4DYRA

Crystal structure of terminase small subunit gp1 of the bacterial virus sf6 with caps ph10.5 buffer
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gene 1 protein
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dyrA01
1NTCA 1MBEA 1IJWC 1IV6A 2GM4A 1FEXA 1MBKA 1XS9A 1RESA 2H8RA 2HOSA 2X48A 3OOUA 3PO3J 4XRMA 3SFIA 4XICA 3S15J 2MG4A 1WH7A 3HKZN 1JTYA 3JRIA 4RBOA 3TEDA 2K40A 4DYQA 1AKHA 2WB1N 3Q0WA 2JA6J 2CUFA 4C3HJ 5EG0A 2RAEA 1MBFA 3FK6A 4X1EA 5EGOB 3MKLA 5EG0B 2DA1A 1DU6A 3SJMA 1ETOA 3S1MJ 1LE8A 3LSGA 4V2GA 3RQIA 1WPKA 1OCPA 3O8GA 2Y30A 1X58A 3HBLA 2XPUA 5M5XJ 3HEFA 2EH3A 2LD5A 5E3MA 3CQZJ 4AC0A 1UHSA 1JKOC 2VKEA 3JRAA 5K7ZA 2HOTA 3ZQLA 2GLOA 3IH3A 4M3EA 3LOCA 1I3QJ 2Y0SN 5FKOA 2DMQA 4W97A 1ZKGA 3NARA 3WHCA 3DEWA 1FTZA 2JMWA 3HGYA 2LR8A 2FD5A 3GTJJ 3ZQHA 1JJ8C 3CDLA 3Q0UA 1ETQA 1RKTA 3IH2A 1YRNA 3FIWA 4DYRA 3S1NJ 5C4JJ 3G1LA 4AUXA 3M3YJ 3BG5A 2HYJA 1ZQ3P 3JRHA 3BR3A 2Y9YA 3GBGA 4MFEA 1BA5A 5M3FJ 1HOMA 4DZPA 3K2AA 3OSGA 5EEAA 2DA5A 1PUFA 4FTHA 3BTIA 2CUEA 3BR2A 1HLVA 1POGA 2EZHA 1X2MA 1ETYA 4M3GA 2W48A 4DYCA 3M4OJ 4J19A 2DMPA 3HB9A 5K7FA 3BT9A 5FLVA 3HOYJ 1BW5A 3Q0VA 4IHYA 4NDLA 1GUUA 2EZLA 4M3BA 3QPLA 5GPAA 4DZJA 4D7MA 1Q1VA 2OPTA 4A69C 2L9RA 1GDTA 3A02A 5EYRA 1MSEC 2ME0A 1MBHA 2ZB9A 2CQXA 4BY1J 1LFUP 1DU0A 1FIAA 3SDGA 2L7FP 2XB5A 3HOXJ 5J1RA 1BL0A 2LY9A 3S2HJ 2E2JJ 4UUTA 1GV2A 3NAUA 3B6AA 2ID3A 3QPSA 1HCRA 2IAIA 1HDDC 1U9NA 5F0CA 3JR9A 4IHXA 5JLWA 4A3CJ 3IV5A 3I4NJ 1EF4A 3A03A 2QF7A 1VFCA 5DTDA 1FIPA 4RDUA 3S16J 3TW7A 3WHBA 4XIDA 2HXIA 3LSRA 3ZQIA 3BR6A 1UG2A 4FCYA 1JJ6C 5IP9J 2YS9A 3E7LA 1S7EA 2FQ4A 3S1QJ 3K7AJ 2TRTA 5EGOA 5E3LA 1IDZA 5C44J 1RKWA 1RETA 1MBGA 4IHWA 3DCFA 3HOZJ 1ZR2A 5IYCJ 3TW6A 2NVYJ 3CMYA 3JRDA 5F04A 3GTOJ 2VKVA 2E19A 2WAQN 4B1RA 3HDDA 2YUSA 1U9OA 4Y52J 1HF0A 4A3IJ 3PO2J 5EZGA 1MBJA 4XRSG 2R0QC 5IYDJ 2CRGA 1ZK8A 5FKNA 5GP9A 5E3OA 1ETXA 3RZOJ 2XB0X 1A6IA 3BTJA 1W0TA 4A3BJ 4DW6A 4BXXJ 2XGDA 3G1OA 1D5YA 3JRFA 4MFDA 5F08A 3ZQCA 1H88C 1G2HA 5IP6A 1QRYA 3BR5A 3S2DJ 2IBDA 4MO7A 5F27A 2JN6A 2O8KA 1Y1VJ 2K9NA 4QTRA 3GTLJ 3C2BA 1FJLA 4XRSA 3BQYA 1VF9A 1SANA 2LVSA 3HM5A 1B72A 3HOVJ 5EF6A 4C2MJ 2CJJA 4UUSB 1JKRC 3B6CA 5FKKA 1MSFC 3O8HA 2JJ7A 1B72B 2EQRA 2HXOA 1BJZA 4JYKA 4CYCB 1P7JA 1B8IA 3PM1A 2L7MP 2M9HA 4C3JJ 2L7ZA 1AHDP 1B8IB 1E3OC 5F0HA 2G0EA 2R7ZJ 3GTKJ 2L0KA 3JRCA 2IEKA 2I10A 5IP7J 1OCTC 2NVQJ 2JWTA 1IC8A 5M5WJ 1OFCX 1TWAJ 2XGEA 4X6AJ 3I4MJ 2NS7A 4BKXA 2DA4A 2O7OA 2LFBA 1VNDA 2EZKA 3L1PA 1I50J 1TWFJ 3ZQGA 3GTQJ 1A5JA 2R5ZA 4C3IJ 1IRZA 3LSJA 2EZIA 1F36A 1P7IA 2JK3A 4M6VA 1JT6A 3OIOA 2R5ZB 2E2IJ 4JP0A 2JA5J 4JX6A 1QVTA 2DTZA 2P81A 2JA7J 1GVDA 1T33A 2E1OA 3D1NI 3GTGJ 3LNQA 3S14J 2NS8A 3QQAA 4Y7NJ 2DMTA 1K61A 2M34A 4FISA 2Y9ZA 3G1MA 1TWGJ 4A3MJ 2COBA 4LOCA 1JKPC 2QCOA 2XSDC 2LLKA 2GBYA 3RZDJ 4D5FA 1ENHA 2DA3A 2NVTJ 4D5CA 1OJLA 5BNGA 1JT0A 2JA8J 3TP0A 4M3FA 3FKIJ 5IOYA 1JUSA 5J1UA 1WCMJ 5IOZA 1O4XA 1T56A 2EBIA 5M5YJ 5FKLA 4IHVA 2R93J 2TCTA 5J3LA 2AHQA 2OF7A 2Y2ZA 1ETKA 2NOGA 1QVUA 3BG3A 1HDPA 1ORKA 2HI3A 2ECCA 4A3JJ 2R5YA 2XPVA 1IDYA 3FK7A 2XGCA 2R92J 3JREA 3A01B 5E3NA 2R5YB 4MIMA 3GTMJ 2VPRA 1XG1A 3H0GJ 2AO9A 2DA7A 2HOAA 1K83J 1Z0XA 2ME6A 2H1KA 1ZTRA 2DMUA 2NVXJ 1AU7A 2O9LA 2ELKA 9ANTA 3BTCA 2LTPA 5F1JA 3ZOBA 2DA6A 1AKHB 4A3EJ 4B4CA 1GV5A 1H89C 3W6VA 4QSHA 2K9QA 4BY7J 4FE4A 1TC3C 3GTPJ 2HQ5A 2FX0A 4A93J 4I76A 1IGNA 2B63J 1JUMA 4BBSJ 3UKGA 2XRLA 1LE8B 1Z77A 4HNVA 1SFOJ 1MH3A 2X9DA 1ZGWA 3BR1A 4AYBN 4EEFG 2DMNA 1ITYA 1MH4A 5M3MJ 2DN0A 4UUSA 3FISA 4W1UA 1WH5A 5HODA 2FJ1A 1RPWA 2LP0A 2VI6A 4S0HB 2YU9J 1I6HJ 1TWHJ 1BW6A 4A3KJ 2Y31A 4V2FA 4G12A 5FJ8J 2M8GX 4BBRJ 4CYCA 4GFBA 3BTLA 5C4XJ 5GPCA 4A3DJ 4QIWN 1ETVA 1NK3P 2KDZA 2ID6A 3S1RJ 5F0FA 1Y1WJ 1JKQC 3HOWJ 2E2HJ 2M2EA 2DJNA 3HGGA 4A3FJ 1IG7A 3BQZA 1JTXA 3BR0A 3IH4A 1YRNB 1F43A 2LK2A 5J1YA 1APLC 2ECBA 4MLOA 5IYBJ 4ABZA 2VUMJ 5C3EJ 3Q3SA 5JLXA 1U78A 1XC5A 3TP3A 1FTTA 5EDNA 1NK2P 4D7NA 1H8AC 1WI3A 4IEJA 1VI0A 2MSYA 3JRBA 1R9TJ 4L5EA 1WGXA 5FLMJ 3HOUJ 1PUFB 1JUPA 2CU7A 3MVPA 2HDDA 5K7HA 5DS9A 4FE7A 2DA2A 4JX4A 3CCYA 2MGQA 1W0UA 1QPIA 1LFBA 4M3DA 1ZR4A 2LKXA 1U8BA 3S17J 3F0CA 2PMZN 2M0CA 1RR7A 2XPWA 2K9SA 2MW8A 1ETWA 2KT0A 1UMQA 5IPAA 1CQTA 1GT0C 3JRGA 4I6ZA 5FKMA 4XK4A 3ZQFA 3RKQA 4A3LJ 4JX5A 1MNMC 4B3AA 1IUFA 2CQQA 1X2NA 3MN2A 3OSFA 3H3VK 2WV1A 2N8GA 1JGGA 5EZHA 3LSPA 2D5VA 4A3GJ 2X6OA 1TWCJ 3VPRA 3A01A 3BG9A
chains in the Genus database with same CATH superfamily
1NTCA 1YFHA 3MMYB 1FEXA 1RESA 1UAAA 5J4YA 1S8NA 4JOMA 3WTUC 3I54A 2CMPA 2H6BA 2FMLA 1JTYA 3JRIA 1E17A 3TEDA 1PUEE 2V1DA 1IXSB 4V19K 2WB1N 3HTUA 3GFIA 4PJ0C 4U0YA 2BGCA 3QOPA 1KQ9A 2E1MC 5EG0A 1B6AA 5JVGF 2IS1A 3GMEA 3W6KB 4P5OA 5EGOB 3T8TA 4IOCF 5EG0B 4A5MA 3QP5A 2Z1DA 1YJWI 3S1MJ 1LE8A 1Z05A 4YFNF 4B47A 5D5XB 2VXZA 3HBLA 3DWLE 5M5XJ 2OQRA 3HEFA 2ICWG 4LK1F 4F55A 3KP3A 4G94A 1JKOC 3J7AY 5ILVA 1KU7A 2HOTA 3ZQLA 6PAXA 4G7ZF 3F21A 3P9IA 1YQAA 1ACIA 1DP3A 3LOCA 5K1YA 3HSFA 2JT1A 4KIGA 2Y0SN 3SEZA 1FOKA 1XMXA 3LFKA 2XIGA 4W97A 1ZKGA 3NARA 5DEQA 1Z7UA 2L4MA 4ESFA 3DEWA 1FTZA 1UCRA 4RM3A 3WTSC 3MD2A 2VJ4A 2DK8A 3BZKA 4GRIA 1ETQA 1YS6A 3IH2A 1YRNA 2VPLA 3FIWA 1XSXA 2H8WA 3S1NJ 3V4GA 5C4JJ 3LQRA 1Z6TA 2E7XA 3DU6A 4GYIA 4OAYA 4PJJA 1AA7A 2HYJA 3TL4X 2K5CA 5FB2A 1ZQ3P 4CCMA 3OYLA 3OIQA 2R7OA 3GFMA 1BA5A 4NC7A 1XN7A 2GA2A 3K70C 1HOMA 4EM2A 4M9SA 5ICGA 4RB2C 5KNLA 2LREA 4QPOA 2CW8A 3N05A 5H2FC 1KZHA 1YE9A 3ZP5A 1POGA 4BHPA 1K7AA 1O7LA 3H5NA 4L9NA 1X2MA 4M3GA 3DBLB 2EB7A 3I59A 4J19A 2ZMEC 2DMPA 2OUMA 2D1HA 1EJ9A 3ZN1A 4F92B 3BT9A 2Q2EA 2B0LA 4Y3OA 1T38A 2JSCA 1EH7A 4BJ6C 3HRSA 2Q2EB 5LEJA 1L3LA 1K79A 2OPTA 4A69C 2L9RA 1GDTA 4HEA2 1BR4A 3H0DA 2ME0A 1LVKA 3BG7A 1SC7A 2K3PA 3A0BC 5EEHA 4NQWB 5K5QA 2CH0A 3H92A 3L2WA 1T0FC 3E6BA 1I1SA 1Y56A 5J6XA 5HS8A 2MD0A 2V6CA 5J40A 2L9VA 3KP5A 1UFMA 5DCFA 2KIUA 4ZZLA 2K27A 1U9NA 1XSVA 1HDDC 1HKQA 5F0CA 1Y8QB 2VJIA 3K1PA 3GO5A 4RMNA 3A03A 3A1YA 2IA1A 2MABA 4KIBA 1WJFA 2E5NA 3DFGA 1UG2A 1K78A 3PJRA 3ZMZA 3B73A 2DPDA 1PYVA 1MMAA 2CQNA 2FQ4A 4UVCA 4MTEA 1K78B 2VOPA 2TRTA 4LFUA 1I3AA 4G6DA 2QKLB 5E3LA 1IDZA 3CJTB 2C6YA 2YPRA 3PNTA 3E6DA 5FD5A 3I53A 5IYCJ 1PJRA 2WAFA 3FXUA 4LIVA 3JRDA 1NG7A 5F04A 1B9NA 1R1VA 1ZRFA 2LRDA 1R5GA 5CKTA 3K1MA 3PNVA 4B1RA 1VQLI 2KDOA 1IW7F 2YUSA 3HL2A 1X4PA 1YHQI 1HF0A 4GGGA 3S3NA 3PO2J 3VSKA 3DKWA 4D9JA 4DBQA 5EZGA 1YW7A 2AQFA 4ZC3A 4EMSA 4YIRX 2MLGA 1K4TA 4BGDA 2R7QA 1G59A 2ZNZA 2ZBKA 4F7ZA 4PJMA 1A6IA 2M5WA 4LJZF 4BXXJ 2JUGA 2XGDA 3BPVA 1D5YA 2EIMH 4KT6A 5F08A 1TT0A 4N4OB 1H88C 3S3OA 4BE0A 2IBDA 3ROUA 1FMWA 3QYBA 1YG2A 1FOWA 2K9NA 4M74A 2O8KA 4BQQA 1W36D 3LAPA 1TNSA 3FX3A 2GXBA 1TZLA 1LEBA 3BQYA 1VF9A 4WWCA 1ODDA 3HM5A 4C2MJ 3CCJI 3P9KA 2P4WA 3B6CA 1HSJA 2OZ6A 1MSFC 3O8HA 3MKWB 4M71A 3F8CA 3TOAA 5HDGA 2K02A 4HYEA 3OYGA 4OMZA 2KFDA 3CUOA 2HWVA 2M9HA 5HVQC 3WTWC 1AHDP 1SMYF 3ZMSA 1TL8A 1LUJB 2G0EA 4WXHA 4M73A 3GTKJ 1OCTC 3OV8A 3OYDA 2NVQJ 1SD6A 1IC8A 5M5WJ 4B44A 4F93B 3EPZA 3I4MJ 4UB8C 3C18A 2DA4A 2LFBA 3HSRA 1Y0NA 4CXFA 1VNDA 3QRFF 1FYMA 3CJQB 4LLLA 3IWFA 3GTQJ 3GZ5A 4Y17A 2R7VA 4C3IJ 4KT5C 1IRZA 3LSJA 1F36A 1FP1D 3HRUA 3WGHA 1HXDA 3HXLA 2BW3B 3G2BA 1RIOH 2LMDA 2JA5J 2DTZA 4LD5A 1HKTA 4R1HA 3VFZA 3GTGJ 1IN8A 2OCCH 4PZJA 2FF4A 4Q47A 3QQAA 2V1XA 2DMTA 4OIQF 4FISA 4B09A 2B7EA 4DIQA 2Y48A 1TWGJ 5B1AH 5E18F 4UUVA 2FU4A 3CCUI 2XSDC 5CJ9A 1OKRA 5CVIA 2W84A 1FMVA 1LQ1A 2GOMA 5ILUA 4B8XA 2IXSA 4HDUA 3FKIJ 1WCMJ 5L3DA 3V7CA 1T56A 2ESHA 2P5KA 1TBXA 3M1CA 2R93J 3QU3A 4AIKA 2OF7A 2XAJA 3BG3A 1FBSA 4XKWA 1ORKA 2A5YB 2ECCA 3EETA 4NB5A 2HVSA 4A3JJ 2R5YA 1YLFA 1FP2A 2ZO4A 2B9SA 3VYRB 2KRHA 3TO7A 3JREA 3G73A 4B3XA 5E3NA 1S72I 2R5YB 2KRCA 4MIMA 4RGRA 2VPRA 5DD4A 5H6RA 2DA7A 2CFXA 2XAFA 4XMYA 1Z0XA 3HPHA 2VIXA 1BM9A 2VN2A 2VKHA 2DMUA 4BEHA 2H1KA 3AG3H 2L54A 3WGIA 3VYTB 3BTCA 2LTPA 3ZOBA 4BEHB 5DUIA 5ED4A 1K6YA 5DCMA 3DLLF 3IRQA 1W1WE 2VT3A 1H89C 4AM3A 2KJCA 5HDKA 2D2WA 3W6VA 2JRMA 4L5IA 2M87A 5DCMB 4EATA 4BY7J 4AWXB 3I4PA 4NBQA 5IT9K 1IRXA 3LSIA 1WSUA 1F5TA 3MFKA 4R79A 3PSIA 5F1RA 3UKGA 4IQJA 4HNVA 3HYIA 1IN5A 4ETSA 4RA2A 4LB5A 1MH3A 3IKTA 4C9YA 1ZGWA 4AYBN 2DMNA 3T1BA 1MNEA 1MIJA 1JXSA 2XASA 3J80K 1MH4A 2E1CA 2X6XA 4W1UA 3I58A 1LDDA 2LP0A 3OYFA 5HOOA 2Z16A 4ENJA 5FGMA 2DFEA 3HHGA 4IRGA 1KYWA 3K10A 2ZJ2A 3BLYA 3LSTA 4RB0A 2H6CA 1RRJA 5FJ8J 4FT8A 1SVMA 2JA2A 3GUDA 4A2UA 5KHDA 3V8KA 4S05A 4P9FA 3H3ZA 5GPCA 1QZZA 3QU6A 4XRFA 1FY7A 1N75A 5DM7F 2KMUA 2DJNA 3LWFA 1UZCA 3DXJF 4PFPA 3BQZA 4PSWA 1Z91A 3OY9A 1R4NB 3CUQC 3JTHA 1VQ4I 4IJAA 1ZAOA 2ECBA 4E7JA 2R4GA 2CUJA 5CVJA 5IYBJ 2ZSHB 1XCBA 3JAMK 1S7AA 1Z67A 3HG9A 3AAFA 5C3EJ 5JLXA 1U78A 2QENA 4XLCA 3LAJA 3CCQI 3RTRA 1S9HA 4MQVA 2A69F 1D1CA 3M9AA 1R9TJ 4BJ5C 4U7DA 2EIKH 1OCRH 2QWWA 2HDWA 4EJOA 3BG6A 3MVPA 1ZN2A 2V9KA 5J8FA 4K2EA 3PQKA 2MA3A 3KP2A 3CESA 1IUYA 1XB4A 1YS7A 4LG3A 1I27A 3DPUA 2QGUA 3OS1A 2A6TA 1MMNA 4KITB 1BR2A 5HLGA 2LKXA 1GXQA 3TOBA 2PMZN 3CMEI 2M0CA 2LDUA 1ZRCA 3ZRGA 2OU2A 1UMQA 2COMA 2DLLA 2O5RA 4KICA 1FZPB 1GT0C 4XK4A 2IJLA 2VQCA 3DTEA 3ZQFA 3RKQA 1SD7A 3HZJA 2QYOA 1IUFA 2CQQA 1X2NA 3OSFA 5L3BA 2QSHX 3PQJA 1R36A 2N8GA 1JGGA 2EFPA 3LSPA 3K4CA 2HYGD 2X6OA 3RIRA 4RS8A 4IKFA 2WTEA 3A01A 3K4NA 1FPQA 2HVQA 5CVRA 2X1EA 4BS9A 1IV6A 1XS9A 2HOSA 2H8RA 4BDYA 3E5XA 3OOUA 4M72A 4XRMA 1TQPA 2KZGA 2XDVA 1JHHA 3SEQA 2PI0A 2RREA 3OL3A 4HV5A 2VQHA 3HKZN 2K40A 1MMGA 4KDPA 3TDZC 3CJRB 1DUXC 1QBJA 2LSOA 2L7KA 3FK6A 3GCMA 3TBIA 4RB3C 4CCNA 3MKLA 1GHCA 2NRAC 2ZC2A 1R1TA 3QOEA 1R5ID 1ETOA 4ANJA 3DBRB 4V2GA 3RQIA 4H4KC 4ITVA 1OCPA 1XX5A 1Z3YA 3O8GA 1L0OC 4CCJA 1D3YA 1EH6A 4ZYEA 1XDUA 2Q0OA 2I5UA 2IGNA 5E3MA 1GLNA 4L9TA 1UHSA 1X1AA 2VKEA 4HSTA 1A36A 3JRAA 1HW5A 2GLOA 3IUOA 3SZTA 4BDZA 2VC0A 1ZH5A 1F1ZA 5TGTA 4BAYA 2MH9A 3KLNA 2RV8A 1WJCA 3W3CA 3DU5A 3HGYA 3SHFA 2PBIA 4HX8A 5CQGA 2E7WA 3ZQHA 2YX4A 4NC8A 1KGSA 3DP7A 4WX9A 1RKTA 4HLXA 1P9QC 2X0LA 4RAZA 4BACA 2A05A 3FM5A 2MD5A 4DYRA 1HSTA 4P55A 3M3YJ 2QQ8A 2F4IA 4IX7A 4ZH4F 1YITI 3O2PE 1FSEA 2Y9YA 3GBGA 4MFEA 2P6SA 4UV8A 2Z2SB 4E7LA 2HKXA 3HOSA 2VC1A 3ZXSA 5EEAA 3OSGA 1U5TC 4FX0A 1ONVA 2OA4A 2CUEA 2O8XA 3DTIA 3RKYA 3SYTA 1HLVA 3I3LA 5ICCA 5LHHA 1WRJA 4ZJZA 1R71A 3M4OJ 3OMYA 2XVCA 4L5JA 5CLSA 1N25A 2DQLA 4U87A 5JR3A 3ASNH 1NH3A 5ERIA 5K7FA 3BDDA 2RC4A 3SDBA 1MD0A 3HJEA 5FLVA 1BW5A 2DW4A 3Q0VA 3M8JA 1SFEA 4F3QA 3KCCA 5BMZA 4IHYA 4M3BA 1LDKB 1YX3A 1N77A 1H9GA 3MCZA 5J47A 4C30A 3A02A 2QSFX 3GXOA 1MSEC 1MBHA 3CJNA 3EUHA 2ZB9A 2CQXA 2BVLA 1LFUP 4BY1J 2O0YA 1HKSA 2FNAA 3JW4A 1DU0A 4ESBA 4E7ZA 3SDGA 4KISA 3I64A 1I5ZA 1BL0A 4L0ZB 2LY9A 4HV6A 1FWZA 2DBBA 5HS7A 2MBFA 3OR2C 3GYHX 2OQGA 3ISPA 2IPQX 5E8IA 2ID3A 2CG4A 3R6SA 2BXZA 4XLNF 5FLXK 1VTNC 3KZZA 5ICEA 4IHXA 5JLWA 1EF4A 3IV5A 2LKPA 2GQQA 2V1NA 2ZJPF 2HGCA 5DTDA 3UNGC 2VB6A 4Y15A 1EH8A 3F3XA 2HXIA 4XIDA 2HPMA 3K0LA 3ZQIA 2XSJC 2JRTA 3H5RA 1WJAA 1JJ6C 2YS9A 3QODA 3K7AJ 2M7AA 4I99C 1WKMA 3BZCA 1X1PA 5EGOA 4U0WA 2A61A 2VKDA 3K69A 3DCFA 1Z1DA 5FO5A 1AWCA 2ZXWH 2JQ7A 3ONQA 2XF7A 5L3FA 3N97A 3U1DA 2X1CA 1U9OA 1DGWY 4O3MA 1FC3A 1AOYA 1ZREA 2VQLA 3H5AA 1XGNA 3MWMA 2NVUB 1BOBA 3L9FA 3OYCA 3TDUC 2R0QC 4UNOA 2EK5A 2IS6A 4XOTA 5IYDJ 4XNFA 2DQRA 5GP9A 2GIZA 3ASOH 2X4HA 3RZOJ 3ABMH 1W0TA 5LGTA 1KU3A 4A3BJ 2P6TA 3JRFA 2BV6A 2PEXA 2MC3A 1G2HA 2DDAA 5EEGA 3KZIC 2P5VA 3S2DJ 5DD8A 4MO7A 1RUNA 1V3FA 5F27A 2XKPA 4QTRA 3GTLJ 2FBKA 1LKXA 1PP8F 1OQYA 1RUOA 4HRIA 4BQNA 4XRSA 2ZFWA 3B02A 1SANA 4M9ZA 2W85A 1JKRC 2DYRH 1LPQA 3BJAA 2JJ7A 1N78A 3BCBA 1YW8A 1NHAA 4N0BA 1WJEA 2BEOA 3OYIA 2BY0A 3ULQB 3F22A 2EA2A 3ZGKA 4XSZF 4ZYAA 2DAOA 2OBPA 2BXYA 2XHKA 4NC6A 2DJIA 3RPUA 2ZSIB 3I56I 1B8IA 3PM1A 1RZ4A 2RVCA 2L7MP 3S93A 1VQ5I 4AVPA 4C3JJ 1WJDA 2LC2A 2Z33A 2ZJRF 1B8IB 3BROA 5F0HA 1E3OC 1T08B 3FHNA 3RYRA 1REPC 4QLCU 2R7ZJ 3OWTA 4HG2A 5IP7J 3JRCA 2JWTA 2KISA 2RNJA 2XGEA 3M8EA 2IGOA 4X6AJ 2KPMA 2X51A 4KJZA 4I7HA 5E1WA 1KYZA 4BKXA 3HTSB 2O7OA 1BI3A 3C2HA 2DCEA 2DT6A 2WB1A 1KQ8A 1ULYA 3ZQGA 3G3ZA 1D8JA 4E7HA 2AXLA 2EZIA 4NQWA 4LB6B 4M6VA 2F5EA 2HVRA 3OIOA 3WTVC 1G3WA 3M1EA 4JP0A 2VODA 3ZPLA 4JX6A 4E70A 3HUGB 1T33A 1T98A 4HPQA 4DQ2A 4BHBA 2KHMA 3DQVC 1XD7A 2NS8A 3HRTA 4XM3A 1K61A 3AG4H 3PIPF 1YX5A 4KFCA 1V54H 2CW0F 3MZ8A 3AL0C 3ZMUA 3CCRI 3RZDJ 2KKOA 4D5FA 2PJPA 4G6TB 3OS2A 1G4DA 4UB6C 2DA3A 2R7WA 3PNYA 1HW2A 1OJLA 1IV8A 2PX9A 5E1XA 2Y0SA 4R8HA 4MGRA 5J1UA 4ASNA 4DBRA 3KEOA 4UVBA 5K5OA 2CO5A 5CVUA 4HBLA 4C2UA 1B59A 1J9IA 1ZG1A 1QVUA 4Y4RA 1YI2I 1IN7A 4HF2A 3KFWX 2HNHA 1QGPA 2DYSH 2UXXA 4Q48A 1IDYA 5LGNA 4IRHA 4RAFA 4G9YA 2XF5A 4HF1A 2RN7A 1T6SA 3BPXA 3D5LA 2AO9A 4XLEA 5E79C 2HOAA 2ME6A 3IHUA 1ZTRA 3R4KA 1V55H 4BHCA 2I8DA 4G6QA 2IA2A 4E4HA 1R1UA 2DA6A 1AKHB 3DKYA 4M6XA 2DDBA 2IRFG 3BZ6A 4BL0B 3IL2A 1W36C 4QSHA 2K9QA 2P0WA 2GAUA 3O3KA 4KN4X 3SFZA 4I09A 1H9TA 3CC7I 2V1UA 4XORA 1TC3C 5D6EA 3GTPJ 2WA0A 4I76A 2VJ5A 3PIOF 1R22A 2VBYA 1JUMA 2VE8A 2PN6A 2LKSA 4Y13A 2ELHA 2L9NA 2W7NA 1XCVA 3CDIA 4KIFA 3NQOA 4HNTA 4EEFG 3H9GA 3L2QA 3CMMA 4N4NB 4AD9A 2LNBA 3DTKA 4E7SA 2RDPA 2HFHA 2MH2A 3E3VA 2CV2A 3FISA 3G71I 1WH5A 3L2RA 1BI2A 3V8JA 4ZDOA 3OS0A 3QWLA 2VI6A 4CCOA 1I6HJ 1TWHJ 4HX7A 3L2UA 3KETA 5F6FA 2TDXA 5KK1A 2VBZA 4V2FA 3ML6A 4AIDA 3NWTA 3DV8A 5FROA 4BBRJ 4GFBA 1HW1A 2PG4A 3SZGA 4RLFA 2ZXIA 1MJ9A 1ETVA 2KDZA 2DODA 2ID6A 1YYVA 1A04A 3PFYA 4BJTA 1TT5B 2M2EA 3HGGA 4A3FJ 3KYLA 1R00A 3IAS2 3RPUD 4ZTFA 5BOXA 3IH4A 3CLOA 2BYVE 2QQ9A 2EPFA 4KA4A 3LSHA 1APLC 4HZFA 2G9WA 5LHGA 2LYCA 3GWZA 4EVIA 4KNYA 2A3SA 4XSXF 1G6NA 3E5QA 3Q3SA 1XC5A 3FMQA 3ERED 1FTTA 3UR3C 2Y75A 3HC7A 4CICA 4HQEA 3IKVA 2GZWA 5A2QK 1VI0A 2MSYA 3P5JA 3JRBA 4L5EA 5FLMJ 1PUFB 2BW3A 1T95A 3A2KA 2HDCA 2E5ZA 1JUPA 2KIQA 2LF8A 2EA4A 4YEJA 4HOBA 3OYBA 4JK1X 3W2AA 5LRRA 4ESJA 3K4LA 1S3JA 4FE7A 4CH7A 2F48A 4OMYA 2DA2A 2QSGX 3CCYA 2XC7A 2MGQA 3LA2A 1QO0D 1J59A 3WU1B 1XGOA 4M3DA 1U8BA 3H36A 1DP7P 3R61A 1ERDA 5E8GA 1RR7A 2XPWA 2MW8A 1ETWA 3S2WA 4YIFA 4XKCA 5IPAA 4HDVA 1CQTA 5HDNA 3G4SI 3CUQB 3AKZA 3JRGA 1VQOI 3F6OA 5FKMA 3U9GA 2ZFUA 1CGPA 1YJNI 1W7PB 2WY7Q 1X1CA 3OOPA 4OIRF 3C3WA 1BC7C 1MKMA 1XPXA 4HX4A 4MEYF 3BJ6A 3DPLC 3FXQA 3BG9A 1X3UA 1IJWC 4BQOA 2OJED 1HQCA 2GM4A 3GX4X 3WU0A 3J7YJ 3PO3J 2D1VA 2JSPA 2YR2A 3F8NA 2JUCA 2W57A 1PDNC 3SQNA 2FBIA 2GXGA 4XICA 4NUBA 1WH7A 1BI1A 2J5PA 2DK5A 4RBOA 1LDJA 4P96A 3QPHA 3MKZA 4LG0B 3CLQA 2AQEA 2OTLI 1FNNA 2PJRB 3OYKA 4CSWA 2DFHA 3IRRA 1MBFA 3PSFA 4X1EA 5K5RA 4YIIA 1TLHB 3C7JA 3X2QH 2DT5A 3CC4I 1KU9A 4D0PA 2WADA 1A31A 1WPKA 1K6OA 1SFXA 1V4RA 2Y30A 1STZA 2RNGA 1KA8A 3WGGA 2EH3A 2LD5A 2DOEA 3CQZJ 2CWEA 4PGGA 4BYYA 5K7ZA 1YOVB 2RGVA 1WVRA 1FLIA 3L00A 3CC2I 1WZ2A 4M3EA 5FFZA 3GEZA 4IOAF 2QQAA 5AONA 2QLZA 5LFAA 5FKOA 3HHHA 2HEOA 2M3AA 3BWGA 1MJBA 2JMWA 3EYYA 2W00A 2LR8A 3WG7H 4J01A 2BBYA 3J7AO 2F4MB 3KPHA 3CDLA 1G3TA 2O61A 5KAIC 3G1LA 5KVRA 5IT3A 3MEXA 3IWZA 4EGZA 1I1GA 2EWNA 3D0SA 1SFUA 1KU2A 4E6KG 4O5VA 5M3FJ 4Z2YA 1Y6IA 3KE2A 4DZPA 3K2AA 2Z5UA 2L02A 2UUZA 1ZHFA 3EUKL 2DA5A 4KYWA 4FTHA 2VQGA 3EQLF 5D8KB 1R4MB 1SAUA 4YELA 3TGNA 3LMMA 3OYNA 1FBUA 3TMOA 4H0EA 2KJBA 4KUMA 2K85A 1ETYA 4LGWA 2W48A 2OZUA 4DYCA 3ABKH 4P9UA 5ICFA 2H1LA 2E34A 5BPIA 2WAQA 2UV1A 3P9CA 1VQ6I 1J2XA 3HOYJ 3LA3A 4EM1A 1SD4A 5LEKA 2W4SA 4NDLA 1B1BA 2EZLA 5GPAA 1O57A 4DZJA 3F8BA 1LEAA 1MMDA 4D7MA 2G7UA 2PMHA 1ZRDA 2FQ3A 4IPAA 3H9QA 1FBQA 3WTTC 5HNFA 4MNUA 3OYJA 3K1NA 3VODA 3T8RA 4HF0A 1W7PD 2L7FP 2Z9OA 3K9TA 3RYPA 4I98B 5F64A 1MDMA 3KIOA 3S2HJ 3TO6A 2E2JJ 3RKWA 1GV2A 3NAUA 3DPTA 4RGSA 1U5TB 4BXUA 1MDMB 3B6AA 5ILSA 2EFOA 1UELB 1HCRA 4AYBA 2IAIA 2FXAA 4OIOF 2VXDA 4A3CJ 1JE8A 3I4NJ 2KL4A 2FRHA 1RI7A 1SAXA 3RSNA 1VFCA 5LLQA 1J09A 1FIPA 1HBXG 4RDUA 2HZTA 3S16J 1EA3A 3DBHB 3FBIB 1V5GA 1D0ZA 2G7HA 1FOYA 1NG6A 1E3HA 1WJ5A 4A6EA 2JPCA 1OMIA 2EIJH 3HRMA 3OYAA 4FCYA 2UXNA 4GCVA 2FOKA 4Z6YA 1DPRA 2Z99A 5DYMA 1S7EA 3ZMVA 1J5YA 2FUG2 2V6EA 2ZXJA 1G8XA 2F5VA 2A07F 5C44J 1TQIA 1YIOA 4ZYGA 3FXMA 4IHWA 1D1AA 1OR7A 2CYYA 3ZR8X 2IT0A 2NOJB 3HIFA 1CF7A 3TW6A 1E0EA 3GTOJ 2VKVA 1BC8C 1D0XA 2E19A 4WCGA 1CF7B 4O6JA 4A5NA 5JFRA 4YFXF 4LLGF 3LSKA 4Y52J 3P7NA 3FXRA 2FEZA 2L01A 2HQNA 2BY2A 4GXOA 4PDKA 2K9MA 3I0TA 1F4KA 2H27A 3WU2C 2M4GA 2F2EA 2E71A 1X3ZB 3DF8A 4AIHA 2A6EF 2CRGA 4I0BA 2F5DA 1ETXA 4A6DA 1OYWA 2IGMA 3J81Z 2M1BA 3R0JA 4MHGA 1Z21A 4OIPF 3ZQCA 5IP6A 5GAEJ 1QRYA 3FXJA 5BQTA 3DEEA 2ETHA 2PMZA 2JTVA 1PVEA 2E1MB 4BE2A 2VLAA 1W4MA 3C2BA 3A4CA 5HLIA 3MKYB 4IF4A 2EV0A 3F9KA 1G3YA 4QPQA 3LSMA 4XONA 2LVSA 5LRSA 1U8RA 1B72A 3HOVJ 2KZVA 5EF6A 2CJJA 4UUSB 4X0GA 5FKKA 4LK0F 4GDFA 5DV5A 2ZJQF 3CP2A 4CO8A 4J00A 3CF5F 1B72B 4IHTA 2FNPA 5IT9Z 1BJZA 2M0MA 4JYKA 4IVNA 2Q1ZB 4TV7A 3MZHA 1RNLA 4PUSA 2CQ7A 4YRVA 4FX4A 2X1DA 2KLOA 2R7TA 4CYCB 4XKBA 1D5VA 3MQ0A 5AIQA 3AG1H 4EJWA 2Y69H 2L7ZA 4RGUA 2KQRA 1VQ7I 4C2TA 2H94A 4XR6A 5BPDA 1OISA 3K4MA 4PK4A 1FX7A 2O6GE 1OFCX 1TWAJ 1Q1HA 1W5CC 2WWYA 1MNDA 4U7BA 1FOXA 5LD2C 2E60A 3GFLA 3HKZA 2NS7A 4L0YB 1TTYA 4I2OA 5B66C 4OINF 1XSDA 4CZCA 4L9JA 1A5JA 2STTA 1R23A 3U1KA 1BN5A 2L5QA 1JT6A 1VQ9I 4XN3A 2V9PA 2W24A 1QVTA 2P81A 2JA7J 4FASD 2E1OA 2R7XA 4XKVA 4L18B 3JAMZ 3JSPA 2K7LA 3ZMDA 4A0ZA 4WF2A 2M34A 3TQNA 2NS0A 2Y9ZA 3G1MA 2ISZA 2QKMB 4A3MJ 4LOCA 3VSLA 1USSA 2HU9A 1HA8A 4MQ9F 2ZMEA 2XKOA 3RJPA 2NVTJ 2EJRA 1ON2A 1IG7A 2ZMEB 1XGMA 2BE5F 4M3FA 1B9MA 5D4RA 1JUSA 3GVAA 4I02A 2EV5A 4RAYA 1EKEA 2EBIA 5M5YJ 5FKLA 3GLLA 3KEYA 3ZN0A 1IRFA 3L2VA 4BUPA 2AHQA 4YG2F 4PJLA 4DGWB 4E7KA 1WFXA 1OPCA 2Y2ZA 5DUKA 2NOGA 2V7FA 2R7UA 2HI3A 2HYFA 4HNUA 2XRNA 2RQPA 3O6BB 1T0FA 3FK7A 2XGCA 3F72A 3H3UA 3SXYA 2R92J 1IN6A 1SEUA 3E6CC 5B5EC 3GTMJ 2KRFA 3EUAA 5HS9A 4CDGA 1XDSA 1K83J 5GAGJ 2VONA 2JVGA 3G6EI 2D45A 1DDNA 2NVXJ 3K4BA 2F5CA 3VOEA 9ANTA 2HR3A 1V5EA 2V79A 3AL0B 3OYHA 3T0YA 2W25A 4IL6C 2L3DA 1GV5A 3JCUC 4P1WA 3NEUA 1EV7A 2WAEA 2DU9A 4FE4A 4L9VA 3LFUA 2HQ5A 2FX0A 2ZXHA 1P92A 5D8LB 4A93J 3VB2A 3RCOA 1C0WA 1IGNA 1BR1A 1LE8B 2XRLA 2IVMA 3ELKA 3BR1A 3D5RC 2K3FA 5J4VA 5FRNA 3DEUA 4B43A 2DN0A 4MTDA 4WK8F 1QHGA 2FJ1A 1RPWA 3IP4B 4S0HB 2YU9J 2LBFA 2KIFA 4HSRA 1BW6A 4A3KJ 2IS2A 1P2FA 1MGTA 3WTZA 5FD6A 5J8CA 4G12A 5D5VB 2LBFB 2QQBA 2M4KA 3I55I 2VOOA 1X3WB 1T8IA 3S32A 1Y39A 4AU7A 2OTJI 3BTLA 1BJAA 3U2RA 5C4XJ 3WTYC 4A3DJ 2MYSA 2K4JA 2YU3A 2HPIA 2ZKZA 2EINH 3K4KA 4RGXA 5F0FA 4ZYDA 3S1RJ 1Y1WJ 2E2HJ 3HOWJ 1U0JA 3WODF 1JTXA 1XTAA 4AVZA 1YRNB 4A0XA 4FHTA 1QA6A 2ADUA 5EJCA 3E5UA 4S04A 4BXFA 2W82A 1XGSA 2WV0A 4EM0B 5L3CA 2V4JC 3Q9VA 3EUHC 4MLOA 3CCEI 4ABZA 2GXAA 1WQ2A 1WI9A 2MFZA 1NK2P 2M7BA 1H8AC 1WI3A 2F5FA 4IEJA 3QYEA 1O3QA 3HOUJ 2XGXA 1ZARA 5E17F 4M9XA 1QNTA 3HUGA 2CU7A 1ZGAA 4RM2A 5K7HA 2BVMA 5DS9A 1X19A 2GA1A 3QPTA 3SZPA 2P7VB 4CHUA 3K70D 3QAHA 5JI6A 2STWA 3I59B 4DNCA 1W0UA 1ZR4A 2XAGA 2R7SA 3CDHA 1P4WA 1Z7LA 4PCQA 4ZTJA 3KYCB 3ABLH 1T2KA 3DLAA 3FM3A 2XAHA 2VL8A 4G8XA 2KT0A 3RKXA 2E1NA 2QA4I 1IZ1A 4G7OF 3KP6A 5JHFA 2V26A 5TISC 2F4OB 2QUFA 3BOQA 2CUZA 1IF1A 4A0YA 1MNMC 1BIAA 2PFBA 4BNCA 4B3AA 4E7IA 2LG4A 3CTAA 3MN2A 1YW9A 3CZ6A 3FXLA 2D5VA 4A3GJ 2X85A 3VPRA 1ZG3A 3LA7A 2P5LC 3I5UA 1R49A 3VYUB 1MBEA 1OCZH 1MBKA 2HQAA 3K6GA 2X48A 2FBHA 2ZCWA 1VQMI 1YIJI 3Q5FA 2LY2A 3SFIA 2ACJA 2CV0A 3S15J 3KX2A 2MG4A 5H20A 1SVOA 5DDGA 2NAZA 1D8KA 4DYQA 2K4BA 2P8TA 1AKHA 4F52A 3Q0WA 1TNTA 2JA6J 2CUFA 1KONA 4C3HJ 1LNWA 4ENMA 1ZGJA 3M7GA 4HW0A 5FLXZ 4ENNA 2RAEA 2NNNA 3EYIA 2DI3A 1R6RA 3ERMA 3BC8A 4B48A 2DA1A 3IAM2 1T39A 1DU6A 2Z3YA 1P4XA 3FMSA 2DFIA 2MC4A 4FQGA 3SJMA 4AIJA 3LSGA 1SVLA 1MW7A 1MZBA 1U6GA 2FOWA 5TRDA 1ZG5A 3PL8A 1X58A 3F23A 2XPUA 4CZZA 2OV7A 2IW5A 2LH9A 3M8FA 2W1OA 3J7ZI 2DXIA 4AC0A 1Y8RB 3HSEA 3K4JA 5D6FA 1J75A 1JHFA 2L9SA 3IH3A 1QQIA 3LL7A 3W2WA 4UY8I 1BI0A 3ESWB 1R5HA 1I3QJ 4EJTA 3FF5A 4MEXF 1D1BA 2X6WA 5IY5H 2DMQA 2EFWA 3WHCA 2WY8Q 5B1BH 2AS5F 2FSWA 3V8LA 2PMUA 3JTGA 2R7RA 1DPUA 2FD5A 2BY3A 3GTJJ 2CFOA 1JJ8C 3Q0UA 1FYLA 1QHHD 3E1SA 1X1BA 2A68F 2FA5A 4NNJA 1VQNI 2DT7B 1UJ8A 4AUXA 1IXRC 3BG5A 4IRIA 2CS3A 3BR3A 1S6LA 3JRHA 3NRVA 4F91B 2H09A 2QM3A 1MJAA 4ZYHA 5CVVA 4XL9A 1X1DA 4M6YA 4GYGA 2Q8KA 3OYMA 5JHUA 1QZEA 1PUFA 3N4MA 3D5SC 3BTIA 3BR2A 4XLFA 1LFPA 3KLOA 5GADJ 3ABUA 1O3SA 2EZHA 4OU0A 2FE3A 2HKOA 4CGZA 3CF2A 2X6YA 4PJNA 2KP6A 3OR1C 5FFXA 3ZQ7A 2CSOA 1SFKA 2EILH 3HB9A 1S7OA 1W5TA 3V7RA 3VDXA 2XROA 1GUUA 3QPLA 2XAUA 4IQ4A 1DQUA 3CUQA 4HA8A 1Q1VA 5CYVA 5BS6A 5EYRA 2F6CA 2R7FA 2O3FA 4EJUA 2ISYA 3ABTA 2OC6A 5GAHJ 1W7PA 2JZYA 1FIAA 2PQ8A 2XB5A 3HOXJ 5J1RA 3FWEA 3F6VA 1UHWA 1ON1A 4LMYA 4UUTA 1B4AA 1VQ8I 3RDIA 3QPSA 1Z3XA 2O03A 3W6JB 2QVOA 3K2ZA 2HTSA 1VQKI 1IRGA 4BH9A 3JR9A 2IS4A 1JI8A 2FMYA 4RB1A 5D5WB 2QF7A 2R3SA 3TW7A 3WHBA 3H35A 2UZKA 1QZYA 3OYEA 3LSRA 3BR6A 4LG0A 3CCLI 2OD5A 1S5LC 1SMTA 2PJRA 2VBXA 2BY1A 2DFFA 5E20A 5IP9J 4U88A 3E7LA 1A6QA 1ZYRF 3S8PA 3S1QJ 3F8FA 2BOLA 1LB2A 1O7FA 1RKWA 3WE3A 3CCVI 4N9HA 1RETA 1MBGA 2DPUA 3CMAI 3RPQA 3H1CA 3HOZJ 1ZR2A 3M07A 1MMSA 1Z6RA 2NVYJ 3J81K 1BBYA 3CMYA 3L2CA 2GWRA 4UVAA 2WAQN 1USTA 3HDDA 5FRMA 1I6XA 2ZNYA 4CCKA 1SD5A 2M30A 4ON0A 1G3SA 3FXOA 4A3IJ 4CCLA 2ELJA 1RC9A 3W2VA 2EV6A 2VE9A 1MBJA 4XRSG 2CQKA 1ZLKA 5LBQA 4XLPF 5HNHA 5DM6F 1TP4A 2XUBA 1ZK8A 5FKNA 3HOTA 5E3OA 2XB0X 1GXPA 3BTJA 3GZ6A 2CW7A 5D5UB 4DW6A 1Z9CA 3G1OA 5H6QA 3QP6A 4MFDA 2EFQA 4Q5SF 1P4AA 3ZQQA 3FHZA 1YJ9I 3NWSA 3Q9SA 2VJJA 1JGSA 3BR5A 3CCSI 1OYYA 5B3SH 2NXNB 2JN6A 5GTHC 1GVJA 1Y1VJ 4ZDPA 3DKXA 2L4AA 1FJLA 2JVHA 4JBAA 3V42A 1YTYA 1M1EB 3CD6I 3MZYA 3FBNB 4BQAA 2DOFA 1WWXA 2JPBA 3REOA 4CUGA 2EQRA 2HXOA 5TJJA 4PFOA 3ZCOA 2IA0A 1IAWA 4RAGA 3PUBA 4XLAA 3V7SA 1TW2A 3GLXA 1P7JA 4G7HF 1VQPI 5HLTA 2RQQA 3KYDB 3FXKA 2DTRA 2K86A 4UHTA 2L0KA 2IEKA 2I10A 2XF6A 3KP4A 5L3GA 4FETA 4LIUA 2VBWA 4XQFA 1YO5C 1TQMA 1H0MA 2OAZA 4II3A 4PGHA 1O3TA 2HTJA 3S3MA 4I0AA 1PP7U 1R7JA 2EZKA 3RI4A 3R60A 3L1PA 1I50J 3GW2A 1UB9A 1TWFJ 4BU2A 2R5ZA 1RR8C 4ZDLA 1P7IA 4HAMA 2E36A 3AG2H 2JK3A 2R5ZB 2E2IJ 3C1DA 1IO2A 1GVDA 1U5TA 3D1NI 3WTXC 4N9IA 1VZ0A 3LNQA 3S14J 5LHIA 2AXTC 3E0JB 3TO9A 1IN4A 4Y7NJ 4D1QA 2LOOA 3I71A 2HZDA 2HOEA 4KMUX 4XBFA 2COBA 1FT9A 3FDYA 4HLYA 5A2QZ 2QCOA 3I9V2 1OCOH 3FKJA 2LLKA 1JKPC 2GBYA 3BY6A 2EFNA 3CO6C 1ENHA 2R7DA 4EQQA 3BCAA 3C2GA 4XN0A 4D5CA 2CV1A 3RQ4A 3KEQA 5CQEA 5BNGA 4PSXA 1JT0A 2JA8J 3TP0A 1D0YA 5IOYA 5IOZA 5HLHA 1O4XA 4IHVA 1BIBA 3GFJA 1KQ0A 1Y0UA 3FZVA 2RKHA 2TCTA 5J3LA 1LJ9A 1U2WA 2YSRA 1ETKA 1HDPA 4IHSA 1WJBA 4II2A 2XPVA 5GTIC 3VEPA 2A6HF 3A01B 3OIPA 1TW3A 4NHJA 1XG1A 3H0GJ 3VWBA 3WE2A 1UG0A 2QZ8A 3JSOA 2QBYA 5JVTA 2IGKA 4RLQA 1AU7A 2O9LA 2ELKA 2L2OA 4LITA 2QBYB 4DJAA 5F1JA 4UV9A 1R58A 1XMAA 4A3EJ 4B4CA 1LVAA 4U0VA 1HC8A 2XV4S 1E2XA 3F8MA 4OOIA 3R0AA 2GIVA 2HQRA 3CP8A 1W5SA 4HQMA 4XLHA 3PFIA 4I01A 1J0RA 2VT2A 4YFKF 2B63J 2KIMA 4BBSJ 2LY1A 1Z77A 1SFOJ 2NNYA 2M8EA 1XMKA 3KP7A 2QEXI 2K9LA 4UXNA 2X9DA 2DOAA 3WG9A 2UWMA 4WXDA 3T5XA 1ITYA 3TKYA 5M3MJ 4UUSA 5HODA 2XAQA 2WBMA 4Q4ZF 3GZNB 3QYFA 3COAC 3L7WA 2PLYA 1QPMA 2Y31A 5LGUA 1K4SA 2V9VA 2E35A 1E3PA 2DO7A 3MAJA 3L09A 2M8GX 4WXCA 2YX7A 4CYCA 1FSHA 2M45A 1V5FA 1BOAA 4QIWN 2CGPA 2WC2A 3GF2A 2MLKA 1NK3P 3E6MA 2OCEA 3AFHA 3OL4A 2P7CB 1JKQC 4EV0A 4XOPA 3J80Z 4EJVA 3BR0A 3FMRA 1OYIA 1S29A 4CA0A 2LK2A 1F43A 5J1YA 1A35A 1WHUA 4BE1A 1J7KA 3ECOA 4ZZDA 4IZZA 1ZELA 3VYSB 2VUMJ 5CPRB 1X4OA 3H9JA 3TP3A 5EDNA 4D7NA 3U21A 1I39A 4GO1A 4IXAA 5KCMA 4OAZA 5L3EA 1WGXA 2Y0MA 4A12A 1U3EM 1P6RA 2BZTA 5E1ZB 3CCMI 2HDDA 3BP8A 2VASA 5D4SA 4CYDA 4Y33A 4JX4A 2IP2A 1OLTA 4OWRB 4IO9F 3IC7A 1QPIA 2NYXA 1LFBA 3S17J 2A5WA 3F0CA 4QWQA 4JQFA 4LLNA 2BHZA 2K9SA 1DGRM 1ZLJA 4I6ZA 3E97A 3LQQA 4DOZA 1QU3A 2J5OA 4KN7X 4A3LJ 4JX5A 2HS5A 4ENKA 3ZMTA 1O3RA 1IXCA 1OR7C 3HPGA 1FYKA 3EDPA 5AIPA 5KAFC 4KMFA 3ECHA 3H3VK 2WV1A 2BHYA 2LF7A 3BJOA 3A0HC 3CO7C 1F9NA 5EZHA 2ESNA 3KZYA 1TWCJ 1UHMA 3PUFA 2GOXB 4EGYA 1OCCH
chains in the Genus database with same CATH topology
1NTCA 1MBEA 1IJWC 1IV6A 2GM4A 1FEXA 1MBKA 1XS9A 1RESA 2H8RA 2HOSA 2X48A 3OOUA 3PO3J 4XRMA 3SFIA 4XICA 3S15J 2MG4A 1WH7A 3HKZN 1JTYA 3JRIA 4RBOA 3TEDA 2K40A 4DYQA 1AKHA 2WB1N 3Q0WA 2JA6J 2CUFA 4C3HJ 5EG0A 2RAEA 1MBFA 3FK6A 4X1EA 5EGOB 3MKLA 5EG0B 2DA1A 1DU6A 3SJMA 1ETOA 3S1MJ 1LE8A 3LSGA 4V2GA 3RQIA 1WPKA 1OCPA 3O8GA 2Y30A 1X58A 3HBLA 2XPUA 5M5XJ 3HEFA 2EH3A 2LD5A 5E3MA 3CQZJ 4AC0A 1UHSA 1JKOC 2VKEA 3JRAA 5K7ZA 2HOTA 3ZQLA 2GLOA 3IH3A 4M3EA 3LOCA 1I3QJ 2Y0SN 5FKOA 2DMQA 4W97A 1ZKGA 3NARA 3WHCA 3DEWA 1FTZA 2JMWA 3HGYA 2LR8A 2FD5A 3GTJJ 3ZQHA 1JJ8C 3CDLA 3Q0UA 1ETQA 1RKTA 3IH2A 1YRNA 3FIWA 4DYRA 3S1NJ 5C4JJ 3G1LA 4AUXA 3M3YJ 3BG5A 2HYJA 1ZQ3P 3JRHA 3BR3A 2Y9YA 3GBGA 4MFEA 1BA5A 5M3FJ 1HOMA 4DZPA 3K2AA 3OSGA 5EEAA 2DA5A 1PUFA 4FTHA 3BTIA 2CUEA 3BR2A 1HLVA 1POGA 2EZHA 1X2MA 1ETYA 4M3GA 2W48A 4DYCA 3M4OJ 4J19A 2DMPA 3HB9A 5K7FA 3BT9A 5FLVA 3HOYJ 1BW5A 3Q0VA 4IHYA 4NDLA 1GUUA 2EZLA 4M3BA 3QPLA 5GPAA 4DZJA 4D7MA 1Q1VA 2OPTA 4A69C 2L9RA 1GDTA 3A02A 5EYRA 1MSEC 2ME0A 1MBHA 2ZB9A 2CQXA 4BY1J 1LFUP 1DU0A 1FIAA 3SDGA 2L7FP 2XB5A 3HOXJ 5J1RA 1BL0A 2LY9A 3S2HJ 2E2JJ 4UUTA 1GV2A 3NAUA 3B6AA 2ID3A 3QPSA 1HCRA 2IAIA 1HDDC 1U9NA 5F0CA 3JR9A 4IHXA 5JLWA 4A3CJ 3IV5A 3I4NJ 1EF4A 3A03A 2QF7A 1VFCA 5DTDA 1FIPA 4RDUA 3S16J 3TW7A 3WHBA 4XIDA 2HXIA 3LSRA 3ZQIA 3BR6A 1UG2A 4FCYA 1JJ6C 5IP9J 2YS9A 3E7LA 1S7EA 2FQ4A 3S1QJ 3K7AJ 2TRTA 5EGOA 5E3LA 1IDZA 5C44J 1RKWA 1RETA 1MBGA 4IHWA 3DCFA 3HOZJ 1ZR2A 5IYCJ 3TW6A 2NVYJ 3CMYA 3JRDA 5F04A 3GTOJ 2VKVA 2E19A 2WAQN 4B1RA 3HDDA 2YUSA 1U9OA 4Y52J 1HF0A 4A3IJ 3PO2J 5EZGA 1MBJA 4XRSG 2R0QC 5IYDJ 2CRGA 1ZK8A 5FKNA 5GP9A 5E3OA 1ETXA 3RZOJ 2XB0X 1A6IA 3BTJA 1W0TA 4A3BJ 4DW6A 4BXXJ 2XGDA 3G1OA 1D5YA 3JRFA 4MFDA 5F08A 3ZQCA 1H88C 1G2HA 5IP6A 1QRYA 3BR5A 3S2DJ 2IBDA 4MO7A 5F27A 2JN6A 2O8KA 1Y1VJ 2K9NA 4QTRA 3GTLJ 3C2BA 1FJLA 4XRSA 3BQYA 1VF9A 1SANA 2LVSA 3HM5A 1B72A 3HOVJ 5EF6A 4C2MJ 2CJJA 4UUSB 1JKRC 3B6CA 5FKKA 1MSFC 3O8HA 2JJ7A 1B72B 2EQRA 2HXOA 1BJZA 4JYKA 4CYCB 1P7JA 1B8IA 3PM1A 2L7MP 2M9HA 4C3JJ 2L7ZA 1AHDP 1B8IB 1E3OC 5F0HA 2G0EA 2R7ZJ 3GTKJ 2L0KA 3JRCA 2IEKA 2I10A 5IP7J 1OCTC 2NVQJ 2JWTA 1IC8A 5M5WJ 1OFCX 1TWAJ 2XGEA 4X6AJ 3I4MJ 2NS7A 4BKXA 2DA4A 2O7OA 2LFBA 1VNDA 2EZKA 3L1PA 1I50J 1TWFJ 3ZQGA 3GTQJ 1A5JA 2R5ZA 4C3IJ 1IRZA 3LSJA 2EZIA 1F36A 1P7IA 2JK3A 4M6VA 1JT6A 3OIOA 2R5ZB 2E2IJ 4JP0A 2JA5J 4JX6A 1QVTA 2DTZA 2P81A 2JA7J 1GVDA 1T33A 2E1OA 3D1NI 3GTGJ 3LNQA 3S14J 2NS8A 3QQAA 4Y7NJ 2DMTA 1K61A 2M34A 4FISA 2Y9ZA 3G1MA 1TWGJ 4A3MJ 2COBA 4LOCA 1JKPC 2QCOA 2XSDC 2LLKA 2GBYA 3RZDJ 4D5FA 1ENHA 2DA3A 2NVTJ 4D5CA 1OJLA 5BNGA 1JT0A 2JA8J 3TP0A 4M3FA 3FKIJ 5IOYA 1JUSA 5J1UA 1WCMJ 5IOZA 1O4XA 1T56A 2EBIA 5M5YJ 5FKLA 4IHVA 2R93J 2TCTA 5J3LA 2AHQA 2OF7A 2Y2ZA 1ETKA 2NOGA 1QVUA 3BG3A 1HDPA 1ORKA 2HI3A 2ECCA 4A3JJ 2R5YA 2XPVA 1IDYA 3FK7A 2XGCA 2R92J 3JREA 3A01B 5E3NA 2R5YB 4MIMA 3GTMJ 2VPRA 1XG1A 3H0GJ 2AO9A 2DA7A 2HOAA 1K83J 1Z0XA 2ME6A 2H1KA 1ZTRA 2DMUA 2NVXJ 1AU7A 2O9LA 2ELKA 9ANTA 3BTCA 2LTPA 5F1JA 3ZOBA 2DA6A 1AKHB 4A3EJ 4B4CA 1GV5A 1H89C 3W6VA 4QSHA 2K9QA 4BY7J 4FE4A 1TC3C 3GTPJ 2HQ5A 2FX0A 4A93J 4I76A 1IGNA 2B63J 1JUMA 4BBSJ 3UKGA 2XRLA 1LE8B 1Z77A 4HNVA 1SFOJ 1MH3A 2X9DA 1ZGWA 3BR1A 4AYBN 4EEFG 2DMNA 1ITYA 1MH4A 5M3MJ 2DN0A 4UUSA 3FISA 4W1UA 1WH5A 5HODA 2FJ1A 1RPWA 2LP0A 2VI6A 4S0HB 2YU9J 1I6HJ 1TWHJ 1BW6A 4A3KJ 2Y31A 4V2FA 4G12A 5FJ8J 2M8GX 4BBRJ 4CYCA 4GFBA 3BTLA 5C4XJ 5GPCA 4A3DJ 4QIWN 1ETVA 1NK3P 2KDZA 2ID6A 3S1RJ 5F0FA 1Y1WJ 1JKQC 3HOWJ 2E2HJ 2M2EA 2DJNA 3HGGA 4A3FJ 1IG7A 3BQZA 1JTXA 3BR0A 3IH4A 1YRNB 1F43A 2LK2A 5J1YA 1APLC 2ECBA 4MLOA 5IYBJ 4ABZA 2VUMJ 5C3EJ 3Q3SA 5JLXA 1U78A 1XC5A 3TP3A 1FTTA 5EDNA 1NK2P 4D7NA 1H8AC 1WI3A 4IEJA 1VI0A 2MSYA 3JRBA 1R9TJ 4L5EA 1WGXA 5FLMJ 3HOUJ 1PUFB 1JUPA 2CU7A 3MVPA 2HDDA 5K7HA 5DS9A 4FE7A 2DA2A 4JX4A 3CCYA 2MGQA 1W0UA 1QPIA 1LFBA 4M3DA 1ZR4A 2LKXA 1U8BA 3S17J 3F0CA 2PMZN 2M0CA 1RR7A 2XPWA 2K9SA 2MW8A 1ETWA 2KT0A 1UMQA 5IPAA 1CQTA 1GT0C 3JRGA 4I6ZA 5FKMA 4XK4A 3ZQFA 3RKQA 4A3LJ 4JX5A 1MNMC 4B3AA 1IUFA 2CQQA 1X2NA 3MN2A 3OSFA 3H3VK 2WV1A 2N8GA 1JGGA 5EZHA 3LSPA 2D5VA 4A3GJ 2X6OA 1TWCJ 3VPRA 3A01A 3BG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTC A;  1MBE A;  1IJW C;  1IV6 A;  2GM4 A;  1FEX A;  1MBK A;  1XS9 A;  1RES A;  2H8R A;  2HOS A;  2X48 A;  3OOU A;  3PO3 J;  4XRM A;  3SFI A;  4XIC A;  3S15 J;  2MG4 A;  1WH7 A;  3HKZ N;  1JTY A;  3JRI A;  4RBO A;  3TED A;  2K40 A;  4DYQ A;  1AKH A;  2WB1 N;  3Q0W A;  2JA6 J;  2CUF A;  4C3H J;  5EG0 A;  2RAE A;  1MBF A;  3FK6 A;  4X1E A;  5EGO B;  3MKL A;  5EG0 B;  2DA1 A;  1DU6 A;  3SJM A;  1ETO A;  3S1M J;  1LE8 A;  3LSG A;  4V2G A;  3RQI A;  1WPK A;  1OCP A;  3O8G A;  2Y30 A;  1X58 A;  3HBL A;  2XPU A;  5M5X J;  3HEF A;  2EH3 A;  2LD5 A;  5E3M A;  3CQZ J;  4AC0 A;  1UHS A;  1JKO C;  2VKE A;  3JRA A;  5K7Z A;  2HOT A;  3ZQL A;  2GLO A;  3IH3 A;  4M3E A;  3LOC A;  1I3Q J;  2Y0S N;  5FKO A;  2DMQ A;  4W97 A;  1ZKG A;  3NAR A;  3WHC A;  3DEW A;  1FTZ A;  2JMW A;  3HGY A;  2LR8 A;  2FD5 A;  3GTJ J;  3ZQH A;  1JJ8 C;  3CDL A;  3Q0U A;  1ETQ A;  1RKT A;  3IH2 A;  1YRN A;  3FIW A;  4DYR A;  3S1N J;  5C4J J;  3G1L A;  4AUX A;  3M3Y J;  3BG5 A;  2HYJ A;  1ZQ3 P;  3JRH A;  3BR3 A;  2Y9Y A;  3GBG A;  4MFE A;  1BA5 A;  5M3F J;  1HOM A;  4DZP A;  3K2A A;  3OSG A;  5EEA A;  2DA5 A;  1PUF A;  4FTH A;  3BTI A;  2CUE A;  3BR2 A;  1HLV A;  1POG A;  2EZH A;  1X2M A;  1ETY A;  4M3G A;  2W48 A;  4DYC A;  3M4O J;  4J19 A;  2DMP A;  3HB9 A;  5K7F A;  3BT9 A;  5FLV A;  3HOY J;  1BW5 A;  3Q0V A;  4IHY A;  4NDL A;  1GUU A;  2EZL A;  4M3B A;  3QPL A;  5GPA A;  4DZJ A;  4D7M A;  1Q1V A;  2OPT A;  4A69 C;  2L9R A;  1GDT A;  3A02 A;  5EYR A;  1MSE C;  2ME0 A;  1MBH A;  2ZB9 A;  2CQX A;  4BY1 J;  1LFU P;  1DU0 A;  1FIA A;  3SDG A;  2L7F P;  2XB5 A;  3HOX J;  5J1R A;  1BL0 A;  2LY9 A;  3S2H J;  2E2J J;  4UUT A;  1GV2 A;  3NAU A;  3B6A A;  2ID3 A;  3QPS A;  1HCR A;  2IAI A;  1HDD C;  1U9N A;  5F0C A;  3JR9 A;  4IHX A;  5JLW A;  4A3C J;  3IV5 A;  3I4N J;  1EF4 A;  3A03 A;  2QF7 A;  1VFC A;  5DTD A;  1FIP A;  4RDU A;  3S16 J;  3TW7 A;  3WHB A;  4XID A;  2HXI A;  3LSR A;  3ZQI A;  3BR6 A;  1UG2 A;  4FCY A;  1JJ6 C;  5IP9 J;  2YS9 A;  3E7L A;  1S7E A;  2FQ4 A;  3S1Q J;  3K7A J;  2TRT A;  5EGO A;  5E3L A;  1IDZ A;  5C44 J;  1RKW A;  1RET A;  1MBG A;  4IHW A;  3DCF A;  3HOZ J;  1ZR2 A;  5IYC J;  3TW6 A;  2NVY J;  3CMY A;  3JRD A;  5F04 A;  3GTO J;  2VKV A;  2E19 A;  2WAQ N;  4B1R A;  3HDD A;  2YUS A;  1U9O A;  4Y52 J;  1HF0 A;  4A3I J;  3PO2 J;  5EZG A;  1MBJ A;  4XRS G;  2R0Q C;  5IYD J;  2CRG A;  1ZK8 A;  5FKN A;  5GP9 A;  5E3O A;  1ETX A;  3RZO J;  2XB0 X;  1A6I A;  3BTJ A;  1W0T A;  4A3B J;  4DW6 A;  4BXX J;  2XGD A;  3G1O A;  1D5Y A;  3JRF A;  4MFD A;  5F08 A;  3ZQC A;  1H88 C;  1G2H A;  5IP6 A;  1QRY A;  3BR5 A;  3S2D J;  2IBD A;  4MO7 A;  5F27 A;  2JN6 A;  2O8K A;  1Y1V J;  2K9N A;  4QTR A;  3GTL J;  3C2B A;  1FJL A;  4XRS A;  3BQY A;  1VF9 A;  1SAN A;  2LVS A;  3HM5 A;  1B72 A;  3HOV J;  5EF6 A;  4C2M J;  2CJJ A;  4UUS B;  1JKR C;  3B6C A;  5FKK A;  1MSF C;  3O8H A;  2JJ7 A;  1B72 B;  2EQR A;  2HXO A;  1BJZ A;  4JYK A;  4CYC B;  1P7J A;  1B8I A;  3PM1 A;  2L7M P;  2M9H A;  4C3J J;  2L7Z A;  1AHD P;  1B8I B;  1E3O C;  5F0H A;  2G0E A;  2R7Z J;  3GTK J;  2L0K A;  3JRC A;  2IEK A;  2I10 A;  5IP7 J;  1OCT C;  2NVQ J;  2JWT A;  1IC8 A;  5M5W J;  1OFC X;  1TWA J;  2XGE A;  4X6A J;  3I4M J;  2NS7 A;  4BKX A;  2DA4 A;  2O7O A;  2LFB A;  1VND A;  2EZK A;  3L1P A;  1I50 J;  1TWF J;  3ZQG A;  3GTQ J;  1A5J A;  2R5Z A;  4C3I J;  1IRZ A;  3LSJ A;  2EZI A;  1F36 A;  1P7I A;  2JK3 A;  4M6V A;  1JT6 A;  3OIO A;  2R5Z B;  2E2I J;  4JP0 A;  2JA5 J;  4JX6 A;  1QVT A;  2DTZ A;  2P81 A;  2JA7 J;  1GVD A;  1T33 A;  2E1O A;  3D1N I;  3GTG J;  3LNQ A;  3S14 J;  2NS8 A;  3QQA A;  4Y7N J;  2DMT A;  1K61 A;  2M34 A;  4FIS A;  2Y9Z A;  3G1M A;  1TWG J;  4A3M J;  2COB A;  4LOC A;  1JKP C;  2QCO A;  2XSD C;  2LLK A;  2GBY A;  3RZD J;  4D5F A;  1ENH A;  2DA3 A;  2NVT J;  4D5C A;  1OJL A;  5BNG A;  1JT0 A;  2JA8 J;  3TP0 A;  4M3F A;  3FKI J;  5IOY A;  1JUS A;  5J1U A;  1WCM J;  5IOZ A;  1O4X A;  1T56 A;  2EBI A;  5M5Y J;  5FKL A;  4IHV A;  2R93 J;  2TCT A;  5J3L A;  2AHQ A;  2OF7 A;  2Y2Z A;  1ETK A;  2NOG A;  1QVU A;  3BG3 A;  1HDP A;  1ORK A;  2HI3 A;  2ECC A;  4A3J J;  2R5Y A;  2XPV A;  1IDY A;  3FK7 A;  2XGC A;  2R92 J;  3JRE A;  3A01 B;  5E3N A;  2R5Y B;  4MIM A;  3GTM J;  2VPR A;  1XG1 A;  3H0G J;  2AO9 A;  2DA7 A;  2HOA A;  1K83 J;  1Z0X A;  2ME6 A;  2H1K A;  1ZTR A;  2DMU A;  2NVX J;  1AU7 A;  2O9L A;  2ELK A;  9ANT A;  3BTC A;  2LTP A;  5F1J A;  3ZOB A;  2DA6 A;  1AKH B;  4A3E J;  4B4C A;  1GV5 A;  1H89 C;  3W6V A;  4QSH A;  2K9Q A;  4BY7 J;  4FE4 A;  1TC3 C;  3GTP J;  2HQ5 A;  2FX0 A;  4A93 J;  4I76 A;  1IGN A;  2B63 J;  1JUM A;  4BBS J;  3UKG A;  2XRL A;  1LE8 B;  1Z77 A;  4HNV A;  1SFO J;  1MH3 A;  2X9D A;  1ZGW A;  3BR1 A;  4AYB N;  4EEF G;  2DMN A;  1ITY A;  1MH4 A;  5M3M J;  2DN0 A;  4UUS A;  3FIS A;  4W1U A;  1WH5 A;  5HOD A;  2FJ1 A;  1RPW A;  2LP0 A;  2VI6 A;  4S0H B;  2YU9 J;  1I6H J;  1TWH J;  1BW6 A;  4A3K J;  2Y31 A;  4V2F A;  4G12 A;  5FJ8 J;  2M8G X;  4BBR J;  4CYC A;  4GFB A;  3BTL A;  5C4X J;  5GPC A;  4A3D J;  4QIW N;  1ETV A;  1NK3 P;  2KDZ A;  2ID6 A;  3S1R J;  5F0F A;  1Y1W J;  1JKQ C;  3HOW J;  2E2H J;  2M2E A;  2DJN A;  3HGG A;  4A3F J;  1IG7 A;  3BQZ A;  1JTX A;  3BR0 A;  3IH4 A;  1YRN B;  1F43 A;  2LK2 A;  5J1Y A;  1APL C;  2ECB A;  4MLO A;  5IYB J;  4ABZ A;  2VUM J;  5C3E J;  3Q3S A;  5JLX A;  1U78 A;  1XC5 A;  3TP3 A;  1FTT A;  5EDN A;  1NK2 P;  4D7N A;  1H8A C;  1WI3 A;  4IEJ A;  1VI0 A;  2MSY A;  3JRB A;  1R9T J;  4L5E A;  1WGX A;  5FLM J;  3HOU J;  1PUF B;  1JUP A;  2CU7 A;  3MVP A;  2HDD A;  5K7H A;  5DS9 A;  4FE7 A;  2DA2 A;  4JX4 A;  3CCY A;  2MGQ A;  1W0U A;  1QPI A;  1LFB A;  4M3D A;  1ZR4 A;  2LKX A;  1U8B A;  3S17 J;  3F0C A;  2PMZ N;  2M0C A;  1RR7 A;  2XPW A;  2K9S A;  2MW8 A;  1ETW A;  2KT0 A;  1UMQ A;  5IPA A;  1CQT A;  1GT0 C;  3JRG A;  4I6Z A;  5FKM A;  4XK4 A;  3ZQF A;  3RKQ A;  4A3L J;  4JX5 A;  1MNM C;  4B3A A;  1IUF A;  2CQQ A;  1X2N A;  3MN2 A;  3OSF A;  3H3V K;  2WV1 A;  2N8G A;  1JGG A;  5EZH A;  3LSP A;  2D5V A;  4A3G J;  2X6O A;  1TWC J;  3VPR A;  3A01 A;  3BG9 A; 
#chains in the Genus database with same CATH topology
 1NTC A;  1YFH A;  3MMY B;  1FEX A;  1RES A;  1UAA A;  5J4Y A;  1S8N A;  4JOM A;  3WTU C;  3I54 A;  2CMP A;  2H6B A;  2FML A;  1JTY A;  3JRI A;  1E17 A;  3TED A;  1PUE E;  2V1D A;  1IXS B;  4V19 K;  2WB1 N;  3HTU A;  3GFI A;  4PJ0 C;  4U0Y A;  2BGC A;  3QOP A;  1KQ9 A;  2E1M C;  5EG0 A;  1B6A A;  5JVG F;  2IS1 A;  3GME A;  3W6K B;  4P5O A;  5EGO B;  3T8T A;  4IOC F;  5EG0 B;  4A5M A;  3QP5 A;  2Z1D A;  1YJW I;  3S1M J;  1LE8 A;  1Z05 A;  4YFN F;  4B47 A;  5D5X B;  2VXZ A;  3HBL A;  3DWL E;  5M5X J;  2OQR A;  3HEF A;  2ICW G;  4LK1 F;  4F55 A;  3KP3 A;  4G94 A;  1JKO C;  3J7A Y;  5ILV A;  1KU7 A;  2HOT A;  3ZQL A;  6PAX A;  4G7Z F;  3F21 A;  3P9I A;  1YQA A;  1ACI A;  1DP3 A;  3LOC A;  5K1Y A;  3HSF A;  2JT1 A;  4KIG A;  2Y0S N;  3SEZ A;  1FOK A;  1XMX A;  3LFK A;  2XIG A;  4W97 A;  1ZKG A;  3NAR A;  5DEQ A;  1Z7U A;  2L4M A;  4ESF A;  3DEW A;  1FTZ A;  1UCR A;  4RM3 A;  3WTS C;  3MD2 A;  2VJ4 A;  2DK8 A;  3BZK A;  4GRI A;  1ETQ A;  1YS6 A;  3IH2 A;  1YRN A;  2VPL A;  3FIW A;  1XSX A;  2H8W A;  3S1N J;  3V4G A;  5C4J J;  3LQR A;  1Z6T A;  2E7X A;  3DU6 A;  4GYI A;  4OAY A;  4PJJ A;  1AA7 A;  2HYJ A;  3TL4 X;  2K5C A;  5FB2 A;  1ZQ3 P;  4CCM A;  3OYL A;  3OIQ A;  2R7O A;  3GFM A;  1BA5 A;  4NC7 A;  1XN7 A;  2GA2 A;  3K70 C;  1HOM A;  4EM2 A;  4M9S A;  5ICG A;  4RB2 C;  5KNL A;  2LRE A;  4QPO A;  2CW8 A;  3N05 A;  5H2F C;  1KZH A;  1YE9 A;  3ZP5 A;  1POG A;  4BHP A;  1K7A A;  1O7L A;  3H5N A;  4L9N A;  1X2M A;  4M3G A;  3DBL B;  2EB7 A;  3I59 A;  4J19 A;  2ZME C;  2DMP A;  2OUM A;  2D1H A;  1EJ9 A;  3ZN1 A;  4F92 B;  3BT9 A;  2Q2E A;  2B0L A;  4Y3O A;  1T38 A;  2JSC A;  1EH7 A;  4BJ6 C;  3HRS A;  2Q2E B;  5LEJ A;  1L3L A;  1K79 A;  2OPT A;  4A69 C;  2L9R A;  1GDT A;  4HEA 2;  1BR4 A;  3H0D A;  2ME0 A;  1LVK A;  3BG7 A;  1SC7 A;  2K3P A;  3A0B C;  5EEH A;  4NQW B;  5K5Q A;  2CH0 A;  3H92 A;  3L2W A;  1T0F C;  3E6B A;  1I1S A;  1Y56 A;  5J6X A;  5HS8 A;  2MD0 A;  2V6C A;  5J40 A;  2L9V A;  3KP5 A;  1UFM A;  5DCF A;  2KIU A;  4ZZL A;  2K27 A;  1U9N A;  1XSV A;  1HDD C;  1HKQ A;  5F0C A;  1Y8Q B;  2VJI A;  3K1P A;  3GO5 A;  4RMN A;  3A03 A;  3A1Y A;  2IA1 A;  2MAB A;  4KIB A;  1WJF A;  2E5N A;  3DFG A;  1UG2 A;  1K78 A;  3PJR A;  3ZMZ A;  3B73 A;  2DPD A;  1PYV A;  1MMA A;  2CQN A;  2FQ4 A;  4UVC A;  4MTE A;  1K78 B;  2VOP A;  2TRT A;  4LFU A;  1I3A A;  4G6D A;  2QKL B;  5E3L A;  1IDZ A;  3CJT B;  2C6Y A;  2YPR A;  3PNT A;  3E6D A;  5FD5 A;  3I53 A;  5IYC J;  1PJR A;  2WAF A;  3FXU A;  4LIV A;  3JRD A;  1NG7 A;  5F04 A;  1B9N A;  1R1V A;  1ZRF A;  2LRD A;  1R5G A;  5CKT A;  3K1M A;  3PNV A;  4B1R A;  1VQL I;  2KDO A;  1IW7 F;  2YUS A;  3HL2 A;  1X4P A;  1YHQ I;  1HF0 A;  4GGG A;  3S3N A;  3PO2 J;  3VSK A;  3DKW A;  4D9J A;  4DBQ A;  5EZG A;  1YW7 A;  2AQF A;  4ZC3 A;  4EMS A;  4YIR X;  2MLG A;  1K4T A;  4BGD A;  2R7Q A;  1G59 A;  2ZNZ A;  2ZBK A;  4F7Z A;  4PJM A;  1A6I A;  2M5W A;  4LJZ F;  4BXX J;  2JUG A;  2XGD A;  3BPV A;  1D5Y A;  2EIM H;  4KT6 A;  5F08 A;  1TT0 A;  4N4O B;  1H88 C;  3S3O A;  4BE0 A;  2IBD A;  3ROU A;  1FMW A;  3QYB A;  1YG2 A;  1FOW A;  2K9N A;  4M74 A;  2O8K A;  4BQQ A;  1W36 D;  3LAP A;  1TNS A;  3FX3 A;  2GXB A;  1TZL A;  1LEB A;  3BQY A;  1VF9 A;  4WWC A;  1ODD A;  3HM5 A;  4C2M J;  3CCJ I;  3P9K A;  2P4W A;  3B6C A;  1HSJ A;  2OZ6 A;  1MSF C;  3O8H A;  3MKW B;  4M71 A;  3F8C A;  3TOA A;  5HDG A;  2K02 A;  4HYE A;  3OYG A;  4OMZ A;  2KFD A;  3CUO A;  2HWV A;  2M9H A;  5HVQ C;  3WTW C;  1AHD P;  1SMY F;  3ZMS A;  1TL8 A;  1LUJ B;  2G0E A;  4WXH A;  4M73 A;  3GTK J;  1OCT C;  3OV8 A;  3OYD A;  2NVQ J;  1SD6 A;  1IC8 A;  5M5W J;  4B44 A;  4F93 B;  3EPZ A;  3I4M J;  4UB8 C;  3C18 A;  2DA4 A;  2LFB A;  3HSR A;  1Y0N A;  4CXF A;  1VND A;  3QRF F;  1FYM A;  3CJQ B;  4LLL A;  3IWF A;  3GTQ J;  3GZ5 A;  4Y17 A;  2R7V A;  4C3I J;  4KT5 C;  1IRZ A;  3LSJ A;  1F36 A;  1FP1 D;  3HRU A;  3WGH A;  1HXD A;  3HXL A;  2BW3 B;  3G2B A;  1RIO H;  2LMD A;  2JA5 J;  2DTZ A;  4LD5 A;  1HKT A;  4R1H A;  3VFZ A;  3GTG J;  1IN8 A;  2OCC H;  4PZJ A;  2FF4 A;  4Q47 A;  3QQA A;  2V1X A;  2DMT A;  4OIQ F;  4FIS A;  4B09 A;  2B7E A;  4DIQ A;  2Y48 A;  1TWG J;  5B1A H;  5E18 F;  4UUV A;  2FU4 A;  3CCU I;  2XSD C;  5CJ9 A;  1OKR A;  5CVI A;  2W84 A;  1FMV A;  1LQ1 A;  2GOM A;  5ILU A;  4B8X A;  2IXS A;  4HDU A;  3FKI J;  1WCM J;  5L3D A;  3V7C A;  1T56 A;  2ESH A;  2P5K A;  1TBX A;  3M1C A;  2R93 J;  3QU3 A;  4AIK A;  2OF7 A;  2XAJ A;  3BG3 A;  1FBS A;  4XKW A;  1ORK A;  2A5Y B;  2ECC A;  3EET A;  4NB5 A;  2HVS A;  4A3J J;  2R5Y A;  1YLF A;  1FP2 A;  2ZO4 A;  2B9S A;  3VYR B;  2KRH A;  3TO7 A;  3JRE A;  3G73 A;  4B3X A;  5E3N A;  1S72 I;  2R5Y B;  2KRC A;  4MIM A;  4RGR A;  2VPR A;  5DD4 A;  5H6R A;  2DA7 A;  2CFX A;  2XAF A;  4XMY A;  1Z0X A;  3HPH A;  2VIX A;  1BM9 A;  2VN2 A;  2VKH A;  2DMU A;  4BEH A;  2H1K A;  3AG3 H;  2L54 A;  3WGI A;  3VYT B;  3BTC A;  2LTP A;  3ZOB A;  4BEH B;  5DUI A;  5ED4 A;  1K6Y A;  5DCM A;  3DLL F;  3IRQ A;  1W1W E;  2VT3 A;  1H89 C;  4AM3 A;  2KJC A;  5HDK A;  2D2W A;  3W6V A;  2JRM A;  4L5I A;  2M87 A;  5DCM B;  4EAT A;  4BY7 J;  4AWX B;  3I4P A;  4NBQ A;  5IT9 K;  1IRX A;  3LSI A;  1WSU A;  1F5T A;  3MFK A;  4R79 A;  3PSI A;  5F1R A;  3UKG A;  4IQJ A;  4HNV A;  3HYI A;  1IN5 A;  4ETS A;  4RA2 A;  4LB5 A;  1MH3 A;  3IKT A;  4C9Y A;  1ZGW A;  4AYB N;  2DMN A;  3T1B A;  1MNE A;  1MIJ A;  1JXS A;  2XAS A;  3J80 K;  1MH4 A;  2E1C A;  2X6X A;  4W1U A;  3I58 A;  1LDD A;  2LP0 A;  3OYF A;  5HOO A;  2Z16 A;  4ENJ A;  5FGM A;  2DFE A;  3HHG A;  4IRG A;  1KYW A;  3K10 A;  2ZJ2 A;  3BLY A;  3LST A;  4RB0 A;  2H6C A;  1RRJ A;  5FJ8 J;  4FT8 A;  1SVM A;  2JA2 A;  3GUD A;  4A2U A;  5KHD A;  3V8K A;  4S05 A;  4P9F A;  3H3Z A;  5GPC A;  1QZZ A;  3QU6 A;  4XRF A;  1FY7 A;  1N75 A;  5DM7 F;  2KMU A;  2DJN A;  3LWF A;  1UZC A;  3DXJ F;  4PFP A;  3BQZ A;  4PSW A;  1Z91 A;  3OY9 A;  1R4N B;  3CUQ C;  3JTH A;  1VQ4 I;  4IJA A;  1ZAO A;  2ECB A;  4E7J A;  2R4G A;  2CUJ A;  5CVJ A;  5IYB J;  2ZSH B;  1XCB A;  3JAM K;  1S7A A;  1Z67 A;  3HG9 A;  3AAF A;  5C3E J;  5JLX A;  1U78 A;  2QEN A;  4XLC A;  3LAJ A;  3CCQ I;  3RTR A;  1S9H A;  4MQV A;  2A69 F;  1D1C A;  3M9A A;  1R9T J;  4BJ5 C;  4U7D A;  2EIK H;  1OCR H;  2QWW A;  2HDW A;  4EJO A;  3BG6 A;  3MVP A;  1ZN2 A;  2V9K A;  5J8F A;  4K2E A;  3PQK A;  2MA3 A;  3KP2 A;  3CES A;  1IUY A;  1XB4 A;  1YS7 A;  4LG3 A;  1I27 A;  3DPU A;  2QGU A;  3OS1 A;  2A6T A;  1MMN A;  4KIT B;  1BR2 A;  5HLG A;  2LKX A;  1GXQ A;  3TOB A;  2PMZ N;  3CME I;  2M0C A;  2LDU A;  1ZRC A;  3ZRG A;  2OU2 A;  1UMQ A;  2COM A;  2DLL A;  2O5R A;  4KIC A;  1FZP B;  1GT0 C;  4XK4 A;  2IJL A;  2VQC A;  3DTE A;  3ZQF A;  3RKQ A;  1SD7 A;  3HZJ A;  2QYO A;  1IUF A;  2CQQ A;  1X2N A;  3OSF A;  5L3B A;  2QSH X;  3PQJ A;  1R36 A;  2N8G A;  1JGG A;  2EFP A;  3LSP A;  3K4C A;  2HYG D;  2X6O A;  3RIR A;  4RS8 A;  4IKF A;  2WTE A;  3A01 A;  3K4N A;  1FPQ A;  2HVQ A;  5CVR A;  2X1E A;  4BS9 A;  1IV6 A;  1XS9 A;  2HOS A;  2H8R A;  4BDY A;  3E5X A;  3OOU A;  4M72 A;  4XRM A;  1TQP A;  2KZG A;  2XDV A;  1JHH A;  3SEQ A;  2PI0 A;  2RRE A;  3OL3 A;  4HV5 A;  2VQH A;  3HKZ N;  2K40 A;  1MMG A;  4KDP A;  3TDZ C;  3CJR B;  1DUX C;  1QBJ A;  2LSO A;  2L7K A;  3FK6 A;  3GCM A;  3TBI A;  4RB3 C;  4CCN A;  3MKL A;  1GHC A;  2NRA C;  2ZC2 A;  1R1T A;  3QOE A;  1R5I D;  1ETO A;  4ANJ A;  3DBR B;  4V2G A;  3RQI A;  4H4K C;  4ITV A;  1OCP A;  1XX5 A;  1Z3Y A;  3O8G A;  1L0O C;  4CCJ A;  1D3Y A;  1EH6 A;  4ZYE A;  1XDU A;  2Q0O A;  2I5U A;  2IGN A;  5E3M A;  1GLN A;  4L9T A;  1UHS A;  1X1A A;  2VKE A;  4HST A;  1A36 A;  3JRA A;  1HW5 A;  2GLO A;  3IUO A;  3SZT A;  4BDZ A;  2VC0 A;  1ZH5 A;  1F1Z A;  5TGT A;  4BAY A;  2MH9 A;  3KLN A;  2RV8 A;  1WJC A;  3W3C A;  3DU5 A;  3HGY A;  3SHF A;  2PBI A;  4HX8 A;  5CQG A;  2E7W A;  3ZQH A;  2YX4 A;  4NC8 A;  1KGS A;  3DP7 A;  4WX9 A;  1RKT A;  4HLX A;  1P9Q C;  2X0L A;  4RAZ A;  4BAC A;  2A05 A;  3FM5 A;  2MD5 A;  4DYR A;  1HST A;  4P55 A;  3M3Y J;  2QQ8 A;  2F4I A;  4IX7 A;  4ZH4 F;  1YIT I;  3O2P E;  1FSE A;  2Y9Y A;  3GBG A;  4MFE A;  2P6S A;  4UV8 A;  2Z2S B;  4E7L A;  2HKX A;  3HOS A;  2VC1 A;  3ZXS A;  5EEA A;  3OSG A;  1U5T C;  4FX0 A;  1ONV A;  2OA4 A;  2CUE A;  2O8X A;  3DTI A;  3RKY A;  3SYT A;  1HLV A;  3I3L A;  5ICC A;  5LHH A;  1WRJ A;  4ZJZ A;  1R71 A;  3M4O J;  3OMY A;  2XVC A;  4L5J A;  5CLS A;  1N25 A;  2DQL A;  4U87 A;  5JR3 A;  3ASN H;  1NH3 A;  5ERI A;  5K7F A;  3BDD A;  2RC4 A;  3SDB A;  1MD0 A;  3HJE A;  5FLV A;  1BW5 A;  2DW4 A;  3Q0V A;  3M8J A;  1SFE A;  4F3Q A;  3KCC A;  5BMZ A;  4IHY A;  4M3B A;  1LDK B;  1YX3 A;  1N77 A;  1H9G A;  3MCZ A;  5J47 A;  4C30 A;  3A02 A;  2QSF X;  3GXO A;  1MSE C;  1MBH A;  3CJN A;  3EUH A;  2ZB9 A;  2CQX A;  2BVL A;  1LFU P;  4BY1 J;  2O0Y A;  1HKS A;  2FNA A;  3JW4 A;  1DU0 A;  4ESB A;  4E7Z A;  3SDG A;  4KIS A;  3I64 A;  1I5Z A;  1BL0 A;  4L0Z B;  2LY9 A;  4HV6 A;  1FWZ A;  2DBB A;  5HS7 A;  2MBF A;  3OR2 C;  3GYH X;  2OQG A;  3ISP A;  2IPQ X;  5E8I A;  2ID3 A;  2CG4 A;  3R6S A;  2BXZ A;  4XLN F;  5FLX K;  1VTN C;  3KZZ A;  5ICE A;  4IHX A;  5JLW A;  1EF4 A;  3IV5 A;  2LKP A;  2GQQ A;  2V1N A;  2ZJP F;  2HGC A;  5DTD A;  3UNG C;  2VB6 A;  4Y15 A;  1EH8 A;  3F3X A;  2HXI A;  4XID A;  2HPM A;  3K0L A;  3ZQI A;  2XSJ C;  2JRT A;  3H5R A;  1WJA A;  1JJ6 C;  2YS9 A;  3QOD A;  3K7A J;  2M7A A;  4I99 C;  1WKM A;  3BZC A;  1X1P A;  5EGO A;  4U0W A;  2A61 A;  2VKD A;  3K69 A;  3DCF A;  1Z1D A;  5FO5 A;  1AWC A;  2ZXW H;  2JQ7 A;  3ONQ A;  2XF7 A;  5L3F A;  3N97 A;  3U1D A;  2X1C A;  1U9O A;  1DGW Y;  4O3M A;  1FC3 A;  1AOY A;  1ZRE A;  2VQL A;  3H5A A;  1XGN A;  3MWM A;  2NVU B;  1BOB A;  3L9F A;  3OYC A;  3TDU C;  2R0Q C;  4UNO A;  2EK5 A;  2IS6 A;  4XOT A;  5IYD J;  4XNF A;  2DQR A;  5GP9 A;  2GIZ A;  3ASO H;  2X4H A;  3RZO J;  3ABM H;  1W0T A;  5LGT A;  1KU3 A;  4A3B J;  2P6T A;  3JRF A;  2BV6 A;  2PEX A;  2MC3 A;  1G2H A;  2DDA A;  5EEG A;  3KZI C;  2P5V A;  3S2D J;  5DD8 A;  4MO7 A;  1RUN A;  1V3F A;  5F27 A;  2XKP A;  4QTR A;  3GTL J;  2FBK A;  1LKX A;  1PP8 F;  1OQY A;  1RUO A;  4HRI A;  4BQN A;  4XRS A;  2ZFW A;  3B02 A;  1SAN A;  4M9Z A;  2W85 A;  1JKR C;  2DYR H;  1LPQ A;  3BJA A;  2JJ7 A;  1N78 A;  3BCB A;  1YW8 A;  1NHA A;  4N0B A;  1WJE A;  2BEO A;  3OYI A;  2BY0 A;  3ULQ B;  3F22 A;  2EA2 A;  3ZGK A;  4XSZ F;  4ZYA A;  2DAO A;  2OBP A;  2BXY A;  2XHK A;  4NC6 A;  2DJI A;  3RPU A;  2ZSI B;  3I56 I;  1B8I A;  3PM1 A;  1RZ4 A;  2RVC A;  2L7M P;  3S93 A;  1VQ5 I;  4AVP A;  4C3J J;  1WJD A;  2LC2 A;  2Z33 A;  2ZJR F;  1B8I B;  3BRO A;  5F0H A;  1E3O C;  1T08 B;  3FHN A;  3RYR A;  1REP C;  4QLC U;  2R7Z J;  3OWT A;  4HG2 A;  5IP7 J;  3JRC A;  2JWT A;  2KIS A;  2RNJ A;  2XGE A;  3M8E A;  2IGO A;  4X6A J;  2KPM A;  2X51 A;  4KJZ A;  4I7H A;  5E1W A;  1KYZ A;  4BKX A;  3HTS B;  2O7O A;  1BI3 A;  3C2H A;  2DCE A;  2DT6 A;  2WB1 A;  1KQ8 A;  1ULY A;  3ZQG A;  3G3Z A;  1D8J A;  4E7H A;  2AXL A;  2EZI A;  4NQW A;  4LB6 B;  4M6V A;  2F5E A;  2HVR A;  3OIO A;  3WTV C;  1G3W A;  3M1E A;  4JP0 A;  2VOD A;  3ZPL A;  4JX6 A;  4E70 A;  3HUG B;  1T33 A;  1T98 A;  4HPQ A;  4DQ2 A;  4BHB A;  2KHM A;  3DQV C;  1XD7 A;  2NS8 A;  3HRT A;  4XM3 A;  1K61 A;  3AG4 H;  3PIP F;  1YX5 A;  4KFC A;  1V54 H;  2CW0 F;  3MZ8 A;  3AL0 C;  3ZMU A;  3CCR I;  3RZD J;  2KKO A;  4D5F A;  2PJP A;  4G6T B;  3OS2 A;  1G4D A;  4UB6 C;  2DA3 A;  2R7W A;  3PNY A;  1HW2 A;  1OJL A;  1IV8 A;  2PX9 A;  5E1X A;  2Y0S A;  4R8H A;  4MGR A;  5J1U A;  4ASN A;  4DBR A;  3KEO A;  4UVB A;  5K5O A;  2CO5 A;  5CVU A;  4HBL A;  4C2U A;  1B59 A;  1J9I A;  1ZG1 A;  1QVU A;  4Y4R A;  1YI2 I;  1IN7 A;  4HF2 A;  3KFW X;  2HNH A;  1QGP A;  2DYS H;  2UXX A;  4Q48 A;  1IDY A;  5LGN A;  4IRH A;  4RAF A;  4G9Y A;  2XF5 A;  4HF1 A;  2RN7 A;  1T6S A;  3BPX A;  3D5L A;  2AO9 A;  4XLE A;  5E79 C;  2HOA A;  2ME6 A;  3IHU A;  1ZTR A;  3R4K A;  1V55 H;  4BHC A;  2I8D A;  4G6Q A;  2IA2 A;  4E4H A;  1R1U A;  2DA6 A;  1AKH B;  3DKY A;  4M6X A;  2DDB A;  2IRF G;  3BZ6 A;  4BL0 B;  3IL2 A;  1W36 C;  4QSH A;  2K9Q A;  2P0W A;  2GAU A;  3O3K A;  4KN4 X;  3SFZ A;  4I09 A;  1H9T A;  3CC7 I;  2V1U A;  4XOR A;  1TC3 C;  5D6E A;  3GTP J;  2WA0 A;  4I76 A;  2VJ5 A;  3PIO F;  1R22 A;  2VBY A;  1JUM A;  2VE8 A;  2PN6 A;  2LKS A;  4Y13 A;  2ELH A;  2L9N A;  2W7N A;  1XCV A;  3CDI A;  4KIF A;  3NQO A;  4HNT A;  4EEF G;  3H9G A;  3L2Q A;  3CMM A;  4N4N B;  4AD9 A;  2LNB A;  3DTK A;  4E7S A;  2RDP A;  2HFH A;  2MH2 A;  3E3V A;  2CV2 A;  3FIS A;  3G71 I;  1WH5 A;  3L2R A;  1BI2 A;  3V8J A;  4ZDO A;  3OS0 A;  3QWL A;  2VI6 A;  4CCO A;  1I6H J;  1TWH J;  4HX7 A;  3L2U A;  3KET A;  5F6F A;  2TDX A;  5KK1 A;  2VBZ A;  4V2F A;  3ML6 A;  4AID A;  3NWT A;  3DV8 A;  5FRO A;  4BBR J;  4GFB A;  1HW1 A;  2PG4 A;  3SZG A;  4RLF A;  2ZXI A;  1MJ9 A;  1ETV A;  2KDZ A;  2DOD A;  2ID6 A;  1YYV A;  1A04 A;  3PFY A;  4BJT A;  1TT5 B;  2M2E A;  3HGG A;  4A3F J;  3KYL A;  1R00 A;  3IAS 2;  3RPU D;  4ZTF A;  5BOX A;  3IH4 A;  3CLO A;  2BYV E;  2QQ9 A;  2EPF A;  4KA4 A;  3LSH A;  1APL C;  4HZF A;  2G9W A;  5LHG A;  2LYC A;  3GWZ A;  4EVI A;  4KNY A;  2A3S A;  4XSX F;  1G6N A;  3E5Q A;  3Q3S A;  1XC5 A;  3FMQ A;  3ERE D;  1FTT A;  3UR3 C;  2Y75 A;  3HC7 A;  4CIC A;  4HQE A;  3IKV A;  2GZW A;  5A2Q K;  1VI0 A;  2MSY A;  3P5J A;  3JRB A;  4L5E A;  5FLM J;  1PUF B;  2BW3 A;  1T95 A;  3A2K A;  2HDC A;  2E5Z A;  1JUP A;  2KIQ A;  2LF8 A;  2EA4 A;  4YEJ A;  4HOB A;  3OYB A;  4JK1 X;  3W2A A;  5LRR A;  4ESJ A;  3K4L A;  1S3J A;  4FE7 A;  4CH7 A;  2F48 A;  4OMY A;  2DA2 A;  2QSG X;  3CCY A;  2XC7 A;  2MGQ A;  3LA2 A;  1QO0 D;  1J59 A;  3WU1 B;  1XGO A;  4M3D A;  1U8B A;  3H36 A;  1DP7 P;  3R61 A;  1ERD A;  5E8G A;  1RR7 A;  2XPW A;  2MW8 A;  1ETW A;  3S2W A;  4YIF A;  4XKC A;  5IPA A;  4HDV A;  1CQT A;  5HDN A;  3G4S I;  3CUQ B;  3AKZ A;  3JRG A;  1VQO I;  3F6O A;  5FKM A;  3U9G A;  2ZFU A;  1CGP A;  1YJN I;  1W7P B;  2WY7 Q;  1X1C A;  3OOP A;  4OIR F;  3C3W A;  1BC7 C;  1MKM A;  1XPX A;  4HX4 A;  4MEY F;  3BJ6 A;  3DPL C;  3FXQ A;  3BG9 A;  1X3U A;  1IJW C;  4BQO A;  2OJE D;  1HQC A;  2GM4 A;  3GX4 X;  3WU0 A;  3J7Y J;  3PO3 J;  2D1V A;  2JSP A;  2YR2 A;  3F8N A;  2JUC A;  2W57 A;  1PDN C;  3SQN A;  2FBI A;  2GXG A;  4XIC A;  4NUB A;  1WH7 A;  1BI1 A;  2J5P A;  2DK5 A;  4RBO A;  1LDJ A;  4P96 A;  3QPH A;  3MKZ A;  4LG0 B;  3CLQ A;  2AQE A;  2OTL I;  1FNN A;  2PJR B;  3OYK A;  4CSW A;  2DFH A;  3IRR A;  1MBF A;  3PSF A;  4X1E A;  5K5R A;  4YII A;  1TLH B;  3C7J A;  3X2Q H;  2DT5 A;  3CC4 I;  1KU9 A;  4D0P A;  2WAD A;  1A31 A;  1WPK A;  1K6O A;  1SFX A;  1V4R A;  2Y30 A;  1STZ A;  2RNG A;  1KA8 A;  3WGG A;  2EH3 A;  2LD5 A;  2DOE A;  3CQZ J;  2CWE A;  4PGG A;  4BYY A;  5K7Z A;  1YOV B;  2RGV A;  1WVR A;  1FLI A;  3L00 A;  3CC2 I;  1WZ2 A;  4M3E A;  5FFZ A;  3GEZ A;  4IOA F;  2QQA A;  5AON A;  2QLZ A;  5LFA A;  5FKO A;  3HHH A;  2HEO A;  2M3A A;  3BWG A;  1MJB A;  2JMW A;  3EYY A;  2W00 A;  2LR8 A;  3WG7 H;  4J01 A;  2BBY A;  3J7A O;  2F4M B;  3KPH A;  3CDL A;  1G3T A;  2O61 A;  5KAI C;  3G1L A;  5KVR A;  5IT3 A;  3MEX A;  3IWZ A;  4EGZ A;  1I1G A;  2EWN A;  3D0S A;  1SFU A;  1KU2 A;  4E6K G;  4O5V A;  5M3F J;  4Z2Y A;  1Y6I A;  3KE2 A;  4DZP A;  3K2A A;  2Z5U A;  2L02 A;  2UUZ A;  1ZHF A;  3EUK L;  2DA5 A;  4KYW A;  4FTH A;  2VQG A;  3EQL F;  5D8K B;  1R4M B;  1SAU A;  4YEL A;  3TGN A;  3LMM A;  3OYN A;  1FBU A;  3TMO A;  4H0E A;  2KJB A;  4KUM A;  2K85 A;  1ETY A;  4LGW A;  2W48 A;  2OZU A;  4DYC A;  3ABK H;  4P9U A;  5ICF A;  2H1L A;  2E34 A;  5BPI A;  2WAQ A;  2UV1 A;  3P9C A;  1VQ6 I;  1J2X A;  3HOY J;  3LA3 A;  4EM1 A;  1SD4 A;  5LEK A;  2W4S A;  4NDL A;  1B1B A;  2EZL A;  5GPA A;  1O57 A;  4DZJ A;  3F8B A;  1LEA A;  1MMD A;  4D7M A;  2G7U A;  2PMH A;  1ZRD A;  2FQ3 A;  4IPA A;  3H9Q A;  1FBQ A;  3WTT C;  5HNF A;  4MNU A;  3OYJ A;  3K1N A;  3VOD A;  3T8R A;  4HF0 A;  1W7P D;  2L7F P;  2Z9O A;  3K9T A;  3RYP A;  4I98 B;  5F64 A;  1MDM A;  3KIO A;  3S2H J;  3TO6 A;  2E2J J;  3RKW A;  1GV2 A;  3NAU A;  3DPT A;  4RGS A;  1U5T B;  4BXU A;  1MDM B;  3B6A A;  5ILS A;  2EFO A;  1UEL B;  1HCR A;  4AYB A;  2IAI A;  2FXA A;  4OIO F;  2VXD A;  4A3C J;  1JE8 A;  3I4N J;  2KL4 A;  2FRH A;  1RI7 A;  1SAX A;  3RSN A;  1VFC A;  5LLQ A;  1J09 A;  1FIP A;  1HBX G;  4RDU A;  2HZT A;  3S16 J;  1EA3 A;  3DBH B;  3FBI B;  1V5G A;  1D0Z A;  2G7H A;  1FOY A;  1NG6 A;  1E3H A;  1WJ5 A;  4A6E A;  2JPC A;  1OMI A;  2EIJ H;  3HRM A;  3OYA A;  4FCY A;  2UXN A;  4GCV A;  2FOK A;  4Z6Y A;  1DPR A;  2Z99 A;  5DYM A;  1S7E A;  3ZMV A;  1J5Y A;  2FUG 2;  2V6E A;  2ZXJ A;  1G8X A;  2F5V A;  2A07 F;  5C44 J;  1TQI A;  1YIO A;  4ZYG A;  3FXM A;  4IHW A;  1D1A A;  1OR7 A;  2CYY A;  3ZR8 X;  2IT0 A;  2NOJ B;  3HIF A;  1CF7 A;  3TW6 A;  1E0E A;  3GTO J;  2VKV A;  1BC8 C;  1D0X A;  2E19 A;  4WCG A;  1CF7 B;  4O6J A;  4A5N A;  5JFR A;  4YFX F;  4LLG F;  3LSK A;  4Y52 J;  3P7N A;  3FXR A;  2FEZ A;  2L01 A;  2HQN A;  2BY2 A;  4GXO A;  4PDK A;  2K9M A;  3I0T A;  1F4K A;  2H27 A;  3WU2 C;  2M4G A;  2F2E A;  2E71 A;  1X3Z B;  3DF8 A;  4AIH A;  2A6E F;  2CRG A;  4I0B A;  2F5D A;  1ETX A;  4A6D A;  1OYW A;  2IGM A;  3J81 Z;  2M1B A;  3R0J A;  4MHG A;  1Z21 A;  4OIP F;  3ZQC A;  5IP6 A;  5GAE J;  1QRY A;  3FXJ A;  5BQT A;  3DEE A;  2ETH A;  2PMZ A;  2JTV A;  1PVE A;  2E1M B;  4BE2 A;  2VLA A;  1W4M A;  3C2B A;  3A4C A;  5HLI A;  3MKY B;  4IF4 A;  2EV0 A;  3F9K A;  1G3Y A;  4QPQ A;  3LSM A;  4XON A;  2LVS A;  5LRS A;  1U8R A;  1B72 A;  3HOV J;  2KZV A;  5EF6 A;  2CJJ A;  4UUS B;  4X0G A;  5FKK A;  4LK0 F;  4GDF A;  5DV5 A;  2ZJQ F;  3CP2 A;  4CO8 A;  4J00 A;  3CF5 F;  1B72 B;  4IHT A;  2FNP A;  5IT9 Z;  1BJZ A;  2M0M A;  4JYK A;  4IVN A;  2Q1Z B;  4TV7 A;  3MZH A;  1RNL A;  4PUS A;  2CQ7 A;  4YRV A;  4FX4 A;  2X1D A;  2KLO A;  2R7T A;  4CYC B;  4XKB A;  1D5V A;  3MQ0 A;  5AIQ A;  3AG1 H;  4EJW A;  2Y69 H;  2L7Z A;  4RGU A;  2KQR A;  1VQ7 I;  4C2T A;  2H94 A;  4XR6 A;  5BPD A;  1OIS A;  3K4M A;  4PK4 A;  1FX7 A;  2O6G E;  1OFC X;  1TWA J;  1Q1H A;  1W5C C;  2WWY A;  1MND A;  4U7B A;  1FOX A;  5LD2 C;  2E60 A;  3GFL A;  3HKZ A;  2NS7 A;  4L0Y B;  1TTY A;  4I2O A;  5B66 C;  4OIN F;  1XSD A;  4CZC A;  4L9J A;  1A5J A;  2STT A;  1R23 A;  3U1K A;  1BN5 A;  2L5Q A;  1JT6 A;  1VQ9 I;  4XN3 A;  2V9P A;  2W24 A;  1QVT A;  2P81 A;  2JA7 J;  4FAS D;  2E1O A;  2R7X A;  4XKV A;  4L18 B;  3JAM Z;  3JSP A;  2K7L A;  3ZMD A;  4A0Z A;  4WF2 A;  2M34 A;  3TQN A;  2NS0 A;  2Y9Z A;  3G1M A;  2ISZ A;  2QKM B;  4A3M J;  4LOC A;  3VSL A;  1USS A;  2HU9 A;  1HA8 A;  4MQ9 F;  2ZME A;  2XKO A;  3RJP A;  2NVT J;  2EJR A;  1ON2 A;  1IG7 A;  2ZME B;  1XGM A;  2BE5 F;  4M3F A;  1B9M A;  5D4R A;  1JUS A;  3GVA A;  4I02 A;  2EV5 A;  4RAY A;  1EKE A;  2EBI A;  5M5Y J;  5FKL A;  3GLL A;  3KEY A;  3ZN0 A;  1IRF A;  3L2V A;  4BUP A;  2AHQ A;  4YG2 F;  4PJL A;  4DGW B;  4E7K A;  1WFX A;  1OPC A;  2Y2Z A;  5DUK A;  2NOG A;  2V7F A;  2R7U A;  2HI3 A;  2HYF A;  4HNU A;  2XRN A;  2RQP A;  3O6B B;  1T0F A;  3FK7 A;  2XGC A;  3F72 A;  3H3U A;  3SXY A;  2R92 J;  1IN6 A;  1SEU A;  3E6C C;  5B5E C;  3GTM J;  2KRF A;  3EUA A;  5HS9 A;  4CDG A;  1XDS A;  1K83 J;  5GAG J;  2VON A;  2JVG A;  3G6E I;  2D45 A;  1DDN A;  2NVX J;  3K4B A;  2F5C A;  3VOE A;  9ANT A;  2HR3 A;  1V5E A;  2V79 A;  3AL0 B;  3OYH A;  3T0Y A;  2W25 A;  4IL6 C;  2L3D A;  1GV5 A;  3JCU C;  4P1W A;  3NEU A;  1EV7 A;  2WAE A;  2DU9 A;  4FE4 A;  4L9V A;  3LFU A;  2HQ5 A;  2FX0 A;  2ZXH A;  1P92 A;  5D8L B;  4A93 J;  3VB2 A;  3RCO A;  1C0W A;  1IGN A;  1BR1 A;  1LE8 B;  2XRL A;  2IVM A;  3ELK A;  3BR1 A;  3D5R C;  2K3F A;  5J4V A;  5FRN A;  3DEU A;  4B43 A;  2DN0 A;  4MTD A;  4WK8 F;  1QHG A;  2FJ1 A;  1RPW A;  3IP4 B;  4S0H B;  2YU9 J;  2LBF A;  2KIF A;  4HSR A;  1BW6 A;  4A3K J;  2IS2 A;  1P2F A;  1MGT A;  3WTZ A;  5FD6 A;  5J8C A;  4G12 A;  5D5V B;  2LBF B;  2QQB A;  2M4K A;  3I55 I;  2VOO A;  1X3W B;  1T8I A;  3S32 A;  1Y39 A;  4AU7 A;  2OTJ I;  3BTL A;  1BJA A;  3U2R A;  5C4X J;  3WTY C;  4A3D J;  2MYS A;  2K4J A;  2YU3 A;  2HPI A;  2ZKZ A;  2EIN H;  3K4K A;  4RGX A;  5F0F A;  4ZYD A;  3S1R J;  1Y1W J;  2E2H J;  3HOW J;  1U0J A;  3WOD F;  1JTX A;  1XTA A;  4AVZ A;  1YRN B;  4A0X A;  4FHT A;  1QA6 A;  2ADU A;  5EJC A;  3E5U A;  4S04 A;  4BXF A;  2W82 A;  1XGS A;  2WV0 A;  4EM0 B;  5L3C A;  2V4J C;  3Q9V A;  3EUH C;  4MLO A;  3CCE I;  4ABZ A;  2GXA A;  1WQ2 A;  1WI9 A;  2MFZ A;  1NK2 P;  2M7B A;  1H8A C;  1WI3 A;  2F5F A;  4IEJ A;  3QYE A;  1O3Q A;  3HOU J;  2XGX A;  1ZAR A;  5E17 F;  4M9X A;  1QNT A;  3HUG A;  2CU7 A;  1ZGA A;  4RM2 A;  5K7H A;  2BVM A;  5DS9 A;  1X19 A;  2GA1 A;  3QPT A;  3SZP A;  2P7V B;  4CHU A;  3K70 D;  3QAH A;  5JI6 A;  2STW A;  3I59 B;  4DNC A;  1W0U A;  1ZR4 A;  2XAG A;  2R7S A;  3CDH A;  1P4W A;  1Z7L A;  4PCQ A;  4ZTJ A;  3KYC B;  3ABL H;  1T2K A;  3DLA A;  3FM3 A;  2XAH A;  2VL8 A;  4G8X A;  2KT0 A;  3RKX A;  2E1N A;  2QA4 I;  1IZ1 A;  4G7O F;  3KP6 A;  5JHF A;  2V26 A;  5TIS C;  2F4O B;  2QUF A;  3BOQ A;  2CUZ A;  1IF1 A;  4A0Y A;  1MNM C;  1BIA A;  2PFB A;  4BNC A;  4B3A A;  4E7I A;  2LG4 A;  3CTA A;  3MN2 A;  1YW9 A;  3CZ6 A;  3FXL A;  2D5V A;  4A3G J;  2X85 A;  3VPR A;  1ZG3 A;  3LA7 A;  2P5L C;  3I5U A;  1R49 A;  3VYU B;  1MBE A;  1OCZ H;  1MBK A;  2HQA A;  3K6G A;  2X48 A;  2FBH A;  2ZCW A;  1VQM I;  1YIJ I;  3Q5F A;  2LY2 A;  3SFI A;  2ACJ A;  2CV0 A;  3S15 J;  3KX2 A;  2MG4 A;  5H20 A;  1SVO A;  5DDG A;  2NAZ A;  1D8K A;  4DYQ A;  2K4B A;  2P8T A;  1AKH A;  4F52 A;  3Q0W A;  1TNT A;  2JA6 J;  2CUF A;  1KON A;  4C3H J;  1LNW A;  4ENM A;  1ZGJ A;  3M7G A;  4HW0 A;  5FLX Z;  4ENN A;  2RAE A;  2NNN A;  3EYI A;  2DI3 A;  1R6R A;  3ERM A;  3BC8 A;  4B48 A;  2DA1 A;  3IAM 2;  1T39 A;  1DU6 A;  2Z3Y A;  1P4X A;  3FMS A;  2DFI A;  2MC4 A;  4FQG A;  3SJM A;  4AIJ A;  3LSG A;  1SVL A;  1MW7 A;  1MZB A;  1U6G A;  2FOW A;  5TRD A;  1ZG5 A;  3PL8 A;  1X58 A;  3F23 A;  2XPU A;  4CZZ A;  2OV7 A;  2IW5 A;  2LH9 A;  3M8F A;  2W1O A;  3J7Z I;  2DXI A;  4AC0 A;  1Y8R B;  3HSE A;  3K4J A;  5D6F A;  1J75 A;  1JHF A;  2L9S A;  3IH3 A;  1QQI A;  3LL7 A;  3W2W A;  4UY8 I;  1BI0 A;  3ESW B;  1R5H A;  1I3Q J;  4EJT A;  3FF5 A;  4MEX F;  1D1B A;  2X6W A;  5IY5 H;  2DMQ A;  2EFW A;  3WHC A;  2WY8 Q;  5B1B H;  2AS5 F;  2FSW A;  3V8L A;  2PMU A;  3JTG A;  2R7R A;  1DPU A;  2FD5 A;  2BY3 A;  3GTJ J;  2CFO A;  1JJ8 C;  3Q0U A;  1FYL A;  1QHH D;  3E1S A;  1X1B A;  2A68 F;  2FA5 A;  4NNJ A;  1VQN I;  2DT7 B;  1UJ8 A;  4AUX A;  1IXR C;  3BG5 A;  4IRI A;  2CS3 A;  3BR3 A;  1S6L A;  3JRH A;  3NRV A;  4F91 B;  2H09 A;  2QM3 A;  1MJA A;  4ZYH A;  5CVV A;  4XL9 A;  1X1D A;  4M6Y A;  4GYG A;  2Q8K A;  3OYM A;  5JHU A;  1QZE A;  1PUF A;  3N4M A;  3D5S C;  3BTI A;  3BR2 A;  4XLF A;  1LFP A;  3KLO A;  5GAD J;  3ABU A;  1O3S A;  2EZH A;  4OU0 A;  2FE3 A;  2HKO A;  4CGZ A;  3CF2 A;  2X6Y A;  4PJN A;  2KP6 A;  3OR1 C;  5FFX A;  3ZQ7 A;  2CSO A;  1SFK A;  2EIL H;  3HB9 A;  1S7O A;  1W5T A;  3V7R A;  3VDX A;  2XRO A;  1GUU A;  3QPL A;  2XAU A;  4IQ4 A;  1DQU A;  3CUQ A;  4HA8 A;  1Q1V A;  5CYV A;  5BS6 A;  5EYR A;  2F6C A;  2R7F A;  2O3F A;  4EJU A;  2ISY A;  3ABT A;  2OC6 A;  5GAH J;  1W7P A;  2JZY A;  1FIA A;  2PQ8 A;  2XB5 A;  3HOX J;  5J1R A;  3FWE A;  3F6V A;  1UHW A;  1ON1 A;  4LMY A;  4UUT A;  1B4A A;  1VQ8 I;  3RDI A;  3QPS A;  1Z3X A;  2O03 A;  3W6J B;  2QVO A;  3K2Z A;  2HTS A;  1VQK I;  1IRG A;  4BH9 A;  3JR9 A;  2IS4 A;  1JI8 A;  2FMY A;  4RB1 A;  5D5W B;  2QF7 A;  2R3S A;  3TW7 A;  3WHB A;  3H35 A;  2UZK A;  1QZY A;  3OYE A;  3LSR A;  3BR6 A;  4LG0 A;  3CCL I;  2OD5 A;  1S5L C;  1SMT A;  2PJR A;  2VBX A;  2BY1 A;  2DFF A;  5E20 A;  5IP9 J;  4U88 A;  3E7L A;  1A6Q A;  1ZYR F;  3S8P A;  3S1Q J;  3F8F A;  2BOL A;  1LB2 A;  1O7F A;  1RKW A;  3WE3 A;  3CCV I;  4N9H A;  1RET A;  1MBG A;  2DPU A;  3CMA I;  3RPQ A;  3H1C A;  3HOZ J;  1ZR2 A;  3M07 A;  1MMS A;  1Z6R A;  2NVY J;  3J81 K;  1BBY A;  3CMY A;  3L2C A;  2GWR A;  4UVA A;  2WAQ N;  1UST A;  3HDD A;  5FRM A;  1I6X A;  2ZNY A;  4CCK A;  1SD5 A;  2M30 A;  4ON0 A;  1G3S A;  3FXO A;  4A3I J;  4CCL A;  2ELJ A;  1RC9 A;  3W2V A;  2EV6 A;  2VE9 A;  1MBJ A;  4XRS G;  2CQK A;  1ZLK A;  5LBQ A;  4XLP F;  5HNH A;  5DM6 F;  1TP4 A;  2XUB A;  1ZK8 A;  5FKN A;  3HOT A;  5E3O A;  2XB0 X;  1GXP A;  3BTJ A;  3GZ6 A;  2CW7 A;  5D5U B;  4DW6 A;  1Z9C A;  3G1O A;  5H6Q A;  3QP6 A;  4MFD A;  2EFQ A;  4Q5S F;  1P4A A;  3ZQQ A;  3FHZ A;  1YJ9 I;  3NWS A;  3Q9S A;  2VJJ A;  1JGS A;  3BR5 A;  3CCS I;  1OYY A;  5B3S H;  2NXN B;  2JN6 A;  5GTH C;  1GVJ A;  1Y1V J;  4ZDP A;  3DKX A;  2L4A A;  1FJL A;  2JVH A;  4JBA A;  3V42 A;  1YTY A;  1M1E B;  3CD6 I;  3MZY A;  3FBN B;  4BQA A;  2DOF A;  1WWX A;  2JPB A;  3REO A;  4CUG A;  2EQR A;  2HXO A;  5TJJ A;  4PFO A;  3ZCO A;  2IA0 A;  1IAW A;  4RAG A;  3PUB A;  4XLA A;  3V7S A;  1TW2 A;  3GLX A;  1P7J A;  4G7H F;  1VQP I;  5HLT A;  2RQQ A;  3KYD B;  3FXK A;  2DTR A;  2K86 A;  4UHT A;  2L0K A;  2IEK A;  2I10 A;  2XF6 A;  3KP4 A;  5L3G A;  4FET A;  4LIU A;  2VBW A;  4XQF A;  1YO5 C;  1TQM A;  1H0M A;  2OAZ A;  4II3 A;  4PGH A;  1O3T A;  2HTJ A;  3S3M A;  4I0A A;  1PP7 U;  1R7J A;  2EZK A;  3RI4 A;  3R60 A;  3L1P A;  1I50 J;  3GW2 A;  1UB9 A;  1TWF J;  4BU2 A;  2R5Z A;  1RR8 C;  4ZDL A;  1P7I A;  4HAM A;  2E36 A;  3AG2 H;  2JK3 A;  2R5Z B;  2E2I J;  3C1D A;  1IO2 A;  1GVD A;  1U5T A;  3D1N I;  3WTX C;  4N9I A;  1VZ0 A;  3LNQ A;  3S14 J;  5LHI A;  2AXT C;  3E0J B;  3TO9 A;  1IN4 A;  4Y7N J;  4D1Q A;  2LOO A;  3I71 A;  2HZD A;  2HOE A;  4KMU X;  4XBF A;  2COB A;  1FT9 A;  3FDY A;  4HLY A;  5A2Q Z;  2QCO A;  3I9V 2;  1OCO H;  3FKJ A;  2LLK A;  1JKP C;  2GBY A;  3BY6 A;  2EFN A;  3CO6 C;  1ENH A;  2R7D A;  4EQQ A;  3BCA A;  3C2G A;  4XN0 A;  4D5C A;  2CV1 A;  3RQ4 A;  3KEQ A;  5CQE A;  5BNG A;  4PSX A;  1JT0 A;  2JA8 J;  3TP0 A;  1D0Y A;  5IOY A;  5IOZ A;  5HLH A;  1O4X A;  4IHV A;  1BIB A;  3GFJ A;  1KQ0 A;  1Y0U A;  3FZV A;  2RKH A;  2TCT A;  5J3L A;  1LJ9 A;  1U2W A;  2YSR A;  1ETK A;  1HDP A;  4IHS A;  1WJB A;  4II2 A;  2XPV A;  5GTI C;  3VEP A;  2A6H F;  3A01 B;  3OIP A;  1TW3 A;  4NHJ A;  1XG1 A;  3H0G J;  3VWB A;  3WE2 A;  1UG0 A;  2QZ8 A;  3JSO A;  2QBY A;  5JVT A;  2IGK A;  4RLQ A;  1AU7 A;  2O9L A;  2ELK A;  2L2O A;  4LIT A;  2QBY B;  4DJA A;  5F1J A;  4UV9 A;  1R58 A;  1XMA A;  4A3E J;  4B4C A;  1LVA A;  4U0V A;  1HC8 A;  2XV4 S;  1E2X A;  3F8M A;  4OOI A;  3R0A A;  2GIV A;  2HQR A;  3CP8 A;  1W5S A;  4HQM A;  4XLH A;  3PFI A;  4I01 A;  1J0R A;  2VT2 A;  4YFK F;  2B63 J;  2KIM A;  4BBS J;  2LY1 A;  1Z77 A;  1SFO J;  2NNY A;  2M8E A;  1XMK A;  3KP7 A;  2QEX I;  2K9L A;  4UXN A;  2X9D A;  2DOA A;  3WG9 A;  2UWM A;  4WXD A;  3T5X A;  1ITY A;  3TKY A;  5M3M J;  4UUS A;  5HOD A;  2XAQ A;  2WBM A;  4Q4Z F;  3GZN B;  3QYF A;  3COA C;  3L7W A;  2PLY A;  1QPM A;  2Y31 A;  5LGU A;  1K4S A;  2V9V A;  2E35 A;  1E3P A;  2DO7 A;  3MAJ A;  3L09 A;  2M8G X;  4WXC A;  2YX7 A;  4CYC A;  1FSH A;  2M45 A;  1V5F A;  1BOA A;  4QIW N;  2CGP A;  2WC2 A;  3GF2 A;  2MLK A;  1NK3 P;  3E6M A;  2OCE A;  3AFH A;  3OL4 A;  2P7C B;  1JKQ C;  4EV0 A;  4XOP A;  3J80 Z;  4EJV A;  3BR0 A;  3FMR A;  1OYI A;  1S29 A;  4CA0 A;  2LK2 A;  1F43 A;  5J1Y A;  1A35 A;  1WHU A;  4BE1 A;  1J7K A;  3ECO A;  4ZZD A;  4IZZ A;  1ZEL A;  3VYS B;  2VUM J;  5CPR B;  1X4O A;  3H9J A;  3TP3 A;  5EDN A;  4D7N A;  3U21 A;  1I39 A;  4GO1 A;  4IXA A;  5KCM A;  4OAZ A;  5L3E A;  1WGX A;  2Y0M A;  4A12 A;  1U3E M;  1P6R A;  2BZT A;  5E1Z B;  3CCM I;  2HDD A;  3BP8 A;  2VAS A;  5D4S A;  4CYD A;  4Y33 A;  4JX4 A;  2IP2 A;  1OLT A;  4OWR B;  4IO9 F;  3IC7 A;  1QPI A;  2NYX A;  1LFB A;  3S17 J;  2A5W A;  3F0C A;  4QWQ A;  4JQF A;  4LLN A;  2BHZ A;  2K9S A;  1DGR M;  1ZLJ A;  4I6Z A;  3E97 A;  3LQQ A;  4DOZ A;  1QU3 A;  2J5O A;  4KN7 X;  4A3L J;  4JX5 A;  2HS5 A;  4ENK A;  3ZMT A;  1O3R A;  1IXC A;  1OR7 C;  3HPG A;  1FYK A;  3EDP A;  5AIP A;  5KAF C;  4KMF A;  3ECH A;  3H3V K;  2WV1 A;  2BHY A;  2LF7 A;  3BJO A;  3A0H C;  3CO7 C;  1F9N A;  5EZH A;  2ESN A;  3KZY A;  1TWC J;  1UHM A;  3PUF A;  2GOX B;  4EGY A;  1OCC H; 
#chains in the Genus database with same CATH homology
 1NTC A;  1MBE A;  1IJW C;  1IV6 A;  2GM4 A;  1FEX A;  1MBK A;  1XS9 A;  1RES A;  2H8R A;  2HOS A;  2X48 A;  3OOU A;  3PO3 J;  4XRM A;  3SFI A;  4XIC A;  3S15 J;  2MG4 A;  1WH7 A;  3HKZ N;  1JTY A;  3JRI A;  4RBO A;  3TED A;  2K40 A;  4DYQ A;  1AKH A;  2WB1 N;  3Q0W A;  2JA6 J;  2CUF A;  4C3H J;  5EG0 A;  2RAE A;  1MBF A;  3FK6 A;  4X1E A;  5EGO B;  3MKL A;  5EG0 B;  2DA1 A;  1DU6 A;  3SJM A;  1ETO A;  3S1M J;  1LE8 A;  3LSG A;  4V2G A;  3RQI A;  1WPK A;  1OCP A;  3O8G A;  2Y30 A;  1X58 A;  3HBL A;  2XPU A;  5M5X J;  3HEF A;  2EH3 A;  2LD5 A;  5E3M A;  3CQZ J;  4AC0 A;  1UHS A;  1JKO C;  2VKE A;  3JRA A;  5K7Z A;  2HOT A;  3ZQL A;  2GLO A;  3IH3 A;  4M3E A;  3LOC A;  1I3Q J;  2Y0S N;  5FKO A;  2DMQ A;  4W97 A;  1ZKG A;  3NAR A;  3WHC A;  3DEW A;  1FTZ A;  2JMW A;  3HGY A;  2LR8 A;  2FD5 A;  3GTJ J;  3ZQH A;  1JJ8 C;  3CDL A;  3Q0U A;  1ETQ A;  1RKT A;  3IH2 A;  1YRN A;  3FIW A;  4DYR A;  3S1N J;  5C4J J;  3G1L A;  4AUX A;  3M3Y J;  3BG5 A;  2HYJ A;  1ZQ3 P;  3JRH A;  3BR3 A;  2Y9Y A;  3GBG A;  4MFE A;  1BA5 A;  5M3F J;  1HOM A;  4DZP A;  3K2A A;  3OSG A;  5EEA A;  2DA5 A;  1PUF A;  4FTH A;  3BTI A;  2CUE A;  3BR2 A;  1HLV A;  1POG A;  2EZH A;  1X2M A;  1ETY A;  4M3G A;  2W48 A;  4DYC A;  3M4O J;  4J19 A;  2DMP A;  3HB9 A;  5K7F A;  3BT9 A;  5FLV A;  3HOY J;  1BW5 A;  3Q0V A;  4IHY A;  4NDL A;  1GUU A;  2EZL A;  4M3B A;  3QPL A;  5GPA A;  4DZJ A;  4D7M A;  1Q1V A;  2OPT A;  4A69 C;  2L9R A;  1GDT A;  3A02 A;  5EYR A;  1MSE C;  2ME0 A;  1MBH A;  2ZB9 A;  2CQX A;  4BY1 J;  1LFU P;  1DU0 A;  1FIA A;  3SDG A;  2L7F P;  2XB5 A;  3HOX J;  5J1R A;  1BL0 A;  2LY9 A;  3S2H J;  2E2J J;  4UUT A;  1GV2 A;  3NAU A;  3B6A A;  2ID3 A;  3QPS A;  1HCR A;  2IAI A;  1HDD C;  1U9N A;  5F0C A;  3JR9 A;  4IHX A;  5JLW A;  4A3C J;  3IV5 A;  3I4N J;  1EF4 A;  3A03 A;  2QF7 A;  1VFC A;  5DTD A;  1FIP A;  4RDU A;  3S16 J;  3TW7 A;  3WHB A;  4XID A;  2HXI A;  3LSR A;  3ZQI A;  3BR6 A;  1UG2 A;  4FCY A;  1JJ6 C;  5IP9 J;  2YS9 A;  3E7L A;  1S7E A;  2FQ4 A;  3S1Q J;  3K7A J;  2TRT A;  5EGO A;  5E3L A;  1IDZ A;  5C44 J;  1RKW A;  1RET A;  1MBG A;  4IHW A;  3DCF A;  3HOZ J;  1ZR2 A;  5IYC J;  3TW6 A;  2NVY J;  3CMY A;  3JRD A;  5F04 A;  3GTO J;  2VKV A;  2E19 A;  2WAQ N;  4B1R A;  3HDD A;  2YUS A;  1U9O A;  4Y52 J;  1HF0 A;  4A3I J;  3PO2 J;  5EZG A;  1MBJ A;  4XRS G;  2R0Q C;  5IYD J;  2CRG A;  1ZK8 A;  5FKN A;  5GP9 A;  5E3O A;  1ETX A;  3RZO J;  2XB0 X;  1A6I A;  3BTJ A;  1W0T A;  4A3B J;  4DW6 A;  4BXX J;  2XGD A;  3G1O A;  1D5Y A;  3JRF A;  4MFD A;  5F08 A;  3ZQC A;  1H88 C;  1G2H A;  5IP6 A;  1QRY A;  3BR5 A;  3S2D J;  2IBD A;  4MO7 A;  5F27 A;  2JN6 A;  2O8K A;  1Y1V J;  2K9N A;  4QTR A;  3GTL J;  3C2B A;  1FJL A;  4XRS A;  3BQY A;  1VF9 A;  1SAN A;  2LVS A;  3HM5 A;  1B72 A;  3HOV J;  5EF6 A;  4C2M J;  2CJJ A;  4UUS B;  1JKR C;  3B6C A;  5FKK A;  1MSF C;  3O8H A;  2JJ7 A;  1B72 B;  2EQR A;  2HXO A;  1BJZ A;  4JYK A;  4CYC B;  1P7J A;  1B8I A;  3PM1 A;  2L7M P;  2M9H A;  4C3J J;  2L7Z A;  1AHD P;  1B8I B;  1E3O C;  5F0H A;  2G0E A;  2R7Z J;  3GTK J;  2L0K A;  3JRC A;  2IEK A;  2I10 A;  5IP7 J;  1OCT C;  2NVQ J;  2JWT A;  1IC8 A;  5M5W J;  1OFC X;  1TWA J;  2XGE A;  4X6A J;  3I4M J;  2NS7 A;  4BKX A;  2DA4 A;  2O7O A;  2LFB A;  1VND A;  2EZK A;  3L1P A;  1I50 J;  1TWF J;  3ZQG A;  3GTQ J;  1A5J A;  2R5Z A;  4C3I J;  1IRZ A;  3LSJ A;  2EZI A;  1F36 A;  1P7I A;  2JK3 A;  4M6V A;  1JT6 A;  3OIO A;  2R5Z B;  2E2I J;  4JP0 A;  2JA5 J;  4JX6 A;  1QVT A;  2DTZ A;  2P81 A;  2JA7 J;  1GVD A;  1T33 A;  2E1O A;  3D1N I;  3GTG J;  3LNQ A;  3S14 J;  2NS8 A;  3QQA A;  4Y7N J;  2DMT A;  1K61 A;  2M34 A;  4FIS A;  2Y9Z A;  3G1M A;  1TWG J;  4A3M J;  2COB A;  4LOC A;  1JKP C;  2QCO A;  2XSD C;  2LLK A;  2GBY A;  3RZD J;  4D5F A;  1ENH A;  2DA3 A;  2NVT J;  4D5C A;  1OJL A;  5BNG A;  1JT0 A;  2JA8 J;  3TP0 A;  4M3F A;  3FKI J;  5IOY A;  1JUS A;  5J1U A;  1WCM J;  5IOZ A;  1O4X A;  1T56 A;  2EBI A;  5M5Y J;  5FKL A;  4IHV A;  2R93 J;  2TCT A;  5J3L A;  2AHQ A;  2OF7 A;  2Y2Z A;  1ETK A;  2NOG A;  1QVU A;  3BG3 A;  1HDP A;  1ORK A;  2HI3 A;  2ECC A;  4A3J J;  2R5Y A;  2XPV A;  1IDY A;  3FK7 A;  2XGC A;  2R92 J;  3JRE A;  3A01 B;  5E3N A;  2R5Y B;  4MIM A;  3GTM J;  2VPR A;  1XG1 A;  3H0G J;  2AO9 A;  2DA7 A;  2HOA A;  1K83 J;  1Z0X A;  2ME6 A;  2H1K A;  1ZTR A;  2DMU A;  2NVX J;  1AU7 A;  2O9L A;  2ELK A;  9ANT A;  3BTC A;  2LTP A;  5F1J A;  3ZOB A;  2DA6 A;  1AKH B;  4A3E J;  4B4C A;  1GV5 A;  1H89 C;  3W6V A;  4QSH A;  2K9Q A;  4BY7 J;  4FE4 A;  1TC3 C;  3GTP J;  2HQ5 A;  2FX0 A;  4A93 J;  4I76 A;  1IGN A;  2B63 J;  1JUM A;  4BBS J;  3UKG A;  2XRL A;  1LE8 B;  1Z77 A;  4HNV A;  1SFO J;  1MH3 A;  2X9D A;  1ZGW A;  3BR1 A;  4AYB N;  4EEF G;  2DMN A;  1ITY A;  1MH4 A;  5M3M J;  2DN0 A;  4UUS A;  3FIS A;  4W1U A;  1WH5 A;  5HOD A;  2FJ1 A;  1RPW A;  2LP0 A;  2VI6 A;  4S0H B;  2YU9 J;  1I6H J;  1TWH J;  1BW6 A;  4A3K J;  2Y31 A;  4V2F A;  4G12 A;  5FJ8 J;  2M8G X;  4BBR J;  4CYC A;  4GFB A;  3BTL A;  5C4X J;  5GPC A;  4A3D J;  4QIW N;  1ETV A;  1NK3 P;  2KDZ A;  2ID6 A;  3S1R J;  5F0F A;  1Y1W J;  1JKQ C;  3HOW J;  2E2H J;  2M2E A;  2DJN A;  3HGG A;  4A3F J;  1IG7 A;  3BQZ A;  1JTX A;  3BR0 A;  3IH4 A;  1YRN B;  1F43 A;  2LK2 A;  5J1Y A;  1APL C;  2ECB A;  4MLO A;  5IYB J;  4ABZ A;  2VUM J;  5C3E J;  3Q3S A;  5JLX A;  1U78 A;  1XC5 A;  3TP3 A;  1FTT A;  5EDN A;  1NK2 P;  4D7N A;  1H8A C;  1WI3 A;  4IEJ A;  1VI0 A;  2MSY A;  3JRB A;  1R9T J;  4L5E A;  1WGX A;  5FLM J;  3HOU J;  1PUF B;  1JUP A;  2CU7 A;  3MVP A;  2HDD A;  5K7H A;  5DS9 A;  4FE7 A;  2DA2 A;  4JX4 A;  3CCY A;  2MGQ A;  1W0U A;  1QPI A;  1LFB A;  4M3D A;  1ZR4 A;  2LKX A;  1U8B A;  3S17 J;  3F0C A;  2PMZ N;  2M0C A;  1RR7 A;  2XPW A;  2K9S A;  2MW8 A;  1ETW A;  2KT0 A;  1UMQ A;  5IPA A;  1CQT A;  1GT0 C;  3JRG A;  4I6Z A;  5FKM A;  4XK4 A;  3ZQF A;  3RKQ A;  4A3L J;  4JX5 A;  1MNM C;  4B3A A;  1IUF A;  2CQQ A;  1X2N A;  3MN2 A;  3OSF A;  3H3V K;  2WV1 A;  2N8G A;  1JGG A;  5EZH A;  3LSP A;  2D5V A;  4A3G J;  2X6O A;  1TWC J;  3VPR A;  3A01 A;  3BG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...