2HWVA

Crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
SHMTIGDLTIHPDAYMVSKRGEKIELTHREFELLYYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPTYLVTRRGVGYYLRNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding response regulator VicR
publication title Structure of the response regulator VicR DNA-binding domain.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hwvA00
4L9VA 4JQFA 1OYIA 4R79A 2Z3YA 1W4MA 5CLSA 2CFXA 3GO5A 1I5ZA 1FPQA 1B59A 1ZRFA 3WTSC 3HHGA 1TTYA 1SD4A 2AXLA 1KU9A 1K78A 3NEUA 5JI6A 2HYGD 2OD5A 2P6TA 2D1VA 2A6EF 1Q1HA 2M45A 1TNSA 5JFRA 2FOKA 1QZYA 2CO5A 2LDUA 4N9HA 1EH6A 5CVUA 1J9IA 1ZRDA 1P2FA 2M30A 2A6HF 3K0LA 5HOOA 2IT0A 5ICFA 2PBIA 1CF7B 2GQQA 3CLOA 3IHUA 4NQWA 1P4AA 2BV6A 4MQ9F 3QP5A 3BJAA 3JTGA 4LK1F 3ERED 2XUBA 4U7BA 1J2XA 3EYYA 4CXFA 2OQRA 2ZJ2A 2QBYA 3IKVA 4MTEA 4P96A 4M72A 1W5SA 2DQRA 5L3EA 1O3SA 3L7WA 5FFXA 2WWYA 1YTYA 3ZN1A 3K1MA 4MGRA 3QP6A 3K9TA 1G3TA 4PGHA 4WWCA 4NHJA 3N97A 3C7JA 2EV6A 1FP2A 2PJPA 1BBYA 1MDMB 2UXXA 2VOPA 3WGIA 4RGUA 4O5VA 4G94A 4KMFA 4AWXB 4LLGF 5HLGA 2XROA 3H3ZA 5LLQA 4CO8A 2A3SA 3I4PA 2NRAC 4GXOA 5HS9A 2FSWA 3ISPA 3GVAA 2FNAA 1WKMA 3Q5FA 3CUQB 4ZZDA 1XMAA 1ZGJA 3VODA 2DFIA 3WGHA 5CVIA 1MGTA 5D5WB 2XKOA 4IHSA 2QQAA 2R7DA 4KIFA 1GXQA 2KJCA 5E1XA 3DKWA 2E7WA 2OAZA 3RKYA 5J8CA 2K4JA 4HF2A 1LDJA 1S29A 1TBXA 3HIFA 1IW7F 1B6AA 1H9GA 4Q47A 4XRFA 1DPRA 3KETA 1D5VA 1FBUA 1ODDA 2FBHA 4IRGA 3L00A 3MZHA 1LVAA 5HS8A 4ENJA 2HR3A 1BC7C 3IL2A 3JTHA 3KLNA 5JVTA 1FT9A 1P92A 3JAMK 4XLPF 1XDSA 2ZFWA 2JSCA 3GFLA 3TO9A 4HQEA 5DDGA 1ON2A 2XKPA 3HTUA 4ESJA 2FXAA 2ZNYA 2ZNZA 4CHUA 5E18F 4MHGA 4HF0A 4XLNF 1ZG1A 1R7JA 2H6CA 3KZYA 3F23A 1IXRC 3TO6A 1RNLA 2K02A 3RPQA 3WTYC 4BH9A 1FSHA 2MLGA 2XAHA 3IWZA 1KYZA 5L3FA 1YO5C 2EK5A 1ZGAA 1ZHFA 3MEXA 1ZN2A 4KICA 2J5PA 3EQLF 1YYVA 1P4XA 4CGZA 2E7XA 2O61A 3QAHA 3E6CC 2PMUA 2CW0F 1R22A 2H6BA 1HW5A 1T39A 5TRDA 3W6JB 1RUNA 4AD9A 5ILUA 3MQ0A 4I0BA 1CF7A 2ZBKA 4HOBA 1UHMA 1EH8A 3F6VA 1TNTA 3BJOA 3VB2A 1JXSA 1O3TA 1I27A 1LB2A 2VT3A 3F21A 4Q5SF 3RIRA 2XAQA 2PFBA 5FFZA 3DP7A 1IN7A 1SFEA 4MTDA 2ELHA 3WU0A 1E2XA 4G8XA 1MKMA 1YS7A 2YX4A 4WCGA 1SD5A 2V1XA 1BI3A 2RC4A 1HKSA 1G4DA 2DTRA 2OU2A 2LF8A 2ISZA 1R58A 2PMHA 3DQVC 2JZYA 4HX7A 1YS6A 3FHZA 4HZFA 3KEOA 4BHCA 4RS8A 4FT8A 4BNCA 4L9JA 4BAYA 2GXBA 1Z6RA 4YIFA 2NYXA 4UVBA 3EUHA 2A61A 3HOSA 3FM3A 2G7HA 1HW1A 2IA0A 3CUQA 1P6RA 4HQMA 4L9TA 1R36A 3T1BA 3HRSA 5HVQC 4PDKA 5AIQA 4RB3C 1WSUA 2NNNA 3KP6A 4H0EA 4N9IA 1WWXA 4RGRA 3S2WA 4G7OF 2DBBA 2XHKA 2GWRA 3BPVA 4HV6A 2P4WA 2XGXA 2LF7A 5BS6A 4Y17A 2Q8KA 1R5HA 2G9WA 1BM9A 1P4WA 1BJAA 1XCBA 3FMRA 4ZYDA 4GYGA 4HLYA 3FF5A 2RV8A 4WXHA 1MJAA 3L9FA 3M8FA 1BC8C 1YQAA 4EGYA 4I09A 5FB2A 4P5OA 3BJ6A 1TQPA 4I02A 3J81K 3IC7A 5F1RA 1V4RA 1PUEE 1K79A 3FMQA 5HLHA 1HXDA 2XVCA 3MAJA 5CVRA 1KA8A 3BZ6A 2Z33A 1PDNC 3RTRA 2K86A 3F8FA 2KRFA 3ZP5A 5HDGA 2XV4S 2ISYA 5D4SA 3QPTA 3CO6C 1SMTA 5CVVA 1KU3A 5LGUA 3E6MA 5FD5A 3R6SA 3KZZA 1QQIA 5LHIA 4G9YA 2W24A 1YW9A 1YLFA 3E6DA 4UVCA 1KYWA 2DO7A 4ESBA 2ZCWA 2PN6A 4ENKA 1R1UA 4RB1A 2L4MA 1LQ1A 3CUQC 4EGZA 2EFNA 3ABTA 4S05A 3TDUC 2UZKA 4LLNA 4U0WA 2LSOA 1T0FA 3IRRA 2F5FA 3E5QA 4Q4ZF 5ICCA 2YSRA 2ADUA 1JHFA 1JHHA 5BOXA 1IN4A 1FWZA 3GFMA 4GGGA 1XD7A 1FBQA 3KP5A 1ULYA 2EWNA 5IT3A 2P5KA 3CDHA 4I01A 3V7RA 4A0XA 5LGTA 2ZKZA 3EDPA 4U88A 4CICA 2ZXJA 4G6QA 1Z7UA 5HDKA 3QOPA 2Q2EA 1IN8A 1USTA 3DF8A 1FC3A 2QUFA 1DDNA 2FBKA 2RVCA 1FSEA 5HLIA 5LRSA 2KIMA 1K6OA 3P9KA 3GW2A 1F4KA 4LFUA 2HOEA 4P9FA 5E8GA 3F6OA 2XAGA 3F8MA 2FNPA 3GEZA 2H94A 2FA5A 5LEJA 3R60A 2WV0A 2UXNA 5DYMA 1S3JA 3GF2A 3J81Z 2DAOA 2QQBA 1DUXC 4PCQA 2FEZA 4UVAA 3SFZA 2O3FA 4L5JA 3E97A 2LKPA 3BWGA 1FY7A 3DFGA 4ZH4F 1IXSB 1FP1D 1E17A 2Z9OA 3I58A 4L18B 5E17F 2CSOA 1O7LA 5KVRA 3I53A 1R00A 3WTZA 1ZLKA 3IRQA 1HQCA 2JPCA 3O6BB 5J6XA 1LNWA 3H92A 2PEXA 2MH2A 4LLLA 4UUVA 3V7CA 1SMYF 2V1UA 4RB0A 3TDZC 1F1ZA 2Q0OA 4Y13A 4I2OA 2P8TA 5D5UB 3E6BA 2O6GE 4K2EA 3FXQA 2HWVA 1S6LA 3GZ5A 3G3ZA 2QENA 4EQQA 1MZBA 3SXYA 4ETSA 5ICEA 1KU7A 2EFOA 2VC1A 1KGSA 1ZAOA 4IPAA 1XCVA 4A6DA 2VBZA 2PI0A 1ZRCA 5A2QK 3M8EA 1UHWA 3KLOA 5H6QA 1HW2A 4G7HF 3JSOA 2X0LA 4IVNA 4WF2A 1WI9A 1D3YA 2JPBA 2Z99A 4KDPA 3CUOA 4LMYA 2DK8A 3GWZA 1QNTA 1D8KA 4FHTA 2CQKA 5K5RA 1UCRA 3CO7C 1S8NA 2DW4A 5IT9K 4HW0A 3T0YA 2NAZA 3J7AO 2ZMEA 4YIIA 4ASNA 4D0PA 3LA2A 2Y48A 1T6SA 4RGXA 3HOTA 1L3LA 2IRFG 1JE8A 5CVJA 3V8LA 1KU2A 4S04A 4HBLA 4EM2A 3WGGA 5E1ZB 2RN7A 3H3UA 2Y75A 1FBSA 1OYWA 1S7OA 5D6FA 3ZN0A 3CTAA 4AVPA 1KQ0A 3F3XA 3GLXA 2OA4A 3LWFA 4B8XA 4KUMA 1RIOH 2DPDA 3ECOA 2NS0A 3FXUA 5L3DA 5ILVA 1ZARA 4M9ZA 6PAXA 2QYOA 2XAFA 3G73A 4AIHA 3TOAA 1FOKA 3SQNA 1ZYRF 3L09A 3ELKA 2IVMA 4AIJA 4MQVA 2WTEA 5JHUA 2ACJA 2M87A 1IRFA 3K1PA 4L0YB 3I59B 3F8NA 1XDUA 4HX8A 2HQNA 4A2UA 2JTVA 1R1VA 2IA1A 3WODF 3D0SA 3PQKA 3LSTA 3GX4X 2O03A 4HLXA 2QZ8A 4U0VA 1Z05A 4I98B 2KIFA 1MJBA 3WU1B 1FLIA 1GXPA 2VBYA 3I64A 3U1DA 5A2QZ 2VE8A 2GIVA 4KT5C 2FQ3A 5AONA 4M73A 2VC0A 3PFIA 4BXUA 5D5VB 1KQ8A 1EV7A 1ZG3A 3LQRA 4GYIA 1V3FA 3ABUA 2XASA 3P9CA 1SD6A 2W85A 1LDDA 2HKXA 3I5UA 1U2WA 2M8EA 5CJ9A 4IXAA 1G3WA 3ULQB 5IT9Z 2O8XA 1L0OC 4HA8A 4IF4A 1WRJA 3LFKA 5ERIA 4EVIA 2STTA 1SD7A 2K7LA 3JSPA 5L3BA 3BP8A 1GHCA 2PLYA 3AAFA 3K2ZA 3PQJA 2XIGA 4EJWA 4HX4A 4EMSA 2HTJA 3WTWC 1HSTA 5ILSA 4EM0B 4ZYHA 2F2EA 2R7FA 1R5GA 2KIUA 1CGPA 1ON1A 2E1NA 2FF4A 3FX3A 4PZJA 3EETA 2D2WA 1O3QA 3KCCA 2NNYA 3HRTA 4Z2YA 1H9TA 4OINF 1X3UA 2DLLA 1IUYA 4I0AA 1W5TA 1I1GA 4G6DA 4F7ZA 2R3SA 5LEKA 1TW3A 3DPLC 2F5EA 2MBFA 2EJRA 5DCMB 3TO7A 5LBQA 3E5XA 2P7CB 4BHBA 3NQOA 2FU4A 2FMYA 4RGSA 3BROA 4E70A 5AIPA 1MD0A 3IWFA 4UXNA 5EEGA 1IN5A 3LAPA 2E1CA 4MEYF 4M71A 1FX7A 2MC3A 2K27A 3KFWX 1DP7P 1QO0D 3ZMSA 4EJTA 3HHHA 2VN2A 3Q9VA 1K7AA 2VE9A 3MCZA 3V7SA 3GUDA 3V4GA 2HTSA 3M7GA 4L9NA 2O0YA 3N4MA 4JK1X 1LJ9A 2JT1A 2X4HA 1BIAA 2YX7A 2Z5UA 2CWEA 1IRGA 3BPXA 3I59A 1IAWA 3L2CA 3C3WA 2OZ6A 4LK0F 4WK8F 2A69F 3BDDA 2ZMEB 5BPIA 1XSDA 1FYMA 3T5XA 5F64A 3RKWA 4MNUA 1G6NA 1J0RA 5DUIA 4ZYGA 2EB7A 1H0MA 4IHTA 3TKYA 2PG4A 4UV9A 5LHGA 2H09A 3I54A 4KNYA 3F8BA 3M9AA 4GCVA 4KMUX 1YW8A 2L02A 3RYPA 4UNOA 4ON0A 3I0TA 5J8FA 5E20A 1F5TA 2IP2A 3ZMTA 1AWCA 3U9GA 1T98A 1XMKA 2KKOA 4RAYA 1FNNA 4YFNF 1XGMA 3ROUA 3FMSA 3T8TA 1YW7A 4L5IA 1HKTA 1C0WA 3E5UA 4BQAA 5D5XB 4YG2F 2FMLA 4EJUA 3T8RA 1QBJA 1ZREA 3RI4A 3SHFA 1U5TB 2QWWA 1O57A 1AOYA 4HYEA 1TW2A 3ZMUA 2CGPA 2EFQA 2YR2A 4KIGA 1MJ9A 2L4AA 2HQRA 2DI3A 5CYVA 2D1HA 2EA4A 5F6FA 1IF1A 3KP7A 3GYHX 2HEOA 2HGCA 4M74A 2ESNA 4L0ZB 2HKOA 4LG0B 1B4AA 4FX4A 2P6SA 2FRHA 2OQGA 3B02A 5BPDA 2HZTA 3D5LA 4MEXF 2VBXA 3TOBA 2M1BA 3F22A 5DV5A 3E3VA 2J5OA 4TV7A 1Z91A 4CYDA 5DD4A 2ESHA 4I7HA 1QPMA 2DU9A 5D4RA 3R61A 2CYYA 3CJNA 5L3GA 1JGSA 1U3EM 1J75A 4N0BA 5DCMA 4RB2C 3ZQ7A 2EV5A 5HS7A 1ZH5A 1XGOA 4DNCA 1FYKA 3C18A 3KP3A 3VOEA 4Q48A 4XBFA 2VBWA 2H27A 2JRTA 5FLXK 4RAZA 4KA4A 5LRRA 2KJBA 1UFMA 3KEQA 3KE2A 3QU6A 3LA7A 3JW4A 3FXRA 4PGGA 2V79A 2XAJA 2F5CA 1I6XA 3HSRA 3WTXC 2DT5A 1D8JA 5TJJA 2RNJA 2GAUA 5K5QA 4UV8A 3BOQA 4BHPA 4M9XA 5ED4A 3SZTA 4WXCA 1GVJA 2RQPA 1QGPA 1LDKB 2V1DA 3FM5A 4P9UA 3DPTA 2GXGA 2GA2A 5FGMA 1IZ1A 1KQ9A 2MA3A 2A68F 3MWMA 3V8JA 1BIBA 1Y0UA 2A07F 4M6XA 2BGCA 1OPCA 1U8RA 4IRHA 2K4BA 2QLZA 3K1NA 2HS5A 1Z1DA 2BE5F 4HF1A 4EJOA 4O3MA 1VTNC 1W7PD 2XRNA 1XGNA 3WE2A 5BQTA 1Z6TA 3LA3A 2CG4A 5HDNA 3VEPA 1XB4A 3ZMDA 1XSXA 4KIBA 4UHTA 3HYIA 4G7ZF 2YU3A 3GZ6A 1J5YA 3FZVA 4CDGA 5EEHA 3OOPA 4IJAA 3P9IA 1YG2A 3WTVC 3WG9A 4KYWA 1YFHA 3R0AA 2HDCA 3QRFF 1PP8F 1G3YA 1PP7U 4B09A 2MD5A 1J7KA 4OOIA 3M1EA 4O6JA 4A0YA 1RI7A 5H6RA 5H20A 2G7UA 4ESFA 2RDPA 1ZG5A 3IKTA 3RDIA 3HRMA 1S7AA 1B1BA 1U5TA 1FYLA 2EA2A 3LQQA 4ZZLA 3GFJA 2AS5F 2VONA 2F5DA 3KP4A 1J59A 4YFKF 1R1TA 4OIRF 3F8CA 5D6EA 1LEAA 2QVOA 2P5VA 4AIKA 3MZYA 2BEOA 5FLXZ 1OYYA 2ZO4A 3F72A 3OV8A 4A5MA 2IW5A 4OMYA 1XSVA 2V6CA 3ZMZA 2HFHA 1O3RA 2W84A 3V8KA 4LG0A 1B9MA 1WQ2A 2W57A 2Y0MA 3RYRA 1RUOA 2HYFA 4LB6B 3J80K 2FE3A 2OBPA 3RJPA 4XSZF 1U6GA 5K5OA 1Z9CA 2FBIA 1EH7A 4IRIA 1RZ4A 4WXDA 4EM1A 4M9SA 5E8IA 2GZWA 4GO1A 4YFXF 2C6YA 4P55A 2B0LA 1XN7A 2UWMA 2DQLA 3HUGA 3C1DA 1DPUA 4OMZA 2P5LC 4OIOF 1W7PB 2WC2A 3LAJA 1T2KA 3R0JA 3O3KA 1SFXA 4R1HA 3HSEA 2RGVA 2BBYA 4KN7X 1ZLJA 2QM3A 1OMIA 2IA2A 1LEBA 2MLKA 4A12A 4XSXF 1TLHB 5ICGA 1B9NA 3QPHA 4CZZA 2A5YB 1IN6A 4HAMA 4ZYEA 1U5TC 2RKHA 1K78B 2COMA 1MDMA 1REPC 2IPQX 2TDXA 2EV0A 5LGNA 5BMZA 2LNBA 1HBXG 3ML6A 3QU3A 1ONVA 4JBAA 3HSFA 3DV8A 4KN4X 3KP2A 2L54A 1BN5A 2EFPA 4OU0A 1T38A 3WTUC 2VT2A 3O2PE 3JAMZ 5L3CA 4LB5A 3EYIA 2L3DA 2VXZA 5DCFA 3W6KB 2DPUA 2P7VB 1TQMA 1F9NA 3GFIA 3TQNA 4M6YA 4ENMA 3GXOA 3SZPA 1A04A 1O7FA 4LGWA 5DD8A 4KFCA 3VFZA 3K69A 3NRVA 3HTSB 2OZUA 4U0YA 1BI2A 2QBYB 2V9VA 3B73A 3BY6A 2L01A 1NHAA 5FO5A 5FD6A 4ENNA 3J80Z 2W25A 4HDUA 3HRUA 3WTTC 1U78A 2YPRA 4HV5A 5LHHA 1SAXA 2GA1A 4Y15A 2QQ9A 5DUKA 4FX0A 1XGSA 4A5NA 3DXJF 2VOOA 1SFUA 5D8LB 1USSA 1OR7A 1R23A 1QZZA 2IJLA 5KK1A 2D45A 2MH9A 1BOAA 1YIOA 1HKQA 3FWEA 4OIQF 5K1YA 3RPUA 3I71A 4EJVA 3Q9SA 5JR3A 4WX9A 2EFWA 3P7NA 4QWQA 5D8KB 4LJZF 4OIPF 2M5WA 1FZPB 3REOA 4EV0A 2VODA 2ETHA 3RKXA 2BYVE 4NB5A 3ZPLA 3U2RA 5DEQA 3MFKA 4A6EA 1I1SA 3R4KA 4A0ZA 1BI1A 3ZMVA 1UB9A 4DQ2A 4U7DA 3COAC 1BI0A 2DK5A 5E1WA 1STZA 1TQIA 3DEUA 1G3SA 1OKRA 3TGNA 1HSJA 3WE3A 4HDVA 4LD5A 4BYYA 1W7PA 1IXCA 4QLCU 2STWA 2PQ8A 4R8HA 3ECHA
chains in the Genus database with same CATH superfamily
1SEUA 4L9VA 4JQFA 1VQ6I 5EDNA 1OYIA 4XN3A 4R79A 2Z3YA 3L2WA 1W4MA 4XORA 2L5QA 2WADA 2OC6A 5CLSA 5J4YA 1JJ6C 5FKOA 2CFXA 4HSRA 1X3ZB 3VYTB 4AVZA 3GO5A 1I5ZA 1YIJI 1FPQA 2ZFUA 2F4IA 3G2BA 2LVSA 1B59A 2R7ZJ 1ZRFA 3HBLA 2NS8A 3WTSC 3WG7H 2H8RA 3HHGA 3BR0A 3OYJA 1ZGWA 1IG7A 2VLAA 1OR7C 1TTYA 1SD4A 3M3YJ 2AXLA 1KU9A 2IGKA 3HGYA 3CMMA 1K78A 2R7UA 1LFBA 1XS9A 1Y1WJ 1FTZA 2MYSA 1IDZA 3HZJA 3NEUA 2LH9A 5FLVA 5JI6A 1IGNA 2HYGD 1TWCJ 2OD5A 2P6TA 2MFZA 2PX9A 5IP9J 3A01A 3KYDB 2D1VA 3PIPF 1VFCA 2A6EF 1Q1HA 2M45A 3DEWA 1TNSA 5EZGA 3S15J 5JFRA 1U9NA 2FOKA 3GTJJ 1QZYA 2CO5A 2D5VA 5GADJ 4BDZA 2LDUA 4GRIA 4N9HA 3H5NA 1BJZA 1G59A 3NARA 1EH6A 5CVUA 1J9IA 1ZRDA 1MH3A 4CH7A 1P2FA 2M30A 3OL3A 4C2UA 2A6HF 2GIZA 3QPSA 3LSRA 5DTDA 1IC8A 2LREA 3K0LA 4NBQA 4Y3OA 2CQXA 5HOOA 2X6XA 2VQLA 2JA5J 3CF5F 2IT0A 4EATA 3HG9A 4PJ0C 4V2GA 2PBIA 5ICFA 1CF7B 1BW5A 2R7XA 3ZRGA 3PSFA 3HUGB 2GQQA 3CLOA 4BJTA 3IHUA 4NQWA 4J00A 1WJCA 1P4AA 1EJ9A 3L2VA 3OYDA 2BV6A 4MQ9F 3QP5A 1QHGA 3BJAA 3JTGA 4LK1F 2IS4A 3B6CA 3ERED 3CC4I 5KNLA 4BEHA 2JJ7A 2XUBA 4QPQA 4U7BA 4RA2A 1WI3A 5EEAA 1J2XA 2HOTA 1OCZH 2VQHA 3K4MA 4CCKA 3S1QJ 3EYYA 2DMPA 3OOUA 4PFOA 4CXFA 3WU2C 2OQRA 1K6YA 2ZJ2A 2BW3B 2QBYA 3IKVA 4MTEA 4P96A 4M72A 2KDZA 1W5SA 2DQRA 5L3EA 1O3SA 4IHYA 3L7WA 5FFXA 1A5JA 4CCNA 2WWYA 1YTYA 3MVPA 2X1CA 3ZN1A 3K1MA 4MGRA 3QP6A 3K9TA 1G3TA 1NG7A 4PGHA 2L9NA 3HPHA 4FE7A 5KAIC 4WWCA 2CMPA 2VL8A 3N97A 4NHJA 3C7JA 2EV6A 2HOSA 1FP2A 5F0HA 3SJMA 2PJPA 1BBYA 1MDMB 4B4CA 1NH3A 2UXXA 2VOPA 3WGIA 1ENHA 4XLHA 1VQMI 4RGUA 4O5VA 2VQCA 2ECCA 2VASA 4G94A 4KMFA 3OSGA 4AWXB 4LLGF 5HLGA 3H9JA 2KISA 2XROA 4BY7J 5B66C 3H3ZA 5LLQA 2XB5A 2XSDC 4CO8A 5FKMA 2DA4A 2A3SA 4Y4RA 2GOXB 4A3LJ 3I4PA 2DFFA 2XC7A 4E7IA 1K83J 3QYFA 2QF7A 2NRAC 1DU6A 2R5YA 2KMUA 4GXOA 5HS9A 2FSWA 3ISPA 4E7SA 1MMGA 3GVAA 2FNAA 4IO9F 5J1YA 1AA7A 1D0XA 1WKMA 3W2AA 1TWFJ 1MBHA 3Q5FA 1GDTA 2ID3A 3CUQB 3L2QA 1H8AC 4ZZDA 1XMAA 4BACA 5F08A 1UAAA 1ZGJA 3VODA 2DFIA 2G0EA 2WBMA 1HC8A 3WGHA 5HLTA 5CVIA 1MGTA 5F0FA 1OQYA 3RSNA 3CF2A 5D5WB 1X2NA 2XKOA 4IHSA 2QQAA 2R7DA 4BXXJ 4KIFA 1GXQA 2KJCA 2CV1A 5E1XA 4GDFA 3DKWA 3OYFA 2E7WA 2EZKA 1K4TA 4GFBA 2OAZA 2KRHA 1MW7A 2X9DA 3RKYA 3PO2J 5J8CA 4RM2A 2K4JA 4HF2A 1LDJA 1S29A 3CP8A 1TBXA 3HIFA 1IW7F 4M3EA 1JKPC 5IYDJ 1B6AA 1H9GA 2L7KA 4Q47A 2E1MC 3FDYA 4XRFA 2FOWA 2X1DA 1B8IB 4M3BA 3L2UA 1DPRA 1X1DA 2DYSH 3KETA 1D5VA 1FBUA 1ODDA 4XKVA 2BXYA 2FBHA 2PJRB 2AQEA 4IRGA 2F48A 1YRNB 3L00A 3MZHA 3BR1A 1LVAA 2COBA 3HPGA 1YJ9I 5HS8A 1KONA 4ENJA 3BTIA 1YX3A 4RLFA 1VQPI 2HR3A 3OYEA 1BC7C 3IL2A 1BR4A 2OTLI 3JTHA 3JRHA 3J7ZI 3L2RA 3KLNA 5JVTA 1V5GA 1PYVA 1FT9A 1P92A 1VQLI 3JAMK 4XLPF 1XDSA 2TRTA 1ETOA 2I5UA 2ZFWA 4FE4A 2JSCA 4HNUA 1ZKGA 2AO9A 2JWTA 3GFLA 2XPWA 4YEJA 3TO9A 3WHCA 4HQEA 5DDGA 1ON2A 2XKPA 2ZXHA 3KYLA 4CYCB 3HTUA 4ESJA 2FXAA 3K4KA 1JUMA 1Y56A 4C30A 5M5WJ 4MO7A 2ZNYA 2ZNZA 3PL8A 1QZEA 4CHUA 5J4VA 2DA5A 4DGWB 2K3PA 2EIKH 4MHGA 5E18F 1D5YA 4HF0A 4XLNF 1ZG1A 1Z0XA 1R7JA 2H6CA 3ESWB 3KZYA 3F23A 3QPLA 4MLOA 3K2AA 1R6RA 1IXRC 3TO6A 2R7SA 1YX5A 1RNLA 2K02A 3RPQA 1OCTC 5EF6A 3WTYC 2VIXA 4BH9A 1R9TJ 2R0QC 2CUEA 1OISA 1FSHA 2MLGA 2XAHA 3IWZA 1KYZA 5L3FA 1YO5C 4OAZA 2EK5A 1ZGAA 3AG3H 1ZHFA 2YUSA 4B3AA 1W36C 3MEXA 4KJZA 5J1UA 1UG2A 3CJTB 1ZN2A 4KICA 3DU6A 2J5PA 1T33A 3E0JB 5GTHC 3EQLF 5GAEJ 2DOFA 3IV5A 2EZIA 5CPRB 1YYVA 1SVLA 1P4XA 5B3SH 3RZOJ 4KISA 4CGZA 4W97A 2E7XA 3CD6I 2O61A 1RESA 3QAHA 3LSIA 3KYCB 2PMUA 3E6CC 1YJWI 2CW0F 1R22A 4BXFA 2H6BA 5EZHA 1HW5A 1T39A 5TRDA 3W6JB 1RUNA 4AD9A 5ILUA 3MQ0A 4I0BA 1CF7A 3ASNH 2ZBKA 5IYBJ 5LD2C 4HOBA 4ZDPA 3QODA 3HDDA 1UHMA 1UJ8A 1EH8A 4UUTA 3F6VA 2DOEA 2CQQA 1M1EB 5J40A 1TNTA 2XPUA 3BJOA 3VB2A 5K7FA 3ZQQA 1X1AA 5TGTA 1JXSA 3ZQHA 3CCLI 1O3TA 4M3FA 2VKVA 4CA0A 1I27A 5C4JJ 1LB2A 2VT3A 3F21A 4Q5SF 3BR6A 2XAQA 3RIRA 2PFBA 4UB8C 3DP7A 5FFZA 2Q2EB 2M4GA 2X6OA 3PNYA 1IN7A 1SFEA 4MTDA 2ELHA 3WU0A 2XRLA 1LPQA 3H3VK 2JQ7A 1E2XA 2L9RA 4G8XA 1MKMA 1YS7A 1SAUA 2YX4A 4WCGA 2BW3A 1SD5A 2V1XA 1BI3A 5M5YJ 2RC4A 1JUPA 1HKSA 3GLLA 2YS9A 2QQ8A 2EPFA 1G4DA 2DTRA 3G1LA 4M3DA 2OU2A 2M2EA 3M07A 3ABLH 3OYHA 2LF8A 2ISZA 1R58A 2PMHA 2XF6A 2FJ1A 3DQVC 3S1RJ 2JZYA 1W5CC 1WJAA 3OWTA 2UUZA 4HX7A 1YS6A 3FHZA 4HZFA 3KEOA 3ZQGA 4N4NB 4BHCA 4NC8A 5GP9A 5FRMA 2ELKA 4RS8A 2EINH 1UG0A 2VXDA 4FT8A 3FIWA 4BNCA 4L9JA 4BAYA 2VKDA 3JRCA 3G1MA 2GXBA 1Z6RA 4YIFA 2EILH 2NYXA 1N75A 4UVBA 3OMYA 3D5RC 3EUAA 4ZTJA 2QCOA 3EUHA 1Y6IA 2A61A 3HOSA 3FM3A 1K61A 2G7HA 5FKKA 1WJDA 3S14J 2GM4A 1HW1A 1MSFC 2IA0A 3I4MJ 3TP3A 1ZTRA 3CUQA 1P6RA 5J1RA 2AXTC 3OIQA 4HQMA 4L9TA 1R36A 1OJLA 3T1BA 3HRSA 5HVQC 2CW7A 4PDKA 5JLXA 2XPVA 5AIQA 4RB3C 5M3MJ 1WSUA 2GOMA 2NNNA 1E3OC 3KP6A 3VYSB 4DYRA 4H0EA 1RC9A 4N9IA 1WWXA 4RGRA 3S2WA 4G7OF 2DBBA 2XHKA 2GWRA 3BPVA 4HV6A 4NNJA 2HDDA 2JVHA 3O8HA 2P4WA 5FJ8J 3AFHA 4BBRJ 2DDBA 2XGXA 2LF7A 5BS6A 1DGWY 5E3MA 2OCCH 3QYBA 4Y17A 2Q8KA 1HF0A 1R5HA 2G9WA 1BM9A 1P4WA 4XLFA 1BJAA 1XCBA 1WGXA 3FMRA 1DU0A 4ZTFA 4ZYDA 4IZZA 1R4NB 4GYGA 4HLYA 1B8IA 5GPAA 2W48A 2GBYA 3FF5A 1FIAA 2RV8A 4WXHA 1MJAA 3L9FA 3M8FA 1BC8C 1YQAA 2PJRA 4UB6C 2BY0A 3K4NA 4EGYA 3LSKA 1EA3A 4I09A 5FB2A 4P5OA 3BJ6A 1YRNA 1TQPA 3GTLJ 4I02A 1WZ2A 3J81K 4XQFA 3FK6A 3IC7A 2CU7A 1OCPA 5F1RA 3OS0A 1V4RA 1PUEE 1K79A 4PJLA 3K4JA 3FMQA 5HLHA 1TT5B 1X1CA 1MIJA 1HXDA 2CRGA 4BU2A 2XVCA 1WCMJ 2X1EA 2E35A 3MAJA 5CVRA 1KA8A 2R7OA 3BZ6A 1AU7A 2Z33A 4LG3A 4JOMA 3GTKJ 3CCMI 1PDNC 3RTRA 2DN0A 2K86A 3F8FA 2QSGX 2KRFA 2Y0SN 3ZP5A 1PUFA 2JA7J 5HDGA 2DDAA 4V19K 2XV4S 2ISYA 3UR3C 5D4SA 3QPTA 4CYCA 3CO6C 1SMTA 1DQUA 3GTGJ 2XDVA 5CVVA 1KU3A 5LGUA 3E6MA 2QKMB 3DBHB 3FXMA 3K10A 3BTLA 5FD5A 3LOCA 3R6SA 3KZZA 1QQIA 5LHIA 4G9YA 2W24A 1YW9A 5F0CA 1YLFA 3E6DA 3I4NJ 2IXSA 3C2BA 4UVCA 1KYWA 2DO7A 3EUHC 4ESBA 4AUXA 2ZCWA 3S8PA 2PN6A 1KZHA 4ENKA 1TL8A 1R1UA 4XRSG 2L4MA 4RB1A 1LQ1A 2LOOA 2HNHA 3CUQC 4EGZA 2HI3A 2N8GA 2EFNA 3ABTA 1I6HJ 2R5ZB 3S3NA 4S05A 3CMAI 3TDUC 2UZKA 1Y39A 1UMQA 4DBRA 2RAEA 4LLNA 3CCVI 1ZELA 4U0WA 4PUSA 2LSOA 1BR1A 1T0FA 3IRRA 2F5FA 1MNMC 3ZCOA 3E5QA 2ZSIB 4Q4ZF 4BS9A 2I8DA 4II3A 2YSRA 5ICCA 4XRSA 3OYIA 3OYNA 3OYGA 1JHFA 2ADUA 1R71A 1JHHA 3GMEA 5BOXA 1IN4A 1FWZA 1U8BA 3GFMA 4GGGA 1XD7A 5EGOB 1J09A 1FBQA 3KP5A 1ULYA 2EWNA 1YOVB 5IT3A 2P5KA 3CDHA 4I01A 4A3FJ 3V7RA 4A0XA 2VI6A 3IP4B 5LGTA 4CCLA 2ZKZA 1QPIA 3S2DJ 3EDPA 2DYRH 5IOYA 4U88A 2HYJA 4AIDA 4CICA 2E2HJ 2ZXJA 4XKBA 5IPAA 4G6QA 1Z7UA 3HGGA 5HDKA 3QOPA 1Z3XA 2Q2EA 1Z7LA 3PIOF 2DJNA 3CCEI 1IN8A 1USTA 3DF8A 1EKEA 1FC3A 1JT6A 2QUFA 1DDNA 2MC4A 2FBKA 3S93A 2RVCA 5IP6A 1FSEA 4DJAA 2LLKA 3OIOA 4XLEA 3ZQIA 5HLIA 5LRSA 3A03A 3TMOA 4YRVA 2KIMA 3JRBA 2BY1A 1K6OA 2O9LA 4A3MJ 3P9KA 1JI8A 4XICA 2ID6A 2Y2ZA 3GW2A 1F4KA 4LFUA 4E7LA 2HOEA 4P9FA 5E8GA 3F6OA 3JRGA 1H88C 4HPQA 2XAGA 3F8MA 2FNPA 3P5JA 2FD5A 1VQ4I 4Y33A 3GEZA 2H94A 2FA5A 5LEJA 3R60A 2WV0A 3U1KA 2HDWA 2UXNA 1HDDC 5DYMA 1S3JA 4BGDA 3HXLA 4RAGA 3GF2A 3J81Z 2LKXA 1HA8A 2DAOA 2L0KA 2QQBA 3IH4A 3O8GA 4X1EA 2DJIA 3AL0B 2NS7A 1DUXC 4AYBN 4PCQA 4DYCA 2FEZA 4UVAA 1JUSA 3SFZA 2O3FA 4L5JA 4D1QA 4A93J 1PJRA 2BXZA 3E97A 2LKPA 1IUFA 3BWGA 3PUBA 3DEEA 1FY7A 1T0FC 4IHWA 3DFGA 4ZH4F 1IXSB 4A3CJ 1FP1D 1E17A 2Z9OA 3I58A 2DFHA 1WH7A 4L18B 5E17F 2CSOA 3X2QH 3OYKA 2VPLA 1O7LA 5KVRA 3I53A 1ETKA 4E4HA 2VJIA 3BQZA 1R00A 3DU5A 4QSHA 3WTZA 1ZLKA 3IRQA 1HQCA 2JPCA 3O6BB 3LSPA 4FQGA 5J6XA 1LNWA 4RMNA 1TZLA 3H92A 2PEXA 2MH2A 4LLLA 2CFOA 3OYLA 4XMYA 4UUVA 1LE8B 2K9LA 4N4OB 3H9GA 5GTIC 4V2FA 3V7CA 1SMYF 2V1UA 4A3IJ 2KRCA 4RB0A 2WAEA 3TDZC 1F1ZA 2Q0OA 1APLC 4Y13A 2K9SA 1JKQC 2CUFA 2RNGA 3PM1A 4I2OA 1XC5A 1JKOC 4LIVA 2Y0SA 4JP0A 2P8TA 2HQAA 3GCMA 4DIQA 5D5UB 3E6BA 2O6GE 4B47A 4K2EA 3FXQA 2HWVA 1S6LA 3GZ5A 1VQKI 3G3ZA 2QENA 4EQQA 3CMEI 4J01A 1MZBA 1E3HA 3PJRA 3BR3A 5GAHJ 2FQ4A 3SXYA 5E3NA 4ETSA 3KPHA 2GXAA 1IRZA 5TISC 2HVRA 1RETA 1FEXA 2R4GA 2K85A 5ICEA 4OWRB 1KU7A 2EFOA 3H36A 1MNDA 3S2HJ 1ZR2A 2VC1A 3OSFA 1KGSA 1ZAOA 4IPAA 1XCVA 4A6DA 2VBZA 3I56I 2PI0A 3D5SC 1N78A 1ZRCA 4BQNA 5A2QK 2HQ5A 3M8EA 1UHWA 2NVUB 3KLOA 5H6QA 2LBFB 3PO3J 2A6TA 1XTAA 1HW2A 3G1OA 5KHDA 3FKIJ 2KZVA 2Q1ZB 4XIDA 2R92J 4G7HF 3JSOA 2X0LA 3AG1H 3DLLF 1VI0A 1SFOJ 4IVNA 4WF2A 2E2JJ 1O4XA 1WI9A 2IEKA 1D3YA 2JPBA 2KHMA 2Z99A 4FTHA 3CUOA 4KDPA 4LMYA 2DK8A 3GWZA 1QNTA 2ZJRF 1D8KA 2Y31A 4FHTA 2CQKA 3LL7A 5K5RA 2M34A 1UCRA 3CO7C 1S8NA 2DW4A 1WFXA 5IT9K 4HW0A 4XKCA 3T0YA 2ZJQF 2NAZA 5E79C 2R5ZA 2Y9ZA 3J7AO 2ZMEA 2JA8J 4YIIA 3FK7A 4ASNA 5K7ZA 4D0PA 3LA2A 2Y48A 4G6TB 1T6SA 4RGXA 3HOTA 1L3LA 4HNVA 5F1JA 1UZCA 2IRFG 1JE8A 1VQ9I 5CVJA 3V8LA 1KU2A 3FBIB 4S04A 3BTCA 2CV0A 2JA6J 2BY2A 4HBLA 4EM2A 1VQNI 3WGGA 1GV2A 4BE2A 5E1ZB 2RN7A 5EYRA 1A6QA 2Y75A 3H3UA 1G2HA 1FBSA 1YE9A 3LMMA 1OYWA 1S7OA 3HOZJ 5D6FA 3H0GJ 4FISA 3ZN0A 3TBIA 1WHUA 3CTAA 4AVPA 1KQ0A 2PMZN 3CJRB 3F3XA 2CH0A 3A1YA 3GLXA 5B5EC 3K70D 2OA4A 5EGOA 2WY8Q 3LWFA 4B8XA 5C3EJ 3LSHA 1Y8RB 4KUMA 1RIOH 2DPDA 4BY1J 4HRIA 3ECOA 2NS0A 5FRNA 3FXUA 3A02A 5L3DA 2TCTA 3HOWJ 2A05A 5ILVA 4IX7A 1HOMA 1ZARA 4M9ZA 1UELB 6PAXA 1HCRA 1GV5A 2AQFA 2QYOA 2XAFA 2V9PA 3G73A 2K9QA 4AIHA 3TOAA 1RKWA 2W4SA 4XM3A 2VJ5A 1FOKA 2NOGA 3SQNA 1F43A 1TWAJ 1ZYRF 1PUFB 3L09A 3ELKA 3A2KA 2IVMA 1Y8QB 3U21A 2OV7A 4AIJA 1LVKA 4XLCA 3CCYA 4MQVA 2KPMA 2WTEA 5JHUA 3SZGA 3CCJI 2LRDA 4AYBA 2ACJA 4A3JJ 2M87A 2LC2A 2M7AA 1HLVA 2R7WA 1VQ8I 1IRFA 5KCMA 3K1PA 4G12A 1VNDA 3MMYB 4MFDA 4IKFA 3I59B 4L0YB 3F8NA 1XDUA 4HX8A 4LITA 2HQNA 1X3WB 4A2UA 1MNEA 2OCEA 2JTVA 5HODA 1R1VA 2IA1A 3WODF 2LYCA 3D0SA 3PQKA 5M3FJ 1XX5A 2CUJA 1ETQA 3LSTA 1NK2P 3GX4X 2O03A 1S9HA 4HLXA 4D5FA 3MKWB 2QZ8A 3DTEA 2F5VA 1TP4A 4U0VA 2Y30A 1Z05A 3HKZN 4I98B 2KIFA 2B63J 2X48A 2DOAA 4PK4A 3SEZA 3CDIA 1MJBA 3WU1B 1FLIA 1GXPA 1S5LC 2VBYA 3I64A 3U1DA 2W82A 1DP3A 4M6VA 1DGRM 4AU7A 5A2QZ 2VE8A 2GIVA 4KT5C 2FQ3A 5AONA 4M73A 2VC0A 2VPRA 5CQEA 3PFIA 4BXUA 1ZR4A 5D5VB 2V1NA 3VPRA 1EV7A 1KQ8A 2E34A 4QTRA 1JKRC 3ZOBA 1VF9A 1ZG3A 4PJNA 3LQRA 3HOXJ 1QRYA 4GYIA 4OAYA 1V3FA 3ABUA 3LNQA 2XASA 3Q0UA 3P9CA 1SD6A 1X19A 4LOCA 1XG1A 3ZQFA 2W85A 3LFUA 1LDDA 1Q1VA 2HKXA 2DA2A 4XKWA 5EG0B 3I5UA 1U2WA 1LE8A 2HPIA 2M8EA 5CJ9A 4IXAA 3I3LA 2E2IJ 1G3WA 2B7EA 1Z21A 3ULQB 4Y52J 2CUZA 5IT9Z 3ONQA 2O8XA 1L0OC 2XGCA 4HA8A 3K7AJ 1HDPA 4XOPA 4IF4A 1WRJA 3LFKA 5ERIA 2R7RA 2V26A 4EVIA 3J7YJ 4F52A 4C3HJ 2STTA 2K5CA 1SD7A 1OFCX 2K7LA 3JSPA 5L3BA 2DA7A 3BP8A 3OY9A 1GHCA 2EIMH 3VSLA 2PLYA 2K9NA 3AAFA 5B1BH 3K2ZA 2DA3A 2AHQA 4C2TA 1Y1VJ 2CQNA 3PQJA 2XIGA 4EJWA 4HX4A 2OUMA 2HTJA 2WAFA 1HSTA 4EMSA 3WTWC 5ILSA 1RRJA 4D7NA 2CV2A 4EM0B 4ZYHA 2F2EA 2R7FA 2JVGA 1R5GA 4PSWA 2KIUA 4XONA 1N25A 1GLNA 1CGPA 4CSWA 4B1RA 4BBSJ 1I50J 4X6AJ 1ON1A 2LBFA 3PFYA 4NDLA 2E1NA 2FF4A 4E6KG 3FX3A 3ZQCA 4KITB 1CQTA 3ABKH 1T08B 3S32A 4PZJA 3AL0C 3EETA 3AG2H 2D2WA 3H9QA 3JRIA 3DTIA 2E60A 1O3QA 3TEDA 2WB1A 3BG6A 3KCCA 2NNYA 2V6EA 3HRTA 1P9QC 4Z2YA 1H9TA 3FHNA 4OINF 1X3UA 2DLLA 1IUYA 2JSPA 2ZB9A 2XAUA 4I0AA 1W5TA 3CCRI 5GPCA 1I1GA 3CESA 3CJQB 2MW8A 4H4KC 4G6DA 2CS3A 2PMZA 1TWGJ 4F7ZA 2R3SA 4C3IJ 5LEKA 1TW3A 3FXOA 3DPLC 3MKZA 2F5EA 2BOLA 2MBFA 2EJRA 4B43A 2XB0X 2MD0A 2IGNA 5DCMB 4ZYAA 3DPUA 4ZDLA 4UY8I 1ITYA 3TO7A 5LBQA 3E5XA 2P7CB 4BHBA 2M8GX 4U87A 3NQOA 2H1KA 2FU4A 2FMYA 4RGSA 2L9SA 4FCYA 4XL9A 3BROA 4E70A 3KZIC 1RKTA 4QPOA 1WPKA 5AIPA 1MD0A 3G71I 2Y9YA 3IWFA 4UXNA 5EEGA 2R7TA 1IN5A 3LAPA 2E1CA 4MEYF 5GAGJ 4M71A 1FX7A 5K7HA 2M4KA 4PJJA 2MC3A 4AM3A 2K27A 2X6WA 3MN2A 3KFWX 3IAM2 2ZJPF 4F91B 1DP7P 1QO0D 3K4CA 3ZMSA 4KT6A 4MFEA 4EJTA 3HHHA 2VN2A 4XR6A 3Q9VA 1K7AA 2VE9A 2IGOA 2NVYJ 5E3LA 3OL4A 4XK4A 4P1WA 3TW7A 3A0BC 3MCZA 2ECBA 3BR2A 3V7SA 1BA5A 3GUDA 3GTPJ 2OF7A 3V4GA 2HTSA 3M7GA 1V5FA 2FX0A 4L9NA 3HKZA 3HL2A 2O0YA 1XMXA 3N4MA 4JK1X 1LJ9A 2O7OA 2JT1A 2QGUA 2JK3A 2K3FA 2X4HA 1W0UA 4AC0A 1BIAA 2YX7A 3CMYA 4IEJA 2Z5UA 2O8KA 2CWEA 5FKNA 1IRGA 5JLWA 5FKLA 3BPXA 3Q3SA 4NC7A 3HB9A 3I59A 1IAWA 3L2CA 2EBIA 2EZHA 3C3WA 2OZ6A 4LK0F 1X1BA 2E1OA 4WK8F 3LSGA 2K9MA 1YJNI 2A69F 4CUGA 1S72I 3BDDA 4IHXA 2ZMEB 1D1AA 5BPIA 1XSDA 1FYMA 2VQGA 3T5XA 5F64A 3RKWA 3H35A 4MNUA 4XN0A 1G6NA 1J0RA 3BG5A 3LSJA 4ZYGA 5DUIA 3ERMA 2EB7A 1H0MA 4IHTA 3TKYA 5B1AH 3MKLA 5BNGA 2PG4A 3S3OA 5DS9A 4UV9A 3DLAA 5LHGA 1MMDA 5J47A 2ELJA 2H09A 2XF7A 3I54A 2LKSA 4KNYA 3F8BA 3M9AA 3H5RA 4GCVA 2E71A 5FROA 4KMUX 2QA4I 1YW8A 2L02A 3DBRB 3RYPA 4C9YA 4UNOA 3H1CA 2KT0A 4PFPA 1Z77A 4ON0A 3QQAA 2ZXIA 2V7FA 3I0TA 2W1OA 1QHHD 3TL4X 1ACIA 3F9KA 5J8FA 1BW6A 4C3JJ 5E20A 1F5TA 2IP2A 3PNTA 3ZMTA 1AWCA 1OLTA 3U9GA 5M5XJ 1T98A 1XMKA 2JUGA 3M4OJ 2BHYA 4R8HA 2KKOA 2Z2SB 2HU9A 4RAYA 5FLMJ 1FNNA 2WY7Q 5EG0A 4YFNF 3DTKA 1XGMA 3ROUA 4CZCA 3FMSA 1LKXA 3JR9A 2KFDA 3T8TA 1YW7A 3VYRB 4I6ZA 4L5IA 1HKTA 1SVMA 1C0WA 1IV8A 3E5UA 4A3EJ 4BQAA 5D5XB 4YG2F 5DM7F 3RQIA 1X2MA 1VQ5I 1AHDP 2FMLA 1MBGA 4EJUA 9ANTA 3T8RA 1QBJA 1FJLA 3W2VA 3RI4A 1ZREA 1SANA 4EEFG 3SHFA 4A69C 3BZCA 1T95A 3SDBA 1U5TB 2QWWA 4NC6A 1O57A 4RLQA 4CCJA 4L5EA 4HYEA 3RZDJ 2QEXI 4BE1A 1TW2A 1AOYA 2OPTA 3ZMUA 1MBJA 2CGPA 4IL6C 1T56A 1LFUP 2EFQA 2YR2A 4KIGA 1MJ9A 1R5ID 2L4AA 2HQRA 1IDYA 2DI3A 2M9HA 3JRFA 3UNGC 5CYVA 1G8XA 2D1HA 1NK3P 2IS1A 4S0HB 4RDUA 2EA4A 5F6FA 1IF1A 2VJJA 3KP7A 1N77A 3GYHX 2HEOA 4A3KJ 2HGCA 4Z6YA 4M74A 2ESNA 1P7JA 5KAFC 1X4OA 2DXIA 4L0ZB 2HKOA 4D9JA 1XPXA 4LG0B 2YU9J 1B4AA 4FX4A 5J3LA 2P6SA 2FRHA 2OQGA 3B02A 5BPDA 2HZTA 3D5LA 3VYUB 4F93B 3CZ6A 2KZGA 4MEXF 2VBXA 1WJFA 3H5AA 3TOBA 2M1BA 3F22A 5DV5A 2HXIA 2VUMJ 3ZR8X 3E3VA 2J5OA 4TV7A 2ME6A 1Z91A 4CYDA 1JJ8C 5DD4A 2ESHA 4I7HA 1QPMA 1U9OA 2DU9A 5D4RA 2LFBA 3R61A 2CYYA 2JRMA 2XF5A 3CJNA 5L3GA 1JGSA 1B72A 4F55A 2DA6A 1U3EM 1J75A 2CW8A 3RQ4A 3ZQLA 5HNFA 3BCBA 4N0BA 2DMUA 2CQ7A 4PJMA 3BLYA 5DCMA 4E7KA 4RB2C 1A35A 3RCOA 1YI2I 3ZQ7A 2LY9A 4X0GA 4DW6A 2EV5A 2UV1A 5HS7A 2WAQN 1ZH5A 4XNFA 1XGOA 1ETYA 2EH3A 4DNCA 1FYKA 3C18A 4ITVA 5C44J 2R7VA 2F4OB 4CCMA 3KP3A 3VOEA 4Q48A 4JX5A 4XBFA 2VBWA 3FBNB 2H27A 2JRTA 2FUG2 1Z67A 5FLXK 4RAZA 2DFEA 2R93J 4KA4A 4RM3A 5LRRA 3KEYA 3K70C 3QOEA 1GUUA 2BZTA 2KJBA 1UFMA 3KEQA 2IS2A 2JUCA 3KE2A 3QU6A 3LA7A 3JW4A 3FXRA 4PGGA 2I10A 2VKHA 2L7MP 3D1NI 2V79A 2XAJA 1ORKA 1ZK8A 2F5CA 1WVRA 4W1UA 4BDYA 1I6XA 1IRXA 3HSRA 1BOBA 1A6IA 4UUSB 3RPUD 3WTXC 2DT5A 1D8JA 3H0DA 4II2A 5IY5H 5DM6F 3MKYB 5TJJA 2RNJA 2GAUA 5K5QA 4UV8A 3BOQA 4M9XA 4BHPA 5ED4A 3JREA 3SZTA 2NVQJ 4WXCA 1GVJA 4F92B 2M0CA 2H1LA 2RQPA 2MGQA 2F4MB 3DKXA 1QGPA 1MH4A 1ERDA 3NAUA 1WJEA 3QYEA 1LDKB 2V1DA 3FM5A 4P9UA 3DPTA 2GXGA 3SEQA 1MBKA 1PVEA 3ABMH 2GA2A 5FGMA 4YELA 1IZ1A 1KQ9A 1R49A 3VDXA 2KL4A 2MA3A 2A68F 2BVMA 3HJEA 4ANJA 1TT0A 3MWMA 5JHFA 3V8JA 1BIBA 1Y0UA 3VSKA 2A07F 4M6XA 1IJWC 2BGCA 1W0TA 1OPCA 2DMTA 3GZNB 1D0ZA 1U8RA 4IRHA 1UHSA 2K4BA 2QLZA 3K4LA 4A3GJ 3K1NA 1FMWA 2MSYA 2WB1N 4BJ6C 2HS5A 2IBDA 3OYBA 1Z1DA 3DKYA 4RBOA 3FXKA 4DBQA 3G6EI 2BE5F 3GBGA 2DT7B 4HF1A 1Y0NA 4EJOA 4O3MA 1VTNC 4JX6A 4IHVA 1W7PD 2XRNA 1XGNA 1FIPA 3WE2A 5BQTA 1Z6TA 3LA3A 2L9VA 2CG4A 5HDNA 3VEPA 3OYAA 1XB4A 3ZMDA 1FTTA 4BE0A 2HZDA 2F6CA 1XSXA 4KIBA 3LSMA 4UHTA 4LIUA 3HYIA 4G7ZF 4HEA2 2YU3A 3GZ6A 1J5YA 1FOYA 3FZVA 4CDGA 5EEHA 3OOPA 4HG2A 4BQQA 2VB6A 4IJAA 3P9IA 1YG2A 4JYKA 3WTVC 1OCOH 4XOTA 3WG9A 3CC7I 2W00A 4MIMA 4KYWA 1U0JA 3BTJA 1YFHA 3R0AA 2HDCA 2HOAA 2IGMA 4M3GA 3QRFF 2V4JC 1PP8F 3W6VA 1MMAA 4FETA 3CC2I 1G3YA 1PP7U 3E1SA 4B09A 2Z16A 2MD5A 1J7KA 4OOIA 4C2MJ 3M1EA 2NVTJ 4O6JA 4A0YA 1RI7A 4IQ4A 5H6RA 5H20A 2G7UA 4ESFA 2RDPA 3FXLA 2L2OA 1ZG5A 3IKTA 3PNVA 3RDIA 3QWLA 3HRMA 3CCUI 1S7AA 1E0EA 1QA6A 5HNHA 1B1BA 1U5TA 4BKXA 1FYLA 2EA2A 3L1PA 3LQQA 4ZZLA 3GFJA 1T8IA 2AS5F 2VONA 2F5DA 3KP4A 1J59A 4ZDOA 4YFKF 1R1TA 3KIOA 4OIRF 3J7AY 2XGDA 3F8CA 5D6EA 2HPMA 3JRAA 4YIRX 1R4MB 2WV1A 4B3XA 4HNTA 2R7QA 1AKHB 1LEAA 1ETXA 2QVOA 3K4BA 2P5VA 2OTJI 4AIKA 2CJJA 3MZYA 2M7BA 1POGA 2BEOA 2BY3A 2K40A 1OYYA 2ZO4A 2OJED 3F72A 4D7MA 5FLXZ 1MMSA 2L7FP 3OV8A 4A5MA 1V5EA 2ZMEC 3OS1A 1RR7A 2IW5A 4OMYA 1XSVA 2V6CA 1EF4A 3ZMZA 2MABA 2HFHA 3HEFA 1O3RA 4DZJA 2W84A 3V8KA 2L7ZA 4LG0A 1B9MA 3BCAA 1WQ2A 2W57A 2Y0MA 3RYRA 4F3QA 1RUOA 2EIJH 2HYFA 3RKQA 4LB6B 3J80K 2FE3A 4I99C 2ZXWH 2OBPA 3FKJA 3RJPA 5LFAA 1K4SA 4XSZF 3ZXSA 1U6GA 2WAQA 5K5OA 3MZ8A 3S1MJ 1IV6A 1I39A 1ETVA 2LMDA 1Z9CA 2FBIA 1GVDA 3DBLB 1EH7A 4IRIA 4IQJA 1RZ4A 3HC7A 4WXDA 1WJ5A 4EM1A 4M9SA 4E7HA 2LY1A 5E8IA 2GZWA 4GO1A 3W3CA 4YFXF 2C6YA 4P55A 3BT9A 4IOCF 1WH5A 2B0LA 1XN7A 3V42A 2UWMA 2DQLA 3HUGA 2QSFX 4ZC3A 2P81A 3C1DA 3EUKL 4HSTA 3CQZJ 1VZ0A 3BG3A 1DPUA 2NXNB 4OMZA 2EQRA 2P5LC 4OIOF 3NWTA 1W7PB 2WC2A 3LAJA 5IOZA 1T2KA 3R0JA 2O5RA 3O3KA 1SFXA 4R1HA 2DTZA 3HSEA 3S3MA 2RGVA 2BBYA 4KN7X 1TC3C 1ZLJA 2QM3A 4J19A 1OMIA 3EPZA 2IA2A 1LEBA 4NUBA 4JX4A 2W7NA 2MLKA 4A12A 4XSXF 1TLHB 2E5NA 5E3OA 4IOAF 5ICGA 1B9NA 3QPHA 5CQGA 4CZZA 2QSHX 3S16J 2A5YB 1IN6A 4HAMA 4ZYEA 2M0MA 1VQ7I 1U5TC 2RKHA 1QVUA 2E19A 1TWHJ 5H2FC 3JRDA 3HOYJ 1JGGA 1K78B 2ICWG 3M8JA 2COMA 1MDMA 1D1CA 1REPC 1NTCA 2LTPA 2RREA 1RR8C 1VQOI 2IPQX 3CLQA 2TDXA 4UUSA 2B9SA 2EV0A 2Y69H 5JVGF 5LGNA 3Q0VA 5BMZA 1W36D 3C2GA 1X1PA 1D1BA 2LNBA 3DWLE 1HBXG 1W1WE 5EJCA 3A01B 3ML6A 2BVLA 3A4CA 2KP6A 1I3QJ 3IAS2 1X4PA 1ONVA 3QU3A 4JBAA 5F27A 2QKLB 3HSFA 2HVSA 3DV8A 3KX2A 2RQQA 4KN4X 3CCSI 3KP2A 2KLOA 1BN5A 2L54A 2EFPA 4OU0A 1T38A 3WTUC 4QIWN 2VT2A 3O2PE 3JAMZ 5L3CA 1V55H 3JCUC 4LB5A 1YHQI 3EYIA 2L3DA 3FISA 3S1NJ 2VXZA 1LFPA 5DCFA 3W6KB 4BQOA 1GT0C 2P7VB 4XRMA 2DPUA 1TQMA 1RPWA 1B72B 3BG7A 2P0WA 4FASD 3M1CA 3PSIA 1BR2A 1F9NA 3W2WA 1YITI 3GFIA 3TQNA 2DMQA 4M6YA 1JTXA 2EZLA 4CCOA 2H8WA 2DODA 4RAFA 4NQWB 4B44A 1H89C 4ENMA 1E3PA 4I76A 3GXOA 3SZPA 1A04A 1O7FA 3N05A 4LGWA 5DD8A 4KFCA 4PSXA 2XSJC 2LR8A 5CKTA 2XGEA 2JA2A 3VFZA 2E1MB 2M3AA 4BEHB 3K69A 3BR5A 1V54H 3NRVA 3OR2C 3GTMJ 3AKZA 2NOJB 3HTSB 3NWSA 3CDLA 1A36A 3HOUJ 3GTQJ 2OZUA 4U0YA 1BI2A 3SYTA 3OS2A 2QBYB 1S7EA 4BUPA 3OYCA 2NVXJ 2JN6A 4BJ5C 4B48A 2V9VA 1BL0A 3B73A 2BHZA 1P7IA 3BY6A 1QU3A 3MD2A 2L01A 1NHAA 2X51A 2VKEA 3K6GA 5FO5A 1MBFA 3I9V2 4BL0B 5FD6A 4ENNA 3J80Z 2W25A 4HDUA 3TP0A 3HRUA 3WTTC 1U78A 1OCCH 2YPRA 4HV5A 2A5WA 4XLAA 3CCQI 5IP7J 5LHHA 1SAXA 2GA1A 2KQRA 2LK2A 2Z1DA 4A3DJ 2ZSHB 3OIPA 4Y15A 2QQ9A 2E5ZA 2GLOA 5DUKA 4FX0A 1XGSA 3A0HC 3OYMA 4A5NA 2E36A 3DXJF 1MSEC 3B6AA 3IUOA 3OR1C 2DCEA 3SFIA 1JTYA 3TW6A 2VOOA 1SFUA 5D8LB 2HXOA 1USSA 2R5YB 1OR7A 1R23A 3BZKA 2X85A 1QZZA 2IJLA 1D0YA 3VWBA 5KK1A 2D45A 1ZQ3P 2MH9A 1BOAA 2WA0A 2DMNA 3HM5A 1AKHA 4Y7NJ 4DYQA 3ASOH 1YIOA 2ZC2A 1HKQA 3BG9A 3FWEA 3PUFA 5K1YA 4OIQF 2DA1A 2ME0A 3RPUA 3I71A 4ABZA 4EJVA 3Q9SA 2DT6A 5JR3A 4WX9A 2EFWA 3P7NA 4QWQA 4DZPA 3UKGA 3IH3A 5D8KB 2LD5A 4LJZF 1LUJB 2JMWA 2VJ4A 3S17J 2HVQA 1QVTA 4OIPF 2M5WA 1FZPB 3REOA 1FOWA 4EV0A 1IO2A 4D5CA 3AG4H 4A3BJ 2X6YA 1MBEA 2VODA 2ETHA 2IAIA 3RKXA 2BYVE 4NB5A 5C4XJ 3ZPLA 1OCRH 3Q0WA 3U2RA 1I3AA 5DEQA 3MFKA 4A6EA 1I1SA 3R4KA 4A0ZA 1BI1A 3C2HA 1NG6A 1Z3YA 2KIQA 3F0CA 3E7LA 3ZMVA 4ZJZA 1UB9A 4E7JA 3BQYA 4E7ZA 3ZGKA 1JT0A 3DCFA 4DQ2A 4U7DA 3COAC 3SDGA 3CP2A 1BI0A 2DK5A 3IH2A 2KDOA 5E1WA 1STZA 3DEUA 1TQIA 1FMVA 2V9KA 1G3SA 2LG4A 2LP0A 3HOVJ 1OKRA 1X58A 3GTOJ 3BC8A 1F36A 3TGNA 1HSJA 3WE3A 1MMNA 3I55I 3FXJA 1SC7A 4HDVA 1FOXA 4LD5A 5F04A 2LY2A 1SFKA 1A31A 1WJBA 1SVOA 3WHBA 4DOZA 2IS6A 4BYYA 1ETWA 1W7PA 1IXCA 4QLCU 5IYCJ 3G4SI 2STWA 2PQ8A 2MG4A 3ECHA
chains in the Genus database with same CATH topology
4L9VA 4JQFA 1OYIA 4R79A 2Z3YA 1W4MA 5CLSA 2CFXA 3GO5A 1I5ZA 1FPQA 1B59A 1ZRFA 3WTSC 3HHGA 1TTYA 1SD4A 2AXLA 1KU9A 1K78A 3NEUA 5JI6A 2HYGD 2OD5A 2P6TA 2D1VA 2A6EF 1Q1HA 2M45A 1TNSA 5JFRA 2FOKA 1QZYA 2CO5A 2LDUA 4N9HA 1EH6A 5CVUA 1J9IA 1ZRDA 1P2FA 2M30A 2A6HF 3K0LA 5HOOA 2IT0A 5ICFA 2PBIA 1CF7B 2GQQA 3CLOA 3IHUA 4NQWA 1P4AA 2BV6A 4MQ9F 3QP5A 3BJAA 3JTGA 4LK1F 3ERED 2XUBA 4U7BA 1J2XA 3EYYA 4CXFA 2OQRA 2ZJ2A 2QBYA 3IKVA 4MTEA 4P96A 4M72A 1W5SA 2DQRA 5L3EA 1O3SA 3L7WA 5FFXA 2WWYA 1YTYA 3ZN1A 3K1MA 4MGRA 3QP6A 3K9TA 1G3TA 4PGHA 4WWCA 4NHJA 3N97A 3C7JA 2EV6A 1FP2A 2PJPA 1BBYA 1MDMB 2UXXA 2VOPA 3WGIA 4RGUA 4O5VA 4G94A 4KMFA 4AWXB 4LLGF 5HLGA 2XROA 3H3ZA 5LLQA 4CO8A 2A3SA 3I4PA 2NRAC 4GXOA 5HS9A 2FSWA 3ISPA 3GVAA 2FNAA 1WKMA 3Q5FA 3CUQB 4ZZDA 1XMAA 1ZGJA 3VODA 2DFIA 3WGHA 5CVIA 1MGTA 5D5WB 2XKOA 4IHSA 2QQAA 2R7DA 4KIFA 1GXQA 2KJCA 5E1XA 3DKWA 2E7WA 2OAZA 3RKYA 5J8CA 2K4JA 4HF2A 1LDJA 1S29A 1TBXA 3HIFA 1IW7F 1B6AA 1H9GA 4Q47A 4XRFA 1DPRA 3KETA 1D5VA 1FBUA 1ODDA 2FBHA 4IRGA 3L00A 3MZHA 1LVAA 5HS8A 4ENJA 2HR3A 1BC7C 3IL2A 3JTHA 3KLNA 5JVTA 1FT9A 1P92A 3JAMK 4XLPF 1XDSA 2ZFWA 2JSCA 3GFLA 3TO9A 4HQEA 5DDGA 1ON2A 2XKPA 3HTUA 4ESJA 2FXAA 2ZNYA 2ZNZA 4CHUA 5E18F 4MHGA 4HF0A 4XLNF 1ZG1A 1R7JA 2H6CA 3KZYA 3F23A 1IXRC 3TO6A 1RNLA 2K02A 3RPQA 3WTYC 4BH9A 1FSHA 2MLGA 2XAHA 3IWZA 1KYZA 5L3FA 1YO5C 2EK5A 1ZGAA 1ZHFA 3MEXA 1ZN2A 4KICA 2J5PA 3EQLF 1YYVA 1P4XA 4CGZA 2E7XA 2O61A 3QAHA 3E6CC 2PMUA 2CW0F 1R22A 2H6BA 1HW5A 1T39A 5TRDA 3W6JB 1RUNA 4AD9A 5ILUA 3MQ0A 4I0BA 1CF7A 2ZBKA 4HOBA 1UHMA 1EH8A 3F6VA 1TNTA 3BJOA 3VB2A 1JXSA 1O3TA 1I27A 1LB2A 2VT3A 3F21A 4Q5SF 3RIRA 2XAQA 2PFBA 5FFZA 3DP7A 1IN7A 1SFEA 4MTDA 2ELHA 3WU0A 1E2XA 4G8XA 1MKMA 1YS7A 2YX4A 4WCGA 1SD5A 2V1XA 1BI3A 2RC4A 1HKSA 1G4DA 2DTRA 2OU2A 2LF8A 2ISZA 1R58A 2PMHA 3DQVC 2JZYA 4HX7A 1YS6A 3FHZA 4HZFA 3KEOA 4BHCA 4RS8A 4FT8A 4BNCA 4L9JA 4BAYA 2GXBA 1Z6RA 4YIFA 2NYXA 4UVBA 3EUHA 2A61A 3HOSA 3FM3A 2G7HA 1HW1A 2IA0A 3CUQA 1P6RA 4HQMA 4L9TA 1R36A 3T1BA 3HRSA 5HVQC 4PDKA 5AIQA 4RB3C 1WSUA 2NNNA 3KP6A 4H0EA 4N9IA 1WWXA 4RGRA 3S2WA 4G7OF 2DBBA 2XHKA 2GWRA 3BPVA 4HV6A 2P4WA 2XGXA 2LF7A 5BS6A 4Y17A 2Q8KA 1R5HA 2G9WA 1BM9A 1P4WA 1BJAA 1XCBA 3FMRA 4ZYDA 4GYGA 4HLYA 3FF5A 2RV8A 4WXHA 1MJAA 3L9FA 3M8FA 1BC8C 1YQAA 4EGYA 4I09A 5FB2A 4P5OA 3BJ6A 1TQPA 4I02A 3J81K 3IC7A 5F1RA 1V4RA 1PUEE 1K79A 3FMQA 5HLHA 1HXDA 2XVCA 3MAJA 5CVRA 1KA8A 3BZ6A 2Z33A 1PDNC 3RTRA 2K86A 3F8FA 2KRFA 3ZP5A 5HDGA 2XV4S 2ISYA 5D4SA 3QPTA 3CO6C 1SMTA 5CVVA 1KU3A 5LGUA 3E6MA 5FD5A 3R6SA 3KZZA 1QQIA 5LHIA 4G9YA 2W24A 1YW9A 1YLFA 3E6DA 4UVCA 1KYWA 2DO7A 4ESBA 2ZCWA 2PN6A 4ENKA 1R1UA 4RB1A 2L4MA 1LQ1A 3CUQC 4EGZA 2EFNA 3ABTA 4S05A 3TDUC 2UZKA 4LLNA 4U0WA 2LSOA 1T0FA 3IRRA 2F5FA 3E5QA 4Q4ZF 5ICCA 2YSRA 2ADUA 1JHFA 1JHHA 5BOXA 1IN4A 1FWZA 3GFMA 4GGGA 1XD7A 1FBQA 3KP5A 1ULYA 2EWNA 5IT3A 2P5KA 3CDHA 4I01A 3V7RA 4A0XA 5LGTA 2ZKZA 3EDPA 4U88A 4CICA 2ZXJA 4G6QA 1Z7UA 5HDKA 3QOPA 2Q2EA 1IN8A 1USTA 3DF8A 1FC3A 2QUFA 1DDNA 2FBKA 2RVCA 1FSEA 5HLIA 5LRSA 2KIMA 1K6OA 3P9KA 3GW2A 1F4KA 4LFUA 2HOEA 4P9FA 5E8GA 3F6OA 2XAGA 3F8MA 2FNPA 3GEZA 2H94A 2FA5A 5LEJA 3R60A 2WV0A 2UXNA 5DYMA 1S3JA 3GF2A 3J81Z 2DAOA 2QQBA 1DUXC 4PCQA 2FEZA 4UVAA 3SFZA 2O3FA 4L5JA 3E97A 2LKPA 3BWGA 1FY7A 3DFGA 4ZH4F 1IXSB 1FP1D 1E17A 2Z9OA 3I58A 4L18B 5E17F 2CSOA 1O7LA 5KVRA 3I53A 1R00A 3WTZA 1ZLKA 3IRQA 1HQCA 2JPCA 3O6BB 5J6XA 1LNWA 3H92A 2PEXA 2MH2A 4LLLA 4UUVA 3V7CA 1SMYF 2V1UA 4RB0A 3TDZC 1F1ZA 2Q0OA 4Y13A 4I2OA 2P8TA 5D5UB 3E6BA 2O6GE 4K2EA 3FXQA 2HWVA 1S6LA 3GZ5A 3G3ZA 2QENA 4EQQA 1MZBA 3SXYA 4ETSA 5ICEA 1KU7A 2EFOA 2VC1A 1KGSA 1ZAOA 4IPAA 1XCVA 4A6DA 2VBZA 2PI0A 1ZRCA 5A2QK 3M8EA 1UHWA 3KLOA 5H6QA 1HW2A 4G7HF 3JSOA 2X0LA 4IVNA 4WF2A 1WI9A 1D3YA 2JPBA 2Z99A 4KDPA 3CUOA 4LMYA 2DK8A 3GWZA 1QNTA 1D8KA 4FHTA 2CQKA 5K5RA 1UCRA 3CO7C 1S8NA 2DW4A 5IT9K 4HW0A 3T0YA 2NAZA 3J7AO 2ZMEA 4YIIA 4ASNA 4D0PA 3LA2A 2Y48A 1T6SA 4RGXA 3HOTA 1L3LA 2IRFG 1JE8A 5CVJA 3V8LA 1KU2A 4S04A 4HBLA 4EM2A 3WGGA 5E1ZB 2RN7A 3H3UA 2Y75A 1FBSA 1OYWA 1S7OA 5D6FA 3ZN0A 3CTAA 4AVPA 1KQ0A 3F3XA 3GLXA 2OA4A 3LWFA 4B8XA 4KUMA 1RIOH 2DPDA 3ECOA 2NS0A 3FXUA 5L3DA 5ILVA 1ZARA 4M9ZA 6PAXA 2QYOA 2XAFA 3G73A 4AIHA 3TOAA 1FOKA 3SQNA 1ZYRF 3L09A 3ELKA 2IVMA 4AIJA 4MQVA 2WTEA 5JHUA 2ACJA 2M87A 1IRFA 3K1PA 4L0YB 3I59B 3F8NA 1XDUA 4HX8A 2HQNA 4A2UA 2JTVA 1R1VA 2IA1A 3WODF 3D0SA 3PQKA 3LSTA 3GX4X 2O03A 4HLXA 2QZ8A 4U0VA 1Z05A 4I98B 2KIFA 1MJBA 3WU1B 1FLIA 1GXPA 2VBYA 3I64A 3U1DA 5A2QZ 2VE8A 2GIVA 4KT5C 2FQ3A 5AONA 4M73A 2VC0A 3PFIA 4BXUA 5D5VB 1KQ8A 1EV7A 1ZG3A 3LQRA 4GYIA 1V3FA 3ABUA 2XASA 3P9CA 1SD6A 2W85A 1LDDA 2HKXA 3I5UA 1U2WA 2M8EA 5CJ9A 4IXAA 1G3WA 3ULQB 5IT9Z 2O8XA 1L0OC 4HA8A 4IF4A 1WRJA 3LFKA 5ERIA 4EVIA 2STTA 1SD7A 2K7LA 3JSPA 5L3BA 3BP8A 1GHCA 2PLYA 3AAFA 3K2ZA 3PQJA 2XIGA 4EJWA 4HX4A 4EMSA 2HTJA 3WTWC 1HSTA 5ILSA 4EM0B 4ZYHA 2F2EA 2R7FA 1R5GA 2KIUA 1CGPA 1ON1A 2E1NA 2FF4A 3FX3A 4PZJA 3EETA 2D2WA 1O3QA 3KCCA 2NNYA 3HRTA 4Z2YA 1H9TA 4OINF 1X3UA 2DLLA 1IUYA 4I0AA 1W5TA 1I1GA 4G6DA 4F7ZA 2R3SA 5LEKA 1TW3A 3DPLC 2F5EA 2MBFA 2EJRA 5DCMB 3TO7A 5LBQA 3E5XA 2P7CB 4BHBA 3NQOA 2FU4A 2FMYA 4RGSA 3BROA 4E70A 5AIPA 1MD0A 3IWFA 4UXNA 5EEGA 1IN5A 3LAPA 2E1CA 4MEYF 4M71A 1FX7A 2MC3A 2K27A 3KFWX 1DP7P 1QO0D 3ZMSA 4EJTA 3HHHA 2VN2A 3Q9VA 1K7AA 2VE9A 3MCZA 3V7SA 3GUDA 3V4GA 2HTSA 3M7GA 4L9NA 2O0YA 3N4MA 4JK1X 1LJ9A 2JT1A 2X4HA 1BIAA 2YX7A 2Z5UA 2CWEA 1IRGA 3BPXA 3I59A 1IAWA 3L2CA 3C3WA 2OZ6A 4LK0F 4WK8F 2A69F 3BDDA 2ZMEB 5BPIA 1XSDA 1FYMA 3T5XA 5F64A 3RKWA 4MNUA 1G6NA 1J0RA 5DUIA 4ZYGA 2EB7A 1H0MA 4IHTA 3TKYA 2PG4A 4UV9A 5LHGA 2H09A 3I54A 4KNYA 3F8BA 3M9AA 4GCVA 4KMUX 1YW8A 2L02A 3RYPA 4UNOA 4ON0A 3I0TA 5J8FA 5E20A 1F5TA 2IP2A 3ZMTA 1AWCA 3U9GA 1T98A 1XMKA 2KKOA 4RAYA 1FNNA 4YFNF 1XGMA 3ROUA 3FMSA 3T8TA 1YW7A 4L5IA 1HKTA 1C0WA 3E5UA 4BQAA 5D5XB 4YG2F 2FMLA 4EJUA 3T8RA 1QBJA 1ZREA 3RI4A 3SHFA 1U5TB 2QWWA 1O57A 1AOYA 4HYEA 1TW2A 3ZMUA 2CGPA 2EFQA 2YR2A 4KIGA 1MJ9A 2L4AA 2HQRA 2DI3A 5CYVA 2D1HA 2EA4A 5F6FA 1IF1A 3KP7A 3GYHX 2HEOA 2HGCA 4M74A 2ESNA 4L0ZB 2HKOA 4LG0B 1B4AA 4FX4A 2P6SA 2FRHA 2OQGA 3B02A 5BPDA 2HZTA 3D5LA 4MEXF 2VBXA 3TOBA 2M1BA 3F22A 5DV5A 3E3VA 2J5OA 4TV7A 1Z91A 4CYDA 5DD4A 2ESHA 4I7HA 1QPMA 2DU9A 5D4RA 3R61A 2CYYA 3CJNA 5L3GA 1JGSA 1U3EM 1J75A 4N0BA 5DCMA 4RB2C 3ZQ7A 2EV5A 5HS7A 1ZH5A 1XGOA 4DNCA 1FYKA 3C18A 3KP3A 3VOEA 4Q48A 4XBFA 2VBWA 2H27A 2JRTA 5FLXK 4RAZA 4KA4A 5LRRA 2KJBA 1UFMA 3KEQA 3KE2A 3QU6A 3LA7A 3JW4A 3FXRA 4PGGA 2V79A 2XAJA 2F5CA 1I6XA 3HSRA 3WTXC 2DT5A 1D8JA 5TJJA 2RNJA 2GAUA 5K5QA 4UV8A 3BOQA 4BHPA 4M9XA 5ED4A 3SZTA 4WXCA 1GVJA 2RQPA 1QGPA 1LDKB 2V1DA 3FM5A 4P9UA 3DPTA 2GXGA 2GA2A 5FGMA 1IZ1A 1KQ9A 2MA3A 2A68F 3MWMA 3V8JA 1BIBA 1Y0UA 2A07F 4M6XA 2BGCA 1OPCA 1U8RA 4IRHA 2K4BA 2QLZA 3K1NA 2HS5A 1Z1DA 2BE5F 4HF1A 4EJOA 4O3MA 1VTNC 1W7PD 2XRNA 1XGNA 3WE2A 5BQTA 1Z6TA 3LA3A 2CG4A 5HDNA 3VEPA 1XB4A 3ZMDA 1XSXA 4KIBA 4UHTA 3HYIA 4G7ZF 2YU3A 3GZ6A 1J5YA 3FZVA 4CDGA 5EEHA 3OOPA 4IJAA 3P9IA 1YG2A 3WTVC 3WG9A 4KYWA 1YFHA 3R0AA 2HDCA 3QRFF 1PP8F 1G3YA 1PP7U 4B09A 2MD5A 1J7KA 4OOIA 3M1EA 4O6JA 4A0YA 1RI7A 5H6RA 5H20A 2G7UA 4ESFA 2RDPA 1ZG5A 3IKTA 3RDIA 3HRMA 1S7AA 1B1BA 1U5TA 1FYLA 2EA2A 3LQQA 4ZZLA 3GFJA 2AS5F 2VONA 2F5DA 3KP4A 1J59A 4YFKF 1R1TA 4OIRF 3F8CA 5D6EA 1LEAA 2QVOA 2P5VA 4AIKA 3MZYA 2BEOA 5FLXZ 1OYYA 2ZO4A 3F72A 3OV8A 4A5MA 2IW5A 4OMYA 1XSVA 2V6CA 3ZMZA 2HFHA 1O3RA 2W84A 3V8KA 4LG0A 1B9MA 1WQ2A 2W57A 2Y0MA 3RYRA 1RUOA 2HYFA 4LB6B 3J80K 2FE3A 2OBPA 3RJPA 4XSZF 1U6GA 5K5OA 1Z9CA 2FBIA 1EH7A 4IRIA 1RZ4A 4WXDA 4EM1A 4M9SA 5E8IA 2GZWA 4GO1A 4YFXF 2C6YA 4P55A 2B0LA 1XN7A 2UWMA 2DQLA 3HUGA 3C1DA 1DPUA 4OMZA 2P5LC 4OIOF 1W7PB 2WC2A 3LAJA 1T2KA 3R0JA 3O3KA 1SFXA 4R1HA 3HSEA 2RGVA 2BBYA 4KN7X 1ZLJA 2QM3A 1OMIA 2IA2A 1LEBA 2MLKA 4A12A 4XSXF 1TLHB 5ICGA 1B9NA 3QPHA 4CZZA 2A5YB 1IN6A 4HAMA 4ZYEA 1U5TC 2RKHA 1K78B 2COMA 1MDMA 1REPC 2IPQX 2TDXA 2EV0A 5LGNA 5BMZA 2LNBA 1HBXG 3ML6A 3QU3A 1ONVA 4JBAA 3HSFA 3DV8A 4KN4X 3KP2A 2L54A 1BN5A 2EFPA 4OU0A 1T38A 3WTUC 2VT2A 3O2PE 3JAMZ 5L3CA 4LB5A 3EYIA 2L3DA 2VXZA 5DCFA 3W6KB 2DPUA 2P7VB 1TQMA 1F9NA 3GFIA 3TQNA 4M6YA 4ENMA 3GXOA 3SZPA 1A04A 1O7FA 4LGWA 5DD8A 4KFCA 3VFZA 3K69A 3NRVA 3HTSB 2OZUA 4U0YA 1BI2A 2QBYB 2V9VA 3B73A 3BY6A 2L01A 1NHAA 5FO5A 5FD6A 4ENNA 3J80Z 2W25A 4HDUA 3HRUA 3WTTC 1U78A 2YPRA 4HV5A 5LHHA 1SAXA 2GA1A 4Y15A 2QQ9A 5DUKA 4FX0A 1XGSA 4A5NA 3DXJF 2VOOA 1SFUA 5D8LB 1USSA 1OR7A 1R23A 1QZZA 2IJLA 5KK1A 2D45A 2MH9A 1BOAA 1YIOA 1HKQA 3FWEA 4OIQF 5K1YA 3RPUA 3I71A 4EJVA 3Q9SA 5JR3A 4WX9A 2EFWA 3P7NA 4QWQA 5D8KB 4LJZF 4OIPF 2M5WA 1FZPB 3REOA 4EV0A 2VODA 2ETHA 3RKXA 2BYVE 4NB5A 3ZPLA 3U2RA 5DEQA 3MFKA 4A6EA 1I1SA 3R4KA 4A0ZA 1BI1A 3ZMVA 1UB9A 4DQ2A 4U7DA 3COAC 1BI0A 2DK5A 5E1WA 1STZA 1TQIA 3DEUA 1G3SA 1OKRA 3TGNA 1HSJA 3WE3A 4HDVA 4LD5A 4BYYA 1W7PA 1IXCA 4QLCU 2STWA 2PQ8A 4R8HA 3ECHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9V A;  4JQF A;  1OYI A;  4R79 A;  2Z3Y A;  1W4M A;  5CLS A;  2CFX A;  3GO5 A;  1I5Z A;  1FPQ A;  1B59 A;  1ZRF A;  3WTS C;  3HHG A;  1TTY A;  1SD4 A;  2AXL A;  1KU9 A;  1K78 A;  3NEU A;  5JI6 A;  2HYG D;  2OD5 A;  2P6T A;  2D1V A;  2A6E F;  1Q1H A;  2M45 A;  1TNS A;  5JFR A;  2FOK A;  1QZY A;  2CO5 A;  2LDU A;  4N9H A;  1EH6 A;  5CVU A;  1J9I A;  1ZRD A;  1P2F A;  2M30 A;  2A6H F;  3K0L A;  5HOO A;  2IT0 A;  5ICF A;  2PBI A;  1CF7 B;  2GQQ A;  3CLO A;  3IHU A;  4NQW A;  1P4A A;  2BV6 A;  4MQ9 F;  3QP5 A;  3BJA A;  3JTG A;  4LK1 F;  3ERE D;  2XUB A;  4U7B A;  1J2X A;  3EYY A;  4CXF A;  2OQR A;  2ZJ2 A;  2QBY A;  3IKV A;  4MTE A;  4P96 A;  4M72 A;  1W5S A;  2DQR A;  5L3E A;  1O3S A;  3L7W A;  5FFX A;  2WWY A;  1YTY A;  3ZN1 A;  3K1M A;  4MGR A;  3QP6 A;  3K9T A;  1G3T A;  4PGH A;  4WWC A;  4NHJ A;  3N97 A;  3C7J A;  2EV6 A;  1FP2 A;  2PJP A;  1BBY A;  1MDM B;  2UXX A;  2VOP A;  3WGI A;  4RGU A;  4O5V A;  4G94 A;  4KMF A;  4AWX B;  4LLG F;  5HLG A;  2XRO A;  3H3Z A;  5LLQ A;  4CO8 A;  2A3S A;  3I4P A;  2NRA C;  4GXO A;  5HS9 A;  2FSW A;  3ISP A;  3GVA A;  2FNA A;  1WKM A;  3Q5F A;  3CUQ B;  4ZZD A;  1XMA A;  1ZGJ A;  3VOD A;  2DFI A;  3WGH A;  5CVI A;  1MGT A;  5D5W B;  2XKO A;  4IHS A;  2QQA A;  2R7D A;  4KIF A;  1GXQ A;  2KJC A;  5E1X A;  3DKW A;  2E7W A;  2OAZ A;  3RKY A;  5J8C A;  2K4J A;  4HF2 A;  1LDJ A;  1S29 A;  1TBX A;  3HIF A;  1IW7 F;  1B6A A;  1H9G A;  4Q47 A;  4XRF A;  1DPR A;  3KET A;  1D5V A;  1FBU A;  1ODD A;  2FBH A;  4IRG A;  3L00 A;  3MZH A;  1LVA A;  5HS8 A;  4ENJ A;  2HR3 A;  1BC7 C;  3IL2 A;  3JTH A;  3KLN A;  5JVT A;  1FT9 A;  1P92 A;  3JAM K;  4XLP F;  1XDS A;  2ZFW A;  2JSC A;  3GFL A;  3TO9 A;  4HQE A;  5DDG A;  1ON2 A;  2XKP A;  3HTU A;  4ESJ A;  2FXA A;  2ZNY A;  2ZNZ A;  4CHU A;  5E18 F;  4MHG A;  4HF0 A;  4XLN F;  1ZG1 A;  1R7J A;  2H6C A;  3KZY A;  3F23 A;  1IXR C;  3TO6 A;  1RNL A;  2K02 A;  3RPQ A;  3WTY C;  4BH9 A;  1FSH A;  2MLG A;  2XAH A;  3IWZ A;  1KYZ A;  5L3F A;  1YO5 C;  2EK5 A;  1ZGA A;  1ZHF A;  3MEX A;  1ZN2 A;  4KIC A;  2J5P A;  3EQL F;  1YYV A;  1P4X A;  4CGZ A;  2E7X A;  2O61 A;  3QAH A;  3E6C C;  2PMU A;  2CW0 F;  1R22 A;  2H6B A;  1HW5 A;  1T39 A;  5TRD A;  3W6J B;  1RUN A;  4AD9 A;  5ILU A;  3MQ0 A;  4I0B A;  1CF7 A;  2ZBK A;  4HOB A;  1UHM A;  1EH8 A;  3F6V A;  1TNT A;  3BJO A;  3VB2 A;  1JXS A;  1O3T A;  1I27 A;  1LB2 A;  2VT3 A;  3F21 A;  4Q5S F;  3RIR A;  2XAQ A;  2PFB A;  5FFZ A;  3DP7 A;  1IN7 A;  1SFE A;  4MTD A;  2ELH A;  3WU0 A;  1E2X A;  4G8X A;  1MKM A;  1YS7 A;  2YX4 A;  4WCG A;  1SD5 A;  2V1X A;  1BI3 A;  2RC4 A;  1HKS A;  1G4D A;  2DTR A;  2OU2 A;  2LF8 A;  2ISZ A;  1R58 A;  2PMH A;  3DQV C;  2JZY A;  4HX7 A;  1YS6 A;  3FHZ A;  4HZF A;  3KEO A;  4BHC A;  4RS8 A;  4FT8 A;  4BNC A;  4L9J A;  4BAY A;  2GXB A;  1Z6R A;  4YIF A;  2NYX A;  4UVB A;  3EUH A;  2A61 A;  3HOS A;  3FM3 A;  2G7H A;  1HW1 A;  2IA0 A;  3CUQ A;  1P6R A;  4HQM A;  4L9T A;  1R36 A;  3T1B A;  3HRS A;  5HVQ C;  4PDK A;  5AIQ A;  4RB3 C;  1WSU A;  2NNN A;  3KP6 A;  4H0E A;  4N9I A;  1WWX A;  4RGR A;  3S2W A;  4G7O F;  2DBB A;  2XHK A;  2GWR A;  3BPV A;  4HV6 A;  2P4W A;  2XGX A;  2LF7 A;  5BS6 A;  4Y17 A;  2Q8K A;  1R5H A;  2G9W A;  1BM9 A;  1P4W A;  1BJA A;  1XCB A;  3FMR A;  4ZYD A;  4GYG A;  4HLY A;  3FF5 A;  2RV8 A;  4WXH A;  1MJA A;  3L9F A;  3M8F A;  1BC8 C;  1YQA A;  4EGY A;  4I09 A;  5FB2 A;  4P5O A;  3BJ6 A;  1TQP A;  4I02 A;  3J81 K;  3IC7 A;  5F1R A;  1V4R A;  1PUE E;  1K79 A;  3FMQ A;  5HLH A;  1HXD A;  2XVC A;  3MAJ A;  5CVR A;  1KA8 A;  3BZ6 A;  2Z33 A;  1PDN C;  3RTR A;  2K86 A;  3F8F A;  2KRF A;  3ZP5 A;  5HDG A;  2XV4 S;  2ISY A;  5D4S A;  3QPT A;  3CO6 C;  1SMT A;  5CVV A;  1KU3 A;  5LGU A;  3E6M A;  5FD5 A;  3R6S A;  3KZZ A;  1QQI A;  5LHI A;  4G9Y A;  2W24 A;  1YW9 A;  1YLF A;  3E6D A;  4UVC A;  1KYW A;  2DO7 A;  4ESB A;  2ZCW A;  2PN6 A;  4ENK A;  1R1U A;  4RB1 A;  2L4M A;  1LQ1 A;  3CUQ C;  4EGZ A;  2EFN A;  3ABT A;  4S05 A;  3TDU C;  2UZK A;  4LLN A;  4U0W A;  2LSO A;  1T0F A;  3IRR A;  2F5F A;  3E5Q A;  4Q4Z F;  5ICC A;  2YSR A;  2ADU A;  1JHF A;  1JHH A;  5BOX A;  1IN4 A;  1FWZ A;  3GFM A;  4GGG A;  1XD7 A;  1FBQ A;  3KP5 A;  1ULY A;  2EWN A;  5IT3 A;  2P5K A;  3CDH A;  4I01 A;  3V7R A;  4A0X A;  5LGT A;  2ZKZ A;  3EDP A;  4U88 A;  4CIC A;  2ZXJ A;  4G6Q A;  1Z7U A;  5HDK A;  3QOP A;  2Q2E A;  1IN8 A;  1UST A;  3DF8 A;  1FC3 A;  2QUF A;  1DDN A;  2FBK A;  2RVC A;  1FSE A;  5HLI A;  5LRS A;  2KIM A;  1K6O A;  3P9K A;  3GW2 A;  1F4K A;  4LFU A;  2HOE A;  4P9F A;  5E8G A;  3F6O A;  2XAG A;  3F8M A;  2FNP A;  3GEZ A;  2H94 A;  2FA5 A;  5LEJ A;  3R60 A;  2WV0 A;  2UXN A;  5DYM A;  1S3J A;  3GF2 A;  3J81 Z;  2DAO A;  2QQB A;  1DUX C;  4PCQ A;  2FEZ A;  4UVA A;  3SFZ A;  2O3F A;  4L5J A;  3E97 A;  2LKP A;  3BWG A;  1FY7 A;  3DFG A;  4ZH4 F;  1IXS B;  1FP1 D;  1E17 A;  2Z9O A;  3I58 A;  4L18 B;  5E17 F;  2CSO A;  1O7L A;  5KVR A;  3I53 A;  1R00 A;  3WTZ A;  1ZLK A;  3IRQ A;  1HQC A;  2JPC A;  3O6B B;  5J6X A;  1LNW A;  3H92 A;  2PEX A;  2MH2 A;  4LLL A;  4UUV A;  3V7C A;  1SMY F;  2V1U A;  4RB0 A;  3TDZ C;  1F1Z A;  2Q0O A;  4Y13 A;  4I2O A;  2P8T A;  5D5U B;  3E6B A;  2O6G E;  4K2E A;  3FXQ A;  2HWV A;  1S6L A;  3GZ5 A;  3G3Z A;  2QEN A;  4EQQ A;  1MZB A;  3SXY A;  4ETS A;  5ICE A;  1KU7 A;  2EFO A;  2VC1 A;  1KGS A;  1ZAO A;  4IPA A;  1XCV A;  4A6D A;  2VBZ A;  2PI0 A;  1ZRC A;  5A2Q K;  3M8E A;  1UHW A;  3KLO A;  5H6Q A;  1HW2 A;  4G7H F;  3JSO A;  2X0L A;  4IVN A;  4WF2 A;  1WI9 A;  1D3Y A;  2JPB A;  2Z99 A;  4KDP A;  3CUO A;  4LMY A;  2DK8 A;  3GWZ A;  1QNT A;  1D8K A;  4FHT A;  2CQK A;  5K5R A;  1UCR A;  3CO7 C;  1S8N A;  2DW4 A;  5IT9 K;  4HW0 A;  3T0Y A;  2NAZ A;  3J7A O;  2ZME A;  4YII A;  4ASN A;  4D0P A;  3LA2 A;  2Y48 A;  1T6S A;  4RGX A;  3HOT A;  1L3L A;  2IRF G;  1JE8 A;  5CVJ A;  3V8L A;  1KU2 A;  4S04 A;  4HBL A;  4EM2 A;  3WGG A;  5E1Z B;  2RN7 A;  3H3U A;  2Y75 A;  1FBS A;  1OYW A;  1S7O A;  5D6F A;  3ZN0 A;  3CTA A;  4AVP A;  1KQ0 A;  3F3X A;  3GLX A;  2OA4 A;  3LWF A;  4B8X A;  4KUM A;  1RIO H;  2DPD A;  3ECO A;  2NS0 A;  3FXU A;  5L3D A;  5ILV A;  1ZAR A;  4M9Z A;  6PAX A;  2QYO A;  2XAF A;  3G73 A;  4AIH A;  3TOA A;  1FOK A;  3SQN A;  1ZYR F;  3L09 A;  3ELK A;  2IVM A;  4AIJ A;  4MQV A;  2WTE A;  5JHU A;  2ACJ A;  2M87 A;  1IRF A;  3K1P A;  4L0Y B;  3I59 B;  3F8N A;  1XDU A;  4HX8 A;  2HQN A;  4A2U A;  2JTV A;  1R1V A;  2IA1 A;  3WOD F;  3D0S A;  3PQK A;  3LST A;  3GX4 X;  2O03 A;  4HLX A;  2QZ8 A;  4U0V A;  1Z05 A;  4I98 B;  2KIF A;  1MJB A;  3WU1 B;  1FLI A;  1GXP A;  2VBY A;  3I64 A;  3U1D A;  5A2Q Z;  2VE8 A;  2GIV A;  4KT5 C;  2FQ3 A;  5AON A;  4M73 A;  2VC0 A;  3PFI A;  4BXU A;  5D5V B;  1KQ8 A;  1EV7 A;  1ZG3 A;  3LQR A;  4GYI A;  1V3F A;  3ABU A;  2XAS A;  3P9C A;  1SD6 A;  2W85 A;  1LDD A;  2HKX A;  3I5U A;  1U2W A;  2M8E A;  5CJ9 A;  4IXA A;  1G3W A;  3ULQ B;  5IT9 Z;  2O8X A;  1L0O C;  4HA8 A;  4IF4 A;  1WRJ A;  3LFK A;  5ERI A;  4EVI A;  2STT A;  1SD7 A;  2K7L A;  3JSP A;  5L3B A;  3BP8 A;  1GHC A;  2PLY A;  3AAF A;  3K2Z A;  3PQJ A;  2XIG A;  4EJW A;  4HX4 A;  4EMS A;  2HTJ A;  3WTW C;  1HST A;  5ILS A;  4EM0 B;  4ZYH A;  2F2E A;  2R7F A;  1R5G A;  2KIU A;  1CGP A;  1ON1 A;  2E1N A;  2FF4 A;  3FX3 A;  4PZJ A;  3EET A;  2D2W A;  1O3Q A;  3KCC A;  2NNY A;  3HRT A;  4Z2Y A;  1H9T A;  4OIN F;  1X3U A;  2DLL A;  1IUY A;  4I0A A;  1W5T A;  1I1G A;  4G6D A;  4F7Z A;  2R3S A;  5LEK A;  1TW3 A;  3DPL C;  2F5E A;  2MBF A;  2EJR A;  5DCM B;  3TO7 A;  5LBQ A;  3E5X A;  2P7C B;  4BHB A;  3NQO A;  2FU4 A;  2FMY A;  4RGS A;  3BRO A;  4E70 A;  5AIP A;  1MD0 A;  3IWF A;  4UXN A;  5EEG A;  1IN5 A;  3LAP A;  2E1C A;  4MEY F;  4M71 A;  1FX7 A;  2MC3 A;  2K27 A;  3KFW X;  1DP7 P;  1QO0 D;  3ZMS A;  4EJT A;  3HHH A;  2VN2 A;  3Q9V A;  1K7A A;  2VE9 A;  3MCZ A;  3V7S A;  3GUD A;  3V4G A;  2HTS A;  3M7G A;  4L9N A;  2O0Y A;  3N4M A;  4JK1 X;  1LJ9 A;  2JT1 A;  2X4H A;  1BIA A;  2YX7 A;  2Z5U A;  2CWE A;  1IRG A;  3BPX A;  3I59 A;  1IAW A;  3L2C A;  3C3W A;  2OZ6 A;  4LK0 F;  4WK8 F;  2A69 F;  3BDD A;  2ZME B;  5BPI A;  1XSD A;  1FYM A;  3T5X A;  5F64 A;  3RKW A;  4MNU A;  1G6N A;  1J0R A;  5DUI A;  4ZYG A;  2EB7 A;  1H0M A;  4IHT A;  3TKY A;  2PG4 A;  4UV9 A;  5LHG A;  2H09 A;  3I54 A;  4KNY A;  3F8B A;  3M9A A;  4GCV A;  4KMU X;  1YW8 A;  2L02 A;  3RYP A;  4UNO A;  4ON0 A;  3I0T A;  5J8F A;  5E20 A;  1F5T A;  2IP2 A;  3ZMT A;  1AWC A;  3U9G A;  1T98 A;  1XMK A;  2KKO A;  4RAY A;  1FNN A;  4YFN F;  1XGM A;  3ROU A;  3FMS A;  3T8T A;  1YW7 A;  4L5I A;  1HKT A;  1C0W A;  3E5U A;  4BQA A;  5D5X B;  4YG2 F;  2FML A;  4EJU A;  3T8R A;  1QBJ A;  1ZRE A;  3RI4 A;  3SHF A;  1U5T B;  2QWW A;  1O57 A;  1AOY A;  4HYE A;  1TW2 A;  3ZMU A;  2CGP A;  2EFQ A;  2YR2 A;  4KIG A;  1MJ9 A;  2L4A A;  2HQR A;  2DI3 A;  5CYV A;  2D1H A;  2EA4 A;  5F6F A;  1IF1 A;  3KP7 A;  3GYH X;  2HEO A;  2HGC A;  4M74 A;  2ESN A;  4L0Z B;  2HKO A;  4LG0 B;  1B4A A;  4FX4 A;  2P6S A;  2FRH A;  2OQG A;  3B02 A;  5BPD A;  2HZT A;  3D5L A;  4MEX F;  2VBX A;  3TOB A;  2M1B A;  3F22 A;  5DV5 A;  3E3V A;  2J5O A;  4TV7 A;  1Z91 A;  4CYD A;  5DD4 A;  2ESH A;  4I7H A;  1QPM A;  2DU9 A;  5D4R A;  3R61 A;  2CYY A;  3CJN A;  5L3G A;  1JGS A;  1U3E M;  1J75 A;  4N0B A;  5DCM A;  4RB2 C;  3ZQ7 A;  2EV5 A;  5HS7 A;  1ZH5 A;  1XGO A;  4DNC A;  1FYK A;  3C18 A;  3KP3 A;  3VOE A;  4Q48 A;  4XBF A;  2VBW A;  2H27 A;  2JRT A;  5FLX K;  4RAZ A;  4KA4 A;  5LRR A;  2KJB A;  1UFM A;  3KEQ A;  3KE2 A;  3QU6 A;  3LA7 A;  3JW4 A;  3FXR A;  4PGG A;  2V79 A;  2XAJ A;  2F5C A;  1I6X A;  3HSR A;  3WTX C;  2DT5 A;  1D8J A;  5TJJ A;  2RNJ A;  2GAU A;  5K5Q A;  4UV8 A;  3BOQ A;  4BHP A;  4M9X A;  5ED4 A;  3SZT A;  4WXC A;  1GVJ A;  2RQP A;  1QGP A;  1LDK B;  2V1D A;  3FM5 A;  4P9U A;  3DPT A;  2GXG A;  2GA2 A;  5FGM A;  1IZ1 A;  1KQ9 A;  2MA3 A;  2A68 F;  3MWM A;  3V8J A;  1BIB A;  1Y0U A;  2A07 F;  4M6X A;  2BGC A;  1OPC A;  1U8R A;  4IRH A;  2K4B A;  2QLZ A;  3K1N A;  2HS5 A;  1Z1D A;  2BE5 F;  4HF1 A;  4EJO A;  4O3M A;  1VTN C;  1W7P D;  2XRN A;  1XGN A;  3WE2 A;  5BQT A;  1Z6T A;  3LA3 A;  2CG4 A;  5HDN A;  3VEP A;  1XB4 A;  3ZMD A;  1XSX A;  4KIB A;  4UHT A;  3HYI A;  4G7Z F;  2YU3 A;  3GZ6 A;  1J5Y A;  3FZV A;  4CDG A;  5EEH A;  3OOP A;  4IJA A;  3P9I A;  1YG2 A;  3WTV C;  3WG9 A;  4KYW A;  1YFH A;  3R0A A;  2HDC A;  3QRF F;  1PP8 F;  1G3Y A;  1PP7 U;  4B09 A;  2MD5 A;  1J7K A;  4OOI A;  3M1E A;  4O6J A;  4A0Y A;  1RI7 A;  5H6R A;  5H20 A;  2G7U A;  4ESF A;  2RDP A;  1ZG5 A;  3IKT A;  3RDI A;  3HRM A;  1S7A A;  1B1B A;  1U5T A;  1FYL A;  2EA2 A;  3LQQ A;  4ZZL A;  3GFJ A;  2AS5 F;  2VON A;  2F5D A;  3KP4 A;  1J59 A;  4YFK F;  1R1T A;  4OIR F;  3F8C A;  5D6E A;  1LEA A;  2QVO A;  2P5V A;  4AIK A;  3MZY A;  2BEO A;  5FLX Z;  1OYY A;  2ZO4 A;  3F72 A;  3OV8 A;  4A5M A;  2IW5 A;  4OMY A;  1XSV A;  2V6C A;  3ZMZ A;  2HFH A;  1O3R A;  2W84 A;  3V8K A;  4LG0 A;  1B9M A;  1WQ2 A;  2W57 A;  2Y0M A;  3RYR A;  1RUO A;  2HYF A;  4LB6 B;  3J80 K;  2FE3 A;  2OBP A;  3RJP A;  4XSZ F;  1U6G A;  5K5O A;  1Z9C A;  2FBI A;  1EH7 A;  4IRI A;  1RZ4 A;  4WXD A;  4EM1 A;  4M9S A;  5E8I A;  2GZW A;  4GO1 A;  4YFX F;  2C6Y A;  4P55 A;  2B0L A;  1XN7 A;  2UWM A;  2DQL A;  3HUG A;  3C1D A;  1DPU A;  4OMZ A;  2P5L C;  4OIO F;  1W7P B;  2WC2 A;  3LAJ A;  1T2K A;  3R0J A;  3O3K A;  1SFX A;  4R1H A;  3HSE A;  2RGV A;  2BBY A;  4KN7 X;  1ZLJ A;  2QM3 A;  1OMI A;  2IA2 A;  1LEB A;  2MLK A;  4A12 A;  4XSX F;  1TLH B;  5ICG A;  1B9N A;  3QPH A;  4CZZ A;  2A5Y B;  1IN6 A;  4HAM A;  4ZYE A;  1U5T C;  2RKH A;  1K78 B;  2COM A;  1MDM A;  1REP C;  2IPQ X;  2TDX A;  2EV0 A;  5LGN A;  5BMZ A;  2LNB A;  1HBX G;  3ML6 A;  3QU3 A;  1ONV A;  4JBA A;  3HSF A;  3DV8 A;  4KN4 X;  3KP2 A;  2L54 A;  1BN5 A;  2EFP A;  4OU0 A;  1T38 A;  3WTU C;  2VT2 A;  3O2P E;  3JAM Z;  5L3C A;  4LB5 A;  3EYI A;  2L3D A;  2VXZ A;  5DCF A;  3W6K B;  2DPU A;  2P7V B;  1TQM A;  1F9N A;  3GFI A;  3TQN A;  4M6Y A;  4ENM A;  3GXO A;  3SZP A;  1A04 A;  1O7F A;  4LGW A;  5DD8 A;  4KFC A;  3VFZ A;  3K69 A;  3NRV A;  3HTS B;  2OZU A;  4U0Y A;  1BI2 A;  2QBY B;  2V9V A;  3B73 A;  3BY6 A;  2L01 A;  1NHA A;  5FO5 A;  5FD6 A;  4ENN A;  3J80 Z;  2W25 A;  4HDU A;  3HRU A;  3WTT C;  1U78 A;  2YPR A;  4HV5 A;  5LHH A;  1SAX A;  2GA1 A;  4Y15 A;  2QQ9 A;  5DUK A;  4FX0 A;  1XGS A;  4A5N A;  3DXJ F;  2VOO A;  1SFU A;  5D8L B;  1USS A;  1OR7 A;  1R23 A;  1QZZ A;  2IJL A;  5KK1 A;  2D45 A;  2MH9 A;  1BOA A;  1YIO A;  1HKQ A;  3FWE A;  4OIQ F;  5K1Y A;  3RPU A;  3I71 A;  4EJV A;  3Q9S A;  5JR3 A;  4WX9 A;  2EFW A;  3P7N A;  4QWQ A;  5D8K B;  4LJZ F;  4OIP F;  2M5W A;  1FZP B;  3REO A;  4EV0 A;  2VOD A;  2ETH A;  3RKX A;  2BYV E;  4NB5 A;  3ZPL A;  3U2R A;  5DEQ A;  3MFK A;  4A6E A;  1I1S A;  3R4K A;  4A0Z A;  1BI1 A;  3ZMV A;  1UB9 A;  4DQ2 A;  4U7D A;  3COA C;  1BI0 A;  2DK5 A;  5E1W A;  1STZ A;  1TQI A;  3DEU A;  1G3S A;  1OKR A;  3TGN A;  1HSJ A;  3WE3 A;  4HDV A;  4LD5 A;  4BYY A;  1W7P A;  1IXC A;  4QLC U;  2STW A;  2PQ8 A;  4R8H A;  3ECH A; 
#chains in the Genus database with same CATH topology
 1SEU A;  4L9V A;  4JQF A;  1VQ6 I;  5EDN A;  1OYI A;  4XN3 A;  4R79 A;  2Z3Y A;  3L2W A;  1W4M A;  4XOR A;  2L5Q A;  2WAD A;  2OC6 A;  5CLS A;  5J4Y A;  1JJ6 C;  5FKO A;  2CFX A;  4HSR A;  1X3Z B;  3VYT B;  4AVZ A;  3GO5 A;  1I5Z A;  1YIJ I;  1FPQ A;  2ZFU A;  2F4I A;  3G2B A;  2LVS A;  1B59 A;  2R7Z J;  1ZRF A;  3HBL A;  2NS8 A;  3WTS C;  3WG7 H;  2H8R A;  3HHG A;  3BR0 A;  3OYJ A;  1ZGW A;  1IG7 A;  2VLA A;  1OR7 C;  1TTY A;  1SD4 A;  3M3Y J;  2AXL A;  1KU9 A;  2IGK A;  3HGY A;  3CMM A;  1K78 A;  2R7U A;  1LFB A;  1XS9 A;  1Y1W J;  1FTZ A;  2MYS A;  1IDZ A;  3HZJ A;  3NEU A;  2LH9 A;  5FLV A;  5JI6 A;  1IGN A;  2HYG D;  1TWC J;  2OD5 A;  2P6T A;  2MFZ A;  2PX9 A;  5IP9 J;  3A01 A;  3KYD B;  2D1V A;  3PIP F;  1VFC A;  2A6E F;  1Q1H A;  2M45 A;  3DEW A;  1TNS A;  5EZG A;  3S15 J;  5JFR A;  1U9N A;  2FOK A;  3GTJ J;  1QZY A;  2CO5 A;  2D5V A;  5GAD J;  4BDZ A;  2LDU A;  4GRI A;  4N9H A;  3H5N A;  1BJZ A;  1G59 A;  3NAR A;  1EH6 A;  5CVU A;  1J9I A;  1ZRD A;  1MH3 A;  4CH7 A;  1P2F A;  2M30 A;  3OL3 A;  4C2U A;  2A6H F;  2GIZ A;  3QPS A;  3LSR A;  5DTD A;  1IC8 A;  2LRE A;  3K0L A;  4NBQ A;  4Y3O A;  2CQX A;  5HOO A;  2X6X A;  2VQL A;  2JA5 J;  3CF5 F;  2IT0 A;  4EAT A;  3HG9 A;  4PJ0 C;  4V2G A;  2PBI A;  5ICF A;  1CF7 B;  1BW5 A;  2R7X A;  3ZRG A;  3PSF A;  3HUG B;  2GQQ A;  3CLO A;  4BJT A;  3IHU A;  4NQW A;  4J00 A;  1WJC A;  1P4A A;  1EJ9 A;  3L2V A;  3OYD A;  2BV6 A;  4MQ9 F;  3QP5 A;  1QHG A;  3BJA A;  3JTG A;  4LK1 F;  2IS4 A;  3B6C A;  3ERE D;  3CC4 I;  5KNL A;  4BEH A;  2JJ7 A;  2XUB A;  4QPQ A;  4U7B A;  4RA2 A;  1WI3 A;  5EEA A;  1J2X A;  2HOT A;  1OCZ H;  2VQH A;  3K4M A;  4CCK A;  3S1Q J;  3EYY A;  2DMP A;  3OOU A;  4PFO A;  4CXF A;  3WU2 C;  2OQR A;  1K6Y A;  2ZJ2 A;  2BW3 B;  2QBY A;  3IKV A;  4MTE A;  4P96 A;  4M72 A;  2KDZ A;  1W5S A;  2DQR A;  5L3E A;  1O3S A;  4IHY A;  3L7W A;  5FFX A;  1A5J A;  4CCN A;  2WWY A;  1YTY A;  3MVP A;  2X1C A;  3ZN1 A;  3K1M A;  4MGR A;  3QP6 A;  3K9T A;  1G3T A;  1NG7 A;  4PGH A;  2L9N A;  3HPH A;  4FE7 A;  5KAI C;  4WWC A;  2CMP A;  2VL8 A;  3N97 A;  4NHJ A;  3C7J A;  2EV6 A;  2HOS A;  1FP2 A;  5F0H A;  3SJM A;  2PJP A;  1BBY A;  1MDM B;  4B4C A;  1NH3 A;  2UXX A;  2VOP A;  3WGI A;  1ENH A;  4XLH A;  1VQM I;  4RGU A;  4O5V A;  2VQC A;  2ECC A;  2VAS A;  4G94 A;  4KMF A;  3OSG A;  4AWX B;  4LLG F;  5HLG A;  3H9J A;  2KIS A;  2XRO A;  4BY7 J;  5B66 C;  3H3Z A;  5LLQ A;  2XB5 A;  2XSD C;  4CO8 A;  5FKM A;  2DA4 A;  2A3S A;  4Y4R A;  2GOX B;  4A3L J;  3I4P A;  2DFF A;  2XC7 A;  4E7I A;  1K83 J;  3QYF A;  2QF7 A;  2NRA C;  1DU6 A;  2R5Y A;  2KMU A;  4GXO A;  5HS9 A;  2FSW A;  3ISP A;  4E7S A;  1MMG A;  3GVA A;  2FNA A;  4IO9 F;  5J1Y A;  1AA7 A;  1D0X A;  1WKM A;  3W2A A;  1TWF J;  1MBH A;  3Q5F A;  1GDT A;  2ID3 A;  3CUQ B;  3L2Q A;  1H8A C;  4ZZD A;  1XMA A;  4BAC A;  5F08 A;  1UAA A;  1ZGJ A;  3VOD A;  2DFI A;  2G0E A;  2WBM A;  1HC8 A;  3WGH A;  5HLT A;  5CVI A;  1MGT A;  5F0F A;  1OQY A;  3RSN A;  3CF2 A;  5D5W B;  1X2N A;  2XKO A;  4IHS A;  2QQA A;  2R7D A;  4BXX J;  4KIF A;  1GXQ A;  2KJC A;  2CV1 A;  5E1X A;  4GDF A;  3DKW A;  3OYF A;  2E7W A;  2EZK A;  1K4T A;  4GFB A;  2OAZ A;  2KRH A;  1MW7 A;  2X9D A;  3RKY A;  3PO2 J;  5J8C A;  4RM2 A;  2K4J A;  4HF2 A;  1LDJ A;  1S29 A;  3CP8 A;  1TBX A;  3HIF A;  1IW7 F;  4M3E A;  1JKP C;  5IYD J;  1B6A A;  1H9G A;  2L7K A;  4Q47 A;  2E1M C;  3FDY A;  4XRF A;  2FOW A;  2X1D A;  1B8I B;  4M3B A;  3L2U A;  1DPR A;  1X1D A;  2DYS H;  3KET A;  1D5V A;  1FBU A;  1ODD A;  4XKV A;  2BXY A;  2FBH A;  2PJR B;  2AQE A;  4IRG A;  2F48 A;  1YRN B;  3L00 A;  3MZH A;  3BR1 A;  1LVA A;  2COB A;  3HPG A;  1YJ9 I;  5HS8 A;  1KON A;  4ENJ A;  3BTI A;  1YX3 A;  4RLF A;  1VQP I;  2HR3 A;  3OYE A;  1BC7 C;  3IL2 A;  1BR4 A;  2OTL I;  3JTH A;  3JRH A;  3J7Z I;  3L2R A;  3KLN A;  5JVT A;  1V5G A;  1PYV A;  1FT9 A;  1P92 A;  1VQL I;  3JAM K;  4XLP F;  1XDS A;  2TRT A;  1ETO A;  2I5U A;  2ZFW A;  4FE4 A;  2JSC A;  4HNU A;  1ZKG A;  2AO9 A;  2JWT A;  3GFL A;  2XPW A;  4YEJ A;  3TO9 A;  3WHC A;  4HQE A;  5DDG A;  1ON2 A;  2XKP A;  2ZXH A;  3KYL A;  4CYC B;  3HTU A;  4ESJ A;  2FXA A;  3K4K A;  1JUM A;  1Y56 A;  4C30 A;  5M5W J;  4MO7 A;  2ZNY A;  2ZNZ A;  3PL8 A;  1QZE A;  4CHU A;  5J4V A;  2DA5 A;  4DGW B;  2K3P A;  2EIK H;  4MHG A;  5E18 F;  1D5Y A;  4HF0 A;  4XLN F;  1ZG1 A;  1Z0X A;  1R7J A;  2H6C A;  3ESW B;  3KZY A;  3F23 A;  3QPL A;  4MLO A;  3K2A A;  1R6R A;  1IXR C;  3TO6 A;  2R7S A;  1YX5 A;  1RNL A;  2K02 A;  3RPQ A;  1OCT C;  5EF6 A;  3WTY C;  2VIX A;  4BH9 A;  1R9T J;  2R0Q C;  2CUE A;  1OIS A;  1FSH A;  2MLG A;  2XAH A;  3IWZ A;  1KYZ A;  5L3F A;  1YO5 C;  4OAZ A;  2EK5 A;  1ZGA A;  3AG3 H;  1ZHF A;  2YUS A;  4B3A A;  1W36 C;  3MEX A;  4KJZ A;  5J1U A;  1UG2 A;  3CJT B;  1ZN2 A;  4KIC A;  3DU6 A;  2J5P A;  1T33 A;  3E0J B;  5GTH C;  3EQL F;  5GAE J;  2DOF A;  3IV5 A;  2EZI A;  5CPR B;  1YYV A;  1SVL A;  1P4X A;  5B3S H;  3RZO J;  4KIS A;  4CGZ A;  4W97 A;  2E7X A;  3CD6 I;  2O61 A;  1RES A;  3QAH A;  3LSI A;  3KYC B;  2PMU A;  3E6C C;  1YJW I;  2CW0 F;  1R22 A;  4BXF A;  2H6B A;  5EZH A;  1HW5 A;  1T39 A;  5TRD A;  3W6J B;  1RUN A;  4AD9 A;  5ILU A;  3MQ0 A;  4I0B A;  1CF7 A;  3ASN H;  2ZBK A;  5IYB J;  5LD2 C;  4HOB A;  4ZDP A;  3QOD A;  3HDD A;  1UHM A;  1UJ8 A;  1EH8 A;  4UUT A;  3F6V A;  2DOE A;  2CQQ A;  1M1E B;  5J40 A;  1TNT A;  2XPU A;  3BJO A;  3VB2 A;  5K7F A;  3ZQQ A;  1X1A A;  5TGT A;  1JXS A;  3ZQH A;  3CCL I;  1O3T A;  4M3F A;  2VKV A;  4CA0 A;  1I27 A;  5C4J J;  1LB2 A;  2VT3 A;  3F21 A;  4Q5S F;  3BR6 A;  2XAQ A;  3RIR A;  2PFB A;  4UB8 C;  3DP7 A;  5FFZ A;  2Q2E B;  2M4G A;  2X6O A;  3PNY A;  1IN7 A;  1SFE A;  4MTD A;  2ELH A;  3WU0 A;  2XRL A;  1LPQ A;  3H3V K;  2JQ7 A;  1E2X A;  2L9R A;  4G8X A;  1MKM A;  1YS7 A;  1SAU A;  2YX4 A;  4WCG A;  2BW3 A;  1SD5 A;  2V1X A;  1BI3 A;  5M5Y J;  2RC4 A;  1JUP A;  1HKS A;  3GLL A;  2YS9 A;  2QQ8 A;  2EPF A;  1G4D A;  2DTR A;  3G1L A;  4M3D A;  2OU2 A;  2M2E A;  3M07 A;  3ABL H;  3OYH A;  2LF8 A;  2ISZ A;  1R58 A;  2PMH A;  2XF6 A;  2FJ1 A;  3DQV C;  3S1R J;  2JZY A;  1W5C C;  1WJA A;  3OWT A;  2UUZ A;  4HX7 A;  1YS6 A;  3FHZ A;  4HZF A;  3KEO A;  3ZQG A;  4N4N B;  4BHC A;  4NC8 A;  5GP9 A;  5FRM A;  2ELK A;  4RS8 A;  2EIN H;  1UG0 A;  2VXD A;  4FT8 A;  3FIW A;  4BNC A;  4L9J A;  4BAY A;  2VKD A;  3JRC A;  3G1M A;  2GXB A;  1Z6R A;  4YIF A;  2EIL H;  2NYX A;  1N75 A;  4UVB A;  3OMY A;  3D5R C;  3EUA A;  4ZTJ A;  2QCO A;  3EUH A;  1Y6I A;  2A61 A;  3HOS A;  3FM3 A;  1K61 A;  2G7H A;  5FKK A;  1WJD A;  3S14 J;  2GM4 A;  1HW1 A;  1MSF C;  2IA0 A;  3I4M J;  3TP3 A;  1ZTR A;  3CUQ A;  1P6R A;  5J1R A;  2AXT C;  3OIQ A;  4HQM A;  4L9T A;  1R36 A;  1OJL A;  3T1B A;  3HRS A;  5HVQ C;  2CW7 A;  4PDK A;  5JLX A;  2XPV A;  5AIQ A;  4RB3 C;  5M3M J;  1WSU A;  2GOM A;  2NNN A;  1E3O C;  3KP6 A;  3VYS B;  4DYR A;  4H0E A;  1RC9 A;  4N9I A;  1WWX A;  4RGR A;  3S2W A;  4G7O F;  2DBB A;  2XHK A;  2GWR A;  3BPV A;  4HV6 A;  4NNJ A;  2HDD A;  2JVH A;  3O8H A;  2P4W A;  5FJ8 J;  3AFH A;  4BBR J;  2DDB A;  2XGX A;  2LF7 A;  5BS6 A;  1DGW Y;  5E3M A;  2OCC H;  3QYB A;  4Y17 A;  2Q8K A;  1HF0 A;  1R5H A;  2G9W A;  1BM9 A;  1P4W A;  4XLF A;  1BJA A;  1XCB A;  1WGX A;  3FMR A;  1DU0 A;  4ZTF A;  4ZYD A;  4IZZ A;  1R4N B;  4GYG A;  4HLY A;  1B8I A;  5GPA A;  2W48 A;  2GBY A;  3FF5 A;  1FIA A;  2RV8 A;  4WXH A;  1MJA A;  3L9F A;  3M8F A;  1BC8 C;  1YQA A;  2PJR A;  4UB6 C;  2BY0 A;  3K4N A;  4EGY A;  3LSK A;  1EA3 A;  4I09 A;  5FB2 A;  4P5O A;  3BJ6 A;  1YRN A;  1TQP A;  3GTL J;  4I02 A;  1WZ2 A;  3J81 K;  4XQF A;  3FK6 A;  3IC7 A;  2CU7 A;  1OCP A;  5F1R A;  3OS0 A;  1V4R A;  1PUE E;  1K79 A;  4PJL A;  3K4J A;  3FMQ A;  5HLH A;  1TT5 B;  1X1C A;  1MIJ A;  1HXD A;  2CRG A;  4BU2 A;  2XVC A;  1WCM J;  2X1E A;  2E35 A;  3MAJ A;  5CVR A;  1KA8 A;  2R7O A;  3BZ6 A;  1AU7 A;  2Z33 A;  4LG3 A;  4JOM A;  3GTK J;  3CCM I;  1PDN C;  3RTR A;  2DN0 A;  2K86 A;  3F8F A;  2QSG X;  2KRF A;  2Y0S N;  3ZP5 A;  1PUF A;  2JA7 J;  5HDG A;  2DDA A;  4V19 K;  2XV4 S;  2ISY A;  3UR3 C;  5D4S A;  3QPT A;  4CYC A;  3CO6 C;  1SMT A;  1DQU A;  3GTG J;  2XDV A;  5CVV A;  1KU3 A;  5LGU A;  3E6M A;  2QKM B;  3DBH B;  3FXM A;  3K10 A;  3BTL A;  5FD5 A;  3LOC A;  3R6S A;  3KZZ A;  1QQI A;  5LHI A;  4G9Y A;  2W24 A;  1YW9 A;  5F0C A;  1YLF A;  3E6D A;  3I4N J;  2IXS A;  3C2B A;  4UVC A;  1KYW A;  2DO7 A;  3EUH C;  4ESB A;  4AUX A;  2ZCW A;  3S8P A;  2PN6 A;  1KZH A;  4ENK A;  1TL8 A;  1R1U A;  4XRS G;  2L4M A;  4RB1 A;  1LQ1 A;  2LOO A;  2HNH A;  3CUQ C;  4EGZ A;  2HI3 A;  2N8G A;  2EFN A;  3ABT A;  1I6H J;  2R5Z B;  3S3N A;  4S05 A;  3CMA I;  3TDU C;  2UZK A;  1Y39 A;  1UMQ A;  4DBR A;  2RAE A;  4LLN A;  3CCV I;  1ZEL A;  4U0W A;  4PUS A;  2LSO A;  1BR1 A;  1T0F A;  3IRR A;  2F5F A;  1MNM C;  3ZCO A;  3E5Q A;  2ZSI B;  4Q4Z F;  4BS9 A;  2I8D A;  4II3 A;  2YSR A;  5ICC A;  4XRS A;  3OYI A;  3OYN A;  3OYG A;  1JHF A;  2ADU A;  1R71 A;  1JHH A;  3GME A;  5BOX A;  1IN4 A;  1FWZ A;  1U8B A;  3GFM A;  4GGG A;  1XD7 A;  5EGO B;  1J09 A;  1FBQ A;  3KP5 A;  1ULY A;  2EWN A;  1YOV B;  5IT3 A;  2P5K A;  3CDH A;  4I01 A;  4A3F J;  3V7R A;  4A0X A;  2VI6 A;  3IP4 B;  5LGT A;  4CCL A;  2ZKZ A;  1QPI A;  3S2D J;  3EDP A;  2DYR H;  5IOY A;  4U88 A;  2HYJ A;  4AID A;  4CIC A;  2E2H J;  2ZXJ A;  4XKB A;  5IPA A;  4G6Q A;  1Z7U A;  3HGG A;  5HDK A;  3QOP A;  1Z3X A;  2Q2E A;  1Z7L A;  3PIO F;  2DJN A;  3CCE I;  1IN8 A;  1UST A;  3DF8 A;  1EKE A;  1FC3 A;  1JT6 A;  2QUF A;  1DDN A;  2MC4 A;  2FBK A;  3S93 A;  2RVC A;  5IP6 A;  1FSE A;  4DJA A;  2LLK A;  3OIO A;  4XLE A;  3ZQI A;  5HLI A;  5LRS A;  3A03 A;  3TMO A;  4YRV A;  2KIM A;  3JRB A;  2BY1 A;  1K6O A;  2O9L A;  4A3M J;  3P9K A;  1JI8 A;  4XIC A;  2ID6 A;  2Y2Z A;  3GW2 A;  1F4K A;  4LFU A;  4E7L A;  2HOE A;  4P9F A;  5E8G A;  3F6O A;  3JRG A;  1H88 C;  4HPQ A;  2XAG A;  3F8M A;  2FNP A;  3P5J A;  2FD5 A;  1VQ4 I;  4Y33 A;  3GEZ A;  2H94 A;  2FA5 A;  5LEJ A;  3R60 A;  2WV0 A;  3U1K A;  2HDW A;  2UXN A;  1HDD C;  5DYM A;  1S3J A;  4BGD A;  3HXL A;  4RAG A;  3GF2 A;  3J81 Z;  2LKX A;  1HA8 A;  2DAO A;  2L0K A;  2QQB A;  3IH4 A;  3O8G A;  4X1E A;  2DJI A;  3AL0 B;  2NS7 A;  1DUX C;  4AYB N;  4PCQ A;  4DYC A;  2FEZ A;  4UVA A;  1JUS A;  3SFZ A;  2O3F A;  4L5J A;  4D1Q A;  4A93 J;  1PJR A;  2BXZ A;  3E97 A;  2LKP A;  1IUF A;  3BWG A;  3PUB A;  3DEE A;  1FY7 A;  1T0F C;  4IHW A;  3DFG A;  4ZH4 F;  1IXS B;  4A3C J;  1FP1 D;  1E17 A;  2Z9O A;  3I58 A;  2DFH A;  1WH7 A;  4L18 B;  5E17 F;  2CSO A;  3X2Q H;  3OYK A;  2VPL A;  1O7L A;  5KVR A;  3I53 A;  1ETK A;  4E4H A;  2VJI A;  3BQZ A;  1R00 A;  3DU5 A;  4QSH A;  3WTZ A;  1ZLK A;  3IRQ A;  1HQC A;  2JPC A;  3O6B B;  3LSP A;  4FQG A;  5J6X A;  1LNW A;  4RMN A;  1TZL A;  3H92 A;  2PEX A;  2MH2 A;  4LLL A;  2CFO A;  3OYL A;  4XMY A;  4UUV A;  1LE8 B;  2K9L A;  4N4O B;  3H9G A;  5GTI C;  4V2F A;  3V7C A;  1SMY F;  2V1U A;  4A3I J;  2KRC A;  4RB0 A;  2WAE A;  3TDZ C;  1F1Z A;  2Q0O A;  1APL C;  4Y13 A;  2K9S A;  1JKQ C;  2CUF A;  2RNG A;  3PM1 A;  4I2O A;  1XC5 A;  1JKO C;  4LIV A;  2Y0S A;  4JP0 A;  2P8T A;  2HQA A;  3GCM A;  4DIQ A;  5D5U B;  3E6B A;  2O6G E;  4B47 A;  4K2E A;  3FXQ A;  2HWV A;  1S6L A;  3GZ5 A;  1VQK I;  3G3Z A;  2QEN A;  4EQQ A;  3CME I;  4J01 A;  1MZB A;  1E3H A;  3PJR A;  3BR3 A;  5GAH J;  2FQ4 A;  3SXY A;  5E3N A;  4ETS A;  3KPH A;  2GXA A;  1IRZ A;  5TIS C;  2HVR A;  1RET A;  1FEX A;  2R4G A;  2K85 A;  5ICE A;  4OWR B;  1KU7 A;  2EFO A;  3H36 A;  1MND A;  3S2H J;  1ZR2 A;  2VC1 A;  3OSF A;  1KGS A;  1ZAO A;  4IPA A;  1XCV A;  4A6D A;  2VBZ A;  3I56 I;  2PI0 A;  3D5S C;  1N78 A;  1ZRC A;  4BQN A;  5A2Q K;  2HQ5 A;  3M8E A;  1UHW A;  2NVU B;  3KLO A;  5H6Q A;  2LBF B;  3PO3 J;  2A6T A;  1XTA A;  1HW2 A;  3G1O A;  5KHD A;  3FKI J;  2KZV A;  2Q1Z B;  4XID A;  2R92 J;  4G7H F;  3JSO A;  2X0L A;  3AG1 H;  3DLL F;  1VI0 A;  1SFO J;  4IVN A;  4WF2 A;  2E2J J;  1O4X A;  1WI9 A;  2IEK A;  1D3Y A;  2JPB A;  2KHM A;  2Z99 A;  4FTH A;  3CUO A;  4KDP A;  4LMY A;  2DK8 A;  3GWZ A;  1QNT A;  2ZJR F;  1D8K A;  2Y31 A;  4FHT A;  2CQK A;  3LL7 A;  5K5R A;  2M34 A;  1UCR A;  3CO7 C;  1S8N A;  2DW4 A;  1WFX A;  5IT9 K;  4HW0 A;  4XKC A;  3T0Y A;  2ZJQ F;  2NAZ A;  5E79 C;  2R5Z A;  2Y9Z A;  3J7A O;  2ZME A;  2JA8 J;  4YII A;  3FK7 A;  4ASN A;  5K7Z A;  4D0P A;  3LA2 A;  2Y48 A;  4G6T B;  1T6S A;  4RGX A;  3HOT A;  1L3L A;  4HNV A;  5F1J A;  1UZC A;  2IRF G;  1JE8 A;  1VQ9 I;  5CVJ A;  3V8L A;  1KU2 A;  3FBI B;  4S04 A;  3BTC A;  2CV0 A;  2JA6 J;  2BY2 A;  4HBL A;  4EM2 A;  1VQN I;  3WGG A;  1GV2 A;  4BE2 A;  5E1Z B;  2RN7 A;  5EYR A;  1A6Q A;  2Y75 A;  3H3U A;  1G2H A;  1FBS A;  1YE9 A;  3LMM A;  1OYW A;  1S7O A;  3HOZ J;  5D6F A;  3H0G J;  4FIS A;  3ZN0 A;  3TBI A;  1WHU A;  3CTA A;  4AVP A;  1KQ0 A;  2PMZ N;  3CJR B;  3F3X A;  2CH0 A;  3A1Y A;  3GLX A;  5B5E C;  3K70 D;  2OA4 A;  5EGO A;  2WY8 Q;  3LWF A;  4B8X A;  5C3E J;  3LSH A;  1Y8R B;  4KUM A;  1RIO H;  2DPD A;  4BY1 J;  4HRI A;  3ECO A;  2NS0 A;  5FRN A;  3FXU A;  3A02 A;  5L3D A;  2TCT A;  3HOW J;  2A05 A;  5ILV A;  4IX7 A;  1HOM A;  1ZAR A;  4M9Z A;  1UEL B;  6PAX A;  1HCR A;  1GV5 A;  2AQF A;  2QYO A;  2XAF A;  2V9P A;  3G73 A;  2K9Q A;  4AIH A;  3TOA A;  1RKW A;  2W4S A;  4XM3 A;  2VJ5 A;  1FOK A;  2NOG A;  3SQN A;  1F43 A;  1TWA J;  1ZYR F;  1PUF B;  3L09 A;  3ELK A;  3A2K A;  2IVM A;  1Y8Q B;  3U21 A;  2OV7 A;  4AIJ A;  1LVK A;  4XLC A;  3CCY A;  4MQV A;  2KPM A;  2WTE A;  5JHU A;  3SZG A;  3CCJ I;  2LRD A;  4AYB A;  2ACJ A;  4A3J J;  2M87 A;  2LC2 A;  2M7A A;  1HLV A;  2R7W A;  1VQ8 I;  1IRF A;  5KCM A;  3K1P A;  4G12 A;  1VND A;  3MMY B;  4MFD A;  4IKF A;  3I59 B;  4L0Y B;  3F8N A;  1XDU A;  4HX8 A;  4LIT A;  2HQN A;  1X3W B;  4A2U A;  1MNE A;  2OCE A;  2JTV A;  5HOD A;  1R1V A;  2IA1 A;  3WOD F;  2LYC A;  3D0S A;  3PQK A;  5M3F J;  1XX5 A;  2CUJ A;  1ETQ A;  3LST A;  1NK2 P;  3GX4 X;  2O03 A;  1S9H A;  4HLX A;  4D5F A;  3MKW B;  2QZ8 A;  3DTE A;  2F5V A;  1TP4 A;  4U0V A;  2Y30 A;  1Z05 A;  3HKZ N;  4I98 B;  2KIF A;  2B63 J;  2X48 A;  2DOA A;  4PK4 A;  3SEZ A;  3CDI A;  1MJB A;  3WU1 B;  1FLI A;  1GXP A;  1S5L C;  2VBY A;  3I64 A;  3U1D A;  2W82 A;  1DP3 A;  4M6V A;  1DGR M;  4AU7 A;  5A2Q Z;  2VE8 A;  2GIV A;  4KT5 C;  2FQ3 A;  5AON A;  4M73 A;  2VC0 A;  2VPR A;  5CQE A;  3PFI A;  4BXU A;  1ZR4 A;  5D5V B;  2V1N A;  3VPR A;  1EV7 A;  1KQ8 A;  2E34 A;  4QTR A;  1JKR C;  3ZOB A;  1VF9 A;  1ZG3 A;  4PJN A;  3LQR A;  3HOX J;  1QRY A;  4GYI A;  4OAY A;  1V3F A;  3ABU A;  3LNQ A;  2XAS A;  3Q0U A;  3P9C A;  1SD6 A;  1X19 A;  4LOC A;  1XG1 A;  3ZQF A;  2W85 A;  3LFU A;  1LDD A;  1Q1V A;  2HKX A;  2DA2 A;  4XKW A;  5EG0 B;  3I5U A;  1U2W A;  1LE8 A;  2HPI A;  2M8E A;  5CJ9 A;  4IXA A;  3I3L A;  2E2I J;  1G3W A;  2B7E A;  1Z21 A;  3ULQ B;  4Y52 J;  2CUZ A;  5IT9 Z;  3ONQ A;  2O8X A;  1L0O C;  2XGC A;  4HA8 A;  3K7A J;  1HDP A;  4XOP A;  4IF4 A;  1WRJ A;  3LFK A;  5ERI A;  2R7R A;  2V26 A;  4EVI A;  3J7Y J;  4F52 A;  4C3H J;  2STT A;  2K5C A;  1SD7 A;  1OFC X;  2K7L A;  3JSP A;  5L3B A;  2DA7 A;  3BP8 A;  3OY9 A;  1GHC A;  2EIM H;  3VSL A;  2PLY A;  2K9N A;  3AAF A;  5B1B H;  3K2Z A;  2DA3 A;  2AHQ A;  4C2T A;  1Y1V J;  2CQN A;  3PQJ A;  2XIG A;  4EJW A;  4HX4 A;  2OUM A;  2HTJ A;  2WAF A;  1HST A;  4EMS A;  3WTW C;  5ILS A;  1RRJ A;  4D7N A;  2CV2 A;  4EM0 B;  4ZYH A;  2F2E A;  2R7F A;  2JVG A;  1R5G A;  4PSW A;  2KIU A;  4XON A;  1N25 A;  1GLN A;  1CGP A;  4CSW A;  4B1R A;  4BBS J;  1I50 J;  4X6A J;  1ON1 A;  2LBF A;  3PFY A;  4NDL A;  2E1N A;  2FF4 A;  4E6K G;  3FX3 A;  3ZQC A;  4KIT B;  1CQT A;  3ABK H;  1T08 B;  3S32 A;  4PZJ A;  3AL0 C;  3EET A;  3AG2 H;  2D2W A;  3H9Q A;  3JRI A;  3DTI A;  2E60 A;  1O3Q A;  3TED A;  2WB1 A;  3BG6 A;  3KCC A;  2NNY A;  2V6E A;  3HRT A;  1P9Q C;  4Z2Y A;  1H9T A;  3FHN A;  4OIN F;  1X3U A;  2DLL A;  1IUY A;  2JSP A;  2ZB9 A;  2XAU A;  4I0A A;  1W5T A;  3CCR I;  5GPC A;  1I1G A;  3CES A;  3CJQ B;  2MW8 A;  4H4K C;  4G6D A;  2CS3 A;  2PMZ A;  1TWG J;  4F7Z A;  2R3S A;  4C3I J;  5LEK A;  1TW3 A;  3FXO A;  3DPL C;  3MKZ A;  2F5E A;  2BOL A;  2MBF A;  2EJR A;  4B43 A;  2XB0 X;  2MD0 A;  2IGN A;  5DCM B;  4ZYA A;  3DPU A;  4ZDL A;  4UY8 I;  1ITY A;  3TO7 A;  5LBQ A;  3E5X A;  2P7C B;  4BHB A;  2M8G X;  4U87 A;  3NQO A;  2H1K A;  2FU4 A;  2FMY A;  4RGS A;  2L9S A;  4FCY A;  4XL9 A;  3BRO A;  4E70 A;  3KZI C;  1RKT A;  4QPO A;  1WPK A;  5AIP A;  1MD0 A;  3G71 I;  2Y9Y A;  3IWF A;  4UXN A;  5EEG A;  2R7T A;  1IN5 A;  3LAP A;  2E1C A;  4MEY F;  5GAG J;  4M71 A;  1FX7 A;  5K7H A;  2M4K A;  4PJJ A;  2MC3 A;  4AM3 A;  2K27 A;  2X6W A;  3MN2 A;  3KFW X;  3IAM 2;  2ZJP F;  4F91 B;  1DP7 P;  1QO0 D;  3K4C A;  3ZMS A;  4KT6 A;  4MFE A;  4EJT A;  3HHH A;  2VN2 A;  4XR6 A;  3Q9V A;  1K7A A;  2VE9 A;  2IGO A;  2NVY J;  5E3L A;  3OL4 A;  4XK4 A;  4P1W A;  3TW7 A;  3A0B C;  3MCZ A;  2ECB A;  3BR2 A;  3V7S A;  1BA5 A;  3GUD A;  3GTP J;  2OF7 A;  3V4G A;  2HTS A;  3M7G A;  1V5F A;  2FX0 A;  4L9N A;  3HKZ A;  3HL2 A;  2O0Y A;  1XMX A;  3N4M A;  4JK1 X;  1LJ9 A;  2O7O A;  2JT1 A;  2QGU A;  2JK3 A;  2K3F A;  2X4H A;  1W0U A;  4AC0 A;  1BIA A;  2YX7 A;  3CMY A;  4IEJ A;  2Z5U A;  2O8K A;  2CWE A;  5FKN A;  1IRG A;  5JLW A;  5FKL A;  3BPX A;  3Q3S A;  4NC7 A;  3HB9 A;  3I59 A;  1IAW A;  3L2C A;  2EBI A;  2EZH A;  3C3W A;  2OZ6 A;  4LK0 F;  1X1B A;  2E1O A;  4WK8 F;  3LSG A;  2K9M A;  1YJN I;  2A69 F;  4CUG A;  1S72 I;  3BDD A;  4IHX A;  2ZME B;  1D1A A;  5BPI A;  1XSD A;  1FYM A;  2VQG A;  3T5X A;  5F64 A;  3RKW A;  3H35 A;  4MNU A;  4XN0 A;  1G6N A;  1J0R A;  3BG5 A;  3LSJ A;  4ZYG A;  5DUI A;  3ERM A;  2EB7 A;  1H0M A;  4IHT A;  3TKY A;  5B1A H;  3MKL A;  5BNG A;  2PG4 A;  3S3O A;  5DS9 A;  4UV9 A;  3DLA A;  5LHG A;  1MMD A;  5J47 A;  2ELJ A;  2H09 A;  2XF7 A;  3I54 A;  2LKS A;  4KNY A;  3F8B A;  3M9A A;  3H5R A;  4GCV A;  2E71 A;  5FRO A;  4KMU X;  2QA4 I;  1YW8 A;  2L02 A;  3DBR B;  3RYP A;  4C9Y A;  4UNO A;  3H1C A;  2KT0 A;  4PFP A;  1Z77 A;  4ON0 A;  3QQA A;  2ZXI A;  2V7F A;  3I0T A;  2W1O A;  1QHH D;  3TL4 X;  1ACI A;  3F9K A;  5J8F A;  1BW6 A;  4C3J J;  5E20 A;  1F5T A;  2IP2 A;  3PNT A;  3ZMT A;  1AWC A;  1OLT A;  3U9G A;  5M5X J;  1T98 A;  1XMK A;  2JUG A;  3M4O J;  2BHY A;  4R8H A;  2KKO A;  2Z2S B;  2HU9 A;  4RAY A;  5FLM J;  1FNN A;  2WY7 Q;  5EG0 A;  4YFN F;  3DTK A;  1XGM A;  3ROU A;  4CZC A;  3FMS A;  1LKX A;  3JR9 A;  2KFD A;  3T8T A;  1YW7 A;  3VYR B;  4I6Z A;  4L5I A;  1HKT A;  1SVM A;  1C0W A;  1IV8 A;  3E5U A;  4A3E J;  4BQA A;  5D5X B;  4YG2 F;  5DM7 F;  3RQI A;  1X2M A;  1VQ5 I;  1AHD P;  2FML A;  1MBG A;  4EJU A;  9ANT A;  3T8R A;  1QBJ A;  1FJL A;  3W2V A;  3RI4 A;  1ZRE A;  1SAN A;  4EEF G;  3SHF A;  4A69 C;  3BZC A;  1T95 A;  3SDB A;  1U5T B;  2QWW A;  4NC6 A;  1O57 A;  4RLQ A;  4CCJ A;  4L5E A;  4HYE A;  3RZD J;  2QEX I;  4BE1 A;  1TW2 A;  1AOY A;  2OPT A;  3ZMU A;  1MBJ A;  2CGP A;  4IL6 C;  1T56 A;  1LFU P;  2EFQ A;  2YR2 A;  4KIG A;  1MJ9 A;  1R5I D;  2L4A A;  2HQR A;  1IDY A;  2DI3 A;  2M9H A;  3JRF A;  3UNG C;  5CYV A;  1G8X A;  2D1H A;  1NK3 P;  2IS1 A;  4S0H B;  4RDU A;  2EA4 A;  5F6F A;  1IF1 A;  2VJJ A;  3KP7 A;  1N77 A;  3GYH X;  2HEO A;  4A3K J;  2HGC A;  4Z6Y A;  4M74 A;  2ESN A;  1P7J A;  5KAF C;  1X4O A;  2DXI A;  4L0Z B;  2HKO A;  4D9J A;  1XPX A;  4LG0 B;  2YU9 J;  1B4A A;  4FX4 A;  5J3L A;  2P6S A;  2FRH A;  2OQG A;  3B02 A;  5BPD A;  2HZT A;  3D5L A;  3VYU B;  4F93 B;  3CZ6 A;  2KZG A;  4MEX F;  2VBX A;  1WJF A;  3H5A A;  3TOB A;  2M1B A;  3F22 A;  5DV5 A;  2HXI A;  2VUM J;  3ZR8 X;  3E3V A;  2J5O A;  4TV7 A;  2ME6 A;  1Z91 A;  4CYD A;  1JJ8 C;  5DD4 A;  2ESH A;  4I7H A;  1QPM A;  1U9O A;  2DU9 A;  5D4R A;  2LFB A;  3R61 A;  2CYY A;  2JRM A;  2XF5 A;  3CJN A;  5L3G A;  1JGS A;  1B72 A;  4F55 A;  2DA6 A;  1U3E M;  1J75 A;  2CW8 A;  3RQ4 A;  3ZQL A;  5HNF A;  3BCB A;  4N0B A;  2DMU A;  2CQ7 A;  4PJM A;  3BLY A;  5DCM A;  4E7K A;  4RB2 C;  1A35 A;  3RCO A;  1YI2 I;  3ZQ7 A;  2LY9 A;  4X0G A;  4DW6 A;  2EV5 A;  2UV1 A;  5HS7 A;  2WAQ N;  1ZH5 A;  4XNF A;  1XGO A;  1ETY A;  2EH3 A;  4DNC A;  1FYK A;  3C18 A;  4ITV A;  5C44 J;  2R7V A;  2F4O B;  4CCM A;  3KP3 A;  3VOE A;  4Q48 A;  4JX5 A;  4XBF A;  2VBW A;  3FBN B;  2H27 A;  2JRT A;  2FUG 2;  1Z67 A;  5FLX K;  4RAZ A;  2DFE A;  2R93 J;  4KA4 A;  4RM3 A;  5LRR A;  3KEY A;  3K70 C;  3QOE A;  1GUU A;  2BZT A;  2KJB A;  1UFM A;  3KEQ A;  2IS2 A;  2JUC A;  3KE2 A;  3QU6 A;  3LA7 A;  3JW4 A;  3FXR A;  4PGG A;  2I10 A;  2VKH A;  2L7M P;  3D1N I;  2V79 A;  2XAJ A;  1ORK A;  1ZK8 A;  2F5C A;  1WVR A;  4W1U A;  4BDY A;  1I6X A;  1IRX A;  3HSR A;  1BOB A;  1A6I A;  4UUS B;  3RPU D;  3WTX C;  2DT5 A;  1D8J A;  3H0D A;  4II2 A;  5IY5 H;  5DM6 F;  3MKY B;  5TJJ A;  2RNJ A;  2GAU A;  5K5Q A;  4UV8 A;  3BOQ A;  4M9X A;  4BHP A;  5ED4 A;  3JRE A;  3SZT A;  2NVQ J;  4WXC A;  1GVJ A;  4F92 B;  2M0C A;  2H1L A;  2RQP A;  2MGQ A;  2F4M B;  3DKX A;  1QGP A;  1MH4 A;  1ERD A;  3NAU A;  1WJE A;  3QYE A;  1LDK B;  2V1D A;  3FM5 A;  4P9U A;  3DPT A;  2GXG A;  3SEQ A;  1MBK A;  1PVE A;  3ABM H;  2GA2 A;  5FGM A;  4YEL A;  1IZ1 A;  1KQ9 A;  1R49 A;  3VDX A;  2KL4 A;  2MA3 A;  2A68 F;  2BVM A;  3HJE A;  4ANJ A;  1TT0 A;  3MWM A;  5JHF A;  3V8J A;  1BIB A;  1Y0U A;  3VSK A;  2A07 F;  4M6X A;  1IJW C;  2BGC A;  1W0T A;  1OPC A;  2DMT A;  3GZN B;  1D0Z A;  1U8R A;  4IRH A;  1UHS A;  2K4B A;  2QLZ A;  3K4L A;  4A3G J;  3K1N A;  1FMW A;  2MSY A;  2WB1 N;  4BJ6 C;  2HS5 A;  2IBD A;  3OYB A;  1Z1D A;  3DKY A;  4RBO A;  3FXK A;  4DBQ A;  3G6E I;  2BE5 F;  3GBG A;  2DT7 B;  4HF1 A;  1Y0N A;  4EJO A;  4O3M A;  1VTN C;  4JX6 A;  4IHV A;  1W7P D;  2XRN A;  1XGN A;  1FIP A;  3WE2 A;  5BQT A;  1Z6T A;  3LA3 A;  2L9V A;  2CG4 A;  5HDN A;  3VEP A;  3OYA A;  1XB4 A;  3ZMD A;  1FTT A;  4BE0 A;  2HZD A;  2F6C A;  1XSX A;  4KIB A;  3LSM A;  4UHT A;  4LIU A;  3HYI A;  4G7Z F;  4HEA 2;  2YU3 A;  3GZ6 A;  1J5Y A;  1FOY A;  3FZV A;  4CDG A;  5EEH A;  3OOP A;  4HG2 A;  4BQQ A;  2VB6 A;  4IJA A;  3P9I A;  1YG2 A;  4JYK A;  3WTV C;  1OCO H;  4XOT A;  3WG9 A;  3CC7 I;  2W00 A;  4MIM A;  4KYW A;  1U0J A;  3BTJ A;  1YFH A;  3R0A A;  2HDC A;  2HOA A;  2IGM A;  4M3G A;  3QRF F;  2V4J C;  1PP8 F;  3W6V A;  1MMA A;  4FET A;  3CC2 I;  1G3Y A;  1PP7 U;  3E1S A;  4B09 A;  2Z16 A;  2MD5 A;  1J7K A;  4OOI A;  4C2M J;  3M1E A;  2NVT J;  4O6J A;  4A0Y A;  1RI7 A;  4IQ4 A;  5H6R A;  5H20 A;  2G7U A;  4ESF A;  2RDP A;  3FXL A;  2L2O A;  1ZG5 A;  3IKT A;  3PNV A;  3RDI A;  3QWL A;  3HRM A;  3CCU I;  1S7A A;  1E0E A;  1QA6 A;  5HNH A;  1B1B A;  1U5T A;  4BKX A;  1FYL A;  2EA2 A;  3L1P A;  3LQQ A;  4ZZL A;  3GFJ A;  1T8I A;  2AS5 F;  2VON A;  2F5D A;  3KP4 A;  1J59 A;  4ZDO A;  4YFK F;  1R1T A;  3KIO A;  4OIR F;  3J7A Y;  2XGD A;  3F8C A;  5D6E A;  2HPM A;  3JRA A;  4YIR X;  1R4M B;  2WV1 A;  4B3X A;  4HNT A;  2R7Q A;  1AKH B;  1LEA A;  1ETX A;  2QVO A;  3K4B A;  2P5V A;  2OTJ I;  4AIK A;  2CJJ A;  3MZY A;  2M7B A;  1POG A;  2BEO A;  2BY3 A;  2K40 A;  1OYY A;  2ZO4 A;  2OJE D;  3F72 A;  4D7M A;  5FLX Z;  1MMS A;  2L7F P;  3OV8 A;  4A5M A;  1V5E A;  2ZME C;  3OS1 A;  1RR7 A;  2IW5 A;  4OMY A;  1XSV A;  2V6C A;  1EF4 A;  3ZMZ A;  2MAB A;  2HFH A;  3HEF A;  1O3R A;  4DZJ A;  2W84 A;  3V8K A;  2L7Z A;  4LG0 A;  1B9M A;  3BCA A;  1WQ2 A;  2W57 A;  2Y0M A;  3RYR A;  4F3Q A;  1RUO A;  2EIJ H;  2HYF A;  3RKQ A;  4LB6 B;  3J80 K;  2FE3 A;  4I99 C;  2ZXW H;  2OBP A;  3FKJ A;  3RJP A;  5LFA A;  1K4S A;  4XSZ F;  3ZXS A;  1U6G A;  2WAQ A;  5K5O A;  3MZ8 A;  3S1M J;  1IV6 A;  1I39 A;  1ETV A;  2LMD A;  1Z9C A;  2FBI A;  1GVD A;  3DBL B;  1EH7 A;  4IRI A;  4IQJ A;  1RZ4 A;  3HC7 A;  4WXD A;  1WJ5 A;  4EM1 A;  4M9S A;  4E7H A;  2LY1 A;  5E8I A;  2GZW A;  4GO1 A;  3W3C A;  4YFX F;  2C6Y A;  4P55 A;  3BT9 A;  4IOC F;  1WH5 A;  2B0L A;  1XN7 A;  3V42 A;  2UWM A;  2DQL A;  3HUG A;  2QSF X;  4ZC3 A;  2P81 A;  3C1D A;  3EUK L;  4HST A;  3CQZ J;  1VZ0 A;  3BG3 A;  1DPU A;  2NXN B;  4OMZ A;  2EQR A;  2P5L C;  4OIO F;  3NWT A;  1W7P B;  2WC2 A;  3LAJ A;  5IOZ A;  1T2K A;  3R0J A;  2O5R A;  3O3K A;  1SFX A;  4R1H A;  2DTZ A;  3HSE A;  3S3M A;  2RGV A;  2BBY A;  4KN7 X;  1TC3 C;  1ZLJ A;  2QM3 A;  4J19 A;  1OMI A;  3EPZ A;  2IA2 A;  1LEB A;  4NUB A;  4JX4 A;  2W7N A;  2MLK A;  4A12 A;  4XSX F;  1TLH B;  2E5N A;  5E3O A;  4IOA F;  5ICG A;  1B9N A;  3QPH A;  5CQG A;  4CZZ A;  2QSH X;  3S16 J;  2A5Y B;  1IN6 A;  4HAM A;  4ZYE A;  2M0M A;  1VQ7 I;  1U5T C;  2RKH A;  1QVU A;  2E19 A;  1TWH J;  5H2F C;  3JRD A;  3HOY J;  1JGG A;  1K78 B;  2ICW G;  3M8J A;  2COM A;  1MDM A;  1D1C A;  1REP C;  1NTC A;  2LTP A;  2RRE A;  1RR8 C;  1VQO I;  2IPQ X;  3CLQ A;  2TDX A;  4UUS A;  2B9S A;  2EV0 A;  2Y69 H;  5JVG F;  5LGN A;  3Q0V A;  5BMZ A;  1W36 D;  3C2G A;  1X1P A;  1D1B A;  2LNB A;  3DWL E;  1HBX G;  1W1W E;  5EJC A;  3A01 B;  3ML6 A;  2BVL A;  3A4C A;  2KP6 A;  1I3Q J;  3IAS 2;  1X4P A;  1ONV A;  3QU3 A;  4JBA A;  5F27 A;  2QKL B;  3HSF A;  2HVS A;  3DV8 A;  3KX2 A;  2RQQ A;  4KN4 X;  3CCS I;  3KP2 A;  2KLO A;  1BN5 A;  2L54 A;  2EFP A;  4OU0 A;  1T38 A;  3WTU C;  4QIW N;  2VT2 A;  3O2P E;  3JAM Z;  5L3C A;  1V55 H;  3JCU C;  4LB5 A;  1YHQ I;  3EYI A;  2L3D A;  3FIS A;  3S1N J;  2VXZ A;  1LFP A;  5DCF A;  3W6K B;  4BQO A;  1GT0 C;  2P7V B;  4XRM A;  2DPU A;  1TQM A;  1RPW A;  1B72 B;  3BG7 A;  2P0W A;  4FAS D;  3M1C A;  3PSI A;  1BR2 A;  1F9N A;  3W2W A;  1YIT I;  3GFI A;  3TQN A;  2DMQ A;  4M6Y A;  1JTX A;  2EZL A;  4CCO A;  2H8W A;  2DOD A;  4RAF A;  4NQW B;  4B44 A;  1H89 C;  4ENM A;  1E3P A;  4I76 A;  3GXO A;  3SZP A;  1A04 A;  1O7F A;  3N05 A;  4LGW A;  5DD8 A;  4KFC A;  4PSX A;  2XSJ C;  2LR8 A;  5CKT A;  2XGE A;  2JA2 A;  3VFZ A;  2E1M B;  2M3A A;  4BEH B;  3K69 A;  3BR5 A;  1V54 H;  3NRV A;  3OR2 C;  3GTM J;  3AKZ A;  2NOJ B;  3HTS B;  3NWS A;  3CDL A;  1A36 A;  3HOU J;  3GTQ J;  2OZU A;  4U0Y A;  1BI2 A;  3SYT A;  3OS2 A;  2QBY B;  1S7E A;  4BUP A;  3OYC A;  2NVX J;  2JN6 A;  4BJ5 C;  4B48 A;  2V9V A;  1BL0 A;  3B73 A;  2BHZ A;  1P7I A;  3BY6 A;  1QU3 A;  3MD2 A;  2L01 A;  1NHA A;  2X51 A;  2VKE A;  3K6G A;  5FO5 A;  1MBF A;  3I9V 2;  4BL0 B;  5FD6 A;  4ENN A;  3J80 Z;  2W25 A;  4HDU A;  3TP0 A;  3HRU A;  3WTT C;  1U78 A;  1OCC H;  2YPR A;  4HV5 A;  2A5W A;  4XLA A;  3CCQ I;  5IP7 J;  5LHH A;  1SAX A;  2GA1 A;  2KQR A;  2LK2 A;  2Z1D A;  4A3D J;  2ZSH B;  3OIP A;  4Y15 A;  2QQ9 A;  2E5Z A;  2GLO A;  5DUK A;  4FX0 A;  1XGS A;  3A0H C;  3OYM A;  4A5N A;  2E36 A;  3DXJ F;  1MSE C;  3B6A A;  3IUO A;  3OR1 C;  2DCE A;  3SFI A;  1JTY A;  3TW6 A;  2VOO A;  1SFU A;  5D8L B;  2HXO A;  1USS A;  2R5Y B;  1OR7 A;  1R23 A;  3BZK A;  2X85 A;  1QZZ A;  2IJL A;  1D0Y A;  3VWB A;  5KK1 A;  2D45 A;  1ZQ3 P;  2MH9 A;  1BOA A;  2WA0 A;  2DMN A;  3HM5 A;  1AKH A;  4Y7N J;  4DYQ A;  3ASO H;  1YIO A;  2ZC2 A;  1HKQ A;  3BG9 A;  3FWE A;  3PUF A;  5K1Y A;  4OIQ F;  2DA1 A;  2ME0 A;  3RPU A;  3I71 A;  4ABZ A;  4EJV A;  3Q9S A;  2DT6 A;  5JR3 A;  4WX9 A;  2EFW A;  3P7N A;  4QWQ A;  4DZP A;  3UKG A;  3IH3 A;  5D8K B;  2LD5 A;  4LJZ F;  1LUJ B;  2JMW A;  2VJ4 A;  3S17 J;  2HVQ A;  1QVT A;  4OIP F;  2M5W A;  1FZP B;  3REO A;  1FOW A;  4EV0 A;  1IO2 A;  4D5C A;  3AG4 H;  4A3B J;  2X6Y A;  1MBE A;  2VOD A;  2ETH A;  2IAI A;  3RKX A;  2BYV E;  4NB5 A;  5C4X J;  3ZPL A;  1OCR H;  3Q0W A;  3U2R A;  1I3A A;  5DEQ A;  3MFK A;  4A6E A;  1I1S A;  3R4K A;  4A0Z A;  1BI1 A;  3C2H A;  1NG6 A;  1Z3Y A;  2KIQ A;  3F0C A;  3E7L A;  3ZMV A;  4ZJZ A;  1UB9 A;  4E7J A;  3BQY A;  4E7Z A;  3ZGK A;  1JT0 A;  3DCF A;  4DQ2 A;  4U7D A;  3COA C;  3SDG A;  3CP2 A;  1BI0 A;  2DK5 A;  3IH2 A;  2KDO A;  5E1W A;  1STZ A;  3DEU A;  1TQI A;  1FMV A;  2V9K A;  1G3S A;  2LG4 A;  2LP0 A;  3HOV J;  1OKR A;  1X58 A;  3GTO J;  3BC8 A;  1F36 A;  3TGN A;  1HSJ A;  3WE3 A;  1MMN A;  3I55 I;  3FXJ A;  1SC7 A;  4HDV A;  1FOX A;  4LD5 A;  5F04 A;  2LY2 A;  1SFK A;  1A31 A;  1WJB A;  1SVO A;  3WHB A;  4DOZ A;  2IS6 A;  4BYY A;  1ETW A;  1W7P A;  1IXC A;  4QLC U;  5IYC J;  3G4S I;  2STW A;  2PQ8 A;  2MG4 A;  3ECH A; 
#chains in the Genus database with same CATH homology
 4L9V A;  4JQF A;  1OYI A;  4R79 A;  2Z3Y A;  1W4M A;  5CLS A;  2CFX A;  3GO5 A;  1I5Z A;  1FPQ A;  1B59 A;  1ZRF A;  3WTS C;  3HHG A;  1TTY A;  1SD4 A;  2AXL A;  1KU9 A;  1K78 A;  3NEU A;  5JI6 A;  2HYG D;  2OD5 A;  2P6T A;  2D1V A;  2A6E F;  1Q1H A;  2M45 A;  1TNS A;  5JFR A;  2FOK A;  1QZY A;  2CO5 A;  2LDU A;  4N9H A;  1EH6 A;  5CVU A;  1J9I A;  1ZRD A;  1P2F A;  2M30 A;  2A6H F;  3K0L A;  5HOO A;  2IT0 A;  5ICF A;  2PBI A;  1CF7 B;  2GQQ A;  3CLO A;  3IHU A;  4NQW A;  1P4A A;  2BV6 A;  4MQ9 F;  3QP5 A;  3BJA A;  3JTG A;  4LK1 F;  3ERE D;  2XUB A;  4U7B A;  1J2X A;  3EYY A;  4CXF A;  2OQR A;  2ZJ2 A;  2QBY A;  3IKV A;  4MTE A;  4P96 A;  4M72 A;  1W5S A;  2DQR A;  5L3E A;  1O3S A;  3L7W A;  5FFX A;  2WWY A;  1YTY A;  3ZN1 A;  3K1M A;  4MGR A;  3QP6 A;  3K9T A;  1G3T A;  4PGH A;  4WWC A;  4NHJ A;  3N97 A;  3C7J A;  2EV6 A;  1FP2 A;  2PJP A;  1BBY A;  1MDM B;  2UXX A;  2VOP A;  3WGI A;  4RGU A;  4O5V A;  4G94 A;  4KMF A;  4AWX B;  4LLG F;  5HLG A;  2XRO A;  3H3Z A;  5LLQ A;  4CO8 A;  2A3S A;  3I4P A;  2NRA C;  4GXO A;  5HS9 A;  2FSW A;  3ISP A;  3GVA A;  2FNA A;  1WKM A;  3Q5F A;  3CUQ B;  4ZZD A;  1XMA A;  1ZGJ A;  3VOD A;  2DFI A;  3WGH A;  5CVI A;  1MGT A;  5D5W B;  2XKO A;  4IHS A;  2QQA A;  2R7D A;  4KIF A;  1GXQ A;  2KJC A;  5E1X A;  3DKW A;  2E7W A;  2OAZ A;  3RKY A;  5J8C A;  2K4J A;  4HF2 A;  1LDJ A;  1S29 A;  1TBX A;  3HIF A;  1IW7 F;  1B6A A;  1H9G A;  4Q47 A;  4XRF A;  1DPR A;  3KET A;  1D5V A;  1FBU A;  1ODD A;  2FBH A;  4IRG A;  3L00 A;  3MZH A;  1LVA A;  5HS8 A;  4ENJ A;  2HR3 A;  1BC7 C;  3IL2 A;  3JTH A;  3KLN A;  5JVT A;  1FT9 A;  1P92 A;  3JAM K;  4XLP F;  1XDS A;  2ZFW A;  2JSC A;  3GFL A;  3TO9 A;  4HQE A;  5DDG A;  1ON2 A;  2XKP A;  3HTU A;  4ESJ A;  2FXA A;  2ZNY A;  2ZNZ A;  4CHU A;  5E18 F;  4MHG A;  4HF0 A;  4XLN F;  1ZG1 A;  1R7J A;  2H6C A;  3KZY A;  3F23 A;  1IXR C;  3TO6 A;  1RNL A;  2K02 A;  3RPQ A;  3WTY C;  4BH9 A;  1FSH A;  2MLG A;  2XAH A;  3IWZ A;  1KYZ A;  5L3F A;  1YO5 C;  2EK5 A;  1ZGA A;  1ZHF A;  3MEX A;  1ZN2 A;  4KIC A;  2J5P A;  3EQL F;  1YYV A;  1P4X A;  4CGZ A;  2E7X A;  2O61 A;  3QAH A;  3E6C C;  2PMU A;  2CW0 F;  1R22 A;  2H6B A;  1HW5 A;  1T39 A;  5TRD A;  3W6J B;  1RUN A;  4AD9 A;  5ILU A;  3MQ0 A;  4I0B A;  1CF7 A;  2ZBK A;  4HOB A;  1UHM A;  1EH8 A;  3F6V A;  1TNT A;  3BJO A;  3VB2 A;  1JXS A;  1O3T A;  1I27 A;  1LB2 A;  2VT3 A;  3F21 A;  4Q5S F;  3RIR A;  2XAQ A;  2PFB A;  5FFZ A;  3DP7 A;  1IN7 A;  1SFE A;  4MTD A;  2ELH A;  3WU0 A;  1E2X A;  4G8X A;  1MKM A;  1YS7 A;  2YX4 A;  4WCG A;  1SD5 A;  2V1X A;  1BI3 A;  2RC4 A;  1HKS A;  1G4D A;  2DTR A;  2OU2 A;  2LF8 A;  2ISZ A;  1R58 A;  2PMH A;  3DQV C;  2JZY A;  4HX7 A;  1YS6 A;  3FHZ A;  4HZF A;  3KEO A;  4BHC A;  4RS8 A;  4FT8 A;  4BNC A;  4L9J A;  4BAY A;  2GXB A;  1Z6R A;  4YIF A;  2NYX A;  4UVB A;  3EUH A;  2A61 A;  3HOS A;  3FM3 A;  2G7H A;  1HW1 A;  2IA0 A;  3CUQ A;  1P6R A;  4HQM A;  4L9T A;  1R36 A;  3T1B A;  3HRS A;  5HVQ C;  4PDK A;  5AIQ A;  4RB3 C;  1WSU A;  2NNN A;  3KP6 A;  4H0E A;  4N9I A;  1WWX A;  4RGR A;  3S2W A;  4G7O F;  2DBB A;  2XHK A;  2GWR A;  3BPV A;  4HV6 A;  2P4W A;  2XGX A;  2LF7 A;  5BS6 A;  4Y17 A;  2Q8K A;  1R5H A;  2G9W A;  1BM9 A;  1P4W A;  1BJA A;  1XCB A;  3FMR A;  4ZYD A;  4GYG A;  4HLY A;  3FF5 A;  2RV8 A;  4WXH A;  1MJA A;  3L9F A;  3M8F A;  1BC8 C;  1YQA A;  4EGY A;  4I09 A;  5FB2 A;  4P5O A;  3BJ6 A;  1TQP A;  4I02 A;  3J81 K;  3IC7 A;  5F1R A;  1V4R A;  1PUE E;  1K79 A;  3FMQ A;  5HLH A;  1HXD A;  2XVC A;  3MAJ A;  5CVR A;  1KA8 A;  3BZ6 A;  2Z33 A;  1PDN C;  3RTR A;  2K86 A;  3F8F A;  2KRF A;  3ZP5 A;  5HDG A;  2XV4 S;  2ISY A;  5D4S A;  3QPT A;  3CO6 C;  1SMT A;  5CVV A;  1KU3 A;  5LGU A;  3E6M A;  5FD5 A;  3R6S A;  3KZZ A;  1QQI A;  5LHI A;  4G9Y A;  2W24 A;  1YW9 A;  1YLF A;  3E6D A;  4UVC A;  1KYW A;  2DO7 A;  4ESB A;  2ZCW A;  2PN6 A;  4ENK A;  1R1U A;  4RB1 A;  2L4M A;  1LQ1 A;  3CUQ C;  4EGZ A;  2EFN A;  3ABT A;  4S05 A;  3TDU C;  2UZK A;  4LLN A;  4U0W A;  2LSO A;  1T0F A;  3IRR A;  2F5F A;  3E5Q A;  4Q4Z F;  5ICC A;  2YSR A;  2ADU A;  1JHF A;  1JHH A;  5BOX A;  1IN4 A;  1FWZ A;  3GFM A;  4GGG A;  1XD7 A;  1FBQ A;  3KP5 A;  1ULY A;  2EWN A;  5IT3 A;  2P5K A;  3CDH A;  4I01 A;  3V7R A;  4A0X A;  5LGT A;  2ZKZ A;  3EDP A;  4U88 A;  4CIC A;  2ZXJ A;  4G6Q A;  1Z7U A;  5HDK A;  3QOP A;  2Q2E A;  1IN8 A;  1UST A;  3DF8 A;  1FC3 A;  2QUF A;  1DDN A;  2FBK A;  2RVC A;  1FSE A;  5HLI A;  5LRS A;  2KIM A;  1K6O A;  3P9K A;  3GW2 A;  1F4K A;  4LFU A;  2HOE A;  4P9F A;  5E8G A;  3F6O A;  2XAG A;  3F8M A;  2FNP A;  3GEZ A;  2H94 A;  2FA5 A;  5LEJ A;  3R60 A;  2WV0 A;  2UXN A;  5DYM A;  1S3J A;  3GF2 A;  3J81 Z;  2DAO A;  2QQB A;  1DUX C;  4PCQ A;  2FEZ A;  4UVA A;  3SFZ A;  2O3F A;  4L5J A;  3E97 A;  2LKP A;  3BWG A;  1FY7 A;  3DFG A;  4ZH4 F;  1IXS B;  1FP1 D;  1E17 A;  2Z9O A;  3I58 A;  4L18 B;  5E17 F;  2CSO A;  1O7L A;  5KVR A;  3I53 A;  1R00 A;  3WTZ A;  1ZLK A;  3IRQ A;  1HQC A;  2JPC A;  3O6B B;  5J6X A;  1LNW A;  3H92 A;  2PEX A;  2MH2 A;  4LLL A;  4UUV A;  3V7C A;  1SMY F;  2V1U A;  4RB0 A;  3TDZ C;  1F1Z A;  2Q0O A;  4Y13 A;  4I2O A;  2P8T A;  5D5U B;  3E6B A;  2O6G E;  4K2E A;  3FXQ A;  2HWV A;  1S6L A;  3GZ5 A;  3G3Z A;  2QEN A;  4EQQ A;  1MZB A;  3SXY A;  4ETS A;  5ICE A;  1KU7 A;  2EFO A;  2VC1 A;  1KGS A;  1ZAO A;  4IPA A;  1XCV A;  4A6D A;  2VBZ A;  2PI0 A;  1ZRC A;  5A2Q K;  3M8E A;  1UHW A;  3KLO A;  5H6Q A;  1HW2 A;  4G7H F;  3JSO A;  2X0L A;  4IVN A;  4WF2 A;  1WI9 A;  1D3Y A;  2JPB A;  2Z99 A;  4KDP A;  3CUO A;  4LMY A;  2DK8 A;  3GWZ A;  1QNT A;  1D8K A;  4FHT A;  2CQK A;  5K5R A;  1UCR A;  3CO7 C;  1S8N A;  2DW4 A;  5IT9 K;  4HW0 A;  3T0Y A;  2NAZ A;  3J7A O;  2ZME A;  4YII A;  4ASN A;  4D0P A;  3LA2 A;  2Y48 A;  1T6S A;  4RGX A;  3HOT A;  1L3L A;  2IRF G;  1JE8 A;  5CVJ A;  3V8L A;  1KU2 A;  4S04 A;  4HBL A;  4EM2 A;  3WGG A;  5E1Z B;  2RN7 A;  3H3U A;  2Y75 A;  1FBS A;  1OYW A;  1S7O A;  5D6F A;  3ZN0 A;  3CTA A;  4AVP A;  1KQ0 A;  3F3X A;  3GLX A;  2OA4 A;  3LWF A;  4B8X A;  4KUM A;  1RIO H;  2DPD A;  3ECO A;  2NS0 A;  3FXU A;  5L3D A;  5ILV A;  1ZAR A;  4M9Z A;  6PAX A;  2QYO A;  2XAF A;  3G73 A;  4AIH A;  3TOA A;  1FOK A;  3SQN A;  1ZYR F;  3L09 A;  3ELK A;  2IVM A;  4AIJ A;  4MQV A;  2WTE A;  5JHU A;  2ACJ A;  2M87 A;  1IRF A;  3K1P A;  4L0Y B;  3I59 B;  3F8N A;  1XDU A;  4HX8 A;  2HQN A;  4A2U A;  2JTV A;  1R1V A;  2IA1 A;  3WOD F;  3D0S A;  3PQK A;  3LST A;  3GX4 X;  2O03 A;  4HLX A;  2QZ8 A;  4U0V A;  1Z05 A;  4I98 B;  2KIF A;  1MJB A;  3WU1 B;  1FLI A;  1GXP A;  2VBY A;  3I64 A;  3U1D A;  5A2Q Z;  2VE8 A;  2GIV A;  4KT5 C;  2FQ3 A;  5AON A;  4M73 A;  2VC0 A;  3PFI A;  4BXU A;  5D5V B;  1KQ8 A;  1EV7 A;  1ZG3 A;  3LQR A;  4GYI A;  1V3F A;  3ABU A;  2XAS A;  3P9C A;  1SD6 A;  2W85 A;  1LDD A;  2HKX A;  3I5U A;  1U2W A;  2M8E A;  5CJ9 A;  4IXA A;  1G3W A;  3ULQ B;  5IT9 Z;  2O8X A;  1L0O C;  4HA8 A;  4IF4 A;  1WRJ A;  3LFK A;  5ERI A;  4EVI A;  2STT A;  1SD7 A;  2K7L A;  3JSP A;  5L3B A;  3BP8 A;  1GHC A;  2PLY A;  3AAF A;  3K2Z A;  3PQJ A;  2XIG A;  4EJW A;  4HX4 A;  4EMS A;  2HTJ A;  3WTW C;  1HST A;  5ILS A;  4EM0 B;  4ZYH A;  2F2E A;  2R7F A;  1R5G A;  2KIU A;  1CGP A;  1ON1 A;  2E1N A;  2FF4 A;  3FX3 A;  4PZJ A;  3EET A;  2D2W A;  1O3Q A;  3KCC A;  2NNY A;  3HRT A;  4Z2Y A;  1H9T A;  4OIN F;  1X3U A;  2DLL A;  1IUY A;  4I0A A;  1W5T A;  1I1G A;  4G6D A;  4F7Z A;  2R3S A;  5LEK A;  1TW3 A;  3DPL C;  2F5E A;  2MBF A;  2EJR A;  5DCM B;  3TO7 A;  5LBQ A;  3E5X A;  2P7C B;  4BHB A;  3NQO A;  2FU4 A;  2FMY A;  4RGS A;  3BRO A;  4E70 A;  5AIP A;  1MD0 A;  3IWF A;  4UXN A;  5EEG A;  1IN5 A;  3LAP A;  2E1C A;  4MEY F;  4M71 A;  1FX7 A;  2MC3 A;  2K27 A;  3KFW X;  1DP7 P;  1QO0 D;  3ZMS A;  4EJT A;  3HHH A;  2VN2 A;  3Q9V A;  1K7A A;  2VE9 A;  3MCZ A;  3V7S A;  3GUD A;  3V4G A;  2HTS A;  3M7G A;  4L9N A;  2O0Y A;  3N4M A;  4JK1 X;  1LJ9 A;  2JT1 A;  2X4H A;  1BIA A;  2YX7 A;  2Z5U A;  2CWE A;  1IRG A;  3BPX A;  3I59 A;  1IAW A;  3L2C A;  3C3W A;  2OZ6 A;  4LK0 F;  4WK8 F;  2A69 F;  3BDD A;  2ZME B;  5BPI A;  1XSD A;  1FYM A;  3T5X A;  5F64 A;  3RKW A;  4MNU A;  1G6N A;  1J0R A;  5DUI A;  4ZYG A;  2EB7 A;  1H0M A;  4IHT A;  3TKY A;  2PG4 A;  4UV9 A;  5LHG A;  2H09 A;  3I54 A;  4KNY A;  3F8B A;  3M9A A;  4GCV A;  4KMU X;  1YW8 A;  2L02 A;  3RYP A;  4UNO A;  4ON0 A;  3I0T A;  5J8F A;  5E20 A;  1F5T A;  2IP2 A;  3ZMT A;  1AWC A;  3U9G A;  1T98 A;  1XMK A;  2KKO A;  4RAY A;  1FNN A;  4YFN F;  1XGM A;  3ROU A;  3FMS A;  3T8T A;  1YW7 A;  4L5I A;  1HKT A;  1C0W A;  3E5U A;  4BQA A;  5D5X B;  4YG2 F;  2FML A;  4EJU A;  3T8R A;  1QBJ A;  1ZRE A;  3RI4 A;  3SHF A;  1U5T B;  2QWW A;  1O57 A;  1AOY A;  4HYE A;  1TW2 A;  3ZMU A;  2CGP A;  2EFQ A;  2YR2 A;  4KIG A;  1MJ9 A;  2L4A A;  2HQR A;  2DI3 A;  5CYV A;  2D1H A;  2EA4 A;  5F6F A;  1IF1 A;  3KP7 A;  3GYH X;  2HEO A;  2HGC A;  4M74 A;  2ESN A;  4L0Z B;  2HKO A;  4LG0 B;  1B4A A;  4FX4 A;  2P6S A;  2FRH A;  2OQG A;  3B02 A;  5BPD A;  2HZT A;  3D5L A;  4MEX F;  2VBX A;  3TOB A;  2M1B A;  3F22 A;  5DV5 A;  3E3V A;  2J5O A;  4TV7 A;  1Z91 A;  4CYD A;  5DD4 A;  2ESH A;  4I7H A;  1QPM A;  2DU9 A;  5D4R A;  3R61 A;  2CYY A;  3CJN A;  5L3G A;  1JGS A;  1U3E M;  1J75 A;  4N0B A;  5DCM A;  4RB2 C;  3ZQ7 A;  2EV5 A;  5HS7 A;  1ZH5 A;  1XGO A;  4DNC A;  1FYK A;  3C18 A;  3KP3 A;  3VOE A;  4Q48 A;  4XBF A;  2VBW A;  2H27 A;  2JRT A;  5FLX K;  4RAZ A;  4KA4 A;  5LRR A;  2KJB A;  1UFM A;  3KEQ A;  3KE2 A;  3QU6 A;  3LA7 A;  3JW4 A;  3FXR A;  4PGG A;  2V79 A;  2XAJ A;  2F5C A;  1I6X A;  3HSR A;  3WTX C;  2DT5 A;  1D8J A;  5TJJ A;  2RNJ A;  2GAU A;  5K5Q A;  4UV8 A;  3BOQ A;  4BHP A;  4M9X A;  5ED4 A;  3SZT A;  4WXC A;  1GVJ A;  2RQP A;  1QGP A;  1LDK B;  2V1D A;  3FM5 A;  4P9U A;  3DPT A;  2GXG A;  2GA2 A;  5FGM A;  1IZ1 A;  1KQ9 A;  2MA3 A;  2A68 F;  3MWM A;  3V8J A;  1BIB A;  1Y0U A;  2A07 F;  4M6X A;  2BGC A;  1OPC A;  1U8R A;  4IRH A;  2K4B A;  2QLZ A;  3K1N A;  2HS5 A;  1Z1D A;  2BE5 F;  4HF1 A;  4EJO A;  4O3M A;  1VTN C;  1W7P D;  2XRN A;  1XGN A;  3WE2 A;  5BQT A;  1Z6T A;  3LA3 A;  2CG4 A;  5HDN A;  3VEP A;  1XB4 A;  3ZMD A;  1XSX A;  4KIB A;  4UHT A;  3HYI A;  4G7Z F;  2YU3 A;  3GZ6 A;  1J5Y A;  3FZV A;  4CDG A;  5EEH A;  3OOP A;  4IJA A;  3P9I A;  1YG2 A;  3WTV C;  3WG9 A;  4KYW A;  1YFH A;  3R0A A;  2HDC A;  3QRF F;  1PP8 F;  1G3Y A;  1PP7 U;  4B09 A;  2MD5 A;  1J7K A;  4OOI A;  3M1E A;  4O6J A;  4A0Y A;  1RI7 A;  5H6R A;  5H20 A;  2G7U A;  4ESF A;  2RDP A;  1ZG5 A;  3IKT A;  3RDI A;  3HRM A;  1S7A A;  1B1B A;  1U5T A;  1FYL A;  2EA2 A;  3LQQ A;  4ZZL A;  3GFJ A;  2AS5 F;  2VON A;  2F5D A;  3KP4 A;  1J59 A;  4YFK F;  1R1T A;  4OIR F;  3F8C A;  5D6E A;  1LEA A;  2QVO A;  2P5V A;  4AIK A;  3MZY A;  2BEO A;  5FLX Z;  1OYY A;  2ZO4 A;  3F72 A;  3OV8 A;  4A5M A;  2IW5 A;  4OMY A;  1XSV A;  2V6C A;  3ZMZ A;  2HFH A;  1O3R A;  2W84 A;  3V8K A;  4LG0 A;  1B9M A;  1WQ2 A;  2W57 A;  2Y0M A;  3RYR A;  1RUO A;  2HYF A;  4LB6 B;  3J80 K;  2FE3 A;  2OBP A;  3RJP A;  4XSZ F;  1U6G A;  5K5O A;  1Z9C A;  2FBI A;  1EH7 A;  4IRI A;  1RZ4 A;  4WXD A;  4EM1 A;  4M9S A;  5E8I A;  2GZW A;  4GO1 A;  4YFX F;  2C6Y A;  4P55 A;  2B0L A;  1XN7 A;  2UWM A;  2DQL A;  3HUG A;  3C1D A;  1DPU A;  4OMZ A;  2P5L C;  4OIO F;  1W7P B;  2WC2 A;  3LAJ A;  1T2K A;  3R0J A;  3O3K A;  1SFX A;  4R1H A;  3HSE A;  2RGV A;  2BBY A;  4KN7 X;  1ZLJ A;  2QM3 A;  1OMI A;  2IA2 A;  1LEB A;  2MLK A;  4A12 A;  4XSX F;  1TLH B;  5ICG A;  1B9N A;  3QPH A;  4CZZ A;  2A5Y B;  1IN6 A;  4HAM A;  4ZYE A;  1U5T C;  2RKH A;  1K78 B;  2COM A;  1MDM A;  1REP C;  2IPQ X;  2TDX A;  2EV0 A;  5LGN A;  5BMZ A;  2LNB A;  1HBX G;  3ML6 A;  3QU3 A;  1ONV A;  4JBA A;  3HSF A;  3DV8 A;  4KN4 X;  3KP2 A;  2L54 A;  1BN5 A;  2EFP A;  4OU0 A;  1T38 A;  3WTU C;  2VT2 A;  3O2P E;  3JAM Z;  5L3C A;  4LB5 A;  3EYI A;  2L3D A;  2VXZ A;  5DCF A;  3W6K B;  2DPU A;  2P7V B;  1TQM A;  1F9N A;  3GFI A;  3TQN A;  4M6Y A;  4ENM A;  3GXO A;  3SZP A;  1A04 A;  1O7F A;  4LGW A;  5DD8 A;  4KFC A;  3VFZ A;  3K69 A;  3NRV A;  3HTS B;  2OZU A;  4U0Y A;  1BI2 A;  2QBY B;  2V9V A;  3B73 A;  3BY6 A;  2L01 A;  1NHA A;  5FO5 A;  5FD6 A;  4ENN A;  3J80 Z;  2W25 A;  4HDU A;  3HRU A;  3WTT C;  1U78 A;  2YPR A;  4HV5 A;  5LHH A;  1SAX A;  2GA1 A;  4Y15 A;  2QQ9 A;  5DUK A;  4FX0 A;  1XGS A;  4A5N A;  3DXJ F;  2VOO A;  1SFU A;  5D8L B;  1USS A;  1OR7 A;  1R23 A;  1QZZ A;  2IJL A;  5KK1 A;  2D45 A;  2MH9 A;  1BOA A;  1YIO A;  1HKQ A;  3FWE A;  4OIQ F;  5K1Y A;  3RPU A;  3I71 A;  4EJV A;  3Q9S A;  5JR3 A;  4WX9 A;  2EFW A;  3P7N A;  4QWQ A;  5D8K B;  4LJZ F;  4OIP F;  2M5W A;  1FZP B;  3REO A;  4EV0 A;  2VOD A;  2ETH A;  3RKX A;  2BYV E;  4NB5 A;  3ZPL A;  3U2R A;  5DEQ A;  3MFK A;  4A6E A;  1I1S A;  3R4K A;  4A0Z A;  1BI1 A;  3ZMV A;  1UB9 A;  4DQ2 A;  4U7D A;  3COA C;  1BI0 A;  2DK5 A;  5E1W A;  1STZ A;  1TQI A;  3DEU A;  1G3S A;  1OKR A;  3TGN A;  1HSJ A;  3WE3 A;  4HDV A;  4LD5 A;  4BYY A;  1W7P A;  1IXC A;  4QLC U;  2STW A;  2PQ8 A;  4R8H A;  3ECH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...