4DYRA

Crystal structure of terminase small subunit gp1 of the bacterial virus sf6 with caps ph10.5 buffer
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 1 protein
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dyrA01
4XK4A 4D5CA 3HOXJ 5F27A 4AUXA 4CYCB 2HDDA 3S1NJ 1BL0A 3GTJJ 2HI3A 2CJJA 5J1UA 4A3DJ 2XSDC 3JREA 4RBOA 2EBIA 2FD5A 5IYCJ 3PM1A 2LP0A 3Q3SA 2DN0A 1BW6A 5J1RA 4A3BJ 2RAEA 1NTCA 3S1QJ 1MH3A 2M9HA 2ME6A 3HDDA 4IHXA 1JGGA 4MO7A 4Y52J 4RDUA 1B72B 2XPVA 5J1YA 2ELKA 1Y1VJ 4EEFG 1BW5A 2XGDA 3SFIA 1VFCA 4MFDA 4D5FA 1IUFA 3BQZA 3S15J 1IDZA 1LFUP 3QPSA 2O8KA 4FE4A 2TCTA 4CYCA 3E7LA 3DCFA 4B3AA 1P7IA 2FX0A 1TWGJ 1H89C 2K9NA 2JA5J 4S0HB 1TWHJ 2R5ZB 4MIMA 4M3DA 2R5YB 2WB1N 2GLOA 4JX5A 3MVPA 3WHBA 4D7NA 5F1JA 3B6CA 1HF0A 4C2MJ 2DA5A 4UUSA 1B72A 3A01B 3ZOBA 1AHDP 1VI0A 2DMNA 2E2HJ 5JLXA 2E2JJ 3K2AA 4MLOA 2IEKA 3S1RJ 2ME0A 3ZQLA 5IOYA 5GP9A 5M3FJ 3TW7A 2XPWA 1X2NA 1RR7A 2AHQA 3HOUJ 3JRHA 2DJNA 4MFEA 1GDTA 2I10A 4HNVA 3RZOJ 2JA6J 5EZHA 1DU0A 1U9OA 5FLMJ 3HM5A 2M34A 2EZKA 2GM4A 3CCYA 1OCPA 2CUFA 2QF7A 9ANTA 1JT6A 2R5YA 1IRZA 3MKLA 5FKLA 4X6AJ 2M8GX 3HEFA 3G1LA 3K7AJ 1VNDA 5F04A 1GV2A 1F43A 5C4JJ 1B8IB 3GTLJ 3S1MJ 2ECCA 3LSPA 5C4XJ 2GBYA 1RPWA 3IV5A 2H8RA 1R9TJ 2DA2A 2WV1A 3G1MA 1WH5A 4V2FA 1YRNB 1WCMJ 4I6ZA 4LOCA 5EF6A 2MW8A 4DZJA 1MBHA 3LOCA 3Q0WA 3GTOJ 5GPAA 4J19A 2L7MP 4ABZA 1AU7A 1IG7A 4D7MA 4FE7A 1MBFA 3JRGA 2KDZA 2OPTA 5IP6A 2XGCA 2H1KA 1B8IA 3JRCA 3HBLA 1IDYA 2DA4A 2Y9YA 5EDNA 1U8BA 5EZGA 3S2DJ 2E19A 1HDPA 5F0CA 3DEWA 2M2EA 1TWCJ 1U9NA 2QCOA 2EZLA 2COBA 1JKQC 1MBGA 3RKQA 4A3CJ 4JYKA 3BG3A 1HOMA 1GT0C 2N8GA 3CDLA 1U78A 1FTZA 2DA6A 3JRIA 1OFCX 3BT9A 4JX6A 2HOAA 2M0CA 1ETKA 4QSHA 4C3IJ 5J3LA 4DW6A 1QPIA 1RESA 1S7EA 4GFBA 4XRSA 1IC8A 3ZQIA 4DZPA 3PO2J 1RETA 2DA1A 2K9QA 5BNGA 1FIPA 3JRBA 1E3OC 3O8HA 4NDLA 2VPRA 2YUSA 4UUSB 4A3JJ 4DYCA 5IP7J 1T56A 3OSGA 1SANA 1TWFJ 1JKPC 4M3BA 3SJMA 3SDGA 4A3IJ 1I50J 3BTCA 4AC0A 5F08A 3LSGA 5IYBJ 1JJ8C 2LFBA 3TP3A 3BR5A 2WAQN 5FKKA 3FIWA 3W6VA 1ORKA 4XRSG 1ZQ3P 4DYQA 4A3KJ 1K61A 4B1RA 3JRDA 3LSRA 3FKIJ 4W97A 1Q1VA 2JWTA 5FKOA 1NK2P 2W48A 4BKXA 3M3YJ 1W0UA 2Y2ZA 2ID3A 2TRTA 3QPLA 5FJ8J 2Y9ZA 1JUMA 3FISA 2R92J 2VUMJ 2K40A 2B63J 1LFBA 4A3GJ 1H8AC 3G1OA 2NVTJ 2FJ1A 2DTZA 4W1UA 1JUSA 1OCTC 4XIDA 1ENHA 3BQYA 2LVSA 3BTLA 2VI6A 1JTXA 2FQ4A 2L9RA 3TW6A 3NAUA 1QVTA 3WHCA 3CMYA 2AO9A 1QVUA 3JR9A 2R7ZJ 1ZR2A 2DMUA 1WPKA 1RKTA 1ETWA 3L1PA 1ETQA 3ZQHA 1P7JA 1XS9A 2NS7A 5EG0A 1I3QJ 1HDDC 1ZK8A 2R0QC 2PMZN 3Q0VA 2XGEA 3A03A 2CUEA 1ETOA 1WI3A 1FJLA 4QTRA 2EH3A 4L5EA 2E1OA 2ID6A 3I4MJ 1XC5A 3F0CA 1JT0A 2CRGA 2IAIA 3BG9A 4A3FJ 2VKEA 1VF9A 2HXIA 5IPAA 1W0TA 2DMPA 2KT0A 5DS9A 1MBJA 1IV6A 3IH3A 2JA7J 3TEDA 4M3FA 4A3MJ 3I4NJ 1AKHA 2O9LA 1G2HA 3TP0A 3BTIA 3BG5A 2JMWA 1MSFC 2XB5A 1ZKGA 4UUTA 3GBGA 4IHVA 2JK3A 1XG1A 4BBSJ 4XICA 3GTKJ 3S16J 3NARA 1HLVA 1BA5A 5E3NA 2DMQA 1ZR4A 1GV5A 4IEJA 3HOWJ 1UG2A 1ETYA 5IYDJ 2ZB9A 1UHSA 1MBEA 3HB9A 5E3OA 1ZGWA 2HOTA 1LE8A 1FIAA 4B4CA 2L7FP 1CQTA 4A93J 5IP9J 3GTGJ 2NVQJ 1EF4A 4I76A 3GTQJ 2DMTA 1X58A 4BY7J 2LLKA 2NS8A 1NK3P 5M5WJ 3ZQCA 5K7ZA 3M4OJ 4IHYA 3OOUA 4M6VA 5E3MA 5FLVA 3FK6A 4M3GA 3HKZN 2YS9A 2K9SA 1JUPA 5F0HA 1FTTA 5E3LA 2XRLA 1APLC 2L7ZA 2MSYA 2OF7A 2EZHA 3B6AA 1JTYA 1QRYA 3IH4A 2JA8J 3LNQA 4XRMA 3BR3A 2VKVA 4C3HJ 5M3MJ 3HGGA 2X9DA 1O4XA 2YU9J 5FKMA 2E2IJ 4X1EA 1A6IA 1I6HJ 1A5JA 2DA3A 3JRAA 1ETVA 4V2GA 2CQXA 4DYRA 4AYBN 4BXXJ 5DTDA 2G0EA 5C44J 2Y31A 1K83J 1Z77A 2LR8A 1PUFB 2DA7A 4FCYA 5EG0B 3H3VK 2IBDA 5EYRA 5M5YJ 4JX4A 5EGOA 2D5VA 2LY9A 1UMQA 2NVXJ 2MGQA 3BR0A 2EZIA 3RZDJ 2L0KA 1RKWA 1H88C 5K7HA 2JJ7A 3BTJA 4G12A 1IJWC 3BR6A 3A02A 3MN2A 3HGYA 3O8GA 3GTPJ 1AKHB 1IGNA 1BJZA 1X2MA 3VPRA 3GTMJ 1JKRC 2HXOA 1PUFA 1ETXA 3IH2A 1MH4A 2HQ5A 1JJ6C 3S14J 3HOVJ 1DU6A 2XPUA 1T33A 2Y30A 5HODA 3ZQGA 1SFOJ 1Y1WJ 1MSEC 4IHWA 2O7OA 3HOYJ 3BR2A 1ZTRA 3JRFA 3UKGA 5F0FA 1GVDA 3CQZJ 4C3JJ 2R5ZA 3S2HJ 5EEAA 4JP0A 3OSFA 3BR1A 3HOZJ 2NVYJ 2CU7A 1LE8B 4QIWN 3A01A 2P81A 4A69C 1D5YA 2CQQA 2R93J 4FTHA 5JLWA 1OJLA 3ZQFA 5IOZA 2XB0X 2X48A 3PO3J 4BBRJ 3QQAA 5K7FA 5M5XJ 1FEXA 2X6OA 3Q0UA 1WH7A 2EQRA 2JN6A 2ECBA 1WGXA 4M3EA 2HYJA 3H0GJ 3S17J 2LD5A 3FK7A 1GUUA 1TWAJ 5GPCA 2HOSA 4FISA 2NOGA 5C3EJ 3D1NI 4A3LJ 2Y0SN 1HCRA 1JKOC 4BY1J 4Y7NJ 1ITYA 5FKNA 2MG4A 1MNMC 2LK2A 1YRNA 3LSJA 1TC3C 2LKXA 3OIOA 1POGA 4A3EJ 1F36A 1MBKA 3C2BA 5EGOB 1Z0XA 2LTPA 3RQIA
chains in the Genus database with same CATH superfamily
4D5CA 1A04A 5HDGA 3HOXJ 1V55H 3KP6A 2ZXHA 5J1UA 2CJJA 2RREA 2J5OA 3S3NA 1R36A 2L9SA 4RBOA 2Q2EB 5FLXK 3WTWC 3SFZA 3BWGA 4A3BJ 3P9IA 2RAEA 2ME6A 1W36D 2VKDA 4IHXA 3MZHA 4RMNA 2VOOA 2BHYA 2NYXA 1KU2A 2JA2A 1TNTA 4G6DA 4UB8C 2JQ7A 3TDZC 3H5AA 1EH6A 4IVNA 1FSEA 4L9NA 3W2AA 4PFPA 1V5GA 5HVQC 2DTRA 2ESHA 2QQAA 4XOTA 5ILSA 3U21A 3KETA 2E34A 1T39A 1FZPB 4WCGA 2OC6A 4PGGA 4IOAF 1D0XA 2O03A 5FLXZ 1O3RA 4XN0A 4FE4A 3Q9SA 2DOEA 3F72A 3DCFA 1BC8C 3BG7A 1P7IA 4OIQF 2GXGA 2E1CA 1TWGJ 3QYEA 2KKOA 2K9NA 2JA5J 1VQOI 4S0HB 3TGNA 4N9HA 2ELHA 3VSLA 3H1CA 3H5NA 3DXJF 3IWZA 3PUBA 4FX4A 1AHDP 1ON1A 5E20A 1Z3YA 2NNNA 4HF0A 1T0FA 4KA4A 3K2AA 5L3DA 4MLOA 1R1TA 4NB5A 5GP9A 4G6QA 3G71I 5M3FJ 1X2NA 3ABTA 2L4AA 3L7WA 4E7LA 2W82A 2RNGA 2XROA 3HOUJ 2K4JA 2DJNA 2PEXA 3JRHA 2I10A 4HNVA 3QPHA 1YYVA 3HG9A 3QYBA 3GXOA 3ONQA 1U9OA 5FLMJ 4CCOA 2M34A 2EZKA 4RAGA 1OCPA 1RNLA 2R3SA 2KRHA 2QF7A 3V4GA 1JT6A 3NEUA 1DGRM 2STWA 2MFZA 2W1OA 4AVZA 2ZJ2A 1VNDA 3CJRB 1FOWA 2LY1A 2PG4A 4KIFA 1B8IB 3GTLJ 2ECCA 4L9VA 4FASD 3TQNA 3GFJA 1H9TA 1HBXG 4I6ZA 4L5IA 2NRAC 2W25A 4XBFA 4PGHA 3AAFA 1MBHA 1YG2A 3CUQC 5GPAA 1IRXA 4J19A 4ABZA 2EV5A 2RN7A 1BIBA 1IG7A 3HTSB 2NOJB 4LFUA 5AONA 2QQ9A 4PK4A 2ZO4A 4BACA 2KDZA 1HQCA 1F5TA 1BM9A 1JHHA 2P4WA 2MA3A 3QWLA 3A2KA 4ON0A 2ZJQF 3K4JA 1HDPA 2M2EA 2LRDA 3TDUC 3I58A 2IS1A 2COBA 1A6QA 2XV4S 3CLQA 1EH8A 4J00A 4A3CJ 2L9VA 4LIUA 1B9MA 2F6CA 3FHNA 1U78A 1FTZA 1UB9A 2VJ4A 3JRIA 1OFCX 4XLEA 2ZBKA 1X4PA 5KAFC 5L3EA 2M0CA 4S04A 4OAZA 2EFOA 4IQJA 1V3FA 1QPIA 3ASOH 2V7FA 4EATA 1KYWA 2LC2A 1RI7A 3BC8A 5B3SH 3PO2J 3OYCA 5BNGA 1FIPA 2WAEA 4CH7A 3JRBA 1SFXA 3O8HA 4NDLA 2YUSA 1DQUA 1P92A 2ISYA 1EA3A 2IGNA 4HV6A 3E0JB 4JBAA 3WGHA 3ERED 1VTNC 3KEOA 1MDMB 1VQ6I 1D0ZA 1TWFJ 3K4LA 2HS5A 4M3BA 5GAEJ 2IGOA 5EJCA 3LSGA 3REOA 2ZMEC 2LFBA 3QPTA 3LFUA 2WAQN 2Y75A 4P9UA 3L2QA 4XRSG 3KE2A 4KMUX 4XKCA 3JRDA 5E18F 4BXFA 2XAGA 3FKIJ 4W97A 5H2FC 1OCOH 1Y56A 4EJOA 1X1AA 5FKOA 1KQ8A 1SVLA 4XLAA 3GZ6A 1LDKB 2W48A 3LQRA 2DJIA 2D1VA 3WTZA 3OYLA 3QPLA 3HC7A 3PIOF 4ZDOA 2VUMJ 3EYIA 4L18B 2B63J 2LSOA 2FXAA 1UELB 4CCLA 2OQRA 4CICA 2DTZA 3LSMA 3I56I 1SEUA 2ADUA 2LVSA 2RV8A 2WADA 2HVSA 1QVTA 4EJWA 4E7JA 2X6WA 1DPUA 1WPKA 1RKTA 1BOAA 3HRUA 1ZRFA 2E35A 4F7ZA 2NS7A 2VN2A 5LRRA 4HLXA 3I71A 2R0QC 2OZ6A 2IA2A 2QGUA 1IN4A 4MGRA 1WI3A 3BPXA 3MCZA 1SFEA 2FF4A 4EJUA 3KYLA 4P55A 2IAIA 1F9NA 1LVKA 4RAYA 3ZP5A 2E7XA 1LPQA 1W0TA 1G3YA 2KT0A 1YX5A 2BYVE 5DS9A 2V1DA 1B4AA 2CSOA 2JMWA 1FP1D 2RQQA 2ZXJA 3BCAA 2CFXA 2FU4A 4FX0A 1ZKGA 1SVOA 1XSXA 5FFXA 4HSTA 4EQQA 2KDOA 4LLNA 1XG1A 2QM3A 4XICA 2EA2A 1ZHFA 2IGMA 4G9YA 1Z05A 2HTSA 3Q9VA 4CUGA 1BA5A 1LNWA 2ZB9A 1QZEA 1FBQA 4L0ZB 3TMOA 2VQGA 4M9SA 2JRMA 4WF2A 2E7WA 3HUGA 2PX9A 2VL8A 2NVQJ 1EF4A 1ZGJA 4ETSA 5CYVA 3V8KA 1S29A 3I5UA 2BW3B 1WRJA 3E1SA 2HWVA 4N4OB 3DBRB 1DPRA 2BE5F 5M5WJ 4XKVA 4DNCA 2PJPA 2IP2A 4IHYA 4E7IA 3FK6A 5JR3A 6PAXA 5J6XA 3HKZN 4EVIA 3EYYA 4U7DA 2VT3A 1ACIA 1HXDA 2Z3YA 5E3LA 1HKTA 2XSJC 3M07A 3ZN0A 1ZG3A 2B7EA 1ODDA 2OF7A 5HOOA 3CMAI 3B6AA 3IH4A 2O8XA 5JHFA 3LAJA 1Z9CA 3I4PA 1MW7A 1T95A 1XSVA 2X9DA 4IHTA 1O4XA 1E0EA 1FX7A 2YU9J 5LHHA 3MQ0A 2E2IJ 4X1EA 1A5JA 5JVGF 3JRAA 4DIQA 4V2GA 4D0PA 3OYMA 4LG0A 2DCEA 2CQXA 2DI3A 4HX4A 1R22A 5LEJA 3I53A 2IGKA 3ZMDA 1MKMA 2P8TA 3ERMA 1BC7C 1R6RA 2EA4A 4RLQA 4M72A 1PUFB 2DA7A 3H3VK 5GTIC 1ZG1A 5D5UB 2B0LA 1FBUA 4ENJA 2CS3A 5LLQA 4X0GA 4M6YA 1BN5A 4P1WA 4CCMA 2W24A 2EZIA 3FXQA 4OIOF 3HPHA 2E71A 1BR2A 1I27A 3TL4X 5DD8A 5K7HA 1H88C 2KLOA 3C3WA 2JJ7A 4KNYA 4Y13A 4HAMA 2F5FA 1IJWC 3SEQA 1D1BA 1TT5B 5D5WB 2CV1A 1P4XA 1BJZA 3AG1H 3CMEI 3GTMJ 2VBWA 3E5QA 1DGWY 1JJ6C 1MIJA 3M8EA 2KIFA 1FMVA 4BU2A 2M3AA 5L3BA 2BY2A 1IZ1A 3WE3A 5LGNA 4XONA 3ZN1A 5K5QA 1MSEC 2O7OA 3OYAA 2DYSH 3PQKA 3OYHA 3T0YA 1ZTRA 3JRFA 2FA5A 4EGYA 4XR6A 5F0FA 4DGWB 3CQZJ 4C3JJ 3N4MA 1FYLA 4N4NB 3K69A 3OYIA 3CCUI 5D4SA 1KONA 1LE8B 2GQQA 1I3AA 4HPQA 4PSWA 1W36C 3B02A 3KCCA 2P81A 1D3YA 2VJJA 1SAUA 1OYYA 1D5YA 2HYFA 1WHUA 1OJLA 3IC7A 4XORA 2XB0X 2X48A 1EV7A 2OA4A 2J5PA 4XKWA 2NXNB 1ZLKA 1C0WA 3DV8A 3EUHC 4M71A 2JN6A 1XGOA 1QU3A 2ECBA 1B59A 2QSGX 2HYJA 2IS6A 2EINH 4B47A 3CCQI 1JGSA 3FWEA 4EMSA 4UUVA 4BJTA 5GPCA 3QU6A 2A5WA 4WX9A 1P2FA 4ZH4F 3FXUA 1VZ0A 2JRTA 3A4CA 3EETA 3I59A 1OISA 5HNHA 4CHUA 1JKOC 2K9MA 3HRTA 3M8FA 5D5XB 2F5VA 3DBLB 2NS0A 2ESNA 1F1ZA 2VXDA 4Z6YA 1ITYA 3HRMA 1IN5A 1LDDA 2EFWA 3I54A 3SZGA 3MD2A 4PJNA 2VLAA 3SZPA 1F36A 3TBIA 3PNTA 3GMEA 5EGOB 3O3KA 4U7BA 2UXNA 4I01A 2LTPA 2Z5UA 2AXLA 2M87A 4DQ2A 3S1NJ 3VYUB 1ZN2A 4H4KC 4FHTA 2HI3A 4HG2A 3CP2A 2RQPA 2EBIA 5IYCJ 4OMZA 3PM1A 2MD0A 1UHMA 5LHIA 5J1RA 4UB6C 4MTEA 1X3UA 2PI0A 1MH3A 2M9HA 2ELJA 3WTYC 3CCEI 1J59A 1JGGA 4MO7A 3GFLA 4DJAA 1K79A 1WFXA 2XAJA 4MFDA 4D5FA 2DDBA 3ELKA 1U8RA 3BQZA 1IDZA 1LFUP 1BIAA 2TCTA 3OR1C 2FX0A 3G3ZA 2DK8A 3DLLF 1U5TB 3IRRA 1H89C 4HA8A 4NQWA 2R5ZB 5J8CA 4MIMA 2JVHA 2L01A 2A07F 1S6LA 2DOFA 2LY2A 4JX5A 4B43A 4D7NA 3B6CA 4XLPF 1BJAA 1B72A 3A01B 3KEQA 4GGGA 2DMNA 4LIVA 2XAQA 2V4JC 3ABUA 4UVBA 3U1KA 1O3TA 5JLXA 2BEOA 2E2JJ 1VQKI 2IEKA 1MMGA 5CJ9A 3S1RJ 1S5LC 3N05A 2AHQA 1ZRDA 3DTEA 3FXMA 3RZOJ 3QP5A 2YX4A 5EZHA 2AXTC 3MKWB 3HM5A 2CMPA 2HOEA 1OR7C 2CUFA 3FMSA 1IRZA 2R5YA 3PL8A 4R8HA 2O61A 2ZXWH 2X51A 3BY6A 4IX7A 3G1LA 4O6JA 5F04A 1GV2A 4QPQA 1XGNA 4E7ZA 1JI8A 4IOCF 3S1MJ 4GCVA 4PFOA 5C4XJ 1RPWA 2E60A 2H8RA 1ULYA 1WWXA 3LMMA 3U2RA 1WH5A 5HDKA 1YRNB 3FHZA 1STZA 3VWBA 3JTGA 5DM6F 4DZJA 3DBHB 3Q0WA 3GTOJ 1RC9A 1TW2A 4LB6B 2EFNA 4AU7A 2OTLI 2C6YA 3SDBA 2JVGA 4D7MA 1MBFA 2AQEA 5JI6A 3A0HC 5JFRA 3TO7A 3JRGA 2NVUB 3LSHA 3L9FA 3VSKA 3VOEA 4BH9A 1DP3A 3CJNA 1XMKA 5D4RA 4XN3A 1IDYA 2DFFA 3R4KA 1MMDA 5ICEA 4ZDPA 2XKOA 2F5EA 1YTYA 3WODF 3W3CA 3L2CA 1OCRH 5EDNA 3J7YJ 1N77A 1J7KA 2I8DA 2QCOA 2KIMA 4EJVA 2EZLA 1PP8F 1ZLJA 1JKQC 2OZUA 3QODA 3ZMSA 3RKQA 4JYKA 1QBJA 3GX4X 3BG3A 3AG3H 1HOMA 4DBRA 2MABA 3OYFA 1D1AA 2N8GA 4ANJA 1XCVA 2KFDA 3P9KA 2ZSIB 1ZGAA 2R4GA 2V26A 2OAZA 1I1GA 2XAFA 5KAIC 2FRHA 4QSHA 1Q1HA 5J3LA 5H20A 4Y4RA 1S7EA 2WWYA 1F4KA 2HU9A 1J2XA 4IO9F 5IY5H 2DA1A 3F3XA 3T8TA 3BP8A 3I3LA 3K4NA 3UR3C 3LFKA 4UUSB 2HPIA 1V54H 1RRJA 1DDNA 2QEXI 5HNFA 1IN7A 1SD4A 3FX3A 1SANA 1GVJA 4IQ4A 4AVPA 5LGTA 5E8IA 1W7PB 2HYGD 1M1EB 4UV8A 2EFQA 2IPQX 3HXLA 5F08A 4ESFA 2V9KA 2FMLA 3BR5A 2FBIA 3KZYA 3GWZA 1YHQI 3RTRA 4ZZDA 1S9HA 5DCMB 1ORKA 3IRQA 2CUJA 2QQ8A 3H9QA 4PJJA 4XSZF 4F3QA 4IZZA 3F8MA 1S72I 3RCOA 4DYQA 1FNNA 2JTVA 1SMYF 3VYSB 3T1BA 4RB3C 1QZZA 1Q1VA 4OIPF 2VQHA 5FROA 4RAFA 4RGXA 5CVJA 3JSPA 3HSRA 3LQQA 1OR7A 2E5ZA 4KISA 3M3YJ 2LKSA 2Y2ZA 2EFPA 3I64A 1UG0A 3N97A 2DT6A 5HDNA 1BOBA 2CW8A 3IUOA 4M73A 3WTTC 2R92J 2FSWA 2K40A 4O3MA 1LFBA 3PSFA 3J7ZI 3DPLC 1TQPA 4OIRF 2FJ1A 3IAS2 3ZXSA 1YFHA 1YW8A 3KIOA 2EV6A 1XGSA 1HSJA 5ICGA 3C2HA 4YEJA 3BQYA 3C18A 4U88A 4KYWA 1R23A 4KIGA 3TW6A 4C9YA 3F6VA 2DBBA 3F8CA 2QENA 4LLLA 4A5MA 4EM0B 3JR9A 2YSRA 1KA8A 2ZJPF 3DTKA 2IRFG 3L1PA 2EJRA 1L3LA 1LDJA 3ZQHA 1XS9A 2PMZN 1J75A 1YJNI 3Q0VA 2R7SA 3HHGA 4GO1A 2K85A 1O7FA 5H6QA 4QTRA 1HKQA 2KZVA 2M0MA 2ID6A 3I4MJ 4NUBA 3BG9A 4ZYAA 2BY3A 2PN6A 2I5UA 3MZ8A 2MH9A 2DMPA 4HBLA 2HVQA 2KZGA 3HOTA 1ZAOA 2K4BA 1MBJA 1O3SA 1HC8A 3TEDA 2HZDA 4Q4ZF 3IWFA 2EB7A 1AKHA 2AS5F 1LFPA 3OIPA 1G2HA 3HUGB 2P6TA 4UXNA 5CVUA 3ZQQA 3BTIA 3CO6C 4G6TB 1Y8RB 2Q0OA 3HZJA 4EV0A 2L54A 3G6EI 3EUKL 2JK3A 1K78B 3OL4A 4WXCA 4BBSJ 4KUMA 2QKMB 3IAM2 5DUKA 2PJRA 3S16J 5HLTA 3MFKA 2E1MB 2XKPA 3F8BA 2KIQA 5E3NA 2L7KA 2EILH 2QQBA 2GA1A 4IEJA 3HOWJ 5IYDJ 2OBPA 2LBFB 3RI4A 1MBEA 3HB9A 4BEHB 3PFIA 1XCBA 1D8KA 2A5YB 3DEUA 3H92A 2L7FP 2HPMA 4ZTJA 4A93J 4E7KA 3GTGJ 1LEAA 4I76A 2M8EA 1YIJI 2V79A 3FXOA 5ED4A 1X58A 3MEXA 1LUJB 4G7OF 2FMYA 2LDUA 2CYYA 1XMAA 4PJMA 4HNUA 3ZQCA 3WTUC 4E6KG 5K7ZA 4KT5C 2F4IA 5E3MA 1Z21A 5FLVA 4M3GA 3E5XA 5ERIA 2YS9A 1FTTA 2O5RA 4YIIA 4CSWA 2XRLA 4QWQA 4HV5A 1ZG5A 1R00A 2X85A 1LJ9A 2KQRA 2MSYA 3ZMTA 2KJBA 1JTYA 5BMZA 3LNQA 3BR3A 3I0TA 5M3MJ 5L3GA 1EJ9A 2GZWA 4NC6A 3CC2I 1Z6RA 4CA0A 1G3WA 3OYKA 3OYDA 3CJTB 4DOZA 1J9IA 2DOAA 3S32A 3OOPA 1ETVA 3FXKA 2DT7B 1VQ5I 2XAUA 4DYRA 3UNGC 4AYBN 2WV0A 4XOPA 3CJQB 3OMYA 2G0EA 1O7LA 2JPCA 4ITVA 1Z77A 2LR8A 2GAUA 2HKXA 1X4OA 1QQIA 2RVCA 3KP4A 5EG0B 4FCYA 2W85A 2IBDA 5EYRA 4KN4X 4HF2A 1D8JA 5M5YJ 2BOLA 3P7NA 1XDUA 4RS8A 4AIDA 1SFKA 3H3ZA 3HRSA 1S7OA 2NVXJ 1YJWI 4HLYA 3KX2A 2K3FA 2MGQA 1R4NB 2EWNA 1FC3A 2KJCA 5J47A 2LF7A 4NHJA 5E79C 2Q2EA 3K6GA 2L0KA 2XVCA 1RKWA 4M6XA 3QAHA 3VDXA 4U0VA 4CCKA 1FMWA 1X1BA 3BTJA 5E17F 2IS4A 1WVRA 3BR6A 3A02A 4LMYA 4TV7A 1TZLA 4Y15A 1UHWA 3O8GA 3GZ5A 5J8FA 3GTPJ 1X2MA 4UVAA 4KFCA 1QHHD 3LA7A 3CUQA 5LFAA 1ETXA 2DLLA 5BOXA 3ZGKA 5J4VA 3OY9A 1T38A 2FOKA 2UXXA 1P9QC 1TQIA 5TGTA 3HOVJ 2XUBA 1DU6A 2M1BA 3GYHX 3PUFA 4KICA 5HODA 1X1PA 3RKYA 1FYMA 1QA6A 1RR8C 2H1LA 1G4DA 2CW0F 1P6RA 3BR2A 3S3MA 5LGUA 1BI3A 4AIJA 1Y39A 3R61A 3PFYA 3HSEA 1I1SA 3K0LA 1CF7B 4JP0A 2CV0A 4BHPA 5H6RA 3RJPA 3V7CA 3HOZJ 2NVYJ 1V4RA 2CU7A 3E6DA 3I59B 3LSIA 3BPVA 4LJZF 1FPQA 2HTJA 1K6YA 3IKVA 2CQQA 5BPIA 3W6KB 2L4MA 4AIKA 2X1EA 2CQNA 4Q48A 2HQAA 3PO3J 3HOSA 3QQAA 3Q0UA 3W2VA 2GXBA 1WGXA 1KQ0A 2QWWA 4BE0A 1OMIA 4QPOA 3S17J 2R7WA 2WC2A 3FK7A 2ETHA 1TWAJ 2ZC2A 4FISA 2NOGA 4RM3A 3X2QH 5A2QK 2R7VA 2BVMA 1FT9A 2Y0SN 4HQMA 1H0MA 1LVAA 1O57A 3H36A 4GDFA 1E2XA 5J4YA 1ZH5A 1D5VA 2Z33A 1I39A 1MNMC 2NNYA 2ZMEA 2DQRA 2R7QA 5FB2A 4MEYF 5DCFA 3D5RC 1OPCA 3BZ6A 1TLHB 1B9NA 3CZ6A 5A2QZ 3WU2C 2DU9A 5BS6A 2PLYA 1Z0XA 1LKXA 4P9FA 4LLGF 5HLHA 3RYRA 2A6HF 1BBYA 1GXPA 2HZTA 4XLCA 3GTJJ 2EIJH 4A3DJ 2XSDC 3JREA 4PUSA 1X3ZB 4EM1A 3GFIA 1SMTA 1Z67A 4JOMA 2QBYB 1NHAA 1BW6A 4ASNA 1LEBA 1PYVA 3HL2A 5FD6A 1NTCA 2DK5A 3S1QJ 2OD5A 1W7PD 2HDCA 4KIBA 2Y48A 5CVVA 4RDUA 2XPVA 1B72B 4LITA 2ELKA 4A2UA 2BHZA 2Q8KA 2XGDA 3EQLF 3H5RA 3SFIA 4ENKA 1VFCA 3K4KA 1J5YA 1VQ4I 1IUFA 4HRIA 2HQRA 4YIFA 2R7TA 3S15J 2VBZA 1QZYA 3ZR8X 2O8KA 3VFZA 3VODA 4CYCA 2PMUA 4M9XA 3I55I 3E7LA 1S7AA 3J7AY 3PNYA 1OYWA 2OCEA 1YQAA 3B73A 4V19K 2ZFWA 4M9ZA 1TWHJ 3M1CA 1T6SA 3FMQA 2WB1N 4C30A 2R5YB 1R49A 2O3FA 3M7GA 3MVPA 1X19A 3WHBA 1HF0A 4OWRB 2DA5A 1USSA 4C2MJ 3ZOBA 2LNBA 1VI0A 1L0OC 2E2HJ 2VC0A 3EDPA 2R7DA 1MDMA 1YI2I 1VQ8I 2ME0A 3ZQLA 1IAWA 5IOYA 4OMYA 1MD0A 1YE9A 3TW7A 2FUG2 2XPWA 1IUYA 2XF6A 1RR7A 2GIVA 2MC4A 1GDTA 5FRMA 3CDIA 1YX3A 2RC4A 2JA6J 2GWRA 2ZCWA 4R1HA 4MTDA 1SD7A 3CCYA 1VQ7I 5KK1A 5FGMA 3BZCA 5FKLA 4U87A 4X6AJ 3HEFA 2KP6A 3PQJA 3KP2A 2IXSA 5DD4A 5L3FA 2WA0A 3A0BC 1F43A 4RGSA 1YLFA 3HJEA 3C1DA 4XSXF 3RYPA 5C4JJ 3LSPA 2GBYA 2MLKA 3GZNB 4II3A 1YS7A 2K5CA 1TNSA 3HTUA 4OAYA 2KIUA 1IO2A 2ZNZA 1YOVB 5D6EA 4UY8I 3PJRA 4B8XA 2F5DA 4I09A 3Q5FA 2GA2A 4PJLA 5EF6A 5CVIA 3DKXA 1NG7A 2JUGA 3LOCA 2YPRA 1AU7A 2WAQA 2LF8A 3MWMA 4MQ9F 4FE7A 1NH3A 2QLZA 1N25A 4AYBA 3BLYA 2OPTA 1SC7A 2H1KA 2XF5A 2RGVA 4WWCA 1UAAA 4AIHA 3JRCA 3HBLA 3V8JA 1Y0NA 4KJZA 2Y9YA 3H3UA 3S2WA 1U8BA 4IRIA 5F0CA 4Q5SF 3KPHA 3DEWA 1TWCJ 1U9NA 2KPMA 3R60A 3J7AO 4YELA 1TP4A 2JT1A 3RPUD 1U3EM 4MEXF 3SZTA 5F6FA 3CDHA 2DA6A 4R79A 1SFUA 5B66C 1UJ8A 2DYRH 4OOIA 1XDSA 3ZMVA 1FOYA 2DQLA 5LBQA 1G59A 5DYMA 3OS2A 1ETKA 3KYCB 4C3IJ 2NAZA 4GRIA 1DUXC 4DW6A 2P5KA 1RESA 5IT3A 4XRSA 3WTSC 4BHCA 1IC8A 4DZPA 2O6GE 2K9QA 3DPUA 5GAGJ 1N78A 1E3OC 3OYGA 4A3JJ 3NWTA 2FEZA 4DYCA 3OSGA 4OU0A 1IXCA 2M4GA 5E1XA 2M7BA 3GW2A 3H9JA 3MAJA 5B1AH 4B3XA 3RDIA 2ZXIA 3SJMA 3TOAA 4A3IJ 2R7RA 4AC0A 1JJ8C 1BI2A 1QGPA 3A1YA 5IYBJ 3FIWA 3W6VA 4YFKF 3QOPA 2H6BA 4A0YA 4RB1A 1JE8A 3ZMUA 3CLOA 4A3KJ 1FY7A 3OV8A 4B1RA 3QU3A 3LSRA 3FBIB 2BY1A 3KP3A 3FZVA 3K10A 4BKXA 3QRFF 1W0UA 4RGRA 2TRTA 1BI0A 1VQNI 1OCZH 5FJ8J 2V1UA 2Y9ZA 3K4MA 2H09A 1JUMA 2OU2A 3FISA 5LEKA 3AL0B 4IHSA 4I99C 4I98B 1KGSA 4A3GJ 1H8AC 3G1OA 3RKXA 2R7XA 3ISPA 2GIZA 4KMFA 2EK5A 1OCTC 4HOBA 4XIDA 1ENHA 1R1UA 3BTLA 2VI6A 2L9RA 3NAUA 2GXAA 3CMYA 4NBQA 2V1NA 1QVUA 3EUHA 1ZR2A 5AIPA 2R7ZJ 2DMUA 1ETWA 1ETQA 2BVLA 2FNAA 1I3QJ 2Z2SB 2Z99A 1HDDC 5TJJA 3LSTA 3OYEA 2QUFA 2XGEA 3A03A 2CUEA 3M8JA 3HKZA 2MD5A 4ZJZA 2EH3A 4L5EA 2XDVA 2A6EF 1XTAA 1XC5A 4ZYEA 2F2EA 2VJIA 4A3FJ 2R7UA 1W5TA 2O0YA 1CGPA 1VQLI 5IPAA 1YS6A 3BJ6A 2OJED 3CF5F 1T0FC 4ENMA 1IV6A 2DO7A 3IH3A 2JA7J 2V1XA 4M3FA 3ABKH 4A3MJ 3BCBA 3I4NJ 1G3SA 4N0BA 4YIRX 2Z9OA 3TP0A 4NNJA 3H0DA 2PBIA 5KCMA 4B09A 1IRGA 4ESJA 2X1DA 2DPDA 2KMUA 1QNTA 3WU0A 3OS1A 1E3HA 1SVMA 1U5TC 3GBGA 4IHVA 3DKYA 4B48A 1A31A 3GTKJ 3HPGA 3F22A 2YR2A 3DPTA 4PJ0C 3NARA 1HLVA 1Z7LA 1R71A 4BQQA 1GV5A 1S8NA 1UG2A 1WJAA 4CCJA 2EPFA 3L2WA 1UHSA 3RIRA 2VONA 3PSIA 2L02A 2TDXA 3PNVA 5E3OA 2W57A 1Y6IA 3RPQA 1LE8A 4O5VA 3CESA 2VE8A 3CF2A 4YG2F 4Y17A 4HNTA 2KHMA 2EIMH 2DMTA 5EEHA 1MMAA 4BQNA 2XF7A 4BY7J 2LLKA 3R0JA 3F6OA 1NK3P 5HLGA 1DP7P 2K7LA 5DUIA 3C2GA 1W1WE 4CO8A 2ACJA 4F52A 4XLHA 3OOUA 4M6VA 5ILVA 4IKFA 1AOYA 2HNHA 2LYCA 2WBMA 4KT6A 1JUPA 4A6EA 5FD5A 5F0HA 2VPLA 1FSHA 1QPMA 4LB5A 2CQ7A 4UVCA 2A61A 1APLC 2L7ZA 4MHGA 1FYKA 3M9AA 2VKHA 2EZHA 1QRYA 4BGDA 4C3HJ 5FO5A 2UV1A 2KRFA 1HW2A 4CXFA 3TOBA 2X6XA 3V42A 1A6IA 3JSOA 2BZTA 4E70A 3M1EA 1ZRCA 3LA3A 5LD2C 3K2ZA 2F4MB 2HR3A 3NQOA 3CC7I 5DTDA 3U9GA 1K4SA 2CO5A 2Y31A 3CUQB 1X3WB 1WJ5A 2P0WA 1HA8A 3E6BA 4JX4A 5EGOA 2D5VA 3PIPF 4U0WA 2VASA 2M7AA 1ZYRF 2OQGA 3BR0A 5B5EC 1LQ1A 3KFWX 2P7VB 4IJAA 3RZDJ 1X1DA 5HLIA 4G7HF 2ISZA 1OLTA 3KEYA 4PSXA 3IKTA 4G12A 3WU1B 3F8NA 1FLIA 2LREA 3WG7H 1IGNA 3DKWA 1OQYA 1K6OA 4CCNA 3CCJI 2P5LC 3IH2A 2H6CA 3E6MA 1MZBA 1MH4A 2HQ5A 2RNJA 4Z2YA 3S14J 3LL7A 2Y0MA 1I5ZA 1FP2A 1JXSA 2HQNA 2XPUA 5E1ZB 2XHKA 1RIOH 3EUAA 2YU3A 3L2RA 1SFOJ 3VYRB 3BJAA 4L5JA 3FXLA 3HOYJ 1U5TA 3GLXA 1WJDA 3OIQA 4HX7A 3MZYA 1A36A 1V5FA 2RDPA 4MNUA 2KL4A 2R5ZA 3S2HJ 1X1CA 5EEAA 1E3PA 1U2WA 3OSFA 1Z1DA 2RKHA 3BR1A 4QIWN 3A01A 2UZKA 3W2WA 3ZCOA 2IW5A 1IV8A 5JLWA 3ZQFA 5IOZA 5J40A 3CCSI 3G4SI 4BJ6C 4N9IA 3DQVC 4BBRJ 4U0YA 2ZMEB 3MKZA 3DWLE 1UFMA 5M5XJ 3DEEA 1I6XA 2X6OA 1IXSB 2EQRA 3F8FA 3IP4B 3CCLI 4M3EA 1GLNA 4BUPA 1XB4A 5CLSA 1QO0D 2L5QA 3QP6A 1GUUA 2DW4A 3ECHA 2HKOA 4RGUA 5C3EJ 4GXOA 1AWCA 2K3PA 1HCRA 1WKMA 2V9PA 1EKEA 1TQMA 1TT0A 3OS0A 4BY1J 2UWMA 4FETA 1VQPI 4LG0B 4Y7NJ 4XLNF 2X0LA 2H27A 1G8XA 2MG4A 2F4OB 5FKNA 1LB2A 5FRNA 2LK2A 1YRNA 3SEZA 2K86A 3CUOA 2WAFA 2VJ5A 1TC3C 1KYZA 1POGA 3FF5A 5D8LB 4A3EJ 1XGMA 3CTAA 3ZPLA 1MBKA 3C2BA 3CMMA 4KDPA 2JSCA 1IN6A 2A05A 3RQIA 3FDYA 4XK4A 1W4MA 2CQKA 4HEA2 5F27A 4AUXA 4BQOA 4CYCB 2HDDA 2STTA 1BL0A 3ML6A 2D2WA 2K9LA 5KVRA 3DLAA 3K70D 3TO6A 2FD5A 4OINF 2HFHA 1MJBA 2LP0A 1QHGA 3Q3SA 2DN0A 2JPBA 2Z16A 1PUEE 2CWEA 4HSRA 1KU7A 2E1NA 1V5EA 3HDDA 3LWFA 4CGZA 5CPRB 4Y52J 3K4BA 3P9CA 5J1YA 4XL9A 1Y1VJ 5TRDA 4EEFG 1HW1A 1IF1A 1BW5A 2CV2A 3R0AA 1PVEA 4AWXB 1ONVA 1XN7A 3KZIC 4B44A 2ZJRF 2X4HA 2VXZA 2DXIA 3L09A 1T08B 3QPSA 2ZNYA 1O3QA 2IVMA 3U1DA 4B3AA 3S8PA 2M5WA 1KQ9A 4HYEA 3S3OA 1XSDA 2CGPA 4E7SA 2E5NA 2KRCA 4H0EA 2E1MC 2R7OA 3KP5A 2R7FA 4M3DA 1Z91A 2GLOA 3FXJA 3CCRI 4XM3A 1D1CA 3GCMA 2DDAA 1MJ9A 4ZC3A 5F1JA 4UUSA 1TW3A 4F91B 2D1HA 2M30A 4XQFA 4RB0A 2M4KA 4UV9A 4HDUA 1W7PA 2Z1DA 1PDNC 3ASNH 1G6NA 1VQ9I 2PMHA 2H94A 4MFEA 4XKBA 4CDGA 1Y0UA 4ZYGA 1FWZA 2XAHA 3ZQ7A 4L0YB 1FOXA 3BZKA 2OCCH 2WY8Q 3BG6A 5DCMA 1DU0A 2A69F 1NG6A 1A35A 4II2A 2GM4A 2UUZA 1XPXA 3EPZA 2WTEA 3R6SA 9ANTA 1WJCA 3OYJA 3MKLA 2M8GX 2X1CA 5LHGA 3K7AJ 1XMXA 3GEZA 3E5UA 3FBNB 3OL3A 3T8RA 1D0YA 4XMYA 3GO5A 4P5OA 3CP8A 3AFHA 5DDGA 5F64A 4A5NA 3IV5A 1R9TJ 1R5GA 2DA2A 1R7JA 2WV1A 3G1MA 3RSNA 1YIOA 1J09A 2A3SA 4YFNF 1K4TA 4V2FA 2BV6A 2DFIA 4YRVA 2W4SA 1WCMJ 2G7HA 5JHUA 1IN8A 4LOCA 2V6EA 3KYDB 2MW8A 1T8IA 3FKJA 4PCQA 4E4HA 5ILUA 1XD7A 4J01A 2QKLB 2L7MP 3IHUA 4ESBA 4IL6C 3CD6I 2DODA 5E1WA 2LG4A 4BS9A 5JVTA 2MH2A 4IPAA 3QOEA 2F48A 1H9GA 2IA1A 2XGCA 4ZYHA 1B1BA 5IP6A 2QZ8A 2VQCA 3ESWB 4Y3OA 1B8IA 1IW7F 3E6CC 2DA4A 2PFBA 3BJOA 2IT0A 3I9V2 5L3CA 1HW5A 4XRFA 5EZGA 3JAMK 2E19A 2P7CB 3S2DJ 4LGWA 4CYDA 3OWTA 2FE3A 1MBGA 2P5VA 1J0RA 1RUNA 5BQTA 1YJ9I 3K1MA 3JCUC 4YFXF 3CDLA 4IXAA 1GT0C 3L2VA 3E3VA 4I7HA 3RQ4A 1KU9A 1R4MB 2QYOA 3BT9A 4JX6A 2HOAA 1P4WA 5K1YA 4BXUA 2FQ3A 2HGCA 2ZSHB 3JAMZ 5GADJ 3E97A 2DFHA 4GFBA 4NQWB 3ZQIA 2XC7A 4I2OA 3W6JB 3AG2H 1MNEA 1K78A 1RETA 2PMZA 4G94A 3VB2A 3DU6A 2PQ8A 2CFOA 4WK8F 1WJEA 2LOOA 1TBXA 2VPRA 1FOKA 1ERDA 1KU3A 5IP7J 1T56A 3ECOA 1T98A 1MMSA 5GAHJ 4BE1A 3T5XA 2LBFA 5FFZA 5GTHC 4BEHA 4IF4A 1JKPC 3SDGA 1I50J 4HF1A 3BOQA 3BTCA 4L9JA 1BI1A 2OUMA 4IRHA 2A6TA 3JW4A 3TP3A 1REPC 4AM3A 3RPUA 5FKKA 5LRSA 2FBKA 2MLGA 4I0AA 4FT8A 4C2UA 2QA4I 2GOMA 3SXYA 1ZQ3P 4RB2C 1K61A 3FXRA 3P5JA 2JWTA 3V8LA 4QLCU 4CZZA 1NK2P 3GFMA 3V7RA 1MGTA 1VQMI 3FM5A 3LAPA 2ID3A 2ICWG 3HSFA 4G7ZF 4BAYA 2D45A 5CVRA 5IT9K 1AA7A 2NVTJ 2XIGA 4BDYA 2FOWA 1JHFA 1JUSA 1Z7UA 1Z6TA 4W1UA 5DV5A 4LD5A 4MQVA 4NC7A 2GOXB 4BHBA 3CO7C 1JTXA 2FQ4A 3LSKA 3WHCA 4C2TA 2AO9A 5HS8A 5DEQA 4BDZA 2HEOA 4P96A 1WJBA 3KLNA 1WSUA 1P7JA 1WJFA 4HW0A 5EG0A 3O6BB 1ZK8A 2XGXA 1UZCA 5IT9Z 1BR1A 3VYTB 1HKSA 4UNOA 3GLLA 4I02A 1ETOA 4I0BA 1HSTA 1FJLA 5KNLA 1SAXA 2E1OA 2HVRA 3F0CA 1JT0A 2WY7Q 2CRGA 3MMYB 4UHTA 4D9JA 5B1BH 2VKEA 1VF9A 2HXIA 1WZ2A 4Y33A 3DU5A 4LK1F 1P4AA 3G2BA 4G8XA 1R1VA 3NRVA 3OYNA 3J80K 2G9WA 4BQAA 3GF2A 4BE2A 2AQFA 2BGCA 2MBFA 4PZJA 2O9LA 3BG5A 4RA2A 3DF8A 3VEPA 4EM2A 1MSFC 1SD5A 2LMDA 3CC4I 2XB5A 1GHCA 1OCCH 4UUTA 2BY0A 4AD9A 1WQ2A 2CW7A 1WI9A 1YW9A 2K02A 3HHHA 5DM7F 1TTYA 5EEGA 2VC1A 4ZTFA 2P6SA 4CZCA 4DBQA 3J80Z 2DMQA 4GYGA 1ZR4A 1ETYA 2FBHA 5CKTA 3IL2A 1CF7A 2BXZA 5HS9A 4WXDA 3TKYA 1ZGWA 2HOTA 1FIAA 4WXHA 3G73A 4B4CA 3SHFA 3MKYB 1ZREA 4F92B 1CQTA 2OV7A 5IP9J 2HDWA 4M74A 5HS7A 4IRGA 4RM2A 3GTQJ 3AG4H 3DP7A 1U0JA 3OYBA 4RLFA 1YITI 2NS8A 2EIKH 2VT2A 3D5SC 3K9TA 3KP7A 3QYFA 2VE9A 1GXQA 4BJ5C 4KN7X 3M4OJ 1E17A 1IXRC 2L2OA 3DFGA 2YX7A 3WE2A 1IRFA 2K9SA 4BNCA 1YW7A 4HDVA 4EGZA 2JZYA 2MC3A 3H9GA 1R58A 3L2UA 3V7SA 1KZHA 2JA8J 4XRMA 2BBYA 2VKVA 5D6FA 2VB6A 3HGGA 1T2KA 2FNPA 3KZZA 4HX8A 5FKMA 1I6HJ 1MJAA 2BXYA 2DA3A 1RUOA 3BROA 3ZRGA 5TISC 2BW3A 4BXXJ 4HZFA 1Z3XA 5C44J 1EH7A 2G7UA 1K83J 1K7AA 4KITB 3F23A 2ZFUA 2DFEA 3S93A 5ICCA 3F9KA 2VOPA 5KHDA 2W7NA 3K1PA 3COAC 4L9TA 2LY9A 2XASA 1PP7U 1UMQA 1W5SA 4BL0B 1YO5C 2MYSA 3KLOA 4GYIA 3WGGA 2IS2A 5CQEA 5BPDA 5K5OA 1R5HA 3O2PE 3WTVC 3F21A 2ZKZA 1SD6A 2QBYA 1RZ4A 2L9NA 2H8WA 2Y0SA 2E36A 3ULQB 3D0SA 4FQGA 3MN2A 3HGYA 3ZMZA 2EV0A 2VBXA 1AKHB 3VPRA 1MNDA 1JKRC 1R5ID 2HXOA 2LKPA 5CQGA 1PUFA 5ICFA 3RKWA 2V6CA 2A68F 3LA2A 5K5RA 1N75A 1USTA 4D1QA 4F55A 4Q47A 4XNFA 2M45A 2Q1ZB 3NWSA 1Y8QB 2IJLA 5F1RA 3HIFA 1T33A 2Y30A 3K1NA 3ZQGA 1BR4A 1Y1WJ 2PJRB 4IHWA 2XRNA 2CH0A 2JUCA 3TO9A 2VIXA 1G3TA 3D5LA 3UKGA 2CG4A 1GVDA 3K70C 1XX5A 1ZARA 2COMA 4JK1X 2X6YA 4PDKA 2W84A 2B9SA 3WG9A 4A69C 1MMNA 3GVAA 4A0ZA 3WTXC 2R93J 2W00A 2JSPA 1FBSA 3ABMH 4FTHA 2DT5A 1U6GA 4NC8A 3FM3A 5AIQA 3ROUA 3L00A 5D5VB 4LG3A 3CCMI 2IA0A 1PJRA 3SQNA 4BYYA 5K7FA 3WGIA 1B6AA 3AKZA 3BDDA 1FEXA 2OTJI 1ZELA 1WH7A 2VODA 2LH9A 4A6DA 4JQFA 4LK0F 4HQEA 4ZYDA 4E7HA 2VBYA 1TL8A 3H0GJ 2CUZA 3J81K 4A12A 2LD5A 2QSFX 2HOSA 4ENNA 4ZZLA 4A3LJ 3D1NI 4EJTA 1OYIA 3DTIA 3AL0C 2WB1A 3CCVI 3SYTA 3GUDA 3FMRA 1OKRA 4K2EA 3ABLH 1UCRA 2V9VA 3K4CA 5D8KB 1ON2A 3H35A 4F93B 3JTHA 4RAZA 2KISA 3LSJA 3HYIA 4ZDLA 1S3JA 2QSHX 5E8GA 3J81Z 2K27A 2QVOA 2LKXA 3OIOA 1W5CC 2Y69H 3OR2C 4XLFA 2L3DA 2DAOA 3C7JA 2VQLA 4A0XA 4S05A 2F5CA 2DPUA
chains in the Genus database with same CATH topology
4XK4A 4D5CA 3HOXJ 5F27A 4AUXA 4CYCB 2HDDA 3S1NJ 1BL0A 3GTJJ 2HI3A 2CJJA 5J1UA 4A3DJ 2XSDC 3JREA 4RBOA 2EBIA 2FD5A 5IYCJ 3PM1A 2LP0A 3Q3SA 2DN0A 1BW6A 5J1RA 4A3BJ 2RAEA 1NTCA 3S1QJ 1MH3A 2M9HA 2ME6A 3HDDA 4IHXA 1JGGA 4MO7A 4Y52J 4RDUA 1B72B 2XPVA 5J1YA 2ELKA 1Y1VJ 4EEFG 1BW5A 2XGDA 3SFIA 1VFCA 4MFDA 4D5FA 1IUFA 3BQZA 3S15J 1IDZA 1LFUP 3QPSA 2O8KA 4FE4A 2TCTA 4CYCA 3E7LA 3DCFA 4B3AA 1P7IA 2FX0A 1TWGJ 1H89C 2K9NA 2JA5J 4S0HB 1TWHJ 2R5ZB 4MIMA 4M3DA 2R5YB 2WB1N 2GLOA 4JX5A 3MVPA 3WHBA 4D7NA 5F1JA 3B6CA 1HF0A 4C2MJ 2DA5A 4UUSA 1B72A 3A01B 3ZOBA 1AHDP 1VI0A 2DMNA 2E2HJ 5JLXA 2E2JJ 3K2AA 4MLOA 2IEKA 3S1RJ 2ME0A 3ZQLA 5IOYA 5GP9A 5M3FJ 3TW7A 2XPWA 1X2NA 1RR7A 2AHQA 3HOUJ 3JRHA 2DJNA 4MFEA 1GDTA 2I10A 4HNVA 3RZOJ 2JA6J 5EZHA 1DU0A 1U9OA 5FLMJ 3HM5A 2M34A 2EZKA 2GM4A 3CCYA 1OCPA 2CUFA 2QF7A 9ANTA 1JT6A 2R5YA 1IRZA 3MKLA 5FKLA 4X6AJ 2M8GX 3HEFA 3G1LA 3K7AJ 1VNDA 5F04A 1GV2A 1F43A 5C4JJ 1B8IB 3GTLJ 3S1MJ 2ECCA 3LSPA 5C4XJ 2GBYA 1RPWA 3IV5A 2H8RA 1R9TJ 2DA2A 2WV1A 3G1MA 1WH5A 4V2FA 1YRNB 1WCMJ 4I6ZA 4LOCA 5EF6A 2MW8A 4DZJA 1MBHA 3LOCA 3Q0WA 3GTOJ 5GPAA 4J19A 2L7MP 4ABZA 1AU7A 1IG7A 4D7MA 4FE7A 1MBFA 3JRGA 2KDZA 2OPTA 5IP6A 2XGCA 2H1KA 1B8IA 3JRCA 3HBLA 1IDYA 2DA4A 2Y9YA 5EDNA 1U8BA 5EZGA 3S2DJ 2E19A 1HDPA 5F0CA 3DEWA 2M2EA 1TWCJ 1U9NA 2QCOA 2EZLA 2COBA 1JKQC 1MBGA 3RKQA 4A3CJ 4JYKA 3BG3A 1HOMA 1GT0C 2N8GA 3CDLA 1U78A 1FTZA 2DA6A 3JRIA 1OFCX 3BT9A 4JX6A 2HOAA 2M0CA 1ETKA 4QSHA 4C3IJ 5J3LA 4DW6A 1QPIA 1RESA 1S7EA 4GFBA 4XRSA 1IC8A 3ZQIA 4DZPA 3PO2J 1RETA 2DA1A 2K9QA 5BNGA 1FIPA 3JRBA 1E3OC 3O8HA 4NDLA 2VPRA 2YUSA 4UUSB 4A3JJ 4DYCA 5IP7J 1T56A 3OSGA 1SANA 1TWFJ 1JKPC 4M3BA 3SJMA 3SDGA 4A3IJ 1I50J 3BTCA 4AC0A 5F08A 3LSGA 5IYBJ 1JJ8C 2LFBA 3TP3A 3BR5A 2WAQN 5FKKA 3FIWA 3W6VA 1ORKA 4XRSG 1ZQ3P 4DYQA 4A3KJ 1K61A 4B1RA 3JRDA 3LSRA 3FKIJ 4W97A 1Q1VA 2JWTA 5FKOA 1NK2P 2W48A 4BKXA 3M3YJ 1W0UA 2Y2ZA 2ID3A 2TRTA 3QPLA 5FJ8J 2Y9ZA 1JUMA 3FISA 2R92J 2VUMJ 2K40A 2B63J 1LFBA 4A3GJ 1H8AC 3G1OA 2NVTJ 2FJ1A 2DTZA 4W1UA 1JUSA 1OCTC 4XIDA 1ENHA 3BQYA 2LVSA 3BTLA 2VI6A 1JTXA 2FQ4A 2L9RA 3TW6A 3NAUA 1QVTA 3WHCA 3CMYA 2AO9A 1QVUA 3JR9A 2R7ZJ 1ZR2A 2DMUA 1WPKA 1RKTA 1ETWA 3L1PA 1ETQA 3ZQHA 1P7JA 1XS9A 2NS7A 5EG0A 1I3QJ 1HDDC 1ZK8A 2R0QC 2PMZN 3Q0VA 2XGEA 3A03A 2CUEA 1ETOA 1WI3A 1FJLA 4QTRA 2EH3A 4L5EA 2E1OA 2ID6A 3I4MJ 1XC5A 3F0CA 1JT0A 2CRGA 2IAIA 3BG9A 4A3FJ 2VKEA 1VF9A 2HXIA 5IPAA 1W0TA 2DMPA 2KT0A 5DS9A 1MBJA 1IV6A 3IH3A 2JA7J 3TEDA 4M3FA 4A3MJ 3I4NJ 1AKHA 2O9LA 1G2HA 3TP0A 3BTIA 3BG5A 2JMWA 1MSFC 2XB5A 1ZKGA 4UUTA 3GBGA 4IHVA 2JK3A 1XG1A 4BBSJ 4XICA 3GTKJ 3S16J 3NARA 1HLVA 1BA5A 5E3NA 2DMQA 1ZR4A 1GV5A 4IEJA 3HOWJ 1UG2A 1ETYA 5IYDJ 2ZB9A 1UHSA 1MBEA 3HB9A 5E3OA 1ZGWA 2HOTA 1LE8A 1FIAA 4B4CA 2L7FP 1CQTA 4A93J 5IP9J 3GTGJ 2NVQJ 1EF4A 4I76A 3GTQJ 2DMTA 1X58A 4BY7J 2LLKA 2NS8A 1NK3P 5M5WJ 3ZQCA 5K7ZA 3M4OJ 4IHYA 3OOUA 4M6VA 5E3MA 5FLVA 3FK6A 4M3GA 3HKZN 2YS9A 2K9SA 1JUPA 5F0HA 1FTTA 5E3LA 2XRLA 1APLC 2L7ZA 2MSYA 2OF7A 2EZHA 3B6AA 1JTYA 1QRYA 3IH4A 2JA8J 3LNQA 4XRMA 3BR3A 2VKVA 4C3HJ 5M3MJ 3HGGA 2X9DA 1O4XA 2YU9J 5FKMA 2E2IJ 4X1EA 1A6IA 1I6HJ 1A5JA 2DA3A 3JRAA 1ETVA 4V2GA 2CQXA 4DYRA 4AYBN 4BXXJ 5DTDA 2G0EA 5C44J 2Y31A 1K83J 1Z77A 2LR8A 1PUFB 2DA7A 4FCYA 5EG0B 3H3VK 2IBDA 5EYRA 5M5YJ 4JX4A 5EGOA 2D5VA 2LY9A 1UMQA 2NVXJ 2MGQA 3BR0A 2EZIA 3RZDJ 2L0KA 1RKWA 1H88C 5K7HA 2JJ7A 3BTJA 4G12A 1IJWC 3BR6A 3A02A 3MN2A 3HGYA 3O8GA 3GTPJ 1AKHB 1IGNA 1BJZA 1X2MA 3VPRA 3GTMJ 1JKRC 2HXOA 1PUFA 1ETXA 3IH2A 1MH4A 2HQ5A 1JJ6C 3S14J 3HOVJ 1DU6A 2XPUA 1T33A 2Y30A 5HODA 3ZQGA 1SFOJ 1Y1WJ 1MSEC 4IHWA 2O7OA 3HOYJ 3BR2A 1ZTRA 3JRFA 3UKGA 5F0FA 1GVDA 3CQZJ 4C3JJ 2R5ZA 3S2HJ 5EEAA 4JP0A 3OSFA 3BR1A 3HOZJ 2NVYJ 2CU7A 1LE8B 4QIWN 3A01A 2P81A 4A69C 1D5YA 2CQQA 2R93J 4FTHA 5JLWA 1OJLA 3ZQFA 5IOZA 2XB0X 2X48A 3PO3J 4BBRJ 3QQAA 5K7FA 5M5XJ 1FEXA 2X6OA 3Q0UA 1WH7A 2EQRA 2JN6A 2ECBA 1WGXA 4M3EA 2HYJA 3H0GJ 3S17J 2LD5A 3FK7A 1GUUA 1TWAJ 5GPCA 2HOSA 4FISA 2NOGA 5C3EJ 3D1NI 4A3LJ 2Y0SN 1HCRA 1JKOC 4BY1J 4Y7NJ 1ITYA 5FKNA 2MG4A 1MNMC 2LK2A 1YRNA 3LSJA 1TC3C 2LKXA 3OIOA 1POGA 4A3EJ 1F36A 1MBKA 3C2BA 5EGOB 1Z0XA 2LTPA 3RQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK4 A;  4D5C A;  3HOX J;  5F27 A;  4AUX A;  4CYC B;  2HDD A;  3S1N J;  1BL0 A;  3GTJ J;  2HI3 A;  2CJJ A;  5J1U A;  4A3D J;  2XSD C;  3JRE A;  4RBO A;  2EBI A;  2FD5 A;  5IYC J;  3PM1 A;  2LP0 A;  3Q3S A;  2DN0 A;  1BW6 A;  5J1R A;  4A3B J;  2RAE A;  1NTC A;  3S1Q J;  1MH3 A;  2M9H A;  2ME6 A;  3HDD A;  4IHX A;  1JGG A;  4MO7 A;  4Y52 J;  4RDU A;  1B72 B;  2XPV A;  5J1Y A;  2ELK A;  1Y1V J;  4EEF G;  1BW5 A;  2XGD A;  3SFI A;  1VFC A;  4MFD A;  4D5F A;  1IUF A;  3BQZ A;  3S15 J;  1IDZ A;  1LFU P;  3QPS A;  2O8K A;  4FE4 A;  2TCT A;  4CYC A;  3E7L A;  3DCF A;  4B3A A;  1P7I A;  2FX0 A;  1TWG J;  1H89 C;  2K9N A;  2JA5 J;  4S0H B;  1TWH J;  2R5Z B;  4MIM A;  4M3D A;  2R5Y B;  2WB1 N;  2GLO A;  4JX5 A;  3MVP A;  3WHB A;  4D7N A;  5F1J A;  3B6C A;  1HF0 A;  4C2M J;  2DA5 A;  4UUS A;  1B72 A;  3A01 B;  3ZOB A;  1AHD P;  1VI0 A;  2DMN A;  2E2H J;  5JLX A;  2E2J J;  3K2A A;  4MLO A;  2IEK A;  3S1R J;  2ME0 A;  3ZQL A;  5IOY A;  5GP9 A;  5M3F J;  3TW7 A;  2XPW A;  1X2N A;  1RR7 A;  2AHQ A;  3HOU J;  3JRH A;  2DJN A;  4MFE A;  1GDT A;  2I10 A;  4HNV A;  3RZO J;  2JA6 J;  5EZH A;  1DU0 A;  1U9O A;  5FLM J;  3HM5 A;  2M34 A;  2EZK A;  2GM4 A;  3CCY A;  1OCP A;  2CUF A;  2QF7 A;  9ANT A;  1JT6 A;  2R5Y A;  1IRZ A;  3MKL A;  5FKL A;  4X6A J;  2M8G X;  3HEF A;  3G1L A;  3K7A J;  1VND A;  5F04 A;  1GV2 A;  1F43 A;  5C4J J;  1B8I B;  3GTL J;  3S1M J;  2ECC A;  3LSP A;  5C4X J;  2GBY A;  1RPW A;  3IV5 A;  2H8R A;  1R9T J;  2DA2 A;  2WV1 A;  3G1M A;  1WH5 A;  4V2F A;  1YRN B;  1WCM J;  4I6Z A;  4LOC A;  5EF6 A;  2MW8 A;  4DZJ A;  1MBH A;  3LOC A;  3Q0W A;  3GTO J;  5GPA A;  4J19 A;  2L7M P;  4ABZ A;  1AU7 A;  1IG7 A;  4D7M A;  4FE7 A;  1MBF A;  3JRG A;  2KDZ A;  2OPT A;  5IP6 A;  2XGC A;  2H1K A;  1B8I A;  3JRC A;  3HBL A;  1IDY A;  2DA4 A;  2Y9Y A;  5EDN A;  1U8B A;  5EZG A;  3S2D J;  2E19 A;  1HDP A;  5F0C A;  3DEW A;  2M2E A;  1TWC J;  1U9N A;  2QCO A;  2EZL A;  2COB A;  1JKQ C;  1MBG A;  3RKQ A;  4A3C J;  4JYK A;  3BG3 A;  1HOM A;  1GT0 C;  2N8G A;  3CDL A;  1U78 A;  1FTZ A;  2DA6 A;  3JRI A;  1OFC X;  3BT9 A;  4JX6 A;  2HOA A;  2M0C A;  1ETK A;  4QSH A;  4C3I J;  5J3L A;  4DW6 A;  1QPI A;  1RES A;  1S7E A;  4GFB A;  4XRS A;  1IC8 A;  3ZQI A;  4DZP A;  3PO2 J;  1RET A;  2DA1 A;  2K9Q A;  5BNG A;  1FIP A;  3JRB A;  1E3O C;  3O8H A;  4NDL A;  2VPR A;  2YUS A;  4UUS B;  4A3J J;  4DYC A;  5IP7 J;  1T56 A;  3OSG A;  1SAN A;  1TWF J;  1JKP C;  4M3B A;  3SJM A;  3SDG A;  4A3I J;  1I50 J;  3BTC A;  4AC0 A;  5F08 A;  3LSG A;  5IYB J;  1JJ8 C;  2LFB A;  3TP3 A;  3BR5 A;  2WAQ N;  5FKK A;  3FIW A;  3W6V A;  1ORK A;  4XRS G;  1ZQ3 P;  4DYQ A;  4A3K J;  1K61 A;  4B1R A;  3JRD A;  3LSR A;  3FKI J;  4W97 A;  1Q1V A;  2JWT A;  5FKO A;  1NK2 P;  2W48 A;  4BKX A;  3M3Y J;  1W0U A;  2Y2Z A;  2ID3 A;  2TRT A;  3QPL A;  5FJ8 J;  2Y9Z A;  1JUM A;  3FIS A;  2R92 J;  2VUM J;  2K40 A;  2B63 J;  1LFB A;  4A3G J;  1H8A C;  3G1O A;  2NVT J;  2FJ1 A;  2DTZ A;  4W1U A;  1JUS A;  1OCT C;  4XID A;  1ENH A;  3BQY A;  2LVS A;  3BTL A;  2VI6 A;  1JTX A;  2FQ4 A;  2L9R A;  3TW6 A;  3NAU A;  1QVT A;  3WHC A;  3CMY A;  2AO9 A;  1QVU A;  3JR9 A;  2R7Z J;  1ZR2 A;  2DMU A;  1WPK A;  1RKT A;  1ETW A;  3L1P A;  1ETQ A;  3ZQH A;  1P7J A;  1XS9 A;  2NS7 A;  5EG0 A;  1I3Q J;  1HDD C;  1ZK8 A;  2R0Q C;  2PMZ N;  3Q0V A;  2XGE A;  3A03 A;  2CUE A;  1ETO A;  1WI3 A;  1FJL A;  4QTR A;  2EH3 A;  4L5E A;  2E1O A;  2ID6 A;  3I4M J;  1XC5 A;  3F0C A;  1JT0 A;  2CRG A;  2IAI A;  3BG9 A;  4A3F J;  2VKE A;  1VF9 A;  2HXI A;  5IPA A;  1W0T A;  2DMP A;  2KT0 A;  5DS9 A;  1MBJ A;  1IV6 A;  3IH3 A;  2JA7 J;  3TED A;  4M3F A;  4A3M J;  3I4N J;  1AKH A;  2O9L A;  1G2H A;  3TP0 A;  3BTI A;  3BG5 A;  2JMW A;  1MSF C;  2XB5 A;  1ZKG A;  4UUT A;  3GBG A;  4IHV A;  2JK3 A;  1XG1 A;  4BBS J;  4XIC A;  3GTK J;  3S16 J;  3NAR A;  1HLV A;  1BA5 A;  5E3N A;  2DMQ A;  1ZR4 A;  1GV5 A;  4IEJ A;  3HOW J;  1UG2 A;  1ETY A;  5IYD J;  2ZB9 A;  1UHS A;  1MBE A;  3HB9 A;  5E3O A;  1ZGW A;  2HOT A;  1LE8 A;  1FIA A;  4B4C A;  2L7F P;  1CQT A;  4A93 J;  5IP9 J;  3GTG J;  2NVQ J;  1EF4 A;  4I76 A;  3GTQ J;  2DMT A;  1X58 A;  4BY7 J;  2LLK A;  2NS8 A;  1NK3 P;  5M5W J;  3ZQC A;  5K7Z A;  3M4O J;  4IHY A;  3OOU A;  4M6V A;  5E3M A;  5FLV A;  3FK6 A;  4M3G A;  3HKZ N;  2YS9 A;  2K9S A;  1JUP A;  5F0H A;  1FTT A;  5E3L A;  2XRL A;  1APL C;  2L7Z A;  2MSY A;  2OF7 A;  2EZH A;  3B6A A;  1JTY A;  1QRY A;  3IH4 A;  2JA8 J;  3LNQ A;  4XRM A;  3BR3 A;  2VKV A;  4C3H J;  5M3M J;  3HGG A;  2X9D A;  1O4X A;  2YU9 J;  5FKM A;  2E2I J;  4X1E A;  1A6I A;  1I6H J;  1A5J A;  2DA3 A;  3JRA A;  1ETV A;  4V2G A;  2CQX A;  4DYR A;  4AYB N;  4BXX J;  5DTD A;  2G0E A;  5C44 J;  2Y31 A;  1K83 J;  1Z77 A;  2LR8 A;  1PUF B;  2DA7 A;  4FCY A;  5EG0 B;  3H3V K;  2IBD A;  5EYR A;  5M5Y J;  4JX4 A;  5EGO A;  2D5V A;  2LY9 A;  1UMQ A;  2NVX J;  2MGQ A;  3BR0 A;  2EZI A;  3RZD J;  2L0K A;  1RKW A;  1H88 C;  5K7H A;  2JJ7 A;  3BTJ A;  4G12 A;  1IJW C;  3BR6 A;  3A02 A;  3MN2 A;  3HGY A;  3O8G A;  3GTP J;  1AKH B;  1IGN A;  1BJZ A;  1X2M A;  3VPR A;  3GTM J;  1JKR C;  2HXO A;  1PUF A;  1ETX A;  3IH2 A;  1MH4 A;  2HQ5 A;  1JJ6 C;  3S14 J;  3HOV J;  1DU6 A;  2XPU A;  1T33 A;  2Y30 A;  5HOD A;  3ZQG A;  1SFO J;  1Y1W J;  1MSE C;  4IHW A;  2O7O A;  3HOY J;  3BR2 A;  1ZTR A;  3JRF A;  3UKG A;  5F0F A;  1GVD A;  3CQZ J;  4C3J J;  2R5Z A;  3S2H J;  5EEA A;  4JP0 A;  3OSF A;  3BR1 A;  3HOZ J;  2NVY J;  2CU7 A;  1LE8 B;  4QIW N;  3A01 A;  2P81 A;  4A69 C;  1D5Y A;  2CQQ A;  2R93 J;  4FTH A;  5JLW A;  1OJL A;  3ZQF A;  5IOZ A;  2XB0 X;  2X48 A;  3PO3 J;  4BBR J;  3QQA A;  5K7F A;  5M5X J;  1FEX A;  2X6O A;  3Q0U A;  1WH7 A;  2EQR A;  2JN6 A;  2ECB A;  1WGX A;  4M3E A;  2HYJ A;  3H0G J;  3S17 J;  2LD5 A;  3FK7 A;  1GUU A;  1TWA J;  5GPC A;  2HOS A;  4FIS A;  2NOG A;  5C3E J;  3D1N I;  4A3L J;  2Y0S N;  1HCR A;  1JKO C;  4BY1 J;  4Y7N J;  1ITY A;  5FKN A;  2MG4 A;  1MNM C;  2LK2 A;  1YRN A;  3LSJ A;  1TC3 C;  2LKX A;  3OIO A;  1POG A;  4A3E J;  1F36 A;  1MBK A;  3C2B A;  5EGO B;  1Z0X A;  2LTP A;  3RQI A; 
#chains in the Genus database with same CATH topology
 4D5C A;  1A04 A;  5HDG A;  3HOX J;  1V55 H;  3KP6 A;  2ZXH A;  5J1U A;  2CJJ A;  2RRE A;  2J5O A;  3S3N A;  1R36 A;  2L9S A;  4RBO A;  2Q2E B;  5FLX K;  3WTW C;  3SFZ A;  3BWG A;  4A3B J;  3P9I A;  2RAE A;  2ME6 A;  1W36 D;  2VKD A;  4IHX A;  3MZH A;  4RMN A;  2VOO A;  2BHY A;  2NYX A;  1KU2 A;  2JA2 A;  1TNT A;  4G6D A;  4UB8 C;  2JQ7 A;  3TDZ C;  3H5A A;  1EH6 A;  4IVN A;  1FSE A;  4L9N A;  3W2A A;  4PFP A;  1V5G A;  5HVQ C;  2DTR A;  2ESH A;  2QQA A;  4XOT A;  5ILS A;  3U21 A;  3KET A;  2E34 A;  1T39 A;  1FZP B;  4WCG A;  2OC6 A;  4PGG A;  4IOA F;  1D0X A;  2O03 A;  5FLX Z;  1O3R A;  4XN0 A;  4FE4 A;  3Q9S A;  2DOE A;  3F72 A;  3DCF A;  1BC8 C;  3BG7 A;  1P7I A;  4OIQ F;  2GXG A;  2E1C A;  1TWG J;  3QYE A;  2KKO A;  2K9N A;  2JA5 J;  1VQO I;  4S0H B;  3TGN A;  4N9H A;  2ELH A;  3VSL A;  3H1C A;  3H5N A;  3DXJ F;  3IWZ A;  3PUB A;  4FX4 A;  1AHD P;  1ON1 A;  5E20 A;  1Z3Y A;  2NNN A;  4HF0 A;  1T0F A;  4KA4 A;  3K2A A;  5L3D A;  4MLO A;  1R1T A;  4NB5 A;  5GP9 A;  4G6Q A;  3G71 I;  5M3F J;  1X2N A;  3ABT A;  2L4A A;  3L7W A;  4E7L A;  2W82 A;  2RNG A;  2XRO A;  3HOU J;  2K4J A;  2DJN A;  2PEX A;  3JRH A;  2I10 A;  4HNV A;  3QPH A;  1YYV A;  3HG9 A;  3QYB A;  3GXO A;  3ONQ A;  1U9O A;  5FLM J;  4CCO A;  2M34 A;  2EZK A;  4RAG A;  1OCP A;  1RNL A;  2R3S A;  2KRH A;  2QF7 A;  3V4G A;  1JT6 A;  3NEU A;  1DGR M;  2STW A;  2MFZ A;  2W1O A;  4AVZ A;  2ZJ2 A;  1VND A;  3CJR B;  1FOW A;  2LY1 A;  2PG4 A;  4KIF A;  1B8I B;  3GTL J;  2ECC A;  4L9V A;  4FAS D;  3TQN A;  3GFJ A;  1H9T A;  1HBX G;  4I6Z A;  4L5I A;  2NRA C;  2W25 A;  4XBF A;  4PGH A;  3AAF A;  1MBH A;  1YG2 A;  3CUQ C;  5GPA A;  1IRX A;  4J19 A;  4ABZ A;  2EV5 A;  2RN7 A;  1BIB A;  1IG7 A;  3HTS B;  2NOJ B;  4LFU A;  5AON A;  2QQ9 A;  4PK4 A;  2ZO4 A;  4BAC A;  2KDZ A;  1HQC A;  1F5T A;  1BM9 A;  1JHH A;  2P4W A;  2MA3 A;  3QWL A;  3A2K A;  4ON0 A;  2ZJQ F;  3K4J A;  1HDP A;  2M2E A;  2LRD A;  3TDU C;  3I58 A;  2IS1 A;  2COB A;  1A6Q A;  2XV4 S;  3CLQ A;  1EH8 A;  4J00 A;  4A3C J;  2L9V A;  4LIU A;  1B9M A;  2F6C A;  3FHN A;  1U78 A;  1FTZ A;  1UB9 A;  2VJ4 A;  3JRI A;  1OFC X;  4XLE A;  2ZBK A;  1X4P A;  5KAF C;  5L3E A;  2M0C A;  4S04 A;  4OAZ A;  2EFO A;  4IQJ A;  1V3F A;  1QPI A;  3ASO H;  2V7F A;  4EAT A;  1KYW A;  2LC2 A;  1RI7 A;  3BC8 A;  5B3S H;  3PO2 J;  3OYC A;  5BNG A;  1FIP A;  2WAE A;  4CH7 A;  3JRB A;  1SFX A;  3O8H A;  4NDL A;  2YUS A;  1DQU A;  1P92 A;  2ISY A;  1EA3 A;  2IGN A;  4HV6 A;  3E0J B;  4JBA A;  3WGH A;  3ERE D;  1VTN C;  3KEO A;  1MDM B;  1VQ6 I;  1D0Z A;  1TWF J;  3K4L A;  2HS5 A;  4M3B A;  5GAE J;  2IGO A;  5EJC A;  3LSG A;  3REO A;  2ZME C;  2LFB A;  3QPT A;  3LFU A;  2WAQ N;  2Y75 A;  4P9U A;  3L2Q A;  4XRS G;  3KE2 A;  4KMU X;  4XKC A;  3JRD A;  5E18 F;  4BXF A;  2XAG A;  3FKI J;  4W97 A;  5H2F C;  1OCO H;  1Y56 A;  4EJO A;  1X1A A;  5FKO A;  1KQ8 A;  1SVL A;  4XLA A;  3GZ6 A;  1LDK B;  2W48 A;  3LQR A;  2DJI A;  2D1V A;  3WTZ A;  3OYL A;  3QPL A;  3HC7 A;  3PIO F;  4ZDO A;  2VUM J;  3EYI A;  4L18 B;  2B63 J;  2LSO A;  2FXA A;  1UEL B;  4CCL A;  2OQR A;  4CIC A;  2DTZ A;  3LSM A;  3I56 I;  1SEU A;  2ADU A;  2LVS A;  2RV8 A;  2WAD A;  2HVS A;  1QVT A;  4EJW A;  4E7J A;  2X6W A;  1DPU A;  1WPK A;  1RKT A;  1BOA A;  3HRU A;  1ZRF A;  2E35 A;  4F7Z A;  2NS7 A;  2VN2 A;  5LRR A;  4HLX A;  3I71 A;  2R0Q C;  2OZ6 A;  2IA2 A;  2QGU A;  1IN4 A;  4MGR A;  1WI3 A;  3BPX A;  3MCZ A;  1SFE A;  2FF4 A;  4EJU A;  3KYL A;  4P55 A;  2IAI A;  1F9N A;  1LVK A;  4RAY A;  3ZP5 A;  2E7X A;  1LPQ A;  1W0T A;  1G3Y A;  2KT0 A;  1YX5 A;  2BYV E;  5DS9 A;  2V1D A;  1B4A A;  2CSO A;  2JMW A;  1FP1 D;  2RQQ A;  2ZXJ A;  3BCA A;  2CFX A;  2FU4 A;  4FX0 A;  1ZKG A;  1SVO A;  1XSX A;  5FFX A;  4HST A;  4EQQ A;  2KDO A;  4LLN A;  1XG1 A;  2QM3 A;  4XIC A;  2EA2 A;  1ZHF A;  2IGM A;  4G9Y A;  1Z05 A;  2HTS A;  3Q9V A;  4CUG A;  1BA5 A;  1LNW A;  2ZB9 A;  1QZE A;  1FBQ A;  4L0Z B;  3TMO A;  2VQG A;  4M9S A;  2JRM A;  4WF2 A;  2E7W A;  3HUG A;  2PX9 A;  2VL8 A;  2NVQ J;  1EF4 A;  1ZGJ A;  4ETS A;  5CYV A;  3V8K A;  1S29 A;  3I5U A;  2BW3 B;  1WRJ A;  3E1S A;  2HWV A;  4N4O B;  3DBR B;  1DPR A;  2BE5 F;  5M5W J;  4XKV A;  4DNC A;  2PJP A;  2IP2 A;  4IHY A;  4E7I A;  3FK6 A;  5JR3 A;  6PAX A;  5J6X A;  3HKZ N;  4EVI A;  3EYY A;  4U7D A;  2VT3 A;  1ACI A;  1HXD A;  2Z3Y A;  5E3L A;  1HKT A;  2XSJ C;  3M07 A;  3ZN0 A;  1ZG3 A;  2B7E A;  1ODD A;  2OF7 A;  5HOO A;  3CMA I;  3B6A A;  3IH4 A;  2O8X A;  5JHF A;  3LAJ A;  1Z9C A;  3I4P A;  1MW7 A;  1T95 A;  1XSV A;  2X9D A;  4IHT A;  1O4X A;  1E0E A;  1FX7 A;  2YU9 J;  5LHH A;  3MQ0 A;  2E2I J;  4X1E A;  1A5J A;  5JVG F;  3JRA A;  4DIQ A;  4V2G A;  4D0P A;  3OYM A;  4LG0 A;  2DCE A;  2CQX A;  2DI3 A;  4HX4 A;  1R22 A;  5LEJ A;  3I53 A;  2IGK A;  3ZMD A;  1MKM A;  2P8T A;  3ERM A;  1BC7 C;  1R6R A;  2EA4 A;  4RLQ A;  4M72 A;  1PUF B;  2DA7 A;  3H3V K;  5GTI C;  1ZG1 A;  5D5U B;  2B0L A;  1FBU A;  4ENJ A;  2CS3 A;  5LLQ A;  4X0G A;  4M6Y A;  1BN5 A;  4P1W A;  4CCM A;  2W24 A;  2EZI A;  3FXQ A;  4OIO F;  3HPH A;  2E71 A;  1BR2 A;  1I27 A;  3TL4 X;  5DD8 A;  5K7H A;  1H88 C;  2KLO A;  3C3W A;  2JJ7 A;  4KNY A;  4Y13 A;  4HAM A;  2F5F A;  1IJW C;  3SEQ A;  1D1B A;  1TT5 B;  5D5W B;  2CV1 A;  1P4X A;  1BJZ A;  3AG1 H;  3CME I;  3GTM J;  2VBW A;  3E5Q A;  1DGW Y;  1JJ6 C;  1MIJ A;  3M8E A;  2KIF A;  1FMV A;  4BU2 A;  2M3A A;  5L3B A;  2BY2 A;  1IZ1 A;  3WE3 A;  5LGN A;  4XON A;  3ZN1 A;  5K5Q A;  1MSE C;  2O7O A;  3OYA A;  2DYS H;  3PQK A;  3OYH A;  3T0Y A;  1ZTR A;  3JRF A;  2FA5 A;  4EGY A;  4XR6 A;  5F0F A;  4DGW B;  3CQZ J;  4C3J J;  3N4M A;  1FYL A;  4N4N B;  3K69 A;  3OYI A;  3CCU I;  5D4S A;  1KON A;  1LE8 B;  2GQQ A;  1I3A A;  4HPQ A;  4PSW A;  1W36 C;  3B02 A;  3KCC A;  2P81 A;  1D3Y A;  2VJJ A;  1SAU A;  1OYY A;  1D5Y A;  2HYF A;  1WHU A;  1OJL A;  3IC7 A;  4XOR A;  2XB0 X;  2X48 A;  1EV7 A;  2OA4 A;  2J5P A;  4XKW A;  2NXN B;  1ZLK A;  1C0W A;  3DV8 A;  3EUH C;  4M71 A;  2JN6 A;  1XGO A;  1QU3 A;  2ECB A;  1B59 A;  2QSG X;  2HYJ A;  2IS6 A;  2EIN H;  4B47 A;  3CCQ I;  1JGS A;  3FWE A;  4EMS A;  4UUV A;  4BJT A;  5GPC A;  3QU6 A;  2A5W A;  4WX9 A;  1P2F A;  4ZH4 F;  3FXU A;  1VZ0 A;  2JRT A;  3A4C A;  3EET A;  3I59 A;  1OIS A;  5HNH A;  4CHU A;  1JKO C;  2K9M A;  3HRT A;  3M8F A;  5D5X B;  2F5V A;  3DBL B;  2NS0 A;  2ESN A;  1F1Z A;  2VXD A;  4Z6Y A;  1ITY A;  3HRM A;  1IN5 A;  1LDD A;  2EFW A;  3I54 A;  3SZG A;  3MD2 A;  4PJN A;  2VLA A;  3SZP A;  1F36 A;  3TBI A;  3PNT A;  3GME A;  5EGO B;  3O3K A;  4U7B A;  2UXN A;  4I01 A;  2LTP A;  2Z5U A;  2AXL A;  2M87 A;  4DQ2 A;  3S1N J;  3VYU B;  1ZN2 A;  4H4K C;  4FHT A;  2HI3 A;  4HG2 A;  3CP2 A;  2RQP A;  2EBI A;  5IYC J;  4OMZ A;  3PM1 A;  2MD0 A;  1UHM A;  5LHI A;  5J1R A;  4UB6 C;  4MTE A;  1X3U A;  2PI0 A;  1MH3 A;  2M9H A;  2ELJ A;  3WTY C;  3CCE I;  1J59 A;  1JGG A;  4MO7 A;  3GFL A;  4DJA A;  1K79 A;  1WFX A;  2XAJ A;  4MFD A;  4D5F A;  2DDB A;  3ELK A;  1U8R A;  3BQZ A;  1IDZ A;  1LFU P;  1BIA A;  2TCT A;  3OR1 C;  2FX0 A;  3G3Z A;  2DK8 A;  3DLL F;  1U5T B;  3IRR A;  1H89 C;  4HA8 A;  4NQW A;  2R5Z B;  5J8C A;  4MIM A;  2JVH A;  2L01 A;  2A07 F;  1S6L A;  2DOF A;  2LY2 A;  4JX5 A;  4B43 A;  4D7N A;  3B6C A;  4XLP F;  1BJA A;  1B72 A;  3A01 B;  3KEQ A;  4GGG A;  2DMN A;  4LIV A;  2XAQ A;  2V4J C;  3ABU A;  4UVB A;  3U1K A;  1O3T A;  5JLX A;  2BEO A;  2E2J J;  1VQK I;  2IEK A;  1MMG A;  5CJ9 A;  3S1R J;  1S5L C;  3N05 A;  2AHQ A;  1ZRD A;  3DTE A;  3FXM A;  3RZO J;  3QP5 A;  2YX4 A;  5EZH A;  2AXT C;  3MKW B;  3HM5 A;  2CMP A;  2HOE A;  1OR7 C;  2CUF A;  3FMS A;  1IRZ A;  2R5Y A;  3PL8 A;  4R8H A;  2O61 A;  2ZXW H;  2X51 A;  3BY6 A;  4IX7 A;  3G1L A;  4O6J A;  5F04 A;  1GV2 A;  4QPQ A;  1XGN A;  4E7Z A;  1JI8 A;  4IOC F;  3S1M J;  4GCV A;  4PFO A;  5C4X J;  1RPW A;  2E60 A;  2H8R A;  1ULY A;  1WWX A;  3LMM A;  3U2R A;  1WH5 A;  5HDK A;  1YRN B;  3FHZ A;  1STZ A;  3VWB A;  3JTG A;  5DM6 F;  4DZJ A;  3DBH B;  3Q0W A;  3GTO J;  1RC9 A;  1TW2 A;  4LB6 B;  2EFN A;  4AU7 A;  2OTL I;  2C6Y A;  3SDB A;  2JVG A;  4D7M A;  1MBF A;  2AQE A;  5JI6 A;  3A0H C;  5JFR A;  3TO7 A;  3JRG A;  2NVU B;  3LSH A;  3L9F A;  3VSK A;  3VOE A;  4BH9 A;  1DP3 A;  3CJN A;  1XMK A;  5D4R A;  4XN3 A;  1IDY A;  2DFF A;  3R4K A;  1MMD A;  5ICE A;  4ZDP A;  2XKO A;  2F5E A;  1YTY A;  3WOD F;  3W3C A;  3L2C A;  1OCR H;  5EDN A;  3J7Y J;  1N77 A;  1J7K A;  2I8D A;  2QCO A;  2KIM A;  4EJV A;  2EZL A;  1PP8 F;  1ZLJ A;  1JKQ C;  2OZU A;  3QOD A;  3ZMS A;  3RKQ A;  4JYK A;  1QBJ A;  3GX4 X;  3BG3 A;  3AG3 H;  1HOM A;  4DBR A;  2MAB A;  3OYF A;  1D1A A;  2N8G A;  4ANJ A;  1XCV A;  2KFD A;  3P9K A;  2ZSI B;  1ZGA A;  2R4G A;  2V26 A;  2OAZ A;  1I1G A;  2XAF A;  5KAI C;  2FRH A;  4QSH A;  1Q1H A;  5J3L A;  5H20 A;  4Y4R A;  1S7E A;  2WWY A;  1F4K A;  2HU9 A;  1J2X A;  4IO9 F;  5IY5 H;  2DA1 A;  3F3X A;  3T8T A;  3BP8 A;  3I3L A;  3K4N A;  3UR3 C;  3LFK A;  4UUS B;  2HPI A;  1V54 H;  1RRJ A;  1DDN A;  2QEX I;  5HNF A;  1IN7 A;  1SD4 A;  3FX3 A;  1SAN A;  1GVJ A;  4IQ4 A;  4AVP A;  5LGT A;  5E8I A;  1W7P B;  2HYG D;  1M1E B;  4UV8 A;  2EFQ A;  2IPQ X;  3HXL A;  5F08 A;  4ESF A;  2V9K A;  2FML A;  3BR5 A;  2FBI A;  3KZY A;  3GWZ A;  1YHQ I;  3RTR A;  4ZZD A;  1S9H A;  5DCM B;  1ORK A;  3IRQ A;  2CUJ A;  2QQ8 A;  3H9Q A;  4PJJ A;  4XSZ F;  4F3Q A;  4IZZ A;  3F8M A;  1S72 I;  3RCO A;  4DYQ A;  1FNN A;  2JTV A;  1SMY F;  3VYS B;  3T1B A;  4RB3 C;  1QZZ A;  1Q1V A;  4OIP F;  2VQH A;  5FRO A;  4RAF A;  4RGX A;  5CVJ A;  3JSP A;  3HSR A;  3LQQ A;  1OR7 A;  2E5Z A;  4KIS A;  3M3Y J;  2LKS A;  2Y2Z A;  2EFP A;  3I64 A;  1UG0 A;  3N97 A;  2DT6 A;  5HDN A;  1BOB A;  2CW8 A;  3IUO A;  4M73 A;  3WTT C;  2R92 J;  2FSW A;  2K40 A;  4O3M A;  1LFB A;  3PSF A;  3J7Z I;  3DPL C;  1TQP A;  4OIR F;  2FJ1 A;  3IAS 2;  3ZXS A;  1YFH A;  1YW8 A;  3KIO A;  2EV6 A;  1XGS A;  1HSJ A;  5ICG A;  3C2H A;  4YEJ A;  3BQY A;  3C18 A;  4U88 A;  4KYW A;  1R23 A;  4KIG A;  3TW6 A;  4C9Y A;  3F6V A;  2DBB A;  3F8C A;  2QEN A;  4LLL A;  4A5M A;  4EM0 B;  3JR9 A;  2YSR A;  1KA8 A;  2ZJP F;  3DTK A;  2IRF G;  3L1P A;  2EJR A;  1L3L A;  1LDJ A;  3ZQH A;  1XS9 A;  2PMZ N;  1J75 A;  1YJN I;  3Q0V A;  2R7S A;  3HHG A;  4GO1 A;  2K85 A;  1O7F A;  5H6Q A;  4QTR A;  1HKQ A;  2KZV A;  2M0M A;  2ID6 A;  3I4M J;  4NUB A;  3BG9 A;  4ZYA A;  2BY3 A;  2PN6 A;  2I5U A;  3MZ8 A;  2MH9 A;  2DMP A;  4HBL A;  2HVQ A;  2KZG A;  3HOT A;  1ZAO A;  2K4B A;  1MBJ A;  1O3S A;  1HC8 A;  3TED A;  2HZD A;  4Q4Z F;  3IWF A;  2EB7 A;  1AKH A;  2AS5 F;  1LFP A;  3OIP A;  1G2H A;  3HUG B;  2P6T A;  4UXN A;  5CVU A;  3ZQQ A;  3BTI A;  3CO6 C;  4G6T B;  1Y8R B;  2Q0O A;  3HZJ A;  4EV0 A;  2L54 A;  3G6E I;  3EUK L;  2JK3 A;  1K78 B;  3OL4 A;  4WXC A;  4BBS J;  4KUM A;  2QKM B;  3IAM 2;  5DUK A;  2PJR A;  3S16 J;  5HLT A;  3MFK A;  2E1M B;  2XKP A;  3F8B A;  2KIQ A;  5E3N A;  2L7K A;  2EIL H;  2QQB A;  2GA1 A;  4IEJ A;  3HOW J;  5IYD J;  2OBP A;  2LBF B;  3RI4 A;  1MBE A;  3HB9 A;  4BEH B;  3PFI A;  1XCB A;  1D8K A;  2A5Y B;  3DEU A;  3H92 A;  2L7F P;  2HPM A;  4ZTJ A;  4A93 J;  4E7K A;  3GTG J;  1LEA A;  4I76 A;  2M8E A;  1YIJ I;  2V79 A;  3FXO A;  5ED4 A;  1X58 A;  3MEX A;  1LUJ B;  4G7O F;  2FMY A;  2LDU A;  2CYY A;  1XMA A;  4PJM A;  4HNU A;  3ZQC A;  3WTU C;  4E6K G;  5K7Z A;  4KT5 C;  2F4I A;  5E3M A;  1Z21 A;  5FLV A;  4M3G A;  3E5X A;  5ERI A;  2YS9 A;  1FTT A;  2O5R A;  4YII A;  4CSW A;  2XRL A;  4QWQ A;  4HV5 A;  1ZG5 A;  1R00 A;  2X85 A;  1LJ9 A;  2KQR A;  2MSY A;  3ZMT A;  2KJB A;  1JTY A;  5BMZ A;  3LNQ A;  3BR3 A;  3I0T A;  5M3M J;  5L3G A;  1EJ9 A;  2GZW A;  4NC6 A;  3CC2 I;  1Z6R A;  4CA0 A;  1G3W A;  3OYK A;  3OYD A;  3CJT B;  4DOZ A;  1J9I A;  2DOA A;  3S32 A;  3OOP A;  1ETV A;  3FXK A;  2DT7 B;  1VQ5 I;  2XAU A;  4DYR A;  3UNG C;  4AYB N;  2WV0 A;  4XOP A;  3CJQ B;  3OMY A;  2G0E A;  1O7L A;  2JPC A;  4ITV A;  1Z77 A;  2LR8 A;  2GAU A;  2HKX A;  1X4O A;  1QQI A;  2RVC A;  3KP4 A;  5EG0 B;  4FCY A;  2W85 A;  2IBD A;  5EYR A;  4KN4 X;  4HF2 A;  1D8J A;  5M5Y J;  2BOL A;  3P7N A;  1XDU A;  4RS8 A;  4AID A;  1SFK A;  3H3Z A;  3HRS A;  1S7O A;  2NVX J;  1YJW I;  4HLY A;  3KX2 A;  2K3F A;  2MGQ A;  1R4N B;  2EWN A;  1FC3 A;  2KJC A;  5J47 A;  2LF7 A;  4NHJ A;  5E79 C;  2Q2E A;  3K6G A;  2L0K A;  2XVC A;  1RKW A;  4M6X A;  3QAH A;  3VDX A;  4U0V A;  4CCK A;  1FMW A;  1X1B A;  3BTJ A;  5E17 F;  2IS4 A;  1WVR A;  3BR6 A;  3A02 A;  4LMY A;  4TV7 A;  1TZL A;  4Y15 A;  1UHW A;  3O8G A;  3GZ5 A;  5J8F A;  3GTP J;  1X2M A;  4UVA A;  4KFC A;  1QHH D;  3LA7 A;  3CUQ A;  5LFA A;  1ETX A;  2DLL A;  5BOX A;  3ZGK A;  5J4V A;  3OY9 A;  1T38 A;  2FOK A;  2UXX A;  1P9Q C;  1TQI A;  5TGT A;  3HOV J;  2XUB A;  1DU6 A;  2M1B A;  3GYH X;  3PUF A;  4KIC A;  5HOD A;  1X1P A;  3RKY A;  1FYM A;  1QA6 A;  1RR8 C;  2H1L A;  1G4D A;  2CW0 F;  1P6R A;  3BR2 A;  3S3M A;  5LGU A;  1BI3 A;  4AIJ A;  1Y39 A;  3R61 A;  3PFY A;  3HSE A;  1I1S A;  3K0L A;  1CF7 B;  4JP0 A;  2CV0 A;  4BHP A;  5H6R A;  3RJP A;  3V7C A;  3HOZ J;  2NVY J;  1V4R A;  2CU7 A;  3E6D A;  3I59 B;  3LSI A;  3BPV A;  4LJZ F;  1FPQ A;  2HTJ A;  1K6Y A;  3IKV A;  2CQQ A;  5BPI A;  3W6K B;  2L4M A;  4AIK A;  2X1E A;  2CQN A;  4Q48 A;  2HQA A;  3PO3 J;  3HOS A;  3QQA A;  3Q0U A;  3W2V A;  2GXB A;  1WGX A;  1KQ0 A;  2QWW A;  4BE0 A;  1OMI A;  4QPO A;  3S17 J;  2R7W A;  2WC2 A;  3FK7 A;  2ETH A;  1TWA J;  2ZC2 A;  4FIS A;  2NOG A;  4RM3 A;  3X2Q H;  5A2Q K;  2R7V A;  2BVM A;  1FT9 A;  2Y0S N;  4HQM A;  1H0M A;  1LVA A;  1O57 A;  3H36 A;  4GDF A;  1E2X A;  5J4Y A;  1ZH5 A;  1D5V A;  2Z33 A;  1I39 A;  1MNM C;  2NNY A;  2ZME A;  2DQR A;  2R7Q A;  5FB2 A;  4MEY F;  5DCF A;  3D5R C;  1OPC A;  3BZ6 A;  1TLH B;  1B9N A;  3CZ6 A;  5A2Q Z;  3WU2 C;  2DU9 A;  5BS6 A;  2PLY A;  1Z0X A;  1LKX A;  4P9F A;  4LLG F;  5HLH A;  3RYR A;  2A6H F;  1BBY A;  1GXP A;  2HZT A;  4XLC A;  3GTJ J;  2EIJ H;  4A3D J;  2XSD C;  3JRE A;  4PUS A;  1X3Z B;  4EM1 A;  3GFI A;  1SMT A;  1Z67 A;  4JOM A;  2QBY B;  1NHA A;  1BW6 A;  4ASN A;  1LEB A;  1PYV A;  3HL2 A;  5FD6 A;  1NTC A;  2DK5 A;  3S1Q J;  2OD5 A;  1W7P D;  2HDC A;  4KIB A;  2Y48 A;  5CVV A;  4RDU A;  2XPV A;  1B72 B;  4LIT A;  2ELK A;  4A2U A;  2BHZ A;  2Q8K A;  2XGD A;  3EQL F;  3H5R A;  3SFI A;  4ENK A;  1VFC A;  3K4K A;  1J5Y A;  1VQ4 I;  1IUF A;  4HRI A;  2HQR A;  4YIF A;  2R7T A;  3S15 J;  2VBZ A;  1QZY A;  3ZR8 X;  2O8K A;  3VFZ A;  3VOD A;  4CYC A;  2PMU A;  4M9X A;  3I55 I;  3E7L A;  1S7A A;  3J7A Y;  3PNY A;  1OYW A;  2OCE A;  1YQA A;  3B73 A;  4V19 K;  2ZFW A;  4M9Z A;  1TWH J;  3M1C A;  1T6S A;  3FMQ A;  2WB1 N;  4C30 A;  2R5Y B;  1R49 A;  2O3F A;  3M7G A;  3MVP A;  1X19 A;  3WHB A;  1HF0 A;  4OWR B;  2DA5 A;  1USS A;  4C2M J;  3ZOB A;  2LNB A;  1VI0 A;  1L0O C;  2E2H J;  2VC0 A;  3EDP A;  2R7D A;  1MDM A;  1YI2 I;  1VQ8 I;  2ME0 A;  3ZQL A;  1IAW A;  5IOY A;  4OMY A;  1MD0 A;  1YE9 A;  3TW7 A;  2FUG 2;  2XPW A;  1IUY A;  2XF6 A;  1RR7 A;  2GIV A;  2MC4 A;  1GDT A;  5FRM A;  3CDI A;  1YX3 A;  2RC4 A;  2JA6 J;  2GWR A;  2ZCW A;  4R1H A;  4MTD A;  1SD7 A;  3CCY A;  1VQ7 I;  5KK1 A;  5FGM A;  3BZC A;  5FKL A;  4U87 A;  4X6A J;  3HEF A;  2KP6 A;  3PQJ A;  3KP2 A;  2IXS A;  5DD4 A;  5L3F A;  2WA0 A;  3A0B C;  1F43 A;  4RGS A;  1YLF A;  3HJE A;  3C1D A;  4XSX F;  3RYP A;  5C4J J;  3LSP A;  2GBY A;  2MLK A;  3GZN B;  4II3 A;  1YS7 A;  2K5C A;  1TNS A;  3HTU A;  4OAY A;  2KIU A;  1IO2 A;  2ZNZ A;  1YOV B;  5D6E A;  4UY8 I;  3PJR A;  4B8X A;  2F5D A;  4I09 A;  3Q5F A;  2GA2 A;  4PJL A;  5EF6 A;  5CVI A;  3DKX A;  1NG7 A;  2JUG A;  3LOC A;  2YPR A;  1AU7 A;  2WAQ A;  2LF8 A;  3MWM A;  4MQ9 F;  4FE7 A;  1NH3 A;  2QLZ A;  1N25 A;  4AYB A;  3BLY A;  2OPT A;  1SC7 A;  2H1K A;  2XF5 A;  2RGV A;  4WWC A;  1UAA A;  4AIH A;  3JRC A;  3HBL A;  3V8J A;  1Y0N A;  4KJZ A;  2Y9Y A;  3H3U A;  3S2W A;  1U8B A;  4IRI A;  5F0C A;  4Q5S F;  3KPH A;  3DEW A;  1TWC J;  1U9N A;  2KPM A;  3R60 A;  3J7A O;  4YEL A;  1TP4 A;  2JT1 A;  3RPU D;  1U3E M;  4MEX F;  3SZT A;  5F6F A;  3CDH A;  2DA6 A;  4R79 A;  1SFU A;  5B66 C;  1UJ8 A;  2DYR H;  4OOI A;  1XDS A;  3ZMV A;  1FOY A;  2DQL A;  5LBQ A;  1G59 A;  5DYM A;  3OS2 A;  1ETK A;  3KYC B;  4C3I J;  2NAZ A;  4GRI A;  1DUX C;  4DW6 A;  2P5K A;  1RES A;  5IT3 A;  4XRS A;  3WTS C;  4BHC A;  1IC8 A;  4DZP A;  2O6G E;  2K9Q A;  3DPU A;  5GAG J;  1N78 A;  1E3O C;  3OYG A;  4A3J J;  3NWT A;  2FEZ A;  4DYC A;  3OSG A;  4OU0 A;  1IXC A;  2M4G A;  5E1X A;  2M7B A;  3GW2 A;  3H9J A;  3MAJ A;  5B1A H;  4B3X A;  3RDI A;  2ZXI A;  3SJM A;  3TOA A;  4A3I J;  2R7R A;  4AC0 A;  1JJ8 C;  1BI2 A;  1QGP A;  3A1Y A;  5IYB J;  3FIW A;  3W6V A;  4YFK F;  3QOP A;  2H6B A;  4A0Y A;  4RB1 A;  1JE8 A;  3ZMU A;  3CLO A;  4A3K J;  1FY7 A;  3OV8 A;  4B1R A;  3QU3 A;  3LSR A;  3FBI B;  2BY1 A;  3KP3 A;  3FZV A;  3K10 A;  4BKX A;  3QRF F;  1W0U A;  4RGR A;  2TRT A;  1BI0 A;  1VQN I;  1OCZ H;  5FJ8 J;  2V1U A;  2Y9Z A;  3K4M A;  2H09 A;  1JUM A;  2OU2 A;  3FIS A;  5LEK A;  3AL0 B;  4IHS A;  4I99 C;  4I98 B;  1KGS A;  4A3G J;  1H8A C;  3G1O A;  3RKX A;  2R7X A;  3ISP A;  2GIZ A;  4KMF A;  2EK5 A;  1OCT C;  4HOB A;  4XID A;  1ENH A;  1R1U A;  3BTL A;  2VI6 A;  2L9R A;  3NAU A;  2GXA A;  3CMY A;  4NBQ A;  2V1N A;  1QVU A;  3EUH A;  1ZR2 A;  5AIP A;  2R7Z J;  2DMU A;  1ETW A;  1ETQ A;  2BVL A;  2FNA A;  1I3Q J;  2Z2S B;  2Z99 A;  1HDD C;  5TJJ A;  3LST A;  3OYE A;  2QUF A;  2XGE A;  3A03 A;  2CUE A;  3M8J A;  3HKZ A;  2MD5 A;  4ZJZ A;  2EH3 A;  4L5E A;  2XDV A;  2A6E F;  1XTA A;  1XC5 A;  4ZYE A;  2F2E A;  2VJI A;  4A3F J;  2R7U A;  1W5T A;  2O0Y A;  1CGP A;  1VQL I;  5IPA A;  1YS6 A;  3BJ6 A;  2OJE D;  3CF5 F;  1T0F C;  4ENM A;  1IV6 A;  2DO7 A;  3IH3 A;  2JA7 J;  2V1X A;  4M3F A;  3ABK H;  4A3M J;  3BCB A;  3I4N J;  1G3S A;  4N0B A;  4YIR X;  2Z9O A;  3TP0 A;  4NNJ A;  3H0D A;  2PBI A;  5KCM A;  4B09 A;  1IRG A;  4ESJ A;  2X1D A;  2DPD A;  2KMU A;  1QNT A;  3WU0 A;  3OS1 A;  1E3H A;  1SVM A;  1U5T C;  3GBG A;  4IHV A;  3DKY A;  4B48 A;  1A31 A;  3GTK J;  3HPG A;  3F22 A;  2YR2 A;  3DPT A;  4PJ0 C;  3NAR A;  1HLV A;  1Z7L A;  1R71 A;  4BQQ A;  1GV5 A;  1S8N A;  1UG2 A;  1WJA A;  4CCJ A;  2EPF A;  3L2W A;  1UHS A;  3RIR A;  2VON A;  3PSI A;  2L02 A;  2TDX A;  3PNV A;  5E3O A;  2W57 A;  1Y6I A;  3RPQ A;  1LE8 A;  4O5V A;  3CES A;  2VE8 A;  3CF2 A;  4YG2 F;  4Y17 A;  4HNT A;  2KHM A;  2EIM H;  2DMT A;  5EEH A;  1MMA A;  4BQN A;  2XF7 A;  4BY7 J;  2LLK A;  3R0J A;  3F6O A;  1NK3 P;  5HLG A;  1DP7 P;  2K7L A;  5DUI A;  3C2G A;  1W1W E;  4CO8 A;  2ACJ A;  4F52 A;  4XLH A;  3OOU A;  4M6V A;  5ILV A;  4IKF A;  1AOY A;  2HNH A;  2LYC A;  2WBM A;  4KT6 A;  1JUP A;  4A6E A;  5FD5 A;  5F0H A;  2VPL A;  1FSH A;  1QPM A;  4LB5 A;  2CQ7 A;  4UVC A;  2A61 A;  1APL C;  2L7Z A;  4MHG A;  1FYK A;  3M9A A;  2VKH A;  2EZH A;  1QRY A;  4BGD A;  4C3H J;  5FO5 A;  2UV1 A;  2KRF A;  1HW2 A;  4CXF A;  3TOB A;  2X6X A;  3V42 A;  1A6I A;  3JSO A;  2BZT A;  4E70 A;  3M1E A;  1ZRC A;  3LA3 A;  5LD2 C;  3K2Z A;  2F4M B;  2HR3 A;  3NQO A;  3CC7 I;  5DTD A;  3U9G A;  1K4S A;  2CO5 A;  2Y31 A;  3CUQ B;  1X3W B;  1WJ5 A;  2P0W A;  1HA8 A;  3E6B A;  4JX4 A;  5EGO A;  2D5V A;  3PIP F;  4U0W A;  2VAS A;  2M7A A;  1ZYR F;  2OQG A;  3BR0 A;  5B5E C;  1LQ1 A;  3KFW X;  2P7V B;  4IJA A;  3RZD J;  1X1D A;  5HLI A;  4G7H F;  2ISZ A;  1OLT A;  3KEY A;  4PSX A;  3IKT A;  4G12 A;  3WU1 B;  3F8N A;  1FLI A;  2LRE A;  3WG7 H;  1IGN A;  3DKW A;  1OQY A;  1K6O A;  4CCN A;  3CCJ I;  2P5L C;  3IH2 A;  2H6C A;  3E6M A;  1MZB A;  1MH4 A;  2HQ5 A;  2RNJ A;  4Z2Y A;  3S14 J;  3LL7 A;  2Y0M A;  1I5Z A;  1FP2 A;  1JXS A;  2HQN A;  2XPU A;  5E1Z B;  2XHK A;  1RIO H;  3EUA A;  2YU3 A;  3L2R A;  1SFO J;  3VYR B;  3BJA A;  4L5J A;  3FXL A;  3HOY J;  1U5T A;  3GLX A;  1WJD A;  3OIQ A;  4HX7 A;  3MZY A;  1A36 A;  1V5F A;  2RDP A;  4MNU A;  2KL4 A;  2R5Z A;  3S2H J;  1X1C A;  5EEA A;  1E3P A;  1U2W A;  3OSF A;  1Z1D A;  2RKH A;  3BR1 A;  4QIW N;  3A01 A;  2UZK A;  3W2W A;  3ZCO A;  2IW5 A;  1IV8 A;  5JLW A;  3ZQF A;  5IOZ A;  5J40 A;  3CCS I;  3G4S I;  4BJ6 C;  4N9I A;  3DQV C;  4BBR J;  4U0Y A;  2ZME B;  3MKZ A;  3DWL E;  1UFM A;  5M5X J;  3DEE A;  1I6X A;  2X6O A;  1IXS B;  2EQR A;  3F8F A;  3IP4 B;  3CCL I;  4M3E A;  1GLN A;  4BUP A;  1XB4 A;  5CLS A;  1QO0 D;  2L5Q A;  3QP6 A;  1GUU A;  2DW4 A;  3ECH A;  2HKO A;  4RGU A;  5C3E J;  4GXO A;  1AWC A;  2K3P A;  1HCR A;  1WKM A;  2V9P A;  1EKE A;  1TQM A;  1TT0 A;  3OS0 A;  4BY1 J;  2UWM A;  4FET A;  1VQP I;  4LG0 B;  4Y7N J;  4XLN F;  2X0L A;  2H27 A;  1G8X A;  2MG4 A;  2F4O B;  5FKN A;  1LB2 A;  5FRN A;  2LK2 A;  1YRN A;  3SEZ A;  2K86 A;  3CUO A;  2WAF A;  2VJ5 A;  1TC3 C;  1KYZ A;  1POG A;  3FF5 A;  5D8L B;  4A3E J;  1XGM A;  3CTA A;  3ZPL A;  1MBK A;  3C2B A;  3CMM A;  4KDP A;  2JSC A;  1IN6 A;  2A05 A;  3RQI A;  3FDY A;  4XK4 A;  1W4M A;  2CQK A;  4HEA 2;  5F27 A;  4AUX A;  4BQO A;  4CYC B;  2HDD A;  2STT A;  1BL0 A;  3ML6 A;  2D2W A;  2K9L A;  5KVR A;  3DLA A;  3K70 D;  3TO6 A;  2FD5 A;  4OIN F;  2HFH A;  1MJB A;  2LP0 A;  1QHG A;  3Q3S A;  2DN0 A;  2JPB A;  2Z16 A;  1PUE E;  2CWE A;  4HSR A;  1KU7 A;  2E1N A;  1V5E A;  3HDD A;  3LWF A;  4CGZ A;  5CPR B;  4Y52 J;  3K4B A;  3P9C A;  5J1Y A;  4XL9 A;  1Y1V J;  5TRD A;  4EEF G;  1HW1 A;  1IF1 A;  1BW5 A;  2CV2 A;  3R0A A;  1PVE A;  4AWX B;  1ONV A;  1XN7 A;  3KZI C;  4B44 A;  2ZJR F;  2X4H A;  2VXZ A;  2DXI A;  3L09 A;  1T08 B;  3QPS A;  2ZNY A;  1O3Q A;  2IVM A;  3U1D A;  4B3A A;  3S8P A;  2M5W A;  1KQ9 A;  4HYE A;  3S3O A;  1XSD A;  2CGP A;  4E7S A;  2E5N A;  2KRC A;  4H0E A;  2E1M C;  2R7O A;  3KP5 A;  2R7F A;  4M3D A;  1Z91 A;  2GLO A;  3FXJ A;  3CCR I;  4XM3 A;  1D1C A;  3GCM A;  2DDA A;  1MJ9 A;  4ZC3 A;  5F1J A;  4UUS A;  1TW3 A;  4F91 B;  2D1H A;  2M30 A;  4XQF A;  4RB0 A;  2M4K A;  4UV9 A;  4HDU A;  1W7P A;  2Z1D A;  1PDN C;  3ASN H;  1G6N A;  1VQ9 I;  2PMH A;  2H94 A;  4MFE A;  4XKB A;  4CDG A;  1Y0U A;  4ZYG A;  1FWZ A;  2XAH A;  3ZQ7 A;  4L0Y B;  1FOX A;  3BZK A;  2OCC H;  2WY8 Q;  3BG6 A;  5DCM A;  1DU0 A;  2A69 F;  1NG6 A;  1A35 A;  4II2 A;  2GM4 A;  2UUZ A;  1XPX A;  3EPZ A;  2WTE A;  3R6S A;  9ANT A;  1WJC A;  3OYJ A;  3MKL A;  2M8G X;  2X1C A;  5LHG A;  3K7A J;  1XMX A;  3GEZ A;  3E5U A;  3FBN B;  3OL3 A;  3T8R A;  1D0Y A;  4XMY A;  3GO5 A;  4P5O A;  3CP8 A;  3AFH A;  5DDG A;  5F64 A;  4A5N A;  3IV5 A;  1R9T J;  1R5G A;  2DA2 A;  1R7J A;  2WV1 A;  3G1M A;  3RSN A;  1YIO A;  1J09 A;  2A3S A;  4YFN F;  1K4T A;  4V2F A;  2BV6 A;  2DFI A;  4YRV A;  2W4S A;  1WCM J;  2G7H A;  5JHU A;  1IN8 A;  4LOC A;  2V6E A;  3KYD B;  2MW8 A;  1T8I A;  3FKJ A;  4PCQ A;  4E4H A;  5ILU A;  1XD7 A;  4J01 A;  2QKL B;  2L7M P;  3IHU A;  4ESB A;  4IL6 C;  3CD6 I;  2DOD A;  5E1W A;  2LG4 A;  4BS9 A;  5JVT A;  2MH2 A;  4IPA A;  3QOE A;  2F48 A;  1H9G A;  2IA1 A;  2XGC A;  4ZYH A;  1B1B A;  5IP6 A;  2QZ8 A;  2VQC A;  3ESW B;  4Y3O A;  1B8I A;  1IW7 F;  3E6C C;  2DA4 A;  2PFB A;  3BJO A;  2IT0 A;  3I9V 2;  5L3C A;  1HW5 A;  4XRF A;  5EZG A;  3JAM K;  2E19 A;  2P7C B;  3S2D J;  4LGW A;  4CYD A;  3OWT A;  2FE3 A;  1MBG A;  2P5V A;  1J0R A;  1RUN A;  5BQT A;  1YJ9 I;  3K1M A;  3JCU C;  4YFX F;  3CDL A;  4IXA A;  1GT0 C;  3L2V A;  3E3V A;  4I7H A;  3RQ4 A;  1KU9 A;  1R4M B;  2QYO A;  3BT9 A;  4JX6 A;  2HOA A;  1P4W A;  5K1Y A;  4BXU A;  2FQ3 A;  2HGC A;  2ZSH B;  3JAM Z;  5GAD J;  3E97 A;  2DFH A;  4GFB A;  4NQW B;  3ZQI A;  2XC7 A;  4I2O A;  3W6J B;  3AG2 H;  1MNE A;  1K78 A;  1RET A;  2PMZ A;  4G94 A;  3VB2 A;  3DU6 A;  2PQ8 A;  2CFO A;  4WK8 F;  1WJE A;  2LOO A;  1TBX A;  2VPR A;  1FOK A;  1ERD A;  1KU3 A;  5IP7 J;  1T56 A;  3ECO A;  1T98 A;  1MMS A;  5GAH J;  4BE1 A;  3T5X A;  2LBF A;  5FFZ A;  5GTH C;  4BEH A;  4IF4 A;  1JKP C;  3SDG A;  1I50 J;  4HF1 A;  3BOQ A;  3BTC A;  4L9J A;  1BI1 A;  2OUM A;  4IRH A;  2A6T A;  3JW4 A;  3TP3 A;  1REP C;  4AM3 A;  3RPU A;  5FKK A;  5LRS A;  2FBK A;  2MLG A;  4I0A A;  4FT8 A;  4C2U A;  2QA4 I;  2GOM A;  3SXY A;  1ZQ3 P;  4RB2 C;  1K61 A;  3FXR A;  3P5J A;  2JWT A;  3V8L A;  4QLC U;  4CZZ A;  1NK2 P;  3GFM A;  3V7R A;  1MGT A;  1VQM I;  3FM5 A;  3LAP A;  2ID3 A;  2ICW G;  3HSF A;  4G7Z F;  4BAY A;  2D45 A;  5CVR A;  5IT9 K;  1AA7 A;  2NVT J;  2XIG A;  4BDY A;  2FOW A;  1JHF A;  1JUS A;  1Z7U A;  1Z6T A;  4W1U A;  5DV5 A;  4LD5 A;  4MQV A;  4NC7 A;  2GOX B;  4BHB A;  3CO7 C;  1JTX A;  2FQ4 A;  3LSK A;  3WHC A;  4C2T A;  2AO9 A;  5HS8 A;  5DEQ A;  4BDZ A;  2HEO A;  4P96 A;  1WJB A;  3KLN A;  1WSU A;  1P7J A;  1WJF A;  4HW0 A;  5EG0 A;  3O6B B;  1ZK8 A;  2XGX A;  1UZC A;  5IT9 Z;  1BR1 A;  3VYT B;  1HKS A;  4UNO A;  3GLL A;  4I02 A;  1ETO A;  4I0B A;  1HST A;  1FJL A;  5KNL A;  1SAX A;  2E1O A;  2HVR A;  3F0C A;  1JT0 A;  2WY7 Q;  2CRG A;  3MMY B;  4UHT A;  4D9J A;  5B1B H;  2VKE A;  1VF9 A;  2HXI A;  1WZ2 A;  4Y33 A;  3DU5 A;  4LK1 F;  1P4A A;  3G2B A;  4G8X A;  1R1V A;  3NRV A;  3OYN A;  3J80 K;  2G9W A;  4BQA A;  3GF2 A;  4BE2 A;  2AQF A;  2BGC A;  2MBF A;  4PZJ A;  2O9L A;  3BG5 A;  4RA2 A;  3DF8 A;  3VEP A;  4EM2 A;  1MSF C;  1SD5 A;  2LMD A;  3CC4 I;  2XB5 A;  1GHC A;  1OCC H;  4UUT A;  2BY0 A;  4AD9 A;  1WQ2 A;  2CW7 A;  1WI9 A;  1YW9 A;  2K02 A;  3HHH A;  5DM7 F;  1TTY A;  5EEG A;  2VC1 A;  4ZTF A;  2P6S A;  4CZC A;  4DBQ A;  3J80 Z;  2DMQ A;  4GYG A;  1ZR4 A;  1ETY A;  2FBH A;  5CKT A;  3IL2 A;  1CF7 A;  2BXZ A;  5HS9 A;  4WXD A;  3TKY A;  1ZGW A;  2HOT A;  1FIA A;  4WXH A;  3G73 A;  4B4C A;  3SHF A;  3MKY B;  1ZRE A;  4F92 B;  1CQT A;  2OV7 A;  5IP9 J;  2HDW A;  4M74 A;  5HS7 A;  4IRG A;  4RM2 A;  3GTQ J;  3AG4 H;  3DP7 A;  1U0J A;  3OYB A;  4RLF A;  1YIT I;  2NS8 A;  2EIK H;  2VT2 A;  3D5S C;  3K9T A;  3KP7 A;  3QYF A;  2VE9 A;  1GXQ A;  4BJ5 C;  4KN7 X;  3M4O J;  1E17 A;  1IXR C;  2L2O A;  3DFG A;  2YX7 A;  3WE2 A;  1IRF A;  2K9S A;  4BNC A;  1YW7 A;  4HDV A;  4EGZ A;  2JZY A;  2MC3 A;  3H9G A;  1R58 A;  3L2U A;  3V7S A;  1KZH A;  2JA8 J;  4XRM A;  2BBY A;  2VKV A;  5D6F A;  2VB6 A;  3HGG A;  1T2K A;  2FNP A;  3KZZ A;  4HX8 A;  5FKM A;  1I6H J;  1MJA A;  2BXY A;  2DA3 A;  1RUO A;  3BRO A;  3ZRG A;  5TIS C;  2BW3 A;  4BXX J;  4HZF A;  1Z3X A;  5C44 J;  1EH7 A;  2G7U A;  1K83 J;  1K7A A;  4KIT B;  3F23 A;  2ZFU A;  2DFE A;  3S93 A;  5ICC A;  3F9K A;  2VOP A;  5KHD A;  2W7N A;  3K1P A;  3COA C;  4L9T A;  2LY9 A;  2XAS A;  1PP7 U;  1UMQ A;  1W5S A;  4BL0 B;  1YO5 C;  2MYS A;  3KLO A;  4GYI A;  3WGG A;  2IS2 A;  5CQE A;  5BPD A;  5K5O A;  1R5H A;  3O2P E;  3WTV C;  3F21 A;  2ZKZ A;  1SD6 A;  2QBY A;  1RZ4 A;  2L9N A;  2H8W A;  2Y0S A;  2E36 A;  3ULQ B;  3D0S A;  4FQG A;  3MN2 A;  3HGY A;  3ZMZ A;  2EV0 A;  2VBX A;  1AKH B;  3VPR A;  1MND A;  1JKR C;  1R5I D;  2HXO A;  2LKP A;  5CQG A;  1PUF A;  5ICF A;  3RKW A;  2V6C A;  2A68 F;  3LA2 A;  5K5R A;  1N75 A;  1UST A;  4D1Q A;  4F55 A;  4Q47 A;  4XNF A;  2M45 A;  2Q1Z B;  3NWS A;  1Y8Q B;  2IJL A;  5F1R A;  3HIF A;  1T33 A;  2Y30 A;  3K1N A;  3ZQG A;  1BR4 A;  1Y1W J;  2PJR B;  4IHW A;  2XRN A;  2CH0 A;  2JUC A;  3TO9 A;  2VIX A;  1G3T A;  3D5L A;  3UKG A;  2CG4 A;  1GVD A;  3K70 C;  1XX5 A;  1ZAR A;  2COM A;  4JK1 X;  2X6Y A;  4PDK A;  2W84 A;  2B9S A;  3WG9 A;  4A69 C;  1MMN A;  3GVA A;  4A0Z A;  3WTX C;  2R93 J;  2W00 A;  2JSP A;  1FBS A;  3ABM H;  4FTH A;  2DT5 A;  1U6G A;  4NC8 A;  3FM3 A;  5AIQ A;  3ROU A;  3L00 A;  5D5V B;  4LG3 A;  3CCM I;  2IA0 A;  1PJR A;  3SQN A;  4BYY A;  5K7F A;  3WGI A;  1B6A A;  3AKZ A;  3BDD A;  1FEX A;  2OTJ I;  1ZEL A;  1WH7 A;  2VOD A;  2LH9 A;  4A6D A;  4JQF A;  4LK0 F;  4HQE A;  4ZYD A;  4E7H A;  2VBY A;  1TL8 A;  3H0G J;  2CUZ A;  3J81 K;  4A12 A;  2LD5 A;  2QSF X;  2HOS A;  4ENN A;  4ZZL A;  4A3L J;  3D1N I;  4EJT A;  1OYI A;  3DTI A;  3AL0 C;  2WB1 A;  3CCV I;  3SYT A;  3GUD A;  3FMR A;  1OKR A;  4K2E A;  3ABL H;  1UCR A;  2V9V A;  3K4C A;  5D8K B;  1ON2 A;  3H35 A;  4F93 B;  3JTH A;  4RAZ A;  2KIS A;  3LSJ A;  3HYI A;  4ZDL A;  1S3J A;  2QSH X;  5E8G A;  3J81 Z;  2K27 A;  2QVO A;  2LKX A;  3OIO A;  1W5C C;  2Y69 H;  3OR2 C;  4XLF A;  2L3D A;  2DAO A;  3C7J A;  2VQL A;  4A0X A;  4S05 A;  2F5C A;  2DPU A; 
#chains in the Genus database with same CATH homology
 4XK4 A;  4D5C A;  3HOX J;  5F27 A;  4AUX A;  4CYC B;  2HDD A;  3S1N J;  1BL0 A;  3GTJ J;  2HI3 A;  2CJJ A;  5J1U A;  4A3D J;  2XSD C;  3JRE A;  4RBO A;  2EBI A;  2FD5 A;  5IYC J;  3PM1 A;  2LP0 A;  3Q3S A;  2DN0 A;  1BW6 A;  5J1R A;  4A3B J;  2RAE A;  1NTC A;  3S1Q J;  1MH3 A;  2M9H A;  2ME6 A;  3HDD A;  4IHX A;  1JGG A;  4MO7 A;  4Y52 J;  4RDU A;  1B72 B;  2XPV A;  5J1Y A;  2ELK A;  1Y1V J;  4EEF G;  1BW5 A;  2XGD A;  3SFI A;  1VFC A;  4MFD A;  4D5F A;  1IUF A;  3BQZ A;  3S15 J;  1IDZ A;  1LFU P;  3QPS A;  2O8K A;  4FE4 A;  2TCT A;  4CYC A;  3E7L A;  3DCF A;  4B3A A;  1P7I A;  2FX0 A;  1TWG J;  1H89 C;  2K9N A;  2JA5 J;  4S0H B;  1TWH J;  2R5Z B;  4MIM A;  4M3D A;  2R5Y B;  2WB1 N;  2GLO A;  4JX5 A;  3MVP A;  3WHB A;  4D7N A;  5F1J A;  3B6C A;  1HF0 A;  4C2M J;  2DA5 A;  4UUS A;  1B72 A;  3A01 B;  3ZOB A;  1AHD P;  1VI0 A;  2DMN A;  2E2H J;  5JLX A;  2E2J J;  3K2A A;  4MLO A;  2IEK A;  3S1R J;  2ME0 A;  3ZQL A;  5IOY A;  5GP9 A;  5M3F J;  3TW7 A;  2XPW A;  1X2N A;  1RR7 A;  2AHQ A;  3HOU J;  3JRH A;  2DJN A;  4MFE A;  1GDT A;  2I10 A;  4HNV A;  3RZO J;  2JA6 J;  5EZH A;  1DU0 A;  1U9O A;  5FLM J;  3HM5 A;  2M34 A;  2EZK A;  2GM4 A;  3CCY A;  1OCP A;  2CUF A;  2QF7 A;  9ANT A;  1JT6 A;  2R5Y A;  1IRZ A;  3MKL A;  5FKL A;  4X6A J;  2M8G X;  3HEF A;  3G1L A;  3K7A J;  1VND A;  5F04 A;  1GV2 A;  1F43 A;  5C4J J;  1B8I B;  3GTL J;  3S1M J;  2ECC A;  3LSP A;  5C4X J;  2GBY A;  1RPW A;  3IV5 A;  2H8R A;  1R9T J;  2DA2 A;  2WV1 A;  3G1M A;  1WH5 A;  4V2F A;  1YRN B;  1WCM J;  4I6Z A;  4LOC A;  5EF6 A;  2MW8 A;  4DZJ A;  1MBH A;  3LOC A;  3Q0W A;  3GTO J;  5GPA A;  4J19 A;  2L7M P;  4ABZ A;  1AU7 A;  1IG7 A;  4D7M A;  4FE7 A;  1MBF A;  3JRG A;  2KDZ A;  2OPT A;  5IP6 A;  2XGC A;  2H1K A;  1B8I A;  3JRC A;  3HBL A;  1IDY A;  2DA4 A;  2Y9Y A;  5EDN A;  1U8B A;  5EZG A;  3S2D J;  2E19 A;  1HDP A;  5F0C A;  3DEW A;  2M2E A;  1TWC J;  1U9N A;  2QCO A;  2EZL A;  2COB A;  1JKQ C;  1MBG A;  3RKQ A;  4A3C J;  4JYK A;  3BG3 A;  1HOM A;  1GT0 C;  2N8G A;  3CDL A;  1U78 A;  1FTZ A;  2DA6 A;  3JRI A;  1OFC X;  3BT9 A;  4JX6 A;  2HOA A;  2M0C A;  1ETK A;  4QSH A;  4C3I J;  5J3L A;  4DW6 A;  1QPI A;  1RES A;  1S7E A;  4GFB A;  4XRS A;  1IC8 A;  3ZQI A;  4DZP A;  3PO2 J;  1RET A;  2DA1 A;  2K9Q A;  5BNG A;  1FIP A;  3JRB A;  1E3O C;  3O8H A;  4NDL A;  2VPR A;  2YUS A;  4UUS B;  4A3J J;  4DYC A;  5IP7 J;  1T56 A;  3OSG A;  1SAN A;  1TWF J;  1JKP C;  4M3B A;  3SJM A;  3SDG A;  4A3I J;  1I50 J;  3BTC A;  4AC0 A;  5F08 A;  3LSG A;  5IYB J;  1JJ8 C;  2LFB A;  3TP3 A;  3BR5 A;  2WAQ N;  5FKK A;  3FIW A;  3W6V A;  1ORK A;  4XRS G;  1ZQ3 P;  4DYQ A;  4A3K J;  1K61 A;  4B1R A;  3JRD A;  3LSR A;  3FKI J;  4W97 A;  1Q1V A;  2JWT A;  5FKO A;  1NK2 P;  2W48 A;  4BKX A;  3M3Y J;  1W0U A;  2Y2Z A;  2ID3 A;  2TRT A;  3QPL A;  5FJ8 J;  2Y9Z A;  1JUM A;  3FIS A;  2R92 J;  2VUM J;  2K40 A;  2B63 J;  1LFB A;  4A3G J;  1H8A C;  3G1O A;  2NVT J;  2FJ1 A;  2DTZ A;  4W1U A;  1JUS A;  1OCT C;  4XID A;  1ENH A;  3BQY A;  2LVS A;  3BTL A;  2VI6 A;  1JTX A;  2FQ4 A;  2L9R A;  3TW6 A;  3NAU A;  1QVT A;  3WHC A;  3CMY A;  2AO9 A;  1QVU A;  3JR9 A;  2R7Z J;  1ZR2 A;  2DMU A;  1WPK A;  1RKT A;  1ETW A;  3L1P A;  1ETQ A;  3ZQH A;  1P7J A;  1XS9 A;  2NS7 A;  5EG0 A;  1I3Q J;  1HDD C;  1ZK8 A;  2R0Q C;  2PMZ N;  3Q0V A;  2XGE A;  3A03 A;  2CUE A;  1ETO A;  1WI3 A;  1FJL A;  4QTR A;  2EH3 A;  4L5E A;  2E1O A;  2ID6 A;  3I4M J;  1XC5 A;  3F0C A;  1JT0 A;  2CRG A;  2IAI A;  3BG9 A;  4A3F J;  2VKE A;  1VF9 A;  2HXI A;  5IPA A;  1W0T A;  2DMP A;  2KT0 A;  5DS9 A;  1MBJ A;  1IV6 A;  3IH3 A;  2JA7 J;  3TED A;  4M3F A;  4A3M J;  3I4N J;  1AKH A;  2O9L A;  1G2H A;  3TP0 A;  3BTI A;  3BG5 A;  2JMW A;  1MSF C;  2XB5 A;  1ZKG A;  4UUT A;  3GBG A;  4IHV A;  2JK3 A;  1XG1 A;  4BBS J;  4XIC A;  3GTK J;  3S16 J;  3NAR A;  1HLV A;  1BA5 A;  5E3N A;  2DMQ A;  1ZR4 A;  1GV5 A;  4IEJ A;  3HOW J;  1UG2 A;  1ETY A;  5IYD J;  2ZB9 A;  1UHS A;  1MBE A;  3HB9 A;  5E3O A;  1ZGW A;  2HOT A;  1LE8 A;  1FIA A;  4B4C A;  2L7F P;  1CQT A;  4A93 J;  5IP9 J;  3GTG J;  2NVQ J;  1EF4 A;  4I76 A;  3GTQ J;  2DMT A;  1X58 A;  4BY7 J;  2LLK A;  2NS8 A;  1NK3 P;  5M5W J;  3ZQC A;  5K7Z A;  3M4O J;  4IHY A;  3OOU A;  4M6V A;  5E3M A;  5FLV A;  3FK6 A;  4M3G A;  3HKZ N;  2YS9 A;  2K9S A;  1JUP A;  5F0H A;  1FTT A;  5E3L A;  2XRL A;  1APL C;  2L7Z A;  2MSY A;  2OF7 A;  2EZH A;  3B6A A;  1JTY A;  1QRY A;  3IH4 A;  2JA8 J;  3LNQ A;  4XRM A;  3BR3 A;  2VKV A;  4C3H J;  5M3M J;  3HGG A;  2X9D A;  1O4X A;  2YU9 J;  5FKM A;  2E2I J;  4X1E A;  1A6I A;  1I6H J;  1A5J A;  2DA3 A;  3JRA A;  1ETV A;  4V2G A;  2CQX A;  4DYR A;  4AYB N;  4BXX J;  5DTD A;  2G0E A;  5C44 J;  2Y31 A;  1K83 J;  1Z77 A;  2LR8 A;  1PUF B;  2DA7 A;  4FCY A;  5EG0 B;  3H3V K;  2IBD A;  5EYR A;  5M5Y J;  4JX4 A;  5EGO A;  2D5V A;  2LY9 A;  1UMQ A;  2NVX J;  2MGQ A;  3BR0 A;  2EZI A;  3RZD J;  2L0K A;  1RKW A;  1H88 C;  5K7H A;  2JJ7 A;  3BTJ A;  4G12 A;  1IJW C;  3BR6 A;  3A02 A;  3MN2 A;  3HGY A;  3O8G A;  3GTP J;  1AKH B;  1IGN A;  1BJZ A;  1X2M A;  3VPR A;  3GTM J;  1JKR C;  2HXO A;  1PUF A;  1ETX A;  3IH2 A;  1MH4 A;  2HQ5 A;  1JJ6 C;  3S14 J;  3HOV J;  1DU6 A;  2XPU A;  1T33 A;  2Y30 A;  5HOD A;  3ZQG A;  1SFO J;  1Y1W J;  1MSE C;  4IHW A;  2O7O A;  3HOY J;  3BR2 A;  1ZTR A;  3JRF A;  3UKG A;  5F0F A;  1GVD A;  3CQZ J;  4C3J J;  2R5Z A;  3S2H J;  5EEA A;  4JP0 A;  3OSF A;  3BR1 A;  3HOZ J;  2NVY J;  2CU7 A;  1LE8 B;  4QIW N;  3A01 A;  2P81 A;  4A69 C;  1D5Y A;  2CQQ A;  2R93 J;  4FTH A;  5JLW A;  1OJL A;  3ZQF A;  5IOZ A;  2XB0 X;  2X48 A;  3PO3 J;  4BBR J;  3QQA A;  5K7F A;  5M5X J;  1FEX A;  2X6O A;  3Q0U A;  1WH7 A;  2EQR A;  2JN6 A;  2ECB A;  1WGX A;  4M3E A;  2HYJ A;  3H0G J;  3S17 J;  2LD5 A;  3FK7 A;  1GUU A;  1TWA J;  5GPC A;  2HOS A;  4FIS A;  2NOG A;  5C3E J;  3D1N I;  4A3L J;  2Y0S N;  1HCR A;  1JKO C;  4BY1 J;  4Y7N J;  1ITY A;  5FKN A;  2MG4 A;  1MNM C;  2LK2 A;  1YRN A;  3LSJ A;  1TC3 C;  2LKX A;  3OIO A;  1POG A;  4A3E J;  1F36 A;  1MBK A;  3C2B A;  5EGO B;  1Z0X A;  2LTP A;  3RQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...