4DYRA

Crystal structure of terminase small subunit gp1 of the bacterial virus sf6 with caps ph10.5 buffer
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 1 protein
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dyrA01
4FCYA 2M0CA 2M34A 3SDGA 3S15J 5IP7J 3S1NJ 4QSHA 5J1YA 2R5YB 2DN0A 3RZOJ 1H8AC 1JUSA 3QPSA 2HOTA 4V2GA 4B1RA 2L0KA 2W48A 2CQXA 5EG0A 1ZR4A 3LSJA 3MVPA 1DU0A 1RKWA 4A3LJ 4BBRJ 1Y1VJ 2X9DA 5JLXA 2VKEA 1JT6A 3NAUA 4M3FA 5F0HA 4BBSJ 2K40A 4A3IJ 1SFOJ 3A01B 1AKHB 9ANTA 1MBHA 2XPVA 5EEAA 2DMUA 4W97A 2M8GX 2VI6A 2Y2ZA 5C4JJ 2MSYA 1UG2A 1BJZA 3HOWJ 5GP9A 2DA1A 3FIWA 4UUTA 3ZQLA 3M4OJ 2LP0A 3S1MJ 5F0CA 1ETXA 3SFIA 1HDDC 1Z77A 4MO7A 1FJLA 2X6OA 1HDPA 4CYCA 4JX6A 5EGOA 1U8BA 2L9RA 2TRTA 3OSFA 5FLVA 3HEFA 3QQAA 1GDTA 3TP3A 3PO2J 3JRBA 3BR0A 1ZK8A 1F36A 5DS9A 5FKOA 2E2HJ 4RDUA 1ITYA 2HQ5A 3PM1A 3JRIA 3LNQA 2TCTA 4DYRA 2NS7A 3S17J 4A69C 4AYBN 4CYCB 1FTZA 3B6CA 2AHQA 5F27A 4JYKA 1MSEC 3LSPA 1LFUP 4D5CA 1AHDP 2MW8A 2LKXA 4S0HB 4FE7A 5E3LA 1GV5A 2M9HA 1JJ8C 3F0CA 1T33A 4A3KJ 2WAQN 3G1LA 2MG4A 3DEWA 1PUFA 1XS9A 2XPWA 2LR8A 2XGEA 2DJNA 1A6IA 2EZHA 5E3OA 2XRLA 3BG3A 3O8GA 3UKGA 1B8IA 4AUXA 3A01A 1DU6A 1GT0C 2CU7A 4DZPA 3QPLA 4X1EA 1PUFB 1OJLA 5EYRA 4XK4A 3OOUA 2NVYJ 3JRAA 1JKOC 3SJMA 4M3DA 4IHVA 1VI0A 3IH4A 1NK2P 4M6VA 3CQZJ 2FD5A 2Y0SN 4DW6A 3BR2A 4D5FA 2OF7A 3DCFA 1UMQA 1T56A 5EDNA 1XG1A 1YRNB 2KDZA 2LK2A 1VNDA 3ZQGA 4XRSA 1MBJA 1RESA 3ZQHA 1LE8A 1QPIA 3GTJJ 3BR5A 2H1KA 4IHXA 4BY1J 1TC3C 2X48A 1RKTA 2HOAA 2L7FP 2YUSA 3RKQA 3OSGA 3M3YJ 5M5WJ 1BW6A 1ZTRA 2XGDA 5FKNA 2XB5A 2JA6J 4IHYA 4XICA 2E1OA 5E3NA 4UUSA 4D7MA 5DTDA 1S7EA 3BR3A 3TW6A 5J1UA 2JK3A 2EZKA 1K83J 2DTZA 2R93J 3FK7A 5IPAA 4M3EA 3ZOBA 1IJWC 3Q0WA 4V2FA 1I50J 1ZGWA 3MN2A 2VUMJ 3HOUJ 3HOYJ 2CJJA 1F43A 3BTIA 3BR1A 1IV6A 4W1UA 3WHCA 2MGQA 3JRCA 2NVTJ 5M5XJ 1JKQC 2XSDC 3RZDJ 1GUUA 2YS9A 4M3GA 3HDDA 1W0UA 3HOXJ 1AKHA 4A93J 2IAIA 4JX4A 1BW5A 1ENHA 2DA2A 3JRFA 5IYCJ 2HI3A 3BTLA 2HDDA 1QVUA 4FE4A 3RQIA 3FISA 5BNGA 1RR7A 2M2EA 5IP9J 2GM4A 4A3GJ 3S1QJ 5F0FA 1FEXA 1ZQ3P 4C3IJ 1TWGJ 1Z0XA 4XRSG 3BG9A 4XRMA 1UHSA 4GFBA 2I10A 3LSRA 4AC0A 4ABZA 4A3CJ 2D5VA 2HOSA 4I76A 2PMZN 1OFCX 2EH3A 4FTHA 1TWHJ 4B4CA 3JRGA 2O9LA 2Y31A 3GTPJ 2E2IJ 4FISA 2NS8A 2YU9J 1SANA 3OIOA 2EZIA 2ZB9A 2CUEA 5K7HA 3Q3SA 3GTGJ 4UUSB 3JREA 3A02A 2IEKA 4JP0A 2FQ4A 3IH3A 4XIDA 1GVDA 1AU7A 1ETQA 3ZQCA 2JA7J 2EZLA 1HLVA 1MBEA 2LTPA 3TW7A 4Y7NJ 2GLOA 5IOYA 3D1NI 5EF6A 1TWCJ 1Y1WJ 1MBFA 2L7MP 1CQTA 2E2JJ 3HGGA 1JGGA 1JKRC 2P81A 5M3FJ 1U9NA 2ME6A 2H8RA 2NVQJ 3GTOJ 2VKVA 4L5EA 3E7LA 3BQZA 1IRZA 5F08A 1FIPA 1VFCA 1HF0A 1FIAA 4DZJA 4BKXA 1ZKGA 3CMYA 3S14J 3WHBA 3LSGA 2JJ7A 3H0GJ 3BQYA 2R5ZB 2O8KA 1POGA 2HYJA 2WV1A 3C2BA 2K9NA 1IGNA 5FKKA 3TP0A 5F04A 1FTTA 2JA8J 3IH2A 4DYQA 3Q0UA 3Q0VA 4DYCA 3GBGA 4M3BA 4D7NA 2AO9A 2EBIA 1D5YA 3FKIJ 1X58A 1MBGA 1NK3P 2JN6A 2EQRA 1B72A 1RETA 2XGCA 1ETWA 1NTCA 1MSFC 3JRHA 3S16J 4QIWN 3GTQJ 3O8HA 5FKMA 1LE8B 1ETYA 2ID6A 2IBDA 1QVTA 5FKLA 4NDLA 3G1MA 4MIMA 2NVXJ 5HODA 1B72B 1K61A 3ZQIA 2DMTA 4I6ZA 4J19A 3HKZN 2XPUA 1GV2A 1JTXA 2R0QC 3LOCA 1HOMA 1ETVA 1JTYA 1X2MA 1BA5A 1MH4A 2VPRA 3H3VK 3BTCA 5M3MJ 1E3OC 2LY9A 3HM5A 1H89C 1OCTC 1TWAJ 5F1JA 2FJ1A 1A5JA 3BT9A 3IV5A 5K7ZA 2HXOA 2R5ZA 2HXIA 1JJ6C 4A3MJ 3GTMJ 1YRNA 5K7FA 1VF9A 2R7ZJ 1OCPA 1X2NA 1U78A 1LFBA 2L7ZA 2E19A 4A3BJ 1XC5A 2GBYA 2Y9YA 3G1OA 3K7AJ 3MKLA 5C4XJ 4C2MJ 2DA5A 1G2HA 2CRGA 1IC8A 5E3MA 3BG5A 1HCRA 2B63J 3VPRA 1APLC 5FJ8J 2DA6A 2DA3A 2ECCA 4C3HJ 2COBA 2O7OA 1ZR2A 1ETOA 1IUFA 1WCMJ 2LVSA 4MLOA 2G0EA 1IG7A 3CCYA 1MBKA 3GTKJ 5GPCA 1P7JA 4A3JJ 1P7IA 1WH7A 2LD5A 1ORKA 2KT0A 2LFBA 3W6VA 3GTLJ 5JLWA 1JUPA 5IP6A 2K9QA 2R92J 4LOCA 5EZGA 4G12A 4RBOA 2XB0X 2DMPA 4Y52J 3JRDA 2Y9ZA 1ETKA 4JX5A 1R9TJ 4IEJA 5J1RA 3BTJA 1B8IB 1QRYA 2DA7A 5EG0B 4A3DJ 5GPAA 1TWFJ 4C3JJ 2RAEA 3HB9A 5IYBJ 1JT0A 2N8GA 3S1RJ 4A3EJ 4MFDA 1JUMA 3HOVJ 4HNVA 4X6AJ 5EZHA 3PO3J 4BY7J 4QTRA 3I4MJ 3L1PA 4B3AA 2JA5J 3HOZJ 2CQQA 3ZQFA 3BR6A 1U9OA 3CDLA 3JR9A 1Q1VA 4EEFG 2FX0A 1IDZA 2JMWA 2DMQA 1W0TA 5IOZA 4MFEA 2LLKA 3HGYA 1JKPC 2ID3A 2NOGA 5FLMJ 4BXXJ 1WI3A 1WH5A 3S2HJ 2WB1N 2DMNA 2Y30A 3B6AA 1MNMC 1H88C 3I4NJ 5C44J 1O4XA 3FK6A 5M5YJ 1EF4A 1I6HJ 3A03A 2DA4A 3HBLA 1RPWA 5IYDJ 1MH3A 3K2AA 2JWTA 5C3EJ 3TEDA 2OPTA 1WGXA 4A3FJ 2QCOA 3S2DJ 2R5YA 2QF7A 1I3QJ 5EGOB 3NARA 1WPKA 1IDYA 2K9SA 2ELKA 4IHWA 5J3LA 2ECBA 1BL0A 2CUFA 2ME0A
chains in the Genus database with same CATH superfamily
2PX9A 3L2WA 5KAFC 2V1DA 1SD5A 4LG0A 4CA0A 2WA0A 3RZOJ 2HKXA 2H6BA 1BOBA 1BIAA 2XAQA 2K27A 1H8AC 2L7KA 2DFHA 2G9WA 4V2GA 4B1RA 1U8RA 1SEUA 3IRQA 4HF0A 2E5ZA 3ML6A 2VODA 4PZJA 2P7VB 3PNTA 4XRFA 3KP5A 3R6SA 3F8NA 4BYYA 5HS9A 3MKWB 2V1NA 3FBIB 4A3LJ 1V5FA 4IHTA 5IT9K 4BBRJ 1TW3A 2JTVA 4GCVA 2VKEA 1YE9A 4KMUX 3R60A 4M3FA 2D45A 2LG4A 3OIQA 1LKXA 1X3UA 2K40A 1R5HA 1E0EA 5JFRA 2ZO4A 3A4CA 3GMEA 2QBYA 2R7SA 5E8IA 2JPBA 1IRXA 1DQUA 4LB6B 3I64A 3RKYA 2FBKA 3IKVA 5FFXA 3SEQA 1Q1HA 4LLNA 5KAIC 1QZEA 2DMUA 3SXYA 2HZTA 1FLIA 5CKTA 2FMYA 2OQGA 2Y2ZA 4ITVA 1AOYA 2MSYA 3PNVA 3HOWJ 1S7OA 4UVBA 2D2WA 3OYIA 3DF8A 2R4GA 3TOBA 1RR8C 2XHKA 2GIVA 3IWFA 1ZHFA 3RYPA 3CLQA 1FBUA 5EGOA 5D6FA 4NB5A 4HRIA 2L9RA 3K9TA 3L7WA 3HEFA 3OYCA 2Z99A 4M72A 2NAZA 3TP3A 1YIOA 3JRBA 3U21A 1ZK8A 5DS9A 3CCLI 5H6QA 2PMHA 3P9CA 3PM1A 2VB6A 3ZGKA 1W5TA 1Z67A 2K02A 2TCTA 3LNQA 1F5TA 2PLYA 1HQCA 3TDZC 4A69C 2PG4A 1DGWY 3HL2A 2AHQA 2K3PA 3FMQA 4ENNA 1MSEC 4UVCA 4PJLA 1BM9A 5CVUA 1AHDP 2XAJA 3M8JA 4EM2A 1LQ1A 4S0HB 1YOVB 4A6DA 1VQPI 2EFWA 4PUSA 4U87A 3GZ5A 1ZG1A 1X19A 2JPCA 2V4JC 3MQ0A 3BLYA 3G1LA 4NBQA 3DEWA 1PP8F 2OV7A 1XS9A 2BXZA 2LR8A 4GDFA 1TQMA 3DTIA 4RGRA 2OJED 3IL2A 1A6IA 2EZHA 3BG3A 1B8IA 3E3VA 1YQAA 2X4HA 5EEGA 5TISC 5J4YA 3W2AA 2E1CA 4DZPA 3QRFF 4PK4A 1HKSA 3PUBA 1LVKA 1XSDA 1OJLA 5EYRA 1YX3A 4HYEA 3F8FA 4KN4X 2NS0A 4Q4ZF 3ECHA 1J2XA 4M3DA 4LK1F 5J47A 3IH4A 2PMZA 2E5NA 2FD5A 2WY8Q 2Y0SN 1DGRM 2QENA 3BP8A 1SVMA 4DW6A 2EV5A 3X2QH 1SVOA 2OF7A 5HDGA 1UMQA 2FE3A 1T56A 3I53A 4XMYA 4EJOA 5EDNA 2BW3B 4L0YB 1BR4A 1B59A 5B1AH 2VLAA 4Y15A 1ZGAA 4NQWB 2BY1A 2W00A 3ZQGA 1SD6A 1YX5A 3AL0C 4XRSA 4IOAF 4JBAA 1LEAA 3KLOA 5GAHJ 1SFEA 2FXAA 3BR5A 3ABKH 1HW5A 3K4MA 3K4NA 4U7DA 4IHXA 5E1ZB 2X48A 4EM1A 2L7FP 3RKQA 5BPIA 3OSGA 3ULQB 2XSJC 1RIOH 3CDIA 4KIGA 4CGZA 3V7CA 3OYBA 1MW7A 3DBLB 3VYTB 4IHYA 1JGSA 4XICA 2XF6A 3K69A 3TL4X 2E1OA 3Q9SA 2KFDA 4UUSA 5JHFA 2ICWG 4D7MA 1S7EA 3BR3A 3W3CA 3ZQ7A 1LDKB 2GQQA 2ZKZA 2F2EA 1MNDA 2YU3A 3TGNA 2R93J 3QOEA 3CTAA 1I50J 2Z33A 3NEUA 1ZGWA 2VUMJ 1WI9A 3GLLA 4OIOF 1DP3A 4OAZA 1O3SA 3WHCA 1IXCA 1VQLI 1S5LC 1R4MB 2X6YA 1JKQC 2F5CA 1KU7A 3CC7I 3KZIC 3K2ZA 2XSDC 2NNNA 2K9LA 3RKWA 3HDDA 1UHWA 3EUAA 4BHPA 1T95A 2IAIA 1P2FA 4JX4A 4CSWA 2IVMA 2CSOA 2LRDA 2W82A 3BTLA 5E18F 3FISA 1RR7A 2M2EA 3VB2A 3E5QA 5IP9J 1IO2A 5F0FA 2RKHA 5IT3A 1OLTA 2MABA 2HFHA 1K6OA 4C3IJ 2FU4A 4L9NA 2M7BA 4RB1A 4XRSG 1FC3A 3E6BA 5DM6F 4IVNA 2LREA 1MZBA 4HF2A 3VEPA 1WKMA 4AC0A 1ZG3A 1EV7A 2V9KA 3LA2A 2OU2A 4A3CJ 1M1EB 2D5VA 4O5VA 2PMZN 3KZZA 2GA1A 2PQ8A 2X6WA 4B4CA 2Y31A 3GTPJ 4BHCA 1ODDA 4KITB 5ICGA 3OYHA 3IRRA 2PI0A 1SANA 2YU9J 3LSHA 3OL4A 3N4MA 4ESBA 3Q3SA 1R71A 3ZPLA 2IEKA 4NC7A 3IH3A 4BACA 1AU7A 1TNSA 2EZLA 5DEQA 2B9SA 2LTPA 5J8FA 5IOYA 5CPRB 2L7MP 1K79A 3GEZA 4C9YA 4DGWB 1IZ1A 3UR3C 3DBRB 3WODF 3J7YJ 2P81A 5M3FJ 2NVQJ 4LLGF 2EJRA 3CF2A 3E7LA 2R3SA 3BCAA 1IRZA 4HSRA 2CGPA 4KICA 1WQ2A 3ELKA 4CCJA 1FP1D 1J59A 1YFHA 4QPOA 1B9NA 4BKXA 2HTJA 3S14J 1W7PB 3WHBA 2EPFA 2H8WA 5LRRA 2A07F 3BQYA 5CQEA 1POGA 2X1EA 2QUFA 1QHGA 3VYSB 5K5QA 3CC2I 2K9NA 1IGNA 5FKKA 1FTTA 5F04A 3IH2A 3Q0UA 1W36C 4MTEA 2CV2A 2VONA 1XN7A 3GFIA 1YW9A 4BQOA 1OYYA 1P4WA 2EBIA 3IWZA 3FHNA 1H9GA 1D5YA 3T1BA 1D0YA 1R5GA 4M71A 3CUQB 1NK3P 1OYWA 2EQRA 1IAWA 2PJRA 5E1WA 3ABMH 2VIXA 1XGOA 2A68F 3JRHA 2GWRA 2P8TA 3GTQJ 2CV1A 5FKMA 3PUFA 1LE8B 2D1VA 2ZCWA 4UUVA 3KP3A 1UB9A 4ESJA 2HVSA 4HG2A 2COMA 1J5YA 5D8LB 2CFOA 4NDLA 5DUKA 1B72B 3KYCB 1K61A 1R1UA 2A3SA 2WAEA 1ON2A 2DODA 4LLLA 3CCMI 5GADJ 1GV2A 1JTXA 2KIQA 2CH0A 4LB5A 5LD2C 4HF1A 4DJAA 4BQNA 3GUDA 5ICCA 1JTYA 1LVAA 2Y69H 1E3OC 4KMFA 3WGHA 1OCTC 2LC2A 1TWAJ 3T8TA 3BT9A 2QWWA 3IV5A 2IS1A 3RKXA 2DPUA 1YW7A 5K5RA 3KP2A 2HXIA 3DP7A 1X1CA 4OOIA 2WTEA 5K7FA 3TDUC 5TRDA 1JI8A 1TQPA 3U1DA 5FFZA 5ICEA 1XC5A 4QWQA 5D4SA 4N0BA 3MKLA 3DTKA 4WF2A 3LSKA 2ZXJA 3HIFA 2QVOA 1WSUA 3MWMA 3BG5A 2ECCA 5JVGF 3CJTB 2BHZA 2HQNA 1I1SA 1UCRA 4P5OA 1IUFA 2LVSA 3JAMK 1MJ9A 4MLOA 4UXNA 1MDMB 2OCCH 3CO6C 3EUHA 3E6MA 1ZRDA 3S3NA 3GTKJ 4RAZA 2BW3A 2M45A 2VN2A 3WTUC 3P9IA 4A3JJ 5CVIA 1P7IA 2OQRA 2LD5A 1ORKA 2KT0A 2LFBA 4PFPA 4LOCA 4YFXF 3MKYB 2X6XA 4O3MA 2DMPA 3SZGA 3KEOA 3HPHA 1ETKA 1R49A 2XVCA 4JX5A 1R9TJ 4U0WA 4IEJA 3DBHB 2CW8A 3O6BB 2IW5A 2EFOA 3AG3H 4Y13A 5EG0B 3E5UA 3CESA 2L5QA 1TWFJ 2LY1A 2DW4A 1F1ZA 1JUMA 4HNVA 1Y56A 1R00A 1EH7A 2A6TA 5F64A 2ZJRF 5FB2A 2CWEA 5EZHA 4QTRA 2E60A 2VBXA 2JA5J 3HOZJ 4F55A 1VQ9I 4II3A 4EEFG 4BJTA 2FX0A 2JMWA 2IJLA 2LLKA 2HPIA 3HGYA 1FPQA 2P5LC 4BXXJ 1WI3A 3LAPA 1XSVA 2Y30A 3B6AA 2O03A 3DU5A 2BV6A 3DFGA 5C44J 3FK6A 1QZZA 2VT3A 2RNGA 2AS5F 2KL4A 3LMMA 2XIGA 1LDDA 1K7AA 4BUPA 2OA4A 4RM3A 2CV0A 2CQKA 1ZH5A 2BY2A 2UV1A 2XAHA 3UNGC 4DOZA 4A3FJ 1LFPA 3FMRA 3I71A 3S2DJ 1I3QJ 4L9VA 2LBFA 2AQFA 3BG7A 2YX7A 2H94A 2K4BA 3PIOF 3K4JA 2A5YB 4CICA 2HEOA 2DPDA 1MMAA 1X4PA 4RB3C 2EFPA 2ZBKA 4QSHA 3G4SI 2R5YB 3PFIA 4AIDA 3BZCA 1DP7P 3QPSA 1S8NA 2UWMA 5ILVA 4KJZA 4UVAA 2L0KA 1U5TC 3H1CA 1RI7A 4OIRF 3MVPA 2XROA 1I6XA 4AM3A 5HDKA 2FEZA 2KHMA 2BEOA 3FXMA 3W6JB 1JT6A 3OYAA 3CO7C 3RPUA 2M4GA 5ED4A 1BC7C 2WAQA 1X3WB 2IXSA 1SFKA 3SEZA 2PN6A 4E7HA 1D3YA 3QYFA 3O2PE 2GOMA 1YJ9I 3V8LA 2VJ4A 3HUGB 4BEHB 3A01B 1AKHB 1F9NA 2W1OA 3CF5F 2E36A 4CHUA 4L9TA 2M8GX 2KQRA 3V7SA 5C4JJ 5HNFA 5JR3A 4RGUA 1KYWA 3Q5FA 2VOOA 2DA1A 1RC9A 2ZJ2A 4XLNF 3ZQLA 1XDUA 2LP0A 5HLGA 2RNJA 5F0CA 4KDPA 2PMUA 2X6OA 4CYCA 2K7LA 3K70D 4JX6A 2MH2A 2LH9A 4EVIA 1SAUA 2DQRA 4YELA 3BR0A 1KONA 1ACIA 3LA3A 5FKOA 3CUQC 1FOYA 4CCMA 2C6YA 4PGHA 4AYBN 3B6CA 3Q9VA 3OYLA 2CW7A 5F27A 4BJ5C 4LGWA 3QAHA 1EA3A 3FF5A 3CMEI 3H36A 4ZH4F 4BQAA 2ZXWH 1TQIA 1H9TA 1GV5A 2IA2A 3FXOA 4Y3OA 2M9HA 1T33A 4UV8A 3C2HA 2DFFA 2FNPA 2MG4A 4UV9A 3WU0A 1ZGJA 4RS8A 3VWBA 2ESHA 2XPWA 3CCUI 3KYDB 2DJNA 1CGPA 5KK1A 1VQ7I 2XRLA 3O8GA 4HAMA 4H4KC 2F4OB 4AUXA 4M9ZA 5LLQA 5LEJA 3HUGA 4BEHA 3A01A 1WJDA 1Z7LA 5B3SH 5DCMB 2ISYA 1R23A 1WJEA 1BJAA 4PDKA 2RN7A 4RB0A 5DYMA 3QPLA 5LRSA 3ZXSA 5L3GA 3JRAA 2XF5A 2IPQX 1TP4A 1S7AA 5GAEJ 3MKZA 2E35A 5J6XA 4Z6YA 1D5VA 3CCSI 2MBFA 1VI0A 1NK2P 3ROUA 3CQZJ 2DO7A 4B09A 3WTSC 1G3TA 4BNCA 1QU3A 2M0MA 3H3ZA 2EA4A 1R6RA 3QOPA 3HOTA 3LSIA 1D8KA 5KNLA 1XG1A 2WC2A 2KDZA 2LK2A 3GXOA 1D0XA 2DAOA 3ZMDA 3M1EA 1MIJA 2NNYA 3M8EA 3OWTA 2CQ7A 1B6AA 3C7JA 5D5XB 3BJ6A 2ACJA 2A6EF 2HVRA 2E1MC 3GTJJ 4L9JA 5FGMA 2BY0A 1TC3C 4M9SA 3L2UA 3K0LA 2YUSA 3NWTA 3KE2A 4XN0A 4XL9A 2XRNA 5D5WB 1FMVA 3MFKA 3HHHA 1O7FA 2XGDA 4HV6A 5FKNA 2JA6J 2MD5A 4WCGA 2ZNZA 1VQOI 5J1UA 2EZKA 4R79A 2K9MA 4I2OA 2F5FA 2IP2A 4OIPF 3FK7A 4FQGA 2Q8KA 3ZOBA 1IJWC 4V2FA 3HOUJ 3HOYJ 2X85A 2CJJA 2ZFUA 3G6EI 1F43A 1BI3A 1E3HA 2HQAA 2DQLA 2MGQA 1PVEA 5JI6A 4WWCA 3JRCA 4EMSA 3FX3A 2JT1A 4LITA 4ESFA 1OCRH 1GUUA 3AL0B 1W0UA 3KP7A 1T2KA 3F22A 3N97A 1WJBA 2BXYA 2DA2A 2H6CA 3JRFA 3GW2A 3VFZA 4LIUA 3WE3A 1QVUA 4FE4A 4MGRA 4HQMA 3S1QJ 4A3GJ 4ZDLA 3GLXA 5LGUA 2K4JA 4BE0A 1YHQI 1UFMA 1Y6IA 5FD5A 4I0BA 3JSPA 2RQPA 4HX7A 4XLEA 3HSFA 3SZTA 4XRMA 3OYFA 3RPUD 1T38A 2HKOA 2KIUA 2I10A 4RGXA 1ZRFA 4GFBA 2AXTC 3LSRA 4I7HA 3NWSA 2O8XA 4FX0A 3A1YA 4ABZA 5L3CA 4IRGA 3CZ6A 3F6VA 3K4BA 1W1WE 2L9SA 2DOEA 3ABTA 2HOSA 2K5CA 1FNNA 1ZN2A 1UAAA 2Z1DA 3JRGA 2O9LA 2E2IJ 5CQGA 4Q5SF 4FISA 5CLSA 2DU9A 1E2XA 3OIOA 5L3DA 5LHHA 2ZB9A 5D5UB 2CUEA 5K7HA 4UUSB 3JREA 3ZR8X 2BOLA 4JP0A 3C2GA 2OZUA 3MMYB 1GVDA 1UJ8A 1PUEE 2VBZA 4BXUA 3J7AY 2GLOA 4Y7NJ 3D1NI 2STWA 4QPQA 1Y1WJ 2GOXB 2J5OA 4HA8A 3HGGA 4A2UA 2L9NA 4G8XA 5D4RA 2H8RA 1U9NA 3B02A 3ABLH 4LD5A 3OL3A 3W6KB 3DLLF 4V19K 3H5RA 2O0YA 2HS5A 2DK8A 3KP4A 3F21A 1FIPA 2M4KA 3GFLA 2DT6A 1YYVA 1FIAA 4B47A 4DZJA 2E71A 1D1AA 2W7NA 5HVQC 1FP2A 1ZLKA 2HYJA 4EQQA 2R7OA 2WV1A 1V54H 3FZVA 4MEYF 2Y48A 3AG2H 1MGTA 4HEA2 2OZ6A 4L5JA 3VYRB 1YTYA 2KDOA 2JA8J 3U1KA 1W7PA 4ASNA 2QYOA 4IRIA 2IT0A 4NNJA 4TV7A 1E17A 3FKIJ 2JVHA 2KPMA 1TW2A 3DXJF 4A12A 4P55A 3HRUA 4FX4A 1ETWA 1NTCA 2E7XA 2KIFA 4HV5A 4QIWN 3OS2A 2LSOA 2IBDA 3HOSA 2Q2EA 3CP2A 4PFOA 3K70C 4E70A 1BR2A 1FZPB 4I02A 5IT9Z 3OOPA 4C2TA 3P9KA 2NVXJ 1DPUA 4XSXF 2VL8A 4L18B 4I0AA 4X0GA 1HKQA 4LMYA 4J19A 1T8IA 2PEXA 4I98B 3FHZA 2VOPA 5E20A 3H9GA 2R0QC 4XN3A 1W36D 2A61A 2NYXA 3H35A 3LOCA 4LIVA 4S04A 3WTXC 1X2MA 1BA5A 4CDGA 2DFEA 2VPRA 1U5TA 1WJ5A 3BTCA 3H3VK 2LY9A 3V8KA 5F1JA 5D8KB 1A5JA 2OTLI 2RDPA 5K7ZA 4F91B 4BDYA 1RZ4A 2IS2A 2BGCA 1O7LA 3GO5A 3H3UA 3V7RA 2ZMEA 3J7ZI 3HSRA 1O57A 2GBYA 2KZGA 2UXNA 3JTGA 1R22A 3ZRGA 4IO9F 3OR2C 3QYEA 2CUJA 2FUG2 4PCQA 4XBFA 2DA5A 4OMZA 3W2WA 4OMYA 1UHMA 3VPRA 2KMUA 5FJ8J 2DA6A 2DA3A 3QP5A 2HDCA 4ON0A 5BS6A 3CJNA 1HSJA 3DEUA 1OR7A 1JHHA 1PYVA 5JVTA 1A04A 3U2RA 4RAFA 1U6GA 2M7AA 1IG7A 3CCYA 3S3OA 2Q2EB 1MBKA 3G2BA 3ASOH 2X1DA 3J80K 4IXAA 1WH7A 2H1LA 2K9QA 3WU2C 3M07A 3GFJA 5EZGA 2QGUA 2VBYA 1R4NB 3PQKA 3ONQA 4XLHA 1OCZH 1UZCA 3L9FA 2XB0X 3HSEA 2P5VA 1ZELA 1Z9CA 4P1WA 4E7ZA 1EH6A 4C2UA 2VE9A 3OYEA 2V9VA 4HX4A 2LMDA 4WX9A 4EGYA 3FXQA 1HKTA 4U7BA 1TL8A 1MMNA 4A3DJ 3V42A 2OBPA 2HVQA 4XLAA 3BPXA 3HB9A 2KJCA 3M7GA 3RDIA 1JT0A 1HBXG 4R8HA 5H6RA 5FRNA 3QPTA 1K4TA 1QA6A 3CJRB 1SMTA 2ADUA 4BY7J 4BHBA 2KP6A 5DUIA 4B3AA 3I4MJ 2CQQA 1VQMI 1KQ8A 1U9OA 3HZJA 4J00A 1XGMA 3K1PA 2IGOA 4XORA 2L2OA 4XOTA 2ID3A 2NOGA 2VASA 4CUGA 3AFHA 1S9HA 3TMOA 4KISA 1WH5A 2Q0OA 3MZHA 3S2HJ 5D5VB 1O4XA 1NHAA 1EF4A 3HRSA 1HC8A 1RPWA 4U0VA 3RIRA 4UB8C 2RC4A 1MH3A 6PAXA 3K2AA 3PIPF 2JWTA 5C3EJ 2WADA 5DDGA 2V26A 3WTYC 4ZTJA 1YITI 1WGXA 1R1VA 2CG4A 4Q47A 4XKVA 1YJNI 1WPKA 4NC6A 3REOA 1IDYA 2IGNA 4CZCA 5J3LA 2ECBA 3ESWB 2O5RA 3BZ6A 4FCYA 2FNAA 2HGCA 2M0CA 5ILSA 3SDGA 4E7KA 4ZYHA 1K4SA 2M5WA 2VKDA 3OMYA 1IUYA 1BR1A 4N9HA 5IP7J 4UNOA 2EV6A 1J0RA 2A5WA 5J1YA 3OYKA 1Z3YA 4XLCA 2HQRA 2HOTA 1ZLJA 5E8GA 2TDXA 5ERIA 5EG0A 3LSJA 1NH3A 1OCCH 1RKWA 5BMZA 2IGMA 2X9DA 2XGXA 3BJOA 3T5XA 4BS9A 5JLXA 2L02A 3NAUA 1G3SA 2RGVA 2DDBA 5F0HA 1V5GA 3OYGA 3FWEA 2Z3YA 3GVAA 4II2A 3CC4I 4LFUA 2W57A 5LBQA 4Q48A 4E6KG 4ENMA 3N05A 4GXOA 3F3XA 2JSPA 1SFOJ 1MKMA 4JOMA 9ANTA 1MBHA 2EFNA 2F5DA 2RQQA 3D5RC 1V4RA 3I59A 5GTHC 3T0YA 4RAYA 4Y33A 2ZSIB 4N4OB 3K6GA 2FF4A 2W85A 1HW1A 1UG2A 3EPZA 5GP9A 4UUTA 2GXGA 4AD9A 3AKZA 3JSOA 1LB2A 5ICFA 4GYIA 3M4OJ 5B66C 3S1MJ 3DKXA 1HDDC 4MO7A 5J40A 1TBXA 4CCOA 1O3QA 2LBFB 2JRMA 2TRTA 2CO5A 5FLVA 2YR2A 4NC8A 1OKRA 3EDPA 1Y0NA 1BN5A 1GDTA 3PO2J 3ERMA 1XDSA 2X51A 3CJQB 3TOAA 1F36A 2VBWA 4RAGA 3BROA 3SFZA 3FXKA 2HQ5A 1BBYA 1LNWA 1MD0A 3I4PA 2NS7A 3S17J 2Z2SB 4F93B 4CYCB 4G6QA 1PJRA 2Z5UA 1GXQA 4XKBA 4KFCA 4JYKA 3EETA 4CCKA 3LSPA 4D5CA 1BI0A 1MMGA 1W5CC 2MW8A 4FHTA 4FE7A 1EKEA 1OCOH 1GHCA 1KQ9A 3E97A 1G6NA 1JJ8C 1O3RA 2GZWA 2B7EA 4A3KJ 4HX8A 3CLOA 2LOOA 1PUFA 2HDWA 1EJ9A 2YPRA 3PQJA 2XGEA 4P9FA 2MYSA 3RPQA 4MEXF 4B43A 4J01A 3LA7A 4PJJA 5JHUA 1VZ0A 1DU6A 3PL8A 1QBJA 1GT0C 2CU7A 2ZXIA 2LY2A 2XDVA 1JXSA 4XK4A 2NVYJ 1TTYA 1JKOC 3FM5A 4HQEA 4OU0A 4NUBA 1A35A 3ZMSA 2PBIA 3KCCA 4M6VA 5DCMA 2WAFA 2M30A 2QQAA 2I5UA 3WTVC 2O3FA 3MAJA 1FBQA 3BR2A 2K3FA 4C30A 5AONA 4IQJA 1FBSA 4M74A 2P7CB 1S29A 3KFWX 1YRNB 4G9YA 3TO9A 3ZMUA 4GYGA 4CH7A 5BOXA 3RJPA 1IV8A 2ZMEC 4LG3A 3CCJI 2X1CA 1RESA 2LF8A 1HSTA 4YFNF 5L3EA 4E7IA 1QPIA 2L3DA 4L5IA 4AU7A 2H1KA 1O3TA 1TNTA 3T8RA 2HNHA 4BY1J 4HDVA 3OV8A 2DT5A 2A6HF 1RKTA 2HOAA 4EGZA 4NQWA 4DBRA 3S93A 1CF7A 5M5WJ 1T6SA 1BW6A 3AG1H 3I56I 3L2VA 1ZTRA 4ZZLA 2R7XA 2XB5A 3KLNA 1X3ZB 2Q1ZB 1NG7A 2F5VA 5FLXZ 4XR6A 2OCEA 2JK3A 1DDNA 4ZYAA 3WG7H 2DTZA 4XM3A 5IPAA 4M3EA 3DEEA 3MN2A 4ZJZA 1W4MA 1OYIA 4W1UA 1A6QA 1A36A 3M9AA 1GVJA 5M5XJ 1Z05A 3D5SC 3CUOA 4Z2YA 3RQ4A 3RZDJ 3K4LA 2YS9A 4M3GA 4G6TB 1AKHA 4A93J 2M1BA 3LFKA 1Z1DA 1BW5A 1ENHA 3ZCOA 4BXFA 2E1MB 4JK1X 3DPUA 4BL0B 2HI3A 5LGNA 5IYCJ 2HDDA 3KYLA 5KCMA 2OD5A 3I54A 2IS6A 3PFYA 4I09A 3LSMA 2KKOA 3JAMZ 2V6EA 2FOWA 5EEHA 2LKSA 4AYBA 1FEXA 1T98A 4BQQA 1ZQ3P 1TWGJ 3DV8A 5CVJA 3KP6A 2EIMH 4JQFA 5EJCA 3BPVA 5HLIA 3KETA 2V1XA 2GXAA 1Z3XA 2ZFWA 3MCZA 3W2VA 4KT6A 3WGIA 4ENJA 3RCOA 2E1NA 5E17F 2L01A 1WJAA 4ZYGA 2IA0A 3VODA 5D6EA 2NS8A 1N77A 2EZIA 3LSTA 3R61A 3A02A 3FMSA 2FQ4A 1ETQA 2JA7J 4IJAA 2W4SA 3ECOA 1MBEA 3TW7A 5EF6A 2ESNA 1G3WA 2L4MA 1MBFA 2HYFA 4PJMA 1CQTA 2DJIA 4XONA 2EIKH 1JKRC 2FA5A 2ME6A 3GTOJ 3BQZA 4Y4RA 3I5UA 5F08A 3ZN0A 1KYZA 2HYGD 4XLPF 3F8MA 2RREA 1Z21A 1VQKI 1HF0A 3E5XA 2QQBA 2XASA 1PP7U 2JUGA 3D5LA 2OUMA 2JJ7A 3PJRA 3GYHX 3LL7A 2MD0A 1J7KA 2R5ZB 4DBQA 1RUNA 2VKHA 1HXDA 2CFXA 4CYDA 4K2EA 1IN6A 4D0PA 1K6YA 3L2CA 2IA1A 3ZMVA 3VSKA 4RB2C 4DYQA 1LEBA 4WXCA 2R7VA 4DYCA 1T0FA 3GBGA 4IX7A 3KZYA 3I59B 3NQOA 1STZA 3CDHA 4S05A 2Y0MA 1B4AA 1XTAA 2EINH 1YW8A 3EUKL 2XGCA 2UUZA 4F3QA 1OMIA 5A2QK 1XMKA 1ZREA 2K86A 3FXLA 3FKJA 3O8HA 1ETYA 2A05A 2VQGA 2ID6A 1ERDA 4GO1A 5LHGA 3K4KA 2ETHA 2LF7A 4MIMA 3LQQA 4YRVA 2JQ7A 2DMTA 3GX4X 4I6ZA 5CVRA 5BPDA 3IAS2 1BC8C 2XPUA 2BYVE 3H5AA 2RVCA 1D1BA 5BQTA 3IHUA 3CCQI 2Y75A 4IPAA 1HOMA 2DOAA 1ETVA 1XB4A 3MZ8A 2QBYB 3I9V2 5M3MJ 3EQLF 4IOCF 1H89C 3JTHA 2DDAA 4RMNA 3WG9A 2KLOA 2HXOA 1JE8A 1H0MA 5CVVA 1JJ6C 3KEYA 4A3MJ 3CMMA 3GTMJ 1YRNA 3H9JA 2R7ZJ 4A0ZA 2DI3A 4GGGA 2G7HA 3SYTA 5FLXK 1LFBA 2KJBA 1P6RA 1P9QC 1FOXA 1LUJB 1OR7C 2IGKA 2GA2A 3FXJA 3IAM2 4A3BJ 4E7LA 3K7AJ 2LNBA 5C4XJ 3P7NA 4M6XA 4C2MJ 1DUXC 3ZP5A 1G2HA 1FOWA 2R7RA 2F6CA 2CRGA 2ZC2A 1IC8A 2B63J 1YLFA 1APLC 2KRHA 4H0EA 1Z6TA 2COBA 3L2RA 4EJWA 5LEKA 1ZR2A 1ETOA 2MLGA 3HTSB 3HYIA 2G0EA 1VQ6I 2NOJB 2V7FA 5F1RA 1E3PA 2OTJI 3MD2A 3H0DA 4QLCU 1VQNI 3CCVI 1USTA 4BAYA 5HDNA 3S32A 3W6VA 3V4GA 5JLWA 2NXNB 1JUPA 5IP6A 3GTLJ 4A5MA 2R92J 3VYUB 3MZYA 1IRFA 3RTRA 1SFXA 4AVZA 1MDMA 4G12A 1TLHB 2EA2A 3JRDA 1R36A 4HLXA 5FO5A 2Y9ZA 1IN5A 3DPTA 1XCBA 4I01A 3GWZA 4XNFA 4A0XA 4EATA 1BIBA 3BTJA 1W7PD 5J1RA 1K78B 1QNTA 1B8IB 5DV5A 5FRMA 2FMLA 3QU3A 3GCMA 4C3JJ 3COAC 5IYBJ 3S1RJ 1V3FA 4MFDA 2DLLA 3F6OA 4RGSA 3DLAA 2HOEA 4CCLA 3HXLA 4X6AJ 3PO3J 4HW0A 1MMDA 4UY8I 3L1PA 3I0TA 3BR6A 2CUZA 3CDLA 3DKWA 1Z91A 4UHTA 1Q1VA 3HHGA 2EK5A 1IDZA 1W0TA 1GXPA 2I8DA 4MFEA 4HSTA 1R5ID 1TT0A 3I3LA 1IN8A 3WTWC 2X0LA 1JKPC 3ABUA 3TO6A 3KX2A 4AIHA 3OYDA 2HWVA 2WB1N 4Y17A 3TBIA 1I5ZA 3BDDA 3I4NJ 2EFQA 4MNUA 2ZNYA 4IL6C 5M5YJ 1I6HJ 2VC0A 2DA4A 4FETA 3HTUA 3K10A 5LHIA 5IYDJ 2VE8A 4RM2A 3GZ6A 5CYVA 4B3XA 1SFUA 2MC3A 2BVMA 5FD6A 3TEDA 1P92A 3LFUA 1YG2A 3EUHC 4KNYA 4HOBA 2F48A 2XAGA 3F8BA 5FROA 4D1QA 1G59A 5L3BA 2QF7A 2OAZA 5EGOB 3BZKA 2K9SA 1D1CA 5KHDA 2GXBA 5H20A 2ELKA 3PNYA 3M8FA 2CMPA 1XD7A 2M8EA 2MLKA 5ILUA 2FQ3A 1MJBA 2M34A 4AWXB 3S15J 1T0FC 2XF7A 3TO7A 2Z9OA 3FM3A 3S1NJ 2DN0A 5A2QZ 3S2WA 1JUSA 1KQ0A 1KA8A 1WJFA 3RI4A 3BC8A 3CCEI 3LQRA 2W48A 2CQXA 4P9UA 2L4AA 3OIPA 1ZR4A 1DU0A 1LJ9A 2Y0SA 3GZNB 3WU1B 1F4KA 4EJVA 3KIOA 2K85A 1Y1VJ 3OR1C 4OAYA 4E7SA 1FY7A 1TZLA 3I58A 2M3AA 1USSA 4XQFA 4BBSJ 2HPMA 3SDBA 1UELB 1Y8RB 2EILH 2ZXHA 3R4KA 2WWYA 4A3IJ 1T39A 2YX4A 4WXHA 2QSGX 4ENKA 2DOFA 2MFZA 1SVLA 2XPVA 2WB1A 1L0OC 5EEAA 1SD4A 4ZC3A 4AIJA 4W97A 4F52A 2VI6A 2JUCA 1N78A 2DK5A 2JZYA 3BOQA 1IXRC 1BJZA 4CZZA 3FIWA 2H09A 2UZKA 1EH8A 3MEXA 4N9IA 1ETXA 3SFIA 1Z77A 1FJLA 1HDPA 3AAFA 4UB6C 2ZJQF 1XSXA 3L2QA 1U8BA 4OINF 1B9MA 3OSFA 3QQAA 3BG6A 5AIQA 4XLFA 2F4IA 4I99C 5HLHA 3O3KA 1XMAA 2E2HJ 4RDUA 3P5JA 1ITYA 3JRIA 3KPHA 1XMXA 4G6DA 4DYRA 2W84A 4E7JA 4DNCA 1FTZA 3F23A 2M87A 2ZJPF 2JVGA 2JSCA 3VSLA 1LFUP 1S72I 3DU6A 3SZPA 3QPHA 1X1PA 3HPGA 4ETSA 4HBLA 2LKXA 2QKLB 2O6GE 2BVLA 3WTTC 2CW0F 5E3LA 2VQCA 4YFKF 2Z16A 2IRFG 5DD8A 3F0CA 4KIBA 5HS8A 2WAQN 1WRJA 3CP8A 2YSRA 3S8PA 3ZMZA 2XKPA 2LYCA 1FT9A 2HR3A 2VXZA 2FSWA 1VQ8I 4PSWA 2W25A 4CCNA 4IZZA 1VTNC 2WBMA 5E3OA 2P5KA 3UKGA 1XX5A 3L00A 5CJ9A 1HA8A 2VC1A 4X1EA 1PUFB 1PDNC 2MA3A 1IXSB 1QZYA 2ELJA 3OOUA 3NRVA 2VJJA 3K4CA 2O61A 3J7AO 5GAGJ 3SJMA 3R0AA 1D0ZA 3ZQQA 3K1MA 5DM7F 4IHVA 3I55I 4MHGA 3JCUC 5L3FA 5LGTA 2ISZA 3F8CA 1QHHD 2XKOA 4KUMA 1G3YA 5E1XA 4KA4A 2HZDA 1N75A 3J81Z 1REPC 3FXRA 4D5FA 2QA4I 1MMSA 3G3ZA 3GF2A 3DCFA 3K1NA 3HRMA 4FASD 1YS7A 3BWGA 3J81K 3CMAI 1R1TA 1VNDA 2QM3A 3H92A 2KISA 1ON1A 4F7ZA 2GIZA 2L54A 4EJTA 1MBJA 1ZRCA 3DPLC 1U0JA 2DTRA 3ZQHA 4PJ0C 2MC4A 1LE8A 1MNEA 2WV0A 1IRGA 4HZFA 2FRHA 5HS7A 2BY3A 1KU9A 4IKFA 5DD4A 5HLTA 4BJ6C 5LFAA 1WHUA 2QSHX 1J09A 4RLQA 3M3YJ 4D9JA 1WZ2A 3HC7A 2VT2A 3V8JA 4KIFA 5E3NA 3R0JA 1ULYA 5DTDA 1U5TB 2DYSH 1Y39A 5TGTA 3TW6A 2WY7Q 3OS1A 3ZMTA 2QEXI 4ZYDA 1K83J 3IKTA 3Q0WA 2H27A 2R7DA 4YIRX 1A31A 4OIQF 3A0BC 3BTIA 3BR1A 1FWZA 3IC7A 1OQYA 1IV6A 4F92B 3S3MA 1J75A 4MTDA 2QKMB 4MQ9F 4O6JA 4RA2A 1K78A 3E6CC 2NVTJ 5E79C 4EJUA 2ZMEB 1ZARA 1KZHA 4EV0A 5IY5H 2CQNA 4ANJA 1YI2I 3HOXJ 3KEQA 4ZTFA 4IHSA 3M1CA 3RYRA 4LK0F 2RV8A 4AVPA 1IN4A 1NG6A 4PJNA 3RQIA 5BNGA 2GM4A 1YJWI 2BZTA 1U2WA 5DCFA 4L0ZB 1X1BA 1FOKA 2BE5F 1OISA 1Z0XA 4AIKA 3BG9A 4B44A 4DQ2A 4WXDA 1UHSA 3EYYA 2VJ5A 1S6LA 4MQVA 5K5OA 3CCRI 3CUQA 3HG9A 1J9IA 4I76A 1OFCX 2EH3A 4FTHA 1TWHJ 5TJJA 3QODA 1XGSA 1WVRA 3GTGJ 1ZYRF 1GLNA 2CS3A 3PSFA 2P6SA 4IRHA 4XIDA 4YG2F 2L9VA 2DCEA 3ZQCA 3TKYA 1HLVA 3JW4A 1TWCJ 2B0LA 2G7UA 1XPXA 1U3EM 2JA2A 2NVUB 2QQ8A 2E2JJ 1P4XA 2UXXA 2DFIA 1JGGA 1Z6RA 3E6DA 4PGGA 1MJAA 2A69F 1KU3A 2E34A 2VKVA 4L5EA 3FBNB 1ONVA 4FT8A 1VFCA 2XV4S 3G73A 4HPQA 4GRIA 3QWLA 4G94A 1ZKGA 3CMYA 5HOOA 3LSGA 3ZN1A 4BU2A 3H0GJ 5F6FA 2QQ9A 2O8KA 4U88A 2D1HA 4M6YA 1I39A 1XGNA 1YS6A 1IW7F 2PJPA 4ZDOA 4G7OF 3C2BA 2EB7A 2V6CA 4BE2A 3QP6A 3HKZA 4M73A 1LPQA 3TP0A 1JHFA 1RNLA 2P6TA 1Y8QB 4ZYEA 4XKCA 1SAXA 1I3AA 3DKYA 2PJRB 2V1UA 3Q0VA 1QO0D 4M3BA 4ZDPA 3H9QA 4R1HA 3A2KA 2KIMA 1OPCA 4D7NA 2AO9A 2PFBA 1G8XA 2GAUA 1I27A 3RSNA 3C1DA 4YIIA 1BI2A 1IN7A 3OY9A 1X58A 1MBGA 3A0HC 1S3JA 1AA7A 2JN6A 3D0SA 1B72A 1RETA 2VXDA 3WGGA 4YEJA 3C18A 2BBYA 1MSFC 5K1YA 3S16J 3HJEA 4HLYA 4KN7X 1QVTA 3GFMA 5FKLA 1WFXA 4HNUA 3G1MA 5HODA 2HU9A 3F9KA 1BI1A 3ZQIA 2XC7A 2ELHA 1FX7A 4BDZA 4RLFA 2EIJH 2VQLA 3E0JB 3HKZN 2JRTA 3PSIA 1TT5B 1QQIA 2QZ8A 3WE2A 1P4AA 4A0YA 3L09A 1R7JA 1MH4A 2DYRH 2FBIA 4XSZF 3HM5A 1I1GA 1XCVA 2ZSHB 2KRCA 1UG0A 2FJ1A 5GTIC 1W5SA 2XAUA 2R7WA 1ZG5A 2QSFX 2J5PA 4M9XA 2R5ZA 1YO5C 1Y0UA 4LJZF 4BGDA 4KT5C 4KYWA 1VF9A 4XOPA 3VOEA 1OCPA 1BOAA 1X2NA 2LDUA 2VQHA 1C0WA 1U78A 3IUOA 2L7ZA 4B48A 2E19A 2MH9A 1FYKA 2R7FA 2Y9YA 3G1OA 2P4WA 4A5NA 2V79A 5KVRA 1AWCA 3BJAA 2KRFA 2AQEA 1FMWA 2HTSA 1SD7A 5E3MA 2AXLA 1HCRA 2DT7B 4C3HJ 1X1DA 3BCBA 1X4OA 4B8XA 2O7OA 5B1BH 3EYIA 3WTZA 1IF1A 1WCMJ 2OC6A 1WWXA 2V9PA 3DQVC 3BY6A 3LAJA 2BHYA 2KZVA 1VQ5I 4EM0B 4BE1A 1FSEA 3HRTA 3IP4B 4IQ4A 4WK8F 5AIPA 5B5EC 3ISPA 1LDJA 5GPCA 4CO8A 1P7JA 3AG4H 1SMYF 1RRJA 3E1SA 1V5EA 1X1AA 3OYJA 4N4NB 2EWNA 3J80Z 5HNHA 1L3LA 2DBBA 1D8JA 1R58A 4ZZDA 4RBOA 1V55H 4Y52J 4BH9A 4U0YA 2STTA 4LG0B 2EV0A 3FDYA 4E4HA 1Z7UA 3F72A 1T08B 3OYNA 4G7HF 2VPLA 2XAFA 1QRYA 2DA7A 3H5NA 3QYBA 1VQ4I 1KU2A 2FBHA 3TQNA 5GPAA 1FSHA 2LKPA 2FOKA 2RAEA 2R7TA 2N8GA 3FXUA 2NRAC 3VDXA 5J8CA 3DWLE 4A3EJ 1QGPA 1RUOA 3HOVJ 2R7UA 2R7QA 1FYMA 2E7WA 2VJIA 3ASNH 3SHFA 4P96A 1QPMA 4CXFA 1DPRA 3ZQFA 3OS0A 5H2FC 2QLZA 3JR9A 3LWFA 4XKWA 2DMQA 5IOZA 1N25A 4A6EA 1SC7A 1FYLA 4OWRB 4YIFA 2CYYA 1HW2A 5FLMJ 3CD6I 2DXIA 1ZAOA 1KGSA 5J4VA 2DMNA 1MNMC 1H88C 4HDUA 2F4MB 4HNTA 4IF4A 3A03A 1B1BA 3HBLA 4DIQA 3SQNA 4PSXA 2F5EA 2XUBA 3C3WA 3U9GA 3ERED 3QU6A 2P0WA 4NHJA 2OPTA 4G7ZF 2IS4A 2QCOA 2W24A 2R5YA 3G71I 3NARA 1WJCA 1YIJI 3B73A 4IHWA 3DTEA 1BL0A 2CUFA 3OYMA 1G4DA 2ME0A 1CF7B
chains in the Genus database with same CATH topology
4FCYA 2M0CA 2M34A 3SDGA 3S15J 5IP7J 3S1NJ 4QSHA 5J1YA 2R5YB 2DN0A 3RZOJ 1H8AC 1JUSA 3QPSA 2HOTA 4V2GA 4B1RA 2L0KA 2W48A 2CQXA 5EG0A 1ZR4A 3LSJA 3MVPA 1DU0A 1RKWA 4A3LJ 4BBRJ 1Y1VJ 2X9DA 5JLXA 2VKEA 1JT6A 3NAUA 4M3FA 5F0HA 4BBSJ 2K40A 4A3IJ 1SFOJ 3A01B 1AKHB 9ANTA 1MBHA 2XPVA 5EEAA 2DMUA 4W97A 2M8GX 2VI6A 2Y2ZA 5C4JJ 2MSYA 1UG2A 1BJZA 3HOWJ 5GP9A 2DA1A 3FIWA 4UUTA 3ZQLA 3M4OJ 2LP0A 3S1MJ 5F0CA 1ETXA 3SFIA 1HDDC 1Z77A 4MO7A 1FJLA 2X6OA 1HDPA 4CYCA 4JX6A 5EGOA 1U8BA 2L9RA 2TRTA 3OSFA 5FLVA 3HEFA 3QQAA 1GDTA 3TP3A 3PO2J 3JRBA 3BR0A 1ZK8A 1F36A 5DS9A 5FKOA 2E2HJ 4RDUA 1ITYA 2HQ5A 3PM1A 3JRIA 3LNQA 2TCTA 4DYRA 2NS7A 3S17J 4A69C 4AYBN 4CYCB 1FTZA 3B6CA 2AHQA 5F27A 4JYKA 1MSEC 3LSPA 1LFUP 4D5CA 1AHDP 2MW8A 2LKXA 4S0HB 4FE7A 5E3LA 1GV5A 2M9HA 1JJ8C 3F0CA 1T33A 4A3KJ 2WAQN 3G1LA 2MG4A 3DEWA 1PUFA 1XS9A 2XPWA 2LR8A 2XGEA 2DJNA 1A6IA 2EZHA 5E3OA 2XRLA 3BG3A 3O8GA 3UKGA 1B8IA 4AUXA 3A01A 1DU6A 1GT0C 2CU7A 4DZPA 3QPLA 4X1EA 1PUFB 1OJLA 5EYRA 4XK4A 3OOUA 2NVYJ 3JRAA 1JKOC 3SJMA 4M3DA 4IHVA 1VI0A 3IH4A 1NK2P 4M6VA 3CQZJ 2FD5A 2Y0SN 4DW6A 3BR2A 4D5FA 2OF7A 3DCFA 1UMQA 1T56A 5EDNA 1XG1A 1YRNB 2KDZA 2LK2A 1VNDA 3ZQGA 4XRSA 1MBJA 1RESA 3ZQHA 1LE8A 1QPIA 3GTJJ 3BR5A 2H1KA 4IHXA 4BY1J 1TC3C 2X48A 1RKTA 2HOAA 2L7FP 2YUSA 3RKQA 3OSGA 3M3YJ 5M5WJ 1BW6A 1ZTRA 2XGDA 5FKNA 2XB5A 2JA6J 4IHYA 4XICA 2E1OA 5E3NA 4UUSA 4D7MA 5DTDA 1S7EA 3BR3A 3TW6A 5J1UA 2JK3A 2EZKA 1K83J 2DTZA 2R93J 3FK7A 5IPAA 4M3EA 3ZOBA 1IJWC 3Q0WA 4V2FA 1I50J 1ZGWA 3MN2A 2VUMJ 3HOUJ 3HOYJ 2CJJA 1F43A 3BTIA 3BR1A 1IV6A 4W1UA 3WHCA 2MGQA 3JRCA 2NVTJ 5M5XJ 1JKQC 2XSDC 3RZDJ 1GUUA 2YS9A 4M3GA 3HDDA 1W0UA 3HOXJ 1AKHA 4A93J 2IAIA 4JX4A 1BW5A 1ENHA 2DA2A 3JRFA 5IYCJ 2HI3A 3BTLA 2HDDA 1QVUA 4FE4A 3RQIA 3FISA 5BNGA 1RR7A 2M2EA 5IP9J 2GM4A 4A3GJ 3S1QJ 5F0FA 1FEXA 1ZQ3P 4C3IJ 1TWGJ 1Z0XA 4XRSG 3BG9A 4XRMA 1UHSA 4GFBA 2I10A 3LSRA 4AC0A 4ABZA 4A3CJ 2D5VA 2HOSA 4I76A 2PMZN 1OFCX 2EH3A 4FTHA 1TWHJ 4B4CA 3JRGA 2O9LA 2Y31A 3GTPJ 2E2IJ 4FISA 2NS8A 2YU9J 1SANA 3OIOA 2EZIA 2ZB9A 2CUEA 5K7HA 3Q3SA 3GTGJ 4UUSB 3JREA 3A02A 2IEKA 4JP0A 2FQ4A 3IH3A 4XIDA 1GVDA 1AU7A 1ETQA 3ZQCA 2JA7J 2EZLA 1HLVA 1MBEA 2LTPA 3TW7A 4Y7NJ 2GLOA 5IOYA 3D1NI 5EF6A 1TWCJ 1Y1WJ 1MBFA 2L7MP 1CQTA 2E2JJ 3HGGA 1JGGA 1JKRC 2P81A 5M3FJ 1U9NA 2ME6A 2H8RA 2NVQJ 3GTOJ 2VKVA 4L5EA 3E7LA 3BQZA 1IRZA 5F08A 1FIPA 1VFCA 1HF0A 1FIAA 4DZJA 4BKXA 1ZKGA 3CMYA 3S14J 3WHBA 3LSGA 2JJ7A 3H0GJ 3BQYA 2R5ZB 2O8KA 1POGA 2HYJA 2WV1A 3C2BA 2K9NA 1IGNA 5FKKA 3TP0A 5F04A 1FTTA 2JA8J 3IH2A 4DYQA 3Q0UA 3Q0VA 4DYCA 3GBGA 4M3BA 4D7NA 2AO9A 2EBIA 1D5YA 3FKIJ 1X58A 1MBGA 1NK3P 2JN6A 2EQRA 1B72A 1RETA 2XGCA 1ETWA 1NTCA 1MSFC 3JRHA 3S16J 4QIWN 3GTQJ 3O8HA 5FKMA 1LE8B 1ETYA 2ID6A 2IBDA 1QVTA 5FKLA 4NDLA 3G1MA 4MIMA 2NVXJ 5HODA 1B72B 1K61A 3ZQIA 2DMTA 4I6ZA 4J19A 3HKZN 2XPUA 1GV2A 1JTXA 2R0QC 3LOCA 1HOMA 1ETVA 1JTYA 1X2MA 1BA5A 1MH4A 2VPRA 3H3VK 3BTCA 5M3MJ 1E3OC 2LY9A 3HM5A 1H89C 1OCTC 1TWAJ 5F1JA 2FJ1A 1A5JA 3BT9A 3IV5A 5K7ZA 2HXOA 2R5ZA 2HXIA 1JJ6C 4A3MJ 3GTMJ 1YRNA 5K7FA 1VF9A 2R7ZJ 1OCPA 1X2NA 1U78A 1LFBA 2L7ZA 2E19A 4A3BJ 1XC5A 2GBYA 2Y9YA 3G1OA 3K7AJ 3MKLA 5C4XJ 4C2MJ 2DA5A 1G2HA 2CRGA 1IC8A 5E3MA 3BG5A 1HCRA 2B63J 3VPRA 1APLC 5FJ8J 2DA6A 2DA3A 2ECCA 4C3HJ 2COBA 2O7OA 1ZR2A 1ETOA 1IUFA 1WCMJ 2LVSA 4MLOA 2G0EA 1IG7A 3CCYA 1MBKA 3GTKJ 5GPCA 1P7JA 4A3JJ 1P7IA 1WH7A 2LD5A 1ORKA 2KT0A 2LFBA 3W6VA 3GTLJ 5JLWA 1JUPA 5IP6A 2K9QA 2R92J 4LOCA 5EZGA 4G12A 4RBOA 2XB0X 2DMPA 4Y52J 3JRDA 2Y9ZA 1ETKA 4JX5A 1R9TJ 4IEJA 5J1RA 3BTJA 1B8IB 1QRYA 2DA7A 5EG0B 4A3DJ 5GPAA 1TWFJ 4C3JJ 2RAEA 3HB9A 5IYBJ 1JT0A 2N8GA 3S1RJ 4A3EJ 4MFDA 1JUMA 3HOVJ 4HNVA 4X6AJ 5EZHA 3PO3J 4BY7J 4QTRA 3I4MJ 3L1PA 4B3AA 2JA5J 3HOZJ 2CQQA 3ZQFA 3BR6A 1U9OA 3CDLA 3JR9A 1Q1VA 4EEFG 2FX0A 1IDZA 2JMWA 2DMQA 1W0TA 5IOZA 4MFEA 2LLKA 3HGYA 1JKPC 2ID3A 2NOGA 5FLMJ 4BXXJ 1WI3A 1WH5A 3S2HJ 2WB1N 2DMNA 2Y30A 3B6AA 1MNMC 1H88C 3I4NJ 5C44J 1O4XA 3FK6A 5M5YJ 1EF4A 1I6HJ 3A03A 2DA4A 3HBLA 1RPWA 5IYDJ 1MH3A 3K2AA 2JWTA 5C3EJ 3TEDA 2OPTA 1WGXA 4A3FJ 2QCOA 3S2DJ 2R5YA 2QF7A 1I3QJ 5EGOB 3NARA 1WPKA 1IDYA 2K9SA 2ELKA 4IHWA 5J3LA 2ECBA 1BL0A 2CUFA 2ME0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCY A;  2M0C A;  2M34 A;  3SDG A;  3S15 J;  5IP7 J;  3S1N J;  4QSH A;  5J1Y A;  2R5Y B;  2DN0 A;  3RZO J;  1H8A C;  1JUS A;  3QPS A;  2HOT A;  4V2G A;  4B1R A;  2L0K A;  2W48 A;  2CQX A;  5EG0 A;  1ZR4 A;  3LSJ A;  3MVP A;  1DU0 A;  1RKW A;  4A3L J;  4BBR J;  1Y1V J;  2X9D A;  5JLX A;  2VKE A;  1JT6 A;  3NAU A;  4M3F A;  5F0H A;  4BBS J;  2K40 A;  4A3I J;  1SFO J;  3A01 B;  1AKH B;  9ANT A;  1MBH A;  2XPV A;  5EEA A;  2DMU A;  4W97 A;  2M8G X;  2VI6 A;  2Y2Z A;  5C4J J;  2MSY A;  1UG2 A;  1BJZ A;  3HOW J;  5GP9 A;  2DA1 A;  3FIW A;  4UUT A;  3ZQL A;  3M4O J;  2LP0 A;  3S1M J;  5F0C A;  1ETX A;  3SFI A;  1HDD C;  1Z77 A;  4MO7 A;  1FJL A;  2X6O A;  1HDP A;  4CYC A;  4JX6 A;  5EGO A;  1U8B A;  2L9R A;  2TRT A;  3OSF A;  5FLV A;  3HEF A;  3QQA A;  1GDT A;  3TP3 A;  3PO2 J;  3JRB A;  3BR0 A;  1ZK8 A;  1F36 A;  5DS9 A;  5FKO A;  2E2H J;  4RDU A;  1ITY A;  2HQ5 A;  3PM1 A;  3JRI A;  3LNQ A;  2TCT A;  4DYR A;  2NS7 A;  3S17 J;  4A69 C;  4AYB N;  4CYC B;  1FTZ A;  3B6C A;  2AHQ A;  5F27 A;  4JYK A;  1MSE C;  3LSP A;  1LFU P;  4D5C A;  1AHD P;  2MW8 A;  2LKX A;  4S0H B;  4FE7 A;  5E3L A;  1GV5 A;  2M9H A;  1JJ8 C;  3F0C A;  1T33 A;  4A3K J;  2WAQ N;  3G1L A;  2MG4 A;  3DEW A;  1PUF A;  1XS9 A;  2XPW A;  2LR8 A;  2XGE A;  2DJN A;  1A6I A;  2EZH A;  5E3O A;  2XRL A;  3BG3 A;  3O8G A;  3UKG A;  1B8I A;  4AUX A;  3A01 A;  1DU6 A;  1GT0 C;  2CU7 A;  4DZP A;  3QPL A;  4X1E A;  1PUF B;  1OJL A;  5EYR A;  4XK4 A;  3OOU A;  2NVY J;  3JRA A;  1JKO C;  3SJM A;  4M3D A;  4IHV A;  1VI0 A;  3IH4 A;  1NK2 P;  4M6V A;  3CQZ J;  2FD5 A;  2Y0S N;  4DW6 A;  3BR2 A;  4D5F A;  2OF7 A;  3DCF A;  1UMQ A;  1T56 A;  5EDN A;  1XG1 A;  1YRN B;  2KDZ A;  2LK2 A;  1VND A;  3ZQG A;  4XRS A;  1MBJ A;  1RES A;  3ZQH A;  1LE8 A;  1QPI A;  3GTJ J;  3BR5 A;  2H1K A;  4IHX A;  4BY1 J;  1TC3 C;  2X48 A;  1RKT A;  2HOA A;  2L7F P;  2YUS A;  3RKQ A;  3OSG A;  3M3Y J;  5M5W J;  1BW6 A;  1ZTR A;  2XGD A;  5FKN A;  2XB5 A;  2JA6 J;  4IHY A;  4XIC A;  2E1O A;  5E3N A;  4UUS A;  4D7M A;  5DTD A;  1S7E A;  3BR3 A;  3TW6 A;  5J1U A;  2JK3 A;  2EZK A;  1K83 J;  2DTZ A;  2R93 J;  3FK7 A;  5IPA A;  4M3E A;  3ZOB A;  1IJW C;  3Q0W A;  4V2F A;  1I50 J;  1ZGW A;  3MN2 A;  2VUM J;  3HOU J;  3HOY J;  2CJJ A;  1F43 A;  3BTI A;  3BR1 A;  1IV6 A;  4W1U A;  3WHC A;  2MGQ A;  3JRC A;  2NVT J;  5M5X J;  1JKQ C;  2XSD C;  3RZD J;  1GUU A;  2YS9 A;  4M3G A;  3HDD A;  1W0U A;  3HOX J;  1AKH A;  4A93 J;  2IAI A;  4JX4 A;  1BW5 A;  1ENH A;  2DA2 A;  3JRF A;  5IYC J;  2HI3 A;  3BTL A;  2HDD A;  1QVU A;  4FE4 A;  3RQI A;  3FIS A;  5BNG A;  1RR7 A;  2M2E A;  5IP9 J;  2GM4 A;  4A3G J;  3S1Q J;  5F0F A;  1FEX A;  1ZQ3 P;  4C3I J;  1TWG J;  1Z0X A;  4XRS G;  3BG9 A;  4XRM A;  1UHS A;  4GFB A;  2I10 A;  3LSR A;  4AC0 A;  4ABZ A;  4A3C J;  2D5V A;  2HOS A;  4I76 A;  2PMZ N;  1OFC X;  2EH3 A;  4FTH A;  1TWH J;  4B4C A;  3JRG A;  2O9L A;  2Y31 A;  3GTP J;  2E2I J;  4FIS A;  2NS8 A;  2YU9 J;  1SAN A;  3OIO A;  2EZI A;  2ZB9 A;  2CUE A;  5K7H A;  3Q3S A;  3GTG J;  4UUS B;  3JRE A;  3A02 A;  2IEK A;  4JP0 A;  2FQ4 A;  3IH3 A;  4XID A;  1GVD A;  1AU7 A;  1ETQ A;  3ZQC A;  2JA7 J;  2EZL A;  1HLV A;  1MBE A;  2LTP A;  3TW7 A;  4Y7N J;  2GLO A;  5IOY A;  3D1N I;  5EF6 A;  1TWC J;  1Y1W J;  1MBF A;  2L7M P;  1CQT A;  2E2J J;  3HGG A;  1JGG A;  1JKR C;  2P81 A;  5M3F J;  1U9N A;  2ME6 A;  2H8R A;  2NVQ J;  3GTO J;  2VKV A;  4L5E A;  3E7L A;  3BQZ A;  1IRZ A;  5F08 A;  1FIP A;  1VFC A;  1HF0 A;  1FIA A;  4DZJ A;  4BKX A;  1ZKG A;  3CMY A;  3S14 J;  3WHB A;  3LSG A;  2JJ7 A;  3H0G J;  3BQY A;  2R5Z B;  2O8K A;  1POG A;  2HYJ A;  2WV1 A;  3C2B A;  2K9N A;  1IGN A;  5FKK A;  3TP0 A;  5F04 A;  1FTT A;  2JA8 J;  3IH2 A;  4DYQ A;  3Q0U A;  3Q0V A;  4DYC A;  3GBG A;  4M3B A;  4D7N A;  2AO9 A;  2EBI A;  1D5Y A;  3FKI J;  1X58 A;  1MBG A;  1NK3 P;  2JN6 A;  2EQR A;  1B72 A;  1RET A;  2XGC A;  1ETW A;  1NTC A;  1MSF C;  3JRH A;  3S16 J;  4QIW N;  3GTQ J;  3O8H A;  5FKM A;  1LE8 B;  1ETY A;  2ID6 A;  2IBD A;  1QVT A;  5FKL A;  4NDL A;  3G1M A;  4MIM A;  2NVX J;  5HOD A;  1B72 B;  1K61 A;  3ZQI A;  2DMT A;  4I6Z A;  4J19 A;  3HKZ N;  2XPU A;  1GV2 A;  1JTX A;  2R0Q C;  3LOC A;  1HOM A;  1ETV A;  1JTY A;  1X2M A;  1BA5 A;  1MH4 A;  2VPR A;  3H3V K;  3BTC A;  5M3M J;  1E3O C;  2LY9 A;  3HM5 A;  1H89 C;  1OCT C;  1TWA J;  5F1J A;  2FJ1 A;  1A5J A;  3BT9 A;  3IV5 A;  5K7Z A;  2HXO A;  2R5Z A;  2HXI A;  1JJ6 C;  4A3M J;  3GTM J;  1YRN A;  5K7F A;  1VF9 A;  2R7Z J;  1OCP A;  1X2N A;  1U78 A;  1LFB A;  2L7Z A;  2E19 A;  4A3B J;  1XC5 A;  2GBY A;  2Y9Y A;  3G1O A;  3K7A J;  3MKL A;  5C4X J;  4C2M J;  2DA5 A;  1G2H A;  2CRG A;  1IC8 A;  5E3M A;  3BG5 A;  1HCR A;  2B63 J;  3VPR A;  1APL C;  5FJ8 J;  2DA6 A;  2DA3 A;  2ECC A;  4C3H J;  2COB A;  2O7O A;  1ZR2 A;  1ETO A;  1IUF A;  1WCM J;  2LVS A;  4MLO A;  2G0E A;  1IG7 A;  3CCY A;  1MBK A;  3GTK J;  5GPC A;  1P7J A;  4A3J J;  1P7I A;  1WH7 A;  2LD5 A;  1ORK A;  2KT0 A;  2LFB A;  3W6V A;  3GTL J;  5JLW A;  1JUP A;  5IP6 A;  2K9Q A;  2R92 J;  4LOC A;  5EZG A;  4G12 A;  4RBO A;  2XB0 X;  2DMP A;  4Y52 J;  3JRD A;  2Y9Z A;  1ETK A;  4JX5 A;  1R9T J;  4IEJ A;  5J1R A;  3BTJ A;  1B8I B;  1QRY A;  2DA7 A;  5EG0 B;  4A3D J;  5GPA A;  1TWF J;  4C3J J;  2RAE A;  3HB9 A;  5IYB J;  1JT0 A;  2N8G A;  3S1R J;  4A3E J;  4MFD A;  1JUM A;  3HOV J;  4HNV A;  4X6A J;  5EZH A;  3PO3 J;  4BY7 J;  4QTR A;  3I4M J;  3L1P A;  4B3A A;  2JA5 J;  3HOZ J;  2CQQ A;  3ZQF A;  3BR6 A;  1U9O A;  3CDL A;  3JR9 A;  1Q1V A;  4EEF G;  2FX0 A;  1IDZ A;  2JMW A;  2DMQ A;  1W0T A;  5IOZ A;  4MFE A;  2LLK A;  3HGY A;  1JKP C;  2ID3 A;  2NOG A;  5FLM J;  4BXX J;  1WI3 A;  1WH5 A;  3S2H J;  2WB1 N;  2DMN A;  2Y30 A;  3B6A A;  1MNM C;  1H88 C;  3I4N J;  5C44 J;  1O4X A;  3FK6 A;  5M5Y J;  1EF4 A;  1I6H J;  3A03 A;  2DA4 A;  3HBL A;  1RPW A;  5IYD J;  1MH3 A;  3K2A A;  2JWT A;  5C3E J;  3TED A;  2OPT A;  1WGX A;  4A3F J;  2QCO A;  3S2D J;  2R5Y A;  2QF7 A;  1I3Q J;  5EGO B;  3NAR A;  1WPK A;  1IDY A;  2K9S A;  2ELK A;  4IHW A;  5J3L A;  2ECB A;  1BL0 A;  2CUF A;  2ME0 A; 
#chains in the Genus database with same CATH topology
 2PX9 A;  3L2W A;  5KAF C;  2V1D A;  1SD5 A;  4LG0 A;  4CA0 A;  2WA0 A;  3RZO J;  2HKX A;  2H6B A;  1BOB A;  1BIA A;  2XAQ A;  2K27 A;  1H8A C;  2L7K A;  2DFH A;  2G9W A;  4V2G A;  4B1R A;  1U8R A;  1SEU A;  3IRQ A;  4HF0 A;  2E5Z A;  3ML6 A;  2VOD A;  4PZJ A;  2P7V B;  3PNT A;  4XRF A;  3KP5 A;  3R6S A;  3F8N A;  4BYY A;  5HS9 A;  3MKW B;  2V1N A;  3FBI B;  4A3L J;  1V5F A;  4IHT A;  5IT9 K;  4BBR J;  1TW3 A;  2JTV A;  4GCV A;  2VKE A;  1YE9 A;  4KMU X;  3R60 A;  4M3F A;  2D45 A;  2LG4 A;  3OIQ A;  1LKX A;  1X3U A;  2K40 A;  1R5H A;  1E0E A;  5JFR A;  2ZO4 A;  3A4C A;  3GME A;  2QBY A;  2R7S A;  5E8I A;  2JPB A;  1IRX A;  1DQU A;  4LB6 B;  3I64 A;  3RKY A;  2FBK A;  3IKV A;  5FFX A;  3SEQ A;  1Q1H A;  4LLN A;  5KAI C;  1QZE A;  2DMU A;  3SXY A;  2HZT A;  1FLI A;  5CKT A;  2FMY A;  2OQG A;  2Y2Z A;  4ITV A;  1AOY A;  2MSY A;  3PNV A;  3HOW J;  1S7O A;  4UVB A;  2D2W A;  3OYI A;  3DF8 A;  2R4G A;  3TOB A;  1RR8 C;  2XHK A;  2GIV A;  3IWF A;  1ZHF A;  3RYP A;  3CLQ A;  1FBU A;  5EGO A;  5D6F A;  4NB5 A;  4HRI A;  2L9R A;  3K9T A;  3L7W A;  3HEF A;  3OYC A;  2Z99 A;  4M72 A;  2NAZ A;  3TP3 A;  1YIO A;  3JRB A;  3U21 A;  1ZK8 A;  5DS9 A;  3CCL I;  5H6Q A;  2PMH A;  3P9C A;  3PM1 A;  2VB6 A;  3ZGK A;  1W5T A;  1Z67 A;  2K02 A;  2TCT A;  3LNQ A;  1F5T A;  2PLY A;  1HQC A;  3TDZ C;  4A69 C;  2PG4 A;  1DGW Y;  3HL2 A;  2AHQ A;  2K3P A;  3FMQ A;  4ENN A;  1MSE C;  4UVC A;  4PJL A;  1BM9 A;  5CVU A;  1AHD P;  2XAJ A;  3M8J A;  4EM2 A;  1LQ1 A;  4S0H B;  1YOV B;  4A6D A;  1VQP I;  2EFW A;  4PUS A;  4U87 A;  3GZ5 A;  1ZG1 A;  1X19 A;  2JPC A;  2V4J C;  3MQ0 A;  3BLY A;  3G1L A;  4NBQ A;  3DEW A;  1PP8 F;  2OV7 A;  1XS9 A;  2BXZ A;  2LR8 A;  4GDF A;  1TQM A;  3DTI A;  4RGR A;  2OJE D;  3IL2 A;  1A6I A;  2EZH A;  3BG3 A;  1B8I A;  3E3V A;  1YQA A;  2X4H A;  5EEG A;  5TIS C;  5J4Y A;  3W2A A;  2E1C A;  4DZP A;  3QRF F;  4PK4 A;  1HKS A;  3PUB A;  1LVK A;  1XSD A;  1OJL A;  5EYR A;  1YX3 A;  4HYE A;  3F8F A;  4KN4 X;  2NS0 A;  4Q4Z F;  3ECH A;  1J2X A;  4M3D A;  4LK1 F;  5J47 A;  3IH4 A;  2PMZ A;  2E5N A;  2FD5 A;  2WY8 Q;  2Y0S N;  1DGR M;  2QEN A;  3BP8 A;  1SVM A;  4DW6 A;  2EV5 A;  3X2Q H;  1SVO A;  2OF7 A;  5HDG A;  1UMQ A;  2FE3 A;  1T56 A;  3I53 A;  4XMY A;  4EJO A;  5EDN A;  2BW3 B;  4L0Y B;  1BR4 A;  1B59 A;  5B1A H;  2VLA A;  4Y15 A;  1ZGA A;  4NQW B;  2BY1 A;  2W00 A;  3ZQG A;  1SD6 A;  1YX5 A;  3AL0 C;  4XRS A;  4IOA F;  4JBA A;  1LEA A;  3KLO A;  5GAH J;  1SFE A;  2FXA A;  3BR5 A;  3ABK H;  1HW5 A;  3K4M A;  3K4N A;  4U7D A;  4IHX A;  5E1Z B;  2X48 A;  4EM1 A;  2L7F P;  3RKQ A;  5BPI A;  3OSG A;  3ULQ B;  2XSJ C;  1RIO H;  3CDI A;  4KIG A;  4CGZ A;  3V7C A;  3OYB A;  1MW7 A;  3DBL B;  3VYT B;  4IHY A;  1JGS A;  4XIC A;  2XF6 A;  3K69 A;  3TL4 X;  2E1O A;  3Q9S A;  2KFD A;  4UUS A;  5JHF A;  2ICW G;  4D7M A;  1S7E A;  3BR3 A;  3W3C A;  3ZQ7 A;  1LDK B;  2GQQ A;  2ZKZ A;  2F2E A;  1MND A;  2YU3 A;  3TGN A;  2R93 J;  3QOE A;  3CTA A;  1I50 J;  2Z33 A;  3NEU A;  1ZGW A;  2VUM J;  1WI9 A;  3GLL A;  4OIO F;  1DP3 A;  4OAZ A;  1O3S A;  3WHC A;  1IXC A;  1VQL I;  1S5L C;  1R4M B;  2X6Y A;  1JKQ C;  2F5C A;  1KU7 A;  3CC7 I;  3KZI C;  3K2Z A;  2XSD C;  2NNN A;  2K9L A;  3RKW A;  3HDD A;  1UHW A;  3EUA A;  4BHP A;  1T95 A;  2IAI A;  1P2F A;  4JX4 A;  4CSW A;  2IVM A;  2CSO A;  2LRD A;  2W82 A;  3BTL A;  5E18 F;  3FIS A;  1RR7 A;  2M2E A;  3VB2 A;  3E5Q A;  5IP9 J;  1IO2 A;  5F0F A;  2RKH A;  5IT3 A;  1OLT A;  2MAB A;  2HFH A;  1K6O A;  4C3I J;  2FU4 A;  4L9N A;  2M7B A;  4RB1 A;  4XRS G;  1FC3 A;  3E6B A;  5DM6 F;  4IVN A;  2LRE A;  1MZB A;  4HF2 A;  3VEP A;  1WKM A;  4AC0 A;  1ZG3 A;  1EV7 A;  2V9K A;  3LA2 A;  2OU2 A;  4A3C J;  1M1E B;  2D5V A;  4O5V A;  2PMZ N;  3KZZ A;  2GA1 A;  2PQ8 A;  2X6W A;  4B4C A;  2Y31 A;  3GTP J;  4BHC A;  1ODD A;  4KIT B;  5ICG A;  3OYH A;  3IRR A;  2PI0 A;  1SAN A;  2YU9 J;  3LSH A;  3OL4 A;  3N4M A;  4ESB A;  3Q3S A;  1R71 A;  3ZPL A;  2IEK A;  4NC7 A;  3IH3 A;  4BAC A;  1AU7 A;  1TNS A;  2EZL A;  5DEQ A;  2B9S A;  2LTP A;  5J8F A;  5IOY A;  5CPR B;  2L7M P;  1K79 A;  3GEZ A;  4C9Y A;  4DGW B;  1IZ1 A;  3UR3 C;  3DBR B;  3WOD F;  3J7Y J;  2P81 A;  5M3F J;  2NVQ J;  4LLG F;  2EJR A;  3CF2 A;  3E7L A;  2R3S A;  3BCA A;  1IRZ A;  4HSR A;  2CGP A;  4KIC A;  1WQ2 A;  3ELK A;  4CCJ A;  1FP1 D;  1J59 A;  1YFH A;  4QPO A;  1B9N A;  4BKX A;  2HTJ A;  3S14 J;  1W7P B;  3WHB A;  2EPF A;  2H8W A;  5LRR A;  2A07 F;  3BQY A;  5CQE A;  1POG A;  2X1E A;  2QUF A;  1QHG A;  3VYS B;  5K5Q A;  3CC2 I;  2K9N A;  1IGN A;  5FKK A;  1FTT A;  5F04 A;  3IH2 A;  3Q0U A;  1W36 C;  4MTE A;  2CV2 A;  2VON A;  1XN7 A;  3GFI A;  1YW9 A;  4BQO A;  1OYY A;  1P4W A;  2EBI A;  3IWZ A;  3FHN A;  1H9G A;  1D5Y A;  3T1B A;  1D0Y A;  1R5G A;  4M71 A;  3CUQ B;  1NK3 P;  1OYW A;  2EQR A;  1IAW A;  2PJR A;  5E1W A;  3ABM H;  2VIX A;  1XGO A;  2A68 F;  3JRH A;  2GWR A;  2P8T A;  3GTQ J;  2CV1 A;  5FKM A;  3PUF A;  1LE8 B;  2D1V A;  2ZCW A;  4UUV A;  3KP3 A;  1UB9 A;  4ESJ A;  2HVS A;  4HG2 A;  2COM A;  1J5Y A;  5D8L B;  2CFO A;  4NDL A;  5DUK A;  1B72 B;  3KYC B;  1K61 A;  1R1U A;  2A3S A;  2WAE A;  1ON2 A;  2DOD A;  4LLL A;  3CCM I;  5GAD J;  1GV2 A;  1JTX A;  2KIQ A;  2CH0 A;  4LB5 A;  5LD2 C;  4HF1 A;  4DJA A;  4BQN A;  3GUD A;  5ICC A;  1JTY A;  1LVA A;  2Y69 H;  1E3O C;  4KMF A;  3WGH A;  1OCT C;  2LC2 A;  1TWA J;  3T8T A;  3BT9 A;  2QWW A;  3IV5 A;  2IS1 A;  3RKX A;  2DPU A;  1YW7 A;  5K5R A;  3KP2 A;  2HXI A;  3DP7 A;  1X1C A;  4OOI A;  2WTE A;  5K7F A;  3TDU C;  5TRD A;  1JI8 A;  1TQP A;  3U1D A;  5FFZ A;  5ICE A;  1XC5 A;  4QWQ A;  5D4S A;  4N0B A;  3MKL A;  3DTK A;  4WF2 A;  3LSK A;  2ZXJ A;  3HIF A;  2QVO A;  1WSU A;  3MWM A;  3BG5 A;  2ECC A;  5JVG F;  3CJT B;  2BHZ A;  2HQN A;  1I1S A;  1UCR A;  4P5O A;  1IUF A;  2LVS A;  3JAM K;  1MJ9 A;  4MLO A;  4UXN A;  1MDM B;  2OCC H;  3CO6 C;  3EUH A;  3E6M A;  1ZRD A;  3S3N A;  3GTK J;  4RAZ A;  2BW3 A;  2M45 A;  2VN2 A;  3WTU C;  3P9I A;  4A3J J;  5CVI A;  1P7I A;  2OQR A;  2LD5 A;  1ORK A;  2KT0 A;  2LFB A;  4PFP A;  4LOC A;  4YFX F;  3MKY B;  2X6X A;  4O3M A;  2DMP A;  3SZG A;  3KEO A;  3HPH A;  1ETK A;  1R49 A;  2XVC A;  4JX5 A;  1R9T J;  4U0W A;  4IEJ A;  3DBH B;  2CW8 A;  3O6B B;  2IW5 A;  2EFO A;  3AG3 H;  4Y13 A;  5EG0 B;  3E5U A;  3CES A;  2L5Q A;  1TWF J;  2LY1 A;  2DW4 A;  1F1Z A;  1JUM A;  4HNV A;  1Y56 A;  1R00 A;  1EH7 A;  2A6T A;  5F64 A;  2ZJR F;  5FB2 A;  2CWE A;  5EZH A;  4QTR A;  2E60 A;  2VBX A;  2JA5 J;  3HOZ J;  4F55 A;  1VQ9 I;  4II3 A;  4EEF G;  4BJT A;  2FX0 A;  2JMW A;  2IJL A;  2LLK A;  2HPI A;  3HGY A;  1FPQ A;  2P5L C;  4BXX J;  1WI3 A;  3LAP A;  1XSV A;  2Y30 A;  3B6A A;  2O03 A;  3DU5 A;  2BV6 A;  3DFG A;  5C44 J;  3FK6 A;  1QZZ A;  2VT3 A;  2RNG A;  2AS5 F;  2KL4 A;  3LMM A;  2XIG A;  1LDD A;  1K7A A;  4BUP A;  2OA4 A;  4RM3 A;  2CV0 A;  2CQK A;  1ZH5 A;  2BY2 A;  2UV1 A;  2XAH A;  3UNG C;  4DOZ A;  4A3F J;  1LFP A;  3FMR A;  3I71 A;  3S2D J;  1I3Q J;  4L9V A;  2LBF A;  2AQF A;  3BG7 A;  2YX7 A;  2H94 A;  2K4B A;  3PIO F;  3K4J A;  2A5Y B;  4CIC A;  2HEO A;  2DPD A;  1MMA A;  1X4P A;  4RB3 C;  2EFP A;  2ZBK A;  4QSH A;  3G4S I;  2R5Y B;  3PFI A;  4AID A;  3BZC A;  1DP7 P;  3QPS A;  1S8N A;  2UWM A;  5ILV A;  4KJZ A;  4UVA A;  2L0K A;  1U5T C;  3H1C A;  1RI7 A;  4OIR F;  3MVP A;  2XRO A;  1I6X A;  4AM3 A;  5HDK A;  2FEZ A;  2KHM A;  2BEO A;  3FXM A;  3W6J B;  1JT6 A;  3OYA A;  3CO7 C;  3RPU A;  2M4G A;  5ED4 A;  1BC7 C;  2WAQ A;  1X3W B;  2IXS A;  1SFK A;  3SEZ A;  2PN6 A;  4E7H A;  1D3Y A;  3QYF A;  3O2P E;  2GOM A;  1YJ9 I;  3V8L A;  2VJ4 A;  3HUG B;  4BEH B;  3A01 B;  1AKH B;  1F9N A;  2W1O A;  3CF5 F;  2E36 A;  4CHU A;  4L9T A;  2M8G X;  2KQR A;  3V7S A;  5C4J J;  5HNF A;  5JR3 A;  4RGU A;  1KYW A;  3Q5F A;  2VOO A;  2DA1 A;  1RC9 A;  2ZJ2 A;  4XLN F;  3ZQL A;  1XDU A;  2LP0 A;  5HLG A;  2RNJ A;  5F0C A;  4KDP A;  2PMU A;  2X6O A;  4CYC A;  2K7L A;  3K70 D;  4JX6 A;  2MH2 A;  2LH9 A;  4EVI A;  1SAU A;  2DQR A;  4YEL A;  3BR0 A;  1KON A;  1ACI A;  3LA3 A;  5FKO A;  3CUQ C;  1FOY A;  4CCM A;  2C6Y A;  4PGH A;  4AYB N;  3B6C A;  3Q9V A;  3OYL A;  2CW7 A;  5F27 A;  4BJ5 C;  4LGW A;  3QAH A;  1EA3 A;  3FF5 A;  3CME I;  3H36 A;  4ZH4 F;  4BQA A;  2ZXW H;  1TQI A;  1H9T A;  1GV5 A;  2IA2 A;  3FXO A;  4Y3O A;  2M9H A;  1T33 A;  4UV8 A;  3C2H A;  2DFF A;  2FNP A;  2MG4 A;  4UV9 A;  3WU0 A;  1ZGJ A;  4RS8 A;  3VWB A;  2ESH A;  2XPW A;  3CCU I;  3KYD B;  2DJN A;  1CGP A;  5KK1 A;  1VQ7 I;  2XRL A;  3O8G A;  4HAM A;  4H4K C;  2F4O B;  4AUX A;  4M9Z A;  5LLQ A;  5LEJ A;  3HUG A;  4BEH A;  3A01 A;  1WJD A;  1Z7L A;  5B3S H;  5DCM B;  2ISY A;  1R23 A;  1WJE A;  1BJA A;  4PDK A;  2RN7 A;  4RB0 A;  5DYM A;  3QPL A;  5LRS A;  3ZXS A;  5L3G A;  3JRA A;  2XF5 A;  2IPQ X;  1TP4 A;  1S7A A;  5GAE J;  3MKZ A;  2E35 A;  5J6X A;  4Z6Y A;  1D5V A;  3CCS I;  2MBF A;  1VI0 A;  1NK2 P;  3ROU A;  3CQZ J;  2DO7 A;  4B09 A;  3WTS C;  1G3T A;  4BNC A;  1QU3 A;  2M0M A;  3H3Z A;  2EA4 A;  1R6R A;  3QOP A;  3HOT A;  3LSI A;  1D8K A;  5KNL A;  1XG1 A;  2WC2 A;  2KDZ A;  2LK2 A;  3GXO A;  1D0X A;  2DAO A;  3ZMD A;  3M1E A;  1MIJ A;  2NNY A;  3M8E A;  3OWT A;  2CQ7 A;  1B6A A;  3C7J A;  5D5X B;  3BJ6 A;  2ACJ A;  2A6E F;  2HVR A;  2E1M C;  3GTJ J;  4L9J A;  5FGM A;  2BY0 A;  1TC3 C;  4M9S A;  3L2U A;  3K0L A;  2YUS A;  3NWT A;  3KE2 A;  4XN0 A;  4XL9 A;  2XRN A;  5D5W B;  1FMV A;  3MFK A;  3HHH A;  1O7F A;  2XGD A;  4HV6 A;  5FKN A;  2JA6 J;  2MD5 A;  4WCG A;  2ZNZ A;  1VQO I;  5J1U A;  2EZK A;  4R79 A;  2K9M A;  4I2O A;  2F5F A;  2IP2 A;  4OIP F;  3FK7 A;  4FQG A;  2Q8K A;  3ZOB A;  1IJW C;  4V2F A;  3HOU J;  3HOY J;  2X85 A;  2CJJ A;  2ZFU A;  3G6E I;  1F43 A;  1BI3 A;  1E3H A;  2HQA A;  2DQL A;  2MGQ A;  1PVE A;  5JI6 A;  4WWC A;  3JRC A;  4EMS A;  3FX3 A;  2JT1 A;  4LIT A;  4ESF A;  1OCR H;  1GUU A;  3AL0 B;  1W0U A;  3KP7 A;  1T2K A;  3F22 A;  3N97 A;  1WJB A;  2BXY A;  2DA2 A;  2H6C A;  3JRF A;  3GW2 A;  3VFZ A;  4LIU A;  3WE3 A;  1QVU A;  4FE4 A;  4MGR A;  4HQM A;  3S1Q J;  4A3G J;  4ZDL A;  3GLX A;  5LGU A;  2K4J A;  4BE0 A;  1YHQ I;  1UFM A;  1Y6I A;  5FD5 A;  4I0B A;  3JSP A;  2RQP A;  4HX7 A;  4XLE A;  3HSF A;  3SZT A;  4XRM A;  3OYF A;  3RPU D;  1T38 A;  2HKO A;  2KIU A;  2I10 A;  4RGX A;  1ZRF A;  4GFB A;  2AXT C;  3LSR A;  4I7H A;  3NWS A;  2O8X A;  4FX0 A;  3A1Y A;  4ABZ A;  5L3C A;  4IRG A;  3CZ6 A;  3F6V A;  3K4B A;  1W1W E;  2L9S A;  2DOE A;  3ABT A;  2HOS A;  2K5C A;  1FNN A;  1ZN2 A;  1UAA A;  2Z1D A;  3JRG A;  2O9L A;  2E2I J;  5CQG A;  4Q5S F;  4FIS A;  5CLS A;  2DU9 A;  1E2X A;  3OIO A;  5L3D A;  5LHH A;  2ZB9 A;  5D5U B;  2CUE A;  5K7H A;  4UUS B;  3JRE A;  3ZR8 X;  2BOL A;  4JP0 A;  3C2G A;  2OZU A;  3MMY B;  1GVD A;  1UJ8 A;  1PUE E;  2VBZ A;  4BXU A;  3J7A Y;  2GLO A;  4Y7N J;  3D1N I;  2STW A;  4QPQ A;  1Y1W J;  2GOX B;  2J5O A;  4HA8 A;  3HGG A;  4A2U A;  2L9N A;  4G8X A;  5D4R A;  2H8R A;  1U9N A;  3B02 A;  3ABL H;  4LD5 A;  3OL3 A;  3W6K B;  3DLL F;  4V19 K;  3H5R A;  2O0Y A;  2HS5 A;  2DK8 A;  3KP4 A;  3F21 A;  1FIP A;  2M4K A;  3GFL A;  2DT6 A;  1YYV A;  1FIA A;  4B47 A;  4DZJ A;  2E71 A;  1D1A A;  2W7N A;  5HVQ C;  1FP2 A;  1ZLK A;  2HYJ A;  4EQQ A;  2R7O A;  2WV1 A;  1V54 H;  3FZV A;  4MEY F;  2Y48 A;  3AG2 H;  1MGT A;  4HEA 2;  2OZ6 A;  4L5J A;  3VYR B;  1YTY A;  2KDO A;  2JA8 J;  3U1K A;  1W7P A;  4ASN A;  2QYO A;  4IRI A;  2IT0 A;  4NNJ A;  4TV7 A;  1E17 A;  3FKI J;  2JVH A;  2KPM A;  1TW2 A;  3DXJ F;  4A12 A;  4P55 A;  3HRU A;  4FX4 A;  1ETW A;  1NTC A;  2E7X A;  2KIF A;  4HV5 A;  4QIW N;  3OS2 A;  2LSO A;  2IBD A;  3HOS A;  2Q2E A;  3CP2 A;  4PFO A;  3K70 C;  4E70 A;  1BR2 A;  1FZP B;  4I02 A;  5IT9 Z;  3OOP A;  4C2T A;  3P9K A;  2NVX J;  1DPU A;  4XSX F;  2VL8 A;  4L18 B;  4I0A A;  4X0G A;  1HKQ A;  4LMY A;  4J19 A;  1T8I A;  2PEX A;  4I98 B;  3FHZ A;  2VOP A;  5E20 A;  3H9G A;  2R0Q C;  4XN3 A;  1W36 D;  2A61 A;  2NYX A;  3H35 A;  3LOC A;  4LIV A;  4S04 A;  3WTX C;  1X2M A;  1BA5 A;  4CDG A;  2DFE A;  2VPR A;  1U5T A;  1WJ5 A;  3BTC A;  3H3V K;  2LY9 A;  3V8K A;  5F1J A;  5D8K B;  1A5J A;  2OTL I;  2RDP A;  5K7Z A;  4F91 B;  4BDY A;  1RZ4 A;  2IS2 A;  2BGC A;  1O7L A;  3GO5 A;  3H3U A;  3V7R A;  2ZME A;  3J7Z I;  3HSR A;  1O57 A;  2GBY A;  2KZG A;  2UXN A;  3JTG A;  1R22 A;  3ZRG A;  4IO9 F;  3OR2 C;  3QYE A;  2CUJ A;  2FUG 2;  4PCQ A;  4XBF A;  2DA5 A;  4OMZ A;  3W2W A;  4OMY A;  1UHM A;  3VPR A;  2KMU A;  5FJ8 J;  2DA6 A;  2DA3 A;  3QP5 A;  2HDC A;  4ON0 A;  5BS6 A;  3CJN A;  1HSJ A;  3DEU A;  1OR7 A;  1JHH A;  1PYV A;  5JVT A;  1A04 A;  3U2R A;  4RAF A;  1U6G A;  2M7A A;  1IG7 A;  3CCY A;  3S3O A;  2Q2E B;  1MBK A;  3G2B A;  3ASO H;  2X1D A;  3J80 K;  4IXA A;  1WH7 A;  2H1L A;  2K9Q A;  3WU2 C;  3M07 A;  3GFJ A;  5EZG A;  2QGU A;  2VBY A;  1R4N B;  3PQK A;  3ONQ A;  4XLH A;  1OCZ H;  1UZC A;  3L9F A;  2XB0 X;  3HSE A;  2P5V A;  1ZEL A;  1Z9C A;  4P1W A;  4E7Z A;  1EH6 A;  4C2U A;  2VE9 A;  3OYE A;  2V9V A;  4HX4 A;  2LMD A;  4WX9 A;  4EGY A;  3FXQ A;  1HKT A;  4U7B A;  1TL8 A;  1MMN A;  4A3D J;  3V42 A;  2OBP A;  2HVQ A;  4XLA A;  3BPX A;  3HB9 A;  2KJC A;  3M7G A;  3RDI A;  1JT0 A;  1HBX G;  4R8H A;  5H6R A;  5FRN A;  3QPT A;  1K4T A;  1QA6 A;  3CJR B;  1SMT A;  2ADU A;  4BY7 J;  4BHB A;  2KP6 A;  5DUI A;  4B3A A;  3I4M J;  2CQQ A;  1VQM I;  1KQ8 A;  1U9O A;  3HZJ A;  4J00 A;  1XGM A;  3K1P A;  2IGO A;  4XOR A;  2L2O A;  4XOT A;  2ID3 A;  2NOG A;  2VAS A;  4CUG A;  3AFH A;  1S9H A;  3TMO A;  4KIS A;  1WH5 A;  2Q0O A;  3MZH A;  3S2H J;  5D5V B;  1O4X A;  1NHA A;  1EF4 A;  3HRS A;  1HC8 A;  1RPW A;  4U0V A;  3RIR A;  4UB8 C;  2RC4 A;  1MH3 A;  6PAX A;  3K2A A;  3PIP F;  2JWT A;  5C3E J;  2WAD A;  5DDG A;  2V26 A;  3WTY C;  4ZTJ A;  1YIT I;  1WGX A;  1R1V A;  2CG4 A;  4Q47 A;  4XKV A;  1YJN I;  1WPK A;  4NC6 A;  3REO A;  1IDY A;  2IGN A;  4CZC A;  5J3L A;  2ECB A;  3ESW B;  2O5R A;  3BZ6 A;  4FCY A;  2FNA A;  2HGC A;  2M0C A;  5ILS A;  3SDG A;  4E7K A;  4ZYH A;  1K4S A;  2M5W A;  2VKD A;  3OMY A;  1IUY A;  1BR1 A;  4N9H A;  5IP7 J;  4UNO A;  2EV6 A;  1J0R A;  2A5W A;  5J1Y A;  3OYK A;  1Z3Y A;  4XLC A;  2HQR A;  2HOT A;  1ZLJ A;  5E8G A;  2TDX A;  5ERI A;  5EG0 A;  3LSJ A;  1NH3 A;  1OCC H;  1RKW A;  5BMZ A;  2IGM A;  2X9D A;  2XGX A;  3BJO A;  3T5X A;  4BS9 A;  5JLX A;  2L02 A;  3NAU A;  1G3S A;  2RGV A;  2DDB A;  5F0H A;  1V5G A;  3OYG A;  3FWE A;  2Z3Y A;  3GVA A;  4II2 A;  3CC4 I;  4LFU A;  2W57 A;  5LBQ A;  4Q48 A;  4E6K G;  4ENM A;  3N05 A;  4GXO A;  3F3X A;  2JSP A;  1SFO J;  1MKM A;  4JOM A;  9ANT A;  1MBH A;  2EFN A;  2F5D A;  2RQQ A;  3D5R C;  1V4R A;  3I59 A;  5GTH C;  3T0Y A;  4RAY A;  4Y33 A;  2ZSI B;  4N4O B;  3K6G A;  2FF4 A;  2W85 A;  1HW1 A;  1UG2 A;  3EPZ A;  5GP9 A;  4UUT A;  2GXG A;  4AD9 A;  3AKZ A;  3JSO A;  1LB2 A;  5ICF A;  4GYI A;  3M4O J;  5B66 C;  3S1M J;  3DKX A;  1HDD C;  4MO7 A;  5J40 A;  1TBX A;  4CCO A;  1O3Q A;  2LBF B;  2JRM A;  2TRT A;  2CO5 A;  5FLV A;  2YR2 A;  4NC8 A;  1OKR A;  3EDP A;  1Y0N A;  1BN5 A;  1GDT A;  3PO2 J;  3ERM A;  1XDS A;  2X51 A;  3CJQ B;  3TOA A;  1F36 A;  2VBW A;  4RAG A;  3BRO A;  3SFZ A;  3FXK A;  2HQ5 A;  1BBY A;  1LNW A;  1MD0 A;  3I4P A;  2NS7 A;  3S17 J;  2Z2S B;  4F93 B;  4CYC B;  4G6Q A;  1PJR A;  2Z5U A;  1GXQ A;  4XKB A;  4KFC A;  4JYK A;  3EET A;  4CCK A;  3LSP A;  4D5C A;  1BI0 A;  1MMG A;  1W5C C;  2MW8 A;  4FHT A;  4FE7 A;  1EKE A;  1OCO H;  1GHC A;  1KQ9 A;  3E97 A;  1G6N A;  1JJ8 C;  1O3R A;  2GZW A;  2B7E A;  4A3K J;  4HX8 A;  3CLO A;  2LOO A;  1PUF A;  2HDW A;  1EJ9 A;  2YPR A;  3PQJ A;  2XGE A;  4P9F A;  2MYS A;  3RPQ A;  4MEX F;  4B43 A;  4J01 A;  3LA7 A;  4PJJ A;  5JHU A;  1VZ0 A;  1DU6 A;  3PL8 A;  1QBJ A;  1GT0 C;  2CU7 A;  2ZXI A;  2LY2 A;  2XDV A;  1JXS A;  4XK4 A;  2NVY J;  1TTY A;  1JKO C;  3FM5 A;  4HQE A;  4OU0 A;  4NUB A;  1A35 A;  3ZMS A;  2PBI A;  3KCC A;  4M6V A;  5DCM A;  2WAF A;  2M30 A;  2QQA A;  2I5U A;  3WTV C;  2O3F A;  3MAJ A;  1FBQ A;  3BR2 A;  2K3F A;  4C30 A;  5AON A;  4IQJ A;  1FBS A;  4M74 A;  2P7C B;  1S29 A;  3KFW X;  1YRN B;  4G9Y A;  3TO9 A;  3ZMU A;  4GYG A;  4CH7 A;  5BOX A;  3RJP A;  1IV8 A;  2ZME C;  4LG3 A;  3CCJ I;  2X1C A;  1RES A;  2LF8 A;  1HST A;  4YFN F;  5L3E A;  4E7I A;  1QPI A;  2L3D A;  4L5I A;  4AU7 A;  2H1K A;  1O3T A;  1TNT A;  3T8R A;  2HNH A;  4BY1 J;  4HDV A;  3OV8 A;  2DT5 A;  2A6H F;  1RKT A;  2HOA A;  4EGZ A;  4NQW A;  4DBR A;  3S93 A;  1CF7 A;  5M5W J;  1T6S A;  1BW6 A;  3AG1 H;  3I56 I;  3L2V A;  1ZTR A;  4ZZL A;  2R7X A;  2XB5 A;  3KLN A;  1X3Z B;  2Q1Z B;  1NG7 A;  2F5V A;  5FLX Z;  4XR6 A;  2OCE A;  2JK3 A;  1DDN A;  4ZYA A;  3WG7 H;  2DTZ A;  4XM3 A;  5IPA A;  4M3E A;  3DEE A;  3MN2 A;  4ZJZ A;  1W4M A;  1OYI A;  4W1U A;  1A6Q A;  1A36 A;  3M9A A;  1GVJ A;  5M5X J;  1Z05 A;  3D5S C;  3CUO A;  4Z2Y A;  3RQ4 A;  3RZD J;  3K4L A;  2YS9 A;  4M3G A;  4G6T B;  1AKH A;  4A93 J;  2M1B A;  3LFK A;  1Z1D A;  1BW5 A;  1ENH A;  3ZCO A;  4BXF A;  2E1M B;  4JK1 X;  3DPU A;  4BL0 B;  2HI3 A;  5LGN A;  5IYC J;  2HDD A;  3KYL A;  5KCM A;  2OD5 A;  3I54 A;  2IS6 A;  3PFY A;  4I09 A;  3LSM A;  2KKO A;  3JAM Z;  2V6E A;  2FOW A;  5EEH A;  2LKS A;  4AYB A;  1FEX A;  1T98 A;  4BQQ A;  1ZQ3 P;  1TWG J;  3DV8 A;  5CVJ A;  3KP6 A;  2EIM H;  4JQF A;  5EJC A;  3BPV A;  5HLI A;  3KET A;  2V1X A;  2GXA A;  1Z3X A;  2ZFW A;  3MCZ A;  3W2V A;  4KT6 A;  3WGI A;  4ENJ A;  3RCO A;  2E1N A;  5E17 F;  2L01 A;  1WJA A;  4ZYG A;  2IA0 A;  3VOD A;  5D6E A;  2NS8 A;  1N77 A;  2EZI A;  3LST A;  3R61 A;  3A02 A;  3FMS A;  2FQ4 A;  1ETQ A;  2JA7 J;  4IJA A;  2W4S A;  3ECO A;  1MBE A;  3TW7 A;  5EF6 A;  2ESN A;  1G3W A;  2L4M A;  1MBF A;  2HYF A;  4PJM A;  1CQT A;  2DJI A;  4XON A;  2EIK H;  1JKR C;  2FA5 A;  2ME6 A;  3GTO J;  3BQZ A;  4Y4R A;  3I5U A;  5F08 A;  3ZN0 A;  1KYZ A;  2HYG D;  4XLP F;  3F8M A;  2RRE A;  1Z21 A;  1VQK I;  1HF0 A;  3E5X A;  2QQB A;  2XAS A;  1PP7 U;  2JUG A;  3D5L A;  2OUM A;  2JJ7 A;  3PJR A;  3GYH X;  3LL7 A;  2MD0 A;  1J7K A;  2R5Z B;  4DBQ A;  1RUN A;  2VKH A;  1HXD A;  2CFX A;  4CYD A;  4K2E A;  1IN6 A;  4D0P A;  1K6Y A;  3L2C A;  2IA1 A;  3ZMV A;  3VSK A;  4RB2 C;  4DYQ A;  1LEB A;  4WXC A;  2R7V A;  4DYC A;  1T0F A;  3GBG A;  4IX7 A;  3KZY A;  3I59 B;  3NQO A;  1STZ A;  3CDH A;  4S05 A;  2Y0M A;  1B4A A;  1XTA A;  2EIN H;  1YW8 A;  3EUK L;  2XGC A;  2UUZ A;  4F3Q A;  1OMI A;  5A2Q K;  1XMK A;  1ZRE A;  2K86 A;  3FXL A;  3FKJ A;  3O8H A;  1ETY A;  2A05 A;  2VQG A;  2ID6 A;  1ERD A;  4GO1 A;  5LHG A;  3K4K A;  2ETH A;  2LF7 A;  4MIM A;  3LQQ A;  4YRV A;  2JQ7 A;  2DMT A;  3GX4 X;  4I6Z A;  5CVR A;  5BPD A;  3IAS 2;  1BC8 C;  2XPU A;  2BYV E;  3H5A A;  2RVC A;  1D1B A;  5BQT A;  3IHU A;  3CCQ I;  2Y75 A;  4IPA A;  1HOM A;  2DOA A;  1ETV A;  1XB4 A;  3MZ8 A;  2QBY B;  3I9V 2;  5M3M J;  3EQL F;  4IOC F;  1H89 C;  3JTH A;  2DDA A;  4RMN A;  3WG9 A;  2KLO A;  2HXO A;  1JE8 A;  1H0M A;  5CVV A;  1JJ6 C;  3KEY A;  4A3M J;  3CMM A;  3GTM J;  1YRN A;  3H9J A;  2R7Z J;  4A0Z A;  2DI3 A;  4GGG A;  2G7H A;  3SYT A;  5FLX K;  1LFB A;  2KJB A;  1P6R A;  1P9Q C;  1FOX A;  1LUJ B;  1OR7 C;  2IGK A;  2GA2 A;  3FXJ A;  3IAM 2;  4A3B J;  4E7L A;  3K7A J;  2LNB A;  5C4X J;  3P7N A;  4M6X A;  4C2M J;  1DUX C;  3ZP5 A;  1G2H A;  1FOW A;  2R7R A;  2F6C A;  2CRG A;  2ZC2 A;  1IC8 A;  2B63 J;  1YLF A;  1APL C;  2KRH A;  4H0E A;  1Z6T A;  2COB A;  3L2R A;  4EJW A;  5LEK A;  1ZR2 A;  1ETO A;  2MLG A;  3HTS B;  3HYI A;  2G0E A;  1VQ6 I;  2NOJ B;  2V7F A;  5F1R A;  1E3P A;  2OTJ I;  3MD2 A;  3H0D A;  4QLC U;  1VQN I;  3CCV I;  1UST A;  4BAY A;  5HDN A;  3S32 A;  3W6V A;  3V4G A;  5JLW A;  2NXN B;  1JUP A;  5IP6 A;  3GTL J;  4A5M A;  2R92 J;  3VYU B;  3MZY A;  1IRF A;  3RTR A;  1SFX A;  4AVZ A;  1MDM A;  4G12 A;  1TLH B;  2EA2 A;  3JRD A;  1R36 A;  4HLX A;  5FO5 A;  2Y9Z A;  1IN5 A;  3DPT A;  1XCB A;  4I01 A;  3GWZ A;  4XNF A;  4A0X A;  4EAT A;  1BIB A;  3BTJ A;  1W7P D;  5J1R A;  1K78 B;  1QNT A;  1B8I B;  5DV5 A;  5FRM A;  2FML A;  3QU3 A;  3GCM A;  4C3J J;  3COA C;  5IYB J;  3S1R J;  1V3F A;  4MFD A;  2DLL A;  3F6O A;  4RGS A;  3DLA A;  2HOE A;  4CCL A;  3HXL A;  4X6A J;  3PO3 J;  4HW0 A;  1MMD A;  4UY8 I;  3L1P A;  3I0T A;  3BR6 A;  2CUZ A;  3CDL A;  3DKW A;  1Z91 A;  4UHT A;  1Q1V A;  3HHG A;  2EK5 A;  1IDZ A;  1W0T A;  1GXP A;  2I8D A;  4MFE A;  4HST A;  1R5I D;  1TT0 A;  3I3L A;  1IN8 A;  3WTW C;  2X0L A;  1JKP C;  3ABU A;  3TO6 A;  3KX2 A;  4AIH A;  3OYD A;  2HWV A;  2WB1 N;  4Y17 A;  3TBI A;  1I5Z A;  3BDD A;  3I4N J;  2EFQ A;  4MNU A;  2ZNY A;  4IL6 C;  5M5Y J;  1I6H J;  2VC0 A;  2DA4 A;  4FET A;  3HTU A;  3K10 A;  5LHI A;  5IYD J;  2VE8 A;  4RM2 A;  3GZ6 A;  5CYV A;  4B3X A;  1SFU A;  2MC3 A;  2BVM A;  5FD6 A;  3TED A;  1P92 A;  3LFU A;  1YG2 A;  3EUH C;  4KNY A;  4HOB A;  2F48 A;  2XAG A;  3F8B A;  5FRO A;  4D1Q A;  1G59 A;  5L3B A;  2QF7 A;  2OAZ A;  5EGO B;  3BZK A;  2K9S A;  1D1C A;  5KHD A;  2GXB A;  5H20 A;  2ELK A;  3PNY A;  3M8F A;  2CMP A;  1XD7 A;  2M8E A;  2MLK A;  5ILU A;  2FQ3 A;  1MJB A;  2M34 A;  4AWX B;  3S15 J;  1T0F C;  2XF7 A;  3TO7 A;  2Z9O A;  3FM3 A;  3S1N J;  2DN0 A;  5A2Q Z;  3S2W A;  1JUS A;  1KQ0 A;  1KA8 A;  1WJF A;  3RI4 A;  3BC8 A;  3CCE I;  3LQR A;  2W48 A;  2CQX A;  4P9U A;  2L4A A;  3OIP A;  1ZR4 A;  1DU0 A;  1LJ9 A;  2Y0S A;  3GZN B;  3WU1 B;  1F4K A;  4EJV A;  3KIO A;  2K85 A;  1Y1V J;  3OR1 C;  4OAY A;  4E7S A;  1FY7 A;  1TZL A;  3I58 A;  2M3A A;  1USS A;  4XQF A;  4BBS J;  2HPM A;  3SDB A;  1UEL B;  1Y8R B;  2EIL H;  2ZXH A;  3R4K A;  2WWY A;  4A3I J;  1T39 A;  2YX4 A;  4WXH A;  2QSG X;  4ENK A;  2DOF A;  2MFZ A;  1SVL A;  2XPV A;  2WB1 A;  1L0O C;  5EEA A;  1SD4 A;  4ZC3 A;  4AIJ A;  4W97 A;  4F52 A;  2VI6 A;  2JUC A;  1N78 A;  2DK5 A;  2JZY A;  3BOQ A;  1IXR C;  1BJZ A;  4CZZ A;  3FIW A;  2H09 A;  2UZK A;  1EH8 A;  3MEX A;  4N9I A;  1ETX A;  3SFI A;  1Z77 A;  1FJL A;  1HDP A;  3AAF A;  4UB6 C;  2ZJQ F;  1XSX A;  3L2Q A;  1U8B A;  4OIN F;  1B9M A;  3OSF A;  3QQA A;  3BG6 A;  5AIQ A;  4XLF A;  2F4I A;  4I99 C;  5HLH A;  3O3K A;  1XMA A;  2E2H J;  4RDU A;  3P5J A;  1ITY A;  3JRI A;  3KPH A;  1XMX A;  4G6D A;  4DYR A;  2W84 A;  4E7J A;  4DNC A;  1FTZ A;  3F23 A;  2M87 A;  2ZJP F;  2JVG A;  2JSC A;  3VSL A;  1LFU P;  1S72 I;  3DU6 A;  3SZP A;  3QPH A;  1X1P A;  3HPG A;  4ETS A;  4HBL A;  2LKX A;  2QKL B;  2O6G E;  2BVL A;  3WTT C;  2CW0 F;  5E3L A;  2VQC A;  4YFK F;  2Z16 A;  2IRF G;  5DD8 A;  3F0C A;  4KIB A;  5HS8 A;  2WAQ N;  1WRJ A;  3CP8 A;  2YSR A;  3S8P A;  3ZMZ A;  2XKP A;  2LYC A;  1FT9 A;  2HR3 A;  2VXZ A;  2FSW A;  1VQ8 I;  4PSW A;  2W25 A;  4CCN A;  4IZZ A;  1VTN C;  2WBM A;  5E3O A;  2P5K A;  3UKG A;  1XX5 A;  3L00 A;  5CJ9 A;  1HA8 A;  2VC1 A;  4X1E A;  1PUF B;  1PDN C;  2MA3 A;  1IXS B;  1QZY A;  2ELJ A;  3OOU A;  3NRV A;  2VJJ A;  3K4C A;  2O61 A;  3J7A O;  5GAG J;  3SJM A;  3R0A A;  1D0Z A;  3ZQQ A;  3K1M A;  5DM7 F;  4IHV A;  3I55 I;  4MHG A;  3JCU C;  5L3F A;  5LGT A;  2ISZ A;  3F8C A;  1QHH D;  2XKO A;  4KUM A;  1G3Y A;  5E1X A;  4KA4 A;  2HZD A;  1N75 A;  3J81 Z;  1REP C;  3FXR A;  4D5F A;  2QA4 I;  1MMS A;  3G3Z A;  3GF2 A;  3DCF A;  3K1N A;  3HRM A;  4FAS D;  1YS7 A;  3BWG A;  3J81 K;  3CMA I;  1R1T A;  1VND A;  2QM3 A;  3H92 A;  2KIS A;  1ON1 A;  4F7Z A;  2GIZ A;  2L54 A;  4EJT A;  1MBJ A;  1ZRC A;  3DPL C;  1U0J A;  2DTR A;  3ZQH A;  4PJ0 C;  2MC4 A;  1LE8 A;  1MNE A;  2WV0 A;  1IRG A;  4HZF A;  2FRH A;  5HS7 A;  2BY3 A;  1KU9 A;  4IKF A;  5DD4 A;  5HLT A;  4BJ6 C;  5LFA A;  1WHU A;  2QSH X;  1J09 A;  4RLQ A;  3M3Y J;  4D9J A;  1WZ2 A;  3HC7 A;  2VT2 A;  3V8J A;  4KIF A;  5E3N A;  3R0J A;  1ULY A;  5DTD A;  1U5T B;  2DYS H;  1Y39 A;  5TGT A;  3TW6 A;  2WY7 Q;  3OS1 A;  3ZMT A;  2QEX I;  4ZYD A;  1K83 J;  3IKT A;  3Q0W A;  2H27 A;  2R7D A;  4YIR X;  1A31 A;  4OIQ F;  3A0B C;  3BTI A;  3BR1 A;  1FWZ A;  3IC7 A;  1OQY A;  1IV6 A;  4F92 B;  3S3M A;  1J75 A;  4MTD A;  2QKM B;  4MQ9 F;  4O6J A;  4RA2 A;  1K78 A;  3E6C C;  2NVT J;  5E79 C;  4EJU A;  2ZME B;  1ZAR A;  1KZH A;  4EV0 A;  5IY5 H;  2CQN A;  4ANJ A;  1YI2 I;  3HOX J;  3KEQ A;  4ZTF A;  4IHS A;  3M1C A;  3RYR A;  4LK0 F;  2RV8 A;  4AVP A;  1IN4 A;  1NG6 A;  4PJN A;  3RQI A;  5BNG A;  2GM4 A;  1YJW I;  2BZT A;  1U2W A;  5DCF A;  4L0Z B;  1X1B A;  1FOK A;  2BE5 F;  1OIS A;  1Z0X A;  4AIK A;  3BG9 A;  4B44 A;  4DQ2 A;  4WXD A;  1UHS A;  3EYY A;  2VJ5 A;  1S6L A;  4MQV A;  5K5O A;  3CCR I;  3CUQ A;  3HG9 A;  1J9I A;  4I76 A;  1OFC X;  2EH3 A;  4FTH A;  1TWH J;  5TJJ A;  3QOD A;  1XGS A;  1WVR A;  3GTG J;  1ZYR F;  1GLN A;  2CS3 A;  3PSF A;  2P6S A;  4IRH A;  4XID A;  4YG2 F;  2L9V A;  2DCE A;  3ZQC A;  3TKY A;  1HLV A;  3JW4 A;  1TWC J;  2B0L A;  2G7U A;  1XPX A;  1U3E M;  2JA2 A;  2NVU B;  2QQ8 A;  2E2J J;  1P4X A;  2UXX A;  2DFI A;  1JGG A;  1Z6R A;  3E6D A;  4PGG A;  1MJA A;  2A69 F;  1KU3 A;  2E34 A;  2VKV A;  4L5E A;  3FBN B;  1ONV A;  4FT8 A;  1VFC A;  2XV4 S;  3G73 A;  4HPQ A;  4GRI A;  3QWL A;  4G94 A;  1ZKG A;  3CMY A;  5HOO A;  3LSG A;  3ZN1 A;  4BU2 A;  3H0G J;  5F6F A;  2QQ9 A;  2O8K A;  4U88 A;  2D1H A;  4M6Y A;  1I39 A;  1XGN A;  1YS6 A;  1IW7 F;  2PJP A;  4ZDO A;  4G7O F;  3C2B A;  2EB7 A;  2V6C A;  4BE2 A;  3QP6 A;  3HKZ A;  4M73 A;  1LPQ A;  3TP0 A;  1JHF A;  1RNL A;  2P6T A;  1Y8Q B;  4ZYE A;  4XKC A;  1SAX A;  1I3A A;  3DKY A;  2PJR B;  2V1U A;  3Q0V A;  1QO0 D;  4M3B A;  4ZDP A;  3H9Q A;  4R1H A;  3A2K A;  2KIM A;  1OPC A;  4D7N A;  2AO9 A;  2PFB A;  1G8X A;  2GAU A;  1I27 A;  3RSN A;  3C1D A;  4YII A;  1BI2 A;  1IN7 A;  3OY9 A;  1X58 A;  1MBG A;  3A0H C;  1S3J A;  1AA7 A;  2JN6 A;  3D0S A;  1B72 A;  1RET A;  2VXD A;  3WGG A;  4YEJ A;  3C18 A;  2BBY A;  1MSF C;  5K1Y A;  3S16 J;  3HJE A;  4HLY A;  4KN7 X;  1QVT A;  3GFM A;  5FKL A;  1WFX A;  4HNU A;  3G1M A;  5HOD A;  2HU9 A;  3F9K A;  1BI1 A;  3ZQI A;  2XC7 A;  2ELH A;  1FX7 A;  4BDZ A;  4RLF A;  2EIJ H;  2VQL A;  3E0J B;  3HKZ N;  2JRT A;  3PSI A;  1TT5 B;  1QQI A;  2QZ8 A;  3WE2 A;  1P4A A;  4A0Y A;  3L09 A;  1R7J A;  1MH4 A;  2DYR H;  2FBI A;  4XSZ F;  3HM5 A;  1I1G A;  1XCV A;  2ZSH B;  2KRC A;  1UG0 A;  2FJ1 A;  5GTI C;  1W5S A;  2XAU A;  2R7W A;  1ZG5 A;  2QSF X;  2J5P A;  4M9X A;  2R5Z A;  1YO5 C;  1Y0U A;  4LJZ F;  4BGD A;  4KT5 C;  4KYW A;  1VF9 A;  4XOP A;  3VOE A;  1OCP A;  1BOA A;  1X2N A;  2LDU A;  2VQH A;  1C0W A;  1U78 A;  3IUO A;  2L7Z A;  4B48 A;  2E19 A;  2MH9 A;  1FYK A;  2R7F A;  2Y9Y A;  3G1O A;  2P4W A;  4A5N A;  2V79 A;  5KVR A;  1AWC A;  3BJA A;  2KRF A;  2AQE A;  1FMW A;  2HTS A;  1SD7 A;  5E3M A;  2AXL A;  1HCR A;  2DT7 B;  4C3H J;  1X1D A;  3BCB A;  1X4O A;  4B8X A;  2O7O A;  5B1B H;  3EYI A;  3WTZ A;  1IF1 A;  1WCM J;  2OC6 A;  1WWX A;  2V9P A;  3DQV C;  3BY6 A;  3LAJ A;  2BHY A;  2KZV A;  1VQ5 I;  4EM0 B;  4BE1 A;  1FSE A;  3HRT A;  3IP4 B;  4IQ4 A;  4WK8 F;  5AIP A;  5B5E C;  3ISP A;  1LDJ A;  5GPC A;  4CO8 A;  1P7J A;  3AG4 H;  1SMY F;  1RRJ A;  3E1S A;  1V5E A;  1X1A A;  3OYJ A;  4N4N B;  2EWN A;  3J80 Z;  5HNH A;  1L3L A;  2DBB A;  1D8J A;  1R58 A;  4ZZD A;  4RBO A;  1V55 H;  4Y52 J;  4BH9 A;  4U0Y A;  2STT A;  4LG0 B;  2EV0 A;  3FDY A;  4E4H A;  1Z7U A;  3F72 A;  1T08 B;  3OYN A;  4G7H F;  2VPL A;  2XAF A;  1QRY A;  2DA7 A;  3H5N A;  3QYB A;  1VQ4 I;  1KU2 A;  2FBH A;  3TQN A;  5GPA A;  1FSH A;  2LKP A;  2FOK A;  2RAE A;  2R7T A;  2N8G A;  3FXU A;  2NRA C;  3VDX A;  5J8C A;  3DWL E;  4A3E J;  1QGP A;  1RUO A;  3HOV J;  2R7U A;  2R7Q A;  1FYM A;  2E7W A;  2VJI A;  3ASN H;  3SHF A;  4P96 A;  1QPM A;  4CXF A;  1DPR A;  3ZQF A;  3OS0 A;  5H2F C;  2QLZ A;  3JR9 A;  3LWF A;  4XKW A;  2DMQ A;  5IOZ A;  1N25 A;  4A6E A;  1SC7 A;  1FYL A;  4OWR B;  4YIF A;  2CYY A;  1HW2 A;  5FLM J;  3CD6 I;  2DXI A;  1ZAO A;  1KGS A;  5J4V A;  2DMN A;  1MNM C;  1H88 C;  4HDU A;  2F4M B;  4HNT A;  4IF4 A;  3A03 A;  1B1B A;  3HBL A;  4DIQ A;  3SQN A;  4PSX A;  2F5E A;  2XUB A;  3C3W A;  3U9G A;  3ERE D;  3QU6 A;  2P0W A;  4NHJ A;  2OPT A;  4G7Z F;  2IS4 A;  2QCO A;  2W24 A;  2R5Y A;  3G71 I;  3NAR A;  1WJC A;  1YIJ I;  3B73 A;  4IHW A;  3DTE A;  1BL0 A;  2CUF A;  3OYM A;  1G4D A;  2ME0 A;  1CF7 B; 
#chains in the Genus database with same CATH homology
 4FCY A;  2M0C A;  2M34 A;  3SDG A;  3S15 J;  5IP7 J;  3S1N J;  4QSH A;  5J1Y A;  2R5Y B;  2DN0 A;  3RZO J;  1H8A C;  1JUS A;  3QPS A;  2HOT A;  4V2G A;  4B1R A;  2L0K A;  2W48 A;  2CQX A;  5EG0 A;  1ZR4 A;  3LSJ A;  3MVP A;  1DU0 A;  1RKW A;  4A3L J;  4BBR J;  1Y1V J;  2X9D A;  5JLX A;  2VKE A;  1JT6 A;  3NAU A;  4M3F A;  5F0H A;  4BBS J;  2K40 A;  4A3I J;  1SFO J;  3A01 B;  1AKH B;  9ANT A;  1MBH A;  2XPV A;  5EEA A;  2DMU A;  4W97 A;  2M8G X;  2VI6 A;  2Y2Z A;  5C4J J;  2MSY A;  1UG2 A;  1BJZ A;  3HOW J;  5GP9 A;  2DA1 A;  3FIW A;  4UUT A;  3ZQL A;  3M4O J;  2LP0 A;  3S1M J;  5F0C A;  1ETX A;  3SFI A;  1HDD C;  1Z77 A;  4MO7 A;  1FJL A;  2X6O A;  1HDP A;  4CYC A;  4JX6 A;  5EGO A;  1U8B A;  2L9R A;  2TRT A;  3OSF A;  5FLV A;  3HEF A;  3QQA A;  1GDT A;  3TP3 A;  3PO2 J;  3JRB A;  3BR0 A;  1ZK8 A;  1F36 A;  5DS9 A;  5FKO A;  2E2H J;  4RDU A;  1ITY A;  2HQ5 A;  3PM1 A;  3JRI A;  3LNQ A;  2TCT A;  4DYR A;  2NS7 A;  3S17 J;  4A69 C;  4AYB N;  4CYC B;  1FTZ A;  3B6C A;  2AHQ A;  5F27 A;  4JYK A;  1MSE C;  3LSP A;  1LFU P;  4D5C A;  1AHD P;  2MW8 A;  2LKX A;  4S0H B;  4FE7 A;  5E3L A;  1GV5 A;  2M9H A;  1JJ8 C;  3F0C A;  1T33 A;  4A3K J;  2WAQ N;  3G1L A;  2MG4 A;  3DEW A;  1PUF A;  1XS9 A;  2XPW A;  2LR8 A;  2XGE A;  2DJN A;  1A6I A;  2EZH A;  5E3O A;  2XRL A;  3BG3 A;  3O8G A;  3UKG A;  1B8I A;  4AUX A;  3A01 A;  1DU6 A;  1GT0 C;  2CU7 A;  4DZP A;  3QPL A;  4X1E A;  1PUF B;  1OJL A;  5EYR A;  4XK4 A;  3OOU A;  2NVY J;  3JRA A;  1JKO C;  3SJM A;  4M3D A;  4IHV A;  1VI0 A;  3IH4 A;  1NK2 P;  4M6V A;  3CQZ J;  2FD5 A;  2Y0S N;  4DW6 A;  3BR2 A;  4D5F A;  2OF7 A;  3DCF A;  1UMQ A;  1T56 A;  5EDN A;  1XG1 A;  1YRN B;  2KDZ A;  2LK2 A;  1VND A;  3ZQG A;  4XRS A;  1MBJ A;  1RES A;  3ZQH A;  1LE8 A;  1QPI A;  3GTJ J;  3BR5 A;  2H1K A;  4IHX A;  4BY1 J;  1TC3 C;  2X48 A;  1RKT A;  2HOA A;  2L7F P;  2YUS A;  3RKQ A;  3OSG A;  3M3Y J;  5M5W J;  1BW6 A;  1ZTR A;  2XGD A;  5FKN A;  2XB5 A;  2JA6 J;  4IHY A;  4XIC A;  2E1O A;  5E3N A;  4UUS A;  4D7M A;  5DTD A;  1S7E A;  3BR3 A;  3TW6 A;  5J1U A;  2JK3 A;  2EZK A;  1K83 J;  2DTZ A;  2R93 J;  3FK7 A;  5IPA A;  4M3E A;  3ZOB A;  1IJW C;  3Q0W A;  4V2F A;  1I50 J;  1ZGW A;  3MN2 A;  2VUM J;  3HOU J;  3HOY J;  2CJJ A;  1F43 A;  3BTI A;  3BR1 A;  1IV6 A;  4W1U A;  3WHC A;  2MGQ A;  3JRC A;  2NVT J;  5M5X J;  1JKQ C;  2XSD C;  3RZD J;  1GUU A;  2YS9 A;  4M3G A;  3HDD A;  1W0U A;  3HOX J;  1AKH A;  4A93 J;  2IAI A;  4JX4 A;  1BW5 A;  1ENH A;  2DA2 A;  3JRF A;  5IYC J;  2HI3 A;  3BTL A;  2HDD A;  1QVU A;  4FE4 A;  3RQI A;  3FIS A;  5BNG A;  1RR7 A;  2M2E A;  5IP9 J;  2GM4 A;  4A3G J;  3S1Q J;  5F0F A;  1FEX A;  1ZQ3 P;  4C3I J;  1TWG J;  1Z0X A;  4XRS G;  3BG9 A;  4XRM A;  1UHS A;  4GFB A;  2I10 A;  3LSR A;  4AC0 A;  4ABZ A;  4A3C J;  2D5V A;  2HOS A;  4I76 A;  2PMZ N;  1OFC X;  2EH3 A;  4FTH A;  1TWH J;  4B4C A;  3JRG A;  2O9L A;  2Y31 A;  3GTP J;  2E2I J;  4FIS A;  2NS8 A;  2YU9 J;  1SAN A;  3OIO A;  2EZI A;  2ZB9 A;  2CUE A;  5K7H A;  3Q3S A;  3GTG J;  4UUS B;  3JRE A;  3A02 A;  2IEK A;  4JP0 A;  2FQ4 A;  3IH3 A;  4XID A;  1GVD A;  1AU7 A;  1ETQ A;  3ZQC A;  2JA7 J;  2EZL A;  1HLV A;  1MBE A;  2LTP A;  3TW7 A;  4Y7N J;  2GLO A;  5IOY A;  3D1N I;  5EF6 A;  1TWC J;  1Y1W J;  1MBF A;  2L7M P;  1CQT A;  2E2J J;  3HGG A;  1JGG A;  1JKR C;  2P81 A;  5M3F J;  1U9N A;  2ME6 A;  2H8R A;  2NVQ J;  3GTO J;  2VKV A;  4L5E A;  3E7L A;  3BQZ A;  1IRZ A;  5F08 A;  1FIP A;  1VFC A;  1HF0 A;  1FIA A;  4DZJ A;  4BKX A;  1ZKG A;  3CMY A;  3S14 J;  3WHB A;  3LSG A;  2JJ7 A;  3H0G J;  3BQY A;  2R5Z B;  2O8K A;  1POG A;  2HYJ A;  2WV1 A;  3C2B A;  2K9N A;  1IGN A;  5FKK A;  3TP0 A;  5F04 A;  1FTT A;  2JA8 J;  3IH2 A;  4DYQ A;  3Q0U A;  3Q0V A;  4DYC A;  3GBG A;  4M3B A;  4D7N A;  2AO9 A;  2EBI A;  1D5Y A;  3FKI J;  1X58 A;  1MBG A;  1NK3 P;  2JN6 A;  2EQR A;  1B72 A;  1RET A;  2XGC A;  1ETW A;  1NTC A;  1MSF C;  3JRH A;  3S16 J;  4QIW N;  3GTQ J;  3O8H A;  5FKM A;  1LE8 B;  1ETY A;  2ID6 A;  2IBD A;  1QVT A;  5FKL A;  4NDL A;  3G1M A;  4MIM A;  2NVX J;  5HOD A;  1B72 B;  1K61 A;  3ZQI A;  2DMT A;  4I6Z A;  4J19 A;  3HKZ N;  2XPU A;  1GV2 A;  1JTX A;  2R0Q C;  3LOC A;  1HOM A;  1ETV A;  1JTY A;  1X2M A;  1BA5 A;  1MH4 A;  2VPR A;  3H3V K;  3BTC A;  5M3M J;  1E3O C;  2LY9 A;  3HM5 A;  1H89 C;  1OCT C;  1TWA J;  5F1J A;  2FJ1 A;  1A5J A;  3BT9 A;  3IV5 A;  5K7Z A;  2HXO A;  2R5Z A;  2HXI A;  1JJ6 C;  4A3M J;  3GTM J;  1YRN A;  5K7F A;  1VF9 A;  2R7Z J;  1OCP A;  1X2N A;  1U78 A;  1LFB A;  2L7Z A;  2E19 A;  4A3B J;  1XC5 A;  2GBY A;  2Y9Y A;  3G1O A;  3K7A J;  3MKL A;  5C4X J;  4C2M J;  2DA5 A;  1G2H A;  2CRG A;  1IC8 A;  5E3M A;  3BG5 A;  1HCR A;  2B63 J;  3VPR A;  1APL C;  5FJ8 J;  2DA6 A;  2DA3 A;  2ECC A;  4C3H J;  2COB A;  2O7O A;  1ZR2 A;  1ETO A;  1IUF A;  1WCM J;  2LVS A;  4MLO A;  2G0E A;  1IG7 A;  3CCY A;  1MBK A;  3GTK J;  5GPC A;  1P7J A;  4A3J J;  1P7I A;  1WH7 A;  2LD5 A;  1ORK A;  2KT0 A;  2LFB A;  3W6V A;  3GTL J;  5JLW A;  1JUP A;  5IP6 A;  2K9Q A;  2R92 J;  4LOC A;  5EZG A;  4G12 A;  4RBO A;  2XB0 X;  2DMP A;  4Y52 J;  3JRD A;  2Y9Z A;  1ETK A;  4JX5 A;  1R9T J;  4IEJ A;  5J1R A;  3BTJ A;  1B8I B;  1QRY A;  2DA7 A;  5EG0 B;  4A3D J;  5GPA A;  1TWF J;  4C3J J;  2RAE A;  3HB9 A;  5IYB J;  1JT0 A;  2N8G A;  3S1R J;  4A3E J;  4MFD A;  1JUM A;  3HOV J;  4HNV A;  4X6A J;  5EZH A;  3PO3 J;  4BY7 J;  4QTR A;  3I4M J;  3L1P A;  4B3A A;  2JA5 J;  3HOZ J;  2CQQ A;  3ZQF A;  3BR6 A;  1U9O A;  3CDL A;  3JR9 A;  1Q1V A;  4EEF G;  2FX0 A;  1IDZ A;  2JMW A;  2DMQ A;  1W0T A;  5IOZ A;  4MFE A;  2LLK A;  3HGY A;  1JKP C;  2ID3 A;  2NOG A;  5FLM J;  4BXX J;  1WI3 A;  1WH5 A;  3S2H J;  2WB1 N;  2DMN A;  2Y30 A;  3B6A A;  1MNM C;  1H88 C;  3I4N J;  5C44 J;  1O4X A;  3FK6 A;  5M5Y J;  1EF4 A;  1I6H J;  3A03 A;  2DA4 A;  3HBL A;  1RPW A;  5IYD J;  1MH3 A;  3K2A A;  2JWT A;  5C3E J;  3TED A;  2OPT A;  1WGX A;  4A3F J;  2QCO A;  3S2D J;  2R5Y A;  2QF7 A;  1I3Q J;  5EGO B;  3NAR A;  1WPK A;  1IDY A;  2K9S A;  2ELK A;  4IHW A;  5J3L A;  2ECB A;  1BL0 A;  2CUF A;  2ME0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...