2HWVA

Crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
SHMTIGDLTIHPDAYMVSKRGEKIELTHREFELLYYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPTYLVTRRGVGYYLRNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords DNA-binding response regulator VicR
publication title Structure of the response regulator VicR DNA-binding domain.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hwvA00
4P9UA 2IW5A 5DUIA 3WU0A 4G6QA 2A6HF 1D5VA 4G7ZF 1WKMA 3RTRA 4AIHA 2A69F 1XDSA 5D4RA 3HTSB 1F4KA 1J59A 4I02A 2ISYA 2BEOA 3FM3A 2O6GE 3ECHA 3O2PE 5LHHA 2GA2A 4BHBA 2XKPA 5J8FA 1KGSA 1IXCA 1G4DA 1JXSA 4LLGF 1BI3A 2ZMEB 4EV0A 3EYYA 3E6DA 5D4SA 4I98B 1DDNA 1BIBA 4P5OA 2JSCA 2FQ3A 3K9TA 2EFPA 2JZYA 3CUQA 3H92A 3BPVA 1S7AA 3S2WA 3MCZA 3I71A 2QZ8A 3VEPA 3QP5A 1XSXA 2ZKZA 3LWFA 3GFMA 3WE2A 3GXOA 1XMAA 2JPCA 5D5WB 5E20A 5ERIA 4HQMA 2OAZA 1R7JA 2CYYA 3F6VA 2XAHA 4HYEA 5L3EA 1O57A 3SQNA 1H0MA 4RAZA 1HKQA 4HLXA 2GZWA 2R3SA 3WGHA 4LG0A 2DQRA 4CDGA 2ESHA 2DK8A 2DW4A 3VODA 1Z9CA 2P5LC 5DYMA 3TDUC 5DD4A 4NB5A 1HW5A 3ZN0A 1QO0D 4OMYA 1SFUA 3K69A 2EA4A 4GYIA 2D45A 2OU2A 4KIGA 4HLYA 5HDGA 5FB2A 3W6KB 4P9FA 4KICA 2P7CB 4KFCA 1S3JA 2DQLA 3FZVA 3RYRA 1ZLKA 1Z05A 2VT2A 2ETHA 4LLNA 4ESFA 2Q0OA 3IL2A 1BC7C 1KU3A 4S04A 2G7UA 2RV8A 4HDVA 1STZA 1B9MA 3I58A 1BI1A 2F5EA 5LEKA 2XV4S 1GHCA 2HKOA 1P4XA 1FP1D 1OKRA 3RI4A 1R1TA 2FXAA 3KP5A 1LQ1A 1ONVA 4AIKA 1S6LA 6PAXA 3RPUA 5ICCA 2FE3A 2FNPA 1BIAA 3E97A 3FMQA 1BJAA 3LA3A 4B8XA 1Z6RA 5D8KB 4UNOA 2A5YB 4M72A 5CVRA 3BJ6A 3F6OA 3L00A 1IAWA 2VT3A 3ZMSA 4L5IA 5EEHA 2VXZA 3M9AA 2YU3A 1MD0A 1MJBA 2KRFA 4HV5A 3QP6A 3P7NA 5CVIA 2ZJ2A 5D5VB 1PP8F 3ZMVA 2XRNA 5FO5A 1K7AA 3ISPA 1ZN2A 4XSZF 4O3MA 3IKVA 2VODA 4LLLA 3ULQB 4R1HA 1U8RA 2PLYA 4Y17A 2RNJA 5CVJA 4M6YA 2A6EF 2D1HA 4U0WA 4HZFA 2V1DA 2EFQA 1FC3A 3GVAA 4RAYA 4ENMA 5H20A 3WTWC 1V4RA 3HSFA 2O03A 2O0YA 2W84A 4LK1F 2BBYA 4ETSA 4ON0A 5AIPA 2CFXA 3QPHA 3KP7A 1TNTA 4UV9A 2CG4A 4WCGA 2M1BA 1R5HA 1Z7UA 1RIOH 1SFXA 5TJJA 1T0FA 1TLHB 2EA2A 2EV0A 1FOKA 4ENJA 5F1RA 4CGZA 5HLGA 4UHTA 1LB2A 2JTVA 1LDDA 1PP7U 1FBSA 1FY7A 1USSA 4IRHA 4EM1A 4A6DA 2DBBA 2QYOA 2FBHA 2MLKA 4N9IA 2YSRA 2VC1A 2RC4A 4I7HA 3GEZA 1Z6TA 2EV6A 1G3WA 3ABTA 2UWMA 1IN4A 4FT8A 4RB0A 1YIOA 4OIRF 5IT9K 1EH8A 3BJOA 1F9NA 1KA8A 2VBYA 2Q8KA 4RGSA 3I53A 5KVRA 1YG2A 3WTXC 1IXSB 1K79A 5ED4A 3QAHA 5H6QA 1B4AA 1G3SA 1HW2A 3CUOA 5ICGA 2IVMA 4S05A 4F7ZA 1OYWA 4M9ZA 5E8IA 2FA5A 2FOKA 3FMRA 2L02A 2PMHA 3JSPA 5JI6A 1R36A 4GO1A 3DQVC 4ZYDA 5DUKA 2KKOA 5IT9Z 1KQ8A 4Y15A 2ZCWA 1PUEE 4R8HA 4Q47A 4RB1A 5E8GA 1ZRCA 1A04A 3VOEA 4OU0A 3Q9SA 1XCVA 4AWXB 1FBUA 2X4HA 2BYVE 1BBYA 1KU7A 1YTYA 2DFIA 3E5QA 2VBWA 2VBXA 3SZPA 2NAZA 4WXCA 5L3CA 1WSUA 3F72A 4B09A 4BHCA 4DNCA 2LKPA 2A07F 2YX4A 4YFKF 4BHPA 4NQWA 2K27A 1G3TA 5JFRA 4Y13A 3WE3A 3FMSA 2MC3A 2LNBA 3GW2A 4BH9A 4L0YB 4G7HF 4PCQA 1SD6A 2DI3A 4BQAA 3TO9A 2V1UA 4YFXF 1T6SA 1K6OA 3IRRA 3I4PA 2H94A 3V8KA 1TQPA 3JTGA 1TW3A 1T38A 2WC2A 2P8TA 2CGPA 1E17A 3TOBA 4HQEA 2FBIA 2MH9A 1SD5A 1P2FA 3P9IA 2A61A 3R0JA 2RDPA 4FX4A 1EH7A 3E6MA 5K1YA 2AS5F 4RS8A 4IHTA 2QENA 3T8TA 2GXGA 2NYXA 1W7PD 3LFKA 3DV8A 2HGCA 1FZPB 4M71A 5LHIA 2Z5UA 4L9TA 4GGGA 5K5RA 3J7AO 3OV8A 2MH2A 4IXAA 1O3TA 3JSOA 3SFZA 1AOYA 1YW7A 3CJNA 3F8NA 1P4AA 3M1EA 2Z99A 1D3YA 3ECOA 1SD4A 3R61A 1B6AA 1BN5A 3F8FA 2P7VB 4HA8A 3M8FA 3ELKA 2EK5A 4I0AA 4GCVA 1YS6A 2GWRA 2EFNA 3P9KA 2GA1A 4IJAA 3N97A 5KK1A 2LSOA 2STWA 3H3ZA 4I0BA 4EJVA 1JHHA 1OR7A 1W7PA 3KZZA 4OIQF 2EV5A 4Q48A 1VTNC 4EVIA 5LRRA 3CO6C 2STTA 2EFWA 4EJTA 3EUHA 2P4WA 3TDZC 2OZ6A 5ILVA 1W5TA 5BQTA 1IN6A 1P4WA 2QQAA 5LGTA 1IUYA 3LAJA 2IA1A 3BY6A 1XN7A 1I1GA 2EB7A 2W25A 3PFIA 2C6YA 1XMKA 3LA7A 3WGGA 1O3SA 1NHAA 3GX4X 4WK8F 2CQKA 1YQAA 4CXFA 3C3WA 2GQQA 2E7XA 2KJCA 2ACJA 1WQ2A 2HR3A 2PFBA 2XROA 4RB2C 2Z3YA 2PBIA 5JHUA 2W85A 3I0TA 5JR3A 1HBXG 4ENNA 4TV7A 3KETA 2L4AA 2HWVA 2XHKA 4HX8A 3SZTA 3VB2A 2KIUA 3WTZA 4LD5A 2RGVA 3KEOA 3NEUA 3IKTA 2J5OA 4ESJA 3J80K 3K2ZA 3JAMK 4ZZDA 2TDXA 2H6BA 3GF2A 2ZO4A 2NNNA 5FD5A 3GUDA 2IPQX 2J5PA 3HSRA 3ZPLA 2E1NA 4IRGA 4AIJA 1IW7F 1XGNA 4KYWA 1UFMA 4HAMA 2P6SA 1W7PB 4YIIA 3J80Z 3Q5FA 2VBZA 2L01A 3JAMZ 1FLIA 3EQLF 4CYDA 1ZG3A 5FFXA 5L3FA 4M73A 1QZZA 3K1NA 4BAYA 2YR2A 1LJ9A 2F5CA 3KE2A 4OMZA 4I01A 1QGPA 1WRJA 2WWYA 4EMSA 2OQGA 2HKXA 4UVBA 4LFUA 3H3UA 2FMYA 2IRFG 5LEJA 2HTSA 5D6EA 1O7LA 1LNWA 2F2EA 5BS6A 3CO7C 5E17F 3DPTA 4XLPF 2DAOA 1QBJA 3KP3A 2PN6A 1JHFA 4P96A 1RZ4A 3SXYA 2CSOA 5E1XA 2VN2A 2VE9A 3WGIA 3ABUA 1QNTA 2D2WA 4L9JA 4MHGA 1FNNA 1BM9A 2LDUA 2YX7A 3U9GA 1KYWA 2LF7A 4KMFA 4UV8A 3I5UA 4WWCA 4XSXF 3T8RA 4EM0B 1I5ZA 3AAFA 1TBXA 5BPIA 1AWCA 2CWEA 1ZREA 2V6CA 3QOPA 2RQPA 1WWXA 2QBYA 4L5JA 1HW1A 2OA4A 3IWZA 3V7CA 1FBQA 4RGXA 3JW4A 2MD5A 3EETA 1HQCA 2M8EA 1U6GA 3RKXA 1I1SA 4U7BA 4A5NA 4KA4A 4A5MA 1D8JA 1B9NA 4XRFA 4A2UA 3SHFA 2M5WA 2BV6A 4BYYA 3QPTA 3K0LA 2HQRA 2FRHA 1U5TC 5ILSA 1IN7A 5DV5A 4KMUX 1GXPA 2UZKA 1BOAA 4UVAA 4PDKA 2DU9A 4WXHA 2HEOA 3BPXA 1S7OA 1R1UA 1HXDA 4XLNF 5D5UB 4EGZA 4MQ9F 1FSEA 2LF8A 2FNAA 2D1VA 2KIFA 5FFZA 5BPDA 2A68F 2IT0A 4HBLA 4Z2YA 1R58A 4A0YA 1S8NA 2G7HA 4OIPF 5FLXK 2QLZA 5CYVA 4FHTA 1L0OC 2DO7A 1OPCA 4QWQA 5CJ9A 5CLSA 2B0LA 1I6XA 3RDIA 5D6FA 2QBYB 3P9CA 1J0RA 1S29A 3PQKA 5BMZA 1I27A 3RKYA 3V4GA 3R4KA 4MQVA 1USTA 2AXLA 2HTJA 4MEXF 3HYIA 4GXOA 4HOBA 3ERED 1YFHA 1GXQA 1OMIA 2CO5A 3WTSC 5LLQA 5CVVA 4G9YA 5AIQA 3WTVC 1ON1A 5CVUA 3QU3A 1REPC 4KIFA 2ZNYA 4U0VA 1UB9A 3DKWA 1IF1A 4LJZF 2WV0A 1U2WA 1YS7A 1XCBA 2OBPA 1ZYRF 2FEZA 3KCCA 5HDNA 2NRAC 1FYMA 3FX3A 4BXUA 2BE5F 2VC0A 2DTRA 1SMYF 5H6RA 3GFIA 3CUQC 4EM2A 3ZMZA 5ICFA 4PGHA 5L3BA 4LB6B 3T1BA 2Q2EA 1G3YA 2Y48A 1BI2A 4L9NA 1Z91A 3ZN1A 2P5VA 3K1MA 3G3ZA 4KUMA 5DEQA 4CICA 3G73A 4L9VA 1RI7A 3V8JA 1T2KA 5D8LB 2ZFWA 3E5XA 1U5TA 2VOOA 2HFHA 3RPQA 3R0AA 4JK1X 1ZHFA 4BNCA 4OINF 4YFNF 1YW9A 3E5UA 3WTTC 5HS7A 3U2RA 3ZMDA 2QQ9A 4A12A 1DUXC 3R60A 1MGTA 4O6JA 3L09A 2DPDA 3EDPA 5DCMB 2IJLA 3R6SA 3IRQA 4L18B 2A3SA 2MA3A 3LAPA 3KLOA 1IXRC 2GIVA 3T0YA 4ZZLA 1MDMB 2JRTA 2G9WA 1F5TA 4AD9A 2CW0F 1EV7A 3LSTA 2Z33A 1UHWA 3DF8A 2M45A 4U7DA 4EGYA 4QLCU 3WTUC 5LGUA 2XAJA 4N0BA 3GWZA 3ML6A 3HRTA 4MGRA 4U0YA 4WXDA 1KQ9A 4KIBA 1RUNA 5ICEA 2JPBA 4M9XA 3LA2A 4ZYHA 3I54A 3U1DA 4ZH4F 5D5XB 3F8BA 2ZNZA 4HW0A 2RVCA 1MZBA 3RKWA 1YYVA 2QWWA 3HOTA 2FU4A 3C18A 3GZ6A 1XB4A 1RUOA 1ODDA 4EJWA 3K1PA 3REOA 4HF2A 1TW2A 1YW8A 2XIGA 3EYIA 3FM5A 3RJPA 2H6CA 2V1XA 1FYKA 1TQMA 3HRSA 1O3RA 1J2XA 1IRFA 1U5TB 1JE8A 3HUGA 1KU2A 1U3EM 1XSVA 1ZGAA 3NQOA 2XAFA 3GFLA 3HHHA 3CTAA 4MEYF 4HF1A 1MJAA 2K02A 4KT5C 3TKYA 3QU6A 3NRVA 3BOQA 1XGMA 5L3DA 3GYHX 2EJRA 4ZYEA 2GXBA 3CDHA 1EH6A 2L54A 3C1DA 2JT1A 2O61A 1YO5C 5IT3A 1D8KA 2O8XA 4KDPA 1OYYA 4OOIA 3F22A 4G94A 3BWGA 1OYIA 3DP7A 3MFKA 4G6DA 1E2XA 2H09A 3KEQA 2MLGA 1FT9A 1R1VA 1DPUA 4PGGA 4KNYA 2FBKA 2W24A 3E6BA 2X0LA 1SFEA 2WTEA 5HS9A 1MKMA 5HS8A 1XD7A 4JQFA 1ZGJA 4MTDA 5DDGA 2QUFA 4GYGA 2IA0A 4L0ZB 2R7DA 1MJ9A 3MQ0A 2Z9OA 4CHUA 1FP2A 4E70A 4ESBA 1XSDA 3FF5A 2GAUA 4H0EA 1XDUA 2NNYA 3L7WA 4HX4A 1ULYA 1G6NA 5K5OA 2UXXA 1HSTA 4ENKA 1B1BA 2HYGD 3LQRA 1ZRFA 4M6XA 4AVPA 3KLNA 3RIRA 2EWNA 1IRGA 3VFZA 1DP7P 2QM3A 3DXJF 3D0SA 2OD5A 3MEXA 4NHJA 1PDNC 2DT5A 5E1WA 1IZ1A 4M9SA 3FXQA 1LDJA 5DCFA 1C0WA 3MAJA 1U78A 3N4MA 3FXRA 5ILUA 3QRFF 3IC7A 4PZJA 2QQBA 3IWFA 2ZBKA 3L2CA 1FX7A 1BC8C 4O5VA 2L4MA 4ASNA 4HV6A 2ESNA 4FX0A 5HDKA 3J81K 2FF4A 4CZZA 1CF7A 1Y0UA 3CUQB 4I09A 4IRIA 1HKSA 2PQ8A 2RKHA 2XKOA 4RGUA 3WTYC 1ZAOA 2FSWA 2L3DA 1QQIA 1R00A 1KQ0A 3I59A 3KP6A 1F1ZA 4OIOF 4EJOA 3DPLC 4D0PA 1W5SA 3HRUA 1TTYA 1J75A 4G8XA 4G7OF 2W57A 5J6XA 3HRMA 1SD7A 2QVOA 2XGXA 4UXNA 2XAGA 3J81Z 1IN5A 3ZP5A 4KN7X 1HSJA 4UUVA 3F23A 3MZHA 2KJBA 1TNSA 4LG0B 2E1CA 3F8MA 3V7SA 3L9FA 4LB5A 3BROA 4KN4X 1ON2A 1UCRA 2DK5A 1LEBA 1K78A 3HIFA 4RB3C 2P6TA 1IN8A 3BJAA 1QZYA 3F3XA 3KP4A 3Q9VA 1T98A 3JTHA 1B59A 1BI0A 2F5DA 1CGPA 3ROUA 5LGNA 1L3LA 2RN7A 1DPRA 3DEUA 2K7LA 1ZH5A 1LDKB 1T39A 3O3KA 5EEGA 2UXNA 3E6CC 3ZMUA 1RNLA 5FGMA 3TO6A 3M8EA 2MBFA 1R22A 3V8LA 3TQNA 5LBQA 4A6EA 1QPMA 3V7RA 1WI9A 1CF7B 2DPUA 1R23A 2HYFA 3HSEA 5E1ZB 2ZXJA 1ZRDA 5HLHA 3HOSA 1J7KA 3HTUA 2ADUA 5BOXA 4P55A 3I59B 2K86A 1J5YA 4HX7A 4JBAA 4M74A 5JVTA 3KFWX 1O7FA 4MTEA 3B02A 2OQRA 1FSHA 2COMA 3IHUA 3T5XA 2HDCA 3ZQ7A 3CLOA 3F21A 3I64A 4K2EA 4WX9A 1HKTA 1SAXA 2O3FA 2HZTA 3FHZA 3BP8A 2H27A 5DD8A 5F64A 4LMYA 5E18F 2K4JA 3B73A 3MZYA 4IHSA 1K78B 3KP2A 4MNUA 2P5KA 3FWEA 2V9VA 5DCMA 4Q5SF 2PMUA 2K4BA 5A2QK 4IVNA 2KIMA 3OOPA 1FYLA 4EJUA 2FMLA 4N9HA 3W6JB 1P6RA 4LGWA 2ELHA 4HDUA 4DQ2A 1MDMA 1KU9A 5FLXZ 2PJPA 4UVCA 5L3GA 3BZ6A 4ZYGA 3C7JA 1JGSA 1J9IA 3E3VA 2BGCA 1GVJA 3M7GA 2VOPA 5F6FA 4I2OA 3TOAA 1O3QA 1FPQA 3MWMA 1Z1DA 3D5LA 2HQNA 5A2QZ 4Q4ZF 1H9GA 1X3UA 3KZYA 1R5GA 3O6BB 4R79A 2PI0A 2XASA 1YLFA 3WU1B 5HOOA 2VONA 1SMTA 3GFJA 1XGOA 5FD6A 3WG9A 5AONA 4IF4A 4XBFA 3FXUA 4A0ZA 2EFOA 5LHGA 4IPAA 5K5QA 1TQIA 2HS5A 1FWZA 4YG2F 3HHGA 4HF0A 3F8CA 5J8CA 2Y0MA 2VE8A 2XAQA 4YIFA 5LRSA 3GO5A 2ZMEA 1KYZA 1ZARA 3COAC 2R7FA 3TO7A 5TRDA 2Y75A 1H9TA 3WODF 2PEXA 4CO8A 2IA2A 1Q1HA 3PQJA 2M30A 1UHMA 2XVCA 1V3FA 2HOEA 1P92A 2NS0A 1ZG1A 1XGSA 2F5FA 1LVAA 4A0XA 2DLLA 5HVQC 4LK0F 2OZUA 3GLXA 3TGNA 4U88A 4RGRA 3GZ5A 2IP2A 1W4MA 2E7WA 4EQQA 3DFGA 3LQQA 3RYPA 1ZG5A 2PG4A 2M87A 1ZLJA 3ZMTA 2V79A 4WF2A 1LEAA 3BDDA 2XUBA 5HLIA 2YPRA 2ISZA
chains in the Genus database with same CATH superfamily
4P9UA 1JJ6C 2IW5A 3X2QH 1JI8A 2Y31A 4C3JJ 5DUIA 1T56A 4ZDPA 1K61A 3WU0A 3OS0A 5EGOA 3D1NI 3PJRA 3ONQA 3PNVA 1B8IB 4G6QA 9ANTA 2A6HF 3BG6A 1OFCX 3CZ6A 1D5VA 4G7ZF 5FRNA 1WKMA 3RTRA 4UB8C 4AIHA 4AUXA 2A69F 1XDSA 2JWTA 5D4RA 3HTSB 3VYRB 1F4KA 5GAGJ 1J59A 4I02A 2ISYA 2BEOA 2KFDA 3BT9A 2ZB9A 3FM3A 1HOMA 2O6GE 3HL2A 2LKXA 2LY2A 4PJJA 3ECHA 3OR1C 3O2PE 3KX2A 2FX0A 5JLXA 5LFAA 4Y52J 1R71A 2NVUB 5LHHA 2GA2A 2WAQA 1VFCA 1IUFA 4BHBA 4RDUA 2XKPA 1RC9A 5J8FA 2O9LA 3RZOJ 1KGSA 3W2VA 2OUMA 1SC7A 1IXCA 2M3AA 2I10A 2IAIA 1G4DA 2M4GA 4XRMA 2KMUA 2KRCA 5F0CA 1VQ8I 1JXSA 4LLGF 1BI3A 1Y6IA 3O8HA 2ZMEB 1VZ0A 2JJ7A 2LREA 4EV0A 1XS9A 1DGRM 3EYYA 3H9GA 4IX7A 3E6DA 5D4SA 3P5JA 3BR6A 4I98B 1DDNA 1BIBA 1YI2I 4P5OA 2CUZA 2JSCA 2ME6A 2FQ3A 3K9TA 2JA7J 2EFPA 2JZYA 2WADA 3CUQA 3H92A 3BPVA 3HPHA 4ABZA 1S7AA 3S2WA 3MCZA 4JYKA 3I71A 1WFXA 5C4XJ 2QZ8A 3VEPA 1JGGA 2QF7A 3QP5A 2MG4A 1XSXA 1XG1A 2ZKZA 2LVSA 3LWFA 3GFMA 4NNJA 4M3EA 3WE2A 3GXOA 1XMAA 3V42A 5FJ8J 4V2FA 3H0DA 4A69C 1FEXA 2EILH 2JPCA 2M7BA 5D5WB 2GOXB 2BY2A 5E20A 5ERIA 2H8WA 3Q3SA 4HQMA 4A3MJ 2OAZA 3BCBA 3LSJA 2VKEA 1GT0C 2WB1N 3FKIJ 1R7JA 2CYYA 3F6VA 4LOCA 3CF5F 3S1NJ 2XAHA 1IRXA 1WJFA 4A3CJ 4HYEA 5L3EA 2NVYJ 1O57A 3SQNA 3AG4H 1H0MA 3RPUD 1IDYA 5CQGA 4RAZA 1HKQA 4HLXA 2GZWA 2R3SA 3WGHA 2FUG2 4LG0A 2DQRA 4CDGA 2X6OA 2ESHA 2DK8A 2DW4A 2OTLI 3VODA 2ME0A 1Z9CA 4I76A 1T0FC 2P5LC 5DYMA 5EGOB 4CCNA 3TDUC 2GOMA 2UUZA 4C3HJ 5DD4A 4NB5A 1QHHD 4G12A 1HW5A 3ZN0A 3M07A 3HEFA 1QO0D 4OMYA 1SFUA 3K69A 2EA4A 4GYIA 2D45A 2OU2A 3M4OJ 4KIGA 3VYUB 3KPHA 4HLYA 4A3DJ 5HDGA 2HOAA 4PFPA 1WVRA 1IDZA 5FB2A 3W6KB 4P9FA 4BBRJ 2R7RA 3B6CA 3GZNB 1EF4A 3PO2J 4A3FJ 2E5NA 4KICA 3S1MJ 2P7CB 4KFCA 1S3JA 2DQLA 3FZVA 3GLLA 3RYRA 1ZLKA 1R5ID 1JTYA 1Z05A 2L7FP 2ETHA 2VT2A 1KONA 4ZTFA 4LLNA 1MBHA 4ESFA 3BR0A 2Q0OA 1Z77A 3KYDB 3IL2A 1BC7C 1KU3A 4S04A 3L2VA 3LMMA 3HXLA 5FROA 2G7UA 1OJLA 1STZA 2RV8A 1B9MA 3I58A 4M3DA 1BI1A 4HDVA 2F5EA 5IP6A 5LEKA 4D1QA 2R7WA 2XV4S 1GHCA 2HKOA 1P4XA 1YIJI 5IYDJ 2VI6A 3BZKA 1FP1D 1OKRA 1MW7A 4HSTA 4DBRA 3RI4A 1V5GA 1R1TA 3IAS2 2FXAA 3S8PA 4D5CA 5DM7F 4IOCF 5GTHC 2LRDA 3KP5A 4Y7NJ 1LQ1A 1ONVA 2CW7A 1BJZA 3NWSA 3QYEA 4AIKA 1S6LA 1HLVA 6PAXA 2DMTA 3OYJA 3RPUA 4C9YA 2VKDA 5IP7J 2DMUA 5ICCA 2FE3A 2W82A 5IYBJ 3BR5A 2FNPA 3TP0A 1LPQA 1SVLA 2ZXWH 4YELA 1BIAA 3CQZJ 3ESWB 2BW3A 2WBMA 3E97A 1JKOC 2M0MA 3FMQA 3K4BA 1BJAA 3LA3A 1XTAA 4B8XA 2QKMB 4P1WA 4CCLA 3RKQA 1Z6RA 5F0FA 2BXZA 2A6TA 5D8KB 1PUFB 1MBFA 4UNOA 2A5YB 4X1EA 4A3BJ 2IS2A 2OTJI 1NK3P 1G8XA 4M72A 5CVRA 1GV5A 3S2HJ 3BJ6A 3CDIA 3F6OA 3L00A 1ORKA 3DLLF 1IAWA 2DTZA 3J7ZI 2VT3A 3KEYA 2JQ7A 2ELKA 3ZMSA 5HLTA 4L5IA 5EEHA 2VXZA 3M9AA 2YU3A 1MD0A 1MJBA 2KRFA 4HV5A 5M5XJ 1S5LC 3QP6A 4QPOA 3P7NA 4D7NA 3OYNA 4Y3OA 2VKVA 3ZXSA 3CMAI 1NK2P 1FIAA 2ZJ2A 5CVIA 5D5VB 3ZMVA 1PP8F 1WJAA 2XRNA 5FO5A 1K7AA 3ISPA 1ZN2A 4XSZF 1A35A 3FK6A 4O3MA 3IKVA 2VODA 5C4JJ 3HOYJ 5IOYA 4LLLA 3ULQB 1Z0XA 4R1HA 4RAGA 1U8RA 2PLYA 2QKLB 3SDGA 2X6YA 5CQEA 1IV6A 3L2UA 1Z67A 4MFDA 2RNJA 4Y17A 2VPLA 2NOGA 5CVJA 1VQ7I 4M6YA 2A6EF 3K4MA 2D1HA 3ZGKA 1YE9A 4U0WA 4ZYAA 3CC4I 4AC0A 3QWLA 2L5QA 5M3FJ 2IBDA 4Y4RA 2COBA 4HZFA 3IV5A 2V1DA 4X0GA 3DBHB 2R7XA 2ECBA 2EFQA 2BY3A 3QPLA 5F27A 1ETVA 1FC3A 3GVAA 5FKKA 2I5UA 5HODA 1ZTRA 4RAYA 4ENMA 3A2KA 3G1MA 2P81A 5H20A 3WTWC 4A3EJ 2OC6A 1FIPA 1V4RA 3HSFA 2O03A 2O0YA 1BR2A 2V1NA 2W84A 3PUBA 4LK1F 2BBYA 2L7KA 4ETSA 1UMQA 3ASOH 4JX5A 4ON0A 3QPSA 1QRYA 5AIPA 2CFXA 5FKMA 1PYVA 1Z21A 3QPHA 1B72B 3KP7A 1TNTA 2LBFA 4UV9A 3IH4A 2CG4A 4F91B 4WCGA 4RAFA 2M1BA 1R5HA 3LSPA 4HSRA 1K4TA 3M8JA 2W7NA 3OYLA 1OCRH 1Z7UA 2ZC2A 1RIOH 1SFXA 5TJJA 4BKXA 1T0FA 3LSHA 3PSIA 1TLHB 2EA2A 2EV0A 1FOKA 1Y8RB 4ENJA 5F1RA 4GDFA 3B6AA 4CGZA 5HLGA 4UHTA 4B3AA 1LB2A 2JTVA 2HPIA 2BW3B 1LDDA 1PP7U 3OYCA 1FBSA 3ZQHA 1HC8A 1FY7A 1USSA 4BJTA 4IRHA 2IS4A 4EM1A 4BY7J 4A6DA 2DBBA 1X3ZB 4XLAA 2QYOA 3CCYA 5K7ZA 3CJRB 2R7SA 2G0EA 1FTZA 2FBHA 3KYCB 4FCYA 2EH3A 2MLKA 4N9IA 1YJNI 4BE2A 2QGUA 2YSRA 1JKPC 2VC1A 2RC4A 1SANA 2I8DA 4I7HA 3GEZA 1I3QJ 3G6EI 2AQEA 4D9JA 3M3YJ 1LKXA 2LLKA 2R7QA 2K9LA 3G4SI 1Z6TA 2UV1A 1MBGA 3JRIA 2EV6A 1YRNA 1G3WA 3ABTA 2UWMA 1IN4A 4FT8A 2NXNB 4RB0A 3K70C 2X6XA 4V19K 1YIOA 4OIRF 5IT9K 1EH8A 3DEWA 2V9PA 2X1CA 3BJOA 1TWHJ 1F9NA 1KA8A 2VBYA 2DDAA 2Q8KA 2DA4A 4DIQA 2MABA 3BR3A 4RGSA 3I53A 1MMDA 3DKYA 5KVRA 1YG2A 3FISA 3WTXC 1IXSB 4BEHA 1K79A 3H5RA 5ED4A 3QAHA 4NBQA 5H6QA 1B4AA 2X9DA 2ZXHA 1G3SA 1X1AA 1HW2A 3CUOA 5KHDA 5ICGA 2CV2A 1R4MB 2IVMA 4S05A 4F7ZA 1OYWA 4M9ZA 1QZEA 3LL7A 5E8IA 5BNGA 2FA5A 2EIJH 2FOKA 3HPGA 1E3OC 2L7ZA 3FMRA 2K9QA 1BOBA 2L02A 4MFEA 4UUTA 5J40A 1DP3A 2PMHA 3JSPA 3DLAA 5JI6A 1R36A 4GO1A 2Y9YA 1MBKA 4XIDA 5K7HA 1AU7A 1IC8A 3GTKJ 3DQVC 2L9RA 4ZYDA 2XSJC 4Z6YA 5DUKA 1WZ2A 2KKOA 5IT9Z 1KQ8A 4Y15A 2ZCWA 1PUEE 4R8HA 4Q47A 2JVGA 2LH9A 1MMGA 1DQUA 4RB1A 1OR7C 5E8GA 2CUEA 2L0KA 2LBFB 1ZRCA 1A04A 2K40A 2WV1A 3VOEA 4PJMA 3FXMA 5B66C 4OU0A 4N4OB 1GUUA 3Q9SA 4RMNA 3EUHC 1XCVA 5J47A 4AWXB 1FBUA 1D0YA 3JRCA 2OF7A 2X4HA 1WCMJ 4QPQA 2BYVE 1J09A 1VQ9I 2V4JC 1BBYA 1KU7A 5E3LA 1YTYA 3JRGA 2AQFA 2XB5A 2KZGA 3AG3H 2JSPA 2KT0A 2DFIA 3E5QA 2VBWA 2VBXA 3LSIA 3SZPA 1LE8A 3EPZA 2NAZA 4WXCA 5L3CA 1WSUA 3F72A 4B09A 4BHCA 4Y33A 2LKPA 4DNCA 2A07F 1U8BA 2YX4A 3DU6A 4YFKF 3GTGJ 1G59A 4H4KC 3G1OA 4BHPA 5J4VA 4NQWA 2CU7A 2K27A 3OIOA 2XF5A 3K70D 1G3TA 5JFRA 3PSFA 4Y13A 2Y0SA 3WE3A 3FMSA 2MC3A 1DU0A 2LNBA 3H9QA 3GW2A 4BH9A 3S16J 2XRLA 3LSKA 4M3FA 4PCQA 4G7HF 3NWTA 1SD6A 2DI3A 4BJ6C 1GVDA 4HG2A 4DGWB 3QYFA 1OQYA 1ZGWA 1X58A 3CC7I 2IS1A 4BQAA 5EZHA 3LOCA 3TO9A 2V1UA 4YFXF 1T6SA 2HYJA 1K6OA 1UG0A 3JR9A 2M0CA 3I4PA 2H94A 3IRRA 3ZCOA 3V8KA 1TQPA 2LOOA 4MIMA 3JTGA 1D0XA 1GLNA 3E0JB 4LITA 1N25A 3Q0WA 4ANJA 1TW3A 1T38A 2O7OA 2DA7A 2P8TA 2WC2A 2CGPA 1E17A 3TOBA 4HQEA 3HGYA 4IL6C 2VKHA 1WJDA 2FBIA 3HKZN 1BA5A 2MH9A 4PJLA 4BEHB 5EEAA 1SD5A 4DBQA 1P2FA 3P9IA 2A61A 4BDZA 2L9SA 3R0JA 2RDPA 4FX4A 4CCOA 1EH7A 3E6MA 2DMPA 2JMWA 5K1YA 2AS5F 3C2BA 2Y9ZA 3ERMA 4RS8A 2H8RA 4IHTA 2QENA 3T8TA 4XKVA 2GXGA 3OS1A 2M8GX 1QVTA 2NYXA 4XICA 4FE7A 1W7PD 3LFKA 3K10A 3DV8A 2HGCA 1EJ9A 1FZPB 3RQ4A 1ZKGA 2E36A 4M71A 5LHIA 2Z5UA 1ZQ3P 1X2NA 3AKZA 4L9TA 2KRHA 4GGGA 2XAUA 3AFHA 5K5RA 3J7AO 1X19A 3OV8A 2MH2A 4IXAA 1O3TA 4XN3A 3JSOA 3RSNA 3M1CA 3SFZA 3OSFA 1AOYA 4XLHA 1YW7A 3CJNA 5FLVA 2E2HJ 4EATA 3F8NA 1RR7A 3PIPF 1D1AA 3OYBA 3A0HC 1P4AA 3M1EA 1I39A 2R7UA 1T08B 4BQOA 4E6KG 2Z99A 1D3YA 3ECOA 1IGNA 4E4HA 1SD4A 2VJIA 3R61A 1B6AA 2B7EA 1BN5A 4E7KA 3S3NA 1JTXA 2KZVA 3F8FA 1VF9A 5TISC 1V5EA 3MMYB 1Y8QB 2P7VB 2MW8A 4HA8A 1LE8B 3W2WA 3M8FA 2HZDA 3BLYA 4E7JA 3ELKA 2XC7A 3OIPA 2W00A 2EK5A 2XPWA 4XKBA 4I0AA 2NVQJ 4GCVA 1YS6A 2RREA 2GWRA 4NQWB 2EFNA 3P9KA 3OY9A 1JJ8C 2W4SA 2GA1A 3KZIC 4CSWA 4IJAA 3N97A 5KK1A 2WY7Q 2LSOA 2STWA 3LSMA 1D1CA 2DMNA 1MNEA 2DOAA 2XF6A 3H3ZA 4I0BA 4EJVA 1JHHA 1X2MA 4CCMA 1OR7A 1W7PA 3KZZA 4OIQF 2EV5A 3Q0UA 3CCLI 1Y1VJ 1MMSA 4Q48A 2DFEA 1VTNC 1ETQA 4EVIA 5LRRA 3CO6C 3HOUJ 1MMAA 2STTA 1VQ5I 2R7ZJ 2K3PA 3LSRA 2EFWA 4EJTA 3EUHA 2P4WA 3TDZC 3ABKH 3G1LA 1IRZA 3HDDA 2OZ6A 4XLEA 1W5TA 2BHZA 5BQTA 5ILVA 2KISA 1IN6A 1P4WA 2Y30A 1N77A 5GP9A 1ERDA 2QQAA 5LGTA 1BL0A 4AU7A 2Y0SN 1IUYA 4NUBA 3BR2A 3LAJA 2PX9A 2IA1A 3MN2A 3FIWA 3I56I 3CCRI 1JKRC 3BY6A 1XN7A 2L7MP 1I1GA 3UR3C 1VNDA 2EB7A 2W25A 3W3CA 3H3VK 1TT5B 3PFIA 2C6YA 1XMKA 2YU9J 3LA7A 2GXAA 3WGGA 1UJ8A 3S93A 1O3SA 2DFFA 1NHAA 2XGEA 4BQNA 3GX4X 2EZLA 4WK8F 2QSGX 2CQKA 4XQFA 1YQAA 3K4NA 4IO9F 4XM3A 4CXFA 1PUFA 3C3WA 2DA3A 2GLOA 2GQQA 2E7XA 4RLQA 4AIDA 2KJCA 2M7AA 2ACJA 1WQ2A 2HR3A 2PFBA 5GAHJ 3QODA 3K4LA 2KHMA 4C2MJ 1NH3A 2XROA 4RB2C 2Z3YA 4AM3A 2PBIA 5JHUA 2W85A 3I0TA 5JR3A 2CQXA 1HBXG 4ENNA 2E60A 4BXXJ 4TV7A 3KETA 2L4AA 2HWVA 2LYCA 2XHKA 4HX8A 1OLTA 3SZTA 3VB2A 2KIUA 3WTZA 4LD5A 3JRHA 4UY8I 3OYMA 2DJIA 2RGVA 3KEOA 3NEUA 2J5OA 5JHFA 3IKTA 4ESJA 1YJ9I 2L9VA 2M2EA 2ZSIB 1JT0A 3FXLA 3J80K 2VB6A 3K2ZA 3JAMK 4QIWN 2EPFA 4ZZDA 2TDXA 2H6BA 1SVOA 3ZQLA 2D5VA 2BHYA 3GF2A 2ZO4A 4IQ4A 2NNNA 5FD5A 2CW8A 3GUDA 3J7YJ 1UG2A 5CPRB 3BTLA 2IPQX 2CJJA 1U9OA 3U1KA 1MNMC 2J5PA 2LK2A 1WPKA 1OCCH 1WJBA 3HSRA 4ZTJA 1AA7A 2X85A 2EBIA 3ZPLA 3DPUA 2LP0A 3ABMH 2HPMA 3DWLE 2R7OA 2E1NA 3LSGA 4IRGA 1Z3YA 2KDOA 4AIJA 4UUSA 4XRSG 1IW7F 1XGNA 2X48A 1IG7A 4KYWA 4YRVA 1WJ5A 1UFMA 4HAMA 4DYCA 3S17J 2BVMA 2E1OA 3S2DJ 2P6SA 1W7PB 2CQNA 4YIIA 3J80Z 2LY1A 3Q5FA 5KCMA 2R7VA 1X1CA 4JX4A 1B72A 2VBZA 2L01A 3JAMZ 3PIOF 1FLIA 1FOXA 3EQLF 4CYDA 2JA8J 1ZG3A 1X4OA 5DM6F 5FFXA 2H1LA 5L3FA 2IXSA 4M73A 5B3SH 2VQGA 1QZZA 1D1BA 3CC2I 3VSKA 3K1NA 2DA5A 4BAYA 2JA5J 1LFUP 2WAQN 1S7EA 4JX6A 3ZQCA 2L2OA 2YR2A 1LJ9A 2F5CA 3CCMI 2E34A 3KE2A 1N75A 4OMZA 2BVLA 4I01A 2ID6A 1QGPA 1WRJA 1XMXA 2WWYA 2B63J 4EMSA 2IS6A 2OQGA 2PMZA 2VJ4A 2HKXA 4UVBA 4LFUA 2DA2A 3H3UA 3DBRB 2NVXJ 2E19A 1IO2A 2FMYA 2IRFG 5LEJA 2HTSA 5D6EA 2KQRA 1O7LA 1TC3C 5KAIC 3BQZA 1LNWA 1CQTA 2F2EA 2CUJA 2EZKA 3CP2A 5BS6A 3CO7C 4C3IJ 4ZC3A 3I9V2 5E17F 1A6QA 2JUGA 2DJNA 2ZJPF 2VUMJ 3DPTA 4XLPF 3BG7A 5LD2C 2DAOA 1QBJA 4DZPA 3BCAA 3KP3A 2PN6A 2WAEA 2ZSHB 2XGDA 1SAUA 2BOLA 4ZJZA 3CJTB 1JHFA 1S72I 4P96A 3HOWJ 4AVZA 1RZ4A 2CQ7A 2EIKH 4S0HB 3SXYA 1APLC 2CSOA 2ZJQF 2CRGA 2VQHA 5E1XA 4CCKA 2ZXIA 2VN2A 2VE9A 3WGIA 3ABUA 4IZZA 3EUKL 1QNTA 2D2WA 4L9JA 3F9KA 2V26A 4MHGA 2DT6A 2LFBA 1FNNA 1BM9A 2LDUA 4F93B 2YX7A 3U9GA 5M5YJ 1KYWA 2LF7A 4KMFA 3GMEA 5IPAA 5B5EC 4UV8A 2N8GA 3I5UA 4WWCA 2HQAA 4XSXF 5CKTA 3T8RA 4EM0B 3C2GA 1I5ZA 3AAFA 1TBXA 5BPIA 4D7MA 3OIQA 1AWCA 3JRBA 2CWEA 1ZREA 5B1BH 2V6CA 4E7SA 3QOPA 2RQPA 1WWXA 4UUSB 2M34A 1JUMA 3FBIB 2QBYA 2M4KA 4L5JA 2R93J 1U0JA 1HW1A 2OA4A 3CCEI 3IWZA 4M3GA 2HXOA 2AO9A 1A36A 3V7CA 2R0QC 1FBQA 4RGXA 1UAAA 3JW4A 3D5SC 3PNTA 3UNGC 2EZHA 2MD5A 1MSFC 3EETA 1HDPA 1MH4A 1HQCA 2OCEA 2M8EA 1U6GA 3RKXA 4B4CA 1JT6A 3HJEA 1I1SA 4U7BA 2OJED 3HC7A 2CV0A 4A5NA 1BW6A 4KA4A 1S9HA 4FISA 4A5MA 1D8JA 4BDYA 1B9NA 2LY9A 4XRFA 1HDDC 2F5VA 3SHFA 4A2UA 1Y0NA 2M5WA 5H2FC 2BV6A 4NC7A 4BYYA 3QPTA 5IOZA 3K0LA 1VI0A 5M5WJ 2HQRA 5E79C 2FRHA 2QQ8A 2EINH 2L9NA 2PJRA 2XPVA 2GBYA 2EQRA 1U5TC 5HNFA 5ILSA 4F55A 1IN7A 3FHNA 4XR6A 3ZRGA 4B47A 5DV5A 2IGKA 4KMUX 5K7FA 2BY0A 2NS8A 4A3KJ 1GXPA 1TWGJ 3RQIA 5HNHA 2QEXI 4XOPA 2UZKA 5GTIC 3KYLA 4KISA 1BOAA 2PMZN 4PDKA 4UVAA 1Y56A 2DU9A 3HB9A 1FMWA 4WXHA 2HEOA 3BPXA 2CS3A 1S7OA 1R1UA 1HXDA 4XLNF 4XLFA 1T8IA 5D5UB 2V9KA 4EGZA 1SFOJ 2W48A 3RCOA 4MQ9F 1FSEA 2EZIA 2LF8A 2FNAA 2D1VA 2KIFA 1D5YA 5FFZA 5BPDA 2A68F 2VL8A 2IT0A 4HBLA 4Z2YA 1NTCA 1R58A 1RPWA 4A0YA 2X1DA 5FLMJ 1U9NA 2V7FA 4BACA 4BS9A 1S8NA 1I3AA 2QCOA 3MD2A 2Y2ZA 3TMOA 2G7HA 4OIPF 2NS7A 3OR2C 3DEEA 5FLXK 1JUSA 2QLZA 5EF6A 3H0GJ 5CYVA 3D5RC 4FHTA 1L0OC 4BJ5C 1R9TJ 2CMPA 2DO7A 1ETWA 3CCJI 1HF0A 1OPCA 4QWQA 4XMYA 5CJ9A 5GPCA 2FOWA 5CLSA 3K4CA 2B0LA 1I6XA 3RDIA 1YOVB 5D6FA 2QBYB 3P9CA 4XN0A 2DT7B 1J0RA 1S29A 2IGNA 3PQKA 5BMZA 3SFIA 1I27A 4XNFA 3VYTB 4XRSA 1P7IA 3RKYA 1W0TA 4BQQA 3V4GA 3R4KA 5C3EJ 4MQVA 5J1YA 2R7TA 2JVHA 4MLOA 1USTA 4HPQA 2X51A 4JP0A 2AXLA 2HTJA 3OYHA 1PJRA 4MEXF 3QYBA 1QPIA 3HYIA 1VQLI 5EZGA 4GXOA 4HOBA 4MO7A 4RM3A 5JLWA 2HDWA 3ERED 1YFHA 1GXQA 1OMIA 2CO5A 3WTSC 4NDLA 5LLQA 3DKXA 5CVVA 2DYRH 4G9YA 3S1RJ 4FQGA 3K6GA 5EYRA 5AIQA 3WTVC 4A3JJ 1ON1A 5CVUA 2O5RA 3AL0C 3OYAA 1T33A 3QU3A 1REPC 4KIFA 2FJ1A 2VJJA 2ZNYA 4U0VA 4F3QA 2F4MB 1UB9A 2W1OA 1ZR4A 3DKWA 3PM1A 4LJZF 1IF1A 2K85A 2WV0A 1U2WA 1MIJA 1YS7A 1MBJA 1XCBA 1WH5A 2E5ZA 2PJRB 2OBPA 1ZYRF 1E3HA 2FEZA 3KCCA 5HDNA 2NRAC 1FYMA 3FX3A 1OCZH 4BXUA 2BE5F 1ENHA 4G6TB 2VC0A 1MMNA 2DTRA 3S15J 1R6RA 1SMYF 5H6RA 1ZELA 2VPRA 3GFIA 3CUQC 2ZFUA 4EM2A 3OL4A 4B1RA 3DBLB 5IY5H 5J4YA 2E2IJ 3ZMZA 5ICFA 1IJWC 1QA6A 4PGHA 5L3BA 5FKLA 4LB6B 3MKZA 1GDTA 3T1BA 3OYDA 2Q2EA 1G3YA 1NG7A 2QSFX 4KJZA 2Y48A 2MD0A 1JUPA 3TL4X 1BI2A 1ETXA 2HNHA 1WI3A 4L9NA 3H5AA 1Z91A 3ZN1A 2DMQA 3VDXA 2P5VA 4JOMA 1P7JA 3K1MA 1TT0A 3G3ZA 4KUMA 5DEQA 4CICA 4D5FA 3G73A 4L9VA 4C2TA 1FOYA 2Z2SB 3CF2A 3PNYA 1RI7A 3S32A 2A05A 3V8JA 1T2KA 1EKEA 5D8LB 4XK4A 4CA0A 2ZFWA 3E5XA 1V5FA 1U5TA 4BUPA 2VOOA 4BBSJ 2HVRA 2DYSH 2HFHA 4DZJA 3RPQA 3R0AA 4JK1X 1ZHFA 4BNCA 4OINF 4YFNF 1YW9A 1OCPA 2P0WA 3E5UA 2MFZA 3WTTC 3CCUI 5HS7A 3U2RA 1Q1VA 3ZMDA 2QQ9A 2CH0A 2WB1A 4A12A 1UHSA 1DUXC 3R60A 3OMYA 4KT6A 4OAZA 1MGTA 2K3FA 4O6JA 3L09A 2DPDA 3EDPA 5DCMB 2IJLA 3R6SA 3IRQA 2OV7A 5E3NA 4PUSA 3ZQFA 4L18B 2A3SA 2MA3A 3LAPA 3KLOA 2AHQA 1IXRC 3BR1A 2GIVA 3L2RA 3ZOBA 1T95A 3T0YA 4ZZLA 3W2AA 4YIRX 4LIUA 1MDMB 2JRTA 2G9WA 3CP8A 1F5TA 4AD9A 2CW0F 1EV7A 4XOTA 4N4NB 3LSTA 1LFPA 3GTQJ 2V6EA 5C44J 2E71A 4J01A 4IHWA 2Z33A 1UHWA 3DF8A 2M45A 4U7DA 4EGYA 3LNQA 1ETOA 4IEJA 4IHYA 4RBOA 4IQJA 3L1PA 2MSYA 1I50J 4QLCU 2LMDA 3Q0VA 1SFKA 4OWRB 3BG5A 3WTUC 5LGUA 3BG3A 3DU5A 2XAJA 4N0BA 4BU2A 1RRJA 2E35A 1O4XA 3GWZA 3ML6A 1X3WB 3HRTA 4MGRA 4PK4A 4U0YA 4WXDA 3OYKA 3GTMJ 3A0BC 3I4NJ 1KQ9A 4KIBA 1RUNA 2Z16A 5ICEA 2JPBA 4M9XA 3LA2A 1DU6A 4ZYHA 3I54A 3G71I 3U1DA 4ZH4F 5D5XB 3F8BA 2ZNZA 3MVPA 4HW0A 4DOZA 2RVCA 4II3A 5GADJ 5EJCA 1MZBA 3RKWA 5B1AH 4DYQA 1A5JA 4FETA 1YYVA 2QWWA 2Q2EB 3CESA 3HOTA 3CLQA 2JA6J 1H89C 2FU4A 4NC8A 4CCJA 3C18A 3GZ6A 1R4NB 1XB4A 1RUOA 1ODDA 2JUCA 4EJWA 4FASD 3CCQI 2R5YA 3K1PA 3REOA 3TW6A 2O8KA 3PFYA 4HF2A 3FK7A 3CJQB 5GPAA 1TW2A 1YW8A 2HU9A 3IH2A 4DYRA 2XIGA 3EYIA 3FM5A 3RJPA 2H6CA 2V1XA 5KNLA 1FYKA 2EIMH 4PFOA 3IH3A 1TQMA 2X1EA 3HRSA 1O3RA 1J2XA 1IRFA 1TWCJ 1U5TB 3FXKA 1JE8A 3HUGA 1KU2A 2Z1DA 3L2QA 5FKOA 1U3EM 4HEA2 3HG9A 3DTKA 1XSVA 1ZGAA 3NQOA 2XAFA 2KPMA 3GFLA 4E7LA 1K6YA 3HHHA 4C2UA 3A01A 1RKWA 3CTAA 3EUAA 1BR4A 1AKHA 4MEYF 4HF1A 1MJAA 2K02A 4KT5C 3I3LA 3CMMA 3TKYA 1VQNI 2HVSA 3QU6A 3NRVA 4RM2A 3BOQA 1XGMA 5L3DA 1TP4A 3E1SA 2ECCA 3GYHX 3BTJA 2EJRA 4ZYEA 1AHDP 2GXBA 3TP3A 4B43A 4A93J 3CDHA 3GBGA 1EH6A 2L54A 3TW7A 4C30A 4DJAA 4HNUA 2GM4A 3C1DA 2JT1A 4PJ0C 1WHUA 1I6HJ 3IAM2 2O61A 1YO5C 4DW6A 2IGMA 5IT3A 5GAEJ 1D8KA 2O8XA 4KDPA 2NVTJ 1OYYA 4OOIA 4II2A 1GV2A 3F22A 2DN0A 4G94A 4LG3A 5DS9A 3BWGA 3QOEA 1OYIA 3SZGA 5F0HA 1WJCA 3DP7A 3N05A 2ICWG 2RQQA 3MFKA 2ID3A 2K9SA 4G6DA 4PSWA 1ITYA 1E2XA 3O8GA 1FOWA 2H09A 3WG7H 3GTLJ 3KEQA 1K83J 2XB0X 4F52A 5E3OA 4UB6C 2MLGA 4ZDLA 1FT9A 3G2BA 3OOUA 1R1VA 1SVMA 1DPUA 2LR8A 4PGGA 4KNYA 3FXOA 2FBKA 2W24A 3E6BA 2X0LA 2RAEA 1SFEA 2WTEA 1QVUA 5HS9A 4BE1A 1MKMA 5HS8A 1XD7A 4JQFA 2YUSA 1ZGJA 4MTDA 1MSEC 5DDGA 2QUFA 4W97A 4GYGA 2IA0A 1FTTA 4I6ZA 4E7HA 4L0ZB 2R7DA 1VQOI 1MJ9A 4BGDA 3MQ0A 2Z9OA 3HOXJ 4CHUA 1FP2A 4E70A 4ESBA 1XSDA 3MKWB 2CFOA 5JVGF 3FF5A 2GAUA 4H0EA 1XDUA 3BQYA 2NNYA 3L7WA 4HX4A 1ULYA 2CUFA 1G6NA 5K5OA 2UXXA 1HSTA 1F36A 1Z7LA 4ENKA 2IGOA 1B1BA 2HYGD 3LQRA 1ZRFA 1MBEA 4M6XA 4AVPA 1Y1WJ 3KLNA 3H35A 2EWNA 3RIRA 1V55H 3VFZA 4B44A 1DP7P 1IRGA 3JRAA 2QM3A 2XGCA 3DXJF 2IEKA 3D0SA 1YX5A 2OD5A 4EEFG 3JRDA 4BY1J 2R5YB 1ZR2A 4KITB 3MEXA 2QA4I 4NHJA 3AL0B 3MKYB 1PDNC 2DT5A 5E1WA 1IZ1A 4M9SA 3FXQA 3ZQGA 1LDJA 5DCFA 1C0WA 2X6WA 3MAJA 1U78A 3F0CA 1VQKI 3CMEI 3N4MA 3FXRA 5ILUA 3QRFF 2K9NA 4L0YB 3IC7A 4PZJA 2QQBA 3IWFA 2ZBKA 3C2HA 2HVQA 3L2CA 1FX7A 3CCSI 1MH3A 2E1MC 3HUGB 1ETYA 1BC8C 3I4MJ 3I55I 3K4KA 4O5VA 2L4MA 3OL3A 5EG0A 1XC5A 4ASNA 4HV6A 2ESNA 2F6CA 4FX0A 5HDKA 1P9QC 2VIXA 3J81K 3A01B 3SYTA 2FF4A 4CZZA 1CF7A 3GTOJ 2FQ4A 4A3LJ 3HM5A 1Y0UA 3CUQB 1AKHB 3S1QJ 4B3XA 2JN6A 2R5ZA 5KAFC 4I09A 4IRIA 1HKSA 2PQ8A 2RKHA 3S14J 2XKOA 4V2GA 2ELJA 2F4IA 4RGUA 3WTYC 1E0EA 1ZAOA 2FSWA 2H1KA 2L3DA 1QQIA 1R00A 2ZJRF 3VWBA 2DA1A 3WU2C 1K4SA 1KQ0A 1D0ZA 1H8AC 2KDZA 3I59A 3KP6A 2BXYA 1F1ZA 5FKNA 1H88C 4OAYA 4GRIA 2VJ5A 1W5CC 2R92J 4OIOF 4EJOA 3DPLC 4D0PA 1W5SA 1HCRA 3HRUA 1TTYA 1J75A 4G8XA 2A5WA 4G7OF 2W57A 5FRMA 5J6XA 3HRMA 3HGGA 3TBIA 4B48A 1BR1A 1SD7A 4AYBA 1MNDA 2QVOA 3S3MA 2XGXA 3CDLA 4XKWA 4UXNA 2XAGA 3J81Z 1IN5A 3ZP5A 4KN7X 4IHXA 5F04A 2XF7A 1HSJA 4UUVA 2WA0A 3F23A 3MZHA 3BTIA 2KJBA 2VQLA 3UKGA 1TNSA 1W36C 3BTCA 4LG0B 2E1CA 1WGXA 5DTDA 2DCEA 2MGQA 3F8MA 3OSGA 4J00A 3V7SA 3L9FA 3SJMA 4LB5A 1LVKA 3BROA 4KN4X 1ON2A 1N78A 1UCRA 3DCFA 2DK5A 1LEBA 2BY1A 3HIFA 4RB3C 1K78A 2P6TA 1IN8A 3BJAA 2B9SA 4IHVA 1QZYA 3E7LA 4XONA 3U21A 3F3XA 3DTIA 1W0UA 3KP4A 3Q9VA 1T98A 3JTHA 1B59A 2CQQA 1BI0A 2LG4A 2LTPA 3OS2A 2F5DA 4W1UA 1CGPA 3ROUA 4GFBA 5LGNA 1L3LA 2RN7A 1TWAJ 5J1RA 4L5EA 5J1UA 1DPRA 3DEUA 2K7LA 1ZH5A 4BXFA 1LDKB 3W6VA 1T39A 3O3KA 3ASNH 4HNVA 5EEGA 1F43A 2UXNA 4A3GJ 3E6CC 3ZMUA 1RNLA 1ETKA 5FGMA 3TO6A 3SEQA 3VYSB 2FD5A 3M8EA 3A4CA 1RR8C 2MBFA 2VQCA 1R22A 2VLAA 3V8LA 2ZMEC 3SDBA 2LKSA 5IYCJ 3NARA 3TQNA 2XPUA 5LBQA 1FMVA 3VPRA 5EG0B 4A6EA 4HRIA 1VQ6I 3NAUA 1QPMA 3V7RA 1X1DA 3H36A 1WI9A 1E3PA 1CF7B 1XX5A 2DPUA 1G2HA 4J19A 1QU3A 2R5ZB 1R49A 1BW5A 1R23A 2HYFA 3HSEA 3K2AA 5E1ZB 4IOAF 1YHQI 3SEZA 4YEJA 2ZXJA 1X1BA 2HXIA 3HBLA 5M3MJ 1ZRDA 5HLHA 3K7AJ 3HOSA 2HQ5A 1X1PA 1J7KA 2KP6A 3CD6I 1A6IA 3HTUA 1OCOH 2ADUA 4M6VA 2XSDC 5BOXA 2M9HA 3OWTA 4IKFA 4P55A 3I59B 2K86A 1J5YA 1A31A 4HX7A 2TCTA 2OPTA 1TL8A 2LC2A 2VXDA 1TWFJ 4JBAA 2GIZA 4M74A 1DGWY 4CUGA 5JVTA 3KFWX 4I99C 1W36D 3GTPJ 1O7FA 3HKZA 1XPXA 4MTEA 3FBNB 3B02A 2OQRA 1LFBA 1FSHA 2AXTC 2COMA 2YS9A 3IHUA 3MZ8A 3T5XA 1ACIA 2HDCA 3FXJA 3OYGA 3MKLA 3ZQ7A 2DXIA 3CLOA 5J3LA 3F21A 3I64A 4K2EA 4WX9A 1YJWI 2VASA 4RA2A 3OYIA 1HKTA 1SAXA 2O3FA 2HDDA 2NOJB 2HZTA 4RLFA 3FHZA 3BP8A 2H27A 4A3IJ 1SEUA 5DD8A 1ZK8A 5F64A 3FDYA 4LMYA 5E18F 3JCUC 2MC4A 3A03A 2K4JA 3B73A 3MZYA 4ITVA 1PVEA 4AYBN 5F1JA 4NC6A 2KL4A 4IHSA 1K78B 3KP2A 1UELB 4MNUA 2E2JJ 1LUJB 2P5KA 1QHGA 2V9VA 3FWEA 1YX3A 2RNGA 4QSHA 5DCMA 3WHBA 4Q5SF 1V54H 2PMUA 3ZQIA 2K4BA 5A2QK 4IVNA 2KIMA 3OOPA 1VQMI 4EJUA 2FMLA 1FYLA 4N9HA 2Q1ZB 4CH7A 5IP9J 3W6JB 3S3OA 1P6RA 3ZQQA 1NG6A 4U87A 4LGWA 1POGA 2ELHA 4CYCA 4HDUA 4F92B 4DQ2A 1MDMA 1KU9A 4FE4A 5FLXZ 1Y39A 2PJPA 3PL8A 4UVCA 4E7ZA 5L3GA 3BZ6A 2DODA 4ZYGA 3C7JA 1JGSA 3QQAA 3OYFA 3PO3J 3CCVI 3HOZJ 1J9IA 3BC8A 2WAFA 1WH7A 3E3VA 2BGCA 2QSHX 4XL9A 1GVJA 4BE0A 3M7GA 2BZTA 3VSLA 5EDNA 2KLOA 2VOPA 1RESA 5F6FA 4I2OA 3TOAA 1O3QA 3GTJJ 1FPQA 3MWMA 1Z1DA 2HOTA 1B8IA 3D5LA 2DOFA 2HQNA 5A2QZ 4Q4ZF 1OISA 1H9GA 1X3UA 3KZYA 4XORA 1R5GA 1VQ4I 3O6BB 4R79A 2DFHA 2F4OB 1RETA 4M3BA 3CMYA 2DOEA 2PI0A 2XASA 1YLFA 4BL0B 3WU1B 3IUOA 1UZCA 5HOOA 2VONA 1SMTA 3GFJA 1XGOA 2JA2A 5FD6A 3WG9A 2JK3A 3GCMA 5AONA 4IF4A 2XDVA 4XBFA 3TEDA 3FXUA 2LD5A 4PJNA 4A0ZA 2EFOA 1EA3A 1OCTC 2Y69H 5LHGA 4IPAA 5K5QA 1TQIA 2HI3A 2HS5A 1FWZA 4YG2F 3HHGA 4HF0A 3H9JA 1YRNB 3F8CA 3KIOA 4HNTA 3A1YA 5J8CA 2Y0MA 1X4PA 2VE8A 2XAQA 3JREA 4YIFA 3ZR8X 3BZCA 5LRSA 4ZDOA 3GO5A 2ZMEA 2E1MB 1KYZA 1ZARA 3COAC 3A02A 2R7FA 3DTEA 3TO7A 1WJEA 2K9MA 3K4JA 5TRDA 2Y75A 4X6AJ 1H9TA 3WODF 3WHCA 2PEXA 3ABLH 2IA2A 3PQJA 1Q1HA 4CO8A 1VQPI 3FKJA 3HOVJ 2M30A 3H5NA 4XKCA 1IV8A 1UHMA 3H1CA 5E3MA 2XVCA 2JRMA 1V3FA 2HOEA 3LFUA 1P92A 2NS0A 1YITI 1ZG1A 1XGSA 1TZLA 1LVAA 2F5FA 3OYEA 2DA6A 4A0XA 2DLLA 2HOSA 2WY8Q 4CZCA 2F48A 3AG2H 5HVQC 4LK0F 2OZUA 1M1EB 3PUFA 3GLXA 3TGNA 2KIQA 3IP4B 4U88A 4RGRA 3AG1H 3GZ5A 1HA8A 2IP2A 1W4MA 5TGTA 2OCCH 2E7WA 4XLCA 4EQQA 3L2WA 3DFGA 3LQQA 4CYCB 2R4GA 4PSXA 1W1WE 3J7AY 3RYPA 4QTRA 1ZG5A 5F08A 1JKQC 1FJLA 2PG4A 2M87A 1ZLJA 3ZMTA 2V79A 2MYSA 4WF2A 1Z3XA 4E7IA 3BG9A 1RKTA 3JRFA 2CV1A 1LEAA 2DDBA 3BDDA 3HZJA 4LIVA 2XUBA 2TRTA 5HLIA 1KZHA 2YPRA 2ISZA 2K5CA 4FTHA 3RZDJ
chains in the Genus database with same CATH topology
4P9UA 2IW5A 5DUIA 3WU0A 4G6QA 2A6HF 1D5VA 4G7ZF 1WKMA 3RTRA 4AIHA 2A69F 1XDSA 5D4RA 3HTSB 1F4KA 1J59A 4I02A 2ISYA 2BEOA 3FM3A 2O6GE 3ECHA 3O2PE 5LHHA 2GA2A 4BHBA 2XKPA 5J8FA 1KGSA 1IXCA 1G4DA 1JXSA 4LLGF 1BI3A 2ZMEB 4EV0A 3EYYA 3E6DA 5D4SA 4I98B 1DDNA 1BIBA 4P5OA 2JSCA 2FQ3A 3K9TA 2EFPA 2JZYA 3CUQA 3H92A 3BPVA 1S7AA 3S2WA 3MCZA 3I71A 2QZ8A 3VEPA 3QP5A 1XSXA 2ZKZA 3LWFA 3GFMA 3WE2A 3GXOA 1XMAA 2JPCA 5D5WB 5E20A 5ERIA 4HQMA 2OAZA 1R7JA 2CYYA 3F6VA 2XAHA 4HYEA 5L3EA 1O57A 3SQNA 1H0MA 4RAZA 1HKQA 4HLXA 2GZWA 2R3SA 3WGHA 4LG0A 2DQRA 4CDGA 2ESHA 2DK8A 2DW4A 3VODA 1Z9CA 2P5LC 5DYMA 3TDUC 5DD4A 4NB5A 1HW5A 3ZN0A 1QO0D 4OMYA 1SFUA 3K69A 2EA4A 4GYIA 2D45A 2OU2A 4KIGA 4HLYA 5HDGA 5FB2A 3W6KB 4P9FA 4KICA 2P7CB 4KFCA 1S3JA 2DQLA 3FZVA 3RYRA 1ZLKA 1Z05A 2VT2A 2ETHA 4LLNA 4ESFA 2Q0OA 3IL2A 1BC7C 1KU3A 4S04A 2G7UA 2RV8A 4HDVA 1STZA 1B9MA 3I58A 1BI1A 2F5EA 5LEKA 2XV4S 1GHCA 2HKOA 1P4XA 1FP1D 1OKRA 3RI4A 1R1TA 2FXAA 3KP5A 1LQ1A 1ONVA 4AIKA 1S6LA 6PAXA 3RPUA 5ICCA 2FE3A 2FNPA 1BIAA 3E97A 3FMQA 1BJAA 3LA3A 4B8XA 1Z6RA 5D8KB 4UNOA 2A5YB 4M72A 5CVRA 3BJ6A 3F6OA 3L00A 1IAWA 2VT3A 3ZMSA 4L5IA 5EEHA 2VXZA 3M9AA 2YU3A 1MD0A 1MJBA 2KRFA 4HV5A 3QP6A 3P7NA 5CVIA 2ZJ2A 5D5VB 1PP8F 3ZMVA 2XRNA 5FO5A 1K7AA 3ISPA 1ZN2A 4XSZF 4O3MA 3IKVA 2VODA 4LLLA 3ULQB 4R1HA 1U8RA 2PLYA 4Y17A 2RNJA 5CVJA 4M6YA 2A6EF 2D1HA 4U0WA 4HZFA 2V1DA 2EFQA 1FC3A 3GVAA 4RAYA 4ENMA 5H20A 3WTWC 1V4RA 3HSFA 2O03A 2O0YA 2W84A 4LK1F 2BBYA 4ETSA 4ON0A 5AIPA 2CFXA 3QPHA 3KP7A 1TNTA 4UV9A 2CG4A 4WCGA 2M1BA 1R5HA 1Z7UA 1RIOH 1SFXA 5TJJA 1T0FA 1TLHB 2EA2A 2EV0A 1FOKA 4ENJA 5F1RA 4CGZA 5HLGA 4UHTA 1LB2A 2JTVA 1LDDA 1PP7U 1FBSA 1FY7A 1USSA 4IRHA 4EM1A 4A6DA 2DBBA 2QYOA 2FBHA 2MLKA 4N9IA 2YSRA 2VC1A 2RC4A 4I7HA 3GEZA 1Z6TA 2EV6A 1G3WA 3ABTA 2UWMA 1IN4A 4FT8A 4RB0A 1YIOA 4OIRF 5IT9K 1EH8A 3BJOA 1F9NA 1KA8A 2VBYA 2Q8KA 4RGSA 3I53A 5KVRA 1YG2A 3WTXC 1IXSB 1K79A 5ED4A 3QAHA 5H6QA 1B4AA 1G3SA 1HW2A 3CUOA 5ICGA 2IVMA 4S05A 4F7ZA 1OYWA 4M9ZA 5E8IA 2FA5A 2FOKA 3FMRA 2L02A 2PMHA 3JSPA 5JI6A 1R36A 4GO1A 3DQVC 4ZYDA 5DUKA 2KKOA 5IT9Z 1KQ8A 4Y15A 2ZCWA 1PUEE 4R8HA 4Q47A 4RB1A 5E8GA 1ZRCA 1A04A 3VOEA 4OU0A 3Q9SA 1XCVA 4AWXB 1FBUA 2X4HA 2BYVE 1BBYA 1KU7A 1YTYA 2DFIA 3E5QA 2VBWA 2VBXA 3SZPA 2NAZA 4WXCA 5L3CA 1WSUA 3F72A 4B09A 4BHCA 4DNCA 2LKPA 2A07F 2YX4A 4YFKF 4BHPA 4NQWA 2K27A 1G3TA 5JFRA 4Y13A 3WE3A 3FMSA 2MC3A 2LNBA 3GW2A 4BH9A 4L0YB 4G7HF 4PCQA 1SD6A 2DI3A 4BQAA 3TO9A 2V1UA 4YFXF 1T6SA 1K6OA 3IRRA 3I4PA 2H94A 3V8KA 1TQPA 3JTGA 1TW3A 1T38A 2WC2A 2P8TA 2CGPA 1E17A 3TOBA 4HQEA 2FBIA 2MH9A 1SD5A 1P2FA 3P9IA 2A61A 3R0JA 2RDPA 4FX4A 1EH7A 3E6MA 5K1YA 2AS5F 4RS8A 4IHTA 2QENA 3T8TA 2GXGA 2NYXA 1W7PD 3LFKA 3DV8A 2HGCA 1FZPB 4M71A 5LHIA 2Z5UA 4L9TA 4GGGA 5K5RA 3J7AO 3OV8A 2MH2A 4IXAA 1O3TA 3JSOA 3SFZA 1AOYA 1YW7A 3CJNA 3F8NA 1P4AA 3M1EA 2Z99A 1D3YA 3ECOA 1SD4A 3R61A 1B6AA 1BN5A 3F8FA 2P7VB 4HA8A 3M8FA 3ELKA 2EK5A 4I0AA 4GCVA 1YS6A 2GWRA 2EFNA 3P9KA 2GA1A 4IJAA 3N97A 5KK1A 2LSOA 2STWA 3H3ZA 4I0BA 4EJVA 1JHHA 1OR7A 1W7PA 3KZZA 4OIQF 2EV5A 4Q48A 1VTNC 4EVIA 5LRRA 3CO6C 2STTA 2EFWA 4EJTA 3EUHA 2P4WA 3TDZC 2OZ6A 5ILVA 1W5TA 5BQTA 1IN6A 1P4WA 2QQAA 5LGTA 1IUYA 3LAJA 2IA1A 3BY6A 1XN7A 1I1GA 2EB7A 2W25A 3PFIA 2C6YA 1XMKA 3LA7A 3WGGA 1O3SA 1NHAA 3GX4X 4WK8F 2CQKA 1YQAA 4CXFA 3C3WA 2GQQA 2E7XA 2KJCA 2ACJA 1WQ2A 2HR3A 2PFBA 2XROA 4RB2C 2Z3YA 2PBIA 5JHUA 2W85A 3I0TA 5JR3A 1HBXG 4ENNA 4TV7A 3KETA 2L4AA 2HWVA 2XHKA 4HX8A 3SZTA 3VB2A 2KIUA 3WTZA 4LD5A 2RGVA 3KEOA 3NEUA 3IKTA 2J5OA 4ESJA 3J80K 3K2ZA 3JAMK 4ZZDA 2TDXA 2H6BA 3GF2A 2ZO4A 2NNNA 5FD5A 3GUDA 2IPQX 2J5PA 3HSRA 3ZPLA 2E1NA 4IRGA 4AIJA 1IW7F 1XGNA 4KYWA 1UFMA 4HAMA 2P6SA 1W7PB 4YIIA 3J80Z 3Q5FA 2VBZA 2L01A 3JAMZ 1FLIA 3EQLF 4CYDA 1ZG3A 5FFXA 5L3FA 4M73A 1QZZA 3K1NA 4BAYA 2YR2A 1LJ9A 2F5CA 3KE2A 4OMZA 4I01A 1QGPA 1WRJA 2WWYA 4EMSA 2OQGA 2HKXA 4UVBA 4LFUA 3H3UA 2FMYA 2IRFG 5LEJA 2HTSA 5D6EA 1O7LA 1LNWA 2F2EA 5BS6A 3CO7C 5E17F 3DPTA 4XLPF 2DAOA 1QBJA 3KP3A 2PN6A 1JHFA 4P96A 1RZ4A 3SXYA 2CSOA 5E1XA 2VN2A 2VE9A 3WGIA 3ABUA 1QNTA 2D2WA 4L9JA 4MHGA 1FNNA 1BM9A 2LDUA 2YX7A 3U9GA 1KYWA 2LF7A 4KMFA 4UV8A 3I5UA 4WWCA 4XSXF 3T8RA 4EM0B 1I5ZA 3AAFA 1TBXA 5BPIA 1AWCA 2CWEA 1ZREA 2V6CA 3QOPA 2RQPA 1WWXA 2QBYA 4L5JA 1HW1A 2OA4A 3IWZA 3V7CA 1FBQA 4RGXA 3JW4A 2MD5A 3EETA 1HQCA 2M8EA 1U6GA 3RKXA 1I1SA 4U7BA 4A5NA 4KA4A 4A5MA 1D8JA 1B9NA 4XRFA 4A2UA 3SHFA 2M5WA 2BV6A 4BYYA 3QPTA 3K0LA 2HQRA 2FRHA 1U5TC 5ILSA 1IN7A 5DV5A 4KMUX 1GXPA 2UZKA 1BOAA 4UVAA 4PDKA 2DU9A 4WXHA 2HEOA 3BPXA 1S7OA 1R1UA 1HXDA 4XLNF 5D5UB 4EGZA 4MQ9F 1FSEA 2LF8A 2FNAA 2D1VA 2KIFA 5FFZA 5BPDA 2A68F 2IT0A 4HBLA 4Z2YA 1R58A 4A0YA 1S8NA 2G7HA 4OIPF 5FLXK 2QLZA 5CYVA 4FHTA 1L0OC 2DO7A 1OPCA 4QWQA 5CJ9A 5CLSA 2B0LA 1I6XA 3RDIA 5D6FA 2QBYB 3P9CA 1J0RA 1S29A 3PQKA 5BMZA 1I27A 3RKYA 3V4GA 3R4KA 4MQVA 1USTA 2AXLA 2HTJA 4MEXF 3HYIA 4GXOA 4HOBA 3ERED 1YFHA 1GXQA 1OMIA 2CO5A 3WTSC 5LLQA 5CVVA 4G9YA 5AIQA 3WTVC 1ON1A 5CVUA 3QU3A 1REPC 4KIFA 2ZNYA 4U0VA 1UB9A 3DKWA 1IF1A 4LJZF 2WV0A 1U2WA 1YS7A 1XCBA 2OBPA 1ZYRF 2FEZA 3KCCA 5HDNA 2NRAC 1FYMA 3FX3A 4BXUA 2BE5F 2VC0A 2DTRA 1SMYF 5H6RA 3GFIA 3CUQC 4EM2A 3ZMZA 5ICFA 4PGHA 5L3BA 4LB6B 3T1BA 2Q2EA 1G3YA 2Y48A 1BI2A 4L9NA 1Z91A 3ZN1A 2P5VA 3K1MA 3G3ZA 4KUMA 5DEQA 4CICA 3G73A 4L9VA 1RI7A 3V8JA 1T2KA 5D8LB 2ZFWA 3E5XA 1U5TA 2VOOA 2HFHA 3RPQA 3R0AA 4JK1X 1ZHFA 4BNCA 4OINF 4YFNF 1YW9A 3E5UA 3WTTC 5HS7A 3U2RA 3ZMDA 2QQ9A 4A12A 1DUXC 3R60A 1MGTA 4O6JA 3L09A 2DPDA 3EDPA 5DCMB 2IJLA 3R6SA 3IRQA 4L18B 2A3SA 2MA3A 3LAPA 3KLOA 1IXRC 2GIVA 3T0YA 4ZZLA 1MDMB 2JRTA 2G9WA 1F5TA 4AD9A 2CW0F 1EV7A 3LSTA 2Z33A 1UHWA 3DF8A 2M45A 4U7DA 4EGYA 4QLCU 3WTUC 5LGUA 2XAJA 4N0BA 3GWZA 3ML6A 3HRTA 4MGRA 4U0YA 4WXDA 1KQ9A 4KIBA 1RUNA 5ICEA 2JPBA 4M9XA 3LA2A 4ZYHA 3I54A 3U1DA 4ZH4F 5D5XB 3F8BA 2ZNZA 4HW0A 2RVCA 1MZBA 3RKWA 1YYVA 2QWWA 3HOTA 2FU4A 3C18A 3GZ6A 1XB4A 1RUOA 1ODDA 4EJWA 3K1PA 3REOA 4HF2A 1TW2A 1YW8A 2XIGA 3EYIA 3FM5A 3RJPA 2H6CA 2V1XA 1FYKA 1TQMA 3HRSA 1O3RA 1J2XA 1IRFA 1U5TB 1JE8A 3HUGA 1KU2A 1U3EM 1XSVA 1ZGAA 3NQOA 2XAFA 3GFLA 3HHHA 3CTAA 4MEYF 4HF1A 1MJAA 2K02A 4KT5C 3TKYA 3QU6A 3NRVA 3BOQA 1XGMA 5L3DA 3GYHX 2EJRA 4ZYEA 2GXBA 3CDHA 1EH6A 2L54A 3C1DA 2JT1A 2O61A 1YO5C 5IT3A 1D8KA 2O8XA 4KDPA 1OYYA 4OOIA 3F22A 4G94A 3BWGA 1OYIA 3DP7A 3MFKA 4G6DA 1E2XA 2H09A 3KEQA 2MLGA 1FT9A 1R1VA 1DPUA 4PGGA 4KNYA 2FBKA 2W24A 3E6BA 2X0LA 1SFEA 2WTEA 5HS9A 1MKMA 5HS8A 1XD7A 4JQFA 1ZGJA 4MTDA 5DDGA 2QUFA 4GYGA 2IA0A 4L0ZB 2R7DA 1MJ9A 3MQ0A 2Z9OA 4CHUA 1FP2A 4E70A 4ESBA 1XSDA 3FF5A 2GAUA 4H0EA 1XDUA 2NNYA 3L7WA 4HX4A 1ULYA 1G6NA 5K5OA 2UXXA 1HSTA 4ENKA 1B1BA 2HYGD 3LQRA 1ZRFA 4M6XA 4AVPA 3KLNA 3RIRA 2EWNA 1IRGA 3VFZA 1DP7P 2QM3A 3DXJF 3D0SA 2OD5A 3MEXA 4NHJA 1PDNC 2DT5A 5E1WA 1IZ1A 4M9SA 3FXQA 1LDJA 5DCFA 1C0WA 3MAJA 1U78A 3N4MA 3FXRA 5ILUA 3QRFF 3IC7A 4PZJA 2QQBA 3IWFA 2ZBKA 3L2CA 1FX7A 1BC8C 4O5VA 2L4MA 4ASNA 4HV6A 2ESNA 4FX0A 5HDKA 3J81K 2FF4A 4CZZA 1CF7A 1Y0UA 3CUQB 4I09A 4IRIA 1HKSA 2PQ8A 2RKHA 2XKOA 4RGUA 3WTYC 1ZAOA 2FSWA 2L3DA 1QQIA 1R00A 1KQ0A 3I59A 3KP6A 1F1ZA 4OIOF 4EJOA 3DPLC 4D0PA 1W5SA 3HRUA 1TTYA 1J75A 4G8XA 4G7OF 2W57A 5J6XA 3HRMA 1SD7A 2QVOA 2XGXA 4UXNA 2XAGA 3J81Z 1IN5A 3ZP5A 4KN7X 1HSJA 4UUVA 3F23A 3MZHA 2KJBA 1TNSA 4LG0B 2E1CA 3F8MA 3V7SA 3L9FA 4LB5A 3BROA 4KN4X 1ON2A 1UCRA 2DK5A 1LEBA 1K78A 3HIFA 4RB3C 2P6TA 1IN8A 3BJAA 1QZYA 3F3XA 3KP4A 3Q9VA 1T98A 3JTHA 1B59A 1BI0A 2F5DA 1CGPA 3ROUA 5LGNA 1L3LA 2RN7A 1DPRA 3DEUA 2K7LA 1ZH5A 1LDKB 1T39A 3O3KA 5EEGA 2UXNA 3E6CC 3ZMUA 1RNLA 5FGMA 3TO6A 3M8EA 2MBFA 1R22A 3V8LA 3TQNA 5LBQA 4A6EA 1QPMA 3V7RA 1WI9A 1CF7B 2DPUA 1R23A 2HYFA 3HSEA 5E1ZB 2ZXJA 1ZRDA 5HLHA 3HOSA 1J7KA 3HTUA 2ADUA 5BOXA 4P55A 3I59B 2K86A 1J5YA 4HX7A 4JBAA 4M74A 5JVTA 3KFWX 1O7FA 4MTEA 3B02A 2OQRA 1FSHA 2COMA 3IHUA 3T5XA 2HDCA 3ZQ7A 3CLOA 3F21A 3I64A 4K2EA 4WX9A 1HKTA 1SAXA 2O3FA 2HZTA 3FHZA 3BP8A 2H27A 5DD8A 5F64A 4LMYA 5E18F 2K4JA 3B73A 3MZYA 4IHSA 1K78B 3KP2A 4MNUA 2P5KA 3FWEA 2V9VA 5DCMA 4Q5SF 2PMUA 2K4BA 5A2QK 4IVNA 2KIMA 3OOPA 1FYLA 4EJUA 2FMLA 4N9HA 3W6JB 1P6RA 4LGWA 2ELHA 4HDUA 4DQ2A 1MDMA 1KU9A 5FLXZ 2PJPA 4UVCA 5L3GA 3BZ6A 4ZYGA 3C7JA 1JGSA 1J9IA 3E3VA 2BGCA 1GVJA 3M7GA 2VOPA 5F6FA 4I2OA 3TOAA 1O3QA 1FPQA 3MWMA 1Z1DA 3D5LA 2HQNA 5A2QZ 4Q4ZF 1H9GA 1X3UA 3KZYA 1R5GA 3O6BB 4R79A 2PI0A 2XASA 1YLFA 3WU1B 5HOOA 2VONA 1SMTA 3GFJA 1XGOA 5FD6A 3WG9A 5AONA 4IF4A 4XBFA 3FXUA 4A0ZA 2EFOA 5LHGA 4IPAA 5K5QA 1TQIA 2HS5A 1FWZA 4YG2F 3HHGA 4HF0A 3F8CA 5J8CA 2Y0MA 2VE8A 2XAQA 4YIFA 5LRSA 3GO5A 2ZMEA 1KYZA 1ZARA 3COAC 2R7FA 3TO7A 5TRDA 2Y75A 1H9TA 3WODF 2PEXA 4CO8A 2IA2A 1Q1HA 3PQJA 2M30A 1UHMA 2XVCA 1V3FA 2HOEA 1P92A 2NS0A 1ZG1A 1XGSA 2F5FA 1LVAA 4A0XA 2DLLA 5HVQC 4LK0F 2OZUA 3GLXA 3TGNA 4U88A 4RGRA 3GZ5A 2IP2A 1W4MA 2E7WA 4EQQA 3DFGA 3LQQA 3RYPA 1ZG5A 2PG4A 2M87A 1ZLJA 3ZMTA 2V79A 4WF2A 1LEAA 3BDDA 2XUBA 5HLIA 2YPRA 2ISZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9U A;  2IW5 A;  5DUI A;  3WU0 A;  4G6Q A;  2A6H F;  1D5V A;  4G7Z F;  1WKM A;  3RTR A;  4AIH A;  2A69 F;  1XDS A;  5D4R A;  3HTS B;  1F4K A;  1J59 A;  4I02 A;  2ISY A;  2BEO A;  3FM3 A;  2O6G E;  3ECH A;  3O2P E;  5LHH A;  2GA2 A;  4BHB A;  2XKP A;  5J8F A;  1KGS A;  1IXC A;  1G4D A;  1JXS A;  4LLG F;  1BI3 A;  2ZME B;  4EV0 A;  3EYY A;  3E6D A;  5D4S A;  4I98 B;  1DDN A;  1BIB A;  4P5O A;  2JSC A;  2FQ3 A;  3K9T A;  2EFP A;  2JZY A;  3CUQ A;  3H92 A;  3BPV A;  1S7A A;  3S2W A;  3MCZ A;  3I71 A;  2QZ8 A;  3VEP A;  3QP5 A;  1XSX A;  2ZKZ A;  3LWF A;  3GFM A;  3WE2 A;  3GXO A;  1XMA A;  2JPC A;  5D5W B;  5E20 A;  5ERI A;  4HQM A;  2OAZ A;  1R7J A;  2CYY A;  3F6V A;  2XAH A;  4HYE A;  5L3E A;  1O57 A;  3SQN A;  1H0M A;  4RAZ A;  1HKQ A;  4HLX A;  2GZW A;  2R3S A;  3WGH A;  4LG0 A;  2DQR A;  4CDG A;  2ESH A;  2DK8 A;  2DW4 A;  3VOD A;  1Z9C A;  2P5L C;  5DYM A;  3TDU C;  5DD4 A;  4NB5 A;  1HW5 A;  3ZN0 A;  1QO0 D;  4OMY A;  1SFU A;  3K69 A;  2EA4 A;  4GYI A;  2D45 A;  2OU2 A;  4KIG A;  4HLY A;  5HDG A;  5FB2 A;  3W6K B;  4P9F A;  4KIC A;  2P7C B;  4KFC A;  1S3J A;  2DQL A;  3FZV A;  3RYR A;  1ZLK A;  1Z05 A;  2VT2 A;  2ETH A;  4LLN A;  4ESF A;  2Q0O A;  3IL2 A;  1BC7 C;  1KU3 A;  4S04 A;  2G7U A;  2RV8 A;  4HDV A;  1STZ A;  1B9M A;  3I58 A;  1BI1 A;  2F5E A;  5LEK A;  2XV4 S;  1GHC A;  2HKO A;  1P4X A;  1FP1 D;  1OKR A;  3RI4 A;  1R1T A;  2FXA A;  3KP5 A;  1LQ1 A;  1ONV A;  4AIK A;  1S6L A;  6PAX A;  3RPU A;  5ICC A;  2FE3 A;  2FNP A;  1BIA A;  3E97 A;  3FMQ A;  1BJA A;  3LA3 A;  4B8X A;  1Z6R A;  5D8K B;  4UNO A;  2A5Y B;  4M72 A;  5CVR A;  3BJ6 A;  3F6O A;  3L00 A;  1IAW A;  2VT3 A;  3ZMS A;  4L5I A;  5EEH A;  2VXZ A;  3M9A A;  2YU3 A;  1MD0 A;  1MJB A;  2KRF A;  4HV5 A;  3QP6 A;  3P7N A;  5CVI A;  2ZJ2 A;  5D5V B;  1PP8 F;  3ZMV A;  2XRN A;  5FO5 A;  1K7A A;  3ISP A;  1ZN2 A;  4XSZ F;  4O3M A;  3IKV A;  2VOD A;  4LLL A;  3ULQ B;  4R1H A;  1U8R A;  2PLY A;  4Y17 A;  2RNJ A;  5CVJ A;  4M6Y A;  2A6E F;  2D1H A;  4U0W A;  4HZF A;  2V1D A;  2EFQ A;  1FC3 A;  3GVA A;  4RAY A;  4ENM A;  5H20 A;  3WTW C;  1V4R A;  3HSF A;  2O03 A;  2O0Y A;  2W84 A;  4LK1 F;  2BBY A;  4ETS A;  4ON0 A;  5AIP A;  2CFX A;  3QPH A;  3KP7 A;  1TNT A;  4UV9 A;  2CG4 A;  4WCG A;  2M1B A;  1R5H A;  1Z7U A;  1RIO H;  1SFX A;  5TJJ A;  1T0F A;  1TLH B;  2EA2 A;  2EV0 A;  1FOK A;  4ENJ A;  5F1R A;  4CGZ A;  5HLG A;  4UHT A;  1LB2 A;  2JTV A;  1LDD A;  1PP7 U;  1FBS A;  1FY7 A;  1USS A;  4IRH A;  4EM1 A;  4A6D A;  2DBB A;  2QYO A;  2FBH A;  2MLK A;  4N9I A;  2YSR A;  2VC1 A;  2RC4 A;  4I7H A;  3GEZ A;  1Z6T A;  2EV6 A;  1G3W A;  3ABT A;  2UWM A;  1IN4 A;  4FT8 A;  4RB0 A;  1YIO A;  4OIR F;  5IT9 K;  1EH8 A;  3BJO A;  1F9N A;  1KA8 A;  2VBY A;  2Q8K A;  4RGS A;  3I53 A;  5KVR A;  1YG2 A;  3WTX C;  1IXS B;  1K79 A;  5ED4 A;  3QAH A;  5H6Q A;  1B4A A;  1G3S A;  1HW2 A;  3CUO A;  5ICG A;  2IVM A;  4S05 A;  4F7Z A;  1OYW A;  4M9Z A;  5E8I A;  2FA5 A;  2FOK A;  3FMR A;  2L02 A;  2PMH A;  3JSP A;  5JI6 A;  1R36 A;  4GO1 A;  3DQV C;  4ZYD A;  5DUK A;  2KKO A;  5IT9 Z;  1KQ8 A;  4Y15 A;  2ZCW A;  1PUE E;  4R8H A;  4Q47 A;  4RB1 A;  5E8G A;  1ZRC A;  1A04 A;  3VOE A;  4OU0 A;  3Q9S A;  1XCV A;  4AWX B;  1FBU A;  2X4H A;  2BYV E;  1BBY A;  1KU7 A;  1YTY A;  2DFI A;  3E5Q A;  2VBW A;  2VBX A;  3SZP A;  2NAZ A;  4WXC A;  5L3C A;  1WSU A;  3F72 A;  4B09 A;  4BHC A;  4DNC A;  2LKP A;  2A07 F;  2YX4 A;  4YFK F;  4BHP A;  4NQW A;  2K27 A;  1G3T A;  5JFR A;  4Y13 A;  3WE3 A;  3FMS A;  2MC3 A;  2LNB A;  3GW2 A;  4BH9 A;  4L0Y B;  4G7H F;  4PCQ A;  1SD6 A;  2DI3 A;  4BQA A;  3TO9 A;  2V1U A;  4YFX F;  1T6S A;  1K6O A;  3IRR A;  3I4P A;  2H94 A;  3V8K A;  1TQP A;  3JTG A;  1TW3 A;  1T38 A;  2WC2 A;  2P8T A;  2CGP A;  1E17 A;  3TOB A;  4HQE A;  2FBI A;  2MH9 A;  1SD5 A;  1P2F A;  3P9I A;  2A61 A;  3R0J A;  2RDP A;  4FX4 A;  1EH7 A;  3E6M A;  5K1Y A;  2AS5 F;  4RS8 A;  4IHT A;  2QEN A;  3T8T A;  2GXG A;  2NYX A;  1W7P D;  3LFK A;  3DV8 A;  2HGC A;  1FZP B;  4M71 A;  5LHI A;  2Z5U A;  4L9T A;  4GGG A;  5K5R A;  3J7A O;  3OV8 A;  2MH2 A;  4IXA A;  1O3T A;  3JSO A;  3SFZ A;  1AOY A;  1YW7 A;  3CJN A;  3F8N A;  1P4A A;  3M1E A;  2Z99 A;  1D3Y A;  3ECO A;  1SD4 A;  3R61 A;  1B6A A;  1BN5 A;  3F8F A;  2P7V B;  4HA8 A;  3M8F A;  3ELK A;  2EK5 A;  4I0A A;  4GCV A;  1YS6 A;  2GWR A;  2EFN A;  3P9K A;  2GA1 A;  4IJA A;  3N97 A;  5KK1 A;  2LSO A;  2STW A;  3H3Z A;  4I0B A;  4EJV A;  1JHH A;  1OR7 A;  1W7P A;  3KZZ A;  4OIQ F;  2EV5 A;  4Q48 A;  1VTN C;  4EVI A;  5LRR A;  3CO6 C;  2STT A;  2EFW A;  4EJT A;  3EUH A;  2P4W A;  3TDZ C;  2OZ6 A;  5ILV A;  1W5T A;  5BQT A;  1IN6 A;  1P4W A;  2QQA A;  5LGT A;  1IUY A;  3LAJ A;  2IA1 A;  3BY6 A;  1XN7 A;  1I1G A;  2EB7 A;  2W25 A;  3PFI A;  2C6Y A;  1XMK A;  3LA7 A;  3WGG A;  1O3S A;  1NHA A;  3GX4 X;  4WK8 F;  2CQK A;  1YQA A;  4CXF A;  3C3W A;  2GQQ A;  2E7X A;  2KJC A;  2ACJ A;  1WQ2 A;  2HR3 A;  2PFB A;  2XRO A;  4RB2 C;  2Z3Y A;  2PBI A;  5JHU A;  2W85 A;  3I0T A;  5JR3 A;  1HBX G;  4ENN A;  4TV7 A;  3KET A;  2L4A A;  2HWV A;  2XHK A;  4HX8 A;  3SZT A;  3VB2 A;  2KIU A;  3WTZ A;  4LD5 A;  2RGV A;  3KEO A;  3NEU A;  3IKT A;  2J5O A;  4ESJ A;  3J80 K;  3K2Z A;  3JAM K;  4ZZD A;  2TDX A;  2H6B A;  3GF2 A;  2ZO4 A;  2NNN A;  5FD5 A;  3GUD A;  2IPQ X;  2J5P A;  3HSR A;  3ZPL A;  2E1N A;  4IRG A;  4AIJ A;  1IW7 F;  1XGN A;  4KYW A;  1UFM A;  4HAM A;  2P6S A;  1W7P B;  4YII A;  3J80 Z;  3Q5F A;  2VBZ A;  2L01 A;  3JAM Z;  1FLI A;  3EQL F;  4CYD A;  1ZG3 A;  5FFX A;  5L3F A;  4M73 A;  1QZZ A;  3K1N A;  4BAY A;  2YR2 A;  1LJ9 A;  2F5C A;  3KE2 A;  4OMZ A;  4I01 A;  1QGP A;  1WRJ A;  2WWY A;  4EMS A;  2OQG A;  2HKX A;  4UVB A;  4LFU A;  3H3U A;  2FMY A;  2IRF G;  5LEJ A;  2HTS A;  5D6E A;  1O7L A;  1LNW A;  2F2E A;  5BS6 A;  3CO7 C;  5E17 F;  3DPT A;  4XLP F;  2DAO A;  1QBJ A;  3KP3 A;  2PN6 A;  1JHF A;  4P96 A;  1RZ4 A;  3SXY A;  2CSO A;  5E1X A;  2VN2 A;  2VE9 A;  3WGI A;  3ABU A;  1QNT A;  2D2W A;  4L9J A;  4MHG A;  1FNN A;  1BM9 A;  2LDU A;  2YX7 A;  3U9G A;  1KYW A;  2LF7 A;  4KMF A;  4UV8 A;  3I5U A;  4WWC A;  4XSX F;  3T8R A;  4EM0 B;  1I5Z A;  3AAF A;  1TBX A;  5BPI A;  1AWC A;  2CWE A;  1ZRE A;  2V6C A;  3QOP A;  2RQP A;  1WWX A;  2QBY A;  4L5J A;  1HW1 A;  2OA4 A;  3IWZ A;  3V7C A;  1FBQ A;  4RGX A;  3JW4 A;  2MD5 A;  3EET A;  1HQC A;  2M8E A;  1U6G A;  3RKX A;  1I1S A;  4U7B A;  4A5N A;  4KA4 A;  4A5M A;  1D8J A;  1B9N A;  4XRF A;  4A2U A;  3SHF A;  2M5W A;  2BV6 A;  4BYY A;  3QPT A;  3K0L A;  2HQR A;  2FRH A;  1U5T C;  5ILS A;  1IN7 A;  5DV5 A;  4KMU X;  1GXP A;  2UZK A;  1BOA A;  4UVA A;  4PDK A;  2DU9 A;  4WXH A;  2HEO A;  3BPX A;  1S7O A;  1R1U A;  1HXD A;  4XLN F;  5D5U B;  4EGZ A;  4MQ9 F;  1FSE A;  2LF8 A;  2FNA A;  2D1V A;  2KIF A;  5FFZ A;  5BPD A;  2A68 F;  2IT0 A;  4HBL A;  4Z2Y A;  1R58 A;  4A0Y A;  1S8N A;  2G7H A;  4OIP F;  5FLX K;  2QLZ A;  5CYV A;  4FHT A;  1L0O C;  2DO7 A;  1OPC A;  4QWQ A;  5CJ9 A;  5CLS A;  2B0L A;  1I6X A;  3RDI A;  5D6F A;  2QBY B;  3P9C A;  1J0R A;  1S29 A;  3PQK A;  5BMZ A;  1I27 A;  3RKY A;  3V4G A;  3R4K A;  4MQV A;  1UST A;  2AXL A;  2HTJ A;  4MEX F;  3HYI A;  4GXO A;  4HOB A;  3ERE D;  1YFH A;  1GXQ A;  1OMI A;  2CO5 A;  3WTS C;  5LLQ A;  5CVV A;  4G9Y A;  5AIQ A;  3WTV C;  1ON1 A;  5CVU A;  3QU3 A;  1REP C;  4KIF A;  2ZNY A;  4U0V A;  1UB9 A;  3DKW A;  1IF1 A;  4LJZ F;  2WV0 A;  1U2W A;  1YS7 A;  1XCB A;  2OBP A;  1ZYR F;  2FEZ A;  3KCC A;  5HDN A;  2NRA C;  1FYM A;  3FX3 A;  4BXU A;  2BE5 F;  2VC0 A;  2DTR A;  1SMY F;  5H6R A;  3GFI A;  3CUQ C;  4EM2 A;  3ZMZ A;  5ICF A;  4PGH A;  5L3B A;  4LB6 B;  3T1B A;  2Q2E A;  1G3Y A;  2Y48 A;  1BI2 A;  4L9N A;  1Z91 A;  3ZN1 A;  2P5V A;  3K1M A;  3G3Z A;  4KUM A;  5DEQ A;  4CIC A;  3G73 A;  4L9V A;  1RI7 A;  3V8J A;  1T2K A;  5D8L B;  2ZFW A;  3E5X A;  1U5T A;  2VOO A;  2HFH A;  3RPQ A;  3R0A A;  4JK1 X;  1ZHF A;  4BNC A;  4OIN F;  4YFN F;  1YW9 A;  3E5U A;  3WTT C;  5HS7 A;  3U2R A;  3ZMD A;  2QQ9 A;  4A12 A;  1DUX C;  3R60 A;  1MGT A;  4O6J A;  3L09 A;  2DPD A;  3EDP A;  5DCM B;  2IJL A;  3R6S A;  3IRQ A;  4L18 B;  2A3S A;  2MA3 A;  3LAP A;  3KLO A;  1IXR C;  2GIV A;  3T0Y A;  4ZZL A;  1MDM B;  2JRT A;  2G9W A;  1F5T A;  4AD9 A;  2CW0 F;  1EV7 A;  3LST A;  2Z33 A;  1UHW A;  3DF8 A;  2M45 A;  4U7D A;  4EGY A;  4QLC U;  3WTU C;  5LGU A;  2XAJ A;  4N0B A;  3GWZ A;  3ML6 A;  3HRT A;  4MGR A;  4U0Y A;  4WXD A;  1KQ9 A;  4KIB A;  1RUN A;  5ICE A;  2JPB A;  4M9X A;  3LA2 A;  4ZYH A;  3I54 A;  3U1D A;  4ZH4 F;  5D5X B;  3F8B A;  2ZNZ A;  4HW0 A;  2RVC A;  1MZB A;  3RKW A;  1YYV A;  2QWW A;  3HOT A;  2FU4 A;  3C18 A;  3GZ6 A;  1XB4 A;  1RUO A;  1ODD A;  4EJW A;  3K1P A;  3REO A;  4HF2 A;  1TW2 A;  1YW8 A;  2XIG A;  3EYI A;  3FM5 A;  3RJP A;  2H6C A;  2V1X A;  1FYK A;  1TQM A;  3HRS A;  1O3R A;  1J2X A;  1IRF A;  1U5T B;  1JE8 A;  3HUG A;  1KU2 A;  1U3E M;  1XSV A;  1ZGA A;  3NQO A;  2XAF A;  3GFL A;  3HHH A;  3CTA A;  4MEY F;  4HF1 A;  1MJA A;  2K02 A;  4KT5 C;  3TKY A;  3QU6 A;  3NRV A;  3BOQ A;  1XGM A;  5L3D A;  3GYH X;  2EJR A;  4ZYE A;  2GXB A;  3CDH A;  1EH6 A;  2L54 A;  3C1D A;  2JT1 A;  2O61 A;  1YO5 C;  5IT3 A;  1D8K A;  2O8X A;  4KDP A;  1OYY A;  4OOI A;  3F22 A;  4G94 A;  3BWG A;  1OYI A;  3DP7 A;  3MFK A;  4G6D A;  1E2X A;  2H09 A;  3KEQ A;  2MLG A;  1FT9 A;  1R1V A;  1DPU A;  4PGG A;  4KNY A;  2FBK A;  2W24 A;  3E6B A;  2X0L A;  1SFE A;  2WTE A;  5HS9 A;  1MKM A;  5HS8 A;  1XD7 A;  4JQF A;  1ZGJ A;  4MTD A;  5DDG A;  2QUF A;  4GYG A;  2IA0 A;  4L0Z B;  2R7D A;  1MJ9 A;  3MQ0 A;  2Z9O A;  4CHU A;  1FP2 A;  4E70 A;  4ESB A;  1XSD A;  3FF5 A;  2GAU A;  4H0E A;  1XDU A;  2NNY A;  3L7W A;  4HX4 A;  1ULY A;  1G6N A;  5K5O A;  2UXX A;  1HST A;  4ENK A;  1B1B A;  2HYG D;  3LQR A;  1ZRF A;  4M6X A;  4AVP A;  3KLN A;  3RIR A;  2EWN A;  1IRG A;  3VFZ A;  1DP7 P;  2QM3 A;  3DXJ F;  3D0S A;  2OD5 A;  3MEX A;  4NHJ A;  1PDN C;  2DT5 A;  5E1W A;  1IZ1 A;  4M9S A;  3FXQ A;  1LDJ A;  5DCF A;  1C0W A;  3MAJ A;  1U78 A;  3N4M A;  3FXR A;  5ILU A;  3QRF F;  3IC7 A;  4PZJ A;  2QQB A;  3IWF A;  2ZBK A;  3L2C A;  1FX7 A;  1BC8 C;  4O5V A;  2L4M A;  4ASN A;  4HV6 A;  2ESN A;  4FX0 A;  5HDK A;  3J81 K;  2FF4 A;  4CZZ A;  1CF7 A;  1Y0U A;  3CUQ B;  4I09 A;  4IRI A;  1HKS A;  2PQ8 A;  2RKH A;  2XKO A;  4RGU A;  3WTY C;  1ZAO A;  2FSW A;  2L3D A;  1QQI A;  1R00 A;  1KQ0 A;  3I59 A;  3KP6 A;  1F1Z A;  4OIO F;  4EJO A;  3DPL C;  4D0P A;  1W5S A;  3HRU A;  1TTY A;  1J75 A;  4G8X A;  4G7O F;  2W57 A;  5J6X A;  3HRM A;  1SD7 A;  2QVO A;  2XGX A;  4UXN A;  2XAG A;  3J81 Z;  1IN5 A;  3ZP5 A;  4KN7 X;  1HSJ A;  4UUV A;  3F23 A;  3MZH A;  2KJB A;  1TNS A;  4LG0 B;  2E1C A;  3F8M A;  3V7S A;  3L9F A;  4LB5 A;  3BRO A;  4KN4 X;  1ON2 A;  1UCR A;  2DK5 A;  1LEB A;  1K78 A;  3HIF A;  4RB3 C;  2P6T A;  1IN8 A;  3BJA A;  1QZY A;  3F3X A;  3KP4 A;  3Q9V A;  1T98 A;  3JTH A;  1B59 A;  1BI0 A;  2F5D A;  1CGP A;  3ROU A;  5LGN A;  1L3L A;  2RN7 A;  1DPR A;  3DEU A;  2K7L A;  1ZH5 A;  1LDK B;  1T39 A;  3O3K A;  5EEG A;  2UXN A;  3E6C C;  3ZMU A;  1RNL A;  5FGM A;  3TO6 A;  3M8E A;  2MBF A;  1R22 A;  3V8L A;  3TQN A;  5LBQ A;  4A6E A;  1QPM A;  3V7R A;  1WI9 A;  1CF7 B;  2DPU A;  1R23 A;  2HYF A;  3HSE A;  5E1Z B;  2ZXJ A;  1ZRD A;  5HLH A;  3HOS A;  1J7K A;  3HTU A;  2ADU A;  5BOX A;  4P55 A;  3I59 B;  2K86 A;  1J5Y A;  4HX7 A;  4JBA A;  4M74 A;  5JVT A;  3KFW X;  1O7F A;  4MTE A;  3B02 A;  2OQR A;  1FSH A;  2COM A;  3IHU A;  3T5X A;  2HDC A;  3ZQ7 A;  3CLO A;  3F21 A;  3I64 A;  4K2E A;  4WX9 A;  1HKT A;  1SAX A;  2O3F A;  2HZT A;  3FHZ A;  3BP8 A;  2H27 A;  5DD8 A;  5F64 A;  4LMY A;  5E18 F;  2K4J A;  3B73 A;  3MZY A;  4IHS A;  1K78 B;  3KP2 A;  4MNU A;  2P5K A;  3FWE A;  2V9V A;  5DCM A;  4Q5S F;  2PMU A;  2K4B A;  5A2Q K;  4IVN A;  2KIM A;  3OOP A;  1FYL A;  4EJU A;  2FML A;  4N9H A;  3W6J B;  1P6R A;  4LGW A;  2ELH A;  4HDU A;  4DQ2 A;  1MDM A;  1KU9 A;  5FLX Z;  2PJP A;  4UVC A;  5L3G A;  3BZ6 A;  4ZYG A;  3C7J A;  1JGS A;  1J9I A;  3E3V A;  2BGC A;  1GVJ A;  3M7G A;  2VOP A;  5F6F A;  4I2O A;  3TOA A;  1O3Q A;  1FPQ A;  3MWM A;  1Z1D A;  3D5L A;  2HQN A;  5A2Q Z;  4Q4Z F;  1H9G A;  1X3U A;  3KZY A;  1R5G A;  3O6B B;  4R79 A;  2PI0 A;  2XAS A;  1YLF A;  3WU1 B;  5HOO A;  2VON A;  1SMT A;  3GFJ A;  1XGO A;  5FD6 A;  3WG9 A;  5AON A;  4IF4 A;  4XBF A;  3FXU A;  4A0Z A;  2EFO A;  5LHG A;  4IPA A;  5K5Q A;  1TQI A;  2HS5 A;  1FWZ A;  4YG2 F;  3HHG A;  4HF0 A;  3F8C A;  5J8C A;  2Y0M A;  2VE8 A;  2XAQ A;  4YIF A;  5LRS A;  3GO5 A;  2ZME A;  1KYZ A;  1ZAR A;  3COA C;  2R7F A;  3TO7 A;  5TRD A;  2Y75 A;  1H9T A;  3WOD F;  2PEX A;  4CO8 A;  2IA2 A;  1Q1H A;  3PQJ A;  2M30 A;  1UHM A;  2XVC A;  1V3F A;  2HOE A;  1P92 A;  2NS0 A;  1ZG1 A;  1XGS A;  2F5F A;  1LVA A;  4A0X A;  2DLL A;  5HVQ C;  4LK0 F;  2OZU A;  3GLX A;  3TGN A;  4U88 A;  4RGR A;  3GZ5 A;  2IP2 A;  1W4M A;  2E7W A;  4EQQ A;  3DFG A;  3LQQ A;  3RYP A;  1ZG5 A;  2PG4 A;  2M87 A;  1ZLJ A;  3ZMT A;  2V79 A;  4WF2 A;  1LEA A;  3BDD A;  2XUB A;  5HLI A;  2YPR A;  2ISZ A; 
#chains in the Genus database with same CATH topology
 4P9U A;  1JJ6 C;  2IW5 A;  3X2Q H;  1JI8 A;  2Y31 A;  4C3J J;  5DUI A;  1T56 A;  4ZDP A;  1K61 A;  3WU0 A;  3OS0 A;  5EGO A;  3D1N I;  3PJR A;  3ONQ A;  3PNV A;  1B8I B;  4G6Q A;  9ANT A;  2A6H F;  3BG6 A;  1OFC X;  3CZ6 A;  1D5V A;  4G7Z F;  5FRN A;  1WKM A;  3RTR A;  4UB8 C;  4AIH A;  4AUX A;  2A69 F;  1XDS A;  2JWT A;  5D4R A;  3HTS B;  3VYR B;  1F4K A;  5GAG J;  1J59 A;  4I02 A;  2ISY A;  2BEO A;  2KFD A;  3BT9 A;  2ZB9 A;  3FM3 A;  1HOM A;  2O6G E;  3HL2 A;  2LKX A;  2LY2 A;  4PJJ A;  3ECH A;  3OR1 C;  3O2P E;  3KX2 A;  2FX0 A;  5JLX A;  5LFA A;  4Y52 J;  1R71 A;  2NVU B;  5LHH A;  2GA2 A;  2WAQ A;  1VFC A;  1IUF A;  4BHB A;  4RDU A;  2XKP A;  1RC9 A;  5J8F A;  2O9L A;  3RZO J;  1KGS A;  3W2V A;  2OUM A;  1SC7 A;  1IXC A;  2M3A A;  2I10 A;  2IAI A;  1G4D A;  2M4G A;  4XRM A;  2KMU A;  2KRC A;  5F0C A;  1VQ8 I;  1JXS A;  4LLG F;  1BI3 A;  1Y6I A;  3O8H A;  2ZME B;  1VZ0 A;  2JJ7 A;  2LRE A;  4EV0 A;  1XS9 A;  1DGR M;  3EYY A;  3H9G A;  4IX7 A;  3E6D A;  5D4S A;  3P5J A;  3BR6 A;  4I98 B;  1DDN A;  1BIB A;  1YI2 I;  4P5O A;  2CUZ A;  2JSC A;  2ME6 A;  2FQ3 A;  3K9T A;  2JA7 J;  2EFP A;  2JZY A;  2WAD A;  3CUQ A;  3H92 A;  3BPV A;  3HPH A;  4ABZ A;  1S7A A;  3S2W A;  3MCZ A;  4JYK A;  3I71 A;  1WFX A;  5C4X J;  2QZ8 A;  3VEP A;  1JGG A;  2QF7 A;  3QP5 A;  2MG4 A;  1XSX A;  1XG1 A;  2ZKZ A;  2LVS A;  3LWF A;  3GFM A;  4NNJ A;  4M3E A;  3WE2 A;  3GXO A;  1XMA A;  3V42 A;  5FJ8 J;  4V2F A;  3H0D A;  4A69 C;  1FEX A;  2EIL H;  2JPC A;  2M7B A;  5D5W B;  2GOX B;  2BY2 A;  5E20 A;  5ERI A;  2H8W A;  3Q3S A;  4HQM A;  4A3M J;  2OAZ A;  3BCB A;  3LSJ A;  2VKE A;  1GT0 C;  2WB1 N;  3FKI J;  1R7J A;  2CYY A;  3F6V A;  4LOC A;  3CF5 F;  3S1N J;  2XAH A;  1IRX A;  1WJF A;  4A3C J;  4HYE A;  5L3E A;  2NVY J;  1O57 A;  3SQN A;  3AG4 H;  1H0M A;  3RPU D;  1IDY A;  5CQG A;  4RAZ A;  1HKQ A;  4HLX A;  2GZW A;  2R3S A;  3WGH A;  2FUG 2;  4LG0 A;  2DQR A;  4CDG A;  2X6O A;  2ESH A;  2DK8 A;  2DW4 A;  2OTL I;  3VOD A;  2ME0 A;  1Z9C A;  4I76 A;  1T0F C;  2P5L C;  5DYM A;  5EGO B;  4CCN A;  3TDU C;  2GOM A;  2UUZ A;  4C3H J;  5DD4 A;  4NB5 A;  1QHH D;  4G12 A;  1HW5 A;  3ZN0 A;  3M07 A;  3HEF A;  1QO0 D;  4OMY A;  1SFU A;  3K69 A;  2EA4 A;  4GYI A;  2D45 A;  2OU2 A;  3M4O J;  4KIG A;  3VYU B;  3KPH A;  4HLY A;  4A3D J;  5HDG A;  2HOA A;  4PFP A;  1WVR A;  1IDZ A;  5FB2 A;  3W6K B;  4P9F A;  4BBR J;  2R7R A;  3B6C A;  3GZN B;  1EF4 A;  3PO2 J;  4A3F J;  2E5N A;  4KIC A;  3S1M J;  2P7C B;  4KFC A;  1S3J A;  2DQL A;  3FZV A;  3GLL A;  3RYR A;  1ZLK A;  1R5I D;  1JTY A;  1Z05 A;  2L7F P;  2ETH A;  2VT2 A;  1KON A;  4ZTF A;  4LLN A;  1MBH A;  4ESF A;  3BR0 A;  2Q0O A;  1Z77 A;  3KYD B;  3IL2 A;  1BC7 C;  1KU3 A;  4S04 A;  3L2V A;  3LMM A;  3HXL A;  5FRO A;  2G7U A;  1OJL A;  1STZ A;  2RV8 A;  1B9M A;  3I58 A;  4M3D A;  1BI1 A;  4HDV A;  2F5E A;  5IP6 A;  5LEK A;  4D1Q A;  2R7W A;  2XV4 S;  1GHC A;  2HKO A;  1P4X A;  1YIJ I;  5IYD J;  2VI6 A;  3BZK A;  1FP1 D;  1OKR A;  1MW7 A;  4HST A;  4DBR A;  3RI4 A;  1V5G A;  1R1T A;  3IAS 2;  2FXA A;  3S8P A;  4D5C A;  5DM7 F;  4IOC F;  5GTH C;  2LRD A;  3KP5 A;  4Y7N J;  1LQ1 A;  1ONV A;  2CW7 A;  1BJZ A;  3NWS A;  3QYE A;  4AIK A;  1S6L A;  1HLV A;  6PAX A;  2DMT A;  3OYJ A;  3RPU A;  4C9Y A;  2VKD A;  5IP7 J;  2DMU A;  5ICC A;  2FE3 A;  2W82 A;  5IYB J;  3BR5 A;  2FNP A;  3TP0 A;  1LPQ A;  1SVL A;  2ZXW H;  4YEL A;  1BIA A;  3CQZ J;  3ESW B;  2BW3 A;  2WBM A;  3E97 A;  1JKO C;  2M0M A;  3FMQ A;  3K4B A;  1BJA A;  3LA3 A;  1XTA A;  4B8X A;  2QKM B;  4P1W A;  4CCL A;  3RKQ A;  1Z6R A;  5F0F A;  2BXZ A;  2A6T A;  5D8K B;  1PUF B;  1MBF A;  4UNO A;  2A5Y B;  4X1E A;  4A3B J;  2IS2 A;  2OTJ I;  1NK3 P;  1G8X A;  4M72 A;  5CVR A;  1GV5 A;  3S2H J;  3BJ6 A;  3CDI A;  3F6O A;  3L00 A;  1ORK A;  3DLL F;  1IAW A;  2DTZ A;  3J7Z I;  2VT3 A;  3KEY A;  2JQ7 A;  2ELK A;  3ZMS A;  5HLT A;  4L5I A;  5EEH A;  2VXZ A;  3M9A A;  2YU3 A;  1MD0 A;  1MJB A;  2KRF A;  4HV5 A;  5M5X J;  1S5L C;  3QP6 A;  4QPO A;  3P7N A;  4D7N A;  3OYN A;  4Y3O A;  2VKV A;  3ZXS A;  3CMA I;  1NK2 P;  1FIA A;  2ZJ2 A;  5CVI A;  5D5V B;  3ZMV A;  1PP8 F;  1WJA A;  2XRN A;  5FO5 A;  1K7A A;  3ISP A;  1ZN2 A;  4XSZ F;  1A35 A;  3FK6 A;  4O3M A;  3IKV A;  2VOD A;  5C4J J;  3HOY J;  5IOY A;  4LLL A;  3ULQ B;  1Z0X A;  4R1H A;  4RAG A;  1U8R A;  2PLY A;  2QKL B;  3SDG A;  2X6Y A;  5CQE A;  1IV6 A;  3L2U A;  1Z67 A;  4MFD A;  2RNJ A;  4Y17 A;  2VPL A;  2NOG A;  5CVJ A;  1VQ7 I;  4M6Y A;  2A6E F;  3K4M A;  2D1H A;  3ZGK A;  1YE9 A;  4U0W A;  4ZYA A;  3CC4 I;  4AC0 A;  3QWL A;  2L5Q A;  5M3F J;  2IBD A;  4Y4R A;  2COB A;  4HZF A;  3IV5 A;  2V1D A;  4X0G A;  3DBH B;  2R7X A;  2ECB A;  2EFQ A;  2BY3 A;  3QPL A;  5F27 A;  1ETV A;  1FC3 A;  3GVA A;  5FKK A;  2I5U A;  5HOD A;  1ZTR A;  4RAY A;  4ENM A;  3A2K A;  3G1M A;  2P81 A;  5H20 A;  3WTW C;  4A3E J;  2OC6 A;  1FIP A;  1V4R A;  3HSF A;  2O03 A;  2O0Y A;  1BR2 A;  2V1N A;  2W84 A;  3PUB A;  4LK1 F;  2BBY A;  2L7K A;  4ETS A;  1UMQ A;  3ASO H;  4JX5 A;  4ON0 A;  3QPS A;  1QRY A;  5AIP A;  2CFX A;  5FKM A;  1PYV A;  1Z21 A;  3QPH A;  1B72 B;  3KP7 A;  1TNT A;  2LBF A;  4UV9 A;  3IH4 A;  2CG4 A;  4F91 B;  4WCG A;  4RAF A;  2M1B A;  1R5H A;  3LSP A;  4HSR A;  1K4T A;  3M8J A;  2W7N A;  3OYL A;  1OCR H;  1Z7U A;  2ZC2 A;  1RIO H;  1SFX A;  5TJJ A;  4BKX A;  1T0F A;  3LSH A;  3PSI A;  1TLH B;  2EA2 A;  2EV0 A;  1FOK A;  1Y8R B;  4ENJ A;  5F1R A;  4GDF A;  3B6A A;  4CGZ A;  5HLG A;  4UHT A;  4B3A A;  1LB2 A;  2JTV A;  2HPI A;  2BW3 B;  1LDD A;  1PP7 U;  3OYC A;  1FBS A;  3ZQH A;  1HC8 A;  1FY7 A;  1USS A;  4BJT A;  4IRH A;  2IS4 A;  4EM1 A;  4BY7 J;  4A6D A;  2DBB A;  1X3Z B;  4XLA A;  2QYO A;  3CCY A;  5K7Z A;  3CJR B;  2R7S A;  2G0E A;  1FTZ A;  2FBH A;  3KYC B;  4FCY A;  2EH3 A;  2MLK A;  4N9I A;  1YJN I;  4BE2 A;  2QGU A;  2YSR A;  1JKP C;  2VC1 A;  2RC4 A;  1SAN A;  2I8D A;  4I7H A;  3GEZ A;  1I3Q J;  3G6E I;  2AQE A;  4D9J A;  3M3Y J;  1LKX A;  2LLK A;  2R7Q A;  2K9L A;  3G4S I;  1Z6T A;  2UV1 A;  1MBG A;  3JRI A;  2EV6 A;  1YRN A;  1G3W A;  3ABT A;  2UWM A;  1IN4 A;  4FT8 A;  2NXN B;  4RB0 A;  3K70 C;  2X6X A;  4V19 K;  1YIO A;  4OIR F;  5IT9 K;  1EH8 A;  3DEW A;  2V9P A;  2X1C A;  3BJO A;  1TWH J;  1F9N A;  1KA8 A;  2VBY A;  2DDA A;  2Q8K A;  2DA4 A;  4DIQ A;  2MAB A;  3BR3 A;  4RGS A;  3I53 A;  1MMD A;  3DKY A;  5KVR A;  1YG2 A;  3FIS A;  3WTX C;  1IXS B;  4BEH A;  1K79 A;  3H5R A;  5ED4 A;  3QAH A;  4NBQ A;  5H6Q A;  1B4A A;  2X9D A;  2ZXH A;  1G3S A;  1X1A A;  1HW2 A;  3CUO A;  5KHD A;  5ICG A;  2CV2 A;  1R4M B;  2IVM A;  4S05 A;  4F7Z A;  1OYW A;  4M9Z A;  1QZE A;  3LL7 A;  5E8I A;  5BNG A;  2FA5 A;  2EIJ H;  2FOK A;  3HPG A;  1E3O C;  2L7Z A;  3FMR A;  2K9Q A;  1BOB A;  2L02 A;  4MFE A;  4UUT A;  5J40 A;  1DP3 A;  2PMH A;  3JSP A;  3DLA A;  5JI6 A;  1R36 A;  4GO1 A;  2Y9Y A;  1MBK A;  4XID A;  5K7H A;  1AU7 A;  1IC8 A;  3GTK J;  3DQV C;  2L9R A;  4ZYD A;  2XSJ C;  4Z6Y A;  5DUK A;  1WZ2 A;  2KKO A;  5IT9 Z;  1KQ8 A;  4Y15 A;  2ZCW A;  1PUE E;  4R8H A;  4Q47 A;  2JVG A;  2LH9 A;  1MMG A;  1DQU A;  4RB1 A;  1OR7 C;  5E8G A;  2CUE A;  2L0K A;  2LBF B;  1ZRC A;  1A04 A;  2K40 A;  2WV1 A;  3VOE A;  4PJM A;  3FXM A;  5B66 C;  4OU0 A;  4N4O B;  1GUU A;  3Q9S A;  4RMN A;  3EUH C;  1XCV A;  5J47 A;  4AWX B;  1FBU A;  1D0Y A;  3JRC A;  2OF7 A;  2X4H A;  1WCM J;  4QPQ A;  2BYV E;  1J09 A;  1VQ9 I;  2V4J C;  1BBY A;  1KU7 A;  5E3L A;  1YTY A;  3JRG A;  2AQF A;  2XB5 A;  2KZG A;  3AG3 H;  2JSP A;  2KT0 A;  2DFI A;  3E5Q A;  2VBW A;  2VBX A;  3LSI A;  3SZP A;  1LE8 A;  3EPZ A;  2NAZ A;  4WXC A;  5L3C A;  1WSU A;  3F72 A;  4B09 A;  4BHC A;  4Y33 A;  2LKP A;  4DNC A;  2A07 F;  1U8B A;  2YX4 A;  3DU6 A;  4YFK F;  3GTG J;  1G59 A;  4H4K C;  3G1O A;  4BHP A;  5J4V A;  4NQW A;  2CU7 A;  2K27 A;  3OIO A;  2XF5 A;  3K70 D;  1G3T A;  5JFR A;  3PSF A;  4Y13 A;  2Y0S A;  3WE3 A;  3FMS A;  2MC3 A;  1DU0 A;  2LNB A;  3H9Q A;  3GW2 A;  4BH9 A;  3S16 J;  2XRL A;  3LSK A;  4M3F A;  4PCQ A;  4G7H F;  3NWT A;  1SD6 A;  2DI3 A;  4BJ6 C;  1GVD A;  4HG2 A;  4DGW B;  3QYF A;  1OQY A;  1ZGW A;  1X58 A;  3CC7 I;  2IS1 A;  4BQA A;  5EZH A;  3LOC A;  3TO9 A;  2V1U A;  4YFX F;  1T6S A;  2HYJ A;  1K6O A;  1UG0 A;  3JR9 A;  2M0C A;  3I4P A;  2H94 A;  3IRR A;  3ZCO A;  3V8K A;  1TQP A;  2LOO A;  4MIM A;  3JTG A;  1D0X A;  1GLN A;  3E0J B;  4LIT A;  1N25 A;  3Q0W A;  4ANJ A;  1TW3 A;  1T38 A;  2O7O A;  2DA7 A;  2P8T A;  2WC2 A;  2CGP A;  1E17 A;  3TOB A;  4HQE A;  3HGY A;  4IL6 C;  2VKH A;  1WJD A;  2FBI A;  3HKZ N;  1BA5 A;  2MH9 A;  4PJL A;  4BEH B;  5EEA A;  1SD5 A;  4DBQ A;  1P2F A;  3P9I A;  2A61 A;  4BDZ A;  2L9S A;  3R0J A;  2RDP A;  4FX4 A;  4CCO A;  1EH7 A;  3E6M A;  2DMP A;  2JMW A;  5K1Y A;  2AS5 F;  3C2B A;  2Y9Z A;  3ERM A;  4RS8 A;  2H8R A;  4IHT A;  2QEN A;  3T8T A;  4XKV A;  2GXG A;  3OS1 A;  2M8G X;  1QVT A;  2NYX A;  4XIC A;  4FE7 A;  1W7P D;  3LFK A;  3K10 A;  3DV8 A;  2HGC A;  1EJ9 A;  1FZP B;  3RQ4 A;  1ZKG A;  2E36 A;  4M71 A;  5LHI A;  2Z5U A;  1ZQ3 P;  1X2N A;  3AKZ A;  4L9T A;  2KRH A;  4GGG A;  2XAU A;  3AFH A;  5K5R A;  3J7A O;  1X19 A;  3OV8 A;  2MH2 A;  4IXA A;  1O3T A;  4XN3 A;  3JSO A;  3RSN A;  3M1C A;  3SFZ A;  3OSF A;  1AOY A;  4XLH A;  1YW7 A;  3CJN A;  5FLV A;  2E2H J;  4EAT A;  3F8N A;  1RR7 A;  3PIP F;  1D1A A;  3OYB A;  3A0H C;  1P4A A;  3M1E A;  1I39 A;  2R7U A;  1T08 B;  4BQO A;  4E6K G;  2Z99 A;  1D3Y A;  3ECO A;  1IGN A;  4E4H A;  1SD4 A;  2VJI A;  3R61 A;  1B6A A;  2B7E A;  1BN5 A;  4E7K A;  3S3N A;  1JTX A;  2KZV A;  3F8F A;  1VF9 A;  5TIS C;  1V5E A;  3MMY B;  1Y8Q B;  2P7V B;  2MW8 A;  4HA8 A;  1LE8 B;  3W2W A;  3M8F A;  2HZD A;  3BLY A;  4E7J A;  3ELK A;  2XC7 A;  3OIP A;  2W00 A;  2EK5 A;  2XPW A;  4XKB A;  4I0A A;  2NVQ J;  4GCV A;  1YS6 A;  2RRE A;  2GWR A;  4NQW B;  2EFN A;  3P9K A;  3OY9 A;  1JJ8 C;  2W4S A;  2GA1 A;  3KZI C;  4CSW A;  4IJA A;  3N97 A;  5KK1 A;  2WY7 Q;  2LSO A;  2STW A;  3LSM A;  1D1C A;  2DMN A;  1MNE A;  2DOA A;  2XF6 A;  3H3Z A;  4I0B A;  4EJV A;  1JHH A;  1X2M A;  4CCM A;  1OR7 A;  1W7P A;  3KZZ A;  4OIQ F;  2EV5 A;  3Q0U A;  3CCL I;  1Y1V J;  1MMS A;  4Q48 A;  2DFE A;  1VTN C;  1ETQ A;  4EVI A;  5LRR A;  3CO6 C;  3HOU J;  1MMA A;  2STT A;  1VQ5 I;  2R7Z J;  2K3P A;  3LSR A;  2EFW A;  4EJT A;  3EUH A;  2P4W A;  3TDZ C;  3ABK H;  3G1L A;  1IRZ A;  3HDD A;  2OZ6 A;  4XLE A;  1W5T A;  2BHZ A;  5BQT A;  5ILV A;  2KIS A;  1IN6 A;  1P4W A;  2Y30 A;  1N77 A;  5GP9 A;  1ERD A;  2QQA A;  5LGT A;  1BL0 A;  4AU7 A;  2Y0S N;  1IUY A;  4NUB A;  3BR2 A;  3LAJ A;  2PX9 A;  2IA1 A;  3MN2 A;  3FIW A;  3I56 I;  3CCR I;  1JKR C;  3BY6 A;  1XN7 A;  2L7M P;  1I1G A;  3UR3 C;  1VND A;  2EB7 A;  2W25 A;  3W3C A;  3H3V K;  1TT5 B;  3PFI A;  2C6Y A;  1XMK A;  2YU9 J;  3LA7 A;  2GXA A;  3WGG A;  1UJ8 A;  3S93 A;  1O3S A;  2DFF A;  1NHA A;  2XGE A;  4BQN A;  3GX4 X;  2EZL A;  4WK8 F;  2QSG X;  2CQK A;  4XQF A;  1YQA A;  3K4N A;  4IO9 F;  4XM3 A;  4CXF A;  1PUF A;  3C3W A;  2DA3 A;  2GLO A;  2GQQ A;  2E7X A;  4RLQ A;  4AID A;  2KJC A;  2M7A A;  2ACJ A;  1WQ2 A;  2HR3 A;  2PFB A;  5GAH J;  3QOD A;  3K4L A;  2KHM A;  4C2M J;  1NH3 A;  2XRO A;  4RB2 C;  2Z3Y A;  4AM3 A;  2PBI A;  5JHU A;  2W85 A;  3I0T A;  5JR3 A;  2CQX A;  1HBX G;  4ENN A;  2E60 A;  4BXX J;  4TV7 A;  3KET A;  2L4A A;  2HWV A;  2LYC A;  2XHK A;  4HX8 A;  1OLT A;  3SZT A;  3VB2 A;  2KIU A;  3WTZ A;  4LD5 A;  3JRH A;  4UY8 I;  3OYM A;  2DJI A;  2RGV A;  3KEO A;  3NEU A;  2J5O A;  5JHF A;  3IKT A;  4ESJ A;  1YJ9 I;  2L9V A;  2M2E A;  2ZSI B;  1JT0 A;  3FXL A;  3J80 K;  2VB6 A;  3K2Z A;  3JAM K;  4QIW N;  2EPF A;  4ZZD A;  2TDX A;  2H6B A;  1SVO A;  3ZQL A;  2D5V A;  2BHY A;  3GF2 A;  2ZO4 A;  4IQ4 A;  2NNN A;  5FD5 A;  2CW8 A;  3GUD A;  3J7Y J;  1UG2 A;  5CPR B;  3BTL A;  2IPQ X;  2CJJ A;  1U9O A;  3U1K A;  1MNM C;  2J5P A;  2LK2 A;  1WPK A;  1OCC H;  1WJB A;  3HSR A;  4ZTJ A;  1AA7 A;  2X85 A;  2EBI A;  3ZPL A;  3DPU A;  2LP0 A;  3ABM H;  2HPM A;  3DWL E;  2R7O A;  2E1N A;  3LSG A;  4IRG A;  1Z3Y A;  2KDO A;  4AIJ A;  4UUS A;  4XRS G;  1IW7 F;  1XGN A;  2X48 A;  1IG7 A;  4KYW A;  4YRV A;  1WJ5 A;  1UFM A;  4HAM A;  4DYC A;  3S17 J;  2BVM A;  2E1O A;  3S2D J;  2P6S A;  1W7P B;  2CQN A;  4YII A;  3J80 Z;  2LY1 A;  3Q5F A;  5KCM A;  2R7V A;  1X1C A;  4JX4 A;  1B72 A;  2VBZ A;  2L01 A;  3JAM Z;  3PIO F;  1FLI A;  1FOX A;  3EQL F;  4CYD A;  2JA8 J;  1ZG3 A;  1X4O A;  5DM6 F;  5FFX A;  2H1L A;  5L3F A;  2IXS A;  4M73 A;  5B3S H;  2VQG A;  1QZZ A;  1D1B A;  3CC2 I;  3VSK A;  3K1N A;  2DA5 A;  4BAY A;  2JA5 J;  1LFU P;  2WAQ N;  1S7E A;  4JX6 A;  3ZQC A;  2L2O A;  2YR2 A;  1LJ9 A;  2F5C A;  3CCM I;  2E34 A;  3KE2 A;  1N75 A;  4OMZ A;  2BVL A;  4I01 A;  2ID6 A;  1QGP A;  1WRJ A;  1XMX A;  2WWY A;  2B63 J;  4EMS A;  2IS6 A;  2OQG A;  2PMZ A;  2VJ4 A;  2HKX A;  4UVB A;  4LFU A;  2DA2 A;  3H3U A;  3DBR B;  2NVX J;  2E19 A;  1IO2 A;  2FMY A;  2IRF G;  5LEJ A;  2HTS A;  5D6E A;  2KQR A;  1O7L A;  1TC3 C;  5KAI C;  3BQZ A;  1LNW A;  1CQT A;  2F2E A;  2CUJ A;  2EZK A;  3CP2 A;  5BS6 A;  3CO7 C;  4C3I J;  4ZC3 A;  3I9V 2;  5E17 F;  1A6Q A;  2JUG A;  2DJN A;  2ZJP F;  2VUM J;  3DPT A;  4XLP F;  3BG7 A;  5LD2 C;  2DAO A;  1QBJ A;  4DZP A;  3BCA A;  3KP3 A;  2PN6 A;  2WAE A;  2ZSH B;  2XGD A;  1SAU A;  2BOL A;  4ZJZ A;  3CJT B;  1JHF A;  1S72 I;  4P96 A;  3HOW J;  4AVZ A;  1RZ4 A;  2CQ7 A;  2EIK H;  4S0H B;  3SXY A;  1APL C;  2CSO A;  2ZJQ F;  2CRG A;  2VQH A;  5E1X A;  4CCK A;  2ZXI A;  2VN2 A;  2VE9 A;  3WGI A;  3ABU A;  4IZZ A;  3EUK L;  1QNT A;  2D2W A;  4L9J A;  3F9K A;  2V26 A;  4MHG A;  2DT6 A;  2LFB A;  1FNN A;  1BM9 A;  2LDU A;  4F93 B;  2YX7 A;  3U9G A;  5M5Y J;  1KYW A;  2LF7 A;  4KMF A;  3GME A;  5IPA A;  5B5E C;  4UV8 A;  2N8G A;  3I5U A;  4WWC A;  2HQA A;  4XSX F;  5CKT A;  3T8R A;  4EM0 B;  3C2G A;  1I5Z A;  3AAF A;  1TBX A;  5BPI A;  4D7M A;  3OIQ A;  1AWC A;  3JRB A;  2CWE A;  1ZRE A;  5B1B H;  2V6C A;  4E7S A;  3QOP A;  2RQP A;  1WWX A;  4UUS B;  2M34 A;  1JUM A;  3FBI B;  2QBY A;  2M4K A;  4L5J A;  2R93 J;  1U0J A;  1HW1 A;  2OA4 A;  3CCE I;  3IWZ A;  4M3G A;  2HXO A;  2AO9 A;  1A36 A;  3V7C A;  2R0Q C;  1FBQ A;  4RGX A;  1UAA A;  3JW4 A;  3D5S C;  3PNT A;  3UNG C;  2EZH A;  2MD5 A;  1MSF C;  3EET A;  1HDP A;  1MH4 A;  1HQC A;  2OCE A;  2M8E A;  1U6G A;  3RKX A;  4B4C A;  1JT6 A;  3HJE A;  1I1S A;  4U7B A;  2OJE D;  3HC7 A;  2CV0 A;  4A5N A;  1BW6 A;  4KA4 A;  1S9H A;  4FIS A;  4A5M A;  1D8J A;  4BDY A;  1B9N A;  2LY9 A;  4XRF A;  1HDD C;  2F5V A;  3SHF A;  4A2U A;  1Y0N A;  2M5W A;  5H2F C;  2BV6 A;  4NC7 A;  4BYY A;  3QPT A;  5IOZ A;  3K0L A;  1VI0 A;  5M5W J;  2HQR A;  5E79 C;  2FRH A;  2QQ8 A;  2EIN H;  2L9N A;  2PJR A;  2XPV A;  2GBY A;  2EQR A;  1U5T C;  5HNF A;  5ILS A;  4F55 A;  1IN7 A;  3FHN A;  4XR6 A;  3ZRG A;  4B47 A;  5DV5 A;  2IGK A;  4KMU X;  5K7F A;  2BY0 A;  2NS8 A;  4A3K J;  1GXP A;  1TWG J;  3RQI A;  5HNH A;  2QEX I;  4XOP A;  2UZK A;  5GTI C;  3KYL A;  4KIS A;  1BOA A;  2PMZ N;  4PDK A;  4UVA A;  1Y56 A;  2DU9 A;  3HB9 A;  1FMW A;  4WXH A;  2HEO A;  3BPX A;  2CS3 A;  1S7O A;  1R1U A;  1HXD A;  4XLN F;  4XLF A;  1T8I A;  5D5U B;  2V9K A;  4EGZ A;  1SFO J;  2W48 A;  3RCO A;  4MQ9 F;  1FSE A;  2EZI A;  2LF8 A;  2FNA A;  2D1V A;  2KIF A;  1D5Y A;  5FFZ A;  5BPD A;  2A68 F;  2VL8 A;  2IT0 A;  4HBL A;  4Z2Y A;  1NTC A;  1R58 A;  1RPW A;  4A0Y A;  2X1D A;  5FLM J;  1U9N A;  2V7F A;  4BAC A;  4BS9 A;  1S8N A;  1I3A A;  2QCO A;  3MD2 A;  2Y2Z A;  3TMO A;  2G7H A;  4OIP F;  2NS7 A;  3OR2 C;  3DEE A;  5FLX K;  1JUS A;  2QLZ A;  5EF6 A;  3H0G J;  5CYV A;  3D5R C;  4FHT A;  1L0O C;  4BJ5 C;  1R9T J;  2CMP A;  2DO7 A;  1ETW A;  3CCJ I;  1HF0 A;  1OPC A;  4QWQ A;  4XMY A;  5CJ9 A;  5GPC A;  2FOW A;  5CLS A;  3K4C A;  2B0L A;  1I6X A;  3RDI A;  1YOV B;  5D6F A;  2QBY B;  3P9C A;  4XN0 A;  2DT7 B;  1J0R A;  1S29 A;  2IGN A;  3PQK A;  5BMZ A;  3SFI A;  1I27 A;  4XNF A;  3VYT B;  4XRS A;  1P7I A;  3RKY A;  1W0T A;  4BQQ A;  3V4G A;  3R4K A;  5C3E J;  4MQV A;  5J1Y A;  2R7T A;  2JVH A;  4MLO A;  1UST A;  4HPQ A;  2X51 A;  4JP0 A;  2AXL A;  2HTJ A;  3OYH A;  1PJR A;  4MEX F;  3QYB A;  1QPI A;  3HYI A;  1VQL I;  5EZG A;  4GXO A;  4HOB A;  4MO7 A;  4RM3 A;  5JLW A;  2HDW A;  3ERE D;  1YFH A;  1GXQ A;  1OMI A;  2CO5 A;  3WTS C;  4NDL A;  5LLQ A;  3DKX A;  5CVV A;  2DYR H;  4G9Y A;  3S1R J;  4FQG A;  3K6G A;  5EYR A;  5AIQ A;  3WTV C;  4A3J J;  1ON1 A;  5CVU A;  2O5R A;  3AL0 C;  3OYA A;  1T33 A;  3QU3 A;  1REP C;  4KIF A;  2FJ1 A;  2VJJ A;  2ZNY A;  4U0V A;  4F3Q A;  2F4M B;  1UB9 A;  2W1O A;  1ZR4 A;  3DKW A;  3PM1 A;  4LJZ F;  1IF1 A;  2K85 A;  2WV0 A;  1U2W A;  1MIJ A;  1YS7 A;  1MBJ A;  1XCB A;  1WH5 A;  2E5Z A;  2PJR B;  2OBP A;  1ZYR F;  1E3H A;  2FEZ A;  3KCC A;  5HDN A;  2NRA C;  1FYM A;  3FX3 A;  1OCZ H;  4BXU A;  2BE5 F;  1ENH A;  4G6T B;  2VC0 A;  1MMN A;  2DTR A;  3S15 J;  1R6R A;  1SMY F;  5H6R A;  1ZEL A;  2VPR A;  3GFI A;  3CUQ C;  2ZFU A;  4EM2 A;  3OL4 A;  4B1R A;  3DBL B;  5IY5 H;  5J4Y A;  2E2I J;  3ZMZ A;  5ICF A;  1IJW C;  1QA6 A;  4PGH A;  5L3B A;  5FKL A;  4LB6 B;  3MKZ A;  1GDT A;  3T1B A;  3OYD A;  2Q2E A;  1G3Y A;  1NG7 A;  2QSF X;  4KJZ A;  2Y48 A;  2MD0 A;  1JUP A;  3TL4 X;  1BI2 A;  1ETX A;  2HNH A;  1WI3 A;  4L9N A;  3H5A A;  1Z91 A;  3ZN1 A;  2DMQ A;  3VDX A;  2P5V A;  4JOM A;  1P7J A;  3K1M A;  1TT0 A;  3G3Z A;  4KUM A;  5DEQ A;  4CIC A;  4D5F A;  3G73 A;  4L9V A;  4C2T A;  1FOY A;  2Z2S B;  3CF2 A;  3PNY A;  1RI7 A;  3S32 A;  2A05 A;  3V8J A;  1T2K A;  1EKE A;  5D8L B;  4XK4 A;  4CA0 A;  2ZFW A;  3E5X A;  1V5F A;  1U5T A;  4BUP A;  2VOO A;  4BBS J;  2HVR A;  2DYS H;  2HFH A;  4DZJ A;  3RPQ A;  3R0A A;  4JK1 X;  1ZHF A;  4BNC A;  4OIN F;  4YFN F;  1YW9 A;  1OCP A;  2P0W A;  3E5U A;  2MFZ A;  3WTT C;  3CCU I;  5HS7 A;  3U2R A;  1Q1V A;  3ZMD A;  2QQ9 A;  2CH0 A;  2WB1 A;  4A12 A;  1UHS A;  1DUX C;  3R60 A;  3OMY A;  4KT6 A;  4OAZ A;  1MGT A;  2K3F A;  4O6J A;  3L09 A;  2DPD A;  3EDP A;  5DCM B;  2IJL A;  3R6S A;  3IRQ A;  2OV7 A;  5E3N A;  4PUS A;  3ZQF A;  4L18 B;  2A3S A;  2MA3 A;  3LAP A;  3KLO A;  2AHQ A;  1IXR C;  3BR1 A;  2GIV A;  3L2R A;  3ZOB A;  1T95 A;  3T0Y A;  4ZZL A;  3W2A A;  4YIR X;  4LIU A;  1MDM B;  2JRT A;  2G9W A;  3CP8 A;  1F5T A;  4AD9 A;  2CW0 F;  1EV7 A;  4XOT A;  4N4N B;  3LST A;  1LFP A;  3GTQ J;  2V6E A;  5C44 J;  2E71 A;  4J01 A;  4IHW A;  2Z33 A;  1UHW A;  3DF8 A;  2M45 A;  4U7D A;  4EGY A;  3LNQ A;  1ETO A;  4IEJ A;  4IHY A;  4RBO A;  4IQJ A;  3L1P A;  2MSY A;  1I50 J;  4QLC U;  2LMD A;  3Q0V A;  1SFK A;  4OWR B;  3BG5 A;  3WTU C;  5LGU A;  3BG3 A;  3DU5 A;  2XAJ A;  4N0B A;  4BU2 A;  1RRJ A;  2E35 A;  1O4X A;  3GWZ A;  3ML6 A;  1X3W B;  3HRT A;  4MGR A;  4PK4 A;  4U0Y A;  4WXD A;  3OYK A;  3GTM J;  3A0B C;  3I4N J;  1KQ9 A;  4KIB A;  1RUN A;  2Z16 A;  5ICE A;  2JPB A;  4M9X A;  3LA2 A;  1DU6 A;  4ZYH A;  3I54 A;  3G71 I;  3U1D A;  4ZH4 F;  5D5X B;  3F8B A;  2ZNZ A;  3MVP A;  4HW0 A;  4DOZ A;  2RVC A;  4II3 A;  5GAD J;  5EJC A;  1MZB A;  3RKW A;  5B1A H;  4DYQ A;  1A5J A;  4FET A;  1YYV A;  2QWW A;  2Q2E B;  3CES A;  3HOT A;  3CLQ A;  2JA6 J;  1H89 C;  2FU4 A;  4NC8 A;  4CCJ A;  3C18 A;  3GZ6 A;  1R4N B;  1XB4 A;  1RUO A;  1ODD A;  2JUC A;  4EJW A;  4FAS D;  3CCQ I;  2R5Y A;  3K1P A;  3REO A;  3TW6 A;  2O8K A;  3PFY A;  4HF2 A;  3FK7 A;  3CJQ B;  5GPA A;  1TW2 A;  1YW8 A;  2HU9 A;  3IH2 A;  4DYR A;  2XIG A;  3EYI A;  3FM5 A;  3RJP A;  2H6C A;  2V1X A;  5KNL A;  1FYK A;  2EIM H;  4PFO A;  3IH3 A;  1TQM A;  2X1E A;  3HRS A;  1O3R A;  1J2X A;  1IRF A;  1TWC J;  1U5T B;  3FXK A;  1JE8 A;  3HUG A;  1KU2 A;  2Z1D A;  3L2Q A;  5FKO A;  1U3E M;  4HEA 2;  3HG9 A;  3DTK A;  1XSV A;  1ZGA A;  3NQO A;  2XAF A;  2KPM A;  3GFL A;  4E7L A;  1K6Y A;  3HHH A;  4C2U A;  3A01 A;  1RKW A;  3CTA A;  3EUA A;  1BR4 A;  1AKH A;  4MEY F;  4HF1 A;  1MJA A;  2K02 A;  4KT5 C;  3I3L A;  3CMM A;  3TKY A;  1VQN I;  2HVS A;  3QU6 A;  3NRV A;  4RM2 A;  3BOQ A;  1XGM A;  5L3D A;  1TP4 A;  3E1S A;  2ECC A;  3GYH X;  3BTJ A;  2EJR A;  4ZYE A;  1AHD P;  2GXB A;  3TP3 A;  4B43 A;  4A93 J;  3CDH A;  3GBG A;  1EH6 A;  2L54 A;  3TW7 A;  4C30 A;  4DJA A;  4HNU A;  2GM4 A;  3C1D A;  2JT1 A;  4PJ0 C;  1WHU A;  1I6H J;  3IAM 2;  2O61 A;  1YO5 C;  4DW6 A;  2IGM A;  5IT3 A;  5GAE J;  1D8K A;  2O8X A;  4KDP A;  2NVT J;  1OYY A;  4OOI A;  4II2 A;  1GV2 A;  3F22 A;  2DN0 A;  4G94 A;  4LG3 A;  5DS9 A;  3BWG A;  3QOE A;  1OYI A;  3SZG A;  5F0H A;  1WJC A;  3DP7 A;  3N05 A;  2ICW G;  2RQQ A;  3MFK A;  2ID3 A;  2K9S A;  4G6D A;  4PSW A;  1ITY A;  1E2X A;  3O8G A;  1FOW A;  2H09 A;  3WG7 H;  3GTL J;  3KEQ A;  1K83 J;  2XB0 X;  4F52 A;  5E3O A;  4UB6 C;  2MLG A;  4ZDL A;  1FT9 A;  3G2B A;  3OOU A;  1R1V A;  1SVM A;  1DPU A;  2LR8 A;  4PGG A;  4KNY A;  3FXO A;  2FBK A;  2W24 A;  3E6B A;  2X0L A;  2RAE A;  1SFE A;  2WTE A;  1QVU A;  5HS9 A;  4BE1 A;  1MKM A;  5HS8 A;  1XD7 A;  4JQF A;  2YUS A;  1ZGJ A;  4MTD A;  1MSE C;  5DDG A;  2QUF A;  4W97 A;  4GYG A;  2IA0 A;  1FTT A;  4I6Z A;  4E7H A;  4L0Z B;  2R7D A;  1VQO I;  1MJ9 A;  4BGD A;  3MQ0 A;  2Z9O A;  3HOX J;  4CHU A;  1FP2 A;  4E70 A;  4ESB A;  1XSD A;  3MKW B;  2CFO A;  5JVG F;  3FF5 A;  2GAU A;  4H0E A;  1XDU A;  3BQY A;  2NNY A;  3L7W A;  4HX4 A;  1ULY A;  2CUF A;  1G6N A;  5K5O A;  2UXX A;  1HST A;  1F36 A;  1Z7L A;  4ENK A;  2IGO A;  1B1B A;  2HYG D;  3LQR A;  1ZRF A;  1MBE A;  4M6X A;  4AVP A;  1Y1W J;  3KLN A;  3H35 A;  2EWN A;  3RIR A;  1V55 H;  3VFZ A;  4B44 A;  1DP7 P;  1IRG A;  3JRA A;  2QM3 A;  2XGC A;  3DXJ F;  2IEK A;  3D0S A;  1YX5 A;  2OD5 A;  4EEF G;  3JRD A;  4BY1 J;  2R5Y B;  1ZR2 A;  4KIT B;  3MEX A;  2QA4 I;  4NHJ A;  3AL0 B;  3MKY B;  1PDN C;  2DT5 A;  5E1W A;  1IZ1 A;  4M9S A;  3FXQ A;  3ZQG A;  1LDJ A;  5DCF A;  1C0W A;  2X6W A;  3MAJ A;  1U78 A;  3F0C A;  1VQK I;  3CME I;  3N4M A;  3FXR A;  5ILU A;  3QRF F;  2K9N A;  4L0Y B;  3IC7 A;  4PZJ A;  2QQB A;  3IWF A;  2ZBK A;  3C2H A;  2HVQ A;  3L2C A;  1FX7 A;  3CCS I;  1MH3 A;  2E1M C;  3HUG B;  1ETY A;  1BC8 C;  3I4M J;  3I55 I;  3K4K A;  4O5V A;  2L4M A;  3OL3 A;  5EG0 A;  1XC5 A;  4ASN A;  4HV6 A;  2ESN A;  2F6C A;  4FX0 A;  5HDK A;  1P9Q C;  2VIX A;  3J81 K;  3A01 B;  3SYT A;  2FF4 A;  4CZZ A;  1CF7 A;  3GTO J;  2FQ4 A;  4A3L J;  3HM5 A;  1Y0U A;  3CUQ B;  1AKH B;  3S1Q J;  4B3X A;  2JN6 A;  2R5Z A;  5KAF C;  4I09 A;  4IRI A;  1HKS A;  2PQ8 A;  2RKH A;  3S14 J;  2XKO A;  4V2G A;  2ELJ A;  2F4I A;  4RGU A;  3WTY C;  1E0E A;  1ZAO A;  2FSW A;  2H1K A;  2L3D A;  1QQI A;  1R00 A;  2ZJR F;  3VWB A;  2DA1 A;  3WU2 C;  1K4S A;  1KQ0 A;  1D0Z A;  1H8A C;  2KDZ A;  3I59 A;  3KP6 A;  2BXY A;  1F1Z A;  5FKN A;  1H88 C;  4OAY A;  4GRI A;  2VJ5 A;  1W5C C;  2R92 J;  4OIO F;  4EJO A;  3DPL C;  4D0P A;  1W5S A;  1HCR A;  3HRU A;  1TTY A;  1J75 A;  4G8X A;  2A5W A;  4G7O F;  2W57 A;  5FRM A;  5J6X A;  3HRM A;  3HGG A;  3TBI A;  4B48 A;  1BR1 A;  1SD7 A;  4AYB A;  1MND A;  2QVO A;  3S3M A;  2XGX A;  3CDL A;  4XKW A;  4UXN A;  2XAG A;  3J81 Z;  1IN5 A;  3ZP5 A;  4KN7 X;  4IHX A;  5F04 A;  2XF7 A;  1HSJ A;  4UUV A;  2WA0 A;  3F23 A;  3MZH A;  3BTI A;  2KJB A;  2VQL A;  3UKG A;  1TNS A;  1W36 C;  3BTC A;  4LG0 B;  2E1C A;  1WGX A;  5DTD A;  2DCE A;  2MGQ A;  3F8M A;  3OSG A;  4J00 A;  3V7S A;  3L9F A;  3SJM A;  4LB5 A;  1LVK A;  3BRO A;  4KN4 X;  1ON2 A;  1N78 A;  1UCR A;  3DCF A;  2DK5 A;  1LEB A;  2BY1 A;  3HIF A;  4RB3 C;  1K78 A;  2P6T A;  1IN8 A;  3BJA A;  2B9S A;  4IHV A;  1QZY A;  3E7L A;  4XON A;  3U21 A;  3F3X A;  3DTI A;  1W0U A;  3KP4 A;  3Q9V A;  1T98 A;  3JTH A;  1B59 A;  2CQQ A;  1BI0 A;  2LG4 A;  2LTP A;  3OS2 A;  2F5D A;  4W1U A;  1CGP A;  3ROU A;  4GFB A;  5LGN A;  1L3L A;  2RN7 A;  1TWA J;  5J1R A;  4L5E A;  5J1U A;  1DPR A;  3DEU A;  2K7L A;  1ZH5 A;  4BXF A;  1LDK B;  3W6V A;  1T39 A;  3O3K A;  3ASN H;  4HNV A;  5EEG A;  1F43 A;  2UXN A;  4A3G J;  3E6C C;  3ZMU A;  1RNL A;  1ETK A;  5FGM A;  3TO6 A;  3SEQ A;  3VYS B;  2FD5 A;  3M8E A;  3A4C A;  1RR8 C;  2MBF A;  2VQC A;  1R22 A;  2VLA A;  3V8L A;  2ZME C;  3SDB A;  2LKS A;  5IYC J;  3NAR A;  3TQN A;  2XPU A;  5LBQ A;  1FMV A;  3VPR A;  5EG0 B;  4A6E A;  4HRI A;  1VQ6 I;  3NAU A;  1QPM A;  3V7R A;  1X1D A;  3H36 A;  1WI9 A;  1E3P A;  1CF7 B;  1XX5 A;  2DPU A;  1G2H A;  4J19 A;  1QU3 A;  2R5Z B;  1R49 A;  1BW5 A;  1R23 A;  2HYF A;  3HSE A;  3K2A A;  5E1Z B;  4IOA F;  1YHQ I;  3SEZ A;  4YEJ A;  2ZXJ A;  1X1B A;  2HXI A;  3HBL A;  5M3M J;  1ZRD A;  5HLH A;  3K7A J;  3HOS A;  2HQ5 A;  1X1P A;  1J7K A;  2KP6 A;  3CD6 I;  1A6I A;  3HTU A;  1OCO H;  2ADU A;  4M6V A;  2XSD C;  5BOX A;  2M9H A;  3OWT A;  4IKF A;  4P55 A;  3I59 B;  2K86 A;  1J5Y A;  1A31 A;  4HX7 A;  2TCT A;  2OPT A;  1TL8 A;  2LC2 A;  2VXD A;  1TWF J;  4JBA A;  2GIZ A;  4M74 A;  1DGW Y;  4CUG A;  5JVT A;  3KFW X;  4I99 C;  1W36 D;  3GTP J;  1O7F A;  3HKZ A;  1XPX A;  4MTE A;  3FBN B;  3B02 A;  2OQR A;  1LFB A;  1FSH A;  2AXT C;  2COM A;  2YS9 A;  3IHU A;  3MZ8 A;  3T5X A;  1ACI A;  2HDC A;  3FXJ A;  3OYG A;  3MKL A;  3ZQ7 A;  2DXI A;  3CLO A;  5J3L A;  3F21 A;  3I64 A;  4K2E A;  4WX9 A;  1YJW I;  2VAS A;  4RA2 A;  3OYI A;  1HKT A;  1SAX A;  2O3F A;  2HDD A;  2NOJ B;  2HZT A;  4RLF A;  3FHZ A;  3BP8 A;  2H27 A;  4A3I J;  1SEU A;  5DD8 A;  1ZK8 A;  5F64 A;  3FDY A;  4LMY A;  5E18 F;  3JCU C;  2MC4 A;  3A03 A;  2K4J A;  3B73 A;  3MZY A;  4ITV A;  1PVE A;  4AYB N;  5F1J A;  4NC6 A;  2KL4 A;  4IHS A;  1K78 B;  3KP2 A;  1UEL B;  4MNU A;  2E2J J;  1LUJ B;  2P5K A;  1QHG A;  2V9V A;  3FWE A;  1YX3 A;  2RNG A;  4QSH A;  5DCM A;  3WHB A;  4Q5S F;  1V54 H;  2PMU A;  3ZQI A;  2K4B A;  5A2Q K;  4IVN A;  2KIM A;  3OOP A;  1VQM I;  4EJU A;  2FML A;  1FYL A;  4N9H A;  2Q1Z B;  4CH7 A;  5IP9 J;  3W6J B;  3S3O A;  1P6R A;  3ZQQ A;  1NG6 A;  4U87 A;  4LGW A;  1POG A;  2ELH A;  4CYC A;  4HDU A;  4F92 B;  4DQ2 A;  1MDM A;  1KU9 A;  4FE4 A;  5FLX Z;  1Y39 A;  2PJP A;  3PL8 A;  4UVC A;  4E7Z A;  5L3G A;  3BZ6 A;  2DOD A;  4ZYG A;  3C7J A;  1JGS A;  3QQA A;  3OYF A;  3PO3 J;  3CCV I;  3HOZ J;  1J9I A;  3BC8 A;  2WAF A;  1WH7 A;  3E3V A;  2BGC A;  2QSH X;  4XL9 A;  1GVJ A;  4BE0 A;  3M7G A;  2BZT A;  3VSL A;  5EDN A;  2KLO A;  2VOP A;  1RES A;  5F6F A;  4I2O A;  3TOA A;  1O3Q A;  3GTJ J;  1FPQ A;  3MWM A;  1Z1D A;  2HOT A;  1B8I A;  3D5L A;  2DOF A;  2HQN A;  5A2Q Z;  4Q4Z F;  1OIS A;  1H9G A;  1X3U A;  3KZY A;  4XOR A;  1R5G A;  1VQ4 I;  3O6B B;  4R79 A;  2DFH A;  2F4O B;  1RET A;  4M3B A;  3CMY A;  2DOE A;  2PI0 A;  2XAS A;  1YLF A;  4BL0 B;  3WU1 B;  3IUO A;  1UZC A;  5HOO A;  2VON A;  1SMT A;  3GFJ A;  1XGO A;  2JA2 A;  5FD6 A;  3WG9 A;  2JK3 A;  3GCM A;  5AON A;  4IF4 A;  2XDV A;  4XBF A;  3TED A;  3FXU A;  2LD5 A;  4PJN A;  4A0Z A;  2EFO A;  1EA3 A;  1OCT C;  2Y69 H;  5LHG A;  4IPA A;  5K5Q A;  1TQI A;  2HI3 A;  2HS5 A;  1FWZ A;  4YG2 F;  3HHG A;  4HF0 A;  3H9J A;  1YRN B;  3F8C A;  3KIO A;  4HNT A;  3A1Y A;  5J8C A;  2Y0M A;  1X4P A;  2VE8 A;  2XAQ A;  3JRE A;  4YIF A;  3ZR8 X;  3BZC A;  5LRS A;  4ZDO A;  3GO5 A;  2ZME A;  2E1M B;  1KYZ A;  1ZAR A;  3COA C;  3A02 A;  2R7F A;  3DTE A;  3TO7 A;  1WJE A;  2K9M A;  3K4J A;  5TRD A;  2Y75 A;  4X6A J;  1H9T A;  3WOD F;  3WHC A;  2PEX A;  3ABL H;  2IA2 A;  3PQJ A;  1Q1H A;  4CO8 A;  1VQP I;  3FKJ A;  3HOV J;  2M30 A;  3H5N A;  4XKC A;  1IV8 A;  1UHM A;  3H1C A;  5E3M A;  2XVC A;  2JRM A;  1V3F A;  2HOE A;  3LFU A;  1P92 A;  2NS0 A;  1YIT I;  1ZG1 A;  1XGS A;  1TZL A;  1LVA A;  2F5F A;  3OYE A;  2DA6 A;  4A0X A;  2DLL A;  2HOS A;  2WY8 Q;  4CZC A;  2F48 A;  3AG2 H;  5HVQ C;  4LK0 F;  2OZU A;  1M1E B;  3PUF A;  3GLX A;  3TGN A;  2KIQ A;  3IP4 B;  4U88 A;  4RGR A;  3AG1 H;  3GZ5 A;  1HA8 A;  2IP2 A;  1W4M A;  5TGT A;  2OCC H;  2E7W A;  4XLC A;  4EQQ A;  3L2W A;  3DFG A;  3LQQ A;  4CYC B;  2R4G A;  4PSX A;  1W1W E;  3J7A Y;  3RYP A;  4QTR A;  1ZG5 A;  5F08 A;  1JKQ C;  1FJL A;  2PG4 A;  2M87 A;  1ZLJ A;  3ZMT A;  2V79 A;  2MYS A;  4WF2 A;  1Z3X A;  4E7I A;  3BG9 A;  1RKT A;  3JRF A;  2CV1 A;  1LEA A;  2DDB A;  3BDD A;  3HZJ A;  4LIV A;  2XUB A;  2TRT A;  5HLI A;  1KZH A;  2YPR A;  2ISZ A;  2K5C A;  4FTH A;  3RZD J; 
#chains in the Genus database with same CATH homology
 4P9U A;  2IW5 A;  5DUI A;  3WU0 A;  4G6Q A;  2A6H F;  1D5V A;  4G7Z F;  1WKM A;  3RTR A;  4AIH A;  2A69 F;  1XDS A;  5D4R A;  3HTS B;  1F4K A;  1J59 A;  4I02 A;  2ISY A;  2BEO A;  3FM3 A;  2O6G E;  3ECH A;  3O2P E;  5LHH A;  2GA2 A;  4BHB A;  2XKP A;  5J8F A;  1KGS A;  1IXC A;  1G4D A;  1JXS A;  4LLG F;  1BI3 A;  2ZME B;  4EV0 A;  3EYY A;  3E6D A;  5D4S A;  4I98 B;  1DDN A;  1BIB A;  4P5O A;  2JSC A;  2FQ3 A;  3K9T A;  2EFP A;  2JZY A;  3CUQ A;  3H92 A;  3BPV A;  1S7A A;  3S2W A;  3MCZ A;  3I71 A;  2QZ8 A;  3VEP A;  3QP5 A;  1XSX A;  2ZKZ A;  3LWF A;  3GFM A;  3WE2 A;  3GXO A;  1XMA A;  2JPC A;  5D5W B;  5E20 A;  5ERI A;  4HQM A;  2OAZ A;  1R7J A;  2CYY A;  3F6V A;  2XAH A;  4HYE A;  5L3E A;  1O57 A;  3SQN A;  1H0M A;  4RAZ A;  1HKQ A;  4HLX A;  2GZW A;  2R3S A;  3WGH A;  4LG0 A;  2DQR A;  4CDG A;  2ESH A;  2DK8 A;  2DW4 A;  3VOD A;  1Z9C A;  2P5L C;  5DYM A;  3TDU C;  5DD4 A;  4NB5 A;  1HW5 A;  3ZN0 A;  1QO0 D;  4OMY A;  1SFU A;  3K69 A;  2EA4 A;  4GYI A;  2D45 A;  2OU2 A;  4KIG A;  4HLY A;  5HDG A;  5FB2 A;  3W6K B;  4P9F A;  4KIC A;  2P7C B;  4KFC A;  1S3J A;  2DQL A;  3FZV A;  3RYR A;  1ZLK A;  1Z05 A;  2VT2 A;  2ETH A;  4LLN A;  4ESF A;  2Q0O A;  3IL2 A;  1BC7 C;  1KU3 A;  4S04 A;  2G7U A;  2RV8 A;  4HDV A;  1STZ A;  1B9M A;  3I58 A;  1BI1 A;  2F5E A;  5LEK A;  2XV4 S;  1GHC A;  2HKO A;  1P4X A;  1FP1 D;  1OKR A;  3RI4 A;  1R1T A;  2FXA A;  3KP5 A;  1LQ1 A;  1ONV A;  4AIK A;  1S6L A;  6PAX A;  3RPU A;  5ICC A;  2FE3 A;  2FNP A;  1BIA A;  3E97 A;  3FMQ A;  1BJA A;  3LA3 A;  4B8X A;  1Z6R A;  5D8K B;  4UNO A;  2A5Y B;  4M72 A;  5CVR A;  3BJ6 A;  3F6O A;  3L00 A;  1IAW A;  2VT3 A;  3ZMS A;  4L5I A;  5EEH A;  2VXZ A;  3M9A A;  2YU3 A;  1MD0 A;  1MJB A;  2KRF A;  4HV5 A;  3QP6 A;  3P7N A;  5CVI A;  2ZJ2 A;  5D5V B;  1PP8 F;  3ZMV A;  2XRN A;  5FO5 A;  1K7A A;  3ISP A;  1ZN2 A;  4XSZ F;  4O3M A;  3IKV A;  2VOD A;  4LLL A;  3ULQ B;  4R1H A;  1U8R A;  2PLY A;  4Y17 A;  2RNJ A;  5CVJ A;  4M6Y A;  2A6E F;  2D1H A;  4U0W A;  4HZF A;  2V1D A;  2EFQ A;  1FC3 A;  3GVA A;  4RAY A;  4ENM A;  5H20 A;  3WTW C;  1V4R A;  3HSF A;  2O03 A;  2O0Y A;  2W84 A;  4LK1 F;  2BBY A;  4ETS A;  4ON0 A;  5AIP A;  2CFX A;  3QPH A;  3KP7 A;  1TNT A;  4UV9 A;  2CG4 A;  4WCG A;  2M1B A;  1R5H A;  1Z7U A;  1RIO H;  1SFX A;  5TJJ A;  1T0F A;  1TLH B;  2EA2 A;  2EV0 A;  1FOK A;  4ENJ A;  5F1R A;  4CGZ A;  5HLG A;  4UHT A;  1LB2 A;  2JTV A;  1LDD A;  1PP7 U;  1FBS A;  1FY7 A;  1USS A;  4IRH A;  4EM1 A;  4A6D A;  2DBB A;  2QYO A;  2FBH A;  2MLK A;  4N9I A;  2YSR A;  2VC1 A;  2RC4 A;  4I7H A;  3GEZ A;  1Z6T A;  2EV6 A;  1G3W A;  3ABT A;  2UWM A;  1IN4 A;  4FT8 A;  4RB0 A;  1YIO A;  4OIR F;  5IT9 K;  1EH8 A;  3BJO A;  1F9N A;  1KA8 A;  2VBY A;  2Q8K A;  4RGS A;  3I53 A;  5KVR A;  1YG2 A;  3WTX C;  1IXS B;  1K79 A;  5ED4 A;  3QAH A;  5H6Q A;  1B4A A;  1G3S A;  1HW2 A;  3CUO A;  5ICG A;  2IVM A;  4S05 A;  4F7Z A;  1OYW A;  4M9Z A;  5E8I A;  2FA5 A;  2FOK A;  3FMR A;  2L02 A;  2PMH A;  3JSP A;  5JI6 A;  1R36 A;  4GO1 A;  3DQV C;  4ZYD A;  5DUK A;  2KKO A;  5IT9 Z;  1KQ8 A;  4Y15 A;  2ZCW A;  1PUE E;  4R8H A;  4Q47 A;  4RB1 A;  5E8G A;  1ZRC A;  1A04 A;  3VOE A;  4OU0 A;  3Q9S A;  1XCV A;  4AWX B;  1FBU A;  2X4H A;  2BYV E;  1BBY A;  1KU7 A;  1YTY A;  2DFI A;  3E5Q A;  2VBW A;  2VBX A;  3SZP A;  2NAZ A;  4WXC A;  5L3C A;  1WSU A;  3F72 A;  4B09 A;  4BHC A;  4DNC A;  2LKP A;  2A07 F;  2YX4 A;  4YFK F;  4BHP A;  4NQW A;  2K27 A;  1G3T A;  5JFR A;  4Y13 A;  3WE3 A;  3FMS A;  2MC3 A;  2LNB A;  3GW2 A;  4BH9 A;  4L0Y B;  4G7H F;  4PCQ A;  1SD6 A;  2DI3 A;  4BQA A;  3TO9 A;  2V1U A;  4YFX F;  1T6S A;  1K6O A;  3IRR A;  3I4P A;  2H94 A;  3V8K A;  1TQP A;  3JTG A;  1TW3 A;  1T38 A;  2WC2 A;  2P8T A;  2CGP A;  1E17 A;  3TOB A;  4HQE A;  2FBI A;  2MH9 A;  1SD5 A;  1P2F A;  3P9I A;  2A61 A;  3R0J A;  2RDP A;  4FX4 A;  1EH7 A;  3E6M A;  5K1Y A;  2AS5 F;  4RS8 A;  4IHT A;  2QEN A;  3T8T A;  2GXG A;  2NYX A;  1W7P D;  3LFK A;  3DV8 A;  2HGC A;  1FZP B;  4M71 A;  5LHI A;  2Z5U A;  4L9T A;  4GGG A;  5K5R A;  3J7A O;  3OV8 A;  2MH2 A;  4IXA A;  1O3T A;  3JSO A;  3SFZ A;  1AOY A;  1YW7 A;  3CJN A;  3F8N A;  1P4A A;  3M1E A;  2Z99 A;  1D3Y A;  3ECO A;  1SD4 A;  3R61 A;  1B6A A;  1BN5 A;  3F8F A;  2P7V B;  4HA8 A;  3M8F A;  3ELK A;  2EK5 A;  4I0A A;  4GCV A;  1YS6 A;  2GWR A;  2EFN A;  3P9K A;  2GA1 A;  4IJA A;  3N97 A;  5KK1 A;  2LSO A;  2STW A;  3H3Z A;  4I0B A;  4EJV A;  1JHH A;  1OR7 A;  1W7P A;  3KZZ A;  4OIQ F;  2EV5 A;  4Q48 A;  1VTN C;  4EVI A;  5LRR A;  3CO6 C;  2STT A;  2EFW A;  4EJT A;  3EUH A;  2P4W A;  3TDZ C;  2OZ6 A;  5ILV A;  1W5T A;  5BQT A;  1IN6 A;  1P4W A;  2QQA A;  5LGT A;  1IUY A;  3LAJ A;  2IA1 A;  3BY6 A;  1XN7 A;  1I1G A;  2EB7 A;  2W25 A;  3PFI A;  2C6Y A;  1XMK A;  3LA7 A;  3WGG A;  1O3S A;  1NHA A;  3GX4 X;  4WK8 F;  2CQK A;  1YQA A;  4CXF A;  3C3W A;  2GQQ A;  2E7X A;  2KJC A;  2ACJ A;  1WQ2 A;  2HR3 A;  2PFB A;  2XRO A;  4RB2 C;  2Z3Y A;  2PBI A;  5JHU A;  2W85 A;  3I0T A;  5JR3 A;  1HBX G;  4ENN A;  4TV7 A;  3KET A;  2L4A A;  2HWV A;  2XHK A;  4HX8 A;  3SZT A;  3VB2 A;  2KIU A;  3WTZ A;  4LD5 A;  2RGV A;  3KEO A;  3NEU A;  3IKT A;  2J5O A;  4ESJ A;  3J80 K;  3K2Z A;  3JAM K;  4ZZD A;  2TDX A;  2H6B A;  3GF2 A;  2ZO4 A;  2NNN A;  5FD5 A;  3GUD A;  2IPQ X;  2J5P A;  3HSR A;  3ZPL A;  2E1N A;  4IRG A;  4AIJ A;  1IW7 F;  1XGN A;  4KYW A;  1UFM A;  4HAM A;  2P6S A;  1W7P B;  4YII A;  3J80 Z;  3Q5F A;  2VBZ A;  2L01 A;  3JAM Z;  1FLI A;  3EQL F;  4CYD A;  1ZG3 A;  5FFX A;  5L3F A;  4M73 A;  1QZZ A;  3K1N A;  4BAY A;  2YR2 A;  1LJ9 A;  2F5C A;  3KE2 A;  4OMZ A;  4I01 A;  1QGP A;  1WRJ A;  2WWY A;  4EMS A;  2OQG A;  2HKX A;  4UVB A;  4LFU A;  3H3U A;  2FMY A;  2IRF G;  5LEJ A;  2HTS A;  5D6E A;  1O7L A;  1LNW A;  2F2E A;  5BS6 A;  3CO7 C;  5E17 F;  3DPT A;  4XLP F;  2DAO A;  1QBJ A;  3KP3 A;  2PN6 A;  1JHF A;  4P96 A;  1RZ4 A;  3SXY A;  2CSO A;  5E1X A;  2VN2 A;  2VE9 A;  3WGI A;  3ABU A;  1QNT A;  2D2W A;  4L9J A;  4MHG A;  1FNN A;  1BM9 A;  2LDU A;  2YX7 A;  3U9G A;  1KYW A;  2LF7 A;  4KMF A;  4UV8 A;  3I5U A;  4WWC A;  4XSX F;  3T8R A;  4EM0 B;  1I5Z A;  3AAF A;  1TBX A;  5BPI A;  1AWC A;  2CWE A;  1ZRE A;  2V6C A;  3QOP A;  2RQP A;  1WWX A;  2QBY A;  4L5J A;  1HW1 A;  2OA4 A;  3IWZ A;  3V7C A;  1FBQ A;  4RGX A;  3JW4 A;  2MD5 A;  3EET A;  1HQC A;  2M8E A;  1U6G A;  3RKX A;  1I1S A;  4U7B A;  4A5N A;  4KA4 A;  4A5M A;  1D8J A;  1B9N A;  4XRF A;  4A2U A;  3SHF A;  2M5W A;  2BV6 A;  4BYY A;  3QPT A;  3K0L A;  2HQR A;  2FRH A;  1U5T C;  5ILS A;  1IN7 A;  5DV5 A;  4KMU X;  1GXP A;  2UZK A;  1BOA A;  4UVA A;  4PDK A;  2DU9 A;  4WXH A;  2HEO A;  3BPX A;  1S7O A;  1R1U A;  1HXD A;  4XLN F;  5D5U B;  4EGZ A;  4MQ9 F;  1FSE A;  2LF8 A;  2FNA A;  2D1V A;  2KIF A;  5FFZ A;  5BPD A;  2A68 F;  2IT0 A;  4HBL A;  4Z2Y A;  1R58 A;  4A0Y A;  1S8N A;  2G7H A;  4OIP F;  5FLX K;  2QLZ A;  5CYV A;  4FHT A;  1L0O C;  2DO7 A;  1OPC A;  4QWQ A;  5CJ9 A;  5CLS A;  2B0L A;  1I6X A;  3RDI A;  5D6F A;  2QBY B;  3P9C A;  1J0R A;  1S29 A;  3PQK A;  5BMZ A;  1I27 A;  3RKY A;  3V4G A;  3R4K A;  4MQV A;  1UST A;  2AXL A;  2HTJ A;  4MEX F;  3HYI A;  4GXO A;  4HOB A;  3ERE D;  1YFH A;  1GXQ A;  1OMI A;  2CO5 A;  3WTS C;  5LLQ A;  5CVV A;  4G9Y A;  5AIQ A;  3WTV C;  1ON1 A;  5CVU A;  3QU3 A;  1REP C;  4KIF A;  2ZNY A;  4U0V A;  1UB9 A;  3DKW A;  1IF1 A;  4LJZ F;  2WV0 A;  1U2W A;  1YS7 A;  1XCB A;  2OBP A;  1ZYR F;  2FEZ A;  3KCC A;  5HDN A;  2NRA C;  1FYM A;  3FX3 A;  4BXU A;  2BE5 F;  2VC0 A;  2DTR A;  1SMY F;  5H6R A;  3GFI A;  3CUQ C;  4EM2 A;  3ZMZ A;  5ICF A;  4PGH A;  5L3B A;  4LB6 B;  3T1B A;  2Q2E A;  1G3Y A;  2Y48 A;  1BI2 A;  4L9N A;  1Z91 A;  3ZN1 A;  2P5V A;  3K1M A;  3G3Z A;  4KUM A;  5DEQ A;  4CIC A;  3G73 A;  4L9V A;  1RI7 A;  3V8J A;  1T2K A;  5D8L B;  2ZFW A;  3E5X A;  1U5T A;  2VOO A;  2HFH A;  3RPQ A;  3R0A A;  4JK1 X;  1ZHF A;  4BNC A;  4OIN F;  4YFN F;  1YW9 A;  3E5U A;  3WTT C;  5HS7 A;  3U2R A;  3ZMD A;  2QQ9 A;  4A12 A;  1DUX C;  3R60 A;  1MGT A;  4O6J A;  3L09 A;  2DPD A;  3EDP A;  5DCM B;  2IJL A;  3R6S A;  3IRQ A;  4L18 B;  2A3S A;  2MA3 A;  3LAP A;  3KLO A;  1IXR C;  2GIV A;  3T0Y A;  4ZZL A;  1MDM B;  2JRT A;  2G9W A;  1F5T A;  4AD9 A;  2CW0 F;  1EV7 A;  3LST A;  2Z33 A;  1UHW A;  3DF8 A;  2M45 A;  4U7D A;  4EGY A;  4QLC U;  3WTU C;  5LGU A;  2XAJ A;  4N0B A;  3GWZ A;  3ML6 A;  3HRT A;  4MGR A;  4U0Y A;  4WXD A;  1KQ9 A;  4KIB A;  1RUN A;  5ICE A;  2JPB A;  4M9X A;  3LA2 A;  4ZYH A;  3I54 A;  3U1D A;  4ZH4 F;  5D5X B;  3F8B A;  2ZNZ A;  4HW0 A;  2RVC A;  1MZB A;  3RKW A;  1YYV A;  2QWW A;  3HOT A;  2FU4 A;  3C18 A;  3GZ6 A;  1XB4 A;  1RUO A;  1ODD A;  4EJW A;  3K1P A;  3REO A;  4HF2 A;  1TW2 A;  1YW8 A;  2XIG A;  3EYI A;  3FM5 A;  3RJP A;  2H6C A;  2V1X A;  1FYK A;  1TQM A;  3HRS A;  1O3R A;  1J2X A;  1IRF A;  1U5T B;  1JE8 A;  3HUG A;  1KU2 A;  1U3E M;  1XSV A;  1ZGA A;  3NQO A;  2XAF A;  3GFL A;  3HHH A;  3CTA A;  4MEY F;  4HF1 A;  1MJA A;  2K02 A;  4KT5 C;  3TKY A;  3QU6 A;  3NRV A;  3BOQ A;  1XGM A;  5L3D A;  3GYH X;  2EJR A;  4ZYE A;  2GXB A;  3CDH A;  1EH6 A;  2L54 A;  3C1D A;  2JT1 A;  2O61 A;  1YO5 C;  5IT3 A;  1D8K A;  2O8X A;  4KDP A;  1OYY A;  4OOI A;  3F22 A;  4G94 A;  3BWG A;  1OYI A;  3DP7 A;  3MFK A;  4G6D A;  1E2X A;  2H09 A;  3KEQ A;  2MLG A;  1FT9 A;  1R1V A;  1DPU A;  4PGG A;  4KNY A;  2FBK A;  2W24 A;  3E6B A;  2X0L A;  1SFE A;  2WTE A;  5HS9 A;  1MKM A;  5HS8 A;  1XD7 A;  4JQF A;  1ZGJ A;  4MTD A;  5DDG A;  2QUF A;  4GYG A;  2IA0 A;  4L0Z B;  2R7D A;  1MJ9 A;  3MQ0 A;  2Z9O A;  4CHU A;  1FP2 A;  4E70 A;  4ESB A;  1XSD A;  3FF5 A;  2GAU A;  4H0E A;  1XDU A;  2NNY A;  3L7W A;  4HX4 A;  1ULY A;  1G6N A;  5K5O A;  2UXX A;  1HST A;  4ENK A;  1B1B A;  2HYG D;  3LQR A;  1ZRF A;  4M6X A;  4AVP A;  3KLN A;  3RIR A;  2EWN A;  1IRG A;  3VFZ A;  1DP7 P;  2QM3 A;  3DXJ F;  3D0S A;  2OD5 A;  3MEX A;  4NHJ A;  1PDN C;  2DT5 A;  5E1W A;  1IZ1 A;  4M9S A;  3FXQ A;  1LDJ A;  5DCF A;  1C0W A;  3MAJ A;  1U78 A;  3N4M A;  3FXR A;  5ILU A;  3QRF F;  3IC7 A;  4PZJ A;  2QQB A;  3IWF A;  2ZBK A;  3L2C A;  1FX7 A;  1BC8 C;  4O5V A;  2L4M A;  4ASN A;  4HV6 A;  2ESN A;  4FX0 A;  5HDK A;  3J81 K;  2FF4 A;  4CZZ A;  1CF7 A;  1Y0U A;  3CUQ B;  4I09 A;  4IRI A;  1HKS A;  2PQ8 A;  2RKH A;  2XKO A;  4RGU A;  3WTY C;  1ZAO A;  2FSW A;  2L3D A;  1QQI A;  1R00 A;  1KQ0 A;  3I59 A;  3KP6 A;  1F1Z A;  4OIO F;  4EJO A;  3DPL C;  4D0P A;  1W5S A;  3HRU A;  1TTY A;  1J75 A;  4G8X A;  4G7O F;  2W57 A;  5J6X A;  3HRM A;  1SD7 A;  2QVO A;  2XGX A;  4UXN A;  2XAG A;  3J81 Z;  1IN5 A;  3ZP5 A;  4KN7 X;  1HSJ A;  4UUV A;  3F23 A;  3MZH A;  2KJB A;  1TNS A;  4LG0 B;  2E1C A;  3F8M A;  3V7S A;  3L9F A;  4LB5 A;  3BRO A;  4KN4 X;  1ON2 A;  1UCR A;  2DK5 A;  1LEB A;  1K78 A;  3HIF A;  4RB3 C;  2P6T A;  1IN8 A;  3BJA A;  1QZY A;  3F3X A;  3KP4 A;  3Q9V A;  1T98 A;  3JTH A;  1B59 A;  1BI0 A;  2F5D A;  1CGP A;  3ROU A;  5LGN A;  1L3L A;  2RN7 A;  1DPR A;  3DEU A;  2K7L A;  1ZH5 A;  1LDK B;  1T39 A;  3O3K A;  5EEG A;  2UXN A;  3E6C C;  3ZMU A;  1RNL A;  5FGM A;  3TO6 A;  3M8E A;  2MBF A;  1R22 A;  3V8L A;  3TQN A;  5LBQ A;  4A6E A;  1QPM A;  3V7R A;  1WI9 A;  1CF7 B;  2DPU A;  1R23 A;  2HYF A;  3HSE A;  5E1Z B;  2ZXJ A;  1ZRD A;  5HLH A;  3HOS A;  1J7K A;  3HTU A;  2ADU A;  5BOX A;  4P55 A;  3I59 B;  2K86 A;  1J5Y A;  4HX7 A;  4JBA A;  4M74 A;  5JVT A;  3KFW X;  1O7F A;  4MTE A;  3B02 A;  2OQR A;  1FSH A;  2COM A;  3IHU A;  3T5X A;  2HDC A;  3ZQ7 A;  3CLO A;  3F21 A;  3I64 A;  4K2E A;  4WX9 A;  1HKT A;  1SAX A;  2O3F A;  2HZT A;  3FHZ A;  3BP8 A;  2H27 A;  5DD8 A;  5F64 A;  4LMY A;  5E18 F;  2K4J A;  3B73 A;  3MZY A;  4IHS A;  1K78 B;  3KP2 A;  4MNU A;  2P5K A;  3FWE A;  2V9V A;  5DCM A;  4Q5S F;  2PMU A;  2K4B A;  5A2Q K;  4IVN A;  2KIM A;  3OOP A;  1FYL A;  4EJU A;  2FML A;  4N9H A;  3W6J B;  1P6R A;  4LGW A;  2ELH A;  4HDU A;  4DQ2 A;  1MDM A;  1KU9 A;  5FLX Z;  2PJP A;  4UVC A;  5L3G A;  3BZ6 A;  4ZYG A;  3C7J A;  1JGS A;  1J9I A;  3E3V A;  2BGC A;  1GVJ A;  3M7G A;  2VOP A;  5F6F A;  4I2O A;  3TOA A;  1O3Q A;  1FPQ A;  3MWM A;  1Z1D A;  3D5L A;  2HQN A;  5A2Q Z;  4Q4Z F;  1H9G A;  1X3U A;  3KZY A;  1R5G A;  3O6B B;  4R79 A;  2PI0 A;  2XAS A;  1YLF A;  3WU1 B;  5HOO A;  2VON A;  1SMT A;  3GFJ A;  1XGO A;  5FD6 A;  3WG9 A;  5AON A;  4IF4 A;  4XBF A;  3FXU A;  4A0Z A;  2EFO A;  5LHG A;  4IPA A;  5K5Q A;  1TQI A;  2HS5 A;  1FWZ A;  4YG2 F;  3HHG A;  4HF0 A;  3F8C A;  5J8C A;  2Y0M A;  2VE8 A;  2XAQ A;  4YIF A;  5LRS A;  3GO5 A;  2ZME A;  1KYZ A;  1ZAR A;  3COA C;  2R7F A;  3TO7 A;  5TRD A;  2Y75 A;  1H9T A;  3WOD F;  2PEX A;  4CO8 A;  2IA2 A;  1Q1H A;  3PQJ A;  2M30 A;  1UHM A;  2XVC A;  1V3F A;  2HOE A;  1P92 A;  2NS0 A;  1ZG1 A;  1XGS A;  2F5F A;  1LVA A;  4A0X A;  2DLL A;  5HVQ C;  4LK0 F;  2OZU A;  3GLX A;  3TGN A;  4U88 A;  4RGR A;  3GZ5 A;  2IP2 A;  1W4M A;  2E7W A;  4EQQ A;  3DFG A;  3LQQ A;  3RYP A;  1ZG5 A;  2PG4 A;  2M87 A;  1ZLJ A;  3ZMT A;  2V79 A;  4WF2 A;  1LEA A;  3BDD A;  2XUB A;  5HLI A;  2YPR A;  2ISZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...