1RIOH

Structure of bacteriophage lambda ci-ntd in complex with sigma-region4 of thermus aquaticus bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
b'SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 27-MER
publication title Structure of a ternary transcription activation complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 22
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rioH00
4XBFA 2XAFA 2K27A 3BPVA 2FMLA 1U5TC 1X3UA 2JZYA 2F5DA 1XSVA 1G4DA 5A2QZ 1DP7P 4FX0A 5FD6A 3DPLC 1MDMB 5CYVA 3N97A 3J80K 3IC7A 1K6OA 1HW5A 3TQNA 1C0WA 4UVBA 5CVUA 3CUQB 1TLHB 2ZMEB 3KLNA 2MA3A 4RB2C 2VOPA 2VC0A 5F6FA 2P6SA 3KZYA 3E97A 2OQRA 4ENNA 2P6TA 3GUDA 1PP8F 2HWVA 3EETA 4HV6A 3KEOA 5ED4A 3MWMA 4M9XA 4BHCA 2WV0A 1TBXA 4LK1F 1SFEA 4B09A 2K4BA 3LWFA 1SMTA 1STZA 2OZUA 3BPXA 1U78A 4EVIA 4WX9A 3T1BA 4A12A 2XAQA 1AOYA 2NAZA 5DD4A 3SXYA 2M87A 1TQIA 1LVAA 2CQKA 2YSRA 3TO6A 2UXNA 2L54A 4IPAA 4LFUA 3HRUA 5HDKA 2PFBA 1W4MA 1IN8A 3T0YA 4RAYA 2A68F 1MDMA 5HS8A 4M73A 3BDDA 3I59A 4JQFA 3ABTA 1OKRA 2XASA 5JHUA 1VTNC 3T5XA 1CGPA 1F1ZA 3CUQA 3IHUA 3GFIA 1FZPB 4I01A 2UZKA 4XLNF 4EGYA 3DFGA 5H6QA 5FLXK 1KU7A 3MQ0A 2F2EA 2VE8A 4LLLA 2E7WA 4G94A 1Z1DA 1PDNC 4LK0F 4L5JA 1O57A 1DDNA 2G7HA 3W6JB 1U8RA 4OINF 5LEKA 1FPQA 3ZMUA 2GWRA 3V7SA 2H6BA 3BJ6A 5HS9A 1U3EM 1USTA 3G73A 2A5YB 2D1HA 4AVPA 4EJUA 3ZPLA 3GWZA 1F4KA 4BHBA 1R23A 3GVAA 4CGZA 2XGXA 1FP2A 2HKOA 3I53A 3F23A 1JXSA 1ZG5A 2HZTA 1OYIA 1LB2A 3ELKA 2ZJ2A 3PQKA 4XSXF 5CJ9A 1UHWA 3KP3A 3FWEA 2AS5F 1FSEA 4ASNA 1XN7A 2VBXA 1YW8A 2Y0MA 2NNNA 3ML6A 1S8NA 3ZP5A 3SZPA 4EJTA 4U0WA 2RGVA 1AWCA 4EJOA 3LAPA 3PQJA 2KRFA 3F6OA 1BOAA 1MJAA 2Z99A 3M1EA 1I1GA 1D5VA 4EM1A 1P4WA 2M30A 1IW7F 4IHSA 2EV5A 3GX4X 4WXHA 5BS6A 3HTSB 4EJWA 2W24A 4Y13A 2QBYB 2DT5A 6PAXA 3M8EA 3N4MA 1O3RA 2VT3A 4Q4ZF 4LLGF 2OAZA 1KU2A 1IN6A 2ZXJA 4CO8A 2M45A 1QPMA 2XAHA 4L18B 4R79A 3WTXC 2B0LA 3T8RA 3DQVC 2ESHA 1E17A 3QP5A 2H09A 1U6GA 3HIFA 4HLXA 3HSFA 2ISZA 3PFIA 1WI9A 3FMQA 3DPTA 2DAOA 4HF1A 4YIFA 2A69F 4TV7A 3EYIA 2VOOA 3GEZA 3LA3A 2OU2A 2FQ3A 4IVNA 4BH9A 3FMRA 4HQEA 4KYWA 2XUBA 2HQNA 1RIOH 3F22A 3KP2A 3T8TA 2PN6A 1IRFA 1T2KA 5DUKA 5DDGA 1JHFA 5LBQA 3IWZA 1FBSA 1V4RA 1ZLJA 3SFZA 1F9NA 2Q8KA 3ZMDA 2X0LA 2M8EA 2R7FA 4L9TA 2RDPA 3ZMTA 2MLKA 2FNPA 1R36A 3I58A 3V7RA 4RGSA 1L3LA 5L3FA 2CSOA 3MEXA 1R58A 4HV5A 3WTZA 5LHGA 1XCVA 2VXZA 1S7OA 2LSOA 2ETHA 5DYMA 3U2RA 2A07F 3KP4A 3B02A 3H3ZA 2STWA 4U7BA 2JT1A 3ZMZA 2JSCA 3REOA 5AONA 2HOEA 4LB5A 3GF2A 4IRGA 3OOPA 5BPIA 3HRTA 2VONA 3BROA 3U9GA 3P7NA 1TNTA 3SQNA 1IRGA 2QLZA 2EV0A 4G6QA 2IVMA 4BHPA 1MGTA 2VBYA 4M71A 3FXUA 2G7UA 1XSDA 5ILVA 2BGCA 1SFXA 2ESNA 4KN4X 4WXDA 3HOTA 3JSOA 4GYIA 3ZMSA 3TO7A 1H9TA 3K2ZA 1UB9A 1FYLA 1FBQA 4ENKA 1B59A 1O3SA 1HSTA 3BZ6A 3K9TA 5BQTA 2A61A 2FRHA 3V7CA 2K4JA 1KQ0A 2NYXA 2EK5A 1WQ2A 1YTYA 4GYGA 2ZNZA 2GAUA 2ZNYA 4FT8A 3ECOA 3P9CA 2J5OA 1SAXA 4OIOF 3HRMA 5HS7A 3I71A 1MKMA 4ZZDA 5DV5A 4UUVA 2J5PA 4O6JA 5CVIA 2CGPA 4R1HA 3Q9SA 2VN2A 5D8LB 2RV8A 3WTYC 1XDUA 1T98A 5ICEA 3EYYA 4ZYHA 2XKOA 3WU0A 4UNOA 4OOIA 5ICGA 1RUOA 4F7ZA 2JPBA 3WODF 3WTTC 2WWYA 1W5SA 5H20A 4HYEA 4PZJA 2BV6A 5ICCA 3EUHA 2V6CA 2F5CA 5J6XA 2CW0F 1LNWA 2DW4A 4A0XA 1LEAA 3QP6A 4FX4A 5K5RA 3EQLF 3LA7A 2FE3A 2FBIA 1FLIA 3ISPA 3QU3A 1IN7A 4K2EA 3JAMZ 2UXXA 3I59B 4QLCU 1OPCA 4RGUA 4S05A 2P8TA 3RDIA 1ULYA 1ZRFA 2KKOA 2PI0A 4P96A 3IRQA 3CLOA 3F21A 4I2OA 1Z6TA 3LA2A 3GFJA 2QQAA 5JR3A 3I0TA 1D8KA 4IRIA 3LQQA 4PCQA 4JBAA 1XDSA 5K1YA 2HS5A 2RVCA 1E2XA 5D5VB 2L3DA 2GZWA 2MH2A 1O7FA 2R7DA 5L3GA 5E1ZB 3QOPA 4OIQF 3SZTA 2P7VB 1YLFA 2CWEA 1D8JA 3ERED 1J59A 4NHJA 2V9VA 3ABUA 1SMYF 4L0YB 3WGGA 3SHFA 4ETSA 4XRFA 1Y0UA 1LQ1A 4E70A 3GXOA 3HSEA 1D3YA 2P4WA 3RKWA 1YS6A 2PJPA 1H9GA 1I6XA 3DKWA 5TRDA 1YYVA 4Y17A 3C1DA 3O3KA 1HBXG 3OV8A 4HW0A 2Z9OA 2QM3A 1R7JA 2YPRA 4OU0A 4AWXB 4KDPA 3O2PE 4HOBA 3ZMVA 3F8CA 3L09A 4NQWA 5FFXA 4G7OF 3FHZA 4HAMA 2KIFA 4YIIA 4WCGA 5CVJA 2DPUA 4RGXA 1P92A 2MC3A 2V79A 4ESFA 1RI7A 3WTVC 2Q0OA 3C7JA 2W25A 2C6YA 3E5UA 2IT0A 4AD9A 4YG2F 3FZVA 3WTSC 1KQ9A 2OA4A 5LGUA 1KYZA 1R1TA 2LF8A 5ILUA 2FF4A 2FXAA 3KFWX 1NHAA 1F5TA 1BIAA 3E5XA 4P9UA 5IT9Z 1YW7A 1FWZA 3AAFA 3V8JA 4P55A 2XV4S 4UVCA 1ON1A 4XSZF 2P5VA 4G7ZF 4YFNF 3RPQA 5E1XA 1XGOA 2FA5A 3K1MA 4GCVA 2QUFA 2E1NA 2XIGA 3EDPA 2DFIA 2H6CA 5J8FA 2L02A 4MTEA 3WGIA 2RNJA 4BQAA 4KIGA 4OIRF 2WC2A 5AIPA 3TDUC 1TW3A 2VT2A 3IL2A 1T0FA 1IN4A 5L3DA 1T6SA 2W85A 1YS7A 1XMKA 1IXSB 1W7PA 1XSXA 1ZRDA 1ZN2A 2ZKZA 1YQAA 4KN7X 4MEXF 3HHGA 5L3EA 4MTDA 1R00A 1O3QA 1IZ1A 3FXQA 2STTA 1FX7A 2X4HA 4CZZA 1USSA 1R5HA 2RKHA 1T38A 3J80Z 2XKPA 5E20A 4HZFA 2MLGA 2D45A 3R60A 4ESJA 4M9SA 2GXBA 2NS0A 1J7KA 4EJVA 2QQ9A 1FBUA 2O03A 4UXNA 3LQRA 4WK8F 4A5MA 3F8FA 4Q47A 2YR2A 4IHTA 2IP2A 3HYIA 3D5LA 3R61A 2HEOA 3J81K 5E1WA 4N0BA 4MQVA 4EM0B 4HQMA 5E8GA 5D8KB 2ISYA 3Q9VA 5DUIA 2DK8A 3U1DA 4G8XA 4LMYA 3VOEA 3B73A 5JVTA 1J9IA 4Y15A 1S29A 2QZ8A 1FOKA 2BE5F 1Z9CA 1Z05A 2JTVA 1P2FA 5ICFA 2HYGD 5HLIA 1JHHA 2EWNA 2DO7A 2ZO4A 1K7AA 3DEUA 2IW5A 4ZH4F 2F5FA 4DNCA 1IXCA 2HDCA 1P4AA 2DBBA 5ERIA 2D1VA 4ZYEA 1QQIA 4I0BA 3VEPA 3RIRA 5K5QA 1BN5A 5A2QK 4ZYDA 2EFPA 1SD4A 4I02A 4L9JA 5FLXZ 2EV6A 1FY7A 4Z2YA 3KP5A 5BOXA 1OMIA 2M1BA 3I64A 5CLSA 1IAWA 2KJBA 4Q48A 1WKMA 5FGMA 2EJRA 4HBLA 2Z33A 3MCZA 1I27A 2DQRA 5HDGA 1K79A 4LGWA 3BOQA 3ZQ7A 3FX3A 4CDGA 3GO5A 1T39A 5D5WB 2Q2EA 2H27A 5FB2A 2EFWA 4KMFA 2BBYA 3FM5A 2EFQA 3DF8A 2V1UA 3E6BA 5DCFA 1O3TA 2IA1A 3MFKA 2W84A 4IJAA 4CXFA 2DU9A 1V3FA 2E7XA 1QBJA 2PMUA 1MJBA 2O3FA 3R0AA 5KK1A 2QQBA 1FNNA 3JSPA 4B8XA 2CG4A 4WWCA 4A0YA 1WWXA 5EEHA 4U7DA 2VE9A 3F72A 1I1SA 4HDVA 2LNBA 1IXRC 5D5XB 1XGNA 2FBKA 2QENA 1DPUA 3GYHX 3L00A 2BYVE 2Z3YA 1U5TB 1H0MA 1REPC 2P7CB 4M9ZA 4A6EA 4GO1A 1K78B 1FYMA 3BJOA 4KA4A 1J5YA 4QWQA 1P4XA 1R5GA 5AIQA 4RB0A 1YW9A 3KE2A 5E17F 2ZFWA 1BI1A 3F8NA 1KGSA 1TW2A 1KA8A 4G6DA 1KU3A 2QVOA 4G9YA 5DD8A 3WE2A 5HLHA 3GFLA 4D0PA 1PP7U 1XGSA 4I0AA 2E1CA 1TNSA 2A3SA 2HGCA 5D5UB 2TDXA 3E6CC 2EA4A 3DP7A 2ZBKA 2FNAA 3GLXA 2QWWA 3L2CA 4OMYA 3GZ6A 3J7AO 2XVCA 1TQMA 2O0YA 3FM3A 2ELHA 4CYDA 1EV7A 3MZHA 2HFHA 1MD0A 4EM2A 3I5UA 4O3MA 3JW4A 2KIUA 3M9AA 2VODA 2HQRA 1LDJA 1ZARA 3MAJA 1U5TA 4LB6B 2MH9A 3ZN1A 3ZN0A 1ON2A 3RTRA 2GIVA 1K78A 3P9IA 3F8MA 2ZCWA 3WU1B 1HW2A 1I5ZA 5D6FA 4A2UA 4MNUA 4P5OA 1EH6A 5KVRA 1A04A 1BBYA 5D6EA 2FSWA 1YG2A 5E18F 1YFHA 1UHMA 4JK1X 5LGNA 2IPQX 2Y75A 2OZ6A 4R8HA 1OYWA 5DCMB 3WE3A 2L4MA 2K02A 5ILSA 5F64A 1OR7A 3V8LA 1W7PD 3RKXA 4HF2A 1BI3A 2V1DA 3E5QA 3RYPA 1IN5A 2CFXA 4EMSA 1J2XA 1YO5C 4L9NA 3RYRA 2HTSA 3I4PA 1PUEE 2FBHA 2LF7A 4BYYA 3TDZC 3RI4A 4PGGA 5TJJA 1R22A 3VODA 1OYYA 4A0ZA 2K86A 1WSUA 1CF7A 2PMHA 2XRNA 4M72A 3I54A 1MZBA 3G3ZA 4NB5A 4KMUX 3TGNA 2UWMA 3H3UA 1ZYRF 4AIHA 3LSTA 1KU9A 3GZ5A 5L3CA 4O5VA 2MBFA 4IXAA 3V4GA 4KT5C 2OQGA 4EQQA 4U0YA 4ENMA 2D2WA 1HXDA 2EA2A 5DCMA 3WG9A 2XAGA 1SD6A 1W5TA 4ENJA 5E8IA 5HOOA 3HSRA 4CICA 2R3SA 3CJNA 1G3WA 1BJAA 2NRAC 2DLLA 2CYYA 4MQ9F 4U88A 1FC3A 2O6GE 1YIOA 3TOBA 4MHGA 2XHKA 5LHHA 1XMAA 1XCBA 2ZMEA 1O7LA 1B1BA 1W7PB 3TOAA 4U0VA 3P9KA 3KZZA 3KLOA 3CUQC 4HLYA 5D4SA 3CUOA 2BEOA 2RQPA 3HUGA 2FMYA 4I7HA 2JPCA 4KIFA 3WTUC 3LAJA 4HF0A 1S6LA 1QZYA 1Z6RA 1ZLKA 5H6RA 1P6RA 1EH7A 2JRTA 1FSHA 2GA2A 2FOKA 3E3VA 4IF4A 3L9FA 1BI2A 1DUXC 3K69A 4MGRA 5D4RA 3COAC 4PDKA 5EEGA 3IKVA 2O61A 4BAYA 5LHIA 4MEYF 1GHCA 4M6XA 2GXGA 3O6BB 4L5IA 1WRJA 5LEJA 4XLPF 2KIMA 1FYKA 4UV9A 2Z5UA 1BC7C 1LDKB 2OD5A 2CO5A 3VB2A 2HTJA 2RC4A 3TO9A 1XD7A 3QPHA 3WGHA 2P5LC 1L0OC 1HQCA 4I09A 3IKTA 1J0RA 1QZZA 5HLGA 2W57A 1ZAOA 2L4AA 2K7LA 2FU4A 4I98B 3K1NA 1BI0A 3MZYA 4A5NA 1KYWA 1XB4A 1GXQA 3RPUA 3ROUA 1RZ4A 2HR3A 2ACJA 4EGZA 2MD5A 1FP1D 3BY6A 3IWFA 5DEQA 5L3BA 1BC8C 4AIJA 5HDNA 3FMSA 1BM9A 1JGSA 3BP8A 1R1UA 5CVRA 4YFKF 4GGGA 4RGRA 5K5OA 1B9MA 1EH8A 1ODDA 2IA2A 1B6AA 3Q5FA 3JTHA 3C18A 2RN7A 2YU3A 2NNYA 3WTWC 1GVJA 1LEBA 4RS8A 4WXCA 3CO6C 2IA0A 4LLNA 1SFUA 1S7AA 4UVAA 2DK5A 1SD7A 1IUYA 2PEXA 4RAZA 2L01A 3DV8A 5F1RA 1LDDA 3M7GA 2FEZA 1G3YA 1U2WA 1Z7UA 4UV8A 4GXOA 3V8KA 1TTYA 1QGPA 1G6NA 2YX7A 3ULQB 3QPTA 2A6EF 3K1PA 2EFNA 1ZHFA 4PGHA 4LD5A 2PLYA 2QBYA 2ADUA 3CTAA 3D0SA 3F8BA 3JAMK 1GXPA 5LRRA 1ZH5A 2O8XA 5FFZA 2H94A 4KICA 1ZGJA 4N9IA 4BXUA 4OIPF 3KP7A 2VC1A 4N9HA 5BMZA 2M5WA 4LJZF 3HHHA 3RJPA 3BJAA 4YFXF 1HW1A 5CVVA 1XGMA 2XROA 1R1VA 2GA1A 2IRFG 3FXRA 2PG4A 4ZZLA 4KFCA 3L7WA 3IRRA 3BWGA 1G3TA 1Q1HA 2EB7A 4G7HF 1MJ9A 3QAHA 3M8FA 3R4KA 2DPDA 2QYOA 3K0LA 5LLQA 4S04A 4LG0B 4BNCA 3CO7C 1IF1A 2LKPA 1ZRCA 3QU6A 3CDHA 4HA8A 2AXLA 4DQ2A 4P9FA 2DTRA 3HOSA 4KNYA 3E6DA 1DPRA 3DXJF 2P5KA 2YX4A 3NRVA 3VFZA 2HYFA 2DI3A 4M6YA 5LRSA 2DQLA 4A6DA 4RB1A 1RNLA 1J75A 1ZG1A 1HKTA 2G9WA 4UHTA 2XAJA 3E6MA 1UCRA 4CHUA 1SD5A 3S2WA 4KUMA 3ECHA 1HSJA 2KJCA 1ZGAA 3GFMA 3QRFF 1QO0D 1QNTA 4OMZA 3KCCA 2Y48A 1ZG3A 2WTEA 4IRHA 3JTGA 2F5EA 1KQ8A 5FO5A 1ONVA 1S3JA 1ZREA 3KP6A 3F3XA 4RB3C 4LG0A 2IJLA 4L9VA 3FF5A 5BPDA 3KETA 2VBWA 4KIBA 3HRSA 1HKSA 1JE8A 1UFMA 3KEQA 1Z91A 2V1XA 3GW2A 4HX7A 2PBIA 3J81Z 3R6SA 4ON0A 3HTUA 5IT9K 2COMA 1HKQA 3RKYA 4WF2A 3NEUA 3LFKA 5J8CA 1TQPA 1G3SA 5JI6A 2A6HF 3R0JA 4ESBA 4M74A 4AIKA 2OBPA 5HVQC 2GQQA 3F6VA 4HX8A 4FHTA 5FD5A 2PQ8A 3H92A 4Q5SF 1CF7B 2EFOA 4H0EA 4L0ZB 5LGTA 2LDUA 1FT9A 4HX4A 5JFRA 1B9NA 1RUNA 3TKYA 3W6KB 1LJ9A 3NQOA 1B4AA 3C3WA 4HDUA 2HKXA 4ZYGA 5IT3A 2VBZA 1BIBA 4EV0A
chains in the Genus database with same CATH superfamily
3QODA 4XBFA 2XAFA 2K27A 3BPVA 2FMLA 3RCOA 1U5TC 1X3UA 2JZYA 2BVLA 1XSVA 2F5DA 1G4DA 3EUHC 4Y52J 4C30A 5A2QZ 1TZLA 1V5EA 4CA0A 5KCMA 2R5ZB 1DP7P 4FX0A 3CCSI 2HYJA 2CRGA 5FD6A 3DPLC 3GZNB 1MDMB 1MSFC 5CYVA 3N97A 4NNJA 3PSFA 3J80K 2RNGA 3IC7A 2CMPA 1K6OA 1HW5A 3CDIA 1GUUA 2DA1A 2HVQA 4V2FA 3TQNA 2ID3A 1C0WA 5GP9A 2L7MP 4UVBA 5CVUA 3BR3A 3CUQB 1TLHB 1ETWA 3BT9A 3ZR8X 2O8KA 2ZMEB 2HNHA 3KLNA 4B4CA 2MA3A 4XOPA 3OYHA 4RB2C 4GDFA 3PNTA 2VOPA 3IH4A 1I3AA 3ESWB 2R7TA 2VC0A 2O9LA 5F6FA 5DS9A 2P6SA 3BTLA 2JJ7A 3KZYA 3E97A 2A5WA 2OQRA 2X6OA 2P6TA 4ENNA 3GUDA 1S72I 1PP8F 2HWVA 3EETA 2PJRA 4HV6A 3KEOA 2EH3A 5ED4A 3MWMA 4M9XA 4A93J 4BHCA 2WV0A 3H35A 3RPUD 2OTLI 1TBXA 3HZJA 2L9NA 2JN6A 2WAFA 4LK1F 4E7LA 1W36C 1FMWA 1SFEA 4B09A 2K4BA 3LWFA 1SMTA 3PNYA 4RLFA 1STZA 2CQQA 2OZUA 3BPXA 1U78A 5B1AH 4EVIA 4WX9A 5TISC 1OLTA 3ONQA 3T1BA 3V42A 4A12A 2XAQA 1AOYA 1ZTRA 2QA4I 2NAZA 3ASNH 2Y30A 5DD4A 3SXYA 4F91B 2M87A 1TQIA 1BR2A 2X6WA 1LVAA 2CQKA 2YSRA 3TO6A 3G1OA 1I50J 2UXNA 4AU7A 2M3AA 2L54A 4IPAA 2XF7A 4BEHB 4BACA 4LFUA 3HRUA 5HDKA 3JRGA 2PFBA 1W4MA 1IN8A 3T0YA 4RAYA 2A68F 1MDMA 5HS8A 4M73A 3DBRB 3BDDA 3I59A 3MN2A 4JQFA 3ABTA 3N05A 3QPSA 4YEJA 1OKRA 2H8WA 2V4JC 5GPAA 2X1DA 2NS7A 2XASA 3QWLA 4F3QA 5JHUA 1VTNC 2CUZA 2ELKA 2GLOA 4I76A 3T5XA 1CGPA 1F1ZA 1APLC 3CUQA 3IHUA 1N25A 2E36A 5FKOA 3GFIA 1FZPB 2JA8J 4I01A 3BCAA 1WH7A 2UZKA 2R5YB 1T08B 3K10A 4XLNF 4EGYA 1U9NA 3DFGA 5H6QA 5FLXK 4XRMA 1KU7A 3MQ0A 1AHDP 2F2EA 2VE8A 4D9JA 4LLLA 2E7WA 4G94A 1Z1DA 1CQTA 4LK0F 1PDNC 1WJDA 3U21A 4XR6A 4UY8I 2CW7A 2KRCA 3GTOJ 4L5JA 2CUEA 5E3OA 1K6YA 3M4OJ 1O57A 1NG6A 1RETA 1DDNA 3OS0A 2AO9A 2G7HA 2JVHA 3W6JB 1U8RA 3WHCA 4OINF 4D7MA 1XG1A 1FPQA 2HQAA 3HJEA 5LEKA 1VQ6I 3ZMUA 3OYLA 2BZTA 2GWRA 3V7SA 1VI0A 2H6BA 3BJ6A 5B66C 1HF0A 5HS9A 1U3EM 1USTA 3CMAI 1T33A 1J09A 3G73A 2A5YB 4B3XA 2D1HA 4AVPA 4EJUA 4JYKA 3ZPLA 1MIJA 3GLLA 3GWZA 4DBRA 1F4KA 1T95A 3DKXA 4N4NB 1F36A 3E7LA 4HNTA 3FISA 2DYSH 4BHBA 1R23A 3AG2H 3GVAA 5K7HA 4CGZA 3HEFA 2HQ5A 4A3JJ 2XGXA 2VUMJ 1FP2A 2HKOA 4BEHA 3I53A 2VQCA 4AYBA 3FIWA 3F23A 1JXSA 4C2TA 1ZG5A 2HZTA 1OCOH 2F4IA 5F1JA 1OYIA 1MH4A 1LB2A 5B1BH 3ELKA 3M07A 3I55I 1YX5A 2ZJ2A 3PQKA 3BG9A 4XSXF 5CJ9A 2EZHA 3Q0WA 4HG2A 2LG4A 1UHWA 4RLQA 4E4HA 3KP3A 3FWEA 2AS5F 4JX6A 2R5YA 3B6AA 5C4XJ 1FSEA 4ASNA 1XN7A 2VBXA 1YW8A 4FASD 1R4NB 4F93B 2XB0X 5F27A 4J19A 2NVTJ 1WZ2A 5FKLA 2Y0MA 2NNNA 3ML6A 3CCRI 3VSLA 2E5NA 3S32A 1S8NA 3ZP5A 3SZPA 3TMOA 4U0WA 4W1UA 4EJTA 2RGVA 3ZXSA 1MNMC 4IHXA 1AWCA 1DU6A 3HG9A 1Z3YA 4EJOA 3LAPA 2M0CA 3PQJA 5KHDA 1FIAA 2DA7A 5B5EC 2Y9ZA 1POGA 2KRFA 3F6OA 4ZDOA 1T8IA 1BOAA 1MJAA 1WHUA 2Z99A 3M1EA 1I1GA 1D5VA 2HVRA 4EM1A 1P4WA 2M30A 3KYLA 1IW7F 1UAAA 2E71A 4IHSA 3LFUA 2L0KA 1ORKA 1LFPA 5LFAA 1E3OC 2EV5A 2LYCA 3GX4X 1VQMI 4WXHA 5BS6A 3O8GA 3HTSB 4EJWA 2W24A 4Y13A 4G12A 3NAUA 2DDBA 4LIUA 3BTCA 2QBYB 2DT5A 6PAXA 3M8EA 3N4MA 1O3RA 2VT3A 4Q4ZF 3CMMA 5KNLA 1W0TA 4LLGF 4PJLA 2UV1A 2IS1A 2K5CA 2OAZA 5IY5H 5EDNA 1KU2A 2KZVA 2F4MB 3JRBA 1IN6A 1XX5A 2ZXHA 2ZXJA 4CO8A 4DBQA 3JRCA 2M45A 3BR0A 4C9YA 4E7SA 5IP9J 1H8AC 1X2MA 1QPMA 2XAHA 1AKHA 3GBGA 4L18B 1LUJB 4BBSJ 4R79A 1X1PA 3WTXC 3K4KA 2MW8A 3K4CA 1VQ5I 3E0JB 2B0LA 3T8RA 3WG7H 1MMAA 3DQVC 2IGNA 1Y39A 4XLCA 1JKPC 3PO2J 2EPFA 2ESHA 3HOWJ 2HDWA 3QP5A 1E17A 1S7EA 2H09A 1ETQA 3KX2A 1U6GA 1BW5A 3CMEI 3PIPF 3BR6A 3HIFA 2LP0A 1IRZA 2VLAA 4HLXA 2WAQA 3HSFA 2LVSA 1ENHA 2ISZA 3PFIA 1WPKA 1WI9A 3FMQA 3DPTA 2DAOA 4HF1A 2BXYA 4YIFA 2A69F 4TV7A 4S0HB 3EYIA 2VOOA 3HOXJ 3GEZA 3OYEA 3DTIA 3AFHA 2IGKA 3LA3A 2OU2A 4FQGA 2JA7J 2FQ3A 3HPHA 4IVNA 2X1CA 4BH9A 2K9SA 2COBA 3FMRA 4FE7A 4HQEA 2XUBA 4KYWA 2DXIA 2HQNA 1RIOH 3F22A 3KP2A 3T8TA 2PN6A 2VPLA 1IRFA 3QYBA 1GT0C 3S93A 4A3DJ 2QQ8A 3BZKA 1X2NA 1T2KA 3MKYB 5FRNA 1WJCA 3SZGA 5DUKA 1SVOA 5DDGA 1B8IB 2X6XA 1Y1WJ 1JHFA 5LBQA 2BY0A 3IWZA 1FBSA 1V4RA 1ZLJA 3F0CA 3SFZA 1F9NA 2Q8KA 3ZMDA 2JA6J 3FXMA 2VJ5A 3CC7I 2GIZA 2W82A 2X0LA 2WV1A 3SJMA 1VQLI 3C2HA 2VKDA 2LOOA 1VQOI 2EIMH 2M8EA 2R7FA 1JT6A 3PUFA 1MMNA 4L9TA 1EJ9A 1GLNA 4YELA 2EBIA 2RDPA 1Y6IA 2VL8A 3ZMTA 3OYNA 1UG2A 3H9JA 2MLKA 3CLQA 4DYRA 2HPMA 3IV5A 2XAUA 2ID6A 3QYEA 4XRSA 1FTZA 2ZJRF 5EGOA 2FNPA 1R36A 3HM5A 3I58A 3V7RA 2ZSHB 4RGSA 1L3LA 2HOTA 2LC2A 5E3NA 5CQGA 3D5RC 4CCJA 5L3FA 2CSOA 5B3SH 2CW8A 2JA5J 3MEXA 1R58A 4HV5A 3WTZA 5LHGA 1XCVA 4KITB 1QPIA 1G59A 1OJLA 3CCYA 4E7IA 2VXZA 1S7OA 3LSHA 1MBFA 2AQEA 3ZQQA 2LSOA 2AQFA 2ETHA 1R6RA 1TT0A 5J47A 3M1CA 5DYMA 3U2RA 2A07F 3KP4A 3B02A 3H3ZA 3HXLA 2STWA 4U7BA 1YJNI 2JT1A 3ZMZA 2JSCA 3REOA 5JVGF 5AONA 1AU7A 2HOEA 4LB5A 3GF2A 1JKRC 4IRGA 3OOPA 1JKQC 5BPIA 3HRTA 2VONA 3OSGA 3BROA 2JQ7A 1QRYA 3Q3SA 3U9GA 3AKZA 3P7NA 4ZC3A 1TNTA 4IZZA 3SQNA 3S15J 1IRGA 1O4XA 2QLZA 2ZSIB 2EV0A 4G6QA 2IVMA 4BHPA 1MGTA 2VBYA 1PJRA 4JX4A 4M71A 3FXUA 2ECBA 1D1BA 2G7UA 5KAIC 1KONA 1XSDA 5ILVA 2BGCA 1SFXA 2ESNA 2CU7A 4KN4X 4WXDA 3HOTA 1N77A 2RREA 3JSOA 2XF6A 3CJTB 4GYIA 3A02A 1V54H 3ZMSA 3KEYA 3TO7A 4BXFA 3BTIA 2FUG2 3JRDA 3L2WA 1X4OA 2LY2A 1H9TA 2LR8A 3I56I 3K2ZA 4IHYA 3HOUJ 1UB9A 1MSEC 3FKIJ 1ACIA 3FHNA 1FYLA 1FBQA 4ENKA 2DN0A 1B59A 3GTJJ 1O3SA 2X51A 4QSHA 2GBYA 3JRFA 3OL3A 3W2VA 1ETOA 4NC8A 1OCZH 1HSTA 5GAEJ 3BZ6A 2R7SA 1IJWC 3K9TA 3BG5A 5BQTA 1GDTA 2A61A 2DA3A 2FRHA 1I3QJ 1RESA 3V7CA 3DTEA 3QYFA 2K4JA 4CCKA 1KQ0A 2NYXA 4QTRA 3RSNA 2EK5A 5EG0B 1WQ2A 1G2HA 1Y1VJ 2WB1A 2DTZA 4HSTA 3HOYJ 1YTYA 4GYGA 2ZNZA 3WHBA 2VPRA 1VQ7I 2GOMA 2GAUA 2ZNYA 4FT8A 3ECOA 2Y69H 3IAS2 3OYFA 1TT5B 3OYJA 4BXXJ 3PSIA 5M5YJ 2IXSA 3P9CA 2J5OA 3ZCOA 4B44A 5GPCA 3GTGJ 1SAXA 4OIOF 3HRMA 5HS7A 2EZIA 2QKMB 3I71A 1MKMA 2WAQN 1M1EB 4ZZDA 5DV5A 4BS9A 1YJWI 4UUVA 4HSRA 2J5PA 4O6JA 5CVIA 4BY1J 2CGPA 4R1HA 2EZLA 3Q9SA 2E5ZA 2VN2A 5D8LB 2RV8A 3WTYC 1XDUA 4MFDA 1MMDA 4H4KC 1X3ZB 1Y8QB 3X2QH 1T98A 5ICEA 2PJRB 1IUFA 4F52A 1TWHJ 3EYYA 2ZC2A 2XKOA 4ZYHA 1VQNI 3WU0A 1ETXA 4UNOA 4OOIA 5H2FC 5ICGA 1RUOA 4F7ZA 2M9HA 3Q0VA 3K4NA 3JRAA 2DJIA 3NWTA 2JPBA 3ZQGA 3K70C 3WODF 3WTTC 2QKLB 2KDZA 2WWYA 4DOZA 3AG3H 3F9KA 5DTDA 1W5SA 2I5UA 5H20A 3ZGKA 4HYEA 4PZJA 5M3MJ 2BV6A 1DU0A 5ICCA 3EUHA 2V6CA 1QVUA 3TW6A 1OCCH 2F5CA 2V6EA 5J6XA 2DODA 2CW0F 2ZFUA 1LNWA 1R49A 1ETKA 2DW4A 5GTHC 4PJMA 3M8JA 4A0XA 3FXKA 1LEAA 3QP6A 4RA2A 2L9RA 5EG0A 4FX4A 3S1QJ 5K5RA 3EQLF 3LA7A 3FXJA 2FE3A 4G6TB 3FBIB 2FBIA 1FLIA 3ISPA 2VJIA 1QHGA 3QU3A 1IN7A 4K2EA 3JAMZ 3BTJA 2UXXA 2HDDA 3I59B 1U0JA 2PMZA 4QLCU 1OPCA 5F0HA 1QHHD 1YOVB 4RGUA 2FX0A 3ZQIA 4S05A 2P8TA 3RDIA 1ULYA 3G6EI 2KKOA 1ZRFA 2TCTA 2PI0A 4P96A 3IRQA 3CLOA 3TP3A 3F21A 2Y31A 4I2OA 3S3MA 4FETA 1Z6TA 2HZDA 3LA2A 3GFJA 4Y33A 2QQAA 1UMQA 3AG4H 4C2MJ 5JR3A 4ZJZA 3I0TA 1D8KA 4XONA 4IRIA 3LQQA 2HOAA 1E3PA 4PCQA 3SEQA 4IO9F 4JBAA 1XDSA 5K1YA 2HS5A 4E7JA 1PUFB 2RVCA 1E2XA 5D5VB 1OR7C 1HCRA 2L3DA 3S14J 2GZWA 2MH2A 1O7FA 2AXTC 3CQZJ 2R7DA 3KYDB 4XKWA 4DGWB 4F55A 5E1ZB 5L3GA 4X0GA 3QOPA 4OIQF 3I4MJ 1V55H 2KIQA 4B43A 3SZTA 4FE4A 5J4YA 1FOYA 1R9TJ 2P7VB 2CV1A 1YLFA 4QPOA 2QGUA 3OYDA 2CWEA 1D8JA 4A3CJ 2BHYA 3ERED 1J59A 4NHJA 2XF5A 2V9VA 3ABUA 1X19A 3B6CA 3DCFA 3BQZA 1SMYF 4D5CA 4DZPA 4L0YB 5E3LA 3WGGA 1LFBA 1BJZA 3SHFA 4ETSA 5GTIC 1NTCA 4XRFA 1Y0UA 4W97A 3PIOF 1LQ1A 4MFEA 4Y4RA 4E70A 2R7RA 2Y2ZA 2E35A 3GXOA 3HSEA 1D3YA 2P4WA 3RKWA 1YS6A 4E7KA 2PJPA 1H9GA 1I6XA 3DKWA 1HDPA 4IQ4A 5TRDA 2Q1ZB 3OSFA 1W0UA 1YYVA 4MLOA 4Y17A 4BGDA 3C1DA 4ANJA 1WI3A 3O3KA 4C2UA 2ELJA 1HBXG 3IUOA 1MBHA 1VFCA 3AL0C 5TGTA 3OV8A 1BW6A 4HW0A 2Z9OA 1MW7A 1ETVA 3D5SC 2QM3A 1R7JA 1A6QA 2YPRA 4OU0A 4AWXB 4KDPA 3O2PE 2WA0A 3I3LA 3SYTA 4HOBA 1OCPA 2ME0A 1BR4A 3ZMVA 3OYAA 3CCJI 2E34A 1OCRH 3F8CA 3L09A 4CSWA 2E60A 5J4VA 5FKMA 4N4OB 4NQWA 5FFXA 1XPXA 2EILH 4G7OF 3FHZA 4M3GA 3GTPJ 4BKXA 3OY9A 4X6AJ 4HAMA 2KIFA 1PUFA 2NVYJ 3DTKA 3ZOBA 4YIIA 4WCGA 1VQKI 5CVJA 2P81A 2OC6A 2F6CA 2DPUA 4RGXA 1WGXA 1P92A 4JP0A 3LSRA 2CQNA 2KDOA 3EPZA 3OYBA 2M8GX 3U1KA 3CF5F 1LVKA 2MC3A 2V79A 4ESFA 1RI7A 3WTVC 2Q0OA 3J7AY 3C7JA 1K4SA 2W25A 2C6YA 2ZMEC 3E5UA 2IT0A 4AD9A 4YG2F 1IGNA 3HC7A 3FZVA 3WTSC 1KQ9A 2VKEA 3OOUA 2IS2A 3BLYA 1XC5A 2OA4A 5LGUA 2VIXA 1YITI 1KYZA 5EZGA 1R1TA 5M5XJ 1TWCJ 2LF8A 1F43A 5ILUA 2FF4A 2FXAA 3KFWX 1NHAA 3H5RA 1F5TA 1BIAA 2LH9A 2RAEA 3E5XA 4XLEA 5JLXA 4P9UA 5IT9Z 1YW7A 3WU2C 2KT0A 4RM3A 3S1MJ 1UG0A 4C3HJ 1FWZA 3AAFA 3V8JA 4P55A 2XV4S 2ZJQF 4UVCA 3EUAA 4U87A 1WJBA 1ON1A 4XSZF 1YJ9I 1W5CC 2P5VA 1RR8C 4IL6C 4G7ZF 4YFNF 3QPLA 1JTYA 3RPQA 5E1XA 1XGOA 2F4OB 2FA5A 3K1MA 4GCVA 4RBOA 2HXOA 1AKHB 3KYCB 2QUFA 3CP2A 3H36A 2E1NA 2NXNB 5DM6F 4BQOA 3CJRB 2XIGA 4M3DA 1LFUP 3I4NJ 5E3MA 3A4CA 3EDPA 4NC7A 1HA8A 2DFIA 1EA3A 1X1BA 2H6CA 5EJCA 2BHZA 5J8FA 2L02A 3LL7A 4MTEA 3RZOJ 1TP4A 1MBGA 3WGIA 2RNJA 4BQAA 4KIGA 1ZR4A 2HPIA 4OIRF 2WC2A 1ETYA 3OWTA 5AIPA 3TDUC 1TW3A 2JUCA 2VT2A 2E2JJ 4PK4A 3IL2A 1LPQA 1T0FA 1RC9A 1IN4A 1IRXA 1ZQ3P 5L3DA 1X1AA 2JSPA 1Z0XA 1T6SA 2W85A 1YS7A 1XMKA 5FLVA 1IXSB 1W7PA 1XSXA 2XSJC 1ZRDA 2DFFA 3IAM2 1ZN2A 3BQYA 2ZKZA 1YHQI 1N78A 1YQAA 2EIKH 2ZJPF 1IC8A 1BL0A 2QEXI 4RMNA 3UKGA 4KN7X 4MEXF 3HHGA 3K2AA 5L3EA 4XLAA 4MTDA 1R00A 1O3QA 3CCMI 1IZ1A 3FXQA 5IP6A 3A03A 2STTA 1FX7A 2NVXJ 1HC8A 2Z1DA 4B48A 2V7FA 2CUJA 2X4HA 4CZZA 2FQ4A 2Z16A 1USSA 1R5HA 2RKHA 1T38A 3J80Z 2XKPA 3OS2A 2IS4A 5E20A 3D1NI 4HZFA 4KISA 1YIJI 2MLGA 2D45A 3R60A 4ESJA 4M9SA 2GXBA 3IH3A 2NS0A 1J7KA 4EJVA 2QQ9A 1FBUA 2W48A 2O03A 4PJNA 4UXNA 2O7OA 3LQRA 2XPVA 4WK8F 2V1NA 1Z3XA 1GV5A 3QQAA 4A5MA 3F8FA 3MVPA 4Q47A 2YR2A 4IHTA 2IP2A 3HYIA 3D5LA 3R61A 2HEOA 4XKCA 3J81K 4PSWA 1WH5A 3MZ8A 5E1WA 4A3FJ 4N0BA 4ZTJA 1B72A 2H8RA 1PVEA 5EGOB 2DT6A 4MQVA 4BE2A 3G2BA 2YU9J 4EM0B 4LITA 4XMYA 4HQMA 5E8GA 4B47A 5D8KB 3GCMA 4XRSG 2ISYA 3Q9VA 4OWRB 5C44J 5DUIA 2DK8A 3U1DA 2R4GA 2E1MC 4G8XA 2L9VA 4LMYA 3VOEA 3B73A 3MKWB 2WY7Q 5FROA 4II3A 5JVTA 1TWGJ 1WJEA 1J9IA 3RKQA 2LMDA 2Q2EB 1S29A 2QZ8A 2R7OA 4Y15A 4QPQA 1SVLA 1FOKA 1Y56A 2BY3A 1OFCX 2BE5F 1Z9CA 1Z05A 1R71A 2JTVA 1P2FA 5ICFA 2HYGD 5HLIA 1JHHA 2EWNA 3OYMA 2DO7A 2ZO4A 2DOEA 3FXLA 3VDXA 2IS6A 2R7VA 1K7AA 3DEUA 3BC8A 4XKVA 3KZIC 2IW5A 4BJTA 3O8HA 4CCLA 1DGRM 4Y7NJ 4CCOA 3CF2A 4ZH4F 2M4KA 3OIQA 2F5FA 2LY1A 3TL4X 4DNCA 3P5JA 2M0MA 1IXCA 2HDCA 3K4JA 1P4AA 4C3IJ 2MFZA 4IHVA 2DBBA 5ERIA 1ZKGA 4XICA 1MBKA 2D1VA 2GOXB 4ZYEA 2V9KA 1QQIA 3OYCA 3A01A 2Y9YA 3MKZA 3A0BC 2DMPA 4I0BA 3VEPA 1YE9A 4D7NA 3RIRA 5K5QA 1BN5A 3ERMA 3LNQA 5A2QK 3S17J 2JVGA 4ZYDA 2EFPA 1SD4A 4I02A 4L9JA 2NS8A 4B3AA 5FLXZ 5C4JJ 2EV6A 2LLKA 1FY7A 4A3GJ 2NOJB 4Z2YA 3KP5A 5BOXA 1OMIA 5J1UA 2M1BA 3I64A 5CLSA 5GAHJ 3JR9A 3LSGA 1IAWA 2KJBA 4Q48A 1WKMA 3DBHB 5FGMA 1ERDA 2EJRA 4HBLA 1JUPA 4KT6A 4HNUA 2Z33A 3S1NJ 3JREA 2M34A 3MCZA 1SANA 3ABMH 1I27A 2DQRA 3FK6A 2ECCA 3A2KA 1XS9A 5HDGA 1E3HA 1K79A 1S5LC 2D5VA 3L2QA 3K4MA 4LGWA 3BOQA 2ME6A 3H3VK 2DMTA 3ZQ7A 3FX3A 4CDGA 4AYBN 3GO5A 1T39A 5D5WB 4UUTA 2Q2EA 2H27A 2KMUA 3W2WA 5FB2A 2EFWA 3NWSA 4KMFA 2OF7A 2BBYA 3FM5A 3HOZJ 2EFQA 3DF8A 3VWBA 2OCEA 3I9V2 2V1UA 3OR1C 3DPUA 2GM4A 5F04A 3E6BA 5DCFA 1O3TA 4M6VA 4ZYAA 2IA1A 4AIDA 3MFKA 2W84A 4F92B 4IJAA 4CXFA 2MYSA 2NVQJ 3BR1A 3OR2C 1R4MB 3BCBA 2DU9A 1V3FA 3GTLJ 1YRNA 2E7XA 3DLLF 1QBJA 1ITYA 3VYSB 4II2A 1IV6A 4JX5A 2PMUA 2WADA 3TP0A 1MJBA 2O3FA 2P0WA 1W36D 3CC4I 3R0AA 5BNGA 5KK1A 4BJ5C 1SEUA 2QQBA 1FNNA 1FTTA 3JSPA 1JI8A 4B8XA 5HNFA 3W6VA 3H1CA 2CG4A 5EYRA 4WWCA 2K85A 4A0YA 1WWXA 5EEHA 4U7DA 3CCUI 2VE9A 3F72A 1I1SA 4HDVA 2LNBA 1IXRC 4CYCA 2TRTA 2K9MA 5D5XB 1XGNA 5HODA 2LY9A 2FBKA 1AA7A 1FEXA 1RKTA 4BJ6C 2NOGA 3CMYA 2R7UA 2QENA 4IOCF 1DPUA 3GYHX 3L00A 2BYVE 2Z3YA 3CDLA 1U5TB 2JA2A 1MMSA 1H0MA 2L5QA 1NG7A 3CCLI 1A36A 1REPC 2P7CB 2L7ZA 3W3CA 4M9ZA 4LG3A 2E2IJ 4A6EA 4GO1A 1K78B 1FYMA 3BJOA 3VYRB 4KA4A 1J5YA 3M3YJ 5J1YA 1JJ8C 3RQIA 4XN3A 4QWQA 1P4XA 1R5GA 5AIQA 4RB0A 1YW9A 2LBFB 3KE2A 3S8PA 5E17F 2ZFWA 1BI1A 3F8NA 1KGSA 2BVMA 3SDGA 4IX7A 1TW2A 2HU9A 1UZCA 3MMYB 3SEZA 1KA8A 4BL0B 4CCMA 4G6DA 1KU3A 2YS9A 4XK4A 5IP7J 3PFYA 3HOVJ 2QVOA 2XC7A 2LREA 1E0EA 4G9YA 5DD8A 1FMVA 3WE2A 1QA6A 5HLHA 3GFLA 5IPAA 4PFOA 5J3LA 2EINH 2VASA 5J40A 2DA5A 4D0PA 3A0HC 1PP7U 1XGSA 4I0AA 4L5EA 2E1CA 1TNSA 2A3SA 4XN0A 5IOYA 3G1MA 2HGCA 5D5UB 1YX3A 2TDXA 3E6CC 2EA4A 3DP7A 2ZBKA 2FNAA 3GLXA 1N75A 3CZ6A 2QWWA 3L2CA 4OMYA 3GZ6A 4A3EJ 3J7AO 2XVCA 5K7FA 1TQMA 4OAZA 2O0YA 3FM3A 2ELHA 4CYDA 1EV7A 2W1OA 3MZHA 2HFHA 1MD0A 4EM2A 3I5UA 4O3MA 3JW4A 3OIOA 2KIUA 1VQPI 1VQ4I 3M9AA 2FD5A 1OCTC 2WBMA 4UB6C 2VODA 2HQRA 1JTXA 1LDJA 2XPUA 2L9SA 4UUSB 1X1CA 2DFEA 4J01A 1LE8B 1ZARA 2A05A 3SDBA 4ZDLA 3MAJA 1U5TA 2B7EA 2MH9A 4LB6B 1K4TA 2CUFA 2DT7B 3ZN1A 4E7HA 3K4LA 3ZN0A 2DOAA 1OISA 2QSFX 4NC6A 1ON2A 3ABLH 2WY8Q 3RTRA 2GIVA 1V5FA 1K78A 2NVUB 3P9IA 3F8MA 2ZCWA 3WU1B 3H0DA 4DIQA 1HW2A 1I5ZA 5D6FA 4A2UA 4DYQA 4MNUA 3OIPA 4P5OA 3H5AA 3ZQHA 2XDVA 2LBFA 1UHSA 2M4GA 1EH6A 5KVRA 3AL0B 4XOTA 3HDDA 5F0CA 2MG4A 4AUXA 1A04A 1DQUA 4V19K 3S2DJ 1BBYA 5D6EA 2FSWA 1YG2A 5E18F 1YFHA 1UHMA 3G1LA 4JK1X 5LGNA 2IPQX 2Y75A 3MKLA 2OZ6A 4A3MJ 4R8HA 1OYWA 1ZK8A 3CCVI 1JUSA 5DCMB 3Q0UA 2W4SA 3WE3A 4MIMA 2L4MA 1A35A 2K02A 5ILSA 5F64A 2VKHA 1OR7A 4NQWB 3V8LA 4BUPA 3JCUC 4IKFA 1PYVA 1W7PD 3RKXA 4HF2A 1BI3A 4MO7A 3CC2I 2V1DA 4P1WA 3E5QA 4OAYA 3RYPA 1IN5A 4A3IJ 2CFXA 4EMSA 2V9PA 3LOCA 4ZDPA 2VI6A 1J2XA 2X1EA 1YO5C 2O5RA 3KPHA 4L9NA 3RYRA 1A31A 1GVDA 2HTSA 2XGDA 2IAIA 1YI2I 3I4PA 1PUEE 2FBHA 1OQYA 2N8GA 2LF7A 4BYYA 5FRMA 3TDZC 3RI4A 4UUSA 2KRHA 2UUZA 5LD2C 1LE8A 4PGGA 1ZR2A 2OTJI 2IGOA 4ITVA 1HLVA 3FKJA 4XM3A 1P9QC 5TJJA 1R22A 3VODA 1OYYA 3HUGB 4A0ZA 2K86A 1WSUA 1TWAJ 1CF7A 1RKWA 2XRNA 2PMHA 4M72A 3I54A 4IQJA 1MZBA 3G3ZA 3OYGA 4NB5A 4KMUX 3AG1H 3TGNA 2UWMA 3H3UA 1D1CA 1ZYRF 4AIHA 3G4SI 2HXIA 4BQNA 3LSTA 1KU9A 3GZ5A 5L3CA 4O5VA 2MBFA 4IXAA 3V4GA 4KT5C 3PNVA 2OQGA 4EQQA 4U0YA 2B63J 4ENMA 2D2WA 3G71I 4M3FA 1HXDA 2DMUA 4Z6YA 2EA2A 5DCMA 3WG9A 3NARA 2XAGA 1SD6A 1W5TA 2KHMA 4ENJA 5E8IA 5HOOA 3PUBA 1LKXA 2KP6A 3HSRA 1H89C 2M2EA 4E6KG 4CICA 2R5ZA 3TEDA 3DKYA 2R3SA 1IV8A 3CJNA 2KLOA 2BY1A 1G3WA 1BJAA 2NRAC 2DLLA 1MH3A 2CYYA 4MQ9F 4U88A 1K61A 2DCEA 1FC3A 2O6GE 3PO3J 1YIOA 3H5NA 3TOBA 2CS3A 1D5YA 1NH3A 5HNHA 3ZQCA 4MHGA 2XHKA 3MD2A 5LHHA 5FJ8J 1XMAA 4IEJA 1XCBA 2ZMEA 2WB1N 1Z7LA 1O7LA 5IOZA 1B1BA 4QIWN 1W7PB 4PJ0C 3TOAA 2CV0A 4U0VA 3P9KA 3GTMJ 1SFOJ 3KZZA 3VPRA 3KLOA 3CUQC 3LSIA 2GXAA 2K3FA 4HLYA 5D4SA 4AC0A 1VZ0A 2WAEA 5F0FA 3CUOA 5CPRB 2BEOA 2RQPA 1U9OA 3HUGA 2FMYA 4I7HA 2EQRA 2JPCA 3HGGA 4KIFA 3WTUC 3LAJA 1Y0NA 1MNDA 4HF0A 1S6LA 5M3FJ 1QZYA 1D1AA 1Z6RA 2FJ1A 4BU2A 1SFKA 1ZLKA 5H6RA 1P6RA 5GADJ 2VXDA 1EH7A 2JRTA 1FSHA 2IEKA 3GTQJ 3VYTB 2GA2A 1TC3C 2JMWA 2FOKA 3E3VA 4IF4A 4IOAF 2CFOA 2IBDA 3L9FA 3HBLA 4NBQA 3CCQI 2L2OA 1WJ5A 1BI2A 1DUXC 4D5FA 3K69A 2BXZA 4MGRA 4AVZA 5D4RA 2R7QA 2HVSA 4GRIA 3COAC 4JOMA 4PDKA 5CQEA 5EEGA 3IKVA 2O61A 1QU3A 5EF6A 4BAYA 5LHIA 1BA5A 2BW3B 1FOXA 1B72B 4MEYF 4IHWA 1GHCA 4M6XA 4YIRX 2GXGA 2R0QC 4FISA 4DJAA 3O6BB 2OJED 4A3LJ 4RDUA 3LSPA 5DM7F 3S3OA 2E1MB 1WJAA 2CQXA 1BR1A 3BG7A 4L5IA 1WRJA 5E79C 5LEJA 2VB6A 4XLPF 2DMQA 2KIMA 2X9DA 1FYKA 1VQ9I 5C3EJ 2JWTA 4UV9A 5FKKA 3HPGA 1JT0A 3OMYA 2RQQA 2Z5UA 3ASOH 1BC7C 2CH0A 4DW6A 1LDKB 1XMXA 2OD5A 1X1DA 2CO5A 3VB2A 3VSKA 2HTJA 3J7YJ 4J00A 2RC4A 2I8DA 1A6IA 2MSYA 5IYDJ 3TO9A 1XD7A 2OUMA 3QPHA 2E2HJ 4A3BJ 3WGHA 2PMZN 3OYIA 1L0OC 2P5LC 1HQCA 4I6ZA 1NK3P 2JUGA 4I09A 3IKTA 3EUKL 4A69C 1J0RA 1XTAA 1EF4A 3HL2A 1R5ID 1QZZA 4Y3OA 5HLGA 3DU5A 3DEEA 3L1PA 2Y0SA 2W57A 4HEA2 1T0FC 3KIOA 1ZAOA 2L4AA 1I6HJ 2K7LA 2FU4A 3W2AA 2IGMA 4BBRJ 4I98B 3K1NA 1FJLA 2LFBA 3L2RA 2DJNA 1BI0A 3CCEI 3MZYA 1HOMA 1TWFJ 3PL8A 4M3BA 3A01B 4A5NA 1KYWA 3BZCA 1IDYA 1XB4A 1GXQA 4A3KJ 3RPUA 1FIPA 3FK7A 3ROUA 2CJJA 1RZ4A 2HR3A 1WJFA 2ACJA 4EGZA 2MD5A 4CH7A 4HRIA 1FP1D 3BY6A 3CP8A 5HLTA 2BW3A 4BY7J 3IWFA 5DEQA 5L3BA 4FTHA 4AIJA 1BC8C 5HDNA 5EZHA 3FMSA 1MMGA 1BM9A 1JGSA 3BP8A 1R1UA 5CVRA 4XLFA 4YFKF 4GGGA 4PJJA 3ZQLA 4RGRA 5K5OA 1B9MA 2AHQA 4DYCA 1EH8A 1NK2P 1ODDA 3UR3C 2IA2A 3CESA 1B6AA 2OV7A 3Q5FA 2DDAA 3JTHA 5F08A 3C18A 2XGCA 1T56A 2RN7A 2YU3A 1X58A 3DEWA 2NNYA 4BE0A 5K7ZA 3WTWC 1U8BA 2VQGA 1X3WB 1GVJA 5GAGJ 1LEBA 1I39A 3J7ZI 4RS8A 4WXCA 3CO6C 2IA0A 4FCYA 1SFUA 4LOCA 4LLNA 1S7AA 4UVAA 2DK5A 1SD7A 1IUYA 2PEXA 4RAZA 2L01A 3DV8A 5F1RA 3H9GA 9ANTA 1LDDA 3M7GA 2FEZA 3HKZA 2KL4A 5M5WJ 1G3YA 1U2WA 1Z7UA 1ZELA 4UV8A 1SC7A 2R93J 1YRNB 4GXOA 3V8KA 1TTYA 2MC4A 2X48A 2H1KA 4XORA 1QGPA 3DBLB 2L7KA 2LD5A 4ABZA 2CV2A 1G6NA 2MGQA 2YX7A 3K70D 3ULQB 4RAFA 4M3EA 3S3NA 1JGGA 2ZXWH 3QPTA 2A6EF 3K1PA 1D0XA 2EFNA 4XNFA 1ZHFA 2KPMA 2H1LA 4DZJA 4PGHA 1SVMA 4LD5A 1K83J 4EEFG 3ZQFA 2PLYA 2QBYA 3HB9A 2ADUA 3CTAA 2EZKA 4PFPA 3OYKA 3D0SA 3F8BA 3JAMK 1GXPA 4CYCB 5LRRA 2XPWA 1ZH5A 2O8XA 1RR7A 4XL9A 5FFZA 1VQ8I 4EATA 2H94A 1IDZA 4KICA 1QVTA 1DGWY 4V2GA 1FOWA 1MBJA 1MNEA 4BDYA 1ZGJA 4N9IA 4UB8C 3HGYA 4BXUA 5J1RA 4OIPF 3KP7A 2VC1A 4N9HA 3LSMA 5BMZA 2R92J 2M5WA 4LJZF 3ZRGA 3RZDJ 4YRVA 4B1RA 3HHHA 3RJPA 2W7NA 3DLAA 4PSXA 2QSGX 3BJAA 4YFXF 1HW1A 2K3PA 5CVVA 1XGMA 2L7FP 4XLHA 1R1VA 2XROA 2QCOA 2GA1A 1V5GA 2IRFG 2Z2SB 3FXRA 2JRMA 3C2GA 2PG4A 1G8XA 4ZZLA 4KFCA 3L7WA 2PX9A 1JKOC 2BOLA 2DA2A 3IRRA 3BWGA 1G3TA 1Q1HA 2EB7A 3K7AJ 1IG7A 2HOSA 4G7HF 3FDYA 1MJ9A 2F5VA 3JRIA 4BE1A 4NDLA 3BR5A 3QAHA 3M8FA 3R4KA 2DPDA 2QYOA 3K0LA 5LLQA 4S04A 4LG0B 4BNCA 3CO7C 5FLMJ 1IF1A 2LKPA 1ZRCA 3QU6A 1RPWA 4AM3A 3CDHA 2A6TA 4HA8A 2AXLA 2LTPA 4DQ2A 4BQQA 2KZGA 4P9FA 2KFDA 2DTRA 3HOSA 2VQLA 4KNYA 3E6DA 1DPRA 3DXJF 4LIVA 2P5KA 2YX4A 4X1EA 1Y8RB 3NRVA 3VFZA 2M7BA 2HYFA 2EIJH 4CZCA 3S1RJ 2DYRH 2DI3A 1Q1VA 1GV2A 2BY2A 3DWLE 4M6YA 3CD6I 5LRSA 1B8IA 2I10A 2DQLA 4A6DA 4RB1A 1VF9A 2R7WA 2ZB9A 2B9SA 2LKXA 1RNLA 1J75A 2E1OA 1ZG1A 2HI3A 2QF7A 1HKTA 2G9WA 1TL8A 1VNDA 4KJZA 3IP4B 2FOWA 2XAJA 4UHTA 3PJRA 3E6MA 2E19A 4RAGA 4NUBA 3A1YA 3C2BA 1UCRA 4CHUA 2Y0SN 1SD5A 3BG6A 3S2WA 2OCCH 4KUMA 2ZXIA 4XKBA 3ECHA 1HSJA 2KJCA 2LK2A 1ZGAA 3GFMA 3QRFF 1QO0D 3FXOA 3TBIA 1UJ8A 1QNTA 2G0EA 2XGEA 3LSKA 4OMZA 3KCCA 2Y48A 4XIDA 1WCMJ 1ZG3A 1QZEA 2WTEA 4IRHA 2VJ4A 5EEAA 3JTGA 2DMNA 3E1SA 1RRJA 2K9NA 2R7XA 2F5EA 1KQ8A 1WVRA 3BG3A 5FO5A 1ONVA 2V26A 5CKTA 4HNVA 1S3JA 1ZREA 2VKVA 3ABKH 4GFBA 2F48A 1BOBA 4RM2A 2LRDA 3KP6A 1ZGWA 1KZHA 3F3XA 3LMMA 4LG0A 4RB3C 2IJLA 1HDDC 4L9VA 3JRHA 2X6YA 3FF5A 4CUGA 4XQFA 3KETA 5BPDA 2M7AA 2CQ7A 4PUSA 2KQRA 5IYBJ 4D1QA 1IO2A 2VBWA 4KIBA 2VQHA 3S2HJ 3HRSA 1HKSA 1JE8A 1UFMA 3CJQB 1W1WE 2MD0A 3RQ4A 2DOFA 3K6GA 3UNGC 1JJ6C 3KEQA 1Z91A 2V1XA 2YUSA 3GW2A 3OS1A 3QOEA 4HX7A 2PBIA 2LKSA 3L2UA 5FKNA 3J81Z 3R6SA 2K9LA 2XRLA 4ON0A 3HTUA 1Z21A 5IT9K 2VJJA 2COMA 3GMEA 1DP3A 5IYCJ 1HKQA 1P7IA 3RKYA 4WF2A 3NEUA 3LFKA 2MABA 5J8CA 1TQPA 5JLWA 1G3SA 1WFXA 2XB5A 2A6HF 2DA6A 5JI6A 3R0JA 4ESBA 2JK3A 2K40A 1Z77A 3SFIA 4I99C 5JHFA 4C3JJ 4M74A 2ICWG 4AIKA 2OBPA 1S9HA 3DU6A 5HVQC 2GQQA 2DA4A 3F6VA 3LSJA 2QSHX 4HX8A 3FBNB 3HKZN 1X4PA 3VYUB 1D0ZA 2XSDC 4FHTA 1EKEA 5FD5A 2PQ8A 3PM1A 2OPTA 5KAFC 1UELB 3H92A 4BDZA 4Q5SF 1CF7B 2R7ZJ 3TW7A 1Z67A 2EFOA 4H0EA 3H0GJ 4L0ZB 3S16J 3BR2A 5LGTA 2DFHA 1FT9A 2LDUA 4HX4A 3OL4A 5JFRA 1B9NA 1RUNA 3TKYA 4E7ZA 3L2VA 1P7JA 4CCNA 3W6KB 1LJ9A 1JUMA 1MBEA 1H88C 3NQOA 4HPQA 3K4BA 1B4AA 3GTKJ 3C3WA 3H9QA 1D0YA 1SAUA 4HDUA 1A5JA 2W00A 2HKXA 4ZYGA 5IT3A 2K9QA 2KISA 2VBZA 2X85A 4ZTFA 1BIBA 3IH2A 4EV0A
chains in the Genus database with same CATH topology
4XBFA 2XAFA 2K27A 3BPVA 2FMLA 1U5TC 1X3UA 2JZYA 2F5DA 1XSVA 1G4DA 5A2QZ 1DP7P 4FX0A 5FD6A 3DPLC 1MDMB 5CYVA 3N97A 3J80K 3IC7A 1K6OA 1HW5A 3TQNA 1C0WA 4UVBA 5CVUA 3CUQB 1TLHB 2ZMEB 3KLNA 2MA3A 4RB2C 2VOPA 2VC0A 5F6FA 2P6SA 3KZYA 3E97A 2OQRA 4ENNA 2P6TA 3GUDA 1PP8F 2HWVA 3EETA 4HV6A 3KEOA 5ED4A 3MWMA 4M9XA 4BHCA 2WV0A 1TBXA 4LK1F 1SFEA 4B09A 2K4BA 3LWFA 1SMTA 1STZA 2OZUA 3BPXA 1U78A 4EVIA 4WX9A 3T1BA 4A12A 2XAQA 1AOYA 2NAZA 5DD4A 3SXYA 2M87A 1TQIA 1LVAA 2CQKA 2YSRA 3TO6A 2UXNA 2L54A 4IPAA 4LFUA 3HRUA 5HDKA 2PFBA 1W4MA 1IN8A 3T0YA 4RAYA 2A68F 1MDMA 5HS8A 4M73A 3BDDA 3I59A 4JQFA 3ABTA 1OKRA 2XASA 5JHUA 1VTNC 3T5XA 1CGPA 1F1ZA 3CUQA 3IHUA 3GFIA 1FZPB 4I01A 2UZKA 4XLNF 4EGYA 3DFGA 5H6QA 5FLXK 1KU7A 3MQ0A 2F2EA 2VE8A 4LLLA 2E7WA 4G94A 1Z1DA 1PDNC 4LK0F 4L5JA 1O57A 1DDNA 2G7HA 3W6JB 1U8RA 4OINF 5LEKA 1FPQA 3ZMUA 2GWRA 3V7SA 2H6BA 3BJ6A 5HS9A 1U3EM 1USTA 3G73A 2A5YB 2D1HA 4AVPA 4EJUA 3ZPLA 3GWZA 1F4KA 4BHBA 1R23A 3GVAA 4CGZA 2XGXA 1FP2A 2HKOA 3I53A 3F23A 1JXSA 1ZG5A 2HZTA 1OYIA 1LB2A 3ELKA 2ZJ2A 3PQKA 4XSXF 5CJ9A 1UHWA 3KP3A 3FWEA 2AS5F 1FSEA 4ASNA 1XN7A 2VBXA 1YW8A 2Y0MA 2NNNA 3ML6A 1S8NA 3ZP5A 3SZPA 4EJTA 4U0WA 2RGVA 1AWCA 4EJOA 3LAPA 3PQJA 2KRFA 3F6OA 1BOAA 1MJAA 2Z99A 3M1EA 1I1GA 1D5VA 4EM1A 1P4WA 2M30A 1IW7F 4IHSA 2EV5A 3GX4X 4WXHA 5BS6A 3HTSB 4EJWA 2W24A 4Y13A 2QBYB 2DT5A 6PAXA 3M8EA 3N4MA 1O3RA 2VT3A 4Q4ZF 4LLGF 2OAZA 1KU2A 1IN6A 2ZXJA 4CO8A 2M45A 1QPMA 2XAHA 4L18B 4R79A 3WTXC 2B0LA 3T8RA 3DQVC 2ESHA 1E17A 3QP5A 2H09A 1U6GA 3HIFA 4HLXA 3HSFA 2ISZA 3PFIA 1WI9A 3FMQA 3DPTA 2DAOA 4HF1A 4YIFA 2A69F 4TV7A 3EYIA 2VOOA 3GEZA 3LA3A 2OU2A 2FQ3A 4IVNA 4BH9A 3FMRA 4HQEA 4KYWA 2XUBA 2HQNA 1RIOH 3F22A 3KP2A 3T8TA 2PN6A 1IRFA 1T2KA 5DUKA 5DDGA 1JHFA 5LBQA 3IWZA 1FBSA 1V4RA 1ZLJA 3SFZA 1F9NA 2Q8KA 3ZMDA 2X0LA 2M8EA 2R7FA 4L9TA 2RDPA 3ZMTA 2MLKA 2FNPA 1R36A 3I58A 3V7RA 4RGSA 1L3LA 5L3FA 2CSOA 3MEXA 1R58A 4HV5A 3WTZA 5LHGA 1XCVA 2VXZA 1S7OA 2LSOA 2ETHA 5DYMA 3U2RA 2A07F 3KP4A 3B02A 3H3ZA 2STWA 4U7BA 2JT1A 3ZMZA 2JSCA 3REOA 5AONA 2HOEA 4LB5A 3GF2A 4IRGA 3OOPA 5BPIA 3HRTA 2VONA 3BROA 3U9GA 3P7NA 1TNTA 3SQNA 1IRGA 2QLZA 2EV0A 4G6QA 2IVMA 4BHPA 1MGTA 2VBYA 4M71A 3FXUA 2G7UA 1XSDA 5ILVA 2BGCA 1SFXA 2ESNA 4KN4X 4WXDA 3HOTA 3JSOA 4GYIA 3ZMSA 3TO7A 1H9TA 3K2ZA 1UB9A 1FYLA 1FBQA 4ENKA 1B59A 1O3SA 1HSTA 3BZ6A 3K9TA 5BQTA 2A61A 2FRHA 3V7CA 2K4JA 1KQ0A 2NYXA 2EK5A 1WQ2A 1YTYA 4GYGA 2ZNZA 2GAUA 2ZNYA 4FT8A 3ECOA 3P9CA 2J5OA 1SAXA 4OIOF 3HRMA 5HS7A 3I71A 1MKMA 4ZZDA 5DV5A 4UUVA 2J5PA 4O6JA 5CVIA 2CGPA 4R1HA 3Q9SA 2VN2A 5D8LB 2RV8A 3WTYC 1XDUA 1T98A 5ICEA 3EYYA 4ZYHA 2XKOA 3WU0A 4UNOA 4OOIA 5ICGA 1RUOA 4F7ZA 2JPBA 3WODF 3WTTC 2WWYA 1W5SA 5H20A 4HYEA 4PZJA 2BV6A 5ICCA 3EUHA 2V6CA 2F5CA 5J6XA 2CW0F 1LNWA 2DW4A 4A0XA 1LEAA 3QP6A 4FX4A 5K5RA 3EQLF 3LA7A 2FE3A 2FBIA 1FLIA 3ISPA 3QU3A 1IN7A 4K2EA 3JAMZ 2UXXA 3I59B 4QLCU 1OPCA 4RGUA 4S05A 2P8TA 3RDIA 1ULYA 1ZRFA 2KKOA 2PI0A 4P96A 3IRQA 3CLOA 3F21A 4I2OA 1Z6TA 3LA2A 3GFJA 2QQAA 5JR3A 3I0TA 1D8KA 4IRIA 3LQQA 4PCQA 4JBAA 1XDSA 5K1YA 2HS5A 2RVCA 1E2XA 5D5VB 2L3DA 2GZWA 2MH2A 1O7FA 2R7DA 5L3GA 5E1ZB 3QOPA 4OIQF 3SZTA 2P7VB 1YLFA 2CWEA 1D8JA 3ERED 1J59A 4NHJA 2V9VA 3ABUA 1SMYF 4L0YB 3WGGA 3SHFA 4ETSA 4XRFA 1Y0UA 1LQ1A 4E70A 3GXOA 3HSEA 1D3YA 2P4WA 3RKWA 1YS6A 2PJPA 1H9GA 1I6XA 3DKWA 5TRDA 1YYVA 4Y17A 3C1DA 3O3KA 1HBXG 3OV8A 4HW0A 2Z9OA 2QM3A 1R7JA 2YPRA 4OU0A 4AWXB 4KDPA 3O2PE 4HOBA 3ZMVA 3F8CA 3L09A 4NQWA 5FFXA 4G7OF 3FHZA 4HAMA 2KIFA 4YIIA 4WCGA 5CVJA 2DPUA 4RGXA 1P92A 2MC3A 2V79A 4ESFA 1RI7A 3WTVC 2Q0OA 3C7JA 2W25A 2C6YA 3E5UA 2IT0A 4AD9A 4YG2F 3FZVA 3WTSC 1KQ9A 2OA4A 5LGUA 1KYZA 1R1TA 2LF8A 5ILUA 2FF4A 2FXAA 3KFWX 1NHAA 1F5TA 1BIAA 3E5XA 4P9UA 5IT9Z 1YW7A 1FWZA 3AAFA 3V8JA 4P55A 2XV4S 4UVCA 1ON1A 4XSZF 2P5VA 4G7ZF 4YFNF 3RPQA 5E1XA 1XGOA 2FA5A 3K1MA 4GCVA 2QUFA 2E1NA 2XIGA 3EDPA 2DFIA 2H6CA 5J8FA 2L02A 4MTEA 3WGIA 2RNJA 4BQAA 4KIGA 4OIRF 2WC2A 5AIPA 3TDUC 1TW3A 2VT2A 3IL2A 1T0FA 1IN4A 5L3DA 1T6SA 2W85A 1YS7A 1XMKA 1IXSB 1W7PA 1XSXA 1ZRDA 1ZN2A 2ZKZA 1YQAA 4KN7X 4MEXF 3HHGA 5L3EA 4MTDA 1R00A 1O3QA 1IZ1A 3FXQA 2STTA 1FX7A 2X4HA 4CZZA 1USSA 1R5HA 2RKHA 1T38A 3J80Z 2XKPA 5E20A 4HZFA 2MLGA 2D45A 3R60A 4ESJA 4M9SA 2GXBA 2NS0A 1J7KA 4EJVA 2QQ9A 1FBUA 2O03A 4UXNA 3LQRA 4WK8F 4A5MA 3F8FA 4Q47A 2YR2A 4IHTA 2IP2A 3HYIA 3D5LA 3R61A 2HEOA 3J81K 5E1WA 4N0BA 4MQVA 4EM0B 4HQMA 5E8GA 5D8KB 2ISYA 3Q9VA 5DUIA 2DK8A 3U1DA 4G8XA 4LMYA 3VOEA 3B73A 5JVTA 1J9IA 4Y15A 1S29A 2QZ8A 1FOKA 2BE5F 1Z9CA 1Z05A 2JTVA 1P2FA 5ICFA 2HYGD 5HLIA 1JHHA 2EWNA 2DO7A 2ZO4A 1K7AA 3DEUA 2IW5A 4ZH4F 2F5FA 4DNCA 1IXCA 2HDCA 1P4AA 2DBBA 5ERIA 2D1VA 4ZYEA 1QQIA 4I0BA 3VEPA 3RIRA 5K5QA 1BN5A 5A2QK 4ZYDA 2EFPA 1SD4A 4I02A 4L9JA 5FLXZ 2EV6A 1FY7A 4Z2YA 3KP5A 5BOXA 1OMIA 2M1BA 3I64A 5CLSA 1IAWA 2KJBA 4Q48A 1WKMA 5FGMA 2EJRA 4HBLA 2Z33A 3MCZA 1I27A 2DQRA 5HDGA 1K79A 4LGWA 3BOQA 3ZQ7A 3FX3A 4CDGA 3GO5A 1T39A 5D5WB 2Q2EA 2H27A 5FB2A 2EFWA 4KMFA 2BBYA 3FM5A 2EFQA 3DF8A 2V1UA 3E6BA 5DCFA 1O3TA 2IA1A 3MFKA 2W84A 4IJAA 4CXFA 2DU9A 1V3FA 2E7XA 1QBJA 2PMUA 1MJBA 2O3FA 3R0AA 5KK1A 2QQBA 1FNNA 3JSPA 4B8XA 2CG4A 4WWCA 4A0YA 1WWXA 5EEHA 4U7DA 2VE9A 3F72A 1I1SA 4HDVA 2LNBA 1IXRC 5D5XB 1XGNA 2FBKA 2QENA 1DPUA 3GYHX 3L00A 2BYVE 2Z3YA 1U5TB 1H0MA 1REPC 2P7CB 4M9ZA 4A6EA 4GO1A 1K78B 1FYMA 3BJOA 4KA4A 1J5YA 4QWQA 1P4XA 1R5GA 5AIQA 4RB0A 1YW9A 3KE2A 5E17F 2ZFWA 1BI1A 3F8NA 1KGSA 1TW2A 1KA8A 4G6DA 1KU3A 2QVOA 4G9YA 5DD8A 3WE2A 5HLHA 3GFLA 4D0PA 1PP7U 1XGSA 4I0AA 2E1CA 1TNSA 2A3SA 2HGCA 5D5UB 2TDXA 3E6CC 2EA4A 3DP7A 2ZBKA 2FNAA 3GLXA 2QWWA 3L2CA 4OMYA 3GZ6A 3J7AO 2XVCA 1TQMA 2O0YA 3FM3A 2ELHA 4CYDA 1EV7A 3MZHA 2HFHA 1MD0A 4EM2A 3I5UA 4O3MA 3JW4A 2KIUA 3M9AA 2VODA 2HQRA 1LDJA 1ZARA 3MAJA 1U5TA 4LB6B 2MH9A 3ZN1A 3ZN0A 1ON2A 3RTRA 2GIVA 1K78A 3P9IA 3F8MA 2ZCWA 3WU1B 1HW2A 1I5ZA 5D6FA 4A2UA 4MNUA 4P5OA 1EH6A 5KVRA 1A04A 1BBYA 5D6EA 2FSWA 1YG2A 5E18F 1YFHA 1UHMA 4JK1X 5LGNA 2IPQX 2Y75A 2OZ6A 4R8HA 1OYWA 5DCMB 3WE3A 2L4MA 2K02A 5ILSA 5F64A 1OR7A 3V8LA 1W7PD 3RKXA 4HF2A 1BI3A 2V1DA 3E5QA 3RYPA 1IN5A 2CFXA 4EMSA 1J2XA 1YO5C 4L9NA 3RYRA 2HTSA 3I4PA 1PUEE 2FBHA 2LF7A 4BYYA 3TDZC 3RI4A 4PGGA 5TJJA 1R22A 3VODA 1OYYA 4A0ZA 2K86A 1WSUA 1CF7A 2PMHA 2XRNA 4M72A 3I54A 1MZBA 3G3ZA 4NB5A 4KMUX 3TGNA 2UWMA 3H3UA 1ZYRF 4AIHA 3LSTA 1KU9A 3GZ5A 5L3CA 4O5VA 2MBFA 4IXAA 3V4GA 4KT5C 2OQGA 4EQQA 4U0YA 4ENMA 2D2WA 1HXDA 2EA2A 5DCMA 3WG9A 2XAGA 1SD6A 1W5TA 4ENJA 5E8IA 5HOOA 3HSRA 4CICA 2R3SA 3CJNA 1G3WA 1BJAA 2NRAC 2DLLA 2CYYA 4MQ9F 4U88A 1FC3A 2O6GE 1YIOA 3TOBA 4MHGA 2XHKA 5LHHA 1XMAA 1XCBA 2ZMEA 1O7LA 1B1BA 1W7PB 3TOAA 4U0VA 3P9KA 3KZZA 3KLOA 3CUQC 4HLYA 5D4SA 3CUOA 2BEOA 2RQPA 3HUGA 2FMYA 4I7HA 2JPCA 4KIFA 3WTUC 3LAJA 4HF0A 1S6LA 1QZYA 1Z6RA 1ZLKA 5H6RA 1P6RA 1EH7A 2JRTA 1FSHA 2GA2A 2FOKA 3E3VA 4IF4A 3L9FA 1BI2A 1DUXC 3K69A 4MGRA 5D4RA 3COAC 4PDKA 5EEGA 3IKVA 2O61A 4BAYA 5LHIA 4MEYF 1GHCA 4M6XA 2GXGA 3O6BB 4L5IA 1WRJA 5LEJA 4XLPF 2KIMA 1FYKA 4UV9A 2Z5UA 1BC7C 1LDKB 2OD5A 2CO5A 3VB2A 2HTJA 2RC4A 3TO9A 1XD7A 3QPHA 3WGHA 2P5LC 1L0OC 1HQCA 4I09A 3IKTA 1J0RA 1QZZA 5HLGA 2W57A 1ZAOA 2L4AA 2K7LA 2FU4A 4I98B 3K1NA 1BI0A 3MZYA 4A5NA 1KYWA 1XB4A 1GXQA 3RPUA 3ROUA 1RZ4A 2HR3A 2ACJA 4EGZA 2MD5A 1FP1D 3BY6A 3IWFA 5DEQA 5L3BA 1BC8C 4AIJA 5HDNA 3FMSA 1BM9A 1JGSA 3BP8A 1R1UA 5CVRA 4YFKF 4GGGA 4RGRA 5K5OA 1B9MA 1EH8A 1ODDA 2IA2A 1B6AA 3Q5FA 3JTHA 3C18A 2RN7A 2YU3A 2NNYA 3WTWC 1GVJA 1LEBA 4RS8A 4WXCA 3CO6C 2IA0A 4LLNA 1SFUA 1S7AA 4UVAA 2DK5A 1SD7A 1IUYA 2PEXA 4RAZA 2L01A 3DV8A 5F1RA 1LDDA 3M7GA 2FEZA 1G3YA 1U2WA 1Z7UA 4UV8A 4GXOA 3V8KA 1TTYA 1QGPA 1G6NA 2YX7A 3ULQB 3QPTA 2A6EF 3K1PA 2EFNA 1ZHFA 4PGHA 4LD5A 2PLYA 2QBYA 2ADUA 3CTAA 3D0SA 3F8BA 3JAMK 1GXPA 5LRRA 1ZH5A 2O8XA 5FFZA 2H94A 4KICA 1ZGJA 4N9IA 4BXUA 4OIPF 3KP7A 2VC1A 4N9HA 5BMZA 2M5WA 4LJZF 3HHHA 3RJPA 3BJAA 4YFXF 1HW1A 5CVVA 1XGMA 2XROA 1R1VA 2GA1A 2IRFG 3FXRA 2PG4A 4ZZLA 4KFCA 3L7WA 3IRRA 3BWGA 1G3TA 1Q1HA 2EB7A 4G7HF 1MJ9A 3QAHA 3M8FA 3R4KA 2DPDA 2QYOA 3K0LA 5LLQA 4S04A 4LG0B 4BNCA 3CO7C 1IF1A 2LKPA 1ZRCA 3QU6A 3CDHA 4HA8A 2AXLA 4DQ2A 4P9FA 2DTRA 3HOSA 4KNYA 3E6DA 1DPRA 3DXJF 2P5KA 2YX4A 3NRVA 3VFZA 2HYFA 2DI3A 4M6YA 5LRSA 2DQLA 4A6DA 4RB1A 1RNLA 1J75A 1ZG1A 1HKTA 2G9WA 4UHTA 2XAJA 3E6MA 1UCRA 4CHUA 1SD5A 3S2WA 4KUMA 3ECHA 1HSJA 2KJCA 1ZGAA 3GFMA 3QRFF 1QO0D 1QNTA 4OMZA 3KCCA 2Y48A 1ZG3A 2WTEA 4IRHA 3JTGA 2F5EA 1KQ8A 5FO5A 1ONVA 1S3JA 1ZREA 3KP6A 3F3XA 4RB3C 4LG0A 2IJLA 4L9VA 3FF5A 5BPDA 3KETA 2VBWA 4KIBA 3HRSA 1HKSA 1JE8A 1UFMA 3KEQA 1Z91A 2V1XA 3GW2A 4HX7A 2PBIA 3J81Z 3R6SA 4ON0A 3HTUA 5IT9K 2COMA 1HKQA 3RKYA 4WF2A 3NEUA 3LFKA 5J8CA 1TQPA 1G3SA 5JI6A 2A6HF 3R0JA 4ESBA 4M74A 4AIKA 2OBPA 5HVQC 2GQQA 3F6VA 4HX8A 4FHTA 5FD5A 2PQ8A 3H92A 4Q5SF 1CF7B 2EFOA 4H0EA 4L0ZB 5LGTA 2LDUA 1FT9A 4HX4A 5JFRA 1B9NA 1RUNA 3TKYA 3W6KB 1LJ9A 3NQOA 1B4AA 3C3WA 4HDUA 2HKXA 4ZYGA 5IT3A 2VBZA 1BIBA 4EV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBF A;  2XAF A;  2K27 A;  3BPV A;  2FML A;  1U5T C;  1X3U A;  2JZY A;  2F5D A;  1XSV A;  1G4D A;  5A2Q Z;  1DP7 P;  4FX0 A;  5FD6 A;  3DPL C;  1MDM B;  5CYV A;  3N97 A;  3J80 K;  3IC7 A;  1K6O A;  1HW5 A;  3TQN A;  1C0W A;  4UVB A;  5CVU A;  3CUQ B;  1TLH B;  2ZME B;  3KLN A;  2MA3 A;  4RB2 C;  2VOP A;  2VC0 A;  5F6F A;  2P6S A;  3KZY A;  3E97 A;  2OQR A;  4ENN A;  2P6T A;  3GUD A;  1PP8 F;  2HWV A;  3EET A;  4HV6 A;  3KEO A;  5ED4 A;  3MWM A;  4M9X A;  4BHC A;  2WV0 A;  1TBX A;  4LK1 F;  1SFE A;  4B09 A;  2K4B A;  3LWF A;  1SMT A;  1STZ A;  2OZU A;  3BPX A;  1U78 A;  4EVI A;  4WX9 A;  3T1B A;  4A12 A;  2XAQ A;  1AOY A;  2NAZ A;  5DD4 A;  3SXY A;  2M87 A;  1TQI A;  1LVA A;  2CQK A;  2YSR A;  3TO6 A;  2UXN A;  2L54 A;  4IPA A;  4LFU A;  3HRU A;  5HDK A;  2PFB A;  1W4M A;  1IN8 A;  3T0Y A;  4RAY A;  2A68 F;  1MDM A;  5HS8 A;  4M73 A;  3BDD A;  3I59 A;  4JQF A;  3ABT A;  1OKR A;  2XAS A;  5JHU A;  1VTN C;  3T5X A;  1CGP A;  1F1Z A;  3CUQ A;  3IHU A;  3GFI A;  1FZP B;  4I01 A;  2UZK A;  4XLN F;  4EGY A;  3DFG A;  5H6Q A;  5FLX K;  1KU7 A;  3MQ0 A;  2F2E A;  2VE8 A;  4LLL A;  2E7W A;  4G94 A;  1Z1D A;  1PDN C;  4LK0 F;  4L5J A;  1O57 A;  1DDN A;  2G7H A;  3W6J B;  1U8R A;  4OIN F;  5LEK A;  1FPQ A;  3ZMU A;  2GWR A;  3V7S A;  2H6B A;  3BJ6 A;  5HS9 A;  1U3E M;  1UST A;  3G73 A;  2A5Y B;  2D1H A;  4AVP A;  4EJU A;  3ZPL A;  3GWZ A;  1F4K A;  4BHB A;  1R23 A;  3GVA A;  4CGZ A;  2XGX A;  1FP2 A;  2HKO A;  3I53 A;  3F23 A;  1JXS A;  1ZG5 A;  2HZT A;  1OYI A;  1LB2 A;  3ELK A;  2ZJ2 A;  3PQK A;  4XSX F;  5CJ9 A;  1UHW A;  3KP3 A;  3FWE A;  2AS5 F;  1FSE A;  4ASN A;  1XN7 A;  2VBX A;  1YW8 A;  2Y0M A;  2NNN A;  3ML6 A;  1S8N A;  3ZP5 A;  3SZP A;  4EJT A;  4U0W A;  2RGV A;  1AWC A;  4EJO A;  3LAP A;  3PQJ A;  2KRF A;  3F6O A;  1BOA A;  1MJA A;  2Z99 A;  3M1E A;  1I1G A;  1D5V A;  4EM1 A;  1P4W A;  2M30 A;  1IW7 F;  4IHS A;  2EV5 A;  3GX4 X;  4WXH A;  5BS6 A;  3HTS B;  4EJW A;  2W24 A;  4Y13 A;  2QBY B;  2DT5 A;  6PAX A;  3M8E A;  3N4M A;  1O3R A;  2VT3 A;  4Q4Z F;  4LLG F;  2OAZ A;  1KU2 A;  1IN6 A;  2ZXJ A;  4CO8 A;  2M45 A;  1QPM A;  2XAH A;  4L18 B;  4R79 A;  3WTX C;  2B0L A;  3T8R A;  3DQV C;  2ESH A;  1E17 A;  3QP5 A;  2H09 A;  1U6G A;  3HIF A;  4HLX A;  3HSF A;  2ISZ A;  3PFI A;  1WI9 A;  3FMQ A;  3DPT A;  2DAO A;  4HF1 A;  4YIF A;  2A69 F;  4TV7 A;  3EYI A;  2VOO A;  3GEZ A;  3LA3 A;  2OU2 A;  2FQ3 A;  4IVN A;  4BH9 A;  3FMR A;  4HQE A;  4KYW A;  2XUB A;  2HQN A;  1RIO H;  3F22 A;  3KP2 A;  3T8T A;  2PN6 A;  1IRF A;  1T2K A;  5DUK A;  5DDG A;  1JHF A;  5LBQ A;  3IWZ A;  1FBS A;  1V4R A;  1ZLJ A;  3SFZ A;  1F9N A;  2Q8K A;  3ZMD A;  2X0L A;  2M8E A;  2R7F A;  4L9T A;  2RDP A;  3ZMT A;  2MLK A;  2FNP A;  1R36 A;  3I58 A;  3V7R A;  4RGS A;  1L3L A;  5L3F A;  2CSO A;  3MEX A;  1R58 A;  4HV5 A;  3WTZ A;  5LHG A;  1XCV A;  2VXZ A;  1S7O A;  2LSO A;  2ETH A;  5DYM A;  3U2R A;  2A07 F;  3KP4 A;  3B02 A;  3H3Z A;  2STW A;  4U7B A;  2JT1 A;  3ZMZ A;  2JSC A;  3REO A;  5AON A;  2HOE A;  4LB5 A;  3GF2 A;  4IRG A;  3OOP A;  5BPI A;  3HRT A;  2VON A;  3BRO A;  3U9G A;  3P7N A;  1TNT A;  3SQN A;  1IRG A;  2QLZ A;  2EV0 A;  4G6Q A;  2IVM A;  4BHP A;  1MGT A;  2VBY A;  4M71 A;  3FXU A;  2G7U A;  1XSD A;  5ILV A;  2BGC A;  1SFX A;  2ESN A;  4KN4 X;  4WXD A;  3HOT A;  3JSO A;  4GYI A;  3ZMS A;  3TO7 A;  1H9T A;  3K2Z A;  1UB9 A;  1FYL A;  1FBQ A;  4ENK A;  1B59 A;  1O3S A;  1HST A;  3BZ6 A;  3K9T A;  5BQT A;  2A61 A;  2FRH A;  3V7C A;  2K4J A;  1KQ0 A;  2NYX A;  2EK5 A;  1WQ2 A;  1YTY A;  4GYG A;  2ZNZ A;  2GAU A;  2ZNY A;  4FT8 A;  3ECO A;  3P9C A;  2J5O A;  1SAX A;  4OIO F;  3HRM A;  5HS7 A;  3I71 A;  1MKM A;  4ZZD A;  5DV5 A;  4UUV A;  2J5P A;  4O6J A;  5CVI A;  2CGP A;  4R1H A;  3Q9S A;  2VN2 A;  5D8L B;  2RV8 A;  3WTY C;  1XDU A;  1T98 A;  5ICE A;  3EYY A;  4ZYH A;  2XKO A;  3WU0 A;  4UNO A;  4OOI A;  5ICG A;  1RUO A;  4F7Z A;  2JPB A;  3WOD F;  3WTT C;  2WWY A;  1W5S A;  5H20 A;  4HYE A;  4PZJ A;  2BV6 A;  5ICC A;  3EUH A;  2V6C A;  2F5C A;  5J6X A;  2CW0 F;  1LNW A;  2DW4 A;  4A0X A;  1LEA A;  3QP6 A;  4FX4 A;  5K5R A;  3EQL F;  3LA7 A;  2FE3 A;  2FBI A;  1FLI A;  3ISP A;  3QU3 A;  1IN7 A;  4K2E A;  3JAM Z;  2UXX A;  3I59 B;  4QLC U;  1OPC A;  4RGU A;  4S05 A;  2P8T A;  3RDI A;  1ULY A;  1ZRF A;  2KKO A;  2PI0 A;  4P96 A;  3IRQ A;  3CLO A;  3F21 A;  4I2O A;  1Z6T A;  3LA2 A;  3GFJ A;  2QQA A;  5JR3 A;  3I0T A;  1D8K A;  4IRI A;  3LQQ A;  4PCQ A;  4JBA A;  1XDS A;  5K1Y A;  2HS5 A;  2RVC A;  1E2X A;  5D5V B;  2L3D A;  2GZW A;  2MH2 A;  1O7F A;  2R7D A;  5L3G A;  5E1Z B;  3QOP A;  4OIQ F;  3SZT A;  2P7V B;  1YLF A;  2CWE A;  1D8J A;  3ERE D;  1J59 A;  4NHJ A;  2V9V A;  3ABU A;  1SMY F;  4L0Y B;  3WGG A;  3SHF A;  4ETS A;  4XRF A;  1Y0U A;  1LQ1 A;  4E70 A;  3GXO A;  3HSE A;  1D3Y A;  2P4W A;  3RKW A;  1YS6 A;  2PJP A;  1H9G A;  1I6X A;  3DKW A;  5TRD A;  1YYV A;  4Y17 A;  3C1D A;  3O3K A;  1HBX G;  3OV8 A;  4HW0 A;  2Z9O A;  2QM3 A;  1R7J A;  2YPR A;  4OU0 A;  4AWX B;  4KDP A;  3O2P E;  4HOB A;  3ZMV A;  3F8C A;  3L09 A;  4NQW A;  5FFX A;  4G7O F;  3FHZ A;  4HAM A;  2KIF A;  4YII A;  4WCG A;  5CVJ A;  2DPU A;  4RGX A;  1P92 A;  2MC3 A;  2V79 A;  4ESF A;  1RI7 A;  3WTV C;  2Q0O A;  3C7J A;  2W25 A;  2C6Y A;  3E5U A;  2IT0 A;  4AD9 A;  4YG2 F;  3FZV A;  3WTS C;  1KQ9 A;  2OA4 A;  5LGU A;  1KYZ A;  1R1T A;  2LF8 A;  5ILU A;  2FF4 A;  2FXA A;  3KFW X;  1NHA A;  1F5T A;  1BIA A;  3E5X A;  4P9U A;  5IT9 Z;  1YW7 A;  1FWZ A;  3AAF A;  3V8J A;  4P55 A;  2XV4 S;  4UVC A;  1ON1 A;  4XSZ F;  2P5V A;  4G7Z F;  4YFN F;  3RPQ A;  5E1X A;  1XGO A;  2FA5 A;  3K1M A;  4GCV A;  2QUF A;  2E1N A;  2XIG A;  3EDP A;  2DFI A;  2H6C A;  5J8F A;  2L02 A;  4MTE A;  3WGI A;  2RNJ A;  4BQA A;  4KIG A;  4OIR F;  2WC2 A;  5AIP A;  3TDU C;  1TW3 A;  2VT2 A;  3IL2 A;  1T0F A;  1IN4 A;  5L3D A;  1T6S A;  2W85 A;  1YS7 A;  1XMK A;  1IXS B;  1W7P A;  1XSX A;  1ZRD A;  1ZN2 A;  2ZKZ A;  1YQA A;  4KN7 X;  4MEX F;  3HHG A;  5L3E A;  4MTD A;  1R00 A;  1O3Q A;  1IZ1 A;  3FXQ A;  2STT A;  1FX7 A;  2X4H A;  4CZZ A;  1USS A;  1R5H A;  2RKH A;  1T38 A;  3J80 Z;  2XKP A;  5E20 A;  4HZF A;  2MLG A;  2D45 A;  3R60 A;  4ESJ A;  4M9S A;  2GXB A;  2NS0 A;  1J7K A;  4EJV A;  2QQ9 A;  1FBU A;  2O03 A;  4UXN A;  3LQR A;  4WK8 F;  4A5M A;  3F8F A;  4Q47 A;  2YR2 A;  4IHT A;  2IP2 A;  3HYI A;  3D5L A;  3R61 A;  2HEO A;  3J81 K;  5E1W A;  4N0B A;  4MQV A;  4EM0 B;  4HQM A;  5E8G A;  5D8K B;  2ISY A;  3Q9V A;  5DUI A;  2DK8 A;  3U1D A;  4G8X A;  4LMY A;  3VOE A;  3B73 A;  5JVT A;  1J9I A;  4Y15 A;  1S29 A;  2QZ8 A;  1FOK A;  2BE5 F;  1Z9C A;  1Z05 A;  2JTV A;  1P2F A;  5ICF A;  2HYG D;  5HLI A;  1JHH A;  2EWN A;  2DO7 A;  2ZO4 A;  1K7A A;  3DEU A;  2IW5 A;  4ZH4 F;  2F5F A;  4DNC A;  1IXC A;  2HDC A;  1P4A A;  2DBB A;  5ERI A;  2D1V A;  4ZYE A;  1QQI A;  4I0B A;  3VEP A;  3RIR A;  5K5Q A;  1BN5 A;  5A2Q K;  4ZYD A;  2EFP A;  1SD4 A;  4I02 A;  4L9J A;  5FLX Z;  2EV6 A;  1FY7 A;  4Z2Y A;  3KP5 A;  5BOX A;  1OMI A;  2M1B A;  3I64 A;  5CLS A;  1IAW A;  2KJB A;  4Q48 A;  1WKM A;  5FGM A;  2EJR A;  4HBL A;  2Z33 A;  3MCZ A;  1I27 A;  2DQR A;  5HDG A;  1K79 A;  4LGW A;  3BOQ A;  3ZQ7 A;  3FX3 A;  4CDG A;  3GO5 A;  1T39 A;  5D5W B;  2Q2E A;  2H27 A;  5FB2 A;  2EFW A;  4KMF A;  2BBY A;  3FM5 A;  2EFQ A;  3DF8 A;  2V1U A;  3E6B A;  5DCF A;  1O3T A;  2IA1 A;  3MFK A;  2W84 A;  4IJA A;  4CXF A;  2DU9 A;  1V3F A;  2E7X A;  1QBJ A;  2PMU A;  1MJB A;  2O3F A;  3R0A A;  5KK1 A;  2QQB A;  1FNN A;  3JSP A;  4B8X A;  2CG4 A;  4WWC A;  4A0Y A;  1WWX A;  5EEH A;  4U7D A;  2VE9 A;  3F72 A;  1I1S A;  4HDV A;  2LNB A;  1IXR C;  5D5X B;  1XGN A;  2FBK A;  2QEN A;  1DPU A;  3GYH X;  3L00 A;  2BYV E;  2Z3Y A;  1U5T B;  1H0M A;  1REP C;  2P7C B;  4M9Z A;  4A6E A;  4GO1 A;  1K78 B;  1FYM A;  3BJO A;  4KA4 A;  1J5Y A;  4QWQ A;  1P4X A;  1R5G A;  5AIQ A;  4RB0 A;  1YW9 A;  3KE2 A;  5E17 F;  2ZFW A;  1BI1 A;  3F8N A;  1KGS A;  1TW2 A;  1KA8 A;  4G6D A;  1KU3 A;  2QVO A;  4G9Y A;  5DD8 A;  3WE2 A;  5HLH A;  3GFL A;  4D0P A;  1PP7 U;  1XGS A;  4I0A A;  2E1C A;  1TNS A;  2A3S A;  2HGC A;  5D5U B;  2TDX A;  3E6C C;  2EA4 A;  3DP7 A;  2ZBK A;  2FNA A;  3GLX A;  2QWW A;  3L2C A;  4OMY A;  3GZ6 A;  3J7A O;  2XVC A;  1TQM A;  2O0Y A;  3FM3 A;  2ELH A;  4CYD A;  1EV7 A;  3MZH A;  2HFH A;  1MD0 A;  4EM2 A;  3I5U A;  4O3M A;  3JW4 A;  2KIU A;  3M9A A;  2VOD A;  2HQR A;  1LDJ A;  1ZAR A;  3MAJ A;  1U5T A;  4LB6 B;  2MH9 A;  3ZN1 A;  3ZN0 A;  1ON2 A;  3RTR A;  2GIV A;  1K78 A;  3P9I A;  3F8M A;  2ZCW A;  3WU1 B;  1HW2 A;  1I5Z A;  5D6F A;  4A2U A;  4MNU A;  4P5O A;  1EH6 A;  5KVR A;  1A04 A;  1BBY A;  5D6E A;  2FSW A;  1YG2 A;  5E18 F;  1YFH A;  1UHM A;  4JK1 X;  5LGN A;  2IPQ X;  2Y75 A;  2OZ6 A;  4R8H A;  1OYW A;  5DCM B;  3WE3 A;  2L4M A;  2K02 A;  5ILS A;  5F64 A;  1OR7 A;  3V8L A;  1W7P D;  3RKX A;  4HF2 A;  1BI3 A;  2V1D A;  3E5Q A;  3RYP A;  1IN5 A;  2CFX A;  4EMS A;  1J2X A;  1YO5 C;  4L9N A;  3RYR A;  2HTS A;  3I4P A;  1PUE E;  2FBH A;  2LF7 A;  4BYY A;  3TDZ C;  3RI4 A;  4PGG A;  5TJJ A;  1R22 A;  3VOD A;  1OYY A;  4A0Z A;  2K86 A;  1WSU A;  1CF7 A;  2PMH A;  2XRN A;  4M72 A;  3I54 A;  1MZB A;  3G3Z A;  4NB5 A;  4KMU X;  3TGN A;  2UWM A;  3H3U A;  1ZYR F;  4AIH A;  3LST A;  1KU9 A;  3GZ5 A;  5L3C A;  4O5V A;  2MBF A;  4IXA A;  3V4G A;  4KT5 C;  2OQG A;  4EQQ A;  4U0Y A;  4ENM A;  2D2W A;  1HXD A;  2EA2 A;  5DCM A;  3WG9 A;  2XAG A;  1SD6 A;  1W5T A;  4ENJ A;  5E8I A;  5HOO A;  3HSR A;  4CIC A;  2R3S A;  3CJN A;  1G3W A;  1BJA A;  2NRA C;  2DLL A;  2CYY A;  4MQ9 F;  4U88 A;  1FC3 A;  2O6G E;  1YIO A;  3TOB A;  4MHG A;  2XHK A;  5LHH A;  1XMA A;  1XCB A;  2ZME A;  1O7L A;  1B1B A;  1W7P B;  3TOA A;  4U0V A;  3P9K A;  3KZZ A;  3KLO A;  3CUQ C;  4HLY A;  5D4S A;  3CUO A;  2BEO A;  2RQP A;  3HUG A;  2FMY A;  4I7H A;  2JPC A;  4KIF A;  3WTU C;  3LAJ A;  4HF0 A;  1S6L A;  1QZY A;  1Z6R A;  1ZLK A;  5H6R A;  1P6R A;  1EH7 A;  2JRT A;  1FSH A;  2GA2 A;  2FOK A;  3E3V A;  4IF4 A;  3L9F A;  1BI2 A;  1DUX C;  3K69 A;  4MGR A;  5D4R A;  3COA C;  4PDK A;  5EEG A;  3IKV A;  2O61 A;  4BAY A;  5LHI A;  4MEY F;  1GHC A;  4M6X A;  2GXG A;  3O6B B;  4L5I A;  1WRJ A;  5LEJ A;  4XLP F;  2KIM A;  1FYK A;  4UV9 A;  2Z5U A;  1BC7 C;  1LDK B;  2OD5 A;  2CO5 A;  3VB2 A;  2HTJ A;  2RC4 A;  3TO9 A;  1XD7 A;  3QPH A;  3WGH A;  2P5L C;  1L0O C;  1HQC A;  4I09 A;  3IKT A;  1J0R A;  1QZZ A;  5HLG A;  2W57 A;  1ZAO A;  2L4A A;  2K7L A;  2FU4 A;  4I98 B;  3K1N A;  1BI0 A;  3MZY A;  4A5N A;  1KYW A;  1XB4 A;  1GXQ A;  3RPU A;  3ROU A;  1RZ4 A;  2HR3 A;  2ACJ A;  4EGZ A;  2MD5 A;  1FP1 D;  3BY6 A;  3IWF A;  5DEQ A;  5L3B A;  1BC8 C;  4AIJ A;  5HDN A;  3FMS A;  1BM9 A;  1JGS A;  3BP8 A;  1R1U A;  5CVR A;  4YFK F;  4GGG A;  4RGR A;  5K5O A;  1B9M A;  1EH8 A;  1ODD A;  2IA2 A;  1B6A A;  3Q5F A;  3JTH A;  3C18 A;  2RN7 A;  2YU3 A;  2NNY A;  3WTW C;  1GVJ A;  1LEB A;  4RS8 A;  4WXC A;  3CO6 C;  2IA0 A;  4LLN A;  1SFU A;  1S7A A;  4UVA A;  2DK5 A;  1SD7 A;  1IUY A;  2PEX A;  4RAZ A;  2L01 A;  3DV8 A;  5F1R A;  1LDD A;  3M7G A;  2FEZ A;  1G3Y A;  1U2W A;  1Z7U A;  4UV8 A;  4GXO A;  3V8K A;  1TTY A;  1QGP A;  1G6N A;  2YX7 A;  3ULQ B;  3QPT A;  2A6E F;  3K1P A;  2EFN A;  1ZHF A;  4PGH A;  4LD5 A;  2PLY A;  2QBY A;  2ADU A;  3CTA A;  3D0S A;  3F8B A;  3JAM K;  1GXP A;  5LRR A;  1ZH5 A;  2O8X A;  5FFZ A;  2H94 A;  4KIC A;  1ZGJ A;  4N9I A;  4BXU A;  4OIP F;  3KP7 A;  2VC1 A;  4N9H A;  5BMZ A;  2M5W A;  4LJZ F;  3HHH A;  3RJP A;  3BJA A;  4YFX F;  1HW1 A;  5CVV A;  1XGM A;  2XRO A;  1R1V A;  2GA1 A;  2IRF G;  3FXR A;  2PG4 A;  4ZZL A;  4KFC A;  3L7W A;  3IRR A;  3BWG A;  1G3T A;  1Q1H A;  2EB7 A;  4G7H F;  1MJ9 A;  3QAH A;  3M8F A;  3R4K A;  2DPD A;  2QYO A;  3K0L A;  5LLQ A;  4S04 A;  4LG0 B;  4BNC A;  3CO7 C;  1IF1 A;  2LKP A;  1ZRC A;  3QU6 A;  3CDH A;  4HA8 A;  2AXL A;  4DQ2 A;  4P9F A;  2DTR A;  3HOS A;  4KNY A;  3E6D A;  1DPR A;  3DXJ F;  2P5K A;  2YX4 A;  3NRV A;  3VFZ A;  2HYF A;  2DI3 A;  4M6Y A;  5LRS A;  2DQL A;  4A6D A;  4RB1 A;  1RNL A;  1J75 A;  1ZG1 A;  1HKT A;  2G9W A;  4UHT A;  2XAJ A;  3E6M A;  1UCR A;  4CHU A;  1SD5 A;  3S2W A;  4KUM A;  3ECH A;  1HSJ A;  2KJC A;  1ZGA A;  3GFM A;  3QRF F;  1QO0 D;  1QNT A;  4OMZ A;  3KCC A;  2Y48 A;  1ZG3 A;  2WTE A;  4IRH A;  3JTG A;  2F5E A;  1KQ8 A;  5FO5 A;  1ONV A;  1S3J A;  1ZRE A;  3KP6 A;  3F3X A;  4RB3 C;  4LG0 A;  2IJL A;  4L9V A;  3FF5 A;  5BPD A;  3KET A;  2VBW A;  4KIB A;  3HRS A;  1HKS A;  1JE8 A;  1UFM A;  3KEQ A;  1Z91 A;  2V1X A;  3GW2 A;  4HX7 A;  2PBI A;  3J81 Z;  3R6S A;  4ON0 A;  3HTU A;  5IT9 K;  2COM A;  1HKQ A;  3RKY A;  4WF2 A;  3NEU A;  3LFK A;  5J8C A;  1TQP A;  1G3S A;  5JI6 A;  2A6H F;  3R0J A;  4ESB A;  4M74 A;  4AIK A;  2OBP A;  5HVQ C;  2GQQ A;  3F6V A;  4HX8 A;  4FHT A;  5FD5 A;  2PQ8 A;  3H92 A;  4Q5S F;  1CF7 B;  2EFO A;  4H0E A;  4L0Z B;  5LGT A;  2LDU A;  1FT9 A;  4HX4 A;  5JFR A;  1B9N A;  1RUN A;  3TKY A;  3W6K B;  1LJ9 A;  3NQO A;  1B4A A;  3C3W A;  4HDU A;  2HKX A;  4ZYG A;  5IT3 A;  2VBZ A;  1BIB A;  4EV0 A; 
#chains in the Genus database with same CATH topology
 3QOD A;  4XBF A;  2XAF A;  2K27 A;  3BPV A;  2FML A;  3RCO A;  1U5T C;  1X3U A;  2JZY A;  2BVL A;  1XSV A;  2F5D A;  1G4D A;  3EUH C;  4Y52 J;  4C30 A;  5A2Q Z;  1TZL A;  1V5E A;  4CA0 A;  5KCM A;  2R5Z B;  1DP7 P;  4FX0 A;  3CCS I;  2HYJ A;  2CRG A;  5FD6 A;  3DPL C;  3GZN B;  1MDM B;  1MSF C;  5CYV A;  3N97 A;  4NNJ A;  3PSF A;  3J80 K;  2RNG A;  3IC7 A;  2CMP A;  1K6O A;  1HW5 A;  3CDI A;  1GUU A;  2DA1 A;  2HVQ A;  4V2F A;  3TQN A;  2ID3 A;  1C0W A;  5GP9 A;  2L7M P;  4UVB A;  5CVU A;  3BR3 A;  3CUQ B;  1TLH B;  1ETW A;  3BT9 A;  3ZR8 X;  2O8K A;  2ZME B;  2HNH A;  3KLN A;  4B4C A;  2MA3 A;  4XOP A;  3OYH A;  4RB2 C;  4GDF A;  3PNT A;  2VOP A;  3IH4 A;  1I3A A;  3ESW B;  2R7T A;  2VC0 A;  2O9L A;  5F6F A;  5DS9 A;  2P6S A;  3BTL A;  2JJ7 A;  3KZY A;  3E97 A;  2A5W A;  2OQR A;  2X6O A;  2P6T A;  4ENN A;  3GUD A;  1S72 I;  1PP8 F;  2HWV A;  3EET A;  2PJR A;  4HV6 A;  3KEO A;  2EH3 A;  5ED4 A;  3MWM A;  4M9X A;  4A93 J;  4BHC A;  2WV0 A;  3H35 A;  3RPU D;  2OTL I;  1TBX A;  3HZJ A;  2L9N A;  2JN6 A;  2WAF A;  4LK1 F;  4E7L A;  1W36 C;  1FMW A;  1SFE A;  4B09 A;  2K4B A;  3LWF A;  1SMT A;  3PNY A;  4RLF A;  1STZ A;  2CQQ A;  2OZU A;  3BPX A;  1U78 A;  5B1A H;  4EVI A;  4WX9 A;  5TIS C;  1OLT A;  3ONQ A;  3T1B A;  3V42 A;  4A12 A;  2XAQ A;  1AOY A;  1ZTR A;  2QA4 I;  2NAZ A;  3ASN H;  2Y30 A;  5DD4 A;  3SXY A;  4F91 B;  2M87 A;  1TQI A;  1BR2 A;  2X6W A;  1LVA A;  2CQK A;  2YSR A;  3TO6 A;  3G1O A;  1I50 J;  2UXN A;  4AU7 A;  2M3A A;  2L54 A;  4IPA A;  2XF7 A;  4BEH B;  4BAC A;  4LFU A;  3HRU A;  5HDK A;  3JRG A;  2PFB A;  1W4M A;  1IN8 A;  3T0Y A;  4RAY A;  2A68 F;  1MDM A;  5HS8 A;  4M73 A;  3DBR B;  3BDD A;  3I59 A;  3MN2 A;  4JQF A;  3ABT A;  3N05 A;  3QPS A;  4YEJ A;  1OKR A;  2H8W A;  2V4J C;  5GPA A;  2X1D A;  2NS7 A;  2XAS A;  3QWL A;  4F3Q A;  5JHU A;  1VTN C;  2CUZ A;  2ELK A;  2GLO A;  4I76 A;  3T5X A;  1CGP A;  1F1Z A;  1APL C;  3CUQ A;  3IHU A;  1N25 A;  2E36 A;  5FKO A;  3GFI A;  1FZP B;  2JA8 J;  4I01 A;  3BCA A;  1WH7 A;  2UZK A;  2R5Y B;  1T08 B;  3K10 A;  4XLN F;  4EGY A;  1U9N A;  3DFG A;  5H6Q A;  5FLX K;  4XRM A;  1KU7 A;  3MQ0 A;  1AHD P;  2F2E A;  2VE8 A;  4D9J A;  4LLL A;  2E7W A;  4G94 A;  1Z1D A;  1CQT A;  4LK0 F;  1PDN C;  1WJD A;  3U21 A;  4XR6 A;  4UY8 I;  2CW7 A;  2KRC A;  3GTO J;  4L5J A;  2CUE A;  5E3O A;  1K6Y A;  3M4O J;  1O57 A;  1NG6 A;  1RET A;  1DDN A;  3OS0 A;  2AO9 A;  2G7H A;  2JVH A;  3W6J B;  1U8R A;  3WHC A;  4OIN F;  4D7M A;  1XG1 A;  1FPQ A;  2HQA A;  3HJE A;  5LEK A;  1VQ6 I;  3ZMU A;  3OYL A;  2BZT A;  2GWR A;  3V7S A;  1VI0 A;  2H6B A;  3BJ6 A;  5B66 C;  1HF0 A;  5HS9 A;  1U3E M;  1UST A;  3CMA I;  1T33 A;  1J09 A;  3G73 A;  2A5Y B;  4B3X A;  2D1H A;  4AVP A;  4EJU A;  4JYK A;  3ZPL A;  1MIJ A;  3GLL A;  3GWZ A;  4DBR A;  1F4K A;  1T95 A;  3DKX A;  4N4N B;  1F36 A;  3E7L A;  4HNT A;  3FIS A;  2DYS H;  4BHB A;  1R23 A;  3AG2 H;  3GVA A;  5K7H A;  4CGZ A;  3HEF A;  2HQ5 A;  4A3J J;  2XGX A;  2VUM J;  1FP2 A;  2HKO A;  4BEH A;  3I53 A;  2VQC A;  4AYB A;  3FIW A;  3F23 A;  1JXS A;  4C2T A;  1ZG5 A;  2HZT A;  1OCO H;  2F4I A;  5F1J A;  1OYI A;  1MH4 A;  1LB2 A;  5B1B H;  3ELK A;  3M07 A;  3I55 I;  1YX5 A;  2ZJ2 A;  3PQK A;  3BG9 A;  4XSX F;  5CJ9 A;  2EZH A;  3Q0W A;  4HG2 A;  2LG4 A;  1UHW A;  4RLQ A;  4E4H A;  3KP3 A;  3FWE A;  2AS5 F;  4JX6 A;  2R5Y A;  3B6A A;  5C4X J;  1FSE A;  4ASN A;  1XN7 A;  2VBX A;  1YW8 A;  4FAS D;  1R4N B;  4F93 B;  2XB0 X;  5F27 A;  4J19 A;  2NVT J;  1WZ2 A;  5FKL A;  2Y0M A;  2NNN A;  3ML6 A;  3CCR I;  3VSL A;  2E5N A;  3S32 A;  1S8N A;  3ZP5 A;  3SZP A;  3TMO A;  4U0W A;  4W1U A;  4EJT A;  2RGV A;  3ZXS A;  1MNM C;  4IHX A;  1AWC A;  1DU6 A;  3HG9 A;  1Z3Y A;  4EJO A;  3LAP A;  2M0C A;  3PQJ A;  5KHD A;  1FIA A;  2DA7 A;  5B5E C;  2Y9Z A;  1POG A;  2KRF A;  3F6O A;  4ZDO A;  1T8I A;  1BOA A;  1MJA A;  1WHU A;  2Z99 A;  3M1E A;  1I1G A;  1D5V A;  2HVR A;  4EM1 A;  1P4W A;  2M30 A;  3KYL A;  1IW7 F;  1UAA A;  2E71 A;  4IHS A;  3LFU A;  2L0K A;  1ORK A;  1LFP A;  5LFA A;  1E3O C;  2EV5 A;  2LYC A;  3GX4 X;  1VQM I;  4WXH A;  5BS6 A;  3O8G A;  3HTS B;  4EJW A;  2W24 A;  4Y13 A;  4G12 A;  3NAU A;  2DDB A;  4LIU A;  3BTC A;  2QBY B;  2DT5 A;  6PAX A;  3M8E A;  3N4M A;  1O3R A;  2VT3 A;  4Q4Z F;  3CMM A;  5KNL A;  1W0T A;  4LLG F;  4PJL A;  2UV1 A;  2IS1 A;  2K5C A;  2OAZ A;  5IY5 H;  5EDN A;  1KU2 A;  2KZV A;  2F4M B;  3JRB A;  1IN6 A;  1XX5 A;  2ZXH A;  2ZXJ A;  4CO8 A;  4DBQ A;  3JRC A;  2M45 A;  3BR0 A;  4C9Y A;  4E7S A;  5IP9 J;  1H8A C;  1X2M A;  1QPM A;  2XAH A;  1AKH A;  3GBG A;  4L18 B;  1LUJ B;  4BBS J;  4R79 A;  1X1P A;  3WTX C;  3K4K A;  2MW8 A;  3K4C A;  1VQ5 I;  3E0J B;  2B0L A;  3T8R A;  3WG7 H;  1MMA A;  3DQV C;  2IGN A;  1Y39 A;  4XLC A;  1JKP C;  3PO2 J;  2EPF A;  2ESH A;  3HOW J;  2HDW A;  3QP5 A;  1E17 A;  1S7E A;  2H09 A;  1ETQ A;  3KX2 A;  1U6G A;  1BW5 A;  3CME I;  3PIP F;  3BR6 A;  3HIF A;  2LP0 A;  1IRZ A;  2VLA A;  4HLX A;  2WAQ A;  3HSF A;  2LVS A;  1ENH A;  2ISZ A;  3PFI A;  1WPK A;  1WI9 A;  3FMQ A;  3DPT A;  2DAO A;  4HF1 A;  2BXY A;  4YIF A;  2A69 F;  4TV7 A;  4S0H B;  3EYI A;  2VOO A;  3HOX J;  3GEZ A;  3OYE A;  3DTI A;  3AFH A;  2IGK A;  3LA3 A;  2OU2 A;  4FQG A;  2JA7 J;  2FQ3 A;  3HPH A;  4IVN A;  2X1C A;  4BH9 A;  2K9S A;  2COB A;  3FMR A;  4FE7 A;  4HQE A;  2XUB A;  4KYW A;  2DXI A;  2HQN A;  1RIO H;  3F22 A;  3KP2 A;  3T8T A;  2PN6 A;  2VPL A;  1IRF A;  3QYB A;  1GT0 C;  3S93 A;  4A3D J;  2QQ8 A;  3BZK A;  1X2N A;  1T2K A;  3MKY B;  5FRN A;  1WJC A;  3SZG A;  5DUK A;  1SVO A;  5DDG A;  1B8I B;  2X6X A;  1Y1W J;  1JHF A;  5LBQ A;  2BY0 A;  3IWZ A;  1FBS A;  1V4R A;  1ZLJ A;  3F0C A;  3SFZ A;  1F9N A;  2Q8K A;  3ZMD A;  2JA6 J;  3FXM A;  2VJ5 A;  3CC7 I;  2GIZ A;  2W82 A;  2X0L A;  2WV1 A;  3SJM A;  1VQL I;  3C2H A;  2VKD A;  2LOO A;  1VQO I;  2EIM H;  2M8E A;  2R7F A;  1JT6 A;  3PUF A;  1MMN A;  4L9T A;  1EJ9 A;  1GLN A;  4YEL A;  2EBI A;  2RDP A;  1Y6I A;  2VL8 A;  3ZMT A;  3OYN A;  1UG2 A;  3H9J A;  2MLK A;  3CLQ A;  4DYR A;  2HPM A;  3IV5 A;  2XAU A;  2ID6 A;  3QYE A;  4XRS A;  1FTZ A;  2ZJR F;  5EGO A;  2FNP A;  1R36 A;  3HM5 A;  3I58 A;  3V7R A;  2ZSH B;  4RGS A;  1L3L A;  2HOT A;  2LC2 A;  5E3N A;  5CQG A;  3D5R C;  4CCJ A;  5L3F A;  2CSO A;  5B3S H;  2CW8 A;  2JA5 J;  3MEX A;  1R58 A;  4HV5 A;  3WTZ A;  5LHG A;  1XCV A;  4KIT B;  1QPI A;  1G59 A;  1OJL A;  3CCY A;  4E7I A;  2VXZ A;  1S7O A;  3LSH A;  1MBF A;  2AQE A;  3ZQQ A;  2LSO A;  2AQF A;  2ETH A;  1R6R A;  1TT0 A;  5J47 A;  3M1C A;  5DYM A;  3U2R A;  2A07 F;  3KP4 A;  3B02 A;  3H3Z A;  3HXL A;  2STW A;  4U7B A;  1YJN I;  2JT1 A;  3ZMZ A;  2JSC A;  3REO A;  5JVG F;  5AON A;  1AU7 A;  2HOE A;  4LB5 A;  3GF2 A;  1JKR C;  4IRG A;  3OOP A;  1JKQ C;  5BPI A;  3HRT A;  2VON A;  3OSG A;  3BRO A;  2JQ7 A;  1QRY A;  3Q3S A;  3U9G A;  3AKZ A;  3P7N A;  4ZC3 A;  1TNT A;  4IZZ A;  3SQN A;  3S15 J;  1IRG A;  1O4X A;  2QLZ A;  2ZSI B;  2EV0 A;  4G6Q A;  2IVM A;  4BHP A;  1MGT A;  2VBY A;  1PJR A;  4JX4 A;  4M71 A;  3FXU A;  2ECB A;  1D1B A;  2G7U A;  5KAI C;  1KON A;  1XSD A;  5ILV A;  2BGC A;  1SFX A;  2ESN A;  2CU7 A;  4KN4 X;  4WXD A;  3HOT A;  1N77 A;  2RRE A;  3JSO A;  2XF6 A;  3CJT B;  4GYI A;  3A02 A;  1V54 H;  3ZMS A;  3KEY A;  3TO7 A;  4BXF A;  3BTI A;  2FUG 2;  3JRD A;  3L2W A;  1X4O A;  2LY2 A;  1H9T A;  2LR8 A;  3I56 I;  3K2Z A;  4IHY A;  3HOU J;  1UB9 A;  1MSE C;  3FKI J;  1ACI A;  3FHN A;  1FYL A;  1FBQ A;  4ENK A;  2DN0 A;  1B59 A;  3GTJ J;  1O3S A;  2X51 A;  4QSH A;  2GBY A;  3JRF A;  3OL3 A;  3W2V A;  1ETO A;  4NC8 A;  1OCZ H;  1HST A;  5GAE J;  3BZ6 A;  2R7S A;  1IJW C;  3K9T A;  3BG5 A;  5BQT A;  1GDT A;  2A61 A;  2DA3 A;  2FRH A;  1I3Q J;  1RES A;  3V7C A;  3DTE A;  3QYF A;  2K4J A;  4CCK A;  1KQ0 A;  2NYX A;  4QTR A;  3RSN A;  2EK5 A;  5EG0 B;  1WQ2 A;  1G2H A;  1Y1V J;  2WB1 A;  2DTZ A;  4HST A;  3HOY J;  1YTY A;  4GYG A;  2ZNZ A;  3WHB A;  2VPR A;  1VQ7 I;  2GOM A;  2GAU A;  2ZNY A;  4FT8 A;  3ECO A;  2Y69 H;  3IAS 2;  3OYF A;  1TT5 B;  3OYJ A;  4BXX J;  3PSI A;  5M5Y J;  2IXS A;  3P9C A;  2J5O A;  3ZCO A;  4B44 A;  5GPC A;  3GTG J;  1SAX A;  4OIO F;  3HRM A;  5HS7 A;  2EZI A;  2QKM B;  3I71 A;  1MKM A;  2WAQ N;  1M1E B;  4ZZD A;  5DV5 A;  4BS9 A;  1YJW I;  4UUV A;  4HSR A;  2J5P A;  4O6J A;  5CVI A;  4BY1 J;  2CGP A;  4R1H A;  2EZL A;  3Q9S A;  2E5Z A;  2VN2 A;  5D8L B;  2RV8 A;  3WTY C;  1XDU A;  4MFD A;  1MMD A;  4H4K C;  1X3Z B;  1Y8Q B;  3X2Q H;  1T98 A;  5ICE A;  2PJR B;  1IUF A;  4F52 A;  1TWH J;  3EYY A;  2ZC2 A;  2XKO A;  4ZYH A;  1VQN I;  3WU0 A;  1ETX A;  4UNO A;  4OOI A;  5H2F C;  5ICG A;  1RUO A;  4F7Z A;  2M9H A;  3Q0V A;  3K4N A;  3JRA A;  2DJI A;  3NWT A;  2JPB A;  3ZQG A;  3K70 C;  3WOD F;  3WTT C;  2QKL B;  2KDZ A;  2WWY A;  4DOZ A;  3AG3 H;  3F9K A;  5DTD A;  1W5S A;  2I5U A;  5H20 A;  3ZGK A;  4HYE A;  4PZJ A;  5M3M J;  2BV6 A;  1DU0 A;  5ICC A;  3EUH A;  2V6C A;  1QVU A;  3TW6 A;  1OCC H;  2F5C A;  2V6E A;  5J6X A;  2DOD A;  2CW0 F;  2ZFU A;  1LNW A;  1R49 A;  1ETK A;  2DW4 A;  5GTH C;  4PJM A;  3M8J A;  4A0X A;  3FXK A;  1LEA A;  3QP6 A;  4RA2 A;  2L9R A;  5EG0 A;  4FX4 A;  3S1Q J;  5K5R A;  3EQL F;  3LA7 A;  3FXJ A;  2FE3 A;  4G6T B;  3FBI B;  2FBI A;  1FLI A;  3ISP A;  2VJI A;  1QHG A;  3QU3 A;  1IN7 A;  4K2E A;  3JAM Z;  3BTJ A;  2UXX A;  2HDD A;  3I59 B;  1U0J A;  2PMZ A;  4QLC U;  1OPC A;  5F0H A;  1QHH D;  1YOV B;  4RGU A;  2FX0 A;  3ZQI A;  4S05 A;  2P8T A;  3RDI A;  1ULY A;  3G6E I;  2KKO A;  1ZRF A;  2TCT A;  2PI0 A;  4P96 A;  3IRQ A;  3CLO A;  3TP3 A;  3F21 A;  2Y31 A;  4I2O A;  3S3M A;  4FET A;  1Z6T A;  2HZD A;  3LA2 A;  3GFJ A;  4Y33 A;  2QQA A;  1UMQ A;  3AG4 H;  4C2M J;  5JR3 A;  4ZJZ A;  3I0T A;  1D8K A;  4XON A;  4IRI A;  3LQQ A;  2HOA A;  1E3P A;  4PCQ A;  3SEQ A;  4IO9 F;  4JBA A;  1XDS A;  5K1Y A;  2HS5 A;  4E7J A;  1PUF B;  2RVC A;  1E2X A;  5D5V B;  1OR7 C;  1HCR A;  2L3D A;  3S14 J;  2GZW A;  2MH2 A;  1O7F A;  2AXT C;  3CQZ J;  2R7D A;  3KYD B;  4XKW A;  4DGW B;  4F55 A;  5E1Z B;  5L3G A;  4X0G A;  3QOP A;  4OIQ F;  3I4M J;  1V55 H;  2KIQ A;  4B43 A;  3SZT A;  4FE4 A;  5J4Y A;  1FOY A;  1R9T J;  2P7V B;  2CV1 A;  1YLF A;  4QPO A;  2QGU A;  3OYD A;  2CWE A;  1D8J A;  4A3C J;  2BHY A;  3ERE D;  1J59 A;  4NHJ A;  2XF5 A;  2V9V A;  3ABU A;  1X19 A;  3B6C A;  3DCF A;  3BQZ A;  1SMY F;  4D5C A;  4DZP A;  4L0Y B;  5E3L A;  3WGG A;  1LFB A;  1BJZ A;  3SHF A;  4ETS A;  5GTI C;  1NTC A;  4XRF A;  1Y0U A;  4W97 A;  3PIO F;  1LQ1 A;  4MFE A;  4Y4R A;  4E70 A;  2R7R A;  2Y2Z A;  2E35 A;  3GXO A;  3HSE A;  1D3Y A;  2P4W A;  3RKW A;  1YS6 A;  4E7K A;  2PJP A;  1H9G A;  1I6X A;  3DKW A;  1HDP A;  4IQ4 A;  5TRD A;  2Q1Z B;  3OSF A;  1W0U A;  1YYV A;  4MLO A;  4Y17 A;  4BGD A;  3C1D A;  4ANJ A;  1WI3 A;  3O3K A;  4C2U A;  2ELJ A;  1HBX G;  3IUO A;  1MBH A;  1VFC A;  3AL0 C;  5TGT A;  3OV8 A;  1BW6 A;  4HW0 A;  2Z9O A;  1MW7 A;  1ETV A;  3D5S C;  2QM3 A;  1R7J A;  1A6Q A;  2YPR A;  4OU0 A;  4AWX B;  4KDP A;  3O2P E;  2WA0 A;  3I3L A;  3SYT A;  4HOB A;  1OCP A;  2ME0 A;  1BR4 A;  3ZMV A;  3OYA A;  3CCJ I;  2E34 A;  1OCR H;  3F8C A;  3L09 A;  4CSW A;  2E60 A;  5J4V A;  5FKM A;  4N4O B;  4NQW A;  5FFX A;  1XPX A;  2EIL H;  4G7O F;  3FHZ A;  4M3G A;  3GTP J;  4BKX A;  3OY9 A;  4X6A J;  4HAM A;  2KIF A;  1PUF A;  2NVY J;  3DTK A;  3ZOB A;  4YII A;  4WCG A;  1VQK I;  5CVJ A;  2P81 A;  2OC6 A;  2F6C A;  2DPU A;  4RGX A;  1WGX A;  1P92 A;  4JP0 A;  3LSR A;  2CQN A;  2KDO A;  3EPZ A;  3OYB A;  2M8G X;  3U1K A;  3CF5 F;  1LVK A;  2MC3 A;  2V79 A;  4ESF A;  1RI7 A;  3WTV C;  2Q0O A;  3J7A Y;  3C7J A;  1K4S A;  2W25 A;  2C6Y A;  2ZME C;  3E5U A;  2IT0 A;  4AD9 A;  4YG2 F;  1IGN A;  3HC7 A;  3FZV A;  3WTS C;  1KQ9 A;  2VKE A;  3OOU A;  2IS2 A;  3BLY A;  1XC5 A;  2OA4 A;  5LGU A;  2VIX A;  1YIT I;  1KYZ A;  5EZG A;  1R1T A;  5M5X J;  1TWC J;  2LF8 A;  1F43 A;  5ILU A;  2FF4 A;  2FXA A;  3KFW X;  1NHA A;  3H5R A;  1F5T A;  1BIA A;  2LH9 A;  2RAE A;  3E5X A;  4XLE A;  5JLX A;  4P9U A;  5IT9 Z;  1YW7 A;  3WU2 C;  2KT0 A;  4RM3 A;  3S1M J;  1UG0 A;  4C3H J;  1FWZ A;  3AAF A;  3V8J A;  4P55 A;  2XV4 S;  2ZJQ F;  4UVC A;  3EUA A;  4U87 A;  1WJB A;  1ON1 A;  4XSZ F;  1YJ9 I;  1W5C C;  2P5V A;  1RR8 C;  4IL6 C;  4G7Z F;  4YFN F;  3QPL A;  1JTY A;  3RPQ A;  5E1X A;  1XGO A;  2F4O B;  2FA5 A;  3K1M A;  4GCV A;  4RBO A;  2HXO A;  1AKH B;  3KYC B;  2QUF A;  3CP2 A;  3H36 A;  2E1N A;  2NXN B;  5DM6 F;  4BQO A;  3CJR B;  2XIG A;  4M3D A;  1LFU P;  3I4N J;  5E3M A;  3A4C A;  3EDP A;  4NC7 A;  1HA8 A;  2DFI A;  1EA3 A;  1X1B A;  2H6C A;  5EJC A;  2BHZ A;  5J8F A;  2L02 A;  3LL7 A;  4MTE A;  3RZO J;  1TP4 A;  1MBG A;  3WGI A;  2RNJ A;  4BQA A;  4KIG A;  1ZR4 A;  2HPI A;  4OIR F;  2WC2 A;  1ETY A;  3OWT A;  5AIP A;  3TDU C;  1TW3 A;  2JUC A;  2VT2 A;  2E2J J;  4PK4 A;  3IL2 A;  1LPQ A;  1T0F A;  1RC9 A;  1IN4 A;  1IRX A;  1ZQ3 P;  5L3D A;  1X1A A;  2JSP A;  1Z0X A;  1T6S A;  2W85 A;  1YS7 A;  1XMK A;  5FLV A;  1IXS B;  1W7P A;  1XSX A;  2XSJ C;  1ZRD A;  2DFF A;  3IAM 2;  1ZN2 A;  3BQY A;  2ZKZ A;  1YHQ I;  1N78 A;  1YQA A;  2EIK H;  2ZJP F;  1IC8 A;  1BL0 A;  2QEX I;  4RMN A;  3UKG A;  4KN7 X;  4MEX F;  3HHG A;  3K2A A;  5L3E A;  4XLA A;  4MTD A;  1R00 A;  1O3Q A;  3CCM I;  1IZ1 A;  3FXQ A;  5IP6 A;  3A03 A;  2STT A;  1FX7 A;  2NVX J;  1HC8 A;  2Z1D A;  4B48 A;  2V7F A;  2CUJ A;  2X4H A;  4CZZ A;  2FQ4 A;  2Z16 A;  1USS A;  1R5H A;  2RKH A;  1T38 A;  3J80 Z;  2XKP A;  3OS2 A;  2IS4 A;  5E20 A;  3D1N I;  4HZF A;  4KIS A;  1YIJ I;  2MLG A;  2D45 A;  3R60 A;  4ESJ A;  4M9S A;  2GXB A;  3IH3 A;  2NS0 A;  1J7K A;  4EJV A;  2QQ9 A;  1FBU A;  2W48 A;  2O03 A;  4PJN A;  4UXN A;  2O7O A;  3LQR A;  2XPV A;  4WK8 F;  2V1N A;  1Z3X A;  1GV5 A;  3QQA A;  4A5M A;  3F8F A;  3MVP A;  4Q47 A;  2YR2 A;  4IHT A;  2IP2 A;  3HYI A;  3D5L A;  3R61 A;  2HEO A;  4XKC A;  3J81 K;  4PSW A;  1WH5 A;  3MZ8 A;  5E1W A;  4A3F J;  4N0B A;  4ZTJ A;  1B72 A;  2H8R A;  1PVE A;  5EGO B;  2DT6 A;  4MQV A;  4BE2 A;  3G2B A;  2YU9 J;  4EM0 B;  4LIT A;  4XMY A;  4HQM A;  5E8G A;  4B47 A;  5D8K B;  3GCM A;  4XRS G;  2ISY A;  3Q9V A;  4OWR B;  5C44 J;  5DUI A;  2DK8 A;  3U1D A;  2R4G A;  2E1M C;  4G8X A;  2L9V A;  4LMY A;  3VOE A;  3B73 A;  3MKW B;  2WY7 Q;  5FRO A;  4II3 A;  5JVT A;  1TWG J;  1WJE A;  1J9I A;  3RKQ A;  2LMD A;  2Q2E B;  1S29 A;  2QZ8 A;  2R7O A;  4Y15 A;  4QPQ A;  1SVL A;  1FOK A;  1Y56 A;  2BY3 A;  1OFC X;  2BE5 F;  1Z9C A;  1Z05 A;  1R71 A;  2JTV A;  1P2F A;  5ICF A;  2HYG D;  5HLI A;  1JHH A;  2EWN A;  3OYM A;  2DO7 A;  2ZO4 A;  2DOE A;  3FXL A;  3VDX A;  2IS6 A;  2R7V A;  1K7A A;  3DEU A;  3BC8 A;  4XKV A;  3KZI C;  2IW5 A;  4BJT A;  3O8H A;  4CCL A;  1DGR M;  4Y7N J;  4CCO A;  3CF2 A;  4ZH4 F;  2M4K A;  3OIQ A;  2F5F A;  2LY1 A;  3TL4 X;  4DNC A;  3P5J A;  2M0M A;  1IXC A;  2HDC A;  3K4J A;  1P4A A;  4C3I J;  2MFZ A;  4IHV A;  2DBB A;  5ERI A;  1ZKG A;  4XIC A;  1MBK A;  2D1V A;  2GOX B;  4ZYE A;  2V9K A;  1QQI A;  3OYC A;  3A01 A;  2Y9Y A;  3MKZ A;  3A0B C;  2DMP A;  4I0B A;  3VEP A;  1YE9 A;  4D7N A;  3RIR A;  5K5Q A;  1BN5 A;  3ERM A;  3LNQ A;  5A2Q K;  3S17 J;  2JVG A;  4ZYD A;  2EFP A;  1SD4 A;  4I02 A;  4L9J A;  2NS8 A;  4B3A A;  5FLX Z;  5C4J J;  2EV6 A;  2LLK A;  1FY7 A;  4A3G J;  2NOJ B;  4Z2Y A;  3KP5 A;  5BOX A;  1OMI A;  5J1U A;  2M1B A;  3I64 A;  5CLS A;  5GAH J;  3JR9 A;  3LSG A;  1IAW A;  2KJB A;  4Q48 A;  1WKM A;  3DBH B;  5FGM A;  1ERD A;  2EJR A;  4HBL A;  1JUP A;  4KT6 A;  4HNU A;  2Z33 A;  3S1N J;  3JRE A;  2M34 A;  3MCZ A;  1SAN A;  3ABM H;  1I27 A;  2DQR A;  3FK6 A;  2ECC A;  3A2K A;  1XS9 A;  5HDG A;  1E3H A;  1K79 A;  1S5L C;  2D5V A;  3L2Q A;  3K4M A;  4LGW A;  3BOQ A;  2ME6 A;  3H3V K;  2DMT A;  3ZQ7 A;  3FX3 A;  4CDG A;  4AYB N;  3GO5 A;  1T39 A;  5D5W B;  4UUT A;  2Q2E A;  2H27 A;  2KMU A;  3W2W A;  5FB2 A;  2EFW A;  3NWS A;  4KMF A;  2OF7 A;  2BBY A;  3FM5 A;  3HOZ J;  2EFQ A;  3DF8 A;  3VWB A;  2OCE A;  3I9V 2;  2V1U A;  3OR1 C;  3DPU A;  2GM4 A;  5F04 A;  3E6B A;  5DCF A;  1O3T A;  4M6V A;  4ZYA A;  2IA1 A;  4AID A;  3MFK A;  2W84 A;  4F92 B;  4IJA A;  4CXF A;  2MYS A;  2NVQ J;  3BR1 A;  3OR2 C;  1R4M B;  3BCB A;  2DU9 A;  1V3F A;  3GTL J;  1YRN A;  2E7X A;  3DLL F;  1QBJ A;  1ITY A;  3VYS B;  4II2 A;  1IV6 A;  4JX5 A;  2PMU A;  2WAD A;  3TP0 A;  1MJB A;  2O3F A;  2P0W A;  1W36 D;  3CC4 I;  3R0A A;  5BNG A;  5KK1 A;  4BJ5 C;  1SEU A;  2QQB A;  1FNN A;  1FTT A;  3JSP A;  1JI8 A;  4B8X A;  5HNF A;  3W6V A;  3H1C A;  2CG4 A;  5EYR A;  4WWC A;  2K85 A;  4A0Y A;  1WWX A;  5EEH A;  4U7D A;  3CCU I;  2VE9 A;  3F72 A;  1I1S A;  4HDV A;  2LNB A;  1IXR C;  4CYC A;  2TRT A;  2K9M A;  5D5X B;  1XGN A;  5HOD A;  2LY9 A;  2FBK A;  1AA7 A;  1FEX A;  1RKT A;  4BJ6 C;  2NOG A;  3CMY A;  2R7U A;  2QEN A;  4IOC F;  1DPU A;  3GYH X;  3L00 A;  2BYV E;  2Z3Y A;  3CDL A;  1U5T B;  2JA2 A;  1MMS A;  1H0M A;  2L5Q A;  1NG7 A;  3CCL I;  1A36 A;  1REP C;  2P7C B;  2L7Z A;  3W3C A;  4M9Z A;  4LG3 A;  2E2I J;  4A6E A;  4GO1 A;  1K78 B;  1FYM A;  3BJO A;  3VYR B;  4KA4 A;  1J5Y A;  3M3Y J;  5J1Y A;  1JJ8 C;  3RQI A;  4XN3 A;  4QWQ A;  1P4X A;  1R5G A;  5AIQ A;  4RB0 A;  1YW9 A;  2LBF B;  3KE2 A;  3S8P A;  5E17 F;  2ZFW A;  1BI1 A;  3F8N A;  1KGS A;  2BVM A;  3SDG A;  4IX7 A;  1TW2 A;  2HU9 A;  1UZC A;  3MMY B;  3SEZ A;  1KA8 A;  4BL0 B;  4CCM A;  4G6D A;  1KU3 A;  2YS9 A;  4XK4 A;  5IP7 J;  3PFY A;  3HOV J;  2QVO A;  2XC7 A;  2LRE A;  1E0E A;  4G9Y A;  5DD8 A;  1FMV A;  3WE2 A;  1QA6 A;  5HLH A;  3GFL A;  5IPA A;  4PFO A;  5J3L A;  2EIN H;  2VAS A;  5J40 A;  2DA5 A;  4D0P A;  3A0H C;  1PP7 U;  1XGS A;  4I0A A;  4L5E A;  2E1C A;  1TNS A;  2A3S A;  4XN0 A;  5IOY A;  3G1M A;  2HGC A;  5D5U B;  1YX3 A;  2TDX A;  3E6C C;  2EA4 A;  3DP7 A;  2ZBK A;  2FNA A;  3GLX A;  1N75 A;  3CZ6 A;  2QWW A;  3L2C A;  4OMY A;  3GZ6 A;  4A3E J;  3J7A O;  2XVC A;  5K7F A;  1TQM A;  4OAZ A;  2O0Y A;  3FM3 A;  2ELH A;  4CYD A;  1EV7 A;  2W1O A;  3MZH A;  2HFH A;  1MD0 A;  4EM2 A;  3I5U A;  4O3M A;  3JW4 A;  3OIO A;  2KIU A;  1VQP I;  1VQ4 I;  3M9A A;  2FD5 A;  1OCT C;  2WBM A;  4UB6 C;  2VOD A;  2HQR A;  1JTX A;  1LDJ A;  2XPU A;  2L9S A;  4UUS B;  1X1C A;  2DFE A;  4J01 A;  1LE8 B;  1ZAR A;  2A05 A;  3SDB A;  4ZDL A;  3MAJ A;  1U5T A;  2B7E A;  2MH9 A;  4LB6 B;  1K4T A;  2CUF A;  2DT7 B;  3ZN1 A;  4E7H A;  3K4L A;  3ZN0 A;  2DOA A;  1OIS A;  2QSF X;  4NC6 A;  1ON2 A;  3ABL H;  2WY8 Q;  3RTR A;  2GIV A;  1V5F A;  1K78 A;  2NVU B;  3P9I A;  3F8M A;  2ZCW A;  3WU1 B;  3H0D A;  4DIQ A;  1HW2 A;  1I5Z A;  5D6F A;  4A2U A;  4DYQ A;  4MNU A;  3OIP A;  4P5O A;  3H5A A;  3ZQH A;  2XDV A;  2LBF A;  1UHS A;  2M4G A;  1EH6 A;  5KVR A;  3AL0 B;  4XOT A;  3HDD A;  5F0C A;  2MG4 A;  4AUX A;  1A04 A;  1DQU A;  4V19 K;  3S2D J;  1BBY A;  5D6E A;  2FSW A;  1YG2 A;  5E18 F;  1YFH A;  1UHM A;  3G1L A;  4JK1 X;  5LGN A;  2IPQ X;  2Y75 A;  3MKL A;  2OZ6 A;  4A3M J;  4R8H A;  1OYW A;  1ZK8 A;  3CCV I;  1JUS A;  5DCM B;  3Q0U A;  2W4S A;  3WE3 A;  4MIM A;  2L4M A;  1A35 A;  2K02 A;  5ILS A;  5F64 A;  2VKH A;  1OR7 A;  4NQW B;  3V8L A;  4BUP A;  3JCU C;  4IKF A;  1PYV A;  1W7P D;  3RKX A;  4HF2 A;  1BI3 A;  4MO7 A;  3CC2 I;  2V1D A;  4P1W A;  3E5Q A;  4OAY A;  3RYP A;  1IN5 A;  4A3I J;  2CFX A;  4EMS A;  2V9P A;  3LOC A;  4ZDP A;  2VI6 A;  1J2X A;  2X1E A;  1YO5 C;  2O5R A;  3KPH A;  4L9N A;  3RYR A;  1A31 A;  1GVD A;  2HTS A;  2XGD A;  2IAI A;  1YI2 I;  3I4P A;  1PUE E;  2FBH A;  1OQY A;  2N8G A;  2LF7 A;  4BYY A;  5FRM A;  3TDZ C;  3RI4 A;  4UUS A;  2KRH A;  2UUZ A;  5LD2 C;  1LE8 A;  4PGG A;  1ZR2 A;  2OTJ I;  2IGO A;  4ITV A;  1HLV A;  3FKJ A;  4XM3 A;  1P9Q C;  5TJJ A;  1R22 A;  3VOD A;  1OYY A;  3HUG B;  4A0Z A;  2K86 A;  1WSU A;  1TWA J;  1CF7 A;  1RKW A;  2XRN A;  2PMH A;  4M72 A;  3I54 A;  4IQJ A;  1MZB A;  3G3Z A;  3OYG A;  4NB5 A;  4KMU X;  3AG1 H;  3TGN A;  2UWM A;  3H3U A;  1D1C A;  1ZYR F;  4AIH A;  3G4S I;  2HXI A;  4BQN A;  3LST A;  1KU9 A;  3GZ5 A;  5L3C A;  4O5V A;  2MBF A;  4IXA A;  3V4G A;  4KT5 C;  3PNV A;  2OQG A;  4EQQ A;  4U0Y A;  2B63 J;  4ENM A;  2D2W A;  3G71 I;  4M3F A;  1HXD A;  2DMU A;  4Z6Y A;  2EA2 A;  5DCM A;  3WG9 A;  3NAR A;  2XAG A;  1SD6 A;  1W5T A;  2KHM A;  4ENJ A;  5E8I A;  5HOO A;  3PUB A;  1LKX A;  2KP6 A;  3HSR A;  1H89 C;  2M2E A;  4E6K G;  4CIC A;  2R5Z A;  3TED A;  3DKY A;  2R3S A;  1IV8 A;  3CJN A;  2KLO A;  2BY1 A;  1G3W A;  1BJA A;  2NRA C;  2DLL A;  1MH3 A;  2CYY A;  4MQ9 F;  4U88 A;  1K61 A;  2DCE A;  1FC3 A;  2O6G E;  3PO3 J;  1YIO A;  3H5N A;  3TOB A;  2CS3 A;  1D5Y A;  1NH3 A;  5HNH A;  3ZQC A;  4MHG A;  2XHK A;  3MD2 A;  5LHH A;  5FJ8 J;  1XMA A;  4IEJ A;  1XCB A;  2ZME A;  2WB1 N;  1Z7L A;  1O7L A;  5IOZ A;  1B1B A;  4QIW N;  1W7P B;  4PJ0 C;  3TOA A;  2CV0 A;  4U0V A;  3P9K A;  3GTM J;  1SFO J;  3KZZ A;  3VPR A;  3KLO A;  3CUQ C;  3LSI A;  2GXA A;  2K3F A;  4HLY A;  5D4S A;  4AC0 A;  1VZ0 A;  2WAE A;  5F0F A;  3CUO A;  5CPR B;  2BEO A;  2RQP A;  1U9O A;  3HUG A;  2FMY A;  4I7H A;  2EQR A;  2JPC A;  3HGG A;  4KIF A;  3WTU C;  3LAJ A;  1Y0N A;  1MND A;  4HF0 A;  1S6L A;  5M3F J;  1QZY A;  1D1A A;  1Z6R A;  2FJ1 A;  4BU2 A;  1SFK A;  1ZLK A;  5H6R A;  1P6R A;  5GAD J;  2VXD A;  1EH7 A;  2JRT A;  1FSH A;  2IEK A;  3GTQ J;  3VYT B;  2GA2 A;  1TC3 C;  2JMW A;  2FOK A;  3E3V A;  4IF4 A;  4IOA F;  2CFO A;  2IBD A;  3L9F A;  3HBL A;  4NBQ A;  3CCQ I;  2L2O A;  1WJ5 A;  1BI2 A;  1DUX C;  4D5F A;  3K69 A;  2BXZ A;  4MGR A;  4AVZ A;  5D4R A;  2R7Q A;  2HVS A;  4GRI A;  3COA C;  4JOM A;  4PDK A;  5CQE A;  5EEG A;  3IKV A;  2O61 A;  1QU3 A;  5EF6 A;  4BAY A;  5LHI A;  1BA5 A;  2BW3 B;  1FOX A;  1B72 B;  4MEY F;  4IHW A;  1GHC A;  4M6X A;  4YIR X;  2GXG A;  2R0Q C;  4FIS A;  4DJA A;  3O6B B;  2OJE D;  4A3L J;  4RDU A;  3LSP A;  5DM7 F;  3S3O A;  2E1M B;  1WJA A;  2CQX A;  1BR1 A;  3BG7 A;  4L5I A;  1WRJ A;  5E79 C;  5LEJ A;  2VB6 A;  4XLP F;  2DMQ A;  2KIM A;  2X9D A;  1FYK A;  1VQ9 I;  5C3E J;  2JWT A;  4UV9 A;  5FKK A;  3HPG A;  1JT0 A;  3OMY A;  2RQQ A;  2Z5U A;  3ASO H;  1BC7 C;  2CH0 A;  4DW6 A;  1LDK B;  1XMX A;  2OD5 A;  1X1D A;  2CO5 A;  3VB2 A;  3VSK A;  2HTJ A;  3J7Y J;  4J00 A;  2RC4 A;  2I8D A;  1A6I A;  2MSY A;  5IYD J;  3TO9 A;  1XD7 A;  2OUM A;  3QPH A;  2E2H J;  4A3B J;  3WGH A;  2PMZ N;  3OYI A;  1L0O C;  2P5L C;  1HQC A;  4I6Z A;  1NK3 P;  2JUG A;  4I09 A;  3IKT A;  3EUK L;  4A69 C;  1J0R A;  1XTA A;  1EF4 A;  3HL2 A;  1R5I D;  1QZZ A;  4Y3O A;  5HLG A;  3DU5 A;  3DEE A;  3L1P A;  2Y0S A;  2W57 A;  4HEA 2;  1T0F C;  3KIO A;  1ZAO A;  2L4A A;  1I6H J;  2K7L A;  2FU4 A;  3W2A A;  2IGM A;  4BBR J;  4I98 B;  3K1N A;  1FJL A;  2LFB A;  3L2R A;  2DJN A;  1BI0 A;  3CCE I;  3MZY A;  1HOM A;  1TWF J;  3PL8 A;  4M3B A;  3A01 B;  4A5N A;  1KYW A;  3BZC A;  1IDY A;  1XB4 A;  1GXQ A;  4A3K J;  3RPU A;  1FIP A;  3FK7 A;  3ROU A;  2CJJ A;  1RZ4 A;  2HR3 A;  1WJF A;  2ACJ A;  4EGZ A;  2MD5 A;  4CH7 A;  4HRI A;  1FP1 D;  3BY6 A;  3CP8 A;  5HLT A;  2BW3 A;  4BY7 J;  3IWF A;  5DEQ A;  5L3B A;  4FTH A;  4AIJ A;  1BC8 C;  5HDN A;  5EZH A;  3FMS A;  1MMG A;  1BM9 A;  1JGS A;  3BP8 A;  1R1U A;  5CVR A;  4XLF A;  4YFK F;  4GGG A;  4PJJ A;  3ZQL A;  4RGR A;  5K5O A;  1B9M A;  2AHQ A;  4DYC A;  1EH8 A;  1NK2 P;  1ODD A;  3UR3 C;  2IA2 A;  3CES A;  1B6A A;  2OV7 A;  3Q5F A;  2DDA A;  3JTH A;  5F08 A;  3C18 A;  2XGC A;  1T56 A;  2RN7 A;  2YU3 A;  1X58 A;  3DEW A;  2NNY A;  4BE0 A;  5K7Z A;  3WTW C;  1U8B A;  2VQG A;  1X3W B;  1GVJ A;  5GAG J;  1LEB A;  1I39 A;  3J7Z I;  4RS8 A;  4WXC A;  3CO6 C;  2IA0 A;  4FCY A;  1SFU A;  4LOC A;  4LLN A;  1S7A A;  4UVA A;  2DK5 A;  1SD7 A;  1IUY A;  2PEX A;  4RAZ A;  2L01 A;  3DV8 A;  5F1R A;  3H9G A;  9ANT A;  1LDD A;  3M7G A;  2FEZ A;  3HKZ A;  2KL4 A;  5M5W J;  1G3Y A;  1U2W A;  1Z7U A;  1ZEL A;  4UV8 A;  1SC7 A;  2R93 J;  1YRN B;  4GXO A;  3V8K A;  1TTY A;  2MC4 A;  2X48 A;  2H1K A;  4XOR A;  1QGP A;  3DBL B;  2L7K A;  2LD5 A;  4ABZ A;  2CV2 A;  1G6N A;  2MGQ A;  2YX7 A;  3K70 D;  3ULQ B;  4RAF A;  4M3E A;  3S3N A;  1JGG A;  2ZXW H;  3QPT A;  2A6E F;  3K1P A;  1D0X A;  2EFN A;  4XNF A;  1ZHF A;  2KPM A;  2H1L A;  4DZJ A;  4PGH A;  1SVM A;  4LD5 A;  1K83 J;  4EEF G;  3ZQF A;  2PLY A;  2QBY A;  3HB9 A;  2ADU A;  3CTA A;  2EZK A;  4PFP A;  3OYK A;  3D0S A;  3F8B A;  3JAM K;  1GXP A;  4CYC B;  5LRR A;  2XPW A;  1ZH5 A;  2O8X A;  1RR7 A;  4XL9 A;  5FFZ A;  1VQ8 I;  4EAT A;  2H94 A;  1IDZ A;  4KIC A;  1QVT A;  1DGW Y;  4V2G A;  1FOW A;  1MBJ A;  1MNE A;  4BDY A;  1ZGJ A;  4N9I A;  4UB8 C;  3HGY A;  4BXU A;  5J1R A;  4OIP F;  3KP7 A;  2VC1 A;  4N9H A;  3LSM A;  5BMZ A;  2R92 J;  2M5W A;  4LJZ F;  3ZRG A;  3RZD J;  4YRV A;  4B1R A;  3HHH A;  3RJP A;  2W7N A;  3DLA A;  4PSX A;  2QSG X;  3BJA A;  4YFX F;  1HW1 A;  2K3P A;  5CVV A;  1XGM A;  2L7F P;  4XLH A;  1R1V A;  2XRO A;  2QCO A;  2GA1 A;  1V5G A;  2IRF G;  2Z2S B;  3FXR A;  2JRM A;  3C2G A;  2PG4 A;  1G8X A;  4ZZL A;  4KFC A;  3L7W A;  2PX9 A;  1JKO C;  2BOL A;  2DA2 A;  3IRR A;  3BWG A;  1G3T A;  1Q1H A;  2EB7 A;  3K7A J;  1IG7 A;  2HOS A;  4G7H F;  3FDY A;  1MJ9 A;  2F5V A;  3JRI A;  4BE1 A;  4NDL A;  3BR5 A;  3QAH A;  3M8F A;  3R4K A;  2DPD A;  2QYO A;  3K0L A;  5LLQ A;  4S04 A;  4LG0 B;  4BNC A;  3CO7 C;  5FLM J;  1IF1 A;  2LKP A;  1ZRC A;  3QU6 A;  1RPW A;  4AM3 A;  3CDH A;  2A6T A;  4HA8 A;  2AXL A;  2LTP A;  4DQ2 A;  4BQQ A;  2KZG A;  4P9F A;  2KFD A;  2DTR A;  3HOS A;  2VQL A;  4KNY A;  3E6D A;  1DPR A;  3DXJ F;  4LIV A;  2P5K A;  2YX4 A;  4X1E A;  1Y8R B;  3NRV A;  3VFZ A;  2M7B A;  2HYF A;  2EIJ H;  4CZC A;  3S1R J;  2DYR H;  2DI3 A;  1Q1V A;  1GV2 A;  2BY2 A;  3DWL E;  4M6Y A;  3CD6 I;  5LRS A;  1B8I A;  2I10 A;  2DQL A;  4A6D A;  4RB1 A;  1VF9 A;  2R7W A;  2ZB9 A;  2B9S A;  2LKX A;  1RNL A;  1J75 A;  2E1O A;  1ZG1 A;  2HI3 A;  2QF7 A;  1HKT A;  2G9W A;  1TL8 A;  1VND A;  4KJZ A;  3IP4 B;  2FOW A;  2XAJ A;  4UHT A;  3PJR A;  3E6M A;  2E19 A;  4RAG A;  4NUB A;  3A1Y A;  3C2B A;  1UCR A;  4CHU A;  2Y0S N;  1SD5 A;  3BG6 A;  3S2W A;  2OCC H;  4KUM A;  2ZXI A;  4XKB A;  3ECH A;  1HSJ A;  2KJC A;  2LK2 A;  1ZGA A;  3GFM A;  3QRF F;  1QO0 D;  3FXO A;  3TBI A;  1UJ8 A;  1QNT A;  2G0E A;  2XGE A;  3LSK A;  4OMZ A;  3KCC A;  2Y48 A;  4XID A;  1WCM J;  1ZG3 A;  1QZE A;  2WTE A;  4IRH A;  2VJ4 A;  5EEA A;  3JTG A;  2DMN A;  3E1S A;  1RRJ A;  2K9N A;  2R7X A;  2F5E A;  1KQ8 A;  1WVR A;  3BG3 A;  5FO5 A;  1ONV A;  2V26 A;  5CKT A;  4HNV A;  1S3J A;  1ZRE A;  2VKV A;  3ABK H;  4GFB A;  2F48 A;  1BOB A;  4RM2 A;  2LRD A;  3KP6 A;  1ZGW A;  1KZH A;  3F3X A;  3LMM A;  4LG0 A;  4RB3 C;  2IJL A;  1HDD C;  4L9V A;  3JRH A;  2X6Y A;  3FF5 A;  4CUG A;  4XQF A;  3KET A;  5BPD A;  2M7A A;  2CQ7 A;  4PUS A;  2KQR A;  5IYB J;  4D1Q A;  1IO2 A;  2VBW A;  4KIB A;  2VQH A;  3S2H J;  3HRS A;  1HKS A;  1JE8 A;  1UFM A;  3CJQ B;  1W1W E;  2MD0 A;  3RQ4 A;  2DOF A;  3K6G A;  3UNG C;  1JJ6 C;  3KEQ A;  1Z91 A;  2V1X A;  2YUS A;  3GW2 A;  3OS1 A;  3QOE A;  4HX7 A;  2PBI A;  2LKS A;  3L2U A;  5FKN A;  3J81 Z;  3R6S A;  2K9L A;  2XRL A;  4ON0 A;  3HTU A;  1Z21 A;  5IT9 K;  2VJJ A;  2COM A;  3GME A;  1DP3 A;  5IYC J;  1HKQ A;  1P7I A;  3RKY A;  4WF2 A;  3NEU A;  3LFK A;  2MAB A;  5J8C A;  1TQP A;  5JLW A;  1G3S A;  1WFX A;  2XB5 A;  2A6H F;  2DA6 A;  5JI6 A;  3R0J A;  4ESB A;  2JK3 A;  2K40 A;  1Z77 A;  3SFI A;  4I99 C;  5JHF A;  4C3J J;  4M74 A;  2ICW G;  4AIK A;  2OBP A;  1S9H A;  3DU6 A;  5HVQ C;  2GQQ A;  2DA4 A;  3F6V A;  3LSJ A;  2QSH X;  4HX8 A;  3FBN B;  3HKZ N;  1X4P A;  3VYU B;  1D0Z A;  2XSD C;  4FHT A;  1EKE A;  5FD5 A;  2PQ8 A;  3PM1 A;  2OPT A;  5KAF C;  1UEL B;  3H92 A;  4BDZ A;  4Q5S F;  1CF7 B;  2R7Z J;  3TW7 A;  1Z67 A;  2EFO A;  4H0E A;  3H0G J;  4L0Z B;  3S16 J;  3BR2 A;  5LGT A;  2DFH A;  1FT9 A;  2LDU A;  4HX4 A;  3OL4 A;  5JFR A;  1B9N A;  1RUN A;  3TKY A;  4E7Z A;  3L2V A;  1P7J A;  4CCN A;  3W6K B;  1LJ9 A;  1JUM A;  1MBE A;  1H88 C;  3NQO A;  4HPQ A;  3K4B A;  1B4A A;  3GTK J;  3C3W A;  3H9Q A;  1D0Y A;  1SAU A;  4HDU A;  1A5J A;  2W00 A;  2HKX A;  4ZYG A;  5IT3 A;  2K9Q A;  2KIS A;  2VBZ A;  2X85 A;  4ZTF A;  1BIB A;  3IH2 A;  4EV0 A; 
#chains in the Genus database with same CATH homology
 4XBF A;  2XAF A;  2K27 A;  3BPV A;  2FML A;  1U5T C;  1X3U A;  2JZY A;  2F5D A;  1XSV A;  1G4D A;  5A2Q Z;  1DP7 P;  4FX0 A;  5FD6 A;  3DPL C;  1MDM B;  5CYV A;  3N97 A;  3J80 K;  3IC7 A;  1K6O A;  1HW5 A;  3TQN A;  1C0W A;  4UVB A;  5CVU A;  3CUQ B;  1TLH B;  2ZME B;  3KLN A;  2MA3 A;  4RB2 C;  2VOP A;  2VC0 A;  5F6F A;  2P6S A;  3KZY A;  3E97 A;  2OQR A;  4ENN A;  2P6T A;  3GUD A;  1PP8 F;  2HWV A;  3EET A;  4HV6 A;  3KEO A;  5ED4 A;  3MWM A;  4M9X A;  4BHC A;  2WV0 A;  1TBX A;  4LK1 F;  1SFE A;  4B09 A;  2K4B A;  3LWF A;  1SMT A;  1STZ A;  2OZU A;  3BPX A;  1U78 A;  4EVI A;  4WX9 A;  3T1B A;  4A12 A;  2XAQ A;  1AOY A;  2NAZ A;  5DD4 A;  3SXY A;  2M87 A;  1TQI A;  1LVA A;  2CQK A;  2YSR A;  3TO6 A;  2UXN A;  2L54 A;  4IPA A;  4LFU A;  3HRU A;  5HDK A;  2PFB A;  1W4M A;  1IN8 A;  3T0Y A;  4RAY A;  2A68 F;  1MDM A;  5HS8 A;  4M73 A;  3BDD A;  3I59 A;  4JQF A;  3ABT A;  1OKR A;  2XAS A;  5JHU A;  1VTN C;  3T5X A;  1CGP A;  1F1Z A;  3CUQ A;  3IHU A;  3GFI A;  1FZP B;  4I01 A;  2UZK A;  4XLN F;  4EGY A;  3DFG A;  5H6Q A;  5FLX K;  1KU7 A;  3MQ0 A;  2F2E A;  2VE8 A;  4LLL A;  2E7W A;  4G94 A;  1Z1D A;  1PDN C;  4LK0 F;  4L5J A;  1O57 A;  1DDN A;  2G7H A;  3W6J B;  1U8R A;  4OIN F;  5LEK A;  1FPQ A;  3ZMU A;  2GWR A;  3V7S A;  2H6B A;  3BJ6 A;  5HS9 A;  1U3E M;  1UST A;  3G73 A;  2A5Y B;  2D1H A;  4AVP A;  4EJU A;  3ZPL A;  3GWZ A;  1F4K A;  4BHB A;  1R23 A;  3GVA A;  4CGZ A;  2XGX A;  1FP2 A;  2HKO A;  3I53 A;  3F23 A;  1JXS A;  1ZG5 A;  2HZT A;  1OYI A;  1LB2 A;  3ELK A;  2ZJ2 A;  3PQK A;  4XSX F;  5CJ9 A;  1UHW A;  3KP3 A;  3FWE A;  2AS5 F;  1FSE A;  4ASN A;  1XN7 A;  2VBX A;  1YW8 A;  2Y0M A;  2NNN A;  3ML6 A;  1S8N A;  3ZP5 A;  3SZP A;  4EJT A;  4U0W A;  2RGV A;  1AWC A;  4EJO A;  3LAP A;  3PQJ A;  2KRF A;  3F6O A;  1BOA A;  1MJA A;  2Z99 A;  3M1E A;  1I1G A;  1D5V A;  4EM1 A;  1P4W A;  2M30 A;  1IW7 F;  4IHS A;  2EV5 A;  3GX4 X;  4WXH A;  5BS6 A;  3HTS B;  4EJW A;  2W24 A;  4Y13 A;  2QBY B;  2DT5 A;  6PAX A;  3M8E A;  3N4M A;  1O3R A;  2VT3 A;  4Q4Z F;  4LLG F;  2OAZ A;  1KU2 A;  1IN6 A;  2ZXJ A;  4CO8 A;  2M45 A;  1QPM A;  2XAH A;  4L18 B;  4R79 A;  3WTX C;  2B0L A;  3T8R A;  3DQV C;  2ESH A;  1E17 A;  3QP5 A;  2H09 A;  1U6G A;  3HIF A;  4HLX A;  3HSF A;  2ISZ A;  3PFI A;  1WI9 A;  3FMQ A;  3DPT A;  2DAO A;  4HF1 A;  4YIF A;  2A69 F;  4TV7 A;  3EYI A;  2VOO A;  3GEZ A;  3LA3 A;  2OU2 A;  2FQ3 A;  4IVN A;  4BH9 A;  3FMR A;  4HQE A;  4KYW A;  2XUB A;  2HQN A;  1RIO H;  3F22 A;  3KP2 A;  3T8T A;  2PN6 A;  1IRF A;  1T2K A;  5DUK A;  5DDG A;  1JHF A;  5LBQ A;  3IWZ A;  1FBS A;  1V4R A;  1ZLJ A;  3SFZ A;  1F9N A;  2Q8K A;  3ZMD A;  2X0L A;  2M8E A;  2R7F A;  4L9T A;  2RDP A;  3ZMT A;  2MLK A;  2FNP A;  1R36 A;  3I58 A;  3V7R A;  4RGS A;  1L3L A;  5L3F A;  2CSO A;  3MEX A;  1R58 A;  4HV5 A;  3WTZ A;  5LHG A;  1XCV A;  2VXZ A;  1S7O A;  2LSO A;  2ETH A;  5DYM A;  3U2R A;  2A07 F;  3KP4 A;  3B02 A;  3H3Z A;  2STW A;  4U7B A;  2JT1 A;  3ZMZ A;  2JSC A;  3REO A;  5AON A;  2HOE A;  4LB5 A;  3GF2 A;  4IRG A;  3OOP A;  5BPI A;  3HRT A;  2VON A;  3BRO A;  3U9G A;  3P7N A;  1TNT A;  3SQN A;  1IRG A;  2QLZ A;  2EV0 A;  4G6Q A;  2IVM A;  4BHP A;  1MGT A;  2VBY A;  4M71 A;  3FXU A;  2G7U A;  1XSD A;  5ILV A;  2BGC A;  1SFX A;  2ESN A;  4KN4 X;  4WXD A;  3HOT A;  3JSO A;  4GYI A;  3ZMS A;  3TO7 A;  1H9T A;  3K2Z A;  1UB9 A;  1FYL A;  1FBQ A;  4ENK A;  1B59 A;  1O3S A;  1HST A;  3BZ6 A;  3K9T A;  5BQT A;  2A61 A;  2FRH A;  3V7C A;  2K4J A;  1KQ0 A;  2NYX A;  2EK5 A;  1WQ2 A;  1YTY A;  4GYG A;  2ZNZ A;  2GAU A;  2ZNY A;  4FT8 A;  3ECO A;  3P9C A;  2J5O A;  1SAX A;  4OIO F;  3HRM A;  5HS7 A;  3I71 A;  1MKM A;  4ZZD A;  5DV5 A;  4UUV A;  2J5P A;  4O6J A;  5CVI A;  2CGP A;  4R1H A;  3Q9S A;  2VN2 A;  5D8L B;  2RV8 A;  3WTY C;  1XDU A;  1T98 A;  5ICE A;  3EYY A;  4ZYH A;  2XKO A;  3WU0 A;  4UNO A;  4OOI A;  5ICG A;  1RUO A;  4F7Z A;  2JPB A;  3WOD F;  3WTT C;  2WWY A;  1W5S A;  5H20 A;  4HYE A;  4PZJ A;  2BV6 A;  5ICC A;  3EUH A;  2V6C A;  2F5C A;  5J6X A;  2CW0 F;  1LNW A;  2DW4 A;  4A0X A;  1LEA A;  3QP6 A;  4FX4 A;  5K5R A;  3EQL F;  3LA7 A;  2FE3 A;  2FBI A;  1FLI A;  3ISP A;  3QU3 A;  1IN7 A;  4K2E A;  3JAM Z;  2UXX A;  3I59 B;  4QLC U;  1OPC A;  4RGU A;  4S05 A;  2P8T A;  3RDI A;  1ULY A;  1ZRF A;  2KKO A;  2PI0 A;  4P96 A;  3IRQ A;  3CLO A;  3F21 A;  4I2O A;  1Z6T A;  3LA2 A;  3GFJ A;  2QQA A;  5JR3 A;  3I0T A;  1D8K A;  4IRI A;  3LQQ A;  4PCQ A;  4JBA A;  1XDS A;  5K1Y A;  2HS5 A;  2RVC A;  1E2X A;  5D5V B;  2L3D A;  2GZW A;  2MH2 A;  1O7F A;  2R7D A;  5L3G A;  5E1Z B;  3QOP A;  4OIQ F;  3SZT A;  2P7V B;  1YLF A;  2CWE A;  1D8J A;  3ERE D;  1J59 A;  4NHJ A;  2V9V A;  3ABU A;  1SMY F;  4L0Y B;  3WGG A;  3SHF A;  4ETS A;  4XRF A;  1Y0U A;  1LQ1 A;  4E70 A;  3GXO A;  3HSE A;  1D3Y A;  2P4W A;  3RKW A;  1YS6 A;  2PJP A;  1H9G A;  1I6X A;  3DKW A;  5TRD A;  1YYV A;  4Y17 A;  3C1D A;  3O3K A;  1HBX G;  3OV8 A;  4HW0 A;  2Z9O A;  2QM3 A;  1R7J A;  2YPR A;  4OU0 A;  4AWX B;  4KDP A;  3O2P E;  4HOB A;  3ZMV A;  3F8C A;  3L09 A;  4NQW A;  5FFX A;  4G7O F;  3FHZ A;  4HAM A;  2KIF A;  4YII A;  4WCG A;  5CVJ A;  2DPU A;  4RGX A;  1P92 A;  2MC3 A;  2V79 A;  4ESF A;  1RI7 A;  3WTV C;  2Q0O A;  3C7J A;  2W25 A;  2C6Y A;  3E5U A;  2IT0 A;  4AD9 A;  4YG2 F;  3FZV A;  3WTS C;  1KQ9 A;  2OA4 A;  5LGU A;  1KYZ A;  1R1T A;  2LF8 A;  5ILU A;  2FF4 A;  2FXA A;  3KFW X;  1NHA A;  1F5T A;  1BIA A;  3E5X A;  4P9U A;  5IT9 Z;  1YW7 A;  1FWZ A;  3AAF A;  3V8J A;  4P55 A;  2XV4 S;  4UVC A;  1ON1 A;  4XSZ F;  2P5V A;  4G7Z F;  4YFN F;  3RPQ A;  5E1X A;  1XGO A;  2FA5 A;  3K1M A;  4GCV A;  2QUF A;  2E1N A;  2XIG A;  3EDP A;  2DFI A;  2H6C A;  5J8F A;  2L02 A;  4MTE A;  3WGI A;  2RNJ A;  4BQA A;  4KIG A;  4OIR F;  2WC2 A;  5AIP A;  3TDU C;  1TW3 A;  2VT2 A;  3IL2 A;  1T0F A;  1IN4 A;  5L3D A;  1T6S A;  2W85 A;  1YS7 A;  1XMK A;  1IXS B;  1W7P A;  1XSX A;  1ZRD A;  1ZN2 A;  2ZKZ A;  1YQA A;  4KN7 X;  4MEX F;  3HHG A;  5L3E A;  4MTD A;  1R00 A;  1O3Q A;  1IZ1 A;  3FXQ A;  2STT A;  1FX7 A;  2X4H A;  4CZZ A;  1USS A;  1R5H A;  2RKH A;  1T38 A;  3J80 Z;  2XKP A;  5E20 A;  4HZF A;  2MLG A;  2D45 A;  3R60 A;  4ESJ A;  4M9S A;  2GXB A;  2NS0 A;  1J7K A;  4EJV A;  2QQ9 A;  1FBU A;  2O03 A;  4UXN A;  3LQR A;  4WK8 F;  4A5M A;  3F8F A;  4Q47 A;  2YR2 A;  4IHT A;  2IP2 A;  3HYI A;  3D5L A;  3R61 A;  2HEO A;  3J81 K;  5E1W A;  4N0B A;  4MQV A;  4EM0 B;  4HQM A;  5E8G A;  5D8K B;  2ISY A;  3Q9V A;  5DUI A;  2DK8 A;  3U1D A;  4G8X A;  4LMY A;  3VOE A;  3B73 A;  5JVT A;  1J9I A;  4Y15 A;  1S29 A;  2QZ8 A;  1FOK A;  2BE5 F;  1Z9C A;  1Z05 A;  2JTV A;  1P2F A;  5ICF A;  2HYG D;  5HLI A;  1JHH A;  2EWN A;  2DO7 A;  2ZO4 A;  1K7A A;  3DEU A;  2IW5 A;  4ZH4 F;  2F5F A;  4DNC A;  1IXC A;  2HDC A;  1P4A A;  2DBB A;  5ERI A;  2D1V A;  4ZYE A;  1QQI A;  4I0B A;  3VEP A;  3RIR A;  5K5Q A;  1BN5 A;  5A2Q K;  4ZYD A;  2EFP A;  1SD4 A;  4I02 A;  4L9J A;  5FLX Z;  2EV6 A;  1FY7 A;  4Z2Y A;  3KP5 A;  5BOX A;  1OMI A;  2M1B A;  3I64 A;  5CLS A;  1IAW A;  2KJB A;  4Q48 A;  1WKM A;  5FGM A;  2EJR A;  4HBL A;  2Z33 A;  3MCZ A;  1I27 A;  2DQR A;  5HDG A;  1K79 A;  4LGW A;  3BOQ A;  3ZQ7 A;  3FX3 A;  4CDG A;  3GO5 A;  1T39 A;  5D5W B;  2Q2E A;  2H27 A;  5FB2 A;  2EFW A;  4KMF A;  2BBY A;  3FM5 A;  2EFQ A;  3DF8 A;  2V1U A;  3E6B A;  5DCF A;  1O3T A;  2IA1 A;  3MFK A;  2W84 A;  4IJA A;  4CXF A;  2DU9 A;  1V3F A;  2E7X A;  1QBJ A;  2PMU A;  1MJB A;  2O3F A;  3R0A A;  5KK1 A;  2QQB A;  1FNN A;  3JSP A;  4B8X A;  2CG4 A;  4WWC A;  4A0Y A;  1WWX A;  5EEH A;  4U7D A;  2VE9 A;  3F72 A;  1I1S A;  4HDV A;  2LNB A;  1IXR C;  5D5X B;  1XGN A;  2FBK A;  2QEN A;  1DPU A;  3GYH X;  3L00 A;  2BYV E;  2Z3Y A;  1U5T B;  1H0M A;  1REP C;  2P7C B;  4M9Z A;  4A6E A;  4GO1 A;  1K78 B;  1FYM A;  3BJO A;  4KA4 A;  1J5Y A;  4QWQ A;  1P4X A;  1R5G A;  5AIQ A;  4RB0 A;  1YW9 A;  3KE2 A;  5E17 F;  2ZFW A;  1BI1 A;  3F8N A;  1KGS A;  1TW2 A;  1KA8 A;  4G6D A;  1KU3 A;  2QVO A;  4G9Y A;  5DD8 A;  3WE2 A;  5HLH A;  3GFL A;  4D0P A;  1PP7 U;  1XGS A;  4I0A A;  2E1C A;  1TNS A;  2A3S A;  2HGC A;  5D5U B;  2TDX A;  3E6C C;  2EA4 A;  3DP7 A;  2ZBK A;  2FNA A;  3GLX A;  2QWW A;  3L2C A;  4OMY A;  3GZ6 A;  3J7A O;  2XVC A;  1TQM A;  2O0Y A;  3FM3 A;  2ELH A;  4CYD A;  1EV7 A;  3MZH A;  2HFH A;  1MD0 A;  4EM2 A;  3I5U A;  4O3M A;  3JW4 A;  2KIU A;  3M9A A;  2VOD A;  2HQR A;  1LDJ A;  1ZAR A;  3MAJ A;  1U5T A;  4LB6 B;  2MH9 A;  3ZN1 A;  3ZN0 A;  1ON2 A;  3RTR A;  2GIV A;  1K78 A;  3P9I A;  3F8M A;  2ZCW A;  3WU1 B;  1HW2 A;  1I5Z A;  5D6F A;  4A2U A;  4MNU A;  4P5O A;  1EH6 A;  5KVR A;  1A04 A;  1BBY A;  5D6E A;  2FSW A;  1YG2 A;  5E18 F;  1YFH A;  1UHM A;  4JK1 X;  5LGN A;  2IPQ X;  2Y75 A;  2OZ6 A;  4R8H A;  1OYW A;  5DCM B;  3WE3 A;  2L4M A;  2K02 A;  5ILS A;  5F64 A;  1OR7 A;  3V8L A;  1W7P D;  3RKX A;  4HF2 A;  1BI3 A;  2V1D A;  3E5Q A;  3RYP A;  1IN5 A;  2CFX A;  4EMS A;  1J2X A;  1YO5 C;  4L9N A;  3RYR A;  2HTS A;  3I4P A;  1PUE E;  2FBH A;  2LF7 A;  4BYY A;  3TDZ C;  3RI4 A;  4PGG A;  5TJJ A;  1R22 A;  3VOD A;  1OYY A;  4A0Z A;  2K86 A;  1WSU A;  1CF7 A;  2PMH A;  2XRN A;  4M72 A;  3I54 A;  1MZB A;  3G3Z A;  4NB5 A;  4KMU X;  3TGN A;  2UWM A;  3H3U A;  1ZYR F;  4AIH A;  3LST A;  1KU9 A;  3GZ5 A;  5L3C A;  4O5V A;  2MBF A;  4IXA A;  3V4G A;  4KT5 C;  2OQG A;  4EQQ A;  4U0Y A;  4ENM A;  2D2W A;  1HXD A;  2EA2 A;  5DCM A;  3WG9 A;  2XAG A;  1SD6 A;  1W5T A;  4ENJ A;  5E8I A;  5HOO A;  3HSR A;  4CIC A;  2R3S A;  3CJN A;  1G3W A;  1BJA A;  2NRA C;  2DLL A;  2CYY A;  4MQ9 F;  4U88 A;  1FC3 A;  2O6G E;  1YIO A;  3TOB A;  4MHG A;  2XHK A;  5LHH A;  1XMA A;  1XCB A;  2ZME A;  1O7L A;  1B1B A;  1W7P B;  3TOA A;  4U0V A;  3P9K A;  3KZZ A;  3KLO A;  3CUQ C;  4HLY A;  5D4S A;  3CUO A;  2BEO A;  2RQP A;  3HUG A;  2FMY A;  4I7H A;  2JPC A;  4KIF A;  3WTU C;  3LAJ A;  4HF0 A;  1S6L A;  1QZY A;  1Z6R A;  1ZLK A;  5H6R A;  1P6R A;  1EH7 A;  2JRT A;  1FSH A;  2GA2 A;  2FOK A;  3E3V A;  4IF4 A;  3L9F A;  1BI2 A;  1DUX C;  3K69 A;  4MGR A;  5D4R A;  3COA C;  4PDK A;  5EEG A;  3IKV A;  2O61 A;  4BAY A;  5LHI A;  4MEY F;  1GHC A;  4M6X A;  2GXG A;  3O6B B;  4L5I A;  1WRJ A;  5LEJ A;  4XLP F;  2KIM A;  1FYK A;  4UV9 A;  2Z5U A;  1BC7 C;  1LDK B;  2OD5 A;  2CO5 A;  3VB2 A;  2HTJ A;  2RC4 A;  3TO9 A;  1XD7 A;  3QPH A;  3WGH A;  2P5L C;  1L0O C;  1HQC A;  4I09 A;  3IKT A;  1J0R A;  1QZZ A;  5HLG A;  2W57 A;  1ZAO A;  2L4A A;  2K7L A;  2FU4 A;  4I98 B;  3K1N A;  1BI0 A;  3MZY A;  4A5N A;  1KYW A;  1XB4 A;  1GXQ A;  3RPU A;  3ROU A;  1RZ4 A;  2HR3 A;  2ACJ A;  4EGZ A;  2MD5 A;  1FP1 D;  3BY6 A;  3IWF A;  5DEQ A;  5L3B A;  1BC8 C;  4AIJ A;  5HDN A;  3FMS A;  1BM9 A;  1JGS A;  3BP8 A;  1R1U A;  5CVR A;  4YFK F;  4GGG A;  4RGR A;  5K5O A;  1B9M A;  1EH8 A;  1ODD A;  2IA2 A;  1B6A A;  3Q5F A;  3JTH A;  3C18 A;  2RN7 A;  2YU3 A;  2NNY A;  3WTW C;  1GVJ A;  1LEB A;  4RS8 A;  4WXC A;  3CO6 C;  2IA0 A;  4LLN A;  1SFU A;  1S7A A;  4UVA A;  2DK5 A;  1SD7 A;  1IUY A;  2PEX A;  4RAZ A;  2L01 A;  3DV8 A;  5F1R A;  1LDD A;  3M7G A;  2FEZ A;  1G3Y A;  1U2W A;  1Z7U A;  4UV8 A;  4GXO A;  3V8K A;  1TTY A;  1QGP A;  1G6N A;  2YX7 A;  3ULQ B;  3QPT A;  2A6E F;  3K1P A;  2EFN A;  1ZHF A;  4PGH A;  4LD5 A;  2PLY A;  2QBY A;  2ADU A;  3CTA A;  3D0S A;  3F8B A;  3JAM K;  1GXP A;  5LRR A;  1ZH5 A;  2O8X A;  5FFZ A;  2H94 A;  4KIC A;  1ZGJ A;  4N9I A;  4BXU A;  4OIP F;  3KP7 A;  2VC1 A;  4N9H A;  5BMZ A;  2M5W A;  4LJZ F;  3HHH A;  3RJP A;  3BJA A;  4YFX F;  1HW1 A;  5CVV A;  1XGM A;  2XRO A;  1R1V A;  2GA1 A;  2IRF G;  3FXR A;  2PG4 A;  4ZZL A;  4KFC A;  3L7W A;  3IRR A;  3BWG A;  1G3T A;  1Q1H A;  2EB7 A;  4G7H F;  1MJ9 A;  3QAH A;  3M8F A;  3R4K A;  2DPD A;  2QYO A;  3K0L A;  5LLQ A;  4S04 A;  4LG0 B;  4BNC A;  3CO7 C;  1IF1 A;  2LKP A;  1ZRC A;  3QU6 A;  3CDH A;  4HA8 A;  2AXL A;  4DQ2 A;  4P9F A;  2DTR A;  3HOS A;  4KNY A;  3E6D A;  1DPR A;  3DXJ F;  2P5K A;  2YX4 A;  3NRV A;  3VFZ A;  2HYF A;  2DI3 A;  4M6Y A;  5LRS A;  2DQL A;  4A6D A;  4RB1 A;  1RNL A;  1J75 A;  1ZG1 A;  1HKT A;  2G9W A;  4UHT A;  2XAJ A;  3E6M A;  1UCR A;  4CHU A;  1SD5 A;  3S2W A;  4KUM A;  3ECH A;  1HSJ A;  2KJC A;  1ZGA A;  3GFM A;  3QRF F;  1QO0 D;  1QNT A;  4OMZ A;  3KCC A;  2Y48 A;  1ZG3 A;  2WTE A;  4IRH A;  3JTG A;  2F5E A;  1KQ8 A;  5FO5 A;  1ONV A;  1S3J A;  1ZRE A;  3KP6 A;  3F3X A;  4RB3 C;  4LG0 A;  2IJL A;  4L9V A;  3FF5 A;  5BPD A;  3KET A;  2VBW A;  4KIB A;  3HRS A;  1HKS A;  1JE8 A;  1UFM A;  3KEQ A;  1Z91 A;  2V1X A;  3GW2 A;  4HX7 A;  2PBI A;  3J81 Z;  3R6S A;  4ON0 A;  3HTU A;  5IT9 K;  2COM A;  1HKQ A;  3RKY A;  4WF2 A;  3NEU A;  3LFK A;  5J8C A;  1TQP A;  1G3S A;  5JI6 A;  2A6H F;  3R0J A;  4ESB A;  4M74 A;  4AIK A;  2OBP A;  5HVQ C;  2GQQ A;  3F6V A;  4HX8 A;  4FHT A;  5FD5 A;  2PQ8 A;  3H92 A;  4Q5S F;  1CF7 B;  2EFO A;  4H0E A;  4L0Z B;  5LGT A;  2LDU A;  1FT9 A;  4HX4 A;  5JFR A;  1B9N A;  1RUN A;  3TKY A;  3W6K B;  1LJ9 A;  3NQO A;  1B4A A;  3C3W A;  4HDU A;  2HKX A;  4ZYG A;  5IT3 A;  2VBZ A;  1BIB A;  4EV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...