1YO5C

Analysis of the 2.0a crystal structure of the protein-dna complex of human pdef ets domain bound to the prostate specific antigen regulatory site
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
QPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Enhancer site of Prostate Specific Antigen Promoter Region
publication title Analysis of the 2.0 A Crystal Structure of the Protein-DNA Complex of the Human PDEF Ets Domain Bound to the Prostate Specific Antigen Regulatory Site
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yo5C00
1U78A 1ZRDA 5E8GA 2EFNA 1J7KA 2K27A 1J2XA 3QPTA 4ZYGA 3SHFA 1OPCA 2YR2A 2NYXA 4NQWA 2CGPA 4EGYA 2DU9A 3COAC 2PN6A 1TW3A 1PP7U 2ZMEB 4G7ZF 2ZXJA 3HOTA 4WX9A 2L4AA 4ZH4F 5DCFA 3V8LA 1WSUA 1T38A 1HXDA 2YPRA 4BXUA 1TQIA 4PZJA 1TLHB 1U5TC 5FB2A 4YG2F 5L3EA 3DPTA 1P2FA 2PI0A 1S8NA 3IC7A 1XSDA 2STTA 5ED4A 1T0FA 3BJOA 4MGRA 3RPQA 3WU1B 4WXCA 4FT8A 4Q5SF 4JK1X 1UCRA 1O7FA 2EFQA 3JAMK 5HOOA 3KP4A 3WGHA 3RKYA 1O57A 2QYOA 4LK0F 2PLYA 4EJUA 1ZG3A 1RZ4A 1YO5C 5L3BA 3BPXA 5DEQA 2ZBKA 3IWFA 1TW2A 3CUQB 3MQ0A 1G3SA 3KE2A 5IT9Z 5ICGA 2JPBA 1R36A 4L5JA 1FX7A 4L9NA 2COMA 2A6EF 2VC0A 2G7HA 1YFHA 1B1BA 5FD6A 1BC7C 3LWFA 4HZFA 2H6BA 4FX0A 4I02A 5CYVA 3KFWX 3WE3A 3TDZC 1T2KA 2VOOA 2VC1A 2GA1A 5E1XA 3WU0A 4LGWA 3CJNA 2R7FA 5J8CA 1CF7A 3TOBA 3MEXA 1XCBA 4CZZA 4HDVA 3HSEA 1B6AA 1XMAA 2XV4S 4EJWA 1GVJA 3WTWC 4RAYA 3WGGA 1IXSB 2EFPA 4IPAA 1JXSA 2A61A 5L3FA 2P6SA 3GFJA 5HLGA 1AWCA 2YX7A 3P9KA 2B0LA 2W84A 3K0LA 4D0PA 4LG0B 3E5XA 1K7AA 4LD5A 2Z3YA 1G4DA 1IRGA 4DQ2A 3E5UA 4GXOA 5HS8A 4HYEA 1SFEA 3E6MA 1XSVA 1Z05A 3NQOA 2ZMEA 3JSPA 2BYVE 3EYYA 3U1DA 5HS7A 4L9VA 1XGMA 4OOIA 1XN7A 1SMTA 4XSXF 3QAHA 3RJPA 2W25A 3QU3A 3U2RA 2VBWA 1ZGAA 4EJVA 3G73A 1R5GA 3KP3A 4CYDA 2V1XA 3K9TA 2V9VA 3F3XA 2A07F 5LGUA 1QZZA 1BI1A 2OZUA 4HV6A 4S04A 1EH8A 2D2WA 1VTNC 2X4HA 5L3DA 1W5SA 4IHTA 1Z6RA 2QENA 1LNWA 3BP8A 4Q48A 5CVIA 4Y15A 2IRFG 3SZTA 2EV5A 2ADUA 3B02A 3K1MA 3RI4A 3E97A 2EFOA 1FBQA 1MZBA 3BY6A 2JT1A 2P5KA 3F8CA 3HRUA 1PDNC 2IT0A 2GXBA 3ML6A 2LF7A 1QNTA 4A2UA 2FRHA 4OIOF 3GWZA 2L3DA 5AIQA 4U0YA 5LHIA 2L4MA 2HTJA 3R61A 2RGVA 1TTYA 3T8TA 1JHHA 1LEAA 2DAOA 3BWGA 4N0BA 2P5VA 4XBFA 1D8JA 4LG0A 4BYYA 1ON2A 1KGSA 4KIBA 5EEHA 2RKHA 4P9UA 3ZMZA 2M30A 3HRTA 3GFMA 3K69A 2L01A 4KT5C 3DFGA 3HHGA 2DQLA 4KDPA 4A6EA 3KP6A 3CLOA 1KU9A 3I5UA 4E70A 4FHTA 2LSOA 2Y75A 2A6HF 2FNPA 4IVNA 1O3QA 3BOQA 4ZZLA 5LRSA 3RKXA 1FT9A 2H27A 3E5QA 2H94A 2NAZA 2H6CA 1IUYA 1UB9A 2JPCA 1P4AA 1YW8A 2HDCA 1W4MA 2HR3A 2MBFA 4M9ZA 2WC2A 5ILSA 2UWMA 1LDKB 1KQ0A 1IN7A 2FSWA 1HBXG 3TQNA 2DBBA 3V8JA 4XLPF 1EV7A 2FBIA 3C18A 3D5LA 2FNAA 1B9NA 5DV5A 4I0BA 1MD0A 3CTAA 2JRTA 1UHMA 4LFUA 3F8NA 2AS5F 2ACJA 4KIFA 4KFCA 3J7AO 3GZ5A 2IA1A 4BQAA 4GGGA 3J80Z 2VONA 1OKRA 1IN6A 1OYIA 2FXAA 3GLXA 1YYVA 2EV6A 2QQAA 4CDGA 2E1NA 3P9IA 2PMHA 3BPVA 4KICA 4HBLA 1HKTA 3GO5A 2V6CA 3F6VA 4HX8A 5IT9K 1ZG1A 5FLXZ 2FQ3A 1RUNA 1H9TA 3WTZA 5K5OA 4G7OF 4HF2A 2ELHA 5D8KB 2OQRA 5HLIA 2A68F 1YQAA 1HKQA 1ZREA 4AIHA 3KZYA 1FC3A 3H92A 2J5PA 3HSFA 5E20A 1IF1A 3V7SA 1QBJA 1H9GA 3WGIA 4JBAA 2ZO4A 1YS7A 1MJ9A 5FFZA 2HYGD 2VXZA 4BH9A 1SD4A 2DT5A 3I71A 2XKPA 1LB2A 1RIOH 4RB0A 1IN4A 1Z91A 4OU0A 2GAUA 1K6OA 1BC8C 4RB3C 4IRGA 5DCMB 5D8LB 5FFXA 2FA5A 1BM9A 1FYMA 4LB6B 1TQMA 3O3KA 3GEZA 5ERIA 1USTA 4P55A 3JSOA 2HTSA 5JVTA 4M71A 1F1ZA 4QWQA 1XCVA 1MGTA 4R79A 3O2PE 3TKYA 3U9GA 4CXFA 2VBZA 3CO6C 5BPDA 4Q4ZF 2W57A 1BBYA 4HLXA 5ILUA 1F9NA 2F5CA 2VE8A 5ICFA 4HX4A 1FWZA 3V7RA 3FMSA 5BQTA 3N4MA 2UZKA 1A04A 2FBHA 3GUDA 3SZPA 2F5EA 3CUQC 2ZNZA 4RB1A 2PBIA 1F5TA 4BHBA 2XHKA 5CVUA 2DPUA 4PGGA 4F7ZA 3EQLF 4L18B 4RB2C 4WWCA 1JHFA 4P5OA 4M6XA 3ZMDA 3ZN1A 2GXGA 5CLSA 3C7JA 1WQ2A 3HRMA 4EGZA 1R1UA 4GYIA 4N9HA 2X0LA 2CSOA 4EM0B 4ZYDA 1BIAA 1MDMA 1EH7A 1ODDA 5D5VB 4S05A 4KNYA 5H6QA 2DLLA 3VFZA 5J6XA 2JTVA 4RGSA 4CGZA 2XIGA 1G3TA 5E17F 3L9FA 5E1ZB 1USSA 2IW5A 3KLNA 5DCMA 2K4BA 2HZTA 3ECOA 2XASA 3ZQ7A 1KA8A 3JTGA 1XMKA 3ELKA 3BJAA 3K1PA 3WTVC 3HSRA 4WK8F 3LQQA 1IXCA 3FF5A 3GF2A 2HWVA 1SD5A 2E1CA 4HQEA 2VBYA 3GYHX 1ZLJA 1TQPA 4M6YA 2XGXA 1WRJA 3K1NA 1J0RA 2V1DA 1U5TB 3F23A 3T8RA 2DQRA 4U0VA 3RTRA 2GZWA 2V1UA 2XUBA 3KEQA 2QBYA 5F1RA 2HQRA 4EM2A 3E3VA 1RI7A 2QVOA 3LAPA 2M45A 3RPUA 1Z9CA 2K86A 3ZMVA 2FU4A 2HKOA 1BI2A 3ZN0A 1K79A 4MTEA 1S6LA 1LEBA 2GQQA 3J80K 1KYZA 2ZJ2A 1Y0UA 2ZFWA 2DI3A 3O6BB 3KP2A 3ZMTA 4ENKA 4GO1A 3OOPA 2NS0A 2W85A 2XKOA 1F4KA 1B59A 1OR7A 3ZPLA 3FWEA 1HKSA 4O3MA 4GYGA 1H0MA 4ESFA 4EV0A 3WG9A 5LBQA 5FLXK 2IJLA 1UFMA 4EMSA 2KIMA 5BPIA 3D0SA 1I5ZA 3B73A 4UUVA 1UHWA 5DD8A 1ZLKA 4MHGA 4ZYHA 4KYWA 5AONA 1ZHFA 2ISYA 3FXQA 4P96A 1O3SA 1GXPA 1ZGJA 1SMYF 1GHCA 4PDKA 2PEXA 2DK5A 2P7CB 3F8MA 2HQNA 4U7BA 1ZARA 3T5XA 4WXHA 2RQPA 1T98A 2MH2A 2DPDA 2F2EA 1GXQA 4I98B 4G6QA 4L0ZB 2OZ6A 3KCCA 4M9XA 1AOYA 3GZ6A 3FMRA 3IRQA 4A5NA 4RS8A 4MEYF 2FMLA 2Z99A 5KVRA 2RC4A 3ERED 1IN5A 3I58A 5JFRA 3W6KB 4Y17A 1HW5A 1U5TA 3T1BA 3FHZA 3IKVA 4KA4A 3I4PA 5ILVA 4MEXF 1S29A 2R3SA 2RN7A 4TV7A 3HYIA 1FPQA 3TGNA 2O61A 3JTHA 2EV0A 1WKMA 3MWMA 5BS6A 2DK8A 3EDPA 1G3WA 3EETA 2IPQX 5D5XB 1T39A 2G7UA 2KJBA 2P6TA 1T6SA 1U3EM 1MJBA 4QLCU 1Z6TA 2J5OA 1KQ9A 5LLQA 4NHJA 2NNYA 1KU7A 2OQGA 4A12A 1OYYA 3H3UA 3L00A 4I0AA 4BAYA 5L3CA 2Y0MA 1KU3A 1P6RA 2Z33A 1S3JA 1FP2A 2RDPA 2DTRA 2RVCA 1R00A 2O3FA 2XAHA 1S7OA 3LFKA 5HLHA 1DDNA 4IJAA 1OMIA 2WTEA 3L09A 3TO6A 3RDIA 5BMZA 2D45A 1U6GA 1I1GA 5HDGA 5CVVA 2IA0A 1ZN2A 1HSJA 1ZRCA 1IXRC 5D4RA 4UNOA 1QGPA 5BOXA 4UVAA 1IAWA 2FOKA 5DUKA 1I6XA 4LLGF 3ZMSA 1LQ1A 3HIFA 1KYWA 4N9IA 3QU6A 2HGCA 5JHUA 3HUGA 2Z9OA 3I53A 3M1EA 2O0YA 4CICA 4ZYEA 2E7WA 4IRIA 1HQCA 4I01A 1D3YA 2K4JA 3N97A 1E2XA 2MD5A 2LDUA 3FX3A 4U0WA 3HTUA 3KP5A 3TOAA 2GWRA 2ISZA 4WCGA 5DUIA 1DPRA 5LHHA 4UHTA 1G6NA 4A5MA 3K2ZA 3I59A 4YFNF 3BZ6A 4HLYA 4O5VA 1YS6A 2HYFA 3DQVC 3GX4X 4EJOA 2HOEA 3R4KA 3CUOA 4MQ9F 4PCQA 2QM3A 3FMQA 1FY7A 1HSTA 1OYWA 4UXNA 2LKPA 1HW2A 4HX7A 1RNLA 1ON1A 2MC3A 2ESNA 3IL2A 1PP8F 1STZA 4UV9A 1O3TA 2XROA 2FMYA 3ZMUA 1REPC 2WV0A 4LMYA 1Z7UA 3IWZA 3HTSB 3ZP5A 3TO7A 2Q8KA 3J81Z 1MDMB 3MZHA 1ZRFA 2QQBA 4IRHA 3BDDA 3ABUA 1E17A 4HW0A 1QPMA 5A2QZ 3NEUA 3S2WA 1YG2A 4Y13A 3ULQB 2Y48A 2Z5UA 4Q47A 4OIQF 2F5FA 1P4XA 3MAJA 1SAXA 2BGCA 3EUHA 4L9JA 2LNBA 1KQ8A 2D1VA 3Q5FA 3F22A 5L3GA 3E6BA 3FM5A 4KIGA 1LDJA 1FSHA 4I09A 2HFHA 2A5YB 3BJ6A 1XSXA 2VN2A 1SFUA 2O8XA 4EM1A 5TJJA 2VE9A 3SXYA 2PMUA 4L0YB 5EEGA 4RGXA 1SD6A 4A0XA 4L5IA 1BN5A 2YSRA 3F21A 3DXJF 3R0AA 4L9TA 4CHUA 2QBYB 4DNCA 2QWWA 3M9AA 3KP7A 2K02A 2PFBA 2E7XA 5D6EA 5D5WB 4KN4X 5E1WA 4XSZF 4XLNF 1YTYA 2PG4A 4HOBA 4M73A 4BNCA 1D5VA 3Q9VA 1XB4A 6PAXA 3FM3A 3RYPA 1XD7A 3KLOA 2EB7A 2H09A 3LA7A 1IW7F 1R58A 3E6CC 2C6YA 2Q0OA 3L2CA 1DPUA 1HW1A 2KIUA 3PQJA 2YX4A 2OBPA 1QQIA 1CGPA 2EK5A 5LEJA 2UXXA 2IP2A 3DF8A 3LA3A 1U2WA 4AIJA 5LRRA 1FOKA 2XAFA 2DO7A 1PUEE 3V8KA 4UVBA 1C0WA 3DKWA 4IF4A 1BIBA 2IVMA 4A6DA 2BV6A 2L02A 1BOAA 2FE3A 2FF4A 2OA4A 1D8KA 3F8FA 4XRFA 2EJRA 2M1BA 4PGHA 3WTYC 1QO0D 1DP7P 5HDKA 4FX4A 2L54A 5LHGA 1FZPB 2RNJA 5H6RA 3QP5A 3REOA 5TRDA 2MLGA 4ASNA 3TDUC 3F8BA 1YW9A 1SFXA 5F64A 2FBKA 4G8XA 1R1VA 5E18F 2KJCA 1R7JA 1I1SA 4JQFA 4ZZDA 2EWNA 3QP6A 1YW7A 2VBXA 1K78B 2RV8A 4K2EA 3MZYA 4ON0A 1ZAOA 4KMFA 4G94A 1SD7A 1FBSA 4EJTA 1R22A 2ETHA 4YIIA 2ZCWA 2F5DA 5FD5A 5FO5A 2ZNYA 1FLIA 2G9WA 2AXLA 3QPHA 1XGNA 1ZYRF 4ESJA 1B9MA 2Q2EA 4OMYA 3GXOA 2P5LC 2VT2A 2MLKA 3KEOA 1R23A 2BBYA 5K5QA 1JE8A 3T0YA 2M87A 2A3SA 3Q9SA 2YU3A 4RGRA 4ESBA 5D6FA 1L3LA 5DD4A 1X3UA 3BROA 3ISPA 4GCVA 4ENMA 4HAMA 4R8HA 4B09A 1TBXA 5E8IA 1P4WA 3QOPA 3P9CA 4U7DA 2KIFA 4M72A 4EQQA 4HF0A 3MFKA 1W5TA 5IT3A 3IHUA 1XGSA 1ZG5A 2HEOA 3WTUC 2P4WA 1EH6A 3H3ZA 5K5RA 3CUQA 3QRFF 5HS9A 5CJ9A 2CWEA 3GW2A 3MCZA 1WI9A 1IRFA 3HRSA 4AD9A 3FXUA 3ECHA 3J81K 1JGSA 2TDXA 1XDUA 1BI0A 4WXDA 2K7LA 3E6DA 4HV5A 3I59B 3M7GA 3V7CA 3DP7A 5A2QK 2VODA 3GFIA 1MJAA 1K78A 2DW4A 3FXRA 1NHAA 3C1DA 4RGUA 3WTSC 3F6OA 2EA2A 5CVJA 4OMZA 4YFKF 1R1TA 3DPLC 3JAMZ 1YLFA 1YIOA 1G3YA 3LA2A 4M9SA 2QQ9A 3P7NA 4UV8A 2JSCA 2O6GE 1XDSA 2LF8A 2OAZA 3VODA 3NRVA 3M8EA 3VB2A 5AIPA 4AIKA 4G9YA 4MNUA 2CYYA 2QLZA 5CVRA 3OV8A 2BE5F 4AVPA 2PQ8A 5FGMA 1P92A 1L0OC 1LVAA 1W7PB 1S7AA 2MA3A 3R6SA 2XVCA 2EFWA 4YFXF 2BEOA 2PJPA 2CW0F 1O3RA 3VEPA 2QZ8A 4B8XA 1W7PD 4LLLA 5LEKA 1R5HA 4UVCA 4KN7X 3G3ZA 4ETSA 2P8TA 4RAZA 4AWXB 2XAQA 3DV8A 4I7HA 1U8RA 2ESHA 5HDNA 4LK1F 2CG4A 1J75A 4OIPF 1FYLA 2P7VB 1QZYA 4Z2YA 1XGOA 5KK1A 4NB5A 5ICEA 4P9FA 2GA2A 4IHSA 3DEUA 3R60A 3LQRA 1J59A 5DDGA 2V79A 4MQVA 1B4AA 1FP1D 2QUFA 5HVQC 2VOPA 3FZVA 2KKOA 3ABTA 2UXNA 3I64A 4H0EA 1BJAA 3GFLA 4KUMA 3W6JB 2JZYA 4R1HA 3LSTA 2XAGA 3L7WA 3GVAA 3RIRA 2W24A 5DYMA 1ZH5A 3VOEA 3WTTC 2CO5A 2O03A 5LGTA 2OD5A 4HQMA 4G6DA 5K1YA 3SQNA 4KMUX 1Z1DA 3R0JA 1FBUA 1ONVA 1TNTA 4ENNA 4HDUA 2VT3A 5D5UB 1LDDA 4A0YA 3I0TA 2D1HA 1J5YA 2MH9A 5H20A 3JW4A 4YIFA 4LJZF 1KU2A 2STWA 4CO8A 2WWYA 2KRFA 1BI3A 2ZKZA 3C3WA 3PFIA 4IXAA 4EVIA 5D4SA 3KZZA 2HKXA 4HF1A 5JR3A 1V4RA 1W7PA 3ROUA 4G7HF 4MTDA 4ENJA 3WTXC 3IRRA 3HHHA 1J9IA 2IA2A 2CFXA 3PQKA 2A69F 1DUXC 3RKWA 3TO9A 2EA4A 1WWXA 4HA8A 1TNSA 4BHPA 2XRNA 1V3FA 3I54A 3WE2A 3LAJA 1RUOA 1O7LA 3WODF 3CDHA 2NRAC 2CQKA 4OINF 4LB5A 1I27A 5ICCA 1IZ1A 3F72A 2M8EA 2M5WA 1Q1HA 1LJ9A 2R7DA 1FYKA 4M74A 2DFIA 5JI6A 2GIVA 3KETA 2OU2A 1FNNA 1IN8A 3M8FA 4I2OA 5F6FA 1CF7B 5LGNA 1FSEA 1ULYA 3SFZA 4A0ZA 4BHCA 2FEZA 3V4GA 2XAJA 4LLNA 3IKTA 2HS5A 3HOSA 3AAFA 3RYRA 3EYIA 2NNNA 4WF2A 4O6JA 4OIRF 5J8FA 3CO7C 4U88A 1MKMA
chains in the Genus database with same CATH superfamily
4FQGA 1WJAA 1U78A 3S3OA 1ZRDA 4BEHA 5E8GA 2W82A 4W97A 4H4KC 1X1CA 5B1AH 2XSJC 2EFNA 2O7OA 1J7KA 2K27A 1J2XA 3QPTA 4ZYGA 2AO9A 3SHFA 3ZCOA 2YU9J 1OPCA 2YR2A 4E4HA 2NYXA 1OFCX 4NQWA 3CDIA 3DEWA 4IZZA 3DTIA 2CGPA 2H1LA 4EGYA 1RPWA 2DU9A 2KQRA 2E60A 2JSPA 3S3NA 3E7LA 2ELJA 1ETKA 4XK4A 2XSDC 2PN6A 3COAC 4CCJA 1X2NA 2CFOA 3IH4A 4IEJA 1TW3A 2Y69H 1PP7U 2ZMEB 4G7ZF 2ZXJA 3BZCA 3HOTA 4WX9A 2L4AA 4ZH4F 5K7ZA 2VQHA 5DCFA 3V8LA 4XRSG 1TWHJ 1WSUA 2OJED 1T38A 1HXDA 2YPRA 3DKYA 5GP9A 4BXUA 1TQIA 4PZJA 1TLHB 1U5TC 5FB2A 4YG2F 4IOAF 5L3EA 2B7EA 3DPTA 4LG3A 1P2FA 2PI0A 3PL8A 1S8NA 3IC7A 1XSDA 2STTA 5ED4A 1T0FA 3BJOA 4MGRA 3MKLA 5TGTA 4N4NB 4E7KA 3RPQA 3WU1B 4WXCA 1PUFA 2XPUA 5IYDJ 4FT8A 4Q5SF 4JK1X 1AU7A 1UCRA 1O7FA 2JK3A 2EFQA 3JAMK 1V55H 2UV1A 3VDXA 5HOOA 3KP4A 3WGHA 4UB8C 2Y9ZA 1WJ5A 2XB0X 3RKYA 1O57A 2QYOA 4LK0F 3BTLA 2PLYA 4EJUA 3DWLE 2FQ4A 4BE1A 1ZG3A 1RZ4A 1U9NA 1YO5C 3PFYA 5L3BA 4E6KG 2X1EA 3BPXA 5DEQA 2ZBKA 3IWFA 2E1MC 1TW2A 2GBYA 1J09A 3CUQB 3MQ0A 5GAEJ 1G3SA 3KE2A 5IT9Z 5ICGA 3HOVJ 4Y4RA 1GUUA 1G8XA 3FKJA 3FXMA 5EZGA 3PJRA 2JPBA 1R36A 4L5JA 1FX7A 4IQJA 4L9NA 3BT9A 1EKEA 2COMA 3ASOH 2A6EF 2IEKA 2VC0A 5KAIC 2Z1DA 4F3QA 2G7HA 1YFHA 1B1BA 3ZRGA 5FD6A 1BC7C 2LKSA 1Z77A 5IP7J 4F52A 3LWFA 4HZFA 2R7VA 2H6BA 4FX0A 4I02A 3BLYA 3TW7A 5CYVA 4JX5A 1JGGA 2BY3A 3KFWX 3WE3A 4HSRA 4IKFA 3TDZC 4BU2A 1T2KA 4P1WA 5F04A 3UKGA 2VOOA 4ITVA 2HDDA 1S72I 2VC1A 2GA1A 5E1XA 1APLC 2X1CA 3WU0A 1BW6A 4LGWA 3CJNA 2R7FA 2GLOA 5J8CA 1CF7A 2MC4A 4KT6A 3KYDB 3TOBA 3S3MA 1T33A 3B6CA 3MEXA 2KRHA 1XCBA 4CZZA 4HDVA 1HDPA 2EZHA 3HSEA 1B6AA 1XMAA 4G12A 4XKWA 2XV4S 3M8JA 3Q0UA 1WVRA 4EJWA 1GVJA 2GM4A 3WTWC 4RAYA 1SVMA 3SDBA 1I39A 3WGGA 1IXSB 2EFPA 4IPAA 1JXSA 2A61A 5L3FA 3DBRB 4II2A 2P6SA 3GFJA 3QWLA 3LSMA 1MH4A 5HLGA 1AWCA 2YX7A 3OIQA 3P9KA 2B0LA 2CU7A 4B3AA 2W84A 5IOZA 2JMWA 3K0LA 2JUGA 3L2UA 4D0PA 2LOOA 2R7WA 4LG0B 3E5XA 1K7AA 4LD5A 2Z3YA 4RM2A 1G4DA 2TRTA 1IRGA 3BCAA 2X51A 1LFBA 4DQ2A 2NVUB 3OYJA 3E5UA 3NWTA 2M0MA 4GXOA 5HS8A 4HYEA 1SFEA 1SFKA 2YUSA 5KAFC 2X9DA 3E6MA 3FHNA 5EYRA 1RKTA 1X58A 2I8DA 1E0EA 1XSVA 1Z05A 3H0GJ 2R4GA 2R93J 3NQOA 2ZMEA 3JSPA 1WFXA 3JRHA 4BY1J 2BYVE 3EYYA 2B9SA 3QODA 3U1DA 1AA7A 2HQAA 3FK6A 4L9VA 1XGMA 4OOIA 4XN0A 5HS7A 1CQTA 1SC7A 3DU6A 4BXXJ 1XN7A 1SMTA 1ZGWA 2CW8A 3RZDJ 4XSXF 3QAHA 3RJPA 4HNUA 2W25A 1E3HA 1W36D 1IC8A 4B43A 3CC4I 3QU3A 5EF6A 3U2RA 3AL0B 2M7BA 2VBWA 1IG7A 2X6WA 1ZGAA 2K3FA 4HG2A 2ZXWH 4EJVA 2IS2A 5JHFA 3A4CA 3G73A 2HNHA 4AIDA 2EQRA 1R5GA 3KP3A 4CYDA 2V1XA 3K9TA 1YE9A 2V4JC 2V9VA 1VQNI 2BOLA 1JT0A 3F3XA 2A07F 2WADA 5LGUA 1QZZA 1BI1A 1LKXA 2OZUA 4HV6A 3W2VA 4S04A 1EH8A 1Z67A 2PMZA 4GDFA 3X2QH 1WJCA 1G2HA 2BW3A 3OYMA 2D2WA 1E3PA 1H89C 1VTNC 3H36A 1TT5B 5F0CA 4CCKA 2X4HA 4B1RA 3ZOBA 3CP2A 5L3DA 1W5SA 4IHTA 1Z6RA 2QENA 4QSHA 3A01A 2HZDA 1LNWA 3BP8A 1TZLA 2MABA 4Q48A 5CVIA 3H3VK 1A6IA 3CDLA 4Y15A 3OSGA 1BW5A 1MSFC 5F0HA 2IRFG 2VJIA 3W6VA 1SVLA 2EV5A 3HPGA 3SZTA 1IO2A 3BR2A 4DOZA 2ADUA 1S5LC 3B02A 3K1MA 2M7AA 3RI4A 3DEEA 3E97A 2XB5A 2EFOA 1FBQA 3H5RA 3V42A 1MZBA 2DFEA 1NK3P 1T95A 2JT1A 3BY6A 2P5KA 3F8CA 3HRUA 1PDNC 2IT0A 2X85A 3ML6A 2GXBA 2LF7A 3DTKA 4RMNA 1T8IA 1QNTA 3EUHC 3IUOA 4A2UA 1FTZA 3TW6A 2FRHA 3D1NI 1MBKA 2KIQA 4OIOF 3GWZA 2L3DA 4RAFA 1BR4A 5B66C 3FDYA 5AIQA 1WJEA 5KHDA 4KITB 3HPHA 4U0YA 5LHIA 2L4MA 2HTJA 2WV1A 3R61A 5FKKA 2RGVA 1MNMC 3HOYJ 3EPZA 1TTYA 2ZXHA 3T8TA 2JA8J 3OYEA 2MG4A 1JHHA 1Y1VJ 1LEAA 2DAOA 2Y2ZA 3BWGA 3PUBA 4OAYA 4C2UA 4N0BA 2P5VA 4XBFA 1D8JA 4LG0A 4BYYA 1ON2A 1KGSA 3TMOA 4KIBA 3CC2I 1B8IA 5EEHA 2RKHA 5F08A 1MMDA 4P9UA 3ZMZA 1N25A 2M30A 1JTYA 2VKHA 5C4JJ 2BY1A 3HRTA 2QCOA 3GFMA 3K69A 3LSGA 1YRNB 2L01A 4KT5C 2LR8A 3DFGA 3HHGA 4PJ0C 2DQLA 4KDPA 4A6EA 3KP6A 3CLOA 1KU9A 3I5UA 4E70A 4FHTA 2LSOA 2Y75A 2A6HF 3BTIA 2FNPA 4IVNA 1O3QA 2OTLI 3BOQA 2XPWA 4ZZLA 5LRSA 3RKXA 1FT9A 3FIWA 2H27A 1X1DA 3E5QA 1MIJA 2H94A 4IHWA 2NAZA 2H6CA 1VQKI 1IUYA 1PVEA 1UB9A 2JN6A 2JPCA 1P4AA 1YW8A 2K9NA 3K70D 4II3A 2HDCA 1W4MA 2QQ8A 3H35A 1W5CC 2ME0A 2HR3A 2MBFA 4M9ZA 1YOVB 2LVSA 2WC2A 3K10A 5EEAA 4XN3A 5ILSA 3D5RC 2UWMA 1LDKB 2VKEA 1KQ0A 1IN7A 2FSWA 2V9PA 1HBXG 1AHDP 3TQNA 2DBBA 3V8JA 3BCBA 2NXNB 3C18A 1EV7A 2FBIA 4GRIA 3D5LA 4XLPF 2FNAA 3HBLA 2DCEA 1B9NA 5DV5A 4I0BA 1RETA 2JUCA 3FXKA 1MD0A 2EZLA 4A3KJ 1IRZA 3CTAA 2JRTA 1UHMA 4LFUA 1NTCA 3F8NA 2AS5F 2ACJA 3K4KA 4KIFA 4EATA 4KFCA 3J7AO 3GZ5A 2HOAA 5F1JA 2IA1A 3H1CA 4BQAA 4GGGA 2HOSA 2CUZA 3J80Z 2VONA 1OKRA 1IN6A 1OYIA 4QTRA 1T0FC 4CSWA 2O5RA 3FBIB 2DA2A 3RZOJ 5EDNA 1X4OA 4XRSA 1GT0C 3WHBA 3CQZJ 3C2BA 2FXAA 3GLXA 1R5ID 1YHQI 1QZEA 1YYVA 2DYRH 2FD5A 2EV6A 2ZSIB 2QQAA 4CDGA 1ERDA 1WCMJ 2E1NA 4BEHB 3P9IA 2PMHA 2VASA 3BPVA 4KICA 2KMUA 1BR2A 2XC7A 4HBLA 3G4SI 2NVXJ 1U9OA 1HKTA 2H8WA 1WHUA 5IYBJ 2PJRA 3GO5A 2DOEA 1OCOH 2LG4A 2V6CA 3F6VA 4HX8A 2BY2A 5IT9K 2E5ZA 3CF2A 1ZG1A 3S8PA 5GAHJ 5FLXZ 2FQ3A 1RUNA 1H9TA 5GTIC 3O8GA 4E7HA 3WTZA 5K5OA 4CYCA 3BC8A 3VYSB 4G7OF 4HF2A 2ELHA 5D8KB 2OQRA 5HLIA 2RAEA 3OSFA 2EIJH 2ME6A 2A68F 1YQAA 1HKQA 1ZREA 3DTEA 1LFPA 4AIHA 3KZYA 2LBFB 1FC3A 2CUJA 4F93B 3L2QA 3NWSA 4OWRB 2EPFA 3H92A 2J5PA 3HSFA 5E20A 1IF1A 2G0EA 2W4SA 3S15J 2EZIA 2XF7A 3K4JA 3LOCA 1YI2I 4V2FA 3V7SA 1VFCA 1QBJA 2VPLA 2PMZN 3CCMI 1JKPC 1H9GA 3WGIA 4C3HJ 4JBAA 2GOXB 4J19A 1V54H 2W48A 2ZO4A 1YS7A 3HOXJ 4ZTJA 2E2JJ 5HLTA 1YRNA 2OTJI 1MJ9A 2E19A 5FFZA 2HYGD 2YS9A 4KJZA 2VXZA 4BH9A 1QVUA 1SD4A 2DT5A 4C9YA 2X1DA 2R7SA 3CC7I 3U1KA 3I71A 2XKPA 4A3BJ 1LB2A 3GTKJ 1RIOH 3CJRB 1R9TJ 4RB0A 1IN4A 1Z91A 4OU0A 2GAUA 3JRFA 1K6OA 1BC8C 2JWTA 1MNEA 4RB3C 4IRGA 2CQNA 5DCMB 4QPOA 5D8LB 2HXIA 2RNGA 5FFXA 2FA5A 4MLOA 1BM9A 4BJTA 2ZJPF 1HA8A 1FYMA 4LB6B 2KDOA 1TQMA 4NDLA 3O3KA 3GEZA 3VYRB 5ERIA 1P7JA 1USTA 4P55A 1UAAA 1GV2A 2ZC2A 3JSOA 3JRBA 2HTSA 3BR3A 1JUMA 2ZMEC 5JVTA 2WAEA 3OYAA 4M71A 1H8AC 3CMAI 1N77A 4DBQA 5FROA 5J40A 1F1ZA 4E7IA 4QWQA 1XCVA 1XTAA 1A35A 3KEYA 1MGTA 4R79A 3O2PE 3TKYA 3U9GA 4CXFA 2FX0A 2VBZA 3CO6C 3TEDA 3JRGA 5BPDA 3ZQGA 4XL9A 4AC0A 4Y7NJ 2A5WA 4Q4ZF 1V5FA 4MIMA 1TWCJ 4MFDA 2W57A 3G1MA 1BBYA 4HLXA 4U87A 4FE7A 5ILUA 4XRMA 1F9NA 3CP8A 4XLHA 2F5CA 2VE8A 1WI3A 5ICFA 3ZQIA 4HX4A 1FWZA 2DFHA 3V7RA 1H88C 5FKNA 2KZVA 3A03A 3FMSA 2HU9A 2JVGA 4ZC3A 5J4VA 5BQTA 3BZKA 3N4MA 3S17J 2UZKA 1A04A 2FBHA 4LITA 3OOUA 3GUDA 4PJJA 3SZPA 3SZGA 1XPXA 2F5EA 3W2AA 3HDDA 1FJLA 2L2OA 2GXAA 3RPUD 3CUQC 3J7AY 2ZNZA 3PUFA 4RB1A 2Y0SA 3JRAA 3WG7H 2PBIA 3G1OA 4JX6A 3W2WA 1F5TA 4BHBA 2XHKA 5H2FC 5CVUA 2BXZA 3CJTB 2DPUA 3FK7A 4PGGA 4PJLA 4F7ZA 5FRMA 3EQLF 1UG2A 4L18B 4NNJA 3HKZA 3IAS2 4RB2C 4WWCA 1RESA 3BR0A 1JHFA 2LBFA 4P5OA 5J1UA 4M6XA 1VZ0A 2LKXA 3ZMDA 3S1NJ 3ZN1A 2AQFA 3F0CA 2GXGA 3ONQA 4DYQA 2CV2A 3CCRI 2DA5A 5CLSA 4NC6A 1HF0A 2L9NA 5B3SH 3C7JA 1WQ2A 3HRMA 4EGZA 1R1UA 4GYIA 1NG7A 2I10A 3HZJA 2XF5A 2X0LA 4N9HA 3GTJJ 1NH3A 2O9LA 1ITYA 1K61A 2VQCA 5E3OA 1YX3A 4NUBA 2CSOA 2IS6A 4MFEA 1A31A 1Y8RB 4EM0B 1R6RA 5FKMA 2QA4I 4ZYDA 2HOTA 1BIAA 4PSXA 3K4BA 5J1RA 1MDMA 1EH7A 1ODDA 5D5VB 4S05A 4KNYA 4BDYA 5H6QA 3Q0WA 1POGA 2VKDA 1K83J 4KISA 2DLLA 5IOYA 3ZGKA 3VFZA 5J6XA 2JTVA 4RGSA 3CCVI 4CGZA 2XIGA 1QPIA 1G3TA 2WY8Q 3A1YA 2DOFA 3GTGJ 2CRGA 3H9JA 5E17F 3L9FA 2BW3B 5E1ZB 4CA0A 5E3MA 5J4YA 1USSA 2IW5A 1Y39A 1ETOA 3KLNA 2HQ5A 2R7OA 5DCMA 1VQMI 1W1WE 2K4BA 2HZTA 2QKLB 3ECOA 1XS9A 2XASA 1KONA 3ZQ7A 3A01B 4HNVA 1KA8A 3JTGA 2XRLA 4XOPA 1XMKA 1T08B 2DTZA 3ELKA 3BJAA 3K1PA 1I50J 3SEZA 3WTVC 3HSRA 3K2AA 4WK8F 4M3DA 1YX5A 4ZJZA 3LQQA 1IXCA 3FF5A 3GF2A 4IQ4A 2HWVA 1SD5A 2E1CA 4HQEA 2X6XA 2K9MA 1TWAJ 4CCNA 4CZCA 2MFZA 3KZIC 1Z3XA 2VBYA 4IL6C 3GYHX 1ZLJA 4RM3A 3CF5F 1TQPA 4A3IJ 1W36C 3FISA 2KZGA 3UR3C 4M6YA 2XGXA 2JJ7A 3ZQLA 1WRJA 3K1NA 1J0RA 4XLCA 2V1DA 1KZHA 1U5TB 3F23A 3T8RA 2DQRA 4U0VA 3RTRA 2X48A 2DN0A 2L5QA 1ACIA 4XONA 1IDZA 2GZWA 2V1UA 3AFHA 2FOWA 5IY5H 3DLAA 3ZQFA 2XUBA 3KEQA 2QEXI 1GDTA 2DA1A 1VQLI 3M3YJ 2QBYA 5F1RA 2HQRA 2IGNA 4JX4A 4EM2A 4ABZA 1Y6IA 3E3VA 1RI7A 3UNGC 4DJAA 2QVOA 3LAPA 2CW7A 1PYVA 2M45A 2P81A 2WY7Q 3RPUA 1Z9CA 2K86A 4Y3OA 3ZMVA 2FU4A 3JRDA 4LIVA 3GTLJ 2HKOA 1FOWA 2NVTJ 1BI2A 1UHSA 1B8IB 2E2IJ 1SAUA 4YELA 3ZN0A 4XNFA 2FJ1A 1K79A 2E1MB 1Y1WJ 2WB1N 4MTEA 2NVYJ 1S6LA 1A5JA 2VJJA 1LEBA 2GQQA 5M5XJ 3J80K 2A6TA 1KYZA 2ZJ2A 1Y0UA 3BG6A 2ZFWA 5CQGA 4DIQA 1WJFA 2DI3A 2IS4A 5GPAA 5M5YJ 3O6BB 1WH5A 4YEJA 1VI0A 1X19A 2M34A 3KP2A 2OC6A 3ZMTA 3PSIA 4ENKA 4GO1A 3OOPA 2NS0A 4E7ZA 4DYCA 2W85A 3N05A 2XKOA 1XC5A 4D5FA 1B59A 1F4KA 5FRNA 3CCLI 1OR7A 4IHVA 3ZPLA 4FCYA 2R5YA 3FWEA 3G6EI 4M6VA 1HKSA 4O3MA 4AU7A 2XDVA 1FMVA 3S93A 4GYGA 3LFUA 1H0MA 4ESFA 2M8GX 2OF7A 4EV0A 3OYIA 1LUJB 2CQQA 3WG9A 5LBQA 3QPLA 5FLXK 2IJLA 2X6YA 5K7FA 1TWFJ 1TP4A 1UFMA 3ZQHA 2KIMA 4EMSA 5BPIA 2DXIA 3Q3SA 1WJBA 5DTDA 3D0SA 1UG0A 3PNVA 1I5ZA 3B73A 3S1RJ 4UUVA 3KYCB 1UHWA 3CD6I 1BOBA 2VQLA 3GTOJ 5DD8A 1ZLKA 3AG4H 4MHGA 4ZYHA 4CCMA 4KYWA 2MW8A 5AONA 4C2MJ 1Z0XA 2QKMB 2COBA 1ZHFA 2Y31A 2ISYA 2KRCA 3FXQA 4P96A 2RREA 1O3SA 1GXPA 1ZGJA 2L9SA 1OCPA 3E1SA 3LMMA 2VQGA 1SMYF 1GHCA 4PDKA 2KL4A 2PEXA 4FE4A 4AM3A 5J1YA 2DK5A 2P7CB 3F8MA 3CCJI 2HQNA 4U7BA 2Y0SN 4IOCF 1ZARA 3T5XA 4WXHA 2CV0A 2PX9A 2RQPA 4BXFA 1T98A 2MH2A 4XLEA 2DPDA 2F2EA 1GXQA 4I98B 4G6QA 5DM7F 1ZELA 5BNGA 2OUMA 4BKXA 3HKZN 3ESWB 4L0ZB 2OZ6A 3KCCA 4M9XA 1AOYA 3RQ4A 3H0DA 2Z2SB 2BVLA 3GZ6A 2Y9YA 3FMRA 2LLKA 3IRQA 3HM5A 3JR9A 4A5NA 2PJRB 4RS8A 4MEYF 5CQEA 2FMLA 2Z99A 3K70C 1RRJA 2LH9A 2LP0A 5KVRA 4A3LJ 2RC4A 3ERED 1IN5A 1V5GA 2QSFX 3I58A 5JFRA 3WHCA 3W6KB 3SFIA 4BDZA 3NAUA 2CQ7A 4Y17A 1HW5A 1OCTC 1HC8A 2IGMA 1U5TA 2M3AA 3M4OJ 1MBFA 4A3CJ 4DZPA 4CYCB 4NC7A 1ZTRA 4BS9A 3T1BA 3FHZA 4HEA2 2IXSA 3HC7A 3OYGA 1MBGA 3I4PA 3IKVA 4KA4A 3QYFA 1WGXA 4ZYAA 5ILVA 4MEXF 1S29A 2R3SA 5IYCJ 2RN7A 4TV7A 3HYIA 5J3LA 1FPQA 1QHGA 3TGNA 2IS1A 1VQ5I 2O61A 3JTHA 2EV0A 2KT0A 5KNLA 1P7IA 1WKMA 3D5SC 3MWMA 5BS6A 3S1MJ 2DK8A 2ECCA 3EDPA 1G3WA 3EETA 2IPQX 5D5XB 1T39A 2IGOA 2JA7J 2G7UA 2KJBA 2LY2A 4X6AJ 3IAM2 2P6TA 1T6SA 2M4KA 1U3EM 1MJBA 4QLCU 2W7NA 2EH3A 1VQ8I 1Z6TA 2J5OA 1KQ9A 2ECBA 3S2HJ 5LLQA 3K4LA 4IHYA 4NHJA 2NNYA 1KU7A 3HG9A 3H9QA 2OQGA 4A12A 2Q1ZB 1OYYA 4RAGA 3H3UA 3L00A 4I0AA 2LY1A 4BAYA 2Y0MA 5L3CA 1KU3A 1P6RA 5DM6F 5GTHC 2Z33A 3MKWB 4E7JA 1S3JA 1FP2A 4BJ6C 3L2WA 2RDPA 2DTRA 2RVCA 1OLTA 1R00A 3TBIA 2O3FA 2XAHA 3CCYA 1S7OA 3GCMA 3GLLA 1R4MB 3LFKA 5HLHA 1DDNA 2DOAA 4IJAA 3ERMA 3HL2A 1OMIA 4F55A 2WTEA 3L09A 3TO6A 3CCEI 3RDIA 1QHHD 5BMZA 4N4OB 3OL3A 2D45A 1U6GA 1I1GA 5HDGA 1IJWC 2FUG2 5CVVA 4NC8A 1FIPA 3GMEA 2EIKH 4A3JJ 2I5UA 2IA0A 2EILH 1IUFA 1ZN2A 2CJJA 1VQ4I 1HSJA 2DA3A 3DPUA 4PFPA 1ZRCA 3OMYA 1IXRC 5D4RA 4UNOA 1D0XA 1QGPA 5BOXA 4UVAA 1IAWA 2FOKA 5DUKA 3Q0VA 1I6XA 4LLGF 4BBRJ 4UUSB 3KPHA 3ZMSA 2KDZA 1LQ1A 2D5VA 3HIFA 1KYWA 5CPRB 4N9IA 2MYSA 3QU6A 3S32A 2NS7A 2HGCA 3GTQJ 5JHUA 3HUGA 2Z9OA 3QQAA 3I53A 3IH3A 3M1EA 2L9RA 2O0YA 4CICA 4ZYEA 5FLVA 2E7WA 4IRIA 1BJZA 1HQCA 1ORKA 2R7UA 3GBGA 1D3YA 2K4JA 4I01A 5EG0B 3N97A 3OYDA 3MKZA 1E2XA 2KISA 4XLFA 4E7SA 1TC3C 2MD5A 2LDUA 3FX3A 4U0WA 3HTUA 3KP5A 3TOAA 5B5EC 3I9V2 2GWRA 2BY0A 2ISZA 4WCGA 2KHMA 5DUIA 3A0BC 1DPRA 2OCEA 5LHHA 4UHTA 1G6NA 4A5MA 1RR8C 3K2ZA 5M3MJ 2E2HJ 1XMXA 3I59A 4YFNF 4S0HB 4FASD 2MSYA 1ZQ3P 3HEFA 3BZ6A 1X1BA 2L7ZA 1FOXA 4HLYA 5M3FJ 1D0ZA 4O5VA 1JKOC 2HYJA 1YS6A 2HYFA 5HNHA 1O4XA 4HRIA 3O8HA 3DQVC 3GX4X 4GFBA 4XICA 4EJOA 2HOEA 3ABMH 3R4KA 3CUOA 4MQ9F 4PCQA 2CS3A 2QM3A 3FMQA 3FXJA 2ICWG 2EBIA 2ZFUA 2M2EA 3OR2C 1FY7A 1HSTA 1OYWA 4UXNA 3OYLA 2LKPA 2W1OA 2EINH 5FKLA 1HW2A 1LFUP 5TISC 4HX7A 1RNLA 2ZJRF 1ON1A 1LPQA 2DT7B 2MC3A 3G2BA 2ESNA 1I3AA 3IV5A 3IL2A 1PP8F 1STZA 2IBDA 3EUAA 4UV9A 1O3TA 5E3NA 1AKHB 3FKIJ 2JRMA 3VWBA 1HOMA 1D1AA 2XROA 3MMYB 2FMYA 3ZMUA 1REPC 1FTTA 2WV0A 2XAUA 4LMYA 4PFOA 4PJMA 4XM3A 2E35A 1ZK8A 3ABLH 1WPKA 3FBNB 1Z7UA 3IWZA 1LE8A 3HTSB 3ZP5A 3TO7A 2WBMA 1MBJA 4L5EA 2MD0A 2Q8KA 1R71A 2BZTA 3J81Z 1MDMB 3MZHA 1ZRFA 2CQXA 2LREA 1ETQA 2QQBA 3JREA 4IRHA 1MW7A 3DCFA 3BDDA 3ABUA 1E17A 4HW0A 1FMWA 1QPMA 5A2QZ 3NEUA 3S2WA 1YG2A 3PIPF 1GLNA 1Y0NA 1K6YA 4Y13A 3KYLA 1X3ZB 3ULQB 2Y48A 2Z5UA 2DMNA 2LY9A 2WB1A 2E71A 3ASNH 2KFDA 4PUSA 4Q47A 4OIQF 5K7HA 2F5FA 1P4XA 3HGGA 1ZKGA 3MAJA 4J01A 1SAXA 2BGCA 1UELB 3EUHA 4L9JA 4IO9F 2LNBA 1KQ8A 3BR5A 4QIWN 2D1VA 1X1PA 1IV8A 3Q5FA 3F22A 5L3GA 2IAIA 3H9GA 1VQ7I 3JRIA 2VPRA 3E6BA 3FM5A 4KIGA 1LDJA 3ZR8X 1FSHA 3BTCA 4AYBA 4I09A 4UUSA 5EJCA 2HFHA 2A5YB 3L2VA 3BJ6A 4AVZA 5J47A 2R7QA 1FOYA 1XSXA 2VN2A 2JA2A 2XGDA 2HPIA 4DBRA 4DW6A 3S14J 3P5JA 1RC9A 1SFUA 2O8XA 4EM1A 1SVOA 5TJJA 1IGNA 2VE9A 1Y8QB 3SXYA 1PJRA 2PMUA 4L0YB 3A0HC 5EEGA 2QSHX 4RGXA 3DKXA 4X1EA 1SD6A 2LYCA 4A0XA 2LK2A 4XLAA 4YRVA 4L5IA 1BN5A 5EG0A 9ANTA 1UJ8A 2YSRA 3F21A 3DXJF 3MVPA 3R0AA 3OS2A 4L9TA 4BJ5C 2ZJQF 4CHUA 2L7KA 3J7YJ 1WH7A 3BQYA 2QBYB 1ETWA 4DNCA 2QWWA 4B44A 2R0QC 3M9AA 2XGEA 4UUTA 3KP7A 2K02A 1IV6A 2PFBA 2E7XA 5D6EA 1VQPI 4HPQA 2VKVA 4KN4X 5D5WB 2E36A 5E1WA 4XSZF 4XLNF 1YTYA 2PG4A 4HOBA 2VB6A 4M73A 4BNCA 1D5YA 1D5VA 3Q9VA 1XB4A 2ELKA 4C3JJ 1IRXA 6PAXA 3FM3A 2N8GA 3OIOA 3RYPA 1XD7A 3KLOA 3PNYA 2EB7A 1MSEC 2K85A 2K40A 2H09A 3LA7A 4PSWA 3K4CA 4A3EJ 2GIZA 1IW7F 1R58A 4V19K 3E6CC 2C6YA 3GTMJ 2KP6A 2Q0OA 3BG3A 2CMPA 2Q2EB 3L2CA 1DPUA 3AG3H 4XORA 3TP0A 1HW1A 1T56A 2DMUA 2KIUA 3PQJA 4M3EA 2YX4A 5JLWA 1NK2P 1JJ6C 4BQOA 2OBPA 3QOEA 1QQIA 1CGPA 1OCZH 3RCOA 2R92J 2EK5A 1AKHA 5LEJA 1JTXA 4BUPA 2UXXA 2BHYA 1SEUA 2IP2A 1QRYA 2R5YB 1GV5A 3DF8A 2E34A 2ID3A 1E3OC 3BG9A 1U2WA 3LA3A 4AIJA 1SFOJ 1OQYA 2DDAA 5LRRA 1FOKA 2XAFA 4CCOA 4IX7A 2DO7A 2H8RA 3CCSI 3FXOA 1PUEE 1QU3A 3V8KA 4UVBA 1C0WA 2ZSHB 2DYSH 3DKWA 1N78A 4IF4A 3BQZA 1BIBA 3TP3A 2L9VA 2IVMA 4A6DA 5FLMJ 2R5ZA 2L0KA 2DMPA 2L7FP 4XR6A 2BV6A 3SYTA 2L02A 3K4MA 1A6QA 1BOAA 2HVRA 2FE3A 2FF4A 2OA4A 1D8KA 5IPAA 1DGRM 3F8FA 4XRFA 5FJ8J 2EJRA 3PO2J 2KPMA 2M1BA 4PGHA 2OCCH 3WTYC 4W1UA 1QO0D 1JKQC 2B63J 1DP7P 5HDKA 3KIOA 4FX4A 2L54A 4RLQA 3DBHB 1OISA 5LHGA 2EIMH 1FZPB 4RLFA 2RNJA 5H6RA 3QP5A 1JJ8C 3REOA 5TRDA 2MLGA 3DU5A 4ZTFA 4ASNA 5E3LA 4A93J 3TDUC 3F8BA 2VXDA 1YW9A 1JKRC 3PSFA 1SFXA 5F64A 3K7AJ 3VYTB 2FBKA 4F92B 3JCUC 4G8XA 3C2HA 1R1VA 3H5AA 2K9QA 5E18F 2XGCA 2KJCA 3TL4X 1R7JA 2XPVA 3BR6A 1I1SA 3ZXSA 4XQFA 4JQFA 4ZZDA 2EWNA 3QP6A 3CMEI 2LC2A 1YW7A 2VBXA 1K78B 3S2DJ 2LRDA 3OWTA 4RBOA 2H1KA 3LL7A 2F4MB 2RV8A 3AL0C 4K2EA 3ABKH 3M1CA 4I99C 3SEQA 4CH7A 3MZYA 1N75A 4XKCA 3HGYA 4ON0A 1ZAOA 2LMDA 1VQ6I 1HLVA 4KMFA 4G94A 2ZXIA 3NARA 1SD7A 1K4TA 1JUPA 4XIDA 2JA5J 5F27A 1FBSA 3F9KA 2NOGA 4EJTA 1R22A 3G1LA 1ENHA 2HI3A 2ETHA 4YIIA 4XKBA 3BTJA 2ZCWA 3OYFA 2F5DA 5FD5A 5FO5A 2ZNYA 2W00A 1BL0A 1FLIA 2G9WA 2V7FA 2AXLA 2ZB9A 5IP6A 2V6EA 3QPHA 2OV7A 3CJQB 2R7TA 1XGNA 1DU6A 2GOMA 1QVTA 1ZYRF 1MH3A 4ESJA 4BGDA 3RSNA 1B9MA 4A3FJ 4D7MA 2Q2EA 1S7EA 4ZDLA 4OMYA 3GXOA 2M4GA 2P5LC 2BXYA 2VT2A 3I3LA 2MLKA 1JI8A 5LFAA 3SJMA 3KEOA 4AYBN 1R23A 3OS0A 2BBYA 5K5QA 4UB6C 2OPTA 1JE8A 3I4MJ 2DDBA 3LSIA 3OL4A 3T0YA 2M87A 2XF6A 2WAFA 2A3SA 2E5NA 1ETXA 2DJNA 4BBSJ 3Q9SA 3JRCA 2DJIA 3CMYA 4IHXA 2YU3A 4RGRA 4ESBA 5M5WJ 5D6FA 1L3LA 3CLQA 4F91B 2M9HA 5DD4A 1X3UA 3BROA 3ISPA 1DP3A 1EF4A 1UMQA 1X1AA 4GCVA 4ENMA 4EEFG 4HAMA 4R8HA 5CKTA 4B09A 1ETVA 2F5VA 1TBXA 2LFBA 2VL8A 1XG1A 1P4WA 5E8IA 3J7ZI 3QOPA 3P9CA 3IH2A 4U7DA 2KIFA 3OR1C 4M72A 4EQQA 4HF0A 3HUGB 3MKYB 1MMAA 3MFKA 1W5TA 4A3MJ 3K4NA 3PIOF 5IT3A 1RKWA 2Y30A 2CV1A 3CZ6A 3IHUA 2F48A 1XGSA 2VIXA 1YJNI 2DT6A 1ZG5A 2HEOA 3WTUC 2P4WA 1EH6A 1Z3YA 3H3ZA 5K5RA 2WAQA 3CUQA 3QRFF 5HS9A 5CJ9A 3IP4B 2DA7A 2CWEA 3GW2A 3MCZA 1WI9A 4JOMA 4BQQA 2R7ZJ 1IRFA 4G6TB 3HRSA 4AD9A 1I6HJ 2CH0A 3FXUA 4Z6YA 3ECHA 2LD5A 1G59A 3J81K 1JGSA 2TDXA 4C3IJ 1XDUA 2BHZA 1BI0A 4WXDA 2K7LA 3E6DA 3QYBA 3PO3J 4HV5A 3I59B 1XX5A 3M7GA 3V7CA 3DP7A 5A2QK 4NBQA 2VODA 1V5EA 2DA4A 1MJAA 3GFIA 1K78A 2DW4A 3FXRA 4FTHA 4JP0A 1OCCH 2ID6A 1I3QJ 3OIPA 4A3GJ 1NHAA 3HXLA 2QSGX 3C1DA 1MMSA 2DA6A 3MN2A 3ZQQA 4RGUA 3WTSC 3F6OA 3QYEA 2EA2A 5CVJA 3OYNA 2VLAA 2HPMA 1Z7LA 1VF9A 1X4PA 3FXLA 4J00A 2NS8A 3K6GA 1F36A 4OMZA 4YFKF 2K9SA 2O8KA 1R1TA 2JA6J 3DPLC 3JAMZ 1OJLA 1YLFA 1YIOA 1G3YA 1X2MA 3LA2A 4M9SA 3GTPJ 4XKVA 2QQ9A 2A05A 4D1QA 3BG7A 4V2GA 3P7NA 4B48A 2F6CA 4M3FA 4CCLA 2V1NA 4A69C 1MMNA 1B72B 3OYHA 1ZR2A 4UV8A 3AG1H 2F4OB 1D1CA 2JSCA 2O6GE 1Q1VA 4BE2A 1XDSA 2LF8A 3HB9A 4I76A 1LE8B 4B47A 2OAZA 2NVQJ 1S9HA 3VODA 3NRVA 2QGUA 3M8EA 3VB2A 5AIPA 4AIKA 4G9YA 2CUEA 3M07A 4MNUA 3W3CA 3EUKL 2CYYA 2QLZA 5CVRA 5EGOB 2HVSA 4DGWB 3WU2C 3SDGA 1VQOI 3OV8A 2BE5F 4C30A 3HOWJ 2F4IA 5C44J 4AVPA 4FETA 1DGWY 2PQ8A 5FGMA 1P92A 4BACA 1L0OC 1LVAA 1W7PB 1S7AA 3MZ8A 4QPQA 2Z16A 2R7RA 2MA3A 3R6SA 2XVCA 2EFWA 4YFXF 2BEOA 3C2GA 2PJPA 2CW0F 1O3RA 3VEPA 2QZ8A 4B8XA 1W7PD 4LLLA 4D5CA 5LEKA 3CCQI 3A2KA 2MGQA 1R5HA 4UVCA 2K5CA 4HSTA 4KN7X 1Y56A 3G3ZA 4ETSA 2AXTC 3LSKA 2P8TA 1BR1A 4RAZA 5DS9A 4JYKA 4AWXB 2XAQA 3DV8A 4BL0B 4I7HA 1U8RA 1P9QC 2ESHA 4CUGA 1ETYA 5HDNA 1BA5A 1RR7A 4ANJA 4LK1F 4X0GA 2CG4A 1R49A 2QF7A 1J75A 4OIPF 5GADJ 1FYLA 2P7VB 3L1PA 1QZYA 4Z2YA 1A36A 1XGOA 1ZR4A 5KK1A 4NB5A 3OYCA 4D9JA 5ICEA 5HNFA 4P9FA 2GA2A 1YJWI 2KLOA 3DEUA 4IHSA 5C4XJ 3R60A 1QA6A 1MMGA 3LQRA 1EJ9A 1WJDA 2RQQA 1J59A 5DDGA 1U0JA 1YJ9I 3L2RA 2V79A 5LD2C 4LIUA 4MQVA 1B4AA 1D1BA 2IGKA 2DODA 1FP1D 2HVQA 4M3GA 2QUFA 3CESA 2HDWA 4B4CA 2VJ4A 5HVQC 2VOPA 3FZVA 4OAZA 4XOTA 2KKOA 3ABTA 1DU0A 2UXNA 3I64A 1MBEA 4H0EA 3OS1A 3OY9A 1BJAA 3GFLA 3VSLA 3VPRA 4KUMA 3W6JB 2JZYA 4R1HA 5HODA 1TT0A 5FKOA 5C3EJ 1VQ9I 1DQUA 4ZDOA 3KX2A 4A3DJ 3LSTA 2XAGA 3L7WA 3GVAA 3RIRA 5GAGJ 3BG5A 3B6AA 2W24A 3OYKA 5DYMA 1IDYA 1ZH5A 4Y33A 3VOEA 3WTTC 2CO5A 2O03A 5LGTA 1X3WB 3DBLB 1D0YA 2OD5A 2L7MP 4HQMA 4UY8I 2DFFA 4G6DA 5K1YA 3SQNA 1WZ2A 3S1QJ 2VI6A 5KCMA 5EZHA 3VSKA 4KMUX 3HOZJ 1GVDA 5JLXA 3RKQA 3I4NJ 3I55I 1TL8A 1Z1DA 1TWGJ 4NQWB 3R0JA 3LSJA 1FBUA 3PM1A 2HXOA 1ONVA 3MD2A 1TNTA 1MNDA 3H5NA 3VYUB 4HDUA 3I56I 4ENNA 2VT3A 5D5UB 5B1BH 1LVKA 1FIAA 4PJNA 1LDDA 4A0YA 3I0TA 1JT6A 2D1HA 1YITI 1MBHA 1J5YA 1B72A 2MH9A 1JUSA 2X6OA 5H20A 5IP9J 1U8BA 5GPCA 1M1EB 3JW4A 4YIFA 3A02A 4BQNA 4M3BA 4LJZF 1KU2A 2WA0A 4BE0A 2STWA 4LOCA 3HJEA 4ZDPA 4CO8A 2WWYA 2KRFA 4RA2A 4E7LA 1BI3A 1W0UA 1SANA 2ZKZA 5EGOA 2WAQN 3C3WA 3PFIA 4IXAA 4EVIA 3AKZA 1W0TA 2K3PA 2JVHA 5D4SA 3KZZA 2HKXA 3QPSA 4HF1A 1NG6A 4DZJA 2R5ZB 1PUFB 5JR3A 1V4RA 1W7PA 3ROUA 2AQEA 4MTDA 4G7HF 2AHQA 4ENJA 3WTXC 3G71I 3IRRA 3HHHA 1J9IA 3ZQCA 2IA2A 2CFXA 3LSRA 3E0JB 3PQKA 1HCRA 5F0FA 1K4SA 4B3XA 2A69F 1DUXC 2R7XA 3RKWA 3TO9A 2EA4A 3CCUI 1WWXA 4HA8A 2JQ7A 4Y52J 1TNSA 4BHPA 5JVGF 2XRNA 1V3FA 3I54A 3WE2A 3LAJA 1F43A 1VNDA 1RUOA 1O7LA 5E79C 3WODF 1FEXA 2NOJB 3CDHA 2NRAC 2VUMJ 2CQKA 3DLLF 2TCTA 4XMYA 2V26A 4OINF 4LB5A 1I27A 2M0CA 3PNTA 1IZ1A 5ICCA 3F72A 2M8EA 2VJ5A 1Z21A 2M5WA 1Q1HA 1LJ9A 2BVMA 4HNTA 2R7DA 1FYKA 3AG2H 4M74A 4MO7A 2DFIA 5JI6A 3GZNB 2LTPA 1EA3A 1OR7C 2GIVA 3LNQA 3HOUJ 3KETA 2OU2A 1FNNA 3U21A 4FISA 2UUZA 4YIRX 2DMQA 3RQIA 1UZCA 1IN8A 3M8FA 4I6ZA 4I2OA 3BR1A 2P0WA 4RDUA 5F6FA 1CF7B 5LGNA 1FSEA 1ULYA 1OCRH 4AUXA 3SFZA 2EZKA 4A0ZA 4BHCA 4C2TA 2FEZA 3V4GA 2XAJA 4BY7J 4LLNA 4DYRA 3IKTA 2HS5A 2CUFA 3HOSA 3LSHA 3AAFA 3RYRA 2DMTA 3EYIA 3LSPA 2NNNA 2V9KA 4O6JA 4WF2A 4OIRF 1YIJI 2K9LA 5J8FA 3S16J 3CO7C 3OYBA 1HDDC 1R4NB 4U88A 3CMMA 4PK4A 1MKMA 2E1OA 4D7NA
chains in the Genus database with same CATH topology
1U78A 1ZRDA 5E8GA 2EFNA 1J7KA 2K27A 1J2XA 3QPTA 4ZYGA 3SHFA 1OPCA 2YR2A 2NYXA 4NQWA 2CGPA 4EGYA 2DU9A 3COAC 2PN6A 1TW3A 1PP7U 2ZMEB 4G7ZF 2ZXJA 3HOTA 4WX9A 2L4AA 4ZH4F 5DCFA 3V8LA 1WSUA 1T38A 1HXDA 2YPRA 4BXUA 1TQIA 4PZJA 1TLHB 1U5TC 5FB2A 4YG2F 5L3EA 3DPTA 1P2FA 2PI0A 1S8NA 3IC7A 1XSDA 2STTA 5ED4A 1T0FA 3BJOA 4MGRA 3RPQA 3WU1B 4WXCA 4FT8A 4Q5SF 4JK1X 1UCRA 1O7FA 2EFQA 3JAMK 5HOOA 3KP4A 3WGHA 3RKYA 1O57A 2QYOA 4LK0F 2PLYA 4EJUA 1ZG3A 1RZ4A 1YO5C 5L3BA 3BPXA 5DEQA 2ZBKA 3IWFA 1TW2A 3CUQB 3MQ0A 1G3SA 3KE2A 5IT9Z 5ICGA 2JPBA 1R36A 4L5JA 1FX7A 4L9NA 2COMA 2A6EF 2VC0A 2G7HA 1YFHA 1B1BA 5FD6A 1BC7C 3LWFA 4HZFA 2H6BA 4FX0A 4I02A 5CYVA 3KFWX 3WE3A 3TDZC 1T2KA 2VOOA 2VC1A 2GA1A 5E1XA 3WU0A 4LGWA 3CJNA 2R7FA 5J8CA 1CF7A 3TOBA 3MEXA 1XCBA 4CZZA 4HDVA 3HSEA 1B6AA 1XMAA 2XV4S 4EJWA 1GVJA 3WTWC 4RAYA 3WGGA 1IXSB 2EFPA 4IPAA 1JXSA 2A61A 5L3FA 2P6SA 3GFJA 5HLGA 1AWCA 2YX7A 3P9KA 2B0LA 2W84A 3K0LA 4D0PA 4LG0B 3E5XA 1K7AA 4LD5A 2Z3YA 1G4DA 1IRGA 4DQ2A 3E5UA 4GXOA 5HS8A 4HYEA 1SFEA 3E6MA 1XSVA 1Z05A 3NQOA 2ZMEA 3JSPA 2BYVE 3EYYA 3U1DA 5HS7A 4L9VA 1XGMA 4OOIA 1XN7A 1SMTA 4XSXF 3QAHA 3RJPA 2W25A 3QU3A 3U2RA 2VBWA 1ZGAA 4EJVA 3G73A 1R5GA 3KP3A 4CYDA 2V1XA 3K9TA 2V9VA 3F3XA 2A07F 5LGUA 1QZZA 1BI1A 2OZUA 4HV6A 4S04A 1EH8A 2D2WA 1VTNC 2X4HA 5L3DA 1W5SA 4IHTA 1Z6RA 2QENA 1LNWA 3BP8A 4Q48A 5CVIA 4Y15A 2IRFG 3SZTA 2EV5A 2ADUA 3B02A 3K1MA 3RI4A 3E97A 2EFOA 1FBQA 1MZBA 3BY6A 2JT1A 2P5KA 3F8CA 3HRUA 1PDNC 2IT0A 2GXBA 3ML6A 2LF7A 1QNTA 4A2UA 2FRHA 4OIOF 3GWZA 2L3DA 5AIQA 4U0YA 5LHIA 2L4MA 2HTJA 3R61A 2RGVA 1TTYA 3T8TA 1JHHA 1LEAA 2DAOA 3BWGA 4N0BA 2P5VA 4XBFA 1D8JA 4LG0A 4BYYA 1ON2A 1KGSA 4KIBA 5EEHA 2RKHA 4P9UA 3ZMZA 2M30A 3HRTA 3GFMA 3K69A 2L01A 4KT5C 3DFGA 3HHGA 2DQLA 4KDPA 4A6EA 3KP6A 3CLOA 1KU9A 3I5UA 4E70A 4FHTA 2LSOA 2Y75A 2A6HF 2FNPA 4IVNA 1O3QA 3BOQA 4ZZLA 5LRSA 3RKXA 1FT9A 2H27A 3E5QA 2H94A 2NAZA 2H6CA 1IUYA 1UB9A 2JPCA 1P4AA 1YW8A 2HDCA 1W4MA 2HR3A 2MBFA 4M9ZA 2WC2A 5ILSA 2UWMA 1LDKB 1KQ0A 1IN7A 2FSWA 1HBXG 3TQNA 2DBBA 3V8JA 4XLPF 1EV7A 2FBIA 3C18A 3D5LA 2FNAA 1B9NA 5DV5A 4I0BA 1MD0A 3CTAA 2JRTA 1UHMA 4LFUA 3F8NA 2AS5F 2ACJA 4KIFA 4KFCA 3J7AO 3GZ5A 2IA1A 4BQAA 4GGGA 3J80Z 2VONA 1OKRA 1IN6A 1OYIA 2FXAA 3GLXA 1YYVA 2EV6A 2QQAA 4CDGA 2E1NA 3P9IA 2PMHA 3BPVA 4KICA 4HBLA 1HKTA 3GO5A 2V6CA 3F6VA 4HX8A 5IT9K 1ZG1A 5FLXZ 2FQ3A 1RUNA 1H9TA 3WTZA 5K5OA 4G7OF 4HF2A 2ELHA 5D8KB 2OQRA 5HLIA 2A68F 1YQAA 1HKQA 1ZREA 4AIHA 3KZYA 1FC3A 3H92A 2J5PA 3HSFA 5E20A 1IF1A 3V7SA 1QBJA 1H9GA 3WGIA 4JBAA 2ZO4A 1YS7A 1MJ9A 5FFZA 2HYGD 2VXZA 4BH9A 1SD4A 2DT5A 3I71A 2XKPA 1LB2A 1RIOH 4RB0A 1IN4A 1Z91A 4OU0A 2GAUA 1K6OA 1BC8C 4RB3C 4IRGA 5DCMB 5D8LB 5FFXA 2FA5A 1BM9A 1FYMA 4LB6B 1TQMA 3O3KA 3GEZA 5ERIA 1USTA 4P55A 3JSOA 2HTSA 5JVTA 4M71A 1F1ZA 4QWQA 1XCVA 1MGTA 4R79A 3O2PE 3TKYA 3U9GA 4CXFA 2VBZA 3CO6C 5BPDA 4Q4ZF 2W57A 1BBYA 4HLXA 5ILUA 1F9NA 2F5CA 2VE8A 5ICFA 4HX4A 1FWZA 3V7RA 3FMSA 5BQTA 3N4MA 2UZKA 1A04A 2FBHA 3GUDA 3SZPA 2F5EA 3CUQC 2ZNZA 4RB1A 2PBIA 1F5TA 4BHBA 2XHKA 5CVUA 2DPUA 4PGGA 4F7ZA 3EQLF 4L18B 4RB2C 4WWCA 1JHFA 4P5OA 4M6XA 3ZMDA 3ZN1A 2GXGA 5CLSA 3C7JA 1WQ2A 3HRMA 4EGZA 1R1UA 4GYIA 4N9HA 2X0LA 2CSOA 4EM0B 4ZYDA 1BIAA 1MDMA 1EH7A 1ODDA 5D5VB 4S05A 4KNYA 5H6QA 2DLLA 3VFZA 5J6XA 2JTVA 4RGSA 4CGZA 2XIGA 1G3TA 5E17F 3L9FA 5E1ZB 1USSA 2IW5A 3KLNA 5DCMA 2K4BA 2HZTA 3ECOA 2XASA 3ZQ7A 1KA8A 3JTGA 1XMKA 3ELKA 3BJAA 3K1PA 3WTVC 3HSRA 4WK8F 3LQQA 1IXCA 3FF5A 3GF2A 2HWVA 1SD5A 2E1CA 4HQEA 2VBYA 3GYHX 1ZLJA 1TQPA 4M6YA 2XGXA 1WRJA 3K1NA 1J0RA 2V1DA 1U5TB 3F23A 3T8RA 2DQRA 4U0VA 3RTRA 2GZWA 2V1UA 2XUBA 3KEQA 2QBYA 5F1RA 2HQRA 4EM2A 3E3VA 1RI7A 2QVOA 3LAPA 2M45A 3RPUA 1Z9CA 2K86A 3ZMVA 2FU4A 2HKOA 1BI2A 3ZN0A 1K79A 4MTEA 1S6LA 1LEBA 2GQQA 3J80K 1KYZA 2ZJ2A 1Y0UA 2ZFWA 2DI3A 3O6BB 3KP2A 3ZMTA 4ENKA 4GO1A 3OOPA 2NS0A 2W85A 2XKOA 1F4KA 1B59A 1OR7A 3ZPLA 3FWEA 1HKSA 4O3MA 4GYGA 1H0MA 4ESFA 4EV0A 3WG9A 5LBQA 5FLXK 2IJLA 1UFMA 4EMSA 2KIMA 5BPIA 3D0SA 1I5ZA 3B73A 4UUVA 1UHWA 5DD8A 1ZLKA 4MHGA 4ZYHA 4KYWA 5AONA 1ZHFA 2ISYA 3FXQA 4P96A 1O3SA 1GXPA 1ZGJA 1SMYF 1GHCA 4PDKA 2PEXA 2DK5A 2P7CB 3F8MA 2HQNA 4U7BA 1ZARA 3T5XA 4WXHA 2RQPA 1T98A 2MH2A 2DPDA 2F2EA 1GXQA 4I98B 4G6QA 4L0ZB 2OZ6A 3KCCA 4M9XA 1AOYA 3GZ6A 3FMRA 3IRQA 4A5NA 4RS8A 4MEYF 2FMLA 2Z99A 5KVRA 2RC4A 3ERED 1IN5A 3I58A 5JFRA 3W6KB 4Y17A 1HW5A 1U5TA 3T1BA 3FHZA 3IKVA 4KA4A 3I4PA 5ILVA 4MEXF 1S29A 2R3SA 2RN7A 4TV7A 3HYIA 1FPQA 3TGNA 2O61A 3JTHA 2EV0A 1WKMA 3MWMA 5BS6A 2DK8A 3EDPA 1G3WA 3EETA 2IPQX 5D5XB 1T39A 2G7UA 2KJBA 2P6TA 1T6SA 1U3EM 1MJBA 4QLCU 1Z6TA 2J5OA 1KQ9A 5LLQA 4NHJA 2NNYA 1KU7A 2OQGA 4A12A 1OYYA 3H3UA 3L00A 4I0AA 4BAYA 5L3CA 2Y0MA 1KU3A 1P6RA 2Z33A 1S3JA 1FP2A 2RDPA 2DTRA 2RVCA 1R00A 2O3FA 2XAHA 1S7OA 3LFKA 5HLHA 1DDNA 4IJAA 1OMIA 2WTEA 3L09A 3TO6A 3RDIA 5BMZA 2D45A 1U6GA 1I1GA 5HDGA 5CVVA 2IA0A 1ZN2A 1HSJA 1ZRCA 1IXRC 5D4RA 4UNOA 1QGPA 5BOXA 4UVAA 1IAWA 2FOKA 5DUKA 1I6XA 4LLGF 3ZMSA 1LQ1A 3HIFA 1KYWA 4N9IA 3QU6A 2HGCA 5JHUA 3HUGA 2Z9OA 3I53A 3M1EA 2O0YA 4CICA 4ZYEA 2E7WA 4IRIA 1HQCA 4I01A 1D3YA 2K4JA 3N97A 1E2XA 2MD5A 2LDUA 3FX3A 4U0WA 3HTUA 3KP5A 3TOAA 2GWRA 2ISZA 4WCGA 5DUIA 1DPRA 5LHHA 4UHTA 1G6NA 4A5MA 3K2ZA 3I59A 4YFNF 3BZ6A 4HLYA 4O5VA 1YS6A 2HYFA 3DQVC 3GX4X 4EJOA 2HOEA 3R4KA 3CUOA 4MQ9F 4PCQA 2QM3A 3FMQA 1FY7A 1HSTA 1OYWA 4UXNA 2LKPA 1HW2A 4HX7A 1RNLA 1ON1A 2MC3A 2ESNA 3IL2A 1PP8F 1STZA 4UV9A 1O3TA 2XROA 2FMYA 3ZMUA 1REPC 2WV0A 4LMYA 1Z7UA 3IWZA 3HTSB 3ZP5A 3TO7A 2Q8KA 3J81Z 1MDMB 3MZHA 1ZRFA 2QQBA 4IRHA 3BDDA 3ABUA 1E17A 4HW0A 1QPMA 5A2QZ 3NEUA 3S2WA 1YG2A 4Y13A 3ULQB 2Y48A 2Z5UA 4Q47A 4OIQF 2F5FA 1P4XA 3MAJA 1SAXA 2BGCA 3EUHA 4L9JA 2LNBA 1KQ8A 2D1VA 3Q5FA 3F22A 5L3GA 3E6BA 3FM5A 4KIGA 1LDJA 1FSHA 4I09A 2HFHA 2A5YB 3BJ6A 1XSXA 2VN2A 1SFUA 2O8XA 4EM1A 5TJJA 2VE9A 3SXYA 2PMUA 4L0YB 5EEGA 4RGXA 1SD6A 4A0XA 4L5IA 1BN5A 2YSRA 3F21A 3DXJF 3R0AA 4L9TA 4CHUA 2QBYB 4DNCA 2QWWA 3M9AA 3KP7A 2K02A 2PFBA 2E7XA 5D6EA 5D5WB 4KN4X 5E1WA 4XSZF 4XLNF 1YTYA 2PG4A 4HOBA 4M73A 4BNCA 1D5VA 3Q9VA 1XB4A 6PAXA 3FM3A 3RYPA 1XD7A 3KLOA 2EB7A 2H09A 3LA7A 1IW7F 1R58A 3E6CC 2C6YA 2Q0OA 3L2CA 1DPUA 1HW1A 2KIUA 3PQJA 2YX4A 2OBPA 1QQIA 1CGPA 2EK5A 5LEJA 2UXXA 2IP2A 3DF8A 3LA3A 1U2WA 4AIJA 5LRRA 1FOKA 2XAFA 2DO7A 1PUEE 3V8KA 4UVBA 1C0WA 3DKWA 4IF4A 1BIBA 2IVMA 4A6DA 2BV6A 2L02A 1BOAA 2FE3A 2FF4A 2OA4A 1D8KA 3F8FA 4XRFA 2EJRA 2M1BA 4PGHA 3WTYC 1QO0D 1DP7P 5HDKA 4FX4A 2L54A 5LHGA 1FZPB 2RNJA 5H6RA 3QP5A 3REOA 5TRDA 2MLGA 4ASNA 3TDUC 3F8BA 1YW9A 1SFXA 5F64A 2FBKA 4G8XA 1R1VA 5E18F 2KJCA 1R7JA 1I1SA 4JQFA 4ZZDA 2EWNA 3QP6A 1YW7A 2VBXA 1K78B 2RV8A 4K2EA 3MZYA 4ON0A 1ZAOA 4KMFA 4G94A 1SD7A 1FBSA 4EJTA 1R22A 2ETHA 4YIIA 2ZCWA 2F5DA 5FD5A 5FO5A 2ZNYA 1FLIA 2G9WA 2AXLA 3QPHA 1XGNA 1ZYRF 4ESJA 1B9MA 2Q2EA 4OMYA 3GXOA 2P5LC 2VT2A 2MLKA 3KEOA 1R23A 2BBYA 5K5QA 1JE8A 3T0YA 2M87A 2A3SA 3Q9SA 2YU3A 4RGRA 4ESBA 5D6FA 1L3LA 5DD4A 1X3UA 3BROA 3ISPA 4GCVA 4ENMA 4HAMA 4R8HA 4B09A 1TBXA 5E8IA 1P4WA 3QOPA 3P9CA 4U7DA 2KIFA 4M72A 4EQQA 4HF0A 3MFKA 1W5TA 5IT3A 3IHUA 1XGSA 1ZG5A 2HEOA 3WTUC 2P4WA 1EH6A 3H3ZA 5K5RA 3CUQA 3QRFF 5HS9A 5CJ9A 2CWEA 3GW2A 3MCZA 1WI9A 1IRFA 3HRSA 4AD9A 3FXUA 3ECHA 3J81K 1JGSA 2TDXA 1XDUA 1BI0A 4WXDA 2K7LA 3E6DA 4HV5A 3I59B 3M7GA 3V7CA 3DP7A 5A2QK 2VODA 3GFIA 1MJAA 1K78A 2DW4A 3FXRA 1NHAA 3C1DA 4RGUA 3WTSC 3F6OA 2EA2A 5CVJA 4OMZA 4YFKF 1R1TA 3DPLC 3JAMZ 1YLFA 1YIOA 1G3YA 3LA2A 4M9SA 2QQ9A 3P7NA 4UV8A 2JSCA 2O6GE 1XDSA 2LF8A 2OAZA 3VODA 3NRVA 3M8EA 3VB2A 5AIPA 4AIKA 4G9YA 4MNUA 2CYYA 2QLZA 5CVRA 3OV8A 2BE5F 4AVPA 2PQ8A 5FGMA 1P92A 1L0OC 1LVAA 1W7PB 1S7AA 2MA3A 3R6SA 2XVCA 2EFWA 4YFXF 2BEOA 2PJPA 2CW0F 1O3RA 3VEPA 2QZ8A 4B8XA 1W7PD 4LLLA 5LEKA 1R5HA 4UVCA 4KN7X 3G3ZA 4ETSA 2P8TA 4RAZA 4AWXB 2XAQA 3DV8A 4I7HA 1U8RA 2ESHA 5HDNA 4LK1F 2CG4A 1J75A 4OIPF 1FYLA 2P7VB 1QZYA 4Z2YA 1XGOA 5KK1A 4NB5A 5ICEA 4P9FA 2GA2A 4IHSA 3DEUA 3R60A 3LQRA 1J59A 5DDGA 2V79A 4MQVA 1B4AA 1FP1D 2QUFA 5HVQC 2VOPA 3FZVA 2KKOA 3ABTA 2UXNA 3I64A 4H0EA 1BJAA 3GFLA 4KUMA 3W6JB 2JZYA 4R1HA 3LSTA 2XAGA 3L7WA 3GVAA 3RIRA 2W24A 5DYMA 1ZH5A 3VOEA 3WTTC 2CO5A 2O03A 5LGTA 2OD5A 4HQMA 4G6DA 5K1YA 3SQNA 4KMUX 1Z1DA 3R0JA 1FBUA 1ONVA 1TNTA 4ENNA 4HDUA 2VT3A 5D5UB 1LDDA 4A0YA 3I0TA 2D1HA 1J5YA 2MH9A 5H20A 3JW4A 4YIFA 4LJZF 1KU2A 2STWA 4CO8A 2WWYA 2KRFA 1BI3A 2ZKZA 3C3WA 3PFIA 4IXAA 4EVIA 5D4SA 3KZZA 2HKXA 4HF1A 5JR3A 1V4RA 1W7PA 3ROUA 4G7HF 4MTDA 4ENJA 3WTXC 3IRRA 3HHHA 1J9IA 2IA2A 2CFXA 3PQKA 2A69F 1DUXC 3RKWA 3TO9A 2EA4A 1WWXA 4HA8A 1TNSA 4BHPA 2XRNA 1V3FA 3I54A 3WE2A 3LAJA 1RUOA 1O7LA 3WODF 3CDHA 2NRAC 2CQKA 4OINF 4LB5A 1I27A 5ICCA 1IZ1A 3F72A 2M8EA 2M5WA 1Q1HA 1LJ9A 2R7DA 1FYKA 4M74A 2DFIA 5JI6A 2GIVA 3KETA 2OU2A 1FNNA 1IN8A 3M8FA 4I2OA 5F6FA 1CF7B 5LGNA 1FSEA 1ULYA 3SFZA 4A0ZA 4BHCA 2FEZA 3V4GA 2XAJA 4LLNA 3IKTA 2HS5A 3HOSA 3AAFA 3RYRA 3EYIA 2NNNA 4WF2A 4O6JA 4OIRF 5J8FA 3CO7C 4U88A 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U78 A;  1ZRD A;  5E8G A;  2EFN A;  1J7K A;  2K27 A;  1J2X A;  3QPT A;  4ZYG A;  3SHF A;  1OPC A;  2YR2 A;  2NYX A;  4NQW A;  2CGP A;  4EGY A;  2DU9 A;  3COA C;  2PN6 A;  1TW3 A;  1PP7 U;  2ZME B;  4G7Z F;  2ZXJ A;  3HOT A;  4WX9 A;  2L4A A;  4ZH4 F;  5DCF A;  3V8L A;  1WSU A;  1T38 A;  1HXD A;  2YPR A;  4BXU A;  1TQI A;  4PZJ A;  1TLH B;  1U5T C;  5FB2 A;  4YG2 F;  5L3E A;  3DPT A;  1P2F A;  2PI0 A;  1S8N A;  3IC7 A;  1XSD A;  2STT A;  5ED4 A;  1T0F A;  3BJO A;  4MGR A;  3RPQ A;  3WU1 B;  4WXC A;  4FT8 A;  4Q5S F;  4JK1 X;  1UCR A;  1O7F A;  2EFQ A;  3JAM K;  5HOO A;  3KP4 A;  3WGH A;  3RKY A;  1O57 A;  2QYO A;  4LK0 F;  2PLY A;  4EJU A;  1ZG3 A;  1RZ4 A;  1YO5 C;  5L3B A;  3BPX A;  5DEQ A;  2ZBK A;  3IWF A;  1TW2 A;  3CUQ B;  3MQ0 A;  1G3S A;  3KE2 A;  5IT9 Z;  5ICG A;  2JPB A;  1R36 A;  4L5J A;  1FX7 A;  4L9N A;  2COM A;  2A6E F;  2VC0 A;  2G7H A;  1YFH A;  1B1B A;  5FD6 A;  1BC7 C;  3LWF A;  4HZF A;  2H6B A;  4FX0 A;  4I02 A;  5CYV A;  3KFW X;  3WE3 A;  3TDZ C;  1T2K A;  2VOO A;  2VC1 A;  2GA1 A;  5E1X A;  3WU0 A;  4LGW A;  3CJN A;  2R7F A;  5J8C A;  1CF7 A;  3TOB A;  3MEX A;  1XCB A;  4CZZ A;  4HDV A;  3HSE A;  1B6A A;  1XMA A;  2XV4 S;  4EJW A;  1GVJ A;  3WTW C;  4RAY A;  3WGG A;  1IXS B;  2EFP A;  4IPA A;  1JXS A;  2A61 A;  5L3F A;  2P6S A;  3GFJ A;  5HLG A;  1AWC A;  2YX7 A;  3P9K A;  2B0L A;  2W84 A;  3K0L A;  4D0P A;  4LG0 B;  3E5X A;  1K7A A;  4LD5 A;  2Z3Y A;  1G4D A;  1IRG A;  4DQ2 A;  3E5U A;  4GXO A;  5HS8 A;  4HYE A;  1SFE A;  3E6M A;  1XSV A;  1Z05 A;  3NQO A;  2ZME A;  3JSP A;  2BYV E;  3EYY A;  3U1D A;  5HS7 A;  4L9V A;  1XGM A;  4OOI A;  1XN7 A;  1SMT A;  4XSX F;  3QAH A;  3RJP A;  2W25 A;  3QU3 A;  3U2R A;  2VBW A;  1ZGA A;  4EJV A;  3G73 A;  1R5G A;  3KP3 A;  4CYD A;  2V1X A;  3K9T A;  2V9V A;  3F3X A;  2A07 F;  5LGU A;  1QZZ A;  1BI1 A;  2OZU A;  4HV6 A;  4S04 A;  1EH8 A;  2D2W A;  1VTN C;  2X4H A;  5L3D A;  1W5S A;  4IHT A;  1Z6R A;  2QEN A;  1LNW A;  3BP8 A;  4Q48 A;  5CVI A;  4Y15 A;  2IRF G;  3SZT A;  2EV5 A;  2ADU A;  3B02 A;  3K1M A;  3RI4 A;  3E97 A;  2EFO A;  1FBQ A;  1MZB A;  3BY6 A;  2JT1 A;  2P5K A;  3F8C A;  3HRU A;  1PDN C;  2IT0 A;  2GXB A;  3ML6 A;  2LF7 A;  1QNT A;  4A2U A;  2FRH A;  4OIO F;  3GWZ A;  2L3D A;  5AIQ A;  4U0Y A;  5LHI A;  2L4M A;  2HTJ A;  3R61 A;  2RGV A;  1TTY A;  3T8T A;  1JHH A;  1LEA A;  2DAO A;  3BWG A;  4N0B A;  2P5V A;  4XBF A;  1D8J A;  4LG0 A;  4BYY A;  1ON2 A;  1KGS A;  4KIB A;  5EEH A;  2RKH A;  4P9U A;  3ZMZ A;  2M30 A;  3HRT A;  3GFM A;  3K69 A;  2L01 A;  4KT5 C;  3DFG A;  3HHG A;  2DQL A;  4KDP A;  4A6E A;  3KP6 A;  3CLO A;  1KU9 A;  3I5U A;  4E70 A;  4FHT A;  2LSO A;  2Y75 A;  2A6H F;  2FNP A;  4IVN A;  1O3Q A;  3BOQ A;  4ZZL A;  5LRS A;  3RKX A;  1FT9 A;  2H27 A;  3E5Q A;  2H94 A;  2NAZ A;  2H6C A;  1IUY A;  1UB9 A;  2JPC A;  1P4A A;  1YW8 A;  2HDC A;  1W4M A;  2HR3 A;  2MBF A;  4M9Z A;  2WC2 A;  5ILS A;  2UWM A;  1LDK B;  1KQ0 A;  1IN7 A;  2FSW A;  1HBX G;  3TQN A;  2DBB A;  3V8J A;  4XLP F;  1EV7 A;  2FBI A;  3C18 A;  3D5L A;  2FNA A;  1B9N A;  5DV5 A;  4I0B A;  1MD0 A;  3CTA A;  2JRT A;  1UHM A;  4LFU A;  3F8N A;  2AS5 F;  2ACJ A;  4KIF A;  4KFC A;  3J7A O;  3GZ5 A;  2IA1 A;  4BQA A;  4GGG A;  3J80 Z;  2VON A;  1OKR A;  1IN6 A;  1OYI A;  2FXA A;  3GLX A;  1YYV A;  2EV6 A;  2QQA A;  4CDG A;  2E1N A;  3P9I A;  2PMH A;  3BPV A;  4KIC A;  4HBL A;  1HKT A;  3GO5 A;  2V6C A;  3F6V A;  4HX8 A;  5IT9 K;  1ZG1 A;  5FLX Z;  2FQ3 A;  1RUN A;  1H9T A;  3WTZ A;  5K5O A;  4G7O F;  4HF2 A;  2ELH A;  5D8K B;  2OQR A;  5HLI A;  2A68 F;  1YQA A;  1HKQ A;  1ZRE A;  4AIH A;  3KZY A;  1FC3 A;  3H92 A;  2J5P A;  3HSF A;  5E20 A;  1IF1 A;  3V7S A;  1QBJ A;  1H9G A;  3WGI A;  4JBA A;  2ZO4 A;  1YS7 A;  1MJ9 A;  5FFZ A;  2HYG D;  2VXZ A;  4BH9 A;  1SD4 A;  2DT5 A;  3I71 A;  2XKP A;  1LB2 A;  1RIO H;  4RB0 A;  1IN4 A;  1Z91 A;  4OU0 A;  2GAU A;  1K6O A;  1BC8 C;  4RB3 C;  4IRG A;  5DCM B;  5D8L B;  5FFX A;  2FA5 A;  1BM9 A;  1FYM A;  4LB6 B;  1TQM A;  3O3K A;  3GEZ A;  5ERI A;  1UST A;  4P55 A;  3JSO A;  2HTS A;  5JVT A;  4M71 A;  1F1Z A;  4QWQ A;  1XCV A;  1MGT A;  4R79 A;  3O2P E;  3TKY A;  3U9G A;  4CXF A;  2VBZ A;  3CO6 C;  5BPD A;  4Q4Z F;  2W57 A;  1BBY A;  4HLX A;  5ILU A;  1F9N A;  2F5C A;  2VE8 A;  5ICF A;  4HX4 A;  1FWZ A;  3V7R A;  3FMS A;  5BQT A;  3N4M A;  2UZK A;  1A04 A;  2FBH A;  3GUD A;  3SZP A;  2F5E A;  3CUQ C;  2ZNZ A;  4RB1 A;  2PBI A;  1F5T A;  4BHB A;  2XHK A;  5CVU A;  2DPU A;  4PGG A;  4F7Z A;  3EQL F;  4L18 B;  4RB2 C;  4WWC A;  1JHF A;  4P5O A;  4M6X A;  3ZMD A;  3ZN1 A;  2GXG A;  5CLS A;  3C7J A;  1WQ2 A;  3HRM A;  4EGZ A;  1R1U A;  4GYI A;  4N9H A;  2X0L A;  2CSO A;  4EM0 B;  4ZYD A;  1BIA A;  1MDM A;  1EH7 A;  1ODD A;  5D5V B;  4S05 A;  4KNY A;  5H6Q A;  2DLL A;  3VFZ A;  5J6X A;  2JTV A;  4RGS A;  4CGZ A;  2XIG A;  1G3T A;  5E17 F;  3L9F A;  5E1Z B;  1USS A;  2IW5 A;  3KLN A;  5DCM A;  2K4B A;  2HZT A;  3ECO A;  2XAS A;  3ZQ7 A;  1KA8 A;  3JTG A;  1XMK A;  3ELK A;  3BJA A;  3K1P A;  3WTV C;  3HSR A;  4WK8 F;  3LQQ A;  1IXC A;  3FF5 A;  3GF2 A;  2HWV A;  1SD5 A;  2E1C A;  4HQE A;  2VBY A;  3GYH X;  1ZLJ A;  1TQP A;  4M6Y A;  2XGX A;  1WRJ A;  3K1N A;  1J0R A;  2V1D A;  1U5T B;  3F23 A;  3T8R A;  2DQR A;  4U0V A;  3RTR A;  2GZW A;  2V1U A;  2XUB A;  3KEQ A;  2QBY A;  5F1R A;  2HQR A;  4EM2 A;  3E3V A;  1RI7 A;  2QVO A;  3LAP A;  2M45 A;  3RPU A;  1Z9C A;  2K86 A;  3ZMV A;  2FU4 A;  2HKO A;  1BI2 A;  3ZN0 A;  1K79 A;  4MTE A;  1S6L A;  1LEB A;  2GQQ A;  3J80 K;  1KYZ A;  2ZJ2 A;  1Y0U A;  2ZFW A;  2DI3 A;  3O6B B;  3KP2 A;  3ZMT A;  4ENK A;  4GO1 A;  3OOP A;  2NS0 A;  2W85 A;  2XKO A;  1F4K A;  1B59 A;  1OR7 A;  3ZPL A;  3FWE A;  1HKS A;  4O3M A;  4GYG A;  1H0M A;  4ESF A;  4EV0 A;  3WG9 A;  5LBQ A;  5FLX K;  2IJL A;  1UFM A;  4EMS A;  2KIM A;  5BPI A;  3D0S A;  1I5Z A;  3B73 A;  4UUV A;  1UHW A;  5DD8 A;  1ZLK A;  4MHG A;  4ZYH A;  4KYW A;  5AON A;  1ZHF A;  2ISY A;  3FXQ A;  4P96 A;  1O3S A;  1GXP A;  1ZGJ A;  1SMY F;  1GHC A;  4PDK A;  2PEX A;  2DK5 A;  2P7C B;  3F8M A;  2HQN A;  4U7B A;  1ZAR A;  3T5X A;  4WXH A;  2RQP A;  1T98 A;  2MH2 A;  2DPD A;  2F2E A;  1GXQ A;  4I98 B;  4G6Q A;  4L0Z B;  2OZ6 A;  3KCC A;  4M9X A;  1AOY A;  3GZ6 A;  3FMR A;  3IRQ A;  4A5N A;  4RS8 A;  4MEY F;  2FML A;  2Z99 A;  5KVR A;  2RC4 A;  3ERE D;  1IN5 A;  3I58 A;  5JFR A;  3W6K B;  4Y17 A;  1HW5 A;  1U5T A;  3T1B A;  3FHZ A;  3IKV A;  4KA4 A;  3I4P A;  5ILV A;  4MEX F;  1S29 A;  2R3S A;  2RN7 A;  4TV7 A;  3HYI A;  1FPQ A;  3TGN A;  2O61 A;  3JTH A;  2EV0 A;  1WKM A;  3MWM A;  5BS6 A;  2DK8 A;  3EDP A;  1G3W A;  3EET A;  2IPQ X;  5D5X B;  1T39 A;  2G7U A;  2KJB A;  2P6T A;  1T6S A;  1U3E M;  1MJB A;  4QLC U;  1Z6T A;  2J5O A;  1KQ9 A;  5LLQ A;  4NHJ A;  2NNY A;  1KU7 A;  2OQG A;  4A12 A;  1OYY A;  3H3U A;  3L00 A;  4I0A A;  4BAY A;  5L3C A;  2Y0M A;  1KU3 A;  1P6R A;  2Z33 A;  1S3J A;  1FP2 A;  2RDP A;  2DTR A;  2RVC A;  1R00 A;  2O3F A;  2XAH A;  1S7O A;  3LFK A;  5HLH A;  1DDN A;  4IJA A;  1OMI A;  2WTE A;  3L09 A;  3TO6 A;  3RDI A;  5BMZ A;  2D45 A;  1U6G A;  1I1G A;  5HDG A;  5CVV A;  2IA0 A;  1ZN2 A;  1HSJ A;  1ZRC A;  1IXR C;  5D4R A;  4UNO A;  1QGP A;  5BOX A;  4UVA A;  1IAW A;  2FOK A;  5DUK A;  1I6X A;  4LLG F;  3ZMS A;  1LQ1 A;  3HIF A;  1KYW A;  4N9I A;  3QU6 A;  2HGC A;  5JHU A;  3HUG A;  2Z9O A;  3I53 A;  3M1E A;  2O0Y A;  4CIC A;  4ZYE A;  2E7W A;  4IRI A;  1HQC A;  4I01 A;  1D3Y A;  2K4J A;  3N97 A;  1E2X A;  2MD5 A;  2LDU A;  3FX3 A;  4U0W A;  3HTU A;  3KP5 A;  3TOA A;  2GWR A;  2ISZ A;  4WCG A;  5DUI A;  1DPR A;  5LHH A;  4UHT A;  1G6N A;  4A5M A;  3K2Z A;  3I59 A;  4YFN F;  3BZ6 A;  4HLY A;  4O5V A;  1YS6 A;  2HYF A;  3DQV C;  3GX4 X;  4EJO A;  2HOE A;  3R4K A;  3CUO A;  4MQ9 F;  4PCQ A;  2QM3 A;  3FMQ A;  1FY7 A;  1HST A;  1OYW A;  4UXN A;  2LKP A;  1HW2 A;  4HX7 A;  1RNL A;  1ON1 A;  2MC3 A;  2ESN A;  3IL2 A;  1PP8 F;  1STZ A;  4UV9 A;  1O3T A;  2XRO A;  2FMY A;  3ZMU A;  1REP C;  2WV0 A;  4LMY A;  1Z7U A;  3IWZ A;  3HTS B;  3ZP5 A;  3TO7 A;  2Q8K A;  3J81 Z;  1MDM B;  3MZH A;  1ZRF A;  2QQB A;  4IRH A;  3BDD A;  3ABU A;  1E17 A;  4HW0 A;  1QPM A;  5A2Q Z;  3NEU A;  3S2W A;  1YG2 A;  4Y13 A;  3ULQ B;  2Y48 A;  2Z5U A;  4Q47 A;  4OIQ F;  2F5F A;  1P4X A;  3MAJ A;  1SAX A;  2BGC A;  3EUH A;  4L9J A;  2LNB A;  1KQ8 A;  2D1V A;  3Q5F A;  3F22 A;  5L3G A;  3E6B A;  3FM5 A;  4KIG A;  1LDJ A;  1FSH A;  4I09 A;  2HFH A;  2A5Y B;  3BJ6 A;  1XSX A;  2VN2 A;  1SFU A;  2O8X A;  4EM1 A;  5TJJ A;  2VE9 A;  3SXY A;  2PMU A;  4L0Y B;  5EEG A;  4RGX A;  1SD6 A;  4A0X A;  4L5I A;  1BN5 A;  2YSR A;  3F21 A;  3DXJ F;  3R0A A;  4L9T A;  4CHU A;  2QBY B;  4DNC A;  2QWW A;  3M9A A;  3KP7 A;  2K02 A;  2PFB A;  2E7X A;  5D6E A;  5D5W B;  4KN4 X;  5E1W A;  4XSZ F;  4XLN F;  1YTY A;  2PG4 A;  4HOB A;  4M73 A;  4BNC A;  1D5V A;  3Q9V A;  1XB4 A;  6PAX A;  3FM3 A;  3RYP A;  1XD7 A;  3KLO A;  2EB7 A;  2H09 A;  3LA7 A;  1IW7 F;  1R58 A;  3E6C C;  2C6Y A;  2Q0O A;  3L2C A;  1DPU A;  1HW1 A;  2KIU A;  3PQJ A;  2YX4 A;  2OBP A;  1QQI A;  1CGP A;  2EK5 A;  5LEJ A;  2UXX A;  2IP2 A;  3DF8 A;  3LA3 A;  1U2W A;  4AIJ A;  5LRR A;  1FOK A;  2XAF A;  2DO7 A;  1PUE E;  3V8K A;  4UVB A;  1C0W A;  3DKW A;  4IF4 A;  1BIB A;  2IVM A;  4A6D A;  2BV6 A;  2L02 A;  1BOA A;  2FE3 A;  2FF4 A;  2OA4 A;  1D8K A;  3F8F A;  4XRF A;  2EJR A;  2M1B A;  4PGH A;  3WTY C;  1QO0 D;  1DP7 P;  5HDK A;  4FX4 A;  2L54 A;  5LHG A;  1FZP B;  2RNJ A;  5H6R A;  3QP5 A;  3REO A;  5TRD A;  2MLG A;  4ASN A;  3TDU C;  3F8B A;  1YW9 A;  1SFX A;  5F64 A;  2FBK A;  4G8X A;  1R1V A;  5E18 F;  2KJC A;  1R7J A;  1I1S A;  4JQF A;  4ZZD A;  2EWN A;  3QP6 A;  1YW7 A;  2VBX A;  1K78 B;  2RV8 A;  4K2E A;  3MZY A;  4ON0 A;  1ZAO A;  4KMF A;  4G94 A;  1SD7 A;  1FBS A;  4EJT A;  1R22 A;  2ETH A;  4YII A;  2ZCW A;  2F5D A;  5FD5 A;  5FO5 A;  2ZNY A;  1FLI A;  2G9W A;  2AXL A;  3QPH A;  1XGN A;  1ZYR F;  4ESJ A;  1B9M A;  2Q2E A;  4OMY A;  3GXO A;  2P5L C;  2VT2 A;  2MLK A;  3KEO A;  1R23 A;  2BBY A;  5K5Q A;  1JE8 A;  3T0Y A;  2M87 A;  2A3S A;  3Q9S A;  2YU3 A;  4RGR A;  4ESB A;  5D6F A;  1L3L A;  5DD4 A;  1X3U A;  3BRO A;  3ISP A;  4GCV A;  4ENM A;  4HAM A;  4R8H A;  4B09 A;  1TBX A;  5E8I A;  1P4W A;  3QOP A;  3P9C A;  4U7D A;  2KIF A;  4M72 A;  4EQQ A;  4HF0 A;  3MFK A;  1W5T A;  5IT3 A;  3IHU A;  1XGS A;  1ZG5 A;  2HEO A;  3WTU C;  2P4W A;  1EH6 A;  3H3Z A;  5K5R A;  3CUQ A;  3QRF F;  5HS9 A;  5CJ9 A;  2CWE A;  3GW2 A;  3MCZ A;  1WI9 A;  1IRF A;  3HRS A;  4AD9 A;  3FXU A;  3ECH A;  3J81 K;  1JGS A;  2TDX A;  1XDU A;  1BI0 A;  4WXD A;  2K7L A;  3E6D A;  4HV5 A;  3I59 B;  3M7G A;  3V7C A;  3DP7 A;  5A2Q K;  2VOD A;  3GFI A;  1MJA A;  1K78 A;  2DW4 A;  3FXR A;  1NHA A;  3C1D A;  4RGU A;  3WTS C;  3F6O A;  2EA2 A;  5CVJ A;  4OMZ A;  4YFK F;  1R1T A;  3DPL C;  3JAM Z;  1YLF A;  1YIO A;  1G3Y A;  3LA2 A;  4M9S A;  2QQ9 A;  3P7N A;  4UV8 A;  2JSC A;  2O6G E;  1XDS A;  2LF8 A;  2OAZ A;  3VOD A;  3NRV A;  3M8E A;  3VB2 A;  5AIP A;  4AIK A;  4G9Y A;  4MNU A;  2CYY A;  2QLZ A;  5CVR A;  3OV8 A;  2BE5 F;  4AVP A;  2PQ8 A;  5FGM A;  1P92 A;  1L0O C;  1LVA A;  1W7P B;  1S7A A;  2MA3 A;  3R6S A;  2XVC A;  2EFW A;  4YFX F;  2BEO A;  2PJP A;  2CW0 F;  1O3R A;  3VEP A;  2QZ8 A;  4B8X A;  1W7P D;  4LLL A;  5LEK A;  1R5H A;  4UVC A;  4KN7 X;  3G3Z A;  4ETS A;  2P8T A;  4RAZ A;  4AWX B;  2XAQ A;  3DV8 A;  4I7H A;  1U8R A;  2ESH A;  5HDN A;  4LK1 F;  2CG4 A;  1J75 A;  4OIP F;  1FYL A;  2P7V B;  1QZY A;  4Z2Y A;  1XGO A;  5KK1 A;  4NB5 A;  5ICE A;  4P9F A;  2GA2 A;  4IHS A;  3DEU A;  3R60 A;  3LQR A;  1J59 A;  5DDG A;  2V79 A;  4MQV A;  1B4A A;  1FP1 D;  2QUF A;  5HVQ C;  2VOP A;  3FZV A;  2KKO A;  3ABT A;  2UXN A;  3I64 A;  4H0E A;  1BJA A;  3GFL A;  4KUM A;  3W6J B;  2JZY A;  4R1H A;  3LST A;  2XAG A;  3L7W A;  3GVA A;  3RIR A;  2W24 A;  5DYM A;  1ZH5 A;  3VOE A;  3WTT C;  2CO5 A;  2O03 A;  5LGT A;  2OD5 A;  4HQM A;  4G6D A;  5K1Y A;  3SQN A;  4KMU X;  1Z1D A;  3R0J A;  1FBU A;  1ONV A;  1TNT A;  4ENN A;  4HDU A;  2VT3 A;  5D5U B;  1LDD A;  4A0Y A;  3I0T A;  2D1H A;  1J5Y A;  2MH9 A;  5H20 A;  3JW4 A;  4YIF A;  4LJZ F;  1KU2 A;  2STW A;  4CO8 A;  2WWY A;  2KRF A;  1BI3 A;  2ZKZ A;  3C3W A;  3PFI A;  4IXA A;  4EVI A;  5D4S A;  3KZZ A;  2HKX A;  4HF1 A;  5JR3 A;  1V4R A;  1W7P A;  3ROU A;  4G7H F;  4MTD A;  4ENJ A;  3WTX C;  3IRR A;  3HHH A;  1J9I A;  2IA2 A;  2CFX A;  3PQK A;  2A69 F;  1DUX C;  3RKW A;  3TO9 A;  2EA4 A;  1WWX A;  4HA8 A;  1TNS A;  4BHP A;  2XRN A;  1V3F A;  3I54 A;  3WE2 A;  3LAJ A;  1RUO A;  1O7L A;  3WOD F;  3CDH A;  2NRA C;  2CQK A;  4OIN F;  4LB5 A;  1I27 A;  5ICC A;  1IZ1 A;  3F72 A;  2M8E A;  2M5W A;  1Q1H A;  1LJ9 A;  2R7D A;  1FYK A;  4M74 A;  2DFI A;  5JI6 A;  2GIV A;  3KET A;  2OU2 A;  1FNN A;  1IN8 A;  3M8F A;  4I2O A;  5F6F A;  1CF7 B;  5LGN A;  1FSE A;  1ULY A;  3SFZ A;  4A0Z A;  4BHC A;  2FEZ A;  3V4G A;  2XAJ A;  4LLN A;  3IKT A;  2HS5 A;  3HOS A;  3AAF A;  3RYR A;  3EYI A;  2NNN A;  4WF2 A;  4O6J A;  4OIR F;  5J8F A;  3CO7 C;  4U88 A;  1MKM A; 
#chains in the Genus database with same CATH topology
 4FQG A;  1WJA A;  1U78 A;  3S3O A;  1ZRD A;  4BEH A;  5E8G A;  2W82 A;  4W97 A;  4H4K C;  1X1C A;  5B1A H;  2XSJ C;  2EFN A;  2O7O A;  1J7K A;  2K27 A;  1J2X A;  3QPT A;  4ZYG A;  2AO9 A;  3SHF A;  3ZCO A;  2YU9 J;  1OPC A;  2YR2 A;  4E4H A;  2NYX A;  1OFC X;  4NQW A;  3CDI A;  3DEW A;  4IZZ A;  3DTI A;  2CGP A;  2H1L A;  4EGY A;  1RPW A;  2DU9 A;  2KQR A;  2E60 A;  2JSP A;  3S3N A;  3E7L A;  2ELJ A;  1ETK A;  4XK4 A;  2XSD C;  2PN6 A;  3COA C;  4CCJ A;  1X2N A;  2CFO A;  3IH4 A;  4IEJ A;  1TW3 A;  2Y69 H;  1PP7 U;  2ZME B;  4G7Z F;  2ZXJ A;  3BZC A;  3HOT A;  4WX9 A;  2L4A A;  4ZH4 F;  5K7Z A;  2VQH A;  5DCF A;  3V8L A;  4XRS G;  1TWH J;  1WSU A;  2OJE D;  1T38 A;  1HXD A;  2YPR A;  3DKY A;  5GP9 A;  4BXU A;  1TQI A;  4PZJ A;  1TLH B;  1U5T C;  5FB2 A;  4YG2 F;  4IOA F;  5L3E A;  2B7E A;  3DPT A;  4LG3 A;  1P2F A;  2PI0 A;  3PL8 A;  1S8N A;  3IC7 A;  1XSD A;  2STT A;  5ED4 A;  1T0F A;  3BJO A;  4MGR A;  3MKL A;  5TGT A;  4N4N B;  4E7K A;  3RPQ A;  3WU1 B;  4WXC A;  1PUF A;  2XPU A;  5IYD J;  4FT8 A;  4Q5S F;  4JK1 X;  1AU7 A;  1UCR A;  1O7F A;  2JK3 A;  2EFQ A;  3JAM K;  1V55 H;  2UV1 A;  3VDX A;  5HOO A;  3KP4 A;  3WGH A;  4UB8 C;  2Y9Z A;  1WJ5 A;  2XB0 X;  3RKY A;  1O57 A;  2QYO A;  4LK0 F;  3BTL A;  2PLY A;  4EJU A;  3DWL E;  2FQ4 A;  4BE1 A;  1ZG3 A;  1RZ4 A;  1U9N A;  1YO5 C;  3PFY A;  5L3B A;  4E6K G;  2X1E A;  3BPX A;  5DEQ A;  2ZBK A;  3IWF A;  2E1M C;  1TW2 A;  2GBY A;  1J09 A;  3CUQ B;  3MQ0 A;  5GAE J;  1G3S A;  3KE2 A;  5IT9 Z;  5ICG A;  3HOV J;  4Y4R A;  1GUU A;  1G8X A;  3FKJ A;  3FXM A;  5EZG A;  3PJR A;  2JPB A;  1R36 A;  4L5J A;  1FX7 A;  4IQJ A;  4L9N A;  3BT9 A;  1EKE A;  2COM A;  3ASO H;  2A6E F;  2IEK A;  2VC0 A;  5KAI C;  2Z1D A;  4F3Q A;  2G7H A;  1YFH A;  1B1B A;  3ZRG A;  5FD6 A;  1BC7 C;  2LKS A;  1Z77 A;  5IP7 J;  4F52 A;  3LWF A;  4HZF A;  2R7V A;  2H6B A;  4FX0 A;  4I02 A;  3BLY A;  3TW7 A;  5CYV A;  4JX5 A;  1JGG A;  2BY3 A;  3KFW X;  3WE3 A;  4HSR A;  4IKF A;  3TDZ C;  4BU2 A;  1T2K A;  4P1W A;  5F04 A;  3UKG A;  2VOO A;  4ITV A;  2HDD A;  1S72 I;  2VC1 A;  2GA1 A;  5E1X A;  1APL C;  2X1C A;  3WU0 A;  1BW6 A;  4LGW A;  3CJN A;  2R7F A;  2GLO A;  5J8C A;  1CF7 A;  2MC4 A;  4KT6 A;  3KYD B;  3TOB A;  3S3M A;  1T33 A;  3B6C A;  3MEX A;  2KRH A;  1XCB A;  4CZZ A;  4HDV A;  1HDP A;  2EZH A;  3HSE A;  1B6A A;  1XMA A;  4G12 A;  4XKW A;  2XV4 S;  3M8J A;  3Q0U A;  1WVR A;  4EJW A;  1GVJ A;  2GM4 A;  3WTW C;  4RAY A;  1SVM A;  3SDB A;  1I39 A;  3WGG A;  1IXS B;  2EFP A;  4IPA A;  1JXS A;  2A61 A;  5L3F A;  3DBR B;  4II2 A;  2P6S A;  3GFJ A;  3QWL A;  3LSM A;  1MH4 A;  5HLG A;  1AWC A;  2YX7 A;  3OIQ A;  3P9K A;  2B0L A;  2CU7 A;  4B3A A;  2W84 A;  5IOZ A;  2JMW A;  3K0L A;  2JUG A;  3L2U A;  4D0P A;  2LOO A;  2R7W A;  4LG0 B;  3E5X A;  1K7A A;  4LD5 A;  2Z3Y A;  4RM2 A;  1G4D A;  2TRT A;  1IRG A;  3BCA A;  2X51 A;  1LFB A;  4DQ2 A;  2NVU B;  3OYJ A;  3E5U A;  3NWT A;  2M0M A;  4GXO A;  5HS8 A;  4HYE A;  1SFE A;  1SFK A;  2YUS A;  5KAF C;  2X9D A;  3E6M A;  3FHN A;  5EYR A;  1RKT A;  1X58 A;  2I8D A;  1E0E A;  1XSV A;  1Z05 A;  3H0G J;  2R4G A;  2R93 J;  3NQO A;  2ZME A;  3JSP A;  1WFX A;  3JRH A;  4BY1 J;  2BYV E;  3EYY A;  2B9S A;  3QOD A;  3U1D A;  1AA7 A;  2HQA A;  3FK6 A;  4L9V A;  1XGM A;  4OOI A;  4XN0 A;  5HS7 A;  1CQT A;  1SC7 A;  3DU6 A;  4BXX J;  1XN7 A;  1SMT A;  1ZGW A;  2CW8 A;  3RZD J;  4XSX F;  3QAH A;  3RJP A;  4HNU A;  2W25 A;  1E3H A;  1W36 D;  1IC8 A;  4B43 A;  3CC4 I;  3QU3 A;  5EF6 A;  3U2R A;  3AL0 B;  2M7B A;  2VBW A;  1IG7 A;  2X6W A;  1ZGA A;  2K3F A;  4HG2 A;  2ZXW H;  4EJV A;  2IS2 A;  5JHF A;  3A4C A;  3G73 A;  2HNH A;  4AID A;  2EQR A;  1R5G A;  3KP3 A;  4CYD A;  2V1X A;  3K9T A;  1YE9 A;  2V4J C;  2V9V A;  1VQN I;  2BOL A;  1JT0 A;  3F3X A;  2A07 F;  2WAD A;  5LGU A;  1QZZ A;  1BI1 A;  1LKX A;  2OZU A;  4HV6 A;  3W2V A;  4S04 A;  1EH8 A;  1Z67 A;  2PMZ A;  4GDF A;  3X2Q H;  1WJC A;  1G2H A;  2BW3 A;  3OYM A;  2D2W A;  1E3P A;  1H89 C;  1VTN C;  3H36 A;  1TT5 B;  5F0C A;  4CCK A;  2X4H A;  4B1R A;  3ZOB A;  3CP2 A;  5L3D A;  1W5S A;  4IHT A;  1Z6R A;  2QEN A;  4QSH A;  3A01 A;  2HZD A;  1LNW A;  3BP8 A;  1TZL A;  2MAB A;  4Q48 A;  5CVI A;  3H3V K;  1A6I A;  3CDL A;  4Y15 A;  3OSG A;  1BW5 A;  1MSF C;  5F0H A;  2IRF G;  2VJI A;  3W6V A;  1SVL A;  2EV5 A;  3HPG A;  3SZT A;  1IO2 A;  3BR2 A;  4DOZ A;  2ADU A;  1S5L C;  3B02 A;  3K1M A;  2M7A A;  3RI4 A;  3DEE A;  3E97 A;  2XB5 A;  2EFO A;  1FBQ A;  3H5R A;  3V42 A;  1MZB A;  2DFE A;  1NK3 P;  1T95 A;  2JT1 A;  3BY6 A;  2P5K A;  3F8C A;  3HRU A;  1PDN C;  2IT0 A;  2X85 A;  3ML6 A;  2GXB A;  2LF7 A;  3DTK A;  4RMN A;  1T8I A;  1QNT A;  3EUH C;  3IUO A;  4A2U A;  1FTZ A;  3TW6 A;  2FRH A;  3D1N I;  1MBK A;  2KIQ A;  4OIO F;  3GWZ A;  2L3D A;  4RAF A;  1BR4 A;  5B66 C;  3FDY A;  5AIQ A;  1WJE A;  5KHD A;  4KIT B;  3HPH A;  4U0Y A;  5LHI A;  2L4M A;  2HTJ A;  2WV1 A;  3R61 A;  5FKK A;  2RGV A;  1MNM C;  3HOY J;  3EPZ A;  1TTY A;  2ZXH A;  3T8T A;  2JA8 J;  3OYE A;  2MG4 A;  1JHH A;  1Y1V J;  1LEA A;  2DAO A;  2Y2Z A;  3BWG A;  3PUB A;  4OAY A;  4C2U A;  4N0B A;  2P5V A;  4XBF A;  1D8J A;  4LG0 A;  4BYY A;  1ON2 A;  1KGS A;  3TMO A;  4KIB A;  3CC2 I;  1B8I A;  5EEH A;  2RKH A;  5F08 A;  1MMD A;  4P9U A;  3ZMZ A;  1N25 A;  2M30 A;  1JTY A;  2VKH A;  5C4J J;  2BY1 A;  3HRT A;  2QCO A;  3GFM A;  3K69 A;  3LSG A;  1YRN B;  2L01 A;  4KT5 C;  2LR8 A;  3DFG A;  3HHG A;  4PJ0 C;  2DQL A;  4KDP A;  4A6E A;  3KP6 A;  3CLO A;  1KU9 A;  3I5U A;  4E70 A;  4FHT A;  2LSO A;  2Y75 A;  2A6H F;  3BTI A;  2FNP A;  4IVN A;  1O3Q A;  2OTL I;  3BOQ A;  2XPW A;  4ZZL A;  5LRS A;  3RKX A;  1FT9 A;  3FIW A;  2H27 A;  1X1D A;  3E5Q A;  1MIJ A;  2H94 A;  4IHW A;  2NAZ A;  2H6C A;  1VQK I;  1IUY A;  1PVE A;  1UB9 A;  2JN6 A;  2JPC A;  1P4A A;  1YW8 A;  2K9N A;  3K70 D;  4II3 A;  2HDC A;  1W4M A;  2QQ8 A;  3H35 A;  1W5C C;  2ME0 A;  2HR3 A;  2MBF A;  4M9Z A;  1YOV B;  2LVS A;  2WC2 A;  3K10 A;  5EEA A;  4XN3 A;  5ILS A;  3D5R C;  2UWM A;  1LDK B;  2VKE A;  1KQ0 A;  1IN7 A;  2FSW A;  2V9P A;  1HBX G;  1AHD P;  3TQN A;  2DBB A;  3V8J A;  3BCB A;  2NXN B;  3C18 A;  1EV7 A;  2FBI A;  4GRI A;  3D5L A;  4XLP F;  2FNA A;  3HBL A;  2DCE A;  1B9N A;  5DV5 A;  4I0B A;  1RET A;  2JUC A;  3FXK A;  1MD0 A;  2EZL A;  4A3K J;  1IRZ A;  3CTA A;  2JRT A;  1UHM A;  4LFU A;  1NTC A;  3F8N A;  2AS5 F;  2ACJ A;  3K4K A;  4KIF A;  4EAT A;  4KFC A;  3J7A O;  3GZ5 A;  2HOA A;  5F1J A;  2IA1 A;  3H1C A;  4BQA A;  4GGG A;  2HOS A;  2CUZ A;  3J80 Z;  2VON A;  1OKR A;  1IN6 A;  1OYI A;  4QTR A;  1T0F C;  4CSW A;  2O5R A;  3FBI B;  2DA2 A;  3RZO J;  5EDN A;  1X4O A;  4XRS A;  1GT0 C;  3WHB A;  3CQZ J;  3C2B A;  2FXA A;  3GLX A;  1R5I D;  1YHQ I;  1QZE A;  1YYV A;  2DYR H;  2FD5 A;  2EV6 A;  2ZSI B;  2QQA A;  4CDG A;  1ERD A;  1WCM J;  2E1N A;  4BEH B;  3P9I A;  2PMH A;  2VAS A;  3BPV A;  4KIC A;  2KMU A;  1BR2 A;  2XC7 A;  4HBL A;  3G4S I;  2NVX J;  1U9O A;  1HKT A;  2H8W A;  1WHU A;  5IYB J;  2PJR A;  3GO5 A;  2DOE A;  1OCO H;  2LG4 A;  2V6C A;  3F6V A;  4HX8 A;  2BY2 A;  5IT9 K;  2E5Z A;  3CF2 A;  1ZG1 A;  3S8P A;  5GAH J;  5FLX Z;  2FQ3 A;  1RUN A;  1H9T A;  5GTI C;  3O8G A;  4E7H A;  3WTZ A;  5K5O A;  4CYC A;  3BC8 A;  3VYS B;  4G7O F;  4HF2 A;  2ELH A;  5D8K B;  2OQR A;  5HLI A;  2RAE A;  3OSF A;  2EIJ H;  2ME6 A;  2A68 F;  1YQA A;  1HKQ A;  1ZRE A;  3DTE A;  1LFP A;  4AIH A;  3KZY A;  2LBF B;  1FC3 A;  2CUJ A;  4F93 B;  3L2Q A;  3NWS A;  4OWR B;  2EPF A;  3H92 A;  2J5P A;  3HSF A;  5E20 A;  1IF1 A;  2G0E A;  2W4S A;  3S15 J;  2EZI A;  2XF7 A;  3K4J A;  3LOC A;  1YI2 I;  4V2F A;  3V7S A;  1VFC A;  1QBJ A;  2VPL A;  2PMZ N;  3CCM I;  1JKP C;  1H9G A;  3WGI A;  4C3H J;  4JBA A;  2GOX B;  4J19 A;  1V54 H;  2W48 A;  2ZO4 A;  1YS7 A;  3HOX J;  4ZTJ A;  2E2J J;  5HLT A;  1YRN A;  2OTJ I;  1MJ9 A;  2E19 A;  5FFZ A;  2HYG D;  2YS9 A;  4KJZ A;  2VXZ A;  4BH9 A;  1QVU A;  1SD4 A;  2DT5 A;  4C9Y A;  2X1D A;  2R7S A;  3CC7 I;  3U1K A;  3I71 A;  2XKP A;  4A3B J;  1LB2 A;  3GTK J;  1RIO H;  3CJR B;  1R9T J;  4RB0 A;  1IN4 A;  1Z91 A;  4OU0 A;  2GAU A;  3JRF A;  1K6O A;  1BC8 C;  2JWT A;  1MNE A;  4RB3 C;  4IRG A;  2CQN A;  5DCM B;  4QPO A;  5D8L B;  2HXI A;  2RNG A;  5FFX A;  2FA5 A;  4MLO A;  1BM9 A;  4BJT A;  2ZJP F;  1HA8 A;  1FYM A;  4LB6 B;  2KDO A;  1TQM A;  4NDL A;  3O3K A;  3GEZ A;  3VYR B;  5ERI A;  1P7J A;  1UST A;  4P55 A;  1UAA A;  1GV2 A;  2ZC2 A;  3JSO A;  3JRB A;  2HTS A;  3BR3 A;  1JUM A;  2ZME C;  5JVT A;  2WAE A;  3OYA A;  4M71 A;  1H8A C;  3CMA I;  1N77 A;  4DBQ A;  5FRO A;  5J40 A;  1F1Z A;  4E7I A;  4QWQ A;  1XCV A;  1XTA A;  1A35 A;  3KEY A;  1MGT A;  4R79 A;  3O2P E;  3TKY A;  3U9G A;  4CXF A;  2FX0 A;  2VBZ A;  3CO6 C;  3TED A;  3JRG A;  5BPD A;  3ZQG A;  4XL9 A;  4AC0 A;  4Y7N J;  2A5W A;  4Q4Z F;  1V5F A;  4MIM A;  1TWC J;  4MFD A;  2W57 A;  3G1M A;  1BBY A;  4HLX A;  4U87 A;  4FE7 A;  5ILU A;  4XRM A;  1F9N A;  3CP8 A;  4XLH A;  2F5C A;  2VE8 A;  1WI3 A;  5ICF A;  3ZQI A;  4HX4 A;  1FWZ A;  2DFH A;  3V7R A;  1H88 C;  5FKN A;  2KZV A;  3A03 A;  3FMS A;  2HU9 A;  2JVG A;  4ZC3 A;  5J4V A;  5BQT A;  3BZK A;  3N4M A;  3S17 J;  2UZK A;  1A04 A;  2FBH A;  4LIT A;  3OOU A;  3GUD A;  4PJJ A;  3SZP A;  3SZG A;  1XPX A;  2F5E A;  3W2A A;  3HDD A;  1FJL A;  2L2O A;  2GXA A;  3RPU D;  3CUQ C;  3J7A Y;  2ZNZ A;  3PUF A;  4RB1 A;  2Y0S A;  3JRA A;  3WG7 H;  2PBI A;  3G1O A;  4JX6 A;  3W2W A;  1F5T A;  4BHB A;  2XHK A;  5H2F C;  5CVU A;  2BXZ A;  3CJT B;  2DPU A;  3FK7 A;  4PGG A;  4PJL A;  4F7Z A;  5FRM A;  3EQL F;  1UG2 A;  4L18 B;  4NNJ A;  3HKZ A;  3IAS 2;  4RB2 C;  4WWC A;  1RES A;  3BR0 A;  1JHF A;  2LBF A;  4P5O A;  5J1U A;  4M6X A;  1VZ0 A;  2LKX A;  3ZMD A;  3S1N J;  3ZN1 A;  2AQF A;  3F0C A;  2GXG A;  3ONQ A;  4DYQ A;  2CV2 A;  3CCR I;  2DA5 A;  5CLS A;  4NC6 A;  1HF0 A;  2L9N A;  5B3S H;  3C7J A;  1WQ2 A;  3HRM A;  4EGZ A;  1R1U A;  4GYI A;  1NG7 A;  2I10 A;  3HZJ A;  2XF5 A;  2X0L A;  4N9H A;  3GTJ J;  1NH3 A;  2O9L A;  1ITY A;  1K61 A;  2VQC A;  5E3O A;  1YX3 A;  4NUB A;  2CSO A;  2IS6 A;  4MFE A;  1A31 A;  1Y8R B;  4EM0 B;  1R6R A;  5FKM A;  2QA4 I;  4ZYD A;  2HOT A;  1BIA A;  4PSX A;  3K4B A;  5J1R A;  1MDM A;  1EH7 A;  1ODD A;  5D5V B;  4S05 A;  4KNY A;  4BDY A;  5H6Q A;  3Q0W A;  1POG A;  2VKD A;  1K83 J;  4KIS A;  2DLL A;  5IOY A;  3ZGK A;  3VFZ A;  5J6X A;  2JTV A;  4RGS A;  3CCV I;  4CGZ A;  2XIG A;  1QPI A;  1G3T A;  2WY8 Q;  3A1Y A;  2DOF A;  3GTG J;  2CRG A;  3H9J A;  5E17 F;  3L9F A;  2BW3 B;  5E1Z B;  4CA0 A;  5E3M A;  5J4Y A;  1USS A;  2IW5 A;  1Y39 A;  1ETO A;  3KLN A;  2HQ5 A;  2R7O A;  5DCM A;  1VQM I;  1W1W E;  2K4B A;  2HZT A;  2QKL B;  3ECO A;  1XS9 A;  2XAS A;  1KON A;  3ZQ7 A;  3A01 B;  4HNV A;  1KA8 A;  3JTG A;  2XRL A;  4XOP A;  1XMK A;  1T08 B;  2DTZ A;  3ELK A;  3BJA A;  3K1P A;  1I50 J;  3SEZ A;  3WTV C;  3HSR A;  3K2A A;  4WK8 F;  4M3D A;  1YX5 A;  4ZJZ A;  3LQQ A;  1IXC A;  3FF5 A;  3GF2 A;  4IQ4 A;  2HWV A;  1SD5 A;  2E1C A;  4HQE A;  2X6X A;  2K9M A;  1TWA J;  4CCN A;  4CZC A;  2MFZ A;  3KZI C;  1Z3X A;  2VBY A;  4IL6 C;  3GYH X;  1ZLJ A;  4RM3 A;  3CF5 F;  1TQP A;  4A3I J;  1W36 C;  3FIS A;  2KZG A;  3UR3 C;  4M6Y A;  2XGX A;  2JJ7 A;  3ZQL A;  1WRJ A;  3K1N A;  1J0R A;  4XLC A;  2V1D A;  1KZH A;  1U5T B;  3F23 A;  3T8R A;  2DQR A;  4U0V A;  3RTR A;  2X48 A;  2DN0 A;  2L5Q A;  1ACI A;  4XON A;  1IDZ A;  2GZW A;  2V1U A;  3AFH A;  2FOW A;  5IY5 H;  3DLA A;  3ZQF A;  2XUB A;  3KEQ A;  2QEX I;  1GDT A;  2DA1 A;  1VQL I;  3M3Y J;  2QBY A;  5F1R A;  2HQR A;  2IGN A;  4JX4 A;  4EM2 A;  4ABZ A;  1Y6I A;  3E3V A;  1RI7 A;  3UNG C;  4DJA A;  2QVO A;  3LAP A;  2CW7 A;  1PYV A;  2M45 A;  2P81 A;  2WY7 Q;  3RPU A;  1Z9C A;  2K86 A;  4Y3O A;  3ZMV A;  2FU4 A;  3JRD A;  4LIV A;  3GTL J;  2HKO A;  1FOW A;  2NVT J;  1BI2 A;  1UHS A;  1B8I B;  2E2I J;  1SAU A;  4YEL A;  3ZN0 A;  4XNF A;  2FJ1 A;  1K79 A;  2E1M B;  1Y1W J;  2WB1 N;  4MTE A;  2NVY J;  1S6L A;  1A5J A;  2VJJ A;  1LEB A;  2GQQ A;  5M5X J;  3J80 K;  2A6T A;  1KYZ A;  2ZJ2 A;  1Y0U A;  3BG6 A;  2ZFW A;  5CQG A;  4DIQ A;  1WJF A;  2DI3 A;  2IS4 A;  5GPA A;  5M5Y J;  3O6B B;  1WH5 A;  4YEJ A;  1VI0 A;  1X19 A;  2M34 A;  3KP2 A;  2OC6 A;  3ZMT A;  3PSI A;  4ENK A;  4GO1 A;  3OOP A;  2NS0 A;  4E7Z A;  4DYC A;  2W85 A;  3N05 A;  2XKO A;  1XC5 A;  4D5F A;  1B59 A;  1F4K A;  5FRN A;  3CCL I;  1OR7 A;  4IHV A;  3ZPL A;  4FCY A;  2R5Y A;  3FWE A;  3G6E I;  4M6V A;  1HKS A;  4O3M A;  4AU7 A;  2XDV A;  1FMV A;  3S93 A;  4GYG A;  3LFU A;  1H0M A;  4ESF A;  2M8G X;  2OF7 A;  4EV0 A;  3OYI A;  1LUJ B;  2CQQ A;  3WG9 A;  5LBQ A;  3QPL A;  5FLX K;  2IJL A;  2X6Y A;  5K7F A;  1TWF J;  1TP4 A;  1UFM A;  3ZQH A;  2KIM A;  4EMS A;  5BPI A;  2DXI A;  3Q3S A;  1WJB A;  5DTD A;  3D0S A;  1UG0 A;  3PNV A;  1I5Z A;  3B73 A;  3S1R J;  4UUV A;  3KYC B;  1UHW A;  3CD6 I;  1BOB A;  2VQL A;  3GTO J;  5DD8 A;  1ZLK A;  3AG4 H;  4MHG A;  4ZYH A;  4CCM A;  4KYW A;  2MW8 A;  5AON A;  4C2M J;  1Z0X A;  2QKM B;  2COB A;  1ZHF A;  2Y31 A;  2ISY A;  2KRC A;  3FXQ A;  4P96 A;  2RRE A;  1O3S A;  1GXP A;  1ZGJ A;  2L9S A;  1OCP A;  3E1S A;  3LMM A;  2VQG A;  1SMY F;  1GHC A;  4PDK A;  2KL4 A;  2PEX A;  4FE4 A;  4AM3 A;  5J1Y A;  2DK5 A;  2P7C B;  3F8M A;  3CCJ I;  2HQN A;  4U7B A;  2Y0S N;  4IOC F;  1ZAR A;  3T5X A;  4WXH A;  2CV0 A;  2PX9 A;  2RQP A;  4BXF A;  1T98 A;  2MH2 A;  4XLE A;  2DPD A;  2F2E A;  1GXQ A;  4I98 B;  4G6Q A;  5DM7 F;  1ZEL A;  5BNG A;  2OUM A;  4BKX A;  3HKZ N;  3ESW B;  4L0Z B;  2OZ6 A;  3KCC A;  4M9X A;  1AOY A;  3RQ4 A;  3H0D A;  2Z2S B;  2BVL A;  3GZ6 A;  2Y9Y A;  3FMR A;  2LLK A;  3IRQ A;  3HM5 A;  3JR9 A;  4A5N A;  2PJR B;  4RS8 A;  4MEY F;  5CQE A;  2FML A;  2Z99 A;  3K70 C;  1RRJ A;  2LH9 A;  2LP0 A;  5KVR A;  4A3L J;  2RC4 A;  3ERE D;  1IN5 A;  1V5G A;  2QSF X;  3I58 A;  5JFR A;  3WHC A;  3W6K B;  3SFI A;  4BDZ A;  3NAU A;  2CQ7 A;  4Y17 A;  1HW5 A;  1OCT C;  1HC8 A;  2IGM A;  1U5T A;  2M3A A;  3M4O J;  1MBF A;  4A3C J;  4DZP A;  4CYC B;  4NC7 A;  1ZTR A;  4BS9 A;  3T1B A;  3FHZ A;  4HEA 2;  2IXS A;  3HC7 A;  3OYG A;  1MBG A;  3I4P A;  3IKV A;  4KA4 A;  3QYF A;  1WGX A;  4ZYA A;  5ILV A;  4MEX F;  1S29 A;  2R3S A;  5IYC J;  2RN7 A;  4TV7 A;  3HYI A;  5J3L A;  1FPQ A;  1QHG A;  3TGN A;  2IS1 A;  1VQ5 I;  2O61 A;  3JTH A;  2EV0 A;  2KT0 A;  5KNL A;  1P7I A;  1WKM A;  3D5S C;  3MWM A;  5BS6 A;  3S1M J;  2DK8 A;  2ECC A;  3EDP A;  1G3W A;  3EET A;  2IPQ X;  5D5X B;  1T39 A;  2IGO A;  2JA7 J;  2G7U A;  2KJB A;  2LY2 A;  4X6A J;  3IAM 2;  2P6T A;  1T6S A;  2M4K A;  1U3E M;  1MJB A;  4QLC U;  2W7N A;  2EH3 A;  1VQ8 I;  1Z6T A;  2J5O A;  1KQ9 A;  2ECB A;  3S2H J;  5LLQ A;  3K4L A;  4IHY A;  4NHJ A;  2NNY A;  1KU7 A;  3HG9 A;  3H9Q A;  2OQG A;  4A12 A;  2Q1Z B;  1OYY A;  4RAG A;  3H3U A;  3L00 A;  4I0A A;  2LY1 A;  4BAY A;  2Y0M A;  5L3C A;  1KU3 A;  1P6R A;  5DM6 F;  5GTH C;  2Z33 A;  3MKW B;  4E7J A;  1S3J A;  1FP2 A;  4BJ6 C;  3L2W A;  2RDP A;  2DTR A;  2RVC A;  1OLT A;  1R00 A;  3TBI A;  2O3F A;  2XAH A;  3CCY A;  1S7O A;  3GCM A;  3GLL A;  1R4M B;  3LFK A;  5HLH A;  1DDN A;  2DOA A;  4IJA A;  3ERM A;  3HL2 A;  1OMI A;  4F55 A;  2WTE A;  3L09 A;  3TO6 A;  3CCE I;  3RDI A;  1QHH D;  5BMZ A;  4N4O B;  3OL3 A;  2D45 A;  1U6G A;  1I1G A;  5HDG A;  1IJW C;  2FUG 2;  5CVV A;  4NC8 A;  1FIP A;  3GME A;  2EIK H;  4A3J J;  2I5U A;  2IA0 A;  2EIL H;  1IUF A;  1ZN2 A;  2CJJ A;  1VQ4 I;  1HSJ A;  2DA3 A;  3DPU A;  4PFP A;  1ZRC A;  3OMY A;  1IXR C;  5D4R A;  4UNO A;  1D0X A;  1QGP A;  5BOX A;  4UVA A;  1IAW A;  2FOK A;  5DUK A;  3Q0V A;  1I6X A;  4LLG F;  4BBR J;  4UUS B;  3KPH A;  3ZMS A;  2KDZ A;  1LQ1 A;  2D5V A;  3HIF A;  1KYW A;  5CPR B;  4N9I A;  2MYS A;  3QU6 A;  3S32 A;  2NS7 A;  2HGC A;  3GTQ J;  5JHU A;  3HUG A;  2Z9O A;  3QQA A;  3I53 A;  3IH3 A;  3M1E A;  2L9R A;  2O0Y A;  4CIC A;  4ZYE A;  5FLV A;  2E7W A;  4IRI A;  1BJZ A;  1HQC A;  1ORK A;  2R7U A;  3GBG A;  1D3Y A;  2K4J A;  4I01 A;  5EG0 B;  3N97 A;  3OYD A;  3MKZ A;  1E2X A;  2KIS A;  4XLF A;  4E7S A;  1TC3 C;  2MD5 A;  2LDU A;  3FX3 A;  4U0W A;  3HTU A;  3KP5 A;  3TOA A;  5B5E C;  3I9V 2;  2GWR A;  2BY0 A;  2ISZ A;  4WCG A;  2KHM A;  5DUI A;  3A0B C;  1DPR A;  2OCE A;  5LHH A;  4UHT A;  1G6N A;  4A5M A;  1RR8 C;  3K2Z A;  5M3M J;  2E2H J;  1XMX A;  3I59 A;  4YFN F;  4S0H B;  4FAS D;  2MSY A;  1ZQ3 P;  3HEF A;  3BZ6 A;  1X1B A;  2L7Z A;  1FOX A;  4HLY A;  5M3F J;  1D0Z A;  4O5V A;  1JKO C;  2HYJ A;  1YS6 A;  2HYF A;  5HNH A;  1O4X A;  4HRI A;  3O8H A;  3DQV C;  3GX4 X;  4GFB A;  4XIC A;  4EJO A;  2HOE A;  3ABM H;  3R4K A;  3CUO A;  4MQ9 F;  4PCQ A;  2CS3 A;  2QM3 A;  3FMQ A;  3FXJ A;  2ICW G;  2EBI A;  2ZFU A;  2M2E A;  3OR2 C;  1FY7 A;  1HST A;  1OYW A;  4UXN A;  3OYL A;  2LKP A;  2W1O A;  2EIN H;  5FKL A;  1HW2 A;  1LFU P;  5TIS C;  4HX7 A;  1RNL A;  2ZJR F;  1ON1 A;  1LPQ A;  2DT7 B;  2MC3 A;  3G2B A;  2ESN A;  1I3A A;  3IV5 A;  3IL2 A;  1PP8 F;  1STZ A;  2IBD A;  3EUA A;  4UV9 A;  1O3T A;  5E3N A;  1AKH B;  3FKI J;  2JRM A;  3VWB A;  1HOM A;  1D1A A;  2XRO A;  3MMY B;  2FMY A;  3ZMU A;  1REP C;  1FTT A;  2WV0 A;  2XAU A;  4LMY A;  4PFO A;  4PJM A;  4XM3 A;  2E35 A;  1ZK8 A;  3ABL H;  1WPK A;  3FBN B;  1Z7U A;  3IWZ A;  1LE8 A;  3HTS B;  3ZP5 A;  3TO7 A;  2WBM A;  1MBJ A;  4L5E A;  2MD0 A;  2Q8K A;  1R71 A;  2BZT A;  3J81 Z;  1MDM B;  3MZH A;  1ZRF A;  2CQX A;  2LRE A;  1ETQ A;  2QQB A;  3JRE A;  4IRH A;  1MW7 A;  3DCF A;  3BDD A;  3ABU A;  1E17 A;  4HW0 A;  1FMW A;  1QPM A;  5A2Q Z;  3NEU A;  3S2W A;  1YG2 A;  3PIP F;  1GLN A;  1Y0N A;  1K6Y A;  4Y13 A;  3KYL A;  1X3Z B;  3ULQ B;  2Y48 A;  2Z5U A;  2DMN A;  2LY9 A;  2WB1 A;  2E71 A;  3ASN H;  2KFD A;  4PUS A;  4Q47 A;  4OIQ F;  5K7H A;  2F5F A;  1P4X A;  3HGG A;  1ZKG A;  3MAJ A;  4J01 A;  1SAX A;  2BGC A;  1UEL B;  3EUH A;  4L9J A;  4IO9 F;  2LNB A;  1KQ8 A;  3BR5 A;  4QIW N;  2D1V A;  1X1P A;  1IV8 A;  3Q5F A;  3F22 A;  5L3G A;  2IAI A;  3H9G A;  1VQ7 I;  3JRI A;  2VPR A;  3E6B A;  3FM5 A;  4KIG A;  1LDJ A;  3ZR8 X;  1FSH A;  3BTC A;  4AYB A;  4I09 A;  4UUS A;  5EJC A;  2HFH A;  2A5Y B;  3L2V A;  3BJ6 A;  4AVZ A;  5J47 A;  2R7Q A;  1FOY A;  1XSX A;  2VN2 A;  2JA2 A;  2XGD A;  2HPI A;  4DBR A;  4DW6 A;  3S14 J;  3P5J A;  1RC9 A;  1SFU A;  2O8X A;  4EM1 A;  1SVO A;  5TJJ A;  1IGN A;  2VE9 A;  1Y8Q B;  3SXY A;  1PJR A;  2PMU A;  4L0Y B;  3A0H C;  5EEG A;  2QSH X;  4RGX A;  3DKX A;  4X1E A;  1SD6 A;  2LYC A;  4A0X A;  2LK2 A;  4XLA A;  4YRV A;  4L5I A;  1BN5 A;  5EG0 A;  9ANT A;  1UJ8 A;  2YSR A;  3F21 A;  3DXJ F;  3MVP A;  3R0A A;  3OS2 A;  4L9T A;  4BJ5 C;  2ZJQ F;  4CHU A;  2L7K A;  3J7Y J;  1WH7 A;  3BQY A;  2QBY B;  1ETW A;  4DNC A;  2QWW A;  4B44 A;  2R0Q C;  3M9A A;  2XGE A;  4UUT A;  3KP7 A;  2K02 A;  1IV6 A;  2PFB A;  2E7X A;  5D6E A;  1VQP I;  4HPQ A;  2VKV A;  4KN4 X;  5D5W B;  2E36 A;  5E1W A;  4XSZ F;  4XLN F;  1YTY A;  2PG4 A;  4HOB A;  2VB6 A;  4M73 A;  4BNC A;  1D5Y A;  1D5V A;  3Q9V A;  1XB4 A;  2ELK A;  4C3J J;  1IRX A;  6PAX A;  3FM3 A;  2N8G A;  3OIO A;  3RYP A;  1XD7 A;  3KLO A;  3PNY A;  2EB7 A;  1MSE C;  2K85 A;  2K40 A;  2H09 A;  3LA7 A;  4PSW A;  3K4C A;  4A3E J;  2GIZ A;  1IW7 F;  1R58 A;  4V19 K;  3E6C C;  2C6Y A;  3GTM J;  2KP6 A;  2Q0O A;  3BG3 A;  2CMP A;  2Q2E B;  3L2C A;  1DPU A;  3AG3 H;  4XOR A;  3TP0 A;  1HW1 A;  1T56 A;  2DMU A;  2KIU A;  3PQJ A;  4M3E A;  2YX4 A;  5JLW A;  1NK2 P;  1JJ6 C;  4BQO A;  2OBP A;  3QOE A;  1QQI A;  1CGP A;  1OCZ H;  3RCO A;  2R92 J;  2EK5 A;  1AKH A;  5LEJ A;  1JTX A;  4BUP A;  2UXX A;  2BHY A;  1SEU A;  2IP2 A;  1QRY A;  2R5Y B;  1GV5 A;  3DF8 A;  2E34 A;  2ID3 A;  1E3O C;  3BG9 A;  1U2W A;  3LA3 A;  4AIJ A;  1SFO J;  1OQY A;  2DDA A;  5LRR A;  1FOK A;  2XAF A;  4CCO A;  4IX7 A;  2DO7 A;  2H8R A;  3CCS I;  3FXO A;  1PUE E;  1QU3 A;  3V8K A;  4UVB A;  1C0W A;  2ZSH B;  2DYS H;  3DKW A;  1N78 A;  4IF4 A;  3BQZ A;  1BIB A;  3TP3 A;  2L9V A;  2IVM A;  4A6D A;  5FLM J;  2R5Z A;  2L0K A;  2DMP A;  2L7F P;  4XR6 A;  2BV6 A;  3SYT A;  2L02 A;  3K4M A;  1A6Q A;  1BOA A;  2HVR A;  2FE3 A;  2FF4 A;  2OA4 A;  1D8K A;  5IPA A;  1DGR M;  3F8F A;  4XRF A;  5FJ8 J;  2EJR A;  3PO2 J;  2KPM A;  2M1B A;  4PGH A;  2OCC H;  3WTY C;  4W1U A;  1QO0 D;  1JKQ C;  2B63 J;  1DP7 P;  5HDK A;  3KIO A;  4FX4 A;  2L54 A;  4RLQ A;  3DBH B;  1OIS A;  5LHG A;  2EIM H;  1FZP B;  4RLF A;  2RNJ A;  5H6R A;  3QP5 A;  1JJ8 C;  3REO A;  5TRD A;  2MLG A;  3DU5 A;  4ZTF A;  4ASN A;  5E3L A;  4A93 J;  3TDU C;  3F8B A;  2VXD A;  1YW9 A;  1JKR C;  3PSF A;  1SFX A;  5F64 A;  3K7A J;  3VYT B;  2FBK A;  4F92 B;  3JCU C;  4G8X A;  3C2H A;  1R1V A;  3H5A A;  2K9Q A;  5E18 F;  2XGC A;  2KJC A;  3TL4 X;  1R7J A;  2XPV A;  3BR6 A;  1I1S A;  3ZXS A;  4XQF A;  4JQF A;  4ZZD A;  2EWN A;  3QP6 A;  3CME I;  2LC2 A;  1YW7 A;  2VBX A;  1K78 B;  3S2D J;  2LRD A;  3OWT A;  4RBO A;  2H1K A;  3LL7 A;  2F4M B;  2RV8 A;  3AL0 C;  4K2E A;  3ABK H;  3M1C A;  4I99 C;  3SEQ A;  4CH7 A;  3MZY A;  1N75 A;  4XKC A;  3HGY A;  4ON0 A;  1ZAO A;  2LMD A;  1VQ6 I;  1HLV A;  4KMF A;  4G94 A;  2ZXI A;  3NAR A;  1SD7 A;  1K4T A;  1JUP A;  4XID A;  2JA5 J;  5F27 A;  1FBS A;  3F9K A;  2NOG A;  4EJT A;  1R22 A;  3G1L A;  1ENH A;  2HI3 A;  2ETH A;  4YII A;  4XKB A;  3BTJ A;  2ZCW A;  3OYF A;  2F5D A;  5FD5 A;  5FO5 A;  2ZNY A;  2W00 A;  1BL0 A;  1FLI A;  2G9W A;  2V7F A;  2AXL A;  2ZB9 A;  5IP6 A;  2V6E A;  3QPH A;  2OV7 A;  3CJQ B;  2R7T A;  1XGN A;  1DU6 A;  2GOM A;  1QVT A;  1ZYR F;  1MH3 A;  4ESJ A;  4BGD A;  3RSN A;  1B9M A;  4A3F J;  4D7M A;  2Q2E A;  1S7E A;  4ZDL A;  4OMY A;  3GXO A;  2M4G A;  2P5L C;  2BXY A;  2VT2 A;  3I3L A;  2MLK A;  1JI8 A;  5LFA A;  3SJM A;  3KEO A;  4AYB N;  1R23 A;  3OS0 A;  2BBY A;  5K5Q A;  4UB6 C;  2OPT A;  1JE8 A;  3I4M J;  2DDB A;  3LSI A;  3OL4 A;  3T0Y A;  2M87 A;  2XF6 A;  2WAF A;  2A3S A;  2E5N A;  1ETX A;  2DJN A;  4BBS J;  3Q9S A;  3JRC A;  2DJI A;  3CMY A;  4IHX A;  2YU3 A;  4RGR A;  4ESB A;  5M5W J;  5D6F A;  1L3L A;  3CLQ A;  4F91 B;  2M9H A;  5DD4 A;  1X3U A;  3BRO A;  3ISP A;  1DP3 A;  1EF4 A;  1UMQ A;  1X1A A;  4GCV A;  4ENM A;  4EEF G;  4HAM A;  4R8H A;  5CKT A;  4B09 A;  1ETV A;  2F5V A;  1TBX A;  2LFB A;  2VL8 A;  1XG1 A;  1P4W A;  5E8I A;  3J7Z I;  3QOP A;  3P9C A;  3IH2 A;  4U7D A;  2KIF A;  3OR1 C;  4M72 A;  4EQQ A;  4HF0 A;  3HUG B;  3MKY B;  1MMA A;  3MFK A;  1W5T A;  4A3M J;  3K4N A;  3PIO F;  5IT3 A;  1RKW A;  2Y30 A;  2CV1 A;  3CZ6 A;  3IHU A;  2F48 A;  1XGS A;  2VIX A;  1YJN I;  2DT6 A;  1ZG5 A;  2HEO A;  3WTU C;  2P4W A;  1EH6 A;  1Z3Y A;  3H3Z A;  5K5R A;  2WAQ A;  3CUQ A;  3QRF F;  5HS9 A;  5CJ9 A;  3IP4 B;  2DA7 A;  2CWE A;  3GW2 A;  3MCZ A;  1WI9 A;  4JOM A;  4BQQ A;  2R7Z J;  1IRF A;  4G6T B;  3HRS A;  4AD9 A;  1I6H J;  2CH0 A;  3FXU A;  4Z6Y A;  3ECH A;  2LD5 A;  1G59 A;  3J81 K;  1JGS A;  2TDX A;  4C3I J;  1XDU A;  2BHZ A;  1BI0 A;  4WXD A;  2K7L A;  3E6D A;  3QYB A;  3PO3 J;  4HV5 A;  3I59 B;  1XX5 A;  3M7G A;  3V7C A;  3DP7 A;  5A2Q K;  4NBQ A;  2VOD A;  1V5E A;  2DA4 A;  1MJA A;  3GFI A;  1K78 A;  2DW4 A;  3FXR A;  4FTH A;  4JP0 A;  1OCC H;  2ID6 A;  1I3Q J;  3OIP A;  4A3G J;  1NHA A;  3HXL A;  2QSG X;  3C1D A;  1MMS A;  2DA6 A;  3MN2 A;  3ZQQ A;  4RGU A;  3WTS C;  3F6O A;  3QYE A;  2EA2 A;  5CVJ A;  3OYN A;  2VLA A;  2HPM A;  1Z7L A;  1VF9 A;  1X4P A;  3FXL A;  4J00 A;  2NS8 A;  3K6G A;  1F36 A;  4OMZ A;  4YFK F;  2K9S A;  2O8K A;  1R1T A;  2JA6 J;  3DPL C;  3JAM Z;  1OJL A;  1YLF A;  1YIO A;  1G3Y A;  1X2M A;  3LA2 A;  4M9S A;  3GTP J;  4XKV A;  2QQ9 A;  2A05 A;  4D1Q A;  3BG7 A;  4V2G A;  3P7N A;  4B48 A;  2F6C A;  4M3F A;  4CCL A;  2V1N A;  4A69 C;  1MMN A;  1B72 B;  3OYH A;  1ZR2 A;  4UV8 A;  3AG1 H;  2F4O B;  1D1C A;  2JSC A;  2O6G E;  1Q1V A;  4BE2 A;  1XDS A;  2LF8 A;  3HB9 A;  4I76 A;  1LE8 B;  4B47 A;  2OAZ A;  2NVQ J;  1S9H A;  3VOD A;  3NRV A;  2QGU A;  3M8E A;  3VB2 A;  5AIP A;  4AIK A;  4G9Y A;  2CUE A;  3M07 A;  4MNU A;  3W3C A;  3EUK L;  2CYY A;  2QLZ A;  5CVR A;  5EGO B;  2HVS A;  4DGW B;  3WU2 C;  3SDG A;  1VQO I;  3OV8 A;  2BE5 F;  4C30 A;  3HOW J;  2F4I A;  5C44 J;  4AVP A;  4FET A;  1DGW Y;  2PQ8 A;  5FGM A;  1P92 A;  4BAC A;  1L0O C;  1LVA A;  1W7P B;  1S7A A;  3MZ8 A;  4QPQ A;  2Z16 A;  2R7R A;  2MA3 A;  3R6S A;  2XVC A;  2EFW A;  4YFX F;  2BEO A;  3C2G A;  2PJP A;  2CW0 F;  1O3R A;  3VEP A;  2QZ8 A;  4B8X A;  1W7P D;  4LLL A;  4D5C A;  5LEK A;  3CCQ I;  3A2K A;  2MGQ A;  1R5H A;  4UVC A;  2K5C A;  4HST A;  4KN7 X;  1Y56 A;  3G3Z A;  4ETS A;  2AXT C;  3LSK A;  2P8T A;  1BR1 A;  4RAZ A;  5DS9 A;  4JYK A;  4AWX B;  2XAQ A;  3DV8 A;  4BL0 B;  4I7H A;  1U8R A;  1P9Q C;  2ESH A;  4CUG A;  1ETY A;  5HDN A;  1BA5 A;  1RR7 A;  4ANJ A;  4LK1 F;  4X0G A;  2CG4 A;  1R49 A;  2QF7 A;  1J75 A;  4OIP F;  5GAD J;  1FYL A;  2P7V B;  3L1P A;  1QZY A;  4Z2Y A;  1A36 A;  1XGO A;  1ZR4 A;  5KK1 A;  4NB5 A;  3OYC A;  4D9J A;  5ICE A;  5HNF A;  4P9F A;  2GA2 A;  1YJW I;  2KLO A;  3DEU A;  4IHS A;  5C4X J;  3R60 A;  1QA6 A;  1MMG A;  3LQR A;  1EJ9 A;  1WJD A;  2RQQ A;  1J59 A;  5DDG A;  1U0J A;  1YJ9 I;  3L2R A;  2V79 A;  5LD2 C;  4LIU A;  4MQV A;  1B4A A;  1D1B A;  2IGK A;  2DOD A;  1FP1 D;  2HVQ A;  4M3G A;  2QUF A;  3CES A;  2HDW A;  4B4C A;  2VJ4 A;  5HVQ C;  2VOP A;  3FZV A;  4OAZ A;  4XOT A;  2KKO A;  3ABT A;  1DU0 A;  2UXN A;  3I64 A;  1MBE A;  4H0E A;  3OS1 A;  3OY9 A;  1BJA A;  3GFL A;  3VSL A;  3VPR A;  4KUM A;  3W6J B;  2JZY A;  4R1H A;  5HOD A;  1TT0 A;  5FKO A;  5C3E J;  1VQ9 I;  1DQU A;  4ZDO A;  3KX2 A;  4A3D J;  3LST A;  2XAG A;  3L7W A;  3GVA A;  3RIR A;  5GAG J;  3BG5 A;  3B6A A;  2W24 A;  3OYK A;  5DYM A;  1IDY A;  1ZH5 A;  4Y33 A;  3VOE A;  3WTT C;  2CO5 A;  2O03 A;  5LGT A;  1X3W B;  3DBL B;  1D0Y A;  2OD5 A;  2L7M P;  4HQM A;  4UY8 I;  2DFF A;  4G6D A;  5K1Y A;  3SQN A;  1WZ2 A;  3S1Q J;  2VI6 A;  5KCM A;  5EZH A;  3VSK A;  4KMU X;  3HOZ J;  1GVD A;  5JLX A;  3RKQ A;  3I4N J;  3I55 I;  1TL8 A;  1Z1D A;  1TWG J;  4NQW B;  3R0J A;  3LSJ A;  1FBU A;  3PM1 A;  2HXO A;  1ONV A;  3MD2 A;  1TNT A;  1MND A;  3H5N A;  3VYU B;  4HDU A;  3I56 I;  4ENN A;  2VT3 A;  5D5U B;  5B1B H;  1LVK A;  1FIA A;  4PJN A;  1LDD A;  4A0Y A;  3I0T A;  1JT6 A;  2D1H A;  1YIT I;  1MBH A;  1J5Y A;  1B72 A;  2MH9 A;  1JUS A;  2X6O A;  5H20 A;  5IP9 J;  1U8B A;  5GPC A;  1M1E B;  3JW4 A;  4YIF A;  3A02 A;  4BQN A;  4M3B A;  4LJZ F;  1KU2 A;  2WA0 A;  4BE0 A;  2STW A;  4LOC A;  3HJE A;  4ZDP A;  4CO8 A;  2WWY A;  2KRF A;  4RA2 A;  4E7L A;  1BI3 A;  1W0U A;  1SAN A;  2ZKZ A;  5EGO A;  2WAQ N;  3C3W A;  3PFI A;  4IXA A;  4EVI A;  3AKZ A;  1W0T A;  2K3P A;  2JVH A;  5D4S A;  3KZZ A;  2HKX A;  3QPS A;  4HF1 A;  1NG6 A;  4DZJ A;  2R5Z B;  1PUF B;  5JR3 A;  1V4R A;  1W7P A;  3ROU A;  2AQE A;  4MTD A;  4G7H F;  2AHQ A;  4ENJ A;  3WTX C;  3G71 I;  3IRR A;  3HHH A;  1J9I A;  3ZQC A;  2IA2 A;  2CFX A;  3LSR A;  3E0J B;  3PQK A;  1HCR A;  5F0F A;  1K4S A;  4B3X A;  2A69 F;  1DUX C;  2R7X A;  3RKW A;  3TO9 A;  2EA4 A;  3CCU I;  1WWX A;  4HA8 A;  2JQ7 A;  4Y52 J;  1TNS A;  4BHP A;  5JVG F;  2XRN A;  1V3F A;  3I54 A;  3WE2 A;  3LAJ A;  1F43 A;  1VND A;  1RUO A;  1O7L A;  5E79 C;  3WOD F;  1FEX A;  2NOJ B;  3CDH A;  2NRA C;  2VUM J;  2CQK A;  3DLL F;  2TCT A;  4XMY A;  2V26 A;  4OIN F;  4LB5 A;  1I27 A;  2M0C A;  3PNT A;  1IZ1 A;  5ICC A;  3F72 A;  2M8E A;  2VJ5 A;  1Z21 A;  2M5W A;  1Q1H A;  1LJ9 A;  2BVM A;  4HNT A;  2R7D A;  1FYK A;  3AG2 H;  4M74 A;  4MO7 A;  2DFI A;  5JI6 A;  3GZN B;  2LTP A;  1EA3 A;  1OR7 C;  2GIV A;  3LNQ A;  3HOU J;  3KET A;  2OU2 A;  1FNN A;  3U21 A;  4FIS A;  2UUZ A;  4YIR X;  2DMQ A;  3RQI A;  1UZC A;  1IN8 A;  3M8F A;  4I6Z A;  4I2O A;  3BR1 A;  2P0W A;  4RDU A;  5F6F A;  1CF7 B;  5LGN A;  1FSE A;  1ULY A;  1OCR H;  4AUX A;  3SFZ A;  2EZK A;  4A0Z A;  4BHC A;  4C2T A;  2FEZ A;  3V4G A;  2XAJ A;  4BY7 J;  4LLN A;  4DYR A;  3IKT A;  2HS5 A;  2CUF A;  3HOS A;  3LSH A;  3AAF A;  3RYR A;  2DMT A;  3EYI A;  3LSP A;  2NNN A;  2V9K A;  4O6J A;  4WF2 A;  4OIR F;  1YIJ I;  2K9L A;  5J8F A;  3S16 J;  3CO7 C;  3OYB A;  1HDD C;  1R4N B;  4U88 A;  3CMM A;  4PK4 A;  1MKM A;  2E1O A;  4D7N A; 
#chains in the Genus database with same CATH homology
 1U78 A;  1ZRD A;  5E8G A;  2EFN A;  1J7K A;  2K27 A;  1J2X A;  3QPT A;  4ZYG A;  3SHF A;  1OPC A;  2YR2 A;  2NYX A;  4NQW A;  2CGP A;  4EGY A;  2DU9 A;  3COA C;  2PN6 A;  1TW3 A;  1PP7 U;  2ZME B;  4G7Z F;  2ZXJ A;  3HOT A;  4WX9 A;  2L4A A;  4ZH4 F;  5DCF A;  3V8L A;  1WSU A;  1T38 A;  1HXD A;  2YPR A;  4BXU A;  1TQI A;  4PZJ A;  1TLH B;  1U5T C;  5FB2 A;  4YG2 F;  5L3E A;  3DPT A;  1P2F A;  2PI0 A;  1S8N A;  3IC7 A;  1XSD A;  2STT A;  5ED4 A;  1T0F A;  3BJO A;  4MGR A;  3RPQ A;  3WU1 B;  4WXC A;  4FT8 A;  4Q5S F;  4JK1 X;  1UCR A;  1O7F A;  2EFQ A;  3JAM K;  5HOO A;  3KP4 A;  3WGH A;  3RKY A;  1O57 A;  2QYO A;  4LK0 F;  2PLY A;  4EJU A;  1ZG3 A;  1RZ4 A;  1YO5 C;  5L3B A;  3BPX A;  5DEQ A;  2ZBK A;  3IWF A;  1TW2 A;  3CUQ B;  3MQ0 A;  1G3S A;  3KE2 A;  5IT9 Z;  5ICG A;  2JPB A;  1R36 A;  4L5J A;  1FX7 A;  4L9N A;  2COM A;  2A6E F;  2VC0 A;  2G7H A;  1YFH A;  1B1B A;  5FD6 A;  1BC7 C;  3LWF A;  4HZF A;  2H6B A;  4FX0 A;  4I02 A;  5CYV A;  3KFW X;  3WE3 A;  3TDZ C;  1T2K A;  2VOO A;  2VC1 A;  2GA1 A;  5E1X A;  3WU0 A;  4LGW A;  3CJN A;  2R7F A;  5J8C A;  1CF7 A;  3TOB A;  3MEX A;  1XCB A;  4CZZ A;  4HDV A;  3HSE A;  1B6A A;  1XMA A;  2XV4 S;  4EJW A;  1GVJ A;  3WTW C;  4RAY A;  3WGG A;  1IXS B;  2EFP A;  4IPA A;  1JXS A;  2A61 A;  5L3F A;  2P6S A;  3GFJ A;  5HLG A;  1AWC A;  2YX7 A;  3P9K A;  2B0L A;  2W84 A;  3K0L A;  4D0P A;  4LG0 B;  3E5X A;  1K7A A;  4LD5 A;  2Z3Y A;  1G4D A;  1IRG A;  4DQ2 A;  3E5U A;  4GXO A;  5HS8 A;  4HYE A;  1SFE A;  3E6M A;  1XSV A;  1Z05 A;  3NQO A;  2ZME A;  3JSP A;  2BYV E;  3EYY A;  3U1D A;  5HS7 A;  4L9V A;  1XGM A;  4OOI A;  1XN7 A;  1SMT A;  4XSX F;  3QAH A;  3RJP A;  2W25 A;  3QU3 A;  3U2R A;  2VBW A;  1ZGA A;  4EJV A;  3G73 A;  1R5G A;  3KP3 A;  4CYD A;  2V1X A;  3K9T A;  2V9V A;  3F3X A;  2A07 F;  5LGU A;  1QZZ A;  1BI1 A;  2OZU A;  4HV6 A;  4S04 A;  1EH8 A;  2D2W A;  1VTN C;  2X4H A;  5L3D A;  1W5S A;  4IHT A;  1Z6R A;  2QEN A;  1LNW A;  3BP8 A;  4Q48 A;  5CVI A;  4Y15 A;  2IRF G;  3SZT A;  2EV5 A;  2ADU A;  3B02 A;  3K1M A;  3RI4 A;  3E97 A;  2EFO A;  1FBQ A;  1MZB A;  3BY6 A;  2JT1 A;  2P5K A;  3F8C A;  3HRU A;  1PDN C;  2IT0 A;  2GXB A;  3ML6 A;  2LF7 A;  1QNT A;  4A2U A;  2FRH A;  4OIO F;  3GWZ A;  2L3D A;  5AIQ A;  4U0Y A;  5LHI A;  2L4M A;  2HTJ A;  3R61 A;  2RGV A;  1TTY A;  3T8T A;  1JHH A;  1LEA A;  2DAO A;  3BWG A;  4N0B A;  2P5V A;  4XBF A;  1D8J A;  4LG0 A;  4BYY A;  1ON2 A;  1KGS A;  4KIB A;  5EEH A;  2RKH A;  4P9U A;  3ZMZ A;  2M30 A;  3HRT A;  3GFM A;  3K69 A;  2L01 A;  4KT5 C;  3DFG A;  3HHG A;  2DQL A;  4KDP A;  4A6E A;  3KP6 A;  3CLO A;  1KU9 A;  3I5U A;  4E70 A;  4FHT A;  2LSO A;  2Y75 A;  2A6H F;  2FNP A;  4IVN A;  1O3Q A;  3BOQ A;  4ZZL A;  5LRS A;  3RKX A;  1FT9 A;  2H27 A;  3E5Q A;  2H94 A;  2NAZ A;  2H6C A;  1IUY A;  1UB9 A;  2JPC A;  1P4A A;  1YW8 A;  2HDC A;  1W4M A;  2HR3 A;  2MBF A;  4M9Z A;  2WC2 A;  5ILS A;  2UWM A;  1LDK B;  1KQ0 A;  1IN7 A;  2FSW A;  1HBX G;  3TQN A;  2DBB A;  3V8J A;  4XLP F;  1EV7 A;  2FBI A;  3C18 A;  3D5L A;  2FNA A;  1B9N A;  5DV5 A;  4I0B A;  1MD0 A;  3CTA A;  2JRT A;  1UHM A;  4LFU A;  3F8N A;  2AS5 F;  2ACJ A;  4KIF A;  4KFC A;  3J7A O;  3GZ5 A;  2IA1 A;  4BQA A;  4GGG A;  3J80 Z;  2VON A;  1OKR A;  1IN6 A;  1OYI A;  2FXA A;  3GLX A;  1YYV A;  2EV6 A;  2QQA A;  4CDG A;  2E1N A;  3P9I A;  2PMH A;  3BPV A;  4KIC A;  4HBL A;  1HKT A;  3GO5 A;  2V6C A;  3F6V A;  4HX8 A;  5IT9 K;  1ZG1 A;  5FLX Z;  2FQ3 A;  1RUN A;  1H9T A;  3WTZ A;  5K5O A;  4G7O F;  4HF2 A;  2ELH A;  5D8K B;  2OQR A;  5HLI A;  2A68 F;  1YQA A;  1HKQ A;  1ZRE A;  4AIH A;  3KZY A;  1FC3 A;  3H92 A;  2J5P A;  3HSF A;  5E20 A;  1IF1 A;  3V7S A;  1QBJ A;  1H9G A;  3WGI A;  4JBA A;  2ZO4 A;  1YS7 A;  1MJ9 A;  5FFZ A;  2HYG D;  2VXZ A;  4BH9 A;  1SD4 A;  2DT5 A;  3I71 A;  2XKP A;  1LB2 A;  1RIO H;  4RB0 A;  1IN4 A;  1Z91 A;  4OU0 A;  2GAU A;  1K6O A;  1BC8 C;  4RB3 C;  4IRG A;  5DCM B;  5D8L B;  5FFX A;  2FA5 A;  1BM9 A;  1FYM A;  4LB6 B;  1TQM A;  3O3K A;  3GEZ A;  5ERI A;  1UST A;  4P55 A;  3JSO A;  2HTS A;  5JVT A;  4M71 A;  1F1Z A;  4QWQ A;  1XCV A;  1MGT A;  4R79 A;  3O2P E;  3TKY A;  3U9G A;  4CXF A;  2VBZ A;  3CO6 C;  5BPD A;  4Q4Z F;  2W57 A;  1BBY A;  4HLX A;  5ILU A;  1F9N A;  2F5C A;  2VE8 A;  5ICF A;  4HX4 A;  1FWZ A;  3V7R A;  3FMS A;  5BQT A;  3N4M A;  2UZK A;  1A04 A;  2FBH A;  3GUD A;  3SZP A;  2F5E A;  3CUQ C;  2ZNZ A;  4RB1 A;  2PBI A;  1F5T A;  4BHB A;  2XHK A;  5CVU A;  2DPU A;  4PGG A;  4F7Z A;  3EQL F;  4L18 B;  4RB2 C;  4WWC A;  1JHF A;  4P5O A;  4M6X A;  3ZMD A;  3ZN1 A;  2GXG A;  5CLS A;  3C7J A;  1WQ2 A;  3HRM A;  4EGZ A;  1R1U A;  4GYI A;  4N9H A;  2X0L A;  2CSO A;  4EM0 B;  4ZYD A;  1BIA A;  1MDM A;  1EH7 A;  1ODD A;  5D5V B;  4S05 A;  4KNY A;  5H6Q A;  2DLL A;  3VFZ A;  5J6X A;  2JTV A;  4RGS A;  4CGZ A;  2XIG A;  1G3T A;  5E17 F;  3L9F A;  5E1Z B;  1USS A;  2IW5 A;  3KLN A;  5DCM A;  2K4B A;  2HZT A;  3ECO A;  2XAS A;  3ZQ7 A;  1KA8 A;  3JTG A;  1XMK A;  3ELK A;  3BJA A;  3K1P A;  3WTV C;  3HSR A;  4WK8 F;  3LQQ A;  1IXC A;  3FF5 A;  3GF2 A;  2HWV A;  1SD5 A;  2E1C A;  4HQE A;  2VBY A;  3GYH X;  1ZLJ A;  1TQP A;  4M6Y A;  2XGX A;  1WRJ A;  3K1N A;  1J0R A;  2V1D A;  1U5T B;  3F23 A;  3T8R A;  2DQR A;  4U0V A;  3RTR A;  2GZW A;  2V1U A;  2XUB A;  3KEQ A;  2QBY A;  5F1R A;  2HQR A;  4EM2 A;  3E3V A;  1RI7 A;  2QVO A;  3LAP A;  2M45 A;  3RPU A;  1Z9C A;  2K86 A;  3ZMV A;  2FU4 A;  2HKO A;  1BI2 A;  3ZN0 A;  1K79 A;  4MTE A;  1S6L A;  1LEB A;  2GQQ A;  3J80 K;  1KYZ A;  2ZJ2 A;  1Y0U A;  2ZFW A;  2DI3 A;  3O6B B;  3KP2 A;  3ZMT A;  4ENK A;  4GO1 A;  3OOP A;  2NS0 A;  2W85 A;  2XKO A;  1F4K A;  1B59 A;  1OR7 A;  3ZPL A;  3FWE A;  1HKS A;  4O3M A;  4GYG A;  1H0M A;  4ESF A;  4EV0 A;  3WG9 A;  5LBQ A;  5FLX K;  2IJL A;  1UFM A;  4EMS A;  2KIM A;  5BPI A;  3D0S A;  1I5Z A;  3B73 A;  4UUV A;  1UHW A;  5DD8 A;  1ZLK A;  4MHG A;  4ZYH A;  4KYW A;  5AON A;  1ZHF A;  2ISY A;  3FXQ A;  4P96 A;  1O3S A;  1GXP A;  1ZGJ A;  1SMY F;  1GHC A;  4PDK A;  2PEX A;  2DK5 A;  2P7C B;  3F8M A;  2HQN A;  4U7B A;  1ZAR A;  3T5X A;  4WXH A;  2RQP A;  1T98 A;  2MH2 A;  2DPD A;  2F2E A;  1GXQ A;  4I98 B;  4G6Q A;  4L0Z B;  2OZ6 A;  3KCC A;  4M9X A;  1AOY A;  3GZ6 A;  3FMR A;  3IRQ A;  4A5N A;  4RS8 A;  4MEY F;  2FML A;  2Z99 A;  5KVR A;  2RC4 A;  3ERE D;  1IN5 A;  3I58 A;  5JFR A;  3W6K B;  4Y17 A;  1HW5 A;  1U5T A;  3T1B A;  3FHZ A;  3IKV A;  4KA4 A;  3I4P A;  5ILV A;  4MEX F;  1S29 A;  2R3S A;  2RN7 A;  4TV7 A;  3HYI A;  1FPQ A;  3TGN A;  2O61 A;  3JTH A;  2EV0 A;  1WKM A;  3MWM A;  5BS6 A;  2DK8 A;  3EDP A;  1G3W A;  3EET A;  2IPQ X;  5D5X B;  1T39 A;  2G7U A;  2KJB A;  2P6T A;  1T6S A;  1U3E M;  1MJB A;  4QLC U;  1Z6T A;  2J5O A;  1KQ9 A;  5LLQ A;  4NHJ A;  2NNY A;  1KU7 A;  2OQG A;  4A12 A;  1OYY A;  3H3U A;  3L00 A;  4I0A A;  4BAY A;  5L3C A;  2Y0M A;  1KU3 A;  1P6R A;  2Z33 A;  1S3J A;  1FP2 A;  2RDP A;  2DTR A;  2RVC A;  1R00 A;  2O3F A;  2XAH A;  1S7O A;  3LFK A;  5HLH A;  1DDN A;  4IJA A;  1OMI A;  2WTE A;  3L09 A;  3TO6 A;  3RDI A;  5BMZ A;  2D45 A;  1U6G A;  1I1G A;  5HDG A;  5CVV A;  2IA0 A;  1ZN2 A;  1HSJ A;  1ZRC A;  1IXR C;  5D4R A;  4UNO A;  1QGP A;  5BOX A;  4UVA A;  1IAW A;  2FOK A;  5DUK A;  1I6X A;  4LLG F;  3ZMS A;  1LQ1 A;  3HIF A;  1KYW A;  4N9I A;  3QU6 A;  2HGC A;  5JHU A;  3HUG A;  2Z9O A;  3I53 A;  3M1E A;  2O0Y A;  4CIC A;  4ZYE A;  2E7W A;  4IRI A;  1HQC A;  4I01 A;  1D3Y A;  2K4J A;  3N97 A;  1E2X A;  2MD5 A;  2LDU A;  3FX3 A;  4U0W A;  3HTU A;  3KP5 A;  3TOA A;  2GWR A;  2ISZ A;  4WCG A;  5DUI A;  1DPR A;  5LHH A;  4UHT A;  1G6N A;  4A5M A;  3K2Z A;  3I59 A;  4YFN F;  3BZ6 A;  4HLY A;  4O5V A;  1YS6 A;  2HYF A;  3DQV C;  3GX4 X;  4EJO A;  2HOE A;  3R4K A;  3CUO A;  4MQ9 F;  4PCQ A;  2QM3 A;  3FMQ A;  1FY7 A;  1HST A;  1OYW A;  4UXN A;  2LKP A;  1HW2 A;  4HX7 A;  1RNL A;  1ON1 A;  2MC3 A;  2ESN A;  3IL2 A;  1PP8 F;  1STZ A;  4UV9 A;  1O3T A;  2XRO A;  2FMY A;  3ZMU A;  1REP C;  2WV0 A;  4LMY A;  1Z7U A;  3IWZ A;  3HTS B;  3ZP5 A;  3TO7 A;  2Q8K A;  3J81 Z;  1MDM B;  3MZH A;  1ZRF A;  2QQB A;  4IRH A;  3BDD A;  3ABU A;  1E17 A;  4HW0 A;  1QPM A;  5A2Q Z;  3NEU A;  3S2W A;  1YG2 A;  4Y13 A;  3ULQ B;  2Y48 A;  2Z5U A;  4Q47 A;  4OIQ F;  2F5F A;  1P4X A;  3MAJ A;  1SAX A;  2BGC A;  3EUH A;  4L9J A;  2LNB A;  1KQ8 A;  2D1V A;  3Q5F A;  3F22 A;  5L3G A;  3E6B A;  3FM5 A;  4KIG A;  1LDJ A;  1FSH A;  4I09 A;  2HFH A;  2A5Y B;  3BJ6 A;  1XSX A;  2VN2 A;  1SFU A;  2O8X A;  4EM1 A;  5TJJ A;  2VE9 A;  3SXY A;  2PMU A;  4L0Y B;  5EEG A;  4RGX A;  1SD6 A;  4A0X A;  4L5I A;  1BN5 A;  2YSR A;  3F21 A;  3DXJ F;  3R0A A;  4L9T A;  4CHU A;  2QBY B;  4DNC A;  2QWW A;  3M9A A;  3KP7 A;  2K02 A;  2PFB A;  2E7X A;  5D6E A;  5D5W B;  4KN4 X;  5E1W A;  4XSZ F;  4XLN F;  1YTY A;  2PG4 A;  4HOB A;  4M73 A;  4BNC A;  1D5V A;  3Q9V A;  1XB4 A;  6PAX A;  3FM3 A;  3RYP A;  1XD7 A;  3KLO A;  2EB7 A;  2H09 A;  3LA7 A;  1IW7 F;  1R58 A;  3E6C C;  2C6Y A;  2Q0O A;  3L2C A;  1DPU A;  1HW1 A;  2KIU A;  3PQJ A;  2YX4 A;  2OBP A;  1QQI A;  1CGP A;  2EK5 A;  5LEJ A;  2UXX A;  2IP2 A;  3DF8 A;  3LA3 A;  1U2W A;  4AIJ A;  5LRR A;  1FOK A;  2XAF A;  2DO7 A;  1PUE E;  3V8K A;  4UVB A;  1C0W A;  3DKW A;  4IF4 A;  1BIB A;  2IVM A;  4A6D A;  2BV6 A;  2L02 A;  1BOA A;  2FE3 A;  2FF4 A;  2OA4 A;  1D8K A;  3F8F A;  4XRF A;  2EJR A;  2M1B A;  4PGH A;  3WTY C;  1QO0 D;  1DP7 P;  5HDK A;  4FX4 A;  2L54 A;  5LHG A;  1FZP B;  2RNJ A;  5H6R A;  3QP5 A;  3REO A;  5TRD A;  2MLG A;  4ASN A;  3TDU C;  3F8B A;  1YW9 A;  1SFX A;  5F64 A;  2FBK A;  4G8X A;  1R1V A;  5E18 F;  2KJC A;  1R7J A;  1I1S A;  4JQF A;  4ZZD A;  2EWN A;  3QP6 A;  1YW7 A;  2VBX A;  1K78 B;  2RV8 A;  4K2E A;  3MZY A;  4ON0 A;  1ZAO A;  4KMF A;  4G94 A;  1SD7 A;  1FBS A;  4EJT A;  1R22 A;  2ETH A;  4YII A;  2ZCW A;  2F5D A;  5FD5 A;  5FO5 A;  2ZNY A;  1FLI A;  2G9W A;  2AXL A;  3QPH A;  1XGN A;  1ZYR F;  4ESJ A;  1B9M A;  2Q2E A;  4OMY A;  3GXO A;  2P5L C;  2VT2 A;  2MLK A;  3KEO A;  1R23 A;  2BBY A;  5K5Q A;  1JE8 A;  3T0Y A;  2M87 A;  2A3S A;  3Q9S A;  2YU3 A;  4RGR A;  4ESB A;  5D6F A;  1L3L A;  5DD4 A;  1X3U A;  3BRO A;  3ISP A;  4GCV A;  4ENM A;  4HAM A;  4R8H A;  4B09 A;  1TBX A;  5E8I A;  1P4W A;  3QOP A;  3P9C A;  4U7D A;  2KIF A;  4M72 A;  4EQQ A;  4HF0 A;  3MFK A;  1W5T A;  5IT3 A;  3IHU A;  1XGS A;  1ZG5 A;  2HEO A;  3WTU C;  2P4W A;  1EH6 A;  3H3Z A;  5K5R A;  3CUQ A;  3QRF F;  5HS9 A;  5CJ9 A;  2CWE A;  3GW2 A;  3MCZ A;  1WI9 A;  1IRF A;  3HRS A;  4AD9 A;  3FXU A;  3ECH A;  3J81 K;  1JGS A;  2TDX A;  1XDU A;  1BI0 A;  4WXD A;  2K7L A;  3E6D A;  4HV5 A;  3I59 B;  3M7G A;  3V7C A;  3DP7 A;  5A2Q K;  2VOD A;  3GFI A;  1MJA A;  1K78 A;  2DW4 A;  3FXR A;  1NHA A;  3C1D A;  4RGU A;  3WTS C;  3F6O A;  2EA2 A;  5CVJ A;  4OMZ A;  4YFK F;  1R1T A;  3DPL C;  3JAM Z;  1YLF A;  1YIO A;  1G3Y A;  3LA2 A;  4M9S A;  2QQ9 A;  3P7N A;  4UV8 A;  2JSC A;  2O6G E;  1XDS A;  2LF8 A;  2OAZ A;  3VOD A;  3NRV A;  3M8E A;  3VB2 A;  5AIP A;  4AIK A;  4G9Y A;  4MNU A;  2CYY A;  2QLZ A;  5CVR A;  3OV8 A;  2BE5 F;  4AVP A;  2PQ8 A;  5FGM A;  1P92 A;  1L0O C;  1LVA A;  1W7P B;  1S7A A;  2MA3 A;  3R6S A;  2XVC A;  2EFW A;  4YFX F;  2BEO A;  2PJP A;  2CW0 F;  1O3R A;  3VEP A;  2QZ8 A;  4B8X A;  1W7P D;  4LLL A;  5LEK A;  1R5H A;  4UVC A;  4KN7 X;  3G3Z A;  4ETS A;  2P8T A;  4RAZ A;  4AWX B;  2XAQ A;  3DV8 A;  4I7H A;  1U8R A;  2ESH A;  5HDN A;  4LK1 F;  2CG4 A;  1J75 A;  4OIP F;  1FYL A;  2P7V B;  1QZY A;  4Z2Y A;  1XGO A;  5KK1 A;  4NB5 A;  5ICE A;  4P9F A;  2GA2 A;  4IHS A;  3DEU A;  3R60 A;  3LQR A;  1J59 A;  5DDG A;  2V79 A;  4MQV A;  1B4A A;  1FP1 D;  2QUF A;  5HVQ C;  2VOP A;  3FZV A;  2KKO A;  3ABT A;  2UXN A;  3I64 A;  4H0E A;  1BJA A;  3GFL A;  4KUM A;  3W6J B;  2JZY A;  4R1H A;  3LST A;  2XAG A;  3L7W A;  3GVA A;  3RIR A;  2W24 A;  5DYM A;  1ZH5 A;  3VOE A;  3WTT C;  2CO5 A;  2O03 A;  5LGT A;  2OD5 A;  4HQM A;  4G6D A;  5K1Y A;  3SQN A;  4KMU X;  1Z1D A;  3R0J A;  1FBU A;  1ONV A;  1TNT A;  4ENN A;  4HDU A;  2VT3 A;  5D5U B;  1LDD A;  4A0Y A;  3I0T A;  2D1H A;  1J5Y A;  2MH9 A;  5H20 A;  3JW4 A;  4YIF A;  4LJZ F;  1KU2 A;  2STW A;  4CO8 A;  2WWY A;  2KRF A;  1BI3 A;  2ZKZ A;  3C3W A;  3PFI A;  4IXA A;  4EVI A;  5D4S A;  3KZZ A;  2HKX A;  4HF1 A;  5JR3 A;  1V4R A;  1W7P A;  3ROU A;  4G7H F;  4MTD A;  4ENJ A;  3WTX C;  3IRR A;  3HHH A;  1J9I A;  2IA2 A;  2CFX A;  3PQK A;  2A69 F;  1DUX C;  3RKW A;  3TO9 A;  2EA4 A;  1WWX A;  4HA8 A;  1TNS A;  4BHP A;  2XRN A;  1V3F A;  3I54 A;  3WE2 A;  3LAJ A;  1RUO A;  1O7L A;  3WOD F;  3CDH A;  2NRA C;  2CQK A;  4OIN F;  4LB5 A;  1I27 A;  5ICC A;  1IZ1 A;  3F72 A;  2M8E A;  2M5W A;  1Q1H A;  1LJ9 A;  2R7D A;  1FYK A;  4M74 A;  2DFI A;  5JI6 A;  2GIV A;  3KET A;  2OU2 A;  1FNN A;  1IN8 A;  3M8F A;  4I2O A;  5F6F A;  1CF7 B;  5LGN A;  1FSE A;  1ULY A;  3SFZ A;  4A0Z A;  4BHC A;  2FEZ A;  3V4G A;  2XAJ A;  4LLN A;  3IKT A;  2HS5 A;  3HOS A;  3AAF A;  3RYR A;  3EYI A;  2NNN A;  4WF2 A;  4O6J A;  4OIR F;  5J8F A;  3CO7 C;  4U88 A;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...