4G6DA

G1 orf67 / staphyloccus aureus sigmaa domain 4 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
62
structure length
62
Chain Sequence
MKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Promoter-specific transcription inhibition in Staphylococcus aureus by a phage protein.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Dna binding protein
molecule keywords RNA polymerase sigma factor rpoD
total genus 20
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4g6dA00
4A6EA 3GUDA 4LG0B 1ZG1A 1ZAOA 3E5UA 2EFOA 2NNNA 3H3UA 5HLGA 3GX4X 1FBSA 3ELKA 1S8NA 1SMTA 5LGTA 3JW4A 1HBXG 4Y15A 3VB2A 2Z9OA 3J81K 2FOKA 5JFRA 2WV0A 2FRHA 1R00A 2FNAA 5TJJA 5L3FA 3ZMTA 1ON1A 5DCMB 2JZYA 1KU9A 3MEXA 1EH8A 1IN5A 2GWRA 5DD4A 4JBAA 3EYYA 4M71A 2P8TA 1K7AA 1P4WA 4UVBA 3V8LA 2Y0MA 2VBXA 2EFPA 2OU2A 3GWZA 2XAQA 4YFKF 3ZPLA 4R8HA 5H20A 2Z33A 4JK1X 2M45A 2C6YA 2IRFG 3WTXC 5E8GA 1FBQA 1K78B 2AXLA 2EV6A 1G3YA 2XKPA 3HRSA 2HOEA 2L4MA 1GXPA 3PQJA 4M74A 3WE3A 5L3CA 2P6SA 3M1EA 3S2WA 2V9VA 4MTDA 1AOYA 5AONA 1IRGA 4EM2A 3GYHX 3SHFA 3BP8A 1IUYA 3PQKA 2H6BA 2CGPA 2RDPA 4HX8A 2O3FA 2R7FA 3I54A 1ZYRF 4KN7X 2VT3A 1HKTA 4YG2F 3J80Z 4XRFA 2EV0A 2TDXA 2PQ8A 3KP6A 1KU3A 4F7ZA 4KDPA 3QPHA 4CO8A 1R1TA 2EFNA 2UXNA 4HBLA 3E6BA 3L9FA 4KICA 3Q9SA 2VONA 3I58A 4XBFA 1BI3A 1T98A 3WTVC 2XAGA 4WXHA 3EYIA 1P2FA 4OIRF 2V1XA 3RPQA 2VOOA 1BIAA 4EJTA 1RNLA 4IF4A 2COMA 1E2XA 1NHAA 1IXSB 3FXQA 4I98B 1XSXA 1DP7P 3ZN0A 2W57A 2A69F 1Y0UA 1S7AA 1CF7B 4R1HA 5LRSA 5FLXK 4GCVA 2RGVA 4LMYA 3W6KB 1D8KA 4MNUA 1OYIA 2VE8A 4MQ9F 4PGGA 3HHGA 3K69A 5LGNA 4B09A 4JQFA 2WTEA 2K27A 1XDUA 3T5XA 3IL2A 2H27A 1QZYA 2F5DA 3K1PA 4AIJA 3K1NA 4Q47A 3T8TA 3TO6A 2QLZA 1MD0A 2O6GE 1IW7F 2HYFA 2L4AA 2ISYA 4EJWA 3JTGA 1AWCA 4U0VA 1FBUA 1MDMB 3GFMA 1ZARA 2LSOA 5DEQA 1K78A 3IHUA 3WTZA 4S04A 1J9IA 2ELHA 1LVAA 2A6EF 4I0AA 3MAJA 3F6VA 2ISZA 2MH9A 1JGSA 2YU3A 1BBYA 4M72A 1O57A 4Q5SF 3BJOA 4I0BA 3W6JB 3IRRA 4RGRA 1ZLKA 5FB2A 5LEKA 2FEZA 1R23A 1U8RA 1R5HA 2D1HA 2HQRA 3Q5FA 1STZA 2HZTA 1U78A 3O2PE 3H3ZA 4EQQA 1KYZA 1ZRDA 3D5LA 2XKOA 5BOXA 1KQ0A 3C3WA 3ZMSA 4HQEA 3FZVA 3HIFA 3H92A 2JT1A 5E20A 4LJZF 3C1DA 1TW2A 1J2XA 4KMUX 2XRNA 4Y13A 2ESHA 4KN4X 1XDSA 3DP7A 5LHIA 4EMSA 2GZWA 5D6FA 4ESFA 2CFXA 5BPDA 2O0YA 3VODA 1IN4A 3ABTA 4YFNF 5DDGA 1C0WA 1EH6A 1YW8A 1FPQA 4IRHA 4K2EA 2XAFA 5E1WA 4Z2YA 5JVTA 4XSXF 3WODF 4RS8A 5FO5A 3L2CA 3KLNA 1MDMA 1TQIA 1BN5A 3L09A 4ZYHA 5HDGA 3M8FA 1Z6TA 5BPIA 5E1XA 3BOQA 2JPBA 2QQBA 3O3KA 2FQ3A 5D4RA 5J6XA 4HX7A 1Z05A 2XHKA 4GGGA 3TO7A 5JHUA 5ERIA 1W7PD 5BS6A 1G6NA 3ABUA 3BJ6A 5L3BA 2PLYA 4KMFA 4U7DA 4M73A 1FZPB 1VTNC 1OPCA 4AIKA 2PFBA 3KP5A 5DD8A 2L01A 2F5EA 3WTWC 4CYDA 2HTSA 4FT8A 1RUOA 4OMYA 3NQOA 4BHBA 2NS0A 4YIFA 2ESNA 2J5OA 5HS9A 1RUNA 4L18B 4KIGA 1MJ9A 4I02A 1ODDA 2BBYA 4RB1A 1ON2A 1YLFA 2L3DA 3F23A 5CVUA 5CVJA 3I4PA 4RAZA 2KJCA 5A2QK 4MGRA 4G6QA 2FBKA 3HSFA 4NB5A 3QP6A 1L0OC 4I7HA 3CUOA 5DCFA 1YTYA 1O3QA 5IT9Z 1FY7A 2IT0A 2CQKA 1U6GA 2PEXA 2QZ8A 2OZ6A 2DTRA 3R61A 2DU9A 3ZMZA 1V4RA 4KIBA 3MZHA 4N9HA 3VEPA 3HTSB 5AIPA 2F5FA 1R5GA 5LHGA 2MLKA 4P5OA 3TOAA 2XAHA 1W7PA 2QQ9A 5FFZA 1MZBA 4EM0B 5JI6A 1FOKA 2K4JA 1FC3A 3F6OA 2ZNYA 3P9CA 3GXOA 4A5NA 3R6SA 3MWMA 1TBXA 4HX4A 2W84A 4GYIA 4WXCA 4MEXF 3C18A 3HOTA 3SFZA 5F1RA 4BNCA 4NHJA 3LWFA 4LLNA 2AS5F 3TOBA 3LA3A 3QAHA 1WKMA 2ZKZA 3BDDA 1J59A 3KEQA 4LK1F 3AAFA 2XUBA 4CZZA 1OMIA 2CWEA 2FBHA 1GXQA 1SD5A 3BROA 2J5PA 4AIHA 1HW1A 5TRDA 4CHUA 5LGUA 5BMZA 2VC0A 5E8IA 4O5VA 1U5TC 3QU3A 2ADUA 5HS7A 1MJAA 5E18F 2VC1A 3M8EA 3T0YA 1H9GA 1SFEA 3LAJA 2VODA 3F22A 2A61A 1BI1A 2M30A 2VXZA 3OV8A 3GO5A 3TQNA 4CICA 1PUEE 3I71A 3QOPA 4P9UA 4BYYA 3G3ZA 1MJBA 1S6LA 1W5TA 2L02A 2DW4A 1Z6RA 1ZH5A 1Q1HA 3VOEA 2M8EA 2O61A 1P4XA 4ASNA 3BZ6A 2VE9A 2OD5A 3ROUA 1YIOA 4M6YA 4ENJA 5ILSA 3FMRA 2RQPA 2VBYA 3PFIA 3BWGA 3O6BB 3KE2A 1HW2A 5HLIA 4G7ZF 2K02A 5ICGA 1FSHA 2EV5A 4G7HF 3CLOA 1KGSA 2B0LA 3ZP5A 2ACJA 3P9IA 3RKWA 2KIFA 3KP3A 2R7DA 4EJUA 3B02A 5ILUA 4CDGA 4HV6A 2MLGA 3JSOA 1LB2A 4EJVA 5FLXZ 5CVVA 1BOAA 2XROA 3FM3A 1U2WA 3QPTA 2A6HF 4FHTA 3REOA 1R36A 2PG4A 1XGMA 2RN7A 3K9TA 2DI3A 1TNTA 4A0ZA 1HSTA 3HRTA 2ZNZA 3E5QA 3DPLC 3F3XA 3MCZA 3ML6A 2JPCA 2GA2A 1JHHA 4G7OF 2H6CA 3CUQB 4IPAA 3ERED 2DO7A 1UFMA 1FLIA 1BC7C 2QBYA 4UV9A 4FX4A 2STWA 2ZXJA 3R0JA 5H6RA 4XLNF 1FP1D 4G6DA 2P7CB 4GXOA 2E7XA 2WC2A 5L3DA 3F8NA 1ZHFA 4UNOA 3ULQB 2LF7A 3IKVA 4RB0A 2KKOA 2RVCA 1REPC 2NRAC 4ENMA 2NAZA 4HLXA 1IAWA 2VOPA 5DUIA 3ECHA 2V79A 2KJBA 3V4GA 2KRFA 2HKXA 3TDUC 4EGYA 1XD7A 4BAYA 4Q48A 1TLHB 3WTYC 2IW5A 4G8XA 2DT5A 2ETHA 1E17A 3LA2A 1ZREA 1OYYA 4QLCU 5IT3A 2M5WA 1XCBA 2CW0F 2FSWA 2ZFWA 1J0RA 3HUGA 3FXUA 2OZUA 3I53A 1YFHA 2K86A 1HXDA 4XLPF 1PP7U 2LF8A 3M9AA 3HHHA 1JHFA 1MGTA 5CLSA 4OIOF 1WWXA 2V6CA 3GZ6A 4KFCA 3JAMK 1HQCA 2E1NA 3E6CC 2QENA 3F8CA 4O3MA 1K79A 3EUHA 1I1GA 1YW9A 1R1VA 4LLLA 3I0TA 1DUXC 3HYIA 2HGCA 2DBBA 1F4KA 2EJRA 4A6DA 4RB3C 1Z91A 3ZN1A 2HFHA 2ZMEA 2V1UA 4MTEA 1P92A 1K6OA 2ZBKA 5L3EA 1D5VA 3FF5A 3R60A 5FD5A 4EM1A 3RJPA 3MFKA 4HOBA 4E70A 2VN2A 2YSRA 1CF7A 4ZZLA 4UVCA 1Z9CA 1FWZA 3FM5A 1T0FA 2XV4S 3WTSC 3CO6C 3WU0A 2EK5A 4HDVA 2H94A 2DPUA 2CO5A 4L0YB 5D4SA 1O7FA 2D1VA 3GF2A 4MHGA 3GW2A 1XGOA 1XGSA 3MZYA 3QP5A 4HAMA 3QRFF 2MA3A 3TO9A 4HYEA 3EETA 1LDJA 2UXXA 1IN6A 2RC4A 4L5JA 2W25A 1HKQA 1QBJA 2Q0OA 4AWXB 5AIQA 2DFIA 2QYOA 5BQTA 1DPUA 3DEUA 4OINF 2QBYB 1J5YA 3U1DA 1XCVA 4L9VA 4IXAA 1UHMA 1SFXA 1IN7A 2PJPA 5K5QA 4G94A 2DPDA 2JRTA 2CG4A 1OYWA 3DKWA 3HSRA 5J8CA 1J75A 4OMZA 5CVRA 4BXUA 1G3SA 2CSOA 5F6FA 3Q9VA 4EJOA 4XSZF 1ONVA 3KZYA 2PI0A 5D5UB 2G9WA 2GQQA 1QNTA 3NRVA 5HDNA 3HOSA 4RGXA 5ICCA 1DPRA 1LNWA 2G7HA 3GFLA 4L9TA 5KVRA 2ZO4A 4LB5A 1B6AA 1GHCA 4RGSA 1YQAA 2MH2A 1Z7UA 4N0BA 3KFWX 4DQ2A 4CGZA 1BC8C 1IZ1A 5E17F 3F72A 2FBIA 2IA2A 3BPXA 3VFZA 4KIFA 2FMLA 4Y17A 1A04A 3CTAA 1QGPA 3KETA 2E1CA 1TQPA 3ZMVA 1WI9A 3SZPA 4A0XA 2GIVA 3C7JA 3KCCA 3E6DA 3EDPA 1SD6A 2NNYA 1QPMA 1KQ9A 4M9SA 1YO5C 4A2UA 4HV5A 3SXYA 3NEUA 2P5KA 5HOOA 4MEYF 1HSJA 3I59B 3N4MA 2HYGD 1U3EM 5HS8A 3IRQA 1HKSA 3HTUA 3FHZA 4HF0A 4G9YA 2EFWA 4P9FA 3RKXA 2K4BA 2LKPA 2NYXA 1WRJA 1IXRC 4PDKA 4RGUA 3U2RA 2PMHA 5HLHA 3WTTC 4U88A 1W4MA 1KU2A 2VBWA 2UWMA 5FFXA 1G3TA 1U5TB 2IA0A 1G4DA 2FXAA 1XB4A 1ZRFA 4WCGA 4L5IA 5LRRA 4BQAA 5ILVA 2X0LA 1IRFA 2W24A 1RIOH 1TQMA 4ZZDA 2P7VB 2OQRA 5KK1A 4ZYGA 3SZTA 5D8KB 2M1BA 4RB2C 4HQMA 4S05A 2BV6A 1T39A 1LDKB 1O3SA 4ESJA 1MKMA 1T2KA 1R7JA 3CJNA 1JXSA 1O7LA 3L7WA 3K0LA 4I09A 1FSEA 2ZMEB 2V1DA 2STTA 3SQNA 4BHCA 1XSVA 1T6SA 4HZFA 3LQQA 3BY6A 4ENKA 1LDDA 1J7KA 3D0SA 1S29A 2GA1A 4UV8A 3GEZA 5DUKA 2GXBA 2KIUA 1LEAA 3P7NA 2A5YB 4L9JA 4HA8A 4KA4A 2E7WA 2F5CA 2HTJA 2M87A 2FF4A 1LJ9A 1HW5A 1Z1DA 2BE5F 2BYVE 4PGHA 2EFQA 2FU4A 5JR3A 2DQRA 5D6EA 2YX7A 2XVCA 2EB7A 2HQNA 5D5XB 1B9NA 1W5SA 4PCQA 2D45A 3WGIA 5LEJA 1QZZA 2O03A 5K5OA 3WG9A 1BI2A 2DQLA 2DK5A 1UCRA 5D5VB 1TW3A 3IWZA 5LBQA 2XASA 2KIMA 3GVAA 4ENNA 5ICEA 2P6TA 4M9XA 4TV7A 5D5WB 2YX4A 4FX0A 4UXNA 3U9GA 3B73A 4UVAA 3EQLF 1GVJA 4A5MA 4MQVA 3HRUA 1F5TA 4I01A 4HF2A 4UUVA 3BJAA 1BIBA 1XMKA 5EEHA 3JSPA 2HDCA 2DLLA 2VBZA 4A12A 4UHTA 1BJAA 2W85A 1SFUA 1TNSA 3KZZA 3MQ0A 4QWQA 3FX3A 1QO0D 2GXGA 4LK0F 5HVQC 2PMUA 2IPQX 3CDHA 1LQ1A 2A3SA 4WXDA 5CYVA 5FD6A 3G73A 1IF1A 2XGXA 3J81Z 3I59A 3QU6A 2FNPA 1IXCA 3DF8A 4U7BA 2LDUA 3V8KA 1ZRCA 2Q2EA 1ZGAA 2R3SA 2QQAA 4AD9A 4GO1A 1SAXA 1H0MA 2Y48A 3L00A 4AVPA 1U5TA 4O6JA 4EGZA 4M9ZA 1WSUA 1ZN2A 5K1YA 1I1SA 2Z5UA 3RYRA 4LFUA 4NQWA 5LLQA 1W7PB 4A0YA 3T1BA 4Q4ZF 1F9NA 3WGGA 4EVIA 3IWFA 3R4KA 4L0ZB 3V7RA 1G3WA 4YFXF 2LNBA 2XIGA 4ETSA 5A2QZ 4I2OA 3GFJA 5IT9K 1DDNA 1JE8A 1USSA 1USTA 5DCMA 3RKYA 3E97A 4L9NA 2JSCA 4U0WA 3HSEA 4WF2A 3CO7C 1XGNA 1KU7A 3TDZC 3LSTA 3LAPA 5ED4A 2O8XA 3TGNA 1EV7A 2A07F 4ESBA 4IRGA 2OQGA 4IHSA 5LHHA 1KQ8A 4HLYA 1D3YA 2MBFA 2Z3YA 3ZQ7A 2BEOA 1YS6A 2MD5A 1FYMA 5DV5A 3E6MA 2L54A 3OOPA 2HR3A 4D0PA 1B9MA 5E1ZB 1SMYF 4IJAA 2HWVA 1H9TA 1YW7A 3KP4A 1FP2A 1S3JA 4OIQF 1SD4A 5L3GA 4WWCA 3FXRA 2QM3A 4ZH4F 1TTYA 2Y75A 3R0AA 4ON0A 1FNNA 1KA8A 1X3UA 3J80K 4WK8F 2XAJA 3DFGA 3RDIA 3E3VA 3DXJF 2OAZA 4HF1A 1YYVA 4YIIA 3RTRA 1RI7A 4IHTA 3TKYA 2K7LA 5CJ9A 1R22A 1I27A 2Z99A 2H09A 1PP8F 3I64A 2DK8A 3F8BA 4N9IA 2ZJ2A 3CUQC 5CVIA 4LB6B 2BGCA 2VT2A 1B4AA 2Q8KA 3FWEA 3GFIA 2YPRA 2PN6A 4KYWA 3HRMA 1WQ2A 4BHPA 4CXFA 5ICFA 3I5UA 2DAOA 4KT5C 4LG0A 2FE3A 2X4HA 1F1ZA 4PZJA 3P9KA 3K1MA 3F21A 1XSDA 1OR7A 3ZMUA 2EA2A 4P55A 4ZYEA 1ZG3A 4B8XA 1FYKA 2QWWA 1FT9A 4GYGA 5DYMA 1YG2A 1V3FA 2IA1A 3GZ5A 3FMQA 3K2ZA 4RAYA 4OOIA 2HS5A 1UHWA 2QUFA 3F8FA 2EA4A 2FA5A 1ZG5A 5J8FA 3FMSA 2P5LC 2P4WA 2MC3A 1PDNC 3RI4A 1O3RA 3T8RA 4M6XA 1OKRA 1P4AA 1BM9A 3E5XA 3COAC 3KP7A 3IC7A 1S7OA 4H0EA 3WU1B 1T38A 2IVMA 4LLGF 2HEOA 1B1BA 2G7UA 2P5VA 4KNYA 2GAUA 1UB9A 2ZCWA 2OBPA 3M7GA 3CUQA 3RPUA 5D8LB 1KYWA 3J7AO 2FMYA 4HW0A 4LD5A 4OIPF 3RYPA 2YR2A 4HDUA 3KEOA 1LEBA 2IJLA 3WTUC 2WWYA 3WGHA 1FYLA 3BPVA 3RIRA 4OU0A 5F64A 4P96A 3WE2A 3KLOA 1BI0A 6PAXA 3KP2A 3GLXA 5K5RA 3V7SA 1SD7A 1R58A 1FX7A 1ZGJA 2A68F 4KUMA 4R79A 3N97A 3JAMZ 3IKTA 2QVOA 3JTHA 3LFKA 1I5ZA 4LGWA 5HDKA 3ZMDA 2D2WA 3ISPA 1RZ4A 4EV0A 1IN8A 1XMAA 2IP2A 1B59A 3LQRA 3DQVC 1CGPA 2RV8A 1R1UA 2HKOA 2PBIA 2RKHA 2F2EA 1L3LA 1EH7A 1P6RA 2JTVA 1ZLJA 5FGMA 1XN7A 3LA7A 1QQIA 3ECOA 3DPTA 1D8JA 2UZKA 4DNCA 3F8MA 2CYYA 3V8JA 1YS7A 4IVNA 4IRIA 3DV8A 2OA4A 4BH9A 5H6QA 4WX9A 2RNJA 2EWNA 1ULYA 5EEGA 4ZYDA 3V7CA 4U0YA 1O3TA 1I6XA
chains in the Genus database with same CATH superfamily
3LSPA 3MKLA 3H5AA 4KT6A 3AL0C 4A6EA 2O9LA 3X2QH 1Z0XA 1I3QJ 3GUDA 3OYIA 4LG0B 2BHZA 2ELJA 1ZG1A 1ETWA 1ZAOA 2X48A 4OWRB 3H9GA 2X1CA 1SVLA 3E5UA 1LFUP 2EFOA 2R7SA 3FKJA 1P7JA 2NNNA 3H3UA 5HLGA 3GX4X 1V55H 1VQ5I 1FBSA 4CCNA 1W0TA 3ELKA 1S8NA 1UG2A 3RSNA 1SMTA 3S1MJ 2R7ZJ 9ANTA 3KPHA 5LGTA 3JW4A 4II3A 4CUGA 1HBXG 4Y15A 3VB2A 3MMYB 2Z9OA 1K4TA 3J81K 2FOKA 3M3YJ 1MBKA 5JFRA 1OR7C 3OYAA 2PX9A 2WV0A 2FRHA 3AFHA 1SFOJ 1R00A 1S5LC 2BY3A 2FNAA 5TJJA 4BY1J 3OYMA 2GBYA 3SDGA 5L3FA 4Y4RA 2X6YA 3ZMTA 2JA2A 1ON1A 5DCMB 2JZYA 3CMAI 1KU9A 3MEXA 1EH8A 1IN5A 2FOWA 2GWRA 5DD4A 4JBAA 3EYYA 2GOMA 2WADA 4M71A 2ZSIB 4M3GA 2P8TA 3CP8A 3JRCA 1K7AA 1P4WA 3DCFA 2MGQA 3H35A 4UVBA 3V8LA 1ZR2A 1IGNA 2EZKA 2Y0MA 3GBGA 2VBXA 2EFPA 4BUPA 2OU2A 3GWZA 2DOAA 2XAQA 3RCOA 4YFKF 3ZPLA 1MH4A 4R8HA 5H20A 2Z33A 4JK1X 3DTKA 2BXYA 2M45A 2XSJC 1G59A 2C6YA 2IRFG 3WTXC 3A2KA 1DU6A 1Y8RB 5E8GA 3HOVJ 1FBQA 2I5UA 1K78B 2AXLA 3HDDA 1Z3YA 4LITA 4Y33A 2EV6A 1G3YA 4BJTA 2XKPA 3HRSA 3BCBA 2W48A 2HOEA 2LKXA 3S3MA 2L4MA 1GXPA 3PQJA 1K83J 4M74A 3WE3A 5L3CA 1WGXA 2P6SA 2Y30A 5C4JJ 1TP4A 3M1EA 3S2WA 2V9VA 4MTDA 1AOYA 2JMWA 2JA5J 3U21A 4CYCB 3IH2A 5AONA 1IRGA 2ZB9A 4EM2A 1VQ7I 5H2FC 3GYHX 3SHFA 3H9QA 2K9SA 1T33A 5EEAA 3BP8A 4MO7A 3PQKA 2H6BA 1IUYA 3K4NA 2CQQA 2JRMA 2CGPA 2M8GX 2RDPA 4HX8A 3GTMJ 1UHSA 2O3FA 2R5ZB 4RA2A 2R7FA 1FMWA 2E5NA 3I54A 1FTZA 2IGNA 3DEEA 3VSKA 1ZYRF 1MSFC 2JUGA 3OOUA 4BXXJ 1HOMA 2XDVA 3AG1H 2WB1A 4KN7X 4B44A 2H1KA 1X19A 2VKEA 2VT3A 1ORKA 5KNLA 1HKTA 4YG2F 3J80Z 2XAUA 3ABKH 4XRFA 4B43A 2XSDC 2EV0A 2TDXA 1JKQC 3JRIA 4J01A 1Y8QB 2PQ8A 3KP6A 1KU3A 3OL4A 4BKXA 4F7ZA 3G4SI 3PIPF 4KDPA 4NC7A 3QPHA 1WJCA 2AHQA 4CO8A 1A6IA 1R1TA 2EFNA 2UXNA 4HBLA 3LSRA 1TL8A 4Z6YA 3E6BA 2XGCA 1A36A 4AYBN 3L9FA 1H89C 3K7AJ 5CPRB 3A1YA 4KICA 3Q9SA 2LBFB 5DM7F 2VONA 2RQQA 5IOZA 3I58A 4XBFA 1BI3A 1F43A 1X3ZB 1T98A 3WTVC 2XAGA 3W6VA 4WXHA 3EYIA 1P2FA 4OIRF 1AHDP 1RPWA 3K2AA 1HDDC 2V1XA 3RPQA 2VOOA 1BIAA 1QHGA 1B72B 4EJTA 1RNLA 4IF4A 2COMA 3JRBA 4E7KA 2CJJA 1E2XA 1NHAA 1IXSB 3FXQA 4I98B 1XSXA 3EPZA 1DP7P 1HCRA 2WV1A 5J40A 2W57A 3ZN0A 2A69F 1OCCH 2NVYJ 4UUTA 1Y0UA 2WAQN 1S7AA 1CF7B 1X1CA 1AKHB 2DFFA 2K3FA 1UELB 2QF7A 4R1HA 5LRSA 5FLXK 1RKTA 4BY7J 4GCVA 2NVTJ 2RGVA 4LMYA 1TWCJ 3W6KB 1D8KA 4HPQA 2QKMB 2HQ5A 1V5FA 2I8DA 4MNUA 1OYIA 2VE8A 4MQ9F 4PGGA 3HHGA 3K69A 4D7NA 1MSEC 5LGNA 2K85A 3VYTB 4B09A 4JQFA 3NARA 2DOFA 2WTEA 4D5CA 1B8IB 4M3DA 3NWSA 4XLAA 1JTXA 2K27A 1XDUA 1MMNA 2CUJA 3T5XA 3IL2A 2H27A 2HDDA 1QZYA 2F5DA 3K1PA 4NNJA 4AIJA 1S72I 3K1NA 1LVKA 4Q47A 1XS9A 3T8TA 1XMXA 3I56I 4ZDOA 3TO6A 2UUZA 2QLZA 1WFXA 1QU3A 3RKQA 1MD0A 2O6GE 1JKPC 1IW7F 1MMAA 2MW8A 3ABLH 2HYFA 1SANA 3VYRB 2L4AA 2ISYA 1G2HA 4EJWA 3JTGA 1T08B 1ACIA 2VKHA 1AWCA 2DA5A 4A3BJ 3ZQQA 4U0VA 3PJRA 2R0QC 1FBUA 3S2DJ 1MDMB 3GFMA 3BTLA 3E0JB 2FJ1A 1ZARA 2LSOA 5DEQA 5GAHJ 3IHUA 1K78A 3WTZA 3CQZJ 4S04A 4UY8I 2ELKA 1T8IA 5HLTA 1J9IA 2ELHA 1LVAA 2A6EF 3BTCA 5GTIC 3OIQA 4I0AA 1DGWY 1JUPA 2M7BA 2CW7A 3MAJA 3F6VA 2ISZA 2MH9A 3PM1A 1JGSA 3H9JA 2YU3A 1BBYA 3QPSA 3W2WA 1VQ9I 2W82A 3L2RA 2M2EA 2QCOA 4M72A 1O57A 1I39A 4Q5SF 3M07A 4RDUA 3UKGA 5C4XJ 3JRHA 3BJOA 3OL3A 4I0BA 3VPRA 4UB6C 3W6JB 3IRRA 4RGRA 1ZLKA 1VQ4I 5FB2A 5LEKA 2FEZA 1R23A 1U8RA 2VPRA 1R5HA 2EBIA 2D1HA 1XX5A 2HQRA 4PSXA 4QPOA 3Q5FA 1STZA 2HZTA 2B9SA 1U78A 4BDZA 3O2PE 5GP9A 3H3ZA 4XKVA 5DM6F 3BR1A 5B1BH 4EQQA 1KYZA 1ZRDA 2DDBA 3D5LA 1VNDA 2MC4A 2XKOA 5BOXA 1HLVA 1KQ0A 3C3WA 3HL2A 3ZMSA 4HQEA 2V7FA 3K70C 4XN3A 5FKOA 1SAUA 1R9TJ 3FZVA 4KJZA 2X6WA 1K4SA 3HIFA 3H92A 2JT1A 2DA3A 5E20A 4LJZF 3C1DA 1TW2A 5GTHC 2GOXB 1J2XA 4J00A 4KMUX 3KZIC 5E79C 2OJED 2XB5A 2XRNA 4Y13A 1WJFA 2AQEA 4L5EA 2ESHA 3O8GA 1XDSA 2PMZN 3DP7A 4KN4X 1OJLA 3CJQB 5LHIA 1D5YA 2KT0A 2NVXJ 4EMSA 2GZWA 2MFZA 5J1UA 2K5CA 3PIOF 5D6FA 4ESFA 5E3LA 3HB9A 2CFXA 5BPDA 2FUG2 2O0YA 2VL8A 5CQEA 3VODA 5CKTA 1IN4A 3ABTA 5J3LA 4YIRX 1YITI 4YFNF 5DDGA 4D7MA 1C0WA 1EH6A 4J19A 1D0ZA 4LG3A 4NDLA 1YIJI 2VKDA 2X6OA 1YW8A 3S15J 2HPIA 3C2HA 1FPQA 3VDXA 3GTOJ 1W1WE 1IRXA 3OIPA 4QTRA 4IRHA 4BBRJ 4K2EA 2XAFA 5GPCA 4NUBA 3HBLA 4RLFA 5E1WA 4Z2YA 1GDTA 5JVTA 4XSXF 2QKLB 3G71I 1ETQA 3WODF 1TC3C 4RS8A 5FO5A 3L2CA 3KLNA 2WBMA 1MDMA 3RQ4A 2VQLA 1TQIA 5JVGF 1BN5A 1EKEA 3L09A 4ZYHA 5HDGA 3M8FA 2CUFA 4KITB 5HODA 5B3SH 3CCJI 1Z6TA 3D5RC 5E1XA 5BPIA 3BOQA 1OCRH 2JPBA 2QQBA 3D5SC 3O3KA 4MLOA 3S1NJ 3CF5F 2FQ3A 3G1OA 5D4RA 4B48A 5J6XA 1ZGWA 4HX7A 1OQYA 1Z05A 2XHKA 2DT6A 4GGGA 3TO7A 2HPMA 1QPIA 5JHUA 2W7NA 5ERIA 2E1MB 4DBRA 1OISA 2NXNB 3BQYA 1W7PD 5BS6A 3DKYA 1G6NA 3ABUA 3BJ6A 5L3BA 4D1QA 2PLYA 2LKSA 1QVTA 4KMFA 4U7DA 4M73A 2R7RA 1VTNC 1FZPB 5EF6A 1OPCA 2PJRB 4AIKA 4PJJA 2PFBA 2OUMA 3KP5A 1JT6A 5B1AH 1D1BA 2OCCH 1IDYA 5DD8A 4YELA 2L01A 2F5EA 3WTWC 4A93J 1QVUA 3GTJJ 4CYDA 2HTSA 2F4MB 4FT8A 1RUOA 2R93J 2ZSHB 4OMYA 3NQOA 2CQ7A 4BHBA 2NS0A 3VSLA 1IV8A 1V5EA 4G12A 5J47A 4YIFA 2ESNA 2J5OA 2I10A 2E36A 4A3IJ 1A35A 3MN2A 4Y7NJ 5HS9A 3HC7A 1RUNA 1ETYA 4L18B 4KIGA 3SYTA 1MJ9A 4I02A 1N25A 1ODDA 2BBYA 4RB1A 1ON2A 1YLFA 2L3DA 3F23A 5CVUA 5CVJA 3DWLE 5EDNA 2OCEA 2W4SA 4DOZA 3I4PA 3OYHA 3H5NA 3PNTA 2XF5A 4RAZA 2EH3A 2KJCA 2FX0A 3K4MA 5A2QK 2ICWG 3H3VK 2KPMA 4MGRA 4G6QA 2FBKA 4LOCA 2MABA 2QA4I 3HSFA 4NB5A 3QP6A 1GV2A 1L0OC 1Y1VJ 1WZ2A 4I7HA 3SJMA 5EYRA 2DYSH 4D9JA 3CUOA 4FTHA 5DCFA 3LFUA 1K61A 2QEXI 1YTYA 3WHCA 4BDYA 1O3QA 5IT9Z 1FY7A 2IT0A 2CQKA 4BJ6C 1U6GA 3HM5A 2PEXA 2QZ8A 2R7XA 2OZ6A 2DTRA 3R61A 2DU9A 3ZMZA 1V4RA 2G0EA 2ZXWH 4KIBA 3MZHA 4N9HA 1WHUA 3VEPA 3HTSB 2EZIA 5AIPA 2F5FA 3G6EI 1R5GA 1DGRM 5FKLA 4CZCA 2KP6A 5LHGA 2MLKA 1QZEA 3CLQA 4P5OA 3TOAA 2XAHA 1TT5B 1W7PA 2QQ9A 5FFZA 3ZQIA 2R7QA 1MZBA 2R7WA 4EM0B 4XOPA 3BTIA 5JI6A 3AG3H 1MIJA 1RESA 3F0CA 1FOKA 2K4JA 1FC3A 2FD5A 3F6OA 3C2BA 5M5WJ 1XG1A 2ZNYA 2KZVA 2VI6A 2K3PA 1IDZA 2MG4A 3P9CA 1WCMJ 4B3XA 2BOLA 2K9MA 4V19K 3ASNH 3GXOA 4A5NA 3R6SA 2JN6A 1TBXA 3MWMA 4BS9A 4HX4A 2W84A 4IX7A 4GYIA 4WXCA 4MEXF 5K7FA 3C18A 4E7ZA 3HOTA 3CCEI 4BE0A 3SFZA 3CZ6A 5F1RA 4BNCA 4NHJA 1R4MB 3LWFA 1XPXA 2AS5F 4LLNA 3TOBA 3LA3A 3QAHA 1WKMA 2ZKZA 3BDDA 3QPLA 1J59A 3KEQA 4DJAA 2X1DA 1WJEA 1Y56A 2NS8A 1Y6IA 4LK1F 3AAFA 1JI8A 2XUBA 2ZC2A 1OMIA 2CWEA 4CZZA 1F36A 1TWAJ 2Y9ZA 1RRJA 2FBHA 4BBSJ 2UV1A 1GXQA 1SD5A 3LSMA 3BROA 4CA0A 1MMDA 2J5PA 2DA4A 2IS1A 4AIHA 1HW1A 2JJ7A 4ZYAA 5TRDA 4CHUA 1D1AA 5LGUA 5BMZA 2VC0A 5E8IA 4O5VA 1U5TC 3QU3A 2IXSA 4YRVA 2ADUA 2R7TA 5HS7A 1MJAA 1IRZA 4F91B 3GMEA 5K7ZA 5E18F 2L0KA 3IV5A 3CJRB 2VC1A 3M8EA 4A3EJ 3SDBA 4II2A 2DCEA 3T0YA 5EZGA 1H9GA 3CCMI 3PUBA 1ERDA 1SFEA 3LAJA 2WAEA 2VODA 3F22A 2A61A 4W97A 2BY1A 1SEUA 1BI1A 2JA6J 2M30A 2VXZA 3OV8A 1NG7A 3GO5A 2L9NA 4V2GA 1LFBA 3TQNA 4CICA 1PUEE 3I71A 3QOPA 4S0HB 4P9UA 3LSIA 1XC5A 1V5GA 2XGEA 1UMQA 2HVSA 4BYYA 2LREA 5E3MA 3FKIJ 4GRIA 2VJIA 4BU2A 3G3ZA 1MJBA 1S6LA 2OV7A 1W5TA 4AVZA 2L02A 3CC2I 2DW4A 5LD2C 1WJ5A 1Z6RA 1ZH5A 1Q1HA 4QSHA 4IEJA 1B8IA 1OLTA 2Y69H 2L9SA 3VOEA 1FEXA 4E7JA 2M8EA 2O61A 1LKXA 1WI3A 4ZJZA 3FIWA 1P4XA 4ASNA 4C3IJ 3BZ6A 2M0MA 2VE9A 2L7FP 2DA1A 2OD5A 5GAGJ 3HZJA 5IYDJ 3ROUA 1YX3A 2ECCA 1YIOA 1JGGA 4M6YA 4ENJA 5ILSA 3FMRA 2RQPA 2DMUA 2VBYA 2CUZA 2VASA 3PFIA 1BOBA 2CV2A 1DU0A 3BWGA 1MMGA 2XPVA 2BXZA 3A0HC 3O6BB 3KE2A 3A01B 3W2VA 4N4NB 1HW2A 5FKNA 2L7KA 5HLIA 4G7ZF 3GTKJ 4HRIA 3I4NJ 2K02A 5ICGA 1FSHA 3K4BA 2EV5A 4G7HF 1BW5A 1POGA 2CRGA 3CLOA 1KGSA 2B0LA 3ZP5A 4JX5A 2ACJA 3P9IA 3RKWA 1FJLA 1JT0A 2KIFA 4PJMA 3VWBA 4XKWA 3B6CA 2R7DA 3KP3A 4EJUA 3B02A 3ZCOA 5ILUA 1LE8A 5FKMA 4XICA 4CDGA 4KISA 2H8WA 4HV6A 2MLGA 4XKCA 1AA7A 2KZGA 3JSOA 3RZDJ 3CF2A 2BY2A 4X1EA 1LB2A 1FIAA 4EJVA 1ZR4A 1ZK8A 5FLXZ 5CVVA 2K40A 1BOAA 2XROA 3FM3A 1U2WA 3CMEI 3QPTA 1TT0A 4C3HJ 2A6HF 2KLOA 5JHFA 4XOTA 4FHTA 3REOA 3S2HJ 1R36A 2R4GA 2PG4A 3PUFA 5K7HA 2QSHX 1XGMA 2RN7A 2KDOA 3K9TA 2DI3A 4C30A 1JUMA 1TNTA 3HUGB 2DJIA 4A0ZA 1HSTA 3SEZA 3HRTA 2ZNZA 3E5QA 4LIVA 1U9OA 3DPLC 3F3XA 2R5YA 1EA3A 3S3NA 3MCZA 2V4JC 3ML6A 3H0DA 4B47A 3OSFA 4XR6A 1X58A 1DP3A 2JPCA 3L2VA 1VZ0A 2GA2A 5JLWA 1JHHA 4G7OF 1X2MA 3HPHA 3M1CA 2CS3A 2H6CA 3CUQB 4IPAA 3ERED 2DO7A 4EEFG 1UFMA 1FLIA 4DZPA 2Z2SB 4E6KG 1BC7C 2QBYA 4UV9A 4FX4A 2STWA 3HGGA 1V54H 2B7EA 2ZXJA 4FE4A 1LPQA 1RR7A 1E3PA 2JUCA 1PYVA 3FXMA 3R0JA 2DN0A 5H6RA 4XLNF 1FP1D 4B3AA 5IP7J 4G6DA 2HOTA 5F1JA 2P7CB 4PJLA 1FOYA 4GXOA 2E7XA 1MMSA 3CCVI 2WC2A 5L3DA 3S8PA 3CCLI 4BGDA 2CQXA 2E5ZA 3F8NA 2BW3B 1ZHFA 1Q1VA 4UNOA 1YRNA 1VFCA 1R5ID 3ULQB 3DU5A 2LF7A 5KCMA 3IKVA 4RB0A 2KKOA 2RVCA 1REPC 3H36A 1FOWA 3OR2C 4ENMA 2NRAC 2E2JJ 2NAZA 4HLXA 1IAWA 3DTEA 1X4OA 2AXTC 3OS0A 2VOPA 3S1RJ 5DUIA 3KX2A 4CCOA 4A3GJ 3ECHA 2V79A 2LY9A 5IPAA 2VJ5A 1T95A 2KJBA 3V4GA 4IHYA 2KRFA 2HKXA 3TDUC 4EGYA 1XD7A 4BAYA 4Q48A 3Q0VA 1Z77A 2XRLA 4B1RA 2LY1A 1YE9A 1TLHB 4N4OB 3WTYC 2IW5A 4G8XA 2DT5A 2ETHA 4EATA 1E17A 3TP0A 3LA2A 1ZREA 1OYYA 4QLCU 4RM2A 5IT3A 1RC9A 2M5WA 1W36C 1XCBA 2CW0F 2NVUB 4RAGA 4GFBA 4HNTA 2FSWA 2HVRA 2ZFWA 4A3MJ 1QA6A 1J0RA 3J7AY 3HUGA 3MD2A 3O8HA 1SVOA 3FXUA 5FKKA 2L7ZA 4A3KJ 2OZUA 3I53A 1D0XA 1YFHA 2K86A 2H8RA 1HXDA 4XLPF 3K10A 1PP7U 2LF8A 5C44J 4F93B 2PMZA 4XK4A 3TL4X 3M9AA 3ZOBA 1CQTA 3HHHA 1JHFA 1MGTA 5CLSA 3BG3A 4GDFA 4OIOF 3DBHB 1P9QC 1WWXA 2V6CA 3GZ6A 2R7UA 4KFCA 3JAMK 3ZRGA 4UUSB 1HQCA 1TWFJ 2VQCA 4C2TA 2E1NA 4IQ4A 3QODA 5HNHA 3E6CC 2QENA 3LSKA 3F8CA 2GLOA 4O3MA 1K79A 3EUHA 3AG2H 2TRTA 2JSPA 3OY9A 1I1GA 1YW9A 1R1VA 3E1SA 4LLLA 3I0TA 1DUXC 2R7VA 2K9QA 3Q0UA 2YU9J 3HYIA 4HNVA 2HGCA 5J4VA 2DBBA 4CCKA 2DT7B 2IBDA 1F4KA 4AIDA 2EJRA 4A6DA 2O8KA 4RB3C 1Z91A 3M8JA 3ZN1A 1HA8A 4BEHB 2HFHA 2ZMEA 2V1UA 4MTEA 3ZQHA 1NK3P 1P92A 2FQ4A 3K70D 1K6OA 2ZBKA 5L3EA 1D5VA 3FF5A 1FTTA 3R60A 5FD5A 4EM1A 3S32A 5FLMJ 3FXKA 4FISA 3S93A 4I6ZA 4C2UA 3RJPA 3MFKA 5E3NA 3AL0B 4HOBA 4E70A 3BTJA 2LD5A 1R6RA 2QQ8A 2VN2A 2YSRA 4PUSA 4M3FA 1CF7A 2HDWA 2HXOA 4ZZLA 1VQ6I 2K9LA 4F3QA 4A3DJ 3S14J 4UVCA 1Z9CA 1FWZA 2WAFA 3FM5A 1T0FA 3PO3J 1WJBA 2XV4S 3WTSC 3CO6C 3WU0A 5LFAA 2EK5A 3OSGA 3BZKA 1MNDA 3IP4B 1T0FC 3SEQA 3I4MJ 4HDVA 4BXFA 2H94A 4NQWB 2CO5A 2M3AA 5D4SA 2DPUA 4L0YB 1O7FA 2D1VA 1UJ8A 3GF2A 4MHGA 3GW2A 1XGOA 1XGSA 3MZYA 2OTJI 5M5YJ 4Y52J 2CFOA 3QP5A 4HAMA 4PFOA 2W00A 2LFBA 3QRFF 2MA3A 3TO9A 2BVLA 2A5WA 4HYEA 3EETA 1MNEA 3UNGC 2ID3A 2NOJB 2YUSA 1LDJA 4JX6A 2UXXA 1IN6A 4RM3A 3A01A 2RC4A 1ENHA 4L5JA 2W25A 4XLHA 3SFIA 1HKQA 4XMYA 4XN0A 3HOZJ 1QBJA 2Q0OA 2VPLA 1BL0A 3CCUI 2X1EA 1PUFA 3FBIB 4AWXB 2DA6A 2DFIA 3FBNB 5AIQA 2QYOA 5BQTA 1DPUA 2Y31A 2IGMA 3DEUA 1X1BA 4OINF 4XLFA 2QBYB 1J5YA 2KHMA 2R92J 3RQIA 4AUXA 1A31A 3S1QJ 3U1DA 3DLAA 3K6GA 3LMMA 2VJ4A 4RAFA 4V2FA 2P0WA 1XCVA 4L9VA 4IHVA 4IXAA 1UHMA 1SFXA 3FISA 3BQZA 1Y39A 3ABMH 1IN7A 3BR3A 2PJPA 5K5QA 3QWLA 1W5CC 4M3BA 2DXIA 3MVPA 3NAUA 4G94A 2JRTA 2DPDA 3J7YJ 1EF4A 1ZELA 2CG4A 1OYWA 3V42A 2KMUA 3OMYA 3DKWA 2LP0A 3HSRA 2WAQA 5J8CA 1J75A 3CESA 4OMZA 1IJWC 5CVRA 4BXUA 1G3SA 2V9PA 2CSOA 5F6FA 1GUUA 3Q9VA 4BQNA 3W3CA 3PFYA 4HEA2 1ZQ3P 4EJOA 4XSZF 4W1UA 1ONVA 3KZYA 4ANJA 2M9HA 2PI0A 4BL0B 5D5UB 2G9WA 1I50J 1MBFA 1WPKA 2GQQA 2M4KA 1QNTA 3NRVA 5HDNA 3HOSA 4E7SA 4RGXA 5ICCA 1DPRA 4IHWA 1LNWA 2G7HA 2OF7A 3GFLA 4L9TA 5KVRA 3JRFA 1IC8A 2YS9A 2ZO4A 4LB5A 3FXJA 1NK2P 3L2UA 1B6AA 1GHCA 1FOXA 4RGSA 1HDPA 4AYBA 1YQAA 2MH2A 1Z7UA 1MW7A 2QGUA 3OYKA 3ZXSA 4N0BA 1NH3A 3KFWX 1NG6A 4DQ2A 4CGZA 2LMDA 1BC8C 1IZ1A 5E17F 3F72A 4XRMA 4XONA 2BVMA 2FBIA 4DBQA 1YRNB 2IA2A 2L7MP 3BPXA 2R5ZA 2O7OA 3VFZA 5M3MJ 3CD6I 3G1MA 4KIFA 2HZDA 2FMLA 4Y17A 3BC8A 1A04A 5EG0A 2ECBA 2JA7J 3CTAA 1QGPA 3KETA 2E1CA 1I6HJ 1TQPA 3ZMVA 1WI9A 2XPUA 3CP2A 3SZPA 4A0XA 2GIVA 3C7JA 3I9V2 3KCCA 2LVSA 4XORA 3A02A 3DKXA 3A0BC 3E6DA 3EDPA 2ZXIA 1SD6A 2WB1N 2M34A 1VQPI 2CU7A 3DLLF 1X1PA 2DFEA 3A03A 2DTZA 4IOAF 2NNYA 2DA7A 1QPMA 4ZTJA 1KQ9A 1B72A 2E34A 3ONQA 2WY7Q 4M9SA 5M5XJ 3HGYA 2M7AA 3K4KA 1YO5C 3PL8A 4A2UA 2IGKA 3BR6A 4HV5A 4PJNA 3SXYA 3NEUA 2NS7A 3FXOA 2P5KA 1YOVB 5HOOA 2ID6A 3BG6A 4MEYF 1HSJA 2TCTA 1YJ9I 3I59B 4HSRA 3N4MA 4E7HA 3CDIA 2HYGD 3OYNA 2HU9A 1U3EM 5HS8A 3IRQA 2MSYA 1HKSA 1OCOH 3HTUA 2JK3A 3FHZA 1QHHD 4HF0A 4G9YA 1N78A 1SVMA 2EFWA 2CQNA 3GZNB 2EILH 2BY0A 4MIMA 4P9FA 3RKXA 5FROA 5E3OA 2K4BA 2CMPA 2IS2A 2LKPA 2NYXA 4XKBA 1WRJA 3G1LA 1IXRC 4PDKA 4RGUA 3U2RA 4BJ5C 2PMHA 2LRDA 5HLHA 3WTTC 4U88A 2E1MC 2L9RA 1W4MA 1KU2A 2VBWA 3LSGA 2F6CA 3HEFA 2HOAA 2UWMA 5FFXA 4H4KC 2Y0SN 4G6TB 2KFDA 1G3TA 2E35A 1U5TB 2IA0A 1G4DA 2FXAA 3GTLJ 1XB4A 2RREA 4DIQA 3AG4H 3D1NI 1ZRFA 4WCGA 2PJRA 4L5IA 3RPUD 4XM3A 5LRRA 4BQAA 3QQAA 4IOCF 5ILVA 2X0LA 4DYQA 3HOUJ 2E60A 3LSJA 5TISC 5F27A 1IRFA 4C3JJ 1MBJA 2W24A 1RIOH 1TQMA 2DYRH 4ZZDA 3BLYA 1Z3XA 2P7VB 2OQRA 4UUSA 5KK1A 2HVQA 3GCMA 1WJAA 3SZTA 2M1BA 2DA2A 5D8KB 4ZYGA 4RB2C 3PSIA 3PNVA 4HQMA 4S05A 1X1AA 2HQAA 2BV6A 2F48A 1T39A 1TWGJ 3B6AA 3KYDB 1LDKB 3HOXJ 1O3SA 2F4OB 4ESJA 1VQLI 1RETA 2V9KA 1MKMA 1T2KA 3ESWB 3S16J 2X51A 4I76A 1R7JA 3CJNA 5M3FJ 2QSGX 2CUEA 3LOCA 1JXSA 1O7LA 4OAYA 1MH3A 1X1DA 3L7WA 5EZHA 3K0LA 3BR5A 4DGWB 5C3EJ 4I09A 1FSEA 3PO2J 2XC7A 5F04A 3ZQCA 2DMNA 2ZMEB 2ME6A 2V1DA 4CH7A 2STTA 3SQNA 1GV5A 3EUAA 4MFDA 2E1OA 4BHCA 3CCQI 1XSVA 3ZGKA 1T6SA 3WU2C 4BEHA 2GXAA 3ZR8X 3TMOA 4HZFA 2VQGA 3LQQA 3BY6A 4FETA 4QIWN 1ZTRA 3BCAA 3G2BA 4ENKA 2DJNA 4F52A 3JREA 1LDDA 1J7KA 2EINH 3D0SA 2IGOA 3JCUC 1S29A 3L1PA 2ZJQF 4A3CJ 2GA1A 5B66C 2LY2A 3CMMA 4UV8A 5CQGA 1K6YA 3MKZA 2Q1ZB 1Z7LA 3CJTB 3GEZA 5DUKA 2GXBA 1ITYA 2K9NA 2KIUA 1N77A 3KIOA 1LEAA 2LBFA 3P7NA 1Y1WJ 2LLKA 2HNHA 2A5YB 2BW3A 4L9JA 4HA8A 3H1CA 4KA4A 2E7WA 2F5CA 2HTJA 2LOOA 2M87A 1IO2A 2FF4A 1LJ9A 5EJCA 3IAM2 1VQMI 3K4LA 5F0FA 2VQHA 4ABZA 1IG7A 1HW5A 3ZQGA 4PK4A 1Z1DA 2XPWA 2BE5F 2BYVE 2KIQA 5F08A 4DYCA 4PGHA 4CCLA 2EFQA 1MBGA 1BW6A 3HXLA 4Y3OA 2FU4A 1WH5A 5JR3A 2DQRA 2DFHA 5D6EA 2YX7A 2Y9YA 2XVCA 2H1LA 2EB7A 2HQNA 5D5XB 4M6VA 1B9NA 4LIUA 2JQ7A 1W5SA 4PCQA 2CW8A 2D45A 2GM4A 3WGIA 3HG9A 3QYBA 5LEJA 2EQRA 1XTAA 1QZZA 5J1RA 1FMVA 2O03A 4D5FA 2NVQJ 5K5OA 3WG9A 1BI2A 4F92B 2DQLA 4HNUA 2RAEA 2DK5A 3BG7A 1UCRA 1YX5A 5D5VB 2R7OA 4XIDA 1TW3A 1PJRA 4FCYA 2JA8J 3H5RA 2E2HJ 1VQ8I 1T56A 3IWZA 3K4JA 3BR2A 3LNQA 5LBQA 2IAIA 3P5JA 3BG9A 2XASA 3MZ8A 2KIMA 3GVAA 2LK2A 1YI2I 2DODA 2LR8A 3TW7A 4ENNA 1R71A 5ICEA 2P6TA 1JKRC 2A05A 1I3AA 4M9XA 3DU6A 4TV7A 5D5WB 2L2OA 2YX4A 4FX0A 4BE2A 2DMPA 4UXNA 3FDYA 3U9GA 3B73A 4UVAA 3EQLF 1GVJA 4XRSA 4A5MA 3ERMA 3OYFA 4MQVA 3HRUA 2LH9A 4I01A 1F5TA 1D1CA 3Q3SA 4HF2A 2JVGA 4UUVA 3BJAA 1BIBA 3VYSB 1XMKA 5EEHA 4C9YA 3JSPA 2HDCA 2DLLA 2IEKA 2VB6A 2VBZA 4ZDPA 4A12A 1PUFB 2XF7A 4UHTA 1BJAA 3OYCA 2W85A 3I3LA 1A6QA 1SFUA 1TNSA 3KZZA 3MQ0A 5KAFC 4QWQA 3FX3A 1QO0D 2GXGA 4LK0F 5HVQC 3OYEA 3JRGA 2PMUA 2IPQX 3CDHA 1LQ1A 2A3SA 4WXDA 5CYVA 4AU7A 5FD6A 1MBHA 3G73A 4E7LA 1IF1A 2HI3A 2BZTA 2XGXA 5FLVA 3J81Z 3OS1A 2V6EA 3I59A 3QU6A 2FNPA 1IXCA 3DF8A 4U7BA 2LDUA 3V8KA 1ZRCA 2Q2EA 2L9VA 3CCYA 4F55A 1BR4A 3L2WA 2KRHA 2Z16A 1ZGAA 2JVHA 2R3SA 2QQAA 5EG0B 4AD9A 4DZJA 4GO1A 3WG7H 2ZJRF 1SAXA 2LC2A 5F0CA 3FK7A 1H0MA 2Y48A 4ZTFA 3KYCB 3L00A 4AVPA 1VQOI 2X6XA 3H0GJ 1U5TA 1SC7A 1GLNA 4O6JA 4EGZA 4JOMA 4M9ZA 1WSUA 1ZN2A 3CCRI 1ETOA 5K1YA 1I1SA 1ETVA 1U9NA 3LL7A 3JR9A 2Z5UA 3RYRA 4LFUA 4NQWA 1PVEA 5LLQA 3JRAA 1W7PB 4A0YA 2P81A 3T1BA 4NC6A 3ZQLA 4Q4ZF 1F9NA 3RZOJ 4X0GA 1W36D 5TGTA 3WGGA 4EVIA 3IWFA 3R4KA 4ITVA 3I55I 2DDAA 1NTCA 4L0ZB 4YEJA 3V7RA 2R5YB 1G3WA 3VYUB 2LNBA 4YFXF 2CV0A 2XIGA 1QRYA 2ZFUA 3QYEA 5IOYA 4ETSA 5A2QZ 4I2OA 3OS2A 3GFJA 5IT9K 1DDNA 1JE8A 3GTQJ 1USSA 1USTA 5DCMA 3RKYA 3E97A 5J4YA 3N05A 2DMTA 2JSCA 4L9NA 4U0WA 2AQFA 3OYGA 1MNMC 1OCTC 3HSEA 4WF2A 3MKWB 3CO7C 1LUJB 2KDZA 1XGNA 1KU7A 1UZCA 3TDZC 3LSTA 2COBA 3LAPA 3EUHC 5ED4A 2O8XA 2V26A 3QOEA 1EV7A 3TGNA 3K4CA 2A07F 4BQOA 4ESBA 4IRGA 3BT9A 2OQGA 4IHSA 5LHHA 1YHQI 1KONA 1KQ8A 1JTYA 3JRDA 4HLYA 1TWHJ 1D3YA 2MBFA 4XNFA 1J09A 2Z3YA 4A3FJ 3ZQ7A 2BEOA 1YJNI 1YS6A 2MD5A 1FYMA 5DV5A 3E6MA 3SZGA 2L54A 4FASD 2XGDA 1A5JA 3OOPA 2HR3A 4P1WA 4D0PA 1B9MA 5E1ZB 3OWTA 1SMYF 1X2NA 2EPFA 2N8GA 4IJAA 2HWVA 3IAS2 1H9TA 4PSWA 1YW7A 1VF9A 2KQRA 3QYFA 3KP4A 5DTDA 1OCPA 3HOWJ 1FP2A 1S3JA 4OIQF 1SD4A 5L3GA 2XB0X 1VQKI 4WWCA 3FXRA 3PSFA 1KZHA 2QM3A 3OIOA 5BNGA 4ZH4F 4XL9A 1BR2A 1E3HA 1TTYA 3GTPJ 2Y75A 1IUFA 3KEYA 3TEDA 3R0AA 4ON0A 1FNNA 3AKZA 1KA8A 1X3UA 5IP6A 1GVDA 4B4CA 3J80K 2GIZA 4FE7A 4WK8F 1O4XA 2XAJA 5FJ8J 1JUSA 1FIPA 1JJ6C 2F4IA 3DFGA 1N75A 3RDIA 3E3VA 5FRMA 3A4CA 3DXJF 2OAZA 4HF1A 2OC6A 1E0EA 1YYVA 4YIIA 1W0UA 3BG5A 2MD0A 3RTRA 4UB8C 3CCSI 4ZC3A 2ZMEC 2VIXA 2MYSA 3BR0A 4A3LJ 1RI7A 4JYKA 4ZDLA 2IS6A 3PNYA 5IY5H 2EZLA 4IHTA 1ETKA 2VXDA 3TKYA 2K7LA 5CJ9A 1WJDA 1R22A 3OYDA 2M0CA 2KISA 1I27A 2Z99A 4IL6C 3OYJA 2H09A 1PP8F 1BJZA 2EIMH 1GT0C 3I64A 1OCZH 2DK8A 4U87A 4I99C 3F8BA 4N9IA 3DBRB 2ZJ2A 3CUQC 4OAZA 2RNGA 5CVIA 1UG0A 4LB6B 4XRSG 2BGCA 2VT2A 4JX4A 4NBQA 3ZQFA 3HPGA 4BACA 1B4AA 2Q8KA 3FWEA 4IO9F 1R4NB 2L5QA 3GFIA 2YPRA 2OPTA 1WVRA 2PN6A 4KYWA 2VLAA 3CC4I 3HRMA 1WQ2A 4BHPA 3F9KA 4BE1A 3CDLA 3ASOH 3IH4A 5DS9A 4CXFA 2F5VA 1X4PA 5ICFA 3I5UA 2DAOA 4E7IA 2QSFX 4KT5C 5GPAA 4LG0A 2FE3A 2X4HA 1F1ZA 4MFEA 1AKHA 4PZJA 3EUKL 5IP9J 3P9KA 2WA0A 3K1MA 3F21A 1H8AC 1XSDA 1OR7A 3ZMUA 1DQUA 2EA2A 5KHDA 3U1KA 3L2QA 4P55A 3TP3A 1JKOC 4RLQA 4ZYEA 5EGOA 1VI0A 1ZG3A 4B8XA 4CCJA 3TBIA 1FYKA 2QWWA 4A69C 1FT9A 4GYGA 3HOYJ 4X6AJ 5DYMA 1YG2A 1V3FA 2IA1A 4AC0A 3GZ5A 2BHYA 3FMQA 2Z1DA 1WH7A 3K2ZA 4RAYA 4XQFA 4OOIA 4HG2A 2HS5A 1UHWA 1HC8A 3UR3C 2QUFA 1Z21A 3F8FA 1RKWA 1APLC 2EA4A 2FA5A 4RBOA 1ZG5A 4E4HA 4FQGA 5GADJ 5GAEJ 5J8FA 5FRNA 2HXIA 3FMSA 3W2AA 2P5LC 2P4WA 2MC3A 5J1YA 1X3WB 1PDNC 2HYJA 3RI4A 1O3RA 3T8RA 4M6XA 1OKRA 1P4AA 3DTIA 2LYCA 1P7IA 1BM9A 3E5XA 3COAC 2ZXHA 4A3JJ 2LG4A 2A6TA 3FK6A 1E3OC 5IYCJ 4IZZA 3KP7A 3IC7A 1HF0A 1S7OA 4JP0A 5EGOB 1TZLA 4H0EA 3WU1B 1T38A 1AU7A 2JWTA 1EJ9A 2M4GA 2KL4A 4IKFA 1ETXA 2IVMA 3HJEA 4LLGF 3KYLA 2Q2EB 2HEOA 2IS4A 2AO9A 2Y0SA 2VUMJ 1B1BA 3HKZA 1OFCX 1UAAA 2G7UA 3DEWA 2P5VA 4KNYA 4IQJA 3E7LA 2DMQA 2VKVA 2GAUA 1UB9A 2ZCWA 2OBPA 1H88C 1Z67A 3M7GA 1BR1A 3CUQA 3RPUA 3TW6A 1KYWA 2V1NA 5D8LB 3J7AO 4CYCA 3GLLA 3OYLA 4QPQA 1S7EA 2FMYA 3CC7I 4HW0A 4LD5A 4OIPF 3RYPA 4NC8A 5F0HA 3FHNA 2YR2A 4HDUA 1RR8C 2Y2ZA 3KEOA 3BZCA 1BA5A 5IYBJ 1LEBA 2IJLA 2XF6A 3IUOA 3IH3A 3WTUC 3WGHA 2WWYA 2E71A 1M1EB 1FYLA 4M3EA 3BPVA 3RIRA 2NOGA 4OU0A 1U8BA 5F64A 2D5VA 4P96A 2X9DA 3WE2A 2E2IJ 3GTGJ 2EZHA 3KLOA 1BI0A 4XLEA 2CV1A 6PAXA 3KP2A 3GLXA 3NWTA 3OYBA 5K5RA 2LTPA 3M4OJ 3V7SA 4XLCA 1SD7A 1R58A 1LE8B 4PJ0C 1FX7A 1ZGJA 2A68F 4KUMA 4R79A 2KRCA 3FXLA 2OTLI 2W1OA 4BQQA 2B63J 4CSWA 5KAIC 4DYRA 3N97A 3J7ZI 3JAMZ 1U0JA 3IKTA 2QVOA 3JTHA 4C2MJ 1VQNI 3LFKA 1I5ZA 4LGWA 3WHBA 4DW6A 5HDKA 1D0YA 3C2GA 3ZMDA 1LFPA 2D2WA 4AM3A 3ISPA 4CCMA 1RZ4A 4EV0A 1IN8A 1XMAA 2IP2A 4PFPA 1B59A 1S9HA 3LQRA 3DQVC 5B5EC 3S3OA 1CGPA 3HKZN 2RV8A 1R1UA 2HKOA 2PBIA 2RKHA 2F2EA 4IHXA 2HOSA 1L3LA 1EH7A 1P6RA 1SFKA 2ME0A 2JTVA 5JLXA 1ZLJA 5FGMA 3Q0WA 1XN7A 3LA7A 2ZJPF 1QQIA 1G8XA 2DOEA 3ECOA 3DPTA 4RMNA 3DBLB 1D8JA 2O5RA 2X85A 2EIJH 5HNFA 2UZKA 1ZKGA 4DNCA 3F8MA 2CYYA 3V8JA 1YJWI 3DPUA 1YS7A 4IVNA 4IRIA 3MKYB 3DV8A 2EIKH 2OA4A 3LSHA 1JJ8C 3S17J 3CMYA 2VJJA 4BH9A 5H6QA 4WX9A 2RNJA 2EWNA 1ULYA 1Y0NA 5EEGA 1R49A 2WY8Q 4ZYDA 2E19A 2CH0A 3OR1C 3V7CA 1MBEA 4U0YA 4HSTA 1O3TA 1IV6A 1I6XA
chains in the Genus database with same CATH topology
4A6EA 3GUDA 4LG0B 1ZG1A 1ZAOA 3E5UA 2EFOA 2NNNA 3H3UA 5HLGA 3GX4X 1FBSA 3ELKA 1S8NA 1SMTA 5LGTA 3JW4A 1HBXG 4Y15A 3VB2A 2Z9OA 3J81K 2FOKA 5JFRA 2WV0A 2FRHA 1R00A 2FNAA 5TJJA 5L3FA 3ZMTA 1ON1A 5DCMB 2JZYA 1KU9A 3MEXA 1EH8A 1IN5A 2GWRA 5DD4A 4JBAA 3EYYA 4M71A 2P8TA 1K7AA 1P4WA 4UVBA 3V8LA 2Y0MA 2VBXA 2EFPA 2OU2A 3GWZA 2XAQA 4YFKF 3ZPLA 4R8HA 5H20A 2Z33A 4JK1X 2M45A 2C6YA 2IRFG 3WTXC 5E8GA 1FBQA 1K78B 2AXLA 2EV6A 1G3YA 2XKPA 3HRSA 2HOEA 2L4MA 1GXPA 3PQJA 4M74A 3WE3A 5L3CA 2P6SA 3M1EA 3S2WA 2V9VA 4MTDA 1AOYA 5AONA 1IRGA 4EM2A 3GYHX 3SHFA 3BP8A 1IUYA 3PQKA 2H6BA 2CGPA 2RDPA 4HX8A 2O3FA 2R7FA 3I54A 1ZYRF 4KN7X 2VT3A 1HKTA 4YG2F 3J80Z 4XRFA 2EV0A 2TDXA 2PQ8A 3KP6A 1KU3A 4F7ZA 4KDPA 3QPHA 4CO8A 1R1TA 2EFNA 2UXNA 4HBLA 3E6BA 3L9FA 4KICA 3Q9SA 2VONA 3I58A 4XBFA 1BI3A 1T98A 3WTVC 2XAGA 4WXHA 3EYIA 1P2FA 4OIRF 2V1XA 3RPQA 2VOOA 1BIAA 4EJTA 1RNLA 4IF4A 2COMA 1E2XA 1NHAA 1IXSB 3FXQA 4I98B 1XSXA 1DP7P 3ZN0A 2W57A 2A69F 1Y0UA 1S7AA 1CF7B 4R1HA 5LRSA 5FLXK 4GCVA 2RGVA 4LMYA 3W6KB 1D8KA 4MNUA 1OYIA 2VE8A 4MQ9F 4PGGA 3HHGA 3K69A 5LGNA 4B09A 4JQFA 2WTEA 2K27A 1XDUA 3T5XA 3IL2A 2H27A 1QZYA 2F5DA 3K1PA 4AIJA 3K1NA 4Q47A 3T8TA 3TO6A 2QLZA 1MD0A 2O6GE 1IW7F 2HYFA 2L4AA 2ISYA 4EJWA 3JTGA 1AWCA 4U0VA 1FBUA 1MDMB 3GFMA 1ZARA 2LSOA 5DEQA 1K78A 3IHUA 3WTZA 4S04A 1J9IA 2ELHA 1LVAA 2A6EF 4I0AA 3MAJA 3F6VA 2ISZA 2MH9A 1JGSA 2YU3A 1BBYA 4M72A 1O57A 4Q5SF 3BJOA 4I0BA 3W6JB 3IRRA 4RGRA 1ZLKA 5FB2A 5LEKA 2FEZA 1R23A 1U8RA 1R5HA 2D1HA 2HQRA 3Q5FA 1STZA 2HZTA 1U78A 3O2PE 3H3ZA 4EQQA 1KYZA 1ZRDA 3D5LA 2XKOA 5BOXA 1KQ0A 3C3WA 3ZMSA 4HQEA 3FZVA 3HIFA 3H92A 2JT1A 5E20A 4LJZF 3C1DA 1TW2A 1J2XA 4KMUX 2XRNA 4Y13A 2ESHA 4KN4X 1XDSA 3DP7A 5LHIA 4EMSA 2GZWA 5D6FA 4ESFA 2CFXA 5BPDA 2O0YA 3VODA 1IN4A 3ABTA 4YFNF 5DDGA 1C0WA 1EH6A 1YW8A 1FPQA 4IRHA 4K2EA 2XAFA 5E1WA 4Z2YA 5JVTA 4XSXF 3WODF 4RS8A 5FO5A 3L2CA 3KLNA 1MDMA 1TQIA 1BN5A 3L09A 4ZYHA 5HDGA 3M8FA 1Z6TA 5BPIA 5E1XA 3BOQA 2JPBA 2QQBA 3O3KA 2FQ3A 5D4RA 5J6XA 4HX7A 1Z05A 2XHKA 4GGGA 3TO7A 5JHUA 5ERIA 1W7PD 5BS6A 1G6NA 3ABUA 3BJ6A 5L3BA 2PLYA 4KMFA 4U7DA 4M73A 1FZPB 1VTNC 1OPCA 4AIKA 2PFBA 3KP5A 5DD8A 2L01A 2F5EA 3WTWC 4CYDA 2HTSA 4FT8A 1RUOA 4OMYA 3NQOA 4BHBA 2NS0A 4YIFA 2ESNA 2J5OA 5HS9A 1RUNA 4L18B 4KIGA 1MJ9A 4I02A 1ODDA 2BBYA 4RB1A 1ON2A 1YLFA 2L3DA 3F23A 5CVUA 5CVJA 3I4PA 4RAZA 2KJCA 5A2QK 4MGRA 4G6QA 2FBKA 3HSFA 4NB5A 3QP6A 1L0OC 4I7HA 3CUOA 5DCFA 1YTYA 1O3QA 5IT9Z 1FY7A 2IT0A 2CQKA 1U6GA 2PEXA 2QZ8A 2OZ6A 2DTRA 3R61A 2DU9A 3ZMZA 1V4RA 4KIBA 3MZHA 4N9HA 3VEPA 3HTSB 5AIPA 2F5FA 1R5GA 5LHGA 2MLKA 4P5OA 3TOAA 2XAHA 1W7PA 2QQ9A 5FFZA 1MZBA 4EM0B 5JI6A 1FOKA 2K4JA 1FC3A 3F6OA 2ZNYA 3P9CA 3GXOA 4A5NA 3R6SA 3MWMA 1TBXA 4HX4A 2W84A 4GYIA 4WXCA 4MEXF 3C18A 3HOTA 3SFZA 5F1RA 4BNCA 4NHJA 3LWFA 4LLNA 2AS5F 3TOBA 3LA3A 3QAHA 1WKMA 2ZKZA 3BDDA 1J59A 3KEQA 4LK1F 3AAFA 2XUBA 4CZZA 1OMIA 2CWEA 2FBHA 1GXQA 1SD5A 3BROA 2J5PA 4AIHA 1HW1A 5TRDA 4CHUA 5LGUA 5BMZA 2VC0A 5E8IA 4O5VA 1U5TC 3QU3A 2ADUA 5HS7A 1MJAA 5E18F 2VC1A 3M8EA 3T0YA 1H9GA 1SFEA 3LAJA 2VODA 3F22A 2A61A 1BI1A 2M30A 2VXZA 3OV8A 3GO5A 3TQNA 4CICA 1PUEE 3I71A 3QOPA 4P9UA 4BYYA 3G3ZA 1MJBA 1S6LA 1W5TA 2L02A 2DW4A 1Z6RA 1ZH5A 1Q1HA 3VOEA 2M8EA 2O61A 1P4XA 4ASNA 3BZ6A 2VE9A 2OD5A 3ROUA 1YIOA 4M6YA 4ENJA 5ILSA 3FMRA 2RQPA 2VBYA 3PFIA 3BWGA 3O6BB 3KE2A 1HW2A 5HLIA 4G7ZF 2K02A 5ICGA 1FSHA 2EV5A 4G7HF 3CLOA 1KGSA 2B0LA 3ZP5A 2ACJA 3P9IA 3RKWA 2KIFA 3KP3A 2R7DA 4EJUA 3B02A 5ILUA 4CDGA 4HV6A 2MLGA 3JSOA 1LB2A 4EJVA 5FLXZ 5CVVA 1BOAA 2XROA 3FM3A 1U2WA 3QPTA 2A6HF 4FHTA 3REOA 1R36A 2PG4A 1XGMA 2RN7A 3K9TA 2DI3A 1TNTA 4A0ZA 1HSTA 3HRTA 2ZNZA 3E5QA 3DPLC 3F3XA 3MCZA 3ML6A 2JPCA 2GA2A 1JHHA 4G7OF 2H6CA 3CUQB 4IPAA 3ERED 2DO7A 1UFMA 1FLIA 1BC7C 2QBYA 4UV9A 4FX4A 2STWA 2ZXJA 3R0JA 5H6RA 4XLNF 1FP1D 4G6DA 2P7CB 4GXOA 2E7XA 2WC2A 5L3DA 3F8NA 1ZHFA 4UNOA 3ULQB 2LF7A 3IKVA 4RB0A 2KKOA 2RVCA 1REPC 2NRAC 4ENMA 2NAZA 4HLXA 1IAWA 2VOPA 5DUIA 3ECHA 2V79A 2KJBA 3V4GA 2KRFA 2HKXA 3TDUC 4EGYA 1XD7A 4BAYA 4Q48A 1TLHB 3WTYC 2IW5A 4G8XA 2DT5A 2ETHA 1E17A 3LA2A 1ZREA 1OYYA 4QLCU 5IT3A 2M5WA 1XCBA 2CW0F 2FSWA 2ZFWA 1J0RA 3HUGA 3FXUA 2OZUA 3I53A 1YFHA 2K86A 1HXDA 4XLPF 1PP7U 2LF8A 3M9AA 3HHHA 1JHFA 1MGTA 5CLSA 4OIOF 1WWXA 2V6CA 3GZ6A 4KFCA 3JAMK 1HQCA 2E1NA 3E6CC 2QENA 3F8CA 4O3MA 1K79A 3EUHA 1I1GA 1YW9A 1R1VA 4LLLA 3I0TA 1DUXC 3HYIA 2HGCA 2DBBA 1F4KA 2EJRA 4A6DA 4RB3C 1Z91A 3ZN1A 2HFHA 2ZMEA 2V1UA 4MTEA 1P92A 1K6OA 2ZBKA 5L3EA 1D5VA 3FF5A 3R60A 5FD5A 4EM1A 3RJPA 3MFKA 4HOBA 4E70A 2VN2A 2YSRA 1CF7A 4ZZLA 4UVCA 1Z9CA 1FWZA 3FM5A 1T0FA 2XV4S 3WTSC 3CO6C 3WU0A 2EK5A 4HDVA 2H94A 2DPUA 2CO5A 4L0YB 5D4SA 1O7FA 2D1VA 3GF2A 4MHGA 3GW2A 1XGOA 1XGSA 3MZYA 3QP5A 4HAMA 3QRFF 2MA3A 3TO9A 4HYEA 3EETA 1LDJA 2UXXA 1IN6A 2RC4A 4L5JA 2W25A 1HKQA 1QBJA 2Q0OA 4AWXB 5AIQA 2DFIA 2QYOA 5BQTA 1DPUA 3DEUA 4OINF 2QBYB 1J5YA 3U1DA 1XCVA 4L9VA 4IXAA 1UHMA 1SFXA 1IN7A 2PJPA 5K5QA 4G94A 2DPDA 2JRTA 2CG4A 1OYWA 3DKWA 3HSRA 5J8CA 1J75A 4OMZA 5CVRA 4BXUA 1G3SA 2CSOA 5F6FA 3Q9VA 4EJOA 4XSZF 1ONVA 3KZYA 2PI0A 5D5UB 2G9WA 2GQQA 1QNTA 3NRVA 5HDNA 3HOSA 4RGXA 5ICCA 1DPRA 1LNWA 2G7HA 3GFLA 4L9TA 5KVRA 2ZO4A 4LB5A 1B6AA 1GHCA 4RGSA 1YQAA 2MH2A 1Z7UA 4N0BA 3KFWX 4DQ2A 4CGZA 1BC8C 1IZ1A 5E17F 3F72A 2FBIA 2IA2A 3BPXA 3VFZA 4KIFA 2FMLA 4Y17A 1A04A 3CTAA 1QGPA 3KETA 2E1CA 1TQPA 3ZMVA 1WI9A 3SZPA 4A0XA 2GIVA 3C7JA 3KCCA 3E6DA 3EDPA 1SD6A 2NNYA 1QPMA 1KQ9A 4M9SA 1YO5C 4A2UA 4HV5A 3SXYA 3NEUA 2P5KA 5HOOA 4MEYF 1HSJA 3I59B 3N4MA 2HYGD 1U3EM 5HS8A 3IRQA 1HKSA 3HTUA 3FHZA 4HF0A 4G9YA 2EFWA 4P9FA 3RKXA 2K4BA 2LKPA 2NYXA 1WRJA 1IXRC 4PDKA 4RGUA 3U2RA 2PMHA 5HLHA 3WTTC 4U88A 1W4MA 1KU2A 2VBWA 2UWMA 5FFXA 1G3TA 1U5TB 2IA0A 1G4DA 2FXAA 1XB4A 1ZRFA 4WCGA 4L5IA 5LRRA 4BQAA 5ILVA 2X0LA 1IRFA 2W24A 1RIOH 1TQMA 4ZZDA 2P7VB 2OQRA 5KK1A 4ZYGA 3SZTA 5D8KB 2M1BA 4RB2C 4HQMA 4S05A 2BV6A 1T39A 1LDKB 1O3SA 4ESJA 1MKMA 1T2KA 1R7JA 3CJNA 1JXSA 1O7LA 3L7WA 3K0LA 4I09A 1FSEA 2ZMEB 2V1DA 2STTA 3SQNA 4BHCA 1XSVA 1T6SA 4HZFA 3LQQA 3BY6A 4ENKA 1LDDA 1J7KA 3D0SA 1S29A 2GA1A 4UV8A 3GEZA 5DUKA 2GXBA 2KIUA 1LEAA 3P7NA 2A5YB 4L9JA 4HA8A 4KA4A 2E7WA 2F5CA 2HTJA 2M87A 2FF4A 1LJ9A 1HW5A 1Z1DA 2BE5F 2BYVE 4PGHA 2EFQA 2FU4A 5JR3A 2DQRA 5D6EA 2YX7A 2XVCA 2EB7A 2HQNA 5D5XB 1B9NA 1W5SA 4PCQA 2D45A 3WGIA 5LEJA 1QZZA 2O03A 5K5OA 3WG9A 1BI2A 2DQLA 2DK5A 1UCRA 5D5VB 1TW3A 3IWZA 5LBQA 2XASA 2KIMA 3GVAA 4ENNA 5ICEA 2P6TA 4M9XA 4TV7A 5D5WB 2YX4A 4FX0A 4UXNA 3U9GA 3B73A 4UVAA 3EQLF 1GVJA 4A5MA 4MQVA 3HRUA 1F5TA 4I01A 4HF2A 4UUVA 3BJAA 1BIBA 1XMKA 5EEHA 3JSPA 2HDCA 2DLLA 2VBZA 4A12A 4UHTA 1BJAA 2W85A 1SFUA 1TNSA 3KZZA 3MQ0A 4QWQA 3FX3A 1QO0D 2GXGA 4LK0F 5HVQC 2PMUA 2IPQX 3CDHA 1LQ1A 2A3SA 4WXDA 5CYVA 5FD6A 3G73A 1IF1A 2XGXA 3J81Z 3I59A 3QU6A 2FNPA 1IXCA 3DF8A 4U7BA 2LDUA 3V8KA 1ZRCA 2Q2EA 1ZGAA 2R3SA 2QQAA 4AD9A 4GO1A 1SAXA 1H0MA 2Y48A 3L00A 4AVPA 1U5TA 4O6JA 4EGZA 4M9ZA 1WSUA 1ZN2A 5K1YA 1I1SA 2Z5UA 3RYRA 4LFUA 4NQWA 5LLQA 1W7PB 4A0YA 3T1BA 4Q4ZF 1F9NA 3WGGA 4EVIA 3IWFA 3R4KA 4L0ZB 3V7RA 1G3WA 4YFXF 2LNBA 2XIGA 4ETSA 5A2QZ 4I2OA 3GFJA 5IT9K 1DDNA 1JE8A 1USSA 1USTA 5DCMA 3RKYA 3E97A 4L9NA 2JSCA 4U0WA 3HSEA 4WF2A 3CO7C 1XGNA 1KU7A 3TDZC 3LSTA 3LAPA 5ED4A 2O8XA 3TGNA 1EV7A 2A07F 4ESBA 4IRGA 2OQGA 4IHSA 5LHHA 1KQ8A 4HLYA 1D3YA 2MBFA 2Z3YA 3ZQ7A 2BEOA 1YS6A 2MD5A 1FYMA 5DV5A 3E6MA 2L54A 3OOPA 2HR3A 4D0PA 1B9MA 5E1ZB 1SMYF 4IJAA 2HWVA 1H9TA 1YW7A 3KP4A 1FP2A 1S3JA 4OIQF 1SD4A 5L3GA 4WWCA 3FXRA 2QM3A 4ZH4F 1TTYA 2Y75A 3R0AA 4ON0A 1FNNA 1KA8A 1X3UA 3J80K 4WK8F 2XAJA 3DFGA 3RDIA 3E3VA 3DXJF 2OAZA 4HF1A 1YYVA 4YIIA 3RTRA 1RI7A 4IHTA 3TKYA 2K7LA 5CJ9A 1R22A 1I27A 2Z99A 2H09A 1PP8F 3I64A 2DK8A 3F8BA 4N9IA 2ZJ2A 3CUQC 5CVIA 4LB6B 2BGCA 2VT2A 1B4AA 2Q8KA 3FWEA 3GFIA 2YPRA 2PN6A 4KYWA 3HRMA 1WQ2A 4BHPA 4CXFA 5ICFA 3I5UA 2DAOA 4KT5C 4LG0A 2FE3A 2X4HA 1F1ZA 4PZJA 3P9KA 3K1MA 3F21A 1XSDA 1OR7A 3ZMUA 2EA2A 4P55A 4ZYEA 1ZG3A 4B8XA 1FYKA 2QWWA 1FT9A 4GYGA 5DYMA 1YG2A 1V3FA 2IA1A 3GZ5A 3FMQA 3K2ZA 4RAYA 4OOIA 2HS5A 1UHWA 2QUFA 3F8FA 2EA4A 2FA5A 1ZG5A 5J8FA 3FMSA 2P5LC 2P4WA 2MC3A 1PDNC 3RI4A 1O3RA 3T8RA 4M6XA 1OKRA 1P4AA 1BM9A 3E5XA 3COAC 3KP7A 3IC7A 1S7OA 4H0EA 3WU1B 1T38A 2IVMA 4LLGF 2HEOA 1B1BA 2G7UA 2P5VA 4KNYA 2GAUA 1UB9A 2ZCWA 2OBPA 3M7GA 3CUQA 3RPUA 5D8LB 1KYWA 3J7AO 2FMYA 4HW0A 4LD5A 4OIPF 3RYPA 2YR2A 4HDUA 3KEOA 1LEBA 2IJLA 3WTUC 2WWYA 3WGHA 1FYLA 3BPVA 3RIRA 4OU0A 5F64A 4P96A 3WE2A 3KLOA 1BI0A 6PAXA 3KP2A 3GLXA 5K5RA 3V7SA 1SD7A 1R58A 1FX7A 1ZGJA 2A68F 4KUMA 4R79A 3N97A 3JAMZ 3IKTA 2QVOA 3JTHA 3LFKA 1I5ZA 4LGWA 5HDKA 3ZMDA 2D2WA 3ISPA 1RZ4A 4EV0A 1IN8A 1XMAA 2IP2A 1B59A 3LQRA 3DQVC 1CGPA 2RV8A 1R1UA 2HKOA 2PBIA 2RKHA 2F2EA 1L3LA 1EH7A 1P6RA 2JTVA 1ZLJA 5FGMA 1XN7A 3LA7A 1QQIA 3ECOA 3DPTA 1D8JA 2UZKA 4DNCA 3F8MA 2CYYA 3V8JA 1YS7A 4IVNA 4IRIA 3DV8A 2OA4A 4BH9A 5H6QA 4WX9A 2RNJA 2EWNA 1ULYA 5EEGA 4ZYDA 3V7CA 4U0YA 1O3TA 1I6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6E A;  3GUD A;  4LG0 B;  1ZG1 A;  1ZAO A;  3E5U A;  2EFO A;  2NNN A;  3H3U A;  5HLG A;  3GX4 X;  1FBS A;  3ELK A;  1S8N A;  1SMT A;  5LGT A;  3JW4 A;  1HBX G;  4Y15 A;  3VB2 A;  2Z9O A;  3J81 K;  2FOK A;  5JFR A;  2WV0 A;  2FRH A;  1R00 A;  2FNA A;  5TJJ A;  5L3F A;  3ZMT A;  1ON1 A;  5DCM B;  2JZY A;  1KU9 A;  3MEX A;  1EH8 A;  1IN5 A;  2GWR A;  5DD4 A;  4JBA A;  3EYY A;  4M71 A;  2P8T A;  1K7A A;  1P4W A;  4UVB A;  3V8L A;  2Y0M A;  2VBX A;  2EFP A;  2OU2 A;  3GWZ A;  2XAQ A;  4YFK F;  3ZPL A;  4R8H A;  5H20 A;  2Z33 A;  4JK1 X;  2M45 A;  2C6Y A;  2IRF G;  3WTX C;  5E8G A;  1FBQ A;  1K78 B;  2AXL A;  2EV6 A;  1G3Y A;  2XKP A;  3HRS A;  2HOE A;  2L4M A;  1GXP A;  3PQJ A;  4M74 A;  3WE3 A;  5L3C A;  2P6S A;  3M1E A;  3S2W A;  2V9V A;  4MTD A;  1AOY A;  5AON A;  1IRG A;  4EM2 A;  3GYH X;  3SHF A;  3BP8 A;  1IUY A;  3PQK A;  2H6B A;  2CGP A;  2RDP A;  4HX8 A;  2O3F A;  2R7F A;  3I54 A;  1ZYR F;  4KN7 X;  2VT3 A;  1HKT A;  4YG2 F;  3J80 Z;  4XRF A;  2EV0 A;  2TDX A;  2PQ8 A;  3KP6 A;  1KU3 A;  4F7Z A;  4KDP A;  3QPH A;  4CO8 A;  1R1T A;  2EFN A;  2UXN A;  4HBL A;  3E6B A;  3L9F A;  4KIC A;  3Q9S A;  2VON A;  3I58 A;  4XBF A;  1BI3 A;  1T98 A;  3WTV C;  2XAG A;  4WXH A;  3EYI A;  1P2F A;  4OIR F;  2V1X A;  3RPQ A;  2VOO A;  1BIA A;  4EJT A;  1RNL A;  4IF4 A;  2COM A;  1E2X A;  1NHA A;  1IXS B;  3FXQ A;  4I98 B;  1XSX A;  1DP7 P;  3ZN0 A;  2W57 A;  2A69 F;  1Y0U A;  1S7A A;  1CF7 B;  4R1H A;  5LRS A;  5FLX K;  4GCV A;  2RGV A;  4LMY A;  3W6K B;  1D8K A;  4MNU A;  1OYI A;  2VE8 A;  4MQ9 F;  4PGG A;  3HHG A;  3K69 A;  5LGN A;  4B09 A;  4JQF A;  2WTE A;  2K27 A;  1XDU A;  3T5X A;  3IL2 A;  2H27 A;  1QZY A;  2F5D A;  3K1P A;  4AIJ A;  3K1N A;  4Q47 A;  3T8T A;  3TO6 A;  2QLZ A;  1MD0 A;  2O6G E;  1IW7 F;  2HYF A;  2L4A A;  2ISY A;  4EJW A;  3JTG A;  1AWC A;  4U0V A;  1FBU A;  1MDM B;  3GFM A;  1ZAR A;  2LSO A;  5DEQ A;  1K78 A;  3IHU A;  3WTZ A;  4S04 A;  1J9I A;  2ELH A;  1LVA A;  2A6E F;  4I0A A;  3MAJ A;  3F6V A;  2ISZ A;  2MH9 A;  1JGS A;  2YU3 A;  1BBY A;  4M72 A;  1O57 A;  4Q5S F;  3BJO A;  4I0B A;  3W6J B;  3IRR A;  4RGR A;  1ZLK A;  5FB2 A;  5LEK A;  2FEZ A;  1R23 A;  1U8R A;  1R5H A;  2D1H A;  2HQR A;  3Q5F A;  1STZ A;  2HZT A;  1U78 A;  3O2P E;  3H3Z A;  4EQQ A;  1KYZ A;  1ZRD A;  3D5L A;  2XKO A;  5BOX A;  1KQ0 A;  3C3W A;  3ZMS A;  4HQE A;  3FZV A;  3HIF A;  3H92 A;  2JT1 A;  5E20 A;  4LJZ F;  3C1D A;  1TW2 A;  1J2X A;  4KMU X;  2XRN A;  4Y13 A;  2ESH A;  4KN4 X;  1XDS A;  3DP7 A;  5LHI A;  4EMS A;  2GZW A;  5D6F A;  4ESF A;  2CFX A;  5BPD A;  2O0Y A;  3VOD A;  1IN4 A;  3ABT A;  4YFN F;  5DDG A;  1C0W A;  1EH6 A;  1YW8 A;  1FPQ A;  4IRH A;  4K2E A;  2XAF A;  5E1W A;  4Z2Y A;  5JVT A;  4XSX F;  3WOD F;  4RS8 A;  5FO5 A;  3L2C A;  3KLN A;  1MDM A;  1TQI A;  1BN5 A;  3L09 A;  4ZYH A;  5HDG A;  3M8F A;  1Z6T A;  5BPI A;  5E1X A;  3BOQ A;  2JPB A;  2QQB A;  3O3K A;  2FQ3 A;  5D4R A;  5J6X A;  4HX7 A;  1Z05 A;  2XHK A;  4GGG A;  3TO7 A;  5JHU A;  5ERI A;  1W7P D;  5BS6 A;  1G6N A;  3ABU A;  3BJ6 A;  5L3B A;  2PLY A;  4KMF A;  4U7D A;  4M73 A;  1FZP B;  1VTN C;  1OPC A;  4AIK A;  2PFB A;  3KP5 A;  5DD8 A;  2L01 A;  2F5E A;  3WTW C;  4CYD A;  2HTS A;  4FT8 A;  1RUO A;  4OMY A;  3NQO A;  4BHB A;  2NS0 A;  4YIF A;  2ESN A;  2J5O A;  5HS9 A;  1RUN A;  4L18 B;  4KIG A;  1MJ9 A;  4I02 A;  1ODD A;  2BBY A;  4RB1 A;  1ON2 A;  1YLF A;  2L3D A;  3F23 A;  5CVU A;  5CVJ A;  3I4P A;  4RAZ A;  2KJC A;  5A2Q K;  4MGR A;  4G6Q A;  2FBK A;  3HSF A;  4NB5 A;  3QP6 A;  1L0O C;  4I7H A;  3CUO A;  5DCF A;  1YTY A;  1O3Q A;  5IT9 Z;  1FY7 A;  2IT0 A;  2CQK A;  1U6G A;  2PEX A;  2QZ8 A;  2OZ6 A;  2DTR A;  3R61 A;  2DU9 A;  3ZMZ A;  1V4R A;  4KIB A;  3MZH A;  4N9H A;  3VEP A;  3HTS B;  5AIP A;  2F5F A;  1R5G A;  5LHG A;  2MLK A;  4P5O A;  3TOA A;  2XAH A;  1W7P A;  2QQ9 A;  5FFZ A;  1MZB A;  4EM0 B;  5JI6 A;  1FOK A;  2K4J A;  1FC3 A;  3F6O A;  2ZNY A;  3P9C A;  3GXO A;  4A5N A;  3R6S A;  3MWM A;  1TBX A;  4HX4 A;  2W84 A;  4GYI A;  4WXC A;  4MEX F;  3C18 A;  3HOT A;  3SFZ A;  5F1R A;  4BNC A;  4NHJ A;  3LWF A;  4LLN A;  2AS5 F;  3TOB A;  3LA3 A;  3QAH A;  1WKM A;  2ZKZ A;  3BDD A;  1J59 A;  3KEQ A;  4LK1 F;  3AAF A;  2XUB A;  4CZZ A;  1OMI A;  2CWE A;  2FBH A;  1GXQ A;  1SD5 A;  3BRO A;  2J5P A;  4AIH A;  1HW1 A;  5TRD A;  4CHU A;  5LGU A;  5BMZ A;  2VC0 A;  5E8I A;  4O5V A;  1U5T C;  3QU3 A;  2ADU A;  5HS7 A;  1MJA A;  5E18 F;  2VC1 A;  3M8E A;  3T0Y A;  1H9G A;  1SFE A;  3LAJ A;  2VOD A;  3F22 A;  2A61 A;  1BI1 A;  2M30 A;  2VXZ A;  3OV8 A;  3GO5 A;  3TQN A;  4CIC A;  1PUE E;  3I71 A;  3QOP A;  4P9U A;  4BYY A;  3G3Z A;  1MJB A;  1S6L A;  1W5T A;  2L02 A;  2DW4 A;  1Z6R A;  1ZH5 A;  1Q1H A;  3VOE A;  2M8E A;  2O61 A;  1P4X A;  4ASN A;  3BZ6 A;  2VE9 A;  2OD5 A;  3ROU A;  1YIO A;  4M6Y A;  4ENJ A;  5ILS A;  3FMR A;  2RQP A;  2VBY A;  3PFI A;  3BWG A;  3O6B B;  3KE2 A;  1HW2 A;  5HLI A;  4G7Z F;  2K02 A;  5ICG A;  1FSH A;  2EV5 A;  4G7H F;  3CLO A;  1KGS A;  2B0L A;  3ZP5 A;  2ACJ A;  3P9I A;  3RKW A;  2KIF A;  3KP3 A;  2R7D A;  4EJU A;  3B02 A;  5ILU A;  4CDG A;  4HV6 A;  2MLG A;  3JSO A;  1LB2 A;  4EJV A;  5FLX Z;  5CVV A;  1BOA A;  2XRO A;  3FM3 A;  1U2W A;  3QPT A;  2A6H F;  4FHT A;  3REO A;  1R36 A;  2PG4 A;  1XGM A;  2RN7 A;  3K9T A;  2DI3 A;  1TNT A;  4A0Z A;  1HST A;  3HRT A;  2ZNZ A;  3E5Q A;  3DPL C;  3F3X A;  3MCZ A;  3ML6 A;  2JPC A;  2GA2 A;  1JHH A;  4G7O F;  2H6C A;  3CUQ B;  4IPA A;  3ERE D;  2DO7 A;  1UFM A;  1FLI A;  1BC7 C;  2QBY A;  4UV9 A;  4FX4 A;  2STW A;  2ZXJ A;  3R0J A;  5H6R A;  4XLN F;  1FP1 D;  4G6D A;  2P7C B;  4GXO A;  2E7X A;  2WC2 A;  5L3D A;  3F8N A;  1ZHF A;  4UNO A;  3ULQ B;  2LF7 A;  3IKV A;  4RB0 A;  2KKO A;  2RVC A;  1REP C;  2NRA C;  4ENM A;  2NAZ A;  4HLX A;  1IAW A;  2VOP A;  5DUI A;  3ECH A;  2V79 A;  2KJB A;  3V4G A;  2KRF A;  2HKX A;  3TDU C;  4EGY A;  1XD7 A;  4BAY A;  4Q48 A;  1TLH B;  3WTY C;  2IW5 A;  4G8X A;  2DT5 A;  2ETH A;  1E17 A;  3LA2 A;  1ZRE A;  1OYY A;  4QLC U;  5IT3 A;  2M5W A;  1XCB A;  2CW0 F;  2FSW A;  2ZFW A;  1J0R A;  3HUG A;  3FXU A;  2OZU A;  3I53 A;  1YFH A;  2K86 A;  1HXD A;  4XLP F;  1PP7 U;  2LF8 A;  3M9A A;  3HHH A;  1JHF A;  1MGT A;  5CLS A;  4OIO F;  1WWX A;  2V6C A;  3GZ6 A;  4KFC A;  3JAM K;  1HQC A;  2E1N A;  3E6C C;  2QEN A;  3F8C A;  4O3M A;  1K79 A;  3EUH A;  1I1G A;  1YW9 A;  1R1V A;  4LLL A;  3I0T A;  1DUX C;  3HYI A;  2HGC A;  2DBB A;  1F4K A;  2EJR A;  4A6D A;  4RB3 C;  1Z91 A;  3ZN1 A;  2HFH A;  2ZME A;  2V1U A;  4MTE A;  1P92 A;  1K6O A;  2ZBK A;  5L3E A;  1D5V A;  3FF5 A;  3R60 A;  5FD5 A;  4EM1 A;  3RJP A;  3MFK A;  4HOB A;  4E70 A;  2VN2 A;  2YSR A;  1CF7 A;  4ZZL A;  4UVC A;  1Z9C A;  1FWZ A;  3FM5 A;  1T0F A;  2XV4 S;  3WTS C;  3CO6 C;  3WU0 A;  2EK5 A;  4HDV A;  2H94 A;  2DPU A;  2CO5 A;  4L0Y B;  5D4S A;  1O7F A;  2D1V A;  3GF2 A;  4MHG A;  3GW2 A;  1XGO A;  1XGS A;  3MZY A;  3QP5 A;  4HAM A;  3QRF F;  2MA3 A;  3TO9 A;  4HYE A;  3EET A;  1LDJ A;  2UXX A;  1IN6 A;  2RC4 A;  4L5J A;  2W25 A;  1HKQ A;  1QBJ A;  2Q0O A;  4AWX B;  5AIQ A;  2DFI A;  2QYO A;  5BQT A;  1DPU A;  3DEU A;  4OIN F;  2QBY B;  1J5Y A;  3U1D A;  1XCV A;  4L9V A;  4IXA A;  1UHM A;  1SFX A;  1IN7 A;  2PJP A;  5K5Q A;  4G94 A;  2DPD A;  2JRT A;  2CG4 A;  1OYW A;  3DKW A;  3HSR A;  5J8C A;  1J75 A;  4OMZ A;  5CVR A;  4BXU A;  1G3S A;  2CSO A;  5F6F A;  3Q9V A;  4EJO A;  4XSZ F;  1ONV A;  3KZY A;  2PI0 A;  5D5U B;  2G9W A;  2GQQ A;  1QNT A;  3NRV A;  5HDN A;  3HOS A;  4RGX A;  5ICC A;  1DPR A;  1LNW A;  2G7H A;  3GFL A;  4L9T A;  5KVR A;  2ZO4 A;  4LB5 A;  1B6A A;  1GHC A;  4RGS A;  1YQA A;  2MH2 A;  1Z7U A;  4N0B A;  3KFW X;  4DQ2 A;  4CGZ A;  1BC8 C;  1IZ1 A;  5E17 F;  3F72 A;  2FBI A;  2IA2 A;  3BPX A;  3VFZ A;  4KIF A;  2FML A;  4Y17 A;  1A04 A;  3CTA A;  1QGP A;  3KET A;  2E1C A;  1TQP A;  3ZMV A;  1WI9 A;  3SZP A;  4A0X A;  2GIV A;  3C7J A;  3KCC A;  3E6D A;  3EDP A;  1SD6 A;  2NNY A;  1QPM A;  1KQ9 A;  4M9S A;  1YO5 C;  4A2U A;  4HV5 A;  3SXY A;  3NEU A;  2P5K A;  5HOO A;  4MEY F;  1HSJ A;  3I59 B;  3N4M A;  2HYG D;  1U3E M;  5HS8 A;  3IRQ A;  1HKS A;  3HTU A;  3FHZ A;  4HF0 A;  4G9Y A;  2EFW A;  4P9F A;  3RKX A;  2K4B A;  2LKP A;  2NYX A;  1WRJ A;  1IXR C;  4PDK A;  4RGU A;  3U2R A;  2PMH A;  5HLH A;  3WTT C;  4U88 A;  1W4M A;  1KU2 A;  2VBW A;  2UWM A;  5FFX A;  1G3T A;  1U5T B;  2IA0 A;  1G4D A;  2FXA A;  1XB4 A;  1ZRF A;  4WCG A;  4L5I A;  5LRR A;  4BQA A;  5ILV A;  2X0L A;  1IRF A;  2W24 A;  1RIO H;  1TQM A;  4ZZD A;  2P7V B;  2OQR A;  5KK1 A;  4ZYG A;  3SZT A;  5D8K B;  2M1B A;  4RB2 C;  4HQM A;  4S05 A;  2BV6 A;  1T39 A;  1LDK B;  1O3S A;  4ESJ A;  1MKM A;  1T2K A;  1R7J A;  3CJN A;  1JXS A;  1O7L A;  3L7W A;  3K0L A;  4I09 A;  1FSE A;  2ZME B;  2V1D A;  2STT A;  3SQN A;  4BHC A;  1XSV A;  1T6S A;  4HZF A;  3LQQ A;  3BY6 A;  4ENK A;  1LDD A;  1J7K A;  3D0S A;  1S29 A;  2GA1 A;  4UV8 A;  3GEZ A;  5DUK A;  2GXB A;  2KIU A;  1LEA A;  3P7N A;  2A5Y B;  4L9J A;  4HA8 A;  4KA4 A;  2E7W A;  2F5C A;  2HTJ A;  2M87 A;  2FF4 A;  1LJ9 A;  1HW5 A;  1Z1D A;  2BE5 F;  2BYV E;  4PGH A;  2EFQ A;  2FU4 A;  5JR3 A;  2DQR A;  5D6E A;  2YX7 A;  2XVC A;  2EB7 A;  2HQN A;  5D5X B;  1B9N A;  1W5S A;  4PCQ A;  2D45 A;  3WGI A;  5LEJ A;  1QZZ A;  2O03 A;  5K5O A;  3WG9 A;  1BI2 A;  2DQL A;  2DK5 A;  1UCR A;  5D5V B;  1TW3 A;  3IWZ A;  5LBQ A;  2XAS A;  2KIM A;  3GVA A;  4ENN A;  5ICE A;  2P6T A;  4M9X A;  4TV7 A;  5D5W B;  2YX4 A;  4FX0 A;  4UXN A;  3U9G A;  3B73 A;  4UVA A;  3EQL F;  1GVJ A;  4A5M A;  4MQV A;  3HRU A;  1F5T A;  4I01 A;  4HF2 A;  4UUV A;  3BJA A;  1BIB A;  1XMK A;  5EEH A;  3JSP A;  2HDC A;  2DLL A;  2VBZ A;  4A12 A;  4UHT A;  1BJA A;  2W85 A;  1SFU A;  1TNS A;  3KZZ A;  3MQ0 A;  4QWQ A;  3FX3 A;  1QO0 D;  2GXG A;  4LK0 F;  5HVQ C;  2PMU A;  2IPQ X;  3CDH A;  1LQ1 A;  2A3S A;  4WXD A;  5CYV A;  5FD6 A;  3G73 A;  1IF1 A;  2XGX A;  3J81 Z;  3I59 A;  3QU6 A;  2FNP A;  1IXC A;  3DF8 A;  4U7B A;  2LDU A;  3V8K A;  1ZRC A;  2Q2E A;  1ZGA A;  2R3S A;  2QQA A;  4AD9 A;  4GO1 A;  1SAX A;  1H0M A;  2Y48 A;  3L00 A;  4AVP A;  1U5T A;  4O6J A;  4EGZ A;  4M9Z A;  1WSU A;  1ZN2 A;  5K1Y A;  1I1S A;  2Z5U A;  3RYR A;  4LFU A;  4NQW A;  5LLQ A;  1W7P B;  4A0Y A;  3T1B A;  4Q4Z F;  1F9N A;  3WGG A;  4EVI A;  3IWF A;  3R4K A;  4L0Z B;  3V7R A;  1G3W A;  4YFX F;  2LNB A;  2XIG A;  4ETS A;  5A2Q Z;  4I2O A;  3GFJ A;  5IT9 K;  1DDN A;  1JE8 A;  1USS A;  1UST A;  5DCM A;  3RKY A;  3E97 A;  4L9N A;  2JSC A;  4U0W A;  3HSE A;  4WF2 A;  3CO7 C;  1XGN A;  1KU7 A;  3TDZ C;  3LST A;  3LAP A;  5ED4 A;  2O8X A;  3TGN A;  1EV7 A;  2A07 F;  4ESB A;  4IRG A;  2OQG A;  4IHS A;  5LHH A;  1KQ8 A;  4HLY A;  1D3Y A;  2MBF A;  2Z3Y A;  3ZQ7 A;  2BEO A;  1YS6 A;  2MD5 A;  1FYM A;  5DV5 A;  3E6M A;  2L54 A;  3OOP A;  2HR3 A;  4D0P A;  1B9M A;  5E1Z B;  1SMY F;  4IJA A;  2HWV A;  1H9T A;  1YW7 A;  3KP4 A;  1FP2 A;  1S3J A;  4OIQ F;  1SD4 A;  5L3G A;  4WWC A;  3FXR A;  2QM3 A;  4ZH4 F;  1TTY A;  2Y75 A;  3R0A A;  4ON0 A;  1FNN A;  1KA8 A;  1X3U A;  3J80 K;  4WK8 F;  2XAJ A;  3DFG A;  3RDI A;  3E3V A;  3DXJ F;  2OAZ A;  4HF1 A;  1YYV A;  4YII A;  3RTR A;  1RI7 A;  4IHT A;  3TKY A;  2K7L A;  5CJ9 A;  1R22 A;  1I27 A;  2Z99 A;  2H09 A;  1PP8 F;  3I64 A;  2DK8 A;  3F8B A;  4N9I A;  2ZJ2 A;  3CUQ C;  5CVI A;  4LB6 B;  2BGC A;  2VT2 A;  1B4A A;  2Q8K A;  3FWE A;  3GFI A;  2YPR A;  2PN6 A;  4KYW A;  3HRM A;  1WQ2 A;  4BHP A;  4CXF A;  5ICF A;  3I5U A;  2DAO A;  4KT5 C;  4LG0 A;  2FE3 A;  2X4H A;  1F1Z A;  4PZJ A;  3P9K A;  3K1M A;  3F21 A;  1XSD A;  1OR7 A;  3ZMU A;  2EA2 A;  4P55 A;  4ZYE A;  1ZG3 A;  4B8X A;  1FYK A;  2QWW A;  1FT9 A;  4GYG A;  5DYM A;  1YG2 A;  1V3F A;  2IA1 A;  3GZ5 A;  3FMQ A;  3K2Z A;  4RAY A;  4OOI A;  2HS5 A;  1UHW A;  2QUF A;  3F8F A;  2EA4 A;  2FA5 A;  1ZG5 A;  5J8F A;  3FMS A;  2P5L C;  2P4W A;  2MC3 A;  1PDN C;  3RI4 A;  1O3R A;  3T8R A;  4M6X A;  1OKR A;  1P4A A;  1BM9 A;  3E5X A;  3COA C;  3KP7 A;  3IC7 A;  1S7O A;  4H0E A;  3WU1 B;  1T38 A;  2IVM A;  4LLG F;  2HEO A;  1B1B A;  2G7U A;  2P5V A;  4KNY A;  2GAU A;  1UB9 A;  2ZCW A;  2OBP A;  3M7G A;  3CUQ A;  3RPU A;  5D8L B;  1KYW A;  3J7A O;  2FMY A;  4HW0 A;  4LD5 A;  4OIP F;  3RYP A;  2YR2 A;  4HDU A;  3KEO A;  1LEB A;  2IJL A;  3WTU C;  2WWY A;  3WGH A;  1FYL A;  3BPV A;  3RIR A;  4OU0 A;  5F64 A;  4P96 A;  3WE2 A;  3KLO A;  1BI0 A;  6PAX A;  3KP2 A;  3GLX A;  5K5R A;  3V7S A;  1SD7 A;  1R58 A;  1FX7 A;  1ZGJ A;  2A68 F;  4KUM A;  4R79 A;  3N97 A;  3JAM Z;  3IKT A;  2QVO A;  3JTH A;  3LFK A;  1I5Z A;  4LGW A;  5HDK A;  3ZMD A;  2D2W A;  3ISP A;  1RZ4 A;  4EV0 A;  1IN8 A;  1XMA A;  2IP2 A;  1B59 A;  3LQR A;  3DQV C;  1CGP A;  2RV8 A;  1R1U A;  2HKO A;  2PBI A;  2RKH A;  2F2E A;  1L3L A;  1EH7 A;  1P6R A;  2JTV A;  1ZLJ A;  5FGM A;  1XN7 A;  3LA7 A;  1QQI A;  3ECO A;  3DPT A;  1D8J A;  2UZK A;  4DNC A;  3F8M A;  2CYY A;  3V8J A;  1YS7 A;  4IVN A;  4IRI A;  3DV8 A;  2OA4 A;  4BH9 A;  5H6Q A;  4WX9 A;  2RNJ A;  2EWN A;  1ULY A;  5EEG A;  4ZYD A;  3V7C A;  4U0Y A;  1O3T A;  1I6X A; 
#chains in the Genus database with same CATH topology
 3LSP A;  3MKL A;  3H5A A;  4KT6 A;  3AL0 C;  4A6E A;  2O9L A;  3X2Q H;  1Z0X A;  1I3Q J;  3GUD A;  3OYI A;  4LG0 B;  2BHZ A;  2ELJ A;  1ZG1 A;  1ETW A;  1ZAO A;  2X48 A;  4OWR B;  3H9G A;  2X1C A;  1SVL A;  3E5U A;  1LFU P;  2EFO A;  2R7S A;  3FKJ A;  1P7J A;  2NNN A;  3H3U A;  5HLG A;  3GX4 X;  1V55 H;  1VQ5 I;  1FBS A;  4CCN A;  1W0T A;  3ELK A;  1S8N A;  1UG2 A;  3RSN A;  1SMT A;  3S1M J;  2R7Z J;  9ANT A;  3KPH A;  5LGT A;  3JW4 A;  4II3 A;  4CUG A;  1HBX G;  4Y15 A;  3VB2 A;  3MMY B;  2Z9O A;  1K4T A;  3J81 K;  2FOK A;  3M3Y J;  1MBK A;  5JFR A;  1OR7 C;  3OYA A;  2PX9 A;  2WV0 A;  2FRH A;  3AFH A;  1SFO J;  1R00 A;  1S5L C;  2BY3 A;  2FNA A;  5TJJ A;  4BY1 J;  3OYM A;  2GBY A;  3SDG A;  5L3F A;  4Y4R A;  2X6Y A;  3ZMT A;  2JA2 A;  1ON1 A;  5DCM B;  2JZY A;  3CMA I;  1KU9 A;  3MEX A;  1EH8 A;  1IN5 A;  2FOW A;  2GWR A;  5DD4 A;  4JBA A;  3EYY A;  2GOM A;  2WAD A;  4M71 A;  2ZSI B;  4M3G A;  2P8T A;  3CP8 A;  3JRC A;  1K7A A;  1P4W A;  3DCF A;  2MGQ A;  3H35 A;  4UVB A;  3V8L A;  1ZR2 A;  1IGN A;  2EZK A;  2Y0M A;  3GBG A;  2VBX A;  2EFP A;  4BUP A;  2OU2 A;  3GWZ A;  2DOA A;  2XAQ A;  3RCO A;  4YFK F;  3ZPL A;  1MH4 A;  4R8H A;  5H20 A;  2Z33 A;  4JK1 X;  3DTK A;  2BXY A;  2M45 A;  2XSJ C;  1G59 A;  2C6Y A;  2IRF G;  3WTX C;  3A2K A;  1DU6 A;  1Y8R B;  5E8G A;  3HOV J;  1FBQ A;  2I5U A;  1K78 B;  2AXL A;  3HDD A;  1Z3Y A;  4LIT A;  4Y33 A;  2EV6 A;  1G3Y A;  4BJT A;  2XKP A;  3HRS A;  3BCB A;  2W48 A;  2HOE A;  2LKX A;  3S3M A;  2L4M A;  1GXP A;  3PQJ A;  1K83 J;  4M74 A;  3WE3 A;  5L3C A;  1WGX A;  2P6S A;  2Y30 A;  5C4J J;  1TP4 A;  3M1E A;  3S2W A;  2V9V A;  4MTD A;  1AOY A;  2JMW A;  2JA5 J;  3U21 A;  4CYC B;  3IH2 A;  5AON A;  1IRG A;  2ZB9 A;  4EM2 A;  1VQ7 I;  5H2F C;  3GYH X;  3SHF A;  3H9Q A;  2K9S A;  1T33 A;  5EEA A;  3BP8 A;  4MO7 A;  3PQK A;  2H6B A;  1IUY A;  3K4N A;  2CQQ A;  2JRM A;  2CGP A;  2M8G X;  2RDP A;  4HX8 A;  3GTM J;  1UHS A;  2O3F A;  2R5Z B;  4RA2 A;  2R7F A;  1FMW A;  2E5N A;  3I54 A;  1FTZ A;  2IGN A;  3DEE A;  3VSK A;  1ZYR F;  1MSF C;  2JUG A;  3OOU A;  4BXX J;  1HOM A;  2XDV A;  3AG1 H;  2WB1 A;  4KN7 X;  4B44 A;  2H1K A;  1X19 A;  2VKE A;  2VT3 A;  1ORK A;  5KNL A;  1HKT A;  4YG2 F;  3J80 Z;  2XAU A;  3ABK H;  4XRF A;  4B43 A;  2XSD C;  2EV0 A;  2TDX A;  1JKQ C;  3JRI A;  4J01 A;  1Y8Q B;  2PQ8 A;  3KP6 A;  1KU3 A;  3OL4 A;  4BKX A;  4F7Z A;  3G4S I;  3PIP F;  4KDP A;  4NC7 A;  3QPH A;  1WJC A;  2AHQ A;  4CO8 A;  1A6I A;  1R1T A;  2EFN A;  2UXN A;  4HBL A;  3LSR A;  1TL8 A;  4Z6Y A;  3E6B A;  2XGC A;  1A36 A;  4AYB N;  3L9F A;  1H89 C;  3K7A J;  5CPR B;  3A1Y A;  4KIC A;  3Q9S A;  2LBF B;  5DM7 F;  2VON A;  2RQQ A;  5IOZ A;  3I58 A;  4XBF A;  1BI3 A;  1F43 A;  1X3Z B;  1T98 A;  3WTV C;  2XAG A;  3W6V A;  4WXH A;  3EYI A;  1P2F A;  4OIR F;  1AHD P;  1RPW A;  3K2A A;  1HDD C;  2V1X A;  3RPQ A;  2VOO A;  1BIA A;  1QHG A;  1B72 B;  4EJT A;  1RNL A;  4IF4 A;  2COM A;  3JRB A;  4E7K A;  2CJJ A;  1E2X A;  1NHA A;  1IXS B;  3FXQ A;  4I98 B;  1XSX A;  3EPZ A;  1DP7 P;  1HCR A;  2WV1 A;  5J40 A;  2W57 A;  3ZN0 A;  2A69 F;  1OCC H;  2NVY J;  4UUT A;  1Y0U A;  2WAQ N;  1S7A A;  1CF7 B;  1X1C A;  1AKH B;  2DFF A;  2K3F A;  1UEL B;  2QF7 A;  4R1H A;  5LRS A;  5FLX K;  1RKT A;  4BY7 J;  4GCV A;  2NVT J;  2RGV A;  4LMY A;  1TWC J;  3W6K B;  1D8K A;  4HPQ A;  2QKM B;  2HQ5 A;  1V5F A;  2I8D A;  4MNU A;  1OYI A;  2VE8 A;  4MQ9 F;  4PGG A;  3HHG A;  3K69 A;  4D7N A;  1MSE C;  5LGN A;  2K85 A;  3VYT B;  4B09 A;  4JQF A;  3NAR A;  2DOF A;  2WTE A;  4D5C A;  1B8I B;  4M3D A;  3NWS A;  4XLA A;  1JTX A;  2K27 A;  1XDU A;  1MMN A;  2CUJ A;  3T5X A;  3IL2 A;  2H27 A;  2HDD A;  1QZY A;  2F5D A;  3K1P A;  4NNJ A;  4AIJ A;  1S72 I;  3K1N A;  1LVK A;  4Q47 A;  1XS9 A;  3T8T A;  1XMX A;  3I56 I;  4ZDO A;  3TO6 A;  2UUZ A;  2QLZ A;  1WFX A;  1QU3 A;  3RKQ A;  1MD0 A;  2O6G E;  1JKP C;  1IW7 F;  1MMA A;  2MW8 A;  3ABL H;  2HYF A;  1SAN A;  3VYR B;  2L4A A;  2ISY A;  1G2H A;  4EJW A;  3JTG A;  1T08 B;  1ACI A;  2VKH A;  1AWC A;  2DA5 A;  4A3B J;  3ZQQ A;  4U0V A;  3PJR A;  2R0Q C;  1FBU A;  3S2D J;  1MDM B;  3GFM A;  3BTL A;  3E0J B;  2FJ1 A;  1ZAR A;  2LSO A;  5DEQ A;  5GAH J;  3IHU A;  1K78 A;  3WTZ A;  3CQZ J;  4S04 A;  4UY8 I;  2ELK A;  1T8I A;  5HLT A;  1J9I A;  2ELH A;  1LVA A;  2A6E F;  3BTC A;  5GTI C;  3OIQ A;  4I0A A;  1DGW Y;  1JUP A;  2M7B A;  2CW7 A;  3MAJ A;  3F6V A;  2ISZ A;  2MH9 A;  3PM1 A;  1JGS A;  3H9J A;  2YU3 A;  1BBY A;  3QPS A;  3W2W A;  1VQ9 I;  2W82 A;  3L2R A;  2M2E A;  2QCO A;  4M72 A;  1O57 A;  1I39 A;  4Q5S F;  3M07 A;  4RDU A;  3UKG A;  5C4X J;  3JRH A;  3BJO A;  3OL3 A;  4I0B A;  3VPR A;  4UB6 C;  3W6J B;  3IRR A;  4RGR A;  1ZLK A;  1VQ4 I;  5FB2 A;  5LEK A;  2FEZ A;  1R23 A;  1U8R A;  2VPR A;  1R5H A;  2EBI A;  2D1H A;  1XX5 A;  2HQR A;  4PSX A;  4QPO A;  3Q5F A;  1STZ A;  2HZT A;  2B9S A;  1U78 A;  4BDZ A;  3O2P E;  5GP9 A;  3H3Z A;  4XKV A;  5DM6 F;  3BR1 A;  5B1B H;  4EQQ A;  1KYZ A;  1ZRD A;  2DDB A;  3D5L A;  1VND A;  2MC4 A;  2XKO A;  5BOX A;  1HLV A;  1KQ0 A;  3C3W A;  3HL2 A;  3ZMS A;  4HQE A;  2V7F A;  3K70 C;  4XN3 A;  5FKO A;  1SAU A;  1R9T J;  3FZV A;  4KJZ A;  2X6W A;  1K4S A;  3HIF A;  3H92 A;  2JT1 A;  2DA3 A;  5E20 A;  4LJZ F;  3C1D A;  1TW2 A;  5GTH C;  2GOX B;  1J2X A;  4J00 A;  4KMU X;  3KZI C;  5E79 C;  2OJE D;  2XB5 A;  2XRN A;  4Y13 A;  1WJF A;  2AQE A;  4L5E A;  2ESH A;  3O8G A;  1XDS A;  2PMZ N;  3DP7 A;  4KN4 X;  1OJL A;  3CJQ B;  5LHI A;  1D5Y A;  2KT0 A;  2NVX J;  4EMS A;  2GZW A;  2MFZ A;  5J1U A;  2K5C A;  3PIO F;  5D6F A;  4ESF A;  5E3L A;  3HB9 A;  2CFX A;  5BPD A;  2FUG 2;  2O0Y A;  2VL8 A;  5CQE A;  3VOD A;  5CKT A;  1IN4 A;  3ABT A;  5J3L A;  4YIR X;  1YIT I;  4YFN F;  5DDG A;  4D7M A;  1C0W A;  1EH6 A;  4J19 A;  1D0Z A;  4LG3 A;  4NDL A;  1YIJ I;  2VKD A;  2X6O A;  1YW8 A;  3S15 J;  2HPI A;  3C2H A;  1FPQ A;  3VDX A;  3GTO J;  1W1W E;  1IRX A;  3OIP A;  4QTR A;  4IRH A;  4BBR J;  4K2E A;  2XAF A;  5GPC A;  4NUB A;  3HBL A;  4RLF A;  5E1W A;  4Z2Y A;  1GDT A;  5JVT A;  4XSX F;  2QKL B;  3G71 I;  1ETQ A;  3WOD F;  1TC3 C;  4RS8 A;  5FO5 A;  3L2C A;  3KLN A;  2WBM A;  1MDM A;  3RQ4 A;  2VQL A;  1TQI A;  5JVG F;  1BN5 A;  1EKE A;  3L09 A;  4ZYH A;  5HDG A;  3M8F A;  2CUF A;  4KIT B;  5HOD A;  5B3S H;  3CCJ I;  1Z6T A;  3D5R C;  5E1X A;  5BPI A;  3BOQ A;  1OCR H;  2JPB A;  2QQB A;  3D5S C;  3O3K A;  4MLO A;  3S1N J;  3CF5 F;  2FQ3 A;  3G1O A;  5D4R A;  4B48 A;  5J6X A;  1ZGW A;  4HX7 A;  1OQY A;  1Z05 A;  2XHK A;  2DT6 A;  4GGG A;  3TO7 A;  2HPM A;  1QPI A;  5JHU A;  2W7N A;  5ERI A;  2E1M B;  4DBR A;  1OIS A;  2NXN B;  3BQY A;  1W7P D;  5BS6 A;  3DKY A;  1G6N A;  3ABU A;  3BJ6 A;  5L3B A;  4D1Q A;  2PLY A;  2LKS A;  1QVT A;  4KMF A;  4U7D A;  4M73 A;  2R7R A;  1VTN C;  1FZP B;  5EF6 A;  1OPC A;  2PJR B;  4AIK A;  4PJJ A;  2PFB A;  2OUM A;  3KP5 A;  1JT6 A;  5B1A H;  1D1B A;  2OCC H;  1IDY A;  5DD8 A;  4YEL A;  2L01 A;  2F5E A;  3WTW C;  4A93 J;  1QVU A;  3GTJ J;  4CYD A;  2HTS A;  2F4M B;  4FT8 A;  1RUO A;  2R93 J;  2ZSH B;  4OMY A;  3NQO A;  2CQ7 A;  4BHB A;  2NS0 A;  3VSL A;  1IV8 A;  1V5E A;  4G12 A;  5J47 A;  4YIF A;  2ESN A;  2J5O A;  2I10 A;  2E36 A;  4A3I J;  1A35 A;  3MN2 A;  4Y7N J;  5HS9 A;  3HC7 A;  1RUN A;  1ETY A;  4L18 B;  4KIG A;  3SYT A;  1MJ9 A;  4I02 A;  1N25 A;  1ODD A;  2BBY A;  4RB1 A;  1ON2 A;  1YLF A;  2L3D A;  3F23 A;  5CVU A;  5CVJ A;  3DWL E;  5EDN A;  2OCE A;  2W4S A;  4DOZ A;  3I4P A;  3OYH A;  3H5N A;  3PNT A;  2XF5 A;  4RAZ A;  2EH3 A;  2KJC A;  2FX0 A;  3K4M A;  5A2Q K;  2ICW G;  3H3V K;  2KPM A;  4MGR A;  4G6Q A;  2FBK A;  4LOC A;  2MAB A;  2QA4 I;  3HSF A;  4NB5 A;  3QP6 A;  1GV2 A;  1L0O C;  1Y1V J;  1WZ2 A;  4I7H A;  3SJM A;  5EYR A;  2DYS H;  4D9J A;  3CUO A;  4FTH A;  5DCF A;  3LFU A;  1K61 A;  2QEX I;  1YTY A;  3WHC A;  4BDY A;  1O3Q A;  5IT9 Z;  1FY7 A;  2IT0 A;  2CQK A;  4BJ6 C;  1U6G A;  3HM5 A;  2PEX A;  2QZ8 A;  2R7X A;  2OZ6 A;  2DTR A;  3R61 A;  2DU9 A;  3ZMZ A;  1V4R A;  2G0E A;  2ZXW H;  4KIB A;  3MZH A;  4N9H A;  1WHU A;  3VEP A;  3HTS B;  2EZI A;  5AIP A;  2F5F A;  3G6E I;  1R5G A;  1DGR M;  5FKL A;  4CZC A;  2KP6 A;  5LHG A;  2MLK A;  1QZE A;  3CLQ A;  4P5O A;  3TOA A;  2XAH A;  1TT5 B;  1W7P A;  2QQ9 A;  5FFZ A;  3ZQI A;  2R7Q A;  1MZB A;  2R7W A;  4EM0 B;  4XOP A;  3BTI A;  5JI6 A;  3AG3 H;  1MIJ A;  1RES A;  3F0C A;  1FOK A;  2K4J A;  1FC3 A;  2FD5 A;  3F6O A;  3C2B A;  5M5W J;  1XG1 A;  2ZNY A;  2KZV A;  2VI6 A;  2K3P A;  1IDZ A;  2MG4 A;  3P9C A;  1WCM J;  4B3X A;  2BOL A;  2K9M A;  4V19 K;  3ASN H;  3GXO A;  4A5N A;  3R6S A;  2JN6 A;  1TBX A;  3MWM A;  4BS9 A;  4HX4 A;  2W84 A;  4IX7 A;  4GYI A;  4WXC A;  4MEX F;  5K7F A;  3C18 A;  4E7Z A;  3HOT A;  3CCE I;  4BE0 A;  3SFZ A;  3CZ6 A;  5F1R A;  4BNC A;  4NHJ A;  1R4M B;  3LWF A;  1XPX A;  2AS5 F;  4LLN A;  3TOB A;  3LA3 A;  3QAH A;  1WKM A;  2ZKZ A;  3BDD A;  3QPL A;  1J59 A;  3KEQ A;  4DJA A;  2X1D A;  1WJE A;  1Y56 A;  2NS8 A;  1Y6I A;  4LK1 F;  3AAF A;  1JI8 A;  2XUB A;  2ZC2 A;  1OMI A;  2CWE A;  4CZZ A;  1F36 A;  1TWA J;  2Y9Z A;  1RRJ A;  2FBH A;  4BBS J;  2UV1 A;  1GXQ A;  1SD5 A;  3LSM A;  3BRO A;  4CA0 A;  1MMD A;  2J5P A;  2DA4 A;  2IS1 A;  4AIH A;  1HW1 A;  2JJ7 A;  4ZYA A;  5TRD A;  4CHU A;  1D1A A;  5LGU A;  5BMZ A;  2VC0 A;  5E8I A;  4O5V A;  1U5T C;  3QU3 A;  2IXS A;  4YRV A;  2ADU A;  2R7T A;  5HS7 A;  1MJA A;  1IRZ A;  4F91 B;  3GME A;  5K7Z A;  5E18 F;  2L0K A;  3IV5 A;  3CJR B;  2VC1 A;  3M8E A;  4A3E J;  3SDB A;  4II2 A;  2DCE A;  3T0Y A;  5EZG A;  1H9G A;  3CCM I;  3PUB A;  1ERD A;  1SFE A;  3LAJ A;  2WAE A;  2VOD A;  3F22 A;  2A61 A;  4W97 A;  2BY1 A;  1SEU A;  1BI1 A;  2JA6 J;  2M30 A;  2VXZ A;  3OV8 A;  1NG7 A;  3GO5 A;  2L9N A;  4V2G A;  1LFB A;  3TQN A;  4CIC A;  1PUE E;  3I71 A;  3QOP A;  4S0H B;  4P9U A;  3LSI A;  1XC5 A;  1V5G A;  2XGE A;  1UMQ A;  2HVS A;  4BYY A;  2LRE A;  5E3M A;  3FKI J;  4GRI A;  2VJI A;  4BU2 A;  3G3Z A;  1MJB A;  1S6L A;  2OV7 A;  1W5T A;  4AVZ A;  2L02 A;  3CC2 I;  2DW4 A;  5LD2 C;  1WJ5 A;  1Z6R A;  1ZH5 A;  1Q1H A;  4QSH A;  4IEJ A;  1B8I A;  1OLT A;  2Y69 H;  2L9S A;  3VOE A;  1FEX A;  4E7J A;  2M8E A;  2O61 A;  1LKX A;  1WI3 A;  4ZJZ A;  3FIW A;  1P4X A;  4ASN A;  4C3I J;  3BZ6 A;  2M0M A;  2VE9 A;  2L7F P;  2DA1 A;  2OD5 A;  5GAG J;  3HZJ A;  5IYD J;  3ROU A;  1YX3 A;  2ECC A;  1YIO A;  1JGG A;  4M6Y A;  4ENJ A;  5ILS A;  3FMR A;  2RQP A;  2DMU A;  2VBY A;  2CUZ A;  2VAS A;  3PFI A;  1BOB A;  2CV2 A;  1DU0 A;  3BWG A;  1MMG A;  2XPV A;  2BXZ A;  3A0H C;  3O6B B;  3KE2 A;  3A01 B;  3W2V A;  4N4N B;  1HW2 A;  5FKN A;  2L7K A;  5HLI A;  4G7Z F;  3GTK J;  4HRI A;  3I4N J;  2K02 A;  5ICG A;  1FSH A;  3K4B A;  2EV5 A;  4G7H F;  1BW5 A;  1POG A;  2CRG A;  3CLO A;  1KGS A;  2B0L A;  3ZP5 A;  4JX5 A;  2ACJ A;  3P9I A;  3RKW A;  1FJL A;  1JT0 A;  2KIF A;  4PJM A;  3VWB A;  4XKW A;  3B6C A;  2R7D A;  3KP3 A;  4EJU A;  3B02 A;  3ZCO A;  5ILU A;  1LE8 A;  5FKM A;  4XIC A;  4CDG A;  4KIS A;  2H8W A;  4HV6 A;  2MLG A;  4XKC A;  1AA7 A;  2KZG A;  3JSO A;  3RZD J;  3CF2 A;  2BY2 A;  4X1E A;  1LB2 A;  1FIA A;  4EJV A;  1ZR4 A;  1ZK8 A;  5FLX Z;  5CVV A;  2K40 A;  1BOA A;  2XRO A;  3FM3 A;  1U2W A;  3CME I;  3QPT A;  1TT0 A;  4C3H J;  2A6H F;  2KLO A;  5JHF A;  4XOT A;  4FHT A;  3REO A;  3S2H J;  1R36 A;  2R4G A;  2PG4 A;  3PUF A;  5K7H A;  2QSH X;  1XGM A;  2RN7 A;  2KDO A;  3K9T A;  2DI3 A;  4C30 A;  1JUM A;  1TNT A;  3HUG B;  2DJI A;  4A0Z A;  1HST A;  3SEZ A;  3HRT A;  2ZNZ A;  3E5Q A;  4LIV A;  1U9O A;  3DPL C;  3F3X A;  2R5Y A;  1EA3 A;  3S3N A;  3MCZ A;  2V4J C;  3ML6 A;  3H0D A;  4B47 A;  3OSF A;  4XR6 A;  1X58 A;  1DP3 A;  2JPC A;  3L2V A;  1VZ0 A;  2GA2 A;  5JLW A;  1JHH A;  4G7O F;  1X2M A;  3HPH A;  3M1C A;  2CS3 A;  2H6C A;  3CUQ B;  4IPA A;  3ERE D;  2DO7 A;  4EEF G;  1UFM A;  1FLI A;  4DZP A;  2Z2S B;  4E6K G;  1BC7 C;  2QBY A;  4UV9 A;  4FX4 A;  2STW A;  3HGG A;  1V54 H;  2B7E A;  2ZXJ A;  4FE4 A;  1LPQ A;  1RR7 A;  1E3P A;  2JUC A;  1PYV A;  3FXM A;  3R0J A;  2DN0 A;  5H6R A;  4XLN F;  1FP1 D;  4B3A A;  5IP7 J;  4G6D A;  2HOT A;  5F1J A;  2P7C B;  4PJL A;  1FOY A;  4GXO A;  2E7X A;  1MMS A;  3CCV I;  2WC2 A;  5L3D A;  3S8P A;  3CCL I;  4BGD A;  2CQX A;  2E5Z A;  3F8N A;  2BW3 B;  1ZHF A;  1Q1V A;  4UNO A;  1YRN A;  1VFC A;  1R5I D;  3ULQ B;  3DU5 A;  2LF7 A;  5KCM A;  3IKV A;  4RB0 A;  2KKO A;  2RVC A;  1REP C;  3H36 A;  1FOW A;  3OR2 C;  4ENM A;  2NRA C;  2E2J J;  2NAZ A;  4HLX A;  1IAW A;  3DTE A;  1X4O A;  2AXT C;  3OS0 A;  2VOP A;  3S1R J;  5DUI A;  3KX2 A;  4CCO A;  4A3G J;  3ECH A;  2V79 A;  2LY9 A;  5IPA A;  2VJ5 A;  1T95 A;  2KJB A;  3V4G A;  4IHY A;  2KRF A;  2HKX A;  3TDU C;  4EGY A;  1XD7 A;  4BAY A;  4Q48 A;  3Q0V A;  1Z77 A;  2XRL A;  4B1R A;  2LY1 A;  1YE9 A;  1TLH B;  4N4O B;  3WTY C;  2IW5 A;  4G8X A;  2DT5 A;  2ETH A;  4EAT A;  1E17 A;  3TP0 A;  3LA2 A;  1ZRE A;  1OYY A;  4QLC U;  4RM2 A;  5IT3 A;  1RC9 A;  2M5W A;  1W36 C;  1XCB A;  2CW0 F;  2NVU B;  4RAG A;  4GFB A;  4HNT A;  2FSW A;  2HVR A;  2ZFW A;  4A3M J;  1QA6 A;  1J0R A;  3J7A Y;  3HUG A;  3MD2 A;  3O8H A;  1SVO A;  3FXU A;  5FKK A;  2L7Z A;  4A3K J;  2OZU A;  3I53 A;  1D0X A;  1YFH A;  2K86 A;  2H8R A;  1HXD A;  4XLP F;  3K10 A;  1PP7 U;  2LF8 A;  5C44 J;  4F93 B;  2PMZ A;  4XK4 A;  3TL4 X;  3M9A A;  3ZOB A;  1CQT A;  3HHH A;  1JHF A;  1MGT A;  5CLS A;  3BG3 A;  4GDF A;  4OIO F;  3DBH B;  1P9Q C;  1WWX A;  2V6C A;  3GZ6 A;  2R7U A;  4KFC A;  3JAM K;  3ZRG A;  4UUS B;  1HQC A;  1TWF J;  2VQC A;  4C2T A;  2E1N A;  4IQ4 A;  3QOD A;  5HNH A;  3E6C C;  2QEN A;  3LSK A;  3F8C A;  2GLO A;  4O3M A;  1K79 A;  3EUH A;  3AG2 H;  2TRT A;  2JSP A;  3OY9 A;  1I1G A;  1YW9 A;  1R1V A;  3E1S A;  4LLL A;  3I0T A;  1DUX C;  2R7V A;  2K9Q A;  3Q0U A;  2YU9 J;  3HYI A;  4HNV A;  2HGC A;  5J4V A;  2DBB A;  4CCK A;  2DT7 B;  2IBD A;  1F4K A;  4AID A;  2EJR A;  4A6D A;  2O8K A;  4RB3 C;  1Z91 A;  3M8J A;  3ZN1 A;  1HA8 A;  4BEH B;  2HFH A;  2ZME A;  2V1U A;  4MTE A;  3ZQH A;  1NK3 P;  1P92 A;  2FQ4 A;  3K70 D;  1K6O A;  2ZBK A;  5L3E A;  1D5V A;  3FF5 A;  1FTT A;  3R60 A;  5FD5 A;  4EM1 A;  3S32 A;  5FLM J;  3FXK A;  4FIS A;  3S93 A;  4I6Z A;  4C2U A;  3RJP A;  3MFK A;  5E3N A;  3AL0 B;  4HOB A;  4E70 A;  3BTJ A;  2LD5 A;  1R6R A;  2QQ8 A;  2VN2 A;  2YSR A;  4PUS A;  4M3F A;  1CF7 A;  2HDW A;  2HXO A;  4ZZL A;  1VQ6 I;  2K9L A;  4F3Q A;  4A3D J;  3S14 J;  4UVC A;  1Z9C A;  1FWZ A;  2WAF A;  3FM5 A;  1T0F A;  3PO3 J;  1WJB A;  2XV4 S;  3WTS C;  3CO6 C;  3WU0 A;  5LFA A;  2EK5 A;  3OSG A;  3BZK A;  1MND A;  3IP4 B;  1T0F C;  3SEQ A;  3I4M J;  4HDV A;  4BXF A;  2H94 A;  4NQW B;  2CO5 A;  2M3A A;  5D4S A;  2DPU A;  4L0Y B;  1O7F A;  2D1V A;  1UJ8 A;  3GF2 A;  4MHG A;  3GW2 A;  1XGO A;  1XGS A;  3MZY A;  2OTJ I;  5M5Y J;  4Y52 J;  2CFO A;  3QP5 A;  4HAM A;  4PFO A;  2W00 A;  2LFB A;  3QRF F;  2MA3 A;  3TO9 A;  2BVL A;  2A5W A;  4HYE A;  3EET A;  1MNE A;  3UNG C;  2ID3 A;  2NOJ B;  2YUS A;  1LDJ A;  4JX6 A;  2UXX A;  1IN6 A;  4RM3 A;  3A01 A;  2RC4 A;  1ENH A;  4L5J A;  2W25 A;  4XLH A;  3SFI A;  1HKQ A;  4XMY A;  4XN0 A;  3HOZ J;  1QBJ A;  2Q0O A;  2VPL A;  1BL0 A;  3CCU I;  2X1E A;  1PUF A;  3FBI B;  4AWX B;  2DA6 A;  2DFI A;  3FBN B;  5AIQ A;  2QYO A;  5BQT A;  1DPU A;  2Y31 A;  2IGM A;  3DEU A;  1X1B A;  4OIN F;  4XLF A;  2QBY B;  1J5Y A;  2KHM A;  2R92 J;  3RQI A;  4AUX A;  1A31 A;  3S1Q J;  3U1D A;  3DLA A;  3K6G A;  3LMM A;  2VJ4 A;  4RAF A;  4V2F A;  2P0W A;  1XCV A;  4L9V A;  4IHV A;  4IXA A;  1UHM A;  1SFX A;  3FIS A;  3BQZ A;  1Y39 A;  3ABM H;  1IN7 A;  3BR3 A;  2PJP A;  5K5Q A;  3QWL A;  1W5C C;  4M3B A;  2DXI A;  3MVP A;  3NAU A;  4G94 A;  2JRT A;  2DPD A;  3J7Y J;  1EF4 A;  1ZEL A;  2CG4 A;  1OYW A;  3V42 A;  2KMU A;  3OMY A;  3DKW A;  2LP0 A;  3HSR A;  2WAQ A;  5J8C A;  1J75 A;  3CES A;  4OMZ A;  1IJW C;  5CVR A;  4BXU A;  1G3S A;  2V9P A;  2CSO A;  5F6F A;  1GUU A;  3Q9V A;  4BQN A;  3W3C A;  3PFY A;  4HEA 2;  1ZQ3 P;  4EJO A;  4XSZ F;  4W1U A;  1ONV A;  3KZY A;  4ANJ A;  2M9H A;  2PI0 A;  4BL0 B;  5D5U B;  2G9W A;  1I50 J;  1MBF A;  1WPK A;  2GQQ A;  2M4K A;  1QNT A;  3NRV A;  5HDN A;  3HOS A;  4E7S A;  4RGX A;  5ICC A;  1DPR A;  4IHW A;  1LNW A;  2G7H A;  2OF7 A;  3GFL A;  4L9T A;  5KVR A;  3JRF A;  1IC8 A;  2YS9 A;  2ZO4 A;  4LB5 A;  3FXJ A;  1NK2 P;  3L2U A;  1B6A A;  1GHC A;  1FOX A;  4RGS A;  1HDP A;  4AYB A;  1YQA A;  2MH2 A;  1Z7U A;  1MW7 A;  2QGU A;  3OYK A;  3ZXS A;  4N0B A;  1NH3 A;  3KFW X;  1NG6 A;  4DQ2 A;  4CGZ A;  2LMD A;  1BC8 C;  1IZ1 A;  5E17 F;  3F72 A;  4XRM A;  4XON A;  2BVM A;  2FBI A;  4DBQ A;  1YRN B;  2IA2 A;  2L7M P;  3BPX A;  2R5Z A;  2O7O A;  3VFZ A;  5M3M J;  3CD6 I;  3G1M A;  4KIF A;  2HZD A;  2FML A;  4Y17 A;  3BC8 A;  1A04 A;  5EG0 A;  2ECB A;  2JA7 J;  3CTA A;  1QGP A;  3KET A;  2E1C A;  1I6H J;  1TQP A;  3ZMV A;  1WI9 A;  2XPU A;  3CP2 A;  3SZP A;  4A0X A;  2GIV A;  3C7J A;  3I9V 2;  3KCC A;  2LVS A;  4XOR A;  3A02 A;  3DKX A;  3A0B C;  3E6D A;  3EDP A;  2ZXI A;  1SD6 A;  2WB1 N;  2M34 A;  1VQP I;  2CU7 A;  3DLL F;  1X1P A;  2DFE A;  3A03 A;  2DTZ A;  4IOA F;  2NNY A;  2DA7 A;  1QPM A;  4ZTJ A;  1KQ9 A;  1B72 A;  2E34 A;  3ONQ A;  2WY7 Q;  4M9S A;  5M5X J;  3HGY A;  2M7A A;  3K4K A;  1YO5 C;  3PL8 A;  4A2U A;  2IGK A;  3BR6 A;  4HV5 A;  4PJN A;  3SXY A;  3NEU A;  2NS7 A;  3FXO A;  2P5K A;  1YOV B;  5HOO A;  2ID6 A;  3BG6 A;  4MEY F;  1HSJ A;  2TCT A;  1YJ9 I;  3I59 B;  4HSR A;  3N4M A;  4E7H A;  3CDI A;  2HYG D;  3OYN A;  2HU9 A;  1U3E M;  5HS8 A;  3IRQ A;  2MSY A;  1HKS A;  1OCO H;  3HTU A;  2JK3 A;  3FHZ A;  1QHH D;  4HF0 A;  4G9Y A;  1N78 A;  1SVM A;  2EFW A;  2CQN A;  3GZN B;  2EIL H;  2BY0 A;  4MIM A;  4P9F A;  3RKX A;  5FRO A;  5E3O A;  2K4B A;  2CMP A;  2IS2 A;  2LKP A;  2NYX A;  4XKB A;  1WRJ A;  3G1L A;  1IXR C;  4PDK A;  4RGU A;  3U2R A;  4BJ5 C;  2PMH A;  2LRD A;  5HLH A;  3WTT C;  4U88 A;  2E1M C;  2L9R A;  1W4M A;  1KU2 A;  2VBW A;  3LSG A;  2F6C A;  3HEF A;  2HOA A;  2UWM A;  5FFX A;  4H4K C;  2Y0S N;  4G6T B;  2KFD A;  1G3T A;  2E35 A;  1U5T B;  2IA0 A;  1G4D A;  2FXA A;  3GTL J;  1XB4 A;  2RRE A;  4DIQ A;  3AG4 H;  3D1N I;  1ZRF A;  4WCG A;  2PJR A;  4L5I A;  3RPU D;  4XM3 A;  5LRR A;  4BQA A;  3QQA A;  4IOC F;  5ILV A;  2X0L A;  4DYQ A;  3HOU J;  2E60 A;  3LSJ A;  5TIS C;  5F27 A;  1IRF A;  4C3J J;  1MBJ A;  2W24 A;  1RIO H;  1TQM A;  2DYR H;  4ZZD A;  3BLY A;  1Z3X A;  2P7V B;  2OQR A;  4UUS A;  5KK1 A;  2HVQ A;  3GCM A;  1WJA A;  3SZT A;  2M1B A;  2DA2 A;  5D8K B;  4ZYG A;  4RB2 C;  3PSI A;  3PNV A;  4HQM A;  4S05 A;  1X1A A;  2HQA A;  2BV6 A;  2F48 A;  1T39 A;  1TWG J;  3B6A A;  3KYD B;  1LDK B;  3HOX J;  1O3S A;  2F4O B;  4ESJ A;  1VQL I;  1RET A;  2V9K A;  1MKM A;  1T2K A;  3ESW B;  3S16 J;  2X51 A;  4I76 A;  1R7J A;  3CJN A;  5M3F J;  2QSG X;  2CUE A;  3LOC A;  1JXS A;  1O7L A;  4OAY A;  1MH3 A;  1X1D A;  3L7W A;  5EZH A;  3K0L A;  3BR5 A;  4DGW B;  5C3E J;  4I09 A;  1FSE A;  3PO2 J;  2XC7 A;  5F04 A;  3ZQC A;  2DMN A;  2ZME B;  2ME6 A;  2V1D A;  4CH7 A;  2STT A;  3SQN A;  1GV5 A;  3EUA A;  4MFD A;  2E1O A;  4BHC A;  3CCQ I;  1XSV A;  3ZGK A;  1T6S A;  3WU2 C;  4BEH A;  2GXA A;  3ZR8 X;  3TMO A;  4HZF A;  2VQG A;  3LQQ A;  3BY6 A;  4FET A;  4QIW N;  1ZTR A;  3BCA A;  3G2B A;  4ENK A;  2DJN A;  4F52 A;  3JRE A;  1LDD A;  1J7K A;  2EIN H;  3D0S A;  2IGO A;  3JCU C;  1S29 A;  3L1P A;  2ZJQ F;  4A3C J;  2GA1 A;  5B66 C;  2LY2 A;  3CMM A;  4UV8 A;  5CQG A;  1K6Y A;  3MKZ A;  2Q1Z B;  1Z7L A;  3CJT B;  3GEZ A;  5DUK A;  2GXB A;  1ITY A;  2K9N A;  2KIU A;  1N77 A;  3KIO A;  1LEA A;  2LBF A;  3P7N A;  1Y1W J;  2LLK A;  2HNH A;  2A5Y B;  2BW3 A;  4L9J A;  4HA8 A;  3H1C A;  4KA4 A;  2E7W A;  2F5C A;  2HTJ A;  2LOO A;  2M87 A;  1IO2 A;  2FF4 A;  1LJ9 A;  5EJC A;  3IAM 2;  1VQM I;  3K4L A;  5F0F A;  2VQH A;  4ABZ A;  1IG7 A;  1HW5 A;  3ZQG A;  4PK4 A;  1Z1D A;  2XPW A;  2BE5 F;  2BYV E;  2KIQ A;  5F08 A;  4DYC A;  4PGH A;  4CCL A;  2EFQ A;  1MBG A;  1BW6 A;  3HXL A;  4Y3O A;  2FU4 A;  1WH5 A;  5JR3 A;  2DQR A;  2DFH A;  5D6E A;  2YX7 A;  2Y9Y A;  2XVC A;  2H1L A;  2EB7 A;  2HQN A;  5D5X B;  4M6V A;  1B9N A;  4LIU A;  2JQ7 A;  1W5S A;  4PCQ A;  2CW8 A;  2D45 A;  2GM4 A;  3WGI A;  3HG9 A;  3QYB A;  5LEJ A;  2EQR A;  1XTA A;  1QZZ A;  5J1R A;  1FMV A;  2O03 A;  4D5F A;  2NVQ J;  5K5O A;  3WG9 A;  1BI2 A;  4F92 B;  2DQL A;  4HNU A;  2RAE A;  2DK5 A;  3BG7 A;  1UCR A;  1YX5 A;  5D5V B;  2R7O A;  4XID A;  1TW3 A;  1PJR A;  4FCY A;  2JA8 J;  3H5R A;  2E2H J;  1VQ8 I;  1T56 A;  3IWZ A;  3K4J A;  3BR2 A;  3LNQ A;  5LBQ A;  2IAI A;  3P5J A;  3BG9 A;  2XAS A;  3MZ8 A;  2KIM A;  3GVA A;  2LK2 A;  1YI2 I;  2DOD A;  2LR8 A;  3TW7 A;  4ENN A;  1R71 A;  5ICE A;  2P6T A;  1JKR C;  2A05 A;  1I3A A;  4M9X A;  3DU6 A;  4TV7 A;  5D5W B;  2L2O A;  2YX4 A;  4FX0 A;  4BE2 A;  2DMP A;  4UXN A;  3FDY A;  3U9G A;  3B73 A;  4UVA A;  3EQL F;  1GVJ A;  4XRS A;  4A5M A;  3ERM A;  3OYF A;  4MQV A;  3HRU A;  2LH9 A;  4I01 A;  1F5T A;  1D1C A;  3Q3S A;  4HF2 A;  2JVG A;  4UUV A;  3BJA A;  1BIB A;  3VYS B;  1XMK A;  5EEH A;  4C9Y A;  3JSP A;  2HDC A;  2DLL A;  2IEK A;  2VB6 A;  2VBZ A;  4ZDP A;  4A12 A;  1PUF B;  2XF7 A;  4UHT A;  1BJA A;  3OYC A;  2W85 A;  3I3L A;  1A6Q A;  1SFU A;  1TNS A;  3KZZ A;  3MQ0 A;  5KAF C;  4QWQ A;  3FX3 A;  1QO0 D;  2GXG A;  4LK0 F;  5HVQ C;  3OYE A;  3JRG A;  2PMU A;  2IPQ X;  3CDH A;  1LQ1 A;  2A3S A;  4WXD A;  5CYV A;  4AU7 A;  5FD6 A;  1MBH A;  3G73 A;  4E7L A;  1IF1 A;  2HI3 A;  2BZT A;  2XGX A;  5FLV A;  3J81 Z;  3OS1 A;  2V6E A;  3I59 A;  3QU6 A;  2FNP A;  1IXC A;  3DF8 A;  4U7B A;  2LDU A;  3V8K A;  1ZRC A;  2Q2E A;  2L9V A;  3CCY A;  4F55 A;  1BR4 A;  3L2W A;  2KRH A;  2Z16 A;  1ZGA A;  2JVH A;  2R3S A;  2QQA A;  5EG0 B;  4AD9 A;  4DZJ A;  4GO1 A;  3WG7 H;  2ZJR F;  1SAX A;  2LC2 A;  5F0C A;  3FK7 A;  1H0M A;  2Y48 A;  4ZTF A;  3KYC B;  3L00 A;  4AVP A;  1VQO I;  2X6X A;  3H0G J;  1U5T A;  1SC7 A;  1GLN A;  4O6J A;  4EGZ A;  4JOM A;  4M9Z A;  1WSU A;  1ZN2 A;  3CCR I;  1ETO A;  5K1Y A;  1I1S A;  1ETV A;  1U9N A;  3LL7 A;  3JR9 A;  2Z5U A;  3RYR A;  4LFU A;  4NQW A;  1PVE A;  5LLQ A;  3JRA A;  1W7P B;  4A0Y A;  2P81 A;  3T1B A;  4NC6 A;  3ZQL A;  4Q4Z F;  1F9N A;  3RZO J;  4X0G A;  1W36 D;  5TGT A;  3WGG A;  4EVI A;  3IWF A;  3R4K A;  4ITV A;  3I55 I;  2DDA A;  1NTC A;  4L0Z B;  4YEJ A;  3V7R A;  2R5Y B;  1G3W A;  3VYU B;  2LNB A;  4YFX F;  2CV0 A;  2XIG A;  1QRY A;  2ZFU A;  3QYE A;  5IOY A;  4ETS A;  5A2Q Z;  4I2O A;  3OS2 A;  3GFJ A;  5IT9 K;  1DDN A;  1JE8 A;  3GTQ J;  1USS A;  1UST A;  5DCM A;  3RKY A;  3E97 A;  5J4Y A;  3N05 A;  2DMT A;  2JSC A;  4L9N A;  4U0W A;  2AQF A;  3OYG A;  1MNM C;  1OCT C;  3HSE A;  4WF2 A;  3MKW B;  3CO7 C;  1LUJ B;  2KDZ A;  1XGN A;  1KU7 A;  1UZC A;  3TDZ C;  3LST A;  2COB A;  3LAP A;  3EUH C;  5ED4 A;  2O8X A;  2V26 A;  3QOE A;  1EV7 A;  3TGN A;  3K4C A;  2A07 F;  4BQO A;  4ESB A;  4IRG A;  3BT9 A;  2OQG A;  4IHS A;  5LHH A;  1YHQ I;  1KON A;  1KQ8 A;  1JTY A;  3JRD A;  4HLY A;  1TWH J;  1D3Y A;  2MBF A;  4XNF A;  1J09 A;  2Z3Y A;  4A3F J;  3ZQ7 A;  2BEO A;  1YJN I;  1YS6 A;  2MD5 A;  1FYM A;  5DV5 A;  3E6M A;  3SZG A;  2L54 A;  4FAS D;  2XGD A;  1A5J A;  3OOP A;  2HR3 A;  4P1W A;  4D0P A;  1B9M A;  5E1Z B;  3OWT A;  1SMY F;  1X2N A;  2EPF A;  2N8G A;  4IJA A;  2HWV A;  3IAS 2;  1H9T A;  4PSW A;  1YW7 A;  1VF9 A;  2KQR A;  3QYF A;  3KP4 A;  5DTD A;  1OCP A;  3HOW J;  1FP2 A;  1S3J A;  4OIQ F;  1SD4 A;  5L3G A;  2XB0 X;  1VQK I;  4WWC A;  3FXR A;  3PSF A;  1KZH A;  2QM3 A;  3OIO A;  5BNG A;  4ZH4 F;  4XL9 A;  1BR2 A;  1E3H A;  1TTY A;  3GTP J;  2Y75 A;  1IUF A;  3KEY A;  3TED A;  3R0A A;  4ON0 A;  1FNN A;  3AKZ A;  1KA8 A;  1X3U A;  5IP6 A;  1GVD A;  4B4C A;  3J80 K;  2GIZ A;  4FE7 A;  4WK8 F;  1O4X A;  2XAJ A;  5FJ8 J;  1JUS A;  1FIP A;  1JJ6 C;  2F4I A;  3DFG A;  1N75 A;  3RDI A;  3E3V A;  5FRM A;  3A4C A;  3DXJ F;  2OAZ A;  4HF1 A;  2OC6 A;  1E0E A;  1YYV A;  4YII A;  1W0U A;  3BG5 A;  2MD0 A;  3RTR A;  4UB8 C;  3CCS I;  4ZC3 A;  2ZME C;  2VIX A;  2MYS A;  3BR0 A;  4A3L J;  1RI7 A;  4JYK A;  4ZDL A;  2IS6 A;  3PNY A;  5IY5 H;  2EZL A;  4IHT A;  1ETK A;  2VXD A;  3TKY A;  2K7L A;  5CJ9 A;  1WJD A;  1R22 A;  3OYD A;  2M0C A;  2KIS A;  1I27 A;  2Z99 A;  4IL6 C;  3OYJ A;  2H09 A;  1PP8 F;  1BJZ A;  2EIM H;  1GT0 C;  3I64 A;  1OCZ H;  2DK8 A;  4U87 A;  4I99 C;  3F8B A;  4N9I A;  3DBR B;  2ZJ2 A;  3CUQ C;  4OAZ A;  2RNG A;  5CVI A;  1UG0 A;  4LB6 B;  4XRS G;  2BGC A;  2VT2 A;  4JX4 A;  4NBQ A;  3ZQF A;  3HPG A;  4BAC A;  1B4A A;  2Q8K A;  3FWE A;  4IO9 F;  1R4N B;  2L5Q A;  3GFI A;  2YPR A;  2OPT A;  1WVR A;  2PN6 A;  4KYW A;  2VLA A;  3CC4 I;  3HRM A;  1WQ2 A;  4BHP A;  3F9K A;  4BE1 A;  3CDL A;  3ASO H;  3IH4 A;  5DS9 A;  4CXF A;  2F5V A;  1X4P A;  5ICF A;  3I5U A;  2DAO A;  4E7I A;  2QSF X;  4KT5 C;  5GPA A;  4LG0 A;  2FE3 A;  2X4H A;  1F1Z A;  4MFE A;  1AKH A;  4PZJ A;  3EUK L;  5IP9 J;  3P9K A;  2WA0 A;  3K1M A;  3F21 A;  1H8A C;  1XSD A;  1OR7 A;  3ZMU A;  1DQU A;  2EA2 A;  5KHD A;  3U1K A;  3L2Q A;  4P55 A;  3TP3 A;  1JKO C;  4RLQ A;  4ZYE A;  5EGO A;  1VI0 A;  1ZG3 A;  4B8X A;  4CCJ A;  3TBI A;  1FYK A;  2QWW A;  4A69 C;  1FT9 A;  4GYG A;  3HOY J;  4X6A J;  5DYM A;  1YG2 A;  1V3F A;  2IA1 A;  4AC0 A;  3GZ5 A;  2BHY A;  3FMQ A;  2Z1D A;  1WH7 A;  3K2Z A;  4RAY A;  4XQF A;  4OOI A;  4HG2 A;  2HS5 A;  1UHW A;  1HC8 A;  3UR3 C;  2QUF A;  1Z21 A;  3F8F A;  1RKW A;  1APL C;  2EA4 A;  2FA5 A;  4RBO A;  1ZG5 A;  4E4H A;  4FQG A;  5GAD J;  5GAE J;  5J8F A;  5FRN A;  2HXI A;  3FMS A;  3W2A A;  2P5L C;  2P4W A;  2MC3 A;  5J1Y A;  1X3W B;  1PDN C;  2HYJ A;  3RI4 A;  1O3R A;  3T8R A;  4M6X A;  1OKR A;  1P4A A;  3DTI A;  2LYC A;  1P7I A;  1BM9 A;  3E5X A;  3COA C;  2ZXH A;  4A3J J;  2LG4 A;  2A6T A;  3FK6 A;  1E3O C;  5IYC J;  4IZZ A;  3KP7 A;  3IC7 A;  1HF0 A;  1S7O A;  4JP0 A;  5EGO B;  1TZL A;  4H0E A;  3WU1 B;  1T38 A;  1AU7 A;  2JWT A;  1EJ9 A;  2M4G A;  2KL4 A;  4IKF A;  1ETX A;  2IVM A;  3HJE A;  4LLG F;  3KYL A;  2Q2E B;  2HEO A;  2IS4 A;  2AO9 A;  2Y0S A;  2VUM J;  1B1B A;  3HKZ A;  1OFC X;  1UAA A;  2G7U A;  3DEW A;  2P5V A;  4KNY A;  4IQJ A;  3E7L A;  2DMQ A;  2VKV A;  2GAU A;  1UB9 A;  2ZCW A;  2OBP A;  1H88 C;  1Z67 A;  3M7G A;  1BR1 A;  3CUQ A;  3RPU A;  3TW6 A;  1KYW A;  2V1N A;  5D8L B;  3J7A O;  4CYC A;  3GLL A;  3OYL A;  4QPQ A;  1S7E A;  2FMY A;  3CC7 I;  4HW0 A;  4LD5 A;  4OIP F;  3RYP A;  4NC8 A;  5F0H A;  3FHN A;  2YR2 A;  4HDU A;  1RR8 C;  2Y2Z A;  3KEO A;  3BZC A;  1BA5 A;  5IYB J;  1LEB A;  2IJL A;  2XF6 A;  3IUO A;  3IH3 A;  3WTU C;  3WGH A;  2WWY A;  2E71 A;  1M1E B;  1FYL A;  4M3E A;  3BPV A;  3RIR A;  2NOG A;  4OU0 A;  1U8B A;  5F64 A;  2D5V A;  4P96 A;  2X9D A;  3WE2 A;  2E2I J;  3GTG J;  2EZH A;  3KLO A;  1BI0 A;  4XLE A;  2CV1 A;  6PAX A;  3KP2 A;  3GLX A;  3NWT A;  3OYB A;  5K5R A;  2LTP A;  3M4O J;  3V7S A;  4XLC A;  1SD7 A;  1R58 A;  1LE8 B;  4PJ0 C;  1FX7 A;  1ZGJ A;  2A68 F;  4KUM A;  4R79 A;  2KRC A;  3FXL A;  2OTL I;  2W1O A;  4BQQ A;  2B63 J;  4CSW A;  5KAI C;  4DYR A;  3N97 A;  3J7Z I;  3JAM Z;  1U0J A;  3IKT A;  2QVO A;  3JTH A;  4C2M J;  1VQN I;  3LFK A;  1I5Z A;  4LGW A;  3WHB A;  4DW6 A;  5HDK A;  1D0Y A;  3C2G A;  3ZMD A;  1LFP A;  2D2W A;  4AM3 A;  3ISP A;  4CCM A;  1RZ4 A;  4EV0 A;  1IN8 A;  1XMA A;  2IP2 A;  4PFP A;  1B59 A;  1S9H A;  3LQR A;  3DQV C;  5B5E C;  3S3O A;  1CGP A;  3HKZ N;  2RV8 A;  1R1U A;  2HKO A;  2PBI A;  2RKH A;  2F2E A;  4IHX A;  2HOS A;  1L3L A;  1EH7 A;  1P6R A;  1SFK A;  2ME0 A;  2JTV A;  5JLX A;  1ZLJ A;  5FGM A;  3Q0W A;  1XN7 A;  3LA7 A;  2ZJP F;  1QQI A;  1G8X A;  2DOE A;  3ECO A;  3DPT A;  4RMN A;  3DBL B;  1D8J A;  2O5R A;  2X85 A;  2EIJ H;  5HNF A;  2UZK A;  1ZKG A;  4DNC A;  3F8M A;  2CYY A;  3V8J A;  1YJW I;  3DPU A;  1YS7 A;  4IVN A;  4IRI A;  3MKY B;  3DV8 A;  2EIK H;  2OA4 A;  3LSH A;  1JJ8 C;  3S17 J;  3CMY A;  2VJJ A;  4BH9 A;  5H6Q A;  4WX9 A;  2RNJ A;  2EWN A;  1ULY A;  1Y0N A;  5EEG A;  1R49 A;  2WY8 Q;  4ZYD A;  2E19 A;  2CH0 A;  3OR1 C;  3V7C A;  1MBE A;  4U0Y A;  4HST A;  1O3T A;  1IV6 A;  1I6X A; 
#chains in the Genus database with same CATH homology
 4A6E A;  3GUD A;  4LG0 B;  1ZG1 A;  1ZAO A;  3E5U A;  2EFO A;  2NNN A;  3H3U A;  5HLG A;  3GX4 X;  1FBS A;  3ELK A;  1S8N A;  1SMT A;  5LGT A;  3JW4 A;  1HBX G;  4Y15 A;  3VB2 A;  2Z9O A;  3J81 K;  2FOK A;  5JFR A;  2WV0 A;  2FRH A;  1R00 A;  2FNA A;  5TJJ A;  5L3F A;  3ZMT A;  1ON1 A;  5DCM B;  2JZY A;  1KU9 A;  3MEX A;  1EH8 A;  1IN5 A;  2GWR A;  5DD4 A;  4JBA A;  3EYY A;  4M71 A;  2P8T A;  1K7A A;  1P4W A;  4UVB A;  3V8L A;  2Y0M A;  2VBX A;  2EFP A;  2OU2 A;  3GWZ A;  2XAQ A;  4YFK F;  3ZPL A;  4R8H A;  5H20 A;  2Z33 A;  4JK1 X;  2M45 A;  2C6Y A;  2IRF G;  3WTX C;  5E8G A;  1FBQ A;  1K78 B;  2AXL A;  2EV6 A;  1G3Y A;  2XKP A;  3HRS A;  2HOE A;  2L4M A;  1GXP A;  3PQJ A;  4M74 A;  3WE3 A;  5L3C A;  2P6S A;  3M1E A;  3S2W A;  2V9V A;  4MTD A;  1AOY A;  5AON A;  1IRG A;  4EM2 A;  3GYH X;  3SHF A;  3BP8 A;  1IUY A;  3PQK A;  2H6B A;  2CGP A;  2RDP A;  4HX8 A;  2O3F A;  2R7F A;  3I54 A;  1ZYR F;  4KN7 X;  2VT3 A;  1HKT A;  4YG2 F;  3J80 Z;  4XRF A;  2EV0 A;  2TDX A;  2PQ8 A;  3KP6 A;  1KU3 A;  4F7Z A;  4KDP A;  3QPH A;  4CO8 A;  1R1T A;  2EFN A;  2UXN A;  4HBL A;  3E6B A;  3L9F A;  4KIC A;  3Q9S A;  2VON A;  3I58 A;  4XBF A;  1BI3 A;  1T98 A;  3WTV C;  2XAG A;  4WXH A;  3EYI A;  1P2F A;  4OIR F;  2V1X A;  3RPQ A;  2VOO A;  1BIA A;  4EJT A;  1RNL A;  4IF4 A;  2COM A;  1E2X A;  1NHA A;  1IXS B;  3FXQ A;  4I98 B;  1XSX A;  1DP7 P;  3ZN0 A;  2W57 A;  2A69 F;  1Y0U A;  1S7A A;  1CF7 B;  4R1H A;  5LRS A;  5FLX K;  4GCV A;  2RGV A;  4LMY A;  3W6K B;  1D8K A;  4MNU A;  1OYI A;  2VE8 A;  4MQ9 F;  4PGG A;  3HHG A;  3K69 A;  5LGN A;  4B09 A;  4JQF A;  2WTE A;  2K27 A;  1XDU A;  3T5X A;  3IL2 A;  2H27 A;  1QZY A;  2F5D A;  3K1P A;  4AIJ A;  3K1N A;  4Q47 A;  3T8T A;  3TO6 A;  2QLZ A;  1MD0 A;  2O6G E;  1IW7 F;  2HYF A;  2L4A A;  2ISY A;  4EJW A;  3JTG A;  1AWC A;  4U0V A;  1FBU A;  1MDM B;  3GFM A;  1ZAR A;  2LSO A;  5DEQ A;  1K78 A;  3IHU A;  3WTZ A;  4S04 A;  1J9I A;  2ELH A;  1LVA A;  2A6E F;  4I0A A;  3MAJ A;  3F6V A;  2ISZ A;  2MH9 A;  1JGS A;  2YU3 A;  1BBY A;  4M72 A;  1O57 A;  4Q5S F;  3BJO A;  4I0B A;  3W6J B;  3IRR A;  4RGR A;  1ZLK A;  5FB2 A;  5LEK A;  2FEZ A;  1R23 A;  1U8R A;  1R5H A;  2D1H A;  2HQR A;  3Q5F A;  1STZ A;  2HZT A;  1U78 A;  3O2P E;  3H3Z A;  4EQQ A;  1KYZ A;  1ZRD A;  3D5L A;  2XKO A;  5BOX A;  1KQ0 A;  3C3W A;  3ZMS A;  4HQE A;  3FZV A;  3HIF A;  3H92 A;  2JT1 A;  5E20 A;  4LJZ F;  3C1D A;  1TW2 A;  1J2X A;  4KMU X;  2XRN A;  4Y13 A;  2ESH A;  4KN4 X;  1XDS A;  3DP7 A;  5LHI A;  4EMS A;  2GZW A;  5D6F A;  4ESF A;  2CFX A;  5BPD A;  2O0Y A;  3VOD A;  1IN4 A;  3ABT A;  4YFN F;  5DDG A;  1C0W A;  1EH6 A;  1YW8 A;  1FPQ A;  4IRH A;  4K2E A;  2XAF A;  5E1W A;  4Z2Y A;  5JVT A;  4XSX F;  3WOD F;  4RS8 A;  5FO5 A;  3L2C A;  3KLN A;  1MDM A;  1TQI A;  1BN5 A;  3L09 A;  4ZYH A;  5HDG A;  3M8F A;  1Z6T A;  5BPI A;  5E1X A;  3BOQ A;  2JPB A;  2QQB A;  3O3K A;  2FQ3 A;  5D4R A;  5J6X A;  4HX7 A;  1Z05 A;  2XHK A;  4GGG A;  3TO7 A;  5JHU A;  5ERI A;  1W7P D;  5BS6 A;  1G6N A;  3ABU A;  3BJ6 A;  5L3B A;  2PLY A;  4KMF A;  4U7D A;  4M73 A;  1FZP B;  1VTN C;  1OPC A;  4AIK A;  2PFB A;  3KP5 A;  5DD8 A;  2L01 A;  2F5E A;  3WTW C;  4CYD A;  2HTS A;  4FT8 A;  1RUO A;  4OMY A;  3NQO A;  4BHB A;  2NS0 A;  4YIF A;  2ESN A;  2J5O A;  5HS9 A;  1RUN A;  4L18 B;  4KIG A;  1MJ9 A;  4I02 A;  1ODD A;  2BBY A;  4RB1 A;  1ON2 A;  1YLF A;  2L3D A;  3F23 A;  5CVU A;  5CVJ A;  3I4P A;  4RAZ A;  2KJC A;  5A2Q K;  4MGR A;  4G6Q A;  2FBK A;  3HSF A;  4NB5 A;  3QP6 A;  1L0O C;  4I7H A;  3CUO A;  5DCF A;  1YTY A;  1O3Q A;  5IT9 Z;  1FY7 A;  2IT0 A;  2CQK A;  1U6G A;  2PEX A;  2QZ8 A;  2OZ6 A;  2DTR A;  3R61 A;  2DU9 A;  3ZMZ A;  1V4R A;  4KIB A;  3MZH A;  4N9H A;  3VEP A;  3HTS B;  5AIP A;  2F5F A;  1R5G A;  5LHG A;  2MLK A;  4P5O A;  3TOA A;  2XAH A;  1W7P A;  2QQ9 A;  5FFZ A;  1MZB A;  4EM0 B;  5JI6 A;  1FOK A;  2K4J A;  1FC3 A;  3F6O A;  2ZNY A;  3P9C A;  3GXO A;  4A5N A;  3R6S A;  3MWM A;  1TBX A;  4HX4 A;  2W84 A;  4GYI A;  4WXC A;  4MEX F;  3C18 A;  3HOT A;  3SFZ A;  5F1R A;  4BNC A;  4NHJ A;  3LWF A;  4LLN A;  2AS5 F;  3TOB A;  3LA3 A;  3QAH A;  1WKM A;  2ZKZ A;  3BDD A;  1J59 A;  3KEQ A;  4LK1 F;  3AAF A;  2XUB A;  4CZZ A;  1OMI A;  2CWE A;  2FBH A;  1GXQ A;  1SD5 A;  3BRO A;  2J5P A;  4AIH A;  1HW1 A;  5TRD A;  4CHU A;  5LGU A;  5BMZ A;  2VC0 A;  5E8I A;  4O5V A;  1U5T C;  3QU3 A;  2ADU A;  5HS7 A;  1MJA A;  5E18 F;  2VC1 A;  3M8E A;  3T0Y A;  1H9G A;  1SFE A;  3LAJ A;  2VOD A;  3F22 A;  2A61 A;  1BI1 A;  2M30 A;  2VXZ A;  3OV8 A;  3GO5 A;  3TQN A;  4CIC A;  1PUE E;  3I71 A;  3QOP A;  4P9U A;  4BYY A;  3G3Z A;  1MJB A;  1S6L A;  1W5T A;  2L02 A;  2DW4 A;  1Z6R A;  1ZH5 A;  1Q1H A;  3VOE A;  2M8E A;  2O61 A;  1P4X A;  4ASN A;  3BZ6 A;  2VE9 A;  2OD5 A;  3ROU A;  1YIO A;  4M6Y A;  4ENJ A;  5ILS A;  3FMR A;  2RQP A;  2VBY A;  3PFI A;  3BWG A;  3O6B B;  3KE2 A;  1HW2 A;  5HLI A;  4G7Z F;  2K02 A;  5ICG A;  1FSH A;  2EV5 A;  4G7H F;  3CLO A;  1KGS A;  2B0L A;  3ZP5 A;  2ACJ A;  3P9I A;  3RKW A;  2KIF A;  3KP3 A;  2R7D A;  4EJU A;  3B02 A;  5ILU A;  4CDG A;  4HV6 A;  2MLG A;  3JSO A;  1LB2 A;  4EJV A;  5FLX Z;  5CVV A;  1BOA A;  2XRO A;  3FM3 A;  1U2W A;  3QPT A;  2A6H F;  4FHT A;  3REO A;  1R36 A;  2PG4 A;  1XGM A;  2RN7 A;  3K9T A;  2DI3 A;  1TNT A;  4A0Z A;  1HST A;  3HRT A;  2ZNZ A;  3E5Q A;  3DPL C;  3F3X A;  3MCZ A;  3ML6 A;  2JPC A;  2GA2 A;  1JHH A;  4G7O F;  2H6C A;  3CUQ B;  4IPA A;  3ERE D;  2DO7 A;  1UFM A;  1FLI A;  1BC7 C;  2QBY A;  4UV9 A;  4FX4 A;  2STW A;  2ZXJ A;  3R0J A;  5H6R A;  4XLN F;  1FP1 D;  4G6D A;  2P7C B;  4GXO A;  2E7X A;  2WC2 A;  5L3D A;  3F8N A;  1ZHF A;  4UNO A;  3ULQ B;  2LF7 A;  3IKV A;  4RB0 A;  2KKO A;  2RVC A;  1REP C;  2NRA C;  4ENM A;  2NAZ A;  4HLX A;  1IAW A;  2VOP A;  5DUI A;  3ECH A;  2V79 A;  2KJB A;  3V4G A;  2KRF A;  2HKX A;  3TDU C;  4EGY A;  1XD7 A;  4BAY A;  4Q48 A;  1TLH B;  3WTY C;  2IW5 A;  4G8X A;  2DT5 A;  2ETH A;  1E17 A;  3LA2 A;  1ZRE A;  1OYY A;  4QLC U;  5IT3 A;  2M5W A;  1XCB A;  2CW0 F;  2FSW A;  2ZFW A;  1J0R A;  3HUG A;  3FXU A;  2OZU A;  3I53 A;  1YFH A;  2K86 A;  1HXD A;  4XLP F;  1PP7 U;  2LF8 A;  3M9A A;  3HHH A;  1JHF A;  1MGT A;  5CLS A;  4OIO F;  1WWX A;  2V6C A;  3GZ6 A;  4KFC A;  3JAM K;  1HQC A;  2E1N A;  3E6C C;  2QEN A;  3F8C A;  4O3M A;  1K79 A;  3EUH A;  1I1G A;  1YW9 A;  1R1V A;  4LLL A;  3I0T A;  1DUX C;  3HYI A;  2HGC A;  2DBB A;  1F4K A;  2EJR A;  4A6D A;  4RB3 C;  1Z91 A;  3ZN1 A;  2HFH A;  2ZME A;  2V1U A;  4MTE A;  1P92 A;  1K6O A;  2ZBK A;  5L3E A;  1D5V A;  3FF5 A;  3R60 A;  5FD5 A;  4EM1 A;  3RJP A;  3MFK A;  4HOB A;  4E70 A;  2VN2 A;  2YSR A;  1CF7 A;  4ZZL A;  4UVC A;  1Z9C A;  1FWZ A;  3FM5 A;  1T0F A;  2XV4 S;  3WTS C;  3CO6 C;  3WU0 A;  2EK5 A;  4HDV A;  2H94 A;  2DPU A;  2CO5 A;  4L0Y B;  5D4S A;  1O7F A;  2D1V A;  3GF2 A;  4MHG A;  3GW2 A;  1XGO A;  1XGS A;  3MZY A;  3QP5 A;  4HAM A;  3QRF F;  2MA3 A;  3TO9 A;  4HYE A;  3EET A;  1LDJ A;  2UXX A;  1IN6 A;  2RC4 A;  4L5J A;  2W25 A;  1HKQ A;  1QBJ A;  2Q0O A;  4AWX B;  5AIQ A;  2DFI A;  2QYO A;  5BQT A;  1DPU A;  3DEU A;  4OIN F;  2QBY B;  1J5Y A;  3U1D A;  1XCV A;  4L9V A;  4IXA A;  1UHM A;  1SFX A;  1IN7 A;  2PJP A;  5K5Q A;  4G94 A;  2DPD A;  2JRT A;  2CG4 A;  1OYW A;  3DKW A;  3HSR A;  5J8C A;  1J75 A;  4OMZ A;  5CVR A;  4BXU A;  1G3S A;  2CSO A;  5F6F A;  3Q9V A;  4EJO A;  4XSZ F;  1ONV A;  3KZY A;  2PI0 A;  5D5U B;  2G9W A;  2GQQ A;  1QNT A;  3NRV A;  5HDN A;  3HOS A;  4RGX A;  5ICC A;  1DPR A;  1LNW A;  2G7H A;  3GFL A;  4L9T A;  5KVR A;  2ZO4 A;  4LB5 A;  1B6A A;  1GHC A;  4RGS A;  1YQA A;  2MH2 A;  1Z7U A;  4N0B A;  3KFW X;  4DQ2 A;  4CGZ A;  1BC8 C;  1IZ1 A;  5E17 F;  3F72 A;  2FBI A;  2IA2 A;  3BPX A;  3VFZ A;  4KIF A;  2FML A;  4Y17 A;  1A04 A;  3CTA A;  1QGP A;  3KET A;  2E1C A;  1TQP A;  3ZMV A;  1WI9 A;  3SZP A;  4A0X A;  2GIV A;  3C7J A;  3KCC A;  3E6D A;  3EDP A;  1SD6 A;  2NNY A;  1QPM A;  1KQ9 A;  4M9S A;  1YO5 C;  4A2U A;  4HV5 A;  3SXY A;  3NEU A;  2P5K A;  5HOO A;  4MEY F;  1HSJ A;  3I59 B;  3N4M A;  2HYG D;  1U3E M;  5HS8 A;  3IRQ A;  1HKS A;  3HTU A;  3FHZ A;  4HF0 A;  4G9Y A;  2EFW A;  4P9F A;  3RKX A;  2K4B A;  2LKP A;  2NYX A;  1WRJ A;  1IXR C;  4PDK A;  4RGU A;  3U2R A;  2PMH A;  5HLH A;  3WTT C;  4U88 A;  1W4M A;  1KU2 A;  2VBW A;  2UWM A;  5FFX A;  1G3T A;  1U5T B;  2IA0 A;  1G4D A;  2FXA A;  1XB4 A;  1ZRF A;  4WCG A;  4L5I A;  5LRR A;  4BQA A;  5ILV A;  2X0L A;  1IRF A;  2W24 A;  1RIO H;  1TQM A;  4ZZD A;  2P7V B;  2OQR A;  5KK1 A;  4ZYG A;  3SZT A;  5D8K B;  2M1B A;  4RB2 C;  4HQM A;  4S05 A;  2BV6 A;  1T39 A;  1LDK B;  1O3S A;  4ESJ A;  1MKM A;  1T2K A;  1R7J A;  3CJN A;  1JXS A;  1O7L A;  3L7W A;  3K0L A;  4I09 A;  1FSE A;  2ZME B;  2V1D A;  2STT A;  3SQN A;  4BHC A;  1XSV A;  1T6S A;  4HZF A;  3LQQ A;  3BY6 A;  4ENK A;  1LDD A;  1J7K A;  3D0S A;  1S29 A;  2GA1 A;  4UV8 A;  3GEZ A;  5DUK A;  2GXB A;  2KIU A;  1LEA A;  3P7N A;  2A5Y B;  4L9J A;  4HA8 A;  4KA4 A;  2E7W A;  2F5C A;  2HTJ A;  2M87 A;  2FF4 A;  1LJ9 A;  1HW5 A;  1Z1D A;  2BE5 F;  2BYV E;  4PGH A;  2EFQ A;  2FU4 A;  5JR3 A;  2DQR A;  5D6E A;  2YX7 A;  2XVC A;  2EB7 A;  2HQN A;  5D5X B;  1B9N A;  1W5S A;  4PCQ A;  2D45 A;  3WGI A;  5LEJ A;  1QZZ A;  2O03 A;  5K5O A;  3WG9 A;  1BI2 A;  2DQL A;  2DK5 A;  1UCR A;  5D5V B;  1TW3 A;  3IWZ A;  5LBQ A;  2XAS A;  2KIM A;  3GVA A;  4ENN A;  5ICE A;  2P6T A;  4M9X A;  4TV7 A;  5D5W B;  2YX4 A;  4FX0 A;  4UXN A;  3U9G A;  3B73 A;  4UVA A;  3EQL F;  1GVJ A;  4A5M A;  4MQV A;  3HRU A;  1F5T A;  4I01 A;  4HF2 A;  4UUV A;  3BJA A;  1BIB A;  1XMK A;  5EEH A;  3JSP A;  2HDC A;  2DLL A;  2VBZ A;  4A12 A;  4UHT A;  1BJA A;  2W85 A;  1SFU A;  1TNS A;  3KZZ A;  3MQ0 A;  4QWQ A;  3FX3 A;  1QO0 D;  2GXG A;  4LK0 F;  5HVQ C;  2PMU A;  2IPQ X;  3CDH A;  1LQ1 A;  2A3S A;  4WXD A;  5CYV A;  5FD6 A;  3G73 A;  1IF1 A;  2XGX A;  3J81 Z;  3I59 A;  3QU6 A;  2FNP A;  1IXC A;  3DF8 A;  4U7B A;  2LDU A;  3V8K A;  1ZRC A;  2Q2E A;  1ZGA A;  2R3S A;  2QQA A;  4AD9 A;  4GO1 A;  1SAX A;  1H0M A;  2Y48 A;  3L00 A;  4AVP A;  1U5T A;  4O6J A;  4EGZ A;  4M9Z A;  1WSU A;  1ZN2 A;  5K1Y A;  1I1S A;  2Z5U A;  3RYR A;  4LFU A;  4NQW A;  5LLQ A;  1W7P B;  4A0Y A;  3T1B A;  4Q4Z F;  1F9N A;  3WGG A;  4EVI A;  3IWF A;  3R4K A;  4L0Z B;  3V7R A;  1G3W A;  4YFX F;  2LNB A;  2XIG A;  4ETS A;  5A2Q Z;  4I2O A;  3GFJ A;  5IT9 K;  1DDN A;  1JE8 A;  1USS A;  1UST A;  5DCM A;  3RKY A;  3E97 A;  4L9N A;  2JSC A;  4U0W A;  3HSE A;  4WF2 A;  3CO7 C;  1XGN A;  1KU7 A;  3TDZ C;  3LST A;  3LAP A;  5ED4 A;  2O8X A;  3TGN A;  1EV7 A;  2A07 F;  4ESB A;  4IRG A;  2OQG A;  4IHS A;  5LHH A;  1KQ8 A;  4HLY A;  1D3Y A;  2MBF A;  2Z3Y A;  3ZQ7 A;  2BEO A;  1YS6 A;  2MD5 A;  1FYM A;  5DV5 A;  3E6M A;  2L54 A;  3OOP A;  2HR3 A;  4D0P A;  1B9M A;  5E1Z B;  1SMY F;  4IJA A;  2HWV A;  1H9T A;  1YW7 A;  3KP4 A;  1FP2 A;  1S3J A;  4OIQ F;  1SD4 A;  5L3G A;  4WWC A;  3FXR A;  2QM3 A;  4ZH4 F;  1TTY A;  2Y75 A;  3R0A A;  4ON0 A;  1FNN A;  1KA8 A;  1X3U A;  3J80 K;  4WK8 F;  2XAJ A;  3DFG A;  3RDI A;  3E3V A;  3DXJ F;  2OAZ A;  4HF1 A;  1YYV A;  4YII A;  3RTR A;  1RI7 A;  4IHT A;  3TKY A;  2K7L A;  5CJ9 A;  1R22 A;  1I27 A;  2Z99 A;  2H09 A;  1PP8 F;  3I64 A;  2DK8 A;  3F8B A;  4N9I A;  2ZJ2 A;  3CUQ C;  5CVI A;  4LB6 B;  2BGC A;  2VT2 A;  1B4A A;  2Q8K A;  3FWE A;  3GFI A;  2YPR A;  2PN6 A;  4KYW A;  3HRM A;  1WQ2 A;  4BHP A;  4CXF A;  5ICF A;  3I5U A;  2DAO A;  4KT5 C;  4LG0 A;  2FE3 A;  2X4H A;  1F1Z A;  4PZJ A;  3P9K A;  3K1M A;  3F21 A;  1XSD A;  1OR7 A;  3ZMU A;  2EA2 A;  4P55 A;  4ZYE A;  1ZG3 A;  4B8X A;  1FYK A;  2QWW A;  1FT9 A;  4GYG A;  5DYM A;  1YG2 A;  1V3F A;  2IA1 A;  3GZ5 A;  3FMQ A;  3K2Z A;  4RAY A;  4OOI A;  2HS5 A;  1UHW A;  2QUF A;  3F8F A;  2EA4 A;  2FA5 A;  1ZG5 A;  5J8F A;  3FMS A;  2P5L C;  2P4W A;  2MC3 A;  1PDN C;  3RI4 A;  1O3R A;  3T8R A;  4M6X A;  1OKR A;  1P4A A;  1BM9 A;  3E5X A;  3COA C;  3KP7 A;  3IC7 A;  1S7O A;  4H0E A;  3WU1 B;  1T38 A;  2IVM A;  4LLG F;  2HEO A;  1B1B A;  2G7U A;  2P5V A;  4KNY A;  2GAU A;  1UB9 A;  2ZCW A;  2OBP A;  3M7G A;  3CUQ A;  3RPU A;  5D8L B;  1KYW A;  3J7A O;  2FMY A;  4HW0 A;  4LD5 A;  4OIP F;  3RYP A;  2YR2 A;  4HDU A;  3KEO A;  1LEB A;  2IJL A;  3WTU C;  2WWY A;  3WGH A;  1FYL A;  3BPV A;  3RIR A;  4OU0 A;  5F64 A;  4P96 A;  3WE2 A;  3KLO A;  1BI0 A;  6PAX A;  3KP2 A;  3GLX A;  5K5R A;  3V7S A;  1SD7 A;  1R58 A;  1FX7 A;  1ZGJ A;  2A68 F;  4KUM A;  4R79 A;  3N97 A;  3JAM Z;  3IKT A;  2QVO A;  3JTH A;  3LFK A;  1I5Z A;  4LGW A;  5HDK A;  3ZMD A;  2D2W A;  3ISP A;  1RZ4 A;  4EV0 A;  1IN8 A;  1XMA A;  2IP2 A;  1B59 A;  3LQR A;  3DQV C;  1CGP A;  2RV8 A;  1R1U A;  2HKO A;  2PBI A;  2RKH A;  2F2E A;  1L3L A;  1EH7 A;  1P6R A;  2JTV A;  1ZLJ A;  5FGM A;  1XN7 A;  3LA7 A;  1QQI A;  3ECO A;  3DPT A;  1D8J A;  2UZK A;  4DNC A;  3F8M A;  2CYY A;  3V8J A;  1YS7 A;  4IVN A;  4IRI A;  3DV8 A;  2OA4 A;  4BH9 A;  5H6Q A;  4WX9 A;  2RNJ A;  2EWN A;  1ULY A;  5EEG A;  4ZYD A;  3V7C A;  4U0Y A;  1O3T A;  1I6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...