A;  2FMY A;  4XQF A;  3TOA A;  3DBR B;  1X1B A;  1CQT A;  4M9Z A;  3SZT A;  3PNY A;  1DUX C;  3BC8 A;  1GVJ A;  2V1U A;  1MNE A;  1KA8 A;  2D5V A;  1D1B A;  4I0B A;  3OYI A;  1Y1V J;  2DTZ A;  4Y17 A;  1VQP I;  3BLY A;  3WE2 A;  3GTO J;  3CDH A;  4XLN F;  3KP5 A;  2DI3 A;  4M73 A;  1CF7 A;  2CMP A;  4UUS A;  4B48 A;  5E17 F;  1YS6 A;  2H1L A;  3GTP J;  3CLO A;  2A05 A;  2VT3 A;  4F93 B;  4KN4 X;  5J1Y A;  4KUM A;  1OCT C;  3GYH X;  3OOU A;  2HYJ A;  3HTS B;  1WJA A;  3JCU C;  1GHC A;  5EEA A;  4BXX J;  2DMP A;  3WOD F;  4EM2 A;  3IKT A;  2KPM A;  3GVA A;  4F91 B;  2CUE A;  3WU2 C;  2RRE A;  4KT6 A;  4BJ5 C;  2LBF B;  4B4C A;  1U0J A;  5IYB J;  3HOU J;  3DFG A;  2E2I J;  4UHT A;  1ETO A;  2F5E A;  3CME I;  4ENJ A;  2ELH A;  2HQ5 A;  1X4O A;  1ZAR A;  2E35 A;  1G3Y A;  3JRB A;  3KET A;  5E3N A;  3ZCO A;  1B59 A;  1NHA A;  3ZRG A;  4D9J A;  3CDL A;  3AG3 H;  2BY0 A;  3C2H A;  3AG4 H;  3SZG A;  2EA2 A;  3H9Q A;  4IOA F;  4HX4 A;  2FSW A;  2X48 A;  1XB4 A;  2CFO A;  4LG3 A;  4CO8 A;  4RS8 A;  1SVM A;  2EB7 A;  3QPL A;  4G6D A;  2OCC H;  1DGR M;  1MMN A;  1SAN A;  3FBN B;  1ENH A;  3V8J A;  1MSF C;  4CHU A;  3GTM J;  3BP8 A;  1WHU A;  2OBP A;  2KJB A;  4QPO A;  4ZZD A;  3B02 A;  4NQW B;  5ICF A;  3OYH A;  3KP4 A;  1K83 J;  3QYE A;  4U7B A;  1ETK A;  3K0L A;  3P9C A;  3OOP A;  5BQT A;  2R92 J;  4I02 A;  4MLO A;  4Z6Y A;  1X3Z B;  4ZYE A;  4IRG A;  1TC3 C;  2LDU A;  1OQY A;  1P9Q C;  2IP2 A;  2EIL H;  2ME0 A;  4MHG A;  4E7H A;  1YHQ I;  2A69 F;  1GT0 C;  1LB2 A;  2P5V A;  1J7K A;  3RJP A;  1G4D A;  5TJJ A;  3IRQ A;  3LSK A;  2R7V A;  4LGW A;  1G8X A;  5TGT A;  2DK8 A;  3GEZ A;  1ZTR A;  1HA8 A;  5TRD A;  2K5C A;  2JWT A;  3PO2 J;  2JPB A;  2EQR A;  3B6A A;  3J81 K;  2FML A;  3I54 A;  2W84 A;  2E1M C;  5FRN A;  3FDY A;  3F21 A;  4NHJ A;  2AS5 F;  3ZQF A;  5EZG A;  2MH2 A;  3V4G A;  4IXA A;  2K85 A;  3OYF A;  2O5R A;  4FX0 A;  3CMM A;  4I2O A;  5GPC A;  5M5W J;  3CCR I;  2WY8 Q;  2KJC A;  4RLQ A;  1IUF A;  3CUQ A;  1EH6 A;  1I1S A;  2TCT A;  3CDI A;  3WG9 A;  3BY6 A;  4L9N A;  3IWF A;  2YSR A;  3FXK A;  1DP3 A;  3HEF A;  4MFE A;  2LVS A;  3J7Z I;  1UAA A;  4LK1 F;  1IO2 A;  4XBF A;  4XKW A;  2P5K A;  2GWR A;  5IT3 A;  3WGG A;  1YO5 C;  1AKH B;  4KIB A;  4W1U A;  1EJ9 A;  4HNV A;  4Y7N J;  2ZCW A;  1FYM A;  4NB5 A;  5FRM A;  1XGN A;  1UMQ A;  4BQQ A;  4A69 C;  4UV9 A;  1OIS A;  3HIF A;  1XSV A;  4KIG A;  2HS5 A;  2G0E A;  1U2W A;  2MH9 A;  2QKL B;  5LBQ A;  1ERD A;  2VKE A;  1BI3 A;  2RQQ A;  4UB8 C;  3T8R A;  2WV1 A;  2VE9 A;  4JOM A;  1GV5 A;  1P6R A;  3Q9V A;  1D0X A;  3JRG A;  3ABL H;  4A3D J;  1WZ2 A;  3SJM A;  2NOG A;  1ODD A;  2V6C A;  2FNP A;  2JZY A;  3WTX C;  1LE8 B;  2PI0 A;  2M8G X;  3W2A A;  2XPU A;  1FX7 A;  4LMY A;  2E71 A;  2E1N A;  5FKK A;  1AA7 A;  2M30 A;  3H9J A;  2Y69 H;  5D8L B;  4Y33 A;  4HLY A;  3KP3 A;  4Q4Z F;  1TWG J;  1OCC H;  3K70 C;  4V19 K;  4M3D A;  4HQE A;  4XKV A;  2A5W A;  4ZYD A;  1O57 A;  1SD4 A;  4PJL A;  4U7D A;  5H20 A;  4RB3 C;  2BEO A;  3Q0V A;  4OU0 A;  2O61 A;  2XPV A;  3OYM A;  3CCE I;  4NC7 A;  1D8J A;  3CC4 I;  3KX2 A;  5K7F A;  3CQZ J;  4GXO A;  3SFI A;  6PAX A;  3F8C A;  2DW4 A;  4Q48 A;  2BYV E;  4I0A A;  4WK8 F;  2O6G E;  5LGT A;  5HNF A;  1ZHF A;  2DDB A;  2XAQ A;  4II3 A;  4FHT A;  4CYD A;  5IYC J;  2ZJ2 A;  2QGU A;  3E6D A;  1ZQ3 P;  2ESH A;  3DEW A;  3F6V A;  4RM2 A;  1Z6T A;  1UEL B;  4NQW A;  2ZNZ A;  1QGP A;  3FM3 A;  3NRV A;  3DLL F;  2XGC A;  4EGZ A;  2MW8 A;  4AVZ A;  3WHC A;  1RET A;  3GLX A;  3U1D A;  5LD2 C;  2DJN A;  2CU7 A;  5CQE A;  3BWG A;  2BY2 A;  3RCO A;  1WJF A;  1JUP A;  1BR2 A;  3IH2 A;  4G7O F;  2L7F P;  3HPH A;  4RBO A;  1APL C;  4O3M A;  3E5U A;  1R71 A;  1ZLJ A;  1VQN I;  4CH7 A;  3HOX J;  4I99 C;  1IRF A;  1UHW A;  1QHH D;  4GDF A;  3K2Z A;  3EYY A;  4PFO A;  3ZR8 X;  4DBQ A;  3RIR A;  4EM0 B;  2CYY A;  3HB9 A;  3GX4 X;  1Y39 A;  1S7E A;  3BOQ A;  4BL0 B;  1BL0 A;  1FBS A;  5H6R A;  4LB6 B;  1VQ6 I;  3QU3 A;  2V79 A;  1I6H J;  2YX4 A;  4RAF A;  4E7Z A;  2DT5 A;  3G1M A;  3IRR A;  3K1P A;  1OLT A;  3FM5 A;  4BH9 A;  4XIC A;  3T1B A;  4KMF A;  2HZT A;  1KU2 A;  3DPT A;  2Y75 A;  2MSY A;  2AQF A;  2QSF X;  1I3A A;  3I0T A;  3JRH A;  1TQM A;  1P4A A;  4HV5 A;  2FNA A;  2KIQ A;  5HS9 A;  2XRO A;  1OR7 C;  2Y0S N;  1R49 A;  4JP0 A;  2XDV A;  3TKY A;  1V54 H;  1SD5 A;  3T5X A;  2Y9Z A;  2WC2 A;  1YOV B;  4HNT A;  1AKH A;  1TL8 A;  4ZH4 F;  1DDN A;  3IH3 A;  2K02 A;  4HW0 A;  4XOP A;  4NBQ A;  2HPI A;  4HZF A;  2XRL A;  3K4N A;  2CQN A;  4KYW A;  4IHS A;  3F72 A;  3GUD A;  2IA2 A;  3QPT A;  3EYI A;  2BVM A;  3KYC B;  3T0Y A;  4PJ0 C;  4M3G A;  1FMV A;  2EIK H;  3HDD A;  2LC2 A;  2ECB A;  2ZXJ A;  3A03 A;  1BR1 A;  2X6Y A;  3H9G A;  1IZ1 A;  1PUF A;  1Z91 A;  2E2H J;  4CGZ A;  1TWF J;  4A3G J;  2F6C A;  1R6R A;  1IDZ A;  3OYD A;  2R3S A;  3CCM I;  3JSP A;  3BTL A;  3H3Z A;  3L1P A;  2GIZ A;  5F04 A;  2G9W A;  4D5C A;  1LE8 A;  2IVM A;  2H94 A;  5EYR A;  1BJA A;  1HKT A;  3OWT A;  3L2C A;  1LFU P;  1FSH A;  2PMH A;  2M7A A;  4OWR B;  2DT6 A;  5E20 A;  1TTY A;  2EFO A;  5DUI A;  3MKY B;  3JTG A;  1XCV A;  4HPQ A;  5L3C A;  5AON A;  2GIV A;  2GOX B;  3J81 Z;  1T56 A;  5K5O A;  1EV7 A;  3JRA A;  3COA C;  2K40 A;  2JPC A;  4A12 A;  2CV1 A;  2UXX A;  1WKM A;  3TL4 X;  3QU6 A;  3UR3 C;  4WXC A;  2OC6 A;  2VXZ A;  1LEB A;  2JN6 A;  4MTE A;  2CUF A;  2L02 A;  2V1X A;  2LKP A;  5J4V A;  1N78 A;  3RQI A;  3K10 A;  2Q8K A;  5GTH C;  3TBI A;  5KAI C;  2WAE A;  3VDX A;  5D8K B;  4M3B A;  2EFQ A;  2XAS A;  2X9D A;  2BVL A;  3CO6 C;  5F27 A;  1VI0 A;  4YRV A;  2HOS A;  5CVU A;  1R9T J;  1IV8 A;  2NXN B;  5E8I A;  4UNO A;  2LLK A;  1VQL I;  2K9N A;  1PYV A;  2F4I A;  1XN7 A;  1QPM A;  2GM4 A;  4WXH A;  3S3M A;  1UCR A;  2HR3 A;  3REO A;  4AU7 A;  1L3L A;  3DU5 A;  1FOX A;  4WXD A;  2QZ8 A;  3A1Y A;  5JLW A;  4XRS A;  4Q47 A;  4ESF A;  4XSX F;  4IVN A;  2L2O A;  4BBR J;  2H09 A;  2PMU A;  3A0B C;  2IS4 A;  1P7J A;  2XGD A;  3R0A A;  5J6X A;  2VOP A;  1R5H A;  3OL4 A;  1V55 H;  3QAH A;  2XAH A;  5DDG A;  2PQ8 A;  5K1Y A;  2ZXH A;  2VOO A;  4X0G A;  4BGD A;  2X1E A;  3S1R J;  1Y0N A;  4CCJ A;  4B44 A;  3QOP A;  5E3M A;  2L4M A;  1E17 A;  4IKF A;  1MJ9 A;  2Z3Y A;  5E79 C;  1IXR C;  1YQA A;  2DCE A;  3BT9 A;  2V26 A;  4CUG A;  2CSO A;  3HGY A;  1EH7 A;  2F2E A;  3OS1 A;  1KU3 A;  4QTR A;  2GXA A;  4NC6 A;  3TO9 A;  3HZJ A;  2ZC2 A;  3HUG B;  4L5E A;  3MMY B;  5DUK A;  2PLY A;  3CD6 I;  1XSD A;  1K4T A;  2NRA C;  4XLF A;  1I1G A;  3BG7 A;  3LSP A;  4KIS A;  1IN8 A;  1OCP A;  2EBI A;  2PJR B;  1FSE A;  5HOO A;  4IJA A;  1WJ5 A;  2CV2 A;  1Z7U A;  2QLZ A;  1A31 A;  2RN7 A;  2YPR A;  3DTI A;  4PSW A;  5F08 A;  2CQQ A;  3TP0 A;  5HLT A;  2HDC A;  5LRS A;  2IS1 A;  5L3F A;  1BI1 A;  2CS3 A;  1IJW C;  5LGN A;  3H0D A;  3G2B A;  3BZK A;  1W7P B;  4AUX A;  3LSG A;  5ILS A;  1BR4 A;  2P4W A;  3ZQG A;  1LDD A;  4QSH A;  3QYF A;  3WGI A;  2IS2 A;  3OYN A;  3CC2 I;  1BW6 A;  1GUU A;  3FXJ A;  1U9O A;  3E97 A;  2LD5 A;  3U1K A;  4L5I A;  2E5N A;  4DZP A;  4C3J J;  1NTC A;  3HPG A;  2L54 A;  3W2V A;  5ICG A;  3CCL I;  4Y3O A;  5LFA A;  3LSR A;  1ZG3 A;  3WTV C;  5EDN A;  1Q1H A;  1JHF A;  4M3E A;  2QA4 I;  5FFZ A;  5ILU A;  2NS8 A;  3ECO A;  4MEX F;  2HVS A;  1T0F C;  1XG1 A;  3KFW X;  4RAG A;  3HG9 A;  1MND A;  3OSF A;  1IRG A;  3ABT A;  2R7S A;  1B9M A;  1BI2 A;  2M4G A;  1X1C A;  4BHP A;  1ZR4 A;  3HTU A;  1HKS A;  4P55 A;  5E1X A;  2ZME B;  1QNT A;  2WB1 N;  2E34 A;  3MZY A;  2ZXI A;  3O8H A;  3KEQ A;  2OPT A;  3CCS I;  2A6E F;  4FT8 A;  4A0Z A;  1W0U A;  2UWM A;  3ONQ A;  4EGY A;  1ZYR F;  3KPH A;  1R00 A;  1JT6 A;  2XKO A;  2BXZ A;  4YFX F;  3R0J A;  2DMT A;  4LLG F;  4A2U A;  5M5Y J;  2KL4 A;  4XSZ F;  2DJI A;  4A3M J;  2FD5 A;  1U78 A;  2R7X A;  2BE5 F;  3GZ5 A;  4CCN A;  1IC8 A;  4F7Z A;  1RPW A;  2F4O B;  3NWT A;  2A61 A;  3EUH A;  2Y2Z A;  1YI2 I;  1JKP C;  2MC4 A;  2I5U A;  3DEU A;  1LVK A;  4CCK A;  3BR0 A;  1A36 A;  4KT5 C;  1A5J A;  4PZJ A;  1X2N A;  2NVY J;  2OQR A;  2VPR A;  4B3A A;  2Z1D A;  2XVC A;  4A3J J;  2X0L A;  3E5X A;  2KIF A;  5B1B H;  4P96 A;  3N4M A;  2R7Q A;  4IZZ A;  1MZB A;  2P7C B;  1XTA A;  3ASN H;  2XSJ C;  2O8K A;  3BG6 A;  4BDZ A;  1Y1W J;  5CVV A;  4CCM A;  4LG0 A;  1BW5 A;  2EV5 A;  1OMI A;  3RPU A;  1R23 A;  3CCU I;  1T6S A;  4HF1 A;  3OYG A;  1LFP A;  2DK5 A;  3WTZ A;  4WCG A;  3DWL E;  3RSN A;  3BG9 A;  1D3Y A;  1JGS A;  1TLH B;  2Z5U A;  4D7N A;  3HUG A;  4GFB A;  4AWX B;  3NAU A;  1MNM C;  3AAF A;  3BR6 A;  3S8P A;  1MD0 A;  2DYS H;  3KP7 A;  1XPX A;  3S16 J;  4L0Y B;  1HW1 A;  3LFU A;  2E1O A;  4U0V A;  5J4Y A;  5IOY A;  2VC0 A;  4ZTJ A;  2F48 A;  4M9X A;  3ZP5 A;  1IG7 A;  2P6T A;  3FXU A;  1O3R A;  5CVI A;  3LAJ A;  3K9T A;  2VI6 A;  3M3Y J;  2VBW A;  5J8F A;  1LKX A;  1IV6 A;  3ZXS A;  1STZ A;  3F6O A;  1W7P A;  3BR5 A;  4O5V A;  3P9K A;  3S2D J;  2IJL A;  1FZP B;  5JVT A;  4BY7 J;  1Z7L A;  2PEX A;  2P5L C;  4V2F A;  1Z3Y A;  1TW2 A;  1Y8Q B;  2O8X A;  4AVP A;  3JRI A;  1HST A;  3TGN A;  2ETH A;  4A3K J;  1PP8 F;  5H2F C;  3W2W A;  2WAQ N;  3UKG A;  5HLH A;  2ZB9 A;  5FLV A;  1JGG A;  3PSF A;  3FKJ A;  3H1C A;  1QBJ A;  1B9N A;  1GXQ A;  3ECH A;  1T95 A;  5IY5 H;  4OIO F;  4UVC A;  2HI3 A;  2O7O A;  4GYI A;  2DBB A;  4M72 A;  1NK3 P;  4BHC A;  2Y0M A;  3SYT A;  2MLG A;  4AID A;  1R36 A;  2OQG A;  2ICW G;  3H5N A;  4IRH A;  4OIR F;  3IV5 A;  1C0W A;  2JRT A;  1ZRF A;  3BZ6 A;  1SAU A;  4R79 A;  2JA6 J;  1Z1D A;  2ZME A;  3PL8 A;  2DTR A;  3SDB A;  3M8E A;  3MAJ A;  3C2B A;  2EZK A;  2YUS A;  4XRF A;  4QWQ A;  1LUJ B;  3BCB A;  2PFB A;  2HTS A;  3G4S I;  4BEH B;  2ZO4 A;  1P4X A;  2MYS A;  3QP5 A;  3QYB A;  1A04 A;  3E0J B;  3FHN A;  3ROU A;  2DXI A;  2HVR A;  3E7L A;  1FP1 D;  3QRF F;  2R7O A;  3GBG A;  3ZGK A;  3E6B A;  3J7A O;  2NS0 A;  2HVQ A;  5HLI A;  2XB0 X;  4YIR X;  4PGG A;  2R93 J;  1KZH A;  1MMD A;  3AFH A;  1I5Z A;  2GXB A;  2K9M A;  3QP6 A;  3EUA A;  4YIF A;  1SFU A;  1MH4 A;  2ZXW H;  2N8G A;  3IAS 2;  4A6E A;  4XID A;  1R7J A;  2GXG A;  4XKB A;  2M3A A;  2W82 A;  2NS7 A;  5M5X J;  1OCZ H;  1IXC A;  2UV1 A;  2LK2 A;  2M2E A;  2IGM A;  3ISP A;  2ZBK A;  3PQJ A;  3WGH A;  3FMS A;  5C4J J;  4D0P A;  2VKV A;  2IXS A;  3DKX A;  2K9Q A;  3CCQ I;  3GWZ A;  3HRS A;  2GAU A;  2HWV A;  2AQE A;  2HXI A;  3PFI A;  3CUQ C;  3K6G A;  4G94 A;  4KJZ A;  3WHB A;  4C2U A;  5DCF A;  2R7U A;  1LJ9 A;  4XLC A;  4HAM A;  5F1J A;  3JAM K;  5D5X B;  1TNS A;  4ENN A;  2H6C A;  1JTX A;  2GA1 A;  3CJR B;  5AIQ A;  4A3L J;  2BHY A;  1J09 A;  1LNW A;  2CO5 A;  3V7C A;  3HOS A;  3LA7 A;  2QCO A;  3AKZ A;  3HL2 A;  1D5V A;  2BY1 A;  4KA4 A;  4PJJ A;  1Z6R A;  1ETV A;  3IH4 A;  1YLF A;  1JUM A;  3K4C A;  2DDA A;  4CZZ A;  2L5Q A;  2LY2 A;  5F64 A;  3GLL A;  4I76 A;  2E2J J;  2XAG A;  4KFC A;  2JUG A;  3LFK A;  3VOD A;  3PJR A;  1UG2 A;  1IUY A;  2DOA A;  2E5Z A;  2K86 A;  5A2Q K;  4LD5 A;  2R7R A;  1YYV A;  5BOX A;  4YEL A;  5CYV A;  4L9T A;  5C3E J;  1OYI A;  1J9I A;  2EV6 A;  2L7M P;  2Z99 A;  2PMZ A;  5LEK A;  1MJA A;  1XMK A;  4XOT A;  4JX5 A;  4DW6 A;  3CJN A;  2WAQ A;  4G7Z F;  1XC5 A;  2R7T A;  1A6Q A;  1MKM A;  1XD7 A;  1DPR A;  1HC8 A;  1X1D A;  2CQ7 A;  2QQ9 A;  4F55 A;  1IN5 A;  1DQU A;  1I39 A;  1RC9 A;  1WJD A;  3VB2 A;  3M8F A;  2IS6 A;  3I59 B;  3N05 A;  4OIP F;  1FNN A;  4MTD A;  1JKO C;  2HKO A;  1EH8 A;  4PJN A;  4U0W A;  5DEQ A;  3WTS C;  2Q0O A;  3OMY A;  4FE7 A;  4ZTF A;  4RMN A;  1RKW A;  3KEO A;  2B63 J;  4AC0 A;  1ORK A;  2A68 F;  2M7B A;  2D45 A;  1MDM B;  2CH0 A;  3JRC A;  2LRD A;  1VQO I;  2IPQ X;  3MFK A;  1QO0 D;  3L2W A;  3GTL J;  3B6C A;  3KIO A;  1W1W E;  2OUM A;  4BQN A;  1VF9 A;  3S2H J;  1WI9 A;  2VT2 A;  2Y30 A;  1F43 A;  4Y13 A;  1ZRE A;  1BJZ A;  2IGK A;  1PVE A;  2EIN H;  2FEZ A;  2IGO A;  4CCL A;  1V5F A;  1SMY F;  2E19 A;  4DQ2 A;  4BY1 J;  3ABK H;  5JI6 A;  1K7A A;  4HF2 A;  2HOT A;  4HNU A;  1LPQ A;  1R4N B;  4UY8 I;  2JJ7 A;  4G6T B;  3T8T A;  2K4J A;  5HNH A;  5BPI A;  3J7Y J;  2ZSI B;  4RB1 A;  1ZG1 A;  1SEU A;  1EKE A;  1WRJ A;  4RLF A;  2O0Y A;  5TIS C;  2X4H A;  2WTE A;  2L7K A;  4EMS A;  5BPD A;  1XGS A;  2CQK A;  3LQR A;  1N25 A;  4ESJ A;  2V6E A;  3BJA A;  2XF6 A;  5L3E A;  3LSJ A;  3DBL B;  4PGH A;  3TW6 A;  1Q1V A;  3ZMD A;  3LA2 A;  5L3B A;  2HZD A;  2OV7 A;  4UVB A;  4L5J A;  3Q0W A;  2DOE A;  2E1C A;  2LYC A;  3VYR B;  4LB5 A;  1RR7 A;  5IP7 J;  2FA5 A;  1QZZ A;  2LBF A;  1R1U A;  2ZNY A;  2NNN A;  3VYU B;  1VQ4 I;  4YEJ A;  1ZAO A;  3HSE A;  3OR2 C;  1WJE A;  2ADU A;  4HBL A;  3CTA A;  3VSK A;  2OF7 A;  2COM A;  3KP2 A;  4JQF A;  3SZP A;  1VQK I;  2M8E A;  3RYP A;  3ULQ B;  4TV7 A;  1X58 A;  4EVI A;  4E4H A;  1W5C C;  1BN5 A;  5BMZ A;  2HEO A;  5FKN A;  2Y9Y A;  3L2R A;  3PFY A;  3GFJ A;  5D4S A;  3S2W A;  1OYW A;  4XMY A;  1ZH5 A;  3S3N A;  1MBJ A;  1W7P D;  3VSL A;  3OYB A;  2WAF A;  1BOB A;  3GW2 A;  2OU2 A;  4YFN F;  4XN0 A;  3H36 A;  3EDP A;  1HW2 A;  2VOD A;  4DZJ A;  4YFK F;  2A3S A;  2DMQ A;  5CQG A;  3ABU A;  3HOY J;  4ABZ A;  3DTK A;  4HDU A;  3VPR A;  5FFX A;  4DYR A;  3BR1 A;  3U2R A;  2Z33 A;  4BYY A;  2EH3 A;  3E5Q A;  2CV0 A;  1ZK8 A;  2RVC A;  3I59 A;  1JJ6 C;  1ZKG A;  1P2F A;  4CIC A;  3MZ8 A;  2FQ4 A;  3SHF A;  1YW7 A;  3SQN A;  5F0H A;  2CJJ A;  3PUB A;  3NQO A;  3TW7 A;  2L0K A;  4CSW A;  1G59 A;  4EM1 A;  4AD9 A;  3KLN A;  2H27 A;  3IWZ A;  1UB9 A;  1WH5 A;  2KFD A;  3A4C A;  4CYC B;  1QVU A;  1MDM A;  4UUT A;  4E7S A;  1AHD P;  1YX5 A;  2VJ4 A;  1YRN B;  3A2K A;  3PSI A;  5ERI A;  1HW5 A;  3JAM Z;  1I3Q J;  1YW8 A;  2HDD A;  5DM6 F;  2QQA A;  5HDK A;  5LHG A;  1U5T C;  4BAY A;  2CW7 A;  3MQ0 A;  3NEU A;  3TDZ C;  3GFL A;  5HVQ C;  4C30 A;  3V42 A;  2G7H A;  1GVD A;  3L2U A;  1Y8R B;  2DO7 A;  4FX4 A;  4F3Q A;  4RA2 A;  3RKX A;  1FIP A;  3GZN B;  1QQI A;  5A2Q Z;  2KDZ A;  2HPM A;  4YG2 F;  4FAS D;  4MNU A;  1BIB A;  3DKW A;  5B3S H;  1TBX A;  4S0H B;  1JXS A;  2UZK A;  3ZMV A;  3SFZ A;  3ZOB A;  2WV0 A;  1QRY A;  1O3S A;  5JHU A;  1MSE C;  1R5G A;  1Z21 A;  1PJR A;  2CWE A;  1F4K A;  2V9K A;  1REP C;  1QU3 A;  1YIO A;  4FE4 A;  1HCR A;  2GBY A;  3KP6 A;  4ETS A;  2CW0 F;  2KDO A;  4AIH A;  2HFH A;  4ASN A;  5LHH A;  4QLC U;  3GCM A;  4LOC A;  1LDJ A;  3M7G A;  5JVG F;  3OS2 A;  1EA3 A;  2VBY A;  2LMD A;  2JSC A;  1SFK A;  5DS9 A;  1MMS A;  1FYL A;  4B09 A;  1F1Z A;  1FOK A;  1KQ0 A;  1XGO A;  1MBE A;  3U9G A;  3A02 A;  5KAF C;  1RI7 A;  4S05 A;  3BCA A;  2LKX A;  1N77 A;  3VYT B;  3TO7 A;  1SMT A;  2F5V A;  4FIS A;  2W7N A;  2D1V A;  3GO5 A;  3NAR A;  5IYD J;  3F0C A;  1ZRC A;  4EJW A;  1BIA A;  1XCB A;  1OPC A;  3QOD A;  2X1D A;  4RDU A;  2VPL A;  3DEE A;  3G6E I;  5GAE J;  5IP9 J;  3FX3 A;  4WX9 A;  2ZJQ F;  9ANT A;  1W36 D;  5J1U A;  1P7I A;  2DOD A;  2VQH A;  4UV8 A;  1MJB A;  2IA1 A;  1VQ5 I;  2H8W A;  3X2Q H;  2B0L A;  4A5M A;  2H6B A;  3F8F A;  4XOR A;  4HG2 A;  2HQA A;  3LQQ A;  3RTR A;  5JHF A;  5FB2 A;  1TWA J;  3H5R A;  2LFB A;  1TZL A;  2R7Z J;  3JRE A;  2LH9 A;  3D5S C;  2PJP A;  4IF4 A;  4HSR A;  2HKX A;  1LVA A;  1BI0 A;  4GCV A;  2HOA A;  2K7L A;  2W57 A;  3GTK J;  1BM9 A;  3HHH A;  3M1E A;  3BPX A;  2NVT J;  2OTL I;  3CJQ B;  1Z77 A;  3D5L A;  1QPI A;  2KP6 A;  2FX0 A;  5ILV A;  4II2 A;  4DIQ A;  3ZQ7 A;  1VTN C;  5D5W B;  4L0Z B;  3MKZ A;  3FIS A;  2MLK A;  3KLO A;  4JX4 A;  3CF2 A;  4A93 J;  1YS7 A;  2QM3 A;  4I7H A;  2K4B A;  1S8N A;  4A3F J;  2JA5 J;  4CYC A;  2LSO A;  3KZY A;  4Q5S F;  1BC8 C;  2DN0 A;  2HYF A;  1K6O A;  3V7R A;  3CMY A;  2Y0S A;  4LFU A;  1YRN A;  1FMW A;  2VC1 A;  2DA6 A;  4QPQ A;  1JI8 A;  1YIT I;  2C6Y A;  1RES A;  3K69 A;  3DBH B;  1JJ8 C;  1X1A A;  1Z0X A;  2KZG A;  2R7F A;  1E3O C;  3R4K A;  2NVX J;  4HX7 A;  2IEK A;  4A0X A;  1WQ2 A;  4BE2 A;  2LY9 A;  1WH7 A;  3C18 A;  3EUH C;  1GLN A;  1I6X A;  1TT0 A;  1ZR2 A;  1T98 A;  2DFE A;  1Z9C A;  2VE8 A;  1ETX A;  2ZJR F;  4OAZ A;  4XKC A;  4A3B J;  1Z05 A;  2WBM A;  2F4M B;  5ICE A;  2R0Q C;  2RGV A;  1KON A;  1RKT A;  2W25 A;  5DCM B;  4D1Q A;  1MBF A;  2HOE A;  4BUP A;  3WTU C;  3F8N A;  4XL9 A;  5CLS A;  4YII A;  2IT0 A;  3IL2 A;  3QOE A;  4BE0 A;  1F5T A;  4NDL A;  2R5Z B;  1SVL A;  1YW9 A;  3I4N J;  2VXD A;  3GTG J;  3IUO A;  1HXD A;  5EEG A;  2QF7 A;  3GME A;  5H6Q A;  4V2G A;  3WU1 B;  4KMU X;  5J47 A;  2EJR A;  1XDS A;  3FMR A;  5M3M J;  1B8I B;  3AL0 B;  1V3F A;  2L9V A;  2AXL A;  2QBY B;  2LY1 A;  3B73 A;  5D6F A;  4HA8 A;  4QIW N;  1KYW A;  2IBD A;  1RNL A;  2R5Y B;  1K78 B;  3CES A;  5K5Q A;  2FQ3 A;  2K3F A;  3CMA I;  1FTT A;  3D1N I;  1X2M A;  2JA8 J;  5EEH A;  3L2V A;  1IW7 F;  1B1B A;  1EF4 A;  3S15 J;  3O2P E;  4HRI A;  1J59 A;  4IHT A;  4GYG A;  2DFI A;  4ENK A;  1XDU A;  3FXL A;  3Q9S A;  2JUC A;  5FKO A;  3F22 A;  2DOF A;  2LF8 A;  4XR6 A;  2R7W A;  2QSG X;  1Y0U A;  4HX8 A;  2STW A;  2W85 A;  3CJT B;  1W5T A;  4XK4 A;  2XKP A;  2NAZ A;  2W4S A;  1D0Y A;  3QPS A;  4EJU A;  4IL6 C;  3S1M J;  3LMM A;  4M6X A;  4OOI A;  2ZFU A;  5DYM A;  2K3P A;  4G7H F;  2K9L A;  1U8R A;  5LHI A;  3HKZ N;  2FUG 2;  3G3Z A;  2DPD A;  2ZSH B;  1SD6 A;  2DMU A;  1FTZ A;  5FD5 A;  1SFX A;  1QVT A;  2E60 A;  3MN2 A;  2RNG A;  2DA3 A;  5FLX K;  2EZH A;  4A6D A;  4IQJ A;  2A6H F;  3K4M A;  5CJ9 A;  1HDP A;  2FU4 A;  1UFM A;  4H0E A;  2V1D A;  4K2E A;  2ELK A;  5FRO A;  2JQ7 A;  4G9Y A;  3FBI B;  1UZC A;  4KDP A;  3F8M A;  1TWH J;  1XMX A;  5DV5 A;  1IF1 A;  3DKY A;  4CCO A;  1RZ4 A;  4L9V A;  2A07 F;  1CF7 B;  3ML6 A;  2NVQ J;  3BJO A;  5FO5 A;  1K4S A;  4UUS B;  2LTP A;  2DFH A;  4ZYG A;  4BBS J;  2L9S A;  4M71 A;  3CF5 F;  3L00 A;  4A3I J;  2DLL A;  3M1C A;  1KGS A;  3PUF A;  4UXN A;  1QA6 A;  3PM1 A;  1T39 A;  4BS9 A;  2PJR A;  1WCM J;  2FBI A;  4Y15 A;  4LLN A;  1XS9 A;  4IPA A;  4C3H J;  1H9T A;  2Y31 A;  2X6O A;  5E1W A;  3PNV A;  1ZRD A;  3QQA A;  4C9Y A;  3E6M A;  3RKQ A;  5KCM A;  4IHW A;  5E3L A;  1G3S A;  2EFW A;  2DA5 A;  4FET A;  3OYA A;  3RI4 A;  3HRT A;  1KQ8 A;  1U9N A;  2Q2E B;  4J01 A;  2ZFW A;  1E3H A;  5LEJ A;  1JKQ C;  3FXM A;  3DXJ F;  1T0F A;  1UHM A;  2VBZ A;  2R5Z A;  2JRM A;  3ESW B;  3MKL A;  5HDN A;  3CZ6 A;  2IGN A;  4P9F A;  1VFC A;  2OJE D;  1ULY A;  1HOM A;  4PSX A;  5L3D A;  2LNB A;  3ZQC A;  3CCY A;  1U8B A;  1WI3 A;  4C2M J;  2JA2 A;  2M45 A;  1YE9 A;  1DP7 P;  2AXT C;  3FIW A;  3E1S A;  3OS0 A;  1B8I A;  3RZO J;  3L9F A;  3ZQL A;  2P7V B;  2QBY A;  4RGR A;  3ZMZ A;  4GRI A;  1DPU A;  3FXO A; 
#chains in the Genus database with same CATH homology
 1ZG5 A;  1K78 A;  1O7L A;  4MQV A;  1BOA A;  4GGG A;  2TDX A;  1H9G A;  4B8X A;  2ACJ A;  1OYY A;  2M5W A;  3O6B B;  5LRR A;  3C7J A;  1XSX A;  2L4A A;  2ISZ A;  3I4P A;  3DPL C;  1IAW A;  4Z2Y A;  2P8T A;  2OZ6 A;  2JT1 A;  3I5U A;  5DD4 A;  2K27 A;  3QPH A;  3DV8 A;  4BQA A;  3D0S A;  1PUE E;  5KK1 A;  1U3E M;  2FXA A;  1IXS B;  5LLQ A;  3LST A;  3M9A A;  1J5Y A;  1FT9 A;  1XMA A;  5CVJ A;  2RC4 A;  4BNC A;  2XAF A;  2EV0 A;  1RUO A;  4HLX A;  2O03 A;  4UVA A;  4JBA A;  3I71 A;  4N9H A;  2DPU A;  2RKH A;  3FHZ A;  3N97 A;  1O3Q A;  3FMQ A;  2RDP A;  3F8B A;  3V8L A;  2Q2E A;  4RGX A;  5F6F A;  3WTY C;  1IN4 A;  3J80 K;  4RGS A;  2D1H A;  5BS6 A;  1MGT A;  1GXP A;  2QQB A;  2F5D A;  5HLG A;  2STT A;  3TO6 A;  1UST A;  4PCQ A;  3V7S A;  1E2X A;  3KZZ A;  5ICC A;  5FLX Z;  3F3X A;  3OV8 A;  2OD5 A;  2IW5 A;  2P6S A;  1PDN C;  3GFI A;  2PN6 A;  1T2K A;  3ERE D;  4RGU A;  3F23 A;  2HQR A;  4R1H A;  1IN6 A;  2QYO A;  4P5O A;  4MQ9 F;  4KN7 X;  1BBY A;  4A0Y A;  2NYX A;  2F5C A;  3BJ6 A;  4E70 A;  1HSJ A;  4AIK A;  1X3U A;  1KYZ A;  2IA0 A;  4EJO A;  1IN7 A;  3DQV C;  3HRU A;  2IRF G;  1FLI A;  2KIM A;  3WU0 A;  2G7U A;  3LWF A;  4JK1 X;  1W4M A;  2HTJ A;  2CG4 A;  3MEX A;  3G73 A;  5DD8 A;  2RQP A;  2YR2 A;  2FBH A;  3GF2 A;  3FXR A;  2UXN A;  3DP7 A;  3RKW A;  1F9N A;  2ZKZ A;  2PG4 A;  2FBK A;  5IT9 K;  3IC7 A;  2NNY A;  2KRF A;  2EA4 A;  4HOB A;  3O3K A;  3JTH A;  4O6J A;  5JFR A;  4UUV A;  4MEY F;  1G6N A;  4HDV A;  5K5R A;  4OMY A;  1XGM A;  1ZGA A;  3FF5 A;  1TW3 A;  3JSO A;  3I64 A;  3ZN0 A;  2RV8 A;  2CGP A;  2L3D A;  4M74 A;  2XGX A;  1U5T B;  4L9J A;  5JR3 A;  3ZMS A;  2QUF A;  1ONV A;  2OAZ A;  2R7D A;  2W24 A;  3GZ6 A;  3I58 A;  4R8H A;  2JTV A;  2HGC A;  2DU9 A;  2FRH A;  1S7O A;  1ZN2 A;  2DAO A;  1HKQ A;  5J8C A;  3R61 A;  5KVR A;  1TNT A;  2MD5 A;  3ZMU A;  3EET A;  4U0Y A;  1O3T A;  4RB0 A;  3ZMT A;  1R22 A;  4I01 A;  4I09 A;  2Y48 A;  3WTW C;  1OKR A;  1YG2 A;  1G3W A;  5FGM A;  3J80 Z;  1S7A A;  3P9I A;  4GO1 A;  1FP2 A;  1FBQ A;  5LGU A;  2O3F A;  2FE3 A;  2EFN A;  2EFP A;  1FWZ A;  4S04 A;  4M6Y A;  3GXO A;  2BBY A;  1P92 A;  3E6C C;  3C1D A;  4A5N A;  2M1B A;  4U88 A;  4IRI A;  2D2W A;  1V4R A;  1FC3 A;  3E3V A;  1SAX A;  1KQ9 A;  2VN2 A;  4P9U A;  3HOT A;  2XAJ A;  2KIU A;  4HV6 A;  1R58 A;  3RKY A;  3LA3 A;  3KE2 A;  1S3J A;  3TOB A;  5D4R A;  5HS8 A;  3K1N A;  3C3W A;  4CDG A;  2PBI A;  3MZH A;  2YU3 A;  5E8G A;  3W6K B;  1OR7 A;  1U5T A;  2YX7 A;  3BDD A;  3W6J B;  3CO7 C;  1CGP A;  2VBX A;  3IKV A;  5E1Z B;  1W5S A;  1FY7 A;  2HYG D;  1LQ1 A;  4EJT A;  4BHB A;  3VEP A;  1YFH A;  2L01 A;  3I53 A;  5E18 F;  1ON1 A;  3R6S A;  5ED4 A;  2E7W A;  2FOK A;  2QEN A;  5IT9 Z;  1KU9 A;  2ISY A;  3HYI A;  2ESN A;  3H3U A;  3TDU C;  2OA4 A;  4EQQ A;  2VON A;  1I27 A;  1S29 A;  4HYE A;  4LG0 B;  1WSU A;  5D5V B;  2Z9O A;  2M87 A;  4HF0 A;  3BRO A;  3RYR A;  1TQP A;  1FBU A;  1HQC A;  1KU7 A;  1ZGJ A;  4ZYH A;  5D6E A;  4L18 B;  3FZV A;  4KIC A;  1P4W A;  1J2X A;  4RB2 C;  1FYK A;  5HS7 A;  4LLL A;  4RAZ A;  1K79 A;  4WF2 A;  2FF4 A;  4G8X A;  1HBX G;  4N0B A;  3LAP A;  3DF8 A;  4RAY A;  3JW4 A;  3RPQ A;  4AIJ A;  3VFZ A;  1QZY A;  2HQN A;  4EJV A;  1B4A A;  4ON0 A;  4N9I A;  3KCC A;  2LF7 A;  4OIN F;  2OZU A;  1WWX A;  2BGC A;  2V9V A;  2DQL A;  4M9S A;  3TQN A;  2WWY A;  3ZPL A;  3WE3 A;  3P7N A;  3Q5F A;  4LK0 F;  2GA2 A;  4OMZ A;  3R60 A;  1JHH A;  3EQL F;  2QWW A;  2MC3 A;  1R1T A;  1AOY A;  1JE8 A;  3HRM A;  2XUB A;  3FXQ A;  3HSR A;  3GFM A;  4CXF A;  2XHK A;  2BV6 A;  1S6L A;  2QVO A;  4G6Q A;  3H92 A;  4OIQ F;  4I98 B;  4BXU A;  3MWM A;  1D8K A;  4ENM A;  4LJZ F;  2KKO A;  2A5Y B;  3BPV A;  5F1R A;  1PP7 U;  1LEA A;  3ELK A;  1SFE A;  1G3T A;  3SXY A;  3RDI A;  1H0M A;  1SD7 A;  2EWN A;  2XV4 S;  1BC7 C;  5HDG A;  5D5U B;  2J5P A;  3ZN1 A;  2DQR A;  4PDK A;  2GQQ A;  3CUO A;  5DCM A;  3FWE A;  1R1V A;  3HSF A;  3WTT C;  2E7X A;  3L09 A;  2RNJ A;  3IHU A;  1YTY A;  1AWC A;  4DNC A;  2MBF A;  3L7W A;  5CVR A;  4WWC A;  2GZW A;  3HHG A;  1O7F A;  1J0R A;  1J75 A;  2F5F A;  2CFX A;  1RUN A;  1LDK B;  3K1M A;  4KNY A;  5FD6 A;  4EV0 A;  3VOE A;  1FPQ A;  1T38 A;  3PQK A;  1B6A A;  4MGR A;  1RIO H;  1USS A;  3V8K A;  4XLP F;  2J5O A;  2XIG A;  1U6G A;  4HQM A;  1ON2 A;  1L0O C;  3MCZ A;  2EK5 A;  2XRN A;  5AIP A;  1TQI A;  4ESB A;  5L3G A;  3CUQ B;  2MA3 A;  4ZZL A;  4KIF A;  1ZLK A;  2FMY A;  3TOA A;  4M9Z A;  3SZT A;  1DUX C;  1GVJ A;  2V1U A;  1KA8 A;  4I0B A;  4Y17 A;  3WE2 A;  3CDH A;  4XLN F;  3KP5 A;  2DI3 A;  4M73 A;  1CF7 A;  5E17 F;  1YS6 A;  3CLO A;  2VT3 A;  4KN4 X;  4KUM A;  3GYH X;  3HTS B;  1GHC A;  3WOD F;  4EM2 A;  3IKT A;  3GVA A;  3DFG A;  4UHT A;  2F5E A;  4ENJ A;  2ELH A;  1ZAR A;  1G3Y A;  3KET A;  1B59 A;  1NHA A;  2EA2 A;  4HX4 A;  2FSW A;  1XB4 A;  4CO8 A;  4RS8 A;  2EB7 A;  4G6D A;  3V8J A;  4CHU A;  2OBP A;  3BP8 A;  2KJB A;  4ZZD A;  3B02 A;  5ICF A;  3KP4 A;  4U7B A;  3K0L A;  3P9C A;  3OOP A;  5BQT A;  4I02 A;  4ZYE A;  4IRG A;  2LDU A;  4MHG A;  2IP2 A;  2A69 F;  1LB2 A;  2P5V A;  1J7K A;  3RJP A;  1G4D A;  5TJJ A;  3IRQ A;  4LGW A;  2DK8 A;  3GEZ A;  5TRD A;  2JPB A;  3J81 K;  2FML A;  3I54 A;  2W84 A;  3F21 A;  4NHJ A;  2AS5 F;  2MH2 A;  3V4G A;  4IXA A;  4FX0 A;  4I2O A;  2KJC A;  3CUQ A;  1EH6 A;  1I1S A;  3WG9 A;  3BY6 A;  4L9N A;  3IWF A;  2YSR A;  4LK1 F;  4XBF A;  2P5K A;  2GWR A;  5IT3 A;  3WGG A;  1YO5 C;  4KIB A;  2ZCW A;  1FYM A;  4NB5 A;  1XGN A;  4UV9 A;  3HIF A;  1XSV A;  4KIG A;  2HS5 A;  1U2W A;  2MH9 A;  5LBQ A;  1BI3 A;  3T8R A;  2VE9 A;  1P6R A;  3Q9V A;  1ODD A;  2V6C A;  2FNP A;  2JZY A;  3WTX C;  2PI0 A;  1FX7 A;  4LMY A;  2E1N A;  2M30 A;  5D8L B;  4HLY A;  3KP3 A;  4Q4Z F;  4HQE A;  4ZYD A;  1O57 A;  1SD4 A;  4U7D A;  5H20 A;  4RB3 C;  2BEO A;  4OU0 A;  2O61 A;  1D8J A;  4GXO A;  6PAX A;  3F8C A;  2DW4 A;  4Q48 A;  2BYV E;  4I0A A;  4WK8 F;  2O6G E;  5LGT A;  1ZHF A;  2XAQ A;  4FHT A;  4CYD A;  2ZJ2 A;  3E6D A;  2ESH A;  3F6V A;  1Z6T A;  4NQW A;  2ZNZ A;  1QGP A;  3FM3 A;  3NRV A;  4EGZ A;  3GLX A;  3U1D A;  3BWG A;  4G7O F;  4O3M A;  3E5U A;  1ZLJ A;  1IRF A;  1UHW A;  3K2Z A;  3EYY A;  3RIR A;  4EM0 B;  2CYY A;  3GX4 X;  3BOQ A;  1FBS A;  5H6R A;  4LB6 B;  3QU3 A;  2V79 A;  2YX4 A;  3IRR A;  2DT5 A;  3K1P A;  3FM5 A;  4BH9 A;  3T1B A;  4KMF A;  2HZT A;  1KU2 A;  3DPT A;  2Y75 A;  3I0T A;  1TQM A;  1P4A A;  4HV5 A;  2FNA A;  5HS9 A;  2XRO A;  3TKY A;  1SD5 A;  3T5X A;  2WC2 A;  4ZH4 F;  1DDN A;  4HW0 A;  2K02 A;  4HZF A;  4KYW A;  4IHS A;  3F72 A;  3GUD A;  2IA2 A;  3QPT A;  3EYI A;  3T0Y A;  2ZXJ A;  1IZ1 A;  1Z91 A;  4CGZ A;  2R3S A;  3JSP A;  3H3Z A;  2G9W A;  2IVM A;  2H94 A;  1BJA A;  1HKT A;  3L2C A;  1FSH A;  2PMH A;  5E20 A;  1TTY A;  2EFO A;  5DUI A;  3JTG A;  1XCV A;  5L3C A;  5AON A;  2GIV A;  3J81 Z;  5K5O A;  1EV7 A;  3COA C;  2JPC A;  4A12 A;  2UXX A;  1WKM A;  3QU6 A;  4WXC A;  2VXZ A;  1LEB A;  4MTE A;  2L02 A;  2V1X A;  2LKP A;  2Q8K A;  5D8K B;  2EFQ A;  2XAS A;  3CO6 C;  5CVU A;  5E8I A;  4UNO A;  1XN7 A;  1QPM A;  4WXH A;  1UCR A;  2HR3 A;  3REO A;  1L3L A;  4WXD A;  2QZ8 A;  4Q47 A;  4ESF A;  4XSX F;  4IVN A;  2H09 A;  2PMU A;  3R0A A;  5J6X A;  2VOP A;  1R5H A;  3QAH A;  2XAH A;  5DDG A;  2PQ8 A;  5K1Y A;  2VOO A;  3QOP A;  2L4M A;  1E17 A;  1MJ9 A;  2Z3Y A;  1IXR C;  1YQA A;  2CSO A;  1EH7 A;  2F2E A;  1KU3 A;  3TO9 A;  5DUK A;  2PLY A;  1XSD A;  2NRA C;  1I1G A;  1IN8 A;  1FSE A;  5HOO A;  4IJA A;  1Z7U A;  2QLZ A;  2RN7 A;  2YPR A;  2HDC A;  5LRS A;  5L3F A;  1BI1 A;  5LGN A;  1W7P B;  5ILS A;  2P4W A;  1LDD A;  3WGI A;  3E97 A;  4L5I A;  2L54 A;  5ICG A;  1ZG3 A;  3WTV C;  1Q1H A;  1JHF A;  5FFZ A;  5ILU A;  3ECO A;  4MEX F;  3KFW X;  1IRG A;  3ABT A;  1B9M A;  1BI2 A;  4BHP A;  3HTU A;  1HKS A;  4P55 A;  5E1X A;  2ZME B;  1QNT A;  3MZY A;  3KEQ A;  2A6E F;  4FT8 A;  4A0Z A;  2UWM A;  4EGY A;  1ZYR F;  1R00 A;  2XKO A;  4YFX F;  3R0J A;  4LLG F;  4A2U A;  4XSZ F;  1U78 A;  2BE5 F;  3GZ5 A;  4F7Z A;  2A61 A;  3EUH A;  3DEU A;  4KT5 C;  4PZJ A;  2OQR A;  2XVC A;  2X0L A;  3E5X A;  2KIF A;  4P96 A;  3N4M A;  1MZB A;  2P7C B;  5CVV A;  4LG0 A;  2EV5 A;  1OMI A;  3RPU A;  1R23 A;  1T6S A;  4HF1 A;  2DK5 A;  3WTZ A;  4WCG A;  1D3Y A;  1JGS A;  1TLH B;  2Z5U A;  3HUG A;  4AWX B;  3AAF A;  1MD0 A;  3KP7 A;  4L0Y B;  1HW1 A;  4U0V A;  2VC0 A;  4M9X A;  3ZP5 A;  2P6T A;  3FXU A;  1O3R A;  5CVI A;  3LAJ A;  3K9T A;  2VBW A;  5J8F A;  1STZ A;  3F6O A;  1W7P A;  4O5V A;  3P9K A;  2IJL A;  1FZP B;  5JVT A;  2PEX A;  2P5L C;  1TW2 A;  2O8X A;  4AVP A;  1HST A;  3TGN A;  2ETH A;  1PP8 F;  5HLH A;  1QBJ A;  1B9N A;  1GXQ A;  3ECH A;  4OIO F;  4UVC A;  4GYI A;  2DBB A;  4M72 A;  4BHC A;  2Y0M A;  2MLG A;  1R36 A;  2OQG A;  4IRH A;  4OIR F;  1C0W A;  2JRT A;  1ZRF A;  3BZ6 A;  4R79 A;  1Z1D A;  2ZME A;  2DTR A;  3M8E A;  3MAJ A;  4XRF A;  4QWQ A;  2PFB A;  2HTS A;  2ZO4 A;  1P4X A;  3QP5 A;  1A04 A;  3ROU A;  1FP1 D;  3QRF F;  3E6B A;  3J7A O;  2NS0 A;  5HLI A;  4PGG A;  1I5Z A;  2GXB A;  3QP6 A;  4YIF A;  1SFU A;  4A6E A;  1R7J A;  2GXG A;  1IXC A;  3ISP A;  2ZBK A;  3PQJ A;  3WGH A;  3FMS A;  4D0P A;  3GWZ A;  3HRS A;  2GAU A;  2HWV A;  4G94 A;  3PFI A;  3CUQ C;  5DCF A;  1LJ9 A;  4HAM A;  3JAM K;  5D5X B;  1TNS A;  4ENN A;  2H6C A;  2GA1 A;  5AIQ A;  1LNW A;  2CO5 A;  3V7C A;  3HOS A;  3LA7 A;  1D5V A;  4KA4 A;  1Z6R A;  1YLF A;  4CZZ A;  5F64 A;  2XAG A;  4KFC A;  3LFK A;  3VOD A;  1IUY A;  2K86 A;  5A2Q K;  4LD5 A;  1YYV A;  5BOX A;  5CYV A;  4L9T A;  1OYI A;  1J9I A;  2EV6 A;  2Z99 A;  5LEK A;  1MJA A;  1XMK A;  3CJN A;  4G7Z F;  1MKM A;  1XD7 A;  1DPR A;  2QQ9 A;  1IN5 A;  3VB2 A;  3M8F A;  3I59 B;  4OIP F;  1FNN A;  4MTD A;  2HKO A;  1EH8 A;  4U0W A;  5DEQ A;  3WTS C;  2Q0O A;  3KEO A;  2A68 F;  2D45 A;  1MDM B;  2IPQ X;  3MFK A;  1QO0 D;  1WI9 A;  2VT2 A;  4Y13 A;  1ZRE A;  2FEZ A;  1SMY F;  4DQ2 A;  5JI6 A;  1K7A A;  4HF2 A;  3T8T A;  2K4J A;  5BPI A;  4RB1 A;  1ZG1 A;  1WRJ A;  2O0Y A;  2X4H A;  2WTE A;  4EMS A;  5BPD A;  1XGS A;  2CQK A;  3LQR A;  4ESJ A;  3BJA A;  5L3E A;  4PGH A;  3ZMD A;  3LA2 A;  5L3B A;  4UVB A;  4L5J A;  2E1C A;  4LB5 A;  2FA5 A;  1QZZ A;  1R1U A;  2ZNY A;  2NNN A;  1ZAO A;  3HSE A;  2ADU A;  4HBL A;  3CTA A;  2COM A;  3KP2 A;  4JQF A;  3SZP A;  2M8E A;  3RYP A;  3ULQ B;  4TV7 A;  4EVI A;  1BN5 A;  5BMZ A;  2HEO A;  3GFJ A;  5D4S A;  3S2W A;  1OYW A;  1ZH5 A;  1W7P D;  3GW2 A;  2OU2 A;  4YFN F;  3EDP A;  1HW2 A;  2VOD A;  4YFK F;  2A3S A;  3ABU A;  4HDU A;  5FFX A;  3U2R A;  2Z33 A;  4BYY A;  3E5Q A;  2RVC A;  3I59 A;  1P2F A;  4CIC A;  3SHF A;  1YW7 A;  3SQN A;  3NQO A;  4EM1 A;  4AD9 A;  3KLN A;  2H27 A;  3IWZ A;  1UB9 A;  1MDM A;  5ERI A;  1HW5 A;  3JAM Z;  1YW8 A;  2QQA A;  5HDK A;  5LHG A;  1U5T C;  4BAY A;  3MQ0 A;  3NEU A;  3TDZ C;  3GFL A;  5HVQ C;  2G7H A;  2DO7 A;  4FX4 A;  3RKX A;  5A2Q Z;  1QQI A;  4YG2 F;  4MNU A;  1BIB A;  3DKW A;  1TBX A;  1JXS A;  2UZK A;  3ZMV A;  3SFZ A;  2WV0 A;  1O3S A;  5JHU A;  1R5G A;  2CWE A;  1F4K A;  1REP C;  1YIO A;  3KP6 A;  4ETS A;  2CW0 F;  4AIH A;  2HFH A;  4ASN A;  5LHH A;  4QLC U;  1LDJ A;  3M7G A;  2VBY A;  2JSC A;  1FYL A;  4B09 A;  1F1Z A;  1FOK A;  1KQ0 A;  1XGO A;  3U9G A;  1RI7 A;  4S05 A;  3TO7 A;  1SMT A;  2D1V A;  3GO5 A;  1ZRC A;  4EJW A;  1BIA A;  1XCB A;  1OPC A;  4WX9 A;  3FX3 A;  4UV8 A;  1MJB A;  2IA1 A;  2B0L A;  4A5M A;  2H6B A;  3F8F A;  3RTR A;  3LQQ A;  5FB2 A;  2PJP A;  4IF4 A;  2HKX A;  1LVA A;  1BI0 A;  4GCV A;  2K7L A;  2W57 A;  1BM9 A;  3HHH A;  3M1E A;  3BPX A;  3D5L A;  5ILV A;  3ZQ7 A;  1VTN C;  5D5W B;  4L0Z B;  2MLK A;  3KLO A;  1YS7 A;  2QM3 A;  4I7H A;  2K4B A;  1S8N A;  2LSO A;  3KZY A;  4Q5S F;  1BC8 C;  1K6O A;  2HYF A;  3V7R A;  4LFU A;  2VC1 A;  2C6Y A;  3K69 A;  2R7F A;  3R4K A;  4HX7 A;  4A0X A;  1WQ2 A;  3C18 A;  1I6X A;  1T98 A;  1Z9C A;  2VE8 A;  1Z05 A;  5ICE A;  2RGV A;  2W25 A;  5DCM B;  2HOE A;  3WTU C;  3F8N A;  5CLS A;  4YII A;  2IT0 A;  3IL2 A;  1F5T A;  1YW9 A;  1HXD A;  5EEG A;  5H6Q A;  3WU1 B;  4KMU X;  2EJR A;  1XDS A;  3FMR A;  1V3F A;  2AXL A;  2QBY B;  3B73 A;  5D6F A;  4HA8 A;  1KYW A;  1RNL A;  1K78 B;  5K5Q A;  2FQ3 A;  5EEH A;  1IW7 F;  1B1B A;  3O2P E;  1J59 A;  4IHT A;  4GYG A;  2DFI A;  4ENK A;  1XDU A;  3Q9S A;  3F22 A;  2LF8 A;  1Y0U A;  4HX8 A;  2STW A;  2W85 A;  1W5T A;  2XKP A;  2NAZ A;  4EJU A;  4M6X A;  4OOI A;  5DYM A;  4G7H F;  1U8R A;  5LHI A;  3G3Z A;  2DPD A;  1SD6 A;  5FD5 A;  1SFX A;  5FLX K;  4A6D A;  2A6H F;  5CJ9 A;  2FU4 A;  1UFM A;  4H0E A;  2V1D A;  4K2E A;  4G9Y A;  4KDP A;  3F8M A;  5DV5 A;  1IF1 A;  1RZ4 A;  4L9V A;  2A07 F;  1CF7 B;  3ML6 A;  3BJO A;  5FO5 A;  4ZYG A;  4M71 A;  3L00 A;  2DLL A;  1KGS A;  4UXN A;  1T39 A;  2FBI A;  4Y15 A;  4LLN A;  4IPA A;  1H9T A;  5E1W A;  1ZRD A;  3E6M A;  1G3S A;  2EFW A;  3RI4 A;  3HRT A;  1KQ8 A;  2ZFW A;  5LEJ A;  3DXJ F;  1T0F A;  1UHM A;  2VBZ A;  5HDN A;  4P9F A;  1ULY A;  5L3D A;  2LNB A;  2M45 A;  1DP7 P;  3L9F A;  2QBY A;  2P7V B;  4RGR A;  3ZMZ A;  1DPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...