2HWVA

Crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
SHMTIGDLTIHPDAYMVSKRGEKIELTHREFELLYYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPTYLVTRRGVGYYLRNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the response regulator VicR DNA-binding domain.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords DNA-binding response regulator VicR
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hwvA00
4OIOF 1ODDA 2K02A 3E97A 1LEAA 2OZUA 2O03A 1RUNA 1RI7A 2MH9A 1Z91A 1RUOA 2IPQX 3GEZA 5AONA 3GFIA 1U5TC 2LF7A 2PI0A 3Q9VA 3JAMK 1FPQA 3N97A 2VOPA 1ZLKA 2WV0A 3HOTA 5J8CA 4WXCA 1QZZA 3GFMA 4G7HF 2WC2A 4I98B 2KIUA 4RGSA 5JR3A 1KQ0A 1GXPA 3QP6A 5A2QK 3JTGA 2L54A 1BC7C 1WSUA 1TLHB 1QNTA 3LAPA 5BS6A 4O3MA 4I02A 2VT2A 4XRFA 4Y13A 3GW2A 4U7DA 1GHCA 1ZHFA 2V1DA 2MA3A 3LAJA 3GX4X 1F9NA 4RAZA 1F5TA 4HQEA 1KGSA 5FLXZ 3WG9A 2EFNA 2XASA 2EK5A 3EDPA 1HKQA 3SFZA 5KVRA 4G8XA 4RB3C 4EJUA 3ZN1A 4H0EA 5CVRA 2RDPA 1W5SA 3IKVA 1OYIA 2ZMEB 2VE8A 1G3SA 3HTSB 3E5XA 2L4MA 3RPUA 1KYWA 4HBLA 4UVCA 2MC3A 1R23A 3QU3A 3KEQA 2ZNYA 3LQRA 1XGOA 2MD5A 3M9AA 3CUQA 2UXXA 4P5OA 4WWCA 3JTHA 2G9WA 3KETA 1SFEA 4ASNA 3LQQA 1DUXC 3DFGA 1U78A 5FLXK 1JHFA 3EETA 1MGTA 4G7ZF 2GQQA 2XAQA 3FMRA 1R1TA 2FXAA 4EJTA 5LLQA 3GFLA 1BOAA 1IAWA 2COMA 1MDMA 5DDGA 4D0PA 5DCFA 3K69A 3EYYA 2HS5A 3IWFA 2L4AA 1CGPA 2PLYA 4EMSA 1MJ9A 3LSTA 4ENJA 3M8FA 2EFPA 2ZFWA 2VC0A 1OYYA 1O57A 3W6KB 1IN8A 2A6EF 1YW9A 5DD8A 3CTAA 2IA1A 4AVPA 4N9HA 4AD9A 1USSA 2IA2A 3QP5A 2QLZA 3FM3A 5DV5A 4RB2C 1QPMA 4L5IA 5DYMA 2KJCA 3ZMUA 2P5VA 3BJOA 4EJVA 1OKRA 3DF8A 1CF7A 1I27A 4DQ2A 2EV6A 4ESFA 1BI2A 2HZTA 4KN7X 5BQTA 2IVMA 1REPC 4UUVA 3HSFA 3FMQA 5LRRA 1XSDA 5ICEA 2FMYA 5K5QA 1BC8C 3AAFA 3CLOA 2F5CA 2FBIA 3C3WA 4Y17A 1IXRC 3J81K 3GZ6A 4RGRA 2QWWA 1H0MA 1HKTA 5L3EA 5TRDA 4P96A 2VOOA 3FM5A 1ONVA 3R0AA 2CFXA 2XAGA 2V9VA 3HUGA 3NRVA 2B0LA 2J5PA 2XROA 5E18F 5J8FA 1U3EM 4CDGA 1P2FA 4A2UA 3B73A 3I59B 4WXHA 3ZMVA 3C18A 1IXSB 1T2KA 3K1NA 1J0RA 4YFKF 4OINF 3SXYA 2QENA 3BPVA 2XRNA 3RIRA 2LSOA 4I0AA 1IW7F 1E17A 1ZGAA 5ILSA 3ZN0A 2D1VA 4HF1A 2E7XA 3V7RA 2LF8A 2BEOA 1R22A 2J5OA 5LHHA 1VTNC 4IHTA 1BM9A 2DQRA 1FOKA 4HZFA 4HX4A 2VC1A 4M6YA 2YU3A 5FB2A 2CYYA 2EFWA 3KP4A 4MTDA 5LEJA 2NNYA 1XDSA 4BYYA 5IT9Z 1Z6TA 3KLNA 2DQLA 5LBQA 3KE2A 3RI4A 4WXDA 1USTA 3E5QA 3SZTA 3GWZA 3F8FA 4DNCA 5BOXA 4ZYDA 2HOEA 4ENNA 3ELKA 1WWXA 3HRSA 2O6GE 2XAFA 5CJ9A 2VN2A 4ENKA 1BI0A 5CVIA 1R00A 1L0OC 2CG4A 4OIQF 3MZHA 1FSHA 2P5KA 1UHWA 2JSCA 1D5VA 4HQMA 1HBXG 2STTA 2IP2A 1TTYA 4A0XA 1W7PD 5LHIA 4KN4X 2ESNA 3I0TA 3I71A 3HHHA 4QLCU 2ACJA 4BHPA 2ETHA 1XSVA 5L3FA 3Q9SA 1L3LA 2OBPA 3W6JB 1XDUA 2YR2A 1IXCA 1OMIA 1R5HA 5HDKA 2TDXA 5AIPA 3CUQC 1KU9A 1GXQA 1AOYA 2H6CA 3I53A 2PJPA 3V8LA 1CF7B 1SD7A 3R6SA 2DK5A 3P9KA 4OIRF 1SD4A 3MZYA 4AIKA 4L18B 1ZRCA 1MJBA 4KDPA 2DT5A 4FX0A 5A2QZ 4MEXF 4LK1F 4HV5A 1T39A 1G3WA 5F64A 1KYZA 2HQRA 5D5UB 1B9MA 1ZLJA 2PMHA 3FWEA 1O7LA 4XSZF 1FSEA 1JXSA 1SMTA 3M8EA 1P4WA 1XSXA 2EFQA 2PEXA 5HVQC 3GFJA 3Q5FA 1J75A 3ERED 3NEUA 4PGHA 5CYVA 2P5LC 3O3KA 2Y0MA 4UHTA 4FHTA 4G7OF 4E70A 2W84A 3D5LA 2JZYA 3DXJF 5K5OA 3KZZA 2Q2EA 5FD5A 1QBJA 3MAJA 2KJBA 3BPXA 1BIBA 3WTWC 3BDDA 3WGGA 5CVVA 3ZMDA 3IC7A 4OU0A 2HKOA 1UFMA 1U5TA 1YLFA 1J7KA 4IXAA 3I64A 5K1YA 2R7DA 1PP7U 3FF5A 3K0LA 2E1NA 4U7BA 3ZP5A 2H94A 4Z2YA 5FGMA 3DEUA 3ZQ7A 1LJ9A 1PUEE 3DPTA 3HSRA 4GYIA 5FD6A 2XAHA 4G6DA 1RNLA 2R3SA 3T1BA 1B1BA 3L7WA 4ON0A 1TBXA 1LQ1A 4KA4A 2ZMEA 3IWZA 1A04A 2JT1A 1STZA 4KICA 2GA1A 2IJLA 5D5WB 3KLOA 1Z1DA 2EFOA 3IHUA 4HDVA 4S05A 3K2ZA 3M7GA 1BI1A 2RV8A 4HF0A 4XLNF 5HDNA 1P4AA 3CO7C 3O2PE 1BI3A 2FEZA 5E8IA 1F4KA 2HKXA 4EGYA 1K78B 2O0YA 3KFWX 4A12A 1U8RA 1D8JA 1HXDA 3KCCA 3HOSA 4M72A 5F6FA 2KKOA 4IRIA 2OD5A 1H9TA 1TW3A 2Z99A 1AWCA 4UXNA 2E1CA 4F7ZA 3ABTA 2Z5UA 1FZPB 1XGSA 4M9SA 4N0BA 2HWVA 2VBXA 3S2WA 1ZAOA 4HX8A 1Q1HA 4M71A 1EH8A 2V1XA 2RNJA 4I01A 4HYEA 3KP2A 4BH9A 5L3CA 1TNTA 3E6DA 2KIMA 4KMUX 4KUMA 4LLGF 5D8LB 1O3RA 4YFNF 4EM0B 4A5MA 3F8BA 3ECOA 4LLLA 3FHZA 5H20A 1H9GA 1K7AA 2YX7A 4JQFA 3LA3A 3LA2A 3F3XA 3TDZC 3L2CA 2NNNA 5D4SA 1XMAA 4NHJA 3TGNA 1WRJA 3VFZA 3HYIA 1U5TB 2BBYA 2NS0A 2VT3A 4U88A 1U6GA 4IVNA 2MH2A 4EJWA 2CO5A 3VOEA 4ZYGA 3HRUA 4RGXA 5E8GA 2RGVA 1MD0A 4IJAA 1W4MA 1R36A 3VODA 3MWMA 2FQ3A 3SHFA 3BWGA 2PN6A 2DW4A 2HFHA 2IW5A 1T98A 2O8XA 2OU2A 2W57A 2RC4A 5LGUA 3WGHA 2HTJA 4LK0F 3REOA 3ZMTA 4HW0A 3IL2A 2DAOA 3B02A 4GYGA 3U9GA 4I09A 4IRHA 3RJPA 1U2WA 2F2EA 2BE5F 4RS8A 1B9NA 2ESHA 3I54A 1YS6A 1KU7A 1JGSA 1R58A 1FBUA 1V4RA 3H3UA 2EB7A 2VBYA 3GZ5A 3V4GA 5TJJA 3MFKA 1W5TA 1W7PA 3FMSA 2CW0F 1Y0UA 1LB2A 3WE3A 2ZXJA 3I59A 1R1VA 1FC3A 2L02A 4R1HA 4IHSA 2HQNA 2YPRA 2YX4A 5E1XA 3GO5A 1DP7P 3ULQB 1E2XA 3WU1B 2FU4A 2W85A 3GXOA 1I5ZA 3D0SA 4EGZA 2O3FA 4PCQA 5D5XB 2LKPA 3RKYA 3MQ0A 4BHCA 3IRRA 2IA0A 4P9FA 1I1GA 4R79A 4ZYHA 3BOQA 2X0LA 5HS9A 2H27A 2ADUA 2Z9OA 1BJAA 2V1UA 4M73A 2MLKA 5D8KB 4BXUA 2VODA 1FNNA 4WF2A 4Q47A 2DTRA 5DEQA 3RKXA 1RIOH 1IF1A 5HOOA 3RKWA 4Q5SF 4M6XA 3ROUA 1I1SA 1F1ZA 1QGPA 2YSRA 1Z7UA 4L0ZB 5JHUA 2AS5F 1QO0D 4EM1A 3RTRA 5E1ZB 2QZ8A 3WE2A 4KIBA 4OOIA 2A69F 3PFIA 1K6OA 5ICCA 1ZARA 3V7CA 1S3JA 2XHKA 1SAXA 4KNYA 3DQVC 3FXRA 2V6CA 3BP8A 5ICGA 4LD5A 3GF2A 5DUIA 4A5NA 4ZZDA 4KFCA 2FSWA 1XN7A 4XSXF 2P7CB 3FX3A 1DPRA 1YW8A 4UV9A 1XGNA 2Y75A 2W24A 3G3ZA 5DCMB 2IRFG 1S6LA 3E6CC 5EEHA 1YQAA 1P6RA 1JHHA 4IRGA 2Q8KA 4EV0A 1ZGJA 5E17F 1HW1A 5ICFA 1K79A 5H6QA 1SD6A 3CUQB 2QQAA 3P9IA 3DPLC 4M9ZA 4JK1X 3TOAA 2DBBA 4M9XA 3J81Z 5D6EA 3I4PA 3P7NA 3ISPA 4PDKA 2M45A 3T8RA 1QQIA 2JRTA 2LDUA 2HGCA 3COAC 2FRHA 3TDUC 2PMUA 5JVTA 4A0ZA 1ZG1A 1SD5A 3JAMZ 4GGGA 1MKMA 3DV8A 4KYWA 2QYOA 3V8KA 3WTVC 1P4XA 3PQKA 1PDNC 3TOBA 2ZJ2A 3R60A 3K1PA 2CGPA 2O61A 2ISYA 4Q48A 3BJ6A 1R5GA 2V79A 4YIIA 4ESBA 3KZYA 1C0WA 2ZO4A 2DI3A 2CWEA 1LDDA 4LLNA 2DFIA 1KA8A 3WTUC 1TQPA 2D1HA 3MEXA 3V7SA 3RPQA 5JI6A 2P8TA 1WI9A 2ZBKA 4BQAA 3ZMZA 2UZKA 1KQ9A 5FFXA 3C1DA 4ETSA 4UNOA 3I5UA 1O7FA 1B6AA 2D2WA 4B8XA 2M1BA 3ZMSA 2JPBA 4L9JA 4I0BA 2ZNZA 1HSTA 5HLGA 1R7JA 4LJZF 1ZG5A 2X4HA 1YFHA 1BN5A 4YIFA 2EA2A 3RDIA 4L0YB 4XBFA 4AIJA 1S7OA 4NB5A 4BNCA 3QPHA 2GWRA 3F22A 1OPCA 4ENMA 2PBIA 1MJAA 2NAZA 3J80K 3BY6A 1YS7A 2A07F 1BBYA 3F8NA 3TKYA 5L3DA 3HRMA 1OYWA 4EM2A 3P9CA 3NQOA 1X3UA 3R61A 4EQQA 4S04A 3E6MA 2A3SA 3HTUA 4K2EA 4IF4A 2FBKA 3WTTC 2DU9A 4CO8A 2PQ8A 4LFUA 2OQGA 1MZBA 4LB5A 3J7AO 2IT0A 4CHUA 3CDHA 5DCMA 3F8MA 3WTXC 1SMYF 4HA8A 1YIOA 4JBAA 1YW7A 2ZKZA 5HS8A 4OIPF 3DP7A 2P4WA 3KEOA 4HF2A 2JTVA 2MLGA 3WTYC 4R8HA 4P9UA 2XIGA 3CJNA 3GLXA 1IN5A 4PGGA 2A6HF 3F6VA 1IRGA 3LA7A 1FLIA 3DKWA 1G3YA 4N9IA 4LG0B 4AIHA 4BHBA 2DO7A 1DPUA 1TW2A 3K9TA 1HW5A 5FFZA 1Z05A 5BMZA 3EUHA 5BPDA 4MQVA 2HYGD 5LRSA 2P6TA 3OV8A 4CICA 1NHAA 2PG4A 4UVAA 1Z9CA 2GIVA 3PQJA 5F1RA 4L9VA 4IPAA 1XCBA 5FO5A 5ILVA 4HX7A 4GO1A 3JSPA 1IUYA 2RKHA 3JSOA 4KMFA 1BIAA 1XGMA 4RB1A 4UVBA 3ABUA 1FX7A 4BAYA 3HHGA 3MCZA 2AXLA 1FYMA 2DLLA 2M30A 1XCVA 4OMYA 4G9YA 2BYVE 4MQ9F 4ZYEA 1HKSA 2XKOA 3KP3A 2RVCA 1YG2A 3L00A 3F21A 3FZVA 2FA5A 2XKPA 2XV4S 1T0FA 1LVAA 1P92A 5HLIA 1SFXA 2P6SA 2FE3A 3KP6A 1B59A 3U2RA 3E3VA 2Z33A 4UV8A 1IN6A 1O3QA 1G4DA 3E5UA 5H6RA 4Q4ZF 4RB0A 3BJAA 4GCVA 2NYXA 1HSJA 2A5YB 2FBHA 2HR3A 1T38A 2K27A 2VONA 2WWYA 3TQNA 4RGUA 3K1MA 4B09A 3G73A 4WX9A 3QRFF 3ECHA 3TO6A 1YYVA 2RN7A 3HSEA 2H6BA 3T5XA 1ULYA 2G7HA 3F72A 2RQPA 1EV7A 2DK8A 1O3SA 2QBYB 2XGXA 5EEGA 2F5EA 2DPDA 4A0YA 4LG0A 2G7UA 2HEOA 5E20A 1R1UA 1Z6RA 5ILUA 3OOPA 1IZ1A 1UB9A 4TV7A 4O5VA 2M8EA 1G3TA 4MHGA 2EJRA 4NQWA 4O6JA 1S8NA 3CO6C 2Y48A 1KU3A 2M5WA 3ML6A 2OAZA 4EJOA 3GUDA 3KP7A 1XB4A 3M1EA 5L3GA 5DUKA 4HV6A 3TO9A 1IN4A 2XVCA 1D8KA 2QVOA 2Z3YA 2L3DA 2FNPA 4G94A 3QPTA 3QU6A 5KK1A 2VBWA 3IKTA 1XMKA 2K4JA 1LEBA 1ZN2A 4LB6B 1B4AA 4LGWA 4WK8F 3H92A 4M74A 3WGIA 2NRAC 4I2OA 1ON2A 5HDGA 2R7FA 4MGRA 4KIFA 3I58A 1YTYA 5HLHA 3ZPLA 3FXUA 2FNAA 5IT3A 1WQ2A 3EQLF 2MBFA 5IT9K 1O3TA 1EH6A 3QOPA 4EVIA 2WTEA 2Q0OA 3JW4A 3F23A 4CGZA 1YO5C 3CUOA 1FP1D 2BGCA 1V3FA 1WKMA 3WU0A 2LNBA 3HIFA 4L5JA 3RYPA 2STWA 2OZ6A 3U1DA 2K7LA 1DDNA 1J9IA 3RYRA 1FP2A 4FX4A 4FT8A 3E6BA 2A61A 3BZ6A 2QBYA 3J80Z 2JPCA 3SQNA 4CZZA 1KQ8A 5AIQA 3R0JA 4U0VA 4Y15A 2QQ9A 1IRFA 2GXBA 3EYIA 2UWMA 2KRFA 1FBQA 1ZREA 3WODF 1G6NA 2CQKA 2GXGA 5DD4A 1IN7A 4QWQA 5LEKA 4HOBA 4L9TA 5D5VB 5CLSA 3F8CA 2M87A 5LGNA 1S29A 3L9FA 5J6XA 2FMLA 1TNSA 3C7JA 2P7VB 4A6DA 1FYLA 1I6XA 4KT5C 4RAYA 3KP5A 4XLPF 2ELHA 4ZZLA 2VXZA 3WTSC 4HAMA 3TO7A 5ED4A 3R4KA 2L01A 1QZYA 2K86A 5D4RA 2DPUA 1PP8F 5BPIA 1K78A 2HDCA 2H09A 1LDJA 5D6FA 2K4BA 1ZH5A 1W7PB 2A68F 2E7WA 2UXNA 4GXOA 3FXQA 2PFBA 5JFRA 1XD7A 1LNWA 4U0WA 5L3BA 4AWXB 2EV0A 3T0YA 4YG2F 1LDKB 2XUBA 1UHMA 1D3YA 3VEPA 6PAXA 4HDUA 4LMYA 3QAHA 4YFXF 4WCGA 2EA4A 4ZH4F 3N4MA 2D45A 1J5YA 1ZG3A 4CYDA 1TQMA 1GVJA 1J2XA 4I7HA 3LFKA 1RZ4A 4L9NA 3GYHX 4A6EA 5CVJA 2EV5A 5HS7A 2W25A 1HQCA 4CXFA 4PZJA 1HW2A 5E1WA 3O6BB 3V8JA 1EH7A 3F6OA 1J59A 1ON1A 4HLXA 2C6YA 1TQIA 4MNUA 1FYKA 2HTSA 2QM3A 1T6SA 2VE9A 1JE8A 2FOKA 2VBZA 1FY7A 2GZWA 4HLYA 4G6QA 3IRQA 1OR7A 5CVUA 2XAJA 3T8TA 3VB2A 1KU2A 2FF4A 3LWFA 5ERIA 2ZCWA 3H3ZA 5LGTA 2CSOA 2QUFA 4OMZA 3HRTA 1S7AA 2F5FA 2ISZA 4MEYF 2KIFA 3GVAA 1ZRFA 2EWNA 2GA2A 2F5DA 2GAUA 3L09A 2OQRA 4KIGA 2QQBA 4MTEA 1ZYRF 4P55A 1MDMB 1FWZA 1UCRA 3SZPA 1SFUA 3BROA 5LHGA 1ZRDA 1FBSA 2OA4A 4ESJA 2BV6A 3WTZA 1FT9A 5K5RA 4U0YA 2HYFA
chains in the Genus database with same CATH superfamily
2E2HJ 3FBIB 4OIOF 2WV1A 1ODDA 2K02A 2E34A 3SDBA 1U0JA 1HLVA 3E97A 1DU0A 2OJED 1LEAA 3CCLI 1YRNB 1OCZH 2OZUA 4CZCA 2CH0A 3E1SA 2O03A 3PNVA 1RUNA 1RI7A 2NOJB 2MH9A 4LIVA 2VLAA 2CUJA 1Z91A 2VASA 5GTHC 1RUOA 2IPQX 5FKLA 3M3YJ 4EEFG 1T56A 3GEZA 2DMTA 5AONA 3GFIA 1U5TC 2LF7A 2PI0A 2KT0A 2LKSA 3X2QH 3Q9VA 3JAMK 1YX3A 3CJRB 1RPWA 1NH3A 3QOEA 1FPQA 1YITI 3N97A 3OYIA 1MBEA 2B63J 3S16J 2VOPA 1ZLKA 4XMYA 1DGRM 2IS1A 2WV0A 3HOTA 2M7AA 5J8CA 1YI2I 4WXCA 2AO9A 1QZZA 2M9HA 2EH3A 3GFMA 5EG0A 3OIOA 1OFCX 4G7HF 5KCMA 3JRIA 2WC2A 4I98B 2KIUA 3DTKA 4RGSA 5J40A 5JR3A 3HOXJ 1KQ0A 1GXPA 3QP6A 3BR1A 3CD6I 1W1WE 1PJRA 5A2QK 3JTGA 2EZHA 2L54A 1JTXA 1BC7C 1WSUA 4E7ZA 2R7TA 1TLHB 2BVLA 1BL0A 4BL0B 1QNTA 3LAPA 5BS6A 4O3MA 1WZ2A 4I02A 2VT2A 2PJRB 4XRFA 4Y13A 3OYNA 3GW2A 4U7DA 2E2JJ 3I4MJ 4IHWA 1R4NB 3CMEI 1T0FC 4RMNA 1GHCA 3L2UA 1ZHFA 2V1DA 2MA3A 3LAJA 1MMGA 4A3DJ 2DA4A 3GX4X 1F9NA 1TWFJ 4RAZA 2DMUA 4ZDLA 1F5TA 3OYCA 4HQEA 2HXIA 1KGSA 2M7BA 4V2FA 5KAIC 3WG9A 5FLXZ 5H2FC 3K6GA 2EFNA 1OJLA 2XASA 4LG3A 2EK5A 3EDPA 5EF6A 3RZOJ 1HKQA 2JQ7A 1U9OA 2XDVA 1MSFC 3SFZA 5KVRA 4G8XA 1XTAA 4RB3C 4EJUA 3QQAA 3CCRI 4XR6A 3ZN1A 4HEA2 1VI0A 1WJ5A 4H0EA 1T8IA 3HZJA 1TWCJ 5CVRA 2A05A 2EIJH 3ZQGA 2RDPA 1ZR2A 1JUMA 1W5SA 3IKVA 1OYIA 2ZMEB 2VE8A 2VQGA 2K40A 1GLNA 1G3SA 2PMZN 3OMYA 3HTSB 3E5XA 2L4MA 2W7NA 3RPUA 3ASNH 1JT0A 3PM1A 2VIXA 2KHMA 1KYWA 1MNEA 4HBLA 4UVCA 2MC3A 4HPQA 1R23A 5M5WJ 3QU3A 3KEQA 4BEHA 2ZNYA 2FD5A 5KHDA 3EUKL 1K83J 4UY8I 3OL4A 3LQRA 1XGOA 1EJ9A 2HOTA 2MD5A 3M9AA 3CUQA 2UXXA 4P5OA 2OV7A 4WWCA 3JTHA 4DYRA 2MC4A 3BCAA 2G9WA 3DLLF 1Y39A 2CV2A 4HSTA 1T08B 3KETA 1SFEA 3OYLA 3SFIA 4A3MJ 4ASNA 3LQQA 4AUXA 4P1WA 1DUXC 5E79C 1T95A 1FIPA 3SEZA 4AYBN 3DFGA 3B6CA 1U78A 3S15J 3OY9A 5FLXK 2N8GA 1JHFA 1X4OA 5EGOA 3EETA 1MGTA 4G7ZF 3S2HJ 3L2VA 2GQQA 5JVGF 4FCYA 2XAQA 3IV5A 2HZDA 5GPAA 3FMRA 1R1TA 2FXAA 5K7ZA 2JA8J 4BJ5C 1NG7A 3FXKA 4EJTA 2FQ4A 5LLQA 3GFLA 3W2AA 4AM3A 1TL8A 1BOAA 1IRXA 1IAWA 2F4OB 1ETOA 2COMA 3CJTB 1MDMA 5DDGA 4Y7NJ 4D0PA 3UKGA 5DCFA 3Q0UA 4NQWB 3JRCA 5IYDJ 1VQPI 3BG9A 2K85A 3K69A 3M07A 3EYYA 4J00A 2HS5A 3IWFA 2L4AA 1CGPA 4A3BJ 2PLYA 2DJNA 4EMSA 1MJ9A 3LSTA 1OLTA 4ENJA 2BY1A 1X4PA 3M8FA 1BW5A 2EFPA 1MBKA 2XSDC 5F08A 2ZFWA 2VC0A 2DJIA 3BTIA 3LOCA 1OYYA 1O57A 1NK3P 3W6KB 1YIJI 2ZC2A 1IN8A 2A6EF 1YW9A 5DD8A 3CTAA 2IA1A 1WJCA 2CFOA 4AVPA 1VQNI 3BCBA 4N9HA 4AD9A 2TRTA 5LFAA 1USSA 2IA2A 1VNDA 3QP5A 3W2VA 3OS0A 2QLZA 3FM3A 5DV5A 2R5YB 4B47A 2V6EA 1VQOI 4RB2C 1QPMA 1NG6A 4L5IA 2XGCA 5DYMA 1A36A 3FISA 2KJCA 3ZMUA 3M4OJ 3OS2A 1K6YA 2P5VA 3OYAA 2DOEA 3BJOA 4EJVA 1DQUA 3V42A 2NXNB 3TW6A 1OKRA 3DF8A 1YJ9I 3G1OA 1CF7A 1I27A 4DQ2A 2EV6A 4ESFA 1BI2A 4KISA 3VPRA 2HZTA 3HBLA 2JN6A 4KN7X 3IAM2 2EZLA 3IP4B 4UUSB 5EZGA 5BQTA 2IVMA 1Z7LA 4PJNA 1HCRA 1REPC 4UUVA 2IS6A 3QPLA 3HSFA 3BG3A 3FMQA 1FJLA 2B7EA 5LRRA 1JKPC 1XSDA 3DEWA 1YE9A 4XKCA 5ICEA 2ZSHB 4DW6A 1QHHD 1WPKA 3VYTB 2FMYA 5K5QA 1BC8C 2ECBA 4E7SA 1AHDP 3AAFA 5F0FA 3CLOA 3GTJJ 2F5CA 2FBIA 3C3WA 4Y17A 2B9SA 1IXRC 3K7AJ 3J81K 1H8AC 5EDNA 1FOYA 2L9SA 5GAHJ 4CA0A 3GZ6A 1VZ0A 4LIUA 2CUEA 4RGRA 2WB1A 2QWWA 4M3GA 1H0MA 4RBOA 1HKTA 2JUCA 5FJ8J 5L3EA 3W3CA 1SVLA 3DLAA 5TRDA 4P96A 2VOOA 1W5CC 1IDYA 3FM5A 1ONVA 3R0AA 4XN0A 2CFXA 1FIAA 2XAGA 2V9VA 3HUGA 3NRVA 2ME6A 1W36D 1VQ8I 2B0LA 4HNUA 2J5PA 1S72I 3H5NA 2XROA 3W2WA 5E18F 3PSFA 3BR3A 5J8FA 4CDGA 1P2FA 3CCQI 2VQCA 4A2UA 1U3EM 4NC8A 3B73A 3H5AA 3I59B 4WXHA 1ETKA 1X1CA 3ZMVA 3C18A 4BACA 1SC7A 1IXSB 1T2KA 3K1NA 1J0RA 4YFKF 4IHYA 3H9JA 4OINF 2ZJRF 3SXYA 4Z6YA 2QENA 3PNYA 3BPVA 3J7AY 2XRNA 3RIRA 4E7HA 2LSOA 1F43A 1PUFA 4I0AA 1IW7F 1N75A 2FJ1A 1E17A 4JX4A 1ZGAA 5ILSA 3ZN0A 2D1VA 4L5EA 4J19A 4HF1A 5C44J 2NVUB 2E7XA 2M2EA 1QVUA 4NUBA 2DCEA 3L2QA 3V7RA 3DEEA 2LF8A 3QWLA 2BEOA 3JRGA 1R22A 2QCOA 1Z67A 2J5OA 1JGGA 5LHHA 1VTNC 1BM9A 4IHTA 2DQRA 3ZGKA 1FOKA 4HZFA 4HX4A 2OF7A 1X2MA 2GBYA 1AA7A 1P9QC 3PL8A 4BBRJ 1AKHA 3KYLA 4U87A 1ETVA 2VC1A 2EZIA 2R7QA 3I56I 4M6YA 2YU3A 5FB2A 2CYYA 1BA5A 2EFWA 2EQRA 3KP4A 3CLQA 5LEJA 4MTDA 2NNYA 3OSGA 3OIPA 1U9NA 3A0HC 1XDSA 4BYYA 5IT9Z 2DDAA 3CC7I 2M0CA 1Z6TA 4FE7A 3KLNA 2DQLA 5LBQA 3KE2A 3RI4A 4WXDA 1USTA 3C2GA 4GRIA 1XPXA 3E5QA 3SZTA 4RLQA 3GWZA 2DOFA 1P7JA 3F8FA 1ACIA 4DNCA 3JRBA 5BOXA 3TL4X 3MKWB 4ZYDA 2HOEA 4ENNA 3ELKA 1WWXA 3HRSA 2JWTA 1SVOA 4XKWA 2O6GE 2I8DA 2XAFA 4B48A 5CJ9A 2VN2A 4ENKA 1BI0A 1VQKI 5CVIA 4G12A 2BHYA 1R00A 1L0OC 2CG4A 2H1LA 4ABZA 4CCJA 4OIQF 3MZHA 2BY2A 1FSHA 3M1CA 3IUOA 3TBIA 2P5KA 2ECCA 4CUGA 1UHWA 2JSCA 3BG5A 4HG2A 4HQMA 1HF0A 3BC8A 1D5VA 4JYKA 1HBXG 2STTA 2IP2A 3ERMA 4A93J 4NC7A 1TTYA 2XPVA 4A0XA 1W7PD 5LHIA 3BTLA 4KN4X 3LFUA 2ESNA 5GPCA 3I0TA 2IGOA 3HHHA 3I71A 4QLCU 2EBIA 2IAIA 2H8RA 2AQEA 2ACJA 2QF7A 4BHPA 2ETHA 1D0XA 5J4YA 1XSVA 5L3FA 4XLAA 3Q9SA 1L3LA 2OBPA 3W6JB 1QPIA 1XDUA 2YR2A 1IXCA 2GOMA 1OMIA 1R5HA 3QYEA 3WHBA 4UB6C 5HDKA 1TWGJ 1J09A 2TDXA 3RQIA 5AIPA 3CUQC 1IC8A 4NNJA 4YEJA 1KU9A 2X51A 3H0GJ 1GXQA 1AOYA 3ZCOA 4II3A 2CQ7A 4IX7A 3CCMI 3HKZN 2H6CA 3PFYA 3I53A 2PJPA 3V8LA 2GXAA 1CF7B 1SD7A 2RQQA 3ZQLA 3R6SA 1VQ9I 2EIMH 2DK5A 2DA1A 1N25A 2IBDA 5F0HA 2CRGA 2BVMA 3P9KA 2XAUA 4OIRF 3E7LA 1SD4A 2LR8A 3MZYA 3RCOA 1Z3YA 1OCPA 5IP6A 4AIKA 4L18B 1IG7A 3K4LA 1ZRCA 1MJBA 4KDPA 2DT5A 4FX0A 4W97A 5A2QZ 4MEXF 4AU7A 4LK1F 2D5VA 4HV5A 1T39A 1A5JA 1R9TJ 1G3WA 3VWBA 4CCMA 3PO2J 5F64A 1KYZA 2HQRA 5D5UB 3K4CA 1B9MA 1ZLJA 2K9QA 2PMHA 3FWEA 1O7LA 4FETA 4XSZF 2X6WA 1FSEA 4OWRB 1JXSA 1SMTA 3M8EA 1P4WA 1XSXA 4IZZA 2JRMA 1VQ6I 2EFQA 2PEXA 2H8WA 3HUGB 2MG4A 4RA2A 1ORKA 5HVQC 2YU9J 3GFJA 4XORA 1S5LC 3Q5FA 1J75A 3JRFA 2DA6A 2LBFA 3ERED 3NEUA 4PGHA 3ESWB 1AKHB 3S3OA 1DU6A 1RKWA 5CYVA 2P5LC 4BXFA 3HL2A 4BQNA 3O3KA 2Y0MA 3BQYA 5M3MJ 3CCYA 4UHTA 4FHTA 1IV6A 4G7OF 4BQQA 4E70A 1YHQI 1VQLI 2HU9A 2W84A 2QKMB 3D5LA 4IQJA 2JZYA 2Y0SN 3DXJF 1MBJA 3OYEA 1Z3XA 3A03A 1UELB 5K5OA 5CQGA 3CMYA 3KZZA 3UNGC 2Q2EA 2E1OA 3QYFA 5FD5A 3OYGA 1QBJA 2Z16A 1MIJA 3MAJA 3O8HA 2KJBA 2BY3A 2JSPA 1WH7A 3BPXA 1HC8A 1BIBA 3RZDJ 3WTWC 3BDDA 2DT7B 3WGGA 5CVVA 2HYJA 3ZMDA 3RQ4A 1JT6A 3K70D 3IC7A 4OU0A 2HKOA 1ETYA 3G4SI 1UFMA 1WJDA 3OSFA 5IP9J 3MD2A 3GLLA 1U5TA 1YLFA 1J7KA 4IXAA 3I64A 5K1YA 5J1YA 2R7DA 4B43A 3BT9A 2E5NA 2KRCA 3FF5A 3K0LA 2E1NA 1PP7U 3FK6A 3J7YJ 2V4JC 4RAGA 4U7BA 3ZP5A 2H94A 4Z2YA 2EPFA 2HXOA 5FGMA 2M0MA 3S93A 2XC7A 1A6QA 3DEUA 3ZQ7A 1LJ9A 2LY1A 4BUPA 3QPSA 1PUEE 3DPTA 4XOPA 3HSRA 4Y33A 4GYIA 3CCUI 5FD6A 1X1PA 2XAHA 4G6DA 2CJJA 3MKYB 4NC6A 3HPGA 1RNLA 1VQMI 2R3SA 3T1BA 1B1BA 3L7WA 1PYVA 4ON0A 1TBXA 3FXMA 3M8JA 1LQ1A 4KA4A 1TT5B 2BW3A 2ZMEA 4C3JJ 3IWZA 1NK2P 1A04A 2JT1A 2CV1A 2XGDA 1STZA 5FRNA 2HDDA 3HM5A 4KICA 3J7ZI 2FOWA 2GA1A 2IJLA 5D5WB 3KLOA 1Z1DA 2EFOA 2L7MP 2VJJA 3IHUA 4HDVA 1YJNI 4S05A 3K2ZA 3M7GA 1B72B 1BI1A 2M4KA 3OS1A 3H35A 2RV8A 2VJ4A 4HF0A 4XLNF 2DMNA 5HDNA 1P4AA 2DFHA 2V9KA 3CO7C 3CQZJ 3O2PE 1BI3A 4KT6A 2W00A 3OYKA 2FEZA 5E8IA 4X0GA 1F4KA 2HKXA 4EGYA 1OCTC 1K78B 2O0YA 3KFWX 4H4KC 4A12A 3AL0B 1U8RA 5TGTA 1D8JA 1HXDA 2W4SA 4FASD 3MKZA 4DYQA 2GOXB 1R6RA 3KCCA 1OR7C 3HOSA 4M72A 3EPZA 5F6FA 2KKOA 4IRIA 2OD5A 1H9TA 1TW3A 3GTPJ 2Z99A 1LFBA 1AWCA 4UXNA 2E1CA 4D7MA 4F7ZA 2LTPA 3ABTA 2Z5UA 1FZPB 1XGSA 2QSGX 2R7SA 3TEDA 2KP6A 4M9SA 4N0BA 1S9HA 2HWVA 2VBXA 3S2WA 1Y8RB 1ZAOA 4HX8A 1Q1HA 4M71A 4DJAA 1EH8A 2V1XA 1GT0C 2RNJA 4I01A 4HYEA 5EZHA 3KP2A 3FXJA 3NWSA 2XB5A 4BH9A 5L3CA 1K4SA 1TNTA 4BDZA 3E6DA 2AHQA 3CZ6A 2KIMA 4M3BA 4KMUX 4KUMA 4LLGF 1BJZA 5J47A 3G71I 5D8LB 1SFOJ 1AU7A 1O3RA 4D7NA 4HRIA 4YFNF 3K4KA 1TP4A 3LSMA 4EM0B 4A5MA 2BHZA 3F8BA 5HNHA 3ECOA 4LLLA 3FHZA 5H20A 3BR2A 1H9GA 3OOUA 1K7AA 2YX7A 3LSHA 4JQFA 1ETQA 1G2HA 3LA3A 3LA2A 4ZYAA 2OCEA 3F3XA 4XOTA 2K5CA 3TDZC 2LY2A 2BOLA 4AIDA 2HPMA 1UHSA 2Y9YA 3ZQIA 1M1EB 2HNHA 2L7FP 2NNNA 2WBMA 1XMAA 5D4SA 5FLMJ 3L2CA 4NHJA 2NVTJ 3H3VK 3HOVJ 2LY9A 3TGNA 1WRJA 3VFZA 3HYIA 1U5TB 2BBYA 2NS0A 2VT3A 3L1PA 4U88A 1U6GA 3NAUA 4IVNA 2MH2A 4EJWA 5J3LA 2LP0A 2DTZA 2F5VA 5E3LA 2CO5A 3VOEA 4ZYGA 3HRUA 4RGXA 5E8GA 2KZVA 2RGVA 4X1EA 1UG2A 4PJJA 2IXSA 1LFUP 1MD0A 1OQYA 4IJAA 1W4MA 1R36A 3VODA 3MWMA 2FQ3A 3SHFA 3DU6A 3BWGA 2PN6A 2DW4A 2HFHA 2IW5A 1T98A 3OWTA 3BG7A 2O8XA 2OU2A 3LSRA 3BZCA 2W57A 4F92B 2RC4A 2F4MB 5LGUA 3WGHA 3PUFA 2HTJA 3G2BA 4PJLA 2VKDA 4LK0F 3REOA 3ZMTA 3TMOA 3ZR8X 2W48A 4HW0A 3IL2A 2DAOA 1D1AA 3B02A 2M8GX 4GYGA 1B8IA 1ITYA 3U9GA 4EATA 4Y52J 4I09A 1QRYA 4GFBA 3S2DJ 5CKTA 2JVHA 4IRHA 3RJPA 1U2WA 2F2EA 2BE5F 4RS8A 1B9NA 1RR8C 2ESHA 3I54A 5JLXA 4PSWA 1YS6A 4QIWN 1KU7A 1JGSA 1R58A 1ZELA 3CF2A 1FBUA 2LK2A 3PNTA 2MGQA 2LD5A 1V4RA 3S1QJ 2LRDA 3H3UA 4ZDOA 3MKLA 2EB7A 2VBYA 3GZ5A 3V4GA 4PFOA 1IRZA 3G1LA 5TJJA 1WI3A 4BY7J 2OTLI 3KYCB 1SFKA 3MFKA 1W5TA 5E3NA 3AFHA 1W7PA 1BR4A 2XF5A 3FMSA 2CW0F 1Y0UA 2JA2A 3DCFA 3U21A 3WE3A 1LB2A 2K3FA 2ZXJA 3FHNA 1XS9A 3HOYJ 3I59A 3S1MJ 1R1VA 1FC3A 2L02A 4R1HA 4NBQA 4IHSA 2HQNA 3ZQHA 4ZJZA 4PK4A 3AG1H 2YPRA 3FDYA 2YX4A 5E1XA 2BW3B 2LREA 3DKXA 3GO5A 1E0EA 1U8BA 4QSHA 2A5WA 4V19K 1DP7P 4UUSA 3EUAA 1E3PA 1QVTA 4B3AA 2EIKH 1E2XA 2HVQA 3ULQB 3WU1B 2JA7J 2FU4A 2V1NA 2W85A 3GXOA 1IV8A 5F27A 4XL9A 3GTMJ 1TZLA 3MMYB 1MBFA 2DA2A 1I5ZA 2R5ZA 4N4NB 3D0SA 3LSIA 4MFDA 4EGZA 1IJWC 2O3FA 4PCQA 4AVZA 5D5XB 3S14J 2LKPA 3RKYA 3MQ0A 4BHCA 3IRRA 2IA0A 2R7ZJ 5FLVA 4P9FA 3K2AA 1I1GA 5J1UA 2L7KA 4A3IJ 2EZKA 2DFFA 4R79A 1LKXA 4ZYHA 1EA3A 4IKFA 1N78A 3BOQA 2X0LA 4S0HB 3LSGA 5HS9A 4KJZA 4CYCA 2H27A 2R7XA 2ADUA 2M34A 2GLOA 2Z9OA 1BJAA 4C2UA 4M73A 3IAS2 2V1UA 2MLKA 2LYCA 3MZ8A 2CQQA 5D8KB 4BXUA 1WJEA 5DM7F 1EF4A 2VODA 1FNNA 4A3KJ 4WF2A 4A3JJ 4XLEA 3CCSI 4Q47A 3PIOF 2K9LA 2DTRA 2E2IJ 5DEQA 2ZMEC 3RKXA 3HB9A 1FMVA 2K9SA 1RIOH 1BR1A 1IF1A 5HOOA 3RKWA 3HDDA 2ZXHA 4Q5SF 4M6XA 3ROUA 1I1SA 1F1ZA 1QGPA 2YSRA 1Z7UA 3RSNA 3H9QA 4L0ZB 5JHUA 3K70C 1QO0D 3NARA 2AS5F 4EM1A 3RTRA 5E1ZB 1RRJA 3HC7A 2QZ8A 3HJEA 2Y0SA 1X58A 3WE2A 4KIBA 3LSKA 5K7HA 4OOIA 5GAEJ 5C4XJ 1PUFB 1WFXA 4XLHA 1TWAJ 1KONA 2A69F 3OL3A 2VB6A 3A1YA 3PFIA 1K6OA 5ICCA 1ZARA 3V7CA 3GTKJ 1S3JA 2XHKA 1SAXA 4D5FA 1FEXA 4KNYA 3K4MA 2V9PA 2X6YA 3DQVC 3FXRA 2O5RA 2V6CA 4I76A 1W0UA 3BP8A 2DXIA 2ZFUA 1IGNA 5ICGA 2VJ5A 3GF2A 4LD5A 1WGXA 5DUIA 4A5NA 2XGEA 1MH3A 4FQGA 2OC6A 4ZZDA 4KFCA 3AKZA 3PO3J 4XQFA 2FSWA 5FKNA 4IOCF 2F48A 3S1NJ 2VXDA 1SANA 1XN7A 4XSXF 2JA5J 3HGGA 4XRSA 2M3AA 2P7CB 2LFBA 3FX3A 4CSWA 1DPRA 1YW8A 4UV9A 1XGNA 2LVSA 2Y75A 2W24A 3G3ZA 5DCMB 2IRFG 1S6LA 3E6CC 5EEHA 1YQAA 1P6RA 1JHHA 4IRGA 2Q8KA 4EV0A 2CUZA 1ZGJA 4BS9A 5E17F 1HW1A 5ICFA 1K79A 1UAAA 1LUJB 5H6QA 5FKMA 1SD6A 3KYDB 3CUQB 2QQAA 3A4CA 2WA0A 3P9IA 3JRDA 3A02A 3DPLC 4JK1X 4M9ZA 3CDIA 2IGKA 3TOAA 2DBBA 4M9XA 2UV1A 3J81Z 2Q1ZB 5D6EA 4BKXA 4IHVA 2Y30A 3I4PA 5GADJ 2Y69H 3P7NA 3ISPA 2QKLB 4PDKA 2M45A 3T8RA 1QQIA 5IYCJ 4JP0A 3AL0C 2JRTA 2LDUA 2DA5A 5TISC 1V5GA 2HGCA 2KZGA 2R7UA 2DMQA 2DDBA 3COAC 2FRHA 2KQRA 3S3MA 5HODA 2KDOA 3TDUC 2PMUA 2RREA 5JVTA 3LSPA 4A0ZA 1A31A 2WAFA 1ZG1A 2JJ7A 4HNTA 1SD5A 3DTIA 4F55A 3HG9A 1FOWA 5DTDA 3JAMZ 1JKOC 4QTRA 4GGGA 1MKMA 3DV8A 4XIDA 1GDTA 3ASOH 1H89C 3GZNB 2HVSA 3DPUA 4KYWA 2KMUA 2DYSH 3SZGA 2QYOA 1MH4A 3V8KA 3WTVC 1P4XA 3PQKA 4Y3OA 1PDNC 3TOBA 2ZJ2A 3R60A 3GTLJ 5C4JJ 3K1PA 2CGPA 2O61A 2ISYA 4HSRA 4Q48A 5FKOA 2ZB9A 3BJ6A 2MYSA 4PJMA 3VYSB 2QA4I 2CMPA 1R5GA 2DYRH 1ZGWA 4F52A 2HI3A 2V79A 4YIIA 4ESBA 3KZYA 1C0WA 3CC4I 2E36A 2ZO4A 2DI3A 1P7IA 3A2KA 2CWEA 1LDDA 4LLNA 2DFIA 2WY8Q 4XKVA 2IGMA 1WJFA 4CCKA 3EUHC 1KA8A 3WTUC 1TQPA 2D1HA 2X1EA 3MEXA 3S17J 3V7SA 3RPQA 4DIQA 5JI6A 2P8TA 1WI9A 2ZBKA 4BQAA 3SDGA 3ZMZA 1Y0NA 2IEKA 2UZKA 1JKQC 1MMAA 4B1RA 1R71A 2LLKA 1X1DA 1KQ9A 5FFXA 2O9LA 3C1DA 3DU5A 4ETSA 2E71A 3FXLA 2ZXWH 3CCVI 4UNOA 5DS9A 1JKRC 3JR9A 3P5JA 3I5UA 2LH9A 4MLOA 1O7FA 4NDLA 1B6AA 2D2WA 4B8XA 4XICA 3LNQA 4F91B 2M1BA 2LBFB 3ZMSA 2JPBA 2BXZA 3JCUC 4F3QA 3S8PA 2DODA 2YS9A 4I0BA 2ZNZA 4L9JA 3JRAA 1HSTA 2DOAA 5HLGA 1R7JA 3ABKH 5GTIC 3H36A 2XF7A 4LJZF 1ZG5A 5FROA 2X4HA 3VYUB 1YFHA 2R93J 1BN5A 4YIFA 2EA2A 3RDIA 1D0ZA 4MIMA 4L0YB 1UG0A 5K7FA 4XBFA 4AIJA 1S7OA 2MFZA 2XPWA 3O8GA 1R5ID 2MSYA 4NB5A 5B1AH 2I10A 4BNCA 1FOXA 3QPHA 3UR3C 2GWRA 3F22A 1JTYA 1I50J 5BNGA 1OPCA 4BEHB 4ENMA 2PBIA 2CS3A 1EKEA 1MJAA 2NAZA 3J80K 3BY6A 1YS7A 1GV2A 1UJ8A 1BBYA 2XSJC 2A07F 3F8NA 3TKYA 5L3DA 2NS7A 1LE8A 3ABLH 2ZJPF 4AYBA 3H0DA 3HRMA 1OYWA 2Y9ZA 4EM2A 2HOAA 3VSLA 3P9CA 3NQOA 1X3UA 2O8KA 3R61A 1Y1WJ 5F0CA 4EQQA 5J4VA 4S04A 2KRHA 3E6MA 2A3SA 1JUSA 2QSFX 2L9RA 3OR1C 1H88C 3HTUA 4K2EA 4XLCA 2NVYJ 4IF4A 3RKQA 2FBKA 4DOZA 2DU9A 4CO8A 1BW6A 3WTTC 2PQ8A 2RNGA 4Y4RA 2O7OA 4LFUA 2OQGA 1MZBA 1CQTA 1YX5A 4LB5A 3J7AO 2IT0A 4CHUA 3K4JA 2ID3A 3CDHA 5GAGJ 5IP7J 4RLFA 3C2HA 1V54H 3OIQA 5DCMA 3F8MA 2LG4A 3WTXC 1SMYF 4HA8A 3OYDA 1SVMA 1YIOA 4JBAA 2X1CA 1YW7A 2ZKZA 2W82A 4A69C 5HS8A 4D9JA 2FUG2 3VYRB 4OIPF 2DA3A 3DP7A 2P4WA 3KEOA 3FKJA 1QU3A 4XK4A 1TT0A 4HF2A 2JTVA 1DGWY 1MMSA 1X1AA 4OAYA 3JRHA 2MLGA 3WTYC 4R8HA 3BR6A 1ERDA 5F1JA 2QGUA 3Q0VA 4E7KA 4P9UA 4YRVA 2XIGA 3CJNA 3GLXA 4D5CA 4F93B 2OPTA 1QHGA 1JUPA 2NVQJ 3H5RA 1IN5A 2NS8A 4MO7A 4PGGA 4M6VA 2A6HF 3F6VA 4V2GA 1F36A 2JA6J 5B1BH 1IRGA 2R5YA 3LA7A 1FLIA 3DKWA 1G3YA 2L0KA 2L9NA 2X6OA 4N9IA 4LG0B 4QPOA 1XC5A 4BBSJ 4AIHA 2M4GA 3U1KA 4BHBA 4IEJA 1HDDC 2DO7A 3IH3A 3HOUJ 1DPUA 1TC3C 1TW2A 3HPHA 3K9TA 1HW5A 4CCNA 2MABA 4C3IJ 5FFZA 1Z05A 5BMZA 5IPAA 3AG3H 3EUHA 4I99C 1VF9A 1JI8A 5BPDA 1D1BA 4MQVA 4N4OB 1I3AA 2HYGD 5LRSA 2P6TA 2QQ8A 3KIOA 3OV8A 4CICA 1NHAA 2PG4A 4UVAA 4C2MJ 2FX0A 3MN2A 3LMMA 1Z9CA 2XB0X 4PFPA 2GIVA 3KPHA 3D5SC 3DBRB 3PQJA 5F1RA 3F9KA 3PUBA 3K10A 4W1UA 1LVKA 1GVDA 2CW7A 4L9VA 2COBA 4IPAA 2ZJQF 4BY1J 1XCBA 5FO5A 5ILVA 2BZTA 2VL8A 1XX5A 4HX7A 3Q0WA 4DBRA 4GO1A 2GIZA 4IOAF 3JSPA 1IUYA 2RKHA 2AXTC 3JSOA 1BIAA 4KMFA 1XGMA 5EG0B 4RB1A 1S7EA 4UVBA 3ABUA 3BZKA 1FX7A 3OR2C 1Z21A 3TW7A 4BAYA 1X19A 5E3OA 4DZPA 3KZIC 1RC9A 4BJ6C 3HHGA 3MCZA 3GTQJ 2AXLA 1FYMA 2DLLA 3ONQA 2E19A 3ZQFA 2M30A 1XCVA 4OMYA 4G9YA 2BYVE 4MQ9F 2EILH 1HKSA 4ZYEA 3GBGA 2XKOA 2HQAA 2MD0A 3KP3A 2RVCA 4JX5A 2ID6A 1YG2A 3QYBA 3L00A 3F21A 3F0CA 1VFCA 3FZVA 2PMZA 2FA5A 4XN3A 3CCJI 2XKPA 2XV4S 1T0FA 1POGA 5CQEA 1RKTA 1LVAA 3D5RC 2DFEA 5HLTA 2NVXJ 2HDWA 4BE2A 3ZOBA 1P92A 5HLIA 1SFXA 2P6SA 4FISA 3FK7A 1BOBA 2FE3A 3KP6A 3PIPF 4LOCA 2VQLA 1YRNA 1B59A 3U2RA 2UUZA 3E3VA 1D5YA 4CH7A 2Z33A 4FTHA 2Y31A 4GDFA 4BXXJ 1SEUA 1Q1VA 5M5YJ 4UV8A 4IQ4A 1IN6A 2IGNA 2CQNA 1O3QA 2E5ZA 9ANTA 1G4DA 4RAFA 3E5UA 5IYBJ 5IOYA 3I55I 4II2A 2VJIA 5H6RA 4XLFA 3N05A 4Q4ZF 1FMWA 1XG1A 1VQ5I 4RB0A 3BJAA 4B3XA 4RM3A 4GCVA 2NYXA 3TP3A 1HSJA 4BGDA 2G0EA 2A5YB 2LMDA 2VKVA 2FBHA 5E3MA 4UB8C 2HR3A 4HNVA 1T38A 2K27A 3C2BA 2VONA 2WWYA 1ENHA 3TQNA 4PJ0C 4RGUA 1MNMC 4XNFA 5LD2C 3K1MA 4B09A 4YIRX 3G73A 2CQXA 2R7OA 4XRSG 4WX9A 3QRFF 3D1NI 2CW8A 3ECHA 3TO6A 1YYVA 2RN7A 5B3SH 3HSEA 2H6BA 2HQ5A 3CC2I 3T5XA 4E6KG 1ULYA 1WVRA 2G7HA 3CP2A 4BU2A 3F72A 1Y1VJ 1EV7A 2RQPA 1UMQA 4A3GJ 2DK8A 1WJBA 1YOVB 1WJAA 2VPRA 5IY5H 1O3SA 2QBYB 2XGXA 4ZTFA 5EEGA 4JOMA 3PJRA 2XPUA 2F5EA 2DPDA 4B4CA 1APLC 1GV5A 1W36C 4A0YA 4LG0A 4A3LJ 2G7UA 2HEOA 3VSKA 3DKYA 2BXYA 5E20A 2HPIA 1RESA 1R1UA 1Z77A 2R5ZB 2K9NA 1Z6RA 5ILUA 4XM3A 3OOPA 1IZ1A 3OYMA 5KNLA 2GM4A 1MMDA 1OISA 1IO2A 1UB9A 5J1RA 3HEFA 4TV7A 2R7VA 2WAQA 4O5VA 4ZTJA 2M8EA 4DGWB 2CV0A 1G3TA 1X2NA 2DT6A 2EJRA 2LOOA 2WADA 4MHGA 4NQWA 1VQ7I 4O6JA 1S8NA 1R4MB 3CO6C 2F6CA 2Y48A 1ZK8A 1KU3A 1NTCA 2M5WA 3ML6A 2VPLA 1T33A 2E35A 3LSJA 3OYJA 4CCLA 4X6AJ 2OAZA 2Q2EB 1GUUA 4EJOA 3KX2A 5CPRB 3GUDA 3KP7A 1XB4A 3M1EA 2KLOA 1Y6IA 5L3GA 5DUKA 2I5UA 3ZQCA 4HV6A 3TO9A 1SAUA 1IN4A 2WB1N 1QZEA 2XVCA 4ITVA 1D8KA 2QVOA 2EINH 2Z3YA 2L3DA 4BQOA 3PSIA 2FNPA 3MVPA 3L2RA 4G94A 3QPTA 1E3HA 3QU6A 3RPUD 1DP3A 5KK1A 2VBWA 3IKTA 1XMKA 2K4JA 1LEBA 1ZN2A 5JLWA 4LB6B 1Y56A 2LC2A 4IO9F 2KDZA 2ELJA 1B4AA 1K4TA 4LGWA 2ELKA 1MSEC 3DBHB 4WK8F 2DMPA 3H92A 4M74A 3WGIA 1PVEA 2NRAC 1IDZA 4I2OA 1ON2A 5HDGA 1TWHJ 2W1OA 4J01A 2X85A 1MBGA 2R7FA 4QPQA 1HOMA 4MGRA 4M3DA 4KIFA 3I58A 2KFDA 1YTYA 2OUMA 5HLHA 3ZPLA 4ZDPA 4YELA 3FXUA 2FNAA 1XMXA 2L9VA 2YUSA 4FE4A 4XKBA 5IT3A 3ABMH 3BQZA 3NWTA 4ANJA 1WQ2A 3EQLF 5FKKA 2MBFA 5IT9K 1O3TA 5B66C 1EH6A 3QOPA 4EVIA 2WTEA 2KPMA 4G6TB 3IH4A 2ICWG 2Q0OA 3DBLB 1ZKGA 5JHFA 1I39A 2A6TA 2WY7Q 5EJCA 3JW4A 1X3ZB 3A01A 3F23A 4CGZA 2R0QC 1YO5C 4D1QA 3CUOA 3LL7A 1K61A 1JJ6C 1FP1D 3I3LA 1ZTRA 2BGCA 1V3FA 1WKMA 3WU0A 4C9YA 3SEQA 2XRLA 3G1MA 2X1DA 2LNBA 2JUGA 3HIFA 4L5JA 3RYPA 2STWA 2OZ6A 3U1DA 2V7FA 2K7LA 3L2WA 1DDNA 1B72A 5FRMA 1J9IA 3RYRA 1FP2A 4FX4A 4FT8A 3E6BA 2A61A 3BZ6A 2QBYA 3J80Z 2JPCA 3SQNA 4CZZA 4DYCA 3S1RJ 1KQ8A 1OCCH 5AIQA 5EEAA 3I9V2 3R0JA 3IH2A 4U0VA 4Y15A 1FTTA 3CF5F 1ZR4A 2QQ9A 2V26A 3CJQB 3S32A 1IRFA 2JMWA 2GXBA 2XF6A 1OCRH 4A3CJ 3K4NA 5EYRA 3EYIA 2UWMA 2KRFA 1FBQA 2VQHA 2ZXIA 1ZREA 1VQ4I 3WODF 2QEXI 1G6NA 2CQKA 1LPQA 3ZXSA 1RETA 1OCOH 2GXGA 5DD4A 2R4GA 1IN7A 2L2OA 4M3EA 4QWQA 1G8XA 2AQFA 2K9MA 2Z1DA 5LEKA 2CU7A 4HOBA 2P81A 4L9TA 5D5VB 5CLSA 3F8CA 3WHCA 2M87A 3HXLA 3S3NA 5LGNA 1S29A 1Z0XA 3L9FA 5J6XA 3A0BC 2FMLA 1TNSA 3C7JA 5B5EC 4ZC3A 2P7VB 2KL4A 2OTJI 4A6DA 1FYLA 2E60A 3CESA 1WH5A 2IS2A 1I6XA 4KT5C 4RAYA 1MW7A 3OYBA 1D0YA 2KISA 1WHUA 3KP5A 4XLPF 2ELHA 3QODA 3GTGJ 4ZZLA 2VXZA 1O4XA 4PSXA 2NOGA 3WTSC 4PUSA 4HAMA 3TO7A 5ED4A 2WAQN 1ETWA 3R4KA 3BTCA 2L01A 1QZYA 2K86A 1I3QJ 5D4RA 2DPUA 1PP8F 2E1MC 1V55H 5BPIA 3Q3SA 1K78A 2HDCA 2H09A 1FTZA 2BY0A 4RDUA 1LDJA 2TCTA 5D6FA 2K4BA 1BR2A 1MNDA 1ZH5A 2HVRA 1W7PB 1WCMJ 2A68F 4E4HA 4BE1A 1G59A 1UZCA 3CDLA 2VI6A 2E7WA 3CCEI 3BR0A 2UXNA 4GXOA 3FXQA 3CMMA 2L5QA 1RR7A 2PFBA 5JFRA 1XD7A 4M3FA 4E7IA 4DZJA 1LNWA 4U0WA 2DN0A 4BE0A 3FIWA 3GTOJ 2VKEA 5L3BA 1IUFA 3BTJA 4AWXB 2EV0A 2DA7A 3T0YA 4YG2F 1LDKB 2R7RA 2XUBA 4E7LA 3BG6A 3G6EI 4JX6A 1B8IB 1UHMA 3KEYA 5GP9A 5F04A 1V5FA 1D3YA 3VEPA 2WAEA 6PAXA 4HDUA 1E3OC 5IOZA 4LMYA 3CP8A 1YJWI 3DWLE 3I4NJ 3QAHA 4YFXF 2ME0A 4WCGA 2EA4A 2ZSIB 4ZH4F 3N4MA 2PX9A 2D45A 1J5YA 1ZG3A 1D1CA 2RAEA 4CYDA 3VDXA 2K3PA 4A3FJ 1ETXA 1LFPA 1TQMA 1GVJA 1J2XA 1N77A 2CUFA 1LE8B 2P0WA 1KZHA 4BDYA 3CMAI 4I7HA 3LFKA 1RZ4A 4L9NA 3GYHX 4A6EA 5CVJA 3FXOA 2E1MB 4AC0A 2EV5A 2F4IA 5HS7A 2W25A 1HQCA 2MW8A 4DBQA 4LITA 4CXFA 4PZJA 1HW2A 5E1WA 3O6BB 3V8JA 2KIQA 1MBHA 1EH7A 3F6OA 5C3EJ 1J59A 1ON1A 4HLXA 3ZQQA 5DM6F 3A01B 2C6YA 4UUTA 4C2TA 1TQIA 4MNUA 5KAFC 3JREA 3SYTA 4BJTA 1I6HJ 2Y2ZA 1FYKA 2HTSA 3OYFA 2VKHA 2JK3A 2QM3A 1T6SA 3AG4H 2VE9A 1JJ8C 2HOSA 4XRMA 1JE8A 2FOKA 3B6AA 2IS4A 3HGYA 2VBZA 4B44A 1FY7A 1Y8QB 2GZWA 2L7ZA 4HLYA 4G6QA 3IRQA 1ZQ3P 1OR7A 2QSHX 4E7JA 5CVUA 2XAJA 3T8TA 2LKXA 1HA8A 2PJRA 5HNFA 3GCMA 3VB2A 1KU2A 2FF4A 3LWFA 1W0TA 5ERIA 2ZCWA 1MMNA 3GMEA 3H3ZA 5LGTA 2CSOA 2QUFA 5M5XJ 3E0JB 2VUMJ 1R49A 4RM2A 3K4BA 2OCCH 4OAZA 4OMZA 3HRTA 1S7AA 2F5FA 4C30A 2ISZA 3FBNB 1X1BA 1A6IA 5M3FJ 2Z2SB 4MEYF 2KIFA 3GVAA 2R7WA 3OYHA 1ZRFA 4C3HJ 2EWNA 1A35A 2GA2A 3BR5A 2X6XA 3HOZJ 2F5DA 4CYCB 3H1CA 2X48A 2GAUA 3WU2C 3L09A 2OQRA 4KIGA 3HKZA 1HDPA 4CCOA 2QQBA 4MTEA 1ZYRF 2R92J 1X3WB 3FKIJ 4P55A 1MDMB 5EGOB 3SJMA 1FWZA 4IL6C 1UCRA 3SZPA 1SFUA 3AG2H 2X9DA 3ZRGA 4A3EJ 4KITB 3BROA 3TP0A 4XONA 5LHGA 1ZRDA 3W6VA 4MFEA 2H1KA 3WG7H 3HOWJ 1V5EA 1FBSA 2OA4A 3DTEA 4ESJA 4I6ZA 2BV6A 1QA6A 2JVGA 3WTZA 3BLYA 4IHXA 1FT9A 5K5RA 4U0YA 2HYFA 3H9GA
chains in the Genus database with same CATH topology
4OIOF 1ODDA 2K02A 3E97A 1LEAA 2OZUA 2O03A 1RUNA 1RI7A 2MH9A 1Z91A 1RUOA 2IPQX 3GEZA 5AONA 3GFIA 1U5TC 2LF7A 2PI0A 3Q9VA 3JAMK 1FPQA 3N97A 2VOPA 1ZLKA 2WV0A 3HOTA 5J8CA 4WXCA 1QZZA 3GFMA 4G7HF 2WC2A 4I98B 2KIUA 4RGSA 5JR3A 1KQ0A 1GXPA 3QP6A 5A2QK 3JTGA 2L54A 1BC7C 1WSUA 1TLHB 1QNTA 3LAPA 5BS6A 4O3MA 4I02A 2VT2A 4XRFA 4Y13A 3GW2A 4U7DA 1GHCA 1ZHFA 2V1DA 2MA3A 3LAJA 3GX4X 1F9NA 4RAZA 1F5TA 4HQEA 1KGSA 5FLXZ 3WG9A 2EFNA 2XASA 2EK5A 3EDPA 1HKQA 3SFZA 5KVRA 4G8XA 4RB3C 4EJUA 3ZN1A 4H0EA 5CVRA 2RDPA 1W5SA 3IKVA 1OYIA 2ZMEB 2VE8A 1G3SA 3HTSB 3E5XA 2L4MA 3RPUA 1KYWA 4HBLA 4UVCA 2MC3A 1R23A 3QU3A 3KEQA 2ZNYA 3LQRA 1XGOA 2MD5A 3M9AA 3CUQA 2UXXA 4P5OA 4WWCA 3JTHA 2G9WA 3KETA 1SFEA 4ASNA 3LQQA 1DUXC 3DFGA 1U78A 5FLXK 1JHFA 3EETA 1MGTA 4G7ZF 2GQQA 2XAQA 3FMRA 1R1TA 2FXAA 4EJTA 5LLQA 3GFLA 1BOAA 1IAWA 2COMA 1MDMA 5DDGA 4D0PA 5DCFA 3K69A 3EYYA 2HS5A 3IWFA 2L4AA 1CGPA 2PLYA 4EMSA 1MJ9A 3LSTA 4ENJA 3M8FA 2EFPA 2ZFWA 2VC0A 1OYYA 1O57A 3W6KB 1IN8A 2A6EF 1YW9A 5DD8A 3CTAA 2IA1A 4AVPA 4N9HA 4AD9A 1USSA 2IA2A 3QP5A 2QLZA 3FM3A 5DV5A 4RB2C 1QPMA 4L5IA 5DYMA 2KJCA 3ZMUA 2P5VA 3BJOA 4EJVA 1OKRA 3DF8A 1CF7A 1I27A 4DQ2A 2EV6A 4ESFA 1BI2A 2HZTA 4KN7X 5BQTA 2IVMA 1REPC 4UUVA 3HSFA 3FMQA 5LRRA 1XSDA 5ICEA 2FMYA 5K5QA 1BC8C 3AAFA 3CLOA 2F5CA 2FBIA 3C3WA 4Y17A 1IXRC 3J81K 3GZ6A 4RGRA 2QWWA 1H0MA 1HKTA 5L3EA 5TRDA 4P96A 2VOOA 3FM5A 1ONVA 3R0AA 2CFXA 2XAGA 2V9VA 3HUGA 3NRVA 2B0LA 2J5PA 2XROA 5E18F 5J8FA 1U3EM 4CDGA 1P2FA 4A2UA 3B73A 3I59B 4WXHA 3ZMVA 3C18A 1IXSB 1T2KA 3K1NA 1J0RA 4YFKF 4OINF 3SXYA 2QENA 3BPVA 2XRNA 3RIRA 2LSOA 4I0AA 1IW7F 1E17A 1ZGAA 5ILSA 3ZN0A 2D1VA 4HF1A 2E7XA 3V7RA 2LF8A 2BEOA 1R22A 2J5OA 5LHHA 1VTNC 4IHTA 1BM9A 2DQRA 1FOKA 4HZFA 4HX4A 2VC1A 4M6YA 2YU3A 5FB2A 2CYYA 2EFWA 3KP4A 4MTDA 5LEJA 2NNYA 1XDSA 4BYYA 5IT9Z 1Z6TA 3KLNA 2DQLA 5LBQA 3KE2A 3RI4A 4WXDA 1USTA 3E5QA 3SZTA 3GWZA 3F8FA 4DNCA 5BOXA 4ZYDA 2HOEA 4ENNA 3ELKA 1WWXA 3HRSA 2O6GE 2XAFA 5CJ9A 2VN2A 4ENKA 1BI0A 5CVIA 1R00A 1L0OC 2CG4A 4OIQF 3MZHA 1FSHA 2P5KA 1UHWA 2JSCA 1D5VA 4HQMA 1HBXG 2STTA 2IP2A 1TTYA 4A0XA 1W7PD 5LHIA 4KN4X 2ESNA 3I0TA 3I71A 3HHHA 4QLCU 2ACJA 4BHPA 2ETHA 1XSVA 5L3FA 3Q9SA 1L3LA 2OBPA 3W6JB 1XDUA 2YR2A 1IXCA 1OMIA 1R5HA 5HDKA 2TDXA 5AIPA 3CUQC 1KU9A 1GXQA 1AOYA 2H6CA 3I53A 2PJPA 3V8LA 1CF7B 1SD7A 3R6SA 2DK5A 3P9KA 4OIRF 1SD4A 3MZYA 4AIKA 4L18B 1ZRCA 1MJBA 4KDPA 2DT5A 4FX0A 5A2QZ 4MEXF 4LK1F 4HV5A 1T39A 1G3WA 5F64A 1KYZA 2HQRA 5D5UB 1B9MA 1ZLJA 2PMHA 3FWEA 1O7LA 4XSZF 1FSEA 1JXSA 1SMTA 3M8EA 1P4WA 1XSXA 2EFQA 2PEXA 5HVQC 3GFJA 3Q5FA 1J75A 3ERED 3NEUA 4PGHA 5CYVA 2P5LC 3O3KA 2Y0MA 4UHTA 4FHTA 4G7OF 4E70A 2W84A 3D5LA 2JZYA 3DXJF 5K5OA 3KZZA 2Q2EA 5FD5A 1QBJA 3MAJA 2KJBA 3BPXA 1BIBA 3WTWC 3BDDA 3WGGA 5CVVA 3ZMDA 3IC7A 4OU0A 2HKOA 1UFMA 1U5TA 1YLFA 1J7KA 4IXAA 3I64A 5K1YA 2R7DA 1PP7U 3FF5A 3K0LA 2E1NA 4U7BA 3ZP5A 2H94A 4Z2YA 5FGMA 3DEUA 3ZQ7A 1LJ9A 1PUEE 3DPTA 3HSRA 4GYIA 5FD6A 2XAHA 4G6DA 1RNLA 2R3SA 3T1BA 1B1BA 3L7WA 4ON0A 1TBXA 1LQ1A 4KA4A 2ZMEA 3IWZA 1A04A 2JT1A 1STZA 4KICA 2GA1A 2IJLA 5D5WB 3KLOA 1Z1DA 2EFOA 3IHUA 4HDVA 4S05A 3K2ZA 3M7GA 1BI1A 2RV8A 4HF0A 4XLNF 5HDNA 1P4AA 3CO7C 3O2PE 1BI3A 2FEZA 5E8IA 1F4KA 2HKXA 4EGYA 1K78B 2O0YA 3KFWX 4A12A 1U8RA 1D8JA 1HXDA 3KCCA 3HOSA 4M72A 5F6FA 2KKOA 4IRIA 2OD5A 1H9TA 1TW3A 2Z99A 1AWCA 4UXNA 2E1CA 4F7ZA 3ABTA 2Z5UA 1FZPB 1XGSA 4M9SA 4N0BA 2HWVA 2VBXA 3S2WA 1ZAOA 4HX8A 1Q1HA 4M71A 1EH8A 2V1XA 2RNJA 4I01A 4HYEA 3KP2A 4BH9A 5L3CA 1TNTA 3E6DA 2KIMA 4KMUX 4KUMA 4LLGF 5D8LB 1O3RA 4YFNF 4EM0B 4A5MA 3F8BA 3ECOA 4LLLA 3FHZA 5H20A 1H9GA 1K7AA 2YX7A 4JQFA 3LA3A 3LA2A 3F3XA 3TDZC 3L2CA 2NNNA 5D4SA 1XMAA 4NHJA 3TGNA 1WRJA 3VFZA 3HYIA 1U5TB 2BBYA 2NS0A 2VT3A 4U88A 1U6GA 4IVNA 2MH2A 4EJWA 2CO5A 3VOEA 4ZYGA 3HRUA 4RGXA 5E8GA 2RGVA 1MD0A 4IJAA 1W4MA 1R36A 3VODA 3MWMA 2FQ3A 3SHFA 3BWGA 2PN6A 2DW4A 2HFHA 2IW5A 1T98A 2O8XA 2OU2A 2W57A 2RC4A 5LGUA 3WGHA 2HTJA 4LK0F 3REOA 3ZMTA 4HW0A 3IL2A 2DAOA 3B02A 4GYGA 3U9GA 4I09A 4IRHA 3RJPA 1U2WA 2F2EA 2BE5F 4RS8A 1B9NA 2ESHA 3I54A 1YS6A 1KU7A 1JGSA 1R58A 1FBUA 1V4RA 3H3UA 2EB7A 2VBYA 3GZ5A 3V4GA 5TJJA 3MFKA 1W5TA 1W7PA 3FMSA 2CW0F 1Y0UA 1LB2A 3WE3A 2ZXJA 3I59A 1R1VA 1FC3A 2L02A 4R1HA 4IHSA 2HQNA 2YPRA 2YX4A 5E1XA 3GO5A 1DP7P 3ULQB 1E2XA 3WU1B 2FU4A 2W85A 3GXOA 1I5ZA 3D0SA 4EGZA 2O3FA 4PCQA 5D5XB 2LKPA 3RKYA 3MQ0A 4BHCA 3IRRA 2IA0A 4P9FA 1I1GA 4R79A 4ZYHA 3BOQA 2X0LA 5HS9A 2H27A 2ADUA 2Z9OA 1BJAA 2V1UA 4M73A 2MLKA 5D8KB 4BXUA 2VODA 1FNNA 4WF2A 4Q47A 2DTRA 5DEQA 3RKXA 1RIOH 1IF1A 5HOOA 3RKWA 4Q5SF 4M6XA 3ROUA 1I1SA 1F1ZA 1QGPA 2YSRA 1Z7UA 4L0ZB 5JHUA 2AS5F 1QO0D 4EM1A 3RTRA 5E1ZB 2QZ8A 3WE2A 4KIBA 4OOIA 2A69F 3PFIA 1K6OA 5ICCA 1ZARA 3V7CA 1S3JA 2XHKA 1SAXA 4KNYA 3DQVC 3FXRA 2V6CA 3BP8A 5ICGA 4LD5A 3GF2A 5DUIA 4A5NA 4ZZDA 4KFCA 2FSWA 1XN7A 4XSXF 2P7CB 3FX3A 1DPRA 1YW8A 4UV9A 1XGNA 2Y75A 2W24A 3G3ZA 5DCMB 2IRFG 1S6LA 3E6CC 5EEHA 1YQAA 1P6RA 1JHHA 4IRGA 2Q8KA 4EV0A 1ZGJA 5E17F 1HW1A 5ICFA 1K79A 5H6QA 1SD6A 3CUQB 2QQAA 3P9IA 3DPLC 4M9ZA 4JK1X 3TOAA 2DBBA 4M9XA 3J81Z 5D6EA 3I4PA 3P7NA 3ISPA 4PDKA 2M45A 3T8RA 1QQIA 2JRTA 2LDUA 2HGCA 3COAC 2FRHA 3TDUC 2PMUA 5JVTA 4A0ZA 1ZG1A 1SD5A 3JAMZ 4GGGA 1MKMA 3DV8A 4KYWA 2QYOA 3V8KA 3WTVC 1P4XA 3PQKA 1PDNC 3TOBA 2ZJ2A 3R60A 3K1PA 2CGPA 2O61A 2ISYA 4Q48A 3BJ6A 1R5GA 2V79A 4YIIA 4ESBA 3KZYA 1C0WA 2ZO4A 2DI3A 2CWEA 1LDDA 4LLNA 2DFIA 1KA8A 3WTUC 1TQPA 2D1HA 3MEXA 3V7SA 3RPQA 5JI6A 2P8TA 1WI9A 2ZBKA 4BQAA 3ZMZA 2UZKA 1KQ9A 5FFXA 3C1DA 4ETSA 4UNOA 3I5UA 1O7FA 1B6AA 2D2WA 4B8XA 2M1BA 3ZMSA 2JPBA 4L9JA 4I0BA 2ZNZA 1HSTA 5HLGA 1R7JA 4LJZF 1ZG5A 2X4HA 1YFHA 1BN5A 4YIFA 2EA2A 3RDIA 4L0YB 4XBFA 4AIJA 1S7OA 4NB5A 4BNCA 3QPHA 2GWRA 3F22A 1OPCA 4ENMA 2PBIA 1MJAA 2NAZA 3J80K 3BY6A 1YS7A 2A07F 1BBYA 3F8NA 3TKYA 5L3DA 3HRMA 1OYWA 4EM2A 3P9CA 3NQOA 1X3UA 3R61A 4EQQA 4S04A 3E6MA 2A3SA 3HTUA 4K2EA 4IF4A 2FBKA 3WTTC 2DU9A 4CO8A 2PQ8A 4LFUA 2OQGA 1MZBA 4LB5A 3J7AO 2IT0A 4CHUA 3CDHA 5DCMA 3F8MA 3WTXC 1SMYF 4HA8A 1YIOA 4JBAA 1YW7A 2ZKZA 5HS8A 4OIPF 3DP7A 2P4WA 3KEOA 4HF2A 2JTVA 2MLGA 3WTYC 4R8HA 4P9UA 2XIGA 3CJNA 3GLXA 1IN5A 4PGGA 2A6HF 3F6VA 1IRGA 3LA7A 1FLIA 3DKWA 1G3YA 4N9IA 4LG0B 4AIHA 4BHBA 2DO7A 1DPUA 1TW2A 3K9TA 1HW5A 5FFZA 1Z05A 5BMZA 3EUHA 5BPDA 4MQVA 2HYGD 5LRSA 2P6TA 3OV8A 4CICA 1NHAA 2PG4A 4UVAA 1Z9CA 2GIVA 3PQJA 5F1RA 4L9VA 4IPAA 1XCBA 5FO5A 5ILVA 4HX7A 4GO1A 3JSPA 1IUYA 2RKHA 3JSOA 4KMFA 1BIAA 1XGMA 4RB1A 4UVBA 3ABUA 1FX7A 4BAYA 3HHGA 3MCZA 2AXLA 1FYMA 2DLLA 2M30A 1XCVA 4OMYA 4G9YA 2BYVE 4MQ9F 4ZYEA 1HKSA 2XKOA 3KP3A 2RVCA 1YG2A 3L00A 3F21A 3FZVA 2FA5A 2XKPA 2XV4S 1T0FA 1LVAA 1P92A 5HLIA 1SFXA 2P6SA 2FE3A 3KP6A 1B59A 3U2RA 3E3VA 2Z33A 4UV8A 1IN6A 1O3QA 1G4DA 3E5UA 5H6RA 4Q4ZF 4RB0A 3BJAA 4GCVA 2NYXA 1HSJA 2A5YB 2FBHA 2HR3A 1T38A 2K27A 2VONA 2WWYA 3TQNA 4RGUA 3K1MA 4B09A 3G73A 4WX9A 3QRFF 3ECHA 3TO6A 1YYVA 2RN7A 3HSEA 2H6BA 3T5XA 1ULYA 2G7HA 3F72A 2RQPA 1EV7A 2DK8A 1O3SA 2QBYB 2XGXA 5EEGA 2F5EA 2DPDA 4A0YA 4LG0A 2G7UA 2HEOA 5E20A 1R1UA 1Z6RA 5ILUA 3OOPA 1IZ1A 1UB9A 4TV7A 4O5VA 2M8EA 1G3TA 4MHGA 2EJRA 4NQWA 4O6JA 1S8NA 3CO6C 2Y48A 1KU3A 2M5WA 3ML6A 2OAZA 4EJOA 3GUDA 3KP7A 1XB4A 3M1EA 5L3GA 5DUKA 4HV6A 3TO9A 1IN4A 2XVCA 1D8KA 2QVOA 2Z3YA 2L3DA 2FNPA 4G94A 3QPTA 3QU6A 5KK1A 2VBWA 3IKTA 1XMKA 2K4JA 1LEBA 1ZN2A 4LB6B 1B4AA 4LGWA 4WK8F 3H92A 4M74A 3WGIA 2NRAC 4I2OA 1ON2A 5HDGA 2R7FA 4MGRA 4KIFA 3I58A 1YTYA 5HLHA 3ZPLA 3FXUA 2FNAA 5IT3A 1WQ2A 3EQLF 2MBFA 5IT9K 1O3TA 1EH6A 3QOPA 4EVIA 2WTEA 2Q0OA 3JW4A 3F23A 4CGZA 1YO5C 3CUOA 1FP1D 2BGCA 1V3FA 1WKMA 3WU0A 2LNBA 3HIFA 4L5JA 3RYPA 2STWA 2OZ6A 3U1DA 2K7LA 1DDNA 1J9IA 3RYRA 1FP2A 4FX4A 4FT8A 3E6BA 2A61A 3BZ6A 2QBYA 3J80Z 2JPCA 3SQNA 4CZZA 1KQ8A 5AIQA 3R0JA 4U0VA 4Y15A 2QQ9A 1IRFA 2GXBA 3EYIA 2UWMA 2KRFA 1FBQA 1ZREA 3WODF 1G6NA 2CQKA 2GXGA 5DD4A 1IN7A 4QWQA 5LEKA 4HOBA 4L9TA 5D5VB 5CLSA 3F8CA 2M87A 5LGNA 1S29A 3L9FA 5J6XA 2FMLA 1TNSA 3C7JA 2P7VB 4A6DA 1FYLA 1I6XA 4KT5C 4RAYA 3KP5A 4XLPF 2ELHA 4ZZLA 2VXZA 3WTSC 4HAMA 3TO7A 5ED4A 3R4KA 2L01A 1QZYA 2K86A 5D4RA 2DPUA 1PP8F 5BPIA 1K78A 2HDCA 2H09A 1LDJA 5D6FA 2K4BA 1ZH5A 1W7PB 2A68F 2E7WA 2UXNA 4GXOA 3FXQA 2PFBA 5JFRA 1XD7A 1LNWA 4U0WA 5L3BA 4AWXB 2EV0A 3T0YA 4YG2F 1LDKB 2XUBA 1UHMA 1D3YA 3VEPA 6PAXA 4HDUA 4LMYA 3QAHA 4YFXF 4WCGA 2EA4A 4ZH4F 3N4MA 2D45A 1J5YA 1ZG3A 4CYDA 1TQMA 1GVJA 1J2XA 4I7HA 3LFKA 1RZ4A 4L9NA 3GYHX 4A6EA 5CVJA 2EV5A 5HS7A 2W25A 1HQCA 4CXFA 4PZJA 1HW2A 5E1WA 3O6BB 3V8JA 1EH7A 3F6OA 1J59A 1ON1A 4HLXA 2C6YA 1TQIA 4MNUA 1FYKA 2HTSA 2QM3A 1T6SA 2VE9A 1JE8A 2FOKA 2VBZA 1FY7A 2GZWA 4HLYA 4G6QA 3IRQA 1OR7A 5CVUA 2XAJA 3T8TA 3VB2A 1KU2A 2FF4A 3LWFA 5ERIA 2ZCWA 3H3ZA 5LGTA 2CSOA 2QUFA 4OMZA 3HRTA 1S7AA 2F5FA 2ISZA 4MEYF 2KIFA 3GVAA 1ZRFA 2EWNA 2GA2A 2F5DA 2GAUA 3L09A 2OQRA 4KIGA 2QQBA 4MTEA 1ZYRF 4P55A 1MDMB 1FWZA 1UCRA 3SZPA 1SFUA 3BROA 5LHGA 1ZRDA 1FBSA 2OA4A 4ESJA 2BV6A 3WTZA 1FT9A 5K5RA 4U0YA 2HYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIO F;  1ODD A;  2K02 A;  3E97 A;  1LEA A;  2OZU A;  2O03 A;  1RUN A;  1RI7 A;  2MH9 A;  1Z91 A;  1RUO A;  2IPQ X;  3GEZ A;  5AON A;  3GFI A;  1U5T C;  2LF7 A;  2PI0 A;  3Q9V A;  3JAM K;  1FPQ A;  3N97 A;  2VOP A;  1ZLK A;  2WV0 A;  3HOT A;  5J8C A;  4WXC A;  1QZZ A;  3GFM A;  4G7H F;  2WC2 A;  4I98 B;  2KIU A;  4RGS A;  5JR3 A;  1KQ0 A;  1GXP A;  3QP6 A;  5A2Q K;  3JTG A;  2L54 A;  1BC7 C;  1WSU A;  1TLH B;  1QNT A;  3LAP A;  5BS6 A;  4O3M A;  4I02 A;  2VT2 A;  4XRF A;  4Y13 A;  3GW2 A;  4U7D A;  1GHC A;  1ZHF A;  2V1D A;  2MA3 A;  3LAJ A;  3GX4 X;  1F9N A;  4RAZ A;  1F5T A;  4HQE A;  1KGS A;  5FLX Z;  3WG9 A;  2EFN A;  2XAS A;  2EK5 A;  3EDP A;  1HKQ A;  3SFZ A;  5KVR A;  4G8X A;  4RB3 C;  4EJU A;  3ZN1 A;  4H0E A;  5CVR A;  2RDP A;  1W5S A;  3IKV A;  1OYI A;  2ZME B;  2VE8 A;  1G3S A;  3HTS B;  3E5X A;  2L4M A;  3RPU A;  1KYW A;  4HBL A;  4UVC A;  2MC3 A;  1R23 A;  3QU3 A;  3KEQ A;  2ZNY A;  3LQR A;  1XGO A;  2MD5 A;  3M9A A;  3CUQ A;  2UXX A;  4P5O A;  4WWC A;  3JTH A;  2G9W A;  3KET A;  1SFE A;  4ASN A;  3LQQ A;  1DUX C;  3DFG A;  1U78 A;  5FLX K;  1JHF A;  3EET A;  1MGT A;  4G7Z F;  2GQQ A;  2XAQ A;  3FMR A;  1R1T A;  2FXA A;  4EJT A;  5LLQ A;  3GFL A;  1BOA A;  1IAW A;  2COM A;  1MDM A;  5DDG A;  4D0P A;  5DCF A;  3K69 A;  3EYY A;  2HS5 A;  3IWF A;  2L4A A;  1CGP A;  2PLY A;  4EMS A;  1MJ9 A;  3LST A;  4ENJ A;  3M8F A;  2EFP A;  2ZFW A;  2VC0 A;  1OYY A;  1O57 A;  3W6K B;  1IN8 A;  2A6E F;  1YW9 A;  5DD8 A;  3CTA A;  2IA1 A;  4AVP A;  4N9H A;  4AD9 A;  1USS A;  2IA2 A;  3QP5 A;  2QLZ A;  3FM3 A;  5DV5 A;  4RB2 C;  1QPM A;  4L5I A;  5DYM A;  2KJC A;  3ZMU A;  2P5V A;  3BJO A;  4EJV A;  1OKR A;  3DF8 A;  1CF7 A;  1I27 A;  4DQ2 A;  2EV6 A;  4ESF A;  1BI2 A;  2HZT A;  4KN7 X;  5BQT A;  2IVM A;  1REP C;  4UUV A;  3HSF A;  3FMQ A;  5LRR A;  1XSD A;  5ICE A;  2FMY A;  5K5Q A;  1BC8 C;  3AAF A;  3CLO A;  2F5C A;  2FBI A;  3C3W A;  4Y17 A;  1IXR C;  3J81 K;  3GZ6 A;  4RGR A;  2QWW A;  1H0M A;  1HKT A;  5L3E A;  5TRD A;  4P96 A;  2VOO A;  3FM5 A;  1ONV A;  3R0A A;  2CFX A;  2XAG A;  2V9V A;  3HUG A;  3NRV A;  2B0L A;  2J5P A;  2XRO A;  5E18 F;  5J8F A;  1U3E M;  4CDG A;  1P2F A;  4A2U A;  3B73 A;  3I59 B;  4WXH A;  3ZMV A;  3C18 A;  1IXS B;  1T2K A;  3K1N A;  1J0R A;  4YFK F;  4OIN F;  3SXY A;  2QEN A;  3BPV A;  2XRN A;  3RIR A;  2LSO A;  4I0A A;  1IW7 F;  1E17 A;  1ZGA A;  5ILS A;  3ZN0 A;  2D1V A;  4HF1 A;  2E7X A;  3V7R A;  2LF8 A;  2BEO A;  1R22 A;  2J5O A;  5LHH A;  1VTN C;  4IHT A;  1BM9 A;  2DQR A;  1FOK A;  4HZF A;  4HX4 A;  2VC1 A;  4M6Y A;  2YU3 A;  5FB2 A;  2CYY A;  2EFW A;  3KP4 A;  4MTD A;  5LEJ A;  2NNY A;  1XDS A;  4BYY A;  5IT9 Z;  1Z6T A;  3KLN A;  2DQL A;  5LBQ A;  3KE2 A;  3RI4 A;  4WXD A;  1UST A;  3E5Q A;  3SZT A;  3GWZ A;  3F8F A;  4DNC A;  5BOX A;  4ZYD A;  2HOE A;  4ENN A;  3ELK A;  1WWX A;  3HRS A;  2O6G E;  2XAF A;  5CJ9 A;  2VN2 A;  4ENK A;  1BI0 A;  5CVI A;  1R00 A;  1L0O C;  2CG4 A;  4OIQ F;  3MZH A;  1FSH A;  2P5K A;  1UHW A;  2JSC A;  1D5V A;  4HQM A;  1HBX G;  2STT A;  2IP2 A;  1TTY A;  4A0X A;  1W7P D;  5LHI A;  4KN4 X;  2ESN A;  3I0T A;  3I71 A;  3HHH A;  4QLC U;  2ACJ A;  4BHP A;  2ETH A;  1XSV A;  5L3F A;  3Q9S A;  1L3L A;  2OBP A;  3W6J B;  1XDU A;  2YR2 A;  1IXC A;  1OMI A;  1R5H A;  5HDK A;  2TDX A;  5AIP A;  3CUQ C;  1KU9 A;  1GXQ A;  1AOY A;  2H6C A;  3I53 A;  2PJP A;  3V8L A;  1CF7 B;  1SD7 A;  3R6S A;  2DK5 A;  3P9K A;  4OIR F;  1SD4 A;  3MZY A;  4AIK A;  4L18 B;  1ZRC A;  1MJB A;  4KDP A;  2DT5 A;  4FX0 A;  5A2Q Z;  4MEX F;  4LK1 F;  4HV5 A;  1T39 A;  1G3W A;  5F64 A;  1KYZ A;  2HQR A;  5D5U B;  1B9M A;  1ZLJ A;  2PMH A;  3FWE A;  1O7L A;  4XSZ F;  1FSE A;  1JXS A;  1SMT A;  3M8E A;  1P4W A;  1XSX A;  2EFQ A;  2PEX A;  5HVQ C;  3GFJ A;  3Q5F A;  1J75 A;  3ERE D;  3NEU A;  4PGH A;  5CYV A;  2P5L C;  3O3K A;  2Y0M A;  4UHT A;  4FHT A;  4G7O F;  4E70 A;  2W84 A;  3D5L A;  2JZY A;  3DXJ F;  5K5O A;  3KZZ A;  2Q2E A;  5FD5 A;  1QBJ A;  3MAJ A;  2KJB A;  3BPX A;  1BIB A;  3WTW C;  3BDD A;  3WGG A;  5CVV A;  3ZMD A;  3IC7 A;  4OU0 A;  2HKO A;  1UFM A;  1U5T A;  1YLF A;  1J7K A;  4IXA A;  3I64 A;  5K1Y A;  2R7D A;  1PP7 U;  3FF5 A;  3K0L A;  2E1N A;  4U7B A;  3ZP5 A;  2H94 A;  4Z2Y A;  5FGM A;  3DEU A;  3ZQ7 A;  1LJ9 A;  1PUE E;  3DPT A;  3HSR A;  4GYI A;  5FD6 A;  2XAH A;  4G6D A;  1RNL A;  2R3S A;  3T1B A;  1B1B A;  3L7W A;  4ON0 A;  1TBX A;  1LQ1 A;  4KA4 A;  2ZME A;  3IWZ A;  1A04 A;  2JT1 A;  1STZ A;  4KIC A;  2GA1 A;  2IJL A;  5D5W B;  3KLO A;  1Z1D A;  2EFO A;  3IHU A;  4HDV A;  4S05 A;  3K2Z A;  3M7G A;  1BI1 A;  2RV8 A;  4HF0 A;  4XLN F;  5HDN A;  1P4A A;  3CO7 C;  3O2P E;  1BI3 A;  2FEZ A;  5E8I A;  1F4K A;  2HKX A;  4EGY A;  1K78 B;  2O0Y A;  3KFW X;  4A12 A;  1U8R A;  1D8J A;  1HXD A;  3KCC A;  3HOS A;  4M72 A;  5F6F A;  2KKO A;  4IRI A;  2OD5 A;  1H9T A;  1TW3 A;  2Z99 A;  1AWC A;  4UXN A;  2E1C A;  4F7Z A;  3ABT A;  2Z5U A;  1FZP B;  1XGS A;  4M9S A;  4N0B A;  2HWV A;  2VBX A;  3S2W A;  1ZAO A;  4HX8 A;  1Q1H A;  4M71 A;  1EH8 A;  2V1X A;  2RNJ A;  4I01 A;  4HYE A;  3KP2 A;  4BH9 A;  5L3C A;  1TNT A;  3E6D A;  2KIM A;  4KMU X;  4KUM A;  4LLG F;  5D8L B;  1O3R A;  4YFN F;  4EM0 B;  4A5M A;  3F8B A;  3ECO A;  4LLL A;  3FHZ A;  5H20 A;  1H9G A;  1K7A A;  2YX7 A;  4JQF A;  3LA3 A;  3LA2 A;  3F3X A;  3TDZ C;  3L2C A;  2NNN A;  5D4S A;  1XMA A;  4NHJ A;  3TGN A;  1WRJ A;  3VFZ A;  3HYI A;  1U5T B;  2BBY A;  2NS0 A;  2VT3 A;  4U88 A;  1U6G A;  4IVN A;  2MH2 A;  4EJW A;  2CO5 A;  3VOE A;  4ZYG A;  3HRU A;  4RGX A;  5E8G A;  2RGV A;  1MD0 A;  4IJA A;  1W4M A;  1R36 A;  3VOD A;  3MWM A;  2FQ3 A;  3SHF A;  3BWG A;  2PN6 A;  2DW4 A;  2HFH A;  2IW5 A;  1T98 A;  2O8X A;  2OU2 A;  2W57 A;  2RC4 A;  5LGU A;  3WGH A;  2HTJ A;  4LK0 F;  3REO A;  3ZMT A;  4HW0 A;  3IL2 A;  2DAO A;  3B02 A;  4GYG A;  3U9G A;  4I09 A;  4IRH A;  3RJP A;  1U2W A;  2F2E A;  2BE5 F;  4RS8 A;  1B9N A;  2ESH A;  3I54 A;  1YS6 A;  1KU7 A;  1JGS A;  1R58 A;  1FBU A;  1V4R A;  3H3U A;  2EB7 A;  2VBY A;  3GZ5 A;  3V4G A;  5TJJ A;  3MFK A;  1W5T A;  1W7P A;  3FMS A;  2CW0 F;  1Y0U A;  1LB2 A;  3WE3 A;  2ZXJ A;  3I59 A;  1R1V A;  1FC3 A;  2L02 A;  4R1H A;  4IHS A;  2HQN A;  2YPR A;  2YX4 A;  5E1X A;  3GO5 A;  1DP7 P;  3ULQ B;  1E2X A;  3WU1 B;  2FU4 A;  2W85 A;  3GXO A;  1I5Z A;  3D0S A;  4EGZ A;  2O3F A;  4PCQ A;  5D5X B;  2LKP A;  3RKY A;  3MQ0 A;  4BHC A;  3IRR A;  2IA0 A;  4P9F A;  1I1G A;  4R79 A;  4ZYH A;  3BOQ A;  2X0L A;  5HS9 A;  2H27 A;  2ADU A;  2Z9O A;  1BJA A;  2V1U A;  4M73 A;  2MLK A;  5D8K B;  4BXU A;  2VOD A;  1FNN A;  4WF2 A;  4Q47 A;  2DTR A;  5DEQ A;  3RKX A;  1RIO H;  1IF1 A;  5HOO A;  3RKW A;  4Q5S F;  4M6X A;  3ROU A;  1I1S A;  1F1Z A;  1QGP A;  2YSR A;  1Z7U A;  4L0Z B;  5JHU A;  2AS5 F;  1QO0 D;  4EM1 A;  3RTR A;  5E1Z B;  2QZ8 A;  3WE2 A;  4KIB A;  4OOI A;  2A69 F;  3PFI A;  1K6O A;  5ICC A;  1ZAR A;  3V7C A;  1S3J A;  2XHK A;  1SAX A;  4KNY A;  3DQV C;  3FXR A;  2V6C A;  3BP8 A;  5ICG A;  4LD5 A;  3GF2 A;  5DUI A;  4A5N A;  4ZZD A;  4KFC A;  2FSW A;  1XN7 A;  4XSX F;  2P7C B;  3FX3 A;  1DPR A;  1YW8 A;  4UV9 A;  1XGN A;  2Y75 A;  2W24 A;  3G3Z A;  5DCM B;  2IRF G;  1S6L A;  3E6C C;  5EEH A;  1YQA A;  1P6R A;  1JHH A;  4IRG A;  2Q8K A;  4EV0 A;  1ZGJ A;  5E17 F;  1HW1 A;  5ICF A;  1K79 A;  5H6Q A;  1SD6 A;  3CUQ B;  2QQA A;  3P9I A;  3DPL C;  4M9Z A;  4JK1 X;  3TOA A;  2DBB A;  4M9X A;  3J81 Z;  5D6E A;  3I4P A;  3P7N A;  3ISP A;  4PDK A;  2M45 A;  3T8R A;  1QQI A;  2JRT A;  2LDU A;  2HGC A;  3COA C;  2FRH A;  3TDU C;  2PMU A;  5JVT A;  4A0Z A;  1ZG1 A;  1SD5 A;  3JAM Z;  4GGG A;  1MKM A;  3DV8 A;  4KYW A;  2QYO A;  3V8K A;  3WTV C;  1P4X A;  3PQK A;  1PDN C;  3TOB A;  2ZJ2 A;  3R60 A;  3K1P A;  2CGP A;  2O61 A;  2ISY A;  4Q48 A;  3BJ6 A;  1R5G A;  2V79 A;  4YII A;  4ESB A;  3KZY A;  1C0W A;  2ZO4 A;  2DI3 A;  2CWE A;  1LDD A;  4LLN A;  2DFI A;  1KA8 A;  3WTU C;  1TQP A;  2D1H A;  3MEX A;  3V7S A;  3RPQ A;  5JI6 A;  2P8T A;  1WI9 A;  2ZBK A;  4BQA A;  3ZMZ A;  2UZK A;  1KQ9 A;  5FFX A;  3C1D A;  4ETS A;  4UNO A;  3I5U A;  1O7F A;  1B6A A;  2D2W A;  4B8X A;  2M1B A;  3ZMS A;  2JPB A;  4L9J A;  4I0B A;  2ZNZ A;  1HST A;  5HLG A;  1R7J A;  4LJZ F;  1ZG5 A;  2X4H A;  1YFH A;  1BN5 A;  4YIF A;  2EA2 A;  3RDI A;  4L0Y B;  4XBF A;  4AIJ A;  1S7O A;  4NB5 A;  4BNC A;  3QPH A;  2GWR A;  3F22 A;  1OPC A;  4ENM A;  2PBI A;  1MJA A;  2NAZ A;  3J80 K;  3BY6 A;  1YS7 A;  2A07 F;  1BBY A;  3F8N A;  3TKY A;  5L3D A;  3HRM A;  1OYW A;  4EM2 A;  3P9C A;  3NQO A;  1X3U A;  3R61 A;  4EQQ A;  4S04 A;  3E6M A;  2A3S A;  3HTU A;  4K2E A;  4IF4 A;  2FBK A;  3WTT C;  2DU9 A;  4CO8 A;  2PQ8 A;  4LFU A;  2OQG A;  1MZB A;  4LB5 A;  3J7A O;  2IT0 A;  4CHU A;  3CDH A;  5DCM A;  3F8M A;  3WTX C;  1SMY F;  4HA8 A;  1YIO A;  4JBA A;  1YW7 A;  2ZKZ A;  5HS8 A;  4OIP F;  3DP7 A;  2P4W A;  3KEO A;  4HF2 A;  2JTV A;  2MLG A;  3WTY C;  4R8H A;  4P9U A;  2XIG A;  3CJN A;  3GLX A;  1IN5 A;  4PGG A;  2A6H F;  3F6V A;  1IRG A;  3LA7 A;  1FLI A;  3DKW A;  1G3Y A;  4N9I A;  4LG0 B;  4AIH A;  4BHB A;  2DO7 A;  1DPU A;  1TW2 A;  3K9T A;  1HW5 A;  5FFZ A;  1Z05 A;  5BMZ A;  3EUH A;  5BPD A;  4MQV A;  2HYG D;  5LRS A;  2P6T A;  3OV8 A;  4CIC A;  1NHA A;  2PG4 A;  4UVA A;  1Z9C A;  2GIV A;  3PQJ A;  5F1R A;  4L9V A;  4IPA A;  1XCB A;  5FO5 A;  5ILV A;  4HX7 A;  4GO1 A;  3JSP A;  1IUY A;  2RKH A;  3JSO A;  4KMF A;  1BIA A;  1XGM A;  4RB1 A;  4UVB A;  3ABU A;  1FX7 A;  4BAY A;  3HHG A;  3MCZ A;  2AXL A;  1FYM A;  2DLL A;  2M30 A;  1XCV A;  4OMY A;  4G9Y A;  2BYV E;  4MQ9 F;  4ZYE A;  1HKS A;  2XKO A;  3KP3 A;  2RVC A;  1YG2 A;  3L00 A;  3F21 A;  3FZV A;  2FA5 A;  2XKP A;  2XV4 S;  1T0F A;  1LVA A;  1P92 A;  5HLI A;  1SFX A;  2P6S A;  2FE3 A;  3KP6 A;  1B59 A;  3U2R A;  3E3V A;  2Z33 A;  4UV8 A;  1IN6 A;  1O3Q A;  1G4D A;  3E5U A;  5H6R A;  4Q4Z F;  4RB0 A;  3BJA A;  4GCV A;  2NYX A;  1HSJ A;  2A5Y B;  2FBH A;  2HR3 A;  1T38 A;  2K27 A;  2VON A;  2WWY A;  3TQN A;  4RGU A;  3K1M A;  4B09 A;  3G73 A;  4WX9 A;  3QRF F;  3ECH A;  3TO6 A;  1YYV A;  2RN7 A;  3HSE A;  2H6B A;  3T5X A;  1ULY A;  2G7H A;  3F72 A;  2RQP A;  1EV7 A;  2DK8 A;  1O3S A;  2QBY B;  2XGX A;  5EEG A;  2F5E A;  2DPD A;  4A0Y A;  4LG0 A;  2G7U A;  2HEO A;  5E20 A;  1R1U A;  1Z6R A;  5ILU A;  3OOP A;  1IZ1 A;  1UB9 A;  4TV7 A;  4O5V A;  2M8E A;  1G3T A;  4MHG A;  2EJR A;  4NQW A;  4O6J A;  1S8N A;  3CO6 C;  2Y48 A;  1KU3 A;  2M5W A;  3ML6 A;  2OAZ A;  4EJO A;  3GUD A;  3KP7 A;  1XB4 A;  3M1E A;  5L3G A;  5DUK A;  4HV6 A;  3TO9 A;  1IN4 A;  2XVC A;  1D8K A;  2QVO A;  2Z3Y A;  2L3D A;  2FNP A;  4G94 A;  3QPT A;  3QU6 A;  5KK1 A;  2VBW A;  3IKT A;  1XMK A;  2K4J A;  1LEB A;  1ZN2 A;  4LB6 B;  1B4A A;  4LGW A;  4WK8 F;  3H92 A;  4M74 A;  3WGI A;  2NRA C;  4I2O A;  1ON2 A;  5HDG A;  2R7F A;  4MGR A;  4KIF A;  3I58 A;  1YTY A;  5HLH A;  3ZPL A;  3FXU A;  2FNA A;  5IT3 A;  1WQ2 A;  3EQL F;  2MBF A;  5IT9 K;  1O3T A;  1EH6 A;  3QOP A;  4EVI A;  2WTE A;  2Q0O A;  3JW4 A;  3F23 A;  4CGZ A;  1YO5 C;  3CUO A;  1FP1 D;  2BGC A;  1V3F A;  1WKM A;  3WU0 A;  2LNB A;  3HIF A;  4L5J A;  3RYP A;  2STW A;  2OZ6 A;  3U1D A;  2K7L A;  1DDN A;  1J9I A;  3RYR A;  1FP2 A;  4FX4 A;  4FT8 A;  3E6B A;  2A61 A;  3BZ6 A;  2QBY A;  3J80 Z;  2JPC A;  3SQN A;  4CZZ A;  1KQ8 A;  5AIQ A;  3R0J A;  4U0V A;  4Y15 A;  2QQ9 A;  1IRF A;  2GXB A;  3EYI A;  2UWM A;  2KRF A;  1FBQ A;  1ZRE A;  3WOD F;  1G6N A;  2CQK A;  2GXG A;  5DD4 A;  1IN7 A;  4QWQ A;  5LEK A;  4HOB A;  4L9T A;  5D5V B;  5CLS A;  3F8C A;  2M87 A;  5LGN A;  1S29 A;  3L9F A;  5J6X A;  2FML A;  1TNS A;  3C7J A;  2P7V B;  4A6D A;  1FYL A;  1I6X A;  4KT5 C;  4RAY A;  3KP5 A;  4XLP F;  2ELH A;  4ZZL A;  2VXZ A;  3WTS C;  4HAM A;  3TO7 A;  5ED4 A;  3R4K A;  2L01 A;  1QZY A;  2K86 A;  5D4R A;  2DPU A;  1PP8 F;  5BPI A;  1K78 A;  2HDC A;  2H09 A;  1LDJ A;  5D6F A;  2K4B A;  1ZH5 A;  1W7P B;  2A68 F;  2E7W A;  2UXN A;  4GXO A;  3FXQ A;  2PFB A;  5JFR A;  1XD7 A;  1LNW A;  4U0W A;  5L3B A;  4AWX B;  2EV0 A;  3T0Y A;  4YG2 F;  1LDK B;  2XUB A;  1UHM A;  1D3Y A;  3VEP A;  6PAX A;  4HDU A;  4LMY A;  3QAH A;  4YFX F;  4WCG A;  2EA4 A;  4ZH4 F;  3N4M A;  2D45 A;  1J5Y A;  1ZG3 A;  4CYD A;  1TQM A;  1GVJ A;  1J2X A;  4I7H A;  3LFK A;  1RZ4 A;  4L9N A;  3GYH X;  4A6E A;  5CVJ A;  2EV5 A;  5HS7 A;  2W25 A;  1HQC A;  4CXF A;  4PZJ A;  1HW2 A;  5E1W A;  3O6B B;  3V8J A;  1EH7 A;  3F6O A;  1J59 A;  1ON1 A;  4HLX A;  2C6Y A;  1TQI A;  4MNU A;  1FYK A;  2HTS A;  2QM3 A;  1T6S A;  2VE9 A;  1JE8 A;  2FOK A;  2VBZ A;  1FY7 A;  2GZW A;  4HLY A;  4G6Q A;  3IRQ A;  1OR7 A;  5CVU A;  2XAJ A;  3T8T A;  3VB2 A;  1KU2 A;  2FF4 A;  3LWF A;  5ERI A;  2ZCW A;  3H3Z A;  5LGT A;  2CSO A;  2QUF A;  4OMZ A;  3HRT A;  1S7A A;  2F5F A;  2ISZ A;  4MEY F;  2KIF A;  3GVA A;  1ZRF A;  2EWN A;  2GA2 A;  2F5D A;  2GAU A;  3L09 A;  2OQR A;  4KIG A;  2QQB A;  4MTE A;  1ZYR F;  4P55 A;  1MDM B;  1FWZ A;  1UCR A;  3SZP A;  1SFU A;  3BRO A;  5LHG A;  1ZRD A;  1FBS A;  2OA4 A;  4ESJ A;  2BV6 A;  3WTZ A;  1FT9 A;  5K5R A;  4U0Y A;  2HYF A; 
#chains in the Genus database with same CATH topology
 2E2H J;  3FBI B;  4OIO F;  2WV1 A;  1ODD A;  2K02 A;  2E34 A;  3SDB A;  1U0J A;  1HLV A;  3E97 A;  1DU0 A;  2OJE D;  1LEA A;  3CCL I;  1YRN B;  1OCZ H;  2OZU A;  4CZC A;  2CH0 A;  3E1S A;  2O03 A;  3PNV A;  1RUN A;  1RI7 A;  2NOJ B;  2MH9 A;  4LIV A;  2VLA A;  2CUJ A;  1Z91 A;  2VAS A;  5GTH C;  1RUO A;  2IPQ X;  5FKL A;  3M3Y J;  4EEF G;  1T56 A;  3GEZ A;  2DMT A;  5AON A;  3GFI A;  1U5T C;  2LF7 A;  2PI0 A;  2KT0 A;  2LKS A;  3X2Q H;  3Q9V A;  3JAM K;  1YX3 A;  3CJR B;  1RPW A;  1NH3 A;  3QOE A;  1FPQ A;  1YIT I;  3N97 A;  3OYI A;  1MBE A;  2B63 J;  3S16 J;  2VOP A;  1ZLK A;  4XMY A;  1DGR M;  2IS1 A;  2WV0 A;  3HOT A;  2M7A A;  5J8C A;  1YI2 I;  4WXC A;  2AO9 A;  1QZZ A;  2M9H A;  2EH3 A;  3GFM A;  5EG0 A;  3OIO A;  1OFC X;  4G7H F;  5KCM A;  3JRI A;  2WC2 A;  4I98 B;  2KIU A;  3DTK A;  4RGS A;  5J40 A;  5JR3 A;  3HOX J;  1KQ0 A;  1GXP A;  3QP6 A;  3BR1 A;  3CD6 I;  1W1W E;  1PJR A;  5A2Q K;  3JTG A;  2EZH A;  2L54 A;  1JTX A;  1BC7 C;  1WSU A;  4E7Z A;  2R7T A;  1TLH B;  2BVL A;  1BL0 A;  4BL0 B;  1QNT A;  3LAP A;  5BS6 A;  4O3M A;  1WZ2 A;  4I02 A;  2VT2 A;  2PJR B;  4XRF A;  4Y13 A;  3OYN A;  3GW2 A;  4U7D A;  2E2J J;  3I4M J;  4IHW A;  1R4N B;  3CME I;  1T0F C;  4RMN A;  1GHC A;  3L2U A;  1ZHF A;  2V1D A;  2MA3 A;  3LAJ A;  1MMG A;  4A3D J;  2DA4 A;  3GX4 X;  1F9N A;  1TWF J;  4RAZ A;  2DMU A;  4ZDL A;  1F5T A;  3OYC A;  4HQE A;  2HXI A;  1KGS A;  2M7B A;  4V2F A;  5KAI C;  3WG9 A;  5FLX Z;  5H2F C;  3K6G A;  2EFN A;  1OJL A;  2XAS A;  4LG3 A;  2EK5 A;  3EDP A;  5EF6 A;  3RZO J;  1HKQ A;  2JQ7 A;  1U9O A;  2XDV A;  1MSF C;  3SFZ A;  5KVR A;  4G8X A;  1XTA A;  4RB3 C;  4EJU A;  3QQA A;  3CCR I;  4XR6 A;  3ZN1 A;  4HEA 2;  1VI0 A;  1WJ5 A;  4H0E A;  1T8I A;  3HZJ A;  1TWC J;  5CVR A;  2A05 A;  2EIJ H;  3ZQG A;  2RDP A;  1ZR2 A;  1JUM A;  1W5S A;  3IKV A;  1OYI A;  2ZME B;  2VE8 A;  2VQG A;  2K40 A;  1GLN A;  1G3S A;  2PMZ N;  3OMY A;  3HTS B;  3E5X A;  2L4M A;  2W7N A;  3RPU A;  3ASN H;  1JT0 A;  3PM1 A;  2VIX A;  2KHM A;  1KYW A;  1MNE A;  4HBL A;  4UVC A;  2MC3 A;  4HPQ A;  1R23 A;  5M5W J;  3QU3 A;  3KEQ A;  4BEH A;  2ZNY A;  2FD5 A;  5KHD A;  3EUK L;  1K83 J;  4UY8 I;  3OL4 A;  3LQR A;  1XGO A;  1EJ9 A;  2HOT A;  2MD5 A;  3M9A A;  3CUQ A;  2UXX A;  4P5O A;  2OV7 A;  4WWC A;  3JTH A;  4DYR A;  2MC4 A;  3BCA A;  2G9W A;  3DLL F;  1Y39 A;  2CV2 A;  4HST A;  1T08 B;  3KET A;  1SFE A;  3OYL A;  3SFI A;  4A3M J;  4ASN A;  3LQQ A;  4AUX A;  4P1W A;  1DUX C;  5E79 C;  1T95 A;  1FIP A;  3SEZ A;  4AYB N;  3DFG A;  3B6C A;  1U78 A;  3S15 J;  3OY9 A;  5FLX K;  2N8G A;  1JHF A;  1X4O A;  5EGO A;  3EET A;  1MGT A;  4G7Z F;  3S2H J;  3L2V A;  2GQQ A;  5JVG F;  4FCY A;  2XAQ A;  3IV5 A;  2HZD A;  5GPA A;  3FMR A;  1R1T A;  2FXA A;  5K7Z A;  2JA8 J;  4BJ5 C;  1NG7 A;  3FXK A;  4EJT A;  2FQ4 A;  5LLQ A;  3GFL A;  3W2A A;  4AM3 A;  1TL8 A;  1BOA A;  1IRX A;  1IAW A;  2F4O B;  1ETO A;  2COM A;  3CJT B;  1MDM A;  5DDG A;  4Y7N J;  4D0P A;  3UKG A;  5DCF A;  3Q0U A;  4NQW B;  3JRC A;  5IYD J;  1VQP I;  3BG9 A;  2K85 A;  3K69 A;  3M07 A;  3EYY A;  4J00 A;  2HS5 A;  3IWF A;  2L4A A;  1CGP A;  4A3B J;  2PLY A;  2DJN A;  4EMS A;  1MJ9 A;  3LST A;  1OLT A;  4ENJ A;  2BY1 A;  1X4P A;  3M8F A;  1BW5 A;  2EFP A;  1MBK A;  2XSD C;  5F08 A;  2ZFW A;  2VC0 A;  2DJI A;  3BTI A;  3LOC A;  1OYY A;  1O57 A;  1NK3 P;  3W6K B;  1YIJ I;  2ZC2 A;  1IN8 A;  2A6E F;  1YW9 A;  5DD8 A;  3CTA A;  2IA1 A;  1WJC A;  2CFO A;  4AVP A;  1VQN I;  3BCB A;  4N9H A;  4AD9 A;  2TRT A;  5LFA A;  1USS A;  2IA2 A;  1VND A;  3QP5 A;  3W2V A;  3OS0 A;  2QLZ A;  3FM3 A;  5DV5 A;  2R5Y B;  4B47 A;  2V6E A;  1VQO I;  4RB2 C;  1QPM A;  1NG6 A;  4L5I A;  2XGC A;  5DYM A;  1A36 A;  3FIS A;  2KJC A;  3ZMU A;  3M4O J;  3OS2 A;  1K6Y A;  2P5V A;  3OYA A;  2DOE A;  3BJO A;  4EJV A;  1DQU A;  3V42 A;  2NXN B;  3TW6 A;  1OKR A;  3DF8 A;  1YJ9 I;  3G1O A;  1CF7 A;  1I27 A;  4DQ2 A;  2EV6 A;  4ESF A;  1BI2 A;  4KIS A;  3VPR A;  2HZT A;  3HBL A;  2JN6 A;  4KN7 X;  3IAM 2;  2EZL A;  3IP4 B;  4UUS B;  5EZG A;  5BQT A;  2IVM A;  1Z7L A;  4PJN A;  1HCR A;  1REP C;  4UUV A;  2IS6 A;  3QPL A;  3HSF A;  3BG3 A;  3FMQ A;  1FJL A;  2B7E A;  5LRR A;  1JKP C;  1XSD A;  3DEW A;  1YE9 A;  4XKC A;  5ICE A;  2ZSH B;  4DW6 A;  1QHH D;  1WPK A;  3VYT B;  2FMY A;  5K5Q A;  1BC8 C;  2ECB A;  4E7S A;  1AHD P;  3AAF A;  5F0F A;  3CLO A;  3GTJ J;  2F5C A;  2FBI A;  3C3W A;  4Y17 A;  2B9S A;  1IXR C;  3K7A J;  3J81 K;  1H8A C;  5EDN A;  1FOY A;  2L9S A;  5GAH J;  4CA0 A;  3GZ6 A;  1VZ0 A;  4LIU A;  2CUE A;  4RGR A;  2WB1 A;  2QWW A;  4M3G A;  1H0M A;  4RBO A;  1HKT A;  2JUC A;  5FJ8 J;  5L3E A;  3W3C A;  1SVL A;  3DLA A;  5TRD A;  4P96 A;  2VOO A;  1W5C C;  1IDY A;  3FM5 A;  1ONV A;  3R0A A;  4XN0 A;  2CFX A;  1FIA A;  2XAG A;  2V9V A;  3HUG A;  3NRV A;  2ME6 A;  1W36 D;  1VQ8 I;  2B0L A;  4HNU A;  2J5P A;  1S72 I;  3H5N A;  2XRO A;  3W2W A;  5E18 F;  3PSF A;  3BR3 A;  5J8F A;  4CDG A;  1P2F A;  3CCQ I;  2VQC A;  4A2U A;  1U3E M;  4NC8 A;  3B73 A;  3H5A A;  3I59 B;  4WXH A;  1ETK A;  1X1C A;  3ZMV A;  3C18 A;  4BAC A;  1SC7 A;  1IXS B;  1T2K A;  3K1N A;  1J0R A;  4YFK F;  4IHY A;  3H9J A;  4OIN F;  2ZJR F;  3SXY A;  4Z6Y A;  2QEN A;  3PNY A;  3BPV A;  3J7A Y;  2XRN A;  3RIR A;  4E7H A;  2LSO A;  1F43 A;  1PUF A;  4I0A A;  1IW7 F;  1N75 A;  2FJ1 A;  1E17 A;  4JX4 A;  1ZGA A;  5ILS A;  3ZN0 A;  2D1V A;  4L5E A;  4J19 A;  4HF1 A;  5C44 J;  2NVU B;  2E7X A;  2M2E A;  1QVU A;  4NUB A;  2DCE A;  3L2Q A;  3V7R A;  3DEE A;  2LF8 A;  3QWL A;  2BEO A;  3JRG A;  1R22 A;  2QCO A;  1Z67 A;  2J5O A;  1JGG A;  5LHH A;  1VTN C;  1BM9 A;  4IHT A;  2DQR A;  3ZGK A;  1FOK A;  4HZF A;  4HX4 A;  2OF7 A;  1X2M A;  2GBY A;  1AA7 A;  1P9Q C;  3PL8 A;  4BBR J;  1AKH A;  3KYL A;  4U87 A;  1ETV A;  2VC1 A;  2EZI A;  2R7Q A;  3I56 I;  4M6Y A;  2YU3 A;  5FB2 A;  2CYY A;  1BA5 A;  2EFW A;  2EQR A;  3KP4 A;  3CLQ A;  5LEJ A;  4MTD A;  2NNY A;  3OSG A;  3OIP A;  1U9N A;  3A0H C;  1XDS A;  4BYY A;  5IT9 Z;  2DDA A;  3CC7 I;  2M0C A;  1Z6T A;  4FE7 A;  3KLN A;  2DQL A;  5LBQ A;  3KE2 A;  3RI4 A;  4WXD A;  1UST A;  3C2G A;  4GRI A;  1XPX A;  3E5Q A;  3SZT A;  4RLQ A;  3GWZ A;  2DOF A;  1P7J A;  3F8F A;  1ACI A;  4DNC A;  3JRB A;  5BOX A;  3TL4 X;  3MKW B;  4ZYD A;  2HOE A;  4ENN A;  3ELK A;  1WWX A;  3HRS A;  2JWT A;  1SVO A;  4XKW A;  2O6G E;  2I8D A;  2XAF A;  4B48 A;  5CJ9 A;  2VN2 A;  4ENK A;  1BI0 A;  1VQK I;  5CVI A;  4G12 A;  2BHY A;  1R00 A;  1L0O C;  2CG4 A;  2H1L A;  4ABZ A;  4CCJ A;  4OIQ F;  3MZH A;  2BY2 A;  1FSH A;  3M1C A;  3IUO A;  3TBI A;  2P5K A;  2ECC A;  4CUG A;  1UHW A;  2JSC A;  3BG5 A;  4HG2 A;  4HQM A;  1HF0 A;  3BC8 A;  1D5V A;  4JYK A;  1HBX G;  2STT A;  2IP2 A;  3ERM A;  4A93 J;  4NC7 A;  1TTY A;  2XPV A;  4A0X A;  1W7P D;  5LHI A;  3BTL A;  4KN4 X;  3LFU A;  2ESN A;  5GPC A;  3I0T A;  2IGO A;  3HHH A;  3I71 A;  4QLC U;  2EBI A;  2IAI A;  2H8R A;  2AQE A;  2ACJ A;  2QF7 A;  4BHP A;  2ETH A;  1D0X A;  5J4Y A;  1XSV A;  5L3F A;  4XLA A;  3Q9S A;  1L3L A;  2OBP A;  3W6J B;  1QPI A;  1XDU A;  2YR2 A;  1IXC A;  2GOM A;  1OMI A;  1R5H A;  3QYE A;  3WHB A;  4UB6 C;  5HDK A;  1TWG J;  1J09 A;  2TDX A;  3RQI A;  5AIP A;  3CUQ C;  1IC8 A;  4NNJ A;  4YEJ A;  1KU9 A;  2X51 A;  3H0G J;  1GXQ A;  1AOY A;  3ZCO A;  4II3 A;  2CQ7 A;  4IX7 A;  3CCM I;  3HKZ N;  2H6C A;  3PFY A;  3I53 A;  2PJP A;  3V8L A;  2GXA A;  1CF7 B;  1SD7 A;  2RQQ A;  3ZQL A;  3R6S A;  1VQ9 I;  2EIM H;  2DK5 A;  2DA1 A;  1N25 A;  2IBD A;  5F0H A;  2CRG A;  2BVM A;  3P9K A;  2XAU A;  4OIR F;  3E7L A;  1SD4 A;  2LR8 A;  3MZY A;  3RCO A;  1Z3Y A;  1OCP A;  5IP6 A;  4AIK A;  4L18 B;  1IG7 A;  3K4L A;  1ZRC A;  1MJB A;  4KDP A;  2DT5 A;  4FX0 A;  4W97 A;  5A2Q Z;  4MEX F;  4AU7 A;  4LK1 F;  2D5V A;  4HV5 A;  1T39 A;  1A5J A;  1R9T J;  1G3W A;  3VWB A;  4CCM A;  3PO2 J;  5F64 A;  1KYZ A;  2HQR A;  5D5U B;  3K4C A;  1B9M A;  1ZLJ A;  2K9Q A;  2PMH A;  3FWE A;  1O7L A;  4FET A;  4XSZ F;  2X6W A;  1FSE A;  4OWR B;  1JXS A;  1SMT A;  3M8E A;  1P4W A;  1XSX A;  4IZZ A;  2JRM A;  1VQ6 I;  2EFQ A;  2PEX A;  2H8W A;  3HUG B;  2MG4 A;  4RA2 A;  1ORK A;  5HVQ C;  2YU9 J;  3GFJ A;  4XOR A;  1S5L C;  3Q5F A;  1J75 A;  3JRF A;  2DA6 A;  2LBF A;  3ERE D;  3NEU A;  4PGH A;  3ESW B;  1AKH B;  3S3O A;  1DU6 A;  1RKW A;  5CYV A;  2P5L C;  4BXF A;  3HL2 A;  4BQN A;  3O3K A;  2Y0M A;  3BQY A;  5M3M J;  3CCY A;  4UHT A;  4FHT A;  1IV6 A;  4G7O F;  4BQQ A;  4E70 A;  1YHQ I;  1VQL I;  2HU9 A;  2W84 A;  2QKM B;  3D5L A;  4IQJ A;  2JZY A;  2Y0S N;  3DXJ F;  1MBJ A;  3OYE A;  1Z3X A;  3A03 A;  1UEL B;  5K5O A;  5CQG A;  3CMY A;  3KZZ A;  3UNG C;  2Q2E A;  2E1O A;  3QYF A;  5FD5 A;  3OYG A;  1QBJ A;  2Z16 A;  1MIJ A;  3MAJ A;  3O8H A;  2KJB A;  2BY3 A;  2JSP A;  1WH7 A;  3BPX A;  1HC8 A;  1BIB A;  3RZD J;  3WTW C;  3BDD A;  2DT7 B;  3WGG A;  5CVV A;  2HYJ A;  3ZMD A;  3RQ4 A;  1JT6 A;  3K70 D;  3IC7 A;  4OU0 A;  2HKO A;  1ETY A;  3G4S I;  1UFM A;  1WJD A;  3OSF A;  5IP9 J;  3MD2 A;  3GLL A;  1U5T A;  1YLF A;  1J7K A;  4IXA A;  3I64 A;  5K1Y A;  5J1Y A;  2R7D A;  4B43 A;  3BT9 A;  2E5N A;  2KRC A;  3FF5 A;  3K0L A;  2E1N A;  1PP7 U;  3FK6 A;  3J7Y J;  2V4J C;  4RAG A;  4U7B A;  3ZP5 A;  2H94 A;  4Z2Y A;  2EPF A;  2HXO A;  5FGM A;  2M0M A;  3S93 A;  2XC7 A;  1A6Q A;  3DEU A;  3ZQ7 A;  1LJ9 A;  2LY1 A;  4BUP A;  3QPS A;  1PUE E;  3DPT A;  4XOP A;  3HSR A;  4Y33 A;  4GYI A;  3CCU I;  5FD6 A;  1X1P A;  2XAH A;  4G6D A;  2CJJ A;  3MKY B;  4NC6 A;  3HPG A;  1RNL A;  1VQM I;  2R3S A;  3T1B A;  1B1B A;  3L7W A;  1PYV A;  4ON0 A;  1TBX A;  3FXM A;  3M8J A;  1LQ1 A;  4KA4 A;  1TT5 B;  2BW3 A;  2ZME A;  4C3J J;  3IWZ A;  1NK2 P;  1A04 A;  2JT1 A;  2CV1 A;  2XGD A;  1STZ A;  5FRN A;  2HDD A;  3HM5 A;  4KIC A;  3J7Z I;  2FOW A;  2GA1 A;  2IJL A;  5D5W B;  3KLO A;  1Z1D A;  2EFO A;  2L7M P;  2VJJ A;  3IHU A;  4HDV A;  1YJN I;  4S05 A;  3K2Z A;  3M7G A;  1B72 B;  1BI1 A;  2M4K A;  3OS1 A;  3H35 A;  2RV8 A;  2VJ4 A;  4HF0 A;  4XLN F;  2DMN A;  5HDN A;  1P4A A;  2DFH A;  2V9K A;  3CO7 C;  3CQZ J;  3O2P E;  1BI3 A;  4KT6 A;  2W00 A;  3OYK A;  2FEZ A;  5E8I A;  4X0G A;  1F4K A;  2HKX A;  4EGY A;  1OCT C;  1K78 B;  2O0Y A;  3KFW X;  4H4K C;  4A12 A;  3AL0 B;  1U8R A;  5TGT A;  1D8J A;  1HXD A;  2W4S A;  4FAS D;  3MKZ A;  4DYQ A;  2GOX B;  1R6R A;  3KCC A;  1OR7 C;  3HOS A;  4M72 A;  3EPZ A;  5F6F A;  2KKO A;  4IRI A;  2OD5 A;  1H9T A;  1TW3 A;  3GTP J;  2Z99 A;  1LFB A;  1AWC A;  4UXN A;  2E1C A;  4D7M A;  4F7Z A;  2LTP A;  3ABT A;  2Z5U A;  1FZP B;  1XGS A;  2QSG X;  2R7S A;  3TED A;  2KP6 A;  4M9S A;  4N0B A;  1S9H A;  2HWV A;  2VBX A;  3S2W A;  1Y8R B;  1ZAO A;  4HX8 A;  1Q1H A;  4M71 A;  4DJA A;  1EH8 A;  2V1X A;  1GT0 C;  2RNJ A;  4I01 A;  4HYE A;  5EZH A;  3KP2 A;  3FXJ A;  3NWS A;  2XB5 A;  4BH9 A;  5L3C A;  1K4S A;  1TNT A;  4BDZ A;  3E6D A;  2AHQ A;  3CZ6 A;  2KIM A;  4M3B A;  4KMU X;  4KUM A;  4LLG F;  1BJZ A;  5J47 A;  3G71 I;  5D8L B;  1SFO J;  1AU7 A;  1O3R A;  4D7N A;  4HRI A;  4YFN F;  3K4K A;  1TP4 A;  3LSM A;  4EM0 B;  4A5M A;  2BHZ A;  3F8B A;  5HNH A;  3ECO A;  4LLL A;  3FHZ A;  5H20 A;  3BR2 A;  1H9G A;  3OOU A;  1K7A A;  2YX7 A;  3LSH A;  4JQF A;  1ETQ A;  1G2H A;  3LA3 A;  3LA2 A;  4ZYA A;  2OCE A;  3F3X A;  4XOT A;  2K5C A;  3TDZ C;  2LY2 A;  2BOL A;  4AID A;  2HPM A;  1UHS A;  2Y9Y A;  3ZQI A;  1M1E B;  2HNH A;  2L7F P;  2NNN A;  2WBM A;  1XMA A;  5D4S A;  5FLM J;  3L2C A;  4NHJ A;  2NVT J;  3H3V K;  3HOV J;  2LY9 A;  3TGN A;  1WRJ A;  3VFZ A;  3HYI A;  1U5T B;  2BBY A;  2NS0 A;  2VT3 A;  3L1P A;  4U88 A;  1U6G A;  3NAU A;  4IVN A;  2MH2 A;  4EJW A;  5J3L A;  2LP0 A;  2DTZ A;  2F5V A;  5E3L A;  2CO5 A;  3VOE A;  4ZYG A;  3HRU A;  4RGX A;  5E8G A;  2KZV A;  2RGV A;  4X1E A;  1UG2 A;  4PJJ A;  2IXS A;  1LFU P;  1MD0 A;  1OQY A;  4IJA A;  1W4M A;  1R36 A;  3VOD A;  3MWM A;  2FQ3 A;  3SHF A;  3DU6 A;  3BWG A;  2PN6 A;  2DW4 A;  2HFH A;  2IW5 A;  1T98 A;  3OWT A;  3BG7 A;  2O8X A;  2OU2 A;  3LSR A;  3BZC A;  2W57 A;  4F92 B;  2RC4 A;  2F4M B;  5LGU A;  3WGH A;  3PUF A;  2HTJ A;  3G2B A;  4PJL A;  2VKD A;  4LK0 F;  3REO A;  3ZMT A;  3TMO A;  3ZR8 X;  2W48 A;  4HW0 A;  3IL2 A;  2DAO A;  1D1A A;  3B02 A;  2M8G X;  4GYG A;  1B8I A;  1ITY A;  3U9G A;  4EAT A;  4Y52 J;  4I09 A;  1QRY A;  4GFB A;  3S2D J;  5CKT A;  2JVH A;  4IRH A;  3RJP A;  1U2W A;  2F2E A;  2BE5 F;  4RS8 A;  1B9N A;  1RR8 C;  2ESH A;  3I54 A;  5JLX A;  4PSW A;  1YS6 A;  4QIW N;  1KU7 A;  1JGS A;  1R58 A;  1ZEL A;  3CF2 A;  1FBU A;  2LK2 A;  3PNT A;  2MGQ A;  2LD5 A;  1V4R A;  3S1Q J;  2LRD A;  3H3U A;  4ZDO A;  3MKL A;  2EB7 A;  2VBY A;  3GZ5 A;  3V4G A;  4PFO A;  1IRZ A;  3G1L A;  5TJJ A;  1WI3 A;  4BY7 J;  2OTL I;  3KYC B;  1SFK A;  3MFK A;  1W5T A;  5E3N A;  3AFH A;  1W7P A;  1BR4 A;  2XF5 A;  3FMS A;  2CW0 F;  1Y0U A;  2JA2 A;  3DCF A;  3U21 A;  3WE3 A;  1LB2 A;  2K3F A;  2ZXJ A;  3FHN A;  1XS9 A;  3HOY J;  3I59 A;  3S1M J;  1R1V A;  1FC3 A;  2L02 A;  4R1H A;  4NBQ A;  4IHS A;  2HQN A;  3ZQH A;  4ZJZ A;  4PK4 A;  3AG1 H;  2YPR A;  3FDY A;  2YX4 A;  5E1X A;  2BW3 B;  2LRE A;  3DKX A;  3GO5 A;  1E0E A;  1U8B A;  4QSH A;  2A5W A;  4V19 K;  1DP7 P;  4UUS A;  3EUA A;  1E3P A;  1QVT A;  4B3A A;  2EIK H;  1E2X A;  2HVQ A;  3ULQ B;  3WU1 B;  2JA7 J;  2FU4 A;  2V1N A;  2W85 A;  3GXO A;  1IV8 A;  5F27 A;  4XL9 A;  3GTM J;  1TZL A;  3MMY B;  1MBF A;  2DA2 A;  1I5Z A;  2R5Z A;  4N4N B;  3D0S A;  3LSI A;  4MFD A;  4EGZ A;  1IJW C;  2O3F A;  4PCQ A;  4AVZ A;  5D5X B;  3S14 J;  2LKP A;  3RKY A;  3MQ0 A;  4BHC A;  3IRR A;  2IA0 A;  2R7Z J;  5FLV A;  4P9F A;  3K2A A;  1I1G A;  5J1U A;  2L7K A;  4A3I J;  2EZK A;  2DFF A;  4R79 A;  1LKX A;  4ZYH A;  1EA3 A;  4IKF A;  1N78 A;  3BOQ A;  2X0L A;  4S0H B;  3LSG A;  5HS9 A;  4KJZ A;  4CYC A;  2H27 A;  2R7X A;  2ADU A;  2M34 A;  2GLO A;  2Z9O A;  1BJA A;  4C2U A;  4M73 A;  3IAS 2;  2V1U A;  2MLK A;  2LYC A;  3MZ8 A;  2CQQ A;  5D8K B;  4BXU A;  1WJE A;  5DM7 F;  1EF4 A;  2VOD A;  1FNN A;  4A3K J;  4WF2 A;  4A3J J;  4XLE A;  3CCS I;  4Q47 A;  3PIO F;  2K9L A;  2DTR A;  2E2I J;  5DEQ A;  2ZME C;  3RKX A;  3HB9 A;  1FMV A;  2K9S A;  1RIO H;  1BR1 A;  1IF1 A;  5HOO A;  3RKW A;  3HDD A;  2ZXH A;  4Q5S F;  4M6X A;  3ROU A;  1I1S A;  1F1Z A;  1QGP A;  2YSR A;  1Z7U A;  3RSN A;  3H9Q A;  4L0Z B;  5JHU A;  3K70 C;  1QO0 D;  3NAR A;  2AS5 F;  4EM1 A;  3RTR A;  5E1Z B;  1RRJ A;  3HC7 A;  2QZ8 A;  3HJE A;  2Y0S A;  1X58 A;  3WE2 A;  4KIB A;  3LSK A;  5K7H A;  4OOI A;  5GAE J;  5C4X J;  1PUF B;  1WFX A;  4XLH A;  1TWA J;  1KON A;  2A69 F;  3OL3 A;  2VB6 A;  3A1Y A;  3PFI A;  1K6O A;  5ICC A;  1ZAR A;  3V7C A;  3GTK J;  1S3J A;  2XHK A;  1SAX A;  4D5F A;  1FEX A;  4KNY A;  3K4M A;  2V9P A;  2X6Y A;  3DQV C;  3FXR A;  2O5R A;  2V6C A;  4I76 A;  1W0U A;  3BP8 A;  2DXI A;  2ZFU A;  1IGN A;  5ICG A;  2VJ5 A;  3GF2 A;  4LD5 A;  1WGX A;  5DUI A;  4A5N A;  2XGE A;  1MH3 A;  4FQG A;  2OC6 A;  4ZZD A;  4KFC A;  3AKZ A;  3PO3 J;  4XQF A;  2FSW A;  5FKN A;  4IOC F;  2F48 A;  3S1N J;  2VXD A;  1SAN A;  1XN7 A;  4XSX F;  2JA5 J;  3HGG A;  4XRS A;  2M3A A;  2P7C B;  2LFB A;  3FX3 A;  4CSW A;  1DPR A;  1YW8 A;  4UV9 A;  1XGN A;  2LVS A;  2Y75 A;  2W24 A;  3G3Z A;  5DCM B;  2IRF G;  1S6L A;  3E6C C;  5EEH A;  1YQA A;  1P6R A;  1JHH A;  4IRG A;  2Q8K A;  4EV0 A;  2CUZ A;  1ZGJ A;  4BS9 A;  5E17 F;  1HW1 A;  5ICF A;  1K79 A;  1UAA A;  1LUJ B;  5H6Q A;  5FKM A;  1SD6 A;  3KYD B;  3CUQ B;  2QQA A;  3A4C A;  2WA0 A;  3P9I A;  3JRD A;  3A02 A;  3DPL C;  4JK1 X;  4M9Z A;  3CDI A;  2IGK A;  3TOA A;  2DBB A;  4M9X A;  2UV1 A;  3J81 Z;  2Q1Z B;  5D6E A;  4BKX A;  4IHV A;  2Y30 A;  3I4P A;  5GAD J;  2Y69 H;  3P7N A;  3ISP A;  2QKL B;  4PDK A;  2M45 A;  3T8R A;  1QQI A;  5IYC J;  4JP0 A;  3AL0 C;  2JRT A;  2LDU A;  2DA5 A;  5TIS C;  1V5G A;  2HGC A;  2KZG A;  2R7U A;  2DMQ A;  2DDB A;  3COA C;  2FRH A;  2KQR A;  3S3M A;  5HOD A;  2KDO A;  3TDU C;  2PMU A;  2RRE A;  5JVT A;  3LSP A;  4A0Z A;  1A31 A;  2WAF A;  1ZG1 A;  2JJ7 A;  4HNT A;  1SD5 A;  3DTI A;  4F55 A;  3HG9 A;  1FOW A;  5DTD A;  3JAM Z;  1JKO C;  4QTR A;  4GGG A;  1MKM A;  3DV8 A;  4XID A;  1GDT A;  3ASO H;  1H89 C;  3GZN B;  2HVS A;  3DPU A;  4KYW A;  2KMU A;  2DYS H;  3SZG A;  2QYO A;  1MH4 A;  3V8K A;  3WTV C;  1P4X A;  3PQK A;  4Y3O A;  1PDN C;  3TOB A;  2ZJ2 A;  3R60 A;  3GTL J;  5C4J J;  3K1P A;  2CGP A;  2O61 A;  2ISY A;  4HSR A;  4Q48 A;  5FKO A;  2ZB9 A;  3BJ6 A;  2MYS A;  4PJM A;  3VYS B;  2QA4 I;  2CMP A;  1R5G A;  2DYR H;  1ZGW A;  4F52 A;  2HI3 A;  2V79 A;  4YII A;  4ESB A;  3KZY A;  1C0W A;  3CC4 I;  2E36 A;  2ZO4 A;  2DI3 A;  1P7I A;  3A2K A;  2CWE A;  1LDD A;  4LLN A;  2DFI A;  2WY8 Q;  4XKV A;  2IGM A;  1WJF A;  4CCK A;  3EUH C;  1KA8 A;  3WTU C;  1TQP A;  2D1H A;  2X1E A;  3MEX A;  3S17 J;  3V7S A;  3RPQ A;  4DIQ A;  5JI6 A;  2P8T A;  1WI9 A;  2ZBK A;  4BQA A;  3SDG A;  3ZMZ A;  1Y0N A;  2IEK A;  2UZK A;  1JKQ C;  1MMA A;  4B1R A;  1R71 A;  2LLK A;  1X1D A;  1KQ9 A;  5FFX A;  2O9L A;  3C1D A;  3DU5 A;  4ETS A;  2E71 A;  3FXL A;  2ZXW H;  3CCV I;  4UNO A;  5DS9 A;  1JKR C;  3JR9 A;  3P5J A;  3I5U A;  2LH9 A;  4MLO A;  1O7F A;  4NDL A;  1B6A A;  2D2W A;  4B8X A;  4XIC A;  3LNQ A;  4F91 B;  2M1B A;  2LBF B;  3ZMS A;  2JPB A;  2BXZ A;  3JCU C;  4F3Q A;  3S8P A;  2DOD A;  2YS9 A;  4I0B A;  2ZNZ A;  4L9J A;  3JRA A;  1HST A;  2DOA A;  5HLG A;  1R7J A;  3ABK H;  5GTI C;  3H36 A;  2XF7 A;  4LJZ F;  1ZG5 A;  5FRO A;  2X4H A;  3VYU B;  1YFH A;  2R93 J;  1BN5 A;  4YIF A;  2EA2 A;  3RDI A;  1D0Z A;  4MIM A;  4L0Y B;  1UG0 A;  5K7F A;  4XBF A;  4AIJ A;  1S7O A;  2MFZ A;  2XPW A;  3O8G A;  1R5I D;  2MSY A;  4NB5 A;  5B1A H;  2I10 A;  4BNC A;  1FOX A;  3QPH A;  3UR3 C;  2GWR A;  3F22 A;  1JTY A;  1I50 J;  5BNG A;  1OPC A;  4BEH B;  4ENM A;  2PBI A;  2CS3 A;  1EKE A;  1MJA A;  2NAZ A;  3J80 K;  3BY6 A;  1YS7 A;  1GV2 A;  1UJ8 A;  1BBY A;  2XSJ C;  2A07 F;  3F8N A;  3TKY A;  5L3D A;  2NS7 A;  1LE8 A;  3ABL H;  2ZJP F;  4AYB A;  3H0D A;  3HRM A;  1OYW A;  2Y9Z A;  4EM2 A;  2HOA A;  3VSL A;  3P9C A;  3NQO A;  1X3U A;  2O8K A;  3R61 A;  1Y1W J;  5F0C A;  4EQQ A;  5J4V A;  4S04 A;  2KRH A;  3E6M A;  2A3S A;  1JUS A;  2QSF X;  2L9R A;  3OR1 C;  1H88 C;  3HTU A;  4K2E A;  4XLC A;  2NVY J;  4IF4 A;  3RKQ A;  2FBK A;  4DOZ A;  2DU9 A;  4CO8 A;  1BW6 A;  3WTT C;  2PQ8 A;  2RNG A;  4Y4R A;  2O7O A;  4LFU A;  2OQG A;  1MZB A;  1CQT A;  1YX5 A;  4LB5 A;  3J7A O;  2IT0 A;  4CHU A;  3K4J A;  2ID3 A;  3CDH A;  5GAG J;  5IP7 J;  4RLF A;  3C2H A;  1V54 H;  3OIQ A;  5DCM A;  3F8M A;  2LG4 A;  3WTX C;  1SMY F;  4HA8 A;  3OYD A;  1SVM A;  1YIO A;  4JBA A;  2X1C A;  1YW7 A;  2ZKZ A;  2W82 A;  4A69 C;  5HS8 A;  4D9J A;  2FUG 2;  3VYR B;  4OIP F;  2DA3 A;  3DP7 A;  2P4W A;  3KEO A;  3FKJ A;  1QU3 A;  4XK4 A;  1TT0 A;  4HF2 A;  2JTV A;  1DGW Y;  1MMS A;  1X1A A;  4OAY A;  3JRH A;  2MLG A;  3WTY C;  4R8H A;  3BR6 A;  1ERD A;  5F1J A;  2QGU A;  3Q0V A;  4E7K A;  4P9U A;  4YRV A;  2XIG A;  3CJN A;  3GLX A;  4D5C A;  4F93 B;  2OPT A;  1QHG A;  1JUP A;  2NVQ J;  3H5R A;  1IN5 A;  2NS8 A;  4MO7 A;  4PGG A;  4M6V A;  2A6H F;  3F6V A;  4V2G A;  1F36 A;  2JA6 J;  5B1B H;  1IRG A;  2R5Y A;  3LA7 A;  1FLI A;  3DKW A;  1G3Y A;  2L0K A;  2L9N A;  2X6O A;  4N9I A;  4LG0 B;  4QPO A;  1XC5 A;  4BBS J;  4AIH A;  2M4G A;  3U1K A;  4BHB A;  4IEJ A;  1HDD C;  2DO7 A;  3IH3 A;  3HOU J;  1DPU A;  1TC3 C;  1TW2 A;  3HPH A;  3K9T A;  1HW5 A;  4CCN A;  2MAB A;  4C3I J;  5FFZ A;  1Z05 A;  5BMZ A;  5IPA A;  3AG3 H;  3EUH A;  4I99 C;  1VF9 A;  1JI8 A;  5BPD A;  1D1B A;  4MQV A;  4N4O B;  1I3A A;  2HYG D;  5LRS A;  2P6T A;  2QQ8 A;  3KIO A;  3OV8 A;  4CIC A;  1NHA A;  2PG4 A;  4UVA A;  4C2M J;  2FX0 A;  3MN2 A;  3LMM A;  1Z9C A;  2XB0 X;  4PFP A;  2GIV A;  3KPH A;  3D5S C;  3DBR B;  3PQJ A;  5F1R A;  3F9K A;  3PUB A;  3K10 A;  4W1U A;  1LVK A;  1GVD A;  2CW7 A;  4L9V A;  2COB A;  4IPA A;  2ZJQ F;  4BY1 J;  1XCB A;  5FO5 A;  5ILV A;  2BZT A;  2VL8 A;  1XX5 A;  4HX7 A;  3Q0W A;  4DBR A;  4GO1 A;  2GIZ A;  4IOA F;  3JSP A;  1IUY A;  2RKH A;  2AXT C;  3JSO A;  1BIA A;  4KMF A;  1XGM A;  5EG0 B;  4RB1 A;  1S7E A;  4UVB A;  3ABU A;  3BZK A;  1FX7 A;  3OR2 C;  1Z21 A;  3TW7 A;  4BAY A;  1X19 A;  5E3O A;  4DZP A;  3KZI C;  1RC9 A;  4BJ6 C;  3HHG A;  3MCZ A;  3GTQ J;  2AXL A;  1FYM A;  2DLL A;  3ONQ A;  2E19 A;  3ZQF A;  2M30 A;  1XCV A;  4OMY A;  4G9Y A;  2BYV E;  4MQ9 F;  2EIL H;  1HKS A;  4ZYE A;  3GBG A;  2XKO A;  2HQA A;  2MD0 A;  3KP3 A;  2RVC A;  4JX5 A;  2ID6 A;  1YG2 A;  3QYB A;  3L00 A;  3F21 A;  3F0C A;  1VFC A;  3FZV A;  2PMZ A;  2FA5 A;  4XN3 A;  3CCJ I;  2XKP A;  2XV4 S;  1T0F A;  1POG A;  5CQE A;  1RKT A;  1LVA A;  3D5R C;  2DFE A;  5HLT A;  2NVX J;  2HDW A;  4BE2 A;  3ZOB A;  1P92 A;  5HLI A;  1SFX A;  2P6S A;  4FIS A;  3FK7 A;  1BOB A;  2FE3 A;  3KP6 A;  3PIP F;  4LOC A;  2VQL A;  1YRN A;  1B59 A;  3U2R A;  2UUZ A;  3E3V A;  1D5Y A;  4CH7 A;  2Z33 A;  4FTH A;  2Y31 A;  4GDF A;  4BXX J;  1SEU A;  1Q1V A;  5M5Y J;  4UV8 A;  4IQ4 A;  1IN6 A;  2IGN A;  2CQN A;  1O3Q A;  2E5Z A;  9ANT A;  1G4D A;  4RAF A;  3E5U A;  5IYB J;  5IOY A;  3I55 I;  4II2 A;  2VJI A;  5H6R A;  4XLF A;  3N05 A;  4Q4Z F;  1FMW A;  1XG1 A;  1VQ5 I;  4RB0 A;  3BJA A;  4B3X A;  4RM3 A;  4GCV A;  2NYX A;  3TP3 A;  1HSJ A;  4BGD A;  2G0E A;  2A5Y B;  2LMD A;  2VKV A;  2FBH A;  5E3M A;  4UB8 C;  2HR3 A;  4HNV A;  1T38 A;  2K27 A;  3C2B A;  2VON A;  2WWY A;  1ENH A;  3TQN A;  4PJ0 C;  4RGU A;  1MNM C;  4XNF A;  5LD2 C;  3K1M A;  4B09 A;  4YIR X;  3G73 A;  2CQX A;  2R7O A;  4XRS G;  4WX9 A;  3QRF F;  3D1N I;  2CW8 A;  3ECH A;  3TO6 A;  1YYV A;  2RN7 A;  5B3S H;  3HSE A;  2H6B A;  2HQ5 A;  3CC2 I;  3T5X A;  4E6K G;  1ULY A;  1WVR A;  2G7H A;  3CP2 A;  4BU2 A;  3F72 A;  1Y1V J;  1EV7 A;  2RQP A;  1UMQ A;  4A3G J;  2DK8 A;  1WJB A;  1YOV B;  1WJA A;  2VPR A;  5IY5 H;  1O3S A;  2QBY B;  2XGX A;  4ZTF A;  5EEG A;  4JOM A;  3PJR A;  2XPU A;  2F5E A;  2DPD A;  4B4C A;  1APL C;  1GV5 A;  1W36 C;  4A0Y A;  4LG0 A;  4A3L J;  2G7U A;  2HEO A;  3VSK A;  3DKY A;  2BXY A;  5E20 A;  2HPI A;  1RES A;  1R1U A;  1Z77 A;  2R5Z B;  2K9N A;  1Z6R A;  5ILU A;  4XM3 A;  3OOP A;  1IZ1 A;  3OYM A;  5KNL A;  2GM4 A;  1MMD A;  1OIS A;  1IO2 A;  1UB9 A;  5J1R A;  3HEF A;  4TV7 A;  2R7V A;  2WAQ A;  4O5V A;  4ZTJ A;  2M8E A;  4DGW B;  2CV0 A;  1G3T A;  1X2N A;  2DT6 A;  2EJR A;  2LOO A;  2WAD A;  4MHG A;  4NQW A;  1VQ7 I;  4O6J A;  1S8N A;  1R4M B;  3CO6 C;  2F6C A;  2Y48 A;  1ZK8 A;  1KU3 A;  1NTC A;  2M5W A;  3ML6 A;  2VPL A;  1T33 A;  2E35 A;  3LSJ A;  3OYJ A;  4CCL A;  4X6A J;  2OAZ A;  2Q2E B;  1GUU A;  4EJO A;  3KX2 A;  5CPR B;  3GUD A;  3KP7 A;  1XB4 A;  3M1E A;  2KLO A;  1Y6I A;  5L3G A;  5DUK A;  2I5U A;  3ZQC A;  4HV6 A;  3TO9 A;  1SAU A;  1IN4 A;  2WB1 N;  1QZE A;  2XVC A;  4ITV A;  1D8K A;  2QVO A;  2EIN H;  2Z3Y A;  2L3D A;  4BQO A;  3PSI A;  2FNP A;  3MVP A;  3L2R A;  4G94 A;  3QPT A;  1E3H A;  3QU6 A;  3RPU D;  1DP3 A;  5KK1 A;  2VBW A;  3IKT A;  1XMK A;  2K4J A;  1LEB A;  1ZN2 A;  5JLW A;  4LB6 B;  1Y56 A;  2LC2 A;  4IO9 F;  2KDZ A;  2ELJ A;  1B4A A;  1K4T A;  4LGW A;  2ELK A;  1MSE C;  3DBH B;  4WK8 F;  2DMP A;  3H92 A;  4M74 A;  3WGI A;  1PVE A;  2NRA C;  1IDZ A;  4I2O A;  1ON2 A;  5HDG A;  1TWH J;  2W1O A;  4J01 A;  2X85 A;  1MBG A;  2R7F A;  4QPQ A;  1HOM A;  4MGR A;  4M3D A;  4KIF A;  3I58 A;  2KFD A;  1YTY A;  2OUM A;  5HLH A;  3ZPL A;  4ZDP A;  4YEL A;  3FXU A;  2FNA A;  1XMX A;  2L9V A;  2YUS A;  4FE4 A;  4XKB A;  5IT3 A;  3ABM H;  3BQZ A;  3NWT A;  4ANJ A;  1WQ2 A;  3EQL F;  5FKK A;  2MBF A;  5IT9 K;  1O3T A;  5B66 C;  1EH6 A;  3QOP A;  4EVI A;  2WTE A;  2KPM A;  4G6T B;  3IH4 A;  2ICW G;  2Q0O A;  3DBL B;  1ZKG A;  5JHF A;  1I39 A;  2A6T A;  2WY7 Q;  5EJC A;  3JW4 A;  1X3Z B;  3A01 A;  3F23 A;  4CGZ A;  2R0Q C;  1YO5 C;  4D1Q A;  3CUO A;  3LL7 A;  1K61 A;  1JJ6 C;  1FP1 D;  3I3L A;  1ZTR A;  2BGC A;  1V3F A;  1WKM A;  3WU0 A;  4C9Y A;  3SEQ A;  2XRL A;  3G1M A;  2X1D A;  2LNB A;  2JUG A;  3HIF A;  4L5J A;  3RYP A;  2STW A;  2OZ6 A;  3U1D A;  2V7F A;  2K7L A;  3L2W A;  1DDN A;  1B72 A;  5FRM A;  1J9I A;  3RYR A;  1FP2 A;  4FX4 A;  4FT8 A;  3E6B A;  2A61 A;  3BZ6 A;  2QBY A;  3J80 Z;  2JPC A;  3SQN A;  4CZZ A;  4DYC A;  3S1R J;  1KQ8 A;  1OCC H;  5AIQ A;  5EEA A;  3I9V 2;  3R0J A;  3IH2 A;  4U0V A;  4Y15 A;  1FTT A;  3CF5 F;  1ZR4 A;  2QQ9 A;  2V26 A;  3CJQ B;  3S32 A;  1IRF A;  2JMW A;  2GXB A;  2XF6 A;  1OCR H;  4A3C J;  3K4N A;  5EYR A;  3EYI A;  2UWM A;  2KRF A;  1FBQ A;  2VQH A;  2ZXI A;  1ZRE A;  1VQ4 I;  3WOD F;  2QEX I;  1G6N A;  2CQK A;  1LPQ A;  3ZXS A;  1RET A;  1OCO H;  2GXG A;  5DD4 A;  2R4G A;  1IN7 A;  2L2O A;  4M3E A;  4QWQ A;  1G8X A;  2AQF A;  2K9M A;  2Z1D A;  5LEK A;  2CU7 A;  4HOB A;  2P81 A;  4L9T A;  5D5V B;  5CLS A;  3F8C A;  3WHC A;  2M87 A;  3HXL A;  3S3N A;  5LGN A;  1S29 A;  1Z0X A;  3L9F A;  5J6X A;  3A0B C;  2FML A;  1TNS A;  3C7J A;  5B5E C;  4ZC3 A;  2P7V B;  2KL4 A;  2OTJ I;  4A6D A;  1FYL A;  2E60 A;  3CES A;  1WH5 A;  2IS2 A;  1I6X A;  4KT5 C;  4RAY A;  1MW7 A;  3OYB A;  1D0Y A;  2KIS A;  1WHU A;  3KP5 A;  4XLP F;  2ELH A;  3QOD A;  3GTG J;  4ZZL A;  2VXZ A;  1O4X A;  4PSX A;  2NOG A;  3WTS C;  4PUS A;  4HAM A;  3TO7 A;  5ED4 A;  2WAQ N;  1ETW A;  3R4K A;  3BTC A;  2L01 A;  1QZY A;  2K86 A;  1I3Q J;  5D4R A;  2DPU A;  1PP8 F;  2E1M C;  1V55 H;  5BPI A;  3Q3S A;  1K78 A;  2HDC A;  2H09 A;  1FTZ A;  2BY0 A;  4RDU A;  1LDJ A;  2TCT A;  5D6F A;  2K4B A;  1BR2 A;  1MND A;  1ZH5 A;  2HVR A;  1W7P B;  1WCM J;  2A68 F;  4E4H A;  4BE1 A;  1G59 A;  1UZC A;  3CDL A;  2VI6 A;  2E7W A;  3CCE I;  3BR0 A;  2UXN A;  4GXO A;  3FXQ A;  3CMM A;  2L5Q A;  1RR7 A;  2PFB A;  5JFR A;  1XD7 A;  4M3F A;  4E7I A;  4DZJ A;  1LNW A;  4U0W A;  2DN0 A;  4BE0 A;  3FIW A;  3GTO J;  2VKE A;  5L3B A;  1IUF A;  3BTJ A;  4AWX B;  2EV0 A;  2DA7 A;  3T0Y A;  4YG2 F;  1LDK B;  2R7R A;  2XUB A;  4E7L A;  3BG6 A;  3G6E I;  4JX6 A;  1B8I B;  1UHM A;  3KEY A;  5GP9 A;  5F04 A;  1V5F A;  1D3Y A;  3VEP A;  2WAE A;  6PAX A;  4HDU A;  1E3O C;  5IOZ A;  4LMY A;  3CP8 A;  1YJW I;  3DWL E;  3I4N J;  3QAH A;  4YFX F;  2ME0 A;  4WCG A;  2EA4 A;  2ZSI B;  4ZH4 F;  3N4M A;  2PX9 A;  2D45 A;  1J5Y A;  1ZG3 A;  1D1C A;  2RAE A;  4CYD A;  3VDX A;  2K3P A;  4A3F J;  1ETX A;  1LFP A;  1TQM A;  1GVJ A;  1J2X A;  1N77 A;  2CUF A;  1LE8 B;  2P0W A;  1KZH A;  4BDY A;  3CMA I;  4I7H A;  3LFK A;  1RZ4 A;  4L9N A;  3GYH X;  4A6E A;  5CVJ A;  3FXO A;  2E1M B;  4AC0 A;  2EV5 A;  2F4I A;  5HS7 A;  2W25 A;  1HQC A;  2MW8 A;  4DBQ A;  4LIT A;  4CXF A;  4PZJ A;  1HW2 A;  5E1W A;  3O6B B;  3V8J A;  2KIQ A;  1MBH A;  1EH7 A;  3F6O A;  5C3E J;  1J59 A;  1ON1 A;  4HLX A;  3ZQQ A;  5DM6 F;  3A01 B;  2C6Y A;  4UUT A;  4C2T A;  1TQI A;  4MNU A;  5KAF C;  3JRE A;  3SYT A;  4BJT A;  1I6H J;  2Y2Z A;  1FYK A;  2HTS A;  3OYF A;  2VKH A;  2JK3 A;  2QM3 A;  1T6S A;  3AG4 H;  2VE9 A;  1JJ8 C;  2HOS A;  4XRM A;  1JE8 A;  2FOK A;  3B6A A;  2IS4 A;  3HGY A;  2VBZ A;  4B44 A;  1FY7 A;  1Y8Q B;  2GZW A;  2L7Z A;  4HLY A;  4G6Q A;  3IRQ A;  1ZQ3 P;  1OR7 A;  2QSH X;  4E7J A;  5CVU A;  2XAJ A;  3T8T A;  2LKX A;  1HA8 A;  2PJR A;  5HNF A;  3GCM A;  3VB2 A;  1KU2 A;  2FF4 A;  3LWF A;  1W0T A;  5ERI A;  2ZCW A;  1MMN A;  3GME A;  3H3Z A;  5LGT A;  2CSO A;  2QUF A;  5M5X J;  3E0J B;  2VUM J;  1R49 A;  4RM2 A;  3K4B A;  2OCC H;  4OAZ A;  4OMZ A;  3HRT A;  1S7A A;  2F5F A;  4C30 A;  2ISZ A;  3FBN B;  1X1B A;  1A6I A;  5M3F J;  2Z2S B;  4MEY F;  2KIF A;  3GVA A;  2R7W A;  3OYH A;  1ZRF A;  4C3H J;  2EWN A;  1A35 A;  2GA2 A;  3BR5 A;  2X6X A;  3HOZ J;  2F5D A;  4CYC B;  3H1C A;  2X48 A;  2GAU A;  3WU2 C;  3L09 A;  2OQR A;  4KIG A;  3HKZ A;  1HDP A;  4CCO A;  2QQB A;  4MTE A;  1ZYR F;  2R92 J;  1X3W B;  3FKI J;  4P55 A;  1MDM B;  5EGO B;  3SJM A;  1FWZ A;  4IL6 C;  1UCR A;  3SZP A;  1SFU A;  3AG2 H;  2X9D A;  3ZRG A;  4A3E J;  4KIT B;  3BRO A;  3TP0 A;  4XON A;  5LHG A;  1ZRD A;  3W6V A;  4MFE A;  2H1K A;  3WG7 H;  3HOW J;  1V5E A;  1FBS A;  2OA4 A;  3DTE A;  4ESJ A;  4I6Z A;  2BV6 A;  1QA6 A;  2JVG A;  3WTZ A;  3BLY A;  4IHX A;  1FT9 A;  5K5R A;  4U0Y A;  2HYF A;  3H9G A; 
#chains in the Genus database with same CATH homology
 4OIO F;  1ODD A;  2K02 A;  3E97 A;  1LEA A;  2OZU A;  2O03 A;  1RUN A;  1RI7 A;  2MH9 A;  1Z91 A;  1RUO A;  2IPQ X;  3GEZ A;  5AON A;  3GFI A;  1U5T C;  2LF7 A;  2PI0 A;  3Q9V A;  3JAM K;  1FPQ A;  3N97 A;  2VOP A;  1ZLK A;  2WV0 A;  3HOT A;  5J8C A;  4WXC A;  1QZZ A;  3GFM A;  4G7H F;  2WC2 A;  4I98 B;  2KIU A;  4RGS A;  5JR3 A;  1KQ0 A;  1GXP A;  3QP6 A;  5A2Q K;  3JTG A;  2L54 A;  1BC7 C;  1WSU A;  1TLH B;  1QNT A;  3LAP A;  5BS6 A;  4O3M A;  4I02 A;  2VT2 A;  4XRF A;  4Y13 A;  3GW2 A;  4U7D A;  1GHC A;  1ZHF A;  2V1D A;  2MA3 A;  3LAJ A;  3GX4 X;  1F9N A;  4RAZ A;  1F5T A;  4HQE A;  1KGS A;  5FLX Z;  3WG9 A;  2EFN A;  2XAS A;  2EK5 A;  3EDP A;  1HKQ A;  3SFZ A;  5KVR A;  4G8X A;  4RB3 C;  4EJU A;  3ZN1 A;  4H0E A;  5CVR A;  2RDP A;  1W5S A;  3IKV A;  1OYI A;  2ZME B;  2VE8 A;  1G3S A;  3HTS B;  3E5X A;  2L4M A;  3RPU A;  1KYW A;  4HBL A;  4UVC A;  2MC3 A;  1R23 A;  3QU3 A;  3KEQ A;  2ZNY A;  3LQR A;  1XGO A;  2MD5 A;  3M9A A;  3CUQ A;  2UXX A;  4P5O A;  4WWC A;  3JTH A;  2G9W A;  3KET A;  1SFE A;  4ASN A;  3LQQ A;  1DUX C;  3DFG A;  1U78 A;  5FLX K;  1JHF A;  3EET A;  1MGT A;  4G7Z F;  2GQQ A;  2XAQ A;  3FMR A;  1R1T A;  2FXA A;  4EJT A;  5LLQ A;  3GFL A;  1BOA A;  1IAW A;  2COM A;  1MDM A;  5DDG A;  4D0P A;  5DCF A;  3K69 A;  3EYY A;  2HS5 A;  3IWF A;  2L4A A;  1CGP A;  2PLY A;  4EMS A;  1MJ9 A;  3LST A;  4ENJ A;  3M8F A;  2EFP A;  2ZFW A;  2VC0 A;  1OYY A;  1O57 A;  3W6K B;  1IN8 A;  2A6E F;  1YW9 A;  5DD8 A;  3CTA A;  2IA1 A;  4AVP A;  4N9H A;  4AD9 A;  1USS A;  2IA2 A;  3QP5 A;  2QLZ A;  3FM3 A;  5DV5 A;  4RB2 C;  1QPM A;  4L5I A;  5DYM A;  2KJC A;  3ZMU A;  2P5V A;  3BJO A;  4EJV A;  1OKR A;  3DF8 A;  1CF7 A;  1I27 A;  4DQ2 A;  2EV6 A;  4ESF A;  1BI2 A;  2HZT A;  4KN7 X;  5BQT A;  2IVM A;  1REP C;  4UUV A;  3HSF A;  3FMQ A;  5LRR A;  1XSD A;  5ICE A;  2FMY A;  5K5Q A;  1BC8 C;  3AAF A;  3CLO A;  2F5C A;  2FBI A;  3C3W A;  4Y17 A;  1IXR C;  3J81 K;  3GZ6 A;  4RGR A;  2QWW A;  1H0M A;  1HKT A;  5L3E A;  5TRD A;  4P96 A;  2VOO A;  3FM5 A;  1ONV A;  3R0A A;  2CFX A;  2XAG A;  2V9V A;  3HUG A;  3NRV A;  2B0L A;  2J5P A;  2XRO A;  5E18 F;  5J8F A;  1U3E M;  4CDG A;  1P2F A;  4A2U A;  3B73 A;  3I59 B;  4WXH A;  3ZMV A;  3C18 A;  1IXS B;  1T2K A;  3K1N A;  1J0R A;  4YFK F;  4OIN F;  3SXY A;  2QEN A;  3BPV A;  2XRN A;  3RIR A;  2LSO A;  4I0A A;  1IW7 F;  1E17 A;  1ZGA A;  5ILS A;  3ZN0 A;  2D1V A;  4HF1 A;  2E7X A;  3V7R A;  2LF8 A;  2BEO A;  1R22 A;  2J5O A;  5LHH A;  1VTN C;  4IHT A;  1BM9 A;  2DQR A;  1FOK A;  4HZF A;  4HX4 A;  2VC1 A;  4M6Y A;  2YU3 A;  5FB2 A;  2CYY A;  2EFW A;  3KP4 A;  4MTD A;  5LEJ A;  2NNY A;  1XDS A;  4BYY A;  5IT9 Z;  1Z6T A;  3KLN A;  2DQL A;  5LBQ A;  3KE2 A;  3RI4 A;  4WXD A;  1UST A;  3E5Q A;  3SZT A;  3GWZ A;  3F8F A;  4DNC A;  5BOX A;  4ZYD A;  2HOE A;  4ENN A;  3ELK A;  1WWX A;  3HRS A;  2O6G E;  2XAF A;  5CJ9 A;  2VN2 A;  4ENK A;  1BI0 A;  5CVI A;  1R00 A;  1L0O C;  2CG4 A;  4OIQ F;  3MZH A;  1FSH A;  2P5K A;  1UHW A;  2JSC A;  1D5V A;  4HQM A;  1HBX G;  2STT A;  2IP2 A;  1TTY A;  4A0X A;  1W7P D;  5LHI A;  4KN4 X;  2ESN A;  3I0T A;  3I71 A;  3HHH A;  4QLC U;  2ACJ A;  4BHP A;  2ETH A;  1XSV A;  5L3F A;  3Q9S A;  1L3L A;  2OBP A;  3W6J B;  1XDU A;  2YR2 A;  1IXC A;  1OMI A;  1R5H A;  5HDK A;  2TDX A;  5AIP A;  3CUQ C;  1KU9 A;  1GXQ A;  1AOY A;  2H6C A;  3I53 A;  2PJP A;  3V8L A;  1CF7 B;  1SD7 A;  3R6S A;  2DK5 A;  3P9K A;  4OIR F;  1SD4 A;  3MZY A;  4AIK A;  4L18 B;  1ZRC A;  1MJB A;  4KDP A;  2DT5 A;  4FX0 A;  5A2Q Z;  4MEX F;  4LK1 F;  4HV5 A;  1T39 A;  1G3W A;  5F64 A;  1KYZ A;  2HQR A;  5D5U B;  1B9M A;  1ZLJ A;  2PMH A;  3FWE A;  1O7L A;  4XSZ F;  1FSE A;  1JXS A;  1SMT A;  3M8E A;  1P4W A;  1XSX A;  2EFQ A;  2PEX A;  5HVQ C;  3GFJ A;  3Q5F A;  1J75 A;  3ERE D;  3NEU A;  4PGH A;  5CYV A;  2P5L C;  3O3K A;  2Y0M A;  4UHT A;  4FHT A;  4G7O F;  4E70 A;  2W84 A;  3D5L A;  2JZY A;  3DXJ F;  5K5O A;  3KZZ A;  2Q2E A;  5FD5 A;  1QBJ A;  3MAJ A;  2KJB A;  3BPX A;  1BIB A;  3WTW C;  3BDD A;  3WGG A;  5CVV A;  3ZMD A;  3IC7 A;  4OU0 A;  2HKO A;  1UFM A;  1U5T A;  1YLF A;  1J7K A;  4IXA A;  3I64 A;  5K1Y A;  2R7D A;  1PP7 U;  3FF5 A;  3K0L A;  2E1N A;  4U7B A;  3ZP5 A;  2H94 A;  4Z2Y A;  5FGM A;  3DEU A;  3ZQ7 A;  1LJ9 A;  1PUE E;  3DPT A;  3HSR A;  4GYI A;  5FD6 A;  2XAH A;  4G6D A;  1RNL A;  2R3S A;  3T1B A;  1B1B A;  3L7W A;  4ON0 A;  1TBX A;  1LQ1 A;  4KA4 A;  2ZME A;  3IWZ A;  1A04 A;  2JT1 A;  1STZ A;  4KIC A;  2GA1 A;  2IJL A;  5D5W B;  3KLO A;  1Z1D A;  2EFO A;  3IHU A;  4HDV A;  4S05 A;  3K2Z A;  3M7G A;  1BI1 A;  2RV8 A;  4HF0 A;  4XLN F;  5HDN A;  1P4A A;  3CO7 C;  3O2P E;  1BI3 A;  2FEZ A;  5E8I A;  1F4K A;  2HKX A;  4EGY A;  1K78 B;  2O0Y A;  3KFW X;  4A12 A;  1U8R A;  1D8J A;  1HXD A;  3KCC A;  3HOS A;  4M72 A;  5F6F A;  2KKO A;  4IRI A;  2OD5 A;  1H9T A;  1TW3 A;  2Z99 A;  1AWC A;  4UXN A;  2E1C A;  4F7Z A;  3ABT A;  2Z5U A;  1FZP B;  1XGS A;  4M9S A;  4N0B A;  2HWV A;  2VBX A;  3S2W A;  1ZAO A;  4HX8 A;  1Q1H A;  4M71 A;  1EH8 A;  2V1X A;  2RNJ A;  4I01 A;  4HYE A;  3KP2 A;  4BH9 A;  5L3C A;  1TNT A;  3E6D A;  2KIM A;  4KMU X;  4KUM A;  4LLG F;  5D8L B;  1O3R A;  4YFN F;  4EM0 B;  4A5M A;  3F8B A;  3ECO A;  4LLL A;  3FHZ A;  5H20 A;  1H9G A;  1K7A A;  2YX7 A;  4JQF A;  3LA3 A;  3LA2 A;  3F3X A;  3TDZ C;  3L2C A;  2NNN A;  5D4S A;  1XMA A;  4NHJ A;  3TGN A;  1WRJ A;  3VFZ A;  3HYI A;  1U5T B;  2BBY A;  2NS0 A;  2VT3 A;  4U88 A;  1U6G A;  4IVN A;  2MH2 A;  4EJW A;  2CO5 A;  3VOE A;  4ZYG A;  3HRU A;  4RGX A;  5E8G A;  2RGV A;  1MD0 A;  4IJA A;  1W4M A;  1R36 A;  3VOD A;  3MWM A;  2FQ3 A;  3SHF A;  3BWG A;  2PN6 A;  2DW4 A;  2HFH A;  2IW5 A;  1T98 A;  2O8X A;  2OU2 A;  2W57 A;  2RC4 A;  5LGU A;  3WGH A;  2HTJ A;  4LK0 F;  3REO A;  3ZMT A;  4HW0 A;  3IL2 A;  2DAO A;  3B02 A;  4GYG A;  3U9G A;  4I09 A;  4IRH A;  3RJP A;  1U2W A;  2F2E A;  2BE5 F;  4RS8 A;  1B9N A;  2ESH A;  3I54 A;  1YS6 A;  1KU7 A;  1JGS A;  1R58 A;  1FBU A;  1V4R A;  3H3U A;  2EB7 A;  2VBY A;  3GZ5 A;  3V4G A;  5TJJ A;  3MFK A;  1W5T A;  1W7P A;  3FMS A;  2CW0 F;  1Y0U A;  1LB2 A;  3WE3 A;  2ZXJ A;  3I59 A;  1R1V A;  1FC3 A;  2L02 A;  4R1H A;  4IHS A;  2HQN A;  2YPR A;  2YX4 A;  5E1X A;  3GO5 A;  1DP7 P;  3ULQ B;  1E2X A;  3WU1 B;  2FU4 A;  2W85 A;  3GXO A;  1I5Z A;  3D0S A;  4EGZ A;  2O3F A;  4PCQ A;  5D5X B;  2LKP A;  3RKY A;  3MQ0 A;  4BHC A;  3IRR A;  2IA0 A;  4P9F A;  1I1G A;  4R79 A;  4ZYH A;  3BOQ A;  2X0L A;  5HS9 A;  2H27 A;  2ADU A;  2Z9O A;  1BJA A;  2V1U A;  4M73 A;  2MLK A;  5D8K B;  4BXU A;  2VOD A;  1FNN A;  4WF2 A;  4Q47 A;  2DTR A;  5DEQ A;  3RKX A;  1RIO H;  1IF1 A;  5HOO A;  3RKW A;  4Q5S F;  4M6X A;  3ROU A;  1I1S A;  1F1Z A;  1QGP A;  2YSR A;  1Z7U A;  4L0Z B;  5JHU A;  2AS5 F;  1QO0 D;  4EM1 A;  3RTR A;  5E1Z B;  2QZ8 A;  3WE2 A;  4KIB A;  4OOI A;  2A69 F;  3PFI A;  1K6O A;  5ICC A;  1ZAR A;  3V7C A;  1S3J A;  2XHK A;  1SAX A;  4KNY A;  3DQV C;  3FXR A;  2V6C A;  3BP8 A;  5ICG A;  4LD5 A;  3GF2 A;  5DUI A;  4A5N A;  4ZZD A;  4KFC A;  2FSW A;  1XN7 A;  4XSX F;  2P7C B;  3FX3 A;  1DPR A;  1YW8 A;  4UV9 A;  1XGN A;  2Y75 A;  2W24 A;  3G3Z A;  5DCM B;  2IRF G;  1S6L A;  3E6C C;  5EEH A;  1YQA A;  1P6R A;  1JHH A;  4IRG A;  2Q8K A;  4EV0 A;  1ZGJ A;  5E17 F;  1HW1 A;  5ICF A;  1K79 A;  5H6Q A;  1SD6 A;  3CUQ B;  2QQA A;  3P9I A;  3DPL C;  4M9Z A;  4JK1 X;  3TOA A;  2DBB A;  4M9X A;  3J81 Z;  5D6E A;  3I4P A;  3P7N A;  3ISP A;  4PDK A;  2M45 A;  3T8R A;  1QQI A;  2JRT A;  2LDU A;  2HGC A;  3COA C;  2FRH A;  3TDU C;  2PMU A;  5JVT A;  4A0Z A;  1ZG1 A;  1SD5 A;  3JAM Z;  4GGG A;  1MKM A;  3DV8 A;  4KYW A;  2QYO A;  3V8K A;  3WTV C;  1P4X A;  3PQK A;  1PDN C;  3TOB A;  2ZJ2 A;  3R60 A;  3K1P A;  2CGP A;  2O61 A;  2ISY A;  4Q48 A;  3BJ6 A;  1R5G A;  2V79 A;  4YII A;  4ESB A;  3KZY A;  1C0W A;  2ZO4 A;  2DI3 A;  2CWE A;  1LDD A;  4LLN A;  2DFI A;  1KA8 A;  3WTU C;  1TQP A;  2D1H A;  3MEX A;  3V7S A;  3RPQ A;  5JI6 A;  2P8T A;  1WI9 A;  2ZBK A;  4BQA A;  3ZMZ A;  2UZK A;  1KQ9 A;  5FFX A;  3C1D A;  4ETS A;  4UNO A;  3I5U A;  1O7F A;  1B6A A;  2D2W A;  4B8X A;  2M1B A;  3ZMS A;  2JPB A;  4L9J A;  4I0B A;  2ZNZ A;  1HST A;  5HLG A;  1R7J A;  4LJZ F;  1ZG5 A;  2X4H A;  1YFH A;  1BN5 A;  4YIF A;  2EA2 A;  3RDI A;  4L0Y B;  4XBF A;  4AIJ A;  1S7O A;  4NB5 A;  4BNC A;  3QPH A;  2GWR A;  3F22 A;  1OPC A;  4ENM A;  2PBI A;  1MJA A;  2NAZ A;  3J80 K;  3BY6 A;  1YS7 A;  2A07 F;  1BBY A;  3F8N A;  3TKY A;  5L3D A;  3HRM A;  1OYW A;  4EM2 A;  3P9C A;  3NQO A;  1X3U A;  3R61 A;  4EQQ A;  4S04 A;  3E6M A;  2A3S A;  3HTU A;  4K2E A;  4IF4 A;  2FBK A;  3WTT C;  2DU9 A;  4CO8 A;  2PQ8 A;  4LFU A;  2OQG A;  1MZB A;  4LB5 A;  3J7A O;  2IT0 A;  4CHU A;  3CDH A;  5DCM A;  3F8M A;  3WTX C;  1SMY F;  4HA8 A;  1YIO A;  4JBA A;  1YW7 A;  2ZKZ A;  5HS8 A;  4OIP F;  3DP7 A;  2P4W A;  3KEO A;  4HF2 A;  2JTV A;  2MLG A;  3WTY C;  4R8H A;  4P9U A;  2XIG A;  3CJN A;  3GLX A;  1IN5 A;  4PGG A;  2A6H F;  3F6V A;  1IRG A;  3LA7 A;  1FLI A;  3DKW A;  1G3Y A;  4N9I A;  4LG0 B;  4AIH A;  4BHB A;  2DO7 A;  1DPU A;  1TW2 A;  3K9T A;  1HW5 A;  5FFZ A;  1Z05 A;  5BMZ A;  3EUH A;  5BPD A;  4MQV A;  2HYG D;  5LRS A;  2P6T A;  3OV8 A;  4CIC A;  1NHA A;  2PG4 A;  4UVA A;  1Z9C A;  2GIV A;  3PQJ A;  5F1R A;  4L9V A;  4IPA A;  1XCB A;  5FO5 A;  5ILV A;  4HX7 A;  4GO1 A;  3JSP A;  1IUY A;  2RKH A;  3JSO A;  4KMF A;  1BIA A;  1XGM A;  4RB1 A;  4UVB A;  3ABU A;  1FX7 A;  4BAY A;  3HHG A;  3MCZ A;  2AXL A;  1FYM A;  2DLL A;  2M30 A;  1XCV A;  4OMY A;  4G9Y A;  2BYV E;  4MQ9 F;  4ZYE A;  1HKS A;  2XKO A;  3KP3 A;  2RVC A;  1YG2 A;  3L00 A;  3F21 A;  3FZV A;  2FA5 A;  2XKP A;  2XV4 S;  1T0F A;  1LVA A;  1P92 A;  5HLI A;  1SFX A;  2P6S A;  2FE3 A;  3KP6 A;  1B59 A;  3U2R A;  3E3V A;  2Z33 A;  4UV8 A;  1IN6 A;  1O3Q A;  1G4D A;  3E5U A;  5H6R A;  4Q4Z F;  4RB0 A;  3BJA A;  4GCV A;  2NYX A;  1HSJ A;  2A5Y B;  2FBH A;  2HR3 A;  1T38 A;  2K27 A;  2VON A;  2WWY A;  3TQN A;  4RGU A;  3K1M A;  4B09 A;  3G73 A;  4WX9 A;  3QRF F;  3ECH A;  3TO6 A;  1YYV A;  2RN7 A;  3HSE A;  2H6B A;  3T5X A;  1ULY A;  2G7H A;  3F72 A;  2RQP A;  1EV7 A;  2DK8 A;  1O3S A;  2QBY B;  2XGX A;  5EEG A;  2F5E A;  2DPD A;  4A0Y A;  4LG0 A;  2G7U A;  2HEO A;  5E20 A;  1R1U A;  1Z6R A;  5ILU A;  3OOP A;  1IZ1 A;  1UB9 A;  4TV7 A;  4O5V A;  2M8E A;  1G3T A;  4MHG A;  2EJR A;  4NQW A;  4O6J A;  1S8N A;  3CO6 C;  2Y48 A;  1KU3 A;  2M5W A;  3ML6 A;  2OAZ A;  4EJO A;  3GUD A;  3KP7 A;  1XB4 A;  3M1E A;  5L3G A;  5DUK A;  4HV6 A;  3TO9 A;  1IN4 A;  2XVC A;  1D8K A;  2QVO A;  2Z3Y A;  2L3D A;  2FNP A;  4G94 A;  3QPT A;  3QU6 A;  5KK1 A;  2VBW A;  3IKT A;  1XMK A;  2K4J A;  1LEB A;  1ZN2 A;  4LB6 B;  1B4A A;  4LGW A;  4WK8 F;  3H92 A;  4M74 A;  3WGI A;  2NRA C;  4I2O A;  1ON2 A;  5HDG A;  2R7F A;  4MGR A;  4KIF A;  3I58 A;  1YTY A;  5HLH A;  3ZPL A;  3FXU A;  2FNA A;  5IT3 A;  1WQ2 A;  3EQL F;  2MBF A;  5IT9 K;  1O3T A;  1EH6 A;  3QOP A;  4EVI A;  2WTE A;  2Q0O A;  3JW4 A;  3F23 A;  4CGZ A;  1YO5 C;  3CUO A;  1FP1 D;  2BGC A;  1V3F A;  1WKM A;  3WU0 A;  2LNB A;  3HIF A;  4L5J A;  3RYP A;  2STW A;  2OZ6 A;  3U1D A;  2K7L A;  1DDN A;  1J9I A;  3RYR A;  1FP2 A;  4FX4 A;  4FT8 A;  3E6B A;  2A61 A;  3BZ6 A;  2QBY A;  3J80 Z;  2JPC A;  3SQN A;  4CZZ A;  1KQ8 A;  5AIQ A;  3R0J A;  4U0V A;  4Y15 A;  2QQ9 A;  1IRF A;  2GXB A;  3EYI A;  2UWM A;  2KRF A;  1FBQ A;  1ZRE A;  3WOD F;  1G6N A;  2CQK A;  2GXG A;  5DD4 A;  1IN7 A;  4QWQ A;  5LEK A;  4HOB A;  4L9T A;  5D5V B;  5CLS A;  3F8C A;  2M87 A;  5LGN A;  1S29 A;  3L9F A;  5J6X A;  2FML A;  1TNS A;  3C7J A;  2P7V B;  4A6D A;  1FYL A;  1I6X A;  4KT5 C;  4RAY A;  3KP5 A;  4XLP F;  2ELH A;  4ZZL A;  2VXZ A;  3WTS C;  4HAM A;  3TO7 A;  5ED4 A;  3R4K A;  2L01 A;  1QZY A;  2K86 A;  5D4R A;  2DPU A;  1PP8 F;  5BPI A;  1K78 A;  2HDC A;  2H09 A;  1LDJ A;  5D6F A;  2K4B A;  1ZH5 A;  1W7P B;  2A68 F;  2E7W A;  2UXN A;  4GXO A;  3FXQ A;  2PFB A;  5JFR A;  1XD7 A;  1LNW A;  4U0W A;  5L3B A;  4AWX B;  2EV0 A;  3T0Y A;  4YG2 F;  1LDK B;  2XUB A;  1UHM A;  1D3Y A;  3VEP A;  6PAX A;  4HDU A;  4LMY A;  3QAH A;  4YFX F;  4WCG A;  2EA4 A;  4ZH4 F;  3N4M A;  2D45 A;  1J5Y A;  1ZG3 A;  4CYD A;  1TQM A;  1GVJ A;  1J2X A;  4I7H A;  3LFK A;  1RZ4 A;  4L9N A;  3GYH X;  4A6E A;  5CVJ A;  2EV5 A;  5HS7 A;  2W25 A;  1HQC A;  4CXF A;  4PZJ A;  1HW2 A;  5E1W A;  3O6B B;  3V8J A;  1EH7 A;  3F6O A;  1J59 A;  1ON1 A;  4HLX A;  2C6Y A;  1TQI A;  4MNU A;  1FYK A;  2HTS A;  2QM3 A;  1T6S A;  2VE9 A;  1JE8 A;  2FOK A;  2VBZ A;  1FY7 A;  2GZW A;  4HLY A;  4G6Q A;  3IRQ A;  1OR7 A;  5CVU A;  2XAJ A;  3T8T A;  3VB2 A;  1KU2 A;  2FF4 A;  3LWF A;  5ERI A;  2ZCW A;  3H3Z A;  5LGT A;  2CSO A;  2QUF A;  4OMZ A;  3HRT A;  1S7A A;  2F5F A;  2ISZ A;  4MEY F;  2KIF A;  3GVA A;  1ZRF A;  2EWN A;  2GA2 A;  2F5D A;  2GAU A;  3L09 A;  2OQR A;  4KIG A;  2QQB A;  4MTE A;  1ZYR F;  4P55 A;  1MDM B;  1FWZ A;  1UCR A;  3SZP A;  1SFU A;  3BRO A;  5LHG A;  1ZRD A;  1FBS A;  2OA4 A;  4ESJ A;  2BV6 A;  3WTZ A;  1FT9 A;  5K5R A;  4U0Y A;  2HYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...