3A01B

Crystal structure of aristaless and clawless homeodomains bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
RRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeodomain-containing protein
publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Gene regulation/dna
total genus 20
structure length 57
sequence length 57
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a01B00
1GV2A 3WHBA 3VPRA 5EZHA 2XGCA 5FKLA 4JX4A 4RDUA 3HKZN 2K40A 4V2GA 3JRBA 2TCTA 5E3NA 2DMTA 2XPVA 1TWGJ 2ECCA 1IV6A 1F36A 4FE4A 1GV5A 3LOCA 2ECBA 3GTKJ 3GTGJ 1MBGA 1S7EA 2LVSA 5JLXA 2O9LA 2E2JJ 2DJNA 3B6AA 2O8KA 3IH4A 3QPSA 3K2AA 3Q0UA 1XG1A 4Y52J 5C4XJ 1OJLA 1BW5A 1Y1WJ 2JJ7A 1ZKGA 3RQIA 4UUSA 2HI3A 3B6CA 5EF6A 2E2HJ 1MBHA 3A02A 5F0HA 2DA2A 2Y0SN 3LNQA 2Y2ZA 1HCRA 3PO3J 1IDYA 1VI0A 3CCYA 1NK3P 4G12A 4MIMA 3HGGA 4C3IJ 2LTPA 1AKHA 4IHXA 3JRHA 1OFCX 1B72B 1K83J 2CQQA 3G1MA 2L0KA 4RBOA 2DA6A 1HDDC 3GTMJ 1F43A 1WCMJ 3ZQGA 3Q3SA 3D1NI 2JMWA 3F0CA 4BBSJ 5IYBJ 1JTYA 4FE7A 5EEAA 3GBGA 1Z0XA 3C2BA 1GVDA 5J3LA 3OSGA 4XIDA 4A3BJ 4IHVA 1UG2A 2CRGA 3RZOJ 2E19A 2YS9A 4D7NA 1WPKA 2FQ4A 3BG5A 2ELKA 2DA1A 2DTZA 4A3FJ 2OPTA 3TW7A 2NVTJ 2JA5J 5EGOA 2QF7A 3A01A 2YUSA 4FTHA 2QCOA 3GTQJ 5GPCA 1JKRC 4CYCB 5IOYA 2AHQA 1BA5A 1FTTA 2M0CA 2MSYA 1XS9A 2XRLA 1MBJA 2LK2A 3MN2A 3I4NJ 1U8BA 3S2DJ 2L7FP 3BQYA 3PM1A 1ZK8A 1IDZA 5BNGA 1O4XA 1U9NA 2EZLA 4DYCA 3BTCA 2VUMJ 4QIWN 1BW6A 4DYRA 4JP0A 1MH3A 2AO9A 4EEFG 1EF4A 5IOZA 2JA6J 2FD5A 2XGEA 5F04A 1ORKA 5M3MJ 1T33A 4B3AA 4A3KJ 1OCTC 3TEDA 1WH7A 1HDPA 1ITYA 4MFDA 4W97A 3RZDJ 3OIOA 1APLC 1DU6A 2Y9ZA 2FX0A 2GBYA 3BG3A 4C3HJ 2NVYJ 2HOAA 1HLVA 3S1NJ 3WHCA 1TWHJ 2JWTA 5E3MA 3FKIJ 5J1YA 2ID3A 1ETWA 3BR0A 4BY1J 2HXIA 1I6HJ 5FLVA 3BR3A 2L9RA 5M5YJ 2JA8J 2X9DA 2R5YA 2NVQJ 1IUFA 1JGGA 3ZQFA 4DYQA 4LOCA 1D5YA 1QRYA 5J1UA 5EZGA 4DW6A 1P7IA 2EQRA 1AKHB 4M6VA 3MKLA 4I6ZA 1JKQC 3E7LA 3JR9A 2I10A 3ZQLA 5E3OA 2CQXA 2R92J 1NTCA 4M3FA 1ETQA 5GPAA 3LSPA 1RPWA 3CQZJ 3G1OA 4W1UA 2X6OA 1WH5A 2WB1N 5FLMJ 2JA7J 2YU9J 1AHDP 3TP3A 4JX6A 1IRZA 1JJ6C 3O8GA 1W0TA 5E3LA 1U9OA 1QVTA 3FK7A 2DA4A 2XB5A 4BXXJ 1LE8A 1YRNB 4C2MJ 4JX5A 3BQZA 4MFEA 4L5EA 4BBRJ 3A01B 1ZR4A 1NK2P 3FISA 1MSEC 3A03A 5K7HA 2VKEA 1R9TJ 2DA5A 4NDLA 3G1LA 4A3MJ 1GT0C 5K7ZA 4XRMA 1RKWA 1E3OC 1POGA 2M8GX 2HOTA 3ZOBA 2D5VA 1VNDA 4B4CA 1JKOC 4A3CJ 5DTDA 5FJ8J 3LSGA 3HOXJ 1FIPA 1JTXA 3M3YJ 5F0FA 1RETA 2KT0A 3IH2A 3HM5A 3JRCA 5K7FA 1VFCA 1K61A 2CUFA 2EZKA 3BR1A 3HEFA 1IC8A 1B8IA 3NAUA 4A93J 2NS7A 2XPUA 3BTJA 4MO7A 2X48A 2JN6A 4MLOA 5F1JA 5M3FJ 4HNVA 4M3EA 2WV1A 1ETXA 3HB9A 2DMQA 3LSRA 4QSHA 1BL0A 1GDTA 5EDNA 4Y7NJ 1FIAA 2XB0X 5IPAA 4V2FA 3GTPJ 1ETVA 1MBFA 2NS8A 1JUSA 3M4OJ 1GUUA 4M3DA 1OCPA 3GTJJ 1H8AC 3SJMA 2G0EA 2LY9A 4A69C 3UKGA 5EG0A 1H88C 3QPLA 3HGYA 1RKTA 1JT0A 3SDGA 4QTRA 1FEXA 3RKQA 4IHWA 2W48A 2IEKA 5IP7J 1TC3C 5IP6A 3S16J 2VKVA 5F08A 1Q1VA 2L7MP 2DA3A 4A3EJ 1AU7A 5IYDJ 4AC0A 3W6VA 4XICA 3HOZJ 2DMUA 1MH4A 1TWAJ 4M3GA 2OF7A 3LSJA 1A5JA 4GFBA 2E2IJ 1H89C 1JUMA 1TWFJ 4X6AJ 4FCYA 2IBDA 4XRSG 2K9NA 5FKNA 1JT6A 3CMYA 4ABZA 3ZQCA 1JJ8C 3I4MJ 1WGXA 2MW8A 4BKXA 3SFIA 1U78A 1X58A 1SANA 2LLKA 2LR8A 4UUSB 2HDDA 1WI3A 2CUEA 1Z77A 3HOVJ 3S1QJ 4A3DJ 3JRGA 1QPIA 4DZJA 2ZB9A 1LE8B 4BY7J 5DS9A 2IAIA 4XRSA 4M3BA 1MBKA 1FTZA 2WAQN 2NOGA 2RAEA 5C3EJ 3JRAA 2DN0A 2XPWA 3O8HA 2E1OA 4C3JJ 4S0HB 5FKOA 1PUFA 2CJJA 2M9HA 5IP9J 5C44J 2ID6A 3BR5A 2PMZN 5FKMA 2DMNA 3ZQHA 1IG7A 3TW6A 1JUPA 3BTLA 2MGQA 3IV5A 2VPRA 5C4JJ 1I3QJ 5IYCJ 1T56A 1FJLA 3TP0A 4J19A 1B8IB 1ZGWA 2MG4A 2M2EA 3BR2A 2N8GA 4B1RA 2JK3A 4A3JJ 2H1KA 3H0GJ 5EGOB 3JRDA 3S17J 1MNMC 3BG9A 3BR6A 2R5ZA 3IH3A 3S15J 5FKKA 5HODA 3HBLA 2ME6A 3PO2J 3HOWJ 3DCFA 1RESA 4AUXA 2M34A 2COBA 2ME0A 1MSFC 4FISA 5M5WJ 1LFUP 2GM4A 1LFBA 2XGDA 2DMPA 3HDDA 3JRFA 1VF9A 2R93J 5JLWA 4AYBN 3Q0VA 1P7JA 4XK4A 3S1RJ 1W0UA 5EG0B 2EZHA 4IHYA 2R0QC 2O7OA 4A3LJ 1HF0A 1ETOA 9ANTA 3ZQIA 3FK6A 1Y1VJ 1ZTRA 1DU0A 1HOMA 2Y31A 3H3VK 3GTOJ 4IEJA 4DZPA 1G2HA 2TRTA 1MBEA 2L7ZA 4D5CA 1I50J 2Y9YA 2LP0A 1IJWC 4A3GJ 1UHSA 3FIWA 4I76A 1YRNA 2B63J 1A6IA 4D5FA 4UUTA 1ETKA 2DA7A 2XSDC 1CQTA 1QVUA 2Y30A 2LFBA 5J1RA 3JREA 3JRIA 2CU7A 3S1MJ 3BTIA 4JYKA 1B72A 2EBIA 2NVXJ 2EZIA 3OSFA 2GLOA 2LD5A 3DEWA 2R5YB 1ENHA 3HOYJ 1XC5A 1RR7A 2HYJA 2HQ5A 3Q0WA 3S2HJ 2EH3A 5F27A 3OOUA 3QQAA 5GP9A 3CDLA 3K7AJ 5M5XJ 5F0CA 3L1PA 3S14J 1ETYA 1ZQ3P 1PUFB 2H8RA 2HXOA 3NARA 3HOUJ 1IGNA 2VI6A 1TWCJ 4A3IJ 4D7MA 2LKXA 2HOSA 4CYCA 1BJZA 1SFOJ 1ZR2A 1X2MA 2K9SA 2P81A 3MVPA 1UMQA 5EYRA 1X2NA 2K9QA 3GTLJ 2KDZA 2R5ZB 4X1EA 1JKPC 2R7ZJ 2FJ1A 3BT9A
chains in the Genus database with same CATH superfamily
2GWRA 3I64A 3OS2A 3VPRA 1DGWY 4BHPA 2XGCA 5FFXA 1Z3YA 2KISA 4RAGA 1DDNA 1BI3A 3HKZN 3G73A 4M71A 4XSXF 2CW7A 3W2VA 2B0LA 3TDZC 1I27A 3E97A 3OWTA 5E3NA 4U0VA 5EEHA 2RN7A 3IWZA 5HVQC 2F5EA 1R22A 2XF6A 1SMYF 4IX7A 1MMAA 1VQKI 2M30A 3GTKJ 4G7OF 5JLXA 1L3LA 2BYVE 2FU4A 1WFXA 3CCLI 2O8KA 3IH4A 4HF1A 3CUOA 2ESHA 3HPGA 2FXAA 2YX7A 3GCMA 3E6CC 4AIKA 3N05A 2MD5A 4EQQA 2WTEA 3VFZA 2M5WA 3CJTB 2BXZA 2JJ7A 1Y1WJ 1ZKGA 3RQIA 3H9JA 2HI3A 2ZXWH 5EF6A 1O3RA 4ZYHA 2EV5A 4GYIA 4L9JA 3K1MA 1H9GA 2OQRA 2CUJA 3CCYA 1NK3P 5E20A 4MIMA 5DD8A 3JRHA 1USTA 1HDDC 2CQQA 2BZTA 2OCCH 1F43A 4EJTA 3T1BA 3Q3SA 4KJZA 3RYRA 2R7SA 5ERIA 2JMWA 5BMZA 2VKDA 3S32A 1ACIA 5EJCA 5ICFA 2DU9A 5IYBJ 4QPOA 2QKMB 4FE7A 4HV6A 3ZN0A 2X51A 5D5XB 3HZJA 5E1XA 5B1BH 5J3LA 2B9SA 4A3BJ 5E17F 2CRGA 3D5LA 2HZDA 2F4OB 2YS9A 5ILSA 2CS3A 1SD7A 2DTRA 2ELKA 2DA1A 4ETSA 1MDMA 2KMUA 3ZN1A 5KAIC 5EGOA 1W7PD 1EH8A 1ZHFA 2JUGA 2PJRB 1IRGA 3I5UA 3TGNA 3G3ZA 2NRAC 2QGUA 2D1HA 2H09A 3VYRB 3C7JA 4BNCA 3FXJA 3MN2A 5ICGA 2DT6A 1R36A 4F52A 4NQWB 1R4MB 1WJFA 3B73A 4JOMA 2CFOA 1TL8A 2DFHA 1XMAA 1VZ0A 3OYMA 4AIHA 2MBFA 1R4NB 5F6FA 4DYCA 2RNGA 4XLCA 4QWQA 4QIWN 5LBQA 2V6CA 2VC0A 2HYGD 4C30A 4EEFG 4XR6A 1HXDA 5D8LB 1JGSA 2FD5A 2VIXA 4ZYEA 1YX5A 1YITI 1IZ1A 2NAZA 1ORKA 2VBXA 1K6OA 5M3MJ 1FYKA 4CZZA 1T33A 4CCMA 1XCVA 4J01A 1V5GA 3TEDA 2Q2EB 1WH7A 2EV6A 3TO7A 4RB3C 2BGCA 2MD0A 3OIOA 2Z16A 3WU0A 2Y9ZA 4LB5A 1QHGA 3TOAA 1B8IA 2GA1A 2DOAA 4HZFA 4P5OA 1Y8QB 3W6JB 2M7BA 4N9HA 5KAFC 1UJ8A 4KN7X 5E3MA 2MFZA 3VOEA 1XGSA 3HOTA 1L0OC 3KFWX 3QRFF 4BY1J 1GXPA 1I6HJ 3I4PA 3CMMA 2PMZA 5J47A 2Q0OA 3OIPA 5M5YJ 2JA8J 1YS6A 2X9DA 1XD7A 5B5EC 1IUFA 2A68F 4ZTFA 4M9XA 5TISC 3J7ZI 2VPLA 4I6ZA 1JKQC 1FYLA 3OR1C 1FWZA 2K3PA 2F48A 3JR9A 2QBYA 2RVCA 4II2A 2RDPA 1NTCA 1ETQA 3CZ6A 4IXAA 2DYSH 5LRRA 1RPWA 3CQZJ 3G1OA 1BBYA 4HNTA 4LLNA 3RSNA 2GA2A 1O57A 2WB1N 1FY7A 2QWWA 2JA7J 3JSPA 5L3DA 2A6EF 4ASNA 2MLGA 1LB2A 5E3LA 5DD4A 1M1EB 5D5WB 2R7QA 3FK7A 4Y15A 3VSKA 5HLHA 2DA4A 1USSA 3DWLE 2QSHX 4Q4ZF 1LE8A 4AYBA 2LC2A 1R1UA 3LFKA 1HKTA 1W5SA 5E8IA 3V42A 1ZR4A 1NK2P 2E1CA 3DTKA 5L3FA 3M07A 4A5NA 2DPUA 4A3MJ 3JSOA 3BY6A 5J8CA 1E3OC 4CHUA 4LB6B 1XMXA 2CQNA 5DTDA 4RB0A 3LSGA 1FIPA 4II3A 4A12A 3F23A 1WJDA 2EFPA 3M3YJ 1RETA 2GZWA 1D8KA 2KT0A 3LL7A 4GGGA 3FF5A 2QA4I 3KEQA 4RAZA 1U2WA 3CC7I 3HEFA 3V8LA 3C3WA 3ABTA 2NVUB 1R23A 3WTVC 2XPUA 4JBAA 3OYKA 1UELB 1G3WA 1MJ9A 5CJ9A 2COMA 2JN6A 4Y3OA 5B3SH 3QOEA 3J7AO 4PJJA 4M3EA 2WV1A 1F4KA 1ETXA 3HB9A 3LSKA 2DMQA 1LQ1A 4BU2A 1QPMA 1BL0A 1FLIA 2V6EA 4Y7NJ 2L4MA 4NB5A 3OYHA 4NBQA 3HC7A 3OYLA 2CW8A 2M0MA 3PJRA 3W2AA 1YHQI 1MBFA 3EYYA 1JUSA 2M3AA 4M3DA 3ZMUA 3WTWC 2PLYA 3OYDA 2E5NA 2G0EA 4A69C 4F91B 2DK8A 1H88C 2WADA 4F92B 3DTIA 3QPLA 2RQQA 1JT0A 1D1CA 1FEXA 2M45A 1NHAA 3QYEA 5FLXZ 4I0BA 1TC3C 4EGYA 1GVJA 2LKPA 2LOOA 2PQ8A 2VKVA 3S2WA 3DU5A 4A3EJ 1UAAA 2QBYB 5IYDJ 4IOAF 2R7TA 3LSJA 2Z9OA 1X1DA 3OYAA 4I02A 2R7FA 3M8EA 4FCYA 2IBDA 1XX5A 2K9NA 2O6GE 1JJ8C 3K0LA 2FMLA 1WGXA 4E7SA 1WJEA 3TO9A 2CH0A 2ZFUA 2DO7A 1FBQA 4ANJA 1IAWA 1DP3A 2L5QA 1JE8A 2LLKA 1WI3A 3D0SA 1Z77A 3S3OA 4OINF 3K4CA 3JRGA 2ZB9A 1LE8B 4RB2C 4HX7A 1D1BA 4U88A 4XRSA 2EFNA 2HKXA 3PUBA 2UXXA 2P8TA 4OMYA 1MBKA 2WAQN 4A6DA 1VQ7I 5DUIA 2DDBA 2E5ZA 1BOAA 3ZMDA 2V4JC 2GOXB 4ZDLA 5FKOA 4UVBA 1PUFA 2KJBA 1KA8A 4KDPA 1OYYA 4KMUX 5IP9J 5H6QA 4UVCA 1ZRDA 1N75A 4K2EA 2ID6A 3GVAA 2G7UA 2JPBA 2DMNA 5FKMA 3K4KA 3ZQHA 4DOZA 1IG7A 2XUBA 2CGPA 2VOOA 3BTLA 3QYBA 1WJCA 5IYCJ 1T56A 2P4WA 1OR7C 3WGGA 4J19A 1QO0D 2MG4A 2QYOA 3ZPLA 1WI9A 3OYBA 3H0GJ 3S17J 3JRDA 3CF5F 1MNMC 2F5FA 1D0XA 3CC2I 5ICCA 3CDHA 1SD6A 2WY8Q 3OY9A 1W4MA 1LEBA 3FHNA 4HBLA 5EEGA 1X4OA 2BW3A 5LGTA 1IXCA 4I09A 1FMVA 5HODA 3CCSI 2CMPA 4HA8A 3PO2J 5GAEJ 3QP5A 2GOMA 4X0GA 4AUXA 4G6QA 3T8TA 5J6XA 3OYEA 2ME0A 3CCEI 1SAUA 4FISA 2NNYA 4HSRA 2XGDA 3F21A 3HDDA 3QAHA 2PMUA 2VL8A 4XK4A 1W0UA 2W25A 3ASOH 2GXBA 4YEJA 2TDXA 3J7AY 4PGGA 3PQJA 5LGUA 1Z3XA 3RJPA 4XOPA 2L7KA 1Y1VJ 3SZTA 3A0BC 1VQ4I 2LY1A 2M4GA 3CD6I 2CWEA 4D5CA 2Y9YA 2HNHA 4CH7A 2KPMA 3Q9SA 3CTAA 2L01A 3P9KA 4G6DA 1LDJA 1UG0A 1V55H 2K9MA 2XHKA 3BPXA 2CYYA 5HS9A 3SDBA 3EUKL 3V8KA 1HW2A 1YRNA 4HX8A 2MC4A 3ECOA 1CQTA 2FNPA 2LFBA 5HLGA 3KIOA 3JRIA 1OYIA 1TNSA 2CSOA 3BTIA 1B72A 1R6RA 4PJNA 1ZLJA 3N97A 1QGPA 1VQ6I 2FQ3A 5LLQA 2HTJA 2ZJQF 5GAGJ 1MJAA 2UV1A 3WG7H 3AL0C 1IN4A 1LKXA 5F27A 4WWCA 5GP9A 2IGOA 3EPZA 3DEUA 1ZRFA 3BZCA 4GO1A 1PUFB 1YIOA 3CCJI 2H8RA 1XPXA 2FOKA 3HOUJ 2VASA 4N0BA 2LH9A 1OKRA 3F6VA 1TWCJ 4BJ6C 3R4KA 4D7MA 3H5RA 3L2QA 3K2ZA 2MABA 4PSWA 4YIRX 1SFEA 3MAJA 4BHCA 4CYCA 3MKZA 1SFOJ 3B02A 3IKVA 4H4KC 5KHDA 2K9SA 4A0XA 3WTSC 1BC8C 1FZPB 5FD5A 4OIOF 5EYRA 1X4PA 1D0YA 1KU7A 5BQTA 4Y13A 1STZA 3OYFA 3TKYA 4HX4A 2FUG2 5FLXK 5EZHA 3FM3A 4JX4A 2K4BA 1IXRC 4M6YA 4CA0A 2I5UA 1KYWA 4V2GA 4ENNA 2E7XA 1MMSA 4HLXA 4V19K 2X6XA 3DP7A 3E0JB 2O3FA 1PYVA 2XPVA 1VQNI 1LUJB 4ZZDA 1LVKA 4BQAA 1HW1A 3PFIA 3FMQA 3AL0B 1GV5A 2IS1A 2ECBA 1P4AA 3G2BA 1HA8A 4L18B 3SHFA 1IN5A 2KIUA 5CQEA 3AAFA 5BPDA 3WGHA 2LMDA 2K4JA 3VYSB 4XLFA 1XSDA 3B6AA 2IS4A 3JAMZ 2HPIA 3RKYA 3G6EI 3DLLF 3QPSA 3K2AA 4U87A 1ZN2A 2HU9A 1XCBA 5C4XJ 1KU2A 2E2HJ 4UUSA 3LMMA 4CCLA 1MBHA 3A02A 3GYHX 1VQMI 4KNYA 1RC9A 5F0HA 2ZSIB 2XKOA 3NQOA 2MH2A 1IN6A 2Y2ZA 1TLHB 3I3LA 3ZGKA 1VI0A 3ELKA 4HSTA 1KONA 4G12A 2PI0A 2V1DA 3SXYA 1H9TA 4EJUA 1B72B 2X6YA 3ZMVA 1WHUA 2OC6A 1WCMJ 4PJLA 2FBHA 2J5OA 3P5JA 4B47A 1F9NA 1FX7A 1MZBA 2IXSA 1G8XA 2OZ6A 2K02A 3C2BA 5E79C 3WU2C 2CUZA 3CLOA 4CYDA 5LFAA 3OSGA 2MH9A 2PMHA 1U3EM 4ESBA 3DFGA 1PJRA 1TW3A 4BUPA 1GHCA 1HSJA 2F5VA 3BG5A 1NH3A 5BPIA 1U6GA 4KFCA 4HDUA 4XLHA 4E7JA 2OPTA 3KYDB 3FDYA 4HEA2 2DXIA 2G9WA 3G71I 3IHUA 5CYVA 5JHFA 2O8XA 2QCOA 1ON2A 1JKRC 4CYCB 1TQPA 2WY7Q 4IVNA 1P4XA 2M0CA 2XRLA 5K5QA 2A69F 5K5RA 1MBJA 4IHSA 4MTDA 3KCCA 3S2DJ 4CCKA 3TL4X 1DQUA 2L7FP 3BQYA 4NHJA 4XKWA 3F8BA 3PM1A 3OS0A 3R0AA 5JI6A 1YIJI 1U9NA 4U7DA 1P92A 2KFDA 4IPAA 1VQLI 5D6FA 3REOA 1UHMA 3DPUA 2Q8KA 3HTUA 1MH3A 2AO9A 4CGZA 1S6LA 1YQAA 2VONA 4UB6C 2JRTA 2HVQA 1EF4A 2FE3A 5IOZA 2JA6J 4TV7A 4IKFA 5F04A 4PFPA 2ELJA 2XF7A 3BC8A 1SFUA 1FP2A 2MA3A 4P96A 1ZELA 1B9MA 1HDPA 1BR1A 3M8FA 4HNUA 3GW2A 1APLC 1J9IA 2A6TA 2GBYA 2ZJ2A 3ONQA 3H35A 4C3HJ 2NVYJ 3HRSA 3KP6A 2H6BA 4LGWA 4XLPF 4EATA 5FRMA 3E5UA 3FM5A 4I2OA 1IN8A 3CESA 4L9VA 2H1LA 2ID3A 3ZCOA 5J1YA 2QUFA 3LSMA 1TBXA 2F2EA 3F8NA 2HXIA 5FLVA 2KZGA 1I3AA 1ZG3A 3O3KA 1I6XA 2HWVA 2ZSHB 3V8JA 3CP2A 2EWNA 4MNUA 4HQMA 1QRYA 5J1UA 3TBIA 4KYWA 2O61A 4E7ZA 2EQRA 1SAXA 1ZARA 4M6VA 3L9FA 1WRJA 2I10A 4MHGA 3HUGA 4A0YA 1YO5C 3ZQLA 3MEXA 3ZMZA 1Y56A 2R92J 1IW7F 1N78A 4M3FA 2BV6A 3L09A 2XROA 2IPQX 2W00A 3ZR8X 1WH5A 2X4HA 4U7BA 5FGMA 2YU9J 1WKMA 4CDGA 1IRZA 2QM3A 4KIFA 2CW0F 4Y4RA 2L4AA 3ESWB 3VB2A 1AOYA 2K3FA 1QZYA 3H9GA 3CCVI 2DAOA 4XORA 1W0TA 2V1UA 1WQ2A 2ESNA 5BS6A 3ABUA 1LDKB 2BHYA 3HTSB 1IRXA 4BXXJ 1TW2A 1OPCA 3AFHA 3K1PA 3KE2A 3V7RA 2EA2A 4L5EA 2OD5A 3GFJA 3FISA 1MSEC 5CVJA 2E35A 3A03A 4E6KG 5K7HA 5LHHA 4OIQF 2P7VB 2VQCA 4NDLA 1GT0C 3DEEA 1Y8RB 2RREA 3H1CA 3BCBA 1JKOC 2KDOA 3KEYA 4A3CJ 2PEXA 2K85A 1LVAA 4AWXB 3HOXJ 1JTXA 3DTEA 4R1HA 1AA7A 5F0FA 4A0ZA 2NYXA 3IH2A 4U0WA 3CCMI 4CCOA 2M4KA 5K7FA 3S3NA 2H6CA 2K9LA 4XL9A 2EZKA 1YE9A 3JAMK 4XLAA 3H92A 2OA4A 4PSXA 4C9YA 4RS8A 4A93J 5LRSA 4MTEA 2V1XA 5CLSA 5A2QK 5JR3A 3DPLC 3RYPA 3RIRA 4G7ZF 5F1JA 5M3FJ 3R0JA 1Z05A 3I0TA 3E5XA 2EB7A 4RM3A 3WTZA 3CO7C 1GDTA 5EDNA 1FPQA 2E36A 2L02A 4HDVA 1FIAA 2XB0X 3GLLA 4I7HA 1BI1A 1G3YA 1BM9A 1Y0NA 4IZZA 4YFKF 3M4OJ 1OCPA 1H8AC 5ICEA 3UKGA 2CQKA 1D3YA 1W7PA 5KVRA 1JI8A 1EH6A 3BDDA 4LG3A 2XASA 3ABMH 1Z7LA 2QEXI 4IHWA 5JVTA 3S16J 5IP6A 2JUCA 2DJIA 2KHMA 5F08A 2DA3A 4L5IA 4ON0A 1K78A 1AU7A 3W6VA 3HUGB 4XICA 4RGUA 4BJTA 4M3GA 5LHIA 4GFBA 3EETA 4I01A 1JUMA 1JHFA 1K6YA 1TWFJ 2RC4A 1REPC 2R7UA 3M1CA 4ABZA 3I4MJ 2D2WA 3RTRA 3Q9VA 3CDIA 2MW8A 3DBRB 3CMEI 3BP8A 5L3EA 2VOPA 3K70D 1T0FA 1SANA 3UR3C 3L2WA 4KIBA 3L2UA 1MMGA 4NC7A 1RIOH 3QWLA 5F64A 2HDDA 4DGWB 1IV8A 5LGNA 4UHTA 3WTUC 2ADUA 3R61A 4HYEA 4BGDA 5HDNA 4IL6C 2IRFG 5C3EJ 3O2PE 3C1DA 2XPWA 3O8HA 3CO6C 1P6RA 1A31A 3MCZA 2E1OA 2WB1A 3HRUA 2ZCWA 2HEOA 1BN5A 2EINH 3G4SI 2CJJA 3BJ6A 3QOPA 4HOBA 1W5TA 1DUXC 2BE5F 2PMZN 2XV4S 2XVCA 3CC4I 1TTYA 4EJVA 1JUPA 2Y75A 2CV1A 2Y0SA 3IV5A 2VPRA 3SZGA 4ZYAA 5H2FC 3NWSA 1E3PA 4G6TB 3KLNA 1S9HA 1FJLA 1ZGWA 2M2EA 1MDMB 2N8GA 5E18F 3V4GA 2JK3A 4Z2YA 1YJ9I 2PJPA 1G6NA 5EGOB 3FHZA 1YTYA 3ZRGA 1T0FC 3BG9A 3BR6A 3K10A 3RCOA 2IW5A 1Q1HA 3S15J 2JT1A 3KPHA 4HLYA 3P9CA 1KU3A 3HBLA 1R49A 2PN6A 2L3DA 2ME6A 3HOWJ 3AG2H 4M73A 2UXNA 1SFKA 1RESA 4YIFA 2M34A 4HF0A 5D5VB 4M9ZA 2RNJA 3LWFA 3BPVA 2XRNA 2Z99A 1B6AA 5CVVA 2HR3A 1LFUP 1E3HA 2HQAA 2GM4A 3WU1B 3JRFA 4OWRB 1VF9A 2R93J 5JLWA 4AYBN 3SYTA 3S1RJ 2QSGX 1W7PB 2R0QC 2O7OA 2R7XA 1ZLKA 2ZMEA 2Z3YA 1P9QC 4B43A 1HF0A 2W82A 2STWA 4C2UA 1ETOA 3K6GA 2XAFA 1HOMA 2GAUA 4CSWA 1X3UA 1DU0A 2OZUA 3H3VK 4BACA 1K78B 3GTOJ 4XBFA 3IRQA 4LFUA 4Q47A 3FXKA 1MBEA 3L2RA 1T39A 1ODDA 3F9KA 2XIGA 3VDXA 3KYCB 2FEZA 4WXDA 4A3GJ 2K86A 4ZTJA 1UHSA 1VQ9I 4I76A 2FA5A 2B63J 4UV9A 4BS9A 4GCVA 1G3SA 1MW7A 1OISA 3TMOA 1T98A 1ETKA 1XDUA 2DA7A 2XSDC 1QVUA 3BZKA 3A4CA 3MZ8A 2CU7A 1QNTA 4JYKA 4RA2A 3ULQB 4E70A 2VQLA 2IS2A 3AKZA 2DFEA 1SMTA 3KP5A 4XQFA 2K27A 4JQFA 4IRGA 1WJBA 3S2HJ 4MQVA 4A6EA 3IUOA 5KNLA 5ED4A 2ZMEC 3GEZA 3SQNA 2ICWG 5FO5A 5DDGA 3S14J 3U9GA 3K1NA 3IAM2 3PSIA 1JHHA 2ZC2A 3FKJA 2IS6A 2DQLA 2OQGA 3J80Z 1XB4A 2R7DA 5HNFA 1HQCA 2DLLA 4P55A 1G4DA 3I55I 3BOQA 3K4LA 3DF8A 1BIBA 2X1EA 5IT3A 5HOOA 3FMSA 4KUMA 1X2MA 2P81A 4PZJA 1R7JA 3DV8A 1UMQA 2D45A 1S5LC 1X2NA 3CMAI 2K9QA 3ZMSA 2LBFA 2ISZA 2KDZA 2GXAA 2F4IA 4B44A 1S29A 3FMRA 2ZKZA 3QU6A 4BQOA 1QHHD 5HDKA 5CKTA 1FP1D 2W85A 3FXQA 3VEPA 3GO5A 4KIGA 4RDUA 1EJ9A 3EQLF 2K40A 1VQPI 3JRBA 2VBYA 2TCTA 4PCQA 3RKWA 2DT7B 2DMTA 2LNBA 1TWGJ 3M8JA 2ECCA 1IV6A 3H5NA 1F36A 5LHGA 3MZHA 5D6EA 3LA7A 4FE4A 4XNFA 5K1YA 5D4RA 1MBGA 2L9SA 2ZMEB 3GLXA 4OU0A 2LVSA 1MJBA 5CPRB 4BEHA 3DQVC 4LK0F 1SVLA 2VLAA 3Q0UA 4YIIA 1XG1A 4Y52J 2RGVA 2VKHA 1BW5A 3FX3A 4RGRA 1YJWI 1VQ8I 1RUNA 3ERED 1OCCH 1BOBA 2DA2A 4M9SA 3LNQA 2H94A 2KL4A 3F22A 5GAHJ 2QQ8A 4BE1A 2DYRH 3X2QH 3PO3J 5J8FA 2HVSA 4IHXA 3DKYA 3FBIB 3KZIC 4M72A 4GXOA 1ZH5A 1K83J 2L0KA 3GTMJ 2DA6A 3DKXA 3PNYA 3F6OA 1Z67A 2EK5A 4WXCA 3EYIA 3ZQGA 3OR2C 2IA2A 4S04A 3D1NI 3IAS2 2ACJA 2GQQA 2E1MC 2XAJA 2W24A 4BBSJ 1OCOH 3D5SC 1YFHA 2HVRA 1Z0XA 3W2WA 3MWMA 1GVDA 1SVOA 4IRHA 3V7SA 1MNEA 4M6XA 3N4MA 1S3JA 3RZOJ 2XDVA 1HKQA 4D7NA 2R7OA 1F1ZA 2WC2A 2P0WA 5LD2C 1CF7A 2NVTJ 2DFFA 3LA2A 2XC7A 3JCUC 1UZCA 4P9FA 4R8HA 3A01A 4ESFA 3JTHA 1I1GA 5GPCA 3BCAA 5IOYA 1BA5A 2MSYA 4R79A 5BOXA 2LK2A 4OAYA 1ZAOA 4ITVA 2EFQA 4EM0B 5H20A 5LEJA 3HIFA 4BHBA 2LBFB 4AIDA 1O4XA 2HPMA 1EA3A 3W3CA 2Z5UA 1IO2A 3PIOF 2A05A 3BTCA 3VYUB 1BR2A 2VQGA 2DQRA 4DYRA 2PG4A 3CUQA 2A5YB 3RI4A 2EIKH 4XMYA 2ZNZA 3M1EA 4RAFA 4XRFA 4B3AA 4A3KJ 1MGTA 1FNNA 2E1MB 5DM7F 1RR8C 3OYCA 1ITYA 3RZDJ 2EILH 5DYMA 1DU6A 1KYZA 4WK8F 3BG3A 1Z91A 2KKOA 2V79A 2FBIA 1HLVA 2LDUA 4XKCA 3S1NJ 4BEHB 3C2GA 1FOWA 2L2OA 2JWTA 3HHGA 2BW3B 4ZDPA 3FKIJ 1XSXA 4IO9F 2HQRA 2WAEA 4E7KA 5IT9Z 1ETWA 1K4SA 4UB8C 4XONA 1PP7U 3I58A 1LDDA 3BR3A 3VSLA 1FSHA 2XSJC 3WTYC 3DXJF 2DFIA 2GIZA 2R5YA 1W36D 4RLFA 4S05A 4LOCA 3HOSA 1SD5A 4RAYA 4D0PA 5EZGA 4DW6A 4PUSA 2PBIA 2XAQA 2R7RA 2BY3A 3F72A 3DLAA 2VJ4A 3E7LA 2K7LA 3MKLA 4GRIA 3J80K 2FBKA 3CUQC 4LIVA 3T0YA 1T95A 2OAZA 1GXQA 3E1SA 5TGTA 2BHZA 5D8KB 5GPAA 3LAJA 1WJAA 1BR4A 2BVLA 2G7HA 3LSPA 1N77A 1DP7P 4ZYGA 4ESJA 4W1UA 2X6OA 6PAXA 3BLYA 3FBNB 3CCUI 4JX6A 5AONA 3O8GA 2IP2A 2XAGA 3QYFA 1QVTA 2BY2A 2XB5A 4AM3A 1YRNB 5HS7A 4C2MJ 4XKBA 3BQZA 2H27A 1X3WB 2IJLA 2X6WA 3SEQA 2WWYA 1P4WA 4BBRJ 3A01B 4B09A 4EV0A 1PUEE 3BJAA 4D9JA 2IT0A 3G1LA 2M8EA 1DPRA 3EUAA 2HOTA 2OU2A 4HV5A 3ZOBA 2R7WA 3U1KA 5FJ8J 5FRNA 2X1CA 3OL4A 3IC7A 2F5DA 5ILVA 1VFCA 2VJ5A 5LEKA 3ECHA 1IC8A 4O3MA 3CUQB 2V26A 3A0HC 2EFOA 3FXRA 5B66C 1T8IA 3NAUA 2HDWA 3HRMA 4FX0A 5E8GA 4YFNF 2RV8A 1J0RA 4ENJA 4HF2A 2NS7A 4Q5SF 4KITB 4XN3A 1V3FA 3BG6A 4MO7A 2KIMA 2X48A 2FSWA 4KT6A 4FX4A 1Z1DA 3QPTA 1FBSA 4ZDOA 1F5TA 1MNDA 5HDGA 4QSHA 3J7YJ 5IPAA 4BXUA 3ERMA 2V9KA 3GTPJ 3K9TA 4B48A 5AIQA 3Q5FA 3M9AA 1UCRA 3H5AA 2L9NA 2NS8A 4EM1A 1IF1A 4MEYF 1GUUA 2V9VA 1XGMA 3SJMA 5HLTA 5EG0A 2NXNB 2W7NA 1RKTA 1VQ5I 5H6RA 2W4SA 3IL2A 1H0MA 2STTA 1EV7A 3KP2A 3KZZA 2EV0A 1Q1VA 3QU3A 4AVZA 4AC0A 3HOZJ 1TWAJ 2OF7A 2KQRA 3QP6A 1HC8A 4HRIA 1RNLA 1OLTA 1YW7A 3O6BB 3OYGA 5GTIC 1K79A 3L7WA 2L54A 3AG4H 3SFIA 1X58A 2NOJB 2Z2SB 3HKZA 4BKXA 1U78A 3KEOA 2PJRA 1LEAA 4WXHA 4UUSB 2ZO4A 3OYNA 3U21A 4G9YA 2YPRA 4A3DJ 3ISPA 1J75A 4DZJA 3FXMA 3ML6A 3CJRB 5E1WA 5DS9A 2IAIA 2ISYA 4M3BA 2OTLI 2ZXJA 3BROA 2VBWA 1IXSB 3LQRA 2ZXIA 3SZPA 4LD5A 3I53A 2JSCA 4F93B 3QODA 3A2KA 4C3JJ 4S0HB 2IVMA 1TQMA 2HQNA 2M9HA 1Y39A 1PP8F 2NS0A 2UWMA 3BR5A 5TRDA 1V54H 3IKTA 1XTAA 2ELHA 2M1BA 2QLZA 2Q2EA 5C4JJ 5J4VA 4KMFA 1I3QJ 3TP0A 3PL8A 1B8IB 3BR2A 5IT9K 4L9NA 4B1RA 3K69A 4A3JJ 2H1KA 4P1WA 2VJJA 4I99C 3MKWB 4AU7A 2UZKA 1EH7A 1J09A 2LF7A 1G59A 2EA4A 2CFXA 3IH3A 4CUGA 4U0YA 5FKKA 4PFOA 4E7LA 3LAPA 2MC3A 3HXLA 3WODF 2BY0A 3DCFA 3VYTB 1ZRCA 4BDYA 1E0EA 1ON1A 3H3ZA 4B8XA 2Z33A 3CLQA 1VTNC 3BJOA 1MSFC 2QENA 5M5WJ 2ZNYA 4GYGA 2DMPA 1OCZH 3CCRI 3F8MA 1R71A 4XLEA 4MGRA 3R6SA 5FROA 1K4TA 1N25A 1P7JA 2DODA 2XGXA 5EG0B 2EZHA 2JVGA 1I1SA 1RUOA 2DK5A 2V9PA 4RGXA 4BQQA 4E7IA 4JK1X 4A3LJ 1K7AA 3H0DA 9ANTA 2P5KA 1ZTRA 2VE8A 3FK6A 2Y31A 1QBJA 4IEJA 5AIPA 1TT0A 2BEOA 3FZVA 2VJIA 4MEXF 1G2HA 1TNTA 1LFPA 2L7ZA 2DW4A 1I50J 1XSVA 2EFWA 1V5FA 2LP0A 4FETA 2KRFA 3EDPA 3FIWA 2J5PA 2RKHA 3I9V2 3PSFA 3FXUA 5J40A 2OTJI 1A6IA 4N4OB 1AWCA 2KP6A 5D5UB 5J1RA 3JREA 4G8XA 1EKEA 3S1MJ 3OYIA 2NVXJ 2GLOA 3DEWA 4E4HA 3S8PA 3HOYJ 1XC5A 2KJCA 3DBLB 2BOLA 2HYJA 2HQ5A 2AQFA 4DNCA 4F7ZA 3F8FA 1J2XA 4YFXF 3Q0WA 2JA2A 2KRCA 1D8JA 2EH3A 2AQEA 2BBYA 3HPHA 3E6BA 2K5CA 3GWZA 2YSRA 1KQ8A 5F0CA 4ENKA 1ZQ3P 2BVMA 1KQ0A 2YU3A 2A5WA 3MZYA 1Z9CA 1U8RA 3BZ6A 3NARA 4EGZA 1IGNA 2VI6A 3LSHA 4PK4A 4A3IJ 1DPUA 4IOCF 4RLQA 2LKXA 1FOXA 1NG6A 1BJZA 4BE2A 3NWTA 2XF5A 2Y48A 4MQ9F 1ZR2A 1J7KA 4BL0B 1X1AA 5CVIA 1W5CC 2ZBKA 3GTLJ 2QZ8A 4I0AA 1WSUA 1JKPC 3E3VA 3LSTA 4IHTA 3CCQI 2DOFA 2BY1A 2VXDA 3GXOA 1GV2A 3WHBA 3K4MA 3CJNA 1YW9A 4KICA 5FKLA 3OOPA 1R00A 2HKOA 2VT3A 4UVAA 3W6KB 4YELA 1YOVB 2VQHA 4C2TA 1BI2A 4ZC3A 4IF4A 1R1TA 2P7CB 1B59A 4LMYA 1TT5B 1OQYA 1Z21A 3LSIA 3LOCA 3D5RC 4DIQA 5GTHC 4DBRA 3GTGJ 1S7EA 1ZYRF 1YYVA 1B9NA 2M7AA 2O9LA 2E2JJ 1A04A 2DJNA 4IQJA 2PFBA 1J5YA 1R5ID 1ZG1A 3HSEA 3FXLA 1XDSA 1QA6A 4CXFA 1V5EA 1OJLA 5KCMA 2D1VA 3B6CA 1RI7A 2Y0SN 2OJED 4UNOA 1C0WA 1HCRA 4Y17A 3H9QA 3RPUD 1IDYA 1MKMA 3ABLH 4UV8A 3JTGA 3HGGA 3H3UA 2LTPA 4C3IJ 1AKHA 1OFCX 3G1MA 4RBOA 3IWFA 3NEUA 2A3SA 3R60A 3K70C 1J59A 3BWGA 3KP7A 4LK1F 1FT9A 3GZ5A 3WG9A 1S72I 3F0CA 1G3TA 1WVRA 3GUDA 3KLOA 3OYJA 1XMKA 1JTYA 1S7OA 4J00A 4RMNA 5EEAA 3GBGA 4XIDA 4L5JA 4IHVA 1UG2A 2E19A 2LRDA 4CZCA 1WPKA 2FQ4A 4YG2F 4WF2A 2DTZA 2MLKA 3GX4X 4A3FJ 2HTSA 3TW7A 1XGOA 2JA5J 2MYSA 3L2VA 2Y0MA 1BJAA 3RPUA 1O3SA 2QF7A 4KISA 1HKSA 2YUSA 2DCEA 3ZP5A 4FTHA 3GTQJ 2RQPA 3CP8A 2AHQA 2V1NA 3OL3A 1FTTA 1XS9A 3ZMTA 3NRVA 4FHTA 5J4YA 3HHHA 1U8BA 3I4NJ 2QQAA 2OCEA 4BQNA 3FXOA 1PDNC 1QU3A 3ZQ7A 5K5OA 3JW4A 2KIFA 3FWEA 2AXLA 1ZK8A 1IDZA 5BNGA 1YG2A 3TQNA 2P5VA 1ZGAA 3T8RA 2EZLA 1SFXA 4WX9A 5DCFA 1WJ5A 2VUMJ 2GXGA 4LLLA 1BW6A 2AS5F 4JP0A 3C18A 3ZQQA 2ETHA 3KX2A 5CQGA 1TP4A 5L3GA 1SEUA 5E1ZB 2XGEA 2YR2A 3HG9A 3ASNH 1U0JA 1O3QA 2VXZA 2JQ7A 5FFZA 1SD4A 3CJQB 1OCTC 2IA0A 4BJ5C 4EMSA 4MFDA 2B7EA 4W97A 2IGKA 3A1YA 4IJAA 2KRHA 2FX0A 2WAQA 1MD0A 2EIJH 2JVHA 3HYIA 4XM3A 5JFRA 2HOAA 2HYFA 3MMYB 1U5TA 1KQ9A 4B3XA 1FSEA 2I8DA 1O7LA 3GZNB 3WHCA 2W57A 2WAFA 1TWHJ 5HS8A 1OR7A 3TO6A 1FMWA 3PUFA 2VC1A 1T6SA 3BR0A 2JSPA 3RDIA 4O6JA 2FF4A 2JRMA 2L9VA 3PIPF 4EJWA 2IA1A 2ZJPF 3GFMA 2L9RA 4BH9A 3UNGC 2VE9A 1JGGA 2VT2A 2NVQJ 3ZQFA 4DYQA 1YI2I 1D5YA 4ENMA 4KT5C 1LJ9A 4Y33A 2AXTC 3KP3A 1P7IA 3RKXA 3WGIA 1AKHB 2OV7A 3PNVA 4UUVA 4M74A 2HFHA 5E3OA 2CO5A 2CQXA 4KA4A 4E7HA 2ZFWA 3DKWA 1P2FA 2VN2A 4XN0A 5FLMJ 5GADJ 1AHDP 3WTXC 2EPFA 1ZGJA 3TP3A 3AG3H 1CGPA 2E71A 1JJ6C 3EUHA 5DUKA 1U5TC 1U9OA 1Y0UA 4N4NB 5HLIA 2FNAA 1O7FA 2R4GA 3K4BA 4JX5A 4NC8A 3E6MA 1RRJA 2W84A 4MFEA 1PVEA 3HRTA 3TDUC 2C6YA 2VKEA 4P9UA 1R9TJ 2DA5A 2FOWA 2EIMH 2W1OA 5K7ZA 4XRMA 2QSFX 1RKWA 2F6CA 1POGA 2XAHA 5JHUA 2M8GX 2D5VA 1VNDA 1XGNA 2KLOA 1ZREA 3COAC 4B4CA 4QPQA 1ULYA 3SEZA 3I56I 3HSRA 3ROUA 4ZJZA 3E5QA 3HM5A 4KN4X 3JRCA 1K61A 1I5ZA 1MMNA 2CUFA 5KK1A 3P9IA 1Z6TA 2UUZA 1B4AA 1W1WE 1TZLA 3BR1A 3J81Z 2QKLB 1UFMA 1R5GA 3K4JA 4CCNA 4OIRF 2P6SA 5FD6A 2XAUA 5DV5A 2DBBA 3EUHC 3BTJA 3V7CA 1IRFA 2OBPA 4RB1A 4FT8A 4MLOA 2H8WA 4AD9A 2WV0A 3K4NA 3DU6A 4HNVA 4WCGA 3I59A 2LYCA 2VODA 1DGRM 1KZHA 1B1BA 1YW8A 4HW0A 2CG4A 2CV2A 4BXFA 3LSRA 1U5TB 5FB2A 1HBXG 4XSZF 3CF2A 1OYWA 2LF8A 5JVGF 5D4SA 5HNHA 2OUMA 1I39A 1KGSA 4V2FA 1YLFA 1IUYA 1ETVA 4BDZA 4XKVA 1ONVA 4ZZLA 3GTJJ 1FYMA 2M87A 2GIVA 2LY9A 1IN7A 4LJZF 3OMYA 1X1CA 3LFUA 2JTVA 1R5HA 1A6QA 3GFLA 3HGYA 1WWXA 3SDGA 3HJEA 4QTRA 2NNNA 1D5VA 3RKQA 3U1DA 2W48A 1D1AA 2IEKA 2Z1DA 5IP7J 3WE2A 2L7MP 4N9IA 4DQ2A 1T08B 2DMUA 2X85A 1MH4A 3KETA 1GLNA 5DM6F 4G94A 3QPHA 1A5JA 2E2IJ 1H89C 2QQ9A 2QQBA 3L00A 1YJNI 4X6AJ 3I71A 4HPQA 4XRSG 5FKNA 1ZG5A 1JT6A 3CMYA 3ZQCA 2HGCA 2DOEA 3TOBA 1X19A 1OMIA 3KYLA 4FQGA 2LR8A 3I54A 3PFYA 5B1AH 3KP4A 4DJAA 4YRVA 2CQ7A 4AIJA 2CUEA 3HOVJ 3S1QJ 1FBUA 1QPIA 3GZ6A 1UHWA 4NC6A 4BY7J 3MFKA 4NUBA 4LG0A 3L2CA 3RPQA 4HQEA 1T38A 2Y69H 1KU9A 2WA0A 1FTZA 2DDAA 2NOGA 2RAEA 3IRRA 3JRAA 2DN0A 3M7GA 4G7HF 4CO8A 4OIPF 4XOTA 1TQIA 3VWBA 1NG7A 2O5RA 3HL2A 2HOEA 5C44J 2FMYA 3P7NA 2KIQA 5DCMA 4H0EA 1R58A 4RM2A 2DI3A 2FRHA 4ZH4F 3TW6A 3GFIA 2IGMA 3OV8A 2MGQA 4OMZA 4RGSA 4BYYA 5L3CA 4XLNF 2BXYA 2Q1ZB 4F3QA 3WE3A 1CF7B 2O03A 5TJJA 1RZ4A 4AVPA 3PNTA 1Y6IA 4LLGF 2V7FA 1Z6RA 1ERDA 2R7VA 4PGHA 2R5ZA 4Z6YA 1FC3A 2HDCA 4HG2A 3T5XA 3I59B 2P5LC 5F1RA 2VB6A 4IRIA 2DPDA 2A07F 2ZXHA 3GMEA 3GF2A 3RQ4A 4EM2A 5A2QZ 2E1NA 3HSFA 2COBA 3SFZA 1FOKA 2ZJRF 5IY5H 1LFBA 4HAMA 3F3XA 3C2HA 3IP4B 1S8NA 1XN7A 4L0ZB 1QZZA 3F8CA 1UB9A 4CCJA 4CICA 2X0LA 3Q0VA 1FOYA 4L9TA 4A2UA 1O3TA 4Q48A 2VBZA 4QLCU 4IHYA 2KZVA 4A5MA 2E34A 1JXSA 1S7AA 2IGNA 4OOIA 4PJ0C 4PDKA 3MQ0A 2O0YA 1MMDA 2DT5A 2YX4A 4EVIA 3ZQIA 4L0YB 2EJRA 1W36C 2A61A 2F4MB 4DZPA 2WBMA 1SVMA 3OS1A 2TRTA 3H36A 3LQQA 4OAZA 3ABKH 3BG7A 3E6DA 5DEQA 2LREA 1X1BA 4LIUA 1IJWC 4LITA 3S93A 3KZYA 1YX3A 3AG1H 2R3SA 4D5FA 1R1VA 4UUTA 2X1DA 3U2RA 2CV0A 3VODA 2Y30A 4DBQA 4EJOA 2EBIA 1QQIA 3DBHB 2EZIA 3OSFA 1X3ZB 2LD5A 2LG4A 1A36A 1LNWA 2R5YB 4GDFA 1ENHA 2LSOA 1BC7C 5ILUA 3DPTA 1RR7A 4O5VA 4LG0B 5L3BA 3J81K 3PQKA 4BE0A 1WZ2A 4NNJA 1VQOI 3OIQA 4D1QA 1HSTA 1OCRH 3OOUA 3QQAA 4ZYDA 3CDLA 3K7AJ 5M5XJ 4BAYA 1SC7A 1BIAA 1QZEA 4UXNA 2XKPA 3L1PA 1LPQA 1ETYA 1YS7A 3MKYB 2HXOA 3WTTC 1X1PA 4IQ4A 5DCMB 4UY8I 2QVOA 5CVRA 1E2XA 3S3MA 2LY2A 1T2KA 3MD2A 3LA3A 2HOSA 4FASD 4F55A 2E60A 4PJMA 1MIJA 5CVUA 1A35A 2P6TA 2E7WA 1HW5A 3ZXSA 1E17A 3MVPA 1Z7UA 2F5CA 2A6HF 2PX9A 4NQWA 2JPCA 2HS5A 2JZYA 1D0ZA 4I98B 1BI0A 1V4RA 2LKSA 2R5ZB 4X1EA 2R7ZJ 2FJ1A 3BT9A 2HZTA
chains in the Genus database with same CATH topology
1GV2A 3WHBA 3VPRA 5EZHA 2XGCA 5FKLA 4JX4A 4RDUA 3HKZN 2K40A 4V2GA 3JRBA 2TCTA 5E3NA 2DMTA 2XPVA 1TWGJ 2ECCA 1IV6A 1F36A 4FE4A 1GV5A 3LOCA 2ECBA 3GTKJ 3GTGJ 1MBGA 1S7EA 2LVSA 5JLXA 2O9LA 2E2JJ 2DJNA 3B6AA 2O8KA 3IH4A 3QPSA 3K2AA 3Q0UA 1XG1A 4Y52J 5C4XJ 1OJLA 1BW5A 1Y1WJ 2JJ7A 1ZKGA 3RQIA 4UUSA 2HI3A 3B6CA 5EF6A 2E2HJ 1MBHA 3A02A 5F0HA 2DA2A 2Y0SN 3LNQA 2Y2ZA 1HCRA 3PO3J 1IDYA 1VI0A 3CCYA 1NK3P 4G12A 4MIMA 3HGGA 4C3IJ 2LTPA 1AKHA 4IHXA 3JRHA 1OFCX 1B72B 1K83J 2CQQA 3G1MA 2L0KA 4RBOA 2DA6A 1HDDC 3GTMJ 1F43A 1WCMJ 3ZQGA 3Q3SA 3D1NI 2JMWA 3F0CA 4BBSJ 5IYBJ 1JTYA 4FE7A 5EEAA 3GBGA 1Z0XA 3C2BA 1GVDA 5J3LA 3OSGA 4XIDA 4A3BJ 4IHVA 1UG2A 2CRGA 3RZOJ 2E19A 2YS9A 4D7NA 1WPKA 2FQ4A 3BG5A 2ELKA 2DA1A 2DTZA 4A3FJ 2OPTA 3TW7A 2NVTJ 2JA5J 5EGOA 2QF7A 3A01A 2YUSA 4FTHA 2QCOA 3GTQJ 5GPCA 1JKRC 4CYCB 5IOYA 2AHQA 1BA5A 1FTTA 2M0CA 2MSYA 1XS9A 2XRLA 1MBJA 2LK2A 3MN2A 3I4NJ 1U8BA 3S2DJ 2L7FP 3BQYA 3PM1A 1ZK8A 1IDZA 5BNGA 1O4XA 1U9NA 2EZLA 4DYCA 3BTCA 2VUMJ 4QIWN 1BW6A 4DYRA 4JP0A 1MH3A 2AO9A 4EEFG 1EF4A 5IOZA 2JA6J 2FD5A 2XGEA 5F04A 1ORKA 5M3MJ 1T33A 4B3AA 4A3KJ 1OCTC 3TEDA 1WH7A 1HDPA 1ITYA 4MFDA 4W97A 3RZDJ 3OIOA 1APLC 1DU6A 2Y9ZA 2FX0A 2GBYA 3BG3A 4C3HJ 2NVYJ 2HOAA 1HLVA 3S1NJ 3WHCA 1TWHJ 2JWTA 5E3MA 3FKIJ 5J1YA 2ID3A 1ETWA 3BR0A 4BY1J 2HXIA 1I6HJ 5FLVA 3BR3A 2L9RA 5M5YJ 2JA8J 2X9DA 2R5YA 2NVQJ 1IUFA 1JGGA 3ZQFA 4DYQA 4LOCA 1D5YA 1QRYA 5J1UA 5EZGA 4DW6A 1P7IA 2EQRA 1AKHB 4M6VA 3MKLA 4I6ZA 1JKQC 3E7LA 3JR9A 2I10A 3ZQLA 5E3OA 2CQXA 2R92J 1NTCA 4M3FA 1ETQA 5GPAA 3LSPA 1RPWA 3CQZJ 3G1OA 4W1UA 2X6OA 1WH5A 2WB1N 5FLMJ 2JA7J 2YU9J 1AHDP 3TP3A 4JX6A 1IRZA 1JJ6C 3O8GA 1W0TA 5E3LA 1U9OA 1QVTA 3FK7A 2DA4A 2XB5A 4BXXJ 1LE8A 1YRNB 4C2MJ 4JX5A 3BQZA 4MFEA 4L5EA 4BBRJ 3A01B 1ZR4A 1NK2P 3FISA 1MSEC 3A03A 5K7HA 2VKEA 1R9TJ 2DA5A 4NDLA 3G1LA 4A3MJ 1GT0C 5K7ZA 4XRMA 1RKWA 1E3OC 1POGA 2M8GX 2HOTA 3ZOBA 2D5VA 1VNDA 4B4CA 1JKOC 4A3CJ 5DTDA 5FJ8J 3LSGA 3HOXJ 1FIPA 1JTXA 3M3YJ 5F0FA 1RETA 2KT0A 3IH2A 3HM5A 3JRCA 5K7FA 1VFCA 1K61A 2CUFA 2EZKA 3BR1A 3HEFA 1IC8A 1B8IA 3NAUA 4A93J 2NS7A 2XPUA 3BTJA 4MO7A 2X48A 2JN6A 4MLOA 5F1JA 5M3FJ 4HNVA 4M3EA 2WV1A 1ETXA 3HB9A 2DMQA 3LSRA 4QSHA 1BL0A 1GDTA 5EDNA 4Y7NJ 1FIAA 2XB0X 5IPAA 4V2FA 3GTPJ 1ETVA 1MBFA 2NS8A 1JUSA 3M4OJ 1GUUA 4M3DA 1OCPA 3GTJJ 1H8AC 3SJMA 2G0EA 2LY9A 4A69C 3UKGA 5EG0A 1H88C 3QPLA 3HGYA 1RKTA 1JT0A 3SDGA 4QTRA 1FEXA 3RKQA 4IHWA 2W48A 2IEKA 5IP7J 1TC3C 5IP6A 3S16J 2VKVA 5F08A 1Q1VA 2L7MP 2DA3A 4A3EJ 1AU7A 5IYDJ 4AC0A 3W6VA 4XICA 3HOZJ 2DMUA 1MH4A 1TWAJ 4M3GA 2OF7A 3LSJA 1A5JA 4GFBA 2E2IJ 1H89C 1JUMA 1TWFJ 4X6AJ 4FCYA 2IBDA 4XRSG 2K9NA 5FKNA 1JT6A 3CMYA 4ABZA 3ZQCA 1JJ8C 3I4MJ 1WGXA 2MW8A 4BKXA 3SFIA 1U78A 1X58A 1SANA 2LLKA 2LR8A 4UUSB 2HDDA 1WI3A 2CUEA 1Z77A 3HOVJ 3S1QJ 4A3DJ 3JRGA 1QPIA 4DZJA 2ZB9A 1LE8B 4BY7J 5DS9A 2IAIA 4XRSA 4M3BA 1MBKA 1FTZA 2WAQN 2NOGA 2RAEA 5C3EJ 3JRAA 2DN0A 2XPWA 3O8HA 2E1OA 4C3JJ 4S0HB 5FKOA 1PUFA 2CJJA 2M9HA 5IP9J 5C44J 2ID6A 3BR5A 2PMZN 5FKMA 2DMNA 3ZQHA 1IG7A 3TW6A 1JUPA 3BTLA 2MGQA 3IV5A 2VPRA 5C4JJ 1I3QJ 5IYCJ 1T56A 1FJLA 3TP0A 4J19A 1B8IB 1ZGWA 2MG4A 2M2EA 3BR2A 2N8GA 4B1RA 2JK3A 4A3JJ 2H1KA 3H0GJ 5EGOB 3JRDA 3S17J 1MNMC 3BG9A 3BR6A 2R5ZA 3IH3A 3S15J 5FKKA 5HODA 3HBLA 2ME6A 3PO2J 3HOWJ 3DCFA 1RESA 4AUXA 2M34A 2COBA 2ME0A 1MSFC 4FISA 5M5WJ 1LFUP 2GM4A 1LFBA 2XGDA 2DMPA 3HDDA 3JRFA 1VF9A 2R93J 5JLWA 4AYBN 3Q0VA 1P7JA 4XK4A 3S1RJ 1W0UA 5EG0B 2EZHA 4IHYA 2R0QC 2O7OA 4A3LJ 1HF0A 1ETOA 9ANTA 3ZQIA 3FK6A 1Y1VJ 1ZTRA 1DU0A 1HOMA 2Y31A 3H3VK 3GTOJ 4IEJA 4DZPA 1G2HA 2TRTA 1MBEA 2L7ZA 4D5CA 1I50J 2Y9YA 2LP0A 1IJWC 4A3GJ 1UHSA 3FIWA 4I76A 1YRNA 2B63J 1A6IA 4D5FA 4UUTA 1ETKA 2DA7A 2XSDC 1CQTA 1QVUA 2Y30A 2LFBA 5J1RA 3JREA 3JRIA 2CU7A 3S1MJ 3BTIA 4JYKA 1B72A 2EBIA 2NVXJ 2EZIA 3OSFA 2GLOA 2LD5A 3DEWA 2R5YB 1ENHA 3HOYJ 1XC5A 1RR7A 2HYJA 2HQ5A 3Q0WA 3S2HJ 2EH3A 5F27A 3OOUA 3QQAA 5GP9A 3CDLA 3K7AJ 5M5XJ 5F0CA 3L1PA 3S14J 1ETYA 1ZQ3P 1PUFB 2H8RA 2HXOA 3NARA 3HOUJ 1IGNA 2VI6A 1TWCJ 4A3IJ 4D7MA 2LKXA 2HOSA 4CYCA 1BJZA 1SFOJ 1ZR2A 1X2MA 2K9SA 2P81A 3MVPA 1UMQA 5EYRA 1X2NA 2K9QA 3GTLJ 2KDZA 2R5ZB 4X1EA 1JKPC 2R7ZJ 2FJ1A 3BT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GV2 A;  3WHB A;  3VPR A;  5EZH A;  2XGC A;  5FKL A;  4JX4 A;  4RDU A;  3HKZ N;  2K40 A;  4V2G A;  3JRB A;  2TCT A;  5E3N A;  2DMT A;  2XPV A;  1TWG J;  2ECC A;  1IV6 A;  1F36 A;  4FE4 A;  1GV5 A;  3LOC A;  2ECB A;  3GTK J;  3GTG J;  1MBG A;  1S7E A;  2LVS A;  5JLX A;  2O9L A;  2E2J J;  2DJN A;  3B6A A;  2O8K A;  3IH4 A;  3QPS A;  3K2A A;  3Q0U A;  1XG1 A;  4Y52 J;  5C4X J;  1OJL A;  1BW5 A;  1Y1W J;  2JJ7 A;  1ZKG A;  3RQI A;  4UUS A;  2HI3 A;  3B6C A;  5EF6 A;  2E2H J;  1MBH A;  3A02 A;  5F0H A;  2DA2 A;  2Y0S N;  3LNQ A;  2Y2Z A;  1HCR A;  3PO3 J;  1IDY A;  1VI0 A;  3CCY A;  1NK3 P;  4G12 A;  4MIM A;  3HGG A;  4C3I J;  2LTP A;  1AKH A;  4IHX A;  3JRH A;  1OFC X;  1B72 B;  1K83 J;  2CQQ A;  3G1M A;  2L0K A;  4RBO A;  2DA6 A;  1HDD C;  3GTM J;  1F43 A;  1WCM J;  3ZQG A;  3Q3S A;  3D1N I;  2JMW A;  3F0C A;  4BBS J;  5IYB J;  1JTY A;  4FE7 A;  5EEA A;  3GBG A;  1Z0X A;  3C2B A;  1GVD A;  5J3L A;  3OSG A;  4XID A;  4A3B J;  4IHV A;  1UG2 A;  2CRG A;  3RZO J;  2E19 A;  2YS9 A;  4D7N A;  1WPK A;  2FQ4 A;  3BG5 A;  2ELK A;  2DA1 A;  2DTZ A;  4A3F J;  2OPT A;  3TW7 A;  2NVT J;  2JA5 J;  5EGO A;  2QF7 A;  3A01 A;  2YUS A;  4FTH A;  2QCO A;  3GTQ J;  5GPC A;  1JKR C;  4CYC B;  5IOY A;  2AHQ A;  1BA5 A;  1FTT A;  2M0C A;  2MSY A;  1XS9 A;  2XRL A;  1MBJ A;  2LK2 A;  3MN2 A;  3I4N J;  1U8B A;  3S2D J;  2L7F P;  3BQY A;  3PM1 A;  1ZK8 A;  1IDZ A;  5BNG A;  1O4X A;  1U9N A;  2EZL A;  4DYC A;  3BTC A;  2VUM J;  4QIW N;  1BW6 A;  4DYR A;  4JP0 A;  1MH3 A;  2AO9 A;  4EEF G;  1EF4 A;  5IOZ A;  2JA6 J;  2FD5 A;  2XGE A;  5F04 A;  1ORK A;  5M3M J;  1T33 A;  4B3A A;  4A3K J;  1OCT C;  3TED A;  1WH7 A;  1HDP A;  1ITY A;  4MFD A;  4W97 A;  3RZD J;  3OIO A;  1APL C;  1DU6 A;  2Y9Z A;  2FX0 A;  2GBY A;  3BG3 A;  4C3H J;  2NVY J;  2HOA A;  1HLV A;  3S1N J;  3WHC A;  1TWH J;  2JWT A;  5E3M A;  3FKI J;  5J1Y A;  2ID3 A;  1ETW A;  3BR0 A;  4BY1 J;  2HXI A;  1I6H J;  5FLV A;  3BR3 A;  2L9R A;  5M5Y J;  2JA8 J;  2X9D A;  2R5Y A;  2NVQ J;  1IUF A;  1JGG A;  3ZQF A;  4DYQ A;  4LOC A;  1D5Y A;  1QRY A;  5J1U A;  5EZG A;  4DW6 A;  1P7I A;  2EQR A;  1AKH B;  4M6V A;  3MKL A;  4I6Z A;  1JKQ C;  3E7L A;  3JR9 A;  2I10 A;  3ZQL A;  5E3O A;  2CQX A;  2R92 J;  1NTC A;  4M3F A;  1ETQ A;  5GPA A;  3LSP A;  1RPW A;  3CQZ J;  3G1O A;  4W1U A;  2X6O A;  1WH5 A;  2WB1 N;  5FLM J;  2JA7 J;  2YU9 J;  1AHD P;  3TP3 A;  4JX6 A;  1IRZ A;  1JJ6 C;  3O8G A;  1W0T A;  5E3L A;  1U9O A;  1QVT A;  3FK7 A;  2DA4 A;  2XB5 A;  4BXX J;  1LE8 A;  1YRN B;  4C2M J;  4JX5 A;  3BQZ A;  4MFE A;  4L5E A;  4BBR J;  3A01 B;  1ZR4 A;  1NK2 P;  3FIS A;  1MSE C;  3A03 A;  5K7H A;  2VKE A;  1R9T J;  2DA5 A;  4NDL A;  3G1L A;  4A3M J;  1GT0 C;  5K7Z A;  4XRM A;  1RKW A;  1E3O C;  1POG A;  2M8G X;  2HOT A;  3ZOB A;  2D5V A;  1VND A;  4B4C A;  1JKO C;  4A3C J;  5DTD A;  5FJ8 J;  3LSG A;  3HOX J;  1FIP A;  1JTX A;  3M3Y J;  5F0F A;  1RET A;  2KT0 A;  3IH2 A;  3HM5 A;  3JRC A;  5K7F A;  1VFC A;  1K61 A;  2CUF A;  2EZK A;  3BR1 A;  3HEF A;  1IC8 A;  1B8I A;  3NAU A;  4A93 J;  2NS7 A;  2XPU A;  3BTJ A;  4MO7 A;  2X48 A;  2JN6 A;  4MLO A;  5F1J A;  5M3F J;  4HNV A;  4M3E A;  2WV1 A;  1ETX A;  3HB9 A;  2DMQ A;  3LSR A;  4QSH A;  1BL0 A;  1GDT A;  5EDN A;  4Y7N J;  1FIA A;  2XB0 X;  5IPA A;  4V2F A;  3GTP J;  1ETV A;  1MBF A;  2NS8 A;  1JUS A;  3M4O J;  1GUU A;  4M3D A;  1OCP A;  3GTJ J;  1H8A C;  3SJM A;  2G0E A;  2LY9 A;  4A69 C;  3UKG A;  5EG0 A;  1H88 C;  3QPL A;  3HGY A;  1RKT A;  1JT0 A;  3SDG A;  4QTR A;  1FEX A;  3RKQ A;  4IHW A;  2W48 A;  2IEK A;  5IP7 J;  1TC3 C;  5IP6 A;  3S16 J;  2VKV A;  5F08 A;  1Q1V A;  2L7M P;  2DA3 A;  4A3E J;  1AU7 A;  5IYD J;  4AC0 A;  3W6V A;  4XIC A;  3HOZ J;  2DMU A;  1MH4 A;  1TWA J;  4M3G A;  2OF7 A;  3LSJ A;  1A5J A;  4GFB A;  2E2I J;  1H89 C;  1JUM A;  1TWF J;  4X6A J;  4FCY A;  2IBD A;  4XRS G;  2K9N A;  5FKN A;  1JT6 A;  3CMY A;  4ABZ A;  3ZQC A;  1JJ8 C;  3I4M J;  1WGX A;  2MW8 A;  4BKX A;  3SFI A;  1U78 A;  1X58 A;  1SAN A;  2LLK A;  2LR8 A;  4UUS B;  2HDD A;  1WI3 A;  2CUE A;  1Z77 A;  3HOV J;  3S1Q J;  4A3D J;  3JRG A;  1QPI A;  4DZJ A;  2ZB9 A;  1LE8 B;  4BY7 J;  5DS9 A;  2IAI A;  4XRS A;  4M3B A;  1MBK A;  1FTZ A;  2WAQ N;  2NOG A;  2RAE A;  5C3E J;  3JRA A;  2DN0 A;  2XPW A;  3O8H A;  2E1O A;  4C3J J;  4S0H B;  5FKO A;  1PUF A;  2CJJ A;  2M9H A;  5IP9 J;  5C44 J;  2ID6 A;  3BR5 A;  2PMZ N;  5FKM A;  2DMN A;  3ZQH A;  1IG7 A;  3TW6 A;  1JUP A;  3BTL A;  2MGQ A;  3IV5 A;  2VPR A;  5C4J J;  1I3Q J;  5IYC J;  1T56 A;  1FJL A;  3TP0 A;  4J19 A;  1B8I B;  1ZGW A;  2MG4 A;  2M2E A;  3BR2 A;  2N8G A;  4B1R A;  2JK3 A;  4A3J J;  2H1K A;  3H0G J;  5EGO B;  3JRD A;  3S17 J;  1MNM C;  3BG9 A;  3BR6 A;  2R5Z A;  3IH3 A;  3S15 J;  5FKK A;  5HOD A;  3HBL A;  2ME6 A;  3PO2 J;  3HOW J;  3DCF A;  1RES A;  4AUX A;  2M34 A;  2COB A;  2ME0 A;  1MSF C;  4FIS A;  5M5W J;  1LFU P;  2GM4 A;  1LFB A;  2XGD A;  2DMP A;  3HDD A;  3JRF A;  1VF9 A;  2R93 J;  5JLW A;  4AYB N;  3Q0V A;  1P7J A;  4XK4 A;  3S1R J;  1W0U A;  5EG0 B;  2EZH A;  4IHY A;  2R0Q C;  2O7O A;  4A3L J;  1HF0 A;  1ETO A;  9ANT A;  3ZQI A;  3FK6 A;  1Y1V J;  1ZTR A;  1DU0 A;  1HOM A;  2Y31 A;  3H3V K;  3GTO J;  4IEJ A;  4DZP A;  1G2H A;  2TRT A;  1MBE A;  2L7Z A;  4D5C A;  1I50 J;  2Y9Y A;  2LP0 A;  1IJW C;  4A3G J;  1UHS A;  3FIW A;  4I76 A;  1YRN A;  2B63 J;  1A6I A;  4D5F A;  4UUT A;  1ETK A;  2DA7 A;  2XSD C;  1CQT A;  1QVU A;  2Y30 A;  2LFB A;  5J1R A;  3JRE A;  3JRI A;  2CU7 A;  3S1M J;  3BTI A;  4JYK A;  1B72 A;  2EBI A;  2NVX J;  2EZI A;  3OSF A;  2GLO A;  2LD5 A;  3DEW A;  2R5Y B;  1ENH A;  3HOY J;  1XC5 A;  1RR7 A;  2HYJ A;  2HQ5 A;  3Q0W A;  3S2H J;  2EH3 A;  5F27 A;  3OOU A;  3QQA A;  5GP9 A;  3CDL A;  3K7A J;  5M5X J;  5F0C A;  3L1P A;  3S14 J;  1ETY A;  1ZQ3 P;  1PUF B;  2H8R A;  2HXO A;  3NAR A;  3HOU J;  1IGN A;  2VI6 A;  1TWC J;  4A3I J;  4D7M A;  2LKX A;  2HOS A;  4CYC A;  1BJZ A;  1SFO J;  1ZR2 A;  1X2M A;  2K9S A;  2P81 A;  3MVP A;  1UMQ A;  5EYR A;  1X2N A;  2K9Q A;  3GTL J;  2KDZ A;  2R5Z B;  4X1E A;  1JKP C;  2R7Z J;  2FJ1 A;  3BT9 A; 
#chains in the Genus database with same CATH topology
 2GWR A;  3I64 A;  3OS2 A;  3VPR A;  1DGW Y;  4BHP A;  2XGC A;  5FFX A;  1Z3Y A;  2KIS A;  4RAG A;  1DDN A;  1BI3 A;  3HKZ N;  3G73 A;  4M71 A;  4XSX F;  2CW7 A;  3W2V A;  2B0L A;  3TDZ C;  1I27 A;  3E97 A;  3OWT A;  5E3N A;  4U0V A;  5EEH A;  2RN7 A;  3IWZ A;  5HVQ C;  2F5E A;  1R22 A;  2XF6 A;  1SMY F;  4IX7 A;  1MMA A;  1VQK I;  2M30 A;  3GTK J;  4G7O F;  5JLX A;  1L3L A;  2BYV E;  2FU4 A;  1WFX A;  3CCL I;  2O8K A;  3IH4 A;  4HF1 A;  3CUO A;  2ESH A;  3HPG A;  2FXA A;  2YX7 A;  3GCM A;  3E6C C;  4AIK A;  3N05 A;  2MD5 A;  4EQQ A;  2WTE A;  3VFZ A;  2M5W A;  3CJT B;  2BXZ A;  2JJ7 A;  1Y1W J;  1ZKG A;  3RQI A;  3H9J A;  2HI3 A;  2ZXW H;  5EF6 A;  1O3R A;  4ZYH A;  2EV5 A;  4GYI A;  4L9J A;  3K1M A;  1H9G A;  2OQR A;  2CUJ A;  3CCY A;  1NK3 P;  5E20 A;  4MIM A;  5DD8 A;  3JRH A;  1UST A;  1HDD C;  2CQQ A;  2BZT A;  2OCC H;  1F43 A;  4EJT A;  3T1B A;  3Q3S A;  4KJZ A;  3RYR A;  2R7S A;  5ERI A;  2JMW A;  5BMZ A;  2VKD A;  3S32 A;  1ACI A;  5EJC A;  5ICF A;  2DU9 A;  5IYB J;  4QPO A;  2QKM B;  4FE7 A;  4HV6 A;  3ZN0 A;  2X51 A;  5D5X B;  3HZJ A;  5E1X A;  5B1B H;  5J3L A;  2B9S A;  4A3B J;  5E17 F;  2CRG A;  3D5L A;  2HZD A;  2F4O B;  2YS9 A;  5ILS A;  2CS3 A;  1SD7 A;  2DTR A;  2ELK A;  2DA1 A;  4ETS A;  1MDM A;  2KMU A;  3ZN1 A;  5KAI C;  5EGO A;  1W7P D;  1EH8 A;  1ZHF A;  2JUG A;  2PJR B;  1IRG A;  3I5U A;  3TGN A;  3G3Z A;  2NRA C;  2QGU A;  2D1H A;  2H09 A;  3VYR B;  3C7J A;  4BNC A;  3FXJ A;  3MN2 A;  5ICG A;  2DT6 A;  1R36 A;  4F52 A;  4NQW B;  1R4M B;  1WJF A;  3B73 A;  4JOM A;  2CFO A;  1TL8 A;  2DFH A;  1XMA A;  1VZ0 A;  3OYM A;  4AIH A;  2MBF A;  1R4N B;  5F6F A;  4DYC A;  2RNG A;  4XLC A;  4QWQ A;  4QIW N;  5LBQ A;  2V6C A;  2VC0 A;  2HYG D;  4C30 A;  4EEF G;  4XR6 A;  1HXD A;  5D8L B;  1JGS A;  2FD5 A;  2VIX A;  4ZYE A;  1YX5 A;  1YIT I;  1IZ1 A;  2NAZ A;  1ORK A;  2VBX A;  1K6O A;  5M3M J;  1FYK A;  4CZZ A;  1T33 A;  4CCM A;  1XCV A;  4J01 A;  1V5G A;  3TED A;  2Q2E B;  1WH7 A;  2EV6 A;  3TO7 A;  4RB3 C;  2BGC A;  2MD0 A;  3OIO A;  2Z16 A;  3WU0 A;  2Y9Z A;  4LB5 A;  1QHG A;  3TOA A;  1B8I A;  2GA1 A;  2DOA A;  4HZF A;  4P5O A;  1Y8Q B;  3W6J B;  2M7B A;  4N9H A;  5KAF C;  1UJ8 A;  4KN7 X;  5E3M A;  2MFZ A;  3VOE A;  1XGS A;  3HOT A;  1L0O C;  3KFW X;  3QRF F;  4BY1 J;  1GXP A;  1I6H J;  3I4P A;  3CMM A;  2PMZ A;  5J47 A;  2Q0O A;  3OIP A;  5M5Y J;  2JA8 J;  1YS6 A;  2X9D A;  1XD7 A;  5B5E C;  1IUF A;  2A68 F;  4ZTF A;  4M9X A;  5TIS C;  3J7Z I;  2VPL A;  4I6Z A;  1JKQ C;  1FYL A;  3OR1 C;  1FWZ A;  2K3P A;  2F48 A;  3JR9 A;  2QBY A;  2RVC A;  4II2 A;  2RDP A;  1NTC A;  1ETQ A;  3CZ6 A;  4IXA A;  2DYS H;  5LRR A;  1RPW A;  3CQZ J;  3G1O A;  1BBY A;  4HNT A;  4LLN A;  3RSN A;  2GA2 A;  1O57 A;  2WB1 N;  1FY7 A;  2QWW A;  2JA7 J;  3JSP A;  5L3D A;  2A6E F;  4ASN A;  2MLG A;  1LB2 A;  5E3L A;  5DD4 A;  1M1E B;  5D5W B;  2R7Q A;  3FK7 A;  4Y15 A;  3VSK A;  5HLH A;  2DA4 A;  1USS A;  3DWL E;  2QSH X;  4Q4Z F;  1LE8 A;  4AYB A;  2LC2 A;  1R1U A;  3LFK A;  1HKT A;  1W5S A;  5E8I A;  3V42 A;  1ZR4 A;  1NK2 P;  2E1C A;  3DTK A;  5L3F A;  3M07 A;  4A5N A;  2DPU A;  4A3M J;  3JSO A;  3BY6 A;  5J8C A;  1E3O C;  4CHU A;  4LB6 B;  1XMX A;  2CQN A;  5DTD A;  4RB0 A;  3LSG A;  1FIP A;  4II3 A;  4A12 A;  3F23 A;  1WJD A;  2EFP A;  3M3Y J;  1RET A;  2GZW A;  1D8K A;  2KT0 A;  3LL7 A;  4GGG A;  3FF5 A;  2QA4 I;  3KEQ A;  4RAZ A;  1U2W A;  3CC7 I;  3HEF A;  3V8L A;  3C3W A;  3ABT A;  2NVU B;  1R23 A;  3WTV C;  2XPU A;  4JBA A;  3OYK A;  1UEL B;  1G3W A;  1MJ9 A;  5CJ9 A;  2COM A;  2JN6 A;  4Y3O A;  5B3S H;  3QOE A;  3J7A O;  4PJJ A;  4M3E A;  2WV1 A;  1F4K A;  1ETX A;  3HB9 A;  3LSK A;  2DMQ A;  1LQ1 A;  4BU2 A;  1QPM A;  1BL0 A;  1FLI A;  2V6E A;  4Y7N J;  2L4M A;  4NB5 A;  3OYH A;  4NBQ A;  3HC7 A;  3OYL A;  2CW8 A;  2M0M A;  3PJR A;  3W2A A;  1YHQ I;  1MBF A;  3EYY A;  1JUS A;  2M3A A;  4M3D A;  3ZMU A;  3WTW C;  2PLY A;  3OYD A;  2E5N A;  2G0E A;  4A69 C;  4F91 B;  2DK8 A;  1H88 C;  2WAD A;  4F92 B;  3DTI A;  3QPL A;  2RQQ A;  1JT0 A;  1D1C A;  1FEX A;  2M45 A;  1NHA A;  3QYE A;  5FLX Z;  4I0B A;  1TC3 C;  4EGY A;  1GVJ A;  2LKP A;  2LOO A;  2PQ8 A;  2VKV A;  3S2W A;  3DU5 A;  4A3E J;  1UAA A;  2QBY B;  5IYD J;  4IOA F;  2R7T A;  3LSJ A;  2Z9O A;  1X1D A;  3OYA A;  4I02 A;  2R7F A;  3M8E A;  4FCY A;  2IBD A;  1XX5 A;  2K9N A;  2O6G E;  1JJ8 C;  3K0L A;  2FML A;  1WGX A;  4E7S A;  1WJE A;  3TO9 A;  2CH0 A;  2ZFU A;  2DO7 A;  1FBQ A;  4ANJ A;  1IAW A;  1DP3 A;  2L5Q A;  1JE8 A;  2LLK A;  1WI3 A;  3D0S A;  1Z77 A;  3S3O A;  4OIN F;  3K4C A;  3JRG A;  2ZB9 A;  1LE8 B;  4RB2 C;  4HX7 A;  1D1B A;  4U88 A;  4XRS A;  2EFN A;  2HKX A;  3PUB A;  2UXX A;  2P8T A;  4OMY A;  1MBK A;  2WAQ N;  4A6D A;  1VQ7 I;  5DUI A;  2DDB A;  2E5Z A;  1BOA A;  3ZMD A;  2V4J C;  2GOX B;  4ZDL A;  5FKO A;  4UVB A;  1PUF A;  2KJB A;  1KA8 A;  4KDP A;  1OYY A;  4KMU X;  5IP9 J;  5H6Q A;  4UVC A;  1ZRD A;  1N75 A;  4K2E A;  2ID6 A;  3GVA A;  2G7U A;  2JPB A;  2DMN A;  5FKM A;  3K4K A;  3ZQH A;  4DOZ A;  1IG7 A;  2XUB A;  2CGP A;  2VOO A;  3BTL A;  3QYB A;  1WJC A;  5IYC J;  1T56 A;  2P4W A;  1OR7 C;  3WGG A;  4J19 A;  1QO0 D;  2MG4 A;  2QYO A;  3ZPL A;  1WI9 A;  3OYB A;  3H0G J;  3S17 J;  3JRD A;  3CF5 F;  1MNM C;  2F5F A;  1D0X A;  3CC2 I;  5ICC A;  3CDH A;  1SD6 A;  2WY8 Q;  3OY9 A;  1W4M A;  1LEB A;  3FHN A;  4HBL A;  5EEG A;  1X4O A;  2BW3 A;  5LGT A;  1IXC A;  4I09 A;  1FMV A;  5HOD A;  3CCS I;  2CMP A;  4HA8 A;  3PO2 J;  5GAE J;  3QP5 A;  2GOM A;  4X0G A;  4AUX A;  4G6Q A;  3T8T A;  5J6X A;  3OYE A;  2ME0 A;  3CCE I;  1SAU A;  4FIS A;  2NNY A;  4HSR A;  2XGD A;  3F21 A;  3HDD A;  3QAH A;  2PMU A;  2VL8 A;  4XK4 A;  1W0U A;  2W25 A;  3ASO H;  2GXB A;  4YEJ A;  2TDX A;  3J7A Y;  4PGG A;  3PQJ A;  5LGU A;  1Z3X A;  3RJP A;  4XOP A;  2L7K A;  1Y1V J;  3SZT A;  3A0B C;  1VQ4 I;  2LY1 A;  2M4G A;  3CD6 I;  2CWE A;  4D5C A;  2Y9Y A;  2HNH A;  4CH7 A;  2KPM A;  3Q9S A;  3CTA A;  2L01 A;  3P9K A;  4G6D A;  1LDJ A;  1UG0 A;  1V55 H;  2K9M A;  2XHK A;  3BPX A;  2CYY A;  5HS9 A;  3SDB A;  3EUK L;  3V8K A;  1HW2 A;  1YRN A;  4HX8 A;  2MC4 A;  3ECO A;  1CQT A;  2FNP A;  2LFB A;  5HLG A;  3KIO A;  3JRI A;  1OYI A;  1TNS A;  2CSO A;  3BTI A;  1B72 A;  1R6R A;  4PJN A;  1ZLJ A;  3N97 A;  1QGP A;  1VQ6 I;  2FQ3 A;  5LLQ A;  2HTJ A;  2ZJQ F;  5GAG J;  1MJA A;  2UV1 A;  3WG7 H;  3AL0 C;  1IN4 A;  1LKX A;  5F27 A;  4WWC A;  5GP9 A;  2IGO A;  3EPZ A;  3DEU A;  1ZRF A;  3BZC A;  4GO1 A;  1PUF B;  1YIO A;  3CCJ I;  2H8R A;  1XPX A;  2FOK A;  3HOU J;  2VAS A;  4N0B A;  2LH9 A;  1OKR A;  3F6V A;  1TWC J;  4BJ6 C;  3R4K A;  4D7M A;  3H5R A;  3L2Q A;  3K2Z A;  2MAB A;  4PSW A;  4YIR X;  1SFE A;  3MAJ A;  4BHC A;  4CYC A;  3MKZ A;  1SFO J;  3B02 A;  3IKV A;  4H4K C;  5KHD A;  2K9S A;  4A0X A;  3WTS C;  1BC8 C;  1FZP B;  5FD5 A;  4OIO F;  5EYR A;  1X4P A;  1D0Y A;  1KU7 A;  5BQT A;  4Y13 A;  1STZ A;  3OYF A;  3TKY A;  4HX4 A;  2FUG 2;  5FLX K;  5EZH A;  3FM3 A;  4JX4 A;  2K4B A;  1IXR C;  4M6Y A;  4CA0 A;  2I5U A;  1KYW A;  4V2G A;  4ENN A;  2E7X A;  1MMS A;  4HLX A;  4V19 K;  2X6X A;  3DP7 A;  3E0J B;  2O3F A;  1PYV A;  2XPV A;  1VQN I;  1LUJ B;  4ZZD A;  1LVK A;  4BQA A;  1HW1 A;  3PFI A;  3FMQ A;  3AL0 B;  1GV5 A;  2IS1 A;  2ECB A;  1P4A A;  3G2B A;  1HA8 A;  4L18 B;  3SHF A;  1IN5 A;  2KIU A;  5CQE A;  3AAF A;  5BPD A;  3WGH A;  2LMD A;  2K4J A;  3VYS B;  4XLF A;  1XSD A;  3B6A A;  2IS4 A;  3JAM Z;  2HPI A;  3RKY A;  3G6E I;  3DLL F;  3QPS A;  3K2A A;  4U87 A;  1ZN2 A;  2HU9 A;  1XCB A;  5C4X J;  1KU2 A;  2E2H J;  4UUS A;  3LMM A;  4CCL A;  1MBH A;  3A02 A;  3GYH X;  1VQM I;  4KNY A;  1RC9 A;  5F0H A;  2ZSI B;  2XKO A;  3NQO A;  2MH2 A;  1IN6 A;  2Y2Z A;  1TLH B;  3I3L A;  3ZGK A;  1VI0 A;  3ELK A;  4HST A;  1KON A;  4G12 A;  2PI0 A;  2V1D A;  3SXY A;  1H9T A;  4EJU A;  1B72 B;  2X6Y A;  3ZMV A;  1WHU A;  2OC6 A;  1WCM J;  4PJL A;  2FBH A;  2J5O A;  3P5J A;  4B47 A;  1F9N A;  1FX7 A;  1MZB A;  2IXS A;  1G8X A;  2OZ6 A;  2K02 A;  3C2B A;  5E79 C;  3WU2 C;  2CUZ A;  3CLO A;  4CYD A;  5LFA A;  3OSG A;  2MH9 A;  2PMH A;  1U3E M;  4ESB A;  3DFG A;  1PJR A;  1TW3 A;  4BUP A;  1GHC A;  1HSJ A;  2F5V A;  3BG5 A;  1NH3 A;  5BPI A;  1U6G A;  4KFC A;  4HDU A;  4XLH A;  4E7J A;  2OPT A;  3KYD B;  3FDY A;  4HEA 2;  2DXI A;  2G9W A;  3G71 I;  3IHU A;  5CYV A;  5JHF A;  2O8X A;  2QCO A;  1ON2 A;  1JKR C;  4CYC B;  1TQP A;  2WY7 Q;  4IVN A;  1P4X A;  2M0C A;  2XRL A;  5K5Q A;  2A69 F;  5K5R A;  1MBJ A;  4IHS A;  4MTD A;  3KCC A;  3S2D J;  4CCK A;  3TL4 X;  1DQU A;  2L7F P;  3BQY A;  4NHJ A;  4XKW A;  3F8B A;  3PM1 A;  3OS0 A;  3R0A A;  5JI6 A;  1YIJ I;  1U9N A;  4U7D A;  1P92 A;  2KFD A;  4IPA A;  1VQL I;  5D6F A;  3REO A;  1UHM A;  3DPU A;  2Q8K A;  3HTU A;  1MH3 A;  2AO9 A;  4CGZ A;  1S6L A;  1YQA A;  2VON A;  4UB6 C;  2JRT A;  2HVQ A;  1EF4 A;  2FE3 A;  5IOZ A;  2JA6 J;  4TV7 A;  4IKF A;  5F04 A;  4PFP A;  2ELJ A;  2XF7 A;  3BC8 A;  1SFU A;  1FP2 A;  2MA3 A;  4P96 A;  1ZEL A;  1B9M A;  1HDP A;  1BR1 A;  3M8F A;  4HNU A;  3GW2 A;  1APL C;  1J9I A;  2A6T A;  2GBY A;  2ZJ2 A;  3ONQ A;  3H35 A;  4C3H J;  2NVY J;  3HRS A;  3KP6 A;  2H6B A;  4LGW A;  4XLP F;  4EAT A;  5FRM A;  3E5U A;  3FM5 A;  4I2O A;  1IN8 A;  3CES A;  4L9V A;  2H1L A;  2ID3 A;  3ZCO A;  5J1Y A;  2QUF A;  3LSM A;  1TBX A;  2F2E A;  3F8N A;  2HXI A;  5FLV A;  2KZG A;  1I3A A;  1ZG3 A;  3O3K A;  1I6X A;  2HWV A;  2ZSH B;  3V8J A;  3CP2 A;  2EWN A;  4MNU A;  4HQM A;  1QRY A;  5J1U A;  3TBI A;  4KYW A;  2O61 A;  4E7Z A;  2EQR A;  1SAX A;  1ZAR A;  4M6V A;  3L9F A;  1WRJ A;  2I10 A;  4MHG A;  3HUG A;  4A0Y A;  1YO5 C;  3ZQL A;  3MEX A;  3ZMZ A;  1Y56 A;  2R92 J;  1IW7 F;  1N78 A;  4M3F A;  2BV6 A;  3L09 A;  2XRO A;  2IPQ X;  2W00 A;  3ZR8 X;  1WH5 A;  2X4H A;  4U7B A;  5FGM A;  2YU9 J;  1WKM A;  4CDG A;  1IRZ A;  2QM3 A;  4KIF A;  2CW0 F;  4Y4R A;  2L4A A;  3ESW B;  3VB2 A;  1AOY A;  2K3F A;  1QZY A;  3H9G A;  3CCV I;  2DAO A;  4XOR A;  1W0T A;  2V1U A;  1WQ2 A;  2ESN A;  5BS6 A;  3ABU A;  1LDK B;  2BHY A;  3HTS B;  1IRX A;  4BXX J;  1TW2 A;  1OPC A;  3AFH A;  3K1P A;  3KE2 A;  3V7R A;  2EA2 A;  4L5E A;  2OD5 A;  3GFJ A;  3FIS A;  1MSE C;  5CVJ A;  2E35 A;  3A03 A;  4E6K G;  5K7H A;  5LHH A;  4OIQ F;  2P7V B;  2VQC A;  4NDL A;  1GT0 C;  3DEE A;  1Y8R B;  2RRE A;  3H1C A;  3BCB A;  1JKO C;  2KDO A;  3KEY A;  4A3C J;  2PEX A;  2K85 A;  1LVA A;  4AWX B;  3HOX J;  1JTX A;  3DTE A;  4R1H A;  1AA7 A;  5F0F A;  4A0Z A;  2NYX A;  3IH2 A;  4U0W A;  3CCM I;  4CCO A;  2M4K A;  5K7F A;  3S3N A;  2H6C A;  2K9L A;  4XL9 A;  2EZK A;  1YE9 A;  3JAM K;  4XLA A;  3H92 A;  2OA4 A;  4PSX A;  4C9Y A;  4RS8 A;  4A93 J;  5LRS A;  4MTE A;  2V1X A;  5CLS A;  5A2Q K;  5JR3 A;  3DPL C;  3RYP A;  3RIR A;  4G7Z F;  5F1J A;  5M3F J;  3R0J A;  1Z05 A;  3I0T A;  3E5X A;  2EB7 A;  4RM3 A;  3WTZ A;  3CO7 C;  1GDT A;  5EDN A;  1FPQ A;  2E36 A;  2L02 A;  4HDV A;  1FIA A;  2XB0 X;  3GLL A;  4I7H A;  1BI1 A;  1G3Y A;  1BM9 A;  1Y0N A;  4IZZ A;  4YFK F;  3M4O J;  1OCP A;  1H8A C;  5ICE A;  3UKG A;  2CQK A;  1D3Y A;  1W7P A;  5KVR A;  1JI8 A;  1EH6 A;  3BDD A;  4LG3 A;  2XAS A;  3ABM H;  1Z7L A;  2QEX I;  4IHW A;  5JVT A;  3S16 J;  5IP6 A;  2JUC A;  2DJI A;  2KHM A;  5F08 A;  2DA3 A;  4L5I A;  4ON0 A;  1K78 A;  1AU7 A;  3W6V A;  3HUG B;  4XIC A;  4RGU A;  4BJT A;  4M3G A;  5LHI A;  4GFB A;  3EET A;  4I01 A;  1JUM A;  1JHF A;  1K6Y A;  1TWF J;  2RC4 A;  1REP C;  2R7U A;  3M1C A;  4ABZ A;  3I4M J;  2D2W A;  3RTR A;  3Q9V A;  3CDI A;  2MW8 A;  3DBR B;  3CME I;  3BP8 A;  5L3E A;  2VOP A;  3K70 D;  1T0F A;  1SAN A;  3UR3 C;  3L2W A;  4KIB A;  3L2U A;  1MMG A;  4NC7 A;  1RIO H;  3QWL A;  5F64 A;  2HDD A;  4DGW B;  1IV8 A;  5LGN A;  4UHT A;  3WTU C;  2ADU A;  3R61 A;  4HYE A;  4BGD A;  5HDN A;  4IL6 C;  2IRF G;  5C3E J;  3O2P E;  3C1D A;  2XPW A;  3O8H A;  3CO6 C;  1P6R A;  1A31 A;  3MCZ A;  2E1O A;  2WB1 A;  3HRU A;  2ZCW A;  2HEO A;  1BN5 A;  2EIN H;  3G4S I;  2CJJ A;  3BJ6 A;  3QOP A;  4HOB A;  1W5T A;  1DUX C;  2BE5 F;  2PMZ N;  2XV4 S;  2XVC A;  3CC4 I;  1TTY A;  4EJV A;  1JUP A;  2Y75 A;  2CV1 A;  2Y0S A;  3IV5 A;  2VPR A;  3SZG A;  4ZYA A;  5H2F C;  3NWS A;  1E3P A;  4G6T B;  3KLN A;  1S9H A;  1FJL A;  1ZGW A;  2M2E A;  1MDM B;  2N8G A;  5E18 F;  3V4G A;  2JK3 A;  4Z2Y A;  1YJ9 I;  2PJP A;  1G6N A;  5EGO B;  3FHZ A;  1YTY A;  3ZRG A;  1T0F C;  3BG9 A;  3BR6 A;  3K10 A;  3RCO A;  2IW5 A;  1Q1H A;  3S15 J;  2JT1 A;  3KPH A;  4HLY A;  3P9C A;  1KU3 A;  3HBL A;  1R49 A;  2PN6 A;  2L3D A;  2ME6 A;  3HOW J;  3AG2 H;  4M73 A;  2UXN A;  1SFK A;  1RES A;  4YIF A;  2M34 A;  4HF0 A;  5D5V B;  4M9Z A;  2RNJ A;  3LWF A;  3BPV A;  2XRN A;  2Z99 A;  1B6A A;  5CVV A;  2HR3 A;  1LFU P;  1E3H A;  2HQA A;  2GM4 A;  3WU1 B;  3JRF A;  4OWR B;  1VF9 A;  2R93 J;  5JLW A;  4AYB N;  3SYT A;  3S1R J;  2QSG X;  1W7P B;  2R0Q C;  2O7O A;  2R7X A;  1ZLK A;  2ZME A;  2Z3Y A;  1P9Q C;  4B43 A;  1HF0 A;  2W82 A;  2STW A;  4C2U A;  1ETO A;  3K6G A;  2XAF A;  1HOM A;  2GAU A;  4CSW A;  1X3U A;  1DU0 A;  2OZU A;  3H3V K;  4BAC A;  1K78 B;  3GTO J;  4XBF A;  3IRQ A;  4LFU A;  4Q47 A;  3FXK A;  1MBE A;  3L2R A;  1T39 A;  1ODD A;  3F9K A;  2XIG A;  3VDX A;  3KYC B;  2FEZ A;  4WXD A;  4A3G J;  2K86 A;  4ZTJ A;  1UHS A;  1VQ9 I;  4I76 A;  2FA5 A;  2B63 J;  4UV9 A;  4BS9 A;  4GCV A;  1G3S A;  1MW7 A;  1OIS A;  3TMO A;  1T98 A;  1ETK A;  1XDU A;  2DA7 A;  2XSD C;  1QVU A;  3BZK A;  3A4C A;  3MZ8 A;  2CU7 A;  1QNT A;  4JYK A;  4RA2 A;  3ULQ B;  4E70 A;  2VQL A;  2IS2 A;  3AKZ A;  2DFE A;  1SMT A;  3KP5 A;  4XQF A;  2K27 A;  4JQF A;  4IRG A;  1WJB A;  3S2H J;  4MQV A;  4A6E A;  3IUO A;  5KNL A;  5ED4 A;  2ZME C;  3GEZ A;  3SQN A;  2ICW G;  5FO5 A;  5DDG A;  3S14 J;  3U9G A;  3K1N A;  3IAM 2;  3PSI A;  1JHH A;  2ZC2 A;  3FKJ A;  2IS6 A;  2DQL A;  2OQG A;  3J80 Z;  1XB4 A;  2R7D A;  5HNF A;  1HQC A;  2DLL A;  4P55 A;  1G4D A;  3I55 I;  3BOQ A;  3K4L A;  3DF8 A;  1BIB A;  2X1E A;  5IT3 A;  5HOO A;  3FMS A;  4KUM A;  1X2M A;  2P81 A;  4PZJ A;  1R7J A;  3DV8 A;  1UMQ A;  2D45 A;  1S5L C;  1X2N A;  3CMA I;  2K9Q A;  3ZMS A;  2LBF A;  2ISZ A;  2KDZ A;  2GXA A;  2F4I A;  4B44 A;  1S29 A;  3FMR A;  2ZKZ A;  3QU6 A;  4BQO A;  1QHH D;  5HDK A;  5CKT A;  1FP1 D;  2W85 A;  3FXQ A;  3VEP A;  3GO5 A;  4KIG A;  4RDU A;  1EJ9 A;  3EQL F;  2K40 A;  1VQP I;  3JRB A;  2VBY A;  2TCT A;  4PCQ A;  3RKW A;  2DT7 B;  2DMT A;  2LNB A;  1TWG J;  3M8J A;  2ECC A;  1IV6 A;  3H5N A;  1F36 A;  5LHG A;  3MZH A;  5D6E A;  3LA7 A;  4FE4 A;  4XNF A;  5K1Y A;  5D4R A;  1MBG A;  2L9S A;  2ZME B;  3GLX A;  4OU0 A;  2LVS A;  1MJB A;  5CPR B;  4BEH A;  3DQV C;  4LK0 F;  1SVL A;  2VLA A;  3Q0U A;  4YII A;  1XG1 A;  4Y52 J;  2RGV A;  2VKH A;  1BW5 A;  3FX3 A;  4RGR A;  1YJW I;  1VQ8 I;  1RUN A;  3ERE D;  1OCC H;  1BOB A;  2DA2 A;  4M9S A;  3LNQ A;  2H94 A;  2KL4 A;  3F22 A;  5GAH J;  2QQ8 A;  4BE1 A;  2DYR H;  3X2Q H;  3PO3 J;  5J8F A;  2HVS A;  4IHX A;  3DKY A;  3FBI B;  3KZI C;  4M72 A;  4GXO A;  1ZH5 A;  1K83 J;  2L0K A;  3GTM J;  2DA6 A;  3DKX A;  3PNY A;  3F6O A;  1Z67 A;  2EK5 A;  4WXC A;  3EYI A;  3ZQG A;  3OR2 C;  2IA2 A;  4S04 A;  3D1N I;  3IAS 2;  2ACJ A;  2GQQ A;  2E1M C;  2XAJ A;  2W24 A;  4BBS J;  1OCO H;  3D5S C;  1YFH A;  2HVR A;  1Z0X A;  3W2W A;  3MWM A;  1GVD A;  1SVO A;  4IRH A;  3V7S A;  1MNE A;  4M6X A;  3N4M A;  1S3J A;  3RZO J;  2XDV A;  1HKQ A;  4D7N A;  2R7O A;  1F1Z A;  2WC2 A;  2P0W A;  5LD2 C;  1CF7 A;  2NVT J;  2DFF A;  3LA2 A;  2XC7 A;  3JCU C;  1UZC A;  4P9F A;  4R8H A;  3A01 A;  4ESF A;  3JTH A;  1I1G A;  5GPC A;  3BCA A;  5IOY A;  1BA5 A;  2MSY A;  4R79 A;  5BOX A;  2LK2 A;  4OAY A;  1ZAO A;  4ITV A;  2EFQ A;  4EM0 B;  5H20 A;  5LEJ A;  3HIF A;  4BHB A;  2LBF B;  4AID A;  1O4X A;  2HPM A;  1EA3 A;  3W3C A;  2Z5U A;  1IO2 A;  3PIO F;  2A05 A;  3BTC A;  3VYU B;  1BR2 A;  2VQG A;  2DQR A;  4DYR A;  2PG4 A;  3CUQ A;  2A5Y B;  3RI4 A;  2EIK H;  4XMY A;  2ZNZ A;  3M1E A;  4RAF A;  4XRF A;  4B3A A;  4A3K J;  1MGT A;  1FNN A;  2E1M B;  5DM7 F;  1RR8 C;  3OYC A;  1ITY A;  3RZD J;  2EIL H;  5DYM A;  1DU6 A;  1KYZ A;  4WK8 F;  3BG3 A;  1Z91 A;  2KKO A;  2V79 A;  2FBI A;  1HLV A;  2LDU A;  4XKC A;  3S1N J;  4BEH B;  3C2G A;  1FOW A;  2L2O A;  2JWT A;  3HHG A;  2BW3 B;  4ZDP A;  3FKI J;  1XSX A;  4IO9 F;  2HQR A;  2WAE A;  4E7K A;  5IT9 Z;  1ETW A;  1K4S A;  4UB8 C;  4XON A;  1PP7 U;  3I58 A;  1LDD A;  3BR3 A;  3VSL A;  1FSH A;  2XSJ C;  3WTY C;  3DXJ F;  2DFI A;  2GIZ A;  2R5Y A;  1W36 D;  4RLF A;  4S05 A;  4LOC A;  3HOS A;  1SD5 A;  4RAY A;  4D0P A;  5EZG A;  4DW6 A;  4PUS A;  2PBI A;  2XAQ A;  2R7R A;  2BY3 A;  3F72 A;  3DLA A;  2VJ4 A;  3E7L A;  2K7L A;  3MKL A;  4GRI A;  3J80 K;  2FBK A;  3CUQ C;  4LIV A;  3T0Y A;  1T95 A;  2OAZ A;  1GXQ A;  3E1S A;  5TGT A;  2BHZ A;  5D8K B;  5GPA A;  3LAJ A;  1WJA A;  1BR4 A;  2BVL A;  2G7H A;  3LSP A;  1N77 A;  1DP7 P;  4ZYG A;  4ESJ A;  4W1U A;  2X6O A;  6PAX A;  3BLY A;  3FBN B;  3CCU I;  4JX6 A;  5AON A;  3O8G A;  2IP2 A;  2XAG A;  3QYF A;  1QVT A;  2BY2 A;  2XB5 A;  4AM3 A;  1YRN B;  5HS7 A;  4C2M J;  4XKB A;  3BQZ A;  2H27 A;  1X3W B;  2IJL A;  2X6W A;  3SEQ A;  2WWY A;  1P4W A;  4BBR J;  3A01 B;  4B09 A;  4EV0 A;  1PUE E;  3BJA A;  4D9J A;  2IT0 A;  3G1L A;  2M8E A;  1DPR A;  3EUA A;  2HOT A;  2OU2 A;  4HV5 A;  3ZOB A;  2R7W A;  3U1K A;  5FJ8 J;  5FRN A;  2X1C A;  3OL4 A;  3IC7 A;  2F5D A;  5ILV A;  1VFC A;  2VJ5 A;  5LEK A;  3ECH A;  1IC8 A;  4O3M A;  3CUQ B;  2V26 A;  3A0H C;  2EFO A;  3FXR A;  5B66 C;  1T8I A;  3NAU A;  2HDW A;  3HRM A;  4FX0 A;  5E8G A;  4YFN F;  2RV8 A;  1J0R A;  4ENJ A;  4HF2 A;  2NS7 A;  4Q5S F;  4KIT B;  4XN3 A;  1V3F A;  3BG6 A;  4MO7 A;  2KIM A;  2X48 A;  2FSW A;  4KT6 A;  4FX4 A;  1Z1D A;  3QPT A;  1FBS A;  4ZDO A;  1F5T A;  1MND A;  5HDG A;  4QSH A;  3J7Y J;  5IPA A;  4BXU A;  3ERM A;  2V9K A;  3GTP J;  3K9T A;  4B48 A;  5AIQ A;  3Q5F A;  3M9A A;  1UCR A;  3H5A A;  2L9N A;  2NS8 A;  4EM1 A;  1IF1 A;  4MEY F;  1GUU A;  2V9V A;  1XGM A;  3SJM A;  5HLT A;  5EG0 A;  2NXN B;  2W7N A;  1RKT A;  1VQ5 I;  5H6R A;  2W4S A;  3IL2 A;  1H0M A;  2STT A;  1EV7 A;  3KP2 A;  3KZZ A;  2EV0 A;  1Q1V A;  3QU3 A;  4AVZ A;  4AC0 A;  3HOZ J;  1TWA J;  2OF7 A;  2KQR A;  3QP6 A;  1HC8 A;  4HRI A;  1RNL A;  1OLT A;  1YW7 A;  3O6B B;  3OYG A;  5GTI C;  1K79 A;  3L7W A;  2L54 A;  3AG4 H;  3SFI A;  1X58 A;  2NOJ B;  2Z2S B;  3HKZ A;  4BKX A;  1U78 A;  3KEO A;  2PJR A;  1LEA A;  4WXH A;  4UUS B;  2ZO4 A;  3OYN A;  3U21 A;  4G9Y A;  2YPR A;  4A3D J;  3ISP A;  1J75 A;  4DZJ A;  3FXM A;  3ML6 A;  3CJR B;  5E1W A;  5DS9 A;  2IAI A;  2ISY A;  4M3B A;  2OTL I;  2ZXJ A;  3BRO A;  2VBW A;  1IXS B;  3LQR A;  2ZXI A;  3SZP A;  4LD5 A;  3I53 A;  2JSC A;  4F93 B;  3QOD A;  3A2K A;  4C3J J;  4S0H B;  2IVM A;  1TQM A;  2HQN A;  2M9H A;  1Y39 A;  1PP8 F;  2NS0 A;  2UWM A;  3BR5 A;  5TRD A;  1V54 H;  3IKT A;  1XTA A;  2ELH A;  2M1B A;  2QLZ A;  2Q2E A;  5C4J J;  5J4V A;  4KMF A;  1I3Q J;  3TP0 A;  3PL8 A;  1B8I B;  3BR2 A;  5IT9 K;  4L9N A;  4B1R A;  3K69 A;  4A3J J;  2H1K A;  4P1W A;  2VJJ A;  4I99 C;  3MKW B;  4AU7 A;  2UZK A;  1EH7 A;  1J09 A;  2LF7 A;  1G59 A;  2EA4 A;  2CFX A;  3IH3 A;  4CUG A;  4U0Y A;  5FKK A;  4PFO A;  4E7L A;  3LAP A;  2MC3 A;  3HXL A;  3WOD F;  2BY0 A;  3DCF A;  3VYT B;  1ZRC A;  4BDY A;  1E0E A;  1ON1 A;  3H3Z A;  4B8X A;  2Z33 A;  3CLQ A;  1VTN C;  3BJO A;  1MSF C;  2QEN A;  5M5W J;  2ZNY A;  4GYG A;  2DMP A;  1OCZ H;  3CCR I;  3F8M A;  1R71 A;  4XLE A;  4MGR A;  3R6S A;  5FRO A;  1K4T A;  1N25 A;  1P7J A;  2DOD A;  2XGX A;  5EG0 B;  2EZH A;  2JVG A;  1I1S A;  1RUO A;  2DK5 A;  2V9P A;  4RGX A;  4BQQ A;  4E7I A;  4JK1 X;  4A3L J;  1K7A A;  3H0D A;  9ANT A;  2P5K A;  1ZTR A;  2VE8 A;  3FK6 A;  2Y31 A;  1QBJ A;  4IEJ A;  5AIP A;  1TT0 A;  2BEO A;  3FZV A;  2VJI A;  4MEX F;  1G2H A;  1TNT A;  1LFP A;  2L7Z A;  2DW4 A;  1I50 J;  1XSV A;  2EFW A;  1V5F A;  2LP0 A;  4FET A;  2KRF A;  3EDP A;  3FIW A;  2J5P A;  2RKH A;  3I9V 2;  3PSF A;  3FXU A;  5J40 A;  2OTJ I;  1A6I A;  4N4O B;  1AWC A;  2KP6 A;  5D5U B;  5J1R A;  3JRE A;  4G8X A;  1EKE A;  3S1M J;  3OYI A;  2NVX J;  2GLO A;  3DEW A;  4E4H A;  3S8P A;  3HOY J;  1XC5 A;  2KJC A;  3DBL B;  2BOL A;  2HYJ A;  2HQ5 A;  2AQF A;  4DNC A;  4F7Z A;  3F8F A;  1J2X A;  4YFX F;  3Q0W A;  2JA2 A;  2KRC A;  1D8J A;  2EH3 A;  2AQE A;  2BBY A;  3HPH A;  3E6B A;  2K5C A;  3GWZ A;  2YSR A;  1KQ8 A;  5F0C A;  4ENK A;  1ZQ3 P;  2BVM A;  1KQ0 A;  2YU3 A;  2A5W A;  3MZY A;  1Z9C A;  1U8R A;  3BZ6 A;  3NAR A;  4EGZ A;  1IGN A;  2VI6 A;  3LSH A;  4PK4 A;  4A3I J;  1DPU A;  4IOC F;  4RLQ A;  2LKX A;  1FOX A;  1NG6 A;  1BJZ A;  4BE2 A;  3NWT A;  2XF5 A;  2Y48 A;  4MQ9 F;  1ZR2 A;  1J7K A;  4BL0 B;  1X1A A;  5CVI A;  1W5C C;  2ZBK A;  3GTL J;  2QZ8 A;  4I0A A;  1WSU A;  1JKP C;  3E3V A;  3LST A;  4IHT A;  3CCQ I;  2DOF A;  2BY1 A;  2VXD A;  3GXO A;  1GV2 A;  3WHB A;  3K4M A;  3CJN A;  1YW9 A;  4KIC A;  5FKL A;  3OOP A;  1R00 A;  2HKO A;  2VT3 A;  4UVA A;  3W6K B;  4YEL A;  1YOV B;  2VQH A;  4C2T A;  1BI2 A;  4ZC3 A;  4IF4 A;  1R1T A;  2P7C B;  1B59 A;  4LMY A;  1TT5 B;  1OQY A;  1Z21 A;  3LSI A;  3LOC A;  3D5R C;  4DIQ A;  5GTH C;  4DBR A;  3GTG J;  1S7E A;  1ZYR F;  1YYV A;  1B9N A;  2M7A A;  2O9L A;  2E2J J;  1A04 A;  2DJN A;  4IQJ A;  2PFB A;  1J5Y A;  1R5I D;  1ZG1 A;  3HSE A;  3FXL A;  1XDS A;  1QA6 A;  4CXF A;  1V5E A;  1OJL A;  5KCM A;  2D1V A;  3B6C A;  1RI7 A;  2Y0S N;  2OJE D;  4UNO A;  1C0W A;  1HCR A;  4Y17 A;  3H9Q A;  3RPU D;  1IDY A;  1MKM A;  3ABL H;  4UV8 A;  3JTG A;  3HGG A;  3H3U A;  2LTP A;  4C3I J;  1AKH A;  1OFC X;  3G1M A;  4RBO A;  3IWF A;  3NEU A;  2A3S A;  3R60 A;  3K70 C;  1J59 A;  3BWG A;  3KP7 A;  4LK1 F;  1FT9 A;  3GZ5 A;  3WG9 A;  1S72 I;  3F0C A;  1G3T A;  1WVR A;  3GUD A;  3KLO A;  3OYJ A;  1XMK A;  1JTY A;  1S7O A;  4J00 A;  4RMN A;  5EEA A;  3GBG A;  4XID A;  4L5J A;  4IHV A;  1UG2 A;  2E19 A;  2LRD A;  4CZC A;  1WPK A;  2FQ4 A;  4YG2 F;  4WF2 A;  2DTZ A;  2MLK A;  3GX4 X;  4A3F J;  2HTS A;  3TW7 A;  1XGO A;  2JA5 J;  2MYS A;  3L2V A;  2Y0M A;  1BJA A;  3RPU A;  1O3S A;  2QF7 A;  4KIS A;  1HKS A;  2YUS A;  2DCE A;  3ZP5 A;  4FTH A;  3GTQ J;  2RQP A;  3CP8 A;  2AHQ A;  2V1N A;  3OL3 A;  1FTT A;  1XS9 A;  3ZMT A;  3NRV A;  4FHT A;  5J4Y A;  3HHH A;  1U8B A;  3I4N J;  2QQA A;  2OCE A;  4BQN A;  3FXO A;  1PDN C;  1QU3 A;  3ZQ7 A;  5K5O A;  3JW4 A;  2KIF A;  3FWE A;  2AXL A;  1ZK8 A;  1IDZ A;  5BNG A;  1YG2 A;  3TQN A;  2P5V A;  1ZGA A;  3T8R A;  2EZL A;  1SFX A;  4WX9 A;  5DCF A;  1WJ5 A;  2VUM J;  2GXG A;  4LLL A;  1BW6 A;  2AS5 F;  4JP0 A;  3C18 A;  3ZQQ A;  2ETH A;  3KX2 A;  5CQG A;  1TP4 A;  5L3G A;  1SEU A;  5E1Z B;  2XGE A;  2YR2 A;  3HG9 A;  3ASN H;  1U0J A;  1O3Q A;  2VXZ A;  2JQ7 A;  5FFZ A;  1SD4 A;  3CJQ B;  1OCT C;  2IA0 A;  4BJ5 C;  4EMS A;  4MFD A;  2B7E A;  4W97 A;  2IGK A;  3A1Y A;  4IJA A;  2KRH A;  2FX0 A;  2WAQ A;  1MD0 A;  2EIJ H;  2JVH A;  3HYI A;  4XM3 A;  5JFR A;  2HOA A;  2HYF A;  3MMY B;  1U5T A;  1KQ9 A;  4B3X A;  1FSE A;  2I8D A;  1O7L A;  3GZN B;  3WHC A;  2W57 A;  2WAF A;  1TWH J;  5HS8 A;  1OR7 A;  3TO6 A;  1FMW A;  3PUF A;  2VC1 A;  1T6S A;  3BR0 A;  2JSP A;  3RDI A;  4O6J A;  2FF4 A;  2JRM A;  2L9V A;  3PIP F;  4EJW A;  2IA1 A;  2ZJP F;  3GFM A;  2L9R A;  4BH9 A;  3UNG C;  2VE9 A;  1JGG A;  2VT2 A;  2NVQ J;  3ZQF A;  4DYQ A;  1YI2 I;  1D5Y A;  4ENM A;  4KT5 C;  1LJ9 A;  4Y33 A;  2AXT C;  3KP3 A;  1P7I A;  3RKX A;  3WGI A;  1AKH B;  2OV7 A;  3PNV A;  4UUV A;  4M74 A;  2HFH A;  5E3O A;  2CO5 A;  2CQX A;  4KA4 A;  4E7H A;  2ZFW A;  3DKW A;  1P2F A;  2VN2 A;  4XN0 A;  5FLM J;  5GAD J;  1AHD P;  3WTX C;  2EPF A;  1ZGJ A;  3TP3 A;  3AG3 H;  1CGP A;  2E71 A;  1JJ6 C;  3EUH A;  5DUK A;  1U5T C;  1U9O A;  1Y0U A;  4N4N B;  5HLI A;  2FNA A;  1O7F A;  2R4G A;  3K4B A;  4JX5 A;  4NC8 A;  3E6M A;  1RRJ A;  2W84 A;  4MFE A;  1PVE A;  3HRT A;  3TDU C;  2C6Y A;  2VKE A;  4P9U A;  1R9T J;  2DA5 A;  2FOW A;  2EIM H;  2W1O A;  5K7Z A;  4XRM A;  2QSF X;  1RKW A;  2F6C A;  1POG A;  2XAH A;  5JHU A;  2M8G X;  2D5V A;  1VND A;  1XGN A;  2KLO A;  1ZRE A;  3COA C;  4B4C A;  4QPQ A;  1ULY A;  3SEZ A;  3I56 I;  3HSR A;  3ROU A;  4ZJZ A;  3E5Q A;  3HM5 A;  4KN4 X;  3JRC A;  1K61 A;  1I5Z A;  1MMN A;  2CUF A;  5KK1 A;  3P9I A;  1Z6T A;  2UUZ A;  1B4A A;  1W1W E;  1TZL A;  3BR1 A;  3J81 Z;  2QKL B;  1UFM A;  1R5G A;  3K4J A;  4CCN A;  4OIR F;  2P6S A;  5FD6 A;  2XAU A;  5DV5 A;  2DBB A;  3EUH C;  3BTJ A;  3V7C A;  1IRF A;  2OBP A;  4RB1 A;  4FT8 A;  4MLO A;  2H8W A;  4AD9 A;  2WV0 A;  3K4N A;  3DU6 A;  4HNV A;  4WCG A;  3I59 A;  2LYC A;  2VOD A;  1DGR M;  1KZH A;  1B1B A;  1YW8 A;  4HW0 A;  2CG4 A;  2CV2 A;  4BXF A;  3LSR A;  1U5T B;  5FB2 A;  1HBX G;  4XSZ F;  3CF2 A;  1OYW A;  2LF8 A;  5JVG F;  5D4S A;  5HNH A;  2OUM A;  1I39 A;  1KGS A;  4V2F A;  1YLF A;  1IUY A;  1ETV A;  4BDZ A;  4XKV A;  1ONV A;  4ZZL A;  3GTJ J;  1FYM A;  2M87 A;  2GIV A;  2LY9 A;  1IN7 A;  4LJZ F;  3OMY A;  1X1C A;  3LFU A;  2JTV A;  1R5H A;  1A6Q A;  3GFL A;  3HGY A;  1WWX A;  3SDG A;  3HJE A;  4QTR A;  2NNN A;  1D5V A;  3RKQ A;  3U1D A;  2W48 A;  1D1A A;  2IEK A;  2Z1D A;  5IP7 J;  3WE2 A;  2L7M P;  4N9I A;  4DQ2 A;  1T08 B;  2DMU A;  2X85 A;  1MH4 A;  3KET A;  1GLN A;  5DM6 F;  4G94 A;  3QPH A;  1A5J A;  2E2I J;  1H89 C;  2QQ9 A;  2QQB A;  3L00 A;  1YJN I;  4X6A J;  3I71 A;  4HPQ A;  4XRS G;  5FKN A;  1ZG5 A;  1JT6 A;  3CMY A;  3ZQC A;  2HGC A;  2DOE A;  3TOB A;  1X19 A;  1OMI A;  3KYL A;  4FQG A;  2LR8 A;  3I54 A;  3PFY A;  5B1A H;  3KP4 A;  4DJA A;  4YRV A;  2CQ7 A;  4AIJ A;  2CUE A;  3HOV J;  3S1Q J;  1FBU A;  1QPI A;  3GZ6 A;  1UHW A;  4NC6 A;  4BY7 J;  3MFK A;  4NUB A;  4LG0 A;  3L2C A;  3RPQ A;  4HQE A;  1T38 A;  2Y69 H;  1KU9 A;  2WA0 A;  1FTZ A;  2DDA A;  2NOG A;  2RAE A;  3IRR A;  3JRA A;  2DN0 A;  3M7G A;  4G7H F;  4CO8 A;  4OIP F;  4XOT A;  1TQI A;  3VWB A;  1NG7 A;  2O5R A;  3HL2 A;  2HOE A;  5C44 J;  2FMY A;  3P7N A;  2KIQ A;  5DCM A;  4H0E A;  1R58 A;  4RM2 A;  2DI3 A;  2FRH A;  4ZH4 F;  3TW6 A;  3GFI A;  2IGM A;  3OV8 A;  2MGQ A;  4OMZ A;  4RGS A;  4BYY A;  5L3C A;  4XLN F;  2BXY A;  2Q1Z B;  4F3Q A;  3WE3 A;  1CF7 B;  2O03 A;  5TJJ A;  1RZ4 A;  4AVP A;  3PNT A;  1Y6I A;  4LLG F;  2V7F A;  1Z6R A;  1ERD A;  2R7V A;  4PGH A;  2R5Z A;  4Z6Y A;  1FC3 A;  2HDC A;  4HG2 A;  3T5X A;  3I59 B;  2P5L C;  5F1R A;  2VB6 A;  4IRI A;  2DPD A;  2A07 F;  2ZXH A;  3GME A;  3GF2 A;  3RQ4 A;  4EM2 A;  5A2Q Z;  2E1N A;  3HSF A;  2COB A;  3SFZ A;  1FOK A;  2ZJR F;  5IY5 H;  1LFB A;  4HAM A;  3F3X A;  3C2H A;  3IP4 B;  1S8N A;  1XN7 A;  4L0Z B;  1QZZ A;  3F8C A;  1UB9 A;  4CCJ A;  4CIC A;  2X0L A;  3Q0V A;  1FOY A;  4L9T A;  4A2U A;  1O3T A;  4Q48 A;  2VBZ A;  4QLC U;  4IHY A;  2KZV A;  4A5M A;  2E34 A;  1JXS A;  1S7A A;  2IGN A;  4OOI A;  4PJ0 C;  4PDK A;  3MQ0 A;  2O0Y A;  1MMD A;  2DT5 A;  2YX4 A;  4EVI A;  3ZQI A;  4L0Y B;  2EJR A;  1W36 C;  2A61 A;  2F4M B;  4DZP A;  2WBM A;  1SVM A;  3OS1 A;  2TRT A;  3H36 A;  3LQQ A;  4OAZ A;  3ABK H;  3BG7 A;  3E6D A;  5DEQ A;  2LRE A;  1X1B A;  4LIU A;  1IJW C;  4LIT A;  3S93 A;  3KZY A;  1YX3 A;  3AG1 H;  2R3S A;  4D5F A;  1R1V A;  4UUT A;  2X1D A;  3U2R A;  2CV0 A;  3VOD A;  2Y30 A;  4DBQ A;  4EJO A;  2EBI A;  1QQI A;  3DBH B;  2EZI A;  3OSF A;  1X3Z B;  2LD5 A;  2LG4 A;  1A36 A;  1LNW A;  2R5Y B;  4GDF A;  1ENH A;  2LSO A;  1BC7 C;  5ILU A;  3DPT A;  1RR7 A;  4O5V A;  4LG0 B;  5L3B A;  3J81 K;  3PQK A;  4BE0 A;  1WZ2 A;  4NNJ A;  1VQO I;  3OIQ A;  4D1Q A;  1HST A;  1OCR H;  3OOU A;  3QQA A;  4ZYD A;  3CDL A;  3K7A J;  5M5X J;  4BAY A;  1SC7 A;  1BIA A;  1QZE A;  4UXN A;  2XKP A;  3L1P A;  1LPQ A;  1ETY A;  1YS7 A;  3MKY B;  2HXO A;  3WTT C;  1X1P A;  4IQ4 A;  5DCM B;  4UY8 I;  2QVO A;  5CVR A;  1E2X A;  3S3M A;  2LY2 A;  1T2K A;  3MD2 A;  3LA3 A;  2HOS A;  4FAS D;  4F55 A;  2E60 A;  4PJM A;  1MIJ A;  5CVU A;  1A35 A;  2P6T A;  2E7W A;  1HW5 A;  3ZXS A;  1E17 A;  3MVP A;  1Z7U A;  2F5C A;  2A6H F;  2PX9 A;  4NQW A;  2JPC A;  2HS5 A;  2JZY A;  1D0Z A;  4I98 B;  1BI0 A;  1V4R A;  2LKS A;  2R5Z B;  4X1E A;  2R7Z J;  2FJ1 A;  3BT9 A;  2HZT A; 
#chains in the Genus database with same CATH homology
 1GV2 A;  3WHB A;  3VPR A;  5EZH A;  2XGC A;  5FKL A;  4JX4 A;  4RDU A;  3HKZ N;  2K40 A;  4V2G A;  3JRB A;  2TCT A;  5E3N A;  2DMT A;  2XPV A;  1TWG J;  2ECC A;  1IV6 A;  1F36 A;  4FE4 A;  1GV5 A;  3LOC A;  2ECB A;  3GTK J;  3GTG J;  1MBG A;  1S7E A;  2LVS A;  5JLX A;  2O9L A;  2E2J J;  2DJN A;  3B6A A;  2O8K A;  3IH4 A;  3QPS A;  3K2A A;  3Q0U A;  1XG1 A;  4Y52 J;  5C4X J;  1OJL A;  1BW5 A;  1Y1W J;  2JJ7 A;  1ZKG A;  3RQI A;  4UUS A;  2HI3 A;  3B6C A;  5EF6 A;  2E2H J;  1MBH A;  3A02 A;  5F0H A;  2DA2 A;  2Y0S N;  3LNQ A;  2Y2Z A;  1HCR A;  3PO3 J;  1IDY A;  1VI0 A;  3CCY A;  1NK3 P;  4G12 A;  4MIM A;  3HGG A;  4C3I J;  2LTP A;  1AKH A;  4IHX A;  3JRH A;  1OFC X;  1B72 B;  1K83 J;  2CQQ A;  3G1M A;  2L0K A;  4RBO A;  2DA6 A;  1HDD C;  3GTM J;  1F43 A;  1WCM J;  3ZQG A;  3Q3S A;  3D1N I;  2JMW A;  3F0C A;  4BBS J;  5IYB J;  1JTY A;  4FE7 A;  5EEA A;  3GBG A;  1Z0X A;  3C2B A;  1GVD A;  5J3L A;  3OSG A;  4XID A;  4A3B J;  4IHV A;  1UG2 A;  2CRG A;  3RZO J;  2E19 A;  2YS9 A;  4D7N A;  1WPK A;  2FQ4 A;  3BG5 A;  2ELK A;  2DA1 A;  2DTZ A;  4A3F J;  2OPT A;  3TW7 A;  2NVT J;  2JA5 J;  5EGO A;  2QF7 A;  3A01 A;  2YUS A;  4FTH A;  2QCO A;  3GTQ J;  5GPC A;  1JKR C;  4CYC B;  5IOY A;  2AHQ A;  1BA5 A;  1FTT A;  2M0C A;  2MSY A;  1XS9 A;  2XRL A;  1MBJ A;  2LK2 A;  3MN2 A;  3I4N J;  1U8B A;  3S2D J;  2L7F P;  3BQY A;  3PM1 A;  1ZK8 A;  1IDZ A;  5BNG A;  1O4X A;  1U9N A;  2EZL A;  4DYC A;  3BTC A;  2VUM J;  4QIW N;  1BW6 A;  4DYR A;  4JP0 A;  1MH3 A;  2AO9 A;  4EEF G;  1EF4 A;  5IOZ A;  2JA6 J;  2FD5 A;  2XGE A;  5F04 A;  1ORK A;  5M3M J;  1T33 A;  4B3A A;  4A3K J;  1OCT C;  3TED A;  1WH7 A;  1HDP A;  1ITY A;  4MFD A;  4W97 A;  3RZD J;  3OIO A;  1APL C;  1DU6 A;  2Y9Z A;  2FX0 A;  2GBY A;  3BG3 A;  4C3H J;  2NVY J;  2HOA A;  1HLV A;  3S1N J;  3WHC A;  1TWH J;  2JWT A;  5E3M A;  3FKI J;  5J1Y A;  2ID3 A;  1ETW A;  3BR0 A;  4BY1 J;  2HXI A;  1I6H J;  5FLV A;  3BR3 A;  2L9R A;  5M5Y J;  2JA8 J;  2X9D A;  2R5Y A;  2NVQ J;  1IUF A;  1JGG A;  3ZQF A;  4DYQ A;  4LOC A;  1D5Y A;  1QRY A;  5J1U A;  5EZG A;  4DW6 A;  1P7I A;  2EQR A;  1AKH B;  4M6V A;  3MKL A;  4I6Z A;  1JKQ C;  3E7L A;  3JR9 A;  2I10 A;  3ZQL A;  5E3O A;  2CQX A;  2R92 J;  1NTC A;  4M3F A;  1ETQ A;  5GPA A;  3LSP A;  1RPW A;  3CQZ J;  3G1O A;  4W1U A;  2X6O A;  1WH5 A;  2WB1 N;  5FLM J;  2JA7 J;  2YU9 J;  1AHD P;  3TP3 A;  4JX6 A;  1IRZ A;  1JJ6 C;  3O8G A;  1W0T A;  5E3L A;  1U9O A;  1QVT A;  3FK7 A;  2DA4 A;  2XB5 A;  4BXX J;  1LE8 A;  1YRN B;  4C2M J;  4JX5 A;  3BQZ A;  4MFE A;  4L5E A;  4BBR J;  3A01 B;  1ZR4 A;  1NK2 P;  3FIS A;  1MSE C;  3A03 A;  5K7H A;  2VKE A;  1R9T J;  2DA5 A;  4NDL A;  3G1L A;  4A3M J;  1GT0 C;  5K7Z A;  4XRM A;  1RKW A;  1E3O C;  1POG A;  2M8G X;  2HOT A;  3ZOB A;  2D5V A;  1VND A;  4B4C A;  1JKO C;  4A3C J;  5DTD A;  5FJ8 J;  3LSG A;  3HOX J;  1FIP A;  1JTX A;  3M3Y J;  5F0F A;  1RET A;  2KT0 A;  3IH2 A;  3HM5 A;  3JRC A;  5K7F A;  1VFC A;  1K61 A;  2CUF A;  2EZK A;  3BR1 A;  3HEF A;  1IC8 A;  1B8I A;  3NAU A;  4A93 J;  2NS7 A;  2XPU A;  3BTJ A;  4MO7 A;  2X48 A;  2JN6 A;  4MLO A;  5F1J A;  5M3F J;  4HNV A;  4M3E A;  2WV1 A;  1ETX A;  3HB9 A;  2DMQ A;  3LSR A;  4QSH A;  1BL0 A;  1GDT A;  5EDN A;  4Y7N J;  1FIA A;  2XB0 X;  5IPA A;  4V2F A;  3GTP J;  1ETV A;  1MBF A;  2NS8 A;  1JUS A;  3M4O J;  1GUU A;  4M3D A;  1OCP A;  3GTJ J;  1H8A C;  3SJM A;  2G0E A;  2LY9 A;  4A69 C;  3UKG A;  5EG0 A;  1H88 C;  3QPL A;  3HGY A;  1RKT A;  1JT0 A;  3SDG A;  4QTR A;  1FEX A;  3RKQ A;  4IHW A;  2W48 A;  2IEK A;  5IP7 J;  1TC3 C;  5IP6 A;  3S16 J;  2VKV A;  5F08 A;  1Q1V A;  2L7M P;  2DA3 A;  4A3E J;  1AU7 A;  5IYD J;  4AC0 A;  3W6V A;  4XIC A;  3HOZ J;  2DMU A;  1MH4 A;  1TWA J;  4M3G A;  2OF7 A;  3LSJ A;  1A5J A;  4GFB A;  2E2I J;  1H89 C;  1JUM A;  1TWF J;  4X6A J;  4FCY A;  2IBD A;  4XRS G;  2K9N A;  5FKN A;  1JT6 A;  3CMY A;  4ABZ A;  3ZQC A;  1JJ8 C;  3I4M J;  1WGX A;  2MW8 A;  4BKX A;  3SFI A;  1U78 A;  1X58 A;  1SAN A;  2LLK A;  2LR8 A;  4UUS B;  2HDD A;  1WI3 A;  2CUE A;  1Z77 A;  3HOV J;  3S1Q J;  4A3D J;  3JRG A;  1QPI A;  4DZJ A;  2ZB9 A;  1LE8 B;  4BY7 J;  5DS9 A;  2IAI A;  4XRS A;  4M3B A;  1MBK A;  1FTZ A;  2WAQ N;  2NOG A;  2RAE A;  5C3E J;  3JRA A;  2DN0 A;  2XPW A;  3O8H A;  2E1O A;  4C3J J;  4S0H B;  5FKO A;  1PUF A;  2CJJ A;  2M9H A;  5IP9 J;  5C44 J;  2ID6 A;  3BR5 A;  2PMZ N;  5FKM A;  2DMN A;  3ZQH A;  1IG7 A;  3TW6 A;  1JUP A;  3BTL A;  2MGQ A;  3IV5 A;  2VPR A;  5C4J J;  1I3Q J;  5IYC J;  1T56 A;  1FJL A;  3TP0 A;  4J19 A;  1B8I B;  1ZGW A;  2MG4 A;  2M2E A;  3BR2 A;  2N8G A;  4B1R A;  2JK3 A;  4A3J J;  2H1K A;  3H0G J;  5EGO B;  3JRD A;  3S17 J;  1MNM C;  3BG9 A;  3BR6 A;  2R5Z A;  3IH3 A;  3S15 J;  5FKK A;  5HOD A;  3HBL A;  2ME6 A;  3PO2 J;  3HOW J;  3DCF A;  1RES A;  4AUX A;  2M34 A;  2COB A;  2ME0 A;  1MSF C;  4FIS A;  5M5W J;  1LFU P;  2GM4 A;  1LFB A;  2XGD A;  2DMP A;  3HDD A;  3JRF A;  1VF9 A;  2R93 J;  5JLW A;  4AYB N;  3Q0V A;  1P7J A;  4XK4 A;  3S1R J;  1W0U A;  5EG0 B;  2EZH A;  4IHY A;  2R0Q C;  2O7O A;  4A3L J;  1HF0 A;  1ETO A;  9ANT A;  3ZQI A;  3FK6 A;  1Y1V J;  1ZTR A;  1DU0 A;  1HOM A;  2Y31 A;  3H3V K;  3GTO J;  4IEJ A;  4DZP A;  1G2H A;  2TRT A;  1MBE A;  2L7Z A;  4D5C A;  1I50 J;  2Y9Y A;  2LP0 A;  1IJW C;  4A3G J;  1UHS A;  3FIW A;  4I76 A;  1YRN A;  2B63 J;  1A6I A;  4D5F A;  4UUT A;  1ETK A;  2DA7 A;  2XSD C;  1CQT A;  1QVU A;  2Y30 A;  2LFB A;  5J1R A;  3JRE A;  3JRI A;  2CU7 A;  3S1M J;  3BTI A;  4JYK A;  1B72 A;  2EBI A;  2NVX J;  2EZI A;  3OSF A;  2GLO A;  2LD5 A;  3DEW A;  2R5Y B;  1ENH A;  3HOY J;  1XC5 A;  1RR7 A;  2HYJ A;  2HQ5 A;  3Q0W A;  3S2H J;  2EH3 A;  5F27 A;  3OOU A;  3QQA A;  5GP9 A;  3CDL A;  3K7A J;  5M5X J;  5F0C A;  3L1P A;  3S14 J;  1ETY A;  1ZQ3 P;  1PUF B;  2H8R A;  2HXO A;  3NAR A;  3HOU J;  1IGN A;  2VI6 A;  1TWC J;  4A3I J;  4D7M A;  2LKX A;  2HOS A;  4CYC A;  1BJZ A;  1SFO J;  1ZR2 A;  1X2M A;  2K9S A;  2P81 A;  3MVP A;  1UMQ A;  5EYR A;  1X2N A;  2K9Q A;  3GTL J;  2KDZ A;  2R5Z B;  4X1E A;  1JKP C;  2R7Z J;  2FJ1 A;  3BT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...