3A01B

Crystal structure of aristaless and clawless homeodomains bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
RRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation/dna
molecule keywords Homeodomain-containing protein
publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 57
sequence length 57
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a01B00
3TEDA 2L7MP 4C3HJ 3A01B 3OSFA 2JK3A 1D5YA 3Q0VA 2IBDA 1W0UA 2GBYA 4BXXJ 4D7NA 2WV1A 1I50J 2HQ5A 1Q1VA 1MH4A 3L1PA 1JGGA 2HOTA 3GTGJ 3G1MA 4AC0A 1FTZA 2ID3A 2FD5A 5F0HA 3TP3A 2HOSA 2VI6A 3MKLA 3PO2J 2L7ZA 5FKMA 1JUPA 2NS7A 3I4MJ 1ZKGA 4J19A 1BJZA 1GV5A 4A3IJ 2O7OA 2LY9A 2HXIA 5C4XJ 2HI3A 1T33A 3JRIA 3LSPA 2XPWA 1MBEA 2L0KA 1ETVA 3JRCA 2OPTA 4HNVA 3JRAA 5IYCJ 1RR7A 1U9NA 3SFIA 1NTCA 3JRDA 1MBFA 3JRHA 5DTDA 4BBSJ 1H8AC 5EF6A 1NK2P 2R0QC 2LD5A 3RKQA 3TW6A 2HDDA 3OIOA 2DA1A 2E19A 2I10A 3TW7A 2R93J 3PM1A 3Q0UA 1QRYA 5M5YJ 4BY7J 1E3OC 2JA5J 2M0CA 1GV2A 2EQRA 2L9RA 5J1UA 4A69C 2XGEA 4W1UA 4Y52J 1AKHB 2Y31A 3O8HA 4A3MJ 1IUFA 1RESA 3MVPA 5IOZA 1RKTA 5E3OA 1DU0A 1ETYA 4C3JJ 1U8BA 3S1NJ 1JT0A 3WHBA 3BR0A 2Y0SN 3HGYA 3NARA 4MO7A 5C3EJ 3S1RJ 3ZQHA 1JUSA 1ETWA 1TWHJ 5HODA 3CMYA 3IV5A 2EZHA 5IP7J 2P81A 1EF4A 2AO9A 2ECCA 4M6VA 5FLMJ 2EZKA 2NVQJ 5BNGA 4DYRA 1JKQC 2FQ4A 4DYQA 2O8KA 1JJ6C 1OFCX 1H89C 2R5ZA 1XG1A 2M8GX 2JWTA 5M5XJ 2TRTA 2DA7A 2O9LA 4FTHA 2LP0A 5M5WJ 4FE7A 1Z0XA 2E2IJ 1O4XA 3HKZN 3LSRA 3GTQJ 2MW8A 5M3FJ 2X48A 1JKRC 4X6AJ 5FKNA 3MN2A 1MBKA 5C4JJ 3CQZJ 1G2HA 1AKHA 4QIWN 5J1RA 2XSDC 5E3MA 5EZHA 2MG4A 4AUXA 4EEFG 3DCFA 4X1EA 2R92J 3HOZJ 3S14J 2ECBA 1JTYA 1F36A 2DA2A 1AU7A 3HOUJ 4UUSA 3B6AA 4FISA 2CU7A 2QF7A 2DTZA 1GVDA 4D5CA 5FKKA 1MBGA 2XB5A 3ZQGA 3GBGA 2LR8A 3BR5A 3SDGA 3Q0WA 1HF0A 3I4NJ 4I76A 1ORKA 1MBJA 3LSGA 2Y9YA 2H8RA 5K7ZA 3NAUA 4D7MA 4IEJA 1WH5A 1UHSA 3SJMA 4BBRJ 3M4OJ 2MSYA 3G1OA 1IRZA 3RZOJ 1HOMA 4XRMA 3LSJA 4CYCA 5IOYA 3QPLA 1QVUA 1WPKA 2PMZN 2Y2ZA 1IGNA 3GTLJ 1VFCA 3S16J 1SANA 1F43A 2JMWA 4XICA 2XPUA 4UUTA 2VUMJ 2RAEA 3ZQIA 2NVXJ 9ANTA 3H3VK 3QQAA 3FKIJ 1BW6A 1UMQA 3HBLA 4LOCA 4MLOA 1X58A 2YU9J 3S2HJ 3BTIA 5FLVA 3ZQLA 1MNMC 3ZQFA 2DMQA 3JREA 3HEFA 1XS9A 4DZJA 1WGXA 2B63J 4Y7NJ 1H88C 2DMPA 2R5ZB 2Y9ZA 1WI3A 2COBA 1P7IA 1P7JA 3FIWA 1X2MA 5IPAA 5FJ8J 2H1KA 3JRFA 3LOCA 1RKWA 5GPCA 4D5FA 3TP0A 5DS9A 1VI0A 2G0EA 1BL0A 1IG7A 3BQZA 1OJLA 4A3FJ 4M3BA 4JX4A 3BQYA 3VPRA 2AHQA 4S0HB 1IJWC 2DJNA 3BTCA 5EDNA 4UUSB 3IH3A 2JA7J 3GTJJ 2R7ZJ 3BG3A 2L7FP 4QSHA 5EYRA 1JKOC 1APLC 1T56A 2LVSA 2ME0A 2LK2A 2XPVA 3FISA 1LE8A 2EBIA 3K7AJ 5FKOA 5EG0A 4I6ZA 2LKXA 3HOXJ 4JP0A 3GTPJ 1RETA 3QPSA 1TWGJ 2CUEA 2WB1N 4A3LJ 2QCOA 5GP9A 4CYCB 3ZOBA 2M2EA 5E3LA 2MGQA 1ZR4A 4A3CJ 2NVYJ 3JR9A 1BA5A 3HB9A 4B4CA 2VKEA 4A3EJ 3WHCA 2LLKA 2EZIA 4AYBN 1YRNA 2XGDA 3FK6A 4M3GA 3S2DJ 1ITYA 3B6CA 2W48A 2NVTJ 3G1LA 1JTXA 1VNDA 5EEAA 3GTOJ 4B3AA 3A03A 4M3FA 3BTJA 1WCMJ 2X6OA 1FEXA 3A02A 3M3YJ 4RDUA 1PUFA 4RBOA 4XRSG 2Y30A 2XB0X 3RQIA 1FJLA 2CRGA 2LTPA 3C2BA 2X9DA 2JA8J 1JJ8C 5F1JA 2DA3A 3DEWA 2XRLA 1R9TJ 5K7FA 1NK3P 2EH3A 4A3JJ 3HDDA 1FIPA 1RPWA 4IHXA 1TWAJ 4C2MJ 1X2NA 2ID6A 2HXOA 1S7EA 3K2AA 1Z77A 1VF9A 5IP6A 5EZGA 1ETOA 1ETKA 1GUUA 1IDYA 5F0FA 4IHYA 4XRSA 4A3DJ 1OCTC 3Q3SA 4M3DA 4GFBA 2D5VA 4A3GJ 2GLOA 1I6HJ 3CCYA 2DN0A 1LE8B 1GT0C 1U9OA 5EG0B 3S17J 2NS8A 3BTLA 2R5YA 1QVTA 1LFBA 3W6VA 1B8IA 5JLWA 5EGOA 4BY1J 1DU6A 3H0GJ 1TWFJ 4V2FA 3E7LA 1ETQA 1I3QJ 4JX5A 2VPRA 1JUMA 1ZK8A 5C44J 2HOAA 2DMTA 1Y1WJ 2EZLA 5F04A 4JX6A 5IYBJ 3PO3J 5J1YA 4JYKA 1MBHA 4W97A 1A6IA 3RZDJ 4XIDA 5F08A 2JA6J 1QPIA 1AHDP 4FCYA 3ZQCA 2NOGA 1YRNB 3HOWJ 3OOUA 3O8GA 2KDZA 2DA4A 1BW5A 2ELKA 2CJJA 1JKPC 3IH2A 4G12A 1LFUP 2JJ7A 1IC8A 1B72A 4A3BJ 5K7HA 2E2HJ 4MFEA 1WH7A 5IYDJ 2DA5A 3A01A 3HM5A 1XC5A 4BKXA 2YUSA 2IEKA 1PUFB 1HLVA 3BG5A 3S1MJ 1ENHA 1POGA 1HDDC 1IDZA 3HGGA 2HYJA 5M3MJ 1UG2A 4NDLA 1OCPA 3BR3A 3BR1A 2IAIA 3OSGA 4C3IJ 4MFDA 2DMUA 3GTMJ 1MSFC 1ETXA 1TWCJ 2ZB9A 2CUFA 3IH4A 4MIMA 4A93J 4DYCA 2KT0A 5FKLA 2WAQN 3S1QJ 3HOVJ 3LNQA 3JRGA 4IHVA 2OF7A 1IV6A 4M3EA 4DW6A 4QTRA 1TC3C 2K9NA 1K83J 5J3LA 4V2GA 2ME6A 1ZTRA 3UKGA 2N8GA 1FIAA 3JRBA 1JT6A 3BG9A 4IHWA 2XGCA 3GTKJ 2LFBA 2E2JJ 2FX0A 4DZPA 3S15J 2VKVA 5F27A 2R5YB 4L5EA 5E3NA 2M34A 2JN6A 4FE4A 1B8IB 3FK7A 5EGOB 2K40A 2YS9A 5GPAA 1FTTA 1HDPA 1ZGWA 1ZQ3P 4ABZA 2FJ1A 2CQQA 3F0CA 1SFOJ 5IP9J 4A3KJ 1CQTA 2M9HA 2TCTA 1Y1VJ 3HOYJ 2E1OA 4B1RA 1GDTA 3CDLA 3D1NI 1W0TA 2GM4A 2K9QA 1HCRA 4XK4A 2K9SA 3BR6A 2DA6A 1U78A 3BR2A 1ZR2A 1A5JA 1MH3A 3BT9A 5JLXA 2DMNA 5F0CA 1B72B 2CQXA 1MSEC 1K61A
chains in the Genus database with same CATH superfamily
1T38A 2L7MP 2CV2A 3OSFA 1LDJA 1D5YA 2HOEA 3U1KA 2Y0SA 3BC8A 1FOWA 3BZ6A 1V3FA 2EV5A 2QKMB 3M1EA 3ZPLA 3J7ZI 2EV6A 2LG4A 4HEA2 4G8XA 4EVIA 2P5LC 1T0FC 2HQ5A 1Q1VA 2JPBA 3SEQA 5HNFA 3GTGJ 2DFIA 3G1MA 3F8MA 1SFUA 3I4PA 2L7ZA 5E1WA 1YJNI 2W00A 1JUPA 3HTSB 2ELHA 2NS7A 3I4MJ 3CF2A 1ZKGA 4J19A 4IQJA 2PJRA 4AVZA 3JCUC 2HI3A 1T33A 5JHUA 2XSJC 4F3QA 2V4JC 3PNVA 1MBEA 3ABKH 2STTA 1ETVA 3EPZA 2OPTA 4HNVA 2E34A 4XORA 1RR7A 1U9NA 2KKOA 4WF2A 2PMHA 1J2XA 2D45A 3VOEA 4BBSJ 3KX2A 1AOYA 3JSOA 1F9NA 1P9QC 2MC3A 4UB8C 3VYSB 3K9TA 3CO6C 2XROA 4OIPF 4HNUA 3T8TA 3RKQA 1L3LA 4G7HF 1FOXA 1QHHD 4Y4RA 1D8JA 5FRMA 2L7KA 3GUDA 5E8IA 2CUJA 4P5OA 4FT8A 4S05A 5CKTA 2QA4I 3TW7A 2R93J 4H0EA 3Q0UA 3F3XA 2J5OA 1E3OC 2L9RA 3RQ4A 5CVJA 3I59A 2FUG2 1O3SA 3O8HA 3MEXA 3L2QA 4A3MJ 2M87A 3CC2I 3U2RA 1DU0A 1ETYA 5AONA 2ZMEA 2FQ3A 4DBQA 1ZGAA 3Q9SA 5KCMA 3S1NJ 3H5RA 4RAZA 3CCEI 2CFOA 2V1NA 3ZQHA 1JUSA 1ETWA 1Y0NA 3V7SA 2X51A 2Z5UA 3CLQA 3KEQA 3E6MA 3DTKA 4U88A 2WY7Q 3QPTA 3IV5A 1EH8A 4B44A 2P81A 2ECCA 4M6VA 5FLMJ 5L3CA 2EZKA 1Z6TA 1USTA 2KZGA 4G6DA 3CUQA 4DYQA 4AIJA 2QQ8A 3ZMZA 2KFDA 4EM1A 4IRIA 3TO9A 4B8XA 1B6AA 2PG4A 3BCBA 3BZKA 1H89C 5M5XJ 4DQ2A 2TRTA 2XKPA 4L0YB 4EQQA 2O9LA 4BEHA 4FTHA 1R5GA 4QPOA 1FYLA 2KIQA 4RMNA 3T5XA 1MW7A 5J8FA 1OLTA 2NAZA 2X1EA 3LSRA 2PJRB 4V19K 2R7XA 4WWCA 2MW8A 4X6AJ 3RPQA 2DU9A 1RI7A 3MN2A 5KHDA 3MMYB 1T0FA 5C4JJ 4QIWN 3IRRA 3F6OA 1P92A 2R7VA 1G4DA 2JRTA 4CUGA 2XSDC 3OYJA 1TP4A 1Y6IA 2FA5A 2ECBA 4HAMA 1OYWA 2DA2A 4KFCA 4FISA 4OIQF 1S29A 2VC0A 3FM3A 5FKKA 1FNNA 5HLHA 4KDPA 4Y3OA 3GBGA 3H1CA 4HV5A 3SDGA 1QU3A 1HF0A 1UHWA 1ORKA 4I76A 3LSGA 2H8RA 1KGSA 3K4KA 2LMDA 4YIRX 1UCRA 4D7MA 1LFPA 1UHSA 3OYFA 4GRIA 2YU3A 1DQUA 1R4NB 2ICWG 4NHJA 1IRZA 3I59B 2ZXJA 4XRMA 3RZOJ 3LSJA 1FZPB 4CYCA 3RKXA 1F4KA 3SZPA 2ZMEB 3GTLJ 3J81K 4AWXB 3CUOA 2CQNA 1F43A 3S32A 1SMYF 2M8EA 2XPUA 4UUTA 2RAEA 3ZQIA 3OYBA 1PP7U 2EIMH 3AFHA 3H36A 5BPDA 9ANTA 3AL0C 1W7PA 1MDMA 1VQ6I 2GOMA 3P9KA 1B4AA 3FKIJ 3IWFA 3QU6A 4CH7A 1UMQA 3HBLA 3X2QH 5GADJ 1BM9A 3E6DA 4LIUA 5LRSA 4HF1A 1FYMA 2VN2A 3VSLA 3CJTB 1KQ0A 2ESNA 3CUQB 1NH3A 2FF4A 2FOWA 4LLLA 1WJAA 3QYEA 4Y7NJ 1BI0A 1HSTA 2Y69H 4YG2F 2Q8KA 5BMZA 2XGXA 3H5NA 2PBIA 3ZQ7A 4BEHB 2F5CA 2DYSH 2P6SA 3ZRGA 1DUXC 3QPHA 5FJ8J 4M74A 1LUJB 1A04A 4ESBA 2MH2A 1RR8C 3B02A 2XC7A 1BL0A 2QSGX 2QGUA 1QHGA 4M3BA 1R4MB 1U8RA 4S0HB 1IJWC 4XLAA 4PJMA 4HPQA 5LLQA 2H6BA 3CTAA 2FNAA 4NBQA 2OUMA 3BG3A 3CLOA 2LVSA 5KNLA 2LK2A 3KP7A 3QYBA 2QBYA 2LKXA 3R0AA 5KAIC 4ENJA 1P4AA 2O8XA 1Z7LA 4JP0A 2DFHA 3OYKA 3GTPJ 5D6EA 1IV8A 3G4SI 1RETA 2R7TA 2CG4A 4YIIA 1S8NA 2GZWA 2JPCA 1S3JA 2CUEA 4OWRB 5IT9Z 4OAYA 2QCOA 5CVUA 3C7JA 5DV5A 5GP9A 3DU6A 3LQQA 2DDAA 4CYCB 2M2EA 2L01A 1BC8C 2MGQA 2OAZA 1X1DA 3JR9A 4L5JA 4A3EJ 3VEPA 1U5TC 1IO2A 4AU7A 1ON2A 1ZARA 2EZIA 5ILVA 3JAMZ 4CCKA 3IRQA 2HYFA 2XGDA 2K27A 3FK6A 1ZELA 2LOOA 1ITYA 2DQLA 4YELA 5DDGA 1W7PB 4RAFA 3GFMA 3UNGC 2IGNA 3VB2A 3ZCOA 1MDMB 4B48A 4EM2A 1VNDA 3GTOJ 5D8LB 2NNNA 4U7BA 5IT3A 3A03A 3JW4A 3M8FA 4I02A 3BTJA 1XTAA 1FEXA 3K0LA 3HOSA 2HDWA 3LA3A 2IPQX 3G2BA 5TISC 4HSRA 2VBWA 3H3ZA 1J9IA 2H94A 4XONA 1R49A 3GZ6A 2LH9A 1J5YA 2DA3A 2DT6A 2GOXB 3DEWA 4RLFA 4MTEA 3WG7H 1FIPA 1FSEA 2FOKA 2HKOA 1X2NA 4C2MJ 2ADUA 3QP6A 2DOFA 3HG9A 2V7FA 2V9VA 3WTUC 2CQKA 3HL2A 1U3EM 2VJJA 1H0MA 1SD6A 4L5IA 3QRFF 3F8FA 1ETKA 1GUUA 2HGCA 2DOEA 2E35A 2FSWA 4IOAF 2WB1A 3M8JA 4J00A 3BLYA 3BJAA 5CYVA 2XF7A 4ENMA 3TO6A 2ZNZA 3Q3SA 2D5VA 3ELKA 2MH9A 2F48A 1EJ9A 2DN0A 1D0XA 1S7OA 1KU7A 1GT0C 2E71A 1U9OA 1HKSA 3KP5A 4EATA 2QBYB 3CJRB 2W24A 4KMUX 4XLFA 1X3UA 3W6VA 2ZO4A 5JVTA 1B8IA 5TRDA 3BZCA 2DK8A 4ASNA 5EGOA 1DU6A 1S6LA 2O5RA 4V2FA 4ZC3A 1FPQA 4CZCA 2OU2A 2XRNA 3CMEI 4EM0B 1ZK8A 1HQCA 1UHMA 3AAFA 2DMTA 2VPLA 5JR3A 2DW4A 4E7LA 1A6IA 2RV8A 5L3GA 3SFZA 1AHDP 5CQGA 4FCYA 4U87A 3P9IA 3NQOA 3O8GA 1OPCA 3KEOA 4YRVA 2GA1A 2KDOA 1ZG3A 5JVGF 3GFLA 3MKYB 1X3ZB 1TW3A 4HV6A 2CJJA 2L5QA 4N0BA 2UUZA 4A3BJ 1B72A 5K7HA 1YI2I 5IYDJ 4IRGA 2FU4A 4HYEA 1U5TA 2IEKA 3ZQQA 4N9IA 2OQGA 3FXLA 3K1MA 2CW0F 3S3MA 2ZKZA 2HVQA 3BG5A 2IA1A 2XDVA 4RB0A 2YR2A 1IDZA 3GWZA 3AL0B 2K7LA 1OMIA 1UG2A 2L02A 3BR1A 4MEYF 4II3A 4UB6C 4C3IJ 3DBRB 2DMUA 3IWZA 1Z05A 2FMYA 2WWYA 2P7VB 4I2OA 1SFXA 2G7HA 2VKDA 2CUFA 2X85A 2XAQA 1XCBA 2BOLA 3HXLA 3IH4A 3E1SA 4Y13A 2ESHA 2KT0A 5FKLA 3TO7A 4XR6A 3KPHA 4HLXA 2DYRH 4M3EA 4DW6A 4QTRA 1XDSA 5E8GA 1TC3C 2K9NA 1K83J 2CSOA 4V2GA 4JQFA 2N8GA 1K4TA 2XGCA 1VQ7I 1QBJA 3DPTA 1E0EA 2NOJB 2FX0A 4HX4A 2DFFA 3S15J 3L9FA 1FP2A 2E5ZA 2KQRA 2M34A 2V9KA 4FE4A 1B8IB 5JI6A 4FQGA 2BE5F 2ELJA 5KK1A 5EGOB 4KNYA 3GLXA 4BQNA 4CCNA 1E17A 3DTEA 2L4AA 1HDPA 1ZGWA 3DBHB 2KJCA 1ERDA 1QGPA 3QP5A 5BQTA 2W84A 4BQOA 2WY8Q 4ON0A 4ANJA 2TCTA 2E1OA 3MZYA 1W0TA 1ZRCA 1F1ZA 3QOPA 3BR6A 1LQ1A 1I27A 5FD5A 2HQRA 3K1PA 1IF1A 3BT9A 3R4KA 2HZTA 5JLXA 1MMDA 1B72B 1IXSB 1R6RA 2E7WA 1JI8A 2XAHA 4PSWA 1U5TB 3DF8A 2LKPA 3Q0VA 4M71A 4E6KG 4CXFA 4L9JA 2V79A 4CCMA 3CC4I 3BY6A 1LEAA 2OCEA 2WV1A 3MD2A 4P96A 1ZRDA 1I50J 1S5LC 2O03A 2X6YA 4BUPA 4U7DA 4H4KC 4PGHA 3J81Z 2ID3A 4AIDA 3N4MA 1FTZA 2VI6A 2EA2A 1WKMA 2MA3A 3OL4A 5FKMA 1OQYA 2CW8A 1Z67A 2ZNYA 3FXOA 1G3YA 5LGTA 1FX7A 1KU9A 4RS8A 2BVLA 4A3IJ 2DOAA 2PJPA 5J6XA 4ZTFA 4XOTA 3RI4A 4BHPA 1X1PA 3R61A 2L0KA 3JRCA 2DT5A 1RUNA 3HPGA 4ZZDA 3JRAA 4ZYDA 3FM5A 3WTTC 3SFIA 3JRDA 3MZHA 1I1SA 1MBFA 2VBYA 3FZVA 3KP2A 5J40A 1T39A 1H8AC 2ISZA 5EF6A 1NK2P 3AG2H 2MLGA 2R0QC 3L2VA 2KMUA 1MJ9A 3TW6A 1FYKA 3OIOA 4ENKA 1WJEA 3DV8A 3WTWC 4ESJA 3I56I 4UV8A 1B1BA 3EUAA 4BY7J 2JA5J 5J4YA 4C2UA 4W1UA 3F8NA 4S04A 1AKHB 1D1CA 2Y31A 3QOEA 2X1DA 3HSEA 2K4JA 2NYXA 5E3OA 1LVAA 4R1HA 5HDGA 1OCOH 4XLPF 1U8BA 3OYMA 3I3LA 4M9SA 1JT0A 4PJLA 4NC6A 3RKWA 2W25A 4PJNA 3HGYA 3F22A 2BGCA 3NARA 4MO7A 5C3EJ 4OU0A 3S1RJ 3CJNA 4JBAA 1J0RA 3CCLI 1U0JA 1PDNC 1XCVA 4RB1A 4XQFA 3LSMA 3FMRA 1YJ9I 5IP7J 1I3AA 2A68F 2UZKA 1GVJA 5BS6A 2KHMA 1XSXA 4BYYA 3J80K 4O5VA 3OIPA 5GTHC 1JJ6C 1OFCX 2ZJQF 1XG1A 4N9HA 3RPUD 2D1VA 2DA7A 3D5LA 3DWLE 2LP0A 4L9VA 5M5WJ 4FE7A 1Z0XA 3T8RA 5ERIA 1IN5A 1UELB 2MD0A 1O4XA 3HKZN 4CHUA 2M0MA 2PX9A 2X48A 2DFEA 2L54A 2FXAA 4XOPA 3CF5F 3QU3A 2QUFA 1W5CC 3K6GA 5J1RA 4FX0A 2MG4A 1MIJA 4EEFG 2O6GE 1WWXA 1HC8A 1JTYA 4XKCA 3B6AA 3HHHA 2CU7A 1MGTA 1SAUA 2DTZA 3MQ0A 3TL4X 2P5VA 1YQAA 1LJ9A 2LR8A 1KU2A 3H0DA 3Q0WA 4KYWA 1FMWA 4G6QA 4WXHA 3KZIC 3NAUA 3ABUA 1BI1A 4ETSA 1AWCA 3M4OJ 3V4GA 2MLKA 3G1OA 4IVNA 2HWVA 1T6SA 3IC7A 4HX7A 1WZ2A 3GXOA 5IOYA 3FXUA 1J09A 2PMUA 2IVMA 4CA0A 4UUVA 4XNFA 3V42A 4WCGA 2PMZN 3GVAA 4RLQA 1RRJA 3S16J 2M4GA 2MYSA 5ICGA 2XASA 4XICA 3PUFA 2ZFUA 2NVXJ 4CCOA 2W7NA 3IKVA 1BW6A 2TDXA 1HBXG 3TQNA 2XAFA 4MLOA 1X58A 2RREA 2BY1A 2ZXIA 3C2HA 3WTYC 3MCZA 5FLVA 3OMYA 2EIKH 2MFZA 2QQAA 2DK5A 4OMZA 4IQ4A 4E7JA 1IRXA 3Q9VA 3JREA 4DZJA 2F5DA 3AG4H 1SC7A 3I0TA 3RKYA 1H88C 4UVAA 4Y15A 3W3CA 3W2WA 1WI3A 3VWBA 2JUGA 4II2A 5H6QA 1NG7A 5IPAA 4IZZA 1X2MA 2H8WA 4E7IA 3JRFA 3LOCA 4BL0B 3K69A 4U0YA 1RKWA 4EJVA 5GPCA 5KAFC 1O7LA 1FMVA 1W4MA 3OS1A 3GZ5A 5DS9A 2R7DA 2E5NA 1VI0A 2F4IA 2G0EA 2M3AA 2R7OA 3BQZA 2WADA 4YFXF 1ZHFA 4BHBA 1OJLA 3CJQB 2DTRA 3E97A 3ROUA 4A3FJ 2P5KA 1X1AA 2MC4A 3K4CA 1R1UA 3UR3C 4LLNA 3D5RC 3BTCA 3FX3A 2RC4A 1D8KA 3IH3A 3VDXA 3OIQA 3OOPA 1IXCA 2R7ZJ 2JVHA 2L7FP 5EYRA 3CCMI 2KIFA 1T56A 1YYVA 2ME0A 2QWWA 1JKOC 4CDGA 4M6XA 2BVMA 2EBIA 3K7AJ 3FKJA 4I0BA 2JZYA 3S3OA 1ULYA 1W36D 1UZCA 5GAGJ 2PI0A 3QYFA 3QPSA 3M8EA 2XF5A 1V55H 3I9V2 1P4XA 3DLAA 3D0SA 1LDDA 4A3LJ 4IKFA 4YFNF 2GIVA 1Z3XA 4ZDLA 5GTIC 1ZR4A 3WGGA 4HF2A 3DEUA 2B0LA 1DP7P 3EETA 1HXDA 1OCRH 2VBZA 1YRNA 1FBSA 1WJCA 5FD6A 2RQQA 3DFGA 3F8CA 4XKVA 1K6YA 1N77A 3S2WA 2FMLA 4BHCA 1T95A 1UFMA 3PQKA 3DPUA 1XMXA 2M7BA 4HSTA 4LGWA 5DEQA 1LDKB 2OD5A 3L2CA 2DCEA 1EH6A 3A02A 4IX7A 3M3YJ 2ZJ2A 3AG3H 1YTYA 2VJIA 1G3WA 4GGGA 2DJIA 4CO8A 4XRSG 4KN4X 1JHHA 2XB0X 3C2BA 2VOPA 4KMFA 1DGRM 2CUZA 3G71I 2JA8J 2F4OB 3U21A 4J01A 4CZZA 2K3FA 1R9TJ 2EJRA 2EH3A 1Y8QB 4JOMA 4RAGA 3CCSI 3OYLA 4YIFA 1MMGA 2LC2A 4D9JA 1X4PA 2EFQA 2F6CA 1DDNA 2V1UA 3LQRA 2VE9A 2OBPA 5LRRA 1KQ8A 5CPRB 3ISPA 2XF6A 2VL8A 5F0FA 1MMNA 4ZYAA 1SD5A 4IHYA 1NHAA 4XRSA 2G9WA 3BJ6A 1AA7A 3BWGA 1V5FA 4IF4A 4HDVA 1I6HJ 2ZXHA 4QPQA 4L9TA 2VJ5A 4HX8A 3DPLC 2MABA 2NS8A 4AYBA 2HNHA 1QVTA 2CS3A 2KRCA 3FMSA 2CO5A 4IRHA 1X1BA 3AKZA 3V8KA 3RCOA 5JLWA 3DKWA 1PVEA 1ETQA 2VXZA 1X4OA 1TT5B 3V7CA 3OY9A 1J75A 2O61A 3L2UA 1JUMA 5HS9A 1JHFA 5C44J 1W5SA 5J8CA 1Y1WJ 5F04A 4JX6A 5IYBJ 5AIPA 3PO3J 5J1YA 1MBHA 3RZDJ 1MMSA 5F08A 2JA6J 1IRFA 1YW8A 5LHHA 4HF0A 1WJ5A 5JFRA 2H09A 2VJ4A 3ZQCA 1T98A 3WG9A 1YRNB 3HOWJ 1G3SA 3CDIA 4G9YA 4N4OB 3ULQB 1ZLKA 2KDZA 5CVVA 1RNLA 4BJTA 2A5YB 3GX4X 1VQPI 4EGYA 2GA2A 1YS7A 1R7JA 2D2WA 5FB2A 2JJ7A 1IC8A 2DPDA 5IY5H 1RIOH 4MFEA 2E2HJ 2JT1A 4U0VA 1YX3A 1LPQA 2DA5A 3HRUA 2K3PA 2A6HF 1XC5A 2YUSA 3IUOA 4N4NB 2DO7A 3EUHC 3OL3A 1W5TA 3DXJF 4NC8A 1TL8A 5E20A 5K5QA 1ENHA 1HDDC 3HGGA 1E2XA 5B66C 1B59A 1OISA 3BG7A 2VIXA 3F23A 4NDLA 4OAZA 4B47A 2BV6A 4HG2A 4Q47A 3GTMJ 4RAYA 1WI9A 1MSFC 2V6CA 2K9MA 2ACJA 1XB4A 2CV1A 3SHFA 2WBMA 1WSUA 2KIMA 3SXYA 3H35A 2L3DA 3HOVJ 5D5WB 3JRGA 2DI3A 2RNGA 1IN7A 2Q1ZB 3LAJA 1YS6A 3M9AA 3OV8A 4BE1A 4LMYA 1ZTRA 2ME6A 1VQNI 3FXQA 4P9UA 3JRBA 3BG9A 4IHWA 2M1BA 3J80Z 2LNBA 1SVMA 2LFBA 3OR1C 1LB2A 4RB2C 5FFZA 2E2JJ 1XX5A 2VASA 3LWFA 2VKVA 5F27A 1IN4A 2JN6A 2J5PA 2NRAC 2QM3A 4EV0A 1Z7UA 3ML6A 2NXNB 2LKSA 3GF2A 5F6FA 1FTTA 3DEEA 3ASOH 2EWNA 3A1YA 5K5OA 4R79A 2XAGA 5E18F 1SFOJ 4A3KJ 2KPMA 4B1RA 4BS9A 1GDTA 4A0ZA 3LSKA 4BNCA 3CDLA 1JE8A 4DIQA 3KZZA 3RJPA 2R4GA 4PJ0C 1UJ8A 3B73A 3JTGA 4IHTA 1HCRA 2K9SA 1YLFA 3PUBA 2HVRA 1U78A 2CQ7A 1IW7F 1MH3A 2HFHA 4Y33A 2DMNA 4GYGA 4IPAA 2JSPA 3CESA 2E1MC 4IOCF 5L3FA 2IBDA 2OV7A 2GBYA 1G8XA 1VZ0A 2GIZA 2WAQA 1XPXA 3IP4B 3WE2A 1MH4A 2NVUB 4WK8F 3L1PA 1DP3A 1OCZH 1G6NA 4AC0A 1KYWA 3KFWX 2DLLA 1SMTA 2FD5A 5F0HA 4PCQA 3MKLA 3W6KB 4I01A 2CH0A 2ZSHB 3CCQI 3QWLA 3KP4A 3PO2J 2QENA 4IL6C 2XVCA 2VLAA 4BDZA 1VQLI 2QVOA 4P1WA 2DDBA 3EUHA 2HXIA 4BE0A 2PLYA 2IS2A 3JRIA 1BIAA 2VQHA 3H5AA 1R00A 1SFKA 2Z3YA 4RGUA 4XLHA 1XGOA 5LGNA 3M7GA 1D1BA 4B09A 3E5QA 2L9VA 2W82A 1NTCA 3QODA 2KL4A 3JRHA 5DTDA 2HKXA 5KVRA 1TBXA 2LD5A 2R7QA 1Z1DA 3ABMH 2EINH 2PQ8A 1MD0A 2RQPA 2A3SA 2HDDA 1FOKA 2K85A 2DA1A 3D5SC 4HDUA 4XKBA 2E19A 5D5UB 1R1TA 2JA2A 3E0JB 3M07A 1TTYA 2LRDA 3PM1A 5M5YJ 2XAUA 1ZYRF 2EQRA 2M0CA 4UVCA 5J1UA 2EA4A 4MQ9F 3SEZA 3GW2A 2WAEA 2GXBA 3TOBA 1XSDA 2BXZA 2R7WA 3EUKL 1RKTA 3A4CA 3R60A 5TGTA 4C3JJ 1HW2A 4KN7X 3WHBA 3A0HC 1OYYA 3FXMA 4BAYA 2IRFG 2ZJRF 4Q48A 2YSRA 3ESWB 4DBRA 2F5VA 1TWHJ 3TKYA 3ZXSA 5LFAA 2BXYA 3PFIA 4BACA 4XBFA 4ZZLA 3K70D 5HODA 3V8LA 1VQ9I 2QQBA 2EZHA 4KICA 2CW7A 1TT0A 1EF4A 3OWTA 4M73A 2NVQJ 4PJJA 1CGPA 5BNGA 4DYRA 2FQ4A 4PK4A 5D4SA 5LD2C 3FXRA 2JVGA 4X0GA 3ZMUA 2R7SA 2M8GX 1MJBA 2JWTA 4AVPA 1K79A 1UG0A 4CCLA 4XSZF 2L2OA 1SFEA 2E2IJ 1YW9A 4BXFA 2ZBKA 3GTQJ 1YOVB 2IGMA 2P8TA 4P55A 5FKNA 3J7AO 1MBKA 2Q2EA 3KZYA 3PJRA 1AKHA 2A07F 3WGHA 4XMYA 1GXQA 4TV7A 2R7RA 4HRIA 2ZFWA 4ESFA 2DQRA 2O0YA 4K2EA 5EZHA 4C30A 4DOZA 5E3MA 2OA4A 3OYHA 2C6YA 3V7RA 2HQAA 2R92J 3HOZJ 3HOUJ 4KISA 2AQEA 1F5TA 1WJFA 1RZ4A 2V1XA 4I7HA 3ZQGA 4Q4ZF 2PN6A 3RPUA 4GCVA 4AM3A 1MBJA 2Y9YA 3W2VA 3FHNA 4P9FA 4UXNA 4F7ZA 3I5UA 2PFBA 1MKMA 4BBRJ 3S3NA 3CD6I 3EYYA 4HLYA 1I6XA 2LF8A 3KEYA 2XIGA 3KE2A 3PFYA 1HOMA 1EKEA 1FP1D 4R8HA 1IUYA 5D4RA 2Z2SB 2QLZA 4NB5A 1WPKA 1VTNC 3FWEA 4ITVA 2Y2ZA 3TDUC 5CQEA 4B43A 5B3SH 1T8IA 4RGRA 2P4WA 3W2AA 2JMWA 3FDYA 3ZMVA 2VOOA 3HTUA 3E5UA 2ISYA 4QWQA 3H3VK 3QQAA 3DTIA 1G3TA 2EK5A 2CFXA 2X6WA 4LOCA 5K5RA 3DLLF 3ABLH 3E6BA 2E1NA 3ZQLA 1MNMC 3SZGA 3ZQFA 4HBLA 3KCCA 1XS9A 5FROA 1P6RA 1MMAA 1WGXA 1ZAOA 2B63J 2DMPA 1KQ9A 1RC9A 3I55I 2E1MB 1A6QA 2EIJH 5E1XA 2MD5A 3OYGA 3F8BA 2COBA 2JRMA 4WXDA 1P7IA 1P7JA 3FIWA 4BDYA 4M9XA 2XAJA 1U2WA 4OOIA 2DBBA 4D5FA 3FBNB 3SQNA 1BI2A 2Q2EB 2QSFX 2QZ8A 4KUMA 1IG7A 3GFJA 5CJ9A 2GXAA 3KIOA 4M9ZA 5DCFA 4UVBA 4AIHA 3VPRA 4DNCA 2IW5A 3AG1H 2HTJA 4GDFA 3OYEA 3MKWB 2JA7J 3GTJJ 4L9NA 4CSWA 1YFHA 4XKWA 4QSHA 4AIKA 3BG6A 2ZXWH 2KJBA 1HW5A 2VBXA 3WE3A 2FRHA 3HOXJ 2A6TA 4RGXA 2ETHA 3ECOA 3O2PE 2CWEA 4EJTA 1FOYA 3OYAA 4PZJA 2JUCA 4BQAA 2LY2A 2IA2A 3IAS2 4Y17A 1IRGA 2WB1N 3PL8A 4OINF 3LMMA 2VKHA 5ILUA 1VQ8I 2VONA 1V5EA 4G94A 3ZMDA 2ZJPF 3PIOF 5E3LA 4A3CJ 2NVYJ 2HR3A 3OS0A 3OYCA 3P7NA 3CO7C 2VKEA 3BCAA 4ZTJA 2JQ7A 5CLSA 1BR2A 3ONQA 5FGMA 3J7AY 1FY7A 4JK1X 2BZTA 2W48A 1Z6RA 3G1LA 3WU2C 5EEAA 3M1CA 4GYIA 4B3AA 4M3FA 1UAAA 3RSNA 3KYLA 1WCMJ 2XV4S 1KA8A 2PEXA 2V1DA 4RDUA 4B3XA 5GAEJ 3G73A 3ZMTA 3WU0A 2X9DA 4LJZF 2CYYA 3HUGA 3BDDA 1JJ8C 5ILSA 5F1JA 4FASD 1G59A 1NK3P 4A3JJ 3HDDA 3A0BC 2BY0A 4I09A 5GAHJ 1TWAJ 5ICCA 2HS5A 2UV1A 2ID6A 5LEKA 3MFKA 1S7EA 3HJEA 3K2AA 2VQCA 1Z77A 3FHZA 2RDPA 1I39A 1FC3A 1UB9A 2L9NA 2HEOA 1S7AA 1ETOA 1NG6A 1X19A 2CV0A 1IAWA 4BJ5C 3DBLB 2IXSA 2K9LA 1IDYA 3PNTA 1K78A 2F4MB 4L0ZB 1IXRC 2P6TA 2B9SA 1OCTC 4GFBA 3H9QA 6PAXA 2Y48A 4O3MA 3CCYA 4F93B 1REPC 2X1CA 3G3ZA 5HS8A 1L0OC 1K7AA 2ZSIB 4ZYHA 3BTLA 2R5YA 2YX4A 2W1OA 3O3KA 2FNPA 3IKTA 1IN6A 2LDUA 5K1YA 2HYGD 3F21A 3LA7A 1WFXA 3GYHX 3MKZA 3E7LA 2Y0MA 5FRNA 1I3QJ 2GAUA 2R3SA 4JX5A 2Z33A 2VPRA 2HOAA 2EILH 3EDPA 1YJWI 1X3WB 2EZLA 2E1CA 4A0XA 3OYIA 1E3HA 4JYKA 4LB6B 3K4NA 3E5XA 1QPIA 1YIOA 5A2QK 2VC1A 4IXAA 4Z6YA 3CC7I 2Q0OA 2BHYA 3SZTA 1Y0UA 3I54A 4HZFA 1JGSA 1Z3YA 1JKPC 3IH2A 4G12A 1LFUP 2LYCA 3C1DA 1SVLA 1ACIA 2M7AA 5DUKA 5LEJA 2KP6A 4XLNF 4O6JA 2YX7A 3A01A 2HPMA 2M45A 1Z91A 4BKXA 1K4SA 1OYIA 3CCUI 5E17F 3HSFA 2EFOA 3S1MJ 3HUGB 5FO5A 4C9YA 5ED4A 3TGNA 2CGPA 2IS4A 3SYTA 5B1AH 1PYVA 5HOOA 1GHCA 5M3MJ 2IP2A 1W1WE 1I1GA 4XRFA 1D0ZA 1RUOA 5L3EA 3BR3A 4IJAA 2OTLI 1ODDA 4UNOA 2A05A 5D8KB 3OSGA 4MFDA 5B1BH 1A35A 1TNTA 2UXXA 2IT0A 4U0WA 4BU2A 4RGSA 2G7UA 4MIMA 4A93J 1YW7A 3NEUA 3L00A 4E7HA 5AIQA 3H9JA 4I99C 2BY3A 2AQFA 2EFNA 1K6OA 3S1QJ 3ZMSA 2XHKA 1K78B 4IHVA 4FHTA 5F1RA 2E60A 2H6CA 2LREA 2OCCH 1DPRA 4PUSA 3ABTA 3L7WA 2DPUA 1FIAA 4A6EA 2KRHA 3OR2C 3PNYA 3VSKA 4RB3C 2R5YB 4L5EA 5HVQC 3LA2A 2M5WA 3H9GA 2YS9A 5GPAA 3HRSA 2KISA 1ZQ3P 4HNTA 3WTXC 4DGWB 2FJ1A 3CZ6A 4IHSA 1T2KA 3F0CA 1XGNA 2RVCA 5IP9J 1CQTA 3GCMA 3KYDB 2WC2A 1YG2A 4UV9A 3VODA 3D1NI 5DUIA 3LSTA 2GM4A 4CICA 2HTSA 3OYNA 4G7ZF 3HYIA 1FBQA 4XK4A 5J4VA 2COMA 2JSCA 3HRTA 3BR2A 2FBKA 4HA8A 1ZR2A 3DU5A 4XN0A 2Z16A 3PSFA 4RM2A 2CQXA 3H3UA 4MQVA 1K61A 1MSEC 1HKQA 1GLNA 3TEDA 4C3HJ 4MTDA 1ZRFA 3A01B 2JK3A 2AS5F 3CDHA 2X4HA 1W0UA 4BXXJ 1EH7A 2CMPA 2VXDA 2P0WA 1MZBA 2A61A 1O57A 4D7NA 4C2TA 1BJAA 5HDKA 2OQRA 2OZUA 5H6RA 1JGGA 2HOTA 3K70C 4LG3A 2JTVA 1J59A 2XUBA 1SD4A 3TP3A 1KU3A 2HOSA 4Q5SF 2IGOA 3NWSA 1SEUA 1SVOA 1WRJA 2DXIA 4WX9A 2LF7A 3ZR8X 1BJZA 1GV5A 2O7OA 4EJUA 3PQJA 2LY9A 3ERMA 5C4XJ 3ZGKA 3CMAI 2FBIA 3LSPA 1ZH5A 2XPWA 3Q5FA 1MNEA 3N05A 4UHTA 2HPIA 2IS1A 2LY1A 1R1VA 1J7KA 2K5CA 5IYCJ 5BPIA 4MGRA 2W85A 3N97A 2VODA 4QLCU 1QZZA 2GXGA 3ERED 2EFWA 2KRFA 2GQQA 5ICFA 4XL9A 3EQLF 3TDZC 4NC7A 1HW1A 2WAFA 5EJCA 3FBIB 1PP8F 3JSPA 3ECHA 4WXCA 3GEZA 2BW3A 3NRVA 2I10A 1EV7A 4OMYA 5EEGA 1TQPA 1QRYA 1PJRA 1GV2A 1DPUA 2W57A 1XSVA 2A69F 4A69C 2XGEA 3REOA 4DJAA 4Y52J 2EFPA 3ASNH 3S8PA 2OZ6A 1IUFA 1RESA 2EPFA 3MVPA 5IOZA 5LGUA 3WTVC 1A36A 2ZC2A 1D3YA 2HVSA 2XKOA 4BJ6C 1S72I 4LFUA 3BR0A 2Y0SN 4E7SA 2LSOA 2V9PA 1OCCH 4LD5A 4A2UA 1O7FA 5FLXZ 3LFKA 2IS6A 3A2KA 3DP7A 3IL2A 3E6CC 3I64A 3ZP5A 2QSHX 3V8JA 1WJDA 3CMYA 1R58A 1TQIA 3R0JA 4KT6A 2AO9A 2BBYA 4NNJA 1YX5A 1ZG5A 1O3QA 2M30A 3T1BA 1JKQC 2O8KA 2FBHA 2BYVE 2VQGA 2R5ZA 5HS7A 2WV0A 3HOTA 3P9CA 4PSXA 1FBUA 1BI3A 3K10A 1TW2A 1WQ2A 3RYRA 5D5VB 2DAOA 3K4BA 1HKTA 4BXUA 5M3FJ 1JKRC 3L2WA 2KIUA 3CQZJ 1G2HA 1QO0D 3GFIA 4AD9A 1MNDA 3OS2A 4LLGF 3GZNB 4EMSA 1Y39A 4AUXA 4PFOA 3DCFA 4X1EA 4E7KA 3S14J 1F36A 3SDBA 1AU7A 2MBFA 4UUSA 2H27A 5D5XB 1S9HA 2OJED 2QF7A 3KP3A 2M4KA 1BOBA 1XGMA 1GVDA 4D5CA 1FSHA 1MBGA 2XB5A 1KZHA 1LEBA 1H9GA 1LKXA 1W7PD 3I58A 1BR1A 3MAJA 4M6YA 2EV0A 2BY2A 5CVIA 3BR5A 2QKLB 3I4NJ 1D0YA 3FXKA 2BW3B 5H20A 5K7ZA 2K4BA 1KYZA 1WH5A 4IEJA 4BH9A 4KT5C 3SJMA 1CF7A 4HOBA 1TNSA 1SAXA 1IN8A 2MSYA 4I98B 1BBYA 3QPLA 4MEXF 1QVUA 4CYDA 1P2FA 1O3RA 1IGNA 1VFCA 3VFZA 1SANA 1XGSA 1QNTA 3KP6A 3K4LA 5F64A 3PIPF 2VUMJ 1ON1A 4FETA 2K86A 1PUEE 4OIOF 3IHUA 1QZYA 2QQ9A 3DKYA 1VQOI 1XMAA 3FMQA 2VE8A 3K1NA 3L2RA 1FLIA 1X1CA 3HKZA 5DYMA 2YU9J 3CCJI 4CGZA 1WJBA 3KLNA 3EYIA 3S2HJ 4E7ZA 3BTIA 4LG0A 5TJJA 3U9GA 1R5ID 2DMQA 5E1ZB 5JHFA 1OKRA 3HEFA 1Z9CA 1C0WA 2BEOA 2STWA 1B9MA 1ZN2A 4A6DA 1Z21A 2R5ZB 4HQMA 3RYPA 4BE2A 3NWTA 1P4WA 2Y9ZA 1JXSA 4UY8I 3RDIA 5A2QZ 1BOAA 3C2GA 3ZN0A 3LFUA 2ZCWA 2H1KA 1USSA 3VYRB 1OR7C 1MJAA 3BPVA 3VYUB 4NQWA 3TP0A 4KITB 2O3FA 4XSXF 3T0YA 5LHGA 2AXTC 2B7EA 4RM3A 1XMKA 4ZJZA 2Z9OA 4YFKF 3CMMA 3F9KA 3S93A 4JX4A 2A5WA 4G7OF 3BQYA 3QAHA 2AHQA 4LK1F 2DODA 3MWMA 5CVRA 3FXJA 2A6EF 2DJNA 2QYOA 1H9TA 5EDNA 2RN7A 4UUSB 3G6EI 4KIFA 3F72A 2VQLA 4A5NA 1APLC 2K02A 3FISA 2XPVA 3KETA 2PMZA 1LE8A 4PGGA 1B9NA 3BP8A 5FKOA 5EG0A 4I6ZA 2IA0A 4ZYGA 3CCVI 2NS0A 3JTHA 1CF7B 1TWGJ 2P7CB 4XN3A 1XN7A 4BGDA 1V5GA 1TLHB 3WTZA 2H1LA 1M1EB 5BOXA 3ZOBA 1ZLJA 1KONA 1T08B 3HIFA 1Y8RB 1BA5A 3HB9A 3K2ZA 4B4CA 3I53A 3WHCA 2LLKA 5B5EC 2V6EA 4XLCA 4AYBN 3ZN1A 1E3PA 4A0YA 2Z99A 4M3GA 2UXNA 1LVKA 3S2DJ 4E70A 1WHUA 2NNYA 3B6CA 4KIGA 1ZG1A 1BC7C 2NVTJ 4A5MA 2FE3A 1JTXA 1QZEA 3P5JA 4XM3A 5E79C 2F5FA 2LBFA 3WODF 3H92A 2X6OA 2W4SA 3L09A 1BN5A 1XDUA 2AXLA 2IJLA 4LG0B 3E3VA 2RGVA 3U1DA 1PUFA 4RBOA 3K4MA 5L3DA 3KLOA 1N25A 2Y30A 3RQIA 1FJLA 2CRGA 2LTPA 3LSHA 1EA3A 2BHZA 3IAM2 1IZ1A 2E36A 1QQIA 2FEZA 2XRLA 1U6GA 5DD8A 4E4HA 3OYDA 5K7FA 1N75A 1RPWA 4IHXA 1Q1HA 1WVRA 3F6VA 2YPRA 2HXOA 2I8DA 4NQWB 1FT9A 1VF9A 3WU1B 5IP6A 5EZGA 1W36C 3TOAA 1R22A 5FFXA 2X6XA 2OC6A 1V4RA 3TBIA 4I0AA 3O6BB 5HLGA 2WTEA 4KA4A 1GXPA 2IGKA 5J47A 3GLLA 4A3DJ 3WGIA 1YO5C 4M3DA 4KIBA 3HZJA 4A3GJ 1VQKI 2GLOA 2E7XA 1OR7A 2RKHA 5ICEA 1LE8B 5EG0B 5HLIA 3S17J 2X0LA 4LITA 1R71A 1LFBA 2WA0A 3RIRA 1R23A 3K4JA 3I71A 4BQQA 4GO1A 4BY1J 3H0GJ 1TWFJ 5DM7F 3CP2A 2F5EA 4YEJA 1A31A 1LNWA 3VYTB 2HZDA 4W97A 4XIDA 4ZH4F 2GWRA 1YHQI 3HPHA 1R5HA 2VT2A 1VQ4I 2NOGA 1I5ZA 3OOUA 1Y56A 3W6JB 3FF5A 3J7YJ 4F55A 5LBQA 1XD7A 5DCMA 1BR4A 4ZDPA 2DA4A 1BW5A 4FX4A 1ZREA 2L4MA 1SD7A 2ELKA 2L9SA 3CCRI 1YIJI 3BPXA 4LK0F 4PDKA 4A12A 1D5VA 2LBFB 1WH7A 1ZGJA 2KZVA 3LAPA 3CP8A 2KLOA 3HM5A 4HW0A 1PUFB 3LSIA 3HHGA 1TQMA 4XLEA 4D1QA 1HLVA 3BJOA 1V54H 4OIRF 1POGA 5L3BA 5FLXK 2D1HA 4ENNA 2HYJA 5HNHA 2HU9A 1BIBA 5DD4A 3WTSC 1OCPA 3R6SA 2VB6A 2IAIA 3DKXA 1FWZA 1ONVA 1R36A 2V26A 5HDNA 4LB5A 1ETXA 1TWCJ 2ZB9A 3GO5A 4EJWA 3DQVC 5IT9K 4DYCA 4EGZA 3HRMA 2Z1DA 4MHGA 2WAQN 2RNJA 3LNQA 4IO9F 1STZA 1QA6A 2R7FA 3LL7A 4G6TB 2OF7A 3PSIA 4L18B 1IV6A 2HDCA 4RA2A 4KJZA 5DM6F 4F92B 2R7UA 5J3LA 4EJOA 3JAMK 3UKGA 1JT6A 2I5UA 3GMEA 4F91B 3GTKJ 2UWMA 5EEHA 4F52A 2Y75A 2DT7B 4NUBA 4DZPA 4PFPA 3BOQA 5E3NA 4D0PA 3KYCB 1HA8A 3FK7A 2ZMEC 3TMOA 3COAC 2K40A 1O3TA 4Z2YA 4MNUA 1VQ5I 2OTJI 4GXOA 2QEXI 3RTRA 1D1AA 4HQEA 4ABZA 2CQQA 4LIVA 4CCJA 1YITI 1TZLA 5LHIA 1HSJA 1DGWY 1YE9A 2M9HA 1Y1VJ 2EB7A 3MZ8A 3HOYJ 3C18A 2F2EA 3HC7A 3HSRA 2K9QA 5DCMB 3BROA 1VQMI 5D6FA 4ZDOA 1N78A 2DA6A 4ZYEA 3C3WA 1A5JA 1QPMA 3CUQC 2HQNA 5F0CA 4M72A 5HLTA 5H2FC 2VT3A
chains in the Genus database with same CATH topology
3TEDA 2L7MP 4C3HJ 3A01B 3OSFA 2JK3A 1D5YA 3Q0VA 2IBDA 1W0UA 2GBYA 4BXXJ 4D7NA 2WV1A 1I50J 2HQ5A 1Q1VA 1MH4A 3L1PA 1JGGA 2HOTA 3GTGJ 3G1MA 4AC0A 1FTZA 2ID3A 2FD5A 5F0HA 3TP3A 2HOSA 2VI6A 3MKLA 3PO2J 2L7ZA 5FKMA 1JUPA 2NS7A 3I4MJ 1ZKGA 4J19A 1BJZA 1GV5A 4A3IJ 2O7OA 2LY9A 2HXIA 5C4XJ 2HI3A 1T33A 3JRIA 3LSPA 2XPWA 1MBEA 2L0KA 1ETVA 3JRCA 2OPTA 4HNVA 3JRAA 5IYCJ 1RR7A 1U9NA 3SFIA 1NTCA 3JRDA 1MBFA 3JRHA 5DTDA 4BBSJ 1H8AC 5EF6A 1NK2P 2R0QC 2LD5A 3RKQA 3TW6A 2HDDA 3OIOA 2DA1A 2E19A 2I10A 3TW7A 2R93J 3PM1A 3Q0UA 1QRYA 5M5YJ 4BY7J 1E3OC 2JA5J 2M0CA 1GV2A 2EQRA 2L9RA 5J1UA 4A69C 2XGEA 4W1UA 4Y52J 1AKHB 2Y31A 3O8HA 4A3MJ 1IUFA 1RESA 3MVPA 5IOZA 1RKTA 5E3OA 1DU0A 1ETYA 4C3JJ 1U8BA 3S1NJ 1JT0A 3WHBA 3BR0A 2Y0SN 3HGYA 3NARA 4MO7A 5C3EJ 3S1RJ 3ZQHA 1JUSA 1ETWA 1TWHJ 5HODA 3CMYA 3IV5A 2EZHA 5IP7J 2P81A 1EF4A 2AO9A 2ECCA 4M6VA 5FLMJ 2EZKA 2NVQJ 5BNGA 4DYRA 1JKQC 2FQ4A 4DYQA 2O8KA 1JJ6C 1OFCX 1H89C 2R5ZA 1XG1A 2M8GX 2JWTA 5M5XJ 2TRTA 2DA7A 2O9LA 4FTHA 2LP0A 5M5WJ 4FE7A 1Z0XA 2E2IJ 1O4XA 3HKZN 3LSRA 3GTQJ 2MW8A 5M3FJ 2X48A 1JKRC 4X6AJ 5FKNA 3MN2A 1MBKA 5C4JJ 3CQZJ 1G2HA 1AKHA 4QIWN 5J1RA 2XSDC 5E3MA 5EZHA 2MG4A 4AUXA 4EEFG 3DCFA 4X1EA 2R92J 3HOZJ 3S14J 2ECBA 1JTYA 1F36A 2DA2A 1AU7A 3HOUJ 4UUSA 3B6AA 4FISA 2CU7A 2QF7A 2DTZA 1GVDA 4D5CA 5FKKA 1MBGA 2XB5A 3ZQGA 3GBGA 2LR8A 3BR5A 3SDGA 3Q0WA 1HF0A 3I4NJ 4I76A 1ORKA 1MBJA 3LSGA 2Y9YA 2H8RA 5K7ZA 3NAUA 4D7MA 4IEJA 1WH5A 1UHSA 3SJMA 4BBRJ 3M4OJ 2MSYA 3G1OA 1IRZA 3RZOJ 1HOMA 4XRMA 3LSJA 4CYCA 5IOYA 3QPLA 1QVUA 1WPKA 2PMZN 2Y2ZA 1IGNA 3GTLJ 1VFCA 3S16J 1SANA 1F43A 2JMWA 4XICA 2XPUA 4UUTA 2VUMJ 2RAEA 3ZQIA 2NVXJ 9ANTA 3H3VK 3QQAA 3FKIJ 1BW6A 1UMQA 3HBLA 4LOCA 4MLOA 1X58A 2YU9J 3S2HJ 3BTIA 5FLVA 3ZQLA 1MNMC 3ZQFA 2DMQA 3JREA 3HEFA 1XS9A 4DZJA 1WGXA 2B63J 4Y7NJ 1H88C 2DMPA 2R5ZB 2Y9ZA 1WI3A 2COBA 1P7IA 1P7JA 3FIWA 1X2MA 5IPAA 5FJ8J 2H1KA 3JRFA 3LOCA 1RKWA 5GPCA 4D5FA 3TP0A 5DS9A 1VI0A 2G0EA 1BL0A 1IG7A 3BQZA 1OJLA 4A3FJ 4M3BA 4JX4A 3BQYA 3VPRA 2AHQA 4S0HB 1IJWC 2DJNA 3BTCA 5EDNA 4UUSB 3IH3A 2JA7J 3GTJJ 2R7ZJ 3BG3A 2L7FP 4QSHA 5EYRA 1JKOC 1APLC 1T56A 2LVSA 2ME0A 2LK2A 2XPVA 3FISA 1LE8A 2EBIA 3K7AJ 5FKOA 5EG0A 4I6ZA 2LKXA 3HOXJ 4JP0A 3GTPJ 1RETA 3QPSA 1TWGJ 2CUEA 2WB1N 4A3LJ 2QCOA 5GP9A 4CYCB 3ZOBA 2M2EA 5E3LA 2MGQA 1ZR4A 4A3CJ 2NVYJ 3JR9A 1BA5A 3HB9A 4B4CA 2VKEA 4A3EJ 3WHCA 2LLKA 2EZIA 4AYBN 1YRNA 2XGDA 3FK6A 4M3GA 3S2DJ 1ITYA 3B6CA 2W48A 2NVTJ 3G1LA 1JTXA 1VNDA 5EEAA 3GTOJ 4B3AA 3A03A 4M3FA 3BTJA 1WCMJ 2X6OA 1FEXA 3A02A 3M3YJ 4RDUA 1PUFA 4RBOA 4XRSG 2Y30A 2XB0X 3RQIA 1FJLA 2CRGA 2LTPA 3C2BA 2X9DA 2JA8J 1JJ8C 5F1JA 2DA3A 3DEWA 2XRLA 1R9TJ 5K7FA 1NK3P 2EH3A 4A3JJ 3HDDA 1FIPA 1RPWA 4IHXA 1TWAJ 4C2MJ 1X2NA 2ID6A 2HXOA 1S7EA 3K2AA 1Z77A 1VF9A 5IP6A 5EZGA 1ETOA 1ETKA 1GUUA 1IDYA 5F0FA 4IHYA 4XRSA 4A3DJ 1OCTC 3Q3SA 4M3DA 4GFBA 2D5VA 4A3GJ 2GLOA 1I6HJ 3CCYA 2DN0A 1LE8B 1GT0C 1U9OA 5EG0B 3S17J 2NS8A 3BTLA 2R5YA 1QVTA 1LFBA 3W6VA 1B8IA 5JLWA 5EGOA 4BY1J 1DU6A 3H0GJ 1TWFJ 4V2FA 3E7LA 1ETQA 1I3QJ 4JX5A 2VPRA 1JUMA 1ZK8A 5C44J 2HOAA 2DMTA 1Y1WJ 2EZLA 5F04A 4JX6A 5IYBJ 3PO3J 5J1YA 4JYKA 1MBHA 4W97A 1A6IA 3RZDJ 4XIDA 5F08A 2JA6J 1QPIA 1AHDP 4FCYA 3ZQCA 2NOGA 1YRNB 3HOWJ 3OOUA 3O8GA 2KDZA 2DA4A 1BW5A 2ELKA 2CJJA 1JKPC 3IH2A 4G12A 1LFUP 2JJ7A 1IC8A 1B72A 4A3BJ 5K7HA 2E2HJ 4MFEA 1WH7A 5IYDJ 2DA5A 3A01A 3HM5A 1XC5A 4BKXA 2YUSA 2IEKA 1PUFB 1HLVA 3BG5A 3S1MJ 1ENHA 1POGA 1HDDC 1IDZA 3HGGA 2HYJA 5M3MJ 1UG2A 4NDLA 1OCPA 3BR3A 3BR1A 2IAIA 3OSGA 4C3IJ 4MFDA 2DMUA 3GTMJ 1MSFC 1ETXA 1TWCJ 2ZB9A 2CUFA 3IH4A 4MIMA 4A93J 4DYCA 2KT0A 5FKLA 2WAQN 3S1QJ 3HOVJ 3LNQA 3JRGA 4IHVA 2OF7A 1IV6A 4M3EA 4DW6A 4QTRA 1TC3C 2K9NA 1K83J 5J3LA 4V2GA 2ME6A 1ZTRA 3UKGA 2N8GA 1FIAA 3JRBA 1JT6A 3BG9A 4IHWA 2XGCA 3GTKJ 2LFBA 2E2JJ 2FX0A 4DZPA 3S15J 2VKVA 5F27A 2R5YB 4L5EA 5E3NA 2M34A 2JN6A 4FE4A 1B8IB 3FK7A 5EGOB 2K40A 2YS9A 5GPAA 1FTTA 1HDPA 1ZGWA 1ZQ3P 4ABZA 2FJ1A 2CQQA 3F0CA 1SFOJ 5IP9J 4A3KJ 1CQTA 2M9HA 2TCTA 1Y1VJ 3HOYJ 2E1OA 4B1RA 1GDTA 3CDLA 3D1NI 1W0TA 2GM4A 2K9QA 1HCRA 4XK4A 2K9SA 3BR6A 2DA6A 1U78A 3BR2A 1ZR2A 1A5JA 1MH3A 3BT9A 5JLXA 2DMNA 5F0CA 1B72B 2CQXA 1MSEC 1K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TED A;  2L7M P;  4C3H J;  3A01 B;  3OSF A;  2JK3 A;  1D5Y A;  3Q0V A;  2IBD A;  1W0U A;  2GBY A;  4BXX J;  4D7N A;  2WV1 A;  1I50 J;  2HQ5 A;  1Q1V A;  1MH4 A;  3L1P A;  1JGG A;  2HOT A;  3GTG J;  3G1M A;  4AC0 A;  1FTZ A;  2ID3 A;  2FD5 A;  5F0H A;  3TP3 A;  2HOS A;  2VI6 A;  3MKL A;  3PO2 J;  2L7Z A;  5FKM A;  1JUP A;  2NS7 A;  3I4M J;  1ZKG A;  4J19 A;  1BJZ A;  1GV5 A;  4A3I J;  2O7O A;  2LY9 A;  2HXI A;  5C4X J;  2HI3 A;  1T33 A;  3JRI A;  3LSP A;  2XPW A;  1MBE A;  2L0K A;  1ETV A;  3JRC A;  2OPT A;  4HNV A;  3JRA A;  5IYC J;  1RR7 A;  1U9N A;  3SFI A;  1NTC A;  3JRD A;  1MBF A;  3JRH A;  5DTD A;  4BBS J;  1H8A C;  5EF6 A;  1NK2 P;  2R0Q C;  2LD5 A;  3RKQ A;  3TW6 A;  2HDD A;  3OIO A;  2DA1 A;  2E19 A;  2I10 A;  3TW7 A;  2R93 J;  3PM1 A;  3Q0U A;  1QRY A;  5M5Y J;  4BY7 J;  1E3O C;  2JA5 J;  2M0C A;  1GV2 A;  2EQR A;  2L9R A;  5J1U A;  4A69 C;  2XGE A;  4W1U A;  4Y52 J;  1AKH B;  2Y31 A;  3O8H A;  4A3M J;  1IUF A;  1RES A;  3MVP A;  5IOZ A;  1RKT A;  5E3O A;  1DU0 A;  1ETY A;  4C3J J;  1U8B A;  3S1N J;  1JT0 A;  3WHB A;  3BR0 A;  2Y0S N;  3HGY A;  3NAR A;  4MO7 A;  5C3E J;  3S1R J;  3ZQH A;  1JUS A;  1ETW A;  1TWH J;  5HOD A;  3CMY A;  3IV5 A;  2EZH A;  5IP7 J;  2P81 A;  1EF4 A;  2AO9 A;  2ECC A;  4M6V A;  5FLM J;  2EZK A;  2NVQ J;  5BNG A;  4DYR A;  1JKQ C;  2FQ4 A;  4DYQ A;  2O8K A;  1JJ6 C;  1OFC X;  1H89 C;  2R5Z A;  1XG1 A;  2M8G X;  2JWT A;  5M5X J;  2TRT A;  2DA7 A;  2O9L A;  4FTH A;  2LP0 A;  5M5W J;  4FE7 A;  1Z0X A;  2E2I J;  1O4X A;  3HKZ N;  3LSR A;  3GTQ J;  2MW8 A;  5M3F J;  2X48 A;  1JKR C;  4X6A J;  5FKN A;  3MN2 A;  1MBK A;  5C4J J;  3CQZ J;  1G2H A;  1AKH A;  4QIW N;  5J1R A;  2XSD C;  5E3M A;  5EZH A;  2MG4 A;  4AUX A;  4EEF G;  3DCF A;  4X1E A;  2R92 J;  3HOZ J;  3S14 J;  2ECB A;  1JTY A;  1F36 A;  2DA2 A;  1AU7 A;  3HOU J;  4UUS A;  3B6A A;  4FIS A;  2CU7 A;  2QF7 A;  2DTZ A;  1GVD A;  4D5C A;  5FKK A;  1MBG A;  2XB5 A;  3ZQG A;  3GBG A;  2LR8 A;  3BR5 A;  3SDG A;  3Q0W A;  1HF0 A;  3I4N J;  4I76 A;  1ORK A;  1MBJ A;  3LSG A;  2Y9Y A;  2H8R A;  5K7Z A;  3NAU A;  4D7M A;  4IEJ A;  1WH5 A;  1UHS A;  3SJM A;  4BBR J;  3M4O J;  2MSY A;  3G1O A;  1IRZ A;  3RZO J;  1HOM A;  4XRM A;  3LSJ A;  4CYC A;  5IOY A;  3QPL A;  1QVU A;  1WPK A;  2PMZ N;  2Y2Z A;  1IGN A;  3GTL J;  1VFC A;  3S16 J;  1SAN A;  1F43 A;  2JMW A;  4XIC A;  2XPU A;  4UUT A;  2VUM J;  2RAE A;  3ZQI A;  2NVX J;  9ANT A;  3H3V K;  3QQA A;  3FKI J;  1BW6 A;  1UMQ A;  3HBL A;  4LOC A;  4MLO A;  1X58 A;  2YU9 J;  3S2H J;  3BTI A;  5FLV A;  3ZQL A;  1MNM C;  3ZQF A;  2DMQ A;  3JRE A;  3HEF A;  1XS9 A;  4DZJ A;  1WGX A;  2B63 J;  4Y7N J;  1H88 C;  2DMP A;  2R5Z B;  2Y9Z A;  1WI3 A;  2COB A;  1P7I A;  1P7J A;  3FIW A;  1X2M A;  5IPA A;  5FJ8 J;  2H1K A;  3JRF A;  3LOC A;  1RKW A;  5GPC A;  4D5F A;  3TP0 A;  5DS9 A;  1VI0 A;  2G0E A;  1BL0 A;  1IG7 A;  3BQZ A;  1OJL A;  4A3F J;  4M3B A;  4JX4 A;  3BQY A;  3VPR A;  2AHQ A;  4S0H B;  1IJW C;  2DJN A;  3BTC A;  5EDN A;  4UUS B;  3IH3 A;  2JA7 J;  3GTJ J;  2R7Z J;  3BG3 A;  2L7F P;  4QSH A;  5EYR A;  1JKO C;  1APL C;  1T56 A;  2LVS A;  2ME0 A;  2LK2 A;  2XPV A;  3FIS A;  1LE8 A;  2EBI A;  3K7A J;  5FKO A;  5EG0 A;  4I6Z A;  2LKX A;  3HOX J;  4JP0 A;  3GTP J;  1RET A;  3QPS A;  1TWG J;  2CUE A;  2WB1 N;  4A3L J;  2QCO A;  5GP9 A;  4CYC B;  3ZOB A;  2M2E A;  5E3L A;  2MGQ A;  1ZR4 A;  4A3C J;  2NVY J;  3JR9 A;  1BA5 A;  3HB9 A;  4B4C A;  2VKE A;  4A3E J;  3WHC A;  2LLK A;  2EZI A;  4AYB N;  1YRN A;  2XGD A;  3FK6 A;  4M3G A;  3S2D J;  1ITY A;  3B6C A;  2W48 A;  2NVT J;  3G1L A;  1JTX A;  1VND A;  5EEA A;  3GTO J;  4B3A A;  3A03 A;  4M3F A;  3BTJ A;  1WCM J;  2X6O A;  1FEX A;  3A02 A;  3M3Y J;  4RDU A;  1PUF A;  4RBO A;  4XRS G;  2Y30 A;  2XB0 X;  3RQI A;  1FJL A;  2CRG A;  2LTP A;  3C2B A;  2X9D A;  2JA8 J;  1JJ8 C;  5F1J A;  2DA3 A;  3DEW A;  2XRL A;  1R9T J;  5K7F A;  1NK3 P;  2EH3 A;  4A3J J;  3HDD A;  1FIP A;  1RPW A;  4IHX A;  1TWA J;  4C2M J;  1X2N A;  2ID6 A;  2HXO A;  1S7E A;  3K2A A;  1Z77 A;  1VF9 A;  5IP6 A;  5EZG A;  1ETO A;  1ETK A;  1GUU A;  1IDY A;  5F0F A;  4IHY A;  4XRS A;  4A3D J;  1OCT C;  3Q3S A;  4M3D A;  4GFB A;  2D5V A;  4A3G J;  2GLO A;  1I6H J;  3CCY A;  2DN0 A;  1LE8 B;  1GT0 C;  1U9O A;  5EG0 B;  3S17 J;  2NS8 A;  3BTL A;  2R5Y A;  1QVT A;  1LFB A;  3W6V A;  1B8I A;  5JLW A;  5EGO A;  4BY1 J;  1DU6 A;  3H0G J;  1TWF J;  4V2F A;  3E7L A;  1ETQ A;  1I3Q J;  4JX5 A;  2VPR A;  1JUM A;  1ZK8 A;  5C44 J;  2HOA A;  2DMT A;  1Y1W J;  2EZL A;  5F04 A;  4JX6 A;  5IYB J;  3PO3 J;  5J1Y A;  4JYK A;  1MBH A;  4W97 A;  1A6I A;  3RZD J;  4XID A;  5F08 A;  2JA6 J;  1QPI A;  1AHD P;  4FCY A;  3ZQC A;  2NOG A;  1YRN B;  3HOW J;  3OOU A;  3O8G A;  2KDZ A;  2DA4 A;  1BW5 A;  2ELK A;  2CJJ A;  1JKP C;  3IH2 A;  4G12 A;  1LFU P;  2JJ7 A;  1IC8 A;  1B72 A;  4A3B J;  5K7H A;  2E2H J;  4MFE A;  1WH7 A;  5IYD J;  2DA5 A;  3A01 A;  3HM5 A;  1XC5 A;  4BKX A;  2YUS A;  2IEK A;  1PUF B;  1HLV A;  3BG5 A;  3S1M J;  1ENH A;  1POG A;  1HDD C;  1IDZ A;  3HGG A;  2HYJ A;  5M3M J;  1UG2 A;  4NDL A;  1OCP A;  3BR3 A;  3BR1 A;  2IAI A;  3OSG A;  4C3I J;  4MFD A;  2DMU A;  3GTM J;  1MSF C;  1ETX A;  1TWC J;  2ZB9 A;  2CUF A;  3IH4 A;  4MIM A;  4A93 J;  4DYC A;  2KT0 A;  5FKL A;  2WAQ N;  3S1Q J;  3HOV J;  3LNQ A;  3JRG A;  4IHV A;  2OF7 A;  1IV6 A;  4M3E A;  4DW6 A;  4QTR A;  1TC3 C;  2K9N A;  1K83 J;  5J3L A;  4V2G A;  2ME6 A;  1ZTR A;  3UKG A;  2N8G A;  1FIA A;  3JRB A;  1JT6 A;  3BG9 A;  4IHW A;  2XGC A;  3GTK J;  2LFB A;  2E2J J;  2FX0 A;  4DZP A;  3S15 J;  2VKV A;  5F27 A;  2R5Y B;  4L5E A;  5E3N A;  2M34 A;  2JN6 A;  4FE4 A;  1B8I B;  3FK7 A;  5EGO B;  2K40 A;  2YS9 A;  5GPA A;  1FTT A;  1HDP A;  1ZGW A;  1ZQ3 P;  4ABZ A;  2FJ1 A;  2CQQ A;  3F0C A;  1SFO J;  5IP9 J;  4A3K J;  1CQT A;  2M9H A;  2TCT A;  1Y1V J;  3HOY J;  2E1O A;  4B1R A;  1GDT A;  3CDL A;  3D1N I;  1W0T A;  2GM4 A;  2K9Q A;  1HCR A;  4XK4 A;  2K9S A;  3BR6 A;  2DA6 A;  1U78 A;  3BR2 A;  1ZR2 A;  1A5J A;  1MH3 A;  3BT9 A;  5JLX A;  2DMN A;  5F0C A;  1B72 B;  2CQX A;  1MSE C;  1K61 A; 
#chains in the Genus database with same CATH topology
 1T38 A;  2L7M P;  2CV2 A;  3OSF A;  1LDJ A;  1D5Y A;  2HOE A;  3U1K A;  2Y0S A;  3BC8 A;  1FOW A;  3BZ6 A;  1V3F A;  2EV5 A;  2QKM B;  3M1E A;  3ZPL A;  3J7Z I;  2EV6 A;  2LG4 A;  4HEA 2;  4G8X A;  4EVI A;  2P5L C;  1T0F C;  2HQ5 A;  1Q1V A;  2JPB A;  3SEQ A;  5HNF A;  3GTG J;  2DFI A;  3G1M A;  3F8M A;  1SFU A;  3I4P A;  2L7Z A;  5E1W A;  1YJN I;  2W00 A;  1JUP A;  3HTS B;  2ELH A;  2NS7 A;  3I4M J;  3CF2 A;  1ZKG A;  4J19 A;  4IQJ A;  2PJR A;  4AVZ A;  3JCU C;  2HI3 A;  1T33 A;  5JHU A;  2XSJ C;  4F3Q A;  2V4J C;  3PNV A;  1MBE A;  3ABK H;  2STT A;  1ETV A;  3EPZ A;  2OPT A;  4HNV A;  2E34 A;  4XOR A;  1RR7 A;  1U9N A;  2KKO A;  4WF2 A;  2PMH A;  1J2X A;  2D45 A;  3VOE A;  4BBS J;  3KX2 A;  1AOY A;  3JSO A;  1F9N A;  1P9Q C;  2MC3 A;  4UB8 C;  3VYS B;  3K9T A;  3CO6 C;  2XRO A;  4OIP F;  4HNU A;  3T8T A;  3RKQ A;  1L3L A;  4G7H F;  1FOX A;  1QHH D;  4Y4R A;  1D8J A;  5FRM A;  2L7K A;  3GUD A;  5E8I A;  2CUJ A;  4P5O A;  4FT8 A;  4S05 A;  5CKT A;  2QA4 I;  3TW7 A;  2R93 J;  4H0E A;  3Q0U A;  3F3X A;  2J5O A;  1E3O C;  2L9R A;  3RQ4 A;  5CVJ A;  3I59 A;  2FUG 2;  1O3S A;  3O8H A;  3MEX A;  3L2Q A;  4A3M J;  2M87 A;  3CC2 I;  3U2R A;  1DU0 A;  1ETY A;  5AON A;  2ZME A;  2FQ3 A;  4DBQ A;  1ZGA A;  3Q9S A;  5KCM A;  3S1N J;  3H5R A;  4RAZ A;  3CCE I;  2CFO A;  2V1N A;  3ZQH A;  1JUS A;  1ETW A;  1Y0N A;  3V7S A;  2X51 A;  2Z5U A;  3CLQ A;  3KEQ A;  3E6M A;  3DTK A;  4U88 A;  2WY7 Q;  3QPT A;  3IV5 A;  1EH8 A;  4B44 A;  2P81 A;  2ECC A;  4M6V A;  5FLM J;  5L3C A;  2EZK A;  1Z6T A;  1UST A;  2KZG A;  4G6D A;  3CUQ A;  4DYQ A;  4AIJ A;  2QQ8 A;  3ZMZ A;  2KFD A;  4EM1 A;  4IRI A;  3TO9 A;  4B8X A;  1B6A A;  2PG4 A;  3BCB A;  3BZK A;  1H89 C;  5M5X J;  4DQ2 A;  2TRT A;  2XKP A;  4L0Y B;  4EQQ A;  2O9L A;  4BEH A;  4FTH A;  1R5G A;  4QPO A;  1FYL A;  2KIQ A;  4RMN A;  3T5X A;  1MW7 A;  5J8F A;  1OLT A;  2NAZ A;  2X1E A;  3LSR A;  2PJR B;  4V19 K;  2R7X A;  4WWC A;  2MW8 A;  4X6A J;  3RPQ A;  2DU9 A;  1RI7 A;  3MN2 A;  5KHD A;  3MMY B;  1T0F A;  5C4J J;  4QIW N;  3IRR A;  3F6O A;  1P92 A;  2R7V A;  1G4D A;  2JRT A;  4CUG A;  2XSD C;  3OYJ A;  1TP4 A;  1Y6I A;  2FA5 A;  2ECB A;  4HAM A;  1OYW A;  2DA2 A;  4KFC A;  4FIS A;  4OIQ F;  1S29 A;  2VC0 A;  3FM3 A;  5FKK A;  1FNN A;  5HLH A;  4KDP A;  4Y3O A;  3GBG A;  3H1C A;  4HV5 A;  3SDG A;  1QU3 A;  1HF0 A;  1UHW A;  1ORK A;  4I76 A;  3LSG A;  2H8R A;  1KGS A;  3K4K A;  2LMD A;  4YIR X;  1UCR A;  4D7M A;  1LFP A;  1UHS A;  3OYF A;  4GRI A;  2YU3 A;  1DQU A;  1R4N B;  2ICW G;  4NHJ A;  1IRZ A;  3I59 B;  2ZXJ A;  4XRM A;  3RZO J;  3LSJ A;  1FZP B;  4CYC A;  3RKX A;  1F4K A;  3SZP A;  2ZME B;  3GTL J;  3J81 K;  4AWX B;  3CUO A;  2CQN A;  1F43 A;  3S32 A;  1SMY F;  2M8E A;  2XPU A;  4UUT A;  2RAE A;  3ZQI A;  3OYB A;  1PP7 U;  2EIM H;  3AFH A;  3H36 A;  5BPD A;  9ANT A;  3AL0 C;  1W7P A;  1MDM A;  1VQ6 I;  2GOM A;  3P9K A;  1B4A A;  3FKI J;  3IWF A;  3QU6 A;  4CH7 A;  1UMQ A;  3HBL A;  3X2Q H;  5GAD J;  1BM9 A;  3E6D A;  4LIU A;  5LRS A;  4HF1 A;  1FYM A;  2VN2 A;  3VSL A;  3CJT B;  1KQ0 A;  2ESN A;  3CUQ B;  1NH3 A;  2FF4 A;  2FOW A;  4LLL A;  1WJA A;  3QYE A;  4Y7N J;  1BI0 A;  1HST A;  2Y69 H;  4YG2 F;  2Q8K A;  5BMZ A;  2XGX A;  3H5N A;  2PBI A;  3ZQ7 A;  4BEH B;  2F5C A;  2DYS H;  2P6S A;  3ZRG A;  1DUX C;  3QPH A;  5FJ8 J;  4M74 A;  1LUJ B;  1A04 A;  4ESB A;  2MH2 A;  1RR8 C;  3B02 A;  2XC7 A;  1BL0 A;  2QSG X;  2QGU A;  1QHG A;  4M3B A;  1R4M B;  1U8R A;  4S0H B;  1IJW C;  4XLA A;  4PJM A;  4HPQ A;  5LLQ A;  2H6B A;  3CTA A;  2FNA A;  4NBQ A;  2OUM A;  3BG3 A;  3CLO A;  2LVS A;  5KNL A;  2LK2 A;  3KP7 A;  3QYB A;  2QBY A;  2LKX A;  3R0A A;  5KAI C;  4ENJ A;  1P4A A;  2O8X A;  1Z7L A;  4JP0 A;  2DFH A;  3OYK A;  3GTP J;  5D6E A;  1IV8 A;  3G4S I;  1RET A;  2R7T A;  2CG4 A;  4YII A;  1S8N A;  2GZW A;  2JPC A;  1S3J A;  2CUE A;  4OWR B;  5IT9 Z;  4OAY A;  2QCO A;  5CVU A;  3C7J A;  5DV5 A;  5GP9 A;  3DU6 A;  3LQQ A;  2DDA A;  4CYC B;  2M2E A;  2L01 A;  1BC8 C;  2MGQ A;  2OAZ A;  1X1D A;  3JR9 A;  4L5J A;  4A3E J;  3VEP A;  1U5T C;  1IO2 A;  4AU7 A;  1ON2 A;  1ZAR A;  2EZI A;  5ILV A;  3JAM Z;  4CCK A;  3IRQ A;  2HYF A;  2XGD A;  2K27 A;  3FK6 A;  1ZEL A;  2LOO A;  1ITY A;  2DQL A;  4YEL A;  5DDG A;  1W7P B;  4RAF A;  3GFM A;  3UNG C;  2IGN A;  3VB2 A;  3ZCO A;  1MDM B;  4B48 A;  4EM2 A;  1VND A;  3GTO J;  5D8L B;  2NNN A;  4U7B A;  5IT3 A;  3A03 A;  3JW4 A;  3M8F A;  4I02 A;  3BTJ A;  1XTA A;  1FEX A;  3K0L A;  3HOS A;  2HDW A;  3LA3 A;  2IPQ X;  3G2B A;  5TIS C;  4HSR A;  2VBW A;  3H3Z A;  1J9I A;  2H94 A;  4XON A;  1R49 A;  3GZ6 A;  2LH9 A;  1J5Y A;  2DA3 A;  2DT6 A;  2GOX B;  3DEW A;  4RLF A;  4MTE A;  3WG7 H;  1FIP A;  1FSE A;  2FOK A;  2HKO A;  1X2N A;  4C2M J;  2ADU A;  3QP6 A;  2DOF A;  3HG9 A;  2V7F A;  2V9V A;  3WTU C;  2CQK A;  3HL2 A;  1U3E M;  2VJJ A;  1H0M A;  1SD6 A;  4L5I A;  3QRF F;  3F8F A;  1ETK A;  1GUU A;  2HGC A;  2DOE A;  2E35 A;  2FSW A;  4IOA F;  2WB1 A;  3M8J A;  4J00 A;  3BLY A;  3BJA A;  5CYV A;  2XF7 A;  4ENM A;  3TO6 A;  2ZNZ A;  3Q3S A;  2D5V A;  3ELK A;  2MH9 A;  2F48 A;  1EJ9 A;  2DN0 A;  1D0X A;  1S7O A;  1KU7 A;  1GT0 C;  2E71 A;  1U9O A;  1HKS A;  3KP5 A;  4EAT A;  2QBY B;  3CJR B;  2W24 A;  4KMU X;  4XLF A;  1X3U A;  3W6V A;  2ZO4 A;  5JVT A;  1B8I A;  5TRD A;  3BZC A;  2DK8 A;  4ASN A;  5EGO A;  1DU6 A;  1S6L A;  2O5R A;  4V2F A;  4ZC3 A;  1FPQ A;  4CZC A;  2OU2 A;  2XRN A;  3CME I;  4EM0 B;  1ZK8 A;  1HQC A;  1UHM A;  3AAF A;  2DMT A;  2VPL A;  5JR3 A;  2DW4 A;  4E7L A;  1A6I A;  2RV8 A;  5L3G A;  3SFZ A;  1AHD P;  5CQG A;  4FCY A;  4U87 A;  3P9I A;  3NQO A;  3O8G A;  1OPC A;  3KEO A;  4YRV A;  2GA1 A;  2KDO A;  1ZG3 A;  5JVG F;  3GFL A;  3MKY B;  1X3Z B;  1TW3 A;  4HV6 A;  2CJJ A;  2L5Q A;  4N0B A;  2UUZ A;  4A3B J;  1B72 A;  5K7H A;  1YI2 I;  5IYD J;  4IRG A;  2FU4 A;  4HYE A;  1U5T A;  2IEK A;  3ZQQ A;  4N9I A;  2OQG A;  3FXL A;  3K1M A;  2CW0 F;  3S3M A;  2ZKZ A;  2HVQ A;  3BG5 A;  2IA1 A;  2XDV A;  4RB0 A;  2YR2 A;  1IDZ A;  3GWZ A;  3AL0 B;  2K7L A;  1OMI A;  1UG2 A;  2L02 A;  3BR1 A;  4MEY F;  4II3 A;  4UB6 C;  4C3I J;  3DBR B;  2DMU A;  3IWZ A;  1Z05 A;  2FMY A;  2WWY A;  2P7V B;  4I2O A;  1SFX A;  2G7H A;  2VKD A;  2CUF A;  2X85 A;  2XAQ A;  1XCB A;  2BOL A;  3HXL A;  3IH4 A;  3E1S A;  4Y13 A;  2ESH A;  2KT0 A;  5FKL A;  3TO7 A;  4XR6 A;  3KPH A;  4HLX A;  2DYR H;  4M3E A;  4DW6 A;  4QTR A;  1XDS A;  5E8G A;  1TC3 C;  2K9N A;  1K83 J;  2CSO A;  4V2G A;  4JQF A;  2N8G A;  1K4T A;  2XGC A;  1VQ7 I;  1QBJ A;  3DPT A;  1E0E A;  2NOJ B;  2FX0 A;  4HX4 A;  2DFF A;  3S15 J;  3L9F A;  1FP2 A;  2E5Z A;  2KQR A;  2M34 A;  2V9K A;  4FE4 A;  1B8I B;  5JI6 A;  4FQG A;  2BE5 F;  2ELJ A;  5KK1 A;  5EGO B;  4KNY A;  3GLX A;  4BQN A;  4CCN A;  1E17 A;  3DTE A;  2L4A A;  1HDP A;  1ZGW A;  3DBH B;  2KJC A;  1ERD A;  1QGP A;  3QP5 A;  5BQT A;  2W84 A;  4BQO A;  2WY8 Q;  4ON0 A;  4ANJ A;  2TCT A;  2E1O A;  3MZY A;  1W0T A;  1ZRC A;  1F1Z A;  3QOP A;  3BR6 A;  1LQ1 A;  1I27 A;  5FD5 A;  2HQR A;  3K1P A;  1IF1 A;  3BT9 A;  3R4K A;  2HZT A;  5JLX A;  1MMD A;  1B72 B;  1IXS B;  1R6R A;  2E7W A;  1JI8 A;  2XAH A;  4PSW A;  1U5T B;  3DF8 A;  2LKP A;  3Q0V A;  4M71 A;  4E6K G;  4CXF A;  4L9J A;  2V79 A;  4CCM A;  3CC4 I;  3BY6 A;  1LEA A;  2OCE A;  2WV1 A;  3MD2 A;  4P96 A;  1ZRD A;  1I50 J;  1S5L C;  2O03 A;  2X6Y A;  4BUP A;  4U7D A;  4H4K C;  4PGH A;  3J81 Z;  2ID3 A;  4AID A;  3N4M A;  1FTZ A;  2VI6 A;  2EA2 A;  1WKM A;  2MA3 A;  3OL4 A;  5FKM A;  1OQY A;  2CW8 A;  1Z67 A;  2ZNY A;  3FXO A;  1G3Y A;  5LGT A;  1FX7 A;  1KU9 A;  4RS8 A;  2BVL A;  4A3I J;  2DOA A;  2PJP A;  5J6X A;  4ZTF A;  4XOT A;  3RI4 A;  4BHP A;  1X1P A;  3R61 A;  2L0K A;  3JRC A;  2DT5 A;  1RUN A;  3HPG A;  4ZZD A;  3JRA A;  4ZYD A;  3FM5 A;  3WTT C;  3SFI A;  3JRD A;  3MZH A;  1I1S A;  1MBF A;  2VBY A;  3FZV A;  3KP2 A;  5J40 A;  1T39 A;  1H8A C;  2ISZ A;  5EF6 A;  1NK2 P;  3AG2 H;  2MLG A;  2R0Q C;  3L2V A;  2KMU A;  1MJ9 A;  3TW6 A;  1FYK A;  3OIO A;  4ENK A;  1WJE A;  3DV8 A;  3WTW C;  4ESJ A;  3I56 I;  4UV8 A;  1B1B A;  3EUA A;  4BY7 J;  2JA5 J;  5J4Y A;  4C2U A;  4W1U A;  3F8N A;  4S04 A;  1AKH B;  1D1C A;  2Y31 A;  3QOE A;  2X1D A;  3HSE A;  2K4J A;  2NYX A;  5E3O A;  1LVA A;  4R1H A;  5HDG A;  1OCO H;  4XLP F;  1U8B A;  3OYM A;  3I3L A;  4M9S A;  1JT0 A;  4PJL A;  4NC6 A;  3RKW A;  2W25 A;  4PJN A;  3HGY A;  3F22 A;  2BGC A;  3NAR A;  4MO7 A;  5C3E J;  4OU0 A;  3S1R J;  3CJN A;  4JBA A;  1J0R A;  3CCL I;  1U0J A;  1PDN C;  1XCV A;  4RB1 A;  4XQF A;  3LSM A;  3FMR A;  1YJ9 I;  5IP7 J;  1I3A A;  2A68 F;  2UZK A;  1GVJ A;  5BS6 A;  2KHM A;  1XSX A;  4BYY A;  3J80 K;  4O5V A;  3OIP A;  5GTH C;  1JJ6 C;  1OFC X;  2ZJQ F;  1XG1 A;  4N9H A;  3RPU D;  2D1V A;  2DA7 A;  3D5L A;  3DWL E;  2LP0 A;  4L9V A;  5M5W J;  4FE7 A;  1Z0X A;  3T8R A;  5ERI A;  1IN5 A;  1UEL B;  2MD0 A;  1O4X A;  3HKZ N;  4CHU A;  2M0M A;  2PX9 A;  2X48 A;  2DFE A;  2L54 A;  2FXA A;  4XOP A;  3CF5 F;  3QU3 A;  2QUF A;  1W5C C;  3K6G A;  5J1R A;  4FX0 A;  2MG4 A;  1MIJ A;  4EEF G;  2O6G E;  1WWX A;  1HC8 A;  1JTY A;  4XKC A;  3B6A A;  3HHH A;  2CU7 A;  1MGT A;  1SAU A;  2DTZ A;  3MQ0 A;  3TL4 X;  2P5V A;  1YQA A;  1LJ9 A;  2LR8 A;  1KU2 A;  3H0D A;  3Q0W A;  4KYW A;  1FMW A;  4G6Q A;  4WXH A;  3KZI C;  3NAU A;  3ABU A;  1BI1 A;  4ETS A;  1AWC A;  3M4O J;  3V4G A;  2MLK A;  3G1O A;  4IVN A;  2HWV A;  1T6S A;  3IC7 A;  4HX7 A;  1WZ2 A;  3GXO A;  5IOY A;  3FXU A;  1J09 A;  2PMU A;  2IVM A;  4CA0 A;  4UUV A;  4XNF A;  3V42 A;  4WCG A;  2PMZ N;  3GVA A;  4RLQ A;  1RRJ A;  3S16 J;  2M4G A;  2MYS A;  5ICG A;  2XAS A;  4XIC A;  3PUF A;  2ZFU A;  2NVX J;  4CCO A;  2W7N A;  3IKV A;  1BW6 A;  2TDX A;  1HBX G;  3TQN A;  2XAF A;  4MLO A;  1X58 A;  2RRE A;  2BY1 A;  2ZXI A;  3C2H A;  3WTY C;  3MCZ A;  5FLV A;  3OMY A;  2EIK H;  2MFZ A;  2QQA A;  2DK5 A;  4OMZ A;  4IQ4 A;  4E7J A;  1IRX A;  3Q9V A;  3JRE A;  4DZJ A;  2F5D A;  3AG4 H;  1SC7 A;  3I0T A;  3RKY A;  1H88 C;  4UVA A;  4Y15 A;  3W3C A;  3W2W A;  1WI3 A;  3VWB A;  2JUG A;  4II2 A;  5H6Q A;  1NG7 A;  5IPA A;  4IZZ A;  1X2M A;  2H8W A;  4E7I A;  3JRF A;  3LOC A;  4BL0 B;  3K69 A;  4U0Y A;  1RKW A;  4EJV A;  5GPC A;  5KAF C;  1O7L A;  1FMV A;  1W4M A;  3OS1 A;  3GZ5 A;  5DS9 A;  2R7D A;  2E5N A;  1VI0 A;  2F4I A;  2G0E A;  2M3A A;  2R7O A;  3BQZ A;  2WAD A;  4YFX F;  1ZHF A;  4BHB A;  1OJL A;  3CJQ B;  2DTR A;  3E97 A;  3ROU A;  4A3F J;  2P5K A;  1X1A A;  2MC4 A;  3K4C A;  1R1U A;  3UR3 C;  4LLN A;  3D5R C;  3BTC A;  3FX3 A;  2RC4 A;  1D8K A;  3IH3 A;  3VDX A;  3OIQ A;  3OOP A;  1IXC A;  2R7Z J;  2JVH A;  2L7F P;  5EYR A;  3CCM I;  2KIF A;  1T56 A;  1YYV A;  2ME0 A;  2QWW A;  1JKO C;  4CDG A;  4M6X A;  2BVM A;  2EBI A;  3K7A J;  3FKJ A;  4I0B A;  2JZY A;  3S3O A;  1ULY A;  1W36 D;  1UZC A;  5GAG J;  2PI0 A;  3QYF A;  3QPS A;  3M8E A;  2XF5 A;  1V55 H;  3I9V 2;  1P4X A;  3DLA A;  3D0S A;  1LDD A;  4A3L J;  4IKF A;  4YFN F;  2GIV A;  1Z3X A;  4ZDL A;  5GTI C;  1ZR4 A;  3WGG A;  4HF2 A;  3DEU A;  2B0L A;  1DP7 P;  3EET A;  1HXD A;  1OCR H;  2VBZ A;  1YRN A;  1FBS A;  1WJC A;  5FD6 A;  2RQQ A;  3DFG A;  3F8C A;  4XKV A;  1K6Y A;  1N77 A;  3S2W A;  2FML A;  4BHC A;  1T95 A;  1UFM A;  3PQK A;  3DPU A;  1XMX A;  2M7B A;  4HST A;  4LGW A;  5DEQ A;  1LDK B;  2OD5 A;  3L2C A;  2DCE A;  1EH6 A;  3A02 A;  4IX7 A;  3M3Y J;  2ZJ2 A;  3AG3 H;  1YTY A;  2VJI A;  1G3W A;  4GGG A;  2DJI A;  4CO8 A;  4XRS G;  4KN4 X;  1JHH A;  2XB0 X;  3C2B A;  2VOP A;  4KMF A;  1DGR M;  2CUZ A;  3G71 I;  2JA8 J;  2F4O B;  3U21 A;  4J01 A;  4CZZ A;  2K3F A;  1R9T J;  2EJR A;  2EH3 A;  1Y8Q B;  4JOM A;  4RAG A;  3CCS I;  3OYL A;  4YIF A;  1MMG A;  2LC2 A;  4D9J A;  1X4P A;  2EFQ A;  2F6C A;  1DDN A;  2V1U A;  3LQR A;  2VE9 A;  2OBP A;  5LRR A;  1KQ8 A;  5CPR B;  3ISP A;  2XF6 A;  2VL8 A;  5F0F A;  1MMN A;  4ZYA A;  1SD5 A;  4IHY A;  1NHA A;  4XRS A;  2G9W A;  3BJ6 A;  1AA7 A;  3BWG A;  1V5F A;  4IF4 A;  4HDV A;  1I6H J;  2ZXH A;  4QPQ A;  4L9T A;  2VJ5 A;  4HX8 A;  3DPL C;  2MAB A;  2NS8 A;  4AYB A;  2HNH A;  1QVT A;  2CS3 A;  2KRC A;  3FMS A;  2CO5 A;  4IRH A;  1X1B A;  3AKZ A;  3V8K A;  3RCO A;  5JLW A;  3DKW A;  1PVE A;  1ETQ A;  2VXZ A;  1X4O A;  1TT5 B;  3V7C A;  3OY9 A;  1J75 A;  2O61 A;  3L2U A;  1JUM A;  5HS9 A;  1JHF A;  5C44 J;  1W5S A;  5J8C A;  1Y1W J;  5F04 A;  4JX6 A;  5IYB J;  5AIP A;  3PO3 J;  5J1Y A;  1MBH A;  3RZD J;  1MMS A;  5F08 A;  2JA6 J;  1IRF A;  1YW8 A;  5LHH A;  4HF0 A;  1WJ5 A;  5JFR A;  2H09 A;  2VJ4 A;  3ZQC A;  1T98 A;  3WG9 A;  1YRN B;  3HOW J;  1G3S A;  3CDI A;  4G9Y A;  4N4O B;  3ULQ B;  1ZLK A;  2KDZ A;  5CVV A;  1RNL A;  4BJT A;  2A5Y B;  3GX4 X;  1VQP I;  4EGY A;  2GA2 A;  1YS7 A;  1R7J A;  2D2W A;  5FB2 A;  2JJ7 A;  1IC8 A;  2DPD A;  5IY5 H;  1RIO H;  4MFE A;  2E2H J;  2JT1 A;  4U0V A;  1YX3 A;  1LPQ A;  2DA5 A;  3HRU A;  2K3P A;  2A6H F;  1XC5 A;  2YUS A;  3IUO A;  4N4N B;  2DO7 A;  3EUH C;  3OL3 A;  1W5T A;  3DXJ F;  4NC8 A;  1TL8 A;  5E20 A;  5K5Q A;  1ENH A;  1HDD C;  3HGG A;  1E2X A;  5B66 C;  1B59 A;  1OIS A;  3BG7 A;  2VIX A;  3F23 A;  4NDL A;  4OAZ A;  4B47 A;  2BV6 A;  4HG2 A;  4Q47 A;  3GTM J;  4RAY A;  1WI9 A;  1MSF C;  2V6C A;  2K9M A;  2ACJ A;  1XB4 A;  2CV1 A;  3SHF A;  2WBM A;  1WSU A;  2KIM A;  3SXY A;  3H35 A;  2L3D A;  3HOV J;  5D5W B;  3JRG A;  2DI3 A;  2RNG A;  1IN7 A;  2Q1Z B;  3LAJ A;  1YS6 A;  3M9A A;  3OV8 A;  4BE1 A;  4LMY A;  1ZTR A;  2ME6 A;  1VQN I;  3FXQ A;  4P9U A;  3JRB A;  3BG9 A;  4IHW A;  2M1B A;  3J80 Z;  2LNB A;  1SVM A;  2LFB A;  3OR1 C;  1LB2 A;  4RB2 C;  5FFZ A;  2E2J J;  1XX5 A;  2VAS A;  3LWF A;  2VKV A;  5F27 A;  1IN4 A;  2JN6 A;  2J5P A;  2NRA C;  2QM3 A;  4EV0 A;  1Z7U A;  3ML6 A;  2NXN B;  2LKS A;  3GF2 A;  5F6F A;  1FTT A;  3DEE A;  3ASO H;  2EWN A;  3A1Y A;  5K5O A;  4R79 A;  2XAG A;  5E18 F;  1SFO J;  4A3K J;  2KPM A;  4B1R A;  4BS9 A;  1GDT A;  4A0Z A;  3LSK A;  4BNC A;  3CDL A;  1JE8 A;  4DIQ A;  3KZZ A;  3RJP A;  2R4G A;  4PJ0 C;  1UJ8 A;  3B73 A;  3JTG A;  4IHT A;  1HCR A;  2K9S A;  1YLF A;  3PUB A;  2HVR A;  1U78 A;  2CQ7 A;  1IW7 F;  1MH3 A;  2HFH A;  4Y33 A;  2DMN A;  4GYG A;  4IPA A;  2JSP A;  3CES A;  2E1M C;  4IOC F;  5L3F A;  2IBD A;  2OV7 A;  2GBY A;  1G8X A;  1VZ0 A;  2GIZ A;  2WAQ A;  1XPX A;  3IP4 B;  3WE2 A;  1MH4 A;  2NVU B;  4WK8 F;  3L1P A;  1DP3 A;  1OCZ H;  1G6N A;  4AC0 A;  1KYW A;  3KFW X;  2DLL A;  1SMT A;  2FD5 A;  5F0H A;  4PCQ A;  3MKL A;  3W6K B;  4I01 A;  2CH0 A;  2ZSH B;  3CCQ I;  3QWL A;  3KP4 A;  3PO2 J;  2QEN A;  4IL6 C;  2XVC A;  2VLA A;  4BDZ A;  1VQL I;  2QVO A;  4P1W A;  2DDB A;  3EUH A;  2HXI A;  4BE0 A;  2PLY A;  2IS2 A;  3JRI A;  1BIA A;  2VQH A;  3H5A A;  1R00 A;  1SFK A;  2Z3Y A;  4RGU A;  4XLH A;  1XGO A;  5LGN A;  3M7G A;  1D1B A;  4B09 A;  3E5Q A;  2L9V A;  2W82 A;  1NTC A;  3QOD A;  2KL4 A;  3JRH A;  5DTD A;  2HKX A;  5KVR A;  1TBX A;  2LD5 A;  2R7Q A;  1Z1D A;  3ABM H;  2EIN H;  2PQ8 A;  1MD0 A;  2RQP A;  2A3S A;  2HDD A;  1FOK A;  2K85 A;  2DA1 A;  3D5S C;  4HDU A;  4XKB A;  2E19 A;  5D5U B;  1R1T A;  2JA2 A;  3E0J B;  3M07 A;  1TTY A;  2LRD A;  3PM1 A;  5M5Y J;  2XAU A;  1ZYR F;  2EQR A;  2M0C A;  4UVC A;  5J1U A;  2EA4 A;  4MQ9 F;  3SEZ A;  3GW2 A;  2WAE A;  2GXB A;  3TOB A;  1XSD A;  2BXZ A;  2R7W A;  3EUK L;  1RKT A;  3A4C A;  3R60 A;  5TGT A;  4C3J J;  1HW2 A;  4KN7 X;  3WHB A;  3A0H C;  1OYY A;  3FXM A;  4BAY A;  2IRF G;  2ZJR F;  4Q48 A;  2YSR A;  3ESW B;  4DBR A;  2F5V A;  1TWH J;  3TKY A;  3ZXS A;  5LFA A;  2BXY A;  3PFI A;  4BAC A;  4XBF A;  4ZZL A;  3K70 D;  5HOD A;  3V8L A;  1VQ9 I;  2QQB A;  2EZH A;  4KIC A;  2CW7 A;  1TT0 A;  1EF4 A;  3OWT A;  4M73 A;  2NVQ J;  4PJJ A;  1CGP A;  5BNG A;  4DYR A;  2FQ4 A;  4PK4 A;  5D4S A;  5LD2 C;  3FXR A;  2JVG A;  4X0G A;  3ZMU A;  2R7S A;  2M8G X;  1MJB A;  2JWT A;  4AVP A;  1K79 A;  1UG0 A;  4CCL A;  4XSZ F;  2L2O A;  1SFE A;  2E2I J;  1YW9 A;  4BXF A;  2ZBK A;  3GTQ J;  1YOV B;  2IGM A;  2P8T A;  4P55 A;  5FKN A;  3J7A O;  1MBK A;  2Q2E A;  3KZY A;  3PJR A;  1AKH A;  2A07 F;  3WGH A;  4XMY A;  1GXQ A;  4TV7 A;  2R7R A;  4HRI A;  2ZFW A;  4ESF A;  2DQR A;  2O0Y A;  4K2E A;  5EZH A;  4C30 A;  4DOZ A;  5E3M A;  2OA4 A;  3OYH A;  2C6Y A;  3V7R A;  2HQA A;  2R92 J;  3HOZ J;  3HOU J;  4KIS A;  2AQE A;  1F5T A;  1WJF A;  1RZ4 A;  2V1X A;  4I7H A;  3ZQG A;  4Q4Z F;  2PN6 A;  3RPU A;  4GCV A;  4AM3 A;  1MBJ A;  2Y9Y A;  3W2V A;  3FHN A;  4P9F A;  4UXN A;  4F7Z A;  3I5U A;  2PFB A;  1MKM A;  4BBR J;  3S3N A;  3CD6 I;  3EYY A;  4HLY A;  1I6X A;  2LF8 A;  3KEY A;  2XIG A;  3KE2 A;  3PFY A;  1HOM A;  1EKE A;  1FP1 D;  4R8H A;  1IUY A;  5D4R A;  2Z2S B;  2QLZ A;  4NB5 A;  1WPK A;  1VTN C;  3FWE A;  4ITV A;  2Y2Z A;  3TDU C;  5CQE A;  4B43 A;  5B3S H;  1T8I A;  4RGR A;  2P4W A;  3W2A A;  2JMW A;  3FDY A;  3ZMV A;  2VOO A;  3HTU A;  3E5U A;  2ISY A;  4QWQ A;  3H3V K;  3QQA A;  3DTI A;  1G3T A;  2EK5 A;  2CFX A;  2X6W A;  4LOC A;  5K5R A;  3DLL F;  3ABL H;  3E6B A;  2E1N A;  3ZQL A;  1MNM C;  3SZG A;  3ZQF A;  4HBL A;  3KCC A;  1XS9 A;  5FRO A;  1P6R A;  1MMA A;  1WGX A;  1ZAO A;  2B63 J;  2DMP A;  1KQ9 A;  1RC9 A;  3I55 I;  2E1M B;  1A6Q A;  2EIJ H;  5E1X A;  2MD5 A;  3OYG A;  3F8B A;  2COB A;  2JRM A;  4WXD A;  1P7I A;  1P7J A;  3FIW A;  4BDY A;  4M9X A;  2XAJ A;  1U2W A;  4OOI A;  2DBB A;  4D5F A;  3FBN B;  3SQN A;  1BI2 A;  2Q2E B;  2QSF X;  2QZ8 A;  4KUM A;  1IG7 A;  3GFJ A;  5CJ9 A;  2GXA A;  3KIO A;  4M9Z A;  5DCF A;  4UVB A;  4AIH A;  3VPR A;  4DNC A;  2IW5 A;  3AG1 H;  2HTJ A;  4GDF A;  3OYE A;  3MKW B;  2JA7 J;  3GTJ J;  4L9N A;  4CSW A;  1YFH A;  4XKW A;  4QSH A;  4AIK A;  3BG6 A;  2ZXW H;  2KJB A;  1HW5 A;  2VBX A;  3WE3 A;  2FRH A;  3HOX J;  2A6T A;  4RGX A;  2ETH A;  3ECO A;  3O2P E;  2CWE A;  4EJT A;  1FOY A;  3OYA A;  4PZJ A;  2JUC A;  4BQA A;  2LY2 A;  2IA2 A;  3IAS 2;  4Y17 A;  1IRG A;  2WB1 N;  3PL8 A;  4OIN F;  3LMM A;  2VKH A;  5ILU A;  1VQ8 I;  2VON A;  1V5E A;  4G94 A;  3ZMD A;  2ZJP F;  3PIO F;  5E3L A;  4A3C J;  2NVY J;  2HR3 A;  3OS0 A;  3OYC A;  3P7N A;  3CO7 C;  2VKE A;  3BCA A;  4ZTJ A;  2JQ7 A;  5CLS A;  1BR2 A;  3ONQ A;  5FGM A;  3J7A Y;  1FY7 A;  4JK1 X;  2BZT A;  2W48 A;  1Z6R A;  3G1L A;  3WU2 C;  5EEA A;  3M1C A;  4GYI A;  4B3A A;  4M3F A;  1UAA A;  3RSN A;  3KYL A;  1WCM J;  2XV4 S;  1KA8 A;  2PEX A;  2V1D A;  4RDU A;  4B3X A;  5GAE J;  3G73 A;  3ZMT A;  3WU0 A;  2X9D A;  4LJZ F;  2CYY A;  3HUG A;  3BDD A;  1JJ8 C;  5ILS A;  5F1J A;  4FAS D;  1G59 A;  1NK3 P;  4A3J J;  3HDD A;  3A0B C;  2BY0 A;  4I09 A;  5GAH J;  1TWA J;  5ICC A;  2HS5 A;  2UV1 A;  2ID6 A;  5LEK A;  3MFK A;  1S7E A;  3HJE A;  3K2A A;  2VQC A;  1Z77 A;  3FHZ A;  2RDP A;  1I39 A;  1FC3 A;  1UB9 A;  2L9N A;  2HEO A;  1S7A A;  1ETO A;  1NG6 A;  1X19 A;  2CV0 A;  1IAW A;  4BJ5 C;  3DBL B;  2IXS A;  2K9L A;  1IDY A;  3PNT A;  1K78 A;  2F4M B;  4L0Z B;  1IXR C;  2P6T A;  2B9S A;  1OCT C;  4GFB A;  3H9Q A;  6PAX A;  2Y48 A;  4O3M A;  3CCY A;  4F93 B;  1REP C;  2X1C A;  3G3Z A;  5HS8 A;  1L0O C;  1K7A A;  2ZSI B;  4ZYH A;  3BTL A;  2R5Y A;  2YX4 A;  2W1O A;  3O3K A;  2FNP A;  3IKT A;  1IN6 A;  2LDU A;  5K1Y A;  2HYG D;  3F21 A;  3LA7 A;  1WFX A;  3GYH X;  3MKZ A;  3E7L A;  2Y0M A;  5FRN A;  1I3Q J;  2GAU A;  2R3S A;  4JX5 A;  2Z33 A;  2VPR A;  2HOA A;  2EIL H;  3EDP A;  1YJW I;  1X3W B;  2EZL A;  2E1C A;  4A0X A;  3OYI A;  1E3H A;  4JYK A;  4LB6 B;  3K4N A;  3E5X A;  1QPI A;  1YIO A;  5A2Q K;  2VC1 A;  4IXA A;  4Z6Y A;  3CC7 I;  2Q0O A;  2BHY A;  3SZT A;  1Y0U A;  3I54 A;  4HZF A;  1JGS A;  1Z3Y A;  1JKP C;  3IH2 A;  4G12 A;  1LFU P;  2LYC A;  3C1D A;  1SVL A;  1ACI A;  2M7A A;  5DUK A;  5LEJ A;  2KP6 A;  4XLN F;  4O6J A;  2YX7 A;  3A01 A;  2HPM A;  2M45 A;  1Z91 A;  4BKX A;  1K4S A;  1OYI A;  3CCU I;  5E17 F;  3HSF A;  2EFO A;  3S1M J;  3HUG B;  5FO5 A;  4C9Y A;  5ED4 A;  3TGN A;  2CGP A;  2IS4 A;  3SYT A;  5B1A H;  1PYV A;  5HOO A;  1GHC A;  5M3M J;  2IP2 A;  1W1W E;  1I1G A;  4XRF A;  1D0Z A;  1RUO A;  5L3E A;  3BR3 A;  4IJA A;  2OTL I;  1ODD A;  4UNO A;  2A05 A;  5D8K B;  3OSG A;  4MFD A;  5B1B H;  1A35 A;  1TNT A;  2UXX A;  2IT0 A;  4U0W A;  4BU2 A;  4RGS A;  2G7U A;  4MIM A;  4A93 J;  1YW7 A;  3NEU A;  3L00 A;  4E7H A;  5AIQ A;  3H9J A;  4I99 C;  2BY3 A;  2AQF A;  2EFN A;  1K6O A;  3S1Q J;  3ZMS A;  2XHK A;  1K78 B;  4IHV A;  4FHT A;  5F1R A;  2E60 A;  2H6C A;  2LRE A;  2OCC H;  1DPR A;  4PUS A;  3ABT A;  3L7W A;  2DPU A;  1FIA A;  4A6E A;  2KRH A;  3OR2 C;  3PNY A;  3VSK A;  4RB3 C;  2R5Y B;  4L5E A;  5HVQ C;  3LA2 A;  2M5W A;  3H9G A;  2YS9 A;  5GPA A;  3HRS A;  2KIS A;  1ZQ3 P;  4HNT A;  3WTX C;  4DGW B;  2FJ1 A;  3CZ6 A;  4IHS A;  1T2K A;  3F0C A;  1XGN A;  2RVC A;  5IP9 J;  1CQT A;  3GCM A;  3KYD B;  2WC2 A;  1YG2 A;  4UV9 A;  3VOD A;  3D1N I;  5DUI A;  3LST A;  2GM4 A;  4CIC A;  2HTS A;  3OYN A;  4G7Z F;  3HYI A;  1FBQ A;  4XK4 A;  5J4V A;  2COM A;  2JSC A;  3HRT A;  3BR2 A;  2FBK A;  4HA8 A;  1ZR2 A;  3DU5 A;  4XN0 A;  2Z16 A;  3PSF A;  4RM2 A;  2CQX A;  3H3U A;  4MQV A;  1K61 A;  1MSE C;  1HKQ A;  1GLN A;  3TED A;  4C3H J;  4MTD A;  1ZRF A;  3A01 B;  2JK3 A;  2AS5 F;  3CDH A;  2X4H A;  1W0U A;  4BXX J;  1EH7 A;  2CMP A;  2VXD A;  2P0W A;  1MZB A;  2A61 A;  1O57 A;  4D7N A;  4C2T A;  1BJA A;  5HDK A;  2OQR A;  2OZU A;  5H6R A;  1JGG A;  2HOT A;  3K70 C;  4LG3 A;  2JTV A;  1J59 A;  2XUB A;  1SD4 A;  3TP3 A;  1KU3 A;  2HOS A;  4Q5S F;  2IGO A;  3NWS A;  1SEU A;  1SVO A;  1WRJ A;  2DXI A;  4WX9 A;  2LF7 A;  3ZR8 X;  1BJZ A;  1GV5 A;  2O7O A;  4EJU A;  3PQJ A;  2LY9 A;  3ERM A;  5C4X J;  3ZGK A;  3CMA I;  2FBI A;  3LSP A;  1ZH5 A;  2XPW A;  3Q5F A;  1MNE A;  3N05 A;  4UHT A;  2HPI A;  2IS1 A;  2LY1 A;  1R1V A;  1J7K A;  2K5C A;  5IYC J;  5BPI A;  4MGR A;  2W85 A;  3N97 A;  2VOD A;  4QLC U;  1QZZ A;  2GXG A;  3ERE D;  2EFW A;  2KRF A;  2GQQ A;  5ICF A;  4XL9 A;  3EQL F;  3TDZ C;  4NC7 A;  1HW1 A;  2WAF A;  5EJC A;  3FBI B;  1PP8 F;  3JSP A;  3ECH A;  4WXC A;  3GEZ A;  2BW3 A;  3NRV A;  2I10 A;  1EV7 A;  4OMY A;  5EEG A;  1TQP A;  1QRY A;  1PJR A;  1GV2 A;  1DPU A;  2W57 A;  1XSV A;  2A69 F;  4A69 C;  2XGE A;  3REO A;  4DJA A;  4Y52 J;  2EFP A;  3ASN H;  3S8P A;  2OZ6 A;  1IUF A;  1RES A;  2EPF A;  3MVP A;  5IOZ A;  5LGU A;  3WTV C;  1A36 A;  2ZC2 A;  1D3Y A;  2HVS A;  2XKO A;  4BJ6 C;  1S72 I;  4LFU A;  3BR0 A;  2Y0S N;  4E7S A;  2LSO A;  2V9P A;  1OCC H;  4LD5 A;  4A2U A;  1O7F A;  5FLX Z;  3LFK A;  2IS6 A;  3A2K A;  3DP7 A;  3IL2 A;  3E6C C;  3I64 A;  3ZP5 A;  2QSH X;  3V8J A;  1WJD A;  3CMY A;  1R58 A;  1TQI A;  3R0J A;  4KT6 A;  2AO9 A;  2BBY A;  4NNJ A;  1YX5 A;  1ZG5 A;  1O3Q A;  2M30 A;  3T1B A;  1JKQ C;  2O8K A;  2FBH A;  2BYV E;  2VQG A;  2R5Z A;  5HS7 A;  2WV0 A;  3HOT A;  3P9C A;  4PSX A;  1FBU A;  1BI3 A;  3K10 A;  1TW2 A;  1WQ2 A;  3RYR A;  5D5V B;  2DAO A;  3K4B A;  1HKT A;  4BXU A;  5M3F J;  1JKR C;  3L2W A;  2KIU A;  3CQZ J;  1G2H A;  1QO0 D;  3GFI A;  4AD9 A;  1MND A;  3OS2 A;  4LLG F;  3GZN B;  4EMS A;  1Y39 A;  4AUX A;  4PFO A;  3DCF A;  4X1E A;  4E7K A;  3S14 J;  1F36 A;  3SDB A;  1AU7 A;  2MBF A;  4UUS A;  2H27 A;  5D5X B;  1S9H A;  2OJE D;  2QF7 A;  3KP3 A;  2M4K A;  1BOB A;  1XGM A;  1GVD A;  4D5C A;  1FSH A;  1MBG A;  2XB5 A;  1KZH A;  1LEB A;  1H9G A;  1LKX A;  1W7P D;  3I58 A;  1BR1 A;  3MAJ A;  4M6Y A;  2EV0 A;  2BY2 A;  5CVI A;  3BR5 A;  2QKL B;  3I4N J;  1D0Y A;  3FXK A;  2BW3 B;  5H20 A;  5K7Z A;  2K4B A;  1KYZ A;  1WH5 A;  4IEJ A;  4BH9 A;  4KT5 C;  3SJM A;  1CF7 A;  4HOB A;  1TNS A;  1SAX A;  1IN8 A;  2MSY A;  4I98 B;  1BBY A;  3QPL A;  4MEX F;  1QVU A;  4CYD A;  1P2F A;  1O3R A;  1IGN A;  1VFC A;  3VFZ A;  1SAN A;  1XGS A;  1QNT A;  3KP6 A;  3K4L A;  5F64 A;  3PIP F;  2VUM J;  1ON1 A;  4FET A;  2K86 A;  1PUE E;  4OIO F;  3IHU A;  1QZY A;  2QQ9 A;  3DKY A;  1VQO I;  1XMA A;  3FMQ A;  2VE8 A;  3K1N A;  3L2R A;  1FLI A;  1X1C A;  3HKZ A;  5DYM A;  2YU9 J;  3CCJ I;  4CGZ A;  1WJB A;  3KLN A;  3EYI A;  3S2H J;  4E7Z A;  3BTI A;  4LG0 A;  5TJJ A;  3U9G A;  1R5I D;  2DMQ A;  5E1Z B;  5JHF A;  1OKR A;  3HEF A;  1Z9C A;  1C0W A;  2BEO A;  2STW A;  1B9M A;  1ZN2 A;  4A6D A;  1Z21 A;  2R5Z B;  4HQM A;  3RYP A;  4BE2 A;  3NWT A;  1P4W A;  2Y9Z A;  1JXS A;  4UY8 I;  3RDI A;  5A2Q Z;  1BOA A;  3C2G A;  3ZN0 A;  3LFU A;  2ZCW A;  2H1K A;  1USS A;  3VYR B;  1OR7 C;  1MJA A;  3BPV A;  3VYU B;  4NQW A;  3TP0 A;  4KIT B;  2O3F A;  4XSX F;  3T0Y A;  5LHG A;  2AXT C;  2B7E A;  4RM3 A;  1XMK A;  4ZJZ A;  2Z9O A;  4YFK F;  3CMM A;  3F9K A;  3S93 A;  4JX4 A;  2A5W A;  4G7O F;  3BQY A;  3QAH A;  2AHQ A;  4LK1 F;  2DOD A;  3MWM A;  5CVR A;  3FXJ A;  2A6E F;  2DJN A;  2QYO A;  1H9T A;  5EDN A;  2RN7 A;  4UUS B;  3G6E I;  4KIF A;  3F72 A;  2VQL A;  4A5N A;  1APL C;  2K02 A;  3FIS A;  2XPV A;  3KET A;  2PMZ A;  1LE8 A;  4PGG A;  1B9N A;  3BP8 A;  5FKO A;  5EG0 A;  4I6Z A;  2IA0 A;  4ZYG A;  3CCV I;  2NS0 A;  3JTH A;  1CF7 B;  1TWG J;  2P7C B;  4XN3 A;  1XN7 A;  4BGD A;  1V5G A;  1TLH B;  3WTZ A;  2H1L A;  1M1E B;  5BOX A;  3ZOB A;  1ZLJ A;  1KON A;  1T08 B;  3HIF A;  1Y8R B;  1BA5 A;  3HB9 A;  3K2Z A;  4B4C A;  3I53 A;  3WHC A;  2LLK A;  5B5E C;  2V6E A;  4XLC A;  4AYB N;  3ZN1 A;  1E3P A;  4A0Y A;  2Z99 A;  4M3G A;  2UXN A;  1LVK A;  3S2D J;  4E70 A;  1WHU A;  2NNY A;  3B6C A;  4KIG A;  1ZG1 A;  1BC7 C;  2NVT J;  4A5M A;  2FE3 A;  1JTX A;  1QZE A;  3P5J A;  4XM3 A;  5E79 C;  2F5F A;  2LBF A;  3WOD F;  3H92 A;  2X6O A;  2W4S A;  3L09 A;  1BN5 A;  1XDU A;  2AXL A;  2IJL A;  4LG0 B;  3E3V A;  2RGV A;  3U1D A;  1PUF A;  4RBO A;  3K4M A;  5L3D A;  3KLO A;  1N25 A;  2Y30 A;  3RQI A;  1FJL A;  2CRG A;  2LTP A;  3LSH A;  1EA3 A;  2BHZ A;  3IAM 2;  1IZ1 A;  2E36 A;  1QQI A;  2FEZ A;  2XRL A;  1U6G A;  5DD8 A;  4E4H A;  3OYD A;  5K7F A;  1N75 A;  1RPW A;  4IHX A;  1Q1H A;  1WVR A;  3F6V A;  2YPR A;  2HXO A;  2I8D A;  4NQW B;  1FT9 A;  1VF9 A;  3WU1 B;  5IP6 A;  5EZG A;  1W36 C;  3TOA A;  1R22 A;  5FFX A;  2X6X A;  2OC6 A;  1V4R A;  3TBI A;  4I0A A;  3O6B B;  5HLG A;  2WTE A;  4KA4 A;  1GXP A;  2IGK A;  5J47 A;  3GLL A;  4A3D J;  3WGI A;  1YO5 C;  4M3D A;  4KIB A;  3HZJ A;  4A3G J;  1VQK I;  2GLO A;  2E7X A;  1OR7 A;  2RKH A;  5ICE A;  1LE8 B;  5EG0 B;  5HLI A;  3S17 J;  2X0L A;  4LIT A;  1R71 A;  1LFB A;  2WA0 A;  3RIR A;  1R23 A;  3K4J A;  3I71 A;  4BQQ A;  4GO1 A;  4BY1 J;  3H0G J;  1TWF J;  5DM7 F;  3CP2 A;  2F5E A;  4YEJ A;  1A31 A;  1LNW A;  3VYT B;  2HZD A;  4W97 A;  4XID A;  4ZH4 F;  2GWR A;  1YHQ I;  3HPH A;  1R5H A;  2VT2 A;  1VQ4 I;  2NOG A;  1I5Z A;  3OOU A;  1Y56 A;  3W6J B;  3FF5 A;  3J7Y J;  4F55 A;  5LBQ A;  1XD7 A;  5DCM A;  1BR4 A;  4ZDP A;  2DA4 A;  1BW5 A;  4FX4 A;  1ZRE A;  2L4M A;  1SD7 A;  2ELK A;  2L9S A;  3CCR I;  1YIJ I;  3BPX A;  4LK0 F;  4PDK A;  4A12 A;  1D5V A;  2LBF B;  1WH7 A;  1ZGJ A;  2KZV A;  3LAP A;  3CP8 A;  2KLO A;  3HM5 A;  4HW0 A;  1PUF B;  3LSI A;  3HHG A;  1TQM A;  4XLE A;  4D1Q A;  1HLV A;  3BJO A;  1V54 H;  4OIR F;  1POG A;  5L3B A;  5FLX K;  2D1H A;  4ENN A;  2HYJ A;  5HNH A;  2HU9 A;  1BIB A;  5DD4 A;  3WTS C;  1OCP A;  3R6S A;  2VB6 A;  2IAI A;  3DKX A;  1FWZ A;  1ONV A;  1R36 A;  2V26 A;  5HDN A;  4LB5 A;  1ETX A;  1TWC J;  2ZB9 A;  3GO5 A;  4EJW A;  3DQV C;  5IT9 K;  4DYC A;  4EGZ A;  3HRM A;  2Z1D A;  4MHG A;  2WAQ N;  2RNJ A;  3LNQ A;  4IO9 F;  1STZ A;  1QA6 A;  2R7F A;  3LL7 A;  4G6T B;  2OF7 A;  3PSI A;  4L18 B;  1IV6 A;  2HDC A;  4RA2 A;  4KJZ A;  5DM6 F;  4F92 B;  2R7U A;  5J3L A;  4EJO A;  3JAM K;  3UKG A;  1JT6 A;  2I5U A;  3GME A;  4F91 B;  3GTK J;  2UWM A;  5EEH A;  4F52 A;  2Y75 A;  2DT7 B;  4NUB A;  4DZP A;  4PFP A;  3BOQ A;  5E3N A;  4D0P A;  3KYC B;  1HA8 A;  3FK7 A;  2ZME C;  3TMO A;  3COA C;  2K40 A;  1O3T A;  4Z2Y A;  4MNU A;  1VQ5 I;  2OTJ I;  4GXO A;  2QEX I;  3RTR A;  1D1A A;  4HQE A;  4ABZ A;  2CQQ A;  4LIV A;  4CCJ A;  1YIT I;  1TZL A;  5LHI A;  1HSJ A;  1DGW Y;  1YE9 A;  2M9H A;  1Y1V J;  2EB7 A;  3MZ8 A;  3HOY J;  3C18 A;  2F2E A;  3HC7 A;  3HSR A;  2K9Q A;  5DCM B;  3BRO A;  1VQM I;  5D6F A;  4ZDO A;  1N78 A;  2DA6 A;  4ZYE A;  3C3W A;  1A5J A;  1QPM A;  3CUQ C;  2HQN A;  5F0C A;  4M72 A;  5HLT A;  5H2F C;  2VT3 A; 
#chains in the Genus database with same CATH homology
 3TED A;  2L7M P;  4C3H J;  3A01 B;  3OSF A;  2JK3 A;  1D5Y A;  3Q0V A;  2IBD A;  1W0U A;  2GBY A;  4BXX J;  4D7N A;  2WV1 A;  1I50 J;  2HQ5 A;  1Q1V A;  1MH4 A;  3L1P A;  1JGG A;  2HOT A;  3GTG J;  3G1M A;  4AC0 A;  1FTZ A;  2ID3 A;  2FD5 A;  5F0H A;  3TP3 A;  2HOS A;  2VI6 A;  3MKL A;  3PO2 J;  2L7Z A;  5FKM A;  1JUP A;  2NS7 A;  3I4M J;  1ZKG A;  4J19 A;  1BJZ A;  1GV5 A;  4A3I J;  2O7O A;  2LY9 A;  2HXI A;  5C4X J;  2HI3 A;  1T33 A;  3JRI A;  3LSP A;  2XPW A;  1MBE A;  2L0K A;  1ETV A;  3JRC A;  2OPT A;  4HNV A;  3JRA A;  5IYC J;  1RR7 A;  1U9N A;  3SFI A;  1NTC A;  3JRD A;  1MBF A;  3JRH A;  5DTD A;  4BBS J;  1H8A C;  5EF6 A;  1NK2 P;  2R0Q C;  2LD5 A;  3RKQ A;  3TW6 A;  2HDD A;  3OIO A;  2DA1 A;  2E19 A;  2I10 A;  3TW7 A;  2R93 J;  3PM1 A;  3Q0U A;  1QRY A;  5M5Y J;  4BY7 J;  1E3O C;  2JA5 J;  2M0C A;  1GV2 A;  2EQR A;  2L9R A;  5J1U A;  4A69 C;  2XGE A;  4W1U A;  4Y52 J;  1AKH B;  2Y31 A;  3O8H A;  4A3M J;  1IUF A;  1RES A;  3MVP A;  5IOZ A;  1RKT A;  5E3O A;  1DU0 A;  1ETY A;  4C3J J;  1U8B A;  3S1N J;  1JT0 A;  3WHB A;  3BR0 A;  2Y0S N;  3HGY A;  3NAR A;  4MO7 A;  5C3E J;  3S1R J;  3ZQH A;  1JUS A;  1ETW A;  1TWH J;  5HOD A;  3CMY A;  3IV5 A;  2EZH A;  5IP7 J;  2P81 A;  1EF4 A;  2AO9 A;  2ECC A;  4M6V A;  5FLM J;  2EZK A;  2NVQ J;  5BNG A;  4DYR A;  1JKQ C;  2FQ4 A;  4DYQ A;  2O8K A;  1JJ6 C;  1OFC X;  1H89 C;  2R5Z A;  1XG1 A;  2M8G X;  2JWT A;  5M5X J;  2TRT A;  2DA7 A;  2O9L A;  4FTH A;  2LP0 A;  5M5W J;  4FE7 A;  1Z0X A;  2E2I J;  1O4X A;  3HKZ N;  3LSR A;  3GTQ J;  2MW8 A;  5M3F J;  2X48 A;  1JKR C;  4X6A J;  5FKN A;  3MN2 A;  1MBK A;  5C4J J;  3CQZ J;  1G2H A;  1AKH A;  4QIW N;  5J1R A;  2XSD C;  5E3M A;  5EZH A;  2MG4 A;  4AUX A;  4EEF G;  3DCF A;  4X1E A;  2R92 J;  3HOZ J;  3S14 J;  2ECB A;  1JTY A;  1F36 A;  2DA2 A;  1AU7 A;  3HOU J;  4UUS A;  3B6A A;  4FIS A;  2CU7 A;  2QF7 A;  2DTZ A;  1GVD A;  4D5C A;  5FKK A;  1MBG A;  2XB5 A;  3ZQG A;  3GBG A;  2LR8 A;  3BR5 A;  3SDG A;  3Q0W A;  1HF0 A;  3I4N J;  4I76 A;  1ORK A;  1MBJ A;  3LSG A;  2Y9Y A;  2H8R A;  5K7Z A;  3NAU A;  4D7M A;  4IEJ A;  1WH5 A;  1UHS A;  3SJM A;  4BBR J;  3M4O J;  2MSY A;  3G1O A;  1IRZ A;  3RZO J;  1HOM A;  4XRM A;  3LSJ A;  4CYC A;  5IOY A;  3QPL A;  1QVU A;  1WPK A;  2PMZ N;  2Y2Z A;  1IGN A;  3GTL J;  1VFC A;  3S16 J;  1SAN A;  1F43 A;  2JMW A;  4XIC A;  2XPU A;  4UUT A;  2VUM J;  2RAE A;  3ZQI A;  2NVX J;  9ANT A;  3H3V K;  3QQA A;  3FKI J;  1BW6 A;  1UMQ A;  3HBL A;  4LOC A;  4MLO A;  1X58 A;  2YU9 J;  3S2H J;  3BTI A;  5FLV A;  3ZQL A;  1MNM C;  3ZQF A;  2DMQ A;  3JRE A;  3HEF A;  1XS9 A;  4DZJ A;  1WGX A;  2B63 J;  4Y7N J;  1H88 C;  2DMP A;  2R5Z B;  2Y9Z A;  1WI3 A;  2COB A;  1P7I A;  1P7J A;  3FIW A;  1X2M A;  5IPA A;  5FJ8 J;  2H1K A;  3JRF A;  3LOC A;  1RKW A;  5GPC A;  4D5F A;  3TP0 A;  5DS9 A;  1VI0 A;  2G0E A;  1BL0 A;  1IG7 A;  3BQZ A;  1OJL A;  4A3F J;  4M3B A;  4JX4 A;  3BQY A;  3VPR A;  2AHQ A;  4S0H B;  1IJW C;  2DJN A;  3BTC A;  5EDN A;  4UUS B;  3IH3 A;  2JA7 J;  3GTJ J;  2R7Z J;  3BG3 A;  2L7F P;  4QSH A;  5EYR A;  1JKO C;  1APL C;  1T56 A;  2LVS A;  2ME0 A;  2LK2 A;  2XPV A;  3FIS A;  1LE8 A;  2EBI A;  3K7A J;  5FKO A;  5EG0 A;  4I6Z A;  2LKX A;  3HOX J;  4JP0 A;  3GTP J;  1RET A;  3QPS A;  1TWG J;  2CUE A;  2WB1 N;  4A3L J;  2QCO A;  5GP9 A;  4CYC B;  3ZOB A;  2M2E A;  5E3L A;  2MGQ A;  1ZR4 A;  4A3C J;  2NVY J;  3JR9 A;  1BA5 A;  3HB9 A;  4B4C A;  2VKE A;  4A3E J;  3WHC A;  2LLK A;  2EZI A;  4AYB N;  1YRN A;  2XGD A;  3FK6 A;  4M3G A;  3S2D J;  1ITY A;  3B6C A;  2W48 A;  2NVT J;  3G1L A;  1JTX A;  1VND A;  5EEA A;  3GTO J;  4B3A A;  3A03 A;  4M3F A;  3BTJ A;  1WCM J;  2X6O A;  1FEX A;  3A02 A;  3M3Y J;  4RDU A;  1PUF A;  4RBO A;  4XRS G;  2Y30 A;  2XB0 X;  3RQI A;  1FJL A;  2CRG A;  2LTP A;  3C2B A;  2X9D A;  2JA8 J;  1JJ8 C;  5F1J A;  2DA3 A;  3DEW A;  2XRL A;  1R9T J;  5K7F A;  1NK3 P;  2EH3 A;  4A3J J;  3HDD A;  1FIP A;  1RPW A;  4IHX A;  1TWA J;  4C2M J;  1X2N A;  2ID6 A;  2HXO A;  1S7E A;  3K2A A;  1Z77 A;  1VF9 A;  5IP6 A;  5EZG A;  1ETO A;  1ETK A;  1GUU A;  1IDY A;  5F0F A;  4IHY A;  4XRS A;  4A3D J;  1OCT C;  3Q3S A;  4M3D A;  4GFB A;  2D5V A;  4A3G J;  2GLO A;  1I6H J;  3CCY A;  2DN0 A;  1LE8 B;  1GT0 C;  1U9O A;  5EG0 B;  3S17 J;  2NS8 A;  3BTL A;  2R5Y A;  1QVT A;  1LFB A;  3W6V A;  1B8I A;  5JLW A;  5EGO A;  4BY1 J;  1DU6 A;  3H0G J;  1TWF J;  4V2F A;  3E7L A;  1ETQ A;  1I3Q J;  4JX5 A;  2VPR A;  1JUM A;  1ZK8 A;  5C44 J;  2HOA A;  2DMT A;  1Y1W J;  2EZL A;  5F04 A;  4JX6 A;  5IYB J;  3PO3 J;  5J1Y A;  4JYK A;  1MBH A;  4W97 A;  1A6I A;  3RZD J;  4XID A;  5F08 A;  2JA6 J;  1QPI A;  1AHD P;  4FCY A;  3ZQC A;  2NOG A;  1YRN B;  3HOW J;  3OOU A;  3O8G A;  2KDZ A;  2DA4 A;  1BW5 A;  2ELK A;  2CJJ A;  1JKP C;  3IH2 A;  4G12 A;  1LFU P;  2JJ7 A;  1IC8 A;  1B72 A;  4A3B J;  5K7H A;  2E2H J;  4MFE A;  1WH7 A;  5IYD J;  2DA5 A;  3A01 A;  3HM5 A;  1XC5 A;  4BKX A;  2YUS A;  2IEK A;  1PUF B;  1HLV A;  3BG5 A;  3S1M J;  1ENH A;  1POG A;  1HDD C;  1IDZ A;  3HGG A;  2HYJ A;  5M3M J;  1UG2 A;  4NDL A;  1OCP A;  3BR3 A;  3BR1 A;  2IAI A;  3OSG A;  4C3I J;  4MFD A;  2DMU A;  3GTM J;  1MSF C;  1ETX A;  1TWC J;  2ZB9 A;  2CUF A;  3IH4 A;  4MIM A;  4A93 J;  4DYC A;  2KT0 A;  5FKL A;  2WAQ N;  3S1Q J;  3HOV J;  3LNQ A;  3JRG A;  4IHV A;  2OF7 A;  1IV6 A;  4M3E A;  4DW6 A;  4QTR A;  1TC3 C;  2K9N A;  1K83 J;  5J3L A;  4V2G A;  2ME6 A;  1ZTR A;  3UKG A;  2N8G A;  1FIA A;  3JRB A;  1JT6 A;  3BG9 A;  4IHW A;  2XGC A;  3GTK J;  2LFB A;  2E2J J;  2FX0 A;  4DZP A;  3S15 J;  2VKV A;  5F27 A;  2R5Y B;  4L5E A;  5E3N A;  2M34 A;  2JN6 A;  4FE4 A;  1B8I B;  3FK7 A;  5EGO B;  2K40 A;  2YS9 A;  5GPA A;  1FTT A;  1HDP A;  1ZGW A;  1ZQ3 P;  4ABZ A;  2FJ1 A;  2CQQ A;  3F0C A;  1SFO J;  5IP9 J;  4A3K J;  1CQT A;  2M9H A;  2TCT A;  1Y1V J;  3HOY J;  2E1O A;  4B1R A;  1GDT A;  3CDL A;  3D1N I;  1W0T A;  2GM4 A;  2K9Q A;  1HCR A;  4XK4 A;  2K9S A;  3BR6 A;  2DA6 A;  1U78 A;  3BR2 A;  1ZR2 A;  1A5J A;  1MH3 A;  3BT9 A;  5JLX A;  2DMN A;  5F0C A;  1B72 B;  2CQX A;  1MSE C;  1K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...