2LKPA

Solution structure of apo-nmtr
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
GHGVEGRNRPSAPLDSQAAAQVASTLQALATPSRLMILTQLRNGPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVVGDRAGRSIVYSLYDTHVAQLLDEAIYHSEHLHLGLSDRHPSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, ArsR family
publication title Solution Structure of Mycobacterium tuberculosis NmtR in the Apo State: Insights into Ni(II)-Mediated Allostery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
total genus 24
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lkpA00
2XUBA 2L01A 4QWQA 3BPVA 3VOEA 3OV8A 4OIOF 3QOPA 2PLYA 5D8KB 3RI4A 1W7PA 1FT9A 5L3FA 4HZFA 4A6DA 4IRGA 3E97A 1LJ9A 3F23A 2O0YA 4IJAA 1LDJA 3L2CA 1W5SA 2AS5F 2L4MA 4ESBA 2DBBA 1S8NA 2L54A 3R6SA 1JHHA 1ZG3A 2XAFA 4KDPA 3M1EA 1FOKA 3DPTA 4U7DA 1PDNC 2CQKA 5A2QK 2GIVA 1DDNA 3IC7A 3QPTA 3T8TA 4A2UA 4MTEA 1SAXA 1SD4A 3DXJF 5DUKA 4WK8F 4D0PA 5ERIA 3I71A 1G6NA 5L3CA 3FM3A 5DCFA 4IVNA 4JBAA 2HDCA 3C3WA 2W25A 2HQNA 4HV6A 5LEKA 4HLXA 5HOOA 4KICA 2DK5A 1WKMA 1HQCA 3KP7A 4YIIA 3L9FA 3D5LA 4L9VA 2JT1A 3F6OA 3G73A 3T1BA 1G3TA 4OMZA 2Z9OA 3FX3A 3T5XA 1DPUA 2JTVA 2GWRA 1P4WA 2UWMA 5DCMA 1JGSA 4LJZF 2L02A 2ZJ2A 3RKWA 4M9ZA 4HX7A 3QP6A 1QBJA 2GA1A 2P5KA 5IT9Z 3V7CA 3LAJA 3KZYA 2V1UA 1LEAA 1QZZA 3ZMVA 1KYWA 4EVIA 3LA3A 5ICCA 1BC7C 3RYRA 4LLGF 3IRQA 4PGHA 2E1NA 4CICA 1S7OA 2BBYA 4RB0A 2QQ9A 5E1WA 3R0JA 3J80Z 1ZGJA 5HS7A 1Z6RA 1E2XA 1CGPA 4LG0B 4ZYGA 3CUQB 3FXUA 3WTUC 1IN6A 2R3SA 5AIPA 3QP5A 2FF4A 1Z7UA 4U0WA 1EH6A 1YYVA 2RN7A 1ZRFA 1ZRDA 2M87A 1LDDA 3I59A 3ZMTA 3F8BA 3DFGA 4U0VA 3TO6A 1LDKB 1EH8A 3CJNA 3HHGA 1FYLA 4HA8A 2R7DA 5FO5A 1TQMA 5DD4A 1O3QA 4JQFA 2EJRA 4UXNA 1YFHA 3BJ6A 3ZQ7A 1FYKA 1H9GA 5HDKA 3CO7C 2ADUA 2B0LA 1YW8A 4XSXF 3I58A 4KUMA 3V8KA 2TDXA 3WODF 1J5YA 1FBUA 4BAYA 2XRNA 1FC3A 1ZAOA 1I1SA 3TO7A 2XHKA 5HVQC 2M8EA 3HTSB 2DTRA 4ZH4F 1YTYA 2IA0A 5HLGA 1DUXC 3ABTA 3MAJA 2EB7A 1R1UA 2R7FA 4KMUX 2HQRA 1PP7U 1GHCA 5K5OA 3ELKA 2A61A 4BXUA 2ESHA 3MZHA 4UVAA 2A07F 3HRTA 1KGSA 4WCGA 3KE2A 2A68F 3BROA 2BYVE 1XCVA 1B4AA 1AWCA 3K0LA 1UB9A 2XASA 3L09A 3GLXA 2GA2A 4O5VA 2JPBA 1FSHA 3DV8A 1BOAA 3JTHA 3U2RA 3GW2A 3GFIA 1XSVA 2QQBA 1RI7A 4I09A 1RZ4A 2WV0A 5CJ9A 3IWFA 4HAMA 4MNUA 1J9IA 2HKXA 5FGMA 1XMKA 3D0SA 4CYDA 2YX4A 3MFKA 2ELHA 4M6YA 2ISZA 4N9HA 1X3UA 1GVJA 2MLKA 2GAUA 2DQLA 3M8FA 4WF2A 2LNBA 3GFLA 5LHHA 4I01A 3FXRA 4OOIA 2IVMA 2NAZA 2UXXA 3F8CA 4LB5A 3R0AA 3SXYA 5L3BA 1K79A 5FLXZ 2XVCA 2UZKA 1HSJA 2MLGA 5E17F 1R5HA 2FOKA 5D6EA 3I5UA 2RNJA 1KQ8A 2F5EA 1OYWA 5DUIA 2VOPA 1Z05A 4EJWA 4KT5C 4WXCA 1IAWA 4BHPA 2QM3A 3LQQA 2DW4A 4AD9A 4YFNF 4B8XA 2D2WA 4R79A 4Q47A 2QZ8A 3W6JB 3WTXC 2JZYA 2VC0A 3R4KA 4P55A 3TQNA 2GQQA 3KZZA 5D5UB 1MDMB 2V1DA 1I6XA 2ZMEA 4CXFA 4RB2C 1R23A 2KIFA 4O6JA 3FF5A 2DPDA 2BV6A 2BE5F 2K4BA 4OINF 2Y75A 3R60A 4HBLA 4ASNA 3TOBA 2FE3A 3WE2A 2D1HA 2VBZA 4RB3C 3QAHA 4FHTA 3GZ6A 3LA2A 2NNYA 4KYWA 3T8RA 1U8RA 3J7AO 1XGSA 5JVTA 4M6XA 1MJ9A 4HYEA 4L9NA 2GXBA 4EQQA 2EA2A 1FP1D 2M30A 1TNSA 3FMRA 5JI6A 3RDIA 1F5TA 1RUNA 3TOAA 3NRVA 4G6DA 1P4AA 1B9MA 5H6QA 1T39A 2UXNA 3RKXA 1DPRA 1R36A 2XAHA 3P9IA 4IRHA 5CVVA 3REOA 4IF4A 1QO0D 3WU1B 5J8CA 2OZ6A 2LDUA 2IA2A 1RNLA 2VOOA 4WXDA 1W4MA 3U1DA 4M9XA 3MZYA 1F1ZA 4R8HA 3ZMZA 1Z9CA 4ENJA 5BPDA 5FFZA 3P7NA 1UCRA 1I1GA 4OMYA 3V7SA 3J81K 4UV9A 4M73A 3CO6C 4LMYA 5LGNA 1HSTA 4M72A 1BI2A 2RDPA 3N4MA 3E6BA 1ZGAA 5FD6A 4H0EA 1XD7A 2BGCA 2QQAA 4WWCA 4RGXA 3M8EA 4P9UA 1ZN2A 1FP2A 1YW9A 3JTGA 3V7RA 2EV0A 1U3EM 4XSZF 1MJBA 5DD8A 4F7ZA 5F6FA 1TBXA 3MWMA 1W7PD 4IHSA 3GO5A 4FX0A 4EM1A 4CZZA 4UNOA 1OKRA 3EQLF 5J6XA 4I7HA 4EM2A 5ILVA 3KFWX 1VTNC 2XAJA 3RYPA 3F8NA 3GVAA 5A2QZ 4FT8A 2ETHA 2ZNYA 4I2OA 1W7PB 5DEQA 1H0MA 3EETA 3P9KA 1HKSA 1XMAA 3L00A 5F64A 1D5VA 1GXPA 2Y0MA 4KNYA 4EMSA 4GXOA 2FA5A 2K02A 2W57A 3BDDA 1XGMA 2Z3YA 2WTEA 2EWNA 1FZPB 2FXAA 1MGTA 5L3EA 2MBFA 5F1RA 1MD0A 1RIOH 1S29A 4WXHA 2ZXJA 2HOEA 4K2EA 5D6FA 3RPUA 2FNPA 4NB5A 2F5FA 4RS8A 3MEXA 3WE3A 1YS6A 4XRFA 4ESFA 1L3LA 3DQVC 3TO9A 2P7CB 2ACJA 3DPLC 3HSRA 3MQ0A 4IPAA 2L4AA 2MC3A 2ZKZA 1F4KA 1OPCA 3P9CA 1WQ2A 3HOSA 3BJAA 5LHIA 2A6EF 5AIQA 4MEYF 2NS0A 1XN7A 2OU2A 1KU3A 4HDVA 3LSTA 3DP7A 1TQPA 2EA4A 4EJVA 1HKTA 2HZTA 4PDKA 4ON0A 1K6OA 1ODDA 3JSPA 3C1DA 1BC8C 1SMYF 1IXCA 5DCMB 2L3DA 2VODA 1OYYA 4S04A 4KFCA 3QU6A 2Z33A 4HV5A 4I0AA 4B09A 2EV5A 2M5WA 2MH2A 5H20A 1ULYA 2V6CA 3KCCA 4G94A 4CHUA 4U88A 2EFWA 3GXOA 3ML6A 2XGXA 1SFEA 3GUDA 1R58A 5TRDA 3E5QA 3FHZA 4L0YB 2KRFA 2E7WA 4L5JA 1YLFA 4MQVA 2ZFWA 3LWFA 1QQIA 3ROUA 3ZMUA 4XLPF 3WGHA 2P6SA 1R22A 1KU7A 4ZYHA 4ENNA 2LF7A 3K9TA 3I59B 1XB4A 1BJAA 3K1PA 5AONA 3KEOA 4N0BA 1XDSA 2KKOA 3WTYC 2XAQA 2ESNA 5IT9K 2VXZA 1KQ9A 5HDGA 2MD5A 4GGGA 1FPQA 1IRGA 5BS6A 2QBYA 3IWZA 2FBKA 2HTSA 3JW4A 3TDUC 1AOYA 2HEOA 1U5TC 5KVRA 1IN4A 4HX4A 2DT5A 4P9FA 5BPIA 2OAZA 4KN4X 5FFXA 1TLHB 2O61A 2VT2A 2A6HF 1LNWA 1XSXA 2XIGA 2HS5A 1HW5A 2Z5UA 4IXAA 4AIJA 5CVUA 4OU0A 2ZBKA 1JHFA 2YR2A 2O3FA 1FBQA 2CGPA 1KYZA 1XCBA 3FM5A 3BY6A 3BJOA 3HRSA 2RC4A 5JR3A 3E5XA 1ONVA 3SQNA 5J8FA 3QRFF 1TQIA 2RVCA 3CTAA 5ICEA 3NEUA 5D8LB 3U9GA 4L9TA 2FNAA 3O6BB 3LFKA 3AAFA 3FWEA 1ZARA 2PN6A 3O3KA 1R1TA 4ESJA 2W85A 4UUVA 1FLIA 1MJAA 1D3YA 4BHBA 3COAC 3F8FA 4HQMA 1O3RA 4KIBA 1FNNA 4IHTA 5DV5A 4BYYA 3M7GA 1I27A 2EFQA 3PQJA 3F8MA 1HW1A 3RTRA 3B02A 1EH7A 4KIGA 1ON2A 1P2FA 2QUFA 3VEPA 3I53A 1FYMA 2XV4S 1OYIA 2PJPA 4KIFA 1K78A 3BWGA 2M1BA 1K78B 2KIMA 2XKOA 3C18A 1J2XA 5JFRA 2FSWA 3NQOA 1B6AA 5LRRA 3IHUA 2MA3A 1YQAA 2YPRA 1ON1A 4Q5SF 3E6MA 1ZLKA 2VBWA 1S7AA 5DYMA 3E3VA 4UVCA 3SZPA 5E8IA 3HYIA 2VC1A 2OZUA 4AIKA 4ENMA 5LGTA 4G9YA 2HFHA 2JPCA 5ED4A 4Z2YA 3LQRA 3HHHA 4EV0A 4M74A 3KETA 2P5LC 2PMUA 5JHUA 4MTDA 2STTA 2OD5A 2VBXA 2ZMEB 1OR7A 2STWA 1SD5A 4G7HF 4HDUA 2PI0A 2OQRA 2WWYA 2EFNA 4Y13A 4LGWA 2DU9A 3FMSA 2OBPA 2FMYA 2H6BA 2PQ8A 4GYGA 3CUQC 2J5PA 2DI3A 5L3DA 4OIRF 1UHMA 4BNCA 4WX9A 3E5UA 5D4RA 2G9WA 1YG2A 2J5OA 3CLOA 5HS9A 3HIFA 3WG9A 4CO8A 1G3SA 3ISPA 3M9AA 1R5GA 2EFPA 1YS7A 4P96A 2QWWA 4E70A 2O8XA 4NQWA 3BP8A 1PP8F 2ZNZA 3ZN0A 1SFXA 2IPQX 3F72A 3JAMK 1T98A 2Q8KA 3WU0A 1D8JA 1U6GA 4HLYA 1T6SA 4A5NA 6PAXA 1P6RA 3VODA 2RKHA 2CSOA 1IXRC 5D5WB 2NRAC 4R1HA 2VONA 2IA1A 1KU9A 1G3WA 3ECOA 5DDGA 1NHAA 2YU3A 5D5XB 2GZWA 3Q9SA 1Q1HA 4ZZLA 1S3JA 2PFBA 3V4GA 2K7LA 4PCQA 5LLQA 3ULQB 1PUEE 2LSOA 3F6VA 1SD7A 3ERED 2BEOA 2NYXA 4O3MA 1BM9A 4I02A 3IL2A 4G7OF 4Q48A 1U5TA 4GCVA 3WGIA 4NHJA 3K2ZA 1IUYA 3GFJA 3KP4A 3LA7A 1T0FA 1UHWA 4YIFA 5H6RA 3EDPA 4HW0A 4ZYDA 5K5RA 1BI1A 3BZ6A 2PBIA 1FWZA 2JRTA 5KK1A 4LLNA 3IKVA 4AIHA 1QZYA 2CWEA 5E1ZB 3FZVA 4LK0F 4HF2A 2DPUA 2XROA 3KP2A 4A6EA 2FBIA 2PEXA 1OMIA 1XGOA 1HW2A 1O7LA 2VBYA 2Q2EA 5FB2A 1BBYA 2YX7A 1EV7A 1TTYA 5E18F 1IF1A 3CUOA 4A0YA 1JE8A 3H3ZA 1BIAA 5CVJA 5E8GA 2DLLA 1DP7P 4KMFA 4EM0B 1J59A 1W5TA 4I0BA 4LD5A 1ZREA 2A69F 2H6CA 4MGRA 2QENA 2DFIA 3EYIA 2V79A 3Q9VA 2O03A 1O3TA 3OOPA 5ILSA 3TKYA 3W6KB 3WTVC 1B1BA 2E7XA 5HS8A 3VB2A 3ZN1A 4ZYEA 3GYHX 1HXDA 4LLLA 2HGCA 2RQPA 4MQ9F 1FX7A 5E1XA 3KP5A 3FMQA 1LQ1A 1TW2A 3WTSC 2H27A 3LAPA 5K5QA 1ZRCA 1G3YA 1ZLJA 1U2WA 3ZMDA 4L5IA 2KJBA 2IRFG 3HRUA 4RGRA 1O3SA 2HYFA 1YW7A 1ZYRF 2DO7A 5FD5A 5L3GA 2KIUA 3E6DA 2IJLA 4EJOA 4DNCA 1ZHFA 1Z91A 2E1CA 5CVIA 3TDZC 1E17A 4G7ZF 5LEJA 1WWXA 1BN5A 4PZJA 4BH9A 3L7WA 4IRIA 4HX8A 3SFZA 2QYOA 1BI3A 3HSFA 3ZP5A 3K1NA 4EGYA 4OIQF 2FRHA 5BMZA 4LG0A 1B59A 2Y48A 4CDGA 3CUQA 5LBQA 3V8JA 3RPQA 1JXSA 1S6LA 3C7JA 1SFUA 2AXLA 4RAYA 2VE9A 3K69A 1LEBA 1QGPA 1FY7A 2F5DA 2ZO4A 5LHGA 2OQGA 1H9TA 2DK8A 4G8XA 3WGGA 2WC2A 1QPMA 4N9IA 3QPHA 4EGZA 4A0ZA 4I98B 1STZA 2QBYB 2Z99A 2ISYA 5EEGA 4RB1A 1F9NA 2XAGA 4Y15A 4A12A 4LB6B 3BOQA 3J80K 4JK1X 5ILUA 5CVRA 2CO5A 1MZBA 5IT3A 1J7KA 2QVOA 4UHTA 4TV7A 4HOBA 2FEZA 4AVPA 3H3UA 3F3XA 2P4WA 4HF0A 3DKWA 4XBFA 1P4XA 2V9VA 4RAZA 2G7HA 1O7FA 3GX4X 3QU3A 2P7VB 1J0RA 1C0WA 2ZCWA 2HYGD 5BQTA 4RGUA 5HLIA 2MH9A 2DAOA 1XSDA 4U0YA 3I4PA 4M9SA 4XLNF 3BPXA 1KA8A 5CYVA 2LF8A 4ZZDA 1J75A 2HWVA 1HKQA 3I0TA 3IRRA 3HSEA 3KEQA 1Z6TA 1D8KA 1L0OC 3E6CC 2XKPA 1ZG1A 5LRSA 4OIPF 2IW5A 1UFMA 2JSCA 2H09A 4M71A 1YO5C 2RGVA 4CGZA 4L0ZB 1USSA 2PG4A 3ZMSA 2F2EA 2VE8A 2A3SA 1Y0UA 3KP3A 2RV8A 1WRJA 3HTUA 2W84A 4LFUA 3ZPLA 1IRFA 4KA4A 1FBSA 2CG4A 2X4HA 1T38A 2CFXA 1WI9A 1IN5A 2FBHA 3TGNA 2P6TA 1MKMA 1YIOA 2FU4A 1REPC 3WTZA 1U78A 3SZTA 2FQ3A 3EYYA 4Q4ZF 3B73A 4G6QA 4PGGA 4HQEA 2C6YA 1SMTA 1WSUA 1TNTA 3ABUA 3RJPA 4UVBA 4EJUA 1V3FA 2QLZA 4L9JA 1G4DA 2D45A 1V4RA 2K86A 4U7BA 1IZ1A 1RUOA 3VFZA 2EV6A 5BOXA 3F22A 3MCZA 4LK1F 3PQKA 5HDNA 3GFMA 1R1VA 1BIBA 1MDMA 2Q0OA 1T2KA 1TW3A 4ETSA 5FLXK 3V8LA 3CDHA 2W24A 3K1MA 2YSRA 4DQ2A 1HBXG 2G7UA 1XGNA 4RGSA 1O57A 1K7AA 4QLCU 3KP6A 3JAMZ 2F5CA 2COMA 1GXQA 4ENKA 4BQAA 1I5ZA 4Y17A 4S05A 3WTWC 2HTJA 2P8TA 3G3ZA 2KJCA 3EUHA 1P92A 2EK5A 5ICGA 3KLNA 4BHCA 2DQRA 4KN7X 5D5VB 3R61A 1XDUA 4YG2F 5LGUA 1USTA 3IKTA 2V1XA 3I54A 1R00A 2PMHA 4GYIA 2EFOA 1Z1DA 2VT3A 2OA4A 2CW0F 4YFXF 2M45A 3HOTA 2VN2A 2LKPA 3RKYA 3J81Z 3H92A 3SHFA 1LB2A 2O6GE 2GXGA 2HKOA 4AWXB 3T0YA 3DF8A 3WTTC 1CF7A 4YFKF 2K4JA 3N97A 5E20A 4MHGA 1CF7B 4HF1A 1ZG5A 1R7JA 3PFIA 5TJJA 2P5VA 3O2PE 5EEHA 2FMLA 1IW7F 3Q5FA 3I64A 2HR3A 5HLHA 3F21A 3RIRA 3JSOA 1KQ0A 4UV8A 5CLSA 4A0XA 2IP2A 1SD6A 4FX4A 3FXQA 2X0LA 3DEUA 1A04A 3S2WA 2IT0A 1BI0A 3HUGA 1ZH5A 5D4SA 5ICFA 1IN8A 2K27A 1IXSB 1LVAA 1IN7A 2CYYA 1KU2A 2A5YB 3GEZA 3HRMA 4MEXF 4P5OA 3GWZA 3KLOA 3GF2A 4EJTA 2D1VA 3GZ5A 1QNTA 1U5TB 4A5MA 2H94A 3ECHA 4L18B 5K1YA 1FSEA 1B9NA 2NNNA 4GO1A
chains in the Genus database with same CATH superfamily
2XUBA 4U87A 2HDDA 3HEFA 2L01A 3ABKH 4QWQA 1SFKA 4C3JJ 3BPVA 4V19K 2OCEA 3VOEA 2WAQN 1MNDA 3MKWB 3KYLA 3CP2A 3LMMA 3OV8A 3JRHA 2K9NA 5FLVA 4OIOF 3QOPA 3FHNA 3PUBA 5IYBJ 3CCRI 1BL0A 4CZCA 3K6GA 2L5QA 1UG0A 1JT0A 1PJRA 2PLYA 4CCNA 5D8KB 3LFUA 3RI4A 1W7PA 3H36A 5GTHC 3NAUA 3W2AA 1FT9A 3IAM2 5L3FA 3CCMI 4HZFA 1E3OC 1WFXA 4A6DA 4IRGA 3E97A 1LJ9A 2LFBA 3VSKA 3F23A 2O0YA 1X1CA 3Q3SA 2XPUA 4IJAA 1QHGA 1LDJA 2Z16A 3G1OA 3L2CA 9ANTA 2OCCH 3K4NA 1W5SA 2AS5F 3ZQQA 2V9KA 2L4MA 1SVLA 4Y4RA 2HNHA 2QKLB 2Q2EB 3X2QH 1X3ZB 4ESBA 5GPAA 2DBBA 1S8NA 2L54A 3R6SA 2NVUB 1GUUA 3M07A 3JRCA 5J47A 1JHHA 1XS9A 3AKZA 5CQGA 1ZG3A 5C3EJ 2XAFA 4KDPA 1XC5A 3M1EA 4J19A 2QCOA 3BTIA 5F1JA 2L0KA 1FOKA 5IYDJ 1OCPA 3DPTA 2E36A 2IEKA 4U7DA 2CQKA 1PDNC 2CJJA 5A2QK 3CJTB 2GIVA 4JX5A 1DDNA 3C2GA 3ZQLA 3IC7A 2ZMEC 2E34A 1RR7A 3QPTA 3T8TA 3MKYB 4A2UA 3CCQI 3S3MA 4MTEA 1SAXA 3NWTA 1SD4A 3ABMH 3DXJF 1PYVA 3S1QJ 3LOCA 5DUKA 4WK8F 1Y8RB 2X6WA 1YE9A 3FXLA 5ERIA 2LR8A 3BTLA 3I71A 4D0PA 1XPXA 3ZQIA 1G6NA 5L3CA 2HPMA 4DJAA 2GXAA 1EA3A 3CF2A 3FM3A 2NVYJ 5DCFA 4IVNA 4DYQA 4JBAA 3I4MJ 1I50J 2QF7A 5F0FA 1SEUA 2HDCA 3C3WA 3KYCB 3KPHA 3A02A 2W25A 1DP3A 5FKNA 2HQNA 2BVLA 2V9PA 4HV6A 2HXIA 5EZHA 5LEKA 4HLXA 2LY1A 5HOOA 4KICA 2DK5A 2DMPA 3CMMA 1NK2P 1WKMA 1UJ8A 1HQCA 4AUXA 3KP7A 4YIIA 2ZJRF 3K4MA 3L9FA 3D5LA 2E35A 3ABLH 1IJWC 3MN2A 2BXYA 4M3DA 4UB6C 4B48A 4L9VA 3G1LA 5DS9A 2JT1A 3F6OA 2E1MB 3G73A 3QWLA 2L7FP 3T1BA 4A3EJ 1G3TA 4OMZA 3G4SI 2Z9OA 1I6HJ 3FX3A 3T5XA 1DPUA 2JTVA 2GWRA 2X6YA 1P4WA 2PJRA 3HXLA 4XM3A 3L2QA 4CSWA 2UWMA 5DCMA 1A5JA 1JGSA 1YOVB 4BACA 4LJZF 2L02A 2ZJ2A 2GOXB 3RKWA 1QA6A 4DIQA 4M9ZA 1K4SA 5H2FC 4HX7A 4B4CA 2V1NA 3QP6A 1QBJA 5F0HA 1UZCA 2GA1A 2P5KA 3W2VA 5IT9Z 3V7CA 3LAJA 3CCYA 3KZYA 1LEAA 2JRMA 2V1UA 1QZZA 3ZMVA 1KYWA 2AXTC 2COBA 4EVIA 3LA3A 1F43A 4BQNA 5ICCA 2JUCA 1BC7C 3RYRA 1I3QJ 3VPRA 2JK3A 3SDBA 4LLGF 3IRQA 4PGHA 2E1NA 3PNYA 1U9NA 4CICA 2R5ZA 1BW5A 4F3QA 2OTJI 1GLNA 1M1EB 2DMNA 1S7OA 1JGGA 1OISA 3DBLB 2BBYA 2XGCA 3GTKJ 4RB0A 2QQ9A 1TWHJ 3R0JA 5E1WA 3J80Z 1ZGJA 5HS7A 1Z6RA 1E2XA 1CGPA 1WHUA 4LG0B 3OIPA 4JYKA 2WB1A 3CUQB 4ZYGA 3FXUA 3S3OA 3WTUC 1S5LC 1IN6A 5KHDA 2R3SA 5AIPA 2N8GA 3QP5A 4LIUA 1WJ5A 2FF4A 1QVUA 1Z7UA 4U0WA 1EH6A 1YYVA 2XF5A 2A6TA 2RN7A 1ZRFA 1ZRDA 2M87A 3D1NI 2Z2SB 1LDDA 3I59A 3ZMTA 4D1QA 2F5VA 2XSJC 3F8BA 3DFGA 3LSIA 3G2BA 1ETYA 2DT6A 3BR0A 3ZRGA 4X0GA 4U0VA 3TO6A 1GV2A 3OYEA 1LDKB 3PSIA 1QPIA 3DWLE 3SDGA 3BTCA 3K70D 1EH8A 3CJNA 3HHGA 1FYLA 3TMOA 3JRBA 3M8JA 2R7QA 4HA8A 2VKVA 2R7DA 2E60A 4XRSA 3CD6I 2DOFA 3S16J 5GP9A 5FO5A 1TQMA 3SZGA 5DD4A 1O3QA 4JQFA 1D0ZA 2EJRA 3S8PA 4UXNA 4LITA 1YFHA 2FQ4A 3BJ6A 1S72I 3ZQ7A 1TWAJ 1FYKA 1HA8A 1H9GA 5HDKA 1D0YA 2CS3A 3CO7C 1Y39A 2DXIA 2HU9A 2ADUA 2B0LA 1YW8A 4JX4A 4XSXF 3I58A 1OFCX 4KUMA 3V8KA 5B3SH 2Y0SN 3RZDJ 2TDXA 3WODF 1J5YA 1FBUA 1H8AC 2JA8J 4BAYA 2XRNA 1FC3A 2MFZA 1ZAOA 2ELJA 3PUFA 1QVTA 4X1EA 3TW7A 2WAEA 3TO7A 2M0CA 2XHKA 5HVQC 2M8EA 1HF0A 2DTRA 2Y9ZA 4ZH4F 3HTSB 1YTYA 1JKRC 2IA0A 5HLGA 3N05A 1DUXC 3ABTA 3BC8A 3MAJA 3BR1A 4LOCA 1XG1A 2EB7A 1R1UA 2R7FA 4KMUX 5FKOA 2DA3A 2DJIA 2FOWA 2HQRA 1PP7U 3GTOJ 1GHCA 3W6VA 5K5OA 4ZDOA 3ELKA 2A61A 4BXUA 1OCTC 2JA2A 3FIWA 2ESHA 3MZHA 4UVAA 2A07F 2VKHA 3HRTA 3ZQGA 1KGSA 4WCGA 2X48A 3KE2A 2A68F 3LL7A 3BROA 4AC0A 2BYVE 1XCVA 1B4AA 1AWCA 3W2WA 3K0LA 1UB9A 1WJAA 2XASA 3L09A 3BCBA 3GLXA 5DTDA 2GA2A 4O5VA 5EG0B 2JPBA 3K7AJ 2MYSA 1FSHA 2E1OA 3DV8A 4GDFA 2KL4A 4XK4A 4BS9A 1BOAA 4F93B 3JTHA 3ERMA 1WZ2A 2HQAA 3GW2A 3U2RA 1P7IA 3GFIA 5GTIC 1XSVA 2QQBA 1RI7A 1VQ9I 1TZLA 3HKZN 1GT0C 3BG3A 4I09A 4RLFA 1RZ4A 2WV0A 5CJ9A 2B7EA 4XIDA 2ID3A 1A6IA 4CUGA 2H1KA 1E0EA 1X2MA 3IWFA 4HAMA 4MNUA 1T56A 3PM1A 1J9IA 2HKXA 4QPQA 5FGMA 1XMKA 1WPKA 1GV5A 3D0SA 1TWGJ 1X2NA 2Y69H 4CYDA 2YX4A 2HI3A 1SVMA 3MFKA 2KMUA 3GCMA 3DLLF 1MBFA 2ELHA 4M6YA 2ISZA 4N9HA 1X3UA 1PUFA 2QA4I 1GVJA 2MLKA 3PIPF 4Y3OA 2GAUA 1WJCA 1LPQA 3M1CA 2DQLA 3M8FA 4WF2A 2LNBA 3GFLA 1V54H 5LHHA 4I01A 3FXRA 4OOIA 1D0XA 3CF5F 2IVMA 2WY7Q 2YS9A 2NAZA 2UXXA 3F8CA 5EJCA 4LB5A 3R0AA 3SXYA 2O9LA 5L3BA 1K79A 1U0JA 5FLXZ 2XVCA 2JA5J 3AL0B 2UZKA 1HSJA 2MLGA 4BGDA 4BU2A 1FMWA 5E17F 4NC8A 1R5HA 3D5RC 2FOKA 3JREA 5D6EA 3I5UA 2LY9A 2EH3A 2RNJA 1KQ8A 2F5EA 1NG6A 4E7SA 1OYWA 2HOAA 5DUIA 3OIQA 2VOPA 1Z05A 1Y6IA 4EJWA 3ZCOA 5TISC 4KT5C 4WXCA 1IAWA 1LE8B 4BHPA 2BW3B 3CZ6A 3DTKA 2QM3A 3LQQA 3SJMA 4W97A 2DW4A 4AD9A 4C3HJ 4YFNF 4A3FJ 2DCEA 4B8XA 4N4OB 2D2WA 3NWSA 4R79A 2CW8A 2W4SA 4Q47A 5CPRB 2QZ8A 1APLC 4M3BA 2PMZN 2IGMA 3W6JB 4XL9A 3WTXC 3CLQA 4NDLA 2JZYA 2VC0A 3ZQHA 3R4KA 4P55A 2V26A 1R4MB 3TQNA 5K7FA 2GQQA 3KZZA 5D5UB 1MDMB 2V1DA 1I6XA 2ZMEA 4CXFA 4XNFA 4XLEA 4RB2C 1R23A 2KIFA 1V5EA 4O6JA 3FF5A 1LVKA 5J1UA 2DA1A 2DPDA 3HJEA 4MLOA 2BV6A 2KHMA 4XN3A 3CJRB 1GDTA 2BE5F 4HNTA 2K4BA 2X1DA 2M34A 4OINF 2MD0A 2Y75A 2P81A 3R60A 2M4GA 4HBLA 3TOBA 4ASNA 2FE3A 1YIJI 3QYEA 4C9YA 3WE2A 2EPFA 3TP0A 2R7UA 1FIPA 4PFPA 4CYCB 2E19A 4BJTA 3DTEA 2D1HA 3ONQA 3LNQA 1VQMI 2EBIA 4JX6A 1W0TA 2NXNB 2DOEA 2VBZA 1YRNB 5B1AH 2LC2A 1LKXA 2VI6A 4RB3C 4BQOA 3QAHA 4FHTA 4IL6C 3GZ6A 2ECBA 4BEHB 2VLAA 4II3A 1SVOA 3EPZA 3LA2A 2NNYA 4KYWA 3ZQCA 2LBFB 3T8RA 1U8RA 4XOTA 4I6ZA 3J7AO 1XGSA 3RQIA 5JVTA 4M6XA 1MJ9A 2F4IA 2P0WA 1IC8A 1W36C 2OTLI 2IGNA 1JTXA 4QPOA 3FK7A 4HYEA 4ZTJA 2RAEA 4L9NA 2GXBA 4E7JA 4EQQA 2EA2A 3BQZA 4F91B 4PSWA 1FP1D 2ICWG 2M30A 1ITYA 1TNSA 3FMRA 5JI6A 5E3OA 3RDIA 1F5TA 1IRZA 5IY5H 2V7FA 2Y0SA 2I5UA 5EGOA 1RUNA 1YI2I 3TOAA 3HG9A 5EGOB 3NRVA 4G6DA 2R7OA 2DMQA 1P4AA 2ZXHA 1B9MA 5C4JJ 3AG2H 4FISA 3HBLA 5H6QA 4RMNA 1T39A 2YUSA 2UXNA 1ENHA 3RKXA 1DPRA 1X1PA 1D5YA 1R36A 2XAHA 3P9IA 4IRHA 2M7AA 3EUKL 5CVVA 2XDVA 3H35A 3REOA 4IF4A 1QO0D 3WU1B 5J8CA 2OZ6A 2LDUA 3HPGA 1ETXA 2D5VA 2IA2A 1RNLA 1WJBA 2VOOA 4WXDA 4Z6YA 4YEJA 1W4MA 3B6AA 3HOZJ 3U1DA 4M9XA 4AIDA 3MZYA 1AKHB 1F1ZA 2KZGA 1MNMC 2KP6A 3DEWA 4R8HA 3ZMZA 1Z9CA 4ENJA 2VPLA 5BPDA 4F52A 3OYCA 1IUFA 5FFZA 3P7NA 1UCRA 1I1GA 3GMEA 4OMYA 1ZK8A 2L9RA 5FKKA 3V7SA 2HOSA 3J81K 4UV9A 4M73A 3CO6C 4LMYA 3HUGB 5LGNA 1HSTA 4M72A 3J7YJ 1WGXA 3LSHA 2ME6A 1FIAA 1BI2A 1ETKA 2NVQJ 2RDPA 5HODA 1MMGA 3N4MA 3E6BA 4IOCF 1DU0A 3FBIB 5IP7J 3H5NA 1IG7A 3HKZA 1ZGAA 5FD6A 4H0EA 1XD7A 2BGCA 2QQAA 2OC6A 3I55I 4WWCA 4RGXA 2EINH 3M8EA 4MFEA 2EIKH 2MABA 4KT6A 4P9UA 3F9KA 4V2GA 5BNGA 4BQQA 4C2TA 4UUSA 2HVQA 5IP6A 1X1AA 3DCFA 1ZN2A 4HPQA 3G6EI 1FP2A 1YW9A 3J7AY 1SANA 4BJ6C 3JTGA 1P9QC 4EEFG 3V7RA 2EV0A 1U3EM 3LSGA 1X4PA 5JVGF 3DU5A 4XSZF 1MJBA 4RLQA 3A1YA 5DD8A 4F7ZA 3OYDA 1A36A 3RQ4A 2DFHA 5F6FA 1TBXA 3MWMA 2NS7A 3U21A 3I56I 3HOYJ 1W7PD 2K3FA 2MSYA 5DM6F 4IHSA 1H89C 4NNJA 2IBDA 3GO5A 1X4OA 4FX0A 4EM1A 1JUPA 4CZZA 2NS8A 2HDWA 1RKWA 2XF7A 4UNOA 1OKRA 3EQLF 1G8XA 1V5GA 4I7HA 4EM2A 3KFWX 3QQAA 5J6XA 5ILVA 3CMYA 1VTNC 4YELA 2XAJA 3CC7I 3RYPA 2VQGA 3F8NA 5JLXA 1VQ8I 1IGNA 3GVAA 5A2QZ 4BY7J 4FT8A 2ETHA 2ZNYA 3IV5A 1W7PB 5DEQA 4IQ4A 1H0MA 4I2OA 5HNFA 2DA7A 1WH7A 3EETA 3P9KA 1HKSA 1XMAA 3L00A 2JMWA 3CDLA 5F64A 1R6RA 2VQHA 3K4LA 1D5VA 2DFEA 1GXPA 2Y0MA 4KNYA 3ZOBA 1KONA 4A3LJ 4EMSA 3BR5A 4RBOA 4GXOA 2IS1A 2FA5A 2K02A 2YU9J 2BOLA 1LUJB 2W57A 3ASNH 1IRXA 1XGMA 3BDDA 2Z3YA 5E79C 2WTEA 1A31A 2EWNA 1FZPB 1Q1VA 2PMZA 3DLAA 4DBQA 2FXAA 2KFDA 2CH0A 1MGTA 5L3EA 1VQ5I 2MBFA 5F1RA 4ZTFA 1MD0A 4A3KJ 1RIOH 3PFYA 3OYGA 2QEXI 1S29A 4WXHA 1A35A 3OYKA 2BHZA 5FRNA 2ZXJA 4XONA 1TL8A 4BBRJ 2HOEA 4CA0A 4K2EA 2TCTA 2Q1ZB 2XAUA 3C2BA 3QOEA 5D6FA 3RPUA 2B9SA 3JRFA 2FNPA 5JLWA 4NB5A 1OR7C 2F5FA 4RS8A 3MEXA 4E7IA 1BW6A 3WE3A 1YS6A 4XRFA 3O8HA 4ESFA 1D1AA 1L3LA 2ZXIA 1XMXA 3DQVC 4M3EA 3TO9A 2P7CB 2ACJA 4CCOA 3DPLC 3HSRA 3MQ0A 4IPAA 2L4AA 1Y1WJ 2MC3A 2ZKZA 1F4KA 1OPCA 3P9CA 4AYBN 4A3GJ 2B63J 1WQ2A 4UUTA 3OL3A 3HOSA 4ZDPA 2K3PA 2RQQA 3BJAA 3ZR8X 5LHIA 2A6EF 2H8WA 5AIQA 3HOVJ 2CU7A 4MEYF 4D5CA 2LVSA 1G2HA 2NS0A 1XN7A 4E7LA 2JJ7A 5E3NA 3S2DJ 2OU2A 1KU3A 4BJ5C 5FROA 4HDVA 3LSTA 3DP7A 4MFDA 1I1SA 4Y7NJ 2Z1DA 1TQPA 2EA4A 4C3IJ 4EJVA 1HKTA 2W82A 2HZTA 3FXKA 4PDKA 4ON0A 1BOBA 2DT7B 1K6OA 5J3LA 2R93J 1ODDA 2HYJA 4HG2A 3JSPA 1T8IA 2KISA 3C1DA 1BC8C 5KAFC 3H9GA 2V6EA 1SMYF 3OYAA 1RPWA 1IXCA 2PJRB 3GTQJ 5DCMB 1QZEA 2L3DA 2VODA 1YHQI 1OYYA 1X1DA 4II2A 3JRAA 5TGTA 4S04A 4GFBA 4KFCA 3QU6A 2I8DA 2Z33A 2GBYA 4HV5A 2I10A 4I0AA 2DODA 4B09A 2XF6A 2EV5A 4A3BJ 2M5WA 1E3HA 2MH2A 3TP3A 5H20A 1UG2A 2K9LA 2LLKA 1ULYA 2V6CA 3OSFA 2KT0A 3KCCA 5FRMA 2JA6J 4G94A 1YJ9I 3BZCA 4CHUA 3CDIA 4U88A 2BY3A 2EFWA 4CCLA 1ETOA 2ZB9A 4XLCA 3GXOA 3ML6A 2VXDA 2R5ZB 2XGXA 1SFEA 2V4JC 4BE0A 3GUDA 1VZ0A 1R58A 2K9QA 4DOZA 5TRDA 3L2WA 2CV0A 3E5QA 2JVGA 2OUMA 3FHZA 4L0YB 2KRFA 2E7WA 2ZSIB 2KDZA 4L5JA 2E2HJ 1YLFA 2VUMJ 4MQVA 2ZFWA 3IH3A 4L5EA 3LWFA 1QQIA 1WJEA 3ROUA 3ZMUA 4HSTA 4ZYAA 4XLPF 3WGHA 3S1NJ 2P6SA 1R22A 4FCYA 3FK6A 2LOOA 1KU7A 4IKFA 2R0QC 4ZYHA 1KZHA 4JP0A 4ENNA 2LF7A 2QSFX 3K9TA 3I59B 3LSKA 1XB4A 2VKDA 1X3WB 3GZNB 1BJAA 4DW6A 3K1PA 5AONA 1ZTRA 3KEOA 3IH4A 4N0BA 1XDSA 4MIMA 2CUFA 1U9OA 2KKOA 5KAIC 3WTYC 3OYFA 2XAQA 4IHVA 2ESNA 2LY2A 3BT9A 2XB0X 3HPHA 3A2KA 5IT9K 2VXZA 1KQ9A 4D7NA 1X1BA 3OYJA 5HDGA 3ASOH 2MD5A 4GGGA 1FPQA 1IRGA 1WCMJ 4FETA 5BS6A 4A3CJ 2QBYA 2EIMH 2KZVA 3IWZA 2FBKA 2L7KA 2HTSA 1I3AA 3JW4A 4I99C 1N78A 3TDUC 4LG3A 4AM3A 1ZR4A 3Q0UA 3QYBA 1AOYA 2HEOA 5FJ8J 1U5TC 2K9SA 2QSGX 5KVRA 4X6AJ 2BY2A 1TP4A 1IN4A 1VFCA 2DDBA 4HX4A 2DT5A 4P9FA 5BPIA 2OAZA 4KN4X 3WU2C 3OR1C 5FFXA 3GTJJ 2R7SA 1TLHB 1T0FC 2O61A 2VT2A 3A0BC 2A6HF 1LNWA 5J1YA 1XSXA 2K5CA 3SYTA 2XIGA 2HS5A 1HW5A 4C30A 3JRDA 2KPMA 2Z5UA 1ERDA 4IXAA 2ME0A 1YITI 4AIJA 5CVUA 3K4JA 1R5ID 4OU0A 1TT0A 2ZBKA 4BKXA 4BDYA 4XR6A 2IXSA 2X1EA 1VI0A 1JHFA 5EZGA 2VL8A 1EF4A 2MW8A 2YR2A 3DBHB 2O3FA 2AO9A 1FBQA 2CGPA 1KYZA 1VNDA 1XCBA 3FM5A 4D5FA 3BY6A 4B3XA 3VDXA 3BJOA 3HRSA 2RC4A 5JR3A 3E5XA 1ONVA 2HOTA 3SQNA 3SEQA 1IDYA 3OIOA 5J8FA 3ESWB 3QRFF 3RZOJ 3FDYA 1TQIA 2RVCA 1N25A 1AA7A 3CTAA 5ICEA 3NEUA 4XKCA 5IOYA 3OS2A 3JR9A 3H5RA 5D8LB 1Z67A 2DJNA 5K7ZA 3U9GA 1ETQA 4L9TA 2FNAA 3OMYA 3O6BB 3HOWJ 3LFKA 3AAFA 3IP4B 3FWEA 1R71A 2K85A 2IS2A 1ZARA 2Y2ZA 2PN6A 3O3KA 2EZHA 1X19A 1R1TA 4ESJA 5CKTA 4QIWN 2W85A 3SEZA 2JVHA 4E7HA 2IS6A 4YIRX 4UUVA 1FLIA 2F4MB 2UUZA 1FJLA 1MJAA 1D3YA 2TRTA 1F36A 4BHBA 3COAC 3F8FA 1B8IA 2R4GA 4PJ0C 2AQEA 1YX5A 2EIJH 4ZC3A 2FX0A 4XKWA 4HQMA 3AFHA 1O3RA 4KIBA 1FNNA 1Y8QB 5DV5A 4IHTA 4BYYA 3OYNA 3M7GA 4AYBA 1JKQC 5IP9J 1I27A 2EFQA 2DMUA 4C2UA 3PQJA 3F8MA 3VSLA 4KISA 4B1RA 1HW1A 3H3VK 3M4OJ 3RTRA 3B02A 4IO9F 1EH7A 3I4NJ 4KIGA 3V42A 1ON2A 1P2FA 2QUFA 3VEPA 1PUFB 3I53A 1FYMA 3A01A 2XV4S 3VYRB 1OYIA 5M5XJ 2PJPA 3NARA 3A01B 2CFOA 3CJQB 3IUOA 2AHQA 1WJFA 4KIFA 2BY1A 5KCMA 3VYTB 2A5WA 1K78A 2VKEA 3BWGA 1E3PA 2M1BA 1K78B 3HC7A 2KIMA 2XKOA 3C18A 5GAGJ 1J2XA 5JFRA 1VQ6I 2X6OA 2FSWA 5GPCA 3VWBA 3NQOA 1B6AA 1X58A 2KLOA 5LRRA 3IHUA 2MA3A 3VYSB 1RETA 3L2VA 1YQAA 2YPRA 1ON1A 4Q5SF 3E6MA 1ZLKA 2VBWA 2DA6A 1S7AA 2M9HA 5DYMA 1IV6A 5EF6A 5LD2C 1N75A 5HLTA 3E3VA 4UVCA 3SZPA 5E8IA 4I76A 5J4YA 2W00A 1U8BA 3HYIA 2VC1A 1GVDA 2OZUA 2ZJQF 3B6CA 1T08B 4FE7A 4XLAA 3IH2A 4AIKA 2M7BA 4ENMA 4E7ZA 3PNVA 5LGTA 4G9YA 2HFHA 2JPCA 1WJDA 5ED4A 4Z2YA 2LREA 4XQFA 3LQRA 3HHHA 3S1RJ 4EV0A 4M74A 1N77A 3KETA 2RREA 2P5LC 2PMUA 1S9HA 1NK3P 2W1OA 3CC4I 5JHUA 4MTDA 1MBEA 2STTA 3HZJA 3JRIA 2OD5A 2VBXA 3DKYA 3BG5A 2ZMEB 1OR7A 5M5WJ 2STWA 1SD5A 3E7LA 2HXOA 4G7HF 4XICA 4HDUA 1TWCJ 2PI0A 2OQRA 4IEJA 4FTHA 3MKZA 2WWYA 2EFNA 1H88C 3FISA 4Y13A 4CCKA 5J1RA 4LGWA 4FASD 3RKQA 1HDDC 1JJ8C 1K83J 3WHBA 2DU9A 5CQEA 3FMSA 1VQNI 2OBPA 2LD5A 3HDDA 2BXZA 2FMYA 2H6BA 2PQ8A 1V5FA 4GYGA 3CUQC 2J5PA 2DI3A 5L3DA 4OIRF 3ZXSA 1UHMA 4BE1A 1POGA 5B66C 2R7RA 5C4XJ 1UAAA 4BNCA 1Z7LA 2X9DA 3RCOA 3FXMA 4WX9A 2XRLA 1SC7A 1BA5A 1LFBA 3QODA 3E5UA 5D4RA 1IDZA 2RNGA 2G9WA 1MSEC 2OF7A 1YG2A 3ZQFA 5E3LA 1K6YA 2J5OA 1ZGWA 3CLOA 1BR2A 5HS9A 1ZKGA 3HIFA 3WG9A 4B3AA 4CO8A 1G3SA 3ISPA 4Y52J 3M9AA 2R7VA 1R5GA 2DOAA 2EFPA 2L9VA 1BR4A 1YS7A 4P96A 2QWWA 1DGWY 4E70A 2O8XA 4NQWA 4ABZA 3BP8A 4A69C 2JQ7A 1PP8F 1OCRH 2ZNZA 2G0EA 3ZN0A 1I39A 1SFXA 2IPQX 3BR2A 3F72A 3KIOA 4RAGA 3JAMK 3HL2A 1T98A 4LIVA 3K70C 2Q8KA 4BL0B 2ID6A 3WU0A 1D8JA 4NUBA 3OSGA 1U6GA 2QKMB 5FKMA 3PNTA 4HLYA 1T6SA 4A5NA 6PAXA 1P6RA 4CCJA 4E6KG 2X85A 4BE2A 1FEXA 3H9QA 2E71A 3VODA 3CCVI 2CUZA 2JUGA 2RKHA 2CSOA 3MKLA 1IXRC 5D5WB 2NRAC 5C44J 3QPSA 1HDPA 3TBIA 3CESA 2VQCA 2MG4A 4R1HA 2MC4A 2VONA 5IOZA 2LP0A 2IA1A 2Y9YA 3UNGC 1KU9A 1G3WA 2KRCA 2LMDA 3BG7A 3ECOA 4W1UA 3OR2C 5DDGA 1NHAA 2YU3A 5D5XB 5F04A 3DEEA 2OV7A 2R7XA 3BTJA 2GZWA 2ELKA 3Q9SA 4M3FA 3P5JA 1Q1HA 3GTPJ 2DA5A 2L9NA 3LSPA 3O8GA 1RC9A 3FXJA 2LYCA 4OWRB 4ZZLA 1S3JA 2PFBA 3V4GA 2K7LA 1VQ4I 3FKJA 4PCQA 5LLQA 3CC2I 3ULQB 1PUEE 2LSOA 4AVZA 2X51A 5M5YJ 4XORA 4UUSB 3BG6A 1WI3A 1DGRM 3F0CA 3F6VA 5GAEJ 4H4KC 2QQ8A 1SD7A 3BCAA 2IAIA 3MVPA 4BXFA 1ETWA 4IHWA 5IPAA 3ERED 1ZELA 2BEOA 2ZC2A 2ZJPF 1XTAA 2NYXA 4O3MA 1Y56A 1FOYA 1BM9A 2LK2A 4I02A 3IL2A 4ITVA 3BZKA 4G7OF 4Q48A 2HQ5A 4CCMA 1U5TA 4GCVA 3WGIA 4NHJA 3K2ZA 1IUYA 2CUEA 2DN0A 4KJZA 3BQYA 3UR3C 3GFJA 4PJNA 4PJMA 4B43A 2H1LA 3KP4A 3LA7A 4XKVA 1T0FA 5J40A 2VJ4A 1UHWA 4YIFA 5H6RA 2HVSA 3OYMA 3EDPA 1VQPI 4HW0A 4ZYDA 3OL4A 5K5RA 1BI1A 3BZ6A 2PBIA 4RDUA 1FWZA 3L1PA 2WBMA 2JRTA 1W1WE 5KK1A 4LLNA 3I9V2 3L2UA 3BR3A 2KQRA 3IKVA 1YX3A 5FKLA 4AIHA 2ZFUA 1R4NB 3DBRB 4D7MA 4RM2A 5M3MJ 3OYHA 3H0GJ 1QZYA 2CWEA 5E1ZB 1AU7A 2WA0A 3FZVA 4LK0F 3AL0C 4HF2A 1RRJA 2DPUA 2XROA 2LTPA 2JA7J 3KP2A 2JN6A 3FKIJ 4A6EA 2FBIA 2WY8Q 3PL8A 2PEXA 1OMIA 4M3GA 1XGOA 3PO3J 1HW2A 1O7LA 2VBYA 2Q2EA 3RPUD 4XLHA 2XGDA 4P1WA 2XSDC 3HB9A 2NVTJ 5FB2A 1BBYA 2YX7A 5DM7F 1EV7A 1TTYA 2OPTA 1OCZH 3DTIA 3PSFA 5E18F 1IF1A 3CUOA 2ZXWH 2WADA 4A0YA 2VQLA 2CV2A 4QTRA 4DGWB 3H3ZA 2XPVA 1JE8A 1OCOH 3KYDB 1BIAA 5CVJA 5E8GA 3OYBA 2DLLA 3MD2A 1G59A 3Q0VA 1DP7P 1EJ9A 5B1BH 4KMFA 4EM0B 1LFPA 1J59A 3MMYB 1W5TA 4I0BA 2DYSH 2KDOA 4LD5A 1ZREA 2A69F 3U1KA 1QRYA 1D1CA 4GRIA 4RAFA 3KZIC 1Z0XA 2H6CA 4MGRA 2QENA 1IO2A 2DFIA 3EYIA 3AG4H 1V55H 4XRMA 1SAUA 3D5SC 3Q0WA 3FBNB 2V79A 3Q9VA 2VB6A 2O03A 1O3TA 3GTLJ 4XKBA 3OOPA 5ILSA 3TKYA 2M2EA 3W6KB 3WTVC 1VQOI 1B1BA 2EILH 1DQUA 3MZ8A 1R49A 2E7XA 3BR6A 3EUHC 4BUPA 2O5RA 4J00A 5HS8A 3VB2A 3ZN1A 3TL4X 4ZYEA 3GYHX 1HXDA 4LLLA 2HGCA 2RQPA 3WG7H 2HVRA 1UMQA 1Y0NA 3GBGA 3H5AA 1FX7A 4MQ9F 5E1XA 3KP5A 3CMEI 3FMQA 3EUAA 1DU6A 1WVRA 1LQ1A 1TW2A 3WTSC 2L2OA 4DYCA 2H27A 3OS1A 1MIJA 2QGUA 4G12A 2QSHX 3M3YJ 3LAPA 1Z77A 5K5QA 1ZRCA 1QU3A 2CRGA 1G3YA 1ZLJA 1TWFJ 3CQZJ 1U2WA 2M3AA 3ZMDA 3DU6A 1HCRA 4L5IA 2KJBA 2VPRA 2IRFG 1JUMA 2R5YA 3HRUA 4RGRA 1O3SA 2HYFA 1YW7A 1ZYRF 4RA2A 2R5YB 1T95A 2DO7A 3PJRA 3K4KA 5FD5A 5L3GA 2KIUA 3E6DA 3L2RA 5EYRA 2VIXA 2IJLA 4EJOA 1MBHA 4DNCA 1ZHFA 1JJ6C 1Z91A 1NTCA 3GLLA 1HOMA 2E1CA 5CVIA 3TDZC 1E17A 4G7ZF 4UY8I 5LEJA 1WWXA 1AHDP 4F55A 1BN5A 5KNLA 2DYRH 4PZJA 4XLFA 4BH9A 2CQXA 3L7WA 4IRIA 4HX8A 3SFZA 1VQ7I 2QYOA 1BI3A 3HSFA 5FLMJ 3ZP5A 3K1NA 4EGYA 4IZZA 1FMVA 4OIQF 2FRHA 4B47A 2KRHA 4LG0A 1B59A 5BMZA 2Y48A 4CDGA 3CUQA 5LBQA 2VJJA 1W36D 3V8JA 3RPQA 1JXSA 1S6LA 3C7JA 1SFUA 2PX9A 2AXLA 3S32A 4HSRA 4RAYA 2VE9A 1FOXA 3K69A 3VYUB 1LEBA 1QGPA 1FY7A 2F5DA 2ZO4A 5LHGA 2OQGA 1H9TA 1RR8C 2E2JJ 2DK8A 2ECCA 4B44A 4G8XA 3G71I 3WGGA 1MMSA 2WC2A 1OLTA 2GOMA 1QPMA 4N9IA 3QPHA 5M3FJ 2GM4A 4IHYA 4EGZA 4A0ZA 4I98B 3AG3H 3HM5A 4XMYA 1B72A 4J01A 2MGQA 1STZA 2GLOA 1B72B 5LFAA 1XX5A 3J7ZI 2R7WA 2QBYB 4BY1J 4FQGA 2Z99A 2ISYA 1MH3A 3GTMJ 5EEGA 1T33A 4RB1A 1FTTA 1F9NA 2XAGA 3UKGA 1J09A 4Y15A 3S93A 4A12A 4LB6B 3BOQA 3J80K 2LH9A 4JK1X 5ILUA 1W0UA 2F4OB 2L7MP 5CVRA 3TW6A 4A3JJ 1MZBA 5IT3A 2WAQA 1J7KA 2EZLA 2QVOA 3OOUA 4UHTA 3K10A 1JKOC 4TV7A 4S0HB 3QYFA 4HOBA 1JKPC 2FEZA 1OQYA 3CCSI 1K61A 4AVPA 4V2FA 1FOWA 3H3UA 4OAZA 4HNUA 3F3XA 2P4WA 4HF0A 5EEAA 3LSRA 4BDZA 3DKWA 4XBFA 2DDAA 4PFOA 1IV8A 1P4XA 2V9VA 4RAZA 3OYIA 2A05A 2G7HA 2F48A 5IYCJ 1O7FA 3GX4X 3QU3A 2P7VB 1J0RA 3K2AA 1C0WA 1Z3XA 2WAFA 2ZCWA 1LFUP 3CCEI 2HYGD 5BQTA 2M8GX 1JUSA 1R9TJ 4RGUA 2IGOA 5E3MA 1VF9A 1UHSA 5HLIA 2MH9A 2DAOA 4ZJZA 1WH5A 5HNHA 1XSDA 4U0YA 3S3NA 3HGGA 3I4PA 4M9SA 5B5EC 4XLNF 2E5NA 3BPXA 2VASA 1KA8A 5CYVA 2LF8A 4ZZDA 1J75A 1W5CC 2HWVA 1HKQA 1FSEA 3I0TA 2HPIA 3IRRA 3HSEA 3CP8A 4BXXJ 3KEQA 1Z6TA 1D8KA 1OCCH 5J4VA 3KX2A 3E1SA 1L0OC 3E6CC 2XKPA 5EG0A 1ZG1A 2K40A 5LRSA 4OIPF 1ACIA 2O7OA 2IW5A 1NG7A 1UFMA 2JSCA 1Y1VJ 2JSPA 2H09A 4M71A 1YO5C 2RGVA 1B8IB 4FE4A 2L9SA 1JTYA 4CGZA 4AU7A 2WV1A 1JI8A 2KIQA 4L0ZB 1USSA 2PG4A 1ZQ3P 1O4XA 1K4TA 3ZMSA 2F2EA 2VE8A 5GADJ 5GAHJ 2A3SA 1Y0UA 1A6QA 3KP3A 3OYLA 4NC6A 3G1MA 2RV8A 1WRJA 3HTUA 2W84A 4LFUA 3ZPLA 1IRFA 2IS4A 3OY9A 2CQQA 4E7KA 4KA4A 1FBSA 3PO2J 2CG4A 2X4HA 2M4KA 1T38A 4IQJA 3HOUJ 2CQ7A 3S15J 3HOXJ 2CFXA 2CUJA 1WI9A 2M0MA 1IN5A 4Y33A 2FBHA 1Z21A 3TGNA 4ANJA 2W7NA 1S7EA 2P6TA 1MKMA 1YIOA 2FU4A 1REPC 3AG1H 3WTZA 1U78A 3SZTA 2R7TA 2FQ3A 4G6TB 3JRGA 3EYYA 4Q4ZF 3WHCA 3B73A 2K9MA 4D9JA 1Z3YA 2DA2A 4G6QA 4DZPA 4PGGA 4HQEA 2C6YA 1SMTA 3CCUI 1WSUA 2CV1A 1TNTA 3ABUA 2E1MC 2NOJB 2AQFA 3RJPA 2GIZA 3LSMA 2EZIA 2BVMA 2CMPA 4UVBA 4EJUA 4UB8C 1ORKA 2XB5A 1MMAA 1V3FA 2JWTA 2QLZA 1LE8A 2VJ5A 2BW3A 4L9JA 1G4DA 1FTZA 2D45A 1V4RA 2K86A 4U7BA 3BLYA 3SFIA 1IZ1A 3DPUA 1RUOA 2X6XA 3VFZA 1OJLA 4YRVA 2EV6A 5BOXA 4IHXA 3F22A 1MMNA 3MCZA 4LK1F 3PQKA 5HDNA 2W48A 2UV1A 3GFMA 2L7ZA 1R1VA 1BIBA 1MDMA 2Q0OA 1MBJA 1T2KA 1TW3A 3GTGJ 4ETSA 5JHFA 5FLXK 2LRDA 2DTZA 2LKSA 3V8LA 4PUSA 2CQNA 3CDHA 4A93J 2W24A 3K1MA 1TT5B 2YSRA 4DQ2A 1HBXG 4JOMA 2G7UA 1XGNA 3JCUC 4RGSA 3S14J 3RSNA 1O57A 4HNVA 1K7AA 1PVEA 4QLCU 2R7ZJ 3KP6A 3JAMZ 2OJED 2XC7A 2F5CA 2COMA 1QHHD 4PSXA 1GXQA 4ENKA 1VQKI 4ZDLA 4BQAA 1I5ZA 4MO7A 4Y17A 4S05A 3WTWC 2DFFA 4HEA2 2HTJA 4CYCA 2NOGA 3CMAI 3DKXA 1MMDA 2P8TA 3G3ZA 2KJCA 4EATA 3EUHA 1YRNA 1P92A 2EK5A 5ICGA 3KLNA 4BHCA 1BJZA 2DQRA 2Y30A 3FXOA 1ZR2A 1MBGA 1EKEA 3A03A 4KN7X 5D5VB 4BEHA 3R61A 1XDUA 4YG2F 5LGUA 1USTA 3IKTA 2V1XA 4BBSJ 2DA4A 4M6VA 3W3CA 3QPLA 3I54A 1R00A 3K4BA 2O8KA 2LBFA 2PMHA 4HRIA 1YJWI 5EDNA 4GYIA 2EFOA 1Z1DA 2VT3A 4RM3A 3H9JA 4OAYA 2OA4A 2CW0F 1UELB 4YFXF 2M45A 5F27A 3HOTA 2VN2A 1YJNI 2IGKA 1MH4A 2LKPA 3RKYA 4CH7A 4E4HA 2EZKA 3J81Z 3H92A 4NQWB 1MW7A 4DZJA 1JT6A 3SHFA 2LKXA 4PK4A 1LB2A 2O6GE 2GXGA 2HKOA 3BG9A 3H1CA 3A0HC 5F08A 2E2IJ 4AWXB 3T0YA 1ETVA 2XPWA 4XN0A 3DF8A 3WTTC 3S2HJ 2BY0A 3KEYA 1RESA 2CW7A 1CF7A 4YFKF 2K4JA 4NBQA 3N97A 5E20A 4A3DJ 4MHGA 1CF7B 4HF1A 1MNEA 1ZG5A 1R7JA 3E0JB 3PFIA 5TJJA 3CCJI 3PIOF 3TEDA 2P5VA 3LSJA 3O2PE 2H8RA 5EEHA 2BHYA 2FMLA 1IW7F 3Q5FA 1BR1A 3I64A 1RKTA 3A4CA 3I3LA 4PJLA 2HR3A 5HLHA 2EQRA 3F21A 3RIRA 4A3IJ 4IX7A 4DBRA 5K7HA 1MSFC 2X1CA 3JSOA 2R92J 1KQ0A 2E5ZA 4UV8A 2ZSHB 5CLSA 3K4CA 4A0XA 1AKHA 1NH3A 2NVXJ 2BZTA 2IP2A 5F0CA 2FJ1A 1D1BA 2DMTA 3S1MJ 1SD6A 3ZGKA 4FX4A 3FXQA 3S17J 2X0LA 3DEUA 3HGYA 4PJJA 1A04A 1MBKA 2WB1N 3H0DA 4QSHA 3S2WA 4C2MJ 1SFOJ 2IT0A 4F92B 1BI0A 3HUGA 1ZH5A 4XRSG 5D4SA 3CCLI 5ICFA 4NC7A 1IN8A 2K27A 1IXSB 4XOPA 4DYRA 1LVAA 1IN7A 2CYYA 1KU2A 2A5YB 2FD5A 3C2HA 3GEZA 3HRMA 4MEXF 1TC3C 2HZDA 4P5OA 3GWZA 2F6CA 3KLOA 3GF2A 2XGEA 3OWTA 2Y31A 4EJTA 3IAS2 2D1VA 2LG4A 4KITB 3OS0A 1CQTA 3GZ5A 1VQLI 2VJIA 1HLVA 1P7JA 2FUG2 1QNTA 1U5TB 4A5MA 4IOAF 2H94A 4A3MJ 1HC8A 3ECHA 4N4NB 4L18B 5K1YA 2CO5A 1B9NA 2NNNA 4GO1A
chains in the Genus database with same CATH topology
2XUBA 2L01A 4QWQA 3BPVA 3VOEA 3OV8A 4OIOF 3QOPA 2PLYA 5D8KB 3RI4A 1W7PA 1FT9A 5L3FA 4HZFA 4A6DA 4IRGA 3E97A 1LJ9A 3F23A 2O0YA 4IJAA 1LDJA 3L2CA 1W5SA 2AS5F 2L4MA 4ESBA 2DBBA 1S8NA 2L54A 3R6SA 1JHHA 1ZG3A 2XAFA 4KDPA 3M1EA 1FOKA 3DPTA 4U7DA 1PDNC 2CQKA 5A2QK 2GIVA 1DDNA 3IC7A 3QPTA 3T8TA 4A2UA 4MTEA 1SAXA 1SD4A 3DXJF 5DUKA 4WK8F 4D0PA 5ERIA 3I71A 1G6NA 5L3CA 3FM3A 5DCFA 4IVNA 4JBAA 2HDCA 3C3WA 2W25A 2HQNA 4HV6A 5LEKA 4HLXA 5HOOA 4KICA 2DK5A 1WKMA 1HQCA 3KP7A 4YIIA 3L9FA 3D5LA 4L9VA 2JT1A 3F6OA 3G73A 3T1BA 1G3TA 4OMZA 2Z9OA 3FX3A 3T5XA 1DPUA 2JTVA 2GWRA 1P4WA 2UWMA 5DCMA 1JGSA 4LJZF 2L02A 2ZJ2A 3RKWA 4M9ZA 4HX7A 3QP6A 1QBJA 2GA1A 2P5KA 5IT9Z 3V7CA 3LAJA 3KZYA 2V1UA 1LEAA 1QZZA 3ZMVA 1KYWA 4EVIA 3LA3A 5ICCA 1BC7C 3RYRA 4LLGF 3IRQA 4PGHA 2E1NA 4CICA 1S7OA 2BBYA 4RB0A 2QQ9A 5E1WA 3R0JA 3J80Z 1ZGJA 5HS7A 1Z6RA 1E2XA 1CGPA 4LG0B 4ZYGA 3CUQB 3FXUA 3WTUC 1IN6A 2R3SA 5AIPA 3QP5A 2FF4A 1Z7UA 4U0WA 1EH6A 1YYVA 2RN7A 1ZRFA 1ZRDA 2M87A 1LDDA 3I59A 3ZMTA 3F8BA 3DFGA 4U0VA 3TO6A 1LDKB 1EH8A 3CJNA 3HHGA 1FYLA 4HA8A 2R7DA 5FO5A 1TQMA 5DD4A 1O3QA 4JQFA 2EJRA 4UXNA 1YFHA 3BJ6A 3ZQ7A 1FYKA 1H9GA 5HDKA 3CO7C 2ADUA 2B0LA 1YW8A 4XSXF 3I58A 4KUMA 3V8KA 2TDXA 3WODF 1J5YA 1FBUA 4BAYA 2XRNA 1FC3A 1ZAOA 1I1SA 3TO7A 2XHKA 5HVQC 2M8EA 3HTSB 2DTRA 4ZH4F 1YTYA 2IA0A 5HLGA 1DUXC 3ABTA 3MAJA 2EB7A 1R1UA 2R7FA 4KMUX 2HQRA 1PP7U 1GHCA 5K5OA 3ELKA 2A61A 4BXUA 2ESHA 3MZHA 4UVAA 2A07F 3HRTA 1KGSA 4WCGA 3KE2A 2A68F 3BROA 2BYVE 1XCVA 1B4AA 1AWCA 3K0LA 1UB9A 2XASA 3L09A 3GLXA 2GA2A 4O5VA 2JPBA 1FSHA 3DV8A 1BOAA 3JTHA 3U2RA 3GW2A 3GFIA 1XSVA 2QQBA 1RI7A 4I09A 1RZ4A 2WV0A 5CJ9A 3IWFA 4HAMA 4MNUA 1J9IA 2HKXA 5FGMA 1XMKA 3D0SA 4CYDA 2YX4A 3MFKA 2ELHA 4M6YA 2ISZA 4N9HA 1X3UA 1GVJA 2MLKA 2GAUA 2DQLA 3M8FA 4WF2A 2LNBA 3GFLA 5LHHA 4I01A 3FXRA 4OOIA 2IVMA 2NAZA 2UXXA 3F8CA 4LB5A 3R0AA 3SXYA 5L3BA 1K79A 5FLXZ 2XVCA 2UZKA 1HSJA 2MLGA 5E17F 1R5HA 2FOKA 5D6EA 3I5UA 2RNJA 1KQ8A 2F5EA 1OYWA 5DUIA 2VOPA 1Z05A 4EJWA 4KT5C 4WXCA 1IAWA 4BHPA 2QM3A 3LQQA 2DW4A 4AD9A 4YFNF 4B8XA 2D2WA 4R79A 4Q47A 2QZ8A 3W6JB 3WTXC 2JZYA 2VC0A 3R4KA 4P55A 3TQNA 2GQQA 3KZZA 5D5UB 1MDMB 2V1DA 1I6XA 2ZMEA 4CXFA 4RB2C 1R23A 2KIFA 4O6JA 3FF5A 2DPDA 2BV6A 2BE5F 2K4BA 4OINF 2Y75A 3R60A 4HBLA 4ASNA 3TOBA 2FE3A 3WE2A 2D1HA 2VBZA 4RB3C 3QAHA 4FHTA 3GZ6A 3LA2A 2NNYA 4KYWA 3T8RA 1U8RA 3J7AO 1XGSA 5JVTA 4M6XA 1MJ9A 4HYEA 4L9NA 2GXBA 4EQQA 2EA2A 1FP1D 2M30A 1TNSA 3FMRA 5JI6A 3RDIA 1F5TA 1RUNA 3TOAA 3NRVA 4G6DA 1P4AA 1B9MA 5H6QA 1T39A 2UXNA 3RKXA 1DPRA 1R36A 2XAHA 3P9IA 4IRHA 5CVVA 3REOA 4IF4A 1QO0D 3WU1B 5J8CA 2OZ6A 2LDUA 2IA2A 1RNLA 2VOOA 4WXDA 1W4MA 3U1DA 4M9XA 3MZYA 1F1ZA 4R8HA 3ZMZA 1Z9CA 4ENJA 5BPDA 5FFZA 3P7NA 1UCRA 1I1GA 4OMYA 3V7SA 3J81K 4UV9A 4M73A 3CO6C 4LMYA 5LGNA 1HSTA 4M72A 1BI2A 2RDPA 3N4MA 3E6BA 1ZGAA 5FD6A 4H0EA 1XD7A 2BGCA 2QQAA 4WWCA 4RGXA 3M8EA 4P9UA 1ZN2A 1FP2A 1YW9A 3JTGA 3V7RA 2EV0A 1U3EM 4XSZF 1MJBA 5DD8A 4F7ZA 5F6FA 1TBXA 3MWMA 1W7PD 4IHSA 3GO5A 4FX0A 4EM1A 4CZZA 4UNOA 1OKRA 3EQLF 5J6XA 4I7HA 4EM2A 5ILVA 3KFWX 1VTNC 2XAJA 3RYPA 3F8NA 3GVAA 5A2QZ 4FT8A 2ETHA 2ZNYA 4I2OA 1W7PB 5DEQA 1H0MA 3EETA 3P9KA 1HKSA 1XMAA 3L00A 5F64A 1D5VA 1GXPA 2Y0MA 4KNYA 4EMSA 4GXOA 2FA5A 2K02A 2W57A 3BDDA 1XGMA 2Z3YA 2WTEA 2EWNA 1FZPB 2FXAA 1MGTA 5L3EA 2MBFA 5F1RA 1MD0A 1RIOH 1S29A 4WXHA 2ZXJA 2HOEA 4K2EA 5D6FA 3RPUA 2FNPA 4NB5A 2F5FA 4RS8A 3MEXA 3WE3A 1YS6A 4XRFA 4ESFA 1L3LA 3DQVC 3TO9A 2P7CB 2ACJA 3DPLC 3HSRA 3MQ0A 4IPAA 2L4AA 2MC3A 2ZKZA 1F4KA 1OPCA 3P9CA 1WQ2A 3HOSA 3BJAA 5LHIA 2A6EF 5AIQA 4MEYF 2NS0A 1XN7A 2OU2A 1KU3A 4HDVA 3LSTA 3DP7A 1TQPA 2EA4A 4EJVA 1HKTA 2HZTA 4PDKA 4ON0A 1K6OA 1ODDA 3JSPA 3C1DA 1BC8C 1SMYF 1IXCA 5DCMB 2L3DA 2VODA 1OYYA 4S04A 4KFCA 3QU6A 2Z33A 4HV5A 4I0AA 4B09A 2EV5A 2M5WA 2MH2A 5H20A 1ULYA 2V6CA 3KCCA 4G94A 4CHUA 4U88A 2EFWA 3GXOA 3ML6A 2XGXA 1SFEA 3GUDA 1R58A 5TRDA 3E5QA 3FHZA 4L0YB 2KRFA 2E7WA 4L5JA 1YLFA 4MQVA 2ZFWA 3LWFA 1QQIA 3ROUA 3ZMUA 4XLPF 3WGHA 2P6SA 1R22A 1KU7A 4ZYHA 4ENNA 2LF7A 3K9TA 3I59B 1XB4A 1BJAA 3K1PA 5AONA 3KEOA 4N0BA 1XDSA 2KKOA 3WTYC 2XAQA 2ESNA 5IT9K 2VXZA 1KQ9A 5HDGA 2MD5A 4GGGA 1FPQA 1IRGA 5BS6A 2QBYA 3IWZA 2FBKA 2HTSA 3JW4A 3TDUC 1AOYA 2HEOA 1U5TC 5KVRA 1IN4A 4HX4A 2DT5A 4P9FA 5BPIA 2OAZA 4KN4X 5FFXA 1TLHB 2O61A 2VT2A 2A6HF 1LNWA 1XSXA 2XIGA 2HS5A 1HW5A 2Z5UA 4IXAA 4AIJA 5CVUA 4OU0A 2ZBKA 1JHFA 2YR2A 2O3FA 1FBQA 2CGPA 1KYZA 1XCBA 3FM5A 3BY6A 3BJOA 3HRSA 2RC4A 5JR3A 3E5XA 1ONVA 3SQNA 5J8FA 3QRFF 1TQIA 2RVCA 3CTAA 5ICEA 3NEUA 5D8LB 3U9GA 4L9TA 2FNAA 3O6BB 3LFKA 3AAFA 3FWEA 1ZARA 2PN6A 3O3KA 1R1TA 4ESJA 2W85A 4UUVA 1FLIA 1MJAA 1D3YA 4BHBA 3COAC 3F8FA 4HQMA 1O3RA 4KIBA 1FNNA 4IHTA 5DV5A 4BYYA 3M7GA 1I27A 2EFQA 3PQJA 3F8MA 1HW1A 3RTRA 3B02A 1EH7A 4KIGA 1ON2A 1P2FA 2QUFA 3VEPA 3I53A 1FYMA 2XV4S 1OYIA 2PJPA 4KIFA 1K78A 3BWGA 2M1BA 1K78B 2KIMA 2XKOA 3C18A 1J2XA 5JFRA 2FSWA 3NQOA 1B6AA 5LRRA 3IHUA 2MA3A 1YQAA 2YPRA 1ON1A 4Q5SF 3E6MA 1ZLKA 2VBWA 1S7AA 5DYMA 3E3VA 4UVCA 3SZPA 5E8IA 3HYIA 2VC1A 2OZUA 4AIKA 4ENMA 5LGTA 4G9YA 2HFHA 2JPCA 5ED4A 4Z2YA 3LQRA 3HHHA 4EV0A 4M74A 3KETA 2P5LC 2PMUA 5JHUA 4MTDA 2STTA 2OD5A 2VBXA 2ZMEB 1OR7A 2STWA 1SD5A 4G7HF 4HDUA 2PI0A 2OQRA 2WWYA 2EFNA 4Y13A 4LGWA 2DU9A 3FMSA 2OBPA 2FMYA 2H6BA 2PQ8A 4GYGA 3CUQC 2J5PA 2DI3A 5L3DA 4OIRF 1UHMA 4BNCA 4WX9A 3E5UA 5D4RA 2G9WA 1YG2A 2J5OA 3CLOA 5HS9A 3HIFA 3WG9A 4CO8A 1G3SA 3ISPA 3M9AA 1R5GA 2EFPA 1YS7A 4P96A 2QWWA 4E70A 2O8XA 4NQWA 3BP8A 1PP8F 2ZNZA 3ZN0A 1SFXA 2IPQX 3F72A 3JAMK 1T98A 2Q8KA 3WU0A 1D8JA 1U6GA 4HLYA 1T6SA 4A5NA 6PAXA 1P6RA 3VODA 2RKHA 2CSOA 1IXRC 5D5WB 2NRAC 4R1HA 2VONA 2IA1A 1KU9A 1G3WA 3ECOA 5DDGA 1NHAA 2YU3A 5D5XB 2GZWA 3Q9SA 1Q1HA 4ZZLA 1S3JA 2PFBA 3V4GA 2K7LA 4PCQA 5LLQA 3ULQB 1PUEE 2LSOA 3F6VA 1SD7A 3ERED 2BEOA 2NYXA 4O3MA 1BM9A 4I02A 3IL2A 4G7OF 4Q48A 1U5TA 4GCVA 3WGIA 4NHJA 3K2ZA 1IUYA 3GFJA 3KP4A 3LA7A 1T0FA 1UHWA 4YIFA 5H6RA 3EDPA 4HW0A 4ZYDA 5K5RA 1BI1A 3BZ6A 2PBIA 1FWZA 2JRTA 5KK1A 4LLNA 3IKVA 4AIHA 1QZYA 2CWEA 5E1ZB 3FZVA 4LK0F 4HF2A 2DPUA 2XROA 3KP2A 4A6EA 2FBIA 2PEXA 1OMIA 1XGOA 1HW2A 1O7LA 2VBYA 2Q2EA 5FB2A 1BBYA 2YX7A 1EV7A 1TTYA 5E18F 1IF1A 3CUOA 4A0YA 1JE8A 3H3ZA 1BIAA 5CVJA 5E8GA 2DLLA 1DP7P 4KMFA 4EM0B 1J59A 1W5TA 4I0BA 4LD5A 1ZREA 2A69F 2H6CA 4MGRA 2QENA 2DFIA 3EYIA 2V79A 3Q9VA 2O03A 1O3TA 3OOPA 5ILSA 3TKYA 3W6KB 3WTVC 1B1BA 2E7XA 5HS8A 3VB2A 3ZN1A 4ZYEA 3GYHX 1HXDA 4LLLA 2HGCA 2RQPA 4MQ9F 1FX7A 5E1XA 3KP5A 3FMQA 1LQ1A 1TW2A 3WTSC 2H27A 3LAPA 5K5QA 1ZRCA 1G3YA 1ZLJA 1U2WA 3ZMDA 4L5IA 2KJBA 2IRFG 3HRUA 4RGRA 1O3SA 2HYFA 1YW7A 1ZYRF 2DO7A 5FD5A 5L3GA 2KIUA 3E6DA 2IJLA 4EJOA 4DNCA 1ZHFA 1Z91A 2E1CA 5CVIA 3TDZC 1E17A 4G7ZF 5LEJA 1WWXA 1BN5A 4PZJA 4BH9A 3L7WA 4IRIA 4HX8A 3SFZA 2QYOA 1BI3A 3HSFA 3ZP5A 3K1NA 4EGYA 4OIQF 2FRHA 5BMZA 4LG0A 1B59A 2Y48A 4CDGA 3CUQA 5LBQA 3V8JA 3RPQA 1JXSA 1S6LA 3C7JA 1SFUA 2AXLA 4RAYA 2VE9A 3K69A 1LEBA 1QGPA 1FY7A 2F5DA 2ZO4A 5LHGA 2OQGA 1H9TA 2DK8A 4G8XA 3WGGA 2WC2A 1QPMA 4N9IA 3QPHA 4EGZA 4A0ZA 4I98B 1STZA 2QBYB 2Z99A 2ISYA 5EEGA 4RB1A 1F9NA 2XAGA 4Y15A 4A12A 4LB6B 3BOQA 3J80K 4JK1X 5ILUA 5CVRA 2CO5A 1MZBA 5IT3A 1J7KA 2QVOA 4UHTA 4TV7A 4HOBA 2FEZA 4AVPA 3H3UA 3F3XA 2P4WA 4HF0A 3DKWA 4XBFA 1P4XA 2V9VA 4RAZA 2G7HA 1O7FA 3GX4X 3QU3A 2P7VB 1J0RA 1C0WA 2ZCWA 2HYGD 5BQTA 4RGUA 5HLIA 2MH9A 2DAOA 1XSDA 4U0YA 3I4PA 4M9SA 4XLNF 3BPXA 1KA8A 5CYVA 2LF8A 4ZZDA 1J75A 2HWVA 1HKQA 3I0TA 3IRRA 3HSEA 3KEQA 1Z6TA 1D8KA 1L0OC 3E6CC 2XKPA 1ZG1A 5LRSA 4OIPF 2IW5A 1UFMA 2JSCA 2H09A 4M71A 1YO5C 2RGVA 4CGZA 4L0ZB 1USSA 2PG4A 3ZMSA 2F2EA 2VE8A 2A3SA 1Y0UA 3KP3A 2RV8A 1WRJA 3HTUA 2W84A 4LFUA 3ZPLA 1IRFA 4KA4A 1FBSA 2CG4A 2X4HA 1T38A 2CFXA 1WI9A 1IN5A 2FBHA 3TGNA 2P6TA 1MKMA 1YIOA 2FU4A 1REPC 3WTZA 1U78A 3SZTA 2FQ3A 3EYYA 4Q4ZF 3B73A 4G6QA 4PGGA 4HQEA 2C6YA 1SMTA 1WSUA 1TNTA 3ABUA 3RJPA 4UVBA 4EJUA 1V3FA 2QLZA 4L9JA 1G4DA 2D45A 1V4RA 2K86A 4U7BA 1IZ1A 1RUOA 3VFZA 2EV6A 5BOXA 3F22A 3MCZA 4LK1F 3PQKA 5HDNA 3GFMA 1R1VA 1BIBA 1MDMA 2Q0OA 1T2KA 1TW3A 4ETSA 5FLXK 3V8LA 3CDHA 2W24A 3K1MA 2YSRA 4DQ2A 1HBXG 2G7UA 1XGNA 4RGSA 1O57A 1K7AA 4QLCU 3KP6A 3JAMZ 2F5CA 2COMA 1GXQA 4ENKA 4BQAA 1I5ZA 4Y17A 4S05A 3WTWC 2HTJA 2P8TA 3G3ZA 2KJCA 3EUHA 1P92A 2EK5A 5ICGA 3KLNA 4BHCA 2DQRA 4KN7X 5D5VB 3R61A 1XDUA 4YG2F 5LGUA 1USTA 3IKTA 2V1XA 3I54A 1R00A 2PMHA 4GYIA 2EFOA 1Z1DA 2VT3A 2OA4A 2CW0F 4YFXF 2M45A 3HOTA 2VN2A 2LKPA 3RKYA 3J81Z 3H92A 3SHFA 1LB2A 2O6GE 2GXGA 2HKOA 4AWXB 3T0YA 3DF8A 3WTTC 1CF7A 4YFKF 2K4JA 3N97A 5E20A 4MHGA 1CF7B 4HF1A 1ZG5A 1R7JA 3PFIA 5TJJA 2P5VA 3O2PE 5EEHA 2FMLA 1IW7F 3Q5FA 3I64A 2HR3A 5HLHA 3F21A 3RIRA 3JSOA 1KQ0A 4UV8A 5CLSA 4A0XA 2IP2A 1SD6A 4FX4A 3FXQA 2X0LA 3DEUA 1A04A 3S2WA 2IT0A 1BI0A 3HUGA 1ZH5A 5D4SA 5ICFA 1IN8A 2K27A 1IXSB 1LVAA 1IN7A 2CYYA 1KU2A 2A5YB 3GEZA 3HRMA 4MEXF 4P5OA 3GWZA 3KLOA 3GF2A 4EJTA 2D1VA 3GZ5A 1QNTA 1U5TB 4A5MA 2H94A 3ECHA 4L18B 5K1YA 1FSEA 1B9NA 2NNNA 4GO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XUB A;  2L01 A;  4QWQ A;  3BPV A;  3VOE A;  3OV8 A;  4OIO F;  3QOP A;  2PLY A;  5D8K B;  3RI4 A;  1W7P A;  1FT9 A;  5L3F A;  4HZF A;  4A6D A;  4IRG A;  3E97 A;  1LJ9 A;  3F23 A;  2O0Y A;  4IJA A;  1LDJ A;  3L2C A;  1W5S A;  2AS5 F;  2L4M A;  4ESB A;  2DBB A;  1S8N A;  2L54 A;  3R6S A;  1JHH A;  1ZG3 A;  2XAF A;  4KDP A;  3M1E A;  1FOK A;  3DPT A;  4U7D A;  1PDN C;  2CQK A;  5A2Q K;  2GIV A;  1DDN A;  3IC7 A;  3QPT A;  3T8T A;  4A2U A;  4MTE A;  1SAX A;  1SD4 A;  3DXJ F;  5DUK A;  4WK8 F;  4D0P A;  5ERI A;  3I71 A;  1G6N A;  5L3C A;  3FM3 A;  5DCF A;  4IVN A;  4JBA A;  2HDC A;  3C3W A;  2W25 A;  2HQN A;  4HV6 A;  5LEK A;  4HLX A;  5HOO A;  4KIC A;  2DK5 A;  1WKM A;  1HQC A;  3KP7 A;  4YII A;  3L9F A;  3D5L A;  4L9V A;  2JT1 A;  3F6O A;  3G73 A;  3T1B A;  1G3T A;  4OMZ A;  2Z9O A;  3FX3 A;  3T5X A;  1DPU A;  2JTV A;  2GWR A;  1P4W A;  2UWM A;  5DCM A;  1JGS A;  4LJZ F;  2L02 A;  2ZJ2 A;  3RKW A;  4M9Z A;  4HX7 A;  3QP6 A;  1QBJ A;  2GA1 A;  2P5K A;  5IT9 Z;  3V7C A;  3LAJ A;  3KZY A;  2V1U A;  1LEA A;  1QZZ A;  3ZMV A;  1KYW A;  4EVI A;  3LA3 A;  5ICC A;  1BC7 C;  3RYR A;  4LLG F;  3IRQ A;  4PGH A;  2E1N A;  4CIC A;  1S7O A;  2BBY A;  4RB0 A;  2QQ9 A;  5E1W A;  3R0J A;  3J80 Z;  1ZGJ A;  5HS7 A;  1Z6R A;  1E2X A;  1CGP A;  4LG0 B;  4ZYG A;  3CUQ B;  3FXU A;  3WTU C;  1IN6 A;  2R3S A;  5AIP A;  3QP5 A;  2FF4 A;  1Z7U A;  4U0W A;  1EH6 A;  1YYV A;  2RN7 A;  1ZRF A;  1ZRD A;  2M87 A;  1LDD A;  3I59 A;  3ZMT A;  3F8B A;  3DFG A;  4U0V A;  3TO6 A;  1LDK B;  1EH8 A;  3CJN A;  3HHG A;  1FYL A;  4HA8 A;  2R7D A;  5FO5 A;  1TQM A;  5DD4 A;  1O3Q A;  4JQF A;  2EJR A;  4UXN A;  1YFH A;  3BJ6 A;  3ZQ7 A;  1FYK A;  1H9G A;  5HDK A;  3CO7 C;  2ADU A;  2B0L A;  1YW8 A;  4XSX F;  3I58 A;  4KUM A;  3V8K A;  2TDX A;  3WOD F;  1J5Y A;  1FBU A;  4BAY A;  2XRN A;  1FC3 A;  1ZAO A;  1I1S A;  3TO7 A;  2XHK A;  5HVQ C;  2M8E A;  3HTS B;  2DTR A;  4ZH4 F;  1YTY A;  2IA0 A;  5HLG A;  1DUX C;  3ABT A;  3MAJ A;  2EB7 A;  1R1U A;  2R7F A;  4KMU X;  2HQR A;  1PP7 U;  1GHC A;  5K5O A;  3ELK A;  2A61 A;  4BXU A;  2ESH A;  3MZH A;  4UVA A;  2A07 F;  3HRT A;  1KGS A;  4WCG A;  3KE2 A;  2A68 F;  3BRO A;  2BYV E;  1XCV A;  1B4A A;  1AWC A;  3K0L A;  1UB9 A;  2XAS A;  3L09 A;  3GLX A;  2GA2 A;  4O5V A;  2JPB A;  1FSH A;  3DV8 A;  1BOA A;  3JTH A;  3U2R A;  3GW2 A;  3GFI A;  1XSV A;  2QQB A;  1RI7 A;  4I09 A;  1RZ4 A;  2WV0 A;  5CJ9 A;  3IWF A;  4HAM A;  4MNU A;  1J9I A;  2HKX A;  5FGM A;  1XMK A;  3D0S A;  4CYD A;  2YX4 A;  3MFK A;  2ELH A;  4M6Y A;  2ISZ A;  4N9H A;  1X3U A;  1GVJ A;  2MLK A;  2GAU A;  2DQL A;  3M8F A;  4WF2 A;  2LNB A;  3GFL A;  5LHH A;  4I01 A;  3FXR A;  4OOI A;  2IVM A;  2NAZ A;  2UXX A;  3F8C A;  4LB5 A;  3R0A A;  3SXY A;  5L3B A;  1K79 A;  5FLX Z;  2XVC A;  2UZK A;  1HSJ A;  2MLG A;  5E17 F;  1R5H A;  2FOK A;  5D6E A;  3I5U A;  2RNJ A;  1KQ8 A;  2F5E A;  1OYW A;  5DUI A;  2VOP A;  1Z05 A;  4EJW A;  4KT5 C;  4WXC A;  1IAW A;  4BHP A;  2QM3 A;  3LQQ A;  2DW4 A;  4AD9 A;  4YFN F;  4B8X A;  2D2W A;  4R79 A;  4Q47 A;  2QZ8 A;  3W6J B;  3WTX C;  2JZY A;  2VC0 A;  3R4K A;  4P55 A;  3TQN A;  2GQQ A;  3KZZ A;  5D5U B;  1MDM B;  2V1D A;  1I6X A;  2ZME A;  4CXF A;  4RB2 C;  1R23 A;  2KIF A;  4O6J A;  3FF5 A;  2DPD A;  2BV6 A;  2BE5 F;  2K4B A;  4OIN F;  2Y75 A;  3R60 A;  4HBL A;  4ASN A;  3TOB A;  2FE3 A;  3WE2 A;  2D1H A;  2VBZ A;  4RB3 C;  3QAH A;  4FHT A;  3GZ6 A;  3LA2 A;  2NNY A;  4KYW A;  3T8R A;  1U8R A;  3J7A O;  1XGS A;  5JVT A;  4M6X A;  1MJ9 A;  4HYE A;  4L9N A;  2GXB A;  4EQQ A;  2EA2 A;  1FP1 D;  2M30 A;  1TNS A;  3FMR A;  5JI6 A;  3RDI A;  1F5T A;  1RUN A;  3TOA A;  3NRV A;  4G6D A;  1P4A A;  1B9M A;  5H6Q A;  1T39 A;  2UXN A;  3RKX A;  1DPR A;  1R36 A;  2XAH A;  3P9I A;  4IRH A;  5CVV A;  3REO A;  4IF4 A;  1QO0 D;  3WU1 B;  5J8C A;  2OZ6 A;  2LDU A;  2IA2 A;  1RNL A;  2VOO A;  4WXD A;  1W4M A;  3U1D A;  4M9X A;  3MZY A;  1F1Z A;  4R8H A;  3ZMZ A;  1Z9C A;  4ENJ A;  5BPD A;  5FFZ A;  3P7N A;  1UCR A;  1I1G A;  4OMY A;  3V7S A;  3J81 K;  4UV9 A;  4M73 A;  3CO6 C;  4LMY A;  5LGN A;  1HST A;  4M72 A;  1BI2 A;  2RDP A;  3N4M A;  3E6B A;  1ZGA A;  5FD6 A;  4H0E A;  1XD7 A;  2BGC A;  2QQA A;  4WWC A;  4RGX A;  3M8E A;  4P9U A;  1ZN2 A;  1FP2 A;  1YW9 A;  3JTG A;  3V7R A;  2EV0 A;  1U3E M;  4XSZ F;  1MJB A;  5DD8 A;  4F7Z A;  5F6F A;  1TBX A;  3MWM A;  1W7P D;  4IHS A;  3GO5 A;  4FX0 A;  4EM1 A;  4CZZ A;  4UNO A;  1OKR A;  3EQL F;  5J6X A;  4I7H A;  4EM2 A;  5ILV A;  3KFW X;  1VTN C;  2XAJ A;  3RYP A;  3F8N A;  3GVA A;  5A2Q Z;  4FT8 A;  2ETH A;  2ZNY A;  4I2O A;  1W7P B;  5DEQ A;  1H0M A;  3EET A;  3P9K A;  1HKS A;  1XMA A;  3L00 A;  5F64 A;  1D5V A;  1GXP A;  2Y0M A;  4KNY A;  4EMS A;  4GXO A;  2FA5 A;  2K02 A;  2W57 A;  3BDD A;  1XGM A;  2Z3Y A;  2WTE A;  2EWN A;  1FZP B;  2FXA A;  1MGT A;  5L3E A;  2MBF A;  5F1R A;  1MD0 A;  1RIO H;  1S29 A;  4WXH A;  2ZXJ A;  2HOE A;  4K2E A;  5D6F A;  3RPU A;  2FNP A;  4NB5 A;  2F5F A;  4RS8 A;  3MEX A;  3WE3 A;  1YS6 A;  4XRF A;  4ESF A;  1L3L A;  3DQV C;  3TO9 A;  2P7C B;  2ACJ A;  3DPL C;  3HSR A;  3MQ0 A;  4IPA A;  2L4A A;  2MC3 A;  2ZKZ A;  1F4K A;  1OPC A;  3P9C A;  1WQ2 A;  3HOS A;  3BJA A;  5LHI A;  2A6E F;  5AIQ A;  4MEY F;  2NS0 A;  1XN7 A;  2OU2 A;  1KU3 A;  4HDV A;  3LST A;  3DP7 A;  1TQP A;  2EA4 A;  4EJV A;  1HKT A;  2HZT A;  4PDK A;  4ON0 A;  1K6O A;  1ODD A;  3JSP A;  3C1D A;  1BC8 C;  1SMY F;  1IXC A;  5DCM B;  2L3D A;  2VOD A;  1OYY A;  4S04 A;  4KFC A;  3QU6 A;  2Z33 A;  4HV5 A;  4I0A A;  4B09 A;  2EV5 A;  2M5W A;  2MH2 A;  5H20 A;  1ULY A;  2V6C A;  3KCC A;  4G94 A;  4CHU A;  4U88 A;  2EFW A;  3GXO A;  3ML6 A;  2XGX A;  1SFE A;  3GUD A;  1R58 A;  5TRD A;  3E5Q A;  3FHZ A;  4L0Y B;  2KRF A;  2E7W A;  4L5J A;  1YLF A;  4MQV A;  2ZFW A;  3LWF A;  1QQI A;  3ROU A;  3ZMU A;  4XLP F;  3WGH A;  2P6S A;  1R22 A;  1KU7 A;  4ZYH A;  4ENN A;  2LF7 A;  3K9T A;  3I59 B;  1XB4 A;  1BJA A;  3K1P A;  5AON A;  3KEO A;  4N0B A;  1XDS A;  2KKO A;  3WTY C;  2XAQ A;  2ESN A;  5IT9 K;  2VXZ A;  1KQ9 A;  5HDG A;  2MD5 A;  4GGG A;  1FPQ A;  1IRG A;  5BS6 A;  2QBY A;  3IWZ A;  2FBK A;  2HTS A;  3JW4 A;  3TDU C;  1AOY A;  2HEO A;  1U5T C;  5KVR A;  1IN4 A;  4HX4 A;  2DT5 A;  4P9F A;  5BPI A;  2OAZ A;  4KN4 X;  5FFX A;  1TLH B;  2O61 A;  2VT2 A;  2A6H F;  1LNW A;  1XSX A;  2XIG A;  2HS5 A;  1HW5 A;  2Z5U A;  4IXA A;  4AIJ A;  5CVU A;  4OU0 A;  2ZBK A;  1JHF A;  2YR2 A;  2O3F A;  1FBQ A;  2CGP A;  1KYZ A;  1XCB A;  3FM5 A;  3BY6 A;  3BJO A;  3HRS A;  2RC4 A;  5JR3 A;  3E5X A;  1ONV A;  3SQN A;  5J8F A;  3QRF F;  1TQI A;  2RVC A;  3CTA A;  5ICE A;  3NEU A;  5D8L B;  3U9G A;  4L9T A;  2FNA A;  3O6B B;  3LFK A;  3AAF A;  3FWE A;  1ZAR A;  2PN6 A;  3O3K A;  1R1T A;  4ESJ A;  2W85 A;  4UUV A;  1FLI A;  1MJA A;  1D3Y A;  4BHB A;  3COA C;  3F8F A;  4HQM A;  1O3R A;  4KIB A;  1FNN A;  4IHT A;  5DV5 A;  4BYY A;  3M7G A;  1I27 A;  2EFQ A;  3PQJ A;  3F8M A;  1HW1 A;  3RTR A;  3B02 A;  1EH7 A;  4KIG A;  1ON2 A;  1P2F A;  2QUF A;  3VEP A;  3I53 A;  1FYM A;  2XV4 S;  1OYI A;  2PJP A;  4KIF A;  1K78 A;  3BWG A;  2M1B A;  1K78 B;  2KIM A;  2XKO A;  3C18 A;  1J2X A;  5JFR A;  2FSW A;  3NQO A;  1B6A A;  5LRR A;  3IHU A;  2MA3 A;  1YQA A;  2YPR A;  1ON1 A;  4Q5S F;  3E6M A;  1ZLK A;  2VBW A;  1S7A A;  5DYM A;  3E3V A;  4UVC A;  3SZP A;  5E8I A;  3HYI A;  2VC1 A;  2OZU A;  4AIK A;  4ENM A;  5LGT A;  4G9Y A;  2HFH A;  2JPC A;  5ED4 A;  4Z2Y A;  3LQR A;  3HHH A;  4EV0 A;  4M74 A;  3KET A;  2P5L C;  2PMU A;  5JHU A;  4MTD A;  2STT A;  2OD5 A;  2VBX A;  2ZME B;  1OR7 A;  2STW A;  1SD5 A;  4G7H F;  4HDU A;  2PI0 A;  2OQR A;  2WWY A;  2EFN A;  4Y13 A;  4LGW A;  2DU9 A;  3FMS A;  2OBP A;  2FMY A;  2H6B A;  2PQ8 A;  4GYG A;  3CUQ C;  2J5P A;  2DI3 A;  5L3D A;  4OIR F;  1UHM A;  4BNC A;  4WX9 A;  3E5U A;  5D4R A;  2G9W A;  1YG2 A;  2J5O A;  3CLO A;  5HS9 A;  3HIF A;  3WG9 A;  4CO8 A;  1G3S A;  3ISP A;  3M9A A;  1R5G A;  2EFP A;  1YS7 A;  4P96 A;  2QWW A;  4E70 A;  2O8X A;  4NQW A;  3BP8 A;  1PP8 F;  2ZNZ A;  3ZN0 A;  1SFX A;  2IPQ X;  3F72 A;  3JAM K;  1T98 A;  2Q8K A;  3WU0 A;  1D8J A;  1U6G A;  4HLY A;  1T6S A;  4A5N A;  6PAX A;  1P6R A;  3VOD A;  2RKH A;  2CSO A;  1IXR C;  5D5W B;  2NRA C;  4R1H A;  2VON A;  2IA1 A;  1KU9 A;  1G3W A;  3ECO A;  5DDG A;  1NHA A;  2YU3 A;  5D5X B;  2GZW A;  3Q9S A;  1Q1H A;  4ZZL A;  1S3J A;  2PFB A;  3V4G A;  2K7L A;  4PCQ A;  5LLQ A;  3ULQ B;  1PUE E;  2LSO A;  3F6V A;  1SD7 A;  3ERE D;  2BEO A;  2NYX A;  4O3M A;  1BM9 A;  4I02 A;  3IL2 A;  4G7O F;  4Q48 A;  1U5T A;  4GCV A;  3WGI A;  4NHJ A;  3K2Z A;  1IUY A;  3GFJ A;  3KP4 A;  3LA7 A;  1T0F A;  1UHW A;  4YIF A;  5H6R A;  3EDP A;  4HW0 A;  4ZYD A;  5K5R A;  1BI1 A;  3BZ6 A;  2PBI A;  1FWZ A;  2JRT A;  5KK1 A;  4LLN A;  3IKV A;  4AIH A;  1QZY A;  2CWE A;  5E1Z B;  3FZV A;  4LK0 F;  4HF2 A;  2DPU A;  2XRO A;  3KP2 A;  4A6E A;  2FBI A;  2PEX A;  1OMI A;  1XGO A;  1HW2 A;  1O7L A;  2VBY A;  2Q2E A;  5FB2 A;  1BBY A;  2YX7 A;  1EV7 A;  1TTY A;  5E18 F;  1IF1 A;  3CUO A;  4A0Y A;  1JE8 A;  3H3Z A;  1BIA A;  5CVJ A;  5E8G A;  2DLL A;  1DP7 P;  4KMF A;  4EM0 B;  1J59 A;  1W5T A;  4I0B A;  4LD5 A;  1ZRE A;  2A69 F;  2H6C A;  4MGR A;  2QEN A;  2DFI A;  3EYI A;  2V79 A;  3Q9V A;  2O03 A;  1O3T A;  3OOP A;  5ILS A;  3TKY A;  3W6K B;  3WTV C;  1B1B A;  2E7X A;  5HS8 A;  3VB2 A;  3ZN1 A;  4ZYE A;  3GYH X;  1HXD A;  4LLL A;  2HGC A;  2RQP A;  4MQ9 F;  1FX7 A;  5E1X A;  3KP5 A;  3FMQ A;  1LQ1 A;  1TW2 A;  3WTS C;  2H27 A;  3LAP A;  5K5Q A;  1ZRC A;  1G3Y A;  1ZLJ A;  1U2W A;  3ZMD A;  4L5I A;  2KJB A;  2IRF G;  3HRU A;  4RGR A;  1O3S A;  2HYF A;  1YW7 A;  1ZYR F;  2DO7 A;  5FD5 A;  5L3G A;  2KIU A;  3E6D A;  2IJL A;  4EJO A;  4DNC A;  1ZHF A;  1Z91 A;  2E1C A;  5CVI A;  3TDZ C;  1E17 A;  4G7Z F;  5LEJ A;  1WWX A;  1BN5 A;  4PZJ A;  4BH9 A;  3L7W A;  4IRI A;  4HX8 A;  3SFZ A;  2QYO A;  1BI3 A;  3HSF A;  3ZP5 A;  3K1N A;  4EGY A;  4OIQ F;  2FRH A;  5BMZ A;  4LG0 A;  1B59 A;  2Y48 A;  4CDG A;  3CUQ A;  5LBQ A;  3V8J A;  3RPQ A;  1JXS A;  1S6L A;  3C7J A;  1SFU A;  2AXL A;  4RAY A;  2VE9 A;  3K69 A;  1LEB A;  1QGP A;  1FY7 A;  2F5D A;  2ZO4 A;  5LHG A;  2OQG A;  1H9T A;  2DK8 A;  4G8X A;  3WGG A;  2WC2 A;  1QPM A;  4N9I A;  3QPH A;  4EGZ A;  4A0Z A;  4I98 B;  1STZ A;  2QBY B;  2Z99 A;  2ISY A;  5EEG A;  4RB1 A;  1F9N A;  2XAG A;  4Y15 A;  4A12 A;  4LB6 B;  3BOQ A;  3J80 K;  4JK1 X;  5ILU A;  5CVR A;  2CO5 A;  1MZB A;  5IT3 A;  1J7K A;  2QVO A;  4UHT A;  4TV7 A;  4HOB A;  2FEZ A;  4AVP A;  3H3U A;  3F3X A;  2P4W A;  4HF0 A;  3DKW A;  4XBF A;  1P4X A;  2V9V A;  4RAZ A;  2G7H A;  1O7F A;  3GX4 X;  3QU3 A;  2P7V B;  1J0R A;  1C0W A;  2ZCW A;  2HYG D;  5BQT A;  4RGU A;  5HLI A;  2MH9 A;  2DAO A;  1XSD A;  4U0Y A;  3I4P A;  4M9S A;  4XLN F;  3BPX A;  1KA8 A;  5CYV A;  2LF8 A;  4ZZD A;  1J75 A;  2HWV A;  1HKQ A;  3I0T A;  3IRR A;  3HSE A;  3KEQ A;  1Z6T A;  1D8K A;  1L0O C;  3E6C C;  2XKP A;  1ZG1 A;  5LRS A;  4OIP F;  2IW5 A;  1UFM A;  2JSC A;  2H09 A;  4M71 A;  1YO5 C;  2RGV A;  4CGZ A;  4L0Z B;  1USS A;  2PG4 A;  3ZMS A;  2F2E A;  2VE8 A;  2A3S A;  1Y0U A;  3KP3 A;  2RV8 A;  1WRJ A;  3HTU A;  2W84 A;  4LFU A;  3ZPL A;  1IRF A;  4KA4 A;  1FBS A;  2CG4 A;  2X4H A;  1T38 A;  2CFX A;  1WI9 A;  1IN5 A;  2FBH A;  3TGN A;  2P6T A;  1MKM A;  1YIO A;  2FU4 A;  1REP C;  3WTZ A;  1U78 A;  3SZT A;  2FQ3 A;  3EYY A;  4Q4Z F;  3B73 A;  4G6Q A;  4PGG A;  4HQE A;  2C6Y A;  1SMT A;  1WSU A;  1TNT A;  3ABU A;  3RJP A;  4UVB A;  4EJU A;  1V3F A;  2QLZ A;  4L9J A;  1G4D A;  2D45 A;  1V4R A;  2K86 A;  4U7B A;  1IZ1 A;  1RUO A;  3VFZ A;  2EV6 A;  5BOX A;  3F22 A;  3MCZ A;  4LK1 F;  3PQK A;  5HDN A;  3GFM A;  1R1V A;  1BIB A;  1MDM A;  2Q0O A;  1T2K A;  1TW3 A;  4ETS A;  5FLX K;  3V8L A;  3CDH A;  2W24 A;  3K1M A;  2YSR A;  4DQ2 A;  1HBX G;  2G7U A;  1XGN A;  4RGS A;  1O57 A;  1K7A A;  4QLC U;  3KP6 A;  3JAM Z;  2F5C A;  2COM A;  1GXQ A;  4ENK A;  4BQA A;  1I5Z A;  4Y17 A;  4S05 A;  3WTW C;  2HTJ A;  2P8T A;  3G3Z A;  2KJC A;  3EUH A;  1P92 A;  2EK5 A;  5ICG A;  3KLN A;  4BHC A;  2DQR A;  4KN7 X;  5D5V B;  3R61 A;  1XDU A;  4YG2 F;  5LGU A;  1UST A;  3IKT A;  2V1X A;  3I54 A;  1R00 A;  2PMH A;  4GYI A;  2EFO A;  1Z1D A;  2VT3 A;  2OA4 A;  2CW0 F;  4YFX F;  2M45 A;  3HOT A;  2VN2 A;  2LKP A;  3RKY A;  3J81 Z;  3H92 A;  3SHF A;  1LB2 A;  2O6G E;  2GXG A;  2HKO A;  4AWX B;  3T0Y A;  3DF8 A;  3WTT C;  1CF7 A;  4YFK F;  2K4J A;  3N97 A;  5E20 A;  4MHG A;  1CF7 B;  4HF1 A;  1ZG5 A;  1R7J A;  3PFI A;  5TJJ A;  2P5V A;  3O2P E;  5EEH A;  2FML A;  1IW7 F;  3Q5F A;  3I64 A;  2HR3 A;  5HLH A;  3F21 A;  3RIR A;  3JSO A;  1KQ0 A;  4UV8 A;  5CLS A;  4A0X A;  2IP2 A;  1SD6 A;  4FX4 A;  3FXQ A;  2X0L A;  3DEU A;  1A04 A;  3S2W A;  2IT0 A;  1BI0 A;  3HUG A;  1ZH5 A;  5D4S A;  5ICF A;  1IN8 A;  2K27 A;  1IXS B;  1LVA A;  1IN7 A;  2CYY A;  1KU2 A;  2A5Y B;  3GEZ A;  3HRM A;  4MEX F;  4P5O A;  3GWZ A;  3KLO A;  3GF2 A;  4EJT A;  2D1V A;  3GZ5 A;  1QNT A;  1U5T B;  4A5M A;  2H94 A;  3ECH A;  4L18 B;  5K1Y A;  1FSE A;  1B9N A;  2NNN A;  4GO1 A; 
#chains in the Genus database with same CATH topology
 2XUB A;  4U87 A;  2HDD A;  3HEF A;  2L01 A;  3ABK H;  4QWQ A;  1SFK A;  4C3J J;  3BPV A;  4V19 K;  2OCE A;  3VOE A;  2WAQ N;  1MND A;  3MKW B;  3KYL A;  3CP2 A;  3LMM A;  3OV8 A;  3JRH A;  2K9N A;  5FLV A;  4OIO F;  3QOP A;  3FHN A;  3PUB A;  5IYB J;  3CCR I;  1BL0 A;  4CZC A;  3K6G A;  2L5Q A;  1UG0 A;  1JT0 A;  1PJR A;  2PLY A;  4CCN A;  5D8K B;  3LFU A;  3RI4 A;  1W7P A;  3H36 A;  5GTH C;  3NAU A;  3W2A A;  1FT9 A;  3IAM 2;  5L3F A;  3CCM I;  4HZF A;  1E3O C;  1WFX A;  4A6D A;  4IRG A;  3E97 A;  1LJ9 A;  2LFB A;  3VSK A;  3F23 A;  2O0Y A;  1X1C A;  3Q3S A;  2XPU A;  4IJA A;  1QHG A;  1LDJ A;  2Z16 A;  3G1O A;  3L2C A;  9ANT A;  2OCC H;  3K4N A;  1W5S A;  2AS5 F;  3ZQQ A;  2V9K A;  2L4M A;  1SVL A;  4Y4R A;  2HNH A;  2QKL B;  2Q2E B;  3X2Q H;  1X3Z B;  4ESB A;  5GPA A;  2DBB A;  1S8N A;  2L54 A;  3R6S A;  2NVU B;  1GUU A;  3M07 A;  3JRC A;  5J47 A;  1JHH A;  1XS9 A;  3AKZ A;  5CQG A;  1ZG3 A;  5C3E J;  2XAF A;  4KDP A;  1XC5 A;  3M1E A;  4J19 A;  2QCO A;  3BTI A;  5F1J A;  2L0K A;  1FOK A;  5IYD J;  1OCP A;  3DPT A;  2E36 A;  2IEK A;  4U7D A;  2CQK A;  1PDN C;  2CJJ A;  5A2Q K;  3CJT B;  2GIV A;  4JX5 A;  1DDN A;  3C2G A;  3ZQL A;  3IC7 A;  2ZME C;  2E34 A;  1RR7 A;  3QPT A;  3T8T A;  3MKY B;  4A2U A;  3CCQ I;  3S3M A;  4MTE A;  1SAX A;  3NWT A;  1SD4 A;  3ABM H;  3DXJ F;  1PYV A;  3S1Q J;  3LOC A;  5DUK A;  4WK8 F;  1Y8R B;  2X6W A;  1YE9 A;  3FXL A;  5ERI A;  2LR8 A;  3BTL A;  3I71 A;  4D0P A;  1XPX A;  3ZQI A;  1G6N A;  5L3C A;  2HPM A;  4DJA A;  2GXA A;  1EA3 A;  3CF2 A;  3FM3 A;  2NVY J;  5DCF A;  4IVN A;  4DYQ A;  4JBA A;  3I4M J;  1I50 J;  2QF7 A;  5F0F A;  1SEU A;  2HDC A;  3C3W A;  3KYC B;  3KPH A;  3A02 A;  2W25 A;  1DP3 A;  5FKN A;  2HQN A;  2BVL A;  2V9P A;  4HV6 A;  2HXI A;  5EZH A;  5LEK A;  4HLX A;  2LY1 A;  5HOO A;  4KIC A;  2DK5 A;  2DMP A;  3CMM A;  1NK2 P;  1WKM A;  1UJ8 A;  1HQC A;  4AUX A;  3KP7 A;  4YII A;  2ZJR F;  3K4M A;  3L9F A;  3D5L A;  2E35 A;  3ABL H;  1IJW C;  3MN2 A;  2BXY A;  4M3D A;  4UB6 C;  4B48 A;  4L9V A;  3G1L A;  5DS9 A;  2JT1 A;  3F6O A;  2E1M B;  3G73 A;  3QWL A;  2L7F P;  3T1B A;  4A3E J;  1G3T A;  4OMZ A;  3G4S I;  2Z9O A;  1I6H J;  3FX3 A;  3T5X A;  1DPU A;  2JTV A;  2GWR A;  2X6Y A;  1P4W A;  2PJR A;  3HXL A;  4XM3 A;  3L2Q A;  4CSW A;  2UWM A;  5DCM A;  1A5J A;  1JGS A;  1YOV B;  4BAC A;  4LJZ F;  2L02 A;  2ZJ2 A;  2GOX B;  3RKW A;  1QA6 A;  4DIQ A;  4M9Z A;  1K4S A;  5H2F C;  4HX7 A;  4B4C A;  2V1N A;  3QP6 A;  1QBJ A;  5F0H A;  1UZC A;  2GA1 A;  2P5K A;  3W2V A;  5IT9 Z;  3V7C A;  3LAJ A;  3CCY A;  3KZY A;  1LEA A;  2JRM A;  2V1U A;  1QZZ A;  3ZMV A;  1KYW A;  2AXT C;  2COB A;  4EVI A;  3LA3 A;  1F43 A;  4BQN A;  5ICC A;  2JUC A;  1BC7 C;  3RYR A;  1I3Q J;  3VPR A;  2JK3 A;  3SDB A;  4LLG F;  3IRQ A;  4PGH A;  2E1N A;  3PNY A;  1U9N A;  4CIC A;  2R5Z A;  1BW5 A;  4F3Q A;  2OTJ I;  1GLN A;  1M1E B;  2DMN A;  1S7O A;  1JGG A;  1OIS A;  3DBL B;  2BBY A;  2XGC A;  3GTK J;  4RB0 A;  2QQ9 A;  1TWH J;  3R0J A;  5E1W A;  3J80 Z;  1ZGJ A;  5HS7 A;  1Z6R A;  1E2X A;  1CGP A;  1WHU A;  4LG0 B;  3OIP A;  4JYK A;  2WB1 A;  3CUQ B;  4ZYG A;  3FXU A;  3S3O A;  3WTU C;  1S5L C;  1IN6 A;  5KHD A;  2R3S A;  5AIP A;  2N8G A;  3QP5 A;  4LIU A;  1WJ5 A;  2FF4 A;  1QVU A;  1Z7U A;  4U0W A;  1EH6 A;  1YYV A;  2XF5 A;  2A6T A;  2RN7 A;  1ZRF A;  1ZRD A;  2M87 A;  3D1N I;  2Z2S B;  1LDD A;  3I59 A;  3ZMT A;  4D1Q A;  2F5V A;  2XSJ C;  3F8B A;  3DFG A;  3LSI A;  3G2B A;  1ETY A;  2DT6 A;  3BR0 A;  3ZRG A;  4X0G A;  4U0V A;  3TO6 A;  1GV2 A;  3OYE A;  1LDK B;  3PSI A;  1QPI A;  3DWL E;  3SDG A;  3BTC A;  3K70 D;  1EH8 A;  3CJN A;  3HHG A;  1FYL A;  3TMO A;  3JRB A;  3M8J A;  2R7Q A;  4HA8 A;  2VKV A;  2R7D A;  2E60 A;  4XRS A;  3CD6 I;  2DOF A;  3S16 J;  5GP9 A;  5FO5 A;  1TQM A;  3SZG A;  5DD4 A;  1O3Q A;  4JQF A;  1D0Z A;  2EJR A;  3S8P A;  4UXN A;  4LIT A;  1YFH A;  2FQ4 A;  3BJ6 A;  1S72 I;  3ZQ7 A;  1TWA J;  1FYK A;  1HA8 A;  1H9G A;  5HDK A;  1D0Y A;  2CS3 A;  3CO7 C;  1Y39 A;  2DXI A;  2HU9 A;  2ADU A;  2B0L A;  1YW8 A;  4JX4 A;  4XSX F;  3I58 A;  1OFC X;  4KUM A;  3V8K A;  5B3S H;  2Y0S N;  3RZD J;  2TDX A;  3WOD F;  1J5Y A;  1FBU A;  1H8A C;  2JA8 J;  4BAY A;  2XRN A;  1FC3 A;  2MFZ A;  1ZAO A;  2ELJ A;  3PUF A;  1QVT A;  4X1E A;  3TW7 A;  2WAE A;  3TO7 A;  2M0C A;  2XHK A;  5HVQ C;  2M8E A;  1HF0 A;  2DTR A;  2Y9Z A;  4ZH4 F;  3HTS B;  1YTY A;  1JKR C;  2IA0 A;  5HLG A;  3N05 A;  1DUX C;  3ABT A;  3BC8 A;  3MAJ A;  3BR1 A;  4LOC A;  1XG1 A;  2EB7 A;  1R1U A;  2R7F A;  4KMU X;  5FKO A;  2DA3 A;  2DJI A;  2FOW A;  2HQR A;  1PP7 U;  3GTO J;  1GHC A;  3W6V A;  5K5O A;  4ZDO A;  3ELK A;  2A61 A;  4BXU A;  1OCT C;  2JA2 A;  3FIW A;  2ESH A;  3MZH A;  4UVA A;  2A07 F;  2VKH A;  3HRT A;  3ZQG A;  1KGS A;  4WCG A;  2X48 A;  3KE2 A;  2A68 F;  3LL7 A;  3BRO A;  4AC0 A;  2BYV E;  1XCV A;  1B4A A;  1AWC A;  3W2W A;  3K0L A;  1UB9 A;  1WJA A;  2XAS A;  3L09 A;  3BCB A;  3GLX A;  5DTD A;  2GA2 A;  4O5V A;  5EG0 B;  2JPB A;  3K7A J;  2MYS A;  1FSH A;  2E1O A;  3DV8 A;  4GDF A;  2KL4 A;  4XK4 A;  4BS9 A;  1BOA A;  4F93 B;  3JTH A;  3ERM A;  1WZ2 A;  2HQA A;  3GW2 A;  3U2R A;  1P7I A;  3GFI A;  5GTI C;  1XSV A;  2QQB A;  1RI7 A;  1VQ9 I;  1TZL A;  3HKZ N;  1GT0 C;  3BG3 A;  4I09 A;  4RLF A;  1RZ4 A;  2WV0 A;  5CJ9 A;  2B7E A;  4XID A;  2ID3 A;  1A6I A;  4CUG A;  2H1K A;  1E0E A;  1X2M A;  3IWF A;  4HAM A;  4MNU A;  1T56 A;  3PM1 A;  1J9I A;  2HKX A;  4QPQ A;  5FGM A;  1XMK A;  1WPK A;  1GV5 A;  3D0S A;  1TWG J;  1X2N A;  2Y69 H;  4CYD A;  2YX4 A;  2HI3 A;  1SVM A;  3MFK A;  2KMU A;  3GCM A;  3DLL F;  1MBF A;  2ELH A;  4M6Y A;  2ISZ A;  4N9H A;  1X3U A;  1PUF A;  2QA4 I;  1GVJ A;  2MLK A;  3PIP F;  4Y3O A;  2GAU A;  1WJC A;  1LPQ A;  3M1C A;  2DQL A;  3M8F A;  4WF2 A;  2LNB A;  3GFL A;  1V54 H;  5LHH A;  4I01 A;  3FXR A;  4OOI A;  1D0X A;  3CF5 F;  2IVM A;  2WY7 Q;  2YS9 A;  2NAZ A;  2UXX A;  3F8C A;  5EJC A;  4LB5 A;  3R0A A;  3SXY A;  2O9L A;  5L3B A;  1K79 A;  1U0J A;  5FLX Z;  2XVC A;  2JA5 J;  3AL0 B;  2UZK A;  1HSJ A;  2MLG A;  4BGD A;  4BU2 A;  1FMW A;  5E17 F;  4NC8 A;  1R5H A;  3D5R C;  2FOK A;  3JRE A;  5D6E A;  3I5U A;  2LY9 A;  2EH3 A;  2RNJ A;  1KQ8 A;  2F5E A;  1NG6 A;  4E7S A;  1OYW A;  2HOA A;  5DUI A;  3OIQ A;  2VOP A;  1Z05 A;  1Y6I A;  4EJW A;  3ZCO A;  5TIS C;  4KT5 C;  4WXC A;  1IAW A;  1LE8 B;  4BHP A;  2BW3 B;  3CZ6 A;  3DTK A;  2QM3 A;  3LQQ A;  3SJM A;  4W97 A;  2DW4 A;  4AD9 A;  4C3H J;  4YFN F;  4A3F J;  2DCE A;  4B8X A;  4N4O B;  2D2W A;  3NWS A;  4R79 A;  2CW8 A;  2W4S A;  4Q47 A;  5CPR B;  2QZ8 A;  1APL C;  4M3B A;  2PMZ N;  2IGM A;  3W6J B;  4XL9 A;  3WTX C;  3CLQ A;  4NDL A;  2JZY A;  2VC0 A;  3ZQH A;  3R4K A;  4P55 A;  2V26 A;  1R4M B;  3TQN A;  5K7F A;  2GQQ A;  3KZZ A;  5D5U B;  1MDM B;  2V1D A;  1I6X A;  2ZME A;  4CXF A;  4XNF A;  4XLE A;  4RB2 C;  1R23 A;  2KIF A;  1V5E A;  4O6J A;  3FF5 A;  1LVK A;  5J1U A;  2DA1 A;  2DPD A;  3HJE A;  4MLO A;  2BV6 A;  2KHM A;  4XN3 A;  3CJR B;  1GDT A;  2BE5 F;  4HNT A;  2K4B A;  2X1D A;  2M34 A;  4OIN F;  2MD0 A;  2Y75 A;  2P81 A;  3R60 A;  2M4G A;  4HBL A;  3TOB A;  4ASN A;  2FE3 A;  1YIJ I;  3QYE A;  4C9Y A;  3WE2 A;  2EPF A;  3TP0 A;  2R7U A;  1FIP A;  4PFP A;  4CYC B;  2E19 A;  4BJT A;  3DTE A;  2D1H A;  3ONQ A;  3LNQ A;  1VQM I;  2EBI A;  4JX6 A;  1W0T A;  2NXN B;  2DOE A;  2VBZ A;  1YRN B;  5B1A H;  2LC2 A;  1LKX A;  2VI6 A;  4RB3 C;  4BQO A;  3QAH A;  4FHT A;  4IL6 C;  3GZ6 A;  2ECB A;  4BEH B;  2VLA A;  4II3 A;  1SVO A;  3EPZ A;  3LA2 A;  2NNY A;  4KYW A;  3ZQC A;  2LBF B;  3T8R A;  1U8R A;  4XOT A;  4I6Z A;  3J7A O;  1XGS A;  3RQI A;  5JVT A;  4M6X A;  1MJ9 A;  2F4I A;  2P0W A;  1IC8 A;  1W36 C;  2OTL I;  2IGN A;  1JTX A;  4QPO A;  3FK7 A;  4HYE A;  4ZTJ A;  2RAE A;  4L9N A;  2GXB A;  4E7J A;  4EQQ A;  2EA2 A;  3BQZ A;  4F91 B;  4PSW A;  1FP1 D;  2ICW G;  2M30 A;  1ITY A;  1TNS A;  3FMR A;  5JI6 A;  5E3O A;  3RDI A;  1F5T A;  1IRZ A;  5IY5 H;  2V7F A;  2Y0S A;  2I5U A;  5EGO A;  1RUN A;  1YI2 I;  3TOA A;  3HG9 A;  5EGO B;  3NRV A;  4G6D A;  2R7O A;  2DMQ A;  1P4A A;  2ZXH A;  1B9M A;  5C4J J;  3AG2 H;  4FIS A;  3HBL A;  5H6Q A;  4RMN A;  1T39 A;  2YUS A;  2UXN A;  1ENH A;  3RKX A;  1DPR A;  1X1P A;  1D5Y A;  1R36 A;  2XAH A;  3P9I A;  4IRH A;  2M7A A;  3EUK L;  5CVV A;  2XDV A;  3H35 A;  3REO A;  4IF4 A;  1QO0 D;  3WU1 B;  5J8C A;  2OZ6 A;  2LDU A;  3HPG A;  1ETX A;  2D5V A;  2IA2 A;  1RNL A;  1WJB A;  2VOO A;  4WXD A;  4Z6Y A;  4YEJ A;  1W4M A;  3B6A A;  3HOZ J;  3U1D A;  4M9X A;  4AID A;  3MZY A;  1AKH B;  1F1Z A;  2KZG A;  1MNM C;  2KP6 A;  3DEW A;  4R8H A;  3ZMZ A;  1Z9C A;  4ENJ A;  2VPL A;  5BPD A;  4F52 A;  3OYC A;  1IUF A;  5FFZ A;  3P7N A;  1UCR A;  1I1G A;  3GME A;  4OMY A;  1ZK8 A;  2L9R A;  5FKK A;  3V7S A;  2HOS A;  3J81 K;  4UV9 A;  4M73 A;  3CO6 C;  4LMY A;  3HUG B;  5LGN A;  1HST A;  4M72 A;  3J7Y J;  1WGX A;  3LSH A;  2ME6 A;  1FIA A;  1BI2 A;  1ETK A;  2NVQ J;  2RDP A;  5HOD A;  1MMG A;  3N4M A;  3E6B A;  4IOC F;  1DU0 A;  3FBI B;  5IP7 J;  3H5N A;  1IG7 A;  3HKZ A;  1ZGA A;  5FD6 A;  4H0E A;  1XD7 A;  2BGC A;  2QQA A;  2OC6 A;  3I55 I;  4WWC A;  4RGX A;  2EIN H;  3M8E A;  4MFE A;  2EIK H;  2MAB A;  4KT6 A;  4P9U A;  3F9K A;  4V2G A;  5BNG A;  4BQQ A;  4C2T A;  4UUS A;  2HVQ A;  5IP6 A;  1X1A A;  3DCF A;  1ZN2 A;  4HPQ A;  3G6E I;  1FP2 A;  1YW9 A;  3J7A Y;  1SAN A;  4BJ6 C;  3JTG A;  1P9Q C;  4EEF G;  3V7R A;  2EV0 A;  1U3E M;  3LSG A;  1X4P A;  5JVG F;  3DU5 A;  4XSZ F;  1MJB A;  4RLQ A;  3A1Y A;  5DD8 A;  4F7Z A;  3OYD A;  1A36 A;  3RQ4 A;  2DFH A;  5F6F A;  1TBX A;  3MWM A;  2NS7 A;  3U21 A;  3I56 I;  3HOY J;  1W7P D;  2K3F A;  2MSY A;  5DM6 F;  4IHS A;  1H89 C;  4NNJ A;  2IBD A;  3GO5 A;  1X4O A;  4FX0 A;  4EM1 A;  1JUP A;  4CZZ A;  2NS8 A;  2HDW A;  1RKW A;  2XF7 A;  4UNO A;  1OKR A;  3EQL F;  1G8X A;  1V5G A;  4I7H A;  4EM2 A;  3KFW X;  3QQA A;  5J6X A;  5ILV A;  3CMY A;  1VTN C;  4YEL A;  2XAJ A;  3CC7 I;  3RYP A;  2VQG A;  3F8N A;  5JLX A;  1VQ8 I;  1IGN A;  3GVA A;  5A2Q Z;  4BY7 J;  4FT8 A;  2ETH A;  2ZNY A;  3IV5 A;  1W7P B;  5DEQ A;  4IQ4 A;  1H0M A;  4I2O A;  5HNF A;  2DA7 A;  1WH7 A;  3EET A;  3P9K A;  1HKS A;  1XMA A;  3L00 A;  2JMW A;  3CDL A;  5F64 A;  1R6R A;  2VQH A;  3K4L A;  1D5V A;  2DFE A;  1GXP A;  2Y0M A;  4KNY A;  3ZOB A;  1KON A;  4A3L J;  4EMS A;  3BR5 A;  4RBO A;  4GXO A;  2IS1 A;  2FA5 A;  2K02 A;  2YU9 J;  2BOL A;  1LUJ B;  2W57 A;  3ASN H;  1IRX A;  1XGM A;  3BDD A;  2Z3Y A;  5E79 C;  2WTE A;  1A31 A;  2EWN A;  1FZP B;  1Q1V A;  2PMZ A;  3DLA A;  4DBQ A;  2FXA A;  2KFD A;  2CH0 A;  1MGT A;  5L3E A;  1VQ5 I;  2MBF A;  5F1R A;  4ZTF A;  1MD0 A;  4A3K J;  1RIO H;  3PFY A;  3OYG A;  2QEX I;  1S29 A;  4WXH A;  1A35 A;  3OYK A;  2BHZ A;  5FRN A;  2ZXJ A;  4XON A;  1TL8 A;  4BBR J;  2HOE A;  4CA0 A;  4K2E A;  2TCT A;  2Q1Z B;  2XAU A;  3C2B A;  3QOE A;  5D6F A;  3RPU A;  2B9S A;  3JRF A;  2FNP A;  5JLW A;  4NB5 A;  1OR7 C;  2F5F A;  4RS8 A;  3MEX A;  4E7I A;  1BW6 A;  3WE3 A;  1YS6 A;  4XRF A;  3O8H A;  4ESF A;  1D1A A;  1L3L A;  2ZXI A;  1XMX A;  3DQV C;  4M3E A;  3TO9 A;  2P7C B;  2ACJ A;  4CCO A;  3DPL C;  3HSR A;  3MQ0 A;  4IPA A;  2L4A A;  1Y1W J;  2MC3 A;  2ZKZ A;  1F4K A;  1OPC A;  3P9C A;  4AYB N;  4A3G J;  2B63 J;  1WQ2 A;  4UUT A;  3OL3 A;  3HOS A;  4ZDP A;  2K3P A;  2RQQ A;  3BJA A;  3ZR8 X;  5LHI A;  2A6E F;  2H8W A;  5AIQ A;  3HOV J;  2CU7 A;  4MEY F;  4D5C A;  2LVS A;  1G2H A;  2NS0 A;  1XN7 A;  4E7L A;  2JJ7 A;  5E3N A;  3S2D J;  2OU2 A;  1KU3 A;  4BJ5 C;  5FRO A;  4HDV A;  3LST A;  3DP7 A;  4MFD A;  1I1S A;  4Y7N J;  2Z1D A;  1TQP A;  2EA4 A;  4C3I J;  4EJV A;  1HKT A;  2W82 A;  2HZT A;  3FXK A;  4PDK A;  4ON0 A;  1BOB A;  2DT7 B;  1K6O A;  5J3L A;  2R93 J;  1ODD A;  2HYJ A;  4HG2 A;  3JSP A;  1T8I A;  2KIS A;  3C1D A;  1BC8 C;  5KAF C;  3H9G A;  2V6E A;  1SMY F;  3OYA A;  1RPW A;  1IXC A;  2PJR B;  3GTQ J;  5DCM B;  1QZE A;  2L3D A;  2VOD A;  1YHQ I;  1OYY A;  1X1D A;  4II2 A;  3JRA A;  5TGT A;  4S04 A;  4GFB A;  4KFC A;  3QU6 A;  2I8D A;  2Z33 A;  2GBY A;  4HV5 A;  2I10 A;  4I0A A;  2DOD A;  4B09 A;  2XF6 A;  2EV5 A;  4A3B J;  2M5W A;  1E3H A;  2MH2 A;  3TP3 A;  5H20 A;  1UG2 A;  2K9L A;  2LLK A;  1ULY A;  2V6C A;  3OSF A;  2KT0 A;  3KCC A;  5FRM A;  2JA6 J;  4G94 A;  1YJ9 I;  3BZC A;  4CHU A;  3CDI A;  4U88 A;  2BY3 A;  2EFW A;  4CCL A;  1ETO A;  2ZB9 A;  4XLC A;  3GXO A;  3ML6 A;  2VXD A;  2R5Z B;  2XGX A;  1SFE A;  2V4J C;  4BE0 A;  3GUD A;  1VZ0 A;  1R58 A;  2K9Q A;  4DOZ A;  5TRD A;  3L2W A;  2CV0 A;  3E5Q A;  2JVG A;  2OUM A;  3FHZ A;  4L0Y B;  2KRF A;  2E7W A;  2ZSI B;  2KDZ A;  4L5J A;  2E2H J;  1YLF A;  2VUM J;  4MQV A;  2ZFW A;  3IH3 A;  4L5E A;  3LWF A;  1QQI A;  1WJE A;  3ROU A;  3ZMU A;  4HST A;  4ZYA A;  4XLP F;  3WGH A;  3S1N J;  2P6S A;  1R22 A;  4FCY A;  3FK6 A;  2LOO A;  1KU7 A;  4IKF A;  2R0Q C;  4ZYH A;  1KZH A;  4JP0 A;  4ENN A;  2LF7 A;  2QSF X;  3K9T A;  3I59 B;  3LSK A;  1XB4 A;  2VKD A;  1X3W B;  3GZN B;  1BJA A;  4DW6 A;  3K1P A;  5AON A;  1ZTR A;  3KEO A;  3IH4 A;  4N0B A;  1XDS A;  4MIM A;  2CUF A;  1U9O A;  2KKO A;  5KAI C;  3WTY C;  3OYF A;  2XAQ A;  4IHV A;  2ESN A;  2LY2 A;  3BT9 A;  2XB0 X;  3HPH A;  3A2K A;  5IT9 K;  2VXZ A;  1KQ9 A;  4D7N A;  1X1B A;  3OYJ A;  5HDG A;  3ASO H;  2MD5 A;  4GGG A;  1FPQ A;  1IRG A;  1WCM J;  4FET A;  5BS6 A;  4A3C J;  2QBY A;  2EIM H;  2KZV A;  3IWZ A;  2FBK A;  2L7K A;  2HTS A;  1I3A A;  3JW4 A;  4I99 C;  1N78 A;  3TDU C;  4LG3 A;  4AM3 A;  1ZR4 A;  3Q0U A;  3QYB A;  1AOY A;  2HEO A;  5FJ8 J;  1U5T C;  2K9S A;  2QSG X;  5KVR A;  4X6A J;  2BY2 A;  1TP4 A;  1IN4 A;  1VFC A;  2DDB A;  4HX4 A;  2DT5 A;  4P9F A;  5BPI A;  2OAZ A;  4KN4 X;  3WU2 C;  3OR1 C;  5FFX A;  3GTJ J;  2R7S A;  1TLH B;  1T0F C;  2O61 A;  2VT2 A;  3A0B C;  2A6H F;  1LNW A;  5J1Y A;  1XSX A;  2K5C A;  3SYT A;  2XIG A;  2HS5 A;  1HW5 A;  4C30 A;  3JRD A;  2KPM A;  2Z5U A;  1ERD A;  4IXA A;  2ME0 A;  1YIT I;  4AIJ A;  5CVU A;  3K4J A;  1R5I D;  4OU0 A;  1TT0 A;  2ZBK A;  4BKX A;  4BDY A;  4XR6 A;  2IXS A;  2X1E A;  1VI0 A;  1JHF A;  5EZG A;  2VL8 A;  1EF4 A;  2MW8 A;  2YR2 A;  3DBH B;  2O3F A;  2AO9 A;  1FBQ A;  2CGP A;  1KYZ A;  1VND A;  1XCB A;  3FM5 A;  4D5F A;  3BY6 A;  4B3X A;  3VDX A;  3BJO A;  3HRS A;  2RC4 A;  5JR3 A;  3E5X A;  1ONV A;  2HOT A;  3SQN A;  3SEQ A;  1IDY A;  3OIO A;  5J8F A;  3ESW B;  3QRF F;  3RZO J;  3FDY A;  1TQI A;  2RVC A;  1N25 A;  1AA7 A;  3CTA A;  5ICE A;  3NEU A;  4XKC A;  5IOY A;  3OS2 A;  3JR9 A;  3H5R A;  5D8L B;  1Z67 A;  2DJN A;  5K7Z A;  3U9G A;  1ETQ A;  4L9T A;  2FNA A;  3OMY A;  3O6B B;  3HOW J;  3LFK A;  3AAF A;  3IP4 B;  3FWE A;  1R71 A;  2K85 A;  2IS2 A;  1ZAR A;  2Y2Z A;  2PN6 A;  3O3K A;  2EZH A;  1X19 A;  1R1T A;  4ESJ A;  5CKT A;  4QIW N;  2W85 A;  3SEZ A;  2JVH A;  4E7H A;  2IS6 A;  4YIR X;  4UUV A;  1FLI A;  2F4M B;  2UUZ A;  1FJL A;  1MJA A;  1D3Y A;  2TRT A;  1F36 A;  4BHB A;  3COA C;  3F8F A;  1B8I A;  2R4G A;  4PJ0 C;  2AQE A;  1YX5 A;  2EIJ H;  4ZC3 A;  2FX0 A;  4XKW A;  4HQM A;  3AFH A;  1O3R A;  4KIB A;  1FNN A;  1Y8Q B;  5DV5 A;  4IHT A;  4BYY A;  3OYN A;  3M7G A;  4AYB A;  1JKQ C;  5IP9 J;  1I27 A;  2EFQ A;  2DMU A;  4C2U A;  3PQJ A;  3F8M A;  3VSL A;  4KIS A;  4B1R A;  1HW1 A;  3H3V K;  3M4O J;  3RTR A;  3B02 A;  4IO9 F;  1EH7 A;  3I4N J;  4KIG A;  3V42 A;  1ON2 A;  1P2F A;  2QUF A;  3VEP A;  1PUF B;  3I53 A;  1FYM A;  3A01 A;  2XV4 S;  3VYR B;  1OYI A;  5M5X J;  2PJP A;  3NAR A;  3A01 B;  2CFO A;  3CJQ B;  3IUO A;  2AHQ A;  1WJF A;  4KIF A;  2BY1 A;  5KCM A;  3VYT B;  2A5W A;  1K78 A;  2VKE A;  3BWG A;  1E3P A;  2M1B A;  1K78 B;  3HC7 A;  2KIM A;  2XKO A;  3C18 A;  5GAG J;  1J2X A;  5JFR A;  1VQ6 I;  2X6O A;  2FSW A;  5GPC A;  3VWB A;  3NQO A;  1B6A A;  1X58 A;  2KLO A;  5LRR A;  3IHU A;  2MA3 A;  3VYS B;  1RET A;  3L2V A;  1YQA A;  2YPR A;  1ON1 A;  4Q5S F;  3E6M A;  1ZLK A;  2VBW A;  2DA6 A;  1S7A A;  2M9H A;  5DYM A;  1IV6 A;  5EF6 A;  5LD2 C;  1N75 A;  5HLT A;  3E3V A;  4UVC A;  3SZP A;  5E8I A;  4I76 A;  5J4Y A;  2W00 A;  1U8B A;  3HYI A;  2VC1 A;  1GVD A;  2OZU A;  2ZJQ F;  3B6C A;  1T08 B;  4FE7 A;  4XLA A;  3IH2 A;  4AIK A;  2M7B A;  4ENM A;  4E7Z A;  3PNV A;  5LGT A;  4G9Y A;  2HFH A;  2JPC A;  1WJD A;  5ED4 A;  4Z2Y A;  2LRE A;  4XQF A;  3LQR A;  3HHH A;  3S1R J;  4EV0 A;  4M74 A;  1N77 A;  3KET A;  2RRE A;  2P5L C;  2PMU A;  1S9H A;  1NK3 P;  2W1O A;  3CC4 I;  5JHU A;  4MTD A;  1MBE A;  2STT A;  3HZJ A;  3JRI A;  2OD5 A;  2VBX A;  3DKY A;  3BG5 A;  2ZME B;  1OR7 A;  5M5W J;  2STW A;  1SD5 A;  3E7L A;  2HXO A;  4G7H F;  4XIC A;  4HDU A;  1TWC J;  2PI0 A;  2OQR A;  4IEJ A;  4FTH A;  3MKZ A;  2WWY A;  2EFN A;  1H88 C;  3FIS A;  4Y13 A;  4CCK A;  5J1R A;  4LGW A;  4FAS D;  3RKQ A;  1HDD C;  1JJ8 C;  1K83 J;  3WHB A;  2DU9 A;  5CQE A;  3FMS A;  1VQN I;  2OBP A;  2LD5 A;  3HDD A;  2BXZ A;  2FMY A;  2H6B A;  2PQ8 A;  1V5F A;  4GYG A;  3CUQ C;  2J5P A;  2DI3 A;  5L3D A;  4OIR F;  3ZXS A;  1UHM A;  4BE1 A;  1POG A;  5B66 C;  2R7R A;  5C4X J;  1UAA A;  4BNC A;  1Z7L A;  2X9D A;  3RCO A;  3FXM A;  4WX9 A;  2XRL A;  1SC7 A;  1BA5 A;  1LFB A;  3QOD A;  3E5U A;  5D4R A;  1IDZ A;  2RNG A;  2G9W A;  1MSE C;  2OF7 A;  1YG2 A;  3ZQF A;  5E3L A;  1K6Y A;  2J5O A;  1ZGW A;  3CLO A;  1BR2 A;  5HS9 A;  1ZKG A;  3HIF A;  3WG9 A;  4B3A A;  4CO8 A;  1G3S A;  3ISP A;  4Y52 J;  3M9A A;  2R7V A;  1R5G A;  2DOA A;  2EFP A;  2L9V A;  1BR4 A;  1YS7 A;  4P96 A;  2QWW A;  1DGW Y;  4E70 A;  2O8X A;  4NQW A;  4ABZ A;  3BP8 A;  4A69 C;  2JQ7 A;  1PP8 F;  1OCR H;  2ZNZ A;  2G0E A;  3ZN0 A;  1I39 A;  1SFX A;  2IPQ X;  3BR2 A;  3F72 A;  3KIO A;  4RAG A;  3JAM K;  3HL2 A;  1T98 A;  4LIV A;  3K70 C;  2Q8K A;  4BL0 B;  2ID6 A;  3WU0 A;  1D8J A;  4NUB A;  3OSG A;  1U6G A;  2QKM B;  5FKM A;  3PNT A;  4HLY A;  1T6S A;  4A5N A;  6PAX A;  1P6R A;  4CCJ A;  4E6K G;  2X85 A;  4BE2 A;  1FEX A;  3H9Q A;  2E71 A;  3VOD A;  3CCV I;  2CUZ A;  2JUG A;  2RKH A;  2CSO A;  3MKL A;  1IXR C;  5D5W B;  2NRA C;  5C44 J;  3QPS A;  1HDP A;  3TBI A;  3CES A;  2VQC A;  2MG4 A;  4R1H A;  2MC4 A;  2VON A;  5IOZ A;  2LP0 A;  2IA1 A;  2Y9Y A;  3UNG C;  1KU9 A;  1G3W A;  2KRC A;  2LMD A;  3BG7 A;  3ECO A;  4W1U A;  3OR2 C;  5DDG A;  1NHA A;  2YU3 A;  5D5X B;  5F04 A;  3DEE A;  2OV7 A;  2R7X A;  3BTJ A;  2GZW A;  2ELK A;  3Q9S A;  4M3F A;  3P5J A;  1Q1H A;  3GTP J;  2DA5 A;  2L9N A;  3LSP A;  3O8G A;  1RC9 A;  3FXJ A;  2LYC A;  4OWR B;  4ZZL A;  1S3J A;  2PFB A;  3V4G A;  2K7L A;  1VQ4 I;  3FKJ A;  4PCQ A;  5LLQ A;  3CC2 I;  3ULQ B;  1PUE E;  2LSO A;  4AVZ A;  2X51 A;  5M5Y J;  4XOR A;  4UUS B;  3BG6 A;  1WI3 A;  1DGR M;  3F0C A;  3F6V A;  5GAE J;  4H4K C;  2QQ8 A;  1SD7 A;  3BCA A;  2IAI A;  3MVP A;  4BXF A;  1ETW A;  4IHW A;  5IPA A;  3ERE D;  1ZEL A;  2BEO A;  2ZC2 A;  2ZJP F;  1XTA A;  2NYX A;  4O3M A;  1Y56 A;  1FOY A;  1BM9 A;  2LK2 A;  4I02 A;  3IL2 A;  4ITV A;  3BZK A;  4G7O F;  4Q48 A;  2HQ5 A;  4CCM A;  1U5T A;  4GCV A;  3WGI A;  4NHJ A;  3K2Z A;  1IUY A;  2CUE A;  2DN0 A;  4KJZ A;  3BQY A;  3UR3 C;  3GFJ A;  4PJN A;  4PJM A;  4B43 A;  2H1L A;  3KP4 A;  3LA7 A;  4XKV A;  1T0F A;  5J40 A;  2VJ4 A;  1UHW A;  4YIF A;  5H6R A;  2HVS A;  3OYM A;  3EDP A;  1VQP I;  4HW0 A;  4ZYD A;  3OL4 A;  5K5R A;  1BI1 A;  3BZ6 A;  2PBI A;  4RDU A;  1FWZ A;  3L1P A;  2WBM A;  2JRT A;  1W1W E;  5KK1 A;  4LLN A;  3I9V 2;  3L2U A;  3BR3 A;  2KQR A;  3IKV A;  1YX3 A;  5FKL A;  4AIH A;  2ZFU A;  1R4N B;  3DBR B;  4D7M A;  4RM2 A;  5M3M J;  3OYH A;  3H0G J;  1QZY A;  2CWE A;  5E1Z B;  1AU7 A;  2WA0 A;  3FZV A;  4LK0 F;  3AL0 C;  4HF2 A;  1RRJ A;  2DPU A;  2XRO A;  2LTP A;  2JA7 J;  3KP2 A;  2JN6 A;  3FKI J;  4A6E A;  2FBI A;  2WY8 Q;  3PL8 A;  2PEX A;  1OMI A;  4M3G A;  1XGO A;  3PO3 J;  1HW2 A;  1O7L A;  2VBY A;  2Q2E A;  3RPU D;  4XLH A;  2XGD A;  4P1W A;  2XSD C;  3HB9 A;  2NVT J;  5FB2 A;  1BBY A;  2YX7 A;  5DM7 F;  1EV7 A;  1TTY A;  2OPT A;  1OCZ H;  3DTI A;  3PSF A;  5E18 F;  1IF1 A;  3CUO A;  2ZXW H;  2WAD A;  4A0Y A;  2VQL A;  2CV2 A;  4QTR A;  4DGW B;  3H3Z A;  2XPV A;  1JE8 A;  1OCO H;  3KYD B;  1BIA A;  5CVJ A;  5E8G A;  3OYB A;  2DLL A;  3MD2 A;  1G59 A;  3Q0V A;  1DP7 P;  1EJ9 A;  5B1B H;  4KMF A;  4EM0 B;  1LFP A;  1J59 A;  3MMY B;  1W5T A;  4I0B A;  2DYS H;  2KDO A;  4LD5 A;  1ZRE A;  2A69 F;  3U1K A;  1QRY A;  1D1C A;  4GRI A;  4RAF A;  3KZI C;  1Z0X A;  2H6C A;  4MGR A;  2QEN A;  1IO2 A;  2DFI A;  3EYI A;  3AG4 H;  1V55 H;  4XRM A;  1SAU A;  3D5S C;  3Q0W A;  3FBN B;  2V79 A;  3Q9V A;  2VB6 A;  2O03 A;  1O3T A;  3GTL J;  4XKB A;  3OOP A;  5ILS A;  3TKY A;  2M2E A;  3W6K B;  3WTV C;  1VQO I;  1B1B A;  2EIL H;  1DQU A;  3MZ8 A;  1R49 A;  2E7X A;  3BR6 A;  3EUH C;  4BUP A;  2O5R A;  4J00 A;  5HS8 A;  3VB2 A;  3ZN1 A;  3TL4 X;  4ZYE A;  3GYH X;  1HXD A;  4LLL A;  2HGC A;  2RQP A;  3WG7 H;  2HVR A;  1UMQ A;  1Y0N A;  3GBG A;  3H5A A;  1FX7 A;  4MQ9 F;  5E1X A;  3KP5 A;  3CME I;  3FMQ A;  3EUA A;  1DU6 A;  1WVR A;  1LQ1 A;  1TW2 A;  3WTS C;  2L2O A;  4DYC A;  2H27 A;  3OS1 A;  1MIJ A;  2QGU A;  4G12 A;  2QSH X;  3M3Y J;  3LAP A;  1Z77 A;  5K5Q A;  1ZRC A;  1QU3 A;  2CRG A;  1G3Y A;  1ZLJ A;  1TWF J;  3CQZ J;  1U2W A;  2M3A A;  3ZMD A;  3DU6 A;  1HCR A;  4L5I A;  2KJB A;  2VPR A;  2IRF G;  1JUM A;  2R5Y A;  3HRU A;  4RGR A;  1O3S A;  2HYF A;  1YW7 A;  1ZYR F;  4RA2 A;  2R5Y B;  1T95 A;  2DO7 A;  3PJR A;  3K4K A;  5FD5 A;  5L3G A;  2KIU A;  3E6D A;  3L2R A;  5EYR A;  2VIX A;  2IJL A;  4EJO A;  1MBH A;  4DNC A;  1ZHF A;  1JJ6 C;  1Z91 A;  1NTC A;  3GLL A;  1HOM A;  2E1C A;  5CVI A;  3TDZ C;  1E17 A;  4G7Z F;  4UY8 I;  5LEJ A;  1WWX A;  1AHD P;  4F55 A;  1BN5 A;  5KNL A;  2DYR H;  4PZJ A;  4XLF A;  4BH9 A;  2CQX A;  3L7W A;  4IRI A;  4HX8 A;  3SFZ A;  1VQ7 I;  2QYO A;  1BI3 A;  3HSF A;  5FLM J;  3ZP5 A;  3K1N A;  4EGY A;  4IZZ A;  1FMV A;  4OIQ F;  2FRH A;  4B47 A;  2KRH A;  4LG0 A;  1B59 A;  5BMZ A;  2Y48 A;  4CDG A;  3CUQ A;  5LBQ A;  2VJJ A;  1W36 D;  3V8J A;  3RPQ A;  1JXS A;  1S6L A;  3C7J A;  1SFU A;  2PX9 A;  2AXL A;  3S32 A;  4HSR A;  4RAY A;  2VE9 A;  1FOX A;  3K69 A;  3VYU B;  1LEB A;  1QGP A;  1FY7 A;  2F5D A;  2ZO4 A;  5LHG A;  2OQG A;  1H9T A;  1RR8 C;  2E2J J;  2DK8 A;  2ECC A;  4B44 A;  4G8X A;  3G71 I;  3WGG A;  1MMS A;  2WC2 A;  1OLT A;  2GOM A;  1QPM A;  4N9I A;  3QPH A;  5M3F J;  2GM4 A;  4IHY A;  4EGZ A;  4A0Z A;  4I98 B;  3AG3 H;  3HM5 A;  4XMY A;  1B72 A;  4J01 A;  2MGQ A;  1STZ A;  2GLO A;  1B72 B;  5LFA A;  1XX5 A;  3J7Z I;  2R7W A;  2QBY B;  4BY1 J;  4FQG A;  2Z99 A;  2ISY A;  1MH3 A;  3GTM J;  5EEG A;  1T33 A;  4RB1 A;  1FTT A;  1F9N A;  2XAG A;  3UKG A;  1J09 A;  4Y15 A;  3S93 A;  4A12 A;  4LB6 B;  3BOQ A;  3J80 K;  2LH9 A;  4JK1 X;  5ILU A;  1W0U A;  2F4O B;  2L7M P;  5CVR A;  3TW6 A;  4A3J J;  1MZB A;  5IT3 A;  2WAQ A;  1J7K A;  2EZL A;  2QVO A;  3OOU A;  4UHT A;  3K10 A;  1JKO C;  4TV7 A;  4S0H B;  3QYF A;  4HOB A;  1JKP C;  2FEZ A;  1OQY A;  3CCS I;  1K61 A;  4AVP A;  4V2F A;  1FOW A;  3H3U A;  4OAZ A;  4HNU A;  3F3X A;  2P4W A;  4HF0 A;  5EEA A;  3LSR A;  4BDZ A;  3DKW A;  4XBF A;  2DDA A;  4PFO A;  1IV8 A;  1P4X A;  2V9V A;  4RAZ A;  3OYI A;  2A05 A;  2G7H A;  2F48 A;  5IYC J;  1O7F A;  3GX4 X;  3QU3 A;  2P7V B;  1J0R A;  3K2A A;  1C0W A;  1Z3X A;  2WAF A;  2ZCW A;  1LFU P;  3CCE I;  2HYG D;  5BQT A;  2M8G X;  1JUS A;  1R9T J;  4RGU A;  2IGO A;  5E3M A;  1VF9 A;  1UHS A;  5HLI A;  2MH9 A;  2DAO A;  4ZJZ A;  1WH5 A;  5HNH A;  1XSD A;  4U0Y A;  3S3N A;  3HGG A;  3I4P A;  4M9S A;  5B5E C;  4XLN F;  2E5N A;  3BPX A;  2VAS A;  1KA8 A;  5CYV A;  2LF8 A;  4ZZD A;  1J75 A;  1W5C C;  2HWV A;  1HKQ A;  1FSE A;  3I0T A;  2HPI A;  3IRR A;  3HSE A;  3CP8 A;  4BXX J;  3KEQ A;  1Z6T A;  1D8K A;  1OCC H;  5J4V A;  3KX2 A;  3E1S A;  1L0O C;  3E6C C;  2XKP A;  5EG0 A;  1ZG1 A;  2K40 A;  5LRS A;  4OIP F;  1ACI A;  2O7O A;  2IW5 A;  1NG7 A;  1UFM A;  2JSC A;  1Y1V J;  2JSP A;  2H09 A;  4M71 A;  1YO5 C;  2RGV A;  1B8I B;  4FE4 A;  2L9S A;  1JTY A;  4CGZ A;  4AU7 A;  2WV1 A;  1JI8 A;  2KIQ A;  4L0Z B;  1USS A;  2PG4 A;  1ZQ3 P;  1O4X A;  1K4T A;  3ZMS A;  2F2E A;  2VE8 A;  5GAD J;  5GAH J;  2A3S A;  1Y0U A;  1A6Q A;  3KP3 A;  3OYL A;  4NC6 A;  3G1M A;  2RV8 A;  1WRJ A;  3HTU A;  2W84 A;  4LFU A;  3ZPL A;  1IRF A;  2IS4 A;  3OY9 A;  2CQQ A;  4E7K A;  4KA4 A;  1FBS A;  3PO2 J;  2CG4 A;  2X4H A;  2M4K A;  1T38 A;  4IQJ A;  3HOU J;  2CQ7 A;  3S15 J;  3HOX J;  2CFX A;  2CUJ A;  1WI9 A;  2M0M A;  1IN5 A;  4Y33 A;  2FBH A;  1Z21 A;  3TGN A;  4ANJ A;  2W7N A;  1S7E A;  2P6T A;  1MKM A;  1YIO A;  2FU4 A;  1REP C;  3AG1 H;  3WTZ A;  1U78 A;  3SZT A;  2R7T A;  2FQ3 A;  4G6T B;  3JRG A;  3EYY A;  4Q4Z F;  3WHC A;  3B73 A;  2K9M A;  4D9J A;  1Z3Y A;  2DA2 A;  4G6Q A;  4DZP A;  4PGG A;  4HQE A;  2C6Y A;  1SMT A;  3CCU I;  1WSU A;  2CV1 A;  1TNT A;  3ABU A;  2E1M C;  2NOJ B;  2AQF A;  3RJP A;  2GIZ A;  3LSM A;  2EZI A;  2BVM A;  2CMP A;  4UVB A;  4EJU A;  4UB8 C;  1ORK A;  2XB5 A;  1MMA A;  1V3F A;  2JWT A;  2QLZ A;  1LE8 A;  2VJ5 A;  2BW3 A;  4L9J A;  1G4D A;  1FTZ A;  2D45 A;  1V4R A;  2K86 A;  4U7B A;  3BLY A;  3SFI A;  1IZ1 A;  3DPU A;  1RUO A;  2X6X A;  3VFZ A;  1OJL A;  4YRV A;  2EV6 A;  5BOX A;  4IHX A;  3F22 A;  1MMN A;  3MCZ A;  4LK1 F;  3PQK A;  5HDN A;  2W48 A;  2UV1 A;  3GFM A;  2L7Z A;  1R1V A;  1BIB A;  1MDM A;  2Q0O A;  1MBJ A;  1T2K A;  1TW3 A;  3GTG J;  4ETS A;  5JHF A;  5FLX K;  2LRD A;  2DTZ A;  2LKS A;  3V8L A;  4PUS A;  2CQN A;  3CDH A;  4A93 J;  2W24 A;  3K1M A;  1TT5 B;  2YSR A;  4DQ2 A;  1HBX G;  4JOM A;  2G7U A;  1XGN A;  3JCU C;  4RGS A;  3S14 J;  3RSN A;  1O57 A;  4HNV A;  1K7A A;  1PVE A;  4QLC U;  2R7Z J;  3KP6 A;  3JAM Z;  2OJE D;  2XC7 A;  2F5C A;  2COM A;  1QHH D;  4PSX A;  1GXQ A;  4ENK A;  1VQK I;  4ZDL A;  4BQA A;  1I5Z A;  4MO7 A;  4Y17 A;  4S05 A;  3WTW C;  2DFF A;  4HEA 2;  2HTJ A;  4CYC A;  2NOG A;  3CMA I;  3DKX A;  1MMD A;  2P8T A;  3G3Z A;  2KJC A;  4EAT A;  3EUH A;  1YRN A;  1P92 A;  2EK5 A;  5ICG A;  3KLN A;  4BHC A;  1BJZ A;  2DQR A;  2Y30 A;  3FXO A;  1ZR2 A;  1MBG A;  1EKE A;  3A03 A;  4KN7 X;  5D5V B;  4BEH A;  3R61 A;  1XDU A;  4YG2 F;  5LGU A;  1UST A;  3IKT A;  2V1X A;  4BBS J;  2DA4 A;  4M6V A;  3W3C A;  3QPL A;  3I54 A;  1R00 A;  3K4B A;  2O8K A;  2LBF A;  2PMH A;  4HRI A;  1YJW I;  5EDN A;  4GYI A;  2EFO A;  1Z1D A;  2VT3 A;  4RM3 A;  3H9J A;  4OAY A;  2OA4 A;  2CW0 F;  1UEL B;  4YFX F;  2M45 A;  5F27 A;  3HOT A;  2VN2 A;  1YJN I;  2IGK A;  1MH4 A;  2LKP A;  3RKY A;  4CH7 A;  4E4H A;  2EZK A;  3J81 Z;  3H92 A;  4NQW B;  1MW7 A;  4DZJ A;  1JT6 A;  3SHF A;  2LKX A;  4PK4 A;  1LB2 A;  2O6G E;  2GXG A;  2HKO A;  3BG9 A;  3H1C A;  3A0H C;  5F08 A;  2E2I J;  4AWX B;  3T0Y A;  1ETV A;  2XPW A;  4XN0 A;  3DF8 A;  3WTT C;  3S2H J;  2BY0 A;  3KEY A;  1RES A;  2CW7 A;  1CF7 A;  4YFK F;  2K4J A;  4NBQ A;  3N97 A;  5E20 A;  4A3D J;  4MHG A;  1CF7 B;  4HF1 A;  1MNE A;  1ZG5 A;  1R7J A;  3E0J B;  3PFI A;  5TJJ A;  3CCJ I;  3PIO F;  3TED A;  2P5V A;  3LSJ A;  3O2P E;  2H8R A;  5EEH A;  2BHY A;  2FML A;  1IW7 F;  3Q5F A;  1BR1 A;  3I64 A;  1RKT A;  3A4C A;  3I3L A;  4PJL A;  2HR3 A;  5HLH A;  2EQR A;  3F21 A;  3RIR A;  4A3I J;  4IX7 A;  4DBR A;  5K7H A;  1MSF C;  2X1C A;  3JSO A;  2R92 J;  1KQ0 A;  2E5Z A;  4UV8 A;  2ZSH B;  5CLS A;  3K4C A;  4A0X A;  1AKH A;  1NH3 A;  2NVX J;  2BZT A;  2IP2 A;  5F0C A;  2FJ1 A;  1D1B A;  2DMT A;  3S1M J;  1SD6 A;  3ZGK A;  4FX4 A;  3FXQ A;  3S17 J;  2X0L A;  3DEU A;  3HGY A;  4PJJ A;  1A04 A;  1MBK A;  2WB1 N;  3H0D A;  4QSH A;  3S2W A;  4C2M J;  1SFO J;  2IT0 A;  4F92 B;  1BI0 A;  3HUG A;  1ZH5 A;  4XRS G;  5D4S A;  3CCL I;  5ICF A;  4NC7 A;  1IN8 A;  2K27 A;  1IXS B;  4XOP A;  4DYR A;  1LVA A;  1IN7 A;  2CYY A;  1KU2 A;  2A5Y B;  2FD5 A;  3C2H A;  3GEZ A;  3HRM A;  4MEX F;  1TC3 C;  2HZD A;  4P5O A;  3GWZ A;  2F6C A;  3KLO A;  3GF2 A;  2XGE A;  3OWT A;  2Y31 A;  4EJT A;  3IAS 2;  2D1V A;  2LG4 A;  4KIT B;  3OS0 A;  1CQT A;  3GZ5 A;  1VQL I;  2VJI A;  1HLV A;  1P7J A;  2FUG 2;  1QNT A;  1U5T B;  4A5M A;  4IOA F;  2H94 A;  4A3M J;  1HC8 A;  3ECH A;  4N4N B;  4L18 B;  5K1Y A;  2CO5 A;  1B9N A;  2NNN A;  4GO1 A; 
#chains in the Genus database with same CATH homology
 2XUB A;  2L01 A;  4QWQ A;  3BPV A;  3VOE A;  3OV8 A;  4OIO F;  3QOP A;  2PLY A;  5D8K B;  3RI4 A;  1W7P A;  1FT9 A;  5L3F A;  4HZF A;  4A6D A;  4IRG A;  3E97 A;  1LJ9 A;  3F23 A;  2O0Y A;  4IJA A;  1LDJ A;  3L2C A;  1W5S A;  2AS5 F;  2L4M A;  4ESB A;  2DBB A;  1S8N A;  2L54 A;  3R6S A;  1JHH A;  1ZG3 A;  2XAF A;  4KDP A;  3M1E A;  1FOK A;  3DPT A;  4U7D A;  1PDN C;  2CQK A;  5A2Q K;  2GIV A;  1DDN A;  3IC7 A;  3QPT A;  3T8T A;  4A2U A;  4MTE A;  1SAX A;  1SD4 A;  3DXJ F;  5DUK A;  4WK8 F;  4D0P A;  5ERI A;  3I71 A;  1G6N A;  5L3C A;  3FM3 A;  5DCF A;  4IVN A;  4JBA A;  2HDC A;  3C3W A;  2W25 A;  2HQN A;  4HV6 A;  5LEK A;  4HLX A;  5HOO A;  4KIC A;  2DK5 A;  1WKM A;  1HQC A;  3KP7 A;  4YII A;  3L9F A;  3D5L A;  4L9V A;  2JT1 A;  3F6O A;  3G73 A;  3T1B A;  1G3T A;  4OMZ A;  2Z9O A;  3FX3 A;  3T5X A;  1DPU A;  2JTV A;  2GWR A;  1P4W A;  2UWM A;  5DCM A;  1JGS A;  4LJZ F;  2L02 A;  2ZJ2 A;  3RKW A;  4M9Z A;  4HX7 A;  3QP6 A;  1QBJ A;  2GA1 A;  2P5K A;  5IT9 Z;  3V7C A;  3LAJ A;  3KZY A;  2V1U A;  1LEA A;  1QZZ A;  3ZMV A;  1KYW A;  4EVI A;  3LA3 A;  5ICC A;  1BC7 C;  3RYR A;  4LLG F;  3IRQ A;  4PGH A;  2E1N A;  4CIC A;  1S7O A;  2BBY A;  4RB0 A;  2QQ9 A;  5E1W A;  3R0J A;  3J80 Z;  1ZGJ A;  5HS7 A;  1Z6R A;  1E2X A;  1CGP A;  4LG0 B;  4ZYG A;  3CUQ B;  3FXU A;  3WTU C;  1IN6 A;  2R3S A;  5AIP A;  3QP5 A;  2FF4 A;  1Z7U A;  4U0W A;  1EH6 A;  1YYV A;  2RN7 A;  1ZRF A;  1ZRD A;  2M87 A;  1LDD A;  3I59 A;  3ZMT A;  3F8B A;  3DFG A;  4U0V A;  3TO6 A;  1LDK B;  1EH8 A;  3CJN A;  3HHG A;  1FYL A;  4HA8 A;  2R7D A;  5FO5 A;  1TQM A;  5DD4 A;  1O3Q A;  4JQF A;  2EJR A;  4UXN A;  1YFH A;  3BJ6 A;  3ZQ7 A;  1FYK A;  1H9G A;  5HDK A;  3CO7 C;  2ADU A;  2B0L A;  1YW8 A;  4XSX F;  3I58 A;  4KUM A;  3V8K A;  2TDX A;  3WOD F;  1J5Y A;  1FBU A;  4BAY A;  2XRN A;  1FC3 A;  1ZAO A;  1I1S A;  3TO7 A;  2XHK A;  5HVQ C;  2M8E A;  3HTS B;  2DTR A;  4ZH4 F;  1YTY A;  2IA0 A;  5HLG A;  1DUX C;  3ABT A;  3MAJ A;  2EB7 A;  1R1U A;  2R7F A;  4KMU X;  2HQR A;  1PP7 U;  1GHC A;  5K5O A;  3ELK A;  2A61 A;  4BXU A;  2ESH A;  3MZH A;  4UVA A;  2A07 F;  3HRT A;  1KGS A;  4WCG A;  3KE2 A;  2A68 F;  3BRO A;  2BYV E;  1XCV A;  1B4A A;  1AWC A;  3K0L A;  1UB9 A;  2XAS A;  3L09 A;  3GLX A;  2GA2 A;  4O5V A;  2JPB A;  1FSH A;  3DV8 A;  1BOA A;  3JTH A;  3U2R A;  3GW2 A;  3GFI A;  1XSV A;  2QQB A;  1RI7 A;  4I09 A;  1RZ4 A;  2WV0 A;  5CJ9 A;  3IWF A;  4HAM A;  4MNU A;  1J9I A;  2HKX A;  5FGM A;  1XMK A;  3D0S A;  4CYD A;  2YX4 A;  3MFK A;  2ELH A;  4M6Y A;  2ISZ A;  4N9H A;  1X3U A;  1GVJ A;  2MLK A;  2GAU A;  2DQL A;  3M8F A;  4WF2 A;  2LNB A;  3GFL A;  5LHH A;  4I01 A;  3FXR A;  4OOI A;  2IVM A;  2NAZ A;  2UXX A;  3F8C A;  4LB5 A;  3R0A A;  3SXY A;  5L3B A;  1K79 A;  5FLX Z;  2XVC A;  2UZK A;  1HSJ A;  2MLG A;  5E17 F;  1R5H A;  2FOK A;  5D6E A;  3I5U A;  2RNJ A;  1KQ8 A;  2F5E A;  1OYW A;  5DUI A;  2VOP A;  1Z05 A;  4EJW A;  4KT5 C;  4WXC A;  1IAW A;  4BHP A;  2QM3 A;  3LQQ A;  2DW4 A;  4AD9 A;  4YFN F;  4B8X A;  2D2W A;  4R79 A;  4Q47 A;  2QZ8 A;  3W6J B;  3WTX C;  2JZY A;  2VC0 A;  3R4K A;  4P55 A;  3TQN A;  2GQQ A;  3KZZ A;  5D5U B;  1MDM B;  2V1D A;  1I6X A;  2ZME A;  4CXF A;  4RB2 C;  1R23 A;  2KIF A;  4O6J A;  3FF5 A;  2DPD A;  2BV6 A;  2BE5 F;  2K4B A;  4OIN F;  2Y75 A;  3R60 A;  4HBL A;  4ASN A;  3TOB A;  2FE3 A;  3WE2 A;  2D1H A;  2VBZ A;  4RB3 C;  3QAH A;  4FHT A;  3GZ6 A;  3LA2 A;  2NNY A;  4KYW A;  3T8R A;  1U8R A;  3J7A O;  1XGS A;  5JVT A;  4M6X A;  1MJ9 A;  4HYE A;  4L9N A;  2GXB A;  4EQQ A;  2EA2 A;  1FP1 D;  2M30 A;  1TNS A;  3FMR A;  5JI6 A;  3RDI A;  1F5T A;  1RUN A;  3TOA A;  3NRV A;  4G6D A;  1P4A A;  1B9M A;  5H6Q A;  1T39 A;  2UXN A;  3RKX A;  1DPR A;  1R36 A;  2XAH A;  3P9I A;  4IRH A;  5CVV A;  3REO A;  4IF4 A;  1QO0 D;  3WU1 B;  5J8C A;  2OZ6 A;  2LDU A;  2IA2 A;  1RNL A;  2VOO A;  4WXD A;  1W4M A;  3U1D A;  4M9X A;  3MZY A;  1F1Z A;  4R8H A;  3ZMZ A;  1Z9C A;  4ENJ A;  5BPD A;  5FFZ A;  3P7N A;  1UCR A;  1I1G A;  4OMY A;  3V7S A;  3J81 K;  4UV9 A;  4M73 A;  3CO6 C;  4LMY A;  5LGN A;  1HST A;  4M72 A;  1BI2 A;  2RDP A;  3N4M A;  3E6B A;  1ZGA A;  5FD6 A;  4H0E A;  1XD7 A;  2BGC A;  2QQA A;  4WWC A;  4RGX A;  3M8E A;  4P9U A;  1ZN2 A;  1FP2 A;  1YW9 A;  3JTG A;  3V7R A;  2EV0 A;  1U3E M;  4XSZ F;  1MJB A;  5DD8 A;  4F7Z A;  5F6F A;  1TBX A;  3MWM A;  1W7P D;  4IHS A;  3GO5 A;  4FX0 A;  4EM1 A;  4CZZ A;  4UNO A;  1OKR A;  3EQL F;  5J6X A;  4I7H A;  4EM2 A;  5ILV A;  3KFW X;  1VTN C;  2XAJ A;  3RYP A;  3F8N A;  3GVA A;  5A2Q Z;  4FT8 A;  2ETH A;  2ZNY A;  4I2O A;  1W7P B;  5DEQ A;  1H0M A;  3EET A;  3P9K A;  1HKS A;  1XMA A;  3L00 A;  5F64 A;  1D5V A;  1GXP A;  2Y0M A;  4KNY A;  4EMS A;  4GXO A;  2FA5 A;  2K02 A;  2W57 A;  3BDD A;  1XGM A;  2Z3Y A;  2WTE A;  2EWN A;  1FZP B;  2FXA A;  1MGT A;  5L3E A;  2MBF A;  5F1R A;  1MD0 A;  1RIO H;  1S29 A;  4WXH A;  2ZXJ A;  2HOE A;  4K2E A;  5D6F A;  3RPU A;  2FNP A;  4NB5 A;  2F5F A;  4RS8 A;  3MEX A;  3WE3 A;  1YS6 A;  4XRF A;  4ESF A;  1L3L A;  3DQV C;  3TO9 A;  2P7C B;  2ACJ A;  3DPL C;  3HSR A;  3MQ0 A;  4IPA A;  2L4A A;  2MC3 A;  2ZKZ A;  1F4K A;  1OPC A;  3P9C A;  1WQ2 A;  3HOS A;  3BJA A;  5LHI A;  2A6E F;  5AIQ A;  4MEY F;  2NS0 A;  1XN7 A;  2OU2 A;  1KU3 A;  4HDV A;  3LST A;  3DP7 A;  1TQP A;  2EA4 A;  4EJV A;  1HKT A;  2HZT A;  4PDK A;  4ON0 A;  1K6O A;  1ODD A;  3JSP A;  3C1D A;  1BC8 C;  1SMY F;  1IXC A;  5DCM B;  2L3D A;  2VOD A;  1OYY A;  4S04 A;  4KFC A;  3QU6 A;  2Z33 A;  4HV5 A;  4I0A A;  4B09 A;  2EV5 A;  2M5W A;  2MH2 A;  5H20 A;  1ULY A;  2V6C A;  3KCC A;  4G94 A;  4CHU A;  4U88 A;  2EFW A;  3GXO A;  3ML6 A;  2XGX A;  1SFE A;  3GUD A;  1R58 A;  5TRD A;  3E5Q A;  3FHZ A;  4L0Y B;  2KRF A;  2E7W A;  4L5J A;  1YLF A;  4MQV A;  2ZFW A;  3LWF A;  1QQI A;  3ROU A;  3ZMU A;  4XLP F;  3WGH A;  2P6S A;  1R22 A;  1KU7 A;  4ZYH A;  4ENN A;  2LF7 A;  3K9T A;  3I59 B;  1XB4 A;  1BJA A;  3K1P A;  5AON A;  3KEO A;  4N0B A;  1XDS A;  2KKO A;  3WTY C;  2XAQ A;  2ESN A;  5IT9 K;  2VXZ A;  1KQ9 A;  5HDG A;  2MD5 A;  4GGG A;  1FPQ A;  1IRG A;  5BS6 A;  2QBY A;  3IWZ A;  2FBK A;  2HTS A;  3JW4 A;  3TDU C;  1AOY A;  2HEO A;  1U5T C;  5KVR A;  1IN4 A;  4HX4 A;  2DT5 A;  4P9F A;  5BPI A;  2OAZ A;  4KN4 X;  5FFX A;  1TLH B;  2O61 A;  2VT2 A;  2A6H F;  1LNW A;  1XSX A;  2XIG A;  2HS5 A;  1HW5 A;  2Z5U A;  4IXA A;  4AIJ A;  5CVU A;  4OU0 A;  2ZBK A;  1JHF A;  2YR2 A;  2O3F A;  1FBQ A;  2CGP A;  1KYZ A;  1XCB A;  3FM5 A;  3BY6 A;  3BJO A;  3HRS A;  2RC4 A;  5JR3 A;  3E5X A;  1ONV A;  3SQN A;  5J8F A;  3QRF F;  1TQI A;  2RVC A;  3CTA A;  5ICE A;  3NEU A;  5D8L B;  3U9G A;  4L9T A;  2FNA A;  3O6B B;  3LFK A;  3AAF A;  3FWE A;  1ZAR A;  2PN6 A;  3O3K A;  1R1T A;  4ESJ A;  2W85 A;  4UUV A;  1FLI A;  1MJA A;  1D3Y A;  4BHB A;  3COA C;  3F8F A;  4HQM A;  1O3R A;  4KIB A;  1FNN A;  4IHT A;  5DV5 A;  4BYY A;  3M7G A;  1I27 A;  2EFQ A;  3PQJ A;  3F8M A;  1HW1 A;  3RTR A;  3B02 A;  1EH7 A;  4KIG A;  1ON2 A;  1P2F A;  2QUF A;  3VEP A;  3I53 A;  1FYM A;  2XV4 S;  1OYI A;  2PJP A;  4KIF A;  1K78 A;  3BWG A;  2M1B A;  1K78 B;  2KIM A;  2XKO A;  3C18 A;  1J2X A;  5JFR A;  2FSW A;  3NQO A;  1B6A A;  5LRR A;  3IHU A;  2MA3 A;  1YQA A;  2YPR A;  1ON1 A;  4Q5S F;  3E6M A;  1ZLK A;  2VBW A;  1S7A A;  5DYM A;  3E3V A;  4UVC A;  3SZP A;  5E8I A;  3HYI A;  2VC1 A;  2OZU A;  4AIK A;  4ENM A;  5LGT A;  4G9Y A;  2HFH A;  2JPC A;  5ED4 A;  4Z2Y A;  3LQR A;  3HHH A;  4EV0 A;  4M74 A;  3KET A;  2P5L C;  2PMU A;  5JHU A;  4MTD A;  2STT A;  2OD5 A;  2VBX A;  2ZME B;  1OR7 A;  2STW A;  1SD5 A;  4G7H F;  4HDU A;  2PI0 A;  2OQR A;  2WWY A;  2EFN A;  4Y13 A;  4LGW A;  2DU9 A;  3FMS A;  2OBP A;  2FMY A;  2H6B A;  2PQ8 A;  4GYG A;  3CUQ C;  2J5P A;  2DI3 A;  5L3D A;  4OIR F;  1UHM A;  4BNC A;  4WX9 A;  3E5U A;  5D4R A;  2G9W A;  1YG2 A;  2J5O A;  3CLO A;  5HS9 A;  3HIF A;  3WG9 A;  4CO8 A;  1G3S A;  3ISP A;  3M9A A;  1R5G A;  2EFP A;  1YS7 A;  4P96 A;  2QWW A;  4E70 A;  2O8X A;  4NQW A;  3BP8 A;  1PP8 F;  2ZNZ A;  3ZN0 A;  1SFX A;  2IPQ X;  3F72 A;  3JAM K;  1T98 A;  2Q8K A;  3WU0 A;  1D8J A;  1U6G A;  4HLY A;  1T6S A;  4A5N A;  6PAX A;  1P6R A;  3VOD A;  2RKH A;  2CSO A;  1IXR C;  5D5W B;  2NRA C;  4R1H A;  2VON A;  2IA1 A;  1KU9 A;  1G3W A;  3ECO A;  5DDG A;  1NHA A;  2YU3 A;  5D5X B;  2GZW A;  3Q9S A;  1Q1H A;  4ZZL A;  1S3J A;  2PFB A;  3V4G A;  2K7L A;  4PCQ A;  5LLQ A;  3ULQ B;  1PUE E;  2LSO A;  3F6V A;  1SD7 A;  3ERE D;  2BEO A;  2NYX A;  4O3M A;  1BM9 A;  4I02 A;  3IL2 A;  4G7O F;  4Q48 A;  1U5T A;  4GCV A;  3WGI A;  4NHJ A;  3K2Z A;  1IUY A;  3GFJ A;  3KP4 A;  3LA7 A;  1T0F A;  1UHW A;  4YIF A;  5H6R A;  3EDP A;  4HW0 A;  4ZYD A;  5K5R A;  1BI1 A;  3BZ6 A;  2PBI A;  1FWZ A;  2JRT A;  5KK1 A;  4LLN A;  3IKV A;  4AIH A;  1QZY A;  2CWE A;  5E1Z B;  3FZV A;  4LK0 F;  4HF2 A;  2DPU A;  2XRO A;  3KP2 A;  4A6E A;  2FBI A;  2PEX A;  1OMI A;  1XGO A;  1HW2 A;  1O7L A;  2VBY A;  2Q2E A;  5FB2 A;  1BBY A;  2YX7 A;  1EV7 A;  1TTY A;  5E18 F;  1IF1 A;  3CUO A;  4A0Y A;  1JE8 A;  3H3Z A;  1BIA A;  5CVJ A;  5E8G A;  2DLL A;  1DP7 P;  4KMF A;  4EM0 B;  1J59 A;  1W5T A;  4I0B A;  4LD5 A;  1ZRE A;  2A69 F;  2H6C A;  4MGR A;  2QEN A;  2DFI A;  3EYI A;  2V79 A;  3Q9V A;  2O03 A;  1O3T A;  3OOP A;  5ILS A;  3TKY A;  3W6K B;  3WTV C;  1B1B A;  2E7X A;  5HS8 A;  3VB2 A;  3ZN1 A;  4ZYE A;  3GYH X;  1HXD A;  4LLL A;  2HGC A;  2RQP A;  4MQ9 F;  1FX7 A;  5E1X A;  3KP5 A;  3FMQ A;  1LQ1 A;  1TW2 A;  3WTS C;  2H27 A;  3LAP A;  5K5Q A;  1ZRC A;  1G3Y A;  1ZLJ A;  1U2W A;  3ZMD A;  4L5I A;  2KJB A;  2IRF G;  3HRU A;  4RGR A;  1O3S A;  2HYF A;  1YW7 A;  1ZYR F;  2DO7 A;  5FD5 A;  5L3G A;  2KIU A;  3E6D A;  2IJL A;  4EJO A;  4DNC A;  1ZHF A;  1Z91 A;  2E1C A;  5CVI A;  3TDZ C;  1E17 A;  4G7Z F;  5LEJ A;  1WWX A;  1BN5 A;  4PZJ A;  4BH9 A;  3L7W A;  4IRI A;  4HX8 A;  3SFZ A;  2QYO A;  1BI3 A;  3HSF A;  3ZP5 A;  3K1N A;  4EGY A;  4OIQ F;  2FRH A;  5BMZ A;  4LG0 A;  1B59 A;  2Y48 A;  4CDG A;  3CUQ A;  5LBQ A;  3V8J A;  3RPQ A;  1JXS A;  1S6L A;  3C7J A;  1SFU A;  2AXL A;  4RAY A;  2VE9 A;  3K69 A;  1LEB A;  1QGP A;  1FY7 A;  2F5D A;  2ZO4 A;  5LHG A;  2OQG A;  1H9T A;  2DK8 A;  4G8X A;  3WGG A;  2WC2 A;  1QPM A;  4N9I A;  3QPH A;  4EGZ A;  4A0Z A;  4I98 B;  1STZ A;  2QBY B;  2Z99 A;  2ISY A;  5EEG A;  4RB1 A;  1F9N A;  2XAG A;  4Y15 A;  4A12 A;  4LB6 B;  3BOQ A;  3J80 K;  4JK1 X;  5ILU A;  5CVR A;  2CO5 A;  1MZB A;  5IT3 A;  1J7K A;  2QVO A;  4UHT A;  4TV7 A;  4HOB A;  2FEZ A;  4AVP A;  3H3U A;  3F3X A;  2P4W A;  4HF0 A;  3DKW A;  4XBF A;  1P4X A;  2V9V A;  4RAZ A;  2G7H A;  1O7F A;  3GX4 X;  3QU3 A;  2P7V B;  1J0R A;  1C0W A;  2ZCW A;  2HYG D;  5BQT A;  4RGU A;  5HLI A;  2MH9 A;  2DAO A;  1XSD A;  4U0Y A;  3I4P A;  4M9S A;  4XLN F;  3BPX A;  1KA8 A;  5CYV A;  2LF8 A;  4ZZD A;  1J75 A;  2HWV A;  1HKQ A;  3I0T A;  3IRR A;  3HSE A;  3KEQ A;  1Z6T A;  1D8K A;  1L0O C;  3E6C C;  2XKP A;  1ZG1 A;  5LRS A;  4OIP F;  2IW5 A;  1UFM A;  2JSC A;  2H09 A;  4M71 A;  1YO5 C;  2RGV A;  4CGZ A;  4L0Z B;  1USS A;  2PG4 A;  3ZMS A;  2F2E A;  2VE8 A;  2A3S A;  1Y0U A;  3KP3 A;  2RV8 A;  1WRJ A;  3HTU A;  2W84 A;  4LFU A;  3ZPL A;  1IRF A;  4KA4 A;  1FBS A;  2CG4 A;  2X4H A;  1T38 A;  2CFX A;  1WI9 A;  1IN5 A;  2FBH A;  3TGN A;  2P6T A;  1MKM A;  1YIO A;  2FU4 A;  1REP C;  3WTZ A;  1U78 A;  3SZT A;  2FQ3 A;  3EYY A;  4Q4Z F;  3B73 A;  4G6Q A;  4PGG A;  4HQE A;  2C6Y A;  1SMT A;  1WSU A;  1TNT A;  3ABU A;  3RJP A;  4UVB A;  4EJU A;  1V3F A;  2QLZ A;  4L9J A;  1G4D A;  2D45 A;  1V4R A;  2K86 A;  4U7B A;  1IZ1 A;  1RUO A;  3VFZ A;  2EV6 A;  5BOX A;  3F22 A;  3MCZ A;  4LK1 F;  3PQK A;  5HDN A;  3GFM A;  1R1V A;  1BIB A;  1MDM A;  2Q0O A;  1T2K A;  1TW3 A;  4ETS A;  5FLX K;  3V8L A;  3CDH A;  2W24 A;  3K1M A;  2YSR A;  4DQ2 A;  1HBX G;  2G7U A;  1XGN A;  4RGS A;  1O57 A;  1K7A A;  4QLC U;  3KP6 A;  3JAM Z;  2F5C A;  2COM A;  1GXQ A;  4ENK A;  4BQA A;  1I5Z A;  4Y17 A;  4S05 A;  3WTW C;  2HTJ A;  2P8T A;  3G3Z A;  2KJC A;  3EUH A;  1P92 A;  2EK5 A;  5ICG A;  3KLN A;  4BHC A;  2DQR A;  4KN7 X;  5D5V B;  3R61 A;  1XDU A;  4YG2 F;  5LGU A;  1UST A;  3IKT A;  2V1X A;  3I54 A;  1R00 A;  2PMH A;  4GYI A;  2EFO A;  1Z1D A;  2VT3 A;  2OA4 A;  2CW0 F;  4YFX F;  2M45 A;  3HOT A;  2VN2 A;  2LKP A;  3RKY A;  3J81 Z;  3H92 A;  3SHF A;  1LB2 A;  2O6G E;  2GXG A;  2HKO A;  4AWX B;  3T0Y A;  3DF8 A;  3WTT C;  1CF7 A;  4YFK F;  2K4J A;  3N97 A;  5E20 A;  4MHG A;  1CF7 B;  4HF1 A;  1ZG5 A;  1R7J A;  3PFI A;  5TJJ A;  2P5V A;  3O2P E;  5EEH A;  2FML A;  1IW7 F;  3Q5F A;  3I64 A;  2HR3 A;  5HLH A;  3F21 A;  3RIR A;  3JSO A;  1KQ0 A;  4UV8 A;  5CLS A;  4A0X A;  2IP2 A;  1SD6 A;  4FX4 A;  3FXQ A;  2X0L A;  3DEU A;  1A04 A;  3S2W A;  2IT0 A;  1BI0 A;  3HUG A;  1ZH5 A;  5D4S A;  5ICF A;  1IN8 A;  2K27 A;  1IXS B;  1LVA A;  1IN7 A;  2CYY A;  1KU2 A;  2A5Y B;  3GEZ A;  3HRM A;  4MEX F;  4P5O A;  3GWZ A;  3KLO A;  3GF2 A;  4EJT A;  2D1V A;  3GZ5 A;  1QNT A;  1U5T B;  4A5M A;  2H94 A;  3ECH A;  4L18 B;  5K1Y A;  1FSE A;  1B9N A;  2NNN A;  4GO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...