2HWVA

Crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
SHMTIGDLTIHPDAYMVSKRGEKIELTHREFELLYYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPTYLVTRRGVGYYLRNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the response regulator VicR DNA-binding domain.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords DNA-binding response regulator VicR
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hwvA00
3P7NA 4IHSA 5LEKA 2P5LC 1MKMA 1IUYA 3VEPA 1SD7A 3ERED 2FF4A 1J2XA 4U0WA 5CLSA 1SFUA 1I1GA 2PEXA 1WWXA 4HLXA 3E6CC 2DPUA 3RJPA 4RB3C 2EV5A 3K2ZA 1K79A 5DEQA 2JPBA 3P9IA 5IT3A 2XKOA 2BGCA 1MGTA 3RYPA 2H09A 1SD5A 3GF2A 2Z99A 1VTNC 5HLIA 2FQ3A 5HS9A 1WSUA 3H3UA 4P5OA 4G9YA 3HOTA 3WE3A 5CVVA 3Q9SA 2ZBKA 3NQOA 2QLZA 2L3DA 5A2QK 4G7HF 4KIFA 1R23A 3IKTA 5L3DA 4EJWA 1DDNA 3FF5A 1WQ2A 5FD6A 4OIOF 2A6EF 2A07F 2V1XA 2IA2A 2Z33A 1XMAA 3F6VA 1HQCA 3BOQA 4DNCA 2V6CA 4ZYGA 4ON0A 1GXPA 1ON1A 3GEZA 3F72A 3SZTA 2MLKA 3WGHA 3PQKA 4LLLA 4LLNA 4UVBA 3FM3A 4AIHA 4WXHA 2FEZA 4Y13A 2X0LA 3R0JA 3HUGA 1P4AA 3T5XA 3O2PE 1O7LA 4ZZLA 1DPRA 3E6MA 3CDHA 2DW4A 4KDPA 4IRGA 2A69F 4Q47A 3MZHA 4KFCA 3MWMA 4I02A 4I09A 2M45A 2VXZA 4Q48A 1RZ4A 1ZGAA 3LA7A 3E5UA 1IN5A 4HOBA 3GFJA 1ZARA 4A0ZA 2GQQA 3KZYA 2PLYA 3BP8A 4B09A 1IF1A 3BJAA 4ESBA 4U7DA 4L9VA 1AOYA 2AXLA 3DQVC 1J59A 2DK5A 2RC4A 1STZA 1W7PA 1G3SA 1Q1HA 3FXRA 3WGIA 4IPAA 2QENA 5ILVA 4M72A 2KJCA 5CVRA 4IF4A 4RGUA 1T6SA 2FMLA 3KCCA 1XN7A 2MD5A 2Q0OA 3ZP5A 1R5GA 3BY6A 4M6YA 4YIIA 1HW2A 3QAHA 1KQ0A 3T0YA 2OD5A 1S29A 1W7PD 3ISPA 1XD7A 1JHHA 5CVUA 1REPC 2CO5A 2UXNA 1LDJA 4HW0A 3C1DA 4ZZDA 4AVPA 5IT9Z 1UHWA 1ZLJA 3HHGA 2D2WA 2LSOA 4MTEA 1ZRFA 1JXSA 3J81Z 1TLHB 3HRTA 4BYYA 3CUQC 3HTSB 5DD4A 1D8JA 4MTDA 4I98B 5CVIA 2W85A 5ILSA 3U2RA 1KYZA 1EV7A 5E17F 3LA2A 4HZFA 4R1HA 3T1BA 3W6JB 2QM3A 3CTAA 2ZXJA 4LB5A 2VE9A 3BZ6A 1FX7A 4YFKF 3M7GA 1CF7B 1MJ9A 5ED4A 2R3SA 5E1XA 2L02A 3LQQA 1BI1A 1BOAA 5LHGA 3JSPA 1LQ1A 2B0LA 3WGGA 2ZNZA 2HQNA 3E6BA 2CGPA 2M30A 3ZMDA 5CYVA 5KK1A 5E1ZB 3WU0A 2FU4A 1XCVA 3SQNA 2EFOA 3GVAA 2FE3A 1LDDA 2ZMEB 2GA2A 2AS5F 1ZG1A 4L0YB 2O3FA 2ZCWA 5L3EA 2CG4A 1IXCA 2HOEA 5LGTA 2XKPA 4B8XA 4YFNF 3E5QA 3IWZA 1LNWA 5D6FA 4HLYA 4YIFA 4KICA 4IHTA 5BQTA 1RUOA 1R5HA 3J81K 3GFMA 3F8BA 5DYMA 5E1WA 1B6AA 5HDKA 2QBYA 3WTUC 1A04A 1B4AA 3CJNA 2Z3YA 4FHTA 4R79A 3FX3A 2HTJA 2LF7A 3V7SA 4PGHA 2PJPA 2QBYB 3HSFA 2IJLA 1OMIA 1XGSA 4ETSA 5J8CA 4TV7A 1USSA 5HS8A 1JGSA 3QOPA 2JT1A 3EDPA 2A61A 1IN4A 4G94A 4KIGA 1OKRA 3ZMTA 3FWEA 1QBJA 4Z2YA 1TQMA 2CW0F 4MHGA 1ZREA 1SFXA 3SZPA 1ZLKA 1LJ9A 4M9SA 1K7AA 4K2EA 1QZYA 1D5VA 2Z9OA 2IA0A 2GA1A 3ABTA 2K4JA 4JK1X 4WXCA 1EH7A 2GXBA 3TO6A 5JFRA 2FOKA 3DEUA 1DUXC 3QP6A 2YU3A 1J0RA 3ECOA 4GYGA 1H0MA 2XUBA 3BWGA 5F64A 3ZN1A 4BXUA 5HOOA 1RI7A 4GGGA 4M6XA 3TOBA 3U9GA 1V4RA 3RPUA 1B9MA 2ISZA 3F22A 2CYYA 4DQ2A 4CGZA 3KEQA 4IRIA 2VT3A 2RDPA 3QU3A 4A5NA 2L4MA 4Y17A 5E8GA 4WX9A 1U5TC 3HRUA 2FBIA 3MFKA 1YW8A 1OYYA 2GWRA 4MNUA 4I7HA 1HSTA 3KE2A 3K9TA 3ELKA 1BI2A 2DPDA 4P9UA 4HA8A 4L5JA 1SFEA 1QNTA 4UV8A 5A2QZ 2Q2EA 3GZ6A 3KFWX 4XSXF 1O7FA 4EQQA 2RN7A 1XMKA 2CFXA 3L09A 1RUNA 1F9NA 3DPLC 3PQJA 2J5PA 4U88A 1HXDA 1BM9A 4KA4A 2VC1A 4D0PA 4I0BA 2P5KA 3I54A 4HX4A 1HW1A 1ZN2A 3K1PA 1H9TA 3FMRA 1O57A 2CSOA 3PFIA 4KMFA 4RB0A 3RKXA 4N0BA 1Y0UA 2BYVE 2NAZA 3FHZA 1R22A 4A2UA 3GW2A 5CJ9A 2ESHA 2XVCA 5ICGA 2G9WA 1SD4A 2YX4A 3VOEA 2VBXA 3KEOA 1W5SA 3W6KB 2O0YA 1ON2A 4LK0F 3HRMA 1ZRCA 2BEOA 3BJOA 3BROA 3HSEA 4A0YA 2JTVA 4OOIA 2F5FA 1FT9A 1O3QA 5BMZA 2OQRA 3ROUA 5FGMA 4O3MA 3JTHA 4LD5A 2K4BA 1I27A 1U6GA 3P9KA 2X4HA 1R1TA 3T8RA 2L4AA 5LGUA 3KLOA 2OAZA 4BQAA 2P8TA 3SFZA 5BPIA 1P2FA 2HFHA 2HYFA 1XCBA 1J75A 3WTWC 3M1EA 4P96A 2ISYA 3TQNA 3F21A 3KZZA 2R7DA 5L3BA 5EEGA 1W5TA 1YTYA 2Y75A 3RIRA 1YG2A 3KP3A 1FBQA 5L3FA 4NB5A 1JE8A 4ZH4F 3J80K 1KU9A 4AIKA 1FC3A 3FMQA 1P4XA 1L0OC 2XGXA 1R36A 3LAJA 4E70A 1DPUA 4ZYHA 1ZH5A 3MEXA 3KP5A 2K86A 4L0ZB 3HSRA 5LEJA 5ERIA 2VOOA 4U0VA 4ENJA 5ICFA 1KU2A 3LAPA 3HYIA 2XAQA 3R6SA 2W25A 2A5YB 3FXQA 2WV0A 3GFLA 1YO5C 1Z1DA 2NS0A 4A5MA 1IN8A 4EJVA 2EA4A 2WTEA 4O5VA 4BAYA 2A68F 1YS7A 1WRJA 1FNNA 2NNYA 1S6LA 3RYRA 4HQEA 5HVQC 5J8FA 4UVCA 4Y15A 3KP7A 4EJUA 1YW9A 2J5OA 1MJBA 5FLXZ 3LQRA 4M9ZA 2VONA 3GYHX 2VOPA 2O8XA 3E6DA 3DF8A 3I5UA 4R8HA 3C18A 3JSOA 4EM0B 1ZRDA 3VODA 4HF2A 2P7VB 5HDGA 1B1BA 1YFHA 4H0EA 2ELHA 2GZWA 1SMTA 5JI6A 4XSZF 1FSHA 4MQ9F 2FNPA 1J7KA 2BE5F 3I58A 1KGSA 2EB7A 4LJZF 3NEUA 2EV0A 4CDGA 2QQ9A 3QP5A 4RAYA 3TO7A 3QPTA 4BHBA 4KN4X 2QYOA 4YFXF 3GX4X 3ECHA 2W24A 4JBAA 2DQRA 2MBFA 1MD0A 5ICCA 4RB2C 2WC2A 3MAJA 4KN7X 3RI4A 4NQWA 1ODDA 2HKOA 4FT8A 2HEOA 3E97A 3F8FA 3IWFA 3KLNA 2DFIA 1S7OA 2RNJA 1UCRA 1HKTA 2PI0A 2MH9A 2EV6A 3BJ6A 3NRVA 2ADUA 4UXNA 4AWXB 3E3VA 4L9JA 2HWVA 2PQ8A 1XDSA 1KU7A 4HX8A 2GIVA 3JAMK 3IHUA 2K27A 4BNCA 3P9CA 3TOAA 2D1VA 3WTSC 1BI3A 4HQMA 2KJBA 4EJOA 4WWCA 4RB1A 5AIPA 3F8MA 4CYDA 4G6QA 2OZUA 4AIJA 2H6CA 4ESJA 4CHUA 1RIOH 1ZHFA 1BIAA 5D8LB 3BPVA 1O3SA 2XROA 3ZN0A 2DQLA 4QWQA 4IVNA 1FBUA 1KQ8A 3F8CA 2EFWA 1Z05A 3DKWA 4GYIA 4I0AA 4OIQF 1F4KA 5BS6A 2XASA 5L3GA 2XV4S 1R1UA 1S8NA 4LGWA 1GHCA 1F1ZA 3ZMSA 4ASNA 3N97A 1U78A 1CF7A 2VBYA 5LHHA 2GXGA 5D6EA 1SD6A 2M8EA 2HDCA 1HW5A 3DV8A 3BPXA 4A6EA 2F2EA 4WF2A 4LG0B 2JPCA 1TBXA 3K0LA 3K1NA 1T98A 3GUDA 5JR3A 2E1NA 3LFKA 5L3CA 2XAJA 4LMYA 4KT5C 4EM1A 4HX7A 4A12A 3MQ0A 1JHFA 2EA2A 2RQPA 4CZZA 1FPQA 2LNBA 3CUQB 3MZYA 1QGPA 3G73A 3EUHA 2MA3A 2IP2A 4HAMA 5D5UB 3VFZA 4XBFA 3QPHA 4ENKA 1LDKB 5ICEA 2E7WA 2PBIA 4HF1A 3GXOA 1IRGA 1HBXG 3K1MA 4ZYEA 3JAMZ 3FM5A 4MEYF 1Z7UA 1HKQA 4LK1F 5F6FA 1ZAOA 3B73A 2DT5A 1R1VA 2BBYA 4LLGF 3F3XA 5HLHA 1TNSA 5HDNA 1G3WA 2IPQX 4FX4A 5D5WB 2PMHA 3CUOA 5CVJA 3WTVC 5DCMA 3IC7A 1S3JA 2P6TA 2HYGD 1XSVA 2IW5A 5AONA 1IN6A 2Y0MA 3KP6A 2WWYA 2G7HA 3ZPLA 5EEHA 3VB2A 1CGPA 2ZJ2A 4OINF 5LRSA 2RVCA 3TO9A 3O3KA 5BPDA 2YSRA 3IRRA 2ESNA 2EJRA 1OPCA 2H94A 3LA3A 1Z91A 5DCFA 4HBLA 1S7AA 5FLXK 1PUEE 2W84A 3ZQ7A 4NHJA 5J6XA 3C3WA 3FMSA 1MZBA 3L7WA 4S04A 1G3YA 4G6DA 2QVOA 3WG9A 4OIPF 1YQAA 1R00A 1MJAA 3E5XA 4PZJA 1UFMA 1ONVA 5DUIA 1DP7P 2QUFA 3L9FA 4AD9A 1MDMB 3DPTA 2V1DA 4HV6A 4BH9A 4CO8A 1FSEA 1SAXA 2NYXA 3TDZC 4UVAA 4O6JA 1FYLA 1K78B 1G3TA 2ACJA 3T8TA 4HV5A 2RGVA 2KIMA 2FBKA 1P6RA 2HGCA 2EFNA 3ABUA 2FBHA 2XRNA 2YPRA 4HF0A 2Z5UA 1IXRC 4EJTA 3QU6A 3WTXC 2UXXA 1LVAA 1G6NA 4P9FA 5K5RA 4U7BA 4YG2F 1YLFA 3REOA 2D45A 6PAXA 5DD8A 1EH8A 3I59B 2ZO4A 5H6QA 1E2XA 4RAZA 1WKMA 4IXAA 2G7UA 4EM2A 3R4KA 3O6BB 2DAOA 4OU0A 1FYMA 2QQBA 4S05A 1PP8F 4N9HA 1HKSA 1LEAA 5D5VB 3MCZA 4CXFA 2KIFA 4FX0A 3K69A 3I53A 2HS5A 4M71A 1R7JA 3L2CA 2R7FA 3R0AA 1TW3A 3S2WA 1O3TA 1L3LA 2DK8A 1YYVA 3EYYA 5AIQA 1OYWA 1XDUA 1UB9A 2DTRA 3F6OA 1U8RA 4JQFA 2DLLA 2O03A 5HLGA 5LHIA 3RKWA 1BIBA 1XB4A 2K02A 1GXQA 3LSTA 3KP2A 1ZG5A 2V79A 1XGOA 1IZ1A 5FD5A 2DO7A 4GXOA 2FRHA 1XGNA 4LB6B 1FLIA 4UHTA 1W7PB 3ZMVA 4WXDA 2O61A 2W57A 1FOKA 1KQ9A 2HQRA 1G4DA 2ZNYA 4OMYA 1D8KA 1X3UA 2PG4A 3H3ZA 4GCVA 4LG0A 2MH2A 5K5OA 2V9VA 4OIRF 3B02A 1Z6RA 3AAFA 3OOPA 3I59A 5E18F 3CLOA 1U2WA 3I4PA 4M73A 3KETA 3WTTC 4L9TA 1J5YA 4I2OA 1IXSB 2ZFWA 1ZGJA 2EFPA 5E8IA 5JHUA 1U3EM 2QZ8A 5LBQA 1OYIA 3R61A 2KKOA 1HSJA 3QRFF 3GO5A 5H6RA 2FNAA 4PCQA 1IRFA 2XAGA 4Q5SF 3I71A 2P6SA 3FZVA 2M5WA 2P5VA 4MEXF 2XIGA 2KIUA 1T0FA 2VC0A 4M9XA 2F5DA 4BHPA 1NHAA 2M87A 3V8LA 4IRHA 2XAFA 3F8NA 4KNYA 4G8XA 2NRAC 1TQPA 5FB2A 2MC3A 2IVMA 3M9AA 2E7XA 2DI3A 4A0XA 2FA5A 1FY7A 2L01A 4HYEA 1KU3A 2HZTA 4MGRA 2GAUA 1SMYF 4BHCA 1I6XA 1J9IA 3RTRA 1IN7A 2YX7A 4ENNA 4I01A 2A3SA 2F5CA 3D0SA 1XSDA 3RPQA 2UZKA 2Y48A 3SHFA 4XLPF 2XHKA 5D8KB 1KA8A 1LEBA 5BOXA 5FO5A 1C0WA 2NNNA 1W4MA 3CO7C 2XAHA 3FXUA 4L9NA 2F5EA 3WTZA 2V1UA 2LKPA 5K5QA 3DFGA 2DBBA 3M8EA 1U5TA 3SXYA 2EWNA 5HS7A 3WU1B 3WTYC 3GWZA 1FZPB 1P4WA 4PGGA 2YR2A 4UV9A 3J80Z 1D3YA 3HIFA 4EMSA 1TQIA 4UUVA 3IRQA 1WI9A 4L5IA 2Q8KA 2QWWA 2PMUA 5KVRA 2FMYA 3TGNA 2BV6A 2A6HF 2PFBA 4N9IA 1ZYRF 3C7JA 3TDUC 1KYWA 1TW2A 3GZ5A 3V8KA 3N4MA 2STWA 3COAC 3ML6A 3DP7A 4F7ZA 1YIOA 1FP1D 4ENMA 1USTA 2VT2A 4OMZA 1I1SA 5DDGA 1O3RA 2C6YA 1RNLA 4EGYA 2P7CB 3ULQB 2HTSA 1YS6A 4G7OF 4KUMA 1FBSA 1ULYA 3EQLF 2EFQA 5DCMB 3LWFA 1GVJA 3KP4A 1V3FA 3EETA 5D4RA 4WCGA 4L18B 3EYIA 4KIBA 4EV0A 2RV8A 2JZYA 3V8JA 1XGMA 3M8FA 4KYWA 3H92A 2LF8A 2O6GE 3Q9VA 4IJAA 2EK5A 3HRSA 1FP2A 3RKYA 3V4GA 1QO0D 1B59A 2OA4A 2DU9A 5FFXA 2COMA 2JSCA 4LFUA 1T2KA 2KRFA 1T38A 3GFIA 4A6DA 2OZ6A 4QLCU 2HKXA 3I64A 3R60A 3ZMZA 1PP7U 2VBZA 4MQVA 3HOSA 2FSWA 5K1YA 3JW4A 3TKYA 3WODF 2OBPA 4XRFA 1B9NA 2QQAA 1Z9CA 4M74A 2IT0A 2FXAA 3HTUA 3D5LA 1IW7F 1BJAA 3J7AO 2UWMA 2VE8A 5ILUA 1K6OA 1IAWA 5IT9K 2PN6A 1P92A 1MDMA 4CICA 5DV5A 1R58A 2D1HA 1OR7A 3WE2A 2E1CA 2IA1A 1UHMA 5LGNA 2RKHA 3G3ZA 1BBYA 5D5XB 5H20A 1T39A 2P4WA 5LRRA 3RDIA 1QPMA 1YW7A 4HDUA 2VODA 2MLGA 2ZMEA 2K7LA 2IRFG 3F23A 1BC7C 2JRTA 4EGZA 3DXJF 5F1RA 2ETHA 1FYKA 1ZG3A 5E20A 3L00A 1K78A 2VN2A 1XSXA 4RGRA 3ZMUA 4WK8F 2HR3A 1E17A 1H9GA 3CUQA 1F5TA 2CWEA 1BN5A 2M1BA 5JVTA 3U1DA 1EH6A 2LDUA 3HHHA 4RS8A 2CQKA 4U0YA 2ZKZA 4XLNF 1Z6TA 3V7CA 4KMUX 5DUKA 1I5ZA 2H6BA 4RGSA 4EVIA 3V7RA 2STTA 3JTGA 4RGXA 4ESFA 1FWZA 3IL2A 1BI0A 2OQGA 3I0TA 4PDKA 1QZZA 5FFZA 4UNOA 1LB2A 1TNTA 2OU2A 5D4SA 5LLQA 4P55A 4GO1A 1AWCA 3CO6C 1TTYA 3Q5FA 3GLXA 2H27A 1U5TB 1PDNC 1QQIA 2TDXA 3BDDA 1BC8C 4Q4ZF 4G7ZF 4ZYDA 2L54A 2VBWA 3OV8A 5TJJA 5TRDA 3IKVA 4HDVA
chains in the Genus database with same CATH superfamily
3P7NA 2F5VA 3CLQA 4BQNA 4QPOA 4PK4A 4HNTA 4IHSA 5LEKA 2P5LC 1MKMA 2Y30A 1Y56A 1LUJB 3CJTB 2AO9A 1IUYA 4XLAA 3AL0B 3VEPA 1R49A 1SD7A 3BR2A 3ERED 1NG6A 3CF2A 3TEDA 2FF4A 4B1RA 2KRHA 1I3AA 1J2XA 1Y1VJ 4QIWN 3G71I 4FE4A 3JRAA 4U0WA 3RSNA 4RAGA 3CDIA 5CLSA 1SFUA 3QPSA 1I1GA 2PEXA 1WWXA 2V4JC 4II2A 3F9KA 4HLXA 3E6CC 2DPUA 3RJPA 4RB3C 2EV5A 3K2ZA 1K79A 3WG7H 1ETOA 5DEQA 2JPBA 2KMUA 3P9IA 5IT3A 2XKOA 5FROA 5E3MA 2BGCA 1YJNI 5IPAA 4UUSA 1MGTA 3RYPA 1VQ7I 2H09A 1SD5A 3GF2A 3HG9A 4IHWA 3VDXA 2Z99A 3L2UA 1VTNC 3PM1A 3I56I 5HLIA 3S1NJ 2FQ3A 5HS9A 1WSUA 1GUUA 3H3UA 4LIVA 4P5OA 5M3FJ 2E36A 2QSFX 4G9YA 2W7NA 3HOTA 4B48A 5J1YA 3WE3A 5CVVA 3Q9SA 2ZBKA 2IBDA 5GTHC 2HOTA 3D5SC 1UAAA 1XPXA 3NQOA 2QLZA 1AHDP 3CCQI 2L3DA 2MABA 5A2QK 4G7HF 4KIFA 3EUHC 5F04A 3C2HA 5FKMA 1R23A 3B6AA 1A35A 3IKTA 5L3DA 4EJWA 2JA2A 1OISA 1DDNA 3OYEA 4IZZA 3FF5A 2UV1A 1WQ2A 5FD6A 2HVRA 2A6EF 2FJ1A 4OIOF 2A07F 2K40A 2V1XA 1FOWA 2IA2A 4Y4RA 2Z33A 1XMAA 2DFHA 2V6EA 3F6VA 4XIDA 4FCYA 1W36C 1HQCA 2MC4A 1IRZA 3BOQA 4DNCA 2V6CA 4ZYGA 4ON0A 1GXPA 1Y8QB 2YUSA 1ON1A 3GEZA 3F72A 2EIKH 3SZTA 1GT0C 3BT9A 2MLKA 3WGHA 3PQKA 4LLLA 4LLNA 4UVBA 2M34A 3FM3A 1HA8A 4AIHA 1LFUP 4WXHA 2FEZA 4Y13A 2HI3A 4D7MA 2X0LA 3R0JA 4NBQA 1D1CA 3HGGA 4F3QA 5EDNA 3HUGA 4LOCA 4DBRA 1P4AA 3T5XA 2H8WA 2M8GX 3O2PE 1O7LA 1S9HA 1DPRA 4ZZLA 3E6MA 3CDHA 2X6OA 3DU5A 3GTQJ 1LKXA 2DW4A 4KDPA 4IRGA 2A69F 4Q47A 3MZHA 3S93A 3JRDA 4KFCA 3MWMA 4I02A 2WA0A 4I09A 4G12A 4X1EA 2M45A 2VXZA 4Q48A 1RZ4A 1ZGAA 3LA7A 3E5UA 1IN5A 1MMAA 4HOBA 5KHDA 1ETYA 1U9OA 2NOGA 3GFJA 3ZQIA 5EGOB 1MBGA 5DM7F 3BQZA 1MH4A 1T95A 1P7IA 1ZARA 4CCNA 4A0ZA 2GQQA 3KZYA 4Y3OA 1X19A 2PLYA 2JA7J 5F1JA 2JRMA 3OOUA 3EPZA 4UB6C 3CC2I 2CV2A 3BP8A 2LBFA 4B09A 1OQYA 3BJAA 1IF1A 4ESBA 3HOZJ 4U7DA 2P0WA 4L9VA 1AOYA 2AXLA 1X1AA 1YI2I 3DQVC 1J59A 1WJEA 2DK5A 3H0GJ 3PO3J 1MH3A 2RC4A 4E7ZA 1STZA 1W7PA 3TL4X 3A03A 2VB6A 3E0JB 1G3SA 3BR1A 1Q1HA 3M8JA 3FXRA 1FOXA 3WGIA 4IPAA 1ZR4A 3OL3A 3K4JA 2QENA 4HPQA 5ILVA 4M72A 2KJCA 4AUXA 1GV5A 5CVRA 4IF4A 3PJRA 1JT0A 4RGUA 2DFFA 1T6SA 2FMLA 3KCCA 3TBIA 1XN7A 2MD5A 2Q0OA 1ZELA 1K6YA 1RPWA 2DA3A 4MO7A 4F93B 4FTHA 3ZP5A 1QVUA 1R5GA 1R9TJ 3BY6A 4M6YA 4YIIA 1D0XA 1HW2A 3QAHA 1KQ0A 1QRYA 3PUFA 2EZHA 3T0YA 1YX5A 1IV6A 2OD5A 1S29A 1W7PD 2QQ8A 3ISPA 1QZEA 1XD7A 4A3KJ 3BZCA 1WCMJ 1JHHA 4HNVA 1ERDA 1VZ0A 1IUFA 2XDVA 2CW8A 4PFOA 5CVUA 1Y39A 1REPC 5JVGF 2M7BA 3GMEA 1SAUA 2CO5A 2UXNA 3UR3C 1LDJA 4A3MJ 4HW0A 3C1DA 4ZZDA 4D9JA 2EBIA 2R7ZJ 4DZPA 1EKEA 4AVPA 5IT9Z 1BJZA 1UHWA 2Y9YA 3M3YJ 2CW7A 1ZLJA 2CRGA 3HHGA 2D2WA 2LSOA 4MTEA 1ZRFA 1JXSA 1J09A 3IAM2 1TLHB 3Q0VA 3J81Z 3HRTA 3LSJA 4BE1A 1FTTA 4BYYA 1YITI 3CUQC 3KPHA 1PUFA 3HTSB 5DD4A 1APLC 4MTDA 3BR3A 1D8JA 1JUMA 1TWGJ 4I98B 4DBQA 3CJQB 5CVIA 4NUBA 1H88C 2W85A 5ILSA 4NC8A 3ZQQA 3U2RA 3SDBA 3X2QH 1T33A 3HOXJ 3H9GA 1KYZA 1EV7A 1X1PA 2VJIA 5E17F 3S16J 3V42A 3LA2A 4HZFA 4R1HA 2X6WA 2O5RA 3T1BA 1Z3YA 3J7AY 5FLMJ 2CUJA 2L7FP 1UELB 3W6JB 2HZDA 2QM3A 5B66C 2BVMA 3CTAA 3ZRGA 3CC4I 4UY8I 2ZXJA 4LB5A 2VE9A 3BZ6A 1FX7A 1QVTA 4YFKF 4BE2A 3VSKA 3M7GA 1CF7B 1MJ9A 5ED4A 2R3SA 3G1LA 5E1XA 1WH7A 3KYLA 2L02A 3G4SI 2R5YA 2M2EA 3LQQA 1BI1A 1BOAA 5CKTA 5LHGA 3PO2J 4JX4A 3BC8A 4M3GA 3JSPA 1OR7C 1LQ1A 2B0LA 3WGGA 2ZNZA 2HQNA 2HQ5A 3E6BA 4OWRB 2CGPA 2LK2A 2M30A 3ZMDA 2M7AA 3DBRB 3S1RJ 5CYVA 2VQCA 5E1ZB 5KK1A 3WU0A 4CUGA 2FU4A 1AA7A 1XCVA 4V19K 3SQNA 1FJLA 2EFOA 5K7ZA 1TWFJ 3VYTB 3RZDJ 3GVAA 2FE3A 1LDDA 4BEHA 2ZMEB 1BR4A 2KLOA 2XSDC 2GA2A 2AS5F 1ZG1A 1PVEA 3OIQA 4L0YB 1MW7A 1RC9A 2O3FA 2ZCWA 5L3EA 4IO9F 2CG4A 3BTCA 4BY1J 1YE9A 1IXCA 2Z1DA 2D5VA 4BEHB 4CCMA 2HOEA 2KRCA 5LGTA 2XKPA 3M4OJ 4XMYA 3FXLA 4B8XA 4YFNF 3E5QA 3IWZA 1LNWA 4I99C 5D6FA 4HLYA 2EZIA 4YIFA 4KICA 3L2WA 4IHTA 3HOUJ 3SYTA 3JREA 3DLLF 5BQTA 1R5HA 3OS1A 1R6RA 2V1NA 3J81K 1RUOA 3GFMA 4OAYA 1YRNA 3DBLB 1IDYA 3F8BA 2E34A 1DGWY 1LFBA 3ASNH 5DYMA 3HC7A 5E1WA 1B6AA 4X6AJ 2ZJRF 1SVOA 2BHYA 5HDKA 3CP8A 3GLLA 2OUMA 1NH3A 2NS8A 5F27A 1H89C 2QBYA 3WTUC 1VQPI 1A04A 2COBA 5KCMA 5F08A 1YX3A 2Q1ZB 1B4AA 3CJNA 2Z3YA 4FHTA 4R79A 3FX3A 2HTJA 3MKYB 2IS1A 2LF7A 1IDZA 3V7SA 4PGHA 2IS2A 2PJPA 3HSFA 2QBYB 2IJLA 1OMIA 3GTPJ 1XGSA 4ETSA 5J8CA 4TV7A 2W82A 1USSA 3K4NA 5HS8A 1TWAJ 1WJAA 5J3LA 3N05A 1JGSA 3QOPA 2HYJA 2JT1A 4UB8C 3EDPA 2A61A 1IN4A 4G94A 3MMYB 4KIGA 1OCZH 2Q2EB 1OKRA 5EJCA 3FWEA 2EQRA 3ZMTA 4YRVA 1QBJA 1YIJI 4Z2YA 1TQMA 2CW0F 4MHGA 3BR6A 1SFXA 1IGNA 1ZREA 3SZPA 1ZLKA 1LJ9A 2X9DA 4A3JJ 4M9SA 3RQIA 1GV2A 4K2EA 1K7AA 1ZTRA 3J7YJ 1QZYA 2XGEA 2DFEA 1D5VA 2Z9OA 2Y2ZA 3LL7A 2CQXA 3FKIJ 2IA0A 2Y69H 2GA1A 3ABTA 1FMVA 2K4JA 4BY7J 4JK1X 1B8IA 4WXCA 5B5EC 4C30A 3OY9A 1EH7A 2OF7A 2L0KA 3CDLA 2EIJH 2GXBA 3EUAA 3TO6A 1WI3A 2A5WA 5JFRA 1VI0A 2FQ4A 2FOKA 2VL8A 5EZGA 3DEUA 5M5XJ 1DUXC 3QP6A 2YU3A 1J0RA 3ECOA 4CSWA 4GYGA 2DA5A 2DJIA 1W1WE 1H0MA 2XUBA 3K2AA 3S3NA 1V5GA 3BWGA 5F64A 1Z0XA 3ZN1A 4BXUA 2QA4I 5F0FA 5HOOA 3FXMA 1K4SA 1RI7A 4GGGA 4M6XA 3TOBA 2ICWG 3HGYA 3U9GA 4IHXA 1V4RA 3RPUA 1B9MA 5CQGA 2ISZA 3F22A 2CYYA 3KYDB 4DQ2A 4CGZA 3LSHA 2EINH 4IQJA 3W2VA 2XRLA 3KEQA 4IRIA 2B63J 2VT3A 4BS9A 3CMEI 2RDPA 3QU3A 1G8XA 2LY2A 4A5NA 2L4MA 4Y17A 2CUZA 2WY7Q 5E8GA 4WX9A 1QHHD 2AQFA 1U5TC 3HRUA 2FBIA 1JT6A 3MFKA 1WJDA 3CC7I 4B4CA 1YW8A 2VLAA 1OYYA 2GWRA 4MNUA 1SC7A 3OR2C 4I76A 4ZC3A 4YEJA 4I7HA 3BCBA 1HSTA 2ZJPF 3KE2A 3K9TA 2CV1A 3ELKA 3K10A 5IYDJ 1BI2A 3U1KA 1UHSA 1ETKA 2M0CA 2M4KA 4P9UA 2DPDA 1Y1WJ 4HA8A 2E2HJ 4PUSA 4L5JA 3A1YA 3BG3A 1SFEA 1QNTA 2QF7A 4UV8A 5A2QZ 4XKVA 2Q2EA 3OSFA 3GZ6A 1VQ6I 2QSHX 2CQ7A 2Z16A 4IHYA 1SEUA 3KFWX 4XSXF 1O7FA 3VYSB 4EQQA 2V7FA 3Q0WA 2RN7A 1XMKA 3GTJJ 1OLTA 2CFXA 2LP0A 1O4XA 1CQTA 3L09A 1RUNA 1F9NA 2CMPA 3QQAA 3DPLC 3BTLA 3OIOA 4F91B 3PQJA 2B9SA 3GTOJ 2J5PA 4U88A 3S3MA 1HXDA 1BM9A 2EPFA 4KA4A 2VC1A 5DTDA 4D0PA 2PMZA 2E1OA 4I0BA 1F43A 5J4YA 2P5KA 3I54A 3S8PA 3U21A 4HX4A 1HW1A 1ZN2A 3K1PA 1H9TA 3FMRA 1O57A 3KYCB 2CSOA 5JLWA 3PFIA 2L9VA 4C9YA 4KMFA 4RB0A 3LNQA 3RKXA 4N0BA 3G6EI 1Y0UA 5EF6A 5H2FC 1BR2A 4PJLA 3FXJA 4DIQA 2BYVE 2NAZA 2F6CA 1JKRC 4RA2A 3FHZA 1R22A 4A2UA 3GW2A 5CJ9A 2ESHA 2XVCA 3K70C 4GFBA 5GP9A 5ICGA 2G9WA 3A2KA 3RPUD 1SD4A 2YX4A 3VOEA 2F48A 2CJJA 2VBXA 3KEOA 1W5SA 1AKHA 1X2NA 3W6KB 2O0YA 4CYCA 1TT0A 3JRGA 3GTKJ 1ON2A 1ETWA 4MFEA 4LK0F 3HRMA 3PFYA 1ZRCA 3BG5A 1W0UA 2BEOA 2GOXB 1YRNB 3BJOA 3BROA 3VYRB 3HSEA 4A0YA 1Y8RB 2JTVA 4OOIA 5IP6A 3MN2A 2F5FA 2DTZA 1FT9A 3JRIA 1O3QA 3H35A 1AKHB 5BMZA 2LKSA 3BR5A 2OQRA 3ROUA 2GOMA 4M3EA 5FGMA 3OYDA 4XN3A 4O3MA 3JTHA 3KEYA 4XRSA 4LD5A 2K4BA 3ABMH 2DDAA 1I27A 1MBJA 1U6GA 3OYLA 3OYFA 3P9KA 4AYBN 3ABKH 4CZCA 2X4HA 2K9LA 1R1TA 3T8RA 4M6VA 3PNVA 2L4AA 3VYUB 4DW6A 5LGUA 3KLOA 4DJAA 4XNFA 2DA1A 3FBIB 2JA6J 1VQOI 2OAZA 4BQAA 2P8TA 5EGOA 4Y7NJ 2A6TA 1OCRH 3SFZA 2K5CA 5BPIA 1P2FA 2HFHA 2R5ZA 2HYFA 5IYCJ 1XCBA 1J75A 3WTWC 3M1EA 4P1WA 4P96A 1JTYA 2ISYA 3TQNA 3F21A 3KZZA 2X48A 2R7DA 4C2UA 5L3BA 5EEGA 1W5TA 1YTYA 2Y75A 3RIRA 1YG2A 3KP3A 1FBQA 5L3FA 2R5YB 2IXSA 2JUGA 4NB5A 1JE8A 3BG9A 3IUOA 1RRJA 2IS4A 1BW6A 4ZH4F 3J80K 3BCAA 4AC0A 4XONA 5KAFC 1KU9A 4AIKA 1FC3A 2JVHA 3EUKL 3FMQA 1P4XA 2R7OA 3K4LA 1L0OC 1MNEA 2E1MC 3RCOA 5J1UA 2VPRA 2XGXA 5GAHJ 1R36A 3LAJA 4E70A 4C2TA 1DPUA 3SEZA 4ZYHA 1ZH5A 3MEXA 3KP5A 2K86A 4D7NA 4HEA2 4L0ZB 4OAZA 2EH3A 3JRHA 3HSRA 5LEJA 1UG0A 5ERIA 2VOOA 4U0VA 4ENJA 3LSRA 5ICFA 1KU2A 5C4XJ 3LAPA 3HYIA 4NC6A 1I6HJ 2XAQA 3R6SA 3VPRA 2W25A 3CZ6A 2A5YB 3FXQA 1LE8B 2DDBA 2WV0A 3GFLA 1YO5C 1Z1DA 3FISA 3A0HC 2HDWA 2NS0A 3AG3H 4JYKA 4A5MA 1IN8A 4EJVA 3QOEA 2BY0A 2EA4A 2X6YA 2RAEA 2WTEA 3DEWA 4O5VA 1WHUA 2GLOA 4BAYA 2A68F 3H9QA 1YS7A 5IP7J 2HVQA 2JA5J 4JP0A 1WRJA 4BBRJ 2BW3B 3K4BA 1FNNA 3IH4A 2NNYA 1S6LA 3RYRA 5EZHA 4HQEA 4C3JJ 3MZ8A 5HVQC 5J8FA 3PUBA 2ME6A 3QPLA 4UVCA 1BR1A 2R7UA 1WJBA 4Y15A 3KP7A 1FIPA 5J40A 4EJUA 2K9QA 1YW9A 2J5OA 4A3IJ 3K70D 4E7KA 1MJBA 4RM2A 5FLXZ 1ZK8A 2R7WA 4BE0A 2NOJB 2ZXHA 3LQRA 4M9ZA 3MKWB 3FDYA 3RQ4A 2VONA 3H5NA 3ZOBA 1N25A 3GYHX 1HC8A 2VQGA 1W5CC 3A01B 2VOPA 1B72A 2O8XA 3E6DA 3ZQHA 1VNDA 3DF8A 3I5UA 1ZR2A 4R8HA 3W6VA 3C18A 3I4NJ 1D0YA 3ONQA 2R7VA 3JSOA 4EM0B 2XF7A 5M5YJ 2BXZA 2X1DA 1ZRDA 3VODA 4E7HA 1A5JA 4HF2A 2P7VB 2BY1A 2MG4A 5HDGA 3C2BA 1B1BA 4II3A 1YFHA 4H0EA 2ELHA 2GZWA 4BJ5C 1SMTA 5JI6A 1MMGA 4XSZF 1FSHA 2MFZA 3HM5A 4MQ9F 3DKYA 2FNPA 2DOAA 2HOAA 1XTAA 3HPHA 1R4MB 1HDPA 1J7KA 2BE5F 3I58A 1KGSA 2EB7A 2L7ZA 2VKEA 4LJZF 3NEUA 2EV0A 5JHFA 4CDGA 2QQ9A 3QP5A 4RAYA 3TO7A 3QPTA 4BHBA 2UUZA 1N78A 5HODA 4MIMA 3SDGA 4KN4X 4JX6A 3AG4H 1RKTA 2QYOA 3H0DA 4YFXF 3GX4X 3ECHA 1XS9A 2NVYJ 2W24A 1HF0A 3FK6A 4JBAA 2DQRA 2MBFA 1MD0A 2MSYA 2LG4A 5ICCA 5IP9J 4RB2C 2DA7A 2WC2A 3OYAA 2DN0A 3MAJA 4YIRX 4KN7X 1K83J 5E79C 3RI4A 4NQWA 4E6KG 1EJ9A 2KZGA 1ODDA 1A6IA 2HKOA 4KISA 2JA8J 4FT8A 4M3FA 3MD2A 3E97A 2HEOA 1YOVB 2R5ZB 2X6XA 3WU2C 3ZQLA 3F8FA 3IWFA 4A69C 3KLNA 2XF5A 3AKZA 2DFIA 1S7OA 4IEJA 4UUTA 4HSRA 4DYRA 2RNJA 1UCRA 2ECBA 1JI8A 5DS9A 1HKTA 2PI0A 2MH9A 2EV6A 3CCEI 4L5EA 2BOLA 3BJ6A 1I39A 2E5NA 3ESWB 3NRVA 2ADUA 4UXNA 4AWXB 2ZFUA 3HOYJ 3E3VA 4L9JA 2R7RA 2HWVA 2PQ8A 4XLHA 2OTLI 1XDSA 1KU7A 4HX8A 2GIVA 3JAMK 3IHUA 2K27A 4BNCA 2KPMA 3HB9A 3PNTA 1LE8A 3P9CA 4M3BA 1MBEA 3TOAA 2JSPA 2D1VA 1ETQA 3WTSC 1BI3A 4HQMA 4RLQA 2KJBA 4EJOA 4WWCA 2ELKA 1VQ5I 2ZXIA 1E3OC 2G0EA 2V9PA 3IH3A 3PNYA 2CFOA 4RB1A 5AIPA 3CD6I 3F8MA 4CYDA 4G6QA 1S72I 1W36D 3HEFA 2OZUA 4AIJA 2H6CA 2X85A 5BNGA 4ESJA 4CHUA 1RIOH 1ZHFA 1BIAA 5D8LB 1Q1VA 2AHQA 3BPVA 1O3SA 4XOPA 2OJED 2HPMA 2XROA 3ZN0A 2DQLA 2RQQA 4QWQA 4IVNA 3ZGKA 1FBUA 1IG7A 1KQ8A 3F8CA 2TRTA 5B3SH 2EFWA 3OMYA 1Z05A 3DKWA 4GYIA 4I0AA 4Y52J 2OCCH 4OIQF 4IL6C 1F4KA 5BS6A 2XASA 2DXIA 5L3GA 2K3FA 2XV4S 1I50J 4F55A 4ZTFA 1R1UA 5FKLA 3OYNA 1DU0A 2KDZA 1S8NA 4LGWA 1GHCA 1F1ZA 4BJTA 4V2FA 3GTGJ 3ZMSA 4ASNA 3SJMA 2JUCA 3N97A 1U78A 1CF7A 2VBYA 2HOSA 2R7QA 5LHHA 5CPRB 2GXGA 2L2OA 1SD6A 5D6EA 1WGXA 2Z2SB 2M9HA 2M8EA 2HDCA 3LFUA 3NWSA 1HW5A 3DV8A 3BPXA 2QSGX 4A6EA 2VJ4A 2F2EA 3DWLE 4WF2A 3ZR8X 4LG0B 2JPCA 5J4VA 1WZ2A 1TBXA 1JKOC 2DMNA 3K0LA 1I3QJ 4RLFA 3JR9A 1T56A 3K1NA 1RETA 2ELJA 1GDTA 1T98A 3GUDA 3OS0A 3S2DJ 3M1CA 5JR3A 2E1NA 4A93J 3LFKA 4RAFA 1Z3XA 1S5LC 4FE7A 2XAJA 5L3CA 2WAQA 4LMYA 2K9MA 2WAEA 4KT5C 4EM1A 5HNHA 1Z77A 4HX7A 4CH7A 4A12A 3MQ0A 1JHFA 3Q0UA 2EA2A 2RQPA 4CZZA 1FPQA 2LNBA 3CUQB 3MZYA 1QGPA 4C3HJ 3G73A 3HXLA 2YS9A 2W1OA 3EUHA 2MA3A 2IGNA 3BLYA 4XQFA 4W97A 2JN6A 2OTJI 2I8DA 4JOMA 2DMTA 2IP2A 1X1BA 3O8HA 4HAMA 4ANJA 5D5UB 3D1NI 5M5WJ 3I9V2 1IV8A 3VFZA 2JQ7A 1Y6IA 4XBFA 3QPHA 4ENKA 1LDKB 5ICEA 2E7WA 2PBIA 3FBNB 4HF1A 3GXOA 3QWLA 2ZB9A 1HBXG 1IRGA 2E19A 1POGA 1EF4A 3K1MA 2VXDA 4ZYEA 3JAMZ 2DOEA 2NVXJ 3L2QA 3FM5A 1SVMA 4MEYF 3HDDA 3Q3SA 1Z7UA 1HKQA 4LK1F 5F6FA 4B43A 3LSGA 4HRIA 1ZAOA 3K4KA 3IH2A 4BL0B 3B73A 2DT5A 2HU9A 1JJ6C 1R1VA 2BBYA 4LLGF 3I3LA 3A02A 1RR8C 4KJZA 3F3XA 5HLHA 1Z67A 2DOFA 2QEXI 1TNSA 5HDNA 2HXOA 2AXTC 1G3WA 2IPQX 1ORKA 4FX4A 5D5WB 1ZGWA 2PMHA 3CUOA 1MMDA 2LD5A 2CUEA 5CVJA 4J01A 2ZXWH 3WTVC 2CQNA 2LC2A 1V54H 4JX5A 5DCMA 3H36A 3TP0A 3IC7A 4V2GA 2JVGA 5E3LA 1S3JA 2P6TA 2HYGD 1XSVA 2IW5A 2WBMA 1IN6A 5AONA 2Y0MA 2DCEA 3KP6A 2WWYA 1VQLI 4FETA 2G7HA 4CCOA 3ZPLA 2FD5A 5EEHA 3F0CA 3H1CA 2K3PA 3VB2A 1CGPA 4A3DJ 2ZJ2A 5KNLA 4OINF 5LRSA 3VWBA 2HQAA 2RVCA 4XRMA 3TO9A 3CCSI 4FISA 3O3KA 3I55I 3GZNB 1OCOH 5BPDA 2YSRA 5J1RA 1SVLA 3IRRA 3AG1H 4G6TB 2ESNA 4NNJA 4X0GA 2EJRA 4HNUA 2GIZA 1D1AA 1OPCA 5IYBJ 2H94A 3LA3A 3DTIA 2VKVA 3UKGA 1YHQI 1Z91A 5DCFA 4HBLA 3PSFA 1S7AA 3PSIA 5FLXK 1TP4A 1PUEE 3FHNA 2W84A 3ZQ7A 2BY2A 5F0CA 4NHJA 5J6XA 1RESA 3CCUI 3OS2A 3C3WA 3FMSA 1MZBA 2QKLB 3L7WA 5KAIC 1N75A 5FJ8J 4S04A 1G3YA 4J19A 4G6DA 4XLFA 2QVOA 2KFDA 3BG6A 2KISA 2Y0SA 3DEEA 4AIDA 3WG9A 2L9RA 4OIPF 2XC7A 1YQAA 1R00A 1MJAA 3E5XA 4PZJA 1UFMA 4A3EJ 3HOWJ 2M3AA 2WADA 3CMMA 1ONVA 1X1DA 3LSIA 5DUIA 1DP7P 2CU7A 2QUFA 2WB1A 3L9FA 4AD9A 2N8GA 3D5RC 1MDMB 3DPTA 2V1DA 1PYVA 3L2VA 4HV6A 1VFCA 4NDLA 4BH9A 4CO8A 4DOZA 5HNFA 2K9SA 1WH5A 1JJ8C 1FSEA 4BQOA 1SAXA 2F4IA 3QYFA 4GDFA 1WJ5A 1RKWA 2NYXA 3TDZC 4UVAA 4ZTJA 1MBHA 4O6JA 2ZMEC 2MD0A 2IGKA 1FYLA 5K7HA 1K78B 1G3TA 2ACJA 1TL8A 3T8TA 5FRNA 4HV5A 4H4KC 4BACA 2CQQA 1MIJA 5J47A 4C2MJ 2RGVA 2R7TA 2M4GA 2LY1A 2XGDA 4Z6YA 2KIMA 1V55H 1WVRA 3CMAI 2LVSA 2FBKA 4XLCA 1P6RA 1OCCH 2HGCA 2EFNA 3ABUA 2FBHA 4KT6A 2XRNA 4PSXA 4E7LA 1XMXA 4F52A 1NK2P 2YPRA 4HF0A 1PJRA 2Z5UA 1IXRC 1HDDC 3PL8A 3K7AJ 4EJTA 3FK7A 3QU6A 3DTKA 3WTXC 2UXXA 2LKXA 1LVAA 1G6NA 2XF6A 4P9FA 5TISC 1UJ8A 4BJ6C 3ZXSA 2F4MB 5K5RA 1X3ZB 2WY8Q 1JGGA 2LMDA 3OYGA 2L7KA 4U7BA 3ASOH 2M0MA 2DA6A 3OL4A 4YG2F 2KHMA 3HJEA 1YLFA 2DMPA 4ZDOA 3REOA 4A3GJ 2D45A 5GADJ 3CCVI 3BR0A 6PAXA 2IEKA 4E7JA 5DD8A 1EH8A 2DJNA 2JWTA 2ZO4A 3I59B 5H6QA 1MNDA 1E2XA 4RAZA 1WKMA 4IXAA 2G7UA 3QODA 4Y33A 4EM2A 3J7ZI 1EA3A 2X51A 3R4KA 4E7SA 2KT0A 3O6BB 2DAOA 1X4OA 4OU0A 2NVUB 1VQKI 2LFBA 1FYMA 3W2WA 2QQBA 4S05A 1PP8F 2LY9A 2WV1A 4N9HA 1HKSA 1LEAA 4LIUA 5D5VB 1FOYA 1ZQ3P 3OYCA 3MCZA 4CXFA 4IOCF 2KIFA 3QYBA 4FX0A 3K6GA 4HSTA 1YJWI 2VJ5A 2KQRA 1SFKA 2FOWA 4RM3A 4IHVA 3K69A 4BU2A 3L2RA 3SEQA 3I53A 4NQWB 4AVZA 3S15J 2HS5A 1VQNI 3FIWA 4M71A 4XKCA 1R7JA 4A3BJ 2LREA 3AFHA 4XOTA 3HL2A 3L2CA 2R7FA 2E35A 3R0AA 3CMYA 4RBOA 2JK3A 1TW3A 3S2WA 1O3TA 1L3LA 2DK8A 1YYVA 3HUGB 1FTZA 3JCUC 4UUSB 3OSGA 3EYYA 1DU6A 5AIQA 3S14J 2MGQA 1OYWA 2HXIA 2ZSHB 1XDUA 3CCMI 1UB9A 4BDZA 2DTRA 3W3CA 2BW3A 2PMZN 1KZHA 3TMOA 1E0EA 2W00A 1V5EA 3F6OA 4JQFA 1U8RA 2DLLA 2O03A 1KONA 1X58A 4CCJA 5HLGA 3KIOA 5LHIA 2KL4A 3S17J 3RKWA 2L9SA 1BIBA 3GTMJ 1JKPC 1XB4A 2K02A 1GXQA 1BOBA 2PX9A 1MBKA 3LSTA 3KP2A 4ITVA 1ZG5A 1S7EA 2V79A 4XORA 1JUSA 1XGOA 1IZ1A 3K4MA 1VQ9I 5FD5A 2DO7A 1IJWC 4GXOA 2LBFB 3H3VK 1FIAA 1UG2A 2FRHA 2OV7A 3OYJA 2R7SA 2JJ7A 1XGNA 4LB6B 2LTPA 1FLIA 4UHTA 4AM3A 1HOMA 1W7PB 4I6ZA 3E7LA 1B8IB 3BTJA 2EILH 1ZKGA 3ZMVA 2QKMB 4WXDA 5DM6F 2O61A 2W57A 1BL0A 1FOKA 1KQ9A 3PIPF 2LR8A 5CQEA 4IOAF 1SFOJ 2HQRA 1G4DA 3BG7A 2ZNYA 3HZJA 4OMYA 1D8KA 4XK4A 1A36A 4A3CJ 4QPQA 2EZLA 2Y31A 1Z21A 5FKKA 1X3UA 2PG4A 3H3ZA 3CF5F 1JKQC 5GPAA 1MMNA 1QU3A 4GCVA 1TWHJ 4LG0A 2MH2A 3LOCA 5K5OA 1R71A 2LRDA 2V9VA 1TT5B 4ZYAA 4OIRF 5F0HA 2MW8A 3B02A 1Z6RA 2VQHA 3AAFA 2ID3A 3OYBA 3OOPA 3I59A 1OJLA 5E18F 3S1MJ 2DODA 3CLOA 1VQ8I 1U2WA 3I4PA 4M73A 3KETA 1P9QC 5FKNA 3WTTC 3OWTA 1UMQA 3CCYA 3RZOJ 4PJJA 4L9TA 1J5YA 3BQYA 1Y0NA 4I2OA 1IXSB 3MKZA 2ZFWA 1ZGJA 2EFPA 3LSKA 5E8IA 2LOOA 2K85A 5JHUA 1U3EM 2QZ8A 5LBQA 4BKXA 1OYIA 3R61A 2KKOA 2CH0A 1HSJA 4E4HA 2VASA 4N4NB 3GO5A 3QRFF 1BA5A 5H6RA 4XLEA 2FNAA 4PCQA 2XPUA 4F92B 5EEAA 1IRFA 2ECCA 4M3DA 3ERMA 2H1KA 2XAGA 2L5QA 3UNGC 4LITA 4Q5SF 2KZVA 3I71A 1U9NA 5E3NA 5FLVA 4B3XA 2CS3A 1R4NB 2P6SA 3FZVA 2M5WA 3K4CA 2P5VA 4MEXF 2XIGA 2KIUA 1ETXA 3HKZA 2OPTA 3H5AA 1T0FA 1U8BA 3TP3A 2VC0A 3FKJA 4M9XA 2DA4A 1BW5A 2VI6A 2F5DA 4BHPA 1NHAA 4IQ4A 2M87A 3V8LA 4BQQA 4IRHA 1X2MA 2XAFA 3F8NA 3SZGA 4KNYA 3E1SA 4EATA 4G8XA 5IOZA 2NRAC 4C3IJ 1TQPA 2O7OA 5FB2A 3CCJI 2MC3A 2IVMA 3M9AA 3OYIA 2E7XA 4AU7A 4D1QA 1B72B 4A3FJ 3A01A 2DI3A 3NWTA 4A0XA 3OR1C 4B3AA 2FA5A 5IOYA 2GM4A 5IY5H 1FY7A 2L01A 3LSPA 3KZIC 1A31A 4HYEA 1KU3A 2Y9ZA 1T08B 2HZTA 4BGDA 4MGRA 1F36A 1VQMI 3KX2A 3IP4B 2RREA 2O9LA 3DCFA 3AG2H 3OYKA 4D5FA 1WFXA 1SMYF 2GAUA 3TW6A 5C44J 1M1EB 1NK3P 2IGOA 1NG7A 1D1BA 2E2IJ 4BHCA 1I6XA 4BXFA 3JRFA 1J9IA 3RTRA 1IN7A 2YX7A 1Z7LA 4XKBA 2E71A 4ENNA 4I01A 1GVDA 2A3SA 1K61A 2F5CA 3D0SA 1XSDA 1ENHA 3RPQA 2UZKA 5JLXA 2Y48A 3SHFA 2DMUA 1T8IA 4XLPF 1LVKA 2V9KA 2XHKA 3DU6A 5D8KB 1KA8A 4XL9A 5C3EJ 4BXXJ 1LEBA 4U87A 5BOXA 5FO5A 1C0WA 2IS6A 2NNNA 1W4MA 3CO7C 2XAHA 3FXOA 2XSJC 3FXUA 4XKWA 2KDOA 3ZQFA 4L9NA 2OC6A 2F5EA 3WTZA 2V1UA 2LKPA 5K5QA 3DFGA 2R93J 3IAS2 2W48A 1TC3C 2DBBA 3LMMA 3M8EA 4PJNA 1U5TA 1K4TA 4PFPA 2GXAA 2K9NA 3SXYA 5FRMA 3H5RA 1MBFA 2AQEA 2EWNA 5HS7A 3WU1B 3G2BA 3WTYC 3GWZA 1FZPB 1P4WA 4PGGA 2YR2A 4UV9A 3J80Z 1X1CA 1WJCA 2GBYA 4EEFG 1D3YA 3M07A 1ACIA 4XR6A 1LPQA 3VSLA 3HIFA 4FQGA 4E7IA 1H8AC 1G2HA 4EMSA 1TQIA 9ANTA 4D5CA 4UUVA 1XC5A 1QHGA 1XG1A 1HLVA 3IRQA 3A4CA 1WI9A 3G1OA 4CCKA 4L5IA 2Q8KA 2QWWA 3W2AA 3DPUA 1UZCA 1U0JA 2PMUA 5KVRA 4S0HB 2FMYA 3TGNA 4XM3A 4QTRA 2HDDA 3S2HJ 2BV6A 1D5YA 2A6HF 2PFBA 4N9IA 1ZYRF 3C7JA 3TDUC 2VUMJ 2DMQA 1LFPA 1KYWA 1TW2A 1D0ZA 3GZ5A 3IV5A 4J00A 3V8KA 3N4MA 3GBGA 3LSMA 2STWA 4B47A 1E3HA 3ML6A 5LFAA 3COAC 4BDYA 3DP7A 4F7ZA 3MKLA 1YIOA 1FP1D 4ENMA 1W0TA 1USTA 2WAQN 2VT2A 4OMZA 2VQLA 3GCMA 2E60A 2EIMH 4RMNA 1I1SA 2R0QC 5GPCA 5GAGJ 5DDGA 1O3RA 2C6YA 1RNLA 4EGYA 2P7CB 4AYBA 5HLTA 3ULQB 2HTSA 1YS6A 3HOVJ 1V5FA 4G7OF 4KUMA 1FBSA 1ULYA 3EQLF 1E3PA 1TWCJ 1VF9A 2EFQA 3CCRI 2NS7A 2XB0X 2VPLA 2X1EA 5DCMB 3LWFA 1GVJA 4IKFA 3KP4A 3OIPA 1DP3A 1V3FA 4DGWB 3EETA 2BVLA 2HVSA 5D4RA 2QGUA 2XPVA 4WCGA 2FUG2 4L18B 3S3OA 3EYIA 4PJ0C 4KIBA 4EV0A 4NC7A 1IRXA 2RV8A 1JUPA 2JZYA 2WB1N 3V8JA 1XGMA 3S32A 3M8FA 4KYWA 4DYCA 4N4OB 3GTLJ 4A3LJ 2ME0A 3H92A 2LF8A 2KP6A 2YU9J 2O6GE 3Q9VA 2R4GA 2EK5A 4IJAA 1MMSA 3FXKA 3HRSA 1FP2A 3RKYA 3V4GA 4ABZA 2OCEA 2BY3A 3ABLH 1QO0D 1NTCA 1B59A 2OA4A 4MLOA 1A6QA 2DU9A 3I4MJ 3OYMA 5FFXA 2COMA 2JSCA 3DTEA 3G1MA 2CV0A 4LFUA 1TZLA 2HNHA 1T2KA 2KRFA 1T38A 3GFIA 5B1BH 4A6DA 1VQ4I 1AU7A 2OZ6A 3PIOF 3RKQA 4QLCU 3NARA 2HKXA 4ZDPA 2I5UA 1ITYA 4QSHA 1WPKA 5LD2C 3I64A 1IC8A 2TCTA 2LYCA 1MSEC 3R60A 3ZMZA 1PP7U 5EYRA 2L7MP 2VBZA 4MQVA 1XX5A 3TW7A 2E1MB 1MNMC 2ZSIB 3HOSA 2CUFA 1N77A 2FSWA 5K1YA 1WJFA 3JW4A 5FKOA 3TKYA 2HPIA 4CA0A 3WODF 2OBPA 2WAFA 2DYSH 1G59A 2LH9A 4KITB 3WHCA 2I10A 2NVTJ 4XRFA 1B9NA 2QQAA 4HG2A 1Z9CA 3OYHA 5TGTA 1QPIA 4M74A 2L9NA 3JRCA 2IT0A 3ZQCA 2VKDA 2LLKA 2Y0SN 2FXAA 3CESA 4BUPA 3HTUA 3D5LA 3AL0C 1P7JA 3NAUA 3S1QJ 3QYEA 2X1CA 5K7FA 1IW7F 1BJAA 3HBLA 3CJRB 3J7AO 2UWMA 1GLNA 2EZKA 2VE8A 2B7EA 5ILUA 1K6OA 1YJ9I 1IAWA 5IT9K 5M3MJ 4IX7A 5GTIC 2PJRB 4RDUA 3WHBA 4XICA 2O8KA 2PN6A 2RNGA 1DGRM 1P92A 1MDMA 3C2GA 3HKZN 4CICA 5DV5A 4XRSG 3L1PA 1R58A 2D1HA 1OR7A 3WE2A 2E1CA 1PUFB 1HCRA 2XB5A 2DA2A 5EG0B 2IA1A 3BZKA 1UHMA 5LGNA 2RKHA 3G3ZA 1BBYA 5D5XB 5H20A 4FASD 1T39A 2P4WA 2PJRA 1SANA 5LRRA 4CCLA 5GAEJ 4W1UA 3DBHB 3RDIA 2ID6A 1QPMA 2VJJA 4ZJZA 1YW7A 4ZDLA 2BHZA 1IO2A 3ZQGA 5E3OA 4CYCB 4HDUA 2VODA 3A0BC 2MLGA 2P81A 2ZMEA 2K7LA 3ZCOA 2IRFG 3F23A 1BC7C 2JRTA 3JRBA 3DXJF 4EGZA 3SFIA 5F1RA 2ETHA 1FYKA 2BZTA 1X3WB 1ZG3A 3B6CA 5E20A 1DQUA 3L00A 2BXYA 2DT7B 1K78A 2VN2A 1XSXA 2XPWA 4RGRA 4DZJA 2R92J 4PJMA 2E2JJ 3ZMUA 4WK8F 2KIQA 1T0FC 2HR3A 1R5ID 1H9GA 1E17A 1FEXA 3CUQA 1F5TA 5EG0A 2CWEA 3MVPA 1JTXA 1BN5A 3CQZJ 2M1BA 4XN0A 5JVTA 3U1DA 3DKXA 1EH6A 2LDUA 1FMWA 3HHHA 4RS8A 3O8GA 4BBSJ 1OCPA 2CQKA 4U0YA 2ZKZA 1RR7A 4XLNF 1Z6TA 2MYSA 3V7CA 3H9JA 2R7XA 4KMUX 2NXNB 5DUKA 3P5JA 1I5ZA 2FX0A 2H6BA 4MFDA 4RGSA 4EVIA 3V7RA 2STTA 2H1LA 2V26A 1OCTC 4PSWA 2E5ZA 4YELA 3JTGA 4RGXA 4LG3A 4ESFA 5C4JJ 1FWZA 1BI0A 2XGCA 2OQGA 3I0TA 4PDKA 3IL2A 1QZZA 5FFZA 4UNOA 1LB2A 4DYQA 1TNTA 3HPGA 1OFCX 2OU2A 5D4SA 5LLQA 4P55A 2IGMA 4GO1A 2VIXA 1AWCA 1QA6A 3CO6C 1TTYA 2DT6A 3Q5FA 2H8RA 3BTIA 2XAUA 3GLXA 2VKHA 2H27A 1U5TB 1PDNC 1QQIA 2TDXA 2NVQJ 2DYRH 3BDDA 4B44A 1ETVA 2QCOA 3CP2A 1BC8C 4Q4ZF 3DLAA 1X4PA 4G7ZF 4ZYDA 2L54A 4GRIA 2IAIA 2ZC2A 2VBWA 3OV8A 5B1AH 1MSFC 5TJJA 5TRDA 2A05A 2ZJQF 2JMWA 2W4SA 3IKVA 4HDVA 2F4OB 3CCLI
chains in the Genus database with same CATH topology
3P7NA 4IHSA 5LEKA 2P5LC 1MKMA 1IUYA 3VEPA 1SD7A 3ERED 2FF4A 1J2XA 4U0WA 5CLSA 1SFUA 1I1GA 2PEXA 1WWXA 4HLXA 3E6CC 2DPUA 3RJPA 4RB3C 2EV5A 3K2ZA 1K79A 5DEQA 2JPBA 3P9IA 5IT3A 2XKOA 2BGCA 1MGTA 3RYPA 2H09A 1SD5A 3GF2A 2Z99A 1VTNC 5HLIA 2FQ3A 5HS9A 1WSUA 3H3UA 4P5OA 4G9YA 3HOTA 3WE3A 5CVVA 3Q9SA 2ZBKA 3NQOA 2QLZA 2L3DA 5A2QK 4G7HF 4KIFA 1R23A 3IKTA 5L3DA 4EJWA 1DDNA 3FF5A 1WQ2A 5FD6A 4OIOF 2A6EF 2A07F 2V1XA 2IA2A 2Z33A 1XMAA 3F6VA 1HQCA 3BOQA 4DNCA 2V6CA 4ZYGA 4ON0A 1GXPA 1ON1A 3GEZA 3F72A 3SZTA 2MLKA 3WGHA 3PQKA 4LLLA 4LLNA 4UVBA 3FM3A 4AIHA 4WXHA 2FEZA 4Y13A 2X0LA 3R0JA 3HUGA 1P4AA 3T5XA 3O2PE 1O7LA 4ZZLA 1DPRA 3E6MA 3CDHA 2DW4A 4KDPA 4IRGA 2A69F 4Q47A 3MZHA 4KFCA 3MWMA 4I02A 4I09A 2M45A 2VXZA 4Q48A 1RZ4A 1ZGAA 3LA7A 3E5UA 1IN5A 4HOBA 3GFJA 1ZARA 4A0ZA 2GQQA 3KZYA 2PLYA 3BP8A 4B09A 1IF1A 3BJAA 4ESBA 4U7DA 4L9VA 1AOYA 2AXLA 3DQVC 1J59A 2DK5A 2RC4A 1STZA 1W7PA 1G3SA 1Q1HA 3FXRA 3WGIA 4IPAA 2QENA 5ILVA 4M72A 2KJCA 5CVRA 4IF4A 4RGUA 1T6SA 2FMLA 3KCCA 1XN7A 2MD5A 2Q0OA 3ZP5A 1R5GA 3BY6A 4M6YA 4YIIA 1HW2A 3QAHA 1KQ0A 3T0YA 2OD5A 1S29A 1W7PD 3ISPA 1XD7A 1JHHA 5CVUA 1REPC 2CO5A 2UXNA 1LDJA 4HW0A 3C1DA 4ZZDA 4AVPA 5IT9Z 1UHWA 1ZLJA 3HHGA 2D2WA 2LSOA 4MTEA 1ZRFA 1JXSA 3J81Z 1TLHB 3HRTA 4BYYA 3CUQC 3HTSB 5DD4A 1D8JA 4MTDA 4I98B 5CVIA 2W85A 5ILSA 3U2RA 1KYZA 1EV7A 5E17F 3LA2A 4HZFA 4R1HA 3T1BA 3W6JB 2QM3A 3CTAA 2ZXJA 4LB5A 2VE9A 3BZ6A 1FX7A 4YFKF 3M7GA 1CF7B 1MJ9A 5ED4A 2R3SA 5E1XA 2L02A 3LQQA 1BI1A 1BOAA 5LHGA 3JSPA 1LQ1A 2B0LA 3WGGA 2ZNZA 2HQNA 3E6BA 2CGPA 2M30A 3ZMDA 5CYVA 5KK1A 5E1ZB 3WU0A 2FU4A 1XCVA 3SQNA 2EFOA 3GVAA 2FE3A 1LDDA 2ZMEB 2GA2A 2AS5F 1ZG1A 4L0YB 2O3FA 2ZCWA 5L3EA 2CG4A 1IXCA 2HOEA 5LGTA 2XKPA 4B8XA 4YFNF 3E5QA 3IWZA 1LNWA 5D6FA 4HLYA 4YIFA 4KICA 4IHTA 5BQTA 1RUOA 1R5HA 3J81K 3GFMA 3F8BA 5DYMA 5E1WA 1B6AA 5HDKA 2QBYA 3WTUC 1A04A 1B4AA 3CJNA 2Z3YA 4FHTA 4R79A 3FX3A 2HTJA 2LF7A 3V7SA 4PGHA 2PJPA 2QBYB 3HSFA 2IJLA 1OMIA 1XGSA 4ETSA 5J8CA 4TV7A 1USSA 5HS8A 1JGSA 3QOPA 2JT1A 3EDPA 2A61A 1IN4A 4G94A 4KIGA 1OKRA 3ZMTA 3FWEA 1QBJA 4Z2YA 1TQMA 2CW0F 4MHGA 1ZREA 1SFXA 3SZPA 1ZLKA 1LJ9A 4M9SA 1K7AA 4K2EA 1QZYA 1D5VA 2Z9OA 2IA0A 2GA1A 3ABTA 2K4JA 4JK1X 4WXCA 1EH7A 2GXBA 3TO6A 5JFRA 2FOKA 3DEUA 1DUXC 3QP6A 2YU3A 1J0RA 3ECOA 4GYGA 1H0MA 2XUBA 3BWGA 5F64A 3ZN1A 4BXUA 5HOOA 1RI7A 4GGGA 4M6XA 3TOBA 3U9GA 1V4RA 3RPUA 1B9MA 2ISZA 3F22A 2CYYA 4DQ2A 4CGZA 3KEQA 4IRIA 2VT3A 2RDPA 3QU3A 4A5NA 2L4MA 4Y17A 5E8GA 4WX9A 1U5TC 3HRUA 2FBIA 3MFKA 1YW8A 1OYYA 2GWRA 4MNUA 4I7HA 1HSTA 3KE2A 3K9TA 3ELKA 1BI2A 2DPDA 4P9UA 4HA8A 4L5JA 1SFEA 1QNTA 4UV8A 5A2QZ 2Q2EA 3GZ6A 3KFWX 4XSXF 1O7FA 4EQQA 2RN7A 1XMKA 2CFXA 3L09A 1RUNA 1F9NA 3DPLC 3PQJA 2J5PA 4U88A 1HXDA 1BM9A 4KA4A 2VC1A 4D0PA 4I0BA 2P5KA 3I54A 4HX4A 1HW1A 1ZN2A 3K1PA 1H9TA 3FMRA 1O57A 2CSOA 3PFIA 4KMFA 4RB0A 3RKXA 4N0BA 1Y0UA 2BYVE 2NAZA 3FHZA 1R22A 4A2UA 3GW2A 5CJ9A 2ESHA 2XVCA 5ICGA 2G9WA 1SD4A 2YX4A 3VOEA 2VBXA 3KEOA 1W5SA 3W6KB 2O0YA 1ON2A 4LK0F 3HRMA 1ZRCA 2BEOA 3BJOA 3BROA 3HSEA 4A0YA 2JTVA 4OOIA 2F5FA 1FT9A 1O3QA 5BMZA 2OQRA 3ROUA 5FGMA 4O3MA 3JTHA 4LD5A 2K4BA 1I27A 1U6GA 3P9KA 2X4HA 1R1TA 3T8RA 2L4AA 5LGUA 3KLOA 2OAZA 4BQAA 2P8TA 3SFZA 5BPIA 1P2FA 2HFHA 2HYFA 1XCBA 1J75A 3WTWC 3M1EA 4P96A 2ISYA 3TQNA 3F21A 3KZZA 2R7DA 5L3BA 5EEGA 1W5TA 1YTYA 2Y75A 3RIRA 1YG2A 3KP3A 1FBQA 5L3FA 4NB5A 1JE8A 4ZH4F 3J80K 1KU9A 4AIKA 1FC3A 3FMQA 1P4XA 1L0OC 2XGXA 1R36A 3LAJA 4E70A 1DPUA 4ZYHA 1ZH5A 3MEXA 3KP5A 2K86A 4L0ZB 3HSRA 5LEJA 5ERIA 2VOOA 4U0VA 4ENJA 5ICFA 1KU2A 3LAPA 3HYIA 2XAQA 3R6SA 2W25A 2A5YB 3FXQA 2WV0A 3GFLA 1YO5C 1Z1DA 2NS0A 4A5MA 1IN8A 4EJVA 2EA4A 2WTEA 4O5VA 4BAYA 2A68F 1YS7A 1WRJA 1FNNA 2NNYA 1S6LA 3RYRA 4HQEA 5HVQC 5J8FA 4UVCA 4Y15A 3KP7A 4EJUA 1YW9A 2J5OA 1MJBA 5FLXZ 3LQRA 4M9ZA 2VONA 3GYHX 2VOPA 2O8XA 3E6DA 3DF8A 3I5UA 4R8HA 3C18A 3JSOA 4EM0B 1ZRDA 3VODA 4HF2A 2P7VB 5HDGA 1B1BA 1YFHA 4H0EA 2ELHA 2GZWA 1SMTA 5JI6A 4XSZF 1FSHA 4MQ9F 2FNPA 1J7KA 2BE5F 3I58A 1KGSA 2EB7A 4LJZF 3NEUA 2EV0A 4CDGA 2QQ9A 3QP5A 4RAYA 3TO7A 3QPTA 4BHBA 4KN4X 2QYOA 4YFXF 3GX4X 3ECHA 2W24A 4JBAA 2DQRA 2MBFA 1MD0A 5ICCA 4RB2C 2WC2A 3MAJA 4KN7X 3RI4A 4NQWA 1ODDA 2HKOA 4FT8A 2HEOA 3E97A 3F8FA 3IWFA 3KLNA 2DFIA 1S7OA 2RNJA 1UCRA 1HKTA 2PI0A 2MH9A 2EV6A 3BJ6A 3NRVA 2ADUA 4UXNA 4AWXB 3E3VA 4L9JA 2HWVA 2PQ8A 1XDSA 1KU7A 4HX8A 2GIVA 3JAMK 3IHUA 2K27A 4BNCA 3P9CA 3TOAA 2D1VA 3WTSC 1BI3A 4HQMA 2KJBA 4EJOA 4WWCA 4RB1A 5AIPA 3F8MA 4CYDA 4G6QA 2OZUA 4AIJA 2H6CA 4ESJA 4CHUA 1RIOH 1ZHFA 1BIAA 5D8LB 3BPVA 1O3SA 2XROA 3ZN0A 2DQLA 4QWQA 4IVNA 1FBUA 1KQ8A 3F8CA 2EFWA 1Z05A 3DKWA 4GYIA 4I0AA 4OIQF 1F4KA 5BS6A 2XASA 5L3GA 2XV4S 1R1UA 1S8NA 4LGWA 1GHCA 1F1ZA 3ZMSA 4ASNA 3N97A 1U78A 1CF7A 2VBYA 5LHHA 2GXGA 5D6EA 1SD6A 2M8EA 2HDCA 1HW5A 3DV8A 3BPXA 4A6EA 2F2EA 4WF2A 4LG0B 2JPCA 1TBXA 3K0LA 3K1NA 1T98A 3GUDA 5JR3A 2E1NA 3LFKA 5L3CA 2XAJA 4LMYA 4KT5C 4EM1A 4HX7A 4A12A 3MQ0A 1JHFA 2EA2A 2RQPA 4CZZA 1FPQA 2LNBA 3CUQB 3MZYA 1QGPA 3G73A 3EUHA 2MA3A 2IP2A 4HAMA 5D5UB 3VFZA 4XBFA 3QPHA 4ENKA 1LDKB 5ICEA 2E7WA 2PBIA 4HF1A 3GXOA 1IRGA 1HBXG 3K1MA 4ZYEA 3JAMZ 3FM5A 4MEYF 1Z7UA 1HKQA 4LK1F 5F6FA 1ZAOA 3B73A 2DT5A 1R1VA 2BBYA 4LLGF 3F3XA 5HLHA 1TNSA 5HDNA 1G3WA 2IPQX 4FX4A 5D5WB 2PMHA 3CUOA 5CVJA 3WTVC 5DCMA 3IC7A 1S3JA 2P6TA 2HYGD 1XSVA 2IW5A 5AONA 1IN6A 2Y0MA 3KP6A 2WWYA 2G7HA 3ZPLA 5EEHA 3VB2A 1CGPA 2ZJ2A 4OINF 5LRSA 2RVCA 3TO9A 3O3KA 5BPDA 2YSRA 3IRRA 2ESNA 2EJRA 1OPCA 2H94A 3LA3A 1Z91A 5DCFA 4HBLA 1S7AA 5FLXK 1PUEE 2W84A 3ZQ7A 4NHJA 5J6XA 3C3WA 3FMSA 1MZBA 3L7WA 4S04A 1G3YA 4G6DA 2QVOA 3WG9A 4OIPF 1YQAA 1R00A 1MJAA 3E5XA 4PZJA 1UFMA 1ONVA 5DUIA 1DP7P 2QUFA 3L9FA 4AD9A 1MDMB 3DPTA 2V1DA 4HV6A 4BH9A 4CO8A 1FSEA 1SAXA 2NYXA 3TDZC 4UVAA 4O6JA 1FYLA 1K78B 1G3TA 2ACJA 3T8TA 4HV5A 2RGVA 2KIMA 2FBKA 1P6RA 2HGCA 2EFNA 3ABUA 2FBHA 2XRNA 2YPRA 4HF0A 2Z5UA 1IXRC 4EJTA 3QU6A 3WTXC 2UXXA 1LVAA 1G6NA 4P9FA 5K5RA 4U7BA 4YG2F 1YLFA 3REOA 2D45A 6PAXA 5DD8A 1EH8A 3I59B 2ZO4A 5H6QA 1E2XA 4RAZA 1WKMA 4IXAA 2G7UA 4EM2A 3R4KA 3O6BB 2DAOA 4OU0A 1FYMA 2QQBA 4S05A 1PP8F 4N9HA 1HKSA 1LEAA 5D5VB 3MCZA 4CXFA 2KIFA 4FX0A 3K69A 3I53A 2HS5A 4M71A 1R7JA 3L2CA 2R7FA 3R0AA 1TW3A 3S2WA 1O3TA 1L3LA 2DK8A 1YYVA 3EYYA 5AIQA 1OYWA 1XDUA 1UB9A 2DTRA 3F6OA 1U8RA 4JQFA 2DLLA 2O03A 5HLGA 5LHIA 3RKWA 1BIBA 1XB4A 2K02A 1GXQA 3LSTA 3KP2A 1ZG5A 2V79A 1XGOA 1IZ1A 5FD5A 2DO7A 4GXOA 2FRHA 1XGNA 4LB6B 1FLIA 4UHTA 1W7PB 3ZMVA 4WXDA 2O61A 2W57A 1FOKA 1KQ9A 2HQRA 1G4DA 2ZNYA 4OMYA 1D8KA 1X3UA 2PG4A 3H3ZA 4GCVA 4LG0A 2MH2A 5K5OA 2V9VA 4OIRF 3B02A 1Z6RA 3AAFA 3OOPA 3I59A 5E18F 3CLOA 1U2WA 3I4PA 4M73A 3KETA 3WTTC 4L9TA 1J5YA 4I2OA 1IXSB 2ZFWA 1ZGJA 2EFPA 5E8IA 5JHUA 1U3EM 2QZ8A 5LBQA 1OYIA 3R61A 2KKOA 1HSJA 3QRFF 3GO5A 5H6RA 2FNAA 4PCQA 1IRFA 2XAGA 4Q5SF 3I71A 2P6SA 3FZVA 2M5WA 2P5VA 4MEXF 2XIGA 2KIUA 1T0FA 2VC0A 4M9XA 2F5DA 4BHPA 1NHAA 2M87A 3V8LA 4IRHA 2XAFA 3F8NA 4KNYA 4G8XA 2NRAC 1TQPA 5FB2A 2MC3A 2IVMA 3M9AA 2E7XA 2DI3A 4A0XA 2FA5A 1FY7A 2L01A 4HYEA 1KU3A 2HZTA 4MGRA 2GAUA 1SMYF 4BHCA 1I6XA 1J9IA 3RTRA 1IN7A 2YX7A 4ENNA 4I01A 2A3SA 2F5CA 3D0SA 1XSDA 3RPQA 2UZKA 2Y48A 3SHFA 4XLPF 2XHKA 5D8KB 1KA8A 1LEBA 5BOXA 5FO5A 1C0WA 2NNNA 1W4MA 3CO7C 2XAHA 3FXUA 4L9NA 2F5EA 3WTZA 2V1UA 2LKPA 5K5QA 3DFGA 2DBBA 3M8EA 1U5TA 3SXYA 2EWNA 5HS7A 3WU1B 3WTYC 3GWZA 1FZPB 1P4WA 4PGGA 2YR2A 4UV9A 3J80Z 1D3YA 3HIFA 4EMSA 1TQIA 4UUVA 3IRQA 1WI9A 4L5IA 2Q8KA 2QWWA 2PMUA 5KVRA 2FMYA 3TGNA 2BV6A 2A6HF 2PFBA 4N9IA 1ZYRF 3C7JA 3TDUC 1KYWA 1TW2A 3GZ5A 3V8KA 3N4MA 2STWA 3COAC 3ML6A 3DP7A 4F7ZA 1YIOA 1FP1D 4ENMA 1USTA 2VT2A 4OMZA 1I1SA 5DDGA 1O3RA 2C6YA 1RNLA 4EGYA 2P7CB 3ULQB 2HTSA 1YS6A 4G7OF 4KUMA 1FBSA 1ULYA 3EQLF 2EFQA 5DCMB 3LWFA 1GVJA 3KP4A 1V3FA 3EETA 5D4RA 4WCGA 4L18B 3EYIA 4KIBA 4EV0A 2RV8A 2JZYA 3V8JA 1XGMA 3M8FA 4KYWA 3H92A 2LF8A 2O6GE 3Q9VA 4IJAA 2EK5A 3HRSA 1FP2A 3RKYA 3V4GA 1QO0D 1B59A 2OA4A 2DU9A 5FFXA 2COMA 2JSCA 4LFUA 1T2KA 2KRFA 1T38A 3GFIA 4A6DA 2OZ6A 4QLCU 2HKXA 3I64A 3R60A 3ZMZA 1PP7U 2VBZA 4MQVA 3HOSA 2FSWA 5K1YA 3JW4A 3TKYA 3WODF 2OBPA 4XRFA 1B9NA 2QQAA 1Z9CA 4M74A 2IT0A 2FXAA 3HTUA 3D5LA 1IW7F 1BJAA 3J7AO 2UWMA 2VE8A 5ILUA 1K6OA 1IAWA 5IT9K 2PN6A 1P92A 1MDMA 4CICA 5DV5A 1R58A 2D1HA 1OR7A 3WE2A 2E1CA 2IA1A 1UHMA 5LGNA 2RKHA 3G3ZA 1BBYA 5D5XB 5H20A 1T39A 2P4WA 5LRRA 3RDIA 1QPMA 1YW7A 4HDUA 2VODA 2MLGA 2ZMEA 2K7LA 2IRFG 3F23A 1BC7C 2JRTA 4EGZA 3DXJF 5F1RA 2ETHA 1FYKA 1ZG3A 5E20A 3L00A 1K78A 2VN2A 1XSXA 4RGRA 3ZMUA 4WK8F 2HR3A 1E17A 1H9GA 3CUQA 1F5TA 2CWEA 1BN5A 2M1BA 5JVTA 3U1DA 1EH6A 2LDUA 3HHHA 4RS8A 2CQKA 4U0YA 2ZKZA 4XLNF 1Z6TA 3V7CA 4KMUX 5DUKA 1I5ZA 2H6BA 4RGSA 4EVIA 3V7RA 2STTA 3JTGA 4RGXA 4ESFA 1FWZA 3IL2A 1BI0A 2OQGA 3I0TA 4PDKA 1QZZA 5FFZA 4UNOA 1LB2A 1TNTA 2OU2A 5D4SA 5LLQA 4P55A 4GO1A 1AWCA 3CO6C 1TTYA 3Q5FA 3GLXA 2H27A 1U5TB 1PDNC 1QQIA 2TDXA 3BDDA 1BC8C 4Q4ZF 4G7ZF 4ZYDA 2L54A 2VBWA 3OV8A 5TJJA 5TRDA 3IKVA 4HDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7N A;  4IHS A;  5LEK A;  2P5L C;  1MKM A;  1IUY A;  3VEP A;  1SD7 A;  3ERE D;  2FF4 A;  1J2X A;  4U0W A;  5CLS A;  1SFU A;  1I1G A;  2PEX A;  1WWX A;  4HLX A;  3E6C C;  2DPU A;  3RJP A;  4RB3 C;  2EV5 A;  3K2Z A;  1K79 A;  5DEQ A;  2JPB A;  3P9I A;  5IT3 A;  2XKO A;  2BGC A;  1MGT A;  3RYP A;  2H09 A;  1SD5 A;  3GF2 A;  2Z99 A;  1VTN C;  5HLI A;  2FQ3 A;  5HS9 A;  1WSU A;  3H3U A;  4P5O A;  4G9Y A;  3HOT A;  3WE3 A;  5CVV A;  3Q9S A;  2ZBK A;  3NQO A;  2QLZ A;  2L3D A;  5A2Q K;  4G7H F;  4KIF A;  1R23 A;  3IKT A;  5L3D A;  4EJW A;  1DDN A;  3FF5 A;  1WQ2 A;  5FD6 A;  4OIO F;  2A6E F;  2A07 F;  2V1X A;  2IA2 A;  2Z33 A;  1XMA A;  3F6V A;  1HQC A;  3BOQ A;  4DNC A;  2V6C A;  4ZYG A;  4ON0 A;  1GXP A;  1ON1 A;  3GEZ A;  3F72 A;  3SZT A;  2MLK A;  3WGH A;  3PQK A;  4LLL A;  4LLN A;  4UVB A;  3FM3 A;  4AIH A;  4WXH A;  2FEZ A;  4Y13 A;  2X0L A;  3R0J A;  3HUG A;  1P4A A;  3T5X A;  3O2P E;  1O7L A;  4ZZL A;  1DPR A;  3E6M A;  3CDH A;  2DW4 A;  4KDP A;  4IRG A;  2A69 F;  4Q47 A;  3MZH A;  4KFC A;  3MWM A;  4I02 A;  4I09 A;  2M45 A;  2VXZ A;  4Q48 A;  1RZ4 A;  1ZGA A;  3LA7 A;  3E5U A;  1IN5 A;  4HOB A;  3GFJ A;  1ZAR A;  4A0Z A;  2GQQ A;  3KZY A;  2PLY A;  3BP8 A;  4B09 A;  1IF1 A;  3BJA A;  4ESB A;  4U7D A;  4L9V A;  1AOY A;  2AXL A;  3DQV C;  1J59 A;  2DK5 A;  2RC4 A;  1STZ A;  1W7P A;  1G3S A;  1Q1H A;  3FXR A;  3WGI A;  4IPA A;  2QEN A;  5ILV A;  4M72 A;  2KJC A;  5CVR A;  4IF4 A;  4RGU A;  1T6S A;  2FML A;  3KCC A;  1XN7 A;  2MD5 A;  2Q0O A;  3ZP5 A;  1R5G A;  3BY6 A;  4M6Y A;  4YII A;  1HW2 A;  3QAH A;  1KQ0 A;  3T0Y A;  2OD5 A;  1S29 A;  1W7P D;  3ISP A;  1XD7 A;  1JHH A;  5CVU A;  1REP C;  2CO5 A;  2UXN A;  1LDJ A;  4HW0 A;  3C1D A;  4ZZD A;  4AVP A;  5IT9 Z;  1UHW A;  1ZLJ A;  3HHG A;  2D2W A;  2LSO A;  4MTE A;  1ZRF A;  1JXS A;  3J81 Z;  1TLH B;  3HRT A;  4BYY A;  3CUQ C;  3HTS B;  5DD4 A;  1D8J A;  4MTD A;  4I98 B;  5CVI A;  2W85 A;  5ILS A;  3U2R A;  1KYZ A;  1EV7 A;  5E17 F;  3LA2 A;  4HZF A;  4R1H A;  3T1B A;  3W6J B;  2QM3 A;  3CTA A;  2ZXJ A;  4LB5 A;  2VE9 A;  3BZ6 A;  1FX7 A;  4YFK F;  3M7G A;  1CF7 B;  1MJ9 A;  5ED4 A;  2R3S A;  5E1X A;  2L02 A;  3LQQ A;  1BI1 A;  1BOA A;  5LHG A;  3JSP A;  1LQ1 A;  2B0L A;  3WGG A;  2ZNZ A;  2HQN A;  3E6B A;  2CGP A;  2M30 A;  3ZMD A;  5CYV A;  5KK1 A;  5E1Z B;  3WU0 A;  2FU4 A;  1XCV A;  3SQN A;  2EFO A;  3GVA A;  2FE3 A;  1LDD A;  2ZME B;  2GA2 A;  2AS5 F;  1ZG1 A;  4L0Y B;  2O3F A;  2ZCW A;  5L3E A;  2CG4 A;  1IXC A;  2HOE A;  5LGT A;  2XKP A;  4B8X A;  4YFN F;  3E5Q A;  3IWZ A;  1LNW A;  5D6F A;  4HLY A;  4YIF A;  4KIC A;  4IHT A;  5BQT A;  1RUO A;  1R5H A;  3J81 K;  3GFM A;  3F8B A;  5DYM A;  5E1W A;  1B6A A;  5HDK A;  2QBY A;  3WTU C;  1A04 A;  1B4A A;  3CJN A;  2Z3Y A;  4FHT A;  4R79 A;  3FX3 A;  2HTJ A;  2LF7 A;  3V7S A;  4PGH A;  2PJP A;  2QBY B;  3HSF A;  2IJL A;  1OMI A;  1XGS A;  4ETS A;  5J8C A;  4TV7 A;  1USS A;  5HS8 A;  1JGS A;  3QOP A;  2JT1 A;  3EDP A;  2A61 A;  1IN4 A;  4G94 A;  4KIG A;  1OKR A;  3ZMT A;  3FWE A;  1QBJ A;  4Z2Y A;  1TQM A;  2CW0 F;  4MHG A;  1ZRE A;  1SFX A;  3SZP A;  1ZLK A;  1LJ9 A;  4M9S A;  1K7A A;  4K2E A;  1QZY A;  1D5V A;  2Z9O A;  2IA0 A;  2GA1 A;  3ABT A;  2K4J A;  4JK1 X;  4WXC A;  1EH7 A;  2GXB A;  3TO6 A;  5JFR A;  2FOK A;  3DEU A;  1DUX C;  3QP6 A;  2YU3 A;  1J0R A;  3ECO A;  4GYG A;  1H0M A;  2XUB A;  3BWG A;  5F64 A;  3ZN1 A;  4BXU A;  5HOO A;  1RI7 A;  4GGG A;  4M6X A;  3TOB A;  3U9G A;  1V4R A;  3RPU A;  1B9M A;  2ISZ A;  3F22 A;  2CYY A;  4DQ2 A;  4CGZ A;  3KEQ A;  4IRI A;  2VT3 A;  2RDP A;  3QU3 A;  4A5N A;  2L4M A;  4Y17 A;  5E8G A;  4WX9 A;  1U5T C;  3HRU A;  2FBI A;  3MFK A;  1YW8 A;  1OYY A;  2GWR A;  4MNU A;  4I7H A;  1HST A;  3KE2 A;  3K9T A;  3ELK A;  1BI2 A;  2DPD A;  4P9U A;  4HA8 A;  4L5J A;  1SFE A;  1QNT A;  4UV8 A;  5A2Q Z;  2Q2E A;  3GZ6 A;  3KFW X;  4XSX F;  1O7F A;  4EQQ A;  2RN7 A;  1XMK A;  2CFX A;  3L09 A;  1RUN A;  1F9N A;  3DPL C;  3PQJ A;  2J5P A;  4U88 A;  1HXD A;  1BM9 A;  4KA4 A;  2VC1 A;  4D0P A;  4I0B A;  2P5K A;  3I54 A;  4HX4 A;  1HW1 A;  1ZN2 A;  3K1P A;  1H9T A;  3FMR A;  1O57 A;  2CSO A;  3PFI A;  4KMF A;  4RB0 A;  3RKX A;  4N0B A;  1Y0U A;  2BYV E;  2NAZ A;  3FHZ A;  1R22 A;  4A2U A;  3GW2 A;  5CJ9 A;  2ESH A;  2XVC A;  5ICG A;  2G9W A;  1SD4 A;  2YX4 A;  3VOE A;  2VBX A;  3KEO A;  1W5S A;  3W6K B;  2O0Y A;  1ON2 A;  4LK0 F;  3HRM A;  1ZRC A;  2BEO A;  3BJO A;  3BRO A;  3HSE A;  4A0Y A;  2JTV A;  4OOI A;  2F5F A;  1FT9 A;  1O3Q A;  5BMZ A;  2OQR A;  3ROU A;  5FGM A;  4O3M A;  3JTH A;  4LD5 A;  2K4B A;  1I27 A;  1U6G A;  3P9K A;  2X4H A;  1R1T A;  3T8R A;  2L4A A;  5LGU A;  3KLO A;  2OAZ A;  4BQA A;  2P8T A;  3SFZ A;  5BPI A;  1P2F A;  2HFH A;  2HYF A;  1XCB A;  1J75 A;  3WTW C;  3M1E A;  4P96 A;  2ISY A;  3TQN A;  3F21 A;  3KZZ A;  2R7D A;  5L3B A;  5EEG A;  1W5T A;  1YTY A;  2Y75 A;  3RIR A;  1YG2 A;  3KP3 A;  1FBQ A;  5L3F A;  4NB5 A;  1JE8 A;  4ZH4 F;  3J80 K;  1KU9 A;  4AIK A;  1FC3 A;  3FMQ A;  1P4X A;  1L0O C;  2XGX A;  1R36 A;  3LAJ A;  4E70 A;  1DPU A;  4ZYH A;  1ZH5 A;  3MEX A;  3KP5 A;  2K86 A;  4L0Z B;  3HSR A;  5LEJ A;  5ERI A;  2VOO A;  4U0V A;  4ENJ A;  5ICF A;  1KU2 A;  3LAP A;  3HYI A;  2XAQ A;  3R6S A;  2W25 A;  2A5Y B;  3FXQ A;  2WV0 A;  3GFL A;  1YO5 C;  1Z1D A;  2NS0 A;  4A5M A;  1IN8 A;  4EJV A;  2EA4 A;  2WTE A;  4O5V A;  4BAY A;  2A68 F;  1YS7 A;  1WRJ A;  1FNN A;  2NNY A;  1S6L A;  3RYR A;  4HQE A;  5HVQ C;  5J8F A;  4UVC A;  4Y15 A;  3KP7 A;  4EJU A;  1YW9 A;  2J5O A;  1MJB A;  5FLX Z;  3LQR A;  4M9Z A;  2VON A;  3GYH X;  2VOP A;  2O8X A;  3E6D A;  3DF8 A;  3I5U A;  4R8H A;  3C18 A;  3JSO A;  4EM0 B;  1ZRD A;  3VOD A;  4HF2 A;  2P7V B;  5HDG A;  1B1B A;  1YFH A;  4H0E A;  2ELH A;  2GZW A;  1SMT A;  5JI6 A;  4XSZ F;  1FSH A;  4MQ9 F;  2FNP A;  1J7K A;  2BE5 F;  3I58 A;  1KGS A;  2EB7 A;  4LJZ F;  3NEU A;  2EV0 A;  4CDG A;  2QQ9 A;  3QP5 A;  4RAY A;  3TO7 A;  3QPT A;  4BHB A;  4KN4 X;  2QYO A;  4YFX F;  3GX4 X;  3ECH A;  2W24 A;  4JBA A;  2DQR A;  2MBF A;  1MD0 A;  5ICC A;  4RB2 C;  2WC2 A;  3MAJ A;  4KN7 X;  3RI4 A;  4NQW A;  1ODD A;  2HKO A;  4FT8 A;  2HEO A;  3E97 A;  3F8F A;  3IWF A;  3KLN A;  2DFI A;  1S7O A;  2RNJ A;  1UCR A;  1HKT A;  2PI0 A;  2MH9 A;  2EV6 A;  3BJ6 A;  3NRV A;  2ADU A;  4UXN A;  4AWX B;  3E3V A;  4L9J A;  2HWV A;  2PQ8 A;  1XDS A;  1KU7 A;  4HX8 A;  2GIV A;  3JAM K;  3IHU A;  2K27 A;  4BNC A;  3P9C A;  3TOA A;  2D1V A;  3WTS C;  1BI3 A;  4HQM A;  2KJB A;  4EJO A;  4WWC A;  4RB1 A;  5AIP A;  3F8M A;  4CYD A;  4G6Q A;  2OZU A;  4AIJ A;  2H6C A;  4ESJ A;  4CHU A;  1RIO H;  1ZHF A;  1BIA A;  5D8L B;  3BPV A;  1O3S A;  2XRO A;  3ZN0 A;  2DQL A;  4QWQ A;  4IVN A;  1FBU A;  1KQ8 A;  3F8C A;  2EFW A;  1Z05 A;  3DKW A;  4GYI A;  4I0A A;  4OIQ F;  1F4K A;  5BS6 A;  2XAS A;  5L3G A;  2XV4 S;  1R1U A;  1S8N A;  4LGW A;  1GHC A;  1F1Z A;  3ZMS A;  4ASN A;  3N97 A;  1U78 A;  1CF7 A;  2VBY A;  5LHH A;  2GXG A;  5D6E A;  1SD6 A;  2M8E A;  2HDC A;  1HW5 A;  3DV8 A;  3BPX A;  4A6E A;  2F2E A;  4WF2 A;  4LG0 B;  2JPC A;  1TBX A;  3K0L A;  3K1N A;  1T98 A;  3GUD A;  5JR3 A;  2E1N A;  3LFK A;  5L3C A;  2XAJ A;  4LMY A;  4KT5 C;  4EM1 A;  4HX7 A;  4A12 A;  3MQ0 A;  1JHF A;  2EA2 A;  2RQP A;  4CZZ A;  1FPQ A;  2LNB A;  3CUQ B;  3MZY A;  1QGP A;  3G73 A;  3EUH A;  2MA3 A;  2IP2 A;  4HAM A;  5D5U B;  3VFZ A;  4XBF A;  3QPH A;  4ENK A;  1LDK B;  5ICE A;  2E7W A;  2PBI A;  4HF1 A;  3GXO A;  1IRG A;  1HBX G;  3K1M A;  4ZYE A;  3JAM Z;  3FM5 A;  4MEY F;  1Z7U A;  1HKQ A;  4LK1 F;  5F6F A;  1ZAO A;  3B73 A;  2DT5 A;  1R1V A;  2BBY A;  4LLG F;  3F3X A;  5HLH A;  1TNS A;  5HDN A;  1G3W A;  2IPQ X;  4FX4 A;  5D5W B;  2PMH A;  3CUO A;  5CVJ A;  3WTV C;  5DCM A;  3IC7 A;  1S3J A;  2P6T A;  2HYG D;  1XSV A;  2IW5 A;  5AON A;  1IN6 A;  2Y0M A;  3KP6 A;  2WWY A;  2G7H A;  3ZPL A;  5EEH A;  3VB2 A;  1CGP A;  2ZJ2 A;  4OIN F;  5LRS A;  2RVC A;  3TO9 A;  3O3K A;  5BPD A;  2YSR A;  3IRR A;  2ESN A;  2EJR A;  1OPC A;  2H94 A;  3LA3 A;  1Z91 A;  5DCF A;  4HBL A;  1S7A A;  5FLX K;  1PUE E;  2W84 A;  3ZQ7 A;  4NHJ A;  5J6X A;  3C3W A;  3FMS A;  1MZB A;  3L7W A;  4S04 A;  1G3Y A;  4G6D A;  2QVO A;  3WG9 A;  4OIP F;  1YQA A;  1R00 A;  1MJA A;  3E5X A;  4PZJ A;  1UFM A;  1ONV A;  5DUI A;  1DP7 P;  2QUF A;  3L9F A;  4AD9 A;  1MDM B;  3DPT A;  2V1D A;  4HV6 A;  4BH9 A;  4CO8 A;  1FSE A;  1SAX A;  2NYX A;  3TDZ C;  4UVA A;  4O6J A;  1FYL A;  1K78 B;  1G3T A;  2ACJ A;  3T8T A;  4HV5 A;  2RGV A;  2KIM A;  2FBK A;  1P6R A;  2HGC A;  2EFN A;  3ABU A;  2FBH A;  2XRN A;  2YPR A;  4HF0 A;  2Z5U A;  1IXR C;  4EJT A;  3QU6 A;  3WTX C;  2UXX A;  1LVA A;  1G6N A;  4P9F A;  5K5R A;  4U7B A;  4YG2 F;  1YLF A;  3REO A;  2D45 A;  6PAX A;  5DD8 A;  1EH8 A;  3I59 B;  2ZO4 A;  5H6Q A;  1E2X A;  4RAZ A;  1WKM A;  4IXA A;  2G7U A;  4EM2 A;  3R4K A;  3O6B B;  2DAO A;  4OU0 A;  1FYM A;  2QQB A;  4S05 A;  1PP8 F;  4N9H A;  1HKS A;  1LEA A;  5D5V B;  3MCZ A;  4CXF A;  2KIF A;  4FX0 A;  3K69 A;  3I53 A;  2HS5 A;  4M71 A;  1R7J A;  3L2C A;  2R7F A;  3R0A A;  1TW3 A;  3S2W A;  1O3T A;  1L3L A;  2DK8 A;  1YYV A;  3EYY A;  5AIQ A;  1OYW A;  1XDU A;  1UB9 A;  2DTR A;  3F6O A;  1U8R A;  4JQF A;  2DLL A;  2O03 A;  5HLG A;  5LHI A;  3RKW A;  1BIB A;  1XB4 A;  2K02 A;  1GXQ A;  3LST A;  3KP2 A;  1ZG5 A;  2V79 A;  1XGO A;  1IZ1 A;  5FD5 A;  2DO7 A;  4GXO A;  2FRH A;  1XGN A;  4LB6 B;  1FLI A;  4UHT A;  1W7P B;  3ZMV A;  4WXD A;  2O61 A;  2W57 A;  1FOK A;  1KQ9 A;  2HQR A;  1G4D A;  2ZNY A;  4OMY A;  1D8K A;  1X3U A;  2PG4 A;  3H3Z A;  4GCV A;  4LG0 A;  2MH2 A;  5K5O A;  2V9V A;  4OIR F;  3B02 A;  1Z6R A;  3AAF A;  3OOP A;  3I59 A;  5E18 F;  3CLO A;  1U2W A;  3I4P A;  4M73 A;  3KET A;  3WTT C;  4L9T A;  1J5Y A;  4I2O A;  1IXS B;  2ZFW A;  1ZGJ A;  2EFP A;  5E8I A;  5JHU A;  1U3E M;  2QZ8 A;  5LBQ A;  1OYI A;  3R61 A;  2KKO A;  1HSJ A;  3QRF F;  3GO5 A;  5H6R A;  2FNA A;  4PCQ A;  1IRF A;  2XAG A;  4Q5S F;  3I71 A;  2P6S A;  3FZV A;  2M5W A;  2P5V A;  4MEX F;  2XIG A;  2KIU A;  1T0F A;  2VC0 A;  4M9X A;  2F5D A;  4BHP A;  1NHA A;  2M87 A;  3V8L A;  4IRH A;  2XAF A;  3F8N A;  4KNY A;  4G8X A;  2NRA C;  1TQP A;  5FB2 A;  2MC3 A;  2IVM A;  3M9A A;  2E7X A;  2DI3 A;  4A0X A;  2FA5 A;  1FY7 A;  2L01 A;  4HYE A;  1KU3 A;  2HZT A;  4MGR A;  2GAU A;  1SMY F;  4BHC A;  1I6X A;  1J9I A;  3RTR A;  1IN7 A;  2YX7 A;  4ENN A;  4I01 A;  2A3S A;  2F5C A;  3D0S A;  1XSD A;  3RPQ A;  2UZK A;  2Y48 A;  3SHF A;  4XLP F;  2XHK A;  5D8K B;  1KA8 A;  1LEB A;  5BOX A;  5FO5 A;  1C0W A;  2NNN A;  1W4M A;  3CO7 C;  2XAH A;  3FXU A;  4L9N A;  2F5E A;  3WTZ A;  2V1U A;  2LKP A;  5K5Q A;  3DFG A;  2DBB A;  3M8E A;  1U5T A;  3SXY A;  2EWN A;  5HS7 A;  3WU1 B;  3WTY C;  3GWZ A;  1FZP B;  1P4W A;  4PGG A;  2YR2 A;  4UV9 A;  3J80 Z;  1D3Y A;  3HIF A;  4EMS A;  1TQI A;  4UUV A;  3IRQ A;  1WI9 A;  4L5I A;  2Q8K A;  2QWW A;  2PMU A;  5KVR A;  2FMY A;  3TGN A;  2BV6 A;  2A6H F;  2PFB A;  4N9I A;  1ZYR F;  3C7J A;  3TDU C;  1KYW A;  1TW2 A;  3GZ5 A;  3V8K A;  3N4M A;  2STW A;  3COA C;  3ML6 A;  3DP7 A;  4F7Z A;  1YIO A;  1FP1 D;  4ENM A;  1UST A;  2VT2 A;  4OMZ A;  1I1S A;  5DDG A;  1O3R A;  2C6Y A;  1RNL A;  4EGY A;  2P7C B;  3ULQ B;  2HTS A;  1YS6 A;  4G7O F;  4KUM A;  1FBS A;  1ULY A;  3EQL F;  2EFQ A;  5DCM B;  3LWF A;  1GVJ A;  3KP4 A;  1V3F A;  3EET A;  5D4R A;  4WCG A;  4L18 B;  3EYI A;  4KIB A;  4EV0 A;  2RV8 A;  2JZY A;  3V8J A;  1XGM A;  3M8F A;  4KYW A;  3H92 A;  2LF8 A;  2O6G E;  3Q9V A;  4IJA A;  2EK5 A;  3HRS A;  1FP2 A;  3RKY A;  3V4G A;  1QO0 D;  1B59 A;  2OA4 A;  2DU9 A;  5FFX A;  2COM A;  2JSC A;  4LFU A;  1T2K A;  2KRF A;  1T38 A;  3GFI A;  4A6D A;  2OZ6 A;  4QLC U;  2HKX A;  3I64 A;  3R60 A;  3ZMZ A;  1PP7 U;  2VBZ A;  4MQV A;  3HOS A;  2FSW A;  5K1Y A;  3JW4 A;  3TKY A;  3WOD F;  2OBP A;  4XRF A;  1B9N A;  2QQA A;  1Z9C A;  4M74 A;  2IT0 A;  2FXA A;  3HTU A;  3D5L A;  1IW7 F;  1BJA A;  3J7A O;  2UWM A;  2VE8 A;  5ILU A;  1K6O A;  1IAW A;  5IT9 K;  2PN6 A;  1P92 A;  1MDM A;  4CIC A;  5DV5 A;  1R58 A;  2D1H A;  1OR7 A;  3WE2 A;  2E1C A;  2IA1 A;  1UHM A;  5LGN A;  2RKH A;  3G3Z A;  1BBY A;  5D5X B;  5H20 A;  1T39 A;  2P4W A;  5LRR A;  3RDI A;  1QPM A;  1YW7 A;  4HDU A;  2VOD A;  2MLG A;  2ZME A;  2K7L A;  2IRF G;  3F23 A;  1BC7 C;  2JRT A;  4EGZ A;  3DXJ F;  5F1R A;  2ETH A;  1FYK A;  1ZG3 A;  5E20 A;  3L00 A;  1K78 A;  2VN2 A;  1XSX A;  4RGR A;  3ZMU A;  4WK8 F;  2HR3 A;  1E17 A;  1H9G A;  3CUQ A;  1F5T A;  2CWE A;  1BN5 A;  2M1B A;  5JVT A;  3U1D A;  1EH6 A;  2LDU A;  3HHH A;  4RS8 A;  2CQK A;  4U0Y A;  2ZKZ A;  4XLN F;  1Z6T A;  3V7C A;  4KMU X;  5DUK A;  1I5Z A;  2H6B A;  4RGS A;  4EVI A;  3V7R A;  2STT A;  3JTG A;  4RGX A;  4ESF A;  1FWZ A;  3IL2 A;  1BI0 A;  2OQG A;  3I0T A;  4PDK A;  1QZZ A;  5FFZ A;  4UNO A;  1LB2 A;  1TNT A;  2OU2 A;  5D4S A;  5LLQ A;  4P55 A;  4GO1 A;  1AWC A;  3CO6 C;  1TTY A;  3Q5F A;  3GLX A;  2H27 A;  1U5T B;  1PDN C;  1QQI A;  2TDX A;  3BDD A;  1BC8 C;  4Q4Z F;  4G7Z F;  4ZYD A;  2L54 A;  2VBW A;  3OV8 A;  5TJJ A;  5TRD A;  3IKV A;  4HDV A; 
#chains in the Genus database with same CATH topology
 3P7N A;  2F5V A;  3CLQ A;  4BQN A;  4QPO A;  4PK4 A;  4HNT A;  4IHS A;  5LEK A;  2P5L C;  1MKM A;  2Y30 A;  1Y56 A;  1LUJ B;  3CJT B;  2AO9 A;  1IUY A;  4XLA A;  3AL0 B;  3VEP A;  1R49 A;  1SD7 A;  3BR2 A;  3ERE D;  1NG6 A;  3CF2 A;  3TED A;  2FF4 A;  4B1R A;  2KRH A;  1I3A A;  1J2X A;  1Y1V J;  4QIW N;  3G71 I;  4FE4 A;  3JRA A;  4U0W A;  3RSN A;  4RAG A;  3CDI A;  5CLS A;  1SFU A;  3QPS A;  1I1G A;  2PEX A;  1WWX A;  2V4J C;  4II2 A;  3F9K A;  4HLX A;  3E6C C;  2DPU A;  3RJP A;  4RB3 C;  2EV5 A;  3K2Z A;  1K79 A;  3WG7 H;  1ETO A;  5DEQ A;  2JPB A;  2KMU A;  3P9I A;  5IT3 A;  2XKO A;  5FRO A;  5E3M A;  2BGC A;  1YJN I;  5IPA A;  4UUS A;  1MGT A;  3RYP A;  1VQ7 I;  2H09 A;  1SD5 A;  3GF2 A;  3HG9 A;  4IHW A;  3VDX A;  2Z99 A;  3L2U A;  1VTN C;  3PM1 A;  3I56 I;  5HLI A;  3S1N J;  2FQ3 A;  5HS9 A;  1WSU A;  1GUU A;  3H3U A;  4LIV A;  4P5O A;  5M3F J;  2E36 A;  2QSF X;  4G9Y A;  2W7N A;  3HOT A;  4B48 A;  5J1Y A;  3WE3 A;  5CVV A;  3Q9S A;  2ZBK A;  2IBD A;  5GTH C;  2HOT A;  3D5S C;  1UAA A;  1XPX A;  3NQO A;  2QLZ A;  1AHD P;  3CCQ I;  2L3D A;  2MAB A;  5A2Q K;  4G7H F;  4KIF A;  3EUH C;  5F04 A;  3C2H A;  5FKM A;  1R23 A;  3B6A A;  1A35 A;  3IKT A;  5L3D A;  4EJW A;  2JA2 A;  1OIS A;  1DDN A;  3OYE A;  4IZZ A;  3FF5 A;  2UV1 A;  1WQ2 A;  5FD6 A;  2HVR A;  2A6E F;  2FJ1 A;  4OIO F;  2A07 F;  2K40 A;  2V1X A;  1FOW A;  2IA2 A;  4Y4R A;  2Z33 A;  1XMA A;  2DFH A;  2V6E A;  3F6V A;  4XID A;  4FCY A;  1W36 C;  1HQC A;  2MC4 A;  1IRZ A;  3BOQ A;  4DNC A;  2V6C A;  4ZYG A;  4ON0 A;  1GXP A;  1Y8Q B;  2YUS A;  1ON1 A;  3GEZ A;  3F72 A;  2EIK H;  3SZT A;  1GT0 C;  3BT9 A;  2MLK A;  3WGH A;  3PQK A;  4LLL A;  4LLN A;  4UVB A;  2M34 A;  3FM3 A;  1HA8 A;  4AIH A;  1LFU P;  4WXH A;  2FEZ A;  4Y13 A;  2HI3 A;  4D7M A;  2X0L A;  3R0J A;  4NBQ A;  1D1C A;  3HGG A;  4F3Q A;  5EDN A;  3HUG A;  4LOC A;  4DBR A;  1P4A A;  3T5X A;  2H8W A;  2M8G X;  3O2P E;  1O7L A;  1S9H A;  1DPR A;  4ZZL A;  3E6M A;  3CDH A;  2X6O A;  3DU5 A;  3GTQ J;  1LKX A;  2DW4 A;  4KDP A;  4IRG A;  2A69 F;  4Q47 A;  3MZH A;  3S93 A;  3JRD A;  4KFC A;  3MWM A;  4I02 A;  2WA0 A;  4I09 A;  4G12 A;  4X1E A;  2M45 A;  2VXZ A;  4Q48 A;  1RZ4 A;  1ZGA A;  3LA7 A;  3E5U A;  1IN5 A;  1MMA A;  4HOB A;  5KHD A;  1ETY A;  1U9O A;  2NOG A;  3GFJ A;  3ZQI A;  5EGO B;  1MBG A;  5DM7 F;  3BQZ A;  1MH4 A;  1T95 A;  1P7I A;  1ZAR A;  4CCN A;  4A0Z A;  2GQQ A;  3KZY A;  4Y3O A;  1X19 A;  2PLY A;  2JA7 J;  5F1J A;  2JRM A;  3OOU A;  3EPZ A;  4UB6 C;  3CC2 I;  2CV2 A;  3BP8 A;  2LBF A;  4B09 A;  1OQY A;  3BJA A;  1IF1 A;  4ESB A;  3HOZ J;  4U7D A;  2P0W A;  4L9V A;  1AOY A;  2AXL A;  1X1A A;  1YI2 I;  3DQV C;  1J59 A;  1WJE A;  2DK5 A;  3H0G J;  3PO3 J;  1MH3 A;  2RC4 A;  4E7Z A;  1STZ A;  1W7P A;  3TL4 X;  3A03 A;  2VB6 A;  3E0J B;  1G3S A;  3BR1 A;  1Q1H A;  3M8J A;  3FXR A;  1FOX A;  3WGI A;  4IPA A;  1ZR4 A;  3OL3 A;  3K4J A;  2QEN A;  4HPQ A;  5ILV A;  4M72 A;  2KJC A;  4AUX A;  1GV5 A;  5CVR A;  4IF4 A;  3PJR A;  1JT0 A;  4RGU A;  2DFF A;  1T6S A;  2FML A;  3KCC A;  3TBI A;  1XN7 A;  2MD5 A;  2Q0O A;  1ZEL A;  1K6Y A;  1RPW A;  2DA3 A;  4MO7 A;  4F93 B;  4FTH A;  3ZP5 A;  1QVU A;  1R5G A;  1R9T J;  3BY6 A;  4M6Y A;  4YII A;  1D0X A;  1HW2 A;  3QAH A;  1KQ0 A;  1QRY A;  3PUF A;  2EZH A;  3T0Y A;  1YX5 A;  1IV6 A;  2OD5 A;  1S29 A;  1W7P D;  2QQ8 A;  3ISP A;  1QZE A;  1XD7 A;  4A3K J;  3BZC A;  1WCM J;  1JHH A;  4HNV A;  1ERD A;  1VZ0 A;  1IUF A;  2XDV A;  2CW8 A;  4PFO A;  5CVU A;  1Y39 A;  1REP C;  5JVG F;  2M7B A;  3GME A;  1SAU A;  2CO5 A;  2UXN A;  3UR3 C;  1LDJ A;  4A3M J;  4HW0 A;  3C1D A;  4ZZD A;  4D9J A;  2EBI A;  2R7Z J;  4DZP A;  1EKE A;  4AVP A;  5IT9 Z;  1BJZ A;  1UHW A;  2Y9Y A;  3M3Y J;  2CW7 A;  1ZLJ A;  2CRG A;  3HHG A;  2D2W A;  2LSO A;  4MTE A;  1ZRF A;  1JXS A;  1J09 A;  3IAM 2;  1TLH B;  3Q0V A;  3J81 Z;  3HRT A;  3LSJ A;  4BE1 A;  1FTT A;  4BYY A;  1YIT I;  3CUQ C;  3KPH A;  1PUF A;  3HTS B;  5DD4 A;  1APL C;  4MTD A;  3BR3 A;  1D8J A;  1JUM A;  1TWG J;  4I98 B;  4DBQ A;  3CJQ B;  5CVI A;  4NUB A;  1H88 C;  2W85 A;  5ILS A;  4NC8 A;  3ZQQ A;  3U2R A;  3SDB A;  3X2Q H;  1T33 A;  3HOX J;  3H9G A;  1KYZ A;  1EV7 A;  1X1P A;  2VJI A;  5E17 F;  3S16 J;  3V42 A;  3LA2 A;  4HZF A;  4R1H A;  2X6W A;  2O5R A;  3T1B A;  1Z3Y A;  3J7A Y;  5FLM J;  2CUJ A;  2L7F P;  1UEL B;  3W6J B;  2HZD A;  2QM3 A;  5B66 C;  2BVM A;  3CTA A;  3ZRG A;  3CC4 I;  4UY8 I;  2ZXJ A;  4LB5 A;  2VE9 A;  3BZ6 A;  1FX7 A;  1QVT A;  4YFK F;  4BE2 A;  3VSK A;  3M7G A;  1CF7 B;  1MJ9 A;  5ED4 A;  2R3S A;  3G1L A;  5E1X A;  1WH7 A;  3KYL A;  2L02 A;  3G4S I;  2R5Y A;  2M2E A;  3LQQ A;  1BI1 A;  1BOA A;  5CKT A;  5LHG A;  3PO2 J;  4JX4 A;  3BC8 A;  4M3G A;  3JSP A;  1OR7 C;  1LQ1 A;  2B0L A;  3WGG A;  2ZNZ A;  2HQN A;  2HQ5 A;  3E6B A;  4OWR B;  2CGP A;  2LK2 A;  2M30 A;  3ZMD A;  2M7A A;  3DBR B;  3S1R J;  5CYV A;  2VQC A;  5E1Z B;  5KK1 A;  3WU0 A;  4CUG A;  2FU4 A;  1AA7 A;  1XCV A;  4V19 K;  3SQN A;  1FJL A;  2EFO A;  5K7Z A;  1TWF J;  3VYT B;  3RZD J;  3GVA A;  2FE3 A;  1LDD A;  4BEH A;  2ZME B;  1BR4 A;  2KLO A;  2XSD C;  2GA2 A;  2AS5 F;  1ZG1 A;  1PVE A;  3OIQ A;  4L0Y B;  1MW7 A;  1RC9 A;  2O3F A;  2ZCW A;  5L3E A;  4IO9 F;  2CG4 A;  3BTC A;  4BY1 J;  1YE9 A;  1IXC A;  2Z1D A;  2D5V A;  4BEH B;  4CCM A;  2HOE A;  2KRC A;  5LGT A;  2XKP A;  3M4O J;  4XMY A;  3FXL A;  4B8X A;  4YFN F;  3E5Q A;  3IWZ A;  1LNW A;  4I99 C;  5D6F A;  4HLY A;  2EZI A;  4YIF A;  4KIC A;  3L2W A;  4IHT A;  3HOU J;  3SYT A;  3JRE A;  3DLL F;  5BQT A;  1R5H A;  3OS1 A;  1R6R A;  2V1N A;  3J81 K;  1RUO A;  3GFM A;  4OAY A;  1YRN A;  3DBL B;  1IDY A;  3F8B A;  2E34 A;  1DGW Y;  1LFB A;  3ASN H;  5DYM A;  3HC7 A;  5E1W A;  1B6A A;  4X6A J;  2ZJR F;  1SVO A;  2BHY A;  5HDK A;  3CP8 A;  3GLL A;  2OUM A;  1NH3 A;  2NS8 A;  5F27 A;  1H89 C;  2QBY A;  3WTU C;  1VQP I;  1A04 A;  2COB A;  5KCM A;  5F08 A;  1YX3 A;  2Q1Z B;  1B4A A;  3CJN A;  2Z3Y A;  4FHT A;  4R79 A;  3FX3 A;  2HTJ A;  3MKY B;  2IS1 A;  2LF7 A;  1IDZ A;  3V7S A;  4PGH A;  2IS2 A;  2PJP A;  3HSF A;  2QBY B;  2IJL A;  1OMI A;  3GTP J;  1XGS A;  4ETS A;  5J8C A;  4TV7 A;  2W82 A;  1USS A;  3K4N A;  5HS8 A;  1TWA J;  1WJA A;  5J3L A;  3N05 A;  1JGS A;  3QOP A;  2HYJ A;  2JT1 A;  4UB8 C;  3EDP A;  2A61 A;  1IN4 A;  4G94 A;  3MMY B;  4KIG A;  1OCZ H;  2Q2E B;  1OKR A;  5EJC A;  3FWE A;  2EQR A;  3ZMT A;  4YRV A;  1QBJ A;  1YIJ I;  4Z2Y A;  1TQM A;  2CW0 F;  4MHG A;  3BR6 A;  1SFX A;  1IGN A;  1ZRE A;  3SZP A;  1ZLK A;  1LJ9 A;  2X9D A;  4A3J J;  4M9S A;  3RQI A;  1GV2 A;  4K2E A;  1K7A A;  1ZTR A;  3J7Y J;  1QZY A;  2XGE A;  2DFE A;  1D5V A;  2Z9O A;  2Y2Z A;  3LL7 A;  2CQX A;  3FKI J;  2IA0 A;  2Y69 H;  2GA1 A;  3ABT A;  1FMV A;  2K4J A;  4BY7 J;  4JK1 X;  1B8I A;  4WXC A;  5B5E C;  4C30 A;  3OY9 A;  1EH7 A;  2OF7 A;  2L0K A;  3CDL A;  2EIJ H;  2GXB A;  3EUA A;  3TO6 A;  1WI3 A;  2A5W A;  5JFR A;  1VI0 A;  2FQ4 A;  2FOK A;  2VL8 A;  5EZG A;  3DEU A;  5M5X J;  1DUX C;  3QP6 A;  2YU3 A;  1J0R A;  3ECO A;  4CSW A;  4GYG A;  2DA5 A;  2DJI A;  1W1W E;  1H0M A;  2XUB A;  3K2A A;  3S3N A;  1V5G A;  3BWG A;  5F64 A;  1Z0X A;  3ZN1 A;  4BXU A;  2QA4 I;  5F0F A;  5HOO A;  3FXM A;  1K4S A;  1RI7 A;  4GGG A;  4M6X A;  3TOB A;  2ICW G;  3HGY A;  3U9G A;  4IHX A;  1V4R A;  3RPU A;  1B9M A;  5CQG A;  2ISZ A;  3F22 A;  2CYY A;  3KYD B;  4DQ2 A;  4CGZ A;  3LSH A;  2EIN H;  4IQJ A;  3W2V A;  2XRL A;  3KEQ A;  4IRI A;  2B63 J;  2VT3 A;  4BS9 A;  3CME I;  2RDP A;  3QU3 A;  1G8X A;  2LY2 A;  4A5N A;  2L4M A;  4Y17 A;  2CUZ A;  2WY7 Q;  5E8G A;  4WX9 A;  1QHH D;  2AQF A;  1U5T C;  3HRU A;  2FBI A;  1JT6 A;  3MFK A;  1WJD A;  3CC7 I;  4B4C A;  1YW8 A;  2VLA A;  1OYY A;  2GWR A;  4MNU A;  1SC7 A;  3OR2 C;  4I76 A;  4ZC3 A;  4YEJ A;  4I7H A;  3BCB A;  1HST A;  2ZJP F;  3KE2 A;  3K9T A;  2CV1 A;  3ELK A;  3K10 A;  5IYD J;  1BI2 A;  3U1K A;  1UHS A;  1ETK A;  2M0C A;  2M4K A;  4P9U A;  2DPD A;  1Y1W J;  4HA8 A;  2E2H J;  4PUS A;  4L5J A;  3A1Y A;  3BG3 A;  1SFE A;  1QNT A;  2QF7 A;  4UV8 A;  5A2Q Z;  4XKV A;  2Q2E A;  3OSF A;  3GZ6 A;  1VQ6 I;  2QSH X;  2CQ7 A;  2Z16 A;  4IHY A;  1SEU A;  3KFW X;  4XSX F;  1O7F A;  3VYS B;  4EQQ A;  2V7F A;  3Q0W A;  2RN7 A;  1XMK A;  3GTJ J;  1OLT A;  2CFX A;  2LP0 A;  1O4X A;  1CQT A;  3L09 A;  1RUN A;  1F9N A;  2CMP A;  3QQA A;  3DPL C;  3BTL A;  3OIO A;  4F91 B;  3PQJ A;  2B9S A;  3GTO J;  2J5P A;  4U88 A;  3S3M A;  1HXD A;  1BM9 A;  2EPF A;  4KA4 A;  2VC1 A;  5DTD A;  4D0P A;  2PMZ A;  2E1O A;  4I0B A;  1F43 A;  5J4Y A;  2P5K A;  3I54 A;  3S8P A;  3U21 A;  4HX4 A;  1HW1 A;  1ZN2 A;  3K1P A;  1H9T A;  3FMR A;  1O57 A;  3KYC B;  2CSO A;  5JLW A;  3PFI A;  2L9V A;  4C9Y A;  4KMF A;  4RB0 A;  3LNQ A;  3RKX A;  4N0B A;  3G6E I;  1Y0U A;  5EF6 A;  5H2F C;  1BR2 A;  4PJL A;  3FXJ A;  4DIQ A;  2BYV E;  2NAZ A;  2F6C A;  1JKR C;  4RA2 A;  3FHZ A;  1R22 A;  4A2U A;  3GW2 A;  5CJ9 A;  2ESH A;  2XVC A;  3K70 C;  4GFB A;  5GP9 A;  5ICG A;  2G9W A;  3A2K A;  3RPU D;  1SD4 A;  2YX4 A;  3VOE A;  2F48 A;  2CJJ A;  2VBX A;  3KEO A;  1W5S A;  1AKH A;  1X2N A;  3W6K B;  2O0Y A;  4CYC A;  1TT0 A;  3JRG A;  3GTK J;  1ON2 A;  1ETW A;  4MFE A;  4LK0 F;  3HRM A;  3PFY A;  1ZRC A;  3BG5 A;  1W0U A;  2BEO A;  2GOX B;  1YRN B;  3BJO A;  3BRO A;  3VYR B;  3HSE A;  4A0Y A;  1Y8R B;  2JTV A;  4OOI A;  5IP6 A;  3MN2 A;  2F5F A;  2DTZ A;  1FT9 A;  3JRI A;  1O3Q A;  3H35 A;  1AKH B;  5BMZ A;  2LKS A;  3BR5 A;  2OQR A;  3ROU A;  2GOM A;  4M3E A;  5FGM A;  3OYD A;  4XN3 A;  4O3M A;  3JTH A;  3KEY A;  4XRS A;  4LD5 A;  2K4B A;  3ABM H;  2DDA A;  1I27 A;  1MBJ A;  1U6G A;  3OYL A;  3OYF A;  3P9K A;  4AYB N;  3ABK H;  4CZC A;  2X4H A;  2K9L A;  1R1T A;  3T8R A;  4M6V A;  3PNV A;  2L4A A;  3VYU B;  4DW6 A;  5LGU A;  3KLO A;  4DJA A;  4XNF A;  2DA1 A;  3FBI B;  2JA6 J;  1VQO I;  2OAZ A;  4BQA A;  2P8T A;  5EGO A;  4Y7N J;  2A6T A;  1OCR H;  3SFZ A;  2K5C A;  5BPI A;  1P2F A;  2HFH A;  2R5Z A;  2HYF A;  5IYC J;  1XCB A;  1J75 A;  3WTW C;  3M1E A;  4P1W A;  4P96 A;  1JTY A;  2ISY A;  3TQN A;  3F21 A;  3KZZ A;  2X48 A;  2R7D A;  4C2U A;  5L3B A;  5EEG A;  1W5T A;  1YTY A;  2Y75 A;  3RIR A;  1YG2 A;  3KP3 A;  1FBQ A;  5L3F A;  2R5Y B;  2IXS A;  2JUG A;  4NB5 A;  1JE8 A;  3BG9 A;  3IUO A;  1RRJ A;  2IS4 A;  1BW6 A;  4ZH4 F;  3J80 K;  3BCA A;  4AC0 A;  4XON A;  5KAF C;  1KU9 A;  4AIK A;  1FC3 A;  2JVH A;  3EUK L;  3FMQ A;  1P4X A;  2R7O A;  3K4L A;  1L0O C;  1MNE A;  2E1M C;  3RCO A;  5J1U A;  2VPR A;  2XGX A;  5GAH J;  1R36 A;  3LAJ A;  4E70 A;  4C2T A;  1DPU A;  3SEZ A;  4ZYH A;  1ZH5 A;  3MEX A;  3KP5 A;  2K86 A;  4D7N A;  4HEA 2;  4L0Z B;  4OAZ A;  2EH3 A;  3JRH A;  3HSR A;  5LEJ A;  1UG0 A;  5ERI A;  2VOO A;  4U0V A;  4ENJ A;  3LSR A;  5ICF A;  1KU2 A;  5C4X J;  3LAP A;  3HYI A;  4NC6 A;  1I6H J;  2XAQ A;  3R6S A;  3VPR A;  2W25 A;  3CZ6 A;  2A5Y B;  3FXQ A;  1LE8 B;  2DDB A;  2WV0 A;  3GFL A;  1YO5 C;  1Z1D A;  3FIS A;  3A0H C;  2HDW A;  2NS0 A;  3AG3 H;  4JYK A;  4A5M A;  1IN8 A;  4EJV A;  3QOE A;  2BY0 A;  2EA4 A;  2X6Y A;  2RAE A;  2WTE A;  3DEW A;  4O5V A;  1WHU A;  2GLO A;  4BAY A;  2A68 F;  3H9Q A;  1YS7 A;  5IP7 J;  2HVQ A;  2JA5 J;  4JP0 A;  1WRJ A;  4BBR J;  2BW3 B;  3K4B A;  1FNN A;  3IH4 A;  2NNY A;  1S6L A;  3RYR A;  5EZH A;  4HQE A;  4C3J J;  3MZ8 A;  5HVQ C;  5J8F A;  3PUB A;  2ME6 A;  3QPL A;  4UVC A;  1BR1 A;  2R7U A;  1WJB A;  4Y15 A;  3KP7 A;  1FIP A;  5J40 A;  4EJU A;  2K9Q A;  1YW9 A;  2J5O A;  4A3I J;  3K70 D;  4E7K A;  1MJB A;  4RM2 A;  5FLX Z;  1ZK8 A;  2R7W A;  4BE0 A;  2NOJ B;  2ZXH A;  3LQR A;  4M9Z A;  3MKW B;  3FDY A;  3RQ4 A;  2VON A;  3H5N A;  3ZOB A;  1N25 A;  3GYH X;  1HC8 A;  2VQG A;  1W5C C;  3A01 B;  2VOP A;  1B72 A;  2O8X A;  3E6D A;  3ZQH A;  1VND A;  3DF8 A;  3I5U A;  1ZR2 A;  4R8H A;  3W6V A;  3C18 A;  3I4N J;  1D0Y A;  3ONQ A;  2R7V A;  3JSO A;  4EM0 B;  2XF7 A;  5M5Y J;  2BXZ A;  2X1D A;  1ZRD A;  3VOD A;  4E7H A;  1A5J A;  4HF2 A;  2P7V B;  2BY1 A;  2MG4 A;  5HDG A;  3C2B A;  1B1B A;  4II3 A;  1YFH A;  4H0E A;  2ELH A;  2GZW A;  4BJ5 C;  1SMT A;  5JI6 A;  1MMG A;  4XSZ F;  1FSH A;  2MFZ A;  3HM5 A;  4MQ9 F;  3DKY A;  2FNP A;  2DOA A;  2HOA A;  1XTA A;  3HPH A;  1R4M B;  1HDP A;  1J7K A;  2BE5 F;  3I58 A;  1KGS A;  2EB7 A;  2L7Z A;  2VKE A;  4LJZ F;  3NEU A;  2EV0 A;  5JHF A;  4CDG A;  2QQ9 A;  3QP5 A;  4RAY A;  3TO7 A;  3QPT A;  4BHB A;  2UUZ A;  1N78 A;  5HOD A;  4MIM A;  3SDG A;  4KN4 X;  4JX6 A;  3AG4 H;  1RKT A;  2QYO A;  3H0D A;  4YFX F;  3GX4 X;  3ECH A;  1XS9 A;  2NVY J;  2W24 A;  1HF0 A;  3FK6 A;  4JBA A;  2DQR A;  2MBF A;  1MD0 A;  2MSY A;  2LG4 A;  5ICC A;  5IP9 J;  4RB2 C;  2DA7 A;  2WC2 A;  3OYA A;  2DN0 A;  3MAJ A;  4YIR X;  4KN7 X;  1K83 J;  5E79 C;  3RI4 A;  4NQW A;  4E6K G;  1EJ9 A;  2KZG A;  1ODD A;  1A6I A;  2HKO A;  4KIS A;  2JA8 J;  4FT8 A;  4M3F A;  3MD2 A;  3E97 A;  2HEO A;  1YOV B;  2R5Z B;  2X6X A;  3WU2 C;  3ZQL A;  3F8F A;  3IWF A;  4A69 C;  3KLN A;  2XF5 A;  3AKZ A;  2DFI A;  1S7O A;  4IEJ A;  4UUT A;  4HSR A;  4DYR A;  2RNJ A;  1UCR A;  2ECB A;  1JI8 A;  5DS9 A;  1HKT A;  2PI0 A;  2MH9 A;  2EV6 A;  3CCE I;  4L5E A;  2BOL A;  3BJ6 A;  1I39 A;  2E5N A;  3ESW B;  3NRV A;  2ADU A;  4UXN A;  4AWX B;  2ZFU A;  3HOY J;  3E3V A;  4L9J A;  2R7R A;  2HWV A;  2PQ8 A;  4XLH A;  2OTL I;  1XDS A;  1KU7 A;  4HX8 A;  2GIV A;  3JAM K;  3IHU A;  2K27 A;  4BNC A;  2KPM A;  3HB9 A;  3PNT A;  1LE8 A;  3P9C A;  4M3B A;  1MBE A;  3TOA A;  2JSP A;  2D1V A;  1ETQ A;  3WTS C;  1BI3 A;  4HQM A;  4RLQ A;  2KJB A;  4EJO A;  4WWC A;  2ELK A;  1VQ5 I;  2ZXI A;  1E3O C;  2G0E A;  2V9P A;  3IH3 A;  3PNY A;  2CFO A;  4RB1 A;  5AIP A;  3CD6 I;  3F8M A;  4CYD A;  4G6Q A;  1S72 I;  1W36 D;  3HEF A;  2OZU A;  4AIJ A;  2H6C A;  2X85 A;  5BNG A;  4ESJ A;  4CHU A;  1RIO H;  1ZHF A;  1BIA A;  5D8L B;  1Q1V A;  2AHQ A;  3BPV A;  1O3S A;  4XOP A;  2OJE D;  2HPM A;  2XRO A;  3ZN0 A;  2DQL A;  2RQQ A;  4QWQ A;  4IVN A;  3ZGK A;  1FBU A;  1IG7 A;  1KQ8 A;  3F8C A;  2TRT A;  5B3S H;  2EFW A;  3OMY A;  1Z05 A;  3DKW A;  4GYI A;  4I0A A;  4Y52 J;  2OCC H;  4OIQ F;  4IL6 C;  1F4K A;  5BS6 A;  2XAS A;  2DXI A;  5L3G A;  2K3F A;  2XV4 S;  1I50 J;  4F55 A;  4ZTF A;  1R1U A;  5FKL A;  3OYN A;  1DU0 A;  2KDZ A;  1S8N A;  4LGW A;  1GHC A;  1F1Z A;  4BJT A;  4V2F A;  3GTG J;  3ZMS A;  4ASN A;  3SJM A;  2JUC A;  3N97 A;  1U78 A;  1CF7 A;  2VBY A;  2HOS A;  2R7Q A;  5LHH A;  5CPR B;  2GXG A;  2L2O A;  1SD6 A;  5D6E A;  1WGX A;  2Z2S B;  2M9H A;  2M8E A;  2HDC A;  3LFU A;  3NWS A;  1HW5 A;  3DV8 A;  3BPX A;  2QSG X;  4A6E A;  2VJ4 A;  2F2E A;  3DWL E;  4WF2 A;  3ZR8 X;  4LG0 B;  2JPC A;  5J4V A;  1WZ2 A;  1TBX A;  1JKO C;  2DMN A;  3K0L A;  1I3Q J;  4RLF A;  3JR9 A;  1T56 A;  3K1N A;  1RET A;  2ELJ A;  1GDT A;  1T98 A;  3GUD A;  3OS0 A;  3S2D J;  3M1C A;  5JR3 A;  2E1N A;  4A93 J;  3LFK A;  4RAF A;  1Z3X A;  1S5L C;  4FE7 A;  2XAJ A;  5L3C A;  2WAQ A;  4LMY A;  2K9M A;  2WAE A;  4KT5 C;  4EM1 A;  5HNH A;  1Z77 A;  4HX7 A;  4CH7 A;  4A12 A;  3MQ0 A;  1JHF A;  3Q0U A;  2EA2 A;  2RQP A;  4CZZ A;  1FPQ A;  2LNB A;  3CUQ B;  3MZY A;  1QGP A;  4C3H J;  3G73 A;  3HXL A;  2YS9 A;  2W1O A;  3EUH A;  2MA3 A;  2IGN A;  3BLY A;  4XQF A;  4W97 A;  2JN6 A;  2OTJ I;  2I8D A;  4JOM A;  2DMT A;  2IP2 A;  1X1B A;  3O8H A;  4HAM A;  4ANJ A;  5D5U B;  3D1N I;  5M5W J;  3I9V 2;  1IV8 A;  3VFZ A;  2JQ7 A;  1Y6I A;  4XBF A;  3QPH A;  4ENK A;  1LDK B;  5ICE A;  2E7W A;  2PBI A;  3FBN B;  4HF1 A;  3GXO A;  3QWL A;  2ZB9 A;  1HBX G;  1IRG A;  2E19 A;  1POG A;  1EF4 A;  3K1M A;  2VXD A;  4ZYE A;  3JAM Z;  2DOE A;  2NVX J;  3L2Q A;  3FM5 A;  1SVM A;  4MEY F;  3HDD A;  3Q3S A;  1Z7U A;  1HKQ A;  4LK1 F;  5F6F A;  4B43 A;  3LSG A;  4HRI A;  1ZAO A;  3K4K A;  3IH2 A;  4BL0 B;  3B73 A;  2DT5 A;  2HU9 A;  1JJ6 C;  1R1V A;  2BBY A;  4LLG F;  3I3L A;  3A02 A;  1RR8 C;  4KJZ A;  3F3X A;  5HLH A;  1Z67 A;  2DOF A;  2QEX I;  1TNS A;  5HDN A;  2HXO A;  2AXT C;  1G3W A;  2IPQ X;  1ORK A;  4FX4 A;  5D5W B;  1ZGW A;  2PMH A;  3CUO A;  1MMD A;  2LD5 A;  2CUE A;  5CVJ A;  4J01 A;  2ZXW H;  3WTV C;  2CQN A;  2LC2 A;  1V54 H;  4JX5 A;  5DCM A;  3H36 A;  3TP0 A;  3IC7 A;  4V2G A;  2JVG A;  5E3L A;  1S3J A;  2P6T A;  2HYG D;  1XSV A;  2IW5 A;  2WBM A;  1IN6 A;  5AON A;  2Y0M A;  2DCE A;  3KP6 A;  2WWY A;  1VQL I;  4FET A;  2G7H A;  4CCO A;  3ZPL A;  2FD5 A;  5EEH A;  3F0C A;  3H1C A;  2K3P A;  3VB2 A;  1CGP A;  4A3D J;  2ZJ2 A;  5KNL A;  4OIN F;  5LRS A;  3VWB A;  2HQA A;  2RVC A;  4XRM A;  3TO9 A;  3CCS I;  4FIS A;  3O3K A;  3I55 I;  3GZN B;  1OCO H;  5BPD A;  2YSR A;  5J1R A;  1SVL A;  3IRR A;  3AG1 H;  4G6T B;  2ESN A;  4NNJ A;  4X0G A;  2EJR A;  4HNU A;  2GIZ A;  1D1A A;  1OPC A;  5IYB J;  2H94 A;  3LA3 A;  3DTI A;  2VKV A;  3UKG A;  1YHQ I;  1Z91 A;  5DCF A;  4HBL A;  3PSF A;  1S7A A;  3PSI A;  5FLX K;  1TP4 A;  1PUE E;  3FHN A;  2W84 A;  3ZQ7 A;  2BY2 A;  5F0C A;  4NHJ A;  5J6X A;  1RES A;  3CCU I;  3OS2 A;  3C3W A;  3FMS A;  1MZB A;  2QKL B;  3L7W A;  5KAI C;  1N75 A;  5FJ8 J;  4S04 A;  1G3Y A;  4J19 A;  4G6D A;  4XLF A;  2QVO A;  2KFD A;  3BG6 A;  2KIS A;  2Y0S A;  3DEE A;  4AID A;  3WG9 A;  2L9R A;  4OIP F;  2XC7 A;  1YQA A;  1R00 A;  1MJA A;  3E5X A;  4PZJ A;  1UFM A;  4A3E J;  3HOW J;  2M3A A;  2WAD A;  3CMM A;  1ONV A;  1X1D A;  3LSI A;  5DUI A;  1DP7 P;  2CU7 A;  2QUF A;  2WB1 A;  3L9F A;  4AD9 A;  2N8G A;  3D5R C;  1MDM B;  3DPT A;  2V1D A;  1PYV A;  3L2V A;  4HV6 A;  1VFC A;  4NDL A;  4BH9 A;  4CO8 A;  4DOZ A;  5HNF A;  2K9S A;  1WH5 A;  1JJ8 C;  1FSE A;  4BQO A;  1SAX A;  2F4I A;  3QYF A;  4GDF A;  1WJ5 A;  1RKW A;  2NYX A;  3TDZ C;  4UVA A;  4ZTJ A;  1MBH A;  4O6J A;  2ZME C;  2MD0 A;  2IGK A;  1FYL A;  5K7H A;  1K78 B;  1G3T A;  2ACJ A;  1TL8 A;  3T8T A;  5FRN A;  4HV5 A;  4H4K C;  4BAC A;  2CQQ A;  1MIJ A;  5J47 A;  4C2M J;  2RGV A;  2R7T A;  2M4G A;  2LY1 A;  2XGD A;  4Z6Y A;  2KIM A;  1V55 H;  1WVR A;  3CMA I;  2LVS A;  2FBK A;  4XLC A;  1P6R A;  1OCC H;  2HGC A;  2EFN A;  3ABU A;  2FBH A;  4KT6 A;  2XRN A;  4PSX A;  4E7L A;  1XMX A;  4F52 A;  1NK2 P;  2YPR A;  4HF0 A;  1PJR A;  2Z5U A;  1IXR C;  1HDD C;  3PL8 A;  3K7A J;  4EJT A;  3FK7 A;  3QU6 A;  3DTK A;  3WTX C;  2UXX A;  2LKX A;  1LVA A;  1G6N A;  2XF6 A;  4P9F A;  5TIS C;  1UJ8 A;  4BJ6 C;  3ZXS A;  2F4M B;  5K5R A;  1X3Z B;  2WY8 Q;  1JGG A;  2LMD A;  3OYG A;  2L7K A;  4U7B A;  3ASO H;  2M0M A;  2DA6 A;  3OL4 A;  4YG2 F;  2KHM A;  3HJE A;  1YLF A;  2DMP A;  4ZDO A;  3REO A;  4A3G J;  2D45 A;  5GAD J;  3CCV I;  3BR0 A;  6PAX A;  2IEK A;  4E7J A;  5DD8 A;  1EH8 A;  2DJN A;  2JWT A;  2ZO4 A;  3I59 B;  5H6Q A;  1MND A;  1E2X A;  4RAZ A;  1WKM A;  4IXA A;  2G7U A;  3QOD A;  4Y33 A;  4EM2 A;  3J7Z I;  1EA3 A;  2X51 A;  3R4K A;  4E7S A;  2KT0 A;  3O6B B;  2DAO A;  1X4O A;  4OU0 A;  2NVU B;  1VQK I;  2LFB A;  1FYM A;  3W2W A;  2QQB A;  4S05 A;  1PP8 F;  2LY9 A;  2WV1 A;  4N9H A;  1HKS A;  1LEA A;  4LIU A;  5D5V B;  1FOY A;  1ZQ3 P;  3OYC A;  3MCZ A;  4CXF A;  4IOC F;  2KIF A;  3QYB A;  4FX0 A;  3K6G A;  4HST A;  1YJW I;  2VJ5 A;  2KQR A;  1SFK A;  2FOW A;  4RM3 A;  4IHV A;  3K69 A;  4BU2 A;  3L2R A;  3SEQ A;  3I53 A;  4NQW B;  4AVZ A;  3S15 J;  2HS5 A;  1VQN I;  3FIW A;  4M71 A;  4XKC A;  1R7J A;  4A3B J;  2LRE A;  3AFH A;  4XOT A;  3HL2 A;  3L2C A;  2R7F A;  2E35 A;  3R0A A;  3CMY A;  4RBO A;  2JK3 A;  1TW3 A;  3S2W A;  1O3T A;  1L3L A;  2DK8 A;  1YYV A;  3HUG B;  1FTZ A;  3JCU C;  4UUS B;  3OSG A;  3EYY A;  1DU6 A;  5AIQ A;  3S14 J;  2MGQ A;  1OYW A;  2HXI A;  2ZSH B;  1XDU A;  3CCM I;  1UB9 A;  4BDZ A;  2DTR A;  3W3C A;  2BW3 A;  2PMZ N;  1KZH A;  3TMO A;  1E0E A;  2W00 A;  1V5E A;  3F6O A;  4JQF A;  1U8R A;  2DLL A;  2O03 A;  1KON A;  1X58 A;  4CCJ A;  5HLG A;  3KIO A;  5LHI A;  2KL4 A;  3S17 J;  3RKW A;  2L9S A;  1BIB A;  3GTM J;  1JKP C;  1XB4 A;  2K02 A;  1GXQ A;  1BOB A;  2PX9 A;  1MBK A;  3LST A;  3KP2 A;  4ITV A;  1ZG5 A;  1S7E A;  2V79 A;  4XOR A;  1JUS A;  1XGO A;  1IZ1 A;  3K4M A;  1VQ9 I;  5FD5 A;  2DO7 A;  1IJW C;  4GXO A;  2LBF B;  3H3V K;  1FIA A;  1UG2 A;  2FRH A;  2OV7 A;  3OYJ A;  2R7S A;  2JJ7 A;  1XGN A;  4LB6 B;  2LTP A;  1FLI A;  4UHT A;  4AM3 A;  1HOM A;  1W7P B;  4I6Z A;  3E7L A;  1B8I B;  3BTJ A;  2EIL H;  1ZKG A;  3ZMV A;  2QKM B;  4WXD A;  5DM6 F;  2O61 A;  2W57 A;  1BL0 A;  1FOK A;  1KQ9 A;  3PIP F;  2LR8 A;  5CQE A;  4IOA F;  1SFO J;  2HQR A;  1G4D A;  3BG7 A;  2ZNY A;  3HZJ A;  4OMY A;  1D8K A;  4XK4 A;  1A36 A;  4A3C J;  4QPQ A;  2EZL A;  2Y31 A;  1Z21 A;  5FKK A;  1X3U A;  2PG4 A;  3H3Z A;  3CF5 F;  1JKQ C;  5GPA A;  1MMN A;  1QU3 A;  4GCV A;  1TWH J;  4LG0 A;  2MH2 A;  3LOC A;  5K5O A;  1R71 A;  2LRD A;  2V9V A;  1TT5 B;  4ZYA A;  4OIR F;  5F0H A;  2MW8 A;  3B02 A;  1Z6R A;  2VQH A;  3AAF A;  2ID3 A;  3OYB A;  3OOP A;  3I59 A;  1OJL A;  5E18 F;  3S1M J;  2DOD A;  3CLO A;  1VQ8 I;  1U2W A;  3I4P A;  4M73 A;  3KET A;  1P9Q C;  5FKN A;  3WTT C;  3OWT A;  1UMQ A;  3CCY A;  3RZO J;  4PJJ A;  4L9T A;  1J5Y A;  3BQY A;  1Y0N A;  4I2O A;  1IXS B;  3MKZ A;  2ZFW A;  1ZGJ A;  2EFP A;  3LSK A;  5E8I A;  2LOO A;  2K85 A;  5JHU A;  1U3E M;  2QZ8 A;  5LBQ A;  4BKX A;  1OYI A;  3R61 A;  2KKO A;  2CH0 A;  1HSJ A;  4E4H A;  2VAS A;  4N4N B;  3GO5 A;  3QRF F;  1BA5 A;  5H6R A;  4XLE A;  2FNA A;  4PCQ A;  2XPU A;  4F92 B;  5EEA A;  1IRF A;  2ECC A;  4M3D A;  3ERM A;  2H1K A;  2XAG A;  2L5Q A;  3UNG C;  4LIT A;  4Q5S F;  2KZV A;  3I71 A;  1U9N A;  5E3N A;  5FLV A;  4B3X A;  2CS3 A;  1R4N B;  2P6S A;  3FZV A;  2M5W A;  3K4C A;  2P5V A;  4MEX F;  2XIG A;  2KIU A;  1ETX A;  3HKZ A;  2OPT A;  3H5A A;  1T0F A;  1U8B A;  3TP3 A;  2VC0 A;  3FKJ A;  4M9X A;  2DA4 A;  1BW5 A;  2VI6 A;  2F5D A;  4BHP A;  1NHA A;  4IQ4 A;  2M87 A;  3V8L A;  4BQQ A;  4IRH A;  1X2M A;  2XAF A;  3F8N A;  3SZG A;  4KNY A;  3E1S A;  4EAT A;  4G8X A;  5IOZ A;  2NRA C;  4C3I J;  1TQP A;  2O7O A;  5FB2 A;  3CCJ I;  2MC3 A;  2IVM A;  3M9A A;  3OYI A;  2E7X A;  4AU7 A;  4D1Q A;  1B72 B;  4A3F J;  3A01 A;  2DI3 A;  3NWT A;  4A0X A;  3OR1 C;  4B3A A;  2FA5 A;  5IOY A;  2GM4 A;  5IY5 H;  1FY7 A;  2L01 A;  3LSP A;  3KZI C;  1A31 A;  4HYE A;  1KU3 A;  2Y9Z A;  1T08 B;  2HZT A;  4BGD A;  4MGR A;  1F36 A;  1VQM I;  3KX2 A;  3IP4 B;  2RRE A;  2O9L A;  3DCF A;  3AG2 H;  3OYK A;  4D5F A;  1WFX A;  1SMY F;  2GAU A;  3TW6 A;  5C44 J;  1M1E B;  1NK3 P;  2IGO A;  1NG7 A;  1D1B A;  2E2I J;  4BHC A;  1I6X A;  4BXF A;  3JRF A;  1J9I A;  3RTR A;  1IN7 A;  2YX7 A;  1Z7L A;  4XKB A;  2E71 A;  4ENN A;  4I01 A;  1GVD A;  2A3S A;  1K61 A;  2F5C A;  3D0S A;  1XSD A;  1ENH A;  3RPQ A;  2UZK A;  5JLX A;  2Y48 A;  3SHF A;  2DMU A;  1T8I A;  4XLP F;  1LVK A;  2V9K A;  2XHK A;  3DU6 A;  5D8K B;  1KA8 A;  4XL9 A;  5C3E J;  4BXX J;  1LEB A;  4U87 A;  5BOX A;  5FO5 A;  1C0W A;  2IS6 A;  2NNN A;  1W4M A;  3CO7 C;  2XAH A;  3FXO A;  2XSJ C;  3FXU A;  4XKW A;  2KDO A;  3ZQF A;  4L9N A;  2OC6 A;  2F5E A;  3WTZ A;  2V1U A;  2LKP A;  5K5Q A;  3DFG A;  2R93 J;  3IAS 2;  2W48 A;  1TC3 C;  2DBB A;  3LMM A;  3M8E A;  4PJN A;  1U5T A;  1K4T A;  4PFP A;  2GXA A;  2K9N A;  3SXY A;  5FRM A;  3H5R A;  1MBF A;  2AQE A;  2EWN A;  5HS7 A;  3WU1 B;  3G2B A;  3WTY C;  3GWZ A;  1FZP B;  1P4W A;  4PGG A;  2YR2 A;  4UV9 A;  3J80 Z;  1X1C A;  1WJC A;  2GBY A;  4EEF G;  1D3Y A;  3M07 A;  1ACI A;  4XR6 A;  1LPQ A;  3VSL A;  3HIF A;  4FQG A;  4E7I A;  1H8A C;  1G2H A;  4EMS A;  1TQI A;  9ANT A;  4D5C A;  4UUV A;  1XC5 A;  1QHG A;  1XG1 A;  1HLV A;  3IRQ A;  3A4C A;  1WI9 A;  3G1O A;  4CCK A;  4L5I A;  2Q8K A;  2QWW A;  3W2A A;  3DPU A;  1UZC A;  1U0J A;  2PMU A;  5KVR A;  4S0H B;  2FMY A;  3TGN A;  4XM3 A;  4QTR A;  2HDD A;  3S2H J;  2BV6 A;  1D5Y A;  2A6H F;  2PFB A;  4N9I A;  1ZYR F;  3C7J A;  3TDU C;  2VUM J;  2DMQ A;  1LFP A;  1KYW A;  1TW2 A;  1D0Z A;  3GZ5 A;  3IV5 A;  4J00 A;  3V8K A;  3N4M A;  3GBG A;  3LSM A;  2STW A;  4B47 A;  1E3H A;  3ML6 A;  5LFA A;  3COA C;  4BDY A;  3DP7 A;  4F7Z A;  3MKL A;  1YIO A;  1FP1 D;  4ENM A;  1W0T A;  1UST A;  2WAQ N;  2VT2 A;  4OMZ A;  2VQL A;  3GCM A;  2E60 A;  2EIM H;  4RMN A;  1I1S A;  2R0Q C;  5GPC A;  5GAG J;  5DDG A;  1O3R A;  2C6Y A;  1RNL A;  4EGY A;  2P7C B;  4AYB A;  5HLT A;  3ULQ B;  2HTS A;  1YS6 A;  3HOV J;  1V5F A;  4G7O F;  4KUM A;  1FBS A;  1ULY A;  3EQL F;  1E3P A;  1TWC J;  1VF9 A;  2EFQ A;  3CCR I;  2NS7 A;  2XB0 X;  2VPL A;  2X1E A;  5DCM B;  3LWF A;  1GVJ A;  4IKF A;  3KP4 A;  3OIP A;  1DP3 A;  1V3F A;  4DGW B;  3EET A;  2BVL A;  2HVS A;  5D4R A;  2QGU A;  2XPV A;  4WCG A;  2FUG 2;  4L18 B;  3S3O A;  3EYI A;  4PJ0 C;  4KIB A;  4EV0 A;  4NC7 A;  1IRX A;  2RV8 A;  1JUP A;  2JZY A;  2WB1 N;  3V8J A;  1XGM A;  3S32 A;  3M8F A;  4KYW A;  4DYC A;  4N4O B;  3GTL J;  4A3L J;  2ME0 A;  3H92 A;  2LF8 A;  2KP6 A;  2YU9 J;  2O6G E;  3Q9V A;  2R4G A;  2EK5 A;  4IJA A;  1MMS A;  3FXK A;  3HRS A;  1FP2 A;  3RKY A;  3V4G A;  4ABZ A;  2OCE A;  2BY3 A;  3ABL H;  1QO0 D;  1NTC A;  1B59 A;  2OA4 A;  4MLO A;  1A6Q A;  2DU9 A;  3I4M J;  3OYM A;  5FFX A;  2COM A;  2JSC A;  3DTE A;  3G1M A;  2CV0 A;  4LFU A;  1TZL A;  2HNH A;  1T2K A;  2KRF A;  1T38 A;  3GFI A;  5B1B H;  4A6D A;  1VQ4 I;  1AU7 A;  2OZ6 A;  3PIO F;  3RKQ A;  4QLC U;  3NAR A;  2HKX A;  4ZDP A;  2I5U A;  1ITY A;  4QSH A;  1WPK A;  5LD2 C;  3I64 A;  1IC8 A;  2TCT A;  2LYC A;  1MSE C;  3R60 A;  3ZMZ A;  1PP7 U;  5EYR A;  2L7M P;  2VBZ A;  4MQV A;  1XX5 A;  3TW7 A;  2E1M B;  1MNM C;  2ZSI B;  3HOS A;  2CUF A;  1N77 A;  2FSW A;  5K1Y A;  1WJF A;  3JW4 A;  5FKO A;  3TKY A;  2HPI A;  4CA0 A;  3WOD F;  2OBP A;  2WAF A;  2DYS H;  1G59 A;  2LH9 A;  4KIT B;  3WHC A;  2I10 A;  2NVT J;  4XRF A;  1B9N A;  2QQA A;  4HG2 A;  1Z9C A;  3OYH A;  5TGT A;  1QPI A;  4M74 A;  2L9N A;  3JRC A;  2IT0 A;  3ZQC A;  2VKD A;  2LLK A;  2Y0S N;  2FXA A;  3CES A;  4BUP A;  3HTU A;  3D5L A;  3AL0 C;  1P7J A;  3NAU A;  3S1Q J;  3QYE A;  2X1C A;  5K7F A;  1IW7 F;  1BJA A;  3HBL A;  3CJR B;  3J7A O;  2UWM A;  1GLN A;  2EZK A;  2VE8 A;  2B7E A;  5ILU A;  1K6O A;  1YJ9 I;  1IAW A;  5IT9 K;  5M3M J;  4IX7 A;  5GTI C;  2PJR B;  4RDU A;  3WHB A;  4XIC A;  2O8K A;  2PN6 A;  2RNG A;  1DGR M;  1P92 A;  1MDM A;  3C2G A;  3HKZ N;  4CIC A;  5DV5 A;  4XRS G;  3L1P A;  1R58 A;  2D1H A;  1OR7 A;  3WE2 A;  2E1C A;  1PUF B;  1HCR A;  2XB5 A;  2DA2 A;  5EG0 B;  2IA1 A;  3BZK A;  1UHM A;  5LGN A;  2RKH A;  3G3Z A;  1BBY A;  5D5X B;  5H20 A;  4FAS D;  1T39 A;  2P4W A;  2PJR A;  1SAN A;  5LRR A;  4CCL A;  5GAE J;  4W1U A;  3DBH B;  3RDI A;  2ID6 A;  1QPM A;  2VJJ A;  4ZJZ A;  1YW7 A;  4ZDL A;  2BHZ A;  1IO2 A;  3ZQG A;  5E3O A;  4CYC B;  4HDU A;  2VOD A;  3A0B C;  2MLG A;  2P81 A;  2ZME A;  2K7L A;  3ZCO A;  2IRF G;  3F23 A;  1BC7 C;  2JRT A;  3JRB A;  3DXJ F;  4EGZ A;  3SFI A;  5F1R A;  2ETH A;  1FYK A;  2BZT A;  1X3W B;  1ZG3 A;  3B6C A;  5E20 A;  1DQU A;  3L00 A;  2BXY A;  2DT7 B;  1K78 A;  2VN2 A;  1XSX A;  2XPW A;  4RGR A;  4DZJ A;  2R92 J;  4PJM A;  2E2J J;  3ZMU A;  4WK8 F;  2KIQ A;  1T0F C;  2HR3 A;  1R5I D;  1H9G A;  1E17 A;  1FEX A;  3CUQ A;  1F5T A;  5EG0 A;  2CWE A;  3MVP A;  1JTX A;  1BN5 A;  3CQZ J;  2M1B A;  4XN0 A;  5JVT A;  3U1D A;  3DKX A;  1EH6 A;  2LDU A;  1FMW A;  3HHH A;  4RS8 A;  3O8G A;  4BBS J;  1OCP A;  2CQK A;  4U0Y A;  2ZKZ A;  1RR7 A;  4XLN F;  1Z6T A;  2MYS A;  3V7C A;  3H9J A;  2R7X A;  4KMU X;  2NXN B;  5DUK A;  3P5J A;  1I5Z A;  2FX0 A;  2H6B A;  4MFD A;  4RGS A;  4EVI A;  3V7R A;  2STT A;  2H1L A;  2V26 A;  1OCT C;  4PSW A;  2E5Z A;  4YEL A;  3JTG A;  4RGX A;  4LG3 A;  4ESF A;  5C4J J;  1FWZ A;  1BI0 A;  2XGC A;  2OQG A;  3I0T A;  4PDK A;  3IL2 A;  1QZZ A;  5FFZ A;  4UNO A;  1LB2 A;  4DYQ A;  1TNT A;  3HPG A;  1OFC X;  2OU2 A;  5D4S A;  5LLQ A;  4P55 A;  2IGM A;  4GO1 A;  2VIX A;  1AWC A;  1QA6 A;  3CO6 C;  1TTY A;  2DT6 A;  3Q5F A;  2H8R A;  3BTI A;  2XAU A;  3GLX A;  2VKH A;  2H27 A;  1U5T B;  1PDN C;  1QQI A;  2TDX A;  2NVQ J;  2DYR H;  3BDD A;  4B44 A;  1ETV A;  2QCO A;  3CP2 A;  1BC8 C;  4Q4Z F;  3DLA A;  1X4P A;  4G7Z F;  4ZYD A;  2L54 A;  4GRI A;  2IAI A;  2ZC2 A;  2VBW A;  3OV8 A;  5B1A H;  1MSF C;  5TJJ A;  5TRD A;  2A05 A;  2ZJQ F;  2JMW A;  2W4S A;  3IKV A;  4HDV A;  2F4O B;  3CCL I; 
#chains in the Genus database with same CATH homology
 3P7N A;  4IHS A;  5LEK A;  2P5L C;  1MKM A;  1IUY A;  3VEP A;  1SD7 A;  3ERE D;  2FF4 A;  1J2X A;  4U0W A;  5CLS A;  1SFU A;  1I1G A;  2PEX A;  1WWX A;  4HLX A;  3E6C C;  2DPU A;  3RJP A;  4RB3 C;  2EV5 A;  3K2Z A;  1K79 A;  5DEQ A;  2JPB A;  3P9I A;  5IT3 A;  2XKO A;  2BGC A;  1MGT A;  3RYP A;  2H09 A;  1SD5 A;  3GF2 A;  2Z99 A;  1VTN C;  5HLI A;  2FQ3 A;  5HS9 A;  1WSU A;  3H3U A;  4P5O A;  4G9Y A;  3HOT A;  3WE3 A;  5CVV A;  3Q9S A;  2ZBK A;  3NQO A;  2QLZ A;  2L3D A;  5A2Q K;  4G7H F;  4KIF A;  1R23 A;  3IKT A;  5L3D A;  4EJW A;  1DDN A;  3FF5 A;  1WQ2 A;  5FD6 A;  4OIO F;  2A6E F;  2A07 F;  2V1X A;  2IA2 A;  2Z33 A;  1XMA A;  3F6V A;  1HQC A;  3BOQ A;  4DNC A;  2V6C A;  4ZYG A;  4ON0 A;  1GXP A;  1ON1 A;  3GEZ A;  3F72 A;  3SZT A;  2MLK A;  3WGH A;  3PQK A;  4LLL A;  4LLN A;  4UVB A;  3FM3 A;  4AIH A;  4WXH A;  2FEZ A;  4Y13 A;  2X0L A;  3R0J A;  3HUG A;  1P4A A;  3T5X A;  3O2P E;  1O7L A;  4ZZL A;  1DPR A;  3E6M A;  3CDH A;  2DW4 A;  4KDP A;  4IRG A;  2A69 F;  4Q47 A;  3MZH A;  4KFC A;  3MWM A;  4I02 A;  4I09 A;  2M45 A;  2VXZ A;  4Q48 A;  1RZ4 A;  1ZGA A;  3LA7 A;  3E5U A;  1IN5 A;  4HOB A;  3GFJ A;  1ZAR A;  4A0Z A;  2GQQ A;  3KZY A;  2PLY A;  3BP8 A;  4B09 A;  1IF1 A;  3BJA A;  4ESB A;  4U7D A;  4L9V A;  1AOY A;  2AXL A;  3DQV C;  1J59 A;  2DK5 A;  2RC4 A;  1STZ A;  1W7P A;  1G3S A;  1Q1H A;  3FXR A;  3WGI A;  4IPA A;  2QEN A;  5ILV A;  4M72 A;  2KJC A;  5CVR A;  4IF4 A;  4RGU A;  1T6S A;  2FML A;  3KCC A;  1XN7 A;  2MD5 A;  2Q0O A;  3ZP5 A;  1R5G A;  3BY6 A;  4M6Y A;  4YII A;  1HW2 A;  3QAH A;  1KQ0 A;  3T0Y A;  2OD5 A;  1S29 A;  1W7P D;  3ISP A;  1XD7 A;  1JHH A;  5CVU A;  1REP C;  2CO5 A;  2UXN A;  1LDJ A;  4HW0 A;  3C1D A;  4ZZD A;  4AVP A;  5IT9 Z;  1UHW A;  1ZLJ A;  3HHG A;  2D2W A;  2LSO A;  4MTE A;  1ZRF A;  1JXS A;  3J81 Z;  1TLH B;  3HRT A;  4BYY A;  3CUQ C;  3HTS B;  5DD4 A;  1D8J A;  4MTD A;  4I98 B;  5CVI A;  2W85 A;  5ILS A;  3U2R A;  1KYZ A;  1EV7 A;  5E17 F;  3LA2 A;  4HZF A;  4R1H A;  3T1B A;  3W6J B;  2QM3 A;  3CTA A;  2ZXJ A;  4LB5 A;  2VE9 A;  3BZ6 A;  1FX7 A;  4YFK F;  3M7G A;  1CF7 B;  1MJ9 A;  5ED4 A;  2R3S A;  5E1X A;  2L02 A;  3LQQ A;  1BI1 A;  1BOA A;  5LHG A;  3JSP A;  1LQ1 A;  2B0L A;  3WGG A;  2ZNZ A;  2HQN A;  3E6B A;  2CGP A;  2M30 A;  3ZMD A;  5CYV A;  5KK1 A;  5E1Z B;  3WU0 A;  2FU4 A;  1XCV A;  3SQN A;  2EFO A;  3GVA A;  2FE3 A;  1LDD A;  2ZME B;  2GA2 A;  2AS5 F;  1ZG1 A;  4L0Y B;  2O3F A;  2ZCW A;  5L3E A;  2CG4 A;  1IXC A;  2HOE A;  5LGT A;  2XKP A;  4B8X A;  4YFN F;  3E5Q A;  3IWZ A;  1LNW A;  5D6F A;  4HLY A;  4YIF A;  4KIC A;  4IHT A;  5BQT A;  1RUO A;  1R5H A;  3J81 K;  3GFM A;  3F8B A;  5DYM A;  5E1W A;  1B6A A;  5HDK A;  2QBY A;  3WTU C;  1A04 A;  1B4A A;  3CJN A;  2Z3Y A;  4FHT A;  4R79 A;  3FX3 A;  2HTJ A;  2LF7 A;  3V7S A;  4PGH A;  2PJP A;  2QBY B;  3HSF A;  2IJL A;  1OMI A;  1XGS A;  4ETS A;  5J8C A;  4TV7 A;  1USS A;  5HS8 A;  1JGS A;  3QOP A;  2JT1 A;  3EDP A;  2A61 A;  1IN4 A;  4G94 A;  4KIG A;  1OKR A;  3ZMT A;  3FWE A;  1QBJ A;  4Z2Y A;  1TQM A;  2CW0 F;  4MHG A;  1ZRE A;  1SFX A;  3SZP A;  1ZLK A;  1LJ9 A;  4M9S A;  1K7A A;  4K2E A;  1QZY A;  1D5V A;  2Z9O A;  2IA0 A;  2GA1 A;  3ABT A;  2K4J A;  4JK1 X;  4WXC A;  1EH7 A;  2GXB A;  3TO6 A;  5JFR A;  2FOK A;  3DEU A;  1DUX C;  3QP6 A;  2YU3 A;  1J0R A;  3ECO A;  4GYG A;  1H0M A;  2XUB A;  3BWG A;  5F64 A;  3ZN1 A;  4BXU A;  5HOO A;  1RI7 A;  4GGG A;  4M6X A;  3TOB A;  3U9G A;  1V4R A;  3RPU A;  1B9M A;  2ISZ A;  3F22 A;  2CYY A;  4DQ2 A;  4CGZ A;  3KEQ A;  4IRI A;  2VT3 A;  2RDP A;  3QU3 A;  4A5N A;  2L4M A;  4Y17 A;  5E8G A;  4WX9 A;  1U5T C;  3HRU A;  2FBI A;  3MFK A;  1YW8 A;  1OYY A;  2GWR A;  4MNU A;  4I7H A;  1HST A;  3KE2 A;  3K9T A;  3ELK A;  1BI2 A;  2DPD A;  4P9U A;  4HA8 A;  4L5J A;  1SFE A;  1QNT A;  4UV8 A;  5A2Q Z;  2Q2E A;  3GZ6 A;  3KFW X;  4XSX F;  1O7F A;  4EQQ A;  2RN7 A;  1XMK A;  2CFX A;  3L09 A;  1RUN A;  1F9N A;  3DPL C;  3PQJ A;  2J5P A;  4U88 A;  1HXD A;  1BM9 A;  4KA4 A;  2VC1 A;  4D0P A;  4I0B A;  2P5K A;  3I54 A;  4HX4 A;  1HW1 A;  1ZN2 A;  3K1P A;  1H9T A;  3FMR A;  1O57 A;  2CSO A;  3PFI A;  4KMF A;  4RB0 A;  3RKX A;  4N0B A;  1Y0U A;  2BYV E;  2NAZ A;  3FHZ A;  1R22 A;  4A2U A;  3GW2 A;  5CJ9 A;  2ESH A;  2XVC A;  5ICG A;  2G9W A;  1SD4 A;  2YX4 A;  3VOE A;  2VBX A;  3KEO A;  1W5S A;  3W6K B;  2O0Y A;  1ON2 A;  4LK0 F;  3HRM A;  1ZRC A;  2BEO A;  3BJO A;  3BRO A;  3HSE A;  4A0Y A;  2JTV A;  4OOI A;  2F5F A;  1FT9 A;  1O3Q A;  5BMZ A;  2OQR A;  3ROU A;  5FGM A;  4O3M A;  3JTH A;  4LD5 A;  2K4B A;  1I27 A;  1U6G A;  3P9K A;  2X4H A;  1R1T A;  3T8R A;  2L4A A;  5LGU A;  3KLO A;  2OAZ A;  4BQA A;  2P8T A;  3SFZ A;  5BPI A;  1P2F A;  2HFH A;  2HYF A;  1XCB A;  1J75 A;  3WTW C;  3M1E A;  4P96 A;  2ISY A;  3TQN A;  3F21 A;  3KZZ A;  2R7D A;  5L3B A;  5EEG A;  1W5T A;  1YTY A;  2Y75 A;  3RIR A;  1YG2 A;  3KP3 A;  1FBQ A;  5L3F A;  4NB5 A;  1JE8 A;  4ZH4 F;  3J80 K;  1KU9 A;  4AIK A;  1FC3 A;  3FMQ A;  1P4X A;  1L0O C;  2XGX A;  1R36 A;  3LAJ A;  4E70 A;  1DPU A;  4ZYH A;  1ZH5 A;  3MEX A;  3KP5 A;  2K86 A;  4L0Z B;  3HSR A;  5LEJ A;  5ERI A;  2VOO A;  4U0V A;  4ENJ A;  5ICF A;  1KU2 A;  3LAP A;  3HYI A;  2XAQ A;  3R6S A;  2W25 A;  2A5Y B;  3FXQ A;  2WV0 A;  3GFL A;  1YO5 C;  1Z1D A;  2NS0 A;  4A5M A;  1IN8 A;  4EJV A;  2EA4 A;  2WTE A;  4O5V A;  4BAY A;  2A68 F;  1YS7 A;  1WRJ A;  1FNN A;  2NNY A;  1S6L A;  3RYR A;  4HQE A;  5HVQ C;  5J8F A;  4UVC A;  4Y15 A;  3KP7 A;  4EJU A;  1YW9 A;  2J5O A;  1MJB A;  5FLX Z;  3LQR A;  4M9Z A;  2VON A;  3GYH X;  2VOP A;  2O8X A;  3E6D A;  3DF8 A;  3I5U A;  4R8H A;  3C18 A;  3JSO A;  4EM0 B;  1ZRD A;  3VOD A;  4HF2 A;  2P7V B;  5HDG A;  1B1B A;  1YFH A;  4H0E A;  2ELH A;  2GZW A;  1SMT A;  5JI6 A;  4XSZ F;  1FSH A;  4MQ9 F;  2FNP A;  1J7K A;  2BE5 F;  3I58 A;  1KGS A;  2EB7 A;  4LJZ F;  3NEU A;  2EV0 A;  4CDG A;  2QQ9 A;  3QP5 A;  4RAY A;  3TO7 A;  3QPT A;  4BHB A;  4KN4 X;  2QYO A;  4YFX F;  3GX4 X;  3ECH A;  2W24 A;  4JBA A;  2DQR A;  2MBF A;  1MD0 A;  5ICC A;  4RB2 C;  2WC2 A;  3MAJ A;  4KN7 X;  3RI4 A;  4NQW A;  1ODD A;  2HKO A;  4FT8 A;  2HEO A;  3E97 A;  3F8F A;  3IWF A;  3KLN A;  2DFI A;  1S7O A;  2RNJ A;  1UCR A;  1HKT A;  2PI0 A;  2MH9 A;  2EV6 A;  3BJ6 A;  3NRV A;  2ADU A;  4UXN A;  4AWX B;  3E3V A;  4L9J A;  2HWV A;  2PQ8 A;  1XDS A;  1KU7 A;  4HX8 A;  2GIV A;  3JAM K;  3IHU A;  2K27 A;  4BNC A;  3P9C A;  3TOA A;  2D1V A;  3WTS C;  1BI3 A;  4HQM A;  2KJB A;  4EJO A;  4WWC A;  4RB1 A;  5AIP A;  3F8M A;  4CYD A;  4G6Q A;  2OZU A;  4AIJ A;  2H6C A;  4ESJ A;  4CHU A;  1RIO H;  1ZHF A;  1BIA A;  5D8L B;  3BPV A;  1O3S A;  2XRO A;  3ZN0 A;  2DQL A;  4QWQ A;  4IVN A;  1FBU A;  1KQ8 A;  3F8C A;  2EFW A;  1Z05 A;  3DKW A;  4GYI A;  4I0A A;  4OIQ F;  1F4K A;  5BS6 A;  2XAS A;  5L3G A;  2XV4 S;  1R1U A;  1S8N A;  4LGW A;  1GHC A;  1F1Z A;  3ZMS A;  4ASN A;  3N97 A;  1U78 A;  1CF7 A;  2VBY A;  5LHH A;  2GXG A;  5D6E A;  1SD6 A;  2M8E A;  2HDC A;  1HW5 A;  3DV8 A;  3BPX A;  4A6E A;  2F2E A;  4WF2 A;  4LG0 B;  2JPC A;  1TBX A;  3K0L A;  3K1N A;  1T98 A;  3GUD A;  5JR3 A;  2E1N A;  3LFK A;  5L3C A;  2XAJ A;  4LMY A;  4KT5 C;  4EM1 A;  4HX7 A;  4A12 A;  3MQ0 A;  1JHF A;  2EA2 A;  2RQP A;  4CZZ A;  1FPQ A;  2LNB A;  3CUQ B;  3MZY A;  1QGP A;  3G73 A;  3EUH A;  2MA3 A;  2IP2 A;  4HAM A;  5D5U B;  3VFZ A;  4XBF A;  3QPH A;  4ENK A;  1LDK B;  5ICE A;  2E7W A;  2PBI A;  4HF1 A;  3GXO A;  1IRG A;  1HBX G;  3K1M A;  4ZYE A;  3JAM Z;  3FM5 A;  4MEY F;  1Z7U A;  1HKQ A;  4LK1 F;  5F6F A;  1ZAO A;  3B73 A;  2DT5 A;  1R1V A;  2BBY A;  4LLG F;  3F3X A;  5HLH A;  1TNS A;  5HDN A;  1G3W A;  2IPQ X;  4FX4 A;  5D5W B;  2PMH A;  3CUO A;  5CVJ A;  3WTV C;  5DCM A;  3IC7 A;  1S3J A;  2P6T A;  2HYG D;  1XSV A;  2IW5 A;  5AON A;  1IN6 A;  2Y0M A;  3KP6 A;  2WWY A;  2G7H A;  3ZPL A;  5EEH A;  3VB2 A;  1CGP A;  2ZJ2 A;  4OIN F;  5LRS A;  2RVC A;  3TO9 A;  3O3K A;  5BPD A;  2YSR A;  3IRR A;  2ESN A;  2EJR A;  1OPC A;  2H94 A;  3LA3 A;  1Z91 A;  5DCF A;  4HBL A;  1S7A A;  5FLX K;  1PUE E;  2W84 A;  3ZQ7 A;  4NHJ A;  5J6X A;  3C3W A;  3FMS A;  1MZB A;  3L7W A;  4S04 A;  1G3Y A;  4G6D A;  2QVO A;  3WG9 A;  4OIP F;  1YQA A;  1R00 A;  1MJA A;  3E5X A;  4PZJ A;  1UFM A;  1ONV A;  5DUI A;  1DP7 P;  2QUF A;  3L9F A;  4AD9 A;  1MDM B;  3DPT A;  2V1D A;  4HV6 A;  4BH9 A;  4CO8 A;  1FSE A;  1SAX A;  2NYX A;  3TDZ C;  4UVA A;  4O6J A;  1FYL A;  1K78 B;  1G3T A;  2ACJ A;  3T8T A;  4HV5 A;  2RGV A;  2KIM A;  2FBK A;  1P6R A;  2HGC A;  2EFN A;  3ABU A;  2FBH A;  2XRN A;  2YPR A;  4HF0 A;  2Z5U A;  1IXR C;  4EJT A;  3QU6 A;  3WTX C;  2UXX A;  1LVA A;  1G6N A;  4P9F A;  5K5R A;  4U7B A;  4YG2 F;  1YLF A;  3REO A;  2D45 A;  6PAX A;  5DD8 A;  1EH8 A;  3I59 B;  2ZO4 A;  5H6Q A;  1E2X A;  4RAZ A;  1WKM A;  4IXA A;  2G7U A;  4EM2 A;  3R4K A;  3O6B B;  2DAO A;  4OU0 A;  1FYM A;  2QQB A;  4S05 A;  1PP8 F;  4N9H A;  1HKS A;  1LEA A;  5D5V B;  3MCZ A;  4CXF A;  2KIF A;  4FX0 A;  3K69 A;  3I53 A;  2HS5 A;  4M71 A;  1R7J A;  3L2C A;  2R7F A;  3R0A A;  1TW3 A;  3S2W A;  1O3T A;  1L3L A;  2DK8 A;  1YYV A;  3EYY A;  5AIQ A;  1OYW A;  1XDU A;  1UB9 A;  2DTR A;  3F6O A;  1U8R A;  4JQF A;  2DLL A;  2O03 A;  5HLG A;  5LHI A;  3RKW A;  1BIB A;  1XB4 A;  2K02 A;  1GXQ A;  3LST A;  3KP2 A;  1ZG5 A;  2V79 A;  1XGO A;  1IZ1 A;  5FD5 A;  2DO7 A;  4GXO A;  2FRH A;  1XGN A;  4LB6 B;  1FLI A;  4UHT A;  1W7P B;  3ZMV A;  4WXD A;  2O61 A;  2W57 A;  1FOK A;  1KQ9 A;  2HQR A;  1G4D A;  2ZNY A;  4OMY A;  1D8K A;  1X3U A;  2PG4 A;  3H3Z A;  4GCV A;  4LG0 A;  2MH2 A;  5K5O A;  2V9V A;  4OIR F;  3B02 A;  1Z6R A;  3AAF A;  3OOP A;  3I59 A;  5E18 F;  3CLO A;  1U2W A;  3I4P A;  4M73 A;  3KET A;  3WTT C;  4L9T A;  1J5Y A;  4I2O A;  1IXS B;  2ZFW A;  1ZGJ A;  2EFP A;  5E8I A;  5JHU A;  1U3E M;  2QZ8 A;  5LBQ A;  1OYI A;  3R61 A;  2KKO A;  1HSJ A;  3QRF F;  3GO5 A;  5H6R A;  2FNA A;  4PCQ A;  1IRF A;  2XAG A;  4Q5S F;  3I71 A;  2P6S A;  3FZV A;  2M5W A;  2P5V A;  4MEX F;  2XIG A;  2KIU A;  1T0F A;  2VC0 A;  4M9X A;  2F5D A;  4BHP A;  1NHA A;  2M87 A;  3V8L A;  4IRH A;  2XAF A;  3F8N A;  4KNY A;  4G8X A;  2NRA C;  1TQP A;  5FB2 A;  2MC3 A;  2IVM A;  3M9A A;  2E7X A;  2DI3 A;  4A0X A;  2FA5 A;  1FY7 A;  2L01 A;  4HYE A;  1KU3 A;  2HZT A;  4MGR A;  2GAU A;  1SMY F;  4BHC A;  1I6X A;  1J9I A;  3RTR A;  1IN7 A;  2YX7 A;  4ENN A;  4I01 A;  2A3S A;  2F5C A;  3D0S A;  1XSD A;  3RPQ A;  2UZK A;  2Y48 A;  3SHF A;  4XLP F;  2XHK A;  5D8K B;  1KA8 A;  1LEB A;  5BOX A;  5FO5 A;  1C0W A;  2NNN A;  1W4M A;  3CO7 C;  2XAH A;  3FXU A;  4L9N A;  2F5E A;  3WTZ A;  2V1U A;  2LKP A;  5K5Q A;  3DFG A;  2DBB A;  3M8E A;  1U5T A;  3SXY A;  2EWN A;  5HS7 A;  3WU1 B;  3WTY C;  3GWZ A;  1FZP B;  1P4W A;  4PGG A;  2YR2 A;  4UV9 A;  3J80 Z;  1D3Y A;  3HIF A;  4EMS A;  1TQI A;  4UUV A;  3IRQ A;  1WI9 A;  4L5I A;  2Q8K A;  2QWW A;  2PMU A;  5KVR A;  2FMY A;  3TGN A;  2BV6 A;  2A6H F;  2PFB A;  4N9I A;  1ZYR F;  3C7J A;  3TDU C;  1KYW A;  1TW2 A;  3GZ5 A;  3V8K A;  3N4M A;  2STW A;  3COA C;  3ML6 A;  3DP7 A;  4F7Z A;  1YIO A;  1FP1 D;  4ENM A;  1UST A;  2VT2 A;  4OMZ A;  1I1S A;  5DDG A;  1O3R A;  2C6Y A;  1RNL A;  4EGY A;  2P7C B;  3ULQ B;  2HTS A;  1YS6 A;  4G7O F;  4KUM A;  1FBS A;  1ULY A;  3EQL F;  2EFQ A;  5DCM B;  3LWF A;  1GVJ A;  3KP4 A;  1V3F A;  3EET A;  5D4R A;  4WCG A;  4L18 B;  3EYI A;  4KIB A;  4EV0 A;  2RV8 A;  2JZY A;  3V8J A;  1XGM A;  3M8F A;  4KYW A;  3H92 A;  2LF8 A;  2O6G E;  3Q9V A;  4IJA A;  2EK5 A;  3HRS A;  1FP2 A;  3RKY A;  3V4G A;  1QO0 D;  1B59 A;  2OA4 A;  2DU9 A;  5FFX A;  2COM A;  2JSC A;  4LFU A;  1T2K A;  2KRF A;  1T38 A;  3GFI A;  4A6D A;  2OZ6 A;  4QLC U;  2HKX A;  3I64 A;  3R60 A;  3ZMZ A;  1PP7 U;  2VBZ A;  4MQV A;  3HOS A;  2FSW A;  5K1Y A;  3JW4 A;  3TKY A;  3WOD F;  2OBP A;  4XRF A;  1B9N A;  2QQA A;  1Z9C A;  4M74 A;  2IT0 A;  2FXA A;  3HTU A;  3D5L A;  1IW7 F;  1BJA A;  3J7A O;  2UWM A;  2VE8 A;  5ILU A;  1K6O A;  1IAW A;  5IT9 K;  2PN6 A;  1P92 A;  1MDM A;  4CIC A;  5DV5 A;  1R58 A;  2D1H A;  1OR7 A;  3WE2 A;  2E1C A;  2IA1 A;  1UHM A;  5LGN A;  2RKH A;  3G3Z A;  1BBY A;  5D5X B;  5H20 A;  1T39 A;  2P4W A;  5LRR A;  3RDI A;  1QPM A;  1YW7 A;  4HDU A;  2VOD A;  2MLG A;  2ZME A;  2K7L A;  2IRF G;  3F23 A;  1BC7 C;  2JRT A;  4EGZ A;  3DXJ F;  5F1R A;  2ETH A;  1FYK A;  1ZG3 A;  5E20 A;  3L00 A;  1K78 A;  2VN2 A;  1XSX A;  4RGR A;  3ZMU A;  4WK8 F;  2HR3 A;  1E17 A;  1H9G A;  3CUQ A;  1F5T A;  2CWE A;  1BN5 A;  2M1B A;  5JVT A;  3U1D A;  1EH6 A;  2LDU A;  3HHH A;  4RS8 A;  2CQK A;  4U0Y A;  2ZKZ A;  4XLN F;  1Z6T A;  3V7C A;  4KMU X;  5DUK A;  1I5Z A;  2H6B A;  4RGS A;  4EVI A;  3V7R A;  2STT A;  3JTG A;  4RGX A;  4ESF A;  1FWZ A;  3IL2 A;  1BI0 A;  2OQG A;  3I0T A;  4PDK A;  1QZZ A;  5FFZ A;  4UNO A;  1LB2 A;  1TNT A;  2OU2 A;  5D4S A;  5LLQ A;  4P55 A;  4GO1 A;  1AWC A;  3CO6 C;  1TTY A;  3Q5F A;  3GLX A;  2H27 A;  1U5T B;  1PDN C;  1QQI A;  2TDX A;  3BDD A;  1BC8 C;  4Q4Z F;  4G7Z F;  4ZYD A;  2L54 A;  2VBW A;  3OV8 A;  5TJJ A;  5TRD A;  3IKV A;  4HDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...