1YO5C

Analysis of the 2.0a crystal structure of the protein-dna complex of human pdef ets domain bound to the prostate specific antigen regulatory site
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
QPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enhancer site of Prostate Specific Antigen Promoter Region
publication title Analysis of the 2.0 A Crystal Structure of the Protein-DNA Complex of the Human PDEF Ets Domain Bound to the Prostate Specific Antigen Regulatory Site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yo5C00
2DK5A 1FYKA 2QLZA 3GO5A 3KZZA 2Q2EA 3GXOA 3ZMZA 5AIQA 2HGCA 3BOQA 2C6YA 2KIUA 3WTXC 1YS7A 4KN7X 1O3SA 3MZHA 3HRUA 3K0LA 4QLCU 1TW2A 5FFZA 2EA4A 3WTTC 4A0XA 1GXPA 3IHUA 4KIGA 5K5OA 5ICCA 2EFPA 5L3CA 3W6JB 4M9SA 4XLNF 1WRJA 1GVJA 1FBUA 4UV9A 4YG2F 2OAZA 3H3ZA 1YQAA 5F64A 3FWEA 4UVCA 1YYVA 1ULYA 1O7LA 2CSOA 1MD0A 3J80K 4OINF 2LSOA 1IRFA 2V9VA 3MFKA 2FA5A 4EGYA 4P5OA 4PZJA 4UV8A 2Q8KA 2GAUA 1IF1A 1YLFA 3F8CA 2L4MA 2UXXA 3F8FA 1BC7C 3ZMUA 1PUEE 5HDKA 4A5NA 4M6XA 1AOYA 3CUQC 3ZMSA 1P6RA 3QPTA 4I02A 3TDUC 3V8LA 4MQ9F 1XCVA 2B0LA 4LB6B 4ZH4F 1BN5A 2CYYA 1MJAA 3HTUA 1FZPB 3RJPA 3FMSA 2P4WA 1ZYRF 5H6QA 2A6HF 1B9NA 4XLPF 2DO7A 2DQRA 4RGXA 1T98A 1R5GA 2R7FA 4MTDA 3GUDA 3RPUA 1FY7A 2FNPA 4JQFA 2P6SA 3RPQA 5DDGA 2HKOA 4MEXF 3DF8A 2FOKA 4OIOF 1T6SA 1WSUA 4UXNA 5HDNA 1XN7A 1IN4A 1RNLA 2JZYA 2QYOA 1IXSB 4P9UA 2EFOA 2XGXA 3KZYA 1HKSA 3K1MA 2OQRA 1R36A 3J81K 1C0WA 1Z6TA 3V7SA 2XVCA 3HOSA 4HDUA 3KP2A 3EQLF 1SD6A 2KJCA 2HTJA 2JT1A 3K1NA 2UZKA 2MD5A 3T1BA 1O7FA 4IXAA 1JE8A 3CTAA 4UVBA 5A2QZ 4HBLA 3HOTA 1K6OA 1P4WA 3KEOA 4G7OF 2BE5F 1HW5A 1XGNA 2OBPA 3H92A 3WGIA 4AIJA 2G9WA 4Y15A 1XDSA 2MA3A 2WV0A 1GXQA 3VOEA 5J6XA 2Q0OA 4ZYHA 1J75A 3I4PA 4YFXF 1LEBA 1NHAA 2LKPA 4A0YA 2O0YA 1BM9A 5H20A 3TKYA 1J5YA 1W5SA 1XDUA 2A69F 1SFEA 4CYDA 3I64A 2STTA 2P6TA 5DEQA 1R1TA 4QWQA 4HX8A 3R61A 1JHFA 1LB2A 3BWGA 1YFHA 1R23A 2RKHA 1D8JA 2RVCA 2K02A 1ZAOA 5L3EA 4KT5C 5KVRA 2MBFA 5HDGA 3GZ5A 2VBWA 1T2KA 3J81Z 4KDPA 2JPBA 5HS9A 4PDKA 4Y13A 1T38A 3LA7A 4RAYA 2EA2A 3EYIA 5FB2A 3FXUA 1KU2A 2M45A 2YSRA 5BPDA 2QUFA 1W7PD 2VE8A 1HQCA 4ENJA 4ASNA 1RUOA 4M73A 5E20A 2Z33A 4U7DA 2K4BA 1Z7UA 4HA8A 4G6QA 3N4MA 3GW2A 3FF5A 3KP6A 1S6LA 4GGGA 1S29A 1H0MA 2F5DA 3BJAA 3U9GA 1X3UA 3DEUA 1IN8A 1FPQA 3JTHA 3LA3A 4I7HA 2RDPA 3BZ6A 1SD5A 3GFLA 2L02A 4HOBA 3IC7A 2Y0MA 2PG4A 2E7XA 4DNCA 1YS6A 1L0OC 1KQ0A 1I6XA 1U8RA 3DPLC 5D8KB 1F1ZA 4P55A 2IJLA 1FC3A 4O6JA 2D1VA 1FWZA 2QVOA 5L3FA 3LAJA 2CFXA 2LF7A 1XD7A 4XSZF 2QBYA 4B09A 1FYLA 1G3SA 3F3XA 2FMLA 1V4RA 2R3SA 4L9TA 4ESBA 1S8NA 4Z2YA 4R1HA 4UHTA 2ACJA 2DTRA 1UHWA 1L3LA 4HDVA 3E6MA 2KKOA 4KUMA 3I71A 2EV6A 3IKVA 1HKTA 1R00A 1H9TA 2FRHA 5TRDA 4L9VA 1LNWA 3O2PE 4I0AA 3KLNA 4JBAA 2QBYB 1EH6A 3F8MA 2PQ8A 3LQRA 5L3BA 4Y17A 3QU3A 3SZPA 2UWMA 1XSDA 2P7VB 3DQVC 2IRFG 3T8RA 2YU3A 2CWEA 3QU6A 3C18A 2VOOA 3VFZA 4LGWA 3IKTA 1MZBA 1IAWA 2VE9A 3I58A 3IL2A 4CHUA 1I5ZA 1TLHB 3GF2A 4ESJA 5CVRA 3HRSA 3I0TA 3ZN0A 3ML6A 3SZTA 3C7JA 2O61A 2CGPA 5IT9K 2FBIA 5EEGA 3F8BA 2ESNA 1DPRA 2DPDA 1Y0UA 3U2RA 3WU0A 3JTGA 2F5EA 4RB0A 1XMKA 1ZN2A 4KIFA 3L00A 3FXRA 3I54A 2MLGA 3K1PA 2M8EA 5J8FA 1HSTA 1J59A 3LQQA 3N97A 1ZG1A 4OOIA 2EWNA 3CJNA 1KQ8A 1BBYA 3V7RA 4YIFA 1PP7U 1YIOA 4N9HA 5K5QA 2GA1A 1QNTA 4R8HA 5BS6A 2GWRA 2V1DA 2ZXJA 3GEZA 2P5LC 2DBBA 3SHFA 5CVUA 4LLGF 1UFMA 5LGTA 1G3WA 3ECOA 3IWFA 5J8CA 1RIOH 1IUYA 5HOOA 1SFXA 2QQBA 4A2UA 3P9KA 4L5IA 1CF7A 1OR7A 2HZTA 2Z5UA 3HSRA 2AXLA 4IHSA 1G3YA 2M30A 2KJBA 2A5YB 1IW7F 1TNSA 2M5WA 5IT9Z 2PFBA 1FT9A 1ZARA 1OYIA 2L54A 3GVAA 5F1RA 3HHHA 1SMTA 2ELHA 2FE3A 5FGMA 3BDDA 1CF7B 3ZMTA 2E7WA 1U3EM 3M9AA 3GFIA 3ABTA 1CGPA 1U2WA 4Q47A 3TQNA 1DUXC 2W57A 4IHTA 4ESFA 5LHGA 2ZJ2A 3ZMDA 2KRFA 2HTSA 3BJOA 4EGZA 2A68F 3TO7A 5JR3A 4MNUA 1BOAA 3IRRA 2DW4A 5A2QK 5K5RA 2ADUA 1Z9CA 1BI1A 3KETA 2W85A 1YW8A 3R6SA 3E6DA 3ZPLA 1KA8A 4I01A 5BOXA 3E3VA 3EYYA 1LDKB 4OMYA 2HQNA 3R4KA 2OA4A 2WTEA 5D4SA 5ICGA 3RTRA 4IRIA 2QQ9A 1RUNA 5FO5A 4G7HF 1B6AA 4KMUX 2XUBA 2JPCA 1ZRDA 2HEOA 4L9JA 1KGSA 2E1CA 2PEXA 4A6DA 1BI2A 1HW2A 3FXQA 3KP5A 2K4JA 2VBXA 1HXDA 1RZ4A 2WC2A 4L5JA 5DV5A 3T5XA 1VTNC 4EVIA 5E18F 3WGGA 2A61A 1R1VA 1BI0A 2VOPA 5E1XA 1XGSA 3G73A 5CLSA 2P7CB 1TNTA 5ED4A 4NB5A 3V8KA 1U5TA 3FM5A 3BP8A 5E8IA 3DPTA 2QM3A 1LEAA 3HHGA 1OYYA 4MGRA 4BHPA 2YR2A 5HS7A 2AS5F 4BYYA 4ZYGA 2NNNA 4OIQF 5AIPA 2HS5A 4HV6A 4L18B 1P92A 3KP3A 5LHIA 1P2FA 4MTEA 3ECHA 2IA1A 3GFMA 1WI9A 4ZZLA 4FX4A 1LDDA 2HR3A 4M71A 5HLGA 2XAGA 2XHKA 1U5TB 1FLIA 1HKQA 1JHHA 3WTWC 2UXNA 2VXZA 3E5UA 1TQPA 2ISZA 2P8TA 1ON1A 1W4MA 1Z1DA 2J5OA 2PBIA 4BNCA 2VN2A 3PQJA 4BH9A 2P5KA 5H6RA 1ZH5A 3IWZA 5F6FA 1FP2A 3QP5A 3KP7A 2F5CA 3MQ0A 4ZYDA 3PQKA 4AD9A 3F8NA 5DUIA 1UHMA 4M72A 4M6YA 1FP1D 3PFIA 2COMA 4NHJA 4YIIA 3BY6A 4LK0F 1MGTA 1XSXA 3COAC 2GQQA 1FX7A 4BQAA 1R1UA 3MWMA 4LLNA 1EH7A 2V6CA 3KEQA 3TOAA 1FNNA 3HUGA 1E17A 2ISYA 4FT8A 3E97A 4A5MA 2H6CA 2HQRA 4KNYA 5E1ZB 1Q1HA 3M8FA 3T8TA 1SD4A 3FHZA 2IP2A 1SMYF 3WTSC 2F5FA 3V7CA 1DDNA 2ESHA 1SFUA 2V79A 2XROA 1FBSA 3HYIA 3RIRA 3R60A 1IN7A 3RYPA 4CXFA 2FBKA 2RC4A 1LDJA 3FX3A 1TTYA 3H3UA 2HWVA 4RAZA 3E5QA 4AWXB 3C3WA 4XSXF 4MQVA 2CO5A 2KIMA 2W84A 4P9FA 2IA2A 2STWA 3MZYA 1W7PA 5LRRA 2PJPA 3Q9VA 4IF4A 4EJWA 1B59A 2EFWA 2O6GE 1USTA 3CO7C 4WWCA 2PMUA 4CO8A 2IVMA 4HF0A 1I27A 4U0YA 4G6DA 5K1YA 3D0SA 2DK8A 1Z05A 2D45A 1PP8F 4S05A 3WODF 4O3MA 4U0WA 4M9ZA 4D0PA 2BBYA 3L9FA 5LGUA 4JK1X 2EK5A 4EM0B 2PN6A 3EDPA 4HF2A 5CJ9A 3P9IA 4OIPF 5LGNA 4HYEA 1U6GA 3DV8A 2MH2A 2H27A 4HX4A 1W7PB 3WTUC 2BYVE 1ON2A 3KP4A 4H0EA 4CICA 4WCGA 1QZZA 3R0JA 4M9XA 3KE2A 4HV5A 1G6NA 1KQ9A 1U5TC 3F6VA 1JXSA 3QRFF 1T0FA 5DD8A 5LLQA 3FZVA 1H9GA 2X0LA 1KYWA 3BJ6A 3E5XA 4HQMA 1IRGA 3SQNA 5AONA 2A07F 2HDCA 2DFIA 2M1BA 2RGVA 4HW0A 3EETA 5D4RA 4ENMA 2RQPA 1P4XA 3IRQA 4ZZDA 4GYGA 1J9IA 5BPIA 5LEKA 1DPUA 1R7JA 3F23A 4Q48A 4U88A 2VODA 4UVAA 1O3QA 4CZZA 2VBYA 1I1GA 2VONA 2VT2A 2MLKA 3GLXA 2XKPA 4HLYA 1KU3A 3R0AA 2A3SA 2NS0A 4RS8A 4BHBA 2JRTA 1TQIA 4XBFA 4IRGA 3HIFA 1IN6A 1K7AA 2D1HA 2J5PA 3I59A 2TDXA 1UCRA 2H6BA 2XAHA 3REOA 1EH8A 2YPRA 3KCCA 5ILSA 1F4KA 1UB9A 3ELKA 4RB3C 3MCZA 2EFNA 1JGSA 1IXCA 4RGUA 1LQ1A 1QGPA 3I5UA 2LDUA 1B4AA 4HAMA 3NRVA 2O3FA 1XGMA 5DD4A 2Z3YA 3MEXA 4IRHA 1MDMA 3CDHA 1ONVA 1AWCA 3I59B 4HZFA 1KU9A 1ZGJA 4WXCA 1PDNC 4OIRF 4LG0A 2D2WA 2ZO4A 5FLXZ 1E2XA 4R79A 2O8XA 2GIVA 1BIBA 3V4GA 4PCQA 2IA0A 2R7DA 3WTZA 3VEPA 1HBXG 4Q5SF 4ENKA 2OD5A 2XV4S 3ZMVA 2KIFA 4KICA 1TBXA 1P4AA 2OU2A 4OMZA 3CUOA 1ZHFA 2GZWA 5CVJA 4BAYA 4WK8F 1MDMB 5D5VB 3Q9SA 5D6EA 5JI6A 4EJOA 4GYIA 2E1NA 1FSEA 4CDGA 4LG0B 1FBQA 1K78A 4PGGA 3M1EA 4IVNA 3BROA 4ETSA 3WU1B 2DU9A 1YTYA 2DT5A 4KFCA 1STZA 2CW0F 4FX0A 4K2EA 1YO5C 1IN5A 3TOBA 3TO6A 4GCVA 1U78A 2BV6A 4I2OA 2Y48A 4OU0A 4AIKA 2QQAA 2HOEA 1QPMA 4PGHA 5DCMA 1W5TA 4GXOA 5L3GA 1DP7P 2P5VA 5HLHA 3BPVA 2VBZA 1XGOA 2DLLA 4IJAA 1MKMA 1K78B 3LSTA 4L0YB 2ZNYA 1ZRCA 2FEZA 4FHTA 1S7OA 2XIGA 2FXAA 4ENNA 4EJTA 4B8XA 4O5VA 3D5LA 2LNBA 4NQWA 5DCMB 2XKOA 1HSJA 3EUHA 3M8EA 3HTSB 2ZBKA 3O6BB 3F21A 1ODDA 4EM1A 4Q4ZF 5EEHA 2FF4A 2DAOA 4CGZA 1D8KA 1ZLKA 5D5XB 3F72A 2BGCA 2GXGA 1WQ2A 4U7BA 1J2XA 2Y75A 3C1DA 3O3KA 4G7ZF 2HKXA 2WWYA 3BPXA 3JW4A 1S3JA 3K69A 1OKRA 3ABUA 4EM2A 2XRNA 1ZREA 2QZ8A 1I1SA 1OMIA 1OPCA 4LJZF 3WE2A 5DYMA 2FQ3A 2VC0A 3ERED 4E70A 5IT3A 2NRAC 3G3ZA 2EB7A 5HVQC 3FMRA 3E6BA 1R58A 5ILVA 1YW7A 2GA2A 2K7LA 5HLIA 3U1DA 3QAHA 4ON0A 3OOPA 3RYRA 2MH9A 2IPQX 1WKMA 3JAMK 3DFGA 3J80Z 1V3FA 3RKYA 4A6EA 1LJ9A 2OZUA 3K2ZA 3MAJA 3KLOA 2ZKZA 4I98B 2ETHA 5ICEA 1KYZA 3WTYC 5JVTA 3CLOA 5L3DA 3ZQ7A 2FU4A 2LF8A 5KK1A 3NEUA 5DCFA 2FSWA 4GO1A 1GHCA 3QOPA 5ICFA 5BQTA 2EV0A 2Z9OA 3P9CA 4YFNF 1OYWA 3QP6A 1ZGAA 3DXJF 5ERIA 2EFQA 2IW5A 2RNJA 2QENA 2XAQA 4G8XA 5D8LB 1XB4A 2YX7A 2ZCWA 4KN4X 2NAZA 2L4AA 3SXYA 5E8GA 3VODA 3ISPA 1HW1A 2CG4A 1G4DA 3ZN1A 2K86A 4XRFA 4MEYF 4WX9A 2FNAA 3DKWA 4F7ZA 2DI3A 4A12A 2M87A 5D6FA 3FMQA 2G7HA 2V1XA 5TJJA 4TV7A 3L2CA 3L09A 3GX4X 1XSVA 1FSHA 3GFJA 4LFUA 4N9IA 3RKWA 3AAFA 3HSEA 2G7UA 3HRMA 3TO9A 3JAMZ 1Z91A 2L3DA 5JFRA 3RDIA 3FM3A 3M7GA 2H09A 2PMHA 1BIAA 4MHGA 3WTVC 5D5UB 3ZP5A 4BXUA 3JSPA 5DUKA 4KA4A 3E6CC 3HSFA 2Z99A 2VT3A 5CYVA 2K27A 1KU7A 4S04A 1D3YA 2HYFA 4AIHA 1IZ1A 5HS8A 5CVIA 2OQGA 2ZNZA 4LD5A 6PAXA 5JHUA 4BHCA 1TW3A 5D5WB 4WXHA 3OV8A 1QZYA 4HF1A 4IPAA 4HX7A 4AVPA 1IXRC 2FBHA 3B73A 2IT0A 1A04A 4KYWA 4EJUA 5FD6A 1MJ9A 3Q5FA 1F9NA 2ZFWA 1TQMA 3TGNA 1SD7A 4RGRA 4EJVA 1SAXA 5CVVA 4G94A 1J0RA 2BEOA 4YFKF 1BJAA 3LAPA 2XASA 3RI4A 5LHHA 1REPC 2RV8A 3ROUA 4RB1A 3P7NA 1RI7A 4KIBA 4WXDA 4EV0A 2L01A 3L7WA 2ZMEA 4WF2A 4L0ZB 1O57A 1XCBA 2W25A 1BC8C 5E1WA 2PI0A 1YG2A 3GZ6A 1R22A 1S7AA 4RGSA 3TDZC 3I53A 3F22A 2MC3A 1QQIA 4LMYA 4I0BA 3QPHA 2JTVA 2O03A 3ULQB 3B02A 4M74A 4DQ2A 2RN7A 2ZMEB 2FMYA 3CUQA 1EV7A 1BI3A 5LEJA 2GXBA 5LBQA 2DPUA 3S2WA 4LB5A 5FLXK 4ZYEA 2PLYA 1B1BA 5LRSA 3SFZA 1MJBA 2EJRA 2VC1A 3DP7A 1Z6RA 2V1UA 4KMFA 5FD5A 3LA2A 3WGHA 2HYGD 1QBJA 5E17F 1ZLJA 4LK1F 3GYHX 5FFXA 5ILUA 5BMZA 1T39A 3CUQB 2H94A 1QO0D 1LVAA 1O3RA 3K9TA 1F5TA 1YW9A 4I09A 3F6OA 4G9YA 4HQEA 2JSCA 3JSOA 2HFHA 4P96A 1G3TA 1XMAA 3J7AO 3WG9A 2QWWA 1WWXA 2F2EA 2YX4A 3VB2A 2NYXA 3W6KB 1FOKA 2XAFA 3HRTA 3LWFA 1R5HA 2EV5A 2XAJA 3T0YA 2A6EF 4HLXA 3WE3A 2W24A 1ZG5A 3V8JA 1B9MA 4A0ZA 1D5VA 4LLLA 4EMSA 1O3TA 2OZ6A 4U0VA 1ZRFA 3CO6C 4UUVA 4N0BA 2X4HA 1J7KA 3KFWX 1ZG3A 4UNOA 2CQKA 1FYMA 3NQOA 4L9NA 2DQLA 4EQQA 3LFKA 1K79A 3GWZA 4RB2C 1USSA 2NNYA 3RKXA
chains in the Genus database with same CATH superfamily
3I4NJ 1JUPA 2DK5A 3ZQFA 2HVSA 1UMQA 1FYKA 4J19A 4GFBA 1P7IA 2NOJB 2QLZA 4BJ6C 3GO5A 3QYEA 3KZZA 4E7LA 2I5UA 2Q2EA 3GXOA 3ZQLA 3ZMZA 1Z0XA 3PNYA 1JKPC 4J01A 2NXNB 2KDZA 5AIQA 2HGCA 2X51A 3BG3A 3BOQA 2C6YA 2KIUA 4ABZA 2R7VA 3MN2A 3WTXC 1R71A 1YS7A 4KN7X 1O3SA 3MZHA 1Y8QB 2M9HA 3IV5A 3HRUA 3K0LA 4QLCU 2EZIA 2CQXA 1TW2A 3HPGA 1OCZH 5FFZA 2EA4A 1Y8RB 3WTTC 4A3FJ 4A0XA 1GDTA 1GXPA 2R93J 3IHUA 3QODA 4KIGA 5K5OA 1Y6IA 5ICCA 2YU9J 4E7ZA 3FHNA 1VZ0A 3E7LA 5F27A 3CF5F 2EFPA 2E34A 5L3CA 2X6OA 5J4VA 3W6JB 3SJMA 1Y1VJ 4M9SA 4XLNF 1WRJA 5EG0B 1GVJA 2K9MA 1FBUA 4UV9A 4YG2F 2OAZA 4M3BA 3H3ZA 1YQAA 2ZMEC 2E2JJ 5F64A 3GMEA 4XQFA 2L9VA 3GTQJ 2Q2EB 3FWEA 1YYVA 1ULYA 3LL7A 4UVCA 1G59A 3S1MJ 1O7LA 4DBQA 2CSOA 4GRIA 5GP9A 1XTAA 4JX4A 4CCMA 1MD0A 3OYHA 3J80K 4OINF 1JGGA 2LSOA 3KYCB 3LNQA 3LSGA 1IRFA 2V9VA 3A01A 2M34A 3MFKA 2FA5A 2K3FA 4EGYA 4Y52J 4P5OA 1MW7A 1PUFA 4PZJA 2CU7A 2E60A 1F36A 4UV8A 4M3FA 5TGTA 3BCAA 1N75A 2Q8KA 2GAUA 1IF1A 1YLFA 1TWFJ 3F8CA 2DMTA 5FRMA 3OYKA 2L4MA 2UXXA 3F8FA 4B47A 3A02A 3ZMUA 1BC7C 1PUEE 5HDKA 4A5NA 2Y30A 4M6XA 3H3VK 1SAUA 1AOYA 3CUQC 3ZMSA 3S3OA 1P6RA 3QPTA 4PK4A 3HB9A 4I02A 3TDUC 3V8LA 3FK6A 3RPUD 4EATA 4F93B 1H8AC 1U9NA 2HOAA 2H8RA 3H35A 4MQ9F 2R7QA 1XCVA 2B0LA 4LB6B 4ZH4F 5CPRB 1BN5A 2CYYA 3CF2A 4Y4RA 1MJAA 3HTUA 1FZPB 2IS1A 3DLAA 1GV2A 3RJPA 3FMSA 1BR4A 2KIQA 2P4WA 3CMEI 1ZYRF 2DMPA 5H6QA 4HNTA 3A01B 1X2MA 2BVMA 5JVGF 3SFIA 4V2GA 2A6HF 4BE0A 1LE8A 1PUFB 4QTRA 1IV8A 2O5RA 4X1EA 1B9NA 4XLPF 2DO7A 1APLC 5IP7J 2DQRA 4RGXA 2W82A 1T98A 1OCPA 4CH7A 1YE9A 1R5GA 1X1BA 2R7FA 4MTDA 2PMZA 2L9RA 2Y31A 3GUDA 2EIKH 1MH3A 3PSIA 1RESA 2K40A 3RPUA 1FY7A 2FNPA 3GLLA 3OR1C 3QPLA 4JQFA 4W97A 3UR3C 2P6SA 5EZHA 2F4IA 3RPQA 3DU6A 5DDGA 3J7AY 2HKOA 4MEXF 3DF8A 3PUFA 2FOKA 1K4TA 4OIOF 1T6SA 5J40A 3D1NI 1WSUA 3FDYA 1JTYA 3K4JA 4UXNA 4J00A 1IUFA 5HDNA 2HZDA 2YS9A 2ZJRF 1IV6A 1XN7A 1SVMA 1IN4A 3SDBA 3GTJJ 1VQ8I 3KYLA 1RNLA 4IOAF 2FD5A 1ZR4A 1LE8B 5E3OA 2EIJH 2JZYA 2H1LA 2QYOA 1IXSB 2JUGA 4P9UA 2R7SA 1WJCA 2EFOA 4AUXA 2XGXA 3KZYA 1HKSA 3K1MA 2OQRA 1R36A 2R7TA 3J81K 1C0WA 1Z6TA 2XF5A 1BW5A 3V7SA 4E7IA 2XVCA 3K4BA 3L2WA 3HOSA 5EJCA 4HDUA 3OYNA 2ECCA 4A3GJ 3RZOJ 3KP2A 3EQLF 3JRAA 2W48A 1SD6A 2KJCA 2HTJA 2JT1A 3K1NA 2JUCA 2UZKA 2MD5A 3HGYA 3T1BA 1IDZA 1O7FA 4IXAA 1JE8A 3TBIA 2X6WA 3CTAA 4UVBA 5A2QZ 9ANTA 4HBLA 3HOTA 1K6OA 1P4WA 5EEAA 2KMUA 3KEOA 4G7OF 2BE5F 1HW5A 3W2VA 5GTHC 2LOOA 1XGNA 2BY0A 2OBPA 3H92A 5J3LA 3WGIA 4AIJA 1WJ5A 2NOGA 2G9WA 4Y15A 1IRZA 2CJJA 1XDSA 1JKOC 2MA3A 4XOTA 2W00A 3OSFA 2WV0A 1DGWY 1GXQA 1WCMJ 1MBHA 2OUMA 3VOEA 1SEUA 2P0WA 1I3QJ 4F92B 2IGOA 1IO2A 5J6XA 2ECBA 2Q0OA 4CCJA 4ZYHA 1J75A 3I4PA 3LMMA 1W5CC 4F55A 4YFXF 4A3KJ 1LEBA 1NHAA 2LKPA 4A0YA 2O0YA 1BW6A 3VYUB 1BM9A 3G71I 5H20A 4A3IJ 3HOYJ 1WFXA 3BCBA 2QKMB 3TKYA 1VNDA 4LITA 1J5YA 1W5SA 1XDUA 5C4XJ 4AM3A 1IDYA 1SFEA 2A69F 2MW8A 2JVHA 3CCSI 4ZJZA 4CYDA 2L9SA 3I64A 2IGKA 2CW7A 1RKTA 2STTA 2P6TA 3I9V2 5DEQA 1R1TA 4QWQA 4AIDA 4HX8A 4CCOA 3R61A 3TEDA 1FOYA 3OS2A 2WAQN 4CYCB 1EF4A 1ETQA 3VDXA 1JHFA 1LB2A 3BWGA 3RQIA 2G0EA 1YFHA 4UY8I 5HODA 1R23A 4IHXA 2RKHA 1D8JA 5IYDJ 2ZXHA 1X1PA 3BQZA 3VYRB 2RVCA 4C2UA 2R7XA 2K02A 1ZAOA 5L3EA 2Z2SB 2CUFA 2JQ7A 2JJ7A 3AKZA 4HSTA 2Z16A 4KT5C 4UB6C 4XIDA 5KVRA 1A6IA 1N25A 1PJRA 1WGXA 2MBFA 3JRFA 1A5JA 3K4NA 1SFKA 5HDGA 1GT0C 3HOUJ 3H5NA 3GZ5A 2VBWA 3DKYA 1T2KA 3J81Z 4KDPA 1WHUA 2JPBA 1YJWI 5HS9A 4XN0A 5E3LA 4PDKA 4Y13A 3JREA 1B8IA 3S17J 1T38A 3D5RC 1FIAA 2MGQA 4XKCA 3LA7A 4PJLA 4RAYA 2EA2A 3EYIA 5FB2A 3FXUA 1KU2A 1LFPA 1W36C 2M45A 2YSRA 1ZK8A 3HEFA 5FROA 5BPDA 2QUFA 3QOEA 3PNVA 1W7PD 2VE8A 2DJNA 3BC8A 4NUBA 1HQCA 4ENJA 4ASNA 1RUOA 4M73A 5E20A 2Z33A 4U7DA 2IS2A 5GTIC 2K4BA 3GZNB 3W6VA 3K4MA 4HNUA 1Z7UA 3N05A 4HA8A 2CMPA 4G6QA 3MKZA 3N4MA 2RNGA 3LSKA 3ZCOA 2VJ5A 3GW2A 3LSPA 2Y2ZA 3FF5A 2DYRH 3KP6A 1S6LA 3BTJA 4GGGA 1VQ9I 1TP4A 2HXOA 2WV1A 3A1YA 3PM1A 3M07A 4A3CJ 1XMXA 1S29A 1H0MA 2F5DA 3BJAA 3U9GA 1X3UA 1B8IB 3DEUA 1IN8A 1D5YA 1U0JA 1FPQA 1NK2P 3JTHA 3LA3A 2GLOA 1OJLA 4I7HA 2CQNA 1OLTA 2RDPA 3BZ6A 2ZSHB 5FKOA 3FXMA 1JTXA 1SD5A 3GFLA 2L02A 1GLNA 4HOBA 3AG4H 3IC7A 2E2HJ 3BTCA 1JUSA 5BNGA 2Y0MA 1ETKA 2VQLA 3K4CA 2LKXA 3CC7I 4RMNA 2PG4A 2XRLA 4ZTJA 2E7XA 4DNCA 1YS6A 1I39A 1P7JA 1L0OC 3IH3A 4UB8C 4MFDA 4PFOA 2OF7A 1KQ0A 1A6QA 1I6XA 3DPLC 5D8KB 2K5CA 1U8RA 4A3BJ 1F1ZA 4P55A 1VQKI 3F0CA 2IJLA 1FC3A 4O6JA 2D1VA 1FWZA 2QVOA 5L3FA 3LAJA 2L2OA 3OOUA 3C2BA 3LSIA 2CFXA 4F52A 2LF7A 4AYBA 1VQ6I 1BOBA 1XD7A 2HNHA 2IXSA 3QYFA 1HCRA 4YELA 2H1KA 1D1CA 4XSZF 2QBYA 1YI2I 2W1OA 4B09A 1FYLA 1G3SA 3C2GA 2AO9A 5HNHA 4IL6C 5FKNA 4CSWA 3F3XA 2FMLA 4FE7A 1V4RA 2R3SA 4A69C 4L9TA 2ME0A 2LP0A 4UUTA 2WY8Q 4ESBA 1S8NA 4Z2YA 4R1HA 5IOZA 1FMVA 3SEZA 4UHTA 2ACJA 1HDPA 2DTRA 1UHWA 4B4CA 1L3LA 4HDVA 3E6MA 2KKOA 2WBMA 4KUMA 3I71A 5B1AH 2HOTA 2EV6A 3IKVA 3VWBA 1TT0A 3BR6A 2X6YA 3PIOF 1HKTA 1R00A 1MSFC 3OYIA 4XKBA 1H9TA 1E3OC 2FRHA 5TRDA 4L9VA 2DFHA 1LNWA 2Y0SA 4C3IJ 3ZRGA 3O2PE 4I0AA 3KLNA 4JBAA 2QBYB 1EH6A 2E1MC 3RZDJ 3F8MA 2PQ8A 3LQRA 1FTTA 1MBKA 4BBRJ 5L3BA 4Y17A 1Y56A 4A3LJ 4KISA 3QU3A 3SZPA 2UWMA 4JX6A 2A6TA 4BS9A 2KDOA 1IG7A 1XSDA 2P7VB 3DQVC 2IRFG 3T8RA 3CDIA 2YU3A 5EYRA 2KL4A 3P5JA 2CWEA 1SVLA 3QU6A 1YRNA 1BR1A 3C18A 3HZJA 4NNJA 2HQAA 3VFZA 2VOOA 3GTMJ 4LGWA 3IKTA 5JLWA 4RDUA 3PNTA 1MZBA 4HG2A 1MH4A 3IUOA 1IAWA 2VE9A 5B66C 3I58A 3IL2A 4CHUA 3OL3A 1I5ZA 3BTLA 1TLHB 3GF2A 2Y9YA 2HPMA 4ESJA 5CVRA 3H9JA 2KT0A 3Q0UA 3HRSA 3I0TA 1T8IA 5H2FC 2W7NA 2LYCA 4Y3OA 3ZN0A 3CMYA 3ML6A 3SZTA 3VSKA 2XB0X 3C7JA 1S7EA 2WAEA 2O61A 5EDNA 2CGPA 4B3XA 1NG7A 1J09A 5IT9K 2FBIA 4PSXA 5EEGA 3FXKA 3K10A 3F8BA 2LY9A 1TWGJ 3H36A 1DQUA 2ESNA 1DPRA 5IPAA 2DPDA 1Y0UA 5M3FJ 3U2RA 2WB1N 4XLHA 3WU0A 3JTGA 3G1OA 2LC2A 2F5EA 4RB0A 3OYDA 1YRNB 4JYKA 1XMKA 1WH7A 1ZN2A 4II3A 4KIFA 2X1EA 5HNFA 3L00A 3OSGA 2VQHA 3FXRA 3I54A 3LSHA 1ETVA 5FLVA 2MLGA 2OC6A 3K1PA 1ETOA 5IY5H 2M8EA 3FBIB 2JA8J 5J8FA 3ONQA 5HLTA 1HSTA 4IHVA 1J59A 3CD6I 3LQQA 3WHBA 3N97A 1ZG1A 4OOIA 3NWTA 2EWNA 3ZQCA 3CJNA 3A0HC 2UV1A 1RR7A 4QIWN 1KQ8A 1BBYA 2XPWA 3V7RA 4YIFA 1PP7U 1YIOA 2M7BA 5M5YJ 2DA2A 4IX7A 4N9HA 2ELJA 5K5QA 2B7EA 2GA1A 4XNFA 1QNTA 4R8HA 5BS6A 2GWRA 2HI3A 1MBEA 1LUJB 2V1DA 2DA4A 3CESA 2ZXJA 3GEZA 2P5LC 4BBSJ 4LIUA 1M1EB 5KNLA 2DBBA 3SHFA 5CVUA 4LLGF 1UFMA 4E6KG 5LGTA 3CCYA 1G3WA 3ECOA 3IWFA 3X2QH 4A93J 4XORA 5J8CA 1RIOH 1IUYA 5HOOA 1SFXA 2QQBA 4A2UA 3P9KA 4L5IA 1CF7A 1OR7A 3Q3SA 2VIXA 3A4CA 2HZTA 3AFHA 2QSHX 1X3ZB 2Z5UA 3HSRA 2AXLA 3JRIA 4IHSA 2KZGA 1G3YA 2M30A 3B6AA 5J4YA 3MKYB 5FLMJ 1MBFA 2KJBA 2A5YB 4BY1J 2OTLI 1IW7F 2R7UA 1TNSA 2M5WA 5IT9Z 2PFBA 1ZTRA 1FT9A 1X19A 2R92J 2PX9A 1ZARA 1JT6A 1OYIA 2CRGA 1TL8A 1G2HA 2L54A 3GVAA 5F1RA 4QPOA 3L2UA 3HHHA 2QSGX 4NBQA 2V9PA 1SMTA 1XPXA 2ELHA 2FE3A 5FGMA 3BDDA 5F0FA 1CF7B 3ZMTA 2E7WA 2VQGA 1U3EM 3M9AA 3PO2J 3CP2A 1VI0A 4XLAA 3GFIA 3ABTA 2MG4A 1CGPA 1NTCA 1QHGA 1U2WA 4Q47A 3DTEA 3TQNA 1I3AA 3DTIA 1MNDA 2IBDA 1DUXC 2VPLA 2FJ1A 4DZJA 2W57A 2XGCA 4IHTA 4ESFA 2V6EA 3PIPF 2LD5A 2ID6A 5LHGA 2ZJ2A 2KRHA 3ZMDA 2KRFA 2HTSA 3BJOA 4EGZA 1UELB 1BL0A 2A68F 1Z21A 2E19A 3TO7A 5DTDA 5JR3A 3L2QA 4MNUA 1BOAA 3IRRA 4XM3A 1ETWA 2DW4A 5A2QK 5K5RA 2ADUA 1Z9CA 2XAUA 1BI1A 2QGUA 3MKWB 2LBFA 4XICA 3KETA 2W85A 1JI8A 3G4SI 2XPVA 1R6RA 1YW8A 2BY2A 3R6SA 3E6DA 1TZLA 3ZPLA 1VQ4I 2ZXIA 1KA8A 4I01A 5BOXA 3E3VA 3W2AA 1Z3XA 1LDKB 3EYYA 2HQNA 4KT6A 2DDAA 4OMYA 3S1QJ 3R4KA 4XKVA 4ZYAA 1YX3A 2OJED 4YEJA 2OA4A 2WTEA 1QA6A 3GTLJ 2QCOA 2M0MA 2QF7A 1GV5A 4II2A 5D4SA 2DA7A 5ICGA 3RTRA 2LY1A 3FKIJ 2BY1A 2DMNA 4IRIA 2QQ9A 1RUNA 5FO5A 4G7HF 5M5XJ 1B6AA 2FUG2 4KMUX 3UNGC 2XUBA 2JPCA 1ZRDA 2HEOA 4L9JA 3HOWJ 1KGSA 1X1CA 2E1CA 4ZDLA 2PEXA 4A6DA 1BI2A 1HW2A 3FXQA 4CA0A 3KP5A 4I99C 2K4JA 2CH0A 3B6CA 3TL4X 2VBXA 5J1YA 2LBFB 3GTPJ 1HXDA 1RZ4A 2WC2A 4L5JA 5DV5A 3T5XA 1VTNC 4EVIA 1WZ2A 5E18F 3WGGA 2DOEA 2A61A 1R1VA 2CW8A 1BI0A 1ZGWA 1AA7A 5E1XA 3HDDA 5J1RA 2VOPA 1XGSA 2PMZN 3G73A 5CLSA 2P7CB 2CV2A 4XN3A 1TNTA 3OS1A 4ZDOA 5ED4A 3HKZA 4IQ4A 2QSFX 4NB5A 3V8KA 1LPQA 1U5TA 2HU9A 3CMAI 2M7AA 4DW6A 3FM5A 3BP8A 5E8IA 1D0XA 3DPTA 2QM3A 5LD2C 1LEAA 4S0HB 1MNEA 2JN6A 3HHGA 3JRCA 1OYYA 5B5EC 4MGRA 4BHPA 2YR2A 5HS7A 2AS5F 4BYYA 4ZYGA 2DYSH 2WADA 2NNNA 4OIQF 3S14J 2R4GA 5AIPA 2HS5A 2XSDC 4BEHA 4HV6A 4L18B 4C2TA 1P92A 2F5VA 3H9GA 1WJAA 3KP3A 5LHIA 1R49A 1P2FA 4MTEA 1BR2A 3H0GJ 3ECHA 2E35A 2IA1A 3G1LA 3GFMA 4PJ0C 5KAIC 4AVZA 1T33A 1WI9A 5F04A 1GVDA 4ZZLA 1LDDA 4FX4A 1E0EA 3KZIC 3CC2I 2HR3A 2BXZA 4M71A 5HLGA 2XAGA 5TISC 3CP8A 4PJJA 2XF7A 1YX5A 2XHKA 3SZGA 4V2FA 2DA5A 2EZKA 5IYBJ 1U5TB 2ZXWH 1FLIA 4XONA 1HKQA 1DGRM 1JHHA 3AL0B 3WTWC 2UXNA 2VXZA 3E5UA 1TQPA 2CFOA 2E36A 2ISZA 1IC8A 2P8TA 3ZQQA 1X4PA 1ON1A 3CC4I 1W4MA 1Z1DA 2J5OA 2VB6A 3HOVJ 2PBIA 2FX0A 3OYGA 4BNCA 2VN2A 3PQJA 2P5KA 5H6RA 4BH9A 1YIJI 3S15J 1ZH5A 5C44J 3IWZA 1X2NA 4BEHB 5F6FA 4XRSG 1S72I 2OCEA 2PJRA 2LLKA 1MSEC 2E1MB 1UG2A 3ASOH 1D1BA 1VQMI 1FP2A 3QP5A 4DYRA 3KP7A 2F5CA 3CDLA 1XG1A 3MQ0A 4ZYDA 2GXAA 2R7WA 3PQKA 2EH3A 4BU2A 4AD9A 3F8NA 3MVPA 4Y33A 4EEFG 4BL0B 5DUIA 4RBOA 1UHMA 2AQEA 4M72A 4QPQA 2VKHA 1MBJA 4M6YA 2B9SA 5F1JA 1FP1D 3PFIA 2COMA 2VJ4A 3OIOA 4NHJA 2HDDA 1OR7C 4YIIA 3BY6A 4LK0F 1MGTA 1XSXA 3COAC 2KP6A 2GQQA 1FX7A 2MSYA 1FTZA 3S3NA 3K7AJ 2K9NA 4BQAA 1R1UA 3WU2C 3MWMA 3O8GA 1Z3YA 5EF6A 4LLNA 1EH7A 1TWHJ 2V6CA 3FXLA 2MABA 3HL2A 5IYCJ 3K70D 1X58A 3AG1H 3KEQA 3TOAA 1FNNA 5GPCA 4E4HA 2PJRB 3JRDA 1A36A 3HUGA 1E17A 2ISYA 4X0GA 4FT8A 3E97A 2K9SA 4A5MA 2H6CA 2HQRA 4KNYA 4XR6A 5E1ZB 1V5EA 1Q1HA 2WY7Q 3M8FA 3DPUA 3LSMA 2JRMA 1OCTC 3T8TA 2DFFA 1SD4A 3FHZA 2EPFA 2XB5A 2BXYA 3BG5A 2B63J 3PUBA 2ZFUA 2IP2A 4CCNA 1SMYF 3OYLA 3WHCA 3WTSC 2F5FA 2JA2A 3V7CA 1DU6A 1DDNA 2ESHA 3M3YJ 1SFUA 5DM7F 2HVRA 2EQRA 2V79A 2XROA 3A0BC 1FBSA 3HYIA 3RIRA 2K3PA 3NAUA 2M2EA 3R60A 2FOWA 1IN7A 2JA5J 3RYPA 4CXFA 2FBKA 3HUGB 2RC4A 3ZXSA 1AHDP 1LDJA 3HJEA 3FX3A 1TTYA 3H3UA 2HWVA 1XS9A 4RAZA 2JA7J 3E5QA 3G2BA 4AWXB 1UZCA 3C3WA 4XSXF 3DBHB 4MQVA 1QPIA 1HC8A 3PL8A 4PJNA 1YHQI 2CO5A 2KIMA 2BVLA 2DOAA 3MMYB 2W84A 4P9FA 2L7FP 2IA2A 2STWA 3MZYA 1MNMC 2V7FA 1W7PA 5LRRA 4RM3A 4M3DA 4ANJA 2PJPA 3Q9VA 4B43A 4IF4A 2HYJA 1X3WB 1WI3A 1B59A 4EJWA 2E2IJ 2EFWA 2X48A 2O6GE 1USTA 3OIPA 2NVUB 3CO7C 4WWCA 1YOVB 2IGNA 2PMUA 4CO8A 2IVMA 4HF0A 3CCQI 1I27A 2XSJC 4U0YA 1YJNI 4G6DA 5K1YA 3D0SA 2DK8A 3VPRA 3HG9A 3EPZA 1Z05A 2D45A 1PP8F 3RCOA 4S05A 2EZLA 5FKMA 3WODF 4O3MA 4U0WA 2M4KA 1R5ID 4M9ZA 4D0PA 1VQPI 1RC9A 2BBYA 2KZVA 3L9FA 3V42A 4JK1X 2EK5A 5LGUA 4HEA2 4BDZA 4EM0B 2PN6A 1N78A 3EDPA 4HF2A 5CJ9A 5E3NA 5E3MA 3KX2A 1H89C 3VSLA 3P9IA 4OIPF 1NG6A 5LGNA 4IHYA 4HYEA 1U6GA 2WAFA 4OAYA 3GBGA 3DV8A 2MH2A 1IGNA 2H27A 4HX4A 2ZSIB 3J7YJ 1W7PB 3WTUC 4BGDA 4AC0A 2BYVE 1ON2A 3KP4A 4H0EA 1JJ6C 3SDGA 4CICA 3GTGJ 2BHZA 4WCGA 4Y7NJ 1QZZA 3D5SC 2HXIA 3ZQHA 4C3HJ 3R0JA 4HSRA 2DTZA 4M9XA 3OYEA 3KE2A 4HV5A 3S93A 1G6NA 2AQFA 1KQ9A 2WA0A 1U5TC 4XLEA 3F6VA 3BR2A 1JXSA 2DOFA 4BACA 1SC7A 1ZELA 3QRFF 3IH4A 3OL4A 3AL0C 1T0FA 5DD8A 5LLQA 1LFUP 3FZVA 1H9GA 3DTKA 4XL9A 1RPWA 2X0LA 1P9QC 1KYWA 2VKEA 3BJ6A 4CCLA 3E5XA 4HQMA 1IRGA 3SQNA 1I50J 5AONA 3FXOA 2A07F 2RREA 2HDCA 2DFIA 2M1BA 4DJAA 2RGVA 4HW0A 1HDDC 5FJ8J 2NS8A 1VQLI 3EETA 5D4RA 4ENMA 2RQPA 1P4XA 3IRQA 3HM5A 5JHFA 1DU0A 4ZZDA 3KPHA 2M3AA 4GYGA 1J9IA 5BPIA 1TWAJ 1LFBA 5LEKA 1DPUA 1R7JA 3E1SA 3F23A 2Y0SN 4Q48A 4U88A 2VODA 2MC4A 4UVAA 5GAHJ 1O3QA 1V5FA 4CZZA 2BZTA 2VBYA 2HDWA 1I1GA 2VONA 2KLOA 3OYMA 1YJ9I 1VQ5I 3ABKH 2VT2A 2MLKA 4A3MJ 3GLXA 1D1AA 3M1CA 2DDBA 2XKPA 4HLYA 4E7JA 2LKSA 4HNVA 3ZGKA 1OCOH 3CCJI 1KU3A 3A2KA 3R0AA 2A3SA 2NS0A 4E7SA 4RS8A 4BHBA 2JRTA 5KCMA 1TQIA 3S1NJ 4XBFA 4IRGA 3HIFA 3OYJA 1IN6A 3W3CA 1Y1WJ 1K7AA 2D1HA 1HF0A 3FK7A 1FIPA 1W0TA 2J5PA 3M8JA 3G6EI 3I59A 2TDXA 1QVTA 1UCRA 2LMDA 2H6BA 2XAHA 3REOA 1R4NB 1EH8A 2YPRA 3KCCA 5ILSA 4PUSA 5E79C 1F4KA 2CUZA 1UB9A 2IEKA 1D0ZA 1GUUA 2JK3A 2RAEA 4OAZA 3K2AA 2V26A 2M4GA 5F0CA 2Z1DA 3U21A 3ELKA 4RB3C 1QZEA 2M0CA 4Z6YA 3MCZA 2N8GA 4MFEA 2EFNA 2ZJQF 1JGSA 1IXCA 4RGUA 1LQ1A 1QGPA 4LIVA 3I5UA 2LDUA 4MLOA 1B4AA 4HAMA 3HBLA 3NRVA 2O3FA 3PJRA 4UUSA 3KIOA 2DMQA 2OCCH 4DBRA 5GAGJ 1XGMA 2VL8A 5DD4A 2Z3YA 5M5WJ 5F08A 2DFEA 3MEXA 1VQNI 1HA8A 4IRHA 3JRGA 3CDHA 1ONVA 1X1DA 1MDMA 1AWCA 4BXFA 1K4SA 1BA5A 3I59B 1LVKA 4B3AA 3VYTB 4HZFA 3ZOBA 3BG6A 1KU9A 1ZGJA 4WXCA 4GDFA 1PDNC 4OIRF 3ASNH 1EA3A 4D5FA 1YITI 2LG4A 4H4KC 1W1WE 4LG0A 3L1PA 1TC3C 2NVTJ 2D2WA 5CQEA 2X1DA 2ZO4A 4DIQA 1E2XA 5FLXZ 4A3EJ 4R79A 2DT7B 1VQOI 4IZZA 3CZ6A 2O8XA 2GIVA 1RETA 4B44A 2O8KA 1BIBA 2LR8A 4BY7J 2OTJI 4XK4A 1MMSA 4XKWA 4BQQA 3V4GA 4PCQA 3BTIA 2IA0A 2R7DA 3WTZA 4N4NB 3I55I 4M3GA 3VEPA 1HBXG 4C9YA 2H8WA 2ME6A 4ENKA 3ZQIA 2OD5A 2XV4S 3ZMVA 4FCYA 4Q5SF 2KIFA 2VJJA 2W4SA 4KICA 4NC7A 5K7ZA 4UUSB 1A35A 3W2WA 1TBXA 1P4AA 2OU2A 4OMZA 2VLAA 3CUOA 1ZHFA 2GZWA 5CVJA 4BAYA 1N77A 4WK8F 1MDMB 3OR2C 3OY9A 2DJIA 5D5VB 3Q9SA 1ETXA 2BHYA 4NC6A 5D6EA 5JI6A 4EJOA 4CZCA 5EG0A 1WVRA 4XLFA 2EIMH 3F9KA 3QYBA 4GYIA 3TP0A 2O9LA 2E1NA 1FSEA 1PYVA 3LFUA 2TCTA 1Q1VA 4CDGA 4LG0B 1FBQA 2LTPA 1K78A 4PGGA 1W36D 3KYDB 3M1EA 4DGWB 4IVNA 2KQRA 3BROA 4ETSA 2KRCA 2V9KA 1OCRH 3HC7A 3WU1B 4BJ5C 2DU9A 1YTYA 2DT5A 5F0HA 4KFCA 1STZA 2CW0F 4FX0A 4K2EA 1ZR2A 2X85A 4LG3A 1YO5C 2L5QA 3H5RA 1IN5A 3TW7A 3TOBA 3TO6A 4GCVA 2K9QA 1U78A 2BV6A 4I2OA 2Y48A 4OU0A 4AIKA 4BXXJ 3JR9A 2QQAA 2HOEA 1QPMA 2EILH 3I3LA 4PGHA 5DCMA 1W5TA 4FISA 5M3MJ 1ZQ3P 4GXOA 5L3GA 3JRBA 1NH3A 3S2HJ 1VF9A 1JJ8C 2ZC2A 1DP7P 2XF6A 4XRMA 2P5VA 5HLHA 4JOMA 4AU7A 3BPVA 2XGDA 2VBZA 1XGOA 1T95A 1R4MB 2VJIA 1R9TJ 2YUSA 3J7ZI 3UKGA 2GOXB 2DLLA 4IJAA 4DYCA 3HOZJ 3H5AA 1MKMA 3CCEI 1K78B 3LSTA 1UG0A 4D9JA 2XDVA 1ERDA 4L0YB 2ZNYA 3EUKL 4NC8A 1UHSA 1ZRCA 2FEZA 1FMWA 4FHTA 1S7OA 3RSNA 2XIGA 5LFAA 2FXAA 4CUGA 4ENNA 2CS3A 4EJTA 5FKLA 4B8XA 4O5VA 3D5LA 2LNBA 4CCKA 3OYBA 2D5VA 4NQWA 5DCMB 1LKXA 5KHDA 1T0FC 4P1WA 4FTHA 2XKOA 1HSJA 3EUHA 3M8EA 3HTSB 2ZBKA 2ID3A 3O6BB 1ODDA 4EM1A 4Q4ZF 3F21A 5EEHA 2FF4A 4BQOA 2DAOA 3BT9A 1D8KA 1ZLKA 4CGZA 5D5XB 2JA6J 4IEJA 2VUMJ 3S32A 2L0KA 3F72A 3CQZJ 2BGCA 3IH2A 3JCUC 3CMMA 2GXGA 2LREA 1WQ2A 4U7BA 1MMAA 3SYTA 1J2XA 2DT6A 1ETYA 3BZCA 2Y75A 2VASA 3C1DA 2QEXI 4LOCA 3DEEA 3O3KA 2LRDA 3IAS2 2VXDA 2ZB9A 4G7ZF 1V54H 2HKXA 4DZPA 4G6TB 2WWYA 3PFYA 3Q0WA 3BPXA 3OIQA 3JW4A 1S3JA 3ABLH 3K69A 1OKRA 3RQ4A 3ABUA 1QHHD 4EM2A 4NQWB 1POGA 2XRNA 1ZREA 3AG2H 2QZ8A 1I1SA 1OMIA 1OPCA 3EUAA 4LJZF 3WE2A 5DYMA 4BDYA 2FQ3A 2VC0A 3DBRB 3ERED 4E70A 3I4MJ 5IT3A 2NRAC 4PSWA 3U1KA 3G3ZA 2EB7A 5HVQC 3FMRA 2NS7A 3E6BA 1R58A 4C3JJ 3HKZN 5ILVA 1YW7A 5IP6A 3MD2A 4E7HA 2GA2A 2K7LA 2GIZA 5HLIA 3QAHA 3U1DA 2AXTC 3GTKJ 4ON0A 1UAAA 4G12A 4RLFA 2EINH 3OOPA 3OMYA 1O4XA 3RYRA 2OPTA 2KPMA 4F91B 3CCUI 3RKQA 4MO7A 1ITYA 2MH9A 2IPQX 1F43A 1WKMA 5FKKA 3JAMK 3DFGA 3J80Z 1RRJA 4D1QA 4QSHA 1V3FA 2LY2A 3FISA 3RKYA 3HOXJ 1AKHA 3S8PA 4A6EA 1QU3A 2R0QC 1LJ9A 4IQJA 2OZUA 2IS4A 3K2ZA 3ESWB 3MAJA 1K83J 4IO9F 4BQNA 2AHQA 3ABMH 3KLOA 2ZKZA 4I98B 1JT0A 2ETHA 5ICEA 1Y39A 1KYZA 4BKXA 2A5WA 3WTYC 5J47A 3H9QA 1FOWA 1W0UA 3DU5A 2R7RA 1MMNA 5JVTA 3DKXA 2NVYJ 3CLOA 2V1NA 5L3DA 1ZKGA 3ZQ7A 2FU4A 4BUPA 2LF8A 5KK1A 1V5GA 3NEUA 2E71A 2V4JC 3OYCA 5DCFA 2FSWA 4GO1A 1GHCA 4A3DJ 3QOPA 2A05A 5ICFA 1G8XA 5BQTA 2IGMA 2CV0A 1ENHA 5JLXA 2EV0A 2Z9OA 4CYCA 4I76A 3P9CA 4B48A 4YFNF 1V55H 2CQQA 2NVQJ 3DBLB 2EBIA 1OYWA 1OQYA 4XRSA 3QP6A 4RAFA 3NWSA 1ZGAA 4X6AJ 2JVGA 4DYQA 1UJ8A 3DXJF 1AKHB 1QRYA 5ERIA 5KAFC 2EFQA 1ORKA 2KISA 2JMWA 2XC7A 2IW5A 1SANA 3S1RJ 2RNJA 2QENA 2XAQA 4G8XA 1XB4A 5D8LB 3FIWA 1HOMA 2YX7A 2ZCWA 4KN4X 2NAZA 3O8HA 4B1RA 4U87A 2L4AA 3CJQB 3MZ8A 2KFDA 3SXYA 2RQQA 5E8GA 2CV1A 3VODA 3GTOJ 3ISPA 1HW1A 1PVEA 3K6GA 3JRHA 1SVOA 2MFZA 2WAQA 5GAEJ 2CG4A 1G4DA 1FOXA 4RM2A 3ZN1A 2K86A 3BLYA 3K4KA 2JSPA 4XRFA 4MEYF 4WX9A 2FNAA 4RLQA 5IOYA 3DKWA 4PJMA 4F3QA 5J1UA 4F7ZA 2DI3A 4A12A 2QA4I 4PFPA 4ZDPA 2E5ZA 2M87A 1WH5A 5D6FA 3FMQA 2G7HA 2V1XA 1XX5A 2TRTA 2ELKA 4C2MJ 5TJJA 1K6YA 4TV7A 2DA1A 1KZHA 3L2CA 2HOSA 3L09A 2XGEA 3GX4X 4FASD 2DXIA 1A31A 1XSVA 1WJFA 2HQ5A 3GFJA 1FSHA 4LFUA 2X1CA 4N9IA 3RKWA 3AAFA 4FETA 3HSEA 3CCRI 2NVXJ 3K4LA 2G7UA 3HRMA 3TO9A 4NDLA 1Z91A 3JAMZ 2R7ZJ 2L3DA 2VKDA 5JFRA 3RDIA 3FM3A 3M7GA 2H09A 2PMHA 5FRNA 5DS9A 1BIAA 4XOPA 3TMOA 4MHGA 2R7OA 3WTVC 4DOZA 5D5UB 3DLLF 3FKJA 3ZP5A 4BXUA 3JSPA 4BJTA 5DUKA 3BG9A 2IAIA 4KA4A 1MMGA 3E6CC 3HSFA 2Z99A 3NARA 4KJZA 2VT3A 5DM6F 3AG3H 3VYSB 5CYVA 2K27A 4BE1A 1KU7A 4S04A 5C4JJ 1D3YA 4I6ZA 1WJBA 2P81A 2HYFA 4AIHA 1IJWC 1IZ1A 5HS8A 5CVIA 1E3PA 2OQGA 2ZNZA 4LD5A 3CJTB 5JHUA 4BHCA 1TW3A 5D5WB 4WXHA 1OISA 6PAXA 4D7NA 3OV8A 1JUMA 4V19K 1QZYA 2DA6A 4HF1A 4IPAA 3DEWA 4HX7A 3HGGA 4AVPA 3CCMI 1IXRC 2FBHA 3B73A 2IT0A 4A3JJ 2VI6A 1A04A 2CUEA 4EJUA 4KYWA 1BJZA 5FD6A 2BW3A 2ICWG 2LK2A 1MJ9A 3GCMA 3Q5FA 3QQAA 1F9NA 2ZFWA 1TQMA 3TGNA 4YIRX 2GOMA 1SD7A 4YRVA 3EUHC 1ACIA 4RGRA 4EJVA 1SAXA 2F6CA 2L9NA 5CVVA 4G94A 1J0RA 2BEOA 3LSJA 4YFKF 1X1AA 4ZC3A 1B72A 1BJAA 3CLQA 3LAPA 2XASA 3RI4A 5LHHA 1REPC 2RV8A 3ROUA 4HPQA 3P7NA 4RB1A 1WJEA 1RI7A 2L7KA 1NK3P 1XC5A 3IP4B 4KIBA 2HVQA 4WXDA 4EV0A 2L01A 3L7WA 5GPAA 4IHWA 2IS6A 3DWLE 4D7MA 1X4OA 2ZMEA 3H0DA 3BR3A 3Q0VA 4WF2A 1O57A 4L0ZB 1XCBA 3L2RA 2W25A 2BW3B 3FXJA 1QVUA 1BC8C 5E1WA 4L5EA 2PI0A 1YG2A 1D0YA 2O7OA 1TWCJ 4ZTFA 4AYBN 3GZ6A 1R22A 5EGOA 1S7AA 4RGSA 3TDZC 2L7ZA 3I53A 2GBYA 3F22A 1B72B 2MC3A 2X6XA 1OFCX 1QQIA 3CCVI 3S2DJ 4LMYA 2Y9ZA 2VPRA 2MD0A 1U8BA 2CUJA 4I0BA 2ZJPF 3C2HA 3QPHA 2JTVA 2XPUA 3BG7A 1U9OA 2O03A 2OV7A 2DODA 2UUZA 3A03A 3ULQB 3B02A 4M74A 2K85A 4DQ2A 4BE2A 2JWTA 2DN0A 4OWRB 2RN7A 2ZMEB 3CUQA 2FMYA 1EV7A 1BI3A 3OWTA 4XLCA 2K9LA 5LEJA 1RR8C 2GXBA 2F4OB 1OCCH 5IP9J 5LBQA 2QQ8A 2I8DA 2DPUA 1T56A 3MKLA 3S2WA 3S3MA 3OYAA 4LB5A 5FLXK 4ZYEA 4M6VA 3I56I 1EJ9A 4MIMA 3BR0A 2KHMA 4JX5A 2PLYA 1B1BA 3M4OJ 5LRSA 3PSFA 2DMUA 2E1OA 5EGOB 1EKEA 3SFZA 2R5YA 1FEXA 1MJBA 1WPKA 2EJRA 2VC1A 3DP7A 4N4OB 5C3EJ 1Y0NA 1Z6RA 2V1UA 3CCLI 3BR5A 2MYSA 5FD5A 3OS0A 4KMFA 1Z7LA 2Y69H 3LA2A 1H88C 3LSRA 3WGHA 5B3SH 2GM4A 2HYGD 1QBJA 5E17F 4KITB 1ZLJA 1WJDA 2E5NA 1Z67A 3CJRB 3PO3J 4LK1F 3ERMA 2QKLB 1HLVA 3GYHX 5FFXA 2DCEA 2I10A 3ZQGA 5ILUA 3H1CA 5BMZA 1T39A 3CUQB 2R5ZA 1E3HA 2H94A 3LOCA 1RKWA 4IOCF 3E0JB 1QO0D 1LVAA 2M8GX 1O3RA 3HPHA 3IAM2 4RAGA 1JKRC 3K9TA 1S9HA 5K7FA 2DA3A 1F5TA 1YW9A 4I09A 3F6OA 4G9YA 4HQEA 3BQYA 2JSCA 5CQGA 4XMYA 2R5YB 2F48A 4FQGA 3JSOA 2HFHA 2FQ4A 3ZR8X 3OYFA 4P96A 5K7HA 1G3TA 1XMAA 3KEYA 1MMDA 3J7AO 4D5CA 4JP0A 3WG9A 3TP3A 2QWWA 2WB1A 4HRIA 3QWLA 2F4MB 1WWXA 2F2EA 1FJLA 2YX4A 3VB2A 3DCFA 2NYXA 1IRXA 1I6HJ 3W6KB 1FOKA 1DP3A 2LVSA 2XAFA 3L2VA 2X9DA 3HRTA 1R5HA 3LWFA 2EV5A 2XAJA 3T0YA 2A6EF 4HLXA 2R5ZB 3HXLA 3WE3A 4IKFA 1MBGA 2HPIA 2W24A 5CKTA 1ZG5A 3V8JA 1CQTA 1B9MA 2VQCA 4A0ZA 1D5VA 3BR1A 4LLLA 2COBA 1JKQC 4EMSA 4M3EA 3QPSA 1TT5B 1O3TA 1VQ7I 2BOLA 2OZ6A 1AU7A 4U0VA 1ZRFA 4ITVA 3CO6C 4UUVA 2LFBA 4N0BA 2X4HA 2LH9A 1MIJA 1J7KA 2BY3A 3KFWX 5EZGA 1ZG3A 4UNOA 2CQKA 5GADJ 3WG7H 1FYMA 2VKVA 3NQOA 1SFOJ 1T08B 2Q1ZB 4RA2A 2EZHA 2CQ7A 4L9NA 2DQLA 5B1BH 3G1MA 4EQQA 3LFKA 1K79A 3SEQA 1KONA 1VFCA 3GWZA 4C30A 3K70C 4RB2C 2L7MP 4FE4A 1Z77A 3S16J 3TW6A 1USSA 1S5LC 3BZKA 2NNYA 4E7KA 4W1UA 3RKXA 1K61A 3FBNB
chains in the Genus database with same CATH topology
2DK5A 1FYKA 2QLZA 3GO5A 3KZZA 2Q2EA 3GXOA 3ZMZA 5AIQA 2HGCA 3BOQA 2C6YA 2KIUA 3WTXC 1YS7A 4KN7X 1O3SA 3MZHA 3HRUA 3K0LA 4QLCU 1TW2A 5FFZA 2EA4A 3WTTC 4A0XA 1GXPA 3IHUA 4KIGA 5K5OA 5ICCA 2EFPA 5L3CA 3W6JB 4M9SA 4XLNF 1WRJA 1GVJA 1FBUA 4UV9A 4YG2F 2OAZA 3H3ZA 1YQAA 5F64A 3FWEA 4UVCA 1YYVA 1ULYA 1O7LA 2CSOA 1MD0A 3J80K 4OINF 2LSOA 1IRFA 2V9VA 3MFKA 2FA5A 4EGYA 4P5OA 4PZJA 4UV8A 2Q8KA 2GAUA 1IF1A 1YLFA 3F8CA 2L4MA 2UXXA 3F8FA 1BC7C 3ZMUA 1PUEE 5HDKA 4A5NA 4M6XA 1AOYA 3CUQC 3ZMSA 1P6RA 3QPTA 4I02A 3TDUC 3V8LA 4MQ9F 1XCVA 2B0LA 4LB6B 4ZH4F 1BN5A 2CYYA 1MJAA 3HTUA 1FZPB 3RJPA 3FMSA 2P4WA 1ZYRF 5H6QA 2A6HF 1B9NA 4XLPF 2DO7A 2DQRA 4RGXA 1T98A 1R5GA 2R7FA 4MTDA 3GUDA 3RPUA 1FY7A 2FNPA 4JQFA 2P6SA 3RPQA 5DDGA 2HKOA 4MEXF 3DF8A 2FOKA 4OIOF 1T6SA 1WSUA 4UXNA 5HDNA 1XN7A 1IN4A 1RNLA 2JZYA 2QYOA 1IXSB 4P9UA 2EFOA 2XGXA 3KZYA 1HKSA 3K1MA 2OQRA 1R36A 3J81K 1C0WA 1Z6TA 3V7SA 2XVCA 3HOSA 4HDUA 3KP2A 3EQLF 1SD6A 2KJCA 2HTJA 2JT1A 3K1NA 2UZKA 2MD5A 3T1BA 1O7FA 4IXAA 1JE8A 3CTAA 4UVBA 5A2QZ 4HBLA 3HOTA 1K6OA 1P4WA 3KEOA 4G7OF 2BE5F 1HW5A 1XGNA 2OBPA 3H92A 3WGIA 4AIJA 2G9WA 4Y15A 1XDSA 2MA3A 2WV0A 1GXQA 3VOEA 5J6XA 2Q0OA 4ZYHA 1J75A 3I4PA 4YFXF 1LEBA 1NHAA 2LKPA 4A0YA 2O0YA 1BM9A 5H20A 3TKYA 1J5YA 1W5SA 1XDUA 2A69F 1SFEA 4CYDA 3I64A 2STTA 2P6TA 5DEQA 1R1TA 4QWQA 4HX8A 3R61A 1JHFA 1LB2A 3BWGA 1YFHA 1R23A 2RKHA 1D8JA 2RVCA 2K02A 1ZAOA 5L3EA 4KT5C 5KVRA 2MBFA 5HDGA 3GZ5A 2VBWA 1T2KA 3J81Z 4KDPA 2JPBA 5HS9A 4PDKA 4Y13A 1T38A 3LA7A 4RAYA 2EA2A 3EYIA 5FB2A 3FXUA 1KU2A 2M45A 2YSRA 5BPDA 2QUFA 1W7PD 2VE8A 1HQCA 4ENJA 4ASNA 1RUOA 4M73A 5E20A 2Z33A 4U7DA 2K4BA 1Z7UA 4HA8A 4G6QA 3N4MA 3GW2A 3FF5A 3KP6A 1S6LA 4GGGA 1S29A 1H0MA 2F5DA 3BJAA 3U9GA 1X3UA 3DEUA 1IN8A 1FPQA 3JTHA 3LA3A 4I7HA 2RDPA 3BZ6A 1SD5A 3GFLA 2L02A 4HOBA 3IC7A 2Y0MA 2PG4A 2E7XA 4DNCA 1YS6A 1L0OC 1KQ0A 1I6XA 1U8RA 3DPLC 5D8KB 1F1ZA 4P55A 2IJLA 1FC3A 4O6JA 2D1VA 1FWZA 2QVOA 5L3FA 3LAJA 2CFXA 2LF7A 1XD7A 4XSZF 2QBYA 4B09A 1FYLA 1G3SA 3F3XA 2FMLA 1V4RA 2R3SA 4L9TA 4ESBA 1S8NA 4Z2YA 4R1HA 4UHTA 2ACJA 2DTRA 1UHWA 1L3LA 4HDVA 3E6MA 2KKOA 4KUMA 3I71A 2EV6A 3IKVA 1HKTA 1R00A 1H9TA 2FRHA 5TRDA 4L9VA 1LNWA 3O2PE 4I0AA 3KLNA 4JBAA 2QBYB 1EH6A 3F8MA 2PQ8A 3LQRA 5L3BA 4Y17A 3QU3A 3SZPA 2UWMA 1XSDA 2P7VB 3DQVC 2IRFG 3T8RA 2YU3A 2CWEA 3QU6A 3C18A 2VOOA 3VFZA 4LGWA 3IKTA 1MZBA 1IAWA 2VE9A 3I58A 3IL2A 4CHUA 1I5ZA 1TLHB 3GF2A 4ESJA 5CVRA 3HRSA 3I0TA 3ZN0A 3ML6A 3SZTA 3C7JA 2O61A 2CGPA 5IT9K 2FBIA 5EEGA 3F8BA 2ESNA 1DPRA 2DPDA 1Y0UA 3U2RA 3WU0A 3JTGA 2F5EA 4RB0A 1XMKA 1ZN2A 4KIFA 3L00A 3FXRA 3I54A 2MLGA 3K1PA 2M8EA 5J8FA 1HSTA 1J59A 3LQQA 3N97A 1ZG1A 4OOIA 2EWNA 3CJNA 1KQ8A 1BBYA 3V7RA 4YIFA 1PP7U 1YIOA 4N9HA 5K5QA 2GA1A 1QNTA 4R8HA 5BS6A 2GWRA 2V1DA 2ZXJA 3GEZA 2P5LC 2DBBA 3SHFA 5CVUA 4LLGF 1UFMA 5LGTA 1G3WA 3ECOA 3IWFA 5J8CA 1RIOH 1IUYA 5HOOA 1SFXA 2QQBA 4A2UA 3P9KA 4L5IA 1CF7A 1OR7A 2HZTA 2Z5UA 3HSRA 2AXLA 4IHSA 1G3YA 2M30A 2KJBA 2A5YB 1IW7F 1TNSA 2M5WA 5IT9Z 2PFBA 1FT9A 1ZARA 1OYIA 2L54A 3GVAA 5F1RA 3HHHA 1SMTA 2ELHA 2FE3A 5FGMA 3BDDA 1CF7B 3ZMTA 2E7WA 1U3EM 3M9AA 3GFIA 3ABTA 1CGPA 1U2WA 4Q47A 3TQNA 1DUXC 2W57A 4IHTA 4ESFA 5LHGA 2ZJ2A 3ZMDA 2KRFA 2HTSA 3BJOA 4EGZA 2A68F 3TO7A 5JR3A 4MNUA 1BOAA 3IRRA 2DW4A 5A2QK 5K5RA 2ADUA 1Z9CA 1BI1A 3KETA 2W85A 1YW8A 3R6SA 3E6DA 3ZPLA 1KA8A 4I01A 5BOXA 3E3VA 3EYYA 1LDKB 4OMYA 2HQNA 3R4KA 2OA4A 2WTEA 5D4SA 5ICGA 3RTRA 4IRIA 2QQ9A 1RUNA 5FO5A 4G7HF 1B6AA 4KMUX 2XUBA 2JPCA 1ZRDA 2HEOA 4L9JA 1KGSA 2E1CA 2PEXA 4A6DA 1BI2A 1HW2A 3FXQA 3KP5A 2K4JA 2VBXA 1HXDA 1RZ4A 2WC2A 4L5JA 5DV5A 3T5XA 1VTNC 4EVIA 5E18F 3WGGA 2A61A 1R1VA 1BI0A 2VOPA 5E1XA 1XGSA 3G73A 5CLSA 2P7CB 1TNTA 5ED4A 4NB5A 3V8KA 1U5TA 3FM5A 3BP8A 5E8IA 3DPTA 2QM3A 1LEAA 3HHGA 1OYYA 4MGRA 4BHPA 2YR2A 5HS7A 2AS5F 4BYYA 4ZYGA 2NNNA 4OIQF 5AIPA 2HS5A 4HV6A 4L18B 1P92A 3KP3A 5LHIA 1P2FA 4MTEA 3ECHA 2IA1A 3GFMA 1WI9A 4ZZLA 4FX4A 1LDDA 2HR3A 4M71A 5HLGA 2XAGA 2XHKA 1U5TB 1FLIA 1HKQA 1JHHA 3WTWC 2UXNA 2VXZA 3E5UA 1TQPA 2ISZA 2P8TA 1ON1A 1W4MA 1Z1DA 2J5OA 2PBIA 4BNCA 2VN2A 3PQJA 4BH9A 2P5KA 5H6RA 1ZH5A 3IWZA 5F6FA 1FP2A 3QP5A 3KP7A 2F5CA 3MQ0A 4ZYDA 3PQKA 4AD9A 3F8NA 5DUIA 1UHMA 4M72A 4M6YA 1FP1D 3PFIA 2COMA 4NHJA 4YIIA 3BY6A 4LK0F 1MGTA 1XSXA 3COAC 2GQQA 1FX7A 4BQAA 1R1UA 3MWMA 4LLNA 1EH7A 2V6CA 3KEQA 3TOAA 1FNNA 3HUGA 1E17A 2ISYA 4FT8A 3E97A 4A5MA 2H6CA 2HQRA 4KNYA 5E1ZB 1Q1HA 3M8FA 3T8TA 1SD4A 3FHZA 2IP2A 1SMYF 3WTSC 2F5FA 3V7CA 1DDNA 2ESHA 1SFUA 2V79A 2XROA 1FBSA 3HYIA 3RIRA 3R60A 1IN7A 3RYPA 4CXFA 2FBKA 2RC4A 1LDJA 3FX3A 1TTYA 3H3UA 2HWVA 4RAZA 3E5QA 4AWXB 3C3WA 4XSXF 4MQVA 2CO5A 2KIMA 2W84A 4P9FA 2IA2A 2STWA 3MZYA 1W7PA 5LRRA 2PJPA 3Q9VA 4IF4A 4EJWA 1B59A 2EFWA 2O6GE 1USTA 3CO7C 4WWCA 2PMUA 4CO8A 2IVMA 4HF0A 1I27A 4U0YA 4G6DA 5K1YA 3D0SA 2DK8A 1Z05A 2D45A 1PP8F 4S05A 3WODF 4O3MA 4U0WA 4M9ZA 4D0PA 2BBYA 3L9FA 5LGUA 4JK1X 2EK5A 4EM0B 2PN6A 3EDPA 4HF2A 5CJ9A 3P9IA 4OIPF 5LGNA 4HYEA 1U6GA 3DV8A 2MH2A 2H27A 4HX4A 1W7PB 3WTUC 2BYVE 1ON2A 3KP4A 4H0EA 4CICA 4WCGA 1QZZA 3R0JA 4M9XA 3KE2A 4HV5A 1G6NA 1KQ9A 1U5TC 3F6VA 1JXSA 3QRFF 1T0FA 5DD8A 5LLQA 3FZVA 1H9GA 2X0LA 1KYWA 3BJ6A 3E5XA 4HQMA 1IRGA 3SQNA 5AONA 2A07F 2HDCA 2DFIA 2M1BA 2RGVA 4HW0A 3EETA 5D4RA 4ENMA 2RQPA 1P4XA 3IRQA 4ZZDA 4GYGA 1J9IA 5BPIA 5LEKA 1DPUA 1R7JA 3F23A 4Q48A 4U88A 2VODA 4UVAA 1O3QA 4CZZA 2VBYA 1I1GA 2VONA 2VT2A 2MLKA 3GLXA 2XKPA 4HLYA 1KU3A 3R0AA 2A3SA 2NS0A 4RS8A 4BHBA 2JRTA 1TQIA 4XBFA 4IRGA 3HIFA 1IN6A 1K7AA 2D1HA 2J5PA 3I59A 2TDXA 1UCRA 2H6BA 2XAHA 3REOA 1EH8A 2YPRA 3KCCA 5ILSA 1F4KA 1UB9A 3ELKA 4RB3C 3MCZA 2EFNA 1JGSA 1IXCA 4RGUA 1LQ1A 1QGPA 3I5UA 2LDUA 1B4AA 4HAMA 3NRVA 2O3FA 1XGMA 5DD4A 2Z3YA 3MEXA 4IRHA 1MDMA 3CDHA 1ONVA 1AWCA 3I59B 4HZFA 1KU9A 1ZGJA 4WXCA 1PDNC 4OIRF 4LG0A 2D2WA 2ZO4A 5FLXZ 1E2XA 4R79A 2O8XA 2GIVA 1BIBA 3V4GA 4PCQA 2IA0A 2R7DA 3WTZA 3VEPA 1HBXG 4Q5SF 4ENKA 2OD5A 2XV4S 3ZMVA 2KIFA 4KICA 1TBXA 1P4AA 2OU2A 4OMZA 3CUOA 1ZHFA 2GZWA 5CVJA 4BAYA 4WK8F 1MDMB 5D5VB 3Q9SA 5D6EA 5JI6A 4EJOA 4GYIA 2E1NA 1FSEA 4CDGA 4LG0B 1FBQA 1K78A 4PGGA 3M1EA 4IVNA 3BROA 4ETSA 3WU1B 2DU9A 1YTYA 2DT5A 4KFCA 1STZA 2CW0F 4FX0A 4K2EA 1YO5C 1IN5A 3TOBA 3TO6A 4GCVA 1U78A 2BV6A 4I2OA 2Y48A 4OU0A 4AIKA 2QQAA 2HOEA 1QPMA 4PGHA 5DCMA 1W5TA 4GXOA 5L3GA 1DP7P 2P5VA 5HLHA 3BPVA 2VBZA 1XGOA 2DLLA 4IJAA 1MKMA 1K78B 3LSTA 4L0YB 2ZNYA 1ZRCA 2FEZA 4FHTA 1S7OA 2XIGA 2FXAA 4ENNA 4EJTA 4B8XA 4O5VA 3D5LA 2LNBA 4NQWA 5DCMB 2XKOA 1HSJA 3EUHA 3M8EA 3HTSB 2ZBKA 3O6BB 3F21A 1ODDA 4EM1A 4Q4ZF 5EEHA 2FF4A 2DAOA 4CGZA 1D8KA 1ZLKA 5D5XB 3F72A 2BGCA 2GXGA 1WQ2A 4U7BA 1J2XA 2Y75A 3C1DA 3O3KA 4G7ZF 2HKXA 2WWYA 3BPXA 3JW4A 1S3JA 3K69A 1OKRA 3ABUA 4EM2A 2XRNA 1ZREA 2QZ8A 1I1SA 1OMIA 1OPCA 4LJZF 3WE2A 5DYMA 2FQ3A 2VC0A 3ERED 4E70A 5IT3A 2NRAC 3G3ZA 2EB7A 5HVQC 3FMRA 3E6BA 1R58A 5ILVA 1YW7A 2GA2A 2K7LA 5HLIA 3U1DA 3QAHA 4ON0A 3OOPA 3RYRA 2MH9A 2IPQX 1WKMA 3JAMK 3DFGA 3J80Z 1V3FA 3RKYA 4A6EA 1LJ9A 2OZUA 3K2ZA 3MAJA 3KLOA 2ZKZA 4I98B 2ETHA 5ICEA 1KYZA 3WTYC 5JVTA 3CLOA 5L3DA 3ZQ7A 2FU4A 2LF8A 5KK1A 3NEUA 5DCFA 2FSWA 4GO1A 1GHCA 3QOPA 5ICFA 5BQTA 2EV0A 2Z9OA 3P9CA 4YFNF 1OYWA 3QP6A 1ZGAA 3DXJF 5ERIA 2EFQA 2IW5A 2RNJA 2QENA 2XAQA 4G8XA 5D8LB 1XB4A 2YX7A 2ZCWA 4KN4X 2NAZA 2L4AA 3SXYA 5E8GA 3VODA 3ISPA 1HW1A 2CG4A 1G4DA 3ZN1A 2K86A 4XRFA 4MEYF 4WX9A 2FNAA 3DKWA 4F7ZA 2DI3A 4A12A 2M87A 5D6FA 3FMQA 2G7HA 2V1XA 5TJJA 4TV7A 3L2CA 3L09A 3GX4X 1XSVA 1FSHA 3GFJA 4LFUA 4N9IA 3RKWA 3AAFA 3HSEA 2G7UA 3HRMA 3TO9A 3JAMZ 1Z91A 2L3DA 5JFRA 3RDIA 3FM3A 3M7GA 2H09A 2PMHA 1BIAA 4MHGA 3WTVC 5D5UB 3ZP5A 4BXUA 3JSPA 5DUKA 4KA4A 3E6CC 3HSFA 2Z99A 2VT3A 5CYVA 2K27A 1KU7A 4S04A 1D3YA 2HYFA 4AIHA 1IZ1A 5HS8A 5CVIA 2OQGA 2ZNZA 4LD5A 6PAXA 5JHUA 4BHCA 1TW3A 5D5WB 4WXHA 3OV8A 1QZYA 4HF1A 4IPAA 4HX7A 4AVPA 1IXRC 2FBHA 3B73A 2IT0A 1A04A 4KYWA 4EJUA 5FD6A 1MJ9A 3Q5FA 1F9NA 2ZFWA 1TQMA 3TGNA 1SD7A 4RGRA 4EJVA 1SAXA 5CVVA 4G94A 1J0RA 2BEOA 4YFKF 1BJAA 3LAPA 2XASA 3RI4A 5LHHA 1REPC 2RV8A 3ROUA 4RB1A 3P7NA 1RI7A 4KIBA 4WXDA 4EV0A 2L01A 3L7WA 2ZMEA 4WF2A 4L0ZB 1O57A 1XCBA 2W25A 1BC8C 5E1WA 2PI0A 1YG2A 3GZ6A 1R22A 1S7AA 4RGSA 3TDZC 3I53A 3F22A 2MC3A 1QQIA 4LMYA 4I0BA 3QPHA 2JTVA 2O03A 3ULQB 3B02A 4M74A 4DQ2A 2RN7A 2ZMEB 2FMYA 3CUQA 1EV7A 1BI3A 5LEJA 2GXBA 5LBQA 2DPUA 3S2WA 4LB5A 5FLXK 4ZYEA 2PLYA 1B1BA 5LRSA 3SFZA 1MJBA 2EJRA 2VC1A 3DP7A 1Z6RA 2V1UA 4KMFA 5FD5A 3LA2A 3WGHA 2HYGD 1QBJA 5E17F 1ZLJA 4LK1F 3GYHX 5FFXA 5ILUA 5BMZA 1T39A 3CUQB 2H94A 1QO0D 1LVAA 1O3RA 3K9TA 1F5TA 1YW9A 4I09A 3F6OA 4G9YA 4HQEA 2JSCA 3JSOA 2HFHA 4P96A 1G3TA 1XMAA 3J7AO 3WG9A 2QWWA 1WWXA 2F2EA 2YX4A 3VB2A 2NYXA 3W6KB 1FOKA 2XAFA 3HRTA 3LWFA 1R5HA 2EV5A 2XAJA 3T0YA 2A6EF 4HLXA 3WE3A 2W24A 1ZG5A 3V8JA 1B9MA 4A0ZA 1D5VA 4LLLA 4EMSA 1O3TA 2OZ6A 4U0VA 1ZRFA 3CO6C 4UUVA 4N0BA 2X4HA 1J7KA 3KFWX 1ZG3A 4UNOA 2CQKA 1FYMA 3NQOA 4L9NA 2DQLA 4EQQA 3LFKA 1K79A 3GWZA 4RB2C 1USSA 2NNYA 3RKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK5 A;  1FYK A;  2QLZ A;  3GO5 A;  3KZZ A;  2Q2E A;  3GXO A;  3ZMZ A;  5AIQ A;  2HGC A;  3BOQ A;  2C6Y A;  2KIU A;  3WTX C;  1YS7 A;  4KN7 X;  1O3S A;  3MZH A;  3HRU A;  3K0L A;  4QLC U;  1TW2 A;  5FFZ A;  2EA4 A;  3WTT C;  4A0X A;  1GXP A;  3IHU A;  4KIG A;  5K5O A;  5ICC A;  2EFP A;  5L3C A;  3W6J B;  4M9S A;  4XLN F;  1WRJ A;  1GVJ A;  1FBU A;  4UV9 A;  4YG2 F;  2OAZ A;  3H3Z A;  1YQA A;  5F64 A;  3FWE A;  4UVC A;  1YYV A;  1ULY A;  1O7L A;  2CSO A;  1MD0 A;  3J80 K;  4OIN F;  2LSO A;  1IRF A;  2V9V A;  3MFK A;  2FA5 A;  4EGY A;  4P5O A;  4PZJ A;  4UV8 A;  2Q8K A;  2GAU A;  1IF1 A;  1YLF A;  3F8C A;  2L4M A;  2UXX A;  3F8F A;  1BC7 C;  3ZMU A;  1PUE E;  5HDK A;  4A5N A;  4M6X A;  1AOY A;  3CUQ C;  3ZMS A;  1P6R A;  3QPT A;  4I02 A;  3TDU C;  3V8L A;  4MQ9 F;  1XCV A;  2B0L A;  4LB6 B;  4ZH4 F;  1BN5 A;  2CYY A;  1MJA A;  3HTU A;  1FZP B;  3RJP A;  3FMS A;  2P4W A;  1ZYR F;  5H6Q A;  2A6H F;  1B9N A;  4XLP F;  2DO7 A;  2DQR A;  4RGX A;  1T98 A;  1R5G A;  2R7F A;  4MTD A;  3GUD A;  3RPU A;  1FY7 A;  2FNP A;  4JQF A;  2P6S A;  3RPQ A;  5DDG A;  2HKO A;  4MEX F;  3DF8 A;  2FOK A;  4OIO F;  1T6S A;  1WSU A;  4UXN A;  5HDN A;  1XN7 A;  1IN4 A;  1RNL A;  2JZY A;  2QYO A;  1IXS B;  4P9U A;  2EFO A;  2XGX A;  3KZY A;  1HKS A;  3K1M A;  2OQR A;  1R36 A;  3J81 K;  1C0W A;  1Z6T A;  3V7S A;  2XVC A;  3HOS A;  4HDU A;  3KP2 A;  3EQL F;  1SD6 A;  2KJC A;  2HTJ A;  2JT1 A;  3K1N A;  2UZK A;  2MD5 A;  3T1B A;  1O7F A;  4IXA A;  1JE8 A;  3CTA A;  4UVB A;  5A2Q Z;  4HBL A;  3HOT A;  1K6O A;  1P4W A;  3KEO A;  4G7O F;  2BE5 F;  1HW5 A;  1XGN A;  2OBP A;  3H92 A;  3WGI A;  4AIJ A;  2G9W A;  4Y15 A;  1XDS A;  2MA3 A;  2WV0 A;  1GXQ A;  3VOE A;  5J6X A;  2Q0O A;  4ZYH A;  1J75 A;  3I4P A;  4YFX F;  1LEB A;  1NHA A;  2LKP A;  4A0Y A;  2O0Y A;  1BM9 A;  5H20 A;  3TKY A;  1J5Y A;  1W5S A;  1XDU A;  2A69 F;  1SFE A;  4CYD A;  3I64 A;  2STT A;  2P6T A;  5DEQ A;  1R1T A;  4QWQ A;  4HX8 A;  3R61 A;  1JHF A;  1LB2 A;  3BWG A;  1YFH A;  1R23 A;  2RKH A;  1D8J A;  2RVC A;  2K02 A;  1ZAO A;  5L3E A;  4KT5 C;  5KVR A;  2MBF A;  5HDG A;  3GZ5 A;  2VBW A;  1T2K A;  3J81 Z;  4KDP A;  2JPB A;  5HS9 A;  4PDK A;  4Y13 A;  1T38 A;  3LA7 A;  4RAY A;  2EA2 A;  3EYI A;  5FB2 A;  3FXU A;  1KU2 A;  2M45 A;  2YSR A;  5BPD A;  2QUF A;  1W7P D;  2VE8 A;  1HQC A;  4ENJ A;  4ASN A;  1RUO A;  4M73 A;  5E20 A;  2Z33 A;  4U7D A;  2K4B A;  1Z7U A;  4HA8 A;  4G6Q A;  3N4M A;  3GW2 A;  3FF5 A;  3KP6 A;  1S6L A;  4GGG A;  1S29 A;  1H0M A;  2F5D A;  3BJA A;  3U9G A;  1X3U A;  3DEU A;  1IN8 A;  1FPQ A;  3JTH A;  3LA3 A;  4I7H A;  2RDP A;  3BZ6 A;  1SD5 A;  3GFL A;  2L02 A;  4HOB A;  3IC7 A;  2Y0M A;  2PG4 A;  2E7X A;  4DNC A;  1YS6 A;  1L0O C;  1KQ0 A;  1I6X A;  1U8R A;  3DPL C;  5D8K B;  1F1Z A;  4P55 A;  2IJL A;  1FC3 A;  4O6J A;  2D1V A;  1FWZ A;  2QVO A;  5L3F A;  3LAJ A;  2CFX A;  2LF7 A;  1XD7 A;  4XSZ F;  2QBY A;  4B09 A;  1FYL A;  1G3S A;  3F3X A;  2FML A;  1V4R A;  2R3S A;  4L9T A;  4ESB A;  1S8N A;  4Z2Y A;  4R1H A;  4UHT A;  2ACJ A;  2DTR A;  1UHW A;  1L3L A;  4HDV A;  3E6M A;  2KKO A;  4KUM A;  3I71 A;  2EV6 A;  3IKV A;  1HKT A;  1R00 A;  1H9T A;  2FRH A;  5TRD A;  4L9V A;  1LNW A;  3O2P E;  4I0A A;  3KLN A;  4JBA A;  2QBY B;  1EH6 A;  3F8M A;  2PQ8 A;  3LQR A;  5L3B A;  4Y17 A;  3QU3 A;  3SZP A;  2UWM A;  1XSD A;  2P7V B;  3DQV C;  2IRF G;  3T8R A;  2YU3 A;  2CWE A;  3QU6 A;  3C18 A;  2VOO A;  3VFZ A;  4LGW A;  3IKT A;  1MZB A;  1IAW A;  2VE9 A;  3I58 A;  3IL2 A;  4CHU A;  1I5Z A;  1TLH B;  3GF2 A;  4ESJ A;  5CVR A;  3HRS A;  3I0T A;  3ZN0 A;  3ML6 A;  3SZT A;  3C7J A;  2O61 A;  2CGP A;  5IT9 K;  2FBI A;  5EEG A;  3F8B A;  2ESN A;  1DPR A;  2DPD A;  1Y0U A;  3U2R A;  3WU0 A;  3JTG A;  2F5E A;  4RB0 A;  1XMK A;  1ZN2 A;  4KIF A;  3L00 A;  3FXR A;  3I54 A;  2MLG A;  3K1P A;  2M8E A;  5J8F A;  1HST A;  1J59 A;  3LQQ A;  3N97 A;  1ZG1 A;  4OOI A;  2EWN A;  3CJN A;  1KQ8 A;  1BBY A;  3V7R A;  4YIF A;  1PP7 U;  1YIO A;  4N9H A;  5K5Q A;  2GA1 A;  1QNT A;  4R8H A;  5BS6 A;  2GWR A;  2V1D A;  2ZXJ A;  3GEZ A;  2P5L C;  2DBB A;  3SHF A;  5CVU A;  4LLG F;  1UFM A;  5LGT A;  1G3W A;  3ECO A;  3IWF A;  5J8C A;  1RIO H;  1IUY A;  5HOO A;  1SFX A;  2QQB A;  4A2U A;  3P9K A;  4L5I A;  1CF7 A;  1OR7 A;  2HZT A;  2Z5U A;  3HSR A;  2AXL A;  4IHS A;  1G3Y A;  2M30 A;  2KJB A;  2A5Y B;  1IW7 F;  1TNS A;  2M5W A;  5IT9 Z;  2PFB A;  1FT9 A;  1ZAR A;  1OYI A;  2L54 A;  3GVA A;  5F1R A;  3HHH A;  1SMT A;  2ELH A;  2FE3 A;  5FGM A;  3BDD A;  1CF7 B;  3ZMT A;  2E7W A;  1U3E M;  3M9A A;  3GFI A;  3ABT A;  1CGP A;  1U2W A;  4Q47 A;  3TQN A;  1DUX C;  2W57 A;  4IHT A;  4ESF A;  5LHG A;  2ZJ2 A;  3ZMD A;  2KRF A;  2HTS A;  3BJO A;  4EGZ A;  2A68 F;  3TO7 A;  5JR3 A;  4MNU A;  1BOA A;  3IRR A;  2DW4 A;  5A2Q K;  5K5R A;  2ADU A;  1Z9C A;  1BI1 A;  3KET A;  2W85 A;  1YW8 A;  3R6S A;  3E6D A;  3ZPL A;  1KA8 A;  4I01 A;  5BOX A;  3E3V A;  3EYY A;  1LDK B;  4OMY A;  2HQN A;  3R4K A;  2OA4 A;  2WTE A;  5D4S A;  5ICG A;  3RTR A;  4IRI A;  2QQ9 A;  1RUN A;  5FO5 A;  4G7H F;  1B6A A;  4KMU X;  2XUB A;  2JPC A;  1ZRD A;  2HEO A;  4L9J A;  1KGS A;  2E1C A;  2PEX A;  4A6D A;  1BI2 A;  1HW2 A;  3FXQ A;  3KP5 A;  2K4J A;  2VBX A;  1HXD A;  1RZ4 A;  2WC2 A;  4L5J A;  5DV5 A;  3T5X A;  1VTN C;  4EVI A;  5E18 F;  3WGG A;  2A61 A;  1R1V A;  1BI0 A;  2VOP A;  5E1X A;  1XGS A;  3G73 A;  5CLS A;  2P7C B;  1TNT A;  5ED4 A;  4NB5 A;  3V8K A;  1U5T A;  3FM5 A;  3BP8 A;  5E8I A;  3DPT A;  2QM3 A;  1LEA A;  3HHG A;  1OYY A;  4MGR A;  4BHP A;  2YR2 A;  5HS7 A;  2AS5 F;  4BYY A;  4ZYG A;  2NNN A;  4OIQ F;  5AIP A;  2HS5 A;  4HV6 A;  4L18 B;  1P92 A;  3KP3 A;  5LHI A;  1P2F A;  4MTE A;  3ECH A;  2IA1 A;  3GFM A;  1WI9 A;  4ZZL A;  4FX4 A;  1LDD A;  2HR3 A;  4M71 A;  5HLG A;  2XAG A;  2XHK A;  1U5T B;  1FLI A;  1HKQ A;  1JHH A;  3WTW C;  2UXN A;  2VXZ A;  3E5U A;  1TQP A;  2ISZ A;  2P8T A;  1ON1 A;  1W4M A;  1Z1D A;  2J5O A;  2PBI A;  4BNC A;  2VN2 A;  3PQJ A;  4BH9 A;  2P5K A;  5H6R A;  1ZH5 A;  3IWZ A;  5F6F A;  1FP2 A;  3QP5 A;  3KP7 A;  2F5C A;  3MQ0 A;  4ZYD A;  3PQK A;  4AD9 A;  3F8N A;  5DUI A;  1UHM A;  4M72 A;  4M6Y A;  1FP1 D;  3PFI A;  2COM A;  4NHJ A;  4YII A;  3BY6 A;  4LK0 F;  1MGT A;  1XSX A;  3COA C;  2GQQ A;  1FX7 A;  4BQA A;  1R1U A;  3MWM A;  4LLN A;  1EH7 A;  2V6C A;  3KEQ A;  3TOA A;  1FNN A;  3HUG A;  1E17 A;  2ISY A;  4FT8 A;  3E97 A;  4A5M A;  2H6C A;  2HQR A;  4KNY A;  5E1Z B;  1Q1H A;  3M8F A;  3T8T A;  1SD4 A;  3FHZ A;  2IP2 A;  1SMY F;  3WTS C;  2F5F A;  3V7C A;  1DDN A;  2ESH A;  1SFU A;  2V79 A;  2XRO A;  1FBS A;  3HYI A;  3RIR A;  3R60 A;  1IN7 A;  3RYP A;  4CXF A;  2FBK A;  2RC4 A;  1LDJ A;  3FX3 A;  1TTY A;  3H3U A;  2HWV A;  4RAZ A;  3E5Q A;  4AWX B;  3C3W A;  4XSX F;  4MQV A;  2CO5 A;  2KIM A;  2W84 A;  4P9F A;  2IA2 A;  2STW A;  3MZY A;  1W7P A;  5LRR A;  2PJP A;  3Q9V A;  4IF4 A;  4EJW A;  1B59 A;  2EFW A;  2O6G E;  1UST A;  3CO7 C;  4WWC A;  2PMU A;  4CO8 A;  2IVM A;  4HF0 A;  1I27 A;  4U0Y A;  4G6D A;  5K1Y A;  3D0S A;  2DK8 A;  1Z05 A;  2D45 A;  1PP8 F;  4S05 A;  3WOD F;  4O3M A;  4U0W A;  4M9Z A;  4D0P A;  2BBY A;  3L9F A;  5LGU A;  4JK1 X;  2EK5 A;  4EM0 B;  2PN6 A;  3EDP A;  4HF2 A;  5CJ9 A;  3P9I A;  4OIP F;  5LGN A;  4HYE A;  1U6G A;  3DV8 A;  2MH2 A;  2H27 A;  4HX4 A;  1W7P B;  3WTU C;  2BYV E;  1ON2 A;  3KP4 A;  4H0E A;  4CIC A;  4WCG A;  1QZZ A;  3R0J A;  4M9X A;  3KE2 A;  4HV5 A;  1G6N A;  1KQ9 A;  1U5T C;  3F6V A;  1JXS A;  3QRF F;  1T0F A;  5DD8 A;  5LLQ A;  3FZV A;  1H9G A;  2X0L A;  1KYW A;  3BJ6 A;  3E5X A;  4HQM A;  1IRG A;  3SQN A;  5AON A;  2A07 F;  2HDC A;  2DFI A;  2M1B A;  2RGV A;  4HW0 A;  3EET A;  5D4R A;  4ENM A;  2RQP A;  1P4X A;  3IRQ A;  4ZZD A;  4GYG A;  1J9I A;  5BPI A;  5LEK A;  1DPU A;  1R7J A;  3F23 A;  4Q48 A;  4U88 A;  2VOD A;  4UVA A;  1O3Q A;  4CZZ A;  2VBY A;  1I1G A;  2VON A;  2VT2 A;  2MLK A;  3GLX A;  2XKP A;  4HLY A;  1KU3 A;  3R0A A;  2A3S A;  2NS0 A;  4RS8 A;  4BHB A;  2JRT A;  1TQI A;  4XBF A;  4IRG A;  3HIF A;  1IN6 A;  1K7A A;  2D1H A;  2J5P A;  3I59 A;  2TDX A;  1UCR A;  2H6B A;  2XAH A;  3REO A;  1EH8 A;  2YPR A;  3KCC A;  5ILS A;  1F4K A;  1UB9 A;  3ELK A;  4RB3 C;  3MCZ A;  2EFN A;  1JGS A;  1IXC A;  4RGU A;  1LQ1 A;  1QGP A;  3I5U A;  2LDU A;  1B4A A;  4HAM A;  3NRV A;  2O3F A;  1XGM A;  5DD4 A;  2Z3Y A;  3MEX A;  4IRH A;  1MDM A;  3CDH A;  1ONV A;  1AWC A;  3I59 B;  4HZF A;  1KU9 A;  1ZGJ A;  4WXC A;  1PDN C;  4OIR F;  4LG0 A;  2D2W A;  2ZO4 A;  5FLX Z;  1E2X A;  4R79 A;  2O8X A;  2GIV A;  1BIB A;  3V4G A;  4PCQ A;  2IA0 A;  2R7D A;  3WTZ A;  3VEP A;  1HBX G;  4Q5S F;  4ENK A;  2OD5 A;  2XV4 S;  3ZMV A;  2KIF A;  4KIC A;  1TBX A;  1P4A A;  2OU2 A;  4OMZ A;  3CUO A;  1ZHF A;  2GZW A;  5CVJ A;  4BAY A;  4WK8 F;  1MDM B;  5D5V B;  3Q9S A;  5D6E A;  5JI6 A;  4EJO A;  4GYI A;  2E1N A;  1FSE A;  4CDG A;  4LG0 B;  1FBQ A;  1K78 A;  4PGG A;  3M1E A;  4IVN A;  3BRO A;  4ETS A;  3WU1 B;  2DU9 A;  1YTY A;  2DT5 A;  4KFC A;  1STZ A;  2CW0 F;  4FX0 A;  4K2E A;  1YO5 C;  1IN5 A;  3TOB A;  3TO6 A;  4GCV A;  1U78 A;  2BV6 A;  4I2O A;  2Y48 A;  4OU0 A;  4AIK A;  2QQA A;  2HOE A;  1QPM A;  4PGH A;  5DCM A;  1W5T A;  4GXO A;  5L3G A;  1DP7 P;  2P5V A;  5HLH A;  3BPV A;  2VBZ A;  1XGO A;  2DLL A;  4IJA A;  1MKM A;  1K78 B;  3LST A;  4L0Y B;  2ZNY A;  1ZRC A;  2FEZ A;  4FHT A;  1S7O A;  2XIG A;  2FXA A;  4ENN A;  4EJT A;  4B8X A;  4O5V A;  3D5L A;  2LNB A;  4NQW A;  5DCM B;  2XKO A;  1HSJ A;  3EUH A;  3M8E A;  3HTS B;  2ZBK A;  3O6B B;  3F21 A;  1ODD A;  4EM1 A;  4Q4Z F;  5EEH A;  2FF4 A;  2DAO A;  4CGZ A;  1D8K A;  1ZLK A;  5D5X B;  3F72 A;  2BGC A;  2GXG A;  1WQ2 A;  4U7B A;  1J2X A;  2Y75 A;  3C1D A;  3O3K A;  4G7Z F;  2HKX A;  2WWY A;  3BPX A;  3JW4 A;  1S3J A;  3K69 A;  1OKR A;  3ABU A;  4EM2 A;  2XRN A;  1ZRE A;  2QZ8 A;  1I1S A;  1OMI A;  1OPC A;  4LJZ F;  3WE2 A;  5DYM A;  2FQ3 A;  2VC0 A;  3ERE D;  4E70 A;  5IT3 A;  2NRA C;  3G3Z A;  2EB7 A;  5HVQ C;  3FMR A;  3E6B A;  1R58 A;  5ILV A;  1YW7 A;  2GA2 A;  2K7L A;  5HLI A;  3U1D A;  3QAH A;  4ON0 A;  3OOP A;  3RYR A;  2MH9 A;  2IPQ X;  1WKM A;  3JAM K;  3DFG A;  3J80 Z;  1V3F A;  3RKY A;  4A6E A;  1LJ9 A;  2OZU A;  3K2Z A;  3MAJ A;  3KLO A;  2ZKZ A;  4I98 B;  2ETH A;  5ICE A;  1KYZ A;  3WTY C;  5JVT A;  3CLO A;  5L3D A;  3ZQ7 A;  2FU4 A;  2LF8 A;  5KK1 A;  3NEU A;  5DCF A;  2FSW A;  4GO1 A;  1GHC A;  3QOP A;  5ICF A;  5BQT A;  2EV0 A;  2Z9O A;  3P9C A;  4YFN F;  1OYW A;  3QP6 A;  1ZGA A;  3DXJ F;  5ERI A;  2EFQ A;  2IW5 A;  2RNJ A;  2QEN A;  2XAQ A;  4G8X A;  5D8L B;  1XB4 A;  2YX7 A;  2ZCW A;  4KN4 X;  2NAZ A;  2L4A A;  3SXY A;  5E8G A;  3VOD A;  3ISP A;  1HW1 A;  2CG4 A;  1G4D A;  3ZN1 A;  2K86 A;  4XRF A;  4MEY F;  4WX9 A;  2FNA A;  3DKW A;  4F7Z A;  2DI3 A;  4A12 A;  2M87 A;  5D6F A;  3FMQ A;  2G7H A;  2V1X A;  5TJJ A;  4TV7 A;  3L2C A;  3L09 A;  3GX4 X;  1XSV A;  1FSH A;  3GFJ A;  4LFU A;  4N9I A;  3RKW A;  3AAF A;  3HSE A;  2G7U A;  3HRM A;  3TO9 A;  3JAM Z;  1Z91 A;  2L3D A;  5JFR A;  3RDI A;  3FM3 A;  3M7G A;  2H09 A;  2PMH A;  1BIA A;  4MHG A;  3WTV C;  5D5U B;  3ZP5 A;  4BXU A;  3JSP A;  5DUK A;  4KA4 A;  3E6C C;  3HSF A;  2Z99 A;  2VT3 A;  5CYV A;  2K27 A;  1KU7 A;  4S04 A;  1D3Y A;  2HYF A;  4AIH A;  1IZ1 A;  5HS8 A;  5CVI A;  2OQG A;  2ZNZ A;  4LD5 A;  6PAX A;  5JHU A;  4BHC A;  1TW3 A;  5D5W B;  4WXH A;  3OV8 A;  1QZY A;  4HF1 A;  4IPA A;  4HX7 A;  4AVP A;  1IXR C;  2FBH A;  3B73 A;  2IT0 A;  1A04 A;  4KYW A;  4EJU A;  5FD6 A;  1MJ9 A;  3Q5F A;  1F9N A;  2ZFW A;  1TQM A;  3TGN A;  1SD7 A;  4RGR A;  4EJV A;  1SAX A;  5CVV A;  4G94 A;  1J0R A;  2BEO A;  4YFK F;  1BJA A;  3LAP A;  2XAS A;  3RI4 A;  5LHH A;  1REP C;  2RV8 A;  3ROU A;  4RB1 A;  3P7N A;  1RI7 A;  4KIB A;  4WXD A;  4EV0 A;  2L01 A;  3L7W A;  2ZME A;  4WF2 A;  4L0Z B;  1O57 A;  1XCB A;  2W25 A;  1BC8 C;  5E1W A;  2PI0 A;  1YG2 A;  3GZ6 A;  1R22 A;  1S7A A;  4RGS A;  3TDZ C;  3I53 A;  3F22 A;  2MC3 A;  1QQI A;  4LMY A;  4I0B A;  3QPH A;  2JTV A;  2O03 A;  3ULQ B;  3B02 A;  4M74 A;  4DQ2 A;  2RN7 A;  2ZME B;  2FMY A;  3CUQ A;  1EV7 A;  1BI3 A;  5LEJ A;  2GXB A;  5LBQ A;  2DPU A;  3S2W A;  4LB5 A;  5FLX K;  4ZYE A;  2PLY A;  1B1B A;  5LRS A;  3SFZ A;  1MJB A;  2EJR A;  2VC1 A;  3DP7 A;  1Z6R A;  2V1U A;  4KMF A;  5FD5 A;  3LA2 A;  3WGH A;  2HYG D;  1QBJ A;  5E17 F;  1ZLJ A;  4LK1 F;  3GYH X;  5FFX A;  5ILU A;  5BMZ A;  1T39 A;  3CUQ B;  2H94 A;  1QO0 D;  1LVA A;  1O3R A;  3K9T A;  1F5T A;  1YW9 A;  4I09 A;  3F6O A;  4G9Y A;  4HQE A;  2JSC A;  3JSO A;  2HFH A;  4P96 A;  1G3T A;  1XMA A;  3J7A O;  3WG9 A;  2QWW A;  1WWX A;  2F2E A;  2YX4 A;  3VB2 A;  2NYX A;  3W6K B;  1FOK A;  2XAF A;  3HRT A;  3LWF A;  1R5H A;  2EV5 A;  2XAJ A;  3T0Y A;  2A6E F;  4HLX A;  3WE3 A;  2W24 A;  1ZG5 A;  3V8J A;  1B9M A;  4A0Z A;  1D5V A;  4LLL A;  4EMS A;  1O3T A;  2OZ6 A;  4U0V A;  1ZRF A;  3CO6 C;  4UUV A;  4N0B A;  2X4H A;  1J7K A;  3KFW X;  1ZG3 A;  4UNO A;  2CQK A;  1FYM A;  3NQO A;  4L9N A;  2DQL A;  4EQQ A;  3LFK A;  1K79 A;  3GWZ A;  4RB2 C;  1USS A;  2NNY A;  3RKX A; 
#chains in the Genus database with same CATH topology
 3I4N J;  1JUP A;  2DK5 A;  3ZQF A;  2HVS A;  1UMQ A;  1FYK A;  4J19 A;  4GFB A;  1P7I A;  2NOJ B;  2QLZ A;  4BJ6 C;  3GO5 A;  3QYE A;  3KZZ A;  4E7L A;  2I5U A;  2Q2E A;  3GXO A;  3ZQL A;  3ZMZ A;  1Z0X A;  3PNY A;  1JKP C;  4J01 A;  2NXN B;  2KDZ A;  5AIQ A;  2HGC A;  2X51 A;  3BG3 A;  3BOQ A;  2C6Y A;  2KIU A;  4ABZ A;  2R7V A;  3MN2 A;  3WTX C;  1R71 A;  1YS7 A;  4KN7 X;  1O3S A;  3MZH A;  1Y8Q B;  2M9H A;  3IV5 A;  3HRU A;  3K0L A;  4QLC U;  2EZI A;  2CQX A;  1TW2 A;  3HPG A;  1OCZ H;  5FFZ A;  2EA4 A;  1Y8R B;  3WTT C;  4A3F J;  4A0X A;  1GDT A;  1GXP A;  2R93 J;  3IHU A;  3QOD A;  4KIG A;  5K5O A;  1Y6I A;  5ICC A;  2YU9 J;  4E7Z A;  3FHN A;  1VZ0 A;  3E7L A;  5F27 A;  3CF5 F;  2EFP A;  2E34 A;  5L3C A;  2X6O A;  5J4V A;  3W6J B;  3SJM A;  1Y1V J;  4M9S A;  4XLN F;  1WRJ A;  5EG0 B;  1GVJ A;  2K9M A;  1FBU A;  4UV9 A;  4YG2 F;  2OAZ A;  4M3B A;  3H3Z A;  1YQA A;  2ZME C;  2E2J J;  5F64 A;  3GME A;  4XQF A;  2L9V A;  3GTQ J;  2Q2E B;  3FWE A;  1YYV A;  1ULY A;  3LL7 A;  4UVC A;  1G59 A;  3S1M J;  1O7L A;  4DBQ A;  2CSO A;  4GRI A;  5GP9 A;  1XTA A;  4JX4 A;  4CCM A;  1MD0 A;  3OYH A;  3J80 K;  4OIN F;  1JGG A;  2LSO A;  3KYC B;  3LNQ A;  3LSG A;  1IRF A;  2V9V A;  3A01 A;  2M34 A;  3MFK A;  2FA5 A;  2K3F A;  4EGY A;  4Y52 J;  4P5O A;  1MW7 A;  1PUF A;  4PZJ A;  2CU7 A;  2E60 A;  1F36 A;  4UV8 A;  4M3F A;  5TGT A;  3BCA A;  1N75 A;  2Q8K A;  2GAU A;  1IF1 A;  1YLF A;  1TWF J;  3F8C A;  2DMT A;  5FRM A;  3OYK A;  2L4M A;  2UXX A;  3F8F A;  4B47 A;  3A02 A;  3ZMU A;  1BC7 C;  1PUE E;  5HDK A;  4A5N A;  2Y30 A;  4M6X A;  3H3V K;  1SAU A;  1AOY A;  3CUQ C;  3ZMS A;  3S3O A;  1P6R A;  3QPT A;  4PK4 A;  3HB9 A;  4I02 A;  3TDU C;  3V8L A;  3FK6 A;  3RPU D;  4EAT A;  4F93 B;  1H8A C;  1U9N A;  2HOA A;  2H8R A;  3H35 A;  4MQ9 F;  2R7Q A;  1XCV A;  2B0L A;  4LB6 B;  4ZH4 F;  5CPR B;  1BN5 A;  2CYY A;  3CF2 A;  4Y4R A;  1MJA A;  3HTU A;  1FZP B;  2IS1 A;  3DLA A;  1GV2 A;  3RJP A;  3FMS A;  1BR4 A;  2KIQ A;  2P4W A;  3CME I;  1ZYR F;  2DMP A;  5H6Q A;  4HNT A;  3A01 B;  1X2M A;  2BVM A;  5JVG F;  3SFI A;  4V2G A;  2A6H F;  4BE0 A;  1LE8 A;  1PUF B;  4QTR A;  1IV8 A;  2O5R A;  4X1E A;  1B9N A;  4XLP F;  2DO7 A;  1APL C;  5IP7 J;  2DQR A;  4RGX A;  2W82 A;  1T98 A;  1OCP A;  4CH7 A;  1YE9 A;  1R5G A;  1X1B A;  2R7F A;  4MTD A;  2PMZ A;  2L9R A;  2Y31 A;  3GUD A;  2EIK H;  1MH3 A;  3PSI A;  1RES A;  2K40 A;  3RPU A;  1FY7 A;  2FNP A;  3GLL A;  3OR1 C;  3QPL A;  4JQF A;  4W97 A;  3UR3 C;  2P6S A;  5EZH A;  2F4I A;  3RPQ A;  3DU6 A;  5DDG A;  3J7A Y;  2HKO A;  4MEX F;  3DF8 A;  3PUF A;  2FOK A;  1K4T A;  4OIO F;  1T6S A;  5J40 A;  3D1N I;  1WSU A;  3FDY A;  1JTY A;  3K4J A;  4UXN A;  4J00 A;  1IUF A;  5HDN A;  2HZD A;  2YS9 A;  2ZJR F;  1IV6 A;  1XN7 A;  1SVM A;  1IN4 A;  3SDB A;  3GTJ J;  1VQ8 I;  3KYL A;  1RNL A;  4IOA F;  2FD5 A;  1ZR4 A;  1LE8 B;  5E3O A;  2EIJ H;  2JZY A;  2H1L A;  2QYO A;  1IXS B;  2JUG A;  4P9U A;  2R7S A;  1WJC A;  2EFO A;  4AUX A;  2XGX A;  3KZY A;  1HKS A;  3K1M A;  2OQR A;  1R36 A;  2R7T A;  3J81 K;  1C0W A;  1Z6T A;  2XF5 A;  1BW5 A;  3V7S A;  4E7I A;  2XVC A;  3K4B A;  3L2W A;  3HOS A;  5EJC A;  4HDU A;  3OYN A;  2ECC A;  4A3G J;  3RZO J;  3KP2 A;  3EQL F;  3JRA A;  2W48 A;  1SD6 A;  2KJC A;  2HTJ A;  2JT1 A;  3K1N A;  2JUC A;  2UZK A;  2MD5 A;  3HGY A;  3T1B A;  1IDZ A;  1O7F A;  4IXA A;  1JE8 A;  3TBI A;  2X6W A;  3CTA A;  4UVB A;  5A2Q Z;  9ANT A;  4HBL A;  3HOT A;  1K6O A;  1P4W A;  5EEA A;  2KMU A;  3KEO A;  4G7O F;  2BE5 F;  1HW5 A;  3W2V A;  5GTH C;  2LOO A;  1XGN A;  2BY0 A;  2OBP A;  3H92 A;  5J3L A;  3WGI A;  4AIJ A;  1WJ5 A;  2NOG A;  2G9W A;  4Y15 A;  1IRZ A;  2CJJ A;  1XDS A;  1JKO C;  2MA3 A;  4XOT A;  2W00 A;  3OSF A;  2WV0 A;  1DGW Y;  1GXQ A;  1WCM J;  1MBH A;  2OUM A;  3VOE A;  1SEU A;  2P0W A;  1I3Q J;  4F92 B;  2IGO A;  1IO2 A;  5J6X A;  2ECB A;  2Q0O A;  4CCJ A;  4ZYH A;  1J75 A;  3I4P A;  3LMM A;  1W5C C;  4F55 A;  4YFX F;  4A3K J;  1LEB A;  1NHA A;  2LKP A;  4A0Y A;  2O0Y A;  1BW6 A;  3VYU B;  1BM9 A;  3G71 I;  5H20 A;  4A3I J;  3HOY J;  1WFX A;  3BCB A;  2QKM B;  3TKY A;  1VND A;  4LIT A;  1J5Y A;  1W5S A;  1XDU A;  5C4X J;  4AM3 A;  1IDY A;  1SFE A;  2A69 F;  2MW8 A;  2JVH A;  3CCS I;  4ZJZ A;  4CYD A;  2L9S A;  3I64 A;  2IGK A;  2CW7 A;  1RKT A;  2STT A;  2P6T A;  3I9V 2;  5DEQ A;  1R1T A;  4QWQ A;  4AID A;  4HX8 A;  4CCO A;  3R61 A;  3TED A;  1FOY A;  3OS2 A;  2WAQ N;  4CYC B;  1EF4 A;  1ETQ A;  3VDX A;  1JHF A;  1LB2 A;  3BWG A;  3RQI A;  2G0E A;  1YFH A;  4UY8 I;  5HOD A;  1R23 A;  4IHX A;  2RKH A;  1D8J A;  5IYD J;  2ZXH A;  1X1P A;  3BQZ A;  3VYR B;  2RVC A;  4C2U A;  2R7X A;  2K02 A;  1ZAO A;  5L3E A;  2Z2S B;  2CUF A;  2JQ7 A;  2JJ7 A;  3AKZ A;  4HST A;  2Z16 A;  4KT5 C;  4UB6 C;  4XID A;  5KVR A;  1A6I A;  1N25 A;  1PJR A;  1WGX A;  2MBF A;  3JRF A;  1A5J A;  3K4N A;  1SFK A;  5HDG A;  1GT0 C;  3HOU J;  3H5N A;  3GZ5 A;  2VBW A;  3DKY A;  1T2K A;  3J81 Z;  4KDP A;  1WHU A;  2JPB A;  1YJW I;  5HS9 A;  4XN0 A;  5E3L A;  4PDK A;  4Y13 A;  3JRE A;  1B8I A;  3S17 J;  1T38 A;  3D5R C;  1FIA A;  2MGQ A;  4XKC A;  3LA7 A;  4PJL A;  4RAY A;  2EA2 A;  3EYI A;  5FB2 A;  3FXU A;  1KU2 A;  1LFP A;  1W36 C;  2M45 A;  2YSR A;  1ZK8 A;  3HEF A;  5FRO A;  5BPD A;  2QUF A;  3QOE A;  3PNV A;  1W7P D;  2VE8 A;  2DJN A;  3BC8 A;  4NUB A;  1HQC A;  4ENJ A;  4ASN A;  1RUO A;  4M73 A;  5E20 A;  2Z33 A;  4U7D A;  2IS2 A;  5GTI C;  2K4B A;  3GZN B;  3W6V A;  3K4M A;  4HNU A;  1Z7U A;  3N05 A;  4HA8 A;  2CMP A;  4G6Q A;  3MKZ A;  3N4M A;  2RNG A;  3LSK A;  3ZCO A;  2VJ5 A;  3GW2 A;  3LSP A;  2Y2Z A;  3FF5 A;  2DYR H;  3KP6 A;  1S6L A;  3BTJ A;  4GGG A;  1VQ9 I;  1TP4 A;  2HXO A;  2WV1 A;  3A1Y A;  3PM1 A;  3M07 A;  4A3C J;  1XMX A;  1S29 A;  1H0M A;  2F5D A;  3BJA A;  3U9G A;  1X3U A;  1B8I B;  3DEU A;  1IN8 A;  1D5Y A;  1U0J A;  1FPQ A;  1NK2 P;  3JTH A;  3LA3 A;  2GLO A;  1OJL A;  4I7H A;  2CQN A;  1OLT A;  2RDP A;  3BZ6 A;  2ZSH B;  5FKO A;  3FXM A;  1JTX A;  1SD5 A;  3GFL A;  2L02 A;  1GLN A;  4HOB A;  3AG4 H;  3IC7 A;  2E2H J;  3BTC A;  1JUS A;  5BNG A;  2Y0M A;  1ETK A;  2VQL A;  3K4C A;  2LKX A;  3CC7 I;  4RMN A;  2PG4 A;  2XRL A;  4ZTJ A;  2E7X A;  4DNC A;  1YS6 A;  1I39 A;  1P7J A;  1L0O C;  3IH3 A;  4UB8 C;  4MFD A;  4PFO A;  2OF7 A;  1KQ0 A;  1A6Q A;  1I6X A;  3DPL C;  5D8K B;  2K5C A;  1U8R A;  4A3B J;  1F1Z A;  4P55 A;  1VQK I;  3F0C A;  2IJL A;  1FC3 A;  4O6J A;  2D1V A;  1FWZ A;  2QVO A;  5L3F A;  3LAJ A;  2L2O A;  3OOU A;  3C2B A;  3LSI A;  2CFX A;  4F52 A;  2LF7 A;  4AYB A;  1VQ6 I;  1BOB A;  1XD7 A;  2HNH A;  2IXS A;  3QYF A;  1HCR A;  4YEL A;  2H1K A;  1D1C A;  4XSZ F;  2QBY A;  1YI2 I;  2W1O A;  4B09 A;  1FYL A;  1G3S A;  3C2G A;  2AO9 A;  5HNH A;  4IL6 C;  5FKN A;  4CSW A;  3F3X A;  2FML A;  4FE7 A;  1V4R A;  2R3S A;  4A69 C;  4L9T A;  2ME0 A;  2LP0 A;  4UUT A;  2WY8 Q;  4ESB A;  1S8N A;  4Z2Y A;  4R1H A;  5IOZ A;  1FMV A;  3SEZ A;  4UHT A;  2ACJ A;  1HDP A;  2DTR A;  1UHW A;  4B4C A;  1L3L A;  4HDV A;  3E6M A;  2KKO A;  2WBM A;  4KUM A;  3I71 A;  5B1A H;  2HOT A;  2EV6 A;  3IKV A;  3VWB A;  1TT0 A;  3BR6 A;  2X6Y A;  3PIO F;  1HKT A;  1R00 A;  1MSF C;  3OYI A;  4XKB A;  1H9T A;  1E3O C;  2FRH A;  5TRD A;  4L9V A;  2DFH A;  1LNW A;  2Y0S A;  4C3I J;  3ZRG A;  3O2P E;  4I0A A;  3KLN A;  4JBA A;  2QBY B;  1EH6 A;  2E1M C;  3RZD J;  3F8M A;  2PQ8 A;  3LQR A;  1FTT A;  1MBK A;  4BBR J;  5L3B A;  4Y17 A;  1Y56 A;  4A3L J;  4KIS A;  3QU3 A;  3SZP A;  2UWM A;  4JX6 A;  2A6T A;  4BS9 A;  2KDO A;  1IG7 A;  1XSD A;  2P7V B;  3DQV C;  2IRF G;  3T8R A;  3CDI A;  2YU3 A;  5EYR A;  2KL4 A;  3P5J A;  2CWE A;  1SVL A;  3QU6 A;  1YRN A;  1BR1 A;  3C18 A;  3HZJ A;  4NNJ A;  2HQA A;  3VFZ A;  2VOO A;  3GTM J;  4LGW A;  3IKT A;  5JLW A;  4RDU A;  3PNT A;  1MZB A;  4HG2 A;  1MH4 A;  3IUO A;  1IAW A;  2VE9 A;  5B66 C;  3I58 A;  3IL2 A;  4CHU A;  3OL3 A;  1I5Z A;  3BTL A;  1TLH B;  3GF2 A;  2Y9Y A;  2HPM A;  4ESJ A;  5CVR A;  3H9J A;  2KT0 A;  3Q0U A;  3HRS A;  3I0T A;  1T8I A;  5H2F C;  2W7N A;  2LYC A;  4Y3O A;  3ZN0 A;  3CMY A;  3ML6 A;  3SZT A;  3VSK A;  2XB0 X;  3C7J A;  1S7E A;  2WAE A;  2O61 A;  5EDN A;  2CGP A;  4B3X A;  1NG7 A;  1J09 A;  5IT9 K;  2FBI A;  4PSX A;  5EEG A;  3FXK A;  3K10 A;  3F8B A;  2LY9 A;  1TWG J;  3H36 A;  1DQU A;  2ESN A;  1DPR A;  5IPA A;  2DPD A;  1Y0U A;  5M3F J;  3U2R A;  2WB1 N;  4XLH A;  3WU0 A;  3JTG A;  3G1O A;  2LC2 A;  2F5E A;  4RB0 A;  3OYD A;  1YRN B;  4JYK A;  1XMK A;  1WH7 A;  1ZN2 A;  4II3 A;  4KIF A;  2X1E A;  5HNF A;  3L00 A;  3OSG A;  2VQH A;  3FXR A;  3I54 A;  3LSH A;  1ETV A;  5FLV A;  2MLG A;  2OC6 A;  3K1P A;  1ETO A;  5IY5 H;  2M8E A;  3FBI B;  2JA8 J;  5J8F A;  3ONQ A;  5HLT A;  1HST A;  4IHV A;  1J59 A;  3CD6 I;  3LQQ A;  3WHB A;  3N97 A;  1ZG1 A;  4OOI A;  3NWT A;  2EWN A;  3ZQC A;  3CJN A;  3A0H C;  2UV1 A;  1RR7 A;  4QIW N;  1KQ8 A;  1BBY A;  2XPW A;  3V7R A;  4YIF A;  1PP7 U;  1YIO A;  2M7B A;  5M5Y J;  2DA2 A;  4IX7 A;  4N9H A;  2ELJ A;  5K5Q A;  2B7E A;  2GA1 A;  4XNF A;  1QNT A;  4R8H A;  5BS6 A;  2GWR A;  2HI3 A;  1MBE A;  1LUJ B;  2V1D A;  2DA4 A;  3CES A;  2ZXJ A;  3GEZ A;  2P5L C;  4BBS J;  4LIU A;  1M1E B;  5KNL A;  2DBB A;  3SHF A;  5CVU A;  4LLG F;  1UFM A;  4E6K G;  5LGT A;  3CCY A;  1G3W A;  3ECO A;  3IWF A;  3X2Q H;  4A93 J;  4XOR A;  5J8C A;  1RIO H;  1IUY A;  5HOO A;  1SFX A;  2QQB A;  4A2U A;  3P9K A;  4L5I A;  1CF7 A;  1OR7 A;  3Q3S A;  2VIX A;  3A4C A;  2HZT A;  3AFH A;  2QSH X;  1X3Z B;  2Z5U A;  3HSR A;  2AXL A;  3JRI A;  4IHS A;  2KZG A;  1G3Y A;  2M30 A;  3B6A A;  5J4Y A;  3MKY B;  5FLM J;  1MBF A;  2KJB A;  2A5Y B;  4BY1 J;  2OTL I;  1IW7 F;  2R7U A;  1TNS A;  2M5W A;  5IT9 Z;  2PFB A;  1ZTR A;  1FT9 A;  1X19 A;  2R92 J;  2PX9 A;  1ZAR A;  1JT6 A;  1OYI A;  2CRG A;  1TL8 A;  1G2H A;  2L54 A;  3GVA A;  5F1R A;  4QPO A;  3L2U A;  3HHH A;  2QSG X;  4NBQ A;  2V9P A;  1SMT A;  1XPX A;  2ELH A;  2FE3 A;  5FGM A;  3BDD A;  5F0F A;  1CF7 B;  3ZMT A;  2E7W A;  2VQG A;  1U3E M;  3M9A A;  3PO2 J;  3CP2 A;  1VI0 A;  4XLA A;  3GFI A;  3ABT A;  2MG4 A;  1CGP A;  1NTC A;  1QHG A;  1U2W A;  4Q47 A;  3DTE A;  3TQN A;  1I3A A;  3DTI A;  1MND A;  2IBD A;  1DUX C;  2VPL A;  2FJ1 A;  4DZJ A;  2W57 A;  2XGC A;  4IHT A;  4ESF A;  2V6E A;  3PIP F;  2LD5 A;  2ID6 A;  5LHG A;  2ZJ2 A;  2KRH A;  3ZMD A;  2KRF A;  2HTS A;  3BJO A;  4EGZ A;  1UEL B;  1BL0 A;  2A68 F;  1Z21 A;  2E19 A;  3TO7 A;  5DTD A;  5JR3 A;  3L2Q A;  4MNU A;  1BOA A;  3IRR A;  4XM3 A;  1ETW A;  2DW4 A;  5A2Q K;  5K5R A;  2ADU A;  1Z9C A;  2XAU A;  1BI1 A;  2QGU A;  3MKW B;  2LBF A;  4XIC A;  3KET A;  2W85 A;  1JI8 A;  3G4S I;  2XPV A;  1R6R A;  1YW8 A;  2BY2 A;  3R6S A;  3E6D A;  1TZL A;  3ZPL A;  1VQ4 I;  2ZXI A;  1KA8 A;  4I01 A;  5BOX A;  3E3V A;  3W2A A;  1Z3X A;  1LDK B;  3EYY A;  2HQN A;  4KT6 A;  2DDA A;  4OMY A;  3S1Q J;  3R4K A;  4XKV A;  4ZYA A;  1YX3 A;  2OJE D;  4YEJ A;  2OA4 A;  2WTE A;  1QA6 A;  3GTL J;  2QCO A;  2M0M A;  2QF7 A;  1GV5 A;  4II2 A;  5D4S A;  2DA7 A;  5ICG A;  3RTR A;  2LY1 A;  3FKI J;  2BY1 A;  2DMN A;  4IRI A;  2QQ9 A;  1RUN A;  5FO5 A;  4G7H F;  5M5X J;  1B6A A;  2FUG 2;  4KMU X;  3UNG C;  2XUB A;  2JPC A;  1ZRD A;  2HEO A;  4L9J A;  3HOW J;  1KGS A;  1X1C A;  2E1C A;  4ZDL A;  2PEX A;  4A6D A;  1BI2 A;  1HW2 A;  3FXQ A;  4CA0 A;  3KP5 A;  4I99 C;  2K4J A;  2CH0 A;  3B6C A;  3TL4 X;  2VBX A;  5J1Y A;  2LBF B;  3GTP J;  1HXD A;  1RZ4 A;  2WC2 A;  4L5J A;  5DV5 A;  3T5X A;  1VTN C;  4EVI A;  1WZ2 A;  5E18 F;  3WGG A;  2DOE A;  2A61 A;  1R1V A;  2CW8 A;  1BI0 A;  1ZGW A;  1AA7 A;  5E1X A;  3HDD A;  5J1R A;  2VOP A;  1XGS A;  2PMZ N;  3G73 A;  5CLS A;  2P7C B;  2CV2 A;  4XN3 A;  1TNT A;  3OS1 A;  4ZDO A;  5ED4 A;  3HKZ A;  4IQ4 A;  2QSF X;  4NB5 A;  3V8K A;  1LPQ A;  1U5T A;  2HU9 A;  3CMA I;  2M7A A;  4DW6 A;  3FM5 A;  3BP8 A;  5E8I A;  1D0X A;  3DPT A;  2QM3 A;  5LD2 C;  1LEA A;  4S0H B;  1MNE A;  2JN6 A;  3HHG A;  3JRC A;  1OYY A;  5B5E C;  4MGR A;  4BHP A;  2YR2 A;  5HS7 A;  2AS5 F;  4BYY A;  4ZYG A;  2DYS H;  2WAD A;  2NNN A;  4OIQ F;  3S14 J;  2R4G A;  5AIP A;  2HS5 A;  2XSD C;  4BEH A;  4HV6 A;  4L18 B;  4C2T A;  1P92 A;  2F5V A;  3H9G A;  1WJA A;  3KP3 A;  5LHI A;  1R49 A;  1P2F A;  4MTE A;  1BR2 A;  3H0G J;  3ECH A;  2E35 A;  2IA1 A;  3G1L A;  3GFM A;  4PJ0 C;  5KAI C;  4AVZ A;  1T33 A;  1WI9 A;  5F04 A;  1GVD A;  4ZZL A;  1LDD A;  4FX4 A;  1E0E A;  3KZI C;  3CC2 I;  2HR3 A;  2BXZ A;  4M71 A;  5HLG A;  2XAG A;  5TIS C;  3CP8 A;  4PJJ A;  2XF7 A;  1YX5 A;  2XHK A;  3SZG A;  4V2F A;  2DA5 A;  2EZK A;  5IYB J;  1U5T B;  2ZXW H;  1FLI A;  4XON A;  1HKQ A;  1DGR M;  1JHH A;  3AL0 B;  3WTW C;  2UXN A;  2VXZ A;  3E5U A;  1TQP A;  2CFO A;  2E36 A;  2ISZ A;  1IC8 A;  2P8T A;  3ZQQ A;  1X4P A;  1ON1 A;  3CC4 I;  1W4M A;  1Z1D A;  2J5O A;  2VB6 A;  3HOV J;  2PBI A;  2FX0 A;  3OYG A;  4BNC A;  2VN2 A;  3PQJ A;  2P5K A;  5H6R A;  4BH9 A;  1YIJ I;  3S15 J;  1ZH5 A;  5C44 J;  3IWZ A;  1X2N A;  4BEH B;  5F6F A;  4XRS G;  1S72 I;  2OCE A;  2PJR A;  2LLK A;  1MSE C;  2E1M B;  1UG2 A;  3ASO H;  1D1B A;  1VQM I;  1FP2 A;  3QP5 A;  4DYR A;  3KP7 A;  2F5C A;  3CDL A;  1XG1 A;  3MQ0 A;  4ZYD A;  2GXA A;  2R7W A;  3PQK A;  2EH3 A;  4BU2 A;  4AD9 A;  3F8N A;  3MVP A;  4Y33 A;  4EEF G;  4BL0 B;  5DUI A;  4RBO A;  1UHM A;  2AQE A;  4M72 A;  4QPQ A;  2VKH A;  1MBJ A;  4M6Y A;  2B9S A;  5F1J A;  1FP1 D;  3PFI A;  2COM A;  2VJ4 A;  3OIO A;  4NHJ A;  2HDD A;  1OR7 C;  4YII A;  3BY6 A;  4LK0 F;  1MGT A;  1XSX A;  3COA C;  2KP6 A;  2GQQ A;  1FX7 A;  2MSY A;  1FTZ A;  3S3N A;  3K7A J;  2K9N A;  4BQA A;  1R1U A;  3WU2 C;  3MWM A;  3O8G A;  1Z3Y A;  5EF6 A;  4LLN A;  1EH7 A;  1TWH J;  2V6C A;  3FXL A;  2MAB A;  3HL2 A;  5IYC J;  3K70 D;  1X58 A;  3AG1 H;  3KEQ A;  3TOA A;  1FNN A;  5GPC A;  4E4H A;  2PJR B;  3JRD A;  1A36 A;  3HUG A;  1E17 A;  2ISY A;  4X0G A;  4FT8 A;  3E97 A;  2K9S A;  4A5M A;  2H6C A;  2HQR A;  4KNY A;  4XR6 A;  5E1Z B;  1V5E A;  1Q1H A;  2WY7 Q;  3M8F A;  3DPU A;  3LSM A;  2JRM A;  1OCT C;  3T8T A;  2DFF A;  1SD4 A;  3FHZ A;  2EPF A;  2XB5 A;  2BXY A;  3BG5 A;  2B63 J;  3PUB A;  2ZFU A;  2IP2 A;  4CCN A;  1SMY F;  3OYL A;  3WHC A;  3WTS C;  2F5F A;  2JA2 A;  3V7C A;  1DU6 A;  1DDN A;  2ESH A;  3M3Y J;  1SFU A;  5DM7 F;  2HVR A;  2EQR A;  2V79 A;  2XRO A;  3A0B C;  1FBS A;  3HYI A;  3RIR A;  2K3P A;  3NAU A;  2M2E A;  3R60 A;  2FOW A;  1IN7 A;  2JA5 J;  3RYP A;  4CXF A;  2FBK A;  3HUG B;  2RC4 A;  3ZXS A;  1AHD P;  1LDJ A;  3HJE A;  3FX3 A;  1TTY A;  3H3U A;  2HWV A;  1XS9 A;  4RAZ A;  2JA7 J;  3E5Q A;  3G2B A;  4AWX B;  1UZC A;  3C3W A;  4XSX F;  3DBH B;  4MQV A;  1QPI A;  1HC8 A;  3PL8 A;  4PJN A;  1YHQ I;  2CO5 A;  2KIM A;  2BVL A;  2DOA A;  3MMY B;  2W84 A;  4P9F A;  2L7F P;  2IA2 A;  2STW A;  3MZY A;  1MNM C;  2V7F A;  1W7P A;  5LRR A;  4RM3 A;  4M3D A;  4ANJ A;  2PJP A;  3Q9V A;  4B43 A;  4IF4 A;  2HYJ A;  1X3W B;  1WI3 A;  1B59 A;  4EJW A;  2E2I J;  2EFW A;  2X48 A;  2O6G E;  1UST A;  3OIP A;  2NVU B;  3CO7 C;  4WWC A;  1YOV B;  2IGN A;  2PMU A;  4CO8 A;  2IVM A;  4HF0 A;  3CCQ I;  1I27 A;  2XSJ C;  4U0Y A;  1YJN I;  4G6D A;  5K1Y A;  3D0S A;  2DK8 A;  3VPR A;  3HG9 A;  3EPZ A;  1Z05 A;  2D45 A;  1PP8 F;  3RCO A;  4S05 A;  2EZL A;  5FKM A;  3WOD F;  4O3M A;  4U0W A;  2M4K A;  1R5I D;  4M9Z A;  4D0P A;  1VQP I;  1RC9 A;  2BBY A;  2KZV A;  3L9F A;  3V42 A;  4JK1 X;  2EK5 A;  5LGU A;  4HEA 2;  4BDZ A;  4EM0 B;  2PN6 A;  1N78 A;  3EDP A;  4HF2 A;  5CJ9 A;  5E3N A;  5E3M A;  3KX2 A;  1H89 C;  3VSL A;  3P9I A;  4OIP F;  1NG6 A;  5LGN A;  4IHY A;  4HYE A;  1U6G A;  2WAF A;  4OAY A;  3GBG A;  3DV8 A;  2MH2 A;  1IGN A;  2H27 A;  4HX4 A;  2ZSI B;  3J7Y J;  1W7P B;  3WTU C;  4BGD A;  4AC0 A;  2BYV E;  1ON2 A;  3KP4 A;  4H0E A;  1JJ6 C;  3SDG A;  4CIC A;  3GTG J;  2BHZ A;  4WCG A;  4Y7N J;  1QZZ A;  3D5S C;  2HXI A;  3ZQH A;  4C3H J;  3R0J A;  4HSR A;  2DTZ A;  4M9X A;  3OYE A;  3KE2 A;  4HV5 A;  3S93 A;  1G6N A;  2AQF A;  1KQ9 A;  2WA0 A;  1U5T C;  4XLE A;  3F6V A;  3BR2 A;  1JXS A;  2DOF A;  4BAC A;  1SC7 A;  1ZEL A;  3QRF F;  3IH4 A;  3OL4 A;  3AL0 C;  1T0F A;  5DD8 A;  5LLQ A;  1LFU P;  3FZV A;  1H9G A;  3DTK A;  4XL9 A;  1RPW A;  2X0L A;  1P9Q C;  1KYW A;  2VKE A;  3BJ6 A;  4CCL A;  3E5X A;  4HQM A;  1IRG A;  3SQN A;  1I50 J;  5AON A;  3FXO A;  2A07 F;  2RRE A;  2HDC A;  2DFI A;  2M1B A;  4DJA A;  2RGV A;  4HW0 A;  1HDD C;  5FJ8 J;  2NS8 A;  1VQL I;  3EET A;  5D4R A;  4ENM A;  2RQP A;  1P4X A;  3IRQ A;  3HM5 A;  5JHF A;  1DU0 A;  4ZZD A;  3KPH A;  2M3A A;  4GYG A;  1J9I A;  5BPI A;  1TWA J;  1LFB A;  5LEK A;  1DPU A;  1R7J A;  3E1S A;  3F23 A;  2Y0S N;  4Q48 A;  4U88 A;  2VOD A;  2MC4 A;  4UVA A;  5GAH J;  1O3Q A;  1V5F A;  4CZZ A;  2BZT A;  2VBY A;  2HDW A;  1I1G A;  2VON A;  2KLO A;  3OYM A;  1YJ9 I;  1VQ5 I;  3ABK H;  2VT2 A;  2MLK A;  4A3M J;  3GLX A;  1D1A A;  3M1C A;  2DDB A;  2XKP A;  4HLY A;  4E7J A;  2LKS A;  4HNV A;  3ZGK A;  1OCO H;  3CCJ I;  1KU3 A;  3A2K A;  3R0A A;  2A3S A;  2NS0 A;  4E7S A;  4RS8 A;  4BHB A;  2JRT A;  5KCM A;  1TQI A;  3S1N J;  4XBF A;  4IRG A;  3HIF A;  3OYJ A;  1IN6 A;  3W3C A;  1Y1W J;  1K7A A;  2D1H A;  1HF0 A;  3FK7 A;  1FIP A;  1W0T A;  2J5P A;  3M8J A;  3G6E I;  3I59 A;  2TDX A;  1QVT A;  1UCR A;  2LMD A;  2H6B A;  2XAH A;  3REO A;  1R4N B;  1EH8 A;  2YPR A;  3KCC A;  5ILS A;  4PUS A;  5E79 C;  1F4K A;  2CUZ A;  1UB9 A;  2IEK A;  1D0Z A;  1GUU A;  2JK3 A;  2RAE A;  4OAZ A;  3K2A A;  2V26 A;  2M4G A;  5F0C A;  2Z1D A;  3U21 A;  3ELK A;  4RB3 C;  1QZE A;  2M0C A;  4Z6Y A;  3MCZ A;  2N8G A;  4MFE A;  2EFN A;  2ZJQ F;  1JGS A;  1IXC A;  4RGU A;  1LQ1 A;  1QGP A;  4LIV A;  3I5U A;  2LDU A;  4MLO A;  1B4A A;  4HAM A;  3HBL A;  3NRV A;  2O3F A;  3PJR A;  4UUS A;  3KIO A;  2DMQ A;  2OCC H;  4DBR A;  5GAG J;  1XGM A;  2VL8 A;  5DD4 A;  2Z3Y A;  5M5W J;  5F08 A;  2DFE A;  3MEX A;  1VQN I;  1HA8 A;  4IRH A;  3JRG A;  3CDH A;  1ONV A;  1X1D A;  1MDM A;  1AWC A;  4BXF A;  1K4S A;  1BA5 A;  3I59 B;  1LVK A;  4B3A A;  3VYT B;  4HZF A;  3ZOB A;  3BG6 A;  1KU9 A;  1ZGJ A;  4WXC A;  4GDF A;  1PDN C;  4OIR F;  3ASN H;  1EA3 A;  4D5F A;  1YIT I;  2LG4 A;  4H4K C;  1W1W E;  4LG0 A;  3L1P A;  1TC3 C;  2NVT J;  2D2W A;  5CQE A;  2X1D A;  2ZO4 A;  4DIQ A;  1E2X A;  5FLX Z;  4A3E J;  4R79 A;  2DT7 B;  1VQO I;  4IZZ A;  3CZ6 A;  2O8X A;  2GIV A;  1RET A;  4B44 A;  2O8K A;  1BIB A;  2LR8 A;  4BY7 J;  2OTJ I;  4XK4 A;  1MMS A;  4XKW A;  4BQQ A;  3V4G A;  4PCQ A;  3BTI A;  2IA0 A;  2R7D A;  3WTZ A;  4N4N B;  3I55 I;  4M3G A;  3VEP A;  1HBX G;  4C9Y A;  2H8W A;  2ME6 A;  4ENK A;  3ZQI A;  2OD5 A;  2XV4 S;  3ZMV A;  4FCY A;  4Q5S F;  2KIF A;  2VJJ A;  2W4S A;  4KIC A;  4NC7 A;  5K7Z A;  4UUS B;  1A35 A;  3W2W A;  1TBX A;  1P4A A;  2OU2 A;  4OMZ A;  2VLA A;  3CUO A;  1ZHF A;  2GZW A;  5CVJ A;  4BAY A;  1N77 A;  4WK8 F;  1MDM B;  3OR2 C;  3OY9 A;  2DJI A;  5D5V B;  3Q9S A;  1ETX A;  2BHY A;  4NC6 A;  5D6E A;  5JI6 A;  4EJO A;  4CZC A;  5EG0 A;  1WVR A;  4XLF A;  2EIM H;  3F9K A;  3QYB A;  4GYI A;  3TP0 A;  2O9L A;  2E1N A;  1FSE A;  1PYV A;  3LFU A;  2TCT A;  1Q1V A;  4CDG A;  4LG0 B;  1FBQ A;  2LTP A;  1K78 A;  4PGG A;  1W36 D;  3KYD B;  3M1E A;  4DGW B;  4IVN A;  2KQR A;  3BRO A;  4ETS A;  2KRC A;  2V9K A;  1OCR H;  3HC7 A;  3WU1 B;  4BJ5 C;  2DU9 A;  1YTY A;  2DT5 A;  5F0H A;  4KFC A;  1STZ A;  2CW0 F;  4FX0 A;  4K2E A;  1ZR2 A;  2X85 A;  4LG3 A;  1YO5 C;  2L5Q A;  3H5R A;  1IN5 A;  3TW7 A;  3TOB A;  3TO6 A;  4GCV A;  2K9Q A;  1U78 A;  2BV6 A;  4I2O A;  2Y48 A;  4OU0 A;  4AIK A;  4BXX J;  3JR9 A;  2QQA A;  2HOE A;  1QPM A;  2EIL H;  3I3L A;  4PGH A;  5DCM A;  1W5T A;  4FIS A;  5M3M J;  1ZQ3 P;  4GXO A;  5L3G A;  3JRB A;  1NH3 A;  3S2H J;  1VF9 A;  1JJ8 C;  2ZC2 A;  1DP7 P;  2XF6 A;  4XRM A;  2P5V A;  5HLH A;  4JOM A;  4AU7 A;  3BPV A;  2XGD A;  2VBZ A;  1XGO A;  1T95 A;  1R4M B;  2VJI A;  1R9T J;  2YUS A;  3J7Z I;  3UKG A;  2GOX B;  2DLL A;  4IJA A;  4DYC A;  3HOZ J;  3H5A A;  1MKM A;  3CCE I;  1K78 B;  3LST A;  1UG0 A;  4D9J A;  2XDV A;  1ERD A;  4L0Y B;  2ZNY A;  3EUK L;  4NC8 A;  1UHS A;  1ZRC A;  2FEZ A;  1FMW A;  4FHT A;  1S7O A;  3RSN A;  2XIG A;  5LFA A;  2FXA A;  4CUG A;  4ENN A;  2CS3 A;  4EJT A;  5FKL A;  4B8X A;  4O5V A;  3D5L A;  2LNB A;  4CCK A;  3OYB A;  2D5V A;  4NQW A;  5DCM B;  1LKX A;  5KHD A;  1T0F C;  4P1W A;  4FTH A;  2XKO A;  1HSJ A;  3EUH A;  3M8E A;  3HTS B;  2ZBK A;  2ID3 A;  3O6B B;  1ODD A;  4EM1 A;  4Q4Z F;  3F21 A;  5EEH A;  2FF4 A;  4BQO A;  2DAO A;  3BT9 A;  1D8K A;  1ZLK A;  4CGZ A;  5D5X B;  2JA6 J;  4IEJ A;  2VUM J;  3S32 A;  2L0K A;  3F72 A;  3CQZ J;  2BGC A;  3IH2 A;  3JCU C;  3CMM A;  2GXG A;  2LRE A;  1WQ2 A;  4U7B A;  1MMA A;  3SYT A;  1J2X A;  2DT6 A;  1ETY A;  3BZC A;  2Y75 A;  2VAS A;  3C1D A;  2QEX I;  4LOC A;  3DEE A;  3O3K A;  2LRD A;  3IAS 2;  2VXD A;  2ZB9 A;  4G7Z F;  1V54 H;  2HKX A;  4DZP A;  4G6T B;  2WWY A;  3PFY A;  3Q0W A;  3BPX A;  3OIQ A;  3JW4 A;  1S3J A;  3ABL H;  3K69 A;  1OKR A;  3RQ4 A;  3ABU A;  1QHH D;  4EM2 A;  4NQW B;  1POG A;  2XRN A;  1ZRE A;  3AG2 H;  2QZ8 A;  1I1S A;  1OMI A;  1OPC A;  3EUA A;  4LJZ F;  3WE2 A;  5DYM A;  4BDY A;  2FQ3 A;  2VC0 A;  3DBR B;  3ERE D;  4E70 A;  3I4M J;  5IT3 A;  2NRA C;  4PSW A;  3U1K A;  3G3Z A;  2EB7 A;  5HVQ C;  3FMR A;  2NS7 A;  3E6B A;  1R58 A;  4C3J J;  3HKZ N;  5ILV A;  1YW7 A;  5IP6 A;  3MD2 A;  4E7H A;  2GA2 A;  2K7L A;  2GIZ A;  5HLI A;  3QAH A;  3U1D A;  2AXT C;  3GTK J;  4ON0 A;  1UAA A;  4G12 A;  4RLF A;  2EIN H;  3OOP A;  3OMY A;  1O4X A;  3RYR A;  2OPT A;  2KPM A;  4F91 B;  3CCU I;  3RKQ A;  4MO7 A;  1ITY A;  2MH9 A;  2IPQ X;  1F43 A;  1WKM A;  5FKK A;  3JAM K;  3DFG A;  3J80 Z;  1RRJ A;  4D1Q A;  4QSH A;  1V3F A;  2LY2 A;  3FIS A;  3RKY A;  3HOX J;  1AKH A;  3S8P A;  4A6E A;  1QU3 A;  2R0Q C;  1LJ9 A;  4IQJ A;  2OZU A;  2IS4 A;  3K2Z A;  3ESW B;  3MAJ A;  1K83 J;  4IO9 F;  4BQN A;  2AHQ A;  3ABM H;  3KLO A;  2ZKZ A;  4I98 B;  1JT0 A;  2ETH A;  5ICE A;  1Y39 A;  1KYZ A;  4BKX A;  2A5W A;  3WTY C;  5J47 A;  3H9Q A;  1FOW A;  1W0U A;  3DU5 A;  2R7R A;  1MMN A;  5JVT A;  3DKX A;  2NVY J;  3CLO A;  2V1N A;  5L3D A;  1ZKG A;  3ZQ7 A;  2FU4 A;  4BUP A;  2LF8 A;  5KK1 A;  1V5G A;  3NEU A;  2E71 A;  2V4J C;  3OYC A;  5DCF A;  2FSW A;  4GO1 A;  1GHC A;  4A3D J;  3QOP A;  2A05 A;  5ICF A;  1G8X A;  5BQT A;  2IGM A;  2CV0 A;  1ENH A;  5JLX A;  2EV0 A;  2Z9O A;  4CYC A;  4I76 A;  3P9C A;  4B48 A;  4YFN F;  1V55 H;  2CQQ A;  2NVQ J;  3DBL B;  2EBI A;  1OYW A;  1OQY A;  4XRS A;  3QP6 A;  4RAF A;  3NWS A;  1ZGA A;  4X6A J;  2JVG A;  4DYQ A;  1UJ8 A;  3DXJ F;  1AKH B;  1QRY A;  5ERI A;  5KAF C;  2EFQ A;  1ORK A;  2KIS A;  2JMW A;  2XC7 A;  2IW5 A;  1SAN A;  3S1R J;  2RNJ A;  2QEN A;  2XAQ A;  4G8X A;  1XB4 A;  5D8L B;  3FIW A;  1HOM A;  2YX7 A;  2ZCW A;  4KN4 X;  2NAZ A;  3O8H A;  4B1R A;  4U87 A;  2L4A A;  3CJQ B;  3MZ8 A;  2KFD A;  3SXY A;  2RQQ A;  5E8G A;  2CV1 A;  3VOD A;  3GTO J;  3ISP A;  1HW1 A;  1PVE A;  3K6G A;  3JRH A;  1SVO A;  2MFZ A;  2WAQ A;  5GAE J;  2CG4 A;  1G4D A;  1FOX A;  4RM2 A;  3ZN1 A;  2K86 A;  3BLY A;  3K4K A;  2JSP A;  4XRF A;  4MEY F;  4WX9 A;  2FNA A;  4RLQ A;  5IOY A;  3DKW A;  4PJM A;  4F3Q A;  5J1U A;  4F7Z A;  2DI3 A;  4A12 A;  2QA4 I;  4PFP A;  4ZDP A;  2E5Z A;  2M87 A;  1WH5 A;  5D6F A;  3FMQ A;  2G7H A;  2V1X A;  1XX5 A;  2TRT A;  2ELK A;  4C2M J;  5TJJ A;  1K6Y A;  4TV7 A;  2DA1 A;  1KZH A;  3L2C A;  2HOS A;  3L09 A;  2XGE A;  3GX4 X;  4FAS D;  2DXI A;  1A31 A;  1XSV A;  1WJF A;  2HQ5 A;  3GFJ A;  1FSH A;  4LFU A;  2X1C A;  4N9I A;  3RKW A;  3AAF A;  4FET A;  3HSE A;  3CCR I;  2NVX J;  3K4L A;  2G7U A;  3HRM A;  3TO9 A;  4NDL A;  1Z91 A;  3JAM Z;  2R7Z J;  2L3D A;  2VKD A;  5JFR A;  3RDI A;  3FM3 A;  3M7G A;  2H09 A;  2PMH A;  5FRN A;  5DS9 A;  1BIA A;  4XOP A;  3TMO A;  4MHG A;  2R7O A;  3WTV C;  4DOZ A;  5D5U B;  3DLL F;  3FKJ A;  3ZP5 A;  4BXU A;  3JSP A;  4BJT A;  5DUK A;  3BG9 A;  2IAI A;  4KA4 A;  1MMG A;  3E6C C;  3HSF A;  2Z99 A;  3NAR A;  4KJZ A;  2VT3 A;  5DM6 F;  3AG3 H;  3VYS B;  5CYV A;  2K27 A;  4BE1 A;  1KU7 A;  4S04 A;  5C4J J;  1D3Y A;  4I6Z A;  1WJB A;  2P81 A;  2HYF A;  4AIH A;  1IJW C;  1IZ1 A;  5HS8 A;  5CVI A;  1E3P A;  2OQG A;  2ZNZ A;  4LD5 A;  3CJT B;  5JHU A;  4BHC A;  1TW3 A;  5D5W B;  4WXH A;  1OIS A;  6PAX A;  4D7N A;  3OV8 A;  1JUM A;  4V19 K;  1QZY A;  2DA6 A;  4HF1 A;  4IPA A;  3DEW A;  4HX7 A;  3HGG A;  4AVP A;  3CCM I;  1IXR C;  2FBH A;  3B73 A;  2IT0 A;  4A3J J;  2VI6 A;  1A04 A;  2CUE A;  4EJU A;  4KYW A;  1BJZ A;  5FD6 A;  2BW3 A;  2ICW G;  2LK2 A;  1MJ9 A;  3GCM A;  3Q5F A;  3QQA A;  1F9N A;  2ZFW A;  1TQM A;  3TGN A;  4YIR X;  2GOM A;  1SD7 A;  4YRV A;  3EUH C;  1ACI A;  4RGR A;  4EJV A;  1SAX A;  2F6C A;  2L9N A;  5CVV A;  4G94 A;  1J0R A;  2BEO A;  3LSJ A;  4YFK F;  1X1A A;  4ZC3 A;  1B72 A;  1BJA A;  3CLQ A;  3LAP A;  2XAS A;  3RI4 A;  5LHH A;  1REP C;  2RV8 A;  3ROU A;  4HPQ A;  3P7N A;  4RB1 A;  1WJE A;  1RI7 A;  2L7K A;  1NK3 P;  1XC5 A;  3IP4 B;  4KIB A;  2HVQ A;  4WXD A;  4EV0 A;  2L01 A;  3L7W A;  5GPA A;  4IHW A;  2IS6 A;  3DWL E;  4D7M A;  1X4O A;  2ZME A;  3H0D A;  3BR3 A;  3Q0V A;  4WF2 A;  1O57 A;  4L0Z B;  1XCB A;  3L2R A;  2W25 A;  2BW3 B;  3FXJ A;  1QVU A;  1BC8 C;  5E1W A;  4L5E A;  2PI0 A;  1YG2 A;  1D0Y A;  2O7O A;  1TWC J;  4ZTF A;  4AYB N;  3GZ6 A;  1R22 A;  5EGO A;  1S7A A;  4RGS A;  3TDZ C;  2L7Z A;  3I53 A;  2GBY A;  3F22 A;  1B72 B;  2MC3 A;  2X6X A;  1OFC X;  1QQI A;  3CCV I;  3S2D J;  4LMY A;  2Y9Z A;  2VPR A;  2MD0 A;  1U8B A;  2CUJ A;  4I0B A;  2ZJP F;  3C2H A;  3QPH A;  2JTV A;  2XPU A;  3BG7 A;  1U9O A;  2O03 A;  2OV7 A;  2DOD A;  2UUZ A;  3A03 A;  3ULQ B;  3B02 A;  4M74 A;  2K85 A;  4DQ2 A;  4BE2 A;  2JWT A;  2DN0 A;  4OWR B;  2RN7 A;  2ZME B;  3CUQ A;  2FMY A;  1EV7 A;  1BI3 A;  3OWT A;  4XLC A;  2K9L A;  5LEJ A;  1RR8 C;  2GXB A;  2F4O B;  1OCC H;  5IP9 J;  5LBQ A;  2QQ8 A;  2I8D A;  2DPU A;  1T56 A;  3MKL A;  3S2W A;  3S3M A;  3OYA A;  4LB5 A;  5FLX K;  4ZYE A;  4M6V A;  3I56 I;  1EJ9 A;  4MIM A;  3BR0 A;  2KHM A;  4JX5 A;  2PLY A;  1B1B A;  3M4O J;  5LRS A;  3PSF A;  2DMU A;  2E1O A;  5EGO B;  1EKE A;  3SFZ A;  2R5Y A;  1FEX A;  1MJB A;  1WPK A;  2EJR A;  2VC1 A;  3DP7 A;  4N4O B;  5C3E J;  1Y0N A;  1Z6R A;  2V1U A;  3CCL I;  3BR5 A;  2MYS A;  5FD5 A;  3OS0 A;  4KMF A;  1Z7L A;  2Y69 H;  3LA2 A;  1H88 C;  3LSR A;  3WGH A;  5B3S H;  2GM4 A;  2HYG D;  1QBJ A;  5E17 F;  4KIT B;  1ZLJ A;  1WJD A;  2E5N A;  1Z67 A;  3CJR B;  3PO3 J;  4LK1 F;  3ERM A;  2QKL B;  1HLV A;  3GYH X;  5FFX A;  2DCE A;  2I10 A;  3ZQG A;  5ILU A;  3H1C A;  5BMZ A;  1T39 A;  3CUQ B;  2R5Z A;  1E3H A;  2H94 A;  3LOC A;  1RKW A;  4IOC F;  3E0J B;  1QO0 D;  1LVA A;  2M8G X;  1O3R A;  3HPH A;  3IAM 2;  4RAG A;  1JKR C;  3K9T A;  1S9H A;  5K7F A;  2DA3 A;  1F5T A;  1YW9 A;  4I09 A;  3F6O A;  4G9Y A;  4HQE A;  3BQY A;  2JSC A;  5CQG A;  4XMY A;  2R5Y B;  2F48 A;  4FQG A;  3JSO A;  2HFH A;  2FQ4 A;  3ZR8 X;  3OYF A;  4P96 A;  5K7H A;  1G3T A;  1XMA A;  3KEY A;  1MMD A;  3J7A O;  4D5C A;  4JP0 A;  3WG9 A;  3TP3 A;  2QWW A;  2WB1 A;  4HRI A;  3QWL A;  2F4M B;  1WWX A;  2F2E A;  1FJL A;  2YX4 A;  3VB2 A;  3DCF A;  2NYX A;  1IRX A;  1I6H J;  3W6K B;  1FOK A;  1DP3 A;  2LVS A;  2XAF A;  3L2V A;  2X9D A;  3HRT A;  1R5H A;  3LWF A;  2EV5 A;  2XAJ A;  3T0Y A;  2A6E F;  4HLX A;  2R5Z B;  3HXL A;  3WE3 A;  4IKF A;  1MBG A;  2HPI A;  2W24 A;  5CKT A;  1ZG5 A;  3V8J A;  1CQT A;  1B9M A;  2VQC A;  4A0Z A;  1D5V A;  3BR1 A;  4LLL A;  2COB A;  1JKQ C;  4EMS A;  4M3E A;  3QPS A;  1TT5 B;  1O3T A;  1VQ7 I;  2BOL A;  2OZ6 A;  1AU7 A;  4U0V A;  1ZRF A;  4ITV A;  3CO6 C;  4UUV A;  2LFB A;  4N0B A;  2X4H A;  2LH9 A;  1MIJ A;  1J7K A;  2BY3 A;  3KFW X;  5EZG A;  1ZG3 A;  4UNO A;  2CQK A;  5GAD J;  3WG7 H;  1FYM A;  2VKV A;  3NQO A;  1SFO J;  1T08 B;  2Q1Z B;  4RA2 A;  2EZH A;  2CQ7 A;  4L9N A;  2DQL A;  5B1B H;  3G1M A;  4EQQ A;  3LFK A;  1K79 A;  3SEQ A;  1KON A;  1VFC A;  3GWZ A;  4C30 A;  3K70 C;  4RB2 C;  2L7M P;  4FE4 A;  1Z77 A;  3S16 J;  3TW6 A;  1USS A;  1S5L C;  3BZK A;  2NNY A;  4E7K A;  4W1U A;  3RKX A;  1K61 A;  3FBN B; 
#chains in the Genus database with same CATH homology
 2DK5 A;  1FYK A;  2QLZ A;  3GO5 A;  3KZZ A;  2Q2E A;  3GXO A;  3ZMZ A;  5AIQ A;  2HGC A;  3BOQ A;  2C6Y A;  2KIU A;  3WTX C;  1YS7 A;  4KN7 X;  1O3S A;  3MZH A;  3HRU A;  3K0L A;  4QLC U;  1TW2 A;  5FFZ A;  2EA4 A;  3WTT C;  4A0X A;  1GXP A;  3IHU A;  4KIG A;  5K5O A;  5ICC A;  2EFP A;  5L3C A;  3W6J B;  4M9S A;  4XLN F;  1WRJ A;  1GVJ A;  1FBU A;  4UV9 A;  4YG2 F;  2OAZ A;  3H3Z A;  1YQA A;  5F64 A;  3FWE A;  4UVC A;  1YYV A;  1ULY A;  1O7L A;  2CSO A;  1MD0 A;  3J80 K;  4OIN F;  2LSO A;  1IRF A;  2V9V A;  3MFK A;  2FA5 A;  4EGY A;  4P5O A;  4PZJ A;  4UV8 A;  2Q8K A;  2GAU A;  1IF1 A;  1YLF A;  3F8C A;  2L4M A;  2UXX A;  3F8F A;  1BC7 C;  3ZMU A;  1PUE E;  5HDK A;  4A5N A;  4M6X A;  1AOY A;  3CUQ C;  3ZMS A;  1P6R A;  3QPT A;  4I02 A;  3TDU C;  3V8L A;  4MQ9 F;  1XCV A;  2B0L A;  4LB6 B;  4ZH4 F;  1BN5 A;  2CYY A;  1MJA A;  3HTU A;  1FZP B;  3RJP A;  3FMS A;  2P4W A;  1ZYR F;  5H6Q A;  2A6H F;  1B9N A;  4XLP F;  2DO7 A;  2DQR A;  4RGX A;  1T98 A;  1R5G A;  2R7F A;  4MTD A;  3GUD A;  3RPU A;  1FY7 A;  2FNP A;  4JQF A;  2P6S A;  3RPQ A;  5DDG A;  2HKO A;  4MEX F;  3DF8 A;  2FOK A;  4OIO F;  1T6S A;  1WSU A;  4UXN A;  5HDN A;  1XN7 A;  1IN4 A;  1RNL A;  2JZY A;  2QYO A;  1IXS B;  4P9U A;  2EFO A;  2XGX A;  3KZY A;  1HKS A;  3K1M A;  2OQR A;  1R36 A;  3J81 K;  1C0W A;  1Z6T A;  3V7S A;  2XVC A;  3HOS A;  4HDU A;  3KP2 A;  3EQL F;  1SD6 A;  2KJC A;  2HTJ A;  2JT1 A;  3K1N A;  2UZK A;  2MD5 A;  3T1B A;  1O7F A;  4IXA A;  1JE8 A;  3CTA A;  4UVB A;  5A2Q Z;  4HBL A;  3HOT A;  1K6O A;  1P4W A;  3KEO A;  4G7O F;  2BE5 F;  1HW5 A;  1XGN A;  2OBP A;  3H92 A;  3WGI A;  4AIJ A;  2G9W A;  4Y15 A;  1XDS A;  2MA3 A;  2WV0 A;  1GXQ A;  3VOE A;  5J6X A;  2Q0O A;  4ZYH A;  1J75 A;  3I4P A;  4YFX F;  1LEB A;  1NHA A;  2LKP A;  4A0Y A;  2O0Y A;  1BM9 A;  5H20 A;  3TKY A;  1J5Y A;  1W5S A;  1XDU A;  2A69 F;  1SFE A;  4CYD A;  3I64 A;  2STT A;  2P6T A;  5DEQ A;  1R1T A;  4QWQ A;  4HX8 A;  3R61 A;  1JHF A;  1LB2 A;  3BWG A;  1YFH A;  1R23 A;  2RKH A;  1D8J A;  2RVC A;  2K02 A;  1ZAO A;  5L3E A;  4KT5 C;  5KVR A;  2MBF A;  5HDG A;  3GZ5 A;  2VBW A;  1T2K A;  3J81 Z;  4KDP A;  2JPB A;  5HS9 A;  4PDK A;  4Y13 A;  1T38 A;  3LA7 A;  4RAY A;  2EA2 A;  3EYI A;  5FB2 A;  3FXU A;  1KU2 A;  2M45 A;  2YSR A;  5BPD A;  2QUF A;  1W7P D;  2VE8 A;  1HQC A;  4ENJ A;  4ASN A;  1RUO A;  4M73 A;  5E20 A;  2Z33 A;  4U7D A;  2K4B A;  1Z7U A;  4HA8 A;  4G6Q A;  3N4M A;  3GW2 A;  3FF5 A;  3KP6 A;  1S6L A;  4GGG A;  1S29 A;  1H0M A;  2F5D A;  3BJA A;  3U9G A;  1X3U A;  3DEU A;  1IN8 A;  1FPQ A;  3JTH A;  3LA3 A;  4I7H A;  2RDP A;  3BZ6 A;  1SD5 A;  3GFL A;  2L02 A;  4HOB A;  3IC7 A;  2Y0M A;  2PG4 A;  2E7X A;  4DNC A;  1YS6 A;  1L0O C;  1KQ0 A;  1I6X A;  1U8R A;  3DPL C;  5D8K B;  1F1Z A;  4P55 A;  2IJL A;  1FC3 A;  4O6J A;  2D1V A;  1FWZ A;  2QVO A;  5L3F A;  3LAJ A;  2CFX A;  2LF7 A;  1XD7 A;  4XSZ F;  2QBY A;  4B09 A;  1FYL A;  1G3S A;  3F3X A;  2FML A;  1V4R A;  2R3S A;  4L9T A;  4ESB A;  1S8N A;  4Z2Y A;  4R1H A;  4UHT A;  2ACJ A;  2DTR A;  1UHW A;  1L3L A;  4HDV A;  3E6M A;  2KKO A;  4KUM A;  3I71 A;  2EV6 A;  3IKV A;  1HKT A;  1R00 A;  1H9T A;  2FRH A;  5TRD A;  4L9V A;  1LNW A;  3O2P E;  4I0A A;  3KLN A;  4JBA A;  2QBY B;  1EH6 A;  3F8M A;  2PQ8 A;  3LQR A;  5L3B A;  4Y17 A;  3QU3 A;  3SZP A;  2UWM A;  1XSD A;  2P7V B;  3DQV C;  2IRF G;  3T8R A;  2YU3 A;  2CWE A;  3QU6 A;  3C18 A;  2VOO A;  3VFZ A;  4LGW A;  3IKT A;  1MZB A;  1IAW A;  2VE9 A;  3I58 A;  3IL2 A;  4CHU A;  1I5Z A;  1TLH B;  3GF2 A;  4ESJ A;  5CVR A;  3HRS A;  3I0T A;  3ZN0 A;  3ML6 A;  3SZT A;  3C7J A;  2O61 A;  2CGP A;  5IT9 K;  2FBI A;  5EEG A;  3F8B A;  2ESN A;  1DPR A;  2DPD A;  1Y0U A;  3U2R A;  3WU0 A;  3JTG A;  2F5E A;  4RB0 A;  1XMK A;  1ZN2 A;  4KIF A;  3L00 A;  3FXR A;  3I54 A;  2MLG A;  3K1P A;  2M8E A;  5J8F A;  1HST A;  1J59 A;  3LQQ A;  3N97 A;  1ZG1 A;  4OOI A;  2EWN A;  3CJN A;  1KQ8 A;  1BBY A;  3V7R A;  4YIF A;  1PP7 U;  1YIO A;  4N9H A;  5K5Q A;  2GA1 A;  1QNT A;  4R8H A;  5BS6 A;  2GWR A;  2V1D A;  2ZXJ A;  3GEZ A;  2P5L C;  2DBB A;  3SHF A;  5CVU A;  4LLG F;  1UFM A;  5LGT A;  1G3W A;  3ECO A;  3IWF A;  5J8C A;  1RIO H;  1IUY A;  5HOO A;  1SFX A;  2QQB A;  4A2U A;  3P9K A;  4L5I A;  1CF7 A;  1OR7 A;  2HZT A;  2Z5U A;  3HSR A;  2AXL A;  4IHS A;  1G3Y A;  2M30 A;  2KJB A;  2A5Y B;  1IW7 F;  1TNS A;  2M5W A;  5IT9 Z;  2PFB A;  1FT9 A;  1ZAR A;  1OYI A;  2L54 A;  3GVA A;  5F1R A;  3HHH A;  1SMT A;  2ELH A;  2FE3 A;  5FGM A;  3BDD A;  1CF7 B;  3ZMT A;  2E7W A;  1U3E M;  3M9A A;  3GFI A;  3ABT A;  1CGP A;  1U2W A;  4Q47 A;  3TQN A;  1DUX C;  2W57 A;  4IHT A;  4ESF A;  5LHG A;  2ZJ2 A;  3ZMD A;  2KRF A;  2HTS A;  3BJO A;  4EGZ A;  2A68 F;  3TO7 A;  5JR3 A;  4MNU A;  1BOA A;  3IRR A;  2DW4 A;  5A2Q K;  5K5R A;  2ADU A;  1Z9C A;  1BI1 A;  3KET A;  2W85 A;  1YW8 A;  3R6S A;  3E6D A;  3ZPL A;  1KA8 A;  4I01 A;  5BOX A;  3E3V A;  3EYY A;  1LDK B;  4OMY A;  2HQN A;  3R4K A;  2OA4 A;  2WTE A;  5D4S A;  5ICG A;  3RTR A;  4IRI A;  2QQ9 A;  1RUN A;  5FO5 A;  4G7H F;  1B6A A;  4KMU X;  2XUB A;  2JPC A;  1ZRD A;  2HEO A;  4L9J A;  1KGS A;  2E1C A;  2PEX A;  4A6D A;  1BI2 A;  1HW2 A;  3FXQ A;  3KP5 A;  2K4J A;  2VBX A;  1HXD A;  1RZ4 A;  2WC2 A;  4L5J A;  5DV5 A;  3T5X A;  1VTN C;  4EVI A;  5E18 F;  3WGG A;  2A61 A;  1R1V A;  1BI0 A;  2VOP A;  5E1X A;  1XGS A;  3G73 A;  5CLS A;  2P7C B;  1TNT A;  5ED4 A;  4NB5 A;  3V8K A;  1U5T A;  3FM5 A;  3BP8 A;  5E8I A;  3DPT A;  2QM3 A;  1LEA A;  3HHG A;  1OYY A;  4MGR A;  4BHP A;  2YR2 A;  5HS7 A;  2AS5 F;  4BYY A;  4ZYG A;  2NNN A;  4OIQ F;  5AIP A;  2HS5 A;  4HV6 A;  4L18 B;  1P92 A;  3KP3 A;  5LHI A;  1P2F A;  4MTE A;  3ECH A;  2IA1 A;  3GFM A;  1WI9 A;  4ZZL A;  4FX4 A;  1LDD A;  2HR3 A;  4M71 A;  5HLG A;  2XAG A;  2XHK A;  1U5T B;  1FLI A;  1HKQ A;  1JHH A;  3WTW C;  2UXN A;  2VXZ A;  3E5U A;  1TQP A;  2ISZ A;  2P8T A;  1ON1 A;  1W4M A;  1Z1D A;  2J5O A;  2PBI A;  4BNC A;  2VN2 A;  3PQJ A;  4BH9 A;  2P5K A;  5H6R A;  1ZH5 A;  3IWZ A;  5F6F A;  1FP2 A;  3QP5 A;  3KP7 A;  2F5C A;  3MQ0 A;  4ZYD A;  3PQK A;  4AD9 A;  3F8N A;  5DUI A;  1UHM A;  4M72 A;  4M6Y A;  1FP1 D;  3PFI A;  2COM A;  4NHJ A;  4YII A;  3BY6 A;  4LK0 F;  1MGT A;  1XSX A;  3COA C;  2GQQ A;  1FX7 A;  4BQA A;  1R1U A;  3MWM A;  4LLN A;  1EH7 A;  2V6C A;  3KEQ A;  3TOA A;  1FNN A;  3HUG A;  1E17 A;  2ISY A;  4FT8 A;  3E97 A;  4A5M A;  2H6C A;  2HQR A;  4KNY A;  5E1Z B;  1Q1H A;  3M8F A;  3T8T A;  1SD4 A;  3FHZ A;  2IP2 A;  1SMY F;  3WTS C;  2F5F A;  3V7C A;  1DDN A;  2ESH A;  1SFU A;  2V79 A;  2XRO A;  1FBS A;  3HYI A;  3RIR A;  3R60 A;  1IN7 A;  3RYP A;  4CXF A;  2FBK A;  2RC4 A;  1LDJ A;  3FX3 A;  1TTY A;  3H3U A;  2HWV A;  4RAZ A;  3E5Q A;  4AWX B;  3C3W A;  4XSX F;  4MQV A;  2CO5 A;  2KIM A;  2W84 A;  4P9F A;  2IA2 A;  2STW A;  3MZY A;  1W7P A;  5LRR A;  2PJP A;  3Q9V A;  4IF4 A;  4EJW A;  1B59 A;  2EFW A;  2O6G E;  1UST A;  3CO7 C;  4WWC A;  2PMU A;  4CO8 A;  2IVM A;  4HF0 A;  1I27 A;  4U0Y A;  4G6D A;  5K1Y A;  3D0S A;  2DK8 A;  1Z05 A;  2D45 A;  1PP8 F;  4S05 A;  3WOD F;  4O3M A;  4U0W A;  4M9Z A;  4D0P A;  2BBY A;  3L9F A;  5LGU A;  4JK1 X;  2EK5 A;  4EM0 B;  2PN6 A;  3EDP A;  4HF2 A;  5CJ9 A;  3P9I A;  4OIP F;  5LGN A;  4HYE A;  1U6G A;  3DV8 A;  2MH2 A;  2H27 A;  4HX4 A;  1W7P B;  3WTU C;  2BYV E;  1ON2 A;  3KP4 A;  4H0E A;  4CIC A;  4WCG A;  1QZZ A;  3R0J A;  4M9X A;  3KE2 A;  4HV5 A;  1G6N A;  1KQ9 A;  1U5T C;  3F6V A;  1JXS A;  3QRF F;  1T0F A;  5DD8 A;  5LLQ A;  3FZV A;  1H9G A;  2X0L A;  1KYW A;  3BJ6 A;  3E5X A;  4HQM A;  1IRG A;  3SQN A;  5AON A;  2A07 F;  2HDC A;  2DFI A;  2M1B A;  2RGV A;  4HW0 A;  3EET A;  5D4R A;  4ENM A;  2RQP A;  1P4X A;  3IRQ A;  4ZZD A;  4GYG A;  1J9I A;  5BPI A;  5LEK A;  1DPU A;  1R7J A;  3F23 A;  4Q48 A;  4U88 A;  2VOD A;  4UVA A;  1O3Q A;  4CZZ A;  2VBY A;  1I1G A;  2VON A;  2VT2 A;  2MLK A;  3GLX A;  2XKP A;  4HLY A;  1KU3 A;  3R0A A;  2A3S A;  2NS0 A;  4RS8 A;  4BHB A;  2JRT A;  1TQI A;  4XBF A;  4IRG A;  3HIF A;  1IN6 A;  1K7A A;  2D1H A;  2J5P A;  3I59 A;  2TDX A;  1UCR A;  2H6B A;  2XAH A;  3REO A;  1EH8 A;  2YPR A;  3KCC A;  5ILS A;  1F4K A;  1UB9 A;  3ELK A;  4RB3 C;  3MCZ A;  2EFN A;  1JGS A;  1IXC A;  4RGU A;  1LQ1 A;  1QGP A;  3I5U A;  2LDU A;  1B4A A;  4HAM A;  3NRV A;  2O3F A;  1XGM A;  5DD4 A;  2Z3Y A;  3MEX A;  4IRH A;  1MDM A;  3CDH A;  1ONV A;  1AWC A;  3I59 B;  4HZF A;  1KU9 A;  1ZGJ A;  4WXC A;  1PDN C;  4OIR F;  4LG0 A;  2D2W A;  2ZO4 A;  5FLX Z;  1E2X A;  4R79 A;  2O8X A;  2GIV A;  1BIB A;  3V4G A;  4PCQ A;  2IA0 A;  2R7D A;  3WTZ A;  3VEP A;  1HBX G;  4Q5S F;  4ENK A;  2OD5 A;  2XV4 S;  3ZMV A;  2KIF A;  4KIC A;  1TBX A;  1P4A A;  2OU2 A;  4OMZ A;  3CUO A;  1ZHF A;  2GZW A;  5CVJ A;  4BAY A;  4WK8 F;  1MDM B;  5D5V B;  3Q9S A;  5D6E A;  5JI6 A;  4EJO A;  4GYI A;  2E1N A;  1FSE A;  4CDG A;  4LG0 B;  1FBQ A;  1K78 A;  4PGG A;  3M1E A;  4IVN A;  3BRO A;  4ETS A;  3WU1 B;  2DU9 A;  1YTY A;  2DT5 A;  4KFC A;  1STZ A;  2CW0 F;  4FX0 A;  4K2E A;  1YO5 C;  1IN5 A;  3TOB A;  3TO6 A;  4GCV A;  1U78 A;  2BV6 A;  4I2O A;  2Y48 A;  4OU0 A;  4AIK A;  2QQA A;  2HOE A;  1QPM A;  4PGH A;  5DCM A;  1W5T A;  4GXO A;  5L3G A;  1DP7 P;  2P5V A;  5HLH A;  3BPV A;  2VBZ A;  1XGO A;  2DLL A;  4IJA A;  1MKM A;  1K78 B;  3LST A;  4L0Y B;  2ZNY A;  1ZRC A;  2FEZ A;  4FHT A;  1S7O A;  2XIG A;  2FXA A;  4ENN A;  4EJT A;  4B8X A;  4O5V A;  3D5L A;  2LNB A;  4NQW A;  5DCM B;  2XKO A;  1HSJ A;  3EUH A;  3M8E A;  3HTS B;  2ZBK A;  3O6B B;  3F21 A;  1ODD A;  4EM1 A;  4Q4Z F;  5EEH A;  2FF4 A;  2DAO A;  4CGZ A;  1D8K A;  1ZLK A;  5D5X B;  3F72 A;  2BGC A;  2GXG A;  1WQ2 A;  4U7B A;  1J2X A;  2Y75 A;  3C1D A;  3O3K A;  4G7Z F;  2HKX A;  2WWY A;  3BPX A;  3JW4 A;  1S3J A;  3K69 A;  1OKR A;  3ABU A;  4EM2 A;  2XRN A;  1ZRE A;  2QZ8 A;  1I1S A;  1OMI A;  1OPC A;  4LJZ F;  3WE2 A;  5DYM A;  2FQ3 A;  2VC0 A;  3ERE D;  4E70 A;  5IT3 A;  2NRA C;  3G3Z A;  2EB7 A;  5HVQ C;  3FMR A;  3E6B A;  1R58 A;  5ILV A;  1YW7 A;  2GA2 A;  2K7L A;  5HLI A;  3U1D A;  3QAH A;  4ON0 A;  3OOP A;  3RYR A;  2MH9 A;  2IPQ X;  1WKM A;  3JAM K;  3DFG A;  3J80 Z;  1V3F A;  3RKY A;  4A6E A;  1LJ9 A;  2OZU A;  3K2Z A;  3MAJ A;  3KLO A;  2ZKZ A;  4I98 B;  2ETH A;  5ICE A;  1KYZ A;  3WTY C;  5JVT A;  3CLO A;  5L3D A;  3ZQ7 A;  2FU4 A;  2LF8 A;  5KK1 A;  3NEU A;  5DCF A;  2FSW A;  4GO1 A;  1GHC A;  3QOP A;  5ICF A;  5BQT A;  2EV0 A;  2Z9O A;  3P9C A;  4YFN F;  1OYW A;  3QP6 A;  1ZGA A;  3DXJ F;  5ERI A;  2EFQ A;  2IW5 A;  2RNJ A;  2QEN A;  2XAQ A;  4G8X A;  5D8L B;  1XB4 A;  2YX7 A;  2ZCW A;  4KN4 X;  2NAZ A;  2L4A A;  3SXY A;  5E8G A;  3VOD A;  3ISP A;  1HW1 A;  2CG4 A;  1G4D A;  3ZN1 A;  2K86 A;  4XRF A;  4MEY F;  4WX9 A;  2FNA A;  3DKW A;  4F7Z A;  2DI3 A;  4A12 A;  2M87 A;  5D6F A;  3FMQ A;  2G7H A;  2V1X A;  5TJJ A;  4TV7 A;  3L2C A;  3L09 A;  3GX4 X;  1XSV A;  1FSH A;  3GFJ A;  4LFU A;  4N9I A;  3RKW A;  3AAF A;  3HSE A;  2G7U A;  3HRM A;  3TO9 A;  3JAM Z;  1Z91 A;  2L3D A;  5JFR A;  3RDI A;  3FM3 A;  3M7G A;  2H09 A;  2PMH A;  1BIA A;  4MHG A;  3WTV C;  5D5U B;  3ZP5 A;  4BXU A;  3JSP A;  5DUK A;  4KA4 A;  3E6C C;  3HSF A;  2Z99 A;  2VT3 A;  5CYV A;  2K27 A;  1KU7 A;  4S04 A;  1D3Y A;  2HYF A;  4AIH A;  1IZ1 A;  5HS8 A;  5CVI A;  2OQG A;  2ZNZ A;  4LD5 A;  6PAX A;  5JHU A;  4BHC A;  1TW3 A;  5D5W B;  4WXH A;  3OV8 A;  1QZY A;  4HF1 A;  4IPA A;  4HX7 A;  4AVP A;  1IXR C;  2FBH A;  3B73 A;  2IT0 A;  1A04 A;  4KYW A;  4EJU A;  5FD6 A;  1MJ9 A;  3Q5F A;  1F9N A;  2ZFW A;  1TQM A;  3TGN A;  1SD7 A;  4RGR A;  4EJV A;  1SAX A;  5CVV A;  4G94 A;  1J0R A;  2BEO A;  4YFK F;  1BJA A;  3LAP A;  2XAS A;  3RI4 A;  5LHH A;  1REP C;  2RV8 A;  3ROU A;  4RB1 A;  3P7N A;  1RI7 A;  4KIB A;  4WXD A;  4EV0 A;  2L01 A;  3L7W A;  2ZME A;  4WF2 A;  4L0Z B;  1O57 A;  1XCB A;  2W25 A;  1BC8 C;  5E1W A;  2PI0 A;  1YG2 A;  3GZ6 A;  1R22 A;  1S7A A;  4RGS A;  3TDZ C;  3I53 A;  3F22 A;  2MC3 A;  1QQI A;  4LMY A;  4I0B A;  3QPH A;  2JTV A;  2O03 A;  3ULQ B;  3B02 A;  4M74 A;  4DQ2 A;  2RN7 A;  2ZME B;  2FMY A;  3CUQ A;  1EV7 A;  1BI3 A;  5LEJ A;  2GXB A;  5LBQ A;  2DPU A;  3S2W A;  4LB5 A;  5FLX K;  4ZYE A;  2PLY A;  1B1B A;  5LRS A;  3SFZ A;  1MJB A;  2EJR A;  2VC1 A;  3DP7 A;  1Z6R A;  2V1U A;  4KMF A;  5FD5 A;  3LA2 A;  3WGH A;  2HYG D;  1QBJ A;  5E17 F;  1ZLJ A;  4LK1 F;  3GYH X;  5FFX A;  5ILU A;  5BMZ A;  1T39 A;  3CUQ B;  2H94 A;  1QO0 D;  1LVA A;  1O3R A;  3K9T A;  1F5T A;  1YW9 A;  4I09 A;  3F6O A;  4G9Y A;  4HQE A;  2JSC A;  3JSO A;  2HFH A;  4P96 A;  1G3T A;  1XMA A;  3J7A O;  3WG9 A;  2QWW A;  1WWX A;  2F2E A;  2YX4 A;  3VB2 A;  2NYX A;  3W6K B;  1FOK A;  2XAF A;  3HRT A;  3LWF A;  1R5H A;  2EV5 A;  2XAJ A;  3T0Y A;  2A6E F;  4HLX A;  3WE3 A;  2W24 A;  1ZG5 A;  3V8J A;  1B9M A;  4A0Z A;  1D5V A;  4LLL A;  4EMS A;  1O3T A;  2OZ6 A;  4U0V A;  1ZRF A;  3CO6 C;  4UUV A;  4N0B A;  2X4H A;  1J7K A;  3KFW X;  1ZG3 A;  4UNO A;  2CQK A;  1FYM A;  3NQO A;  4L9N A;  2DQL A;  4EQQ A;  3LFK A;  1K79 A;  3GWZ A;  4RB2 C;  1USS A;  2NNY A;  3RKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...