1RIOH

Structure of bacteriophage lambda ci-ntd in complex with sigma-region4 of thermus aquaticus bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a ternary transcription activation complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
molecule keywords 27-MER
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rioH00
2PMUA 2ISYA 3WTUC 2LF8A 1MDMA 2ZMEA 5L3EA 1JGSA 5KK1A 2UWMA 2IJLA 4PGGA 5ILSA 3J7AO 3IC7A 4UVCA 2QM3A 5HLHA 4FHTA 5HDKA 4A0ZA 2XROA 1FSEA 4BHCA 3KLOA 3FXUA 2CGPA 4HLXA 4IJAA 3JAMZ 4Y15A 1P4XA 5L3GA 1IRGA 2XAQA 4MNUA 1MKMA 1BBYA 3I59A 3F8MA 4RB0A 3CO6C 1ZGJA 1BJAA 4MQVA 2KIMA 1Z9CA 4HYEA 1YS7A 3KP6A 1U5TA 4Q4ZF 2P5VA 1U5TB 2CG4A 3DXJF 1MJBA 4MGRA 1ZYRF 2P6SA 2PQ8A 2X4HA 2VBZA 4WXDA 4YG2F 4HF1A 1SAXA 1Z05A 2RGVA 2OZUA 3FHZA 2Z3YA 3GXOA 2YX4A 1XSXA 1UB9A 1LEAA 2V1UA 1DDNA 2VBXA 3DPLC 1XB4A 5CVUA 1GVJA 4A12A 4HA8A 2FF4A 5K5QA 2ZJ2A 5ED4A 2EFQA 2VBWA 1V4RA 4MTDA 2J5PA 1IN6A 2XAHA 3DV8A 3ZMZA 2F5FA 2F5CA 2IP2A 1TNTA 1H9TA 4UV9A 3JTHA 2HKXA 3O6BB 3ZN1A 4EJOA 1I27A 2ACJA 4BNCA 1T2KA 2V79A 4CYDA 4I7HA 5ILVA 2Z99A 3GVAA 4AIJA 2Y75A 4KIGA 5K1YA 4P9UA 2DAOA 3LWFA 3AAFA 4A0XA 4WWCA 2HWVA 4B09A 1YW9A 4KFCA 4LGWA 5ILUA 1S8NA 2XAFA 4P96A 2V1DA 3SXYA 3U2RA 2LDUA 1KQ0A 2W85A 3MCZA 3FZVA 1GHCA 3K2ZA 1DUXC 5BMZA 2ZXJA 1S7OA 4O6JA 3LA7A 3WU0A 4G7ZF 2EA4A 2NS0A 2MC3A 1S3JA 1Z1DA 1FX7A 4M73A 5HS9A 4YFKF 3IKTA 1B6AA 4IRIA 3MZYA 2FQ3A 1U6GA 2COMA 1L3LA 5LGTA 3WTZA 5FB2A 1D8KA 5BS6A 1IN5A 4M9XA 4Y13A 1ZHFA 3CUOA 4ENMA 2C6YA 4EM2A 3I58A 1R1TA 4EM0B 2A3SA 5D5WB 3U9GA 4MTEA 4XSZF 2CQKA 1QBJA 1LNWA 4PZJA 2M8EA 3DP7A 2EJRA 4L9VA 2XKPA 4L9JA 3VOEA 1ZH5A 1BIBA 4QWQA 3I0TA 3MWMA 3KEOA 3RDIA 3ZP5A 1J7KA 3BJAA 1Y0UA 1SD4A 3KP3A 4G7OF 1HSTA 2XAJA 3DKWA 1ZREA 3BJ6A 2HTSA 3ZMVA 4RB2C 5E17F 3M9AA 2TDXA 2DK5A 5E1WA 4B8XA 1BM9A 1K6OA 1KGSA 3FM5A 2XVCA 5CLSA 3IKVA 5HS8A 1YW7A 4IF4A 2FSWA 1LVAA 3V8JA 3E5XA 2K7LA 2CYYA 1IRFA 2DU9A 4N9HA 2D1VA 3P9CA 3HRTA 5JHUA 4IHSA 3CUQC 3KP7A 4I98B 3K1PA 3RPQA 5HLIA 1TLHB 1FP1D 3GF2A 3ULQB 4U88A 3LFKA 2DT5A 2FOKA 4EGZA 5L3CA 1FYKA 3F3XA 3RJPA 4FT8A 1PDNC 1ZAOA 2O0YA 2JRTA 1LJ9A 3F6OA 5D8LB 4XLPF 5DUIA 1DP7P 1V3FA 2M1BA 3W6JB 1OMIA 1IUYA 1BI1A 1DPRA 1G3SA 2HDCA 1WSUA 3KZYA 3KZZA 5DD8A 4L5JA 3PQJA 3KCCA 3ABTA 1D3YA 2E7XA 2P6TA 4LMYA 2OQRA 4LB6B 3KP5A 4K2EA 3IRRA 3MFKA 3BOQA 4WK8F 3ZMTA 5FLXK 3O2PE 5D5UB 3HOTA 3FMRA 1K78A 4M74A 1UHWA 2UZKA 5CJ9A 1K78B 4UNOA 3F8BA 4KIBA 4EMSA 2EK5A 2A6HF 2Q0OA 3ELKA 3L7WA 4OU0A 3TO7A 1NHAA 4G9YA 1USTA 4DNCA 1D5VA 2VXZA 5FFZA 3M7GA 2XASA 1T98A 3R0AA 3IWFA 5D4SA 3IRQA 2HQRA 4A5NA 2Z9OA 4ZYEA 3TGNA 4ESBA 1H9GA 5JR3A 2ELHA 1Z6RA 1RZ4A 3J80K 4RGSA 5H6RA 4M6YA 3F6VA 3F22A 4WF2A 4M71A 2XGXA 1LDKB 4G94A 3GEZA 3V7RA 1KU9A 3QPTA 3BROA 3M8EA 4Z2YA 4U7BA 2H09A 2PG4A 2VBYA 1OYIA 1SD5A 4N9IA 5DV5A 4QLCU 1HBXG 3NEUA 1U78A 4YFNF 3T0YA 2FE3A 2NAZA 4OINF 3V7CA 1CGPA 3T1BA 4AIHA 3I54A 1EH6A 2BBYA 5D8KB 3WTYC 5D6FA 2JPBA 5ICFA 3W6KB 2HKOA 5ERIA 2G9WA 2O61A 1T39A 2DBBA 1SMTA 1P2FA 4P9FA 1O3SA 3GX4X 1XGSA 1I1GA 3LSTA 4BHBA 4HDVA 3Q9SA 4IPAA 2ZCWA 3WE3A 3SQNA 1HW1A 3SHFA 1KYWA 1IXRC 1AWCA 3C3WA 1TNSA 3JSPA 2Q2EA 4L18B 3GW2A 3QP6A 3IL2A 3QPHA 4RS8A 2G7UA 3S2WA 3PFIA 3HSEA 3CO7C 1FT9A 1HKTA 3HUGA 3DPTA 4UHTA 3H92A 1HSJA 3KEQA 4L5IA 4L9TA 2CFXA 2YSRA 5DUKA 1TW3A 2IPQX 2W24A 1EV7A 2D45A 1IN8A 2HZTA 1U2WA 1IN4A 3WTWC 3PQKA 3HTUA 1XMAA 3T5XA 4YFXF 4HX7A 1J0RA 3E6MA 4HZFA 4HBLA 5DCFA 3N97A 3VFZA 3WU1B 1MJ9A 2DFIA 1ZN2A 2GZWA 2VE8A 3RIRA 3H3ZA 4Q5SF 1T38A 2ETHA 5CVVA 4S04A 2QQBA 3WTXC 2VOPA 3JSOA 4RAYA 2JT1A 1BC7C 1O7FA 4GYIA 2QBYA 2L4MA 2D2WA 1Z6TA 4PCQA 1ZRCA 3J81Z 4KA4A 4WXHA 4Y17A 2QYOA 5D4RA 5J8FA 4I02A 1UHMA 3HHGA 4KUMA 1BIAA 4AD9A 3E3VA 3QP5A 2W57A 3TO6A 2EWNA 3E97A 1FPQA 1B9MA 1WI9A 1BI2A 2FXAA 5CYVA 4ASNA 4EQQA 5BPDA 4KN7X 4EV0A 4JK1X 3K1NA 3I59B 2YPRA 1EH8A 2RQPA 1XMKA 1H0MA 3QOPA 1UCRA 4AWXB 1QQIA 4RB3C 5K5RA 4UUVA 5EEGA 2QENA 2DTRA 1CF7B 3GWZA 2DK8A 5ICEA 2DPUA 3G73A 2O6GE 2ZNZA 2H94A 5LGUA 4IHTA 1J75A 4Q47A 1R7JA 1IW7F 1FBSA 4ZZLA 2EFPA 2V1XA 1YS6A 2P7CB 4IXAA 4R8HA 2F2EA 3FMQA 2Q8KA 4H0EA 5FD6A 3K9TA 4ZYDA 2PEXA 5E8GA 4CGZA 4ZYGA 4N0BA 2P4WA 5ICCA 2GQQA 5H6QA 4RGXA 2QBYB 3CUQA 2HYFA 1LQ1A 2D1HA 1TQPA 4MEXF 2QWWA 4HAMA 1OR7A 2L4AA 1RIOH 4I2OA 1YLFA 4U0VA 2ADUA 1ZG5A 5D6EA 2HR3A 4WXCA 2IA1A 3FXRA 4GXOA 2V9VA 2W25A 3V7SA 2LKPA 4HX4A 2GA2A 1JE8A 4HV6A 4O3MA 2IA2A 4LJZF 4L0ZB 5JVTA 1O3TA 2K86A 2JTVA 2XUBA 1U3EM 1LEBA 2PMHA 3NQOA 2EV6A 2E7WA 3V4GA 1ODDA 2RV8A 4EGYA 2R7DA 3H3UA 1SMYF 3B73A 3L9FA 3NRVA 5HDNA 2G7HA 3RKXA 1WRJA 3KP2A 3ABUA 2DQRA 4XLNF 4HX8A 3T8RA 3EYIA 2ZNYA 1XGNA 2QQAA 2VONA 1R5HA 4OMYA 3KE2A 3DF8A 5AIPA 1REPC 3WG9A 1GXPA 4F7ZA 1FBQA 4LK0F 5FO5A 2WC2A 3SZTA 5L3FA 3TDZC 1LB2A 1R22A 5JFRA 1ONVA 2ESHA 5LBQA 3RYPA 1U5TC 2RKHA 5JI6A 3R61A 5FLXZ 2FNAA 5LEKA 4IVNA 1P6RA 1O57A 3N4MA 2J5OA 1BN5A 2FBHA 3DFGA 3FX3A 1KA8A 5DCMB 1HKQA 4DQ2A 4A0YA 2IW5A 2LSOA 3QU3A 3QRFF 2L02A 3K1MA 2XAGA 5AONA 5FFXA 3F8FA 5LHIA 3BP8A 4HQEA 2YX7A 3I71A 3WTSC 1KYZA 3TQNA 2H27A 4LLGF 4BXUA 2EFOA 3ZMDA 1MGTA 3R6SA 2X0LA 2A07F 2MLKA 4A6EA 2UXNA 1T6SA 2GIVA 1SFEA 3HHHA 2MLGA 2AS5F 1OYWA 1PUEE 2ESNA 2NNNA 2OAZA 3P9KA 2FMLA 2PN6A 3E6BA 4EJUA 1ZG3A 4UVAA 3HOSA 4U7DA 3ERED 1MJAA 3GFIA 3G3ZA 1WQ2A 1W7PA 2A5YB 2NRAC 1JHHA 2FMYA 1RUNA 3ZN0A 3VB2A 1WKMA 1XSVA 2OQGA 4EJWA 2KRFA 5CVJA 2VODA 1G3TA 4IRGA 2DI3A 2STWA 1BI0A 1KU2A 4HLYA 3C7JA 3I5UA 4ZZDA 3WTVC 3T8TA 3BPVA 2XIGA 3CJNA 1BOAA 2LF7A 3CUQB 3R60A 5LHHA 4PDKA 4FX4A 3LA3A 2M45A 4AVPA 2Y0MA 3GFMA 1L0OC 3BWGA 5E1ZB 5IT3A 3E6CC 2IA0A 1P4WA 3TO9A 1C0WA 1DPUA 2DO7A 1Z7UA 3ECOA 1ULYA 4HW0A 4CHUA 1HKSA 4BHPA 1SD7A 3ECHA 2PJPA 3BDDA 4BYYA 3GFLA 4JBAA 4LFUA 1GXQA 3P7NA 3TOBA 1IXSB 1B4AA 5HS7A 1IF1A 3KETA 3RKYA 3JAMK 5FGMA 1T0FA 4R1HA 5F64A 2HGCA 5TJJA 2XKOA 4MQ9F 3GZ5A 4YIIA 5LGNA 1EH7A 2HS5A 4I01A 3HYIA 1F9NA 3LAJA 1I6XA 3IWZA 2FBIA 2IT0A 1KU7A 2HTJA 5D5VB 2R3SA 3FF5A 4LLNA 1W7PD 2R7FA 1R5GA 1R23A 2W84A 4RB1A 1J5YA 1YO5C 1TBXA 2UXXA 2DQLA 4UVBA 1ON2A 2RNJA 4D0PA 1RUOA 4AIKA 1ZGAA 2EFWA 5E20A 2JZYA 2M5WA 5ICGA 4OOIA 5DCMA 2A68F 4CO8A 1IAWA 4CDGA 2P5KA 2KJCA 1QGPA 1FYMA 4PGHA 2MH2A 4UXNA 2M87A 1QO0D 2LNBA 2O03A 3WODF 4A5MA 1X3UA 1P4AA 4BAYA 1S29A 1YYVA 2VT2A 5AIQA 3TDUC 4KNYA 5E8IA 1OYYA 5J6XA 1XSDA 1K7AA 1HXDA 1R1VA 1JXSA 3HRUA 5J8CA 3B02A 3ZMSA 1E2XA 2MBFA 1CF7A 2K27A 2BE5F 2FU4A 5IT9Z 2JSCA 3GZ6A 1W7PB 4BQAA 1A04A 3KFWX 1IN7A 2XHKA 1XDSA 3ZMUA 4NQWA 2V6CA 3Q5FA 4HF2A 1B9NA 4LD5A 3CLOA 2Z33A 2WV0A 1F5TA 2BV6A 1XD7A 4YIFA 1PP8F 1HW5A 1YQAA 4I09A 2P8TA 2FNPA 2H6BA 4RGRA 3FXQA 5LRSA 4CICA 3BZ6A 2OBPA 4ENNA 3EQLF 1FYLA 3F21A 2BEOA 1G3YA 3COAC 1MZBA 5LEJA 2GAUA 5H20A 1XGOA 2MD5A 3R4KA 1J59A 2VN2A 3OOPA 2XV4S 3EETA 1SD6A 2CW0F 2QLZA 1HW2A 3C1DA 3D0SA 2DW4A 2GWRA 2VC1A 5EEHA 1ZG1A 2QVOA 5F6FA 2VE9A 1TQMA 2EV0A 1D8JA 2HQNA 3EYYA 1ZRFA 3RKWA 1ON1A 3CTAA 2K4JA 1S6LA 5CVIA 1YW8A 4G8XA 3FWEA 2HEOA 1MD0A 1B59A 4E70A 3SZPA 4XBFA 2PFBA 2K4BA 1SFUA 1BI3A 5BPIA 2FEZA 3F8CA 5KVRA 2RC4A 2QQ9A 1KQ8A 2QZ8A 4OIOF 4M9ZA 1FSHA 3BPXA 2IVMA 4EM1A 2ZFWA 4A6DA 1G4DA 3J81K 1UFMA 1FBUA 1W5SA 4OIRF 1XCBA 3P9IA 1LDDA 4MEYF 1VTNC 3ROUA 2STTA 2ZBKA 3I4PA 4CXFA 5IT9K 3Q9VA 1O7LA 4U0WA 3E5QA 3CDHA 1KQ9A 2OD5A 2Y48A 3TOAA 3VODA 3I53A 2CWEA 1RI7A 4MHGA 3WGGA 2JPCA 2MH9A 5HOOA 1KU3A 4ZYHA 4FX0A 2OA4A 4GYGA 4KMFA 4A2UA 5DEQA 2GA1A 3C18A 2RN7A 2O3FA 3GYHX 1I5ZA 3RI4A 3BY6A 4HDUA 1WWXA 2CSOA 2K02A 3RYRA 1E17A 5E1XA 6PAXA 2O8XA 2A61A 5DDGA 1ZARA 5L3DA 5LHGA 4L9NA 3O3KA 3V8KA 1RNLA 4LG0A 5DD4A 2P5LC 1PP7U 2KIUA 4UV8A 2P7VB 1S7AA 3K69A 2A69F 3F72A 4ENKA 4I0AA 5L3BA 1TTYA 1P92A 3FMSA 3KLNA 5TRDA 3E5UA 2GXGA 1YFHA 4KYWA 2IRFG 2L01A 4ENJA 4EVIA 2WTEA 4RGUA 1LDJA 3IHUA 2BYVE 5F1RA 3J80Z 1SFXA 5LRRA 4P55A 2PBIA 2NNYA 2HFHA 3RTRA 1USSA 2H6CA 1G3WA 3E6DA 2A6EF 1OPCA 3VEPA 1W5TA 1ZLJA 2NYXA 2PI0A 1ZRDA 1F4KA 1O3RA 3ZPLA 2ZKZA 1Q1HA 4L0YB 4EJVA 4ZH4F 2GXBA 1AOYA 1F1ZA 2VC0A 3JW4A 4HV5A 1W4MA 1FZPB 3MZHA 4WCGA 4M72A 3L2CA 3MAJA 4EJTA 2WWYA 3I64A 1FNNA 1MDMB 2EA2A 4P5OA 5A2QZ 1JHFA 2EV5A 4KN4X 2MA3A 3HIFA 3KP4A 1FLIA 2FRHA 4O5VA 5LLQA 4ETSA 3U1DA 1ZLKA 2QUFA 1XDUA 4I0BA 1FOKA 4Q48A 5K5OA 4TV7A 3K0LA 4GGGA 3MQ0A 2F5EA 2RDPA 1TQIA 3SFZA 1U8RA 3DQVC 3QAHA 1R00A 4BH9A 4KIFA 3ML6A 1OKRA 4NB5A 2DLLA 4GO1A 3TKYA 3L09A 4ESFA 1XGMA 2ZO4A 4ESJA 3L00A 2FA5A 4LB5A 3OV8A 3HSFA 3D5LA 4G6QA 2KIFA 2RVCA 4HQMA 3WE2A 2KKOA 3QU6A 3FM3A 2OU2A 5FD5A 2ISZA 2XRNA 3WGIA 4G7HF 4LK1F 2VT3A 2FBKA 3WTTC 2M30A 2YU3A 2HOEA 1XCVA 1HQCA 3EUHA 1Z91A 2HYGD 1IZ1A 5HDGA 1STZA 1QZZA 1B1BA 3REOA 4OIPF 4XSXF 3HTSB 2AXLA 3R0JA 3GO5A 2B0LA 2EFNA 1FC3A 2CO5A 4U0YA 3JTGA 1K79A 5HLGA 1R36A 3GUDA 4KDPA 1J2XA 4WX9A 3LQRA 3WGHA 3F23A 3GLXA 1BC8C 2L3DA 1FP2A 1IXCA 1R58A 1FWZA 3M1EA 3HRSA 2E1CA 1QZYA 4KMUX 5BOXA 1TW2A 3HSRA 4CZZA 2DPDA 3DEUA 4GCVA 4JQFA 2E1NA 1G6NA 2YR2A 5A2QK 1XN7A 1YTYA 1J9IA 1YG2A 3HRMA 4RAZA 4XRFA 1QPMA 2KJBA 3V8LA 2PLYA 5HVQC 3GFJA 3ISPA 3RPUA 3LAPA 4LLLA 3M8FA 1R1UA 4NHJA 4ON0A 5E18F 2F5DA 5D5XB 5BQTA 1QNTA 3F8NA 2BGCA 4HOBA 4HF0A 2L54A 3LQQA 5DYMA 4S05A 4OIQF 4M9SA 1YIOA 3LA2A 1FY7A 2EB7A 1O3QA 4KICA 4OMZA 4G6DA 4IRHA 3MEXA 4R79A 5CVRA 2OZ6A 3EDPA 2Z5UA 1I1SA 2VOOA 4KT5C 3BJOA 4M6XA 4LG0B 2ZMEB 3ZQ7A
chains in the Genus database with same CATH superfamily
3ZQQA 2PMUA 2ISYA 4JX6A 3WTUC 2LF8A 1MMSA 5B3SH 3LSPA 4F52A 1MDMA 2ZMEA 5L3EA 1JGSA 5KK1A 2UWMA 3H0GJ 2IJLA 4PGGA 5ILSA 4MFDA 3IC7A 3J7AO 4UVCA 2QM3A 2R5ZA 5HLHA 2DJIA 4FHTA 5C3EJ 3MN2A 4Y33A 5HDKA 1RR8C 4A0ZA 4AM3A 2XROA 2WADA 1FSEA 3U21A 4BHCA 3KLOA 3U1KA 3FKIJ 3E0JB 3FXUA 2CGPA 4ZTJA 4HLXA 2HPMA 4IJAA 3JAMZ 3JRCA 3LSHA 4Y15A 1P4XA 5L3GA 1IRGA 3OS0A 3ZCOA 5EGOB 2Y0SN 2XAQA 1QA6A 1Y6IA 4MNUA 2JA2A 5EYRA 2E35A 1MKMA 1BBYA 2ZSIB 3CCYA 3F8MA 3I59A 4RB0A 3CO6C 2YU9J 1ZGJA 2LKSA 2JA8J 3ABKH 5EJCA 1BJAA 1BJZA 1WJ5A 4MQVA 3VDXA 2KIMA 5CKTA 4DW6A 5C4XJ 4NNJA 1Z9CA 1HC8A 4HYEA 1GV5A 1MMAA 1YS7A 3KP6A 3GTMJ 1U5TA 4Q4ZF 1U9OA 5FKKA 4AIDA 2O9LA 2P5VA 3KX2A 2V9PA 1U5TB 2CG4A 1IDZA 3DXJF 1MJBA 1MH3A 3FIWA 5J3LA 2L9NA 2LR8A 4MGRA 1D5YA 1ZYRF 1QU3A 2KISA 1BR4A 2P6SA 1T8IA 1AHDP 1WH5A 2PQ8A 2X4HA 2VBZA 3I3LA 2X85A 4WXDA 2W48A 2JUGA 4YG2F 4HF1A 3NWSA 2IGMA 1SAXA 3IH2A 4A3KJ 1Z05A 5EZHA 2RGVA 1OCTC 2DCEA 2HOAA 1N78A 4XRSG 2OZUA 3FHZA 2Z3YA 1LE8A 1A6QA 4CCNA 1RR7A 2F4OB 3PNTA 4HSTA 3GXOA 2YX4A 2VKDA 4XN3A 1XSXA 2EZIA 3BLYA 4A93J 1UB9A 1LEAA 2V1UA 2R92J 1DDNA 2VBXA 2CFOA 2ZB9A 3DPLC 3H35A 1XB4A 5CVUA 1GVJA 4A12A 4HA8A 2XC7A 1EKEA 2FF4A 5K5QA 2ZJ2A 3BCBA 5ED4A 3BR1A 1X4OA 2EFQA 4BQOA 2KPMA 2VBWA 4B3AA 1V4RA 4MTDA 2J5PA 2OC6A 3HDDA 1IN6A 2XAHA 1XTAA 4XN0A 3DV8A 3ZMZA 2F5FA 2F5CA 4B3XA 2IP2A 1TNTA 1VQLI 3S1QJ 1H9TA 4UV9A 1Y1VJ 3RZDJ 3OR2C 3JTHA 3Q0UA 2PJRB 2HKXA 3O6BB 4XLAA 2L9VA 3ZN1A 4EJOA 1I27A 2ACJA 2Y9YA 4BNCA 1XX5A 1T2KA 4IHYA 3L2RA 1MBKA 2IEKA 4KISA 4II2A 3PIPF 2V79A 4CYDA 5DS9A 4B44A 2HVRA 4I7HA 3PNYA 3WHBA 5ILVA 3BT9A 2D5VA 2AQEA 2Z99A 3GVAA 4AIJA 2Y75A 4KIGA 2X1DA 4BJTA 5K1YA 4P9UA 2DAOA 3LWFA 3QQAA 3AAFA 4A0XA 4WWCA 2HWVA 4B09A 2BW3B 2LFBA 3OR1C 1YW9A 1Y8QB 4KFCA 3VWBA 2R7UA 3PL8A 3G1OA 4GDFA 1AKHA 2K40A 2XSDC 4LGWA 2MD0A 5ILUA 3O8HA 4E7JA 1S8NA 2XAFA 2HU9A 4D5CA 4RAFA 2M7BA 4P96A 2DYRH 2V1DA 3SXYA 3U2RA 2LDUA 2XB5A 1KQ0A 2DDBA 3F9KA 3VYRB 2W85A 1H89C 2L7MP 2R7QA 3MCZA 1FMVA 2E5ZA 3DTIA 3FZVA 1N75A 1SVOA 2MW8A 3K2ZA 3CCEI 1GHCA 2F6CA 1Z77A 1DUXC 5BMZA 2ZXJA 1S7OA 4O6JA 4OWRB 3LA7A 3WU0A 4D7NA 3LSRA 2EA4A 2NS0A 2MC3A 3CF5F 4G7ZF 1KZHA 4D5FA 3FHNA 1WJAA 1S3JA 3SFIA 2IBDA 1Z1DA 1FX7A 2HI3A 3H1CA 4M73A 3JREA 5LFAA 1Y39A 5HS9A 2DMQA 3LL7A 4YFKF 1B6AA 3IKTA 1T0FC 4IRIA 4RLQA 5DM6F 1RETA 2CH0A 1MSEC 2VUMJ 3MZYA 4XONA 3CJRB 1U6GA 2FQ3A 2O8KA 2COMA 1L3LA 3K4BA 5LGTA 3PO3J 3WTZA 1BW5A 5FB2A 5J40A 1D8KA 4HG2A 5BS6A 1IN5A 4M9XA 4Y13A 1ZHFA 2OV7A 1W5CC 3CUOA 3I9V2 4ZDLA 4ENMA 2C6YA 4EM2A 3I58A 4BE2A 1FOXA 2E60A 1ENHA 1R1TA 4EM0B 2A3SA 5D5WB 3U9GA 4MTEA 4XSZF 2CQKA 1QBJA 2R93J 1WJDA 1LNWA 4PZJA 2M8EA 3PNVA 1HOMA 1QZEA 3DP7A 2EJRA 4DYRA 5F1JA 4L9VA 1HDPA 1AU7A 5EGOA 5B66C 2XKPA 4L9JA 3VOEA 1XG1A 2JRMA 2JWTA 3AFHA 1ZH5A 2GOMA 3ZQHA 1GT0C 2NVXJ 1BIBA 2BW3A 4BDZA 2K9MA 4QWQA 3I0TA 2XGDA 3W2WA 2OTJI 3MWMA 3KEOA 4BBRJ 1FIPA 2H8RA 3DBRB 3RDIA 3ZP5A 2XPVA 1J7KA 3BJAA 5GPAA 3FISA 1Y0UA 3N05A 1SD4A 2FUG2 4BGDA 3KP3A 4G7OF 3AG1H 1HSTA 1X2NA 2XAJA 3DKWA 1DP3A 2IXSA 1ZREA 1IO2A 3QOEA 1LFBA 2HQ5A 3D1NI 2PX9A 2LTPA 3BJ6A 2QSHX 2AO9A 5M3MJ 2CV0A 2HTSA 2VKHA 1APLC 3LSKA 1A5JA 3ZMVA 3OWTA 4RB2C 5E17F 2Y0SA 2O7OA 3M9AA 2TDXA 2DK5A 3NARA 1TZLA 5E1WA 4B8XA 1BM9A 1K6OA 3K10A 3PO2J 2IS1A 1KGSA 2XF7A 3FM5A 2XVCA 5CLSA 5FLMJ 1SFKA 3GTPJ 5KHDA 3GZNB 2DOAA 1PYVA 4V2GA 1IUFA 3IKVA 3HXLA 5HS8A 1YW7A 3J7AY 4IF4A 2FSWA 1LVAA 2IGKA 3V8JA 5K7ZA 3LOCA 3E5XA 4A3CJ 2K7LA 2CYYA 2E34A 3B6AA 1IRFA 2DMPA 2DU9A 4N9HA 2D1VA 3P9CA 3HRTA 5JHUA 3LSGA 4IHSA 4M3GA 2V9KA 2IS4A 3CUQC 3KP7A 1BL0A 4I98B 1WFXA 3K1PA 3RPQA 5HLIA 2GM4A 1TLHB 4Y52J 3OYCA 3ZR8X 1FP1D 3GF2A 3ULQB 4Z6YA 4A3DJ 3KYDB 2L7ZA 1WJCA 3NAUA 4U88A 1RRJA 2K5CA 2DT5A 3LFKA 3OMYA 2FOKA 4EGZA 1IG7A 5L3CA 4F91B 2HYJA 2EIMH 1FYKA 3IH4A 2VJJA 3F3XA 3RJPA 2LP0A 2KHMA 4FT8A 1PDNC 1ZAOA 1OCCH 2O0YA 2JRTA 1LJ9A 3F6OA 5D8LB 2R5YA 4XLPF 5DUIA 1DP7P 4ZDPA 3S2HJ 3C2BA 1V3FA 3LFUA 2M1BA 3W6JB 1OMIA 2BXYA 1IUYA 1BI1A 4E7SA 1DPRA 1G3SA 2HDCA 3CCQI 2ZFUA 1WSUA 3CC2I 5JLWA 2HZDA 3KZYA 3KZZA 5DD8A 1D0YA 2WBMA 4L5JA 2E1MC 3PQJA 3HZJA 3KCCA 3ABTA 1D3YA 4XRSA 2E7XA 2P6TA 2Q1ZB 5K7HA 1OCPA 4LMYA 2OQRA 2CS3A 4LB6B 3KP5A 2PMZA 1Z3XA 4K2EA 2W1OA 2X1EA 2DA3A 3QYFA 5CPRB 2LBFB 4AVZA 1WJFA 2VXDA 4J01A 4IOAF 2Z16A 1K6YA 3HUGB 3MFKA 3BOQA 4WK8F 3ZMTA 5FLXK 1E0EA 3O2PE 5D5UB 3OYGA 1PUFA 3HOTA 3FMRA 1K78A 3VSLA 4M74A 1UHWA 2BHZA 1FTTA 2LH9A 2UZKA 3BQYA 5CJ9A 1Z21A 1K78B 4UNOA 3F8BA 4KIBA 4RA2A 4EMSA 3KZIC 1AKHB 2EK5A 2A6HF 2Q0OA 5GAGJ 3ELKA 3L7WA 4OU0A 3OYEA 4IQ4A 3K4JA 3TO7A 5E3MA 2FOWA 1NHAA 4G9YA 1USTA 4NBQA 4DNCA 2EZHA 1D5VA 2E2IJ 2VXZA 5FFZA 4XLEA 3M7GA 3SDBA 3KEYA 3V42A 1UELB 2XASA 3K4NA 1JUSA 1T98A 3PSIA 5M3FJ 1B72A 3R0AA 2ZJPF 2VJIA 3CC7I 2VI6A 3IWFA 5D4SA 3IRQA 3DKXA 3DBHB 1IGNA 4NDLA 3KPHA 2HQRA 2OUMA 4A5NA 4I6ZA 2V7FA 4BXFA 3C2HA 2Z9OA 4AYBN 4ZYEA 3TGNA 1R6RA 1H88C 4ESBA 2RAEA 4ITVA 1I3QJ 2FJ1A 3C2GA 4KT6A 1H9GA 5JR3A 2K9SA 2CJJA 2ELHA 1Z6RA 1RZ4A 3J80K 3ASOH 4RGSA 2E1MB 3JRFA 5H6RA 3CMEI 2B7EA 3AG2H 3E7LA 1T95A 4M6YA 3F6VA 3F22A 1ETKA 4WF2A 4M71A 2XGXA 3E1SA 1LDKB 4G94A 1JT0A 3GEZA 3V7RA 1KU9A 1ZQ3P 3L2UA 3QPTA 3CCRI 3BROA 3M8EA 3QYEA 4Z2YA 4U7BA 2W4SA 2LYCA 4PUSA 4BQQA 5JHFA 5GTIC 2H09A 2PG4A 4II3A 3PUBA 2VBYA 5E79C 4PJNA 3GTLJ 4DYCA 1OYIA 1VQMI 3BQZA 1SD5A 4QTRA 4N9IA 4F93B 3S3NA 1R71A 5DV5A 4BBSJ 4QLCU 3CMAI 1HBXG 3J7ZI 1LUJB 3NEUA 1U78A 1OCOH 4YFNF 3QWLA 1LPQA 3T0YA 2FE3A 2NAZA 4D1QA 4OINF 3V7CA 3DBLB 5FRNA 3EUKL 1CGPA 2VJ4A 3T1BA 4AIHA 5HLTA 2CQ7A 3H3VK 3S2DJ 4BU2A 2WAQA 3I54A 3RZOJ 3K4LA 1EH6A 2BBYA 1DQUA 3TP3A 5D8KB 3WTYC 5D6FA 2JPBA 5IP9J 5M5XJ 2B9SA 1WJBA 2UUZA 3BG9A 3VYUB 5ICFA 3W6KB 4CYCA 2HKOA 4RM3A 4DBQA 3JRAA 2NOJB 3TEDA 4ABZA 5EEAA 2LY1A 5F0HA 5ERIA 1I3AA 2G9WA 2O61A 3DWLE 1T39A 4XMYA 2DBBA 1SMTA 1P2FA 2EH3A 2QKMB 4P9FA 3L1PA 1O3SA 1V5EA 3GX4X 1VQ4I 2CW8A 1XGSA 2DMUA 4XKCA 1Z3YA 1I1GA 1BA5A 3H9JA 3LSTA 4BHBA 4HDVA 3Q9SA 2DMTA 4IPAA 1MMGA 4DBRA 2HXOA 2ZCWA 2MG4A 1TL8A 1K4SA 3WE3A 2XF6A 2QKLB 1N77A 1X4PA 4XKVA 3SQNA 1HW1A 3S93A 3SHFA 3CQZJ 3MKWB 2HXIA 1KYWA 1IXRC 1AWCA 1A36A 3C3WA 3ZQGA 1TNSA 3JSPA 5IYBJ 2Q2EA 5FKNA 3K2AA 2X48A 4L18B 3GW2A 3QP6A 3IL2A 3QPHA 4RS8A 2L5QA 1XPXA 2G7UA 3QPLA 3PFIA 2KZVA 3HSEA 3S2WA 4L5EA 3OYMA 3CO7C 2M4KA 1FT9A 1HKTA 3A2KA 3HUGA 3DPTA 2RNGA 4UHTA 3H92A 1HSJA 3KEQA 4L5IA 4L9TA 4A3GJ 4UUTA 4CCMA 2L9SA 3UR3C 2CFXA 2E36A 2YSRA 5DUKA 3S32A 4F92B 1MBEA 4C2MJ 5FRMA 1TW3A 4BJ6C 1WVRA 3ZQLA 2IPQX 2W24A 5HNFA 1EV7A 4FETA 1NG6A 3LSIA 5EG0B 2D45A 2TCTA 1IN8A 1NH3A 2HZTA 2X1CA 4M3BA 4FISA 3BTJA 1U2WA 1FIAA 2I5UA 1ZGWA 1IN4A 3WTWC 3PQKA 2BY3A 3HTUA 3CCJI 1XMAA 3T5XA 3FKJA 4YFXF 4PJ0C 2ZJQF 4HX7A 1J0RA 4RAGA 3E6MA 4HZFA 3H0DA 3CP8A 3KYLA 1ETXA 3LSJA 4HBLA 5DCFA 3N97A 2PMZN 2XPUA 3VFZA 3TMOA 3H9GA 3WU1B 2XSJC 1MJ9A 4GFBA 3BG6A 4GRIA 2VASA 2DFIA 1YHQI 2UV1A 2F4IA 1ZN2A 3DKYA 2JUCA 2GZWA 4BE1A 4LG3A 1VQ6I 2VE8A 3RIRA 3H3ZA 3TW7A 2R4GA 1JJ6C 2P0WA 4S0HB 1DU6A 1JTYA 4Q5SF 1YRNB 2Y2ZA 1T38A 2ETHA 5CVVA 4S04A 4DYQA 3ZOBA 2R7RA 1LE8B 2QQBA 3WTXC 2VOPA 1YRNA 4MO7A 4C3JJ 3JSOA 1JUPA 1A6IA 2LRDA 4RAYA 2JT1A 4E4HA 4X6AJ 1BC7C 2JVGA 2R7OA 1O7FA 4GYIA 3ZQCA 3EUAA 2QBYA 2L4MA 2D2WA 1Z6TA 2QCOA 4PCQA 1ZRCA 3J81Z 4KA4A 2VKVA 3HBLA 4WXHA 4Y17A 2QYOA 5D4RA 5J8FA 4I02A 1UHMA 3HHGA 4KUMA 1BIAA 3G1LA 4AD9A 4MIMA 3E3VA 3QP5A 2YS9A 2W57A 3TO6A 2EWNA 3E97A 3X2QH 3CZ6A 1FPQA 1R4MB 4Y7NJ 3FXOA 3S1RJ 1Y1WJ 1B9MA 2TRTA 1WI9A 2N8GA 1BI2A 1YOVB 3Q0VA 2FXAA 5CYVA 3CCUI 4ASNA 1T33A 4PJMA 4EQQA 3M3YJ 4ZJZA 5BPDA 4KN7X 4EV0A 4JK1X 3K1NA 2Z1DA 4BACA 4AC0A 2ICWG 2JMWA 2BHYA 3I59B 1IV8A 2YPRA 1EH8A 2RQPA 1XMKA 4V2FA 4XORA 3QOPA 4CCOA 1UCRA 4QIWN 1H0MA 5KNLA 3S14J 2EBIA 4AWXB 1QQIA 4RB3C 5J1YA 5K5RA 4UUVA 1V54H 2ZXIA 5EEGA 2X9DA 2QENA 2DTRA 3GTGJ 1CF7B 3GWZA 1VI0A 2DK8A 5ICEA 2DPUA 1N25A 2GXAA 4PFOA 3G73A 2O6GE 2ZNZA 2MGQA 4CCKA 2H94A 5LGUA 4IHTA 3OYAA 2OTLI 1J75A 3DU5A 2X6YA 4Q47A 1R7JA 1IW7F 1FBSA 2CQQA 2AQFA 5DTDA 4ZZLA 3AL0B 2EFPA 2WB1N 2HDDA 2V1XA 1YS6A 2P7CB 4IXAA 1ETYA 4R8HA 2F2EA 3FMQA 3O8GA 2Q8KA 2W7NA 1RESA 4H0EA 5FD6A 2CV2A 1R9TJ 4XR6A 3K9TA 4ZYDA 1ETQA 2PEXA 3GLLA 5E8GA 4CGZA 4ZYGA 2BY1A 2G0EA 4N0BA 2WAFA 4E7LA 2I10A 2P4WA 5B1BH 2NXNB 2CQNA 1Y8RB 2GQQA 5H6QA 4RGXA 5ICCA 2R0QC 3CUQA 4YELA 2QBYB 4DGWB 4IKFA 2HYFA 1SEUA 3FBNB 1LQ1A 2D1HA 1TQPA 4MEXF 1WHUA 2MFZA 2QWWA 4HAMA 3OYBA 2XDVA 3VSKA 3OSFA 1OR7A 2L4AA 4E7ZA 4IQJA 1RIOH 4I2OA 1YLFA 4U0VA 2ADUA 3S15J 1ZG5A 5D6EA 2HR3A 3DLAA 4WXCA 2IA1A 3FXRA 4BUPA 2R7TA 4NC8A 5F27A 3AL0C 4GXOA 1Z0XA 3ZXSA 1KONA 1H8AC 2V9VA 2W25A 2EZLA 1U9NA 3V7SA 1G2HA 1YJ9I 3OYLA 2HVQA 2LKPA 3D5RC 1T56A 4HX4A 2GA2A 1JE8A 1A35A 4HV6A 4O3MA 2IA2A 4LJZF 4W1UA 5JVTA 4L0ZB 1O3TA 4H4KC 1X1DA 2K86A 2JTVA 2XUBA 4PJJA 3OS2A 1U3EM 4AU7A 1SVLA 2PMHA 3NQOA 1LEBA 2EV6A 1NTCA 2E7WA 3V4GA 2XF5A 1ODDA 2RV8A 1WH7A 4EGYA 3HC7A 1E3HA 2R7DA 3H3UA 1SMYF 3B73A 3L9FA 3NRVA 5HDNA 1HF0A 2G7HA 2KFDA 3RKXA 1WRJA 3KP2A 3ABUA 2DQRA 2M2EA 4XLNF 4HX8A 3T8RA 1HA8A 3I55I 3EYIA 4HNUA 1MMNA 2ZNYA 3MKZA 1XGNA 2QQAA 2KIQA 5IP6A 2VONA 1R5HA 2JA5J 4XL9A 1UJ8A 4OMYA 1YITI 3KE2A 3DF8A 5AIPA 1REPC 3WG9A 2M9HA 1GXPA 4F7ZA 1FBQA 4LK0F 5FO5A 2WC2A 3SZTA 1OR7C 1TP4A 5L3FA 2NOGA 3TDZC 1LB2A 1R22A 5JFRA 1ONVA 2ESHA 5LBQA 3RYPA 1U5TC 3CF2A 2KQRA 2RKHA 1X1BA 3S1MJ 5JI6A 3MKYB 1BOBA 4JX5A 3R61A 2ELKA 2OJED 1S9HA 1JKQC 1DU0A 3I4NJ 3WHCA 5FLXZ 2DT6A 1OCZH 2FNAA 5LEKA 3CMMA 2K9QA 4QPOA 2AHQA 2Y31A 1TWFJ 4IVNA 1P6RA 2OCCH 1O57A 2QGUA 2B63J 1FTZA 5TISC 5GTHC 3N4MA 2J5OA 1BN5A 2COBA 2FBHA 3DFGA 3FX3A 1KA8A 5DCMB 1HKQA 2I8DA 4DQ2A 1IV6A 4A0YA 4HNTA 2IW5A 2LSOA 3ASNH 3QU3A 1ETOA 3QRFF 2L02A 1MNEA 5B5EC 3K1MA 3OL3A 2XAGA 5AONA 2VB6A 5FFXA 3F8FA 9ANTA 3F0CA 4CCJA 5LHIA 3NWTA 3BP8A 4HQEA 1X3ZB 2YX7A 3I71A 3IUOA 3WTSC 4UUSB 4E7HA 2X51A 1SFOJ 4C2UA 1KYZA 3TQNA 2H27A 4LLGF 4I76A 4FCYA 4FASD 4BXUA 2EFOA 3K4MA 3ZMDA 4UB6C 1MGTA 2AXTC 2X0LA 3R6SA 2A07F 2MLKA 4A6EA 2UXNA 3CD6I 1T08B 5HNHA 1T6SA 2GIVA 3A03A 1G59A 3FDYA 1SFEA 3HHHA 2MLGA 2AS5F 3AG4H 2QSFX 1OYWA 1G8XA 1PUEE 4IHWA 2ESNA 2NNNA 3IP4B 3HL2A 2OAZA 2WA0A 2FMLA 3P9KA 2PN6A 3E6BA 4XNFA 2KDZA 1X19A 4EJUA 1VQNI 1ZG3A 4XLFA 4YRVA 4UVAA 3HOSA 4U7DA 1MBGA 3ERED 5E3NA 1MJAA 3GFIA 3G3ZA 1WQ2A 1W7PA 3FXMA 3CDIA 2A5YB 4V19K 3RPUD 2NRAC 1TWAJ 1JHHA 1MNDA 2FMYA 2CMPA 2ELJA 2ZXHA 1RUNA 3ZN0A 3CDLA 3VB2A 4DZJA 3OSGA 1WKMA 2FX0A 1XSVA 2OQGA 1A31A 4EJWA 2QA4I 2KRFA 5CVJA 4HRIA 2VODA 1G3TA 1PJRA 2H1LA 2JN6A 4IRGA 3BZCA 1XMXA 1W36C 3DTKA 2DI3A 2STWA 1BI0A 1KU2A 4HLYA 3HOZJ 3C7JA 3I5UA 4D9JA 4ZZDA 1NG7A 3WTVC 2BZTA 3T8TA 3BPVA 2XGEA 2K9NA 2NS7A 3A0HC 2XIGA 3CJNA 1YJNI 3JRDA 1BOAA 1OFCX 1WZ2A 3FK7A 2LF7A 3CUQB 3CLQA 3R60A 1ZTRA 3OYKA 5LHHA 4PDKA 4FX4A 3LA3A 1F43A 2M45A 1U0JA 4AVPA 3KYCB 2Y0MA 1ZR2A 3GFMA 1L0OC 3BWGA 1UHSA 5E1ZB 4N4NB 3QPSA 5IT3A 3JCUC 1MW7A 4RDUA 1JKRC 3E6CC 1B8IB 2IA0A 1UG2A 1P4WA 3TO9A 2HNHA 2CU7A 2LLKA 1C0WA 1FOYA 1DPUA 1JTXA 3A01A 2DO7A 1Z7UA 3ECOA 2DOFA 4QSHA 1ULYA 1X1PA 4F3QA 5J1UA 1R4NB 4HW0A 3K70D 1WPKA 4CHUA 1HKSA 4BHPA 1SC7A 1SD7A 3DU6A 3Q0WA 5CQGA 3RQIA 3ECHA 2PJPA 3BDDA 2F4MB 2JA6J 5GAHJ 2DFHA 2M3AA 4BYYA 3P5JA 3H5NA 3GFLA 2KT0A 4C3IJ 1BR1A 3A1YA 2K3FA 4JBAA 2ECCA 4LFUA 2QQ8A 4M3DA 3S3OA 2CRGA 4FE4A 1GXQA 3P7NA 3MMYB 4XK4A 3TOBA 3SDGA 1IXSB 1B4AA 2HQAA 4M3FA 5HS7A 1IF1A 3KETA 3DPUA 3RKYA 3JAMK 5FGMA 3G4SI 1IDYA 1WJEA 2XRLA 1PUFB 1S72I 1T0FA 2WV1A 4R1HA 2HGCA 5F64A 5EDNA 5KAIC 2BOLA 1XS9A 4IOCF 5TJJA 2XKOA 1LVKA 2XB0X 3OIPA 4MQ9F 3GZ5A 4YIIA 5LGNA 1EH7A 2HS5A 2JA7J 4I01A 5BNGA 1P7JA 4BKXA 3HYIA 1F9NA 4PSWA 1I6XA 3LAJA 4A3EJ 3IWZA 2FBIA 2IT0A 1KU7A 2HTJA 5D5VB 3GTJJ 4ZDOA 2R3SA 3FF5A 2MYSA 2KZGA 4LLNA 2CW7A 1W7PD 4E7IA 2R7FA 1R5GA 3HOVJ 3S17J 1R23A 2W84A 4RB1A 3PSFA 4XLCA 1J5YA 1YO5C 1K83J 1TBXA 2UXXA 2DQLA 1TWCJ 4UVBA 1ON2A 4IX7A 3SYTA 4X1EA 2RNJA 1R49A 3HGGA 4D0PA 1RUOA 4AIKA 4IO9F 1ZGAA 4C2TA 2EFWA 2VPLA 1D1AA 2E1OA 4PSXA 3S16J 2HPIA 5E20A 2JZYA 2M5WA 5ICGA 2KMUA 4OOIA 5DCMA 1PVEA 4CH7A 2A68F 4CO8A 1P9QC 5F0CA 1IAWA 4CDGA 1RKWA 2P5KA 2KJCA 3JRBA 1QGPA 1FYMA 2DA5A 4PGHA 2W00A 1VNDA 2DN0A 2F48A 2MH2A 4UXNA 2GLOA 1DGRM 3G1MA 2F5VA 2M87A 1QO0D 2LNBA 2WY7Q 2O03A 3WODF 4CZCA 5E3LA 2ID6A 4A5MA 2OF7A 3GTOJ 4BY7J 1X3UA 3TBIA 1P4AA 4XKBA 4BAYA 3A0BC 2R7SA 1S29A 3IH3A 1YYVA 2VT2A 5AIQA 3K4KA 2CUEA 1EF4A 3ZRGA 1ITYA 3TDUC 5J4YA 2ZMEC 4QPQA 4BQNA 4XIDA 1VQKI 5E8IA 4KNYA 1OYYA 5J6XA 2XGCA 4NC7A 1XSDA 4PK4A 1HXDA 1K7AA 1R1VA 1JXSA 1ETWA 2DXIA 1ACIA 3HRUA 2ZC2A 3LSMA 3K4CA 5J8CA 3B02A 5HODA 1JI8A 3HG9A 3OYFA 3ZMSA 2Z2SB 1E2XA 2MBFA 4FQGA 3OL4A 1CF7A 2K27A 2BE5F 2FU4A 5IT9Z 3A4CA 2JSCA 3GZ6A 3DLLF 2WY8Q 1W7PB 5IY5H 4BQAA 4DOZA 1GV2A 3OYJA 1A04A 3KFWX 3SEQA 1MMDA 2GIZA 2VLAA 1IN7A 2XHKA 1XDSA 3ZMUA 4NQWA 2V6CA 1B72B 3Q5FA 4HF2A 5FROA 5J4VA 2CUFA 1B9NA 4LD5A 3CLOA 1TWHJ 1OLTA 5FKMA 2H8WA 3KIOA 2Z33A 3HOXJ 3FXLA 2EQRA 2WV0A 5GAEJ 1F5TA 2BV6A 1XD7A 2E19A 4YIFA 1PP8F 3W2AA 1HW5A 4A3JJ 2CUJA 2YUSA 4EATA 3WU2C 1YQAA 4I09A 5H2FC 2W82A 4MFEA 4XOPA 4D7MA 4PFPA 1AA7A 1W0TA 4A3MJ 2P8TA 2FNPA 4CSWA 2H6BA 2LVSA 1V55H 4RGRA 2R7WA 1Z67A 2A5WA 3FXQA 1BW6A 5LRSA 1IJWC 4CICA 2R7VA 3BZ6A 4X0GA 2LD5A 2M0CA 2OBPA 3HKZA 4ENNA 3HOUJ 2M0MA 4ZC3A 3W3CA 5JVGF 3B6CA 3EQLF 1JJ8C 1FYLA 2PJRA 3BR3A 3BR6A 3OY9A 2EIKH 2FQ4A 2BEOA 4RMNA 1Y0NA 3F21A 3OOUA 1B8IA 1G3YA 4P1WA 2QSGX 3W2VA 1QVTA 4BJ5C 4BL0B 3COAC 3W6VA 1MZBA 5JLXA 3CJQB 1YIJI 5LEJA 4J00A 2KLOA 5F0FA 2GAUA 2E2HJ 5H20A 5IYCJ 1QPIA 2KP6A 1XGOA 2MD5A 4JYKA 3R4KA 1J59A 2VN2A 3OOPA 3EETA 2XV4S 1SD6A 3FXJA 4LITA 2A6TA 2CW0F 4ZTFA 2QLZA 3Q3SA 2MABA 1LKXA 3A02A 1HW2A 3C1DA 2VIXA 3D0SA 5EG0A 1RPWA 2DW4A 4NQWB 5K7FA 2OCEA 1VQ7I 2ECBA 2GWRA 2M7AA 2VC1A 5EEHA 1ZG1A 2QVOA 1GUUA 4UB8C 3ESWB 5F6FA 2VE9A 1TQMA 2VQLA 2EV0A 1D8JA 4NUBA 2HQNA 1VF9A 3EYYA 1EA3A 1ZRFA 3QYBA 1ON1A 3K7AJ 3RKWA 1RKTA 3CTAA 1JKOC 2K4JA 1UAAA 2EIJH 2VKEA 2FD5A 1I39A 2R7XA 1S6LA 1D0ZA 1YE9A 4FE7A 5CVIA 1YW8A 5F04A 3SEZA 4BS9A 4G8XA 1OCRH 3FWEA 2HEOA 1MD0A 1B59A 2RREA 4E70A 2DMNA 3SZPA 4XBFA 2PFBA 2X6XA 2V6EA 1I6HJ 2K4BA 3IAM2 1GDTA 3TP0A 4YEJA 3PFYA 5EF6A 1SFUA 4LIUA 1JUMA 1BI3A 1Q1VA 4G12A 5BPIA 2FEZA 3BR0A 4F55A 3F8CA 3CC4I 4NC6A 4YIRX 3PIOF 5KVRA 3CESA 1SAUA 2RC4A 2QQ9A 1FOWA 2WB1A 1KQ8A 2QZ8A 4OIOF 4JX4A 4M9ZA 2KRHA 1FSHA 3LMMA 1GLNA 5IPAA 3BPXA 4BY1J 2IVMA 4EM1A 2ZFWA 4A6DA 1G4DA 3GBGA 4CCLA 3J81K 2IS6A 1UFMA 1FBUA 1W5SA 4XLHA 1MSFC 4OIRF 3CCSI 2BVLA 1XCBA 3ABMH 2KDOA 3P9IA 2IS2A 2DODA 3OYDA 2DA2A 4ANJA 5M5YJ 1LDDA 4MEYF 3RKQA 1VQ5I 1VTNC 2CUZA 3ROUA 2STTA 4HPQA 2ZBKA 2Q2EB 2LY2A 3BG5A 3I4PA 3JRHA 4CXFA 4E6KG 5IT9K 4B4CA 4LOCA 2L2OA 1Y56A 3Q9VA 1O7LA 4U0WA 3E5QA 3BG3A 3CDHA 1KQ9A 3JR9A 1WCMJ 2OD5A 2Y48A 3J7YJ 3TOAA 3M1CA 3VODA 3I53A 2CWEA 3SZGA 1RI7A 4MHGA 5C44J 3WGGA 2JPCA 4IHVA 4KJZA 2MH9A 4BEHB 2X6OA 5HOOA 1KU3A 5C4JJ 2DA6A 3UKGA 4XRMA 3HEFA 4ZYHA 2WAEA 4FX0A 2OA4A 4GYGA 4LIVA 4C30A 3IRRA 1VZ0A 1X3WB 3DEWA 4KMFA 4A2UA 3L2WA 3QODA 2ZSHB 5DEQA 3HOYJ 2GA1A 3C18A 2E2JJ 4DZPA 2A05A 2DOEA 4IZZA 2M34A 2RN7A 2DJNA 2O3FA 3CCMI 3GYHX 1MBJA 1OQYA 4CYCB 1I5ZA 4RM2A 3RI4A 3H9QA 1VQ9I 3BY6A 5FLVA 5M5WJ 4HDUA 1WWXA 2CSOA 2DYSH 5GP9A 4HEA2 1O4XA 2K02A 5IP7J 3I4MJ 4FTHA 3RYRA 2XAUA 1E17A 1W36D 5E1XA 3GTQJ 6PAXA 2OPTA 2O8XA 2A61A 3MKLA 1JKPC 2V1NA 3VPRA 5DDGA 3PM1A 1ZARA 5L3DA 2E71A 5LHGA 2ME0A 2Y30A 1E3PA 4L9NA 3L2VA 3O3KA 3V8KA 2V4JC 1RNLA 2LK2A 4RLFA 4UUSA 3OYHA 4LG0A 5GADJ 5DD4A 2DFFA 2P5LC 1PP7U 2NVYJ 3G71I 2KIUA 2L9RA 2WAQN 4UV8A 2P7VB 2LREA 1S7AA 3K69A 1JGGA 2QF7A 1SANA 2A69F 1XC5A 4XICA 2BY2A 3F72A 4ENKA 1W1WE 4I0AA 3RSNA 5L3BA 1TTYA 3AKZA 1P92A 3TL4X 1VQ8I 1ORKA 2VQGA 2ZJRF 3FMSA 4BDYA 3KLNA 2O5RA 5TRDA 3E5UA 2GXGA 1YFHA 3FBIB 3M8JA 4KYWA 2IRFG 2L01A 2H1KA 4ENJA 3MVPA 3ZQIA 2KL4A 4CUGA 2NS8A 4EVIA 2WTEA 3H5AA 1V5GA 4RGUA 5IYDJ 1LDJA 2L0KA 1D0XA 3IHUA 2BYVE 4A69C 5F1RA 1U8BA 1ZELA 1ETVA 3J80Z 1MIJA 1SFXA 1WGXA 5LRRA 3ONQA 4P55A 2PBIA 2NNYA 2HFHA 4IL6C 1DGWY 3G6EI 3RTRA 1USSA 1VFCA 2H6CA 1G3WA 3E6DA 3MD2A 2A6EF 1OPCA 1X1AA 2DA1A 2MSYA 3VEPA 2K85A 1MNMC 3DEEA 1W5TA 3EUHC 1ZLJA 3S8PA 1TC3C 2NYXA 3OIQA 3I56I 5FKLA 2HOSA 3IAS2 4BXXJ 2K9LA 1QVUA 2PI0A 1ZRDA 1F4KA 3ZQFA 2LMDA 4Y4RA 2HOTA 4N4OB 2K3PA 1K4TA 2CQXA 1S7EA 2E5NA 1CQTA 1O3RA 3ZPLA 2ZKZA 4BEHA 5IOYA 1Q1HA 3PJRA 4L0YB 4EJVA 4XOTA 2DT7B 5KCMA 1HLVA 4ZH4F 2GXBA 1V5FA 1AOYA 1F1ZA 2VC0A 3JW4A 1YX5A 4HV5A 1W4MA 4I99C 1FZPB 3MZHA 4WCGA 2VPRA 4OAYA 4XKWA 4M72A 1EJ9A 4PJLA 5EZGA 3L2CA 1YI2I 3MAJA 1MBFA 4RBOA 1K61A 4EJTA 3K6GA 2NVQJ 2WWYA 1R5ID 1FNNA 3I64A 5LD2C 5KAFC 1MDMB 2R5YB 1P7IA 2EA2A 3H5RA 1LFPA 2BXZA 4P5OA 1JHFA 2EV5A 4KN4X 2HDWA 5A2QZ 2MA3A 3CMYA 5IOZA 3HIFA 3BR2A 3KP4A 2NVTJ 1FLIA 4ZYAA 3BR5A 2FRHA 1TT0A 3HKZN 4O5VA 3BG7A 5LLQA 1ERDA 4ETSA 4B1RA 3U1DA 1ZLKA 2BVMA 2QUFA 1X2MA 2VJ5A 1XDUA 2DA7A 4I0BA 1FOKA 4Q48A 5B1AH 2EPFA 1TWGJ 1D1CA 4TV7A 5K5OA 3K0LA 3BZKA 4GGGA 3MQ0A 2F5EA 3L2QA 3SJMA 2RDPA 2LG4A 3PUFA 5FJ8J 1TQIA 3JRGA 3SFZA 1U8RA 3DQVC 3QAHA 1NK3P 4HNVA 1R00A 4BH9A 4KIFA 3ML6A 2VQHA 1OKRA 4NB5A 2DLLA 4GO1A 4AUXA 3TKYA 4B43A 4M3EA 4M6VA 3L09A 4E7KA 2JQ7A 4UY8I 3GTKJ 1ZK8A 1XGMA 4ESFA 2ZO4A 4ESJA 2JSPA 3L00A 2FA5A 4LB5A 2EZKA 3HSFA 3OV8A 1UG0A 3CP2A 3D5LA 4G6QA 2KIFA 2RVCA 4HQMA 1IRZA 4KITB 4Y3OA 3WE2A 2KKOA 3DCFA 4XQFA 4JOMA 1F36A 3VYTB 3QU6A 1FEXA 1MBHA 2GBYA 3FM3A 3HGYA 2OU2A 5FD5A 2JK3A 2ISZA 2XRNA 3MZ8A 3WGIA 4G7HF 3BCAA 4LK1F 4C9YA 3WG7H 2VT3A 3BTCA 1W0UA 2FBKA 3WTTC 3GMEA 2M30A 2YU3A 2HOEA 1XCVA 1HQCA 2CV1A 1VQPI 5CQEA 3EUHA 1Z91A 2HYGD 2DTZA 4JP0A 1IZ1A 1LFUP 5HDGA 3UNGC 1STZA 3BTLA 1QZZA 1B1BA 2M8GX 3REOA 4OIPF 4XSXF 3HTSB 2AXLA 1FMWA 3R0JA 1QRYA 3GO5A 2MC4A 2B0LA 3S1NJ 1QHGA 2EFNA 1FC3A 4C3HJ 2CO5A 4CA0A 4U0YA 4J19A 3JTGA 1NK2P 3JRIA 1K79A 5GPCA 1R36A 3GUDA 5FKOA 5HLGA 4KDPA 1J2XA 1OISA 2M4GA 3DTEA 1SVMA 3M4OJ 4WX9A 3FK6A 3LQRA 3WGHA 4A3BJ 4BE0A 3F23A 3ABLH 1HDDC 3GLXA 2R5ZB 2VL8A 3VYSB 5DM7F 1BC8C 3HOWJ 1QHHD 2L3DA 1FP2A 1IXCA 1R58A 1FWZA 3K70C 3M1EA 3HRSA 3BTIA 3AG3H 3EPZA 1D1BA 2E1CA 1QZYA 3HPHA 3G2BA 4HSRA 2JVHA 4KMUX 5BOXA 2GOXB 5F08A 1TW2A 1Z7LA 3HSRA 2IGNA 2NVUB 4CZZA 2DPDA 2IGOA 3DEUA 4GCVA 4JQFA 2LKXA 1HCRA 1UMQA 4W97A 2E1NA 4A3IJ 1G6NA 2DA4A 3A01B 4IHXA 2YR2A 5A2QK 1XN7A 2L7KA 2L7FP 1YTYA 1BR2A 3RQ4A 1YJWI 1UZCA 1YG2A 1J9IA 1ZKGA 3HRMA 1J09A 1POGA 4B47A 4RAZA 3CJTB 4MLOA 2KRCA 4XRFA 1QPMA 2KJBA 3OIOA 1I50J 3V8LA 1RC9A 1X58A 5J1RA 2PLYA 2VQCA 5HVQC 1TT5B 1YX3A 1FJLA 2ZXWH 3HPGA 3TW6A 3GFJA 2LBFA 4A3FJ 2LY9A 3ISPA 2Y9ZA 5J47A 1JT6A 4DIQA 1M1EB 3RPUA 3LNQA 1ZR4A 3LAPA 3IV5A 1OJLA 2DDAA 1IC8A 2XPWA 4LLLA 3M8FA 4XM3A 1R1UA 2V26A 4NHJA 3CCLI 1MH4A 2EILH 4IEJA 2JJ7A 3BC8A 4ON0A 2IAIA 5E18F 3HM5A 2ME6A 4A3LJ 3M07A 3FXKA 2F5DA 2DFEA 5D5XB 4EEFG 1S5LC 5BQTA 1QNTA 2QEXI 4DJAA 4AYBA 4B48A 1X1CA 3F8NA 2BGCA 4HOBA 4HF0A 3ERMA 2RQQA 2X6WA 3HB9A 2L54A 3LQQA 3OS1A 5DYMA 4S05A 1GVDA 4M9SA 4OIQF 1YIOA 3LA2A 1FY7A 2EINH 2EB7A 1O3QA 3ZGKA 4KICA 4OMZA 2P81A 3GCMA 4G6DA 4IRHA 5E3OA 3MEXA 3H36A 4R79A 2Y69H 4U87A 5CVRA 2R7ZJ 2OZ6A 3HJEA 2HVSA 1E3OC 3EDPA 2Z5UA 3S3MA 1VQOI 1I1SA 2VOOA 5TGTA 4KT5C 2ID3A 1IRXA 2LC2A 3BJOA 1WI3A 3OYIA 3D5SC 4G6TB 4M6XA 3RCOA 4LG0B 2BY0A 4OAZA 3CCVI 2LOOA 2ZMEB 3ZQ7A 3OYNA
chains in the Genus database with same CATH topology
2PMUA 2ISYA 3WTUC 2LF8A 1MDMA 2ZMEA 5L3EA 1JGSA 5KK1A 2UWMA 2IJLA 4PGGA 5ILSA 3J7AO 3IC7A 4UVCA 2QM3A 5HLHA 4FHTA 5HDKA 4A0ZA 2XROA 1FSEA 4BHCA 3KLOA 3FXUA 2CGPA 4HLXA 4IJAA 3JAMZ 4Y15A 1P4XA 5L3GA 1IRGA 2XAQA 4MNUA 1MKMA 1BBYA 3I59A 3F8MA 4RB0A 3CO6C 1ZGJA 1BJAA 4MQVA 2KIMA 1Z9CA 4HYEA 1YS7A 3KP6A 1U5TA 4Q4ZF 2P5VA 1U5TB 2CG4A 3DXJF 1MJBA 4MGRA 1ZYRF 2P6SA 2PQ8A 2X4HA 2VBZA 4WXDA 4YG2F 4HF1A 1SAXA 1Z05A 2RGVA 2OZUA 3FHZA 2Z3YA 3GXOA 2YX4A 1XSXA 1UB9A 1LEAA 2V1UA 1DDNA 2VBXA 3DPLC 1XB4A 5CVUA 1GVJA 4A12A 4HA8A 2FF4A 5K5QA 2ZJ2A 5ED4A 2EFQA 2VBWA 1V4RA 4MTDA 2J5PA 1IN6A 2XAHA 3DV8A 3ZMZA 2F5FA 2F5CA 2IP2A 1TNTA 1H9TA 4UV9A 3JTHA 2HKXA 3O6BB 3ZN1A 4EJOA 1I27A 2ACJA 4BNCA 1T2KA 2V79A 4CYDA 4I7HA 5ILVA 2Z99A 3GVAA 4AIJA 2Y75A 4KIGA 5K1YA 4P9UA 2DAOA 3LWFA 3AAFA 4A0XA 4WWCA 2HWVA 4B09A 1YW9A 4KFCA 4LGWA 5ILUA 1S8NA 2XAFA 4P96A 2V1DA 3SXYA 3U2RA 2LDUA 1KQ0A 2W85A 3MCZA 3FZVA 1GHCA 3K2ZA 1DUXC 5BMZA 2ZXJA 1S7OA 4O6JA 3LA7A 3WU0A 4G7ZF 2EA4A 2NS0A 2MC3A 1S3JA 1Z1DA 1FX7A 4M73A 5HS9A 4YFKF 3IKTA 1B6AA 4IRIA 3MZYA 2FQ3A 1U6GA 2COMA 1L3LA 5LGTA 3WTZA 5FB2A 1D8KA 5BS6A 1IN5A 4M9XA 4Y13A 1ZHFA 3CUOA 4ENMA 2C6YA 4EM2A 3I58A 1R1TA 4EM0B 2A3SA 5D5WB 3U9GA 4MTEA 4XSZF 2CQKA 1QBJA 1LNWA 4PZJA 2M8EA 3DP7A 2EJRA 4L9VA 2XKPA 4L9JA 3VOEA 1ZH5A 1BIBA 4QWQA 3I0TA 3MWMA 3KEOA 3RDIA 3ZP5A 1J7KA 3BJAA 1Y0UA 1SD4A 3KP3A 4G7OF 1HSTA 2XAJA 3DKWA 1ZREA 3BJ6A 2HTSA 3ZMVA 4RB2C 5E17F 3M9AA 2TDXA 2DK5A 5E1WA 4B8XA 1BM9A 1K6OA 1KGSA 3FM5A 2XVCA 5CLSA 3IKVA 5HS8A 1YW7A 4IF4A 2FSWA 1LVAA 3V8JA 3E5XA 2K7LA 2CYYA 1IRFA 2DU9A 4N9HA 2D1VA 3P9CA 3HRTA 5JHUA 4IHSA 3CUQC 3KP7A 4I98B 3K1PA 3RPQA 5HLIA 1TLHB 1FP1D 3GF2A 3ULQB 4U88A 3LFKA 2DT5A 2FOKA 4EGZA 5L3CA 1FYKA 3F3XA 3RJPA 4FT8A 1PDNC 1ZAOA 2O0YA 2JRTA 1LJ9A 3F6OA 5D8LB 4XLPF 5DUIA 1DP7P 1V3FA 2M1BA 3W6JB 1OMIA 1IUYA 1BI1A 1DPRA 1G3SA 2HDCA 1WSUA 3KZYA 3KZZA 5DD8A 4L5JA 3PQJA 3KCCA 3ABTA 1D3YA 2E7XA 2P6TA 4LMYA 2OQRA 4LB6B 3KP5A 4K2EA 3IRRA 3MFKA 3BOQA 4WK8F 3ZMTA 5FLXK 3O2PE 5D5UB 3HOTA 3FMRA 1K78A 4M74A 1UHWA 2UZKA 5CJ9A 1K78B 4UNOA 3F8BA 4KIBA 4EMSA 2EK5A 2A6HF 2Q0OA 3ELKA 3L7WA 4OU0A 3TO7A 1NHAA 4G9YA 1USTA 4DNCA 1D5VA 2VXZA 5FFZA 3M7GA 2XASA 1T98A 3R0AA 3IWFA 5D4SA 3IRQA 2HQRA 4A5NA 2Z9OA 4ZYEA 3TGNA 4ESBA 1H9GA 5JR3A 2ELHA 1Z6RA 1RZ4A 3J80K 4RGSA 5H6RA 4M6YA 3F6VA 3F22A 4WF2A 4M71A 2XGXA 1LDKB 4G94A 3GEZA 3V7RA 1KU9A 3QPTA 3BROA 3M8EA 4Z2YA 4U7BA 2H09A 2PG4A 2VBYA 1OYIA 1SD5A 4N9IA 5DV5A 4QLCU 1HBXG 3NEUA 1U78A 4YFNF 3T0YA 2FE3A 2NAZA 4OINF 3V7CA 1CGPA 3T1BA 4AIHA 3I54A 1EH6A 2BBYA 5D8KB 3WTYC 5D6FA 2JPBA 5ICFA 3W6KB 2HKOA 5ERIA 2G9WA 2O61A 1T39A 2DBBA 1SMTA 1P2FA 4P9FA 1O3SA 3GX4X 1XGSA 1I1GA 3LSTA 4BHBA 4HDVA 3Q9SA 4IPAA 2ZCWA 3WE3A 3SQNA 1HW1A 3SHFA 1KYWA 1IXRC 1AWCA 3C3WA 1TNSA 3JSPA 2Q2EA 4L18B 3GW2A 3QP6A 3IL2A 3QPHA 4RS8A 2G7UA 3S2WA 3PFIA 3HSEA 3CO7C 1FT9A 1HKTA 3HUGA 3DPTA 4UHTA 3H92A 1HSJA 3KEQA 4L5IA 4L9TA 2CFXA 2YSRA 5DUKA 1TW3A 2IPQX 2W24A 1EV7A 2D45A 1IN8A 2HZTA 1U2WA 1IN4A 3WTWC 3PQKA 3HTUA 1XMAA 3T5XA 4YFXF 4HX7A 1J0RA 3E6MA 4HZFA 4HBLA 5DCFA 3N97A 3VFZA 3WU1B 1MJ9A 2DFIA 1ZN2A 2GZWA 2VE8A 3RIRA 3H3ZA 4Q5SF 1T38A 2ETHA 5CVVA 4S04A 2QQBA 3WTXC 2VOPA 3JSOA 4RAYA 2JT1A 1BC7C 1O7FA 4GYIA 2QBYA 2L4MA 2D2WA 1Z6TA 4PCQA 1ZRCA 3J81Z 4KA4A 4WXHA 4Y17A 2QYOA 5D4RA 5J8FA 4I02A 1UHMA 3HHGA 4KUMA 1BIAA 4AD9A 3E3VA 3QP5A 2W57A 3TO6A 2EWNA 3E97A 1FPQA 1B9MA 1WI9A 1BI2A 2FXAA 5CYVA 4ASNA 4EQQA 5BPDA 4KN7X 4EV0A 4JK1X 3K1NA 3I59B 2YPRA 1EH8A 2RQPA 1XMKA 1H0MA 3QOPA 1UCRA 4AWXB 1QQIA 4RB3C 5K5RA 4UUVA 5EEGA 2QENA 2DTRA 1CF7B 3GWZA 2DK8A 5ICEA 2DPUA 3G73A 2O6GE 2ZNZA 2H94A 5LGUA 4IHTA 1J75A 4Q47A 1R7JA 1IW7F 1FBSA 4ZZLA 2EFPA 2V1XA 1YS6A 2P7CB 4IXAA 4R8HA 2F2EA 3FMQA 2Q8KA 4H0EA 5FD6A 3K9TA 4ZYDA 2PEXA 5E8GA 4CGZA 4ZYGA 4N0BA 2P4WA 5ICCA 2GQQA 5H6QA 4RGXA 2QBYB 3CUQA 2HYFA 1LQ1A 2D1HA 1TQPA 4MEXF 2QWWA 4HAMA 1OR7A 2L4AA 1RIOH 4I2OA 1YLFA 4U0VA 2ADUA 1ZG5A 5D6EA 2HR3A 4WXCA 2IA1A 3FXRA 4GXOA 2V9VA 2W25A 3V7SA 2LKPA 4HX4A 2GA2A 1JE8A 4HV6A 4O3MA 2IA2A 4LJZF 4L0ZB 5JVTA 1O3TA 2K86A 2JTVA 2XUBA 1U3EM 1LEBA 2PMHA 3NQOA 2EV6A 2E7WA 3V4GA 1ODDA 2RV8A 4EGYA 2R7DA 3H3UA 1SMYF 3B73A 3L9FA 3NRVA 5HDNA 2G7HA 3RKXA 1WRJA 3KP2A 3ABUA 2DQRA 4XLNF 4HX8A 3T8RA 3EYIA 2ZNYA 1XGNA 2QQAA 2VONA 1R5HA 4OMYA 3KE2A 3DF8A 5AIPA 1REPC 3WG9A 1GXPA 4F7ZA 1FBQA 4LK0F 5FO5A 2WC2A 3SZTA 5L3FA 3TDZC 1LB2A 1R22A 5JFRA 1ONVA 2ESHA 5LBQA 3RYPA 1U5TC 2RKHA 5JI6A 3R61A 5FLXZ 2FNAA 5LEKA 4IVNA 1P6RA 1O57A 3N4MA 2J5OA 1BN5A 2FBHA 3DFGA 3FX3A 1KA8A 5DCMB 1HKQA 4DQ2A 4A0YA 2IW5A 2LSOA 3QU3A 3QRFF 2L02A 3K1MA 2XAGA 5AONA 5FFXA 3F8FA 5LHIA 3BP8A 4HQEA 2YX7A 3I71A 3WTSC 1KYZA 3TQNA 2H27A 4LLGF 4BXUA 2EFOA 3ZMDA 1MGTA 3R6SA 2X0LA 2A07F 2MLKA 4A6EA 2UXNA 1T6SA 2GIVA 1SFEA 3HHHA 2MLGA 2AS5F 1OYWA 1PUEE 2ESNA 2NNNA 2OAZA 3P9KA 2FMLA 2PN6A 3E6BA 4EJUA 1ZG3A 4UVAA 3HOSA 4U7DA 3ERED 1MJAA 3GFIA 3G3ZA 1WQ2A 1W7PA 2A5YB 2NRAC 1JHHA 2FMYA 1RUNA 3ZN0A 3VB2A 1WKMA 1XSVA 2OQGA 4EJWA 2KRFA 5CVJA 2VODA 1G3TA 4IRGA 2DI3A 2STWA 1BI0A 1KU2A 4HLYA 3C7JA 3I5UA 4ZZDA 3WTVC 3T8TA 3BPVA 2XIGA 3CJNA 1BOAA 2LF7A 3CUQB 3R60A 5LHHA 4PDKA 4FX4A 3LA3A 2M45A 4AVPA 2Y0MA 3GFMA 1L0OC 3BWGA 5E1ZB 5IT3A 3E6CC 2IA0A 1P4WA 3TO9A 1C0WA 1DPUA 2DO7A 1Z7UA 3ECOA 1ULYA 4HW0A 4CHUA 1HKSA 4BHPA 1SD7A 3ECHA 2PJPA 3BDDA 4BYYA 3GFLA 4JBAA 4LFUA 1GXQA 3P7NA 3TOBA 1IXSB 1B4AA 5HS7A 1IF1A 3KETA 3RKYA 3JAMK 5FGMA 1T0FA 4R1HA 5F64A 2HGCA 5TJJA 2XKOA 4MQ9F 3GZ5A 4YIIA 5LGNA 1EH7A 2HS5A 4I01A 3HYIA 1F9NA 3LAJA 1I6XA 3IWZA 2FBIA 2IT0A 1KU7A 2HTJA 5D5VB 2R3SA 3FF5A 4LLNA 1W7PD 2R7FA 1R5GA 1R23A 2W84A 4RB1A 1J5YA 1YO5C 1TBXA 2UXXA 2DQLA 4UVBA 1ON2A 2RNJA 4D0PA 1RUOA 4AIKA 1ZGAA 2EFWA 5E20A 2JZYA 2M5WA 5ICGA 4OOIA 5DCMA 2A68F 4CO8A 1IAWA 4CDGA 2P5KA 2KJCA 1QGPA 1FYMA 4PGHA 2MH2A 4UXNA 2M87A 1QO0D 2LNBA 2O03A 3WODF 4A5MA 1X3UA 1P4AA 4BAYA 1S29A 1YYVA 2VT2A 5AIQA 3TDUC 4KNYA 5E8IA 1OYYA 5J6XA 1XSDA 1K7AA 1HXDA 1R1VA 1JXSA 3HRUA 5J8CA 3B02A 3ZMSA 1E2XA 2MBFA 1CF7A 2K27A 2BE5F 2FU4A 5IT9Z 2JSCA 3GZ6A 1W7PB 4BQAA 1A04A 3KFWX 1IN7A 2XHKA 1XDSA 3ZMUA 4NQWA 2V6CA 3Q5FA 4HF2A 1B9NA 4LD5A 3CLOA 2Z33A 2WV0A 1F5TA 2BV6A 1XD7A 4YIFA 1PP8F 1HW5A 1YQAA 4I09A 2P8TA 2FNPA 2H6BA 4RGRA 3FXQA 5LRSA 4CICA 3BZ6A 2OBPA 4ENNA 3EQLF 1FYLA 3F21A 2BEOA 1G3YA 3COAC 1MZBA 5LEJA 2GAUA 5H20A 1XGOA 2MD5A 3R4KA 1J59A 2VN2A 3OOPA 2XV4S 3EETA 1SD6A 2CW0F 2QLZA 1HW2A 3C1DA 3D0SA 2DW4A 2GWRA 2VC1A 5EEHA 1ZG1A 2QVOA 5F6FA 2VE9A 1TQMA 2EV0A 1D8JA 2HQNA 3EYYA 1ZRFA 3RKWA 1ON1A 3CTAA 2K4JA 1S6LA 5CVIA 1YW8A 4G8XA 3FWEA 2HEOA 1MD0A 1B59A 4E70A 3SZPA 4XBFA 2PFBA 2K4BA 1SFUA 1BI3A 5BPIA 2FEZA 3F8CA 5KVRA 2RC4A 2QQ9A 1KQ8A 2QZ8A 4OIOF 4M9ZA 1FSHA 3BPXA 2IVMA 4EM1A 2ZFWA 4A6DA 1G4DA 3J81K 1UFMA 1FBUA 1W5SA 4OIRF 1XCBA 3P9IA 1LDDA 4MEYF 1VTNC 3ROUA 2STTA 2ZBKA 3I4PA 4CXFA 5IT9K 3Q9VA 1O7LA 4U0WA 3E5QA 3CDHA 1KQ9A 2OD5A 2Y48A 3TOAA 3VODA 3I53A 2CWEA 1RI7A 4MHGA 3WGGA 2JPCA 2MH9A 5HOOA 1KU3A 4ZYHA 4FX0A 2OA4A 4GYGA 4KMFA 4A2UA 5DEQA 2GA1A 3C18A 2RN7A 2O3FA 3GYHX 1I5ZA 3RI4A 3BY6A 4HDUA 1WWXA 2CSOA 2K02A 3RYRA 1E17A 5E1XA 6PAXA 2O8XA 2A61A 5DDGA 1ZARA 5L3DA 5LHGA 4L9NA 3O3KA 3V8KA 1RNLA 4LG0A 5DD4A 2P5LC 1PP7U 2KIUA 4UV8A 2P7VB 1S7AA 3K69A 2A69F 3F72A 4ENKA 4I0AA 5L3BA 1TTYA 1P92A 3FMSA 3KLNA 5TRDA 3E5UA 2GXGA 1YFHA 4KYWA 2IRFG 2L01A 4ENJA 4EVIA 2WTEA 4RGUA 1LDJA 3IHUA 2BYVE 5F1RA 3J80Z 1SFXA 5LRRA 4P55A 2PBIA 2NNYA 2HFHA 3RTRA 1USSA 2H6CA 1G3WA 3E6DA 2A6EF 1OPCA 3VEPA 1W5TA 1ZLJA 2NYXA 2PI0A 1ZRDA 1F4KA 1O3RA 3ZPLA 2ZKZA 1Q1HA 4L0YB 4EJVA 4ZH4F 2GXBA 1AOYA 1F1ZA 2VC0A 3JW4A 4HV5A 1W4MA 1FZPB 3MZHA 4WCGA 4M72A 3L2CA 3MAJA 4EJTA 2WWYA 3I64A 1FNNA 1MDMB 2EA2A 4P5OA 5A2QZ 1JHFA 2EV5A 4KN4X 2MA3A 3HIFA 3KP4A 1FLIA 2FRHA 4O5VA 5LLQA 4ETSA 3U1DA 1ZLKA 2QUFA 1XDUA 4I0BA 1FOKA 4Q48A 5K5OA 4TV7A 3K0LA 4GGGA 3MQ0A 2F5EA 2RDPA 1TQIA 3SFZA 1U8RA 3DQVC 3QAHA 1R00A 4BH9A 4KIFA 3ML6A 1OKRA 4NB5A 2DLLA 4GO1A 3TKYA 3L09A 4ESFA 1XGMA 2ZO4A 4ESJA 3L00A 2FA5A 4LB5A 3OV8A 3HSFA 3D5LA 4G6QA 2KIFA 2RVCA 4HQMA 3WE2A 2KKOA 3QU6A 3FM3A 2OU2A 5FD5A 2ISZA 2XRNA 3WGIA 4G7HF 4LK1F 2VT3A 2FBKA 3WTTC 2M30A 2YU3A 2HOEA 1XCVA 1HQCA 3EUHA 1Z91A 2HYGD 1IZ1A 5HDGA 1STZA 1QZZA 1B1BA 3REOA 4OIPF 4XSXF 3HTSB 2AXLA 3R0JA 3GO5A 2B0LA 2EFNA 1FC3A 2CO5A 4U0YA 3JTGA 1K79A 5HLGA 1R36A 3GUDA 4KDPA 1J2XA 4WX9A 3LQRA 3WGHA 3F23A 3GLXA 1BC8C 2L3DA 1FP2A 1IXCA 1R58A 1FWZA 3M1EA 3HRSA 2E1CA 1QZYA 4KMUX 5BOXA 1TW2A 3HSRA 4CZZA 2DPDA 3DEUA 4GCVA 4JQFA 2E1NA 1G6NA 2YR2A 5A2QK 1XN7A 1YTYA 1J9IA 1YG2A 3HRMA 4RAZA 4XRFA 1QPMA 2KJBA 3V8LA 2PLYA 5HVQC 3GFJA 3ISPA 3RPUA 3LAPA 4LLLA 3M8FA 1R1UA 4NHJA 4ON0A 5E18F 2F5DA 5D5XB 5BQTA 1QNTA 3F8NA 2BGCA 4HOBA 4HF0A 2L54A 3LQQA 5DYMA 4S05A 4OIQF 4M9SA 1YIOA 3LA2A 1FY7A 2EB7A 1O3QA 4KICA 4OMZA 4G6DA 4IRHA 3MEXA 4R79A 5CVRA 2OZ6A 3EDPA 2Z5UA 1I1SA 2VOOA 4KT5C 3BJOA 4M6XA 4LG0B 2ZMEB 3ZQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMU A;  2ISY A;  3WTU C;  2LF8 A;  1MDM A;  2ZME A;  5L3E A;  1JGS A;  5KK1 A;  2UWM A;  2IJL A;  4PGG A;  5ILS A;  3J7A O;  3IC7 A;  4UVC A;  2QM3 A;  5HLH A;  4FHT A;  5HDK A;  4A0Z A;  2XRO A;  1FSE A;  4BHC A;  3KLO A;  3FXU A;  2CGP A;  4HLX A;  4IJA A;  3JAM Z;  4Y15 A;  1P4X A;  5L3G A;  1IRG A;  2XAQ A;  4MNU A;  1MKM A;  1BBY A;  3I59 A;  3F8M A;  4RB0 A;  3CO6 C;  1ZGJ A;  1BJA A;  4MQV A;  2KIM A;  1Z9C A;  4HYE A;  1YS7 A;  3KP6 A;  1U5T A;  4Q4Z F;  2P5V A;  1U5T B;  2CG4 A;  3DXJ F;  1MJB A;  4MGR A;  1ZYR F;  2P6S A;  2PQ8 A;  2X4H A;  2VBZ A;  4WXD A;  4YG2 F;  4HF1 A;  1SAX A;  1Z05 A;  2RGV A;  2OZU A;  3FHZ A;  2Z3Y A;  3GXO A;  2YX4 A;  1XSX A;  1UB9 A;  1LEA A;  2V1U A;  1DDN A;  2VBX A;  3DPL C;  1XB4 A;  5CVU A;  1GVJ A;  4A12 A;  4HA8 A;  2FF4 A;  5K5Q A;  2ZJ2 A;  5ED4 A;  2EFQ A;  2VBW A;  1V4R A;  4MTD A;  2J5P A;  1IN6 A;  2XAH A;  3DV8 A;  3ZMZ A;  2F5F A;  2F5C A;  2IP2 A;  1TNT A;  1H9T A;  4UV9 A;  3JTH A;  2HKX A;  3O6B B;  3ZN1 A;  4EJO A;  1I27 A;  2ACJ A;  4BNC A;  1T2K A;  2V79 A;  4CYD A;  4I7H A;  5ILV A;  2Z99 A;  3GVA A;  4AIJ A;  2Y75 A;  4KIG A;  5K1Y A;  4P9U A;  2DAO A;  3LWF A;  3AAF A;  4A0X A;  4WWC A;  2HWV A;  4B09 A;  1YW9 A;  4KFC A;  4LGW A;  5ILU A;  1S8N A;  2XAF A;  4P96 A;  2V1D A;  3SXY A;  3U2R A;  2LDU A;  1KQ0 A;  2W85 A;  3MCZ A;  3FZV A;  1GHC A;  3K2Z A;  1DUX C;  5BMZ A;  2ZXJ A;  1S7O A;  4O6J A;  3LA7 A;  3WU0 A;  4G7Z F;  2EA4 A;  2NS0 A;  2MC3 A;  1S3J A;  1Z1D A;  1FX7 A;  4M73 A;  5HS9 A;  4YFK F;  3IKT A;  1B6A A;  4IRI A;  3MZY A;  2FQ3 A;  1U6G A;  2COM A;  1L3L A;  5LGT A;  3WTZ A;  5FB2 A;  1D8K A;  5BS6 A;  1IN5 A;  4M9X A;  4Y13 A;  1ZHF A;  3CUO A;  4ENM A;  2C6Y A;  4EM2 A;  3I58 A;  1R1T A;  4EM0 B;  2A3S A;  5D5W B;  3U9G A;  4MTE A;  4XSZ F;  2CQK A;  1QBJ A;  1LNW A;  4PZJ A;  2M8E A;  3DP7 A;  2EJR A;  4L9V A;  2XKP A;  4L9J A;  3VOE A;  1ZH5 A;  1BIB A;  4QWQ A;  3I0T A;  3MWM A;  3KEO A;  3RDI A;  3ZP5 A;  1J7K A;  3BJA A;  1Y0U A;  1SD4 A;  3KP3 A;  4G7O F;  1HST A;  2XAJ A;  3DKW A;  1ZRE A;  3BJ6 A;  2HTS A;  3ZMV A;  4RB2 C;  5E17 F;  3M9A A;  2TDX A;  2DK5 A;  5E1W A;  4B8X A;  1BM9 A;  1K6O A;  1KGS A;  3FM5 A;  2XVC A;  5CLS A;  3IKV A;  5HS8 A;  1YW7 A;  4IF4 A;  2FSW A;  1LVA A;  3V8J A;  3E5X A;  2K7L A;  2CYY A;  1IRF A;  2DU9 A;  4N9H A;  2D1V A;  3P9C A;  3HRT A;  5JHU A;  4IHS A;  3CUQ C;  3KP7 A;  4I98 B;  3K1P A;  3RPQ A;  5HLI A;  1TLH B;  1FP1 D;  3GF2 A;  3ULQ B;  4U88 A;  3LFK A;  2DT5 A;  2FOK A;  4EGZ A;  5L3C A;  1FYK A;  3F3X A;  3RJP A;  4FT8 A;  1PDN C;  1ZAO A;  2O0Y A;  2JRT A;  1LJ9 A;  3F6O A;  5D8L B;  4XLP F;  5DUI A;  1DP7 P;  1V3F A;  2M1B A;  3W6J B;  1OMI A;  1IUY A;  1BI1 A;  1DPR A;  1G3S A;  2HDC A;  1WSU A;  3KZY A;  3KZZ A;  5DD8 A;  4L5J A;  3PQJ A;  3KCC A;  3ABT A;  1D3Y A;  2E7X A;  2P6T A;  4LMY A;  2OQR A;  4LB6 B;  3KP5 A;  4K2E A;  3IRR A;  3MFK A;  3BOQ A;  4WK8 F;  3ZMT A;  5FLX K;  3O2P E;  5D5U B;  3HOT A;  3FMR A;  1K78 A;  4M74 A;  1UHW A;  2UZK A;  5CJ9 A;  1K78 B;  4UNO A;  3F8B A;  4KIB A;  4EMS A;  2EK5 A;  2A6H F;  2Q0O A;  3ELK A;  3L7W A;  4OU0 A;  3TO7 A;  1NHA A;  4G9Y A;  1UST A;  4DNC A;  1D5V A;  2VXZ A;  5FFZ A;  3M7G A;  2XAS A;  1T98 A;  3R0A A;  3IWF A;  5D4S A;  3IRQ A;  2HQR A;  4A5N A;  2Z9O A;  4ZYE A;  3TGN A;  4ESB A;  1H9G A;  5JR3 A;  2ELH A;  1Z6R A;  1RZ4 A;  3J80 K;  4RGS A;  5H6R A;  4M6Y A;  3F6V A;  3F22 A;  4WF2 A;  4M71 A;  2XGX A;  1LDK B;  4G94 A;  3GEZ A;  3V7R A;  1KU9 A;  3QPT A;  3BRO A;  3M8E A;  4Z2Y A;  4U7B A;  2H09 A;  2PG4 A;  2VBY A;  1OYI A;  1SD5 A;  4N9I A;  5DV5 A;  4QLC U;  1HBX G;  3NEU A;  1U78 A;  4YFN F;  3T0Y A;  2FE3 A;  2NAZ A;  4OIN F;  3V7C A;  1CGP A;  3T1B A;  4AIH A;  3I54 A;  1EH6 A;  2BBY A;  5D8K B;  3WTY C;  5D6F A;  2JPB A;  5ICF A;  3W6K B;  2HKO A;  5ERI A;  2G9W A;  2O61 A;  1T39 A;  2DBB A;  1SMT A;  1P2F A;  4P9F A;  1O3S A;  3GX4 X;  1XGS A;  1I1G A;  3LST A;  4BHB A;  4HDV A;  3Q9S A;  4IPA A;  2ZCW A;  3WE3 A;  3SQN A;  1HW1 A;  3SHF A;  1KYW A;  1IXR C;  1AWC A;  3C3W A;  1TNS A;  3JSP A;  2Q2E A;  4L18 B;  3GW2 A;  3QP6 A;  3IL2 A;  3QPH A;  4RS8 A;  2G7U A;  3S2W A;  3PFI A;  3HSE A;  3CO7 C;  1FT9 A;  1HKT A;  3HUG A;  3DPT A;  4UHT A;  3H92 A;  1HSJ A;  3KEQ A;  4L5I A;  4L9T A;  2CFX A;  2YSR A;  5DUK A;  1TW3 A;  2IPQ X;  2W24 A;  1EV7 A;  2D45 A;  1IN8 A;  2HZT A;  1U2W A;  1IN4 A;  3WTW C;  3PQK A;  3HTU A;  1XMA A;  3T5X A;  4YFX F;  4HX7 A;  1J0R A;  3E6M A;  4HZF A;  4HBL A;  5DCF A;  3N97 A;  3VFZ A;  3WU1 B;  1MJ9 A;  2DFI A;  1ZN2 A;  2GZW A;  2VE8 A;  3RIR A;  3H3Z A;  4Q5S F;  1T38 A;  2ETH A;  5CVV A;  4S04 A;  2QQB A;  3WTX C;  2VOP A;  3JSO A;  4RAY A;  2JT1 A;  1BC7 C;  1O7F A;  4GYI A;  2QBY A;  2L4M A;  2D2W A;  1Z6T A;  4PCQ A;  1ZRC A;  3J81 Z;  4KA4 A;  4WXH A;  4Y17 A;  2QYO A;  5D4R A;  5J8F A;  4I02 A;  1UHM A;  3HHG A;  4KUM A;  1BIA A;  4AD9 A;  3E3V A;  3QP5 A;  2W57 A;  3TO6 A;  2EWN A;  3E97 A;  1FPQ A;  1B9M A;  1WI9 A;  1BI2 A;  2FXA A;  5CYV A;  4ASN A;  4EQQ A;  5BPD A;  4KN7 X;  4EV0 A;  4JK1 X;  3K1N A;  3I59 B;  2YPR A;  1EH8 A;  2RQP A;  1XMK A;  1H0M A;  3QOP A;  1UCR A;  4AWX B;  1QQI A;  4RB3 C;  5K5R A;  4UUV A;  5EEG A;  2QEN A;  2DTR A;  1CF7 B;  3GWZ A;  2DK8 A;  5ICE A;  2DPU A;  3G73 A;  2O6G E;  2ZNZ A;  2H94 A;  5LGU A;  4IHT A;  1J75 A;  4Q47 A;  1R7J A;  1IW7 F;  1FBS A;  4ZZL A;  2EFP A;  2V1X A;  1YS6 A;  2P7C B;  4IXA A;  4R8H A;  2F2E A;  3FMQ A;  2Q8K A;  4H0E A;  5FD6 A;  3K9T A;  4ZYD A;  2PEX A;  5E8G A;  4CGZ A;  4ZYG A;  4N0B A;  2P4W A;  5ICC A;  2GQQ A;  5H6Q A;  4RGX A;  2QBY B;  3CUQ A;  2HYF A;  1LQ1 A;  2D1H A;  1TQP A;  4MEX F;  2QWW A;  4HAM A;  1OR7 A;  2L4A A;  1RIO H;  4I2O A;  1YLF A;  4U0V A;  2ADU A;  1ZG5 A;  5D6E A;  2HR3 A;  4WXC A;  2IA1 A;  3FXR A;  4GXO A;  2V9V A;  2W25 A;  3V7S A;  2LKP A;  4HX4 A;  2GA2 A;  1JE8 A;  4HV6 A;  4O3M A;  2IA2 A;  4LJZ F;  4L0Z B;  5JVT A;  1O3T A;  2K86 A;  2JTV A;  2XUB A;  1U3E M;  1LEB A;  2PMH A;  3NQO A;  2EV6 A;  2E7W A;  3V4G A;  1ODD A;  2RV8 A;  4EGY A;  2R7D A;  3H3U A;  1SMY F;  3B73 A;  3L9F A;  3NRV A;  5HDN A;  2G7H A;  3RKX A;  1WRJ A;  3KP2 A;  3ABU A;  2DQR A;  4XLN F;  4HX8 A;  3T8R A;  3EYI A;  2ZNY A;  1XGN A;  2QQA A;  2VON A;  1R5H A;  4OMY A;  3KE2 A;  3DF8 A;  5AIP A;  1REP C;  3WG9 A;  1GXP A;  4F7Z A;  1FBQ A;  4LK0 F;  5FO5 A;  2WC2 A;  3SZT A;  5L3F A;  3TDZ C;  1LB2 A;  1R22 A;  5JFR A;  1ONV A;  2ESH A;  5LBQ A;  3RYP A;  1U5T C;  2RKH A;  5JI6 A;  3R61 A;  5FLX Z;  2FNA A;  5LEK A;  4IVN A;  1P6R A;  1O57 A;  3N4M A;  2J5O A;  1BN5 A;  2FBH A;  3DFG A;  3FX3 A;  1KA8 A;  5DCM B;  1HKQ A;  4DQ2 A;  4A0Y A;  2IW5 A;  2LSO A;  3QU3 A;  3QRF F;  2L02 A;  3K1M A;  2XAG A;  5AON A;  5FFX A;  3F8F A;  5LHI A;  3BP8 A;  4HQE A;  2YX7 A;  3I71 A;  3WTS C;  1KYZ A;  3TQN A;  2H27 A;  4LLG F;  4BXU A;  2EFO A;  3ZMD A;  1MGT A;  3R6S A;  2X0L A;  2A07 F;  2MLK A;  4A6E A;  2UXN A;  1T6S A;  2GIV A;  1SFE A;  3HHH A;  2MLG A;  2AS5 F;  1OYW A;  1PUE E;  2ESN A;  2NNN A;  2OAZ A;  3P9K A;  2FML A;  2PN6 A;  3E6B A;  4EJU A;  1ZG3 A;  4UVA A;  3HOS A;  4U7D A;  3ERE D;  1MJA A;  3GFI A;  3G3Z A;  1WQ2 A;  1W7P A;  2A5Y B;  2NRA C;  1JHH A;  2FMY A;  1RUN A;  3ZN0 A;  3VB2 A;  1WKM A;  1XSV A;  2OQG A;  4EJW A;  2KRF A;  5CVJ A;  2VOD A;  1G3T A;  4IRG A;  2DI3 A;  2STW A;  1BI0 A;  1KU2 A;  4HLY A;  3C7J A;  3I5U A;  4ZZD A;  3WTV C;  3T8T A;  3BPV A;  2XIG A;  3CJN A;  1BOA A;  2LF7 A;  3CUQ B;  3R60 A;  5LHH A;  4PDK A;  4FX4 A;  3LA3 A;  2M45 A;  4AVP A;  2Y0M A;  3GFM A;  1L0O C;  3BWG A;  5E1Z B;  5IT3 A;  3E6C C;  2IA0 A;  1P4W A;  3TO9 A;  1C0W A;  1DPU A;  2DO7 A;  1Z7U A;  3ECO A;  1ULY A;  4HW0 A;  4CHU A;  1HKS A;  4BHP A;  1SD7 A;  3ECH A;  2PJP A;  3BDD A;  4BYY A;  3GFL A;  4JBA A;  4LFU A;  1GXQ A;  3P7N A;  3TOB A;  1IXS B;  1B4A A;  5HS7 A;  1IF1 A;  3KET A;  3RKY A;  3JAM K;  5FGM A;  1T0F A;  4R1H A;  5F64 A;  2HGC A;  5TJJ A;  2XKO A;  4MQ9 F;  3GZ5 A;  4YII A;  5LGN A;  1EH7 A;  2HS5 A;  4I01 A;  3HYI A;  1F9N A;  3LAJ A;  1I6X A;  3IWZ A;  2FBI A;  2IT0 A;  1KU7 A;  2HTJ A;  5D5V B;  2R3S A;  3FF5 A;  4LLN A;  1W7P D;  2R7F A;  1R5G A;  1R23 A;  2W84 A;  4RB1 A;  1J5Y A;  1YO5 C;  1TBX A;  2UXX A;  2DQL A;  4UVB A;  1ON2 A;  2RNJ A;  4D0P A;  1RUO A;  4AIK A;  1ZGA A;  2EFW A;  5E20 A;  2JZY A;  2M5W A;  5ICG A;  4OOI A;  5DCM A;  2A68 F;  4CO8 A;  1IAW A;  4CDG A;  2P5K A;  2KJC A;  1QGP A;  1FYM A;  4PGH A;  2MH2 A;  4UXN A;  2M87 A;  1QO0 D;  2LNB A;  2O03 A;  3WOD F;  4A5M A;  1X3U A;  1P4A A;  4BAY A;  1S29 A;  1YYV A;  2VT2 A;  5AIQ A;  3TDU C;  4KNY A;  5E8I A;  1OYY A;  5J6X A;  1XSD A;  1K7A A;  1HXD A;  1R1V A;  1JXS A;  3HRU A;  5J8C A;  3B02 A;  3ZMS A;  1E2X A;  2MBF A;  1CF7 A;  2K27 A;  2BE5 F;  2FU4 A;  5IT9 Z;  2JSC A;  3GZ6 A;  1W7P B;  4BQA A;  1A04 A;  3KFW X;  1IN7 A;  2XHK A;  1XDS A;  3ZMU A;  4NQW A;  2V6C A;  3Q5F A;  4HF2 A;  1B9N A;  4LD5 A;  3CLO A;  2Z33 A;  2WV0 A;  1F5T A;  2BV6 A;  1XD7 A;  4YIF A;  1PP8 F;  1HW5 A;  1YQA A;  4I09 A;  2P8T A;  2FNP A;  2H6B A;  4RGR A;  3FXQ A;  5LRS A;  4CIC A;  3BZ6 A;  2OBP A;  4ENN A;  3EQL F;  1FYL A;  3F21 A;  2BEO A;  1G3Y A;  3COA C;  1MZB A;  5LEJ A;  2GAU A;  5H20 A;  1XGO A;  2MD5 A;  3R4K A;  1J59 A;  2VN2 A;  3OOP A;  2XV4 S;  3EET A;  1SD6 A;  2CW0 F;  2QLZ A;  1HW2 A;  3C1D A;  3D0S A;  2DW4 A;  2GWR A;  2VC1 A;  5EEH A;  1ZG1 A;  2QVO A;  5F6F A;  2VE9 A;  1TQM A;  2EV0 A;  1D8J A;  2HQN A;  3EYY A;  1ZRF A;  3RKW A;  1ON1 A;  3CTA A;  2K4J A;  1S6L A;  5CVI A;  1YW8 A;  4G8X A;  3FWE A;  2HEO A;  1MD0 A;  1B59 A;  4E70 A;  3SZP A;  4XBF A;  2PFB A;  2K4B A;  1SFU A;  1BI3 A;  5BPI A;  2FEZ A;  3F8C A;  5KVR A;  2RC4 A;  2QQ9 A;  1KQ8 A;  2QZ8 A;  4OIO F;  4M9Z A;  1FSH A;  3BPX A;  2IVM A;  4EM1 A;  2ZFW A;  4A6D A;  1G4D A;  3J81 K;  1UFM A;  1FBU A;  1W5S A;  4OIR F;  1XCB A;  3P9I A;  1LDD A;  4MEY F;  1VTN C;  3ROU A;  2STT A;  2ZBK A;  3I4P A;  4CXF A;  5IT9 K;  3Q9V A;  1O7L A;  4U0W A;  3E5Q A;  3CDH A;  1KQ9 A;  2OD5 A;  2Y48 A;  3TOA A;  3VOD A;  3I53 A;  2CWE A;  1RI7 A;  4MHG A;  3WGG A;  2JPC A;  2MH9 A;  5HOO A;  1KU3 A;  4ZYH A;  4FX0 A;  2OA4 A;  4GYG A;  4KMF A;  4A2U A;  5DEQ A;  2GA1 A;  3C18 A;  2RN7 A;  2O3F A;  3GYH X;  1I5Z A;  3RI4 A;  3BY6 A;  4HDU A;  1WWX A;  2CSO A;  2K02 A;  3RYR A;  1E17 A;  5E1X A;  6PAX A;  2O8X A;  2A61 A;  5DDG A;  1ZAR A;  5L3D A;  5LHG A;  4L9N A;  3O3K A;  3V8K A;  1RNL A;  4LG0 A;  5DD4 A;  2P5L C;  1PP7 U;  2KIU A;  4UV8 A;  2P7V B;  1S7A A;  3K69 A;  2A69 F;  3F72 A;  4ENK A;  4I0A A;  5L3B A;  1TTY A;  1P92 A;  3FMS A;  3KLN A;  5TRD A;  3E5U A;  2GXG A;  1YFH A;  4KYW A;  2IRF G;  2L01 A;  4ENJ A;  4EVI A;  2WTE A;  4RGU A;  1LDJ A;  3IHU A;  2BYV E;  5F1R A;  3J80 Z;  1SFX A;  5LRR A;  4P55 A;  2PBI A;  2NNY A;  2HFH A;  3RTR A;  1USS A;  2H6C A;  1G3W A;  3E6D A;  2A6E F;  1OPC A;  3VEP A;  1W5T A;  1ZLJ A;  2NYX A;  2PI0 A;  1ZRD A;  1F4K A;  1O3R A;  3ZPL A;  2ZKZ A;  1Q1H A;  4L0Y B;  4EJV A;  4ZH4 F;  2GXB A;  1AOY A;  1F1Z A;  2VC0 A;  3JW4 A;  4HV5 A;  1W4M A;  1FZP B;  3MZH A;  4WCG A;  4M72 A;  3L2C A;  3MAJ A;  4EJT A;  2WWY A;  3I64 A;  1FNN A;  1MDM B;  2EA2 A;  4P5O A;  5A2Q Z;  1JHF A;  2EV5 A;  4KN4 X;  2MA3 A;  3HIF A;  3KP4 A;  1FLI A;  2FRH A;  4O5V A;  5LLQ A;  4ETS A;  3U1D A;  1ZLK A;  2QUF A;  1XDU A;  4I0B A;  1FOK A;  4Q48 A;  5K5O A;  4TV7 A;  3K0L A;  4GGG A;  3MQ0 A;  2F5E A;  2RDP A;  1TQI A;  3SFZ A;  1U8R A;  3DQV C;  3QAH A;  1R00 A;  4BH9 A;  4KIF A;  3ML6 A;  1OKR A;  4NB5 A;  2DLL A;  4GO1 A;  3TKY A;  3L09 A;  4ESF A;  1XGM A;  2ZO4 A;  4ESJ A;  3L00 A;  2FA5 A;  4LB5 A;  3OV8 A;  3HSF A;  3D5L A;  4G6Q A;  2KIF A;  2RVC A;  4HQM A;  3WE2 A;  2KKO A;  3QU6 A;  3FM3 A;  2OU2 A;  5FD5 A;  2ISZ A;  2XRN A;  3WGI A;  4G7H F;  4LK1 F;  2VT3 A;  2FBK A;  3WTT C;  2M30 A;  2YU3 A;  2HOE A;  1XCV A;  1HQC A;  3EUH A;  1Z91 A;  2HYG D;  1IZ1 A;  5HDG A;  1STZ A;  1QZZ A;  1B1B A;  3REO A;  4OIP F;  4XSX F;  3HTS B;  2AXL A;  3R0J A;  3GO5 A;  2B0L A;  2EFN A;  1FC3 A;  2CO5 A;  4U0Y A;  3JTG A;  1K79 A;  5HLG A;  1R36 A;  3GUD A;  4KDP A;  1J2X A;  4WX9 A;  3LQR A;  3WGH A;  3F23 A;  3GLX A;  1BC8 C;  2L3D A;  1FP2 A;  1IXC A;  1R58 A;  1FWZ A;  3M1E A;  3HRS A;  2E1C A;  1QZY A;  4KMU X;  5BOX A;  1TW2 A;  3HSR A;  4CZZ A;  2DPD A;  3DEU A;  4GCV A;  4JQF A;  2E1N A;  1G6N A;  2YR2 A;  5A2Q K;  1XN7 A;  1YTY A;  1J9I A;  1YG2 A;  3HRM A;  4RAZ A;  4XRF A;  1QPM A;  2KJB A;  3V8L A;  2PLY A;  5HVQ C;  3GFJ A;  3ISP A;  3RPU A;  3LAP A;  4LLL A;  3M8F A;  1R1U A;  4NHJ A;  4ON0 A;  5E18 F;  2F5D A;  5D5X B;  5BQT A;  1QNT A;  3F8N A;  2BGC A;  4HOB A;  4HF0 A;  2L54 A;  3LQQ A;  5DYM A;  4S05 A;  4OIQ F;  4M9S A;  1YIO A;  3LA2 A;  1FY7 A;  2EB7 A;  1O3Q A;  4KIC A;  4OMZ A;  4G6D A;  4IRH A;  3MEX A;  4R79 A;  5CVR A;  2OZ6 A;  3EDP A;  2Z5U A;  1I1S A;  2VOO A;  4KT5 C;  3BJO A;  4M6X A;  4LG0 B;  2ZME B;  3ZQ7 A; 
#chains in the Genus database with same CATH topology
 3ZQQ A;  2PMU A;  2ISY A;  4JX6 A;  3WTU C;  2LF8 A;  1MMS A;  5B3S H;  3LSP A;  4F52 A;  1MDM A;  2ZME A;  5L3E A;  1JGS A;  5KK1 A;  2UWM A;  3H0G J;  2IJL A;  4PGG A;  5ILS A;  4MFD A;  3IC7 A;  3J7A O;  4UVC A;  2QM3 A;  2R5Z A;  5HLH A;  2DJI A;  4FHT A;  5C3E J;  3MN2 A;  4Y33 A;  5HDK A;  1RR8 C;  4A0Z A;  4AM3 A;  2XRO A;  2WAD A;  1FSE A;  3U21 A;  4BHC A;  3KLO A;  3U1K A;  3FKI J;  3E0J B;  3FXU A;  2CGP A;  4ZTJ A;  4HLX A;  2HPM A;  4IJA A;  3JAM Z;  3JRC A;  3LSH A;  4Y15 A;  1P4X A;  5L3G A;  1IRG A;  3OS0 A;  3ZCO A;  5EGO B;  2Y0S N;  2XAQ A;  1QA6 A;  1Y6I A;  4MNU A;  2JA2 A;  5EYR A;  2E35 A;  1MKM A;  1BBY A;  2ZSI B;  3CCY A;  3F8M A;  3I59 A;  4RB0 A;  3CO6 C;  2YU9 J;  1ZGJ A;  2LKS A;  2JA8 J;  3ABK H;  5EJC A;  1BJA A;  1BJZ A;  1WJ5 A;  4MQV A;  3VDX A;  2KIM A;  5CKT A;  4DW6 A;  5C4X J;  4NNJ A;  1Z9C A;  1HC8 A;  4HYE A;  1GV5 A;  1MMA A;  1YS7 A;  3KP6 A;  3GTM J;  1U5T A;  4Q4Z F;  1U9O A;  5FKK A;  4AID A;  2O9L A;  2P5V A;  3KX2 A;  2V9P A;  1U5T B;  2CG4 A;  1IDZ A;  3DXJ F;  1MJB A;  1MH3 A;  3FIW A;  5J3L A;  2L9N A;  2LR8 A;  4MGR A;  1D5Y A;  1ZYR F;  1QU3 A;  2KIS A;  1BR4 A;  2P6S A;  1T8I A;  1AHD P;  1WH5 A;  2PQ8 A;  2X4H A;  2VBZ A;  3I3L A;  2X85 A;  4WXD A;  2W48 A;  2JUG A;  4YG2 F;  4HF1 A;  3NWS A;  2IGM A;  1SAX A;  3IH2 A;  4A3K J;  1Z05 A;  5EZH A;  2RGV A;  1OCT C;  2DCE A;  2HOA A;  1N78 A;  4XRS G;  2OZU A;  3FHZ A;  2Z3Y A;  1LE8 A;  1A6Q A;  4CCN A;  1RR7 A;  2F4O B;  3PNT A;  4HST A;  3GXO A;  2YX4 A;  2VKD A;  4XN3 A;  1XSX A;  2EZI A;  3BLY A;  4A93 J;  1UB9 A;  1LEA A;  2V1U A;  2R92 J;  1DDN A;  2VBX A;  2CFO A;  2ZB9 A;  3DPL C;  3H35 A;  1XB4 A;  5CVU A;  1GVJ A;  4A12 A;  4HA8 A;  2XC7 A;  1EKE A;  2FF4 A;  5K5Q A;  2ZJ2 A;  3BCB A;  5ED4 A;  3BR1 A;  1X4O A;  2EFQ A;  4BQO A;  2KPM A;  2VBW A;  4B3A A;  1V4R A;  4MTD A;  2J5P A;  2OC6 A;  3HDD A;  1IN6 A;  2XAH A;  1XTA A;  4XN0 A;  3DV8 A;  3ZMZ A;  2F5F A;  2F5C A;  4B3X A;  2IP2 A;  1TNT A;  1VQL I;  3S1Q J;  1H9T A;  4UV9 A;  1Y1V J;  3RZD J;  3OR2 C;  3JTH A;  3Q0U A;  2PJR B;  2HKX A;  3O6B B;  4XLA A;  2L9V A;  3ZN1 A;  4EJO A;  1I27 A;  2ACJ A;  2Y9Y A;  4BNC A;  1XX5 A;  1T2K A;  4IHY A;  3L2R A;  1MBK A;  2IEK A;  4KIS A;  4II2 A;  3PIP F;  2V79 A;  4CYD A;  5DS9 A;  4B44 A;  2HVR A;  4I7H A;  3PNY A;  3WHB A;  5ILV A;  3BT9 A;  2D5V A;  2AQE A;  2Z99 A;  3GVA A;  4AIJ A;  2Y75 A;  4KIG A;  2X1D A;  4BJT A;  5K1Y A;  4P9U A;  2DAO A;  3LWF A;  3QQA A;  3AAF A;  4A0X A;  4WWC A;  2HWV A;  4B09 A;  2BW3 B;  2LFB A;  3OR1 C;  1YW9 A;  1Y8Q B;  4KFC A;  3VWB A;  2R7U A;  3PL8 A;  3G1O A;  4GDF A;  1AKH A;  2K40 A;  2XSD C;  4LGW A;  2MD0 A;  5ILU A;  3O8H A;  4E7J A;  1S8N A;  2XAF A;  2HU9 A;  4D5C A;  4RAF A;  2M7B A;  4P96 A;  2DYR H;  2V1D A;  3SXY A;  3U2R A;  2LDU A;  2XB5 A;  1KQ0 A;  2DDB A;  3F9K A;  3VYR B;  2W85 A;  1H89 C;  2L7M P;  2R7Q A;  3MCZ A;  1FMV A;  2E5Z A;  3DTI A;  3FZV A;  1N75 A;  1SVO A;  2MW8 A;  3K2Z A;  3CCE I;  1GHC A;  2F6C A;  1Z77 A;  1DUX C;  5BMZ A;  2ZXJ A;  1S7O A;  4O6J A;  4OWR B;  3LA7 A;  3WU0 A;  4D7N A;  3LSR A;  2EA4 A;  2NS0 A;  2MC3 A;  3CF5 F;  4G7Z F;  1KZH A;  4D5F A;  3FHN A;  1WJA A;  1S3J A;  3SFI A;  2IBD A;  1Z1D A;  1FX7 A;  2HI3 A;  3H1C A;  4M73 A;  3JRE A;  5LFA A;  1Y39 A;  5HS9 A;  2DMQ A;  3LL7 A;  4YFK F;  1B6A A;  3IKT A;  1T0F C;  4IRI A;  4RLQ A;  5DM6 F;  1RET A;  2CH0 A;  1MSE C;  2VUM J;  3MZY A;  4XON A;  3CJR B;  1U6G A;  2FQ3 A;  2O8K A;  2COM A;  1L3L A;  3K4B A;  5LGT A;  3PO3 J;  3WTZ A;  1BW5 A;  5FB2 A;  5J40 A;  1D8K A;  4HG2 A;  5BS6 A;  1IN5 A;  4M9X A;  4Y13 A;  1ZHF A;  2OV7 A;  1W5C C;  3CUO A;  3I9V 2;  4ZDL A;  4ENM A;  2C6Y A;  4EM2 A;  3I58 A;  4BE2 A;  1FOX A;  2E60 A;  1ENH A;  1R1T A;  4EM0 B;  2A3S A;  5D5W B;  3U9G A;  4MTE A;  4XSZ F;  2CQK A;  1QBJ A;  2R93 J;  1WJD A;  1LNW A;  4PZJ A;  2M8E A;  3PNV A;  1HOM A;  1QZE A;  3DP7 A;  2EJR A;  4DYR A;  5F1J A;  4L9V A;  1HDP A;  1AU7 A;  5EGO A;  5B66 C;  2XKP A;  4L9J A;  3VOE A;  1XG1 A;  2JRM A;  2JWT A;  3AFH A;  1ZH5 A;  2GOM A;  3ZQH A;  1GT0 C;  2NVX J;  1BIB A;  2BW3 A;  4BDZ A;  2K9M A;  4QWQ A;  3I0T A;  2XGD A;  3W2W A;  2OTJ I;  3MWM A;  3KEO A;  4BBR J;  1FIP A;  2H8R A;  3DBR B;  3RDI A;  3ZP5 A;  2XPV A;  1J7K A;  3BJA A;  5GPA A;  3FIS A;  1Y0U A;  3N05 A;  1SD4 A;  2FUG 2;  4BGD A;  3KP3 A;  4G7O F;  3AG1 H;  1HST A;  1X2N A;  2XAJ A;  3DKW A;  1DP3 A;  2IXS A;  1ZRE A;  1IO2 A;  3QOE A;  1LFB A;  2HQ5 A;  3D1N I;  2PX9 A;  2LTP A;  3BJ6 A;  2QSH X;  2AO9 A;  5M3M J;  2CV0 A;  2HTS A;  2VKH A;  1APL C;  3LSK A;  1A5J A;  3ZMV A;  3OWT A;  4RB2 C;  5E17 F;  2Y0S A;  2O7O A;  3M9A A;  2TDX A;  2DK5 A;  3NAR A;  1TZL A;  5E1W A;  4B8X A;  1BM9 A;  1K6O A;  3K10 A;  3PO2 J;  2IS1 A;  1KGS A;  2XF7 A;  3FM5 A;  2XVC A;  5CLS A;  5FLM J;  1SFK A;  3GTP J;  5KHD A;  3GZN B;  2DOA A;  1PYV A;  4V2G A;  1IUF A;  3IKV A;  3HXL A;  5HS8 A;  1YW7 A;  3J7A Y;  4IF4 A;  2FSW A;  1LVA A;  2IGK A;  3V8J A;  5K7Z A;  3LOC A;  3E5X A;  4A3C J;  2K7L A;  2CYY A;  2E34 A;  3B6A A;  1IRF A;  2DMP A;  2DU9 A;  4N9H A;  2D1V A;  3P9C A;  3HRT A;  5JHU A;  3LSG A;  4IHS A;  4M3G A;  2V9K A;  2IS4 A;  3CUQ C;  3KP7 A;  1BL0 A;  4I98 B;  1WFX A;  3K1P A;  3RPQ A;  5HLI A;  2GM4 A;  1TLH B;  4Y52 J;  3OYC A;  3ZR8 X;  1FP1 D;  3GF2 A;  3ULQ B;  4Z6Y A;  4A3D J;  3KYD B;  2L7Z A;  1WJC A;  3NAU A;  4U88 A;  1RRJ A;  2K5C A;  2DT5 A;  3LFK A;  3OMY A;  2FOK A;  4EGZ A;  1IG7 A;  5L3C A;  4F91 B;  2HYJ A;  2EIM H;  1FYK A;  3IH4 A;  2VJJ A;  3F3X A;  3RJP A;  2LP0 A;  2KHM A;  4FT8 A;  1PDN C;  1ZAO A;  1OCC H;  2O0Y A;  2JRT A;  1LJ9 A;  3F6O A;  5D8L B;  2R5Y A;  4XLP F;  5DUI A;  1DP7 P;  4ZDP A;  3S2H J;  3C2B A;  1V3F A;  3LFU A;  2M1B A;  3W6J B;  1OMI A;  2BXY A;  1IUY A;  1BI1 A;  4E7S A;  1DPR A;  1G3S A;  2HDC A;  3CCQ I;  2ZFU A;  1WSU A;  3CC2 I;  5JLW A;  2HZD A;  3KZY A;  3KZZ A;  5DD8 A;  1D0Y A;  2WBM A;  4L5J A;  2E1M C;  3PQJ A;  3HZJ A;  3KCC A;  3ABT A;  1D3Y A;  4XRS A;  2E7X A;  2P6T A;  2Q1Z B;  5K7H A;  1OCP A;  4LMY A;  2OQR A;  2CS3 A;  4LB6 B;  3KP5 A;  2PMZ A;  1Z3X A;  4K2E A;  2W1O A;  2X1E A;  2DA3 A;  3QYF A;  5CPR B;  2LBF B;  4AVZ A;  1WJF A;  2VXD A;  4J01 A;  4IOA F;  2Z16 A;  1K6Y A;  3HUG B;  3MFK A;  3BOQ A;  4WK8 F;  3ZMT A;  5FLX K;  1E0E A;  3O2P E;  5D5U B;  3OYG A;  1PUF A;  3HOT A;  3FMR A;  1K78 A;  3VSL A;  4M74 A;  1UHW A;  2BHZ A;  1FTT A;  2LH9 A;  2UZK A;  3BQY A;  5CJ9 A;  1Z21 A;  1K78 B;  4UNO A;  3F8B A;  4KIB A;  4RA2 A;  4EMS A;  3KZI C;  1AKH B;  2EK5 A;  2A6H F;  2Q0O A;  5GAG J;  3ELK A;  3L7W A;  4OU0 A;  3OYE A;  4IQ4 A;  3K4J A;  3TO7 A;  5E3M A;  2FOW A;  1NHA A;  4G9Y A;  1UST A;  4NBQ A;  4DNC A;  2EZH A;  1D5V A;  2E2I J;  2VXZ A;  5FFZ A;  4XLE A;  3M7G A;  3SDB A;  3KEY A;  3V42 A;  1UEL B;  2XAS A;  3K4N A;  1JUS A;  1T98 A;  3PSI A;  5M3F J;  1B72 A;  3R0A A;  2ZJP F;  2VJI A;  3CC7 I;  2VI6 A;  3IWF A;  5D4S A;  3IRQ A;  3DKX A;  3DBH B;  1IGN A;  4NDL A;  3KPH A;  2HQR A;  2OUM A;  4A5N A;  4I6Z A;  2V7F A;  4BXF A;  3C2H A;  2Z9O A;  4AYB N;  4ZYE A;  3TGN A;  1R6R A;  1H88 C;  4ESB A;  2RAE A;  4ITV A;  1I3Q J;  2FJ1 A;  3C2G A;  4KT6 A;  1H9G A;  5JR3 A;  2K9S A;  2CJJ A;  2ELH A;  1Z6R A;  1RZ4 A;  3J80 K;  3ASO H;  4RGS A;  2E1M B;  3JRF A;  5H6R A;  3CME I;  2B7E A;  3AG2 H;  3E7L A;  1T95 A;  4M6Y A;  3F6V A;  3F22 A;  1ETK A;  4WF2 A;  4M71 A;  2XGX A;  3E1S A;  1LDK B;  4G94 A;  1JT0 A;  3GEZ A;  3V7R A;  1KU9 A;  1ZQ3 P;  3L2U A;  3QPT A;  3CCR I;  3BRO A;  3M8E A;  3QYE A;  4Z2Y A;  4U7B A;  2W4S A;  2LYC A;  4PUS A;  4BQQ A;  5JHF A;  5GTI C;  2H09 A;  2PG4 A;  4II3 A;  3PUB A;  2VBY A;  5E79 C;  4PJN A;  3GTL J;  4DYC A;  1OYI A;  1VQM I;  3BQZ A;  1SD5 A;  4QTR A;  4N9I A;  4F93 B;  3S3N A;  1R71 A;  5DV5 A;  4BBS J;  4QLC U;  3CMA I;  1HBX G;  3J7Z I;  1LUJ B;  3NEU A;  1U78 A;  1OCO H;  4YFN F;  3QWL A;  1LPQ A;  3T0Y A;  2FE3 A;  2NAZ A;  4D1Q A;  4OIN F;  3V7C A;  3DBL B;  5FRN A;  3EUK L;  1CGP A;  2VJ4 A;  3T1B A;  4AIH A;  5HLT A;  2CQ7 A;  3H3V K;  3S2D J;  4BU2 A;  2WAQ A;  3I54 A;  3RZO J;  3K4L A;  1EH6 A;  2BBY A;  1DQU A;  3TP3 A;  5D8K B;  3WTY C;  5D6F A;  2JPB A;  5IP9 J;  5M5X J;  2B9S A;  1WJB A;  2UUZ A;  3BG9 A;  3VYU B;  5ICF A;  3W6K B;  4CYC A;  2HKO A;  4RM3 A;  4DBQ A;  3JRA A;  2NOJ B;  3TED A;  4ABZ A;  5EEA A;  2LY1 A;  5F0H A;  5ERI A;  1I3A A;  2G9W A;  2O61 A;  3DWL E;  1T39 A;  4XMY A;  2DBB A;  1SMT A;  1P2F A;  2EH3 A;  2QKM B;  4P9F A;  3L1P A;  1O3S A;  1V5E A;  3GX4 X;  1VQ4 I;  2CW8 A;  1XGS A;  2DMU A;  4XKC A;  1Z3Y A;  1I1G A;  1BA5 A;  3H9J A;  3LST A;  4BHB A;  4HDV A;  3Q9S A;  2DMT A;  4IPA A;  1MMG A;  4DBR A;  2HXO A;  2ZCW A;  2MG4 A;  1TL8 A;  1K4S A;  3WE3 A;  2XF6 A;  2QKL B;  1N77 A;  1X4P A;  4XKV A;  3SQN A;  1HW1 A;  3S93 A;  3SHF A;  3CQZ J;  3MKW B;  2HXI A;  1KYW A;  1IXR C;  1AWC A;  1A36 A;  3C3W A;  3ZQG A;  1TNS A;  3JSP A;  5IYB J;  2Q2E A;  5FKN A;  3K2A A;  2X48 A;  4L18 B;  3GW2 A;  3QP6 A;  3IL2 A;  3QPH A;  4RS8 A;  2L5Q A;  1XPX A;  2G7U A;  3QPL A;  3PFI A;  2KZV A;  3HSE A;  3S2W A;  4L5E A;  3OYM A;  3CO7 C;  2M4K A;  1FT9 A;  1HKT A;  3A2K A;  3HUG A;  3DPT A;  2RNG A;  4UHT A;  3H92 A;  1HSJ A;  3KEQ A;  4L5I A;  4L9T A;  4A3G J;  4UUT A;  4CCM A;  2L9S A;  3UR3 C;  2CFX A;  2E36 A;  2YSR A;  5DUK A;  3S32 A;  4F92 B;  1MBE A;  4C2M J;  5FRM A;  1TW3 A;  4BJ6 C;  1WVR A;  3ZQL A;  2IPQ X;  2W24 A;  5HNF A;  1EV7 A;  4FET A;  1NG6 A;  3LSI A;  5EG0 B;  2D45 A;  2TCT A;  1IN8 A;  1NH3 A;  2HZT A;  2X1C A;  4M3B A;  4FIS A;  3BTJ A;  1U2W A;  1FIA A;  2I5U A;  1ZGW A;  1IN4 A;  3WTW C;  3PQK A;  2BY3 A;  3HTU A;  3CCJ I;  1XMA A;  3T5X A;  3FKJ A;  4YFX F;  4PJ0 C;  2ZJQ F;  4HX7 A;  1J0R A;  4RAG A;  3E6M A;  4HZF A;  3H0D A;  3CP8 A;  3KYL A;  1ETX A;  3LSJ A;  4HBL A;  5DCF A;  3N97 A;  2PMZ N;  2XPU A;  3VFZ A;  3TMO A;  3H9G A;  3WU1 B;  2XSJ C;  1MJ9 A;  4GFB A;  3BG6 A;  4GRI A;  2VAS A;  2DFI A;  1YHQ I;  2UV1 A;  2F4I A;  1ZN2 A;  3DKY A;  2JUC A;  2GZW A;  4BE1 A;  4LG3 A;  1VQ6 I;  2VE8 A;  3RIR A;  3H3Z A;  3TW7 A;  2R4G A;  1JJ6 C;  2P0W A;  4S0H B;  1DU6 A;  1JTY A;  4Q5S F;  1YRN B;  2Y2Z A;  1T38 A;  2ETH A;  5CVV A;  4S04 A;  4DYQ A;  3ZOB A;  2R7R A;  1LE8 B;  2QQB A;  3WTX C;  2VOP A;  1YRN A;  4MO7 A;  4C3J J;  3JSO A;  1JUP A;  1A6I A;  2LRD A;  4RAY A;  2JT1 A;  4E4H A;  4X6A J;  1BC7 C;  2JVG A;  2R7O A;  1O7F A;  4GYI A;  3ZQC A;  3EUA A;  2QBY A;  2L4M A;  2D2W A;  1Z6T A;  2QCO A;  4PCQ A;  1ZRC A;  3J81 Z;  4KA4 A;  2VKV A;  3HBL A;  4WXH A;  4Y17 A;  2QYO A;  5D4R A;  5J8F A;  4I02 A;  1UHM A;  3HHG A;  4KUM A;  1BIA A;  3G1L A;  4AD9 A;  4MIM A;  3E3V A;  3QP5 A;  2YS9 A;  2W57 A;  3TO6 A;  2EWN A;  3E97 A;  3X2Q H;  3CZ6 A;  1FPQ A;  1R4M B;  4Y7N J;  3FXO A;  3S1R J;  1Y1W J;  1B9M A;  2TRT A;  1WI9 A;  2N8G A;  1BI2 A;  1YOV B;  3Q0V A;  2FXA A;  5CYV A;  3CCU I;  4ASN A;  1T33 A;  4PJM A;  4EQQ A;  3M3Y J;  4ZJZ A;  5BPD A;  4KN7 X;  4EV0 A;  4JK1 X;  3K1N A;  2Z1D A;  4BAC A;  4AC0 A;  2ICW G;  2JMW A;  2BHY A;  3I59 B;  1IV8 A;  2YPR A;  1EH8 A;  2RQP A;  1XMK A;  4V2F A;  4XOR A;  3QOP A;  4CCO A;  1UCR A;  4QIW N;  1H0M A;  5KNL A;  3S14 J;  2EBI A;  4AWX B;  1QQI A;  4RB3 C;  5J1Y A;  5K5R A;  4UUV A;  1V54 H;  2ZXI A;  5EEG A;  2X9D A;  2QEN A;  2DTR A;  3GTG J;  1CF7 B;  3GWZ A;  1VI0 A;  2DK8 A;  5ICE A;  2DPU A;  1N25 A;  2GXA A;  4PFO A;  3G73 A;  2O6G E;  2ZNZ A;  2MGQ A;  4CCK A;  2H94 A;  5LGU A;  4IHT A;  3OYA A;  2OTL I;  1J75 A;  3DU5 A;  2X6Y A;  4Q47 A;  1R7J A;  1IW7 F;  1FBS A;  2CQQ A;  2AQF A;  5DTD A;  4ZZL A;  3AL0 B;  2EFP A;  2WB1 N;  2HDD A;  2V1X A;  1YS6 A;  2P7C B;  4IXA A;  1ETY A;  4R8H A;  2F2E A;  3FMQ A;  3O8G A;  2Q8K A;  2W7N A;  1RES A;  4H0E A;  5FD6 A;  2CV2 A;  1R9T J;  4XR6 A;  3K9T A;  4ZYD A;  1ETQ A;  2PEX A;  3GLL A;  5E8G A;  4CGZ A;  4ZYG A;  2BY1 A;  2G0E A;  4N0B A;  2WAF A;  4E7L A;  2I10 A;  2P4W A;  5B1B H;  2NXN B;  2CQN A;  1Y8R B;  2GQQ A;  5H6Q A;  4RGX A;  5ICC A;  2R0Q C;  3CUQ A;  4YEL A;  2QBY B;  4DGW B;  4IKF A;  2HYF A;  1SEU A;  3FBN B;  1LQ1 A;  2D1H A;  1TQP A;  4MEX F;  1WHU A;  2MFZ A;  2QWW A;  4HAM A;  3OYB A;  2XDV A;  3VSK A;  3OSF A;  1OR7 A;  2L4A A;  4E7Z A;  4IQJ A;  1RIO H;  4I2O A;  1YLF A;  4U0V A;  2ADU A;  3S15 J;  1ZG5 A;  5D6E A;  2HR3 A;  3DLA A;  4WXC A;  2IA1 A;  3FXR A;  4BUP A;  2R7T A;  4NC8 A;  5F27 A;  3AL0 C;  4GXO A;  1Z0X A;  3ZXS A;  1KON A;  1H8A C;  2V9V A;  2W25 A;  2EZL A;  1U9N A;  3V7S A;  1G2H A;  1YJ9 I;  3OYL A;  2HVQ A;  2LKP A;  3D5R C;  1T56 A;  4HX4 A;  2GA2 A;  1JE8 A;  1A35 A;  4HV6 A;  4O3M A;  2IA2 A;  4LJZ F;  4W1U A;  5JVT A;  4L0Z B;  1O3T A;  4H4K C;  1X1D A;  2K86 A;  2JTV A;  2XUB A;  4PJJ A;  3OS2 A;  1U3E M;  4AU7 A;  1SVL A;  2PMH A;  3NQO A;  1LEB A;  2EV6 A;  1NTC A;  2E7W A;  3V4G A;  2XF5 A;  1ODD A;  2RV8 A;  1WH7 A;  4EGY A;  3HC7 A;  1E3H A;  2R7D A;  3H3U A;  1SMY F;  3B73 A;  3L9F A;  3NRV A;  5HDN A;  1HF0 A;  2G7H A;  2KFD A;  3RKX A;  1WRJ A;  3KP2 A;  3ABU A;  2DQR A;  2M2E A;  4XLN F;  4HX8 A;  3T8R A;  1HA8 A;  3I55 I;  3EYI A;  4HNU A;  1MMN A;  2ZNY A;  3MKZ A;  1XGN A;  2QQA A;  2KIQ A;  5IP6 A;  2VON A;  1R5H A;  2JA5 J;  4XL9 A;  1UJ8 A;  4OMY A;  1YIT I;  3KE2 A;  3DF8 A;  5AIP A;  1REP C;  3WG9 A;  2M9H A;  1GXP A;  4F7Z A;  1FBQ A;  4LK0 F;  5FO5 A;  2WC2 A;  3SZT A;  1OR7 C;  1TP4 A;  5L3F A;  2NOG A;  3TDZ C;  1LB2 A;  1R22 A;  5JFR A;  1ONV A;  2ESH A;  5LBQ A;  3RYP A;  1U5T C;  3CF2 A;  2KQR A;  2RKH A;  1X1B A;  3S1M J;  5JI6 A;  3MKY B;  1BOB A;  4JX5 A;  3R61 A;  2ELK A;  2OJE D;  1S9H A;  1JKQ C;  1DU0 A;  3I4N J;  3WHC A;  5FLX Z;  2DT6 A;  1OCZ H;  2FNA A;  5LEK A;  3CMM A;  2K9Q A;  4QPO A;  2AHQ A;  2Y31 A;  1TWF J;  4IVN A;  1P6R A;  2OCC H;  1O57 A;  2QGU A;  2B63 J;  1FTZ A;  5TIS C;  5GTH C;  3N4M A;  2J5O A;  1BN5 A;  2COB A;  2FBH A;  3DFG A;  3FX3 A;  1KA8 A;  5DCM B;  1HKQ A;  2I8D A;  4DQ2 A;  1IV6 A;  4A0Y A;  4HNT A;  2IW5 A;  2LSO A;  3ASN H;  3QU3 A;  1ETO A;  3QRF F;  2L02 A;  1MNE A;  5B5E C;  3K1M A;  3OL3 A;  2XAG A;  5AON A;  2VB6 A;  5FFX A;  3F8F A;  9ANT A;  3F0C A;  4CCJ A;  5LHI A;  3NWT A;  3BP8 A;  4HQE A;  1X3Z B;  2YX7 A;  3I71 A;  3IUO A;  3WTS C;  4UUS B;  4E7H A;  2X51 A;  1SFO J;  4C2U A;  1KYZ A;  3TQN A;  2H27 A;  4LLG F;  4I76 A;  4FCY A;  4FAS D;  4BXU A;  2EFO A;  3K4M A;  3ZMD A;  4UB6 C;  1MGT A;  2AXT C;  2X0L A;  3R6S A;  2A07 F;  2MLK A;  4A6E A;  2UXN A;  3CD6 I;  1T08 B;  5HNH A;  1T6S A;  2GIV A;  3A03 A;  1G59 A;  3FDY A;  1SFE A;  3HHH A;  2MLG A;  2AS5 F;  3AG4 H;  2QSF X;  1OYW A;  1G8X A;  1PUE E;  4IHW A;  2ESN A;  2NNN A;  3IP4 B;  3HL2 A;  2OAZ A;  2WA0 A;  2FML A;  3P9K A;  2PN6 A;  3E6B A;  4XNF A;  2KDZ A;  1X19 A;  4EJU A;  1VQN I;  1ZG3 A;  4XLF A;  4YRV A;  4UVA A;  3HOS A;  4U7D A;  1MBG A;  3ERE D;  5E3N A;  1MJA A;  3GFI A;  3G3Z A;  1WQ2 A;  1W7P A;  3FXM A;  3CDI A;  2A5Y B;  4V19 K;  3RPU D;  2NRA C;  1TWA J;  1JHH A;  1MND A;  2FMY A;  2CMP A;  2ELJ A;  2ZXH A;  1RUN A;  3ZN0 A;  3CDL A;  3VB2 A;  4DZJ A;  3OSG A;  1WKM A;  2FX0 A;  1XSV A;  2OQG A;  1A31 A;  4EJW A;  2QA4 I;  2KRF A;  5CVJ A;  4HRI A;  2VOD A;  1G3T A;  1PJR A;  2H1L A;  2JN6 A;  4IRG A;  3BZC A;  1XMX A;  1W36 C;  3DTK A;  2DI3 A;  2STW A;  1BI0 A;  1KU2 A;  4HLY A;  3HOZ J;  3C7J A;  3I5U A;  4D9J A;  4ZZD A;  1NG7 A;  3WTV C;  2BZT A;  3T8T A;  3BPV A;  2XGE A;  2K9N A;  2NS7 A;  3A0H C;  2XIG A;  3CJN A;  1YJN I;  3JRD A;  1BOA A;  1OFC X;  1WZ2 A;  3FK7 A;  2LF7 A;  3CUQ B;  3CLQ A;  3R60 A;  1ZTR A;  3OYK A;  5LHH A;  4PDK A;  4FX4 A;  3LA3 A;  1F43 A;  2M45 A;  1U0J A;  4AVP A;  3KYC B;  2Y0M A;  1ZR2 A;  3GFM A;  1L0O C;  3BWG A;  1UHS A;  5E1Z B;  4N4N B;  3QPS A;  5IT3 A;  3JCU C;  1MW7 A;  4RDU A;  1JKR C;  3E6C C;  1B8I B;  2IA0 A;  1UG2 A;  1P4W A;  3TO9 A;  2HNH A;  2CU7 A;  2LLK A;  1C0W A;  1FOY A;  1DPU A;  1JTX A;  3A01 A;  2DO7 A;  1Z7U A;  3ECO A;  2DOF A;  4QSH A;  1ULY A;  1X1P A;  4F3Q A;  5J1U A;  1R4N B;  4HW0 A;  3K70 D;  1WPK A;  4CHU A;  1HKS A;  4BHP A;  1SC7 A;  1SD7 A;  3DU6 A;  3Q0W A;  5CQG A;  3RQI A;  3ECH A;  2PJP A;  3BDD A;  2F4M B;  2JA6 J;  5GAH J;  2DFH A;  2M3A A;  4BYY A;  3P5J A;  3H5N A;  3GFL A;  2KT0 A;  4C3I J;  1BR1 A;  3A1Y A;  2K3F A;  4JBA A;  2ECC A;  4LFU A;  2QQ8 A;  4M3D A;  3S3O A;  2CRG A;  4FE4 A;  1GXQ A;  3P7N A;  3MMY B;  4XK4 A;  3TOB A;  3SDG A;  1IXS B;  1B4A A;  2HQA A;  4M3F A;  5HS7 A;  1IF1 A;  3KET A;  3DPU A;  3RKY A;  3JAM K;  5FGM A;  3G4S I;  1IDY A;  1WJE A;  2XRL A;  1PUF B;  1S72 I;  1T0F A;  2WV1 A;  4R1H A;  2HGC A;  5F64 A;  5EDN A;  5KAI C;  2BOL A;  1XS9 A;  4IOC F;  5TJJ A;  2XKO A;  1LVK A;  2XB0 X;  3OIP A;  4MQ9 F;  3GZ5 A;  4YII A;  5LGN A;  1EH7 A;  2HS5 A;  2JA7 J;  4I01 A;  5BNG A;  1P7J A;  4BKX A;  3HYI A;  1F9N A;  4PSW A;  1I6X A;  3LAJ A;  4A3E J;  3IWZ A;  2FBI A;  2IT0 A;  1KU7 A;  2HTJ A;  5D5V B;  3GTJ J;  4ZDO A;  2R3S A;  3FF5 A;  2MYS A;  2KZG A;  4LLN A;  2CW7 A;  1W7P D;  4E7I A;  2R7F A;  1R5G A;  3HOV J;  3S17 J;  1R23 A;  2W84 A;  4RB1 A;  3PSF A;  4XLC A;  1J5Y A;  1YO5 C;  1K83 J;  1TBX A;  2UXX A;  2DQL A;  1TWC J;  4UVB A;  1ON2 A;  4IX7 A;  3SYT A;  4X1E A;  2RNJ A;  1R49 A;  3HGG A;  4D0P A;  1RUO A;  4AIK A;  4IO9 F;  1ZGA A;  4C2T A;  2EFW A;  2VPL A;  1D1A A;  2E1O A;  4PSX A;  3S16 J;  2HPI A;  5E20 A;  2JZY A;  2M5W A;  5ICG A;  2KMU A;  4OOI A;  5DCM A;  1PVE A;  4CH7 A;  2A68 F;  4CO8 A;  1P9Q C;  5F0C A;  1IAW A;  4CDG A;  1RKW A;  2P5K A;  2KJC A;  3JRB A;  1QGP A;  1FYM A;  2DA5 A;  4PGH A;  2W00 A;  1VND A;  2DN0 A;  2F48 A;  2MH2 A;  4UXN A;  2GLO A;  1DGR M;  3G1M A;  2F5V A;  2M87 A;  1QO0 D;  2LNB A;  2WY7 Q;  2O03 A;  3WOD F;  4CZC A;  5E3L A;  2ID6 A;  4A5M A;  2OF7 A;  3GTO J;  4BY7 J;  1X3U A;  3TBI A;  1P4A A;  4XKB A;  4BAY A;  3A0B C;  2R7S A;  1S29 A;  3IH3 A;  1YYV A;  2VT2 A;  5AIQ A;  3K4K A;  2CUE A;  1EF4 A;  3ZRG A;  1ITY A;  3TDU C;  5J4Y A;  2ZME C;  4QPQ A;  4BQN A;  4XID A;  1VQK I;  5E8I A;  4KNY A;  1OYY A;  5J6X A;  2XGC A;  4NC7 A;  1XSD A;  4PK4 A;  1HXD A;  1K7A A;  1R1V A;  1JXS A;  1ETW A;  2DXI A;  1ACI A;  3HRU A;  2ZC2 A;  3LSM A;  3K4C A;  5J8C A;  3B02 A;  5HOD A;  1JI8 A;  3HG9 A;  3OYF A;  3ZMS A;  2Z2S B;  1E2X A;  2MBF A;  4FQG A;  3OL4 A;  1CF7 A;  2K27 A;  2BE5 F;  2FU4 A;  5IT9 Z;  3A4C A;  2JSC A;  3GZ6 A;  3DLL F;  2WY8 Q;  1W7P B;  5IY5 H;  4BQA A;  4DOZ A;  1GV2 A;  3OYJ A;  1A04 A;  3KFW X;  3SEQ A;  1MMD A;  2GIZ A;  2VLA A;  1IN7 A;  2XHK A;  1XDS A;  3ZMU A;  4NQW A;  2V6C A;  1B72 B;  3Q5F A;  4HF2 A;  5FRO A;  5J4V A;  2CUF A;  1B9N A;  4LD5 A;  3CLO A;  1TWH J;  1OLT A;  5FKM A;  2H8W A;  3KIO A;  2Z33 A;  3HOX J;  3FXL A;  2EQR A;  2WV0 A;  5GAE J;  1F5T A;  2BV6 A;  1XD7 A;  2E19 A;  4YIF A;  1PP8 F;  3W2A A;  1HW5 A;  4A3J J;  2CUJ A;  2YUS A;  4EAT A;  3WU2 C;  1YQA A;  4I09 A;  5H2F C;  2W82 A;  4MFE A;  4XOP A;  4D7M A;  4PFP A;  1AA7 A;  1W0T A;  4A3M J;  2P8T A;  2FNP A;  4CSW A;  2H6B A;  2LVS A;  1V55 H;  4RGR A;  2R7W A;  1Z67 A;  2A5W A;  3FXQ A;  1BW6 A;  5LRS A;  1IJW C;  4CIC A;  2R7V A;  3BZ6 A;  4X0G A;  2LD5 A;  2M0C A;  2OBP A;  3HKZ A;  4ENN A;  3HOU J;  2M0M A;  4ZC3 A;  3W3C A;  5JVG F;  3B6C A;  3EQL F;  1JJ8 C;  1FYL A;  2PJR A;  3BR3 A;  3BR6 A;  3OY9 A;  2EIK H;  2FQ4 A;  2BEO A;  4RMN A;  1Y0N A;  3F21 A;  3OOU A;  1B8I A;  1G3Y A;  4P1W A;  2QSG X;  3W2V A;  1QVT A;  4BJ5 C;  4BL0 B;  3COA C;  3W6V A;  1MZB A;  5JLX A;  3CJQ B;  1YIJ I;  5LEJ A;  4J00 A;  2KLO A;  5F0F A;  2GAU A;  2E2H J;  5H20 A;  5IYC J;  1QPI A;  2KP6 A;  1XGO A;  2MD5 A;  4JYK A;  3R4K A;  1J59 A;  2VN2 A;  3OOP A;  3EET A;  2XV4 S;  1SD6 A;  3FXJ A;  4LIT A;  2A6T A;  2CW0 F;  4ZTF A;  2QLZ A;  3Q3S A;  2MAB A;  1LKX A;  3A02 A;  1HW2 A;  3C1D A;  2VIX A;  3D0S A;  5EG0 A;  1RPW A;  2DW4 A;  4NQW B;  5K7F A;  2OCE A;  1VQ7 I;  2ECB A;  2GWR A;  2M7A A;  2VC1 A;  5EEH A;  1ZG1 A;  2QVO A;  1GUU A;  4UB8 C;  3ESW B;  5F6F A;  2VE9 A;  1TQM A;  2VQL A;  2EV0 A;  1D8J A;  4NUB A;  2HQN A;  1VF9 A;  3EYY A;  1EA3 A;  1ZRF A;  3QYB A;  1ON1 A;  3K7A J;  3RKW A;  1RKT A;  3CTA A;  1JKO C;  2K4J A;  1UAA A;  2EIJ H;  2VKE A;  2FD5 A;  1I39 A;  2R7X A;  1S6L A;  1D0Z A;  1YE9 A;  4FE7 A;  5CVI A;  1YW8 A;  5F04 A;  3SEZ A;  4BS9 A;  4G8X A;  1OCR H;  3FWE A;  2HEO A;  1MD0 A;  1B59 A;  2RRE A;  4E70 A;  2DMN A;  3SZP A;  4XBF A;  2PFB A;  2X6X A;  2V6E A;  1I6H J;  2K4B A;  3IAM 2;  1GDT A;  3TP0 A;  4YEJ A;  3PFY A;  5EF6 A;  1SFU A;  4LIU A;  1JUM A;  1BI3 A;  1Q1V A;  4G12 A;  5BPI A;  2FEZ A;  3BR0 A;  4F55 A;  3F8C A;  3CC4 I;  4NC6 A;  4YIR X;  3PIO F;  5KVR A;  3CES A;  1SAU A;  2RC4 A;  2QQ9 A;  1FOW A;  2WB1 A;  1KQ8 A;  2QZ8 A;  4OIO F;  4JX4 A;  4M9Z A;  2KRH A;  1FSH A;  3LMM A;  1GLN A;  5IPA A;  3BPX A;  4BY1 J;  2IVM A;  4EM1 A;  2ZFW A;  4A6D A;  1G4D A;  3GBG A;  4CCL A;  3J81 K;  2IS6 A;  1UFM A;  1FBU A;  1W5S A;  4XLH A;  1MSF C;  4OIR F;  3CCS I;  2BVL A;  1XCB A;  3ABM H;  2KDO A;  3P9I A;  2IS2 A;  2DOD A;  3OYD A;  2DA2 A;  4ANJ A;  5M5Y J;  1LDD A;  4MEY F;  3RKQ A;  1VQ5 I;  1VTN C;  2CUZ A;  3ROU A;  2STT A;  4HPQ A;  2ZBK A;  2Q2E B;  2LY2 A;  3BG5 A;  3I4P A;  3JRH A;  4CXF A;  4E6K G;  5IT9 K;  4B4C A;  4LOC A;  2L2O A;  1Y56 A;  3Q9V A;  1O7L A;  4U0W A;  3E5Q A;  3BG3 A;  3CDH A;  1KQ9 A;  3JR9 A;  1WCM J;  2OD5 A;  2Y48 A;  3J7Y J;  3TOA A;  3M1C A;  3VOD A;  3I53 A;  2CWE A;  3SZG A;  1RI7 A;  4MHG A;  5C44 J;  3WGG A;  2JPC A;  4IHV A;  4KJZ A;  2MH9 A;  4BEH B;  2X6O A;  5HOO A;  1KU3 A;  5C4J J;  2DA6 A;  3UKG A;  4XRM A;  3HEF A;  4ZYH A;  2WAE A;  4FX0 A;  2OA4 A;  4GYG A;  4LIV A;  4C30 A;  3IRR A;  1VZ0 A;  1X3W B;  3DEW A;  4KMF A;  4A2U A;  3L2W A;  3QOD A;  2ZSH B;  5DEQ A;  3HOY J;  2GA1 A;  3C18 A;  2E2J J;  4DZP A;  2A05 A;  2DOE A;  4IZZ A;  2M34 A;  2RN7 A;  2DJN A;  2O3F A;  3CCM I;  3GYH X;  1MBJ A;  1OQY A;  4CYC B;  1I5Z A;  4RM2 A;  3RI4 A;  3H9Q A;  1VQ9 I;  3BY6 A;  5FLV A;  5M5W J;  4HDU A;  1WWX A;  2CSO A;  2DYS H;  5GP9 A;  4HEA 2;  1O4X A;  2K02 A;  5IP7 J;  3I4M J;  4FTH A;  3RYR A;  2XAU A;  1E17 A;  1W36 D;  5E1X A;  3GTQ J;  6PAX A;  2OPT A;  2O8X A;  2A61 A;  3MKL A;  1JKP C;  2V1N A;  3VPR A;  5DDG A;  3PM1 A;  1ZAR A;  5L3D A;  2E71 A;  5LHG A;  2ME0 A;  2Y30 A;  1E3P A;  4L9N A;  3L2V A;  3O3K A;  3V8K A;  2V4J C;  1RNL A;  2LK2 A;  4RLF A;  4UUS A;  3OYH A;  4LG0 A;  5GAD J;  5DD4 A;  2DFF A;  2P5L C;  1PP7 U;  2NVY J;  3G71 I;  2KIU A;  2L9R A;  2WAQ N;  4UV8 A;  2P7V B;  2LRE A;  1S7A A;  3K69 A;  1JGG A;  2QF7 A;  1SAN A;  2A69 F;  1XC5 A;  4XIC A;  2BY2 A;  3F72 A;  4ENK A;  1W1W E;  4I0A A;  3RSN A;  5L3B A;  1TTY A;  3AKZ A;  1P92 A;  3TL4 X;  1VQ8 I;  1ORK A;  2VQG A;  2ZJR F;  3FMS A;  4BDY A;  3KLN A;  2O5R A;  5TRD A;  3E5U A;  2GXG A;  1YFH A;  3FBI B;  3M8J A;  4KYW A;  2IRF G;  2L01 A;  2H1K A;  4ENJ A;  3MVP A;  3ZQI A;  2KL4 A;  4CUG A;  2NS8 A;  4EVI A;  2WTE A;  3H5A A;  1V5G A;  4RGU A;  5IYD J;  1LDJ A;  2L0K A;  1D0X A;  3IHU A;  2BYV E;  4A69 C;  5F1R A;  1U8B A;  1ZEL A;  1ETV A;  3J80 Z;  1MIJ A;  1SFX A;  1WGX A;  5LRR A;  3ONQ A;  4P55 A;  2PBI A;  2NNY A;  2HFH A;  4IL6 C;  1DGW Y;  3G6E I;  3RTR A;  1USS A;  1VFC A;  2H6C A;  1G3W A;  3E6D A;  3MD2 A;  2A6E F;  1OPC A;  1X1A A;  2DA1 A;  2MSY A;  3VEP A;  2K85 A;  1MNM C;  3DEE A;  1W5T A;  3EUH C;  1ZLJ A;  3S8P A;  1TC3 C;  2NYX A;  3OIQ A;  3I56 I;  5FKL A;  2HOS A;  3IAS 2;  4BXX J;  2K9L A;  1QVU A;  2PI0 A;  1ZRD A;  1F4K A;  3ZQF A;  2LMD A;  4Y4R A;  2HOT A;  4N4O B;  2K3P A;  1K4T A;  2CQX A;  1S7E A;  2E5N A;  1CQT A;  1O3R A;  3ZPL A;  2ZKZ A;  4BEH A;  5IOY A;  1Q1H A;  3PJR A;  4L0Y B;  4EJV A;  4XOT A;  2DT7 B;  5KCM A;  1HLV A;  4ZH4 F;  2GXB A;  1V5F A;  1AOY A;  1F1Z A;  2VC0 A;  3JW4 A;  1YX5 A;  4HV5 A;  1W4M A;  4I99 C;  1FZP B;  3MZH A;  4WCG A;  2VPR A;  4OAY A;  4XKW A;  4M72 A;  1EJ9 A;  4PJL A;  5EZG A;  3L2C A;  1YI2 I;  3MAJ A;  1MBF A;  4RBO A;  1K61 A;  4EJT A;  3K6G A;  2NVQ J;  2WWY A;  1R5I D;  1FNN A;  3I64 A;  5LD2 C;  5KAF C;  1MDM B;  2R5Y B;  1P7I A;  2EA2 A;  3H5R A;  1LFP A;  2BXZ A;  4P5O A;  1JHF A;  2EV5 A;  4KN4 X;  2HDW A;  5A2Q Z;  2MA3 A;  3CMY A;  5IOZ A;  3HIF A;  3BR2 A;  3KP4 A;  2NVT J;  1FLI A;  4ZYA A;  3BR5 A;  2FRH A;  1TT0 A;  3HKZ N;  4O5V A;  3BG7 A;  5LLQ A;  1ERD A;  4ETS A;  4B1R A;  3U1D A;  1ZLK A;  2BVM A;  2QUF A;  1X2M A;  2VJ5 A;  1XDU A;  2DA7 A;  4I0B A;  1FOK A;  4Q48 A;  5B1A H;  2EPF A;  1TWG J;  1D1C A;  4TV7 A;  5K5O A;  3K0L A;  3BZK A;  4GGG A;  3MQ0 A;  2F5E A;  3L2Q A;  3SJM A;  2RDP A;  2LG4 A;  3PUF A;  5FJ8 J;  1TQI A;  3JRG A;  3SFZ A;  1U8R A;  3DQV C;  3QAH A;  1NK3 P;  4HNV A;  1R00 A;  4BH9 A;  4KIF A;  3ML6 A;  2VQH A;  1OKR A;  4NB5 A;  2DLL A;  4GO1 A;  4AUX A;  3TKY A;  4B43 A;  4M3E A;  4M6V A;  3L09 A;  4E7K A;  2JQ7 A;  4UY8 I;  3GTK J;  1ZK8 A;  1XGM A;  4ESF A;  2ZO4 A;  4ESJ A;  2JSP A;  3L00 A;  2FA5 A;  4LB5 A;  2EZK A;  3HSF A;  3OV8 A;  1UG0 A;  3CP2 A;  3D5L A;  4G6Q A;  2KIF A;  2RVC A;  4HQM A;  1IRZ A;  4KIT B;  4Y3O A;  3WE2 A;  2KKO A;  3DCF A;  4XQF A;  4JOM A;  1F36 A;  3VYT B;  3QU6 A;  1FEX A;  1MBH A;  2GBY A;  3FM3 A;  3HGY A;  2OU2 A;  5FD5 A;  2JK3 A;  2ISZ A;  2XRN A;  3MZ8 A;  3WGI A;  4G7H F;  3BCA A;  4LK1 F;  4C9Y A;  3WG7 H;  2VT3 A;  3BTC A;  1W0U A;  2FBK A;  3WTT C;  3GME A;  2M30 A;  2YU3 A;  2HOE A;  1XCV A;  1HQC A;  2CV1 A;  1VQP I;  5CQE A;  3EUH A;  1Z91 A;  2HYG D;  2DTZ A;  4JP0 A;  1IZ1 A;  1LFU P;  5HDG A;  3UNG C;  1STZ A;  3BTL A;  1QZZ A;  1B1B A;  2M8G X;  3REO A;  4OIP F;  4XSX F;  3HTS B;  2AXL A;  1FMW A;  3R0J A;  1QRY A;  3GO5 A;  2MC4 A;  2B0L A;  3S1N J;  1QHG A;  2EFN A;  1FC3 A;  4C3H J;  2CO5 A;  4CA0 A;  4U0Y A;  4J19 A;  3JTG A;  1NK2 P;  3JRI A;  1K79 A;  5GPC A;  1R36 A;  3GUD A;  5FKO A;  5HLG A;  4KDP A;  1J2X A;  1OIS A;  2M4G A;  3DTE A;  1SVM A;  3M4O J;  4WX9 A;  3FK6 A;  3LQR A;  3WGH A;  4A3B J;  4BE0 A;  3F23 A;  3ABL H;  1HDD C;  3GLX A;  2R5Z B;  2VL8 A;  3VYS B;  5DM7 F;  1BC8 C;  3HOW J;  1QHH D;  2L3D A;  1FP2 A;  1IXC A;  1R58 A;  1FWZ A;  3K70 C;  3M1E A;  3HRS A;  3BTI A;  3AG3 H;  3EPZ A;  1D1B A;  2E1C A;  1QZY A;  3HPH A;  3G2B A;  4HSR A;  2JVH A;  4KMU X;  5BOX A;  2GOX B;  5F08 A;  1TW2 A;  1Z7L A;  3HSR A;  2IGN A;  2NVU B;  4CZZ A;  2DPD A;  2IGO A;  3DEU A;  4GCV A;  4JQF A;  2LKX A;  1HCR A;  1UMQ A;  4W97 A;  2E1N A;  4A3I J;  1G6N A;  2DA4 A;  3A01 B;  4IHX A;  2YR2 A;  5A2Q K;  1XN7 A;  2L7K A;  2L7F P;  1YTY A;  1BR2 A;  3RQ4 A;  1YJW I;  1UZC A;  1YG2 A;  1J9I A;  1ZKG A;  3HRM A;  1J09 A;  1POG A;  4B47 A;  4RAZ A;  3CJT B;  4MLO A;  2KRC A;  4XRF A;  1QPM A;  2KJB A;  3OIO A;  1I50 J;  3V8L A;  1RC9 A;  1X58 A;  5J1R A;  2PLY A;  2VQC A;  5HVQ C;  1TT5 B;  1YX3 A;  1FJL A;  2ZXW H;  3HPG A;  3TW6 A;  3GFJ A;  2LBF A;  4A3F J;  2LY9 A;  3ISP A;  2Y9Z A;  5J47 A;  1JT6 A;  4DIQ A;  1M1E B;  3RPU A;  3LNQ A;  1ZR4 A;  3LAP A;  3IV5 A;  1OJL A;  2DDA A;  1IC8 A;  2XPW A;  4LLL A;  3M8F A;  4XM3 A;  1R1U A;  2V26 A;  4NHJ A;  3CCL I;  1MH4 A;  2EIL H;  4IEJ A;  2JJ7 A;  3BC8 A;  4ON0 A;  2IAI A;  5E18 F;  3HM5 A;  2ME6 A;  4A3L J;  3M07 A;  3FXK A;  2F5D A;  2DFE A;  5D5X B;  4EEF G;  1S5L C;  5BQT A;  1QNT A;  2QEX I;  4DJA A;  4AYB A;  4B48 A;  1X1C A;  3F8N A;  2BGC A;  4HOB A;  4HF0 A;  3ERM A;  2RQQ A;  2X6W A;  3HB9 A;  2L54 A;  3LQQ A;  3OS1 A;  5DYM A;  4S05 A;  1GVD A;  4M9S A;  4OIQ F;  1YIO A;  3LA2 A;  1FY7 A;  2EIN H;  2EB7 A;  1O3Q A;  3ZGK A;  4KIC A;  4OMZ A;  2P81 A;  3GCM A;  4G6D A;  4IRH A;  5E3O A;  3MEX A;  3H36 A;  4R79 A;  2Y69 H;  4U87 A;  5CVR A;  2R7Z J;  2OZ6 A;  3HJE A;  2HVS A;  1E3O C;  3EDP A;  2Z5U A;  3S3M A;  1VQO I;  1I1S A;  2VOO A;  5TGT A;  4KT5 C;  2ID3 A;  1IRX A;  2LC2 A;  3BJO A;  1WI3 A;  3OYI A;  3D5S C;  4G6T B;  4M6X A;  3RCO A;  4LG0 B;  2BY0 A;  4OAZ A;  3CCV I;  2LOO A;  2ZME B;  3ZQ7 A;  3OYN A; 
#chains in the Genus database with same CATH homology
 2PMU A;  2ISY A;  3WTU C;  2LF8 A;  1MDM A;  2ZME A;  5L3E A;  1JGS A;  5KK1 A;  2UWM A;  2IJL A;  4PGG A;  5ILS A;  3J7A O;  3IC7 A;  4UVC A;  2QM3 A;  5HLH A;  4FHT A;  5HDK A;  4A0Z A;  2XRO A;  1FSE A;  4BHC A;  3KLO A;  3FXU A;  2CGP A;  4HLX A;  4IJA A;  3JAM Z;  4Y15 A;  1P4X A;  5L3G A;  1IRG A;  2XAQ A;  4MNU A;  1MKM A;  1BBY A;  3I59 A;  3F8M A;  4RB0 A;  3CO6 C;  1ZGJ A;  1BJA A;  4MQV A;  2KIM A;  1Z9C A;  4HYE A;  1YS7 A;  3KP6 A;  1U5T A;  4Q4Z F;  2P5V A;  1U5T B;  2CG4 A;  3DXJ F;  1MJB A;  4MGR A;  1ZYR F;  2P6S A;  2PQ8 A;  2X4H A;  2VBZ A;  4WXD A;  4YG2 F;  4HF1 A;  1SAX A;  1Z05 A;  2RGV A;  2OZU A;  3FHZ A;  2Z3Y A;  3GXO A;  2YX4 A;  1XSX A;  1UB9 A;  1LEA A;  2V1U A;  1DDN A;  2VBX A;  3DPL C;  1XB4 A;  5CVU A;  1GVJ A;  4A12 A;  4HA8 A;  2FF4 A;  5K5Q A;  2ZJ2 A;  5ED4 A;  2EFQ A;  2VBW A;  1V4R A;  4MTD A;  2J5P A;  1IN6 A;  2XAH A;  3DV8 A;  3ZMZ A;  2F5F A;  2F5C A;  2IP2 A;  1TNT A;  1H9T A;  4UV9 A;  3JTH A;  2HKX A;  3O6B B;  3ZN1 A;  4EJO A;  1I27 A;  2ACJ A;  4BNC A;  1T2K A;  2V79 A;  4CYD A;  4I7H A;  5ILV A;  2Z99 A;  3GVA A;  4AIJ A;  2Y75 A;  4KIG A;  5K1Y A;  4P9U A;  2DAO A;  3LWF A;  3AAF A;  4A0X A;  4WWC A;  2HWV A;  4B09 A;  1YW9 A;  4KFC A;  4LGW A;  5ILU A;  1S8N A;  2XAF A;  4P96 A;  2V1D A;  3SXY A;  3U2R A;  2LDU A;  1KQ0 A;  2W85 A;  3MCZ A;  3FZV A;  1GHC A;  3K2Z A;  1DUX C;  5BMZ A;  2ZXJ A;  1S7O A;  4O6J A;  3LA7 A;  3WU0 A;  4G7Z F;  2EA4 A;  2NS0 A;  2MC3 A;  1S3J A;  1Z1D A;  1FX7 A;  4M73 A;  5HS9 A;  4YFK F;  3IKT A;  1B6A A;  4IRI A;  3MZY A;  2FQ3 A;  1U6G A;  2COM A;  1L3L A;  5LGT A;  3WTZ A;  5FB2 A;  1D8K A;  5BS6 A;  1IN5 A;  4M9X A;  4Y13 A;  1ZHF A;  3CUO A;  4ENM A;  2C6Y A;  4EM2 A;  3I58 A;  1R1T A;  4EM0 B;  2A3S A;  5D5W B;  3U9G A;  4MTE A;  4XSZ F;  2CQK A;  1QBJ A;  1LNW A;  4PZJ A;  2M8E A;  3DP7 A;  2EJR A;  4L9V A;  2XKP A;  4L9J A;  3VOE A;  1ZH5 A;  1BIB A;  4QWQ A;  3I0T A;  3MWM A;  3KEO A;  3RDI A;  3ZP5 A;  1J7K A;  3BJA A;  1Y0U A;  1SD4 A;  3KP3 A;  4G7O F;  1HST A;  2XAJ A;  3DKW A;  1ZRE A;  3BJ6 A;  2HTS A;  3ZMV A;  4RB2 C;  5E17 F;  3M9A A;  2TDX A;  2DK5 A;  5E1W A;  4B8X A;  1BM9 A;  1K6O A;  1KGS A;  3FM5 A;  2XVC A;  5CLS A;  3IKV A;  5HS8 A;  1YW7 A;  4IF4 A;  2FSW A;  1LVA A;  3V8J A;  3E5X A;  2K7L A;  2CYY A;  1IRF A;  2DU9 A;  4N9H A;  2D1V A;  3P9C A;  3HRT A;  5JHU A;  4IHS A;  3CUQ C;  3KP7 A;  4I98 B;  3K1P A;  3RPQ A;  5HLI A;  1TLH B;  1FP1 D;  3GF2 A;  3ULQ B;  4U88 A;  3LFK A;  2DT5 A;  2FOK A;  4EGZ A;  5L3C A;  1FYK A;  3F3X A;  3RJP A;  4FT8 A;  1PDN C;  1ZAO A;  2O0Y A;  2JRT A;  1LJ9 A;  3F6O A;  5D8L B;  4XLP F;  5DUI A;  1DP7 P;  1V3F A;  2M1B A;  3W6J B;  1OMI A;  1IUY A;  1BI1 A;  1DPR A;  1G3S A;  2HDC A;  1WSU A;  3KZY A;  3KZZ A;  5DD8 A;  4L5J A;  3PQJ A;  3KCC A;  3ABT A;  1D3Y A;  2E7X A;  2P6T A;  4LMY A;  2OQR A;  4LB6 B;  3KP5 A;  4K2E A;  3IRR A;  3MFK A;  3BOQ A;  4WK8 F;  3ZMT A;  5FLX K;  3O2P E;  5D5U B;  3HOT A;  3FMR A;  1K78 A;  4M74 A;  1UHW A;  2UZK A;  5CJ9 A;  1K78 B;  4UNO A;  3F8B A;  4KIB A;  4EMS A;  2EK5 A;  2A6H F;  2Q0O A;  3ELK A;  3L7W A;  4OU0 A;  3TO7 A;  1NHA A;  4G9Y A;  1UST A;  4DNC A;  1D5V A;  2VXZ A;  5FFZ A;  3M7G A;  2XAS A;  1T98 A;  3R0A A;  3IWF A;  5D4S A;  3IRQ A;  2HQR A;  4A5N A;  2Z9O A;  4ZYE A;  3TGN A;  4ESB A;  1H9G A;  5JR3 A;  2ELH A;  1Z6R A;  1RZ4 A;  3J80 K;  4RGS A;  5H6R A;  4M6Y A;  3F6V A;  3F22 A;  4WF2 A;  4M71 A;  2XGX A;  1LDK B;  4G94 A;  3GEZ A;  3V7R A;  1KU9 A;  3QPT A;  3BRO A;  3M8E A;  4Z2Y A;  4U7B A;  2H09 A;  2PG4 A;  2VBY A;  1OYI A;  1SD5 A;  4N9I A;  5DV5 A;  4QLC U;  1HBX G;  3NEU A;  1U78 A;  4YFN F;  3T0Y A;  2FE3 A;  2NAZ A;  4OIN F;  3V7C A;  1CGP A;  3T1B A;  4AIH A;  3I54 A;  1EH6 A;  2BBY A;  5D8K B;  3WTY C;  5D6F A;  2JPB A;  5ICF A;  3W6K B;  2HKO A;  5ERI A;  2G9W A;  2O61 A;  1T39 A;  2DBB A;  1SMT A;  1P2F A;  4P9F A;  1O3S A;  3GX4 X;  1XGS A;  1I1G A;  3LST A;  4BHB A;  4HDV A;  3Q9S A;  4IPA A;  2ZCW A;  3WE3 A;  3SQN A;  1HW1 A;  3SHF A;  1KYW A;  1IXR C;  1AWC A;  3C3W A;  1TNS A;  3JSP A;  2Q2E A;  4L18 B;  3GW2 A;  3QP6 A;  3IL2 A;  3QPH A;  4RS8 A;  2G7U A;  3S2W A;  3PFI A;  3HSE A;  3CO7 C;  1FT9 A;  1HKT A;  3HUG A;  3DPT A;  4UHT A;  3H92 A;  1HSJ A;  3KEQ A;  4L5I A;  4L9T A;  2CFX A;  2YSR A;  5DUK A;  1TW3 A;  2IPQ X;  2W24 A;  1EV7 A;  2D45 A;  1IN8 A;  2HZT A;  1U2W A;  1IN4 A;  3WTW C;  3PQK A;  3HTU A;  1XMA A;  3T5X A;  4YFX F;  4HX7 A;  1J0R A;  3E6M A;  4HZF A;  4HBL A;  5DCF A;  3N97 A;  3VFZ A;  3WU1 B;  1MJ9 A;  2DFI A;  1ZN2 A;  2GZW A;  2VE8 A;  3RIR A;  3H3Z A;  4Q5S F;  1T38 A;  2ETH A;  5CVV A;  4S04 A;  2QQB A;  3WTX C;  2VOP A;  3JSO A;  4RAY A;  2JT1 A;  1BC7 C;  1O7F A;  4GYI A;  2QBY A;  2L4M A;  2D2W A;  1Z6T A;  4PCQ A;  1ZRC A;  3J81 Z;  4KA4 A;  4WXH A;  4Y17 A;  2QYO A;  5D4R A;  5J8F A;  4I02 A;  1UHM A;  3HHG A;  4KUM A;  1BIA A;  4AD9 A;  3E3V A;  3QP5 A;  2W57 A;  3TO6 A;  2EWN A;  3E97 A;  1FPQ A;  1B9M A;  1WI9 A;  1BI2 A;  2FXA A;  5CYV A;  4ASN A;  4EQQ A;  5BPD A;  4KN7 X;  4EV0 A;  4JK1 X;  3K1N A;  3I59 B;  2YPR A;  1EH8 A;  2RQP A;  1XMK A;  1H0M A;  3QOP A;  1UCR A;  4AWX B;  1QQI A;  4RB3 C;  5K5R A;  4UUV A;  5EEG A;  2QEN A;  2DTR A;  1CF7 B;  3GWZ A;  2DK8 A;  5ICE A;  2DPU A;  3G73 A;  2O6G E;  2ZNZ A;  2H94 A;  5LGU A;  4IHT A;  1J75 A;  4Q47 A;  1R7J A;  1IW7 F;  1FBS A;  4ZZL A;  2EFP A;  2V1X A;  1YS6 A;  2P7C B;  4IXA A;  4R8H A;  2F2E A;  3FMQ A;  2Q8K A;  4H0E A;  5FD6 A;  3K9T A;  4ZYD A;  2PEX A;  5E8G A;  4CGZ A;  4ZYG A;  4N0B A;  2P4W A;  5ICC A;  2GQQ A;  5H6Q A;  4RGX A;  2QBY B;  3CUQ A;  2HYF A;  1LQ1 A;  2D1H A;  1TQP A;  4MEX F;  2QWW A;  4HAM A;  1OR7 A;  2L4A A;  1RIO H;  4I2O A;  1YLF A;  4U0V A;  2ADU A;  1ZG5 A;  5D6E A;  2HR3 A;  4WXC A;  2IA1 A;  3FXR A;  4GXO A;  2V9V A;  2W25 A;  3V7S A;  2LKP A;  4HX4 A;  2GA2 A;  1JE8 A;  4HV6 A;  4O3M A;  2IA2 A;  4LJZ F;  4L0Z B;  5JVT A;  1O3T A;  2K86 A;  2JTV A;  2XUB A;  1U3E M;  1LEB A;  2PMH A;  3NQO A;  2EV6 A;  2E7W A;  3V4G A;  1ODD A;  2RV8 A;  4EGY A;  2R7D A;  3H3U A;  1SMY F;  3B73 A;  3L9F A;  3NRV A;  5HDN A;  2G7H A;  3RKX A;  1WRJ A;  3KP2 A;  3ABU A;  2DQR A;  4XLN F;  4HX8 A;  3T8R A;  3EYI A;  2ZNY A;  1XGN A;  2QQA A;  2VON A;  1R5H A;  4OMY A;  3KE2 A;  3DF8 A;  5AIP A;  1REP C;  3WG9 A;  1GXP A;  4F7Z A;  1FBQ A;  4LK0 F;  5FO5 A;  2WC2 A;  3SZT A;  5L3F A;  3TDZ C;  1LB2 A;  1R22 A;  5JFR A;  1ONV A;  2ESH A;  5LBQ A;  3RYP A;  1U5T C;  2RKH A;  5JI6 A;  3R61 A;  5FLX Z;  2FNA A;  5LEK A;  4IVN A;  1P6R A;  1O57 A;  3N4M A;  2J5O A;  1BN5 A;  2FBH A;  3DFG A;  3FX3 A;  1KA8 A;  5DCM B;  1HKQ A;  4DQ2 A;  4A0Y A;  2IW5 A;  2LSO A;  3QU3 A;  3QRF F;  2L02 A;  3K1M A;  2XAG A;  5AON A;  5FFX A;  3F8F A;  5LHI A;  3BP8 A;  4HQE A;  2YX7 A;  3I71 A;  3WTS C;  1KYZ A;  3TQN A;  2H27 A;  4LLG F;  4BXU A;  2EFO A;  3ZMD A;  1MGT A;  3R6S A;  2X0L A;  2A07 F;  2MLK A;  4A6E A;  2UXN A;  1T6S A;  2GIV A;  1SFE A;  3HHH A;  2MLG A;  2AS5 F;  1OYW A;  1PUE E;  2ESN A;  2NNN A;  2OAZ A;  3P9K A;  2FML A;  2PN6 A;  3E6B A;  4EJU A;  1ZG3 A;  4UVA A;  3HOS A;  4U7D A;  3ERE D;  1MJA A;  3GFI A;  3G3Z A;  1WQ2 A;  1W7P A;  2A5Y B;  2NRA C;  1JHH A;  2FMY A;  1RUN A;  3ZN0 A;  3VB2 A;  1WKM A;  1XSV A;  2OQG A;  4EJW A;  2KRF A;  5CVJ A;  2VOD A;  1G3T A;  4IRG A;  2DI3 A;  2STW A;  1BI0 A;  1KU2 A;  4HLY A;  3C7J A;  3I5U A;  4ZZD A;  3WTV C;  3T8T A;  3BPV A;  2XIG A;  3CJN A;  1BOA A;  2LF7 A;  3CUQ B;  3R60 A;  5LHH A;  4PDK A;  4FX4 A;  3LA3 A;  2M45 A;  4AVP A;  2Y0M A;  3GFM A;  1L0O C;  3BWG A;  5E1Z B;  5IT3 A;  3E6C C;  2IA0 A;  1P4W A;  3TO9 A;  1C0W A;  1DPU A;  2DO7 A;  1Z7U A;  3ECO A;  1ULY A;  4HW0 A;  4CHU A;  1HKS A;  4BHP A;  1SD7 A;  3ECH A;  2PJP A;  3BDD A;  4BYY A;  3GFL A;  4JBA A;  4LFU A;  1GXQ A;  3P7N A;  3TOB A;  1IXS B;  1B4A A;  5HS7 A;  1IF1 A;  3KET A;  3RKY A;  3JAM K;  5FGM A;  1T0F A;  4R1H A;  5F64 A;  2HGC A;  5TJJ A;  2XKO A;  4MQ9 F;  3GZ5 A;  4YII A;  5LGN A;  1EH7 A;  2HS5 A;  4I01 A;  3HYI A;  1F9N A;  3LAJ A;  1I6X A;  3IWZ A;  2FBI A;  2IT0 A;  1KU7 A;  2HTJ A;  5D5V B;  2R3S A;  3FF5 A;  4LLN A;  1W7P D;  2R7F A;  1R5G A;  1R23 A;  2W84 A;  4RB1 A;  1J5Y A;  1YO5 C;  1TBX A;  2UXX A;  2DQL A;  4UVB A;  1ON2 A;  2RNJ A;  4D0P A;  1RUO A;  4AIK A;  1ZGA A;  2EFW A;  5E20 A;  2JZY A;  2M5W A;  5ICG A;  4OOI A;  5DCM A;  2A68 F;  4CO8 A;  1IAW A;  4CDG A;  2P5K A;  2KJC A;  1QGP A;  1FYM A;  4PGH A;  2MH2 A;  4UXN A;  2M87 A;  1QO0 D;  2LNB A;  2O03 A;  3WOD F;  4A5M A;  1X3U A;  1P4A A;  4BAY A;  1S29 A;  1YYV A;  2VT2 A;  5AIQ A;  3TDU C;  4KNY A;  5E8I A;  1OYY A;  5J6X A;  1XSD A;  1K7A A;  1HXD A;  1R1V A;  1JXS A;  3HRU A;  5J8C A;  3B02 A;  3ZMS A;  1E2X A;  2MBF A;  1CF7 A;  2K27 A;  2BE5 F;  2FU4 A;  5IT9 Z;  2JSC A;  3GZ6 A;  1W7P B;  4BQA A;  1A04 A;  3KFW X;  1IN7 A;  2XHK A;  1XDS A;  3ZMU A;  4NQW A;  2V6C A;  3Q5F A;  4HF2 A;  1B9N A;  4LD5 A;  3CLO A;  2Z33 A;  2WV0 A;  1F5T A;  2BV6 A;  1XD7 A;  4YIF A;  1PP8 F;  1HW5 A;  1YQA A;  4I09 A;  2P8T A;  2FNP A;  2H6B A;  4RGR A;  3FXQ A;  5LRS A;  4CIC A;  3BZ6 A;  2OBP A;  4ENN A;  3EQL F;  1FYL A;  3F21 A;  2BEO A;  1G3Y A;  3COA C;  1MZB A;  5LEJ A;  2GAU A;  5H20 A;  1XGO A;  2MD5 A;  3R4K A;  1J59 A;  2VN2 A;  3OOP A;  2XV4 S;  3EET A;  1SD6 A;  2CW0 F;  2QLZ A;  1HW2 A;  3C1D A;  3D0S A;  2DW4 A;  2GWR A;  2VC1 A;  5EEH A;  1ZG1 A;  2QVO A;  5F6F A;  2VE9 A;  1TQM A;  2EV0 A;  1D8J A;  2HQN A;  3EYY A;  1ZRF A;  3RKW A;  1ON1 A;  3CTA A;  2K4J A;  1S6L A;  5CVI A;  1YW8 A;  4G8X A;  3FWE A;  2HEO A;  1MD0 A;  1B59 A;  4E70 A;  3SZP A;  4XBF A;  2PFB A;  2K4B A;  1SFU A;  1BI3 A;  5BPI A;  2FEZ A;  3F8C A;  5KVR A;  2RC4 A;  2QQ9 A;  1KQ8 A;  2QZ8 A;  4OIO F;  4M9Z A;  1FSH A;  3BPX A;  2IVM A;  4EM1 A;  2ZFW A;  4A6D A;  1G4D A;  3J81 K;  1UFM A;  1FBU A;  1W5S A;  4OIR F;  1XCB A;  3P9I A;  1LDD A;  4MEY F;  1VTN C;  3ROU A;  2STT A;  2ZBK A;  3I4P A;  4CXF A;  5IT9 K;  3Q9V A;  1O7L A;  4U0W A;  3E5Q A;  3CDH A;  1KQ9 A;  2OD5 A;  2Y48 A;  3TOA A;  3VOD A;  3I53 A;  2CWE A;  1RI7 A;  4MHG A;  3WGG A;  2JPC A;  2MH9 A;  5HOO A;  1KU3 A;  4ZYH A;  4FX0 A;  2OA4 A;  4GYG A;  4KMF A;  4A2U A;  5DEQ A;  2GA1 A;  3C18 A;  2RN7 A;  2O3F A;  3GYH X;  1I5Z A;  3RI4 A;  3BY6 A;  4HDU A;  1WWX A;  2CSO A;  2K02 A;  3RYR A;  1E17 A;  5E1X A;  6PAX A;  2O8X A;  2A61 A;  5DDG A;  1ZAR A;  5L3D A;  5LHG A;  4L9N A;  3O3K A;  3V8K A;  1RNL A;  4LG0 A;  5DD4 A;  2P5L C;  1PP7 U;  2KIU A;  4UV8 A;  2P7V B;  1S7A A;  3K69 A;  2A69 F;  3F72 A;  4ENK A;  4I0A A;  5L3B A;  1TTY A;  1P92 A;  3FMS A;  3KLN A;  5TRD A;  3E5U A;  2GXG A;  1YFH A;  4KYW A;  2IRF G;  2L01 A;  4ENJ A;  4EVI A;  2WTE A;  4RGU A;  1LDJ A;  3IHU A;  2BYV E;  5F1R A;  3J80 Z;  1SFX A;  5LRR A;  4P55 A;  2PBI A;  2NNY A;  2HFH A;  3RTR A;  1USS A;  2H6C A;  1G3W A;  3E6D A;  2A6E F;  1OPC A;  3VEP A;  1W5T A;  1ZLJ A;  2NYX A;  2PI0 A;  1ZRD A;  1F4K A;  1O3R A;  3ZPL A;  2ZKZ A;  1Q1H A;  4L0Y B;  4EJV A;  4ZH4 F;  2GXB A;  1AOY A;  1F1Z A;  2VC0 A;  3JW4 A;  4HV5 A;  1W4M A;  1FZP B;  3MZH A;  4WCG A;  4M72 A;  3L2C A;  3MAJ A;  4EJT A;  2WWY A;  3I64 A;  1FNN A;  1MDM B;  2EA2 A;  4P5O A;  5A2Q Z;  1JHF A;  2EV5 A;  4KN4 X;  2MA3 A;  3HIF A;  3KP4 A;  1FLI A;  2FRH A;  4O5V A;  5LLQ A;  4ETS A;  3U1D A;  1ZLK A;  2QUF A;  1XDU A;  4I0B A;  1FOK A;  4Q48 A;  5K5O A;  4TV7 A;  3K0L A;  4GGG A;  3MQ0 A;  2F5E A;  2RDP A;  1TQI A;  3SFZ A;  1U8R A;  3DQV C;  3QAH A;  1R00 A;  4BH9 A;  4KIF A;  3ML6 A;  1OKR A;  4NB5 A;  2DLL A;  4GO1 A;  3TKY A;  3L09 A;  4ESF A;  1XGM A;  2ZO4 A;  4ESJ A;  3L00 A;  2FA5 A;  4LB5 A;  3OV8 A;  3HSF A;  3D5L A;  4G6Q A;  2KIF A;  2RVC A;  4HQM A;  3WE2 A;  2KKO A;  3QU6 A;  3FM3 A;  2OU2 A;  5FD5 A;  2ISZ A;  2XRN A;  3WGI A;  4G7H F;  4LK1 F;  2VT3 A;  2FBK A;  3WTT C;  2M30 A;  2YU3 A;  2HOE A;  1XCV A;  1HQC A;  3EUH A;  1Z91 A;  2HYG D;  1IZ1 A;  5HDG A;  1STZ A;  1QZZ A;  1B1B A;  3REO A;  4OIP F;  4XSX F;  3HTS B;  2AXL A;  3R0J A;  3GO5 A;  2B0L A;  2EFN A;  1FC3 A;  2CO5 A;  4U0Y A;  3JTG A;  1K79 A;  5HLG A;  1R36 A;  3GUD A;  4KDP A;  1J2X A;  4WX9 A;  3LQR A;  3WGH A;  3F23 A;  3GLX A;  1BC8 C;  2L3D A;  1FP2 A;  1IXC A;  1R58 A;  1FWZ A;  3M1E A;  3HRS A;  2E1C A;  1QZY A;  4KMU X;  5BOX A;  1TW2 A;  3HSR A;  4CZZ A;  2DPD A;  3DEU A;  4GCV A;  4JQF A;  2E1N A;  1G6N A;  2YR2 A;  5A2Q K;  1XN7 A;  1YTY A;  1J9I A;  1YG2 A;  3HRM A;  4RAZ A;  4XRF A;  1QPM A;  2KJB A;  3V8L A;  2PLY A;  5HVQ C;  3GFJ A;  3ISP A;  3RPU A;  3LAP A;  4LLL A;  3M8F A;  1R1U A;  4NHJ A;  4ON0 A;  5E18 F;  2F5D A;  5D5X B;  5BQT A;  1QNT A;  3F8N A;  2BGC A;  4HOB A;  4HF0 A;  2L54 A;  3LQQ A;  5DYM A;  4S05 A;  4OIQ F;  4M9S A;  1YIO A;  3LA2 A;  1FY7 A;  2EB7 A;  1O3Q A;  4KIC A;  4OMZ A;  4G6D A;  4IRH A;  3MEX A;  4R79 A;  5CVR A;  2OZ6 A;  3EDP A;  2Z5U A;  1I1S A;  2VOO A;  4KT5 C;  3BJO A;  4M6X A;  4LG0 B;  2ZME B;  3ZQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...