2LKPA

Solution structure of apo-nmtr
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
GHGVEGRNRPSAPLDSQAAAQVASTLQALATPSRLMILTQLRNGPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVVGDRAGRSIVYSLYDTHVAQLLDEAIYHSEHLHLGLSDRHPSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, ArsR family
publication title Solution Structure of Mycobacterium tuberculosis NmtR in the Apo State: Insights into Ni(II)-Mediated Allostery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 24
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lkpA00
4RAYA 4E70A 3H92A 5HS9A 3MZYA 3MZHA 2B0LA 3DF8A 5DCMB 1YLFA 1TQIA 2YU3A 1J59A 4IHSA 2HDCA 1HW5A 5FLXK 2QBYA 2VBZA 3IKVA 3KP6A 4KFCA 5FO5A 3NRVA 1F1ZA 3EDPA 1I6XA 2GQQA 3HSRA 2XIGA 2W84A 4OIRF 3KZYA 3R6SA 3CJNA 3MQ0A 4WXCA 1O3RA 2PFBA 2KJBA 5J8CA 3RIRA 4LK1F 3RYRA 2FOKA 4WXHA 1Z1DA 2XKPA 3CO7C 1TNSA 2ELHA 4B8XA 1SD6A 1G3YA 2KKOA 2IT0A 1RUNA 3IWZA 4OIPF 3LQRA 3GYHX 2KJCA 3WTUC 2G7UA 2P7CB 4U0YA 3G3ZA 3GW2A 3M8FA 4R8HA 4IRHA 4U0VA 4AWXB 1BOAA 2ZFWA 4GGGA 1Z9CA 2XV4S 4HZFA 4MTDA 3F3XA 4RAZA 4I01A 1RNLA 2QUFA 5EEHA 1J2XA 2QWWA 4L9VA 3V7RA 2ZMEA 4UVCA 3L7WA 1I5ZA 1JGSA 3ABTA 1FLIA 2BEOA 1SMTA 1L0OC 4ESFA 3COAC 3QOPA 3R0AA 4AIJA 1KQ9A 2DTRA 2R3SA 1Z7UA 2FA5A 2ZNZA 2JT1A 2K4JA 1O3SA 3L00A 4M6XA 3VEPA 2AS5F 3I59A 1BC8C 1MDMA 1ZG1A 4B09A 2ISZA 4RB0A 3WODF 2DLLA 1DDNA 4WK8F 1TQPA 3FWEA 4EM1A 1R1TA 4S05A 3HRSA 5L3GA 1WRJA 1XGSA 2EB7A 3LA2A 4BQAA 1XSVA 4HYEA 4U7DA 2HTSA 4XLPF 1KQ8A 5D5VB 4GYGA 3JW4A 3ZN0A 1KYZA 2M87A 3RDIA 1RIOH 4XLNF 3HUGA 2ESNA 2EV0A 1JE8A 2EFQA 4G6DA 3ERED 2DPUA 1MKMA 2LNBA 2K02A 2OD5A 4RB3C 2DO7A 3BJOA 2JPBA 2UWMA 1BI1A 3GVAA 4HV5A 1D8KA 3TKYA 2Q8KA 2FU4A 4ENNA 1KGSA 1LEAA 2O03A 2H6CA 5FFXA 2NNYA 4QLCU 5ICFA 2X0LA 1YIOA 1K78A 2KIMA 5FFZA 4I0BA 2HEOA 5DD8A 3G73A 4KIBA 1B1BA 2KIUA 1T0FA 2J5PA 4ON0A 2G9WA 1GHCA 3F22A 1SMYF 2JZYA 2ACJA 2VXZA 3ELKA 2RKHA 5HDNA 1SAXA 5KVRA 4DQ2A 1UCRA 2IA1A 3DP7A 2LF7A 5CVIA 3ZMVA 4OMZA 5E1XA 1OMIA 3BOQA 1T6SA 3ZMSA 2W25A 4LJZF 1YO5C 4OOIA 1GXQA 1R58A 3F6OA 4DNCA 3WTYC 3K0LA 3OV8A 2XVCA 3CLOA 2XAHA 4YFXF 2FNAA 3H3ZA 2FXAA 1B9MA 5H20A 1T38A 4HX7A 2E1NA 2EV5A 2M8EA 1ZRFA 2IW5A 3HOSA 1K79A 3RPQA 1G3WA 4ZZDA 5CYVA 3GF2A 2L4AA 1REPC 4NHJA 3TQNA 3QPTA 1MJBA 2FSWA 1R36A 1BM9A 3K1PA 3JSOA 3J80Z 3LFKA 3ZP5A 3MEXA 1ON1A 3I58A 1STZA 4HA8A 1XDUA 4N9HA 4FX4A 3PQKA 4IRIA 3EYIA 1QQIA 3Q9VA 1S8NA 2MH2A 1PDNC 4RB1A 3TOBA 1XSXA 4BHCA 3WTZA 3ZMUA 3T8TA 4R1HA 2E1CA 4RS8A 3KP7A 3LQQA 3GUDA 4IHTA 4RGSA 3LAPA 2EV6A 3SHFA 3ABUA 5A2QZ 1H9GA 5L3DA 2L54A 3EETA 2WWYA 1F5TA 1IN5A 5D6EA 3F8MA 2VE9A 4IPAA 1AOYA 1S6LA 5K5QA 5HS7A 3ZQ7A 3O2PE 2FMLA 4OMYA 4P9UA 5DCMA 4LK0F 3F6VA 1ZARA 2EFOA 1DP7P 2F5DA 1IXCA 4O3MA 1YS6A 1XMAA 3HTSB 2HYGD 4HX8A 4MQVA 2VT2A 4AIKA 4UV8A 3WU0A 1G6NA 2DQRA 1FY7A 5ILSA 2HS5A 1EV7A 3C18A 2MA3A 5AIQA 5LHHA 3TGNA 3J81Z 1WI9A 2YX4A 4KN7X 1K7AA 4XSXF 1IN6A 3SXYA 2KRFA 4UNOA 4M71A 3T0YA 2JPCA 1WQ2A 4YFNF 4UHTA 5LRRA 4ENKA 2CGPA 1YS7A 4KA4A 2OQGA 1ZH5A 2X4HA 2P7VB 1WSUA 2WV0A 3JTGA 4HDUA 2OZUA 2VN2A 4IF4A 2CG4A 3SFZA 1BIBA 4I7HA 3ROUA 4HLYA 2GA2A 2BGCA 3BPXA 4HW0A 5EEGA 1U6GA 2YPRA 4LB6B 4Q5SF 4ZYEA 2NYXA 2A6EF 3ECOA 4WCGA 5FD5A 2Q0OA 4MQ9F 1XCBA 1SFXA 1F9NA 4OINF 5IT3A 3E5XA 1OYIA 4NQWA 1MJ9A 1A04A 4M72A 3IRQA 4EMSA 2FQ3A 2QZ8A 5H6RA 1I27A 3GO5A 6PAXA 1S7AA 2MBFA 2Z99A 5LRSA 3F8BA 2F5FA 1ZGAA 3QP5A 4EJVA 3B02A 1JHHA 2FMYA 1W5TA 1BBYA 1R22A 1ZGJA 3CUQA 2OA4A 3T1BA 2GZWA 4HAMA 5L3CA 1OYWA 2IVMA 2MLKA 3DV8A 4LLGF 3U9GA 3FMSA 3MAJA 1B4AA 1XB4A 5JI6A 1IF1A 4N0BA 5BS6A 5LGTA 2V9VA 4I0AA 3CTAA 4EVIA 2XRNA 1W4MA 5LHGA 4KICA 3R61A 4KT5C 2P5LC 2CW0F 3KFWX 1SD5A 3SZTA 3IRRA 1W7PB 2IRFG 1D8JA 2XGXA 2VBYA 1Q1HA 2QLZA 3IC7A 5E18F 3U2RA 3WTSC 3V8JA 2OZ6A 5DUKA 3R4KA 4O5VA 4EV0A 4WF2A 5CLSA 3DXJF 3IKTA 3P7NA 3ML6A 3LA7A 1IW7F 4EM0B 2BE5F 2DK5A 3F8CA 3KZZA 2IA0A 4EJUA 2W24A 2HTJA 1O7FA 3K9TA 3F8FA 1ZG3A 2YR2A 1ZRDA 1QZZA 1PUEE 3J80K 1KU7A 1DPUA 1ZN2A 3RJPA 5CVRA 4JBAA 4HLXA 5D5XB 5JFRA 5K5OA 2M45A 1RI7A 4CXFA 4KIFA 2JSCA 2HQNA 5AONA 1I1SA 3K1MA 1EH7A 1U5TA 5D4RA 1HBXG 3OOPA 4BNCA 2HWVA 5FB2A 1MJAA 3E6CC 2DAOA 3CDHA 1J75A 1WKMA 5A2QK 1HSJA 2BYVE 3FXQA 1J0RA 3LSTA 1FWZA 2XUBA 1XDSA 2M30A 2RGVA 3JAMK 1USSA 3WGGA 2A3SA 5TJJA 2ISYA 4EGYA 1K6OA 1IN4A 4BHPA 1EH6A 3I54A 2VODA 2D2WA 3RPUA 4XBFA 1KYWA 5HLGA 3WTVC 5L3BA 3C3WA 4A0ZA 3MWMA 3DEUA 1ZAOA 1MGTA 2HKOA 5H6QA 2DI3A 3QU3A 2HGCA 5DV5A 3ULQB 5D4SA 5FGMA 2VOPA 2P4WA 4R79A 1GVJA 2KIFA 3JTHA 1W7PD 3GFMA 4MTEA 5LBQA 1I1GA 1SFEA 1Z6TA 3CUQC 1YTYA 5DYMA 3GZ5A 2L4MA 1IUYA 2ZXJA 4KMFA 5HDGA 3HIFA 3J81K 1ZYRF 3HHGA 4Y13A 5E20A 2QQ9A 4UVAA 1FC3A 4G8XA 3VFZA 2O61A 3KEOA 2PMHA 2VONA 1TTYA 1WWXA 2A68F 2O6GE 2FBIA 3TDZC 3E3VA 3SZPA 3I53A 4G9YA 2Y75A 5ICEA 3IWFA 3T5XA 1LJ9A 3QU6A 4GO1A 4PGGA 3QAHA 2RNJA 2QQBA 2H94A 2LKPA 3Q5FA 2ESHA 3ECHA 4I2OA 2Y48A 2O0YA 2J5OA 1R7JA 1ULYA 2HKXA 2VT3A 1UFMA 4N9IA 4XSZF 3HRMA 4U0WA 1YQAA 3F8NA 2HYFA 2VBWA 3PFIA 3FMQA 4PCQA 1USTA 3I4PA 4LLLA 5CVJA 1V4RA 1H0MA 3VODA 2FEZA 5CVVA 1TNTA 1AWCA 5E1WA 4KMUX 4EGZA 4IJAA 4RB2C 4GCVA 2D1HA 3FXRA 3H3UA 1HKSA 4LG0A 3BDDA 2E7XA 1TBXA 4I02A 2ZO4A 4KIGA 1U5TC 5JVTA 5DD4A 1HKQA 3EYYA 3L09A 3RI4A 5HDKA 1G4DA 5LGUA 1LDDA 4OIQF 2G7HA 4M9ZA 1MDMB 2V79A 2K7LA 3WTTC 1LQ1A 3I5UA 1JXSA 1LEBA 3M7GA 1ZREA 2DPDA 5HLHA 3T8RA 3TDUC 3HTUA 2Y0MA 4BYYA 3REOA 4I98B 2PJPA 1GXPA 4TV7A 4FT8A 5BMZA 3TO9A 2EFNA 3JAMZ 4L18B 3GFJA 4ESJA 1CF7B 3WG9A 4GYIA 3Q9SA 4AIHA 1D3YA 5KK1A 4G6QA 2STTA 1ZG5A 2XHKA 4P55A 1XCVA 2D1VA 2P6TA 2COMA 1FYLA 4F7ZA 4S04A 4ENJA 2LDUA 2QYOA 1E2XA 3GWZA 3HRTA 1QGPA 2UXXA 4U7BA 5LGNA 3HOTA 3C1DA 1HSTA 2EA2A 3WGHA 1IXSB 3TOAA 4MHGA 3RKYA 1W7PA 2Z5UA 4ZH4F 1IRGA 2YX7A 5JHUA 2ZKZA 2JTVA 2DBBA 2DQLA 3WU1B 1K78B 3M8EA 1YFHA 4M73A 3RKWA 3SQNA 1MD0A 3ZMTA 3FXUA 2STWA 1U8RA 2QM3A 3BPVA 3ZMDA 1EH8A 1HKTA 4H0EA 2UZKA 3CUOA 4L9NA 4A0XA 3P9IA 3P9KA 2DW4A 3E97A 2VOOA 3LWFA 5J6XA 1OYYA 1S29A 4A12A 4IRGA 1T98A 2MH9A 2Z33A 2FBHA 4RGXA 4ZYHA 3EUHA 2Q2EA 1OPCA 2Z3YA 2R7DA 2VC0A 3WGIA 3TO7A 2MD5A 1JHFA 2FF4A 1O57A 2QVOA 1RZ4A 2F5CA 1ZLJA 3EQLF 1UB9A 4O6JA 2EFWA 2HR3A 1FX7A 1W5SA 2W57A 3WE3A 1P2FA 4A5MA 3L2CA 5HVQC 2XASA 3DQVC 2L02A 4FHTA 4BAYA 1FZPB 5ICCA 3VOEA 1FP1D 2W85A 2QQAA 4U88A 4ZZLA 2HFHA 4OU0A 1BN5A 5AIPA 2ADUA 2XAJA 2HQRA 3IHUA 2V1UA 1XMKA 4D0PA 1P4AA 2DU9A 2CO5A 2XAQA 2LF8A 2WTEA 3K1NA 5D5UB 4M9SA 2IP2A 2OU2A 3BJ6A 4PZJA 1UHMA 3BP8A 2JRTA 2PI0A 4CYDA 1XGMA 5HLIA 3GLXA 2ZJ2A 4PGHA 4A0YA 4AVPA 2HZTA 3KEQA 1V3FA 4HQMA 2O3FA 2XAGA 1Z91A 3HHHA 5HOOA 3GZ6A 1R5HA 2GWRA 4HF1A 3DKWA 4LFUA 4BHBA 2NRAC 2DK8A 3KP5A 5J8FA 1LDKB 2P5VA 4YIFA 2P6SA 2V6CA 4L9JA 1HW1A 2R7FA 3PQJA 3M9AA 3C7JA 1ODDA 1KU2A 4Q47A 1LB2A 2OQRA 2EFPA 1SD7A 3GXOA 4CGZA 3RKXA 3GEZA 5K5RA 4JQFA 1H9TA 3RYPA 4NB5A 2HOEA 3WTWC 3LA3A 1YW8A 3BROA 1ON2A 3E6DA 4ENMA 1IN7A 1C0WA 4LMYA 3R60A 3W6JB 2EA4A 1XGNA 1IZ1A 2D45A 2LSOA 5CJ9A 1R5GA 4UV9A 4KYWA 4YFKF 3FMRA 2PG4A 4G7OF 2IJLA 3O3KA 4XRFA 4BH9A 3N4MA 2QENA 3KP2A 3WE2A 3BZ6A 1YW9A 5ERIA 1LDJA 1TQMA 1BI3A 3D5LA 5E8IA 3FHZA 3RTRA 1J7KA 2VBXA 1Z6RA 2UXNA 3I0TA 2OAZA 2A6HF 3KP4A 4MEXF 3U1DA 3J7AO 3KLNA 3BJAA 3FX3A 5IT9Z 1FPQA 4ZYDA 2EWNA 2O8XA 5D8KB 5ILVA 2XROA 2CFXA 2P5KA 2MC3A 3K2ZA 4P96A 4CO8A 5L3EA 1O7LA 5DEQA 5BOXA 2PN6A 4MGRA 5D8LB 5D5WB 2GAUA 2WC2A 1BIAA 3E6MA 2RV8A 3LAJA 3CUQB 3DPLC 2CYYA 3FM5A 1D5VA 4FX0A 3V7CA 4A6EA 2C6YA 1KU9A 4RGUA 1HW2A 3KLOA 1KA8A 1QPMA 4Y17A 1Y0UA 1CF7A 1L3LA 4HQEA 2F2EA 2QBYB 2V1XA 1IXRC 1G3SA 1FOKA 3JSPA 1CGPA 3HSFA 4HV6A 1O3QA 3V8LA 2RDPA 3IL2A 4LLNA 4YIIA 2VE8A 2V1DA 4A6DA 3E5UA 5F1RA 4CHUA 3V4GA 2L3DA 1X3UA 5L3FA 3GX4X 4MEYF 2ZBKA 1SD4A 2F5EA 2RVCA 3WTXC 3QPHA 4KNYA 2YSRA 1G3TA 5F6FA 3K69A 2GXGA 1FNNA 3I71A 4L0ZB 2CSOA 1KQ0A 1B59A 2EK5A 5BPDA 5FLXZ 4UXNA 4RGRA 2H6BA 3N97A 1MZBA 4EM2A 1FYKA 2K27A 3V8KA 4P9FA 4ESBA 1R00A 4L5JA 1R23A 1DPRA 4A5NA 3MFKA 1U3EM 5JR3A 4LB5A 3GFLA 2PBIA 1R1UA 1KU3A 4A2UA 1E17A 2Z9OA 2NS0A 3HRUA 3BY6A 1OR7A 4IXAA 1HXDA 5LLQA 4AD9A 1BI0A 1O3TA 5LHIA 1ZRCA 2GA1A 1YG2A 2ZMEB 1U5TB 5FD6A 3GFIA 2E7WA 4G7ZF 1YW7A 2ZNYA 4Y15A 3NQOA 3MCZA 4MNUA 4G94A 1B6AA 4KUMA 1J9IA 1Z05A 4BXUA 5ED4A 5ILUA 4I09A 4HF2A 1F4KA 2IA2A 4GXOA 3B73A 3HSEA 5K1YA 2BV6A 3I59B 2M1BA 1DUXC 4Z2YA 1FSHA 3P9CA 4UVBA 4CZZA 5DUIA 4ASNA 5E17F 3DFGA 2VC1A 2A07F 1S7OA 4WX9A 1LVAA 4LGWA 4M9XA 2L01A 4JK1X 4G7HF 2H09A 2CQKA 2A5YB 4L9TA 3CO6C 4CICA 1TW2A 3D0SA 1T2KA 2FNPA 1R1VA 3S2WA 4EJWA 2ZCWA 3E5QA 5TRDA 1ZHFA 1OKRA 4HBLA 1SFUA 1S3JA 1YYVA 1P4XA 5CVUA 1FP2A 3F21A 4Q4ZF 3AAFA 1XSDA 2XAFA 1BI2A 2DT5A 4M74A 3FM3A 3I64A 2K86A 4IVNA 1FBQA 5DCFA 4YG2F 2AXLA 2PMUA 1ZLKA 4WWCA 2TDXA 3ZMZA 1HQCA 4HOBA 1RUOA 4QWQA 1U78A 1IRFA 1BC7C 4L0YB 5BPIA 2IPQX 3KP3A 4P5OA 4LD5A 2GXBA 5F64A 3ISPA 3DPTA 4WXDA 1IN8A 1VTNC 1UHWA 4K2EA 1U2WA 4PDKA 4KDPA 2FRHA 5IT9K 1IAWA 5D6FA 1PP8F 3F23A 3HYIA 4HF0A 1PP7U 2A61A 3O6BB 2RN7A 4ETSA 2M5WA 1FYMA 1FT9A 1P4WA 3F72A 2FBKA 3R0JA 2DFIA 1TLHB 2BBYA 3ZPLA 2ETHA 1LNWA 2OBPA 4EJOA 3KETA 2A69F 3QRFF 3FZVA 3FF5A 4OIOF 4KN4X 5LEJA 1FBUA 3M1EA 4Q48A 4LG0B 1P6RA 2K4BA 2MLGA 1TW3A 1XN7A 5LEKA 2H27A 1ONVA 3QP6A 3V7SA 2CWEA 2NNNA 2PQ8A 4EQQA 3VB2A 2NAZA 3NEUA 2GIVA 1FSEA 1XGOA 2P8TA 4EJTA 1QBJA 4M6YA 3L9FA 3ZN1A 1NHAA 3KE2A 3KCCA 1J5YA 5ICGA 5DDGA 4CDGA 1QZYA 1QNTA 1T39A 2EJRA 3E6BA 3TO6A 1B9NA 4UUVA 4HX4A 2XKOA 2FE3A 3W6KB 5HS8A 2RC4A 4HDVA 1BJAA 2RQPA 5E8GA 5E1ZB 1XD7A 3BWGA 1FBSA 1P92A 2PLYA 2PEXA 4L5IA 5BQTA 1QO0D 4ZYGA
chains in the Genus database with same CATH superfamily
4RAYA 4E70A 2DXIA 3H92A 5HS9A 3H5NA 3MZYA 3MZHA 4HNTA 2B0LA 3BTLA 3DF8A 4F55A 5DCMB 5B1AH 3PSFA 2VJ4A 1YLFA 3TP0A 1TQIA 2YU3A 1J59A 4IHSA 2HDCA 3BC8A 2K9NA 1PYVA 2TCTA 1HW5A 5FLXK 2QBYA 2VBZA 3IKVA 2OCCH 3KP6A 4W1UA 2E5NA 4KFCA 5FO5A 3NRVA 1PVEA 1F1ZA 3EDPA 2LKXA 1N78A 3B6AA 1I6XA 3H5RA 2WAFA 2LP0A 4D9JA 1T08B 2CUJA 4FE4A 2GQQA 2DMNA 3HSRA 4OAZA 2XIGA 2W84A 4BL0B 2HPIA 4OIRF 4XOTA 1YITI 1V5FA 3KZYA 5F0CA 3R6SA 1RPWA 3L2UA 1SFOJ 3CJNA 1GV5A 3MKYB 3MQ0A 4PFPA 4WXCA 1O3RA 2PFBA 2VKVA 2COBA 2KJBA 5J8CA 1ZQ3P 3OYFA 3RIRA 5C3EJ 4LK1F 3RYRA 2FOKA 4WXHA 1Z1DA 3TW6A 1MBEA 3AG1H 3W2AA 1K6YA 2XKPA 3CO7C 2RAEA 1TNSA 1XTAA 2ELHA 1SD6A 1G3YA 4B8XA 5FROA 1DGRM 2KKOA 4F52A 5KNLA 2IT0A 2E1MB 4HPQA 1RUNA 3IWZA 2EIMH 2ID6A 2HOTA 4IQJA 1VQKI 2ZB9A 4OIPF 2ID3A 3CDLA 3LQRA 3GYHX 2KJCA 3WTUC 2G7UA 5E79C 3AFHA 2P7CB 4U0YA 3G3ZA 3GW2A 1WJDA 3OYGA 3M8FA 4R8HA 4NC7A 3K2AA 4IRHA 4U0VA 4NNJA 1K4SA 1U8BA 1X2NA 4AWXB 3CMMA 1BOAA 5F04A 2ZFWA 4GGGA 1Z9CA 1VNDA 5J4YA 2XV4S 1MBFA 4HZFA 4AM3A 4XQFA 3PNVA 1IV8A 3DBRB 1NG6A 1ITYA 4MTDA 3F3XA 1YX5A 1BW5A 4RAZA 2QA4I 1WFXA 4I01A 1RNLA 2KP6A 3GTPJ 2QUFA 5EEHA 1J2XA 2QWWA 2DJIA 3CJRB 1QHGA 1X3WB 5C4XJ 2V7FA 3D1NI 1D0XA 4C2TA 4L9VA 3V7RA 3BT9A 2R5ZA 2ZMEA 4JX5A 3S1MJ 4UVCA 2EZHA 1U9OA 2VB6A 3L7WA 2V26A 1I5ZA 4LIUA 5IP9J 1H8AC 1JGSA 3ABTA 3FKIJ 4B1RA 2BEOA 1FLIA 2H1LA 1SMTA 3WHBA 1L0OC 3HKZA 2W00A 4BJTA 4ESFA 3COAC 3GTKJ 1MIJA 2WY8Q 3QOPA 3R0AA 3J7ZI 4AIJA 4MLOA 1KQ9A 2DTRA 2FOWA 2NXNB 2R3SA 4NQWB 1RR8C 1Z7UA 3DTKA 2FA5A 4PUSA 1HCRA 5J1YA 2JSPA 2VIXA 2ZNZA 1YJ9I 2JT1A 1MMGA 3VYSB 5FKLA 2LBFA 2K4JA 3L1PA 1O3SA 4A3CJ 4N4NB 2W82A 3S3NA 3L00A 4M6XA 3VEPA 3A4CA 3I59A 2AS5F 3S1NJ 1BC8C 1MDMA 2XPWA 4D5FA 1ZG1A 2BY3A 4PFOA 4B09A 4D5CA 4RB0A 2ISZA 4NUBA 3WODF 2BY1A 2DLLA 4XOPA 3W2VA 1DDNA 2B63J 4WK8F 1TQPA 3FK6A 5KAFC 4YELA 3FWEA 1VQPI 3EUAA 4EM1A 3OYJA 1FOXA 3HOWJ 1R1TA 3L2VA 1TC3C 4S05A 3HRSA 5L3GA 1FMVA 1WRJA 2R93J 1XGSA 2EB7A 4ANJA 2JRMA 3LA2A 3JRFA 2R7WA 4BQAA 2XGEA 1XSVA 4HYEA 2HTSA 4XLPF 5M3MJ 4U7DA 1KQ8A 5D5VB 4GYGA 3JW4A 1V55H 3ZN0A 1KYZA 2ECCA 3JRHA 2M87A 2LREA 3RDIA 3FK7A 4QIWN 1RIOH 4U87A 4XLNF 3HUGA 4DYQA 3RQ4A 1J09A 4BU2A 2CW8A 2ESNA 2F6CA 2EV0A 3GTMJ 1JE8A 2EFQA 2DDAA 1WGXA 4G6DA 3ERED 3S8PA 1R71A 2DPUA 1MKMA 2LNBA 2K02A 2OD5A 4RB3C 2DO7A 1DQUA 4XLCA 3BJOA 2JPBA 5J3LA 4CCMA 2BVMA 2UWMA 2M4GA 1BI1A 1NTCA 3OYBA 3A1YA 3LSHA 3GVAA 4XL9A 1IDZA 1JUPA 3HC7A 4HV5A 2BY2A 1D8KA 1W36C 4CYCA 3HDDA 3TKYA 2Q8KA 2FU4A 3HM5A 2X1EA 2JUGA 4ENNA 2HQAA 3ZQGA 3KYCB 2M0MA 3GZNB 4XM3A 1GLNA 1KGSA 3L2QA 1LEAA 1VZ0A 2O03A 2H6CA 3IH3A 1N77A 1FIAA 5FFXA 3I55I 3JRDA 2NNYA 4F91B 3S32A 4QLCU 1EJ9A 2DOEA 5ICFA 2X0LA 5F1JA 3CC4I 4Y4RA 1YIOA 1K78A 2KIMA 1R4MB 2WAEA 5FFZA 4I0BA 3UKGA 3CP8A 2CV1A 5FKNA 2HEOA 2GBYA 4PSWA 5DD8A 4KIBA 3OYCA 3G73A 5GPCA 4DW6A 1B1BA 1MMSA 2O5RA 1XG1A 4UUSB 2E19A 3NARA 2KIUA 1I6HJ 1T0FA 2J5PA 4ON0A 2G9WA 2XF5A 5J1RA 1YI2I 4E7JA 3F22A 4IHWA 1SMYF 2JZYA 2VXDA 2ACJA 2VXZA 3ELKA 1MBGA 2RKHA 3OR2C 5HDNA 1SAXA 5KVRA 4DQ2A 1UCRA 2EH3A 2IA1A 3DP7A 4XN0A 2LF7A 3PIPF 3K4MA 5CVIA 3ZMVA 1ETKA 4OMZA 5E1XA 1EKEA 3TBIA 1OMIA 3BOQA 1T6SA 3ZMSA 5B3SH 2W25A 4LJZF 1YO5C 4OOIA 1GXQA 1R58A 3F6OA 4DNCA 3WHCA 4G6TB 3WTYC 3S16J 3K0LA 2DMUA 1R6RA 3HEFA 3OV8A 2XVCA 3CLOA 2XAHA 4YFXF 2FNAA 3I56I 1LFBA 3H3ZA 2FXAA 1B9MA 5H20A 1T38A 1LFUP 4HX7A 2E1NA 2EV5A 2M8EA 1ZRFA 3BCBA 2IW5A 3HOSA 2E34A 2XGCA 3FXLA 5CPRB 3J7YJ 2F4OB 2DA5A 1K79A 2CV2A 1A31A 2LY1A 3RPQA 5B66C 2WB1A 1G3WA 4ZZDA 3DLLF 5CYVA 3HJEA 1PUFB 3GF2A 2L4AA 3OS1A 2E36A 1REPC 3MVPA 1OCZH 4NHJA 1IO2A 3TQNA 3K70C 3H1CA 3QPTA 1MJBA 2FSWA 2E5ZA 1R36A 1OJLA 1B72B 1BM9A 2ZSHB 1D0ZA 3K1PA 3JSOA 3DBLB 3LFKA 5IOYA 3J80Z 3ZP5A 1AKHB 2WY7Q 3MEXA 1ON1A 3I58A 5F0FA 4GRIA 1LKXA 1STZA 4HA8A 1XDUA 4N9HA 2X51A 1EF4A 4FX4A 3PQKA 4IRIA 3DKYA 2XB0X 4BBRJ 1QQIA 3EYIA 3Q9VA 1S8NA 4ZDLA 2MH2A 1PDNC 2KRHA 4RB1A 4LOCA 3TOBA 1T56A 1XSXA 4BHCA 4A3JJ 3WTZA 3ZMUA 3T8TA 4C2MJ 4R1HA 3HOZJ 1K61A 1G8XA 1XMXA 2MFZA 3FKJA 4BE1A 2E1CA 1YRNB 5GAGJ 4RS8A 2ZJQF 3KP7A 3WU2C 3LQQA 4V2GA 3GUDA 4IHTA 1RKTA 1VQNI 4RGSA 3LAPA 3VPRA 2EV6A 5BNGA 1TWGJ 3SHFA 2HDDA 3ABUA 3LSGA 1SAUA 5A2QZ 1H9GA 2JA2A 1QVTA 1QHHD 5L3DA 2L54A 3EETA 2WWYA 1F5TA 3DTEA 2ZJRF 2PMZA 5IY5H 3A02A 5IYDJ 1QPIA 4ZYGA 4AUXA 1IN5A 2WA0A 2LLKA 5D6EA 1SEUA 1I39A 4M6VA 3F8MA 2VE9A 2ZXHA 4IPAA 1AOYA 1ETXA 1S6LA 5K5QA 1XPXA 5HS7A 3ZQ7A 3RZOJ 3O2PE 1U9NA 4ZDPA 2FMLA 4OMYA 4P9UA 4HSTA 2V6EA 2DOAA 5M5XJ 1IRZA 5DCMA 2QSHX 3O8GA 4LK0F 3F6VA 5K7ZA 1ZARA 3W2WA 3OIPA 2EFOA 1DP7P 2F5DA 1IXCA 4O3MA 3OL4A 2R7VA 2NS8A 1K83J 1YOVB 1YS6A 1XMAA 3HTSB 2HYGD 2VKEA 4HX8A 2RNGA 4ZTFA 4MQVA 2VT2A 4AIKA 4UV8A 3WU0A 3S17J 2I5UA 1G6NA 4QTRA 2E2JJ 2R7OA 2DQRA 2B7EA 1FY7A 4P1WA 1T33A 2HS5A 5CQGA 5ILSA 1EV7A 2WBMA 3SDGA 3C18A 2ZC2A 2MA3A 5HNHA 1Y0NA 5AIQA 3RCOA 4A3DJ 4PJNA 5LHHA 3TGNA 3J81Z 1WI9A 2R7RA 3C2BA 3BZKA 2YX4A 3AL0C 4KN7X 4L5EA 3PFYA 1K7AA 3M8JA 4XSXF 1IN6A 3H5AA 1DU0A 2R7UA 1TWCJ 3SXYA 2KRFA 4UNOA 3HOYJ 4CCOA 3OY9A 5FRNA 4IZZA 2QSFX 3ABKH 1BA5A 4M71A 4E7SA 3AG4H 3BR3A 3OMYA 1TWAJ 2JPCA 3T0YA 1JJ6C 2KZVA 2ZXIA 1WQ2A 4DYRA 4CCNA 4E4HA 4YFNF 4UHTA 2G0EA 5EG0A 5LRRA 5JLXA 4DJAA 4ENKA 2CGPA 1RC9A 4II3A 2M0CA 1YS7A 4KA4A 1ZTRA 4ITVA 4XLHA 2OQGA 2BZTA 1ZH5A 5JVGF 2X4HA 2P7VB 1WSUA 1V5GA 1VQ5I 3CC2I 2WV0A 3JTGA 3C2HA 4HDUA 2OZUA 2VN2A 4IF4A 4MIMA 2CG4A 2VJJA 3SFZA 4V2FA 1BIBA 4I7HA 3ROUA 4HLYA 2OF7A 5EGOA 2JQ7A 1FTZA 1WI3A 2GA2A 2HVQA 4Y3OA 2BGCA 2EINH 3BPXA 4HW0A 2KISA 5E3MA 2CV0A 5EEGA 1U6GA 2KFDA 1JKPC 1KZHA 2DFEA 1SFKA 2CJJA 4PK4A 2XDVA 2YPRA 2IS1A 2HOAA 4LB6B 4Q5SF 2OUMA 4ZYEA 2NYXA 2A6EF 3RKQA 4RDUA 3ECOA 1BL0A 4WCGA 4M3FA 5FD5A 4MO7A 2Q0OA 4MQ9F 1XCBA 1SFXA 1F9NA 2VJIA 4OINF 2IAIA 4CCJA 4BXFA 5IT3A 2PX9A 3E5XA 3I3LA 3DPUA 1OYIA 4IO9F 2HVRA 4NQWA 5DS9A 2GXAA 1MJ9A 1A04A 1PJRA 4M72A 1U0JA 4EMSA 2FQ3A 3IRQA 2CUZA 1IC8A 2OJED 5GADJ 2QZ8A 4XN3A 5H6RA 1I27A 3HBLA 5M3FJ 2YS9A 3K4KA 3GO5A 6PAXA 1S7AA 2MBFA 2Z99A 5LRSA 3CESA 3F8BA 4OWRB 2F5FA 1ZGAA 3G2BA 3QP5A 3B02A 2DA2A 4EJVA 1JHHA 1JKOC 2FMYA 1W5TA 3RZDJ 1BBYA 2KPMA 1R22A 1ZGJA 3CUQA 3LSPA 4RA2A 2OA4A 2CU7A 3K7AJ 3T1BA 3ZGKA 4KJZA 3JRBA 2I8DA 5J40A 1W0TA 1JKQC 1MH4A 4BDZA 3NWSA 2GZWA 2E60A 4HAMA 5L3CA 3UR3C 1OYWA 4FASD 2IVMA 3O8HA 1UJ8A 2M2EA 1DU6A 2MLKA 1JTXA 3PM1A 3DV8A 4LLGF 1FIPA 3U9GA 1D0YA 2FD5A 3PL8A 3FMSA 3M3YJ 2ECBA 3MAJA 1VQMI 1B4AA 3OSGA 1XB4A 5JI6A 2F4IA 1UAAA 1IF1A 2K9QA 4N0BA 1FOYA 5BS6A 5LGTA 2V9VA 4I0AA 4B4CA 2DMTA 3CTAA 1ACIA 2K9MA 4EVIA 2XRNA 3MKLA 4A3EJ 3M07A 1W4MA 2JK3A 2HYJA 5LHGA 4KICA 3R61A 1ETOA 4KT5C 2P5LC 2CW0F 5EDNA 2E2IJ 3KFWX 1SD5A 4C9YA 3SZTA 3IRRA 4IL6C 2AQFA 2A05A 1W7PB 2IRFG 1OQYA 1MNMC 1D8JA 2EPFA 2XGXA 2VBYA 2OTLI 2IEKA 2JVGA 3HKZN 2OTJI 1Q1HA 2QLZA 3IC7A 5E18F 3U2RA 3WTSC 1ZELA 3V8JA 4M3EA 2OZ6A 2IS2A 1OFCX 4RM3A 5DUKA 3R4KA 3ZQFA 3U21A 1Y1WJ 3HL2A 2L0KA 4O5VA 2ELJA 4EV0A 4WF2A 2L9RA 5CLSA 3DXJF 3IKTA 1MNEA 3OR1C 3P7NA 3ML6A 2NS7A 3LA7A 1IW7F 5IYBJ 4EM0B 4ABZA 3L2WA 2BE5F 2DK5A 3F8CA 3KZZA 1N75A 1V54H 2H8WA 3E1SA 3A0HC 2CQ7A 3I4MJ 4EJUA 3S1QJ 2W24A 2HTJA 1O7FA 3K9TA 2DT6A 4EATA 3F8FA 1T8IA 1ZG3A 2YR2A 2XSJC 1QZZA 4HNUA 3ZQCA 1ZRDA 1PUEE 3J80K 1KU7A 1DPUA 1ZN2A 3RJPA 2R5YB 5CVRA 2P0WA 4JBAA 4HLXA 5D5XB 5JFRA 4DZJA 5K5OA 3D5RC 3S3OA 4GDFA 2Q2EB 3FHNA 2GOMA 2Y30A 2K9SA 2M45A 3DEWA 1RI7A 5GP9A 4CXFA 5DTDA 1QVUA 1XS9A 4KIFA 2JSCA 1D1AA 4RLQA 2HQNA 5AONA 3KZIC 4X0GA 3H3VK 1I1SA 3K1MA 3FDYA 2CQNA 1EH7A 1U5TA 1OISA 5D4RA 1HBXG 1MBKA 2ME6A 3OOPA 4BNCA 2HWVA 5FB2A 2LOOA 1MJAA 3E6CC 2DAOA 3CDHA 5C44J 2Y31A 3N05A 4C3IJ 1J75A 1WKMA 1JT6A 1HSJA 2IXSA 2BYVE 5A2QK 3FXQA 3QWLA 3KIOA 1X19A 2L9SA 2CQQA 2DMPA 5K7FA 1J0RA 3LSTA 1B72A 1FWZA 2XUBA 1XDSA 2M30A 2RGVA 3JAMK 1USSA 3PSIA 3P5JA 3BQZA 3QODA 2A3SA 4X1EA 3WGGA 1AKHA 5TJJA 2ISYA 4EGYA 3CMAI 2BHZA 2X85A 4B48A 1K6OA 1IN4A 4BHPA 1EH6A 4A3BJ 3I54A 2VODA 2D2WA 3RPUA 1Y6IA 4XBFA 4C3HJ 3H0GJ 1KYWA 5HLGA 3WTVC 5L3BA 1YE9A 1Z67A 3C3WA 4XKVA 4A0ZA 1ZR4A 3MWMA 3TL4X 3DEUA 1DP3A 1ZAOA 1MGTA 4AIDA 2HKOA 2X9DA 5H6QA 2OV7A 2DI3A 4HG2A 4N4OB 1A6IA 3S1RJ 4CUGA 2VPRA 4IHYA 3QU3A 4X6AJ 2HGCA 2ZJPF 4BQOA 3MN2A 5FKKA 5DV5A 2X6OA 3ULQB 5D4SA 1JI8A 5FGMA 1HF0A 2VOPA 1BR1A 2P4WA 4R79A 2B9SA 1GVJA 2KIFA 1WJCA 3JTHA 1W7PD 3GFMA 4MTEA 5LBQA 1I1GA 3KEYA 2QSGX 3IUOA 1SFEA 1Z6TA 3CUQC 3Q0WA 5DYMA 1YTYA 3GZ5A 3X2QH 2L4MA 1IUYA 2ZXJA 3PUBA 4KMFA 3KYLA 5HDGA 4YRVA 2RREA 1AHDP 3HIFA 3J81K 1VF9A 1ZYRF 1HDDC 1Z77A 2XPUA 2DODA 1JJ8C 3G1MA 2HI3A 3HHGA 4Y13A 5E20A 1OCOH 2WV1A 4JOMA 4UUTA 2GM4A 2QQ9A 4UVAA 2X6YA 1FC3A 2HNHA 4G8XA 1W1WE 3VFZA 5GAHJ 2HZDA 2O61A 2R92J 3KEOA 3V42A 3CC7I 2WB1N 3HOXJ 1R49A 3DEEA 2PMHA 2KMUA 3IH2A 2VONA 1TTYA 1WWXA 1UMQA 2A68F 2MC4A 2O6GE 1E0EA 2FBIA 3TDZC 3H36A 3E3VA 3G1LA 3SZPA 5EZHA 3I53A 1D1BA 4G9YA 2Y75A 3H9GA 5ICEA 3BTJA 1P9QC 1WVRA 4DOZA 1AU7A 3IWFA 2I10A 3ASNH 3VDXA 1LE8A 4V19K 3T5XA 4B44A 4IQ4A 1LJ9A 3QU6A 1SVLA 4GO1A 1ZK8A 3QPSA 3ASOH 4PGGA 1WH5A 3QAHA 2RNJA 2QQBA 2H94A 2LKPA 4A3FJ 1UZCA 3Q5FA 1IV6A 4GFBA 2L7ZA 2ESHA 3ECHA 4I2OA 2Y48A 2CMPA 1MMNA 2O0YA 3K6GA 4F92B 3MKZA 2J5OA 2M8GX 1R7JA 1NK3P 1VQ4I 1ULYA 2HKXA 2VT3A 2E35A 3OIQA 1Z7LA 4KITB 1UFMA 4B3XA 4N9IA 3CCQI 4XSZF 3HRMA 4U0WA 2QGUA 3FXJA 1TP4A 4XMYA 1VQ8I 1YQAA 1H88C 3F8NA 3GTLJ 5E3NA 3BG9A 2HYFA 2VBWA 3LFUA 3PFIA 3FMQA 4PCQA 1USTA 1N25A 3QYFA 2UV1A 4PJ0C 1RETA 2DYRH 5HODA 5J4VA 3JREA 2PMZN 3I4PA 2Y9ZA 4LLLA 2ELKA 5CVJA 5F0HA 1V4RA 1H0MA 4C30A 2FJ1A 3VODA 2MG4A 1S5LC 2FEZA 3WG7H 2FQ4A 4B47A 1E3PA 5CVVA 1TNTA 5GTHC 1AWCA 1HDPA 5E1WA 2LY9A 4BE0A 3S3MA 3BR5A 4KMUX 3E0JB 2W4SA 1VI0A 3CCUI 4IJAA 4RB2C 3H9JA 4GCVA 4EGZA 2D1HA 1RRJA 1R9TJ 3FXRA 4CZCA 4BACA 3H3UA 3PUFA 1HKSA 3LOCA 2VUMJ 2KHMA 2LK2A 1TWFJ 1R4NB 2IGKA 4LG0A 2L7FP 5EZGA 3BDDA 3ZOBA 2E7XA 2A5WA 2PJRA 1TBXA 4I02A 2ZMEC 2ZO4A 1IUFA 1HA8A 5F27A 4KIGA 1U5TC 1Y8RB 5JVTA 4A3GJ 4IHVA 2O7OA 5DD4A 1HKQA 3EYYA 2VQCA 3L09A 3PJRA 3L2RA 4CCKA 3RI4A 2JN6A 5HDKA 4JX6A 1G4DA 5LGUA 1LDDA 4OIQF 1BOBA 2G7HA 4M9ZA 4BY7J 1MDMB 2KZGA 2V79A 4Z6YA 2K7LA 1X1CA 2VQLA 3H35A 3WTTC 1LQ1A 3I5UA 2NOJB 3ZRGA 1W36D 1LEBA 1JXSA 2K3FA 3M7GA 4BJ5C 1ZREA 4D1QA 2DPDA 3IV5A 5HLHA 3A0BC 3T8RA 3TDUC 3BTIA 3HTUA 2Y0MA 4BYYA 4FQGA 3REOA 4I98B 4MFEA 4XLFA 2PJPA 1POGA 4II2A 1VFCA 1GXPA 5DM6F 2QKMB 1X4OA 4TV7A 2GLOA 4FT8A 1UELB 5BMZA 4BQNA 2XF7A 2K3PA 4AU7A 5K7HA 3GTGJ 4HSRA 3TO9A 2R7QA 2LKSA 2EFNA 5TGTA 3JAMZ 4L18B 3GFJA 4ESJA 3MZ8A 1CF7B 3QOEA 1ZGWA 4LIVA 3WG9A 4AC0A 5JHFA 2NVUB 4GYIA 3A2KA 4BXXJ 3Q9SA 2BY0A 4AIHA 1D3YA 1MW7A 3OYAA 3CJQB 4UY8I 1W0UA 1ORKA 5KK1A 2HVSA 3HB9A 1P7IA 3I9V2 4BEHB 2YUSA 4G6QA 1UG0A 4B43A 4OAYA 2STTA 1ZG5A 2XHKA 1QZEA 4P55A 4XRSA 1XCVA 2D1VA 1BJZA 2P6TA 2MSYA 2COMA 4IEJA 1UG2A 1FYLA 4LITA 4QPQA 4F7ZA 3OS0A 2LDUA 4S04A 2QYOA 2VQGA 4ENJA 3QPLA 1I3QJ 1E2XA 2MW8A 3GWZA 3HRTA 1QGPA 2UXXA 4U7BA 4G12A 4IOAF 2EIJH 4CYCB 4DBQA 4J00A 1D5YA 3IAM2 5LGNA 3HOTA 3C1DA 4BBSJ 2XSDC 3SEZA 2KQRA 1HSTA 2EA2A 2LR8A 3WGHA 2IGMA 5KCMA 4CH7A 1IXSB 3TOAA 4MHGA 3RKYA 4XLEA 1W7PA 1BR2A 2R7ZJ 2M9HA 3AL0B 2Z5UA 4ZH4F 1IRGA 2YX7A 5JHUA 2ZKZA 2JTVA 2DBBA 2DQLA 3ZXSA 3WU1B 1K78B 1RESA 3M8EA 3RSNA 1YFHA 5EYRA 2K5CA 4M73A 1MBJA 5LFAA 3RKWA 3SQNA 1MD0A 3GTJJ 3ZMTA 3FXUA 2STWA 3OYHA 5IYCJ 3S2HJ 3K70D 1U8RA 3OIOA 2QM3A 1CQTA 1MBHA 1Z21A 3BPVA 2QEXI 2HPMA 3ZMDA 1EH8A 1HKTA 3CMEI 2BXZA 4H0EA 2UZKA 3CUOA 3FBNB 4L9NA 4A0XA 1T0FC 3P9IA 2EIKH 3P9KA 2DW4A 3E97A 5M5WJ 2VOOA 3LWFA 3CCVI 2JUCA 3Q3SA 5J6XA 5FKOA 3CCMI 3EUKL 1OYYA 1S29A 4A12A 4IRGA 3F0CA 1T98A 2MH9A 1HLVA 2Z33A 1Y56A 2Q1ZB 3FISA 1MNDA 2FBHA 2JA8J 2AQEA 4RGXA 1A35A 3H9QA 4ZYHA 3EUHA 3ZQQA 2Q2EA 1OPCA 1GT0C 2Z3YA 2R7DA 2VC0A 3WGIA 1A36A 3TO7A 2MD5A 1JHFA 2FF4A 1O57A 2QVOA 1RZ4A 3BG5A 2NVQJ 2XGDA 1X58A 2F5CA 2Y2ZA 1A6QA 3BG3A 1ZLJA 3EQLF 1UB9A 4O6JA 2EFWA 2JJ7A 2ZXWH 2HR3A 1FX7A 1X1DA 1W5SA 3ZR8X 3CCJI 2DTZA 2ME0A 3HZJA 1TZLA 3LSIA 1Z3XA 2F5VA 2W57A 3WE3A 4I76A 1P2FA 4A5MA 5HVQC 3L2CA 3M4OJ 2XASA 1WJEA 5B1BH 1YX3A 2VJ5A 2L02A 2KL4A 3DQVC 4FHTA 4BAYA 3M1CA 4M3GA 1FZPB 1GUUA 2LMDA 5ICCA 3VOEA 1FP1D 1MSEC 5EEAA 2W85A 1WH7A 2BW3B 2QQAA 4U88A 2QF7A 3PIOF 4XORA 1FMWA 4ZZLA 3ZQIA 3OWTA 1ENHA 2MGQA 2NVTJ 2HFHA 4OU0A 4J01A 1WJFA 1BN5A 5AIPA 2TRTA 2WADA 2ADUA 2XAJA 4ZYAA 2HQRA 3A01B 3IHUA 3FBIB 2V1UA 3JRGA 1X4PA 3CCEI 1XMKA 4D0PA 1P4AA 2DU9A 2CO5A 2XAQA 2LF8A 2WTEA 4C2UA 2R7SA 3K1NA 3CCRI 1Y1VJ 3SDBA 5D5UB 3LNQA 4M9SA 5IOZA 2IP2A 2OU2A 3BJ6A 4PZJA 1UHMA 3BP8A 2JRTA 4RLFA 2PI0A 1APLC 3FXOA 1AA7A 3PNYA 4CYDA 1XGMA 5HLIA 1GDTA 3GLXA 2ZJ2A 4PGHA 4A0YA 4AVPA 4A93J 2DA7A 3GTOJ 2HZTA 3KEQA 4AYBA 3DWLE 1V3FA 4HQMA 2O3FA 2XAGA 1Z91A 3SEQA 3HHHA 3BR6A 5HOOA 5TISC 1R5HA 3GZ6A 2Y9YA 2GWRA 4HF1A 3AG3H 3DKWA 4LFUA 4BHBA 2NRAC 3B6CA 2DK8A 3HOUJ 3KP5A 1TL8A 5J8FA 1LDKB 1JUSA 1BW6A 2P5VA 4YIFA 2P6SA 1WJ5A 3QQAA 4AVZA 1LVKA 1ETQA 1HW1A 1R5ID 2V6CA 4L9JA 2R7FA 3PQJA 3M9AA 4F3QA 2CS3A 3SFIA 4BJ6C 2NVXJ 3BCAA 3C7JA 1ODDA 5EF6A 1KU2A 2ZFUA 3G1OA 1OCCH 4Q47A 1LB2A 4RM2A 3VSLA 2OQRA 2EFPA 3RQIA 1SD7A 3GXOA 3CCLI 4CGZA 3KYDB 3RKXA 4IX7A 4XK4A 3GEZA 4J19A 1T95A 1M1EB 2AXTC 5K5RA 1I50J 3SZGA 4JQFA 3CZ6A 1H9TA 3RYPA 4NB5A 3TP3A 2HOEA 2DN0A 3WTWC 5FLVA 3LA3A 3HGYA 1YW8A 3BROA 1B8IB 1ON2A 4XNFA 4LG3A 3JRCA 3S93A 1FTTA 3E6DA 4ZC3A 4ENMA 2Y69H 1IN7A 2DFFA 1C0WA 4LMYA 2DMQA 3R60A 1VQLI 3W6JB 3K4NA 2EA4A 1GVDA 1XGNA 1IZ1A 2DFHA 2D45A 2Y0SN 4UUSA 2LSOA 2OPTA 4YEJA 5CJ9A 1R5GA 3CLQA 1YJWI 1Z3YA 4UV9A 4JP0A 2R4GA 4KYWA 4YFKF 2LD5A 3FMRA 2PG4A 4G7OF 2IJLA 3O3KA 4M3DA 3OYNA 5J1UA 4BKXA 4XRFA 4BH9A 3N4MA 1XC5A 2QENA 3KP2A 3SJMA 3WE2A 5EG0B 3BZ6A 2KIQA 2IS6A 1YW9A 5ERIA 1LDJA 5GTIC 1ETYA 2E1MC 3CJTB 1TQMA 1BI3A 2KT0A 1VQ7I 2M4KA 3D5LA 5E8IA 2L2OA 1IGNA 3C2GA 4ZJZA 3FHZA 3RTRA 1J7KA 2IBDA 2VBXA 2DT7B 3BR2A 1DGWY 3GTQJ 4PJMA 1Z6RA 1YHQI 2KRCA 2UXNA 5CQEA 3I0TA 1EA3A 2OAZA 2A6HF 3KP4A 4JYKA 4MEXF 2VASA 3DLAA 2VKHA 5EGOB 3U1DA 4FETA 1TT5B 2E1OA 3J7AO 1PUFA 2K9LA 3KLNA 3BJAA 3EUHC 5IP7J 5LD2C 3FX3A 4DIQA 4DYCA 1SVMA 5IT9Z 2W48A 1FPQA 4ZYDA 2EWNA 2KDOA 1FEXA 2KDZA 2O8XA 3MMYB 3G4SI 5D8KB 5ILVA 2XROA 4FTHA 5J47A 2CH0A 2X6XA 2O8KA 2CFXA 2P5KA 4Y7NJ 2MC3A 2VI6A 2W1OA 2JA5J 3K2ZA 4HNVA 3AKZA 3ZQLA 4P96A 4PJJA 1OCTC 4CO8A 3BG7A 2V9PA 3F9KA 4E6KG 1LPQA 5L3EA 1IG7A 3PO3J 3OOUA 1O7LA 2Y0SA 5DEQA 2JWTA 5BOXA 2JA7J 2PN6A 1MMDA 3HOVJ 4MGRA 2LVSA 5GAEJ 2L5QA 5D8LB 5D5WB 2GAUA 2WC2A 2DDBA 5H2FC 1BIAA 3E6MA 4XICA 4FE7A 2RV8A 5E3OA 1YRNA 3LAJA 1JTYA 3LSKA 3CUQB 3DPLC 2CYYA 3FM5A 4D7NA 1D5VA 2X48A 2ICWG 4IHXA 2EILH 3CMYA 2E2HJ 4FX0A 3DTIA 1NG7A 3V7CA 4A6EA 1P7JA 3CP2A 3ABLH 2C6YA 1KU9A 4RGUA 5M5YJ 3K4LA 1HW2A 1Y39A 1NK2P 4MFDA 3KLOA 4KISA 1VQOI 2VL8A 3IH4A 1KA8A 2XPVA 1QPMA 3TMOA 4Y17A 1Y0UA 4HEA2 3UNGC 2AO9A 3JRIA 2FUG2 1CF7A 2K40A 1L3LA 4HQEA 2NVYJ 2F2EA 2QBYB 2V1XA 1IXRC 4BEHA 2DA3A 2NOGA 1G3SA 1FOKA 2BOLA 3JSPA 1IJWC 2CQXA 1CGPA 3OS2A 2O9LA 2DYSH 4XKBA 3HSFA 1TWHJ 2W7NA 2CRGA 1S72I 3HG9A 4HV6A 1ERDA 1O3QA 3V8LA 2RDPA 3IL2A 1WHUA 4LLNA 5F08A 5EJCA 4YIIA 3BTCA 2ZSIB 3LSJA 5CKTA 2DA1A 3CCYA 2VE8A 4QSHA 4UB6C 2V1DA 3VYRB 3BR0A 4A6DA 3E5UA 5F1RA 2BHYA 4RAGA 4B3AA 3S2DJ 3ERMA 1GV2A 3V4GA 3OYLA 2OC6A 2L3DA 4CHUA 4IKFA 1X3UA 5L3FA 2GOXB 3GX4X 4FCYA 4MEYF 2N8GA 2ZBKA 1SD4A 2F5EA 5FRMA 1Z0XA 2RVCA 2JVHA 3WTXC 2DOFA 2VKDA 3QPHA 2LH9A 4KNYA 2XB5A 2YSRA 1X1PA 1G3TA 3NWTA 5F6FA 1SVOA 4BUPA 2HU9A 3K10A 3G71I 3K69A 3IAS2 2GXGA 1FNNA 1V5EA 3I71A 4I99C 4XIDA 3HXLA 1YJNI 4Y33A 4L0ZB 1Y8QB 2CSOA 3FXMA 1KQ0A 2EQRA 1B59A 2EK5A 5BPDA 5FLXZ 4UXNA 4RGRA 4UB8C 2H6BA 3BG6A 1MZBA 4EM2A 3N97A 1FYKA 3CF5F 4E7IA 2M7AA 4RMNA 2K27A 2M7BA 3V8KA 4XRSG 5B5EC 4P9FA 4ESBA 4ZDOA 3OYEA 1R00A 4L5JA 3TW7A 2WAQN 3LSMA 3PNTA 1K4TA 1R23A 1H89C 2JMWA 3U1KA 1DPRA 2X1CA 3FIWA 3Q0UA 4A5NA 3EPZA 3MFKA 1U3EM 4HRIA 3E7LA 3KPHA 1F36A 5JR3A 1QRYA 4LB5A 2Z1DA 4D7MA 3GFLA 2PBIA 3VYTB 1R1UA 1G59A 1KU3A 2OCEA 4A2UA 1E17A 4E7KA 2Z9OA 2NS0A 3HRUA 3VWBA 3BY6A 2V1NA 1OR7A 4IXAA 1HXDA 5LLQA 3DKXA 1O4XA 1XX5A 4AD9A 1BI0A 1O3TA 5LHIA 1ZRCA 1D1CA 2GA1A 1GHCA 1YG2A 2R5ZB 2ZMEB 4XKWA 4BQQA 1U5TB 9ANTA 3BQYA 1FOWA 3QYBA 5FD6A 2LFBA 3GFIA 2E7WA 2XF6A 4G7ZF 3GBGA 1YW7A 2ZNYA 4Y15A 1X1AA 2P81A 3K4JA 3NQOA 3MKWB 1TT0A 4A3IJ 3MCZA 4MNUA 3LL7A 1ETWA 4DZPA 4A3LJ 4G94A 1B6AA 1HOMA 4KUMA 1IDYA 3OYKA 1J9IA 1Z05A 4BXUA 5ED4A 5ILUA 4I09A 3JR9A 4E7HA 4HF2A 2XRLA 1F4KA 2IA2A 2LBFB 4GXOA 1NH3A 3B73A 2HOSA 3OL3A 3LMMA 3VSKA 2EZIA 3HSEA 5K1YA 2CFOA 2BV6A 2XC7A 3I59B 2M1BA 2L9VA 4IOCF 3HGGA 1DUXC 4E7ZA 4BY1J 4Z2YA 1SC7A 1FSHA 2BW3A 2CUEA 3P9CA 4UVBA 4CZZA 5DUIA 2VPLA 4ASNA 2LRDA 5E17F 2R7XA 2DJNA 4PJLA 2QKLB 3DFGA 2QCOA 2VC1A 2A07F 3BZCA 4BGDA 3H0DA 2WAQA 3A01A 1S7OA 2DCEA 1Q1VA 1LVAA 4LGWA 4WX9A 4M9XA 3SYTA 3PO2J 3AG2H 2L01A 1X1BA 4JK1X 4G7HF 1MMAA 2H09A 2CQKA 1HC8A 4NC6A 2A5YB 4L9TA 3CO6C 2IS4A 4CICA 1TW2A 2VQHA 3D0SA 1T2KA 4FISA 2MD0A 2FNPA 1OLTA 2A6TA 1R1VA 3CCSI 3HUGB 3S2WA 3DBHB 2V4JC 1X3ZB 2CUFA 1JT0A 5KHDA 2IGNA 3QYEA 4KT6A 2X6WA 4EJWA 2ZCWA 3E5QA 4XKCA 5TRDA 3S14J 4NC8A 1ZHFA 4W97A 4I6ZA 1OKRA 4HBLA 3ZQHA 1SFUA 1S3JA 4S0HB 4RBOA 3W3CA 1YYVA 1P4XA 3OYIA 4XR6A 5CVUA 1FP2A 4E7LA 3F21A 4Q4ZF 5HNFA 2H8RA 1E3OC 1JKRC 3AAFA 1XSDA 1A5JA 3HPHA 4A3MJ 2FX0A 5GPAA 2R7TA 2XAFA 1BI2A 1ETVA 2YU9J 1LFPA 2DT5A 3ESWB 4M74A 3BLYA 4XONA 3FM3A 3I64A 4BS9A 2K86A 4IVNA 4XLAA 1FBQA 3I4NJ 5DCFA 4YG2F 4A3KJ 2AXLA 2PMUA 4YIRX 1ZLKA 1IRXA 3DU5A 4WWCA 2TDXA 4QPOA 3ZMZA 4BDYA 1HQCA 2XAUA 2JA6J 1SANA 4HOBA 1F43A 1RUOA 5DM7F 1E3HA 4QWQA 1U78A 2HDWA 4H4KC 3JRAA 1IRFA 1BC7C 4L0YB 3OSFA 1LE8B 1OCRH 3OYMA 5BPIA 2IPQX 1S7EA 2LG4A 3KP3A 4P5OA 1KONA 2LY2A 2D5VA 2KLOA 4LD5A 2GXBA 1W5CC 5F64A 3ISPA 3DPTA 4WXDA 3DU6A 1IN8A 3GMEA 1B8IA 2L9NA 3IP4B 2GIZA 3CQZJ 1VTNC 1UHWA 4K2EA 5FJ8J 1U2WA 4PDKA 4PSXA 4KDPA 2L7KA 4F93B 2FRHA 5IT9K 1UHSA 2F4MB 1IAWA 5D6FA 2IGOA 1PP8F 3F23A 3HYIA 1YIJI 4HF0A 1PP7U 2LYCA 4DGWB 1X2MA 2A61A 3O6BB 4Y52J 2R5YA 1QA6A 1LUJB 2RN7A 4ETSA 5JLWA 2M5WA 3FXKA 1FT9A 2HQ5A 2L7MP 1P4WA 4CSWA 1FYMA 1G2HA 3F72A 2FBKA 3R0JA 2DFIA 4JX4A 1TLHB 1WCMJ 2BBYA 4AYBN 3ZPLA 1VQ9I 2ETHA 1BR4A 2V9KA 5E3LA 2QQ8A 1LNWA 2OBPA 1WZ2A 4EJOA 2LTPA 1ZKGA 3KETA 2A69F 3QRFF 3FZVA 3FF5A 3ABMH 3A03A 1VQ6I 4OIOF 4KN4X 3RPUD 3LSRA 2R0QC 2F48A 5LEJA 3CDIA 1JUMA 1MH3A 1FBUA 2DA6A 1WJAA 4NBQA 3M1EA 1OR7C 4Q48A 3K4BA 4LG0B 1P6RA 3W6VA 2K4BA 2MLGA 4M3BA 1TW3A 1XN7A 3JCUC 1QU3A 2PJRB 5LEKA 2K85A 2H27A 1ONVA 3OYDA 3QP6A 4NDLA 3ONQA 3V7SA 2CWEA 2BXYA 3J7AY 2NNNA 2PQ8A 4EQQA 3VB2A 2NAZA 3D5SC 3NEUA 2GIVA 2H1KA 1FSEA 1WPKA 4EEFG 1XGOA 2P8TA 1WJBA 4EJTA 1QBJA 4CCLA 3GLLA 4M6YA 5C4JJ 3L9FA 2X1DA 5FLMJ 3ZN1A 4BE2A 1MSFC 1S9HA 1NHAA 3KE2A 2UUZA 3K4CA 3KCCA 5IP6A 1J5YA 5ICGA 3S15J 3Q0VA 4A69C 5DDGA 1JGGA 2CW7A 4CDGA 1QZYA 2DA4A 1QNTA 3KX2A 3CF2A 1T39A 4XRMA 1RR7A 2Z16A 3VYUB 4DBRA 2EJRA 3HPGA 2RQQA 3E6BA 3TO6A 5FKMA 1B9NA 2EBIA 1FJLA 4UUVA 4HX4A 1OCPA 3DCFA 3TEDA 2BVLA 2XKOA 1RKWA 2FE3A 2MABA 3W6KB 4C3JJ 5HS8A 2AHQA 2M34A 3ZCOA 2RC4A 4RAFA 5KAIC 3MD2A 4HDVA 1BJAA 3GCMA 3CD6I 2RQPA 2VLAA 5E8GA 2EZKA 2Z2SB 3G6EI 5E1ZB 2E71A 1ZR2A 4ZTJA 2M3AA 1XD7A 2LC2A 3BWGA 1FBSA 2EZLA 1P92A 3BR1A 2HXOA 2HXIA 2PLYA 2MYSA 2PEXA 4CA0A 4L5IA 3NAUA 1I3AA 5BQTA 1QO0D 5HLTA 5IPAA 2IA0A
chains in the Genus database with same CATH topology
4RAYA 4E70A 3H92A 5HS9A 3MZYA 3MZHA 2B0LA 3DF8A 5DCMB 1YLFA 1TQIA 2YU3A 1J59A 4IHSA 2HDCA 1HW5A 5FLXK 2QBYA 2VBZA 3IKVA 3KP6A 4KFCA 5FO5A 3NRVA 1F1ZA 3EDPA 1I6XA 2GQQA 3HSRA 2XIGA 2W84A 4OIRF 3KZYA 3R6SA 3CJNA 3MQ0A 4WXCA 1O3RA 2PFBA 2KJBA 5J8CA 3RIRA 4LK1F 3RYRA 2FOKA 4WXHA 1Z1DA 2XKPA 3CO7C 1TNSA 2ELHA 4B8XA 1SD6A 1G3YA 2KKOA 2IT0A 1RUNA 3IWZA 4OIPF 3LQRA 3GYHX 2KJCA 3WTUC 2G7UA 2P7CB 4U0YA 3G3ZA 3GW2A 3M8FA 4R8HA 4IRHA 4U0VA 4AWXB 1BOAA 2ZFWA 4GGGA 1Z9CA 2XV4S 4HZFA 4MTDA 3F3XA 4RAZA 4I01A 1RNLA 2QUFA 5EEHA 1J2XA 2QWWA 4L9VA 3V7RA 2ZMEA 4UVCA 3L7WA 1I5ZA 1JGSA 3ABTA 1FLIA 2BEOA 1SMTA 1L0OC 4ESFA 3COAC 3QOPA 3R0AA 4AIJA 1KQ9A 2DTRA 2R3SA 1Z7UA 2FA5A 2ZNZA 2JT1A 2K4JA 1O3SA 3L00A 4M6XA 3VEPA 2AS5F 3I59A 1BC8C 1MDMA 1ZG1A 4B09A 2ISZA 4RB0A 3WODF 2DLLA 1DDNA 4WK8F 1TQPA 3FWEA 4EM1A 1R1TA 4S05A 3HRSA 5L3GA 1WRJA 1XGSA 2EB7A 3LA2A 4BQAA 1XSVA 4HYEA 4U7DA 2HTSA 4XLPF 1KQ8A 5D5VB 4GYGA 3JW4A 3ZN0A 1KYZA 2M87A 3RDIA 1RIOH 4XLNF 3HUGA 2ESNA 2EV0A 1JE8A 2EFQA 4G6DA 3ERED 2DPUA 1MKMA 2LNBA 2K02A 2OD5A 4RB3C 2DO7A 3BJOA 2JPBA 2UWMA 1BI1A 3GVAA 4HV5A 1D8KA 3TKYA 2Q8KA 2FU4A 4ENNA 1KGSA 1LEAA 2O03A 2H6CA 5FFXA 2NNYA 4QLCU 5ICFA 2X0LA 1YIOA 1K78A 2KIMA 5FFZA 4I0BA 2HEOA 5DD8A 3G73A 4KIBA 1B1BA 2KIUA 1T0FA 2J5PA 4ON0A 2G9WA 1GHCA 3F22A 1SMYF 2JZYA 2ACJA 2VXZA 3ELKA 2RKHA 5HDNA 1SAXA 5KVRA 4DQ2A 1UCRA 2IA1A 3DP7A 2LF7A 5CVIA 3ZMVA 4OMZA 5E1XA 1OMIA 3BOQA 1T6SA 3ZMSA 2W25A 4LJZF 1YO5C 4OOIA 1GXQA 1R58A 3F6OA 4DNCA 3WTYC 3K0LA 3OV8A 2XVCA 3CLOA 2XAHA 4YFXF 2FNAA 3H3ZA 2FXAA 1B9MA 5H20A 1T38A 4HX7A 2E1NA 2EV5A 2M8EA 1ZRFA 2IW5A 3HOSA 1K79A 3RPQA 1G3WA 4ZZDA 5CYVA 3GF2A 2L4AA 1REPC 4NHJA 3TQNA 3QPTA 1MJBA 2FSWA 1R36A 1BM9A 3K1PA 3JSOA 3J80Z 3LFKA 3ZP5A 3MEXA 1ON1A 3I58A 1STZA 4HA8A 1XDUA 4N9HA 4FX4A 3PQKA 4IRIA 3EYIA 1QQIA 3Q9VA 1S8NA 2MH2A 1PDNC 4RB1A 3TOBA 1XSXA 4BHCA 3WTZA 3ZMUA 3T8TA 4R1HA 2E1CA 4RS8A 3KP7A 3LQQA 3GUDA 4IHTA 4RGSA 3LAPA 2EV6A 3SHFA 3ABUA 5A2QZ 1H9GA 5L3DA 2L54A 3EETA 2WWYA 1F5TA 1IN5A 5D6EA 3F8MA 2VE9A 4IPAA 1AOYA 1S6LA 5K5QA 5HS7A 3ZQ7A 3O2PE 2FMLA 4OMYA 4P9UA 5DCMA 4LK0F 3F6VA 1ZARA 2EFOA 1DP7P 2F5DA 1IXCA 4O3MA 1YS6A 1XMAA 3HTSB 2HYGD 4HX8A 4MQVA 2VT2A 4AIKA 4UV8A 3WU0A 1G6NA 2DQRA 1FY7A 5ILSA 2HS5A 1EV7A 3C18A 2MA3A 5AIQA 5LHHA 3TGNA 3J81Z 1WI9A 2YX4A 4KN7X 1K7AA 4XSXF 1IN6A 3SXYA 2KRFA 4UNOA 4M71A 3T0YA 2JPCA 1WQ2A 4YFNF 4UHTA 5LRRA 4ENKA 2CGPA 1YS7A 4KA4A 2OQGA 1ZH5A 2X4HA 2P7VB 1WSUA 2WV0A 3JTGA 4HDUA 2OZUA 2VN2A 4IF4A 2CG4A 3SFZA 1BIBA 4I7HA 3ROUA 4HLYA 2GA2A 2BGCA 3BPXA 4HW0A 5EEGA 1U6GA 2YPRA 4LB6B 4Q5SF 4ZYEA 2NYXA 2A6EF 3ECOA 4WCGA 5FD5A 2Q0OA 4MQ9F 1XCBA 1SFXA 1F9NA 4OINF 5IT3A 3E5XA 1OYIA 4NQWA 1MJ9A 1A04A 4M72A 3IRQA 4EMSA 2FQ3A 2QZ8A 5H6RA 1I27A 3GO5A 6PAXA 1S7AA 2MBFA 2Z99A 5LRSA 3F8BA 2F5FA 1ZGAA 3QP5A 4EJVA 3B02A 1JHHA 2FMYA 1W5TA 1BBYA 1R22A 1ZGJA 3CUQA 2OA4A 3T1BA 2GZWA 4HAMA 5L3CA 1OYWA 2IVMA 2MLKA 3DV8A 4LLGF 3U9GA 3FMSA 3MAJA 1B4AA 1XB4A 5JI6A 1IF1A 4N0BA 5BS6A 5LGTA 2V9VA 4I0AA 3CTAA 4EVIA 2XRNA 1W4MA 5LHGA 4KICA 3R61A 4KT5C 2P5LC 2CW0F 3KFWX 1SD5A 3SZTA 3IRRA 1W7PB 2IRFG 1D8JA 2XGXA 2VBYA 1Q1HA 2QLZA 3IC7A 5E18F 3U2RA 3WTSC 3V8JA 2OZ6A 5DUKA 3R4KA 4O5VA 4EV0A 4WF2A 5CLSA 3DXJF 3IKTA 3P7NA 3ML6A 3LA7A 1IW7F 4EM0B 2BE5F 2DK5A 3F8CA 3KZZA 2IA0A 4EJUA 2W24A 2HTJA 1O7FA 3K9TA 3F8FA 1ZG3A 2YR2A 1ZRDA 1QZZA 1PUEE 3J80K 1KU7A 1DPUA 1ZN2A 3RJPA 5CVRA 4JBAA 4HLXA 5D5XB 5JFRA 5K5OA 2M45A 1RI7A 4CXFA 4KIFA 2JSCA 2HQNA 5AONA 1I1SA 3K1MA 1EH7A 1U5TA 5D4RA 1HBXG 3OOPA 4BNCA 2HWVA 5FB2A 1MJAA 3E6CC 2DAOA 3CDHA 1J75A 1WKMA 5A2QK 1HSJA 2BYVE 3FXQA 1J0RA 3LSTA 1FWZA 2XUBA 1XDSA 2M30A 2RGVA 3JAMK 1USSA 3WGGA 2A3SA 5TJJA 2ISYA 4EGYA 1K6OA 1IN4A 4BHPA 1EH6A 3I54A 2VODA 2D2WA 3RPUA 4XBFA 1KYWA 5HLGA 3WTVC 5L3BA 3C3WA 4A0ZA 3MWMA 3DEUA 1ZAOA 1MGTA 2HKOA 5H6QA 2DI3A 3QU3A 2HGCA 5DV5A 3ULQB 5D4SA 5FGMA 2VOPA 2P4WA 4R79A 1GVJA 2KIFA 3JTHA 1W7PD 3GFMA 4MTEA 5LBQA 1I1GA 1SFEA 1Z6TA 3CUQC 1YTYA 5DYMA 3GZ5A 2L4MA 1IUYA 2ZXJA 4KMFA 5HDGA 3HIFA 3J81K 1ZYRF 3HHGA 4Y13A 5E20A 2QQ9A 4UVAA 1FC3A 4G8XA 3VFZA 2O61A 3KEOA 2PMHA 2VONA 1TTYA 1WWXA 2A68F 2O6GE 2FBIA 3TDZC 3E3VA 3SZPA 3I53A 4G9YA 2Y75A 5ICEA 3IWFA 3T5XA 1LJ9A 3QU6A 4GO1A 4PGGA 3QAHA 2RNJA 2QQBA 2H94A 2LKPA 3Q5FA 2ESHA 3ECHA 4I2OA 2Y48A 2O0YA 2J5OA 1R7JA 1ULYA 2HKXA 2VT3A 1UFMA 4N9IA 4XSZF 3HRMA 4U0WA 1YQAA 3F8NA 2HYFA 2VBWA 3PFIA 3FMQA 4PCQA 1USTA 3I4PA 4LLLA 5CVJA 1V4RA 1H0MA 3VODA 2FEZA 5CVVA 1TNTA 1AWCA 5E1WA 4KMUX 4EGZA 4IJAA 4RB2C 4GCVA 2D1HA 3FXRA 3H3UA 1HKSA 4LG0A 3BDDA 2E7XA 1TBXA 4I02A 2ZO4A 4KIGA 1U5TC 5JVTA 5DD4A 1HKQA 3EYYA 3L09A 3RI4A 5HDKA 1G4DA 5LGUA 1LDDA 4OIQF 2G7HA 4M9ZA 1MDMB 2V79A 2K7LA 3WTTC 1LQ1A 3I5UA 1JXSA 1LEBA 3M7GA 1ZREA 2DPDA 5HLHA 3T8RA 3TDUC 3HTUA 2Y0MA 4BYYA 3REOA 4I98B 2PJPA 1GXPA 4TV7A 4FT8A 5BMZA 3TO9A 2EFNA 3JAMZ 4L18B 3GFJA 4ESJA 1CF7B 3WG9A 4GYIA 3Q9SA 4AIHA 1D3YA 5KK1A 4G6QA 2STTA 1ZG5A 2XHKA 4P55A 1XCVA 2D1VA 2P6TA 2COMA 1FYLA 4F7ZA 4S04A 4ENJA 2LDUA 2QYOA 1E2XA 3GWZA 3HRTA 1QGPA 2UXXA 4U7BA 5LGNA 3HOTA 3C1DA 1HSTA 2EA2A 3WGHA 1IXSB 3TOAA 4MHGA 3RKYA 1W7PA 2Z5UA 4ZH4F 1IRGA 2YX7A 5JHUA 2ZKZA 2JTVA 2DBBA 2DQLA 3WU1B 1K78B 3M8EA 1YFHA 4M73A 3RKWA 3SQNA 1MD0A 3ZMTA 3FXUA 2STWA 1U8RA 2QM3A 3BPVA 3ZMDA 1EH8A 1HKTA 4H0EA 2UZKA 3CUOA 4L9NA 4A0XA 3P9IA 3P9KA 2DW4A 3E97A 2VOOA 3LWFA 5J6XA 1OYYA 1S29A 4A12A 4IRGA 1T98A 2MH9A 2Z33A 2FBHA 4RGXA 4ZYHA 3EUHA 2Q2EA 1OPCA 2Z3YA 2R7DA 2VC0A 3WGIA 3TO7A 2MD5A 1JHFA 2FF4A 1O57A 2QVOA 1RZ4A 2F5CA 1ZLJA 3EQLF 1UB9A 4O6JA 2EFWA 2HR3A 1FX7A 1W5SA 2W57A 3WE3A 1P2FA 4A5MA 3L2CA 5HVQC 2XASA 3DQVC 2L02A 4FHTA 4BAYA 1FZPB 5ICCA 3VOEA 1FP1D 2W85A 2QQAA 4U88A 4ZZLA 2HFHA 4OU0A 1BN5A 5AIPA 2ADUA 2XAJA 2HQRA 3IHUA 2V1UA 1XMKA 4D0PA 1P4AA 2DU9A 2CO5A 2XAQA 2LF8A 2WTEA 3K1NA 5D5UB 4M9SA 2IP2A 2OU2A 3BJ6A 4PZJA 1UHMA 3BP8A 2JRTA 2PI0A 4CYDA 1XGMA 5HLIA 3GLXA 2ZJ2A 4PGHA 4A0YA 4AVPA 2HZTA 3KEQA 1V3FA 4HQMA 2O3FA 2XAGA 1Z91A 3HHHA 5HOOA 3GZ6A 1R5HA 2GWRA 4HF1A 3DKWA 4LFUA 4BHBA 2NRAC 2DK8A 3KP5A 5J8FA 1LDKB 2P5VA 4YIFA 2P6SA 2V6CA 4L9JA 1HW1A 2R7FA 3PQJA 3M9AA 3C7JA 1ODDA 1KU2A 4Q47A 1LB2A 2OQRA 2EFPA 1SD7A 3GXOA 4CGZA 3RKXA 3GEZA 5K5RA 4JQFA 1H9TA 3RYPA 4NB5A 2HOEA 3WTWC 3LA3A 1YW8A 3BROA 1ON2A 3E6DA 4ENMA 1IN7A 1C0WA 4LMYA 3R60A 3W6JB 2EA4A 1XGNA 1IZ1A 2D45A 2LSOA 5CJ9A 1R5GA 4UV9A 4KYWA 4YFKF 3FMRA 2PG4A 4G7OF 2IJLA 3O3KA 4XRFA 4BH9A 3N4MA 2QENA 3KP2A 3WE2A 3BZ6A 1YW9A 5ERIA 1LDJA 1TQMA 1BI3A 3D5LA 5E8IA 3FHZA 3RTRA 1J7KA 2VBXA 1Z6RA 2UXNA 3I0TA 2OAZA 2A6HF 3KP4A 4MEXF 3U1DA 3J7AO 3KLNA 3BJAA 3FX3A 5IT9Z 1FPQA 4ZYDA 2EWNA 2O8XA 5D8KB 5ILVA 2XROA 2CFXA 2P5KA 2MC3A 3K2ZA 4P96A 4CO8A 5L3EA 1O7LA 5DEQA 5BOXA 2PN6A 4MGRA 5D8LB 5D5WB 2GAUA 2WC2A 1BIAA 3E6MA 2RV8A 3LAJA 3CUQB 3DPLC 2CYYA 3FM5A 1D5VA 4FX0A 3V7CA 4A6EA 2C6YA 1KU9A 4RGUA 1HW2A 3KLOA 1KA8A 1QPMA 4Y17A 1Y0UA 1CF7A 1L3LA 4HQEA 2F2EA 2QBYB 2V1XA 1IXRC 1G3SA 1FOKA 3JSPA 1CGPA 3HSFA 4HV6A 1O3QA 3V8LA 2RDPA 3IL2A 4LLNA 4YIIA 2VE8A 2V1DA 4A6DA 3E5UA 5F1RA 4CHUA 3V4GA 2L3DA 1X3UA 5L3FA 3GX4X 4MEYF 2ZBKA 1SD4A 2F5EA 2RVCA 3WTXC 3QPHA 4KNYA 2YSRA 1G3TA 5F6FA 3K69A 2GXGA 1FNNA 3I71A 4L0ZB 2CSOA 1KQ0A 1B59A 2EK5A 5BPDA 5FLXZ 4UXNA 4RGRA 2H6BA 3N97A 1MZBA 4EM2A 1FYKA 2K27A 3V8KA 4P9FA 4ESBA 1R00A 4L5JA 1R23A 1DPRA 4A5NA 3MFKA 1U3EM 5JR3A 4LB5A 3GFLA 2PBIA 1R1UA 1KU3A 4A2UA 1E17A 2Z9OA 2NS0A 3HRUA 3BY6A 1OR7A 4IXAA 1HXDA 5LLQA 4AD9A 1BI0A 1O3TA 5LHIA 1ZRCA 2GA1A 1YG2A 2ZMEB 1U5TB 5FD6A 3GFIA 2E7WA 4G7ZF 1YW7A 2ZNYA 4Y15A 3NQOA 3MCZA 4MNUA 4G94A 1B6AA 4KUMA 1J9IA 1Z05A 4BXUA 5ED4A 5ILUA 4I09A 4HF2A 1F4KA 2IA2A 4GXOA 3B73A 3HSEA 5K1YA 2BV6A 3I59B 2M1BA 1DUXC 4Z2YA 1FSHA 3P9CA 4UVBA 4CZZA 5DUIA 4ASNA 5E17F 3DFGA 2VC1A 2A07F 1S7OA 4WX9A 1LVAA 4LGWA 4M9XA 2L01A 4JK1X 4G7HF 2H09A 2CQKA 2A5YB 4L9TA 3CO6C 4CICA 1TW2A 3D0SA 1T2KA 2FNPA 1R1VA 3S2WA 4EJWA 2ZCWA 3E5QA 5TRDA 1ZHFA 1OKRA 4HBLA 1SFUA 1S3JA 1YYVA 1P4XA 5CVUA 1FP2A 3F21A 4Q4ZF 3AAFA 1XSDA 2XAFA 1BI2A 2DT5A 4M74A 3FM3A 3I64A 2K86A 4IVNA 1FBQA 5DCFA 4YG2F 2AXLA 2PMUA 1ZLKA 4WWCA 2TDXA 3ZMZA 1HQCA 4HOBA 1RUOA 4QWQA 1U78A 1IRFA 1BC7C 4L0YB 5BPIA 2IPQX 3KP3A 4P5OA 4LD5A 2GXBA 5F64A 3ISPA 3DPTA 4WXDA 1IN8A 1VTNC 1UHWA 4K2EA 1U2WA 4PDKA 4KDPA 2FRHA 5IT9K 1IAWA 5D6FA 1PP8F 3F23A 3HYIA 4HF0A 1PP7U 2A61A 3O6BB 2RN7A 4ETSA 2M5WA 1FYMA 1FT9A 1P4WA 3F72A 2FBKA 3R0JA 2DFIA 1TLHB 2BBYA 3ZPLA 2ETHA 1LNWA 2OBPA 4EJOA 3KETA 2A69F 3QRFF 3FZVA 3FF5A 4OIOF 4KN4X 5LEJA 1FBUA 3M1EA 4Q48A 4LG0B 1P6RA 2K4BA 2MLGA 1TW3A 1XN7A 5LEKA 2H27A 1ONVA 3QP6A 3V7SA 2CWEA 2NNNA 2PQ8A 4EQQA 3VB2A 2NAZA 3NEUA 2GIVA 1FSEA 1XGOA 2P8TA 4EJTA 1QBJA 4M6YA 3L9FA 3ZN1A 1NHAA 3KE2A 3KCCA 1J5YA 5ICGA 5DDGA 4CDGA 1QZYA 1QNTA 1T39A 2EJRA 3E6BA 3TO6A 1B9NA 4UUVA 4HX4A 2XKOA 2FE3A 3W6KB 5HS8A 2RC4A 4HDVA 1BJAA 2RQPA 5E8GA 5E1ZB 1XD7A 3BWGA 1FBSA 1P92A 2PLYA 2PEXA 4L5IA 5BQTA 1QO0D 4ZYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RAY A;  4E70 A;  3H92 A;  5HS9 A;  3MZY A;  3MZH A;  2B0L A;  3DF8 A;  5DCM B;  1YLF A;  1TQI A;  2YU3 A;  1J59 A;  4IHS A;  2HDC A;  1HW5 A;  5FLX K;  2QBY A;  2VBZ A;  3IKV A;  3KP6 A;  4KFC A;  5FO5 A;  3NRV A;  1F1Z A;  3EDP A;  1I6X A;  2GQQ A;  3HSR A;  2XIG A;  2W84 A;  4OIR F;  3KZY A;  3R6S A;  3CJN A;  3MQ0 A;  4WXC A;  1O3R A;  2PFB A;  2KJB A;  5J8C A;  3RIR A;  4LK1 F;  3RYR A;  2FOK A;  4WXH A;  1Z1D A;  2XKP A;  3CO7 C;  1TNS A;  2ELH A;  4B8X A;  1SD6 A;  1G3Y A;  2KKO A;  2IT0 A;  1RUN A;  3IWZ A;  4OIP F;  3LQR A;  3GYH X;  2KJC A;  3WTU C;  2G7U A;  2P7C B;  4U0Y A;  3G3Z A;  3GW2 A;  3M8F A;  4R8H A;  4IRH A;  4U0V A;  4AWX B;  1BOA A;  2ZFW A;  4GGG A;  1Z9C A;  2XV4 S;  4HZF A;  4MTD A;  3F3X A;  4RAZ A;  4I01 A;  1RNL A;  2QUF A;  5EEH A;  1J2X A;  2QWW A;  4L9V A;  3V7R A;  2ZME A;  4UVC A;  3L7W A;  1I5Z A;  1JGS A;  3ABT A;  1FLI A;  2BEO A;  1SMT A;  1L0O C;  4ESF A;  3COA C;  3QOP A;  3R0A A;  4AIJ A;  1KQ9 A;  2DTR A;  2R3S A;  1Z7U A;  2FA5 A;  2ZNZ A;  2JT1 A;  2K4J A;  1O3S A;  3L00 A;  4M6X A;  3VEP A;  2AS5 F;  3I59 A;  1BC8 C;  1MDM A;  1ZG1 A;  4B09 A;  2ISZ A;  4RB0 A;  3WOD F;  2DLL A;  1DDN A;  4WK8 F;  1TQP A;  3FWE A;  4EM1 A;  1R1T A;  4S05 A;  3HRS A;  5L3G A;  1WRJ A;  1XGS A;  2EB7 A;  3LA2 A;  4BQA A;  1XSV A;  4HYE A;  4U7D A;  2HTS A;  4XLP F;  1KQ8 A;  5D5V B;  4GYG A;  3JW4 A;  3ZN0 A;  1KYZ A;  2M87 A;  3RDI A;  1RIO H;  4XLN F;  3HUG A;  2ESN A;  2EV0 A;  1JE8 A;  2EFQ A;  4G6D A;  3ERE D;  2DPU A;  1MKM A;  2LNB A;  2K02 A;  2OD5 A;  4RB3 C;  2DO7 A;  3BJO A;  2JPB A;  2UWM A;  1BI1 A;  3GVA A;  4HV5 A;  1D8K A;  3TKY A;  2Q8K A;  2FU4 A;  4ENN A;  1KGS A;  1LEA A;  2O03 A;  2H6C A;  5FFX A;  2NNY A;  4QLC U;  5ICF A;  2X0L A;  1YIO A;  1K78 A;  2KIM A;  5FFZ A;  4I0B A;  2HEO A;  5DD8 A;  3G73 A;  4KIB A;  1B1B A;  2KIU A;  1T0F A;  2J5P A;  4ON0 A;  2G9W A;  1GHC A;  3F22 A;  1SMY F;  2JZY A;  2ACJ A;  2VXZ A;  3ELK A;  2RKH A;  5HDN A;  1SAX A;  5KVR A;  4DQ2 A;  1UCR A;  2IA1 A;  3DP7 A;  2LF7 A;  5CVI A;  3ZMV A;  4OMZ A;  5E1X A;  1OMI A;  3BOQ A;  1T6S A;  3ZMS A;  2W25 A;  4LJZ F;  1YO5 C;  4OOI A;  1GXQ A;  1R58 A;  3F6O A;  4DNC A;  3WTY C;  3K0L A;  3OV8 A;  2XVC A;  3CLO A;  2XAH A;  4YFX F;  2FNA A;  3H3Z A;  2FXA A;  1B9M A;  5H20 A;  1T38 A;  4HX7 A;  2E1N A;  2EV5 A;  2M8E A;  1ZRF A;  2IW5 A;  3HOS A;  1K79 A;  3RPQ A;  1G3W A;  4ZZD A;  5CYV A;  3GF2 A;  2L4A A;  1REP C;  4NHJ A;  3TQN A;  3QPT A;  1MJB A;  2FSW A;  1R36 A;  1BM9 A;  3K1P A;  3JSO A;  3J80 Z;  3LFK A;  3ZP5 A;  3MEX A;  1ON1 A;  3I58 A;  1STZ A;  4HA8 A;  1XDU A;  4N9H A;  4FX4 A;  3PQK A;  4IRI A;  3EYI A;  1QQI A;  3Q9V A;  1S8N A;  2MH2 A;  1PDN C;  4RB1 A;  3TOB A;  1XSX A;  4BHC A;  3WTZ A;  3ZMU A;  3T8T A;  4R1H A;  2E1C A;  4RS8 A;  3KP7 A;  3LQQ A;  3GUD A;  4IHT A;  4RGS A;  3LAP A;  2EV6 A;  3SHF A;  3ABU A;  5A2Q Z;  1H9G A;  5L3D A;  2L54 A;  3EET A;  2WWY A;  1F5T A;  1IN5 A;  5D6E A;  3F8M A;  2VE9 A;  4IPA A;  1AOY A;  1S6L A;  5K5Q A;  5HS7 A;  3ZQ7 A;  3O2P E;  2FML A;  4OMY A;  4P9U A;  5DCM A;  4LK0 F;  3F6V A;  1ZAR A;  2EFO A;  1DP7 P;  2F5D A;  1IXC A;  4O3M A;  1YS6 A;  1XMA A;  3HTS B;  2HYG D;  4HX8 A;  4MQV A;  2VT2 A;  4AIK A;  4UV8 A;  3WU0 A;  1G6N A;  2DQR A;  1FY7 A;  5ILS A;  2HS5 A;  1EV7 A;  3C18 A;  2MA3 A;  5AIQ A;  5LHH A;  3TGN A;  3J81 Z;  1WI9 A;  2YX4 A;  4KN7 X;  1K7A A;  4XSX F;  1IN6 A;  3SXY A;  2KRF A;  4UNO A;  4M71 A;  3T0Y A;  2JPC A;  1WQ2 A;  4YFN F;  4UHT A;  5LRR A;  4ENK A;  2CGP A;  1YS7 A;  4KA4 A;  2OQG A;  1ZH5 A;  2X4H A;  2P7V B;  1WSU A;  2WV0 A;  3JTG A;  4HDU A;  2OZU A;  2VN2 A;  4IF4 A;  2CG4 A;  3SFZ A;  1BIB A;  4I7H A;  3ROU A;  4HLY A;  2GA2 A;  2BGC A;  3BPX A;  4HW0 A;  5EEG A;  1U6G A;  2YPR A;  4LB6 B;  4Q5S F;  4ZYE A;  2NYX A;  2A6E F;  3ECO A;  4WCG A;  5FD5 A;  2Q0O A;  4MQ9 F;  1XCB A;  1SFX A;  1F9N A;  4OIN F;  5IT3 A;  3E5X A;  1OYI A;  4NQW A;  1MJ9 A;  1A04 A;  4M72 A;  3IRQ A;  4EMS A;  2FQ3 A;  2QZ8 A;  5H6R A;  1I27 A;  3GO5 A;  6PAX A;  1S7A A;  2MBF A;  2Z99 A;  5LRS A;  3F8B A;  2F5F A;  1ZGA A;  3QP5 A;  4EJV A;  3B02 A;  1JHH A;  2FMY A;  1W5T A;  1BBY A;  1R22 A;  1ZGJ A;  3CUQ A;  2OA4 A;  3T1B A;  2GZW A;  4HAM A;  5L3C A;  1OYW A;  2IVM A;  2MLK A;  3DV8 A;  4LLG F;  3U9G A;  3FMS A;  3MAJ A;  1B4A A;  1XB4 A;  5JI6 A;  1IF1 A;  4N0B A;  5BS6 A;  5LGT A;  2V9V A;  4I0A A;  3CTA A;  4EVI A;  2XRN A;  1W4M A;  5LHG A;  4KIC A;  3R61 A;  4KT5 C;  2P5L C;  2CW0 F;  3KFW X;  1SD5 A;  3SZT A;  3IRR A;  1W7P B;  2IRF G;  1D8J A;  2XGX A;  2VBY A;  1Q1H A;  2QLZ A;  3IC7 A;  5E18 F;  3U2R A;  3WTS C;  3V8J A;  2OZ6 A;  5DUK A;  3R4K A;  4O5V A;  4EV0 A;  4WF2 A;  5CLS A;  3DXJ F;  3IKT A;  3P7N A;  3ML6 A;  3LA7 A;  1IW7 F;  4EM0 B;  2BE5 F;  2DK5 A;  3F8C A;  3KZZ A;  2IA0 A;  4EJU A;  2W24 A;  2HTJ A;  1O7F A;  3K9T A;  3F8F A;  1ZG3 A;  2YR2 A;  1ZRD A;  1QZZ A;  1PUE E;  3J80 K;  1KU7 A;  1DPU A;  1ZN2 A;  3RJP A;  5CVR A;  4JBA A;  4HLX A;  5D5X B;  5JFR A;  5K5O A;  2M45 A;  1RI7 A;  4CXF A;  4KIF A;  2JSC A;  2HQN A;  5AON A;  1I1S A;  3K1M A;  1EH7 A;  1U5T A;  5D4R A;  1HBX G;  3OOP A;  4BNC A;  2HWV A;  5FB2 A;  1MJA A;  3E6C C;  2DAO A;  3CDH A;  1J75 A;  1WKM A;  5A2Q K;  1HSJ A;  2BYV E;  3FXQ A;  1J0R A;  3LST A;  1FWZ A;  2XUB A;  1XDS A;  2M30 A;  2RGV A;  3JAM K;  1USS A;  3WGG A;  2A3S A;  5TJJ A;  2ISY A;  4EGY A;  1K6O A;  1IN4 A;  4BHP A;  1EH6 A;  3I54 A;  2VOD A;  2D2W A;  3RPU A;  4XBF A;  1KYW A;  5HLG A;  3WTV C;  5L3B A;  3C3W A;  4A0Z A;  3MWM A;  3DEU A;  1ZAO A;  1MGT A;  2HKO A;  5H6Q A;  2DI3 A;  3QU3 A;  2HGC A;  5DV5 A;  3ULQ B;  5D4S A;  5FGM A;  2VOP A;  2P4W A;  4R79 A;  1GVJ A;  2KIF A;  3JTH A;  1W7P D;  3GFM A;  4MTE A;  5LBQ A;  1I1G A;  1SFE A;  1Z6T A;  3CUQ C;  1YTY A;  5DYM A;  3GZ5 A;  2L4M A;  1IUY A;  2ZXJ A;  4KMF A;  5HDG A;  3HIF A;  3J81 K;  1ZYR F;  3HHG A;  4Y13 A;  5E20 A;  2QQ9 A;  4UVA A;  1FC3 A;  4G8X A;  3VFZ A;  2O61 A;  3KEO A;  2PMH A;  2VON A;  1TTY A;  1WWX A;  2A68 F;  2O6G E;  2FBI A;  3TDZ C;  3E3V A;  3SZP A;  3I53 A;  4G9Y A;  2Y75 A;  5ICE A;  3IWF A;  3T5X A;  1LJ9 A;  3QU6 A;  4GO1 A;  4PGG A;  3QAH A;  2RNJ A;  2QQB A;  2H94 A;  2LKP A;  3Q5F A;  2ESH A;  3ECH A;  4I2O A;  2Y48 A;  2O0Y A;  2J5O A;  1R7J A;  1ULY A;  2HKX A;  2VT3 A;  1UFM A;  4N9I A;  4XSZ F;  3HRM A;  4U0W A;  1YQA A;  3F8N A;  2HYF A;  2VBW A;  3PFI A;  3FMQ A;  4PCQ A;  1UST A;  3I4P A;  4LLL A;  5CVJ A;  1V4R A;  1H0M A;  3VOD A;  2FEZ A;  5CVV A;  1TNT A;  1AWC A;  5E1W A;  4KMU X;  4EGZ A;  4IJA A;  4RB2 C;  4GCV A;  2D1H A;  3FXR A;  3H3U A;  1HKS A;  4LG0 A;  3BDD A;  2E7X A;  1TBX A;  4I02 A;  2ZO4 A;  4KIG A;  1U5T C;  5JVT A;  5DD4 A;  1HKQ A;  3EYY A;  3L09 A;  3RI4 A;  5HDK A;  1G4D A;  5LGU A;  1LDD A;  4OIQ F;  2G7H A;  4M9Z A;  1MDM B;  2V79 A;  2K7L A;  3WTT C;  1LQ1 A;  3I5U A;  1JXS A;  1LEB A;  3M7G A;  1ZRE A;  2DPD A;  5HLH A;  3T8R A;  3TDU C;  3HTU A;  2Y0M A;  4BYY A;  3REO A;  4I98 B;  2PJP A;  1GXP A;  4TV7 A;  4FT8 A;  5BMZ A;  3TO9 A;  2EFN A;  3JAM Z;  4L18 B;  3GFJ A;  4ESJ A;  1CF7 B;  3WG9 A;  4GYI A;  3Q9S A;  4AIH A;  1D3Y A;  5KK1 A;  4G6Q A;  2STT A;  1ZG5 A;  2XHK A;  4P55 A;  1XCV A;  2D1V A;  2P6T A;  2COM A;  1FYL A;  4F7Z A;  4S04 A;  4ENJ A;  2LDU A;  2QYO A;  1E2X A;  3GWZ A;  3HRT A;  1QGP A;  2UXX A;  4U7B A;  5LGN A;  3HOT A;  3C1D A;  1HST A;  2EA2 A;  3WGH A;  1IXS B;  3TOA A;  4MHG A;  3RKY A;  1W7P A;  2Z5U A;  4ZH4 F;  1IRG A;  2YX7 A;  5JHU A;  2ZKZ A;  2JTV A;  2DBB A;  2DQL A;  3WU1 B;  1K78 B;  3M8E A;  1YFH A;  4M73 A;  3RKW A;  3SQN A;  1MD0 A;  3ZMT A;  3FXU A;  2STW A;  1U8R A;  2QM3 A;  3BPV A;  3ZMD A;  1EH8 A;  1HKT A;  4H0E A;  2UZK A;  3CUO A;  4L9N A;  4A0X A;  3P9I A;  3P9K A;  2DW4 A;  3E97 A;  2VOO A;  3LWF A;  5J6X A;  1OYY A;  1S29 A;  4A12 A;  4IRG A;  1T98 A;  2MH9 A;  2Z33 A;  2FBH A;  4RGX A;  4ZYH A;  3EUH A;  2Q2E A;  1OPC A;  2Z3Y A;  2R7D A;  2VC0 A;  3WGI A;  3TO7 A;  2MD5 A;  1JHF A;  2FF4 A;  1O57 A;  2QVO A;  1RZ4 A;  2F5C A;  1ZLJ A;  3EQL F;  1UB9 A;  4O6J A;  2EFW A;  2HR3 A;  1FX7 A;  1W5S A;  2W57 A;  3WE3 A;  1P2F A;  4A5M A;  3L2C A;  5HVQ C;  2XAS A;  3DQV C;  2L02 A;  4FHT A;  4BAY A;  1FZP B;  5ICC A;  3VOE A;  1FP1 D;  2W85 A;  2QQA A;  4U88 A;  4ZZL A;  2HFH A;  4OU0 A;  1BN5 A;  5AIP A;  2ADU A;  2XAJ A;  2HQR A;  3IHU A;  2V1U A;  1XMK A;  4D0P A;  1P4A A;  2DU9 A;  2CO5 A;  2XAQ A;  2LF8 A;  2WTE A;  3K1N A;  5D5U B;  4M9S A;  2IP2 A;  2OU2 A;  3BJ6 A;  4PZJ A;  1UHM A;  3BP8 A;  2JRT A;  2PI0 A;  4CYD A;  1XGM A;  5HLI A;  3GLX A;  2ZJ2 A;  4PGH A;  4A0Y A;  4AVP A;  2HZT A;  3KEQ A;  1V3F A;  4HQM A;  2O3F A;  2XAG A;  1Z91 A;  3HHH A;  5HOO A;  3GZ6 A;  1R5H A;  2GWR A;  4HF1 A;  3DKW A;  4LFU A;  4BHB A;  2NRA C;  2DK8 A;  3KP5 A;  5J8F A;  1LDK B;  2P5V A;  4YIF A;  2P6S A;  2V6C A;  4L9J A;  1HW1 A;  2R7F A;  3PQJ A;  3M9A A;  3C7J A;  1ODD A;  1KU2 A;  4Q47 A;  1LB2 A;  2OQR A;  2EFP A;  1SD7 A;  3GXO A;  4CGZ A;  3RKX A;  3GEZ A;  5K5R A;  4JQF A;  1H9T A;  3RYP A;  4NB5 A;  2HOE A;  3WTW C;  3LA3 A;  1YW8 A;  3BRO A;  1ON2 A;  3E6D A;  4ENM A;  1IN7 A;  1C0W A;  4LMY A;  3R60 A;  3W6J B;  2EA4 A;  1XGN A;  1IZ1 A;  2D45 A;  2LSO A;  5CJ9 A;  1R5G A;  4UV9 A;  4KYW A;  4YFK F;  3FMR A;  2PG4 A;  4G7O F;  2IJL A;  3O3K A;  4XRF A;  4BH9 A;  3N4M A;  2QEN A;  3KP2 A;  3WE2 A;  3BZ6 A;  1YW9 A;  5ERI A;  1LDJ A;  1TQM A;  1BI3 A;  3D5L A;  5E8I A;  3FHZ A;  3RTR A;  1J7K A;  2VBX A;  1Z6R A;  2UXN A;  3I0T A;  2OAZ A;  2A6H F;  3KP4 A;  4MEX F;  3U1D A;  3J7A O;  3KLN A;  3BJA A;  3FX3 A;  5IT9 Z;  1FPQ A;  4ZYD A;  2EWN A;  2O8X A;  5D8K B;  5ILV A;  2XRO A;  2CFX A;  2P5K A;  2MC3 A;  3K2Z A;  4P96 A;  4CO8 A;  5L3E A;  1O7L A;  5DEQ A;  5BOX A;  2PN6 A;  4MGR A;  5D8L B;  5D5W B;  2GAU A;  2WC2 A;  1BIA A;  3E6M A;  2RV8 A;  3LAJ A;  3CUQ B;  3DPL C;  2CYY A;  3FM5 A;  1D5V A;  4FX0 A;  3V7C A;  4A6E A;  2C6Y A;  1KU9 A;  4RGU A;  1HW2 A;  3KLO A;  1KA8 A;  1QPM A;  4Y17 A;  1Y0U A;  1CF7 A;  1L3L A;  4HQE A;  2F2E A;  2QBY B;  2V1X A;  1IXR C;  1G3S A;  1FOK A;  3JSP A;  1CGP A;  3HSF A;  4HV6 A;  1O3Q A;  3V8L A;  2RDP A;  3IL2 A;  4LLN A;  4YII A;  2VE8 A;  2V1D A;  4A6D A;  3E5U A;  5F1R A;  4CHU A;  3V4G A;  2L3D A;  1X3U A;  5L3F A;  3GX4 X;  4MEY F;  2ZBK A;  1SD4 A;  2F5E A;  2RVC A;  3WTX C;  3QPH A;  4KNY A;  2YSR A;  1G3T A;  5F6F A;  3K69 A;  2GXG A;  1FNN A;  3I71 A;  4L0Z B;  2CSO A;  1KQ0 A;  1B59 A;  2EK5 A;  5BPD A;  5FLX Z;  4UXN A;  4RGR A;  2H6B A;  3N97 A;  1MZB A;  4EM2 A;  1FYK A;  2K27 A;  3V8K A;  4P9F A;  4ESB A;  1R00 A;  4L5J A;  1R23 A;  1DPR A;  4A5N A;  3MFK A;  1U3E M;  5JR3 A;  4LB5 A;  3GFL A;  2PBI A;  1R1U A;  1KU3 A;  4A2U A;  1E17 A;  2Z9O A;  2NS0 A;  3HRU A;  3BY6 A;  1OR7 A;  4IXA A;  1HXD A;  5LLQ A;  4AD9 A;  1BI0 A;  1O3T A;  5LHI A;  1ZRC A;  2GA1 A;  1YG2 A;  2ZME B;  1U5T B;  5FD6 A;  3GFI A;  2E7W A;  4G7Z F;  1YW7 A;  2ZNY A;  4Y15 A;  3NQO A;  3MCZ A;  4MNU A;  4G94 A;  1B6A A;  4KUM A;  1J9I A;  1Z05 A;  4BXU A;  5ED4 A;  5ILU A;  4I09 A;  4HF2 A;  1F4K A;  2IA2 A;  4GXO A;  3B73 A;  3HSE A;  5K1Y A;  2BV6 A;  3I59 B;  2M1B A;  1DUX C;  4Z2Y A;  1FSH A;  3P9C A;  4UVB A;  4CZZ A;  5DUI A;  4ASN A;  5E17 F;  3DFG A;  2VC1 A;  2A07 F;  1S7O A;  4WX9 A;  1LVA A;  4LGW A;  4M9X A;  2L01 A;  4JK1 X;  4G7H F;  2H09 A;  2CQK A;  2A5Y B;  4L9T A;  3CO6 C;  4CIC A;  1TW2 A;  3D0S A;  1T2K A;  2FNP A;  1R1V A;  3S2W A;  4EJW A;  2ZCW A;  3E5Q A;  5TRD A;  1ZHF A;  1OKR A;  4HBL A;  1SFU A;  1S3J A;  1YYV A;  1P4X A;  5CVU A;  1FP2 A;  3F21 A;  4Q4Z F;  3AAF A;  1XSD A;  2XAF A;  1BI2 A;  2DT5 A;  4M74 A;  3FM3 A;  3I64 A;  2K86 A;  4IVN A;  1FBQ A;  5DCF A;  4YG2 F;  2AXL A;  2PMU A;  1ZLK A;  4WWC A;  2TDX A;  3ZMZ A;  1HQC A;  4HOB A;  1RUO A;  4QWQ A;  1U78 A;  1IRF A;  1BC7 C;  4L0Y B;  5BPI A;  2IPQ X;  3KP3 A;  4P5O A;  4LD5 A;  2GXB A;  5F64 A;  3ISP A;  3DPT A;  4WXD A;  1IN8 A;  1VTN C;  1UHW A;  4K2E A;  1U2W A;  4PDK A;  4KDP A;  2FRH A;  5IT9 K;  1IAW A;  5D6F A;  1PP8 F;  3F23 A;  3HYI A;  4HF0 A;  1PP7 U;  2A61 A;  3O6B B;  2RN7 A;  4ETS A;  2M5W A;  1FYM A;  1FT9 A;  1P4W A;  3F72 A;  2FBK A;  3R0J A;  2DFI A;  1TLH B;  2BBY A;  3ZPL A;  2ETH A;  1LNW A;  2OBP A;  4EJO A;  3KET A;  2A69 F;  3QRF F;  3FZV A;  3FF5 A;  4OIO F;  4KN4 X;  5LEJ A;  1FBU A;  3M1E A;  4Q48 A;  4LG0 B;  1P6R A;  2K4B A;  2MLG A;  1TW3 A;  1XN7 A;  5LEK A;  2H27 A;  1ONV A;  3QP6 A;  3V7S A;  2CWE A;  2NNN A;  2PQ8 A;  4EQQ A;  3VB2 A;  2NAZ A;  3NEU A;  2GIV A;  1FSE A;  1XGO A;  2P8T A;  4EJT A;  1QBJ A;  4M6Y A;  3L9F A;  3ZN1 A;  1NHA A;  3KE2 A;  3KCC A;  1J5Y A;  5ICG A;  5DDG A;  4CDG A;  1QZY A;  1QNT A;  1T39 A;  2EJR A;  3E6B A;  3TO6 A;  1B9N A;  4UUV A;  4HX4 A;  2XKO A;  2FE3 A;  3W6K B;  5HS8 A;  2RC4 A;  4HDV A;  1BJA A;  2RQP A;  5E8G A;  5E1Z B;  1XD7 A;  3BWG A;  1FBS A;  1P92 A;  2PLY A;  2PEX A;  4L5I A;  5BQT A;  1QO0 D;  4ZYG A; 
#chains in the Genus database with same CATH topology
 4RAY A;  4E70 A;  2DXI A;  3H92 A;  5HS9 A;  3H5N A;  3MZY A;  3MZH A;  4HNT A;  2B0L A;  3BTL A;  3DF8 A;  4F55 A;  5DCM B;  5B1A H;  3PSF A;  2VJ4 A;  1YLF A;  3TP0 A;  1TQI A;  2YU3 A;  1J59 A;  4IHS A;  2HDC A;  3BC8 A;  2K9N A;  1PYV A;  2TCT A;  1HW5 A;  5FLX K;  2QBY A;  2VBZ A;  3IKV A;  2OCC H;  3KP6 A;  4W1U A;  2E5N A;  4KFC A;  5FO5 A;  3NRV A;  1PVE A;  1F1Z A;  3EDP A;  2LKX A;  1N78 A;  3B6A A;  1I6X A;  3H5R A;  2WAF A;  2LP0 A;  4D9J A;  1T08 B;  2CUJ A;  4FE4 A;  2GQQ A;  2DMN A;  3HSR A;  4OAZ A;  2XIG A;  2W84 A;  4BL0 B;  2HPI A;  4OIR F;  4XOT A;  1YIT I;  1V5F A;  3KZY A;  5F0C A;  3R6S A;  1RPW A;  3L2U A;  1SFO J;  3CJN A;  1GV5 A;  3MKY B;  3MQ0 A;  4PFP A;  4WXC A;  1O3R A;  2PFB A;  2VKV A;  2COB A;  2KJB A;  5J8C A;  1ZQ3 P;  3OYF A;  3RIR A;  5C3E J;  4LK1 F;  3RYR A;  2FOK A;  4WXH A;  1Z1D A;  3TW6 A;  1MBE A;  3AG1 H;  3W2A A;  1K6Y A;  2XKP A;  3CO7 C;  2RAE A;  1TNS A;  1XTA A;  2ELH A;  1SD6 A;  1G3Y A;  4B8X A;  5FRO A;  1DGR M;  2KKO A;  4F52 A;  5KNL A;  2IT0 A;  2E1M B;  4HPQ A;  1RUN A;  3IWZ A;  2EIM H;  2ID6 A;  2HOT A;  4IQJ A;  1VQK I;  2ZB9 A;  4OIP F;  2ID3 A;  3CDL A;  3LQR A;  3GYH X;  2KJC A;  3WTU C;  2G7U A;  5E79 C;  3AFH A;  2P7C B;  4U0Y A;  3G3Z A;  3GW2 A;  1WJD A;  3OYG A;  3M8F A;  4R8H A;  4NC7 A;  3K2A A;  4IRH A;  4U0V A;  4NNJ A;  1K4S A;  1U8B A;  1X2N A;  4AWX B;  3CMM A;  1BOA A;  5F04 A;  2ZFW A;  4GGG A;  1Z9C A;  1VND A;  5J4Y A;  2XV4 S;  1MBF A;  4HZF A;  4AM3 A;  4XQF A;  3PNV A;  1IV8 A;  3DBR B;  1NG6 A;  1ITY A;  4MTD A;  3F3X A;  1YX5 A;  1BW5 A;  4RAZ A;  2QA4 I;  1WFX A;  4I01 A;  1RNL A;  2KP6 A;  3GTP J;  2QUF A;  5EEH A;  1J2X A;  2QWW A;  2DJI A;  3CJR B;  1QHG A;  1X3W B;  5C4X J;  2V7F A;  3D1N I;  1D0X A;  4C2T A;  4L9V A;  3V7R A;  3BT9 A;  2R5Z A;  2ZME A;  4JX5 A;  3S1M J;  4UVC A;  2EZH A;  1U9O A;  2VB6 A;  3L7W A;  2V26 A;  1I5Z A;  4LIU A;  5IP9 J;  1H8A C;  1JGS A;  3ABT A;  3FKI J;  4B1R A;  2BEO A;  1FLI A;  2H1L A;  1SMT A;  3WHB A;  1L0O C;  3HKZ A;  2W00 A;  4BJT A;  4ESF A;  3COA C;  3GTK J;  1MIJ A;  2WY8 Q;  3QOP A;  3R0A A;  3J7Z I;  4AIJ A;  4MLO A;  1KQ9 A;  2DTR A;  2FOW A;  2NXN B;  2R3S A;  4NQW B;  1RR8 C;  1Z7U A;  3DTK A;  2FA5 A;  4PUS A;  1HCR A;  5J1Y A;  2JSP A;  2VIX A;  2ZNZ A;  1YJ9 I;  2JT1 A;  1MMG A;  3VYS B;  5FKL A;  2LBF A;  2K4J A;  3L1P A;  1O3S A;  4A3C J;  4N4N B;  2W82 A;  3S3N A;  3L00 A;  4M6X A;  3VEP A;  3A4C A;  3I59 A;  2AS5 F;  3S1N J;  1BC8 C;  1MDM A;  2XPW A;  4D5F A;  1ZG1 A;  2BY3 A;  4PFO A;  4B09 A;  4D5C A;  4RB0 A;  2ISZ A;  4NUB A;  3WOD F;  2BY1 A;  2DLL A;  4XOP A;  3W2V A;  1DDN A;  2B63 J;  4WK8 F;  1TQP A;  3FK6 A;  5KAF C;  4YEL A;  3FWE A;  1VQP I;  3EUA A;  4EM1 A;  3OYJ A;  1FOX A;  3HOW J;  1R1T A;  3L2V A;  1TC3 C;  4S05 A;  3HRS A;  5L3G A;  1FMV A;  1WRJ A;  2R93 J;  1XGS A;  2EB7 A;  4ANJ A;  2JRM A;  3LA2 A;  3JRF A;  2R7W A;  4BQA A;  2XGE A;  1XSV A;  4HYE A;  2HTS A;  4XLP F;  5M3M J;  4U7D A;  1KQ8 A;  5D5V B;  4GYG A;  3JW4 A;  1V55 H;  3ZN0 A;  1KYZ A;  2ECC A;  3JRH A;  2M87 A;  2LRE A;  3RDI A;  3FK7 A;  4QIW N;  1RIO H;  4U87 A;  4XLN F;  3HUG A;  4DYQ A;  3RQ4 A;  1J09 A;  4BU2 A;  2CW8 A;  2ESN A;  2F6C A;  2EV0 A;  3GTM J;  1JE8 A;  2EFQ A;  2DDA A;  1WGX A;  4G6D A;  3ERE D;  3S8P A;  1R71 A;  2DPU A;  1MKM A;  2LNB A;  2K02 A;  2OD5 A;  4RB3 C;  2DO7 A;  1DQU A;  4XLC A;  3BJO A;  2JPB A;  5J3L A;  4CCM A;  2BVM A;  2UWM A;  2M4G A;  1BI1 A;  1NTC A;  3OYB A;  3A1Y A;  3LSH A;  3GVA A;  4XL9 A;  1IDZ A;  1JUP A;  3HC7 A;  4HV5 A;  2BY2 A;  1D8K A;  1W36 C;  4CYC A;  3HDD A;  3TKY A;  2Q8K A;  2FU4 A;  3HM5 A;  2X1E A;  2JUG A;  4ENN A;  2HQA A;  3ZQG A;  3KYC B;  2M0M A;  3GZN B;  4XM3 A;  1GLN A;  1KGS A;  3L2Q A;  1LEA A;  1VZ0 A;  2O03 A;  2H6C A;  3IH3 A;  1N77 A;  1FIA A;  5FFX A;  3I55 I;  3JRD A;  2NNY A;  4F91 B;  3S32 A;  4QLC U;  1EJ9 A;  2DOE A;  5ICF A;  2X0L A;  5F1J A;  3CC4 I;  4Y4R A;  1YIO A;  1K78 A;  2KIM A;  1R4M B;  2WAE A;  5FFZ A;  4I0B A;  3UKG A;  3CP8 A;  2CV1 A;  5FKN A;  2HEO A;  2GBY A;  4PSW A;  5DD8 A;  4KIB A;  3OYC A;  3G73 A;  5GPC A;  4DW6 A;  1B1B A;  1MMS A;  2O5R A;  1XG1 A;  4UUS B;  2E19 A;  3NAR A;  2KIU A;  1I6H J;  1T0F A;  2J5P A;  4ON0 A;  2G9W A;  2XF5 A;  5J1R A;  1YI2 I;  4E7J A;  3F22 A;  4IHW A;  1SMY F;  2JZY A;  2VXD A;  2ACJ A;  2VXZ A;  3ELK A;  1MBG A;  2RKH A;  3OR2 C;  5HDN A;  1SAX A;  5KVR A;  4DQ2 A;  1UCR A;  2EH3 A;  2IA1 A;  3DP7 A;  4XN0 A;  2LF7 A;  3PIP F;  3K4M A;  5CVI A;  3ZMV A;  1ETK A;  4OMZ A;  5E1X A;  1EKE A;  3TBI A;  1OMI A;  3BOQ A;  1T6S A;  3ZMS A;  5B3S H;  2W25 A;  4LJZ F;  1YO5 C;  4OOI A;  1GXQ A;  1R58 A;  3F6O A;  4DNC A;  3WHC A;  4G6T B;  3WTY C;  3S16 J;  3K0L A;  2DMU A;  1R6R A;  3HEF A;  3OV8 A;  2XVC A;  3CLO A;  2XAH A;  4YFX F;  2FNA A;  3I56 I;  1LFB A;  3H3Z A;  2FXA A;  1B9M A;  5H20 A;  1T38 A;  1LFU P;  4HX7 A;  2E1N A;  2EV5 A;  2M8E A;  1ZRF A;  3BCB A;  2IW5 A;  3HOS A;  2E34 A;  2XGC A;  3FXL A;  5CPR B;  3J7Y J;  2F4O B;  2DA5 A;  1K79 A;  2CV2 A;  1A31 A;  2LY1 A;  3RPQ A;  5B66 C;  2WB1 A;  1G3W A;  4ZZD A;  3DLL F;  5CYV A;  3HJE A;  1PUF B;  3GF2 A;  2L4A A;  3OS1 A;  2E36 A;  1REP C;  3MVP A;  1OCZ H;  4NHJ A;  1IO2 A;  3TQN A;  3K70 C;  3H1C A;  3QPT A;  1MJB A;  2FSW A;  2E5Z A;  1R36 A;  1OJL A;  1B72 B;  1BM9 A;  2ZSH B;  1D0Z A;  3K1P A;  3JSO A;  3DBL B;  3LFK A;  5IOY A;  3J80 Z;  3ZP5 A;  1AKH B;  2WY7 Q;  3MEX A;  1ON1 A;  3I58 A;  5F0F A;  4GRI A;  1LKX A;  1STZ A;  4HA8 A;  1XDU A;  4N9H A;  2X51 A;  1EF4 A;  4FX4 A;  3PQK A;  4IRI A;  3DKY A;  2XB0 X;  4BBR J;  1QQI A;  3EYI A;  3Q9V A;  1S8N A;  4ZDL A;  2MH2 A;  1PDN C;  2KRH A;  4RB1 A;  4LOC A;  3TOB A;  1T56 A;  1XSX A;  4BHC A;  4A3J J;  3WTZ A;  3ZMU A;  3T8T A;  4C2M J;  4R1H A;  3HOZ J;  1K61 A;  1G8X A;  1XMX A;  2MFZ A;  3FKJ A;  4BE1 A;  2E1C A;  1YRN B;  5GAG J;  4RS8 A;  2ZJQ F;  3KP7 A;  3WU2 C;  3LQQ A;  4V2G A;  3GUD A;  4IHT A;  1RKT A;  1VQN I;  4RGS A;  3LAP A;  3VPR A;  2EV6 A;  5BNG A;  1TWG J;  3SHF A;  2HDD A;  3ABU A;  3LSG A;  1SAU A;  5A2Q Z;  1H9G A;  2JA2 A;  1QVT A;  1QHH D;  5L3D A;  2L54 A;  3EET A;  2WWY A;  1F5T A;  3DTE A;  2ZJR F;  2PMZ A;  5IY5 H;  3A02 A;  5IYD J;  1QPI A;  4ZYG A;  4AUX A;  1IN5 A;  2WA0 A;  2LLK A;  5D6E A;  1SEU A;  1I39 A;  4M6V A;  3F8M A;  2VE9 A;  2ZXH A;  4IPA A;  1AOY A;  1ETX A;  1S6L A;  5K5Q A;  1XPX A;  5HS7 A;  3ZQ7 A;  3RZO J;  3O2P E;  1U9N A;  4ZDP A;  2FML A;  4OMY A;  4P9U A;  4HST A;  2V6E A;  2DOA A;  5M5X J;  1IRZ A;  5DCM A;  2QSH X;  3O8G A;  4LK0 F;  3F6V A;  5K7Z A;  1ZAR A;  3W2W A;  3OIP A;  2EFO A;  1DP7 P;  2F5D A;  1IXC A;  4O3M A;  3OL4 A;  2R7V A;  2NS8 A;  1K83 J;  1YOV B;  1YS6 A;  1XMA A;  3HTS B;  2HYG D;  2VKE A;  4HX8 A;  2RNG A;  4ZTF A;  4MQV A;  2VT2 A;  4AIK A;  4UV8 A;  3WU0 A;  3S17 J;  2I5U A;  1G6N A;  4QTR A;  2E2J J;  2R7O A;  2DQR A;  2B7E A;  1FY7 A;  4P1W A;  1T33 A;  2HS5 A;  5CQG A;  5ILS A;  1EV7 A;  2WBM A;  3SDG A;  3C18 A;  2ZC2 A;  2MA3 A;  5HNH A;  1Y0N A;  5AIQ A;  3RCO A;  4A3D J;  4PJN A;  5LHH A;  3TGN A;  3J81 Z;  1WI9 A;  2R7R A;  3C2B A;  3BZK A;  2YX4 A;  3AL0 C;  4KN7 X;  4L5E A;  3PFY A;  1K7A A;  3M8J A;  4XSX F;  1IN6 A;  3H5A A;  1DU0 A;  2R7U A;  1TWC J;  3SXY A;  2KRF A;  4UNO A;  3HOY J;  4CCO A;  3OY9 A;  5FRN A;  4IZZ A;  2QSF X;  3ABK H;  1BA5 A;  4M71 A;  4E7S A;  3AG4 H;  3BR3 A;  3OMY A;  1TWA J;  2JPC A;  3T0Y A;  1JJ6 C;  2KZV A;  2ZXI A;  1WQ2 A;  4DYR A;  4CCN A;  4E4H A;  4YFN F;  4UHT A;  2G0E A;  5EG0 A;  5LRR A;  5JLX A;  4DJA A;  4ENK A;  2CGP A;  1RC9 A;  4II3 A;  2M0C A;  1YS7 A;  4KA4 A;  1ZTR A;  4ITV A;  4XLH A;  2OQG A;  2BZT A;  1ZH5 A;  5JVG F;  2X4H A;  2P7V B;  1WSU A;  1V5G A;  1VQ5 I;  3CC2 I;  2WV0 A;  3JTG A;  3C2H A;  4HDU A;  2OZU A;  2VN2 A;  4IF4 A;  4MIM A;  2CG4 A;  2VJJ A;  3SFZ A;  4V2F A;  1BIB A;  4I7H A;  3ROU A;  4HLY A;  2OF7 A;  5EGO A;  2JQ7 A;  1FTZ A;  1WI3 A;  2GA2 A;  2HVQ A;  4Y3O A;  2BGC A;  2EIN H;  3BPX A;  4HW0 A;  2KIS A;  5E3M A;  2CV0 A;  5EEG A;  1U6G A;  2KFD A;  1JKP C;  1KZH A;  2DFE A;  1SFK A;  2CJJ A;  4PK4 A;  2XDV A;  2YPR A;  2IS1 A;  2HOA A;  4LB6 B;  4Q5S F;  2OUM A;  4ZYE A;  2NYX A;  2A6E F;  3RKQ A;  4RDU A;  3ECO A;  1BL0 A;  4WCG A;  4M3F A;  5FD5 A;  4MO7 A;  2Q0O A;  4MQ9 F;  1XCB A;  1SFX A;  1F9N A;  2VJI A;  4OIN F;  2IAI A;  4CCJ A;  4BXF A;  5IT3 A;  2PX9 A;  3E5X A;  3I3L A;  3DPU A;  1OYI A;  4IO9 F;  2HVR A;  4NQW A;  5DS9 A;  2GXA A;  1MJ9 A;  1A04 A;  1PJR A;  4M72 A;  1U0J A;  4EMS A;  2FQ3 A;  3IRQ A;  2CUZ A;  1IC8 A;  2OJE D;  5GAD J;  2QZ8 A;  4XN3 A;  5H6R A;  1I27 A;  3HBL A;  5M3F J;  2YS9 A;  3K4K A;  3GO5 A;  6PAX A;  1S7A A;  2MBF A;  2Z99 A;  5LRS A;  3CES A;  3F8B A;  4OWR B;  2F5F A;  1ZGA A;  3G2B A;  3QP5 A;  3B02 A;  2DA2 A;  4EJV A;  1JHH A;  1JKO C;  2FMY A;  1W5T A;  3RZD J;  1BBY A;  2KPM A;  1R22 A;  1ZGJ A;  3CUQ A;  3LSP A;  4RA2 A;  2OA4 A;  2CU7 A;  3K7A J;  3T1B A;  3ZGK A;  4KJZ A;  3JRB A;  2I8D A;  5J40 A;  1W0T A;  1JKQ C;  1MH4 A;  4BDZ A;  3NWS A;  2GZW A;  2E60 A;  4HAM A;  5L3C A;  3UR3 C;  1OYW A;  4FAS D;  2IVM A;  3O8H A;  1UJ8 A;  2M2E A;  1DU6 A;  2MLK A;  1JTX A;  3PM1 A;  3DV8 A;  4LLG F;  1FIP A;  3U9G A;  1D0Y A;  2FD5 A;  3PL8 A;  3FMS A;  3M3Y J;  2ECB A;  3MAJ A;  1VQM I;  1B4A A;  3OSG A;  1XB4 A;  5JI6 A;  2F4I A;  1UAA A;  1IF1 A;  2K9Q A;  4N0B A;  1FOY A;  5BS6 A;  5LGT A;  2V9V A;  4I0A A;  4B4C A;  2DMT A;  3CTA A;  1ACI A;  2K9M A;  4EVI A;  2XRN A;  3MKL A;  4A3E J;  3M07 A;  1W4M A;  2JK3 A;  2HYJ A;  5LHG A;  4KIC A;  3R61 A;  1ETO A;  4KT5 C;  2P5L C;  2CW0 F;  5EDN A;  2E2I J;  3KFW X;  1SD5 A;  4C9Y A;  3SZT A;  3IRR A;  4IL6 C;  2AQF A;  2A05 A;  1W7P B;  2IRF G;  1OQY A;  1MNM C;  1D8J A;  2EPF A;  2XGX A;  2VBY A;  2OTL I;  2IEK A;  2JVG A;  3HKZ N;  2OTJ I;  1Q1H A;  2QLZ A;  3IC7 A;  5E18 F;  3U2R A;  3WTS C;  1ZEL A;  3V8J A;  4M3E A;  2OZ6 A;  2IS2 A;  1OFC X;  4RM3 A;  5DUK A;  3R4K A;  3ZQF A;  3U21 A;  1Y1W J;  3HL2 A;  2L0K A;  4O5V A;  2ELJ A;  4EV0 A;  4WF2 A;  2L9R A;  5CLS A;  3DXJ F;  3IKT A;  1MNE A;  3OR1 C;  3P7N A;  3ML6 A;  2NS7 A;  3LA7 A;  1IW7 F;  5IYB J;  4EM0 B;  4ABZ A;  3L2W A;  2BE5 F;  2DK5 A;  3F8C A;  3KZZ A;  1N75 A;  1V54 H;  2H8W A;  3E1S A;  3A0H C;  2CQ7 A;  3I4M J;  4EJU A;  3S1Q J;  2W24 A;  2HTJ A;  1O7F A;  3K9T A;  2DT6 A;  4EAT A;  3F8F A;  1T8I A;  1ZG3 A;  2YR2 A;  2XSJ C;  1QZZ A;  4HNU A;  3ZQC A;  1ZRD A;  1PUE E;  3J80 K;  1KU7 A;  1DPU A;  1ZN2 A;  3RJP A;  2R5Y B;  5CVR A;  2P0W A;  4JBA A;  4HLX A;  5D5X B;  5JFR A;  4DZJ A;  5K5O A;  3D5R C;  3S3O A;  4GDF A;  2Q2E B;  3FHN A;  2GOM A;  2Y30 A;  2K9S A;  2M45 A;  3DEW A;  1RI7 A;  5GP9 A;  4CXF A;  5DTD A;  1QVU A;  1XS9 A;  4KIF A;  2JSC A;  1D1A A;  4RLQ A;  2HQN A;  5AON A;  3KZI C;  4X0G A;  3H3V K;  1I1S A;  3K1M A;  3FDY A;  2CQN A;  1EH7 A;  1U5T A;  1OIS A;  5D4R A;  1HBX G;  1MBK A;  2ME6 A;  3OOP A;  4BNC A;  2HWV A;  5FB2 A;  2LOO A;  1MJA A;  3E6C C;  2DAO A;  3CDH A;  5C44 J;  2Y31 A;  3N05 A;  4C3I J;  1J75 A;  1WKM A;  1JT6 A;  1HSJ A;  2IXS A;  2BYV E;  5A2Q K;  3FXQ A;  3QWL A;  3KIO A;  1X19 A;  2L9S A;  2CQQ A;  2DMP A;  5K7F A;  1J0R A;  3LST A;  1B72 A;  1FWZ A;  2XUB A;  1XDS A;  2M30 A;  2RGV A;  3JAM K;  1USS A;  3PSI A;  3P5J A;  3BQZ A;  3QOD A;  2A3S A;  4X1E A;  3WGG A;  1AKH A;  5TJJ A;  2ISY A;  4EGY A;  3CMA I;  2BHZ A;  2X85 A;  4B48 A;  1K6O A;  1IN4 A;  4BHP A;  1EH6 A;  4A3B J;  3I54 A;  2VOD A;  2D2W A;  3RPU A;  1Y6I A;  4XBF A;  4C3H J;  3H0G J;  1KYW A;  5HLG A;  3WTV C;  5L3B A;  1YE9 A;  1Z67 A;  3C3W A;  4XKV A;  4A0Z A;  1ZR4 A;  3MWM A;  3TL4 X;  3DEU A;  1DP3 A;  1ZAO A;  1MGT A;  4AID A;  2HKO A;  2X9D A;  5H6Q A;  2OV7 A;  2DI3 A;  4HG2 A;  4N4O B;  1A6I A;  3S1R J;  4CUG A;  2VPR A;  4IHY A;  3QU3 A;  4X6A J;  2HGC A;  2ZJP F;  4BQO A;  3MN2 A;  5FKK A;  5DV5 A;  2X6O A;  3ULQ B;  5D4S A;  1JI8 A;  5FGM A;  1HF0 A;  2VOP A;  1BR1 A;  2P4W A;  4R79 A;  2B9S A;  1GVJ A;  2KIF A;  1WJC A;  3JTH A;  1W7P D;  3GFM A;  4MTE A;  5LBQ A;  1I1G A;  3KEY A;  2QSG X;  3IUO A;  1SFE A;  1Z6T A;  3CUQ C;  3Q0W A;  5DYM A;  1YTY A;  3GZ5 A;  3X2Q H;  2L4M A;  1IUY A;  2ZXJ A;  3PUB A;  4KMF A;  3KYL A;  5HDG A;  4YRV A;  2RRE A;  1AHD P;  3HIF A;  3J81 K;  1VF9 A;  1ZYR F;  1HDD C;  1Z77 A;  2XPU A;  2DOD A;  1JJ8 C;  3G1M A;  2HI3 A;  3HHG A;  4Y13 A;  5E20 A;  1OCO H;  2WV1 A;  4JOM A;  4UUT A;  2GM4 A;  2QQ9 A;  4UVA A;  2X6Y A;  1FC3 A;  2HNH A;  4G8X A;  1W1W E;  3VFZ A;  5GAH J;  2HZD A;  2O61 A;  2R92 J;  3KEO A;  3V42 A;  3CC7 I;  2WB1 N;  3HOX J;  1R49 A;  3DEE A;  2PMH A;  2KMU A;  3IH2 A;  2VON A;  1TTY A;  1WWX A;  1UMQ A;  2A68 F;  2MC4 A;  2O6G E;  1E0E A;  2FBI A;  3TDZ C;  3H36 A;  3E3V A;  3G1L A;  3SZP A;  5EZH A;  3I53 A;  1D1B A;  4G9Y A;  2Y75 A;  3H9G A;  5ICE A;  3BTJ A;  1P9Q C;  1WVR A;  4DOZ A;  1AU7 A;  3IWF A;  2I10 A;  3ASN H;  3VDX A;  1LE8 A;  4V19 K;  3T5X A;  4B44 A;  4IQ4 A;  1LJ9 A;  3QU6 A;  1SVL A;  4GO1 A;  1ZK8 A;  3QPS A;  3ASO H;  4PGG A;  1WH5 A;  3QAH A;  2RNJ A;  2QQB A;  2H94 A;  2LKP A;  4A3F J;  1UZC A;  3Q5F A;  1IV6 A;  4GFB A;  2L7Z A;  2ESH A;  3ECH A;  4I2O A;  2Y48 A;  2CMP A;  1MMN A;  2O0Y A;  3K6G A;  4F92 B;  3MKZ A;  2J5O A;  2M8G X;  1R7J A;  1NK3 P;  1VQ4 I;  1ULY A;  2HKX A;  2VT3 A;  2E35 A;  3OIQ A;  1Z7L A;  4KIT B;  1UFM A;  4B3X A;  4N9I A;  3CCQ I;  4XSZ F;  3HRM A;  4U0W A;  2QGU A;  3FXJ A;  1TP4 A;  4XMY A;  1VQ8 I;  1YQA A;  1H88 C;  3F8N A;  3GTL J;  5E3N A;  3BG9 A;  2HYF A;  2VBW A;  3LFU A;  3PFI A;  3FMQ A;  4PCQ A;  1UST A;  1N25 A;  3QYF A;  2UV1 A;  4PJ0 C;  1RET A;  2DYR H;  5HOD A;  5J4V A;  3JRE A;  2PMZ N;  3I4P A;  2Y9Z A;  4LLL A;  2ELK A;  5CVJ A;  5F0H A;  1V4R A;  1H0M A;  4C30 A;  2FJ1 A;  3VOD A;  2MG4 A;  1S5L C;  2FEZ A;  3WG7 H;  2FQ4 A;  4B47 A;  1E3P A;  5CVV A;  1TNT A;  5GTH C;  1AWC A;  1HDP A;  5E1W A;  2LY9 A;  4BE0 A;  3S3M A;  3BR5 A;  4KMU X;  3E0J B;  2W4S A;  1VI0 A;  3CCU I;  4IJA A;  4RB2 C;  3H9J A;  4GCV A;  4EGZ A;  2D1H A;  1RRJ A;  1R9T J;  3FXR A;  4CZC A;  4BAC A;  3H3U A;  3PUF A;  1HKS A;  3LOC A;  2VUM J;  2KHM A;  2LK2 A;  1TWF J;  1R4N B;  2IGK A;  4LG0 A;  2L7F P;  5EZG A;  3BDD A;  3ZOB A;  2E7X A;  2A5W A;  2PJR A;  1TBX A;  4I02 A;  2ZME C;  2ZO4 A;  1IUF A;  1HA8 A;  5F27 A;  4KIG A;  1U5T C;  1Y8R B;  5JVT A;  4A3G J;  4IHV A;  2O7O A;  5DD4 A;  1HKQ A;  3EYY A;  2VQC A;  3L09 A;  3PJR A;  3L2R A;  4CCK A;  3RI4 A;  2JN6 A;  5HDK A;  4JX6 A;  1G4D A;  5LGU A;  1LDD A;  4OIQ F;  1BOB A;  2G7H A;  4M9Z A;  4BY7 J;  1MDM B;  2KZG A;  2V79 A;  4Z6Y A;  2K7L A;  1X1C A;  2VQL A;  3H35 A;  3WTT C;  1LQ1 A;  3I5U A;  2NOJ B;  3ZRG A;  1W36 D;  1LEB A;  1JXS A;  2K3F A;  3M7G A;  4BJ5 C;  1ZRE A;  4D1Q A;  2DPD A;  3IV5 A;  5HLH A;  3A0B C;  3T8R A;  3TDU C;  3BTI A;  3HTU A;  2Y0M A;  4BYY A;  4FQG A;  3REO A;  4I98 B;  4MFE A;  4XLF A;  2PJP A;  1POG A;  4II2 A;  1VFC A;  1GXP A;  5DM6 F;  2QKM B;  1X4O A;  4TV7 A;  2GLO A;  4FT8 A;  1UEL B;  5BMZ A;  4BQN A;  2XF7 A;  2K3P A;  4AU7 A;  5K7H A;  3GTG J;  4HSR A;  3TO9 A;  2R7Q A;  2LKS A;  2EFN A;  5TGT A;  3JAM Z;  4L18 B;  3GFJ A;  4ESJ A;  3MZ8 A;  1CF7 B;  3QOE A;  1ZGW A;  4LIV A;  3WG9 A;  4AC0 A;  5JHF A;  2NVU B;  4GYI A;  3A2K A;  4BXX J;  3Q9S A;  2BY0 A;  4AIH A;  1D3Y A;  1MW7 A;  3OYA A;  3CJQ B;  4UY8 I;  1W0U A;  1ORK A;  5KK1 A;  2HVS A;  3HB9 A;  1P7I A;  3I9V 2;  4BEH B;  2YUS A;  4G6Q A;  1UG0 A;  4B43 A;  4OAY A;  2STT A;  1ZG5 A;  2XHK A;  1QZE A;  4P55 A;  4XRS A;  1XCV A;  2D1V A;  1BJZ A;  2P6T A;  2MSY A;  2COM A;  4IEJ A;  1UG2 A;  1FYL A;  4LIT A;  4QPQ A;  4F7Z A;  3OS0 A;  2LDU A;  4S04 A;  2QYO A;  2VQG A;  4ENJ A;  3QPL A;  1I3Q J;  1E2X A;  2MW8 A;  3GWZ A;  3HRT A;  1QGP A;  2UXX A;  4U7B A;  4G12 A;  4IOA F;  2EIJ H;  4CYC B;  4DBQ A;  4J00 A;  1D5Y A;  3IAM 2;  5LGN A;  3HOT A;  3C1D A;  4BBS J;  2XSD C;  3SEZ A;  2KQR A;  1HST A;  2EA2 A;  2LR8 A;  3WGH A;  2IGM A;  5KCM A;  4CH7 A;  1IXS B;  3TOA A;  4MHG A;  3RKY A;  4XLE A;  1W7P A;  1BR2 A;  2R7Z J;  2M9H A;  3AL0 B;  2Z5U A;  4ZH4 F;  1IRG A;  2YX7 A;  5JHU A;  2ZKZ A;  2JTV A;  2DBB A;  2DQL A;  3ZXS A;  3WU1 B;  1K78 B;  1RES A;  3M8E A;  3RSN A;  1YFH A;  5EYR A;  2K5C A;  4M73 A;  1MBJ A;  5LFA A;  3RKW A;  3SQN A;  1MD0 A;  3GTJ J;  3ZMT A;  3FXU A;  2STW A;  3OYH A;  5IYC J;  3S2H J;  3K70 D;  1U8R A;  3OIO A;  2QM3 A;  1CQT A;  1MBH A;  1Z21 A;  3BPV A;  2QEX I;  2HPM A;  3ZMD A;  1EH8 A;  1HKT A;  3CME I;  2BXZ A;  4H0E A;  2UZK A;  3CUO A;  3FBN B;  4L9N A;  4A0X A;  1T0F C;  3P9I A;  2EIK H;  3P9K A;  2DW4 A;  3E97 A;  5M5W J;  2VOO A;  3LWF A;  3CCV I;  2JUC A;  3Q3S A;  5J6X A;  5FKO A;  3CCM I;  3EUK L;  1OYY A;  1S29 A;  4A12 A;  4IRG A;  3F0C A;  1T98 A;  2MH9 A;  1HLV A;  2Z33 A;  1Y56 A;  2Q1Z B;  3FIS A;  1MND A;  2FBH A;  2JA8 J;  2AQE A;  4RGX A;  1A35 A;  3H9Q A;  4ZYH A;  3EUH A;  3ZQQ A;  2Q2E A;  1OPC A;  1GT0 C;  2Z3Y A;  2R7D A;  2VC0 A;  3WGI A;  1A36 A;  3TO7 A;  2MD5 A;  1JHF A;  2FF4 A;  1O57 A;  2QVO A;  1RZ4 A;  3BG5 A;  2NVQ J;  2XGD A;  1X58 A;  2F5C A;  2Y2Z A;  1A6Q A;  3BG3 A;  1ZLJ A;  3EQL F;  1UB9 A;  4O6J A;  2EFW A;  2JJ7 A;  2ZXW H;  2HR3 A;  1FX7 A;  1X1D A;  1W5S A;  3ZR8 X;  3CCJ I;  2DTZ A;  2ME0 A;  3HZJ A;  1TZL A;  3LSI A;  1Z3X A;  2F5V A;  2W57 A;  3WE3 A;  4I76 A;  1P2F A;  4A5M A;  5HVQ C;  3L2C A;  3M4O J;  2XAS A;  1WJE A;  5B1B H;  1YX3 A;  2VJ5 A;  2L02 A;  2KL4 A;  3DQV C;  4FHT A;  4BAY A;  3M1C A;  4M3G A;  1FZP B;  1GUU A;  2LMD A;  5ICC A;  3VOE A;  1FP1 D;  1MSE C;  5EEA A;  2W85 A;  1WH7 A;  2BW3 B;  2QQA A;  4U88 A;  2QF7 A;  3PIO F;  4XOR A;  1FMW A;  4ZZL A;  3ZQI A;  3OWT A;  1ENH A;  2MGQ A;  2NVT J;  2HFH A;  4OU0 A;  4J01 A;  1WJF A;  1BN5 A;  5AIP A;  2TRT A;  2WAD A;  2ADU A;  2XAJ A;  4ZYA A;  2HQR A;  3A01 B;  3IHU A;  3FBI B;  2V1U A;  3JRG A;  1X4P A;  3CCE I;  1XMK A;  4D0P A;  1P4A A;  2DU9 A;  2CO5 A;  2XAQ A;  2LF8 A;  2WTE A;  4C2U A;  2R7S A;  3K1N A;  3CCR I;  1Y1V J;  3SDB A;  5D5U B;  3LNQ A;  4M9S A;  5IOZ A;  2IP2 A;  2OU2 A;  3BJ6 A;  4PZJ A;  1UHM A;  3BP8 A;  2JRT A;  4RLF A;  2PI0 A;  1APL C;  3FXO A;  1AA7 A;  3PNY A;  4CYD A;  1XGM A;  5HLI A;  1GDT A;  3GLX A;  2ZJ2 A;  4PGH A;  4A0Y A;  4AVP A;  4A93 J;  2DA7 A;  3GTO J;  2HZT A;  3KEQ A;  4AYB A;  3DWL E;  1V3F A;  4HQM A;  2O3F A;  2XAG A;  1Z91 A;  3SEQ A;  3HHH A;  3BR6 A;  5HOO A;  5TIS C;  1R5H A;  3GZ6 A;  2Y9Y A;  2GWR A;  4HF1 A;  3AG3 H;  3DKW A;  4LFU A;  4BHB A;  2NRA C;  3B6C A;  2DK8 A;  3HOU J;  3KP5 A;  1TL8 A;  5J8F A;  1LDK B;  1JUS A;  1BW6 A;  2P5V A;  4YIF A;  2P6S A;  1WJ5 A;  3QQA A;  4AVZ A;  1LVK A;  1ETQ A;  1HW1 A;  1R5I D;  2V6C A;  4L9J A;  2R7F A;  3PQJ A;  3M9A A;  4F3Q A;  2CS3 A;  3SFI A;  4BJ6 C;  2NVX J;  3BCA A;  3C7J A;  1ODD A;  5EF6 A;  1KU2 A;  2ZFU A;  3G1O A;  1OCC H;  4Q47 A;  1LB2 A;  4RM2 A;  3VSL A;  2OQR A;  2EFP A;  3RQI A;  1SD7 A;  3GXO A;  3CCL I;  4CGZ A;  3KYD B;  3RKX A;  4IX7 A;  4XK4 A;  3GEZ A;  4J19 A;  1T95 A;  1M1E B;  2AXT C;  5K5R A;  1I50 J;  3SZG A;  4JQF A;  3CZ6 A;  1H9T A;  3RYP A;  4NB5 A;  3TP3 A;  2HOE A;  2DN0 A;  3WTW C;  5FLV A;  3LA3 A;  3HGY A;  1YW8 A;  3BRO A;  1B8I B;  1ON2 A;  4XNF A;  4LG3 A;  3JRC A;  3S93 A;  1FTT A;  3E6D A;  4ZC3 A;  4ENM A;  2Y69 H;  1IN7 A;  2DFF A;  1C0W A;  4LMY A;  2DMQ A;  3R60 A;  1VQL I;  3W6J B;  3K4N A;  2EA4 A;  1GVD A;  1XGN A;  1IZ1 A;  2DFH A;  2D45 A;  2Y0S N;  4UUS A;  2LSO A;  2OPT A;  4YEJ A;  5CJ9 A;  1R5G A;  3CLQ A;  1YJW I;  1Z3Y A;  4UV9 A;  4JP0 A;  2R4G A;  4KYW A;  4YFK F;  2LD5 A;  3FMR A;  2PG4 A;  4G7O F;  2IJL A;  3O3K A;  4M3D A;  3OYN A;  5J1U A;  4BKX A;  4XRF A;  4BH9 A;  3N4M A;  1XC5 A;  2QEN A;  3KP2 A;  3SJM A;  3WE2 A;  5EG0 B;  3BZ6 A;  2KIQ A;  2IS6 A;  1YW9 A;  5ERI A;  1LDJ A;  5GTI C;  1ETY A;  2E1M C;  3CJT B;  1TQM A;  1BI3 A;  2KT0 A;  1VQ7 I;  2M4K A;  3D5L A;  5E8I A;  2L2O A;  1IGN A;  3C2G A;  4ZJZ A;  3FHZ A;  3RTR A;  1J7K A;  2IBD A;  2VBX A;  2DT7 B;  3BR2 A;  1DGW Y;  3GTQ J;  4PJM A;  1Z6R A;  1YHQ I;  2KRC A;  2UXN A;  5CQE A;  3I0T A;  1EA3 A;  2OAZ A;  2A6H F;  3KP4 A;  4JYK A;  4MEX F;  2VAS A;  3DLA A;  2VKH A;  5EGO B;  3U1D A;  4FET A;  1TT5 B;  2E1O A;  3J7A O;  1PUF A;  2K9L A;  3KLN A;  3BJA A;  3EUH C;  5IP7 J;  5LD2 C;  3FX3 A;  4DIQ A;  4DYC A;  1SVM A;  5IT9 Z;  2W48 A;  1FPQ A;  4ZYD A;  2EWN A;  2KDO A;  1FEX A;  2KDZ A;  2O8X A;  3MMY B;  3G4S I;  5D8K B;  5ILV A;  2XRO A;  4FTH A;  5J47 A;  2CH0 A;  2X6X A;  2O8K A;  2CFX A;  2P5K A;  4Y7N J;  2MC3 A;  2VI6 A;  2W1O A;  2JA5 J;  3K2Z A;  4HNV A;  3AKZ A;  3ZQL A;  4P96 A;  4PJJ A;  1OCT C;  4CO8 A;  3BG7 A;  2V9P A;  3F9K A;  4E6K G;  1LPQ A;  5L3E A;  1IG7 A;  3PO3 J;  3OOU A;  1O7L A;  2Y0S A;  5DEQ A;  2JWT A;  5BOX A;  2JA7 J;  2PN6 A;  1MMD A;  3HOV J;  4MGR A;  2LVS A;  5GAE J;  2L5Q A;  5D8L B;  5D5W B;  2GAU A;  2WC2 A;  2DDB A;  5H2F C;  1BIA A;  3E6M A;  4XIC A;  4FE7 A;  2RV8 A;  5E3O A;  1YRN A;  3LAJ A;  1JTY A;  3LSK A;  3CUQ B;  3DPL C;  2CYY A;  3FM5 A;  4D7N A;  1D5V A;  2X48 A;  2ICW G;  4IHX A;  2EIL H;  3CMY A;  2E2H J;  4FX0 A;  3DTI A;  1NG7 A;  3V7C A;  4A6E A;  1P7J A;  3CP2 A;  3ABL H;  2C6Y A;  1KU9 A;  4RGU A;  5M5Y J;  3K4L A;  1HW2 A;  1Y39 A;  1NK2 P;  4MFD A;  3KLO A;  4KIS A;  1VQO I;  2VL8 A;  3IH4 A;  1KA8 A;  2XPV A;  1QPM A;  3TMO A;  4Y17 A;  1Y0U A;  4HEA 2;  3UNG C;  2AO9 A;  3JRI A;  2FUG 2;  1CF7 A;  2K40 A;  1L3L A;  4HQE A;  2NVY J;  2F2E A;  2QBY B;  2V1X A;  1IXR C;  4BEH A;  2DA3 A;  2NOG A;  1G3S A;  1FOK A;  2BOL A;  3JSP A;  1IJW C;  2CQX A;  1CGP A;  3OS2 A;  2O9L A;  2DYS H;  4XKB A;  3HSF A;  1TWH J;  2W7N A;  2CRG A;  1S72 I;  3HG9 A;  4HV6 A;  1ERD A;  1O3Q A;  3V8L A;  2RDP A;  3IL2 A;  1WHU A;  4LLN A;  5F08 A;  5EJC A;  4YII A;  3BTC A;  2ZSI B;  3LSJ A;  5CKT A;  2DA1 A;  3CCY A;  2VE8 A;  4QSH A;  4UB6 C;  2V1D A;  3VYR B;  3BR0 A;  4A6D A;  3E5U A;  5F1R A;  2BHY A;  4RAG A;  4B3A A;  3S2D J;  3ERM A;  1GV2 A;  3V4G A;  3OYL A;  2OC6 A;  2L3D A;  4CHU A;  4IKF A;  1X3U A;  5L3F A;  2GOX B;  3GX4 X;  4FCY A;  4MEY F;  2N8G A;  2ZBK A;  1SD4 A;  2F5E A;  5FRM A;  1Z0X A;  2RVC A;  2JVH A;  3WTX C;  2DOF A;  2VKD A;  3QPH A;  2LH9 A;  4KNY A;  2XB5 A;  2YSR A;  1X1P A;  1G3T A;  3NWT A;  5F6F A;  1SVO A;  4BUP A;  2HU9 A;  3K10 A;  3G71 I;  3K69 A;  3IAS 2;  2GXG A;  1FNN A;  1V5E A;  3I71 A;  4I99 C;  4XID A;  3HXL A;  1YJN I;  4Y33 A;  4L0Z B;  1Y8Q B;  2CSO A;  3FXM A;  1KQ0 A;  2EQR A;  1B59 A;  2EK5 A;  5BPD A;  5FLX Z;  4UXN A;  4RGR A;  4UB8 C;  2H6B A;  3BG6 A;  1MZB A;  4EM2 A;  3N97 A;  1FYK A;  3CF5 F;  4E7I A;  2M7A A;  4RMN A;  2K27 A;  2M7B A;  3V8K A;  4XRS G;  5B5E C;  4P9F A;  4ESB A;  4ZDO A;  3OYE A;  1R00 A;  4L5J A;  3TW7 A;  2WAQ N;  3LSM A;  3PNT A;  1K4T A;  1R23 A;  1H89 C;  2JMW A;  3U1K A;  1DPR A;  2X1C A;  3FIW A;  3Q0U A;  4A5N A;  3EPZ A;  3MFK A;  1U3E M;  4HRI A;  3E7L A;  3KPH A;  1F36 A;  5JR3 A;  1QRY A;  4LB5 A;  2Z1D A;  4D7M A;  3GFL A;  2PBI A;  3VYT B;  1R1U A;  1G59 A;  1KU3 A;  2OCE A;  4A2U A;  1E17 A;  4E7K A;  2Z9O A;  2NS0 A;  3HRU A;  3VWB A;  3BY6 A;  2V1N A;  1OR7 A;  4IXA A;  1HXD A;  5LLQ A;  3DKX A;  1O4X A;  1XX5 A;  4AD9 A;  1BI0 A;  1O3T A;  5LHI A;  1ZRC A;  1D1C A;  2GA1 A;  1GHC A;  1YG2 A;  2R5Z B;  2ZME B;  4XKW A;  4BQQ A;  1U5T B;  9ANT A;  3BQY A;  1FOW A;  3QYB A;  5FD6 A;  2LFB A;  3GFI A;  2E7W A;  2XF6 A;  4G7Z F;  3GBG A;  1YW7 A;  2ZNY A;  4Y15 A;  1X1A A;  2P81 A;  3K4J A;  3NQO A;  3MKW B;  1TT0 A;  4A3I J;  3MCZ A;  4MNU A;  3LL7 A;  1ETW A;  4DZP A;  4A3L J;  4G94 A;  1B6A A;  1HOM A;  4KUM A;  1IDY A;  3OYK A;  1J9I A;  1Z05 A;  4BXU A;  5ED4 A;  5ILU A;  4I09 A;  3JR9 A;  4E7H A;  4HF2 A;  2XRL A;  1F4K A;  2IA2 A;  2LBF B;  4GXO A;  1NH3 A;  3B73 A;  2HOS A;  3OL3 A;  3LMM A;  3VSK A;  2EZI A;  3HSE A;  5K1Y A;  2CFO A;  2BV6 A;  2XC7 A;  3I59 B;  2M1B A;  2L9V A;  4IOC F;  3HGG A;  1DUX C;  4E7Z A;  4BY1 J;  4Z2Y A;  1SC7 A;  1FSH A;  2BW3 A;  2CUE A;  3P9C A;  4UVB A;  4CZZ A;  5DUI A;  2VPL A;  4ASN A;  2LRD A;  5E17 F;  2R7X A;  2DJN A;  4PJL A;  2QKL B;  3DFG A;  2QCO A;  2VC1 A;  2A07 F;  3BZC A;  4BGD A;  3H0D A;  2WAQ A;  3A01 A;  1S7O A;  2DCE A;  1Q1V A;  1LVA A;  4LGW A;  4WX9 A;  4M9X A;  3SYT A;  3PO2 J;  3AG2 H;  2L01 A;  1X1B A;  4JK1 X;  4G7H F;  1MMA A;  2H09 A;  2CQK A;  1HC8 A;  4NC6 A;  2A5Y B;  4L9T A;  3CO6 C;  2IS4 A;  4CIC A;  1TW2 A;  2VQH A;  3D0S A;  1T2K A;  4FIS A;  2MD0 A;  2FNP A;  1OLT A;  2A6T A;  1R1V A;  3CCS I;  3HUG B;  3S2W A;  3DBH B;  2V4J C;  1X3Z B;  2CUF A;  1JT0 A;  5KHD A;  2IGN A;  3QYE A;  4KT6 A;  2X6W A;  4EJW A;  2ZCW A;  3E5Q A;  4XKC A;  5TRD A;  3S14 J;  4NC8 A;  1ZHF A;  4W97 A;  4I6Z A;  1OKR A;  4HBL A;  3ZQH A;  1SFU A;  1S3J A;  4S0H B;  4RBO A;  3W3C A;  1YYV A;  1P4X A;  3OYI A;  4XR6 A;  5CVU A;  1FP2 A;  4E7L A;  3F21 A;  4Q4Z F;  5HNF A;  2H8R A;  1E3O C;  1JKR C;  3AAF A;  1XSD A;  1A5J A;  3HPH A;  4A3M J;  2FX0 A;  5GPA A;  2R7T A;  2XAF A;  1BI2 A;  1ETV A;  2YU9 J;  1LFP A;  2DT5 A;  3ESW B;  4M74 A;  3BLY A;  4XON A;  3FM3 A;  3I64 A;  4BS9 A;  2K86 A;  4IVN A;  4XLA A;  1FBQ A;  3I4N J;  5DCF A;  4YG2 F;  4A3K J;  2AXL A;  2PMU A;  4YIR X;  1ZLK A;  1IRX A;  3DU5 A;  4WWC A;  2TDX A;  4QPO A;  3ZMZ A;  4BDY A;  1HQC A;  2XAU A;  2JA6 J;  1SAN A;  4HOB A;  1F43 A;  1RUO A;  5DM7 F;  1E3H A;  4QWQ A;  1U78 A;  2HDW A;  4H4K C;  3JRA A;  1IRF A;  1BC7 C;  4L0Y B;  3OSF A;  1LE8 B;  1OCR H;  3OYM A;  5BPI A;  2IPQ X;  1S7E A;  2LG4 A;  3KP3 A;  4P5O A;  1KON A;  2LY2 A;  2D5V A;  2KLO A;  4LD5 A;  2GXB A;  1W5C C;  5F64 A;  3ISP A;  3DPT A;  4WXD A;  3DU6 A;  1IN8 A;  3GME A;  1B8I A;  2L9N A;  3IP4 B;  2GIZ A;  3CQZ J;  1VTN C;  1UHW A;  4K2E A;  5FJ8 J;  1U2W A;  4PDK A;  4PSX A;  4KDP A;  2L7K A;  4F93 B;  2FRH A;  5IT9 K;  1UHS A;  2F4M B;  1IAW A;  5D6F A;  2IGO A;  1PP8 F;  3F23 A;  3HYI A;  1YIJ I;  4HF0 A;  1PP7 U;  2LYC A;  4DGW B;  1X2M A;  2A61 A;  3O6B B;  4Y52 J;  2R5Y A;  1QA6 A;  1LUJ B;  2RN7 A;  4ETS A;  5JLW A;  2M5W A;  3FXK A;  1FT9 A;  2HQ5 A;  2L7M P;  1P4W A;  4CSW A;  1FYM A;  1G2H A;  3F72 A;  2FBK A;  3R0J A;  2DFI A;  4JX4 A;  1TLH B;  1WCM J;  2BBY A;  4AYB N;  3ZPL A;  1VQ9 I;  2ETH A;  1BR4 A;  2V9K A;  5E3L A;  2QQ8 A;  1LNW A;  2OBP A;  1WZ2 A;  4EJO A;  2LTP A;  1ZKG A;  3KET A;  2A69 F;  3QRF F;  3FZV A;  3FF5 A;  3ABM H;  3A03 A;  1VQ6 I;  4OIO F;  4KN4 X;  3RPU D;  3LSR A;  2R0Q C;  2F48 A;  5LEJ A;  3CDI A;  1JUM A;  1MH3 A;  1FBU A;  2DA6 A;  1WJA A;  4NBQ A;  3M1E A;  1OR7 C;  4Q48 A;  3K4B A;  4LG0 B;  1P6R A;  3W6V A;  2K4B A;  2MLG A;  4M3B A;  1TW3 A;  1XN7 A;  3JCU C;  1QU3 A;  2PJR B;  5LEK A;  2K85 A;  2H27 A;  1ONV A;  3OYD A;  3QP6 A;  4NDL A;  3ONQ A;  3V7S A;  2CWE A;  2BXY A;  3J7A Y;  2NNN A;  2PQ8 A;  4EQQ A;  3VB2 A;  2NAZ A;  3D5S C;  3NEU A;  2GIV A;  2H1K A;  1FSE A;  1WPK A;  4EEF G;  1XGO A;  2P8T A;  1WJB A;  4EJT A;  1QBJ A;  4CCL A;  3GLL A;  4M6Y A;  5C4J J;  3L9F A;  2X1D A;  5FLM J;  3ZN1 A;  4BE2 A;  1MSF C;  1S9H A;  1NHA A;  3KE2 A;  2UUZ A;  3K4C A;  3KCC A;  5IP6 A;  1J5Y A;  5ICG A;  3S15 J;  3Q0V A;  4A69 C;  5DDG A;  1JGG A;  2CW7 A;  4CDG A;  1QZY A;  2DA4 A;  1QNT A;  3KX2 A;  3CF2 A;  1T39 A;  4XRM A;  1RR7 A;  2Z16 A;  3VYU B;  4DBR A;  2EJR A;  3HPG A;  2RQQ A;  3E6B A;  3TO6 A;  5FKM A;  1B9N A;  2EBI A;  1FJL A;  4UUV A;  4HX4 A;  1OCP A;  3DCF A;  3TED A;  2BVL A;  2XKO A;  1RKW A;  2FE3 A;  2MAB A;  3W6K B;  4C3J J;  5HS8 A;  2AHQ A;  2M34 A;  3ZCO A;  2RC4 A;  4RAF A;  5KAI C;  3MD2 A;  4HDV A;  1BJA A;  3GCM A;  3CD6 I;  2RQP A;  2VLA A;  5E8G A;  2EZK A;  2Z2S B;  3G6E I;  5E1Z B;  2E71 A;  1ZR2 A;  4ZTJ A;  2M3A A;  1XD7 A;  2LC2 A;  3BWG A;  1FBS A;  2EZL A;  1P92 A;  3BR1 A;  2HXO A;  2HXI A;  2PLY A;  2MYS A;  2PEX A;  4CA0 A;  4L5I A;  3NAU A;  1I3A A;  5BQT A;  1QO0 D;  5HLT A;  5IPA A;  2IA0 A; 
#chains in the Genus database with same CATH homology
 4RAY A;  4E70 A;  3H92 A;  5HS9 A;  3MZY A;  3MZH A;  2B0L A;  3DF8 A;  5DCM B;  1YLF A;  1TQI A;  2YU3 A;  1J59 A;  4IHS A;  2HDC A;  1HW5 A;  5FLX K;  2QBY A;  2VBZ A;  3IKV A;  3KP6 A;  4KFC A;  5FO5 A;  3NRV A;  1F1Z A;  3EDP A;  1I6X A;  2GQQ A;  3HSR A;  2XIG A;  2W84 A;  4OIR F;  3KZY A;  3R6S A;  3CJN A;  3MQ0 A;  4WXC A;  1O3R A;  2PFB A;  2KJB A;  5J8C A;  3RIR A;  4LK1 F;  3RYR A;  2FOK A;  4WXH A;  1Z1D A;  2XKP A;  3CO7 C;  1TNS A;  2ELH A;  4B8X A;  1SD6 A;  1G3Y A;  2KKO A;  2IT0 A;  1RUN A;  3IWZ A;  4OIP F;  3LQR A;  3GYH X;  2KJC A;  3WTU C;  2G7U A;  2P7C B;  4U0Y A;  3G3Z A;  3GW2 A;  3M8F A;  4R8H A;  4IRH A;  4U0V A;  4AWX B;  1BOA A;  2ZFW A;  4GGG A;  1Z9C A;  2XV4 S;  4HZF A;  4MTD A;  3F3X A;  4RAZ A;  4I01 A;  1RNL A;  2QUF A;  5EEH A;  1J2X A;  2QWW A;  4L9V A;  3V7R A;  2ZME A;  4UVC A;  3L7W A;  1I5Z A;  1JGS A;  3ABT A;  1FLI A;  2BEO A;  1SMT A;  1L0O C;  4ESF A;  3COA C;  3QOP A;  3R0A A;  4AIJ A;  1KQ9 A;  2DTR A;  2R3S A;  1Z7U A;  2FA5 A;  2ZNZ A;  2JT1 A;  2K4J A;  1O3S A;  3L00 A;  4M6X A;  3VEP A;  2AS5 F;  3I59 A;  1BC8 C;  1MDM A;  1ZG1 A;  4B09 A;  2ISZ A;  4RB0 A;  3WOD F;  2DLL A;  1DDN A;  4WK8 F;  1TQP A;  3FWE A;  4EM1 A;  1R1T A;  4S05 A;  3HRS A;  5L3G A;  1WRJ A;  1XGS A;  2EB7 A;  3LA2 A;  4BQA A;  1XSV A;  4HYE A;  4U7D A;  2HTS A;  4XLP F;  1KQ8 A;  5D5V B;  4GYG A;  3JW4 A;  3ZN0 A;  1KYZ A;  2M87 A;  3RDI A;  1RIO H;  4XLN F;  3HUG A;  2ESN A;  2EV0 A;  1JE8 A;  2EFQ A;  4G6D A;  3ERE D;  2DPU A;  1MKM A;  2LNB A;  2K02 A;  2OD5 A;  4RB3 C;  2DO7 A;  3BJO A;  2JPB A;  2UWM A;  1BI1 A;  3GVA A;  4HV5 A;  1D8K A;  3TKY A;  2Q8K A;  2FU4 A;  4ENN A;  1KGS A;  1LEA A;  2O03 A;  2H6C A;  5FFX A;  2NNY A;  4QLC U;  5ICF A;  2X0L A;  1YIO A;  1K78 A;  2KIM A;  5FFZ A;  4I0B A;  2HEO A;  5DD8 A;  3G73 A;  4KIB A;  1B1B A;  2KIU A;  1T0F A;  2J5P A;  4ON0 A;  2G9W A;  1GHC A;  3F22 A;  1SMY F;  2JZY A;  2ACJ A;  2VXZ A;  3ELK A;  2RKH A;  5HDN A;  1SAX A;  5KVR A;  4DQ2 A;  1UCR A;  2IA1 A;  3DP7 A;  2LF7 A;  5CVI A;  3ZMV A;  4OMZ A;  5E1X A;  1OMI A;  3BOQ A;  1T6S A;  3ZMS A;  2W25 A;  4LJZ F;  1YO5 C;  4OOI A;  1GXQ A;  1R58 A;  3F6O A;  4DNC A;  3WTY C;  3K0L A;  3OV8 A;  2XVC A;  3CLO A;  2XAH A;  4YFX F;  2FNA A;  3H3Z A;  2FXA A;  1B9M A;  5H20 A;  1T38 A;  4HX7 A;  2E1N A;  2EV5 A;  2M8E A;  1ZRF A;  2IW5 A;  3HOS A;  1K79 A;  3RPQ A;  1G3W A;  4ZZD A;  5CYV A;  3GF2 A;  2L4A A;  1REP C;  4NHJ A;  3TQN A;  3QPT A;  1MJB A;  2FSW A;  1R36 A;  1BM9 A;  3K1P A;  3JSO A;  3J80 Z;  3LFK A;  3ZP5 A;  3MEX A;  1ON1 A;  3I58 A;  1STZ A;  4HA8 A;  1XDU A;  4N9H A;  4FX4 A;  3PQK A;  4IRI A;  3EYI A;  1QQI A;  3Q9V A;  1S8N A;  2MH2 A;  1PDN C;  4RB1 A;  3TOB A;  1XSX A;  4BHC A;  3WTZ A;  3ZMU A;  3T8T A;  4R1H A;  2E1C A;  4RS8 A;  3KP7 A;  3LQQ A;  3GUD A;  4IHT A;  4RGS A;  3LAP A;  2EV6 A;  3SHF A;  3ABU A;  5A2Q Z;  1H9G A;  5L3D A;  2L54 A;  3EET A;  2WWY A;  1F5T A;  1IN5 A;  5D6E A;  3F8M A;  2VE9 A;  4IPA A;  1AOY A;  1S6L A;  5K5Q A;  5HS7 A;  3ZQ7 A;  3O2P E;  2FML A;  4OMY A;  4P9U A;  5DCM A;  4LK0 F;  3F6V A;  1ZAR A;  2EFO A;  1DP7 P;  2F5D A;  1IXC A;  4O3M A;  1YS6 A;  1XMA A;  3HTS B;  2HYG D;  4HX8 A;  4MQV A;  2VT2 A;  4AIK A;  4UV8 A;  3WU0 A;  1G6N A;  2DQR A;  1FY7 A;  5ILS A;  2HS5 A;  1EV7 A;  3C18 A;  2MA3 A;  5AIQ A;  5LHH A;  3TGN A;  3J81 Z;  1WI9 A;  2YX4 A;  4KN7 X;  1K7A A;  4XSX F;  1IN6 A;  3SXY A;  2KRF A;  4UNO A;  4M71 A;  3T0Y A;  2JPC A;  1WQ2 A;  4YFN F;  4UHT A;  5LRR A;  4ENK A;  2CGP A;  1YS7 A;  4KA4 A;  2OQG A;  1ZH5 A;  2X4H A;  2P7V B;  1WSU A;  2WV0 A;  3JTG A;  4HDU A;  2OZU A;  2VN2 A;  4IF4 A;  2CG4 A;  3SFZ A;  1BIB A;  4I7H A;  3ROU A;  4HLY A;  2GA2 A;  2BGC A;  3BPX A;  4HW0 A;  5EEG A;  1U6G A;  2YPR A;  4LB6 B;  4Q5S F;  4ZYE A;  2NYX A;  2A6E F;  3ECO A;  4WCG A;  5FD5 A;  2Q0O A;  4MQ9 F;  1XCB A;  1SFX A;  1F9N A;  4OIN F;  5IT3 A;  3E5X A;  1OYI A;  4NQW A;  1MJ9 A;  1A04 A;  4M72 A;  3IRQ A;  4EMS A;  2FQ3 A;  2QZ8 A;  5H6R A;  1I27 A;  3GO5 A;  6PAX A;  1S7A A;  2MBF A;  2Z99 A;  5LRS A;  3F8B A;  2F5F A;  1ZGA A;  3QP5 A;  4EJV A;  3B02 A;  1JHH A;  2FMY A;  1W5T A;  1BBY A;  1R22 A;  1ZGJ A;  3CUQ A;  2OA4 A;  3T1B A;  2GZW A;  4HAM A;  5L3C A;  1OYW A;  2IVM A;  2MLK A;  3DV8 A;  4LLG F;  3U9G A;  3FMS A;  3MAJ A;  1B4A A;  1XB4 A;  5JI6 A;  1IF1 A;  4N0B A;  5BS6 A;  5LGT A;  2V9V A;  4I0A A;  3CTA A;  4EVI A;  2XRN A;  1W4M A;  5LHG A;  4KIC A;  3R61 A;  4KT5 C;  2P5L C;  2CW0 F;  3KFW X;  1SD5 A;  3SZT A;  3IRR A;  1W7P B;  2IRF G;  1D8J A;  2XGX A;  2VBY A;  1Q1H A;  2QLZ A;  3IC7 A;  5E18 F;  3U2R A;  3WTS C;  3V8J A;  2OZ6 A;  5DUK A;  3R4K A;  4O5V A;  4EV0 A;  4WF2 A;  5CLS A;  3DXJ F;  3IKT A;  3P7N A;  3ML6 A;  3LA7 A;  1IW7 F;  4EM0 B;  2BE5 F;  2DK5 A;  3F8C A;  3KZZ A;  2IA0 A;  4EJU A;  2W24 A;  2HTJ A;  1O7F A;  3K9T A;  3F8F A;  1ZG3 A;  2YR2 A;  1ZRD A;  1QZZ A;  1PUE E;  3J80 K;  1KU7 A;  1DPU A;  1ZN2 A;  3RJP A;  5CVR A;  4JBA A;  4HLX A;  5D5X B;  5JFR A;  5K5O A;  2M45 A;  1RI7 A;  4CXF A;  4KIF A;  2JSC A;  2HQN A;  5AON A;  1I1S A;  3K1M A;  1EH7 A;  1U5T A;  5D4R A;  1HBX G;  3OOP A;  4BNC A;  2HWV A;  5FB2 A;  1MJA A;  3E6C C;  2DAO A;  3CDH A;  1J75 A;  1WKM A;  5A2Q K;  1HSJ A;  2BYV E;  3FXQ A;  1J0R A;  3LST A;  1FWZ A;  2XUB A;  1XDS A;  2M30 A;  2RGV A;  3JAM K;  1USS A;  3WGG A;  2A3S A;  5TJJ A;  2ISY A;  4EGY A;  1K6O A;  1IN4 A;  4BHP A;  1EH6 A;  3I54 A;  2VOD A;  2D2W A;  3RPU A;  4XBF A;  1KYW A;  5HLG A;  3WTV C;  5L3B A;  3C3W A;  4A0Z A;  3MWM A;  3DEU A;  1ZAO A;  1MGT A;  2HKO A;  5H6Q A;  2DI3 A;  3QU3 A;  2HGC A;  5DV5 A;  3ULQ B;  5D4S A;  5FGM A;  2VOP A;  2P4W A;  4R79 A;  1GVJ A;  2KIF A;  3JTH A;  1W7P D;  3GFM A;  4MTE A;  5LBQ A;  1I1G A;  1SFE A;  1Z6T A;  3CUQ C;  1YTY A;  5DYM A;  3GZ5 A;  2L4M A;  1IUY A;  2ZXJ A;  4KMF A;  5HDG A;  3HIF A;  3J81 K;  1ZYR F;  3HHG A;  4Y13 A;  5E20 A;  2QQ9 A;  4UVA A;  1FC3 A;  4G8X A;  3VFZ A;  2O61 A;  3KEO A;  2PMH A;  2VON A;  1TTY A;  1WWX A;  2A68 F;  2O6G E;  2FBI A;  3TDZ C;  3E3V A;  3SZP A;  3I53 A;  4G9Y A;  2Y75 A;  5ICE A;  3IWF A;  3T5X A;  1LJ9 A;  3QU6 A;  4GO1 A;  4PGG A;  3QAH A;  2RNJ A;  2QQB A;  2H94 A;  2LKP A;  3Q5F A;  2ESH A;  3ECH A;  4I2O A;  2Y48 A;  2O0Y A;  2J5O A;  1R7J A;  1ULY A;  2HKX A;  2VT3 A;  1UFM A;  4N9I A;  4XSZ F;  3HRM A;  4U0W A;  1YQA A;  3F8N A;  2HYF A;  2VBW A;  3PFI A;  3FMQ A;  4PCQ A;  1UST A;  3I4P A;  4LLL A;  5CVJ A;  1V4R A;  1H0M A;  3VOD A;  2FEZ A;  5CVV A;  1TNT A;  1AWC A;  5E1W A;  4KMU X;  4EGZ A;  4IJA A;  4RB2 C;  4GCV A;  2D1H A;  3FXR A;  3H3U A;  1HKS A;  4LG0 A;  3BDD A;  2E7X A;  1TBX A;  4I02 A;  2ZO4 A;  4KIG A;  1U5T C;  5JVT A;  5DD4 A;  1HKQ A;  3EYY A;  3L09 A;  3RI4 A;  5HDK A;  1G4D A;  5LGU A;  1LDD A;  4OIQ F;  2G7H A;  4M9Z A;  1MDM B;  2V79 A;  2K7L A;  3WTT C;  1LQ1 A;  3I5U A;  1JXS A;  1LEB A;  3M7G A;  1ZRE A;  2DPD A;  5HLH A;  3T8R A;  3TDU C;  3HTU A;  2Y0M A;  4BYY A;  3REO A;  4I98 B;  2PJP A;  1GXP A;  4TV7 A;  4FT8 A;  5BMZ A;  3TO9 A;  2EFN A;  3JAM Z;  4L18 B;  3GFJ A;  4ESJ A;  1CF7 B;  3WG9 A;  4GYI A;  3Q9S A;  4AIH A;  1D3Y A;  5KK1 A;  4G6Q A;  2STT A;  1ZG5 A;  2XHK A;  4P55 A;  1XCV A;  2D1V A;  2P6T A;  2COM A;  1FYL A;  4F7Z A;  4S04 A;  4ENJ A;  2LDU A;  2QYO A;  1E2X A;  3GWZ A;  3HRT A;  1QGP A;  2UXX A;  4U7B A;  5LGN A;  3HOT A;  3C1D A;  1HST A;  2EA2 A;  3WGH A;  1IXS B;  3TOA A;  4MHG A;  3RKY A;  1W7P A;  2Z5U A;  4ZH4 F;  1IRG A;  2YX7 A;  5JHU A;  2ZKZ A;  2JTV A;  2DBB A;  2DQL A;  3WU1 B;  1K78 B;  3M8E A;  1YFH A;  4M73 A;  3RKW A;  3SQN A;  1MD0 A;  3ZMT A;  3FXU A;  2STW A;  1U8R A;  2QM3 A;  3BPV A;  3ZMD A;  1EH8 A;  1HKT A;  4H0E A;  2UZK A;  3CUO A;  4L9N A;  4A0X A;  3P9I A;  3P9K A;  2DW4 A;  3E97 A;  2VOO A;  3LWF A;  5J6X A;  1OYY A;  1S29 A;  4A12 A;  4IRG A;  1T98 A;  2MH9 A;  2Z33 A;  2FBH A;  4RGX A;  4ZYH A;  3EUH A;  2Q2E A;  1OPC A;  2Z3Y A;  2R7D A;  2VC0 A;  3WGI A;  3TO7 A;  2MD5 A;  1JHF A;  2FF4 A;  1O57 A;  2QVO A;  1RZ4 A;  2F5C A;  1ZLJ A;  3EQL F;  1UB9 A;  4O6J A;  2EFW A;  2HR3 A;  1FX7 A;  1W5S A;  2W57 A;  3WE3 A;  1P2F A;  4A5M A;  3L2C A;  5HVQ C;  2XAS A;  3DQV C;  2L02 A;  4FHT A;  4BAY A;  1FZP B;  5ICC A;  3VOE A;  1FP1 D;  2W85 A;  2QQA A;  4U88 A;  4ZZL A;  2HFH A;  4OU0 A;  1BN5 A;  5AIP A;  2ADU A;  2XAJ A;  2HQR A;  3IHU A;  2V1U A;  1XMK A;  4D0P A;  1P4A A;  2DU9 A;  2CO5 A;  2XAQ A;  2LF8 A;  2WTE A;  3K1N A;  5D5U B;  4M9S A;  2IP2 A;  2OU2 A;  3BJ6 A;  4PZJ A;  1UHM A;  3BP8 A;  2JRT A;  2PI0 A;  4CYD A;  1XGM A;  5HLI A;  3GLX A;  2ZJ2 A;  4PGH A;  4A0Y A;  4AVP A;  2HZT A;  3KEQ A;  1V3F A;  4HQM A;  2O3F A;  2XAG A;  1Z91 A;  3HHH A;  5HOO A;  3GZ6 A;  1R5H A;  2GWR A;  4HF1 A;  3DKW A;  4LFU A;  4BHB A;  2NRA C;  2DK8 A;  3KP5 A;  5J8F A;  1LDK B;  2P5V A;  4YIF A;  2P6S A;  2V6C A;  4L9J A;  1HW1 A;  2R7F A;  3PQJ A;  3M9A A;  3C7J A;  1ODD A;  1KU2 A;  4Q47 A;  1LB2 A;  2OQR A;  2EFP A;  1SD7 A;  3GXO A;  4CGZ A;  3RKX A;  3GEZ A;  5K5R A;  4JQF A;  1H9T A;  3RYP A;  4NB5 A;  2HOE A;  3WTW C;  3LA3 A;  1YW8 A;  3BRO A;  1ON2 A;  3E6D A;  4ENM A;  1IN7 A;  1C0W A;  4LMY A;  3R60 A;  3W6J B;  2EA4 A;  1XGN A;  1IZ1 A;  2D45 A;  2LSO A;  5CJ9 A;  1R5G A;  4UV9 A;  4KYW A;  4YFK F;  3FMR A;  2PG4 A;  4G7O F;  2IJL A;  3O3K A;  4XRF A;  4BH9 A;  3N4M A;  2QEN A;  3KP2 A;  3WE2 A;  3BZ6 A;  1YW9 A;  5ERI A;  1LDJ A;  1TQM A;  1BI3 A;  3D5L A;  5E8I A;  3FHZ A;  3RTR A;  1J7K A;  2VBX A;  1Z6R A;  2UXN A;  3I0T A;  2OAZ A;  2A6H F;  3KP4 A;  4MEX F;  3U1D A;  3J7A O;  3KLN A;  3BJA A;  3FX3 A;  5IT9 Z;  1FPQ A;  4ZYD A;  2EWN A;  2O8X A;  5D8K B;  5ILV A;  2XRO A;  2CFX A;  2P5K A;  2MC3 A;  3K2Z A;  4P96 A;  4CO8 A;  5L3E A;  1O7L A;  5DEQ A;  5BOX A;  2PN6 A;  4MGR A;  5D8L B;  5D5W B;  2GAU A;  2WC2 A;  1BIA A;  3E6M A;  2RV8 A;  3LAJ A;  3CUQ B;  3DPL C;  2CYY A;  3FM5 A;  1D5V A;  4FX0 A;  3V7C A;  4A6E A;  2C6Y A;  1KU9 A;  4RGU A;  1HW2 A;  3KLO A;  1KA8 A;  1QPM A;  4Y17 A;  1Y0U A;  1CF7 A;  1L3L A;  4HQE A;  2F2E A;  2QBY B;  2V1X A;  1IXR C;  1G3S A;  1FOK A;  3JSP A;  1CGP A;  3HSF A;  4HV6 A;  1O3Q A;  3V8L A;  2RDP A;  3IL2 A;  4LLN A;  4YII A;  2VE8 A;  2V1D A;  4A6D A;  3E5U A;  5F1R A;  4CHU A;  3V4G A;  2L3D A;  1X3U A;  5L3F A;  3GX4 X;  4MEY F;  2ZBK A;  1SD4 A;  2F5E A;  2RVC A;  3WTX C;  3QPH A;  4KNY A;  2YSR A;  1G3T A;  5F6F A;  3K69 A;  2GXG A;  1FNN A;  3I71 A;  4L0Z B;  2CSO A;  1KQ0 A;  1B59 A;  2EK5 A;  5BPD A;  5FLX Z;  4UXN A;  4RGR A;  2H6B A;  3N97 A;  1MZB A;  4EM2 A;  1FYK A;  2K27 A;  3V8K A;  4P9F A;  4ESB A;  1R00 A;  4L5J A;  1R23 A;  1DPR A;  4A5N A;  3MFK A;  1U3E M;  5JR3 A;  4LB5 A;  3GFL A;  2PBI A;  1R1U A;  1KU3 A;  4A2U A;  1E17 A;  2Z9O A;  2NS0 A;  3HRU A;  3BY6 A;  1OR7 A;  4IXA A;  1HXD A;  5LLQ A;  4AD9 A;  1BI0 A;  1O3T A;  5LHI A;  1ZRC A;  2GA1 A;  1YG2 A;  2ZME B;  1U5T B;  5FD6 A;  3GFI A;  2E7W A;  4G7Z F;  1YW7 A;  2ZNY A;  4Y15 A;  3NQO A;  3MCZ A;  4MNU A;  4G94 A;  1B6A A;  4KUM A;  1J9I A;  1Z05 A;  4BXU A;  5ED4 A;  5ILU A;  4I09 A;  4HF2 A;  1F4K A;  2IA2 A;  4GXO A;  3B73 A;  3HSE A;  5K1Y A;  2BV6 A;  3I59 B;  2M1B A;  1DUX C;  4Z2Y A;  1FSH A;  3P9C A;  4UVB A;  4CZZ A;  5DUI A;  4ASN A;  5E17 F;  3DFG A;  2VC1 A;  2A07 F;  1S7O A;  4WX9 A;  1LVA A;  4LGW A;  4M9X A;  2L01 A;  4JK1 X;  4G7H F;  2H09 A;  2CQK A;  2A5Y B;  4L9T A;  3CO6 C;  4CIC A;  1TW2 A;  3D0S A;  1T2K A;  2FNP A;  1R1V A;  3S2W A;  4EJW A;  2ZCW A;  3E5Q A;  5TRD A;  1ZHF A;  1OKR A;  4HBL A;  1SFU A;  1S3J A;  1YYV A;  1P4X A;  5CVU A;  1FP2 A;  3F21 A;  4Q4Z F;  3AAF A;  1XSD A;  2XAF A;  1BI2 A;  2DT5 A;  4M74 A;  3FM3 A;  3I64 A;  2K86 A;  4IVN A;  1FBQ A;  5DCF A;  4YG2 F;  2AXL A;  2PMU A;  1ZLK A;  4WWC A;  2TDX A;  3ZMZ A;  1HQC A;  4HOB A;  1RUO A;  4QWQ A;  1U78 A;  1IRF A;  1BC7 C;  4L0Y B;  5BPI A;  2IPQ X;  3KP3 A;  4P5O A;  4LD5 A;  2GXB A;  5F64 A;  3ISP A;  3DPT A;  4WXD A;  1IN8 A;  1VTN C;  1UHW A;  4K2E A;  1U2W A;  4PDK A;  4KDP A;  2FRH A;  5IT9 K;  1IAW A;  5D6F A;  1PP8 F;  3F23 A;  3HYI A;  4HF0 A;  1PP7 U;  2A61 A;  3O6B B;  2RN7 A;  4ETS A;  2M5W A;  1FYM A;  1FT9 A;  1P4W A;  3F72 A;  2FBK A;  3R0J A;  2DFI A;  1TLH B;  2BBY A;  3ZPL A;  2ETH A;  1LNW A;  2OBP A;  4EJO A;  3KET A;  2A69 F;  3QRF F;  3FZV A;  3FF5 A;  4OIO F;  4KN4 X;  5LEJ A;  1FBU A;  3M1E A;  4Q48 A;  4LG0 B;  1P6R A;  2K4B A;  2MLG A;  1TW3 A;  1XN7 A;  5LEK A;  2H27 A;  1ONV A;  3QP6 A;  3V7S A;  2CWE A;  2NNN A;  2PQ8 A;  4EQQ A;  3VB2 A;  2NAZ A;  3NEU A;  2GIV A;  1FSE A;  1XGO A;  2P8T A;  4EJT A;  1QBJ A;  4M6Y A;  3L9F A;  3ZN1 A;  1NHA A;  3KE2 A;  3KCC A;  1J5Y A;  5ICG A;  5DDG A;  4CDG A;  1QZY A;  1QNT A;  1T39 A;  2EJR A;  3E6B A;  3TO6 A;  1B9N A;  4UUV A;  4HX4 A;  2XKO A;  2FE3 A;  3W6K B;  5HS8 A;  2RC4 A;  4HDV A;  1BJA A;  2RQP A;  5E8G A;  5E1Z B;  1XD7 A;  3BWG A;  1FBS A;  1P92 A;  2PLY A;  2PEX A;  4L5I A;  5BQT A;  1QO0 D;  4ZYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...