4WCGA

The binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
PISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVRKHPQHPVWYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords ORF112
publication title The Structure of the Cyprinid herpesvirus 3 ORF112-Z alpha Z-DNA Complex Reveals a Mechanism of Nucleic Acids Recognition Conserved with E3L, a Poxvirus Inhibitor of Interferon Response.
pubmed doi rcsb
source organism Cyprinid herpesvirus 3
total genus 21
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wcgA00
1YW7A 3MQ0A 4IRGA 3ZN1A 1V3FA 3MFKA 2FSWA 4OIQF 2D1VA 1HW2A 2IRFG 1KU2A 2HEOA 2PJPA 1HSTA 2ACJA 3I53A 4RB3C 1YLFA 4LK0F 2P8TA 2HKXA 2IA0A 1W7PD 1W5TA 3EUHA 2KJBA 2Y48A 4YIFA 3G73A 1MJBA 3J80K 4BHCA 2XAJA 2F5EA 1BM9A 2ESHA 2JRTA 2RDPA 4B09A 1FYKA 4PZJA 4JK1X 3ABUA 4MTEA 1CGPA 1FC3A 3LSTA 1OR7A 2HGCA 3R61A 2DW4A 3HRUA 2VOOA 2E7WA 1MJ9A 2DT5A 3F8NA 1WKMA 4ESJA 2P7VB 4HV6A 1ZREA 1JGSA 4HX7A 1J0RA 4UV8A 1TQPA 3GEZA 3KP7A 4HX8A 4PDKA 2FBKA 4CYDA 2HQRA 2EB7A 4OIRF 1S6LA 4KFCA 1BI0A 4I98B 1BC8C 1IW7F 4PCQA 4EGYA 3DP7A 4LJZF 1K78B 4O3MA 1BIBA 5D5UB 1KYWA 1BC7C 2HKOA 1MKMA 5H6RA 2VXZA 2NNNA 4H0EA 1HKSA 5LBQA 2VONA 5DV5A 3LAJA 4HA8A 3CUQA 1F9NA 1U5TA 1UB9A 3RDIA 4EJUA 1F1ZA 3F8FA 4BYYA 1R00A 4HLXA 2WWYA 4RGSA 3MEXA 2NRAC 1LEBA 1B1BA 4EVIA 1KYZA 2ZBKA 4FT8A 4HOBA 1SD7A 2HR3A 4LK1F 3QRFF 2O3FA 3GFLA 2MA3A 3H3ZA 3BZ6A 5D5XB 3I64A 4S05A 2PLYA 3ZMZA 2Q8KA 3N97A 3ECHA 1Y0UA 5HLHA 1STZA 4OIPF 4Y17A 1EH6A 3RI4A 1MDMA 2O03A 3ZMUA 1U2WA 3PFIA 3FXQA 2MH2A 3EYIA 1WRJA 4EGZA 2ZKZA 2J5OA 2L3DA 2FE3A 1TQMA 5FB2A 4WWCA 4XLNF 3FWEA 2DU9A 3WE2A 2DLLA 3C1DA 4IPAA 3Q9VA 2CO5A 4LFUA 2V1DA 4N0BA 3GF2A 5ILUA 1JHHA 2W57A 1SD6A 3D5LA 2D1HA 2HOEA 3QU6A 3M9AA 3KCCA 3S2WA 1HW5A 4HBLA 1I5ZA 3L2CA 3GFIA 1TTYA 3JTHA 1RNLA 1JE8A 2EA2A 3TO9A 3F3XA 2OD5A 2F5CA 3K1MA 1QZZA 3K1NA 1D5VA 2JT1A 4KDPA 3CUQB 3LQQA 1G3TA 2EV0A 3HRSA 4YFNF 4P96A 2GQQA 3T1BA 1T0FA 4A0ZA 2A6EF 2M5WA 4Q4ZF 1KQ8A 3RTRA 3F6OA 1YW9A 2DTRA 5FLXZ 2Z99A 1ZH5A 4ON0A 3QU3A 5TJJA 3OV8A 2RQPA 3AAFA 2FMYA 1YIOA 4WCGA 4I09A 3I59B 2G7UA 1MDMB 3ZMSA 3FHZA 5J6XA 1E17A 3CDHA 1WI9A 2GIVA 5K5QA 2QVOA 1T6SA 2DQLA 2QUFA 1FSEA 1P92A 2L01A 1ZGAA 2HTJA 1Z9CA 2NAZA 5HLIA 1C0WA 1U6GA 1LQ1A 1DPRA 1SFUA 4HQEA 3BPVA 2KKOA 1QNTA 5DDGA 3CUOA 4GYGA 3GLXA 1K79A 1IUYA 2A61A 4CDGA 2HWVA 3I54A 4XLPF 4U0WA 3BOQA 4HDVA 1GHCA 4OMZA 4AIHA 4YG2F 4UV9A 3VFZA 2XAFA 5L3CA 4WF2A 1IAWA 3RKWA 1EH7A 3WGGA 4WX9A 1SAXA 3DFGA 2BBYA 1ZN2A 4LG0B 5ICEA 1J5YA 4LLGF 3BJ6A 4Y15A 1LDDA 4U0VA 4QWQA 3CLOA 3SFZA 1GXQA 4HF0A 3COAC 1MGTA 3E5XA 2WV0A 1XDUA 2BEOA 3W6KB 3WGHA 4NQWA 4MEXF 1AWCA 2K86A 1TLHB 4M73A 1EH8A 4A6EA 2G9WA 2DPUA 4JBAA 3CUQC 5LGTA 1U5TC 2OU2A 3HOSA 4XSZF 5DEQA 2QQBA 5BOXA 2NS0A 3WU0A 1IF1A 2VBYA 3QAHA 3F6VA 1YYVA 4AIJA 1LB2A 2DQRA 2DK8A 1O7FA 1O3SA 2Z9OA 1SFEA 2FBHA 1LDKB 1UFMA 2F5DA 2JZYA 4BAYA 4G7OF 4S04A 2EFPA 4CHUA 4R79A 4NHJA 4L0YB 5LGUA 2D45A 1T98A 3ROUA 3U1DA 1LVAA 3W6JB 1H9GA 2FNAA 5AIPA 3ULQB 4L5IA 2RGVA 3C7JA 2VOPA 2BGCA 1RUNA 4EJOA 2YX7A 2M30A 2VBWA 2OA4A 1B4AA 5LHIA 3E6MA 1DUXC 1PUEE 1RUOA 5DCMA 5A2QZ 1IN5A 4RB1A 1FYLA 3J7AO 2V6CA 5CVRA 3O6BB 3JSOA 2FU4A 1S8NA 2ETHA 3CO6C 4A0YA 2DI3A 3WTVC 2H94A 2HS5A 4CXFA 1F5TA 2FOKA 2WTEA 1RIOH 1QO0D 4WXHA 1S7AA 2CW0F 1PP7U 4P9FA 2PMHA 3KZYA 3IKVA 2ZCWA 3DKWA 1ZRCA 2PI0A 3QOPA 4XRFA 2A69F 1HKTA 3E5UA 3JTGA 2FRHA 1J7KA 1XMAA 2Z3YA 1ZGJA 2B0LA 2OZUA 3VB2A 1FBQA 1ZARA 4EM0B 3TO7A 1RZ4A 2HZTA 4U88A 2IP2A 5BPIA 2XAHA 1P4WA 5HDKA 1O57A 1ZG1A 5L3EA 3V8JA 5E1WA 4LGWA 4GXOA 4RS8A 1XB4A 1KQ0A 2O6GE 5E8IA 2HYGD 2QENA 2XASA 2P7CB 4KN4X 3R0AA 1DPUA 5D6FA 2GXGA 2QWWA 5LLQA 5FO5A 3QP6A 5LEJA 4G8XA 1SD4A 3K0LA 4P5OA 1G6NA 3BROA 1FPQA 2UXNA 4Q47A 2PBIA 4G7HF 2O61A 3H92A 1ON1A 2H6CA 1X3UA 5HOOA 4KA4A 1S3JA 2P5KA 4LMYA 1Z7UA 4ESBA 3GYHX 3KP5A 2MH9A 2LKPA 1XMKA 1KQ9A 2BE5F 4KIFA 4M6YA 4MGRA 4IRHA 5IT3A 3GZ6A 3ML6A 3GX4X 4D0PA 4L9NA 3K1PA 1OYYA 5ICCA 4B8XA 4LD5A 4EM1A 1KU9A 3M8EA 4L18B 1S7OA 1ONVA 2RV8A 2ZNZA 2AS5F 2LDUA 3HHHA 3E97A 4LB5A 2ZO4A 4G6QA 4IJAA 4U0YA 1G4DA 3FXRA 1FP1D 1SD5A 2GZWA 5HDNA 4L5JA 4GCVA 4UNOA 1BI1A 3V7RA 1K6OA 4IXAA 2QQ9A 1O3QA 2EWNA 5E17F 3GXOA 4YFKF 4M72A 2K4JA 3OOPA 2E1NA 4ASNA 1B6AA 4Q5SF 4WXDA 1I27A 1USTA 2LNBA 2GA1A 2L02A 2M8EA 1XSXA 5LRSA 3T8RA 2IT0A 2BV6A 1XGMA 5D4RA 4L9JA 3KLOA 1CF7A 4RB2C 2HQNA 2ZMEA 5J8CA 2EJRA 2ELHA 2GAUA 4HQMA 5CLSA 4IHSA 3MZHA 4G94A 5KVRA 4WK8F 3GWZA 3KE2A 4U7DA 1Z91A 2HFHA 2AXLA 4HZFA 4ZYHA 2ZFWA 4KICA 1W4MA 2VC0A 1D8KA 3F21A 2L4MA 1EV7A 4G6DA 3NEUA 3J81Z 2IA1A 3GUDA 3RJPA 3RKXA 2IVMA 5JR3A 2ADUA 3WG9A 2G7HA 3HRTA 4K2EA 4CICA 3GVAA 4RAYA 1R7JA 3IRRA 3BJAA 5TRDA 4A0XA 1YFHA 3T5XA 1UCRA 1IXRC 1MZBA 3MZYA 2LF7A 5ERIA 1R36A 3HHGA 5HS7A 2D2WA 4EJWA 2RNJA 1L3LA 5EEHA 4KMFA 2CGPA 5HDGA 3I71A 3JAMZ 3LAPA 2ISZA 1T39A 3FM3A 4ZYGA 5E1XA 4LLNA 2OBPA 1U5TB 4I01A 1JXSA 2A6HF 1XCVA 2XKPA 4GGGA 1XN7A 2H6BA 2M87A 5E1ZB 5IT9K 1FY7A 2OZ6A 3PQJA 1FSHA 4UVAA 5CVUA 4CGZA 2UWMA 3HTUA 2RVCA 2YU3A 3SXYA 1OMIA 2P4WA 1D3YA 3HSFA 4R8HA 3PQKA 4RGUA 1R1UA 3HSEA 2V1XA 2STWA 2KRFA 4TV7A 4I0BA 1KU3A 4QLCU 1FT9A 2CYYA 5DD4A 3TGNA 3J80Z 1OYIA 1XGOA 4AD9A 4L9VA 2COMA 1ZG5A 1XCBA 1A04A 5LGNA 1R5GA 1ZYRF 1ULYA 2NYXA 1R1TA 4M71A 1TBXA 2P6SA 3DV8A 3ZN0A 3U2RA 1ZLKA 2VN2A 3V8KA 4HLYA 1XD7A 1IXSB 4Q48A 4BHPA 2Y75A 2C6YA 2XV4S 2HDCA 4I0AA 1FOKA 1YTYA 2MD5A 4KIGA 5AONA 4MQVA 1IN7A 5CYVA 3WU1B 3FM5A 5LRRA 4ENKA 2MLKA 2QLZA 5AIQA 3L7WA 1HQCA 5KK1A 1BOAA 3GFJA 4ZYEA 4DNCA 3H3UA 2PG4A 3LWFA 1YW8A 5CVVA 3I4PA 2DAOA 2FMLA 1G3WA 3QPTA 1W7PA 4OMYA 1SMYF 2EFNA 3N4MA 1F4KA 4CZZA 1QBJA 4GO1A 2W25A 4R1HA 3WGIA 5E18F 4KUMA 1OYWA 3Q5FA 3RIRA 3FXUA 1B59A 5HVQC 3F22A 1FYMA 4L9TA 2M45A 5JI6A 4M9ZA 4MEYF 1FNNA 4HV5A 5D5WB 1PP8F 5BMZA 1IN8A 4I7HA 2K02A 3KP6A 2V1UA 4BXUA 4F7ZA 2FEZA 1HSJA 5J8FA 4HX4A 4RB0A 3V8LA 1OKRA 3RPQA 1USSA 5HS9A 2PQ8A 3M8FA 2M1BA 5L3BA 2JPCA 3B73A 2XUBA 2CG4A 2PMUA 2KJCA 3P7NA 2J5PA 4LB6B 1WSUA 5H20A 5BS6A 2F5FA 3ISPA 1P6RA 3LFKA 5ILSA 5DUKA 1XSDA 2FXAA 2DPDA 3DPLC 4M6XA 4YIIA 1DP7P 2UXXA 2IPQX 3REOA 1B9MA 4G9YA 2OQRA 5DUIA 1IRGA 4MQ9F 1UHWA 5ILVA 2H27A 2WC2A 1BIAA 1G3YA 1Z6TA 2XHKA 1P4XA 2A07F 2VT3A 2DBBA 1Q1HA 2GWRA 4M74A 1S29A 4O5VA 4I2OA 2DK5A 1TW3A 3EYYA 1K78A 4A5NA 2VBXA 2VT2A 2JSCA 3KFWX 3M1EA 2STTA 5K5OA 3FMSA 5FLXK 3HRMA 1P2FA 4KN7X 3CTAA 2A3SA 5ED4A 2LSOA 2W24A 3V4GA 3KP4A 3WTWC 1BJAA 2RN7A 2CSOA 3DEUA 2O8XA 4MHGA 1B9NA 2QZ8A 3R60A 1IRFA 1BI3A 3KETA 1KGSA 3MWMA 2XAGA 3F8MA 1QPMA 1YS7A 4HAMA 2OQGA 2GXBA 4U7BA 1HW1A 4IRIA 3C18A 3ZQ7A 4RGRA 5E20A 3BY6A 6PAXA 5DCMB 1REPC 4PGGA 2KIMA 5FD6A 3BWGA 3SQNA 1BN5A 3WTZA 3K69A 3I58A 4EQQA 1XSVA 3WE3A 5E8GA 1SFXA 1QZYA 1FWZA 2CQKA 1XGNA 1MJAA 2IJLA 3GO5A 4P55A 3EETA 2XROA 1I6XA 1VTNC 1J75A 3I0TA 1YO5C 4AIKA 2LF8A 2RKHA 4A6DA 3DPTA 3KZZA 3TDZC 2E1CA 2L54A 4XBFA 4UUVA 4ZZDA 2ZXJA 3TKYA 4M9SA 3EQLF 3VOEA 2R7DA 1G3SA 5FFZA 5F1RA 3K9TA 2ZNYA 1QGPA 2MC3A 2O0YA 2YR2A 3FX3A 3TDUC 5K5RA 4ENMA 1R1VA 1JHFA 4AWXB 2VODA 1U8RA 1LDJA 2ISYA 3QPHA 5EEGA 1U3EM 1ZLJA 3E5QA 2UZKA 3ECOA 3IKTA 2EV5A 4E70A 5BQTA 3BP8A 3K2ZA 4GYIA 2VE9A 5LHGA 4FX0A 4CO8A 1D8JA 3LA3A 5CVIA 1ODDA 5L3DA 1FP2A 3L9FA 1NHAA 3ZMDA 1GVJA 2W85A 5ICFA 2P5VA 4Y13A 1DDNA 3Q9SA 4I02A 1FBUA 3ERED 1HBXG 2YSRA 3TO6A 1FX7A 4BHBA 1O7LA 5HS8A 3I59A 2QM3A 5LHHA 3V7CA 2RC4A 5FD5A 5K1YA 4AVPA 3C3WA 1Z6RA 4HW0A 1PDNC 2K27A 1HKQA 5CVJA 2MBFA 4IF4A 2XKOA 4G7ZF 2ESNA 2JPBA 2R3SA 4XSXF 1KA8A 3HTSB 4ZZLA 2K7LA 4FHTA 1UHMA 3RPUA 3KEOA 5JFRA 5ICGA 4DQ2A 1U78A 1TW2A 5JHUA 2A5YB 1I1SA 1L0OC 4EM2A 3RYPA 4OINF 5A2QK 3GFMA 2YX4A 1J2XA 4RAZA 3IC7A 2FNPA 4OOIA 1O3TA 3EDPA 1R5HA 2VBZA 3IWZA 3ZMVA 1ZHFA 1O3RA 4FX4A 3RYRA 3G3ZA 2NNYA 2ZJ2A 1CF7B 1ON2A 1J59A 2ZMEB 4BQAA 4EMSA 4LG0A 3IL2A 4BNCA 2XGXA 2YPRA 5D8KB 5BPDA 5DD8A 1ZRDA 3KP3A 2Y0MA 3T0YA 2KIUA 2L4AA 5D6EA 4LLLA 2PEXA 4EJTA 3DF8A 4O6JA 3SZTA 2Z33A 4UXNA 1E2XA 2JTVA 3MAJA 4Z2YA 4HDUA 4N9HA 3B02A 4EV0A 4P9UA 1H0MA 4M9XA 3IRQA 4MNUA 2TDXA 4PGHA 1GXPA 1QQIA 1R58A 2PN6A 1R22A 2EFOA 1W5SA 2X0LA 4WXCA 4ENNA 5D5VB 2GA2A 3JW4A 3V7SA 4L0ZB 2EK5A 4ETSA 3F23A 2E7XA 5FGMA 2V79A 1R23A 4OIOF 5DCFA 2VC1A 1KU7A 2Q0OA 4ZH4F 3O2PE 3DXJF 3R6SA 5D8LB 3FMQA 1HXDA 1XDSA 3R0JA 2XVCA 4YFXF 4KYWA 1TNSA 3ELKA 3WTYC 3VODA 1IN6A 2QBYA 4A2UA 3BJOA 2K4BA 2V9VA 1MD0A 3JSPA 2DO7A 3VEPA 3DQVC 1T2KA 4UVBA 1WQ2A 1TQIA 2Q2EA 1YQAA 3ZP5A 4ENJA 3R4KA 2EV6A 1ZAOA 1Z05A 3E3VA 1SMTA 5F6FA 1J9IA 1IZ1A 2X4HA 1RI7A 1LJ9A 3ABTA 2XRNA 1YG2A 5CJ9A 3P9CA 2HYFA 2F2EA 3E6CC 3LA7A 4UVCA 3KP2A 3ZPLA 4KIBA 3WTTC 3HIFA 2XAQA 5D4SA 4HF2A 3CO7C 2Z5UA 3WTXC 2QQAA 4MTDA 4A12A 2IW5A 2KIFA 3F8CA 3BPXA 4UHTA 2P5LC 1XGSA 1BBYA 1I1GA 3NQOA 4IHTA 3WODF 3TOAA 3QP5A 3GW2A 4OU0A 1OPCA 3L00A 1IXCA 3HUGA 2VE8A 2H09A 1K7AA 4BH9A 4ZYDA 3CJNA 3GZ5A 1BI2A 3P9KA 3L09A 2A68F 3SHFA 1LNWA 1YS6A 1FZPB 3J81K 2HTSA 2P6TA 3TOBA 3M7GA 2EFWA 3KLNA 5H6QA 3TQNA 3FMRA 5HLGA 3D0SA 4RGXA 5JVTA 3T8TA 2BYVE 2CFXA 2QBYB 1ZRFA 3E6DA 3HYIA 3WTUC 2PFBA 2EA4A 4EJVA 1T38A 2OAZA 2EFQA 3HOTA 1IN4A 2MLGA 3LQRA 4NB5A 1V4RA 1LEAA 1AOYA 3RKYA 4KMUX 1Z1DA 4KNYA 5L3GA 3KEQA 3IHUA 1ZG3A 3SZPA 3U9GA 5FFXA 5L3FA 5LEKA 5DYMA 3JAMK 4HYEA 5F64A 4N9IA 4ESFA 2FQ3A 2W84A 3O3KA 3LA2A 2FF4A 3F8BA 5IT9Z 2FBIA 1W7PB 3E6BA 3IWFA 2FA5A 3FF5A 3F72A 3ZMTA 1H9TA 1TNTA 3FZVA 3I5UA 1P4AA 2QYOA 4HF1A 3NRVA 3BDDA 4A5MA 1FLIA 3P9IA 1WWXA 3HSRA 2R7FA 4KT5C 4JQFA 1FBSA 3MCZA 2XIGA 4IVNA 2DFIA 2IA2A 3WTSC 2CWEA
chains in the Genus database with same CATH superfamily
3FBNB 2JA7J 1YW7A 3MQ0A 4IRGA 1APLC 2W82A 4PJLA 3HKZN 3WU2C 4A69C 1VQ8I 3ZN1A 1WH7A 1WJCA 1U9NA 4B43A 1V3FA 3MFKA 3PJRA 2FSWA 2RQQA 4OIQF 1TWAJ 2D1VA 1HW2A 1I39A 2LRDA 3HUGB 4XICA 2IRFG 2WAEA 1KU2A 4JX5A 2HEOA 1SFKA 2PJPA 3JCUC 5LD2C 3A0BC 1HSTA 5DS9A 2ACJA 3I53A 4RB3C 1YLFA 4LK0F 2P8TA 3S1MJ 4EATA 2HKXA 2IA0A 4E6KG 1W7PD 2IS1A 1W5TA 3EUHA 2KJBA 3FXLA 2Y48A 4YIFA 1YRNB 2GLOA 1WPKA 3G73A 1X2MA 4IHXA 2ICWG 1HDPA 1NTCA 1MJBA 1R6RA 3J80K 4BHCA 2M0CA 2XAJA 3AKZA 2LKXA 3KX2A 2F5EA 2WBMA 1BM9A 2CQXA 2ESHA 2JRTA 3PO2J 2RDPA 1B8IB 4B09A 2M8GX 1FYKA 5EYRA 2HXIA 5EZHA 4PZJA 3TL4X 2HOTA 4DOZA 4JK1X 3ABUA 4MTEA 2UV1A 5IP9J 1CGPA 1FC3A 2LY9A 3LSTA 1OR7A 3IH3A 2HGCA 3R61A 4E7JA 1JJ6C 1BJZA 2DW4A 3HRUA 2VOOA 2E7WA 1MJ9A 3ABLH 4M3EA 9ANTA 2DT5A 3F8NA 1WKMA 4ESJA 2KDOA 2P7VB 2XGEA 1T95A 2XPUA 1I3AA 3CMMA 1WJ5A 2BHZA 4HV6A 3LNQA 3OOUA 1ZREA 3A02A 1JGSA 4HX7A 4MO7A 1FOWA 2R7XA 2X85A 1J0RA 3BT9A 4UV8A 4XN3A 1TQPA 3NARA 2EIKH 3GEZA 3HOZJ 1XPXA 1ZR2A 1AU7A 3KP7A 4HX8A 4PDKA 4V2GA 2FBKA 4CYDA 3GTJJ 3CCVI 2HQRA 1Z21A 2EB7A 4OIRF 5GAHJ 1S6LA 4KFCA 1BI0A 4IX7A 5GP9A 4A3EJ 4I98B 5TGTA 2CW8A 1BC8C 1IW7F 4PCQA 3O8GA 4EGYA 1VZ0A 2DFEA 2GOXB 3DP7A 4LJZF 1K78B 4O3MA 1BIBA 2OCCH 3EUKL 3WG7H 5D5UB 2K9MA 1KYWA 1BC7C 2DMTA 3OS0A 2HKOA 1MKMA 5H6RA 3EPZA 3C2BA 3K7AJ 3QYEA 5B1AH 2VXZA 3H35A 2NNNA 5IYCJ 5E3MA 1H8AC 4H0EA 4BQQA 1HKSA 5LBQA 2VONA 4JYKA 2FJ1A 5DV5A 3LAJA 4HA8A 3CUQA 2JUGA 3ABMH 4IO9F 3GTQJ 1F9NA 1U5TA 1UB9A 3H9QA 3RDIA 1P9QC 4EJUA 1F1ZA 3F8FA 4BYYA 1R00A 4HLXA 2WWYA 3GZNB 4RGSA 3MEXA 2NRAC 1LEBA 1B1BA 1Y0NA 4EVIA 2NVQJ 4BDYA 3Q0UA 1KYZA 3KYLA 2DJNA 2ZBKA 2B7EA 4FT8A 3OSFA 4HOBA 3CMYA 1SD7A 2HR3A 4LK1F 3QRFF 2O3FA 1UZCA 4C30A 4AM3A 1AKHA 3DLAA 3GFLA 4BBRJ 4FCYA 1R9TJ 2VKVA 2MA3A 3H3ZA 3K70D 3BZ6A 1IDYA 5D5XB 3F9KA 3I64A 4S05A 3OYFA 2PLYA 3ZMZA 2Q8KA 4RM2A 1S7EA 3FKJA 1S5LC 3N97A 3ECHA 2LP0A 1Y0UA 5HLHA 1STZA 1JGGA 3S16J 4OIPF 2JA2A 4Y17A 1EH6A 2WB1A 3RI4A 2AQEA 3PL8A 1MDMA 2JA5J 1T33A 5BNGA 2O03A 3ZMUA 1U2WA 3PFIA 3FXQA 1BR2A 2MH2A 4IHWA 4A3FJ 3EYIA 3A2KA 1WRJA 4EGZA 3CD6I 3S15J 4A3CJ 2ZKZA 3NAUA 1PUFA 3DEWA 4BDZA 2F4IA 2J5OA 1NH3A 2ZFUA 2L3DA 2P81A 3DBLB 4BKXA 3VSLA 2DT6A 2FE3A 4JOMA 1TQMA 4BQNA 2CS3A 3G1MA 3PNVA 3H3VK 3S17J 3L2QA 3BTCA 5C4JJ 2KLOA 5FB2A 2GOMA 4WWCA 4ZTJA 4XLNF 4HNVA 3FWEA 1N25A 2CU7A 2DU9A 1JTXA 4RLFA 3WE2A 4BU2A 2F6CA 1OQYA 3FK7A 1SAUA 1F43A 3LFUA 2DN0A 2OTJI 2DLLA 1VQ6I 3MMYB 3L2VA 3ZQHA 3C1DA 4IPAA 3BG5A 3Q9VA 2CO5A 4LFUA 1JUMA 2V1DA 1JT6A 5GPCA 1W0TA 4N0BA 4IZZA 3GF2A 1MBHA 1VF9A 4KITB 5ILUA 1JHHA 5KAFC 2W57A 1SD6A 2H8WA 3D5LA 4BXXJ 2D1HA 2W7NA 2HOEA 3QU6A 4XQFA 3M9AA 4GDFA 3KCCA 3S2WA 3CLQA 1HW5A 4HBLA 1I5ZA 3L2CA 2EZHA 3GFIA 1IJWC 1TTYA 3JTHA 1ZGWA 1RNLA 1JE8A 2EIMH 2RAEA 3ZR8X 2EA2A 3CJTB 3ASNH 3F3XA 3GMEA 4XLAA 3TO9A 2OD5A 2F5CA 3HJEA 1QZZA 3K1MA 3KPHA 3PUBA 3ZCOA 3W3CA 4D1QA 2HZDA 3RQ4A 3K1NA 1D5VA 2JT1A 2R4GA 4KDPA 2JJ7A 2XPWA 5EJCA 3CUQB 2LY1A 3K70C 1VQ5I 1NG7A 3DTKA 3LQQA 1G3TA 2EV0A 3HRSA 4YFNF 4P96A 4CSWA 2GQQA 4PSWA 3T1BA 3OYBA 1T0FA 4A0ZA 2A6EF 2M5WA 4Q4ZF 1GDTA 1MW7A 1KQ8A 1MH4A 4HNTA 3RTRA 5J4YA 5DM6F 2IAIA 3F6OA 4I6ZA 1YW9A 2DTRA 5FLXZ 1V5EA 2Z99A 3BG3A 5IY5H 2YUSA 1ZH5A 4ON0A 2DA6A 3QU3A 3V42A 2JWTA 3OV8A 1Z3YA 3K4NA 5TJJA 3MN2A 1W1WE 4JP0A 2G0EA 1QRYA 2RQPA 3AAFA 2FMYA 4GRIA 4FE7A 1ETXA 1YIOA 1NG6A 4HG2A 4X6AJ 4WCGA 4I09A 3I59B 2JMWA 4YRVA 2NVXJ 2G7UA 4F93B 1EF4A 4UB8C 2AXTC 3WHBA 5IYBJ 1VFCA 3ZMSA 1MDMB 2MG4A 1CQTA 3BQYA 4OAYA 3FHZA 2VL8A 2DMUA 5J6XA 1E17A 4A93J 2E2IJ 2VJJA 2JK3A 3CDHA 1OLTA 2Y31A 3KYDB 1WI9A 2GIVA 1PUFB 3CF2A 4XN0A 3S14J 1UJ8A 2RREA 5FKOA 5K5QA 2QVOA 4CCMA 3VWBA 2Y9ZA 4ZDPA 1T6SA 3S3MA 2DQLA 4PJMA 2QUFA 3DCFA 2M2EA 3EUHC 1FSEA 5C3EJ 1P92A 4J19A 4A3IJ 2L01A 1KONA 1OCRH 1ZGAA 1ITYA 2HTJA 2H8RA 1Z9CA 1SVMA 1JTYA 3PNYA 2NAZA 4PJJA 2DXIA 5HLIA 2NVTJ 2PX9A 2WAQN 2KISA 4LIVA 1C0WA 2LG4A 4DBRA 5F08A 1U6GA 1LQ1A 3KYCB 1LVKA 2QCOA 1X4OA 1IRXA 2ME0A 3QPLA 1DPRA 3OYKA 1SFUA 4HQEA 1JKQC 3BPVA 1DGRM 1QNTA 2CJJA 2KKOA 5DDGA 3CUOA 4GYGA 3HGGA 3GLXA 4XLFA 3OYCA 1K79A 1IUYA 2A61A 1OR7C 1Q1VA 4CDGA 3CC7I 3OR2C 3ZQCA 2HWVA 3I54A 4XLPF 4U0WA 3BOQA 4HDVA 1GHCA 3HBLA 4OMZA 2VJ4A 3SEZA 4AIHA 2Q1ZB 4YG2F 1RR7A 4UV9A 3VFZA 2XAFA 5L3CA 3W6VA 3PO3J 2ZJPF 4WF2A 1IAWA 3HC7A 2DYSH 1RESA 2Y0SN 1EH7A 5B1BH 3RKWA 4CCNA 3WGGA 5GAGJ 4WX9A 3OYAA 4A3KJ 1SAXA 3DFGA 2BBYA 2COBA 1ZN2A 4LG0B 5ICEA 1J5YA 4NC8A 3QOEA 4LLGF 3BJ6A 4Y15A 1LDDA 4U0VA 4QWQA 3CLOA 3SFZA 1GXQA 2I10A 3OSGA 4HF0A 3COAC 1VNDA 1MGTA 3E5XA 2BY0A 1QHGA 2WV0A 1XDUA 2BEOA 2LTPA 3W6KB 3WGHA 4Y7NJ 1WJAA 4NQWA 1JKRC 4MEXF 1AWCA 2I8DA 4FE4A 2XF6A 2K86A 1TLHB 3DPUA 4M73A 1EH8A 2PJRA 3GBGA 4A6EA 1R5ID 1ZQ3P 3JRIA 2G9WA 2DPUA 3C2GA 4JBAA 3CUQC 1BL0A 1SFOJ 5LGTA 2X6OA 3Q3SA 1U5TC 2OU2A 3HOSA 4XSZF 3BTJA 5DEQA 3IAS2 2QQBA 2LK2A 4KT6A 2KZGA 2NS0A 4HNUA 3LSPA 3A01A 3WU0A 5BOXA 1IF1A 2VBYA 3CMEI 3QAHA 4RBOA 1SEUA 1WHUA 3F6VA 3I3LA 3HOYJ 1SVLA 5M3MJ 1YYVA 4AIJA 4E7ZA 1LB2A 3S32A 2DQRA 4UB6C 2FD5A 2DK8A 1O7FA 2LOOA 1O3SA 3LSKA 4CUGA 2ZB9A 3OIQA 2K40A 5K7HA 4C3HJ 2Z9OA 1SFEA 2FBHA 1QA6A 4YIRX 2Y0SA 3OWTA 1LDKB 1UFMA 2F5DA 1MBKA 2JZYA 4FASD 3FHNA 2VB6A 4BAYA 4G7OF 2HNHA 4S04A 4P1WA 4ABZA 4CZCA 4XKVA 2EFPA 1Z3XA 4CHUA 2NVYJ 4R79A 4QTRA 1IG7A 4IL6C 1DQUA 4L0YB 4NHJA 2HOSA 5LGUA 2D45A 1T98A 2XB0X 3ROUA 3HPHA 2QKMB 3WHCA 3U1DA 3HEFA 1LVAA 4KJZA 3W6JB 1H9GA 4W97A 1ZELA 1PVEA 1GV2A 3FXMA 2FNAA 4MLOA 3BG7A 5AIPA 3ULQB 2XRLA 5J1RA 4L5IA 2RGVA 2K85A 3C7JA 2VOPA 4XNFA 2BGCA 1RUNA 1HC8A 4EJOA 1OISA 2YX7A 2M30A 2DA5A 3MKLA 4ITVA 2VBWA 2X48A 2OA4A 3K4LA 1B4AA 1R4NB 2K3FA 5LHIA 3E6MA 1DUXC 1PUEE 4QPOA 4IQ4A 1RUOA 5DCMA 2W1OA 2VXDA 5A2QZ 1IN5A 4RB1A 1FYLA 2MW8A 3J7AO 2V6CA 5CVRA 4C9YA 1AA7A 3O6BB 2E36A 3JSOA 2Q2EB 2FU4A 1S8NA 2EINH 3ZQFA 2X1DA 2XC7A 1MMNA 1X1PA 2ETHA 3A0HC 3CO6C 3L2WA 4A0YA 2DI3A 3WTVC 2H94A 2HS5A 1X1AA 4F52A 1LFUP 4CXFA 1F5TA 1OCTC 1X3WB 2FOKA 1NK3P 3DLLF 2WTEA 2R7VA 1RIOH 3OYNA 4XM3A 2DA1A 1QO0D 4WXHA 2K9QA 1S7AA 2CW0F 3S1RJ 3JRAA 3FXJA 1LKXA 4M6VA 3MZ8A 1PP7U 4P9FA 4RM3A 2LR8A 2PMHA 1HA8A 3KZYA 3IKVA 2ZCWA 3DKWA 2PJRB 2KL4A 1ZRCA 2LC2A 2PI0A 3QOPA 4XRFA 2A69F 2LKSA 3BCBA 1IC8A 3H36A 1HKTA 1XTAA 3E5UA 2KRHA 3JTGA 2NVUB 2FRHA 1J7KA 1XMAA 2Z3YA 1B72A 3A01B 1ZGJA 1E0EA 1A5JA 2B0LA 2OZUA 3VB2A 1YITI 1FBQA 1ZARA 4BGDA 1T0FC 4DBQA 2V7FA 3JRDA 4EM0B 2P0WA 3TO7A 1RZ4A 1Y56A 2HZTA 1OFCX 4U88A 2IP2A 1ETOA 1HOMA 2PMZA 5BPIA 1LE8A 2XAHA 1P4WA 5HDKA 1O57A 1ZG1A 5L3EA 3V8JA 3RZDJ 2BVMA 1T08B 3S1QJ 4RLQA 1Z0XA 5E1WA 4LGWA 4GXOA 4RS8A 1XB4A 2E34A 1R49A 1KQ0A 4HSTA 5J40A 2O6GE 5E8IA 2HYGD 2QENA 2XASA 5J3LA 2P7CB 2OJED 1HLVA 5IP7J 2Y30A 2IGMA 3TEDA 4KN4X 4IHYA 1OJLA 2R5YB 3R0AA 5B3SH 1DPUA 5D6FA 2GXGA 3HOXJ 2QWWA 5LLQA 5FO5A 2OF7A 3CQZJ 3QP6A 5LEJA 4G8XA 5KCMA 2MSYA 3BR1A 1SD4A 2MABA 2QSGX 3K0LA 4P5OA 1G6NA 3BROA 1FPQA 1MIJA 3ZOBA 1V55H 2UXNA 4Q47A 2PBIA 3IP4B 4G7HF 3HB9A 2O61A 3PFYA 3OYMA 1VQ4I 3H92A 1ON1A 2H6CA 1X3UA 3H9JA 5HOOA 4KA4A 1S3JA 2P5KA 4LMYA 3IAM2 1ZTRA 3L2RA 1Z7UA 4ESBA 2L7MP 3GYHX 3KP5A 3O8HA 4XOTA 2MH9A 1WJFA 2LKPA 1XMKA 2K3PA 5FKLA 2YU9J 1KQ9A 2BE5F 2CUFA 1RKTA 4KIFA 4M6YA 4MGRA 1QU3A 4UUSA 4IRHA 1YX5A 5IT3A 3GZ6A 3ML6A 3GX4X 1QHHD 2BY1A 4D0PA 2IGOA 3HKZA 4XMYA 4L9NA 2IS6A 3P5JA 1UG2A 2Z16A 3DBHB 3S93A 2Y9YA 3K1PA 1OYYA 5ICCA 4B8XA 4LD5A 4EM1A 1KU9A 3CCYA 3M8EA 2L5QA 2HVRA 3QWLA 4L18B 3JRBA 1S7OA 4BS9A 1ONVA 2ELJA 3BZCA 4NC6A 2RV8A 2ZNZA 3H9GA 2LDUA 4CYCA 4E7KA 2AS5F 3HHHA 4BEHB 3E97A 4D7MA 3G4SI 3GTKJ 3BR6A 2R7ZJ 1NK2P 4LB5A 1X3ZB 2ZO4A 4G6QA 1X4PA 2HI3A 4IJAA 5E3NA 4U0YA 5GTIC 4GFBA 1E3HA 2M7AA 1G4DA 2F4MB 3L2UA 3TBIA 3FXRA 1FP1D 1SD5A 3OY9A 2HYJA 2GZWA 5TISC 5HDNA 2E35A 4L5JA 4GCVA 2HXOA 4UNOA 3K6GA 1BI1A 1POGA 1TWFJ 3V7RA 1K6OA 4A3MJ 4IXAA 2QQ9A 4M3DA 4HPQA 2QQ8A 1O3QA 2EWNA 1WVRA 5F1JA 3JRGA 5E17F 1LE8B 2L9SA 3GXOA 4YFKF 5IOZA 3EUAA 2F4OB 2CQ7A 3FK6A 3GTLJ 1Y6IA 4M72A 2K4JA 3OOPA 3TW7A 2E1NA 4BE1A 4ASNA 1B6AA 4XKWA 4Q5SF 2X51A 4WXDA 1A6QA 1I27A 3GTPJ 1USTA 2BZTA 2LNBA 3AG3H 2GA1A 2L02A 1X2NA 3IUOA 2M8EA 1XSXA 3AG2H 3K10A 5LRSA 4A3GJ 3T8RA 4F55A 3JRCA 2IT0A 2BV6A 1XGMA 2AQFA 4PSXA 5D4RA 3PUFA 2GIZA 4L9JA 3KLOA 4PUSA 1CF7A 4RB2C 2HQNA 2ZMEA 3PIOF 5J8CA 3IH2A 2EJRA 2ELHA 1VQOI 1V5FA 2GAUA 1GLNA 4HQMA 5CLSA 5CQGA 4YELA 4IHSA 3BR2A 3MZHA 1BOBA 3VPRA 1N77A 1Z77A 1DU0A 4G94A 2X6WA 1BR1A 5KVRA 3M8JA 4L5EA 1KZHA 2X6XA 2NOGA 5F04A 4QPQA 4WK8F 3GWZA 2BHYA 1H88C 3KE2A 4U7DA 1Z91A 5KHDA 2FQ4A 2DDBA 2HFHA 3ZQIA 2AXLA 3LSJA 4HZFA 4ZYHA 2ZFWA 2E2JJ 3QYFA 3SDBA 2JVHA 4KICA 1G2HA 3HG9A 1W4MA 3D5RC 2VC0A 1D8KA 3OL4A 3DWLE 3OIOA 3F21A 2L4MA 1EV7A 2NXNB 4G6DA 2H1LA 1D0YA 3NEUA 3J81Z 2IA1A 3GUDA 3KZIC 3RJPA 1ETWA 2K5CA 3RKXA 2IVMA 5JR3A 4UUSB 2ADUA 2KP6A 4D9JA 3WG9A 2G7HA 2BW3A 3HRTA 3I55I 1T56A 2DDAA 4K2EA 1FOXA 4CICA 2K9SA 3F0CA 4CCOA 4N4NB 3GVAA 3PSFA 4RAYA 4V2FA 1U9OA 1R7JA 2R7WA 3IRRA 3BJAA 4XRSA 2EBIA 4E7LA 5TRDA 4A0XA 1YFHA 4XOPA 5IP6A 3T5XA 1JJ8C 3U1KA 4CYCB 2JUCA 1UCRA 1IXRC 1FIAA 1MZBA 3LOCA 3MZYA 2LF7A 5ERIA 4JX6A 2M3AA 3L1PA 2E1OA 2O7OA 1R36A 3HHGA 5HS7A 2D2WA 5K7FA 3FIWA 2CUEA 5F0CA 4EJWA 2CV2A 2XDVA 2KDZA 2RNJA 1L3LA 5EEHA 4KMFA 1V5GA 2CGPA 1MNMC 1BW6A 5HDGA 3I71A 3JAMZ 1LUJB 4U87A 3LAPA 2Z1DA 2IS4A 2ISZA 3OR1C 5F27A 1T39A 3MKZA 3TP3A 1FMWA 3FM3A 4ZYGA 4IOAF 5E1XA 4CH7A 2IEKA 4LLNA 2OBPA 1U5TB 1XX5A 4I01A 4XIDA 2MYSA 2MFZA 1A36A 1JXSA 2X1EA 2L7KA 2A6HF 1XCVA 2R5ZA 3CP2A 1WI3A 1JI8A 2XKPA 4GGGA 1XN7A 1U0JA 2H6BA 1SC7A 4RDUA 2M87A 5E1ZB 5IT9K 1O4XA 3BCAA 1FY7A 1AKHB 3FISA 2OV7A 3GCMA 2OZ6A 3PQJA 4M3FA 4NDLA 2E2HJ 4UVAA 5CVUA 1FSHA 3OYDA 5C4XJ 4CGZA 3TW6A 2UWMA 4QIWN 3HTUA 2RVCA 2YU3A 3G1LA 3SXYA 2A5WA 5B5EC 1BW5A 4XRSG 2DA2A 4C2MJ 5GPAA 1OMIA 1YX3A 1W5CC 2P4WA 1MMSA 4D7NA 4II3A 3W2VA 1RR8C 1D3YA 4NBQA 3HSFA 4R8HA 2EZIA 3PQKA 4RGUA 3D5SC 3S2HJ 4XLEA 5DM7F 1R1UA 3HSEA 4ZJZA 2V1XA 3I9V2 2STWA 5EG0A 2R7UA 2LH9A 2DA4A 4XKBA 1Y1WJ 3FXKA 2FX0A 2KRFA 4MFDA 4OWRB 4TV7A 1YHQI 4I0BA 1KU3A 3DU6A 4F92B 4QLCU 1D0ZA 2VKHA 3K2AA 1FT9A 2CYYA 5DD4A 3TGNA 2R0QC 3J80Z 5EGOA 5FKNA 3K4BA 1JKOC 3HOUJ 4NNJA 3DKXA 4BE0A 1OYIA 1XGOA 1VQ9I 3GLLA 1YJNI 4AD9A 4L9VA 2COMA 1ZG5A 4BUPA 3CESA 2R7RA 1VI0A 1XCBA 1X1CA 1A04A 5LGNA 4BJ5C 2CFOA 1R5GA 4IOCF 3S3OA 1SVOA 1ULYA 1ZYRF 1PJRA 5J1UA 3K4MA 2NYXA 2BVLA 3FBIB 1WJDA 3CJQB 1R1TA 3NWTA 4M71A 1LFBA 4PJNA 5EDNA 1JUSA 2A6TA 3JRHA 1TBXA 2Y69H 2JA6J 2P6SA 5J47A 3DV8A 2GXAA 3ZN0A 3U2RA 1WJBA 1ZLKA 1WJEA 3C2HA 1DU6A 1LPQA 2M4KA 3G71I 2VN2A 3V8KA 1MMAA 3H1CA 3LSMA 4V19K 1TC3C 1H89C 3CCUI 2DJIA 4HLYA 4XR6A 1MBGA 1XD7A 1IXSB 4Q48A 1BR4A 2JSPA 2X1CA 2Y75A 3G2BA 4BHPA 2C6YA 5IPAA 4DJAA 2BY3A 2XV4S 2HDCA 1ZK8A 3NWSA 4I0AA 1FOKA 1YTYA 1E3OC 2MD5A 1FTZA 2KT0A 4C3JJ 2KQRA 2L9VA 4KIGA 2R5ZB 2LBFA 1DGWY 3OYGA 4HEA2 4MQVA 5AONA 1IN7A 5CYVA 3WU1B 3CC4I 3FM5A 5LRRA 4ENKA 1P7IA 2K9LA 1TL8A 2MLKA 2QLZA 2DMNA 3KIOA 5AIQA 3L7WA 3MKWB 1HQCA 5KK1A 1BOAA 2WAQA 4ZC3A 3GFJA 2E60A 3RZOJ 4ZYEA 4DNCA 3H3UA 2PG4A 5E79C 3LWFA 4XLCA 1YW8A 3H5RA 4LIUA 2IS2A 4XORA 4Y4RA 4DYRA 4Y3OA 3G6EI 5CVVA 3DTEA 3I4PA 1V54H 3H0GJ 1MBJA 1SANA 2DAOA 2EILH 2FMLA 1T8IA 1ETQA 3HZJA 2L2OA 3Q0VA 1G3WA 3QPTA 1W7PA 4OMYA 1IGNA 3CMAI 2V4JC 2B9SA 1WCMJ 4G12A 4M3GA 5CKTA 2ZMEC 2NS7A 1SMYF 2EFNA 3N4MA 2DCEA 1F4KA 1Z7LA 5F0HA 1D5YA 2BXYA 4CZZA 5H2FC 1ENHA 1QBJA 4GO1A 2W25A 1QVUA 4R1HA 3WGIA 3BR5A 5E18F 4KUMA 1RPWA 3CZ6A 3LL7A 4BY7J 2ZJRF 1OYWA 4AYBN 1X58A 1VQMI 1OCPA 1W36D 3Q5FA 2V1NA 3RIRA 3FXUA 2M7BA 4X1EA 1B59A 1WFXA 3PSIA 4B3AA 5HVQC 2EQRA 3F22A 1LFPA 2KFDA 1FYMA 3BR0A 1FMVA 4L9TA 2JN6A 2M45A 2ZSIB 1YOVB 5JI6A 4XRMA 1J09A 3HGYA 4M9ZA 4MEYF 2CH0A 1QPIA 1FNNA 4HV5A 3HXLA 5D5WB 1PP8F 3SEQA 1XMXA 5BMZA 1IN8A 4I7HA 1D1BA 2K02A 2RNGA 3KP6A 4QSHA 5KAIC 2HPMA 5EZGA 2V1UA 4BXUA 1UG0A 2LY2A 4NC7A 4F7ZA 2FEZA 1HSJA 5J8FA 4HX4A 3QYBA 2XGDA 4RB0A 3RQIA 2EZKA 3V8LA 1OKRA 1FTTA 2M9HA 2B63J 3RPQA 2R7QA 1USSA 1K83J 5HS9A 1IV8A 2PQ8A 1YRNA 2XSDC 3CCQI 2LLKA 3M8FA 4N4OB 2M1BA 5L3BA 2JPCA 3B73A 2CV0A 3AG1H 4IQJA 2XUBA 3KEYA 3ERMA 1TZLA 2ID3A 2CG4A 2PMUA 2KJCA 3P7NA 5FRMA 5K7ZA 1MMDA 2VJ5A 3VYUB 2OTLI 3U21A 1B8IA 2J5PA 4LB6B 2O9LA 1WSUA 2X6YA 2XGCA 3I4NJ 2CQNA 5E3LA 5H20A 5BS6A 2F5FA 3ISPA 4I76A 1P6RA 5HNFA 1A6IA 3LFKA 5ILSA 4NQWB 3AFHA 5DUKA 5JVGF 1XSDA 2FXAA 2DPDA 3DPLC 4M6XA 4YIIA 1DP7P 1Z67A 2UXXA 1K61A 2IPQX 3REOA 1B9MA 4G9YA 4BJTA 2OQRA 5EEAA 1OCOH 2VI6A 3AG4H 5DUIA 2WA0A 3BLYA 3BZKA 4B47A 1ACIA 1IRGA 4MQ9F 2L7ZA 2NOJB 1UHWA 5ILVA 2ME6A 2E1MC 2H27A 2WC2A 2BY2A 1BIAA 4EEFG 2ZSHB 1G3YA 1W36C 1MBFA 4C2TA 4BY1J 2E5NA 1Z6TA 3CP8A 3JREA 2XHKA 1GV5A 2CW7A 1P4XA 4II2A 3VYSB 3ZQLA 2A07F 2LREA 2VT3A 2DBBA 1Q1HA 2GWRA 4M74A 1S29A 4O5VA 5FKKA 4I2OA 2MGQA 2DK5A 1OCCH 1TW3A 3EYYA 4AUXA 5DTDA 1K78A 4A5NA 2VBXA 2VT2A 2JSCA 3KFWX 3M1EA 5FKMA 2STTA 2CUJA 1R4MB 5K5OA 3FMSA 2L0KA 5FLXK 2CUZA 5J1YA 4LOCA 3HRMA 2HQ5A 2VASA 1P2FA 4HSRA 4J01A 4KN7X 2DTZA 3DBRB 3CTAA 4B44A 3S8PA 1VQKI 2A3SA 1R71A 5ED4A 2LSOA 4BACA 2W24A 4ZYAA 3OYLA 3CCMI 4JX4A 3V4GA 1TT0A 3KP4A 3WTWC 1BJAA 2RN7A 2CSOA 3DEUA 2O8XA 5GTHC 3IH4A 3B6CA 2KIQA 4MHGA 3CCSI 2WY7Q 1B9NA 2QZ8A 3R60A 2R7SA 1IRFA 1BI3A 3KETA 1KGSA 2V9PA 3MWMA 2XAGA 3F8MA 1QPMA 1YS7A 2XB5A 4HAMA 2OQGA 2ZXIA 2GXBA 4U7BA 3OS1A 3GTMJ 3K4JA 1HW1A 4IRIA 3C18A 3ZQ7A 1QZEA 2HDWA 4RGRA 5M3FJ 5E20A 3BY6A 2XSJC 3DU5A 6PAXA 2CRGA 3H5AA 1IUFA 5DCMB 1REPC 2QSHX 2JVGA 4PGGA 3K4CA 1JT0A 5KNLA 1GT0C 2KIMA 5FD6A 3BWGA 2KHMA 3SQNA 1GUUA 1BN5A 3WTZA 2KRCA 1EJ9A 3K69A 1F36A 3OMYA 3I58A 4EQQA 2VQCA 1XSVA 3ZXSA 2WY8Q 3WE3A 4LG3A 3H5NA 5E8GA 4MFEA 4PK4A 1SFXA 1QZYA 1FWZA 3GTOJ 4XK4A 3ABKH 2O8KA 2CQKA 4ZTFA 1XGNA 1G8XA 1MJAA 2IJLA 3GO5A 4P55A 3EETA 5FLVA 2XROA 1I6XA 3LSGA 1ZR4A 3CDLA 3LSHA 1VTNC 1J75A 3I0TA 2VPRA 1YO5C 4AIKA 2XF5A 2LD5A 2LF8A 2RKHA 2R7OA 4A6DA 3DPTA 3KZZA 3TDZC 4A3JJ 2E1CA 1EKEA 2HU9A 2L54A 4XBFA 4UUVA 4ZZDA 1FJLA 3JRFA 2ZXJA 3TKYA 2DA7A 4M9SA 3EQLF 3VOEA 2R7DA 4XLHA 1B72B 1FOYA 1G3SA 5FFZA 3M07A 5F1RA 3SFIA 3K9TA 2QF7A 2ZNYA 3MKYB 3ZRGA 1QGPA 1WGXA 2MC3A 3OYJA 5F0FA 5JLWA 2O0YA 2YR2A 3FX3A 3TDUC 3K4KA 5GADJ 2LVSA 5K5RA 4ENMA 2WB1N 1R1VA 1JHFA 2VQGA 4AWXB 3H0DA 2VODA 2L7FP 1U8RA 4E7IA 1LDJA 2ISYA 3QPHA 5EEGA 1U3EM 1ZLJA 3OS2A 1BA5A 3E5QA 3ECOA 3IKTA 2UZKA 2EV5A 4E70A 5BQTA 2NS8A 3CCLI 3BP8A 1MBEA 3K2ZA 4GYIA 2VE9A 2JQ7A 3UNGC 2E71A 5J4VA 5EF6A 2MC4A 5LHGA 4FX0A 4CO8A 4BBSJ 1VQLI 1X1DA 1EA3A 3ONQA 1D8JA 3LA3A 1DP3A 3HOWJ 4AIDA 2X9DA 1ODDA 5CVIA 5L3DA 1TWCJ 1JUPA 1FP2A 4W1UA 2UUZA 3FDYA 3AL0C 2M0MA 2QSFX 3L9FA 1NHAA 3ZMDA 1GVJA 2W85A 5ICFA 2Y2ZA 1IV6A 2ZJQF 4DYQA 2P5VA 2DYRH 1RC9A 4Y13A 1DDNA 3J7AY 2ECBA 3Q9SA 3J7YJ 4I02A 3A03A 1FBUA 4I99C 4G6TB 3ERED 2YSRA 3TO6A 1HBXG 2KPMA 3PM1A 1FX7A 4A3LJ 4Y52J 4BHBA 5FJ8J 1IO2A 1RKWA 1MSEC 1O7LA 1XC5A 2DOFA 5B66C 4IHVA 5HS8A 3I59A 1YIJI 2QM3A 3QQAA 3LMMA 1N78A 4FQGA 3ZQGA 2WAFA 2XPVA 3M1CA 1FEXA 5LHHA 3V7CA 2RC4A 3BC8A 5FD5A 5K1YA 5IYDJ 4AVPA 3C3WA 4ZDLA 3UR3C 4HRIA 4KISA 1Z6RA 3GTGJ 2HVQA 4HW0A 3HM5A 2K27A 2VLAA 1PDNC 3CF5F 1HKQA 2WADA 5CVJA 2MBFA 4IF4A 2XKOA 4G7ZF 2ESNA 2TRTA 2JPBA 2K9NA 4LITA 2R3SA 4M3BA 4CCLA 4XSXF 3A4CA 1KA8A 3HTSB 4ZZLA 2QA4I 2ZC2A 2D5VA 2K7LA 4FHTA 1UHMA 1D1AA 3RPUA 3CCJI 3KEOA 1QVTA 2ECCA 3FXOA 3UKGA 3ZQQA 1YJWI 5JFRA 5ICGA 3E1SA 4ZDOA 4DQ2A 3N05A 1U78A 1TW2A 5JHUA 2A5YB 2HOAA 1I1SA 3M4OJ 3G1OA 2VIXA 2L9RA 2BXZA 3PNTA 1L0OC 2LFBA 4D5CA 3B6AA 4EM2A 3RYPA 2W48A 4OINF 5A2QK 4B1RA 2VPLA 2DA3A 3GFMA 2YX4A 1J2XA 5E3OA 1MNDA 1D0XA 3S3NA 2V9KA 3DKYA 1HDDC 4RAZA 3IC7A 1Y1VJ 2FNPA 2WV1A 2DFFA 4OOIA 1Y8RB 1O3TA 2TCTA 2A05A 2EH3A 1UAAA 3EDPA 4XONA 1RRJA 1R5HA 3CCEI 3JR9A 2VBZA 3IWZA 1P7JA 3QPSA 2AO9A 2BOLA 4FISA 3ZMVA 1ZHFA 5FRNA 1O3RA 2QKLB 4FX4A 3RYRA 1UHSA 4Z6YA 3SZGA 2QGUA 3G3ZA 5LFAA 2JA8J 4DZJA 2ZJ2A 2NNYA 1CF7B 1TP4A 1MMGA 1ON2A 5FROA 1J59A 2ZMEB 4BQAA 4A3DJ 4EMSA 4LG0A 1ETKA 3IL2A 4BNCA 2IGNA 3VYTB 3HDDA 2XGXA 2VKDA 5HODA 2N8GA 2YPRA 5D8KB 1PYVA 2LYCA 3SYTA 5BPDA 5DD8A 1MSFC 1ZRDA 4IKFA 5JLXA 3KP3A 2Y0MA 4FETA 2Z2SB 4UY8I 3T0YA 2OUMA 2KIUA 2L4AA 2OCEA 4XL9A 5D6EA 4LLLA 2PEXA 5CQEA 2CV1A 4EJTA 3DF8A 1YE9A 4O6JA 4AVZA 4YEJA 2IBDA 3SZTA 3D1NI 2Z33A 4UXNA 1E2XA 2KZVA 2JTVA 3MAJA 4RMNA 4Z2YA 4HDUA 2ELKA 4N9HA 2YS9A 3B02A 3BG6A 2DFHA 4EV0A 2F48A 2W00A 3HPGA 4P9UA 4AU7A 2BW3B 1H0MA 4CA0A 4M9XA 2M34A 3IRQA 4MNUA 2TDXA 4PGHA 1GXPA 1QQIA 3BG9A 3MVPA 1R58A 4H4KC 2PN6A 2EZLA 1R22A 4DYCA 2EFOA 1W5SA 2OC6A 3HOVJ 4RAGA 2MD0A 2X0LA 4WXCA 2V26A 2DT7B 4ENNA 1VQ7I 2ID6A 5D5VB 2GA2A 3VYRB 2R92J 3M3YJ 2VQLA 3JW4A 3V7SA 4L0ZB 2M4GA 2EK5A 4PJ0C 3E7LA 5FLMJ 4ETSA 3I56I 3F23A 3CCRI 2E7XA 5FGMA 4DIQA 3HL2A 2L9NA 2V79A 2LMDA 2V6EA 1R23A 3MD2A 4OIOF 5DCFA 1U8BA 2VC1A 5GAEJ 1KU7A 2Q0OA 3Q0WA 4OAZA 4ZH4F 4MIMA 3O2PE 3DXJF 2VUMJ 3R6SA 1K4TA 1A35A 3OIPA 5D8LB 1Y8QB 3FMQA 1HXDA 1XDSA 3R0JA 4IEJA 5M5YJ 2XVCA 1RETA 4YFXF 4F91B 4BQOA 4KYWA 1TNSA 4FTHA 3ELKA 2FOWA 3WTYC 3VODA 2JRMA 1IN6A 2QBYA 3IV5A 5M5WJ 4A2UA 3BJOA 3OYHA 2K4BA 2V9VA 3BR3A 4B4CA 1MD0A 4BE2A 2E1MB 3JSPA 2DO7A 3RKQA 1TWHJ 2XF7A 3VEPA 3PIPF 3S2DJ 3DQVC 1T2KA 4UVBA 1WQ2A 3E0JB 1N75A 1TQIA 1WH5A 2Q2EA 4RA2A 1YQAA 4XKCA 3ZP5A 4ENJA 3CC2I 1VQNI 2R7TA 1UELB 3R4KA 1S72I 3ESWB 3QODA 2EV6A 3RPUD 3LSIA 4UUTA 1YI2I 1ZAOA 5HLTA 1VQPI 1Z05A 3E3VA 4BJ6C 1SMTA 5F6FA 1J9IA 1IZ1A 2X4HA 3OYIA 1FIPA 1RI7A 1LJ9A 3ABTA 2O5RA 2XRNA 1YG2A 3ZGKA 5CJ9A 3SDGA 1ERDA 3BTIA 3P9CA 1XG1A 4PFOA 2HYFA 3RSNA 2F2EA 3E6CC 3CJRB 1IRZA 1I50J 1ETYA 1TWGJ 3VSKA 3LA7A 2DMQA 5CPRB 4UVCA 3KP2A 3OL3A 2CQQA 5EG0B 1E3PA 4D5FA 5JHFA 2HDDA 3ZPLA 4AC0A 2HVSA 4KIBA 3S1NJ 3WTTC 3HIFA 2HQAA 2XAQA 1MH3A 5D4SA 4HF2A 1W0UA 3CO7C 3BQZA 2Z5UA 1HF0A 3WTXC 2QQAA 4Y33A 4MTDA 4A12A 2IW5A 2KIFA 1M1EB 5EGOB 2DODA 1I6HJ 2DMPA 4RAFA 3F8CA 3BPXA 4UHTA 2E5ZA 2P5LC 1XGSA 2VJIA 4X0GA 1BBYA 4PFPA 4BXFA 1I1GA 3NQOA 4IHTA 1K6YA 3WODF 4CCKA 2ZXWH 3TP0A 3TOAA 3OYEA 3QP5A 3GW2A 4OU0A 1OPCA 2EIJH 1X1BA 2XAUA 2H1KA 4E7HA 3L00A 1IXCA 5IOYA 3VDXA 2FUG2 3DEEA 3HUGA 1AHDP 2R5YA 1WZ2A 1I3QJ 2VE8A 2H09A 1K7AA 3TMOA 3LSRA 1D1CA 4C2UA 4BH9A 2KMUA 3CJNA 2HPIA 3GZ5A 1BI2A 4C3IJ 5M5XJ 4ZYDA 4A3BJ 3P9KA 2DOAA 3L09A 2A68F 3SHFA 1LNWA 1YS6A 1FZPB 3J81K 2HTSA 2EPFA 2P6TA 3TOBA 4DW6A 2W4SA 3M7GA 4B3XA 1ETVA 2EFWA 5HNHA 3KLNA 5H6QA 3TQNA 3W2WA 3X2QH 3FMRA 3D0SA 4DGWB 5HLGA 4RGXA 4B48A 5JVTA 3T8TA 2BYVE 2CFXA 2QBYB 1JKPC 1XS9A 1ZRFA 3E6DA 2LBFB 2ZXHA 2F5VA 2PMZN 3SJMA 3HYIA 2GM4A 2GBYA 3WTUC 1MNEA 2PFBA 2EA4A 4EJVA 2AHQA 1T38A 4AYBA 2OAZA 5C44J 1IDZA 2EFQA 4BL0B 1IN4A 2MLGA 2OPTA 3LQRA 4NB5A 3HOTA 3RCOA 1ZKGA 1V4RA 2IXSA 1LEAA 1AOYA 2VKEA 3RKYA 2VQHA 2E19A 4KMUX 1Z1DA 4KNYA 2IGKA 1GVDA 5L3GA 3KEQA 4ANJA 3IHUA 1ZG3A 3SZPA 3U9GA 4E4HA 5FFXA 3I4MJ 5L3FA 5LEKA 5DYMA 2CMPA 2QEXI 1A31A 3JAMK 3A1YA 4HYEA 4N9IA 5F64A 4ESFA 2FQ3A 2W84A 1HCRA 4CCJA 3O3KA 3LA2A 2FF4A 3F8BA 4F3QA 4DZPA 2I5UA 5IT9Z 1X19A 4BEHA 3FKIJ 3DTIA 2FBIA 1W7PB 3E6BA 3IWFA 1Y39A 2R93J 2FA5A 3AL0B 3J7ZI 3W2AA 1S9HA 3BTLA 3F72A 1UMQA 3FF5A 3ZMTA 1H9TA 1TNTA 3FZVA 4NUBA 3I5UA 1P4AA 2QYOA 1YJ9I 4HF1A 3NRVA 3ASOH 1OCZH 1ORKA 3BDDA 4A5MA 1TT5B 1FLIA 3P9IA 1WWXA 1K4SA 4S0HB 3HSRA 2R7FA 4KT5C 4JQFA 1FBSA 2DOEA 1G59A 3MCZA 4E7SA 4J00A 2XIGA 4IVNA 2DFIA 3CDIA 2IA2A 3WTSC 2CWEA
chains in the Genus database with same CATH topology
1YW7A 3MQ0A 4IRGA 3ZN1A 1V3FA 3MFKA 2FSWA 4OIQF 2D1VA 1HW2A 2IRFG 1KU2A 2HEOA 2PJPA 1HSTA 2ACJA 3I53A 4RB3C 1YLFA 4LK0F 2P8TA 2HKXA 2IA0A 1W7PD 1W5TA 3EUHA 2KJBA 2Y48A 4YIFA 3G73A 1MJBA 3J80K 4BHCA 2XAJA 2F5EA 1BM9A 2ESHA 2JRTA 2RDPA 4B09A 1FYKA 4PZJA 4JK1X 3ABUA 4MTEA 1CGPA 1FC3A 3LSTA 1OR7A 2HGCA 3R61A 2DW4A 3HRUA 2VOOA 2E7WA 1MJ9A 2DT5A 3F8NA 1WKMA 4ESJA 2P7VB 4HV6A 1ZREA 1JGSA 4HX7A 1J0RA 4UV8A 1TQPA 3GEZA 3KP7A 4HX8A 4PDKA 2FBKA 4CYDA 2HQRA 2EB7A 4OIRF 1S6LA 4KFCA 1BI0A 4I98B 1BC8C 1IW7F 4PCQA 4EGYA 3DP7A 4LJZF 1K78B 4O3MA 1BIBA 5D5UB 1KYWA 1BC7C 2HKOA 1MKMA 5H6RA 2VXZA 2NNNA 4H0EA 1HKSA 5LBQA 2VONA 5DV5A 3LAJA 4HA8A 3CUQA 1F9NA 1U5TA 1UB9A 3RDIA 4EJUA 1F1ZA 3F8FA 4BYYA 1R00A 4HLXA 2WWYA 4RGSA 3MEXA 2NRAC 1LEBA 1B1BA 4EVIA 1KYZA 2ZBKA 4FT8A 4HOBA 1SD7A 2HR3A 4LK1F 3QRFF 2O3FA 3GFLA 2MA3A 3H3ZA 3BZ6A 5D5XB 3I64A 4S05A 2PLYA 3ZMZA 2Q8KA 3N97A 3ECHA 1Y0UA 5HLHA 1STZA 4OIPF 4Y17A 1EH6A 3RI4A 1MDMA 2O03A 3ZMUA 1U2WA 3PFIA 3FXQA 2MH2A 3EYIA 1WRJA 4EGZA 2ZKZA 2J5OA 2L3DA 2FE3A 1TQMA 5FB2A 4WWCA 4XLNF 3FWEA 2DU9A 3WE2A 2DLLA 3C1DA 4IPAA 3Q9VA 2CO5A 4LFUA 2V1DA 4N0BA 3GF2A 5ILUA 1JHHA 2W57A 1SD6A 3D5LA 2D1HA 2HOEA 3QU6A 3M9AA 3KCCA 3S2WA 1HW5A 4HBLA 1I5ZA 3L2CA 3GFIA 1TTYA 3JTHA 1RNLA 1JE8A 2EA2A 3TO9A 3F3XA 2OD5A 2F5CA 3K1MA 1QZZA 3K1NA 1D5VA 2JT1A 4KDPA 3CUQB 3LQQA 1G3TA 2EV0A 3HRSA 4YFNF 4P96A 2GQQA 3T1BA 1T0FA 4A0ZA 2A6EF 2M5WA 4Q4ZF 1KQ8A 3RTRA 3F6OA 1YW9A 2DTRA 5FLXZ 2Z99A 1ZH5A 4ON0A 3QU3A 5TJJA 3OV8A 2RQPA 3AAFA 2FMYA 1YIOA 4WCGA 4I09A 3I59B 2G7UA 1MDMB 3ZMSA 3FHZA 5J6XA 1E17A 3CDHA 1WI9A 2GIVA 5K5QA 2QVOA 1T6SA 2DQLA 2QUFA 1FSEA 1P92A 2L01A 1ZGAA 2HTJA 1Z9CA 2NAZA 5HLIA 1C0WA 1U6GA 1LQ1A 1DPRA 1SFUA 4HQEA 3BPVA 2KKOA 1QNTA 5DDGA 3CUOA 4GYGA 3GLXA 1K79A 1IUYA 2A61A 4CDGA 2HWVA 3I54A 4XLPF 4U0WA 3BOQA 4HDVA 1GHCA 4OMZA 4AIHA 4YG2F 4UV9A 3VFZA 2XAFA 5L3CA 4WF2A 1IAWA 3RKWA 1EH7A 3WGGA 4WX9A 1SAXA 3DFGA 2BBYA 1ZN2A 4LG0B 5ICEA 1J5YA 4LLGF 3BJ6A 4Y15A 1LDDA 4U0VA 4QWQA 3CLOA 3SFZA 1GXQA 4HF0A 3COAC 1MGTA 3E5XA 2WV0A 1XDUA 2BEOA 3W6KB 3WGHA 4NQWA 4MEXF 1AWCA 2K86A 1TLHB 4M73A 1EH8A 4A6EA 2G9WA 2DPUA 4JBAA 3CUQC 5LGTA 1U5TC 2OU2A 3HOSA 4XSZF 5DEQA 2QQBA 5BOXA 2NS0A 3WU0A 1IF1A 2VBYA 3QAHA 3F6VA 1YYVA 4AIJA 1LB2A 2DQRA 2DK8A 1O7FA 1O3SA 2Z9OA 1SFEA 2FBHA 1LDKB 1UFMA 2F5DA 2JZYA 4BAYA 4G7OF 4S04A 2EFPA 4CHUA 4R79A 4NHJA 4L0YB 5LGUA 2D45A 1T98A 3ROUA 3U1DA 1LVAA 3W6JB 1H9GA 2FNAA 5AIPA 3ULQB 4L5IA 2RGVA 3C7JA 2VOPA 2BGCA 1RUNA 4EJOA 2YX7A 2M30A 2VBWA 2OA4A 1B4AA 5LHIA 3E6MA 1DUXC 1PUEE 1RUOA 5DCMA 5A2QZ 1IN5A 4RB1A 1FYLA 3J7AO 2V6CA 5CVRA 3O6BB 3JSOA 2FU4A 1S8NA 2ETHA 3CO6C 4A0YA 2DI3A 3WTVC 2H94A 2HS5A 4CXFA 1F5TA 2FOKA 2WTEA 1RIOH 1QO0D 4WXHA 1S7AA 2CW0F 1PP7U 4P9FA 2PMHA 3KZYA 3IKVA 2ZCWA 3DKWA 1ZRCA 2PI0A 3QOPA 4XRFA 2A69F 1HKTA 3E5UA 3JTGA 2FRHA 1J7KA 1XMAA 2Z3YA 1ZGJA 2B0LA 2OZUA 3VB2A 1FBQA 1ZARA 4EM0B 3TO7A 1RZ4A 2HZTA 4U88A 2IP2A 5BPIA 2XAHA 1P4WA 5HDKA 1O57A 1ZG1A 5L3EA 3V8JA 5E1WA 4LGWA 4GXOA 4RS8A 1XB4A 1KQ0A 2O6GE 5E8IA 2HYGD 2QENA 2XASA 2P7CB 4KN4X 3R0AA 1DPUA 5D6FA 2GXGA 2QWWA 5LLQA 5FO5A 3QP6A 5LEJA 4G8XA 1SD4A 3K0LA 4P5OA 1G6NA 3BROA 1FPQA 2UXNA 4Q47A 2PBIA 4G7HF 2O61A 3H92A 1ON1A 2H6CA 1X3UA 5HOOA 4KA4A 1S3JA 2P5KA 4LMYA 1Z7UA 4ESBA 3GYHX 3KP5A 2MH9A 2LKPA 1XMKA 1KQ9A 2BE5F 4KIFA 4M6YA 4MGRA 4IRHA 5IT3A 3GZ6A 3ML6A 3GX4X 4D0PA 4L9NA 3K1PA 1OYYA 5ICCA 4B8XA 4LD5A 4EM1A 1KU9A 3M8EA 4L18B 1S7OA 1ONVA 2RV8A 2ZNZA 2AS5F 2LDUA 3HHHA 3E97A 4LB5A 2ZO4A 4G6QA 4IJAA 4U0YA 1G4DA 3FXRA 1FP1D 1SD5A 2GZWA 5HDNA 4L5JA 4GCVA 4UNOA 1BI1A 3V7RA 1K6OA 4IXAA 2QQ9A 1O3QA 2EWNA 5E17F 3GXOA 4YFKF 4M72A 2K4JA 3OOPA 2E1NA 4ASNA 1B6AA 4Q5SF 4WXDA 1I27A 1USTA 2LNBA 2GA1A 2L02A 2M8EA 1XSXA 5LRSA 3T8RA 2IT0A 2BV6A 1XGMA 5D4RA 4L9JA 3KLOA 1CF7A 4RB2C 2HQNA 2ZMEA 5J8CA 2EJRA 2ELHA 2GAUA 4HQMA 5CLSA 4IHSA 3MZHA 4G94A 5KVRA 4WK8F 3GWZA 3KE2A 4U7DA 1Z91A 2HFHA 2AXLA 4HZFA 4ZYHA 2ZFWA 4KICA 1W4MA 2VC0A 1D8KA 3F21A 2L4MA 1EV7A 4G6DA 3NEUA 3J81Z 2IA1A 3GUDA 3RJPA 3RKXA 2IVMA 5JR3A 2ADUA 3WG9A 2G7HA 3HRTA 4K2EA 4CICA 3GVAA 4RAYA 1R7JA 3IRRA 3BJAA 5TRDA 4A0XA 1YFHA 3T5XA 1UCRA 1IXRC 1MZBA 3MZYA 2LF7A 5ERIA 1R36A 3HHGA 5HS7A 2D2WA 4EJWA 2RNJA 1L3LA 5EEHA 4KMFA 2CGPA 5HDGA 3I71A 3JAMZ 3LAPA 2ISZA 1T39A 3FM3A 4ZYGA 5E1XA 4LLNA 2OBPA 1U5TB 4I01A 1JXSA 2A6HF 1XCVA 2XKPA 4GGGA 1XN7A 2H6BA 2M87A 5E1ZB 5IT9K 1FY7A 2OZ6A 3PQJA 1FSHA 4UVAA 5CVUA 4CGZA 2UWMA 3HTUA 2RVCA 2YU3A 3SXYA 1OMIA 2P4WA 1D3YA 3HSFA 4R8HA 3PQKA 4RGUA 1R1UA 3HSEA 2V1XA 2STWA 2KRFA 4TV7A 4I0BA 1KU3A 4QLCU 1FT9A 2CYYA 5DD4A 3TGNA 3J80Z 1OYIA 1XGOA 4AD9A 4L9VA 2COMA 1ZG5A 1XCBA 1A04A 5LGNA 1R5GA 1ZYRF 1ULYA 2NYXA 1R1TA 4M71A 1TBXA 2P6SA 3DV8A 3ZN0A 3U2RA 1ZLKA 2VN2A 3V8KA 4HLYA 1XD7A 1IXSB 4Q48A 4BHPA 2Y75A 2C6YA 2XV4S 2HDCA 4I0AA 1FOKA 1YTYA 2MD5A 4KIGA 5AONA 4MQVA 1IN7A 5CYVA 3WU1B 3FM5A 5LRRA 4ENKA 2MLKA 2QLZA 5AIQA 3L7WA 1HQCA 5KK1A 1BOAA 3GFJA 4ZYEA 4DNCA 3H3UA 2PG4A 3LWFA 1YW8A 5CVVA 3I4PA 2DAOA 2FMLA 1G3WA 3QPTA 1W7PA 4OMYA 1SMYF 2EFNA 3N4MA 1F4KA 4CZZA 1QBJA 4GO1A 2W25A 4R1HA 3WGIA 5E18F 4KUMA 1OYWA 3Q5FA 3RIRA 3FXUA 1B59A 5HVQC 3F22A 1FYMA 4L9TA 2M45A 5JI6A 4M9ZA 4MEYF 1FNNA 4HV5A 5D5WB 1PP8F 5BMZA 1IN8A 4I7HA 2K02A 3KP6A 2V1UA 4BXUA 4F7ZA 2FEZA 1HSJA 5J8FA 4HX4A 4RB0A 3V8LA 1OKRA 3RPQA 1USSA 5HS9A 2PQ8A 3M8FA 2M1BA 5L3BA 2JPCA 3B73A 2XUBA 2CG4A 2PMUA 2KJCA 3P7NA 2J5PA 4LB6B 1WSUA 5H20A 5BS6A 2F5FA 3ISPA 1P6RA 3LFKA 5ILSA 5DUKA 1XSDA 2FXAA 2DPDA 3DPLC 4M6XA 4YIIA 1DP7P 2UXXA 2IPQX 3REOA 1B9MA 4G9YA 2OQRA 5DUIA 1IRGA 4MQ9F 1UHWA 5ILVA 2H27A 2WC2A 1BIAA 1G3YA 1Z6TA 2XHKA 1P4XA 2A07F 2VT3A 2DBBA 1Q1HA 2GWRA 4M74A 1S29A 4O5VA 4I2OA 2DK5A 1TW3A 3EYYA 1K78A 4A5NA 2VBXA 2VT2A 2JSCA 3KFWX 3M1EA 2STTA 5K5OA 3FMSA 5FLXK 3HRMA 1P2FA 4KN7X 3CTAA 2A3SA 5ED4A 2LSOA 2W24A 3V4GA 3KP4A 3WTWC 1BJAA 2RN7A 2CSOA 3DEUA 2O8XA 4MHGA 1B9NA 2QZ8A 3R60A 1IRFA 1BI3A 3KETA 1KGSA 3MWMA 2XAGA 3F8MA 1QPMA 1YS7A 4HAMA 2OQGA 2GXBA 4U7BA 1HW1A 4IRIA 3C18A 3ZQ7A 4RGRA 5E20A 3BY6A 6PAXA 5DCMB 1REPC 4PGGA 2KIMA 5FD6A 3BWGA 3SQNA 1BN5A 3WTZA 3K69A 3I58A 4EQQA 1XSVA 3WE3A 5E8GA 1SFXA 1QZYA 1FWZA 2CQKA 1XGNA 1MJAA 2IJLA 3GO5A 4P55A 3EETA 2XROA 1I6XA 1VTNC 1J75A 3I0TA 1YO5C 4AIKA 2LF8A 2RKHA 4A6DA 3DPTA 3KZZA 3TDZC 2E1CA 2L54A 4XBFA 4UUVA 4ZZDA 2ZXJA 3TKYA 4M9SA 3EQLF 3VOEA 2R7DA 1G3SA 5FFZA 5F1RA 3K9TA 2ZNYA 1QGPA 2MC3A 2O0YA 2YR2A 3FX3A 3TDUC 5K5RA 4ENMA 1R1VA 1JHFA 4AWXB 2VODA 1U8RA 1LDJA 2ISYA 3QPHA 5EEGA 1U3EM 1ZLJA 3E5QA 2UZKA 3ECOA 3IKTA 2EV5A 4E70A 5BQTA 3BP8A 3K2ZA 4GYIA 2VE9A 5LHGA 4FX0A 4CO8A 1D8JA 3LA3A 5CVIA 1ODDA 5L3DA 1FP2A 3L9FA 1NHAA 3ZMDA 1GVJA 2W85A 5ICFA 2P5VA 4Y13A 1DDNA 3Q9SA 4I02A 1FBUA 3ERED 1HBXG 2YSRA 3TO6A 1FX7A 4BHBA 1O7LA 5HS8A 3I59A 2QM3A 5LHHA 3V7CA 2RC4A 5FD5A 5K1YA 4AVPA 3C3WA 1Z6RA 4HW0A 1PDNC 2K27A 1HKQA 5CVJA 2MBFA 4IF4A 2XKOA 4G7ZF 2ESNA 2JPBA 2R3SA 4XSXF 1KA8A 3HTSB 4ZZLA 2K7LA 4FHTA 1UHMA 3RPUA 3KEOA 5JFRA 5ICGA 4DQ2A 1U78A 1TW2A 5JHUA 2A5YB 1I1SA 1L0OC 4EM2A 3RYPA 4OINF 5A2QK 3GFMA 2YX4A 1J2XA 4RAZA 3IC7A 2FNPA 4OOIA 1O3TA 3EDPA 1R5HA 2VBZA 3IWZA 3ZMVA 1ZHFA 1O3RA 4FX4A 3RYRA 3G3ZA 2NNYA 2ZJ2A 1CF7B 1ON2A 1J59A 2ZMEB 4BQAA 4EMSA 4LG0A 3IL2A 4BNCA 2XGXA 2YPRA 5D8KB 5BPDA 5DD8A 1ZRDA 3KP3A 2Y0MA 3T0YA 2KIUA 2L4AA 5D6EA 4LLLA 2PEXA 4EJTA 3DF8A 4O6JA 3SZTA 2Z33A 4UXNA 1E2XA 2JTVA 3MAJA 4Z2YA 4HDUA 4N9HA 3B02A 4EV0A 4P9UA 1H0MA 4M9XA 3IRQA 4MNUA 2TDXA 4PGHA 1GXPA 1QQIA 1R58A 2PN6A 1R22A 2EFOA 1W5SA 2X0LA 4WXCA 4ENNA 5D5VB 2GA2A 3JW4A 3V7SA 4L0ZB 2EK5A 4ETSA 3F23A 2E7XA 5FGMA 2V79A 1R23A 4OIOF 5DCFA 2VC1A 1KU7A 2Q0OA 4ZH4F 3O2PE 3DXJF 3R6SA 5D8LB 3FMQA 1HXDA 1XDSA 3R0JA 2XVCA 4YFXF 4KYWA 1TNSA 3ELKA 3WTYC 3VODA 1IN6A 2QBYA 4A2UA 3BJOA 2K4BA 2V9VA 1MD0A 3JSPA 2DO7A 3VEPA 3DQVC 1T2KA 4UVBA 1WQ2A 1TQIA 2Q2EA 1YQAA 3ZP5A 4ENJA 3R4KA 2EV6A 1ZAOA 1Z05A 3E3VA 1SMTA 5F6FA 1J9IA 1IZ1A 2X4HA 1RI7A 1LJ9A 3ABTA 2XRNA 1YG2A 5CJ9A 3P9CA 2HYFA 2F2EA 3E6CC 3LA7A 4UVCA 3KP2A 3ZPLA 4KIBA 3WTTC 3HIFA 2XAQA 5D4SA 4HF2A 3CO7C 2Z5UA 3WTXC 2QQAA 4MTDA 4A12A 2IW5A 2KIFA 3F8CA 3BPXA 4UHTA 2P5LC 1XGSA 1BBYA 1I1GA 3NQOA 4IHTA 3WODF 3TOAA 3QP5A 3GW2A 4OU0A 1OPCA 3L00A 1IXCA 3HUGA 2VE8A 2H09A 1K7AA 4BH9A 4ZYDA 3CJNA 3GZ5A 1BI2A 3P9KA 3L09A 2A68F 3SHFA 1LNWA 1YS6A 1FZPB 3J81K 2HTSA 2P6TA 3TOBA 3M7GA 2EFWA 3KLNA 5H6QA 3TQNA 3FMRA 5HLGA 3D0SA 4RGXA 5JVTA 3T8TA 2BYVE 2CFXA 2QBYB 1ZRFA 3E6DA 3HYIA 3WTUC 2PFBA 2EA4A 4EJVA 1T38A 2OAZA 2EFQA 3HOTA 1IN4A 2MLGA 3LQRA 4NB5A 1V4RA 1LEAA 1AOYA 3RKYA 4KMUX 1Z1DA 4KNYA 5L3GA 3KEQA 3IHUA 1ZG3A 3SZPA 3U9GA 5FFXA 5L3FA 5LEKA 5DYMA 3JAMK 4HYEA 5F64A 4N9IA 4ESFA 2FQ3A 2W84A 3O3KA 3LA2A 2FF4A 3F8BA 5IT9Z 2FBIA 1W7PB 3E6BA 3IWFA 2FA5A 3FF5A 3F72A 3ZMTA 1H9TA 1TNTA 3FZVA 3I5UA 1P4AA 2QYOA 4HF1A 3NRVA 3BDDA 4A5MA 1FLIA 3P9IA 1WWXA 3HSRA 2R7FA 4KT5C 4JQFA 1FBSA 3MCZA 2XIGA 4IVNA 2DFIA 2IA2A 3WTSC 2CWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW7 A;  3MQ0 A;  4IRG A;  3ZN1 A;  1V3F A;  3MFK A;  2FSW A;  4OIQ F;  2D1V A;  1HW2 A;  2IRF G;  1KU2 A;  2HEO A;  2PJP A;  1HST A;  2ACJ A;  3I53 A;  4RB3 C;  1YLF A;  4LK0 F;  2P8T A;  2HKX A;  2IA0 A;  1W7P D;  1W5T A;  3EUH A;  2KJB A;  2Y48 A;  4YIF A;  3G73 A;  1MJB A;  3J80 K;  4BHC A;  2XAJ A;  2F5E A;  1BM9 A;  2ESH A;  2JRT A;  2RDP A;  4B09 A;  1FYK A;  4PZJ A;  4JK1 X;  3ABU A;  4MTE A;  1CGP A;  1FC3 A;  3LST A;  1OR7 A;  2HGC A;  3R61 A;  2DW4 A;  3HRU A;  2VOO A;  2E7W A;  1MJ9 A;  2DT5 A;  3F8N A;  1WKM A;  4ESJ A;  2P7V B;  4HV6 A;  1ZRE A;  1JGS A;  4HX7 A;  1J0R A;  4UV8 A;  1TQP A;  3GEZ A;  3KP7 A;  4HX8 A;  4PDK A;  2FBK A;  4CYD A;  2HQR A;  2EB7 A;  4OIR F;  1S6L A;  4KFC A;  1BI0 A;  4I98 B;  1BC8 C;  1IW7 F;  4PCQ A;  4EGY A;  3DP7 A;  4LJZ F;  1K78 B;  4O3M A;  1BIB A;  5D5U B;  1KYW A;  1BC7 C;  2HKO A;  1MKM A;  5H6R A;  2VXZ A;  2NNN A;  4H0E A;  1HKS A;  5LBQ A;  2VON A;  5DV5 A;  3LAJ A;  4HA8 A;  3CUQ A;  1F9N A;  1U5T A;  1UB9 A;  3RDI A;  4EJU A;  1F1Z A;  3F8F A;  4BYY A;  1R00 A;  4HLX A;  2WWY A;  4RGS A;  3MEX A;  2NRA C;  1LEB A;  1B1B A;  4EVI A;  1KYZ A;  2ZBK A;  4FT8 A;  4HOB A;  1SD7 A;  2HR3 A;  4LK1 F;  3QRF F;  2O3F A;  3GFL A;  2MA3 A;  3H3Z A;  3BZ6 A;  5D5X B;  3I64 A;  4S05 A;  2PLY A;  3ZMZ A;  2Q8K A;  3N97 A;  3ECH A;  1Y0U A;  5HLH A;  1STZ A;  4OIP F;  4Y17 A;  1EH6 A;  3RI4 A;  1MDM A;  2O03 A;  3ZMU A;  1U2W A;  3PFI A;  3FXQ A;  2MH2 A;  3EYI A;  1WRJ A;  4EGZ A;  2ZKZ A;  2J5O A;  2L3D A;  2FE3 A;  1TQM A;  5FB2 A;  4WWC A;  4XLN F;  3FWE A;  2DU9 A;  3WE2 A;  2DLL A;  3C1D A;  4IPA A;  3Q9V A;  2CO5 A;  4LFU A;  2V1D A;  4N0B A;  3GF2 A;  5ILU A;  1JHH A;  2W57 A;  1SD6 A;  3D5L A;  2D1H A;  2HOE A;  3QU6 A;  3M9A A;  3KCC A;  3S2W A;  1HW5 A;  4HBL A;  1I5Z A;  3L2C A;  3GFI A;  1TTY A;  3JTH A;  1RNL A;  1JE8 A;  2EA2 A;  3TO9 A;  3F3X A;  2OD5 A;  2F5C A;  3K1M A;  1QZZ A;  3K1N A;  1D5V A;  2JT1 A;  4KDP A;  3CUQ B;  3LQQ A;  1G3T A;  2EV0 A;  3HRS A;  4YFN F;  4P96 A;  2GQQ A;  3T1B A;  1T0F A;  4A0Z A;  2A6E F;  2M5W A;  4Q4Z F;  1KQ8 A;  3RTR A;  3F6O A;  1YW9 A;  2DTR A;  5FLX Z;  2Z99 A;  1ZH5 A;  4ON0 A;  3QU3 A;  5TJJ A;  3OV8 A;  2RQP A;  3AAF A;  2FMY A;  1YIO A;  4WCG A;  4I09 A;  3I59 B;  2G7U A;  1MDM B;  3ZMS A;  3FHZ A;  5J6X A;  1E17 A;  3CDH A;  1WI9 A;  2GIV A;  5K5Q A;  2QVO A;  1T6S A;  2DQL A;  2QUF A;  1FSE A;  1P92 A;  2L01 A;  1ZGA A;  2HTJ A;  1Z9C A;  2NAZ A;  5HLI A;  1C0W A;  1U6G A;  1LQ1 A;  1DPR A;  1SFU A;  4HQE A;  3BPV A;  2KKO A;  1QNT A;  5DDG A;  3CUO A;  4GYG A;  3GLX A;  1K79 A;  1IUY A;  2A61 A;  4CDG A;  2HWV A;  3I54 A;  4XLP F;  4U0W A;  3BOQ A;  4HDV A;  1GHC A;  4OMZ A;  4AIH A;  4YG2 F;  4UV9 A;  3VFZ A;  2XAF A;  5L3C A;  4WF2 A;  1IAW A;  3RKW A;  1EH7 A;  3WGG A;  4WX9 A;  1SAX A;  3DFG A;  2BBY A;  1ZN2 A;  4LG0 B;  5ICE A;  1J5Y A;  4LLG F;  3BJ6 A;  4Y15 A;  1LDD A;  4U0V A;  4QWQ A;  3CLO A;  3SFZ A;  1GXQ A;  4HF0 A;  3COA C;  1MGT A;  3E5X A;  2WV0 A;  1XDU A;  2BEO A;  3W6K B;  3WGH A;  4NQW A;  4MEX F;  1AWC A;  2K86 A;  1TLH B;  4M73 A;  1EH8 A;  4A6E A;  2G9W A;  2DPU A;  4JBA A;  3CUQ C;  5LGT A;  1U5T C;  2OU2 A;  3HOS A;  4XSZ F;  5DEQ A;  2QQB A;  5BOX A;  2NS0 A;  3WU0 A;  1IF1 A;  2VBY A;  3QAH A;  3F6V A;  1YYV A;  4AIJ A;  1LB2 A;  2DQR A;  2DK8 A;  1O7F A;  1O3S A;  2Z9O A;  1SFE A;  2FBH A;  1LDK B;  1UFM A;  2F5D A;  2JZY A;  4BAY A;  4G7O F;  4S04 A;  2EFP A;  4CHU A;  4R79 A;  4NHJ A;  4L0Y B;  5LGU A;  2D45 A;  1T98 A;  3ROU A;  3U1D A;  1LVA A;  3W6J B;  1H9G A;  2FNA A;  5AIP A;  3ULQ B;  4L5I A;  2RGV A;  3C7J A;  2VOP A;  2BGC A;  1RUN A;  4EJO A;  2YX7 A;  2M30 A;  2VBW A;  2OA4 A;  1B4A A;  5LHI A;  3E6M A;  1DUX C;  1PUE E;  1RUO A;  5DCM A;  5A2Q Z;  1IN5 A;  4RB1 A;  1FYL A;  3J7A O;  2V6C A;  5CVR A;  3O6B B;  3JSO A;  2FU4 A;  1S8N A;  2ETH A;  3CO6 C;  4A0Y A;  2DI3 A;  3WTV C;  2H94 A;  2HS5 A;  4CXF A;  1F5T A;  2FOK A;  2WTE A;  1RIO H;  1QO0 D;  4WXH A;  1S7A A;  2CW0 F;  1PP7 U;  4P9F A;  2PMH A;  3KZY A;  3IKV A;  2ZCW A;  3DKW A;  1ZRC A;  2PI0 A;  3QOP A;  4XRF A;  2A69 F;  1HKT A;  3E5U A;  3JTG A;  2FRH A;  1J7K A;  1XMA A;  2Z3Y A;  1ZGJ A;  2B0L A;  2OZU A;  3VB2 A;  1FBQ A;  1ZAR A;  4EM0 B;  3TO7 A;  1RZ4 A;  2HZT A;  4U88 A;  2IP2 A;  5BPI A;  2XAH A;  1P4W A;  5HDK A;  1O57 A;  1ZG1 A;  5L3E A;  3V8J A;  5E1W A;  4LGW A;  4GXO A;  4RS8 A;  1XB4 A;  1KQ0 A;  2O6G E;  5E8I A;  2HYG D;  2QEN A;  2XAS A;  2P7C B;  4KN4 X;  3R0A A;  1DPU A;  5D6F A;  2GXG A;  2QWW A;  5LLQ A;  5FO5 A;  3QP6 A;  5LEJ A;  4G8X A;  1SD4 A;  3K0L A;  4P5O A;  1G6N A;  3BRO A;  1FPQ A;  2UXN A;  4Q47 A;  2PBI A;  4G7H F;  2O61 A;  3H92 A;  1ON1 A;  2H6C A;  1X3U A;  5HOO A;  4KA4 A;  1S3J A;  2P5K A;  4LMY A;  1Z7U A;  4ESB A;  3GYH X;  3KP5 A;  2MH9 A;  2LKP A;  1XMK A;  1KQ9 A;  2BE5 F;  4KIF A;  4M6Y A;  4MGR A;  4IRH A;  5IT3 A;  3GZ6 A;  3ML6 A;  3GX4 X;  4D0P A;  4L9N A;  3K1P A;  1OYY A;  5ICC A;  4B8X A;  4LD5 A;  4EM1 A;  1KU9 A;  3M8E A;  4L18 B;  1S7O A;  1ONV A;  2RV8 A;  2ZNZ A;  2AS5 F;  2LDU A;  3HHH A;  3E97 A;  4LB5 A;  2ZO4 A;  4G6Q A;  4IJA A;  4U0Y A;  1G4D A;  3FXR A;  1FP1 D;  1SD5 A;  2GZW A;  5HDN A;  4L5J A;  4GCV A;  4UNO A;  1BI1 A;  3V7R A;  1K6O A;  4IXA A;  2QQ9 A;  1O3Q A;  2EWN A;  5E17 F;  3GXO A;  4YFK F;  4M72 A;  2K4J A;  3OOP A;  2E1N A;  4ASN A;  1B6A A;  4Q5S F;  4WXD A;  1I27 A;  1UST A;  2LNB A;  2GA1 A;  2L02 A;  2M8E A;  1XSX A;  5LRS A;  3T8R A;  2IT0 A;  2BV6 A;  1XGM A;  5D4R A;  4L9J A;  3KLO A;  1CF7 A;  4RB2 C;  2HQN A;  2ZME A;  5J8C A;  2EJR A;  2ELH A;  2GAU A;  4HQM A;  5CLS A;  4IHS A;  3MZH A;  4G94 A;  5KVR A;  4WK8 F;  3GWZ A;  3KE2 A;  4U7D A;  1Z91 A;  2HFH A;  2AXL A;  4HZF A;  4ZYH A;  2ZFW A;  4KIC A;  1W4M A;  2VC0 A;  1D8K A;  3F21 A;  2L4M A;  1EV7 A;  4G6D A;  3NEU A;  3J81 Z;  2IA1 A;  3GUD A;  3RJP A;  3RKX A;  2IVM A;  5JR3 A;  2ADU A;  3WG9 A;  2G7H A;  3HRT A;  4K2E A;  4CIC A;  3GVA A;  4RAY A;  1R7J A;  3IRR A;  3BJA A;  5TRD A;  4A0X A;  1YFH A;  3T5X A;  1UCR A;  1IXR C;  1MZB A;  3MZY A;  2LF7 A;  5ERI A;  1R36 A;  3HHG A;  5HS7 A;  2D2W A;  4EJW A;  2RNJ A;  1L3L A;  5EEH A;  4KMF A;  2CGP A;  5HDG A;  3I71 A;  3JAM Z;  3LAP A;  2ISZ A;  1T39 A;  3FM3 A;  4ZYG A;  5E1X A;  4LLN A;  2OBP A;  1U5T B;  4I01 A;  1JXS A;  2A6H F;  1XCV A;  2XKP A;  4GGG A;  1XN7 A;  2H6B A;  2M87 A;  5E1Z B;  5IT9 K;  1FY7 A;  2OZ6 A;  3PQJ A;  1FSH A;  4UVA A;  5CVU A;  4CGZ A;  2UWM A;  3HTU A;  2RVC A;  2YU3 A;  3SXY A;  1OMI A;  2P4W A;  1D3Y A;  3HSF A;  4R8H A;  3PQK A;  4RGU A;  1R1U A;  3HSE A;  2V1X A;  2STW A;  2KRF A;  4TV7 A;  4I0B A;  1KU3 A;  4QLC U;  1FT9 A;  2CYY A;  5DD4 A;  3TGN A;  3J80 Z;  1OYI A;  1XGO A;  4AD9 A;  4L9V A;  2COM A;  1ZG5 A;  1XCB A;  1A04 A;  5LGN A;  1R5G A;  1ZYR F;  1ULY A;  2NYX A;  1R1T A;  4M71 A;  1TBX A;  2P6S A;  3DV8 A;  3ZN0 A;  3U2R A;  1ZLK A;  2VN2 A;  3V8K A;  4HLY A;  1XD7 A;  1IXS B;  4Q48 A;  4BHP A;  2Y75 A;  2C6Y A;  2XV4 S;  2HDC A;  4I0A A;  1FOK A;  1YTY A;  2MD5 A;  4KIG A;  5AON A;  4MQV A;  1IN7 A;  5CYV A;  3WU1 B;  3FM5 A;  5LRR A;  4ENK A;  2MLK A;  2QLZ A;  5AIQ A;  3L7W A;  1HQC A;  5KK1 A;  1BOA A;  3GFJ A;  4ZYE A;  4DNC A;  3H3U A;  2PG4 A;  3LWF A;  1YW8 A;  5CVV A;  3I4P A;  2DAO A;  2FML A;  1G3W A;  3QPT A;  1W7P A;  4OMY A;  1SMY F;  2EFN A;  3N4M A;  1F4K A;  4CZZ A;  1QBJ A;  4GO1 A;  2W25 A;  4R1H A;  3WGI A;  5E18 F;  4KUM A;  1OYW A;  3Q5F A;  3RIR A;  3FXU A;  1B59 A;  5HVQ C;  3F22 A;  1FYM A;  4L9T A;  2M45 A;  5JI6 A;  4M9Z A;  4MEY F;  1FNN A;  4HV5 A;  5D5W B;  1PP8 F;  5BMZ A;  1IN8 A;  4I7H A;  2K02 A;  3KP6 A;  2V1U A;  4BXU A;  4F7Z A;  2FEZ A;  1HSJ A;  5J8F A;  4HX4 A;  4RB0 A;  3V8L A;  1OKR A;  3RPQ A;  1USS A;  5HS9 A;  2PQ8 A;  3M8F A;  2M1B A;  5L3B A;  2JPC A;  3B73 A;  2XUB A;  2CG4 A;  2PMU A;  2KJC A;  3P7N A;  2J5P A;  4LB6 B;  1WSU A;  5H20 A;  5BS6 A;  2F5F A;  3ISP A;  1P6R A;  3LFK A;  5ILS A;  5DUK A;  1XSD A;  2FXA A;  2DPD A;  3DPL C;  4M6X A;  4YII A;  1DP7 P;  2UXX A;  2IPQ X;  3REO A;  1B9M A;  4G9Y A;  2OQR A;  5DUI A;  1IRG A;  4MQ9 F;  1UHW A;  5ILV A;  2H27 A;  2WC2 A;  1BIA A;  1G3Y A;  1Z6T A;  2XHK A;  1P4X A;  2A07 F;  2VT3 A;  2DBB A;  1Q1H A;  2GWR A;  4M74 A;  1S29 A;  4O5V A;  4I2O A;  2DK5 A;  1TW3 A;  3EYY A;  1K78 A;  4A5N A;  2VBX A;  2VT2 A;  2JSC A;  3KFW X;  3M1E A;  2STT A;  5K5O A;  3FMS A;  5FLX K;  3HRM A;  1P2F A;  4KN7 X;  3CTA A;  2A3S A;  5ED4 A;  2LSO A;  2W24 A;  3V4G A;  3KP4 A;  3WTW C;  1BJA A;  2RN7 A;  2CSO A;  3DEU A;  2O8X A;  4MHG A;  1B9N A;  2QZ8 A;  3R60 A;  1IRF A;  1BI3 A;  3KET A;  1KGS A;  3MWM A;  2XAG A;  3F8M A;  1QPM A;  1YS7 A;  4HAM A;  2OQG A;  2GXB A;  4U7B A;  1HW1 A;  4IRI A;  3C18 A;  3ZQ7 A;  4RGR A;  5E20 A;  3BY6 A;  6PAX A;  5DCM B;  1REP C;  4PGG A;  2KIM A;  5FD6 A;  3BWG A;  3SQN A;  1BN5 A;  3WTZ A;  3K69 A;  3I58 A;  4EQQ A;  1XSV A;  3WE3 A;  5E8G A;  1SFX A;  1QZY A;  1FWZ A;  2CQK A;  1XGN A;  1MJA A;  2IJL A;  3GO5 A;  4P55 A;  3EET A;  2XRO A;  1I6X A;  1VTN C;  1J75 A;  3I0T A;  1YO5 C;  4AIK A;  2LF8 A;  2RKH A;  4A6D A;  3DPT A;  3KZZ A;  3TDZ C;  2E1C A;  2L54 A;  4XBF A;  4UUV A;  4ZZD A;  2ZXJ A;  3TKY A;  4M9S A;  3EQL F;  3VOE A;  2R7D A;  1G3S A;  5FFZ A;  5F1R A;  3K9T A;  2ZNY A;  1QGP A;  2MC3 A;  2O0Y A;  2YR2 A;  3FX3 A;  3TDU C;  5K5R A;  4ENM A;  1R1V A;  1JHF A;  4AWX B;  2VOD A;  1U8R A;  1LDJ A;  2ISY A;  3QPH A;  5EEG A;  1U3E M;  1ZLJ A;  3E5Q A;  2UZK A;  3ECO A;  3IKT A;  2EV5 A;  4E70 A;  5BQT A;  3BP8 A;  3K2Z A;  4GYI A;  2VE9 A;  5LHG A;  4FX0 A;  4CO8 A;  1D8J A;  3LA3 A;  5CVI A;  1ODD A;  5L3D A;  1FP2 A;  3L9F A;  1NHA A;  3ZMD A;  1GVJ A;  2W85 A;  5ICF A;  2P5V A;  4Y13 A;  1DDN A;  3Q9S A;  4I02 A;  1FBU A;  3ERE D;  1HBX G;  2YSR A;  3TO6 A;  1FX7 A;  4BHB A;  1O7L A;  5HS8 A;  3I59 A;  2QM3 A;  5LHH A;  3V7C A;  2RC4 A;  5FD5 A;  5K1Y A;  4AVP A;  3C3W A;  1Z6R A;  4HW0 A;  1PDN C;  2K27 A;  1HKQ A;  5CVJ A;  2MBF A;  4IF4 A;  2XKO A;  4G7Z F;  2ESN A;  2JPB A;  2R3S A;  4XSX F;  1KA8 A;  3HTS B;  4ZZL A;  2K7L A;  4FHT A;  1UHM A;  3RPU A;  3KEO A;  5JFR A;  5ICG A;  4DQ2 A;  1U78 A;  1TW2 A;  5JHU A;  2A5Y B;  1I1S A;  1L0O C;  4EM2 A;  3RYP A;  4OIN F;  5A2Q K;  3GFM A;  2YX4 A;  1J2X A;  4RAZ A;  3IC7 A;  2FNP A;  4OOI A;  1O3T A;  3EDP A;  1R5H A;  2VBZ A;  3IWZ A;  3ZMV A;  1ZHF A;  1O3R A;  4FX4 A;  3RYR A;  3G3Z A;  2NNY A;  2ZJ2 A;  1CF7 B;  1ON2 A;  1J59 A;  2ZME B;  4BQA A;  4EMS A;  4LG0 A;  3IL2 A;  4BNC A;  2XGX A;  2YPR A;  5D8K B;  5BPD A;  5DD8 A;  1ZRD A;  3KP3 A;  2Y0M A;  3T0Y A;  2KIU A;  2L4A A;  5D6E A;  4LLL A;  2PEX A;  4EJT A;  3DF8 A;  4O6J A;  3SZT A;  2Z33 A;  4UXN A;  1E2X A;  2JTV A;  3MAJ A;  4Z2Y A;  4HDU A;  4N9H A;  3B02 A;  4EV0 A;  4P9U A;  1H0M A;  4M9X A;  3IRQ A;  4MNU A;  2TDX A;  4PGH A;  1GXP A;  1QQI A;  1R58 A;  2PN6 A;  1R22 A;  2EFO A;  1W5S A;  2X0L A;  4WXC A;  4ENN A;  5D5V B;  2GA2 A;  3JW4 A;  3V7S A;  4L0Z B;  2EK5 A;  4ETS A;  3F23 A;  2E7X A;  5FGM A;  2V79 A;  1R23 A;  4OIO F;  5DCF A;  2VC1 A;  1KU7 A;  2Q0O A;  4ZH4 F;  3O2P E;  3DXJ F;  3R6S A;  5D8L B;  3FMQ A;  1HXD A;  1XDS A;  3R0J A;  2XVC A;  4YFX F;  4KYW A;  1TNS A;  3ELK A;  3WTY C;  3VOD A;  1IN6 A;  2QBY A;  4A2U A;  3BJO A;  2K4B A;  2V9V A;  1MD0 A;  3JSP A;  2DO7 A;  3VEP A;  3DQV C;  1T2K A;  4UVB A;  1WQ2 A;  1TQI A;  2Q2E A;  1YQA A;  3ZP5 A;  4ENJ A;  3R4K A;  2EV6 A;  1ZAO A;  1Z05 A;  3E3V A;  1SMT A;  5F6F A;  1J9I A;  1IZ1 A;  2X4H A;  1RI7 A;  1LJ9 A;  3ABT A;  2XRN A;  1YG2 A;  5CJ9 A;  3P9C A;  2HYF A;  2F2E A;  3E6C C;  3LA7 A;  4UVC A;  3KP2 A;  3ZPL A;  4KIB A;  3WTT C;  3HIF A;  2XAQ A;  5D4S A;  4HF2 A;  3CO7 C;  2Z5U A;  3WTX C;  2QQA A;  4MTD A;  4A12 A;  2IW5 A;  2KIF A;  3F8C A;  3BPX A;  4UHT A;  2P5L C;  1XGS A;  1BBY A;  1I1G A;  3NQO A;  4IHT A;  3WOD F;  3TOA A;  3QP5 A;  3GW2 A;  4OU0 A;  1OPC A;  3L00 A;  1IXC A;  3HUG A;  2VE8 A;  2H09 A;  1K7A A;  4BH9 A;  4ZYD A;  3CJN A;  3GZ5 A;  1BI2 A;  3P9K A;  3L09 A;  2A68 F;  3SHF A;  1LNW A;  1YS6 A;  1FZP B;  3J81 K;  2HTS A;  2P6T A;  3TOB A;  3M7G A;  2EFW A;  3KLN A;  5H6Q A;  3TQN A;  3FMR A;  5HLG A;  3D0S A;  4RGX A;  5JVT A;  3T8T A;  2BYV E;  2CFX A;  2QBY B;  1ZRF A;  3E6D A;  3HYI A;  3WTU C;  2PFB A;  2EA4 A;  4EJV A;  1T38 A;  2OAZ A;  2EFQ A;  3HOT A;  1IN4 A;  2MLG A;  3LQR A;  4NB5 A;  1V4R A;  1LEA A;  1AOY A;  3RKY A;  4KMU X;  1Z1D A;  4KNY A;  5L3G A;  3KEQ A;  3IHU A;  1ZG3 A;  3SZP A;  3U9G A;  5FFX A;  5L3F A;  5LEK A;  5DYM A;  3JAM K;  4HYE A;  5F64 A;  4N9I A;  4ESF A;  2FQ3 A;  2W84 A;  3O3K A;  3LA2 A;  2FF4 A;  3F8B A;  5IT9 Z;  2FBI A;  1W7P B;  3E6B A;  3IWF A;  2FA5 A;  3FF5 A;  3F72 A;  3ZMT A;  1H9T A;  1TNT A;  3FZV A;  3I5U A;  1P4A A;  2QYO A;  4HF1 A;  3NRV A;  3BDD A;  4A5M A;  1FLI A;  3P9I A;  1WWX A;  3HSR A;  2R7F A;  4KT5 C;  4JQF A;  1FBS A;  3MCZ A;  2XIG A;  4IVN A;  2DFI A;  2IA2 A;  3WTS C;  2CWE A; 
#chains in the Genus database with same CATH topology
 3FBN B;  2JA7 J;  1YW7 A;  3MQ0 A;  4IRG A;  1APL C;  2W82 A;  4PJL A;  3HKZ N;  3WU2 C;  4A69 C;  1VQ8 I;  3ZN1 A;  1WH7 A;  1WJC A;  1U9N A;  4B43 A;  1V3F A;  3MFK A;  3PJR A;  2FSW A;  2RQQ A;  4OIQ F;  1TWA J;  2D1V A;  1HW2 A;  1I39 A;  2LRD A;  3HUG B;  4XIC A;  2IRF G;  2WAE A;  1KU2 A;  4JX5 A;  2HEO A;  1SFK A;  2PJP A;  3JCU C;  5LD2 C;  3A0B C;  1HST A;  5DS9 A;  2ACJ A;  3I53 A;  4RB3 C;  1YLF A;  4LK0 F;  2P8T A;  3S1M J;  4EAT A;  2HKX A;  2IA0 A;  4E6K G;  1W7P D;  2IS1 A;  1W5T A;  3EUH A;  2KJB A;  3FXL A;  2Y48 A;  4YIF A;  1YRN B;  2GLO A;  1WPK A;  3G73 A;  1X2M A;  4IHX A;  2ICW G;  1HDP A;  1NTC A;  1MJB A;  1R6R A;  3J80 K;  4BHC A;  2M0C A;  2XAJ A;  3AKZ A;  2LKX A;  3KX2 A;  2F5E A;  2WBM A;  1BM9 A;  2CQX A;  2ESH A;  2JRT A;  3PO2 J;  2RDP A;  1B8I B;  4B09 A;  2M8G X;  1FYK A;  5EYR A;  2HXI A;  5EZH A;  4PZJ A;  3TL4 X;  2HOT A;  4DOZ A;  4JK1 X;  3ABU A;  4MTE A;  2UV1 A;  5IP9 J;  1CGP A;  1FC3 A;  2LY9 A;  3LST A;  1OR7 A;  3IH3 A;  2HGC A;  3R61 A;  4E7J A;  1JJ6 C;  1BJZ A;  2DW4 A;  3HRU A;  2VOO A;  2E7W A;  1MJ9 A;  3ABL H;  4M3E A;  9ANT A;  2DT5 A;  3F8N A;  1WKM A;  4ESJ A;  2KDO A;  2P7V B;  2XGE A;  1T95 A;  2XPU A;  1I3A A;  3CMM A;  1WJ5 A;  2BHZ A;  4HV6 A;  3LNQ A;  3OOU A;  1ZRE A;  3A02 A;  1JGS A;  4HX7 A;  4MO7 A;  1FOW A;  2R7X A;  2X85 A;  1J0R A;  3BT9 A;  4UV8 A;  4XN3 A;  1TQP A;  3NAR A;  2EIK H;  3GEZ A;  3HOZ J;  1XPX A;  1ZR2 A;  1AU7 A;  3KP7 A;  4HX8 A;  4PDK A;  4V2G A;  2FBK A;  4CYD A;  3GTJ J;  3CCV I;  2HQR A;  1Z21 A;  2EB7 A;  4OIR F;  5GAH J;  1S6L A;  4KFC A;  1BI0 A;  4IX7 A;  5GP9 A;  4A3E J;  4I98 B;  5TGT A;  2CW8 A;  1BC8 C;  1IW7 F;  4PCQ A;  3O8G A;  4EGY A;  1VZ0 A;  2DFE A;  2GOX B;  3DP7 A;  4LJZ F;  1K78 B;  4O3M A;  1BIB A;  2OCC H;  3EUK L;  3WG7 H;  5D5U B;  2K9M A;  1KYW A;  1BC7 C;  2DMT A;  3OS0 A;  2HKO A;  1MKM A;  5H6R A;  3EPZ A;  3C2B A;  3K7A J;  3QYE A;  5B1A H;  2VXZ A;  3H35 A;  2NNN A;  5IYC J;  5E3M A;  1H8A C;  4H0E A;  4BQQ A;  1HKS A;  5LBQ A;  2VON A;  4JYK A;  2FJ1 A;  5DV5 A;  3LAJ A;  4HA8 A;  3CUQ A;  2JUG A;  3ABM H;  4IO9 F;  3GTQ J;  1F9N A;  1U5T A;  1UB9 A;  3H9Q A;  3RDI A;  1P9Q C;  4EJU A;  1F1Z A;  3F8F A;  4BYY A;  1R00 A;  4HLX A;  2WWY A;  3GZN B;  4RGS A;  3MEX A;  2NRA C;  1LEB A;  1B1B A;  1Y0N A;  4EVI A;  2NVQ J;  4BDY A;  3Q0U A;  1KYZ A;  3KYL A;  2DJN A;  2ZBK A;  2B7E A;  4FT8 A;  3OSF A;  4HOB A;  3CMY A;  1SD7 A;  2HR3 A;  4LK1 F;  3QRF F;  2O3F A;  1UZC A;  4C30 A;  4AM3 A;  1AKH A;  3DLA A;  3GFL A;  4BBR J;  4FCY A;  1R9T J;  2VKV A;  2MA3 A;  3H3Z A;  3K70 D;  3BZ6 A;  1IDY A;  5D5X B;  3F9K A;  3I64 A;  4S05 A;  3OYF A;  2PLY A;  3ZMZ A;  2Q8K A;  4RM2 A;  1S7E A;  3FKJ A;  1S5L C;  3N97 A;  3ECH A;  2LP0 A;  1Y0U A;  5HLH A;  1STZ A;  1JGG A;  3S16 J;  4OIP F;  2JA2 A;  4Y17 A;  1EH6 A;  2WB1 A;  3RI4 A;  2AQE A;  3PL8 A;  1MDM A;  2JA5 J;  1T33 A;  5BNG A;  2O03 A;  3ZMU A;  1U2W A;  3PFI A;  3FXQ A;  1BR2 A;  2MH2 A;  4IHW A;  4A3F J;  3EYI A;  3A2K A;  1WRJ A;  4EGZ A;  3CD6 I;  3S15 J;  4A3C J;  2ZKZ A;  3NAU A;  1PUF A;  3DEW A;  4BDZ A;  2F4I A;  2J5O A;  1NH3 A;  2ZFU A;  2L3D A;  2P81 A;  3DBL B;  4BKX A;  3VSL A;  2DT6 A;  2FE3 A;  4JOM A;  1TQM A;  4BQN A;  2CS3 A;  3G1M A;  3PNV A;  3H3V K;  3S17 J;  3L2Q A;  3BTC A;  5C4J J;  2KLO A;  5FB2 A;  2GOM A;  4WWC A;  4ZTJ A;  4XLN F;  4HNV A;  3FWE A;  1N25 A;  2CU7 A;  2DU9 A;  1JTX A;  4RLF A;  3WE2 A;  4BU2 A;  2F6C A;  1OQY A;  3FK7 A;  1SAU A;  1F43 A;  3LFU A;  2DN0 A;  2OTJ I;  2DLL A;  1VQ6 I;  3MMY B;  3L2V A;  3ZQH A;  3C1D A;  4IPA A;  3BG5 A;  3Q9V A;  2CO5 A;  4LFU A;  1JUM A;  2V1D A;  1JT6 A;  5GPC A;  1W0T A;  4N0B A;  4IZZ A;  3GF2 A;  1MBH A;  1VF9 A;  4KIT B;  5ILU A;  1JHH A;  5KAF C;  2W57 A;  1SD6 A;  2H8W A;  3D5L A;  4BXX J;  2D1H A;  2W7N A;  2HOE A;  3QU6 A;  4XQF A;  3M9A A;  4GDF A;  3KCC A;  3S2W A;  3CLQ A;  1HW5 A;  4HBL A;  1I5Z A;  3L2C A;  2EZH A;  3GFI A;  1IJW C;  1TTY A;  3JTH A;  1ZGW A;  1RNL A;  1JE8 A;  2EIM H;  2RAE A;  3ZR8 X;  2EA2 A;  3CJT B;  3ASN H;  3F3X A;  3GME A;  4XLA A;  3TO9 A;  2OD5 A;  2F5C A;  3HJE A;  1QZZ A;  3K1M A;  3KPH A;  3PUB A;  3ZCO A;  3W3C A;  4D1Q A;  2HZD A;  3RQ4 A;  3K1N A;  1D5V A;  2JT1 A;  2R4G A;  4KDP A;  2JJ7 A;  2XPW A;  5EJC A;  3CUQ B;  2LY1 A;  3K70 C;  1VQ5 I;  1NG7 A;  3DTK A;  3LQQ A;  1G3T A;  2EV0 A;  3HRS A;  4YFN F;  4P96 A;  4CSW A;  2GQQ A;  4PSW A;  3T1B A;  3OYB A;  1T0F A;  4A0Z A;  2A6E F;  2M5W A;  4Q4Z F;  1GDT A;  1MW7 A;  1KQ8 A;  1MH4 A;  4HNT A;  3RTR A;  5J4Y A;  5DM6 F;  2IAI A;  3F6O A;  4I6Z A;  1YW9 A;  2DTR A;  5FLX Z;  1V5E A;  2Z99 A;  3BG3 A;  5IY5 H;  2YUS A;  1ZH5 A;  4ON0 A;  2DA6 A;  3QU3 A;  3V42 A;  2JWT A;  3OV8 A;  1Z3Y A;  3K4N A;  5TJJ A;  3MN2 A;  1W1W E;  4JP0 A;  2G0E A;  1QRY A;  2RQP A;  3AAF A;  2FMY A;  4GRI A;  4FE7 A;  1ETX A;  1YIO A;  1NG6 A;  4HG2 A;  4X6A J;  4WCG A;  4I09 A;  3I59 B;  2JMW A;  4YRV A;  2NVX J;  2G7U A;  4F93 B;  1EF4 A;  4UB8 C;  2AXT C;  3WHB A;  5IYB J;  1VFC A;  3ZMS A;  1MDM B;  2MG4 A;  1CQT A;  3BQY A;  4OAY A;  3FHZ A;  2VL8 A;  2DMU A;  5J6X A;  1E17 A;  4A93 J;  2E2I J;  2VJJ A;  2JK3 A;  3CDH A;  1OLT A;  2Y31 A;  3KYD B;  1WI9 A;  2GIV A;  1PUF B;  3CF2 A;  4XN0 A;  3S14 J;  1UJ8 A;  2RRE A;  5FKO A;  5K5Q A;  2QVO A;  4CCM A;  3VWB A;  2Y9Z A;  4ZDP A;  1T6S A;  3S3M A;  2DQL A;  4PJM A;  2QUF A;  3DCF A;  2M2E A;  3EUH C;  1FSE A;  5C3E J;  1P92 A;  4J19 A;  4A3I J;  2L01 A;  1KON A;  1OCR H;  1ZGA A;  1ITY A;  2HTJ A;  2H8R A;  1Z9C A;  1SVM A;  1JTY A;  3PNY A;  2NAZ A;  4PJJ A;  2DXI A;  5HLI A;  2NVT J;  2PX9 A;  2WAQ N;  2KIS A;  4LIV A;  1C0W A;  2LG4 A;  4DBR A;  5F08 A;  1U6G A;  1LQ1 A;  3KYC B;  1LVK A;  2QCO A;  1X4O A;  1IRX A;  2ME0 A;  3QPL A;  1DPR A;  3OYK A;  1SFU A;  4HQE A;  1JKQ C;  3BPV A;  1DGR M;  1QNT A;  2CJJ A;  2KKO A;  5DDG A;  3CUO A;  4GYG A;  3HGG A;  3GLX A;  4XLF A;  3OYC A;  1K79 A;  1IUY A;  2A61 A;  1OR7 C;  1Q1V A;  4CDG A;  3CC7 I;  3OR2 C;  3ZQC A;  2HWV A;  3I54 A;  4XLP F;  4U0W A;  3BOQ A;  4HDV A;  1GHC A;  3HBL A;  4OMZ A;  2VJ4 A;  3SEZ A;  4AIH A;  2Q1Z B;  4YG2 F;  1RR7 A;  4UV9 A;  3VFZ A;  2XAF A;  5L3C A;  3W6V A;  3PO3 J;  2ZJP F;  4WF2 A;  1IAW A;  3HC7 A;  2DYS H;  1RES A;  2Y0S N;  1EH7 A;  5B1B H;  3RKW A;  4CCN A;  3WGG A;  5GAG J;  4WX9 A;  3OYA A;  4A3K J;  1SAX A;  3DFG A;  2BBY A;  2COB A;  1ZN2 A;  4LG0 B;  5ICE A;  1J5Y A;  4NC8 A;  3QOE A;  4LLG F;  3BJ6 A;  4Y15 A;  1LDD A;  4U0V A;  4QWQ A;  3CLO A;  3SFZ A;  1GXQ A;  2I10 A;  3OSG A;  4HF0 A;  3COA C;  1VND A;  1MGT A;  3E5X A;  2BY0 A;  1QHG A;  2WV0 A;  1XDU A;  2BEO A;  2LTP A;  3W6K B;  3WGH A;  4Y7N J;  1WJA A;  4NQW A;  1JKR C;  4MEX F;  1AWC A;  2I8D A;  4FE4 A;  2XF6 A;  2K86 A;  1TLH B;  3DPU A;  4M73 A;  1EH8 A;  2PJR A;  3GBG A;  4A6E A;  1R5I D;  1ZQ3 P;  3JRI A;  2G9W A;  2DPU A;  3C2G A;  4JBA A;  3CUQ C;  1BL0 A;  1SFO J;  5LGT A;  2X6O A;  3Q3S A;  1U5T C;  2OU2 A;  3HOS A;  4XSZ F;  3BTJ A;  5DEQ A;  3IAS 2;  2QQB A;  2LK2 A;  4KT6 A;  2KZG A;  2NS0 A;  4HNU A;  3LSP A;  3A01 A;  3WU0 A;  5BOX A;  1IF1 A;  2VBY A;  3CME I;  3QAH A;  4RBO A;  1SEU A;  1WHU A;  3F6V A;  3I3L A;  3HOY J;  1SVL A;  5M3M J;  1YYV A;  4AIJ A;  4E7Z A;  1LB2 A;  3S32 A;  2DQR A;  4UB6 C;  2FD5 A;  2DK8 A;  1O7F A;  2LOO A;  1O3S A;  3LSK A;  4CUG A;  2ZB9 A;  3OIQ A;  2K40 A;  5K7H A;  4C3H J;  2Z9O A;  1SFE A;  2FBH A;  1QA6 A;  4YIR X;  2Y0S A;  3OWT A;  1LDK B;  1UFM A;  2F5D A;  1MBK A;  2JZY A;  4FAS D;  3FHN A;  2VB6 A;  4BAY A;  4G7O F;  2HNH A;  4S04 A;  4P1W A;  4ABZ A;  4CZC A;  4XKV A;  2EFP A;  1Z3X A;  4CHU A;  2NVY J;  4R79 A;  4QTR A;  1IG7 A;  4IL6 C;  1DQU A;  4L0Y B;  4NHJ A;  2HOS A;  5LGU A;  2D45 A;  1T98 A;  2XB0 X;  3ROU A;  3HPH A;  2QKM B;  3WHC A;  3U1D A;  3HEF A;  1LVA A;  4KJZ A;  3W6J B;  1H9G A;  4W97 A;  1ZEL A;  1PVE A;  1GV2 A;  3FXM A;  2FNA A;  4MLO A;  3BG7 A;  5AIP A;  3ULQ B;  2XRL A;  5J1R A;  4L5I A;  2RGV A;  2K85 A;  3C7J A;  2VOP A;  4XNF A;  2BGC A;  1RUN A;  1HC8 A;  4EJO A;  1OIS A;  2YX7 A;  2M30 A;  2DA5 A;  3MKL A;  4ITV A;  2VBW A;  2X48 A;  2OA4 A;  3K4L A;  1B4A A;  1R4N B;  2K3F A;  5LHI A;  3E6M A;  1DUX C;  1PUE E;  4QPO A;  4IQ4 A;  1RUO A;  5DCM A;  2W1O A;  2VXD A;  5A2Q Z;  1IN5 A;  4RB1 A;  1FYL A;  2MW8 A;  3J7A O;  2V6C A;  5CVR A;  4C9Y A;  1AA7 A;  3O6B B;  2E36 A;  3JSO A;  2Q2E B;  2FU4 A;  1S8N A;  2EIN H;  3ZQF A;  2X1D A;  2XC7 A;  1MMN A;  1X1P A;  2ETH A;  3A0H C;  3CO6 C;  3L2W A;  4A0Y A;  2DI3 A;  3WTV C;  2H94 A;  2HS5 A;  1X1A A;  4F52 A;  1LFU P;  4CXF A;  1F5T A;  1OCT C;  1X3W B;  2FOK A;  1NK3 P;  3DLL F;  2WTE A;  2R7V A;  1RIO H;  3OYN A;  4XM3 A;  2DA1 A;  1QO0 D;  4WXH A;  2K9Q A;  1S7A A;  2CW0 F;  3S1R J;  3JRA A;  3FXJ A;  1LKX A;  4M6V A;  3MZ8 A;  1PP7 U;  4P9F A;  4RM3 A;  2LR8 A;  2PMH A;  1HA8 A;  3KZY A;  3IKV A;  2ZCW A;  3DKW A;  2PJR B;  2KL4 A;  1ZRC A;  2LC2 A;  2PI0 A;  3QOP A;  4XRF A;  2A69 F;  2LKS A;  3BCB A;  1IC8 A;  3H36 A;  1HKT A;  1XTA A;  3E5U A;  2KRH A;  3JTG A;  2NVU B;  2FRH A;  1J7K A;  1XMA A;  2Z3Y A;  1B72 A;  3A01 B;  1ZGJ A;  1E0E A;  1A5J A;  2B0L A;  2OZU A;  3VB2 A;  1YIT I;  1FBQ A;  1ZAR A;  4BGD A;  1T0F C;  4DBQ A;  2V7F A;  3JRD A;  4EM0 B;  2P0W A;  3TO7 A;  1RZ4 A;  1Y56 A;  2HZT A;  1OFC X;  4U88 A;  2IP2 A;  1ETO A;  1HOM A;  2PMZ A;  5BPI A;  1LE8 A;  2XAH A;  1P4W A;  5HDK A;  1O57 A;  1ZG1 A;  5L3E A;  3V8J A;  3RZD J;  2BVM A;  1T08 B;  3S1Q J;  4RLQ A;  1Z0X A;  5E1W A;  4LGW A;  4GXO A;  4RS8 A;  1XB4 A;  2E34 A;  1R49 A;  1KQ0 A;  4HST A;  5J40 A;  2O6G E;  5E8I A;  2HYG D;  2QEN A;  2XAS A;  5J3L A;  2P7C B;  2OJE D;  1HLV A;  5IP7 J;  2Y30 A;  2IGM A;  3TED A;  4KN4 X;  4IHY A;  1OJL A;  2R5Y B;  3R0A A;  5B3S H;  1DPU A;  5D6F A;  2GXG A;  3HOX J;  2QWW A;  5LLQ A;  5FO5 A;  2OF7 A;  3CQZ J;  3QP6 A;  5LEJ A;  4G8X A;  5KCM A;  2MSY A;  3BR1 A;  1SD4 A;  2MAB A;  2QSG X;  3K0L A;  4P5O A;  1G6N A;  3BRO A;  1FPQ A;  1MIJ A;  3ZOB A;  1V55 H;  2UXN A;  4Q47 A;  2PBI A;  3IP4 B;  4G7H F;  3HB9 A;  2O61 A;  3PFY A;  3OYM A;  1VQ4 I;  3H92 A;  1ON1 A;  2H6C A;  1X3U A;  3H9J A;  5HOO A;  4KA4 A;  1S3J A;  2P5K A;  4LMY A;  3IAM 2;  1ZTR A;  3L2R A;  1Z7U A;  4ESB A;  2L7M P;  3GYH X;  3KP5 A;  3O8H A;  4XOT A;  2MH9 A;  1WJF A;  2LKP A;  1XMK A;  2K3P A;  5FKL A;  2YU9 J;  1KQ9 A;  2BE5 F;  2CUF A;  1RKT A;  4KIF A;  4M6Y A;  4MGR A;  1QU3 A;  4UUS A;  4IRH A;  1YX5 A;  5IT3 A;  3GZ6 A;  3ML6 A;  3GX4 X;  1QHH D;  2BY1 A;  4D0P A;  2IGO A;  3HKZ A;  4XMY A;  4L9N A;  2IS6 A;  3P5J A;  1UG2 A;  2Z16 A;  3DBH B;  3S93 A;  2Y9Y A;  3K1P A;  1OYY A;  5ICC A;  4B8X A;  4LD5 A;  4EM1 A;  1KU9 A;  3CCY A;  3M8E A;  2L5Q A;  2HVR A;  3QWL A;  4L18 B;  3JRB A;  1S7O A;  4BS9 A;  1ONV A;  2ELJ A;  3BZC A;  4NC6 A;  2RV8 A;  2ZNZ A;  3H9G A;  2LDU A;  4CYC A;  4E7K A;  2AS5 F;  3HHH A;  4BEH B;  3E97 A;  4D7M A;  3G4S I;  3GTK J;  3BR6 A;  2R7Z J;  1NK2 P;  4LB5 A;  1X3Z B;  2ZO4 A;  4G6Q A;  1X4P A;  2HI3 A;  4IJA A;  5E3N A;  4U0Y A;  5GTI C;  4GFB A;  1E3H A;  2M7A A;  1G4D A;  2F4M B;  3L2U A;  3TBI A;  3FXR A;  1FP1 D;  1SD5 A;  3OY9 A;  2HYJ A;  2GZW A;  5TIS C;  5HDN A;  2E35 A;  4L5J A;  4GCV A;  2HXO A;  4UNO A;  3K6G A;  1BI1 A;  1POG A;  1TWF J;  3V7R A;  1K6O A;  4A3M J;  4IXA A;  2QQ9 A;  4M3D A;  4HPQ A;  2QQ8 A;  1O3Q A;  2EWN A;  1WVR A;  5F1J A;  3JRG A;  5E17 F;  1LE8 B;  2L9S A;  3GXO A;  4YFK F;  5IOZ A;  3EUA A;  2F4O B;  2CQ7 A;  3FK6 A;  3GTL J;  1Y6I A;  4M72 A;  2K4J A;  3OOP A;  3TW7 A;  2E1N A;  4BE1 A;  4ASN A;  1B6A A;  4XKW A;  4Q5S F;  2X51 A;  4WXD A;  1A6Q A;  1I27 A;  3GTP J;  1UST A;  2BZT A;  2LNB A;  3AG3 H;  2GA1 A;  2L02 A;  1X2N A;  3IUO A;  2M8E A;  1XSX A;  3AG2 H;  3K10 A;  5LRS A;  4A3G J;  3T8R A;  4F55 A;  3JRC A;  2IT0 A;  2BV6 A;  1XGM A;  2AQF A;  4PSX A;  5D4R A;  3PUF A;  2GIZ A;  4L9J A;  3KLO A;  4PUS A;  1CF7 A;  4RB2 C;  2HQN A;  2ZME A;  3PIO F;  5J8C A;  3IH2 A;  2EJR A;  2ELH A;  1VQO I;  1V5F A;  2GAU A;  1GLN A;  4HQM A;  5CLS A;  5CQG A;  4YEL A;  4IHS A;  3BR2 A;  3MZH A;  1BOB A;  3VPR A;  1N77 A;  1Z77 A;  1DU0 A;  4G94 A;  2X6W A;  1BR1 A;  5KVR A;  3M8J A;  4L5E A;  1KZH A;  2X6X A;  2NOG A;  5F04 A;  4QPQ A;  4WK8 F;  3GWZ A;  2BHY A;  1H88 C;  3KE2 A;  4U7D A;  1Z91 A;  5KHD A;  2FQ4 A;  2DDB A;  2HFH A;  3ZQI A;  2AXL A;  3LSJ A;  4HZF A;  4ZYH A;  2ZFW A;  2E2J J;  3QYF A;  3SDB A;  2JVH A;  4KIC A;  1G2H A;  3HG9 A;  1W4M A;  3D5R C;  2VC0 A;  1D8K A;  3OL4 A;  3DWL E;  3OIO A;  3F21 A;  2L4M A;  1EV7 A;  2NXN B;  4G6D A;  2H1L A;  1D0Y A;  3NEU A;  3J81 Z;  2IA1 A;  3GUD A;  3KZI C;  3RJP A;  1ETW A;  2K5C A;  3RKX A;  2IVM A;  5JR3 A;  4UUS B;  2ADU A;  2KP6 A;  4D9J A;  3WG9 A;  2G7H A;  2BW3 A;  3HRT A;  3I55 I;  1T56 A;  2DDA A;  4K2E A;  1FOX A;  4CIC A;  2K9S A;  3F0C A;  4CCO A;  4N4N B;  3GVA A;  3PSF A;  4RAY A;  4V2F A;  1U9O A;  1R7J A;  2R7W A;  3IRR A;  3BJA A;  4XRS A;  2EBI A;  4E7L A;  5TRD A;  4A0X A;  1YFH A;  4XOP A;  5IP6 A;  3T5X A;  1JJ8 C;  3U1K A;  4CYC B;  2JUC A;  1UCR A;  1IXR C;  1FIA A;  1MZB A;  3LOC A;  3MZY A;  2LF7 A;  5ERI A;  4JX6 A;  2M3A A;  3L1P A;  2E1O A;  2O7O A;  1R36 A;  3HHG A;  5HS7 A;  2D2W A;  5K7F A;  3FIW A;  2CUE A;  5F0C A;  4EJW A;  2CV2 A;  2XDV A;  2KDZ A;  2RNJ A;  1L3L A;  5EEH A;  4KMF A;  1V5G A;  2CGP A;  1MNM C;  1BW6 A;  5HDG A;  3I71 A;  3JAM Z;  1LUJ B;  4U87 A;  3LAP A;  2Z1D A;  2IS4 A;  2ISZ A;  3OR1 C;  5F27 A;  1T39 A;  3MKZ A;  3TP3 A;  1FMW A;  3FM3 A;  4ZYG A;  4IOA F;  5E1X A;  4CH7 A;  2IEK A;  4LLN A;  2OBP A;  1U5T B;  1XX5 A;  4I01 A;  4XID A;  2MYS A;  2MFZ A;  1A36 A;  1JXS A;  2X1E A;  2L7K A;  2A6H F;  1XCV A;  2R5Z A;  3CP2 A;  1WI3 A;  1JI8 A;  2XKP A;  4GGG A;  1XN7 A;  1U0J A;  2H6B A;  1SC7 A;  4RDU A;  2M87 A;  5E1Z B;  5IT9 K;  1O4X A;  3BCA A;  1FY7 A;  1AKH B;  3FIS A;  2OV7 A;  3GCM A;  2OZ6 A;  3PQJ A;  4M3F A;  4NDL A;  2E2H J;  4UVA A;  5CVU A;  1FSH A;  3OYD A;  5C4X J;  4CGZ A;  3TW6 A;  2UWM A;  4QIW N;  3HTU A;  2RVC A;  2YU3 A;  3G1L A;  3SXY A;  2A5W A;  5B5E C;  1BW5 A;  4XRS G;  2DA2 A;  4C2M J;  5GPA A;  1OMI A;  1YX3 A;  1W5C C;  2P4W A;  1MMS A;  4D7N A;  4II3 A;  3W2V A;  1RR8 C;  1D3Y A;  4NBQ A;  3HSF A;  4R8H A;  2EZI A;  3PQK A;  4RGU A;  3D5S C;  3S2H J;  4XLE A;  5DM7 F;  1R1U A;  3HSE A;  4ZJZ A;  2V1X A;  3I9V 2;  2STW A;  5EG0 A;  2R7U A;  2LH9 A;  2DA4 A;  4XKB A;  1Y1W J;  3FXK A;  2FX0 A;  2KRF A;  4MFD A;  4OWR B;  4TV7 A;  1YHQ I;  4I0B A;  1KU3 A;  3DU6 A;  4F92 B;  4QLC U;  1D0Z A;  2VKH A;  3K2A A;  1FT9 A;  2CYY A;  5DD4 A;  3TGN A;  2R0Q C;  3J80 Z;  5EGO A;  5FKN A;  3K4B A;  1JKO C;  3HOU J;  4NNJ A;  3DKX A;  4BE0 A;  1OYI A;  1XGO A;  1VQ9 I;  3GLL A;  1YJN I;  4AD9 A;  4L9V A;  2COM A;  1ZG5 A;  4BUP A;  3CES A;  2R7R A;  1VI0 A;  1XCB A;  1X1C A;  1A04 A;  5LGN A;  4BJ5 C;  2CFO A;  1R5G A;  4IOC F;  3S3O A;  1SVO A;  1ULY A;  1ZYR F;  1PJR A;  5J1U A;  3K4M A;  2NYX A;  2BVL A;  3FBI B;  1WJD A;  3CJQ B;  1R1T A;  3NWT A;  4M71 A;  1LFB A;  4PJN A;  5EDN A;  1JUS A;  2A6T A;  3JRH A;  1TBX A;  2Y69 H;  2JA6 J;  2P6S A;  5J47 A;  3DV8 A;  2GXA A;  3ZN0 A;  3U2R A;  1WJB A;  1ZLK A;  1WJE A;  3C2H A;  1DU6 A;  1LPQ A;  2M4K A;  3G71 I;  2VN2 A;  3V8K A;  1MMA A;  3H1C A;  3LSM A;  4V19 K;  1TC3 C;  1H89 C;  3CCU I;  2DJI A;  4HLY A;  4XR6 A;  1MBG A;  1XD7 A;  1IXS B;  4Q48 A;  1BR4 A;  2JSP A;  2X1C A;  2Y75 A;  3G2B A;  4BHP A;  2C6Y A;  5IPA A;  4DJA A;  2BY3 A;  2XV4 S;  2HDC A;  1ZK8 A;  3NWS A;  4I0A A;  1FOK A;  1YTY A;  1E3O C;  2MD5 A;  1FTZ A;  2KT0 A;  4C3J J;  2KQR A;  2L9V A;  4KIG A;  2R5Z B;  2LBF A;  1DGW Y;  3OYG A;  4HEA 2;  4MQV A;  5AON A;  1IN7 A;  5CYV A;  3WU1 B;  3CC4 I;  3FM5 A;  5LRR A;  4ENK A;  1P7I A;  2K9L A;  1TL8 A;  2MLK A;  2QLZ A;  2DMN A;  3KIO A;  5AIQ A;  3L7W A;  3MKW B;  1HQC A;  5KK1 A;  1BOA A;  2WAQ A;  4ZC3 A;  3GFJ A;  2E60 A;  3RZO J;  4ZYE A;  4DNC A;  3H3U A;  2PG4 A;  5E79 C;  3LWF A;  4XLC A;  1YW8 A;  3H5R A;  4LIU A;  2IS2 A;  4XOR A;  4Y4R A;  4DYR A;  4Y3O A;  3G6E I;  5CVV A;  3DTE A;  3I4P A;  1V54 H;  3H0G J;  1MBJ A;  1SAN A;  2DAO A;  2EIL H;  2FML A;  1T8I A;  1ETQ A;  3HZJ A;  2L2O A;  3Q0V A;  1G3W A;  3QPT A;  1W7P A;  4OMY A;  1IGN A;  3CMA I;  2V4J C;  2B9S A;  1WCM J;  4G12 A;  4M3G A;  5CKT A;  2ZME C;  2NS7 A;  1SMY F;  2EFN A;  3N4M A;  2DCE A;  1F4K A;  1Z7L A;  5F0H A;  1D5Y A;  2BXY A;  4CZZ A;  5H2F C;  1ENH A;  1QBJ A;  4GO1 A;  2W25 A;  1QVU A;  4R1H A;  3WGI A;  3BR5 A;  5E18 F;  4KUM A;  1RPW A;  3CZ6 A;  3LL7 A;  4BY7 J;  2ZJR F;  1OYW A;  4AYB N;  1X58 A;  1VQM I;  1OCP A;  1W36 D;  3Q5F A;  2V1N A;  3RIR A;  3FXU A;  2M7B A;  4X1E A;  1B59 A;  1WFX A;  3PSI A;  4B3A A;  5HVQ C;  2EQR A;  3F22 A;  1LFP A;  2KFD A;  1FYM A;  3BR0 A;  1FMV A;  4L9T A;  2JN6 A;  2M45 A;  2ZSI B;  1YOV B;  5JI6 A;  4XRM A;  1J09 A;  3HGY A;  4M9Z A;  4MEY F;  2CH0 A;  1QPI A;  1FNN A;  4HV5 A;  3HXL A;  5D5W B;  1PP8 F;  3SEQ A;  1XMX A;  5BMZ A;  1IN8 A;  4I7H A;  1D1B A;  2K02 A;  2RNG A;  3KP6 A;  4QSH A;  5KAI C;  2HPM A;  5EZG A;  2V1U A;  4BXU A;  1UG0 A;  2LY2 A;  4NC7 A;  4F7Z A;  2FEZ A;  1HSJ A;  5J8F A;  4HX4 A;  3QYB A;  2XGD A;  4RB0 A;  3RQI A;  2EZK A;  3V8L A;  1OKR A;  1FTT A;  2M9H A;  2B63 J;  3RPQ A;  2R7Q A;  1USS A;  1K83 J;  5HS9 A;  1IV8 A;  2PQ8 A;  1YRN A;  2XSD C;  3CCQ I;  2LLK A;  3M8F A;  4N4O B;  2M1B A;  5L3B A;  2JPC A;  3B73 A;  2CV0 A;  3AG1 H;  4IQJ A;  2XUB A;  3KEY A;  3ERM A;  1TZL A;  2ID3 A;  2CG4 A;  2PMU A;  2KJC A;  3P7N A;  5FRM A;  5K7Z A;  1MMD A;  2VJ5 A;  3VYU B;  2OTL I;  3U21 A;  1B8I A;  2J5P A;  4LB6 B;  2O9L A;  1WSU A;  2X6Y A;  2XGC A;  3I4N J;  2CQN A;  5E3L A;  5H20 A;  5BS6 A;  2F5F A;  3ISP A;  4I76 A;  1P6R A;  5HNF A;  1A6I A;  3LFK A;  5ILS A;  4NQW B;  3AFH A;  5DUK A;  5JVG F;  1XSD A;  2FXA A;  2DPD A;  3DPL C;  4M6X A;  4YII A;  1DP7 P;  1Z67 A;  2UXX A;  1K61 A;  2IPQ X;  3REO A;  1B9M A;  4G9Y A;  4BJT A;  2OQR A;  5EEA A;  1OCO H;  2VI6 A;  3AG4 H;  5DUI A;  2WA0 A;  3BLY A;  3BZK A;  4B47 A;  1ACI A;  1IRG A;  4MQ9 F;  2L7Z A;  2NOJ B;  1UHW A;  5ILV A;  2ME6 A;  2E1M C;  2H27 A;  2WC2 A;  2BY2 A;  1BIA A;  4EEF G;  2ZSH B;  1G3Y A;  1W36 C;  1MBF A;  4C2T A;  4BY1 J;  2E5N A;  1Z6T A;  3CP8 A;  3JRE A;  2XHK A;  1GV5 A;  2CW7 A;  1P4X A;  4II2 A;  3VYS B;  3ZQL A;  2A07 F;  2LRE A;  2VT3 A;  2DBB A;  1Q1H A;  2GWR A;  4M74 A;  1S29 A;  4O5V A;  5FKK A;  4I2O A;  2MGQ A;  2DK5 A;  1OCC H;  1TW3 A;  3EYY A;  4AUX A;  5DTD A;  1K78 A;  4A5N A;  2VBX A;  2VT2 A;  2JSC A;  3KFW X;  3M1E A;  5FKM A;  2STT A;  2CUJ A;  1R4M B;  5K5O A;  3FMS A;  2L0K A;  5FLX K;  2CUZ A;  5J1Y A;  4LOC A;  3HRM A;  2HQ5 A;  2VAS A;  1P2F A;  4HSR A;  4J01 A;  4KN7 X;  2DTZ A;  3DBR B;  3CTA A;  4B44 A;  3S8P A;  1VQK I;  2A3S A;  1R71 A;  5ED4 A;  2LSO A;  4BAC A;  2W24 A;  4ZYA A;  3OYL A;  3CCM I;  4JX4 A;  3V4G A;  1TT0 A;  3KP4 A;  3WTW C;  1BJA A;  2RN7 A;  2CSO A;  3DEU A;  2O8X A;  5GTH C;  3IH4 A;  3B6C A;  2KIQ A;  4MHG A;  3CCS I;  2WY7 Q;  1B9N A;  2QZ8 A;  3R60 A;  2R7S A;  1IRF A;  1BI3 A;  3KET A;  1KGS A;  2V9P A;  3MWM A;  2XAG A;  3F8M A;  1QPM A;  1YS7 A;  2XB5 A;  4HAM A;  2OQG A;  2ZXI A;  2GXB A;  4U7B A;  3OS1 A;  3GTM J;  3K4J A;  1HW1 A;  4IRI A;  3C18 A;  3ZQ7 A;  1QZE A;  2HDW A;  4RGR A;  5M3F J;  5E20 A;  3BY6 A;  2XSJ C;  3DU5 A;  6PAX A;  2CRG A;  3H5A A;  1IUF A;  5DCM B;  1REP C;  2QSH X;  2JVG A;  4PGG A;  3K4C A;  1JT0 A;  5KNL A;  1GT0 C;  2KIM A;  5FD6 A;  3BWG A;  2KHM A;  3SQN A;  1GUU A;  1BN5 A;  3WTZ A;  2KRC A;  1EJ9 A;  3K69 A;  1F36 A;  3OMY A;  3I58 A;  4EQQ A;  2VQC A;  1XSV A;  3ZXS A;  2WY8 Q;  3WE3 A;  4LG3 A;  3H5N A;  5E8G A;  4MFE A;  4PK4 A;  1SFX A;  1QZY A;  1FWZ A;  3GTO J;  4XK4 A;  3ABK H;  2O8K A;  2CQK A;  4ZTF A;  1XGN A;  1G8X A;  1MJA A;  2IJL A;  3GO5 A;  4P55 A;  3EET A;  5FLV A;  2XRO A;  1I6X A;  3LSG A;  1ZR4 A;  3CDL A;  3LSH A;  1VTN C;  1J75 A;  3I0T A;  2VPR A;  1YO5 C;  4AIK A;  2XF5 A;  2LD5 A;  2LF8 A;  2RKH A;  2R7O A;  4A6D A;  3DPT A;  3KZZ A;  3TDZ C;  4A3J J;  2E1C A;  1EKE A;  2HU9 A;  2L54 A;  4XBF A;  4UUV A;  4ZZD A;  1FJL A;  3JRF A;  2ZXJ A;  3TKY A;  2DA7 A;  4M9S A;  3EQL F;  3VOE A;  2R7D A;  4XLH A;  1B72 B;  1FOY A;  1G3S A;  5FFZ A;  3M07 A;  5F1R A;  3SFI A;  3K9T A;  2QF7 A;  2ZNY A;  3MKY B;  3ZRG A;  1QGP A;  1WGX A;  2MC3 A;  3OYJ A;  5F0F A;  5JLW A;  2O0Y A;  2YR2 A;  3FX3 A;  3TDU C;  3K4K A;  5GAD J;  2LVS A;  5K5R A;  4ENM A;  2WB1 N;  1R1V A;  1JHF A;  2VQG A;  4AWX B;  3H0D A;  2VOD A;  2L7F P;  1U8R A;  4E7I A;  1LDJ A;  2ISY A;  3QPH A;  5EEG A;  1U3E M;  1ZLJ A;  3OS2 A;  1BA5 A;  3E5Q A;  3ECO A;  3IKT A;  2UZK A;  2EV5 A;  4E70 A;  5BQT A;  2NS8 A;  3CCL I;  3BP8 A;  1MBE A;  3K2Z A;  4GYI A;  2VE9 A;  2JQ7 A;  3UNG C;  2E71 A;  5J4V A;  5EF6 A;  2MC4 A;  5LHG A;  4FX0 A;  4CO8 A;  4BBS J;  1VQL I;  1X1D A;  1EA3 A;  3ONQ A;  1D8J A;  3LA3 A;  1DP3 A;  3HOW J;  4AID A;  2X9D A;  1ODD A;  5CVI A;  5L3D A;  1TWC J;  1JUP A;  1FP2 A;  4W1U A;  2UUZ A;  3FDY A;  3AL0 C;  2M0M A;  2QSF X;  3L9F A;  1NHA A;  3ZMD A;  1GVJ A;  2W85 A;  5ICF A;  2Y2Z A;  1IV6 A;  2ZJQ F;  4DYQ A;  2P5V A;  2DYR H;  1RC9 A;  4Y13 A;  1DDN A;  3J7A Y;  2ECB A;  3Q9S A;  3J7Y J;  4I02 A;  3A03 A;  1FBU A;  4I99 C;  4G6T B;  3ERE D;  2YSR A;  3TO6 A;  1HBX G;  2KPM A;  3PM1 A;  1FX7 A;  4A3L J;  4Y52 J;  4BHB A;  5FJ8 J;  1IO2 A;  1RKW A;  1MSE C;  1O7L A;  1XC5 A;  2DOF A;  5B66 C;  4IHV A;  5HS8 A;  3I59 A;  1YIJ I;  2QM3 A;  3QQA A;  3LMM A;  1N78 A;  4FQG A;  3ZQG A;  2WAF A;  2XPV A;  3M1C A;  1FEX A;  5LHH A;  3V7C A;  2RC4 A;  3BC8 A;  5FD5 A;  5K1Y A;  5IYD J;  4AVP A;  3C3W A;  4ZDL A;  3UR3 C;  4HRI A;  4KIS A;  1Z6R A;  3GTG J;  2HVQ A;  4HW0 A;  3HM5 A;  2K27 A;  2VLA A;  1PDN C;  3CF5 F;  1HKQ A;  2WAD A;  5CVJ A;  2MBF A;  4IF4 A;  2XKO A;  4G7Z F;  2ESN A;  2TRT A;  2JPB A;  2K9N A;  4LIT A;  2R3S A;  4M3B A;  4CCL A;  4XSX F;  3A4C A;  1KA8 A;  3HTS B;  4ZZL A;  2QA4 I;  2ZC2 A;  2D5V A;  2K7L A;  4FHT A;  1UHM A;  1D1A A;  3RPU A;  3CCJ I;  3KEO A;  1QVT A;  2ECC A;  3FXO A;  3UKG A;  3ZQQ A;  1YJW I;  5JFR A;  5ICG A;  3E1S A;  4ZDO A;  4DQ2 A;  3N05 A;  1U78 A;  1TW2 A;  5JHU A;  2A5Y B;  2HOA A;  1I1S A;  3M4O J;  3G1O A;  2VIX A;  2L9R A;  2BXZ A;  3PNT A;  1L0O C;  2LFB A;  4D5C A;  3B6A A;  4EM2 A;  3RYP A;  2W48 A;  4OIN F;  5A2Q K;  4B1R A;  2VPL A;  2DA3 A;  3GFM A;  2YX4 A;  1J2X A;  5E3O A;  1MND A;  1D0X A;  3S3N A;  2V9K A;  3DKY A;  1HDD C;  4RAZ A;  3IC7 A;  1Y1V J;  2FNP A;  2WV1 A;  2DFF A;  4OOI A;  1Y8R B;  1O3T A;  2TCT A;  2A05 A;  2EH3 A;  1UAA A;  3EDP A;  4XON A;  1RRJ A;  1R5H A;  3CCE I;  3JR9 A;  2VBZ A;  3IWZ A;  1P7J A;  3QPS A;  2AO9 A;  2BOL A;  4FIS A;  3ZMV A;  1ZHF A;  5FRN A;  1O3R A;  2QKL B;  4FX4 A;  3RYR A;  1UHS A;  4Z6Y A;  3SZG A;  2QGU A;  3G3Z A;  5LFA A;  2JA8 J;  4DZJ A;  2ZJ2 A;  2NNY A;  1CF7 B;  1TP4 A;  1MMG A;  1ON2 A;  5FRO A;  1J59 A;  2ZME B;  4BQA A;  4A3D J;  4EMS A;  4LG0 A;  1ETK A;  3IL2 A;  4BNC A;  2IGN A;  3VYT B;  3HDD A;  2XGX A;  2VKD A;  5HOD A;  2N8G A;  2YPR A;  5D8K B;  1PYV A;  2LYC A;  3SYT A;  5BPD A;  5DD8 A;  1MSF C;  1ZRD A;  4IKF A;  5JLX A;  3KP3 A;  2Y0M A;  4FET A;  2Z2S B;  4UY8 I;  3T0Y A;  2OUM A;  2KIU A;  2L4A A;  2OCE A;  4XL9 A;  5D6E A;  4LLL A;  2PEX A;  5CQE A;  2CV1 A;  4EJT A;  3DF8 A;  1YE9 A;  4O6J A;  4AVZ A;  4YEJ A;  2IBD A;  3SZT A;  3D1N I;  2Z33 A;  4UXN A;  1E2X A;  2KZV A;  2JTV A;  3MAJ A;  4RMN A;  4Z2Y A;  4HDU A;  2ELK A;  4N9H A;  2YS9 A;  3B02 A;  3BG6 A;  2DFH A;  4EV0 A;  2F48 A;  2W00 A;  3HPG A;  4P9U A;  4AU7 A;  2BW3 B;  1H0M A;  4CA0 A;  4M9X A;  2M34 A;  3IRQ A;  4MNU A;  2TDX A;  4PGH A;  1GXP A;  1QQI A;  3BG9 A;  3MVP A;  1R58 A;  4H4K C;  2PN6 A;  2EZL A;  1R22 A;  4DYC A;  2EFO A;  1W5S A;  2OC6 A;  3HOV J;  4RAG A;  2MD0 A;  2X0L A;  4WXC A;  2V26 A;  2DT7 B;  4ENN A;  1VQ7 I;  2ID6 A;  5D5V B;  2GA2 A;  3VYR B;  2R92 J;  3M3Y J;  2VQL A;  3JW4 A;  3V7S A;  4L0Z B;  2M4G A;  2EK5 A;  4PJ0 C;  3E7L A;  5FLM J;  4ETS A;  3I56 I;  3F23 A;  3CCR I;  2E7X A;  5FGM A;  4DIQ A;  3HL2 A;  2L9N A;  2V79 A;  2LMD A;  2V6E A;  1R23 A;  3MD2 A;  4OIO F;  5DCF A;  1U8B A;  2VC1 A;  5GAE J;  1KU7 A;  2Q0O A;  3Q0W A;  4OAZ A;  4ZH4 F;  4MIM A;  3O2P E;  3DXJ F;  2VUM J;  3R6S A;  1K4T A;  1A35 A;  3OIP A;  5D8L B;  1Y8Q B;  3FMQ A;  1HXD A;  1XDS A;  3R0J A;  4IEJ A;  5M5Y J;  2XVC A;  1RET A;  4YFX F;  4F91 B;  4BQO A;  4KYW A;  1TNS A;  4FTH A;  3ELK A;  2FOW A;  3WTY C;  3VOD A;  2JRM A;  1IN6 A;  2QBY A;  3IV5 A;  5M5W J;  4A2U A;  3BJO A;  3OYH A;  2K4B A;  2V9V A;  3BR3 A;  4B4C A;  1MD0 A;  4BE2 A;  2E1M B;  3JSP A;  2DO7 A;  3RKQ A;  1TWH J;  2XF7 A;  3VEP A;  3PIP F;  3S2D J;  3DQV C;  1T2K A;  4UVB A;  1WQ2 A;  3E0J B;  1N75 A;  1TQI A;  1WH5 A;  2Q2E A;  4RA2 A;  1YQA A;  4XKC A;  3ZP5 A;  4ENJ A;  3CC2 I;  1VQN I;  2R7T A;  1UEL B;  3R4K A;  1S72 I;  3ESW B;  3QOD A;  2EV6 A;  3RPU D;  3LSI A;  4UUT A;  1YI2 I;  1ZAO A;  5HLT A;  1VQP I;  1Z05 A;  3E3V A;  4BJ6 C;  1SMT A;  5F6F A;  1J9I A;  1IZ1 A;  2X4H A;  3OYI A;  1FIP A;  1RI7 A;  1LJ9 A;  3ABT A;  2O5R A;  2XRN A;  1YG2 A;  3ZGK A;  5CJ9 A;  3SDG A;  1ERD A;  3BTI A;  3P9C A;  1XG1 A;  4PFO A;  2HYF A;  3RSN A;  2F2E A;  3E6C C;  3CJR B;  1IRZ A;  1I50 J;  1ETY A;  1TWG J;  3VSK A;  3LA7 A;  2DMQ A;  5CPR B;  4UVC A;  3KP2 A;  3OL3 A;  2CQQ A;  5EG0 B;  1E3P A;  4D5F A;  5JHF A;  2HDD A;  3ZPL A;  4AC0 A;  2HVS A;  4KIB A;  3S1N J;  3WTT C;  3HIF A;  2HQA A;  2XAQ A;  1MH3 A;  5D4S A;  4HF2 A;  1W0U A;  3CO7 C;  3BQZ A;  2Z5U A;  1HF0 A;  3WTX C;  2QQA A;  4Y33 A;  4MTD A;  4A12 A;  2IW5 A;  2KIF A;  1M1E B;  5EGO B;  2DOD A;  1I6H J;  2DMP A;  4RAF A;  3F8C A;  3BPX A;  4UHT A;  2E5Z A;  2P5L C;  1XGS A;  2VJI A;  4X0G A;  1BBY A;  4PFP A;  4BXF A;  1I1G A;  3NQO A;  4IHT A;  1K6Y A;  3WOD F;  4CCK A;  2ZXW H;  3TP0 A;  3TOA A;  3OYE A;  3QP5 A;  3GW2 A;  4OU0 A;  1OPC A;  2EIJ H;  1X1B A;  2XAU A;  2H1K A;  4E7H A;  3L00 A;  1IXC A;  5IOY A;  3VDX A;  2FUG 2;  3DEE A;  3HUG A;  1AHD P;  2R5Y A;  1WZ2 A;  1I3Q J;  2VE8 A;  2H09 A;  1K7A A;  3TMO A;  3LSR A;  1D1C A;  4C2U A;  4BH9 A;  2KMU A;  3CJN A;  2HPI A;  3GZ5 A;  1BI2 A;  4C3I J;  5M5X J;  4ZYD A;  4A3B J;  3P9K A;  2DOA A;  3L09 A;  2A68 F;  3SHF A;  1LNW A;  1YS6 A;  1FZP B;  3J81 K;  2HTS A;  2EPF A;  2P6T A;  3TOB A;  4DW6 A;  2W4S A;  3M7G A;  4B3X A;  1ETV A;  2EFW A;  5HNH A;  3KLN A;  5H6Q A;  3TQN A;  3W2W A;  3X2Q H;  3FMR A;  3D0S A;  4DGW B;  5HLG A;  4RGX A;  4B48 A;  5JVT A;  3T8T A;  2BYV E;  2CFX A;  2QBY B;  1JKP C;  1XS9 A;  1ZRF A;  3E6D A;  2LBF B;  2ZXH A;  2F5V A;  2PMZ N;  3SJM A;  3HYI A;  2GM4 A;  2GBY A;  3WTU C;  1MNE A;  2PFB A;  2EA4 A;  4EJV A;  2AHQ A;  1T38 A;  4AYB A;  2OAZ A;  5C44 J;  1IDZ A;  2EFQ A;  4BL0 B;  1IN4 A;  2MLG A;  2OPT A;  3LQR A;  4NB5 A;  3HOT A;  3RCO A;  1ZKG A;  1V4R A;  2IXS A;  1LEA A;  1AOY A;  2VKE A;  3RKY A;  2VQH A;  2E19 A;  4KMU X;  1Z1D A;  4KNY A;  2IGK A;  1GVD A;  5L3G A;  3KEQ A;  4ANJ A;  3IHU A;  1ZG3 A;  3SZP A;  3U9G A;  4E4H A;  5FFX A;  3I4M J;  5L3F A;  5LEK A;  5DYM A;  2CMP A;  2QEX I;  1A31 A;  3JAM K;  3A1Y A;  4HYE A;  4N9I A;  5F64 A;  4ESF A;  2FQ3 A;  2W84 A;  1HCR A;  4CCJ A;  3O3K A;  3LA2 A;  2FF4 A;  3F8B A;  4F3Q A;  4DZP A;  2I5U A;  5IT9 Z;  1X19 A;  4BEH A;  3FKI J;  3DTI A;  2FBI A;  1W7P B;  3E6B A;  3IWF A;  1Y39 A;  2R93 J;  2FA5 A;  3AL0 B;  3J7Z I;  3W2A A;  1S9H A;  3BTL A;  3F72 A;  1UMQ A;  3FF5 A;  3ZMT A;  1H9T A;  1TNT A;  3FZV A;  4NUB A;  3I5U A;  1P4A A;  2QYO A;  1YJ9 I;  4HF1 A;  3NRV A;  3ASO H;  1OCZ H;  1ORK A;  3BDD A;  4A5M A;  1TT5 B;  1FLI A;  3P9I A;  1WWX A;  1K4S A;  4S0H B;  3HSR A;  2R7F A;  4KT5 C;  4JQF A;  1FBS A;  2DOE A;  1G59 A;  3MCZ A;  4E7S A;  4J00 A;  2XIG A;  4IVN A;  2DFI A;  3CDI A;  2IA2 A;  3WTS C;  2CWE A; 
#chains in the Genus database with same CATH homology
 1YW7 A;  3MQ0 A;  4IRG A;  3ZN1 A;  1V3F A;  3MFK A;  2FSW A;  4OIQ F;  2D1V A;  1HW2 A;  2IRF G;  1KU2 A;  2HEO A;  2PJP A;  1HST A;  2ACJ A;  3I53 A;  4RB3 C;  1YLF A;  4LK0 F;  2P8T A;  2HKX A;  2IA0 A;  1W7P D;  1W5T A;  3EUH A;  2KJB A;  2Y48 A;  4YIF A;  3G73 A;  1MJB A;  3J80 K;  4BHC A;  2XAJ A;  2F5E A;  1BM9 A;  2ESH A;  2JRT A;  2RDP A;  4B09 A;  1FYK A;  4PZJ A;  4JK1 X;  3ABU A;  4MTE A;  1CGP A;  1FC3 A;  3LST A;  1OR7 A;  2HGC A;  3R61 A;  2DW4 A;  3HRU A;  2VOO A;  2E7W A;  1MJ9 A;  2DT5 A;  3F8N A;  1WKM A;  4ESJ A;  2P7V B;  4HV6 A;  1ZRE A;  1JGS A;  4HX7 A;  1J0R A;  4UV8 A;  1TQP A;  3GEZ A;  3KP7 A;  4HX8 A;  4PDK A;  2FBK A;  4CYD A;  2HQR A;  2EB7 A;  4OIR F;  1S6L A;  4KFC A;  1BI0 A;  4I98 B;  1BC8 C;  1IW7 F;  4PCQ A;  4EGY A;  3DP7 A;  4LJZ F;  1K78 B;  4O3M A;  1BIB A;  5D5U B;  1KYW A;  1BC7 C;  2HKO A;  1MKM A;  5H6R A;  2VXZ A;  2NNN A;  4H0E A;  1HKS A;  5LBQ A;  2VON A;  5DV5 A;  3LAJ A;  4HA8 A;  3CUQ A;  1F9N A;  1U5T A;  1UB9 A;  3RDI A;  4EJU A;  1F1Z A;  3F8F A;  4BYY A;  1R00 A;  4HLX A;  2WWY A;  4RGS A;  3MEX A;  2NRA C;  1LEB A;  1B1B A;  4EVI A;  1KYZ A;  2ZBK A;  4FT8 A;  4HOB A;  1SD7 A;  2HR3 A;  4LK1 F;  3QRF F;  2O3F A;  3GFL A;  2MA3 A;  3H3Z A;  3BZ6 A;  5D5X B;  3I64 A;  4S05 A;  2PLY A;  3ZMZ A;  2Q8K A;  3N97 A;  3ECH A;  1Y0U A;  5HLH A;  1STZ A;  4OIP F;  4Y17 A;  1EH6 A;  3RI4 A;  1MDM A;  2O03 A;  3ZMU A;  1U2W A;  3PFI A;  3FXQ A;  2MH2 A;  3EYI A;  1WRJ A;  4EGZ A;  2ZKZ A;  2J5O A;  2L3D A;  2FE3 A;  1TQM A;  5FB2 A;  4WWC A;  4XLN F;  3FWE A;  2DU9 A;  3WE2 A;  2DLL A;  3C1D A;  4IPA A;  3Q9V A;  2CO5 A;  4LFU A;  2V1D A;  4N0B A;  3GF2 A;  5ILU A;  1JHH A;  2W57 A;  1SD6 A;  3D5L A;  2D1H A;  2HOE A;  3QU6 A;  3M9A A;  3KCC A;  3S2W A;  1HW5 A;  4HBL A;  1I5Z A;  3L2C A;  3GFI A;  1TTY A;  3JTH A;  1RNL A;  1JE8 A;  2EA2 A;  3TO9 A;  3F3X A;  2OD5 A;  2F5C A;  3K1M A;  1QZZ A;  3K1N A;  1D5V A;  2JT1 A;  4KDP A;  3CUQ B;  3LQQ A;  1G3T A;  2EV0 A;  3HRS A;  4YFN F;  4P96 A;  2GQQ A;  3T1B A;  1T0F A;  4A0Z A;  2A6E F;  2M5W A;  4Q4Z F;  1KQ8 A;  3RTR A;  3F6O A;  1YW9 A;  2DTR A;  5FLX Z;  2Z99 A;  1ZH5 A;  4ON0 A;  3QU3 A;  5TJJ A;  3OV8 A;  2RQP A;  3AAF A;  2FMY A;  1YIO A;  4WCG A;  4I09 A;  3I59 B;  2G7U A;  1MDM B;  3ZMS A;  3FHZ A;  5J6X A;  1E17 A;  3CDH A;  1WI9 A;  2GIV A;  5K5Q A;  2QVO A;  1T6S A;  2DQL A;  2QUF A;  1FSE A;  1P92 A;  2L01 A;  1ZGA A;  2HTJ A;  1Z9C A;  2NAZ A;  5HLI A;  1C0W A;  1U6G A;  1LQ1 A;  1DPR A;  1SFU A;  4HQE A;  3BPV A;  2KKO A;  1QNT A;  5DDG A;  3CUO A;  4GYG A;  3GLX A;  1K79 A;  1IUY A;  2A61 A;  4CDG A;  2HWV A;  3I54 A;  4XLP F;  4U0W A;  3BOQ A;  4HDV A;  1GHC A;  4OMZ A;  4AIH A;  4YG2 F;  4UV9 A;  3VFZ A;  2XAF A;  5L3C A;  4WF2 A;  1IAW A;  3RKW A;  1EH7 A;  3WGG A;  4WX9 A;  1SAX A;  3DFG A;  2BBY A;  1ZN2 A;  4LG0 B;  5ICE A;  1J5Y A;  4LLG F;  3BJ6 A;  4Y15 A;  1LDD A;  4U0V A;  4QWQ A;  3CLO A;  3SFZ A;  1GXQ A;  4HF0 A;  3COA C;  1MGT A;  3E5X A;  2WV0 A;  1XDU A;  2BEO A;  3W6K B;  3WGH A;  4NQW A;  4MEX F;  1AWC A;  2K86 A;  1TLH B;  4M73 A;  1EH8 A;  4A6E A;  2G9W A;  2DPU A;  4JBA A;  3CUQ C;  5LGT A;  1U5T C;  2OU2 A;  3HOS A;  4XSZ F;  5DEQ A;  2QQB A;  5BOX A;  2NS0 A;  3WU0 A;  1IF1 A;  2VBY A;  3QAH A;  3F6V A;  1YYV A;  4AIJ A;  1LB2 A;  2DQR A;  2DK8 A;  1O7F A;  1O3S A;  2Z9O A;  1SFE A;  2FBH A;  1LDK B;  1UFM A;  2F5D A;  2JZY A;  4BAY A;  4G7O F;  4S04 A;  2EFP A;  4CHU A;  4R79 A;  4NHJ A;  4L0Y B;  5LGU A;  2D45 A;  1T98 A;  3ROU A;  3U1D A;  1LVA A;  3W6J B;  1H9G A;  2FNA A;  5AIP A;  3ULQ B;  4L5I A;  2RGV A;  3C7J A;  2VOP A;  2BGC A;  1RUN A;  4EJO A;  2YX7 A;  2M30 A;  2VBW A;  2OA4 A;  1B4A A;  5LHI A;  3E6M A;  1DUX C;  1PUE E;  1RUO A;  5DCM A;  5A2Q Z;  1IN5 A;  4RB1 A;  1FYL A;  3J7A O;  2V6C A;  5CVR A;  3O6B B;  3JSO A;  2FU4 A;  1S8N A;  2ETH A;  3CO6 C;  4A0Y A;  2DI3 A;  3WTV C;  2H94 A;  2HS5 A;  4CXF A;  1F5T A;  2FOK A;  2WTE A;  1RIO H;  1QO0 D;  4WXH A;  1S7A A;  2CW0 F;  1PP7 U;  4P9F A;  2PMH A;  3KZY A;  3IKV A;  2ZCW A;  3DKW A;  1ZRC A;  2PI0 A;  3QOP A;  4XRF A;  2A69 F;  1HKT A;  3E5U A;  3JTG A;  2FRH A;  1J7K A;  1XMA A;  2Z3Y A;  1ZGJ A;  2B0L A;  2OZU A;  3VB2 A;  1FBQ A;  1ZAR A;  4EM0 B;  3TO7 A;  1RZ4 A;  2HZT A;  4U88 A;  2IP2 A;  5BPI A;  2XAH A;  1P4W A;  5HDK A;  1O57 A;  1ZG1 A;  5L3E A;  3V8J A;  5E1W A;  4LGW A;  4GXO A;  4RS8 A;  1XB4 A;  1KQ0 A;  2O6G E;  5E8I A;  2HYG D;  2QEN A;  2XAS A;  2P7C B;  4KN4 X;  3R0A A;  1DPU A;  5D6F A;  2GXG A;  2QWW A;  5LLQ A;  5FO5 A;  3QP6 A;  5LEJ A;  4G8X A;  1SD4 A;  3K0L A;  4P5O A;  1G6N A;  3BRO A;  1FPQ A;  2UXN A;  4Q47 A;  2PBI A;  4G7H F;  2O61 A;  3H92 A;  1ON1 A;  2H6C A;  1X3U A;  5HOO A;  4KA4 A;  1S3J A;  2P5K A;  4LMY A;  1Z7U A;  4ESB A;  3GYH X;  3KP5 A;  2MH9 A;  2LKP A;  1XMK A;  1KQ9 A;  2BE5 F;  4KIF A;  4M6Y A;  4MGR A;  4IRH A;  5IT3 A;  3GZ6 A;  3ML6 A;  3GX4 X;  4D0P A;  4L9N A;  3K1P A;  1OYY A;  5ICC A;  4B8X A;  4LD5 A;  4EM1 A;  1KU9 A;  3M8E A;  4L18 B;  1S7O A;  1ONV A;  2RV8 A;  2ZNZ A;  2AS5 F;  2LDU A;  3HHH A;  3E97 A;  4LB5 A;  2ZO4 A;  4G6Q A;  4IJA A;  4U0Y A;  1G4D A;  3FXR A;  1FP1 D;  1SD5 A;  2GZW A;  5HDN A;  4L5J A;  4GCV A;  4UNO A;  1BI1 A;  3V7R A;  1K6O A;  4IXA A;  2QQ9 A;  1O3Q A;  2EWN A;  5E17 F;  3GXO A;  4YFK F;  4M72 A;  2K4J A;  3OOP A;  2E1N A;  4ASN A;  1B6A A;  4Q5S F;  4WXD A;  1I27 A;  1UST A;  2LNB A;  2GA1 A;  2L02 A;  2M8E A;  1XSX A;  5LRS A;  3T8R A;  2IT0 A;  2BV6 A;  1XGM A;  5D4R A;  4L9J A;  3KLO A;  1CF7 A;  4RB2 C;  2HQN A;  2ZME A;  5J8C A;  2EJR A;  2ELH A;  2GAU A;  4HQM A;  5CLS A;  4IHS A;  3MZH A;  4G94 A;  5KVR A;  4WK8 F;  3GWZ A;  3KE2 A;  4U7D A;  1Z91 A;  2HFH A;  2AXL A;  4HZF A;  4ZYH A;  2ZFW A;  4KIC A;  1W4M A;  2VC0 A;  1D8K A;  3F21 A;  2L4M A;  1EV7 A;  4G6D A;  3NEU A;  3J81 Z;  2IA1 A;  3GUD A;  3RJP A;  3RKX A;  2IVM A;  5JR3 A;  2ADU A;  3WG9 A;  2G7H A;  3HRT A;  4K2E A;  4CIC A;  3GVA A;  4RAY A;  1R7J A;  3IRR A;  3BJA A;  5TRD A;  4A0X A;  1YFH A;  3T5X A;  1UCR A;  1IXR C;  1MZB A;  3MZY A;  2LF7 A;  5ERI A;  1R36 A;  3HHG A;  5HS7 A;  2D2W A;  4EJW A;  2RNJ A;  1L3L A;  5EEH A;  4KMF A;  2CGP A;  5HDG A;  3I71 A;  3JAM Z;  3LAP A;  2ISZ A;  1T39 A;  3FM3 A;  4ZYG A;  5E1X A;  4LLN A;  2OBP A;  1U5T B;  4I01 A;  1JXS A;  2A6H F;  1XCV A;  2XKP A;  4GGG A;  1XN7 A;  2H6B A;  2M87 A;  5E1Z B;  5IT9 K;  1FY7 A;  2OZ6 A;  3PQJ A;  1FSH A;  4UVA A;  5CVU A;  4CGZ A;  2UWM A;  3HTU A;  2RVC A;  2YU3 A;  3SXY A;  1OMI A;  2P4W A;  1D3Y A;  3HSF A;  4R8H A;  3PQK A;  4RGU A;  1R1U A;  3HSE A;  2V1X A;  2STW A;  2KRF A;  4TV7 A;  4I0B A;  1KU3 A;  4QLC U;  1FT9 A;  2CYY A;  5DD4 A;  3TGN A;  3J80 Z;  1OYI A;  1XGO A;  4AD9 A;  4L9V A;  2COM A;  1ZG5 A;  1XCB A;  1A04 A;  5LGN A;  1R5G A;  1ZYR F;  1ULY A;  2NYX A;  1R1T A;  4M71 A;  1TBX A;  2P6S A;  3DV8 A;  3ZN0 A;  3U2R A;  1ZLK A;  2VN2 A;  3V8K A;  4HLY A;  1XD7 A;  1IXS B;  4Q48 A;  4BHP A;  2Y75 A;  2C6Y A;  2XV4 S;  2HDC A;  4I0A A;  1FOK A;  1YTY A;  2MD5 A;  4KIG A;  5AON A;  4MQV A;  1IN7 A;  5CYV A;  3WU1 B;  3FM5 A;  5LRR A;  4ENK A;  2MLK A;  2QLZ A;  5AIQ A;  3L7W A;  1HQC A;  5KK1 A;  1BOA A;  3GFJ A;  4ZYE A;  4DNC A;  3H3U A;  2PG4 A;  3LWF A;  1YW8 A;  5CVV A;  3I4P A;  2DAO A;  2FML A;  1G3W A;  3QPT A;  1W7P A;  4OMY A;  1SMY F;  2EFN A;  3N4M A;  1F4K A;  4CZZ A;  1QBJ A;  4GO1 A;  2W25 A;  4R1H A;  3WGI A;  5E18 F;  4KUM A;  1OYW A;  3Q5F A;  3RIR A;  3FXU A;  1B59 A;  5HVQ C;  3F22 A;  1FYM A;  4L9T A;  2M45 A;  5JI6 A;  4M9Z A;  4MEY F;  1FNN A;  4HV5 A;  5D5W B;  1PP8 F;  5BMZ A;  1IN8 A;  4I7H A;  2K02 A;  3KP6 A;  2V1U A;  4BXU A;  4F7Z A;  2FEZ A;  1HSJ A;  5J8F A;  4HX4 A;  4RB0 A;  3V8L A;  1OKR A;  3RPQ A;  1USS A;  5HS9 A;  2PQ8 A;  3M8F A;  2M1B A;  5L3B A;  2JPC A;  3B73 A;  2XUB A;  2CG4 A;  2PMU A;  2KJC A;  3P7N A;  2J5P A;  4LB6 B;  1WSU A;  5H20 A;  5BS6 A;  2F5F A;  3ISP A;  1P6R A;  3LFK A;  5ILS A;  5DUK A;  1XSD A;  2FXA A;  2DPD A;  3DPL C;  4M6X A;  4YII A;  1DP7 P;  2UXX A;  2IPQ X;  3REO A;  1B9M A;  4G9Y A;  2OQR A;  5DUI A;  1IRG A;  4MQ9 F;  1UHW A;  5ILV A;  2H27 A;  2WC2 A;  1BIA A;  1G3Y A;  1Z6T A;  2XHK A;  1P4X A;  2A07 F;  2VT3 A;  2DBB A;  1Q1H A;  2GWR A;  4M74 A;  1S29 A;  4O5V A;  4I2O A;  2DK5 A;  1TW3 A;  3EYY A;  1K78 A;  4A5N A;  2VBX A;  2VT2 A;  2JSC A;  3KFW X;  3M1E A;  2STT A;  5K5O A;  3FMS A;  5FLX K;  3HRM A;  1P2F A;  4KN7 X;  3CTA A;  2A3S A;  5ED4 A;  2LSO A;  2W24 A;  3V4G A;  3KP4 A;  3WTW C;  1BJA A;  2RN7 A;  2CSO A;  3DEU A;  2O8X A;  4MHG A;  1B9N A;  2QZ8 A;  3R60 A;  1IRF A;  1BI3 A;  3KET A;  1KGS A;  3MWM A;  2XAG A;  3F8M A;  1QPM A;  1YS7 A;  4HAM A;  2OQG A;  2GXB A;  4U7B A;  1HW1 A;  4IRI A;  3C18 A;  3ZQ7 A;  4RGR A;  5E20 A;  3BY6 A;  6PAX A;  5DCM B;  1REP C;  4PGG A;  2KIM A;  5FD6 A;  3BWG A;  3SQN A;  1BN5 A;  3WTZ A;  3K69 A;  3I58 A;  4EQQ A;  1XSV A;  3WE3 A;  5E8G A;  1SFX A;  1QZY A;  1FWZ A;  2CQK A;  1XGN A;  1MJA A;  2IJL A;  3GO5 A;  4P55 A;  3EET A;  2XRO A;  1I6X A;  1VTN C;  1J75 A;  3I0T A;  1YO5 C;  4AIK A;  2LF8 A;  2RKH A;  4A6D A;  3DPT A;  3KZZ A;  3TDZ C;  2E1C A;  2L54 A;  4XBF A;  4UUV A;  4ZZD A;  2ZXJ A;  3TKY A;  4M9S A;  3EQL F;  3VOE A;  2R7D A;  1G3S A;  5FFZ A;  5F1R A;  3K9T A;  2ZNY A;  1QGP A;  2MC3 A;  2O0Y A;  2YR2 A;  3FX3 A;  3TDU C;  5K5R A;  4ENM A;  1R1V A;  1JHF A;  4AWX B;  2VOD A;  1U8R A;  1LDJ A;  2ISY A;  3QPH A;  5EEG A;  1U3E M;  1ZLJ A;  3E5Q A;  2UZK A;  3ECO A;  3IKT A;  2EV5 A;  4E70 A;  5BQT A;  3BP8 A;  3K2Z A;  4GYI A;  2VE9 A;  5LHG A;  4FX0 A;  4CO8 A;  1D8J A;  3LA3 A;  5CVI A;  1ODD A;  5L3D A;  1FP2 A;  3L9F A;  1NHA A;  3ZMD A;  1GVJ A;  2W85 A;  5ICF A;  2P5V A;  4Y13 A;  1DDN A;  3Q9S A;  4I02 A;  1FBU A;  3ERE D;  1HBX G;  2YSR A;  3TO6 A;  1FX7 A;  4BHB A;  1O7L A;  5HS8 A;  3I59 A;  2QM3 A;  5LHH A;  3V7C A;  2RC4 A;  5FD5 A;  5K1Y A;  4AVP A;  3C3W A;  1Z6R A;  4HW0 A;  1PDN C;  2K27 A;  1HKQ A;  5CVJ A;  2MBF A;  4IF4 A;  2XKO A;  4G7Z F;  2ESN A;  2JPB A;  2R3S A;  4XSX F;  1KA8 A;  3HTS B;  4ZZL A;  2K7L A;  4FHT A;  1UHM A;  3RPU A;  3KEO A;  5JFR A;  5ICG A;  4DQ2 A;  1U78 A;  1TW2 A;  5JHU A;  2A5Y B;  1I1S A;  1L0O C;  4EM2 A;  3RYP A;  4OIN F;  5A2Q K;  3GFM A;  2YX4 A;  1J2X A;  4RAZ A;  3IC7 A;  2FNP A;  4OOI A;  1O3T A;  3EDP A;  1R5H A;  2VBZ A;  3IWZ A;  3ZMV A;  1ZHF A;  1O3R A;  4FX4 A;  3RYR A;  3G3Z A;  2NNY A;  2ZJ2 A;  1CF7 B;  1ON2 A;  1J59 A;  2ZME B;  4BQA A;  4EMS A;  4LG0 A;  3IL2 A;  4BNC A;  2XGX A;  2YPR A;  5D8K B;  5BPD A;  5DD8 A;  1ZRD A;  3KP3 A;  2Y0M A;  3T0Y A;  2KIU A;  2L4A A;  5D6E A;  4LLL A;  2PEX A;  4EJT A;  3DF8 A;  4O6J A;  3SZT A;  2Z33 A;  4UXN A;  1E2X A;  2JTV A;  3MAJ A;  4Z2Y A;  4HDU A;  4N9H A;  3B02 A;  4EV0 A;  4P9U A;  1H0M A;  4M9X A;  3IRQ A;  4MNU A;  2TDX A;  4PGH A;  1GXP A;  1QQI A;  1R58 A;  2PN6 A;  1R22 A;  2EFO A;  1W5S A;  2X0L A;  4WXC A;  4ENN A;  5D5V B;  2GA2 A;  3JW4 A;  3V7S A;  4L0Z B;  2EK5 A;  4ETS A;  3F23 A;  2E7X A;  5FGM A;  2V79 A;  1R23 A;  4OIO F;  5DCF A;  2VC1 A;  1KU7 A;  2Q0O A;  4ZH4 F;  3O2P E;  3DXJ F;  3R6S A;  5D8L B;  3FMQ A;  1HXD A;  1XDS A;  3R0J A;  2XVC A;  4YFX F;  4KYW A;  1TNS A;  3ELK A;  3WTY C;  3VOD A;  1IN6 A;  2QBY A;  4A2U A;  3BJO A;  2K4B A;  2V9V A;  1MD0 A;  3JSP A;  2DO7 A;  3VEP A;  3DQV C;  1T2K A;  4UVB A;  1WQ2 A;  1TQI A;  2Q2E A;  1YQA A;  3ZP5 A;  4ENJ A;  3R4K A;  2EV6 A;  1ZAO A;  1Z05 A;  3E3V A;  1SMT A;  5F6F A;  1J9I A;  1IZ1 A;  2X4H A;  1RI7 A;  1LJ9 A;  3ABT A;  2XRN A;  1YG2 A;  5CJ9 A;  3P9C A;  2HYF A;  2F2E A;  3E6C C;  3LA7 A;  4UVC A;  3KP2 A;  3ZPL A;  4KIB A;  3WTT C;  3HIF A;  2XAQ A;  5D4S A;  4HF2 A;  3CO7 C;  2Z5U A;  3WTX C;  2QQA A;  4MTD A;  4A12 A;  2IW5 A;  2KIF A;  3F8C A;  3BPX A;  4UHT A;  2P5L C;  1XGS A;  1BBY A;  1I1G A;  3NQO A;  4IHT A;  3WOD F;  3TOA A;  3QP5 A;  3GW2 A;  4OU0 A;  1OPC A;  3L00 A;  1IXC A;  3HUG A;  2VE8 A;  2H09 A;  1K7A A;  4BH9 A;  4ZYD A;  3CJN A;  3GZ5 A;  1BI2 A;  3P9K A;  3L09 A;  2A68 F;  3SHF A;  1LNW A;  1YS6 A;  1FZP B;  3J81 K;  2HTS A;  2P6T A;  3TOB A;  3M7G A;  2EFW A;  3KLN A;  5H6Q A;  3TQN A;  3FMR A;  5HLG A;  3D0S A;  4RGX A;  5JVT A;  3T8T A;  2BYV E;  2CFX A;  2QBY B;  1ZRF A;  3E6D A;  3HYI A;  3WTU C;  2PFB A;  2EA4 A;  4EJV A;  1T38 A;  2OAZ A;  2EFQ A;  3HOT A;  1IN4 A;  2MLG A;  3LQR A;  4NB5 A;  1V4R A;  1LEA A;  1AOY A;  3RKY A;  4KMU X;  1Z1D A;  4KNY A;  5L3G A;  3KEQ A;  3IHU A;  1ZG3 A;  3SZP A;  3U9G A;  5FFX A;  5L3F A;  5LEK A;  5DYM A;  3JAM K;  4HYE A;  5F64 A;  4N9I A;  4ESF A;  2FQ3 A;  2W84 A;  3O3K A;  3LA2 A;  2FF4 A;  3F8B A;  5IT9 Z;  2FBI A;  1W7P B;  3E6B A;  3IWF A;  2FA5 A;  3FF5 A;  3F72 A;  3ZMT A;  1H9T A;  1TNT A;  3FZV A;  3I5U A;  1P4A A;  2QYO A;  4HF1 A;  3NRV A;  3BDD A;  4A5M A;  1FLI A;  3P9I A;  1WWX A;  3HSR A;  2R7F A;  4KT5 C;  4JQF A;  1FBS A;  3MCZ A;  2XIG A;  4IVN A;  2DFI A;  2IA2 A;  3WTS C;  2CWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...