1RIOH

Structure of bacteriophage lambda ci-ntd in complex with sigma-region4 of thermus aquaticus bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a ternary transcription activation complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
molecule keywords 27-MER
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rioH00
4CICA 3K69A 4M6YA 2IA0A 3HUGA 4GO1A 1XGNA 1G3YA 4D0PA 3U1DA 3GX4X 1FSEA 1J59A 3G3ZA 3N4MA 3GFJA 1LJ9A 1B1BA 2ZNZA 2WC2A 2L4AA 4U0VA 3WG9A 2GXBA 2HKXA 4L9TA 3JTHA 5JR3A 4XSZF 3MZHA 3BDDA 3HIFA 1R23A 3K2ZA 2CO5A 1T0FA 1KU2A 2F5FA 4UV8A 5KK1A 3J81Z 3TOAA 4PZJA 2CSOA 3R4KA 1OPCA 3F8MA 3IRRA 4YG2F 3FM3A 4HBLA 4H0EA 2B0LA 1SMYF 3LFKA 2K86A 3IKTA 1ULYA 2PBIA 4GYIA 4ESBA 2FU4A 3L9FA 2RC4A 2V6CA 3KP4A 4PGHA 3F23A 3IRQA 1FBUA 2QENA 3PQJA 2FQ3A 4HF0A 2XV4S 2FRHA 4MQVA 1LDKB 1J0RA 4XRFA 3R0AA 3F8CA 1ZG5A 5LGTA 5HLIA 2HYGD 1HBXG 1UFMA 4HV6A 3T8TA 2P6SA 3ZP5A 4HAMA 4M9ZA 4LG0B 1R00A 5E18F 2ZO4A 2HZTA 4P9UA 4HLYA 3E5UA 3RYRA 1P4AA 3E6BA 2XROA 1Z1DA 2D1HA 1QO0D 3ZMZA 4HX7A 3RI4A 3KP3A 3PQKA 2CWEA 4ASNA 5E17F 1MD0A 1W7PA 5E20A 2ELHA 1HW2A 4PDKA 2Z5UA 3QAHA 1T98A 3U2RA 4ENKA 5TJJA 4JQFA 1J2XA 1TNSA 4M6XA 4P96A 2H94A 5D4RA 1FX7A 1W7PB 4BHBA 2A6HF 3ZMSA 3K1MA 5F6FA 1FP1D 3JTGA 3FXQA 3RPUA 3F8NA 4ETSA 1LEAA 4UVCA 1JXSA 2VODA 1YTYA 4WXDA 4Y13A 2CFXA 1DDNA 1ZLKA 4A6DA 2DI3A 2FSWA 2PMHA 3IC7A 2FA5A 4HX8A 4U0YA 1TW3A 5CLSA 1G4DA 1ZAOA 3FZVA 2F5DA 3RPQA 4LLNA 4U0WA 4G7ZF 2CW0F 1XGOA 4A5NA 1QGPA 1BI0A 2XAQA 3HHGA 4L0ZB 1REPC 2OZUA 1XB4A 2L3DA 4BNCA 4UXNA 5TRDA 1TQIA 1AWCA 1Y0UA 4OMYA 2K4BA 1HKSA 1IXRC 1BJAA 4FX4A 4A5MA 1U6GA 3V4GA 1XSXA 2EFWA 1LNWA 1IXCA 2DU9A 3CUQB 4MTDA 3KEOA 1JHFA 5LRRA 1D5VA 4IJAA 1ODDA 4RAZA 2L54A 2CGPA 2YX7A 2DLLA 3GFIA 1FYMA 4GCVA 1IUYA 2V1DA 1E17A 1BC8C 5J8CA 5FGMA 4G7HF 4WXCA 2K7LA 2HTJA 1B4AA 5JI6A 2ZBKA 2M8EA 4CGZA 4KN7X 4IXAA 1P92A 1LDJA 3HYIA 2MLGA 3P7NA 2RV8A 2PLYA 1SD6A 1G3SA 1TBXA 2W85A 3TDUC 5DCFA 3FX3A 1JE8A 1XMKA 2GQQA 5J6XA 5HS9A 5FFZA 1MJ9A 1SFXA 3RKWA 4AVPA 1WI9A 3DV8A 3V8JA 4RAYA 4UUVA 2RDPA 5H6QA 4I0BA 1BOAA 4IVNA 3RKXA 3KLNA 1CF7A 2QBYB 3GWZA 4Q47A 1IN6A 2HYFA 4RGUA 1MZBA 4RGSA 4O5VA 4U7BA 2VN2A 2A5YB 4ZYDA 4MEYF 2O61A 5ICEA 4IPAA 2QYOA 5LGNA 3N97A 5IT9K 5H6RA 3NRVA 5AIPA 1ZG3A 2O3FA 1D8KA 5D5XB 4L18B 4MTEA 2VOOA 1KQ0A 2E7XA 2PFBA 1S7OA 1QNTA 4XSXF 3P9CA 2PG4A 1KU3A 1GXPA 3L00A 2FF4A 1XGSA 1EH7A 5D6FA 1GVJA 3DP7A 2VE9A 1IN8A 2ISZA 1C0WA 2O6GE 2ZKZA 1F1ZA 1ZGAA 5ILVA 2M1BA 3IKVA 4M74A 4LMYA 4NHJA 4WK8F 2NNYA 1U8RA 4EJOA 3ABTA 3F21A 2DQLA 1TQMA 3CDHA 1XCBA 3R6SA 2EWNA 5DYMA 5HVQC 4U7DA 2WV0A 1FWZA 2TDXA 2EA2A 3RYPA 2YSRA 2XVCA 2D45A 5HDNA 2VT3A 4F7ZA 5LHHA 3CO6C 4OINF 2RKHA 3I59A 3V7SA 3F72A 4LJZF 3E3VA 2JPCA 4B09A 4YFKF 2IP2A 5DUIA 4ZH4F 2E7WA 5E1ZB 1X3UA 3SXYA 3BJAA 3TO6A 4ZZLA 3SZPA 1HSTA 3DF8A 4KYWA 1HW5A 3KCCA 4HYEA 1J7KA 5BS6A 1R1VA 4G7OF 3HHHA 3ROUA 3V7RA 1HSJA 5FFXA 2EJRA 3I54A 3WTYC 5ICFA 2XUBA 1U5TC 3VODA 3I5UA 2GIVA 4MHGA 3M1EA 1YW8A 5JVTA 2GZWA 1UB9A 3J81K 3RKYA 3ZMDA 4KUMA 3HRSA 1KYZA 4HF1A 2H6CA 1ZH5A 2A61A 4RB2C 3F6VA 5JFRA 1WQ2A 1IF1A 3CTAA 3J80K 4ENNA 1FBSA 1IN4A 2EV0A 1KA8A 4GYGA 1XDSA 2EFPA 1L0OC 3ECOA 3R0JA 3S2WA 5D4SA 4UVBA 4PCQA 2FNAA 1FC3A 4EJVA 2HR3A 3CUOA 4KICA 2EA4A 2JRTA 3MEXA 1Z7UA 2W57A 3V7CA 2PI0A 3COAC 1F4KA 4AD9A 2KJCA 4LG0A 2YPRA 2XAFA 3JW4A 3LA3A 2QVOA 5D6EA 4P9FA 3B02A 1XD7A 2QLZA 1R1UA 1S8NA 1RUOA 2FOKA 3VFZA 3BWGA 1V3FA 1S6LA 3BZ6A 4EQQA 1LVAA 3SHFA 1YQAA 3E97A 3RJPA 1CF7B 2AS5F 4YFXF 3MFKA 1YLFA 4MNUA 4I02A 3QPHA 4A2UA 4LD5A 1PP8F 1QPMA 4IF4A 3JSPA 3L2CA 5HOOA 1SAXA 2NS0A 4KMUX 5A2QZ 3FXRA 5LEKA 1O57A 1QBJA 2IJLA 3WTUC 3F6OA 1IN7A 4IRHA 1OMIA 2QUFA 1AOYA 2FNPA 1BI2A 2VE8A 4RGRA 1XDUA 3VOEA 4KNYA 4M9XA 4Y17A 5ERIA 1A04A 5LLQA 2IPQX 1FOKA 3QPTA 3DPLC 3V8KA 5K5QA 1WRJA 1TQPA 3K1PA 1RNLA 2F5CA 2XKOA 2EV6A 3MCZA 3HSRA 3TQNA 2V9VA 2ZMEB 4M71A 4UV9A 3FMQA 4L5IA 4S05A 2X0LA 3SQNA 1V4RA 2KKOA 2G7UA 2FEZA 4A0YA 3WTXC 1ZLJA 2HGCA 1R1TA 4L0YB 1JHHA 4BAYA 2HTSA 2BGCA 3RTRA 5AIQA 1PP7U 4QWQA 1G3TA 3JSOA 4HF2A 3JAMZ 2ZNYA 2A3SA 4AWXB 2EFQA 3KLOA 4O6JA 3J80Z 1EH6A 2LDUA 2Y48A 3QOPA 1L3LA 5LHIA 5L3CA 1DPRA 3ZMTA 2OQRA 3LAJA 3MQ0A 2P7VB 3WE3A 3LA2A 1DP7P 4A6EA 1GHCA 5D8LB 1J75A 2VT2A 4OOIA 4N9HA 3NEUA 1IN5A 4LFUA 5D8KB 3WODF 3T8RA 3WTZA 2KJBA 2MC3A 4Y15A 1YFHA 5FLXZ 1O3TA 3ULQB 3ZQ7A 3GO5A 1J5YA 2ZMEA 2XGXA 4L5JA 1TNTA 1BBYA 4OIQF 2J5PA 4UVAA 3JAMK 1BN5A 2ISYA 3C18A 3BROA 4LGWA 3I0TA 3D5LA 4RS8A 4QLCU 4HQEA 3TO7A 2E1CA 2BV6A 4L9VA 1BIAA 1RI7A 2H6BA 2MH9A 4EM2A 4KDPA 5A2QK 3BJ6A 2ZCWA 1R7JA 1HKTA 2RVCA 2ZXJA 2Z99A 3DEUA 1GXQA 4Q5SF 1LDDA 2KRFA 2R3SA 2DK8A 3FXUA 1T6SA 2PN6A 3Q9SA 2J5OA 3KP5A 3KP7A 1O7LA 1VTNC 1FYKA 4HW0A 4I2OA 1IZ1A 2O8XA 2KIFA 1KYWA 2Z9OA 1Z6TA 2Y75A 4ZYGA 3I58A 4I98B 1R22A 1HW1A 3GXOA 4A0XA 3BPVA 2DAOA 3H92A 4I7HA 3C1DA 4OU0A 1MGTA 2H09A 2IT0A 4KIGA 3WTVC 2MD5A 2ZJ2A 4YFNF 1H9TA 4G94A 3EQLF 1W5TA 1STZA 4JBAA 5CVVA 3D0SA 2HQRA 5F64A 1DPUA 3KETA 2OA4A 3QP6A 3IHUA 5E1XA 1B9NA 2JT1A 3HRMA 5D5VB 1D8JA 3GFLA 2XKPA 1S3JA 5LRSA 1YO5C 3CLOA 2IW5A 1W7PD 2P4WA 2DO7A 5BOXA 2DBBA 2LF8A 2ETHA 4AIKA 2QZ8A 3DKWA 5FD5A 3ZN0A 1J9IA 1USTA 3IWZA 5DD4A 3TOBA 3E6CC 3KP2A 3ISPA 2A68F 4JK1X 4PGGA 3E6DA 2DW4A 1BI3A 2W24A 2ESNA 2FBIA 4WF2A 4EMSA 5FB2A 1XGMA 2HFHA 2AXLA 2XASA 5L3FA 3BJOA 3SZTA 2DTRA 4KA4A 1U2WA 4G9YA 3SFZA 2OQGA 1WKMA 3O2PE 3ZN1A 2HS5A 2MA3A 1MJBA 1JGSA 2DK5A 2HQNA 1D3YA 4G6DA 3BP8A 4EJWA 3J7AO 4WXHA 2F5EA 5ICCA 4NB5A 3I71A 1ZRDA 4I01A 2OD5A 1Q1HA 2EK5A 3EDPA 5CVRA 2PEXA 2OAZA 3O3KA 4GXOA 5H20A 2IA1A 5LEJA 4N9IA 2CQKA 4HQMA 4DQ2A 4G6QA 3IL2A 2NNNA 4AIJA 1LEBA 1G3WA 3I4PA 2E1NA 2COMA 4U88A 2V79A 2XRNA 1R58A 5K5OA 6PAXA 1B6AA 1K78B 2V1XA 5KVRA 4ENJA 5BPDA 4KT5C 3W6JB 2GA2A 1KU7A 5CYVA 1FPQA 3GUDA 1ZARA 3WGHA 2VOPA 1PUEE 4EGZA 4M73A 3CUQA 3KZZA 2LKPA 1R36A 4S04A 2A07F 2HKOA 2FMLA 4LK0F 4MQ9F 4N0BA 1FY7A 2IA2A 2JPBA 5DEQA 3KE2A 3REOA 2QWWA 1K79A 4A12A 3QRFF 2JSCA 2VXZA 2QBYA 4CHUA 4P5OA 1I1SA 4CDGA 2M30A 4M72A 3HTUA 1USSA 4E70A 3KFWX 1KGSA 2M5WA 1G6NA 4XBFA 3FHZA 4Z2YA 1BIBA 5EEHA 3IWFA 4HV5A 2V1UA 2KIUA 5D5UB 4LB6B 4NQWA 1P6RA 4BQAA 5FD6A 3B73A 2XAGA 3FMRA 3KZYA 4IHTA 4Q48A 2G9WA 3T0YA 1QZYA 4P55A 4RB0A 3BOQA 1MDMA 3O6BB 1H9GA 1U5TB 3WU0A 3WTTC 2LSOA 4HLXA 1K78A 4IRIA 3WGGA 1P2FA 1LB2A 2LNBA 2NYXA 5L3BA 2GXGA 1HQCA 3F8BA 4EGYA 1RZ4A 2UWMA 3I53A 4R1HA 4ESFA 1I27A 3WGIA 2Z33A 5JHUA 1S7AA 2K4JA 5ED4A 3LAPA 3E5XA 3QU3A 3M8EA 3CUQC 5DCMA 3HSFA 2M45A 3ECHA 3H3UA 3HSEA 4EJTA 1XMAA 2EB7A 3VB2A 5K5RA 1OYYA 4L9JA 2PMUA 2A6EF 3GVAA 3FMSA 5ICGA 1I6XA 2Y0MA 2YR2A 2OZ6A 5J8FA 3FF5A 1FT9A 3FWEA 1QZZA 3RDIA 4IRGA 5CVIA 1ZYRF 2UXXA 2D2WA 2QQBA 2P7CB 3T1BA 1U3EM 3LWFA 4CZZA 5E8GA 4MGRA 1IRFA 5HDKA 2ADUA 1ZRFA 4RB3C 2XHKA 4BYYA 2L02A 2RN7A 2L4MA 1R5HA 3PFIA 4CYDA 3ZMVA 2R7DA 4LB5A 1P4XA 5L3GA 1Z6RA 1MJAA 4I09A 4BHCA 4AIHA 5HLGA 2VBZA 1YG2A 2MH2A 1O3RA 5LHGA 1U5TA 3MWMA 1ON2A 3ZMUA 2DPUA 2DFIA 4DNCA 1FSHA 2G7HA 4B8XA 3LQRA 1K6OA 1T39A 2WTEA 1OKRA 3GLXA 3HOTA 4EM1A 4UNOA 5AONA 1MKMA 2RGVA 1YIOA 4KFCA 1B9MA 2CYYA 2OU2A 4EJUA 2FE3A 3EETA 3DXJF 3LQQA 1XN7A 4LLGF 1YW7A 5EEGA 1S29A 1TTYA 2MBFA 4RGXA 3M8FA 1IRGA 1F9NA 3ABUA 1SD7A 3F22A 4FX0A 5FO5A 1T38A 3KP6A 1FNNA 2HDCA 1ZN2A 5BQTA 3I64A 4MEXF 2IRFG 4HDUA 2K02A 4HOBA 4TV7A 2Q0OA 1SFUA 4R8HA 3C7JA 1YW9A 5FLXK 4K2EA 1HXDA 3KEQA 3NQOA 2QQ9A 2K27A 4RB1A 3GZ5A 4KIBA 5DUKA 2ESHA 3GZ6A 3ZPLA 3MAJA 2DPDA 2W84A 3DQVC 2P6TA 3RIRA 1W5SA 3Q5FA 3GF2A 1I1GA 5DD8A 3EYIA 2VBYA 1FP2A 2Z3YA 2WWYA 1T2KA 3BY6A 4WCGA 1XCVA 2PQ8A 1HKQA 4OIPF 2XAHA 2RQPA 3AAFA 4OMZA 1ON1A 1ZG1A 1IAWA 2VBXA 2PJPA 1UHMA 4CO8A 2RNJA 5IT3A 2O0YA 2JZYA 1UHWA 4IHSA 4ENMA 4BHPA 5LBQA 3TKYA 2OBPA 4OIRF 4EVIA 1RIOH 3TO9A 2QQAA 3L7WA 3DPTA 1WSUA 4KMFA 2GWRA 5CVJA 3ELKA 2VBWA 1CGPA 5DDGA 4HDVA 4FT8A 1WWXA 1PDNC 3DFGA 1XSDA 3HTSB 2P5LC 5HS7A 5BPIA 4ON0A 1Z05A 2MLKA 3M7GA 2D1VA 2FBKA 5IT9Z 4HX4A 2IVMA 1MDMB 1KQ9A 2P8TA 3M9AA 3C3WA 3R60A 1ONVA 3Q9VA 3W6KB 1I5ZA 4I0AA 1NHAA 1FZPB 3GYHX 4UHTA 2P5VA 2Q2EA 1OR7A 3F3XA 3K1NA 1FBQA 1SFEA 5CJ9A 4KN4X 4ZYEA 1XSVA 2BE5F 1YYVA 5E8IA 3GEZA 3K0LA 2F2EA 3F8FA 5L3EA 2X4HA 5DCMB 2GAUA 3P9IA 1Z9CA 1EV7A 1EH8A 1ZREA 2STTA 1W4MA 4EM0B 1SMTA 2HOEA 1ZGJA 2BEOA 3G73A 2NRAC 3LA7A 3WTSC 4ESJA 1B59A 1TW2A 5D5WB 4WX9A 2GA1A 1OYWA 2VONA 3U9GA 3H3ZA 4WWCA 4EV0A 4A0ZA 1F5TA 2NAZA 2R7FA 3R61A 5BMZA 1TLHB 1SD5A 3P9KA 1K7AA 2BYVE 3TGNA 5HDGA 2STWA 1FLIA 2DT5A 2EFNA 5ILSA 1O3QA 3EUHA 2A69F 2HEOA 2FXAA 3ERED 2UZKA 4O3MA 3BPXA 2H27A 1H0MA 4R79A 1P4WA 1O7FA 3L09A 1R5GA 4GGGA 2ACJA 1BC7C 1FYLA 2CG4A 3HOSA 2XAJA 4HA8A 5CVUA 2P5KA 4OIOF 2L01A 3GFMA 3WTWC 3WU1B 3V8LA 1O3SA 4G8XA 1UCRA 4XLPF 5HS8A 1KQ8A 5E1WA 3OV8A 3CJNA 4KIFA 4LK1F 4BH9A 4HZFA 5HLHA 1SD4A 2M87A 3K9TA 3GW2A 2DQRA 3T5XA 1QQIA 5LGUA 1KU9A 2W25A 4LLLA 2O03A 3E5QA 3FM5A 2Q8KA 3VEPA 5F1RA 3I59B 4ZZDA 2EFOA 2HWVA 2UXNA 4FHTA 1E2XA 2VC0A 2LF7A 1YS6A 1Z91A 1OYIA 3QP5A 3E6MA 2YX4A 3QU6A 3LSTA 1RUNA 3OOPA 3MZYA 3WE2A 5K1YA 2VC1A 1ZRCA 3TDZC 3CO7C 5L3DA 3EYYA 4YIFA 4Q4ZF 1DUXC 2FMYA 1IW7F 2JTVA 2XIGA 4L9NA 5DV5A 1LQ1A 1BM9A 2QM3A 4M9SA 1IXSB 1ZHFA 5ILUA 1U78A 4YIIA 3HRTA 2EV5A 3HRUA 3ML6A 4CXFA 2BBYA 1BI1A 2KIMA 4ZYHA 4BXUA 2YU3A 2C6YA 1YS7A 2ZFWA 4XLNF 2FBHA
chains in the Genus database with same CATH superfamily
4CICA 1BR2A 2PJRA 3K69A 4M6YA 2IA0A 5E3LA 3HUGA 3OYLA 3PNYA 3SDGA 5IP9J 1MBGA 3G2BA 1KZHA 3BCAA 4GO1A 1XGNA 1TWFJ 1G3YA 4MFDA 4D0PA 4Y3OA 3U1DA 3GX4X 1FSEA 1S9HA 1J59A 3G3ZA 3KYCB 4DZJA 3N4MA 3GFJA 1LJ9A 2XF6A 3S3OA 1B1BA 2ZNZA 2WC2A 2L4AA 4DGWB 2CV0A 4UB8C 4U0VA 4ZYAA 1TC3C 4BE1A 3WG9A 1MW7A 4BJ6C 2GXBA 2V9KA 2HKXA 1R5ID 3CESA 4L9TA 3ABKH 3JTHA 5JR3A 4XSZF 3MZHA 1YIJI 4IZZA 3BDDA 1LPQA 3H36A 3HIFA 1R23A 2LVSA 2JUGA 2LK2A 1JI8A 2L2OA 3K2ZA 1OFCX 2CO5A 1T0FA 2VJ5A 1KU2A 2F5FA 4LIUA 4UV8A 5KK1A 3J81Z 3PIPF 3TOAA 4PZJA 2V6EA 3K4LA 3IH4A 1OR7C 3ZQHA 1Z67A 4OAYA 1HA8A 4RMNA 4XRSA 2CSOA 3R4KA 3FXMA 4QSHA 4X6AJ 1OPCA 4AYBA 1JJ6C 1OLTA 5J3LA 3CCVI 3F8MA 3IRRA 4YG2F 3FM3A 4HBLA 4H0EA 2B0LA 2W7NA 1SMYF 3LFKA 5E3OA 2E60A 2K86A 3ZQIA 1RKTA 3IKTA 3K2AA 1ULYA 1QHGA 2PBIA 4F52A 3AG3H 2DOFA 3DWLE 4GYIA 4F3QA 2IS2A 4ESBA 4BQOA 2FU4A 2LG4A 1OJLA 1YITI 3H0GJ 2RC4A 2V6CA 3L9FA 3KP4A 4PGHA 5JLXA 3FXOA 3F23A 3IRQA 4GFBA 3TL4X 1FBUA 2K40A 4AC0A 5J4VA 2QENA 2CV1A 2PMZA 3PQJA 4IKFA 2FQ3A 4HF0A 3FKIJ 2R7TA 2XV4S 3MD2A 4XKVA 2Y31A 5EG0B 2FRHA 2DMPA 1OCTC 2Y2ZA 4ZJZA 4MQVA 1LDKB 1J0RA 4XRFA 2HDWA 2JQ7A 3R0AA 2K85A 3F8CA 2R5ZB 2X48A 5LGTA 1ZG5A 1ETXA 1IC8A 2JA5J 4NDLA 2WY8Q 4A3CJ 5HLIA 1JT6A 3DLAA 2PJRB 2FUG2 2HYGD 1FMWA 4NC8A 3ZQQA 5EF6A 1HBXG 3S1RJ 1QHHD 1UFMA 4HV6A 3T8TA 4A69C 2P6SA 1Z21A 2VLAA 3ZP5A 3V42A 1TL8A 5M3FJ 4HAMA 2E1OA 3MKWB 4IHXA 2VJIA 4M9ZA 3SFIA 4YELA 5GAGJ 2HOTA 3H5RA 2IEKA 3G1LA 4DBQA 4LG0B 1SEUA 4BKXA 1Y8QB 2VKHA 2VPRA 5GADJ 5J1YA 3IP4B 1R00A 3WU2C 3EUHC 4CCLA 5E18F 3M8JA 2NOGA 2ZO4A 2HZTA 4P9UA 5EYRA 3S2DJ 2IGNA 4HLYA 3E5UA 5E79C 3RYRA 1P4AA 3E6BA 1XC5A 1ENHA 2VI6A 2XROA 1Z1DA 2HYJA 2V26A 1BOBA 3ERMA 2D1HA 1QO0D 2FX0A 3ZMZA 4BEHB 2JA8J 2WAQN 4LG3A 3M4OJ 1Y1VJ 2DA1A 4HX7A 3RI4A 3KP3A 3PQKA 2CWEA 4ASNA 5E17F 1IO2A 3MMYB 1MD0A 3J7YJ 1W7PA 5E20A 1UG2A 9ANTA 2ELHA 1HW2A 4PDKA 4BBRJ 2Z5UA 3QAHA 1Z77A 1YJNI 2CRGA 2DFEA 1VI0A 1SFOJ 1T98A 1D0YA 3U2RA 4IQ4A 3GBGA 5TJJA 4ENKA 4JQFA 1J2XA 2JA6J 1TNSA 2KDOA 1R49A 2DJNA 4M6XA 4P96A 5GAHJ 3DBHB 5FLVA 1QA6A 2H94A 5D4RA 1FX7A 1QU3A 1WGXA 1W7PB 4BHBA 4PSXA 2A6HF 2X51A 2JK3A 3K1MA 3ZMSA 5F6FA 1FP1D 3OYEA 3JTGA 3FXQA 3RPUA 1OISA 1G2HA 3F8NA 1VZ0A 4NBQA 2NXNB 1TZLA 3CCSI 4HG2A 4ETSA 2CH0A 1LEAA 4UVCA 1X1AA 1T33A 1YTYA 2VODA 1JXSA 4FE4A 4WXDA 4PJMA 3VSLA 4Y13A 2CFXA 1DDNA 3JRDA 4IX7A 4D7NA 1ZLKA 4IOCF 4A6DA 2DI3A 2FSWA 2PMHA 2MABA 3IC7A 2FA5A 3CCLI 3CMYA 3G71I 2KLOA 2LBFA 1V55H 2ICWG 2ZFUA 4HX8A 1X1PA 4U0YA 1TW3A 5CLSA 1G4DA 1ZAOA 2MYSA 3FZVA 2F5DA 3RPQA 4H4KC 4LLNA 3KPHA 4U0WA 3OSGA 4G7ZF 1OCOH 2CW0F 1XGOA 4A5NA 1QGPA 1BI0A 5FROA 1ETVA 2K9NA 2XAQA 3HHGA 4L0ZB 3TBIA 1REPC 2OZUA 1XB4A 2YUSA 3F0CA 2L3DA 1ERDA 1XS9A 2XB0X 3OYNA 4BNCA 2Z1DA 1EJ9A 4UXNA 5TRDA 3HC7A 1TQIA 1AWCA 2D5VA 1Y0UA 4RA2A 3OYKA 4ZDPA 3SDBA 3CCEI 4OMYA 2B7EA 2OF7A 2K4BA 5DM6F 5KNLA 1HKSA 3JREA 1F43A 1IXRC 1MIJA 4GDFA 1BJAA 4FX4A 2WV1A 4BDYA 2FJ1A 4J01A 2Q1ZB 4A5MA 3OOUA 3AKZA 1U6GA 3FKJA 3V4GA 3OY9A 1XSXA 5J47A 2EFWA 1LNWA 1XTAA 1IXCA 2DMUA 3VYTB 1R4MB 2DU9A 3CUQB 3E1SA 3BTIA 2AQEA 1WJEA 1Y56A 2GIZA 2HVRA 4AUXA 4MTDA 2IGOA 3KEOA 1JHFA 1YRNA 2NS8A 5LRRA 1D5VA 4IJAA 2F4IA 1ODDA 1AU7A 4RAZA 4BACA 1EA3A 2L54A 2KISA 2CGPA 3TMOA 2YX7A 2DLLA 3OL4A 3GFIA 1X1BA 3B6CA 3HGGA 1FYMA 3IV5A 1D0ZA 4GCVA 1IUYA 2V1DA 3ZGKA 3CJRB 1E17A 2LMDA 1BC8C 2M2EA 5J8CA 5F27A 5FGMA 4XQFA 4G7HF 3BTCA 3MN2A 4WXCA 2E1MB 3SYTA 4ABZA 1LUJB 3CP2A 2K7LA 2HTJA 3IAM2 1B4AA 2M3AA 5JI6A 2ZBKA 2M8EA 3H9JA 3QYBA 4CGZA 4KN7X 2KPMA 1P92A 4IXAA 1LDJA 2EPFA 4IL6C 3HYIA 2MLGA 3N05A 2RV8A 3P7NA 1Q1VA 2PLYA 1EF4A 1SD6A 3KYDB 1G3SA 1TBXA 2W85A 3TDUC 1TWAJ 5DCFA 2L7FP 3FX3A 1JE8A 3OIOA 3RQIA 1JKQC 1XMKA 3A0HC 2CU7A 4RM2A 2GQQA 5J6XA 2LOOA 5HS9A 3KX2A 4D9JA 4HNTA 2DDBA 5FFZA 5TISC 1MJ9A 1MMDA 1Y8RB 2LYCA 4CUGA 4KT6A 1NTCA 1SFXA 4G12A 3RKWA 2R4GA 2L9SA 4AVPA 1WI9A 3DV8A 3V8JA 1W36D 3MKZA 4KISA 4GRIA 2LLKA 3SZGA 4RAYA 2L7KA 4UUVA 2O7OA 4CYCB 2XDVA 2B9SA 3J7ZI 2RDPA 1BL0A 5H6QA 4I0BA 3A01A 4J19A 1BOAA 3RSNA 4IVNA 3RKXA 3VPRA 3S3MA 2NVXJ 5GAEJ 3KLNA 2BHYA 3BR1A 1CF7A 2QBYB 1BJZA 1TT0A 1GV5A 2V9PA 3A0BC 3GWZA 4BE2A 1S72I 3OYHA 4Q47A 1IN6A 3RKQA 3L2QA 2F5VA 2HYFA 3CZ6A 4RGUA 1MZBA 4RGSA 4XKWA 4O5VA 4U7BA 3EUAA 2M0MA 2VN2A 2A5YB 2FD5A 4ZYDA 4MEYF 2O61A 5ICEA 2EBIA 4IPAA 2XF7A 2TCTA 2QYOA 2ELJA 2ID6A 5LGNA 3H5AA 3N97A 2XPWA 3C2GA 1X2NA 5IT9K 5H6RA 3DTEA 2JMWA 3HG9A 3NRVA 5AIPA 1ZG3A 3MKLA 2ZXIA 4BGDA 2O3FA 3BG5A 1I50J 2ZXWH 3TEDA 3P5JA 2XGCA 1D8KA 3I9V2 5D5XB 4L18B 4MTEA 4AM3A 2VKVA 2VIXA 2VOOA 1KQ0A 3J7AY 2ELKA 2E7XA 2EIMH 2KRHA 2PFBA 1P7IA 3BC8A 1S7OA 2EH3A 3D5RC 1H8AC 1QNTA 1YI2I 2MC4A 4XSXF 3S14J 3P9CA 2PG4A 1KU3A 2DMQA 1O4XA 1GXPA 4QPQA 3L00A 3FIWA 2FF4A 1XGSA 1EH7A 2KMUA 5D6FA 3S2HJ 1GVJA 2QGUA 4IQJA 3DP7A 3RPUD 3MKYB 2VE9A 2R0QC 1IN8A 2ISZA 1C0WA 2O6GE 2ZKZA 1F1ZA 4LITA 1ZGAA 1Z3XA 5ILVA 3OS2A 2M1BA 3IKVA 3K4NA 2R7VA 2CJJA 4C30A 4M74A 3CCQI 2E5ZA 4LMYA 3ZOBA 1JTXA 1XX5A 3S8PA 4BL0B 4N4NB 2F4OB 4NHJA 3LMMA 4WK8F 2NNYA 1U8RA 2YU9J 2JN6A 4CCOA 4BY7J 3JRBA 4EJOA 3ABTA 1BW5A 3F21A 2DQLA 2JVHA 2NVUB 1TQMA 2WA0A 3CDHA 1XCBA 4E6KG 3R6SA 2EWNA 5DYMA 4A3LJ 1Z7LA 5HVQC 4U7DA 2WV0A 3GTMJ 1RC9A 2H1LA 3BR5A 1FWZA 2LH9A 1X2MA 2TDXA 2EA2A 4A3KJ 2FQ4A 2YSRA 3RYPA 2XVCA 5K7ZA 3BR6A 2BVLA 2D45A 2KT0A 5HDNA 2V4JC 4BU2A 2QA4I 1VNDA 1JT0A 2VT3A 1ZELA 4F7ZA 2DA5A 1R71A 5LHHA 4JP0A 3CO6C 4E4HA 2R7UA 3HOVJ 2E2IJ 2EZLA 4OINF 2RKHA 3I59A 2CW8A 3PM1A 3V7SA 3F72A 5E3NA 2K9QA 4LJZF 1SVMA 2VQGA 2JPCA 3E3VA 4B09A 4YFKF 2IP2A 5DUIA 3CDLA 3L2VA 4ZH4F 2E7WA 5E1ZB 4BY1J 2HPIA 1X3UA 2X6XA 3SXYA 3BJAA 3S93A 3TO6A 4ZZLA 3SZPA 3S16J 1HSTA 1A6IA 2LY9A 5DTDA 3DF8A 2ZXHA 5H2FC 3OSFA 2BY3A 4KYWA 1WJDA 1VQPI 1HW5A 3KCCA 4HYEA 4QPOA 1J7KA 5BS6A 1R1VA 3CCMI 2DODA 4G7OF 1P9QC 1MBEA 3HHHA 1VQ6I 2NOJB 2F48A 4XLEA 3ROUA 1VQNI 5EGOB 3V7RA 3K4BA 2CUJA 1HSJA 5FFXA 3S1NJ 3GTQJ 1I6HJ 3X2QH 2G0EA 3HKZN 2KIQA 2EJRA 1IGNA 3I54A 2RAEA 5IYCJ 3ZQLA 3WTYC 2DMNA 5ICFA 2XUBA 1U5TC 3VODA 2WAFA 3I5UA 3OYFA 2GIVA 4MHGA 3M1EA 1YW8A 3QODA 1R4NB 5JVTA 2GZWA 2DA4A 1UB9A 2Z2SB 2IS4A 3QYEA 3J81K 5EGOA 3RKYA 2GBYA 1YOVB 3ZMDA 2W48A 1DP3A 1FOYA 4KUMA 1FIPA 4UB6C 3NAUA 3HRSA 1KYZA 4YRVA 4HF1A 2H6CA 1ZH5A 2A61A 1DQUA 4RB2C 3F6VA 5JFRA 2HVQA 1WQ2A 1RR7A 1IDYA 2BVMA 1IF1A 5LFAA 3DCFA 3CTAA 3J80K 4ENNA 1FBSA 1W1WE 1IN4A 2EV0A 1KA8A 1FEXA 4FTHA 4GYGA 4IHWA 1XDSA 2EFPA 4OWRB 3G6EI 3FBNB 1L0OC 3PSFA 3ECOA 3GMEA 2ZJQF 2Q2EB 3R0JA 4AYBN 4J00A 3S2WA 4UVBA 5D4SA 2LR8A 4PCQA 2FNAA 1FC3A 4EJVA 2HR3A 3CUOA 2GM4A 3LSPA 4KICA 2XF5A 2EA4A 4RAFA 3H1CA 2JRTA 4ITVA 1JGGA 3MEXA 1Z7UA 4PFOA 3SEZA 2W57A 2AO9A 3V7CA 3CC7I 2PI0A 4DBRA 3OYBA 3COAC 2BZTA 1XMXA 2LY2A 3UR3C 3OYDA 1CQTA 1F4KA 1WH7A 4AD9A 2KJCA 4B48A 4CA0A 4LG0A 3A2KA 1W5CC 3OWTA 5FKKA 2HXOA 2YPRA 2XAFA 3ZQCA 2NVYJ 3HGYA 4NC6A 2ZC2A 1VQ7I 2IXSA 3JW4A 1ZR2A 4CCMA 3W2VA 3LA3A 1A6QA 2E5NA 2QVOA 4E7KA 5D6EA 4P9FA 3B02A 1XD7A 2LREA 4B3AA 2QLZA 1R1UA 1S8NA 1RUOA 2JA2A 1LKXA 1ACIA 1X4OA 4MLOA 2FOKA 3VFZA 4M3DA 1LFUP 4QTRA 3BWGA 3TW7A 1V3FA 2VJ4A 4MFEA 1QVUA 1S6LA 1FMVA 1ETOA 2M7AA 3BZ6A 3K6GA 4EQQA 1LVAA 3SHFA 4FCYA 2EILH 2FOWA 5EZHA 1YQAA 1WPKA 3E97A 3RJPA 2OPTA 4BUPA 4XKCA 1CF7B 2AS5F 1ORKA 3GLLA 3I56I 4YFXF 1PYVA 1JKOC 4DYQA 3MFKA 4XM3A 1YLFA 4MNUA 4NC7A 4I02A 3QPHA 2X1EA 2WADA 4A2UA 3LSKA 4LD5A 1PP8F 1QPMA 3AL0B 4XLAA 4IF4A 3CC2I 4DOZA 3JSPA 1HDPA 3L2CA 1U8BA 3KZIC 2A05A 5HOOA 1SAXA 2JWTA 2NS0A 4PK4A 3DTIA 4XIDA 4KMUX 1DU6A 5A2QZ 3FXRA 3OIQA 5LEKA 1O57A 1QBJA 2IJLA 3WTUC 1W36C 3F6OA 1IN7A 2CQQA 4IRHA 3PSIA 2CQNA 3DLLF 1OMIA 3PJRA 2UUZA 3OS1A 2QUFA 1AOYA 4B1RA 2FNPA 1BI2A 1MNDA 2VE8A 3GCMA 4RGRA 1XDUA 3VOEA 1QRYA 2DOAA 4JOMA 1W0UA 4KNYA 4M9XA 3ZQGA 1LE8A 4M6VA 1B72A 4Y17A 5DS9A 1WJAA 2XAUA 5ERIA 1A04A 1DGRM 3OYCA 4UUSA 5LLQA 5EJCA 3LSRA 2IPQX 1JUPA 3A02A 1FOKA 2B63J 3QPTA 4RM3A 3GZNB 3DPLC 3V8KA 5K5QA 4X0GA 1WRJA 1TQPA 2JSPA 3K1PA 3VYSB 4EEFG 1RNLA 2F5CA 2XKOA 2EV6A 3MCZA 3TP3A 2EIKH 4BDZA 3HSRA 4RDUA 3TQNA 2V9VA 2ZMEB 4M71A 4JX6A 4UV9A 3FMQA 2L5QA 5KAFC 3JRGA 4L5IA 4S05A 1JKRC 3DPUA 2X0LA 4Y7NJ 2N8GA 5F0FA 3SQNA 1A36A 1V4RA 2KKOA 2G7UA 1FOXA 2FEZA 1TWHJ 2L0KA 4A0YA 3WTXC 2R7QA 1ZLJA 2HGCA 1M1EB 1R1TA 4X1EA 5CPRB 1APLC 4L0YB 3FISA 1JHHA 4BAYA 1HOMA 2HTSA 2BGCA 3ONQA 4HSTA 3FXKA 3RTRA 5AIQA 1SANA 3CMMA 3FDYA 1PP7U 2JUCA 4QWQA 4E7JA 4F55A 4IO9F 1G3TA 5K7FA 3JSOA 1ZQ3P 4HF2A 3JAMZ 2ZNYA 2A3SA 1HDDC 2I5UA 4LOCA 4AWXB 2EFQA 3M3YJ 3KLOA 4O6JA 3J80Z 1EH6A 2L9VA 2LDUA 5IOYA 2Y48A 3QOPA 4BS9A 3PIOF 2DN0A 2O9LA 1L3LA 5LHIA 5L3CA 1DPRA 2LRDA 2OQRA 3BQZA 3ZMTA 3LAJA 3MQ0A 2P7VB 2DT6A 3IUOA 1E3PA 2KZGA 3WE3A 4D1QA 3LA2A 1DP7P 4A6EA 3HOYJ 1GHCA 4A3IJ 3EPZA 5D8LB 4OOIA 2VT2A 2LKSA 1J75A 5FRMA 2OV7A 3VWBA 4IOAF 3U1KA 3G1MA 1TP4A 5M5XJ 4N9HA 4XR6A 3NEUA 2OCCH 4XLCA 3H3VK 1IN5A 2AQFA 2M8GX 4LFUA 3BG3A 3RCOA 3QPSA 5D8KB 3CCYA 4G6TB 3WODF 1MNMC 1TWGJ 5EEAA 5FJ8J 2YS9A 3T8RA 3DU5A 3WTZA 4PJJA 1NG7A 2CS3A 5M5YJ 2A5WA 2KJBA 3S1MJ 2MC3A 4Y15A 1YFHA 3DU6A 5FLXZ 1O3TA 1R6RA 2EZHA 3JRFA 3ULQB 4A93J 3H35A 3ZQ7A 3GO5A 1J5YA 2ZMEA 4XONA 2XGXA 3PL8A 4XNFA 4JX5A 2QEXI 3PNVA 4ANJA 4L5JA 2XB5A 1TNTA 1BBYA 1Z0XA 4F91B 4OIQF 2J5PA 3CQZJ 4UVAA 3JAMK 1GDTA 1BN5A 1ZK8A 4F93B 3C18A 2ISYA 2K9SA 1WFXA 3BROA 4XLFA 1ZR4A 2DOEA 4LGWA 3I0TA 1WZ2A 3CCRI 3D5LA 3HOUJ 2Y69H 3BTLA 4RS8A 4BXXJ 4QLCU 4HQEA 1MH3A 4B44A 3TO7A 2E1CA 4BJTA 1GUUA 3A1YA 2VQCA 1FOWA 3ESWB 1VF9A 2BV6A 2ZJPF 4L9VA 1JJ8C 1BIAA 1RI7A 3LSMA 2H6BA 4EATA 2MH9A 2BY0A 2E71A 4C9YA 3W2WA 2X1DA 4EM2A 2DA3A 4AIDA 4KDPA 5A2QK 3BJ6A 2ZCWA 1R7JA 1HKTA 2RVCA 2ZXJA 2Z99A 3I4NJ 3DEUA 1GXQA 4Q5SF 1LDDA 2KRFA 5IP6A 2JA7J 3ZXSA 5C4XJ 5GP9A 2W4SA 2XGDA 2Y0SA 3NWTA 2R3SA 2DK8A 2IGMA 3FXUA 1T6SA 1IRZA 2PN6A 1MBJA 2W82A 4V2FA 3Q9SA 2J5OA 3KP5A 2O8KA 3KP7A 3LSGA 1O7LA 3QWLA 1VTNC 3GTPJ 1MMNA 1MBFA 1FYKA 4HW0A 3OYIA 4I2OA 1VFCA 1PUFB 2ZSHB 3A4CA 1OCPA 1IZ1A 3BG6A 3O8GA 4CCNA 3C2HA 2O8XA 1YX5A 4BJ5C 1QZEA 3I55I 2KIFA 1KYWA 2QQ8A 5B3SH 3GTLJ 2GOMA 2Z9OA 1Z6TA 2Y75A 1NH3A 4ZYGA 3I58A 3JRAA 4I98B 1R22A 1HW1A 3GXOA 4A0XA 3BPVA 3GTGJ 2DAOA 3DBRB 3H92A 4I7HA 2MG4A 3C1DA 5EG0A 5HNFA 4IHVA 1KONA 4OU0A 4B4CA 4UY8I 1MGTA 2H09A 3DKYA 3L2WA 2IT0A 2IGKA 1VQ8I 5EZGA 4KIGA 3WTVC 2MD5A 2EZIA 4W97A 4C2TA 3G1OA 2ZJ2A 5F04A 2L9RA 2MGQA 1FTZA 4YFNF 1H9TA 4G94A 2H1KA 3EQLF 1W5TA 1STZA 4JBAA 5CVVA 4LIVA 1VQOI 5M3MJ 3D0SA 3JRCA 1BW6A 2HQRA 3AFHA 5F64A 2R5YB 1DPUA 3AG4H 3KETA 1WVRA 2OA4A 3QP6A 2R7SA 2Y9ZA 4N4OB 2AHQA 3IHUA 2RQQA 5E1XA 3TW6A 2OC6A 3Q0VA 3HUGB 3HOZJ 1B9NA 1UG0A 2Y9YA 2JT1A 2R7XA 3HRMA 1WJCA 5D5VB 1D8JA 4E7IA 3B6AA 5GPAA 3GFLA 5KAIC 2XKPA 1S3JA 5LRSA 2ME0A 3PNTA 1YO5C 3CLOA 5GPCA 2IW5A 1W7PD 2P4WA 2DO7A 1MH4A 2V1NA 2DBBA 2LF8A 5BOXA 2ETHA 4AIKA 1K6YA 2X1CA 2QZ8A 3DKWA 5FD5A 3ZN0A 1J9IA 3CC4I 3S17J 2F4MB 3ASOH 1USTA 3IWZA 5DD4A 3QYFA 3TOBA 3KP2A 2W00A 3E6CC 3ISPA 4L5EA 1ETWA 2A68F 4JK1X 4PGGA 3E6DA 5F0HA 4XN0A 2DJIA 3FK7A 2VXDA 2DW4A 1BI3A 2W24A 1S5LC 2ESNA 2FBIA 4WF2A 4EMSA 3DKXA 5FB2A 1XGMA 2HI3A 3HEFA 2HFHA 2AXLA 2XASA 3BZKA 3BJOA 5L3FA 1RESA 2IS6A 3SZTA 3NWSA 2DTRA 4KA4A 1GV2A 1UAAA 1U2WA 2CFOA 4G9YA 5C4JJ 2R7WA 3SFZA 3HKZA 4HNUA 2OQGA 1WKMA 3FK6A 3K7AJ 3O2PE 5IYBJ 3CMAI 3CD6I 1MBKA 3ZN1A 2HS5A 2MA3A 3BQYA 3QPLA 5IY5H 3PUFA 2IBDA 3C2BA 3L1PA 1MJBA 1TWCJ 1JGSA 2DK5A 2HQNA 3WHBA 1FJLA 1D3YA 4G6DA 4RLQA 1WHUA 3BP8A 4EJWA 3J7AO 4WXHA 3ZQFA 2F5EA 5ICCA 1Y39A 4NB5A 3I71A 1ZRDA 4D5CA 4I01A 1JKPC 4HSRA 2OD5A 2M7BA 1Q1HA 2EK5A 3EDPA 2ZJRF 3PO3J 2WB1N 2WAEA 1MMAA 5CVRA 2X6WA 2PEXA 2R7ZJ 2OAZA 3O3KA 4GXOA 5H20A 2IA1A 2R5YA 5LEJA 5IPAA 2KZVA 1SVLA 4YIRX 5CQEA 4N9IA 2CQKA 1BA5A 4HQMA 4ZDLA 5F0CA 4DQ2A 4DJAA 4I99C 5J40A 1V5GA 4Y4RA 4G6QA 2CUZA 4XOPA 4S0HB 3IL2A 3MVPA 3OMYA 2NNNA 4AIJA 1LEBA 4C2MJ 1G3WA 3I4PA 3PUBA 2E19A 1SC7A 2E1NA 3BZCA 2COMA 4U88A 1YHQI 2OTLI 2V79A 2XRNA 1U9NA 1R58A 5K5OA 6PAXA 2EQRA 1B6AA 1K78B 2V1XA 1GVDA 5KVRA 4ENJA 1JUSA 1LFPA 2HDDA 5BPDA 2NS7A 1MMGA 4KT5C 3W6JB 2GA2A 4CSWA 1KU7A 5CYVA 1FPQA 3GUDA 2CUFA 1E3OC 3HOXJ 1X4PA 2V7FA 2X9DA 1ZARA 3RQ4A 3WGHA 2P0WA 2VOPA 3JCUC 4F92B 2DDAA 1PUEE 4EGZA 1RKWA 4M73A 3CUQA 3FHNA 3KZZA 2LKPA 1R36A 4DYCA 4S04A 1X3WB 3OR2C 2A07F 2HKOA 1ETQA 4XORA 2FMLA 4LK0F 4MQ9F 5J1RA 2H8RA 3H9QA 4N0BA 1FY7A 5FKOA 2IA2A 3MZ8A 1UELB 2JPBA 5DEQA 3KE2A 1WCMJ 4DW6A 4ZTJA 4U87A 3REOA 2QWWA 1K79A 3SJMA 2QF7A 1D1CA 4A12A 3QRFF 2JSCA 2VXZA 4I76A 2QBYA 4CHUA 4P5OA 1V5FA 4PJLA 1I1SA 4CDGA 3Q3SA 2M30A 2Y30A 4M72A 3HTUA 1USSA 1WI3A 4E70A 3KFWX 4KITB 1KGSA 1U9OA 1VQ5I 1MMSA 3ASNH 2BXZA 4D5FA 1YX3A 2M5WA 1G6NA 1E3HA 4XBFA 3W3CA 4DZPA 3FHZA 3K10A 4PSWA 1BIBA 4Z2YA 5EEHA 3BLYA 3IWFA 4HV5A 4W1UA 1JUMA 1OCZH 2V1UA 4A3GJ 2KIUA 5F08A 2BHZA 5D5UB 2ZMEC 3A03A 4DYRA 4LB6B 1FTTA 5TGTA 3OYJA 1H88C 5LD2C 2TRTA 4NQWA 5GTHC 1P6RA 4A3FJ 1I3QJ 4BQAA 5FD6A 1HF0A 3B73A 2XAGA 3FMRA 3KZYA 4IHTA 2E1MC 2DFFA 4Q48A 2G9WA 3T0YA 1QZYA 4PUSA 1UZCA 4P55A 4RB0A 3BOQA 1UJ8A 1MDMA 1IUFA 3O6BB 1H9GA 1BR4A 1MBHA 2OUMA 1U5TB 2COBA 4E7HA 3WU0A 3WTTC 2QSFX 2DMTA 2LSOA 3ZCOA 3BCBA 4HLXA 3ZRGA 1K78A 4B43A 4IRIA 4A3BJ 1PUFA 3WGGA 1P2FA 4QIWN 2XPVA 1LB2A 2LNBA 1LE8B 2NYXA 5L3BA 2GXGA 2VUMJ 1HQCA 4FISA 3F8BA 4PJ0C 4EGYA 1B72B 1RZ4A 2H8WA 2UWMA 3I53A 1VQLI 4R1HA 4HEA2 4CCJA 1I27A 4ESFA 3K4MA 2VASA 4BE0A 4UUSB 1N75A 3WGIA 5CQGA 2DFHA 2Z33A 3E0JB 2HQAA 5JHUA 3LNQA 1S7AA 3GTKJ 2K3PA 2K4JA 3KEYA 5ED4A 3E5XA 3LAPA 3QU3A 3M8EA 5FKNA 2CMPA 3CUQC 5DCMA 3HSFA 4YEJA 2M45A 3ECHA 3H3UA 4BBSJ 1ITYA 2Z16A 3HSEA 1X3ZB 1FIAA 4EJTA 3WG7H 1E0EA 2VQHA 1XMAA 2EB7A 2E2HJ 5C44J 3VB2A 1YJWI 3PO2J 5K7HA 2BW3A 5K5RA 1OYYA 4L9JA 3LFUA 5B1BH 2PMUA 2A6EF 3GVAA 3FMSA 1X1DA 1I6XA 5ICGA 1RR8C 2IS1A 2Y0MA 2YR2A 2K3FA 2OZ6A 5J8FA 3FF5A 3VYUB 2MW8A 1FT9A 3CCUI 1AA7A 3FWEA 1QZZA 1SFKA 3RDIA 4IRGA 4CH7A 3PFYA 5CVIA 5B66C 2KDZA 1ZYRF 3HL2A 2R5ZA 4NUBA 2VPLA 3S32A 2UXXA 3BG9A 2I8DA 1YJ9I 2D2WA 2QQBA 2P7CB 1AHDP 1X58A 3T1BA 1U3EM 2R93J 3LWFA 4CZZA 2M4GA 5E8GA 2KFDA 3QOEA 4MGRA 1IRFA 5HDKA 4HRIA 2ADUA 1ZRFA 4RB3C 2XHKA 4BYYA 2L02A 2RN7A 3U21A 2L4MA 3LSJA 2JRMA 3HB9A 4NNJA 1R5HA 3PFIA 2BY1A 1WJ5A 2E2JJ 2DXIA 4CYDA 3ZMVA 1ETKA 1T56A 2R7DA 3OIPA 4LB5A 4CCKA 3HM5A 1P4XA 5L3GA 2R92J 1Z6RA 1MJAA 3K4JA 4I09A 4Y52J 4BHCA 4A3EJ 3CF2A 3H9GA 4AIHA 5HLGA 2VBZA 1YG2A 4A3DJ 2MH2A 2QSGX 1O3RA 1VQKI 3ABMH 4BQNA 1ZTRA 4MO7A 3SEQA 5LHGA 1U5TA 1V5EA 2WY7Q 3MWMA 1ON2A 3K4KA 3ZMUA 4C3IJ 2DPUA 2DFIA 1IDZA 1WJBA 3DTKA 4DNCA 5EDNA 1FSHA 2VQLA 3VDXA 4XRSG 2G7HA 4B8XA 2L7MP 2QCOA 3LQRA 1K6OA 3RZDJ 1G59A 1T39A 1RRJA 1N78A 5HNHA 2WTEA 1OKRA 4RLFA 3GLXA 2KL4A 2W1OA 3HOTA 3OL3A 4EM1A 4UNOA 1RETA 2M0CA 2OTJI 3S3NA 5AONA 1MKMA 2DA2A 1NG6A 2RGVA 5DM7F 3L2UA 1HCRA 1YIOA 4KFCA 1B9MA 2CYYA 2OU2A 4EJUA 4XMYA 2HZDA 2FE3A 4E7LA 1OQYA 3KIOA 3Q0WA 2Y0SN 3DXJF 3EETA 3LQQA 1XN7A 2XGEA 4LLGF 4E7SA 1YW7A 5EEGA 1S29A 5FLMJ 1TTYA 2MBFA 4RGXA 3A01B 3D1NI 3M8FA 1IRGA 1F9NA 3K70D 1QPIA 2BOLA 3ABUA 1SD7A 3HZJA 3F22A 4FX0A 5FO5A 1T38A 2DA7A 4XN3A 3KP6A 1FNNA 2BXYA 2HDCA 2ZB9A 5B5EC 2R7OA 1ZN2A 3QQAA 5BQTA 2JVGA 4C3JJ 3I64A 2EZKA 4MEXF 2IRFG 1F36A 1Y0NA 4PFPA 1IRXA 4HDUA 2K02A 2EIJH 4HOBA 4TV7A 2GXAA 2CUEA 5KCMA 2Q0OA 2VB6A 1SFUA 4R8HA 2JJ7A 4JYKA 3C7JA 1YW9A 4CZCA 5FLXK 4K2EA 4IHYA 4AVZA 1T08B 4RBOA 3JR9A 1HXDA 1U0JA 3KEQA 3NQOA 5FKLA 2CV2A 2LC2A 4BXFA 2QQ9A 2K27A 3LL7A 4E7ZA 4RB1A 3EUKL 1LVKA 3BG7A 3GZ5A 4KIBA 3FXJA 5DUKA 2ESHA 2I10A 4ZC3A 3GZ6A 3ZPLA 2DT7B 2HNHA 2XPUA 3MAJA 2DPDA 4FQGA 2W84A 3LOCA 3DQVC 3IAS2 2P6TA 2CQXA 3BR0A 3RIRA 1W5SA 2BY2A 3Q5FA 1A5JA 5F1JA 3GF2A 1I1GA 5DD8A 3EYIA 2VBYA 4XKBA 2K9MA 1FP2A 2Z3YA 2WWYA 4JX4A 4Z6YA 1T2KA 3BY6A 4WCGA 1XCVA 3G4SI 2PQ8A 1HKQA 3H5NA 4OIPF 2XAHA 2P81A 1POGA 1B8IB 2RQPA 3DBLB 4ZDOA 3AAFA 4OMZA 2X6OA 3WHCA 1ON1A 1ZG1A 2CW7A 1IAWA 2LKXA 1T0FC 2VBXA 2LTPA 2PJPA 1UHMA 3S15J 4CO8A 3BTJA 1J09A 2RNJA 5IT3A 2O0YA 2JZYA 1UHWA 1P7JA 4IHSA 1N25A 4ENMA 3IH2A 4BHPA 5LBQA 3TKYA 2OBPA 5CKTA 4OIRF 4EVIA 3H0DA 3TO9A 1RIOH 2QQAA 2X85A 3L7WA 1ZKGA 1VQMI 3DPTA 1WSUA 4KMFA 3CDIA 3M1CA 2GWRA 5CVJA 3ELKA 4PJNA 3AL0C 3OYMA 2HPMA 2VBWA 2LD5A 4MIMA 2E34A 1CGPA 1SVOA 4XOTA 1GLNA 5DDGA 4HDVA 4FT8A 1S7EA 1BR1A 2RREA 1WWXA 3CJTB 1GT0C 3BR2A 1PDNC 3DFGA 1XSDA 3HTSB 1G8XA 2P5LC 4A3MJ 1V54H 3CCJI 1D5YA 3CJQB 1JTYA 5HS7A 5BPIA 4BQQA 4ON0A 1Z05A 4IEJA 2MLKA 2ZSIB 3M7GA 2D1VA 2FBKA 5IT9Z 4HX4A 4B47A 2IVMA 3IH3A 1MDMB 1KQ9A 2P8TA 3M9AA 2HXIA 3C3WA 1I39A 3R60A 1ONVA 2MD0A 3Q9VA 1WH5A 3W6KB 1I5ZA 2QKMB 3HPHA 4I0AA 1DGWY 5KHDA 1D0XA 1NHAA 1FZPB 3GYHX 4UHTA 1X19A 2P5VA 2Q2EA 3F3XA 1OR7A 3FXLA 3K1NA 1FBQA 1SFEA 5CJ9A 4KN4X 2PX9A 2IAIA 4M3FA 2ME6A 4P1WA 1YE9A 1AKHA 4ZYEA 1XSVA 4I6ZA 1RPWA 2BE5F 1YYVA 2VKEA 5E8IA 3LSIA 3GEZA 2LY1A 1NK2P 3S1QJ 3L2RA 4HPQA 1D1BA 2KRCA 2WAQA 1W0TA 3K0LA 2ECCA 3UNGC 2K5CA 2F2EA 3F8FA 5L3EA 1H89C 2X4HA 3DEWA 1LFBA 2GAUA 2KP6A 5DCMB 4BEHA 3P9IA 2GOXB 3OR1C 1B8IA 4V2GA 1Z9CA 4FETA 1MSEC 1EV7A 1EH8A 5B1AH 2QSHX 1VQ9I 2MFZA 1ZREA 3FBIB 3D5SC 2BW3B 2STTA 1W4MA 5JHFA 4EM0B 1SMTA 2E36A 2XRLA 2HOEA 1ZGJA 2BEOA 3G73A 2DYRH 2F6CA 1UHSA 3CF5F 1K4SA 2NRAC 1N77A 3LA7A 5JLWA 3WTSC 4ESJA 4M3GA 1B59A 2XC7A 2HOAA 4A3JJ 1K4TA 1TW2A 1PJRA 2VL8A 5D5WB 4WX9A 2GA1A 1OYWA 2VONA 3BR3A 4XRMA 3U9GA 2EINH 4KJZA 3H3ZA 3AG2H 1Z3YA 4WWCA 2LFBA 4OAZA 3CLQA 4EV0A 1MSFC 2ECBA 4A0ZA 1F5TA 5IYDJ 1XG1A 2WBMA 4DIQA 2CQ7A 2NAZA 2R7FA 1ZGWA 3OYAA 3R61A 5BMZA 2VJJA 1K83J 3DEEA 3I3LA 5J4YA 1TLHB 1X1CA 1SD5A 3P9KA 1SAUA 4M3EA 4HNVA 1K7AA 2BYVE 3TGNA 5HDGA 2STWA 5FKMA 1VQ4I 1FLIA 2DT5A 5JVGF 2EFNA 3NARA 5ILSA 1OCRH 1O3QA 3W2AA 2L9NA 2LP0A 1DU0A 4D7MA 3EUHA 1UMQA 2A69F 2HEOA 2FXAA 1A31A 3ERED 5C3EJ 2UZKA 2UV1A 2KQRA 5IP7J 4O3MA 3BPXA 1OCCH 1XPXA 2H27A 1H0MA 2R7RA 4R79A 3CMEI 1P4WA 1O7FA 3HJEA 3L09A 1R5GA 4M3BA 1HC8A 5HODA 4GGGA 3HOWJ 3VSKA 3K4CA 2ACJA 2E35A 3Q0UA 1BC7C 1FYLA 2M9HA 5FRNA 2CG4A 3HOSA 2XAJA 4HA8A 1AKHB 2XSJC 5CVUA 2P5KA 4OIOF 2L01A 3GFMA 3WTWC 3WU1B 2KHMA 3V8LA 4Y33A 3HXLA 1O3SA 1A35A 3JRIA 2DYSH 2ID3A 4G8XA 1UCRA 4XLPF 5HS8A 3RZOJ 5GTIC 1Y6IA 5E3MA 1KQ8A 5HLTA 1PVEA 5E1WA 3OV8A 1T8IA 3CJNA 4RAGA 1I3AA 2DTZA 1IV8A 4KIFA 1IV6A 3M07A 4FE7A 5M5WJ 1D1AA 4LK1F 4BH9A 4HZFA 5HLHA 1MNEA 1SD4A 2M87A 3K9TA 1IG7A 3GW2A 2DQRA 3F9KA 5BNGA 2VKDA 2L7ZA 3TP0A 1YRNB 3K70C 3T5XA 1QQIA 2HVSA 5LGUA 3HPGA 3JRHA 2GLOA 3AG1H 2NVTJ 1KU9A 2HOSA 1TT5B 4AU7A 2W25A 4UUTA 3KYLA 4LLLA 2A6TA 2O03A 3E5QA 3FM5A 2Q8KA 3VEPA 3ZR8X 5F1RA 1NK3P 5IOZA 3I59B 4ZZDA 4XK4A 2PMZN 2EFOA 2HWVA 2LBFB 2UXNA 4FHTA 2OJED 4FASD 1E2XA 2VC0A 3UKGA 2LF7A 1YS6A 1Z91A 4NQWB 1T95A 1OYIA 3QP5A 2AXTC 4II3A 3E6MA 2YX4A 3QU6A 2HU9A 3LSTA 1RUNA 3GTOJ 1IJWC 3OOPA 3MZYA 2XSDC 3O8HA 1EKEA 2DA6A 1R9TJ 3WE2A 5K1YA 2VC1A 2QKLB 3CP8A 1ZRCA 4XICA 3TDZC 4ZTFA 3CO7C 5L3DA 4C2UA 3EYYA 1ETYA 4YIFA 4Q4ZF 1WJFA 2RNGA 1DUXC 4II2A 2K9LA 2FMYA 1IW7F 2JTVA 4B3XA 1K61A 1Y1WJ 2XIGA 4L9NA 5DV5A 1LQ1A 1BM9A 2M34A 2QM3A 4M9SA 4C3HJ 4XL9A 1IXSB 1ZHFA 3GTJJ 5ILUA 4V19K 1U78A 4YIIA 3HDDA 2HQ5A 3HRTA 2EV5A 3HRUA 3ML6A 4XLHA 2DCEA 4CXFA 2BBYA 2MSYA 1BI1A 2X6YA 2O5RA 3I4MJ 2NVQJ 3ABLH 1HLVA 2KIMA 3OYGA 2WB1A 2OCEA 4ZYHA 1QVTA 5J1UA 4BXUA 4CYCA 3W6VA 2YU3A 3LSHA 3VYRB 2C6YA 3E7LA 3OS0A 3BT9A 1YS7A 2ZFWA 3HBLA 4XLNF 2M4KA 2FBHA
chains in the Genus database with same CATH topology
4CICA 3K69A 4M6YA 2IA0A 3HUGA 4GO1A 1XGNA 1G3YA 4D0PA 3U1DA 3GX4X 1FSEA 1J59A 3G3ZA 3N4MA 3GFJA 1LJ9A 1B1BA 2ZNZA 2WC2A 2L4AA 4U0VA 3WG9A 2GXBA 2HKXA 4L9TA 3JTHA 5JR3A 4XSZF 3MZHA 3BDDA 3HIFA 1R23A 3K2ZA 2CO5A 1T0FA 1KU2A 2F5FA 4UV8A 5KK1A 3J81Z 3TOAA 4PZJA 2CSOA 3R4KA 1OPCA 3F8MA 3IRRA 4YG2F 3FM3A 4HBLA 4H0EA 2B0LA 1SMYF 3LFKA 2K86A 3IKTA 1ULYA 2PBIA 4GYIA 4ESBA 2FU4A 3L9FA 2RC4A 2V6CA 3KP4A 4PGHA 3F23A 3IRQA 1FBUA 2QENA 3PQJA 2FQ3A 4HF0A 2XV4S 2FRHA 4MQVA 1LDKB 1J0RA 4XRFA 3R0AA 3F8CA 1ZG5A 5LGTA 5HLIA 2HYGD 1HBXG 1UFMA 4HV6A 3T8TA 2P6SA 3ZP5A 4HAMA 4M9ZA 4LG0B 1R00A 5E18F 2ZO4A 2HZTA 4P9UA 4HLYA 3E5UA 3RYRA 1P4AA 3E6BA 2XROA 1Z1DA 2D1HA 1QO0D 3ZMZA 4HX7A 3RI4A 3KP3A 3PQKA 2CWEA 4ASNA 5E17F 1MD0A 1W7PA 5E20A 2ELHA 1HW2A 4PDKA 2Z5UA 3QAHA 1T98A 3U2RA 4ENKA 5TJJA 4JQFA 1J2XA 1TNSA 4M6XA 4P96A 2H94A 5D4RA 1FX7A 1W7PB 4BHBA 2A6HF 3ZMSA 3K1MA 5F6FA 1FP1D 3JTGA 3FXQA 3RPUA 3F8NA 4ETSA 1LEAA 4UVCA 1JXSA 2VODA 1YTYA 4WXDA 4Y13A 2CFXA 1DDNA 1ZLKA 4A6DA 2DI3A 2FSWA 2PMHA 3IC7A 2FA5A 4HX8A 4U0YA 1TW3A 5CLSA 1G4DA 1ZAOA 3FZVA 2F5DA 3RPQA 4LLNA 4U0WA 4G7ZF 2CW0F 1XGOA 4A5NA 1QGPA 1BI0A 2XAQA 3HHGA 4L0ZB 1REPC 2OZUA 1XB4A 2L3DA 4BNCA 4UXNA 5TRDA 1TQIA 1AWCA 1Y0UA 4OMYA 2K4BA 1HKSA 1IXRC 1BJAA 4FX4A 4A5MA 1U6GA 3V4GA 1XSXA 2EFWA 1LNWA 1IXCA 2DU9A 3CUQB 4MTDA 3KEOA 1JHFA 5LRRA 1D5VA 4IJAA 1ODDA 4RAZA 2L54A 2CGPA 2YX7A 2DLLA 3GFIA 1FYMA 4GCVA 1IUYA 2V1DA 1E17A 1BC8C 5J8CA 5FGMA 4G7HF 4WXCA 2K7LA 2HTJA 1B4AA 5JI6A 2ZBKA 2M8EA 4CGZA 4KN7X 4IXAA 1P92A 1LDJA 3HYIA 2MLGA 3P7NA 2RV8A 2PLYA 1SD6A 1G3SA 1TBXA 2W85A 3TDUC 5DCFA 3FX3A 1JE8A 1XMKA 2GQQA 5J6XA 5HS9A 5FFZA 1MJ9A 1SFXA 3RKWA 4AVPA 1WI9A 3DV8A 3V8JA 4RAYA 4UUVA 2RDPA 5H6QA 4I0BA 1BOAA 4IVNA 3RKXA 3KLNA 1CF7A 2QBYB 3GWZA 4Q47A 1IN6A 2HYFA 4RGUA 1MZBA 4RGSA 4O5VA 4U7BA 2VN2A 2A5YB 4ZYDA 4MEYF 2O61A 5ICEA 4IPAA 2QYOA 5LGNA 3N97A 5IT9K 5H6RA 3NRVA 5AIPA 1ZG3A 2O3FA 1D8KA 5D5XB 4L18B 4MTEA 2VOOA 1KQ0A 2E7XA 2PFBA 1S7OA 1QNTA 4XSXF 3P9CA 2PG4A 1KU3A 1GXPA 3L00A 2FF4A 1XGSA 1EH7A 5D6FA 1GVJA 3DP7A 2VE9A 1IN8A 2ISZA 1C0WA 2O6GE 2ZKZA 1F1ZA 1ZGAA 5ILVA 2M1BA 3IKVA 4M74A 4LMYA 4NHJA 4WK8F 2NNYA 1U8RA 4EJOA 3ABTA 3F21A 2DQLA 1TQMA 3CDHA 1XCBA 3R6SA 2EWNA 5DYMA 5HVQC 4U7DA 2WV0A 1FWZA 2TDXA 2EA2A 3RYPA 2YSRA 2XVCA 2D45A 5HDNA 2VT3A 4F7ZA 5LHHA 3CO6C 4OINF 2RKHA 3I59A 3V7SA 3F72A 4LJZF 3E3VA 2JPCA 4B09A 4YFKF 2IP2A 5DUIA 4ZH4F 2E7WA 5E1ZB 1X3UA 3SXYA 3BJAA 3TO6A 4ZZLA 3SZPA 1HSTA 3DF8A 4KYWA 1HW5A 3KCCA 4HYEA 1J7KA 5BS6A 1R1VA 4G7OF 3HHHA 3ROUA 3V7RA 1HSJA 5FFXA 2EJRA 3I54A 3WTYC 5ICFA 2XUBA 1U5TC 3VODA 3I5UA 2GIVA 4MHGA 3M1EA 1YW8A 5JVTA 2GZWA 1UB9A 3J81K 3RKYA 3ZMDA 4KUMA 3HRSA 1KYZA 4HF1A 2H6CA 1ZH5A 2A61A 4RB2C 3F6VA 5JFRA 1WQ2A 1IF1A 3CTAA 3J80K 4ENNA 1FBSA 1IN4A 2EV0A 1KA8A 4GYGA 1XDSA 2EFPA 1L0OC 3ECOA 3R0JA 3S2WA 5D4SA 4UVBA 4PCQA 2FNAA 1FC3A 4EJVA 2HR3A 3CUOA 4KICA 2EA4A 2JRTA 3MEXA 1Z7UA 2W57A 3V7CA 2PI0A 3COAC 1F4KA 4AD9A 2KJCA 4LG0A 2YPRA 2XAFA 3JW4A 3LA3A 2QVOA 5D6EA 4P9FA 3B02A 1XD7A 2QLZA 1R1UA 1S8NA 1RUOA 2FOKA 3VFZA 3BWGA 1V3FA 1S6LA 3BZ6A 4EQQA 1LVAA 3SHFA 1YQAA 3E97A 3RJPA 1CF7B 2AS5F 4YFXF 3MFKA 1YLFA 4MNUA 4I02A 3QPHA 4A2UA 4LD5A 1PP8F 1QPMA 4IF4A 3JSPA 3L2CA 5HOOA 1SAXA 2NS0A 4KMUX 5A2QZ 3FXRA 5LEKA 1O57A 1QBJA 2IJLA 3WTUC 3F6OA 1IN7A 4IRHA 1OMIA 2QUFA 1AOYA 2FNPA 1BI2A 2VE8A 4RGRA 1XDUA 3VOEA 4KNYA 4M9XA 4Y17A 5ERIA 1A04A 5LLQA 2IPQX 1FOKA 3QPTA 3DPLC 3V8KA 5K5QA 1WRJA 1TQPA 3K1PA 1RNLA 2F5CA 2XKOA 2EV6A 3MCZA 3HSRA 3TQNA 2V9VA 2ZMEB 4M71A 4UV9A 3FMQA 4L5IA 4S05A 2X0LA 3SQNA 1V4RA 2KKOA 2G7UA 2FEZA 4A0YA 3WTXC 1ZLJA 2HGCA 1R1TA 4L0YB 1JHHA 4BAYA 2HTSA 2BGCA 3RTRA 5AIQA 1PP7U 4QWQA 1G3TA 3JSOA 4HF2A 3JAMZ 2ZNYA 2A3SA 4AWXB 2EFQA 3KLOA 4O6JA 3J80Z 1EH6A 2LDUA 2Y48A 3QOPA 1L3LA 5LHIA 5L3CA 1DPRA 3ZMTA 2OQRA 3LAJA 3MQ0A 2P7VB 3WE3A 3LA2A 1DP7P 4A6EA 1GHCA 5D8LB 1J75A 2VT2A 4OOIA 4N9HA 3NEUA 1IN5A 4LFUA 5D8KB 3WODF 3T8RA 3WTZA 2KJBA 2MC3A 4Y15A 1YFHA 5FLXZ 1O3TA 3ULQB 3ZQ7A 3GO5A 1J5YA 2ZMEA 2XGXA 4L5JA 1TNTA 1BBYA 4OIQF 2J5PA 4UVAA 3JAMK 1BN5A 2ISYA 3C18A 3BROA 4LGWA 3I0TA 3D5LA 4RS8A 4QLCU 4HQEA 3TO7A 2E1CA 2BV6A 4L9VA 1BIAA 1RI7A 2H6BA 2MH9A 4EM2A 4KDPA 5A2QK 3BJ6A 2ZCWA 1R7JA 1HKTA 2RVCA 2ZXJA 2Z99A 3DEUA 1GXQA 4Q5SF 1LDDA 2KRFA 2R3SA 2DK8A 3FXUA 1T6SA 2PN6A 3Q9SA 2J5OA 3KP5A 3KP7A 1O7LA 1VTNC 1FYKA 4HW0A 4I2OA 1IZ1A 2O8XA 2KIFA 1KYWA 2Z9OA 1Z6TA 2Y75A 4ZYGA 3I58A 4I98B 1R22A 1HW1A 3GXOA 4A0XA 3BPVA 2DAOA 3H92A 4I7HA 3C1DA 4OU0A 1MGTA 2H09A 2IT0A 4KIGA 3WTVC 2MD5A 2ZJ2A 4YFNF 1H9TA 4G94A 3EQLF 1W5TA 1STZA 4JBAA 5CVVA 3D0SA 2HQRA 5F64A 1DPUA 3KETA 2OA4A 3QP6A 3IHUA 5E1XA 1B9NA 2JT1A 3HRMA 5D5VB 1D8JA 3GFLA 2XKPA 1S3JA 5LRSA 1YO5C 3CLOA 2IW5A 1W7PD 2P4WA 2DO7A 5BOXA 2DBBA 2LF8A 2ETHA 4AIKA 2QZ8A 3DKWA 5FD5A 3ZN0A 1J9IA 1USTA 3IWZA 5DD4A 3TOBA 3E6CC 3KP2A 3ISPA 2A68F 4JK1X 4PGGA 3E6DA 2DW4A 1BI3A 2W24A 2ESNA 2FBIA 4WF2A 4EMSA 5FB2A 1XGMA 2HFHA 2AXLA 2XASA 5L3FA 3BJOA 3SZTA 2DTRA 4KA4A 1U2WA 4G9YA 3SFZA 2OQGA 1WKMA 3O2PE 3ZN1A 2HS5A 2MA3A 1MJBA 1JGSA 2DK5A 2HQNA 1D3YA 4G6DA 3BP8A 4EJWA 3J7AO 4WXHA 2F5EA 5ICCA 4NB5A 3I71A 1ZRDA 4I01A 2OD5A 1Q1HA 2EK5A 3EDPA 5CVRA 2PEXA 2OAZA 3O3KA 4GXOA 5H20A 2IA1A 5LEJA 4N9IA 2CQKA 4HQMA 4DQ2A 4G6QA 3IL2A 2NNNA 4AIJA 1LEBA 1G3WA 3I4PA 2E1NA 2COMA 4U88A 2V79A 2XRNA 1R58A 5K5OA 6PAXA 1B6AA 1K78B 2V1XA 5KVRA 4ENJA 5BPDA 4KT5C 3W6JB 2GA2A 1KU7A 5CYVA 1FPQA 3GUDA 1ZARA 3WGHA 2VOPA 1PUEE 4EGZA 4M73A 3CUQA 3KZZA 2LKPA 1R36A 4S04A 2A07F 2HKOA 2FMLA 4LK0F 4MQ9F 4N0BA 1FY7A 2IA2A 2JPBA 5DEQA 3KE2A 3REOA 2QWWA 1K79A 4A12A 3QRFF 2JSCA 2VXZA 2QBYA 4CHUA 4P5OA 1I1SA 4CDGA 2M30A 4M72A 3HTUA 1USSA 4E70A 3KFWX 1KGSA 2M5WA 1G6NA 4XBFA 3FHZA 4Z2YA 1BIBA 5EEHA 3IWFA 4HV5A 2V1UA 2KIUA 5D5UB 4LB6B 4NQWA 1P6RA 4BQAA 5FD6A 3B73A 2XAGA 3FMRA 3KZYA 4IHTA 4Q48A 2G9WA 3T0YA 1QZYA 4P55A 4RB0A 3BOQA 1MDMA 3O6BB 1H9GA 1U5TB 3WU0A 3WTTC 2LSOA 4HLXA 1K78A 4IRIA 3WGGA 1P2FA 1LB2A 2LNBA 2NYXA 5L3BA 2GXGA 1HQCA 3F8BA 4EGYA 1RZ4A 2UWMA 3I53A 4R1HA 4ESFA 1I27A 3WGIA 2Z33A 5JHUA 1S7AA 2K4JA 5ED4A 3LAPA 3E5XA 3QU3A 3M8EA 3CUQC 5DCMA 3HSFA 2M45A 3ECHA 3H3UA 3HSEA 4EJTA 1XMAA 2EB7A 3VB2A 5K5RA 1OYYA 4L9JA 2PMUA 2A6EF 3GVAA 3FMSA 5ICGA 1I6XA 2Y0MA 2YR2A 2OZ6A 5J8FA 3FF5A 1FT9A 3FWEA 1QZZA 3RDIA 4IRGA 5CVIA 1ZYRF 2UXXA 2D2WA 2QQBA 2P7CB 3T1BA 1U3EM 3LWFA 4CZZA 5E8GA 4MGRA 1IRFA 5HDKA 2ADUA 1ZRFA 4RB3C 2XHKA 4BYYA 2L02A 2RN7A 2L4MA 1R5HA 3PFIA 4CYDA 3ZMVA 2R7DA 4LB5A 1P4XA 5L3GA 1Z6RA 1MJAA 4I09A 4BHCA 4AIHA 5HLGA 2VBZA 1YG2A 2MH2A 1O3RA 5LHGA 1U5TA 3MWMA 1ON2A 3ZMUA 2DPUA 2DFIA 4DNCA 1FSHA 2G7HA 4B8XA 3LQRA 1K6OA 1T39A 2WTEA 1OKRA 3GLXA 3HOTA 4EM1A 4UNOA 5AONA 1MKMA 2RGVA 1YIOA 4KFCA 1B9MA 2CYYA 2OU2A 4EJUA 2FE3A 3EETA 3DXJF 3LQQA 1XN7A 4LLGF 1YW7A 5EEGA 1S29A 1TTYA 2MBFA 4RGXA 3M8FA 1IRGA 1F9NA 3ABUA 1SD7A 3F22A 4FX0A 5FO5A 1T38A 3KP6A 1FNNA 2HDCA 1ZN2A 5BQTA 3I64A 4MEXF 2IRFG 4HDUA 2K02A 4HOBA 4TV7A 2Q0OA 1SFUA 4R8HA 3C7JA 1YW9A 5FLXK 4K2EA 1HXDA 3KEQA 3NQOA 2QQ9A 2K27A 4RB1A 3GZ5A 4KIBA 5DUKA 2ESHA 3GZ6A 3ZPLA 3MAJA 2DPDA 2W84A 3DQVC 2P6TA 3RIRA 1W5SA 3Q5FA 3GF2A 1I1GA 5DD8A 3EYIA 2VBYA 1FP2A 2Z3YA 2WWYA 1T2KA 3BY6A 4WCGA 1XCVA 2PQ8A 1HKQA 4OIPF 2XAHA 2RQPA 3AAFA 4OMZA 1ON1A 1ZG1A 1IAWA 2VBXA 2PJPA 1UHMA 4CO8A 2RNJA 5IT3A 2O0YA 2JZYA 1UHWA 4IHSA 4ENMA 4BHPA 5LBQA 3TKYA 2OBPA 4OIRF 4EVIA 1RIOH 3TO9A 2QQAA 3L7WA 3DPTA 1WSUA 4KMFA 2GWRA 5CVJA 3ELKA 2VBWA 1CGPA 5DDGA 4HDVA 4FT8A 1WWXA 1PDNC 3DFGA 1XSDA 3HTSB 2P5LC 5HS7A 5BPIA 4ON0A 1Z05A 2MLKA 3M7GA 2D1VA 2FBKA 5IT9Z 4HX4A 2IVMA 1MDMB 1KQ9A 2P8TA 3M9AA 3C3WA 3R60A 1ONVA 3Q9VA 3W6KB 1I5ZA 4I0AA 1NHAA 1FZPB 3GYHX 4UHTA 2P5VA 2Q2EA 1OR7A 3F3XA 3K1NA 1FBQA 1SFEA 5CJ9A 4KN4X 4ZYEA 1XSVA 2BE5F 1YYVA 5E8IA 3GEZA 3K0LA 2F2EA 3F8FA 5L3EA 2X4HA 5DCMB 2GAUA 3P9IA 1Z9CA 1EV7A 1EH8A 1ZREA 2STTA 1W4MA 4EM0B 1SMTA 2HOEA 1ZGJA 2BEOA 3G73A 2NRAC 3LA7A 3WTSC 4ESJA 1B59A 1TW2A 5D5WB 4WX9A 2GA1A 1OYWA 2VONA 3U9GA 3H3ZA 4WWCA 4EV0A 4A0ZA 1F5TA 2NAZA 2R7FA 3R61A 5BMZA 1TLHB 1SD5A 3P9KA 1K7AA 2BYVE 3TGNA 5HDGA 2STWA 1FLIA 2DT5A 2EFNA 5ILSA 1O3QA 3EUHA 2A69F 2HEOA 2FXAA 3ERED 2UZKA 4O3MA 3BPXA 2H27A 1H0MA 4R79A 1P4WA 1O7FA 3L09A 1R5GA 4GGGA 2ACJA 1BC7C 1FYLA 2CG4A 3HOSA 2XAJA 4HA8A 5CVUA 2P5KA 4OIOF 2L01A 3GFMA 3WTWC 3WU1B 3V8LA 1O3SA 4G8XA 1UCRA 4XLPF 5HS8A 1KQ8A 5E1WA 3OV8A 3CJNA 4KIFA 4LK1F 4BH9A 4HZFA 5HLHA 1SD4A 2M87A 3K9TA 3GW2A 2DQRA 3T5XA 1QQIA 5LGUA 1KU9A 2W25A 4LLLA 2O03A 3E5QA 3FM5A 2Q8KA 3VEPA 5F1RA 3I59B 4ZZDA 2EFOA 2HWVA 2UXNA 4FHTA 1E2XA 2VC0A 2LF7A 1YS6A 1Z91A 1OYIA 3QP5A 3E6MA 2YX4A 3QU6A 3LSTA 1RUNA 3OOPA 3MZYA 3WE2A 5K1YA 2VC1A 1ZRCA 3TDZC 3CO7C 5L3DA 3EYYA 4YIFA 4Q4ZF 1DUXC 2FMYA 1IW7F 2JTVA 2XIGA 4L9NA 5DV5A 1LQ1A 1BM9A 2QM3A 4M9SA 1IXSB 1ZHFA 5ILUA 1U78A 4YIIA 3HRTA 2EV5A 3HRUA 3ML6A 4CXFA 2BBYA 1BI1A 2KIMA 4ZYHA 4BXUA 2YU3A 2C6YA 1YS7A 2ZFWA 4XLNF 2FBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CIC A;  3K69 A;  4M6Y A;  2IA0 A;  3HUG A;  4GO1 A;  1XGN A;  1G3Y A;  4D0P A;  3U1D A;  3GX4 X;  1FSE A;  1J59 A;  3G3Z A;  3N4M A;  3GFJ A;  1LJ9 A;  1B1B A;  2ZNZ A;  2WC2 A;  2L4A A;  4U0V A;  3WG9 A;  2GXB A;  2HKX A;  4L9T A;  3JTH A;  5JR3 A;  4XSZ F;  3MZH A;  3BDD A;  3HIF A;  1R23 A;  3K2Z A;  2CO5 A;  1T0F A;  1KU2 A;  2F5F A;  4UV8 A;  5KK1 A;  3J81 Z;  3TOA A;  4PZJ A;  2CSO A;  3R4K A;  1OPC A;  3F8M A;  3IRR A;  4YG2 F;  3FM3 A;  4HBL A;  4H0E A;  2B0L A;  1SMY F;  3LFK A;  2K86 A;  3IKT A;  1ULY A;  2PBI A;  4GYI A;  4ESB A;  2FU4 A;  3L9F A;  2RC4 A;  2V6C A;  3KP4 A;  4PGH A;  3F23 A;  3IRQ A;  1FBU A;  2QEN A;  3PQJ A;  2FQ3 A;  4HF0 A;  2XV4 S;  2FRH A;  4MQV A;  1LDK B;  1J0R A;  4XRF A;  3R0A A;  3F8C A;  1ZG5 A;  5LGT A;  5HLI A;  2HYG D;  1HBX G;  1UFM A;  4HV6 A;  3T8T A;  2P6S A;  3ZP5 A;  4HAM A;  4M9Z A;  4LG0 B;  1R00 A;  5E18 F;  2ZO4 A;  2HZT A;  4P9U A;  4HLY A;  3E5U A;  3RYR A;  1P4A A;  3E6B A;  2XRO A;  1Z1D A;  2D1H A;  1QO0 D;  3ZMZ A;  4HX7 A;  3RI4 A;  3KP3 A;  3PQK A;  2CWE A;  4ASN A;  5E17 F;  1MD0 A;  1W7P A;  5E20 A;  2ELH A;  1HW2 A;  4PDK A;  2Z5U A;  3QAH A;  1T98 A;  3U2R A;  4ENK A;  5TJJ A;  4JQF A;  1J2X A;  1TNS A;  4M6X A;  4P96 A;  2H94 A;  5D4R A;  1FX7 A;  1W7P B;  4BHB A;  2A6H F;  3ZMS A;  3K1M A;  5F6F A;  1FP1 D;  3JTG A;  3FXQ A;  3RPU A;  3F8N A;  4ETS A;  1LEA A;  4UVC A;  1JXS A;  2VOD A;  1YTY A;  4WXD A;  4Y13 A;  2CFX A;  1DDN A;  1ZLK A;  4A6D A;  2DI3 A;  2FSW A;  2PMH A;  3IC7 A;  2FA5 A;  4HX8 A;  4U0Y A;  1TW3 A;  5CLS A;  1G4D A;  1ZAO A;  3FZV A;  2F5D A;  3RPQ A;  4LLN A;  4U0W A;  4G7Z F;  2CW0 F;  1XGO A;  4A5N A;  1QGP A;  1BI0 A;  2XAQ A;  3HHG A;  4L0Z B;  1REP C;  2OZU A;  1XB4 A;  2L3D A;  4BNC A;  4UXN A;  5TRD A;  1TQI A;  1AWC A;  1Y0U A;  4OMY A;  2K4B A;  1HKS A;  1IXR C;  1BJA A;  4FX4 A;  4A5M A;  1U6G A;  3V4G A;  1XSX A;  2EFW A;  1LNW A;  1IXC A;  2DU9 A;  3CUQ B;  4MTD A;  3KEO A;  1JHF A;  5LRR A;  1D5V A;  4IJA A;  1ODD A;  4RAZ A;  2L54 A;  2CGP A;  2YX7 A;  2DLL A;  3GFI A;  1FYM A;  4GCV A;  1IUY A;  2V1D A;  1E17 A;  1BC8 C;  5J8C A;  5FGM A;  4G7H F;  4WXC A;  2K7L A;  2HTJ A;  1B4A A;  5JI6 A;  2ZBK A;  2M8E A;  4CGZ A;  4KN7 X;  4IXA A;  1P92 A;  1LDJ A;  3HYI A;  2MLG A;  3P7N A;  2RV8 A;  2PLY A;  1SD6 A;  1G3S A;  1TBX A;  2W85 A;  3TDU C;  5DCF A;  3FX3 A;  1JE8 A;  1XMK A;  2GQQ A;  5J6X A;  5HS9 A;  5FFZ A;  1MJ9 A;  1SFX A;  3RKW A;  4AVP A;  1WI9 A;  3DV8 A;  3V8J A;  4RAY A;  4UUV A;  2RDP A;  5H6Q A;  4I0B A;  1BOA A;  4IVN A;  3RKX A;  3KLN A;  1CF7 A;  2QBY B;  3GWZ A;  4Q47 A;  1IN6 A;  2HYF A;  4RGU A;  1MZB A;  4RGS A;  4O5V A;  4U7B A;  2VN2 A;  2A5Y B;  4ZYD A;  4MEY F;  2O61 A;  5ICE A;  4IPA A;  2QYO A;  5LGN A;  3N97 A;  5IT9 K;  5H6R A;  3NRV A;  5AIP A;  1ZG3 A;  2O3F A;  1D8K A;  5D5X B;  4L18 B;  4MTE A;  2VOO A;  1KQ0 A;  2E7X A;  2PFB A;  1S7O A;  1QNT A;  4XSX F;  3P9C A;  2PG4 A;  1KU3 A;  1GXP A;  3L00 A;  2FF4 A;  1XGS A;  1EH7 A;  5D6F A;  1GVJ A;  3DP7 A;  2VE9 A;  1IN8 A;  2ISZ A;  1C0W A;  2O6G E;  2ZKZ A;  1F1Z A;  1ZGA A;  5ILV A;  2M1B A;  3IKV A;  4M74 A;  4LMY A;  4NHJ A;  4WK8 F;  2NNY A;  1U8R A;  4EJO A;  3ABT A;  3F21 A;  2DQL A;  1TQM A;  3CDH A;  1XCB A;  3R6S A;  2EWN A;  5DYM A;  5HVQ C;  4U7D A;  2WV0 A;  1FWZ A;  2TDX A;  2EA2 A;  3RYP A;  2YSR A;  2XVC A;  2D45 A;  5HDN A;  2VT3 A;  4F7Z A;  5LHH A;  3CO6 C;  4OIN F;  2RKH A;  3I59 A;  3V7S A;  3F72 A;  4LJZ F;  3E3V A;  2JPC A;  4B09 A;  4YFK F;  2IP2 A;  5DUI A;  4ZH4 F;  2E7W A;  5E1Z B;  1X3U A;  3SXY A;  3BJA A;  3TO6 A;  4ZZL A;  3SZP A;  1HST A;  3DF8 A;  4KYW A;  1HW5 A;  3KCC A;  4HYE A;  1J7K A;  5BS6 A;  1R1V A;  4G7O F;  3HHH A;  3ROU A;  3V7R A;  1HSJ A;  5FFX A;  2EJR A;  3I54 A;  3WTY C;  5ICF A;  2XUB A;  1U5T C;  3VOD A;  3I5U A;  2GIV A;  4MHG A;  3M1E A;  1YW8 A;  5JVT A;  2GZW A;  1UB9 A;  3J81 K;  3RKY A;  3ZMD A;  4KUM A;  3HRS A;  1KYZ A;  4HF1 A;  2H6C A;  1ZH5 A;  2A61 A;  4RB2 C;  3F6V A;  5JFR A;  1WQ2 A;  1IF1 A;  3CTA A;  3J80 K;  4ENN A;  1FBS A;  1IN4 A;  2EV0 A;  1KA8 A;  4GYG A;  1XDS A;  2EFP A;  1L0O C;  3ECO A;  3R0J A;  3S2W A;  5D4S A;  4UVB A;  4PCQ A;  2FNA A;  1FC3 A;  4EJV A;  2HR3 A;  3CUO A;  4KIC A;  2EA4 A;  2JRT A;  3MEX A;  1Z7U A;  2W57 A;  3V7C A;  2PI0 A;  3COA C;  1F4K A;  4AD9 A;  2KJC A;  4LG0 A;  2YPR A;  2XAF A;  3JW4 A;  3LA3 A;  2QVO A;  5D6E A;  4P9F A;  3B02 A;  1XD7 A;  2QLZ A;  1R1U A;  1S8N A;  1RUO A;  2FOK A;  3VFZ A;  3BWG A;  1V3F A;  1S6L A;  3BZ6 A;  4EQQ A;  1LVA A;  3SHF A;  1YQA A;  3E97 A;  3RJP A;  1CF7 B;  2AS5 F;  4YFX F;  3MFK A;  1YLF A;  4MNU A;  4I02 A;  3QPH A;  4A2U A;  4LD5 A;  1PP8 F;  1QPM A;  4IF4 A;  3JSP A;  3L2C A;  5HOO A;  1SAX A;  2NS0 A;  4KMU X;  5A2Q Z;  3FXR A;  5LEK A;  1O57 A;  1QBJ A;  2IJL A;  3WTU C;  3F6O A;  1IN7 A;  4IRH A;  1OMI A;  2QUF A;  1AOY A;  2FNP A;  1BI2 A;  2VE8 A;  4RGR A;  1XDU A;  3VOE A;  4KNY A;  4M9X A;  4Y17 A;  5ERI A;  1A04 A;  5LLQ A;  2IPQ X;  1FOK A;  3QPT A;  3DPL C;  3V8K A;  5K5Q A;  1WRJ A;  1TQP A;  3K1P A;  1RNL A;  2F5C A;  2XKO A;  2EV6 A;  3MCZ A;  3HSR A;  3TQN A;  2V9V A;  2ZME B;  4M71 A;  4UV9 A;  3FMQ A;  4L5I A;  4S05 A;  2X0L A;  3SQN A;  1V4R A;  2KKO A;  2G7U A;  2FEZ A;  4A0Y A;  3WTX C;  1ZLJ A;  2HGC A;  1R1T A;  4L0Y B;  1JHH A;  4BAY A;  2HTS A;  2BGC A;  3RTR A;  5AIQ A;  1PP7 U;  4QWQ A;  1G3T A;  3JSO A;  4HF2 A;  3JAM Z;  2ZNY A;  2A3S A;  4AWX B;  2EFQ A;  3KLO A;  4O6J A;  3J80 Z;  1EH6 A;  2LDU A;  2Y48 A;  3QOP A;  1L3L A;  5LHI A;  5L3C A;  1DPR A;  3ZMT A;  2OQR A;  3LAJ A;  3MQ0 A;  2P7V B;  3WE3 A;  3LA2 A;  1DP7 P;  4A6E A;  1GHC A;  5D8L B;  1J75 A;  2VT2 A;  4OOI A;  4N9H A;  3NEU A;  1IN5 A;  4LFU A;  5D8K B;  3WOD F;  3T8R A;  3WTZ A;  2KJB A;  2MC3 A;  4Y15 A;  1YFH A;  5FLX Z;  1O3T A;  3ULQ B;  3ZQ7 A;  3GO5 A;  1J5Y A;  2ZME A;  2XGX A;  4L5J A;  1TNT A;  1BBY A;  4OIQ F;  2J5P A;  4UVA A;  3JAM K;  1BN5 A;  2ISY A;  3C18 A;  3BRO A;  4LGW A;  3I0T A;  3D5L A;  4RS8 A;  4QLC U;  4HQE A;  3TO7 A;  2E1C A;  2BV6 A;  4L9V A;  1BIA A;  1RI7 A;  2H6B A;  2MH9 A;  4EM2 A;  4KDP A;  5A2Q K;  3BJ6 A;  2ZCW A;  1R7J A;  1HKT A;  2RVC A;  2ZXJ A;  2Z99 A;  3DEU A;  1GXQ A;  4Q5S F;  1LDD A;  2KRF A;  2R3S A;  2DK8 A;  3FXU A;  1T6S A;  2PN6 A;  3Q9S A;  2J5O A;  3KP5 A;  3KP7 A;  1O7L A;  1VTN C;  1FYK A;  4HW0 A;  4I2O A;  1IZ1 A;  2O8X A;  2KIF A;  1KYW A;  2Z9O A;  1Z6T A;  2Y75 A;  4ZYG A;  3I58 A;  4I98 B;  1R22 A;  1HW1 A;  3GXO A;  4A0X A;  3BPV A;  2DAO A;  3H92 A;  4I7H A;  3C1D A;  4OU0 A;  1MGT A;  2H09 A;  2IT0 A;  4KIG A;  3WTV C;  2MD5 A;  2ZJ2 A;  4YFN F;  1H9T A;  4G94 A;  3EQL F;  1W5T A;  1STZ A;  4JBA A;  5CVV A;  3D0S A;  2HQR A;  5F64 A;  1DPU A;  3KET A;  2OA4 A;  3QP6 A;  3IHU A;  5E1X A;  1B9N A;  2JT1 A;  3HRM A;  5D5V B;  1D8J A;  3GFL A;  2XKP A;  1S3J A;  5LRS A;  1YO5 C;  3CLO A;  2IW5 A;  1W7P D;  2P4W A;  2DO7 A;  5BOX A;  2DBB A;  2LF8 A;  2ETH A;  4AIK A;  2QZ8 A;  3DKW A;  5FD5 A;  3ZN0 A;  1J9I A;  1UST A;  3IWZ A;  5DD4 A;  3TOB A;  3E6C C;  3KP2 A;  3ISP A;  2A68 F;  4JK1 X;  4PGG A;  3E6D A;  2DW4 A;  1BI3 A;  2W24 A;  2ESN A;  2FBI A;  4WF2 A;  4EMS A;  5FB2 A;  1XGM A;  2HFH A;  2AXL A;  2XAS A;  5L3F A;  3BJO A;  3SZT A;  2DTR A;  4KA4 A;  1U2W A;  4G9Y A;  3SFZ A;  2OQG A;  1WKM A;  3O2P E;  3ZN1 A;  2HS5 A;  2MA3 A;  1MJB A;  1JGS A;  2DK5 A;  2HQN A;  1D3Y A;  4G6D A;  3BP8 A;  4EJW A;  3J7A O;  4WXH A;  2F5E A;  5ICC A;  4NB5 A;  3I71 A;  1ZRD A;  4I01 A;  2OD5 A;  1Q1H A;  2EK5 A;  3EDP A;  5CVR A;  2PEX A;  2OAZ A;  3O3K A;  4GXO A;  5H20 A;  2IA1 A;  5LEJ A;  4N9I A;  2CQK A;  4HQM A;  4DQ2 A;  4G6Q A;  3IL2 A;  2NNN A;  4AIJ A;  1LEB A;  1G3W A;  3I4P A;  2E1N A;  2COM A;  4U88 A;  2V79 A;  2XRN A;  1R58 A;  5K5O A;  6PAX A;  1B6A A;  1K78 B;  2V1X A;  5KVR A;  4ENJ A;  5BPD A;  4KT5 C;  3W6J B;  2GA2 A;  1KU7 A;  5CYV A;  1FPQ A;  3GUD A;  1ZAR A;  3WGH A;  2VOP A;  1PUE E;  4EGZ A;  4M73 A;  3CUQ A;  3KZZ A;  2LKP A;  1R36 A;  4S04 A;  2A07 F;  2HKO A;  2FML A;  4LK0 F;  4MQ9 F;  4N0B A;  1FY7 A;  2IA2 A;  2JPB A;  5DEQ A;  3KE2 A;  3REO A;  2QWW A;  1K79 A;  4A12 A;  3QRF F;  2JSC A;  2VXZ A;  2QBY A;  4CHU A;  4P5O A;  1I1S A;  4CDG A;  2M30 A;  4M72 A;  3HTU A;  1USS A;  4E70 A;  3KFW X;  1KGS A;  2M5W A;  1G6N A;  4XBF A;  3FHZ A;  4Z2Y A;  1BIB A;  5EEH A;  3IWF A;  4HV5 A;  2V1U A;  2KIU A;  5D5U B;  4LB6 B;  4NQW A;  1P6R A;  4BQA A;  5FD6 A;  3B73 A;  2XAG A;  3FMR A;  3KZY A;  4IHT A;  4Q48 A;  2G9W A;  3T0Y A;  1QZY A;  4P55 A;  4RB0 A;  3BOQ A;  1MDM A;  3O6B B;  1H9G A;  1U5T B;  3WU0 A;  3WTT C;  2LSO A;  4HLX A;  1K78 A;  4IRI A;  3WGG A;  1P2F A;  1LB2 A;  2LNB A;  2NYX A;  5L3B A;  2GXG A;  1HQC A;  3F8B A;  4EGY A;  1RZ4 A;  2UWM A;  3I53 A;  4R1H A;  4ESF A;  1I27 A;  3WGI A;  2Z33 A;  5JHU A;  1S7A A;  2K4J A;  5ED4 A;  3LAP A;  3E5X A;  3QU3 A;  3M8E A;  3CUQ C;  5DCM A;  3HSF A;  2M45 A;  3ECH A;  3H3U A;  3HSE A;  4EJT A;  1XMA A;  2EB7 A;  3VB2 A;  5K5R A;  1OYY A;  4L9J A;  2PMU A;  2A6E F;  3GVA A;  3FMS A;  5ICG A;  1I6X A;  2Y0M A;  2YR2 A;  2OZ6 A;  5J8F A;  3FF5 A;  1FT9 A;  3FWE A;  1QZZ A;  3RDI A;  4IRG A;  5CVI A;  1ZYR F;  2UXX A;  2D2W A;  2QQB A;  2P7C B;  3T1B A;  1U3E M;  3LWF A;  4CZZ A;  5E8G A;  4MGR A;  1IRF A;  5HDK A;  2ADU A;  1ZRF A;  4RB3 C;  2XHK A;  4BYY A;  2L02 A;  2RN7 A;  2L4M A;  1R5H A;  3PFI A;  4CYD A;  3ZMV A;  2R7D A;  4LB5 A;  1P4X A;  5L3G A;  1Z6R A;  1MJA A;  4I09 A;  4BHC A;  4AIH A;  5HLG A;  2VBZ A;  1YG2 A;  2MH2 A;  1O3R A;  5LHG A;  1U5T A;  3MWM A;  1ON2 A;  3ZMU A;  2DPU A;  2DFI A;  4DNC A;  1FSH A;  2G7H A;  4B8X A;  3LQR A;  1K6O A;  1T39 A;  2WTE A;  1OKR A;  3GLX A;  3HOT A;  4EM1 A;  4UNO A;  5AON A;  1MKM A;  2RGV A;  1YIO A;  4KFC A;  1B9M A;  2CYY A;  2OU2 A;  4EJU A;  2FE3 A;  3EET A;  3DXJ F;  3LQQ A;  1XN7 A;  4LLG F;  1YW7 A;  5EEG A;  1S29 A;  1TTY A;  2MBF A;  4RGX A;  3M8F A;  1IRG A;  1F9N A;  3ABU A;  1SD7 A;  3F22 A;  4FX0 A;  5FO5 A;  1T38 A;  3KP6 A;  1FNN A;  2HDC A;  1ZN2 A;  5BQT A;  3I64 A;  4MEX F;  2IRF G;  4HDU A;  2K02 A;  4HOB A;  4TV7 A;  2Q0O A;  1SFU A;  4R8H A;  3C7J A;  1YW9 A;  5FLX K;  4K2E A;  1HXD A;  3KEQ A;  3NQO A;  2QQ9 A;  2K27 A;  4RB1 A;  3GZ5 A;  4KIB A;  5DUK A;  2ESH A;  3GZ6 A;  3ZPL A;  3MAJ A;  2DPD A;  2W84 A;  3DQV C;  2P6T A;  3RIR A;  1W5S A;  3Q5F A;  3GF2 A;  1I1G A;  5DD8 A;  3EYI A;  2VBY A;  1FP2 A;  2Z3Y A;  2WWY A;  1T2K A;  3BY6 A;  4WCG A;  1XCV A;  2PQ8 A;  1HKQ A;  4OIP F;  2XAH A;  2RQP A;  3AAF A;  4OMZ A;  1ON1 A;  1ZG1 A;  1IAW A;  2VBX A;  2PJP A;  1UHM A;  4CO8 A;  2RNJ A;  5IT3 A;  2O0Y A;  2JZY A;  1UHW A;  4IHS A;  4ENM A;  4BHP A;  5LBQ A;  3TKY A;  2OBP A;  4OIR F;  4EVI A;  1RIO H;  3TO9 A;  2QQA A;  3L7W A;  3DPT A;  1WSU A;  4KMF A;  2GWR A;  5CVJ A;  3ELK A;  2VBW A;  1CGP A;  5DDG A;  4HDV A;  4FT8 A;  1WWX A;  1PDN C;  3DFG A;  1XSD A;  3HTS B;  2P5L C;  5HS7 A;  5BPI A;  4ON0 A;  1Z05 A;  2MLK A;  3M7G A;  2D1V A;  2FBK A;  5IT9 Z;  4HX4 A;  2IVM A;  1MDM B;  1KQ9 A;  2P8T A;  3M9A A;  3C3W A;  3R60 A;  1ONV A;  3Q9V A;  3W6K B;  1I5Z A;  4I0A A;  1NHA A;  1FZP B;  3GYH X;  4UHT A;  2P5V A;  2Q2E A;  1OR7 A;  3F3X A;  3K1N A;  1FBQ A;  1SFE A;  5CJ9 A;  4KN4 X;  4ZYE A;  1XSV A;  2BE5 F;  1YYV A;  5E8I A;  3GEZ A;  3K0L A;  2F2E A;  3F8F A;  5L3E A;  2X4H A;  5DCM B;  2GAU A;  3P9I A;  1Z9C A;  1EV7 A;  1EH8 A;  1ZRE A;  2STT A;  1W4M A;  4EM0 B;  1SMT A;  2HOE A;  1ZGJ A;  2BEO A;  3G73 A;  2NRA C;  3LA7 A;  3WTS C;  4ESJ A;  1B59 A;  1TW2 A;  5D5W B;  4WX9 A;  2GA1 A;  1OYW A;  2VON A;  3U9G A;  3H3Z A;  4WWC A;  4EV0 A;  4A0Z A;  1F5T A;  2NAZ A;  2R7F A;  3R61 A;  5BMZ A;  1TLH B;  1SD5 A;  3P9K A;  1K7A A;  2BYV E;  3TGN A;  5HDG A;  2STW A;  1FLI A;  2DT5 A;  2EFN A;  5ILS A;  1O3Q A;  3EUH A;  2A69 F;  2HEO A;  2FXA A;  3ERE D;  2UZK A;  4O3M A;  3BPX A;  2H27 A;  1H0M A;  4R79 A;  1P4W A;  1O7F A;  3L09 A;  1R5G A;  4GGG A;  2ACJ A;  1BC7 C;  1FYL A;  2CG4 A;  3HOS A;  2XAJ A;  4HA8 A;  5CVU A;  2P5K A;  4OIO F;  2L01 A;  3GFM A;  3WTW C;  3WU1 B;  3V8L A;  1O3S A;  4G8X A;  1UCR A;  4XLP F;  5HS8 A;  1KQ8 A;  5E1W A;  3OV8 A;  3CJN A;  4KIF A;  4LK1 F;  4BH9 A;  4HZF A;  5HLH A;  1SD4 A;  2M87 A;  3K9T A;  3GW2 A;  2DQR A;  3T5X A;  1QQI A;  5LGU A;  1KU9 A;  2W25 A;  4LLL A;  2O03 A;  3E5Q A;  3FM5 A;  2Q8K A;  3VEP A;  5F1R A;  3I59 B;  4ZZD A;  2EFO A;  2HWV A;  2UXN A;  4FHT A;  1E2X A;  2VC0 A;  2LF7 A;  1YS6 A;  1Z91 A;  1OYI A;  3QP5 A;  3E6M A;  2YX4 A;  3QU6 A;  3LST A;  1RUN A;  3OOP A;  3MZY A;  3WE2 A;  5K1Y A;  2VC1 A;  1ZRC A;  3TDZ C;  3CO7 C;  5L3D A;  3EYY A;  4YIF A;  4Q4Z F;  1DUX C;  2FMY A;  1IW7 F;  2JTV A;  2XIG A;  4L9N A;  5DV5 A;  1LQ1 A;  1BM9 A;  2QM3 A;  4M9S A;  1IXS B;  1ZHF A;  5ILU A;  1U78 A;  4YII A;  3HRT A;  2EV5 A;  3HRU A;  3ML6 A;  4CXF A;  2BBY A;  1BI1 A;  2KIM A;  4ZYH A;  4BXU A;  2YU3 A;  2C6Y A;  1YS7 A;  2ZFW A;  4XLN F;  2FBH A; 
#chains in the Genus database with same CATH topology
 4CIC A;  1BR2 A;  2PJR A;  3K69 A;  4M6Y A;  2IA0 A;  5E3L A;  3HUG A;  3OYL A;  3PNY A;  3SDG A;  5IP9 J;  1MBG A;  3G2B A;  1KZH A;  3BCA A;  4GO1 A;  1XGN A;  1TWF J;  1G3Y A;  4MFD A;  4D0P A;  4Y3O A;  3U1D A;  3GX4 X;  1FSE A;  1S9H A;  1J59 A;  3G3Z A;  3KYC B;  4DZJ A;  3N4M A;  3GFJ A;  1LJ9 A;  2XF6 A;  3S3O A;  1B1B A;  2ZNZ A;  2WC2 A;  2L4A A;  4DGW B;  2CV0 A;  4UB8 C;  4U0V A;  4ZYA A;  1TC3 C;  4BE1 A;  3WG9 A;  1MW7 A;  4BJ6 C;  2GXB A;  2V9K A;  2HKX A;  1R5I D;  3CES A;  4L9T A;  3ABK H;  3JTH A;  5JR3 A;  4XSZ F;  3MZH A;  1YIJ I;  4IZZ A;  3BDD A;  1LPQ A;  3H36 A;  3HIF A;  1R23 A;  2LVS A;  2JUG A;  2LK2 A;  1JI8 A;  2L2O A;  3K2Z A;  1OFC X;  2CO5 A;  1T0F A;  2VJ5 A;  1KU2 A;  2F5F A;  4LIU A;  4UV8 A;  5KK1 A;  3J81 Z;  3PIP F;  3TOA A;  4PZJ A;  2V6E A;  3K4L A;  3IH4 A;  1OR7 C;  3ZQH A;  1Z67 A;  4OAY A;  1HA8 A;  4RMN A;  4XRS A;  2CSO A;  3R4K A;  3FXM A;  4QSH A;  4X6A J;  1OPC A;  4AYB A;  1JJ6 C;  1OLT A;  5J3L A;  3CCV I;  3F8M A;  3IRR A;  4YG2 F;  3FM3 A;  4HBL A;  4H0E A;  2B0L A;  2W7N A;  1SMY F;  3LFK A;  5E3O A;  2E60 A;  2K86 A;  3ZQI A;  1RKT A;  3IKT A;  3K2A A;  1ULY A;  1QHG A;  2PBI A;  4F52 A;  3AG3 H;  2DOF A;  3DWL E;  4GYI A;  4F3Q A;  2IS2 A;  4ESB A;  4BQO A;  2FU4 A;  2LG4 A;  1OJL A;  1YIT I;  3H0G J;  2RC4 A;  2V6C A;  3L9F A;  3KP4 A;  4PGH A;  5JLX A;  3FXO A;  3F23 A;  3IRQ A;  4GFB A;  3TL4 X;  1FBU A;  2K40 A;  4AC0 A;  5J4V A;  2QEN A;  2CV1 A;  2PMZ A;  3PQJ A;  4IKF A;  2FQ3 A;  4HF0 A;  3FKI J;  2R7T A;  2XV4 S;  3MD2 A;  4XKV A;  2Y31 A;  5EG0 B;  2FRH A;  2DMP A;  1OCT C;  2Y2Z A;  4ZJZ A;  4MQV A;  1LDK B;  1J0R A;  4XRF A;  2HDW A;  2JQ7 A;  3R0A A;  2K85 A;  3F8C A;  2R5Z B;  2X48 A;  5LGT A;  1ZG5 A;  1ETX A;  1IC8 A;  2JA5 J;  4NDL A;  2WY8 Q;  4A3C J;  5HLI A;  1JT6 A;  3DLA A;  2PJR B;  2FUG 2;  2HYG D;  1FMW A;  4NC8 A;  3ZQQ A;  5EF6 A;  1HBX G;  3S1R J;  1QHH D;  1UFM A;  4HV6 A;  3T8T A;  4A69 C;  2P6S A;  1Z21 A;  2VLA A;  3ZP5 A;  3V42 A;  1TL8 A;  5M3F J;  4HAM A;  2E1O A;  3MKW B;  4IHX A;  2VJI A;  4M9Z A;  3SFI A;  4YEL A;  5GAG J;  2HOT A;  3H5R A;  2IEK A;  3G1L A;  4DBQ A;  4LG0 B;  1SEU A;  4BKX A;  1Y8Q B;  2VKH A;  2VPR A;  5GAD J;  5J1Y A;  3IP4 B;  1R00 A;  3WU2 C;  3EUH C;  4CCL A;  5E18 F;  3M8J A;  2NOG A;  2ZO4 A;  2HZT A;  4P9U A;  5EYR A;  3S2D J;  2IGN A;  4HLY A;  3E5U A;  5E79 C;  3RYR A;  1P4A A;  3E6B A;  1XC5 A;  1ENH A;  2VI6 A;  2XRO A;  1Z1D A;  2HYJ A;  2V26 A;  1BOB A;  3ERM A;  2D1H A;  1QO0 D;  2FX0 A;  3ZMZ A;  4BEH B;  2JA8 J;  2WAQ N;  4LG3 A;  3M4O J;  1Y1V J;  2DA1 A;  4HX7 A;  3RI4 A;  3KP3 A;  3PQK A;  2CWE A;  4ASN A;  5E17 F;  1IO2 A;  3MMY B;  1MD0 A;  3J7Y J;  1W7P A;  5E20 A;  1UG2 A;  9ANT A;  2ELH A;  1HW2 A;  4PDK A;  4BBR J;  2Z5U A;  3QAH A;  1Z77 A;  1YJN I;  2CRG A;  2DFE A;  1VI0 A;  1SFO J;  1T98 A;  1D0Y A;  3U2R A;  4IQ4 A;  3GBG A;  5TJJ A;  4ENK A;  4JQF A;  1J2X A;  2JA6 J;  1TNS A;  2KDO A;  1R49 A;  2DJN A;  4M6X A;  4P96 A;  5GAH J;  3DBH B;  5FLV A;  1QA6 A;  2H94 A;  5D4R A;  1FX7 A;  1QU3 A;  1WGX A;  1W7P B;  4BHB A;  4PSX A;  2A6H F;  2X51 A;  2JK3 A;  3K1M A;  3ZMS A;  5F6F A;  1FP1 D;  3OYE A;  3JTG A;  3FXQ A;  3RPU A;  1OIS A;  1G2H A;  3F8N A;  1VZ0 A;  4NBQ A;  2NXN B;  1TZL A;  3CCS I;  4HG2 A;  4ETS A;  2CH0 A;  1LEA A;  4UVC A;  1X1A A;  1T33 A;  1YTY A;  2VOD A;  1JXS A;  4FE4 A;  4WXD A;  4PJM A;  3VSL A;  4Y13 A;  2CFX A;  1DDN A;  3JRD A;  4IX7 A;  4D7N A;  1ZLK A;  4IOC F;  4A6D A;  2DI3 A;  2FSW A;  2PMH A;  2MAB A;  3IC7 A;  2FA5 A;  3CCL I;  3CMY A;  3G71 I;  2KLO A;  2LBF A;  1V55 H;  2ICW G;  2ZFU A;  4HX8 A;  1X1P A;  4U0Y A;  1TW3 A;  5CLS A;  1G4D A;  1ZAO A;  2MYS A;  3FZV A;  2F5D A;  3RPQ A;  4H4K C;  4LLN A;  3KPH A;  4U0W A;  3OSG A;  4G7Z F;  1OCO H;  2CW0 F;  1XGO A;  4A5N A;  1QGP A;  1BI0 A;  5FRO A;  1ETV A;  2K9N A;  2XAQ A;  3HHG A;  4L0Z B;  3TBI A;  1REP C;  2OZU A;  1XB4 A;  2YUS A;  3F0C A;  2L3D A;  1ERD A;  1XS9 A;  2XB0 X;  3OYN A;  4BNC A;  2Z1D A;  1EJ9 A;  4UXN A;  5TRD A;  3HC7 A;  1TQI A;  1AWC A;  2D5V A;  1Y0U A;  4RA2 A;  3OYK A;  4ZDP A;  3SDB A;  3CCE I;  4OMY A;  2B7E A;  2OF7 A;  2K4B A;  5DM6 F;  5KNL A;  1HKS A;  3JRE A;  1F43 A;  1IXR C;  1MIJ A;  4GDF A;  1BJA A;  4FX4 A;  2WV1 A;  4BDY A;  2FJ1 A;  4J01 A;  2Q1Z B;  4A5M A;  3OOU A;  3AKZ A;  1U6G A;  3FKJ A;  3V4G A;  3OY9 A;  1XSX A;  5J47 A;  2EFW A;  1LNW A;  1XTA A;  1IXC A;  2DMU A;  3VYT B;  1R4M B;  2DU9 A;  3CUQ B;  3E1S A;  3BTI A;  2AQE A;  1WJE A;  1Y56 A;  2GIZ A;  2HVR A;  4AUX A;  4MTD A;  2IGO A;  3KEO A;  1JHF A;  1YRN A;  2NS8 A;  5LRR A;  1D5V A;  4IJA A;  2F4I A;  1ODD A;  1AU7 A;  4RAZ A;  4BAC A;  1EA3 A;  2L54 A;  2KIS A;  2CGP A;  3TMO A;  2YX7 A;  2DLL A;  3OL4 A;  3GFI A;  1X1B A;  3B6C A;  3HGG A;  1FYM A;  3IV5 A;  1D0Z A;  4GCV A;  1IUY A;  2V1D A;  3ZGK A;  3CJR B;  1E17 A;  2LMD A;  1BC8 C;  2M2E A;  5J8C A;  5F27 A;  5FGM A;  4XQF A;  4G7H F;  3BTC A;  3MN2 A;  4WXC A;  2E1M B;  3SYT A;  4ABZ A;  1LUJ B;  3CP2 A;  2K7L A;  2HTJ A;  3IAM 2;  1B4A A;  2M3A A;  5JI6 A;  2ZBK A;  2M8E A;  3H9J A;  3QYB A;  4CGZ A;  4KN7 X;  2KPM A;  1P92 A;  4IXA A;  1LDJ A;  2EPF A;  4IL6 C;  3HYI A;  2MLG A;  3N05 A;  2RV8 A;  3P7N A;  1Q1V A;  2PLY A;  1EF4 A;  1SD6 A;  3KYD B;  1G3S A;  1TBX A;  2W85 A;  3TDU C;  1TWA J;  5DCF A;  2L7F P;  3FX3 A;  1JE8 A;  3OIO A;  3RQI A;  1JKQ C;  1XMK A;  3A0H C;  2CU7 A;  4RM2 A;  2GQQ A;  5J6X A;  2LOO A;  5HS9 A;  3KX2 A;  4D9J A;  4HNT A;  2DDB A;  5FFZ A;  5TIS C;  1MJ9 A;  1MMD A;  1Y8R B;  2LYC A;  4CUG A;  4KT6 A;  1NTC A;  1SFX A;  4G12 A;  3RKW A;  2R4G A;  2L9S A;  4AVP A;  1WI9 A;  3DV8 A;  3V8J A;  1W36 D;  3MKZ A;  4KIS A;  4GRI A;  2LLK A;  3SZG A;  4RAY A;  2L7K A;  4UUV A;  2O7O A;  4CYC B;  2XDV A;  2B9S A;  3J7Z I;  2RDP A;  1BL0 A;  5H6Q A;  4I0B A;  3A01 A;  4J19 A;  1BOA A;  3RSN A;  4IVN A;  3RKX A;  3VPR A;  3S3M A;  2NVX J;  5GAE J;  3KLN A;  2BHY A;  3BR1 A;  1CF7 A;  2QBY B;  1BJZ A;  1TT0 A;  1GV5 A;  2V9P A;  3A0B C;  3GWZ A;  4BE2 A;  1S72 I;  3OYH A;  4Q47 A;  1IN6 A;  3RKQ A;  3L2Q A;  2F5V A;  2HYF A;  3CZ6 A;  4RGU A;  1MZB A;  4RGS A;  4XKW A;  4O5V A;  4U7B A;  3EUA A;  2M0M A;  2VN2 A;  2A5Y B;  2FD5 A;  4ZYD A;  4MEY F;  2O61 A;  5ICE A;  2EBI A;  4IPA A;  2XF7 A;  2TCT A;  2QYO A;  2ELJ A;  2ID6 A;  5LGN A;  3H5A A;  3N97 A;  2XPW A;  3C2G A;  1X2N A;  5IT9 K;  5H6R A;  3DTE A;  2JMW A;  3HG9 A;  3NRV A;  5AIP A;  1ZG3 A;  3MKL A;  2ZXI A;  4BGD A;  2O3F A;  3BG5 A;  1I50 J;  2ZXW H;  3TED A;  3P5J A;  2XGC A;  1D8K A;  3I9V 2;  5D5X B;  4L18 B;  4MTE A;  4AM3 A;  2VKV A;  2VIX A;  2VOO A;  1KQ0 A;  3J7A Y;  2ELK A;  2E7X A;  2EIM H;  2KRH A;  2PFB A;  1P7I A;  3BC8 A;  1S7O A;  2EH3 A;  3D5R C;  1H8A C;  1QNT A;  1YI2 I;  2MC4 A;  4XSX F;  3S14 J;  3P9C A;  2PG4 A;  1KU3 A;  2DMQ A;  1O4X A;  1GXP A;  4QPQ A;  3L00 A;  3FIW A;  2FF4 A;  1XGS A;  1EH7 A;  2KMU A;  5D6F A;  3S2H J;  1GVJ A;  2QGU A;  4IQJ A;  3DP7 A;  3RPU D;  3MKY B;  2VE9 A;  2R0Q C;  1IN8 A;  2ISZ A;  1C0W A;  2O6G E;  2ZKZ A;  1F1Z A;  4LIT A;  1ZGA A;  1Z3X A;  5ILV A;  3OS2 A;  2M1B A;  3IKV A;  3K4N A;  2R7V A;  2CJJ A;  4C30 A;  4M74 A;  3CCQ I;  2E5Z A;  4LMY A;  3ZOB A;  1JTX A;  1XX5 A;  3S8P A;  4BL0 B;  4N4N B;  2F4O B;  4NHJ A;  3LMM A;  4WK8 F;  2NNY A;  1U8R A;  2YU9 J;  2JN6 A;  4CCO A;  4BY7 J;  3JRB A;  4EJO A;  3ABT A;  1BW5 A;  3F21 A;  2DQL A;  2JVH A;  2NVU B;  1TQM A;  2WA0 A;  3CDH A;  1XCB A;  4E6K G;  3R6S A;  2EWN A;  5DYM A;  4A3L J;  1Z7L A;  5HVQ C;  4U7D A;  2WV0 A;  3GTM J;  1RC9 A;  2H1L A;  3BR5 A;  1FWZ A;  2LH9 A;  1X2M A;  2TDX A;  2EA2 A;  4A3K J;  2FQ4 A;  2YSR A;  3RYP A;  2XVC A;  5K7Z A;  3BR6 A;  2BVL A;  2D45 A;  2KT0 A;  5HDN A;  2V4J C;  4BU2 A;  2QA4 I;  1VND A;  1JT0 A;  2VT3 A;  1ZEL A;  4F7Z A;  2DA5 A;  1R71 A;  5LHH A;  4JP0 A;  3CO6 C;  4E4H A;  2R7U A;  3HOV J;  2E2I J;  2EZL A;  4OIN F;  2RKH A;  3I59 A;  2CW8 A;  3PM1 A;  3V7S A;  3F72 A;  5E3N A;  2K9Q A;  4LJZ F;  1SVM A;  2VQG A;  2JPC A;  3E3V A;  4B09 A;  4YFK F;  2IP2 A;  5DUI A;  3CDL A;  3L2V A;  4ZH4 F;  2E7W A;  5E1Z B;  4BY1 J;  2HPI A;  1X3U A;  2X6X A;  3SXY A;  3BJA A;  3S93 A;  3TO6 A;  4ZZL A;  3SZP A;  3S16 J;  1HST A;  1A6I A;  2LY9 A;  5DTD A;  3DF8 A;  2ZXH A;  5H2F C;  3OSF A;  2BY3 A;  4KYW A;  1WJD A;  1VQP I;  1HW5 A;  3KCC A;  4HYE A;  4QPO A;  1J7K A;  5BS6 A;  1R1V A;  3CCM I;  2DOD A;  4G7O F;  1P9Q C;  1MBE A;  3HHH A;  1VQ6 I;  2NOJ B;  2F48 A;  4XLE A;  3ROU A;  1VQN I;  5EGO B;  3V7R A;  3K4B A;  2CUJ A;  1HSJ A;  5FFX A;  3S1N J;  3GTQ J;  1I6H J;  3X2Q H;  2G0E A;  3HKZ N;  2KIQ A;  2EJR A;  1IGN A;  3I54 A;  2RAE A;  5IYC J;  3ZQL A;  3WTY C;  2DMN A;  5ICF A;  2XUB A;  1U5T C;  3VOD A;  2WAF A;  3I5U A;  3OYF A;  2GIV A;  4MHG A;  3M1E A;  1YW8 A;  3QOD A;  1R4N B;  5JVT A;  2GZW A;  2DA4 A;  1UB9 A;  2Z2S B;  2IS4 A;  3QYE A;  3J81 K;  5EGO A;  3RKY A;  2GBY A;  1YOV B;  3ZMD A;  2W48 A;  1DP3 A;  1FOY A;  4KUM A;  1FIP A;  4UB6 C;  3NAU A;  3HRS A;  1KYZ A;  4YRV A;  4HF1 A;  2H6C A;  1ZH5 A;  2A61 A;  1DQU A;  4RB2 C;  3F6V A;  5JFR A;  2HVQ A;  1WQ2 A;  1RR7 A;  1IDY A;  2BVM A;  1IF1 A;  5LFA A;  3DCF A;  3CTA A;  3J80 K;  4ENN A;  1FBS A;  1W1W E;  1IN4 A;  2EV0 A;  1KA8 A;  1FEX A;  4FTH A;  4GYG A;  4IHW A;  1XDS A;  2EFP A;  4OWR B;  3G6E I;  3FBN B;  1L0O C;  3PSF A;  3ECO A;  3GME A;  2ZJQ F;  2Q2E B;  3R0J A;  4AYB N;  4J00 A;  3S2W A;  4UVB A;  5D4S A;  2LR8 A;  4PCQ A;  2FNA A;  1FC3 A;  4EJV A;  2HR3 A;  3CUO A;  2GM4 A;  3LSP A;  4KIC A;  2XF5 A;  2EA4 A;  4RAF A;  3H1C A;  2JRT A;  4ITV A;  1JGG A;  3MEX A;  1Z7U A;  4PFO A;  3SEZ A;  2W57 A;  2AO9 A;  3V7C A;  3CC7 I;  2PI0 A;  4DBR A;  3OYB A;  3COA C;  2BZT A;  1XMX A;  2LY2 A;  3UR3 C;  3OYD A;  1CQT A;  1F4K A;  1WH7 A;  4AD9 A;  2KJC A;  4B48 A;  4CA0 A;  4LG0 A;  3A2K A;  1W5C C;  3OWT A;  5FKK A;  2HXO A;  2YPR A;  2XAF A;  3ZQC A;  2NVY J;  3HGY A;  4NC6 A;  2ZC2 A;  1VQ7 I;  2IXS A;  3JW4 A;  1ZR2 A;  4CCM A;  3W2V A;  3LA3 A;  1A6Q A;  2E5N A;  2QVO A;  4E7K A;  5D6E A;  4P9F A;  3B02 A;  1XD7 A;  2LRE A;  4B3A A;  2QLZ A;  1R1U A;  1S8N A;  1RUO A;  2JA2 A;  1LKX A;  1ACI A;  1X4O A;  4MLO A;  2FOK A;  3VFZ A;  4M3D A;  1LFU P;  4QTR A;  3BWG A;  3TW7 A;  1V3F A;  2VJ4 A;  4MFE A;  1QVU A;  1S6L A;  1FMV A;  1ETO A;  2M7A A;  3BZ6 A;  3K6G A;  4EQQ A;  1LVA A;  3SHF A;  4FCY A;  2EIL H;  2FOW A;  5EZH A;  1YQA A;  1WPK A;  3E97 A;  3RJP A;  2OPT A;  4BUP A;  4XKC A;  1CF7 B;  2AS5 F;  1ORK A;  3GLL A;  3I56 I;  4YFX F;  1PYV A;  1JKO C;  4DYQ A;  3MFK A;  4XM3 A;  1YLF A;  4MNU A;  4NC7 A;  4I02 A;  3QPH A;  2X1E A;  2WAD A;  4A2U A;  3LSK A;  4LD5 A;  1PP8 F;  1QPM A;  3AL0 B;  4XLA A;  4IF4 A;  3CC2 I;  4DOZ A;  3JSP A;  1HDP A;  3L2C A;  1U8B A;  3KZI C;  2A05 A;  5HOO A;  1SAX A;  2JWT A;  2NS0 A;  4PK4 A;  3DTI A;  4XID A;  4KMU X;  1DU6 A;  5A2Q Z;  3FXR A;  3OIQ A;  5LEK A;  1O57 A;  1QBJ A;  2IJL A;  3WTU C;  1W36 C;  3F6O A;  1IN7 A;  2CQQ A;  4IRH A;  3PSI A;  2CQN A;  3DLL F;  1OMI A;  3PJR A;  2UUZ A;  3OS1 A;  2QUF A;  1AOY A;  4B1R A;  2FNP A;  1BI2 A;  1MND A;  2VE8 A;  3GCM A;  4RGR A;  1XDU A;  3VOE A;  1QRY A;  2DOA A;  4JOM A;  1W0U A;  4KNY A;  4M9X A;  3ZQG A;  1LE8 A;  4M6V A;  1B72 A;  4Y17 A;  5DS9 A;  1WJA A;  2XAU A;  5ERI A;  1A04 A;  1DGR M;  3OYC A;  4UUS A;  5LLQ A;  5EJC A;  3LSR A;  2IPQ X;  1JUP A;  3A02 A;  1FOK A;  2B63 J;  3QPT A;  4RM3 A;  3GZN B;  3DPL C;  3V8K A;  5K5Q A;  4X0G A;  1WRJ A;  1TQP A;  2JSP A;  3K1P A;  3VYS B;  4EEF G;  1RNL A;  2F5C A;  2XKO A;  2EV6 A;  3MCZ A;  3TP3 A;  2EIK H;  4BDZ A;  3HSR A;  4RDU A;  3TQN A;  2V9V A;  2ZME B;  4M71 A;  4JX6 A;  4UV9 A;  3FMQ A;  2L5Q A;  5KAF C;  3JRG A;  4L5I A;  4S05 A;  1JKR C;  3DPU A;  2X0L A;  4Y7N J;  2N8G A;  5F0F A;  3SQN A;  1A36 A;  1V4R A;  2KKO A;  2G7U A;  1FOX A;  2FEZ A;  1TWH J;  2L0K A;  4A0Y A;  3WTX C;  2R7Q A;  1ZLJ A;  2HGC A;  1M1E B;  1R1T A;  4X1E A;  5CPR B;  1APL C;  4L0Y B;  3FIS A;  1JHH A;  4BAY A;  1HOM A;  2HTS A;  2BGC A;  3ONQ A;  4HST A;  3FXK A;  3RTR A;  5AIQ A;  1SAN A;  3CMM A;  3FDY A;  1PP7 U;  2JUC A;  4QWQ A;  4E7J A;  4F55 A;  4IO9 F;  1G3T A;  5K7F A;  3JSO A;  1ZQ3 P;  4HF2 A;  3JAM Z;  2ZNY A;  2A3S A;  1HDD C;  2I5U A;  4LOC A;  4AWX B;  2EFQ A;  3M3Y J;  3KLO A;  4O6J A;  3J80 Z;  1EH6 A;  2L9V A;  2LDU A;  5IOY A;  2Y48 A;  3QOP A;  4BS9 A;  3PIO F;  2DN0 A;  2O9L A;  1L3L A;  5LHI A;  5L3C A;  1DPR A;  2LRD A;  2OQR A;  3BQZ A;  3ZMT A;  3LAJ A;  3MQ0 A;  2P7V B;  2DT6 A;  3IUO A;  1E3P A;  2KZG A;  3WE3 A;  4D1Q A;  3LA2 A;  1DP7 P;  4A6E A;  3HOY J;  1GHC A;  4A3I J;  3EPZ A;  5D8L B;  4OOI A;  2VT2 A;  2LKS A;  1J75 A;  5FRM A;  2OV7 A;  3VWB A;  4IOA F;  3U1K A;  3G1M A;  1TP4 A;  5M5X J;  4N9H A;  4XR6 A;  3NEU A;  2OCC H;  4XLC A;  3H3V K;  1IN5 A;  2AQF A;  2M8G X;  4LFU A;  3BG3 A;  3RCO A;  3QPS A;  5D8K B;  3CCY A;  4G6T B;  3WOD F;  1MNM C;  1TWG J;  5EEA A;  5FJ8 J;  2YS9 A;  3T8R A;  3DU5 A;  3WTZ A;  4PJJ A;  1NG7 A;  2CS3 A;  5M5Y J;  2A5W A;  2KJB A;  3S1M J;  2MC3 A;  4Y15 A;  1YFH A;  3DU6 A;  5FLX Z;  1O3T A;  1R6R A;  2EZH A;  3JRF A;  3ULQ B;  4A93 J;  3H35 A;  3ZQ7 A;  3GO5 A;  1J5Y A;  2ZME A;  4XON A;  2XGX A;  3PL8 A;  4XNF A;  4JX5 A;  2QEX I;  3PNV A;  4ANJ A;  4L5J A;  2XB5 A;  1TNT A;  1BBY A;  1Z0X A;  4F91 B;  4OIQ F;  2J5P A;  3CQZ J;  4UVA A;  3JAM K;  1GDT A;  1BN5 A;  1ZK8 A;  4F93 B;  3C18 A;  2ISY A;  2K9S A;  1WFX A;  3BRO A;  4XLF A;  1ZR4 A;  2DOE A;  4LGW A;  3I0T A;  1WZ2 A;  3CCR I;  3D5L A;  3HOU J;  2Y69 H;  3BTL A;  4RS8 A;  4BXX J;  4QLC U;  4HQE A;  1MH3 A;  4B44 A;  3TO7 A;  2E1C A;  4BJT A;  1GUU A;  3A1Y A;  2VQC A;  1FOW A;  3ESW B;  1VF9 A;  2BV6 A;  2ZJP F;  4L9V A;  1JJ8 C;  1BIA A;  1RI7 A;  3LSM A;  2H6B A;  4EAT A;  2MH9 A;  2BY0 A;  2E71 A;  4C9Y A;  3W2W A;  2X1D A;  4EM2 A;  2DA3 A;  4AID A;  4KDP A;  5A2Q K;  3BJ6 A;  2ZCW A;  1R7J A;  1HKT A;  2RVC A;  2ZXJ A;  2Z99 A;  3I4N J;  3DEU A;  1GXQ A;  4Q5S F;  1LDD A;  2KRF A;  5IP6 A;  2JA7 J;  3ZXS A;  5C4X J;  5GP9 A;  2W4S A;  2XGD A;  2Y0S A;  3NWT A;  2R3S A;  2DK8 A;  2IGM A;  3FXU A;  1T6S A;  1IRZ A;  2PN6 A;  1MBJ A;  2W82 A;  4V2F A;  3Q9S A;  2J5O A;  3KP5 A;  2O8K A;  3KP7 A;  3LSG A;  1O7L A;  3QWL A;  1VTN C;  3GTP J;  1MMN A;  1MBF A;  1FYK A;  4HW0 A;  3OYI A;  4I2O A;  1VFC A;  1PUF B;  2ZSH B;  3A4C A;  1OCP A;  1IZ1 A;  3BG6 A;  3O8G A;  4CCN A;  3C2H A;  2O8X A;  1YX5 A;  4BJ5 C;  1QZE A;  3I55 I;  2KIF A;  1KYW A;  2QQ8 A;  5B3S H;  3GTL J;  2GOM A;  2Z9O A;  1Z6T A;  2Y75 A;  1NH3 A;  4ZYG A;  3I58 A;  3JRA A;  4I98 B;  1R22 A;  1HW1 A;  3GXO A;  4A0X A;  3BPV A;  3GTG J;  2DAO A;  3DBR B;  3H92 A;  4I7H A;  2MG4 A;  3C1D A;  5EG0 A;  5HNF A;  4IHV A;  1KON A;  4OU0 A;  4B4C A;  4UY8 I;  1MGT A;  2H09 A;  3DKY A;  3L2W A;  2IT0 A;  2IGK A;  1VQ8 I;  5EZG A;  4KIG A;  3WTV C;  2MD5 A;  2EZI A;  4W97 A;  4C2T A;  3G1O A;  2ZJ2 A;  5F04 A;  2L9R A;  2MGQ A;  1FTZ A;  4YFN F;  1H9T A;  4G94 A;  2H1K A;  3EQL F;  1W5T A;  1STZ A;  4JBA A;  5CVV A;  4LIV A;  1VQO I;  5M3M J;  3D0S A;  3JRC A;  1BW6 A;  2HQR A;  3AFH A;  5F64 A;  2R5Y B;  1DPU A;  3AG4 H;  3KET A;  1WVR A;  2OA4 A;  3QP6 A;  2R7S A;  2Y9Z A;  4N4O B;  2AHQ A;  3IHU A;  2RQQ A;  5E1X A;  3TW6 A;  2OC6 A;  3Q0V A;  3HUG B;  3HOZ J;  1B9N A;  1UG0 A;  2Y9Y A;  2JT1 A;  2R7X A;  3HRM A;  1WJC A;  5D5V B;  1D8J A;  4E7I A;  3B6A A;  5GPA A;  3GFL A;  5KAI C;  2XKP A;  1S3J A;  5LRS A;  2ME0 A;  3PNT A;  1YO5 C;  3CLO A;  5GPC A;  2IW5 A;  1W7P D;  2P4W A;  2DO7 A;  1MH4 A;  2V1N A;  2DBB A;  2LF8 A;  5BOX A;  2ETH A;  4AIK A;  1K6Y A;  2X1C A;  2QZ8 A;  3DKW A;  5FD5 A;  3ZN0 A;  1J9I A;  3CC4 I;  3S17 J;  2F4M B;  3ASO H;  1UST A;  3IWZ A;  5DD4 A;  3QYF A;  3TOB A;  3KP2 A;  2W00 A;  3E6C C;  3ISP A;  4L5E A;  1ETW A;  2A68 F;  4JK1 X;  4PGG A;  3E6D A;  5F0H A;  4XN0 A;  2DJI A;  3FK7 A;  2VXD A;  2DW4 A;  1BI3 A;  2W24 A;  1S5L C;  2ESN A;  2FBI A;  4WF2 A;  4EMS A;  3DKX A;  5FB2 A;  1XGM A;  2HI3 A;  3HEF A;  2HFH A;  2AXL A;  2XAS A;  3BZK A;  3BJO A;  5L3F A;  1RES A;  2IS6 A;  3SZT A;  3NWS A;  2DTR A;  4KA4 A;  1GV2 A;  1UAA A;  1U2W A;  2CFO A;  4G9Y A;  5C4J J;  2R7W A;  3SFZ A;  3HKZ A;  4HNU A;  2OQG A;  1WKM A;  3FK6 A;  3K7A J;  3O2P E;  5IYB J;  3CMA I;  3CD6 I;  1MBK A;  3ZN1 A;  2HS5 A;  2MA3 A;  3BQY A;  3QPL A;  5IY5 H;  3PUF A;  2IBD A;  3C2B A;  3L1P A;  1MJB A;  1TWC J;  1JGS A;  2DK5 A;  2HQN A;  3WHB A;  1FJL A;  1D3Y A;  4G6D A;  4RLQ A;  1WHU A;  3BP8 A;  4EJW A;  3J7A O;  4WXH A;  3ZQF A;  2F5E A;  5ICC A;  1Y39 A;  4NB5 A;  3I71 A;  1ZRD A;  4D5C A;  4I01 A;  1JKP C;  4HSR A;  2OD5 A;  2M7B A;  1Q1H A;  2EK5 A;  3EDP A;  2ZJR F;  3PO3 J;  2WB1 N;  2WAE A;  1MMA A;  5CVR A;  2X6W A;  2PEX A;  2R7Z J;  2OAZ A;  3O3K A;  4GXO A;  5H20 A;  2IA1 A;  2R5Y A;  5LEJ A;  5IPA A;  2KZV A;  1SVL A;  4YIR X;  5CQE A;  4N9I A;  2CQK A;  1BA5 A;  4HQM A;  4ZDL A;  5F0C A;  4DQ2 A;  4DJA A;  4I99 C;  5J40 A;  1V5G A;  4Y4R A;  4G6Q A;  2CUZ A;  4XOP A;  4S0H B;  3IL2 A;  3MVP A;  3OMY A;  2NNN A;  4AIJ A;  1LEB A;  4C2M J;  1G3W A;  3I4P A;  3PUB A;  2E19 A;  1SC7 A;  2E1N A;  3BZC A;  2COM A;  4U88 A;  1YHQ I;  2OTL I;  2V79 A;  2XRN A;  1U9N A;  1R58 A;  5K5O A;  6PAX A;  2EQR A;  1B6A A;  1K78 B;  2V1X A;  1GVD A;  5KVR A;  4ENJ A;  1JUS A;  1LFP A;  2HDD A;  5BPD A;  2NS7 A;  1MMG A;  4KT5 C;  3W6J B;  2GA2 A;  4CSW A;  1KU7 A;  5CYV A;  1FPQ A;  3GUD A;  2CUF A;  1E3O C;  3HOX J;  1X4P A;  2V7F A;  2X9D A;  1ZAR A;  3RQ4 A;  3WGH A;  2P0W A;  2VOP A;  3JCU C;  4F92 B;  2DDA A;  1PUE E;  4EGZ A;  1RKW A;  4M73 A;  3CUQ A;  3FHN A;  3KZZ A;  2LKP A;  1R36 A;  4DYC A;  4S04 A;  1X3W B;  3OR2 C;  2A07 F;  2HKO A;  1ETQ A;  4XOR A;  2FML A;  4LK0 F;  4MQ9 F;  5J1R A;  2H8R A;  3H9Q A;  4N0B A;  1FY7 A;  5FKO A;  2IA2 A;  3MZ8 A;  1UEL B;  2JPB A;  5DEQ A;  3KE2 A;  1WCM J;  4DW6 A;  4ZTJ A;  4U87 A;  3REO A;  2QWW A;  1K79 A;  3SJM A;  2QF7 A;  1D1C A;  4A12 A;  3QRF F;  2JSC A;  2VXZ A;  4I76 A;  2QBY A;  4CHU A;  4P5O A;  1V5F A;  4PJL A;  1I1S A;  4CDG A;  3Q3S A;  2M30 A;  2Y30 A;  4M72 A;  3HTU A;  1USS A;  1WI3 A;  4E70 A;  3KFW X;  4KIT B;  1KGS A;  1U9O A;  1VQ5 I;  1MMS A;  3ASN H;  2BXZ A;  4D5F A;  1YX3 A;  2M5W A;  1G6N A;  1E3H A;  4XBF A;  3W3C A;  4DZP A;  3FHZ A;  3K10 A;  4PSW A;  1BIB A;  4Z2Y A;  5EEH A;  3BLY A;  3IWF A;  4HV5 A;  4W1U A;  1JUM A;  1OCZ H;  2V1U A;  4A3G J;  2KIU A;  5F08 A;  2BHZ A;  5D5U B;  2ZME C;  3A03 A;  4DYR A;  4LB6 B;  1FTT A;  5TGT A;  3OYJ A;  1H88 C;  5LD2 C;  2TRT A;  4NQW A;  5GTH C;  1P6R A;  4A3F J;  1I3Q J;  4BQA A;  5FD6 A;  1HF0 A;  3B73 A;  2XAG A;  3FMR A;  3KZY A;  4IHT A;  2E1M C;  2DFF A;  4Q48 A;  2G9W A;  3T0Y A;  1QZY A;  4PUS A;  1UZC A;  4P55 A;  4RB0 A;  3BOQ A;  1UJ8 A;  1MDM A;  1IUF A;  3O6B B;  1H9G A;  1BR4 A;  1MBH A;  2OUM A;  1U5T B;  2COB A;  4E7H A;  3WU0 A;  3WTT C;  2QSF X;  2DMT A;  2LSO A;  3ZCO A;  3BCB A;  4HLX A;  3ZRG A;  1K78 A;  4B43 A;  4IRI A;  4A3B J;  1PUF A;  3WGG A;  1P2F A;  4QIW N;  2XPV A;  1LB2 A;  2LNB A;  1LE8 B;  2NYX A;  5L3B A;  2GXG A;  2VUM J;  1HQC A;  4FIS A;  3F8B A;  4PJ0 C;  4EGY A;  1B72 B;  1RZ4 A;  2H8W A;  2UWM A;  3I53 A;  1VQL I;  4R1H A;  4HEA 2;  4CCJ A;  1I27 A;  4ESF A;  3K4M A;  2VAS A;  4BE0 A;  4UUS B;  1N75 A;  3WGI A;  5CQG A;  2DFH A;  2Z33 A;  3E0J B;  2HQA A;  5JHU A;  3LNQ A;  1S7A A;  3GTK J;  2K3P A;  2K4J A;  3KEY A;  5ED4 A;  3E5X A;  3LAP A;  3QU3 A;  3M8E A;  5FKN A;  2CMP A;  3CUQ C;  5DCM A;  3HSF A;  4YEJ A;  2M45 A;  3ECH A;  3H3U A;  4BBS J;  1ITY A;  2Z16 A;  3HSE A;  1X3Z B;  1FIA A;  4EJT A;  3WG7 H;  1E0E A;  2VQH A;  1XMA A;  2EB7 A;  2E2H J;  5C44 J;  3VB2 A;  1YJW I;  3PO2 J;  5K7H A;  2BW3 A;  5K5R A;  1OYY A;  4L9J A;  3LFU A;  5B1B H;  2PMU A;  2A6E F;  3GVA A;  3FMS A;  1X1D A;  1I6X A;  5ICG A;  1RR8 C;  2IS1 A;  2Y0M A;  2YR2 A;  2K3F A;  2OZ6 A;  5J8F A;  3FF5 A;  3VYU B;  2MW8 A;  1FT9 A;  3CCU I;  1AA7 A;  3FWE A;  1QZZ A;  1SFK A;  3RDI A;  4IRG A;  4CH7 A;  3PFY A;  5CVI A;  5B66 C;  2KDZ A;  1ZYR F;  3HL2 A;  2R5Z A;  4NUB A;  2VPL A;  3S32 A;  2UXX A;  3BG9 A;  2I8D A;  1YJ9 I;  2D2W A;  2QQB A;  2P7C B;  1AHD P;  1X58 A;  3T1B A;  1U3E M;  2R93 J;  3LWF A;  4CZZ A;  2M4G A;  5E8G A;  2KFD A;  3QOE A;  4MGR A;  1IRF A;  5HDK A;  4HRI A;  2ADU A;  1ZRF A;  4RB3 C;  2XHK A;  4BYY A;  2L02 A;  2RN7 A;  3U21 A;  2L4M A;  3LSJ A;  2JRM A;  3HB9 A;  4NNJ A;  1R5H A;  3PFI A;  2BY1 A;  1WJ5 A;  2E2J J;  2DXI A;  4CYD A;  3ZMV A;  1ETK A;  1T56 A;  2R7D A;  3OIP A;  4LB5 A;  4CCK A;  3HM5 A;  1P4X A;  5L3G A;  2R92 J;  1Z6R A;  1MJA A;  3K4J A;  4I09 A;  4Y52 J;  4BHC A;  4A3E J;  3CF2 A;  3H9G A;  4AIH A;  5HLG A;  2VBZ A;  1YG2 A;  4A3D J;  2MH2 A;  2QSG X;  1O3R A;  1VQK I;  3ABM H;  4BQN A;  1ZTR A;  4MO7 A;  3SEQ A;  5LHG A;  1U5T A;  1V5E A;  2WY7 Q;  3MWM A;  1ON2 A;  3K4K A;  3ZMU A;  4C3I J;  2DPU A;  2DFI A;  1IDZ A;  1WJB A;  3DTK A;  4DNC A;  5EDN A;  1FSH A;  2VQL A;  3VDX A;  4XRS G;  2G7H A;  4B8X A;  2L7M P;  2QCO A;  3LQR A;  1K6O A;  3RZD J;  1G59 A;  1T39 A;  1RRJ A;  1N78 A;  5HNH A;  2WTE A;  1OKR A;  4RLF A;  3GLX A;  2KL4 A;  2W1O A;  3HOT A;  3OL3 A;  4EM1 A;  4UNO A;  1RET A;  2M0C A;  2OTJ I;  3S3N A;  5AON A;  1MKM A;  2DA2 A;  1NG6 A;  2RGV A;  5DM7 F;  3L2U A;  1HCR A;  1YIO A;  4KFC A;  1B9M A;  2CYY A;  2OU2 A;  4EJU A;  4XMY A;  2HZD A;  2FE3 A;  4E7L A;  1OQY A;  3KIO A;  3Q0W A;  2Y0S N;  3DXJ F;  3EET A;  3LQQ A;  1XN7 A;  2XGE A;  4LLG F;  4E7S A;  1YW7 A;  5EEG A;  1S29 A;  5FLM J;  1TTY A;  2MBF A;  4RGX A;  3A01 B;  3D1N I;  3M8F A;  1IRG A;  1F9N A;  3K70 D;  1QPI A;  2BOL A;  3ABU A;  1SD7 A;  3HZJ A;  3F22 A;  4FX0 A;  5FO5 A;  1T38 A;  2DA7 A;  4XN3 A;  3KP6 A;  1FNN A;  2BXY A;  2HDC A;  2ZB9 A;  5B5E C;  2R7O A;  1ZN2 A;  3QQA A;  5BQT A;  2JVG A;  4C3J J;  3I64 A;  2EZK A;  4MEX F;  2IRF G;  1F36 A;  1Y0N A;  4PFP A;  1IRX A;  4HDU A;  2K02 A;  2EIJ H;  4HOB A;  4TV7 A;  2GXA A;  2CUE A;  5KCM A;  2Q0O A;  2VB6 A;  1SFU A;  4R8H A;  2JJ7 A;  4JYK A;  3C7J A;  1YW9 A;  4CZC A;  5FLX K;  4K2E A;  4IHY A;  4AVZ A;  1T08 B;  4RBO A;  3JR9 A;  1HXD A;  1U0J A;  3KEQ A;  3NQO A;  5FKL A;  2CV2 A;  2LC2 A;  4BXF A;  2QQ9 A;  2K27 A;  3LL7 A;  4E7Z A;  4RB1 A;  3EUK L;  1LVK A;  3BG7 A;  3GZ5 A;  4KIB A;  3FXJ A;  5DUK A;  2ESH A;  2I10 A;  4ZC3 A;  3GZ6 A;  3ZPL A;  2DT7 B;  2HNH A;  2XPU A;  3MAJ A;  2DPD A;  4FQG A;  2W84 A;  3LOC A;  3DQV C;  3IAS 2;  2P6T A;  2CQX A;  3BR0 A;  3RIR A;  1W5S A;  2BY2 A;  3Q5F A;  1A5J A;  5F1J A;  3GF2 A;  1I1G A;  5DD8 A;  3EYI A;  2VBY A;  4XKB A;  2K9M A;  1FP2 A;  2Z3Y A;  2WWY A;  4JX4 A;  4Z6Y A;  1T2K A;  3BY6 A;  4WCG A;  1XCV A;  3G4S I;  2PQ8 A;  1HKQ A;  3H5N A;  4OIP F;  2XAH A;  2P81 A;  1POG A;  1B8I B;  2RQP A;  3DBL B;  4ZDO A;  3AAF A;  4OMZ A;  2X6O A;  3WHC A;  1ON1 A;  1ZG1 A;  2CW7 A;  1IAW A;  2LKX A;  1T0F C;  2VBX A;  2LTP A;  2PJP A;  1UHM A;  3S15 J;  4CO8 A;  3BTJ A;  1J09 A;  2RNJ A;  5IT3 A;  2O0Y A;  2JZY A;  1UHW A;  1P7J A;  4IHS A;  1N25 A;  4ENM A;  3IH2 A;  4BHP A;  5LBQ A;  3TKY A;  2OBP A;  5CKT A;  4OIR F;  4EVI A;  3H0D A;  3TO9 A;  1RIO H;  2QQA A;  2X85 A;  3L7W A;  1ZKG A;  1VQM I;  3DPT A;  1WSU A;  4KMF A;  3CDI A;  3M1C A;  2GWR A;  5CVJ A;  3ELK A;  4PJN A;  3AL0 C;  3OYM A;  2HPM A;  2VBW A;  2LD5 A;  4MIM A;  2E34 A;  1CGP A;  1SVO A;  4XOT A;  1GLN A;  5DDG A;  4HDV A;  4FT8 A;  1S7E A;  1BR1 A;  2RRE A;  1WWX A;  3CJT B;  1GT0 C;  3BR2 A;  1PDN C;  3DFG A;  1XSD A;  3HTS B;  1G8X A;  2P5L C;  4A3M J;  1V54 H;  3CCJ I;  1D5Y A;  3CJQ B;  1JTY A;  5HS7 A;  5BPI A;  4BQQ A;  4ON0 A;  1Z05 A;  4IEJ A;  2MLK A;  2ZSI B;  3M7G A;  2D1V A;  2FBK A;  5IT9 Z;  4HX4 A;  4B47 A;  2IVM A;  3IH3 A;  1MDM B;  1KQ9 A;  2P8T A;  3M9A A;  2HXI A;  3C3W A;  1I39 A;  3R60 A;  1ONV A;  2MD0 A;  3Q9V A;  1WH5 A;  3W6K B;  1I5Z A;  2QKM B;  3HPH A;  4I0A A;  1DGW Y;  5KHD A;  1D0X A;  1NHA A;  1FZP B;  3GYH X;  4UHT A;  1X19 A;  2P5V A;  2Q2E A;  3F3X A;  1OR7 A;  3FXL A;  3K1N A;  1FBQ A;  1SFE A;  5CJ9 A;  4KN4 X;  2PX9 A;  2IAI A;  4M3F A;  2ME6 A;  4P1W A;  1YE9 A;  1AKH A;  4ZYE A;  1XSV A;  4I6Z A;  1RPW A;  2BE5 F;  1YYV A;  2VKE A;  5E8I A;  3LSI A;  3GEZ A;  2LY1 A;  1NK2 P;  3S1Q J;  3L2R A;  4HPQ A;  1D1B A;  2KRC A;  2WAQ A;  1W0T A;  3K0L A;  2ECC A;  3UNG C;  2K5C A;  2F2E A;  3F8F A;  5L3E A;  1H89 C;  2X4H A;  3DEW A;  1LFB A;  2GAU A;  2KP6 A;  5DCM B;  4BEH A;  3P9I A;  2GOX B;  3OR1 C;  1B8I A;  4V2G A;  1Z9C A;  4FET A;  1MSE C;  1EV7 A;  1EH8 A;  5B1A H;  2QSH X;  1VQ9 I;  2MFZ A;  1ZRE A;  3FBI B;  3D5S C;  2BW3 B;  2STT A;  1W4M A;  5JHF A;  4EM0 B;  1SMT A;  2E36 A;  2XRL A;  2HOE A;  1ZGJ A;  2BEO A;  3G73 A;  2DYR H;  2F6C A;  1UHS A;  3CF5 F;  1K4S A;  2NRA C;  1N77 A;  3LA7 A;  5JLW A;  3WTS C;  4ESJ A;  4M3G A;  1B59 A;  2XC7 A;  2HOA A;  4A3J J;  1K4T A;  1TW2 A;  1PJR A;  2VL8 A;  5D5W B;  4WX9 A;  2GA1 A;  1OYW A;  2VON A;  3BR3 A;  4XRM A;  3U9G A;  2EIN H;  4KJZ A;  3H3Z A;  3AG2 H;  1Z3Y A;  4WWC A;  2LFB A;  4OAZ A;  3CLQ A;  4EV0 A;  1MSF C;  2ECB A;  4A0Z A;  1F5T A;  5IYD J;  1XG1 A;  2WBM A;  4DIQ A;  2CQ7 A;  2NAZ A;  2R7F A;  1ZGW A;  3OYA A;  3R61 A;  5BMZ A;  2VJJ A;  1K83 J;  3DEE A;  3I3L A;  5J4Y A;  1TLH B;  1X1C A;  1SD5 A;  3P9K A;  1SAU A;  4M3E A;  4HNV A;  1K7A A;  2BYV E;  3TGN A;  5HDG A;  2STW A;  5FKM A;  1VQ4 I;  1FLI A;  2DT5 A;  5JVG F;  2EFN A;  3NAR A;  5ILS A;  1OCR H;  1O3Q A;  3W2A A;  2L9N A;  2LP0 A;  1DU0 A;  4D7M A;  3EUH A;  1UMQ A;  2A69 F;  2HEO A;  2FXA A;  1A31 A;  3ERE D;  5C3E J;  2UZK A;  2UV1 A;  2KQR A;  5IP7 J;  4O3M A;  3BPX A;  1OCC H;  1XPX A;  2H27 A;  1H0M A;  2R7R A;  4R79 A;  3CME I;  1P4W A;  1O7F A;  3HJE A;  3L09 A;  1R5G A;  4M3B A;  1HC8 A;  5HOD A;  4GGG A;  3HOW J;  3VSK A;  3K4C A;  2ACJ A;  2E35 A;  3Q0U A;  1BC7 C;  1FYL A;  2M9H A;  5FRN A;  2CG4 A;  3HOS A;  2XAJ A;  4HA8 A;  1AKH B;  2XSJ C;  5CVU A;  2P5K A;  4OIO F;  2L01 A;  3GFM A;  3WTW C;  3WU1 B;  2KHM A;  3V8L A;  4Y33 A;  3HXL A;  1O3S A;  1A35 A;  3JRI A;  2DYS H;  2ID3 A;  4G8X A;  1UCR A;  4XLP F;  5HS8 A;  3RZO J;  5GTI C;  1Y6I A;  5E3M A;  1KQ8 A;  5HLT A;  1PVE A;  5E1W A;  3OV8 A;  1T8I A;  3CJN A;  4RAG A;  1I3A A;  2DTZ A;  1IV8 A;  4KIF A;  1IV6 A;  3M07 A;  4FE7 A;  5M5W J;  1D1A A;  4LK1 F;  4BH9 A;  4HZF A;  5HLH A;  1MNE A;  1SD4 A;  2M87 A;  3K9T A;  1IG7 A;  3GW2 A;  2DQR A;  3F9K A;  5BNG A;  2VKD A;  2L7Z A;  3TP0 A;  1YRN B;  3K70 C;  3T5X A;  1QQI A;  2HVS A;  5LGU A;  3HPG A;  3JRH A;  2GLO A;  3AG1 H;  2NVT J;  1KU9 A;  2HOS A;  1TT5 B;  4AU7 A;  2W25 A;  4UUT A;  3KYL A;  4LLL A;  2A6T A;  2O03 A;  3E5Q A;  3FM5 A;  2Q8K A;  3VEP A;  3ZR8 X;  5F1R A;  1NK3 P;  5IOZ A;  3I59 B;  4ZZD A;  4XK4 A;  2PMZ N;  2EFO A;  2HWV A;  2LBF B;  2UXN A;  4FHT A;  2OJE D;  4FAS D;  1E2X A;  2VC0 A;  3UKG A;  2LF7 A;  1YS6 A;  1Z91 A;  4NQW B;  1T95 A;  1OYI A;  3QP5 A;  2AXT C;  4II3 A;  3E6M A;  2YX4 A;  3QU6 A;  2HU9 A;  3LST A;  1RUN A;  3GTO J;  1IJW C;  3OOP A;  3MZY A;  2XSD C;  3O8H A;  1EKE A;  2DA6 A;  1R9T J;  3WE2 A;  5K1Y A;  2VC1 A;  2QKL B;  3CP8 A;  1ZRC A;  4XIC A;  3TDZ C;  4ZTF A;  3CO7 C;  5L3D A;  4C2U A;  3EYY A;  1ETY A;  4YIF A;  4Q4Z F;  1WJF A;  2RNG A;  1DUX C;  4II2 A;  2K9L A;  2FMY A;  1IW7 F;  2JTV A;  4B3X A;  1K61 A;  1Y1W J;  2XIG A;  4L9N A;  5DV5 A;  1LQ1 A;  1BM9 A;  2M34 A;  2QM3 A;  4M9S A;  4C3H J;  4XL9 A;  1IXS B;  1ZHF A;  3GTJ J;  5ILU A;  4V19 K;  1U78 A;  4YII A;  3HDD A;  2HQ5 A;  3HRT A;  2EV5 A;  3HRU A;  3ML6 A;  4XLH A;  2DCE A;  4CXF A;  2BBY A;  2MSY A;  1BI1 A;  2X6Y A;  2O5R A;  3I4M J;  2NVQ J;  3ABL H;  1HLV A;  2KIM A;  3OYG A;  2WB1 A;  2OCE A;  4ZYH A;  1QVT A;  5J1U A;  4BXU A;  4CYC A;  3W6V A;  2YU3 A;  3LSH A;  3VYR B;  2C6Y A;  3E7L A;  3OS0 A;  3BT9 A;  1YS7 A;  2ZFW A;  3HBL A;  4XLN F;  2M4K A;  2FBH A; 
#chains in the Genus database with same CATH homology
 4CIC A;  3K69 A;  4M6Y A;  2IA0 A;  3HUG A;  4GO1 A;  1XGN A;  1G3Y A;  4D0P A;  3U1D A;  3GX4 X;  1FSE A;  1J59 A;  3G3Z A;  3N4M A;  3GFJ A;  1LJ9 A;  1B1B A;  2ZNZ A;  2WC2 A;  2L4A A;  4U0V A;  3WG9 A;  2GXB A;  2HKX A;  4L9T A;  3JTH A;  5JR3 A;  4XSZ F;  3MZH A;  3BDD A;  3HIF A;  1R23 A;  3K2Z A;  2CO5 A;  1T0F A;  1KU2 A;  2F5F A;  4UV8 A;  5KK1 A;  3J81 Z;  3TOA A;  4PZJ A;  2CSO A;  3R4K A;  1OPC A;  3F8M A;  3IRR A;  4YG2 F;  3FM3 A;  4HBL A;  4H0E A;  2B0L A;  1SMY F;  3LFK A;  2K86 A;  3IKT A;  1ULY A;  2PBI A;  4GYI A;  4ESB A;  2FU4 A;  3L9F A;  2RC4 A;  2V6C A;  3KP4 A;  4PGH A;  3F23 A;  3IRQ A;  1FBU A;  2QEN A;  3PQJ A;  2FQ3 A;  4HF0 A;  2XV4 S;  2FRH A;  4MQV A;  1LDK B;  1J0R A;  4XRF A;  3R0A A;  3F8C A;  1ZG5 A;  5LGT A;  5HLI A;  2HYG D;  1HBX G;  1UFM A;  4HV6 A;  3T8T A;  2P6S A;  3ZP5 A;  4HAM A;  4M9Z A;  4LG0 B;  1R00 A;  5E18 F;  2ZO4 A;  2HZT A;  4P9U A;  4HLY A;  3E5U A;  3RYR A;  1P4A A;  3E6B A;  2XRO A;  1Z1D A;  2D1H A;  1QO0 D;  3ZMZ A;  4HX7 A;  3RI4 A;  3KP3 A;  3PQK A;  2CWE A;  4ASN A;  5E17 F;  1MD0 A;  1W7P A;  5E20 A;  2ELH A;  1HW2 A;  4PDK A;  2Z5U A;  3QAH A;  1T98 A;  3U2R A;  4ENK A;  5TJJ A;  4JQF A;  1J2X A;  1TNS A;  4M6X A;  4P96 A;  2H94 A;  5D4R A;  1FX7 A;  1W7P B;  4BHB A;  2A6H F;  3ZMS A;  3K1M A;  5F6F A;  1FP1 D;  3JTG A;  3FXQ A;  3RPU A;  3F8N A;  4ETS A;  1LEA A;  4UVC A;  1JXS A;  2VOD A;  1YTY A;  4WXD A;  4Y13 A;  2CFX A;  1DDN A;  1ZLK A;  4A6D A;  2DI3 A;  2FSW A;  2PMH A;  3IC7 A;  2FA5 A;  4HX8 A;  4U0Y A;  1TW3 A;  5CLS A;  1G4D A;  1ZAO A;  3FZV A;  2F5D A;  3RPQ A;  4LLN A;  4U0W A;  4G7Z F;  2CW0 F;  1XGO A;  4A5N A;  1QGP A;  1BI0 A;  2XAQ A;  3HHG A;  4L0Z B;  1REP C;  2OZU A;  1XB4 A;  2L3D A;  4BNC A;  4UXN A;  5TRD A;  1TQI A;  1AWC A;  1Y0U A;  4OMY A;  2K4B A;  1HKS A;  1IXR C;  1BJA A;  4FX4 A;  4A5M A;  1U6G A;  3V4G A;  1XSX A;  2EFW A;  1LNW A;  1IXC A;  2DU9 A;  3CUQ B;  4MTD A;  3KEO A;  1JHF A;  5LRR A;  1D5V A;  4IJA A;  1ODD A;  4RAZ A;  2L54 A;  2CGP A;  2YX7 A;  2DLL A;  3GFI A;  1FYM A;  4GCV A;  1IUY A;  2V1D A;  1E17 A;  1BC8 C;  5J8C A;  5FGM A;  4G7H F;  4WXC A;  2K7L A;  2HTJ A;  1B4A A;  5JI6 A;  2ZBK A;  2M8E A;  4CGZ A;  4KN7 X;  4IXA A;  1P92 A;  1LDJ A;  3HYI A;  2MLG A;  3P7N A;  2RV8 A;  2PLY A;  1SD6 A;  1G3S A;  1TBX A;  2W85 A;  3TDU C;  5DCF A;  3FX3 A;  1JE8 A;  1XMK A;  2GQQ A;  5J6X A;  5HS9 A;  5FFZ A;  1MJ9 A;  1SFX A;  3RKW A;  4AVP A;  1WI9 A;  3DV8 A;  3V8J A;  4RAY A;  4UUV A;  2RDP A;  5H6Q A;  4I0B A;  1BOA A;  4IVN A;  3RKX A;  3KLN A;  1CF7 A;  2QBY B;  3GWZ A;  4Q47 A;  1IN6 A;  2HYF A;  4RGU A;  1MZB A;  4RGS A;  4O5V A;  4U7B A;  2VN2 A;  2A5Y B;  4ZYD A;  4MEY F;  2O61 A;  5ICE A;  4IPA A;  2QYO A;  5LGN A;  3N97 A;  5IT9 K;  5H6R A;  3NRV A;  5AIP A;  1ZG3 A;  2O3F A;  1D8K A;  5D5X B;  4L18 B;  4MTE A;  2VOO A;  1KQ0 A;  2E7X A;  2PFB A;  1S7O A;  1QNT A;  4XSX F;  3P9C A;  2PG4 A;  1KU3 A;  1GXP A;  3L00 A;  2FF4 A;  1XGS A;  1EH7 A;  5D6F A;  1GVJ A;  3DP7 A;  2VE9 A;  1IN8 A;  2ISZ A;  1C0W A;  2O6G E;  2ZKZ A;  1F1Z A;  1ZGA A;  5ILV A;  2M1B A;  3IKV A;  4M74 A;  4LMY A;  4NHJ A;  4WK8 F;  2NNY A;  1U8R A;  4EJO A;  3ABT A;  3F21 A;  2DQL A;  1TQM A;  3CDH A;  1XCB A;  3R6S A;  2EWN A;  5DYM A;  5HVQ C;  4U7D A;  2WV0 A;  1FWZ A;  2TDX A;  2EA2 A;  3RYP A;  2YSR A;  2XVC A;  2D45 A;  5HDN A;  2VT3 A;  4F7Z A;  5LHH A;  3CO6 C;  4OIN F;  2RKH A;  3I59 A;  3V7S A;  3F72 A;  4LJZ F;  3E3V A;  2JPC A;  4B09 A;  4YFK F;  2IP2 A;  5DUI A;  4ZH4 F;  2E7W A;  5E1Z B;  1X3U A;  3SXY A;  3BJA A;  3TO6 A;  4ZZL A;  3SZP A;  1HST A;  3DF8 A;  4KYW A;  1HW5 A;  3KCC A;  4HYE A;  1J7K A;  5BS6 A;  1R1V A;  4G7O F;  3HHH A;  3ROU A;  3V7R A;  1HSJ A;  5FFX A;  2EJR A;  3I54 A;  3WTY C;  5ICF A;  2XUB A;  1U5T C;  3VOD A;  3I5U A;  2GIV A;  4MHG A;  3M1E A;  1YW8 A;  5JVT A;  2GZW A;  1UB9 A;  3J81 K;  3RKY A;  3ZMD A;  4KUM A;  3HRS A;  1KYZ A;  4HF1 A;  2H6C A;  1ZH5 A;  2A61 A;  4RB2 C;  3F6V A;  5JFR A;  1WQ2 A;  1IF1 A;  3CTA A;  3J80 K;  4ENN A;  1FBS A;  1IN4 A;  2EV0 A;  1KA8 A;  4GYG A;  1XDS A;  2EFP A;  1L0O C;  3ECO A;  3R0J A;  3S2W A;  5D4S A;  4UVB A;  4PCQ A;  2FNA A;  1FC3 A;  4EJV A;  2HR3 A;  3CUO A;  4KIC A;  2EA4 A;  2JRT A;  3MEX A;  1Z7U A;  2W57 A;  3V7C A;  2PI0 A;  3COA C;  1F4K A;  4AD9 A;  2KJC A;  4LG0 A;  2YPR A;  2XAF A;  3JW4 A;  3LA3 A;  2QVO A;  5D6E A;  4P9F A;  3B02 A;  1XD7 A;  2QLZ A;  1R1U A;  1S8N A;  1RUO A;  2FOK A;  3VFZ A;  3BWG A;  1V3F A;  1S6L A;  3BZ6 A;  4EQQ A;  1LVA A;  3SHF A;  1YQA A;  3E97 A;  3RJP A;  1CF7 B;  2AS5 F;  4YFX F;  3MFK A;  1YLF A;  4MNU A;  4I02 A;  3QPH A;  4A2U A;  4LD5 A;  1PP8 F;  1QPM A;  4IF4 A;  3JSP A;  3L2C A;  5HOO A;  1SAX A;  2NS0 A;  4KMU X;  5A2Q Z;  3FXR A;  5LEK A;  1O57 A;  1QBJ A;  2IJL A;  3WTU C;  3F6O A;  1IN7 A;  4IRH A;  1OMI A;  2QUF A;  1AOY A;  2FNP A;  1BI2 A;  2VE8 A;  4RGR A;  1XDU A;  3VOE A;  4KNY A;  4M9X A;  4Y17 A;  5ERI A;  1A04 A;  5LLQ A;  2IPQ X;  1FOK A;  3QPT A;  3DPL C;  3V8K A;  5K5Q A;  1WRJ A;  1TQP A;  3K1P A;  1RNL A;  2F5C A;  2XKO A;  2EV6 A;  3MCZ A;  3HSR A;  3TQN A;  2V9V A;  2ZME B;  4M71 A;  4UV9 A;  3FMQ A;  4L5I A;  4S05 A;  2X0L A;  3SQN A;  1V4R A;  2KKO A;  2G7U A;  2FEZ A;  4A0Y A;  3WTX C;  1ZLJ A;  2HGC A;  1R1T A;  4L0Y B;  1JHH A;  4BAY A;  2HTS A;  2BGC A;  3RTR A;  5AIQ A;  1PP7 U;  4QWQ A;  1G3T A;  3JSO A;  4HF2 A;  3JAM Z;  2ZNY A;  2A3S A;  4AWX B;  2EFQ A;  3KLO A;  4O6J A;  3J80 Z;  1EH6 A;  2LDU A;  2Y48 A;  3QOP A;  1L3L A;  5LHI A;  5L3C A;  1DPR A;  3ZMT A;  2OQR A;  3LAJ A;  3MQ0 A;  2P7V B;  3WE3 A;  3LA2 A;  1DP7 P;  4A6E A;  1GHC A;  5D8L B;  1J75 A;  2VT2 A;  4OOI A;  4N9H A;  3NEU A;  1IN5 A;  4LFU A;  5D8K B;  3WOD F;  3T8R A;  3WTZ A;  2KJB A;  2MC3 A;  4Y15 A;  1YFH A;  5FLX Z;  1O3T A;  3ULQ B;  3ZQ7 A;  3GO5 A;  1J5Y A;  2ZME A;  2XGX A;  4L5J A;  1TNT A;  1BBY A;  4OIQ F;  2J5P A;  4UVA A;  3JAM K;  1BN5 A;  2ISY A;  3C18 A;  3BRO A;  4LGW A;  3I0T A;  3D5L A;  4RS8 A;  4QLC U;  4HQE A;  3TO7 A;  2E1C A;  2BV6 A;  4L9V A;  1BIA A;  1RI7 A;  2H6B A;  2MH9 A;  4EM2 A;  4KDP A;  5A2Q K;  3BJ6 A;  2ZCW A;  1R7J A;  1HKT A;  2RVC A;  2ZXJ A;  2Z99 A;  3DEU A;  1GXQ A;  4Q5S F;  1LDD A;  2KRF A;  2R3S A;  2DK8 A;  3FXU A;  1T6S A;  2PN6 A;  3Q9S A;  2J5O A;  3KP5 A;  3KP7 A;  1O7L A;  1VTN C;  1FYK A;  4HW0 A;  4I2O A;  1IZ1 A;  2O8X A;  2KIF A;  1KYW A;  2Z9O A;  1Z6T A;  2Y75 A;  4ZYG A;  3I58 A;  4I98 B;  1R22 A;  1HW1 A;  3GXO A;  4A0X A;  3BPV A;  2DAO A;  3H92 A;  4I7H A;  3C1D A;  4OU0 A;  1MGT A;  2H09 A;  2IT0 A;  4KIG A;  3WTV C;  2MD5 A;  2ZJ2 A;  4YFN F;  1H9T A;  4G94 A;  3EQL F;  1W5T A;  1STZ A;  4JBA A;  5CVV A;  3D0S A;  2HQR A;  5F64 A;  1DPU A;  3KET A;  2OA4 A;  3QP6 A;  3IHU A;  5E1X A;  1B9N A;  2JT1 A;  3HRM A;  5D5V B;  1D8J A;  3GFL A;  2XKP A;  1S3J A;  5LRS A;  1YO5 C;  3CLO A;  2IW5 A;  1W7P D;  2P4W A;  2DO7 A;  5BOX A;  2DBB A;  2LF8 A;  2ETH A;  4AIK A;  2QZ8 A;  3DKW A;  5FD5 A;  3ZN0 A;  1J9I A;  1UST A;  3IWZ A;  5DD4 A;  3TOB A;  3E6C C;  3KP2 A;  3ISP A;  2A68 F;  4JK1 X;  4PGG A;  3E6D A;  2DW4 A;  1BI3 A;  2W24 A;  2ESN A;  2FBI A;  4WF2 A;  4EMS A;  5FB2 A;  1XGM A;  2HFH A;  2AXL A;  2XAS A;  5L3F A;  3BJO A;  3SZT A;  2DTR A;  4KA4 A;  1U2W A;  4G9Y A;  3SFZ A;  2OQG A;  1WKM A;  3O2P E;  3ZN1 A;  2HS5 A;  2MA3 A;  1MJB A;  1JGS A;  2DK5 A;  2HQN A;  1D3Y A;  4G6D A;  3BP8 A;  4EJW A;  3J7A O;  4WXH A;  2F5E A;  5ICC A;  4NB5 A;  3I71 A;  1ZRD A;  4I01 A;  2OD5 A;  1Q1H A;  2EK5 A;  3EDP A;  5CVR A;  2PEX A;  2OAZ A;  3O3K A;  4GXO A;  5H20 A;  2IA1 A;  5LEJ A;  4N9I A;  2CQK A;  4HQM A;  4DQ2 A;  4G6Q A;  3IL2 A;  2NNN A;  4AIJ A;  1LEB A;  1G3W A;  3I4P A;  2E1N A;  2COM A;  4U88 A;  2V79 A;  2XRN A;  1R58 A;  5K5O A;  6PAX A;  1B6A A;  1K78 B;  2V1X A;  5KVR A;  4ENJ A;  5BPD A;  4KT5 C;  3W6J B;  2GA2 A;  1KU7 A;  5CYV A;  1FPQ A;  3GUD A;  1ZAR A;  3WGH A;  2VOP A;  1PUE E;  4EGZ A;  4M73 A;  3CUQ A;  3KZZ A;  2LKP A;  1R36 A;  4S04 A;  2A07 F;  2HKO A;  2FML A;  4LK0 F;  4MQ9 F;  4N0B A;  1FY7 A;  2IA2 A;  2JPB A;  5DEQ A;  3KE2 A;  3REO A;  2QWW A;  1K79 A;  4A12 A;  3QRF F;  2JSC A;  2VXZ A;  2QBY A;  4CHU A;  4P5O A;  1I1S A;  4CDG A;  2M30 A;  4M72 A;  3HTU A;  1USS A;  4E70 A;  3KFW X;  1KGS A;  2M5W A;  1G6N A;  4XBF A;  3FHZ A;  4Z2Y A;  1BIB A;  5EEH A;  3IWF A;  4HV5 A;  2V1U A;  2KIU A;  5D5U B;  4LB6 B;  4NQW A;  1P6R A;  4BQA A;  5FD6 A;  3B73 A;  2XAG A;  3FMR A;  3KZY A;  4IHT A;  4Q48 A;  2G9W A;  3T0Y A;  1QZY A;  4P55 A;  4RB0 A;  3BOQ A;  1MDM A;  3O6B B;  1H9G A;  1U5T B;  3WU0 A;  3WTT C;  2LSO A;  4HLX A;  1K78 A;  4IRI A;  3WGG A;  1P2F A;  1LB2 A;  2LNB A;  2NYX A;  5L3B A;  2GXG A;  1HQC A;  3F8B A;  4EGY A;  1RZ4 A;  2UWM A;  3I53 A;  4R1H A;  4ESF A;  1I27 A;  3WGI A;  2Z33 A;  5JHU A;  1S7A A;  2K4J A;  5ED4 A;  3LAP A;  3E5X A;  3QU3 A;  3M8E A;  3CUQ C;  5DCM A;  3HSF A;  2M45 A;  3ECH A;  3H3U A;  3HSE A;  4EJT A;  1XMA A;  2EB7 A;  3VB2 A;  5K5R A;  1OYY A;  4L9J A;  2PMU A;  2A6E F;  3GVA A;  3FMS A;  5ICG A;  1I6X A;  2Y0M A;  2YR2 A;  2OZ6 A;  5J8F A;  3FF5 A;  1FT9 A;  3FWE A;  1QZZ A;  3RDI A;  4IRG A;  5CVI A;  1ZYR F;  2UXX A;  2D2W A;  2QQB A;  2P7C B;  3T1B A;  1U3E M;  3LWF A;  4CZZ A;  5E8G A;  4MGR A;  1IRF A;  5HDK A;  2ADU A;  1ZRF A;  4RB3 C;  2XHK A;  4BYY A;  2L02 A;  2RN7 A;  2L4M A;  1R5H A;  3PFI A;  4CYD A;  3ZMV A;  2R7D A;  4LB5 A;  1P4X A;  5L3G A;  1Z6R A;  1MJA A;  4I09 A;  4BHC A;  4AIH A;  5HLG A;  2VBZ A;  1YG2 A;  2MH2 A;  1O3R A;  5LHG A;  1U5T A;  3MWM A;  1ON2 A;  3ZMU A;  2DPU A;  2DFI A;  4DNC A;  1FSH A;  2G7H A;  4B8X A;  3LQR A;  1K6O A;  1T39 A;  2WTE A;  1OKR A;  3GLX A;  3HOT A;  4EM1 A;  4UNO A;  5AON A;  1MKM A;  2RGV A;  1YIO A;  4KFC A;  1B9M A;  2CYY A;  2OU2 A;  4EJU A;  2FE3 A;  3EET A;  3DXJ F;  3LQQ A;  1XN7 A;  4LLG F;  1YW7 A;  5EEG A;  1S29 A;  1TTY A;  2MBF A;  4RGX A;  3M8F A;  1IRG A;  1F9N A;  3ABU A;  1SD7 A;  3F22 A;  4FX0 A;  5FO5 A;  1T38 A;  3KP6 A;  1FNN A;  2HDC A;  1ZN2 A;  5BQT A;  3I64 A;  4MEX F;  2IRF G;  4HDU A;  2K02 A;  4HOB A;  4TV7 A;  2Q0O A;  1SFU A;  4R8H A;  3C7J A;  1YW9 A;  5FLX K;  4K2E A;  1HXD A;  3KEQ A;  3NQO A;  2QQ9 A;  2K27 A;  4RB1 A;  3GZ5 A;  4KIB A;  5DUK A;  2ESH A;  3GZ6 A;  3ZPL A;  3MAJ A;  2DPD A;  2W84 A;  3DQV C;  2P6T A;  3RIR A;  1W5S A;  3Q5F A;  3GF2 A;  1I1G A;  5DD8 A;  3EYI A;  2VBY A;  1FP2 A;  2Z3Y A;  2WWY A;  1T2K A;  3BY6 A;  4WCG A;  1XCV A;  2PQ8 A;  1HKQ A;  4OIP F;  2XAH A;  2RQP A;  3AAF A;  4OMZ A;  1ON1 A;  1ZG1 A;  1IAW A;  2VBX A;  2PJP A;  1UHM A;  4CO8 A;  2RNJ A;  5IT3 A;  2O0Y A;  2JZY A;  1UHW A;  4IHS A;  4ENM A;  4BHP A;  5LBQ A;  3TKY A;  2OBP A;  4OIR F;  4EVI A;  1RIO H;  3TO9 A;  2QQA A;  3L7W A;  3DPT A;  1WSU A;  4KMF A;  2GWR A;  5CVJ A;  3ELK A;  2VBW A;  1CGP A;  5DDG A;  4HDV A;  4FT8 A;  1WWX A;  1PDN C;  3DFG A;  1XSD A;  3HTS B;  2P5L C;  5HS7 A;  5BPI A;  4ON0 A;  1Z05 A;  2MLK A;  3M7G A;  2D1V A;  2FBK A;  5IT9 Z;  4HX4 A;  2IVM A;  1MDM B;  1KQ9 A;  2P8T A;  3M9A A;  3C3W A;  3R60 A;  1ONV A;  3Q9V A;  3W6K B;  1I5Z A;  4I0A A;  1NHA A;  1FZP B;  3GYH X;  4UHT A;  2P5V A;  2Q2E A;  1OR7 A;  3F3X A;  3K1N A;  1FBQ A;  1SFE A;  5CJ9 A;  4KN4 X;  4ZYE A;  1XSV A;  2BE5 F;  1YYV A;  5E8I A;  3GEZ A;  3K0L A;  2F2E A;  3F8F A;  5L3E A;  2X4H A;  5DCM B;  2GAU A;  3P9I A;  1Z9C A;  1EV7 A;  1EH8 A;  1ZRE A;  2STT A;  1W4M A;  4EM0 B;  1SMT A;  2HOE A;  1ZGJ A;  2BEO A;  3G73 A;  2NRA C;  3LA7 A;  3WTS C;  4ESJ A;  1B59 A;  1TW2 A;  5D5W B;  4WX9 A;  2GA1 A;  1OYW A;  2VON A;  3U9G A;  3H3Z A;  4WWC A;  4EV0 A;  4A0Z A;  1F5T A;  2NAZ A;  2R7F A;  3R61 A;  5BMZ A;  1TLH B;  1SD5 A;  3P9K A;  1K7A A;  2BYV E;  3TGN A;  5HDG A;  2STW A;  1FLI A;  2DT5 A;  2EFN A;  5ILS A;  1O3Q A;  3EUH A;  2A69 F;  2HEO A;  2FXA A;  3ERE D;  2UZK A;  4O3M A;  3BPX A;  2H27 A;  1H0M A;  4R79 A;  1P4W A;  1O7F A;  3L09 A;  1R5G A;  4GGG A;  2ACJ A;  1BC7 C;  1FYL A;  2CG4 A;  3HOS A;  2XAJ A;  4HA8 A;  5CVU A;  2P5K A;  4OIO F;  2L01 A;  3GFM A;  3WTW C;  3WU1 B;  3V8L A;  1O3S A;  4G8X A;  1UCR A;  4XLP F;  5HS8 A;  1KQ8 A;  5E1W A;  3OV8 A;  3CJN A;  4KIF A;  4LK1 F;  4BH9 A;  4HZF A;  5HLH A;  1SD4 A;  2M87 A;  3K9T A;  3GW2 A;  2DQR A;  3T5X A;  1QQI A;  5LGU A;  1KU9 A;  2W25 A;  4LLL A;  2O03 A;  3E5Q A;  3FM5 A;  2Q8K A;  3VEP A;  5F1R A;  3I59 B;  4ZZD A;  2EFO A;  2HWV A;  2UXN A;  4FHT A;  1E2X A;  2VC0 A;  2LF7 A;  1YS6 A;  1Z91 A;  1OYI A;  3QP5 A;  3E6M A;  2YX4 A;  3QU6 A;  3LST A;  1RUN A;  3OOP A;  3MZY A;  3WE2 A;  5K1Y A;  2VC1 A;  1ZRC A;  3TDZ C;  3CO7 C;  5L3D A;  3EYY A;  4YIF A;  4Q4Z F;  1DUX C;  2FMY A;  1IW7 F;  2JTV A;  2XIG A;  4L9N A;  5DV5 A;  1LQ1 A;  1BM9 A;  2QM3 A;  4M9S A;  1IXS B;  1ZHF A;  5ILU A;  1U78 A;  4YII A;  3HRT A;  2EV5 A;  3HRU A;  3ML6 A;  4CXF A;  2BBY A;  1BI1 A;  2KIM A;  4ZYH A;  4BXU A;  2YU3 A;  2C6Y A;  1YS7 A;  2ZFW A;  4XLN F;  2FBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...