4WCGA

The binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
PISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVRKHPQHPVWYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF112
publication title The Structure of the Cyprinid herpesvirus 3 ORF112-Z alpha Z-DNA Complex Reveals a Mechanism of Nucleic Acids Recognition Conserved with E3L, a Poxvirus Inhibitor of Interferon Response.
pubmed doi rcsb
source organism Cyprinid herpesvirus 3
molecule tags Dna binding protein
total genus 21
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wcgA00
3TDUC 3FZVA 4OU0A 3IKTA 1K79A 3KETA 4RB1A 3KP3A 3ROUA 3K1NA 1FPQA 1XCVA 3H92A 2P4WA 1K7AA 1KYZA 2FNPA 3GFLA 3LAPA 5FLXK 3RYRA 2G7UA 4Q4ZF 2R7DA 4K2EA 2DO7A 3CJNA 1KA8A 1RI7A 2ZO4A 1W7PA 1B6AA 3T5XA 3PFIA 2JPBA 2D2WA 1ZREA 4G7OF 4PDKA 4LG0A 4AIJA 3EETA 4L18B 2AXLA 2OZ6A 5FO5A 2ESNA 2VT2A 2XV4S 1F9NA 4U0YA 3TQNA 1XDSA 1KU7A 1HKQA 3WTXC 1XGNA 1WSUA 2M5WA 5LRSA 2GXGA 5ICCA 1FC3A 4CYDA 3HOTA 2EA2A 2STTA 5BS6A 2E7XA 4LD5A 2JTVA 4HV5A 4Y13A 2KJBA 4R1HA 1XDUA 5J8CA 3CUQC 1U2WA 1ZN2A 1OR7A 2XAHA 1FBQA 2H94A 4ETSA 4BQAA 4XSXF 2COMA 3FWEA 5ICGA 2VBYA 1F4KA 1OYYA 1SFUA 1D3YA 2O03A 1P92A 1TQMA 3C18A 2HOEA 4U0WA 3KP2A 2RV8A 1R58A 4ZZLA 3JSOA 3COAC 2FMYA 2PJPA 2ZNZA 5LHIA 4KNYA 2BV6A 1YFHA 1O57A 5L3BA 4LFUA 1IN8A 1ZAOA 5J8FA 1W7PD 2F5DA 3BWGA 1S7OA 2QBYB 4XBFA 4O5VA 2CG4A 3E5XA 2EV5A 3HTSB 3G3ZA 1LVAA 1V3FA 1ZHFA 2A5YB 2P8TA 2IJLA 4L0YB 2UXNA 4RGUA 4KICA 4U0VA 1IN4A 2K27A 4KMUX 3GX4X 3JTHA 4MNUA 1YW7A 2ELHA 3S2WA 2LKPA 2LF7A 4GXOA 2CYYA 4Y15A 3I4PA 3P9CA 3NQOA 1W7PB 2MD5A 1SD6A 1PP7U 2ACJA 4A6DA 4WXHA 3KP5A 1QBJA 2XROA 2DW4A 4LJZF 1XN7A 3D5LA 3M7GA 2C6YA 4LG0B 4FHTA 5K5OA 4ENJA 3R4KA 1BC7C 3OOPA 3WE2A 4YFKF 3M1EA 1R5HA 2XGXA 2M8EA 1O3TA 4IPAA 4CO8A 1XGMA 2NNYA 1UHMA 2GAUA 5E8IA 5A2QZ 5D4RA 4U7DA 3K0LA 1F1ZA 1SMTA 1ZRCA 1R1VA 4YIIA 3CUOA 5E17F 2FBIA 3KZYA 1LNWA 2VXZA 5LEJA 4DQ2A 3ZPLA 3SHFA 1BI0A 1XB4A 4XLNF 1HKTA 1Z6RA 4EGYA 3HSRA 4E70A 5ICFA 2DU9A 2HKXA 1QZZA 2H6BA 4HBLA 2XKOA 2ISZA 3IHUA 3LA3A 1T38A 2DQLA 1DPRA 2FXAA 3BJAA 3KEOA 5E1XA 2JT1A 3SXYA 4HQMA 1JE8A 3WTSC 3NEUA 3GEZA 3WGHA 1HBXG 3FXRA 2W25A 1FNNA 1ZGAA 5E1WA 4WWCA 1ODDA 3LAJA 5AIQA 3ZP5A 3KLNA 3P7NA 2BE5F 5HLHA 3ISPA 3B73A 3WGGA 3GZ6A 4CGZA 1DDNA 4KYWA 2HQNA 1DPUA 4ESJA 3KP7A 1Z6TA 3RKWA 3RDIA 2IP2A 1GHCA 1ZGJA 2VC0A 4EVIA 3F23A 4EJWA 3V7RA 1TW3A 5FD6A 1FYMA 1J59A 3I59A 1ZRDA 4L9JA 1K6OA 3J81K 4Q5SF 1T6SA 4HZFA 4LK0F 3TO6A 3F72A 3DKWA 3VEPA 2RVCA 2H6CA 3RYPA 1YQAA 4MHGA 2EA4A 3FMRA 1AWCA 1EH8A 2NYXA 3HUGA 5HOOA 1ZG1A 2FOKA 1FSHA 3JTGA 4KN7X 4S04A 2YX4A 3E97A 3LFKA 3DQVC 2LDUA 5CYVA 5HS7A 3DPLC 4EM2A 3T8TA 2BBYA 2F5CA 4ENNA 3QU3A 4AIHA 1JGSA 3RIRA 3TOBA 4L0ZB 5LBQA 3J7AO 5J6XA 2A07F 3ZMDA 3O3KA 2QENA 2VN2A 4IXAA 5D8LB 1W5SA 1TLHB 4L9TA 4R8HA 1FYLA 4MEXF 2GXBA 5E1ZB 2Q0OA 4A6EA 2NS0A 5ED4A 2Z3YA 1U78A 1W5TA 5HVQC 1RZ4A 3I64A 3GW2A 2DFIA 5LHHA 3F6VA 4LK1F 3L9FA 5K5QA 4QWQA 2BEOA 3ZN0A 1LEBA 4M6XA 1XMKA 4RB3C 1KYWA 2IW5A 5DCFA 3QAHA 1P2FA 4BH9A 4L9NA 1HSJA 5CJ9A 4FT8A 3F22A 4L9VA 3WU0A 3REOA 4NQWA 4BHBA 2A6EF 2DK8A 4O3MA 3DP7A 1TNTA 3FM5A 1VTNC 2UWMA 1REPC 4RS8A 4AIKA 2LNBA 2CQKA 1EV7A 4MEYF 2HFHA 1FX7A 1KU2A 1SD4A 4PGGA 4I0AA 1IAWA 2O8XA 4IHTA 3W6KB 3VOEA 3GUDA 4EQQA 1BIAA 1HKSA 1HW1A 1MKMA 1Z1DA 3VFZA 1FLIA 3TDZC 1FP2A 1GXQA 3P9IA 3FXUA 2FU4A 2A69F 5BQTA 1HXDA 3GVAA 1S29A 4IRHA 4ZYHA 3BROA 3I59B 4KDPA 4UUVA 3KP6A 1SMYF 2QQAA 4EM1A 3DFGA 1J7KA 2P6SA 4EGZA 1FSEA 4A5MA 2CSOA 1HW5A 2WTEA 5E8GA 4KFCA 1YG2A 4YG2F 2L54A 5DCMA 1JXSA 2FQ3A 3ECHA 2W85A 1PDNC 1I27A 1O3QA 5CVRA 4U88A 5F6FA 3D0SA 4M9ZA 3F6OA 4F7ZA 1K78B 4LB6B 1BM9A 5D4SA 3RI4A 4ZYGA 3CUQA 1BBYA 4HX4A 2ZBKA 2NNNA 1XSXA 4B09A 5CVJA 2XAQA 1G3SA 2QM3A 2VODA 3FMQA 3AAFA 2A61A 2PMUA 5IT3A 3R6SA 1ULYA 5JHUA 3L09A 5BMZA 3WTTC 1TQIA 2EFWA 2YX7A 2QVOA 1AOYA 3U9GA 2PI0A 3DV8A 1WI9A 4XLPF 4EJVA 5A2QK 1CF7A 2OQGA 2HDCA 2JSCA 4P96A 4EM0B 1KU9A 1MDMA 1BJAA 3BY6A 4N9HA 1B9MA 1J2XA 1WRJA 2OBPA 2ISYA 3R0AA 3GXOA 4M71A 4UNOA 1ON1A 1YTYA 2MH9A 2TDXA 3WTYC 3HHHA 1TBXA 4UV9A 2P5VA 4CICA 2R3SA 2HYGD 3TKYA 1X3UA 4AVPA 4I01A 1XGOA 3DXJF 1XCBA 3EUHA 1T2KA 4WK8F 3WGIA 1Q1HA 1I1SA 2FBKA 2UXXA 1YW9A 4HDUA 2OD5A 4HOBA 4BAYA 2RN7A 2ADUA 1BI2A 4HF2A 3Q9SA 3NRVA 1WQ2A 4Y17A 3F8MA 2HWVA 2RGVA 5FFZA 2MH2A 1EH6A 4NHJA 3JAMZ 1EH7A 1G4DA 2XVCA 1S7AA 4JBAA 1Y0UA 3ML6A 1IZ1A 4IRGA 5LGNA 1MD0A 3M8EA 2JRTA 3M8FA 1ZYRF 2ZNYA 5DD4A 4RB2C 1GXPA 3IWFA 2RKHA 2L4MA 4ON0A 4CDGA 3DEUA 2NRAC 2X0LA 2GA2A 2PN6A 5KK1A 1LEAA 2QQBA 3C3WA 5DCMB 1FWZA 2PQ8A 1LB2A 2RQPA 3KFWX 1MJAA 2OAZA 4HF1A 1ON2A 3FXQA 4I98B 4UV8A 4WXDA 3WODF 4XRFA 3U1DA 3C1DA 1YIOA 2J5PA 4MQ9F 4IRIA 2V9VA 4LGWA 6PAXA 1IN5A 3CUQB 3H3ZA 5H6QA 3L2CA 3L00A 4MQVA 3LQQA 1XD7A 4Z2YA 3I5UA 4HV6A 1V4RA 4A5NA 3BJ6A 2ZCWA 2EFPA 1H9TA 1KQ9A 1MJ9A 4BHCA 1STZA 2WC2A 3MEXA 1RIOH 1T98A 1USTA 5L3EA 2HS5A 5LGTA 2PFBA 1H9GA 1CF7B 1A04A 1U5TC 3L7WA 4ESBA 3QP6A 3KLOA 1YO5C 1T39A 1MDMB 3KP4A 2BGCA 4HDVA 2MLGA 4KT5C 5HDNA 5CVIA 1P4WA 3WU1B 2HYFA 4GYIA 4RGRA 1IXRC 1P4XA 3ZQ7A 1FT9A 2P7VB 3I0TA 5ERIA 4IVNA 2HTSA 1USSA 4YIFA 3CO7C 5TRDA 4R79A 3I53A 2EJRA 4UVCA 4BHPA 2OZUA 4AWXB 2L01A 3N4MA 4M9XA 2MLKA 2F2EA 5E18F 4ZYEA 1BC8C 2Q2EA 4KMFA 2K86A 4M6YA 2FSWA 3VODA 3HHGA 3K1MA 3F8NA 5D8KB 2VE8A 4M9SA 4ENKA 1YS7A 2K4JA 2DPUA 4M73A 1IXCA 4CZZA 1TTYA 1L3LA 1Z9CA 3MAJA 2AS5F 3GFJA 4LMYA 1I1GA 5HLIA 2PMHA 3JSPA 4OINF 5FGMA 1SFXA 4FX4A 2O0YA 3IL2A 2P7CB 2EFNA 5LLQA 1O3SA 2F5EA 1PP8F 3MZYA 5LRRA 1YS6A 5DEQA 1J9IA 2OA4A 2O61A 3T8RA 1LQ1A 2XHKA 4A2UA 2EV6A 1U3EM 1K78A 2G7HA 2M45A 2EK5A 2VBXA 3MZHA 2EV0A 3LSTA 1IN6A 3RTRA 1XMAA 1I6XA 2PG4A 1TNSA 4UVAA 1BOAA 3KZZA 1UB9A 3K2ZA 3TO9A 2P5LC 2MC3A 2RDPA 3E3VA 5DUIA 3RKYA 3V7CA 4KIBA 3ECOA 2CW0F 2CWEA 4HF0A 2VOOA 2M30A 2RC4A 4G9YA 3QOPA 2YR2A 3IKVA 2Y0MA 1MGTA 4A0ZA 3Q5FA 1L0OC 2BYVE 4OIQF 4KIGA 2QUFA 2FRHA 3E6MA 1QZYA 4A12A 1Z91A 3E5UA 1DUXC 1FP1D 5EEGA 1R23A 4MGRA 3WG9A 2FBHA 5D5VB 4G94A 4ESFA 1RUOA 4RAZA 4D0PA 2M87A 3H3UA 1OYIA 1MZBA 1XSDA 3ZMUA 2Z9OA 3J80Z 5ILVA 2L02A 1G3TA 1ZG5A 5DV5A 3EQLF 1J75A 5F1RA 5D6EA 2DAOA 2MBFA 4PZJA 2ZFWA 3T0YA 1IUYA 4CXFA 3FF5A 3GYHX 1QO0D 1RNLA 3K69A 2Q8KA 4MTDA 3P9KA 2JZYA 2ETHA 1FOKA 2DK5A 4G7ZF 3GO5A 5KVRA 4AD9A 4ZYDA 1S6LA 3WTWC 4OIOF 3F8BA 2EB7A 4OIPF 1RUNA 3ABUA 2JPCA 3SQNA 3WE3A 5DD8A 2KIUA 1IW7F 4HX7A 1LDKB 4EJUA 4GCVA 3E5QA 3MFKA 2XUBA 1LJ9A 1D5VA 4YFNF 1B59A 2DT5A 3FHZA 4HAMA 3TOAA 3HRMA 4RB0A 2O6GE 2ZKZA 1JHFA 4EV0A 3JAMK 3DF8A 2IPQX 2KIFA 4HA8A 2XKPA 5BPIA 2IT0A 2Y75A 1P6RA 4ZH4F 5JI6A 2DLLA 4UXNA 2NAZA 1B4AA 4KN4X 3LQRA 3K1PA 3CLOA 5IT9Z 2KIMA 4NB5A 4HLYA 3QRFF 4YFXF 4ENMA 2P6TA 3RPQA 1P4AA 3V8JA 2EWNA 2YU3A 4I02A 2FNAA 3F21A 4IF4A 4LLLA 3HRSA 2DPDA 3R61A 2XAGA 4GGGA 5HLGA 3MWMA 2OQRA 1FYKA 5LGUA 3BPXA 4ZZDA 1D8JA 2WWYA 4EMSA 3IRQA 2KJCA 2WV0A 1YYVA 3ULQB 4HLXA 4IJAA 1QNTA 3QPTA 4OOIA 2A6HF 3MCZA 1MJBA 3ABTA 4P9FA 3ZMVA 1FBSA 5BOXA 2DBBA 4P5OA 5BPDA 4FX0A 4G6DA 3ERED 1FY7A 2A3SA 2IVMA 2LF8A 5DYMA 3PQJA 1O3RA 5H20A 3RPUA 3BOQA 4EJTA 4TV7A 4UHTA 2D45A 3TO7A 1GVJA 5HDGA 5JR3A 2HQRA 4BXUA 1PUEE 2J5OA 1IF1A 5JFRA 4G7HF 4H0EA 2K4BA 2B0LA 3WTVC 3ZMTA 2CO5A 2HTJA 5DDGA 2VBZA 3QP5A 1G3WA 2L4AA 1ZRFA 1XSVA 5HS9A 1ZLJA 2OU2A 5LEKA 3C7JA 2YSRA 5CVUA 3V8LA 2GWRA 4I09A 3F8CA 2V1XA 4JQFA 4S05A 3R0JA 2K02A 2FEZA 1J0RA 4I7HA 2W84A 2VT3A 2ZMEA 3G73A 1QGPA 2FF4A 4KA4A 2QLZA 4BYYA 5ILUA 3IC7A 1CGPA 3HRUA 1SD7A 5AONA 4MTEA 3HIFA 2DQRA 5FLXZ 5H6RA 2M1BA 4RGXA 1U8RA 5CLSA 1C0WA 3EYIA 2PEXA 3FX3A 4P9UA 4BNCA 3B02A 1T0FA 1HQCA 1IRFA 5ICEA 2F5FA 2HGCA 2UZKA 1R22A 3DPTA 2HEOA 4PCQA 4OMYA 5D5WB 4GO1A 2XAJA 5D6FA 2FE3A 4WX9A 3SZTA 1R36A 1R7JA 3W6JB 4Q47A 1WWXA 4N0BA 1BIBA 4B8XA 1U5TA 2Z5UA 4Q48A 3BZ6A 3LWFA 5E20A 4RAYA 3T1BA 1I5ZA 3BJOA 4L5IA 2Z99A 3ZMZA 3R60A 1KQ8A 2H27A 4I2OA 1S8NA 2IA0A 4OMZA 4EJOA 2D1VA 2E1CA 3V4GA 3RJPA 4HW0A 5L3CA 3HRTA 1SAXA 3LA7A 1UCRA 5FFXA 3EYYA 5L3GA 3KCCA 1QPMA 5JVTA 3VB2A 2CGPA 3KE2A 4HX8A 1R1TA 5K5RA 1O7FA 1TW2A 5D5UB 1JHHA 4OIRF 1DP7P 4G6QA 1KGSA 4M74A 5D5XB 1B1BA 3N97A 4ASNA 3U2RA 1NHAA 2ZJ2A 5CVVA 1SD5A 2XASA 1YLFA 1KU3A 3OV8A 3KEQA 4P55A 4A0YA 3J80K 1F5TA 3O2PE 2ESHA 1OPCA 2H09A 2FMLA 1BI3A 2VE9A 1HSTA 2P5KA 3IWZA 3E6CC 2HR3A 3FMSA 1FBUA 1R5GA 1YW8A 1LDDA 2IRFG 2YPRA 3MQ0A 5F64A 1OKRA 2V1UA 2HKOA 2O3FA 1IXSB 2ZMEB 4KUMA 2VC1A 2K7LA 1G6NA 4LB5A 3HSFA 3WTUC 4G8XA 2QYOA 3O6BB 2E7WA 2W24A 2V6CA 3ZMSA 3F8FA 2STWA 2IA2A 4PGHA 1J5YA 1ZARA 1ONVA 2CFXA 3I54A 1OMIA 4DNCA 3ELKA 3PQKA 4A0XA 5ILSA 2HZTA 2PLYA 2G9WA 1Z05A 3GWZA 3GFMA 5AIPA 3FM3A 1KQ0A 2XAFA 1U5TB 1G3YA 4CHUA 4XSZF 1B9NA 5IT9K 2GA1A 1QQIA 5DUKA 3BPVA 4WF2A 2GQQA 3CDHA 4N9IA 4WCGA 2XIGA 4IHSA 3CTAA 1SFEA 2VBWA 1O7LA 4QLCU 5FD5A 4L5JA 1ZH5A 1W4MA 1Z7UA 3GZ5A 1UFMA 2IA1A 2LSOA 5TJJA 1H0MA 4JK1X 3HSEA 4RGSA 3GLXA 1UHWA 5LHGA 3BDDA 3CO6C 2KKOA 3RKXA 4WXCA 1BN5A 2RNJA 1U6GA 1D8KA 2VOPA 4GYGA 2GZWA 3IRRA 2R7FA 5FB2A 3V7SA 5K1YA 2D1HA 1R00A 5L3FA 3JW4A 3HOSA 3QU6A 4M72A 3M9AA 3I71A 1FZPB 3EDPA 2V79A 4HYEA 1ZLKA 3GF2A 3HYIA 2MA3A 3QPHA 2QQ9A 2GIVA 5HS8A 3ZN1A 3Q9VA 2EFOA 2DI3A 2Y48A 4UVBA 2KRFA 2QWWA 4HQEA 5EEHA 5HDKA 2L3DA 3LA2A 4KIFA 4LLNA 2ZXJA 3WTZA 2A68F 3F3XA 3E6BA 2PBIA 3I58A 3V8KA 2EFQA 2DTRA 4U7BA 1R1UA 3TGNA 3HTUA 2FA5A 1IN7A 3E6DA 1OYWA 1E17A 4LLGF 2W57A 3GFIA 1ZG3A 2X4HA 2E1NA 3SFZA 1E2XA 2XRNA 4O6JA 4I0BA 1WKMA 1BI1A 1LDJA 2V1DA 1TQPA 2QBYA 3SZPA 1S3JA 2Z33A 2VONA 1HW2A 3J81Z 1XGSA 3K9TA 3BP8A 5L3DA 2QZ8A 1IRGA
chains in the Genus database with same CATH superfamily
3TDUC 2KLOA 2DA3A 3FZVA 4OU0A 3IKTA 3BQZA 3OYBA 1K79A 2E34A 1X1PA 4RM2A 3OYAA 3KETA 1ZKGA 4JX5A 2E1MB 2HOTA 4RB1A 1P9QC 2LOOA 3KP3A 2R7VA 3ROUA 3BG7A 3K1NA 1FPQA 2HZDA 4XQFA 5FKLA 1XCVA 3CP2A 2Y30A 3H92A 1MW7A 2P4WA 1K7AA 3G2BA 1KYZA 2FNPA 3GFLA 2XSDC 4QPOA 3LAPA 5FLXK 4FTHA 2AQEA 3OIQA 2NS7A 3RYRA 2G7UA 4Q4ZF 2R7DA 2BVMA 4C2TA 3M4OJ 4K2EA 2DO7A 4J01A 3CJNA 2BXZA 1KA8A 1EA3A 1RI7A 2ZO4A 4RM3A 3OWTA 1W7PA 2BY2A 3BZKA 4D1QA 1K83J 1B6AA 3T5XA 3PFIA 2JPBA 3I4NJ 1ETOA 3SYTA 1EKEA 2FUG2 2TCTA 4XRSA 1AHDP 1G8XA 2D2WA 1UHSA 1Y8QB 4YEJA 1ZREA 4G7OF 4PDKA 4LG0A 2QCOA 1OCOH 4AIJA 2CQXA 3Q0UA 5F0HA 3EETA 2JWTA 2VQGA 4L18B 4IQ4A 2AXLA 3KYCB 3CMYA 1UZCA 2OZ6A 5FO5A 2ESNA 2VT2A 1JKOC 1FIAA 2XV4S 1F9NA 2VJ4A 1MBKA 4U0YA 2O8KA 1V55H 3TQNA 4OAZA 2KZVA 1XDSA 2W4SA 1KU7A 3PJRA 1HKQA 3WTXC 3FK7A 1XGNA 1WSUA 2R7OA 2M5WA 3K4BA 2XB5A 5FKMA 4DZPA 5GTIC 1WJFA 4LIVA 5LRSA 5GTHC 2GXGA 5EZHA 2KZGA 3P5JA 5ICCA 2VI6A 1N75A 1FC3A 4CYDA 3HOTA 1I39A 3H35A 4HNVA 5EJCA 3OYFA 2JVHA 1XTAA 2EA2A 2STTA 5B1AH 5BS6A 2E7XA 4C30A 3I3LA 4LD5A 4A3FJ 2Q1ZB 1NK3P 3CCMI 2JTVA 4HV5A 1BJZA 4Y13A 2KJBA 3W2VA 4R1HA 2ZJRF 1XDUA 3KIOA 3W3CA 5J8CA 3LNQA 3CUQC 1U2WA 4KITB 2WAQN 1ZN2A 3BZCA 1OR7A 3OMYA 5J40A 3N05A 5CPRB 2XAHA 1ETWA 1FBQA 2H94A 4LITA 4X0GA 2Z2SB 4ETSA 4BQAA 4XSXF 1S5LC 2COMA 3FWEA 5ICGA 4DBRA 2VBYA 4IL6C 3S93A 1OCRH 1F4KA 1OYYA 2BHZA 1SFUA 4FASD 1D3YA 2O03A 5EZGA 2H8RA 1P92A 3C18A 1TQMA 3QOEA 1HDPA 2HOEA 2XSJC 1NG7A 5FRNA 1Z77A 4U0WA 3KP2A 3VYRB 2RV8A 3CC7I 2XGDA 1R58A 4BBRJ 4ZZLA 3CMEI 2LREA 2DFFA 2WAFA 3JSOA 4BACA 1YJWI 1VI0A 3ABLH 3DU5A 3COAC 4DYQA 2K9SA 2FMYA 3VYSB 2PJPA 2ZNZA 5LHIA 4HEA2 4KNYA 3CCSI 2K9LA 4AYBA 2BV6A 1YFHA 4XNFA 1O57A 1WJDA 5L3BA 2L9RA 4LFUA 1IN8A 1OR7C 1ZAOA 2R92J 3PL8A 2ZSHB 3HL2A 9ANTA 5M3FJ 4HNTA 5J8FA 1W7PD 3M1CA 2F5DA 1QHGA 3BWGA 1IG7A 4BBSJ 1S7OA 5BNGA 2QBYB 5B3SH 3A01A 4XBFA 1Z3XA 3CCUI 3VWBA 4O5VA 3LMMA 1DU0A 3AG1H 1UAAA 1IV6A 2CG4A 3E5XA 4UUSA 2VKDA 4BDYA 2EV5A 3HTSB 3G3ZA 1FOWA 2DXIA 5IOZA 2HDWA 1VQ8I 4XMYA 1X1CA 1BR4A 5LD2C 1FTZA 1LVAA 3BTIA 1V54H 1V3FA 2HOSA 3GTGJ 1ZHFA 4BS9A 2A5YB 2P8TA 2IJLA 3B6AA 1OJLA 3O8GA 4L0YB 2UXNA 4RGUA 1VQPI 4KICA 4U0VA 1LE8A 3S2DJ 1IN4A 2K27A 2LG4A 4KMUX 3BG3A 2XRLA 3GX4X 2YUSA 1HC8A 4CCLA 2XF6A 3JTHA 5GADJ 4JX6A 4MNUA 1YW7A 3S1RJ 2ELHA 3S2WA 2LKPA 2LF7A 4GXOA 2W48A 2CYYA 4Y15A 3I4PA 3IAS2 3P9CA 3NQOA 3DBHB 1W7PB 2EZIA 2MD5A 1W5CC 1SD6A 4E7IA 1PP7U 2ACJA 4Y3OA 2M7BA 2X6YA 4A6DA 4WXHA 1WFXA 3KP5A 1JGGA 1QBJA 1JUSA 2XROA 2DT7B 2DW4A 4LJZF 2PJRA 1WH5A 4PFPA 1XN7A 5F27A 3D5LA 3OYCA 1Z21A 3OL4A 3CF5F 3M7GA 2IEKA 2C6YA 2ME0A 2EQRA 3TW6A 4LG0B 3BR0A 4FHTA 5K5OA 3OSGA 4RLQA 1A35A 4ENJA 3H5NA 3R4KA 1BC7C 3OOPA 3WE2A 1RC9A 1I6HJ 4YFKF 3M1EA 3BR1A 1R5HA 2WADA 3HPHA 2VJJA 4E7KA 1MSEC 5DM7F 2XGXA 3CJRB 2M8EA 2UUZA 1O3TA 4IPAA 4CO8A 2MSYA 3OYLA 3CDIA 2OTJI 1XGMA 2NNYA 1UHMA 2LLKA 2GAUA 5E8IA 5A2QZ 4IHVA 2K3FA 2L9VA 5D4RA 4U7DA 3K0LA 3RCOA 1F1ZA 2F48A 4W97A 1FEXA 1SMTA 3PM1A 1ZRCA 1N25A 3BTJA 4RDUA 1R1VA 4YIIA 2XPUA 3MKLA 4XIDA 3BR5A 3CUOA 5E17F 2FBIA 3HEFA 3CC4I 3KZYA 1LNWA 2VXZA 3GLLA 5LEJA 4MO7A 4DQ2A 3ZPLA 3SHFA 4EATA 1D1AA 4FCYA 5HNFA 1BI0A 2WBMA 1XB4A 1M1EB 1MBEA 1U9NA 4XLNF 1HKTA 1Z6RA 4EGYA 3HSRA 3AFHA 4E70A 3FK6A 5ICFA 5M3MJ 2DU9A 2HKXA 1QZZA 2F4IA 3PUBA 2H6BA 4HBLA 2XKOA 3FXLA 2KISA 3IHUA 1MH3A 3LA3A 2DQLA 1DPRA 3TMOA 4B4CA 1T38A 2FXAA 1W1WE 3BJAA 3FHNA 3KEOA 3A2KA 1JI8A 5E1XA 2JT1A 3SXYA 2YU9J 4HQMA 1JE8A 3WTSC 3JRHA 3NEUA 1R5ID 3S3MA 5HNHA 2L7MP 3GEZA 4PSXA 3ZQQA 3WGHA 5E3LA 1HBXG 3FXRA 1HLVA 2W25A 1FNNA 2K3PA 3HPGA 1LFBA 1ZGAA 5E1WA 4WWCA 1ODDA 3LAJA 5AIQA 2JK3A 2CV0A 3ZP5A 5IP7J 3KLNA 1A6QA 5KCMA 3P7NA 2BE5F 3OS1A 2M0MA 5HLHA 4B48A 3ISPA 1OCCH 3B73A 3WGGA 3GZ6A 1LPQA 3DKYA 4CGZA 1DDNA 1NG6A 1OCTC 4KYWA 1WGXA 3D5RC 3AL0C 4C3JJ 3SEQA 3H5AA 1ERDA 2HQNA 1J09A 2AXTC 3QPLA 4BKXA 2B63J 1DPUA 4IZZA 2DMQA 4ESJA 3KP7A 3OOUA 2HDDA 1Z6TA 3RKWA 3K4LA 3DEWA 3RDIA 4UUSB 2IP2A 1GHCA 3GTOJ 3I4MJ 1ZGJA 2VC0A 3K4NA 4D7MA 4EVIA 4BJTA 3F23A 1MBFA 3EUKL 4EJWA 3V7RA 1TW3A 2XC7A 1E3OC 2LH9A 2BW3B 5FD6A 1FYMA 1QHHD 4KT6A 2V4JC 4B3AA 4DJAA 4A3JJ 3OYEA 1J59A 2JA8J 2W82A 1RKTA 4ITVA 3I59A 1ZRDA 4XONA 4L9JA 1K6OA 2MYSA 2DMPA 3E0JB 3J81K 4Q5SF 1T6SA 4HZFA 1SAUA 4RAGA 4ZYAA 3RZDJ 1LE8B 4LK0F 3TO6A 3F72A 3DKWA 3VEPA 2RVCA 4B43A 2H6CA 3RYPA 4XICA 1QRYA 1YQAA 2R7SA 1R6RA 4MHGA 2NVXJ 2EA4A 3FMRA 2ZJPF 1AWCA 1EH8A 2NYXA 3PNYA 2LKSA 5JLXA 5F0FA 3ZQIA 3HUGA 5HOOA 1ZG1A 2FOKA 1FSHA 2AQFA 2XF7A 3JTGA 4KN7X 4CCJA 3LSGA 2GOMA 2QF7A 4S04A 2YX4A 3PUFA 3E97A 4CUGA 3LFKA 3DQVC 2LDUA 5CYVA 4XKBA 5HS7A 2HPIA 2ECBA 3DPLC 5E79C 4EM2A 2BY3A 3T8TA 2BBYA 2F5CA 4ENNA 2PJRB 3LSHA 4P1WA 3QU3A 4MIMA 1BW5A 1TWCJ 3UR3C 2BZTA 1HCRA 4CA0A 4AIHA 2DN0A 3IH4A 2M0CA 1JGSA 3CCRI 1MNDA 3RIRA 1SVLA 3TOBA 3CF2A 4J19A 1YI2I 5J3LA 2KDZA 3FXMA 2JMWA 4L0ZB 5LBQA 1VQLI 3J7AO 2DA2A 5J6XA 2A07F 3ZMDA 3O3KA 2QENA 2VN2A 4IXAA 4I6ZA 3H9JA 2AHQA 5D8LB 1W5SA 1X2MA 1TLHB 2FOWA 3FDYA 4L9TA 4R8HA 1FYLA 4MEXF 2GXBA 5E1ZB 2M8GX 2WY7Q 2Q0OA 4A6EA 3U21A 2CQQA 2NS0A 3MZ8A 4AU7A 4BE1A 1FOYA 2JA5J 2X1EA 3SDBA 2IS1A 4E7SA 1E3PA 2E5ZA 3G1MA 5ED4A 2Z3YA 3I55I 4ZTFA 1U78A 1JT0A 2DT6A 1JKRC 1SFKA 3KEYA 1MBJA 1W5TA 2IGMA 5HVQC 1RZ4A 1X3WB 2XPWA 3VYUB 2VQHA 4II3A 3VPRA 5IP6A 3HOUJ 3I64A 3GW2A 2DFIA 2L5QA 1OCPA 2CW8A 4M3DA 2EPFA 5LHHA 3F6VA 1X3ZB 4LK1F 3L9FA 2K85A 5K5QA 5C4JJ 1D0YA 3DTIA 5JHFA 1BA5A 4YRVA 4QWQA 2BEOA 3ZN0A 1LEBA 3BR3A 3AL0B 2I8DA 4M6XA 1X1DA 1MNEA 1XMKA 4RB3C 1KYWA 4A93J 2IW5A 5DCFA 3QAHA 1P2FA 5FKKA 2EBIA 4BH9A 1JKQC 4L9NA 4BE2A 4XM3A 1ZTRA 2CMPA 4XLEA 1HSJA 4NUBA 4BE0A 1X4PA 1LFUP 1APLC 1FOXA 4ZJZA 5CJ9A 2LVSA 2XF5A 4FT8A 3F22A 1VQ4I 5C3EJ 5TGTA 4L9VA 3WU0A 2LFBA 3REOA 4NQWA 4BHBA 2A6EF 2DK8A 4I99C 4O3MA 3DP7A 1TNTA 4HSRA 1UMQA 5K7FA 3V42A 3DLLF 3DWLE 2NOJB 3FM5A 1VTNC 2UWMA 2VL8A 1REPC 4RS8A 4AIKA 3HOZJ 2LNBA 3GTKJ 2XB0X 2CQKA 1EV7A 4ZDPA 1UELB 4MEYF 2HFHA 1FX7A 4BQOA 3CZ6A 1KU2A 1SD4A 3HZJA 4PGGA 4I0AA 1IAWA 2M9HA 1Y8RB 2O8XA 4IHTA 4CCMA 3W6KB 3LSJA 4PK4A 3VOEA 3GUDA 1XC5A 4EQQA 1BIAA 1HKSA 3HOYJ 1HW1A 1MKMA 1Z1DA 3VFZA 2DTZA 1FLIA 2IS6A 1WZ2A 1WJEA 3TDZC 2LY1A 2PX9A 1R4MB 3J7AY 3CMMA 3HGYA 1B72A 1FP2A 1GXQA 2NOGA 3P9IA 2L7KA 3FXUA 2FU4A 2A69F 5BQTA 3TL4X 5J4YA 5FJ8J 1HXDA 2WB1N 2Y0SA 3A03A 2CUEA 3OYMA 5K7ZA 1D0XA 2A5WA 2E2HJ 3GVAA 1S29A 4IRHA 4ZYHA 3BROA 3K4KA 3I59B 4KDPA 4CH7A 4UUVA 3KP6A 1SMYF 3X2QH 4CCNA 2HXIA 4D7NA 3OL3A 2QQAA 3D5SC 4EM1A 4GRIA 3DFGA 1XS9A 1J7KA 1MMNA 1ETVA 2LBFA 2X51A 2P6SA 1D5YA 4EGZA 1FSEA 2R0QC 4ABZA 5IYBJ 4XLCA 4A5MA 1A6IA 2TRTA 2CSOA 3A0BC 1HW5A 1ORKA 2WTEA 5E8GA 1DGRM 4BY1J 2R5ZB 4KFCA 1RR7A 1YG2A 4YG2F 4XRMA 2L54A 1T33A 3HUGB 1MMSA 5DCMA 2IGOA 1JJ8C 1G2HA 1JXSA 2FQ3A 3ECHA 3A0HC 2GBYA 2QSFX 2W85A 2KIQA 2MFZA 3O8HA 1I27A 1PDNC 1O3QA 5CVRA 4U88A 5F6FA 3D0SA 4Y7NJ 4M9ZA 4B1RA 4BU2A 3F6OA 1TP4A 1WJCA 2V1NA 3VDXA 4DZJA 4F7ZA 1K78B 4LB6B 3F0CA 1BM9A 4XORA 5D4SA 1I3QJ 3RI4A 4M3FA 4IKFA 4ZYGA 3CUQA 4N4NB 1BBYA 4HX4A 4AVZA 2XPVA 4XLHA 2ZBKA 2NNNA 1XSXA 5M5XJ 4B09A 2KL4A 5CVJA 2R7QA 2XAQA 1G3SA 4A3BJ 2X48A 1LVKA 2QM3A 2R7XA 2M3AA 2VODA 3FMQA 3AAFA 2A61A 2PMUA 2M2EA 1VQNI 5IT3A 3R6SA 2CV1A 1ULYA 3S14J 5JHUA 4IO9F 3L09A 3RZOJ 5BMZA 3WTTC 2DCEA 2RQQA 1TQIA 1F43A 2E5NA 2EFWA 3FBIB 2YX7A 2QVOA 1AOYA 4IHWA 1PJRA 3U9GA 4DYRA 3M8JA 4ANJA 2R5YA 2PI0A 1ZR2A 2M7AA 3DV8A 4H4KC 1WI9A 4XLPF 3HB9A 3HOWJ 2DOEA 4EJVA 5A2QK 1CF7A 2OQGA 2DFEA 2HDCA 2RNGA 4M6VA 2JSCA 4P96A 2X1DA 2GIZA 3W6VA 4N4OB 4EM0B 2ISZA 1KU9A 2ZJQF 1MDMA 2CUZA 4XRSG 1BJAA 2PMZA 2XGCA 3BY6A 1PVEA 3G4SI 1ZGWA 2WAEA 4N9HA 1B9MA 1J2XA 2VASA 1WRJA 2OBPA 3PO3J 2ISYA 2JA2A 3R0AA 2K40A 3GXOA 4M71A 3KPHA 4UNOA 1ON1A 1VQKI 2W1OA 4NQWB 4Y4RA 4C3IJ 2KPMA 2MH9A 1YTYA 2TDXA 3WTYC 3HHHA 2Z16A 3AKZA 4HPQA 1TBXA 4A69C 3KZIC 4PUSA 3A02A 3WHBA 4UV9A 2WA0A 1YITI 5IPAA 1DU6A 3TBIA 2EH3A 2V7FA 2LTPA 2HI3A 2P5VA 1VF9A 3E7LA 4RAFA 2E60A 4CICA 3FIWA 2LD5A 2R3SA 2HYGD 3ZQCA 1QU3A 3CMAI 3TKYA 1X3UA 4AVPA 2E2JJ 4I01A 2FD5A 1XGOA 1X58A 3M07A 3DXJF 1XCBA 3EUHA 1T2KA 1ZQ3P 4WK8F 3WGIA 1Q1HA 2K9NA 1I1SA 2FBKA 2UXXA 3ABMH 1YW9A 3G1LA 5GP9A 1KONA 3K70C 4HDUA 3MKWB 4BQQA 2OD5A 3JRDA 3FISA 4HOBA 3S2HJ 1WH7A 3NWSA 4NC6A 4BAYA 2RN7A 2DDAA 2ADUA 1BI2A 4HF2A 3Q9SA 2CJJA 3NRVA 4QSHA 4B44A 1B72B 1WQ2A 4Y17A 3F8MA 5FKOA 2HWVA 4V2GA 2BW3A 2RGVA 5FFZA 2MH2A 1EH6A 4NHJA 1R9TJ 3JAMZ 1EH7A 2XDVA 1G4DA 1IDYA 4DYCA 2DMTA 2XVCA 2NVYJ 1S7AA 4JBAA 4HG2A 2VKHA 1AA7A 1Y0UA 3RSNA 4XKWA 3HGGA 1TWFJ 1IZ1A 3ML6A 3K7AJ 2E36A 4W1UA 1GVDA 2X9DA 1GV2A 3LSKA 4IRGA 5LGNA 1MD0A 2IS2A 1AKHA 2VQCA 3M8EA 1X1BA 4LOCA 2JRTA 3M8FA 5EYRA 2LBFB 1ZYRF 2ZNYA 5DD4A 4RB2C 1GXPA 4CCOA 3IWFA 2RKHA 2L4MA 3EUHC 4F3QA 2JA7J 4ON0A 5FLMJ 1DGWY 4CDGA 3DEUA 4A3GJ 2NRAC 5CKTA 1Z7LA 3H0GJ 2X0LA 2GA2A 1VFCA 3CCYA 2PN6A 5KK1A 2R7UA 1LEAA 2QQBA 3C3WA 5DCMB 3BG5A 1FWZA 4EEFG 2A6TA 2CRGA 2PQ8A 2VIXA 1H8AC 1Y6IA 2R4GA 4X6AJ 1LB2A 1F36A 4GFBA 2EZKA 2RQPA 3KFWX 1MJAA 2V26A 2OAZA 4HF1A 3L1PA 1ON2A 3FXQA 4I98B 4E7JA 3BCBA 4UV8A 4WXDA 2DFHA 3WODF 2COBA 2X85A 4XRFA 3U1DA 3C1DA 1YIOA 2J5PA 2X1CA 4MQ9F 4YELA 2EINH 3SFIA 4A3EJ 1N77A 4IRIA 3S15J 4A3IJ 2V9VA 2ZC2A 4LGWA 6PAXA 1IN5A 3CUQB 3H3ZA 3ONQA 3PO2J 5H6QA 2HVRA 3PNVA 3S3NA 3L2CA 2HU9A 2EILH 3L00A 1WPKA 1XMXA 4MQVA 4ZTJA 1IV8A 3LQQA 2DMUA 1GUUA 1XD7A 2NXNB 4Z2YA 5B1BH 3CCEI 3I5UA 2QA4I 2OJED 3J7YJ 3S16J 4AM3A 4RMNA 4HV6A 3H9QA 1V4RA 4A5NA 1VQ9I 1TWGJ 1MIJA 3BJ6A 2ZCWA 1Y1VJ 3JRAA 3CCVI 1P7JA 2H1LA 2EFPA 1OFCX 4QPQA 1H9TA 3NWTA 1KQ9A 1MJ9A 4BHCA 4PJNA 3OSFA 2CQNA 1STZA 2WC2A 3MEXA 1RIOH 1T98A 1B8IA 3D1NI 2R5YB 3GBGA 5C44J 1USTA 2OF7A 5L3EA 2HS5A 5LGTA 2PFBA 1TWAJ 1PYVA 4XKVA 1H9GA 1CF7B 3HKZN 3S3OA 3LSMA 1A04A 1U5TC 3L7WA 4ESBA 3IAM2 3QP6A 3KLOA 1YO5C 3BR6A 1T39A 1MDMB 1V5FA 3KP4A 2BOLA 2BGCA 1S72I 4HDVA 2MLGA 4KT5C 3LSIA 5HDNA 1H88C 2DOAA 5CVIA 1P4WA 3WU1B 2HYFA 4GYIA 4PJ0C 4RGRA 1IXRC 1P4XA 4HRIA 3ZQ7A 1FT9A 2P7VB 1D1BA 3I0TA 5ERIA 4GDFA 4IVNA 4F91B 2HTSA 2CU7A 2CUJA 1USSA 2JVGA 2KRCA 4YIFA 4IOCF 3CO7C 4A3KJ 1MBHA 3FBNB 1S9HA 5TRDA 4R79A 3I53A 2EJRA 4UVCA 1WJ5A 3CLQA 2BHYA 3PIOF 2MW8A 4BHPA 2OZUA 4AWXB 2L01A 3N4MA 1T8IA 1SFOJ 2CV2A 4M9XA 2MLKA 2MG4A 1RRJA 3RQIA 2F2EA 5E18F 4ZYEA 1RR8C 2H1KA 2Z1DA 3HXLA 2IGNA 2OV7A 1VNDA 5EEAA 3W2AA 1BC8C 2Q2EA 4KMFA 2K86A 2DJIA 4F52A 4M6YA 2FSWA 4OWRB 3VODA 1YOVB 1XPXA 3HHGA 3K1MA 3KYLA 1FIPA 1QA6A 3F8NA 2YS9A 2VUMJ 5D8KB 2VE8A 4M9SA 2V9PA 4OAYA 3H1CA 4ENKA 2K4JA 1WVRA 1YS7A 3LFUA 3MD2A 3OR2C 2DPUA 3S8PA 3SDGA 4M73A 2QEXI 1IXCA 1EF4A 2L7FP 1ZR4A 3Q0VA 4CZZA 1TTYA 4E4HA 1ZK8A 1L3LA 2NS8A 2JSPA 3PNTA 1MSFC 1Z9CA 2WAQA 3IV5A 1WJBA 3K10A 3MAJA 4FE4A 2AS5F 3GFJA 2KFDA 5IYDJ 4LMYA 1I1GA 4U87A 5HLIA 2PMHA 3KYDB 3JSPA 1OLTA 4OINF 3Q3SA 2ELKA 2VKEA 4XOTA 5FGMA 1SFXA 4FX4A 2Y31A 2O0YA 3IL2A 2P7CB 1AKHB 2EFNA 5LLQA 2JRMA 4E7HA 1O3SA 2F5EA 1PP8F 4IEJA 4FETA 1K4SA 3MZYA 3RKQA 2HXOA 2R5ZA 5LRRA 2F4OB 5F04A 5B66C 5IYCJ 1K6YA 1YS6A 5DEQA 1J9IA 2Y9YA 1V5EA 1X1AA 2OA4A 3K6GA 4AUXA 1A31A 2O61A 3T8RA 4M3BA 1LQ1A 2XHKA 4A2UA 4NC7A 3G6EI 2EV6A 1U3EM 1P7IA 3CCLI 4D9JA 1Y39A 4DIQA 3TW7A 2BVLA 2I5UA 2CFOA 1K78A 1T95A 4XR6A 2G7HA 1LKXA 2M45A 2KMUA 2VJ5A 2EK5A 2VBXA 2ID3A 1UG0A 2EV0A 3LSTA 1IN6A 4IX7A 3MZHA 2R7ZJ 3BTCA 3RTRA 1XMAA 1I6XA 3ZRGA 2PG4A 1TNSA 2DYSH 4UVAA 1BOAA 3ASNH 3KZZA 4CYCA 1UB9A 3K2ZA 3TO9A 2P5LC 3L2VA 1LFPA 2MC3A 2RDPA 1ACIA 1RPWA 3E3VA 1ENHA 5DUIA 3M3YJ 3RKYA 4M3EA 4KIBA 3V7CA 4IHYA 3K4JA 2P81A 1WHUA 2CW0F 3ECOA 2CWEA 4HF0A 1VQOI 3DEEA 2VOOA 2X6OA 3JRFA 2M30A 2RC4A 2DA7A 2A05A 1VQ5I 1NH3A 1I3AA 4G9YA 3U1KA 2JA6J 2MD0A 3GTQJ 3QOPA 2YR2A 3IKVA 4BEHA 1U0JA 2Y0MA 2IBDA 3ZQHA 3L2WA 1MGTA 4BY7J 4A0ZA 1QVUA 5J1UA 4AYBN 2Y9ZA 3Q5FA 1L0OC 2BYVE 3J7ZI 4OIQF 5FRMA 4KIGA 3CDLA 2QUFA 2CUFA 3OYNA 2FRHA 2OUMA 5KNLA 3E6MA 2W7NA 2DDBA 1W0TA 1QZYA 4A12A 1Z91A 3E5UA 5K7HA 1B8IB 1DUXC 1FP1D 5EEGA 3DTKA 1R23A 4MGRA 3WG9A 3HJEA 2FBHA 3HOVJ 5D5VB 3DKXA 4G94A 4ESFA 1Q1VA 1RUOA 2L0KA 4RAZA 3QODA 4D0PA 4F93B 1FTTA 2M87A 3E1SA 3H3UA 1K61A 1OYIA 4NDLA 1MZBA 2KHMA 1XSDA 3ZMUA 2Z9OA 2ZXWH 2HOAA 3J80Z 5ILVA 2L02A 1G3TA 4XKCA 5DV5A 1ZG5A 1U8BA 3EQLF 2GLOA 3G1OA 1J75A 3CESA 5F1RA 5D6EA 2DAOA 4XLFA 2MBFA 1JKPC 1X4OA 4PZJA 2EIMH 1BOBA 2ZFWA 3T0YA 1VQ6I 1IC8A 1MMAA 4DGWB 3MN2A 2GOXB 3QYFA 5FKNA 1IUYA 2BY1A 4CXFA 3FF5A 3GYHX 1QO0D 1R49A 1RNLA 3K69A 2Q8KA 2M34A 4MTDA 3P9KA 3GTPJ 4A3MJ 2DMNA 2JZYA 2ETHA 2P0WA 3TP3A 1FOKA 2DK5A 4G7ZF 3GO5A 2Q2EB 5KVRA 2L7ZA 4IHXA 4AD9A 2ZSIB 4ZYDA 1IGNA 2L9NA 1S6LA 4CSWA 3WTWC 4OIOF 3F8BA 2EB7A 4LG3A 4OIPF 2NVQJ 1RUNA 3ABUA 2JPCA 1GLNA 2F6CA 1WCMJ 3K4MA 5EGOA 3SQNA 3WE3A 5KAFC 5DD8A 2KIUA 3FKJA 3DPUA 1IW7F 4HX7A 1LDKB 2AO9A 2EZHA 4EJUA 5H2FC 4GCVA 1KZHA 1HF0A 2MGQA 3E5QA 3MFKA 2XUBA 3BG6A 2ECCA 1LJ9A 5J4VA 1JTXA 3JRBA 1D5VA 1FJLA 4YFNF 1B59A 1Z67A 1FMWA 2DT5A 3FHZA 1IO2A 1A5JA 4HAMA 3TOAA 1MBGA 3HRMA 3ZGKA 1YE9A 1S7EA 3MVPA 2BXYA 1ETKA 3CP8A 3WU2C 1I50J 4RB0A 2JJ7A 2O6GE 2ZKZA 1JHFA 4XLAA 3W2WA 4EV0A 3HG9A 3JAMK 1ETQA 4JYKA 1V5GA 2I10A 3DF8A 2IPQX 2KIFA 1GDTA 3OS0A 4F92B 3G71I 4HA8A 2L2OA 2XKPA 5BPIA 5EG0A 1UJ8A 2IT0A 1X2NA 4II2A 2Y75A 4ZDLA 1P6RA 1N78A 4ZH4F 4BJ5C 5JI6A 3OY9A 1VQMI 1POGA 2DLLA 3QYEA 2NAZA 4UXNA 2DA5A 1B4AA 2V9KA 4DOZA 3TEDA 4KN4X 3ZR8X 3C2GA 2E1OA 3JRIA 3IH2A 3LQRA 2CW7A 3K1PA 3CLOA 3JCUC 5IT9Z 2KIMA 2FX0A 4NB5A 4HLYA 3QRFF 3JR9A 4CZCA 1A36A 3NARA 4YFXF 2JQ7A 4ENMA 2P6TA 3VSKA 3RPQA 1P4AA 2EZLA 3V8JA 2EWNA 2O7OA 4IQJA 2YU3A 5JVGF 4I02A 5HLTA 1Y1WJ 2FNAA 3F21A 3HDDA 2HVSA 4IF4A 4LLLA 3HRSA 2ZXHA 2HQ5A 1MNMC 3QPSA 2ICWG 2VXDA 1CQTA 3EPZA 2DPDA 4CYCB 4KJZA 2E2IJ 3OYGA 1T56A 1YRNA 1DQUA 2XAGA 3R61A 4L5EA 3IH3A 4PFOA 4GGGA 2LY2A 3CD6I 5HLGA 4BXXJ 1LUJB 1QPIA 3H9GA 2LR8A 2OQRA 3MWMA 4JX4A 4BXFA 2JN6A 5J47A 5B5EC 1AU7A 1TT0A 3LL7A 5LGUA 1FYKA 2KQRA 3BPXA 4ZZDA 1FMVA 1D8JA 2WWYA 3S1MJ 1BR1A 2UV1A 4BEHB 1XG1A 4EMSA 5IOYA 2VPRA 3IRQA 2KJCA 2WV0A 2QQ8A 1YYVA 3ULQB 2LC2A 4HLXA 1JJ6C 4IJAA 2F5VA 1QNTA 5CQEA 3QPTA 4OOIA 3FXKA 2A6HF 3MCZA 1YIJI 1MJBA 2R7WA 3ABTA 4P9FA 3ZMVA 4IOAF 1FBSA 3CQZJ 4DW6A 5BOXA 1YJNI 2HQAA 2DBBA 4P5OA 5BPDA 2EIJH 3VSLA 1VQ7I 4FX0A 2ZXIA 4G6DA 3DBLB 2HVQA 3ERED 4XOPA 4BQNA 5CQGA 1FY7A 5HODA 2A3SA 2IVMA 2LF8A 5DYMA 3PQJA 4BJ6C 1O3RA 3BLYA 5H20A 3CJTB 3RPUA 3BOQA 3H5RA 4EJTA 1OQYA 4TV7A 4UHTA 2D45A 3TO7A 1GVJA 5HDGA 1TZLA 5JR3A 5M5WJ 5EDNA 3JREA 2HQRA 4BXUA 5DS9A 3K4CA 5EF6A 2J5OA 4I76A 1PUEE 1IF1A 5JFRA 4G7HF 2M4GA 3SJMA 4CCKA 3FKIJ 4H0EA 2K4BA 1ETYA 1E0EA 1PUFB 4B47A 4D5FA 4C2MJ 3BC8A 3FXJA 2B0LA 3WTVC 3ZMTA 2CO5A 2E19A 3ZCOA 2HTJA 5DTDA 1TWHJ 5KAIC 5DDGA 3UKGA 2DODA 2VBZA 3QP5A 1G3WA 1TC3C 1YX5A 1IJWC 1XX5A 2L4AA 2XAUA 4BDZA 1ZRFA 1XSVA 5HS9A 1R71A 2CQ7A 1ZLJA 2OU2A 3OYJA 1WI3A 4QTRA 3CC2I 5LEKA 3CCQI 2KDOA 3C7JA 2YSRA 3I9V2 5CVUA 3EUAA 2GWRA 3V8LA 4MLOA 5EGOB 5IP9J 4I09A 3F8CA 2V1XA 4JQFA 4S05A 3R0JA 2K02A 1R4NB 2G0EA 4UB6C 3AG3H 2VJIA 2FEZA 2VLAA 1J0RA 4I7HA 2W84A 2VT3A 2ZMEA 3G73A 1QGPA 2FF4A 4DBQA 4KA4A 2QLZA 3S17J 2IGKA 3GMEA 4BYYA 5ILUA 2R7TA 2FJ1A 2OC6A 1HA8A 3IC7A 1CGPA 2LY9A 3HRUA 4YIRX 1SD7A 4Z6YA 3ABKH 3WHCA 1D1CA 5AONA 4MTEA 3HIFA 2DQRA 5FLXZ 5H6RA 4D5CA 2M1BA 3C2HA 3OR1C 4RGXA 1U8RA 3OS2A 5CLSA 1C0WA 2ME6A 3EYIA 2NVTJ 3GTJJ 2PEXA 3FX3A 4P9UA 4BNCA 3FXOA 2QSGX 3B02A 1T0FA 2K5CA 3JRGA 1HQCA 3LOCA 1IRFA 1T08B 3JRCA 1ZELA 3HOXJ 1W36C 5ICEA 2QGUA 2F5FA 5EG0B 2EIKH 3MKZA 2K9QA 2HGCA 2UZKA 1R22A 3DPTA 2HEOA 4PCQA 4OMYA 3IP4B 4FISA 5D5WB 4NC8A 3C2BA 4GO1A 2ZMEC 2B7EA 2XAJA 2RREA 2ELJA 5D6FA 1IDZA 3ZQGA 4AIDA 1DP3A 3L2UA 2FE3A 4WX9A 3SZTA 3BR2A 1R36A 1R7JA 1SC7A 3W6JB 4Q47A 5FLVA 3H3VK 5GAGJ 3RPUD 1WWXA 1IUFA 4UB8C 3K70D 4A3LJ 4N0BA 1BIBA 1MH4A 4B8XA 2LKXA 3HC7A 4E6KG 1U5TA 2Z5UA 4Q48A 4LIUA 4PSWA 3BZ6A 3OYDA 3LWFA 5E20A 2R93J 4RAYA 2WB1A 3T1BA 1YRNB 1I5ZA 1T0FC 3BJOA 4L5IA 3A4CA 5E3OA 1SVMA 2Z99A 2W00A 3ZMZA 3TP0A 4PJLA 3R60A 4NNJA 1KQ8A 2H27A 4I2OA 1YHQI 2MABA 2E35A 1JUPA 1S8NA 2IA0A 4OMZA 1HDDC 1TT5B 4EJOA 4B3XA 2D1VA 2LMDA 3BTLA 3OIPA 2L9SA 3QYBA 3AG4H 4RA2A 2E1CA 3V4GA 3MMYB 3RJPA 4KISA 4HW0A 2GXAA 2N8GA 4JOMA 3VYTB 5L3CA 3HRTA 1SAXA 1QZEA 3I56I 2JUCA 3LA7A 1UCRA 3CCJI 5FFXA 3GZNB 3EYYA 5GPAA 5L3GA 3GTLJ 3QWLA 1W36D 3KCCA 1QPMA 1NK2P 5JLWA 3VB2A 5JVTA 5J1RA 3MKYB 2CGPA 2K9MA 3Q0WA 3GCMA 4PJJA 2VPLA 3H0DA 3KE2A 4HX8A 1R1TA 5K5RA 1O7FA 4XN0A 2D5VA 1TW2A 5D5UB 1TL8A 3BQYA 1JHHA 2VQLA 4OIRF 1DP7P 2Y0SN 4G6QA 3BCAA 1KGSA 1Y56A 2X6XA 4M74A 3CJQB 5D5XB 1B1BA 4G6TB 3BG9A 3N97A 1SEUA 4ASNA 3U2RA 1NHAA 2ZJ2A 5CVVA 1SD5A 2XASA 1YLFA 1KU3A 3OV8A 3KEQA 4P55A 4A0YA 3K2AA 3J80K 1F5TA 3O2PE 2ESHA 1OPCA 2H09A 1K4TA 4AC0A 2FMLA 4FQGA 1BI3A 1Y0NA 2VE9A 1HSTA 2P5KA 3IWZA 3E6CC 1Z0XA 5F08A 3OYIA 2HR3A 3FMSA 1FBUA 2LP0A 1W0UA 3HM5A 1R5GA 1YW8A 1LDDA 4UUTA 2IRFG 5C4XJ 2YPRA 2LYCA 3MQ0A 4Y33A 1D0ZA 1OKRA 5F64A 2WV1A 2V1UA 2HKOA 2MC4A 2BY0A 3AG2H 4C3HJ 3DTEA 5GAHJ 5M5YJ 2O3FA 3HBLA 1ETXA 1WJAA 1E3HA 1IXSB 3DCFA 1H89C 2ZMEB 4KUMA 3DLAA 4E7ZA 2VC1A 3A01B 2K7LA 3SEZA 5KHDA 1NTCA 3PSFA 4BL0B 1G6NA 4LB5A 3HSFA 3WTUC 1GV5A 1RETA 2NVUB 4G8XA 2QYOA 3O6BB 4A3DJ 2E7WA 2W24A 2V6CA 2O5RA 3S1QJ 3ZMSA 1O4XA 2QKMB 3F8FA 2B9SA 2HYJA 3PFYA 2STWA 2HNHA 4HSTA 2IA2A 4PGHA 3F9KA 1JUMA 1J5YA 1ZARA 1ONVA 2CFXA 1IRZA 4MFDA 1JTYA 4RLFA 1Z3YA 1BW6A 3PIPF 3I54A 1OMIA 3S32A 4DNCA 2ZB9A 3ELKA 3OYKA 1OCZH 2KP6A 1QVTA 3PQKA 1MMGA 2HZTA 5ILSA 4A0XA 2OCCH 4G12A 4PJMA 2V6EA 2PLYA 2QSHX 3UNGC 2G9WA 3DBRB 1U9OA 2F4MB 1Z05A 3GWZA 2DYRH 3GFMA 4XN3A 4NBQA 5AIPA 3ZQLA 3FM3A 1KQ0A 2KRHA 3ESWB 2XAFA 1BR2A 4XK4A 2CS3A 3PSIA 4J00A 1U5TB 1G3YA 1ITYA 2OTLI 2PMZN 4S0HB 4CHUA 4XSZF 1B9NA 2KT0A 5IT9K 1MMDA 1QQIA 2GA1A 1SANA 5DUKA 1X19A 3BPVA 3L2RA 2OCEA 2E1MC 4WF2A 2GQQA 2VB6A 3CDHA 2DA4A 4N9IA 4WCGA 1SVOA 2FQ4A 3ZXSA 2XIGA 4MFEA 4IHSA 3CTAA 5FROA 1SFEA 2H8WA 2VBWA 1O7LA 4QLCU 2E71A 5FD5A 4L5JA 1ZH5A 1W4MA 4FE7A 1Z7UA 3GZ5A 2ZFUA 3OIOA 3QQAA 4V2FA 4HNUA 1UFMA 5DM6F 1YX3A 2HPMA 2IA1A 1G59A 2DJNA 3LSRA 2Y2ZA 2LSOA 3KX2A 5TJJA 2ID6A 1H0MA 4JK1X 3HSEA 3ZQFA 1OISA 4RGSA 3GLXA 1UHWA 5LHGA 3BDDA 3CO6C 2KKOA 3RKXA 4WXCA 1BN5A 2RNJA 1IRXA 4Y52J 1U6GA 3S1NJ 1D8KA 2VOPA 4GYGA 2GZWA 3IRRA 2R7FA 2GM4A 5FB2A 3V7SA 3LSPA 3ZOBA 3SZGA 5K1YA 2D1HA 4XL9A 1R00A 3ERMA 5L3FA 5E3NA 3JW4A 1HOMA 1UG2A 5F0CA 1JT6A 3HOSA 3QU6A 4M72A 3GTMJ 3M9AA 3I71A 5LFAA 2RAEA 1FZPB 3EDPA 2V79A 2IAIA 5J1YA 4HYEA 1ZLKA 5TISC 1GT0C 3GF2A 4C2UA 3WG7H 2DA6A 3HYIA 2MA3A 3QPHA 2QQ9A 2GIVA 5HS8A 3ZN1A 2DA1A 3Q9VA 1VZ0A 4UY8I 2EFOA 2DI3A 2IXSA 2OPTA 2Y48A 5F1JA 1EJ9A 5GAEJ 2M4KA 4UVBA 1PUFA 2KRFA 2QWWA 2CH0A 1RESA 5IY5H 2R7RA 4HQEA 5EEHA 5HDKA 2L3DA 3LA2A 2XGEA 4KIFA 4LLNA 2ZXJA 3WTZA 2A68F 3F3XA 3E6BA 1YJ9I 2PBIA 3I58A 3V8KA 2O9LA 2DOFA 2EFQA 2DTRA 2VKVA 4U7BA 1R1UA 4ZC3A 3TGNA 4X1EA 3A1YA 3RQ4A 1BL0A 3HTUA 2FA5A 1IN7A 3E6DA 3NAUA 4C9YA 1OYWA 1E17A 3OYHA 4LLGF 2LK2A 4JP0A 2W57A 3GFIA 1ZG3A 2JUGA 2X4HA 4V19K 4E7LA 2E1NA 3SFZA 1RKWA 1E2XA 2QKLB 2XRNA 4BGDA 4O6JA 4I0BA 1WKMA 1BI1A 1LDJA 2V1DA 3HKZA 4F55A 2LRDA 1TQPA 4ZDOA 3DU6A 3B6CA 2QBYA 3SZPA 1S3JA 3ASOH 3BT9A 2Z33A 2VONA 5GPCA 1HW2A 3J81Z 4QIWN 4A3CJ 2WY8Q 4BUPA 3IUOA 2X6WA 1XGSA 2Y69H 3K9TA 3BP8A 5E3MA 3L2QA 3H36A 5L3DA 2QZ8A 2IS4A 4M3GA 4RBOA 1IRGA
chains in the Genus database with same CATH topology
3TDUC 3FZVA 4OU0A 3IKTA 1K79A 3KETA 4RB1A 3KP3A 3ROUA 3K1NA 1FPQA 1XCVA 3H92A 2P4WA 1K7AA 1KYZA 2FNPA 3GFLA 3LAPA 5FLXK 3RYRA 2G7UA 4Q4ZF 2R7DA 4K2EA 2DO7A 3CJNA 1KA8A 1RI7A 2ZO4A 1W7PA 1B6AA 3T5XA 3PFIA 2JPBA 2D2WA 1ZREA 4G7OF 4PDKA 4LG0A 4AIJA 3EETA 4L18B 2AXLA 2OZ6A 5FO5A 2ESNA 2VT2A 2XV4S 1F9NA 4U0YA 3TQNA 1XDSA 1KU7A 1HKQA 3WTXC 1XGNA 1WSUA 2M5WA 5LRSA 2GXGA 5ICCA 1FC3A 4CYDA 3HOTA 2EA2A 2STTA 5BS6A 2E7XA 4LD5A 2JTVA 4HV5A 4Y13A 2KJBA 4R1HA 1XDUA 5J8CA 3CUQC 1U2WA 1ZN2A 1OR7A 2XAHA 1FBQA 2H94A 4ETSA 4BQAA 4XSXF 2COMA 3FWEA 5ICGA 2VBYA 1F4KA 1OYYA 1SFUA 1D3YA 2O03A 1P92A 1TQMA 3C18A 2HOEA 4U0WA 3KP2A 2RV8A 1R58A 4ZZLA 3JSOA 3COAC 2FMYA 2PJPA 2ZNZA 5LHIA 4KNYA 2BV6A 1YFHA 1O57A 5L3BA 4LFUA 1IN8A 1ZAOA 5J8FA 1W7PD 2F5DA 3BWGA 1S7OA 2QBYB 4XBFA 4O5VA 2CG4A 3E5XA 2EV5A 3HTSB 3G3ZA 1LVAA 1V3FA 1ZHFA 2A5YB 2P8TA 2IJLA 4L0YB 2UXNA 4RGUA 4KICA 4U0VA 1IN4A 2K27A 4KMUX 3GX4X 3JTHA 4MNUA 1YW7A 2ELHA 3S2WA 2LKPA 2LF7A 4GXOA 2CYYA 4Y15A 3I4PA 3P9CA 3NQOA 1W7PB 2MD5A 1SD6A 1PP7U 2ACJA 4A6DA 4WXHA 3KP5A 1QBJA 2XROA 2DW4A 4LJZF 1XN7A 3D5LA 3M7GA 2C6YA 4LG0B 4FHTA 5K5OA 4ENJA 3R4KA 1BC7C 3OOPA 3WE2A 4YFKF 3M1EA 1R5HA 2XGXA 2M8EA 1O3TA 4IPAA 4CO8A 1XGMA 2NNYA 1UHMA 2GAUA 5E8IA 5A2QZ 5D4RA 4U7DA 3K0LA 1F1ZA 1SMTA 1ZRCA 1R1VA 4YIIA 3CUOA 5E17F 2FBIA 3KZYA 1LNWA 2VXZA 5LEJA 4DQ2A 3ZPLA 3SHFA 1BI0A 1XB4A 4XLNF 1HKTA 1Z6RA 4EGYA 3HSRA 4E70A 5ICFA 2DU9A 2HKXA 1QZZA 2H6BA 4HBLA 2XKOA 2ISZA 3IHUA 3LA3A 1T38A 2DQLA 1DPRA 2FXAA 3BJAA 3KEOA 5E1XA 2JT1A 3SXYA 4HQMA 1JE8A 3WTSC 3NEUA 3GEZA 3WGHA 1HBXG 3FXRA 2W25A 1FNNA 1ZGAA 5E1WA 4WWCA 1ODDA 3LAJA 5AIQA 3ZP5A 3KLNA 3P7NA 2BE5F 5HLHA 3ISPA 3B73A 3WGGA 3GZ6A 4CGZA 1DDNA 4KYWA 2HQNA 1DPUA 4ESJA 3KP7A 1Z6TA 3RKWA 3RDIA 2IP2A 1GHCA 1ZGJA 2VC0A 4EVIA 3F23A 4EJWA 3V7RA 1TW3A 5FD6A 1FYMA 1J59A 3I59A 1ZRDA 4L9JA 1K6OA 3J81K 4Q5SF 1T6SA 4HZFA 4LK0F 3TO6A 3F72A 3DKWA 3VEPA 2RVCA 2H6CA 3RYPA 1YQAA 4MHGA 2EA4A 3FMRA 1AWCA 1EH8A 2NYXA 3HUGA 5HOOA 1ZG1A 2FOKA 1FSHA 3JTGA 4KN7X 4S04A 2YX4A 3E97A 3LFKA 3DQVC 2LDUA 5CYVA 5HS7A 3DPLC 4EM2A 3T8TA 2BBYA 2F5CA 4ENNA 3QU3A 4AIHA 1JGSA 3RIRA 3TOBA 4L0ZB 5LBQA 3J7AO 5J6XA 2A07F 3ZMDA 3O3KA 2QENA 2VN2A 4IXAA 5D8LB 1W5SA 1TLHB 4L9TA 4R8HA 1FYLA 4MEXF 2GXBA 5E1ZB 2Q0OA 4A6EA 2NS0A 5ED4A 2Z3YA 1U78A 1W5TA 5HVQC 1RZ4A 3I64A 3GW2A 2DFIA 5LHHA 3F6VA 4LK1F 3L9FA 5K5QA 4QWQA 2BEOA 3ZN0A 1LEBA 4M6XA 1XMKA 4RB3C 1KYWA 2IW5A 5DCFA 3QAHA 1P2FA 4BH9A 4L9NA 1HSJA 5CJ9A 4FT8A 3F22A 4L9VA 3WU0A 3REOA 4NQWA 4BHBA 2A6EF 2DK8A 4O3MA 3DP7A 1TNTA 3FM5A 1VTNC 2UWMA 1REPC 4RS8A 4AIKA 2LNBA 2CQKA 1EV7A 4MEYF 2HFHA 1FX7A 1KU2A 1SD4A 4PGGA 4I0AA 1IAWA 2O8XA 4IHTA 3W6KB 3VOEA 3GUDA 4EQQA 1BIAA 1HKSA 1HW1A 1MKMA 1Z1DA 3VFZA 1FLIA 3TDZC 1FP2A 1GXQA 3P9IA 3FXUA 2FU4A 2A69F 5BQTA 1HXDA 3GVAA 1S29A 4IRHA 4ZYHA 3BROA 3I59B 4KDPA 4UUVA 3KP6A 1SMYF 2QQAA 4EM1A 3DFGA 1J7KA 2P6SA 4EGZA 1FSEA 4A5MA 2CSOA 1HW5A 2WTEA 5E8GA 4KFCA 1YG2A 4YG2F 2L54A 5DCMA 1JXSA 2FQ3A 3ECHA 2W85A 1PDNC 1I27A 1O3QA 5CVRA 4U88A 5F6FA 3D0SA 4M9ZA 3F6OA 4F7ZA 1K78B 4LB6B 1BM9A 5D4SA 3RI4A 4ZYGA 3CUQA 1BBYA 4HX4A 2ZBKA 2NNNA 1XSXA 4B09A 5CVJA 2XAQA 1G3SA 2QM3A 2VODA 3FMQA 3AAFA 2A61A 2PMUA 5IT3A 3R6SA 1ULYA 5JHUA 3L09A 5BMZA 3WTTC 1TQIA 2EFWA 2YX7A 2QVOA 1AOYA 3U9GA 2PI0A 3DV8A 1WI9A 4XLPF 4EJVA 5A2QK 1CF7A 2OQGA 2HDCA 2JSCA 4P96A 4EM0B 1KU9A 1MDMA 1BJAA 3BY6A 4N9HA 1B9MA 1J2XA 1WRJA 2OBPA 2ISYA 3R0AA 3GXOA 4M71A 4UNOA 1ON1A 1YTYA 2MH9A 2TDXA 3WTYC 3HHHA 1TBXA 4UV9A 2P5VA 4CICA 2R3SA 2HYGD 3TKYA 1X3UA 4AVPA 4I01A 1XGOA 3DXJF 1XCBA 3EUHA 1T2KA 4WK8F 3WGIA 1Q1HA 1I1SA 2FBKA 2UXXA 1YW9A 4HDUA 2OD5A 4HOBA 4BAYA 2RN7A 2ADUA 1BI2A 4HF2A 3Q9SA 3NRVA 1WQ2A 4Y17A 3F8MA 2HWVA 2RGVA 5FFZA 2MH2A 1EH6A 4NHJA 3JAMZ 1EH7A 1G4DA 2XVCA 1S7AA 4JBAA 1Y0UA 3ML6A 1IZ1A 4IRGA 5LGNA 1MD0A 3M8EA 2JRTA 3M8FA 1ZYRF 2ZNYA 5DD4A 4RB2C 1GXPA 3IWFA 2RKHA 2L4MA 4ON0A 4CDGA 3DEUA 2NRAC 2X0LA 2GA2A 2PN6A 5KK1A 1LEAA 2QQBA 3C3WA 5DCMB 1FWZA 2PQ8A 1LB2A 2RQPA 3KFWX 1MJAA 2OAZA 4HF1A 1ON2A 3FXQA 4I98B 4UV8A 4WXDA 3WODF 4XRFA 3U1DA 3C1DA 1YIOA 2J5PA 4MQ9F 4IRIA 2V9VA 4LGWA 6PAXA 1IN5A 3CUQB 3H3ZA 5H6QA 3L2CA 3L00A 4MQVA 3LQQA 1XD7A 4Z2YA 3I5UA 4HV6A 1V4RA 4A5NA 3BJ6A 2ZCWA 2EFPA 1H9TA 1KQ9A 1MJ9A 4BHCA 1STZA 2WC2A 3MEXA 1RIOH 1T98A 1USTA 5L3EA 2HS5A 5LGTA 2PFBA 1H9GA 1CF7B 1A04A 1U5TC 3L7WA 4ESBA 3QP6A 3KLOA 1YO5C 1T39A 1MDMB 3KP4A 2BGCA 4HDVA 2MLGA 4KT5C 5HDNA 5CVIA 1P4WA 3WU1B 2HYFA 4GYIA 4RGRA 1IXRC 1P4XA 3ZQ7A 1FT9A 2P7VB 3I0TA 5ERIA 4IVNA 2HTSA 1USSA 4YIFA 3CO7C 5TRDA 4R79A 3I53A 2EJRA 4UVCA 4BHPA 2OZUA 4AWXB 2L01A 3N4MA 4M9XA 2MLKA 2F2EA 5E18F 4ZYEA 1BC8C 2Q2EA 4KMFA 2K86A 4M6YA 2FSWA 3VODA 3HHGA 3K1MA 3F8NA 5D8KB 2VE8A 4M9SA 4ENKA 1YS7A 2K4JA 2DPUA 4M73A 1IXCA 4CZZA 1TTYA 1L3LA 1Z9CA 3MAJA 2AS5F 3GFJA 4LMYA 1I1GA 5HLIA 2PMHA 3JSPA 4OINF 5FGMA 1SFXA 4FX4A 2O0YA 3IL2A 2P7CB 2EFNA 5LLQA 1O3SA 2F5EA 1PP8F 3MZYA 5LRRA 1YS6A 5DEQA 1J9IA 2OA4A 2O61A 3T8RA 1LQ1A 2XHKA 4A2UA 2EV6A 1U3EM 1K78A 2G7HA 2M45A 2EK5A 2VBXA 3MZHA 2EV0A 3LSTA 1IN6A 3RTRA 1XMAA 1I6XA 2PG4A 1TNSA 4UVAA 1BOAA 3KZZA 1UB9A 3K2ZA 3TO9A 2P5LC 2MC3A 2RDPA 3E3VA 5DUIA 3RKYA 3V7CA 4KIBA 3ECOA 2CW0F 2CWEA 4HF0A 2VOOA 2M30A 2RC4A 4G9YA 3QOPA 2YR2A 3IKVA 2Y0MA 1MGTA 4A0ZA 3Q5FA 1L0OC 2BYVE 4OIQF 4KIGA 2QUFA 2FRHA 3E6MA 1QZYA 4A12A 1Z91A 3E5UA 1DUXC 1FP1D 5EEGA 1R23A 4MGRA 3WG9A 2FBHA 5D5VB 4G94A 4ESFA 1RUOA 4RAZA 4D0PA 2M87A 3H3UA 1OYIA 1MZBA 1XSDA 3ZMUA 2Z9OA 3J80Z 5ILVA 2L02A 1G3TA 1ZG5A 5DV5A 3EQLF 1J75A 5F1RA 5D6EA 2DAOA 2MBFA 4PZJA 2ZFWA 3T0YA 1IUYA 4CXFA 3FF5A 3GYHX 1QO0D 1RNLA 3K69A 2Q8KA 4MTDA 3P9KA 2JZYA 2ETHA 1FOKA 2DK5A 4G7ZF 3GO5A 5KVRA 4AD9A 4ZYDA 1S6LA 3WTWC 4OIOF 3F8BA 2EB7A 4OIPF 1RUNA 3ABUA 2JPCA 3SQNA 3WE3A 5DD8A 2KIUA 1IW7F 4HX7A 1LDKB 4EJUA 4GCVA 3E5QA 3MFKA 2XUBA 1LJ9A 1D5VA 4YFNF 1B59A 2DT5A 3FHZA 4HAMA 3TOAA 3HRMA 4RB0A 2O6GE 2ZKZA 1JHFA 4EV0A 3JAMK 3DF8A 2IPQX 2KIFA 4HA8A 2XKPA 5BPIA 2IT0A 2Y75A 1P6RA 4ZH4F 5JI6A 2DLLA 4UXNA 2NAZA 1B4AA 4KN4X 3LQRA 3K1PA 3CLOA 5IT9Z 2KIMA 4NB5A 4HLYA 3QRFF 4YFXF 4ENMA 2P6TA 3RPQA 1P4AA 3V8JA 2EWNA 2YU3A 4I02A 2FNAA 3F21A 4IF4A 4LLLA 3HRSA 2DPDA 3R61A 2XAGA 4GGGA 5HLGA 3MWMA 2OQRA 1FYKA 5LGUA 3BPXA 4ZZDA 1D8JA 2WWYA 4EMSA 3IRQA 2KJCA 2WV0A 1YYVA 3ULQB 4HLXA 4IJAA 1QNTA 3QPTA 4OOIA 2A6HF 3MCZA 1MJBA 3ABTA 4P9FA 3ZMVA 1FBSA 5BOXA 2DBBA 4P5OA 5BPDA 4FX0A 4G6DA 3ERED 1FY7A 2A3SA 2IVMA 2LF8A 5DYMA 3PQJA 1O3RA 5H20A 3RPUA 3BOQA 4EJTA 4TV7A 4UHTA 2D45A 3TO7A 1GVJA 5HDGA 5JR3A 2HQRA 4BXUA 1PUEE 2J5OA 1IF1A 5JFRA 4G7HF 4H0EA 2K4BA 2B0LA 3WTVC 3ZMTA 2CO5A 2HTJA 5DDGA 2VBZA 3QP5A 1G3WA 2L4AA 1ZRFA 1XSVA 5HS9A 1ZLJA 2OU2A 5LEKA 3C7JA 2YSRA 5CVUA 3V8LA 2GWRA 4I09A 3F8CA 2V1XA 4JQFA 4S05A 3R0JA 2K02A 2FEZA 1J0RA 4I7HA 2W84A 2VT3A 2ZMEA 3G73A 1QGPA 2FF4A 4KA4A 2QLZA 4BYYA 5ILUA 3IC7A 1CGPA 3HRUA 1SD7A 5AONA 4MTEA 3HIFA 2DQRA 5FLXZ 5H6RA 2M1BA 4RGXA 1U8RA 5CLSA 1C0WA 3EYIA 2PEXA 3FX3A 4P9UA 4BNCA 3B02A 1T0FA 1HQCA 1IRFA 5ICEA 2F5FA 2HGCA 2UZKA 1R22A 3DPTA 2HEOA 4PCQA 4OMYA 5D5WB 4GO1A 2XAJA 5D6FA 2FE3A 4WX9A 3SZTA 1R36A 1R7JA 3W6JB 4Q47A 1WWXA 4N0BA 1BIBA 4B8XA 1U5TA 2Z5UA 4Q48A 3BZ6A 3LWFA 5E20A 4RAYA 3T1BA 1I5ZA 3BJOA 4L5IA 2Z99A 3ZMZA 3R60A 1KQ8A 2H27A 4I2OA 1S8NA 2IA0A 4OMZA 4EJOA 2D1VA 2E1CA 3V4GA 3RJPA 4HW0A 5L3CA 3HRTA 1SAXA 3LA7A 1UCRA 5FFXA 3EYYA 5L3GA 3KCCA 1QPMA 5JVTA 3VB2A 2CGPA 3KE2A 4HX8A 1R1TA 5K5RA 1O7FA 1TW2A 5D5UB 1JHHA 4OIRF 1DP7P 4G6QA 1KGSA 4M74A 5D5XB 1B1BA 3N97A 4ASNA 3U2RA 1NHAA 2ZJ2A 5CVVA 1SD5A 2XASA 1YLFA 1KU3A 3OV8A 3KEQA 4P55A 4A0YA 3J80K 1F5TA 3O2PE 2ESHA 1OPCA 2H09A 2FMLA 1BI3A 2VE9A 1HSTA 2P5KA 3IWZA 3E6CC 2HR3A 3FMSA 1FBUA 1R5GA 1YW8A 1LDDA 2IRFG 2YPRA 3MQ0A 5F64A 1OKRA 2V1UA 2HKOA 2O3FA 1IXSB 2ZMEB 4KUMA 2VC1A 2K7LA 1G6NA 4LB5A 3HSFA 3WTUC 4G8XA 2QYOA 3O6BB 2E7WA 2W24A 2V6CA 3ZMSA 3F8FA 2STWA 2IA2A 4PGHA 1J5YA 1ZARA 1ONVA 2CFXA 3I54A 1OMIA 4DNCA 3ELKA 3PQKA 4A0XA 5ILSA 2HZTA 2PLYA 2G9WA 1Z05A 3GWZA 3GFMA 5AIPA 3FM3A 1KQ0A 2XAFA 1U5TB 1G3YA 4CHUA 4XSZF 1B9NA 5IT9K 2GA1A 1QQIA 5DUKA 3BPVA 4WF2A 2GQQA 3CDHA 4N9IA 4WCGA 2XIGA 4IHSA 3CTAA 1SFEA 2VBWA 1O7LA 4QLCU 5FD5A 4L5JA 1ZH5A 1W4MA 1Z7UA 3GZ5A 1UFMA 2IA1A 2LSOA 5TJJA 1H0MA 4JK1X 3HSEA 4RGSA 3GLXA 1UHWA 5LHGA 3BDDA 3CO6C 2KKOA 3RKXA 4WXCA 1BN5A 2RNJA 1U6GA 1D8KA 2VOPA 4GYGA 2GZWA 3IRRA 2R7FA 5FB2A 3V7SA 5K1YA 2D1HA 1R00A 5L3FA 3JW4A 3HOSA 3QU6A 4M72A 3M9AA 3I71A 1FZPB 3EDPA 2V79A 4HYEA 1ZLKA 3GF2A 3HYIA 2MA3A 3QPHA 2QQ9A 2GIVA 5HS8A 3ZN1A 3Q9VA 2EFOA 2DI3A 2Y48A 4UVBA 2KRFA 2QWWA 4HQEA 5EEHA 5HDKA 2L3DA 3LA2A 4KIFA 4LLNA 2ZXJA 3WTZA 2A68F 3F3XA 3E6BA 2PBIA 3I58A 3V8KA 2EFQA 2DTRA 4U7BA 1R1UA 3TGNA 3HTUA 2FA5A 1IN7A 3E6DA 1OYWA 1E17A 4LLGF 2W57A 3GFIA 1ZG3A 2X4HA 2E1NA 3SFZA 1E2XA 2XRNA 4O6JA 4I0BA 1WKMA 1BI1A 1LDJA 2V1DA 1TQPA 2QBYA 3SZPA 1S3JA 2Z33A 2VONA 1HW2A 3J81Z 1XGSA 3K9TA 3BP8A 5L3DA 2QZ8A 1IRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDU C;  3FZV A;  4OU0 A;  3IKT A;  1K79 A;  3KET A;  4RB1 A;  3KP3 A;  3ROU A;  3K1N A;  1FPQ A;  1XCV A;  3H92 A;  2P4W A;  1K7A A;  1KYZ A;  2FNP A;  3GFL A;  3LAP A;  5FLX K;  3RYR A;  2G7U A;  4Q4Z F;  2R7D A;  4K2E A;  2DO7 A;  3CJN A;  1KA8 A;  1RI7 A;  2ZO4 A;  1W7P A;  1B6A A;  3T5X A;  3PFI A;  2JPB A;  2D2W A;  1ZRE A;  4G7O F;  4PDK A;  4LG0 A;  4AIJ A;  3EET A;  4L18 B;  2AXL A;  2OZ6 A;  5FO5 A;  2ESN A;  2VT2 A;  2XV4 S;  1F9N A;  4U0Y A;  3TQN A;  1XDS A;  1KU7 A;  1HKQ A;  3WTX C;  1XGN A;  1WSU A;  2M5W A;  5LRS A;  2GXG A;  5ICC A;  1FC3 A;  4CYD A;  3HOT A;  2EA2 A;  2STT A;  5BS6 A;  2E7X A;  4LD5 A;  2JTV A;  4HV5 A;  4Y13 A;  2KJB A;  4R1H A;  1XDU A;  5J8C A;  3CUQ C;  1U2W A;  1ZN2 A;  1OR7 A;  2XAH A;  1FBQ A;  2H94 A;  4ETS A;  4BQA A;  4XSX F;  2COM A;  3FWE A;  5ICG A;  2VBY A;  1F4K A;  1OYY A;  1SFU A;  1D3Y A;  2O03 A;  1P92 A;  1TQM A;  3C18 A;  2HOE A;  4U0W A;  3KP2 A;  2RV8 A;  1R58 A;  4ZZL A;  3JSO A;  3COA C;  2FMY A;  2PJP A;  2ZNZ A;  5LHI A;  4KNY A;  2BV6 A;  1YFH A;  1O57 A;  5L3B A;  4LFU A;  1IN8 A;  1ZAO A;  5J8F A;  1W7P D;  2F5D A;  3BWG A;  1S7O A;  2QBY B;  4XBF A;  4O5V A;  2CG4 A;  3E5X A;  2EV5 A;  3HTS B;  3G3Z A;  1LVA A;  1V3F A;  1ZHF A;  2A5Y B;  2P8T A;  2IJL A;  4L0Y B;  2UXN A;  4RGU A;  4KIC A;  4U0V A;  1IN4 A;  2K27 A;  4KMU X;  3GX4 X;  3JTH A;  4MNU A;  1YW7 A;  2ELH A;  3S2W A;  2LKP A;  2LF7 A;  4GXO A;  2CYY A;  4Y15 A;  3I4P A;  3P9C A;  3NQO A;  1W7P B;  2MD5 A;  1SD6 A;  1PP7 U;  2ACJ A;  4A6D A;  4WXH A;  3KP5 A;  1QBJ A;  2XRO A;  2DW4 A;  4LJZ F;  1XN7 A;  3D5L A;  3M7G A;  2C6Y A;  4LG0 B;  4FHT A;  5K5O A;  4ENJ A;  3R4K A;  1BC7 C;  3OOP A;  3WE2 A;  4YFK F;  3M1E A;  1R5H A;  2XGX A;  2M8E A;  1O3T A;  4IPA A;  4CO8 A;  1XGM A;  2NNY A;  1UHM A;  2GAU A;  5E8I A;  5A2Q Z;  5D4R A;  4U7D A;  3K0L A;  1F1Z A;  1SMT A;  1ZRC A;  1R1V A;  4YII A;  3CUO A;  5E17 F;  2FBI A;  3KZY A;  1LNW A;  2VXZ A;  5LEJ A;  4DQ2 A;  3ZPL A;  3SHF A;  1BI0 A;  1XB4 A;  4XLN F;  1HKT A;  1Z6R A;  4EGY A;  3HSR A;  4E70 A;  5ICF A;  2DU9 A;  2HKX A;  1QZZ A;  2H6B A;  4HBL A;  2XKO A;  2ISZ A;  3IHU A;  3LA3 A;  1T38 A;  2DQL A;  1DPR A;  2FXA A;  3BJA A;  3KEO A;  5E1X A;  2JT1 A;  3SXY A;  4HQM A;  1JE8 A;  3WTS C;  3NEU A;  3GEZ A;  3WGH A;  1HBX G;  3FXR A;  2W25 A;  1FNN A;  1ZGA A;  5E1W A;  4WWC A;  1ODD A;  3LAJ A;  5AIQ A;  3ZP5 A;  3KLN A;  3P7N A;  2BE5 F;  5HLH A;  3ISP A;  3B73 A;  3WGG A;  3GZ6 A;  4CGZ A;  1DDN A;  4KYW A;  2HQN A;  1DPU A;  4ESJ A;  3KP7 A;  1Z6T A;  3RKW A;  3RDI A;  2IP2 A;  1GHC A;  1ZGJ A;  2VC0 A;  4EVI A;  3F23 A;  4EJW A;  3V7R A;  1TW3 A;  5FD6 A;  1FYM A;  1J59 A;  3I59 A;  1ZRD A;  4L9J A;  1K6O A;  3J81 K;  4Q5S F;  1T6S A;  4HZF A;  4LK0 F;  3TO6 A;  3F72 A;  3DKW A;  3VEP A;  2RVC A;  2H6C A;  3RYP A;  1YQA A;  4MHG A;  2EA4 A;  3FMR A;  1AWC A;  1EH8 A;  2NYX A;  3HUG A;  5HOO A;  1ZG1 A;  2FOK A;  1FSH A;  3JTG A;  4KN7 X;  4S04 A;  2YX4 A;  3E97 A;  3LFK A;  3DQV C;  2LDU A;  5CYV A;  5HS7 A;  3DPL C;  4EM2 A;  3T8T A;  2BBY A;  2F5C A;  4ENN A;  3QU3 A;  4AIH A;  1JGS A;  3RIR A;  3TOB A;  4L0Z B;  5LBQ A;  3J7A O;  5J6X A;  2A07 F;  3ZMD A;  3O3K A;  2QEN A;  2VN2 A;  4IXA A;  5D8L B;  1W5S A;  1TLH B;  4L9T A;  4R8H A;  1FYL A;  4MEX F;  2GXB A;  5E1Z B;  2Q0O A;  4A6E A;  2NS0 A;  5ED4 A;  2Z3Y A;  1U78 A;  1W5T A;  5HVQ C;  1RZ4 A;  3I64 A;  3GW2 A;  2DFI A;  5LHH A;  3F6V A;  4LK1 F;  3L9F A;  5K5Q A;  4QWQ A;  2BEO A;  3ZN0 A;  1LEB A;  4M6X A;  1XMK A;  4RB3 C;  1KYW A;  2IW5 A;  5DCF A;  3QAH A;  1P2F A;  4BH9 A;  4L9N A;  1HSJ A;  5CJ9 A;  4FT8 A;  3F22 A;  4L9V A;  3WU0 A;  3REO A;  4NQW A;  4BHB A;  2A6E F;  2DK8 A;  4O3M A;  3DP7 A;  1TNT A;  3FM5 A;  1VTN C;  2UWM A;  1REP C;  4RS8 A;  4AIK A;  2LNB A;  2CQK A;  1EV7 A;  4MEY F;  2HFH A;  1FX7 A;  1KU2 A;  1SD4 A;  4PGG A;  4I0A A;  1IAW A;  2O8X A;  4IHT A;  3W6K B;  3VOE A;  3GUD A;  4EQQ A;  1BIA A;  1HKS A;  1HW1 A;  1MKM A;  1Z1D A;  3VFZ A;  1FLI A;  3TDZ C;  1FP2 A;  1GXQ A;  3P9I A;  3FXU A;  2FU4 A;  2A69 F;  5BQT A;  1HXD A;  3GVA A;  1S29 A;  4IRH A;  4ZYH A;  3BRO A;  3I59 B;  4KDP A;  4UUV A;  3KP6 A;  1SMY F;  2QQA A;  4EM1 A;  3DFG A;  1J7K A;  2P6S A;  4EGZ A;  1FSE A;  4A5M A;  2CSO A;  1HW5 A;  2WTE A;  5E8G A;  4KFC A;  1YG2 A;  4YG2 F;  2L54 A;  5DCM A;  1JXS A;  2FQ3 A;  3ECH A;  2W85 A;  1PDN C;  1I27 A;  1O3Q A;  5CVR A;  4U88 A;  5F6F A;  3D0S A;  4M9Z A;  3F6O A;  4F7Z A;  1K78 B;  4LB6 B;  1BM9 A;  5D4S A;  3RI4 A;  4ZYG A;  3CUQ A;  1BBY A;  4HX4 A;  2ZBK A;  2NNN A;  1XSX A;  4B09 A;  5CVJ A;  2XAQ A;  1G3S A;  2QM3 A;  2VOD A;  3FMQ A;  3AAF A;  2A61 A;  2PMU A;  5IT3 A;  3R6S A;  1ULY A;  5JHU A;  3L09 A;  5BMZ A;  3WTT C;  1TQI A;  2EFW A;  2YX7 A;  2QVO A;  1AOY A;  3U9G A;  2PI0 A;  3DV8 A;  1WI9 A;  4XLP F;  4EJV A;  5A2Q K;  1CF7 A;  2OQG A;  2HDC A;  2JSC A;  4P96 A;  4EM0 B;  1KU9 A;  1MDM A;  1BJA A;  3BY6 A;  4N9H A;  1B9M A;  1J2X A;  1WRJ A;  2OBP A;  2ISY A;  3R0A A;  3GXO A;  4M71 A;  4UNO A;  1ON1 A;  1YTY A;  2MH9 A;  2TDX A;  3WTY C;  3HHH A;  1TBX A;  4UV9 A;  2P5V A;  4CIC A;  2R3S A;  2HYG D;  3TKY A;  1X3U A;  4AVP A;  4I01 A;  1XGO A;  3DXJ F;  1XCB A;  3EUH A;  1T2K A;  4WK8 F;  3WGI A;  1Q1H A;  1I1S A;  2FBK A;  2UXX A;  1YW9 A;  4HDU A;  2OD5 A;  4HOB A;  4BAY A;  2RN7 A;  2ADU A;  1BI2 A;  4HF2 A;  3Q9S A;  3NRV A;  1WQ2 A;  4Y17 A;  3F8M A;  2HWV A;  2RGV A;  5FFZ A;  2MH2 A;  1EH6 A;  4NHJ A;  3JAM Z;  1EH7 A;  1G4D A;  2XVC A;  1S7A A;  4JBA A;  1Y0U A;  3ML6 A;  1IZ1 A;  4IRG A;  5LGN A;  1MD0 A;  3M8E A;  2JRT A;  3M8F A;  1ZYR F;  2ZNY A;  5DD4 A;  4RB2 C;  1GXP A;  3IWF A;  2RKH A;  2L4M A;  4ON0 A;  4CDG A;  3DEU A;  2NRA C;  2X0L A;  2GA2 A;  2PN6 A;  5KK1 A;  1LEA A;  2QQB A;  3C3W A;  5DCM B;  1FWZ A;  2PQ8 A;  1LB2 A;  2RQP A;  3KFW X;  1MJA A;  2OAZ A;  4HF1 A;  1ON2 A;  3FXQ A;  4I98 B;  4UV8 A;  4WXD A;  3WOD F;  4XRF A;  3U1D A;  3C1D A;  1YIO A;  2J5P A;  4MQ9 F;  4IRI A;  2V9V A;  4LGW A;  6PAX A;  1IN5 A;  3CUQ B;  3H3Z A;  5H6Q A;  3L2C A;  3L00 A;  4MQV A;  3LQQ A;  1XD7 A;  4Z2Y A;  3I5U A;  4HV6 A;  1V4R A;  4A5N A;  3BJ6 A;  2ZCW A;  2EFP A;  1H9T A;  1KQ9 A;  1MJ9 A;  4BHC A;  1STZ A;  2WC2 A;  3MEX A;  1RIO H;  1T98 A;  1UST A;  5L3E A;  2HS5 A;  5LGT A;  2PFB A;  1H9G A;  1CF7 B;  1A04 A;  1U5T C;  3L7W A;  4ESB A;  3QP6 A;  3KLO A;  1YO5 C;  1T39 A;  1MDM B;  3KP4 A;  2BGC A;  4HDV A;  2MLG A;  4KT5 C;  5HDN A;  5CVI A;  1P4W A;  3WU1 B;  2HYF A;  4GYI A;  4RGR A;  1IXR C;  1P4X A;  3ZQ7 A;  1FT9 A;  2P7V B;  3I0T A;  5ERI A;  4IVN A;  2HTS A;  1USS A;  4YIF A;  3CO7 C;  5TRD A;  4R79 A;  3I53 A;  2EJR A;  4UVC A;  4BHP A;  2OZU A;  4AWX B;  2L01 A;  3N4M A;  4M9X A;  2MLK A;  2F2E A;  5E18 F;  4ZYE A;  1BC8 C;  2Q2E A;  4KMF A;  2K86 A;  4M6Y A;  2FSW A;  3VOD A;  3HHG A;  3K1M A;  3F8N A;  5D8K B;  2VE8 A;  4M9S A;  4ENK A;  1YS7 A;  2K4J A;  2DPU A;  4M73 A;  1IXC A;  4CZZ A;  1TTY A;  1L3L A;  1Z9C A;  3MAJ A;  2AS5 F;  3GFJ A;  4LMY A;  1I1G A;  5HLI A;  2PMH A;  3JSP A;  4OIN F;  5FGM A;  1SFX A;  4FX4 A;  2O0Y A;  3IL2 A;  2P7C B;  2EFN A;  5LLQ A;  1O3S A;  2F5E A;  1PP8 F;  3MZY A;  5LRR A;  1YS6 A;  5DEQ A;  1J9I A;  2OA4 A;  2O61 A;  3T8R A;  1LQ1 A;  2XHK A;  4A2U A;  2EV6 A;  1U3E M;  1K78 A;  2G7H A;  2M45 A;  2EK5 A;  2VBX A;  3MZH A;  2EV0 A;  3LST A;  1IN6 A;  3RTR A;  1XMA A;  1I6X A;  2PG4 A;  1TNS A;  4UVA A;  1BOA A;  3KZZ A;  1UB9 A;  3K2Z A;  3TO9 A;  2P5L C;  2MC3 A;  2RDP A;  3E3V A;  5DUI A;  3RKY A;  3V7C A;  4KIB A;  3ECO A;  2CW0 F;  2CWE A;  4HF0 A;  2VOO A;  2M30 A;  2RC4 A;  4G9Y A;  3QOP A;  2YR2 A;  3IKV A;  2Y0M A;  1MGT A;  4A0Z A;  3Q5F A;  1L0O C;  2BYV E;  4OIQ F;  4KIG A;  2QUF A;  2FRH A;  3E6M A;  1QZY A;  4A12 A;  1Z91 A;  3E5U A;  1DUX C;  1FP1 D;  5EEG A;  1R23 A;  4MGR A;  3WG9 A;  2FBH A;  5D5V B;  4G94 A;  4ESF A;  1RUO A;  4RAZ A;  4D0P A;  2M87 A;  3H3U A;  1OYI A;  1MZB A;  1XSD A;  3ZMU A;  2Z9O A;  3J80 Z;  5ILV A;  2L02 A;  1G3T A;  1ZG5 A;  5DV5 A;  3EQL F;  1J75 A;  5F1R A;  5D6E A;  2DAO A;  2MBF A;  4PZJ A;  2ZFW A;  3T0Y A;  1IUY A;  4CXF A;  3FF5 A;  3GYH X;  1QO0 D;  1RNL A;  3K69 A;  2Q8K A;  4MTD A;  3P9K A;  2JZY A;  2ETH A;  1FOK A;  2DK5 A;  4G7Z F;  3GO5 A;  5KVR A;  4AD9 A;  4ZYD A;  1S6L A;  3WTW C;  4OIO F;  3F8B A;  2EB7 A;  4OIP F;  1RUN A;  3ABU A;  2JPC A;  3SQN A;  3WE3 A;  5DD8 A;  2KIU A;  1IW7 F;  4HX7 A;  1LDK B;  4EJU A;  4GCV A;  3E5Q A;  3MFK A;  2XUB A;  1LJ9 A;  1D5V A;  4YFN F;  1B59 A;  2DT5 A;  3FHZ A;  4HAM A;  3TOA A;  3HRM A;  4RB0 A;  2O6G E;  2ZKZ A;  1JHF A;  4EV0 A;  3JAM K;  3DF8 A;  2IPQ X;  2KIF A;  4HA8 A;  2XKP A;  5BPI A;  2IT0 A;  2Y75 A;  1P6R A;  4ZH4 F;  5JI6 A;  2DLL A;  4UXN A;  2NAZ A;  1B4A A;  4KN4 X;  3LQR A;  3K1P A;  3CLO A;  5IT9 Z;  2KIM A;  4NB5 A;  4HLY A;  3QRF F;  4YFX F;  4ENM A;  2P6T A;  3RPQ A;  1P4A A;  3V8J A;  2EWN A;  2YU3 A;  4I02 A;  2FNA A;  3F21 A;  4IF4 A;  4LLL A;  3HRS A;  2DPD A;  3R61 A;  2XAG A;  4GGG A;  5HLG A;  3MWM A;  2OQR A;  1FYK A;  5LGU A;  3BPX A;  4ZZD A;  1D8J A;  2WWY A;  4EMS A;  3IRQ A;  2KJC A;  2WV0 A;  1YYV A;  3ULQ B;  4HLX A;  4IJA A;  1QNT A;  3QPT A;  4OOI A;  2A6H F;  3MCZ A;  1MJB A;  3ABT A;  4P9F A;  3ZMV A;  1FBS A;  5BOX A;  2DBB A;  4P5O A;  5BPD A;  4FX0 A;  4G6D A;  3ERE D;  1FY7 A;  2A3S A;  2IVM A;  2LF8 A;  5DYM A;  3PQJ A;  1O3R A;  5H20 A;  3RPU A;  3BOQ A;  4EJT A;  4TV7 A;  4UHT A;  2D45 A;  3TO7 A;  1GVJ A;  5HDG A;  5JR3 A;  2HQR A;  4BXU A;  1PUE E;  2J5O A;  1IF1 A;  5JFR A;  4G7H F;  4H0E A;  2K4B A;  2B0L A;  3WTV C;  3ZMT A;  2CO5 A;  2HTJ A;  5DDG A;  2VBZ A;  3QP5 A;  1G3W A;  2L4A A;  1ZRF A;  1XSV A;  5HS9 A;  1ZLJ A;  2OU2 A;  5LEK A;  3C7J A;  2YSR A;  5CVU A;  3V8L A;  2GWR A;  4I09 A;  3F8C A;  2V1X A;  4JQF A;  4S05 A;  3R0J A;  2K02 A;  2FEZ A;  1J0R A;  4I7H A;  2W84 A;  2VT3 A;  2ZME A;  3G73 A;  1QGP A;  2FF4 A;  4KA4 A;  2QLZ A;  4BYY A;  5ILU A;  3IC7 A;  1CGP A;  3HRU A;  1SD7 A;  5AON A;  4MTE A;  3HIF A;  2DQR A;  5FLX Z;  5H6R A;  2M1B A;  4RGX A;  1U8R A;  5CLS A;  1C0W A;  3EYI A;  2PEX A;  3FX3 A;  4P9U A;  4BNC A;  3B02 A;  1T0F A;  1HQC A;  1IRF A;  5ICE A;  2F5F A;  2HGC A;  2UZK A;  1R22 A;  3DPT A;  2HEO A;  4PCQ A;  4OMY A;  5D5W B;  4GO1 A;  2XAJ A;  5D6F A;  2FE3 A;  4WX9 A;  3SZT A;  1R36 A;  1R7J A;  3W6J B;  4Q47 A;  1WWX A;  4N0B A;  1BIB A;  4B8X A;  1U5T A;  2Z5U A;  4Q48 A;  3BZ6 A;  3LWF A;  5E20 A;  4RAY A;  3T1B A;  1I5Z A;  3BJO A;  4L5I A;  2Z99 A;  3ZMZ A;  3R60 A;  1KQ8 A;  2H27 A;  4I2O A;  1S8N A;  2IA0 A;  4OMZ A;  4EJO A;  2D1V A;  2E1C A;  3V4G A;  3RJP A;  4HW0 A;  5L3C A;  3HRT A;  1SAX A;  3LA7 A;  1UCR A;  5FFX A;  3EYY A;  5L3G A;  3KCC A;  1QPM A;  5JVT A;  3VB2 A;  2CGP A;  3KE2 A;  4HX8 A;  1R1T A;  5K5R A;  1O7F A;  1TW2 A;  5D5U B;  1JHH A;  4OIR F;  1DP7 P;  4G6Q A;  1KGS A;  4M74 A;  5D5X B;  1B1B A;  3N97 A;  4ASN A;  3U2R A;  1NHA A;  2ZJ2 A;  5CVV A;  1SD5 A;  2XAS A;  1YLF A;  1KU3 A;  3OV8 A;  3KEQ A;  4P55 A;  4A0Y A;  3J80 K;  1F5T A;  3O2P E;  2ESH A;  1OPC A;  2H09 A;  2FML A;  1BI3 A;  2VE9 A;  1HST A;  2P5K A;  3IWZ A;  3E6C C;  2HR3 A;  3FMS A;  1FBU A;  1R5G A;  1YW8 A;  1LDD A;  2IRF G;  2YPR A;  3MQ0 A;  5F64 A;  1OKR A;  2V1U A;  2HKO A;  2O3F A;  1IXS B;  2ZME B;  4KUM A;  2VC1 A;  2K7L A;  1G6N A;  4LB5 A;  3HSF A;  3WTU C;  4G8X A;  2QYO A;  3O6B B;  2E7W A;  2W24 A;  2V6C A;  3ZMS A;  3F8F A;  2STW A;  2IA2 A;  4PGH A;  1J5Y A;  1ZAR A;  1ONV A;  2CFX A;  3I54 A;  1OMI A;  4DNC A;  3ELK A;  3PQK A;  4A0X A;  5ILS A;  2HZT A;  2PLY A;  2G9W A;  1Z05 A;  3GWZ A;  3GFM A;  5AIP A;  3FM3 A;  1KQ0 A;  2XAF A;  1U5T B;  1G3Y A;  4CHU A;  4XSZ F;  1B9N A;  5IT9 K;  2GA1 A;  1QQI A;  5DUK A;  3BPV A;  4WF2 A;  2GQQ A;  3CDH A;  4N9I A;  4WCG A;  2XIG A;  4IHS A;  3CTA A;  1SFE A;  2VBW A;  1O7L A;  4QLC U;  5FD5 A;  4L5J A;  1ZH5 A;  1W4M A;  1Z7U A;  3GZ5 A;  1UFM A;  2IA1 A;  2LSO A;  5TJJ A;  1H0M A;  4JK1 X;  3HSE A;  4RGS A;  3GLX A;  1UHW A;  5LHG A;  3BDD A;  3CO6 C;  2KKO A;  3RKX A;  4WXC A;  1BN5 A;  2RNJ A;  1U6G A;  1D8K A;  2VOP A;  4GYG A;  2GZW A;  3IRR A;  2R7F A;  5FB2 A;  3V7S A;  5K1Y A;  2D1H A;  1R00 A;  5L3F A;  3JW4 A;  3HOS A;  3QU6 A;  4M72 A;  3M9A A;  3I71 A;  1FZP B;  3EDP A;  2V79 A;  4HYE A;  1ZLK A;  3GF2 A;  3HYI A;  2MA3 A;  3QPH A;  2QQ9 A;  2GIV A;  5HS8 A;  3ZN1 A;  3Q9V A;  2EFO A;  2DI3 A;  2Y48 A;  4UVB A;  2KRF A;  2QWW A;  4HQE A;  5EEH A;  5HDK A;  2L3D A;  3LA2 A;  4KIF A;  4LLN A;  2ZXJ A;  3WTZ A;  2A68 F;  3F3X A;  3E6B A;  2PBI A;  3I58 A;  3V8K A;  2EFQ A;  2DTR A;  4U7B A;  1R1U A;  3TGN A;  3HTU A;  2FA5 A;  1IN7 A;  3E6D A;  1OYW A;  1E17 A;  4LLG F;  2W57 A;  3GFI A;  1ZG3 A;  2X4H A;  2E1N A;  3SFZ A;  1E2X A;  2XRN A;  4O6J A;  4I0B A;  1WKM A;  1BI1 A;  1LDJ A;  2V1D A;  1TQP A;  2QBY A;  3SZP A;  1S3J A;  2Z33 A;  2VON A;  1HW2 A;  3J81 Z;  1XGS A;  3K9T A;  3BP8 A;  5L3D A;  2QZ8 A;  1IRG A; 
#chains in the Genus database with same CATH topology
 3TDU C;  2KLO A;  2DA3 A;  3FZV A;  4OU0 A;  3IKT A;  3BQZ A;  3OYB A;  1K79 A;  2E34 A;  1X1P A;  4RM2 A;  3OYA A;  3KET A;  1ZKG A;  4JX5 A;  2E1M B;  2HOT A;  4RB1 A;  1P9Q C;  2LOO A;  3KP3 A;  2R7V A;  3ROU A;  3BG7 A;  3K1N A;  1FPQ A;  2HZD A;  4XQF A;  5FKL A;  1XCV A;  3CP2 A;  2Y30 A;  3H92 A;  1MW7 A;  2P4W A;  1K7A A;  3G2B A;  1KYZ A;  2FNP A;  3GFL A;  2XSD C;  4QPO A;  3LAP A;  5FLX K;  4FTH A;  2AQE A;  3OIQ A;  2NS7 A;  3RYR A;  2G7U A;  4Q4Z F;  2R7D A;  2BVM A;  4C2T A;  3M4O J;  4K2E A;  2DO7 A;  4J01 A;  3CJN A;  2BXZ A;  1KA8 A;  1EA3 A;  1RI7 A;  2ZO4 A;  4RM3 A;  3OWT A;  1W7P A;  2BY2 A;  3BZK A;  4D1Q A;  1K83 J;  1B6A A;  3T5X A;  3PFI A;  2JPB A;  3I4N J;  1ETO A;  3SYT A;  1EKE A;  2FUG 2;  2TCT A;  4XRS A;  1AHD P;  1G8X A;  2D2W A;  1UHS A;  1Y8Q B;  4YEJ A;  1ZRE A;  4G7O F;  4PDK A;  4LG0 A;  2QCO A;  1OCO H;  4AIJ A;  2CQX A;  3Q0U A;  5F0H A;  3EET A;  2JWT A;  2VQG A;  4L18 B;  4IQ4 A;  2AXL A;  3KYC B;  3CMY A;  1UZC A;  2OZ6 A;  5FO5 A;  2ESN A;  2VT2 A;  1JKO C;  1FIA A;  2XV4 S;  1F9N A;  2VJ4 A;  1MBK A;  4U0Y A;  2O8K A;  1V55 H;  3TQN A;  4OAZ A;  2KZV A;  1XDS A;  2W4S A;  1KU7 A;  3PJR A;  1HKQ A;  3WTX C;  3FK7 A;  1XGN A;  1WSU A;  2R7O A;  2M5W A;  3K4B A;  2XB5 A;  5FKM A;  4DZP A;  5GTI C;  1WJF A;  4LIV A;  5LRS A;  5GTH C;  2GXG A;  5EZH A;  2KZG A;  3P5J A;  5ICC A;  2VI6 A;  1N75 A;  1FC3 A;  4CYD A;  3HOT A;  1I39 A;  3H35 A;  4HNV A;  5EJC A;  3OYF A;  2JVH A;  1XTA A;  2EA2 A;  2STT A;  5B1A H;  5BS6 A;  2E7X A;  4C30 A;  3I3L A;  4LD5 A;  4A3F J;  2Q1Z B;  1NK3 P;  3CCM I;  2JTV A;  4HV5 A;  1BJZ A;  4Y13 A;  2KJB A;  3W2V A;  4R1H A;  2ZJR F;  1XDU A;  3KIO A;  3W3C A;  5J8C A;  3LNQ A;  3CUQ C;  1U2W A;  4KIT B;  2WAQ N;  1ZN2 A;  3BZC A;  1OR7 A;  3OMY A;  5J40 A;  3N05 A;  5CPR B;  2XAH A;  1ETW A;  1FBQ A;  2H94 A;  4LIT A;  4X0G A;  2Z2S B;  4ETS A;  4BQA A;  4XSX F;  1S5L C;  2COM A;  3FWE A;  5ICG A;  4DBR A;  2VBY A;  4IL6 C;  3S93 A;  1OCR H;  1F4K A;  1OYY A;  2BHZ A;  1SFU A;  4FAS D;  1D3Y A;  2O03 A;  5EZG A;  2H8R A;  1P92 A;  3C18 A;  1TQM A;  3QOE A;  1HDP A;  2HOE A;  2XSJ C;  1NG7 A;  5FRN A;  1Z77 A;  4U0W A;  3KP2 A;  3VYR B;  2RV8 A;  3CC7 I;  2XGD A;  1R58 A;  4BBR J;  4ZZL A;  3CME I;  2LRE A;  2DFF A;  2WAF A;  3JSO A;  4BAC A;  1YJW I;  1VI0 A;  3ABL H;  3DU5 A;  3COA C;  4DYQ A;  2K9S A;  2FMY A;  3VYS B;  2PJP A;  2ZNZ A;  5LHI A;  4HEA 2;  4KNY A;  3CCS I;  2K9L A;  4AYB A;  2BV6 A;  1YFH A;  4XNF A;  1O57 A;  1WJD A;  5L3B A;  2L9R A;  4LFU A;  1IN8 A;  1OR7 C;  1ZAO A;  2R92 J;  3PL8 A;  2ZSH B;  3HL2 A;  9ANT A;  5M3F J;  4HNT A;  5J8F A;  1W7P D;  3M1C A;  2F5D A;  1QHG A;  3BWG A;  1IG7 A;  4BBS J;  1S7O A;  5BNG A;  2QBY B;  5B3S H;  3A01 A;  4XBF A;  1Z3X A;  3CCU I;  3VWB A;  4O5V A;  3LMM A;  1DU0 A;  3AG1 H;  1UAA A;  1IV6 A;  2CG4 A;  3E5X A;  4UUS A;  2VKD A;  4BDY A;  2EV5 A;  3HTS B;  3G3Z A;  1FOW A;  2DXI A;  5IOZ A;  2HDW A;  1VQ8 I;  4XMY A;  1X1C A;  1BR4 A;  5LD2 C;  1FTZ A;  1LVA A;  3BTI A;  1V54 H;  1V3F A;  2HOS A;  3GTG J;  1ZHF A;  4BS9 A;  2A5Y B;  2P8T A;  2IJL A;  3B6A A;  1OJL A;  3O8G A;  4L0Y B;  2UXN A;  4RGU A;  1VQP I;  4KIC A;  4U0V A;  1LE8 A;  3S2D J;  1IN4 A;  2K27 A;  2LG4 A;  4KMU X;  3BG3 A;  2XRL A;  3GX4 X;  2YUS A;  1HC8 A;  4CCL A;  2XF6 A;  3JTH A;  5GAD J;  4JX6 A;  4MNU A;  1YW7 A;  3S1R J;  2ELH A;  3S2W A;  2LKP A;  2LF7 A;  4GXO A;  2W48 A;  2CYY A;  4Y15 A;  3I4P A;  3IAS 2;  3P9C A;  3NQO A;  3DBH B;  1W7P B;  2EZI A;  2MD5 A;  1W5C C;  1SD6 A;  4E7I A;  1PP7 U;  2ACJ A;  4Y3O A;  2M7B A;  2X6Y A;  4A6D A;  4WXH A;  1WFX A;  3KP5 A;  1JGG A;  1QBJ A;  1JUS A;  2XRO A;  2DT7 B;  2DW4 A;  4LJZ F;  2PJR A;  1WH5 A;  4PFP A;  1XN7 A;  5F27 A;  3D5L A;  3OYC A;  1Z21 A;  3OL4 A;  3CF5 F;  3M7G A;  2IEK A;  2C6Y A;  2ME0 A;  2EQR A;  3TW6 A;  4LG0 B;  3BR0 A;  4FHT A;  5K5O A;  3OSG A;  4RLQ A;  1A35 A;  4ENJ A;  3H5N A;  3R4K A;  1BC7 C;  3OOP A;  3WE2 A;  1RC9 A;  1I6H J;  4YFK F;  3M1E A;  3BR1 A;  1R5H A;  2WAD A;  3HPH A;  2VJJ A;  4E7K A;  1MSE C;  5DM7 F;  2XGX A;  3CJR B;  2M8E A;  2UUZ A;  1O3T A;  4IPA A;  4CO8 A;  2MSY A;  3OYL A;  3CDI A;  2OTJ I;  1XGM A;  2NNY A;  1UHM A;  2LLK A;  2GAU A;  5E8I A;  5A2Q Z;  4IHV A;  2K3F A;  2L9V A;  5D4R A;  4U7D A;  3K0L A;  3RCO A;  1F1Z A;  2F48 A;  4W97 A;  1FEX A;  1SMT A;  3PM1 A;  1ZRC A;  1N25 A;  3BTJ A;  4RDU A;  1R1V A;  4YII A;  2XPU A;  3MKL A;  4XID A;  3BR5 A;  3CUO A;  5E17 F;  2FBI A;  3HEF A;  3CC4 I;  3KZY A;  1LNW A;  2VXZ A;  3GLL A;  5LEJ A;  4MO7 A;  4DQ2 A;  3ZPL A;  3SHF A;  4EAT A;  1D1A A;  4FCY A;  5HNF A;  1BI0 A;  2WBM A;  1XB4 A;  1M1E B;  1MBE A;  1U9N A;  4XLN F;  1HKT A;  1Z6R A;  4EGY A;  3HSR A;  3AFH A;  4E70 A;  3FK6 A;  5ICF A;  5M3M J;  2DU9 A;  2HKX A;  1QZZ A;  2F4I A;  3PUB A;  2H6B A;  4HBL A;  2XKO A;  3FXL A;  2KIS A;  3IHU A;  1MH3 A;  3LA3 A;  2DQL A;  1DPR A;  3TMO A;  4B4C A;  1T38 A;  2FXA A;  1W1W E;  3BJA A;  3FHN A;  3KEO A;  3A2K A;  1JI8 A;  5E1X A;  2JT1 A;  3SXY A;  2YU9 J;  4HQM A;  1JE8 A;  3WTS C;  3JRH A;  3NEU A;  1R5I D;  3S3M A;  5HNH A;  2L7M P;  3GEZ A;  4PSX A;  3ZQQ A;  3WGH A;  5E3L A;  1HBX G;  3FXR A;  1HLV A;  2W25 A;  1FNN A;  2K3P A;  3HPG A;  1LFB A;  1ZGA A;  5E1W A;  4WWC A;  1ODD A;  3LAJ A;  5AIQ A;  2JK3 A;  2CV0 A;  3ZP5 A;  5IP7 J;  3KLN A;  1A6Q A;  5KCM A;  3P7N A;  2BE5 F;  3OS1 A;  2M0M A;  5HLH A;  4B48 A;  3ISP A;  1OCC H;  3B73 A;  3WGG A;  3GZ6 A;  1LPQ A;  3DKY A;  4CGZ A;  1DDN A;  1NG6 A;  1OCT C;  4KYW A;  1WGX A;  3D5R C;  3AL0 C;  4C3J J;  3SEQ A;  3H5A A;  1ERD A;  2HQN A;  1J09 A;  2AXT C;  3QPL A;  4BKX A;  2B63 J;  1DPU A;  4IZZ A;  2DMQ A;  4ESJ A;  3KP7 A;  3OOU A;  2HDD A;  1Z6T A;  3RKW A;  3K4L A;  3DEW A;  3RDI A;  4UUS B;  2IP2 A;  1GHC A;  3GTO J;  3I4M J;  1ZGJ A;  2VC0 A;  3K4N A;  4D7M A;  4EVI A;  4BJT A;  3F23 A;  1MBF A;  3EUK L;  4EJW A;  3V7R A;  1TW3 A;  2XC7 A;  1E3O C;  2LH9 A;  2BW3 B;  5FD6 A;  1FYM A;  1QHH D;  4KT6 A;  2V4J C;  4B3A A;  4DJA A;  4A3J J;  3OYE A;  1J59 A;  2JA8 J;  2W82 A;  1RKT A;  4ITV A;  3I59 A;  1ZRD A;  4XON A;  4L9J A;  1K6O A;  2MYS A;  2DMP A;  3E0J B;  3J81 K;  4Q5S F;  1T6S A;  4HZF A;  1SAU A;  4RAG A;  4ZYA A;  3RZD J;  1LE8 B;  4LK0 F;  3TO6 A;  3F72 A;  3DKW A;  3VEP A;  2RVC A;  4B43 A;  2H6C A;  3RYP A;  4XIC A;  1QRY A;  1YQA A;  2R7S A;  1R6R A;  4MHG A;  2NVX J;  2EA4 A;  3FMR A;  2ZJP F;  1AWC A;  1EH8 A;  2NYX A;  3PNY A;  2LKS A;  5JLX A;  5F0F A;  3ZQI A;  3HUG A;  5HOO A;  1ZG1 A;  2FOK A;  1FSH A;  2AQF A;  2XF7 A;  3JTG A;  4KN7 X;  4CCJ A;  3LSG A;  2GOM A;  2QF7 A;  4S04 A;  2YX4 A;  3PUF A;  3E97 A;  4CUG A;  3LFK A;  3DQV C;  2LDU A;  5CYV A;  4XKB A;  5HS7 A;  2HPI A;  2ECB A;  3DPL C;  5E79 C;  4EM2 A;  2BY3 A;  3T8T A;  2BBY A;  2F5C A;  4ENN A;  2PJR B;  3LSH A;  4P1W A;  3QU3 A;  4MIM A;  1BW5 A;  1TWC J;  3UR3 C;  2BZT A;  1HCR A;  4CA0 A;  4AIH A;  2DN0 A;  3IH4 A;  2M0C A;  1JGS A;  3CCR I;  1MND A;  3RIR A;  1SVL A;  3TOB A;  3CF2 A;  4J19 A;  1YI2 I;  5J3L A;  2KDZ A;  3FXM A;  2JMW A;  4L0Z B;  5LBQ A;  1VQL I;  3J7A O;  2DA2 A;  5J6X A;  2A07 F;  3ZMD A;  3O3K A;  2QEN A;  2VN2 A;  4IXA A;  4I6Z A;  3H9J A;  2AHQ A;  5D8L B;  1W5S A;  1X2M A;  1TLH B;  2FOW A;  3FDY A;  4L9T A;  4R8H A;  1FYL A;  4MEX F;  2GXB A;  5E1Z B;  2M8G X;  2WY7 Q;  2Q0O A;  4A6E A;  3U21 A;  2CQQ A;  2NS0 A;  3MZ8 A;  4AU7 A;  4BE1 A;  1FOY A;  2JA5 J;  2X1E A;  3SDB A;  2IS1 A;  4E7S A;  1E3P A;  2E5Z A;  3G1M A;  5ED4 A;  2Z3Y A;  3I55 I;  4ZTF A;  1U78 A;  1JT0 A;  2DT6 A;  1JKR C;  1SFK A;  3KEY A;  1MBJ A;  1W5T A;  2IGM A;  5HVQ C;  1RZ4 A;  1X3W B;  2XPW A;  3VYU B;  2VQH A;  4II3 A;  3VPR A;  5IP6 A;  3HOU J;  3I64 A;  3GW2 A;  2DFI A;  2L5Q A;  1OCP A;  2CW8 A;  4M3D A;  2EPF A;  5LHH A;  3F6V A;  1X3Z B;  4LK1 F;  3L9F A;  2K85 A;  5K5Q A;  5C4J J;  1D0Y A;  3DTI A;  5JHF A;  1BA5 A;  4YRV A;  4QWQ A;  2BEO A;  3ZN0 A;  1LEB A;  3BR3 A;  3AL0 B;  2I8D A;  4M6X A;  1X1D A;  1MNE A;  1XMK A;  4RB3 C;  1KYW A;  4A93 J;  2IW5 A;  5DCF A;  3QAH A;  1P2F A;  5FKK A;  2EBI A;  4BH9 A;  1JKQ C;  4L9N A;  4BE2 A;  4XM3 A;  1ZTR A;  2CMP A;  4XLE A;  1HSJ A;  4NUB A;  4BE0 A;  1X4P A;  1LFU P;  1APL C;  1FOX A;  4ZJZ A;  5CJ9 A;  2LVS A;  2XF5 A;  4FT8 A;  3F22 A;  1VQ4 I;  5C3E J;  5TGT A;  4L9V A;  3WU0 A;  2LFB A;  3REO A;  4NQW A;  4BHB A;  2A6E F;  2DK8 A;  4I99 C;  4O3M A;  3DP7 A;  1TNT A;  4HSR A;  1UMQ A;  5K7F A;  3V42 A;  3DLL F;  3DWL E;  2NOJ B;  3FM5 A;  1VTN C;  2UWM A;  2VL8 A;  1REP C;  4RS8 A;  4AIK A;  3HOZ J;  2LNB A;  3GTK J;  2XB0 X;  2CQK A;  1EV7 A;  4ZDP A;  1UEL B;  4MEY F;  2HFH A;  1FX7 A;  4BQO A;  3CZ6 A;  1KU2 A;  1SD4 A;  3HZJ A;  4PGG A;  4I0A A;  1IAW A;  2M9H A;  1Y8R B;  2O8X A;  4IHT A;  4CCM A;  3W6K B;  3LSJ A;  4PK4 A;  3VOE A;  3GUD A;  1XC5 A;  4EQQ A;  1BIA A;  1HKS A;  3HOY J;  1HW1 A;  1MKM A;  1Z1D A;  3VFZ A;  2DTZ A;  1FLI A;  2IS6 A;  1WZ2 A;  1WJE A;  3TDZ C;  2LY1 A;  2PX9 A;  1R4M B;  3J7A Y;  3CMM A;  3HGY A;  1B72 A;  1FP2 A;  1GXQ A;  2NOG A;  3P9I A;  2L7K A;  3FXU A;  2FU4 A;  2A69 F;  5BQT A;  3TL4 X;  5J4Y A;  5FJ8 J;  1HXD A;  2WB1 N;  2Y0S A;  3A03 A;  2CUE A;  3OYM A;  5K7Z A;  1D0X A;  2A5W A;  2E2H J;  3GVA A;  1S29 A;  4IRH A;  4ZYH A;  3BRO A;  3K4K A;  3I59 B;  4KDP A;  4CH7 A;  4UUV A;  3KP6 A;  1SMY F;  3X2Q H;  4CCN A;  2HXI A;  4D7N A;  3OL3 A;  2QQA A;  3D5S C;  4EM1 A;  4GRI A;  3DFG A;  1XS9 A;  1J7K A;  1MMN A;  1ETV A;  2LBF A;  2X51 A;  2P6S A;  1D5Y A;  4EGZ A;  1FSE A;  2R0Q C;  4ABZ A;  5IYB J;  4XLC A;  4A5M A;  1A6I A;  2TRT A;  2CSO A;  3A0B C;  1HW5 A;  1ORK A;  2WTE A;  5E8G A;  1DGR M;  4BY1 J;  2R5Z B;  4KFC A;  1RR7 A;  1YG2 A;  4YG2 F;  4XRM A;  2L54 A;  1T33 A;  3HUG B;  1MMS A;  5DCM A;  2IGO A;  1JJ8 C;  1G2H A;  1JXS A;  2FQ3 A;  3ECH A;  3A0H C;  2GBY A;  2QSF X;  2W85 A;  2KIQ A;  2MFZ A;  3O8H A;  1I27 A;  1PDN C;  1O3Q A;  5CVR A;  4U88 A;  5F6F A;  3D0S A;  4Y7N J;  4M9Z A;  4B1R A;  4BU2 A;  3F6O A;  1TP4 A;  1WJC A;  2V1N A;  3VDX A;  4DZJ A;  4F7Z A;  1K78 B;  4LB6 B;  3F0C A;  1BM9 A;  4XOR A;  5D4S A;  1I3Q J;  3RI4 A;  4M3F A;  4IKF A;  4ZYG A;  3CUQ A;  4N4N B;  1BBY A;  4HX4 A;  4AVZ A;  2XPV A;  4XLH A;  2ZBK A;  2NNN A;  1XSX A;  5M5X J;  4B09 A;  2KL4 A;  5CVJ A;  2R7Q A;  2XAQ A;  1G3S A;  4A3B J;  2X48 A;  1LVK A;  2QM3 A;  2R7X A;  2M3A A;  2VOD A;  3FMQ A;  3AAF A;  2A61 A;  2PMU A;  2M2E A;  1VQN I;  5IT3 A;  3R6S A;  2CV1 A;  1ULY A;  3S14 J;  5JHU A;  4IO9 F;  3L09 A;  3RZO J;  5BMZ A;  3WTT C;  2DCE A;  2RQQ A;  1TQI A;  1F43 A;  2E5N A;  2EFW A;  3FBI B;  2YX7 A;  2QVO A;  1AOY A;  4IHW A;  1PJR A;  3U9G A;  4DYR A;  3M8J A;  4ANJ A;  2R5Y A;  2PI0 A;  1ZR2 A;  2M7A A;  3DV8 A;  4H4K C;  1WI9 A;  4XLP F;  3HB9 A;  3HOW J;  2DOE A;  4EJV A;  5A2Q K;  1CF7 A;  2OQG A;  2DFE A;  2HDC A;  2RNG A;  4M6V A;  2JSC A;  4P96 A;  2X1D A;  2GIZ A;  3W6V A;  4N4O B;  4EM0 B;  2ISZ A;  1KU9 A;  2ZJQ F;  1MDM A;  2CUZ A;  4XRS G;  1BJA A;  2PMZ A;  2XGC A;  3BY6 A;  1PVE A;  3G4S I;  1ZGW A;  2WAE A;  4N9H A;  1B9M A;  1J2X A;  2VAS A;  1WRJ A;  2OBP A;  3PO3 J;  2ISY A;  2JA2 A;  3R0A A;  2K40 A;  3GXO A;  4M71 A;  3KPH A;  4UNO A;  1ON1 A;  1VQK I;  2W1O A;  4NQW B;  4Y4R A;  4C3I J;  2KPM A;  2MH9 A;  1YTY A;  2TDX A;  3WTY C;  3HHH A;  2Z16 A;  3AKZ A;  4HPQ A;  1TBX A;  4A69 C;  3KZI C;  4PUS A;  3A02 A;  3WHB A;  4UV9 A;  2WA0 A;  1YIT I;  5IPA A;  1DU6 A;  3TBI A;  2EH3 A;  2V7F A;  2LTP A;  2HI3 A;  2P5V A;  1VF9 A;  3E7L A;  4RAF A;  2E60 A;  4CIC A;  3FIW A;  2LD5 A;  2R3S A;  2HYG D;  3ZQC A;  1QU3 A;  3CMA I;  3TKY A;  1X3U A;  4AVP A;  2E2J J;  4I01 A;  2FD5 A;  1XGO A;  1X58 A;  3M07 A;  3DXJ F;  1XCB A;  3EUH A;  1T2K A;  1ZQ3 P;  4WK8 F;  3WGI A;  1Q1H A;  2K9N A;  1I1S A;  2FBK A;  2UXX A;  3ABM H;  1YW9 A;  3G1L A;  5GP9 A;  1KON A;  3K70 C;  4HDU A;  3MKW B;  4BQQ A;  2OD5 A;  3JRD A;  3FIS A;  4HOB A;  3S2H J;  1WH7 A;  3NWS A;  4NC6 A;  4BAY A;  2RN7 A;  2DDA A;  2ADU A;  1BI2 A;  4HF2 A;  3Q9S A;  2CJJ A;  3NRV A;  4QSH A;  4B44 A;  1B72 B;  1WQ2 A;  4Y17 A;  3F8M A;  5FKO A;  2HWV A;  4V2G A;  2BW3 A;  2RGV A;  5FFZ A;  2MH2 A;  1EH6 A;  4NHJ A;  1R9T J;  3JAM Z;  1EH7 A;  2XDV A;  1G4D A;  1IDY A;  4DYC A;  2DMT A;  2XVC A;  2NVY J;  1S7A A;  4JBA A;  4HG2 A;  2VKH A;  1AA7 A;  1Y0U A;  3RSN A;  4XKW A;  3HGG A;  1TWF J;  1IZ1 A;  3ML6 A;  3K7A J;  2E36 A;  4W1U A;  1GVD A;  2X9D A;  1GV2 A;  3LSK A;  4IRG A;  5LGN A;  1MD0 A;  2IS2 A;  1AKH A;  2VQC A;  3M8E A;  1X1B A;  4LOC A;  2JRT A;  3M8F A;  5EYR A;  2LBF B;  1ZYR F;  2ZNY A;  5DD4 A;  4RB2 C;  1GXP A;  4CCO A;  3IWF A;  2RKH A;  2L4M A;  3EUH C;  4F3Q A;  2JA7 J;  4ON0 A;  5FLM J;  1DGW Y;  4CDG A;  3DEU A;  4A3G J;  2NRA C;  5CKT A;  1Z7L A;  3H0G J;  2X0L A;  2GA2 A;  1VFC A;  3CCY A;  2PN6 A;  5KK1 A;  2R7U A;  1LEA A;  2QQB A;  3C3W A;  5DCM B;  3BG5 A;  1FWZ A;  4EEF G;  2A6T A;  2CRG A;  2PQ8 A;  2VIX A;  1H8A C;  1Y6I A;  2R4G A;  4X6A J;  1LB2 A;  1F36 A;  4GFB A;  2EZK A;  2RQP A;  3KFW X;  1MJA A;  2V26 A;  2OAZ A;  4HF1 A;  3L1P A;  1ON2 A;  3FXQ A;  4I98 B;  4E7J A;  3BCB A;  4UV8 A;  4WXD A;  2DFH A;  3WOD F;  2COB A;  2X85 A;  4XRF A;  3U1D A;  3C1D A;  1YIO A;  2J5P A;  2X1C A;  4MQ9 F;  4YEL A;  2EIN H;  3SFI A;  4A3E J;  1N77 A;  4IRI A;  3S15 J;  4A3I J;  2V9V A;  2ZC2 A;  4LGW A;  6PAX A;  1IN5 A;  3CUQ B;  3H3Z A;  3ONQ A;  3PO2 J;  5H6Q A;  2HVR A;  3PNV A;  3S3N A;  3L2C A;  2HU9 A;  2EIL H;  3L00 A;  1WPK A;  1XMX A;  4MQV A;  4ZTJ A;  1IV8 A;  3LQQ A;  2DMU A;  1GUU A;  1XD7 A;  2NXN B;  4Z2Y A;  5B1B H;  3CCE I;  3I5U A;  2QA4 I;  2OJE D;  3J7Y J;  3S16 J;  4AM3 A;  4RMN A;  4HV6 A;  3H9Q A;  1V4R A;  4A5N A;  1VQ9 I;  1TWG J;  1MIJ A;  3BJ6 A;  2ZCW A;  1Y1V J;  3JRA A;  3CCV I;  1P7J A;  2H1L A;  2EFP A;  1OFC X;  4QPQ A;  1H9T A;  3NWT A;  1KQ9 A;  1MJ9 A;  4BHC A;  4PJN A;  3OSF A;  2CQN A;  1STZ A;  2WC2 A;  3MEX A;  1RIO H;  1T98 A;  1B8I A;  3D1N I;  2R5Y B;  3GBG A;  5C44 J;  1UST A;  2OF7 A;  5L3E A;  2HS5 A;  5LGT A;  2PFB A;  1TWA J;  1PYV A;  4XKV A;  1H9G A;  1CF7 B;  3HKZ N;  3S3O A;  3LSM A;  1A04 A;  1U5T C;  3L7W A;  4ESB A;  3IAM 2;  3QP6 A;  3KLO A;  1YO5 C;  3BR6 A;  1T39 A;  1MDM B;  1V5F A;  3KP4 A;  2BOL A;  2BGC A;  1S72 I;  4HDV A;  2MLG A;  4KT5 C;  3LSI A;  5HDN A;  1H88 C;  2DOA A;  5CVI A;  1P4W A;  3WU1 B;  2HYF A;  4GYI A;  4PJ0 C;  4RGR A;  1IXR C;  1P4X A;  4HRI A;  3ZQ7 A;  1FT9 A;  2P7V B;  1D1B A;  3I0T A;  5ERI A;  4GDF A;  4IVN A;  4F91 B;  2HTS A;  2CU7 A;  2CUJ A;  1USS A;  2JVG A;  2KRC A;  4YIF A;  4IOC F;  3CO7 C;  4A3K J;  1MBH A;  3FBN B;  1S9H A;  5TRD A;  4R79 A;  3I53 A;  2EJR A;  4UVC A;  1WJ5 A;  3CLQ A;  2BHY A;  3PIO F;  2MW8 A;  4BHP A;  2OZU A;  4AWX B;  2L01 A;  3N4M A;  1T8I A;  1SFO J;  2CV2 A;  4M9X A;  2MLK A;  2MG4 A;  1RRJ A;  3RQI A;  2F2E A;  5E18 F;  4ZYE A;  1RR8 C;  2H1K A;  2Z1D A;  3HXL A;  2IGN A;  2OV7 A;  1VND A;  5EEA A;  3W2A A;  1BC8 C;  2Q2E A;  4KMF A;  2K86 A;  2DJI A;  4F52 A;  4M6Y A;  2FSW A;  4OWR B;  3VOD A;  1YOV B;  1XPX A;  3HHG A;  3K1M A;  3KYL A;  1FIP A;  1QA6 A;  3F8N A;  2YS9 A;  2VUM J;  5D8K B;  2VE8 A;  4M9S A;  2V9P A;  4OAY A;  3H1C A;  4ENK A;  2K4J A;  1WVR A;  1YS7 A;  3LFU A;  3MD2 A;  3OR2 C;  2DPU A;  3S8P A;  3SDG A;  4M73 A;  2QEX I;  1IXC A;  1EF4 A;  2L7F P;  1ZR4 A;  3Q0V A;  4CZZ A;  1TTY A;  4E4H A;  1ZK8 A;  1L3L A;  2NS8 A;  2JSP A;  3PNT A;  1MSF C;  1Z9C A;  2WAQ A;  3IV5 A;  1WJB A;  3K10 A;  3MAJ A;  4FE4 A;  2AS5 F;  3GFJ A;  2KFD A;  5IYD J;  4LMY A;  1I1G A;  4U87 A;  5HLI A;  2PMH A;  3KYD B;  3JSP A;  1OLT A;  4OIN F;  3Q3S A;  2ELK A;  2VKE A;  4XOT A;  5FGM A;  1SFX A;  4FX4 A;  2Y31 A;  2O0Y A;  3IL2 A;  2P7C B;  1AKH B;  2EFN A;  5LLQ A;  2JRM A;  4E7H A;  1O3S A;  2F5E A;  1PP8 F;  4IEJ A;  4FET A;  1K4S A;  3MZY A;  3RKQ A;  2HXO A;  2R5Z A;  5LRR A;  2F4O B;  5F04 A;  5B66 C;  5IYC J;  1K6Y A;  1YS6 A;  5DEQ A;  1J9I A;  2Y9Y A;  1V5E A;  1X1A A;  2OA4 A;  3K6G A;  4AUX A;  1A31 A;  2O61 A;  3T8R A;  4M3B A;  1LQ1 A;  2XHK A;  4A2U A;  4NC7 A;  3G6E I;  2EV6 A;  1U3E M;  1P7I A;  3CCL I;  4D9J A;  1Y39 A;  4DIQ A;  3TW7 A;  2BVL A;  2I5U A;  2CFO A;  1K78 A;  1T95 A;  4XR6 A;  2G7H A;  1LKX A;  2M45 A;  2KMU A;  2VJ5 A;  2EK5 A;  2VBX A;  2ID3 A;  1UG0 A;  2EV0 A;  3LST A;  1IN6 A;  4IX7 A;  3MZH A;  2R7Z J;  3BTC A;  3RTR A;  1XMA A;  1I6X A;  3ZRG A;  2PG4 A;  1TNS A;  2DYS H;  4UVA A;  1BOA A;  3ASN H;  3KZZ A;  4CYC A;  1UB9 A;  3K2Z A;  3TO9 A;  2P5L C;  3L2V A;  1LFP A;  2MC3 A;  2RDP A;  1ACI A;  1RPW A;  3E3V A;  1ENH A;  5DUI A;  3M3Y J;  3RKY A;  4M3E A;  4KIB A;  3V7C A;  4IHY A;  3K4J A;  2P81 A;  1WHU A;  2CW0 F;  3ECO A;  2CWE A;  4HF0 A;  1VQO I;  3DEE A;  2VOO A;  2X6O A;  3JRF A;  2M30 A;  2RC4 A;  2DA7 A;  2A05 A;  1VQ5 I;  1NH3 A;  1I3A A;  4G9Y A;  3U1K A;  2JA6 J;  2MD0 A;  3GTQ J;  3QOP A;  2YR2 A;  3IKV A;  4BEH A;  1U0J A;  2Y0M A;  2IBD A;  3ZQH A;  3L2W A;  1MGT A;  4BY7 J;  4A0Z A;  1QVU A;  5J1U A;  4AYB N;  2Y9Z A;  3Q5F A;  1L0O C;  2BYV E;  3J7Z I;  4OIQ F;  5FRM A;  4KIG A;  3CDL A;  2QUF A;  2CUF A;  3OYN A;  2FRH A;  2OUM A;  5KNL A;  3E6M A;  2W7N A;  2DDB A;  1W0T A;  1QZY A;  4A12 A;  1Z91 A;  3E5U A;  5K7H A;  1B8I B;  1DUX C;  1FP1 D;  5EEG A;  3DTK A;  1R23 A;  4MGR A;  3WG9 A;  3HJE A;  2FBH A;  3HOV J;  5D5V B;  3DKX A;  4G94 A;  4ESF A;  1Q1V A;  1RUO A;  2L0K A;  4RAZ A;  3QOD A;  4D0P A;  4F93 B;  1FTT A;  2M87 A;  3E1S A;  3H3U A;  1K61 A;  1OYI A;  4NDL A;  1MZB A;  2KHM A;  1XSD A;  3ZMU A;  2Z9O A;  2ZXW H;  2HOA A;  3J80 Z;  5ILV A;  2L02 A;  1G3T A;  4XKC A;  5DV5 A;  1ZG5 A;  1U8B A;  3EQL F;  2GLO A;  3G1O A;  1J75 A;  3CES A;  5F1R A;  5D6E A;  2DAO A;  4XLF A;  2MBF A;  1JKP C;  1X4O A;  4PZJ A;  2EIM H;  1BOB A;  2ZFW A;  3T0Y A;  1VQ6 I;  1IC8 A;  1MMA A;  4DGW B;  3MN2 A;  2GOX B;  3QYF A;  5FKN A;  1IUY A;  2BY1 A;  4CXF A;  3FF5 A;  3GYH X;  1QO0 D;  1R49 A;  1RNL A;  3K69 A;  2Q8K A;  2M34 A;  4MTD A;  3P9K A;  3GTP J;  4A3M J;  2DMN A;  2JZY A;  2ETH A;  2P0W A;  3TP3 A;  1FOK A;  2DK5 A;  4G7Z F;  3GO5 A;  2Q2E B;  5KVR A;  2L7Z A;  4IHX A;  4AD9 A;  2ZSI B;  4ZYD A;  1IGN A;  2L9N A;  1S6L A;  4CSW A;  3WTW C;  4OIO F;  3F8B A;  2EB7 A;  4LG3 A;  4OIP F;  2NVQ J;  1RUN A;  3ABU A;  2JPC A;  1GLN A;  2F6C A;  1WCM J;  3K4M A;  5EGO A;  3SQN A;  3WE3 A;  5KAF C;  5DD8 A;  2KIU A;  3FKJ A;  3DPU A;  1IW7 F;  4HX7 A;  1LDK B;  2AO9 A;  2EZH A;  4EJU A;  5H2F C;  4GCV A;  1KZH A;  1HF0 A;  2MGQ A;  3E5Q A;  3MFK A;  2XUB A;  3BG6 A;  2ECC A;  1LJ9 A;  5J4V A;  1JTX A;  3JRB A;  1D5V A;  1FJL A;  4YFN F;  1B59 A;  1Z67 A;  1FMW A;  2DT5 A;  3FHZ A;  1IO2 A;  1A5J A;  4HAM A;  3TOA A;  1MBG A;  3HRM A;  3ZGK A;  1YE9 A;  1S7E A;  3MVP A;  2BXY A;  1ETK A;  3CP8 A;  3WU2 C;  1I50 J;  4RB0 A;  2JJ7 A;  2O6G E;  2ZKZ A;  1JHF A;  4XLA A;  3W2W A;  4EV0 A;  3HG9 A;  3JAM K;  1ETQ A;  4JYK A;  1V5G A;  2I10 A;  3DF8 A;  2IPQ X;  2KIF A;  1GDT A;  3OS0 A;  4F92 B;  3G71 I;  4HA8 A;  2L2O A;  2XKP A;  5BPI A;  5EG0 A;  1UJ8 A;  2IT0 A;  1X2N A;  4II2 A;  2Y75 A;  4ZDL A;  1P6R A;  1N78 A;  4ZH4 F;  4BJ5 C;  5JI6 A;  3OY9 A;  1VQM I;  1POG A;  2DLL A;  3QYE A;  2NAZ A;  4UXN A;  2DA5 A;  1B4A A;  2V9K A;  4DOZ A;  3TED A;  4KN4 X;  3ZR8 X;  3C2G A;  2E1O A;  3JRI A;  3IH2 A;  3LQR A;  2CW7 A;  3K1P A;  3CLO A;  3JCU C;  5IT9 Z;  2KIM A;  2FX0 A;  4NB5 A;  4HLY A;  3QRF F;  3JR9 A;  4CZC A;  1A36 A;  3NAR A;  4YFX F;  2JQ7 A;  4ENM A;  2P6T A;  3VSK A;  3RPQ A;  1P4A A;  2EZL A;  3V8J A;  2EWN A;  2O7O A;  4IQJ A;  2YU3 A;  5JVG F;  4I02 A;  5HLT A;  1Y1W J;  2FNA A;  3F21 A;  3HDD A;  2HVS A;  4IF4 A;  4LLL A;  3HRS A;  2ZXH A;  2HQ5 A;  1MNM C;  3QPS A;  2ICW G;  2VXD A;  1CQT A;  3EPZ A;  2DPD A;  4CYC B;  4KJZ A;  2E2I J;  3OYG A;  1T56 A;  1YRN A;  1DQU A;  2XAG A;  3R61 A;  4L5E A;  3IH3 A;  4PFO A;  4GGG A;  2LY2 A;  3CD6 I;  5HLG A;  4BXX J;  1LUJ B;  1QPI A;  3H9G A;  2LR8 A;  2OQR A;  3MWM A;  4JX4 A;  4BXF A;  2JN6 A;  5J47 A;  5B5E C;  1AU7 A;  1TT0 A;  3LL7 A;  5LGU A;  1FYK A;  2KQR A;  3BPX A;  4ZZD A;  1FMV A;  1D8J A;  2WWY A;  3S1M J;  1BR1 A;  2UV1 A;  4BEH B;  1XG1 A;  4EMS A;  5IOY A;  2VPR A;  3IRQ A;  2KJC A;  2WV0 A;  2QQ8 A;  1YYV A;  3ULQ B;  2LC2 A;  4HLX A;  1JJ6 C;  4IJA A;  2F5V A;  1QNT A;  5CQE A;  3QPT A;  4OOI A;  3FXK A;  2A6H F;  3MCZ A;  1YIJ I;  1MJB A;  2R7W A;  3ABT A;  4P9F A;  3ZMV A;  4IOA F;  1FBS A;  3CQZ J;  4DW6 A;  5BOX A;  1YJN I;  2HQA A;  2DBB A;  4P5O A;  5BPD A;  2EIJ H;  3VSL A;  1VQ7 I;  4FX0 A;  2ZXI A;  4G6D A;  3DBL B;  2HVQ A;  3ERE D;  4XOP A;  4BQN A;  5CQG A;  1FY7 A;  5HOD A;  2A3S A;  2IVM A;  2LF8 A;  5DYM A;  3PQJ A;  4BJ6 C;  1O3R A;  3BLY A;  5H20 A;  3CJT B;  3RPU A;  3BOQ A;  3H5R A;  4EJT A;  1OQY A;  4TV7 A;  4UHT A;  2D45 A;  3TO7 A;  1GVJ A;  5HDG A;  1TZL A;  5JR3 A;  5M5W J;  5EDN A;  3JRE A;  2HQR A;  4BXU A;  5DS9 A;  3K4C A;  5EF6 A;  2J5O A;  4I76 A;  1PUE E;  1IF1 A;  5JFR A;  4G7H F;  2M4G A;  3SJM A;  4CCK A;  3FKI J;  4H0E A;  2K4B A;  1ETY A;  1E0E A;  1PUF B;  4B47 A;  4D5F A;  4C2M J;  3BC8 A;  3FXJ A;  2B0L A;  3WTV C;  3ZMT A;  2CO5 A;  2E19 A;  3ZCO A;  2HTJ A;  5DTD A;  1TWH J;  5KAI C;  5DDG A;  3UKG A;  2DOD A;  2VBZ A;  3QP5 A;  1G3W A;  1TC3 C;  1YX5 A;  1IJW C;  1XX5 A;  2L4A A;  2XAU A;  4BDZ A;  1ZRF A;  1XSV A;  5HS9 A;  1R71 A;  2CQ7 A;  1ZLJ A;  2OU2 A;  3OYJ A;  1WI3 A;  4QTR A;  3CC2 I;  5LEK A;  3CCQ I;  2KDO A;  3C7J A;  2YSR A;  3I9V 2;  5CVU A;  3EUA A;  2GWR A;  3V8L A;  4MLO A;  5EGO B;  5IP9 J;  4I09 A;  3F8C A;  2V1X A;  4JQF A;  4S05 A;  3R0J A;  2K02 A;  1R4N B;  2G0E A;  4UB6 C;  3AG3 H;  2VJI A;  2FEZ A;  2VLA A;  1J0R A;  4I7H A;  2W84 A;  2VT3 A;  2ZME A;  3G73 A;  1QGP A;  2FF4 A;  4DBQ A;  4KA4 A;  2QLZ A;  3S17 J;  2IGK A;  3GME A;  4BYY A;  5ILU A;  2R7T A;  2FJ1 A;  2OC6 A;  1HA8 A;  3IC7 A;  1CGP A;  2LY9 A;  3HRU A;  4YIR X;  1SD7 A;  4Z6Y A;  3ABK H;  3WHC A;  1D1C A;  5AON A;  4MTE A;  3HIF A;  2DQR A;  5FLX Z;  5H6R A;  4D5C A;  2M1B A;  3C2H A;  3OR1 C;  4RGX A;  1U8R A;  3OS2 A;  5CLS A;  1C0W A;  2ME6 A;  3EYI A;  2NVT J;  3GTJ J;  2PEX A;  3FX3 A;  4P9U A;  4BNC A;  3FXO A;  2QSG X;  3B02 A;  1T0F A;  2K5C A;  3JRG A;  1HQC A;  3LOC A;  1IRF A;  1T08 B;  3JRC A;  1ZEL A;  3HOX J;  1W36 C;  5ICE A;  2QGU A;  2F5F A;  5EG0 B;  2EIK H;  3MKZ A;  2K9Q A;  2HGC A;  2UZK A;  1R22 A;  3DPT A;  2HEO A;  4PCQ A;  4OMY A;  3IP4 B;  4FIS A;  5D5W B;  4NC8 A;  3C2B A;  4GO1 A;  2ZME C;  2B7E A;  2XAJ A;  2RRE A;  2ELJ A;  5D6F A;  1IDZ A;  3ZQG A;  4AID A;  1DP3 A;  3L2U A;  2FE3 A;  4WX9 A;  3SZT A;  3BR2 A;  1R36 A;  1R7J A;  1SC7 A;  3W6J B;  4Q47 A;  5FLV A;  3H3V K;  5GAG J;  3RPU D;  1WWX A;  1IUF A;  4UB8 C;  3K70 D;  4A3L J;  4N0B A;  1BIB A;  1MH4 A;  4B8X A;  2LKX A;  3HC7 A;  4E6K G;  1U5T A;  2Z5U A;  4Q48 A;  4LIU A;  4PSW A;  3BZ6 A;  3OYD A;  3LWF A;  5E20 A;  2R93 J;  4RAY A;  2WB1 A;  3T1B A;  1YRN B;  1I5Z A;  1T0F C;  3BJO A;  4L5I A;  3A4C A;  5E3O A;  1SVM A;  2Z99 A;  2W00 A;  3ZMZ A;  3TP0 A;  4PJL A;  3R60 A;  4NNJ A;  1KQ8 A;  2H27 A;  4I2O A;  1YHQ I;  2MAB A;  2E35 A;  1JUP A;  1S8N A;  2IA0 A;  4OMZ A;  1HDD C;  1TT5 B;  4EJO A;  4B3X A;  2D1V A;  2LMD A;  3BTL A;  3OIP A;  2L9S A;  3QYB A;  3AG4 H;  4RA2 A;  2E1C A;  3V4G A;  3MMY B;  3RJP A;  4KIS A;  4HW0 A;  2GXA A;  2N8G A;  4JOM A;  3VYT B;  5L3C A;  3HRT A;  1SAX A;  1QZE A;  3I56 I;  2JUC A;  3LA7 A;  1UCR A;  3CCJ I;  5FFX A;  3GZN B;  3EYY A;  5GPA A;  5L3G A;  3GTL J;  3QWL A;  1W36 D;  3KCC A;  1QPM A;  1NK2 P;  5JLW A;  3VB2 A;  5JVT A;  5J1R A;  3MKY B;  2CGP A;  2K9M A;  3Q0W A;  3GCM A;  4PJJ A;  2VPL A;  3H0D A;  3KE2 A;  4HX8 A;  1R1T A;  5K5R A;  1O7F A;  4XN0 A;  2D5V A;  1TW2 A;  5D5U B;  1TL8 A;  3BQY A;  1JHH A;  2VQL A;  4OIR F;  1DP7 P;  2Y0S N;  4G6Q A;  3BCA A;  1KGS A;  1Y56 A;  2X6X A;  4M74 A;  3CJQ B;  5D5X B;  1B1B A;  4G6T B;  3BG9 A;  3N97 A;  1SEU A;  4ASN A;  3U2R A;  1NHA A;  2ZJ2 A;  5CVV A;  1SD5 A;  2XAS A;  1YLF A;  1KU3 A;  3OV8 A;  3KEQ A;  4P55 A;  4A0Y A;  3K2A A;  3J80 K;  1F5T A;  3O2P E;  2ESH A;  1OPC A;  2H09 A;  1K4T A;  4AC0 A;  2FML A;  4FQG A;  1BI3 A;  1Y0N A;  2VE9 A;  1HST A;  2P5K A;  3IWZ A;  3E6C C;  1Z0X A;  5F08 A;  3OYI A;  2HR3 A;  3FMS A;  1FBU A;  2LP0 A;  1W0U A;  3HM5 A;  1R5G A;  1YW8 A;  1LDD A;  4UUT A;  2IRF G;  5C4X J;  2YPR A;  2LYC A;  3MQ0 A;  4Y33 A;  1D0Z A;  1OKR A;  5F64 A;  2WV1 A;  2V1U A;  2HKO A;  2MC4 A;  2BY0 A;  3AG2 H;  4C3H J;  3DTE A;  5GAH J;  5M5Y J;  2O3F A;  3HBL A;  1ETX A;  1WJA A;  1E3H A;  1IXS B;  3DCF A;  1H89 C;  2ZME B;  4KUM A;  3DLA A;  4E7Z A;  2VC1 A;  3A01 B;  2K7L A;  3SEZ A;  5KHD A;  1NTC A;  3PSF A;  4BL0 B;  1G6N A;  4LB5 A;  3HSF A;  3WTU C;  1GV5 A;  1RET A;  2NVU B;  4G8X A;  2QYO A;  3O6B B;  4A3D J;  2E7W A;  2W24 A;  2V6C A;  2O5R A;  3S1Q J;  3ZMS A;  1O4X A;  2QKM B;  3F8F A;  2B9S A;  2HYJ A;  3PFY A;  2STW A;  2HNH A;  4HST A;  2IA2 A;  4PGH A;  3F9K A;  1JUM A;  1J5Y A;  1ZAR A;  1ONV A;  2CFX A;  1IRZ A;  4MFD A;  1JTY A;  4RLF A;  1Z3Y A;  1BW6 A;  3PIP F;  3I54 A;  1OMI A;  3S32 A;  4DNC A;  2ZB9 A;  3ELK A;  3OYK A;  1OCZ H;  2KP6 A;  1QVT A;  3PQK A;  1MMG A;  2HZT A;  5ILS A;  4A0X A;  2OCC H;  4G12 A;  4PJM A;  2V6E A;  2PLY A;  2QSH X;  3UNG C;  2G9W A;  3DBR B;  1U9O A;  2F4M B;  1Z05 A;  3GWZ A;  2DYR H;  3GFM A;  4XN3 A;  4NBQ A;  5AIP A;  3ZQL A;  3FM3 A;  1KQ0 A;  2KRH A;  3ESW B;  2XAF A;  1BR2 A;  4XK4 A;  2CS3 A;  3PSI A;  4J00 A;  1U5T B;  1G3Y A;  1ITY A;  2OTL I;  2PMZ N;  4S0H B;  4CHU A;  4XSZ F;  1B9N A;  2KT0 A;  5IT9 K;  1MMD A;  1QQI A;  2GA1 A;  1SAN A;  5DUK A;  1X19 A;  3BPV A;  3L2R A;  2OCE A;  2E1M C;  4WF2 A;  2GQQ A;  2VB6 A;  3CDH A;  2DA4 A;  4N9I A;  4WCG A;  1SVO A;  2FQ4 A;  3ZXS A;  2XIG A;  4MFE A;  4IHS A;  3CTA A;  5FRO A;  1SFE A;  2H8W A;  2VBW A;  1O7L A;  4QLC U;  2E71 A;  5FD5 A;  4L5J A;  1ZH5 A;  1W4M A;  4FE7 A;  1Z7U A;  3GZ5 A;  2ZFU A;  3OIO A;  3QQA A;  4V2F A;  4HNU A;  1UFM A;  5DM6 F;  1YX3 A;  2HPM A;  2IA1 A;  1G59 A;  2DJN A;  3LSR A;  2Y2Z A;  2LSO A;  3KX2 A;  5TJJ A;  2ID6 A;  1H0M A;  4JK1 X;  3HSE A;  3ZQF A;  1OIS A;  4RGS A;  3GLX A;  1UHW A;  5LHG A;  3BDD A;  3CO6 C;  2KKO A;  3RKX A;  4WXC A;  1BN5 A;  2RNJ A;  1IRX A;  4Y52 J;  1U6G A;  3S1N J;  1D8K A;  2VOP A;  4GYG A;  2GZW A;  3IRR A;  2R7F A;  2GM4 A;  5FB2 A;  3V7S A;  3LSP A;  3ZOB A;  3SZG A;  5K1Y A;  2D1H A;  4XL9 A;  1R00 A;  3ERM A;  5L3F A;  5E3N A;  3JW4 A;  1HOM A;  1UG2 A;  5F0C A;  1JT6 A;  3HOS A;  3QU6 A;  4M72 A;  3GTM J;  3M9A A;  3I71 A;  5LFA A;  2RAE A;  1FZP B;  3EDP A;  2V79 A;  2IAI A;  5J1Y A;  4HYE A;  1ZLK A;  5TIS C;  1GT0 C;  3GF2 A;  4C2U A;  3WG7 H;  2DA6 A;  3HYI A;  2MA3 A;  3QPH A;  2QQ9 A;  2GIV A;  5HS8 A;  3ZN1 A;  2DA1 A;  3Q9V A;  1VZ0 A;  4UY8 I;  2EFO A;  2DI3 A;  2IXS A;  2OPT A;  2Y48 A;  5F1J A;  1EJ9 A;  5GAE J;  2M4K A;  4UVB A;  1PUF A;  2KRF A;  2QWW A;  2CH0 A;  1RES A;  5IY5 H;  2R7R A;  4HQE A;  5EEH A;  5HDK A;  2L3D A;  3LA2 A;  2XGE A;  4KIF A;  4LLN A;  2ZXJ A;  3WTZ A;  2A68 F;  3F3X A;  3E6B A;  1YJ9 I;  2PBI A;  3I58 A;  3V8K A;  2O9L A;  2DOF A;  2EFQ A;  2DTR A;  2VKV A;  4U7B A;  1R1U A;  4ZC3 A;  3TGN A;  4X1E A;  3A1Y A;  3RQ4 A;  1BL0 A;  3HTU A;  2FA5 A;  1IN7 A;  3E6D A;  3NAU A;  4C9Y A;  1OYW A;  1E17 A;  3OYH A;  4LLG F;  2LK2 A;  4JP0 A;  2W57 A;  3GFI A;  1ZG3 A;  2JUG A;  2X4H A;  4V19 K;  4E7L A;  2E1N A;  3SFZ A;  1RKW A;  1E2X A;  2QKL B;  2XRN A;  4BGD A;  4O6J A;  4I0B A;  1WKM A;  1BI1 A;  1LDJ A;  2V1D A;  3HKZ A;  4F55 A;  2LRD A;  1TQP A;  4ZDO A;  3DU6 A;  3B6C A;  2QBY A;  3SZP A;  1S3J A;  3ASO H;  3BT9 A;  2Z33 A;  2VON A;  5GPC A;  1HW2 A;  3J81 Z;  4QIW N;  4A3C J;  2WY8 Q;  4BUP A;  3IUO A;  2X6W A;  1XGS A;  2Y69 H;  3K9T A;  3BP8 A;  5E3M A;  3L2Q A;  3H36 A;  5L3D A;  2QZ8 A;  2IS4 A;  4M3G A;  4RBO A;  1IRG A; 
#chains in the Genus database with same CATH homology
 3TDU C;  3FZV A;  4OU0 A;  3IKT A;  1K79 A;  3KET A;  4RB1 A;  3KP3 A;  3ROU A;  3K1N A;  1FPQ A;  1XCV A;  3H92 A;  2P4W A;  1K7A A;  1KYZ A;  2FNP A;  3GFL A;  3LAP A;  5FLX K;  3RYR A;  2G7U A;  4Q4Z F;  2R7D A;  4K2E A;  2DO7 A;  3CJN A;  1KA8 A;  1RI7 A;  2ZO4 A;  1W7P A;  1B6A A;  3T5X A;  3PFI A;  2JPB A;  2D2W A;  1ZRE A;  4G7O F;  4PDK A;  4LG0 A;  4AIJ A;  3EET A;  4L18 B;  2AXL A;  2OZ6 A;  5FO5 A;  2ESN A;  2VT2 A;  2XV4 S;  1F9N A;  4U0Y A;  3TQN A;  1XDS A;  1KU7 A;  1HKQ A;  3WTX C;  1XGN A;  1WSU A;  2M5W A;  5LRS A;  2GXG A;  5ICC A;  1FC3 A;  4CYD A;  3HOT A;  2EA2 A;  2STT A;  5BS6 A;  2E7X A;  4LD5 A;  2JTV A;  4HV5 A;  4Y13 A;  2KJB A;  4R1H A;  1XDU A;  5J8C A;  3CUQ C;  1U2W A;  1ZN2 A;  1OR7 A;  2XAH A;  1FBQ A;  2H94 A;  4ETS A;  4BQA A;  4XSX F;  2COM A;  3FWE A;  5ICG A;  2VBY A;  1F4K A;  1OYY A;  1SFU A;  1D3Y A;  2O03 A;  1P92 A;  1TQM A;  3C18 A;  2HOE A;  4U0W A;  3KP2 A;  2RV8 A;  1R58 A;  4ZZL A;  3JSO A;  3COA C;  2FMY A;  2PJP A;  2ZNZ A;  5LHI A;  4KNY A;  2BV6 A;  1YFH A;  1O57 A;  5L3B A;  4LFU A;  1IN8 A;  1ZAO A;  5J8F A;  1W7P D;  2F5D A;  3BWG A;  1S7O A;  2QBY B;  4XBF A;  4O5V A;  2CG4 A;  3E5X A;  2EV5 A;  3HTS B;  3G3Z A;  1LVA A;  1V3F A;  1ZHF A;  2A5Y B;  2P8T A;  2IJL A;  4L0Y B;  2UXN A;  4RGU A;  4KIC A;  4U0V A;  1IN4 A;  2K27 A;  4KMU X;  3GX4 X;  3JTH A;  4MNU A;  1YW7 A;  2ELH A;  3S2W A;  2LKP A;  2LF7 A;  4GXO A;  2CYY A;  4Y15 A;  3I4P A;  3P9C A;  3NQO A;  1W7P B;  2MD5 A;  1SD6 A;  1PP7 U;  2ACJ A;  4A6D A;  4WXH A;  3KP5 A;  1QBJ A;  2XRO A;  2DW4 A;  4LJZ F;  1XN7 A;  3D5L A;  3M7G A;  2C6Y A;  4LG0 B;  4FHT A;  5K5O A;  4ENJ A;  3R4K A;  1BC7 C;  3OOP A;  3WE2 A;  4YFK F;  3M1E A;  1R5H A;  2XGX A;  2M8E A;  1O3T A;  4IPA A;  4CO8 A;  1XGM A;  2NNY A;  1UHM A;  2GAU A;  5E8I A;  5A2Q Z;  5D4R A;  4U7D A;  3K0L A;  1F1Z A;  1SMT A;  1ZRC A;  1R1V A;  4YII A;  3CUO A;  5E17 F;  2FBI A;  3KZY A;  1LNW A;  2VXZ A;  5LEJ A;  4DQ2 A;  3ZPL A;  3SHF A;  1BI0 A;  1XB4 A;  4XLN F;  1HKT A;  1Z6R A;  4EGY A;  3HSR A;  4E70 A;  5ICF A;  2DU9 A;  2HKX A;  1QZZ A;  2H6B A;  4HBL A;  2XKO A;  2ISZ A;  3IHU A;  3LA3 A;  1T38 A;  2DQL A;  1DPR A;  2FXA A;  3BJA A;  3KEO A;  5E1X A;  2JT1 A;  3SXY A;  4HQM A;  1JE8 A;  3WTS C;  3NEU A;  3GEZ A;  3WGH A;  1HBX G;  3FXR A;  2W25 A;  1FNN A;  1ZGA A;  5E1W A;  4WWC A;  1ODD A;  3LAJ A;  5AIQ A;  3ZP5 A;  3KLN A;  3P7N A;  2BE5 F;  5HLH A;  3ISP A;  3B73 A;  3WGG A;  3GZ6 A;  4CGZ A;  1DDN A;  4KYW A;  2HQN A;  1DPU A;  4ESJ A;  3KP7 A;  1Z6T A;  3RKW A;  3RDI A;  2IP2 A;  1GHC A;  1ZGJ A;  2VC0 A;  4EVI A;  3F23 A;  4EJW A;  3V7R A;  1TW3 A;  5FD6 A;  1FYM A;  1J59 A;  3I59 A;  1ZRD A;  4L9J A;  1K6O A;  3J81 K;  4Q5S F;  1T6S A;  4HZF A;  4LK0 F;  3TO6 A;  3F72 A;  3DKW A;  3VEP A;  2RVC A;  2H6C A;  3RYP A;  1YQA A;  4MHG A;  2EA4 A;  3FMR A;  1AWC A;  1EH8 A;  2NYX A;  3HUG A;  5HOO A;  1ZG1 A;  2FOK A;  1FSH A;  3JTG A;  4KN7 X;  4S04 A;  2YX4 A;  3E97 A;  3LFK A;  3DQV C;  2LDU A;  5CYV A;  5HS7 A;  3DPL C;  4EM2 A;  3T8T A;  2BBY A;  2F5C A;  4ENN A;  3QU3 A;  4AIH A;  1JGS A;  3RIR A;  3TOB A;  4L0Z B;  5LBQ A;  3J7A O;  5J6X A;  2A07 F;  3ZMD A;  3O3K A;  2QEN A;  2VN2 A;  4IXA A;  5D8L B;  1W5S A;  1TLH B;  4L9T A;  4R8H A;  1FYL A;  4MEX F;  2GXB A;  5E1Z B;  2Q0O A;  4A6E A;  2NS0 A;  5ED4 A;  2Z3Y A;  1U78 A;  1W5T A;  5HVQ C;  1RZ4 A;  3I64 A;  3GW2 A;  2DFI A;  5LHH A;  3F6V A;  4LK1 F;  3L9F A;  5K5Q A;  4QWQ A;  2BEO A;  3ZN0 A;  1LEB A;  4M6X A;  1XMK A;  4RB3 C;  1KYW A;  2IW5 A;  5DCF A;  3QAH A;  1P2F A;  4BH9 A;  4L9N A;  1HSJ A;  5CJ9 A;  4FT8 A;  3F22 A;  4L9V A;  3WU0 A;  3REO A;  4NQW A;  4BHB A;  2A6E F;  2DK8 A;  4O3M A;  3DP7 A;  1TNT A;  3FM5 A;  1VTN C;  2UWM A;  1REP C;  4RS8 A;  4AIK A;  2LNB A;  2CQK A;  1EV7 A;  4MEY F;  2HFH A;  1FX7 A;  1KU2 A;  1SD4 A;  4PGG A;  4I0A A;  1IAW A;  2O8X A;  4IHT A;  3W6K B;  3VOE A;  3GUD A;  4EQQ A;  1BIA A;  1HKS A;  1HW1 A;  1MKM A;  1Z1D A;  3VFZ A;  1FLI A;  3TDZ C;  1FP2 A;  1GXQ A;  3P9I A;  3FXU A;  2FU4 A;  2A69 F;  5BQT A;  1HXD A;  3GVA A;  1S29 A;  4IRH A;  4ZYH A;  3BRO A;  3I59 B;  4KDP A;  4UUV A;  3KP6 A;  1SMY F;  2QQA A;  4EM1 A;  3DFG A;  1J7K A;  2P6S A;  4EGZ A;  1FSE A;  4A5M A;  2CSO A;  1HW5 A;  2WTE A;  5E8G A;  4KFC A;  1YG2 A;  4YG2 F;  2L54 A;  5DCM A;  1JXS A;  2FQ3 A;  3ECH A;  2W85 A;  1PDN C;  1I27 A;  1O3Q A;  5CVR A;  4U88 A;  5F6F A;  3D0S A;  4M9Z A;  3F6O A;  4F7Z A;  1K78 B;  4LB6 B;  1BM9 A;  5D4S A;  3RI4 A;  4ZYG A;  3CUQ A;  1BBY A;  4HX4 A;  2ZBK A;  2NNN A;  1XSX A;  4B09 A;  5CVJ A;  2XAQ A;  1G3S A;  2QM3 A;  2VOD A;  3FMQ A;  3AAF A;  2A61 A;  2PMU A;  5IT3 A;  3R6S A;  1ULY A;  5JHU A;  3L09 A;  5BMZ A;  3WTT C;  1TQI A;  2EFW A;  2YX7 A;  2QVO A;  1AOY A;  3U9G A;  2PI0 A;  3DV8 A;  1WI9 A;  4XLP F;  4EJV A;  5A2Q K;  1CF7 A;  2OQG A;  2HDC A;  2JSC A;  4P96 A;  4EM0 B;  1KU9 A;  1MDM A;  1BJA A;  3BY6 A;  4N9H A;  1B9M A;  1J2X A;  1WRJ A;  2OBP A;  2ISY A;  3R0A A;  3GXO A;  4M71 A;  4UNO A;  1ON1 A;  1YTY A;  2MH9 A;  2TDX A;  3WTY C;  3HHH A;  1TBX A;  4UV9 A;  2P5V A;  4CIC A;  2R3S A;  2HYG D;  3TKY A;  1X3U A;  4AVP A;  4I01 A;  1XGO A;  3DXJ F;  1XCB A;  3EUH A;  1T2K A;  4WK8 F;  3WGI A;  1Q1H A;  1I1S A;  2FBK A;  2UXX A;  1YW9 A;  4HDU A;  2OD5 A;  4HOB A;  4BAY A;  2RN7 A;  2ADU A;  1BI2 A;  4HF2 A;  3Q9S A;  3NRV A;  1WQ2 A;  4Y17 A;  3F8M A;  2HWV A;  2RGV A;  5FFZ A;  2MH2 A;  1EH6 A;  4NHJ A;  3JAM Z;  1EH7 A;  1G4D A;  2XVC A;  1S7A A;  4JBA A;  1Y0U A;  3ML6 A;  1IZ1 A;  4IRG A;  5LGN A;  1MD0 A;  3M8E A;  2JRT A;  3M8F A;  1ZYR F;  2ZNY A;  5DD4 A;  4RB2 C;  1GXP A;  3IWF A;  2RKH A;  2L4M A;  4ON0 A;  4CDG A;  3DEU A;  2NRA C;  2X0L A;  2GA2 A;  2PN6 A;  5KK1 A;  1LEA A;  2QQB A;  3C3W A;  5DCM B;  1FWZ A;  2PQ8 A;  1LB2 A;  2RQP A;  3KFW X;  1MJA A;  2OAZ A;  4HF1 A;  1ON2 A;  3FXQ A;  4I98 B;  4UV8 A;  4WXD A;  3WOD F;  4XRF A;  3U1D A;  3C1D A;  1YIO A;  2J5P A;  4MQ9 F;  4IRI A;  2V9V A;  4LGW A;  6PAX A;  1IN5 A;  3CUQ B;  3H3Z A;  5H6Q A;  3L2C A;  3L00 A;  4MQV A;  3LQQ A;  1XD7 A;  4Z2Y A;  3I5U A;  4HV6 A;  1V4R A;  4A5N A;  3BJ6 A;  2ZCW A;  2EFP A;  1H9T A;  1KQ9 A;  1MJ9 A;  4BHC A;  1STZ A;  2WC2 A;  3MEX A;  1RIO H;  1T98 A;  1UST A;  5L3E A;  2HS5 A;  5LGT A;  2PFB A;  1H9G A;  1CF7 B;  1A04 A;  1U5T C;  3L7W A;  4ESB A;  3QP6 A;  3KLO A;  1YO5 C;  1T39 A;  1MDM B;  3KP4 A;  2BGC A;  4HDV A;  2MLG A;  4KT5 C;  5HDN A;  5CVI A;  1P4W A;  3WU1 B;  2HYF A;  4GYI A;  4RGR A;  1IXR C;  1P4X A;  3ZQ7 A;  1FT9 A;  2P7V B;  3I0T A;  5ERI A;  4IVN A;  2HTS A;  1USS A;  4YIF A;  3CO7 C;  5TRD A;  4R79 A;  3I53 A;  2EJR A;  4UVC A;  4BHP A;  2OZU A;  4AWX B;  2L01 A;  3N4M A;  4M9X A;  2MLK A;  2F2E A;  5E18 F;  4ZYE A;  1BC8 C;  2Q2E A;  4KMF A;  2K86 A;  4M6Y A;  2FSW A;  3VOD A;  3HHG A;  3K1M A;  3F8N A;  5D8K B;  2VE8 A;  4M9S A;  4ENK A;  1YS7 A;  2K4J A;  2DPU A;  4M73 A;  1IXC A;  4CZZ A;  1TTY A;  1L3L A;  1Z9C A;  3MAJ A;  2AS5 F;  3GFJ A;  4LMY A;  1I1G A;  5HLI A;  2PMH A;  3JSP A;  4OIN F;  5FGM A;  1SFX A;  4FX4 A;  2O0Y A;  3IL2 A;  2P7C B;  2EFN A;  5LLQ A;  1O3S A;  2F5E A;  1PP8 F;  3MZY A;  5LRR A;  1YS6 A;  5DEQ A;  1J9I A;  2OA4 A;  2O61 A;  3T8R A;  1LQ1 A;  2XHK A;  4A2U A;  2EV6 A;  1U3E M;  1K78 A;  2G7H A;  2M45 A;  2EK5 A;  2VBX A;  3MZH A;  2EV0 A;  3LST A;  1IN6 A;  3RTR A;  1XMA A;  1I6X A;  2PG4 A;  1TNS A;  4UVA A;  1BOA A;  3KZZ A;  1UB9 A;  3K2Z A;  3TO9 A;  2P5L C;  2MC3 A;  2RDP A;  3E3V A;  5DUI A;  3RKY A;  3V7C A;  4KIB A;  3ECO A;  2CW0 F;  2CWE A;  4HF0 A;  2VOO A;  2M30 A;  2RC4 A;  4G9Y A;  3QOP A;  2YR2 A;  3IKV A;  2Y0M A;  1MGT A;  4A0Z A;  3Q5F A;  1L0O C;  2BYV E;  4OIQ F;  4KIG A;  2QUF A;  2FRH A;  3E6M A;  1QZY A;  4A12 A;  1Z91 A;  3E5U A;  1DUX C;  1FP1 D;  5EEG A;  1R23 A;  4MGR A;  3WG9 A;  2FBH A;  5D5V B;  4G94 A;  4ESF A;  1RUO A;  4RAZ A;  4D0P A;  2M87 A;  3H3U A;  1OYI A;  1MZB A;  1XSD A;  3ZMU A;  2Z9O A;  3J80 Z;  5ILV A;  2L02 A;  1G3T A;  1ZG5 A;  5DV5 A;  3EQL F;  1J75 A;  5F1R A;  5D6E A;  2DAO A;  2MBF A;  4PZJ A;  2ZFW A;  3T0Y A;  1IUY A;  4CXF A;  3FF5 A;  3GYH X;  1QO0 D;  1RNL A;  3K69 A;  2Q8K A;  4MTD A;  3P9K A;  2JZY A;  2ETH A;  1FOK A;  2DK5 A;  4G7Z F;  3GO5 A;  5KVR A;  4AD9 A;  4ZYD A;  1S6L A;  3WTW C;  4OIO F;  3F8B A;  2EB7 A;  4OIP F;  1RUN A;  3ABU A;  2JPC A;  3SQN A;  3WE3 A;  5DD8 A;  2KIU A;  1IW7 F;  4HX7 A;  1LDK B;  4EJU A;  4GCV A;  3E5Q A;  3MFK A;  2XUB A;  1LJ9 A;  1D5V A;  4YFN F;  1B59 A;  2DT5 A;  3FHZ A;  4HAM A;  3TOA A;  3HRM A;  4RB0 A;  2O6G E;  2ZKZ A;  1JHF A;  4EV0 A;  3JAM K;  3DF8 A;  2IPQ X;  2KIF A;  4HA8 A;  2XKP A;  5BPI A;  2IT0 A;  2Y75 A;  1P6R A;  4ZH4 F;  5JI6 A;  2DLL A;  4UXN A;  2NAZ A;  1B4A A;  4KN4 X;  3LQR A;  3K1P A;  3CLO A;  5IT9 Z;  2KIM A;  4NB5 A;  4HLY A;  3QRF F;  4YFX F;  4ENM A;  2P6T A;  3RPQ A;  1P4A A;  3V8J A;  2EWN A;  2YU3 A;  4I02 A;  2FNA A;  3F21 A;  4IF4 A;  4LLL A;  3HRS A;  2DPD A;  3R61 A;  2XAG A;  4GGG A;  5HLG A;  3MWM A;  2OQR A;  1FYK A;  5LGU A;  3BPX A;  4ZZD A;  1D8J A;  2WWY A;  4EMS A;  3IRQ A;  2KJC A;  2WV0 A;  1YYV A;  3ULQ B;  4HLX A;  4IJA A;  1QNT A;  3QPT A;  4OOI A;  2A6H F;  3MCZ A;  1MJB A;  3ABT A;  4P9F A;  3ZMV A;  1FBS A;  5BOX A;  2DBB A;  4P5O A;  5BPD A;  4FX0 A;  4G6D A;  3ERE D;  1FY7 A;  2A3S A;  2IVM A;  2LF8 A;  5DYM A;  3PQJ A;  1O3R A;  5H20 A;  3RPU A;  3BOQ A;  4EJT A;  4TV7 A;  4UHT A;  2D45 A;  3TO7 A;  1GVJ A;  5HDG A;  5JR3 A;  2HQR A;  4BXU A;  1PUE E;  2J5O A;  1IF1 A;  5JFR A;  4G7H F;  4H0E A;  2K4B A;  2B0L A;  3WTV C;  3ZMT A;  2CO5 A;  2HTJ A;  5DDG A;  2VBZ A;  3QP5 A;  1G3W A;  2L4A A;  1ZRF A;  1XSV A;  5HS9 A;  1ZLJ A;  2OU2 A;  5LEK A;  3C7J A;  2YSR A;  5CVU A;  3V8L A;  2GWR A;  4I09 A;  3F8C A;  2V1X A;  4JQF A;  4S05 A;  3R0J A;  2K02 A;  2FEZ A;  1J0R A;  4I7H A;  2W84 A;  2VT3 A;  2ZME A;  3G73 A;  1QGP A;  2FF4 A;  4KA4 A;  2QLZ A;  4BYY A;  5ILU A;  3IC7 A;  1CGP A;  3HRU A;  1SD7 A;  5AON A;  4MTE A;  3HIF A;  2DQR A;  5FLX Z;  5H6R A;  2M1B A;  4RGX A;  1U8R A;  5CLS A;  1C0W A;  3EYI A;  2PEX A;  3FX3 A;  4P9U A;  4BNC A;  3B02 A;  1T0F A;  1HQC A;  1IRF A;  5ICE A;  2F5F A;  2HGC A;  2UZK A;  1R22 A;  3DPT A;  2HEO A;  4PCQ A;  4OMY A;  5D5W B;  4GO1 A;  2XAJ A;  5D6F A;  2FE3 A;  4WX9 A;  3SZT A;  1R36 A;  1R7J A;  3W6J B;  4Q47 A;  1WWX A;  4N0B A;  1BIB A;  4B8X A;  1U5T A;  2Z5U A;  4Q48 A;  3BZ6 A;  3LWF A;  5E20 A;  4RAY A;  3T1B A;  1I5Z A;  3BJO A;  4L5I A;  2Z99 A;  3ZMZ A;  3R60 A;  1KQ8 A;  2H27 A;  4I2O A;  1S8N A;  2IA0 A;  4OMZ A;  4EJO A;  2D1V A;  2E1C A;  3V4G A;  3RJP A;  4HW0 A;  5L3C A;  3HRT A;  1SAX A;  3LA7 A;  1UCR A;  5FFX A;  3EYY A;  5L3G A;  3KCC A;  1QPM A;  5JVT A;  3VB2 A;  2CGP A;  3KE2 A;  4HX8 A;  1R1T A;  5K5R A;  1O7F A;  1TW2 A;  5D5U B;  1JHH A;  4OIR F;  1DP7 P;  4G6Q A;  1KGS A;  4M74 A;  5D5X B;  1B1B A;  3N97 A;  4ASN A;  3U2R A;  1NHA A;  2ZJ2 A;  5CVV A;  1SD5 A;  2XAS A;  1YLF A;  1KU3 A;  3OV8 A;  3KEQ A;  4P55 A;  4A0Y A;  3J80 K;  1F5T A;  3O2P E;  2ESH A;  1OPC A;  2H09 A;  2FML A;  1BI3 A;  2VE9 A;  1HST A;  2P5K A;  3IWZ A;  3E6C C;  2HR3 A;  3FMS A;  1FBU A;  1R5G A;  1YW8 A;  1LDD A;  2IRF G;  2YPR A;  3MQ0 A;  5F64 A;  1OKR A;  2V1U A;  2HKO A;  2O3F A;  1IXS B;  2ZME B;  4KUM A;  2VC1 A;  2K7L A;  1G6N A;  4LB5 A;  3HSF A;  3WTU C;  4G8X A;  2QYO A;  3O6B B;  2E7W A;  2W24 A;  2V6C A;  3ZMS A;  3F8F A;  2STW A;  2IA2 A;  4PGH A;  1J5Y A;  1ZAR A;  1ONV A;  2CFX A;  3I54 A;  1OMI A;  4DNC A;  3ELK A;  3PQK A;  4A0X A;  5ILS A;  2HZT A;  2PLY A;  2G9W A;  1Z05 A;  3GWZ A;  3GFM A;  5AIP A;  3FM3 A;  1KQ0 A;  2XAF A;  1U5T B;  1G3Y A;  4CHU A;  4XSZ F;  1B9N A;  5IT9 K;  2GA1 A;  1QQI A;  5DUK A;  3BPV A;  4WF2 A;  2GQQ A;  3CDH A;  4N9I A;  4WCG A;  2XIG A;  4IHS A;  3CTA A;  1SFE A;  2VBW A;  1O7L A;  4QLC U;  5FD5 A;  4L5J A;  1ZH5 A;  1W4M A;  1Z7U A;  3GZ5 A;  1UFM A;  2IA1 A;  2LSO A;  5TJJ A;  1H0M A;  4JK1 X;  3HSE A;  4RGS A;  3GLX A;  1UHW A;  5LHG A;  3BDD A;  3CO6 C;  2KKO A;  3RKX A;  4WXC A;  1BN5 A;  2RNJ A;  1U6G A;  1D8K A;  2VOP A;  4GYG A;  2GZW A;  3IRR A;  2R7F A;  5FB2 A;  3V7S A;  5K1Y A;  2D1H A;  1R00 A;  5L3F A;  3JW4 A;  3HOS A;  3QU6 A;  4M72 A;  3M9A A;  3I71 A;  1FZP B;  3EDP A;  2V79 A;  4HYE A;  1ZLK A;  3GF2 A;  3HYI A;  2MA3 A;  3QPH A;  2QQ9 A;  2GIV A;  5HS8 A;  3ZN1 A;  3Q9V A;  2EFO A;  2DI3 A;  2Y48 A;  4UVB A;  2KRF A;  2QWW A;  4HQE A;  5EEH A;  5HDK A;  2L3D A;  3LA2 A;  4KIF A;  4LLN A;  2ZXJ A;  3WTZ A;  2A68 F;  3F3X A;  3E6B A;  2PBI A;  3I58 A;  3V8K A;  2EFQ A;  2DTR A;  4U7B A;  1R1U A;  3TGN A;  3HTU A;  2FA5 A;  1IN7 A;  3E6D A;  1OYW A;  1E17 A;  4LLG F;  2W57 A;  3GFI A;  1ZG3 A;  2X4H A;  2E1N A;  3SFZ A;  1E2X A;  2XRN A;  4O6J A;  4I0B A;  1WKM A;  1BI1 A;  1LDJ A;  2V1D A;  1TQP A;  2QBY A;  3SZP A;  1S3J A;  2Z33 A;  2VON A;  1HW2 A;  3J81 Z;  1XGS A;  3K9T A;  3BP8 A;  5L3D A;  2QZ8 A;  1IRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...