3A01B

Crystal structure of aristaless and clawless homeodomains bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
RRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Gene regulation/dna
molecule keywords Homeodomain-containing protein
total genus 20
structure length 57
sequence length 57
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a01B00
2ECBA 2EZKA 5J3LA 5JLXA 2E2HJ 1I6HJ 4JX4A 3GTLJ 1JUSA 4LOCA 2GBYA 1H8AC 5JLWA 3L1PA 2EQRA 3RZDJ 1ZR4A 1LE8B 2VKVA 1APLC 2K9SA 2M8GX 3CDLA 5EYRA 3M3YJ 1FTTA 4A3KJ 2ID3A 1F36A 2B63J 3M4OJ 2LP0A 4DYRA 4QIWN 3A01B 5FKMA 4RBOA 1JT0A 1HDDC 3S14J 4M6VA 2ID6A 3OOUA 1WH5A 2R5YA 3NARA 2R0QC 2E1OA 2HOAA 2LR8A 4G12A 4BXXJ 5EZHA 5EZGA 4IHVA 5J1YA 3S1RJ 3SFIA 1XS9A 9ANTA 1XG1A 3HGGA 4A3MJ 3A01A 1QVUA 5K7HA 4FISA 1GUUA 1ETXA 2MW8A 1ETOA 5M3MJ 2O7OA 1W0UA 1QRYA 3JRGA 3WHBA 1G2HA 1MBGA 1PUFA 1OCTC 2VKEA 1ETWA 1TWAJ 3RQIA 3HOWJ 4GFBA 5FKOA 5E3OA 4L5EA 3A02A 3BR6A 3E7LA 2EBIA 3ZQIA 2YUSA 3BQYA 1LFUP 3HOZJ 5M5WJ 1P7IA 3BTIA 1UG2A 2MG4A 2QCOA 4D7NA 4V2FA 4BY1J 4M3EA 2GM4A 1IG7A 2JA5J 3BTJA 1FEXA 2DA4A 2L7MP 1Y1VJ 3IH4A 1MBFA 2JN6A 1O4XA 1NK2P 1MNMC 3O8GA 5IOZA 3GTQJ 2IAIA 2X48A 2LLKA 2DMNA 2OPTA 4C3IJ 3WHCA 1BW6A 2H8RA 1FTZA 2XB0X 5F1JA 1EF4A 1U9NA 4XIDA 4JX6A 3HOYJ 3S15J 2HXOA 1NTCA 1ETKA 2E2JJ 1TC3C 2L7ZA 1H89C 2YS9A 1GV5A 1ETVA 4FE4A 3SJMA 1VI0A 3G1MA 1GDTA 5M3FJ 4JX5A 1YRNB 3CQZJ 3BG5A 3HM5A 2Y9ZA 3I4NJ 1RESA 3OSFA 1JKOC 1IV6A 3S1QJ 1X58A 1TWCJ 2DMQA 5IOYA 3QQAA 2DJNA 1IJWC 2R5YB 3ZQHA 1AKHA 3MVPA 2LVSA 2LTPA 2EZIA 3FK6A 1MBKA 5F0HA 1HOMA 2CU7A 4M3BA 1JTXA 2CJJA 1Z0XA 5E3NA 1JKPC 2DMPA 5GPAA 4UUTA 4A3IJ 4FCYA 2LFBA 3S2DJ 3FIWA 4M3FA 1FIAA 5J1UA 3BTCA 4NDLA 5E3MA 3HB9A 3ZQCA 1DU0A 3LOCA 3Q3SA 3GTKJ 1H88C 2K9QA 4UUSB 3JR9A 2XRLA 5IP9J 2AHQA 4CYCB 4BBSJ 2XB5A 4BBRJ 2COBA 2Y30A 3O8HA 4MIMA 4C3JJ 3QPSA 1RPWA 2K40A 5F08A 1IDZA 3B6AA 3JRDA 1MBEA 2EZLA 1IC8A 2Y2ZA 2PMZN 1ETYA 2L9RA 2R7ZJ 2K9NA 2XSDC 2JK3A 2XGCA 5EG0A 2DA6A 1AHDP 4XK4A 2NVYJ 2JA6J 1VNDA 1JT6A 2DA2A 1S7EA 2VPRA 3MKLA 2L0KA 4DYCA 1WI3A 1I50J 3K2AA 3JRBA 3OIOA 2HQ5A 4QTRA 1JJ8C 3IH3A 3K7AJ 1JUMA 3TEDA 1MBJA 2XPVA 4MLOA 1E3OC 3CCYA 2NS7A 3HEFA 4X1EA 4AC0A 3BR1A 2W48A 5FKKA 4A3DJ 1OCPA 3BG9A 1A6IA 1K83J 1TWFJ 3I4MJ 2DTZA 4DYQA 1OJLA 5C44J 1BL0A 2NVXJ 1ZGWA 1F43A 3S2HJ 3BR2A 1ETQA 4V2GA 1I3QJ 2TRTA 1BW5A 4A3EJ 3FKIJ 2R92J 3NAUA 3C2BA 1MSEC 3LSGA 1MH3A 3BT9A 4MFEA 2WAQN 1RR7A 1JTYA 1FIPA 4UUSA 3ZOBA 2Y31A 4B4CA 1TWHJ 4IHWA 1U78A 3GTMJ 1R9TJ 4A3GJ 3TP3A 4W97A 5C3EJ 2I10A 5IP7J 1D5YA 3A03A 4JP0A 4A69C 4EEFG 4Y52J 4HNVA 3RZOJ 1SANA 2DMUA 4D5CA 4M3DA 1JJ6C 1Q1VA 2FD5A 1GT0C 1ZK8A 2JJ7A 1VF9A 2HYJA 5EGOB 2NVQJ 2CQXA 3G1OA 5GPCA 2DA7A 1BJZA 4D7MA 2M2EA 2ZB9A 1JKQC 1X2NA 2FJ1A 1B8IA 1WGXA 3TW7A 4I76A 2DA3A 3S17J 2X6OA 3MN2A 4FE7A 3JRIA 4I6ZA 1CQTA 4ABZA 2XPWA 4M3GA 3BQZA 2R5ZA 1YRNA 1XC5A 2WB1N 1ZKGA 3CMYA 2NS8A 2H1KA 2D5VA 4A93J 4AUXA 4MO7A 1UMQA 3BTLA 2P81A 3G1LA 3H3VK 3SDGA 4A3FJ 1GV2A 5K7FA 2E2IJ 1FJLA 1P7JA 3H0GJ 2LY9A 1DU6A 2Y0SN 1RKTA 2YU9J 2DA5A 1AKHB 3GTGJ 2HI3A 1ZQ3P 5C4JJ 1PUFB 1RETA 3IH2A 1JKRC 1IGNA 2CUFA 2E19A 3PM1A 4X6AJ 5EEAA 3ZQFA 3HBLA 4W1UA 3LSJA 2TCTA 5K7ZA 5FLVA 1QVTA 4Y7NJ 1POGA 5FKLA 3UKGA 2LKXA 5BNGA 2KDZA 2HOSA 1BA5A 1MSFC 2G0EA 2LD5A 4A3JJ 4JYKA 5EF6A 4A3LJ 1T56A 2CUEA 3LSPA 1HDPA 5F0CA 4B3AA 1HF0A 2M9HA 2XPUA 1B72B 2FQ4A 2JA7J 3FISA 5IYBJ 2VUMJ 3PO2J 2R93J 3HOVJ 1QPIA 3IV5A 3ZQLA 2ELKA 4QSHA 3LNQA 2M34A 3LSRA 2HXIA 5DTDA 5HODA 2EH3A 1WPKA 5E3LA 4DZPA 4XRSA 3ZQGA 3BR3A 2GLOA 1JUPA 3B6CA 1LFBA 5J1RA 1W0TA 2VI6A 2JA8J 2KT0A 3BR5A 2MSYA 3BG3A 5C4XJ 5IYDJ 1B8IB 3Q0VA 5FKNA 2XGDA 2ECCA 2OF7A 2NOGA 2JMWA 2HDDA 1ENHA 4FTHA 4A3BJ 1UHSA 1JGGA 2IBDA 3TP0A 2CQQA 4S0HB 1MBHA 1U9OA 3HDDA 1B72A 4CYCA 3W6VA 1OFCX 2CRGA 2DMTA 4IEJA 3DCFA 2IEKA 2L7FP 2QF7A 5GP9A 1A5JA 4B1RA 3HKZN 1RKWA 2X9DA 4C3HJ 1SFOJ 5F0FA 4DZJA 4A3CJ 4AYBN 5IPAA 2M0CA 2O8KA 3QPLA 1WCMJ 2ME6A 2O9LA 1HCRA 4RDUA 3PO3J 4DW6A 1Z77A 5DS9A 5IP6A 1T33A 5F27A 4XRMA 4IHYA 3RKQA 1ZTRA 3GTJJ 4MFDA 4XRSG 2DA1A 2MGQA 2RAEA 3HOUJ 2ME0A 3JRHA 3JREA 5EDNA 1NK3P 1TWGJ 2DN0A 2NVTJ 3Q0UA 4C2MJ 5IYCJ 1Y1WJ 1MH4A 3Q0WA 4J19A 2N8GA 3OSGA 3S1MJ 1AU7A 3FK7A 3S16J 1WH7A 1LE8A 1IRZA 3JRCA 1IUFA 3DEWA 4BKXA 5FJ8J 1U8BA 1HLVA 4XICA 3JRFA 3S1NJ 1ZR2A 1IDYA 1ITYA 3BR0A 3TW6A 2AO9A 2WV1A 5FLMJ 1X2MA 3F0CA 5EG0B 2FX0A 5EGOA 3GTOJ 1GVDA 2EZHA 3D1NI 3JRAA 4BY7J 3HOXJ 2LK2A 4D5FA 1VFCA 4IHXA 2Y9YA 2JWTA 3GBGA 3HGYA 1ORKA 2XGEA 3VPRA 5M5XJ 2HOTA 5M5YJ 1K61A 2R5ZB 3GTPJ 5F04A
chains in the Genus database with same CATH superfamily
2MD0A 2HFHA 1IN8A 3LA2A 1N78A 3HRTA 3GLXA 4XKWA 1VQ4I 1BOBA 4XKCA 1X3UA 5GTIC 2Z33A 5JLWA 1LE8B 3GEZA 1APLC 3RCOA 2H09A 2EFQA 3HYIA 3I5UA 2A6EF 1FTTA 1KQ9A 3M8JA 3OYCA 2YSRA 4IX7A 1BI1A 5DCMA 4QIWN 1W36C 2XAGA 3ELKA 1PP7U 1JT0A 5DM6F 2W25A 5L3BA 1HDDC 1MDMA 3DKXA 3OOUA 1V5EA 2HYFA 5FD5A 3S32A 3W3CA 1OPCA 3NARA 4EVIA 1U5TB 2E1OA 3VYRB 3I9V2 1DPUA 2WB1A 2A07F 4U88A 2ISYA 1VQMI 2F5DA 5DCFA 4F55A 1LVKA 2GXAA 3HGGA 4A3MJ 2IXSA 1Y8RB 4BH9A 2MBFA 4CO8A 1E3PA 3BZKA 2LG4A 3TDZC 2FOKA 4PJ0C 3I0TA 3N4MA 3GLLA 1FPQA 4GXOA 2O7OA 3H3UA 5BMZA 2FOWA 1SMYF 1QRYA 2OV7A 2D2WA 4N9HA 5HLGA 3JRGA 3D0SA 4M9XA 1W0UA 1FYMA 1G2HA 1BI2A 5F1RA 3FXOA 1HKTA 3RQIA 3HOWJ 1F9NA 4AIHA 1IXRC 4L5EA 3PFIA 4HX7A 2YUSA 4KT6A 4R79A 1MD0A 3I55I 3E1SA 4D7NA 4G7HF 3HIFA 1MZBA 2WAEA 4XORA 1SEUA 4BY1J 2XDVA 2CQNA 4M3EA 3OYJA 1UG0A 3TO9A 3J7YJ 3BTJA 2CUJA 3FHNA 4D9JA 1SC7A 3PUFA 1Y1VJ 3K4LA 2JN6A 2IA2A 2L3DA 4XONA 3JAMK 3FXRA 3LAJA 1J7KA 2HOEA 2M3AA 4UVAA 1S6LA 3WHCA 3HXLA 1XD7A 3KPHA 3NQOA 3I54A 3SDBA 5F1JA 3KZIC 3S15J 4MEXF 3WTZA 2VJJA 1NTCA 2XAQA 1TC3C 4EV0A 2YS9A 2O3FA 1GV5A 4KN7X 3SJMA 4ZH4F 1VI0A 4WXCA 4YRVA 3IL2A 4QPQA 1BC8C 1GDTA 3HOTA 4JX5A 5DYMA 3CQZJ 3BG5A 3HM5A 1T38A 3D5LA 3LL7A 1UB9A 4LD5A 5DUIA 1U3EM 2KP6A 2RREA 2DMQA 3EETA 4Z6YA 2DJNA 3HJEA 2A5YB 2M45A 2MA3A 3ZQHA 3CJQB 1YX3A 2IJLA 3P5JA 5CLSA 2BVMA 2LVSA 1P92A 3WU0A 3KP5A 1BOAA 3SYTA 1J0RA 3QPHA 3FK6A 4ENNA 1G3WA 2L4AA 1HOMA 4M3BA 1IN6A 1FX7A 1YQAA 1VZ0A 2DMPA 4LLGF 1JKPC 5GPAA 2W7NA 2LY2A 2MLKA 3VSKA 4M3FA 2CW8A 4ETSA 4NDLA 4RAFA 3ZQCA 3CO6C 5DUKA 3Q3SA 4HOBA 2OTJI 2W57A 5IP9J 2AHQA 3CLOA 5B1BH 1IXSB 1S8NA 3SHFA 1U6GA 4BBSJ 2IS2A 1A36A 4N9IA 2C6YA 2KRFA 5D8LB 2L4MA 2JVGA 3MAJA 3QPSA 1S3JA 3OV8A 4HEA2 5F08A 2AXLA 3SZTA 4UB8C 2EZLA 3GFMA 1IC8A 4ENMA 2WC2A 3GCMA 4IZZA 2XRNA 2L9RA 4CCNA 2R7ZJ 3PIOF 2XSDC 2V9KA 5HS8A 5H20A 4ZYEA 1MIJA 5CQGA 1HBXG 4XSXF 3BOQA 2V6CA 2H27A 2R7TA 2DA2A 1S7EA 4PGGA 4YIIA 2L0KA 4DYCA 3CF5F 3JRBA 4PJMA 2HQ5A 4UY8I 1JJ8C 2FMLA 1S7AA 3IH3A 2HEOA 2XF6A 2ZSIB 4MLOA 4KITB 2ZJRF 3KETA 1YI2I 5JVTA 1ZGAA 2NS7A 3BZCA 4X1EA 3W2WA 5H2FC 3CD6I 5D6EA 3BR1A 3GVAA 3OYHA 1OCPA 2DBBA 4NC8A 1YW8A 2HQAA 3OYFA 1OJLA 3DTIA 3CCSI 1F43A 3RI4A 2GZWA 4DGWB 2D45A 1WKMA 2A61A 1DUXC 5LFAA 2LC2A 3ZMZA 2VOOA 1OCOH 1I3QJ 5HDGA 4A3EJ 3WGIA 2PMHA 2Q1ZB 2R92J 2BZTA 2RKHA 3OYDA 2IGMA 3ZQQA 4MHGA 4B48A 2XC7A 1MH3A 4HW0A 2VODA 3ABKH 1M1EB 1RR7A 4KFCA 1OCZH 1NHAA 2GA2A 4RM3A 4BXFA 1FIPA 1LEAA 4MTDA 4CCOA 1FOXA 4GCVA 1XGSA 2Y31A 4A6EA 1YG2A 5DEQA 4EJUA 1R9TJ 3T1BA 3CDHA 3OR1C 2EINH 5C3EJ 3OIPA 2M1BA 2OZ6A 2DT7B 2EFOA 3A03A 4AVZA 4XLPF 3CCRI 5J8CA 2Z16A 4Y52J 2W1OA 3ZPLA 4D5CA 3BCAA 1ZK8A 3BJOA 3RDIA 5DV5A 1XX5A 1W4MA 1FOWA 4O3MA 1RUOA 2VBZA 2QGUA 2CQXA 1O57A 3F6VA 3AG4H 2FJ1A 4WWCA 4I76A 1TW2A 2DA3A 1X3ZB 3LA3A 1SFUA 4LG3A 4LG0A 3MN2A 1CQTA 3FM3A 3BJAA 5L3EA 1W7PD 3CMYA 4PSWA 2EB7A 1EKEA 1R1UA 2DOFA 2QA4I 4AUXA 3HOSA 2W24A 3BTLA 2P81A 3H3VK 2KPMA 3SDGA 1QBJA 2STWA 3H0GJ 2LY9A 1DU6A 2YU9J 1RKTA 1AKHB 4XN3A 3RKYA 3ECOA 3X2QH 5C4JJ 1L3LA 3IH2A 3OL4A 2WTEA 1JKRC 3KE2A 2FBKA 3IWZA 4Q4ZF 2VE8A 4X6AJ 1X1BA 5DCMB 2Z3YA 3ESWB 4W1UA 3IAS2 1B6AA 2OA4A 3QOPA 3D5RC 3CMAI 5K7ZA 1CF7A 2ESNA 4HPQA 1F1ZA 3R0AA 1QVTA 4A2UA 4Y7NJ 3ZP5A 5FKLA 4UNOA 4P5OA 1UZCA 2VBYA 4F7ZA 2F5CA 3ISPA 2QUFA 3COAC 4JYKA 5EF6A 2LD5A 1B1BA 1TBXA 2CUEA 1LJ9A 4ZYGA 4B3AA 2DTRA 2CQ7A 1FSHA 1AOYA 5FD6A 3FXKA 1VQOI 1B72B 2KZVA 2XPUA 5LRSA 3PNYA 2CGPA 3ASNH 3RYPA 3BP8A 5ILVA 1TQPA 2O5RA 2DYRH 4MEYF 3IV5A 1QPIA 3ZQLA 2ZBKA 2FMYA 1IN7A 3LNQA 4BS9A 2M34A 2M4GA 4L18B 2KKOA 1SFXA 4XLCA 3RIRA 3AKZA 5E3LA 3GUDA 4CXFA 3L2WA 1ACIA 3ZQGA 2Z99A 3CLQA 3H3ZA 2Y0SA 4HAMA 3MKYB 3S93A 2LF7A 4PZJA 1IN5A 5L3CA 1V54H 3BG3A 5TISC 2QEXI 5C4XJ 3JTGA 4M74A 1B8IB 1PDNC 3Q0VA 1Y0UA 2LYCA 2Y48A 4S05A 4WK8F 2HDDA 1QNTA 2DU9A 3K6GA 2K5CA 1FMVA 1G8XA 2ZCWA 3QP6A 1Y6IA 5LBQA 3G6EI 1JGGA 4LFUA 1G6NA 5BOXA 1FNNA 2KQRA 1FYKA 2CQQA 3CP8A 2YPRA 2FSWA 5ICCA 4F91B 2CRGA 3S3MA 2DMTA 5BPDA 4IOAF 2IEKA 2QF7A 4M9ZA 3WTWC 1QA6A 3G4SI 3KEOA 2FXAA 4KMUX 4NBQA 1XCBA 2X9DA 5F0FA 4AU7A 2V6EA 2K9MA 2M0CA 3U2RA 1B59A 5HOOA 3K1NA 1G59A 2O9LA 1RC9A 3R60A 2JVHA 4KA4A 2FU4A 2BY3A 1O3SA 4IHYA 2QSGX 1KU3A 1DP7P 3O3KA 5GAHJ 3DLAA 3RKQA 5LLQA 3V7RA 4GRIA 5K1YA 3KP6A 4BEHA 1W5SA 3MKWB 1TWGJ 2NXNB 3H9QA 4RGRA 2L5QA 4A0ZA 1YLFA 3R61A 3WG7H 4AWXB 1Y1WJ 2BW3A 3QWLA 2HPMA 1T39A 2R7XA 1N77A 3SZGA 1E2XA 1ZG5A 4OMZA 4CZCA 1AU7A 4FASD 1WH7A 1WSUA 3S16J 1W7PB 3K4JA 3TGNA 3JRCA 3HC7A 3F3XA 5FJ8J 1HLVA 3L9FA 2O8XA 4F3QA 1IW7F 1T98A 1ZELA 2KRHA 3HHHA 4HV6A 2Q8KA 3RPQA 3CC4I 2MYSA 4UXNA 3ZMSA 3BPXA 3BWGA 3KP2A 3NRVA 5J4VA 3F0CA 3FWEA 3FKJA 1XSDA 3D1NI 1N25A 4LB6B 4Q5SF 2W85A 2VKDA 3ABTA 4Y4RA 2VT2A 4CH7A 2Y9YA 2JWTA 3DU6A 3GBGA 3HSEA 1ORKA 1Z3YA 2QSFX 3A2KA 4NC7A 3ZMDA 3S3NA 3WTYC 1YJ9I 4BXUA 2LBFB 5M5YJ 4ENJA 1USSA 1VQ5I 2IS1A 1OYYA 3A4CA 1FZPB 2VN2A 4G7OF 3SXYA 5J3LA 3MQ0A 5JLXA 1I6HJ 4JX4A 2E7XA 3VYUB 2FEZA 4G8XA 3L09A 1ZR4A 2GQQA 2VKVA 2ELHA 1K7AA 3CDLA 1ERDA 4BE0A 2GIZA 2P8TA 4Y17A 4A3KJ 2XSJC 2B63J 2LP0A 4DYRA 3A01B 3KZZA 5FKMA 4RBOA 3BDDA 4RB2C 2P5LC 3S14J 1R5ID 2ID6A 3W6JB 2IT0A 1K4SA 4EJTA 4P1WA 2QYOA 1O3RA 3PUBA 5K5RA 2LR8A 2OQGA 4B43A 3CCLI 3C7JA 4BXXJ 1X1CA 1LEBA 3GO5A 3OYKA 1HW2A 3V8KA 1ZRCA 1NG7A 4Y15A 1Z05A 4BGDA 4EGYA 1YJNI 1QVUA 3EPZA 4IRHA 2CYYA 1OLTA 5CVUA 5K7HA 2VASA 4Y3OA 4A5NA 2VLAA 4FISA 2MW8A 1JGSA 3R4KA 2ZJ2A 1U8RA 2EV0A 4O5VA 2A6HF 3LSMA 4PFPA 3E97A 2P0WA 2VKEA 1Z6TA 1TWAJ 2CG4A 3KP4A 1R22A 5E3OA 4KT5C 5JHFA 3HOZJ 1KQ8A 5M5WJ 1X1PA 1ODDA 2AQFA 1R5GA 1UG2A 4KN4X 2KIFA 2QCOA 4HA8A 3ZN0A 3FMSA 4FQGA 3TBIA 2JA5J 1FEXA 1KONA 3L2UA 3G73A 1P2FA 1Z21A 1R49A 1XPXA 2OCCH 1NK2P 1MNMC 2V9PA 3IKVA 3GTQJ 3H9JA 4B44A 4M6YA 3TOAA 2BYVE 3SEZA 1FC3A 2ZJQF 2OPTA 2VQLA 3MD2A 1BW6A 2Z2SB 2X6YA 5GAEJ 1FTZA 3MKZA 2W00A 1I6XA 1LDDA 5JHUA 1U9NA 3ABMH 3PQKA 4OIRF 4JX6A 3HOYJ 1HA8A 3JW4A 4C9YA 1D5VA 3C1DA 1D1BA 1ETKA 2EIKH 4O6JA 2ELJA 4UHTA 2R7VA 1H89C 3EUHC 3QP5A 3CCEI 2DFEA 1E17A 2EILH 2HQNA 2LSOA 4H0EA 2A5WA 4LJZF 4ZYHA 5LHIA 4BE1A 1TQMA 5M3FJ 3L00A 3AG3H 2NNYA 1OCRH 2Y9ZA 3I4NJ 1RESA 3MFKA 2F5EA 3ASOH 2FUG2 3OSFA 2G7UA 1ZG1A 4PCQA 1MJ9A 5IOYA 4L9VA 2VQHA 2X1DA 1IJWC 3HHGA 3BLYA 4NNJA 1AKHA 3WE2A 4XOTA 3E6BA 1YS7A 4E70A 3E6CC 1JXSA 1Z91A 3UR3C 3FMQA 5F0HA 1ZN2A 2CU7A 2LDUA 1JTXA 4NB5A 2CJJA 1EH8A 2FQ3A 4L9JA 2NYXA 1T08B 1P4XA 3LSKA 4UUTA 3FIWA 4FCYA 1X1AA 2YX7A 4ASNA 4A3IJ 1NH3A 1EA3A 1H9TA 1SAXA 3BTCA 3I59A 2M8EA 3ZR8X 1BJAA 1DU0A 4RMNA 3PSFA 3LOCA 1HC8A 3AL0C 2K9QA 1FBSA 4PDKA 3GFLA 2I5UA 2OAZA 2HKOA 5E8IA 3H5NA 3SEQA 2DQLA 3DWLE 2PLYA 2XB5A 1LPQA 5JFRA 2HTSA 2COBA 2JUGA 4MIMA 2GOXB 3WG9A 1RPWA 4LK1F 3VODA 5A2QZ 3MZ8A 1X19A 2K40A 1REPC 2CUZA 3AL0B 3CC7I 2XKPA 1O7LA 4N4OB 1X4PA 2NAZA 2ZXWH 4HQEA 4HLYA 3CCMI 4PGHA 2XGCA 2DA6A 1AHDP 1ZLKA 5JR3A 3U1DA 2P7VB 4ZTJA 1YO5C 2MC4A 2JA6J 3H36A 1AWCA 1JT6A 3KP7A 1BR1A 3Q9SA 3F6OA 4XN0A 2BHZA 1MMNA 1WI3A 2RQPA 1I50J 1X3WB 3K2AA 1GXPA 3OIOA 4BACA 2DO7A 1JUMA 5J47A 4E7HA 3RPUA 2XPVA 3QYBA 2E5NA 5B1AH 3UNGC 3DBLB 3HEFA 3ZMUA 3ECHA 1QZZA 4AC0A 3K4MA 3N05A 3OYLA 2W48A 1QO0D 4HF1A 1P4AA 1TWFJ 4JOMA 5DM7F 1BL0A 4DYQA 2NVXJ 1ZGWA 3TOBA 1GVJA 3BR2A 1N75A 2UWMA 1ETQA 5F6FA 2VJIA 5H6QA 2DT5A 4V2GA 1IXCA 2TRTA 4ZZLA 3IRRA 3DBHB 1ZH5A 1BW5A 1ON1A 1KZHA 1OCCH 4CSWA 2PEXA 4BQQA 2F48A 3V8JA 3RSNA 2WY7Q 5D5XB 2XVCA 3F21A 1PUEE 4OINF 1K79A 1BBYA 3GZ5A 4M73A 4EJVA 1G3YA 4FT8A 4RAYA 2A6TA 3L2CA 1SD5A 4B4CA 1TWHJ 1FMWA 2DODA 2V9VA 2LKPA 3ZQ7A 4A3GJ 2XAHA 1Y56A 2HDCA 4G6DA 3HKZA 1FBUA 1ZREA 4EEFG 2IS6A 1RIOH 4DIQA 3ERED 3PQJA 2PJRA 4PK4A 3Q9VA 2FD5A 3RZOJ 3HRMA 2BV6A 5CPRB 2HYJA 2QSHX 4S04A 3G1OA 3KLNA 5GPCA 2DA7A 4D7MA 2M2EA 2ZB9A 3KEQA 3PIPF 2R7UA 1MMAA 2HZTA 3S17J 2B7EA 4FE7A 3LFKA 4I6ZA 1IZ1A 3PSIA 2EPFA 2XPWA 3BQZA 4M3GA 1ZKGA 4XM3A 2BOLA 2JUCA 2NS8A 2NVUB 2H1KA 1H9GA 2QM3A 1OR7C 2D5VA 4A93J 3V8LA 4MO7A 3R6SA 2HQRA 2WAFA 1GV2A 5K7FA 2JSPA 2HZDA 1P7JA 1GHCA 2Y0SN 3CCUI 2JA2A 3GTGJ 2HI3A 5B5EC 4KUMA 1ZQ3P 1RZ4A 4HX4A 1I3AA 4KIBA 5FB2A 1IGNA 2R7SA 5FO5A 2VXZA 3IRQA 4U7DA 5EEAA 4I98B 3ZQFA 3HBLA 4I2OA 3DP7A 5L3FA 2L54A 2QENA 1XGMA 2ETHA 3U1KA 3LA7A 5FLVA 1W36D 1FY7A 3IUOA 1POGA 1Z67A 2CQKA 4M6XA 1QHHD 2LKXA 4BQAA 4IOCF 3WU2C 3RPUD 1HW1A 1I1SA 3JAMZ 1SD6A 2KDZA 3K4KA 3SZPA 5CVVA 1T6SA 3K70D 1T56A 1X1DA 4UUVA 5F0CA 4YFKF 2VJ5A 1QHGA 1HF0A 2M9HA 2R7FA 3W2AA 2FQ4A 5ERIA 4HF2A 3G71I 4M72A 3FISA 3RQ4A 1D1CA 5IYBJ 5E18F 1E0EA 2VUMJ 3P7NA 4U0VA 1F4KA 2DAOA 3HOVJ 2G7HA 3BJ6A 1ON2A 4B09A 2ZFWA 4WXDA 4RB3C 4IHTA 4PUSA 4GO1A 3CJTB 1XMAA 2Z1DA 1DPRA 1LFPA 2LRDA 4XL9A 1T8IA 4OIQF 5HODA 2CS3A 3CCJI 2XAJA 3GF2A 1WPKA 1WJFA 2X4HA 3KCCA 2GLOA 3LSTA 2FBHA 5E20A 3B6CA 3L7WA 4HDVA 1W0TA 1W5TA 2NNNA 4I99C 3DU5A 3LWFA 2DYSH 5EJCA 2XASA 3TL4X 1WZ2A 4KIFA 2PG4A 1MNEA 1WJEA 2HTJA 3F8FA 3NWSA 2W4SA 3P9KA 4H4KC 2NOGA 2JMWA 4MNUA 1QZYA 1UFMA 1Z3XA 3SQNA 2QKMB 2QZ8A 3FXJA 5KCMA 4MQVA 5E8GA 2IBDA 1YS6A 3MEXA 2EIJH 4ZTFA 3K69A 4U87A 2CFXA 1MBHA 1R5HA 2ZXHA 2HU9A 2BGCA 4EJWA 1B72A 3W6VA 3DCFA 2HS5A 3QU3A 2F5VA 2MLGA 4RLQA 1OMIA 4BL0B 3GWZA 3HSFA 3VFZA 1Z9CA 2EWNA 3K4BA 3RKXA 2IP2A 1SFOJ 3AG2H 4AYBN 2O8KA 3ABLH 1SFEA 3GXOA 2ME6A 1CF7B 2Y0MA 2EFPA 1FOYA 3O2PE 1ZARA 1ULYA 1Z77A 4HZFA 1LDKB 2JPCA 2RQQA 4XRMA 1T33A 1BIAA 1FP2A 1A31A 2GXBA 1BIBA 1ZTRA 2QWWA 3CF2A 4ZZDA 2OUMA 3BCBA 4HBLA 2DA1A 2RAEA 4UV9A 3ZMTA 4LLNA 3HOUJ 1Z1DA 5HLHA 2DN0A 3EDPA 3V7SA 1FSEA 2IGOA 4C2TA 3D5SC 5D6FA 1YYVA 1PVEA 1MH4A 2IW5A 4OIPF 3FBNB 3LQQA 4XKBA 3OSGA 3S1MJ 4EGZA 4BHBA 1LE8A 1T0FA 4AIKA 4HRIA 1OYWA 1IRZA 3DEWA 5D8KB 3B73A 1WRJA 4PJNA 1U8BA 1V4RA 5KNLA 2ADUA 1ZR2A 3GFJA 2OQRA 1T0FC 5LEJA 3WTXC 2KDOA 4EATA 1JI8A 3BR0A 3T8RA 2WV1A 3TW6A 3ZN1A 1UELB 5FLMJ 1BM9A 1X2MA 1XSXA 2HNHA 2Z9OA 5IT9K 1GVDA 2A05A 1R1TA 4NQWA 3B02A 4FETA 4NC6A 4BY7J 4E7SA 5GADJ 5DDGA 5D5UB 1U5TC 2CFOA 4ANJA 5B66C 3HGYA 3VPRA 2ZXIA 3S2WA 2YR2A 5AIQA 4CCJA 2X1EA 1IUYA 2WWYA 3KYLA 2GA1A 1FBQA 3IHUA 4KIGA 3TO7A 5J6XA 1ZAOA 5BQTA 2KJCA 3QYFA 1TQIA 2EZKA 5HS9A 5KAIC 1TNSA 3GTLJ 3FDYA 4F93B 2IGNA 3F8MA 1QPMA 2GBYA 3K1MA 4GGGA 2EQRA 2JZYA 4GYIA 3L1PA 2ZMEC 2CSOA 2MFZA 5EYRA 3M3YJ 1R58A 1F36A 3M4OJ 4HQMA 3HRSA 3VYTB 4A0YA 1XSVA 2B0LA 4CUGA 3FXLA 3IAM2 1MMGA 3K1PA 4LIUA 4M6VA 2ZKZA 4BU2A 1WH5A 1QZEA 2R0QC 4G12A 1EH7A 2BEOA 4J01A 5EZHA 5EZGA 4HF0A 3WGGA 4IHVA 4WXHA 2E1MC 1XS9A 2IA1A 4ZDLA 4GDFA 3A01A 3CDIA 1RUNA 4RAZA 4II3A 3FX3A 4DOZA 3QODA 5M3MJ 1GUUA 1ETXA 1KU9A 3CUQA 3HUGA 5D5WB 3M7GA 4E4HA 1SVLA 2DFHA 2L9SA 2E1MB 4HLXA 4RGUA 4BQOA 3WHBA 3OYAA 3O6BB 1BI0A 2XHKA 2HPIA 5FKOA 4A6DA 3BZ6A 2XROA 4GFBA 3MMYB 5LHHA 3OS1A 5GTHC 3GW2A 3A02A 2EBIA 3ZQIA 1LFUP 2L01A 2DK8A 2OD5A 2ZJPF 1WVRA 1FT9A 4DNCA 2H94A 5D4RA 4ITVA 2KZGA 2J5PA 4CYDA 3VEPA 3MZHA 4RLFA 2P6SA 2GM4A 4LMYA 1IG7A 3K9TA 2DA4A 1D8JA 4B3XA 1MBFA 4BJ5C 5L3GA 3A0BC 3O8GA 2DQRA 2STTA 3RKWA 2X48A 2LLKA 4L0YB 4C3IJ 2XB0X 2RC4A 2JSCA 2F5FA 1F5TA 1EF4A 4G6QA 4M71A 2F4OB 4K2EA 5TGTA 3VWBA 5BPIA 2E2JJ 3DEEA 2L7ZA 2M5WA 2BY0A 1EV7A 2MC3A 3K10A 4N4NB 1YX5A 4FE4A 3E6MA 3G1MA 2P6TA 1IN4A 2EIMH 4HV5A 1YRNB 2DXIA 4RS8A 2BW3B 2F4IA 3ERMA 2CH0A 1JKOC 1IV6A 4C2UA 3S1QJ 1X58A 1TWCJ 1ZLJA 5K5OA 3AFHA 1XMXA 3M8EA 2I8DA 3QQAA 3FZVA 3F9KA 1S7OA 4PJJA 2R5YB 3ZRGA 2XV4S 4I0AA 2RVCA 3GX4X 2BVLA 4CICA 4DJAA 4EJOA 5HVQC 3GFIA 2HR3A 3OIQA 4EQQA 5LGNA 4WCGA 2MABA 2EZIA 2NOJB 2CV2A 3IP4B 4B47A 1MBKA 2F6CA 4CCMA 2VKHA 3ULQB 2DW4A 2K85A 4PJLA 5ICEA 1STZA 4FX4A 2R7DA 1D8KA 3HB9A 3IC7A 1UJ8A 2O03A 2J5OA 3K70C 1I5ZA 2XRLA 4CYCB 1RRJA 2L9VA 2K02A 3E3VA 2VE9A 4BBRJ 3O8HA 3TDUC 4YFNF 1SVMA 1IDZA 3W2VA 2Y2ZA 4XNFA 2PMZN 5L3DA 2K3PA 4KISA 5HLTA 4ZC3A 2K9NA 4UVCA 1J2XA 2JK3A 1TL8A 4XK4A 4Q47A 1QGPA 2VBXA 1VQLI 1J75A 4A12A 2FNPA 3E5XA 3EYIA 2LY1A 3GZNB 2LKSA 1VNDA 3CUQB 2P5KA 4V19K 2NRAC 3FM5A 1JHHA 5ICFA 3WTUC 2VPRA 1USTA 3EYYA 4KMFA 1VQKI 5HNFA 2W84A 1R6RA 3VB2A 6PAXA 4QTRA 3TEDA 4R8HA 1MBJA 1E3OC 2ISZA 2IRFG 2DDBA 2V7FA 1ZG3A 5FKKA 3J7ZI 2CO5A 2DDAA 5FRMA 3FXUA 4A3DJ 3BG9A 3QU6A 4BUPA 5LD2C 1A6IA 3F23A 1K83J 2GAUA 1S72I 2B9SA 2DTZA 2YU3A 3DF8A 5FFXA 2PBIA 1U2WA 3S2HJ 4XQFA 2X51A 1D0ZA 2D1HA 2M4KA 3FKIJ 3V7CA 2GWRA 2CW0F 2DOEA 4WX9A 5KHDA 3C2BA 3OYIA 5FROA 1MSEC 1V55H 2F2EA 4XLNF 3MZYA 4DQ2A 2BXZA 3PNTA 2M30A 3BT9A 2VQCA 3ZXSA 2WAQN 2V26A 2E36A 2FE3A 4UV8A 4E7LA 5LHGA 1IRGA 4HG2A 3ZOBA 4IXAA 1UHWA 1U78A 5D4SA 3GTMJ 4AM3A 3TP3A 5KAFC 4IRGA 2I10A 3KP3A 3DEUA 2EA4A 4JP0A 4CCLA 2KJBA 5J8FA 1YIJI 2DMUA 4BHPA 2AXTC 1Q1VA 4XR6A 2LF8A 3IWFA 1VF9A 1WJAA 2DFFA 4XBFA 1RR8C 4BHCA 1G4DA 4HYEA 1OYIA 2RNGA 2A68F 1BJZA 2MH9A 1X2NA 4R1HA 1B8IA 2CMPA 3TW7A 2VB6A 1KU7A 3CUOA 3H5RA 3I64A 1R7JA 3TKYA 2R7QA 3J80K 1ZGJA 1P6RA 2VL8A 1YRNA 2WB1N 2QKLB 4QLCU 3ZCOA 3G3ZA 2DJIA 3I71A 1YJWI 1UMQA 3G1LA 3S3OA 2WADA 2JT1A 2E2IJ 1I39A 3F8BA 2OZUA 4XSZF 1PUFB 1WJCA 3JSOA 4NHJA 1RETA 3J81K 1WHUA 1BN5A 2CUFA 2KLOA 1WJDA 2E19A 3PM1A 1MW7A 1SFKA 1V3FA 1BI3A 4BDZA 1ONVA 3M1CA 3RTRA 2TCTA 2VJ4A 3CJNA 1VTNC 5A2QK 2R7WA 2PJRB 3C3WA 2UZKA 4E7JA 3UKGA 1DGWY 1Y39A 1UHMA 2Z5UA 3M9AA 4I0BA 3VSLA 3BY6A 4TV7A 1FP1D 3ONQA 5E1ZB 4EMSA 2HOSA 3WTSC 5GAGJ 2WBMA 4A3LJ 3MCZA 4KICA 3BROA 1R36A 1XGNA 3HPGA 5HS7A 3LSPA 3CCQI 1HDPA 3OY9A 4IJAA 4BJ6C 3PL8A 2ZFUA 2HKXA 4A0XA 1HKQA 2X85A 2FRHA 2G9WA 1PP8F 2JA7J 4ZDPA 1X4OA 3JTHA 2GIVA 4BEHB 3PO2J 3K0LA 2R93J 1S29A 5CYVA 1MGTA 1SD7A 4IQ4A 1WI9A 2IGKA 2VC1A 2BY2A 2EH3A 2QQ9A 4KNYA 1Z7UA 2KISA 4DZPA 1IF1A 1JUPA 3I56I 2LH9A 1JE8A 5J1RA 2O6GE 1LKXA 4II2A 2L2OA 1A04A 2VI6A 1HKSA 2KT0A 3BR5A 3V42A 2CV0A 5IYDJ 2IVMA 4G94A 1XCVA 4G6TB 5FKNA 1QU3A 2XGDA 4E7IA 1MDMB 4OOIA 2PQ8A 4JK1X 4FTHA 2M7AA 4I01A 3LSIA 1UHSA 3CZ6A 2HGCA 3KYDB 3DPUA 3TP0A 2LREA 1VQPI 2KIMA 2E5ZA 1QQIA 1U9OA 1ZRDA 3VOEA 4CYCA 2YX4A 1OFCX 2QQAA 3ZMVA 3DPTA 1B9MA 2L7FP 5ILSA 5ILUA 5GP9A 5HLIA 3PJRA 3OYNA 1D0XA 4PSXA 1A5JA 1DDNA 4YIFA 1RKWA 1UCRA 5IPAA 3F8CA 2O0YA 1T95A 3AG1H 3M07A 1WCMJ 3PO3J 5FLXK 1TZLA 4DW6A 3T0YA 5DS9A 2P4WA 4EM0B 2GXGA 2R7RA 3CMEI 3FMRA 4Q48A 3OYGA 1P4WA 3GTJJ 4LB5A 4XRSG 2MGQA 3DQVC 4P96A 2ME0A 2CWEA 3F8NA 1HSJA 1SVOA 3CP2A 5EDNA 3JREA 2XF7A 3JRHA 1VQ9I 2E35A 4IF4A 4ZJZA 2K4JA 2OU2A 5IYCJ 1ZRFA 1E3HA 4MGRA 1ZYRF 5E79C 1YTYA 3P9CA 4IQJA 1H0MA 2MH2A 2L9NA 2VT3A 5CVJA 2IS4A 3FK7A 1J9IA 1IUFA 2RNJA 4U0YA 2LMDA 3DPLC 3DTKA 2DFIA 1LB2A 4XICA 1LNWA 2K9LA 1B9NA 3OYEA 3I53A 1IDYA 5EEGA 1R23A 3H35A 2QBYB 4CDGA 4EM2A 4BE2A 1KA8A 2VQGA 1O3TA 1C0WA 1B4AA 5EGOA 3QYEA 2EZHA 2LBFA 1MNDA 4E7ZA 3JRAA 4CCKA 4CHUA 3HOXJ 2ICWG 1LVAA 3LSHA 4D5FA 3OYMA 1YHQI 3FF5A 1G3SA 4UVBA 1VFCA 2XGEA 5M5XJ 5JVGF 4G7ZF 4ESBA 2ZMEA 1TLHB 1BR2A 1GXQA 3E5QA 5J4YA 2E1CA 2XIGA 1YITI 3OYBA 5F04A 2ECBA 2CV1A 3WTVC 2HWVA 1R4MB 4BQNA 2E2HJ 4HDUA 1J59A 1VQNI 3I3LA 1JUSA 4LOCA 1H8AC 1XN7A 3RZDJ 4Z2YA 2PMUA 1SAUA 2E1NA 2FF4A 2K9SA 2M8GX 4RB0A 3VYSB 4RGXA 3OR2C 4YG2F 3PFYA 3ZGKA 2ID3A 1LDJA 3C2HA 1JHFA 3LQRA 1HW5A 2R5YA 4WF2A 3QRFF 4E7KA 2UV1A 1AA7A 2KIUA 3H5AA 2WV0A 2HOAA 2PFBA 4F92B 3ROUA 4ESFA 2X6XA 2XAFA 1Z7LA 1NG6A 2OCEA 2ZNZA 3I58A 5J1YA 3S1RJ 3SFIA 9ANTA 4ON0A 4KDPA 2DLLA 1XG1A 2RDPA 3REOA 3KIOA 1TTYA 4MTEA 2V1XA 2ZMEB 2VC0A 3EUHA 1UAAA 2AS5F 4N0BA 2UXNA 3HTUA 4I02A 3OS2A 3RYRA 1ETOA 5K5QA 3J7AO 4IVNA 3TO6A 1WJBA 2QVOA 4G9YA 4IL6C 1OQYA 1MBGA 3KLOA 2EA2A 4AVPA 1K4TA 1PUFA 4OIOF 1OCTC 2H6BA 4LLLA 1ETWA 2R3SA 3NWTA 1YIOA 2H8WA 5FRNA 3OS0A 1FWZA 3BR6A 3E7LA 4OAYA 3BQYA 4Y33A 1Q1HA 4HSTA 3CJRB 1P7IA 1LQ1A 5CKTA 3BTIA 2E34A 2LOOA 2DT6A 2MG4A 4P55A 4V2FA 2VOPA 2M7BA 2EV5A 2UUZA 5LRRA 5CJ9A 2L7MP 3IH4A 1D0YA 1O4XA 5IOZA 2ZO4A 2PJPA 1WWXA 2IAIA 3QAHA 2EFWA 2HDWA 1OISA 3OL3A 5F64A 4HNUA 2DMNA 1IRFA 2RGVA 2HVRA 4JQFA 2RV8A 2H8RA 4AYBA 4XIDA 3CTAA 3F72A 3DLLF 5H6RA 1XDSA 3TQNA 2HXOA 1J09A 4HSRA 1ETVA 1O7FA 1EJ9A 4LGWA 3KEYA 4XRFA 3DKYA 3IKTA 2XAUA 2K4BA 3PNVA 3L2RA 3E6DA 1K6OA 4A5MA 1R71A 1G3TA 1K78B 2BHYA 3OWTA 1XGOA 3HSRA 3WU1B 1FYLA 5CQEA 1FLIA 2F4MB 2XKOA 3J80Z 3MVPA 2LTPA 3EQLF 1XDUA 4X0GA 2JPBA 3A0HC 2EV6A 1FOKA 3KYCB 3T8TA 3U21A 3LFUA 5TRDA 1Z0XA 1DQUA 5E3NA 2KL4A 3H9GA 1O3QA 3S2DJ 2LFBA 1MMSA 1SMTA 3KX2A 1FIAA 5J1UA 1S5LC 2Y75A 5E3MA 2HVQA 4I7HA 2IPQX 3GTKJ 1TT0A 1H88C 2EJRA 4UUSB 3JR9A 3J81Z 3GZ6A 4NUBA 1XB4A 1YW9A 1V5FA 3G2BA 1A6QA 3W6KB 2Y30A 4C3JJ 3I4PA 2DOAA 1P9QC 2K3FA 3B6AA 3JRDA 1MBEA 2E71A 1KYZA 3CUQC 5AONA 1ETYA 5FLXZ 5FFZA 1IO2A 5LEKA 3GYHX 2BE5F 1WFXA 3V4GA 5EG0A 4D0PA 4CGZA 2NVYJ 2R7OA 4IHSA 3M8FA 1BR4A 1TW3A 2BBYA 4XLFA 2LNBA 3MKLA 1T2KA 1BC7C 2DPDA 3HPHA 2VXDA 2DCEA 1Z6RA 2WA0A 3WGHA 4E6KG 3CMMA 3K7AJ 4CA0A 3WODF 2X1CA 4XKVA 3CCYA 3DFGA 1CGPA 4BDYA 2Q2EB 4OAZA 1KU2A 4XLEA 5LGUA 4RGSA 4XOPA 3CESA 3DXJF 4YEJA 2COMA 3I4MJ 2PN6A 5KK1A 1K78A 5C44J 4YFXF 3ML6A 2NS0A 2KFDA 2ACJA 1XMKA 1KGSA 1IV8A 5JI6A 3MWMA 4DBQA 2K27A 1PJRA 3NAUA 1HSTA 2RN7A 2FA5A 3K2ZA 3LSGA 2K86A 2DK5A 2EK5A 4MFEA 2XGXA 3R0JA 2DPUA 1YW7A 1JTYA 4UUSA 4LK0F 4XLHA 4CZZA 4LITA 4ENKA 1U5TA 3K4CA 4L9TA 3LMMA 4IHWA 2W82A 3H0DA 2AQEA 4W97A 5IP7J 1EH6A 1MJAA 1D5YA 4RA2A 4A69C 2V1DA 5E1XA 4HNVA 1RNLA 5HNHA 3Q5FA 1SANA 3BPVA 4P9FA 1MJBA 1TNTA 4QPOA 4M3DA 3L2QA 4MQ9F 1JJ6C 2IA0A 1MKMA 1GT0C 2JJ7A 1MMDA 3E0JB 3QOEA 1GLNA 5EGOB 1DGRM 2H6CA 2Y69H 4OWRB 3HTSB 2NVQJ 2QLZA 3QPTA 4L9NA 1JKQC 3KZYA 1WGXA 2E7WA 3AAFA 1Y8QB 2BXYA 5DD4A 2X6OA 5IT9Z 2A69F 2XF5A 3JRIA 5D5VB 4XMYA 1W7PA 4ABZA 2R5ZA 1XC5A 2V79A 3A1YA 3WE3A 4ZDOA 3F22A 4FX0A 3DKWA 5CVRA 1SD4A 3TMOA 4IKFA 4A3FJ 1XTAA 2ZXJA 1FJLA 3ABUA 1J5YA 2DA5A 2PX9A 4YELA 3H92A 2HYGD 1W5CC 1W1WE 3HL2A 2MD5A 4RAGA 4B8XA 1LUJB 4L5IA 5HDKA 3L2VA 3JCUC 3EUKL 4JBAA 4U0WA 2D1VA 3LSJA 4KYWA 2M0MA 1DP3A 1RI7A 1PYVA 2M87A 5BNGA 2L02A 2X0LA 2JRTA 4LIVA 5IY5H 3OMYA 1BA5A 1MSFC 2G0EA 2OBPA 4A3JJ 4RM2A 2P7CB 1VQ6I 1WJ5A 2R4GA 5E17F 4L5JA 4FHTA 2EFNA 3E5UA 4I09A 2E60A 1R1VA 2L7KA 2H1LA 1I27A 3DBRB 2ELKA 2QQBA 4QSHA 3JSPA 2BY1A 3WTTC 5CVIA 4M9SA 4OU0A 3LSRA 2HXIA 5DTDA 2FBIA 4BAYA 2HVSA 4U7BA 4XRSA 3CC2I 2O61A 3BR3A 3H1CA 5ED4A 1R00A 4IPAA 2PI0A 2KRCA 4OMYA 1I1GA 1LFBA 5IT3A 2QBYA 1U0JA 2A3SA 4IRIA 5TJJA 2KHMA 2ZSHB 1S9HA 4AD9A 2JA8J 5AIPA 2MSYA 3HZJA 5J40A 3GMEA 5EEHA 2VPLA 3DV8A 1D3YA 3BG7A 3C2GA 4PFOA 2ECCA 2OF7A 4P9UA 5HDNA 3P9IA 1ENHA 5E1WA 4A3BJ 4BNCA 5B3SH 1YOVB 1YFHA 4C30A 2TDXA 5BS6A 2JRMA 4HNTA 3FHZA 3C18A 4ZYDA 1R4NB 3HG9A 3OOPA 4S0HB 1HQCA 2WY8Q 2ZC2A 2ZNYA 5KVRA 3CCVI 3HDDA 4AIJA 2FNAA 1VQ7I 1IAWA 4IEJA 2CW7A 1KYWA 3FXQA 3M1EA 2GOMA 3HUGB 1Y0NA 3I59B 2Q2EA 2DI3A 4B1RA 3HRUA 3HKZN 3J7AY 4C3HJ 4A3CJ 4DZJA 1HXDA 2Q0OA 4ZYAA 2ESHA 1WQ2A 3QPLA 4HX8A 4EM1A 2WAQA 5LGTA 2P5VA 2V1NA 4XLAA 1HCRA 4RDUA 1TT5B 5ICGA 4IO9F 2JTVA 4UB6C 2UXXA 5IP6A 5F27A 3DTEA 3FXMA 3FBIB 4MFDA 1OR7A 3LAPA 1NK3P 1K6YA 2NVTJ 3Q0UA 4C2MJ 1KQ0A 1ZHFA 4L0ZB 1VQ8I 1D1AA 2KIQA 2OTLI 3Q0WA 4BJTA 3N97A 4J19A 2N8GA 3T5XA 4GYGA 3SFZA 4Y13A 2K7LA 4BKXA 2VONA 1A35A 4LG0B 4RB1A 2VBWA 4D1QA 3JRFA 3S1NJ 2OC6A 2V4JC 1OKRA 4J00A 1ITYA 2AO9A 2KMUA 2VIXA 4DBRA 3KFWX 4ESJA 3S8PA 3EUAA 5EG0B 2FX0A 4KJZA 5DD8A 3RJPA 3GTOJ 3BC8A 2X6WA 5FGMA 1L0OC 4YIRX 2QQ8A 3NEUA 2V1UA 2XUBA 2LK2A 4BYYA 4IHXA 2JQ7A 4F52A 1IRXA 1YE9A 3U9GA 4QWQA 2HOTA 4NQWB 3VDXA 2PMZA 3BG6A 1K61A 3K4NA 2R5ZB 4AIDA 2OJED 3CO7C 3GTPJ 1V5GA 1TP4A
chains in the Genus database with same CATH topology
2ECBA 2EZKA 5J3LA 5JLXA 2E2HJ 1I6HJ 4JX4A 3GTLJ 1JUSA 4LOCA 2GBYA 1H8AC 5JLWA 3L1PA 2EQRA 3RZDJ 1ZR4A 1LE8B 2VKVA 1APLC 2K9SA 2M8GX 3CDLA 5EYRA 3M3YJ 1FTTA 4A3KJ 2ID3A 1F36A 2B63J 3M4OJ 2LP0A 4DYRA 4QIWN 3A01B 5FKMA 4RBOA 1JT0A 1HDDC 3S14J 4M6VA 2ID6A 3OOUA 1WH5A 2R5YA 3NARA 2R0QC 2E1OA 2HOAA 2LR8A 4G12A 4BXXJ 5EZHA 5EZGA 4IHVA 5J1YA 3S1RJ 3SFIA 1XS9A 9ANTA 1XG1A 3HGGA 4A3MJ 3A01A 1QVUA 5K7HA 4FISA 1GUUA 1ETXA 2MW8A 1ETOA 5M3MJ 2O7OA 1W0UA 1QRYA 3JRGA 3WHBA 1G2HA 1MBGA 1PUFA 1OCTC 2VKEA 1ETWA 1TWAJ 3RQIA 3HOWJ 4GFBA 5FKOA 5E3OA 4L5EA 3A02A 3BR6A 3E7LA 2EBIA 3ZQIA 2YUSA 3BQYA 1LFUP 3HOZJ 5M5WJ 1P7IA 3BTIA 1UG2A 2MG4A 2QCOA 4D7NA 4V2FA 4BY1J 4M3EA 2GM4A 1IG7A 2JA5J 3BTJA 1FEXA 2DA4A 2L7MP 1Y1VJ 3IH4A 1MBFA 2JN6A 1O4XA 1NK2P 1MNMC 3O8GA 5IOZA 3GTQJ 2IAIA 2X48A 2LLKA 2DMNA 2OPTA 4C3IJ 3WHCA 1BW6A 2H8RA 1FTZA 2XB0X 5F1JA 1EF4A 1U9NA 4XIDA 4JX6A 3HOYJ 3S15J 2HXOA 1NTCA 1ETKA 2E2JJ 1TC3C 2L7ZA 1H89C 2YS9A 1GV5A 1ETVA 4FE4A 3SJMA 1VI0A 3G1MA 1GDTA 5M3FJ 4JX5A 1YRNB 3CQZJ 3BG5A 3HM5A 2Y9ZA 3I4NJ 1RESA 3OSFA 1JKOC 1IV6A 3S1QJ 1X58A 1TWCJ 2DMQA 5IOYA 3QQAA 2DJNA 1IJWC 2R5YB 3ZQHA 1AKHA 3MVPA 2LVSA 2LTPA 2EZIA 3FK6A 1MBKA 5F0HA 1HOMA 2CU7A 4M3BA 1JTXA 2CJJA 1Z0XA 5E3NA 1JKPC 2DMPA 5GPAA 4UUTA 4A3IJ 4FCYA 2LFBA 3S2DJ 3FIWA 4M3FA 1FIAA 5J1UA 3BTCA 4NDLA 5E3MA 3HB9A 3ZQCA 1DU0A 3LOCA 3Q3SA 3GTKJ 1H88C 2K9QA 4UUSB 3JR9A 2XRLA 5IP9J 2AHQA 4CYCB 4BBSJ 2XB5A 4BBRJ 2COBA 2Y30A 3O8HA 4MIMA 4C3JJ 3QPSA 1RPWA 2K40A 5F08A 1IDZA 3B6AA 3JRDA 1MBEA 2EZLA 1IC8A 2Y2ZA 2PMZN 1ETYA 2L9RA 2R7ZJ 2K9NA 2XSDC 2JK3A 2XGCA 5EG0A 2DA6A 1AHDP 4XK4A 2NVYJ 2JA6J 1VNDA 1JT6A 2DA2A 1S7EA 2VPRA 3MKLA 2L0KA 4DYCA 1WI3A 1I50J 3K2AA 3JRBA 3OIOA 2HQ5A 4QTRA 1JJ8C 3IH3A 3K7AJ 1JUMA 3TEDA 1MBJA 2XPVA 4MLOA 1E3OC 3CCYA 2NS7A 3HEFA 4X1EA 4AC0A 3BR1A 2W48A 5FKKA 4A3DJ 1OCPA 3BG9A 1A6IA 1K83J 1TWFJ 3I4MJ 2DTZA 4DYQA 1OJLA 5C44J 1BL0A 2NVXJ 1ZGWA 1F43A 3S2HJ 3BR2A 1ETQA 4V2GA 1I3QJ 2TRTA 1BW5A 4A3EJ 3FKIJ 2R92J 3NAUA 3C2BA 1MSEC 3LSGA 1MH3A 3BT9A 4MFEA 2WAQN 1RR7A 1JTYA 1FIPA 4UUSA 3ZOBA 2Y31A 4B4CA 1TWHJ 4IHWA 1U78A 3GTMJ 1R9TJ 4A3GJ 3TP3A 4W97A 5C3EJ 2I10A 5IP7J 1D5YA 3A03A 4JP0A 4A69C 4EEFG 4Y52J 4HNVA 3RZOJ 1SANA 2DMUA 4D5CA 4M3DA 1JJ6C 1Q1VA 2FD5A 1GT0C 1ZK8A 2JJ7A 1VF9A 2HYJA 5EGOB 2NVQJ 2CQXA 3G1OA 5GPCA 2DA7A 1BJZA 4D7MA 2M2EA 2ZB9A 1JKQC 1X2NA 2FJ1A 1B8IA 1WGXA 3TW7A 4I76A 2DA3A 3S17J 2X6OA 3MN2A 4FE7A 3JRIA 4I6ZA 1CQTA 4ABZA 2XPWA 4M3GA 3BQZA 2R5ZA 1YRNA 1XC5A 2WB1N 1ZKGA 3CMYA 2NS8A 2H1KA 2D5VA 4A93J 4AUXA 4MO7A 1UMQA 3BTLA 2P81A 3G1LA 3H3VK 3SDGA 4A3FJ 1GV2A 5K7FA 2E2IJ 1FJLA 1P7JA 3H0GJ 2LY9A 1DU6A 2Y0SN 1RKTA 2YU9J 2DA5A 1AKHB 3GTGJ 2HI3A 1ZQ3P 5C4JJ 1PUFB 1RETA 3IH2A 1JKRC 1IGNA 2CUFA 2E19A 3PM1A 4X6AJ 5EEAA 3ZQFA 3HBLA 4W1UA 3LSJA 2TCTA 5K7ZA 5FLVA 1QVTA 4Y7NJ 1POGA 5FKLA 3UKGA 2LKXA 5BNGA 2KDZA 2HOSA 1BA5A 1MSFC 2G0EA 2LD5A 4A3JJ 4JYKA 5EF6A 4A3LJ 1T56A 2CUEA 3LSPA 1HDPA 5F0CA 4B3AA 1HF0A 2M9HA 2XPUA 1B72B 2FQ4A 2JA7J 3FISA 5IYBJ 2VUMJ 3PO2J 2R93J 3HOVJ 1QPIA 3IV5A 3ZQLA 2ELKA 4QSHA 3LNQA 2M34A 3LSRA 2HXIA 5DTDA 5HODA 2EH3A 1WPKA 5E3LA 4DZPA 4XRSA 3ZQGA 3BR3A 2GLOA 1JUPA 3B6CA 1LFBA 5J1RA 1W0TA 2VI6A 2JA8J 2KT0A 3BR5A 2MSYA 3BG3A 5C4XJ 5IYDJ 1B8IB 3Q0VA 5FKNA 2XGDA 2ECCA 2OF7A 2NOGA 2JMWA 2HDDA 1ENHA 4FTHA 4A3BJ 1UHSA 1JGGA 2IBDA 3TP0A 2CQQA 4S0HB 1MBHA 1U9OA 3HDDA 1B72A 4CYCA 3W6VA 1OFCX 2CRGA 2DMTA 4IEJA 3DCFA 2IEKA 2L7FP 2QF7A 5GP9A 1A5JA 4B1RA 3HKZN 1RKWA 2X9DA 4C3HJ 1SFOJ 5F0FA 4DZJA 4A3CJ 4AYBN 5IPAA 2M0CA 2O8KA 3QPLA 1WCMJ 2ME6A 2O9LA 1HCRA 4RDUA 3PO3J 4DW6A 1Z77A 5DS9A 5IP6A 1T33A 5F27A 4XRMA 4IHYA 3RKQA 1ZTRA 3GTJJ 4MFDA 4XRSG 2DA1A 2MGQA 2RAEA 3HOUJ 2ME0A 3JRHA 3JREA 5EDNA 1NK3P 1TWGJ 2DN0A 2NVTJ 3Q0UA 4C2MJ 5IYCJ 1Y1WJ 1MH4A 3Q0WA 4J19A 2N8GA 3OSGA 3S1MJ 1AU7A 3FK7A 3S16J 1WH7A 1LE8A 1IRZA 3JRCA 1IUFA 3DEWA 4BKXA 5FJ8J 1U8BA 1HLVA 4XICA 3JRFA 3S1NJ 1ZR2A 1IDYA 1ITYA 3BR0A 3TW6A 2AO9A 2WV1A 5FLMJ 1X2MA 3F0CA 5EG0B 2FX0A 5EGOA 3GTOJ 1GVDA 2EZHA 3D1NI 3JRAA 4BY7J 3HOXJ 2LK2A 4D5FA 1VFCA 4IHXA 2Y9YA 2JWTA 3GBGA 3HGYA 1ORKA 2XGEA 3VPRA 5M5XJ 2HOTA 5M5YJ 1K61A 2R5ZB 3GTPJ 5F04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECB A;  2EZK A;  5J3L A;  5JLX A;  2E2H J;  1I6H J;  4JX4 A;  3GTL J;  1JUS A;  4LOC A;  2GBY A;  1H8A C;  5JLW A;  3L1P A;  2EQR A;  3RZD J;  1ZR4 A;  1LE8 B;  2VKV A;  1APL C;  2K9S A;  2M8G X;  3CDL A;  5EYR A;  3M3Y J;  1FTT A;  4A3K J;  2ID3 A;  1F36 A;  2B63 J;  3M4O J;  2LP0 A;  4DYR A;  4QIW N;  3A01 B;  5FKM A;  4RBO A;  1JT0 A;  1HDD C;  3S14 J;  4M6V A;  2ID6 A;  3OOU A;  1WH5 A;  2R5Y A;  3NAR A;  2R0Q C;  2E1O A;  2HOA A;  2LR8 A;  4G12 A;  4BXX J;  5EZH A;  5EZG A;  4IHV A;  5J1Y A;  3S1R J;  3SFI A;  1XS9 A;  9ANT A;  1XG1 A;  3HGG A;  4A3M J;  3A01 A;  1QVU A;  5K7H A;  4FIS A;  1GUU A;  1ETX A;  2MW8 A;  1ETO A;  5M3M J;  2O7O A;  1W0U A;  1QRY A;  3JRG A;  3WHB A;  1G2H A;  1MBG A;  1PUF A;  1OCT C;  2VKE A;  1ETW A;  1TWA J;  3RQI A;  3HOW J;  4GFB A;  5FKO A;  5E3O A;  4L5E A;  3A02 A;  3BR6 A;  3E7L A;  2EBI A;  3ZQI A;  2YUS A;  3BQY A;  1LFU P;  3HOZ J;  5M5W J;  1P7I A;  3BTI A;  1UG2 A;  2MG4 A;  2QCO A;  4D7N A;  4V2F A;  4BY1 J;  4M3E A;  2GM4 A;  1IG7 A;  2JA5 J;  3BTJ A;  1FEX A;  2DA4 A;  2L7M P;  1Y1V J;  3IH4 A;  1MBF A;  2JN6 A;  1O4X A;  1NK2 P;  1MNM C;  3O8G A;  5IOZ A;  3GTQ J;  2IAI A;  2X48 A;  2LLK A;  2DMN A;  2OPT A;  4C3I J;  3WHC A;  1BW6 A;  2H8R A;  1FTZ A;  2XB0 X;  5F1J A;  1EF4 A;  1U9N A;  4XID A;  4JX6 A;  3HOY J;  3S15 J;  2HXO A;  1NTC A;  1ETK A;  2E2J J;  1TC3 C;  2L7Z A;  1H89 C;  2YS9 A;  1GV5 A;  1ETV A;  4FE4 A;  3SJM A;  1VI0 A;  3G1M A;  1GDT A;  5M3F J;  4JX5 A;  1YRN B;  3CQZ J;  3BG5 A;  3HM5 A;  2Y9Z A;  3I4N J;  1RES A;  3OSF A;  1JKO C;  1IV6 A;  3S1Q J;  1X58 A;  1TWC J;  2DMQ A;  5IOY A;  3QQA A;  2DJN A;  1IJW C;  2R5Y B;  3ZQH A;  1AKH A;  3MVP A;  2LVS A;  2LTP A;  2EZI A;  3FK6 A;  1MBK A;  5F0H A;  1HOM A;  2CU7 A;  4M3B A;  1JTX A;  2CJJ A;  1Z0X A;  5E3N A;  1JKP C;  2DMP A;  5GPA A;  4UUT A;  4A3I J;  4FCY A;  2LFB A;  3S2D J;  3FIW A;  4M3F A;  1FIA A;  5J1U A;  3BTC A;  4NDL A;  5E3M A;  3HB9 A;  3ZQC A;  1DU0 A;  3LOC A;  3Q3S A;  3GTK J;  1H88 C;  2K9Q A;  4UUS B;  3JR9 A;  2XRL A;  5IP9 J;  2AHQ A;  4CYC B;  4BBS J;  2XB5 A;  4BBR J;  2COB A;  2Y30 A;  3O8H A;  4MIM A;  4C3J J;  3QPS A;  1RPW A;  2K40 A;  5F08 A;  1IDZ A;  3B6A A;  3JRD A;  1MBE A;  2EZL A;  1IC8 A;  2Y2Z A;  2PMZ N;  1ETY A;  2L9R A;  2R7Z J;  2K9N A;  2XSD C;  2JK3 A;  2XGC A;  5EG0 A;  2DA6 A;  1AHD P;  4XK4 A;  2NVY J;  2JA6 J;  1VND A;  1JT6 A;  2DA2 A;  1S7E A;  2VPR A;  3MKL A;  2L0K A;  4DYC A;  1WI3 A;  1I50 J;  3K2A A;  3JRB A;  3OIO A;  2HQ5 A;  4QTR A;  1JJ8 C;  3IH3 A;  3K7A J;  1JUM A;  3TED A;  1MBJ A;  2XPV A;  4MLO A;  1E3O C;  3CCY A;  2NS7 A;  3HEF A;  4X1E A;  4AC0 A;  3BR1 A;  2W48 A;  5FKK A;  4A3D J;  1OCP A;  3BG9 A;  1A6I A;  1K83 J;  1TWF J;  3I4M J;  2DTZ A;  4DYQ A;  1OJL A;  5C44 J;  1BL0 A;  2NVX J;  1ZGW A;  1F43 A;  3S2H J;  3BR2 A;  1ETQ A;  4V2G A;  1I3Q J;  2TRT A;  1BW5 A;  4A3E J;  3FKI J;  2R92 J;  3NAU A;  3C2B A;  1MSE C;  3LSG A;  1MH3 A;  3BT9 A;  4MFE A;  2WAQ N;  1RR7 A;  1JTY A;  1FIP A;  4UUS A;  3ZOB A;  2Y31 A;  4B4C A;  1TWH J;  4IHW A;  1U78 A;  3GTM J;  1R9T J;  4A3G J;  3TP3 A;  4W97 A;  5C3E J;  2I10 A;  5IP7 J;  1D5Y A;  3A03 A;  4JP0 A;  4A69 C;  4EEF G;  4Y52 J;  4HNV A;  3RZO J;  1SAN A;  2DMU A;  4D5C A;  4M3D A;  1JJ6 C;  1Q1V A;  2FD5 A;  1GT0 C;  1ZK8 A;  2JJ7 A;  1VF9 A;  2HYJ A;  5EGO B;  2NVQ J;  2CQX A;  3G1O A;  5GPC A;  2DA7 A;  1BJZ A;  4D7M A;  2M2E A;  2ZB9 A;  1JKQ C;  1X2N A;  2FJ1 A;  1B8I A;  1WGX A;  3TW7 A;  4I76 A;  2DA3 A;  3S17 J;  2X6O A;  3MN2 A;  4FE7 A;  3JRI A;  4I6Z A;  1CQT A;  4ABZ A;  2XPW A;  4M3G A;  3BQZ A;  2R5Z A;  1YRN A;  1XC5 A;  2WB1 N;  1ZKG A;  3CMY A;  2NS8 A;  2H1K A;  2D5V A;  4A93 J;  4AUX A;  4MO7 A;  1UMQ A;  3BTL A;  2P81 A;  3G1L A;  3H3V K;  3SDG A;  4A3F J;  1GV2 A;  5K7F A;  2E2I J;  1FJL A;  1P7J A;  3H0G J;  2LY9 A;  1DU6 A;  2Y0S N;  1RKT A;  2YU9 J;  2DA5 A;  1AKH B;  3GTG J;  2HI3 A;  1ZQ3 P;  5C4J J;  1PUF B;  1RET A;  3IH2 A;  1JKR C;  1IGN A;  2CUF A;  2E19 A;  3PM1 A;  4X6A J;  5EEA A;  3ZQF A;  3HBL A;  4W1U A;  3LSJ A;  2TCT A;  5K7Z A;  5FLV A;  1QVT A;  4Y7N J;  1POG A;  5FKL A;  3UKG A;  2LKX A;  5BNG A;  2KDZ A;  2HOS A;  1BA5 A;  1MSF C;  2G0E A;  2LD5 A;  4A3J J;  4JYK A;  5EF6 A;  4A3L J;  1T56 A;  2CUE A;  3LSP A;  1HDP A;  5F0C A;  4B3A A;  1HF0 A;  2M9H A;  2XPU A;  1B72 B;  2FQ4 A;  2JA7 J;  3FIS A;  5IYB J;  2VUM J;  3PO2 J;  2R93 J;  3HOV J;  1QPI A;  3IV5 A;  3ZQL A;  2ELK A;  4QSH A;  3LNQ A;  2M34 A;  3LSR A;  2HXI A;  5DTD A;  5HOD A;  2EH3 A;  1WPK A;  5E3L A;  4DZP A;  4XRS A;  3ZQG A;  3BR3 A;  2GLO A;  1JUP A;  3B6C A;  1LFB A;  5J1R A;  1W0T A;  2VI6 A;  2JA8 J;  2KT0 A;  3BR5 A;  2MSY A;  3BG3 A;  5C4X J;  5IYD J;  1B8I B;  3Q0V A;  5FKN A;  2XGD A;  2ECC A;  2OF7 A;  2NOG A;  2JMW A;  2HDD A;  1ENH A;  4FTH A;  4A3B J;  1UHS A;  1JGG A;  2IBD A;  3TP0 A;  2CQQ A;  4S0H B;  1MBH A;  1U9O A;  3HDD A;  1B72 A;  4CYC A;  3W6V A;  1OFC X;  2CRG A;  2DMT A;  4IEJ A;  3DCF A;  2IEK A;  2L7F P;  2QF7 A;  5GP9 A;  1A5J A;  4B1R A;  3HKZ N;  1RKW A;  2X9D A;  4C3H J;  1SFO J;  5F0F A;  4DZJ A;  4A3C J;  4AYB N;  5IPA A;  2M0C A;  2O8K A;  3QPL A;  1WCM J;  2ME6 A;  2O9L A;  1HCR A;  4RDU A;  3PO3 J;  4DW6 A;  1Z77 A;  5DS9 A;  5IP6 A;  1T33 A;  5F27 A;  4XRM A;  4IHY A;  3RKQ A;  1ZTR A;  3GTJ J;  4MFD A;  4XRS G;  2DA1 A;  2MGQ A;  2RAE A;  3HOU J;  2ME0 A;  3JRH A;  3JRE A;  5EDN A;  1NK3 P;  1TWG J;  2DN0 A;  2NVT J;  3Q0U A;  4C2M J;  5IYC J;  1Y1W J;  1MH4 A;  3Q0W A;  4J19 A;  2N8G A;  3OSG A;  3S1M J;  1AU7 A;  3FK7 A;  3S16 J;  1WH7 A;  1LE8 A;  1IRZ A;  3JRC A;  1IUF A;  3DEW A;  4BKX A;  5FJ8 J;  1U8B A;  1HLV A;  4XIC A;  3JRF A;  3S1N J;  1ZR2 A;  1IDY A;  1ITY A;  3BR0 A;  3TW6 A;  2AO9 A;  2WV1 A;  5FLM J;  1X2M A;  3F0C A;  5EG0 B;  2FX0 A;  5EGO A;  3GTO J;  1GVD A;  2EZH A;  3D1N I;  3JRA A;  4BY7 J;  3HOX J;  2LK2 A;  4D5F A;  1VFC A;  4IHX A;  2Y9Y A;  2JWT A;  3GBG A;  3HGY A;  1ORK A;  2XGE A;  3VPR A;  5M5X J;  2HOT A;  5M5Y J;  1K61 A;  2R5Z B;  3GTP J;  5F04 A; 
#chains in the Genus database with same CATH topology
 2MD0 A;  2HFH A;  1IN8 A;  3LA2 A;  1N78 A;  3HRT A;  3GLX A;  4XKW A;  1VQ4 I;  1BOB A;  4XKC A;  1X3U A;  5GTI C;  2Z33 A;  5JLW A;  1LE8 B;  3GEZ A;  1APL C;  3RCO A;  2H09 A;  2EFQ A;  3HYI A;  3I5U A;  2A6E F;  1FTT A;  1KQ9 A;  3M8J A;  3OYC A;  2YSR A;  4IX7 A;  1BI1 A;  5DCM A;  4QIW N;  1W36 C;  2XAG A;  3ELK A;  1PP7 U;  1JT0 A;  5DM6 F;  2W25 A;  5L3B A;  1HDD C;  1MDM A;  3DKX A;  3OOU A;  1V5E A;  2HYF A;  5FD5 A;  3S32 A;  3W3C A;  1OPC A;  3NAR A;  4EVI A;  1U5T B;  2E1O A;  3VYR B;  3I9V 2;  1DPU A;  2WB1 A;  2A07 F;  4U88 A;  2ISY A;  1VQM I;  2F5D A;  5DCF A;  4F55 A;  1LVK A;  2GXA A;  3HGG A;  4A3M J;  2IXS A;  1Y8R B;  4BH9 A;  2MBF A;  4CO8 A;  1E3P A;  3BZK A;  2LG4 A;  3TDZ C;  2FOK A;  4PJ0 C;  3I0T A;  3N4M A;  3GLL A;  1FPQ A;  4GXO A;  2O7O A;  3H3U A;  5BMZ A;  2FOW A;  1SMY F;  1QRY A;  2OV7 A;  2D2W A;  4N9H A;  5HLG A;  3JRG A;  3D0S A;  4M9X A;  1W0U A;  1FYM A;  1G2H A;  1BI2 A;  5F1R A;  3FXO A;  1HKT A;  3RQI A;  3HOW J;  1F9N A;  4AIH A;  1IXR C;  4L5E A;  3PFI A;  4HX7 A;  2YUS A;  4KT6 A;  4R79 A;  1MD0 A;  3I55 I;  3E1S A;  4D7N A;  4G7H F;  3HIF A;  1MZB A;  2WAE A;  4XOR A;  1SEU A;  4BY1 J;  2XDV A;  2CQN A;  4M3E A;  3OYJ A;  1UG0 A;  3TO9 A;  3J7Y J;  3BTJ A;  2CUJ A;  3FHN A;  4D9J A;  1SC7 A;  3PUF A;  1Y1V J;  3K4L A;  2JN6 A;  2IA2 A;  2L3D A;  4XON A;  3JAM K;  3FXR A;  3LAJ A;  1J7K A;  2HOE A;  2M3A A;  4UVA A;  1S6L A;  3WHC A;  3HXL A;  1XD7 A;  3KPH A;  3NQO A;  3I54 A;  3SDB A;  5F1J A;  3KZI C;  3S15 J;  4MEX F;  3WTZ A;  2VJJ A;  1NTC A;  2XAQ A;  1TC3 C;  4EV0 A;  2YS9 A;  2O3F A;  1GV5 A;  4KN7 X;  3SJM A;  4ZH4 F;  1VI0 A;  4WXC A;  4YRV A;  3IL2 A;  4QPQ A;  1BC8 C;  1GDT A;  3HOT A;  4JX5 A;  5DYM A;  3CQZ J;  3BG5 A;  3HM5 A;  1T38 A;  3D5L A;  3LL7 A;  1UB9 A;  4LD5 A;  5DUI A;  1U3E M;  2KP6 A;  2RRE A;  2DMQ A;  3EET A;  4Z6Y A;  2DJN A;  3HJE A;  2A5Y B;  2M45 A;  2MA3 A;  3ZQH A;  3CJQ B;  1YX3 A;  2IJL A;  3P5J A;  5CLS A;  2BVM A;  2LVS A;  1P92 A;  3WU0 A;  3KP5 A;  1BOA A;  3SYT A;  1J0R A;  3QPH A;  3FK6 A;  4ENN A;  1G3W A;  2L4A A;  1HOM A;  4M3B A;  1IN6 A;  1FX7 A;  1YQA A;  1VZ0 A;  2DMP A;  4LLG F;  1JKP C;  5GPA A;  2W7N A;  2LY2 A;  2MLK A;  3VSK A;  4M3F A;  2CW8 A;  4ETS A;  4NDL A;  4RAF A;  3ZQC A;  3CO6 C;  5DUK A;  3Q3S A;  4HOB A;  2OTJ I;  2W57 A;  5IP9 J;  2AHQ A;  3CLO A;  5B1B H;  1IXS B;  1S8N A;  3SHF A;  1U6G A;  4BBS J;  2IS2 A;  1A36 A;  4N9I A;  2C6Y A;  2KRF A;  5D8L B;  2L4M A;  2JVG A;  3MAJ A;  3QPS A;  1S3J A;  3OV8 A;  4HEA 2;  5F08 A;  2AXL A;  3SZT A;  4UB8 C;  2EZL A;  3GFM A;  1IC8 A;  4ENM A;  2WC2 A;  3GCM A;  4IZZ A;  2XRN A;  2L9R A;  4CCN A;  2R7Z J;  3PIO F;  2XSD C;  2V9K A;  5HS8 A;  5H20 A;  4ZYE A;  1MIJ A;  5CQG A;  1HBX G;  4XSX F;  3BOQ A;  2V6C A;  2H27 A;  2R7T A;  2DA2 A;  1S7E A;  4PGG A;  4YII A;  2L0K A;  4DYC A;  3CF5 F;  3JRB A;  4PJM A;  2HQ5 A;  4UY8 I;  1JJ8 C;  2FML A;  1S7A A;  3IH3 A;  2HEO A;  2XF6 A;  2ZSI B;  4MLO A;  4KIT B;  2ZJR F;  3KET A;  1YI2 I;  5JVT A;  1ZGA A;  2NS7 A;  3BZC A;  4X1E A;  3W2W A;  5H2F C;  3CD6 I;  5D6E A;  3BR1 A;  3GVA A;  3OYH A;  1OCP A;  2DBB A;  4NC8 A;  1YW8 A;  2HQA A;  3OYF A;  1OJL A;  3DTI A;  3CCS I;  1F43 A;  3RI4 A;  2GZW A;  4DGW B;  2D45 A;  1WKM A;  2A61 A;  1DUX C;  5LFA A;  2LC2 A;  3ZMZ A;  2VOO A;  1OCO H;  1I3Q J;  5HDG A;  4A3E J;  3WGI A;  2PMH A;  2Q1Z B;  2R92 J;  2BZT A;  2RKH A;  3OYD A;  2IGM A;  3ZQQ A;  4MHG A;  4B48 A;  2XC7 A;  1MH3 A;  4HW0 A;  2VOD A;  3ABK H;  1M1E B;  1RR7 A;  4KFC A;  1OCZ H;  1NHA A;  2GA2 A;  4RM3 A;  4BXF A;  1FIP A;  1LEA A;  4MTD A;  4CCO A;  1FOX A;  4GCV A;  1XGS A;  2Y31 A;  4A6E A;  1YG2 A;  5DEQ A;  4EJU A;  1R9T J;  3T1B A;  3CDH A;  3OR1 C;  2EIN H;  5C3E J;  3OIP A;  2M1B A;  2OZ6 A;  2DT7 B;  2EFO A;  3A03 A;  4AVZ A;  4XLP F;  3CCR I;  5J8C A;  2Z16 A;  4Y52 J;  2W1O A;  3ZPL A;  4D5C A;  3BCA A;  1ZK8 A;  3BJO A;  3RDI A;  5DV5 A;  1XX5 A;  1W4M A;  1FOW A;  4O3M A;  1RUO A;  2VBZ A;  2QGU A;  2CQX A;  1O57 A;  3F6V A;  3AG4 H;  2FJ1 A;  4WWC A;  4I76 A;  1TW2 A;  2DA3 A;  1X3Z B;  3LA3 A;  1SFU A;  4LG3 A;  4LG0 A;  3MN2 A;  1CQT A;  3FM3 A;  3BJA A;  5L3E A;  1W7P D;  3CMY A;  4PSW A;  2EB7 A;  1EKE A;  1R1U A;  2DOF A;  2QA4 I;  4AUX A;  3HOS A;  2W24 A;  3BTL A;  2P81 A;  3H3V K;  2KPM A;  3SDG A;  1QBJ A;  2STW A;  3H0G J;  2LY9 A;  1DU6 A;  2YU9 J;  1RKT A;  1AKH B;  4XN3 A;  3RKY A;  3ECO A;  3X2Q H;  5C4J J;  1L3L A;  3IH2 A;  3OL4 A;  2WTE A;  1JKR C;  3KE2 A;  2FBK A;  3IWZ A;  4Q4Z F;  2VE8 A;  4X6A J;  1X1B A;  5DCM B;  2Z3Y A;  3ESW B;  4W1U A;  3IAS 2;  1B6A A;  2OA4 A;  3QOP A;  3D5R C;  3CMA I;  5K7Z A;  1CF7 A;  2ESN A;  4HPQ A;  1F1Z A;  3R0A A;  1QVT A;  4A2U A;  4Y7N J;  3ZP5 A;  5FKL A;  4UNO A;  4P5O A;  1UZC A;  2VBY A;  4F7Z A;  2F5C A;  3ISP A;  2QUF A;  3COA C;  4JYK A;  5EF6 A;  2LD5 A;  1B1B A;  1TBX A;  2CUE A;  1LJ9 A;  4ZYG A;  4B3A A;  2DTR A;  2CQ7 A;  1FSH A;  1AOY A;  5FD6 A;  3FXK A;  1VQO I;  1B72 B;  2KZV A;  2XPU A;  5LRS A;  3PNY A;  2CGP A;  3ASN H;  3RYP A;  3BP8 A;  5ILV A;  1TQP A;  2O5R A;  2DYR H;  4MEY F;  3IV5 A;  1QPI A;  3ZQL A;  2ZBK A;  2FMY A;  1IN7 A;  3LNQ A;  4BS9 A;  2M34 A;  2M4G A;  4L18 B;  2KKO A;  1SFX A;  4XLC A;  3RIR A;  3AKZ A;  5E3L A;  3GUD A;  4CXF A;  3L2W A;  1ACI A;  3ZQG A;  2Z99 A;  3CLQ A;  3H3Z A;  2Y0S A;  4HAM A;  3MKY B;  3S93 A;  2LF7 A;  4PZJ A;  1IN5 A;  5L3C A;  1V54 H;  3BG3 A;  5TIS C;  2QEX I;  5C4X J;  3JTG A;  4M74 A;  1B8I B;  1PDN C;  3Q0V A;  1Y0U A;  2LYC A;  2Y48 A;  4S05 A;  4WK8 F;  2HDD A;  1QNT A;  2DU9 A;  3K6G A;  2K5C A;  1FMV A;  1G8X A;  2ZCW A;  3QP6 A;  1Y6I A;  5LBQ A;  3G6E I;  1JGG A;  4LFU A;  1G6N A;  5BOX A;  1FNN A;  2KQR A;  1FYK A;  2CQQ A;  3CP8 A;  2YPR A;  2FSW A;  5ICC A;  4F91 B;  2CRG A;  3S3M A;  2DMT A;  5BPD A;  4IOA F;  2IEK A;  2QF7 A;  4M9Z A;  3WTW C;  1QA6 A;  3G4S I;  3KEO A;  2FXA A;  4KMU X;  4NBQ A;  1XCB A;  2X9D A;  5F0F A;  4AU7 A;  2V6E A;  2K9M A;  2M0C A;  3U2R A;  1B59 A;  5HOO A;  3K1N A;  1G59 A;  2O9L A;  1RC9 A;  3R60 A;  2JVH A;  4KA4 A;  2FU4 A;  2BY3 A;  1O3S A;  4IHY A;  2QSG X;  1KU3 A;  1DP7 P;  3O3K A;  5GAH J;  3DLA A;  3RKQ A;  5LLQ A;  3V7R A;  4GRI A;  5K1Y A;  3KP6 A;  4BEH A;  1W5S A;  3MKW B;  1TWG J;  2NXN B;  3H9Q A;  4RGR A;  2L5Q A;  4A0Z A;  1YLF A;  3R61 A;  3WG7 H;  4AWX B;  1Y1W J;  2BW3 A;  3QWL A;  2HPM A;  1T39 A;  2R7X A;  1N77 A;  3SZG A;  1E2X A;  1ZG5 A;  4OMZ A;  4CZC A;  1AU7 A;  4FAS D;  1WH7 A;  1WSU A;  3S16 J;  1W7P B;  3K4J A;  3TGN A;  3JRC A;  3HC7 A;  3F3X A;  5FJ8 J;  1HLV A;  3L9F A;  2O8X A;  4F3Q A;  1IW7 F;  1T98 A;  1ZEL A;  2KRH A;  3HHH A;  4HV6 A;  2Q8K A;  3RPQ A;  3CC4 I;  2MYS A;  4UXN A;  3ZMS A;  3BPX A;  3BWG A;  3KP2 A;  3NRV A;  5J4V A;  3F0C A;  3FWE A;  3FKJ A;  1XSD A;  3D1N I;  1N25 A;  4LB6 B;  4Q5S F;  2W85 A;  2VKD A;  3ABT A;  4Y4R A;  2VT2 A;  4CH7 A;  2Y9Y A;  2JWT A;  3DU6 A;  3GBG A;  3HSE A;  1ORK A;  1Z3Y A;  2QSF X;  3A2K A;  4NC7 A;  3ZMD A;  3S3N A;  3WTY C;  1YJ9 I;  4BXU A;  2LBF B;  5M5Y J;  4ENJ A;  1USS A;  1VQ5 I;  2IS1 A;  1OYY A;  3A4C A;  1FZP B;  2VN2 A;  4G7O F;  3SXY A;  5J3L A;  3MQ0 A;  5JLX A;  1I6H J;  4JX4 A;  2E7X A;  3VYU B;  2FEZ A;  4G8X A;  3L09 A;  1ZR4 A;  2GQQ A;  2VKV A;  2ELH A;  1K7A A;  3CDL A;  1ERD A;  4BE0 A;  2GIZ A;  2P8T A;  4Y17 A;  4A3K J;  2XSJ C;  2B63 J;  2LP0 A;  4DYR A;  3A01 B;  3KZZ A;  5FKM A;  4RBO A;  3BDD A;  4RB2 C;  2P5L C;  3S14 J;  1R5I D;  2ID6 A;  3W6J B;  2IT0 A;  1K4S A;  4EJT A;  4P1W A;  2QYO A;  1O3R A;  3PUB A;  5K5R A;  2LR8 A;  2OQG A;  4B43 A;  3CCL I;  3C7J A;  4BXX J;  1X1C A;  1LEB A;  3GO5 A;  3OYK A;  1HW2 A;  3V8K A;  1ZRC A;  1NG7 A;  4Y15 A;  1Z05 A;  4BGD A;  4EGY A;  1YJN I;  1QVU A;  3EPZ A;  4IRH A;  2CYY A;  1OLT A;  5CVU A;  5K7H A;  2VAS A;  4Y3O A;  4A5N A;  2VLA A;  4FIS A;  2MW8 A;  1JGS A;  3R4K A;  2ZJ2 A;  1U8R A;  2EV0 A;  4O5V A;  2A6H F;  3LSM A;  4PFP A;  3E97 A;  2P0W A;  2VKE A;  1Z6T A;  1TWA J;  2CG4 A;  3KP4 A;  1R22 A;  5E3O A;  4KT5 C;  5JHF A;  3HOZ J;  1KQ8 A;  5M5W J;  1X1P A;  1ODD A;  2AQF A;  1R5G A;  1UG2 A;  4KN4 X;  2KIF A;  2QCO A;  4HA8 A;  3ZN0 A;  3FMS A;  4FQG A;  3TBI A;  2JA5 J;  1FEX A;  1KON A;  3L2U A;  3G73 A;  1P2F A;  1Z21 A;  1R49 A;  1XPX A;  2OCC H;  1NK2 P;  1MNM C;  2V9P A;  3IKV A;  3GTQ J;  3H9J A;  4B44 A;  4M6Y A;  3TOA A;  2BYV E;  3SEZ A;  1FC3 A;  2ZJQ F;  2OPT A;  2VQL A;  3MD2 A;  1BW6 A;  2Z2S B;  2X6Y A;  5GAE J;  1FTZ A;  3MKZ A;  2W00 A;  1I6X A;  1LDD A;  5JHU A;  1U9N A;  3ABM H;  3PQK A;  4OIR F;  4JX6 A;  3HOY J;  1HA8 A;  3JW4 A;  4C9Y A;  1D5V A;  3C1D A;  1D1B A;  1ETK A;  2EIK H;  4O6J A;  2ELJ A;  4UHT A;  2R7V A;  1H89 C;  3EUH C;  3QP5 A;  3CCE I;  2DFE A;  1E17 A;  2EIL H;  2HQN A;  2LSO A;  4H0E A;  2A5W A;  4LJZ F;  4ZYH A;  5LHI A;  4BE1 A;  1TQM A;  5M3F J;  3L00 A;  3AG3 H;  2NNY A;  1OCR H;  2Y9Z A;  3I4N J;  1RES A;  3MFK A;  2F5E A;  3ASO H;  2FUG 2;  3OSF A;  2G7U A;  1ZG1 A;  4PCQ A;  1MJ9 A;  5IOY A;  4L9V A;  2VQH A;  2X1D A;  1IJW C;  3HHG A;  3BLY A;  4NNJ A;  1AKH A;  3WE2 A;  4XOT A;  3E6B A;  1YS7 A;  4E70 A;  3E6C C;  1JXS A;  1Z91 A;  3UR3 C;  3FMQ A;  5F0H A;  1ZN2 A;  2CU7 A;  2LDU A;  1JTX A;  4NB5 A;  2CJJ A;  1EH8 A;  2FQ3 A;  4L9J A;  2NYX A;  1T08 B;  1P4X A;  3LSK A;  4UUT A;  3FIW A;  4FCY A;  1X1A A;  2YX7 A;  4ASN A;  4A3I J;  1NH3 A;  1EA3 A;  1H9T A;  1SAX A;  3BTC A;  3I59 A;  2M8E A;  3ZR8 X;  1BJA A;  1DU0 A;  4RMN A;  3PSF A;  3LOC A;  1HC8 A;  3AL0 C;  2K9Q A;  1FBS A;  4PDK A;  3GFL A;  2I5U A;  2OAZ A;  2HKO A;  5E8I A;  3H5N A;  3SEQ A;  2DQL A;  3DWL E;  2PLY A;  2XB5 A;  1LPQ A;  5JFR A;  2HTS A;  2COB A;  2JUG A;  4MIM A;  2GOX B;  3WG9 A;  1RPW A;  4LK1 F;  3VOD A;  5A2Q Z;  3MZ8 A;  1X19 A;  2K40 A;  1REP C;  2CUZ A;  3AL0 B;  3CC7 I;  2XKP A;  1O7L A;  4N4O B;  1X4P A;  2NAZ A;  2ZXW H;  4HQE A;  4HLY A;  3CCM I;  4PGH A;  2XGC A;  2DA6 A;  1AHD P;  1ZLK A;  5JR3 A;  3U1D A;  2P7V B;  4ZTJ A;  1YO5 C;  2MC4 A;  2JA6 J;  3H36 A;  1AWC A;  1JT6 A;  3KP7 A;  1BR1 A;  3Q9S A;  3F6O A;  4XN0 A;  2BHZ A;  1MMN A;  1WI3 A;  2RQP A;  1I50 J;  1X3W B;  3K2A A;  1GXP A;  3OIO A;  4BAC A;  2DO7 A;  1JUM A;  5J47 A;  4E7H A;  3RPU A;  2XPV A;  3QYB A;  2E5N A;  5B1A H;  3UNG C;  3DBL B;  3HEF A;  3ZMU A;  3ECH A;  1QZZ A;  4AC0 A;  3K4M A;  3N05 A;  3OYL A;  2W48 A;  1QO0 D;  4HF1 A;  1P4A A;  1TWF J;  4JOM A;  5DM7 F;  1BL0 A;  4DYQ A;  2NVX J;  1ZGW A;  3TOB A;  1GVJ A;  3BR2 A;  1N75 A;  2UWM A;  1ETQ A;  5F6F A;  2VJI A;  5H6Q A;  2DT5 A;  4V2G A;  1IXC A;  2TRT A;  4ZZL A;  3IRR A;  3DBH B;  1ZH5 A;  1BW5 A;  1ON1 A;  1KZH A;  1OCC H;  4CSW A;  2PEX A;  4BQQ A;  2F48 A;  3V8J A;  3RSN A;  2WY7 Q;  5D5X B;  2XVC A;  3F21 A;  1PUE E;  4OIN F;  1K79 A;  1BBY A;  3GZ5 A;  4M73 A;  4EJV A;  1G3Y A;  4FT8 A;  4RAY A;  2A6T A;  3L2C A;  1SD5 A;  4B4C A;  1TWH J;  1FMW A;  2DOD A;  2V9V A;  2LKP A;  3ZQ7 A;  4A3G J;  2XAH A;  1Y56 A;  2HDC A;  4G6D A;  3HKZ A;  1FBU A;  1ZRE A;  4EEF G;  2IS6 A;  1RIO H;  4DIQ A;  3ERE D;  3PQJ A;  2PJR A;  4PK4 A;  3Q9V A;  2FD5 A;  3RZO J;  3HRM A;  2BV6 A;  5CPR B;  2HYJ A;  2QSH X;  4S04 A;  3G1O A;  3KLN A;  5GPC A;  2DA7 A;  4D7M A;  2M2E A;  2ZB9 A;  3KEQ A;  3PIP F;  2R7U A;  1MMA A;  2HZT A;  3S17 J;  2B7E A;  4FE7 A;  3LFK A;  4I6Z A;  1IZ1 A;  3PSI A;  2EPF A;  2XPW A;  3BQZ A;  4M3G A;  1ZKG A;  4XM3 A;  2BOL A;  2JUC A;  2NS8 A;  2NVU B;  2H1K A;  1H9G A;  2QM3 A;  1OR7 C;  2D5V A;  4A93 J;  3V8L A;  4MO7 A;  3R6S A;  2HQR A;  2WAF A;  1GV2 A;  5K7F A;  2JSP A;  2HZD A;  1P7J A;  1GHC A;  2Y0S N;  3CCU I;  2JA2 A;  3GTG J;  2HI3 A;  5B5E C;  4KUM A;  1ZQ3 P;  1RZ4 A;  4HX4 A;  1I3A A;  4KIB A;  5FB2 A;  1IGN A;  2R7S A;  5FO5 A;  2VXZ A;  3IRQ A;  4U7D A;  5EEA A;  4I98 B;  3ZQF A;  3HBL A;  4I2O A;  3DP7 A;  5L3F A;  2L54 A;  2QEN A;  1XGM A;  2ETH A;  3U1K A;  3LA7 A;  5FLV A;  1W36 D;  1FY7 A;  3IUO A;  1POG A;  1Z67 A;  2CQK A;  4M6X A;  1QHH D;  2LKX A;  4BQA A;  4IOC F;  3WU2 C;  3RPU D;  1HW1 A;  1I1S A;  3JAM Z;  1SD6 A;  2KDZ A;  3K4K A;  3SZP A;  5CVV A;  1T6S A;  3K70 D;  1T56 A;  1X1D A;  4UUV A;  5F0C A;  4YFK F;  2VJ5 A;  1QHG A;  1HF0 A;  2M9H A;  2R7F A;  3W2A A;  2FQ4 A;  5ERI A;  4HF2 A;  3G71 I;  4M72 A;  3FIS A;  3RQ4 A;  1D1C A;  5IYB J;  5E18 F;  1E0E A;  2VUM J;  3P7N A;  4U0V A;  1F4K A;  2DAO A;  3HOV J;  2G7H A;  3BJ6 A;  1ON2 A;  4B09 A;  2ZFW A;  4WXD A;  4RB3 C;  4IHT A;  4PUS A;  4GO1 A;  3CJT B;  1XMA A;  2Z1D A;  1DPR A;  1LFP A;  2LRD A;  4XL9 A;  1T8I A;  4OIQ F;  5HOD A;  2CS3 A;  3CCJ I;  2XAJ A;  3GF2 A;  1WPK A;  1WJF A;  2X4H A;  3KCC A;  2GLO A;  3LST A;  2FBH A;  5E20 A;  3B6C A;  3L7W A;  4HDV A;  1W0T A;  1W5T A;  2NNN A;  4I99 C;  3DU5 A;  3LWF A;  2DYS H;  5EJC A;  2XAS A;  3TL4 X;  1WZ2 A;  4KIF A;  2PG4 A;  1MNE A;  1WJE A;  2HTJ A;  3F8F A;  3NWS A;  2W4S A;  3P9K A;  4H4K C;  2NOG A;  2JMW A;  4MNU A;  1QZY A;  1UFM A;  1Z3X A;  3SQN A;  2QKM B;  2QZ8 A;  3FXJ A;  5KCM A;  4MQV A;  5E8G A;  2IBD A;  1YS6 A;  3MEX A;  2EIJ H;  4ZTF A;  3K69 A;  4U87 A;  2CFX A;  1MBH A;  1R5H A;  2ZXH A;  2HU9 A;  2BGC A;  4EJW A;  1B72 A;  3W6V A;  3DCF A;  2HS5 A;  3QU3 A;  2F5V A;  2MLG A;  4RLQ A;  1OMI A;  4BL0 B;  3GWZ A;  3HSF A;  3VFZ A;  1Z9C A;  2EWN A;  3K4B A;  3RKX A;  2IP2 A;  1SFO J;  3AG2 H;  4AYB N;  2O8K A;  3ABL H;  1SFE A;  3GXO A;  2ME6 A;  1CF7 B;  2Y0M A;  2EFP A;  1FOY A;  3O2P E;  1ZAR A;  1ULY A;  1Z77 A;  4HZF A;  1LDK B;  2JPC A;  2RQQ A;  4XRM A;  1T33 A;  1BIA A;  1FP2 A;  1A31 A;  2GXB A;  1BIB A;  1ZTR A;  2QWW A;  3CF2 A;  4ZZD A;  2OUM A;  3BCB A;  4HBL A;  2DA1 A;  2RAE A;  4UV9 A;  3ZMT A;  4LLN A;  3HOU J;  1Z1D A;  5HLH A;  2DN0 A;  3EDP A;  3V7S A;  1FSE A;  2IGO A;  4C2T A;  3D5S C;  5D6F A;  1YYV A;  1PVE A;  1MH4 A;  2IW5 A;  4OIP F;  3FBN B;  3LQQ A;  4XKB A;  3OSG A;  3S1M J;  4EGZ A;  4BHB A;  1LE8 A;  1T0F A;  4AIK A;  4HRI A;  1OYW A;  1IRZ A;  3DEW A;  5D8K B;  3B73 A;  1WRJ A;  4PJN A;  1U8B A;  1V4R A;  5KNL A;  2ADU A;  1ZR2 A;  3GFJ A;  2OQR A;  1T0F C;  5LEJ A;  3WTX C;  2KDO A;  4EAT A;  1JI8 A;  3BR0 A;  3T8R A;  2WV1 A;  3TW6 A;  3ZN1 A;  1UEL B;  5FLM J;  1BM9 A;  1X2M A;  1XSX A;  2HNH A;  2Z9O A;  5IT9 K;  1GVD A;  2A05 A;  1R1T A;  4NQW A;  3B02 A;  4FET A;  4NC6 A;  4BY7 J;  4E7S A;  5GAD J;  5DDG A;  5D5U B;  1U5T C;  2CFO A;  4ANJ A;  5B66 C;  3HGY A;  3VPR A;  2ZXI A;  3S2W A;  2YR2 A;  5AIQ A;  4CCJ A;  2X1E A;  1IUY A;  2WWY A;  3KYL A;  2GA1 A;  1FBQ A;  3IHU A;  4KIG A;  3TO7 A;  5J6X A;  1ZAO A;  5BQT A;  2KJC A;  3QYF A;  1TQI A;  2EZK A;  5HS9 A;  5KAI C;  1TNS A;  3GTL J;  3FDY A;  4F93 B;  2IGN A;  3F8M A;  1QPM A;  2GBY A;  3K1M A;  4GGG A;  2EQR A;  2JZY A;  4GYI A;  3L1P A;  2ZME C;  2CSO A;  2MFZ A;  5EYR A;  3M3Y J;  1R58 A;  1F36 A;  3M4O J;  4HQM A;  3HRS A;  3VYT B;  4A0Y A;  1XSV A;  2B0L A;  4CUG A;  3FXL A;  3IAM 2;  1MMG A;  3K1P A;  4LIU A;  4M6V A;  2ZKZ A;  4BU2 A;  1WH5 A;  1QZE A;  2R0Q C;  4G12 A;  1EH7 A;  2BEO A;  4J01 A;  5EZH A;  5EZG A;  4HF0 A;  3WGG A;  4IHV A;  4WXH A;  2E1M C;  1XS9 A;  2IA1 A;  4ZDL A;  4GDF A;  3A01 A;  3CDI A;  1RUN A;  4RAZ A;  4II3 A;  3FX3 A;  4DOZ A;  3QOD A;  5M3M J;  1GUU A;  1ETX A;  1KU9 A;  3CUQ A;  3HUG A;  5D5W B;  3M7G A;  4E4H A;  1SVL A;  2DFH A;  2L9S A;  2E1M B;  4HLX A;  4RGU A;  4BQO A;  3WHB A;  3OYA A;  3O6B B;  1BI0 A;  2XHK A;  2HPI A;  5FKO A;  4A6D A;  3BZ6 A;  2XRO A;  4GFB A;  3MMY B;  5LHH A;  3OS1 A;  5GTH C;  3GW2 A;  3A02 A;  2EBI A;  3ZQI A;  1LFU P;  2L01 A;  2DK8 A;  2OD5 A;  2ZJP F;  1WVR A;  1FT9 A;  4DNC A;  2H94 A;  5D4R A;  4ITV A;  2KZG A;  2J5P A;  4CYD A;  3VEP A;  3MZH A;  4RLF A;  2P6S A;  2GM4 A;  4LMY A;  1IG7 A;  3K9T A;  2DA4 A;  1D8J A;  4B3X A;  1MBF A;  4BJ5 C;  5L3G A;  3A0B C;  3O8G A;  2DQR A;  2STT A;  3RKW A;  2X48 A;  2LLK A;  4L0Y B;  4C3I J;  2XB0 X;  2RC4 A;  2JSC A;  2F5F A;  1F5T A;  1EF4 A;  4G6Q A;  4M71 A;  2F4O B;  4K2E A;  5TGT A;  3VWB A;  5BPI A;  2E2J J;  3DEE A;  2L7Z A;  2M5W A;  2BY0 A;  1EV7 A;  2MC3 A;  3K10 A;  4N4N B;  1YX5 A;  4FE4 A;  3E6M A;  3G1M A;  2P6T A;  1IN4 A;  2EIM H;  4HV5 A;  1YRN B;  2DXI A;  4RS8 A;  2BW3 B;  2F4I A;  3ERM A;  2CH0 A;  1JKO C;  1IV6 A;  4C2U A;  3S1Q J;  1X58 A;  1TWC J;  1ZLJ A;  5K5O A;  3AFH A;  1XMX A;  3M8E A;  2I8D A;  3QQA A;  3FZV A;  3F9K A;  1S7O A;  4PJJ A;  2R5Y B;  3ZRG A;  2XV4 S;  4I0A A;  2RVC A;  3GX4 X;  2BVL A;  4CIC A;  4DJA A;  4EJO A;  5HVQ C;  3GFI A;  2HR3 A;  3OIQ A;  4EQQ A;  5LGN A;  4WCG A;  2MAB A;  2EZI A;  2NOJ B;  2CV2 A;  3IP4 B;  4B47 A;  1MBK A;  2F6C A;  4CCM A;  2VKH A;  3ULQ B;  2DW4 A;  2K85 A;  4PJL A;  5ICE A;  1STZ A;  4FX4 A;  2R7D A;  1D8K A;  3HB9 A;  3IC7 A;  1UJ8 A;  2O03 A;  2J5O A;  3K70 C;  1I5Z A;  2XRL A;  4CYC B;  1RRJ A;  2L9V A;  2K02 A;  3E3V A;  2VE9 A;  4BBR J;  3O8H A;  3TDU C;  4YFN F;  1SVM A;  1IDZ A;  3W2V A;  2Y2Z A;  4XNF A;  2PMZ N;  5L3D A;  2K3P A;  4KIS A;  5HLT A;  4ZC3 A;  2K9N A;  4UVC A;  1J2X A;  2JK3 A;  1TL8 A;  4XK4 A;  4Q47 A;  1QGP A;  2VBX A;  1VQL I;  1J75 A;  4A12 A;  2FNP A;  3E5X A;  3EYI A;  2LY1 A;  3GZN B;  2LKS A;  1VND A;  3CUQ B;  2P5K A;  4V19 K;  2NRA C;  3FM5 A;  1JHH A;  5ICF A;  3WTU C;  2VPR A;  1UST A;  3EYY A;  4KMF A;  1VQK I;  5HNF A;  2W84 A;  1R6R A;  3VB2 A;  6PAX A;  4QTR A;  3TED A;  4R8H A;  1MBJ A;  1E3O C;  2ISZ A;  2IRF G;  2DDB A;  2V7F A;  1ZG3 A;  5FKK A;  3J7Z I;  2CO5 A;  2DDA A;  5FRM A;  3FXU A;  4A3D J;  3BG9 A;  3QU6 A;  4BUP A;  5LD2 C;  1A6I A;  3F23 A;  1K83 J;  2GAU A;  1S72 I;  2B9S A;  2DTZ A;  2YU3 A;  3DF8 A;  5FFX A;  2PBI A;  1U2W A;  3S2H J;  4XQF A;  2X51 A;  1D0Z A;  2D1H A;  2M4K A;  3FKI J;  3V7C A;  2GWR A;  2CW0 F;  2DOE A;  4WX9 A;  5KHD A;  3C2B A;  3OYI A;  5FRO A;  1MSE C;  1V55 H;  2F2E A;  4XLN F;  3MZY A;  4DQ2 A;  2BXZ A;  3PNT A;  2M30 A;  3BT9 A;  2VQC A;  3ZXS A;  2WAQ N;  2V26 A;  2E36 A;  2FE3 A;  4UV8 A;  4E7L A;  5LHG A;  1IRG A;  4HG2 A;  3ZOB A;  4IXA A;  1UHW A;  1U78 A;  5D4S A;  3GTM J;  4AM3 A;  3TP3 A;  5KAF C;  4IRG A;  2I10 A;  3KP3 A;  3DEU A;  2EA4 A;  4JP0 A;  4CCL A;  2KJB A;  5J8F A;  1YIJ I;  2DMU A;  4BHP A;  2AXT C;  1Q1V A;  4XR6 A;  2LF8 A;  3IWF A;  1VF9 A;  1WJA A;  2DFF A;  4XBF A;  1RR8 C;  4BHC A;  1G4D A;  4HYE A;  1OYI A;  2RNG A;  2A68 F;  1BJZ A;  2MH9 A;  1X2N A;  4R1H A;  1B8I A;  2CMP A;  3TW7 A;  2VB6 A;  1KU7 A;  3CUO A;  3H5R A;  3I64 A;  1R7J A;  3TKY A;  2R7Q A;  3J80 K;  1ZGJ A;  1P6R A;  2VL8 A;  1YRN A;  2WB1 N;  2QKL B;  4QLC U;  3ZCO A;  3G3Z A;  2DJI A;  3I71 A;  1YJW I;  1UMQ A;  3G1L A;  3S3O A;  2WAD A;  2JT1 A;  2E2I J;  1I39 A;  3F8B A;  2OZU A;  4XSZ F;  1PUF B;  1WJC A;  3JSO A;  4NHJ A;  1RET A;  3J81 K;  1WHU A;  1BN5 A;  2CUF A;  2KLO A;  1WJD A;  2E19 A;  3PM1 A;  1MW7 A;  1SFK A;  1V3F A;  1BI3 A;  4BDZ A;  1ONV A;  3M1C A;  3RTR A;  2TCT A;  2VJ4 A;  3CJN A;  1VTN C;  5A2Q K;  2R7W A;  2PJR B;  3C3W A;  2UZK A;  4E7J A;  3UKG A;  1DGW Y;  1Y39 A;  1UHM A;  2Z5U A;  3M9A A;  4I0B A;  3VSL A;  3BY6 A;  4TV7 A;  1FP1 D;  3ONQ A;  5E1Z B;  4EMS A;  2HOS A;  3WTS C;  5GAG J;  2WBM A;  4A3L J;  3MCZ A;  4KIC A;  3BRO A;  1R36 A;  1XGN A;  3HPG A;  5HS7 A;  3LSP A;  3CCQ I;  1HDP A;  3OY9 A;  4IJA A;  4BJ6 C;  3PL8 A;  2ZFU A;  2HKX A;  4A0X A;  1HKQ A;  2X85 A;  2FRH A;  2G9W A;  1PP8 F;  2JA7 J;  4ZDP A;  1X4O A;  3JTH A;  2GIV A;  4BEH B;  3PO2 J;  3K0L A;  2R93 J;  1S29 A;  5CYV A;  1MGT A;  1SD7 A;  4IQ4 A;  1WI9 A;  2IGK A;  2VC1 A;  2BY2 A;  2EH3 A;  2QQ9 A;  4KNY A;  1Z7U A;  2KIS A;  4DZP A;  1IF1 A;  1JUP A;  3I56 I;  2LH9 A;  1JE8 A;  5J1R A;  2O6G E;  1LKX A;  4II2 A;  2L2O A;  1A04 A;  2VI6 A;  1HKS A;  2KT0 A;  3BR5 A;  3V42 A;  2CV0 A;  5IYD J;  2IVM A;  4G94 A;  1XCV A;  4G6T B;  5FKN A;  1QU3 A;  2XGD A;  4E7I A;  1MDM B;  4OOI A;  2PQ8 A;  4JK1 X;  4FTH A;  2M7A A;  4I01 A;  3LSI A;  1UHS A;  3CZ6 A;  2HGC A;  3KYD B;  3DPU A;  3TP0 A;  2LRE A;  1VQP I;  2KIM A;  2E5Z A;  1QQI A;  1U9O A;  1ZRD A;  3VOE A;  4CYC A;  2YX4 A;  1OFC X;  2QQA A;  3ZMV A;  3DPT A;  1B9M A;  2L7F P;  5ILS A;  5ILU A;  5GP9 A;  5HLI A;  3PJR A;  3OYN A;  1D0X A;  4PSX A;  1A5J A;  1DDN A;  4YIF A;  1RKW A;  1UCR A;  5IPA A;  3F8C A;  2O0Y A;  1T95 A;  3AG1 H;  3M07 A;  1WCM J;  3PO3 J;  5FLX K;  1TZL A;  4DW6 A;  3T0Y A;  5DS9 A;  2P4W A;  4EM0 B;  2GXG A;  2R7R A;  3CME I;  3FMR A;  4Q48 A;  3OYG A;  1P4W A;  3GTJ J;  4LB5 A;  4XRS G;  2MGQ A;  3DQV C;  4P96 A;  2ME0 A;  2CWE A;  3F8N A;  1HSJ A;  1SVO A;  3CP2 A;  5EDN A;  3JRE A;  2XF7 A;  3JRH A;  1VQ9 I;  2E35 A;  4IF4 A;  4ZJZ A;  2K4J A;  2OU2 A;  5IYC J;  1ZRF A;  1E3H A;  4MGR A;  1ZYR F;  5E79 C;  1YTY A;  3P9C A;  4IQJ A;  1H0M A;  2MH2 A;  2L9N A;  2VT3 A;  5CVJ A;  2IS4 A;  3FK7 A;  1J9I A;  1IUF A;  2RNJ A;  4U0Y A;  2LMD A;  3DPL C;  3DTK A;  2DFI A;  1LB2 A;  4XIC A;  1LNW A;  2K9L A;  1B9N A;  3OYE A;  3I53 A;  1IDY A;  5EEG A;  1R23 A;  3H35 A;  2QBY B;  4CDG A;  4EM2 A;  4BE2 A;  1KA8 A;  2VQG A;  1O3T A;  1C0W A;  1B4A A;  5EGO A;  3QYE A;  2EZH A;  2LBF A;  1MND A;  4E7Z A;  3JRA A;  4CCK A;  4CHU A;  3HOX J;  2ICW G;  1LVA A;  3LSH A;  4D5F A;  3OYM A;  1YHQ I;  3FF5 A;  1G3S A;  4UVB A;  1VFC A;  2XGE A;  5M5X J;  5JVG F;  4G7Z F;  4ESB A;  2ZME A;  1TLH B;  1BR2 A;  1GXQ A;  3E5Q A;  5J4Y A;  2E1C A;  2XIG A;  1YIT I;  3OYB A;  5F04 A;  2ECB A;  2CV1 A;  3WTV C;  2HWV A;  1R4M B;  4BQN A;  2E2H J;  4HDU A;  1J59 A;  1VQN I;  3I3L A;  1JUS A;  4LOC A;  1H8A C;  1XN7 A;  3RZD J;  4Z2Y A;  2PMU A;  1SAU A;  2E1N A;  2FF4 A;  2K9S A;  2M8G X;  4RB0 A;  3VYS B;  4RGX A;  3OR2 C;  4YG2 F;  3PFY A;  3ZGK A;  2ID3 A;  1LDJ A;  3C2H A;  1JHF A;  3LQR A;  1HW5 A;  2R5Y A;  4WF2 A;  3QRF F;  4E7K A;  2UV1 A;  1AA7 A;  2KIU A;  3H5A A;  2WV0 A;  2HOA A;  2PFB A;  4F92 B;  3ROU A;  4ESF A;  2X6X A;  2XAF A;  1Z7L A;  1NG6 A;  2OCE A;  2ZNZ A;  3I58 A;  5J1Y A;  3S1R J;  3SFI A;  9ANT A;  4ON0 A;  4KDP A;  2DLL A;  1XG1 A;  2RDP A;  3REO A;  3KIO A;  1TTY A;  4MTE A;  2V1X A;  2ZME B;  2VC0 A;  3EUH A;  1UAA A;  2AS5 F;  4N0B A;  2UXN A;  3HTU A;  4I02 A;  3OS2 A;  3RYR A;  1ETO A;  5K5Q A;  3J7A O;  4IVN A;  3TO6 A;  1WJB A;  2QVO A;  4G9Y A;  4IL6 C;  1OQY A;  1MBG A;  3KLO A;  2EA2 A;  4AVP A;  1K4T A;  1PUF A;  4OIO F;  1OCT C;  2H6B A;  4LLL A;  1ETW A;  2R3S A;  3NWT A;  1YIO A;  2H8W A;  5FRN A;  3OS0 A;  1FWZ A;  3BR6 A;  3E7L A;  4OAY A;  3BQY A;  4Y33 A;  1Q1H A;  4HST A;  3CJR B;  1P7I A;  1LQ1 A;  5CKT A;  3BTI A;  2E34 A;  2LOO A;  2DT6 A;  2MG4 A;  4P55 A;  4V2F A;  2VOP A;  2M7B A;  2EV5 A;  2UUZ A;  5LRR A;  5CJ9 A;  2L7M P;  3IH4 A;  1D0Y A;  1O4X A;  5IOZ A;  2ZO4 A;  2PJP A;  1WWX A;  2IAI A;  3QAH A;  2EFW A;  2HDW A;  1OIS A;  3OL3 A;  5F64 A;  4HNU A;  2DMN A;  1IRF A;  2RGV A;  2HVR A;  4JQF A;  2RV8 A;  2H8R A;  4AYB A;  4XID A;  3CTA A;  3F72 A;  3DLL F;  5H6R A;  1XDS A;  3TQN A;  2HXO A;  1J09 A;  4HSR A;  1ETV A;  1O7F A;  1EJ9 A;  4LGW A;  3KEY A;  4XRF A;  3DKY A;  3IKT A;  2XAU A;  2K4B A;  3PNV A;  3L2R A;  3E6D A;  1K6O A;  4A5M A;  1R71 A;  1G3T A;  1K78 B;  2BHY A;  3OWT A;  1XGO A;  3HSR A;  3WU1 B;  1FYL A;  5CQE A;  1FLI A;  2F4M B;  2XKO A;  3J80 Z;  3MVP A;  2LTP A;  3EQL F;  1XDU A;  4X0G A;  2JPB A;  3A0H C;  2EV6 A;  1FOK A;  3KYC B;  3T8T A;  3U21 A;  3LFU A;  5TRD A;  1Z0X A;  1DQU A;  5E3N A;  2KL4 A;  3H9G A;  1O3Q A;  3S2D J;  2LFB A;  1MMS A;  1SMT A;  3KX2 A;  1FIA A;  5J1U A;  1S5L C;  2Y75 A;  5E3M A;  2HVQ A;  4I7H A;  2IPQ X;  3GTK J;  1TT0 A;  1H88 C;  2EJR A;  4UUS B;  3JR9 A;  3J81 Z;  3GZ6 A;  4NUB A;  1XB4 A;  1YW9 A;  1V5F A;  3G2B A;  1A6Q A;  3W6K B;  2Y30 A;  4C3J J;  3I4P A;  2DOA A;  1P9Q C;  2K3F A;  3B6A A;  3JRD A;  1MBE A;  2E71 A;  1KYZ A;  3CUQ C;  5AON A;  1ETY A;  5FLX Z;  5FFZ A;  1IO2 A;  5LEK A;  3GYH X;  2BE5 F;  1WFX A;  3V4G A;  5EG0 A;  4D0P A;  4CGZ A;  2NVY J;  2R7O A;  4IHS A;  3M8F A;  1BR4 A;  1TW3 A;  2BBY A;  4XLF A;  2LNB A;  3MKL A;  1T2K A;  1BC7 C;  2DPD A;  3HPH A;  2VXD A;  2DCE A;  1Z6R A;  2WA0 A;  3WGH A;  4E6K G;  3CMM A;  3K7A J;  4CA0 A;  3WOD F;  2X1C A;  4XKV A;  3CCY A;  3DFG A;  1CGP A;  4BDY A;  2Q2E B;  4OAZ A;  1KU2 A;  4XLE A;  5LGU A;  4RGS A;  4XOP A;  3CES A;  3DXJ F;  4YEJ A;  2COM A;  3I4M J;  2PN6 A;  5KK1 A;  1K78 A;  5C44 J;  4YFX F;  3ML6 A;  2NS0 A;  2KFD A;  2ACJ A;  1XMK A;  1KGS A;  1IV8 A;  5JI6 A;  3MWM A;  4DBQ A;  2K27 A;  1PJR A;  3NAU A;  1HST A;  2RN7 A;  2FA5 A;  3K2Z A;  3LSG A;  2K86 A;  2DK5 A;  2EK5 A;  4MFE A;  2XGX A;  3R0J A;  2DPU A;  1YW7 A;  1JTY A;  4UUS A;  4LK0 F;  4XLH A;  4CZZ A;  4LIT A;  4ENK A;  1U5T A;  3K4C A;  4L9T A;  3LMM A;  4IHW A;  2W82 A;  3H0D A;  2AQE A;  4W97 A;  5IP7 J;  1EH6 A;  1MJA A;  1D5Y A;  4RA2 A;  4A69 C;  2V1D A;  5E1X A;  4HNV A;  1RNL A;  5HNH A;  3Q5F A;  1SAN A;  3BPV A;  4P9F A;  1MJB A;  1TNT A;  4QPO A;  4M3D A;  3L2Q A;  4MQ9 F;  1JJ6 C;  2IA0 A;  1MKM A;  1GT0 C;  2JJ7 A;  1MMD A;  3E0J B;  3QOE A;  1GLN A;  5EGO B;  1DGR M;  2H6C A;  2Y69 H;  4OWR B;  3HTS B;  2NVQ J;  2QLZ A;  3QPT A;  4L9N A;  1JKQ C;  3KZY A;  1WGX A;  2E7W A;  3AAF A;  1Y8Q B;  2BXY A;  5DD4 A;  2X6O A;  5IT9 Z;  2A69 F;  2XF5 A;  3JRI A;  5D5V B;  4XMY A;  1W7P A;  4ABZ A;  2R5Z A;  1XC5 A;  2V79 A;  3A1Y A;  3WE3 A;  4ZDO A;  3F22 A;  4FX0 A;  3DKW A;  5CVR A;  1SD4 A;  3TMO A;  4IKF A;  4A3F J;  1XTA A;  2ZXJ A;  1FJL A;  3ABU A;  1J5Y A;  2DA5 A;  2PX9 A;  4YEL A;  3H92 A;  2HYG D;  1W5C C;  1W1W E;  3HL2 A;  2MD5 A;  4RAG A;  4B8X A;  1LUJ B;  4L5I A;  5HDK A;  3L2V A;  3JCU C;  3EUK L;  4JBA A;  4U0W A;  2D1V A;  3LSJ A;  4KYW A;  2M0M A;  1DP3 A;  1RI7 A;  1PYV A;  2M87 A;  5BNG A;  2L02 A;  2X0L A;  2JRT A;  4LIV A;  5IY5 H;  3OMY A;  1BA5 A;  1MSF C;  2G0E A;  2OBP A;  4A3J J;  4RM2 A;  2P7C B;  1VQ6 I;  1WJ5 A;  2R4G A;  5E17 F;  4L5J A;  4FHT A;  2EFN A;  3E5U A;  4I09 A;  2E60 A;  1R1V A;  2L7K A;  2H1L A;  1I27 A;  3DBR B;  2ELK A;  2QQB A;  4QSH A;  3JSP A;  2BY1 A;  3WTT C;  5CVI A;  4M9S A;  4OU0 A;  3LSR A;  2HXI A;  5DTD A;  2FBI A;  4BAY A;  2HVS A;  4U7B A;  4XRS A;  3CC2 I;  2O61 A;  3BR3 A;  3H1C A;  5ED4 A;  1R00 A;  4IPA A;  2PI0 A;  2KRC A;  4OMY A;  1I1G A;  1LFB A;  5IT3 A;  2QBY A;  1U0J A;  2A3S A;  4IRI A;  5TJJ A;  2KHM A;  2ZSH B;  1S9H A;  4AD9 A;  2JA8 J;  5AIP A;  2MSY A;  3HZJ A;  5J40 A;  3GME A;  5EEH A;  2VPL A;  3DV8 A;  1D3Y A;  3BG7 A;  3C2G A;  4PFO A;  2ECC A;  2OF7 A;  4P9U A;  5HDN A;  3P9I A;  1ENH A;  5E1W A;  4A3B J;  4BNC A;  5B3S H;  1YOV B;  1YFH A;  4C30 A;  2TDX A;  5BS6 A;  2JRM A;  4HNT A;  3FHZ A;  3C18 A;  4ZYD A;  1R4N B;  3HG9 A;  3OOP A;  4S0H B;  1HQC A;  2WY8 Q;  2ZC2 A;  2ZNY A;  5KVR A;  3CCV I;  3HDD A;  4AIJ A;  2FNA A;  1VQ7 I;  1IAW A;  4IEJ A;  2CW7 A;  1KYW A;  3FXQ A;  3M1E A;  2GOM A;  3HUG B;  1Y0N A;  3I59 B;  2Q2E A;  2DI3 A;  4B1R A;  3HRU A;  3HKZ N;  3J7A Y;  4C3H J;  4A3C J;  4DZJ A;  1HXD A;  2Q0O A;  4ZYA A;  2ESH A;  1WQ2 A;  3QPL A;  4HX8 A;  4EM1 A;  2WAQ A;  5LGT A;  2P5V A;  2V1N A;  4XLA A;  1HCR A;  4RDU A;  1TT5 B;  5ICG A;  4IO9 F;  2JTV A;  4UB6 C;  2UXX A;  5IP6 A;  5F27 A;  3DTE A;  3FXM A;  3FBI B;  4MFD A;  1OR7 A;  3LAP A;  1NK3 P;  1K6Y A;  2NVT J;  3Q0U A;  4C2M J;  1KQ0 A;  1ZHF A;  4L0Z B;  1VQ8 I;  1D1A A;  2KIQ A;  2OTL I;  3Q0W A;  4BJT A;  3N97 A;  4J19 A;  2N8G A;  3T5X A;  4GYG A;  3SFZ A;  4Y13 A;  2K7L A;  4BKX A;  2VON A;  1A35 A;  4LG0 B;  4RB1 A;  2VBW A;  4D1Q A;  3JRF A;  3S1N J;  2OC6 A;  2V4J C;  1OKR A;  4J00 A;  1ITY A;  2AO9 A;  2KMU A;  2VIX A;  4DBR A;  3KFW X;  4ESJ A;  3S8P A;  3EUA A;  5EG0 B;  2FX0 A;  4KJZ A;  5DD8 A;  3RJP A;  3GTO J;  3BC8 A;  2X6W A;  5FGM A;  1L0O C;  4YIR X;  2QQ8 A;  3NEU A;  2V1U A;  2XUB A;  2LK2 A;  4BYY A;  4IHX A;  2JQ7 A;  4F52 A;  1IRX A;  1YE9 A;  3U9G A;  4QWQ A;  2HOT A;  4NQW B;  3VDX A;  2PMZ A;  3BG6 A;  1K61 A;  3K4N A;  2R5Z B;  4AID A;  2OJE D;  3CO7 C;  3GTP J;  1V5G A;  1TP4 A; 
#chains in the Genus database with same CATH homology
 2ECB A;  2EZK A;  5J3L A;  5JLX A;  2E2H J;  1I6H J;  4JX4 A;  3GTL J;  1JUS A;  4LOC A;  2GBY A;  1H8A C;  5JLW A;  3L1P A;  2EQR A;  3RZD J;  1ZR4 A;  1LE8 B;  2VKV A;  1APL C;  2K9S A;  2M8G X;  3CDL A;  5EYR A;  3M3Y J;  1FTT A;  4A3K J;  2ID3 A;  1F36 A;  2B63 J;  3M4O J;  2LP0 A;  4DYR A;  4QIW N;  3A01 B;  5FKM A;  4RBO A;  1JT0 A;  1HDD C;  3S14 J;  4M6V A;  2ID6 A;  3OOU A;  1WH5 A;  2R5Y A;  3NAR A;  2R0Q C;  2E1O A;  2HOA A;  2LR8 A;  4G12 A;  4BXX J;  5EZH A;  5EZG A;  4IHV A;  5J1Y A;  3S1R J;  3SFI A;  1XS9 A;  9ANT A;  1XG1 A;  3HGG A;  4A3M J;  3A01 A;  1QVU A;  5K7H A;  4FIS A;  1GUU A;  1ETX A;  2MW8 A;  1ETO A;  5M3M J;  2O7O A;  1W0U A;  1QRY A;  3JRG A;  3WHB A;  1G2H A;  1MBG A;  1PUF A;  1OCT C;  2VKE A;  1ETW A;  1TWA J;  3RQI A;  3HOW J;  4GFB A;  5FKO A;  5E3O A;  4L5E A;  3A02 A;  3BR6 A;  3E7L A;  2EBI A;  3ZQI A;  2YUS A;  3BQY A;  1LFU P;  3HOZ J;  5M5W J;  1P7I A;  3BTI A;  1UG2 A;  2MG4 A;  2QCO A;  4D7N A;  4V2F A;  4BY1 J;  4M3E A;  2GM4 A;  1IG7 A;  2JA5 J;  3BTJ A;  1FEX A;  2DA4 A;  2L7M P;  1Y1V J;  3IH4 A;  1MBF A;  2JN6 A;  1O4X A;  1NK2 P;  1MNM C;  3O8G A;  5IOZ A;  3GTQ J;  2IAI A;  2X48 A;  2LLK A;  2DMN A;  2OPT A;  4C3I J;  3WHC A;  1BW6 A;  2H8R A;  1FTZ A;  2XB0 X;  5F1J A;  1EF4 A;  1U9N A;  4XID A;  4JX6 A;  3HOY J;  3S15 J;  2HXO A;  1NTC A;  1ETK A;  2E2J J;  1TC3 C;  2L7Z A;  1H89 C;  2YS9 A;  1GV5 A;  1ETV A;  4FE4 A;  3SJM A;  1VI0 A;  3G1M A;  1GDT A;  5M3F J;  4JX5 A;  1YRN B;  3CQZ J;  3BG5 A;  3HM5 A;  2Y9Z A;  3I4N J;  1RES A;  3OSF A;  1JKO C;  1IV6 A;  3S1Q J;  1X58 A;  1TWC J;  2DMQ A;  5IOY A;  3QQA A;  2DJN A;  1IJW C;  2R5Y B;  3ZQH A;  1AKH A;  3MVP A;  2LVS A;  2LTP A;  2EZI A;  3FK6 A;  1MBK A;  5F0H A;  1HOM A;  2CU7 A;  4M3B A;  1JTX A;  2CJJ A;  1Z0X A;  5E3N A;  1JKP C;  2DMP A;  5GPA A;  4UUT A;  4A3I J;  4FCY A;  2LFB A;  3S2D J;  3FIW A;  4M3F A;  1FIA A;  5J1U A;  3BTC A;  4NDL A;  5E3M A;  3HB9 A;  3ZQC A;  1DU0 A;  3LOC A;  3Q3S A;  3GTK J;  1H88 C;  2K9Q A;  4UUS B;  3JR9 A;  2XRL A;  5IP9 J;  2AHQ A;  4CYC B;  4BBS J;  2XB5 A;  4BBR J;  2COB A;  2Y30 A;  3O8H A;  4MIM A;  4C3J J;  3QPS A;  1RPW A;  2K40 A;  5F08 A;  1IDZ A;  3B6A A;  3JRD A;  1MBE A;  2EZL A;  1IC8 A;  2Y2Z A;  2PMZ N;  1ETY A;  2L9R A;  2R7Z J;  2K9N A;  2XSD C;  2JK3 A;  2XGC A;  5EG0 A;  2DA6 A;  1AHD P;  4XK4 A;  2NVY J;  2JA6 J;  1VND A;  1JT6 A;  2DA2 A;  1S7E A;  2VPR A;  3MKL A;  2L0K A;  4DYC A;  1WI3 A;  1I50 J;  3K2A A;  3JRB A;  3OIO A;  2HQ5 A;  4QTR A;  1JJ8 C;  3IH3 A;  3K7A J;  1JUM A;  3TED A;  1MBJ A;  2XPV A;  4MLO A;  1E3O C;  3CCY A;  2NS7 A;  3HEF A;  4X1E A;  4AC0 A;  3BR1 A;  2W48 A;  5FKK A;  4A3D J;  1OCP A;  3BG9 A;  1A6I A;  1K83 J;  1TWF J;  3I4M J;  2DTZ A;  4DYQ A;  1OJL A;  5C44 J;  1BL0 A;  2NVX J;  1ZGW A;  1F43 A;  3S2H J;  3BR2 A;  1ETQ A;  4V2G A;  1I3Q J;  2TRT A;  1BW5 A;  4A3E J;  3FKI J;  2R92 J;  3NAU A;  3C2B A;  1MSE C;  3LSG A;  1MH3 A;  3BT9 A;  4MFE A;  2WAQ N;  1RR7 A;  1JTY A;  1FIP A;  4UUS A;  3ZOB A;  2Y31 A;  4B4C A;  1TWH J;  4IHW A;  1U78 A;  3GTM J;  1R9T J;  4A3G J;  3TP3 A;  4W97 A;  5C3E J;  2I10 A;  5IP7 J;  1D5Y A;  3A03 A;  4JP0 A;  4A69 C;  4EEF G;  4Y52 J;  4HNV A;  3RZO J;  1SAN A;  2DMU A;  4D5C A;  4M3D A;  1JJ6 C;  1Q1V A;  2FD5 A;  1GT0 C;  1ZK8 A;  2JJ7 A;  1VF9 A;  2HYJ A;  5EGO B;  2NVQ J;  2CQX A;  3G1O A;  5GPC A;  2DA7 A;  1BJZ A;  4D7M A;  2M2E A;  2ZB9 A;  1JKQ C;  1X2N A;  2FJ1 A;  1B8I A;  1WGX A;  3TW7 A;  4I76 A;  2DA3 A;  3S17 J;  2X6O A;  3MN2 A;  4FE7 A;  3JRI A;  4I6Z A;  1CQT A;  4ABZ A;  2XPW A;  4M3G A;  3BQZ A;  2R5Z A;  1YRN A;  1XC5 A;  2WB1 N;  1ZKG A;  3CMY A;  2NS8 A;  2H1K A;  2D5V A;  4A93 J;  4AUX A;  4MO7 A;  1UMQ A;  3BTL A;  2P81 A;  3G1L A;  3H3V K;  3SDG A;  4A3F J;  1GV2 A;  5K7F A;  2E2I J;  1FJL A;  1P7J A;  3H0G J;  2LY9 A;  1DU6 A;  2Y0S N;  1RKT A;  2YU9 J;  2DA5 A;  1AKH B;  3GTG J;  2HI3 A;  1ZQ3 P;  5C4J J;  1PUF B;  1RET A;  3IH2 A;  1JKR C;  1IGN A;  2CUF A;  2E19 A;  3PM1 A;  4X6A J;  5EEA A;  3ZQF A;  3HBL A;  4W1U A;  3LSJ A;  2TCT A;  5K7Z A;  5FLV A;  1QVT A;  4Y7N J;  1POG A;  5FKL A;  3UKG A;  2LKX A;  5BNG A;  2KDZ A;  2HOS A;  1BA5 A;  1MSF C;  2G0E A;  2LD5 A;  4A3J J;  4JYK A;  5EF6 A;  4A3L J;  1T56 A;  2CUE A;  3LSP A;  1HDP A;  5F0C A;  4B3A A;  1HF0 A;  2M9H A;  2XPU A;  1B72 B;  2FQ4 A;  2JA7 J;  3FIS A;  5IYB J;  2VUM J;  3PO2 J;  2R93 J;  3HOV J;  1QPI A;  3IV5 A;  3ZQL A;  2ELK A;  4QSH A;  3LNQ A;  2M34 A;  3LSR A;  2HXI A;  5DTD A;  5HOD A;  2EH3 A;  1WPK A;  5E3L A;  4DZP A;  4XRS A;  3ZQG A;  3BR3 A;  2GLO A;  1JUP A;  3B6C A;  1LFB A;  5J1R A;  1W0T A;  2VI6 A;  2JA8 J;  2KT0 A;  3BR5 A;  2MSY A;  3BG3 A;  5C4X J;  5IYD J;  1B8I B;  3Q0V A;  5FKN A;  2XGD A;  2ECC A;  2OF7 A;  2NOG A;  2JMW A;  2HDD A;  1ENH A;  4FTH A;  4A3B J;  1UHS A;  1JGG A;  2IBD A;  3TP0 A;  2CQQ A;  4S0H B;  1MBH A;  1U9O A;  3HDD A;  1B72 A;  4CYC A;  3W6V A;  1OFC X;  2CRG A;  2DMT A;  4IEJ A;  3DCF A;  2IEK A;  2L7F P;  2QF7 A;  5GP9 A;  1A5J A;  4B1R A;  3HKZ N;  1RKW A;  2X9D A;  4C3H J;  1SFO J;  5F0F A;  4DZJ A;  4A3C J;  4AYB N;  5IPA A;  2M0C A;  2O8K A;  3QPL A;  1WCM J;  2ME6 A;  2O9L A;  1HCR A;  4RDU A;  3PO3 J;  4DW6 A;  1Z77 A;  5DS9 A;  5IP6 A;  1T33 A;  5F27 A;  4XRM A;  4IHY A;  3RKQ A;  1ZTR A;  3GTJ J;  4MFD A;  4XRS G;  2DA1 A;  2MGQ A;  2RAE A;  3HOU J;  2ME0 A;  3JRH A;  3JRE A;  5EDN A;  1NK3 P;  1TWG J;  2DN0 A;  2NVT J;  3Q0U A;  4C2M J;  5IYC J;  1Y1W J;  1MH4 A;  3Q0W A;  4J19 A;  2N8G A;  3OSG A;  3S1M J;  1AU7 A;  3FK7 A;  3S16 J;  1WH7 A;  1LE8 A;  1IRZ A;  3JRC A;  1IUF A;  3DEW A;  4BKX A;  5FJ8 J;  1U8B A;  1HLV A;  4XIC A;  3JRF A;  3S1N J;  1ZR2 A;  1IDY A;  1ITY A;  3BR0 A;  3TW6 A;  2AO9 A;  2WV1 A;  5FLM J;  1X2M A;  3F0C A;  5EG0 B;  2FX0 A;  5EGO A;  3GTO J;  1GVD A;  2EZH A;  3D1N I;  3JRA A;  4BY7 J;  3HOX J;  2LK2 A;  4D5F A;  1VFC A;  4IHX A;  2Y9Y A;  2JWT A;  3GBG A;  3HGY A;  1ORK A;  2XGE A;  3VPR A;  5M5X J;  2HOT A;  5M5Y J;  1K61 A;  2R5Z B;  3GTP J;  5F04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...