2HWVA

Crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
SHMTIGDLTIHPDAYMVSKRGEKIELTHREFELLYYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPTYLVTRRGVGYYLRNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the response regulator VicR DNA-binding domain.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords DNA-binding response regulator VicR
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hwvA00
3L7WA 5J6XA 2EJRA 1BN5A 4LB5A 2KIFA 4B8XA 4FX4A 2RQPA 2CO5A 5HDGA 1U5TA 2L3DA 1P6RA 4L0ZB 2IP2A 1BI3A 3V4GA 1QQIA 1QZZA 3Q5FA 1ZLJA 3DXJF 2H94A 2M45A 2MC3A 4M6XA 3HSFA 1AWCA 4FX0A 4RB1A 3JW4A 1IF1A 3KP2A 3T5XA 2W24A 5LHIA 1K78A 4OIRF 2RGVA 3R4KA 2XASA 4OMZA 3Q9VA 1RIOH 2Y0MA 5DYMA 2V79A 1DPRA 2KJCA 2K27A 1FPQA 2PQ8A 5IT9Z 1DP7P 5HLHA 1H0MA 1JHHA 3EETA 4MTEA 3WE2A 2LKPA 2L4AA 3KP3A 1GHCA 1XSXA 1KU7A 3GFMA 2EV6A 3QPHA 4NB5A 5ILVA 1XSDA 1W7PB 5D5XB 4MTDA 4A0YA 2VBYA 3JSOA 1XGMA 4YG2F 2A6EF 2EFOA 3OV8A 1XGSA 3K9TA 3U9GA 2HFHA 3KEQA 4UHTA 2O61A 4HDUA 5ED4A 1U2WA 5CVUA 1MDMA 1ZGAA 1HQCA 3OOPA 1JGSA 1UFMA 2FU4A 4UV8A 1J59A 2D1HA 1JE8A 3DKWA 4I02A 1J2XA 1MDMB 2MH9A 3EYYA 3RKYA 2F5CA 1TQPA 5K5QA 1STZA 1WI9A 4ZZLA 3LQQA 2VT2A 2EFPA 2STWA 4U88A 4G8XA 2IT0A 2HQRA 4U7DA 2QBYA 3ZPLA 1BC7C 2VOPA 1U5TB 5FD5A 5LHHA 4N9HA 2GIVA 3E6BA 1ZGJA 1IRFA 5E20A 3GO5A 2HYFA 3QP5A 5H6QA 1KQ0A 2HZTA 1QZYA 4L5IA 3GEZA 4AD9A 2P6SA 2FOKA 1YO5C 3LSTA 1TBXA 1P4XA 1XCBA 2QWWA 2O03A 5H20A 2DQLA 2PMHA 1YW8A 1U3EM 4M74A 5LHGA 1UCRA 5ICEA 2GQQA 3L9FA 1ZG5A 3TDZC 2A68F 4BAYA 1BI2A 1LDKB 1Z1DA 2EA2A 2OD5A 3TO7A 2ETHA 2IA2A 2L54A 1A04A 5DEQA 4L9NA 1GVJA 1SMYF 4UVAA 2RV8A 3HUGA 3QP6A 2H6BA 3IC7A 1YYVA 2DI3A 4I0AA 1BC8C 2G9WA 3HOTA 2HWVA 2DW4A 4Z2YA 4RGUA 3C18A 3ISPA 3GWZA 3LA2A 1W5SA 3HTSB 4K2EA 3FXUA 3RI4A 5CVRA 2VONA 3KP7A 4EQQA 3FXRA 3O6BB 3I5UA 4CZZA 3RTRA 2ZBKA 4FHTA 2RKHA 2KJBA 3NRVA 2BBYA 2CFXA 3K1MA 3K2ZA 2LSOA 1LJ9A 1FP2A 5J8FA 3SXYA 2NNNA 2X4HA 2KRFA 3WTSC 3ECOA 2XAJA 1SD7A 1JXSA 1FLIA 3HSRA 2EA4A 2OU2A 3RDIA 1CF7B 2V6CA 1FNNA 2HTSA 2P5VA 2QUFA 2QQ9A 5TJJA 4I98B 2GA1A 3KE2A 2HTJA 3VFZA 4I0BA 4RAYA 4G7ZF 3MFKA 3WTYC 2QVOA 5K1YA 3C3WA 3TO6A 3FM5A 3IWFA 2ELHA 4MEYF 1F5TA 4E70A 2P6TA 3FWEA 1JHFA 5FO5A 1LVAA 5HDKA 4HA8A 1U8RA 3TQNA 1OKRA 1LDDA 2XV4S 5ICGA 4AVPA 4BXUA 3RPUA 3WGGA 4ESJA 1OPCA 1B9NA 3U2RA 3IKVA 1W4MA 3F3XA 4JBAA 2VE8A 3FZVA 1OYYA 4ENKA 4YFXF 3RPQA 1GXPA 2JTVA 2ACJA 4EJWA 4ON0A 5HLIA 2IA1A 4OIPF 1B6AA 1QNTA 2PJPA 4HF0A 2HOEA 3BJAA 4EM0B 4U7BA 4I01A 3IRQA 2VBZA 3JTHA 1S7OA 1V3FA 4JK1X 3BJ6A 2ZMEB 3DV8A 3GZ6A 4YFNF 3HRMA 5HOOA 2JRTA 3FMSA 2JZYA 3FF5A 1FBUA 4HX7A 4L9VA 5D5UB 3BP8A 4L5JA 2OZ6A 3L09A 4M71A 1FSEA 3VB2A 4G6QA 5AONA 1B1BA 2ADUA 5CVJA 3T0YA 4L9TA 1ONVA 4Q47A 1G3SA 4A5NA 1FP1D 3BPXA 3LWFA 4EV0A 2WTEA 1DDNA 4Y13A 3COAC 5BOXA 5DDGA 2OBPA 1L0OC 5DV5A 4UV9A 4GGGA 1U78A 2FBHA 3HRTA 2XKOA 4RAZA 2HEOA 1B4AA 4LGWA 3V7RA 1Z05A 3SFZA 2FA5A 5CVIA 4KN4X 4A2UA 1EH8A 3MQ0A 5KK1A 1YTYA 1XSVA 4P96A 3G3ZA 4HDVA 1S6LA 2FRHA 4M9XA 1WQ2A 4GXOA 3TGNA 3KETA 1I27A 2QM3A 1YS6A 1R1UA 2H6CA 2GXBA 2A5YB 3F23A 4MQVA 3F8FA 3BPVA 2FEZA 2AS5F 1ZRFA 2B0LA 3W6KB 1O57A 5ILUA 1SMTA 1IAWA 1MD0A 5LEJA 2GA2A 3D5LA 2GZWA 1XCVA 2CQKA 2YX7A 4IHSA 2DK5A 2QQBA 1W7PD 4RGSA 3ELKA 2FXAA 4XSXF 4A12A 4O3MA 3RJPA 1F4KA 4GYGA 5HS9A 1IN5A 1S8NA 1KGSA 1B9MA 5LRRA 2V1DA 2XIGA 2FSWA 1LEAA 1YG2A 3FX3A 4QLCU 2XVCA 2MD5A 1LQ1A 4A0XA 2O6GE 2W25A 5LGUA 1VTNC 1XN7A 4KUMA 5FD6A 3GUDA 4RGXA 1IN7A 1Q1HA 3EDPA 5L3FA 2MH2A 2M87A 2ZFWA 4EJOA 3PQJA 3M1EA 2HR3A 3K1PA 1LNWA 2EV5A 1F9NA 1T38A 5BS6A 5BPDA 4Q4ZF 2NYXA 2HDCA 1O7LA 4CICA 5HVQC 3WGHA 2W57A 3ZQ7A 4G6DA 1DUXC 1BBYA 1ULYA 4ENJA 2HKXA 4KICA 4OINF 2IA0A 1QO0D 1IZ1A 3ABUA 1SFUA 2H27A 5H6RA 2VC0A 4KIBA 3I71A 3F21A 4MQ9F 2STTA 5JVTA 2QQAA 4EVIA 1K79A 3WTXC 2DPDA 2ZXJA 1ON1A 2YPRA 3LAJA 4G9YA 4HQMA 1Z9CA 2V9VA 4WXHA 5D8KB 3WODF 3LA3A 4JQFA 2GWRA 5D8LB 4Q5SF 2FNPA 3TOBA 1D8JA 1FYMA 6PAXA 1WSUA 3E97A 4HW0A 2EB7A 1PP7U 3WE3A 5L3CA 3MZYA 3V8LA 2UXNA 1Y0UA 1T6SA 1P2FA 1HW5A 2P5KA 5D6EA 1REPC 4LK0F 3SHFA 5LRSA 1SD4A 4KNYA 4UXNA 1TW3A 4EMSA 1FT9A 2XAFA 4AIJA 3ZMVA 5ERIA 1UHWA 1BM9A 1V4RA 2K86A 3EUHA 4WXCA 2VODA 4P5OA 4Q48A 1MZBA 2EFNA 1MJBA 2E1CA 2L4MA 1OR7A 1OYIA 1YW7A 1R5HA 2HGCA 1ZHFA 5E8IA 1KQ9A 1T2KA 2UZKA 3SZTA 2RDPA 1IN4A 4UUVA 2XUBA 2PG4A 3CO6C 1YW9A 4F7ZA 4HF2A 2EWNA 4YFKF 3GFJA 2J5PA 3IRRA 2RN7A 2A6HF 2XGXA 1ZG1A 1XD7A 5LGTA 3KLNA 1BI0A 3QOPA 3R0AA 1D3YA 5L3BA 2DAOA 2M1BA 4U0WA 2Q8KA 3GXOA 3R6SA 4HLYA 1ON2A 1IXCA 5ILSA 3HTUA 5LEKA 2M5WA 2A07F 1YLFA 3B73A 3TO9A 5EEHA 2DPUA 4XBFA 1AOYA 4L0YB 5HS8A 2XAHA 4BYYA 4DNCA 3WTUC 3I59B 2MLKA 1Z7UA 1TQMA 2ZKZA 4H0EA 4CO8A 1G4DA 2PN6A 4BHCA 1O3QA 3DFGA 2DFIA 3BZ6A 4WXDA 1FBQA 4M73A 1ZLKA 4I09A 3IWZA 3FMQA 1BIBA 3M9AA 2NS0A 3REOA 3HHHA 1IXSB 4N0BA 2FMYA 4BQAA 2PEXA 1G3YA 4G7OF 3WU1B 2V1UA 2HKOA 3K0LA 4HV5A 4L9JA 2OQRA 4LLGF 2WWYA 2UWMA 3DPTA 1TW2A 1HBXG 3GYHX 1UB9A 3N97A 1O3TA 2XROA 4S05A 5DUIA 2O8XA 2JPBA 1HKSA 4QWQA 2P7CB 2JSCA 1KU9A 3BY6A 2LNBA 2Y75A 3KP5A 2JT1A 1MGTA 1TQIA 2VBWA 4XLPF 4IHTA 3R60A 1J0RA 3E5UA 3ZMDA 3LA7A 4RB0A 1TNSA 1CF7A 4KDPA 2MBFA 1YQAA 5A2QK 5D5VB 4EJVA 3P9KA 3I59A 3IHUA 3TKYA 1USSA 4NHJA 4HX8A 3RKWA 2G7UA 1E17A 2ISZA 3L2CA 1KQ8A 5DCMA 5CYVA 4ENMA 4KN7X 4ESFA 3J80Z 3BDDA 3PFIA 3V8KA 2YR2A 1SD5A 4AIKA 3HHGA 3RYPA 3U1DA 4UVBA 4BH9A 2FBIA 3TOAA 2E1NA 3GW2A 2A3SA 1RUOA 1IXRC 4XRFA 1Z91A 3G73A 3GFIA 1HKQA 3E3VA 4ZYHA 2PBIA 4D0PA 5TRDA 3I4PA 1FY7A 4P9FA 3ZMUA 3JAMK 3P7NA 3CJNA 1XGNA 2QYOA 3F8NA 3VEPA 3WTTC 4I7HA 3WG9A 2COMA 5D6FA 3I64A 1G6NA 3BJOA 2DLLA 3R61A 3E5XA 1KYWA 2IVMA 3F8MA 4CYDA 1J9IA 2YX4A 2FMLA 2LF8A 1K7AA 2BV6A 3QRFF 4ESBA 2D45A 3DPLC 4R79A 3IL2A 2OQGA 1S3JA 4WK8F 2OAZA 3M7GA 1IRGA 5FFXA 1BI1A 3RIRA 1HSJA 2G7HA 1Z6RA 1YFHA 2OA4A 4IRGA 4YIIA 2A61A 5F1RA 1K78B 3HYIA 3HSEA 3M8EA 2IJLA 2Z9OA 4OMYA 5A2QZ 2YU3A 3AAFA 2RNJA 5ICFA 4KMUX 2AXLA 4G94A 5LBQA 2D2WA 2XAGA 3WTVC 4IRHA 2QBYB 4I2OA 2VXZA 2GXGA 2CSOA 3CUQB 5CJ9A 2PI0A 1GXQA 4LK1F 2QENA 3CDHA 2VT3A 4GYIA 3ABTA 4IJAA 3H92A 4KT5C 1P92A 4P55A 4MEXF 3ZN1A 4OU0A 4IXAA 1EH6A 3E6DA 1R23A 2K7LA 1O3SA 5L3EA 5F6FA 1XMAA 3JTGA 1R1TA 4UNOA 1HW1A 4Y15A 3RKXA 4IVNA 3S2WA 5D5WB 1ZN2A 4RGRA 2O3FA 4P9UA 5JFRA 2VBXA 1YIOA 3V7SA 4O6JA 5K5RA 3FMRA 2F5DA 3L00A 3I58A 1FX7A 4PGGA 3ULQB 4RS8A 2C6YA 3BROA 2CGPA 3V7CA 5BMZA 2EFWA 1RI7A 1R7JA 5AIQA 2P8TA 1FWZA 1OYWA 3ECHA 4BHPA 4BNCA 1O3RA 2XHKA 2WV0A 3I53A 1X3UA 5KVRA 1ZG3A 3NQOA 4U0YA 2Z33A 5HS7A 4KA4A 3DP7A 3ZMTA 1CGPA 2O0YA 4ZYEA 2PMUA 3MEXA 4M6YA 4WCGA 4HZFA 4IPAA 3O3KA 3W6JB 2M30A 2W85A 2F5FA 3J7AO 4FT8A 4AIHA 3P9CA 1C0WA 3F8CA 1RZ4A 4M9SA 3GZ5A 5LGNA 1SD6A 5CLSA 5DCFA 1U6GA 1LDJA 3QPTA 2R7FA 3HRUA 2Q2EA 1BIAA 2HS5A 2ZNZA 2JPCA 2MA3A 4KIGA 1BJAA 1SFXA 2M8EA 2OZUA 3VOEA 1ZH5A 2BEOA 5FFZA 4HV6A 4LG0B 2FNAA 3K1NA 1G3TA 2PLYA 5LLQA 1R5GA 3TDUC 2EK5A 4HAMA 5BQTA 4Y17A 3WTZA 1ZREA 2RVCA 3KZZA 3GFLA 1R22A 2HYGD 1D5VA 4A0ZA 2L01A 4NQWA 3J81Z 1FYLA 1WRJA 3ZN0A 3EQLF 1WWXA 2FQ3A 4S04A 4ZYGA 2KIUA 2KIMA 3ERED 5HDNA 1R58A 3WTWC 1I1SA 1R36A 1HSTA 2KKOA 2P4WA 4GO1A 3RYRA 3CUQC 1FYKA 3C7JA 1G3WA 3Q9SA 4N9IA 1D8KA 5E17F 4EJTA 1T98A 3QU3A 3MZHA 2R3SA 1OMIA 1E2XA 2QZ8A 3KP4A 1TNTA 3BOQA 1ZAOA 1XDUA 5IT3A 4LLNA 1SFEA 5D4RA 3ROUA 4EM2A 4OIQF 3PQKA 3FHZA 4M72A 1EV7A 5ICCA 2BGCA 2IPQX 4ENNA 3KLOA 4XLNF 1EH7A 2ZO4A 3MWMA 5FGMA 1K6OA 1T0FA 4EM1A 4LG0A 1BOAA 1QPMA 3GF2A 3E6CC 4HX4A 3T1BA 1B59A 4TV7A 1RUNA 4MHGA 1J7KA 3LQRA 3F72A 4R1HA 5DCMB 4CXFA 2BYVE 2IRFG 4B09A 5HLGA 3JSPA 2MLGA 1F1ZA 2VE9A 4IRIA 1IW7F 4L18B 2LDUA 1H9TA 1TTYA 3F6OA 2DK8A 5JHUA 1MKMA 3VODA 5E1ZB 1LEBA 4WF2A 1PUEE 5E18F 2DBBA 3JAMZ 3HIFA 4LLLA 3EYIA 5E1WA 1RNLA 1T39A 5EEGA 1FOKA 4MNUA 5DUKA 3FXQA 2FF4A 4CDGA 1MJAA 1KU3A 3E6MA 3WU0A 1USTA 3LAPA 5L3DA 3FM3A 2NRAC 3I0TA 4LB6B 2YSRA 2BE5F 4XSZF 4KFCA 5D4SA 5K5OA 2VOOA 2XAQA 2E7WA 1I1GA 1XDSA 3GLXA 2XKPA 4MGRA 3I54A 3DQVC 1HKTA 4LFUA 4R8HA 1SAXA 3KEOA 2QLZA 2EFQA 3CUOA 1O7FA 2ZCWA 1QGPA 2F5EA 1ODDA 2X0LA 3D0SA 2CYYA 2FE3A 3T8TA 4PZJA 3F8BA 3H3ZA 2Z99A 1IUYA 1YS7A 4OOIA 4O5VA 1FBSA 4GCVA 4M9ZA 2Y48A 5F64A 2DO7A 3CLOA 2FBKA 2H09A 3CUQA 2XRNA 4CGZA 2K4JA 1J5YA 2DT5A 1IN6A 2LF7A 2Z5UA 4LMYA 2NNYA 1KYZA 4HLXA 5AIPA 1FSHA 2F2EA 1H9GA 2WC2A 3HRSA 2L02A 2DQRA 5JI6A 3CO7C 4PGHA 3C1DA 1XMKA 4U0VA 4EGYA 1ZRCA 4KIFA 1ZARA 2Q0OA 3P9IA 4HBLA 3J81K 1KA8A 4PDKA 2EV0A 1L3LA 3SQNA 4EGZA 1W7PA 4G7HF 3M8FA 3QU6A 4LD5A 2HQNA 3GVAA 3F6VA 2RC4A 5DD8A 1TLHB 1P4WA 3KP6A 1LB2A 5FLXZ 4ZYDA 3B02A 3LFKA 1WKMA 5FLXK 4ASNA 2IW5A 5FB2A 1W5TA 4HOBA 3IKTA 4KMFA 3DEUA 3KFWX 5DD4A 1J75A 4A6DA 4KYWA 5CVVA 2ZJ2A 2ZMEA 5J8CA 4BHBA 2TDXA 3ZP5A 3V8JA 4RB2C 1I6XA 3HOSA 2V1XA 1R00A 2UXXA 1ZRDA 2P5LC 4A6EA 4EJUA 3R0JA 4HQEA 5E8GA 2NAZA 3SZPA 1HXDA 3KZYA 4OIOF 3MAJA 2Z3YA 2VN2A 4PCQA 1HW2A 3DF8A 2J5OA 2ESNA 3NEUA 2ISYA 2CG4A 2E7XA 1DPUA 4AWXB 4HYEA 1FC3A 3GX4X 4ZZDA 2PFBA 3K69A 2CWEA 4IF4A 2GAUA 1U5TC 5E1XA 4ETSA 5BPIA 1Z6TA 1NHAA 3BWGA 1XB4A 1MJ9A 3H3UA 5IT9K 2ZNYA 2K02A 1XGOA 3CTAA 1QBJA 2K4BA 4CHUA 2A69F 3QAHA 4HF1A 1PP8F 5JR3A 3KCCA 2R7DA 1S29A 4WX9A 3MCZA 1PDNC 3T8RA 2DTRA 2P7VB 1P4AA 3J80K 1KU2A 1FZPB 1IN8A 5L3GA 1ZYRF 4DQ2A 1R1VA 4A5MA 4UVCA 3F22A 4LJZF 2CW0F 1S7AA 2D1VA 3E5QA 3N4MA 2ESHA 4RB3C 3ML6A 1I5ZA 3WGIA 3O2PE 2DU9A 3ZMSA 3ZMZA 2W84A 4YIFA 4WWCA 4ZH4F 1UHMA 2VC1A
chains in the Genus database with same CATH superfamily
1IJWC 2VI6A 1MBHA 1VNDA 3L7WA 3OOUA 3TP0A 5J6XA 2EJRA 1BN5A 4LB5A 2X9DA 1WJDA 2KIFA 5J1YA 3K4BA 1ZELA 3ZQIA 2RQPA 2CO5A 5HDGA 4B8XA 4FX4A 3B6AA 1U5TA 2L3DA 1P6RA 3B6CA 4L0ZB 3CMAI 2IP2A 1BI3A 3BZKA 3H5NA 3V4GA 1QQIA 4DBQA 1QZZA 3Q5FA 3H35A 1ZLJA 1WJEA 3DXJF 1VQNI 2H94A 2M45A 3CCMI 4CH7A 2CQQA 2MC3A 4M6XA 4IOCF 1YJWI 3OYEA 4A3FJ 3HSFA 2GXAA 2EPFA 1HA8A 1AWCA 4FX0A 3K4NA 4RB1A 1EA3A 3JW4A 1IF1A 3KP2A 3T5XA 2W24A 3G2BA 5LHIA 1K78A 3JRBA 4OIRF 2RGVA 3WU2C 5KAFC 3DEWA 3R4KA 1EKEA 2XASA 3GTKJ 2IS4A 4OMZA 3Q9VA 5FLMJ 4GFBA 1XMXA 2RNGA 3LSMA 1RIOH 2HOTA 3PIOF 2Y0MA 5DYMA 3HB9A 2V79A 1DPRA 1AKHB 1VQLI 2XPWA 3LSGA 4BJ5C 2KJCA 2K27A 1X1CA 1FPQA 2PQ8A 1MBJA 4A3JJ 5IT9Z 1DP7P 3HZJA 2OF7A 5HLHA 1H0MA 1JHHA 2ZXWH 3AFHA 3EETA 4Y52J 4MTEA 3WE2A 2EIMH 2LKPA 2L4AA 3KP3A 4PFOA 3WHCA 3ZGKA 1GHCA 1XSXA 3S1NJ 4LIUA 3LSJA 1KU7A 3QYBA 1WJAA 3GFMA 4BBSJ 2EV6A 3QPHA 4NB5A 5ILVA 1XSDA 2M34A 1W7PB 5D5XB 4MTDA 4PJMA 3G4SI 4A0YA 2VBYA 3JSOA 3EPZA 3CCVI 1XGMA 2DMUA 4YG2F 2A6EF 1X3ZB 2EFOA 3OV8A 1XGSA 4D7NA 3DTKA 3IUOA 3RQIA 3K9TA 3PO2J 3U9GA 2HFHA 4D5FA 1FTZA 3KEQA 3KIOA 4UHTA 3FDYA 5EGOB 2A6TA 2O61A 4HDUA 5ED4A 3FXJA 2DFEA 1E0EA 2CMPA 2E5ZA 1U2WA 3BR3A 5CVUA 2Q2EB 1MDMA 2LOOA 1ZGAA 1HQCA 1MBKA 3OOPA 3BR2A 1ZGWA 4XKCA 1JGSA 3CDLA 1UFMA 4M3BA 5HNHA 2FU4A 4UV8A 5K7FA 1J59A 1SVLA 2X1DA 3PNTA 3HUGB 2VJIA 2D1HA 2X6YA 1JE8A 1DU0A 3DKWA 3S14J 4I02A 1J2XA 1MDMB 3C2GA 2MH9A 3EYYA 4B3AA 1XC5A 2NOJB 3RKYA 3TP3A 1JGGA 1TQPA 2F5CA 5K5QA 1TP4A 1STZA 1WI9A 4ZZLA 3A0HC 1E3OC 3LQQA 1VI0A 3OR2C 2COBA 3DBHB 4OAZA 2VT2A 2EFPA 2STWA 4U88A 4G8XA 2IT0A 1WJ5A 2CQXA 3BC8A 3PUBA 2HQRA 2H8WA 5IP7J 4HEA2 4U7DA 2QBYA 1BW5A 3ZPLA 1WPKA 1BC7C 2VOPA 1U5TB 5FD5A 3PSIA 4XLFA 3Q0UA 2R7SA 5LHHA 4N9HA 4FISA 2GIVA 3E6BA 1ZGJA 1IRFA 5E20A 1QPIA 3GO5A 2HYFA 2KZVA 3QP5A 2QSFX 5H6QA 1KQ0A 2HZTA 3CJTB 3UKGA 1X1PA 1OLTA 1QZYA 4L5IA 3GEZA 2QCOA 4Y7NJ 5IOYA 4AD9A 2P6SA 1BJZA 3ZXSA 4C2UA 2FOKA 3S1RJ 1YO5C 2JN6A 3LSTA 4DZJA 1TBXA 3G71I 4IHWA 1R4NB 1U9NA 2M8GX 1P4XA 9ANTA 2EZIA 1GVDA 1XCBA 2QWWA 1YJNI 2Z16A 2KDOA 2R5ZA 2O03A 5H20A 2DQLA 2PMHA 1YW8A 1U3EM 4M74A 2Y9YA 2RREA 5LHGA 4LITA 3S16J 1UCRA 5ICEA 2DA2A 3QQAA 1G2HA 2GQQA 3L9FA 1JKRC 1ZG5A 4ZTFA 3SYTA 4NC7A 3TDZC 3I3LA 2A68F 4BAYA 1UMQA 1BI2A 1LDKB 2OUMA 2H1LA 4XL9A 1Z1DA 3SEZA 2EA2A 4NC6A 2OD5A 2DODA 3TO7A 3ABMH 1VQOI 1Y39A 2ETHA 2NS8A 2IA2A 4PSWA 1MMAA 2WADA 1V55H 2L54A 3HC7A 3K4KA 3LSKA 1A04A 1JJ6C 5DEQA 4UUSB 3DTEA 4L9NA 1GVJA 2CQ7A 3I56I 3CCSI 1IG7A 3MKYB 1SMYF 1DU6A 2IBDA 2NVYJ 3FXOA 2RV8A 4UVAA 3HUGA 3QP6A 4CCNA 3ZRGA 4A3GJ 1Z3XA 1OFCX 1ITYA 2VKDA 2H6BA 3IC7A 4BL0B 1YYVA 2FQ4A 2DI3A 4I0AA 3ABKH 1VQPI 3IAM2 3S1QJ 1BC8C 2VQHA 1H8AC 3OYNA 1NG6A 4FASD 2G9WA 3HOTA 2HWVA 1Z21A 3SJMA 2DW4A 4Z2YA 4RGUA 1WH7A 4XLCA 1N78A 1TWFJ 3C18A 3ISPA 1OR7C 3GWZA 3LA2A 2AO9A 1W5SA 3HTSB 3OSFA 3SEQA 4K2EA 3FXUA 3RI4A 5CVRA 2WAQN 2PX9A 2VONA 2MSYA 5IYDJ 3KP7A 2HYJA 2L0KA 4EQQA 4J01A 3FXRA 2LFBA 3O6BB 2MGQA 3I5UA 3VYTB 4CZZA 3RTRA 2ZBKA 4FHTA 2ID6A 2RKHA 2KJBA 5E3NA 2IGOA 3NRVA 2BBYA 2CFXA 5GAHJ 2I5UA 3K1MA 3K2ZA 2LSOA 1LJ9A 4BUPA 1FP2A 1IC8A 5J8FA 3SXYA 2NNNA 2VXDA 2X4HA 2R7XA 4DYCA 1ZR4A 3VYRB 3KZIC 2KRFA 3WTSC 1D0XA 3ECOA 2XAJA 4XRMA 1JT6A 3MD2A 1SD7A 4XLHA 4A3MJ 1JXSA 1FLIA 3HSRA 2EA4A 2XSJC 4M3FA 4U87A 2OU2A 3RDIA 1CF7B 2V6CA 3S2HJ 1OJLA 1MBGA 1FNNA 4MIMA 4RLFA 1TWHJ 3LSRA 1YI2I 2HTSA 4BQNA 4F92B 1MIJA 2P5VA 2QUFA 1S72I 3S3NA 1RC9A 2QQ9A 1TWGJ 3ASOH 5TJJA 4I98B 4DW6A 2GA1A 3KE2A 1FMVA 2HTJA 3K6GA 5HNFA 3VFZA 1T33A 1G8XA 4I0BA 4RAYA 1KZHA 5HODA 4G7ZF 2PJRB 3MFKA 1FEXA 2WY7Q 3WTYC 2DCEA 2QVOA 4C3IJ 4KITB 1EJ9A 1D5YA 5K1YA 3C3WA 3TO6A 3FM5A 1IV6A 1I3AA 5FKLA 3IWFA 4II2A 2UUZA 2DJNA 2ELHA 4MEYF 2A05A 4E70A 1F5TA 2P6TA 5IP9J 2ECBA 5EG0B 3FWEA 2EH3A 2KRHA 1JHFA 5FO5A 1LVAA 2DMNA 5HDKA 4HA8A 1U8RA 3TQNA 4AYBA 4E7SA 1OKRA 4XM3A 1LDDA 4X6AJ 5C4JJ 2XV4S 3CCEI 5ICGA 3CC7I 3H5RA 1V5EA 3SDGA 4AVPA 4BXUA 4JX5A 4CSWA 3RPUA 1JI8A 2VQGA 3DU5A 3WGGA 4ESJA 1YITI 1FMWA 1OPCA 1B9NA 3U2RA 3IKVA 1W4MA 3F3XA 4JBAA 2VE8A 3FZVA 1OYYA 1V54H 4E6KG 4YFXF 1UHSA 3C2BA 3RPQA 2QEXI 1GXPA 3VSLA 2JTVA 2ACJA 3KEYA 4EJWA 5F0HA 1LFBA 2R7TA 1ZKGA 3Q3SA 2F4MB 1O4XA 4ON0A 3BQYA 5HLIA 4F3QA 2IA1A 3OYAA 4OIPF 1B6AA 1QNTA 2PJPA 3BR0A 1X3WB 1X58A 3JRCA 4HF0A 1AHDP 2HOEA 4DIQA 4GRIA 3BJAA 4EM0B 3D5SC 4U7BA 1I3QJ 1XTAA 3HPHA 4I01A 5FLVA 1QU3A 3IRQA 1T8IA 4A3DJ 2VBZA 4MLOA 3JTHA 2FOWA 4I76A 3EUHC 1S7OA 3G1OA 1V3FA 4JK1X 3BJ6A 2ZMEB 3DV8A 4JX4A 4BJ6C 5H2FC 3GZ6A 2DA4A 4KISA 4YFNF 1ERDA 3KX2A 3HRMA 5HOOA 4D9JA 3KYCB 2JRTA 1VZ0A 3FMSA 4D5CA 2JZYA 3FF5A 1IRZA 3M1CA 5GTIC 1FBUA 4HX7A 1OCPA 4L9VA 5D5UB 2GOXB 3BP8A 4L5JA 4XLEA 3HOXJ 2OZ6A 3L09A 3BG5A 1FSEA 4M71A 3VB2A 4G6QA 5AONA 3IAS2 1B1BA 2PMZA 2F48A 2BXZA 2ADUA 2UV1A 1QVTA 5CVJA 2NS7A 3T0YA 2L9VA 4L9TA 1W36C 1ONVA 4HSTA 4Q47A 4PJLA 1G3SA 4A5NA 1FP1D 3SFIA 3BPXA 1VQ7I 3LWFA 4EV0A 2LD5A 2KPMA 4V2FA 1IV8A 2WTEA 2EZHA 1LPQA 2Y9ZA 2CW8A 1DDNA 3MVPA 3HOWJ 4Y13A 1LFPA 3COAC 4BXXJ 5BOXA 1Y8QB 4HRIA 5J40A 1IO2A 3LL7A 1GDTA 5DDGA 2BY0A 2OBPA 1L0OC 5DV5A 4V2GA 2LG4A 4UV9A 4GGGA 4RBOA 1JUPA 2FBHA 1U78A 3HRTA 4RA2A 3H3VK 2XKOA 2P0WA 4RAZA 5GTHC 1FIPA 2HEOA 1QZEA 1B4AA 2KZGA 4RAFA 3OS2A 2VUMJ 4LGWA 3V7RA 1MSEC 1Z05A 3SFZA 1B72B 2FA5A 2XF5A 3CJQB 5CVIA 1F36A 4KN4X 4A2UA 5C3EJ 1EH8A 5FKMA 3MQ0A 4HNTA 4D7MA 5KK1A 1YTYA 1XSVA 4P96A 3WHBA 3G3ZA 4HDVA 1S6LA 4XORA 2FRHA 4M9XA 1WQ2A 1OQYA 4GXOA 2OTLI 4DYRA 5CPRB 3TGNA 3KETA 4IKFA 3DLLF 2E35A 3LFUA 3MKZA 1W0UA 1OCZH 2CUJA 2HU9A 5IYCJ 1I27A 2DMQA 3CMEI 1WH5A 5KCMA 5EZHA 4G6TB 1YX3A 4Y4RA 2VJJA 4ABZA 2WBMA 2QM3A 1YS6A 2XGCA 1R1UA 3ABLH 1SEUA 4M3EA 2H6CA 1T95A 2F4IA 2GXBA 2A5YB 3IP4B 4DBRA 1GT0C 3F23A 2DFHA 1X2NA 4MQVA 3F8FA 3BPVA 2FEZA 3AG2H 3BG7A 4AM3A 3JRAA 2AS5F 1ZRFA 1BL0A 2B0LA 3W6KB 3O8GA 3JRHA 4LG3A 1O57A 2XRLA 5ILUA 1SMTA 1LE8A 2CJJA 1IAWA 1MNEA 1MD0A 5LEJA 2GA2A 3D5LA 3ZQQA 2DMPA 2GZWA 2VJ4A 1XCVA 2CQKA 2YX7A 4IHSA 4EATA 2DK5A 2QQBA 1W7PD 2BVLA 4XIDA 4RGSA 1V5FA 1RR8C 3CP2A 3ELKA 2FXAA 3UR3C 3CMYA 4XSXF 4A12A 1JUMA 4O3MA 3RZOJ 2IXSA 3RJPA 5FRNA 4E7IA 1A6QA 1F4KA 4CUGA 1YRNB 4GYGA 3CCLI 2R5YB 2K9QA 4XN3A 5HS9A 1IN5A 1S8NA 1KGSA 1B9MA 5LRRA 5HLTA 2LH9A 2V1DA 2XIGA 2FSWA 1LEAA 1YG2A 3FX3A 2A5WA 4QLCU 1G59A 1W36D 5IOZA 2XVCA 2MD5A 3GTLJ 3DTIA 1LQ1A 1Y1WJ 4AUXA 4A0XA 2O6GE 2LP0A 2W25A 3G1LA 5LGUA 1VTNC 1XN7A 4KUMA 1MMSA 3HOVJ 5FD6A 3GUDA 4RGXA 1X4OA 1IN7A 1Q1HA 1RR7A 3EDPA 3VYUB 5L3FA 2MH2A 2M87A 2ZFWA 4HG2A 2IS2A 2ZB9A 2VIXA 4ENKA 3CD6I 5FKNA 4EJOA 5FKKA 2CW7A 3PQJA 3M1EA 2VL8A 2XDVA 2HPMA 1I6HJ 2CV0A 2HR3A 1VQ8I 3K1PA 1LNWA 2OV7A 3WG7H 2HXOA 2EV5A 1F9NA 5GAEJ 2KQRA 1T38A 5BS6A 2AXTC 2E34A 5E3OA 5BPDA 4Q4ZF 2K9LA 2NYXA 2JA6J 4B47A 2HDCA 4PFPA 1O7LA 4C3JJ 2W48A 4CICA 5HVQC 3WGHA 2W57A 2W7NA 1EF4A 3ZQ7A 4G6DA 1DUXC 1BBYA 1ULYA 1I50J 5F0FA 4AYBN 1RKTA 4ENJA 1VQ5I 4JP0A 2R7RA 3S15J 3M4OJ 2R7VA 2HKXA 4C2TA 2OCEA 3NAUA 5KAIC 2DTZA 4KICA 3TW6A 4OINF 2HOSA 2IA0A 1QO0D 1IZ1A 3ABUA 1DGWY 1SFUA 2H27A 3S93A 5H6RA 3W3CA 2Y2ZA 5GAGJ 2VC0A 4KIBA 3LOCA 4MFDA 3I71A 3F21A 4MQ9F 2STTA 3I4MJ 5JVTA 3DCFA 2QQAA 4EVIA 1K79A 3JRDA 3WTXC 3OYHA 2DPDA 2ZXJA 1ON1A 2YPRA 3LAJA 3HOZJ 4G9YA 4HQMA 1Z9CA 2L5QA 1NK2P 3E0JB 3TEDA 2V9VA 4WXHA 5D8KB 2HQ5A 3WODF 2WB1N 4XKVA 3LA3A 4JQFA 2GWRA 2DA5A 5D8LB 4Q5SF 5K7ZA 2LTPA 3OIQA 2FNPA 3TOBA 1D8JA 1FYMA 6PAXA 3GTMJ 3W6VA 3MMYB 1WSUA 2OPTA 3KYLA 2R4GA 3E97A 2EB7A 2X6WA 4HW0A 2V4JC 3ZCOA 4F55A 1PP7U 2CV1A 3WE3A 4XK4A 2MABA 3MZYA 5L3CA 3L1PA 3V8LA 2UXNA 2W82A 2KT0A 2ICWG 1Y0UA 1T6SA 1P2FA 3OWTA 2QGUA 4DZPA 1HW5A 2K9NA 2P5KA 1B8IB 3S32A 3RKQA 5D6EA 2M0CA 1I39A 2B63J 3S3MA 1REPC 1WJBA 2ZSIB 3K70D 4LK0F 2X6OA 3SHFA 5LRSA 1SD4A 2P81A 3OYJA 3K10A 3PNVA 2DMTA 1HDPA 4KNYA 2ME6A 4UXNA 1TW3A 4AC0A 4EMSA 1FT9A 1JKOC 3RPUD 2XAFA 3ZQFA 4AIJA 3ZMVA 1BW6A 3BTCA 4IEJA 5ERIA 2MG4A 1UHWA 1BM9A 1V4RA 2K86A 5M5WJ 3EUHA 4WXCA 2VODA 2R7UA 3A01B 2M7BA 3QYFA 4P5OA 5IP6A 3RZDJ 4Q48A 1MZBA 2HPIA 3GTPJ 5F08A 2E1MC 2EFNA 2NVTJ 1MJBA 3TL4X 2E1CA 2L4MA 4C9YA 1OR7A 2DJIA 1OYIA 1YW7A 1MBFA 1R5HA 1LKXA 2HGCA 4YIRX 1ZHFA 5E8IA 2IGMA 1A36A 1KQ9A 1T2KA 2UZKA 3SZTA 5F1JA 3MN2A 2RDPA 3G1MA 1IN4A 2V1NA 4QPOA 4UUVA 2XUBA 2AQEA 2PG4A 2ZMEC 2BOLA 3CO6C 1YW9A 4F7ZA 4HF2A 2EWNA 4YFKF 4RDUA 1B72A 3GFJA 2J5PA 1P7JA 3IRRA 2RN7A 3PIPF 1ZQ3P 2HZDA 3D5RC 3V42A 4M3DA 2AQFA 3PSFA 2JSPA 5EDNA 4BACA 2A6HF 2NOGA 2V7FA 2XGXA 1ZG1A 1XD7A 5LGTA 1K61A 4XMYA 2VJ5A 3OYIA 4A3CJ 3KLNA 3RSNA 3OYMA 1ETYA 2BY3A 2R7OA 2IEKA 1PVEA 1BI0A 1WGXA 3QOPA 4X1EA 5E79C 3P5JA 3R0AA 1D3YA 3VDXA 2L7MP 3J7ZI 5L3BA 2H8RA 2DAOA 2M2EA 1PJRA 2M1BA 1ZTRA 4U0WA 2Q8KA 3GXOA 3R6SA 4HLYA 2BHZA 2PMZN 1GLNA 1ON2A 3CF2A 3GBGA 2K3FA 3QWLA 4BGDA 3S17J 1IXCA 5ILSA 2Y0SN 3HJEA 4HNUA 3HTUA 2CUFA 3PM1A 1FJLA 3K4LA 2M5WA 5LEKA 2A07F 1YLFA 3B73A 2ZJRF 3TO9A 4BEHB 1QRYA 4FE4A 5EEHA 4X0GA 2DPUA 3F0CA 3ZQGA 2ZXIA 4XBFA 1AOYA 1MH3A 2V9PA 2XGEA 4L0YB 3H1CA 1ENHA 5HS8A 2XAHA 3PFYA 4BYYA 4DNCA 3MZ8A 3WTUC 3I59B 2MLKA 1Z7UA 2HOAA 1Y6IA 1TQMA 2ZKZA 4H0EA 1UG2A 1JT0A 3FXLA 4CO8A 3MKLA 4KT6A 1G4DA 4H4KC 1IUFA 2PN6A 4BHCA 1R6RA 3DKXA 1O3QA 2JUGA 3BCBA 2QKMB 4J00A 2CV2A 3DFGA 2DFIA 3BZ6A 2HQAA 2QF7A 4WXDA 3Q0VA 1YJ9I 1FBQA 4M73A 1ZLKA 4I09A 3IWZA 3FMQA 1BIBA 3ZR8X 3LSHA 3M9AA 1R71A 2L7ZA 2KDZA 2NS0A 2DOAA 4BDYA 5J3LA 3REOA 3HHHA 2Z1DA 1HLVA 2BW3A 1IXSB 2R7QA 4N0BA 4BBRJ 4QIWN 2FMYA 3AL0C 4BQAA 3E1SA 2PEXA 1G3YA 1K4SA 4G7OF 3WU1B 2V1UA 3C2HA 3CCRI 4PSXA 2HKOA 1IDZA 4ZDOA 3K0LA 4HV5A 3QODA 3HKZN 4L9JA 2OQRA 1JKQC 4LLGF 2WWYA 2UWMA 4PK4A 2JVGA 3DPTA 1TW2A 2EQRA 1HBXG 3GMEA 3GYHX 1UB9A 1YE9A 2DN0A 3QOEA 2XPUA 2Y69H 3N97A 1O3TA 2XROA 1KONA 2MD0A 4S05A 5DUIA 3CZ6A 2O8XA 5GPCA 2JPBA 1HKSA 4ZDPA 4ZDLA 2OJED 4QWQA 2P7CB 3OY9A 2JSCA 1KU9A 1V5GA 2JQ7A 3BY6A 2GIZA 1POGA 2ME0A 2LNBA 2Y75A 1SVOA 3KP5A 2JT1A 1MGTA 1TQIA 4A3IJ 2VBWA 2V26A 3BR6A 1ETKA 2L9SA 4FCYA 4XLPF 4IHTA 3W2VA 5F0CA 3R60A 1J0RA 1PUFB 1TL8A 3O8HA 3E5UA 3ZMDA 2M4GA 3AG4H 4XQFA 3E7LA 1H88C 3LA7A 4RB0A 3CCQI 3AG3H 1TNSA 1M1EB 1WVRA 2NXNB 1CF7A 2MBFA 4KDPA 2L9NA 2F5VA 1XX5A 1YQAA 3S1MJ 5A2QK 5D5VB 2DT7B 4NUBA 4EJVA 3VWBA 5FROA 3P9KA 3GZNB 3I59A 3IHUA 3TKYA 1X1DA 1USSA 4NHJA 2CFOA 4HX8A 3RKWA 1UJ8A 2G7UA 1E17A 2ISZA 1MW7A 2K85A 3L2CA 1KQ8A 1BR1A 2E2JJ 2O5RA 1S5LC 5DCMA 1CQTA 3KPHA 5CYVA 3DEEA 4ENMA 4KN7X 2IGKA 4ESFA 3J80Z 4F93B 3NWSA 4BY1J 3BDDA 2GLOA 3PFIA 3V8KA 2YR2A 1SD5A 1YX5A 4AIKA 3HHGA 2R93J 3JR9A 5B3SH 2XB5A 4QPQA 5BNGA 1Y8RB 1HCRA 4FE7A 3RYPA 3U1DA 2EIKH 4UVBA 1MNMC 4BH9A 2FBIA 3TOAA 2ELJA 5TGTA 2E1NA 3HKZA 3GW2A 2CS3A 2A3SA 3ZQHA 3HGGA 1RUOA 1PUFA 1IXRC 2QQ8A 4XRFA 1AU7A 1Z91A 3G73A 3HOYJ 3GFIA 1HKQA 2VPLA 1Z67A 3DPUA 1ETVA 3E3VA 4ZYHA 2PBIA 3GCMA 4D0PA 5TRDA 3I4PA 1FY7A 3H0GJ 4P9FA 3ZMUA 1LE8B 3JAMK 5FJ8J 3P7NA 3CJNA 1XGNA 2QYOA 1Z7LA 2PJRA 2LKSA 2CH0A 3F8NA 3VEPA 4C2MJ 2WAQA 4I7HA 3WTTC 3WG9A 2JWTA 2X48A 1Y0NA 2COMA 4RMNA 5D6FA 4QTRA 3I64A 3ERMA 1G6NA 3BJOA 3JCUC 2YS9A 2VKEA 2Y30A 2ZJPF 2AHQA 3PL8A 3QPLA 1YOVB 2DLLA 3R61A 3E5XA 5EYRA 1KYWA 2IVMA 3F8MA 5FRMA 4CYDA 4V19K 1S7EA 1J9IA 2YX4A 2FMLA 1N75A 2KRCA 2LF8A 3OYKA 3X2QH 1K7AA 2BV6A 2HVQA 1SFKA 4YELA 4XICA 3QRFF 3J7YJ 4B44A 4ESBA 2WB1A 2D45A 1HC8A 3S3OA 3DPLC 3I55I 4R79A 2YUSA 3IL2A 4E7LA 3OSGA 4I99C 2BXYA 4M6VA 2XB0X 2OQGA 3S2DJ 1XS9A 1S3JA 4WK8F 2OAZA 3M7GA 3QPSA 4IHVA 1AKHA 1DQUA 2EBIA 1IRGA 5FFXA 3FIWA 1BI1A 3RIRA 1HSJA 2G7HA 1Z6RA 3HBLA 4HNVA 1YFHA 3A01A 2OA4A 2DYSH 3H0DA 4IRGA 4YIIA 2A61A 1MMNA 2R0QC 3EUKL 4XRSG 5F1RA 1K78B 2LBFB 3HYIA 4CCOA 3PJRA 1RESA 3HSEA 3M8EA 3J7AY 1Y1VJ 2JA5J 2IJLA 2K5CA 2LKXA 5DS9A 2Z9OA 4OMYA 5A2QZ 2YU3A 1F43A 2RNJA 3AAFA 5ICFA 2DOEA 2EINH 2MFZA 4ZJZA 2FUG2 4KMUX 2AXLA 4CCLA 4B48A 2X51A 2OC6A 1ETWA 3CC4I 4G94A 5LBQA 3QYEA 1Y56A 2D2WA 1SANA 2XAGA 3BG3A 4ZYAA 4IRHA 4B43A 3WTVC 3CCYA 2QBYB 2R92J 4I2OA 2VXZA 3OYFA 2CUEA 2GXGA 4I6ZA 4A3BJ 4UB6C 2CSOA 4ITVA 3CUQB 1MMGA 3K4MA 5CJ9A 2PI0A 1GXQA 4LK1F 2KP6A 4BE0A 3ZQLA 1D1CA 2N8GA 5F27A 1NG7A 1QHGA 2QENA 3CDHA 4JX6A 2VB6A 4Y3OA 2VT3A 3IH2A 4A3EJ 2Y31A 4BS9A 4GYIA 2WAFA 3ABTA 2ZC2A 3H92A 4IJAA 1JJ8C 4KT5C 1P92A 4P55A 5M5XJ 4MEXF 3ZN1A 4NDLA 4BE2A 1Z77A 2BY1A 4OU0A 4IXAA 3BG9A 1EH6A 2EZLA 1SFOJ 3E6DA 1R23A 2K7LA 3PO3J 1O3SA 5L3EA 5M3FJ 5F6FA 3A02A 1XMAA 2V6EA 3JTGA 1R1TA 2BVMA 3SZGA 1R5ID 2HNHA 4UNOA 1HW1A 2M7AA 4Y15A 3RKXA 3LMMA 4IVNA 3S2WA 1U0JA 5D5WB 5EGOA 1ZN2A 4B4CA 4E7HA 2O9LA 4RGRA 1FOXA 2O3FA 3A1YA 4P9UA 2IS6A 5JFRA 2VBXA 1YIOA 3HEFA 4O6JA 4XKBA 1UELB 3V7SA 5K5RA 3FMRA 5J47A 2L7KA 1VFCA 2F5DA 3JRIA 3GTJJ 3L00A 3I58A 1UAAA 3H5AA 3N05A 3U21A 1FX7A 1GV2A 4PGGA 3ULQB 3HDDA 5J1RA 1MBEA 3OL4A 4RS8A 3L2QA 5TISC 2C6YA 3BROA 3CMMA 2CGPA 3V7CA 4M3GA 3FK7A 4IQJA 1BR4A 2HVRA 4XR6A 5BMZA 2EFWA 1RI7A 1R7JA 5AIQA 2P8TA 3BZCA 1FWZA 1U9OA 1Q1VA 1FTTA 1OYWA 3ECHA 4BHPA 4MO7A 2Y0SA 4BNCA 3BLYA 4YEJA 1O3RA 2XHKA 2WV0A 3I53A 1X3UA 5KVRA 1HF0A 1R9TJ 1ZG3A 4OAYA 1D1BA 3FKJA 3NQOA 3OYDA 4U0YA 4XRSA 2Z33A 5HS7A 3IH4A 3H36A 4KA4A 2VASA 3K7AJ 5GP9A 5DM6F 1X4PA 2BW3B 3DP7A 3ZMTA 1CGPA 2E36A 1WI3A 4XOTA 2O0YA 4ZYEA 3OYGA 2PMUA 3MEXA 2HDDA 4M6YA 2HXIA 4MFEA 1XPXA 4WCGA 2ZSHB 2F6CA 4HZFA 1TWAJ 4Z6YA 3DKYA 4IPAA 3O3KA 4XOPA 3W6JB 2M30A 2W85A 2F5FA 1MH4A 3H9GA 3J7AO 4FT8A 2LK2A 1RETA 4AIHA 3P9CA 3SDBA 1C0WA 3F8CA 1RZ4A 4M9SA 4BDZA 3GZ5A 3W2AA 5LGNA 1ETXA 1SD6A 1QHHD 5CLSA 5DCFA 4A3KJ 1ZR2A 1U6GA 1JUSA 3K4CA 1LDJA 3QPTA 2R7FA 3HRUA 2Q2EA 1BIAA 2ELKA 2XPVA 2HS5A 2ZNZA 2JPCA 2MA3A 3OL3A 4YRVA 4KIGA 1IRXA 1BJAA 1SFXA 2M8EA 2OZUA 3VOEA 4ZTJA 1ZH5A 3OYLA 1HOMA 3OIPA 1FOWA 2LRDA 2BEOA 5FFZA 4HV6A 3F9KA 4LG0B 2FNAA 2WA0A 3K1NA 3ONQA 1G3TA 4BQQA 2E2IJ 4UUSA 1OCTC 3CLQA 2PLYA 3AG1H 1NK3P 3A0BC 5LLQA 4A69C 1R5GA 2JJ7A 3TDUC 2EK5A 4CCJA 2XC7A 4HAMA 5F04A 5BQTA 5M5YJ 2LLKA 4PJ0C 4Y17A 2JUCA 3WTZA 1ZREA 3A2KA 1PYVA 1ACIA 2RVCA 3KZZA 5FKOA 2VQLA 2G0EA 3GFLA 2VPRA 1R22A 2HYGD 3PNYA 1SVMA 1D5VA 4XONA 4A0ZA 2L01A 4PJNA 1LUJB 4NQWA 4XNFA 4LOCA 3J81Z 3GLLA 3JRGA 1FYLA 1WRJA 3ZN0A 2TCTA 2XGDA 1X19A 3EQLF 1WWXA 5EEAA 2FQ3A 4G12A 4S04A 4ZYGA 2OCCH 3L2VA 5J4VA 1DGRM 5EG0A 1YRNA 2I8DA 2KIUA 3JRFA 2HVSA 4RLQA 2KIMA 3ERED 2YU9J 4BU2A 5HDNA 2DYRH 1R58A 3WTWC 3M3YJ 1I1SA 1R36A 2DDBA 1HSTA 2KKOA 2P4WA 2NVUB 4GO1A 4B3XA 1Z0XA 3RYRA 3CUQC 1FYKA 3C7JA 1G3WA 3Q9SA 4N9IA 3L2WA 1D8KA 4L5EA 5E17F 3IV5A 2M0MA 4S0HB 4EJTA 1OCOH 1T98A 4Y33A 1A6IA 3QU3A 2W4SA 3MZHA 2R3SA 4BJTA 1OMIA 1ORKA 3BG6A 4IQ4A 1A5JA 1E2XA 1UG0A 1WJCA 5J1UA 2QZ8A 3KP4A 2HDWA 1YIJI 1TNTA 2X85A 3BOQA 1H89C 1ZAOA 3LNQA 1XDUA 2NVXJ 2HI3A 5IT3A 3OMYA 3MKWB 2BY2A 2CU7A 1B8IA 1AA7A 4LLNA 3VPRA 2L7FP 1SFEA 1NTCA 1ETQA 3K4JA 2E1OA 5D4RA 1R49A 1ZK8A 2RQQA 2Q1ZB 2E19A 3ROUA 4EM2A 1GUUA 4OIQF 2V9KA 2MW8A 3DBLB 3PQKA 2DXIA 3FHZA 4J19A 5C4XJ 4M72A 1EV7A 5ICCA 2FX0A 4IOAF 2M9HA 2BGCA 1D1AA 2DA7A 2IPQX 4ENNA 4CCKA 3KLOA 2LR8A 3ASNH 4XLNF 1EH7A 2ZO4A 3OS0A 4GDFA 3MWMA 5FGMA 2ECCA 3A03A 1K6OA 3FHNA 1T0FA 4HPQA 4BEHA 3BTIA 3FBIB 4EM1A 1UZCA 4LG0A 4UUTA 1VQKI 1BOAA 2F4OB 1QPMA 3GF2A 3E6CC 4HX4A 3T1BA 3AKZA 5EF6A 4BXFA 2ID3A 3K70C 1B59A 4AU7A 4CCMA 1VQ6I 1T08B 4N4NB 5DTDA 4TV7A 4E7KA 2H1KA 1RUNA 4MHGA 1J7KA 3LQRA 3F72A 4R1HA 4BQOA 4BE1A 5DCMB 4CXFA 1WJFA 2BYVE 2IRFG 2E60A 3GTOJ 4B09A 5HLGA 3JSPA 3HPGA 2XF7A 1K4TA 2MLGA 1F1ZA 4AIDA 2VE9A 3HOUJ 4IRIA 3FISA 1IW7F 4L18B 3S8PA 2LDUA 1HDDC 2CRGA 1H9TA 1TTYA 3F6OA 2DK8A 5JHUA 1MKMA 3VODA 5E1ZB 3UNGC 3BCAA 2IGNA 2LREA 1LEBA 4WF2A 1PUEE 1RKWA 5IPAA 5E18F 2DDAA 2DBBA 3JAMZ 2JMWA 2LYCA 3HGYA 3BR5A 1TT0A 3HIFA 2O7OA 4LLLA 3EYIA 2GBYA 5E1WA 5JVGF 1RNLA 1T39A 5EEGA 2D5VA 3OIOA 5B5EC 4MNUA 5DUKA 1FOKA 3FXQA 2FF4A 3TBIA 4CDGA 1TWCJ 4CZCA 1MJAA 4CYCB 1KU3A 3BR1A 3E6MA 3WU0A 2VLAA 4JYKA 2QA4I 4IX7A 1USTA 3LAPA 5L3DA 4XLAA 3HL2A 3FM3A 2XF6A 3W2WA 2NRAC 3BT9A 3I0TA 4LB6B 2YSRA 3I9V2 1X2MA 2BE5F 5J4YA 4XSZF 3CJRB 2QSHX 3KYDB 4KFCA 2ZXHA 1X1BA 5D4SA 5K5OA 4P1WA 2TRTA 2VOOA 1TC3C 1YHQI 3GTQJ 2ZJQF 4ZC3A 2EZKA 2XAQA 2VKHA 4XKWA 4IHYA 1X1AA 2E7WA 1I1GA 4PJJA 5EZGA 3OYBA 2DA6A 1JTYA 1BA5A 1XDSA 2W1OA 3GLXA 2XKPA 1K6YA 4MGRA 4UB8C 3I54A 3DQVC 3M8JA 1RPWA 3CQZJ 1HKTA 1NH3A 4LFUA 4R8HA 4A93J 1SAXA 3FK6A 5JLWA 3KEOA 2QLZA 2EFQA 4NQWB 3CUOA 3M07A 2R5ZB 1O7FA 2X1CA 2ZCWA 1QGPA 2F5EA 3TMOA 4D1QA 1VQMI 1ODDA 2X0LA 1QVUA 3JREA 3NARA 3D0SA 2CYYA 2FE3A 3T8TA 4PZJA 3F8BA 3H3ZA 3CCUI 1MNDA 2Z99A 1IUYA 1YS7A 4OOIA 4O5VA 1FBSA 4GCVA 5IYBJ 4IL6C 4W1UA 4M9ZA 2MC4A 2Y48A 4OWRB 5F64A 2DO7A 3CLOA 2KIQA 2FD5A 2K3PA 2FBKA 2E1MB 2H09A 2LY9A 3CUQA 2XRNA 2K4JA 3ESWB 4CGZA 1J5YA 1W1WE 3BQZA 2DT5A 1IN6A 2QKLB 1APLC 2I10A 2LF7A 2Z5UA 3U1KA 4AVZA 3LSPA 1FOYA 2LY1A 1LVKA 4LMYA 2KISA 2GM4A 2NNYA 1KYZA 1T56A 1ETOA 4HLXA 5AIPA 4BKXA 1FSHA 1E3PA 2F2EA 1H9GA 1VF9A 2WC2A 3AL0B 3HRSA 1WHUA 2L02A 4NC8A 2DQRA 5JI6A 3DBRB 2K9MA 3CO7C 1QA6A 2FJ1A 4PGHA 2EILH 1N77A 4XN0A 1E3HA 2E5NA 5B66C 2JVHA 3H9JA 2LY2A 3C1DA 1XMKA 5KHDA 4U0VA 4EGYA 1J09A 1ZRCA 1BOBA 4KIFA 1ZARA 2Q0OA 3P9IA 4HBLA 3J81K 1KA8A 4DGWB 4PDKA 2KMUA 2EV0A 2WV1A 1L3LA 2KHMA 2LMDA 3NWTA 3SQNA 3D1NI 3RQ4A 2LBFA 3FXKA 2NVQJ 4EGZA 1TT5B 1W7PA 4G7HF 2WY8Q 3M8FA 3QU6A 4LD5A 2HQNA 2OTJI 3GVAA 4CA0A 4BY7J 3F6VA 1N25A 1D0YA 2XSDC 2RC4A 3BTLA 5IY5H 5JHFA 1IGNA 5DD8A 4KJZA 1TLHB 1R4MB 1P4WA 4IZZA 3KP6A 3CDIA 4CYCA 2K9SA 1LB2A 5FLXZ 4ZYDA 1U8BA 2LVSA 3B02A 1IDYA 1WKMA 3LFKA 5FLXK 4ASNA 1WCMJ 1OCRH 2IW5A 1MSFC 1P7IA 1WZ2A 2KFDA 5FB2A 1VQ4I 1P9QC 1W5TA 3FXMA 4HOBA 5K7HA 5JLXA 3CESA 1D0ZA 2JA7J 3IKTA 4KMFA 4NBQA 3CCJI 3GTGJ 2VKVA 2VQCA 3DEUA 3CC2I 4UY8I 3HM5A 2JRMA 3KFWX 5DD4A 2DA1A 1RRJA 1J75A 2M3AA 3A4CA 4A6DA 2M4KA 2KLOA 1W0TA 2JA2A 4KYWA 5CVVA 2ZJ2A 1Z3YA 1SC7A 4HSRA 2ZMEA 3PUFA 5J8CA 4BHBA 2TDXA 4A3LJ 2QSGX 3G6EI 3ZP5A 3V8JA 4N4OB 4F91B 4IO9F 4RB2C 1I6XA 2V1XA 2X6XA 2Z2SB 3HOSA 1R00A 2UXXA 1ZRDA 2P5LC 3K2AA 2X1EA 4A6EA 4EJUA 4RM3A 2DT6A 2R7ZJ 3R0JA 4HQEA 4RAGA 5E8GA 3OYCA 2NAZA 4LIVA 3SZPA 2E2HJ 1HXDA 2W00A 3KZYA 3MAJA 2Z3YA 4OIOF 2GOMA 2VN2A 4PCQA 3DU6A 1HW2A 3DF8A 1TZLA 2J5OA 3HG9A 3BTJA 4C30A 4FTHA 5B1AH 3Q0WA 2ESNA 1JKPC 3NEUA 4DYQA 4B1RA 2ISYA 2CQNA 5M3MJ 2O8KA 2CG4A 2B7EA 3HXLA 5CKTA 2E7XA 1DPUA 5CQEA 1BR2A 4C3HJ 4AWXB 4HYEA 1FC3A 2E71A 3GX4X 4ZZDA 2PFBA 3LSIA 3K69A 1OCCH 2JK3A 3RCOA 2CWEA 4IF4A 3CP8A 4NNJA 2GAUA 3OR1C 5C44J 1U5TC 5E1XA 4ETSA 4QSHA 5E3LA 4DJAA 2MYSA 3VSKA 1T0FC 5KNLA 5BPIA 5EJCA 1Z6TA 4E7JA 1NHAA 3BWGA 1OISA 3I4NJ 3H9QA 3ZQCA 1XB4A 1MJ9A 3H3UA 2B9SA 5IT9K 1SAUA 2ZNYA 2K02A 3TW7A 4FQGA 2R7WA 1XGOA 3L2RA 3CF5F 3CTAA 2XAUA 1S9HA 2R5YA 4DOZA 1QBJA 2K4BA 4IHXA 4CHUA 5B1BH 1A31A 2A69F 2DFFA 1GV5A 2L9RA 2RAEA 3QAHA 4HF1A 4E4HA 2K40A 1VQ9I 1PP8F 1MMDA 1W5CC 5JR3A 1K83J 3KCCA 2R7DA 5CQGA 1LFUP 4FETA 2DOFA 2BZTA 2L2OA 4F52A 1S29A 4W97A 3OS1A 1XG1A 4II3A 3EUAA 4WX9A 3MCZA 1PDNC 3T8RA 3FKIJ 2DTRA 2P7VB 2CUZA 1P4AA 3J80K 1KU2A 1A35A 1WFXA 2EIJH 1FZPB 1IN8A 5L3GA 5GADJ 2ZFUA 1ZYRF 4DQ2A 2JA8J 2IS1A 1R1VA 5E3MA 4A5MA 4UVCA 3F22A 2KL4A 5LFAA 4LJZF 1JTXA 2CW0F 4EEFG 5LD2C 4RM2A 2DA3A 4JOMA 1DP3A 5DM7F 1S7AA 2D1VA 3E5QA 3N4MA 3IH3A 5GPAA 2ESHA 4RB3C 3L2UA 3ML6A 1I5ZA 3WGIA 3O2PE 2DU9A 3ZMSA 3ZMZA 4ANJA 2W84A 2LC2A 3FBNB 3ZOBA 2BHYA 4E7ZA 1FIAA 4YIFA 4PUSA 3DWLE 3DLAA 2WAEA 4WWCA 4ZH4F 2IAIA 1UHMA 2VC1A 3VYSB
chains in the Genus database with same CATH topology
3L7WA 5J6XA 2EJRA 1BN5A 4LB5A 2KIFA 4B8XA 4FX4A 2RQPA 2CO5A 5HDGA 1U5TA 2L3DA 1P6RA 4L0ZB 2IP2A 1BI3A 3V4GA 1QQIA 1QZZA 3Q5FA 1ZLJA 3DXJF 2H94A 2M45A 2MC3A 4M6XA 3HSFA 1AWCA 4FX0A 4RB1A 3JW4A 1IF1A 3KP2A 3T5XA 2W24A 5LHIA 1K78A 4OIRF 2RGVA 3R4KA 2XASA 4OMZA 3Q9VA 1RIOH 2Y0MA 5DYMA 2V79A 1DPRA 2KJCA 2K27A 1FPQA 2PQ8A 5IT9Z 1DP7P 5HLHA 1H0MA 1JHHA 3EETA 4MTEA 3WE2A 2LKPA 2L4AA 3KP3A 1GHCA 1XSXA 1KU7A 3GFMA 2EV6A 3QPHA 4NB5A 5ILVA 1XSDA 1W7PB 5D5XB 4MTDA 4A0YA 2VBYA 3JSOA 1XGMA 4YG2F 2A6EF 2EFOA 3OV8A 1XGSA 3K9TA 3U9GA 2HFHA 3KEQA 4UHTA 2O61A 4HDUA 5ED4A 1U2WA 5CVUA 1MDMA 1ZGAA 1HQCA 3OOPA 1JGSA 1UFMA 2FU4A 4UV8A 1J59A 2D1HA 1JE8A 3DKWA 4I02A 1J2XA 1MDMB 2MH9A 3EYYA 3RKYA 2F5CA 1TQPA 5K5QA 1STZA 1WI9A 4ZZLA 3LQQA 2VT2A 2EFPA 2STWA 4U88A 4G8XA 2IT0A 2HQRA 4U7DA 2QBYA 3ZPLA 1BC7C 2VOPA 1U5TB 5FD5A 5LHHA 4N9HA 2GIVA 3E6BA 1ZGJA 1IRFA 5E20A 3GO5A 2HYFA 3QP5A 5H6QA 1KQ0A 2HZTA 1QZYA 4L5IA 3GEZA 4AD9A 2P6SA 2FOKA 1YO5C 3LSTA 1TBXA 1P4XA 1XCBA 2QWWA 2O03A 5H20A 2DQLA 2PMHA 1YW8A 1U3EM 4M74A 5LHGA 1UCRA 5ICEA 2GQQA 3L9FA 1ZG5A 3TDZC 2A68F 4BAYA 1BI2A 1LDKB 1Z1DA 2EA2A 2OD5A 3TO7A 2ETHA 2IA2A 2L54A 1A04A 5DEQA 4L9NA 1GVJA 1SMYF 4UVAA 2RV8A 3HUGA 3QP6A 2H6BA 3IC7A 1YYVA 2DI3A 4I0AA 1BC8C 2G9WA 3HOTA 2HWVA 2DW4A 4Z2YA 4RGUA 3C18A 3ISPA 3GWZA 3LA2A 1W5SA 3HTSB 4K2EA 3FXUA 3RI4A 5CVRA 2VONA 3KP7A 4EQQA 3FXRA 3O6BB 3I5UA 4CZZA 3RTRA 2ZBKA 4FHTA 2RKHA 2KJBA 3NRVA 2BBYA 2CFXA 3K1MA 3K2ZA 2LSOA 1LJ9A 1FP2A 5J8FA 3SXYA 2NNNA 2X4HA 2KRFA 3WTSC 3ECOA 2XAJA 1SD7A 1JXSA 1FLIA 3HSRA 2EA4A 2OU2A 3RDIA 1CF7B 2V6CA 1FNNA 2HTSA 2P5VA 2QUFA 2QQ9A 5TJJA 4I98B 2GA1A 3KE2A 2HTJA 3VFZA 4I0BA 4RAYA 4G7ZF 3MFKA 3WTYC 2QVOA 5K1YA 3C3WA 3TO6A 3FM5A 3IWFA 2ELHA 4MEYF 1F5TA 4E70A 2P6TA 3FWEA 1JHFA 5FO5A 1LVAA 5HDKA 4HA8A 1U8RA 3TQNA 1OKRA 1LDDA 2XV4S 5ICGA 4AVPA 4BXUA 3RPUA 3WGGA 4ESJA 1OPCA 1B9NA 3U2RA 3IKVA 1W4MA 3F3XA 4JBAA 2VE8A 3FZVA 1OYYA 4ENKA 4YFXF 3RPQA 1GXPA 2JTVA 2ACJA 4EJWA 4ON0A 5HLIA 2IA1A 4OIPF 1B6AA 1QNTA 2PJPA 4HF0A 2HOEA 3BJAA 4EM0B 4U7BA 4I01A 3IRQA 2VBZA 3JTHA 1S7OA 1V3FA 4JK1X 3BJ6A 2ZMEB 3DV8A 3GZ6A 4YFNF 3HRMA 5HOOA 2JRTA 3FMSA 2JZYA 3FF5A 1FBUA 4HX7A 4L9VA 5D5UB 3BP8A 4L5JA 2OZ6A 3L09A 4M71A 1FSEA 3VB2A 4G6QA 5AONA 1B1BA 2ADUA 5CVJA 3T0YA 4L9TA 1ONVA 4Q47A 1G3SA 4A5NA 1FP1D 3BPXA 3LWFA 4EV0A 2WTEA 1DDNA 4Y13A 3COAC 5BOXA 5DDGA 2OBPA 1L0OC 5DV5A 4UV9A 4GGGA 1U78A 2FBHA 3HRTA 2XKOA 4RAZA 2HEOA 1B4AA 4LGWA 3V7RA 1Z05A 3SFZA 2FA5A 5CVIA 4KN4X 4A2UA 1EH8A 3MQ0A 5KK1A 1YTYA 1XSVA 4P96A 3G3ZA 4HDVA 1S6LA 2FRHA 4M9XA 1WQ2A 4GXOA 3TGNA 3KETA 1I27A 2QM3A 1YS6A 1R1UA 2H6CA 2GXBA 2A5YB 3F23A 4MQVA 3F8FA 3BPVA 2FEZA 2AS5F 1ZRFA 2B0LA 3W6KB 1O57A 5ILUA 1SMTA 1IAWA 1MD0A 5LEJA 2GA2A 3D5LA 2GZWA 1XCVA 2CQKA 2YX7A 4IHSA 2DK5A 2QQBA 1W7PD 4RGSA 3ELKA 2FXAA 4XSXF 4A12A 4O3MA 3RJPA 1F4KA 4GYGA 5HS9A 1IN5A 1S8NA 1KGSA 1B9MA 5LRRA 2V1DA 2XIGA 2FSWA 1LEAA 1YG2A 3FX3A 4QLCU 2XVCA 2MD5A 1LQ1A 4A0XA 2O6GE 2W25A 5LGUA 1VTNC 1XN7A 4KUMA 5FD6A 3GUDA 4RGXA 1IN7A 1Q1HA 3EDPA 5L3FA 2MH2A 2M87A 2ZFWA 4EJOA 3PQJA 3M1EA 2HR3A 3K1PA 1LNWA 2EV5A 1F9NA 1T38A 5BS6A 5BPDA 4Q4ZF 2NYXA 2HDCA 1O7LA 4CICA 5HVQC 3WGHA 2W57A 3ZQ7A 4G6DA 1DUXC 1BBYA 1ULYA 4ENJA 2HKXA 4KICA 4OINF 2IA0A 1QO0D 1IZ1A 3ABUA 1SFUA 2H27A 5H6RA 2VC0A 4KIBA 3I71A 3F21A 4MQ9F 2STTA 5JVTA 2QQAA 4EVIA 1K79A 3WTXC 2DPDA 2ZXJA 1ON1A 2YPRA 3LAJA 4G9YA 4HQMA 1Z9CA 2V9VA 4WXHA 5D8KB 3WODF 3LA3A 4JQFA 2GWRA 5D8LB 4Q5SF 2FNPA 3TOBA 1D8JA 1FYMA 6PAXA 1WSUA 3E97A 4HW0A 2EB7A 1PP7U 3WE3A 5L3CA 3MZYA 3V8LA 2UXNA 1Y0UA 1T6SA 1P2FA 1HW5A 2P5KA 5D6EA 1REPC 4LK0F 3SHFA 5LRSA 1SD4A 4KNYA 4UXNA 1TW3A 4EMSA 1FT9A 2XAFA 4AIJA 3ZMVA 5ERIA 1UHWA 1BM9A 1V4RA 2K86A 3EUHA 4WXCA 2VODA 4P5OA 4Q48A 1MZBA 2EFNA 1MJBA 2E1CA 2L4MA 1OR7A 1OYIA 1YW7A 1R5HA 2HGCA 1ZHFA 5E8IA 1KQ9A 1T2KA 2UZKA 3SZTA 2RDPA 1IN4A 4UUVA 2XUBA 2PG4A 3CO6C 1YW9A 4F7ZA 4HF2A 2EWNA 4YFKF 3GFJA 2J5PA 3IRRA 2RN7A 2A6HF 2XGXA 1ZG1A 1XD7A 5LGTA 3KLNA 1BI0A 3QOPA 3R0AA 1D3YA 5L3BA 2DAOA 2M1BA 4U0WA 2Q8KA 3GXOA 3R6SA 4HLYA 1ON2A 1IXCA 5ILSA 3HTUA 5LEKA 2M5WA 2A07F 1YLFA 3B73A 3TO9A 5EEHA 2DPUA 4XBFA 1AOYA 4L0YB 5HS8A 2XAHA 4BYYA 4DNCA 3WTUC 3I59B 2MLKA 1Z7UA 1TQMA 2ZKZA 4H0EA 4CO8A 1G4DA 2PN6A 4BHCA 1O3QA 3DFGA 2DFIA 3BZ6A 4WXDA 1FBQA 4M73A 1ZLKA 4I09A 3IWZA 3FMQA 1BIBA 3M9AA 2NS0A 3REOA 3HHHA 1IXSB 4N0BA 2FMYA 4BQAA 2PEXA 1G3YA 4G7OF 3WU1B 2V1UA 2HKOA 3K0LA 4HV5A 4L9JA 2OQRA 4LLGF 2WWYA 2UWMA 3DPTA 1TW2A 1HBXG 3GYHX 1UB9A 3N97A 1O3TA 2XROA 4S05A 5DUIA 2O8XA 2JPBA 1HKSA 4QWQA 2P7CB 2JSCA 1KU9A 3BY6A 2LNBA 2Y75A 3KP5A 2JT1A 1MGTA 1TQIA 2VBWA 4XLPF 4IHTA 3R60A 1J0RA 3E5UA 3ZMDA 3LA7A 4RB0A 1TNSA 1CF7A 4KDPA 2MBFA 1YQAA 5A2QK 5D5VB 4EJVA 3P9KA 3I59A 3IHUA 3TKYA 1USSA 4NHJA 4HX8A 3RKWA 2G7UA 1E17A 2ISZA 3L2CA 1KQ8A 5DCMA 5CYVA 4ENMA 4KN7X 4ESFA 3J80Z 3BDDA 3PFIA 3V8KA 2YR2A 1SD5A 4AIKA 3HHGA 3RYPA 3U1DA 4UVBA 4BH9A 2FBIA 3TOAA 2E1NA 3GW2A 2A3SA 1RUOA 1IXRC 4XRFA 1Z91A 3G73A 3GFIA 1HKQA 3E3VA 4ZYHA 2PBIA 4D0PA 5TRDA 3I4PA 1FY7A 4P9FA 3ZMUA 3JAMK 3P7NA 3CJNA 1XGNA 2QYOA 3F8NA 3VEPA 3WTTC 4I7HA 3WG9A 2COMA 5D6FA 3I64A 1G6NA 3BJOA 2DLLA 3R61A 3E5XA 1KYWA 2IVMA 3F8MA 4CYDA 1J9IA 2YX4A 2FMLA 2LF8A 1K7AA 2BV6A 3QRFF 4ESBA 2D45A 3DPLC 4R79A 3IL2A 2OQGA 1S3JA 4WK8F 2OAZA 3M7GA 1IRGA 5FFXA 1BI1A 3RIRA 1HSJA 2G7HA 1Z6RA 1YFHA 2OA4A 4IRGA 4YIIA 2A61A 5F1RA 1K78B 3HYIA 3HSEA 3M8EA 2IJLA 2Z9OA 4OMYA 5A2QZ 2YU3A 3AAFA 2RNJA 5ICFA 4KMUX 2AXLA 4G94A 5LBQA 2D2WA 2XAGA 3WTVC 4IRHA 2QBYB 4I2OA 2VXZA 2GXGA 2CSOA 3CUQB 5CJ9A 2PI0A 1GXQA 4LK1F 2QENA 3CDHA 2VT3A 4GYIA 3ABTA 4IJAA 3H92A 4KT5C 1P92A 4P55A 4MEXF 3ZN1A 4OU0A 4IXAA 1EH6A 3E6DA 1R23A 2K7LA 1O3SA 5L3EA 5F6FA 1XMAA 3JTGA 1R1TA 4UNOA 1HW1A 4Y15A 3RKXA 4IVNA 3S2WA 5D5WB 1ZN2A 4RGRA 2O3FA 4P9UA 5JFRA 2VBXA 1YIOA 3V7SA 4O6JA 5K5RA 3FMRA 2F5DA 3L00A 3I58A 1FX7A 4PGGA 3ULQB 4RS8A 2C6YA 3BROA 2CGPA 3V7CA 5BMZA 2EFWA 1RI7A 1R7JA 5AIQA 2P8TA 1FWZA 1OYWA 3ECHA 4BHPA 4BNCA 1O3RA 2XHKA 2WV0A 3I53A 1X3UA 5KVRA 1ZG3A 3NQOA 4U0YA 2Z33A 5HS7A 4KA4A 3DP7A 3ZMTA 1CGPA 2O0YA 4ZYEA 2PMUA 3MEXA 4M6YA 4WCGA 4HZFA 4IPAA 3O3KA 3W6JB 2M30A 2W85A 2F5FA 3J7AO 4FT8A 4AIHA 3P9CA 1C0WA 3F8CA 1RZ4A 4M9SA 3GZ5A 5LGNA 1SD6A 5CLSA 5DCFA 1U6GA 1LDJA 3QPTA 2R7FA 3HRUA 2Q2EA 1BIAA 2HS5A 2ZNZA 2JPCA 2MA3A 4KIGA 1BJAA 1SFXA 2M8EA 2OZUA 3VOEA 1ZH5A 2BEOA 5FFZA 4HV6A 4LG0B 2FNAA 3K1NA 1G3TA 2PLYA 5LLQA 1R5GA 3TDUC 2EK5A 4HAMA 5BQTA 4Y17A 3WTZA 1ZREA 2RVCA 3KZZA 3GFLA 1R22A 2HYGD 1D5VA 4A0ZA 2L01A 4NQWA 3J81Z 1FYLA 1WRJA 3ZN0A 3EQLF 1WWXA 2FQ3A 4S04A 4ZYGA 2KIUA 2KIMA 3ERED 5HDNA 1R58A 3WTWC 1I1SA 1R36A 1HSTA 2KKOA 2P4WA 4GO1A 3RYRA 3CUQC 1FYKA 3C7JA 1G3WA 3Q9SA 4N9IA 1D8KA 5E17F 4EJTA 1T98A 3QU3A 3MZHA 2R3SA 1OMIA 1E2XA 2QZ8A 3KP4A 1TNTA 3BOQA 1ZAOA 1XDUA 5IT3A 4LLNA 1SFEA 5D4RA 3ROUA 4EM2A 4OIQF 3PQKA 3FHZA 4M72A 1EV7A 5ICCA 2BGCA 2IPQX 4ENNA 3KLOA 4XLNF 1EH7A 2ZO4A 3MWMA 5FGMA 1K6OA 1T0FA 4EM1A 4LG0A 1BOAA 1QPMA 3GF2A 3E6CC 4HX4A 3T1BA 1B59A 4TV7A 1RUNA 4MHGA 1J7KA 3LQRA 3F72A 4R1HA 5DCMB 4CXFA 2BYVE 2IRFG 4B09A 5HLGA 3JSPA 2MLGA 1F1ZA 2VE9A 4IRIA 1IW7F 4L18B 2LDUA 1H9TA 1TTYA 3F6OA 2DK8A 5JHUA 1MKMA 3VODA 5E1ZB 1LEBA 4WF2A 1PUEE 5E18F 2DBBA 3JAMZ 3HIFA 4LLLA 3EYIA 5E1WA 1RNLA 1T39A 5EEGA 1FOKA 4MNUA 5DUKA 3FXQA 2FF4A 4CDGA 1MJAA 1KU3A 3E6MA 3WU0A 1USTA 3LAPA 5L3DA 3FM3A 2NRAC 3I0TA 4LB6B 2YSRA 2BE5F 4XSZF 4KFCA 5D4SA 5K5OA 2VOOA 2XAQA 2E7WA 1I1GA 1XDSA 3GLXA 2XKPA 4MGRA 3I54A 3DQVC 1HKTA 4LFUA 4R8HA 1SAXA 3KEOA 2QLZA 2EFQA 3CUOA 1O7FA 2ZCWA 1QGPA 2F5EA 1ODDA 2X0LA 3D0SA 2CYYA 2FE3A 3T8TA 4PZJA 3F8BA 3H3ZA 2Z99A 1IUYA 1YS7A 4OOIA 4O5VA 1FBSA 4GCVA 4M9ZA 2Y48A 5F64A 2DO7A 3CLOA 2FBKA 2H09A 3CUQA 2XRNA 4CGZA 2K4JA 1J5YA 2DT5A 1IN6A 2LF7A 2Z5UA 4LMYA 2NNYA 1KYZA 4HLXA 5AIPA 1FSHA 2F2EA 1H9GA 2WC2A 3HRSA 2L02A 2DQRA 5JI6A 3CO7C 4PGHA 3C1DA 1XMKA 4U0VA 4EGYA 1ZRCA 4KIFA 1ZARA 2Q0OA 3P9IA 4HBLA 3J81K 1KA8A 4PDKA 2EV0A 1L3LA 3SQNA 4EGZA 1W7PA 4G7HF 3M8FA 3QU6A 4LD5A 2HQNA 3GVAA 3F6VA 2RC4A 5DD8A 1TLHB 1P4WA 3KP6A 1LB2A 5FLXZ 4ZYDA 3B02A 3LFKA 1WKMA 5FLXK 4ASNA 2IW5A 5FB2A 1W5TA 4HOBA 3IKTA 4KMFA 3DEUA 3KFWX 5DD4A 1J75A 4A6DA 4KYWA 5CVVA 2ZJ2A 2ZMEA 5J8CA 4BHBA 2TDXA 3ZP5A 3V8JA 4RB2C 1I6XA 3HOSA 2V1XA 1R00A 2UXXA 1ZRDA 2P5LC 4A6EA 4EJUA 3R0JA 4HQEA 5E8GA 2NAZA 3SZPA 1HXDA 3KZYA 4OIOF 3MAJA 2Z3YA 2VN2A 4PCQA 1HW2A 3DF8A 2J5OA 2ESNA 3NEUA 2ISYA 2CG4A 2E7XA 1DPUA 4AWXB 4HYEA 1FC3A 3GX4X 4ZZDA 2PFBA 3K69A 2CWEA 4IF4A 2GAUA 1U5TC 5E1XA 4ETSA 5BPIA 1Z6TA 1NHAA 3BWGA 1XB4A 1MJ9A 3H3UA 5IT9K 2ZNYA 2K02A 1XGOA 3CTAA 1QBJA 2K4BA 4CHUA 2A69F 3QAHA 4HF1A 1PP8F 5JR3A 3KCCA 2R7DA 1S29A 4WX9A 3MCZA 1PDNC 3T8RA 2DTRA 2P7VB 1P4AA 3J80K 1KU2A 1FZPB 1IN8A 5L3GA 1ZYRF 4DQ2A 1R1VA 4A5MA 4UVCA 3F22A 4LJZF 2CW0F 1S7AA 2D1VA 3E5QA 3N4MA 2ESHA 4RB3C 3ML6A 1I5ZA 3WGIA 3O2PE 2DU9A 3ZMSA 3ZMZA 2W84A 4YIFA 4WWCA 4ZH4F 1UHMA 2VC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7W A;  5J6X A;  2EJR A;  1BN5 A;  4LB5 A;  2KIF A;  4B8X A;  4FX4 A;  2RQP A;  2CO5 A;  5HDG A;  1U5T A;  2L3D A;  1P6R A;  4L0Z B;  2IP2 A;  1BI3 A;  3V4G A;  1QQI A;  1QZZ A;  3Q5F A;  1ZLJ A;  3DXJ F;  2H94 A;  2M45 A;  2MC3 A;  4M6X A;  3HSF A;  1AWC A;  4FX0 A;  4RB1 A;  3JW4 A;  1IF1 A;  3KP2 A;  3T5X A;  2W24 A;  5LHI A;  1K78 A;  4OIR F;  2RGV A;  3R4K A;  2XAS A;  4OMZ A;  3Q9V A;  1RIO H;  2Y0M A;  5DYM A;  2V79 A;  1DPR A;  2KJC A;  2K27 A;  1FPQ A;  2PQ8 A;  5IT9 Z;  1DP7 P;  5HLH A;  1H0M A;  1JHH A;  3EET A;  4MTE A;  3WE2 A;  2LKP A;  2L4A A;  3KP3 A;  1GHC A;  1XSX A;  1KU7 A;  3GFM A;  2EV6 A;  3QPH A;  4NB5 A;  5ILV A;  1XSD A;  1W7P B;  5D5X B;  4MTD A;  4A0Y A;  2VBY A;  3JSO A;  1XGM A;  4YG2 F;  2A6E F;  2EFO A;  3OV8 A;  1XGS A;  3K9T A;  3U9G A;  2HFH A;  3KEQ A;  4UHT A;  2O61 A;  4HDU A;  5ED4 A;  1U2W A;  5CVU A;  1MDM A;  1ZGA A;  1HQC A;  3OOP A;  1JGS A;  1UFM A;  2FU4 A;  4UV8 A;  1J59 A;  2D1H A;  1JE8 A;  3DKW A;  4I02 A;  1J2X A;  1MDM B;  2MH9 A;  3EYY A;  3RKY A;  2F5C A;  1TQP A;  5K5Q A;  1STZ A;  1WI9 A;  4ZZL A;  3LQQ A;  2VT2 A;  2EFP A;  2STW A;  4U88 A;  4G8X A;  2IT0 A;  2HQR A;  4U7D A;  2QBY A;  3ZPL A;  1BC7 C;  2VOP A;  1U5T B;  5FD5 A;  5LHH A;  4N9H A;  2GIV A;  3E6B A;  1ZGJ A;  1IRF A;  5E20 A;  3GO5 A;  2HYF A;  3QP5 A;  5H6Q A;  1KQ0 A;  2HZT A;  1QZY A;  4L5I A;  3GEZ A;  4AD9 A;  2P6S A;  2FOK A;  1YO5 C;  3LST A;  1TBX A;  1P4X A;  1XCB A;  2QWW A;  2O03 A;  5H20 A;  2DQL A;  2PMH A;  1YW8 A;  1U3E M;  4M74 A;  5LHG A;  1UCR A;  5ICE A;  2GQQ A;  3L9F A;  1ZG5 A;  3TDZ C;  2A68 F;  4BAY A;  1BI2 A;  1LDK B;  1Z1D A;  2EA2 A;  2OD5 A;  3TO7 A;  2ETH A;  2IA2 A;  2L54 A;  1A04 A;  5DEQ A;  4L9N A;  1GVJ A;  1SMY F;  4UVA A;  2RV8 A;  3HUG A;  3QP6 A;  2H6B A;  3IC7 A;  1YYV A;  2DI3 A;  4I0A A;  1BC8 C;  2G9W A;  3HOT A;  2HWV A;  2DW4 A;  4Z2Y A;  4RGU A;  3C18 A;  3ISP A;  3GWZ A;  3LA2 A;  1W5S A;  3HTS B;  4K2E A;  3FXU A;  3RI4 A;  5CVR A;  2VON A;  3KP7 A;  4EQQ A;  3FXR A;  3O6B B;  3I5U A;  4CZZ A;  3RTR A;  2ZBK A;  4FHT A;  2RKH A;  2KJB A;  3NRV A;  2BBY A;  2CFX A;  3K1M A;  3K2Z A;  2LSO A;  1LJ9 A;  1FP2 A;  5J8F A;  3SXY A;  2NNN A;  2X4H A;  2KRF A;  3WTS C;  3ECO A;  2XAJ A;  1SD7 A;  1JXS A;  1FLI A;  3HSR A;  2EA4 A;  2OU2 A;  3RDI A;  1CF7 B;  2V6C A;  1FNN A;  2HTS A;  2P5V A;  2QUF A;  2QQ9 A;  5TJJ A;  4I98 B;  2GA1 A;  3KE2 A;  2HTJ A;  3VFZ A;  4I0B A;  4RAY A;  4G7Z F;  3MFK A;  3WTY C;  2QVO A;  5K1Y A;  3C3W A;  3TO6 A;  3FM5 A;  3IWF A;  2ELH A;  4MEY F;  1F5T A;  4E70 A;  2P6T A;  3FWE A;  1JHF A;  5FO5 A;  1LVA A;  5HDK A;  4HA8 A;  1U8R A;  3TQN A;  1OKR A;  1LDD A;  2XV4 S;  5ICG A;  4AVP A;  4BXU A;  3RPU A;  3WGG A;  4ESJ A;  1OPC A;  1B9N A;  3U2R A;  3IKV A;  1W4M A;  3F3X A;  4JBA A;  2VE8 A;  3FZV A;  1OYY A;  4ENK A;  4YFX F;  3RPQ A;  1GXP A;  2JTV A;  2ACJ A;  4EJW A;  4ON0 A;  5HLI A;  2IA1 A;  4OIP F;  1B6A A;  1QNT A;  2PJP A;  4HF0 A;  2HOE A;  3BJA A;  4EM0 B;  4U7B A;  4I01 A;  3IRQ A;  2VBZ A;  3JTH A;  1S7O A;  1V3F A;  4JK1 X;  3BJ6 A;  2ZME B;  3DV8 A;  3GZ6 A;  4YFN F;  3HRM A;  5HOO A;  2JRT A;  3FMS A;  2JZY A;  3FF5 A;  1FBU A;  4HX7 A;  4L9V A;  5D5U B;  3BP8 A;  4L5J A;  2OZ6 A;  3L09 A;  4M71 A;  1FSE A;  3VB2 A;  4G6Q A;  5AON A;  1B1B A;  2ADU A;  5CVJ A;  3T0Y A;  4L9T A;  1ONV A;  4Q47 A;  1G3S A;  4A5N A;  1FP1 D;  3BPX A;  3LWF A;  4EV0 A;  2WTE A;  1DDN A;  4Y13 A;  3COA C;  5BOX A;  5DDG A;  2OBP A;  1L0O C;  5DV5 A;  4UV9 A;  4GGG A;  1U78 A;  2FBH A;  3HRT A;  2XKO A;  4RAZ A;  2HEO A;  1B4A A;  4LGW A;  3V7R A;  1Z05 A;  3SFZ A;  2FA5 A;  5CVI A;  4KN4 X;  4A2U A;  1EH8 A;  3MQ0 A;  5KK1 A;  1YTY A;  1XSV A;  4P96 A;  3G3Z A;  4HDV A;  1S6L A;  2FRH A;  4M9X A;  1WQ2 A;  4GXO A;  3TGN A;  3KET A;  1I27 A;  2QM3 A;  1YS6 A;  1R1U A;  2H6C A;  2GXB A;  2A5Y B;  3F23 A;  4MQV A;  3F8F A;  3BPV A;  2FEZ A;  2AS5 F;  1ZRF A;  2B0L A;  3W6K B;  1O57 A;  5ILU A;  1SMT A;  1IAW A;  1MD0 A;  5LEJ A;  2GA2 A;  3D5L A;  2GZW A;  1XCV A;  2CQK A;  2YX7 A;  4IHS A;  2DK5 A;  2QQB A;  1W7P D;  4RGS A;  3ELK A;  2FXA A;  4XSX F;  4A12 A;  4O3M A;  3RJP A;  1F4K A;  4GYG A;  5HS9 A;  1IN5 A;  1S8N A;  1KGS A;  1B9M A;  5LRR A;  2V1D A;  2XIG A;  2FSW A;  1LEA A;  1YG2 A;  3FX3 A;  4QLC U;  2XVC A;  2MD5 A;  1LQ1 A;  4A0X A;  2O6G E;  2W25 A;  5LGU A;  1VTN C;  1XN7 A;  4KUM A;  5FD6 A;  3GUD A;  4RGX A;  1IN7 A;  1Q1H A;  3EDP A;  5L3F A;  2MH2 A;  2M87 A;  2ZFW A;  4EJO A;  3PQJ A;  3M1E A;  2HR3 A;  3K1P A;  1LNW A;  2EV5 A;  1F9N A;  1T38 A;  5BS6 A;  5BPD A;  4Q4Z F;  2NYX A;  2HDC A;  1O7L A;  4CIC A;  5HVQ C;  3WGH A;  2W57 A;  3ZQ7 A;  4G6D A;  1DUX C;  1BBY A;  1ULY A;  4ENJ A;  2HKX A;  4KIC A;  4OIN F;  2IA0 A;  1QO0 D;  1IZ1 A;  3ABU A;  1SFU A;  2H27 A;  5H6R A;  2VC0 A;  4KIB A;  3I71 A;  3F21 A;  4MQ9 F;  2STT A;  5JVT A;  2QQA A;  4EVI A;  1K79 A;  3WTX C;  2DPD A;  2ZXJ A;  1ON1 A;  2YPR A;  3LAJ A;  4G9Y A;  4HQM A;  1Z9C A;  2V9V A;  4WXH A;  5D8K B;  3WOD F;  3LA3 A;  4JQF A;  2GWR A;  5D8L B;  4Q5S F;  2FNP A;  3TOB A;  1D8J A;  1FYM A;  6PAX A;  1WSU A;  3E97 A;  4HW0 A;  2EB7 A;  1PP7 U;  3WE3 A;  5L3C A;  3MZY A;  3V8L A;  2UXN A;  1Y0U A;  1T6S A;  1P2F A;  1HW5 A;  2P5K A;  5D6E A;  1REP C;  4LK0 F;  3SHF A;  5LRS A;  1SD4 A;  4KNY A;  4UXN A;  1TW3 A;  4EMS A;  1FT9 A;  2XAF A;  4AIJ A;  3ZMV A;  5ERI A;  1UHW A;  1BM9 A;  1V4R A;  2K86 A;  3EUH A;  4WXC A;  2VOD A;  4P5O A;  4Q48 A;  1MZB A;  2EFN A;  1MJB A;  2E1C A;  2L4M A;  1OR7 A;  1OYI A;  1YW7 A;  1R5H A;  2HGC A;  1ZHF A;  5E8I A;  1KQ9 A;  1T2K A;  2UZK A;  3SZT A;  2RDP A;  1IN4 A;  4UUV A;  2XUB A;  2PG4 A;  3CO6 C;  1YW9 A;  4F7Z A;  4HF2 A;  2EWN A;  4YFK F;  3GFJ A;  2J5P A;  3IRR A;  2RN7 A;  2A6H F;  2XGX A;  1ZG1 A;  1XD7 A;  5LGT A;  3KLN A;  1BI0 A;  3QOP A;  3R0A A;  1D3Y A;  5L3B A;  2DAO A;  2M1B A;  4U0W A;  2Q8K A;  3GXO A;  3R6S A;  4HLY A;  1ON2 A;  1IXC A;  5ILS A;  3HTU A;  5LEK A;  2M5W A;  2A07 F;  1YLF A;  3B73 A;  3TO9 A;  5EEH A;  2DPU A;  4XBF A;  1AOY A;  4L0Y B;  5HS8 A;  2XAH A;  4BYY A;  4DNC A;  3WTU C;  3I59 B;  2MLK A;  1Z7U A;  1TQM A;  2ZKZ A;  4H0E A;  4CO8 A;  1G4D A;  2PN6 A;  4BHC A;  1O3Q A;  3DFG A;  2DFI A;  3BZ6 A;  4WXD A;  1FBQ A;  4M73 A;  1ZLK A;  4I09 A;  3IWZ A;  3FMQ A;  1BIB A;  3M9A A;  2NS0 A;  3REO A;  3HHH A;  1IXS B;  4N0B A;  2FMY A;  4BQA A;  2PEX A;  1G3Y A;  4G7O F;  3WU1 B;  2V1U A;  2HKO A;  3K0L A;  4HV5 A;  4L9J A;  2OQR A;  4LLG F;  2WWY A;  2UWM A;  3DPT A;  1TW2 A;  1HBX G;  3GYH X;  1UB9 A;  3N97 A;  1O3T A;  2XRO A;  4S05 A;  5DUI A;  2O8X A;  2JPB A;  1HKS A;  4QWQ A;  2P7C B;  2JSC A;  1KU9 A;  3BY6 A;  2LNB A;  2Y75 A;  3KP5 A;  2JT1 A;  1MGT A;  1TQI A;  2VBW A;  4XLP F;  4IHT A;  3R60 A;  1J0R A;  3E5U A;  3ZMD A;  3LA7 A;  4RB0 A;  1TNS A;  1CF7 A;  4KDP A;  2MBF A;  1YQA A;  5A2Q K;  5D5V B;  4EJV A;  3P9K A;  3I59 A;  3IHU A;  3TKY A;  1USS A;  4NHJ A;  4HX8 A;  3RKW A;  2G7U A;  1E17 A;  2ISZ A;  3L2C A;  1KQ8 A;  5DCM A;  5CYV A;  4ENM A;  4KN7 X;  4ESF A;  3J80 Z;  3BDD A;  3PFI A;  3V8K A;  2YR2 A;  1SD5 A;  4AIK A;  3HHG A;  3RYP A;  3U1D A;  4UVB A;  4BH9 A;  2FBI A;  3TOA A;  2E1N A;  3GW2 A;  2A3S A;  1RUO A;  1IXR C;  4XRF A;  1Z91 A;  3G73 A;  3GFI A;  1HKQ A;  3E3V A;  4ZYH A;  2PBI A;  4D0P A;  5TRD A;  3I4P A;  1FY7 A;  4P9F A;  3ZMU A;  3JAM K;  3P7N A;  3CJN A;  1XGN A;  2QYO A;  3F8N A;  3VEP A;  3WTT C;  4I7H A;  3WG9 A;  2COM A;  5D6F A;  3I64 A;  1G6N A;  3BJO A;  2DLL A;  3R61 A;  3E5X A;  1KYW A;  2IVM A;  3F8M A;  4CYD A;  1J9I A;  2YX4 A;  2FML A;  2LF8 A;  1K7A A;  2BV6 A;  3QRF F;  4ESB A;  2D45 A;  3DPL C;  4R79 A;  3IL2 A;  2OQG A;  1S3J A;  4WK8 F;  2OAZ A;  3M7G A;  1IRG A;  5FFX A;  1BI1 A;  3RIR A;  1HSJ A;  2G7H A;  1Z6R A;  1YFH A;  2OA4 A;  4IRG A;  4YII A;  2A61 A;  5F1R A;  1K78 B;  3HYI A;  3HSE A;  3M8E A;  2IJL A;  2Z9O A;  4OMY A;  5A2Q Z;  2YU3 A;  3AAF A;  2RNJ A;  5ICF A;  4KMU X;  2AXL A;  4G94 A;  5LBQ A;  2D2W A;  2XAG A;  3WTV C;  4IRH A;  2QBY B;  4I2O A;  2VXZ A;  2GXG A;  2CSO A;  3CUQ B;  5CJ9 A;  2PI0 A;  1GXQ A;  4LK1 F;  2QEN A;  3CDH A;  2VT3 A;  4GYI A;  3ABT A;  4IJA A;  3H92 A;  4KT5 C;  1P92 A;  4P55 A;  4MEX F;  3ZN1 A;  4OU0 A;  4IXA A;  1EH6 A;  3E6D A;  1R23 A;  2K7L A;  1O3S A;  5L3E A;  5F6F A;  1XMA A;  3JTG A;  1R1T A;  4UNO A;  1HW1 A;  4Y15 A;  3RKX A;  4IVN A;  3S2W A;  5D5W B;  1ZN2 A;  4RGR A;  2O3F A;  4P9U A;  5JFR A;  2VBX A;  1YIO A;  3V7S A;  4O6J A;  5K5R A;  3FMR A;  2F5D A;  3L00 A;  3I58 A;  1FX7 A;  4PGG A;  3ULQ B;  4RS8 A;  2C6Y A;  3BRO A;  2CGP A;  3V7C A;  5BMZ A;  2EFW A;  1RI7 A;  1R7J A;  5AIQ A;  2P8T A;  1FWZ A;  1OYW A;  3ECH A;  4BHP A;  4BNC A;  1O3R A;  2XHK A;  2WV0 A;  3I53 A;  1X3U A;  5KVR A;  1ZG3 A;  3NQO A;  4U0Y A;  2Z33 A;  5HS7 A;  4KA4 A;  3DP7 A;  3ZMT A;  1CGP A;  2O0Y A;  4ZYE A;  2PMU A;  3MEX A;  4M6Y A;  4WCG A;  4HZF A;  4IPA A;  3O3K A;  3W6J B;  2M30 A;  2W85 A;  2F5F A;  3J7A O;  4FT8 A;  4AIH A;  3P9C A;  1C0W A;  3F8C A;  1RZ4 A;  4M9S A;  3GZ5 A;  5LGN A;  1SD6 A;  5CLS A;  5DCF A;  1U6G A;  1LDJ A;  3QPT A;  2R7F A;  3HRU A;  2Q2E A;  1BIA A;  2HS5 A;  2ZNZ A;  2JPC A;  2MA3 A;  4KIG A;  1BJA A;  1SFX A;  2M8E A;  2OZU A;  3VOE A;  1ZH5 A;  2BEO A;  5FFZ A;  4HV6 A;  4LG0 B;  2FNA A;  3K1N A;  1G3T A;  2PLY A;  5LLQ A;  1R5G A;  3TDU C;  2EK5 A;  4HAM A;  5BQT A;  4Y17 A;  3WTZ A;  1ZRE A;  2RVC A;  3KZZ A;  3GFL A;  1R22 A;  2HYG D;  1D5V A;  4A0Z A;  2L01 A;  4NQW A;  3J81 Z;  1FYL A;  1WRJ A;  3ZN0 A;  3EQL F;  1WWX A;  2FQ3 A;  4S04 A;  4ZYG A;  2KIU A;  2KIM A;  3ERE D;  5HDN A;  1R58 A;  3WTW C;  1I1S A;  1R36 A;  1HST A;  2KKO A;  2P4W A;  4GO1 A;  3RYR A;  3CUQ C;  1FYK A;  3C7J A;  1G3W A;  3Q9S A;  4N9I A;  1D8K A;  5E17 F;  4EJT A;  1T98 A;  3QU3 A;  3MZH A;  2R3S A;  1OMI A;  1E2X A;  2QZ8 A;  3KP4 A;  1TNT A;  3BOQ A;  1ZAO A;  1XDU A;  5IT3 A;  4LLN A;  1SFE A;  5D4R A;  3ROU A;  4EM2 A;  4OIQ F;  3PQK A;  3FHZ A;  4M72 A;  1EV7 A;  5ICC A;  2BGC A;  2IPQ X;  4ENN A;  3KLO A;  4XLN F;  1EH7 A;  2ZO4 A;  3MWM A;  5FGM A;  1K6O A;  1T0F A;  4EM1 A;  4LG0 A;  1BOA A;  1QPM A;  3GF2 A;  3E6C C;  4HX4 A;  3T1B A;  1B59 A;  4TV7 A;  1RUN A;  4MHG A;  1J7K A;  3LQR A;  3F72 A;  4R1H A;  5DCM B;  4CXF A;  2BYV E;  2IRF G;  4B09 A;  5HLG A;  3JSP A;  2MLG A;  1F1Z A;  2VE9 A;  4IRI A;  1IW7 F;  4L18 B;  2LDU A;  1H9T A;  1TTY A;  3F6O A;  2DK8 A;  5JHU A;  1MKM A;  3VOD A;  5E1Z B;  1LEB A;  4WF2 A;  1PUE E;  5E18 F;  2DBB A;  3JAM Z;  3HIF A;  4LLL A;  3EYI A;  5E1W A;  1RNL A;  1T39 A;  5EEG A;  1FOK A;  4MNU A;  5DUK A;  3FXQ A;  2FF4 A;  4CDG A;  1MJA A;  1KU3 A;  3E6M A;  3WU0 A;  1UST A;  3LAP A;  5L3D A;  3FM3 A;  2NRA C;  3I0T A;  4LB6 B;  2YSR A;  2BE5 F;  4XSZ F;  4KFC A;  5D4S A;  5K5O A;  2VOO A;  2XAQ A;  2E7W A;  1I1G A;  1XDS A;  3GLX A;  2XKP A;  4MGR A;  3I54 A;  3DQV C;  1HKT A;  4LFU A;  4R8H A;  1SAX A;  3KEO A;  2QLZ A;  2EFQ A;  3CUO A;  1O7F A;  2ZCW A;  1QGP A;  2F5E A;  1ODD A;  2X0L A;  3D0S A;  2CYY A;  2FE3 A;  3T8T A;  4PZJ A;  3F8B A;  3H3Z A;  2Z99 A;  1IUY A;  1YS7 A;  4OOI A;  4O5V A;  1FBS A;  4GCV A;  4M9Z A;  2Y48 A;  5F64 A;  2DO7 A;  3CLO A;  2FBK A;  2H09 A;  3CUQ A;  2XRN A;  4CGZ A;  2K4J A;  1J5Y A;  2DT5 A;  1IN6 A;  2LF7 A;  2Z5U A;  4LMY A;  2NNY A;  1KYZ A;  4HLX A;  5AIP A;  1FSH A;  2F2E A;  1H9G A;  2WC2 A;  3HRS A;  2L02 A;  2DQR A;  5JI6 A;  3CO7 C;  4PGH A;  3C1D A;  1XMK A;  4U0V A;  4EGY A;  1ZRC A;  4KIF A;  1ZAR A;  2Q0O A;  3P9I A;  4HBL A;  3J81 K;  1KA8 A;  4PDK A;  2EV0 A;  1L3L A;  3SQN A;  4EGZ A;  1W7P A;  4G7H F;  3M8F A;  3QU6 A;  4LD5 A;  2HQN A;  3GVA A;  3F6V A;  2RC4 A;  5DD8 A;  1TLH B;  1P4W A;  3KP6 A;  1LB2 A;  5FLX Z;  4ZYD A;  3B02 A;  3LFK A;  1WKM A;  5FLX K;  4ASN A;  2IW5 A;  5FB2 A;  1W5T A;  4HOB A;  3IKT A;  4KMF A;  3DEU A;  3KFW X;  5DD4 A;  1J75 A;  4A6D A;  4KYW A;  5CVV A;  2ZJ2 A;  2ZME A;  5J8C A;  4BHB A;  2TDX A;  3ZP5 A;  3V8J A;  4RB2 C;  1I6X A;  3HOS A;  2V1X A;  1R00 A;  2UXX A;  1ZRD A;  2P5L C;  4A6E A;  4EJU A;  3R0J A;  4HQE A;  5E8G A;  2NAZ A;  3SZP A;  1HXD A;  3KZY A;  4OIO F;  3MAJ A;  2Z3Y A;  2VN2 A;  4PCQ A;  1HW2 A;  3DF8 A;  2J5O A;  2ESN A;  3NEU A;  2ISY A;  2CG4 A;  2E7X A;  1DPU A;  4AWX B;  4HYE A;  1FC3 A;  3GX4 X;  4ZZD A;  2PFB A;  3K69 A;  2CWE A;  4IF4 A;  2GAU A;  1U5T C;  5E1X A;  4ETS A;  5BPI A;  1Z6T A;  1NHA A;  3BWG A;  1XB4 A;  1MJ9 A;  3H3U A;  5IT9 K;  2ZNY A;  2K02 A;  1XGO A;  3CTA A;  1QBJ A;  2K4B A;  4CHU A;  2A69 F;  3QAH A;  4HF1 A;  1PP8 F;  5JR3 A;  3KCC A;  2R7D A;  1S29 A;  4WX9 A;  3MCZ A;  1PDN C;  3T8R A;  2DTR A;  2P7V B;  1P4A A;  3J80 K;  1KU2 A;  1FZP B;  1IN8 A;  5L3G A;  1ZYR F;  4DQ2 A;  1R1V A;  4A5M A;  4UVC A;  3F22 A;  4LJZ F;  2CW0 F;  1S7A A;  2D1V A;  3E5Q A;  3N4M A;  2ESH A;  4RB3 C;  3ML6 A;  1I5Z A;  3WGI A;  3O2P E;  2DU9 A;  3ZMS A;  3ZMZ A;  2W84 A;  4YIF A;  4WWC A;  4ZH4 F;  1UHM A;  2VC1 A; 
#chains in the Genus database with same CATH topology
 1IJW C;  2VI6 A;  1MBH A;  1VND A;  3L7W A;  3OOU A;  3TP0 A;  5J6X A;  2EJR A;  1BN5 A;  4LB5 A;  2X9D A;  1WJD A;  2KIF A;  5J1Y A;  3K4B A;  1ZEL A;  3ZQI A;  2RQP A;  2CO5 A;  5HDG A;  4B8X A;  4FX4 A;  3B6A A;  1U5T A;  2L3D A;  1P6R A;  3B6C A;  4L0Z B;  3CMA I;  2IP2 A;  1BI3 A;  3BZK A;  3H5N A;  3V4G A;  1QQI A;  4DBQ A;  1QZZ A;  3Q5F A;  3H35 A;  1ZLJ A;  1WJE A;  3DXJ F;  1VQN I;  2H94 A;  2M45 A;  3CCM I;  4CH7 A;  2CQQ A;  2MC3 A;  4M6X A;  4IOC F;  1YJW I;  3OYE A;  4A3F J;  3HSF A;  2GXA A;  2EPF A;  1HA8 A;  1AWC A;  4FX0 A;  3K4N A;  4RB1 A;  1EA3 A;  3JW4 A;  1IF1 A;  3KP2 A;  3T5X A;  2W24 A;  3G2B A;  5LHI A;  1K78 A;  3JRB A;  4OIR F;  2RGV A;  3WU2 C;  5KAF C;  3DEW A;  3R4K A;  1EKE A;  2XAS A;  3GTK J;  2IS4 A;  4OMZ A;  3Q9V A;  5FLM J;  4GFB A;  1XMX A;  2RNG A;  3LSM A;  1RIO H;  2HOT A;  3PIO F;  2Y0M A;  5DYM A;  3HB9 A;  2V79 A;  1DPR A;  1AKH B;  1VQL I;  2XPW A;  3LSG A;  4BJ5 C;  2KJC A;  2K27 A;  1X1C A;  1FPQ A;  2PQ8 A;  1MBJ A;  4A3J J;  5IT9 Z;  1DP7 P;  3HZJ A;  2OF7 A;  5HLH A;  1H0M A;  1JHH A;  2ZXW H;  3AFH A;  3EET A;  4Y52 J;  4MTE A;  3WE2 A;  2EIM H;  2LKP A;  2L4A A;  3KP3 A;  4PFO A;  3WHC A;  3ZGK A;  1GHC A;  1XSX A;  3S1N J;  4LIU A;  3LSJ A;  1KU7 A;  3QYB A;  1WJA A;  3GFM A;  4BBS J;  2EV6 A;  3QPH A;  4NB5 A;  5ILV A;  1XSD A;  2M34 A;  1W7P B;  5D5X B;  4MTD A;  4PJM A;  3G4S I;  4A0Y A;  2VBY A;  3JSO A;  3EPZ A;  3CCV I;  1XGM A;  2DMU A;  4YG2 F;  2A6E F;  1X3Z B;  2EFO A;  3OV8 A;  1XGS A;  4D7N A;  3DTK A;  3IUO A;  3RQI A;  3K9T A;  3PO2 J;  3U9G A;  2HFH A;  4D5F A;  1FTZ A;  3KEQ A;  3KIO A;  4UHT A;  3FDY A;  5EGO B;  2A6T A;  2O61 A;  4HDU A;  5ED4 A;  3FXJ A;  2DFE A;  1E0E A;  2CMP A;  2E5Z A;  1U2W A;  3BR3 A;  5CVU A;  2Q2E B;  1MDM A;  2LOO A;  1ZGA A;  1HQC A;  1MBK A;  3OOP A;  3BR2 A;  1ZGW A;  4XKC A;  1JGS A;  3CDL A;  1UFM A;  4M3B A;  5HNH A;  2FU4 A;  4UV8 A;  5K7F A;  1J59 A;  1SVL A;  2X1D A;  3PNT A;  3HUG B;  2VJI A;  2D1H A;  2X6Y A;  1JE8 A;  1DU0 A;  3DKW A;  3S14 J;  4I02 A;  1J2X A;  1MDM B;  3C2G A;  2MH9 A;  3EYY A;  4B3A A;  1XC5 A;  2NOJ B;  3RKY A;  3TP3 A;  1JGG A;  1TQP A;  2F5C A;  5K5Q A;  1TP4 A;  1STZ A;  1WI9 A;  4ZZL A;  3A0H C;  1E3O C;  3LQQ A;  1VI0 A;  3OR2 C;  2COB A;  3DBH B;  4OAZ A;  2VT2 A;  2EFP A;  2STW A;  4U88 A;  4G8X A;  2IT0 A;  1WJ5 A;  2CQX A;  3BC8 A;  3PUB A;  2HQR A;  2H8W A;  5IP7 J;  4HEA 2;  4U7D A;  2QBY A;  1BW5 A;  3ZPL A;  1WPK A;  1BC7 C;  2VOP A;  1U5T B;  5FD5 A;  3PSI A;  4XLF A;  3Q0U A;  2R7S A;  5LHH A;  4N9H A;  4FIS A;  2GIV A;  3E6B A;  1ZGJ A;  1IRF A;  5E20 A;  1QPI A;  3GO5 A;  2HYF A;  2KZV A;  3QP5 A;  2QSF X;  5H6Q A;  1KQ0 A;  2HZT A;  3CJT B;  3UKG A;  1X1P A;  1OLT A;  1QZY A;  4L5I A;  3GEZ A;  2QCO A;  4Y7N J;  5IOY A;  4AD9 A;  2P6S A;  1BJZ A;  3ZXS A;  4C2U A;  2FOK A;  3S1R J;  1YO5 C;  2JN6 A;  3LST A;  4DZJ A;  1TBX A;  3G71 I;  4IHW A;  1R4N B;  1U9N A;  2M8G X;  1P4X A;  9ANT A;  2EZI A;  1GVD A;  1XCB A;  2QWW A;  1YJN I;  2Z16 A;  2KDO A;  2R5Z A;  2O03 A;  5H20 A;  2DQL A;  2PMH A;  1YW8 A;  1U3E M;  4M74 A;  2Y9Y A;  2RRE A;  5LHG A;  4LIT A;  3S16 J;  1UCR A;  5ICE A;  2DA2 A;  3QQA A;  1G2H A;  2GQQ A;  3L9F A;  1JKR C;  1ZG5 A;  4ZTF A;  3SYT A;  4NC7 A;  3TDZ C;  3I3L A;  2A68 F;  4BAY A;  1UMQ A;  1BI2 A;  1LDK B;  2OUM A;  2H1L A;  4XL9 A;  1Z1D A;  3SEZ A;  2EA2 A;  4NC6 A;  2OD5 A;  2DOD A;  3TO7 A;  3ABM H;  1VQO I;  1Y39 A;  2ETH A;  2NS8 A;  2IA2 A;  4PSW A;  1MMA A;  2WAD A;  1V55 H;  2L54 A;  3HC7 A;  3K4K A;  3LSK A;  1A04 A;  1JJ6 C;  5DEQ A;  4UUS B;  3DTE A;  4L9N A;  1GVJ A;  2CQ7 A;  3I56 I;  3CCS I;  1IG7 A;  3MKY B;  1SMY F;  1DU6 A;  2IBD A;  2NVY J;  3FXO A;  2RV8 A;  4UVA A;  3HUG A;  3QP6 A;  4CCN A;  3ZRG A;  4A3G J;  1Z3X A;  1OFC X;  1ITY A;  2VKD A;  2H6B A;  3IC7 A;  4BL0 B;  1YYV A;  2FQ4 A;  2DI3 A;  4I0A A;  3ABK H;  1VQP I;  3IAM 2;  3S1Q J;  1BC8 C;  2VQH A;  1H8A C;  3OYN A;  1NG6 A;  4FAS D;  2G9W A;  3HOT A;  2HWV A;  1Z21 A;  3SJM A;  2DW4 A;  4Z2Y A;  4RGU A;  1WH7 A;  4XLC A;  1N78 A;  1TWF J;  3C18 A;  3ISP A;  1OR7 C;  3GWZ A;  3LA2 A;  2AO9 A;  1W5S A;  3HTS B;  3OSF A;  3SEQ A;  4K2E A;  3FXU A;  3RI4 A;  5CVR A;  2WAQ N;  2PX9 A;  2VON A;  2MSY A;  5IYD J;  3KP7 A;  2HYJ A;  2L0K A;  4EQQ A;  4J01 A;  3FXR A;  2LFB A;  3O6B B;  2MGQ A;  3I5U A;  3VYT B;  4CZZ A;  3RTR A;  2ZBK A;  4FHT A;  2ID6 A;  2RKH A;  2KJB A;  5E3N A;  2IGO A;  3NRV A;  2BBY A;  2CFX A;  5GAH J;  2I5U A;  3K1M A;  3K2Z A;  2LSO A;  1LJ9 A;  4BUP A;  1FP2 A;  1IC8 A;  5J8F A;  3SXY A;  2NNN A;  2VXD A;  2X4H A;  2R7X A;  4DYC A;  1ZR4 A;  3VYR B;  3KZI C;  2KRF A;  3WTS C;  1D0X A;  3ECO A;  2XAJ A;  4XRM A;  1JT6 A;  3MD2 A;  1SD7 A;  4XLH A;  4A3M J;  1JXS A;  1FLI A;  3HSR A;  2EA4 A;  2XSJ C;  4M3F A;  4U87 A;  2OU2 A;  3RDI A;  1CF7 B;  2V6C A;  3S2H J;  1OJL A;  1MBG A;  1FNN A;  4MIM A;  4RLF A;  1TWH J;  3LSR A;  1YI2 I;  2HTS A;  4BQN A;  4F92 B;  1MIJ A;  2P5V A;  2QUF A;  1S72 I;  3S3N A;  1RC9 A;  2QQ9 A;  1TWG J;  3ASO H;  5TJJ A;  4I98 B;  4DW6 A;  2GA1 A;  3KE2 A;  1FMV A;  2HTJ A;  3K6G A;  5HNF A;  3VFZ A;  1T33 A;  1G8X A;  4I0B A;  4RAY A;  1KZH A;  5HOD A;  4G7Z F;  2PJR B;  3MFK A;  1FEX A;  2WY7 Q;  3WTY C;  2DCE A;  2QVO A;  4C3I J;  4KIT B;  1EJ9 A;  1D5Y A;  5K1Y A;  3C3W A;  3TO6 A;  3FM5 A;  1IV6 A;  1I3A A;  5FKL A;  3IWF A;  4II2 A;  2UUZ A;  2DJN A;  2ELH A;  4MEY F;  2A05 A;  4E70 A;  1F5T A;  2P6T A;  5IP9 J;  2ECB A;  5EG0 B;  3FWE A;  2EH3 A;  2KRH A;  1JHF A;  5FO5 A;  1LVA A;  2DMN A;  5HDK A;  4HA8 A;  1U8R A;  3TQN A;  4AYB A;  4E7S A;  1OKR A;  4XM3 A;  1LDD A;  4X6A J;  5C4J J;  2XV4 S;  3CCE I;  5ICG A;  3CC7 I;  3H5R A;  1V5E A;  3SDG A;  4AVP A;  4BXU A;  4JX5 A;  4CSW A;  3RPU A;  1JI8 A;  2VQG A;  3DU5 A;  3WGG A;  4ESJ A;  1YIT I;  1FMW A;  1OPC A;  1B9N A;  3U2R A;  3IKV A;  1W4M A;  3F3X A;  4JBA A;  2VE8 A;  3FZV A;  1OYY A;  1V54 H;  4E6K G;  4YFX F;  1UHS A;  3C2B A;  3RPQ A;  2QEX I;  1GXP A;  3VSL A;  2JTV A;  2ACJ A;  3KEY A;  4EJW A;  5F0H A;  1LFB A;  2R7T A;  1ZKG A;  3Q3S A;  2F4M B;  1O4X A;  4ON0 A;  3BQY A;  5HLI A;  4F3Q A;  2IA1 A;  3OYA A;  4OIP F;  1B6A A;  1QNT A;  2PJP A;  3BR0 A;  1X3W B;  1X58 A;  3JRC A;  4HF0 A;  1AHD P;  2HOE A;  4DIQ A;  4GRI A;  3BJA A;  4EM0 B;  3D5S C;  4U7B A;  1I3Q J;  1XTA A;  3HPH A;  4I01 A;  5FLV A;  1QU3 A;  3IRQ A;  1T8I A;  4A3D J;  2VBZ A;  4MLO A;  3JTH A;  2FOW A;  4I76 A;  3EUH C;  1S7O A;  3G1O A;  1V3F A;  4JK1 X;  3BJ6 A;  2ZME B;  3DV8 A;  4JX4 A;  4BJ6 C;  5H2F C;  3GZ6 A;  2DA4 A;  4KIS A;  4YFN F;  1ERD A;  3KX2 A;  3HRM A;  5HOO A;  4D9J A;  3KYC B;  2JRT A;  1VZ0 A;  3FMS A;  4D5C A;  2JZY A;  3FF5 A;  1IRZ A;  3M1C A;  5GTI C;  1FBU A;  4HX7 A;  1OCP A;  4L9V A;  5D5U B;  2GOX B;  3BP8 A;  4L5J A;  4XLE A;  3HOX J;  2OZ6 A;  3L09 A;  3BG5 A;  1FSE A;  4M71 A;  3VB2 A;  4G6Q A;  5AON A;  3IAS 2;  1B1B A;  2PMZ A;  2F48 A;  2BXZ A;  2ADU A;  2UV1 A;  1QVT A;  5CVJ A;  2NS7 A;  3T0Y A;  2L9V A;  4L9T A;  1W36 C;  1ONV A;  4HST A;  4Q47 A;  4PJL A;  1G3S A;  4A5N A;  1FP1 D;  3SFI A;  3BPX A;  1VQ7 I;  3LWF A;  4EV0 A;  2LD5 A;  2KPM A;  4V2F A;  1IV8 A;  2WTE A;  2EZH A;  1LPQ A;  2Y9Z A;  2CW8 A;  1DDN A;  3MVP A;  3HOW J;  4Y13 A;  1LFP A;  3COA C;  4BXX J;  5BOX A;  1Y8Q B;  4HRI A;  5J40 A;  1IO2 A;  3LL7 A;  1GDT A;  5DDG A;  2BY0 A;  2OBP A;  1L0O C;  5DV5 A;  4V2G A;  2LG4 A;  4UV9 A;  4GGG A;  4RBO A;  1JUP A;  2FBH A;  1U78 A;  3HRT A;  4RA2 A;  3H3V K;  2XKO A;  2P0W A;  4RAZ A;  5GTH C;  1FIP A;  2HEO A;  1QZE A;  1B4A A;  2KZG A;  4RAF A;  3OS2 A;  2VUM J;  4LGW A;  3V7R A;  1MSE C;  1Z05 A;  3SFZ A;  1B72 B;  2FA5 A;  2XF5 A;  3CJQ B;  5CVI A;  1F36 A;  4KN4 X;  4A2U A;  5C3E J;  1EH8 A;  5FKM A;  3MQ0 A;  4HNT A;  4D7M A;  5KK1 A;  1YTY A;  1XSV A;  4P96 A;  3WHB A;  3G3Z A;  4HDV A;  1S6L A;  4XOR A;  2FRH A;  4M9X A;  1WQ2 A;  1OQY A;  4GXO A;  2OTL I;  4DYR A;  5CPR B;  3TGN A;  3KET A;  4IKF A;  3DLL F;  2E35 A;  3LFU A;  3MKZ A;  1W0U A;  1OCZ H;  2CUJ A;  2HU9 A;  5IYC J;  1I27 A;  2DMQ A;  3CME I;  1WH5 A;  5KCM A;  5EZH A;  4G6T B;  1YX3 A;  4Y4R A;  2VJJ A;  4ABZ A;  2WBM A;  2QM3 A;  1YS6 A;  2XGC A;  1R1U A;  3ABL H;  1SEU A;  4M3E A;  2H6C A;  1T95 A;  2F4I A;  2GXB A;  2A5Y B;  3IP4 B;  4DBR A;  1GT0 C;  3F23 A;  2DFH A;  1X2N A;  4MQV A;  3F8F A;  3BPV A;  2FEZ A;  3AG2 H;  3BG7 A;  4AM3 A;  3JRA A;  2AS5 F;  1ZRF A;  1BL0 A;  2B0L A;  3W6K B;  3O8G A;  3JRH A;  4LG3 A;  1O57 A;  2XRL A;  5ILU A;  1SMT A;  1LE8 A;  2CJJ A;  1IAW A;  1MNE A;  1MD0 A;  5LEJ A;  2GA2 A;  3D5L A;  3ZQQ A;  2DMP A;  2GZW A;  2VJ4 A;  1XCV A;  2CQK A;  2YX7 A;  4IHS A;  4EAT A;  2DK5 A;  2QQB A;  1W7P D;  2BVL A;  4XID A;  4RGS A;  1V5F A;  1RR8 C;  3CP2 A;  3ELK A;  2FXA A;  3UR3 C;  3CMY A;  4XSX F;  4A12 A;  1JUM A;  4O3M A;  3RZO J;  2IXS A;  3RJP A;  5FRN A;  4E7I A;  1A6Q A;  1F4K A;  4CUG A;  1YRN B;  4GYG A;  3CCL I;  2R5Y B;  2K9Q A;  4XN3 A;  5HS9 A;  1IN5 A;  1S8N A;  1KGS A;  1B9M A;  5LRR A;  5HLT A;  2LH9 A;  2V1D A;  2XIG A;  2FSW A;  1LEA A;  1YG2 A;  3FX3 A;  2A5W A;  4QLC U;  1G59 A;  1W36 D;  5IOZ A;  2XVC A;  2MD5 A;  3GTL J;  3DTI A;  1LQ1 A;  1Y1W J;  4AUX A;  4A0X A;  2O6G E;  2LP0 A;  2W25 A;  3G1L A;  5LGU A;  1VTN C;  1XN7 A;  4KUM A;  1MMS A;  3HOV J;  5FD6 A;  3GUD A;  4RGX A;  1X4O A;  1IN7 A;  1Q1H A;  1RR7 A;  3EDP A;  3VYU B;  5L3F A;  2MH2 A;  2M87 A;  2ZFW A;  4HG2 A;  2IS2 A;  2ZB9 A;  2VIX A;  4ENK A;  3CD6 I;  5FKN A;  4EJO A;  5FKK A;  2CW7 A;  3PQJ A;  3M1E A;  2VL8 A;  2XDV A;  2HPM A;  1I6H J;  2CV0 A;  2HR3 A;  1VQ8 I;  3K1P A;  1LNW A;  2OV7 A;  3WG7 H;  2HXO A;  2EV5 A;  1F9N A;  5GAE J;  2KQR A;  1T38 A;  5BS6 A;  2AXT C;  2E34 A;  5E3O A;  5BPD A;  4Q4Z F;  2K9L A;  2NYX A;  2JA6 J;  4B47 A;  2HDC A;  4PFP A;  1O7L A;  4C3J J;  2W48 A;  4CIC A;  5HVQ C;  3WGH A;  2W57 A;  2W7N A;  1EF4 A;  3ZQ7 A;  4G6D A;  1DUX C;  1BBY A;  1ULY A;  1I50 J;  5F0F A;  4AYB N;  1RKT A;  4ENJ A;  1VQ5 I;  4JP0 A;  2R7R A;  3S15 J;  3M4O J;  2R7V A;  2HKX A;  4C2T A;  2OCE A;  3NAU A;  5KAI C;  2DTZ A;  4KIC A;  3TW6 A;  4OIN F;  2HOS A;  2IA0 A;  1QO0 D;  1IZ1 A;  3ABU A;  1DGW Y;  1SFU A;  2H27 A;  3S93 A;  5H6R A;  3W3C A;  2Y2Z A;  5GAG J;  2VC0 A;  4KIB A;  3LOC A;  4MFD A;  3I71 A;  3F21 A;  4MQ9 F;  2STT A;  3I4M J;  5JVT A;  3DCF A;  2QQA A;  4EVI A;  1K79 A;  3JRD A;  3WTX C;  3OYH A;  2DPD A;  2ZXJ A;  1ON1 A;  2YPR A;  3LAJ A;  3HOZ J;  4G9Y A;  4HQM A;  1Z9C A;  2L5Q A;  1NK2 P;  3E0J B;  3TED A;  2V9V A;  4WXH A;  5D8K B;  2HQ5 A;  3WOD F;  2WB1 N;  4XKV A;  3LA3 A;  4JQF A;  2GWR A;  2DA5 A;  5D8L B;  4Q5S F;  5K7Z A;  2LTP A;  3OIQ A;  2FNP A;  3TOB A;  1D8J A;  1FYM A;  6PAX A;  3GTM J;  3W6V A;  3MMY B;  1WSU A;  2OPT A;  3KYL A;  2R4G A;  3E97 A;  2EB7 A;  2X6W A;  4HW0 A;  2V4J C;  3ZCO A;  4F55 A;  1PP7 U;  2CV1 A;  3WE3 A;  4XK4 A;  2MAB A;  3MZY A;  5L3C A;  3L1P A;  3V8L A;  2UXN A;  2W82 A;  2KT0 A;  2ICW G;  1Y0U A;  1T6S A;  1P2F A;  3OWT A;  2QGU A;  4DZP A;  1HW5 A;  2K9N A;  2P5K A;  1B8I B;  3S32 A;  3RKQ A;  5D6E A;  2M0C A;  1I39 A;  2B63 J;  3S3M A;  1REP C;  1WJB A;  2ZSI B;  3K70 D;  4LK0 F;  2X6O A;  3SHF A;  5LRS A;  1SD4 A;  2P81 A;  3OYJ A;  3K10 A;  3PNV A;  2DMT A;  1HDP A;  4KNY A;  2ME6 A;  4UXN A;  1TW3 A;  4AC0 A;  4EMS A;  1FT9 A;  1JKO C;  3RPU D;  2XAF A;  3ZQF A;  4AIJ A;  3ZMV A;  1BW6 A;  3BTC A;  4IEJ A;  5ERI A;  2MG4 A;  1UHW A;  1BM9 A;  1V4R A;  2K86 A;  5M5W J;  3EUH A;  4WXC A;  2VOD A;  2R7U A;  3A01 B;  2M7B A;  3QYF A;  4P5O A;  5IP6 A;  3RZD J;  4Q48 A;  1MZB A;  2HPI A;  3GTP J;  5F08 A;  2E1M C;  2EFN A;  2NVT J;  1MJB A;  3TL4 X;  2E1C A;  2L4M A;  4C9Y A;  1OR7 A;  2DJI A;  1OYI A;  1YW7 A;  1MBF A;  1R5H A;  1LKX A;  2HGC A;  4YIR X;  1ZHF A;  5E8I A;  2IGM A;  1A36 A;  1KQ9 A;  1T2K A;  2UZK A;  3SZT A;  5F1J A;  3MN2 A;  2RDP A;  3G1M A;  1IN4 A;  2V1N A;  4QPO A;  4UUV A;  2XUB A;  2AQE A;  2PG4 A;  2ZME C;  2BOL A;  3CO6 C;  1YW9 A;  4F7Z A;  4HF2 A;  2EWN A;  4YFK F;  4RDU A;  1B72 A;  3GFJ A;  2J5P A;  1P7J A;  3IRR A;  2RN7 A;  3PIP F;  1ZQ3 P;  2HZD A;  3D5R C;  3V42 A;  4M3D A;  2AQF A;  3PSF A;  2JSP A;  5EDN A;  4BAC A;  2A6H F;  2NOG A;  2V7F A;  2XGX A;  1ZG1 A;  1XD7 A;  5LGT A;  1K61 A;  4XMY A;  2VJ5 A;  3OYI A;  4A3C J;  3KLN A;  3RSN A;  3OYM A;  1ETY A;  2BY3 A;  2R7O A;  2IEK A;  1PVE A;  1BI0 A;  1WGX A;  3QOP A;  4X1E A;  5E79 C;  3P5J A;  3R0A A;  1D3Y A;  3VDX A;  2L7M P;  3J7Z I;  5L3B A;  2H8R A;  2DAO A;  2M2E A;  1PJR A;  2M1B A;  1ZTR A;  4U0W A;  2Q8K A;  3GXO A;  3R6S A;  4HLY A;  2BHZ A;  2PMZ N;  1GLN A;  1ON2 A;  3CF2 A;  3GBG A;  2K3F A;  3QWL A;  4BGD A;  3S17 J;  1IXC A;  5ILS A;  2Y0S N;  3HJE A;  4HNU A;  3HTU A;  2CUF A;  3PM1 A;  1FJL A;  3K4L A;  2M5W A;  5LEK A;  2A07 F;  1YLF A;  3B73 A;  2ZJR F;  3TO9 A;  4BEH B;  1QRY A;  4FE4 A;  5EEH A;  4X0G A;  2DPU A;  3F0C A;  3ZQG A;  2ZXI A;  4XBF A;  1AOY A;  1MH3 A;  2V9P A;  2XGE A;  4L0Y B;  3H1C A;  1ENH A;  5HS8 A;  2XAH A;  3PFY A;  4BYY A;  4DNC A;  3MZ8 A;  3WTU C;  3I59 B;  2MLK A;  1Z7U A;  2HOA A;  1Y6I A;  1TQM A;  2ZKZ A;  4H0E A;  1UG2 A;  1JT0 A;  3FXL A;  4CO8 A;  3MKL A;  4KT6 A;  1G4D A;  4H4K C;  1IUF A;  2PN6 A;  4BHC A;  1R6R A;  3DKX A;  1O3Q A;  2JUG A;  3BCB A;  2QKM B;  4J00 A;  2CV2 A;  3DFG A;  2DFI A;  3BZ6 A;  2HQA A;  2QF7 A;  4WXD A;  3Q0V A;  1YJ9 I;  1FBQ A;  4M73 A;  1ZLK A;  4I09 A;  3IWZ A;  3FMQ A;  1BIB A;  3ZR8 X;  3LSH A;  3M9A A;  1R71 A;  2L7Z A;  2KDZ A;  2NS0 A;  2DOA A;  4BDY A;  5J3L A;  3REO A;  3HHH A;  2Z1D A;  1HLV A;  2BW3 A;  1IXS B;  2R7Q A;  4N0B A;  4BBR J;  4QIW N;  2FMY A;  3AL0 C;  4BQA A;  3E1S A;  2PEX A;  1G3Y A;  1K4S A;  4G7O F;  3WU1 B;  2V1U A;  3C2H A;  3CCR I;  4PSX A;  2HKO A;  1IDZ A;  4ZDO A;  3K0L A;  4HV5 A;  3QOD A;  3HKZ N;  4L9J A;  2OQR A;  1JKQ C;  4LLG F;  2WWY A;  2UWM A;  4PK4 A;  2JVG A;  3DPT A;  1TW2 A;  2EQR A;  1HBX G;  3GME A;  3GYH X;  1UB9 A;  1YE9 A;  2DN0 A;  3QOE A;  2XPU A;  2Y69 H;  3N97 A;  1O3T A;  2XRO A;  1KON A;  2MD0 A;  4S05 A;  5DUI A;  3CZ6 A;  2O8X A;  5GPC A;  2JPB A;  1HKS A;  4ZDP A;  4ZDL A;  2OJE D;  4QWQ A;  2P7C B;  3OY9 A;  2JSC A;  1KU9 A;  1V5G A;  2JQ7 A;  3BY6 A;  2GIZ A;  1POG A;  2ME0 A;  2LNB A;  2Y75 A;  1SVO A;  3KP5 A;  2JT1 A;  1MGT A;  1TQI A;  4A3I J;  2VBW A;  2V26 A;  3BR6 A;  1ETK A;  2L9S A;  4FCY A;  4XLP F;  4IHT A;  3W2V A;  5F0C A;  3R60 A;  1J0R A;  1PUF B;  1TL8 A;  3O8H A;  3E5U A;  3ZMD A;  2M4G A;  3AG4 H;  4XQF A;  3E7L A;  1H88 C;  3LA7 A;  4RB0 A;  3CCQ I;  3AG3 H;  1TNS A;  1M1E B;  1WVR A;  2NXN B;  1CF7 A;  2MBF A;  4KDP A;  2L9N A;  2F5V A;  1XX5 A;  1YQA A;  3S1M J;  5A2Q K;  5D5V B;  2DT7 B;  4NUB A;  4EJV A;  3VWB A;  5FRO A;  3P9K A;  3GZN B;  3I59 A;  3IHU A;  3TKY A;  1X1D A;  1USS A;  4NHJ A;  2CFO A;  4HX8 A;  3RKW A;  1UJ8 A;  2G7U A;  1E17 A;  2ISZ A;  1MW7 A;  2K85 A;  3L2C A;  1KQ8 A;  1BR1 A;  2E2J J;  2O5R A;  1S5L C;  5DCM A;  1CQT A;  3KPH A;  5CYV A;  3DEE A;  4ENM A;  4KN7 X;  2IGK A;  4ESF A;  3J80 Z;  4F93 B;  3NWS A;  4BY1 J;  3BDD A;  2GLO A;  3PFI A;  3V8K A;  2YR2 A;  1SD5 A;  1YX5 A;  4AIK A;  3HHG A;  2R93 J;  3JR9 A;  5B3S H;  2XB5 A;  4QPQ A;  5BNG A;  1Y8R B;  1HCR A;  4FE7 A;  3RYP A;  3U1D A;  2EIK H;  4UVB A;  1MNM C;  4BH9 A;  2FBI A;  3TOA A;  2ELJ A;  5TGT A;  2E1N A;  3HKZ A;  3GW2 A;  2CS3 A;  2A3S A;  3ZQH A;  3HGG A;  1RUO A;  1PUF A;  1IXR C;  2QQ8 A;  4XRF A;  1AU7 A;  1Z91 A;  3G73 A;  3HOY J;  3GFI A;  1HKQ A;  2VPL A;  1Z67 A;  3DPU A;  1ETV A;  3E3V A;  4ZYH A;  2PBI A;  3GCM A;  4D0P A;  5TRD A;  3I4P A;  1FY7 A;  3H0G J;  4P9F A;  3ZMU A;  1LE8 B;  3JAM K;  5FJ8 J;  3P7N A;  3CJN A;  1XGN A;  2QYO A;  1Z7L A;  2PJR A;  2LKS A;  2CH0 A;  3F8N A;  3VEP A;  4C2M J;  2WAQ A;  4I7H A;  3WTT C;  3WG9 A;  2JWT A;  2X48 A;  1Y0N A;  2COM A;  4RMN A;  5D6F A;  4QTR A;  3I64 A;  3ERM A;  1G6N A;  3BJO A;  3JCU C;  2YS9 A;  2VKE A;  2Y30 A;  2ZJP F;  2AHQ A;  3PL8 A;  3QPL A;  1YOV B;  2DLL A;  3R61 A;  3E5X A;  5EYR A;  1KYW A;  2IVM A;  3F8M A;  5FRM A;  4CYD A;  4V19 K;  1S7E A;  1J9I A;  2YX4 A;  2FML A;  1N75 A;  2KRC A;  2LF8 A;  3OYK A;  3X2Q H;  1K7A A;  2BV6 A;  2HVQ A;  1SFK A;  4YEL A;  4XIC A;  3QRF F;  3J7Y J;  4B44 A;  4ESB A;  2WB1 A;  2D45 A;  1HC8 A;  3S3O A;  3DPL C;  3I55 I;  4R79 A;  2YUS A;  3IL2 A;  4E7L A;  3OSG A;  4I99 C;  2BXY A;  4M6V A;  2XB0 X;  2OQG A;  3S2D J;  1XS9 A;  1S3J A;  4WK8 F;  2OAZ A;  3M7G A;  3QPS A;  4IHV A;  1AKH A;  1DQU A;  2EBI A;  1IRG A;  5FFX A;  3FIW A;  1BI1 A;  3RIR A;  1HSJ A;  2G7H A;  1Z6R A;  3HBL A;  4HNV A;  1YFH A;  3A01 A;  2OA4 A;  2DYS H;  3H0D A;  4IRG A;  4YII A;  2A61 A;  1MMN A;  2R0Q C;  3EUK L;  4XRS G;  5F1R A;  1K78 B;  2LBF B;  3HYI A;  4CCO A;  3PJR A;  1RES A;  3HSE A;  3M8E A;  3J7A Y;  1Y1V J;  2JA5 J;  2IJL A;  2K5C A;  2LKX A;  5DS9 A;  2Z9O A;  4OMY A;  5A2Q Z;  2YU3 A;  1F43 A;  2RNJ A;  3AAF A;  5ICF A;  2DOE A;  2EIN H;  2MFZ A;  4ZJZ A;  2FUG 2;  4KMU X;  2AXL A;  4CCL A;  4B48 A;  2X51 A;  2OC6 A;  1ETW A;  3CC4 I;  4G94 A;  5LBQ A;  3QYE A;  1Y56 A;  2D2W A;  1SAN A;  2XAG A;  3BG3 A;  4ZYA A;  4IRH A;  4B43 A;  3WTV C;  3CCY A;  2QBY B;  2R92 J;  4I2O A;  2VXZ A;  3OYF A;  2CUE A;  2GXG A;  4I6Z A;  4A3B J;  4UB6 C;  2CSO A;  4ITV A;  3CUQ B;  1MMG A;  3K4M A;  5CJ9 A;  2PI0 A;  1GXQ A;  4LK1 F;  2KP6 A;  4BE0 A;  3ZQL A;  1D1C A;  2N8G A;  5F27 A;  1NG7 A;  1QHG A;  2QEN A;  3CDH A;  4JX6 A;  2VB6 A;  4Y3O A;  2VT3 A;  3IH2 A;  4A3E J;  2Y31 A;  4BS9 A;  4GYI A;  2WAF A;  3ABT A;  2ZC2 A;  3H92 A;  4IJA A;  1JJ8 C;  4KT5 C;  1P92 A;  4P55 A;  5M5X J;  4MEX F;  3ZN1 A;  4NDL A;  4BE2 A;  1Z77 A;  2BY1 A;  4OU0 A;  4IXA A;  3BG9 A;  1EH6 A;  2EZL A;  1SFO J;  3E6D A;  1R23 A;  2K7L A;  3PO3 J;  1O3S A;  5L3E A;  5M3F J;  5F6F A;  3A02 A;  1XMA A;  2V6E A;  3JTG A;  1R1T A;  2BVM A;  3SZG A;  1R5I D;  2HNH A;  4UNO A;  1HW1 A;  2M7A A;  4Y15 A;  3RKX A;  3LMM A;  4IVN A;  3S2W A;  1U0J A;  5D5W B;  5EGO A;  1ZN2 A;  4B4C A;  4E7H A;  2O9L A;  4RGR A;  1FOX A;  2O3F A;  3A1Y A;  4P9U A;  2IS6 A;  5JFR A;  2VBX A;  1YIO A;  3HEF A;  4O6J A;  4XKB A;  1UEL B;  3V7S A;  5K5R A;  3FMR A;  5J47 A;  2L7K A;  1VFC A;  2F5D A;  3JRI A;  3GTJ J;  3L00 A;  3I58 A;  1UAA A;  3H5A A;  3N05 A;  3U21 A;  1FX7 A;  1GV2 A;  4PGG A;  3ULQ B;  3HDD A;  5J1R A;  1MBE A;  3OL4 A;  4RS8 A;  3L2Q A;  5TIS C;  2C6Y A;  3BRO A;  3CMM A;  2CGP A;  3V7C A;  4M3G A;  3FK7 A;  4IQJ A;  1BR4 A;  2HVR A;  4XR6 A;  5BMZ A;  2EFW A;  1RI7 A;  1R7J A;  5AIQ A;  2P8T A;  3BZC A;  1FWZ A;  1U9O A;  1Q1V A;  1FTT A;  1OYW A;  3ECH A;  4BHP A;  4MO7 A;  2Y0S A;  4BNC A;  3BLY A;  4YEJ A;  1O3R A;  2XHK A;  2WV0 A;  3I53 A;  1X3U A;  5KVR A;  1HF0 A;  1R9T J;  1ZG3 A;  4OAY A;  1D1B A;  3FKJ A;  3NQO A;  3OYD A;  4U0Y A;  4XRS A;  2Z33 A;  5HS7 A;  3IH4 A;  3H36 A;  4KA4 A;  2VAS A;  3K7A J;  5GP9 A;  5DM6 F;  1X4P A;  2BW3 B;  3DP7 A;  3ZMT A;  1CGP A;  2E36 A;  1WI3 A;  4XOT A;  2O0Y A;  4ZYE A;  3OYG A;  2PMU A;  3MEX A;  2HDD A;  4M6Y A;  2HXI A;  4MFE A;  1XPX A;  4WCG A;  2ZSH B;  2F6C A;  4HZF A;  1TWA J;  4Z6Y A;  3DKY A;  4IPA A;  3O3K A;  4XOP A;  3W6J B;  2M30 A;  2W85 A;  2F5F A;  1MH4 A;  3H9G A;  3J7A O;  4FT8 A;  2LK2 A;  1RET A;  4AIH A;  3P9C A;  3SDB A;  1C0W A;  3F8C A;  1RZ4 A;  4M9S A;  4BDZ A;  3GZ5 A;  3W2A A;  5LGN A;  1ETX A;  1SD6 A;  1QHH D;  5CLS A;  5DCF A;  4A3K J;  1ZR2 A;  1U6G A;  1JUS A;  3K4C A;  1LDJ A;  3QPT A;  2R7F A;  3HRU A;  2Q2E A;  1BIA A;  2ELK A;  2XPV A;  2HS5 A;  2ZNZ A;  2JPC A;  2MA3 A;  3OL3 A;  4YRV A;  4KIG A;  1IRX A;  1BJA A;  1SFX A;  2M8E A;  2OZU A;  3VOE A;  4ZTJ A;  1ZH5 A;  3OYL A;  1HOM A;  3OIP A;  1FOW A;  2LRD A;  2BEO A;  5FFZ A;  4HV6 A;  3F9K A;  4LG0 B;  2FNA A;  2WA0 A;  3K1N A;  3ONQ A;  1G3T A;  4BQQ A;  2E2I J;  4UUS A;  1OCT C;  3CLQ A;  2PLY A;  3AG1 H;  1NK3 P;  3A0B C;  5LLQ A;  4A69 C;  1R5G A;  2JJ7 A;  3TDU C;  2EK5 A;  4CCJ A;  2XC7 A;  4HAM A;  5F04 A;  5BQT A;  5M5Y J;  2LLK A;  4PJ0 C;  4Y17 A;  2JUC A;  3WTZ A;  1ZRE A;  3A2K A;  1PYV A;  1ACI A;  2RVC A;  3KZZ A;  5FKO A;  2VQL A;  2G0E A;  3GFL A;  2VPR A;  1R22 A;  2HYG D;  3PNY A;  1SVM A;  1D5V A;  4XON A;  4A0Z A;  2L01 A;  4PJN A;  1LUJ B;  4NQW A;  4XNF A;  4LOC A;  3J81 Z;  3GLL A;  3JRG A;  1FYL A;  1WRJ A;  3ZN0 A;  2TCT A;  2XGD A;  1X19 A;  3EQL F;  1WWX A;  5EEA A;  2FQ3 A;  4G12 A;  4S04 A;  4ZYG A;  2OCC H;  3L2V A;  5J4V A;  1DGR M;  5EG0 A;  1YRN A;  2I8D A;  2KIU A;  3JRF A;  2HVS A;  4RLQ A;  2KIM A;  3ERE D;  2YU9 J;  4BU2 A;  5HDN A;  2DYR H;  1R58 A;  3WTW C;  3M3Y J;  1I1S A;  1R36 A;  2DDB A;  1HST A;  2KKO A;  2P4W A;  2NVU B;  4GO1 A;  4B3X A;  1Z0X A;  3RYR A;  3CUQ C;  1FYK A;  3C7J A;  1G3W A;  3Q9S A;  4N9I A;  3L2W A;  1D8K A;  4L5E A;  5E17 F;  3IV5 A;  2M0M A;  4S0H B;  4EJT A;  1OCO H;  1T98 A;  4Y33 A;  1A6I A;  3QU3 A;  2W4S A;  3MZH A;  2R3S A;  4BJT A;  1OMI A;  1ORK A;  3BG6 A;  4IQ4 A;  1A5J A;  1E2X A;  1UG0 A;  1WJC A;  5J1U A;  2QZ8 A;  3KP4 A;  2HDW A;  1YIJ I;  1TNT A;  2X85 A;  3BOQ A;  1H89 C;  1ZAO A;  3LNQ A;  1XDU A;  2NVX J;  2HI3 A;  5IT3 A;  3OMY A;  3MKW B;  2BY2 A;  2CU7 A;  1B8I A;  1AA7 A;  4LLN A;  3VPR A;  2L7F P;  1SFE A;  1NTC A;  1ETQ A;  3K4J A;  2E1O A;  5D4R A;  1R49 A;  1ZK8 A;  2RQQ A;  2Q1Z B;  2E19 A;  3ROU A;  4EM2 A;  1GUU A;  4OIQ F;  2V9K A;  2MW8 A;  3DBL B;  3PQK A;  2DXI A;  3FHZ A;  4J19 A;  5C4X J;  4M72 A;  1EV7 A;  5ICC A;  2FX0 A;  4IOA F;  2M9H A;  2BGC A;  1D1A A;  2DA7 A;  2IPQ X;  4ENN A;  4CCK A;  3KLO A;  2LR8 A;  3ASN H;  4XLN F;  1EH7 A;  2ZO4 A;  3OS0 A;  4GDF A;  3MWM A;  5FGM A;  2ECC A;  3A03 A;  1K6O A;  3FHN A;  1T0F A;  4HPQ A;  4BEH A;  3BTI A;  3FBI B;  4EM1 A;  1UZC A;  4LG0 A;  4UUT A;  1VQK I;  1BOA A;  2F4O B;  1QPM A;  3GF2 A;  3E6C C;  4HX4 A;  3T1B A;  3AKZ A;  5EF6 A;  4BXF A;  2ID3 A;  3K70 C;  1B59 A;  4AU7 A;  4CCM A;  1VQ6 I;  1T08 B;  4N4N B;  5DTD A;  4TV7 A;  4E7K A;  2H1K A;  1RUN A;  4MHG A;  1J7K A;  3LQR A;  3F72 A;  4R1H A;  4BQO A;  4BE1 A;  5DCM B;  4CXF A;  1WJF A;  2BYV E;  2IRF G;  2E60 A;  3GTO J;  4B09 A;  5HLG A;  3JSP A;  3HPG A;  2XF7 A;  1K4T A;  2MLG A;  1F1Z A;  4AID A;  2VE9 A;  3HOU J;  4IRI A;  3FIS A;  1IW7 F;  4L18 B;  3S8P A;  2LDU A;  1HDD C;  2CRG A;  1H9T A;  1TTY A;  3F6O A;  2DK8 A;  5JHU A;  1MKM A;  3VOD A;  5E1Z B;  3UNG C;  3BCA A;  2IGN A;  2LRE A;  1LEB A;  4WF2 A;  1PUE E;  1RKW A;  5IPA A;  5E18 F;  2DDA A;  2DBB A;  3JAM Z;  2JMW A;  2LYC A;  3HGY A;  3BR5 A;  1TT0 A;  3HIF A;  2O7O A;  4LLL A;  3EYI A;  2GBY A;  5E1W A;  5JVG F;  1RNL A;  1T39 A;  5EEG A;  2D5V A;  3OIO A;  5B5E C;  4MNU A;  5DUK A;  1FOK A;  3FXQ A;  2FF4 A;  3TBI A;  4CDG A;  1TWC J;  4CZC A;  1MJA A;  4CYC B;  1KU3 A;  3BR1 A;  3E6M A;  3WU0 A;  2VLA A;  4JYK A;  2QA4 I;  4IX7 A;  1UST A;  3LAP A;  5L3D A;  4XLA A;  3HL2 A;  3FM3 A;  2XF6 A;  3W2W A;  2NRA C;  3BT9 A;  3I0T A;  4LB6 B;  2YSR A;  3I9V 2;  1X2M A;  2BE5 F;  5J4Y A;  4XSZ F;  3CJR B;  2QSH X;  3KYD B;  4KFC A;  2ZXH A;  1X1B A;  5D4S A;  5K5O A;  4P1W A;  2TRT A;  2VOO A;  1TC3 C;  1YHQ I;  3GTQ J;  2ZJQ F;  4ZC3 A;  2EZK A;  2XAQ A;  2VKH A;  4XKW A;  4IHY A;  1X1A A;  2E7W A;  1I1G A;  4PJJ A;  5EZG A;  3OYB A;  2DA6 A;  1JTY A;  1BA5 A;  1XDS A;  2W1O A;  3GLX A;  2XKP A;  1K6Y A;  4MGR A;  4UB8 C;  3I54 A;  3DQV C;  3M8J A;  1RPW A;  3CQZ J;  1HKT A;  1NH3 A;  4LFU A;  4R8H A;  4A93 J;  1SAX A;  3FK6 A;  5JLW A;  3KEO A;  2QLZ A;  2EFQ A;  4NQW B;  3CUO A;  3M07 A;  2R5Z B;  1O7F A;  2X1C A;  2ZCW A;  1QGP A;  2F5E A;  3TMO A;  4D1Q A;  1VQM I;  1ODD A;  2X0L A;  1QVU A;  3JRE A;  3NAR A;  3D0S A;  2CYY A;  2FE3 A;  3T8T A;  4PZJ A;  3F8B A;  3H3Z A;  3CCU I;  1MND A;  2Z99 A;  1IUY A;  1YS7 A;  4OOI A;  4O5V A;  1FBS A;  4GCV A;  5IYB J;  4IL6 C;  4W1U A;  4M9Z A;  2MC4 A;  2Y48 A;  4OWR B;  5F64 A;  2DO7 A;  3CLO A;  2KIQ A;  2FD5 A;  2K3P A;  2FBK A;  2E1M B;  2H09 A;  2LY9 A;  3CUQ A;  2XRN A;  2K4J A;  3ESW B;  4CGZ A;  1J5Y A;  1W1W E;  3BQZ A;  2DT5 A;  1IN6 A;  2QKL B;  1APL C;  2I10 A;  2LF7 A;  2Z5U A;  3U1K A;  4AVZ A;  3LSP A;  1FOY A;  2LY1 A;  1LVK A;  4LMY A;  2KIS A;  2GM4 A;  2NNY A;  1KYZ A;  1T56 A;  1ETO A;  4HLX A;  5AIP A;  4BKX A;  1FSH A;  1E3P A;  2F2E A;  1H9G A;  1VF9 A;  2WC2 A;  3AL0 B;  3HRS A;  1WHU A;  2L02 A;  4NC8 A;  2DQR A;  5JI6 A;  3DBR B;  2K9M A;  3CO7 C;  1QA6 A;  2FJ1 A;  4PGH A;  2EIL H;  1N77 A;  4XN0 A;  1E3H A;  2E5N A;  5B66 C;  2JVH A;  3H9J A;  2LY2 A;  3C1D A;  1XMK A;  5KHD A;  4U0V A;  4EGY A;  1J09 A;  1ZRC A;  1BOB A;  4KIF A;  1ZAR A;  2Q0O A;  3P9I A;  4HBL A;  3J81 K;  1KA8 A;  4DGW B;  4PDK A;  2KMU A;  2EV0 A;  2WV1 A;  1L3L A;  2KHM A;  2LMD A;  3NWT A;  3SQN A;  3D1N I;  3RQ4 A;  2LBF A;  3FXK A;  2NVQ J;  4EGZ A;  1TT5 B;  1W7P A;  4G7H F;  2WY8 Q;  3M8F A;  3QU6 A;  4LD5 A;  2HQN A;  2OTJ I;  3GVA A;  4CA0 A;  4BY7 J;  3F6V A;  1N25 A;  1D0Y A;  2XSD C;  2RC4 A;  3BTL A;  5IY5 H;  5JHF A;  1IGN A;  5DD8 A;  4KJZ A;  1TLH B;  1R4M B;  1P4W A;  4IZZ A;  3KP6 A;  3CDI A;  4CYC A;  2K9S A;  1LB2 A;  5FLX Z;  4ZYD A;  1U8B A;  2LVS A;  3B02 A;  1IDY A;  1WKM A;  3LFK A;  5FLX K;  4ASN A;  1WCM J;  1OCR H;  2IW5 A;  1MSF C;  1P7I A;  1WZ2 A;  2KFD A;  5FB2 A;  1VQ4 I;  1P9Q C;  1W5T A;  3FXM A;  4HOB A;  5K7H A;  5JLX A;  3CES A;  1D0Z A;  2JA7 J;  3IKT A;  4KMF A;  4NBQ A;  3CCJ I;  3GTG J;  2VKV A;  2VQC A;  3DEU A;  3CC2 I;  4UY8 I;  3HM5 A;  2JRM A;  3KFW X;  5DD4 A;  2DA1 A;  1RRJ A;  1J75 A;  2M3A A;  3A4C A;  4A6D A;  2M4K A;  2KLO A;  1W0T A;  2JA2 A;  4KYW A;  5CVV A;  2ZJ2 A;  1Z3Y A;  1SC7 A;  4HSR A;  2ZME A;  3PUF A;  5J8C A;  4BHB A;  2TDX A;  4A3L J;  2QSG X;  3G6E I;  3ZP5 A;  3V8J A;  4N4O B;  4F91 B;  4IO9 F;  4RB2 C;  1I6X A;  2V1X A;  2X6X A;  2Z2S B;  3HOS A;  1R00 A;  2UXX A;  1ZRD A;  2P5L C;  3K2A A;  2X1E A;  4A6E A;  4EJU A;  4RM3 A;  2DT6 A;  2R7Z J;  3R0J A;  4HQE A;  4RAG A;  5E8G A;  3OYC A;  2NAZ A;  4LIV A;  3SZP A;  2E2H J;  1HXD A;  2W00 A;  3KZY A;  3MAJ A;  2Z3Y A;  4OIO F;  2GOM A;  2VN2 A;  4PCQ A;  3DU6 A;  1HW2 A;  3DF8 A;  1TZL A;  2J5O A;  3HG9 A;  3BTJ A;  4C30 A;  4FTH A;  5B1A H;  3Q0W A;  2ESN A;  1JKP C;  3NEU A;  4DYQ A;  4B1R A;  2ISY A;  2CQN A;  5M3M J;  2O8K A;  2CG4 A;  2B7E A;  3HXL A;  5CKT A;  2E7X A;  1DPU A;  5CQE A;  1BR2 A;  4C3H J;  4AWX B;  4HYE A;  1FC3 A;  2E71 A;  3GX4 X;  4ZZD A;  2PFB A;  3LSI A;  3K69 A;  1OCC H;  2JK3 A;  3RCO A;  2CWE A;  4IF4 A;  3CP8 A;  4NNJ A;  2GAU A;  3OR1 C;  5C44 J;  1U5T C;  5E1X A;  4ETS A;  4QSH A;  5E3L A;  4DJA A;  2MYS A;  3VSK A;  1T0F C;  5KNL A;  5BPI A;  5EJC A;  1Z6T A;  4E7J A;  1NHA A;  3BWG A;  1OIS A;  3I4N J;  3H9Q A;  3ZQC A;  1XB4 A;  1MJ9 A;  3H3U A;  2B9S A;  5IT9 K;  1SAU A;  2ZNY A;  2K02 A;  3TW7 A;  4FQG A;  2R7W A;  1XGO A;  3L2R A;  3CF5 F;  3CTA A;  2XAU A;  1S9H A;  2R5Y A;  4DOZ A;  1QBJ A;  2K4B A;  4IHX A;  4CHU A;  5B1B H;  1A31 A;  2A69 F;  2DFF A;  1GV5 A;  2L9R A;  2RAE A;  3QAH A;  4HF1 A;  4E4H A;  2K40 A;  1VQ9 I;  1PP8 F;  1MMD A;  1W5C C;  5JR3 A;  1K83 J;  3KCC A;  2R7D A;  5CQG A;  1LFU P;  4FET A;  2DOF A;  2BZT A;  2L2O A;  4F52 A;  1S29 A;  4W97 A;  3OS1 A;  1XG1 A;  4II3 A;  3EUA A;  4WX9 A;  3MCZ A;  1PDN C;  3T8R A;  3FKI J;  2DTR A;  2P7V B;  2CUZ A;  1P4A A;  3J80 K;  1KU2 A;  1A35 A;  1WFX A;  2EIJ H;  1FZP B;  1IN8 A;  5L3G A;  5GAD J;  2ZFU A;  1ZYR F;  4DQ2 A;  2JA8 J;  2IS1 A;  1R1V A;  5E3M A;  4A5M A;  4UVC A;  3F22 A;  2KL4 A;  5LFA A;  4LJZ F;  1JTX A;  2CW0 F;  4EEF G;  5LD2 C;  4RM2 A;  2DA3 A;  4JOM A;  1DP3 A;  5DM7 F;  1S7A A;  2D1V A;  3E5Q A;  3N4M A;  3IH3 A;  5GPA A;  2ESH A;  4RB3 C;  3L2U A;  3ML6 A;  1I5Z A;  3WGI A;  3O2P E;  2DU9 A;  3ZMS A;  3ZMZ A;  4ANJ A;  2W84 A;  2LC2 A;  3FBN B;  3ZOB A;  2BHY A;  4E7Z A;  1FIA A;  4YIF A;  4PUS A;  3DWL E;  3DLA A;  2WAE A;  4WWC A;  4ZH4 F;  2IAI A;  1UHM A;  2VC1 A;  3VYS B; 
#chains in the Genus database with same CATH homology
 3L7W A;  5J6X A;  2EJR A;  1BN5 A;  4LB5 A;  2KIF A;  4B8X A;  4FX4 A;  2RQP A;  2CO5 A;  5HDG A;  1U5T A;  2L3D A;  1P6R A;  4L0Z B;  2IP2 A;  1BI3 A;  3V4G A;  1QQI A;  1QZZ A;  3Q5F A;  1ZLJ A;  3DXJ F;  2H94 A;  2M45 A;  2MC3 A;  4M6X A;  3HSF A;  1AWC A;  4FX0 A;  4RB1 A;  3JW4 A;  1IF1 A;  3KP2 A;  3T5X A;  2W24 A;  5LHI A;  1K78 A;  4OIR F;  2RGV A;  3R4K A;  2XAS A;  4OMZ A;  3Q9V A;  1RIO H;  2Y0M A;  5DYM A;  2V79 A;  1DPR A;  2KJC A;  2K27 A;  1FPQ A;  2PQ8 A;  5IT9 Z;  1DP7 P;  5HLH A;  1H0M A;  1JHH A;  3EET A;  4MTE A;  3WE2 A;  2LKP A;  2L4A A;  3KP3 A;  1GHC A;  1XSX A;  1KU7 A;  3GFM A;  2EV6 A;  3QPH A;  4NB5 A;  5ILV A;  1XSD A;  1W7P B;  5D5X B;  4MTD A;  4A0Y A;  2VBY A;  3JSO A;  1XGM A;  4YG2 F;  2A6E F;  2EFO A;  3OV8 A;  1XGS A;  3K9T A;  3U9G A;  2HFH A;  3KEQ A;  4UHT A;  2O61 A;  4HDU A;  5ED4 A;  1U2W A;  5CVU A;  1MDM A;  1ZGA A;  1HQC A;  3OOP A;  1JGS A;  1UFM A;  2FU4 A;  4UV8 A;  1J59 A;  2D1H A;  1JE8 A;  3DKW A;  4I02 A;  1J2X A;  1MDM B;  2MH9 A;  3EYY A;  3RKY A;  2F5C A;  1TQP A;  5K5Q A;  1STZ A;  1WI9 A;  4ZZL A;  3LQQ A;  2VT2 A;  2EFP A;  2STW A;  4U88 A;  4G8X A;  2IT0 A;  2HQR A;  4U7D A;  2QBY A;  3ZPL A;  1BC7 C;  2VOP A;  1U5T B;  5FD5 A;  5LHH A;  4N9H A;  2GIV A;  3E6B A;  1ZGJ A;  1IRF A;  5E20 A;  3GO5 A;  2HYF A;  3QP5 A;  5H6Q A;  1KQ0 A;  2HZT A;  1QZY A;  4L5I A;  3GEZ A;  4AD9 A;  2P6S A;  2FOK A;  1YO5 C;  3LST A;  1TBX A;  1P4X A;  1XCB A;  2QWW A;  2O03 A;  5H20 A;  2DQL A;  2PMH A;  1YW8 A;  1U3E M;  4M74 A;  5LHG A;  1UCR A;  5ICE A;  2GQQ A;  3L9F A;  1ZG5 A;  3TDZ C;  2A68 F;  4BAY A;  1BI2 A;  1LDK B;  1Z1D A;  2EA2 A;  2OD5 A;  3TO7 A;  2ETH A;  2IA2 A;  2L54 A;  1A04 A;  5DEQ A;  4L9N A;  1GVJ A;  1SMY F;  4UVA A;  2RV8 A;  3HUG A;  3QP6 A;  2H6B A;  3IC7 A;  1YYV A;  2DI3 A;  4I0A A;  1BC8 C;  2G9W A;  3HOT A;  2HWV A;  2DW4 A;  4Z2Y A;  4RGU A;  3C18 A;  3ISP A;  3GWZ A;  3LA2 A;  1W5S A;  3HTS B;  4K2E A;  3FXU A;  3RI4 A;  5CVR A;  2VON A;  3KP7 A;  4EQQ A;  3FXR A;  3O6B B;  3I5U A;  4CZZ A;  3RTR A;  2ZBK A;  4FHT A;  2RKH A;  2KJB A;  3NRV A;  2BBY A;  2CFX A;  3K1M A;  3K2Z A;  2LSO A;  1LJ9 A;  1FP2 A;  5J8F A;  3SXY A;  2NNN A;  2X4H A;  2KRF A;  3WTS C;  3ECO A;  2XAJ A;  1SD7 A;  1JXS A;  1FLI A;  3HSR A;  2EA4 A;  2OU2 A;  3RDI A;  1CF7 B;  2V6C A;  1FNN A;  2HTS A;  2P5V A;  2QUF A;  2QQ9 A;  5TJJ A;  4I98 B;  2GA1 A;  3KE2 A;  2HTJ A;  3VFZ A;  4I0B A;  4RAY A;  4G7Z F;  3MFK A;  3WTY C;  2QVO A;  5K1Y A;  3C3W A;  3TO6 A;  3FM5 A;  3IWF A;  2ELH A;  4MEY F;  1F5T A;  4E70 A;  2P6T A;  3FWE A;  1JHF A;  5FO5 A;  1LVA A;  5HDK A;  4HA8 A;  1U8R A;  3TQN A;  1OKR A;  1LDD A;  2XV4 S;  5ICG A;  4AVP A;  4BXU A;  3RPU A;  3WGG A;  4ESJ A;  1OPC A;  1B9N A;  3U2R A;  3IKV A;  1W4M A;  3F3X A;  4JBA A;  2VE8 A;  3FZV A;  1OYY A;  4ENK A;  4YFX F;  3RPQ A;  1GXP A;  2JTV A;  2ACJ A;  4EJW A;  4ON0 A;  5HLI A;  2IA1 A;  4OIP F;  1B6A A;  1QNT A;  2PJP A;  4HF0 A;  2HOE A;  3BJA A;  4EM0 B;  4U7B A;  4I01 A;  3IRQ A;  2VBZ A;  3JTH A;  1S7O A;  1V3F A;  4JK1 X;  3BJ6 A;  2ZME B;  3DV8 A;  3GZ6 A;  4YFN F;  3HRM A;  5HOO A;  2JRT A;  3FMS A;  2JZY A;  3FF5 A;  1FBU A;  4HX7 A;  4L9V A;  5D5U B;  3BP8 A;  4L5J A;  2OZ6 A;  3L09 A;  4M71 A;  1FSE A;  3VB2 A;  4G6Q A;  5AON A;  1B1B A;  2ADU A;  5CVJ A;  3T0Y A;  4L9T A;  1ONV A;  4Q47 A;  1G3S A;  4A5N A;  1FP1 D;  3BPX A;  3LWF A;  4EV0 A;  2WTE A;  1DDN A;  4Y13 A;  3COA C;  5BOX A;  5DDG A;  2OBP A;  1L0O C;  5DV5 A;  4UV9 A;  4GGG A;  1U78 A;  2FBH A;  3HRT A;  2XKO A;  4RAZ A;  2HEO A;  1B4A A;  4LGW A;  3V7R A;  1Z05 A;  3SFZ A;  2FA5 A;  5CVI A;  4KN4 X;  4A2U A;  1EH8 A;  3MQ0 A;  5KK1 A;  1YTY A;  1XSV A;  4P96 A;  3G3Z A;  4HDV A;  1S6L A;  2FRH A;  4M9X A;  1WQ2 A;  4GXO A;  3TGN A;  3KET A;  1I27 A;  2QM3 A;  1YS6 A;  1R1U A;  2H6C A;  2GXB A;  2A5Y B;  3F23 A;  4MQV A;  3F8F A;  3BPV A;  2FEZ A;  2AS5 F;  1ZRF A;  2B0L A;  3W6K B;  1O57 A;  5ILU A;  1SMT A;  1IAW A;  1MD0 A;  5LEJ A;  2GA2 A;  3D5L A;  2GZW A;  1XCV A;  2CQK A;  2YX7 A;  4IHS A;  2DK5 A;  2QQB A;  1W7P D;  4RGS A;  3ELK A;  2FXA A;  4XSX F;  4A12 A;  4O3M A;  3RJP A;  1F4K A;  4GYG A;  5HS9 A;  1IN5 A;  1S8N A;  1KGS A;  1B9M A;  5LRR A;  2V1D A;  2XIG A;  2FSW A;  1LEA A;  1YG2 A;  3FX3 A;  4QLC U;  2XVC A;  2MD5 A;  1LQ1 A;  4A0X A;  2O6G E;  2W25 A;  5LGU A;  1VTN C;  1XN7 A;  4KUM A;  5FD6 A;  3GUD A;  4RGX A;  1IN7 A;  1Q1H A;  3EDP A;  5L3F A;  2MH2 A;  2M87 A;  2ZFW A;  4EJO A;  3PQJ A;  3M1E A;  2HR3 A;  3K1P A;  1LNW A;  2EV5 A;  1F9N A;  1T38 A;  5BS6 A;  5BPD A;  4Q4Z F;  2NYX A;  2HDC A;  1O7L A;  4CIC A;  5HVQ C;  3WGH A;  2W57 A;  3ZQ7 A;  4G6D A;  1DUX C;  1BBY A;  1ULY A;  4ENJ A;  2HKX A;  4KIC A;  4OIN F;  2IA0 A;  1QO0 D;  1IZ1 A;  3ABU A;  1SFU A;  2H27 A;  5H6R A;  2VC0 A;  4KIB A;  3I71 A;  3F21 A;  4MQ9 F;  2STT A;  5JVT A;  2QQA A;  4EVI A;  1K79 A;  3WTX C;  2DPD A;  2ZXJ A;  1ON1 A;  2YPR A;  3LAJ A;  4G9Y A;  4HQM A;  1Z9C A;  2V9V A;  4WXH A;  5D8K B;  3WOD F;  3LA3 A;  4JQF A;  2GWR A;  5D8L B;  4Q5S F;  2FNP A;  3TOB A;  1D8J A;  1FYM A;  6PAX A;  1WSU A;  3E97 A;  4HW0 A;  2EB7 A;  1PP7 U;  3WE3 A;  5L3C A;  3MZY A;  3V8L A;  2UXN A;  1Y0U A;  1T6S A;  1P2F A;  1HW5 A;  2P5K A;  5D6E A;  1REP C;  4LK0 F;  3SHF A;  5LRS A;  1SD4 A;  4KNY A;  4UXN A;  1TW3 A;  4EMS A;  1FT9 A;  2XAF A;  4AIJ A;  3ZMV A;  5ERI A;  1UHW A;  1BM9 A;  1V4R A;  2K86 A;  3EUH A;  4WXC A;  2VOD A;  4P5O A;  4Q48 A;  1MZB A;  2EFN A;  1MJB A;  2E1C A;  2L4M A;  1OR7 A;  1OYI A;  1YW7 A;  1R5H A;  2HGC A;  1ZHF A;  5E8I A;  1KQ9 A;  1T2K A;  2UZK A;  3SZT A;  2RDP A;  1IN4 A;  4UUV A;  2XUB A;  2PG4 A;  3CO6 C;  1YW9 A;  4F7Z A;  4HF2 A;  2EWN A;  4YFK F;  3GFJ A;  2J5P A;  3IRR A;  2RN7 A;  2A6H F;  2XGX A;  1ZG1 A;  1XD7 A;  5LGT A;  3KLN A;  1BI0 A;  3QOP A;  3R0A A;  1D3Y A;  5L3B A;  2DAO A;  2M1B A;  4U0W A;  2Q8K A;  3GXO A;  3R6S A;  4HLY A;  1ON2 A;  1IXC A;  5ILS A;  3HTU A;  5LEK A;  2M5W A;  2A07 F;  1YLF A;  3B73 A;  3TO9 A;  5EEH A;  2DPU A;  4XBF A;  1AOY A;  4L0Y B;  5HS8 A;  2XAH A;  4BYY A;  4DNC A;  3WTU C;  3I59 B;  2MLK A;  1Z7U A;  1TQM A;  2ZKZ A;  4H0E A;  4CO8 A;  1G4D A;  2PN6 A;  4BHC A;  1O3Q A;  3DFG A;  2DFI A;  3BZ6 A;  4WXD A;  1FBQ A;  4M73 A;  1ZLK A;  4I09 A;  3IWZ A;  3FMQ A;  1BIB A;  3M9A A;  2NS0 A;  3REO A;  3HHH A;  1IXS B;  4N0B A;  2FMY A;  4BQA A;  2PEX A;  1G3Y A;  4G7O F;  3WU1 B;  2V1U A;  2HKO A;  3K0L A;  4HV5 A;  4L9J A;  2OQR A;  4LLG F;  2WWY A;  2UWM A;  3DPT A;  1TW2 A;  1HBX G;  3GYH X;  1UB9 A;  3N97 A;  1O3T A;  2XRO A;  4S05 A;  5DUI A;  2O8X A;  2JPB A;  1HKS A;  4QWQ A;  2P7C B;  2JSC A;  1KU9 A;  3BY6 A;  2LNB A;  2Y75 A;  3KP5 A;  2JT1 A;  1MGT A;  1TQI A;  2VBW A;  4XLP F;  4IHT A;  3R60 A;  1J0R A;  3E5U A;  3ZMD A;  3LA7 A;  4RB0 A;  1TNS A;  1CF7 A;  4KDP A;  2MBF A;  1YQA A;  5A2Q K;  5D5V B;  4EJV A;  3P9K A;  3I59 A;  3IHU A;  3TKY A;  1USS A;  4NHJ A;  4HX8 A;  3RKW A;  2G7U A;  1E17 A;  2ISZ A;  3L2C A;  1KQ8 A;  5DCM A;  5CYV A;  4ENM A;  4KN7 X;  4ESF A;  3J80 Z;  3BDD A;  3PFI A;  3V8K A;  2YR2 A;  1SD5 A;  4AIK A;  3HHG A;  3RYP A;  3U1D A;  4UVB A;  4BH9 A;  2FBI A;  3TOA A;  2E1N A;  3GW2 A;  2A3S A;  1RUO A;  1IXR C;  4XRF A;  1Z91 A;  3G73 A;  3GFI A;  1HKQ A;  3E3V A;  4ZYH A;  2PBI A;  4D0P A;  5TRD A;  3I4P A;  1FY7 A;  4P9F A;  3ZMU A;  3JAM K;  3P7N A;  3CJN A;  1XGN A;  2QYO A;  3F8N A;  3VEP A;  3WTT C;  4I7H A;  3WG9 A;  2COM A;  5D6F A;  3I64 A;  1G6N A;  3BJO A;  2DLL A;  3R61 A;  3E5X A;  1KYW A;  2IVM A;  3F8M A;  4CYD A;  1J9I A;  2YX4 A;  2FML A;  2LF8 A;  1K7A A;  2BV6 A;  3QRF F;  4ESB A;  2D45 A;  3DPL C;  4R79 A;  3IL2 A;  2OQG A;  1S3J A;  4WK8 F;  2OAZ A;  3M7G A;  1IRG A;  5FFX A;  1BI1 A;  3RIR A;  1HSJ A;  2G7H A;  1Z6R A;  1YFH A;  2OA4 A;  4IRG A;  4YII A;  2A61 A;  5F1R A;  1K78 B;  3HYI A;  3HSE A;  3M8E A;  2IJL A;  2Z9O A;  4OMY A;  5A2Q Z;  2YU3 A;  3AAF A;  2RNJ A;  5ICF A;  4KMU X;  2AXL A;  4G94 A;  5LBQ A;  2D2W A;  2XAG A;  3WTV C;  4IRH A;  2QBY B;  4I2O A;  2VXZ A;  2GXG A;  2CSO A;  3CUQ B;  5CJ9 A;  2PI0 A;  1GXQ A;  4LK1 F;  2QEN A;  3CDH A;  2VT3 A;  4GYI A;  3ABT A;  4IJA A;  3H92 A;  4KT5 C;  1P92 A;  4P55 A;  4MEX F;  3ZN1 A;  4OU0 A;  4IXA A;  1EH6 A;  3E6D A;  1R23 A;  2K7L A;  1O3S A;  5L3E A;  5F6F A;  1XMA A;  3JTG A;  1R1T A;  4UNO A;  1HW1 A;  4Y15 A;  3RKX A;  4IVN A;  3S2W A;  5D5W B;  1ZN2 A;  4RGR A;  2O3F A;  4P9U A;  5JFR A;  2VBX A;  1YIO A;  3V7S A;  4O6J A;  5K5R A;  3FMR A;  2F5D A;  3L00 A;  3I58 A;  1FX7 A;  4PGG A;  3ULQ B;  4RS8 A;  2C6Y A;  3BRO A;  2CGP A;  3V7C A;  5BMZ A;  2EFW A;  1RI7 A;  1R7J A;  5AIQ A;  2P8T A;  1FWZ A;  1OYW A;  3ECH A;  4BHP A;  4BNC A;  1O3R A;  2XHK A;  2WV0 A;  3I53 A;  1X3U A;  5KVR A;  1ZG3 A;  3NQO A;  4U0Y A;  2Z33 A;  5HS7 A;  4KA4 A;  3DP7 A;  3ZMT A;  1CGP A;  2O0Y A;  4ZYE A;  2PMU A;  3MEX A;  4M6Y A;  4WCG A;  4HZF A;  4IPA A;  3O3K A;  3W6J B;  2M30 A;  2W85 A;  2F5F A;  3J7A O;  4FT8 A;  4AIH A;  3P9C A;  1C0W A;  3F8C A;  1RZ4 A;  4M9S A;  3GZ5 A;  5LGN A;  1SD6 A;  5CLS A;  5DCF A;  1U6G A;  1LDJ A;  3QPT A;  2R7F A;  3HRU A;  2Q2E A;  1BIA A;  2HS5 A;  2ZNZ A;  2JPC A;  2MA3 A;  4KIG A;  1BJA A;  1SFX A;  2M8E A;  2OZU A;  3VOE A;  1ZH5 A;  2BEO A;  5FFZ A;  4HV6 A;  4LG0 B;  2FNA A;  3K1N A;  1G3T A;  2PLY A;  5LLQ A;  1R5G A;  3TDU C;  2EK5 A;  4HAM A;  5BQT A;  4Y17 A;  3WTZ A;  1ZRE A;  2RVC A;  3KZZ A;  3GFL A;  1R22 A;  2HYG D;  1D5V A;  4A0Z A;  2L01 A;  4NQW A;  3J81 Z;  1FYL A;  1WRJ A;  3ZN0 A;  3EQL F;  1WWX A;  2FQ3 A;  4S04 A;  4ZYG A;  2KIU A;  2KIM A;  3ERE D;  5HDN A;  1R58 A;  3WTW C;  1I1S A;  1R36 A;  1HST A;  2KKO A;  2P4W A;  4GO1 A;  3RYR A;  3CUQ C;  1FYK A;  3C7J A;  1G3W A;  3Q9S A;  4N9I A;  1D8K A;  5E17 F;  4EJT A;  1T98 A;  3QU3 A;  3MZH A;  2R3S A;  1OMI A;  1E2X A;  2QZ8 A;  3KP4 A;  1TNT A;  3BOQ A;  1ZAO A;  1XDU A;  5IT3 A;  4LLN A;  1SFE A;  5D4R A;  3ROU A;  4EM2 A;  4OIQ F;  3PQK A;  3FHZ A;  4M72 A;  1EV7 A;  5ICC A;  2BGC A;  2IPQ X;  4ENN A;  3KLO A;  4XLN F;  1EH7 A;  2ZO4 A;  3MWM A;  5FGM A;  1K6O A;  1T0F A;  4EM1 A;  4LG0 A;  1BOA A;  1QPM A;  3GF2 A;  3E6C C;  4HX4 A;  3T1B A;  1B59 A;  4TV7 A;  1RUN A;  4MHG A;  1J7K A;  3LQR A;  3F72 A;  4R1H A;  5DCM B;  4CXF A;  2BYV E;  2IRF G;  4B09 A;  5HLG A;  3JSP A;  2MLG A;  1F1Z A;  2VE9 A;  4IRI A;  1IW7 F;  4L18 B;  2LDU A;  1H9T A;  1TTY A;  3F6O A;  2DK8 A;  5JHU A;  1MKM A;  3VOD A;  5E1Z B;  1LEB A;  4WF2 A;  1PUE E;  5E18 F;  2DBB A;  3JAM Z;  3HIF A;  4LLL A;  3EYI A;  5E1W A;  1RNL A;  1T39 A;  5EEG A;  1FOK A;  4MNU A;  5DUK A;  3FXQ A;  2FF4 A;  4CDG A;  1MJA A;  1KU3 A;  3E6M A;  3WU0 A;  1UST A;  3LAP A;  5L3D A;  3FM3 A;  2NRA C;  3I0T A;  4LB6 B;  2YSR A;  2BE5 F;  4XSZ F;  4KFC A;  5D4S A;  5K5O A;  2VOO A;  2XAQ A;  2E7W A;  1I1G A;  1XDS A;  3GLX A;  2XKP A;  4MGR A;  3I54 A;  3DQV C;  1HKT A;  4LFU A;  4R8H A;  1SAX A;  3KEO A;  2QLZ A;  2EFQ A;  3CUO A;  1O7F A;  2ZCW A;  1QGP A;  2F5E A;  1ODD A;  2X0L A;  3D0S A;  2CYY A;  2FE3 A;  3T8T A;  4PZJ A;  3F8B A;  3H3Z A;  2Z99 A;  1IUY A;  1YS7 A;  4OOI A;  4O5V A;  1FBS A;  4GCV A;  4M9Z A;  2Y48 A;  5F64 A;  2DO7 A;  3CLO A;  2FBK A;  2H09 A;  3CUQ A;  2XRN A;  4CGZ A;  2K4J A;  1J5Y A;  2DT5 A;  1IN6 A;  2LF7 A;  2Z5U A;  4LMY A;  2NNY A;  1KYZ A;  4HLX A;  5AIP A;  1FSH A;  2F2E A;  1H9G A;  2WC2 A;  3HRS A;  2L02 A;  2DQR A;  5JI6 A;  3CO7 C;  4PGH A;  3C1D A;  1XMK A;  4U0V A;  4EGY A;  1ZRC A;  4KIF A;  1ZAR A;  2Q0O A;  3P9I A;  4HBL A;  3J81 K;  1KA8 A;  4PDK A;  2EV0 A;  1L3L A;  3SQN A;  4EGZ A;  1W7P A;  4G7H F;  3M8F A;  3QU6 A;  4LD5 A;  2HQN A;  3GVA A;  3F6V A;  2RC4 A;  5DD8 A;  1TLH B;  1P4W A;  3KP6 A;  1LB2 A;  5FLX Z;  4ZYD A;  3B02 A;  3LFK A;  1WKM A;  5FLX K;  4ASN A;  2IW5 A;  5FB2 A;  1W5T A;  4HOB A;  3IKT A;  4KMF A;  3DEU A;  3KFW X;  5DD4 A;  1J75 A;  4A6D A;  4KYW A;  5CVV A;  2ZJ2 A;  2ZME A;  5J8C A;  4BHB A;  2TDX A;  3ZP5 A;  3V8J A;  4RB2 C;  1I6X A;  3HOS A;  2V1X A;  1R00 A;  2UXX A;  1ZRD A;  2P5L C;  4A6E A;  4EJU A;  3R0J A;  4HQE A;  5E8G A;  2NAZ A;  3SZP A;  1HXD A;  3KZY A;  4OIO F;  3MAJ A;  2Z3Y A;  2VN2 A;  4PCQ A;  1HW2 A;  3DF8 A;  2J5O A;  2ESN A;  3NEU A;  2ISY A;  2CG4 A;  2E7X A;  1DPU A;  4AWX B;  4HYE A;  1FC3 A;  3GX4 X;  4ZZD A;  2PFB A;  3K69 A;  2CWE A;  4IF4 A;  2GAU A;  1U5T C;  5E1X A;  4ETS A;  5BPI A;  1Z6T A;  1NHA A;  3BWG A;  1XB4 A;  1MJ9 A;  3H3U A;  5IT9 K;  2ZNY A;  2K02 A;  1XGO A;  3CTA A;  1QBJ A;  2K4B A;  4CHU A;  2A69 F;  3QAH A;  4HF1 A;  1PP8 F;  5JR3 A;  3KCC A;  2R7D A;  1S29 A;  4WX9 A;  3MCZ A;  1PDN C;  3T8R A;  2DTR A;  2P7V B;  1P4A A;  3J80 K;  1KU2 A;  1FZP B;  1IN8 A;  5L3G A;  1ZYR F;  4DQ2 A;  1R1V A;  4A5M A;  4UVC A;  3F22 A;  4LJZ F;  2CW0 F;  1S7A A;  2D1V A;  3E5Q A;  3N4M A;  2ESH A;  4RB3 C;  3ML6 A;  1I5Z A;  3WGI A;  3O2P E;  2DU9 A;  3ZMS A;  3ZMZ A;  2W84 A;  4YIF A;  4WWC A;  4ZH4 F;  1UHM A;  2VC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...