4G6DA

G1 orf67 / staphyloccus aureus sigmaa domain 4 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
62
structure length
62
Chain Sequence
MKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords RNA polymerase sigma factor rpoD
publication title Promoter-specific transcription inhibition in Staphylococcus aureus by a phage protein.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 20
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4g6dA00
5JFRA 5DD4A 3K69A 4G94A 4LMYA 2Z33A 5E8IA 4Y17A 2DBBA 3HOSA 3K0LA 5K5OA 2K86A 3M9AA 3Q5FA 4XLNF 1HW2A 4R79A 3ECHA 3NEUA 1KU3A 2ZKZA 3MZHA 5DYMA 2KKOA 1L3LA 3SZTA 1CF7B 5D4SA 2O8XA 2W85A 1TBXA 1E2XA 2B0LA 3LQRA 1R1VA 1XSVA 4HBLA 1ZAOA 4BAYA 1F9NA 4IRGA 1XCVA 2ESNA 4KT5C 2XAGA 2HZTA 4IF4A 4WX9A 4EJWA 3HTSB 4L9VA 1FLIA 4FHTA 1FSEA 2FMLA 5BQTA 4B8XA 3BJOA 2VT3A 3E3VA 5D5WB 4MNUA 3T5XA 2HQRA 1FYMA 2XAFA 3E5XA 1O3TA 5E17F 1KYZA 3QRFF 2GIVA 1UHWA 1G3SA 2GA2A 4S05A 1USSA 4UVAA 1ZRDA 3NQOA 2K4JA 2A07F 3ISPA 1T0FA 2QBYB 5E1WA 4BQAA 2OA4A 3FZVA 1XN7A 3GUDA 2Y48A 3ZMSA 1OPCA 1KQ9A 2O61A 1HKTA 3W6KB 2F2EA 1OKRA 5EEGA 4XBFA 2ETHA 3K1NA 4HZFA 3HOTA 1JXSA 1HBXG 3GXOA 4IRHA 4AIHA 5CVIA 2OAZA 5HDNA 2HEOA 3I4PA 2HFHA 3RTRA 1BBYA 2NAZA 1G4DA 2RDPA 3AAFA 2PQ8A 4ZZDA 3J80K 1ZREA 3GYHX 3F22A 2P5KA 4LJZF 4Q4ZF 3V8JA 3L2CA 1PUEE 3GZ5A 2A61A 2E1NA 1T6SA 5KVRA 2A6HF 3SZPA 1O57A 4CGZA 3MFKA 3MZYA 1CF7A 2V9VA 5F6FA 3ERED 1LQ1A 1O3SA 3KLNA 2XGXA 1J5YA 2DLLA 4JK1X 3VEPA 1RUNA 2G7HA 1SMYF 1U2WA 1XDUA 1YW8A 4MHGA 1S7AA 3BZ6A 5LGUA 3CUQC 3TOAA 2XIGA 3HYIA 3GFJA 4IVNA 1R58A 5DV5A 3DQVC 4AWXB 2HYFA 1OMIA 2NNYA 2COMA 2P6TA 1I27A 4EM1A 4YIIA 1DPRA 1S6LA 2NNNA 1X3UA 2R7DA 3RKWA 2KJCA 4ZYDA 2PJPA 3ZQ7A 3BOQA 2QBYA 4G8XA 1XMKA 5JVTA 2VOPA 2JTVA 4IHSA 1TTYA 5K1YA 2VXZA 3U9GA 1ZH5A 1ZG3A 5FB2A 4RAZA 2V1DA 4UHTA 4EJVA 1I5ZA 3V7CA 3RKYA 5D4RA 1JHHA 2Q8KA 3F23A 3F6OA 4RGRA 2LF8A 1BJAA 4R1HA 3SQNA 2HGCA 1QZZA 4AD9A 4N9HA 3DV8A 1OYYA 5CVRA 1XGNA 1SFUA 5FLXZ 3EYYA 2XAHA 4UV9A 4I0BA 1KQ0A 3KETA 4RB2C 3T1BA 1FNNA 4UUVA 3WTYC 2FBIA 3HSEA 3REOA 5BOXA 1IZ1A 2E1CA 2CSOA 4HQMA 2MLKA 2Z3YA 4G7HF 1R7JA 3V7RA 4A0ZA 1IN6A 4KN7X 2KJBA 1YS6A 3PFIA 4NB5A 1FX7A 1FOKA 1SD6A 3D5LA 1YG2A 4LK1F 1I1GA 5D5VB 2P6SA 2CYYA 1T38A 1RNLA 1TQMA 1YO5C 2HR3A 3ZP5A 3BY6A 3K1PA 3CUOA 1SFEA 4ESFA 1Y0UA 3FF5A 4K2EA 1R22A 2FRHA 4G6DA 5HVQC 1BC8C 4HX4A 3CLOA 1QQIA 2ISZA 1K7AA 1XD7A 2E7WA 3KP7A 2DT5A 4RB0A 3PQJA 4OMYA 4HYEA 3KP2A 1KU2A 4ZZLA 2V79A 1ZGAA 5DCMA 3KE2A 4XLPF 2OBPA 1YQAA 3K9TA 3JAMZ 2IT0A 4LB6B 3F8MA 2QZ8A 1U8RA 1J0RA 1SAXA 1PDNC 2JZYA 4G7ZF 4XSXF 2F5DA 3RPQA 2DI3A 5ERIA 2BV6A 3QU6A 4XSZF 1MDMB 1BI1A 4B09A 3TDZC 4MGRA 2UXNA 1XGSA 4EM2A 1J7KA 2YPRA 2RGVA 5HLGA 2R3SA 2QUFA 4LB5A 2YX7A 4P96A 1IAWA 2P8TA 3F72A 1XSDA 1BOAA 2M87A 2CQKA 2XVCA 3T0YA 2H6CA 2L02A 4ASNA 1NHAA 3F6VA 2PI0A 1TNSA 1ZLJA 1STZA 2LF7A 5IT3A 1JGSA 2PEXA 4EGZA 1IXCA 4WF2A 4EGYA 2RC4A 4KIFA 1WWXA 3RI4A 4ZH4F 4PDKA 1FWZA 5A2QZ 2PFBA 3K1MA 3LQQA 2ACJA 4L18B 4KNYA 4EJOA 5L3GA 2ISYA 1KU9A 3FX3A 2IW5A 4QLCU 3LAPA 1G3YA 2WC2A 2RQPA 4ESBA 3WTWC 2F5CA 5AIPA 3C7JA 3DPLC 2DK8A 4LLGF 2PBIA 4FX0A 3WE2A 3FWEA 3ZMDA 3CUQB 2OQRA 2H94A 1QO0D 2F5FA 5EEHA 3WE3A 4M6XA 1T39A 1IXSB 3TOBA 3IRQA 5CVUA 3GWZA 2BEOA 1QGPA 4CICA 4U0WA 3I71A 3LWFA 5ICGA 2VOOA 2CGPA 5H20A 2Y0MA 3HHGA 3OV8A 2A68F 1T98A 2K4BA 3ABUA 3IC7A 2OZUA 1MDMA 3J81Z 4EJTA 2A6EF 5J8FA 1Z05A 1Z6TA 2YSRA 1UFMA 4HV5A 1Z9CA 1MJ9A 3HSRA 1W4MA 2P7VB 1LEBA 3FM5A 1B59A 3H3ZA 1LEAA 3C3WA 3HRMA 3DF8A 1IRFA 4YFKF 2FU4A 1YYVA 5DD8A 1MGTA 3HRUA 2JPCA 3IWZA 2DPDA 4HA8A 2O3FA 3EYIA 2UWMA 2D45A 2WV0A 1EH7A 3IKVA 2OZ6A 4I0AA 3TGNA 2UZKA 3HUGA 2HS5A 5FD6A 2L54A 3IKTA 4ON0A 1BM9A 4OOIA 1FP1D 5LLQA 1IN7A 4GYIA 4HAMA 4RB3C 5FLXK 2RNJA 4IPAA 5LRRA 1GXPA 2NS0A 5J8CA 4M72A 5K5RA 2HKXA 3FXQA 5DEQA 4DNCA 2EFNA 3CUQA 1YFHA 1FP2A 4UNOA 4BH9A 1LNWA 4OIOF 4BYYA 2BE5F 3ZN1A 1S7OA 1YS7A 2M8EA 4YFNF 4HLYA 4A6DA 2E7XA 2CW0F 3E97A 5HDKA 3LA7A 2H27A 3BPXA 5BS6A 3O3KA 1SFXA 2IRFG 3QP5A 1J2XA 2GQQA 1DPUA 4WCGA 5IT9K 4HLXA 4L9JA 2ESHA 2LDUA 5LRSA 4ESJA 3ROUA 2G9WA 3BJAA 4PGHA 3GO5A 3U1DA 3KEOA 4I09A 1B6AA 3KFWX 2FBKA 3CJNA 3S2WA 1W5SA 2QENA 1GXQA 4TV7A 3WTSC 2MC3A 1FPQA 4IRIA 1D8JA 1IN4A 1HSTA 5ICEA 2AS5F 3L00A 3VODA 4E70A 3R4KA 2KIFA 4ETSA 1ZN2A 2XASA 4RGUA 3M1EA 1XB4A 1P4XA 1FBUA 2IJLA 1RI7A 4EMSA 4LLLA 1XGMA 3I0TA 4G6QA 4WXCA 2LKPA 4WXDA 4A2UA 5HS7A 3M7GA 3F21A 1TLHB 2FE3A 1MJAA 2OU2A 2HOEA 3N97A 3V8LA 4Q47A 3FXRA 3I5UA 1T2KA 3IWFA 4AIKA 4RGXA 1TW3A 1RIOH 3I54A 5ILUA 1Z91A 3BROA 1SD7A 2PLYA 4O5VA 3R0AA 2Z9OA 1WQ2A 4P5OA 4BXUA 1UCRA 1ODDA 2GA1A 3LSTA 3KZZA 3R0JA 2K27A 4M74A 2ZMEB 2FMYA 2O03A 1U3EM 4YIFA 3VFZA 4CYDA 5A2QK 4L5IA 2IA0A 4CDGA 3GLXA 2UXXA 4XRFA 4LLNA 2P5LC 4ENMA 2F5EA 3ZN0A 3ZMVA 3HRSA 2OQGA 4R8HA 5LBQA 1R23A 3F8FA 4FT8A 1H0MA 1IW7F 4Z2YA 4UV8A 4WXHA 1C0WA 3QP6A 4HDVA 4AVPA 1YIOA 4EQQA 1S3JA 2JT1A 2XROA 5H6QA 4GXOA 3COAC 1HW5A 1XDSA 3P9CA 2HTJA 3KP5A 1MZBA 1D3YA 2DK5A 2FA5A 4L9NA 1USTA 5DUKA 3J81K 1IUYA 3NRVA 4RB1A 2GXGA 3F8NA 1ON2A 5HOOA 4MTDA 3C18A 2EFQA 3F8BA 3IL2A 2QM3A 3I64A 2IPQX 1EH6A 1R5GA 3GVAA 2STTA 4HW0A 2C6YA 1IF1A 5ILSA 2EB7A 5CJ9A 4GGGA 2FOKA 1B1BA 2XUBA 2ZMEA 1KU7A 4A5MA 3BJ6A 1V4RA 1EH8A 2M45A 1REPC 1KGSA 3M8FA 4PZJA 2VE9A 3O2PE 2HDCA 5DUIA 5BMZA 3RYRA 4KICA 1I6XA 1F1ZA 2JSCA 1BIBA 1FY7A 4H0EA 2NYXA 3QU3A 3GF2A 1P4WA 4HDUA 3MWMA 2G7UA 1XGOA 3L9FA 3SFZA 3JSOA 2W84A 2EK5A 3T8TA 2DPUA 2DFIA 1DUXC 3IHUA 2HKOA 2AXLA 3V8KA 5E1ZB 5KK1A 1ZGJA 1F4KA 1BI2A 2CG4A 1LDKB 1GVJA 4CHUA 1H9GA 1W7PB 4MQVA 3RKXA 3WTXC 1TQIA 3FM3A 3J80Z 4CO8A 1F5TA 1LDJA 5E8GA 3EQLF 1SD4A 3B73A 1YTYA 1EV7A 3FHZA 4A12A 1FBSA 4N9IA 5D5XB 2P4WA 3WTVC 2X0LA 1OYIA 5FFZA 1QZYA 3H92A 3E6MA 1XCBA 3P9KA 5L3EA 2HWVA 1JE8A 2GAUA 1OR7A 3WGGA 3MQ0A 1SD5A 5TRDA 2DAOA 3JTHA 2EWNA 1U5TB 2XHKA 5D6FA 1IN5A 2KIUA 2QVOA 3ULQB 2R7FA 4GO1A 4L0YB 2MD5A 2TDXA 2H09A 3FMRA 2JRTA 2J5OA 2RKHA 3F3XA 1QPMA 4U0VA 1WKMA 3MEXA 2HYGD 1FC3A 4HX8A 3I58A 2QWWA 3VB2A 2EV5A 4M9XA 2ZBKA 1WSUA 3QAHA 2Q2EA 3WG9A 2QQAA 3Q9SA 4I7HA 1CGPA 1MKMA 4OIRF 3TQNA 4HX7A 2YR2A 1W7PA 2ZO4A 5HS9A 4KIGA 5BPIA 4JBAA 4OIQF 5LHHA 1S8NA 3WODF 2X4HA 3E5UA 2VC1A 4BHCA 1KYWA 2FNPA 1FT9A 4MTEA 5K5QA 3KP3A 1BIAA 5LHGA 1R00A 1HW1A 4KIBA 3TDUC 1GHCA 1D8KA 3GFIA 3T8RA 4ENJA 1XSXA 1P92A 2FBHA 1ZARA 4KA4A 1BN5A 2L3DA 1P2FA 2LSOA 3LFKA 1E17A 1BI3A 5TJJA 2EFWA 1S29A 2FEZA 2CO5A 3J7AO 2PN6A 1QBJA 4IXAA 2OD5A 2NRAC 1L0OC 3OOPA 4LFUA 1U5TA 4ENNA 4A0YA 1B4AA 2Z5UA 4OU0A 2EJRA 2ADUA 1P4AA 2L4MA 3BWGA 3FMSA 4GYGA 3ZPLA 1P6RA 5D5UB 1ZLKA 1ONVA 3E6BA 4LG0B 3H3UA 4I98B 1ZG5A 3KP4A 3CTAA 3LA3A 3TO6A 4KYWA 1J75A 4LGWA 2PMHA 2EV6A 2LNBA 5ICFA 4WK8F 4KN4X 4UVBA 4HF2A 1R1TA 3HSFA 1PP8F 5FD5A 1J59A 3GX4X 4O3MA 4Q5SF 3DPTA 3V7SA 2FF4A 3GEZA 2GXBA 1W5TA 5LGTA 1Z6RA 1G6NA 2W57A 2PMUA 4NHJA 4M9ZA 5F1RA 2RV8A 1J9IA 5DDGA 3D0SA 3L7WA 5CVJA 3HRTA 4OINF 3U2RA 3BDDA 4U88A 3WTZA 1XMAA 4YFXF 2L4AA 3P9IA 4ZYEA 4LD5A 2WWYA 2PG4A 2MBFA 3KP6A 3JAMK 3ELKA 4HQEA 5FGMA 1ZRFA 2D1VA 4RAYA 3GFMA 4HV6A 3FMQA 2D2WA 4P9UA 2EA2A 2IVMA 4S04A 1MJBA 4PGGA 3FXUA 5ED4A 3HTUA 2EV0A 1K78B 3DKWA 2WTEA 3JW4A 4RGSA 1G3TA 3E6DA 5AONA 3LAJA 2DQRA 2HQNA 4IJAA 3LA2A 2QQ9A 5DCFA 2VC0A 1U5TC 3E6CC 3PQKA 1AOYA 1IRGA 4LG0A 3JTGA 4M9SA 4G7OF 1I1SA 3BPVA 3L09A 3KEQA 1WRJA 4MEXF 4L9TA 1IXRC 3O6BB 3N4MA 2K02A 1DDNA 4PCQA 1V3FA 5JR3A 5D8LB 5CVVA 1JHFA 4AIJA 4M6YA 3JSPA 2W24A 4KMFA 2DTRA 3HIFA 3IRRA 1SMTA 4G9YA 4F7ZA 1B9NA 1A04A 1R1UA 1D5VA 1FZPB 4ZYGA 1WI9A 2GWRA 1ZRCA 3E5QA 3I53A 5FFXA 3QOPA 1ZYRF 2VBXA 1ZG1A 3RDIA 2KRFA 2M30A 2V1UA 2VODA 4BHPA 2YU3A 2XRNA 3RYPA 5DCMB 1FYLA 1FBQA 3EUHA 1DP7P 5LEKA 2VE8A 3F8CA 3KLOA 4U7DA 4Y13A 3WU0A 2VONA 1HSJA 2QYOA 2XAJA 5ILVA 1K78A 3V4GA 4KDPA 4KMUX 1LB2A 5D8KB 4BNCA 1HQCA 1YW7A 2QQBA 3RPUA 4OIPF 5L3BA 3C1DA 3WGIA 2BGCA 1TNTA 4I02A 2ZNYA 2DW4A 2P5VA 4WWCA 3RJPA 3W6JB 2ZCWA 2MH2A 4I2OA 5H6RA 2DU9A 2A3SA 2CWEA 4Y15A 2D1HA 3ZMUA 4HOBA 2IA2A 3VOEA 3ABTA 1W7PD 2Z99A 2RN7A 5E1XA 2FXAA 2XV4S 5AIQA 2FQ3A 2DQLA 1B9MA 3KCCA 2BYVE 3WTTC 1AWCA 2QLZA 2YX4A 2VBWA 1MD0A 1G3WA 5CYVA 3QPTA 1YLFA 3MCZA 5LEJA 5IT9Z 4ENKA 2K7LA 4UVCA 5HS8A 3R61A 1BC7C 1KA8A 4IHTA 5L3DA 1U6GA 5LHIA 2O0YA 3KZYA 4UXNA 3GZ6A 4HF1A 4L0ZB 1Z1DA 3EDPA 1LJ9A 1K6OA 4DQ2A 4U7BA 3WTUC 5D6EA 4EVIA 2Y75A 2ZFWA 1UHMA 2JPBA 2MH9A 1LDDA 4GCVA 5CLSA 1TQPA 2A5YB 3WU1B 3B02A 4JQFA 1H9TA 4Q48A 1U78A 5HLHA 5JHUA 3BP8A 1O3QA 3DXJF 2H6BA 3DEUA 2XKOA 4EM0B 3CDHA 1K79A 3WGHA 3SHFA 5HLIA 3ML6A 2O6GE 1R36A 1IN8A 5FO5A 2M5WA 2VBYA 4YG2F 3I59B 4FX4A 4NQWA 4P9FA 3G3ZA 4LK0F 3M8EA 2P7CB 4CZZA 1LVAA 2L01A 1RUOA 4EJUA 1FSHA 1TW2A 1BI0A 4I01A 3GFLA 5F64A 3DP7A 3HHHA 2GZWA 2V1XA 2A69F 4QWQA 2ZNZA 4MEYF 5JI6A 2RVCA 2EA4A 1FYKA 4MQ9F 3MAJA 2MA3A 2Q0OA 4KUMA 4HF0A 1ZHFA 4A6EA 3ZMZA 5ICCA 2HTSA 4CXFA 3K2ZA 4D0PA 3GW2A 3G73A 1O3RA 3R6SA 2W25A 4L5JA 5L3FA 1HKQA 1O7FA 4ZYHA 2J5PA 2DO7A 3Q9VA 2V6CA 2IA1A 2XKPA 4KFCA 2STWA 2EFPA 2EFOA 1HXDA 2M1BA 4O6JA 5E18F 3DFGA 3P7NA 5J6XA 5E20A 1O7LA 1Z7UA 1ULYA 2VT2A 6PAXA 4BHBA 3ECOA 3TKYA 4OMZA 1QNTA 2FNAA 4EV0A 4RS8A 4A5NA 5L3CA 2CFXA 3TO7A 2KIMA 1YW9A 4N0BA 3R60A 5HDGA 4A0XA 3QPHA 2ZXJA 1R5HA 2FSWA 1OYWA 1Q1HA 3ZMTA 1VTNC 3EETA 2MLGA 3CO6C 5BPDA 4M73A 2VN2A 3RIRA 2IP2A 3TO9A 2VBZA 4P55A 2ELHA 2BBYA 4U0YA 1ON1A 5LGNA 3I59A 1HKSA 1RZ4A 4M71A 2XAQA 1PP7U 3SXYA 1UB9A 2ZJ2A 1KQ8A 3CO7C
chains in the Genus database with same CATH superfamily
2CW8A 4A3EJ 5JFRA 1D0ZA 5DD4A 1JTXA 4KJZA 3K69A 4XR6A 2HDWA 4G94A 4LMYA 1VNDA 2Z33A 2CJJA 2MFZA 2DA5A 5E8IA 4Y17A 4DGWB 2DBBA 3HOSA 3K0LA 4NBQA 5K5OA 1V5FA 2K86A 2L9SA 3M9AA 3Q5FA 4XLNF 1HW2A 3BR6A 1K4SA 4R79A 3ERMA 3ECHA 3NEUA 2M7BA 4A69C 3FK7A 4C30A 3Q3SA 2NVTJ 4J00A 1KU3A 2ZKZA 3MZHA 4KISA 5DYMA 5FKNA 2KKOA 1L3LA 2DFHA 3SZTA 1BR2A 3SEQA 4C3JJ 3JRBA 2R93J 1Z7LA 4NC7A 1CF7B 5D4SA 2XC7A 4BXXJ 5HLTA 1Z3XA 4BBSJ 3BQZA 4BQOA 2O8XA 3S17J 1WHUA 2W85A 1TBXA 1E2XA 3CDIA 4IOCF 3GTPJ 2L9NA 2B0LA 3LQRA 1VQ7I 1R1VA 3TBIA 1XSVA 2M3AA 1ZAOA 4HBLA 4BAYA 1F9NA 3OYNA 4IRGA 1XCVA 3BR3A 4QSHA 2ESNA 4KT5C 2XAGA 3DKXA 2HZTA 2VI6A 4IF4A 4WX9A 4EJWA 3HTSB 4L9VA 1FLIA 3HOYJ 4FHTA 1FSEA 2FMLA 5BQTA 2CFOA 4B8XA 3BJOA 2VT3A 1FMVA 2E34A 3RPUD 3E3VA 1HC8A 5D5WB 4MNUA 3T5XA 2JA7J 4II2A 2HQRA 2JUCA 1FYMA 2GXAA 2XAFA 3E5XA 2IGKA 1O3TA 1KYZA 5E17F 3QRFF 2GIVA 1UHWA 1G3SA 3VPRA 1ZELA 2GA2A 4S05A 2L7ZA 3S3NA 1USSA 4UVAA 1ZRDA 3NQOA 2K4JA 4D5CA 1J09A 2M7AA 2A07F 3ISPA 3OIQA 1T0FA 2QBYB 2Y0SA 5E1WA 3DWLE 4BQAA 2MW8A 2OA4A 3FZVA 1Y8QB 1XN7A 1GVDA 1MBFA 3TW7A 2NOJB 2ZXHA 3GUDA 2Y48A 3ZMSA 2KRCA 1OPCA 1KQ9A 1W36D 2O61A 1HKTA 3W6KB 2F2EA 5EJCA 2LLKA 1OKRA 5EEGA 3L1PA 3IUOA 4XBFA 3OL4A 2ETHA 3K1NA 4HZFA 3HOTA 2ZJQF 1JXSA 1HBXG 1GDTA 3GXOA 1Z3YA 3B6AA 4IRHA 4AIHA 5CVIA 2LREA 3PNVA 2OAZA 5HDNA 2HEOA 3I4PA 3BTCA 2HFHA 3RTRA 1BBYA 2NAZA 4ZYAA 2RDPA 3MZ8A 3ZQQA 1G4DA 4I6ZA 3HL2A 2DMQA 3AAFA 2EZHA 2PQ8A 4ZZDA 3J80K 1ZREA 3GYHX 3F22A 2P5KA 1PYVA 2WAQA 4LJZF 3A2KA 4Q4ZF 3V8JA 4Z6YA 2EBIA 3L2CA 1PUEE 3GZ5A 2A61A 5DM7F 4BL0B 2E1NA 3BCBA 4XK4A 1H88C 1T6SA 1Q1VA 4C3HJ 4BE0A 4LIUA 3ZXSA 1CQTA 3SYTA 5KVRA 2A6HF 2HVSA 3FDYA 3SZPA 1O57A 4CGZA 5IP9J 2X1EA 3K4BA 2LVSA 1WJAA 3MFKA 3MZYA 1CF7A 2WY7Q 3DKYA 2V9VA 5F6FA 3ERED 1LQ1A 1O3SA 2VQCA 3KLNA 2XGXA 1J5YA 3HPGA 2DLLA 2LY9A 3AG4H 4JK1X 3VEPA 4F3QA 2JSPA 4C2TA 1RUNA 5K7ZA 2COBA 2G7HA 4XRMA 4A3CJ 3GLLA 3JR9A 2R0QC 1SMYF 1U2WA 4DZPA 1XDUA 1YW8A 2UUZA 4MHGA 1QA6A 2EH3A 3CP8A 3HC7A 1S7AA 3BZ6A 5LGUA 1JKRC 4HRIA 1Y0NA 3ZOBA 3CUQC 1AA7A 3K6GA 1IGNA 3FKIJ 3TOAA 2XIGA 3HYIA 3GFJA 2R7VA 3DBRB 4IVNA 1R58A 5DV5A 3DQVC 4AWXB 4QTRA 2HYFA 1OMIA 5TGTA 2CQNA 1GV2A 4Y33A 2NNYA 1JGGA 2HU9A 2COMA 4BS9A 4GDFA 3WHBA 2P6TA 1MH3A 4N4NB 3ABLH 1I27A 1DP3A 3QOEA 4EM1A 1KZHA 4YIIA 1DPRA 2HOSA 1S6LA 2NNNA 2OC6A 1X3UA 2R7DA 2D5VA 3RKWA 2KJCA 1D0XA 4ZYDA 2PJPA 3ZQ7A 3N05A 1APLC 3BOQA 4BBRJ 4CYCB 2DODA 1W0UA 2QBYA 4G8XA 3BR2A 2X6OA 2CV0A 3K7AJ 1XMKA 2ECBA 2YU9J 1ENHA 5JVTA 4Y3OA 2VOPA 4W97A 2JN6A 2JTVA 4IHSA 1TTYA 4PFPA 2O5RA 1VF9A 5K1YA 2VXZA 4RLQA 2VJ5A 3U9GA 1ZH5A 1ZG3A 5FB2A 1UMQA 4A3FJ 1WH7A 2V1DA 4RAZA 4UHTA 4IL6C 4QIWN 4BU2A 4EJVA 3H35A 1I5ZA 2JJ7A 3V7CA 3RKYA 5D4RA 1UZCA 1JHHA 3DPUA 5M5YJ 3HZJA 2Q8KA 3F23A 3F6OA 4RGRA 2LF8A 1BJAA 4R1HA 3SQNA 2HGCA 1SFOJ 4UB8C 1WJCA 3SZGA 2O7OA 1QZZA 1BL0A 4AD9A 4N9HA 3G6EI 2R7WA 2LYCA 2I5UA 1P9QC 3DV8A 1OYYA 5CVRA 1XGNA 1SFUA 3SEZA 5FLXZ 2ID3A 1HLVA 1B8IB 1ETYA 3EYYA 2XAHA 4UV9A 3H9QA 4I0BA 1KQ0A 3KETA 1UHSA 4RB2C 4J01A 1WH5A 3T1BA 5IPAA 4DYQA 1FNNA 2ZFUA 2GLOA 4UUVA 3WTYC 3RZOJ 2FBIA 3HSEA 1JKPC 2KQRA 5DS9A 3REOA 5BOXA 3K2AA 1IZ1A 2E1CA 2KDZA 2QA4I 2CSOA 4HQMA 2MLKA 2Z3YA 4G7HF 2HOAA 1R7JA 3V7RA 5IOYA 4A0ZA 3H0GJ 2VJ4A 1IN6A 4KN7X 2KJBA 1QPIA 2DA1A 2KZGA 4PUSA 3EPZA 1YS6A 3G2BA 3PFIA 1FX7A 4NB5A 2ZJRF 1FOKA 1T08B 1SD6A 3D5LA 2LP0A 4BGDA 1YG2A 3BCAA 5J4YA 4LK1F 1I1GA 5D5VB 2DXIA 2P6SA 2CYYA 3I9V2 2F48A 1T38A 2B9SA 2DOFA 1VQ5I 1RNLA 1TQMA 1Z67A 4B48A 3FISA 1YO5C 2HR3A 3ZP5A 3S1QJ 4HNVA 3BY6A 3K1PA 3U1KA 1YJNI 2KMUA 3CUOA 1SFEA 3G1MA 1V5EA 1Y0UA 4ESFA 2XSJC 1G8XA 2ZSHB 3FF5A 4K2EA 1R22A 2FRHA 4G6DA 5HVQC 3I4MJ 5IY5H 2XF6A 4FQGA 3OS1A 1IUFA 1BC8C 2VB6A 4HX4A 3CLOA 1AU7A 1QQIA 2ISZA 1K7AA 2DA4A 3S1MJ 1XD7A 1RC9A 5E3LA 3CCYA 3WHCA 2E7WA 3KP7A 1BR1A 4E7HA 1JUPA 2DT5A 4FE4A 3I3LA 3SFIA 3K70C 4CYCA 4RB0A 2OF7A 3PQJA 4OMYA 3K4MA 4HYEA 3KP2A 1KU2A 1TT0A 5F27A 3OYFA 4ZZLA 4HPQA 2V79A 2BHYA 2P81A 1ZGAA 5DCMA 4FASD 3KE2A 4H4KC 4XLPF 1MMDA 1MNEA 2OBPA 4C2MJ 4A3JJ 4C2UA 1YQAA 1D1AA 3K9TA 4CCKA 2DYSH 3BG6A 3JAMZ 4Y52J 2HPIA 2IT0A 3KYLA 4LB6B 3MKYB 2L7MP 3F8MA 2QQ8A 2QZ8A 1U8RA 1J0RA 5J3LA 5C4JJ 1SAXA 1N25A 1PDNC 3SDGA 2JZYA 4G7ZF 4XSXF 2F5DA 3RPQA 1VQKI 2DI3A 4D5FA 5ERIA 2BV6A 3D5SC 3QPLA 3QU6A 4XSZF 1V55H 1X4OA 1MDMB 1BI1A 4B09A 1IV6A 2Y31A 3TDZC 4MGRA 3GCMA 2UXNA 2B7EA 1XGSA 3S1RJ 2HI3A 3A4CA 4EM2A 4XIDA 1J7KA 2YPRA 2RGVA 5HLGA 1R6RA 2R3SA 3OR1C 2QUFA 2K9SA 2M34A 5B66C 5FKKA 2AQEA 4LB5A 2IEKA 2YX7A 3QWLA 1WJ5A 2XPVA 3H1CA 4P96A 1IAWA 2P8TA 3F72A 1XSDA 3GMEA 4HSRA 1VQ9I 1BOAA 2M87A 2CQKA 2NS8A 3JRCA 2XVCA 5FKMA 3S93A 2JUGA 3CC4I 2DMNA 3T0YA 2H6CA 2VASA 2L02A 2DJIA 4ASNA 3CMEI 1NHAA 3F6VA 2LD5A 2PI0A 1TNSA 1ZLJA 1STZA 2A05A 2LF7A 5IT3A 2QKLB 1H8AC 1IJWC 1QU3A 1JGSA 2PEXA 1R4MB 1IXCA 4WF2A 4EGZA 4EGYA 2RC4A 2L5QA 2CQXA 1B72A 4KIFA 1WWXA 3RI4A 1W0TA 4ZH4F 1X58A 4PDKA 1QHHD 1FWZA 5A2QZ 2A5WA 2PFBA 3K1MA 3LQQA 2ACJA 4L18B 3PFYA 4KNYA 4EJOA 5L3GA 3HUGB 3CMYA 2ISYA 1KU9A 3FX3A 3S3MA 2IW5A 3S8PA 4QLCU 3LAPA 1G3YA 1YJ9I 2WC2A 3MN2A 4UUSB 4PJ0C 1DU0A 2RQPA 5E3NA 1HOMA 4ESBA 3WTWC 3Q0VA 2X6XA 2F5CA 2QCOA 5AIPA 1SAUA 3LL7A 3C7JA 3G1LA 3DPLC 2DK8A 4I99C 4LLGF 2PBIA 2AHQA 4FX0A 2N8GA 3OYGA 1RESA 1T33A 4V2GA 2IXSA 3WE2A 2E19A 3FWEA 3M8JA 4FTHA 4F52A 3ZMDA 2F4OB 1IDYA 2OQRA 3CUQB 2VKEA 3OYEA 2H94A 1QO0D 2F5FA 5H2FC 5EEHA 2IAIA 1P7IA 4M6XA 3WE3A 1T39A 1IXSB 2X1CA 3TOBA 1DU6A 2LR8A 2EILH 3IRQA 5CVUA 3GWZA 2BEOA 1QGPA 1GLNA 4CICA 1QZEA 2R4GA 2IGNA 4U0WA 3O8HA 1JI8A 5IOZA 3I71A 1RKTA 3LWFA 4N4OB 1EJ9A 1MMSA 2R5YB 5ICGA 2VOOA 5GP9A 3KPHA 2CGPA 5H20A 2Y0MA 3HHGA 2E5NA 4XLCA 3OV8A 2A68F 1T98A 3ASNH 2K4BA 5EZHA 3ABUA 4GFBA 4LIVA 3IC7A 2GOMA 2OZUA 2H8WA 3TP0A 4PSXA 3LSJA 3M1CA 2WBMA 1MDMA 3J81Z 4EJTA 2A6EF 5J8FA 2XB5A 1Z05A 2V9PA 1DQUA 1Z6TA 2YSRA 3CMMA 2VPLA 1UFMA 2G0EA 4HV5A 1Z9CA 3M07A 1MJ9A 2KLOA 3HSRA 1W4MA 4UB6C 4B1RA 2P7VB 4NUBA 2OPTA 5CPRB 2M9HA 3L2WA 2R7RA 1LEBA 3FM5A 5LD2C 1B59A 4XLEA 1SFKA 3H3ZA 1ORKA 4E7LA 3ZR8X 4NC8A 1LEAA 2W82A 3C3WA 3HRMA 2HZDA 2P0WA 1IDZA 3DF8A 1IRFA 1ZR2A 3UNGC 4YFKF 3HEFA 1H89C 1X1DA 2FU4A 1YYVA 5DD8A 1MGTA 1NG6A 1FMWA 4ABZA 4DJAA 3HRUA 1TWAJ 2JPCA 3W2VA 1YJWI 1OCZH 3IWZA 2DPDA 3AG2H 4HA8A 2O3FA 1JT0A 3EYIA 3MKLA 5K7FA 5EDNA 4BACA 3ABMH 1UG0A 2UWMA 1ETOA 3CCSI 2IGMA 2QGUA 1LKXA 2D45A 2WV0A 4AUXA 1D1BA 3QODA 2H8RA 1EH7A 3IKVA 2WAEA 2OZ6A 2K5CA 2R92J 1NG7A 3G4SI 2R5ZA 4I0AA 3TGNA 2UZKA 3HUGA 2HS5A 5FD6A 2L54A 3IKTA 3ZGKA 4ON0A 1BM9A 4OOIA 2I8DA 4E7SA 1FP1D 5LLQA 4UUSA 1Y1VJ 3TW6A 4ZTFA 1IN7A 4UUTA 4GYIA 4HAMA 4YELA 1ITYA 1JJ8C 4YRVA 1RR7A 4RB3C 5FLXK 2RNJA 3HPHA 4IPAA 2LG4A 3DTIA 5LRRA 1GXPA 2NS0A 5J8CA 4M72A 1OR7C 3PM1A 5K5RA 2HKXA 2DT7B 2MD0A 3FK6A 3S14J 1N77A 3FXQA 5DEQA 4DNCA 1TWGJ 2EFNA 3CUQA 4HSTA 3HXLA 3KYDB 2DOAA 3BG9A 1YFHA 2DMUA 2V26A 2H1KA 1FP2A 4GRIA 4UNOA 1TZLA 4BH9A 2QSGX 1I6HJ 1LNWA 2PMZN 4D7MA 4OIOF 4BYYA 1R9TJ 2CRGA 2X6WA 2BE5F 2FD5A 3ZN1A 2KZVA 1OCCH 3L2QA 4M3BA 2DMTA 5F0FA 1S7OA 1DGRM 2QKMB 1I3QJ 2VKVA 1G59A 2ICWG 1YS7A 2M8EA 1ZK8A 4YFNF 4HLYA 1ZTRA 3AFHA 1X3ZB 2E7XA 4A6DA 2CW0F 3E97A 5HDKA 2X51A 1OFCX 2HQ5A 2CUEA 3LA7A 3DBHB 2H27A 4AIDA 3DBLB 3PL8A 3BPXA 2Z16A 3GTLJ 1YRNB 5BS6A 3O3KA 1SFXA 2IRFG 3CD6I 3QP5A 1J2XA 1TWCJ 2AO9A 3DCFA 2GQQA 1DPUA 4WCGA 3ZCOA 1SC7A 5FJ8J 5IT9K 4HLXA 4L9JA 4X0GA 1UAAA 1OCRH 2BXZA 2ESHA 2LDUA 5LRSA 4ESJA 4RLFA 1D0YA 3OYAA 3ROUA 3ZQIA 2G9WA 3BJAA 3BLYA 4PGHA 3HDDA 1Z77A 4X1EA 3LSMA 4M3EA 3GO5A 1WJDA 3U1DA 3KEOA 4L5EA 1HCRA 4I09A 1B6AA 4FETA 3OYDA 1GUUA 3KFWX 3OY9A 3S1NJ 2E71A 2FBKA 1LE8B 4G6TB 3CJNA 3PO2J 3S2WA 1W5SA 3D1NI 3CF5F 5FRMA 2Q1ZB 1X1PA 2QENA 2EZKA 1BA5A 1GXQA 4TV7A 3WTSC 2MC3A 1FPQA 3SJMA 4IRIA 3FXOA 1D8JA 1IN4A 4DIQA 1HSTA 5ICEA 1RRJA 5F04A 2AS5F 3L00A 3VODA 5GAEJ 4E70A 3R4KA 2KIFA 1YX5A 4MLOA 4ETSA 1ZN2A 3KYCB 5DM6F 2NOGA 2XASA 4LG3A 4RGUA 1BW6A 3M1EA 1XB4A 3S32A 3CJTB 2HDDA 1P4XA 1FBUA 2GM4A 2CQ7A 3RZDJ 1HDPA 4Y7NJ 2V1NA 3KX2A 1X1AA 2IJLA 1RI7A 4EMSA 4LLLA 1XGMA 3I0TA 4G6QA 3A02A 4WXCA 3RQ4A 2LKPA 4WXDA 2NVUB 4A2UA 5HS7A 2BXYA 3M7GA 3F21A 1TLHB 2FE3A 1FJLA 3RKQA 2VQGA 2JMWA 1MJAA 2OU2A 2IGOA 3VSKA 2HOEA 3N97A 1WVRA 3V8LA 4Q47A 4XKCA 3FXRA 3I5UA 1R71A 3HOWJ 4F91B 3GTMJ 1T2KA 4BQQA 3IWFA 4AIKA 4RGXA 3OYKA 1A31A 1TW3A 1RIOH 2HQAA 3I54A 3BG3A 5ILUA 3TEDA 3B6CA 1Z91A 2E2JJ 2VL8A 1WZ2A 4IEJA 4BEHB 3BROA 2DA6A 4RM3A 2JQ7A 5GTHC 2ZXWH 1SD7A 2PLYA 1E3PA 4O5VA 3CZ6A 2F5VA 2Y2ZA 3S2DJ 2BHZA 2K9LA 2E1MC 3E1SA 3R0AA 2Z9OA 1WQ2A 3CCMI 4P5OA 4BXUA 3CJQB 1UCRA 3DTEA 3ZQCA 4B3XA 3J7YJ 1ODDA 2GA1A 3LSTA 1A36A 1LFUP 4DBRA 4BDZA 3KZZA 3R0JA 2K27A 4M74A 2ZMEB 2PMZA 2FMYA 4JOMA 2O03A 1U3EM 4YIFA 2Z1DA 3VFZA 4CYDA 2H1LA 1JUSA 5A2QK 1YRNA 4L5IA 2IA0A 3JCUC 4CDGA 4PJJA 3OYMA 1VQPI 3CCEI 3GLXA 3MVPA 2UXXA 3CMAI 4XRFA 2HVQA 4LLNA 4XONA 2P5LC 4ENMA 1VQNI 1JT6A 5IP6A 2F5EA 1K4TA 3ZN0A 1R4NB 1Z21A 2QEXI 1A6IA 3OSFA 3ZMVA 3HRSA 2OQGA 2K9MA 3LSRA 3W3CA 2K9NA 1U9OA 4R8HA 5LBQA 1LE8A 1R23A 3F8FA 1ZGWA 4FT8A 1H0MA 1IW7F 3NWSA 4Z2YA 4UV8A 4WXHA 1C0WA 4EEFG 3QP6A 2JRMA 4HDVA 4AYBN 2DDAA 4AVPA 1YIOA 4EQQA 1XS9A 2CUJA 3L2RA 1S3JA 2HVRA 4RDUA 2JT1A 1VQ6I 2XROA 5H6QA 4GXOA 5GTIC 3COAC 1HW5A 1XDSA 3P9CA 2A6TA 2HTJA 3KP5A 2PJRB 1MZBA 4B44A 5J47A 1D3YA 2DK5A 4V2FA 2FA5A 5JHFA 3H9GA 3CJRB 1XX5A 4KITB 4E4HA 4L9NA 4FE7A 1USTA 1ETXA 4BUPA 5DUKA 1XTAA 4M3GA 4DBQA 5KAFC 3J81K 3DEWA 3OYBA 3U21A 2Y9ZA 1IUYA 3NRVA 4RB1A 2GXGA 3F8NA 5JLXA 1ON2A 4YEJA 5EGOB 5HOOA 1MBHA 5EEAA 4XKVA 1MBEA 4MTDA 3JRHA 3C18A 1YE9A 2EFQA 3F8BA 2V4JC 2RREA 3IL2A 2IS2A 4U87A 2QM3A 2LFBA 3FBNB 1T95A 3I64A 3V42A 3OYLA 2IPQX 4CCLA 3K10A 1EH6A 3G1OA 1MNDA 1R5GA 3GVAA 4CCNA 3PNYA 4BEHA 2AQFA 2STTA 4HW0A 2C6YA 1IF1A 3J7ZI 4HG2A 5ILSA 1VQ4I 1IG7A 2EB7A 3L2UA 5F0HA 4OAZA 5CJ9A 3DLLF 4F93B 4GGGA 2JWTA 1ZQ3P 1VQMI 2FOKA 1B1BA 2XUBA 2ZMEA 4MIMA 1KU7A 1GV5A 3BJ6A 4A5MA 1V4RA 1EH8A 2M45A 2OV7A 5FLMJ 4BY7J 1SEUA 4BE2A 3KIOA 1REPC 1KGSA 1VQLI 3K4LA 1TWHJ 3M8FA 1LUJB 4NQWB 2CUZA 4PZJA 3VYTB 5FLVA 2VE9A 1A5JA 3O2PE 2YS9A 2BW3B 1O4XA 4XLHA 2HDCA 5DUIA 5BMZA 1SVLA 3H5NA 4ZTJA 3RYRA 4KICA 3A0HC 4D7NA 2HNHA 3FXLA 3LSKA 1I6XA 1RKWA 3KEYA 1WJBA 2ELKA 3OYCA 1F1ZA 3JRAA 3WU2C 2JSCA 1BIBA 2EIKH 2E2IJ 1FY7A 9ANTA 3VYUB 2V6EA 2CUFA 2WB1N 4H0EA 1TP4A 2NYXA 3MD2A 2CW7A 3HGGA 3QU3A 3GF2A 1P4WA 4HDUA 2VJIA 3MWMA 2G7UA 1XGOA 3L9FA 3SFZA 3OS0A 3JSOA 2W84A 2JA2A 2ME6A 2EK5A 3W6VA 3T8TA 5M5WJ 2DPUA 2DFIA 1DUXC 5B1AH 3IHUA 3VSLA 2FQ4A 2YUSA 1F36A 2IS6A 2GIZA 2PJRA 2HKOA 2Q2EB 3PUBA 2AXLA 3CCJI 5IYDJ 3V8KA 4IQ4A 1LPQA 5E1ZB 5KK1A 3BR1A 1ZGJA 4CCOA 1F4KA 1BI2A 2CG4A 2DMPA 1LDKB 1U9NA 1GVJA 4DYRA 2OCCH 1B8IA 4CHUA 1H9GA 1W7PB 2IBDA 4MQVA 1DGWY 1JKQC 2HXIA 1HA8A 3EUAA 1N75A 3ONQA 3RKXA 3P5JA 3WTXC 2I10A 2M2EA 3EUKL 3BTLA 5EGOA 1OJLA 2M4GA 1TQIA 3FM3A 5KCMA 4C3IJ 1SVMA 3O8GA 3OS2A 3EUHC 3J80Z 1MH4A 4CO8A 1MW7A 3FBIB 1F5TA 1LDJA 5E8GA 3EQLF 2L7FP 2VKHA 1SD4A 2W4SA 3AL0C 2BOLA 3B73A 1YTYA 1EV7A 3FHZA 4A12A 1FBSA 2QSHX 3F0CA 1S9HA 4N9IA 4OWRB 1X2NA 2CQQA 2NXNB 3HBLA 2VQHA 5D5XB 3BG7A 2P4WA 1U8BA 2R7ZJ 2DN0A 2CH0A 4E7KA 2XF7A 2LOOA 3OYHA 3WTVC 1PVEA 1OYIA 2X0LA 1QZYA 5FFZA 3H92A 3E6MA 5J1UA 2R7QA 1XCBA 1IC8A 3P9KA 4XM3A 3KZIC 2HWVA 5L3EA 1JE8A 2GAUA 1OR7A 1HDDC 1ETKA 3WGGA 1GT0C 4E7JA 3MQ0A 1SD5A 2EZLA 3D5RC 4B4CA 5TRDA 2DAOA 3JTHA 2M0CA 2EWNA 1U5TB 2XHKA 5D6FA 4ANJA 3HOVJ 1IN5A 2KIUA 2QVOA 1VZ0A 3ULQB 4XN3A 2Y9YA 3IV5A 4RA2A 2R7FA 3IH2A 1QVUA 4FISA 1WFXA 2V7FA 2LH9A 4GO1A 4L0YB 2ZMEC 2HOTA 2MD5A 2XGEA 5HNFA 2E1MB 2TDXA 5J4VA 1ZKGA 2H09A 4ZDLA 2E5ZA 3FMRA 2DDBA 1D1CA 2JRTA 2J5OA 2VJJA 3CCQI 1K6YA 5KHDA 1FOWA 1U0JA 3FHNA 2RKHA 4Y4RA 3F3XA 1QPMA 4U0VA 1WKMA 3MEXA 2HYGD 2CS3A 4F55A 1FC3A 4HX8A 3I58A 1OCPA 2QWWA 3IH3A 4B47A 3VB2A 4PK4A 3OYIA 2EV5A 3OL3A 3PIPF 3GTJJ 3S16J 2WV1A 2JA8J 4XOPA 4M9XA 2ZBKA 1WSUA 2OTJI 3QAHA 2Q2EA 4AVZA 3WG9A 5C44J 2QQAA 3OIPA 2KIQA 1BR4A 1A35A 2E1OA 3Q9SA 4I7HA 1HF0A 1CGPA 1MKMA 1MSFC 4OIRF 4X6AJ 3TQNA 4HX7A 2DOEA 2WY8Q 1NTCA 3TMOA 1LVKA 4QPQA 5K7HA 5CQGA 5JVGF 2YR2A 1W7PA 3JRFA 2ZO4A 2EIJH 3H36A 3LFUA 2ECCA 3BQYA 5HS9A 4B3AA 4KIGA 5BPIA 2K40A 4JBAA 4OIQF 4DW6A 5LHHA 1S8NA 3WODF 3JRGA 2X4HA 3CQZJ 4CSWA 3E5UA 2VC1A 4BHCA 1KYWA 2FNPA 1FT9A 3UKGA 4ZJZA 4MTEA 1D5YA 2HXOA 5K5QA 3KP3A 1BIAA 5LHGA 1R00A 3BZKA 2Y0SN 2OTLI 1HW1A 2UV1A 4KIBA 2LTPA 3TDUC 4MO7A 4MFDA 3H3VK 5EF6A 1GHCA 1D8KA 3GFIA 3T8RA 1OISA 2WAFA 4ENJA 2MYSA 2DYRH 3IAM2 1XSXA 2FX0A 1P92A 3C2BA 3HKZN 2FBHA 2OUMA 1ZARA 4KA4A 1BN5A 1FOYA 2L3DA 1P2FA 2QSFX 2HYJA 2LSOA 3LFKA 1E17A 1G2HA 2K9QA 2KISA 2VKDA 1BI3A 1V5GA 5TJJA 3J7AY 2L7KA 4A3MJ 2KFDA 1JJ6C 3K70D 3S15J 2X85A 4XNFA 1S29A 2FEZA 5CQEA 2EFWA 5J40A 1E3OC 2CO5A 3J7AO 2NVYJ 5GADJ 1IV8A 2MSYA 2PN6A 1QBJA 4EATA 4IXAA 2OD5A 2NRAC 1X4PA 1RETA 1L0OC 3TP3A 3OOPA 2OCEA 1JTYA 1U5TA 4LFUA 4ENNA 1S7EA 3OOUA 4A0YA 3UR3C 1B4AA 2Z5UA 4XKBA 1R5ID 4OU0A 2EJRA 4BE1A 1VQOI 1MMNA 2ADUA 1P4AA 2L4MA 3BWGA 3DLAA 3FMSA 1WJEA 4GYGA 2MGQA 1OQYA 3ZPLA 2XF5A 2Y69H 3CC2I 1P6RA 1XMXA 4BKXA 1BJZA 5D5UB 4BDYA 4F92B 1ZLKA 1ONVA 3E6BA 3W2AA 1EKEA 3I56I 4LG0B 4IKFA 4E6KG 3H3UA 1S72I 4I98B 4M3FA 1QRYA 2EZIA 2BVMA 1ZG5A 3KP4A 1W1WE 2O9LA 3CTAA 3E0JB 3LA3A 1LFPA 3TO6A 4KYWA 1J75A 3MKWB 2R5YA 4LGWA 2XSDC 3HOXJ 2PMHA 2EV6A 3CESA 2LNBA 5ICFA 2DTZA 4WK8F 4KN4X 2DJNA 4UVBA 2R7UA 4HF2A 3G71I 1R1TA 2VXDA 3HSFA 3BT9A 4DOZA 3S2HJ 5M5XJ 1PP8F 4BJTA 1FTTA 3RSNA 5FD5A 3FXMA 4CUGA 1J59A 2FJ1A 3GX4X 2KT0A 4J19A 3DEEA 4D9JA 4XLFA 5F0CA 3W2WA 4O3MA 1E0EA 3LOCA 1WCMJ 4W1UA 3LSHA 3DPTA 4Q5SF 4ZDOA 1Y8RB 3V7SA 2LY2A 2EINH 2FF4A 2L9RA 4XOTA 1BOBA 3GEZA 3BR5A 2GXBA 1W5TA 2R7SA 5LGTA 1Z6RA 4M3DA 1FEXA 3ASOH 1G6NA 2W57A 2PMUA 4NHJA 2XGDA 4M9ZA 5J1RA 2FUG2 1MMGA 5F1RA 2RV8A 2Y30A 5DDGA 5GPAA 1J9IA 3L2VA 3D0SA 3DU5A 3PUFA 4JX6A 3L7WA 2E60A 5CVJA 1TL8A 3HRTA 4OINF 3QYBA 3U2RA 3BDDA 4U88A 2BY3A 2JVHA 3GTKJ 3WTZA 2E36A 1XMAA 4YFXF 2L4AA 3P9IA 4C9YA 3SDBA 3ZQFA 2JK3A 2LMDA 1K83J 4ZYEA 1A6QA 5JLWA 3PO3J 1ETQA 4LD5A 2WWYA 2PG4A 1ETVA 2MBFA 1TWFJ 3KP6A 3JAMK 3ELKA 4HQEA 1I39A 5FGMA 1ZRFA 1QVTA 2D1VA 2K3FA 4RAYA 3LMMA 4CH7A 1SANA 1YOVB 4A3LJ 3ESWB 2V9KA 5DTDA 3HKZA 4CCMA 3LNQA 2CMPA 3GFMA 3K4JA 4HV6A 2LK2A 4E7IA 3FMQA 2D2WA 4P9UA 3H5RA 2EA2A 2NVQJ 2IVMA 3AL0B 1I3AA 2XPWA 4PFOA 4S04A 4S0HB 5KNLA 1MJBA 2ZC2A 4PGGA 3FXUA 3FXJA 2WADA 2L2OA 4RAFA 5ED4A 2NVXJ 1KONA 4LOCA 1YHQI 3HTUA 2ZSIB 2EV0A 1K78B 1ETWA 3M3YJ 3NAUA 3DKWA 1ACIA 2WTEA 3JW4A 4RGSA 1G3TA 2EQRA 4NDLA 4JYKA 3E6DA 1YI2I 5AONA 3LAJA 1MBGA 2DQRA 1X2MA 2HQNA 4IJAA 3LA2A 2QQ9A 5DCFA 2VC0A 3H5AA 4XLAA 5M3MJ 1U5TC 2TCTA 5FKLA 3E6CC 3PQKA 1AOYA 1VQ8I 4MFEA 2CU7A 2B63J 1IRGA 1LFBA 4LG0A 5GAHJ 3JTGA 4M9SA 4G7OF 3CLQA 1I1SA 3BPVA 3L09A 2BVLA 2GOXB 3KEQA 1WRJA 2DA3A 4MEXF 1X1BA 2GBYA 4L9TA 1MNMC 1V54H 3DU6A 1Y56A 1BW5A 4UY8I 1IXRC 3O6BB 4IHWA 1FIPA 1MSEC 4BY1J 3N4MA 2K02A 1DDNA 3C2GA 2VLAA 4FCYA 4PCQA 1V3FA 5JR3A 5HNHA 2ID6A 5D8LB 3OMYA 5CVVA 1JHFA 4A3IJ 3GTGJ 4AIJA 3A03A 2W00A 4M6YA 3JSPA 1R49A 2W24A 2FOWA 4KMFA 1M1EB 4PJMA 2DTRA 3HIFA 3OWTA 2LBFB 3IRRA 1SMTA 2M8GX 3RCOA 4G9YA 4II3A 2VPRA 3RQIA 4F7ZA 1B9NA 1NK2P 1A04A 1R1UA 1D5VA 1IRZA 3BR0A 3PSIA 1FZPB 3BTIA 4XMYA 1WI3A 4RAGA 1MBKA 4ZYGA 1WI9A 2GWRA 1ZRCA 4KT6A 3E5QA 3I53A 5FFXA 3QOPA 1ZYRF 2L0KA 3CCUI 2VBXA 2DA2A 2X1DA 2XB0X 5IYCJ 3I55I 5KAIC 1ZG1A 1ZR4A 3RDIA 2ELJA 1AHDP 2KRFA 2M30A 2V1UA 2VODA 5FKOA 4XL9A 4BHPA 1TC3C 2YU3A 2XRNA 5CKTA 3RYPA 4BJ5C 3MKZA 4AM3A 5DCMB 1FYLA 3GTQJ 2VUMJ 1FBQA 3EUHA 4PJLA 1DP7P 5LEKA 1IRXA 2W7NA 2MC4A 2VE8A 3CCRI 2DT6A 3VWBA 3FKJA 3F8CA 2KRHA 2ZXIA 2PX9A 1MIJA 1RPWA 2EIMH 2M0MA 3KLOA 4U7DA 3F9KA 4Y13A 2BZTA 2LC2A 1T0FC 3WU0A 1ERDA 2VONA 1HSJA 3GTOJ 2QYOA 3PNTA 1FOXA 2XAJA 3PIOF 5ILVA 1K78A 3V4GA 1UG2A 1Z0XA 2K85A 3IP4B 3GZNB 3AG3H 3LSIA 5C4XJ 3HM5A 1POGA 2DFEA 4KDPA 4KMUX 1LB2A 5D8KB 5M3FJ 5B3SH 2AXTC 4JX4A 4BNCA 4IQJA 1HQCA 1W5CC 1YW7A 2QQBA 3RPUA 1PJRA 3LSGA 3Q0UA 4NC6A 4OIPF 5L3BA 3C1DA 3WGIA 2BGCA 1VFCA 1TNTA 3IH4A 4I02A 3C2HA 2ZNYA 3HG9A 1YITI 3A0BC 2DW4A 3M4OJ 3ZRGA 2R7OA 4QPOA 2IS4A 4PSWA 2P5VA 4WWCA 3RJPA 3W6JB 2ZCWA 2MH2A 4I2OA 5H6RA 2DU9A 2A3SA 2CWEA 4Y15A 2D1HA 3ZMUA 4BQNA 3FXKA 4G12A 4HOBA 1FTZA 4XRSG 2IA2A 4M6VA 3VOEA 2MG4A 3ABTA 1W7PD 2Z99A 2MABA 2RN7A 3CCVI 1E3HA 5E1XA 3X2QH 2FXAA 2XV4S 3OR2C 4A3DJ 5AIQA 2FQ3A 2DQLA 1B9MA 1YIJI 1IO2A 1B72B 3KCCA 5C3EJ 4IHVA 2BYVE 4I76A 2JA5J 4JX5A 4P1WA 3WTTC 1K61A 1AWCA 2LBFA 3ZQHA 2QLZA 2YX4A 5J1YA 2KPMA 1RR8C 2CV2A 2VBWA 4A3GJ 1MD0A 3VDXA 3VYRB 1G3WA 3ABKH 5CYVA 2QF7A 2M4KA 3QPTA 1YLFA 3MCZA 2RNGA 4HEA2 4JP0A 5LEJA 5IT9Z 4ENKA 2K7LA 1X3WB 4IHYA 4UVCA 1T56A 2KDOA 3PSFA 5HS8A 2K3PA 3R61A 1BC7C 1KA8A 4IHTA 1UJ8A 5L3DA 1U6GA 1XPXA 1T8IA 5LHIA 4XN0A 1OCOH 2O0YA 3NWTA 3KZYA 2JVGA 1XC5A 4UXNA 3GZ6A 4HF1A 4OAYA 2Z2SB 3A01B 4L0ZB 4XRSA 2R7TA 1Z1DA 4CA0A 3PJRA 2DCEA 3EDPA 3ZQGA 3FIWA 5E79C 3JREA 1LJ9A 2X9DA 1K6OA 2X6YA 4DQ2A 5BNGA 1Y39A 5B1BH 4U7BA 3WTUC 2XGCA 2EPFA 1P7JA 2XDVA 5D6EA 4EVIA 4AYBA 1VI0A 2E2HJ 2Y75A 2ZFWA 1UELB 1WPKA 1UHMA 2JPBA 2MH9A 2E35A 1LDDA 4GCVA 5CLSA 1AKHB 3CC7I 1TQPA 2A5YB 2LKXA 2XRLA 4DYCA 5F08A 3WU1B 2DFFA 3B02A 4JQFA 1H9TA 4XORA 4IOAF 2RQQA 4Q48A 2KL4A 1U78A 5HLHA 5JHUA 3BP8A 3IAS2 2ZJPF 3DTKA 2ME0A 5EG0B 3GBGA 1O3QA 3DXJF 4AC0A 2H6BA 5TISC 3HGYA 3DEUA 2XKOA 4XKWA 2XAUA 2BY1A 4AU7A 3H0DA 4EM0B 1YX3A 1I50J 4XICA 3CDHA 1K79A 3WGHA 3SHFA 2NS7A 4E7ZA 5HLIA 1WGXA 3ML6A 1NK3P 2O6GE 1R36A 3K4NA 4PJNA 3QPSA 1IN8A 4HNTA 1PUFB 3CP2A 5FO5A 3BG5A 2M5WA 5IP7J 3HB9A 2VBYA 1MBJA 2F6CA 2HPMA 4CCJA 4RMNA 1JUMA 2BY2A 3I4NJ 3OYJA 1N78A 3HOUJ 3BZCA 4YG2F 3I59B 4DZJA 4FX4A 4NQWA 2KHMA 2ZB9A 2W1OA 1XG1A 4P9FA 3G3ZA 4LK0F 3M8EA 2P7CB 2BW3A 4CZZA 1LVAA 5EZGA 2L01A 1RUOA 1TT5B 4EJUA 1EA3A 1FSHA 3CF2A 3LSPA 5LFAA 3AG1H 1TW2A 1BI0A 4I01A 2LY1A 2LKSA 3GFLA 5F64A 1Y6IA 3DP7A 3HHHA 2R5ZB 3K4CA 5EYRA 4ZDPA 1FIAA 2GZWA 2V1XA 2A69F 3CDLA 4IHXA 2R7XA 3NARA 4QWQA 1W36C 2ZNZA 4MEYF 5JI6A 2RVCA 1NH3A 2EA4A 2RAEA 1FYKA 4MQ9F 4A3BJ 4NNJA 3MAJA 2MA3A 5FROA 4V19K 2Q0OA 4KUMA 4HF0A 1ZHFA 4HNUA 3OIOA 4A3KJ 4A6EA 3ZMZA 5ICCA 2HTSA 4IZZA 3ZQLA 1S5LC 4CXFA 3H9JA 3K2ZA 5GAGJ 4D0PA 3GW2A 3A1YA 3A01A 5IYBJ 3Q0WA 4B43A 3G73A 1O3RA 3R6SA 2LRDA 2W25A 2WB1A 4L5JA 5L3FA 3JRDA 1HKQA 1O7FA 4ZYHA 2J5PA 4A93J 2DO7A 3Q9VA 2V6CA 4BJ6C 2IA1A 2VIXA 2XKPA 4KFCA 2TRTA 1QHGA 1MMAA 2STWA 1WJFA 2EFOA 1X19A 1HXDA 2EFPA 2M1BA 4O6JA 5E18F 4RBOA 4IX7A 3WG7H 3DFGA 3P7NA 2W48A 2WA0A 5J6XA 5E20A 4XQFA 1O7LA 2O8KA 4LITA 1AKHA 1Z7UA 3CCLI 1ULYA 1OCTC 2VT2A 2CV1A 4YIRX 2VQLA 6PAXA 1SVOA 4BXFA 5E3MA 4BHBA 3ECOA 3OSGA 3TKYA 4OMZA 1QNTA 3K4KA 2FNAA 1Y1WJ 4RM2A 4EV0A 5B5EC 4RS8A 5FRNA 2KP6A 2F4IA 2L9VA 4A5NA 5F1JA 1JKOC 5EG0A 4ZC3A 5L3CA 2CFXA 3TO7A 2KIMA 3MMYB 2DA7A 1YW9A 3BTJA 4N0BA 3R60A 5HDGA 4A0XA 5GPCA 3QPHA 1OLTA 3S3OA 2ZXJA 3TL4X 2JA6J 5E3OA 1EF4A 1R5HA 4ITVA 2FSWA 1OYWA 1Q1HA 3ZMTA 2XPUA 5HODA 1VTNC 3VYSB 1X1CA 2X48A 3EETA 3HOZJ 2MLGA 3CO6C 2F4MB 4D1QA 5BPDA 1PUFA 4M73A 3JRIA 2VN2A 3RIRA 2IS1A 3HJEA 2IP2A 4CZCA 3TO9A 3AKZA 3QYFA 2BY0A 2OJED 2VBZA 4P55A 3E7LA 2ELHA 2BBYA 3BC8A 4U0YA 1ON1A 5LGNA 3I59A 1HKSA 1RZ4A 3QYEA 3QQAA 4M71A 2XAQA 1PP7U 3SXYA 1F43A 4IO9F 2WAQN 1UB9A 2ZJ2A 1KQ8A 3CO7C
chains in the Genus database with same CATH topology
5JFRA 5DD4A 3K69A 4G94A 4LMYA 2Z33A 5E8IA 4Y17A 2DBBA 3HOSA 3K0LA 5K5OA 2K86A 3M9AA 3Q5FA 4XLNF 1HW2A 4R79A 3ECHA 3NEUA 1KU3A 2ZKZA 3MZHA 5DYMA 2KKOA 1L3LA 3SZTA 1CF7B 5D4SA 2O8XA 2W85A 1TBXA 1E2XA 2B0LA 3LQRA 1R1VA 1XSVA 4HBLA 1ZAOA 4BAYA 1F9NA 4IRGA 1XCVA 2ESNA 4KT5C 2XAGA 2HZTA 4IF4A 4WX9A 4EJWA 3HTSB 4L9VA 1FLIA 4FHTA 1FSEA 2FMLA 5BQTA 4B8XA 3BJOA 2VT3A 3E3VA 5D5WB 4MNUA 3T5XA 2HQRA 1FYMA 2XAFA 3E5XA 1O3TA 5E17F 1KYZA 3QRFF 2GIVA 1UHWA 1G3SA 2GA2A 4S05A 1USSA 4UVAA 1ZRDA 3NQOA 2K4JA 2A07F 3ISPA 1T0FA 2QBYB 5E1WA 4BQAA 2OA4A 3FZVA 1XN7A 3GUDA 2Y48A 3ZMSA 1OPCA 1KQ9A 2O61A 1HKTA 3W6KB 2F2EA 1OKRA 5EEGA 4XBFA 2ETHA 3K1NA 4HZFA 3HOTA 1JXSA 1HBXG 3GXOA 4IRHA 4AIHA 5CVIA 2OAZA 5HDNA 2HEOA 3I4PA 2HFHA 3RTRA 1BBYA 2NAZA 1G4DA 2RDPA 3AAFA 2PQ8A 4ZZDA 3J80K 1ZREA 3GYHX 3F22A 2P5KA 4LJZF 4Q4ZF 3V8JA 3L2CA 1PUEE 3GZ5A 2A61A 2E1NA 1T6SA 5KVRA 2A6HF 3SZPA 1O57A 4CGZA 3MFKA 3MZYA 1CF7A 2V9VA 5F6FA 3ERED 1LQ1A 1O3SA 3KLNA 2XGXA 1J5YA 2DLLA 4JK1X 3VEPA 1RUNA 2G7HA 1SMYF 1U2WA 1XDUA 1YW8A 4MHGA 1S7AA 3BZ6A 5LGUA 3CUQC 3TOAA 2XIGA 3HYIA 3GFJA 4IVNA 1R58A 5DV5A 3DQVC 4AWXB 2HYFA 1OMIA 2NNYA 2COMA 2P6TA 1I27A 4EM1A 4YIIA 1DPRA 1S6LA 2NNNA 1X3UA 2R7DA 3RKWA 2KJCA 4ZYDA 2PJPA 3ZQ7A 3BOQA 2QBYA 4G8XA 1XMKA 5JVTA 2VOPA 2JTVA 4IHSA 1TTYA 5K1YA 2VXZA 3U9GA 1ZH5A 1ZG3A 5FB2A 4RAZA 2V1DA 4UHTA 4EJVA 1I5ZA 3V7CA 3RKYA 5D4RA 1JHHA 2Q8KA 3F23A 3F6OA 4RGRA 2LF8A 1BJAA 4R1HA 3SQNA 2HGCA 1QZZA 4AD9A 4N9HA 3DV8A 1OYYA 5CVRA 1XGNA 1SFUA 5FLXZ 3EYYA 2XAHA 4UV9A 4I0BA 1KQ0A 3KETA 4RB2C 3T1BA 1FNNA 4UUVA 3WTYC 2FBIA 3HSEA 3REOA 5BOXA 1IZ1A 2E1CA 2CSOA 4HQMA 2MLKA 2Z3YA 4G7HF 1R7JA 3V7RA 4A0ZA 1IN6A 4KN7X 2KJBA 1YS6A 3PFIA 4NB5A 1FX7A 1FOKA 1SD6A 3D5LA 1YG2A 4LK1F 1I1GA 5D5VB 2P6SA 2CYYA 1T38A 1RNLA 1TQMA 1YO5C 2HR3A 3ZP5A 3BY6A 3K1PA 3CUOA 1SFEA 4ESFA 1Y0UA 3FF5A 4K2EA 1R22A 2FRHA 4G6DA 5HVQC 1BC8C 4HX4A 3CLOA 1QQIA 2ISZA 1K7AA 1XD7A 2E7WA 3KP7A 2DT5A 4RB0A 3PQJA 4OMYA 4HYEA 3KP2A 1KU2A 4ZZLA 2V79A 1ZGAA 5DCMA 3KE2A 4XLPF 2OBPA 1YQAA 3K9TA 3JAMZ 2IT0A 4LB6B 3F8MA 2QZ8A 1U8RA 1J0RA 1SAXA 1PDNC 2JZYA 4G7ZF 4XSXF 2F5DA 3RPQA 2DI3A 5ERIA 2BV6A 3QU6A 4XSZF 1MDMB 1BI1A 4B09A 3TDZC 4MGRA 2UXNA 1XGSA 4EM2A 1J7KA 2YPRA 2RGVA 5HLGA 2R3SA 2QUFA 4LB5A 2YX7A 4P96A 1IAWA 2P8TA 3F72A 1XSDA 1BOAA 2M87A 2CQKA 2XVCA 3T0YA 2H6CA 2L02A 4ASNA 1NHAA 3F6VA 2PI0A 1TNSA 1ZLJA 1STZA 2LF7A 5IT3A 1JGSA 2PEXA 4EGZA 1IXCA 4WF2A 4EGYA 2RC4A 4KIFA 1WWXA 3RI4A 4ZH4F 4PDKA 1FWZA 5A2QZ 2PFBA 3K1MA 3LQQA 2ACJA 4L18B 4KNYA 4EJOA 5L3GA 2ISYA 1KU9A 3FX3A 2IW5A 4QLCU 3LAPA 1G3YA 2WC2A 2RQPA 4ESBA 3WTWC 2F5CA 5AIPA 3C7JA 3DPLC 2DK8A 4LLGF 2PBIA 4FX0A 3WE2A 3FWEA 3ZMDA 3CUQB 2OQRA 2H94A 1QO0D 2F5FA 5EEHA 3WE3A 4M6XA 1T39A 1IXSB 3TOBA 3IRQA 5CVUA 3GWZA 2BEOA 1QGPA 4CICA 4U0WA 3I71A 3LWFA 5ICGA 2VOOA 2CGPA 5H20A 2Y0MA 3HHGA 3OV8A 2A68F 1T98A 2K4BA 3ABUA 3IC7A 2OZUA 1MDMA 3J81Z 4EJTA 2A6EF 5J8FA 1Z05A 1Z6TA 2YSRA 1UFMA 4HV5A 1Z9CA 1MJ9A 3HSRA 1W4MA 2P7VB 1LEBA 3FM5A 1B59A 3H3ZA 1LEAA 3C3WA 3HRMA 3DF8A 1IRFA 4YFKF 2FU4A 1YYVA 5DD8A 1MGTA 3HRUA 2JPCA 3IWZA 2DPDA 4HA8A 2O3FA 3EYIA 2UWMA 2D45A 2WV0A 1EH7A 3IKVA 2OZ6A 4I0AA 3TGNA 2UZKA 3HUGA 2HS5A 5FD6A 2L54A 3IKTA 4ON0A 1BM9A 4OOIA 1FP1D 5LLQA 1IN7A 4GYIA 4HAMA 4RB3C 5FLXK 2RNJA 4IPAA 5LRRA 1GXPA 2NS0A 5J8CA 4M72A 5K5RA 2HKXA 3FXQA 5DEQA 4DNCA 2EFNA 3CUQA 1YFHA 1FP2A 4UNOA 4BH9A 1LNWA 4OIOF 4BYYA 2BE5F 3ZN1A 1S7OA 1YS7A 2M8EA 4YFNF 4HLYA 4A6DA 2E7XA 2CW0F 3E97A 5HDKA 3LA7A 2H27A 3BPXA 5BS6A 3O3KA 1SFXA 2IRFG 3QP5A 1J2XA 2GQQA 1DPUA 4WCGA 5IT9K 4HLXA 4L9JA 2ESHA 2LDUA 5LRSA 4ESJA 3ROUA 2G9WA 3BJAA 4PGHA 3GO5A 3U1DA 3KEOA 4I09A 1B6AA 3KFWX 2FBKA 3CJNA 3S2WA 1W5SA 2QENA 1GXQA 4TV7A 3WTSC 2MC3A 1FPQA 4IRIA 1D8JA 1IN4A 1HSTA 5ICEA 2AS5F 3L00A 3VODA 4E70A 3R4KA 2KIFA 4ETSA 1ZN2A 2XASA 4RGUA 3M1EA 1XB4A 1P4XA 1FBUA 2IJLA 1RI7A 4EMSA 4LLLA 1XGMA 3I0TA 4G6QA 4WXCA 2LKPA 4WXDA 4A2UA 5HS7A 3M7GA 3F21A 1TLHB 2FE3A 1MJAA 2OU2A 2HOEA 3N97A 3V8LA 4Q47A 3FXRA 3I5UA 1T2KA 3IWFA 4AIKA 4RGXA 1TW3A 1RIOH 3I54A 5ILUA 1Z91A 3BROA 1SD7A 2PLYA 4O5VA 3R0AA 2Z9OA 1WQ2A 4P5OA 4BXUA 1UCRA 1ODDA 2GA1A 3LSTA 3KZZA 3R0JA 2K27A 4M74A 2ZMEB 2FMYA 2O03A 1U3EM 4YIFA 3VFZA 4CYDA 5A2QK 4L5IA 2IA0A 4CDGA 3GLXA 2UXXA 4XRFA 4LLNA 2P5LC 4ENMA 2F5EA 3ZN0A 3ZMVA 3HRSA 2OQGA 4R8HA 5LBQA 1R23A 3F8FA 4FT8A 1H0MA 1IW7F 4Z2YA 4UV8A 4WXHA 1C0WA 3QP6A 4HDVA 4AVPA 1YIOA 4EQQA 1S3JA 2JT1A 2XROA 5H6QA 4GXOA 3COAC 1HW5A 1XDSA 3P9CA 2HTJA 3KP5A 1MZBA 1D3YA 2DK5A 2FA5A 4L9NA 1USTA 5DUKA 3J81K 1IUYA 3NRVA 4RB1A 2GXGA 3F8NA 1ON2A 5HOOA 4MTDA 3C18A 2EFQA 3F8BA 3IL2A 2QM3A 3I64A 2IPQX 1EH6A 1R5GA 3GVAA 2STTA 4HW0A 2C6YA 1IF1A 5ILSA 2EB7A 5CJ9A 4GGGA 2FOKA 1B1BA 2XUBA 2ZMEA 1KU7A 4A5MA 3BJ6A 1V4RA 1EH8A 2M45A 1REPC 1KGSA 3M8FA 4PZJA 2VE9A 3O2PE 2HDCA 5DUIA 5BMZA 3RYRA 4KICA 1I6XA 1F1ZA 2JSCA 1BIBA 1FY7A 4H0EA 2NYXA 3QU3A 3GF2A 1P4WA 4HDUA 3MWMA 2G7UA 1XGOA 3L9FA 3SFZA 3JSOA 2W84A 2EK5A 3T8TA 2DPUA 2DFIA 1DUXC 3IHUA 2HKOA 2AXLA 3V8KA 5E1ZB 5KK1A 1ZGJA 1F4KA 1BI2A 2CG4A 1LDKB 1GVJA 4CHUA 1H9GA 1W7PB 4MQVA 3RKXA 3WTXC 1TQIA 3FM3A 3J80Z 4CO8A 1F5TA 1LDJA 5E8GA 3EQLF 1SD4A 3B73A 1YTYA 1EV7A 3FHZA 4A12A 1FBSA 4N9IA 5D5XB 2P4WA 3WTVC 2X0LA 1OYIA 5FFZA 1QZYA 3H92A 3E6MA 1XCBA 3P9KA 5L3EA 2HWVA 1JE8A 2GAUA 1OR7A 3WGGA 3MQ0A 1SD5A 5TRDA 2DAOA 3JTHA 2EWNA 1U5TB 2XHKA 5D6FA 1IN5A 2KIUA 2QVOA 3ULQB 2R7FA 4GO1A 4L0YB 2MD5A 2TDXA 2H09A 3FMRA 2JRTA 2J5OA 2RKHA 3F3XA 1QPMA 4U0VA 1WKMA 3MEXA 2HYGD 1FC3A 4HX8A 3I58A 2QWWA 3VB2A 2EV5A 4M9XA 2ZBKA 1WSUA 3QAHA 2Q2EA 3WG9A 2QQAA 3Q9SA 4I7HA 1CGPA 1MKMA 4OIRF 3TQNA 4HX7A 2YR2A 1W7PA 2ZO4A 5HS9A 4KIGA 5BPIA 4JBAA 4OIQF 5LHHA 1S8NA 3WODF 2X4HA 3E5UA 2VC1A 4BHCA 1KYWA 2FNPA 1FT9A 4MTEA 5K5QA 3KP3A 1BIAA 5LHGA 1R00A 1HW1A 4KIBA 3TDUC 1GHCA 1D8KA 3GFIA 3T8RA 4ENJA 1XSXA 1P92A 2FBHA 1ZARA 4KA4A 1BN5A 2L3DA 1P2FA 2LSOA 3LFKA 1E17A 1BI3A 5TJJA 2EFWA 1S29A 2FEZA 2CO5A 3J7AO 2PN6A 1QBJA 4IXAA 2OD5A 2NRAC 1L0OC 3OOPA 4LFUA 1U5TA 4ENNA 4A0YA 1B4AA 2Z5UA 4OU0A 2EJRA 2ADUA 1P4AA 2L4MA 3BWGA 3FMSA 4GYGA 3ZPLA 1P6RA 5D5UB 1ZLKA 1ONVA 3E6BA 4LG0B 3H3UA 4I98B 1ZG5A 3KP4A 3CTAA 3LA3A 3TO6A 4KYWA 1J75A 4LGWA 2PMHA 2EV6A 2LNBA 5ICFA 4WK8F 4KN4X 4UVBA 4HF2A 1R1TA 3HSFA 1PP8F 5FD5A 1J59A 3GX4X 4O3MA 4Q5SF 3DPTA 3V7SA 2FF4A 3GEZA 2GXBA 1W5TA 5LGTA 1Z6RA 1G6NA 2W57A 2PMUA 4NHJA 4M9ZA 5F1RA 2RV8A 1J9IA 5DDGA 3D0SA 3L7WA 5CVJA 3HRTA 4OINF 3U2RA 3BDDA 4U88A 3WTZA 1XMAA 4YFXF 2L4AA 3P9IA 4ZYEA 4LD5A 2WWYA 2PG4A 2MBFA 3KP6A 3JAMK 3ELKA 4HQEA 5FGMA 1ZRFA 2D1VA 4RAYA 3GFMA 4HV6A 3FMQA 2D2WA 4P9UA 2EA2A 2IVMA 4S04A 1MJBA 4PGGA 3FXUA 5ED4A 3HTUA 2EV0A 1K78B 3DKWA 2WTEA 3JW4A 4RGSA 1G3TA 3E6DA 5AONA 3LAJA 2DQRA 2HQNA 4IJAA 3LA2A 2QQ9A 5DCFA 2VC0A 1U5TC 3E6CC 3PQKA 1AOYA 1IRGA 4LG0A 3JTGA 4M9SA 4G7OF 1I1SA 3BPVA 3L09A 3KEQA 1WRJA 4MEXF 4L9TA 1IXRC 3O6BB 3N4MA 2K02A 1DDNA 4PCQA 1V3FA 5JR3A 5D8LB 5CVVA 1JHFA 4AIJA 4M6YA 3JSPA 2W24A 4KMFA 2DTRA 3HIFA 3IRRA 1SMTA 4G9YA 4F7ZA 1B9NA 1A04A 1R1UA 1D5VA 1FZPB 4ZYGA 1WI9A 2GWRA 1ZRCA 3E5QA 3I53A 5FFXA 3QOPA 1ZYRF 2VBXA 1ZG1A 3RDIA 2KRFA 2M30A 2V1UA 2VODA 4BHPA 2YU3A 2XRNA 3RYPA 5DCMB 1FYLA 1FBQA 3EUHA 1DP7P 5LEKA 2VE8A 3F8CA 3KLOA 4U7DA 4Y13A 3WU0A 2VONA 1HSJA 2QYOA 2XAJA 5ILVA 1K78A 3V4GA 4KDPA 4KMUX 1LB2A 5D8KB 4BNCA 1HQCA 1YW7A 2QQBA 3RPUA 4OIPF 5L3BA 3C1DA 3WGIA 2BGCA 1TNTA 4I02A 2ZNYA 2DW4A 2P5VA 4WWCA 3RJPA 3W6JB 2ZCWA 2MH2A 4I2OA 5H6RA 2DU9A 2A3SA 2CWEA 4Y15A 2D1HA 3ZMUA 4HOBA 2IA2A 3VOEA 3ABTA 1W7PD 2Z99A 2RN7A 5E1XA 2FXAA 2XV4S 5AIQA 2FQ3A 2DQLA 1B9MA 3KCCA 2BYVE 3WTTC 1AWCA 2QLZA 2YX4A 2VBWA 1MD0A 1G3WA 5CYVA 3QPTA 1YLFA 3MCZA 5LEJA 5IT9Z 4ENKA 2K7LA 4UVCA 5HS8A 3R61A 1BC7C 1KA8A 4IHTA 5L3DA 1U6GA 5LHIA 2O0YA 3KZYA 4UXNA 3GZ6A 4HF1A 4L0ZB 1Z1DA 3EDPA 1LJ9A 1K6OA 4DQ2A 4U7BA 3WTUC 5D6EA 4EVIA 2Y75A 2ZFWA 1UHMA 2JPBA 2MH9A 1LDDA 4GCVA 5CLSA 1TQPA 2A5YB 3WU1B 3B02A 4JQFA 1H9TA 4Q48A 1U78A 5HLHA 5JHUA 3BP8A 1O3QA 3DXJF 2H6BA 3DEUA 2XKOA 4EM0B 3CDHA 1K79A 3WGHA 3SHFA 5HLIA 3ML6A 2O6GE 1R36A 1IN8A 5FO5A 2M5WA 2VBYA 4YG2F 3I59B 4FX4A 4NQWA 4P9FA 3G3ZA 4LK0F 3M8EA 2P7CB 4CZZA 1LVAA 2L01A 1RUOA 4EJUA 1FSHA 1TW2A 1BI0A 4I01A 3GFLA 5F64A 3DP7A 3HHHA 2GZWA 2V1XA 2A69F 4QWQA 2ZNZA 4MEYF 5JI6A 2RVCA 2EA4A 1FYKA 4MQ9F 3MAJA 2MA3A 2Q0OA 4KUMA 4HF0A 1ZHFA 4A6EA 3ZMZA 5ICCA 2HTSA 4CXFA 3K2ZA 4D0PA 3GW2A 3G73A 1O3RA 3R6SA 2W25A 4L5JA 5L3FA 1HKQA 1O7FA 4ZYHA 2J5PA 2DO7A 3Q9VA 2V6CA 2IA1A 2XKPA 4KFCA 2STWA 2EFPA 2EFOA 1HXDA 2M1BA 4O6JA 5E18F 3DFGA 3P7NA 5J6XA 5E20A 1O7LA 1Z7UA 1ULYA 2VT2A 6PAXA 4BHBA 3ECOA 3TKYA 4OMZA 1QNTA 2FNAA 4EV0A 4RS8A 4A5NA 5L3CA 2CFXA 3TO7A 2KIMA 1YW9A 4N0BA 3R60A 5HDGA 4A0XA 3QPHA 2ZXJA 1R5HA 2FSWA 1OYWA 1Q1HA 3ZMTA 1VTNC 3EETA 2MLGA 3CO6C 5BPDA 4M73A 2VN2A 3RIRA 2IP2A 3TO9A 2VBZA 4P55A 2ELHA 2BBYA 4U0YA 1ON1A 5LGNA 3I59A 1HKSA 1RZ4A 4M71A 2XAQA 1PP7U 3SXYA 1UB9A 2ZJ2A 1KQ8A 3CO7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFR A;  5DD4 A;  3K69 A;  4G94 A;  4LMY A;  2Z33 A;  5E8I A;  4Y17 A;  2DBB A;  3HOS A;  3K0L A;  5K5O A;  2K86 A;  3M9A A;  3Q5F A;  4XLN F;  1HW2 A;  4R79 A;  3ECH A;  3NEU A;  1KU3 A;  2ZKZ A;  3MZH A;  5DYM A;  2KKO A;  1L3L A;  3SZT A;  1CF7 B;  5D4S A;  2O8X A;  2W85 A;  1TBX A;  1E2X A;  2B0L A;  3LQR A;  1R1V A;  1XSV A;  4HBL A;  1ZAO A;  4BAY A;  1F9N A;  4IRG A;  1XCV A;  2ESN A;  4KT5 C;  2XAG A;  2HZT A;  4IF4 A;  4WX9 A;  4EJW A;  3HTS B;  4L9V A;  1FLI A;  4FHT A;  1FSE A;  2FML A;  5BQT A;  4B8X A;  3BJO A;  2VT3 A;  3E3V A;  5D5W B;  4MNU A;  3T5X A;  2HQR A;  1FYM A;  2XAF A;  3E5X A;  1O3T A;  5E17 F;  1KYZ A;  3QRF F;  2GIV A;  1UHW A;  1G3S A;  2GA2 A;  4S05 A;  1USS A;  4UVA A;  1ZRD A;  3NQO A;  2K4J A;  2A07 F;  3ISP A;  1T0F A;  2QBY B;  5E1W A;  4BQA A;  2OA4 A;  3FZV A;  1XN7 A;  3GUD A;  2Y48 A;  3ZMS A;  1OPC A;  1KQ9 A;  2O61 A;  1HKT A;  3W6K B;  2F2E A;  1OKR A;  5EEG A;  4XBF A;  2ETH A;  3K1N A;  4HZF A;  3HOT A;  1JXS A;  1HBX G;  3GXO A;  4IRH A;  4AIH A;  5CVI A;  2OAZ A;  5HDN A;  2HEO A;  3I4P A;  2HFH A;  3RTR A;  1BBY A;  2NAZ A;  1G4D A;  2RDP A;  3AAF A;  2PQ8 A;  4ZZD A;  3J80 K;  1ZRE A;  3GYH X;  3F22 A;  2P5K A;  4LJZ F;  4Q4Z F;  3V8J A;  3L2C A;  1PUE E;  3GZ5 A;  2A61 A;  2E1N A;  1T6S A;  5KVR A;  2A6H F;  3SZP A;  1O57 A;  4CGZ A;  3MFK A;  3MZY A;  1CF7 A;  2V9V A;  5F6F A;  3ERE D;  1LQ1 A;  1O3S A;  3KLN A;  2XGX A;  1J5Y A;  2DLL A;  4JK1 X;  3VEP A;  1RUN A;  2G7H A;  1SMY F;  1U2W A;  1XDU A;  1YW8 A;  4MHG A;  1S7A A;  3BZ6 A;  5LGU A;  3CUQ C;  3TOA A;  2XIG A;  3HYI A;  3GFJ A;  4IVN A;  1R58 A;  5DV5 A;  3DQV C;  4AWX B;  2HYF A;  1OMI A;  2NNY A;  2COM A;  2P6T A;  1I27 A;  4EM1 A;  4YII A;  1DPR A;  1S6L A;  2NNN A;  1X3U A;  2R7D A;  3RKW A;  2KJC A;  4ZYD A;  2PJP A;  3ZQ7 A;  3BOQ A;  2QBY A;  4G8X A;  1XMK A;  5JVT A;  2VOP A;  2JTV A;  4IHS A;  1TTY A;  5K1Y A;  2VXZ A;  3U9G A;  1ZH5 A;  1ZG3 A;  5FB2 A;  4RAZ A;  2V1D A;  4UHT A;  4EJV A;  1I5Z A;  3V7C A;  3RKY A;  5D4R A;  1JHH A;  2Q8K A;  3F23 A;  3F6O A;  4RGR A;  2LF8 A;  1BJA A;  4R1H A;  3SQN A;  2HGC A;  1QZZ A;  4AD9 A;  4N9H A;  3DV8 A;  1OYY A;  5CVR A;  1XGN A;  1SFU A;  5FLX Z;  3EYY A;  2XAH A;  4UV9 A;  4I0B A;  1KQ0 A;  3KET A;  4RB2 C;  3T1B A;  1FNN A;  4UUV A;  3WTY C;  2FBI A;  3HSE A;  3REO A;  5BOX A;  1IZ1 A;  2E1C A;  2CSO A;  4HQM A;  2MLK A;  2Z3Y A;  4G7H F;  1R7J A;  3V7R A;  4A0Z A;  1IN6 A;  4KN7 X;  2KJB A;  1YS6 A;  3PFI A;  4NB5 A;  1FX7 A;  1FOK A;  1SD6 A;  3D5L A;  1YG2 A;  4LK1 F;  1I1G A;  5D5V B;  2P6S A;  2CYY A;  1T38 A;  1RNL A;  1TQM A;  1YO5 C;  2HR3 A;  3ZP5 A;  3BY6 A;  3K1P A;  3CUO A;  1SFE A;  4ESF A;  1Y0U A;  3FF5 A;  4K2E A;  1R22 A;  2FRH A;  4G6D A;  5HVQ C;  1BC8 C;  4HX4 A;  3CLO A;  1QQI A;  2ISZ A;  1K7A A;  1XD7 A;  2E7W A;  3KP7 A;  2DT5 A;  4RB0 A;  3PQJ A;  4OMY A;  4HYE A;  3KP2 A;  1KU2 A;  4ZZL A;  2V79 A;  1ZGA A;  5DCM A;  3KE2 A;  4XLP F;  2OBP A;  1YQA A;  3K9T A;  3JAM Z;  2IT0 A;  4LB6 B;  3F8M A;  2QZ8 A;  1U8R A;  1J0R A;  1SAX A;  1PDN C;  2JZY A;  4G7Z F;  4XSX F;  2F5D A;  3RPQ A;  2DI3 A;  5ERI A;  2BV6 A;  3QU6 A;  4XSZ F;  1MDM B;  1BI1 A;  4B09 A;  3TDZ C;  4MGR A;  2UXN A;  1XGS A;  4EM2 A;  1J7K A;  2YPR A;  2RGV A;  5HLG A;  2R3S A;  2QUF A;  4LB5 A;  2YX7 A;  4P96 A;  1IAW A;  2P8T A;  3F72 A;  1XSD A;  1BOA A;  2M87 A;  2CQK A;  2XVC A;  3T0Y A;  2H6C A;  2L02 A;  4ASN A;  1NHA A;  3F6V A;  2PI0 A;  1TNS A;  1ZLJ A;  1STZ A;  2LF7 A;  5IT3 A;  1JGS A;  2PEX A;  4EGZ A;  1IXC A;  4WF2 A;  4EGY A;  2RC4 A;  4KIF A;  1WWX A;  3RI4 A;  4ZH4 F;  4PDK A;  1FWZ A;  5A2Q Z;  2PFB A;  3K1M A;  3LQQ A;  2ACJ A;  4L18 B;  4KNY A;  4EJO A;  5L3G A;  2ISY A;  1KU9 A;  3FX3 A;  2IW5 A;  4QLC U;  3LAP A;  1G3Y A;  2WC2 A;  2RQP A;  4ESB A;  3WTW C;  2F5C A;  5AIP A;  3C7J A;  3DPL C;  2DK8 A;  4LLG F;  2PBI A;  4FX0 A;  3WE2 A;  3FWE A;  3ZMD A;  3CUQ B;  2OQR A;  2H94 A;  1QO0 D;  2F5F A;  5EEH A;  3WE3 A;  4M6X A;  1T39 A;  1IXS B;  3TOB A;  3IRQ A;  5CVU A;  3GWZ A;  2BEO A;  1QGP A;  4CIC A;  4U0W A;  3I71 A;  3LWF A;  5ICG A;  2VOO A;  2CGP A;  5H20 A;  2Y0M A;  3HHG A;  3OV8 A;  2A68 F;  1T98 A;  2K4B A;  3ABU A;  3IC7 A;  2OZU A;  1MDM A;  3J81 Z;  4EJT A;  2A6E F;  5J8F A;  1Z05 A;  1Z6T A;  2YSR A;  1UFM A;  4HV5 A;  1Z9C A;  1MJ9 A;  3HSR A;  1W4M A;  2P7V B;  1LEB A;  3FM5 A;  1B59 A;  3H3Z A;  1LEA A;  3C3W A;  3HRM A;  3DF8 A;  1IRF A;  4YFK F;  2FU4 A;  1YYV A;  5DD8 A;  1MGT A;  3HRU A;  2JPC A;  3IWZ A;  2DPD A;  4HA8 A;  2O3F A;  3EYI A;  2UWM A;  2D45 A;  2WV0 A;  1EH7 A;  3IKV A;  2OZ6 A;  4I0A A;  3TGN A;  2UZK A;  3HUG A;  2HS5 A;  5FD6 A;  2L54 A;  3IKT A;  4ON0 A;  1BM9 A;  4OOI A;  1FP1 D;  5LLQ A;  1IN7 A;  4GYI A;  4HAM A;  4RB3 C;  5FLX K;  2RNJ A;  4IPA A;  5LRR A;  1GXP A;  2NS0 A;  5J8C A;  4M72 A;  5K5R A;  2HKX A;  3FXQ A;  5DEQ A;  4DNC A;  2EFN A;  3CUQ A;  1YFH A;  1FP2 A;  4UNO A;  4BH9 A;  1LNW A;  4OIO F;  4BYY A;  2BE5 F;  3ZN1 A;  1S7O A;  1YS7 A;  2M8E A;  4YFN F;  4HLY A;  4A6D A;  2E7X A;  2CW0 F;  3E97 A;  5HDK A;  3LA7 A;  2H27 A;  3BPX A;  5BS6 A;  3O3K A;  1SFX A;  2IRF G;  3QP5 A;  1J2X A;  2GQQ A;  1DPU A;  4WCG A;  5IT9 K;  4HLX A;  4L9J A;  2ESH A;  2LDU A;  5LRS A;  4ESJ A;  3ROU A;  2G9W A;  3BJA A;  4PGH A;  3GO5 A;  3U1D A;  3KEO A;  4I09 A;  1B6A A;  3KFW X;  2FBK A;  3CJN A;  3S2W A;  1W5S A;  2QEN A;  1GXQ A;  4TV7 A;  3WTS C;  2MC3 A;  1FPQ A;  4IRI A;  1D8J A;  1IN4 A;  1HST A;  5ICE A;  2AS5 F;  3L00 A;  3VOD A;  4E70 A;  3R4K A;  2KIF A;  4ETS A;  1ZN2 A;  2XAS A;  4RGU A;  3M1E A;  1XB4 A;  1P4X A;  1FBU A;  2IJL A;  1RI7 A;  4EMS A;  4LLL A;  1XGM A;  3I0T A;  4G6Q A;  4WXC A;  2LKP A;  4WXD A;  4A2U A;  5HS7 A;  3M7G A;  3F21 A;  1TLH B;  2FE3 A;  1MJA A;  2OU2 A;  2HOE A;  3N97 A;  3V8L A;  4Q47 A;  3FXR A;  3I5U A;  1T2K A;  3IWF A;  4AIK A;  4RGX A;  1TW3 A;  1RIO H;  3I54 A;  5ILU A;  1Z91 A;  3BRO A;  1SD7 A;  2PLY A;  4O5V A;  3R0A A;  2Z9O A;  1WQ2 A;  4P5O A;  4BXU A;  1UCR A;  1ODD A;  2GA1 A;  3LST A;  3KZZ A;  3R0J A;  2K27 A;  4M74 A;  2ZME B;  2FMY A;  2O03 A;  1U3E M;  4YIF A;  3VFZ A;  4CYD A;  5A2Q K;  4L5I A;  2IA0 A;  4CDG A;  3GLX A;  2UXX A;  4XRF A;  4LLN A;  2P5L C;  4ENM A;  2F5E A;  3ZN0 A;  3ZMV A;  3HRS A;  2OQG A;  4R8H A;  5LBQ A;  1R23 A;  3F8F A;  4FT8 A;  1H0M A;  1IW7 F;  4Z2Y A;  4UV8 A;  4WXH A;  1C0W A;  3QP6 A;  4HDV A;  4AVP A;  1YIO A;  4EQQ A;  1S3J A;  2JT1 A;  2XRO A;  5H6Q A;  4GXO A;  3COA C;  1HW5 A;  1XDS A;  3P9C A;  2HTJ A;  3KP5 A;  1MZB A;  1D3Y A;  2DK5 A;  2FA5 A;  4L9N A;  1UST A;  5DUK A;  3J81 K;  1IUY A;  3NRV A;  4RB1 A;  2GXG A;  3F8N A;  1ON2 A;  5HOO A;  4MTD A;  3C18 A;  2EFQ A;  3F8B A;  3IL2 A;  2QM3 A;  3I64 A;  2IPQ X;  1EH6 A;  1R5G A;  3GVA A;  2STT A;  4HW0 A;  2C6Y A;  1IF1 A;  5ILS A;  2EB7 A;  5CJ9 A;  4GGG A;  2FOK A;  1B1B A;  2XUB A;  2ZME A;  1KU7 A;  4A5M A;  3BJ6 A;  1V4R A;  1EH8 A;  2M45 A;  1REP C;  1KGS A;  3M8F A;  4PZJ A;  2VE9 A;  3O2P E;  2HDC A;  5DUI A;  5BMZ A;  3RYR A;  4KIC A;  1I6X A;  1F1Z A;  2JSC A;  1BIB A;  1FY7 A;  4H0E A;  2NYX A;  3QU3 A;  3GF2 A;  1P4W A;  4HDU A;  3MWM A;  2G7U A;  1XGO A;  3L9F A;  3SFZ A;  3JSO A;  2W84 A;  2EK5 A;  3T8T A;  2DPU A;  2DFI A;  1DUX C;  3IHU A;  2HKO A;  2AXL A;  3V8K A;  5E1Z B;  5KK1 A;  1ZGJ A;  1F4K A;  1BI2 A;  2CG4 A;  1LDK B;  1GVJ A;  4CHU A;  1H9G A;  1W7P B;  4MQV A;  3RKX A;  3WTX C;  1TQI A;  3FM3 A;  3J80 Z;  4CO8 A;  1F5T A;  1LDJ A;  5E8G A;  3EQL F;  1SD4 A;  3B73 A;  1YTY A;  1EV7 A;  3FHZ A;  4A12 A;  1FBS A;  4N9I A;  5D5X B;  2P4W A;  3WTV C;  2X0L A;  1OYI A;  5FFZ A;  1QZY A;  3H92 A;  3E6M A;  1XCB A;  3P9K A;  5L3E A;  2HWV A;  1JE8 A;  2GAU A;  1OR7 A;  3WGG A;  3MQ0 A;  1SD5 A;  5TRD A;  2DAO A;  3JTH A;  2EWN A;  1U5T B;  2XHK A;  5D6F A;  1IN5 A;  2KIU A;  2QVO A;  3ULQ B;  2R7F A;  4GO1 A;  4L0Y B;  2MD5 A;  2TDX A;  2H09 A;  3FMR A;  2JRT A;  2J5O A;  2RKH A;  3F3X A;  1QPM A;  4U0V A;  1WKM A;  3MEX A;  2HYG D;  1FC3 A;  4HX8 A;  3I58 A;  2QWW A;  3VB2 A;  2EV5 A;  4M9X A;  2ZBK A;  1WSU A;  3QAH A;  2Q2E A;  3WG9 A;  2QQA A;  3Q9S A;  4I7H A;  1CGP A;  1MKM A;  4OIR F;  3TQN A;  4HX7 A;  2YR2 A;  1W7P A;  2ZO4 A;  5HS9 A;  4KIG A;  5BPI A;  4JBA A;  4OIQ F;  5LHH A;  1S8N A;  3WOD F;  2X4H A;  3E5U A;  2VC1 A;  4BHC A;  1KYW A;  2FNP A;  1FT9 A;  4MTE A;  5K5Q A;  3KP3 A;  1BIA A;  5LHG A;  1R00 A;  1HW1 A;  4KIB A;  3TDU C;  1GHC A;  1D8K A;  3GFI A;  3T8R A;  4ENJ A;  1XSX A;  1P92 A;  2FBH A;  1ZAR A;  4KA4 A;  1BN5 A;  2L3D A;  1P2F A;  2LSO A;  3LFK A;  1E17 A;  1BI3 A;  5TJJ A;  2EFW A;  1S29 A;  2FEZ A;  2CO5 A;  3J7A O;  2PN6 A;  1QBJ A;  4IXA A;  2OD5 A;  2NRA C;  1L0O C;  3OOP A;  4LFU A;  1U5T A;  4ENN A;  4A0Y A;  1B4A A;  2Z5U A;  4OU0 A;  2EJR A;  2ADU A;  1P4A A;  2L4M A;  3BWG A;  3FMS A;  4GYG A;  3ZPL A;  1P6R A;  5D5U B;  1ZLK A;  1ONV A;  3E6B A;  4LG0 B;  3H3U A;  4I98 B;  1ZG5 A;  3KP4 A;  3CTA A;  3LA3 A;  3TO6 A;  4KYW A;  1J75 A;  4LGW A;  2PMH A;  2EV6 A;  2LNB A;  5ICF A;  4WK8 F;  4KN4 X;  4UVB A;  4HF2 A;  1R1T A;  3HSF A;  1PP8 F;  5FD5 A;  1J59 A;  3GX4 X;  4O3M A;  4Q5S F;  3DPT A;  3V7S A;  2FF4 A;  3GEZ A;  2GXB A;  1W5T A;  5LGT A;  1Z6R A;  1G6N A;  2W57 A;  2PMU A;  4NHJ A;  4M9Z A;  5F1R A;  2RV8 A;  1J9I A;  5DDG A;  3D0S A;  3L7W A;  5CVJ A;  3HRT A;  4OIN F;  3U2R A;  3BDD A;  4U88 A;  3WTZ A;  1XMA A;  4YFX F;  2L4A A;  3P9I A;  4ZYE A;  4LD5 A;  2WWY A;  2PG4 A;  2MBF A;  3KP6 A;  3JAM K;  3ELK A;  4HQE A;  5FGM A;  1ZRF A;  2D1V A;  4RAY A;  3GFM A;  4HV6 A;  3FMQ A;  2D2W A;  4P9U A;  2EA2 A;  2IVM A;  4S04 A;  1MJB A;  4PGG A;  3FXU A;  5ED4 A;  3HTU A;  2EV0 A;  1K78 B;  3DKW A;  2WTE A;  3JW4 A;  4RGS A;  1G3T A;  3E6D A;  5AON A;  3LAJ A;  2DQR A;  2HQN A;  4IJA A;  3LA2 A;  2QQ9 A;  5DCF A;  2VC0 A;  1U5T C;  3E6C C;  3PQK A;  1AOY A;  1IRG A;  4LG0 A;  3JTG A;  4M9S A;  4G7O F;  1I1S A;  3BPV A;  3L09 A;  3KEQ A;  1WRJ A;  4MEX F;  4L9T A;  1IXR C;  3O6B B;  3N4M A;  2K02 A;  1DDN A;  4PCQ A;  1V3F A;  5JR3 A;  5D8L B;  5CVV A;  1JHF A;  4AIJ A;  4M6Y A;  3JSP A;  2W24 A;  4KMF A;  2DTR A;  3HIF A;  3IRR A;  1SMT A;  4G9Y A;  4F7Z A;  1B9N A;  1A04 A;  1R1U A;  1D5V A;  1FZP B;  4ZYG A;  1WI9 A;  2GWR A;  1ZRC A;  3E5Q A;  3I53 A;  5FFX A;  3QOP A;  1ZYR F;  2VBX A;  1ZG1 A;  3RDI A;  2KRF A;  2M30 A;  2V1U A;  2VOD A;  4BHP A;  2YU3 A;  2XRN A;  3RYP A;  5DCM B;  1FYL A;  1FBQ A;  3EUH A;  1DP7 P;  5LEK A;  2VE8 A;  3F8C A;  3KLO A;  4U7D A;  4Y13 A;  3WU0 A;  2VON A;  1HSJ A;  2QYO A;  2XAJ A;  5ILV A;  1K78 A;  3V4G A;  4KDP A;  4KMU X;  1LB2 A;  5D8K B;  4BNC A;  1HQC A;  1YW7 A;  2QQB A;  3RPU A;  4OIP F;  5L3B A;  3C1D A;  3WGI A;  2BGC A;  1TNT A;  4I02 A;  2ZNY A;  2DW4 A;  2P5V A;  4WWC A;  3RJP A;  3W6J B;  2ZCW A;  2MH2 A;  4I2O A;  5H6R A;  2DU9 A;  2A3S A;  2CWE A;  4Y15 A;  2D1H A;  3ZMU A;  4HOB A;  2IA2 A;  3VOE A;  3ABT A;  1W7P D;  2Z99 A;  2RN7 A;  5E1X A;  2FXA A;  2XV4 S;  5AIQ A;  2FQ3 A;  2DQL A;  1B9M A;  3KCC A;  2BYV E;  3WTT C;  1AWC A;  2QLZ A;  2YX4 A;  2VBW A;  1MD0 A;  1G3W A;  5CYV A;  3QPT A;  1YLF A;  3MCZ A;  5LEJ A;  5IT9 Z;  4ENK A;  2K7L A;  4UVC A;  5HS8 A;  3R61 A;  1BC7 C;  1KA8 A;  4IHT A;  5L3D A;  1U6G A;  5LHI A;  2O0Y A;  3KZY A;  4UXN A;  3GZ6 A;  4HF1 A;  4L0Z B;  1Z1D A;  3EDP A;  1LJ9 A;  1K6O A;  4DQ2 A;  4U7B A;  3WTU C;  5D6E A;  4EVI A;  2Y75 A;  2ZFW A;  1UHM A;  2JPB A;  2MH9 A;  1LDD A;  4GCV A;  5CLS A;  1TQP A;  2A5Y B;  3WU1 B;  3B02 A;  4JQF A;  1H9T A;  4Q48 A;  1U78 A;  5HLH A;  5JHU A;  3BP8 A;  1O3Q A;  3DXJ F;  2H6B A;  3DEU A;  2XKO A;  4EM0 B;  3CDH A;  1K79 A;  3WGH A;  3SHF A;  5HLI A;  3ML6 A;  2O6G E;  1R36 A;  1IN8 A;  5FO5 A;  2M5W A;  2VBY A;  4YG2 F;  3I59 B;  4FX4 A;  4NQW A;  4P9F A;  3G3Z A;  4LK0 F;  3M8E A;  2P7C B;  4CZZ A;  1LVA A;  2L01 A;  1RUO A;  4EJU A;  1FSH A;  1TW2 A;  1BI0 A;  4I01 A;  3GFL A;  5F64 A;  3DP7 A;  3HHH A;  2GZW A;  2V1X A;  2A69 F;  4QWQ A;  2ZNZ A;  4MEY F;  5JI6 A;  2RVC A;  2EA4 A;  1FYK A;  4MQ9 F;  3MAJ A;  2MA3 A;  2Q0O A;  4KUM A;  4HF0 A;  1ZHF A;  4A6E A;  3ZMZ A;  5ICC A;  2HTS A;  4CXF A;  3K2Z A;  4D0P A;  3GW2 A;  3G73 A;  1O3R A;  3R6S A;  2W25 A;  4L5J A;  5L3F A;  1HKQ A;  1O7F A;  4ZYH A;  2J5P A;  2DO7 A;  3Q9V A;  2V6C A;  2IA1 A;  2XKP A;  4KFC A;  2STW A;  2EFP A;  2EFO A;  1HXD A;  2M1B A;  4O6J A;  5E18 F;  3DFG A;  3P7N A;  5J6X A;  5E20 A;  1O7L A;  1Z7U A;  1ULY A;  2VT2 A;  6PAX A;  4BHB A;  3ECO A;  3TKY A;  4OMZ A;  1QNT A;  2FNA A;  4EV0 A;  4RS8 A;  4A5N A;  5L3C A;  2CFX A;  3TO7 A;  2KIM A;  1YW9 A;  4N0B A;  3R60 A;  5HDG A;  4A0X A;  3QPH A;  2ZXJ A;  1R5H A;  2FSW A;  1OYW A;  1Q1H A;  3ZMT A;  1VTN C;  3EET A;  2MLG A;  3CO6 C;  5BPD A;  4M73 A;  2VN2 A;  3RIR A;  2IP2 A;  3TO9 A;  2VBZ A;  4P55 A;  2ELH A;  2BBY A;  4U0Y A;  1ON1 A;  5LGN A;  3I59 A;  1HKS A;  1RZ4 A;  4M71 A;  2XAQ A;  1PP7 U;  3SXY A;  1UB9 A;  2ZJ2 A;  1KQ8 A;  3CO7 C; 
#chains in the Genus database with same CATH topology
 2CW8 A;  4A3E J;  5JFR A;  1D0Z A;  5DD4 A;  1JTX A;  4KJZ A;  3K69 A;  4XR6 A;  2HDW A;  4G94 A;  4LMY A;  1VND A;  2Z33 A;  2CJJ A;  2MFZ A;  2DA5 A;  5E8I A;  4Y17 A;  4DGW B;  2DBB A;  3HOS A;  3K0L A;  4NBQ A;  5K5O A;  1V5F A;  2K86 A;  2L9S A;  3M9A A;  3Q5F A;  4XLN F;  1HW2 A;  3BR6 A;  1K4S A;  4R79 A;  3ERM A;  3ECH A;  3NEU A;  2M7B A;  4A69 C;  3FK7 A;  4C30 A;  3Q3S A;  2NVT J;  4J00 A;  1KU3 A;  2ZKZ A;  3MZH A;  4KIS A;  5DYM A;  5FKN A;  2KKO A;  1L3L A;  2DFH A;  3SZT A;  1BR2 A;  3SEQ A;  4C3J J;  3JRB A;  2R93 J;  1Z7L A;  4NC7 A;  1CF7 B;  5D4S A;  2XC7 A;  4BXX J;  5HLT A;  1Z3X A;  4BBS J;  3BQZ A;  4BQO A;  2O8X A;  3S17 J;  1WHU A;  2W85 A;  1TBX A;  1E2X A;  3CDI A;  4IOC F;  3GTP J;  2L9N A;  2B0L A;  3LQR A;  1VQ7 I;  1R1V A;  3TBI A;  1XSV A;  2M3A A;  1ZAO A;  4HBL A;  4BAY A;  1F9N A;  3OYN A;  4IRG A;  1XCV A;  3BR3 A;  4QSH A;  2ESN A;  4KT5 C;  2XAG A;  3DKX A;  2HZT A;  2VI6 A;  4IF4 A;  4WX9 A;  4EJW A;  3HTS B;  4L9V A;  1FLI A;  3HOY J;  4FHT A;  1FSE A;  2FML A;  5BQT A;  2CFO A;  4B8X A;  3BJO A;  2VT3 A;  1FMV A;  2E34 A;  3RPU D;  3E3V A;  1HC8 A;  5D5W B;  4MNU A;  3T5X A;  2JA7 J;  4II2 A;  2HQR A;  2JUC A;  1FYM A;  2GXA A;  2XAF A;  3E5X A;  2IGK A;  1O3T A;  1KYZ A;  5E17 F;  3QRF F;  2GIV A;  1UHW A;  1G3S A;  3VPR A;  1ZEL A;  2GA2 A;  4S05 A;  2L7Z A;  3S3N A;  1USS A;  4UVA A;  1ZRD A;  3NQO A;  2K4J A;  4D5C A;  1J09 A;  2M7A A;  2A07 F;  3ISP A;  3OIQ A;  1T0F A;  2QBY B;  2Y0S A;  5E1W A;  3DWL E;  4BQA A;  2MW8 A;  2OA4 A;  3FZV A;  1Y8Q B;  1XN7 A;  1GVD A;  1MBF A;  3TW7 A;  2NOJ B;  2ZXH A;  3GUD A;  2Y48 A;  3ZMS A;  2KRC A;  1OPC A;  1KQ9 A;  1W36 D;  2O61 A;  1HKT A;  3W6K B;  2F2E A;  5EJC A;  2LLK A;  1OKR A;  5EEG A;  3L1P A;  3IUO A;  4XBF A;  3OL4 A;  2ETH A;  3K1N A;  4HZF A;  3HOT A;  2ZJQ F;  1JXS A;  1HBX G;  1GDT A;  3GXO A;  1Z3Y A;  3B6A A;  4IRH A;  4AIH A;  5CVI A;  2LRE A;  3PNV A;  2OAZ A;  5HDN A;  2HEO A;  3I4P A;  3BTC A;  2HFH A;  3RTR A;  1BBY A;  2NAZ A;  4ZYA A;  2RDP A;  3MZ8 A;  3ZQQ A;  1G4D A;  4I6Z A;  3HL2 A;  2DMQ A;  3AAF A;  2EZH A;  2PQ8 A;  4ZZD A;  3J80 K;  1ZRE A;  3GYH X;  3F22 A;  2P5K A;  1PYV A;  2WAQ A;  4LJZ F;  3A2K A;  4Q4Z F;  3V8J A;  4Z6Y A;  2EBI A;  3L2C A;  1PUE E;  3GZ5 A;  2A61 A;  5DM7 F;  4BL0 B;  2E1N A;  3BCB A;  4XK4 A;  1H88 C;  1T6S A;  1Q1V A;  4C3H J;  4BE0 A;  4LIU A;  3ZXS A;  1CQT A;  3SYT A;  5KVR A;  2A6H F;  2HVS A;  3FDY A;  3SZP A;  1O57 A;  4CGZ A;  5IP9 J;  2X1E A;  3K4B A;  2LVS A;  1WJA A;  3MFK A;  3MZY A;  1CF7 A;  2WY7 Q;  3DKY A;  2V9V A;  5F6F A;  3ERE D;  1LQ1 A;  1O3S A;  2VQC A;  3KLN A;  2XGX A;  1J5Y A;  3HPG A;  2DLL A;  2LY9 A;  3AG4 H;  4JK1 X;  3VEP A;  4F3Q A;  2JSP A;  4C2T A;  1RUN A;  5K7Z A;  2COB A;  2G7H A;  4XRM A;  4A3C J;  3GLL A;  3JR9 A;  2R0Q C;  1SMY F;  1U2W A;  4DZP A;  1XDU A;  1YW8 A;  2UUZ A;  4MHG A;  1QA6 A;  2EH3 A;  3CP8 A;  3HC7 A;  1S7A A;  3BZ6 A;  5LGU A;  1JKR C;  4HRI A;  1Y0N A;  3ZOB A;  3CUQ C;  1AA7 A;  3K6G A;  1IGN A;  3FKI J;  3TOA A;  2XIG A;  3HYI A;  3GFJ A;  2R7V A;  3DBR B;  4IVN A;  1R58 A;  5DV5 A;  3DQV C;  4AWX B;  4QTR A;  2HYF A;  1OMI A;  5TGT A;  2CQN A;  1GV2 A;  4Y33 A;  2NNY A;  1JGG A;  2HU9 A;  2COM A;  4BS9 A;  4GDF A;  3WHB A;  2P6T A;  1MH3 A;  4N4N B;  3ABL H;  1I27 A;  1DP3 A;  3QOE A;  4EM1 A;  1KZH A;  4YII A;  1DPR A;  2HOS A;  1S6L A;  2NNN A;  2OC6 A;  1X3U A;  2R7D A;  2D5V A;  3RKW A;  2KJC A;  1D0X A;  4ZYD A;  2PJP A;  3ZQ7 A;  3N05 A;  1APL C;  3BOQ A;  4BBR J;  4CYC B;  2DOD A;  1W0U A;  2QBY A;  4G8X A;  3BR2 A;  2X6O A;  2CV0 A;  3K7A J;  1XMK A;  2ECB A;  2YU9 J;  1ENH A;  5JVT A;  4Y3O A;  2VOP A;  4W97 A;  2JN6 A;  2JTV A;  4IHS A;  1TTY A;  4PFP A;  2O5R A;  1VF9 A;  5K1Y A;  2VXZ A;  4RLQ A;  2VJ5 A;  3U9G A;  1ZH5 A;  1ZG3 A;  5FB2 A;  1UMQ A;  4A3F J;  1WH7 A;  2V1D A;  4RAZ A;  4UHT A;  4IL6 C;  4QIW N;  4BU2 A;  4EJV A;  3H35 A;  1I5Z A;  2JJ7 A;  3V7C A;  3RKY A;  5D4R A;  1UZC A;  1JHH A;  3DPU A;  5M5Y J;  3HZJ A;  2Q8K A;  3F23 A;  3F6O A;  4RGR A;  2LF8 A;  1BJA A;  4R1H A;  3SQN A;  2HGC A;  1SFO J;  4UB8 C;  1WJC A;  3SZG A;  2O7O A;  1QZZ A;  1BL0 A;  4AD9 A;  4N9H A;  3G6E I;  2R7W A;  2LYC A;  2I5U A;  1P9Q C;  3DV8 A;  1OYY A;  5CVR A;  1XGN A;  1SFU A;  3SEZ A;  5FLX Z;  2ID3 A;  1HLV A;  1B8I B;  1ETY A;  3EYY A;  2XAH A;  4UV9 A;  3H9Q A;  4I0B A;  1KQ0 A;  3KET A;  1UHS A;  4RB2 C;  4J01 A;  1WH5 A;  3T1B A;  5IPA A;  4DYQ A;  1FNN A;  2ZFU A;  2GLO A;  4UUV A;  3WTY C;  3RZO J;  2FBI A;  3HSE A;  1JKP C;  2KQR A;  5DS9 A;  3REO A;  5BOX A;  3K2A A;  1IZ1 A;  2E1C A;  2KDZ A;  2QA4 I;  2CSO A;  4HQM A;  2MLK A;  2Z3Y A;  4G7H F;  2HOA A;  1R7J A;  3V7R A;  5IOY A;  4A0Z A;  3H0G J;  2VJ4 A;  1IN6 A;  4KN7 X;  2KJB A;  1QPI A;  2DA1 A;  2KZG A;  4PUS A;  3EPZ A;  1YS6 A;  3G2B A;  3PFI A;  1FX7 A;  4NB5 A;  2ZJR F;  1FOK A;  1T08 B;  1SD6 A;  3D5L A;  2LP0 A;  4BGD A;  1YG2 A;  3BCA A;  5J4Y A;  4LK1 F;  1I1G A;  5D5V B;  2DXI A;  2P6S A;  2CYY A;  3I9V 2;  2F48 A;  1T38 A;  2B9S A;  2DOF A;  1VQ5 I;  1RNL A;  1TQM A;  1Z67 A;  4B48 A;  3FIS A;  1YO5 C;  2HR3 A;  3ZP5 A;  3S1Q J;  4HNV A;  3BY6 A;  3K1P A;  3U1K A;  1YJN I;  2KMU A;  3CUO A;  1SFE A;  3G1M A;  1V5E A;  1Y0U A;  4ESF A;  2XSJ C;  1G8X A;  2ZSH B;  3FF5 A;  4K2E A;  1R22 A;  2FRH A;  4G6D A;  5HVQ C;  3I4M J;  5IY5 H;  2XF6 A;  4FQG A;  3OS1 A;  1IUF A;  1BC8 C;  2VB6 A;  4HX4 A;  3CLO A;  1AU7 A;  1QQI A;  2ISZ A;  1K7A A;  2DA4 A;  3S1M J;  1XD7 A;  1RC9 A;  5E3L A;  3CCY A;  3WHC A;  2E7W A;  3KP7 A;  1BR1 A;  4E7H A;  1JUP A;  2DT5 A;  4FE4 A;  3I3L A;  3SFI A;  3K70 C;  4CYC A;  4RB0 A;  2OF7 A;  3PQJ A;  4OMY A;  3K4M A;  4HYE A;  3KP2 A;  1KU2 A;  1TT0 A;  5F27 A;  3OYF A;  4ZZL A;  4HPQ A;  2V79 A;  2BHY A;  2P81 A;  1ZGA A;  5DCM A;  4FAS D;  3KE2 A;  4H4K C;  4XLP F;  1MMD A;  1MNE A;  2OBP A;  4C2M J;  4A3J J;  4C2U A;  1YQA A;  1D1A A;  3K9T A;  4CCK A;  2DYS H;  3BG6 A;  3JAM Z;  4Y52 J;  2HPI A;  2IT0 A;  3KYL A;  4LB6 B;  3MKY B;  2L7M P;  3F8M A;  2QQ8 A;  2QZ8 A;  1U8R A;  1J0R A;  5J3L A;  5C4J J;  1SAX A;  1N25 A;  1PDN C;  3SDG A;  2JZY A;  4G7Z F;  4XSX F;  2F5D A;  3RPQ A;  1VQK I;  2DI3 A;  4D5F A;  5ERI A;  2BV6 A;  3D5S C;  3QPL A;  3QU6 A;  4XSZ F;  1V55 H;  1X4O A;  1MDM B;  1BI1 A;  4B09 A;  1IV6 A;  2Y31 A;  3TDZ C;  4MGR A;  3GCM A;  2UXN A;  2B7E A;  1XGS A;  3S1R J;  2HI3 A;  3A4C A;  4EM2 A;  4XID A;  1J7K A;  2YPR A;  2RGV A;  5HLG A;  1R6R A;  2R3S A;  3OR1 C;  2QUF A;  2K9S A;  2M34 A;  5B66 C;  5FKK A;  2AQE A;  4LB5 A;  2IEK A;  2YX7 A;  3QWL A;  1WJ5 A;  2XPV A;  3H1C A;  4P96 A;  1IAW A;  2P8T A;  3F72 A;  1XSD A;  3GME A;  4HSR A;  1VQ9 I;  1BOA A;  2M87 A;  2CQK A;  2NS8 A;  3JRC A;  2XVC A;  5FKM A;  3S93 A;  2JUG A;  3CC4 I;  2DMN A;  3T0Y A;  2H6C A;  2VAS A;  2L02 A;  2DJI A;  4ASN A;  3CME I;  1NHA A;  3F6V A;  2LD5 A;  2PI0 A;  1TNS A;  1ZLJ A;  1STZ A;  2A05 A;  2LF7 A;  5IT3 A;  2QKL B;  1H8A C;  1IJW C;  1QU3 A;  1JGS A;  2PEX A;  1R4M B;  1IXC A;  4WF2 A;  4EGZ A;  4EGY A;  2RC4 A;  2L5Q A;  2CQX A;  1B72 A;  4KIF A;  1WWX A;  3RI4 A;  1W0T A;  4ZH4 F;  1X58 A;  4PDK A;  1QHH D;  1FWZ A;  5A2Q Z;  2A5W A;  2PFB A;  3K1M A;  3LQQ A;  2ACJ A;  4L18 B;  3PFY A;  4KNY A;  4EJO A;  5L3G A;  3HUG B;  3CMY A;  2ISY A;  1KU9 A;  3FX3 A;  3S3M A;  2IW5 A;  3S8P A;  4QLC U;  3LAP A;  1G3Y A;  1YJ9 I;  2WC2 A;  3MN2 A;  4UUS B;  4PJ0 C;  1DU0 A;  2RQP A;  5E3N A;  1HOM A;  4ESB A;  3WTW C;  3Q0V A;  2X6X A;  2F5C A;  2QCO A;  5AIP A;  1SAU A;  3LL7 A;  3C7J A;  3G1L A;  3DPL C;  2DK8 A;  4I99 C;  4LLG F;  2PBI A;  2AHQ A;  4FX0 A;  2N8G A;  3OYG A;  1RES A;  1T33 A;  4V2G A;  2IXS A;  3WE2 A;  2E19 A;  3FWE A;  3M8J A;  4FTH A;  4F52 A;  3ZMD A;  2F4O B;  1IDY A;  2OQR A;  3CUQ B;  2VKE A;  3OYE A;  2H94 A;  1QO0 D;  2F5F A;  5H2F C;  5EEH A;  2IAI A;  1P7I A;  4M6X A;  3WE3 A;  1T39 A;  1IXS B;  2X1C A;  3TOB A;  1DU6 A;  2LR8 A;  2EIL H;  3IRQ A;  5CVU A;  3GWZ A;  2BEO A;  1QGP A;  1GLN A;  4CIC A;  1QZE A;  2R4G A;  2IGN A;  4U0W A;  3O8H A;  1JI8 A;  5IOZ A;  3I71 A;  1RKT A;  3LWF A;  4N4O B;  1EJ9 A;  1MMS A;  2R5Y B;  5ICG A;  2VOO A;  5GP9 A;  3KPH A;  2CGP A;  5H20 A;  2Y0M A;  3HHG A;  2E5N A;  4XLC A;  3OV8 A;  2A68 F;  1T98 A;  3ASN H;  2K4B A;  5EZH A;  3ABU A;  4GFB A;  4LIV A;  3IC7 A;  2GOM A;  2OZU A;  2H8W A;  3TP0 A;  4PSX A;  3LSJ A;  3M1C A;  2WBM A;  1MDM A;  3J81 Z;  4EJT A;  2A6E F;  5J8F A;  2XB5 A;  1Z05 A;  2V9P A;  1DQU A;  1Z6T A;  2YSR A;  3CMM A;  2VPL A;  1UFM A;  2G0E A;  4HV5 A;  1Z9C A;  3M07 A;  1MJ9 A;  2KLO A;  3HSR A;  1W4M A;  4UB6 C;  4B1R A;  2P7V B;  4NUB A;  2OPT A;  5CPR B;  2M9H A;  3L2W A;  2R7R A;  1LEB A;  3FM5 A;  5LD2 C;  1B59 A;  4XLE A;  1SFK A;  3H3Z A;  1ORK A;  4E7L A;  3ZR8 X;  4NC8 A;  1LEA A;  2W82 A;  3C3W A;  3HRM A;  2HZD A;  2P0W A;  1IDZ A;  3DF8 A;  1IRF A;  1ZR2 A;  3UNG C;  4YFK F;  3HEF A;  1H89 C;  1X1D A;  2FU4 A;  1YYV A;  5DD8 A;  1MGT A;  1NG6 A;  1FMW A;  4ABZ A;  4DJA A;  3HRU A;  1TWA J;  2JPC A;  3W2V A;  1YJW I;  1OCZ H;  3IWZ A;  2DPD A;  3AG2 H;  4HA8 A;  2O3F A;  1JT0 A;  3EYI A;  3MKL A;  5K7F A;  5EDN A;  4BAC A;  3ABM H;  1UG0 A;  2UWM A;  1ETO A;  3CCS I;  2IGM A;  2QGU A;  1LKX A;  2D45 A;  2WV0 A;  4AUX A;  1D1B A;  3QOD A;  2H8R A;  1EH7 A;  3IKV A;  2WAE A;  2OZ6 A;  2K5C A;  2R92 J;  1NG7 A;  3G4S I;  2R5Z A;  4I0A A;  3TGN A;  2UZK A;  3HUG A;  2HS5 A;  5FD6 A;  2L54 A;  3IKT A;  3ZGK A;  4ON0 A;  1BM9 A;  4OOI A;  2I8D A;  4E7S A;  1FP1 D;  5LLQ A;  4UUS A;  1Y1V J;  3TW6 A;  4ZTF A;  1IN7 A;  4UUT A;  4GYI A;  4HAM A;  4YEL A;  1ITY A;  1JJ8 C;  4YRV A;  1RR7 A;  4RB3 C;  5FLX K;  2RNJ A;  3HPH A;  4IPA A;  2LG4 A;  3DTI A;  5LRR A;  1GXP A;  2NS0 A;  5J8C A;  4M72 A;  1OR7 C;  3PM1 A;  5K5R A;  2HKX A;  2DT7 B;  2MD0 A;  3FK6 A;  3S14 J;  1N77 A;  3FXQ A;  5DEQ A;  4DNC A;  1TWG J;  2EFN A;  3CUQ A;  4HST A;  3HXL A;  3KYD B;  2DOA A;  3BG9 A;  1YFH A;  2DMU A;  2V26 A;  2H1K A;  1FP2 A;  4GRI A;  4UNO A;  1TZL A;  4BH9 A;  2QSG X;  1I6H J;  1LNW A;  2PMZ N;  4D7M A;  4OIO F;  4BYY A;  1R9T J;  2CRG A;  2X6W A;  2BE5 F;  2FD5 A;  3ZN1 A;  2KZV A;  1OCC H;  3L2Q A;  4M3B A;  2DMT A;  5F0F A;  1S7O A;  1DGR M;  2QKM B;  1I3Q J;  2VKV A;  1G59 A;  2ICW G;  1YS7 A;  2M8E A;  1ZK8 A;  4YFN F;  4HLY A;  1ZTR A;  3AFH A;  1X3Z B;  2E7X A;  4A6D A;  2CW0 F;  3E97 A;  5HDK A;  2X51 A;  1OFC X;  2HQ5 A;  2CUE A;  3LA7 A;  3DBH B;  2H27 A;  4AID A;  3DBL B;  3PL8 A;  3BPX A;  2Z16 A;  3GTL J;  1YRN B;  5BS6 A;  3O3K A;  1SFX A;  2IRF G;  3CD6 I;  3QP5 A;  1J2X A;  1TWC J;  2AO9 A;  3DCF A;  2GQQ A;  1DPU A;  4WCG A;  3ZCO A;  1SC7 A;  5FJ8 J;  5IT9 K;  4HLX A;  4L9J A;  4X0G A;  1UAA A;  1OCR H;  2BXZ A;  2ESH A;  2LDU A;  5LRS A;  4ESJ A;  4RLF A;  1D0Y A;  3OYA A;  3ROU A;  3ZQI A;  2G9W A;  3BJA A;  3BLY A;  4PGH A;  3HDD A;  1Z77 A;  4X1E A;  3LSM A;  4M3E A;  3GO5 A;  1WJD A;  3U1D A;  3KEO A;  4L5E A;  1HCR A;  4I09 A;  1B6A A;  4FET A;  3OYD A;  1GUU A;  3KFW X;  3OY9 A;  3S1N J;  2E71 A;  2FBK A;  1LE8 B;  4G6T B;  3CJN A;  3PO2 J;  3S2W A;  1W5S A;  3D1N I;  3CF5 F;  5FRM A;  2Q1Z B;  1X1P A;  2QEN A;  2EZK A;  1BA5 A;  1GXQ A;  4TV7 A;  3WTS C;  2MC3 A;  1FPQ A;  3SJM A;  4IRI A;  3FXO A;  1D8J A;  1IN4 A;  4DIQ A;  1HST A;  5ICE A;  1RRJ A;  5F04 A;  2AS5 F;  3L00 A;  3VOD A;  5GAE J;  4E70 A;  3R4K A;  2KIF A;  1YX5 A;  4MLO A;  4ETS A;  1ZN2 A;  3KYC B;  5DM6 F;  2NOG A;  2XAS A;  4LG3 A;  4RGU A;  1BW6 A;  3M1E A;  1XB4 A;  3S32 A;  3CJT B;  2HDD A;  1P4X A;  1FBU A;  2GM4 A;  2CQ7 A;  3RZD J;  1HDP A;  4Y7N J;  2V1N A;  3KX2 A;  1X1A A;  2IJL A;  1RI7 A;  4EMS A;  4LLL A;  1XGM A;  3I0T A;  4G6Q A;  3A02 A;  4WXC A;  3RQ4 A;  2LKP A;  4WXD A;  2NVU B;  4A2U A;  5HS7 A;  2BXY A;  3M7G A;  3F21 A;  1TLH B;  2FE3 A;  1FJL A;  3RKQ A;  2VQG A;  2JMW A;  1MJA A;  2OU2 A;  2IGO A;  3VSK A;  2HOE A;  3N97 A;  1WVR A;  3V8L A;  4Q47 A;  4XKC A;  3FXR A;  3I5U A;  1R71 A;  3HOW J;  4F91 B;  3GTM J;  1T2K A;  4BQQ A;  3IWF A;  4AIK A;  4RGX A;  3OYK A;  1A31 A;  1TW3 A;  1RIO H;  2HQA A;  3I54 A;  3BG3 A;  5ILU A;  3TED A;  3B6C A;  1Z91 A;  2E2J J;  2VL8 A;  1WZ2 A;  4IEJ A;  4BEH B;  3BRO A;  2DA6 A;  4RM3 A;  2JQ7 A;  5GTH C;  2ZXW H;  1SD7 A;  2PLY A;  1E3P A;  4O5V A;  3CZ6 A;  2F5V A;  2Y2Z A;  3S2D J;  2BHZ A;  2K9L A;  2E1M C;  3E1S A;  3R0A A;  2Z9O A;  1WQ2 A;  3CCM I;  4P5O A;  4BXU A;  3CJQ B;  1UCR A;  3DTE A;  3ZQC A;  4B3X A;  3J7Y J;  1ODD A;  2GA1 A;  3LST A;  1A36 A;  1LFU P;  4DBR A;  4BDZ A;  3KZZ A;  3R0J A;  2K27 A;  4M74 A;  2ZME B;  2PMZ A;  2FMY A;  4JOM A;  2O03 A;  1U3E M;  4YIF A;  2Z1D A;  3VFZ A;  4CYD A;  2H1L A;  1JUS A;  5A2Q K;  1YRN A;  4L5I A;  2IA0 A;  3JCU C;  4CDG A;  4PJJ A;  3OYM A;  1VQP I;  3CCE I;  3GLX A;  3MVP A;  2UXX A;  3CMA I;  4XRF A;  2HVQ A;  4LLN A;  4XON A;  2P5L C;  4ENM A;  1VQN I;  1JT6 A;  5IP6 A;  2F5E A;  1K4T A;  3ZN0 A;  1R4N B;  1Z21 A;  2QEX I;  1A6I A;  3OSF A;  3ZMV A;  3HRS A;  2OQG A;  2K9M A;  3LSR A;  3W3C A;  2K9N A;  1U9O A;  4R8H A;  5LBQ A;  1LE8 A;  1R23 A;  3F8F A;  1ZGW A;  4FT8 A;  1H0M A;  1IW7 F;  3NWS A;  4Z2Y A;  4UV8 A;  4WXH A;  1C0W A;  4EEF G;  3QP6 A;  2JRM A;  4HDV A;  4AYB N;  2DDA A;  4AVP A;  1YIO A;  4EQQ A;  1XS9 A;  2CUJ A;  3L2R A;  1S3J A;  2HVR A;  4RDU A;  2JT1 A;  1VQ6 I;  2XRO A;  5H6Q A;  4GXO A;  5GTI C;  3COA C;  1HW5 A;  1XDS A;  3P9C A;  2A6T A;  2HTJ A;  3KP5 A;  2PJR B;  1MZB A;  4B44 A;  5J47 A;  1D3Y A;  2DK5 A;  4V2F A;  2FA5 A;  5JHF A;  3H9G A;  3CJR B;  1XX5 A;  4KIT B;  4E4H A;  4L9N A;  4FE7 A;  1UST A;  1ETX A;  4BUP A;  5DUK A;  1XTA A;  4M3G A;  4DBQ A;  5KAF C;  3J81 K;  3DEW A;  3OYB A;  3U21 A;  2Y9Z A;  1IUY A;  3NRV A;  4RB1 A;  2GXG A;  3F8N A;  5JLX A;  1ON2 A;  4YEJ A;  5EGO B;  5HOO A;  1MBH A;  5EEA A;  4XKV A;  1MBE A;  4MTD A;  3JRH A;  3C18 A;  1YE9 A;  2EFQ A;  3F8B A;  2V4J C;  2RRE A;  3IL2 A;  2IS2 A;  4U87 A;  2QM3 A;  2LFB A;  3FBN B;  1T95 A;  3I64 A;  3V42 A;  3OYL A;  2IPQ X;  4CCL A;  3K10 A;  1EH6 A;  3G1O A;  1MND A;  1R5G A;  3GVA A;  4CCN A;  3PNY A;  4BEH A;  2AQF A;  2STT A;  4HW0 A;  2C6Y A;  1IF1 A;  3J7Z I;  4HG2 A;  5ILS A;  1VQ4 I;  1IG7 A;  2EB7 A;  3L2U A;  5F0H A;  4OAZ A;  5CJ9 A;  3DLL F;  4F93 B;  4GGG A;  2JWT A;  1ZQ3 P;  1VQM I;  2FOK A;  1B1B A;  2XUB A;  2ZME A;  4MIM A;  1KU7 A;  1GV5 A;  3BJ6 A;  4A5M A;  1V4R A;  1EH8 A;  2M45 A;  2OV7 A;  5FLM J;  4BY7 J;  1SEU A;  4BE2 A;  3KIO A;  1REP C;  1KGS A;  1VQL I;  3K4L A;  1TWH J;  3M8F A;  1LUJ B;  4NQW B;  2CUZ A;  4PZJ A;  3VYT B;  5FLV A;  2VE9 A;  1A5J A;  3O2P E;  2YS9 A;  2BW3 B;  1O4X A;  4XLH A;  2HDC A;  5DUI A;  5BMZ A;  1SVL A;  3H5N A;  4ZTJ A;  3RYR A;  4KIC A;  3A0H C;  4D7N A;  2HNH A;  3FXL A;  3LSK A;  1I6X A;  1RKW A;  3KEY A;  1WJB A;  2ELK A;  3OYC A;  1F1Z A;  3JRA A;  3WU2 C;  2JSC A;  1BIB A;  2EIK H;  2E2I J;  1FY7 A;  9ANT A;  3VYU B;  2V6E A;  2CUF A;  2WB1 N;  4H0E A;  1TP4 A;  2NYX A;  3MD2 A;  2CW7 A;  3HGG A;  3QU3 A;  3GF2 A;  1P4W A;  4HDU A;  2VJI A;  3MWM A;  2G7U A;  1XGO A;  3L9F A;  3SFZ A;  3OS0 A;  3JSO A;  2W84 A;  2JA2 A;  2ME6 A;  2EK5 A;  3W6V A;  3T8T A;  5M5W J;  2DPU A;  2DFI A;  1DUX C;  5B1A H;  3IHU A;  3VSL A;  2FQ4 A;  2YUS A;  1F36 A;  2IS6 A;  2GIZ A;  2PJR A;  2HKO A;  2Q2E B;  3PUB A;  2AXL A;  3CCJ I;  5IYD J;  3V8K A;  4IQ4 A;  1LPQ A;  5E1Z B;  5KK1 A;  3BR1 A;  1ZGJ A;  4CCO A;  1F4K A;  1BI2 A;  2CG4 A;  2DMP A;  1LDK B;  1U9N A;  1GVJ A;  4DYR A;  2OCC H;  1B8I A;  4CHU A;  1H9G A;  1W7P B;  2IBD A;  4MQV A;  1DGW Y;  1JKQ C;  2HXI A;  1HA8 A;  3EUA A;  1N75 A;  3ONQ A;  3RKX A;  3P5J A;  3WTX C;  2I10 A;  2M2E A;  3EUK L;  3BTL A;  5EGO A;  1OJL A;  2M4G A;  1TQI A;  3FM3 A;  5KCM A;  4C3I J;  1SVM A;  3O8G A;  3OS2 A;  3EUH C;  3J80 Z;  1MH4 A;  4CO8 A;  1MW7 A;  3FBI B;  1F5T A;  1LDJ A;  5E8G A;  3EQL F;  2L7F P;  2VKH A;  1SD4 A;  2W4S A;  3AL0 C;  2BOL A;  3B73 A;  1YTY A;  1EV7 A;  3FHZ A;  4A12 A;  1FBS A;  2QSH X;  3F0C A;  1S9H A;  4N9I A;  4OWR B;  1X2N A;  2CQQ A;  2NXN B;  3HBL A;  2VQH A;  5D5X B;  3BG7 A;  2P4W A;  1U8B A;  2R7Z J;  2DN0 A;  2CH0 A;  4E7K A;  2XF7 A;  2LOO A;  3OYH A;  3WTV C;  1PVE A;  1OYI A;  2X0L A;  1QZY A;  5FFZ A;  3H92 A;  3E6M A;  5J1U A;  2R7Q A;  1XCB A;  1IC8 A;  3P9K A;  4XM3 A;  3KZI C;  2HWV A;  5L3E A;  1JE8 A;  2GAU A;  1OR7 A;  1HDD C;  1ETK A;  3WGG A;  1GT0 C;  4E7J A;  3MQ0 A;  1SD5 A;  2EZL A;  3D5R C;  4B4C A;  5TRD A;  2DAO A;  3JTH A;  2M0C A;  2EWN A;  1U5T B;  2XHK A;  5D6F A;  4ANJ A;  3HOV J;  1IN5 A;  2KIU A;  2QVO A;  1VZ0 A;  3ULQ B;  4XN3 A;  2Y9Y A;  3IV5 A;  4RA2 A;  2R7F A;  3IH2 A;  1QVU A;  4FIS A;  1WFX A;  2V7F A;  2LH9 A;  4GO1 A;  4L0Y B;  2ZME C;  2HOT A;  2MD5 A;  2XGE A;  5HNF A;  2E1M B;  2TDX A;  5J4V A;  1ZKG A;  2H09 A;  4ZDL A;  2E5Z A;  3FMR A;  2DDB A;  1D1C A;  2JRT A;  2J5O A;  2VJJ A;  3CCQ I;  1K6Y A;  5KHD A;  1FOW A;  1U0J A;  3FHN A;  2RKH A;  4Y4R A;  3F3X A;  1QPM A;  4U0V A;  1WKM A;  3MEX A;  2HYG D;  2CS3 A;  4F55 A;  1FC3 A;  4HX8 A;  3I58 A;  1OCP A;  2QWW A;  3IH3 A;  4B47 A;  3VB2 A;  4PK4 A;  3OYI A;  2EV5 A;  3OL3 A;  3PIP F;  3GTJ J;  3S16 J;  2WV1 A;  2JA8 J;  4XOP A;  4M9X A;  2ZBK A;  1WSU A;  2OTJ I;  3QAH A;  2Q2E A;  4AVZ A;  3WG9 A;  5C44 J;  2QQA A;  3OIP A;  2KIQ A;  1BR4 A;  1A35 A;  2E1O A;  3Q9S A;  4I7H A;  1HF0 A;  1CGP A;  1MKM A;  1MSF C;  4OIR F;  4X6A J;  3TQN A;  4HX7 A;  2DOE A;  2WY8 Q;  1NTC A;  3TMO A;  1LVK A;  4QPQ A;  5K7H A;  5CQG A;  5JVG F;  2YR2 A;  1W7P A;  3JRF A;  2ZO4 A;  2EIJ H;  3H36 A;  3LFU A;  2ECC A;  3BQY A;  5HS9 A;  4B3A A;  4KIG A;  5BPI A;  2K40 A;  4JBA A;  4OIQ F;  4DW6 A;  5LHH A;  1S8N A;  3WOD F;  3JRG A;  2X4H A;  3CQZ J;  4CSW A;  3E5U A;  2VC1 A;  4BHC A;  1KYW A;  2FNP A;  1FT9 A;  3UKG A;  4ZJZ A;  4MTE A;  1D5Y A;  2HXO A;  5K5Q A;  3KP3 A;  1BIA A;  5LHG A;  1R00 A;  3BZK A;  2Y0S N;  2OTL I;  1HW1 A;  2UV1 A;  4KIB A;  2LTP A;  3TDU C;  4MO7 A;  4MFD A;  3H3V K;  5EF6 A;  1GHC A;  1D8K A;  3GFI A;  3T8R A;  1OIS A;  2WAF A;  4ENJ A;  2MYS A;  2DYR H;  3IAM 2;  1XSX A;  2FX0 A;  1P92 A;  3C2B A;  3HKZ N;  2FBH A;  2OUM A;  1ZAR A;  4KA4 A;  1BN5 A;  1FOY A;  2L3D A;  1P2F A;  2QSF X;  2HYJ A;  2LSO A;  3LFK A;  1E17 A;  1G2H A;  2K9Q A;  2KIS A;  2VKD A;  1BI3 A;  1V5G A;  5TJJ A;  3J7A Y;  2L7K A;  4A3M J;  2KFD A;  1JJ6 C;  3K70 D;  3S15 J;  2X85 A;  4XNF A;  1S29 A;  2FEZ A;  5CQE A;  2EFW A;  5J40 A;  1E3O C;  2CO5 A;  3J7A O;  2NVY J;  5GAD J;  1IV8 A;  2MSY A;  2PN6 A;  1QBJ A;  4EAT A;  4IXA A;  2OD5 A;  2NRA C;  1X4P A;  1RET A;  1L0O C;  3TP3 A;  3OOP A;  2OCE A;  1JTY A;  1U5T A;  4LFU A;  4ENN A;  1S7E A;  3OOU A;  4A0Y A;  3UR3 C;  1B4A A;  2Z5U A;  4XKB A;  1R5I D;  4OU0 A;  2EJR A;  4BE1 A;  1VQO I;  1MMN A;  2ADU A;  1P4A A;  2L4M A;  3BWG A;  3DLA A;  3FMS A;  1WJE A;  4GYG A;  2MGQ A;  1OQY A;  3ZPL A;  2XF5 A;  2Y69 H;  3CC2 I;  1P6R A;  1XMX A;  4BKX A;  1BJZ A;  5D5U B;  4BDY A;  4F92 B;  1ZLK A;  1ONV A;  3E6B A;  3W2A A;  1EKE A;  3I56 I;  4LG0 B;  4IKF A;  4E6K G;  3H3U A;  1S72 I;  4I98 B;  4M3F A;  1QRY A;  2EZI A;  2BVM A;  1ZG5 A;  3KP4 A;  1W1W E;  2O9L A;  3CTA A;  3E0J B;  3LA3 A;  1LFP A;  3TO6 A;  4KYW A;  1J75 A;  3MKW B;  2R5Y A;  4LGW A;  2XSD C;  3HOX J;  2PMH A;  2EV6 A;  3CES A;  2LNB A;  5ICF A;  2DTZ A;  4WK8 F;  4KN4 X;  2DJN A;  4UVB A;  2R7U A;  4HF2 A;  3G71 I;  1R1T A;  2VXD A;  3HSF A;  3BT9 A;  4DOZ A;  3S2H J;  5M5X J;  1PP8 F;  4BJT A;  1FTT A;  3RSN A;  5FD5 A;  3FXM A;  4CUG A;  1J59 A;  2FJ1 A;  3GX4 X;  2KT0 A;  4J19 A;  3DEE A;  4D9J A;  4XLF A;  5F0C A;  3W2W A;  4O3M A;  1E0E A;  3LOC A;  1WCM J;  4W1U A;  3LSH A;  3DPT A;  4Q5S F;  4ZDO A;  1Y8R B;  3V7S A;  2LY2 A;  2EIN H;  2FF4 A;  2L9R A;  4XOT A;  1BOB A;  3GEZ A;  3BR5 A;  2GXB A;  1W5T A;  2R7S A;  5LGT A;  1Z6R A;  4M3D A;  1FEX A;  3ASO H;  1G6N A;  2W57 A;  2PMU A;  4NHJ A;  2XGD A;  4M9Z A;  5J1R A;  2FUG 2;  1MMG A;  5F1R A;  2RV8 A;  2Y30 A;  5DDG A;  5GPA A;  1J9I A;  3L2V A;  3D0S A;  3DU5 A;  3PUF A;  4JX6 A;  3L7W A;  2E60 A;  5CVJ A;  1TL8 A;  3HRT A;  4OIN F;  3QYB A;  3U2R A;  3BDD A;  4U88 A;  2BY3 A;  2JVH A;  3GTK J;  3WTZ A;  2E36 A;  1XMA A;  4YFX F;  2L4A A;  3P9I A;  4C9Y A;  3SDB A;  3ZQF A;  2JK3 A;  2LMD A;  1K83 J;  4ZYE A;  1A6Q A;  5JLW A;  3PO3 J;  1ETQ A;  4LD5 A;  2WWY A;  2PG4 A;  1ETV A;  2MBF A;  1TWF J;  3KP6 A;  3JAM K;  3ELK A;  4HQE A;  1I39 A;  5FGM A;  1ZRF A;  1QVT A;  2D1V A;  2K3F A;  4RAY A;  3LMM A;  4CH7 A;  1SAN A;  1YOV B;  4A3L J;  3ESW B;  2V9K A;  5DTD A;  3HKZ A;  4CCM A;  3LNQ A;  2CMP A;  3GFM A;  3K4J A;  4HV6 A;  2LK2 A;  4E7I A;  3FMQ A;  2D2W A;  4P9U A;  3H5R A;  2EA2 A;  2NVQ J;  2IVM A;  3AL0 B;  1I3A A;  2XPW A;  4PFO A;  4S04 A;  4S0H B;  5KNL A;  1MJB A;  2ZC2 A;  4PGG A;  3FXU A;  3FXJ A;  2WAD A;  2L2O A;  4RAF A;  5ED4 A;  2NVX J;  1KON A;  4LOC A;  1YHQ I;  3HTU A;  2ZSI B;  2EV0 A;  1K78 B;  1ETW A;  3M3Y J;  3NAU A;  3DKW A;  1ACI A;  2WTE A;  3JW4 A;  4RGS A;  1G3T A;  2EQR A;  4NDL A;  4JYK A;  3E6D A;  1YI2 I;  5AON A;  3LAJ A;  1MBG A;  2DQR A;  1X2M A;  2HQN A;  4IJA A;  3LA2 A;  2QQ9 A;  5DCF A;  2VC0 A;  3H5A A;  4XLA A;  5M3M J;  1U5T C;  2TCT A;  5FKL A;  3E6C C;  3PQK A;  1AOY A;  1VQ8 I;  4MFE A;  2CU7 A;  2B63 J;  1IRG A;  1LFB A;  4LG0 A;  5GAH J;  3JTG A;  4M9S A;  4G7O F;  3CLQ A;  1I1S A;  3BPV A;  3L09 A;  2BVL A;  2GOX B;  3KEQ A;  1WRJ A;  2DA3 A;  4MEX F;  1X1B A;  2GBY A;  4L9T A;  1MNM C;  1V54 H;  3DU6 A;  1Y56 A;  1BW5 A;  4UY8 I;  1IXR C;  3O6B B;  4IHW A;  1FIP A;  1MSE C;  4BY1 J;  3N4M A;  2K02 A;  1DDN A;  3C2G A;  2VLA A;  4FCY A;  4PCQ A;  1V3F A;  5JR3 A;  5HNH A;  2ID6 A;  5D8L B;  3OMY A;  5CVV A;  1JHF A;  4A3I J;  3GTG J;  4AIJ A;  3A03 A;  2W00 A;  4M6Y A;  3JSP A;  1R49 A;  2W24 A;  2FOW A;  4KMF A;  1M1E B;  4PJM A;  2DTR A;  3HIF A;  3OWT A;  2LBF B;  3IRR A;  1SMT A;  2M8G X;  3RCO A;  4G9Y A;  4II3 A;  2VPR A;  3RQI A;  4F7Z A;  1B9N A;  1NK2 P;  1A04 A;  1R1U A;  1D5V A;  1IRZ A;  3BR0 A;  3PSI A;  1FZP B;  3BTI A;  4XMY A;  1WI3 A;  4RAG A;  1MBK A;  4ZYG A;  1WI9 A;  2GWR A;  1ZRC A;  4KT6 A;  3E5Q A;  3I53 A;  5FFX A;  3QOP A;  1ZYR F;  2L0K A;  3CCU I;  2VBX A;  2DA2 A;  2X1D A;  2XB0 X;  5IYC J;  3I55 I;  5KAI C;  1ZG1 A;  1ZR4 A;  3RDI A;  2ELJ A;  1AHD P;  2KRF A;  2M30 A;  2V1U A;  2VOD A;  5FKO A;  4XL9 A;  4BHP A;  1TC3 C;  2YU3 A;  2XRN A;  5CKT A;  3RYP A;  4BJ5 C;  3MKZ A;  4AM3 A;  5DCM B;  1FYL A;  3GTQ J;  2VUM J;  1FBQ A;  3EUH A;  4PJL A;  1DP7 P;  5LEK A;  1IRX A;  2W7N A;  2MC4 A;  2VE8 A;  3CCR I;  2DT6 A;  3VWB A;  3FKJ A;  3F8C A;  2KRH A;  2ZXI A;  2PX9 A;  1MIJ A;  1RPW A;  2EIM H;  2M0M A;  3KLO A;  4U7D A;  3F9K A;  4Y13 A;  2BZT A;  2LC2 A;  1T0F C;  3WU0 A;  1ERD A;  2VON A;  1HSJ A;  3GTO J;  2QYO A;  3PNT A;  1FOX A;  2XAJ A;  3PIO F;  5ILV A;  1K78 A;  3V4G A;  1UG2 A;  1Z0X A;  2K85 A;  3IP4 B;  3GZN B;  3AG3 H;  3LSI A;  5C4X J;  3HM5 A;  1POG A;  2DFE A;  4KDP A;  4KMU X;  1LB2 A;  5D8K B;  5M3F J;  5B3S H;  2AXT C;  4JX4 A;  4BNC A;  4IQJ A;  1HQC A;  1W5C C;  1YW7 A;  2QQB A;  3RPU A;  1PJR A;  3LSG A;  3Q0U A;  4NC6 A;  4OIP F;  5L3B A;  3C1D A;  3WGI A;  2BGC A;  1VFC A;  1TNT A;  3IH4 A;  4I02 A;  3C2H A;  2ZNY A;  3HG9 A;  1YIT I;  3A0B C;  2DW4 A;  3M4O J;  3ZRG A;  2R7O A;  4QPO A;  2IS4 A;  4PSW A;  2P5V A;  4WWC A;  3RJP A;  3W6J B;  2ZCW A;  2MH2 A;  4I2O A;  5H6R A;  2DU9 A;  2A3S A;  2CWE A;  4Y15 A;  2D1H A;  3ZMU A;  4BQN A;  3FXK A;  4G12 A;  4HOB A;  1FTZ A;  4XRS G;  2IA2 A;  4M6V A;  3VOE A;  2MG4 A;  3ABT A;  1W7P D;  2Z99 A;  2MAB A;  2RN7 A;  3CCV I;  1E3H A;  5E1X A;  3X2Q H;  2FXA A;  2XV4 S;  3OR2 C;  4A3D J;  5AIQ A;  2FQ3 A;  2DQL A;  1B9M A;  1YIJ I;  1IO2 A;  1B72 B;  3KCC A;  5C3E J;  4IHV A;  2BYV E;  4I76 A;  2JA5 J;  4JX5 A;  4P1W A;  3WTT C;  1K61 A;  1AWC A;  2LBF A;  3ZQH A;  2QLZ A;  2YX4 A;  5J1Y A;  2KPM A;  1RR8 C;  2CV2 A;  2VBW A;  4A3G J;  1MD0 A;  3VDX A;  3VYR B;  1G3W A;  3ABK H;  5CYV A;  2QF7 A;  2M4K A;  3QPT A;  1YLF A;  3MCZ A;  2RNG A;  4HEA 2;  4JP0 A;  5LEJ A;  5IT9 Z;  4ENK A;  2K7L A;  1X3W B;  4IHY A;  4UVC A;  1T56 A;  2KDO A;  3PSF A;  5HS8 A;  2K3P A;  3R61 A;  1BC7 C;  1KA8 A;  4IHT A;  1UJ8 A;  5L3D A;  1U6G A;  1XPX A;  1T8I A;  5LHI A;  4XN0 A;  1OCO H;  2O0Y A;  3NWT A;  3KZY A;  2JVG A;  1XC5 A;  4UXN A;  3GZ6 A;  4HF1 A;  4OAY A;  2Z2S B;  3A01 B;  4L0Z B;  4XRS A;  2R7T A;  1Z1D A;  4CA0 A;  3PJR A;  2DCE A;  3EDP A;  3ZQG A;  3FIW A;  5E79 C;  3JRE A;  1LJ9 A;  2X9D A;  1K6O A;  2X6Y A;  4DQ2 A;  5BNG A;  1Y39 A;  5B1B H;  4U7B A;  3WTU C;  2XGC A;  2EPF A;  1P7J A;  2XDV A;  5D6E A;  4EVI A;  4AYB A;  1VI0 A;  2E2H J;  2Y75 A;  2ZFW A;  1UEL B;  1WPK A;  1UHM A;  2JPB A;  2MH9 A;  2E35 A;  1LDD A;  4GCV A;  5CLS A;  1AKH B;  3CC7 I;  1TQP A;  2A5Y B;  2LKX A;  2XRL A;  4DYC A;  5F08 A;  3WU1 B;  2DFF A;  3B02 A;  4JQF A;  1H9T A;  4XOR A;  4IOA F;  2RQQ A;  4Q48 A;  2KL4 A;  1U78 A;  5HLH A;  5JHU A;  3BP8 A;  3IAS 2;  2ZJP F;  3DTK A;  2ME0 A;  5EG0 B;  3GBG A;  1O3Q A;  3DXJ F;  4AC0 A;  2H6B A;  5TIS C;  3HGY A;  3DEU A;  2XKO A;  4XKW A;  2XAU A;  2BY1 A;  4AU7 A;  3H0D A;  4EM0 B;  1YX3 A;  1I50 J;  4XIC A;  3CDH A;  1K79 A;  3WGH A;  3SHF A;  2NS7 A;  4E7Z A;  5HLI A;  1WGX A;  3ML6 A;  1NK3 P;  2O6G E;  1R36 A;  3K4N A;  4PJN A;  3QPS A;  1IN8 A;  4HNT A;  1PUF B;  3CP2 A;  5FO5 A;  3BG5 A;  2M5W A;  5IP7 J;  3HB9 A;  2VBY A;  1MBJ A;  2F6C A;  2HPM A;  4CCJ A;  4RMN A;  1JUM A;  2BY2 A;  3I4N J;  3OYJ A;  1N78 A;  3HOU J;  3BZC A;  4YG2 F;  3I59 B;  4DZJ A;  4FX4 A;  4NQW A;  2KHM A;  2ZB9 A;  2W1O A;  1XG1 A;  4P9F A;  3G3Z A;  4LK0 F;  3M8E A;  2P7C B;  2BW3 A;  4CZZ A;  1LVA A;  5EZG A;  2L01 A;  1RUO A;  1TT5 B;  4EJU A;  1EA3 A;  1FSH A;  3CF2 A;  3LSP A;  5LFA A;  3AG1 H;  1TW2 A;  1BI0 A;  4I01 A;  2LY1 A;  2LKS A;  3GFL A;  5F64 A;  1Y6I A;  3DP7 A;  3HHH A;  2R5Z B;  3K4C A;  5EYR A;  4ZDP A;  1FIA A;  2GZW A;  2V1X A;  2A69 F;  3CDL A;  4IHX A;  2R7X A;  3NAR A;  4QWQ A;  1W36 C;  2ZNZ A;  4MEY F;  5JI6 A;  2RVC A;  1NH3 A;  2EA4 A;  2RAE A;  1FYK A;  4MQ9 F;  4A3B J;  4NNJ A;  3MAJ A;  2MA3 A;  5FRO A;  4V19 K;  2Q0O A;  4KUM A;  4HF0 A;  1ZHF A;  4HNU A;  3OIO A;  4A3K J;  4A6E A;  3ZMZ A;  5ICC A;  2HTS A;  4IZZ A;  3ZQL A;  1S5L C;  4CXF A;  3H9J A;  3K2Z A;  5GAG J;  4D0P A;  3GW2 A;  3A1Y A;  3A01 A;  5IYB J;  3Q0W A;  4B43 A;  3G73 A;  1O3R A;  3R6S A;  2LRD A;  2W25 A;  2WB1 A;  4L5J A;  5L3F A;  3JRD A;  1HKQ A;  1O7F A;  4ZYH A;  2J5P A;  4A93 J;  2DO7 A;  3Q9V A;  2V6C A;  4BJ6 C;  2IA1 A;  2VIX A;  2XKP A;  4KFC A;  2TRT A;  1QHG A;  1MMA A;  2STW A;  1WJF A;  2EFO A;  1X19 A;  1HXD A;  2EFP A;  2M1B A;  4O6J A;  5E18 F;  4RBO A;  4IX7 A;  3WG7 H;  3DFG A;  3P7N A;  2W48 A;  2WA0 A;  5J6X A;  5E20 A;  4XQF A;  1O7L A;  2O8K A;  4LIT A;  1AKH A;  1Z7U A;  3CCL I;  1ULY A;  1OCT C;  2VT2 A;  2CV1 A;  4YIR X;  2VQL A;  6PAX A;  1SVO A;  4BXF A;  5E3M A;  4BHB A;  3ECO A;  3OSG A;  3TKY A;  4OMZ A;  1QNT A;  3K4K A;  2FNA A;  1Y1W J;  4RM2 A;  4EV0 A;  5B5E C;  4RS8 A;  5FRN A;  2KP6 A;  2F4I A;  2L9V A;  4A5N A;  5F1J A;  1JKO C;  5EG0 A;  4ZC3 A;  5L3C A;  2CFX A;  3TO7 A;  2KIM A;  3MMY B;  2DA7 A;  1YW9 A;  3BTJ A;  4N0B A;  3R60 A;  5HDG A;  4A0X A;  5GPC A;  3QPH A;  1OLT A;  3S3O A;  2ZXJ A;  3TL4 X;  2JA6 J;  5E3O A;  1EF4 A;  1R5H A;  4ITV A;  2FSW A;  1OYW A;  1Q1H A;  3ZMT A;  2XPU A;  5HOD A;  1VTN C;  3VYS B;  1X1C A;  2X48 A;  3EET A;  3HOZ J;  2MLG A;  3CO6 C;  2F4M B;  4D1Q A;  5BPD A;  1PUF A;  4M73 A;  3JRI A;  2VN2 A;  3RIR A;  2IS1 A;  3HJE A;  2IP2 A;  4CZC A;  3TO9 A;  3AKZ A;  3QYF A;  2BY0 A;  2OJE D;  2VBZ A;  4P55 A;  3E7L A;  2ELH A;  2BBY A;  3BC8 A;  4U0Y A;  1ON1 A;  5LGN A;  3I59 A;  1HKS A;  1RZ4 A;  3QYE A;  3QQA A;  4M71 A;  2XAQ A;  1PP7 U;  3SXY A;  1F43 A;  4IO9 F;  2WAQ N;  1UB9 A;  2ZJ2 A;  1KQ8 A;  3CO7 C; 
#chains in the Genus database with same CATH homology
 5JFR A;  5DD4 A;  3K69 A;  4G94 A;  4LMY A;  2Z33 A;  5E8I A;  4Y17 A;  2DBB A;  3HOS A;  3K0L A;  5K5O A;  2K86 A;  3M9A A;  3Q5F A;  4XLN F;  1HW2 A;  4R79 A;  3ECH A;  3NEU A;  1KU3 A;  2ZKZ A;  3MZH A;  5DYM A;  2KKO A;  1L3L A;  3SZT A;  1CF7 B;  5D4S A;  2O8X A;  2W85 A;  1TBX A;  1E2X A;  2B0L A;  3LQR A;  1R1V A;  1XSV A;  4HBL A;  1ZAO A;  4BAY A;  1F9N A;  4IRG A;  1XCV A;  2ESN A;  4KT5 C;  2XAG A;  2HZT A;  4IF4 A;  4WX9 A;  4EJW A;  3HTS B;  4L9V A;  1FLI A;  4FHT A;  1FSE A;  2FML A;  5BQT A;  4B8X A;  3BJO A;  2VT3 A;  3E3V A;  5D5W B;  4MNU A;  3T5X A;  2HQR A;  1FYM A;  2XAF A;  3E5X A;  1O3T A;  5E17 F;  1KYZ A;  3QRF F;  2GIV A;  1UHW A;  1G3S A;  2GA2 A;  4S05 A;  1USS A;  4UVA A;  1ZRD A;  3NQO A;  2K4J A;  2A07 F;  3ISP A;  1T0F A;  2QBY B;  5E1W A;  4BQA A;  2OA4 A;  3FZV A;  1XN7 A;  3GUD A;  2Y48 A;  3ZMS A;  1OPC A;  1KQ9 A;  2O61 A;  1HKT A;  3W6K B;  2F2E A;  1OKR A;  5EEG A;  4XBF A;  2ETH A;  3K1N A;  4HZF A;  3HOT A;  1JXS A;  1HBX G;  3GXO A;  4IRH A;  4AIH A;  5CVI A;  2OAZ A;  5HDN A;  2HEO A;  3I4P A;  2HFH A;  3RTR A;  1BBY A;  2NAZ A;  1G4D A;  2RDP A;  3AAF A;  2PQ8 A;  4ZZD A;  3J80 K;  1ZRE A;  3GYH X;  3F22 A;  2P5K A;  4LJZ F;  4Q4Z F;  3V8J A;  3L2C A;  1PUE E;  3GZ5 A;  2A61 A;  2E1N A;  1T6S A;  5KVR A;  2A6H F;  3SZP A;  1O57 A;  4CGZ A;  3MFK A;  3MZY A;  1CF7 A;  2V9V A;  5F6F A;  3ERE D;  1LQ1 A;  1O3S A;  3KLN A;  2XGX A;  1J5Y A;  2DLL A;  4JK1 X;  3VEP A;  1RUN A;  2G7H A;  1SMY F;  1U2W A;  1XDU A;  1YW8 A;  4MHG A;  1S7A A;  3BZ6 A;  5LGU A;  3CUQ C;  3TOA A;  2XIG A;  3HYI A;  3GFJ A;  4IVN A;  1R58 A;  5DV5 A;  3DQV C;  4AWX B;  2HYF A;  1OMI A;  2NNY A;  2COM A;  2P6T A;  1I27 A;  4EM1 A;  4YII A;  1DPR A;  1S6L A;  2NNN A;  1X3U A;  2R7D A;  3RKW A;  2KJC A;  4ZYD A;  2PJP A;  3ZQ7 A;  3BOQ A;  2QBY A;  4G8X A;  1XMK A;  5JVT A;  2VOP A;  2JTV A;  4IHS A;  1TTY A;  5K1Y A;  2VXZ A;  3U9G A;  1ZH5 A;  1ZG3 A;  5FB2 A;  4RAZ A;  2V1D A;  4UHT A;  4EJV A;  1I5Z A;  3V7C A;  3RKY A;  5D4R A;  1JHH A;  2Q8K A;  3F23 A;  3F6O A;  4RGR A;  2LF8 A;  1BJA A;  4R1H A;  3SQN A;  2HGC A;  1QZZ A;  4AD9 A;  4N9H A;  3DV8 A;  1OYY A;  5CVR A;  1XGN A;  1SFU A;  5FLX Z;  3EYY A;  2XAH A;  4UV9 A;  4I0B A;  1KQ0 A;  3KET A;  4RB2 C;  3T1B A;  1FNN A;  4UUV A;  3WTY C;  2FBI A;  3HSE A;  3REO A;  5BOX A;  1IZ1 A;  2E1C A;  2CSO A;  4HQM A;  2MLK A;  2Z3Y A;  4G7H F;  1R7J A;  3V7R A;  4A0Z A;  1IN6 A;  4KN7 X;  2KJB A;  1YS6 A;  3PFI A;  4NB5 A;  1FX7 A;  1FOK A;  1SD6 A;  3D5L A;  1YG2 A;  4LK1 F;  1I1G A;  5D5V B;  2P6S A;  2CYY A;  1T38 A;  1RNL A;  1TQM A;  1YO5 C;  2HR3 A;  3ZP5 A;  3BY6 A;  3K1P A;  3CUO A;  1SFE A;  4ESF A;  1Y0U A;  3FF5 A;  4K2E A;  1R22 A;  2FRH A;  4G6D A;  5HVQ C;  1BC8 C;  4HX4 A;  3CLO A;  1QQI A;  2ISZ A;  1K7A A;  1XD7 A;  2E7W A;  3KP7 A;  2DT5 A;  4RB0 A;  3PQJ A;  4OMY A;  4HYE A;  3KP2 A;  1KU2 A;  4ZZL A;  2V79 A;  1ZGA A;  5DCM A;  3KE2 A;  4XLP F;  2OBP A;  1YQA A;  3K9T A;  3JAM Z;  2IT0 A;  4LB6 B;  3F8M A;  2QZ8 A;  1U8R A;  1J0R A;  1SAX A;  1PDN C;  2JZY A;  4G7Z F;  4XSX F;  2F5D A;  3RPQ A;  2DI3 A;  5ERI A;  2BV6 A;  3QU6 A;  4XSZ F;  1MDM B;  1BI1 A;  4B09 A;  3TDZ C;  4MGR A;  2UXN A;  1XGS A;  4EM2 A;  1J7K A;  2YPR A;  2RGV A;  5HLG A;  2R3S A;  2QUF A;  4LB5 A;  2YX7 A;  4P96 A;  1IAW A;  2P8T A;  3F72 A;  1XSD A;  1BOA A;  2M87 A;  2CQK A;  2XVC A;  3T0Y A;  2H6C A;  2L02 A;  4ASN A;  1NHA A;  3F6V A;  2PI0 A;  1TNS A;  1ZLJ A;  1STZ A;  2LF7 A;  5IT3 A;  1JGS A;  2PEX A;  4EGZ A;  1IXC A;  4WF2 A;  4EGY A;  2RC4 A;  4KIF A;  1WWX A;  3RI4 A;  4ZH4 F;  4PDK A;  1FWZ A;  5A2Q Z;  2PFB A;  3K1M A;  3LQQ A;  2ACJ A;  4L18 B;  4KNY A;  4EJO A;  5L3G A;  2ISY A;  1KU9 A;  3FX3 A;  2IW5 A;  4QLC U;  3LAP A;  1G3Y A;  2WC2 A;  2RQP A;  4ESB A;  3WTW C;  2F5C A;  5AIP A;  3C7J A;  3DPL C;  2DK8 A;  4LLG F;  2PBI A;  4FX0 A;  3WE2 A;  3FWE A;  3ZMD A;  3CUQ B;  2OQR A;  2H94 A;  1QO0 D;  2F5F A;  5EEH A;  3WE3 A;  4M6X A;  1T39 A;  1IXS B;  3TOB A;  3IRQ A;  5CVU A;  3GWZ A;  2BEO A;  1QGP A;  4CIC A;  4U0W A;  3I71 A;  3LWF A;  5ICG A;  2VOO A;  2CGP A;  5H20 A;  2Y0M A;  3HHG A;  3OV8 A;  2A68 F;  1T98 A;  2K4B A;  3ABU A;  3IC7 A;  2OZU A;  1MDM A;  3J81 Z;  4EJT A;  2A6E F;  5J8F A;  1Z05 A;  1Z6T A;  2YSR A;  1UFM A;  4HV5 A;  1Z9C A;  1MJ9 A;  3HSR A;  1W4M A;  2P7V B;  1LEB A;  3FM5 A;  1B59 A;  3H3Z A;  1LEA A;  3C3W A;  3HRM A;  3DF8 A;  1IRF A;  4YFK F;  2FU4 A;  1YYV A;  5DD8 A;  1MGT A;  3HRU A;  2JPC A;  3IWZ A;  2DPD A;  4HA8 A;  2O3F A;  3EYI A;  2UWM A;  2D45 A;  2WV0 A;  1EH7 A;  3IKV A;  2OZ6 A;  4I0A A;  3TGN A;  2UZK A;  3HUG A;  2HS5 A;  5FD6 A;  2L54 A;  3IKT A;  4ON0 A;  1BM9 A;  4OOI A;  1FP1 D;  5LLQ A;  1IN7 A;  4GYI A;  4HAM A;  4RB3 C;  5FLX K;  2RNJ A;  4IPA A;  5LRR A;  1GXP A;  2NS0 A;  5J8C A;  4M72 A;  5K5R A;  2HKX A;  3FXQ A;  5DEQ A;  4DNC A;  2EFN A;  3CUQ A;  1YFH A;  1FP2 A;  4UNO A;  4BH9 A;  1LNW A;  4OIO F;  4BYY A;  2BE5 F;  3ZN1 A;  1S7O A;  1YS7 A;  2M8E A;  4YFN F;  4HLY A;  4A6D A;  2E7X A;  2CW0 F;  3E97 A;  5HDK A;  3LA7 A;  2H27 A;  3BPX A;  5BS6 A;  3O3K A;  1SFX A;  2IRF G;  3QP5 A;  1J2X A;  2GQQ A;  1DPU A;  4WCG A;  5IT9 K;  4HLX A;  4L9J A;  2ESH A;  2LDU A;  5LRS A;  4ESJ A;  3ROU A;  2G9W A;  3BJA A;  4PGH A;  3GO5 A;  3U1D A;  3KEO A;  4I09 A;  1B6A A;  3KFW X;  2FBK A;  3CJN A;  3S2W A;  1W5S A;  2QEN A;  1GXQ A;  4TV7 A;  3WTS C;  2MC3 A;  1FPQ A;  4IRI A;  1D8J A;  1IN4 A;  1HST A;  5ICE A;  2AS5 F;  3L00 A;  3VOD A;  4E70 A;  3R4K A;  2KIF A;  4ETS A;  1ZN2 A;  2XAS A;  4RGU A;  3M1E A;  1XB4 A;  1P4X A;  1FBU A;  2IJL A;  1RI7 A;  4EMS A;  4LLL A;  1XGM A;  3I0T A;  4G6Q A;  4WXC A;  2LKP A;  4WXD A;  4A2U A;  5HS7 A;  3M7G A;  3F21 A;  1TLH B;  2FE3 A;  1MJA A;  2OU2 A;  2HOE A;  3N97 A;  3V8L A;  4Q47 A;  3FXR A;  3I5U A;  1T2K A;  3IWF A;  4AIK A;  4RGX A;  1TW3 A;  1RIO H;  3I54 A;  5ILU A;  1Z91 A;  3BRO A;  1SD7 A;  2PLY A;  4O5V A;  3R0A A;  2Z9O A;  1WQ2 A;  4P5O A;  4BXU A;  1UCR A;  1ODD A;  2GA1 A;  3LST A;  3KZZ A;  3R0J A;  2K27 A;  4M74 A;  2ZME B;  2FMY A;  2O03 A;  1U3E M;  4YIF A;  3VFZ A;  4CYD A;  5A2Q K;  4L5I A;  2IA0 A;  4CDG A;  3GLX A;  2UXX A;  4XRF A;  4LLN A;  2P5L C;  4ENM A;  2F5E A;  3ZN0 A;  3ZMV A;  3HRS A;  2OQG A;  4R8H A;  5LBQ A;  1R23 A;  3F8F A;  4FT8 A;  1H0M A;  1IW7 F;  4Z2Y A;  4UV8 A;  4WXH A;  1C0W A;  3QP6 A;  4HDV A;  4AVP A;  1YIO A;  4EQQ A;  1S3J A;  2JT1 A;  2XRO A;  5H6Q A;  4GXO A;  3COA C;  1HW5 A;  1XDS A;  3P9C A;  2HTJ A;  3KP5 A;  1MZB A;  1D3Y A;  2DK5 A;  2FA5 A;  4L9N A;  1UST A;  5DUK A;  3J81 K;  1IUY A;  3NRV A;  4RB1 A;  2GXG A;  3F8N A;  1ON2 A;  5HOO A;  4MTD A;  3C18 A;  2EFQ A;  3F8B A;  3IL2 A;  2QM3 A;  3I64 A;  2IPQ X;  1EH6 A;  1R5G A;  3GVA A;  2STT A;  4HW0 A;  2C6Y A;  1IF1 A;  5ILS A;  2EB7 A;  5CJ9 A;  4GGG A;  2FOK A;  1B1B A;  2XUB A;  2ZME A;  1KU7 A;  4A5M A;  3BJ6 A;  1V4R A;  1EH8 A;  2M45 A;  1REP C;  1KGS A;  3M8F A;  4PZJ A;  2VE9 A;  3O2P E;  2HDC A;  5DUI A;  5BMZ A;  3RYR A;  4KIC A;  1I6X A;  1F1Z A;  2JSC A;  1BIB A;  1FY7 A;  4H0E A;  2NYX A;  3QU3 A;  3GF2 A;  1P4W A;  4HDU A;  3MWM A;  2G7U A;  1XGO A;  3L9F A;  3SFZ A;  3JSO A;  2W84 A;  2EK5 A;  3T8T A;  2DPU A;  2DFI A;  1DUX C;  3IHU A;  2HKO A;  2AXL A;  3V8K A;  5E1Z B;  5KK1 A;  1ZGJ A;  1F4K A;  1BI2 A;  2CG4 A;  1LDK B;  1GVJ A;  4CHU A;  1H9G A;  1W7P B;  4MQV A;  3RKX A;  3WTX C;  1TQI A;  3FM3 A;  3J80 Z;  4CO8 A;  1F5T A;  1LDJ A;  5E8G A;  3EQL F;  1SD4 A;  3B73 A;  1YTY A;  1EV7 A;  3FHZ A;  4A12 A;  1FBS A;  4N9I A;  5D5X B;  2P4W A;  3WTV C;  2X0L A;  1OYI A;  5FFZ A;  1QZY A;  3H92 A;  3E6M A;  1XCB A;  3P9K A;  5L3E A;  2HWV A;  1JE8 A;  2GAU A;  1OR7 A;  3WGG A;  3MQ0 A;  1SD5 A;  5TRD A;  2DAO A;  3JTH A;  2EWN A;  1U5T B;  2XHK A;  5D6F A;  1IN5 A;  2KIU A;  2QVO A;  3ULQ B;  2R7F A;  4GO1 A;  4L0Y B;  2MD5 A;  2TDX A;  2H09 A;  3FMR A;  2JRT A;  2J5O A;  2RKH A;  3F3X A;  1QPM A;  4U0V A;  1WKM A;  3MEX A;  2HYG D;  1FC3 A;  4HX8 A;  3I58 A;  2QWW A;  3VB2 A;  2EV5 A;  4M9X A;  2ZBK A;  1WSU A;  3QAH A;  2Q2E A;  3WG9 A;  2QQA A;  3Q9S A;  4I7H A;  1CGP A;  1MKM A;  4OIR F;  3TQN A;  4HX7 A;  2YR2 A;  1W7P A;  2ZO4 A;  5HS9 A;  4KIG A;  5BPI A;  4JBA A;  4OIQ F;  5LHH A;  1S8N A;  3WOD F;  2X4H A;  3E5U A;  2VC1 A;  4BHC A;  1KYW A;  2FNP A;  1FT9 A;  4MTE A;  5K5Q A;  3KP3 A;  1BIA A;  5LHG A;  1R00 A;  1HW1 A;  4KIB A;  3TDU C;  1GHC A;  1D8K A;  3GFI A;  3T8R A;  4ENJ A;  1XSX A;  1P92 A;  2FBH A;  1ZAR A;  4KA4 A;  1BN5 A;  2L3D A;  1P2F A;  2LSO A;  3LFK A;  1E17 A;  1BI3 A;  5TJJ A;  2EFW A;  1S29 A;  2FEZ A;  2CO5 A;  3J7A O;  2PN6 A;  1QBJ A;  4IXA A;  2OD5 A;  2NRA C;  1L0O C;  3OOP A;  4LFU A;  1U5T A;  4ENN A;  4A0Y A;  1B4A A;  2Z5U A;  4OU0 A;  2EJR A;  2ADU A;  1P4A A;  2L4M A;  3BWG A;  3FMS A;  4GYG A;  3ZPL A;  1P6R A;  5D5U B;  1ZLK A;  1ONV A;  3E6B A;  4LG0 B;  3H3U A;  4I98 B;  1ZG5 A;  3KP4 A;  3CTA A;  3LA3 A;  3TO6 A;  4KYW A;  1J75 A;  4LGW A;  2PMH A;  2EV6 A;  2LNB A;  5ICF A;  4WK8 F;  4KN4 X;  4UVB A;  4HF2 A;  1R1T A;  3HSF A;  1PP8 F;  5FD5 A;  1J59 A;  3GX4 X;  4O3M A;  4Q5S F;  3DPT A;  3V7S A;  2FF4 A;  3GEZ A;  2GXB A;  1W5T A;  5LGT A;  1Z6R A;  1G6N A;  2W57 A;  2PMU A;  4NHJ A;  4M9Z A;  5F1R A;  2RV8 A;  1J9I A;  5DDG A;  3D0S A;  3L7W A;  5CVJ A;  3HRT A;  4OIN F;  3U2R A;  3BDD A;  4U88 A;  3WTZ A;  1XMA A;  4YFX F;  2L4A A;  3P9I A;  4ZYE A;  4LD5 A;  2WWY A;  2PG4 A;  2MBF A;  3KP6 A;  3JAM K;  3ELK A;  4HQE A;  5FGM A;  1ZRF A;  2D1V A;  4RAY A;  3GFM A;  4HV6 A;  3FMQ A;  2D2W A;  4P9U A;  2EA2 A;  2IVM A;  4S04 A;  1MJB A;  4PGG A;  3FXU A;  5ED4 A;  3HTU A;  2EV0 A;  1K78 B;  3DKW A;  2WTE A;  3JW4 A;  4RGS A;  1G3T A;  3E6D A;  5AON A;  3LAJ A;  2DQR A;  2HQN A;  4IJA A;  3LA2 A;  2QQ9 A;  5DCF A;  2VC0 A;  1U5T C;  3E6C C;  3PQK A;  1AOY A;  1IRG A;  4LG0 A;  3JTG A;  4M9S A;  4G7O F;  1I1S A;  3BPV A;  3L09 A;  3KEQ A;  1WRJ A;  4MEX F;  4L9T A;  1IXR C;  3O6B B;  3N4M A;  2K02 A;  1DDN A;  4PCQ A;  1V3F A;  5JR3 A;  5D8L B;  5CVV A;  1JHF A;  4AIJ A;  4M6Y A;  3JSP A;  2W24 A;  4KMF A;  2DTR A;  3HIF A;  3IRR A;  1SMT A;  4G9Y A;  4F7Z A;  1B9N A;  1A04 A;  1R1U A;  1D5V A;  1FZP B;  4ZYG A;  1WI9 A;  2GWR A;  1ZRC A;  3E5Q A;  3I53 A;  5FFX A;  3QOP A;  1ZYR F;  2VBX A;  1ZG1 A;  3RDI A;  2KRF A;  2M30 A;  2V1U A;  2VOD A;  4BHP A;  2YU3 A;  2XRN A;  3RYP A;  5DCM B;  1FYL A;  1FBQ A;  3EUH A;  1DP7 P;  5LEK A;  2VE8 A;  3F8C A;  3KLO A;  4U7D A;  4Y13 A;  3WU0 A;  2VON A;  1HSJ A;  2QYO A;  2XAJ A;  5ILV A;  1K78 A;  3V4G A;  4KDP A;  4KMU X;  1LB2 A;  5D8K B;  4BNC A;  1HQC A;  1YW7 A;  2QQB A;  3RPU A;  4OIP F;  5L3B A;  3C1D A;  3WGI A;  2BGC A;  1TNT A;  4I02 A;  2ZNY A;  2DW4 A;  2P5V A;  4WWC A;  3RJP A;  3W6J B;  2ZCW A;  2MH2 A;  4I2O A;  5H6R A;  2DU9 A;  2A3S A;  2CWE A;  4Y15 A;  2D1H A;  3ZMU A;  4HOB A;  2IA2 A;  3VOE A;  3ABT A;  1W7P D;  2Z99 A;  2RN7 A;  5E1X A;  2FXA A;  2XV4 S;  5AIQ A;  2FQ3 A;  2DQL A;  1B9M A;  3KCC A;  2BYV E;  3WTT C;  1AWC A;  2QLZ A;  2YX4 A;  2VBW A;  1MD0 A;  1G3W A;  5CYV A;  3QPT A;  1YLF A;  3MCZ A;  5LEJ A;  5IT9 Z;  4ENK A;  2K7L A;  4UVC A;  5HS8 A;  3R61 A;  1BC7 C;  1KA8 A;  4IHT A;  5L3D A;  1U6G A;  5LHI A;  2O0Y A;  3KZY A;  4UXN A;  3GZ6 A;  4HF1 A;  4L0Z B;  1Z1D A;  3EDP A;  1LJ9 A;  1K6O A;  4DQ2 A;  4U7B A;  3WTU C;  5D6E A;  4EVI A;  2Y75 A;  2ZFW A;  1UHM A;  2JPB A;  2MH9 A;  1LDD A;  4GCV A;  5CLS A;  1TQP A;  2A5Y B;  3WU1 B;  3B02 A;  4JQF A;  1H9T A;  4Q48 A;  1U78 A;  5HLH A;  5JHU A;  3BP8 A;  1O3Q A;  3DXJ F;  2H6B A;  3DEU A;  2XKO A;  4EM0 B;  3CDH A;  1K79 A;  3WGH A;  3SHF A;  5HLI A;  3ML6 A;  2O6G E;  1R36 A;  1IN8 A;  5FO5 A;  2M5W A;  2VBY A;  4YG2 F;  3I59 B;  4FX4 A;  4NQW A;  4P9F A;  3G3Z A;  4LK0 F;  3M8E A;  2P7C B;  4CZZ A;  1LVA A;  2L01 A;  1RUO A;  4EJU A;  1FSH A;  1TW2 A;  1BI0 A;  4I01 A;  3GFL A;  5F64 A;  3DP7 A;  3HHH A;  2GZW A;  2V1X A;  2A69 F;  4QWQ A;  2ZNZ A;  4MEY F;  5JI6 A;  2RVC A;  2EA4 A;  1FYK A;  4MQ9 F;  3MAJ A;  2MA3 A;  2Q0O A;  4KUM A;  4HF0 A;  1ZHF A;  4A6E A;  3ZMZ A;  5ICC A;  2HTS A;  4CXF A;  3K2Z A;  4D0P A;  3GW2 A;  3G73 A;  1O3R A;  3R6S A;  2W25 A;  4L5J A;  5L3F A;  1HKQ A;  1O7F A;  4ZYH A;  2J5P A;  2DO7 A;  3Q9V A;  2V6C A;  2IA1 A;  2XKP A;  4KFC A;  2STW A;  2EFP A;  2EFO A;  1HXD A;  2M1B A;  4O6J A;  5E18 F;  3DFG A;  3P7N A;  5J6X A;  5E20 A;  1O7L A;  1Z7U A;  1ULY A;  2VT2 A;  6PAX A;  4BHB A;  3ECO A;  3TKY A;  4OMZ A;  1QNT A;  2FNA A;  4EV0 A;  4RS8 A;  4A5N A;  5L3C A;  2CFX A;  3TO7 A;  2KIM A;  1YW9 A;  4N0B A;  3R60 A;  5HDG A;  4A0X A;  3QPH A;  2ZXJ A;  1R5H A;  2FSW A;  1OYW A;  1Q1H A;  3ZMT A;  1VTN C;  3EET A;  2MLG A;  3CO6 C;  5BPD A;  4M73 A;  2VN2 A;  3RIR A;  2IP2 A;  3TO9 A;  2VBZ A;  4P55 A;  2ELH A;  2BBY A;  4U0Y A;  1ON1 A;  5LGN A;  3I59 A;  1HKS A;  1RZ4 A;  4M71 A;  2XAQ A;  1PP7 U;  3SXY A;  1UB9 A;  2ZJ2 A;  1KQ8 A;  3CO7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...