2HWVA

Crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
b'SHMTIGDLTIHPDAYMVSKRGEKIELTHREFELLYYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPTYLVTRRGVGYYLRNPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding response regulator VicR
publication title Structure of the response regulator VicR DNA-binding domain.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hwvA00
2B0LA 2P7CB 4KICA 2L4MA 1B9MA 5LGUA 5J8CA 5K5QA 2KRFA 1T2KA 5K1YA 2STTA 2VBWA 3E5UA 4ENMA 5TRDA 3QAHA 3M8EA 4LG0B 3N4MA 1FWZA 1YTYA 5HDGA 2XVCA 2D1VA 4OOIA 2W57A 1ONVA 4M6XA 5CYVA 4EM2A 1XMKA 2MC3A 1BBYA 2RVCA 2EV0A 1OYIA 2HTSA 5CVVA 5CVRA 1HQCA 3EETA 2VT2A 1HBXG 1OYWA 1Z6TA 1T98A 1KA8A 4ESJA 3RYRA 1ZHFA 4ZH4F 2FQ3A 4ZZLA 1KQ9A 4PDKA 2K4BA 4HW0A 1LQ1A 3T8TA 1UCRA 1Z05A 2F5FA 4U88A 3F22A 1W4MA 2D2WA 3EYIA 2Q8KA 1SD7A 1YS7A 2DLLA 1JHHA 4KUMA 4RGXA 1R1VA 4AIKA 2V1DA 3E6DA 1KGSA 2VBZA 1S6LA 4KIBA 5JVTA 1LEAA 3WE3A 1DPRA 3R61A 4UVBA 2D1HA 1SD5A 4A2UA 4KN4X 2LKPA 2FU4A 3FMQA 4O5VA 2ACJA 4OIRF 2OBPA 2EFOA 1EV7A 2YU3A 5TJJA 4PGGA 3KFWX 4G8XA 3K0LA 3TDZC 4AD9A 5JR3A 4IJAA 1P2FA 5FO5A 1JHFA 4MNUA 1E2XA 3TO7A 2HGCA 1DP7P 2A6EF 2IP2A 3BWGA 2IPQX 2GAUA 4P96A 1T0FA 1JXSA 3K2ZA 4U0YA 1Z6RA 2EWNA 1J59A 3K69A 4I01A 1FBSA 4PGHA 1MDMA 2DK8A 4U7DA 4I0AA 1R58A 2A69F 2P5VA 4FHTA 1RUOA 2D45A 4MTEA 1IRFA 5D6FA 4CICA 1HW1A 1ODDA 3J80K 2PI0A 1REPC 4IRHA 2QENA 5HLGA 1USSA 2M5WA 2RQPA 2ISYA 4LFUA 3QRFF 1HSJA 5L3CA 3JSOA 1ZRDA 4UV8A 3T5XA 4A5NA 3T1BA 2EFWA 4L18B 1G3TA 4AWXB 3M7GA 2FA5A 3ZMDA 1H0MA 4I2OA 3K1NA 2VT3A 2Z99A 1WRJA 4HF1A 2KJBA 3I54A 4BH9A 5CVIA 2ZNZA 3DPLC 1FX7A 3K1PA 4GCVA 4M9SA 2NRAC 2R7DA 1OYYA 3TDUC 1FZPB 1ZG5A 3CO7C 1BI2A 1MJBA 2PFBA 4YIIA 1W7PD 3TKYA 4WWCA 3NQOA 4RAYA 1XSDA 3SQNA 1WSUA 5JHUA 4ZYGA 5CJ9A 4O6JA 2ZO4A 2WV0A 4LK1F 4BAYA 1H9GA 1MD0A 1B1BA 1QO0D 2LF8A 5DDGA 3WU1B 2IA2A 3FX3A 1ON2A 4A12A 1HKTA 2VXZA 5ILUA 2VOOA 4M6YA 4Z2YA 4EJWA 2MH9A 5HS8A 4CGZA 3RYPA 3B73A 5JFRA 3O3KA 5FGMA 1HW5A 1XGNA 2ZBKA 1KU9A 1ZRCA 4M9ZA 5FD5A 2HYFA 4ZZDA 2H6BA 3FMRA 3L09A 4U7BA 2P7VB 3I59B 3U1DA 2ZMEA 2X4HA 3JTHA 3RDIA 3HIFA 3LAJA 2FXAA 1XN7A 2E7WA 1O7FA 3MAJA 4BQAA 4L5IA 2FSWA 3F3XA 2GA2A 2QQAA 4FX4A 1R5GA 4YFXF 1HXDA 5D5VB 3RPQA 2FNAA 3P7NA 3V8LA 3IKTA 5IT9Z 3WG9A 3WTVC 3PQKA 1D8JA 2UXXA 4R8HA 4HLYA 1YO5C 2PBIA 3MZYA 3MWMA 3WTUC 2M45A 4U0VA 2FF4A 5HLIA 5ILVA 1TQPA 3HRTA 3QU3A 3ELKA 1CGPA 2JZYA 2IRFG 5AIPA 2HDCA 4F7ZA 2O6GE 4K2EA 1K78A 3VB2A 3D5LA 4R79A 3LFKA 5A2QK 1FYKA 1FOKA 1ZG1A 3E6MA 1FC3A 4PZJA 4RS8A 1CF7A 5J6XA 3NRVA 4N9IA 2P6SA 2OD5A 4Y13A 4L9TA 2EB7A 1YLFA 2W85A 2HOEA 1KQ0A 5FB2A 2STWA 3SFZA 4MQ9F 3GZ6A 4LMYA 2Y0MA 5HDNA 3I71A 1RUNA 2PQ8A 2Y75A 2VBXA 2VE9A 2PJPA 2LF7A 1K79A 1ZAOA 2VOPA 2P8TA 3RKYA 1KYWA 4I98B 3GO5A 5E8IA 4LLGF 5FFXA 4KA4A 2DAOA 3IL2A 2A3SA 4OMYA 1TQIA 3O2PE 3FXRA 2M87A 2GQQA 4H0EA 3ERED 4HX8A 3P9CA 4YIFA 2MLGA 2EV6A 3HRUA 2H09A 4RGUA 1SFEA 2HTJA 2XAGA 5ILSA 3TO6A 4ZYEA 1U8RA 1QZZA 3RJPA 1BI3A 3W6JB 4KFCA 3I0TA 1LB2A 4OU0A 3I53A 3IRRA 2YPRA 2HWVA 4EM1A 2RKHA 3DEUA 4G7HF 2GXBA 1QQIA 2IA0A 2L3DA 2VN2A 2OQRA 3Q9VA 5DEQA 1H9TA 3E6CC 2XAJA 3BY6A 2GZWA 1KYZA 1D5VA 1BN5A 4BXUA 1XCBA 1IN5A 2OAZA 1R1UA 1ZLJA 6PAXA 3OV8A 4EJTA 1YFHA 2FMYA 4HYEA 4YFKF 4HV6A 2R7FA 1ZGAA 2YSRA 1S7AA 1MDMB 3BP8A 1O3SA 3DFGA 2OA4A 5LRRA 1BC7C 2XASA 2UXNA 1QPMA 1IN6A 4UVCA 4Y15A 4LB6B 5BMZA 2G7UA 2XAQA 1G3WA 1J2XA 1FBQA 5DD4A 3ROUA 2L4AA 3KEQA 4M9XA 1PP8F 3FHZA 4P9FA 4CHUA 2QVOA 3DF8A 4UNOA 1FSEA 4S04A 2HZTA 2FEZA 3ZMZA 2XKOA 3ZN1A 1A04A 2CWEA 2FNPA 1C0WA 1IAWA 4HX7A 5D5WB 4D0PA 1NHAA 2KJCA 1Y0UA 2CSOA 3F6OA 4UXNA 1K6OA 1EH6A 3WTXC 4GYIA 4P9UA 3FF5A 2K27A 2OU2A 2DI3A 2PMHA 3F8BA 3DP7A 3J7AO 1XDSA 1BI1A 4ENNA 5KVRA 3PFIA 1RI7A 4A5MA 1TNSA 4EJVA 1SFUA 1ZREA 1TQMA 1D3YA 2LDUA 3ML6A 4NQWA 4WK8F 3QPTA 4M72A 2DTRA 1B9NA 1W7PA 3WODF 4ENJA 3FMSA 3EDPA 3BOQA 1PDNC 5DV5A 4CZZA 1IXCA 2DFIA 3WE2A 4EGZA 3WTWC 4GYGA 4OIPF 2F5EA 3ZMVA 5HOOA 3ZN0A 2E7XA 1OR7A 1FBUA 3C7JA 3WU0A 4B8XA 1FP1D 4MTDA 4EJOA 4EMSA 2BYVE 1BI0A 4KIFA 2LSOA 2Q2EA 3LA2A 3LQRA 3F72A 3V8JA 5D8LB 1E17A 5LHHA 2DK5A 3FZVA 3P9IA 3F6VA 2V1UA 4IRIA 3F8FA 4M73A 1VTNC 4KDPA 4XBFA 2HKXA 2XV4S 4LGWA 2ESHA 4L0YB 5ICFA 3ZQ7A 4WXDA 2ZKZA 1D8KA 3QOPA 5D4SA 2QWWA 4LJZF 3QU6A 4CXFA 2LNBA 4S05A 1L3LA 4Q5SF 4RGRA 1P92A 1XD7A 3ULQB 3HSRA 4PCQA 2V6CA 1HKQA 4A6DA 3R0JA 1IN8A 3QP5A 4ASNA 4GGGA 4U0WA 2XAFA 1FNNA 2KKOA 3J81Z 1ZYRF 1OPCA 2OZ6A 3GFIA 4EVIA 1ZH5A 2DQLA 4AIHA 4P5OA 4HV5A 3U2RA 5L3BA 2ZNYA 1K78B 1J5YA 4RB1A 2H27A 1Z9CA 1T39A 3EQLF 5ICGA 1XSXA 4I02A 1CF7B 2XAHA 4KYWA 3HHHA 4UHTA 4MEXF 2RC4A 2RDPA 1L0OC 4IPAA 3HOTA 4LK0F 1O7LA 4QLCU 3I64A 4NHJA 3HTSB 4GO1A 3V7RA 5E1XA 2G9WA 4A0YA 1SAXA 3CUQA 4A6EA 5E1WA 2QM3A 2FRHA 1J9IA 2RN7A 3BJ6A 1X3UA 3IRQA 3G73A 4EGYA 5ERIA 2ADUA 3GFJA 5DCMA 3MFKA 2UZKA 4LLNA 1TBXA 4M74A 1YW8A 2K4JA 3SXYA 2C6YA 1O57A 3J81K 3IHUA 1XGSA 1XGOA 1YG2A 4UUVA 1WWXA 5BQTA 2M30A 1GXQA 2JSCA 3KCCA 4ESBA 2EV5A 1YYVA 2DW4A 4IHTA 2FE3A 5LRSA 3AAFA 1MJ9A 3M1EA 3ZMUA 2O61A 1U2WA 5F6FA 5IT3A 1JGSA 4I09A 3WTTC 1W5TA 4BHPA 5L3FA 3O6BB 2V1XA 1ZN2A 2A68F 1IW7F 3W6KB 3HHGA 4B09A 3JSPA 5E1ZB 4IHSA 4IXAA 4HQEA 2F2EA 1OMIA 4L5JA 3E5XA 3ECOA 1IN7A 4HF2A 2O0YA 3MEXA 5E20A 4OMZA 5H6RA 3E3VA 4KMFA 5E17F 1XSVA 2EFQA 5HS7A 3GW2A 1UB9A 1F4KA 2F5DA 4YG2F 2F5CA 1T38A 4HF0A 2VONA 4IVNA 2ZFWA 2EK5A 3HUGA 2BE5F 2J5OA 2ISZA 5DCFA 2QQ9A 2IA1A 2XUBA 1FY7A 5LHGA 3LAPA 2ZCWA 2XRNA 1FSHA 3DPTA 2EJRA 3N97A 1USTA 2Q0OA 5D5UB 3R60A 4DQ2A 4BHBA 2EA4A 1U6GA 2NNYA 1ZRFA 2A61A 5CVUA 1HKSA 3LQQA 3RTRA 4L0ZB 2K86A 4CO8A 1TTYA 3KEOA 3H3UA 3KP6A 3KP5A 1IF1A 2HKOA 5H20A 2V9VA 4Q4ZF 4NB5A 3V7SA 4A0XA 1O3TA 4OIQF 3LA3A 2ESNA 1R00A 1STZA 1W7PB 4FX0A 1EH7A 2XROA 3L7WA 1UHWA 2VC1A 1KU3A 3COAC 5BS6A 2OQGA 1V3FA 3SZPA 3MQ0A 1Z7UA 2YX4A 5IT9K 3VEPA 1I1GA 3L2CA 3F23A 1Z91A 3TOAA 1P4XA 3GWZA 5FLXZ 4JK1X 4XLNF 5EEGA 3KP4A 4L9NA 4O3MA 2HFHA 1YQAA 3JAMZ 3VFZA 4OINF 3GXOA 3D0SA 5K5OA 3QP6A 1Z1DA 3KP2A 1FP2A 1MJAA 3KE2A 3V8KA 2CO5A 4M71A 4AVPA 4ENKA 1IUYA 4EV0A 2HR3A 1TLHB 5J8FA 4LD5A 1HSTA 3WTZA 1SD6A 1ZLKA 1KU7A 2HQRA 3RPUA 2O3FA 3F8MA 2DPUA 3T8RA 3JTGA 3K9TA 4LB5A 5D8KB 5D6EA 3Q9SA 2MLKA 1TW2A 1UFMA 4UV9A 2JPBA 5H6QA 1U78A 1ZARA 2NYXA 2FOKA 4HBLA 1TNTA 4Y17A 2MH2A 5ED4A 3HTUA 4G6DA 5CVJA 3GLXA 4FT8A 3V4GA 3TOBA 1ON1A 5LLQA 1W5SA 1MKMA 1FPQA 1I6XA 1LJ9A 3JAMK 1QBJA 1LDKB 1R7JA 2DU9A 3H92A 4CYDA 3FWEA 2M1BA 2IW5A 1O3QA 5BOXA 3HSFA 4G7OF 2BV6A 4UVAA 1XB4A 3V7CA 5LEJA 2XGXA 4EQQA 4XRFA 4XSXF 4KIGA 3B02A 2W84A 1WQ2A 2IJLA 3KP7A 1IXRC 3CUQB 3KP3A 3NEUA 4ZYHA 3BJAA 3GFMA 2QBYA 1S7OA 1S29A 1PUEE 1XCVA 2A6HF 2Z9OA 3JW4A 4GXOA 1BM9A 5DCMB 2QLZA 4TV7A 1G3SA 3REOA 3R6SA 4KNYA 1J7KA 4BHCA 2DT5A 2H94A 1FYMA 2E1NA 3ABTA 4DNCA 2UWMA 2FMLA 1BC8C 1RZ4A 2DO7A 3C3WA 3BPVA 3GX4X 1K7AA 2W25A 5D4RA 3ZMTA 5L3GA 4IRGA 5D5XB 4G7ZF 1O3RA 2P5LC 3GFLA 1SMTA 4KN7X 1P4WA 3H3ZA 4A0ZA 1U5TA 3CUQC 3J80Z 2J5PA 3ZPLA 3IKVA 2WWYA 1HW2A 2ZMEB 3E5QA 2MD5A 3ECHA 3IWFA 3GZ5A 4WX9A 4MEYF 4BNCA 3LWFA 5F64A 1QZYA 1V4RA 4R1HA 1PP7U 1IN4A 3R4KA 4ETSA 4KT5C 1BIBA 4P55A 2CQKA 4L9VA 3LSTA 2KIMA 3T0YA 4E70A 4I0BA 1IXSB 4HLXA 2GA1A 2IVMA 4MGRA 1F9NA 3E97A 4IF4A 4HDVA 3M9AA 3VOEA 3I58A 2AS5F 2BBYA 1SD4A 2ETHA 3CTAA 3P9KA 1B59A 4HOBA 5LHIA 4RAZA 3DKWA 5HDKA 3BPXA 3C1DA 1FLIA 3BDDA 1ZG3A 1AWCA 1RNLA 1P4AA 2ZXJA 3M8FA 1XMAA 3GUDA 4WF2A 1KQ8A 2HQNA 1U3EM 2RNJA 4ON0A 3WGGA 5HS9A 2V79A 4BYYA 5LGNA 3CJNA 3ZP5A 1UHMA 3RKWA 1TW3A 5CLSA 2YX7A 3LA7A 2TDXA 4QWQA 3MZHA 3GF2A 4WXCA 5EEHA 4LG0A 5ICEA 3TQNA 3IWZA 2CG4A 1B6AA 3ZMSA 2PN6A 4WCGA 1BOAA 2K7LA 1WI9A 5AONA 4OIOF 4RB2C 2HS5A 2RV8A 4L9JA 2XIGA 4Q48A 2GIVA 3U9GA 5FFZA 1Q1HA 2CGPA 1BIAA 2E1CA 5KK1A 3CUOA 3GVAA 3HYIA 1KU2A 2CFXA 3K1MA 1XGMA 5K5RA 2Z33A 3BZ6A 3WTYC 1WKMA 2XHKA 3HRSA 2XKPA 2L01A 5LGTA 5HVQC 1G3YA 2PEXA 3F8CA 3DXJF 4LLLA 1I27A 1I1SA 1LEBA 2FBKA 1JE8A 1J75A 4HDUA 5LBQA 3E6BA 4RGSA 2NAZA 3FM3A 3KZYA 5BPDA 2MBFA 3TO9A 1LNWA 3OOPA 1R36A 3FXUA 1LDJA 4KMUX 1BJAA 1SFXA 2AXLA 5A2QZ 3KLOA 1OKRA 4CDGA 3VODA 3F21A 1QNTA 2Z5UA 3BJOA 1DPUA 4HZFA 4HAMA 2L54A 3I5UA 1RIOH 3C18A 1R5HA 3L00A 1DUXC 2DQRA 2O8XA 2Z3YA 5L3DA 2EFPA 2QQBA 4N0BA 1GHCA 1YS6A 3F8NA 3Q5FA 1SMYF 3EUHA 3GYHX 2DBBA 5BPIA 4G9YA 2X0LA 2HYGD 2DPDA 5DUIA 2EFNA 2A07F 2PLYA 2L02A 5E8GA 2VODA 1R23A 2PG4A 4HA8A 5F1RA 2KIUA 4EJUA 2BEOA 4MHGA 2JT1A 3CLOA 1S3JA 3BROA 3G3ZA 2Y48A 2P4WA 4Q47A 1QGPA 3KLNA 3HRMA 1P6RA 1DDNA 1ZGJA 2QUFA 1YW7A 2GXGA 2RGVA 5LEKA 4RB3C 4XLPF 3WGIA 2HEOA 2KIFA 1J0RA 1IZ1A 2H6CA 2BGCA 4MQVA 2VC0A 2QBYB 1T6SA 2ZJ2A 4I7HA 3KZZA 2QZ8A 2JRTA 2A5YB 3MCZA 2FBIA 2G7HA 2WTEA 3HOSA 3KETA 5AIQA 3TGNA 2JPCA 4G94A 3RI4A 1I5ZA 4HQMA 2M8EA 3CDHA 2WC2A 1MGTA 4HX4A 5DD8A 4YFNF 1R1TA 5HLHA 1GVJA 4RB0A 1F5TA 2P6TA 3S2WA 2OZUA 2NNNA 1LVAA 3DQVC 4N9HA 3FM5A 4ESFA 2VE8A 3L9FA 3RKXA 4EM0B 3I4PA 1U5TB 2FBHA 2EA2A 2GWRA 2IT0A 3IC7A 1LDDA 2P5KA 3R0AA 1XDUA 2JTVA 3FXQA 2NS0A 5ICCA 2ELHA 2COMA 3WTSC 1EH8A 2K02A 1MZBA 4G6QA 1FT9A 1B4AA 1YW9A 1F1ZA 1G6NA 1AOYA 2PMUA 3I59A 5JI6A 4XSZF 4WXHA 2QYOA 3ISPA 1S8NA 3CO6C 5FD6A 4JBAA 2MA3A 5DYMA 3QPHA 1IRGA 1G4DA 3GEZA 5E18F 3SZTA 2YR2A 3WGHA 3RIRA 2O03A 1U5TC 3DV8A 3EYYA 2W24A 3PQJA 1YIOA 3ABUA 4JQFA 3SHFA 1R22A 3HSEA 2CW0F 2R3SA 1ULYA 1FYLA 1GXPA 5DUKA 2CYYA 4AIJA 2VBYA 5L3EA 5FLXK 4ZYDA
chains in the Genus database with same CATH superfamily
4RLQA 3MMYB 2E60A 2B0LA 2P7CB 4KICA 1JUPA 2L4MA 1B9MA 5LGUA 5J8CA 3AG1H 5HNHA 5K5QA 3MKYB 1ZGWA 3OSGA 1FOXA 2KRFA 4BXFA 2AXTC 2OUMA 1T2KA 5K1YA 4BL0B 4DJAA 1IUFA 2STTA 1YX3A 3VWBA 2X9DA 2OV7A 2EINH 3AG4H 3ZCOA 3DBLB 4GDFA 2VBWA 4C2UA 2M8GX 3O8HA 3E5UA 1VQ8I 1DU0A 4ENMA 5TRDA 5IY5H 3QAHA 4ZTFA 3M8EA 4XIDA 4LG0B 2X6XA 3N4MA 1FWZA 1GUUA 1YTYA 5HDGA 2VQGA 4EEFG 2XB5A 2XVCA 2D1VA 3KX2A 1WJDA 5JLWA 4OOIA 2W57A 4PJLA 4B3AA 1ONVA 4EATA 1MMDA 4M6XA 2IS4A 2F4OB 5CYVA 4EM2A 3ZRGA 1XMKA 4OAZA 3CCRI 1Y56A 1BBYA 2MC3A 2RVCA 2EV0A 2ZXHA 5DTDA 2R5YA 1OYIA 2HTSA 1BR2A 1P7IA 2JMWA 1HQCA 2Y0SN 3EETA 5CVRA 2VT2A 5CVVA 2OPTA 2CUJA 2VKHA 2QQ8A 2XSJC 1OYWA 1Z6TA 1T98A 1HBXG 1KA8A 3HDDA 3OOUA 2R7UA 4B3XA 4ESJA 2L9VA 2WBMA 2EZLA 3RYRA 2RQQA 3CESA 2UUZA 1VQLI 1ZHFA 4ZH4F 2HYJA 3SZGA 1RRJA 2X1EA 2FQ3A 2WAQA 1I39A 4ZZLA 1KQ9A 1QPIA 4PDKA 3UR3C 2K4BA 4IHVA 3HOWJ 4HW0A 3I56I 1ETOA 5KAFC 1LQ1A 2L9RA 5J4YA 3T8TA 2ECBA 1RR8C 3BTLA 1H88C 1VQPI 1UCRA 1D0YA 4F93B 1Z05A 5IP7J 1W5CC 5C44J 2F5FA 3LSMA 1U9NA 4U88A 3F22A 1W4MA 3W6VA 2D2WA 2X6OA 1QHGA 3AG3H 3EYIA 1WH7A 1ETXA 1UAAA 3L2WA 2BW3A 2Q8KA 1SD7A 1XC5A 1YS7A 2DLLA 2M34A 1JHHA 1IDZA 4KUMA 4RGXA 1R1VA 4AIKA 3BG5A 2V1DA 3E6DA 1KGSA 2VBZA 1S6LA 4FE4A 4KIBA 2LY1A 5JVTA 3OYIA 1O4XA 1LEAA 2JRMA 3WE3A 1DPRA 4D7NA 3R61A 4UVBA 4Y33A 2D1HA 1SD5A 2WB1A 4A2UA 4KN4X 1LFUP 2LKPA 2XGDA 3BG9A 4MIMA 2FU4A 2BY3A 2EZKA 3FMQA 4IOCF 2WY8Q 4O5VA 2ACJA 4OIRF 2OBPA 2VQHA 1VFCA 2DA3A 2EFOA 1EV7A 2YU3A 5TJJA 3DBRB 1RESA 3KFWX 4PGGA 5HLTA 4G8XA 2EZHA 3K0LA 3TDZC 1MBJA 4LG3A 1FMVA 4AD9A 3GTQJ 5JR3A 3LMMA 1MBKA 1P2FA 2Y69H 4IJAA 5FO5A 1JHFA 4MNUA 1E2XA 3TO7A 2HGCA 1DP7P 4JX5A 1GV5A 2VKEA 2A6EF 1JJ8C 2A5WA 1QHHD 3DKYA 2XGEA 3OL3A 4ZDLA 1PUFB 2IP2A 3BWGA 5E3LA 2KLOA 2IPQX 2GAUA 4P96A 4F52A 4PJ0C 1T0FA 1X1PA 1JXSA 3K2ZA 4U0YA 1Z6RA 3S93A 2EWNA 1J59A 3K69A 1LFPA 2X48A 4JYKA 4I01A 4PSXA 4NDLA 2JN6A 1FBSA 4PGHA 1MDMA 2W7NA 5B1AH 2GBYA 2DK8A 4U7DA 4I0AA 4XL9A 1R58A 2A69F 2E1OA 3CF5F 2BXZA 4BQNA 2LBFB 3OL4A 2P5VA 4M3BA 4FHTA 4J01A 1RUOA 1UHSA 2D45A 1EF4A 4MTEA 1IRFA 2HZDA 5D6FA 4CICA 3I9V2 1X1BA 1HW1A 1SANA 1ODDA 2MYSA 3J80K 5LFAA 1REPC 2PI0A 4IRHA 2QENA 5HLGA 1USSA 1WHUA 2M5WA 2RQPA 2ISYA 4AYBN 4ANJA 3OSFA 4LFUA 4AIDA 3QRFF 4XRMA 1HSJA 2M0CA 3HZJA 2E2JJ 2K9SA 5L3CA 3JSOA 1DGWY 1ZRDA 2DYRH 1OFCX 4UV8A 3T5XA 1SAUA 2NVTJ 2DMQA 3ZQIA 1ETKA 4A5NA 3DCFA 3T1BA 1TWGJ 3CMAI 2HVRA 2EFWA 3TEDA 2JA5J 4XKBA 2DA2A 1EJ9A 4L18B 3GTGJ 1E3HA 1G3TA 2DMPA 2PMZN 4AWXB 3M7GA 4D9JA 2FA5A 3ZMDA 1H0MA 4I2OA 1NG7A 3K1NA 2KL4A 1AU7A 5K7FA 1P9QC 2VT3A 2Z99A 4BDZA 4PSWA 5JHFA 1WRJA 4HF1A 2KJBA 2VJIA 3I54A 2H8RA 5FKMA 1IG7A 4BH9A 5CVIA 2ZNZA 3DPLC 1FX7A 4BQOA 1MBHA 3K1PA 4GCVA 4XLEA 4M9SA 5B3SH 2R7DA 1OYYA 3TDUC 1FZPB 2NRAC 1Z21A 1ZG5A 1A36A 3CO7C 2V4JC 1BI2A 1MJBA 2PFBA 4YIIA 5GPAA 1W7PD 3TKYA 4C9YA 4WWCA 3NQOA 5DM6F 5EJCA 4RAYA 1XSDA 2CRGA 3SQNA 1WSUA 4JP0A 5JHUA 5M3MJ 3L2UA 4ZYGA 5CJ9A 4B4CA 3CMEI 4O6JA 3PNYA 2R7RA 2ZO4A 1WI3A 3S15J 2WV0A 4LK1F 3FBIB 4BE2A 2XPWA 1OCCH 1PYVA 4BAYA 5FRMA 1H9GA 4X0GA 2F4IA 1MD0A 1HDDC 1B1BA 1QO0D 2LF8A 5DDGA 1FIPA 2DA4A 3WU1B 2IA2A 1NTCA 3FX3A 1ON2A 2DOAA 4F55A 4A12A 2H1KA 1HKTA 2LKXA 2VXZA 1WJBA 3F0CA 4ZDPA 4KISA 5ILUA 2VOOA 1XPXA 4M6YA 4Z2YA 4EJWA 4Y3OA 2MH9A 2RNGA 2L7ZA 5HS8A 2R7WA 2IBDA 5H2FC 4FQGA 4C3HJ 3F9KA 3FXLA 2DFFA 4CGZA 3RYPA 2HDWA 2ZC2A 3FIWA 3B73A 5JFRA 3O3KA 5FGMA 3E7LA 1W36C 1HW5A 1XGNA 2ZBKA 1KU9A 4MLOA 3PIPF 1ZRCA 4M9ZA 3HOZJ 5FD5A 2HYFA 4ZZDA 2CV2A 2H6BA 3FMRA 3L09A 9ANTA 4HG2A 1HCRA 4U7BA 3FISA 3GZNB 1FEXA 2P7VB 4CYCB 3I59B 3U1DA 2DT7B 4BU2A 2ZMEA 3PL8A 4G12A 2QCOA 2X4HA 3JTHA 4RBOA 2W4SA 1MH3A 3RDIA 4BY1J 1E3OC 2HU9A 5EYRA 2A05A 3K4JA 3HIFA 2LY2A 1FMWA 1Z3XA 5CQGA 5K7ZA 1B8IB 3KIOA 2M7AA 4UB8C 3LAJA 2FXAA 1XN7A 2CUFA 2E7WA 1O7FA 2M7BA 3MAJA 1OCTC 3PUFA 4BQAA 1ZKGA 1W0TA 4L5IA 2FSWA 3F3XA 2GA2A 2QQAA 4IX7A 4FX4A 2FJ1A 1R5GA 4YFXF 1HXDA 2LVSA 3S1NJ 5D5VB 4JX6A 3J7ZI 4II2A 3RPQA 2FNAA 2XC7A 3P7NA 3ZGKA 4A3MJ 1YJ9I 4FISA 2CQ7A 2EH3A 3V8LA 3IKTA 2ZJQF 5IT9Z 3JRIA 3WG9A 2KZGA 3WTVC 3PQKA 4FETA 2UXXA 1D8JA 3Q0WA 4R8HA 4HLYA 4E7HA 1YO5C 1MNDA 3GLLA 1X4OA 2L5QA 2JWTA 2PBIA 3MZYA 3MWMA 3WTUC 3PO2J 2XDVA 3OYAA 1R9TJ 4A3EJ 2M45A 1BA5A 2A6TA 4HNVA 2JVHA 1HF0A 2B7EA 4U0VA 3IH3A 2FF4A 5HLIA 4CCNA 5ILVA 1F36A 2ID6A 4F91B 1TQPA 3CCYA 1TT5B 3ABMH 3HRTA 3QU3A 2V6EA 3ZXSA 1OCRH 3ELKA 5F0FA 1CGPA 2JZYA 1YJNI 2IRFG 5AIPA 2H8WA 2HDCA 1P7JA 4PUSA 3RQIA 4NC7A 3S2HJ 3BG3A 4F7ZA 1SFOJ 2O6GE 4K2EA 1K78A 1Y0NA 4OWRB 1D1BA 3DU6A 3VB2A 3D5LA 4R79A 2L9NA 3LFKA 3QPSA 5A2QK 1S72I 1FYKA 3K4LA 4CA0A 4A3FJ 1FOKA 1ZG1A 2Y2ZA 3E6MA 1X1DA 1FC3A 4PZJA 2R0QC 3W2AA 4RS8A 1CF7A 5J6XA 2DDAA 3H5NA 3NRVA 4N9IA 2P6SA 3LSHA 2R7VA 2OD5A 4Y13A 4L9TA 2EB7A 1YLFA 2W85A 3BLYA 5FKKA 2HOEA 1KQ0A 5FB2A 2R5YB 1K4TA 2STWA 3SFZA 4MQ9F 4A3GJ 2CV0A 3GZ6A 4V2GA 4LMYA 2Y0MA 5HDNA 3CJRB 3I71A 1RUNA 2PQ8A 2LD5A 1N78A 2LH9A 2Y75A 4A3LJ 1U8BA 2VBXA 1Y1VJ 1WGXA 3JRBA 2VE9A 2PJPA 3WU2C 2LF7A 1K79A 1ZAOA 2VOPA 2GLOA 2P8TA 3RKYA 3KYLA 4DBRA 1KYWA 4I98B 3GO5A 5E8IA 1XX5A 4LLGF 5FFXA 4KA4A 2DAOA 3IL2A 2M0MA 3VYUB 4U87A 3L2VA 3DEWA 2A3SA 2KQRA 3LSPA 4AVZA 1Z77A 2QSFX 5DS9A 4OMYA 3HL2A 1TQIA 3O2PE 4ZJZA 3FXRA 2M87A 2GQQA 4H0EA 3ERED 4HX8A 2CUEA 2XRLA 3P9CA 5FRNA 2IS1A 4YIFA 2BW3B 2MLGA 2Y0SA 2OCCH 3SDBA 3EPZA 1A31A 1IV6A 2EV6A 3HRUA 2H09A 4RGUA 4XK4A 1EA3A 1OISA 1VQ7I 1SFEA 2HTJA 2XAGA 5ILSA 4BEHA 1XS9A 3TO6A 4ZYEA 4CH7A 3G2BA 1U8RA 1S5LC 1QZZA 3RJPA 2LMDA 4XORA 1BI3A 3H9QA 3W6JB 4CUGA 4KFCA 1WPKA 5J1YA 1HDPA 3I0TA 3AL0B 1QZEA 2HQ5A 2NXNB 2DA7A 1LB2A 4OU0A 3I53A 4RM3A 3A2KA 3IRRA 4UUSB 1ZQ3P 2PJRA 1NK3P 2YPRA 4AC0A 2HWVA 4EM1A 3A01A 2RKHA 3DEUA 3SDGA 4G7HF 3C2HA 2GXBA 2KMUA 2LLKA 1QQIA 1R4MB 2IA0A 3DLAA 3UKGA 2L3DA 3OYCA 3RKQA 2IS2A 2VN2A 2OQRA 3Q9VA 5DEQA 1H9TA 3E6CC 3PIOF 2XAJA 3BY6A 3OMYA 2CUZA 3LSRA 2IGNA 2GZWA 1KYZA 4ZYDA 1D5VA 1BN5A 4BXUA 4DGWB 2HVQA 4YRVA 2HOTA 1XCBA 5CPRB 1IN5A 2OAZA 4E7SA 2LG4A 2OTLI 1R1UA 1ZLJA 6PAXA 2LC2A 3OV8A 4BQQA 3AG2H 2ZJRF 1YFHA 4EJTA 3CCLI 2FMYA 4HYEA 4I6ZA 1MNEA 4YFKF 2DODA 3BZKA 2R7FA 4HV6A 5EG0A 1ZGAA 3HGYA 2YSRA 1S7AA 4M3EA 1MDMB 1JT6A 3AL0C 1TWFJ 3BP8A 5HNFA 1O3SA 3DFGA 2OA4A 5LRRA 1BC7C 2I8DA 4B43A 2E2HJ 3CF2A 2XASA 4NC8A 2KFDA 1QPMA 2UXNA 1IN6A 4UVCA 4Y15A 4LB6B 5BMZA 4ZDOA 2G7UA 1UZCA 2XAQA 3OIQA 1G3WA 4OAYA 1J2XA 2HXIA 1FBQA 5DD4A 3ROUA 2L4AA 3KEQA 5J40A 4M9XA 1PP8F 2DDBA 1ERDA 4BE1A 3FHZA 2DFEA 4P9FA 4CHUA 2QVOA 4J00A 4W1UA 1WJFA 3DF8A 4UNOA 2ZSHB 1FSEA 2LKSA 3JCUC 4S04A 1FOYA 1RETA 1JUMA 2FEZA 2HZTA 2R7QA 3ZMZA 2XKOA 3ZQQA 2CS3A 3ZN1A 1A04A 2X1CA 2CWEA 2FNPA 1C0WA 1IAWA 4HX7A 5D5WB 2IEKA 4A3DJ 3CCVI 4D0PA 1NHAA 2KJCA 1Y0UA 2CSOA 3F6OA 5EGOA 4UXNA 1K6OA 3M1CA 1D0XA 1EH6A 1MMNA 2W1OA 4GYIA 5F0CA 3WTXC 4P9UA 2EPFA 3TP3A 4A3BJ 3FF5A 2K27A 3BR2A 2OU2A 3ABLH 1ZTRA 2DI3A 2DJNA 2PMHA 3F8BA 2O8KA 2NVUB 3DP7A 3J7AO 2R7SA 1XDSA 1BI1A 4ENNA 5KVRA 3PFIA 5F1JA 1JKQC 1RI7A 4XMYA 2AO9A 4QIWN 2RAEA 1TNSA 4A5MA 4EJVA 1SFUA 1ZREA 1TQMA 2VASA 1D3YA 1HC8A 3TP0A 2JK3A 2LDUA 1WJEA 3ABKH 5IP6A 2E1MB 1MMSA 4X1EA 1TWHJ 3ML6A 4NQWA 4WK8F 3JRDA 1PVEA 3QPTA 5C4JJ 2PMZA 4BJ6C 4M72A 2DTRA 1B9NA 1W7PA 4HRIA 2KRHA 3WODF 1Z0XA 4ENJA 2ELJA 3FMSA 2TCTA 5GP9A 2B63J 3EDPA 3BOQA 1PDNC 1OCPA 5DV5A 4XOTA 4CZZA 2E5ZA 2ZXIA 5F04A 1IXCA 3CC7I 2DFIA 2VPRA 3WE2A 4N4OB 2JA8J 1KONA 4EGZA 1V54H 1Q1VA 1N77A 3WTWC 4M3FA 1Y6IA 3U21A 4GYGA 1ZR2A 4OIPF 2F5EA 2EILH 3ZMVA 5HOOA 3ZN0A 2JA7J 2E19A 2NVXJ 2V7FA 4Y7NJ 1G59A 3FK6A 4DZJA 1F43A 2LK2A 2EIKH 4FE7A 3G1LA 2E7XA 1OR7A 1FBUA 3C7JA 3QYFA 3KEYA 3WU0A 4B8XA 4D1QA 4V19K 1LKXA 1FP1D 2BHYA 3H0GJ 2M9HA 4BGDA 4MTDA 2DT6A 5GPCA 3HKZN 4EJOA 2YS9A 1VF9A 4EMSA 2BYVE 2R5ZB 2VB6A 3HXLA 1BI0A 4DW6A 3BQZA 4KIFA 3DU5A 3O8GA 5IPAA 2LSOA 3SFIA 1TZLA 2Q2EA 2E36A 3CMMA 1QA6A 3LA2A 3WHBA 1N75A 3LQRA 4XOPA 3F72A 3V8JA 5D8LB 1E17A 1QRYA 5LHHA 2DK5A 3FZVA 3P9IA 3F6VA 3QYBA 3VYRB 2V1UA 4IRIA 3BR6A 2DA6A 3F8FA 4M73A 1VTNC 4XBFA 4KDPA 3LL7A 4LIUA 2HKXA 3BG6A 2XV4S 4BXXJ 4LGWA 2ESHA 4L0YB 5ICFA 3RPUD 3ZQ7A 4PJNA 2V9PA 3CJQB 4WXDA 3LOCA 2ZKZA 3LFUA 1D8KA 3FXJA 1R71A 1WJ5A 4XLCA 3QOPA 3SEQA 5D4SA 2K9MA 2QWWA 4IQJA 4LJZF 1NH3A 3QU6A 4II3A 4CXFA 5JVGF 2QGUA 4N4NB 2LNBA 3OWTA 4S05A 1L3LA 2VJ5A 4AUXA 4Q5SF 4RGRA 4RAFA 1P92A 1S7EA 1XD7A 2LTPA 3ULQB 3HSRA 1YIJI 3K4NA 2V6CA 4PCQA 4FASD 1HKQA 4A6DA 1HA8A 3R0JA 4IQ4A 3K4KA 3BT9A 1DGRM 1IN8A 3OYKA 3QP5A 4I99C 4ASNA 4GGGA 4U0WA 2XAFA 1FNNA 2B9SA 4NC6A 2KKOA 3J81Z 1ZYRF 2NVQJ 1OPCA 3B6CA 2OZ6A 3PNTA 2NVYJ 3GFIA 3CCMI 4XICA 3L2QA 3HM5A 4I76A 4PFOA 3L1PA 2X1DA 4EVIA 1MNMC 4XONA 1ZH5A 3CMYA 2M2EA 1XMXA 2DQLA 3K4BA 4AIHA 4P5OA 4HV5A 4M3DA 3U2RA 4BE0A 1OLTA 3BCAA 5L3BA 2ZB9A 4Y52J 2ZNYA 1K78B 2I10A 1J5YA 1JTYA 2K3PA 4QPOA 4RB1A 2H27A 1Z9CA 4ABZA 2GIZA 1T39A 3EQLF 5ICGA 3ASOH 1XSXA 2EQRA 2QSGX 4I02A 1BW5A 3K7AJ 1CF7B 2XAHA 1W0UA 3VSKA 4KYWA 3VPRA 2BZTA 3KPHA 4LITA 3HHHA 4UHTA 4RA2A 3SYTA 1JT0A 3EUHC 2W48A 2JSPA 4MEXF 2RC4A 1X3ZB 2RDPA 1S9HA 3HOYJ 3EUAA 1L0OC 3HPGA 3S1RJ 4IPAA 2M4GA 3HOTA 4LK0F 1O7LA 2L7KA 4QLCU 1FOWA 3I64A 4NHJA 3HTSB 4GO1A 3V7RA 2KP6A 5E1XA 2G9WA 4A0YA 1SAXA 3CUQA 1KZHA 4A6EA 5E1WA 5EDNA 2QM3A 2WADA 2R7ZJ 3M4OJ 2FRHA 2CQXA 1J9IA 2L0KA 2NOGA 2RN7A 3BJ6A 1X3UA 3IRQA 1H8AC 1JUSA 3G73A 2HPMA 5BNGA 4EGYA 1RR7A 5ERIA 3OYFA 4MFDA 5M5YJ 2ADUA 1R49A 1N25A 2E2IJ 4XKVA 4C3JJ 4B47A 3GFJA 4F3QA 3U1KA 5DCMA 2Z16A 5CQEA 3MFKA 2UZKA 3A02A 5FLVA 3HOXJ 4LLNA 1TBXA 4M74A 1YW8A 2K4JA 2ID3A 3SXYA 2C6YA 5EEAA 1O57A 2QKLB 3J81K 4BJTA 2F4MB 3IHUA 1XGSA 1XGOA 2DMTA 1YG2A 4BEHB 4CCKA 2DMUA 4UUVA 2DJIA 2O7OA 1WWXA 5BQTA 4CZCA 2M30A 1GXQA 2JSCA 3KCCA 4ESBA 4BBSJ 2EV5A 1YYVA 1Z3YA 2DW4A 4IHTA 2FE3A 5LRSA 2JQ7A 1ENHA 3AAFA 2MW8A 1MJ9A 3M1EA 3OYNA 3ZMUA 3S16J 2JVGA 2O61A 1U2WA 2BY2A 5F6FA 5IT3A 3CCSI 1JGSA 3BTCA 2PJRB 2EIJH 4I09A 2ME6A 3WTTC 1W5TA 3G1OA 3MKLA 4BHPA 5L3FA 3A01B 4MFEA 5GAGJ 3MKZA 3O6BB 2V1XA 1ZN2A 2A68F 1IW7F 3W6KB 3HHGA 4IOAF 1UJ8A 3MKWB 4B09A 3MD2A 3JSPA 3NARA 2XF5A 3K70C 5E1ZB 4IHSA 4IXAA 5IOZA 5KCMA 2CH0A 1WJCA 1X4PA 3PSIA 2VXDA 4HQEA 1NK2P 2F2EA 1OMIA 1ZR4A 4L5JA 4NUBA 3E5XA 1FJLA 1TT0A 2VJJA 3ECOA 3B6AA 2WY7Q 1IN7A 4HF2A 2O0YA 3MEXA 4GRIA 1OCZH 1POGA 3JRFA 5EG0B 5C4XJ 5E20A 4QSHA 3OYDA 4OMZA 5H6RA 3WG7H 3E3VA 4KMFA 5E17F 1V5GA 2YU9J 2E71A 2VL8A 4DYCA 3PM1A 1XSVA 2CW7A 4H4KC 5J4VA 3IH2A 2EFQA 5HS7A 1D0ZA 3GW2A 1UB9A 3RCOA 1F4KA 4MO7A 3WHCA 4AM3A 2DA1A 2F5DA 5K7HA 4YG2F 3H1CA 2F5CA 1T38A 4HF0A 2WAFA 4E7IA 2L7MP 3HOVJ 2VONA 3HG9A 1YRNA 4BUPA 3DBHB 4IVNA 3TMOA 3DLLF 1YOVB 2ZFWA 2MG4A 2EK5A 3HUGA 2BE5F 3PUBA 2FX0A 2J5OA 3HEFA 2HQAA 2ISZA 2VJ4A 5DCFA 1MMGA 2QQ9A 2IA1A 2XUBA 1FY7A 5LHGA 1MBEA 2BVMA 2FUG2 3LAPA 2ZCWA 2XRNA 2R7TA 1FSHA 3DPTA 2EJRA 3GBGA 4LOCA 3N97A 4KITB 1FIAA 2R4GA 3BR1A 1USTA 3H5AA 2Q0OA 5D5UB 3S3NA 1LE8A 2K85A 1E0EA 5EGOB 3R60A 4DQ2A 4BHBA 2EA4A 1U6GA 2NNYA 1ZRFA 4J19A 2A61A 5CVUA 1HKSA 2L9SA 3OS0A 3LQQA 3RTRA 4L0ZB 2K86A 1MSEC 5FLMJ 3H0DA 4CO8A 1TTYA 3SJMA 3HC7A 3KEOA 3H3UA 4DZPA 1MBGA 3QQAA 3KP6A 3KP5A 1IF1A 4P1WA 2HKOA 4BY7J 5H20A 2V9VA 4Q4ZF 4NB5A 5FKOA 3V7SA 1TWCJ 4A0XA 3ASNH 1O3TA 4OIQF 3LA3A 1APLC 4ZC3A 2NS8A 3FXOA 3SEZA 3FHNA 2ESNA 1R00A 1PJRA 3PNVA 1STZA 1W7PB 2AHQA 1EH7A 4FX0A 2XROA 3L7WA 1UHWA 3CLQA 5HODA 5GADJ 3G71I 2VC1A 2HI3A 1GLNA 3PFYA 3FK7A 1KU3A 2K9NA 4UY8I 3COAC 2ZFUA 4YIRX 5BS6A 5E3OA 2OQGA 1V3FA 3SZPA 1RC9A 3MQ0A 1Z7UA 2YX4A 5IT9K 3VEPA 3G4SI 1I1GA 3L2CA 3BC8A 3F23A 3LSKA 4HSTA 1Z91A 3K2AA 1JKOC 3D5RC 1X58A 2CW8A 2F5VA 3K4CA 3TOAA 2TRTA 5FKNA 1HOMA 2UV1A 4RDUA 2HOAA 1P4XA 1JI8A 3W2WA 3GWZA 5FLXZ 3CJTB 4JK1X 4XLNF 5EEGA 3KP4A 4L9NA 1VQOI 4O3MA 2HFHA 3CP2A 1YQAA 4RMNA 3JAMZ 4BS9A 3VFZA 2Q2EB 2CQQA 4OINF 5E3MA 3GXOA 3D0SA 1DQUA 3KZIC 5K5OA 5EF6A 3OS2A 2IGMA 3QP6A 1Z1DA 3CP8A 5IYCJ 1ZK8A 1OQYA 2GOMA 3KP2A 1FP2A 1MJAA 2DFHA 2VQLA 2DN0A 4LIVA 3KE2A 3V8KA 1YHQI 4RM2A 1UELB 1AKHA 2PX9A 2CO5A 4HNUA 4M71A 4AVPA 4ENKA 1IUYA 3CD6I 3HPHA 4B48A 4EV0A 2HR3A 1TLHB 1MMAA 5J8FA 4LD5A 4BDYA 2R93J 1HSTA 3VSLA 2X85A 3WTZA 1SD6A 1M1EB 2VKVA 4E4HA 3K4MA 4BBRJ 1ZLKA 1SVOA 3ESWB 1KU7A 2IS6A 2HQRA 3RPUA 2BY1A 2X6YA 2O3FA 1ORKA 3FKJA 3ONQA 2DOFA 2LYCA 3DTEA 5B5EC 4BKXA 2LY9A 3F8MA 2DPUA 3S8PA 2L7FP 4C2TA 3T8RA 3JTGA 3K9TA 4LB5A 5D8KB 5D6EA 5TGTA 3Q9SA 1WCMJ 2F48A 2MLKA 1TW2A 4AU7A 1UFMA 4UV9A 2JPBA 5H6QA 1U78A 1ZARA 2NYXA 2Y31A 3I4NJ 4CCJA 1B72A 2FOKA 2COBA 4HBLA 2Y9ZA 1TNTA 4Y17A 3TW7A 2MH2A 2DXIA 5J1RA 4Y4RA 4KT6A 2V9KA 1TP4A 3DWLE 3TW6A 1LPQA 5GAHJ 5ED4A 3HTUA 4G6DA 5CVJA 5DM7F 3GLXA 4FT8A 3V4GA 3TOBA 2GOXB 1ON1A 5LLQA 1W5SA 3IP4B 1SC7A 3ERMA 3ZOBA 3V42A 1MKMA 1FPQA 3BCBA 1I6XA 1LJ9A 4ZYAA 3JAMK 2GM4A 2CQNA 3FXKA 1CQTA 5KHDA 1T0FC 1QBJA 1LDKB 5GTHC 3OY9A 4FTHA 1R7JA 2DU9A 4XQFA 1JKPC 1T56A 3H92A 1VNDA 4CYDA 2BXYA 3DEEA 2M1BA 3FWEA 2IW5A 4B44A 1O3QA 3IH4A 5BOXA 3QODA 3HSFA 3A1YA 4G7OF 2BV6A 4UVAA 1XB4A 3V7CA 5LEJA 2XGXA 3VYSB 4EQQA 2OJED 3BG7A 4XRFA 2FQ4A 3NWSA 4XSXF 1IRXA 4AYBA 4KIGA 1SEUA 3S32A 3LNQA 3B02A 1UMQA 2W84A 1WQ2A 1T08B 2IJLA 3KP7A 1IXRC 3A0HC 2ECCA 3CUQB 3KP3A 3RZOJ 3M3YJ 3NEUA 2VQCA 4ZYHA 3BJAA 3HBLA 2H1LA 3GFMA 2QBYA 3FDYA 1S7OA 1NG6A 1S29A 2P81A 1PUEE 1W36D 1XCVA 1Y1WJ 2R7OA 2A6HF 1WFXA 4RAGA 3DTIA 3G1MA 3GTPJ 4A3CJ 2Z9OA 3JW4A 2RREA 4GXOA 1BW6A 2GXAA 2KT0A 3RZDJ 1BM9A 5DCMB 4G6TB 1ITYA 4NBQA 2QLZA 2XAUA 4E7JA 4TV7A 1G3SA 1D1CA 2MABA 3REOA 5IP9J 2LREA 5B1BH 2R7XA 3R6SA 4KNYA 1J7KA 4BHCA 4YELA 1I3QJ 2DT5A 2H94A 1FYMA 3K70D 2E1NA 1D1AA 5LD2C 3NWTA 3ABTA 3GCMA 4DNCA 2UWMA 2FMLA 1BC8C 1RZ4A 2DO7A 3C3WA 3CQZJ 3JR9A 3CCJI 3BPVA 4HEA2 3GX4X 1K7AA 2W25A 5D4RA 3ZMTA 1BR4A 1RKWA 2HXOA 3QYEA 5L3GA 4IRGA 5D5XB 4G7ZF 4A3JJ 2QF7A 1O3RA 2P5LC 3GFLA 5IYBJ 1SMTA 3I3LA 4KN7X 1T33A 1P4WA 3LSJA 3H3ZA 2O9LA 1BJZA 4A0ZA 5M3FJ 1U5TA 3CUQC 1H89C 1W1WE 3A03A 1BL0A 3J7AY 3J80Z 2J5PA 2N8GA 3ZPLA 4C3IJ 1VQMI 1FTZA 3IKVA 2WWYA 1HW2A 1UG0A 4QPQA 2E1MC 1BOBA 2BOLA 3AFHA 4IHYA 2ZMEB 3E5QA 1IRZA 5J1UA 1JKRC 2MD5A 3ECHA 3Q0VA 3GTKJ 3IWFA 3GZ5A 2MGQA 4WX9A 1X2MA 4MEYF 1R4NB 3E1SA 4PFPA 2F6CA 4BNCA 1LFBA 3LWFA 5F64A 1QZYA 1V4RA 4UUSA 3OYJA 4M3GA 4DYRA 3OIPA 2CMPA 4R1HA 3GTMJ 2JUCA 2ELKA 2DOEA 1PP7U 2ME0A 1QVTA 1ACIA 1IN4A 3GMEA 1OJLA 2XGCA 1I6HJ 4C2MJ 3H3VK 3R4KA 4XN0A 5JLXA 5KAIC 4ETSA 4E7ZA 1A5JA 4DBQA 4KT5C 1BIBA 3BTJA 2OCEA 3DTKA 3MN2A 4P55A 1X3WB 4L5EA 3S1MJ 2CQKA 3FKIJ 4L9VA 3LSTA 2KIMA 3BZCA 4XN3A 3T0YA 3S2DJ 4E70A 3OR2C 4I0BA 1IXSB 4XKWA 4HLXA 2GA1A 1LVKA 2IVMA 4MGRA 1F9NA 3E97A 4IF4A 3CCEI 2VKDA 2XF7A 5F08A 3M9AA 2X51A 3I58A 3VOEA 4HDVA 2AS5F 1V55H 2BBYA 4ITVA 3I4MJ 1SD4A 2ETHA 3CTAA 3P9KA 3UNGC 1B59A 2OF7A 3GTJJ 2Q1ZB 2Z1DA 4HOBA 1U9OA 5LHIA 4XLAA 2ZMEC 3KYDB 4S0HB 4RAZA 4CCOA 4IKFA 1YRNB 3DKWA 5HDKA 3BPXA 3C1DA 4IEJA 1FLIA 2CFOA 3BDDA 2NOJB 3GTOJ 1ZG3A 2JJ7A 3HUGB 4PJJA 3ZQCA 1AWCA 1RNLA 2FD5A 5FJ8J 2KDOA 1P4AA 2ZXJA 2V26A 4XLFA 3S3OA 1ETWA 3ZQFA 3M8FA 1XMAA 2NS7A 3GUDA 3CDLA 3JRHA 1IGNA 3NAUA 1SVMA 3OYEA 1G2HA 3A0BC 1YX5A 4WF2A 1KQ8A 3BTIA 2HQNA 1U3EM 2RNJA 1X1CA 2G0EA 4ON0A 2K5CA 2FOWA 4W97A 1LE8B 1JGGA 1MSFC 3WGGA 1RPWA 5HS9A 3BR5A 2ZSIB 3CC2I 2V79A 3CCUI 4BYYA 2HNHA 1VQKI 5LGNA 4FCYA 1ETQA 3CJNA 4CCLA 5F0HA 1IV8A 4F92B 3ZP5A 1UHMA 3RKWA 1TW3A 5CLSA 2YX7A 2LP0A 5EZGA 3X2QH 3LA7A 4XRSA 4UUTA 2TDXA 4QWQA 3MZHA 1OCOH 3GF2A 2WAQN 2IAIA 4WXCA 5EEHA 1LUJB 4LG0A 1QU3A 2ICWG 5M5WJ 1TL8A 4XR6A 5E79C 5ICEA 2LFBA 1FTTA 1XTAA 3TQNA 3IWZA 2CG4A 1U0JA 1B6AA 5F27A 3ZMSA 2YUSA 2KHMA 2PN6A 2IXSA 4WCGA 4A69C 1BOAA 4CCMA 2M4KA 2K7LA 1WI9A 5AONA 3J7YJ 1I50J 1ZELA 2XF6A 3EUKL 4OIOF 3W3CA 4RB2C 2HS5A 2RV8A 4L9JA 3FXMA 2IGKA 2BHZA 2XIGA 4Q48A 2GIVA 3U9GA 5FFZA 1Q1HA 3OYLA 2CGPA 3N05A 3HJEA 1R5ID 2DMNA 1BIAA 2W82A 4XNFA 1Y8RB 4IZZA 2E1CA 1UG2A 4UB6C 5KK1A 3CUOA 4KJZA 5M5XJ 3GVAA 3HYIA 1MH4A 2WB1N 1KU2A 2CFXA 3K1MA 1XGMA 4A3IJ 5K5RA 1D5YA 2Z33A 2OTJI 2DCEA 3BZ6A 3WTYC 1WKMA 2XHKA 3HRSA 4A93J 3OYMA 2XKPA 2HOSA 3H9JA 2L01A 5LGTA 1Y39A 3A4CA 5HVQC 3IUOA 1G3YA 2PEXA 3F8CA 3DXJF 5J3LA 4LLLA 1GT0C 2JA6J 1I27A 1I1SA 1ETYA 1LEBA 2R92J 2FBKA 2VLAA 4PK4A 2XPUA 3P5JA 2HDDA 2L2OA 4XLHA 3IAM2 2QKMB 2X6WA 3VDXA 4IHWA 3MVPA 1JE8A 1J75A 2EZIA 4HDUA 2MD0A 3K6GA 4NNJA 2WV1A 3QPLA 5FKLA 3Q3SA 4HNTA 5LBQA 3E6BA 4RGSA 1VQ4I 2NAZA 2D5VA 3FM3A 3KZYA 1GVDA 3VYTB 5BPDA 2MBFA 1AKHB 1MIJA 1LNWA 1J09A 3OOPA 3TO9A 1R36A 2KZVA 3JRGA 4Z6YA 3FXUA 1LDJA 2KISA 3CCQI 1X1AA 4KMUX 2R5ZA 3CZ6A 1BJAA 1SFXA 2AXLA 5A2QZ 4XKCA 3M8JA 4XM3A 3KLOA 3S17J 4GFBA 1OKRA 4CDGA 5J47A 2CJJA 4IL6C 3VODA 2KIQA 2HPIA 3F21A 1QNTA 2Z5UA 4JX4A 3BJOA 1DPUA 1VQ9I 2E35A 1IJWC 1E3PA 1G8XA 3S14J 1T95A 4HZFA 4XRSG 2BY0A 4B1RA 4HAMA 1A6IA 2JA2A 4IO9F 5E3NA 4M6VA 2L54A 3I5UA 1RIOH 3C18A 1R5HA 3L00A 1Z67A 3I55I 1PUFA 1DUXC 2AQEA 2QSHX 1VQ6I 2DQRA 2O8XA 2Z3YA 3OR1C 5L3DA 2EFPA 2MC4A 2QQBA 2Z2SB 3HGGA 4N0BA 1B72B 1GHCA 2VI6A 1YS6A 3F8NA 3Q5FA 3LSIA 1SVLA 1SMYF 3EUHA 3GYHX 1JTXA 2DBBA 1K6YA 2DYSH 3BR0A 5BPIA 2LRDA 4G9YA 3BQYA 2X0LA 2HYGD 2DPDA 1MBFA 2BVLA 5DUIA 4QTRA 1Y8QB 2EFNA 2OC6A 2A07F 4HPQA 1A6QA 2LBFA 2DA5A 2L02A 1BR1A 2PLYA 5E8GA 3ZQLA 2VODA 1R23A 5GAEJ 2PG4A 4HA8A 5F1RA 2KIUA 4EJUA 2BEOA 4MHGA 4BJ5C 2JT1A 4D5FA 3CLOA 3IV5A 1S3JA 3BROA 5B66C 3G3ZA 4DOZA 1WH5A 2ZXWH 2Y48A 3L2RA 3JRAA 2CV1A 2P4WA 4Q47A 1QGPA 3KLNA 4JOMA 3HRMA 1P6RA 1DDNA 2K3FA 4CSWA 1ZGJA 2QUFA 1YW7A 2GXGA 3PJRA 2RGVA 5LEKA 3DPUA 4RB3C 3S1QJ 1YI2I 1JJ6C 4XLPF 3WGIA 3Q0UA 3TBIA 3MZ8A 4D7MA 2HEOA 3JREA 4E7KA 2KIFA 1AA7A 1J0RA 1IZ1A 2H6CA 3OYHA 2BGCA 3DKXA 4MQVA 4PJMA 5TISC 3JRCA 1VQ5I 2LR8A 2VC0A 2QBYB 1T6SA 5GTIC 2ZJ2A 4I7HA 2WA0A 4NQWB 1WJAA 3KZZA 2QZ8A 3OIOA 3H9GA 2E34A 2JRTA 2A5YB 1XG1A 3MCZA 1K4SA 2FBIA 2CU7A 2O5RA 1QVUA 3CC4I 2G7HA 3H35A 2WTEA 3G6EI 4ZTJA 1V5FA 3HOSA 3RSNA 3KETA 5AIQA 1K61A 3TGNA 5C3EJ 2JPCA 2K40A 4G94A 1Z7LA 2XPVA 2E5NA 2HVSA 3RI4A 3H5RA 1IC8A 3GTLJ 1I5ZA 3D1NI 2VUMJ 2KRCA 1YE9A 4HQMA 2M8EA 3CDHA 2WC2A 1MGTA 4HX4A 5DD8A 3K10A 4YFNF 1R1TA 4BACA 5HLHA 1GVJA 2MSYA 3C2BA 4RB0A 5IOYA 1F5TA 3HOUJ 2MFZA 2P6TA 3LSGA 3M07A 3TL4X 4DYQA 5IYDJ 2ZJPF 3C2GA 5FROA 1TC3C 3PSFA 2DTZA 3S2WA 2OZUA 2NNNA 1LVAA 2I5UA 3DQVC 3IAS2 4N9HA 3QOEA 2QA4I 3FM5A 1VI0A 1DP3A 4ESFA 1A35A 2VE8A 3L9FA 3RKXA 3ZR8X 2K9QA 2M3AA 4X6AJ 4EM0B 3I4PA 1U5TB 1R6RA 4HSRA 2FBHA 2EA2A 1YITI 2GWRA 3H36A 2KPMA 2IT0A 3IC7A 3OS1A 4DIQA 2XSDC 3S3MA 1LDDA 1ETVA 2XB0X 2P5KA 3R0AA 1XDUA 2JTVA 2K9LA 1GV2A 3OYBA 1YJWI 3FXQA 1X19A 2NS0A 4V2FA 5ICCA 3AKZA 2ELHA 2COMA 3WTSC 3ZQHA 1EH8A 2K02A 1K83J 3W2VA 2IGOA 2Y9YA 2W00A 1MZBA 3BR3A 3OYGA 4G6QA 1AHDP 3KYCB 3HB9A 1VQNI 1HLVA 5KNLA 2LOOA 1FT9A 3CDIA 3PO3J 1B4AA 1YW9A 1F1ZA 3RQ4A 1G6NA 4CYCA 2PMUA 1AOYA 3I59A 5JI6A 4XSZF 4WXHA 3HKZA 2QYOA 3ISPA 1S8NA 1WVRA 4YEJA 3CO6C 3D5SC 5FD6A 2Y30A 4JBAA 1WZ2A 2MA3A 3ZQGA 2EIMH 3E0JB 5EZHA 1OR7C 5DYMA 3QPHA 1IRGA 1G4DA 1X2NA 3GEZA 1IDYA 3SZTA 2YR2A 2EBIA 5E18F 3WGHA 3RIRA 1GDTA 2O03A 1U5TC 3DV8A 3EYYA 1B8IA 2W24A 3PQJA 1DU6A 1V5EA 1TWAJ 3FBNB 1YIOA 2JUGA 2VPLA 3ABUA 4JQFA 3SHFA 4D5CA 1IO2A 1R22A 3HSEA 2CW0F 1T8IA 2R3SA 1ULYA 1RKTA 1VZ0A 2WAEA 1FYLA 4A3KJ 1SFKA 1GXPA 2KDZA 5DUKA 4C30A 1EKEA 2VIXA 2CYYA 4AIJA 4E7LA 1MW7A 4RLFA 4E6KG 4IHXA 2V1NA 2VBYA 2QEXI 5L3EA 5FLXK 2AQFA 2P0WA 5CKTA 1I3AA 3QWLA
chains in the Genus database with same CATH topology
2B0LA 2P7CB 4KICA 2L4MA 1B9MA 5LGUA 5J8CA 5K5QA 2KRFA 1T2KA 5K1YA 2STTA 2VBWA 3E5UA 4ENMA 5TRDA 3QAHA 3M8EA 4LG0B 3N4MA 1FWZA 1YTYA 5HDGA 2XVCA 2D1VA 4OOIA 2W57A 1ONVA 4M6XA 5CYVA 4EM2A 1XMKA 2MC3A 1BBYA 2RVCA 2EV0A 1OYIA 2HTSA 5CVVA 5CVRA 1HQCA 3EETA 2VT2A 1HBXG 1OYWA 1Z6TA 1T98A 1KA8A 4ESJA 3RYRA 1ZHFA 4ZH4F 2FQ3A 4ZZLA 1KQ9A 4PDKA 2K4BA 4HW0A 1LQ1A 3T8TA 1UCRA 1Z05A 2F5FA 4U88A 3F22A 1W4MA 2D2WA 3EYIA 2Q8KA 1SD7A 1YS7A 2DLLA 1JHHA 4KUMA 4RGXA 1R1VA 4AIKA 2V1DA 3E6DA 1KGSA 2VBZA 1S6LA 4KIBA 5JVTA 1LEAA 3WE3A 1DPRA 3R61A 4UVBA 2D1HA 1SD5A 4A2UA 4KN4X 2LKPA 2FU4A 3FMQA 4O5VA 2ACJA 4OIRF 2OBPA 2EFOA 1EV7A 2YU3A 5TJJA 4PGGA 3KFWX 4G8XA 3K0LA 3TDZC 4AD9A 5JR3A 4IJAA 1P2FA 5FO5A 1JHFA 4MNUA 1E2XA 3TO7A 2HGCA 1DP7P 2A6EF 2IP2A 3BWGA 2IPQX 2GAUA 4P96A 1T0FA 1JXSA 3K2ZA 4U0YA 1Z6RA 2EWNA 1J59A 3K69A 4I01A 1FBSA 4PGHA 1MDMA 2DK8A 4U7DA 4I0AA 1R58A 2A69F 2P5VA 4FHTA 1RUOA 2D45A 4MTEA 1IRFA 5D6FA 4CICA 1HW1A 1ODDA 3J80K 2PI0A 1REPC 4IRHA 2QENA 5HLGA 1USSA 2M5WA 2RQPA 2ISYA 4LFUA 3QRFF 1HSJA 5L3CA 3JSOA 1ZRDA 4UV8A 3T5XA 4A5NA 3T1BA 2EFWA 4L18B 1G3TA 4AWXB 3M7GA 2FA5A 3ZMDA 1H0MA 4I2OA 3K1NA 2VT3A 2Z99A 1WRJA 4HF1A 2KJBA 3I54A 4BH9A 5CVIA 2ZNZA 3DPLC 1FX7A 3K1PA 4GCVA 4M9SA 2NRAC 2R7DA 1OYYA 3TDUC 1FZPB 1ZG5A 3CO7C 1BI2A 1MJBA 2PFBA 4YIIA 1W7PD 3TKYA 4WWCA 3NQOA 4RAYA 1XSDA 3SQNA 1WSUA 5JHUA 4ZYGA 5CJ9A 4O6JA 2ZO4A 2WV0A 4LK1F 4BAYA 1H9GA 1MD0A 1B1BA 1QO0D 2LF8A 5DDGA 3WU1B 2IA2A 3FX3A 1ON2A 4A12A 1HKTA 2VXZA 5ILUA 2VOOA 4M6YA 4Z2YA 4EJWA 2MH9A 5HS8A 4CGZA 3RYPA 3B73A 5JFRA 3O3KA 5FGMA 1HW5A 1XGNA 2ZBKA 1KU9A 1ZRCA 4M9ZA 5FD5A 2HYFA 4ZZDA 2H6BA 3FMRA 3L09A 4U7BA 2P7VB 3I59B 3U1DA 2ZMEA 2X4HA 3JTHA 3RDIA 3HIFA 3LAJA 2FXAA 1XN7A 2E7WA 1O7FA 3MAJA 4BQAA 4L5IA 2FSWA 3F3XA 2GA2A 2QQAA 4FX4A 1R5GA 4YFXF 1HXDA 5D5VB 3RPQA 2FNAA 3P7NA 3V8LA 3IKTA 5IT9Z 3WG9A 3WTVC 3PQKA 1D8JA 2UXXA 4R8HA 4HLYA 1YO5C 2PBIA 3MZYA 3MWMA 3WTUC 2M45A 4U0VA 2FF4A 5HLIA 5ILVA 1TQPA 3HRTA 3QU3A 3ELKA 1CGPA 2JZYA 2IRFG 5AIPA 2HDCA 4F7ZA 2O6GE 4K2EA 1K78A 3VB2A 3D5LA 4R79A 3LFKA 5A2QK 1FYKA 1FOKA 1ZG1A 3E6MA 1FC3A 4PZJA 4RS8A 1CF7A 5J6XA 3NRVA 4N9IA 2P6SA 2OD5A 4Y13A 4L9TA 2EB7A 1YLFA 2W85A 2HOEA 1KQ0A 5FB2A 2STWA 3SFZA 4MQ9F 3GZ6A 4LMYA 2Y0MA 5HDNA 3I71A 1RUNA 2PQ8A 2Y75A 2VBXA 2VE9A 2PJPA 2LF7A 1K79A 1ZAOA 2VOPA 2P8TA 3RKYA 1KYWA 4I98B 3GO5A 5E8IA 4LLGF 5FFXA 4KA4A 2DAOA 3IL2A 2A3SA 4OMYA 1TQIA 3O2PE 3FXRA 2M87A 2GQQA 4H0EA 3ERED 4HX8A 3P9CA 4YIFA 2MLGA 2EV6A 3HRUA 2H09A 4RGUA 1SFEA 2HTJA 2XAGA 5ILSA 3TO6A 4ZYEA 1U8RA 1QZZA 3RJPA 1BI3A 3W6JB 4KFCA 3I0TA 1LB2A 4OU0A 3I53A 3IRRA 2YPRA 2HWVA 4EM1A 2RKHA 3DEUA 4G7HF 2GXBA 1QQIA 2IA0A 2L3DA 2VN2A 2OQRA 3Q9VA 5DEQA 1H9TA 3E6CC 2XAJA 3BY6A 2GZWA 1KYZA 1D5VA 1BN5A 4BXUA 1XCBA 1IN5A 2OAZA 1R1UA 1ZLJA 6PAXA 3OV8A 4EJTA 1YFHA 2FMYA 4HYEA 4YFKF 4HV6A 2R7FA 1ZGAA 2YSRA 1S7AA 1MDMB 3BP8A 1O3SA 3DFGA 2OA4A 5LRRA 1BC7C 2XASA 2UXNA 1QPMA 1IN6A 4UVCA 4Y15A 4LB6B 5BMZA 2G7UA 2XAQA 1G3WA 1J2XA 1FBQA 5DD4A 3ROUA 2L4AA 3KEQA 4M9XA 1PP8F 3FHZA 4P9FA 4CHUA 2QVOA 3DF8A 4UNOA 1FSEA 4S04A 2HZTA 2FEZA 3ZMZA 2XKOA 3ZN1A 1A04A 2CWEA 2FNPA 1C0WA 1IAWA 4HX7A 5D5WB 4D0PA 1NHAA 2KJCA 1Y0UA 2CSOA 3F6OA 4UXNA 1K6OA 1EH6A 3WTXC 4GYIA 4P9UA 3FF5A 2K27A 2OU2A 2DI3A 2PMHA 3F8BA 3DP7A 3J7AO 1XDSA 1BI1A 4ENNA 5KVRA 3PFIA 1RI7A 4A5MA 1TNSA 4EJVA 1SFUA 1ZREA 1TQMA 1D3YA 2LDUA 3ML6A 4NQWA 4WK8F 3QPTA 4M72A 2DTRA 1B9NA 1W7PA 3WODF 4ENJA 3FMSA 3EDPA 3BOQA 1PDNC 5DV5A 4CZZA 1IXCA 2DFIA 3WE2A 4EGZA 3WTWC 4GYGA 4OIPF 2F5EA 3ZMVA 5HOOA 3ZN0A 2E7XA 1OR7A 1FBUA 3C7JA 3WU0A 4B8XA 1FP1D 4MTDA 4EJOA 4EMSA 2BYVE 1BI0A 4KIFA 2LSOA 2Q2EA 3LA2A 3LQRA 3F72A 3V8JA 5D8LB 1E17A 5LHHA 2DK5A 3FZVA 3P9IA 3F6VA 2V1UA 4IRIA 3F8FA 4M73A 1VTNC 4KDPA 4XBFA 2HKXA 2XV4S 4LGWA 2ESHA 4L0YB 5ICFA 3ZQ7A 4WXDA 2ZKZA 1D8KA 3QOPA 5D4SA 2QWWA 4LJZF 3QU6A 4CXFA 2LNBA 4S05A 1L3LA 4Q5SF 4RGRA 1P92A 1XD7A 3ULQB 3HSRA 4PCQA 2V6CA 1HKQA 4A6DA 3R0JA 1IN8A 3QP5A 4ASNA 4GGGA 4U0WA 2XAFA 1FNNA 2KKOA 3J81Z 1ZYRF 1OPCA 2OZ6A 3GFIA 4EVIA 1ZH5A 2DQLA 4AIHA 4P5OA 4HV5A 3U2RA 5L3BA 2ZNYA 1K78B 1J5YA 4RB1A 2H27A 1Z9CA 1T39A 3EQLF 5ICGA 1XSXA 4I02A 1CF7B 2XAHA 4KYWA 3HHHA 4UHTA 4MEXF 2RC4A 2RDPA 1L0OC 4IPAA 3HOTA 4LK0F 1O7LA 4QLCU 3I64A 4NHJA 3HTSB 4GO1A 3V7RA 5E1XA 2G9WA 4A0YA 1SAXA 3CUQA 4A6EA 5E1WA 2QM3A 2FRHA 1J9IA 2RN7A 3BJ6A 1X3UA 3IRQA 3G73A 4EGYA 5ERIA 2ADUA 3GFJA 5DCMA 3MFKA 2UZKA 4LLNA 1TBXA 4M74A 1YW8A 2K4JA 3SXYA 2C6YA 1O57A 3J81K 3IHUA 1XGSA 1XGOA 1YG2A 4UUVA 1WWXA 5BQTA 2M30A 1GXQA 2JSCA 3KCCA 4ESBA 2EV5A 1YYVA 2DW4A 4IHTA 2FE3A 5LRSA 3AAFA 1MJ9A 3M1EA 3ZMUA 2O61A 1U2WA 5F6FA 5IT3A 1JGSA 4I09A 3WTTC 1W5TA 4BHPA 5L3FA 3O6BB 2V1XA 1ZN2A 2A68F 1IW7F 3W6KB 3HHGA 4B09A 3JSPA 5E1ZB 4IHSA 4IXAA 4HQEA 2F2EA 1OMIA 4L5JA 3E5XA 3ECOA 1IN7A 4HF2A 2O0YA 3MEXA 5E20A 4OMZA 5H6RA 3E3VA 4KMFA 5E17F 1XSVA 2EFQA 5HS7A 3GW2A 1UB9A 1F4KA 2F5DA 4YG2F 2F5CA 1T38A 4HF0A 2VONA 4IVNA 2ZFWA 2EK5A 3HUGA 2BE5F 2J5OA 2ISZA 5DCFA 2QQ9A 2IA1A 2XUBA 1FY7A 5LHGA 3LAPA 2ZCWA 2XRNA 1FSHA 3DPTA 2EJRA 3N97A 1USTA 2Q0OA 5D5UB 3R60A 4DQ2A 4BHBA 2EA4A 1U6GA 2NNYA 1ZRFA 2A61A 5CVUA 1HKSA 3LQQA 3RTRA 4L0ZB 2K86A 4CO8A 1TTYA 3KEOA 3H3UA 3KP6A 3KP5A 1IF1A 2HKOA 5H20A 2V9VA 4Q4ZF 4NB5A 3V7SA 4A0XA 1O3TA 4OIQF 3LA3A 2ESNA 1R00A 1STZA 1W7PB 4FX0A 1EH7A 2XROA 3L7WA 1UHWA 2VC1A 1KU3A 3COAC 5BS6A 2OQGA 1V3FA 3SZPA 3MQ0A 1Z7UA 2YX4A 5IT9K 3VEPA 1I1GA 3L2CA 3F23A 1Z91A 3TOAA 1P4XA 3GWZA 5FLXZ 4JK1X 4XLNF 5EEGA 3KP4A 4L9NA 4O3MA 2HFHA 1YQAA 3JAMZ 3VFZA 4OINF 3GXOA 3D0SA 5K5OA 3QP6A 1Z1DA 3KP2A 1FP2A 1MJAA 3KE2A 3V8KA 2CO5A 4M71A 4AVPA 4ENKA 1IUYA 4EV0A 2HR3A 1TLHB 5J8FA 4LD5A 1HSTA 3WTZA 1SD6A 1ZLKA 1KU7A 2HQRA 3RPUA 2O3FA 3F8MA 2DPUA 3T8RA 3JTGA 3K9TA 4LB5A 5D8KB 5D6EA 3Q9SA 2MLKA 1TW2A 1UFMA 4UV9A 2JPBA 5H6QA 1U78A 1ZARA 2NYXA 2FOKA 4HBLA 1TNTA 4Y17A 2MH2A 5ED4A 3HTUA 4G6DA 5CVJA 3GLXA 4FT8A 3V4GA 3TOBA 1ON1A 5LLQA 1W5SA 1MKMA 1FPQA 1I6XA 1LJ9A 3JAMK 1QBJA 1LDKB 1R7JA 2DU9A 3H92A 4CYDA 3FWEA 2M1BA 2IW5A 1O3QA 5BOXA 3HSFA 4G7OF 2BV6A 4UVAA 1XB4A 3V7CA 5LEJA 2XGXA 4EQQA 4XRFA 4XSXF 4KIGA 3B02A 2W84A 1WQ2A 2IJLA 3KP7A 1IXRC 3CUQB 3KP3A 3NEUA 4ZYHA 3BJAA 3GFMA 2QBYA 1S7OA 1S29A 1PUEE 1XCVA 2A6HF 2Z9OA 3JW4A 4GXOA 1BM9A 5DCMB 2QLZA 4TV7A 1G3SA 3REOA 3R6SA 4KNYA 1J7KA 4BHCA 2DT5A 2H94A 1FYMA 2E1NA 3ABTA 4DNCA 2UWMA 2FMLA 1BC8C 1RZ4A 2DO7A 3C3WA 3BPVA 3GX4X 1K7AA 2W25A 5D4RA 3ZMTA 5L3GA 4IRGA 5D5XB 4G7ZF 1O3RA 2P5LC 3GFLA 1SMTA 4KN7X 1P4WA 3H3ZA 4A0ZA 1U5TA 3CUQC 3J80Z 2J5PA 3ZPLA 3IKVA 2WWYA 1HW2A 2ZMEB 3E5QA 2MD5A 3ECHA 3IWFA 3GZ5A 4WX9A 4MEYF 4BNCA 3LWFA 5F64A 1QZYA 1V4RA 4R1HA 1PP7U 1IN4A 3R4KA 4ETSA 4KT5C 1BIBA 4P55A 2CQKA 4L9VA 3LSTA 2KIMA 3T0YA 4E70A 4I0BA 1IXSB 4HLXA 2GA1A 2IVMA 4MGRA 1F9NA 3E97A 4IF4A 4HDVA 3M9AA 3VOEA 3I58A 2AS5F 2BBYA 1SD4A 2ETHA 3CTAA 3P9KA 1B59A 4HOBA 5LHIA 4RAZA 3DKWA 5HDKA 3BPXA 3C1DA 1FLIA 3BDDA 1ZG3A 1AWCA 1RNLA 1P4AA 2ZXJA 3M8FA 1XMAA 3GUDA 4WF2A 1KQ8A 2HQNA 1U3EM 2RNJA 4ON0A 3WGGA 5HS9A 2V79A 4BYYA 5LGNA 3CJNA 3ZP5A 1UHMA 3RKWA 1TW3A 5CLSA 2YX7A 3LA7A 2TDXA 4QWQA 3MZHA 3GF2A 4WXCA 5EEHA 4LG0A 5ICEA 3TQNA 3IWZA 2CG4A 1B6AA 3ZMSA 2PN6A 4WCGA 1BOAA 2K7LA 1WI9A 5AONA 4OIOF 4RB2C 2HS5A 2RV8A 4L9JA 2XIGA 4Q48A 2GIVA 3U9GA 5FFZA 1Q1HA 2CGPA 1BIAA 2E1CA 5KK1A 3CUOA 3GVAA 3HYIA 1KU2A 2CFXA 3K1MA 1XGMA 5K5RA 2Z33A 3BZ6A 3WTYC 1WKMA 2XHKA 3HRSA 2XKPA 2L01A 5LGTA 5HVQC 1G3YA 2PEXA 3F8CA 3DXJF 4LLLA 1I27A 1I1SA 1LEBA 2FBKA 1JE8A 1J75A 4HDUA 5LBQA 3E6BA 4RGSA 2NAZA 3FM3A 3KZYA 5BPDA 2MBFA 3TO9A 1LNWA 3OOPA 1R36A 3FXUA 1LDJA 4KMUX 1BJAA 1SFXA 2AXLA 5A2QZ 3KLOA 1OKRA 4CDGA 3VODA 3F21A 1QNTA 2Z5UA 3BJOA 1DPUA 4HZFA 4HAMA 2L54A 3I5UA 1RIOH 3C18A 1R5HA 3L00A 1DUXC 2DQRA 2O8XA 2Z3YA 5L3DA 2EFPA 2QQBA 4N0BA 1GHCA 1YS6A 3F8NA 3Q5FA 1SMYF 3EUHA 3GYHX 2DBBA 5BPIA 4G9YA 2X0LA 2HYGD 2DPDA 5DUIA 2EFNA 2A07F 2PLYA 2L02A 5E8GA 2VODA 1R23A 2PG4A 4HA8A 5F1RA 2KIUA 4EJUA 2BEOA 4MHGA 2JT1A 3CLOA 1S3JA 3BROA 3G3ZA 2Y48A 2P4WA 4Q47A 1QGPA 3KLNA 3HRMA 1P6RA 1DDNA 1ZGJA 2QUFA 1YW7A 2GXGA 2RGVA 5LEKA 4RB3C 4XLPF 3WGIA 2HEOA 2KIFA 1J0RA 1IZ1A 2H6CA 2BGCA 4MQVA 2VC0A 2QBYB 1T6SA 2ZJ2A 4I7HA 3KZZA 2QZ8A 2JRTA 2A5YB 3MCZA 2FBIA 2G7HA 2WTEA 3HOSA 3KETA 5AIQA 3TGNA 2JPCA 4G94A 3RI4A 1I5ZA 4HQMA 2M8EA 3CDHA 2WC2A 1MGTA 4HX4A 5DD8A 4YFNF 1R1TA 5HLHA 1GVJA 4RB0A 1F5TA 2P6TA 3S2WA 2OZUA 2NNNA 1LVAA 3DQVC 4N9HA 3FM5A 4ESFA 2VE8A 3L9FA 3RKXA 4EM0B 3I4PA 1U5TB 2FBHA 2EA2A 2GWRA 2IT0A 3IC7A 1LDDA 2P5KA 3R0AA 1XDUA 2JTVA 3FXQA 2NS0A 5ICCA 2ELHA 2COMA 3WTSC 1EH8A 2K02A 1MZBA 4G6QA 1FT9A 1B4AA 1YW9A 1F1ZA 1G6NA 1AOYA 2PMUA 3I59A 5JI6A 4XSZF 4WXHA 2QYOA 3ISPA 1S8NA 3CO6C 5FD6A 4JBAA 2MA3A 5DYMA 3QPHA 1IRGA 1G4DA 3GEZA 5E18F 3SZTA 2YR2A 3WGHA 3RIRA 2O03A 1U5TC 3DV8A 3EYYA 2W24A 3PQJA 1YIOA 3ABUA 4JQFA 3SHFA 1R22A 3HSEA 2CW0F 2R3SA 1ULYA 1FYLA 1GXPA 5DUKA 2CYYA 4AIJA 2VBYA 5L3EA 5FLXK 4ZYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0L A;  2P7C B;  4KIC A;  2L4M A;  1B9M A;  5LGU A;  5J8C A;  5K5Q A;  2KRF A;  1T2K A;  5K1Y A;  2STT A;  2VBW A;  3E5U A;  4ENM A;  5TRD A;  3QAH A;  3M8E A;  4LG0 B;  3N4M A;  1FWZ A;  1YTY A;  5HDG A;  2XVC A;  2D1V A;  4OOI A;  2W57 A;  1ONV A;  4M6X A;  5CYV A;  4EM2 A;  1XMK A;  2MC3 A;  1BBY A;  2RVC A;  2EV0 A;  1OYI A;  2HTS A;  5CVV A;  5CVR A;  1HQC A;  3EET A;  2VT2 A;  1HBX G;  1OYW A;  1Z6T A;  1T98 A;  1KA8 A;  4ESJ A;  3RYR A;  1ZHF A;  4ZH4 F;  2FQ3 A;  4ZZL A;  1KQ9 A;  4PDK A;  2K4B A;  4HW0 A;  1LQ1 A;  3T8T A;  1UCR A;  1Z05 A;  2F5F A;  4U88 A;  3F22 A;  1W4M A;  2D2W A;  3EYI A;  2Q8K A;  1SD7 A;  1YS7 A;  2DLL A;  1JHH A;  4KUM A;  4RGX A;  1R1V A;  4AIK A;  2V1D A;  3E6D A;  1KGS A;  2VBZ A;  1S6L A;  4KIB A;  5JVT A;  1LEA A;  3WE3 A;  1DPR A;  3R61 A;  4UVB A;  2D1H A;  1SD5 A;  4A2U A;  4KN4 X;  2LKP A;  2FU4 A;  3FMQ A;  4O5V A;  2ACJ A;  4OIR F;  2OBP A;  2EFO A;  1EV7 A;  2YU3 A;  5TJJ A;  4PGG A;  3KFW X;  4G8X A;  3K0L A;  3TDZ C;  4AD9 A;  5JR3 A;  4IJA A;  1P2F A;  5FO5 A;  1JHF A;  4MNU A;  1E2X A;  3TO7 A;  2HGC A;  1DP7 P;  2A6E F;  2IP2 A;  3BWG A;  2IPQ X;  2GAU A;  4P96 A;  1T0F A;  1JXS A;  3K2Z A;  4U0Y A;  1Z6R A;  2EWN A;  1J59 A;  3K69 A;  4I01 A;  1FBS A;  4PGH A;  1MDM A;  2DK8 A;  4U7D A;  4I0A A;  1R58 A;  2A69 F;  2P5V A;  4FHT A;  1RUO A;  2D45 A;  4MTE A;  1IRF A;  5D6F A;  4CIC A;  1HW1 A;  1ODD A;  3J80 K;  2PI0 A;  1REP C;  4IRH A;  2QEN A;  5HLG A;  1USS A;  2M5W A;  2RQP A;  2ISY A;  4LFU A;  3QRF F;  1HSJ A;  5L3C A;  3JSO A;  1ZRD A;  4UV8 A;  3T5X A;  4A5N A;  3T1B A;  2EFW A;  4L18 B;  1G3T A;  4AWX B;  3M7G A;  2FA5 A;  3ZMD A;  1H0M A;  4I2O A;  3K1N A;  2VT3 A;  2Z99 A;  1WRJ A;  4HF1 A;  2KJB A;  3I54 A;  4BH9 A;  5CVI A;  2ZNZ A;  3DPL C;  1FX7 A;  3K1P A;  4GCV A;  4M9S A;  2NRA C;  2R7D A;  1OYY A;  3TDU C;  1FZP B;  1ZG5 A;  3CO7 C;  1BI2 A;  1MJB A;  2PFB A;  4YII A;  1W7P D;  3TKY A;  4WWC A;  3NQO A;  4RAY A;  1XSD A;  3SQN A;  1WSU A;  5JHU A;  4ZYG A;  5CJ9 A;  4O6J A;  2ZO4 A;  2WV0 A;  4LK1 F;  4BAY A;  1H9G A;  1MD0 A;  1B1B A;  1QO0 D;  2LF8 A;  5DDG A;  3WU1 B;  2IA2 A;  3FX3 A;  1ON2 A;  4A12 A;  1HKT A;  2VXZ A;  5ILU A;  2VOO A;  4M6Y A;  4Z2Y A;  4EJW A;  2MH9 A;  5HS8 A;  4CGZ A;  3RYP A;  3B73 A;  5JFR A;  3O3K A;  5FGM A;  1HW5 A;  1XGN A;  2ZBK A;  1KU9 A;  1ZRC A;  4M9Z A;  5FD5 A;  2HYF A;  4ZZD A;  2H6B A;  3FMR A;  3L09 A;  4U7B A;  2P7V B;  3I59 B;  3U1D A;  2ZME A;  2X4H A;  3JTH A;  3RDI A;  3HIF A;  3LAJ A;  2FXA A;  1XN7 A;  2E7W A;  1O7F A;  3MAJ A;  4BQA A;  4L5I A;  2FSW A;  3F3X A;  2GA2 A;  2QQA A;  4FX4 A;  1R5G A;  4YFX F;  1HXD A;  5D5V B;  3RPQ A;  2FNA A;  3P7N A;  3V8L A;  3IKT A;  5IT9 Z;  3WG9 A;  3WTV C;  3PQK A;  1D8J A;  2UXX A;  4R8H A;  4HLY A;  1YO5 C;  2PBI A;  3MZY A;  3MWM A;  3WTU C;  2M45 A;  4U0V A;  2FF4 A;  5HLI A;  5ILV A;  1TQP A;  3HRT A;  3QU3 A;  3ELK A;  1CGP A;  2JZY A;  2IRF G;  5AIP A;  2HDC A;  4F7Z A;  2O6G E;  4K2E A;  1K78 A;  3VB2 A;  3D5L A;  4R79 A;  3LFK A;  5A2Q K;  1FYK A;  1FOK A;  1ZG1 A;  3E6M A;  1FC3 A;  4PZJ A;  4RS8 A;  1CF7 A;  5J6X A;  3NRV A;  4N9I A;  2P6S A;  2OD5 A;  4Y13 A;  4L9T A;  2EB7 A;  1YLF A;  2W85 A;  2HOE A;  1KQ0 A;  5FB2 A;  2STW A;  3SFZ A;  4MQ9 F;  3GZ6 A;  4LMY A;  2Y0M A;  5HDN A;  3I71 A;  1RUN A;  2PQ8 A;  2Y75 A;  2VBX A;  2VE9 A;  2PJP A;  2LF7 A;  1K79 A;  1ZAO A;  2VOP A;  2P8T A;  3RKY A;  1KYW A;  4I98 B;  3GO5 A;  5E8I A;  4LLG F;  5FFX A;  4KA4 A;  2DAO A;  3IL2 A;  2A3S A;  4OMY A;  1TQI A;  3O2P E;  3FXR A;  2M87 A;  2GQQ A;  4H0E A;  3ERE D;  4HX8 A;  3P9C A;  4YIF A;  2MLG A;  2EV6 A;  3HRU A;  2H09 A;  4RGU A;  1SFE A;  2HTJ A;  2XAG A;  5ILS A;  3TO6 A;  4ZYE A;  1U8R A;  1QZZ A;  3RJP A;  1BI3 A;  3W6J B;  4KFC A;  3I0T A;  1LB2 A;  4OU0 A;  3I53 A;  3IRR A;  2YPR A;  2HWV A;  4EM1 A;  2RKH A;  3DEU A;  4G7H F;  2GXB A;  1QQI A;  2IA0 A;  2L3D A;  2VN2 A;  2OQR A;  3Q9V A;  5DEQ A;  1H9T A;  3E6C C;  2XAJ A;  3BY6 A;  2GZW A;  1KYZ A;  1D5V A;  1BN5 A;  4BXU A;  1XCB A;  1IN5 A;  2OAZ A;  1R1U A;  1ZLJ A;  6PAX A;  3OV8 A;  4EJT A;  1YFH A;  2FMY A;  4HYE A;  4YFK F;  4HV6 A;  2R7F A;  1ZGA A;  2YSR A;  1S7A A;  1MDM B;  3BP8 A;  1O3S A;  3DFG A;  2OA4 A;  5LRR A;  1BC7 C;  2XAS A;  2UXN A;  1QPM A;  1IN6 A;  4UVC A;  4Y15 A;  4LB6 B;  5BMZ A;  2G7U A;  2XAQ A;  1G3W A;  1J2X A;  1FBQ A;  5DD4 A;  3ROU A;  2L4A A;  3KEQ A;  4M9X A;  1PP8 F;  3FHZ A;  4P9F A;  4CHU A;  2QVO A;  3DF8 A;  4UNO A;  1FSE A;  4S04 A;  2HZT A;  2FEZ A;  3ZMZ A;  2XKO A;  3ZN1 A;  1A04 A;  2CWE A;  2FNP A;  1C0W A;  1IAW A;  4HX7 A;  5D5W B;  4D0P A;  1NHA A;  2KJC A;  1Y0U A;  2CSO A;  3F6O A;  4UXN A;  1K6O A;  1EH6 A;  3WTX C;  4GYI A;  4P9U A;  3FF5 A;  2K27 A;  2OU2 A;  2DI3 A;  2PMH A;  3F8B A;  3DP7 A;  3J7A O;  1XDS A;  1BI1 A;  4ENN A;  5KVR A;  3PFI A;  1RI7 A;  4A5M A;  1TNS A;  4EJV A;  1SFU A;  1ZRE A;  1TQM A;  1D3Y A;  2LDU A;  3ML6 A;  4NQW A;  4WK8 F;  3QPT A;  4M72 A;  2DTR A;  1B9N A;  1W7P A;  3WOD F;  4ENJ A;  3FMS A;  3EDP A;  3BOQ A;  1PDN C;  5DV5 A;  4CZZ A;  1IXC A;  2DFI A;  3WE2 A;  4EGZ A;  3WTW C;  4GYG A;  4OIP F;  2F5E A;  3ZMV A;  5HOO A;  3ZN0 A;  2E7X A;  1OR7 A;  1FBU A;  3C7J A;  3WU0 A;  4B8X A;  1FP1 D;  4MTD A;  4EJO A;  4EMS A;  2BYV E;  1BI0 A;  4KIF A;  2LSO A;  2Q2E A;  3LA2 A;  3LQR A;  3F72 A;  3V8J A;  5D8L B;  1E17 A;  5LHH A;  2DK5 A;  3FZV A;  3P9I A;  3F6V A;  2V1U A;  4IRI A;  3F8F A;  4M73 A;  1VTN C;  4KDP A;  4XBF A;  2HKX A;  2XV4 S;  4LGW A;  2ESH A;  4L0Y B;  5ICF A;  3ZQ7 A;  4WXD A;  2ZKZ A;  1D8K A;  3QOP A;  5D4S A;  2QWW A;  4LJZ F;  3QU6 A;  4CXF A;  2LNB A;  4S05 A;  1L3L A;  4Q5S F;  4RGR A;  1P92 A;  1XD7 A;  3ULQ B;  3HSR A;  4PCQ A;  2V6C A;  1HKQ A;  4A6D A;  3R0J A;  1IN8 A;  3QP5 A;  4ASN A;  4GGG A;  4U0W A;  2XAF A;  1FNN A;  2KKO A;  3J81 Z;  1ZYR F;  1OPC A;  2OZ6 A;  3GFI A;  4EVI A;  1ZH5 A;  2DQL A;  4AIH A;  4P5O A;  4HV5 A;  3U2R A;  5L3B A;  2ZNY A;  1K78 B;  1J5Y A;  4RB1 A;  2H27 A;  1Z9C A;  1T39 A;  3EQL F;  5ICG A;  1XSX A;  4I02 A;  1CF7 B;  2XAH A;  4KYW A;  3HHH A;  4UHT A;  4MEX F;  2RC4 A;  2RDP A;  1L0O C;  4IPA A;  3HOT A;  4LK0 F;  1O7L A;  4QLC U;  3I64 A;  4NHJ A;  3HTS B;  4GO1 A;  3V7R A;  5E1X A;  2G9W A;  4A0Y A;  1SAX A;  3CUQ A;  4A6E A;  5E1W A;  2QM3 A;  2FRH A;  1J9I A;  2RN7 A;  3BJ6 A;  1X3U A;  3IRQ A;  3G73 A;  4EGY A;  5ERI A;  2ADU A;  3GFJ A;  5DCM A;  3MFK A;  2UZK A;  4LLN A;  1TBX A;  4M74 A;  1YW8 A;  2K4J A;  3SXY A;  2C6Y A;  1O57 A;  3J81 K;  3IHU A;  1XGS A;  1XGO A;  1YG2 A;  4UUV A;  1WWX A;  5BQT A;  2M30 A;  1GXQ A;  2JSC A;  3KCC A;  4ESB A;  2EV5 A;  1YYV A;  2DW4 A;  4IHT A;  2FE3 A;  5LRS A;  3AAF A;  1MJ9 A;  3M1E A;  3ZMU A;  2O61 A;  1U2W A;  5F6F A;  5IT3 A;  1JGS A;  4I09 A;  3WTT C;  1W5T A;  4BHP A;  5L3F A;  3O6B B;  2V1X A;  1ZN2 A;  2A68 F;  1IW7 F;  3W6K B;  3HHG A;  4B09 A;  3JSP A;  5E1Z B;  4IHS A;  4IXA A;  4HQE A;  2F2E A;  1OMI A;  4L5J A;  3E5X A;  3ECO A;  1IN7 A;  4HF2 A;  2O0Y A;  3MEX A;  5E20 A;  4OMZ A;  5H6R A;  3E3V A;  4KMF A;  5E17 F;  1XSV A;  2EFQ A;  5HS7 A;  3GW2 A;  1UB9 A;  1F4K A;  2F5D A;  4YG2 F;  2F5C A;  1T38 A;  4HF0 A;  2VON A;  4IVN A;  2ZFW A;  2EK5 A;  3HUG A;  2BE5 F;  2J5O A;  2ISZ A;  5DCF A;  2QQ9 A;  2IA1 A;  2XUB A;  1FY7 A;  5LHG A;  3LAP A;  2ZCW A;  2XRN A;  1FSH A;  3DPT A;  2EJR A;  3N97 A;  1UST A;  2Q0O A;  5D5U B;  3R60 A;  4DQ2 A;  4BHB A;  2EA4 A;  1U6G A;  2NNY A;  1ZRF A;  2A61 A;  5CVU A;  1HKS A;  3LQQ A;  3RTR A;  4L0Z B;  2K86 A;  4CO8 A;  1TTY A;  3KEO A;  3H3U A;  3KP6 A;  3KP5 A;  1IF1 A;  2HKO A;  5H20 A;  2V9V A;  4Q4Z F;  4NB5 A;  3V7S A;  4A0X A;  1O3T A;  4OIQ F;  3LA3 A;  2ESN A;  1R00 A;  1STZ A;  1W7P B;  4FX0 A;  1EH7 A;  2XRO A;  3L7W A;  1UHW A;  2VC1 A;  1KU3 A;  3COA C;  5BS6 A;  2OQG A;  1V3F A;  3SZP A;  3MQ0 A;  1Z7U A;  2YX4 A;  5IT9 K;  3VEP A;  1I1G A;  3L2C A;  3F23 A;  1Z91 A;  3TOA A;  1P4X A;  3GWZ A;  5FLX Z;  4JK1 X;  4XLN F;  5EEG A;  3KP4 A;  4L9N A;  4O3M A;  2HFH A;  1YQA A;  3JAM Z;  3VFZ A;  4OIN F;  3GXO A;  3D0S A;  5K5O A;  3QP6 A;  1Z1D A;  3KP2 A;  1FP2 A;  1MJA A;  3KE2 A;  3V8K A;  2CO5 A;  4M71 A;  4AVP A;  4ENK A;  1IUY A;  4EV0 A;  2HR3 A;  1TLH B;  5J8F A;  4LD5 A;  1HST A;  3WTZ A;  1SD6 A;  1ZLK A;  1KU7 A;  2HQR A;  3RPU A;  2O3F A;  3F8M A;  2DPU A;  3T8R A;  3JTG A;  3K9T A;  4LB5 A;  5D8K B;  5D6E A;  3Q9S A;  2MLK A;  1TW2 A;  1UFM A;  4UV9 A;  2JPB A;  5H6Q A;  1U78 A;  1ZAR A;  2NYX A;  2FOK A;  4HBL A;  1TNT A;  4Y17 A;  2MH2 A;  5ED4 A;  3HTU A;  4G6D A;  5CVJ A;  3GLX A;  4FT8 A;  3V4G A;  3TOB A;  1ON1 A;  5LLQ A;  1W5S A;  1MKM A;  1FPQ A;  1I6X A;  1LJ9 A;  3JAM K;  1QBJ A;  1LDK B;  1R7J A;  2DU9 A;  3H92 A;  4CYD A;  3FWE A;  2M1B A;  2IW5 A;  1O3Q A;  5BOX A;  3HSF A;  4G7O F;  2BV6 A;  4UVA A;  1XB4 A;  3V7C A;  5LEJ A;  2XGX A;  4EQQ A;  4XRF A;  4XSX F;  4KIG A;  3B02 A;  2W84 A;  1WQ2 A;  2IJL A;  3KP7 A;  1IXR C;  3CUQ B;  3KP3 A;  3NEU A;  4ZYH A;  3BJA A;  3GFM A;  2QBY A;  1S7O A;  1S29 A;  1PUE E;  1XCV A;  2A6H F;  2Z9O A;  3JW4 A;  4GXO A;  1BM9 A;  5DCM B;  2QLZ A;  4TV7 A;  1G3S A;  3REO A;  3R6S A;  4KNY A;  1J7K A;  4BHC A;  2DT5 A;  2H94 A;  1FYM A;  2E1N A;  3ABT A;  4DNC A;  2UWM A;  2FML A;  1BC8 C;  1RZ4 A;  2DO7 A;  3C3W A;  3BPV A;  3GX4 X;  1K7A A;  2W25 A;  5D4R A;  3ZMT A;  5L3G A;  4IRG A;  5D5X B;  4G7Z F;  1O3R A;  2P5L C;  3GFL A;  1SMT A;  4KN7 X;  1P4W A;  3H3Z A;  4A0Z A;  1U5T A;  3CUQ C;  3J80 Z;  2J5P A;  3ZPL A;  3IKV A;  2WWY A;  1HW2 A;  2ZME B;  3E5Q A;  2MD5 A;  3ECH A;  3IWF A;  3GZ5 A;  4WX9 A;  4MEY F;  4BNC A;  3LWF A;  5F64 A;  1QZY A;  1V4R A;  4R1H A;  1PP7 U;  1IN4 A;  3R4K A;  4ETS A;  4KT5 C;  1BIB A;  4P55 A;  2CQK A;  4L9V A;  3LST A;  2KIM A;  3T0Y A;  4E70 A;  4I0B A;  1IXS B;  4HLX A;  2GA1 A;  2IVM A;  4MGR A;  1F9N A;  3E97 A;  4IF4 A;  4HDV A;  3M9A A;  3VOE A;  3I58 A;  2AS5 F;  2BBY A;  1SD4 A;  2ETH A;  3CTA A;  3P9K A;  1B59 A;  4HOB A;  5LHI A;  4RAZ A;  3DKW A;  5HDK A;  3BPX A;  3C1D A;  1FLI A;  3BDD A;  1ZG3 A;  1AWC A;  1RNL A;  1P4A A;  2ZXJ A;  3M8F A;  1XMA A;  3GUD A;  4WF2 A;  1KQ8 A;  2HQN A;  1U3E M;  2RNJ A;  4ON0 A;  3WGG A;  5HS9 A;  2V79 A;  4BYY A;  5LGN A;  3CJN A;  3ZP5 A;  1UHM A;  3RKW A;  1TW3 A;  5CLS A;  2YX7 A;  3LA7 A;  2TDX A;  4QWQ A;  3MZH A;  3GF2 A;  4WXC A;  5EEH A;  4LG0 A;  5ICE A;  3TQN A;  3IWZ A;  2CG4 A;  1B6A A;  3ZMS A;  2PN6 A;  4WCG A;  1BOA A;  2K7L A;  1WI9 A;  5AON A;  4OIO F;  4RB2 C;  2HS5 A;  2RV8 A;  4L9J A;  2XIG A;  4Q48 A;  2GIV A;  3U9G A;  5FFZ A;  1Q1H A;  2CGP A;  1BIA A;  2E1C A;  5KK1 A;  3CUO A;  3GVA A;  3HYI A;  1KU2 A;  2CFX A;  3K1M A;  1XGM A;  5K5R A;  2Z33 A;  3BZ6 A;  3WTY C;  1WKM A;  2XHK A;  3HRS A;  2XKP A;  2L01 A;  5LGT A;  5HVQ C;  1G3Y A;  2PEX A;  3F8C A;  3DXJ F;  4LLL A;  1I27 A;  1I1S A;  1LEB A;  2FBK A;  1JE8 A;  1J75 A;  4HDU A;  5LBQ A;  3E6B A;  4RGS A;  2NAZ A;  3FM3 A;  3KZY A;  5BPD A;  2MBF A;  3TO9 A;  1LNW A;  3OOP A;  1R36 A;  3FXU A;  1LDJ A;  4KMU X;  1BJA A;  1SFX A;  2AXL A;  5A2Q Z;  3KLO A;  1OKR A;  4CDG A;  3VOD A;  3F21 A;  1QNT A;  2Z5U A;  3BJO A;  1DPU A;  4HZF A;  4HAM A;  2L54 A;  3I5U A;  1RIO H;  3C18 A;  1R5H A;  3L00 A;  1DUX C;  2DQR A;  2O8X A;  2Z3Y A;  5L3D A;  2EFP A;  2QQB A;  4N0B A;  1GHC A;  1YS6 A;  3F8N A;  3Q5F A;  1SMY F;  3EUH A;  3GYH X;  2DBB A;  5BPI A;  4G9Y A;  2X0L A;  2HYG D;  2DPD A;  5DUI A;  2EFN A;  2A07 F;  2PLY A;  2L02 A;  5E8G A;  2VOD A;  1R23 A;  2PG4 A;  4HA8 A;  5F1R A;  2KIU A;  4EJU A;  2BEO A;  4MHG A;  2JT1 A;  3CLO A;  1S3J A;  3BRO A;  3G3Z A;  2Y48 A;  2P4W A;  4Q47 A;  1QGP A;  3KLN A;  3HRM A;  1P6R A;  1DDN A;  1ZGJ A;  2QUF A;  1YW7 A;  2GXG A;  2RGV A;  5LEK A;  4RB3 C;  4XLP F;  3WGI A;  2HEO A;  2KIF A;  1J0R A;  1IZ1 A;  2H6C A;  2BGC A;  4MQV A;  2VC0 A;  2QBY B;  1T6S A;  2ZJ2 A;  4I7H A;  3KZZ A;  2QZ8 A;  2JRT A;  2A5Y B;  3MCZ A;  2FBI A;  2G7H A;  2WTE A;  3HOS A;  3KET A;  5AIQ A;  3TGN A;  2JPC A;  4G94 A;  3RI4 A;  1I5Z A;  4HQM A;  2M8E A;  3CDH A;  2WC2 A;  1MGT A;  4HX4 A;  5DD8 A;  4YFN F;  1R1T A;  5HLH A;  1GVJ A;  4RB0 A;  1F5T A;  2P6T A;  3S2W A;  2OZU A;  2NNN A;  1LVA A;  3DQV C;  4N9H A;  3FM5 A;  4ESF A;  2VE8 A;  3L9F A;  3RKX A;  4EM0 B;  3I4P A;  1U5T B;  2FBH A;  2EA2 A;  2GWR A;  2IT0 A;  3IC7 A;  1LDD A;  2P5K A;  3R0A A;  1XDU A;  2JTV A;  3FXQ A;  2NS0 A;  5ICC A;  2ELH A;  2COM A;  3WTS C;  1EH8 A;  2K02 A;  1MZB A;  4G6Q A;  1FT9 A;  1B4A A;  1YW9 A;  1F1Z A;  1G6N A;  1AOY A;  2PMU A;  3I59 A;  5JI6 A;  4XSZ F;  4WXH A;  2QYO A;  3ISP A;  1S8N A;  3CO6 C;  5FD6 A;  4JBA A;  2MA3 A;  5DYM A;  3QPH A;  1IRG A;  1G4D A;  3GEZ A;  5E18 F;  3SZT A;  2YR2 A;  3WGH A;  3RIR A;  2O03 A;  1U5T C;  3DV8 A;  3EYY A;  2W24 A;  3PQJ A;  1YIO A;  3ABU A;  4JQF A;  3SHF A;  1R22 A;  3HSE A;  2CW0 F;  2R3S A;  1ULY A;  1FYL A;  1GXP A;  5DUK A;  2CYY A;  4AIJ A;  2VBY A;  5L3E A;  5FLX K;  4ZYD A; 
#chains in the Genus database with same CATH topology
 4RLQ A;  3MMY B;  2E60 A;  2B0L A;  2P7C B;  4KIC A;  1JUP A;  2L4M A;  1B9M A;  5LGU A;  5J8C A;  3AG1 H;  5HNH A;  5K5Q A;  3MKY B;  1ZGW A;  3OSG A;  1FOX A;  2KRF A;  4BXF A;  2AXT C;  2OUM A;  1T2K A;  5K1Y A;  4BL0 B;  4DJA A;  1IUF A;  2STT A;  1YX3 A;  3VWB A;  2X9D A;  2OV7 A;  2EIN H;  3AG4 H;  3ZCO A;  3DBL B;  4GDF A;  2VBW A;  4C2U A;  2M8G X;  3O8H A;  3E5U A;  1VQ8 I;  1DU0 A;  4ENM A;  5TRD A;  5IY5 H;  3QAH A;  4ZTF A;  3M8E A;  4XID A;  4LG0 B;  2X6X A;  3N4M A;  1FWZ A;  1GUU A;  1YTY A;  5HDG A;  2VQG A;  4EEF G;  2XB5 A;  2XVC A;  2D1V A;  3KX2 A;  1WJD A;  5JLW A;  4OOI A;  2W57 A;  4PJL A;  4B3A A;  1ONV A;  4EAT A;  1MMD A;  4M6X A;  2IS4 A;  2F4O B;  5CYV A;  4EM2 A;  3ZRG A;  1XMK A;  4OAZ A;  3CCR I;  1Y56 A;  1BBY A;  2MC3 A;  2RVC A;  2EV0 A;  2ZXH A;  5DTD A;  2R5Y A;  1OYI A;  2HTS A;  1BR2 A;  1P7I A;  2JMW A;  1HQC A;  2Y0S N;  3EET A;  5CVR A;  2VT2 A;  5CVV A;  2OPT A;  2CUJ A;  2VKH A;  2QQ8 A;  2XSJ C;  1OYW A;  1Z6T A;  1T98 A;  1HBX G;  1KA8 A;  3HDD A;  3OOU A;  2R7U A;  4B3X A;  4ESJ A;  2L9V A;  2WBM A;  2EZL A;  3RYR A;  2RQQ A;  3CES A;  2UUZ A;  1VQL I;  1ZHF A;  4ZH4 F;  2HYJ A;  3SZG A;  1RRJ A;  2X1E A;  2FQ3 A;  2WAQ A;  1I39 A;  4ZZL A;  1KQ9 A;  1QPI A;  4PDK A;  3UR3 C;  2K4B A;  4IHV A;  3HOW J;  4HW0 A;  3I56 I;  1ETO A;  5KAF C;  1LQ1 A;  2L9R A;  5J4Y A;  3T8T A;  2ECB A;  1RR8 C;  3BTL A;  1H88 C;  1VQP I;  1UCR A;  1D0Y A;  4F93 B;  1Z05 A;  5IP7 J;  1W5C C;  5C44 J;  2F5F A;  3LSM A;  1U9N A;  4U88 A;  3F22 A;  1W4M A;  3W6V A;  2D2W A;  2X6O A;  1QHG A;  3AG3 H;  3EYI A;  1WH7 A;  1ETX A;  1UAA A;  3L2W A;  2BW3 A;  2Q8K A;  1SD7 A;  1XC5 A;  1YS7 A;  2DLL A;  2M34 A;  1JHH A;  1IDZ A;  4KUM A;  4RGX A;  1R1V A;  4AIK A;  3BG5 A;  2V1D A;  3E6D A;  1KGS A;  2VBZ A;  1S6L A;  4FE4 A;  4KIB A;  2LY1 A;  5JVT A;  3OYI A;  1O4X A;  1LEA A;  2JRM A;  3WE3 A;  1DPR A;  4D7N A;  3R61 A;  4UVB A;  4Y33 A;  2D1H A;  1SD5 A;  2WB1 A;  4A2U A;  4KN4 X;  1LFU P;  2LKP A;  2XGD A;  3BG9 A;  4MIM A;  2FU4 A;  2BY3 A;  2EZK A;  3FMQ A;  4IOC F;  2WY8 Q;  4O5V A;  2ACJ A;  4OIR F;  2OBP A;  2VQH A;  1VFC A;  2DA3 A;  2EFO A;  1EV7 A;  2YU3 A;  5TJJ A;  3DBR B;  1RES A;  3KFW X;  4PGG A;  5HLT A;  4G8X A;  2EZH A;  3K0L A;  3TDZ C;  1MBJ A;  4LG3 A;  1FMV A;  4AD9 A;  3GTQ J;  5JR3 A;  3LMM A;  1MBK A;  1P2F A;  2Y69 H;  4IJA A;  5FO5 A;  1JHF A;  4MNU A;  1E2X A;  3TO7 A;  2HGC A;  1DP7 P;  4JX5 A;  1GV5 A;  2VKE A;  2A6E F;  1JJ8 C;  2A5W A;  1QHH D;  3DKY A;  2XGE A;  3OL3 A;  4ZDL A;  1PUF B;  2IP2 A;  3BWG A;  5E3L A;  2KLO A;  2IPQ X;  2GAU A;  4P96 A;  4F52 A;  4PJ0 C;  1T0F A;  1X1P A;  1JXS A;  3K2Z A;  4U0Y A;  1Z6R A;  3S93 A;  2EWN A;  1J59 A;  3K69 A;  1LFP A;  2X48 A;  4JYK A;  4I01 A;  4PSX A;  4NDL A;  2JN6 A;  1FBS A;  4PGH A;  1MDM A;  2W7N A;  5B1A H;  2GBY A;  2DK8 A;  4U7D A;  4I0A A;  4XL9 A;  1R58 A;  2A69 F;  2E1O A;  3CF5 F;  2BXZ A;  4BQN A;  2LBF B;  3OL4 A;  2P5V A;  4M3B A;  4FHT A;  4J01 A;  1RUO A;  1UHS A;  2D45 A;  1EF4 A;  4MTE A;  1IRF A;  2HZD A;  5D6F A;  4CIC A;  3I9V 2;  1X1B A;  1HW1 A;  1SAN A;  1ODD A;  2MYS A;  3J80 K;  5LFA A;  1REP C;  2PI0 A;  4IRH A;  2QEN A;  5HLG A;  1USS A;  1WHU A;  2M5W A;  2RQP A;  2ISY A;  4AYB N;  4ANJ A;  3OSF A;  4LFU A;  4AID A;  3QRF F;  4XRM A;  1HSJ A;  2M0C A;  3HZJ A;  2E2J J;  2K9S A;  5L3C A;  3JSO A;  1DGW Y;  1ZRD A;  2DYR H;  1OFC X;  4UV8 A;  3T5X A;  1SAU A;  2NVT J;  2DMQ A;  3ZQI A;  1ETK A;  4A5N A;  3DCF A;  3T1B A;  1TWG J;  3CMA I;  2HVR A;  2EFW A;  3TED A;  2JA5 J;  4XKB A;  2DA2 A;  1EJ9 A;  4L18 B;  3GTG J;  1E3H A;  1G3T A;  2DMP A;  2PMZ N;  4AWX B;  3M7G A;  4D9J A;  2FA5 A;  3ZMD A;  1H0M A;  4I2O A;  1NG7 A;  3K1N A;  2KL4 A;  1AU7 A;  5K7F A;  1P9Q C;  2VT3 A;  2Z99 A;  4BDZ A;  4PSW A;  5JHF A;  1WRJ A;  4HF1 A;  2KJB A;  2VJI A;  3I54 A;  2H8R A;  5FKM A;  1IG7 A;  4BH9 A;  5CVI A;  2ZNZ A;  3DPL C;  1FX7 A;  4BQO A;  1MBH A;  3K1P A;  4GCV A;  4XLE A;  4M9S A;  5B3S H;  2R7D A;  1OYY A;  3TDU C;  1FZP B;  2NRA C;  1Z21 A;  1ZG5 A;  1A36 A;  3CO7 C;  2V4J C;  1BI2 A;  1MJB A;  2PFB A;  4YII A;  5GPA A;  1W7P D;  3TKY A;  4C9Y A;  4WWC A;  3NQO A;  5DM6 F;  5EJC A;  4RAY A;  1XSD A;  2CRG A;  3SQN A;  1WSU A;  4JP0 A;  5JHU A;  5M3M J;  3L2U A;  4ZYG A;  5CJ9 A;  4B4C A;  3CME I;  4O6J A;  3PNY A;  2R7R A;  2ZO4 A;  1WI3 A;  3S15 J;  2WV0 A;  4LK1 F;  3FBI B;  4BE2 A;  2XPW A;  1OCC H;  1PYV A;  4BAY A;  5FRM A;  1H9G A;  4X0G A;  2F4I A;  1MD0 A;  1HDD C;  1B1B A;  1QO0 D;  2LF8 A;  5DDG A;  1FIP A;  2DA4 A;  3WU1 B;  2IA2 A;  1NTC A;  3FX3 A;  1ON2 A;  2DOA A;  4F55 A;  4A12 A;  2H1K A;  1HKT A;  2LKX A;  2VXZ A;  1WJB A;  3F0C A;  4ZDP A;  4KIS A;  5ILU A;  2VOO A;  1XPX A;  4M6Y A;  4Z2Y A;  4EJW A;  4Y3O A;  2MH9 A;  2RNG A;  2L7Z A;  5HS8 A;  2R7W A;  2IBD A;  5H2F C;  4FQG A;  4C3H J;  3F9K A;  3FXL A;  2DFF A;  4CGZ A;  3RYP A;  2HDW A;  2ZC2 A;  3FIW A;  3B73 A;  5JFR A;  3O3K A;  5FGM A;  3E7L A;  1W36 C;  1HW5 A;  1XGN A;  2ZBK A;  1KU9 A;  4MLO A;  3PIP F;  1ZRC A;  4M9Z A;  3HOZ J;  5FD5 A;  2HYF A;  4ZZD A;  2CV2 A;  2H6B A;  3FMR A;  3L09 A;  9ANT A;  4HG2 A;  1HCR A;  4U7B A;  3FIS A;  3GZN B;  1FEX A;  2P7V B;  4CYC B;  3I59 B;  3U1D A;  2DT7 B;  4BU2 A;  2ZME A;  3PL8 A;  4G12 A;  2QCO A;  2X4H A;  3JTH A;  4RBO A;  2W4S A;  1MH3 A;  3RDI A;  4BY1 J;  1E3O C;  2HU9 A;  5EYR A;  2A05 A;  3K4J A;  3HIF A;  2LY2 A;  1FMW A;  1Z3X A;  5CQG A;  5K7Z A;  1B8I B;  3KIO A;  2M7A A;  4UB8 C;  3LAJ A;  2FXA A;  1XN7 A;  2CUF A;  2E7W A;  1O7F A;  2M7B A;  3MAJ A;  1OCT C;  3PUF A;  4BQA A;  1ZKG A;  1W0T A;  4L5I A;  2FSW A;  3F3X A;  2GA2 A;  2QQA A;  4IX7 A;  4FX4 A;  2FJ1 A;  1R5G A;  4YFX F;  1HXD A;  2LVS A;  3S1N J;  5D5V B;  4JX6 A;  3J7Z I;  4II2 A;  3RPQ A;  2FNA A;  2XC7 A;  3P7N A;  3ZGK A;  4A3M J;  1YJ9 I;  4FIS A;  2CQ7 A;  2EH3 A;  3V8L A;  3IKT A;  2ZJQ F;  5IT9 Z;  3JRI A;  3WG9 A;  2KZG A;  3WTV C;  3PQK A;  4FET A;  2UXX A;  1D8J A;  3Q0W A;  4R8H A;  4HLY A;  4E7H A;  1YO5 C;  1MND A;  3GLL A;  1X4O A;  2L5Q A;  2JWT A;  2PBI A;  3MZY A;  3MWM A;  3WTU C;  3PO2 J;  2XDV A;  3OYA A;  1R9T J;  4A3E J;  2M45 A;  1BA5 A;  2A6T A;  4HNV A;  2JVH A;  1HF0 A;  2B7E A;  4U0V A;  3IH3 A;  2FF4 A;  5HLI A;  4CCN A;  5ILV A;  1F36 A;  2ID6 A;  4F91 B;  1TQP A;  3CCY A;  1TT5 B;  3ABM H;  3HRT A;  3QU3 A;  2V6E A;  3ZXS A;  1OCR H;  3ELK A;  5F0F A;  1CGP A;  2JZY A;  1YJN I;  2IRF G;  5AIP A;  2H8W A;  2HDC A;  1P7J A;  4PUS A;  3RQI A;  4NC7 A;  3S2H J;  3BG3 A;  4F7Z A;  1SFO J;  2O6G E;  4K2E A;  1K78 A;  1Y0N A;  4OWR B;  1D1B A;  3DU6 A;  3VB2 A;  3D5L A;  4R79 A;  2L9N A;  3LFK A;  3QPS A;  5A2Q K;  1S72 I;  1FYK A;  3K4L A;  4CA0 A;  4A3F J;  1FOK A;  1ZG1 A;  2Y2Z A;  3E6M A;  1X1D A;  1FC3 A;  4PZJ A;  2R0Q C;  3W2A A;  4RS8 A;  1CF7 A;  5J6X A;  2DDA A;  3H5N A;  3NRV A;  4N9I A;  2P6S A;  3LSH A;  2R7V A;  2OD5 A;  4Y13 A;  4L9T A;  2EB7 A;  1YLF A;  2W85 A;  3BLY A;  5FKK A;  2HOE A;  1KQ0 A;  5FB2 A;  2R5Y B;  1K4T A;  2STW A;  3SFZ A;  4MQ9 F;  4A3G J;  2CV0 A;  3GZ6 A;  4V2G A;  4LMY A;  2Y0M A;  5HDN A;  3CJR B;  3I71 A;  1RUN A;  2PQ8 A;  2LD5 A;  1N78 A;  2LH9 A;  2Y75 A;  4A3L J;  1U8B A;  2VBX A;  1Y1V J;  1WGX A;  3JRB A;  2VE9 A;  2PJP A;  3WU2 C;  2LF7 A;  1K79 A;  1ZAO A;  2VOP A;  2GLO A;  2P8T A;  3RKY A;  3KYL A;  4DBR A;  1KYW A;  4I98 B;  3GO5 A;  5E8I A;  1XX5 A;  4LLG F;  5FFX A;  4KA4 A;  2DAO A;  3IL2 A;  2M0M A;  3VYU B;  4U87 A;  3L2V A;  3DEW A;  2A3S A;  2KQR A;  3LSP A;  4AVZ A;  1Z77 A;  2QSF X;  5DS9 A;  4OMY A;  3HL2 A;  1TQI A;  3O2P E;  4ZJZ A;  3FXR A;  2M87 A;  2GQQ A;  4H0E A;  3ERE D;  4HX8 A;  2CUE A;  2XRL A;  3P9C A;  5FRN A;  2IS1 A;  4YIF A;  2BW3 B;  2MLG A;  2Y0S A;  2OCC H;  3SDB A;  3EPZ A;  1A31 A;  1IV6 A;  2EV6 A;  3HRU A;  2H09 A;  4RGU A;  4XK4 A;  1EA3 A;  1OIS A;  1VQ7 I;  1SFE A;  2HTJ A;  2XAG A;  5ILS A;  4BEH A;  1XS9 A;  3TO6 A;  4ZYE A;  4CH7 A;  3G2B A;  1U8R A;  1S5L C;  1QZZ A;  3RJP A;  2LMD A;  4XOR A;  1BI3 A;  3H9Q A;  3W6J B;  4CUG A;  4KFC A;  1WPK A;  5J1Y A;  1HDP A;  3I0T A;  3AL0 B;  1QZE A;  2HQ5 A;  2NXN B;  2DA7 A;  1LB2 A;  4OU0 A;  3I53 A;  4RM3 A;  3A2K A;  3IRR A;  4UUS B;  1ZQ3 P;  2PJR A;  1NK3 P;  2YPR A;  4AC0 A;  2HWV A;  4EM1 A;  3A01 A;  2RKH A;  3DEU A;  3SDG A;  4G7H F;  3C2H A;  2GXB A;  2KMU A;  2LLK A;  1QQI A;  1R4M B;  2IA0 A;  3DLA A;  3UKG A;  2L3D A;  3OYC A;  3RKQ A;  2IS2 A;  2VN2 A;  2OQR A;  3Q9V A;  5DEQ A;  1H9T A;  3E6C C;  3PIO F;  2XAJ A;  3BY6 A;  3OMY A;  2CUZ A;  3LSR A;  2IGN A;  2GZW A;  1KYZ A;  4ZYD A;  1D5V A;  1BN5 A;  4BXU A;  4DGW B;  2HVQ A;  4YRV A;  2HOT A;  1XCB A;  5CPR B;  1IN5 A;  2OAZ A;  4E7S A;  2LG4 A;  2OTL I;  1R1U A;  1ZLJ A;  6PAX A;  2LC2 A;  3OV8 A;  4BQQ A;  3AG2 H;  2ZJR F;  1YFH A;  4EJT A;  3CCL I;  2FMY A;  4HYE A;  4I6Z A;  1MNE A;  4YFK F;  2DOD A;  3BZK A;  2R7F A;  4HV6 A;  5EG0 A;  1ZGA A;  3HGY A;  2YSR A;  1S7A A;  4M3E A;  1MDM B;  1JT6 A;  3AL0 C;  1TWF J;  3BP8 A;  5HNF A;  1O3S A;  3DFG A;  2OA4 A;  5LRR A;  1BC7 C;  2I8D A;  4B43 A;  2E2H J;  3CF2 A;  2XAS A;  4NC8 A;  2KFD A;  1QPM A;  2UXN A;  1IN6 A;  4UVC A;  4Y15 A;  4LB6 B;  5BMZ A;  4ZDO A;  2G7U A;  1UZC A;  2XAQ A;  3OIQ A;  1G3W A;  4OAY A;  1J2X A;  2HXI A;  1FBQ A;  5DD4 A;  3ROU A;  2L4A A;  3KEQ A;  5J40 A;  4M9X A;  1PP8 F;  2DDB A;  1ERD A;  4BE1 A;  3FHZ A;  2DFE A;  4P9F A;  4CHU A;  2QVO A;  4J00 A;  4W1U A;  1WJF A;  3DF8 A;  4UNO A;  2ZSH B;  1FSE A;  2LKS A;  3JCU C;  4S04 A;  1FOY A;  1RET A;  1JUM A;  2FEZ A;  2HZT A;  2R7Q A;  3ZMZ A;  2XKO A;  3ZQQ A;  2CS3 A;  3ZN1 A;  1A04 A;  2X1C A;  2CWE A;  2FNP A;  1C0W A;  1IAW A;  4HX7 A;  5D5W B;  2IEK A;  4A3D J;  3CCV I;  4D0P A;  1NHA A;  2KJC A;  1Y0U A;  2CSO A;  3F6O A;  5EGO A;  4UXN A;  1K6O A;  3M1C A;  1D0X A;  1EH6 A;  1MMN A;  2W1O A;  4GYI A;  5F0C A;  3WTX C;  4P9U A;  2EPF A;  3TP3 A;  4A3B J;  3FF5 A;  2K27 A;  3BR2 A;  2OU2 A;  3ABL H;  1ZTR A;  2DI3 A;  2DJN A;  2PMH A;  3F8B A;  2O8K A;  2NVU B;  3DP7 A;  3J7A O;  2R7S A;  1XDS A;  1BI1 A;  4ENN A;  5KVR A;  3PFI A;  5F1J A;  1JKQ C;  1RI7 A;  4XMY A;  2AO9 A;  4QIW N;  2RAE A;  1TNS A;  4A5M A;  4EJV A;  1SFU A;  1ZRE A;  1TQM A;  2VAS A;  1D3Y A;  1HC8 A;  3TP0 A;  2JK3 A;  2LDU A;  1WJE A;  3ABK H;  5IP6 A;  2E1M B;  1MMS A;  4X1E A;  1TWH J;  3ML6 A;  4NQW A;  4WK8 F;  3JRD A;  1PVE A;  3QPT A;  5C4J J;  2PMZ A;  4BJ6 C;  4M72 A;  2DTR A;  1B9N A;  1W7P A;  4HRI A;  2KRH A;  3WOD F;  1Z0X A;  4ENJ A;  2ELJ A;  3FMS A;  2TCT A;  5GP9 A;  2B63 J;  3EDP A;  3BOQ A;  1PDN C;  1OCP A;  5DV5 A;  4XOT A;  4CZZ A;  2E5Z A;  2ZXI A;  5F04 A;  1IXC A;  3CC7 I;  2DFI A;  2VPR A;  3WE2 A;  4N4O B;  2JA8 J;  1KON A;  4EGZ A;  1V54 H;  1Q1V A;  1N77 A;  3WTW C;  4M3F A;  1Y6I A;  3U21 A;  4GYG A;  1ZR2 A;  4OIP F;  2F5E A;  2EIL H;  3ZMV A;  5HOO A;  3ZN0 A;  2JA7 J;  2E19 A;  2NVX J;  2V7F A;  4Y7N J;  1G59 A;  3FK6 A;  4DZJ A;  1F43 A;  2LK2 A;  2EIK H;  4FE7 A;  3G1L A;  2E7X A;  1OR7 A;  1FBU A;  3C7J A;  3QYF A;  3KEY A;  3WU0 A;  4B8X A;  4D1Q A;  4V19 K;  1LKX A;  1FP1 D;  2BHY A;  3H0G J;  2M9H A;  4BGD A;  4MTD A;  2DT6 A;  5GPC A;  3HKZ N;  4EJO A;  2YS9 A;  1VF9 A;  4EMS A;  2BYV E;  2R5Z B;  2VB6 A;  3HXL A;  1BI0 A;  4DW6 A;  3BQZ A;  4KIF A;  3DU5 A;  3O8G A;  5IPA A;  2LSO A;  3SFI A;  1TZL A;  2Q2E A;  2E36 A;  3CMM A;  1QA6 A;  3LA2 A;  3WHB A;  1N75 A;  3LQR A;  4XOP A;  3F72 A;  3V8J A;  5D8L B;  1E17 A;  1QRY A;  5LHH A;  2DK5 A;  3FZV A;  3P9I A;  3F6V A;  3QYB A;  3VYR B;  2V1U A;  4IRI A;  3BR6 A;  2DA6 A;  3F8F A;  4M73 A;  1VTN C;  4XBF A;  4KDP A;  3LL7 A;  4LIU A;  2HKX A;  3BG6 A;  2XV4 S;  4BXX J;  4LGW A;  2ESH A;  4L0Y B;  5ICF A;  3RPU D;  3ZQ7 A;  4PJN A;  2V9P A;  3CJQ B;  4WXD A;  3LOC A;  2ZKZ A;  3LFU A;  1D8K A;  3FXJ A;  1R71 A;  1WJ5 A;  4XLC A;  3QOP A;  3SEQ A;  5D4S A;  2K9M A;  2QWW A;  4IQJ A;  4LJZ F;  1NH3 A;  3QU6 A;  4II3 A;  4CXF A;  5JVG F;  2QGU A;  4N4N B;  2LNB A;  3OWT A;  4S05 A;  1L3L A;  2VJ5 A;  4AUX A;  4Q5S F;  4RGR A;  4RAF A;  1P92 A;  1S7E A;  1XD7 A;  2LTP A;  3ULQ B;  3HSR A;  1YIJ I;  3K4N A;  2V6C A;  4PCQ A;  4FAS D;  1HKQ A;  4A6D A;  1HA8 A;  3R0J A;  4IQ4 A;  3K4K A;  3BT9 A;  1DGR M;  1IN8 A;  3OYK A;  3QP5 A;  4I99 C;  4ASN A;  4GGG A;  4U0W A;  2XAF A;  1FNN A;  2B9S A;  4NC6 A;  2KKO A;  3J81 Z;  1ZYR F;  2NVQ J;  1OPC A;  3B6C A;  2OZ6 A;  3PNT A;  2NVY J;  3GFI A;  3CCM I;  4XIC A;  3L2Q A;  3HM5 A;  4I76 A;  4PFO A;  3L1P A;  2X1D A;  4EVI A;  1MNM C;  4XON A;  1ZH5 A;  3CMY A;  2M2E A;  1XMX A;  2DQL A;  3K4B A;  4AIH A;  4P5O A;  4HV5 A;  4M3D A;  3U2R A;  4BE0 A;  1OLT A;  3BCA A;  5L3B A;  2ZB9 A;  4Y52 J;  2ZNY A;  1K78 B;  2I10 A;  1J5Y A;  1JTY A;  2K3P A;  4QPO A;  4RB1 A;  2H27 A;  1Z9C A;  4ABZ A;  2GIZ A;  1T39 A;  3EQL F;  5ICG A;  3ASO H;  1XSX A;  2EQR A;  2QSG X;  4I02 A;  1BW5 A;  3K7A J;  1CF7 B;  2XAH A;  1W0U A;  3VSK A;  4KYW A;  3VPR A;  2BZT A;  3KPH A;  4LIT A;  3HHH A;  4UHT A;  4RA2 A;  3SYT A;  1JT0 A;  3EUH C;  2W48 A;  2JSP A;  4MEX F;  2RC4 A;  1X3Z B;  2RDP A;  1S9H A;  3HOY J;  3EUA A;  1L0O C;  3HPG A;  3S1R J;  4IPA A;  2M4G A;  3HOT A;  4LK0 F;  1O7L A;  2L7K A;  4QLC U;  1FOW A;  3I64 A;  4NHJ A;  3HTS B;  4GO1 A;  3V7R A;  2KP6 A;  5E1X A;  2G9W A;  4A0Y A;  1SAX A;  3CUQ A;  1KZH A;  4A6E A;  5E1W A;  5EDN A;  2QM3 A;  2WAD A;  2R7Z J;  3M4O J;  2FRH A;  2CQX A;  1J9I A;  2L0K A;  2NOG A;  2RN7 A;  3BJ6 A;  1X3U A;  3IRQ A;  1H8A C;  1JUS A;  3G73 A;  2HPM A;  5BNG A;  4EGY A;  1RR7 A;  5ERI A;  3OYF A;  4MFD A;  5M5Y J;  2ADU A;  1R49 A;  1N25 A;  2E2I J;  4XKV A;  4C3J J;  4B47 A;  3GFJ A;  4F3Q A;  3U1K A;  5DCM A;  2Z16 A;  5CQE A;  3MFK A;  2UZK A;  3A02 A;  5FLV A;  3HOX J;  4LLN A;  1TBX A;  4M74 A;  1YW8 A;  2K4J A;  2ID3 A;  3SXY A;  2C6Y A;  5EEA A;  1O57 A;  2QKL B;  3J81 K;  4BJT A;  2F4M B;  3IHU A;  1XGS A;  1XGO A;  2DMT A;  1YG2 A;  4BEH B;  4CCK A;  2DMU A;  4UUV A;  2DJI A;  2O7O A;  1WWX A;  5BQT A;  4CZC A;  2M30 A;  1GXQ A;  2JSC A;  3KCC A;  4ESB A;  4BBS J;  2EV5 A;  1YYV A;  1Z3Y A;  2DW4 A;  4IHT A;  2FE3 A;  5LRS A;  2JQ7 A;  1ENH A;  3AAF A;  2MW8 A;  1MJ9 A;  3M1E A;  3OYN A;  3ZMU A;  3S16 J;  2JVG A;  2O61 A;  1U2W A;  2BY2 A;  5F6F A;  5IT3 A;  3CCS I;  1JGS A;  3BTC A;  2PJR B;  2EIJ H;  4I09 A;  2ME6 A;  3WTT C;  1W5T A;  3G1O A;  3MKL A;  4BHP A;  5L3F A;  3A01 B;  4MFE A;  5GAG J;  3MKZ A;  3O6B B;  2V1X A;  1ZN2 A;  2A68 F;  1IW7 F;  3W6K B;  3HHG A;  4IOA F;  1UJ8 A;  3MKW B;  4B09 A;  3MD2 A;  3JSP A;  3NAR A;  2XF5 A;  3K70 C;  5E1Z B;  4IHS A;  4IXA A;  5IOZ A;  5KCM A;  2CH0 A;  1WJC A;  1X4P A;  3PSI A;  2VXD A;  4HQE A;  1NK2 P;  2F2E A;  1OMI A;  1ZR4 A;  4L5J A;  4NUB A;  3E5X A;  1FJL A;  1TT0 A;  2VJJ A;  3ECO A;  3B6A A;  2WY7 Q;  1IN7 A;  4HF2 A;  2O0Y A;  3MEX A;  4GRI A;  1OCZ H;  1POG A;  3JRF A;  5EG0 B;  5C4X J;  5E20 A;  4QSH A;  3OYD A;  4OMZ A;  5H6R A;  3WG7 H;  3E3V A;  4KMF A;  5E17 F;  1V5G A;  2YU9 J;  2E71 A;  2VL8 A;  4DYC A;  3PM1 A;  1XSV A;  2CW7 A;  4H4K C;  5J4V A;  3IH2 A;  2EFQ A;  5HS7 A;  1D0Z A;  3GW2 A;  1UB9 A;  3RCO A;  1F4K A;  4MO7 A;  3WHC A;  4AM3 A;  2DA1 A;  2F5D A;  5K7H A;  4YG2 F;  3H1C A;  2F5C A;  1T38 A;  4HF0 A;  2WAF A;  4E7I A;  2L7M P;  3HOV J;  2VON A;  3HG9 A;  1YRN A;  4BUP A;  3DBH B;  4IVN A;  3TMO A;  3DLL F;  1YOV B;  2ZFW A;  2MG4 A;  2EK5 A;  3HUG A;  2BE5 F;  3PUB A;  2FX0 A;  2J5O A;  3HEF A;  2HQA A;  2ISZ A;  2VJ4 A;  5DCF A;  1MMG A;  2QQ9 A;  2IA1 A;  2XUB A;  1FY7 A;  5LHG A;  1MBE A;  2BVM A;  2FUG 2;  3LAP A;  2ZCW A;  2XRN A;  2R7T A;  1FSH A;  3DPT A;  2EJR A;  3GBG A;  4LOC A;  3N97 A;  4KIT B;  1FIA A;  2R4G A;  3BR1 A;  1UST A;  3H5A A;  2Q0O A;  5D5U B;  3S3N A;  1LE8 A;  2K85 A;  1E0E A;  5EGO B;  3R60 A;  4DQ2 A;  4BHB A;  2EA4 A;  1U6G A;  2NNY A;  1ZRF A;  4J19 A;  2A61 A;  5CVU A;  1HKS A;  2L9S A;  3OS0 A;  3LQQ A;  3RTR A;  4L0Z B;  2K86 A;  1MSE C;  5FLM J;  3H0D A;  4CO8 A;  1TTY A;  3SJM A;  3HC7 A;  3KEO A;  3H3U A;  4DZP A;  1MBG A;  3QQA A;  3KP6 A;  3KP5 A;  1IF1 A;  4P1W A;  2HKO A;  4BY7 J;  5H20 A;  2V9V A;  4Q4Z F;  4NB5 A;  5FKO A;  3V7S A;  1TWC J;  4A0X A;  3ASN H;  1O3T A;  4OIQ F;  3LA3 A;  1APL C;  4ZC3 A;  2NS8 A;  3FXO A;  3SEZ A;  3FHN A;  2ESN A;  1R00 A;  1PJR A;  3PNV A;  1STZ A;  1W7P B;  2AHQ A;  1EH7 A;  4FX0 A;  2XRO A;  3L7W A;  1UHW A;  3CLQ A;  5HOD A;  5GAD J;  3G71 I;  2VC1 A;  2HI3 A;  1GLN A;  3PFY A;  3FK7 A;  1KU3 A;  2K9N A;  4UY8 I;  3COA C;  2ZFU A;  4YIR X;  5BS6 A;  5E3O A;  2OQG A;  1V3F A;  3SZP A;  1RC9 A;  3MQ0 A;  1Z7U A;  2YX4 A;  5IT9 K;  3VEP A;  3G4S I;  1I1G A;  3L2C A;  3BC8 A;  3F23 A;  3LSK A;  4HST A;  1Z91 A;  3K2A A;  1JKO C;  3D5R C;  1X58 A;  2CW8 A;  2F5V A;  3K4C A;  3TOA A;  2TRT A;  5FKN A;  1HOM A;  2UV1 A;  4RDU A;  2HOA A;  1P4X A;  1JI8 A;  3W2W A;  3GWZ A;  5FLX Z;  3CJT B;  4JK1 X;  4XLN F;  5EEG A;  3KP4 A;  4L9N A;  1VQO I;  4O3M A;  2HFH A;  3CP2 A;  1YQA A;  4RMN A;  3JAM Z;  4BS9 A;  3VFZ A;  2Q2E B;  2CQQ A;  4OIN F;  5E3M A;  3GXO A;  3D0S A;  1DQU A;  3KZI C;  5K5O A;  5EF6 A;  3OS2 A;  2IGM A;  3QP6 A;  1Z1D A;  3CP8 A;  5IYC J;  1ZK8 A;  1OQY A;  2GOM A;  3KP2 A;  1FP2 A;  1MJA A;  2DFH A;  2VQL A;  2DN0 A;  4LIV A;  3KE2 A;  3V8K A;  1YHQ I;  4RM2 A;  1UEL B;  1AKH A;  2PX9 A;  2CO5 A;  4HNU A;  4M71 A;  4AVP A;  4ENK A;  1IUY A;  3CD6 I;  3HPH A;  4B48 A;  4EV0 A;  2HR3 A;  1TLH B;  1MMA A;  5J8F A;  4LD5 A;  4BDY A;  2R93 J;  1HST A;  3VSL A;  2X85 A;  3WTZ A;  1SD6 A;  1M1E B;  2VKV A;  4E4H A;  3K4M A;  4BBR J;  1ZLK A;  1SVO A;  3ESW B;  1KU7 A;  2IS6 A;  2HQR A;  3RPU A;  2BY1 A;  2X6Y A;  2O3F A;  1ORK A;  3FKJ A;  3ONQ A;  2DOF A;  2LYC A;  3DTE A;  5B5E C;  4BKX A;  2LY9 A;  3F8M A;  2DPU A;  3S8P A;  2L7F P;  4C2T A;  3T8R A;  3JTG A;  3K9T A;  4LB5 A;  5D8K B;  5D6E A;  5TGT A;  3Q9S A;  1WCM J;  2F48 A;  2MLK A;  1TW2 A;  4AU7 A;  1UFM A;  4UV9 A;  2JPB A;  5H6Q A;  1U78 A;  1ZAR A;  2NYX A;  2Y31 A;  3I4N J;  4CCJ A;  1B72 A;  2FOK A;  2COB A;  4HBL A;  2Y9Z A;  1TNT A;  4Y17 A;  3TW7 A;  2MH2 A;  2DXI A;  5J1R A;  4Y4R A;  4KT6 A;  2V9K A;  1TP4 A;  3DWL E;  3TW6 A;  1LPQ A;  5GAH J;  5ED4 A;  3HTU A;  4G6D A;  5CVJ A;  5DM7 F;  3GLX A;  4FT8 A;  3V4G A;  3TOB A;  2GOX B;  1ON1 A;  5LLQ A;  1W5S A;  3IP4 B;  1SC7 A;  3ERM A;  3ZOB A;  3V42 A;  1MKM A;  1FPQ A;  3BCB A;  1I6X A;  1LJ9 A;  4ZYA A;  3JAM K;  2GM4 A;  2CQN A;  3FXK A;  1CQT A;  5KHD A;  1T0F C;  1QBJ A;  1LDK B;  5GTH C;  3OY9 A;  4FTH A;  1R7J A;  2DU9 A;  4XQF A;  1JKP C;  1T56 A;  3H92 A;  1VND A;  4CYD A;  2BXY A;  3DEE A;  2M1B A;  3FWE A;  2IW5 A;  4B44 A;  1O3Q A;  3IH4 A;  5BOX A;  3QOD A;  3HSF A;  3A1Y A;  4G7O F;  2BV6 A;  4UVA A;  1XB4 A;  3V7C A;  5LEJ A;  2XGX A;  3VYS B;  4EQQ A;  2OJE D;  3BG7 A;  4XRF A;  2FQ4 A;  3NWS A;  4XSX F;  1IRX A;  4AYB A;  4KIG A;  1SEU A;  3S32 A;  3LNQ A;  3B02 A;  1UMQ A;  2W84 A;  1WQ2 A;  1T08 B;  2IJL A;  3KP7 A;  1IXR C;  3A0H C;  2ECC A;  3CUQ B;  3KP3 A;  3RZO J;  3M3Y J;  3NEU A;  2VQC A;  4ZYH A;  3BJA A;  3HBL A;  2H1L A;  3GFM A;  2QBY A;  3FDY A;  1S7O A;  1NG6 A;  1S29 A;  2P81 A;  1PUE E;  1W36 D;  1XCV A;  1Y1W J;  2R7O A;  2A6H F;  1WFX A;  4RAG A;  3DTI A;  3G1M A;  3GTP J;  4A3C J;  2Z9O A;  3JW4 A;  2RRE A;  4GXO A;  1BW6 A;  2GXA A;  2KT0 A;  3RZD J;  1BM9 A;  5DCM B;  4G6T B;  1ITY A;  4NBQ A;  2QLZ A;  2XAU A;  4E7J A;  4TV7 A;  1G3S A;  1D1C A;  2MAB A;  3REO A;  5IP9 J;  2LRE A;  5B1B H;  2R7X A;  3R6S A;  4KNY A;  1J7K A;  4BHC A;  4YEL A;  1I3Q J;  2DT5 A;  2H94 A;  1FYM A;  3K70 D;  2E1N A;  1D1A A;  5LD2 C;  3NWT A;  3ABT A;  3GCM A;  4DNC A;  2UWM A;  2FML A;  1BC8 C;  1RZ4 A;  2DO7 A;  3C3W A;  3CQZ J;  3JR9 A;  3CCJ I;  3BPV A;  4HEA 2;  3GX4 X;  1K7A A;  2W25 A;  5D4R A;  3ZMT A;  1BR4 A;  1RKW A;  2HXO A;  3QYE A;  5L3G A;  4IRG A;  5D5X B;  4G7Z F;  4A3J J;  2QF7 A;  1O3R A;  2P5L C;  3GFL A;  5IYB J;  1SMT A;  3I3L A;  4KN7 X;  1T33 A;  1P4W A;  3LSJ A;  3H3Z A;  2O9L A;  1BJZ A;  4A0Z A;  5M3F J;  1U5T A;  3CUQ C;  1H89 C;  1W1W E;  3A03 A;  1BL0 A;  3J7A Y;  3J80 Z;  2J5P A;  2N8G A;  3ZPL A;  4C3I J;  1VQM I;  1FTZ A;  3IKV A;  2WWY A;  1HW2 A;  1UG0 A;  4QPQ A;  2E1M C;  1BOB A;  2BOL A;  3AFH A;  4IHY A;  2ZME B;  3E5Q A;  1IRZ A;  5J1U A;  1JKR C;  2MD5 A;  3ECH A;  3Q0V A;  3GTK J;  3IWF A;  3GZ5 A;  2MGQ A;  4WX9 A;  1X2M A;  4MEY F;  1R4N B;  3E1S A;  4PFP A;  2F6C A;  4BNC A;  1LFB A;  3LWF A;  5F64 A;  1QZY A;  1V4R A;  4UUS A;  3OYJ A;  4M3G A;  4DYR A;  3OIP A;  2CMP A;  4R1H A;  3GTM J;  2JUC A;  2ELK A;  2DOE A;  1PP7 U;  2ME0 A;  1QVT A;  1ACI A;  1IN4 A;  3GME A;  1OJL A;  2XGC A;  1I6H J;  4C2M J;  3H3V K;  3R4K A;  4XN0 A;  5JLX A;  5KAI C;  4ETS A;  4E7Z A;  1A5J A;  4DBQ A;  4KT5 C;  1BIB A;  3BTJ A;  2OCE A;  3DTK A;  3MN2 A;  4P55 A;  1X3W B;  4L5E A;  3S1M J;  2CQK A;  3FKI J;  4L9V A;  3LST A;  2KIM A;  3BZC A;  4XN3 A;  3T0Y A;  3S2D J;  4E70 A;  3OR2 C;  4I0B A;  1IXS B;  4XKW A;  4HLX A;  2GA1 A;  1LVK A;  2IVM A;  4MGR A;  1F9N A;  3E97 A;  4IF4 A;  3CCE I;  2VKD A;  2XF7 A;  5F08 A;  3M9A A;  2X51 A;  3I58 A;  3VOE A;  4HDV A;  2AS5 F;  1V55 H;  2BBY A;  4ITV A;  3I4M J;  1SD4 A;  2ETH A;  3CTA A;  3P9K A;  3UNG C;  1B59 A;  2OF7 A;  3GTJ J;  2Q1Z B;  2Z1D A;  4HOB A;  1U9O A;  5LHI A;  4XLA A;  2ZME C;  3KYD B;  4S0H B;  4RAZ A;  4CCO A;  4IKF A;  1YRN B;  3DKW A;  5HDK A;  3BPX A;  3C1D A;  4IEJ A;  1FLI A;  2CFO A;  3BDD A;  2NOJ B;  3GTO J;  1ZG3 A;  2JJ7 A;  3HUG B;  4PJJ A;  3ZQC A;  1AWC A;  1RNL A;  2FD5 A;  5FJ8 J;  2KDO A;  1P4A A;  2ZXJ A;  2V26 A;  4XLF A;  3S3O A;  1ETW A;  3ZQF A;  3M8F A;  1XMA A;  2NS7 A;  3GUD A;  3CDL A;  3JRH A;  1IGN A;  3NAU A;  1SVM A;  3OYE A;  1G2H A;  3A0B C;  1YX5 A;  4WF2 A;  1KQ8 A;  3BTI A;  2HQN A;  1U3E M;  2RNJ A;  1X1C A;  2G0E A;  4ON0 A;  2K5C A;  2FOW A;  4W97 A;  1LE8 B;  1JGG A;  1MSF C;  3WGG A;  1RPW A;  5HS9 A;  3BR5 A;  2ZSI B;  3CC2 I;  2V79 A;  3CCU I;  4BYY A;  2HNH A;  1VQK I;  5LGN A;  4FCY A;  1ETQ A;  3CJN A;  4CCL A;  5F0H A;  1IV8 A;  4F92 B;  3ZP5 A;  1UHM A;  3RKW A;  1TW3 A;  5CLS A;  2YX7 A;  2LP0 A;  5EZG A;  3X2Q H;  3LA7 A;  4XRS A;  4UUT A;  2TDX A;  4QWQ A;  3MZH A;  1OCO H;  3GF2 A;  2WAQ N;  2IAI A;  4WXC A;  5EEH A;  1LUJ B;  4LG0 A;  1QU3 A;  2ICW G;  5M5W J;  1TL8 A;  4XR6 A;  5E79 C;  5ICE A;  2LFB A;  1FTT A;  1XTA A;  3TQN A;  3IWZ A;  2CG4 A;  1U0J A;  1B6A A;  5F27 A;  3ZMS A;  2YUS A;  2KHM A;  2PN6 A;  2IXS A;  4WCG A;  4A69 C;  1BOA A;  4CCM A;  2M4K A;  2K7L A;  1WI9 A;  5AON A;  3J7Y J;  1I50 J;  1ZEL A;  2XF6 A;  3EUK L;  4OIO F;  3W3C A;  4RB2 C;  2HS5 A;  2RV8 A;  4L9J A;  3FXM A;  2IGK A;  2BHZ A;  2XIG A;  4Q48 A;  2GIV A;  3U9G A;  5FFZ A;  1Q1H A;  3OYL A;  2CGP A;  3N05 A;  3HJE A;  1R5I D;  2DMN A;  1BIA A;  2W82 A;  4XNF A;  1Y8R B;  4IZZ A;  2E1C A;  1UG2 A;  4UB6 C;  5KK1 A;  3CUO A;  4KJZ A;  5M5X J;  3GVA A;  3HYI A;  1MH4 A;  2WB1 N;  1KU2 A;  2CFX A;  3K1M A;  1XGM A;  4A3I J;  5K5R A;  1D5Y A;  2Z33 A;  2OTJ I;  2DCE A;  3BZ6 A;  3WTY C;  1WKM A;  2XHK A;  3HRS A;  4A93 J;  3OYM A;  2XKP A;  2HOS A;  3H9J A;  2L01 A;  5LGT A;  1Y39 A;  3A4C A;  5HVQ C;  3IUO A;  1G3Y A;  2PEX A;  3F8C A;  3DXJ F;  5J3L A;  4LLL A;  1GT0 C;  2JA6 J;  1I27 A;  1I1S A;  1ETY A;  1LEB A;  2R92 J;  2FBK A;  2VLA A;  4PK4 A;  2XPU A;  3P5J A;  2HDD A;  2L2O A;  4XLH A;  3IAM 2;  2QKM B;  2X6W A;  3VDX A;  4IHW A;  3MVP A;  1JE8 A;  1J75 A;  2EZI A;  4HDU A;  2MD0 A;  3K6G A;  4NNJ A;  2WV1 A;  3QPL A;  5FKL A;  3Q3S A;  4HNT A;  5LBQ A;  3E6B A;  4RGS A;  1VQ4 I;  2NAZ A;  2D5V A;  3FM3 A;  3KZY A;  1GVD A;  3VYT B;  5BPD A;  2MBF A;  1AKH B;  1MIJ A;  1LNW A;  1J09 A;  3OOP A;  3TO9 A;  1R36 A;  2KZV A;  3JRG A;  4Z6Y A;  3FXU A;  1LDJ A;  2KIS A;  3CCQ I;  1X1A A;  4KMU X;  2R5Z A;  3CZ6 A;  1BJA A;  1SFX A;  2AXL A;  5A2Q Z;  4XKC A;  3M8J A;  4XM3 A;  3KLO A;  3S17 J;  4GFB A;  1OKR A;  4CDG A;  5J47 A;  2CJJ A;  4IL6 C;  3VOD A;  2KIQ A;  2HPI A;  3F21 A;  1QNT A;  2Z5U A;  4JX4 A;  3BJO A;  1DPU A;  1VQ9 I;  2E35 A;  1IJW C;  1E3P A;  1G8X A;  3S14 J;  1T95 A;  4HZF A;  4XRS G;  2BY0 A;  4B1R A;  4HAM A;  1A6I A;  2JA2 A;  4IO9 F;  5E3N A;  4M6V A;  2L54 A;  3I5U A;  1RIO H;  3C18 A;  1R5H A;  3L00 A;  1Z67 A;  3I55 I;  1PUF A;  1DUX C;  2AQE A;  2QSH X;  1VQ6 I;  2DQR A;  2O8X A;  2Z3Y A;  3OR1 C;  5L3D A;  2EFP A;  2MC4 A;  2QQB A;  2Z2S B;  3HGG A;  4N0B A;  1B72 B;  1GHC A;  2VI6 A;  1YS6 A;  3F8N A;  3Q5F A;  3LSI A;  1SVL A;  1SMY F;  3EUH A;  3GYH X;  1JTX A;  2DBB A;  1K6Y A;  2DYS H;  3BR0 A;  5BPI A;  2LRD A;  4G9Y A;  3BQY A;  2X0L A;  2HYG D;  2DPD A;  1MBF A;  2BVL A;  5DUI A;  4QTR A;  1Y8Q B;  2EFN A;  2OC6 A;  2A07 F;  4HPQ A;  1A6Q A;  2LBF A;  2DA5 A;  2L02 A;  1BR1 A;  2PLY A;  5E8G A;  3ZQL A;  2VOD A;  1R23 A;  5GAE J;  2PG4 A;  4HA8 A;  5F1R A;  2KIU A;  4EJU A;  2BEO A;  4MHG A;  4BJ5 C;  2JT1 A;  4D5F A;  3CLO A;  3IV5 A;  1S3J A;  3BRO A;  5B66 C;  3G3Z A;  4DOZ A;  1WH5 A;  2ZXW H;  2Y48 A;  3L2R A;  3JRA A;  2CV1 A;  2P4W A;  4Q47 A;  1QGP A;  3KLN A;  4JOM A;  3HRM A;  1P6R A;  1DDN A;  2K3F A;  4CSW A;  1ZGJ A;  2QUF A;  1YW7 A;  2GXG A;  3PJR A;  2RGV A;  5LEK A;  3DPU A;  4RB3 C;  3S1Q J;  1YI2 I;  1JJ6 C;  4XLP F;  3WGI A;  3Q0U A;  3TBI A;  3MZ8 A;  4D7M A;  2HEO A;  3JRE A;  4E7K A;  2KIF A;  1AA7 A;  1J0R A;  1IZ1 A;  2H6C A;  3OYH A;  2BGC A;  3DKX A;  4MQV A;  4PJM A;  5TIS C;  3JRC A;  1VQ5 I;  2LR8 A;  2VC0 A;  2QBY B;  1T6S A;  5GTI C;  2ZJ2 A;  4I7H A;  2WA0 A;  4NQW B;  1WJA A;  3KZZ A;  2QZ8 A;  3OIO A;  3H9G A;  2E34 A;  2JRT A;  2A5Y B;  1XG1 A;  3MCZ A;  1K4S A;  2FBI A;  2CU7 A;  2O5R A;  1QVU A;  3CC4 I;  2G7H A;  3H35 A;  2WTE A;  3G6E I;  4ZTJ A;  1V5F A;  3HOS A;  3RSN A;  3KET A;  5AIQ A;  1K61 A;  3TGN A;  5C3E J;  2JPC A;  2K40 A;  4G94 A;  1Z7L A;  2XPV A;  2E5N A;  2HVS A;  3RI4 A;  3H5R A;  1IC8 A;  3GTL J;  1I5Z A;  3D1N I;  2VUM J;  2KRC A;  1YE9 A;  4HQM A;  2M8E A;  3CDH A;  2WC2 A;  1MGT A;  4HX4 A;  5DD8 A;  3K10 A;  4YFN F;  1R1T A;  4BAC A;  5HLH A;  1GVJ A;  2MSY A;  3C2B A;  4RB0 A;  5IOY A;  1F5T A;  3HOU J;  2MFZ A;  2P6T A;  3LSG A;  3M07 A;  3TL4 X;  4DYQ A;  5IYD J;  2ZJP F;  3C2G A;  5FRO A;  1TC3 C;  3PSF A;  2DTZ A;  3S2W A;  2OZU A;  2NNN A;  1LVA A;  2I5U A;  3DQV C;  3IAS 2;  4N9H A;  3QOE A;  2QA4 I;  3FM5 A;  1VI0 A;  1DP3 A;  4ESF A;  1A35 A;  2VE8 A;  3L9F A;  3RKX A;  3ZR8 X;  2K9Q A;  2M3A A;  4X6A J;  4EM0 B;  3I4P A;  1U5T B;  1R6R A;  4HSR A;  2FBH A;  2EA2 A;  1YIT I;  2GWR A;  3H36 A;  2KPM A;  2IT0 A;  3IC7 A;  3OS1 A;  4DIQ A;  2XSD C;  3S3M A;  1LDD A;  1ETV A;  2XB0 X;  2P5K A;  3R0A A;  1XDU A;  2JTV A;  2K9L A;  1GV2 A;  3OYB A;  1YJW I;  3FXQ A;  1X19 A;  2NS0 A;  4V2F A;  5ICC A;  3AKZ A;  2ELH A;  2COM A;  3WTS C;  3ZQH A;  1EH8 A;  2K02 A;  1K83 J;  3W2V A;  2IGO A;  2Y9Y A;  2W00 A;  1MZB A;  3BR3 A;  3OYG A;  4G6Q A;  1AHD P;  3KYC B;  3HB9 A;  1VQN I;  1HLV A;  5KNL A;  2LOO A;  1FT9 A;  3CDI A;  3PO3 J;  1B4A A;  1YW9 A;  1F1Z A;  3RQ4 A;  1G6N A;  4CYC A;  2PMU A;  1AOY A;  3I59 A;  5JI6 A;  4XSZ F;  4WXH A;  3HKZ A;  2QYO A;  3ISP A;  1S8N A;  1WVR A;  4YEJ A;  3CO6 C;  3D5S C;  5FD6 A;  2Y30 A;  4JBA A;  1WZ2 A;  2MA3 A;  3ZQG A;  2EIM H;  3E0J B;  5EZH A;  1OR7 C;  5DYM A;  3QPH A;  1IRG A;  1G4D A;  1X2N A;  3GEZ A;  1IDY A;  3SZT A;  2YR2 A;  2EBI A;  5E18 F;  3WGH A;  3RIR A;  1GDT A;  2O03 A;  1U5T C;  3DV8 A;  3EYY A;  1B8I A;  2W24 A;  3PQJ A;  1DU6 A;  1V5E A;  1TWA J;  3FBN B;  1YIO A;  2JUG A;  2VPL A;  3ABU A;  4JQF A;  3SHF A;  4D5C A;  1IO2 A;  1R22 A;  3HSE A;  2CW0 F;  1T8I A;  2R3S A;  1ULY A;  1RKT A;  1VZ0 A;  2WAE A;  1FYL A;  4A3K J;  1SFK A;  1GXP A;  2KDZ A;  5DUK A;  4C30 A;  1EKE A;  2VIX A;  2CYY A;  4AIJ A;  4E7L A;  1MW7 A;  4RLF A;  4E6K G;  4IHX A;  2V1N A;  2VBY A;  2QEX I;  5L3E A;  5FLX K;  2AQF A;  2P0W A;  5CKT A;  1I3A A;  3QWL A; 
#chains in the Genus database with same CATH homology
 2B0L A;  2P7C B;  4KIC A;  2L4M A;  1B9M A;  5LGU A;  5J8C A;  5K5Q A;  2KRF A;  1T2K A;  5K1Y A;  2STT A;  2VBW A;  3E5U A;  4ENM A;  5TRD A;  3QAH A;  3M8E A;  4LG0 B;  3N4M A;  1FWZ A;  1YTY A;  5HDG A;  2XVC A;  2D1V A;  4OOI A;  2W57 A;  1ONV A;  4M6X A;  5CYV A;  4EM2 A;  1XMK A;  2MC3 A;  1BBY A;  2RVC A;  2EV0 A;  1OYI A;  2HTS A;  5CVV A;  5CVR A;  1HQC A;  3EET A;  2VT2 A;  1HBX G;  1OYW A;  1Z6T A;  1T98 A;  1KA8 A;  4ESJ A;  3RYR A;  1ZHF A;  4ZH4 F;  2FQ3 A;  4ZZL A;  1KQ9 A;  4PDK A;  2K4B A;  4HW0 A;  1LQ1 A;  3T8T A;  1UCR A;  1Z05 A;  2F5F A;  4U88 A;  3F22 A;  1W4M A;  2D2W A;  3EYI A;  2Q8K A;  1SD7 A;  1YS7 A;  2DLL A;  1JHH A;  4KUM A;  4RGX A;  1R1V A;  4AIK A;  2V1D A;  3E6D A;  1KGS A;  2VBZ A;  1S6L A;  4KIB A;  5JVT A;  1LEA A;  3WE3 A;  1DPR A;  3R61 A;  4UVB A;  2D1H A;  1SD5 A;  4A2U A;  4KN4 X;  2LKP A;  2FU4 A;  3FMQ A;  4O5V A;  2ACJ A;  4OIR F;  2OBP A;  2EFO A;  1EV7 A;  2YU3 A;  5TJJ A;  4PGG A;  3KFW X;  4G8X A;  3K0L A;  3TDZ C;  4AD9 A;  5JR3 A;  4IJA A;  1P2F A;  5FO5 A;  1JHF A;  4MNU A;  1E2X A;  3TO7 A;  2HGC A;  1DP7 P;  2A6E F;  2IP2 A;  3BWG A;  2IPQ X;  2GAU A;  4P96 A;  1T0F A;  1JXS A;  3K2Z A;  4U0Y A;  1Z6R A;  2EWN A;  1J59 A;  3K69 A;  4I01 A;  1FBS A;  4PGH A;  1MDM A;  2DK8 A;  4U7D A;  4I0A A;  1R58 A;  2A69 F;  2P5V A;  4FHT A;  1RUO A;  2D45 A;  4MTE A;  1IRF A;  5D6F A;  4CIC A;  1HW1 A;  1ODD A;  3J80 K;  2PI0 A;  1REP C;  4IRH A;  2QEN A;  5HLG A;  1USS A;  2M5W A;  2RQP A;  2ISY A;  4LFU A;  3QRF F;  1HSJ A;  5L3C A;  3JSO A;  1ZRD A;  4UV8 A;  3T5X A;  4A5N A;  3T1B A;  2EFW A;  4L18 B;  1G3T A;  4AWX B;  3M7G A;  2FA5 A;  3ZMD A;  1H0M A;  4I2O A;  3K1N A;  2VT3 A;  2Z99 A;  1WRJ A;  4HF1 A;  2KJB A;  3I54 A;  4BH9 A;  5CVI A;  2ZNZ A;  3DPL C;  1FX7 A;  3K1P A;  4GCV A;  4M9S A;  2NRA C;  2R7D A;  1OYY A;  3TDU C;  1FZP B;  1ZG5 A;  3CO7 C;  1BI2 A;  1MJB A;  2PFB A;  4YII A;  1W7P D;  3TKY A;  4WWC A;  3NQO A;  4RAY A;  1XSD A;  3SQN A;  1WSU A;  5JHU A;  4ZYG A;  5CJ9 A;  4O6J A;  2ZO4 A;  2WV0 A;  4LK1 F;  4BAY A;  1H9G A;  1MD0 A;  1B1B A;  1QO0 D;  2LF8 A;  5DDG A;  3WU1 B;  2IA2 A;  3FX3 A;  1ON2 A;  4A12 A;  1HKT A;  2VXZ A;  5ILU A;  2VOO A;  4M6Y A;  4Z2Y A;  4EJW A;  2MH9 A;  5HS8 A;  4CGZ A;  3RYP A;  3B73 A;  5JFR A;  3O3K A;  5FGM A;  1HW5 A;  1XGN A;  2ZBK A;  1KU9 A;  1ZRC A;  4M9Z A;  5FD5 A;  2HYF A;  4ZZD A;  2H6B A;  3FMR A;  3L09 A;  4U7B A;  2P7V B;  3I59 B;  3U1D A;  2ZME A;  2X4H A;  3JTH A;  3RDI A;  3HIF A;  3LAJ A;  2FXA A;  1XN7 A;  2E7W A;  1O7F A;  3MAJ A;  4BQA A;  4L5I A;  2FSW A;  3F3X A;  2GA2 A;  2QQA A;  4FX4 A;  1R5G A;  4YFX F;  1HXD A;  5D5V B;  3RPQ A;  2FNA A;  3P7N A;  3V8L A;  3IKT A;  5IT9 Z;  3WG9 A;  3WTV C;  3PQK A;  1D8J A;  2UXX A;  4R8H A;  4HLY A;  1YO5 C;  2PBI A;  3MZY A;  3MWM A;  3WTU C;  2M45 A;  4U0V A;  2FF4 A;  5HLI A;  5ILV A;  1TQP A;  3HRT A;  3QU3 A;  3ELK A;  1CGP A;  2JZY A;  2IRF G;  5AIP A;  2HDC A;  4F7Z A;  2O6G E;  4K2E A;  1K78 A;  3VB2 A;  3D5L A;  4R79 A;  3LFK A;  5A2Q K;  1FYK A;  1FOK A;  1ZG1 A;  3E6M A;  1FC3 A;  4PZJ A;  4RS8 A;  1CF7 A;  5J6X A;  3NRV A;  4N9I A;  2P6S A;  2OD5 A;  4Y13 A;  4L9T A;  2EB7 A;  1YLF A;  2W85 A;  2HOE A;  1KQ0 A;  5FB2 A;  2STW A;  3SFZ A;  4MQ9 F;  3GZ6 A;  4LMY A;  2Y0M A;  5HDN A;  3I71 A;  1RUN A;  2PQ8 A;  2Y75 A;  2VBX A;  2VE9 A;  2PJP A;  2LF7 A;  1K79 A;  1ZAO A;  2VOP A;  2P8T A;  3RKY A;  1KYW A;  4I98 B;  3GO5 A;  5E8I A;  4LLG F;  5FFX A;  4KA4 A;  2DAO A;  3IL2 A;  2A3S A;  4OMY A;  1TQI A;  3O2P E;  3FXR A;  2M87 A;  2GQQ A;  4H0E A;  3ERE D;  4HX8 A;  3P9C A;  4YIF A;  2MLG A;  2EV6 A;  3HRU A;  2H09 A;  4RGU A;  1SFE A;  2HTJ A;  2XAG A;  5ILS A;  3TO6 A;  4ZYE A;  1U8R A;  1QZZ A;  3RJP A;  1BI3 A;  3W6J B;  4KFC A;  3I0T A;  1LB2 A;  4OU0 A;  3I53 A;  3IRR A;  2YPR A;  2HWV A;  4EM1 A;  2RKH A;  3DEU A;  4G7H F;  2GXB A;  1QQI A;  2IA0 A;  2L3D A;  2VN2 A;  2OQR A;  3Q9V A;  5DEQ A;  1H9T A;  3E6C C;  2XAJ A;  3BY6 A;  2GZW A;  1KYZ A;  1D5V A;  1BN5 A;  4BXU A;  1XCB A;  1IN5 A;  2OAZ A;  1R1U A;  1ZLJ A;  6PAX A;  3OV8 A;  4EJT A;  1YFH A;  2FMY A;  4HYE A;  4YFK F;  4HV6 A;  2R7F A;  1ZGA A;  2YSR A;  1S7A A;  1MDM B;  3BP8 A;  1O3S A;  3DFG A;  2OA4 A;  5LRR A;  1BC7 C;  2XAS A;  2UXN A;  1QPM A;  1IN6 A;  4UVC A;  4Y15 A;  4LB6 B;  5BMZ A;  2G7U A;  2XAQ A;  1G3W A;  1J2X A;  1FBQ A;  5DD4 A;  3ROU A;  2L4A A;  3KEQ A;  4M9X A;  1PP8 F;  3FHZ A;  4P9F A;  4CHU A;  2QVO A;  3DF8 A;  4UNO A;  1FSE A;  4S04 A;  2HZT A;  2FEZ A;  3ZMZ A;  2XKO A;  3ZN1 A;  1A04 A;  2CWE A;  2FNP A;  1C0W A;  1IAW A;  4HX7 A;  5D5W B;  4D0P A;  1NHA A;  2KJC A;  1Y0U A;  2CSO A;  3F6O A;  4UXN A;  1K6O A;  1EH6 A;  3WTX C;  4GYI A;  4P9U A;  3FF5 A;  2K27 A;  2OU2 A;  2DI3 A;  2PMH A;  3F8B A;  3DP7 A;  3J7A O;  1XDS A;  1BI1 A;  4ENN A;  5KVR A;  3PFI A;  1RI7 A;  4A5M A;  1TNS A;  4EJV A;  1SFU A;  1ZRE A;  1TQM A;  1D3Y A;  2LDU A;  3ML6 A;  4NQW A;  4WK8 F;  3QPT A;  4M72 A;  2DTR A;  1B9N A;  1W7P A;  3WOD F;  4ENJ A;  3FMS A;  3EDP A;  3BOQ A;  1PDN C;  5DV5 A;  4CZZ A;  1IXC A;  2DFI A;  3WE2 A;  4EGZ A;  3WTW C;  4GYG A;  4OIP F;  2F5E A;  3ZMV A;  5HOO A;  3ZN0 A;  2E7X A;  1OR7 A;  1FBU A;  3C7J A;  3WU0 A;  4B8X A;  1FP1 D;  4MTD A;  4EJO A;  4EMS A;  2BYV E;  1BI0 A;  4KIF A;  2LSO A;  2Q2E A;  3LA2 A;  3LQR A;  3F72 A;  3V8J A;  5D8L B;  1E17 A;  5LHH A;  2DK5 A;  3FZV A;  3P9I A;  3F6V A;  2V1U A;  4IRI A;  3F8F A;  4M73 A;  1VTN C;  4KDP A;  4XBF A;  2HKX A;  2XV4 S;  4LGW A;  2ESH A;  4L0Y B;  5ICF A;  3ZQ7 A;  4WXD A;  2ZKZ A;  1D8K A;  3QOP A;  5D4S A;  2QWW A;  4LJZ F;  3QU6 A;  4CXF A;  2LNB A;  4S05 A;  1L3L A;  4Q5S F;  4RGR A;  1P92 A;  1XD7 A;  3ULQ B;  3HSR A;  4PCQ A;  2V6C A;  1HKQ A;  4A6D A;  3R0J A;  1IN8 A;  3QP5 A;  4ASN A;  4GGG A;  4U0W A;  2XAF A;  1FNN A;  2KKO A;  3J81 Z;  1ZYR F;  1OPC A;  2OZ6 A;  3GFI A;  4EVI A;  1ZH5 A;  2DQL A;  4AIH A;  4P5O A;  4HV5 A;  3U2R A;  5L3B A;  2ZNY A;  1K78 B;  1J5Y A;  4RB1 A;  2H27 A;  1Z9C A;  1T39 A;  3EQL F;  5ICG A;  1XSX A;  4I02 A;  1CF7 B;  2XAH A;  4KYW A;  3HHH A;  4UHT A;  4MEX F;  2RC4 A;  2RDP A;  1L0O C;  4IPA A;  3HOT A;  4LK0 F;  1O7L A;  4QLC U;  3I64 A;  4NHJ A;  3HTS B;  4GO1 A;  3V7R A;  5E1X A;  2G9W A;  4A0Y A;  1SAX A;  3CUQ A;  4A6E A;  5E1W A;  2QM3 A;  2FRH A;  1J9I A;  2RN7 A;  3BJ6 A;  1X3U A;  3IRQ A;  3G73 A;  4EGY A;  5ERI A;  2ADU A;  3GFJ A;  5DCM A;  3MFK A;  2UZK A;  4LLN A;  1TBX A;  4M74 A;  1YW8 A;  2K4J A;  3SXY A;  2C6Y A;  1O57 A;  3J81 K;  3IHU A;  1XGS A;  1XGO A;  1YG2 A;  4UUV A;  1WWX A;  5BQT A;  2M30 A;  1GXQ A;  2JSC A;  3KCC A;  4ESB A;  2EV5 A;  1YYV A;  2DW4 A;  4IHT A;  2FE3 A;  5LRS A;  3AAF A;  1MJ9 A;  3M1E A;  3ZMU A;  2O61 A;  1U2W A;  5F6F A;  5IT3 A;  1JGS A;  4I09 A;  3WTT C;  1W5T A;  4BHP A;  5L3F A;  3O6B B;  2V1X A;  1ZN2 A;  2A68 F;  1IW7 F;  3W6K B;  3HHG A;  4B09 A;  3JSP A;  5E1Z B;  4IHS A;  4IXA A;  4HQE A;  2F2E A;  1OMI A;  4L5J A;  3E5X A;  3ECO A;  1IN7 A;  4HF2 A;  2O0Y A;  3MEX A;  5E20 A;  4OMZ A;  5H6R A;  3E3V A;  4KMF A;  5E17 F;  1XSV A;  2EFQ A;  5HS7 A;  3GW2 A;  1UB9 A;  1F4K A;  2F5D A;  4YG2 F;  2F5C A;  1T38 A;  4HF0 A;  2VON A;  4IVN A;  2ZFW A;  2EK5 A;  3HUG A;  2BE5 F;  2J5O A;  2ISZ A;  5DCF A;  2QQ9 A;  2IA1 A;  2XUB A;  1FY7 A;  5LHG A;  3LAP A;  2ZCW A;  2XRN A;  1FSH A;  3DPT A;  2EJR A;  3N97 A;  1UST A;  2Q0O A;  5D5U B;  3R60 A;  4DQ2 A;  4BHB A;  2EA4 A;  1U6G A;  2NNY A;  1ZRF A;  2A61 A;  5CVU A;  1HKS A;  3LQQ A;  3RTR A;  4L0Z B;  2K86 A;  4CO8 A;  1TTY A;  3KEO A;  3H3U A;  3KP6 A;  3KP5 A;  1IF1 A;  2HKO A;  5H20 A;  2V9V A;  4Q4Z F;  4NB5 A;  3V7S A;  4A0X A;  1O3T A;  4OIQ F;  3LA3 A;  2ESN A;  1R00 A;  1STZ A;  1W7P B;  4FX0 A;  1EH7 A;  2XRO A;  3L7W A;  1UHW A;  2VC1 A;  1KU3 A;  3COA C;  5BS6 A;  2OQG A;  1V3F A;  3SZP A;  3MQ0 A;  1Z7U A;  2YX4 A;  5IT9 K;  3VEP A;  1I1G A;  3L2C A;  3F23 A;  1Z91 A;  3TOA A;  1P4X A;  3GWZ A;  5FLX Z;  4JK1 X;  4XLN F;  5EEG A;  3KP4 A;  4L9N A;  4O3M A;  2HFH A;  1YQA A;  3JAM Z;  3VFZ A;  4OIN F;  3GXO A;  3D0S A;  5K5O A;  3QP6 A;  1Z1D A;  3KP2 A;  1FP2 A;  1MJA A;  3KE2 A;  3V8K A;  2CO5 A;  4M71 A;  4AVP A;  4ENK A;  1IUY A;  4EV0 A;  2HR3 A;  1TLH B;  5J8F A;  4LD5 A;  1HST A;  3WTZ A;  1SD6 A;  1ZLK A;  1KU7 A;  2HQR A;  3RPU A;  2O3F A;  3F8M A;  2DPU A;  3T8R A;  3JTG A;  3K9T A;  4LB5 A;  5D8K B;  5D6E A;  3Q9S A;  2MLK A;  1TW2 A;  1UFM A;  4UV9 A;  2JPB A;  5H6Q A;  1U78 A;  1ZAR A;  2NYX A;  2FOK A;  4HBL A;  1TNT A;  4Y17 A;  2MH2 A;  5ED4 A;  3HTU A;  4G6D A;  5CVJ A;  3GLX A;  4FT8 A;  3V4G A;  3TOB A;  1ON1 A;  5LLQ A;  1W5S A;  1MKM A;  1FPQ A;  1I6X A;  1LJ9 A;  3JAM K;  1QBJ A;  1LDK B;  1R7J A;  2DU9 A;  3H92 A;  4CYD A;  3FWE A;  2M1B A;  2IW5 A;  1O3Q A;  5BOX A;  3HSF A;  4G7O F;  2BV6 A;  4UVA A;  1XB4 A;  3V7C A;  5LEJ A;  2XGX A;  4EQQ A;  4XRF A;  4XSX F;  4KIG A;  3B02 A;  2W84 A;  1WQ2 A;  2IJL A;  3KP7 A;  1IXR C;  3CUQ B;  3KP3 A;  3NEU A;  4ZYH A;  3BJA A;  3GFM A;  2QBY A;  1S7O A;  1S29 A;  1PUE E;  1XCV A;  2A6H F;  2Z9O A;  3JW4 A;  4GXO A;  1BM9 A;  5DCM B;  2QLZ A;  4TV7 A;  1G3S A;  3REO A;  3R6S A;  4KNY A;  1J7K A;  4BHC A;  2DT5 A;  2H94 A;  1FYM A;  2E1N A;  3ABT A;  4DNC A;  2UWM A;  2FML A;  1BC8 C;  1RZ4 A;  2DO7 A;  3C3W A;  3BPV A;  3GX4 X;  1K7A A;  2W25 A;  5D4R A;  3ZMT A;  5L3G A;  4IRG A;  5D5X B;  4G7Z F;  1O3R A;  2P5L C;  3GFL A;  1SMT A;  4KN7 X;  1P4W A;  3H3Z A;  4A0Z A;  1U5T A;  3CUQ C;  3J80 Z;  2J5P A;  3ZPL A;  3IKV A;  2WWY A;  1HW2 A;  2ZME B;  3E5Q A;  2MD5 A;  3ECH A;  3IWF A;  3GZ5 A;  4WX9 A;  4MEY F;  4BNC A;  3LWF A;  5F64 A;  1QZY A;  1V4R A;  4R1H A;  1PP7 U;  1IN4 A;  3R4K A;  4ETS A;  4KT5 C;  1BIB A;  4P55 A;  2CQK A;  4L9V A;  3LST A;  2KIM A;  3T0Y A;  4E70 A;  4I0B A;  1IXS B;  4HLX A;  2GA1 A;  2IVM A;  4MGR A;  1F9N A;  3E97 A;  4IF4 A;  4HDV A;  3M9A A;  3VOE A;  3I58 A;  2AS5 F;  2BBY A;  1SD4 A;  2ETH A;  3CTA A;  3P9K A;  1B59 A;  4HOB A;  5LHI A;  4RAZ A;  3DKW A;  5HDK A;  3BPX A;  3C1D A;  1FLI A;  3BDD A;  1ZG3 A;  1AWC A;  1RNL A;  1P4A A;  2ZXJ A;  3M8F A;  1XMA A;  3GUD A;  4WF2 A;  1KQ8 A;  2HQN A;  1U3E M;  2RNJ A;  4ON0 A;  3WGG A;  5HS9 A;  2V79 A;  4BYY A;  5LGN A;  3CJN A;  3ZP5 A;  1UHM A;  3RKW A;  1TW3 A;  5CLS A;  2YX7 A;  3LA7 A;  2TDX A;  4QWQ A;  3MZH A;  3GF2 A;  4WXC A;  5EEH A;  4LG0 A;  5ICE A;  3TQN A;  3IWZ A;  2CG4 A;  1B6A A;  3ZMS A;  2PN6 A;  4WCG A;  1BOA A;  2K7L A;  1WI9 A;  5AON A;  4OIO F;  4RB2 C;  2HS5 A;  2RV8 A;  4L9J A;  2XIG A;  4Q48 A;  2GIV A;  3U9G A;  5FFZ A;  1Q1H A;  2CGP A;  1BIA A;  2E1C A;  5KK1 A;  3CUO A;  3GVA A;  3HYI A;  1KU2 A;  2CFX A;  3K1M A;  1XGM A;  5K5R A;  2Z33 A;  3BZ6 A;  3WTY C;  1WKM A;  2XHK A;  3HRS A;  2XKP A;  2L01 A;  5LGT A;  5HVQ C;  1G3Y A;  2PEX A;  3F8C A;  3DXJ F;  4LLL A;  1I27 A;  1I1S A;  1LEB A;  2FBK A;  1JE8 A;  1J75 A;  4HDU A;  5LBQ A;  3E6B A;  4RGS A;  2NAZ A;  3FM3 A;  3KZY A;  5BPD A;  2MBF A;  3TO9 A;  1LNW A;  3OOP A;  1R36 A;  3FXU A;  1LDJ A;  4KMU X;  1BJA A;  1SFX A;  2AXL A;  5A2Q Z;  3KLO A;  1OKR A;  4CDG A;  3VOD A;  3F21 A;  1QNT A;  2Z5U A;  3BJO A;  1DPU A;  4HZF A;  4HAM A;  2L54 A;  3I5U A;  1RIO H;  3C18 A;  1R5H A;  3L00 A;  1DUX C;  2DQR A;  2O8X A;  2Z3Y A;  5L3D A;  2EFP A;  2QQB A;  4N0B A;  1GHC A;  1YS6 A;  3F8N A;  3Q5F A;  1SMY F;  3EUH A;  3GYH X;  2DBB A;  5BPI A;  4G9Y A;  2X0L A;  2HYG D;  2DPD A;  5DUI A;  2EFN A;  2A07 F;  2PLY A;  2L02 A;  5E8G A;  2VOD A;  1R23 A;  2PG4 A;  4HA8 A;  5F1R A;  2KIU A;  4EJU A;  2BEO A;  4MHG A;  2JT1 A;  3CLO A;  1S3J A;  3BRO A;  3G3Z A;  2Y48 A;  2P4W A;  4Q47 A;  1QGP A;  3KLN A;  3HRM A;  1P6R A;  1DDN A;  1ZGJ A;  2QUF A;  1YW7 A;  2GXG A;  2RGV A;  5LEK A;  4RB3 C;  4XLP F;  3WGI A;  2HEO A;  2KIF A;  1J0R A;  1IZ1 A;  2H6C A;  2BGC A;  4MQV A;  2VC0 A;  2QBY B;  1T6S A;  2ZJ2 A;  4I7H A;  3KZZ A;  2QZ8 A;  2JRT A;  2A5Y B;  3MCZ A;  2FBI A;  2G7H A;  2WTE A;  3HOS A;  3KET A;  5AIQ A;  3TGN A;  2JPC A;  4G94 A;  3RI4 A;  1I5Z A;  4HQM A;  2M8E A;  3CDH A;  2WC2 A;  1MGT A;  4HX4 A;  5DD8 A;  4YFN F;  1R1T A;  5HLH A;  1GVJ A;  4RB0 A;  1F5T A;  2P6T A;  3S2W A;  2OZU A;  2NNN A;  1LVA A;  3DQV C;  4N9H A;  3FM5 A;  4ESF A;  2VE8 A;  3L9F A;  3RKX A;  4EM0 B;  3I4P A;  1U5T B;  2FBH A;  2EA2 A;  2GWR A;  2IT0 A;  3IC7 A;  1LDD A;  2P5K A;  3R0A A;  1XDU A;  2JTV A;  3FXQ A;  2NS0 A;  5ICC A;  2ELH A;  2COM A;  3WTS C;  1EH8 A;  2K02 A;  1MZB A;  4G6Q A;  1FT9 A;  1B4A A;  1YW9 A;  1F1Z A;  1G6N A;  1AOY A;  2PMU A;  3I59 A;  5JI6 A;  4XSZ F;  4WXH A;  2QYO A;  3ISP A;  1S8N A;  3CO6 C;  5FD6 A;  4JBA A;  2MA3 A;  5DYM A;  3QPH A;  1IRG A;  1G4D A;  3GEZ A;  5E18 F;  3SZT A;  2YR2 A;  3WGH A;  3RIR A;  2O03 A;  1U5T C;  3DV8 A;  3EYY A;  2W24 A;  3PQJ A;  1YIO A;  3ABU A;  4JQF A;  3SHF A;  1R22 A;  3HSE A;  2CW0 F;  2R3S A;  1ULY A;  1FYL A;  1GXP A;  5DUK A;  2CYY A;  4AIJ A;  2VBY A;  5L3E A;  5FLX K;  4ZYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...