2JUGA

Multienzyme docking in hybrid megasynthetases
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
78
Chain Sequence
GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords TubC protein
publication title Multienzyme docking in hybrid megasynthetases
pubmed doi rcsb
source organism Angiococcus disciformis
total genus 10
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18563 TubC_N TubC N-terminal docking domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2jugA01
2JUGA
chains in the Genus database with same CATH superfamily
1MBGA 3HOVJ 3HOXJ 2DDAA 3LFKA 5A2QZ 3E6CC 1WPKA 1WCMJ 1D5YA 1WZ2A 3MZHA 1I5ZA 1R4NB 1SFXA 5IY5H 3S1QJ 2G0EA 3MFKA 1N75A 2M34A 5J4YA 4A2UA 3IH4A 1WSUA 1VQ8I 3AG2H 3QOPA 2X0LA 4UUSB 1S5LC 4YELA 1YIJI 1FTTA 2HTSA 4IZZA 3BR1A 3CZ6A 2ZMEA 4M3EA 3GVAA 1O3SA 2F4MB 4U0VA 2PJPA 4MO7A 5KAFC 3MEXA 5HS9A 1SMYF 3OYFA 1N77A 3IWZA 3HUGA 4BY7J 2MABA 2DA3A 2H8WA 4B4CA 3M07A 3VFZA 2W57A 3O3KA 4LG3A 2AXTC 1VQ9I 2Y0SN 4F52A 5D5VB 1FX7A 2STWA 3KYDB 2VLAA 2FMYA 4RGUA 3IRQA 5LFAA 3ZCOA 4M6XA 2JA2A 3ZN1A 3EYIA 2VOPA 3OYGA 1UMQA 1HSJA 4JX4A 3K2AA 3VEPA 2V6EA 1QGPA 4NB5A 3SZPA 4UNOA 1ULYA 3E5QA 1O7FA 3BDDA 4ENKA 1HSTA 3C1DA 1FOYA 2VQLA 4P55A 1IF1A 1XGNA 2RNJA 1D0XA 2KL4A 5CKTA 1TT5B 3M8EA 2VKVA 1QO0D 2VBXA 3OS2A 4A3BJ 1Y1WJ 3CF2A 2Z2SB 5B5EC 4Y33A 5FLXZ 3BCBA 3VPRA 5J1RA 4MGRA 3J81Z 4ASNA 4EJUA 2Z3YA 2MC3A 1AU7A 4EM0B 1PYVA 2LSOA 5BPDA 4IHVA 4PJMA 4QIWN 2KIMA 4HF0A 1EA3A 5K5QA 2XF5A 3CCRI 4UVBA 1FYMA 3FISA 4KYWA 2M1BA 5FKLA 2BY1A 2RV8A 2R93J 2V9VA 3MCZA 2BV6A 5EEGA 3U9GA 1IN4A 2P6TA 1P4XA 3TBIA 4YFNF 1CGPA 1MD0A 2MC4A 3KLNA 1R7JA 4GRIA 4HOBA 2OJED 5DS9A 1OQYA 2HQ5A 2Q2EA 2TDXA 4PGHA 4ZH4F 2PEXA 4ZYAA 5CVJA 1JT6A 2FXAA 1MMDA 2R4GA 3V8JA 4MEYF 2ZMEB 2R92J 2QYOA 3R6SA 2BW3A 2KRFA 3HHGA 1SAXA 5M5XJ 3O6BB 4CUGA 4RBOA 1QNTA 1MJ9A 4E7SA 4OIOF 2VJIA 1JXSA 2NXNB 3DTIA 2DQLA 2ME6A 4LITA 3D1NI 1WVRA 1K83J 2EILH 1GUUA 3TO9A 5D5XB 5J8CA 3KIOA 2FBIA 2E5ZA 4KIFA 4Y4RA 1XB4A 3L2VA 2ADUA 3F0CA 3CC7I 2E1OA 2YU3A 5DYMA 3M1EA 5C3EJ 1FLIA 5F0HA 2E7XA 4IXAA 1F5TA 1IRZA 1QHGA 2F48A 4O6JA 1DPRA 5LRSA 3WU2C 3B6CA 3S8PA 4ENNA 2LC2A 3HSEA 1OYYA 2R5ZA 2F5EA 1UHSA 3S14J 2LRDA 2DK5A 2WA0A 3FXLA 4WXDA 1TLHB 3JSOA 3M9AA 4I02A 2G9WA 1LDKB 4JQFA 2DJIA 2ISYA 2A07F 4GCVA 2HKXA 4UVAA 3MKLA 3GW2A 5D4RA 1S7OA 2E5NA 1H8AC 1PVEA 5FB2A 3BC8A 2BXZA 1LFUP 2ID6A 2R7OA 3X2QH 1WJDA 2H8RA 5FLXK 3FKIJ 3HSFA 1XSXA 5CVUA 3NAUA 3MKZA 2BHYA 4F3QA 5J6XA 2HPMA 2KLOA 2UZKA 1XGOA 3B02A 1MNMC 2X1EA 3I55I 5IYBJ 4N4NB 2P8TA 1VTNC 2L2OA 2RGVA 4QLCU 5E8GA 1I6HJ 4FX0A 2KIFA 1MBEA 3FXRA 3QOEA 4B44A 3HOZJ 3H0GJ 2EWNA 2Q2EB 3LA3A 1J75A 1MNEA 5GTIC 4XLNF 3WGIA 4HX8A 1GXQA 1HF0A 2ZNYA 4A3IJ 1SD4A 4M9XA 2R5YB 2NVTJ 3S2WA 3IH3A 1S7AA 2ME0A 2BW3B 4YG2F 2P0WA 2IJLA 2CS3A 3MZYA 1P9QC 4YEJA 4L9NA 3M1CA 5J47A 2EFNA 1OR7C 2V1XA 3FK7A 1ZK8A 3HTSB 1Y8RB 2M2EA 4HX4A 2W1OA 2V6CA 3PJRA 3AG3H 1X3UA 1BOBA 3H0DA 1U2WA 3RDIA 5D4SA 2VC1A 2WC2A 3CO7C 3DPTA 2M4KA 2RDPA 2VASA 3HL2A 4H0EA 2O5RA 1MBFA 4KIBA 3E5XA 2FOKA 1Y8QB 2Y2ZA 3EYYA 2BZTA 1NTCA 1ETVA 2VJJA 1NK2P 1WI9A 2D1VA 4XIDA 1O3TA 3OYCA 1W5TA 1MW7A 3CESA 1D8KA 3QP6A 4BXFA 2R5ZB 1WH7A 5CVIA 3K70C 4OIPF 2VQHA 4II3A 3TKYA 3OYHA 1W5SA 1F36A 4I0AA 4KN4X 3TDUC 2MG4A 4DBRA 2MW8A 3PNVA 5ICFA 4DJAA 4WK8F 2XV4S 3NARA 2WWYA 4KT5C 1JKOC 2XPVA 2JJ7A 4RB2C 2EIKH 1I3AA 4JX6A 1WJFA 3W3CA 1CF7A 3U1KA 2P7VB 4M3FA 3CCJI 5M5YJ 4V19K 4G7HF 1B72B 1P6RA 1VQ5I 2IT0A 3HGYA 1FTZA 3H9QA 4FQGA 3ZGKA 2PG4A 4UVCA 3H35A 2JQ7A 3FMQA 2GOMA 2K4JA 2VC0A 3M3YJ 4ZDOA 1MJAA 2YR2A 3J7AO 4XBFA 2XAGA 3LSKA 2WAEA 1MKMA 1UZCA 4BYYA 3MAJA 1E2XA 2LBFB 5CPRB 1RZ4A 3BG6A 1LVAA 4LIUA 4G7OF 2HOTA 3FMRA 3HKZA 4NDLA 1RKTA 4LGWA 2TRTA 5IT3A 1NH3A 5DUKA 2LR8A 4ZYEA 1OCZH 1SD5A 4B3XA 2JZYA 4XN3A 2CUZA 4BAYA 4HG2A 4J19A 2JPCA 3ERED 5FJ8J 5HOOA 3QRFF 1YITI 1HLVA 1JJ8C 2IS1A 2XROA 3T8TA 2LG4A 4CICA 1STZA 2HQAA 3H5NA 2O03A 4EJOA 2H1LA 3OS1A 4FCYA 3BJAA 1XCBA 4WXHA 2CG4A 2K9SA 4ANJA 3S3MA 3KYCB 2FD5A 2Z16A 3E0JB 2OC6A 3KEOA 4L5JA 1U9OA 2F5VA 3G6EI 4KNYA 3ISPA 2A6HF 3EETA 1ZELA 3L00A 4XLPF 3BJOA 4X0GA 1XD7A 3KP2A 2A5YB 5ICEA 4E7IA 2HS5A 3S32A 5C44J 4EGYA 2HVRA 4HEA2 5DCMA 2LY9A 3BR5A 3ZMZA 1XSVA 2STTA 2QENA 4CGZA 3DLLF 2XASA 1LEBA 4MFDA 1A5JA 5B3SH 4NNJA 4XRFA 3U21A 1TBXA 3K1MA 1Z3XA 3QPSA 4KMUX 2X48A 3BOQA 4JP0A 3A0HC 2FBHA 5FD6A 4HAMA 2HOEA 3KETA 4G7ZF 2NVXJ 1TWAJ 1P7JA 4DYCA 4I0BA 4N0BA 1HKTA 1W36D 1XGSA 1DPUA 2OQGA 2DMTA 2DOFA 5EF6A 4ENJA 2LP0A 2Z33A 1POGA 4C3HJ 3I9V2 3PUBA 4JX5A 2CQKA 2HZTA 4XORA 3HOYJ 3DF8A 5L3DA 3E7LA 2Y0MA 2DA1A 4HSTA 2CRGA 4CXFA 1XC5A 4OOIA 5L3FA 1SFUA 3FZVA 3HG9A 3IAM2 2XAFA 2DW4A 2RREA 1OFCX 1EF4A 3JREA 2EH3A 5TJJA 4BACA 1WQ2A 1J09A 2KISA 4RLFA 4QPOA 3LA2A 3QPTA 1MZBA 5DD8A 3J80K 5IYCJ 3C7JA 4U87A 4S04A 4DW6A 1E17A 1USSA 1USTA 3V8LA 2CMPA 5D8LB 3DEEA 1J0RA 1JHFA 1V5EA 1DGWY 2K3FA 3BTCA 2NVQJ 2B0LA 5K5RA 3LSIA 1SMTA 1BOAA 3K0LA 5D8KB 2MA3A 2E19A 4BXUA 2EQRA 2W7NA 1H9GA 3RYPA 3ZMVA 5E17F 2CQXA 5LEJA 2F4OB 4M6YA 1S8NA 3Q9VA 2M45A 1K61A 3SEQA 2DMQA 3PO2J 5J3LA 2KJBA 1FOWA 3LOCA 3CUQA 3IHUA 3KZZA 5B1AH 2EZLA 3OYKA 1XMXA 3V7SA 6PAXA 1HOMA 3MQ0A 5FRMA 4GO1A 1R5ID 4MHGA 2L4MA 2JA6J 5L3BA 4I2OA 2UXNA 1R6RA 2VODA 2LF8A 1ZG1A 1W0TA 2XAUA 5H2FC 3MVPA 3Q0WA 5JVTA 1VQ4I 3MKWB 2DFFA 3CJRB 3PNYA 2NOGA 2IA1A 2XPUA 2FNPA 3RZDJ 5ICCA 3I0TA 1VF9A 1WJEA 5J40A 3G3ZA 1ZRDA 1WJBA 1W7PD 3B6AA 2QLZA 2EA4A 3UR3C 2K86A 4CSWA 2QSGX 3FKJA 2CQ7A 2DTRA 2HPIA 1XMKA 3OV8A 2FQ4A 2XF7A 3KCCA 4NC7A 2K9NA 4XK4A 1QVUA 1T08B 2QQ8A 1N25A 3RKYA 2I8DA 2CUEA 4WXCA 1XTAA 3GFLA 2Z1DA 4U7BA 2R7UA 2E1NA 3P7NA 3A0BC 3W6VA 3KP5A 5KNLA 4IHXA 1BJAA 2OCEA 3F23A 2JVGA 3IKVA 5F6FA 3VB2A 2VL8A 3NEUA 3GTPJ 1K4SA 1YX3A 4GGGA 3PO3J 2RNGA 4MLOA 3LQQA 3S93A 2GA2A 2GXBA 3IUOA 1FOKA 1Z67A 3VSLA 3CC2I 1BW6A 2GIZA 1OYIA 1KONA 2EB7A 4M6VA 3KE2A 2GXGA 3P5JA 2R7XA 3FK6A 3CF5F 1YTYA 1JKQC 4UHTA 3EUAA 3BPXA 3EUHA 2EK5A 5CLSA 2BYVE 2YX7A 4PJ0C 2EIJH 4IF4A 3DTKA 3DBRB 3CUQB 1EH7A 2L9RA 2OQRA 2X6YA 2Y69H 4R79A 1S7EA 1TQIA 3H5AA 4Z6YA 1ZRFA 4Q5SF 4RGRA 4XLHA 2EINH 2Y0SA 1X1DA 5J4VA 1UFMA 3JRFA 4N9IA 3HB9A 2KIQA 2BBYA 1YFHA 2GWRA 3RIRA 4G94A 5DTDA 2VQGA 2NAZA 2E1MC 3CCUI 1BI0A 1EV7A 2TCTA 3HPGA 3RYRA 4B43A 3CMAI 2L7FP 2KPMA 2K4BA 1B4AA 3W2AA 3CMYA 2CJJA 3KLOA 2CGPA 4KUMA 1MMNA 1Z1DA 1OCRH 2NS8A 4OWRB 2VE9A 3V4GA 2ISZA 4Q4ZF 2IS4A 4C9YA 4EM2A 2EJRA 2LOOA 3CCSI 2MH9A 4HV5A 1LE8A 3P9CA 1FWZA 1WKMA 5ICGA 5IPAA 1O57A 3BROA 4P96A 4BEHA 5E8IA 5LRRA 2DQRA 3TMOA 4CCOA 1YJ9I 5F08A 3G1OA 1XN7A 2E34A 1SD7A 2A5WA 3GTMJ 2YS9A 2E2HJ 2D45A 1VQOI 2W4SA 1PUFA 5K5OA 3GTOJ 4XLAA 1A6QA 2OD5A 4YIIA 5BOXA 3HEFA 1ETWA 5EZGA 2OUMA 1E3HA 1ONVA 4WX9A 2JN6A 2BVMA 4CCJA 4OIRF 5AIQA 2JA8J 1U3EM 1LDDA 3T5XA 2A69F 5LHHA 1HC8A 3KP7A 4ZYGA 2VKEA 2VPLA 2K9LA 2IRFG 2MYSA 1Z91A 3AG1H 4JK1X 1BC7C 1EJ9A 2VBZA 4AYBN 1MBHA 4OIQF 5EEHA 3VYTB 5JFRA 2ELKA 1ACIA 3ZQQA 3BQZA 2QKLB 2BGCA 4YIFA 4I76A 4C30A 2KQRA 1K6OA 4OAYA 2K3PA 4G9YA 5E79C 5EGOA 1QA6A 2F5FA 5JVGF 4A3GJ 1QU3A 1D1AA 2X1CA 4BE1A 5EG0A 2HQNA 3DU6A 4FASD 4X1EA 1I6XA 2P4WA 5LGNA 3EUHC 3OS0A 1FPQA 5KHDA 2LH9A 1JKPC 1WJ5A 4MTEA 2YX4A 4HNVA 4RAYA 4UV9A 3M8FA 4ZZDA 1ZR2A 3H3UA 2CQQA 4ABZA 3OMYA 4II2A 2VUMJ 1Z7UA 2FF4A 1HDDC 5AONA 4BDZA 1T56A 3ABLH 5EZHA 2FUG2 5TRDA 1JI8A 5FKKA 2BY2A 2DPDA 3HYIA 1OCOH 1TWFJ 4P9FA 3AG4H 1T0FC 3BLYA 1OMIA 1LE8B 3DPUA 1T39A 3DKYA 1YG2A 1WI3A 4ZZLA 4EMSA 4NUBA 1B8IB 1PUFB 1QZYA 1TNTA 1LFBA 3E6DA 1FEXA 2VT2A 3JRAA 1KYWA 3COAC 3HIFA 2NS7A 1VZ0A 3HHHA 4RGSA 3BTJA 1G8XA 5E18F 2M0MA 2IGMA 4ZDLA 2HYJA 3I3LA 3W2WA 2QQAA 4UY8I 2LREA 5DM6F 2D5VA 1ZH5A 3DEUA 3BZKA 5JHFA 1MSFC 1X1BA 3F21A 5HNFA 2IS6A 3WU0A 2W00A 4HLXA 5ERIA 5GTHC 3K4MA 1GDTA 4IOCF 2CW0F 4BNCA 3S3OA 3BG7A 1K78A 2ECCA 1ENHA 2B7EA 4ESFA 3DBHB 4IO9F 3O8GA 3KYLA 1P4AA 3Q0VA 2Z99A 5EGOB 2QZ8A 2XIGA 1SFKA 2YSRA 4G6TB 4IHWA 1FNNA 4FE7A 4L9TA 3FXUA 4IHSA 2JRMA 5ILSA 3QQAA 5EG0B 1ON2A 1Z9CA 5KK1A 1TQMA 1RR8C 3ZMTA 2XGEA 1NG7A 3TO7A 2LKPA 3RJPA 2MFZA 1OR7A 1X1AA 3HOSA 1X4OA 1N78A 3BR0A 1L3LA 2ZJQF 2EV6A 2FA5A 2HGCA 2CW8A 1FYKA 4IJAA 1IRXA 3LWFA 3OYIA 2ZJPF 1DP3A 3ABTA 2HXIA 3FF5A 3VSKA 4IHYA 3BG5A 2XB0X 5FFXA 3DXJF 1QPMA 2IEKA 2F5CA 2KIUA 3WTUC 4G12A 2PJRA 5E3OA 1U8RA 1TC3C 2V7FA 1VQKI 4LK0F 1JJ6C 1R00A 4YFKF 3OYMA 3HUGB 3OYBA 4DYQA 3TW6A 2IW5A 2EFWA 2KRHA 2JWTA 4C2TA 4IRGA 2ZSIB 1J9IA 1OYWA 5FLVA 2LYCA 4RLQA 4RB1A 4E7LA 3GUDA 3TO6A 5B66C 3TP3A 5HNHA 2VOOA 1OCPA 5ED4A 2XKOA 2QQ9A 5FKOA 1FMWA 5FROA 3E3VA 3KEYA 3HM5A 4E6KG 2HTJA 1ZLKA 2ZXWH 2XVCA 3C18A 3H92A 3CDIA 3DPLC 2Q8KA 4ENMA 1BR1A 4A0ZA 1BC8C 3IV5A 3CMEI 1O3RA 5CJ9A 3MZ8A 2CU7A 1BI1A 2ICWG 2IVMA 2KFDA 3H3ZA 4U0YA 1A35A 3E1SA 3GZNB 4Z2YA 3I59A 1U9NA 4ESBA 2OZ6A 2NNNA 4XKWA 1O4XA 1MGTA 2X51A 1A31A 1K79A 3LSTA 3ZQCA 2VQCA 3RZOJ 4E7JA 3J7AY 3CP2A 4XKVA 4ZDPA 2HYGD 1FIPA 1VNDA 3ZMDA 4BY1J 1IN5A 3WG9A 2RKHA 4F55A 4E4HA 1WH5A 1C0WA 4M3GA 5KCMA 1Z6RA 3WTXC 5IYDJ 5M3MJ 4P5OA 1P4WA 3EPZA 2G7HA 2DOAA 4LFUA 1HBXG 4EQQA 2EIMH 4HRIA 1L0OC 2CV0A 3WGHA 4NC6A 2E35A 4AVPA 5IOZA 3FM5A 1KQ8A 2V1NA 1RPWA 1WGXA 3RQIA 1XG1A 1JT0A 3V42A 4F7ZA 5IP7J 1GV5A 3GTLJ 1IDZA 3D5RC 1LDJA 4C3JJ 1MJBA 2QF7A 2XGCA 1AKHA 3HDDA 2X6OA 3JCUC 3JTHA 3VDXA 1B9NA 5FKMA 4HV6A 2DLLA 2HEOA 3ZQIA 4I6ZA 5IP9J 1H88C 4JYKA 3HRUA 3ROUA 2EA2A 2COBA 2E7WA 2CFXA 2OTJI 2WV1A 1SVLA 2FSWA 1RR7A 1FSHA 2L54A 2D2WA 2LK2A 4ZYHA 5FO5A 5H6RA 2R7VA 1FT9A 3MMYB 4D0PA 5IOYA 2Y30A 3P9KA 3J7ZI 3CLOA 4AIKA 2M0CA 4RM3A 1W0UA 1B6AA 1ETYA 3I59B 4E70A 1I50J 4LLGF 3SYTA 3AAFA 3I64A 3T0YA 4BE2A 2XRNA 2LVSA 2G7UA 3LSGA 4MIMA 3SZTA 3A02A 4HW0A 3LL7A 1QQIA 3KP3A 4MQ9F 4GDFA 3ZOBA 1JGSA 3OL3A 4IRHA 3L7WA 1HA8A 2HXOA 2ZBKA 1GXPA 5FKNA 2L5QA 5E20A 2HR3A 4UB6C 4NHJA 2Z9OA 3EUKL 1ZG5A 1UHMA 3G1LA 4I98B 3GXOA 2QKMB 4KISA 4PFPA 4U0WA 1KZHA 3JSPA 4BJ5C 4IPAA 3BWGA 4O5VA 2HQRA 3LAPA 3CTAA 4BQAA 3J80Z 2VXDA 1R71A 2P5VA 3OL4A 5E1ZB 1XSDA 3GLLA 3MN2A 4CCNA 4XLCA 2O61A 2QM3A 4RB0A 4IRIA 3Q5FA 1EH8A 3RPUD 1HCRA 2EPFA 2ZCWA 4EGZA 1GVDA 4ITVA 2HDWA 5IT9K 3HRTA 4G6QA 3IRRA 1F4KA 1R4MB 4BUPA 1XPXA 5E3MA 2EFOA 2WY7Q 2PLYA 1VQMI 3QU6A 1U6GA 4B3AA 3C2GA 1CQTA 4NBQA 2HWVA 1AKHB 2ETHA 1KA8A 1BN5A 2RVCA 1KU7A 4FHTA 1U5TA 2DA4A 4HZFA 3GCMA 4IVNA 4PK4A 3F9KA 4M74A 2PMZN 4BJTA 1YHQI 1GT0C 2E1CA 4AU7A 1TT0A 5LHGA 1X58A 1YW7A 3HJEA 1ETKA 2L0KA 2GAUA 4J01A 1RNLA 2DFEA 2IBDA 4KJZA 1FZPB 4ZYDA 3KPHA 2PFBA 3E6MA 1SFEA 4LD5A 3KFWX 5M3FJ 1WWXA 1E3PA 3R0AA 5HDNA 3GTJJ 2GQQA 1H89C 2PBIA 3QPLA 1JTXA 2KT0A 1CF7B 3H1CA 4PFOA 4HYEA 3KZYA 4AC0A 1SVMA 2BEOA 3GMEA 1TP4A 2WB1A 1P2FA 4CYCA 4BJ6C 2FRHA 3ZMUA 4QPQA 4BGDA 1DQUA 4RA2A 2XAQA 1E0EA 2R7WA 2P6SA 2Q1ZB 3ELKA 2ZFWA 3J7YJ 4P9UA 5F1JA 2FOWA 5F27A 4OAZA 1ZTRA 3GLXA 1QPIA 1GHCA 4IEJA 1Q1HA 2HU9A 2BY0A 3TP0A 3DWLE 2RC4A 1PP7U 1FMVA 1BR4A 1KU9A 3RSNA 4XSXF 2KP6A 2JPBA 4LLLA 1ZGAA 1QZEA 1ZARA 5EJCA 3CP8A 4CCKA 3CCMI 1IG7A 2LFBA 3VYSB 2XDVA 4GYIA 1G4DA 1BL0A 2CWEA 1Z3YA 4WF2A 3OYJA 2VI6A 3HXLA 2DDBA 4E7KA 1SAUA 1X2MA 4J00A 4AVZA 4D5CA 4O3MA 2R7SA 2JTVA 1YI2I 1T38A 1R36A 3PM1A 4DNCA 4A5MA 4XOPA 4BBSJ 1LQ1A 2MLGA 4B8XA 2O7OA 3N4MA 1DU0A 5CVRA 1RESA 5DCMB 4ON0A 4A3LJ 3BY6A 2HDDA 1DUXC 1HKQA 3TQNA 1K6YA 2ZSHB 3AL0B 1IW7F 3ZMSA 3F8CA 1KU3A 3F22A 2A6TA 1A36A 2R7DA 4V2GA 1RUOA 1U5TC 1WJAA 4BE0A 4HA8A 2L7ZA 1LVKA 1R1TA 3V8KA 4RAGA 5J1YA 3WG7H 5GAHJ 1MMGA 2DMPA 2QGUA 3WU1B 3F8FA 2NVUB 3L1PA 1VQ7I 1UELB 3F6VA 4GYGA 1UCRA 1ERDA 4RB3C 3K4LA 4QWQA 5K7FA 2H27A 1BW5A 4AYBA 2BE5F 4XQFA 4WWCA 1IUYA 3DKXA 2EV5A 4NQWA 2JMWA 3GFJA 4L18B 4P1WA 1R58A 3TL4X 4B09A 2MGQA 2M30A 2CUFA 2D1HA 4PDKA 1MIJA 3LSRA 3L09A 2AQFA 2A3SA 2EZHA 5EYRA 3WTYC 5HDGA 2XUBA 4IQJA 2V79A 1ZLJA 3OYLA 2JRTA 3SQNA 4XONA 3ASOH 4XRSA 2C6YA 3JTGA 3I4PA 4CDGA 4MFEA 2M7BA 4IOAF 3HC7A 4S05A 2LKXA 3FIWA 4GFBA 4I99C 4OU0A 4E7HA 4BQOA 3OYDA 2ACJA 4M9SA 2WV0A 1YIOA 5D5WB 3F8NA 2NS0A 3MWMA 4JBAA 1QHHD 2DA6A 1OCTC 4LG0A 3A2KA 3S1RJ 5GADJ 3K1PA 1FBQA 3ZP5A 5E1XA 2WB1N 2VJ4A 1I1GA 3PFYA 1I39A 3ERMA 1ZQ3P 5AIPA 3LNQA 3HOWJ 3BCAA 4DIQA 2IGKA 4LB5A 4XKCA 1MH3A 4HQMA 1BA5A 2LY2A 1W7PA 4M3DA 3FXQA 2DI3A 2DMUA 1I27A 2M4GA 3S1MJ 2X6XA 2WTEA 4UV8A 5C4XJ 4M3BA 3JRBA 3RCOA 2VE8A 5DM7F 5JLWA 1UAAA 1XCVA 1MNDA 5DV5A 3K4KA 4LOCA 1W36C 1T0FA 1BIBA 1IXRC 2PQ8A 2M3AA 2E60A 3BT9A 1FBSA 4CZZA 3D5SC 2DOEA 2CUJA 3QWLA 2DYRH 5F0CA 1RC9A 3FBIB 4RAFA 4XKBA 1VQNI 4DBQA 1XX5A 2QSHX 3ABKH 2Y31A 2YUSA 1S29A 3P9IA 2P5LC 4D1QA 2NRAC 1IXCA 1WHUA 4XLEA 1IDYA 1ODDA 3RKWA 1UB9A 2OF7A 2QSFX 3JAMK 2VJ5A 4FE4A 4HDVA 2Y9ZA 1TL8A 2ZKZA 2M87A 3DKWA 3HTUA 2WBMA 1SD6A 5CVVA 1YE9A 2DCEA 3W6JB 1FY7A 4KICA 3BG9A 5TGTA 2XC7A 2CH0A 1FP2A 2V9KA 2X9DA 3JRIA 3QYEA 3I4MJ 1J2XA 1U78A 2F4IA 2CSOA 3WTZA 2XKPA 5CQGA 3CCEI 3OYNA 1PUEE 5HDKA 3IH2A 2CYYA 2MD5A 4D7NA 3I4NJ 1JTYA 4X6AJ 4XRMA 4W1UA 1WRJA 1LEAA 2H09A 2XPWA 5L3CA 1Q1VA 2K85A 2BY3A 5CYVA 2COMA 1T98A 4L9VA 5LEKA 1TTYA 3TOBA 3ZQFA 2H1KA 4KITB 3K7AJ 4LIVA 1Z0XA 3OYAA 3G2BA 3MD2A 5E3LA 1APLC 3TDZC 3NRVA 2ZO4A 4CHUA 4EJTA 2KRCA 3I58A 2I10A 2M8EA 2KHMA 1IN8A 2FBKA 1AA7A 3GF2A 1MMSA 4L0ZB 1TW3A 3K1NA 4N4OB 3IL2A 1JGGA 1B1BA 4D9JA 3QYFA 3PUFA 5LD2C 2DXIA 3FWEA 1O7LA 3VWBA 1LNWA 1Y56A 2MBFA 4BBRJ 2WAQN 3K4CA 3EQLF 3V7CA 4F92B 1I1SA 2VKDA 2PMUA 4ETSA 3PIPF 1Y0UA 1K4TA 3KZIC 3VYUB 2HDCA 3VYRB 3OSGA 2E2IJ 4RS8A 2A6EF 5K1YA 2FMLA 3A03A 3T1BA 2GXAA 4IHTA 4BEHB 3WE3A 2PMHA 4C2MJ 5GAEJ 2DA5A 3BG3A 4MQVA 3GX4X 3UNGC 4PJLA 1YO5C 4I09A 4BQQA 3H3VK 1D8JA 3M8JA 1KGSA 1ZRCA 2DO7A 3S16J 1SFOJ 3E6BA 5F04A 2IGNA 3E97A 3GEZA 3WTTC 1Y39A 4HSRA 1KYZA 4CA0A 4A6DA 5JHUA 4W97A 1MBKA 5LHIA 4A0XA 1JHHA 4V2FA 1FP1D 2RN7A 3L9FA 2B9SA 1VI0A 4YRVA 3FXJA 3SHFA 1P92A 4KFCA 2JSPA 1NHAA 1ZR4A 2YPRA 2R3SA 2XHKA 2AS5F 4A69C 2K27A 4PUSA 3G4SI 1FIAA 2DTZA 1MMAA 3LAJA 3WHCA 2JUCA 3U2RA 2DPUA 4IL6C 4M73A 3WGGA 3PFIA 4XLFA 2VKHA 2A05A 1X1CA 3PSFA 2AO9A 3K2ZA 4D5FA 4DYRA 5DD4A 2JSCA 2RQPA 3DCFA 1S6LA 4FISA 5EDNA 3CMMA 4ZTFA 2IA0A 2A68F 2OZUA 1X2NA 3RI4A 1NG6A 4G8XA 3LMMA 4OMZA 3K70D 3BZ6A 3ONQA 3CO6C 3GBGA 3HSRA 2PX9A 3GFIA 3ECOA 1VQ6I 1ZHFA 2FU4A 2EBIA 3GYHX 4A5NA 2OA4A 3R61A 2HNHA 3CCQI 2L9SA 2KKOA 4XRSG 1ON1A 1TWHJ 1YW8A 2OCCH 1H0MA 3ML6A 4YFXF 1RETA 1D1CA 3KEQA 4Y52J 4AIHA 1YOVB 3GTQJ 4L5EA 4B1RA 5HLGA 4HF2A 2PI0A 5DCFA 2DFIA 1KU2A 1RKWA 2VB6A 4HLYA 4LMYA 2ZFUA 3DTEA 5HLHA 4PSWA 1ZGWA 3K4JA 5A2QK 3M4OJ 1YLFA 4XM3A 2W84A 4HNUA 2E71A 5FRNA 4U88A 1UG2A 4UUVA 3S2DJ 2Z5UA 1AWCA 2OTLI 3ECHA 3S17J 4XL9A 2EFPA 2MH2A 2Q0OA 1W4MA 2VBWA 2R5YA 4H4KC 4BL0B 2F6CA 1YQAA 4OINF 3I56I 2R7TA 3IP4B 2Y9YA 3FHNA 3DU5A 1FYLA 2V26A 4CCMA 2DU9A 2A61A 1X1PA 3CCLI 2LDUA 2QEXI 1V5FA 3HZJA 2QUFA 5FFZA 4E7ZA 3CUOA 5CQEA 3OWTA 1K78B 3H9JA 4A6EA 2EZIA 2LNBA 2F5DA 2CV1A 2ESHA 4MTDA 4FT8A 1G2HA 1YS6A 2O9LA 2M5WA 2ZMEC 5ILUA 1RIOH 2W24A 3HGGA 1Z77A 3GO5A 1K7AA 4CO8A 3M7GA 2E36A 4U7DA 2ESNA 2KJCA 1YX5A 5HVQC 4Y7NJ 1XGMA 3K10A 3JRCA 3OIOA 4A3DJ 3TEDA 2X1DA 3OR1C 4XR6A 5BNGA 2CO5A 4MNUA 4DGWB 3QP5A 3GZ6A 4RDUA 3A1YA 3H9GA 2DJNA 2W85A 1Z7LA 1J7KA 2PMZA 3K4NA 4N9HA 3OR2C 3SFIA 1Y0NA 1FOXA 2DMNA 2ECBA 1G3TA 1GLNA 4QSHA 3CCVI 4A3JJ 3SEZA 3UKGA 2OPTA 4LJZF 3WTWC 3J81K 1B72A 1ETXA 2AQEA 1JE8A 1T95A 5IP6A 3NWTA 4HX7A 3C2HA 5KVRA 2DBBA 2HFHA 3H36A 1YJNI 2ELHA 3KX2A 5LLQA 2PJRB 5IT9Z 2M8GX 4NC8A 2MLKA 1X19A 1DGRM 4DQ2A 4HPQA 4DZPA 3PQKA 3E5UA 2LBFA 2L9NA 1DU6A 4BDYA 2GM4A 2QA4I 4AM3A 1IC8A 3D5LA 2AHQA 3B73A 2XGXA 5LGTA 2UWMA 3C3WA 3Q0UA 4PZJA 4IKFA 4EM1A 1QVTA 1JUSA 2OBPA 2VIXA 1OJLA 2KDOA 3LFUA 2CV2A 1Z05A 4XN0A 4M9ZA 3REOA 5J1UA 3ABUA 1D0YA 2R7QA 3JR9A 2X4HA 3K4BA 4EVIA 3G71I 5J8FA 1HDPA 1IUFA 4A93J 3QU3A 4BS9A 5BPIA 1JKRC 1B9MA 2OV7A 3QYBA 1M1EB 2JA5J 3SDBA 1YS7A 3CJQB 3I71A 1R5HA 3BTIA 3R4KA 4I7HA 1R9TJ 1NK3P 4KDPA 3HPHA 4UXNA 4BHPA 1V54H 3LSPA 4HDUA 1P7IA 3VOEA 9ANTA 3ZQ7A 4I01A 4XNFA 2Y48A 3NWSA 4CH7A 3K6GA 3BR6A 5DUIA 3S3NA 5HLIA 2XF6A 3WHBA 1S72I 2K7LA 3ZQLA 3S15J 1JUPA 2WY8Q 2IPQX 5TISC 2W48A 2IAIA 1SVOA 3LSHA 3KP4A 1Y6IA 2VBYA 4ZC3A 3SFZA 1ZYRF 1O3QA 3SZGA 2KZGA 3I53A 2P7CB 1XDSA 1LJ9A 5D6EA 3V7RA 4QTRA 1XDUA 5GAGJ 1IV6A 1BIAA 1W1WE 4Y13A 2X6WA 3F8MA 1TNSA 3DP7A 3CDLA 3CDHA 2K5CA 3F6OA 3GFMA 1X3WB 3N97A 4EEFG 1F1ZA 3TOAA 2ELJA 2IA2A 1VQLI 1OCCH 2GZWA 2K9QA 3PNTA 3ZRGA 3HRMA 4PGGA 2R0QC 2NNYA 2HOSA 2K02A 3JRDA 4XMYA 4G6DA 2CFOA 2W25A 2MD0A 3DV8A 3WTVC 3IC7A 4A12A 2ZNZA 3RTRA 2HYFA 3ZXSA 1RRJA 3JRHA 2BVLA 3WTSC 1G6NA 3WE2A 1G59A 4EJVA 2R7RA 1G3YA 5B1BH 4BHBA 5GPAA 4A0YA 4PSXA 1HKSA 3FXKA 3RKXA 1IRFA 3HRSA 3T8RA 4Q47A 1R1VA 4D7MA 3PIOF 1F9NA 3GWZA 5M5WJ 2HVSA 2H94A 2J5OA 2XAHA 3ULQB 4KMFA 3A01A 3TGNA 2N8GA 1IV8A 2XRLA 2J5PA 5FGMA 1IXSB 2CQNA 4BHCA 1HW5A 2HKOA 3BZCA 3LSMA 1EKEA 1YW9A 3I5UA 2DYSH 1FSEA 5BS6A 3ZQGA 5DDGA 3LQRA 4HNTA 4EATA 2L9VA 1LUJB 2IS2A 4Y3OA 5DEQA 4Y15A 4AWXB 2QCOA 2LD5A 3DEWA 4HBLA 1Z6TA 4JOMA 1UJ8A 2GOXB 3RPUA 5BQTA 2E2JJ 1T2KA 3AFHA 1ORKA 5H20A 1IN7A 2LF7A 1ETQA 3IKTA 2L7MP 3QPHA 1OLTA 5GPCA 2HI3A 3FXOA 5L3EA 1KQ9A 4S0HB 2K9MA 1G3WA 1I3QJ 1JUMA 4C2UA 2H6CA 3PSIA 4AIDA 1W5CC 2XGDA 2QBYA 2P81A 2KZVA 1VFCA 2O3FA 3DQVC 3BR3A 4TV7A 1R23A 2H6BA 1PP8F 3BP8A 2W82A 2ZJRF 2DAOA 1ZREA 2FQ3A 5D6FA 3SDGA 1TW2A 5EEAA 4PCQA 2EV0A 3PQJA 2ZXJA 2BOLA 1FJLA 5F0FA 1TWCJ 4BU2A 5HLTA 1BR2A 1D0ZA 3FX3A 4XOTA 1GV2A 3W6KB 5D5UB 3TW7A 1V4RA 1HW1A 1U5TB 2O0YA 4KA4A 4CYDA 3LSJA 1WFXA 1BJZA 2DODA 4WCGA 1UHWA 2EZKA 3ASNH 1IGNA 2EFQA 3D0SA 4MEXF 2P5KA 3QAHA 1F43A 3JRGA 3VODA 1BI3A 1PJRA 2L7KA 5L3GA 3IAS2 1QRYA 1AOYA 1IO2A 1T8IA 1U8BA 5ILVA 2VPRA 1LKXA 2DT6A 3KP6A 3GTKJ 2RAEA 3A01B 2OU2A 2VN2A 5FD5A 3ABMH 4M71A 1D3YA 3HOUJ 5F64A 3ZPLA 1ZN2A 4YIRX 1D5VA 2O6GE 5E1WA 1ZG3A 2B63J 4ESJA 4PJJA 1MH4A 1RI7A 2HOAA 1R49A 3HBLA 3DLAA 3W2VA 1VQPI 2ZB9A 1ZGJA 1V55H 3DFGA 3C2BA 4CYCB 1XS9A 3RQ4A 3H5RA 3HKZN 1TQPA 1Y1VJ 3OY9A 4RMNA 4IQ4A 1DP7P 3G1MA 1IJWC 1MSEC 1SEUA 3CJTB 4AIJA 1LFPA 1Z21A 1MBJA 2IGOA 2GLOA 3JAMZ 3DBLB 3A4CA 2DT5A 2QBYB 3CC4I 3S1NJ 1ETOA 2HVQA 2L4AA 3ZQHA 3AL0C 2DN0A 2UUZA 4A3MJ 5BMZA 4R8HA 4F93B 1R5GA 2X85A 2L01A 3K9TA 1X3ZB 4HF1A 2I5UA 2FJ1A 3CJNA 3FXMA 2WAQA 2QQBA 2XB5A 2LLKA 2UV1A 3L2UA 3NQOA 2BHZA 2R7FA 2VT3A 3FM3A 2FX0A 5GP9A 1TWGJ 2JK3A 2LKSA 5HODA 1KQ0A 1ZKGA 1YJWI 2DK8A 2M9HA 5K7HA 1D1BA 1YRNA 3OOPA 1WJCA 2JT1A 3CD6I 3BQYA 4EJWA 1R22A 2ZXIA 4DOZA 1S3JA 3CCYA 4IX7A 2E1MB 4FETA 5FLMJ 3L2RA 4HQEA 2IXSA 2BXYA 1X4PA 3L2QA 2FE3A 4CZCA 3I54A 4RM2A 1ITYA 1IZ1A 3LA7A 1REPC 4Q48A 4RGXA 4LB6B 2HZDA 3F72A 2K40A 1LB2A 3GTGJ 4BH9A 5LBQA 4KT6A 2O8KA 1AHDP 5E3NA 4KN7X 4XICA 4B47A 2KDZA 1OPCA 2NOJB 4A3CJ 2JA7J 2Y75A 1J5YA 2L02A 1RUNA 3L2CA 4BXXJ 3RPQA 1V5GA 1MDMA 5JLXA 4FX4A 4L5IA 1FBUA 3BR2A 3RKQA 1QBJA 2DFHA 1HQCA 1SANA 2QVOA 3BTLA 4Y17A 3HOTA 4LK1F 4UB8C 1E3OC 1A04A 3BPVA 1BM9A 3U1DA 3OOUA 2DA2A 2OAZA 4NQWB 5H6QA 3QODA 3R0JA 3OIQA 5JR3A 1IN6A 4KIGA 2JVHA 1TZLA 3FMSA 5HS8A 3SJMA 3FHZA 1BI2A 1GVJA 2ZJ2A 1DDNA 2V1UA 3SXYA 4A3FJ 1SC7A 4B48A 4CCLA 1B59A 1A6IA 2LTPA 2V1DA 3CUQC 3ESWB 3R60A 5HS7A 1OISA 4DZJA 5C4JJ 3F8BA 4A3EJ 2MSYA 2V4JC 3CLQA 4K2EA 2O8XA 3OYEA 3MKYB 2ID3A 2NYXA 3GZ5A 4R1HA 1OKRA 4UUSA 2GA1A 3WODF 1FC3A 3ZN0A 2QWWA 2VXZA 2M7AA 3OIPA 1J59A 2VONA 4L0YB 3AKZA 4XSZF 2XAJA 1UG0A 3BJ6A 1YYVA 4BKXA 2FEZA 2ZXHA 4LG0B 3OSFA 4AD9A 2FNAA 3F3XA 3Q3SA 2AXLA 3G73A 2JUGA 2PN6A 1HXDA 1XMAA 1B8IA 3ZR8X 1YRNB 4L9JA 1BBYA 2YU9J 1IAWA 5K7ZA 2WAFA 1EH6A 3FBNB 2UXXA 4FTHA 2CW7A 3JW4A 4ZJZA 1QZZA 1PDNC 1IRGA 1W7PB 4AUXA 3PL8A 3O2PE 5LGUA 1U0JA 3FDYA 3IWFA 1LPQA 5JI6A 1V3FA 5KAIC 2GBYA 4RAZA 2LY1A 4PJNA 1T6SA 3Q9SA 3EDPA 4OMYA 2V9PA 1T33A 1ZAOA 4EV0A 2ZC2A 4M72A 2NVYJ 1MDMB 2KMUA 3S2HJ 3O8HA 2R7ZJ 2XSDC 2RQQA 4A3KJ 1S9HA 4C3IJ 2F2EA 4F91B 1G3SA 1HW2A 3K69A 1R1UA 4ZTJA 4LLNA 3L2WA 3N05A 2WADA 4BQNA 1H9TA 2L3DA 2XSJC 2DA7A 2DT7B 2IP2A 4GXOA 5F1RA 4UUTA 3CQZJ 2GIVA 2LMDA
chains in the Genus database with same CATH topology
5HVQC 2Z1DA 4U7BA 3K10A 4PK4A 2X1DA 3OR1C 4XR6A 2R7UA 3F9KA 4DGWB 5KNLA 4BJTA 3A1YA 3H9GA 4AU7A 2JVGA 1N75A 1TT0A 1Z7LA 2PMZA 2VL8A 3K4NA 1YX3A 3OR2C 4YELA 4J01A 1GLNA 4KJZA 2RNGA 3SEZA 4MLOA 4IZZA 3CZ6A 3S93A 3IUOA 3VSLA 1KONA 2R7XA 2AQEA 1T95A 3NWTA 3C2HA 3EUAA 4PFOA 3OYFA 1N77A 2WB1A 3KX2A 2MABA 3DTKA 4BJ6C 2PJRB 4NC8A 1X19A 1DGRM 4QPQA 4BGDA 1DQUA 2X6YA 4HPQA 4LG3A 4R79A 3H5AA 1E0EA 2LBFA 2L9NA 2R7WA 4F52A 2Q1ZB 4BDYA 2VLAA 4XLHA 3D5LA 5LFAA 2Y0SA 4OAZA 3ZCOA 2JA2A 1X1DA 2UWMA 3OYGA 2HU9A 4IKFA 3DWLE 1FMVA 2V6EA 2VIXA 1BR4A 3RSNA 2KDOA 3LFUA 2CV2A 2KP6A 4XN0A 2VQGA 1D0YA 2R7QA 2VQLA 2E1MC 3K4BA 3CP8A 4CCKA 3HPGA 4B43A 3VYSB 3OS2A 1D0XA 2KL4A 5CKTA 2XDVA 4BS9A 2KPMA 2OV7A 1Z3YA 3QYBA 3W2AA 3CF2A 3SDBA 3CJQB 2Z2SB 1MMNA 3OYJA 4Y33A 4OWRB 3BCBA 3HXLA 3HPHA 4E7KA 1SAUA 4J00A 2IS4A 4C9YA 2LOOA 4XNFA 4AVZA 1PYVA 2R7SA 4BEHA 3NWSA 4PJMA 4CH7A 3K6GA 1EA3A 3TMOA 4CCOA 2XF5A 3S3NA 2XF6A 4XOPA 2A5WA 2WY8Q 2W4SA 3TBIA 2MC4A 4XLAA 4GRIA 1K6YA 2ZSHB 3LSHA 1Y6IA 4ZC3A 3AL0B 4ZYAA 3SZGA 2OUMA 2A6TA 2R4GA 1MMDA 2BVMA 4CCJA 1WJAA 2X6WA 4BE0A 2BW3A 1LVKA 2K5CA 4CUGA 2VPLA 2K9LA 4E7SA 2MYSA 1MMGA 2VJIA 1UELB 3DTIA 2ELJA 4LITA 1ERDA 3VYTB 3K4LA 3ZRGA 3PNTA 3ZQQA 2QKLB 4AYBA 2E5ZA 4XQFA 4Y4RA 3L2VA 4C30A 2KQRA 4OAYA 2K3PA 3DKXA 4P1WA 3TL4X 4XMYA 1QU3A 1QHGA 2CFOA 2MD0A 1D1AA 2X1CA 4BE1A 2AQFA 3RTRA 3ZXSA 3DU6A 3S8PA 2BVLA 2LC2A 4FASD 3EUHC 3OS0A 1G59A 4IQJA 5KHDA 2R7RA 2LH9A 3OYLA 2LRDA 2WA0A 4XONA 1WJ5A 4PSXA 1LDKB 4JQFA 2M7BA 2DJIA 3HC7A 4E7HA 3OMYA 4II2A 4BQOA 2HVSA 3OYDA 2E5NA 4BDZA 1QHHD 2FUG2 3A2KA 1JI8A 3BC8A 2R7OA 1WJDA 3LSMA 3MKZA 4F3QA 1T0FC 3BLYA 2HPMA 2KLOA 4HNTA 4EATA 3DPUA 2VJ4A 3PFYA 2IS2A 4Y3OA 3DKYA 2X1EA 4N4NB 3BCAA 2L2OA 4DIQA 2IGKA 4XKCA 4JOMA 4NUBA 2GOXB 2LY2A 3QOEA 4B44A 3AFHA 1VZ0A 1G8XA 2Q2EB 2M0MA 1MNEA 2IGMA 1OLTA 2M4GA 3I3LA 4ZDLA 3W2WA 2X6XA 2LREA 2K9MA 4C2UA 5JHFA 1X1BA 3PSIA 5HNFA 2IS6A 2W00A 3RCOA 2BW3B 1UAAA 3K4MA 2P0WA 1MNDA 2CS3A 3K4KA 1P9QC 4YEJA 2KZVA 1W36C 3M1CA 3DQVC 1OR7C 3BG7A 3S3OA 2M3AA 2W1OA 2E60A 2W82A 3PJRA 3D5SC 3KYLA 2CUJA 1BOBA 3H0DA 3DPTA 2M4KA 3HL2A 2VASA 3FBIB 2BOLA 2O5RA 1SFKA 4XKBA 4BU2A 4DBQA 4G6TB 5HLTA 1BR2A 1D0ZA 4XOTA 4D1QA 2VJJA 3OYCA 1MW7A 3CESA 4XLEA 4BXFA 3K70C 1WFXA 2VQHA 1NG7A 2VJ5A 4II3A 3OYHA 2MFZA 1X1AA 3HOSA 1PJRA 1X4OA 2L7KA 3IAS2 4DBRA 1N78A 2WBMA 3PNVA 4DJAA 1LKXA 2DT6A 1YE9A 2CW8A 2DCEA 5TGTA 2XC7A 1IRXA 1DP3A 3OYIA 2CH0A 2V9KA 3W3CA 1WJFA 3QYEA 3VSKA 2F4IA 4PJJA 2PJRA 5CQGA 2V7FA 3OYNA 3H9QA 3ZGKA 3DLAA 3W2VA 3H35A 3OYMA 2GOMA 3HUGB 3OYBA 4ZDOA 3RQ4A 2KRHA 2WAEA 3H5RA 3LSKA 4C2TA 2ZSIB 2LBFB 5CPRB 3OY9A 4RMNA 4IQ4A 3BG6A 4LIUA 3HKZA 2LYCA 4RLQA 1LFPA 4E7LA 1Z21A 2IGOA 4KITB 4B3XA 4LIVA 3OYAA 4XN3A 2CUZA 3G2BA 3MD2A 3A4CA 4HG2A 5HNHA 5HOOA 2IS1A 2KRCA 1FMWA 5FROA 3KEYA 2KHMA 1AA7A 2HVQA 3AL0C 4E6KG 2UUZA 4N4OB 2LG4A 2HQAA 3H5NA 3DPLC 3OS1A 4D9JA 1BR1A 3QYFA 4F93B 5LD2C 2DXIA 2X85A 3VWBA 4ANJA 3S3MA 1Y56A 4F92B 3K4CA 2Z16A 3E0JB 2OC6A 2F5VA 2VKDA 3E1SA 2WAQA 1ZELA 4XKWA 2UV1A 3VYUB 3L2UA 3VYRB 4X0GA 2X51A 2VQCA 4E7JA 4BEHB 3J7AY 4E7IA 3S32A 3CP2A 1D1BA 4HEA2 2HVRA 4XKVA 4ZDPA 1WJCA 3UNGC 2ZXIA 4PJLA 4DOZA 4F55A 4E4HA 4BQQA 4NNJA 2E1MB 4FETA 3M8JA 3L2RA 4IX7A 5KCMA 3U21A 2IXSA 3L2QA 1X4PA 4P5OA 3EPZA 4CZCA 4RM2A 2DOAA 1Z3XA 4HRIA 2HZDA 2IGNA 2CV0A 4HSRA 4KT6A 4CA0A 4B47A 2NOJB 1W36D 4YRVA 1V5GA 2V1NA 2JSPA 3I9V2 3PUBA 3V42A 4XORA 4PUSA 3HOTA 1MMAA 3D5RC 4HSTA 3OOUA 4XLFA 2VKHA 1X1CA 4NQWB 3PSFA 3QODA 3OIQA 3HG9A 3IAM2 3VDXA 2RREA 2JVHA 1TZLA 4ZTFA 3CMMA 4BACA 1NG6A 3LMMA 1J09A 4RLFA 4B48A 4CCLA 3K70D 4QPOA 3ONQA 3GBGA 2V4JC 4U87A 3OYEA 2HNHA 3MKYB 2CMPA 2L9SA 3DEEA 2R7VA 1V5EA 3MMYB 1DGWY 2VXZA 2M7AA 3OIPA 3LSIA 3AKZA 4RM3A 1D1CA 1UG0A 2W7NA 2ZXHA 3SYTA 4BE2A 2VB6A 3LSGA 2ZFUA 3DTEA 4PSWA 2JUGA 3SEQA 3K4JA 3LL7A 4XM3A 3ZR8X 3OL3A 4HNUA 3OYKA 5FRNA 1HA8A 2WAFA 3FBNB 2L5QA 2CW7A 5FRMA 4ZJZA 4XL9A 3EUKL 3PL8A 1R6RA 1U0JA 2QKMB 3FDYA 4H4KC 4BL0B 4KISA 4PFPA 2F6CA 2R7TA 2XAUA 3IP4B 3FHNA 4BJ5C 3DU5A 2LY1A 4PJNA 2V26A 4CCMA 3MKWB 3CJRB 2VXDA 3OL4A 3PNYA 1V5FA 4CCNA 4XLCA 4E7ZA 1WJEA 2KMUA 3RPUD 5CQEA 1WJBA 3OWTA 2RQQA 1S9HA 3H9JA 4ITVA 2HDWA 3UR3C 4CSWA 2CV1A 4F91B 3FKJA 4BUPA 2HPIA 2XF7A 2WY7Q 4ZTJA 4NC7A 3L2WA 3C2GA 3N05A 2WADA 4BQNA 2XSJC 2DT7B 2I8DA 1YX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUG A; 
#chains in the Genus database with same CATH topology
 1MBG A;  3HOV J;  3HOX J;  2DDA A;  3LFK A;  5A2Q Z;  3E6C C;  1WPK A;  1WCM J;  1D5Y A;  1WZ2 A;  3MZH A;  1I5Z A;  1R4N B;  1SFX A;  5IY5 H;  3S1Q J;  2G0E A;  3MFK A;  1N75 A;  2M34 A;  5J4Y A;  4A2U A;  3IH4 A;  1WSU A;  1VQ8 I;  3AG2 H;  3QOP A;  2X0L A;  4UUS B;  1S5L C;  4YEL A;  1YIJ I;  1FTT A;  2HTS A;  4IZZ A;  3BR1 A;  3CZ6 A;  2ZME A;  4M3E A;  3GVA A;  1O3S A;  2F4M B;  4U0V A;  2PJP A;  4MO7 A;  5KAF C;  3MEX A;  5HS9 A;  1SMY F;  3OYF A;  1N77 A;  3IWZ A;  3HUG A;  4BY7 J;  2MAB A;  2DA3 A;  2H8W A;  4B4C A;  3M07 A;  3VFZ A;  2W57 A;  3O3K A;  4LG3 A;  2AXT C;  1VQ9 I;  2Y0S N;  4F52 A;  5D5V B;  1FX7 A;  2STW A;  3KYD B;  2VLA A;  2FMY A;  4RGU A;  3IRQ A;  5LFA A;  3ZCO A;  4M6X A;  2JA2 A;  3ZN1 A;  3EYI A;  2VOP A;  3OYG A;  1UMQ A;  1HSJ A;  4JX4 A;  3K2A A;  3VEP A;  2V6E A;  1QGP A;  4NB5 A;  3SZP A;  4UNO A;  1ULY A;  3E5Q A;  1O7F A;  3BDD A;  4ENK A;  1HST A;  3C1D A;  1FOY A;  2VQL A;  4P55 A;  1IF1 A;  1XGN A;  2RNJ A;  1D0X A;  2KL4 A;  5CKT A;  1TT5 B;  3M8E A;  2VKV A;  1QO0 D;  2VBX A;  3OS2 A;  4A3B J;  1Y1W J;  3CF2 A;  2Z2S B;  5B5E C;  4Y33 A;  5FLX Z;  3BCB A;  3VPR A;  5J1R A;  4MGR A;  3J81 Z;  4ASN A;  4EJU A;  2Z3Y A;  2MC3 A;  1AU7 A;  4EM0 B;  1PYV A;  2LSO A;  5BPD A;  4IHV A;  4PJM A;  4QIW N;  2KIM A;  4HF0 A;  1EA3 A;  5K5Q A;  2XF5 A;  3CCR I;  4UVB A;  1FYM A;  3FIS A;  4KYW A;  2M1B A;  5FKL A;  2BY1 A;  2RV8 A;  2R93 J;  2V9V A;  3MCZ A;  2BV6 A;  5EEG A;  3U9G A;  1IN4 A;  2P6T A;  1P4X A;  3TBI A;  4YFN F;  1CGP A;  1MD0 A;  2MC4 A;  3KLN A;  1R7J A;  4GRI A;  4HOB A;  2OJE D;  5DS9 A;  1OQY A;  2HQ5 A;  2Q2E A;  2TDX A;  4PGH A;  4ZH4 F;  2PEX A;  4ZYA A;  5CVJ A;  1JT6 A;  2FXA A;  1MMD A;  2R4G A;  3V8J A;  4MEY F;  2ZME B;  2R92 J;  2QYO A;  3R6S A;  2BW3 A;  2KRF A;  3HHG A;  1SAX A;  5M5X J;  3O6B B;  4CUG A;  4RBO A;  1QNT A;  1MJ9 A;  4E7S A;  4OIO F;  2VJI A;  1JXS A;  2NXN B;  3DTI A;  2DQL A;  2ME6 A;  4LIT A;  3D1N I;  1WVR A;  1K83 J;  2EIL H;  1GUU A;  3TO9 A;  5D5X B;  5J8C A;  3KIO A;  2FBI A;  2E5Z A;  4KIF A;  4Y4R A;  1XB4 A;  3L2V A;  2ADU A;  3F0C A;  3CC7 I;  2E1O A;  2YU3 A;  5DYM A;  3M1E A;  5C3E J;  1FLI A;  5F0H A;  2E7X A;  4IXA A;  1F5T A;  1IRZ A;  1QHG A;  2F48 A;  4O6J A;  1DPR A;  5LRS A;  3WU2 C;  3B6C A;  3S8P A;  4ENN A;  2LC2 A;  3HSE A;  1OYY A;  2R5Z A;  2F5E A;  1UHS A;  3S14 J;  2LRD A;  2DK5 A;  2WA0 A;  3FXL A;  4WXD A;  1TLH B;  3JSO A;  3M9A A;  4I02 A;  2G9W A;  1LDK B;  4JQF A;  2DJI A;  2ISY A;  2A07 F;  4GCV A;  2HKX A;  4UVA A;  3MKL A;  3GW2 A;  5D4R A;  1S7O A;  2E5N A;  1H8A C;  1PVE A;  5FB2 A;  3BC8 A;  2BXZ A;  1LFU P;  2ID6 A;  2R7O A;  3X2Q H;  1WJD A;  2H8R A;  5FLX K;  3FKI J;  3HSF A;  1XSX A;  5CVU A;  3NAU A;  3MKZ A;  2BHY A;  4F3Q A;  5J6X A;  2HPM A;  2KLO A;  2UZK A;  1XGO A;  3B02 A;  1MNM C;  2X1E A;  3I55 I;  5IYB J;  4N4N B;  2P8T A;  1VTN C;  2L2O A;  2RGV A;  4QLC U;  5E8G A;  1I6H J;  4FX0 A;  2KIF A;  1MBE A;  3FXR A;  3QOE A;  4B44 A;  3HOZ J;  3H0G J;  2EWN A;  2Q2E B;  3LA3 A;  1J75 A;  1MNE A;  5GTI C;  4XLN F;  3WGI A;  4HX8 A;  1GXQ A;  1HF0 A;  2ZNY A;  4A3I J;  1SD4 A;  4M9X A;  2R5Y B;  2NVT J;  3S2W A;  3IH3 A;  1S7A A;  2ME0 A;  2BW3 B;  4YG2 F;  2P0W A;  2IJL A;  2CS3 A;  3MZY A;  1P9Q C;  4YEJ A;  4L9N A;  3M1C A;  5J47 A;  2EFN A;  1OR7 C;  2V1X A;  3FK7 A;  1ZK8 A;  3HTS B;  1Y8R B;  2M2E A;  4HX4 A;  2W1O A;  2V6C A;  3PJR A;  3AG3 H;  1X3U A;  1BOB A;  3H0D A;  1U2W A;  3RDI A;  5D4S A;  2VC1 A;  2WC2 A;  3CO7 C;  3DPT A;  2M4K A;  2RDP A;  2VAS A;  3HL2 A;  4H0E A;  2O5R A;  1MBF A;  4KIB A;  3E5X A;  2FOK A;  1Y8Q B;  2Y2Z A;  3EYY A;  2BZT A;  1NTC A;  1ETV A;  2VJJ A;  1NK2 P;  1WI9 A;  2D1V A;  4XID A;  1O3T A;  3OYC A;  1W5T A;  1MW7 A;  3CES A;  1D8K A;  3QP6 A;  4BXF A;  2R5Z B;  1WH7 A;  5CVI A;  3K70 C;  4OIP F;  2VQH A;  4II3 A;  3TKY A;  3OYH A;  1W5S A;  1F36 A;  4I0A A;  4KN4 X;  3TDU C;  2MG4 A;  4DBR A;  2MW8 A;  3PNV A;  5ICF A;  4DJA A;  4WK8 F;  2XV4 S;  3NAR A;  2WWY A;  4KT5 C;  1JKO C;  2XPV A;  2JJ7 A;  4RB2 C;  2EIK H;  1I3A A;  4JX6 A;  1WJF A;  3W3C A;  1CF7 A;  3U1K A;  2P7V B;  4M3F A;  3CCJ I;  5M5Y J;  4V19 K;  4G7H F;  1B72 B;  1P6R A;  1VQ5 I;  2IT0 A;  3HGY A;  1FTZ A;  3H9Q A;  4FQG A;  3ZGK A;  2PG4 A;  4UVC A;  3H35 A;  2JQ7 A;  3FMQ A;  2GOM A;  2K4J A;  2VC0 A;  3M3Y J;  4ZDO A;  1MJA A;  2YR2 A;  3J7A O;  4XBF A;  2XAG A;  3LSK A;  2WAE A;  1MKM A;  1UZC A;  4BYY A;  3MAJ A;  1E2X A;  2LBF B;  5CPR B;  1RZ4 A;  3BG6 A;  1LVA A;  4LIU A;  4G7O F;  2HOT A;  3FMR A;  3HKZ A;  4NDL A;  1RKT A;  4LGW A;  2TRT A;  5IT3 A;  1NH3 A;  5DUK A;  2LR8 A;  4ZYE A;  1OCZ H;  1SD5 A;  4B3X A;  2JZY A;  4XN3 A;  2CUZ A;  4BAY A;  4HG2 A;  4J19 A;  2JPC A;  3ERE D;  5FJ8 J;  5HOO A;  3QRF F;  1YIT I;  1HLV A;  1JJ8 C;  2IS1 A;  2XRO A;  3T8T A;  2LG4 A;  4CIC A;  1STZ A;  2HQA A;  3H5N A;  2O03 A;  4EJO A;  2H1L A;  3OS1 A;  4FCY A;  3BJA A;  1XCB A;  4WXH A;  2CG4 A;  2K9S A;  4ANJ A;  3S3M A;  3KYC B;  2FD5 A;  2Z16 A;  3E0J B;  2OC6 A;  3KEO A;  4L5J A;  1U9O A;  2F5V A;  3G6E I;  4KNY A;  3ISP A;  2A6H F;  3EET A;  1ZEL A;  3L00 A;  4XLP F;  3BJO A;  4X0G A;  1XD7 A;  3KP2 A;  2A5Y B;  5ICE A;  4E7I A;  2HS5 A;  3S32 A;  5C44 J;  4EGY A;  2HVR A;  4HEA 2;  5DCM A;  2LY9 A;  3BR5 A;  3ZMZ A;  1XSV A;  2STT A;  2QEN A;  4CGZ A;  3DLL F;  2XAS A;  1LEB A;  4MFD A;  1A5J A;  5B3S H;  4NNJ A;  4XRF A;  3U21 A;  1TBX A;  3K1M A;  1Z3X A;  3QPS A;  4KMU X;  2X48 A;  3BOQ A;  4JP0 A;  3A0H C;  2FBH A;  5FD6 A;  4HAM A;  2HOE A;  3KET A;  4G7Z F;  2NVX J;  1TWA J;  1P7J A;  4DYC A;  4I0B A;  4N0B A;  1HKT A;  1W36 D;  1XGS A;  1DPU A;  2OQG A;  2DMT A;  2DOF A;  5EF6 A;  4ENJ A;  2LP0 A;  2Z33 A;  1POG A;  4C3H J;  3I9V 2;  3PUB A;  4JX5 A;  2CQK A;  2HZT A;  4XOR A;  3HOY J;  3DF8 A;  5L3D A;  3E7L A;  2Y0M A;  2DA1 A;  4HST A;  2CRG A;  4CXF A;  1XC5 A;  4OOI A;  5L3F A;  1SFU A;  3FZV A;  3HG9 A;  3IAM 2;  2XAF A;  2DW4 A;  2RRE A;  1OFC X;  1EF4 A;  3JRE A;  2EH3 A;  5TJJ A;  4BAC A;  1WQ2 A;  1J09 A;  2KIS A;  4RLF A;  4QPO A;  3LA2 A;  3QPT A;  1MZB A;  5DD8 A;  3J80 K;  5IYC J;  3C7J A;  4U87 A;  4S04 A;  4DW6 A;  1E17 A;  1USS A;  1UST A;  3V8L A;  2CMP A;  5D8L B;  3DEE A;  1J0R A;  1JHF A;  1V5E A;  1DGW Y;  2K3F A;  3BTC A;  2NVQ J;  2B0L A;  5K5R A;  3LSI A;  1SMT A;  1BOA A;  3K0L A;  5D8K B;  2MA3 A;  2E19 A;  4BXU A;  2EQR A;  2W7N A;  1H9G A;  3RYP A;  3ZMV A;  5E17 F;  2CQX A;  5LEJ A;  2F4O B;  4M6Y A;  1S8N A;  3Q9V A;  2M45 A;  1K61 A;  3SEQ A;  2DMQ A;  3PO2 J;  5J3L A;  2KJB A;  1FOW A;  3LOC A;  3CUQ A;  3IHU A;  3KZZ A;  5B1A H;  2EZL A;  3OYK A;  1XMX A;  3V7S A;  6PAX A;  1HOM A;  3MQ0 A;  5FRM A;  4GO1 A;  1R5I D;  4MHG A;  2L4M A;  2JA6 J;  5L3B A;  4I2O A;  2UXN A;  1R6R A;  2VOD A;  2LF8 A;  1ZG1 A;  1W0T A;  2XAU A;  5H2F C;  3MVP A;  3Q0W A;  5JVT A;  1VQ4 I;  3MKW B;  2DFF A;  3CJR B;  3PNY A;  2NOG A;  2IA1 A;  2XPU A;  2FNP A;  3RZD J;  5ICC A;  3I0T A;  1VF9 A;  1WJE A;  5J40 A;  3G3Z A;  1ZRD A;  1WJB A;  1W7P D;  3B6A A;  2QLZ A;  2EA4 A;  3UR3 C;  2K86 A;  4CSW A;  2QSG X;  3FKJ A;  2CQ7 A;  2DTR A;  2HPI A;  1XMK A;  3OV8 A;  2FQ4 A;  2XF7 A;  3KCC A;  4NC7 A;  2K9N A;  4XK4 A;  1QVU A;  1T08 B;  2QQ8 A;  1N25 A;  3RKY A;  2I8D A;  2CUE A;  4WXC A;  1XTA A;  3GFL A;  2Z1D A;  4U7B A;  2R7U A;  2E1N A;  3P7N A;  3A0B C;  3W6V A;  3KP5 A;  5KNL A;  4IHX A;  1BJA A;  2OCE A;  3F23 A;  2JVG A;  3IKV A;  5F6F A;  3VB2 A;  2VL8 A;  3NEU A;  3GTP J;  1K4S A;  1YX3 A;  4GGG A;  3PO3 J;  2RNG A;  4MLO A;  3LQQ A;  3S93 A;  2GA2 A;  2GXB A;  3IUO A;  1FOK A;  1Z67 A;  3VSL A;  3CC2 I;  1BW6 A;  2GIZ A;  1OYI A;  1KON A;  2EB7 A;  4M6V A;  3KE2 A;  2GXG A;  3P5J A;  2R7X A;  3FK6 A;  3CF5 F;  1YTY A;  1JKQ C;  4UHT A;  3EUA A;  3BPX A;  3EUH A;  2EK5 A;  5CLS A;  2BYV E;  2YX7 A;  4PJ0 C;  2EIJ H;  4IF4 A;  3DTK A;  3DBR B;  3CUQ B;  1EH7 A;  2L9R A;  2OQR A;  2X6Y A;  2Y69 H;  4R79 A;  1S7E A;  1TQI A;  3H5A A;  4Z6Y A;  1ZRF A;  4Q5S F;  4RGR A;  4XLH A;  2EIN H;  2Y0S A;  1X1D A;  5J4V A;  1UFM A;  3JRF A;  4N9I A;  3HB9 A;  2KIQ A;  2BBY A;  1YFH A;  2GWR A;  3RIR A;  4G94 A;  5DTD A;  2VQG A;  2NAZ A;  2E1M C;  3CCU I;  1BI0 A;  1EV7 A;  2TCT A;  3HPG A;  3RYR A;  4B43 A;  3CMA I;  2L7F P;  2KPM A;  2K4B A;  1B4A A;  3W2A A;  3CMY A;  2CJJ A;  3KLO A;  2CGP A;  4KUM A;  1MMN A;  1Z1D A;  1OCR H;  2NS8 A;  4OWR B;  2VE9 A;  3V4G A;  2ISZ A;  4Q4Z F;  2IS4 A;  4C9Y A;  4EM2 A;  2EJR A;  2LOO A;  3CCS I;  2MH9 A;  4HV5 A;  1LE8 A;  3P9C A;  1FWZ A;  1WKM A;  5ICG A;  5IPA A;  1O57 A;  3BRO A;  4P96 A;  4BEH A;  5E8I A;  5LRR A;  2DQR A;  3TMO A;  4CCO A;  1YJ9 I;  5F08 A;  3G1O A;  1XN7 A;  2E34 A;  1SD7 A;  2A5W A;  3GTM J;  2YS9 A;  2E2H J;  2D45 A;  1VQO I;  2W4S A;  1PUF A;  5K5O A;  3GTO J;  4XLA A;  1A6Q A;  2OD5 A;  4YII A;  5BOX A;  3HEF A;  1ETW A;  5EZG A;  2OUM A;  1E3H A;  1ONV A;  4WX9 A;  2JN6 A;  2BVM A;  4CCJ A;  4OIR F;  5AIQ A;  2JA8 J;  1U3E M;  1LDD A;  3T5X A;  2A69 F;  5LHH A;  1HC8 A;  3KP7 A;  4ZYG A;  2VKE A;  2VPL A;  2K9L A;  2IRF G;  2MYS A;  1Z91 A;  3AG1 H;  4JK1 X;  1BC7 C;  1EJ9 A;  2VBZ A;  4AYB N;  1MBH A;  4OIQ F;  5EEH A;  3VYT B;  5JFR A;  2ELK A;  1ACI A;  3ZQQ A;  3BQZ A;  2QKL B;  2BGC A;  4YIF A;  4I76 A;  4C30 A;  2KQR A;  1K6O A;  4OAY A;  2K3P A;  4G9Y A;  5E79 C;  5EGO A;  1QA6 A;  2F5F A;  5JVG F;  4A3G J;  1QU3 A;  1D1A A;  2X1C A;  4BE1 A;  5EG0 A;  2HQN A;  3DU6 A;  4FAS D;  4X1E A;  1I6X A;  2P4W A;  5LGN A;  3EUH C;  3OS0 A;  1FPQ A;  5KHD A;  2LH9 A;  1JKP C;  1WJ5 A;  4MTE A;  2YX4 A;  4HNV A;  4RAY A;  4UV9 A;  3M8F A;  4ZZD A;  1ZR2 A;  3H3U A;  2CQQ A;  4ABZ A;  3OMY A;  4II2 A;  2VUM J;  1Z7U A;  2FF4 A;  1HDD C;  5AON A;  4BDZ A;  1T56 A;  3ABL H;  5EZH A;  2FUG 2;  5TRD A;  1JI8 A;  5FKK A;  2BY2 A;  2DPD A;  3HYI A;  1OCO H;  1TWF J;  4P9F A;  3AG4 H;  1T0F C;  3BLY A;  1OMI A;  1LE8 B;  3DPU A;  1T39 A;  3DKY A;  1YG2 A;  1WI3 A;  4ZZL A;  4EMS A;  4NUB A;  1B8I B;  1PUF B;  1QZY A;  1TNT A;  1LFB A;  3E6D A;  1FEX A;  2VT2 A;  3JRA A;  1KYW A;  3COA C;  3HIF A;  2NS7 A;  1VZ0 A;  3HHH A;  4RGS A;  3BTJ A;  1G8X A;  5E18 F;  2M0M A;  2IGM A;  4ZDL A;  2HYJ A;  3I3L A;  3W2W A;  2QQA A;  4UY8 I;  2LRE A;  5DM6 F;  2D5V A;  1ZH5 A;  3DEU A;  3BZK A;  5JHF A;  1MSF C;  1X1B A;  3F21 A;  5HNF A;  2IS6 A;  3WU0 A;  2W00 A;  4HLX A;  5ERI A;  5GTH C;  3K4M A;  1GDT A;  4IOC F;  2CW0 F;  4BNC A;  3S3O A;  3BG7 A;  1K78 A;  2ECC A;  1ENH A;  2B7E A;  4ESF A;  3DBH B;  4IO9 F;  3O8G A;  3KYL A;  1P4A A;  3Q0V A;  2Z99 A;  5EGO B;  2QZ8 A;  2XIG A;  1SFK A;  2YSR A;  4G6T B;  4IHW A;  1FNN A;  4FE7 A;  4L9T A;  3FXU A;  4IHS A;  2JRM A;  5ILS A;  3QQA A;  5EG0 B;  1ON2 A;  1Z9C A;  5KK1 A;  1TQM A;  1RR8 C;  3ZMT A;  2XGE A;  1NG7 A;  3TO7 A;  2LKP A;  3RJP A;  2MFZ A;  1OR7 A;  1X1A A;  3HOS A;  1X4O A;  1N78 A;  3BR0 A;  1L3L A;  2ZJQ F;  2EV6 A;  2FA5 A;  2HGC A;  2CW8 A;  1FYK A;  4IJA A;  1IRX A;  3LWF A;  3OYI A;  2ZJP F;  1DP3 A;  3ABT A;  2HXI A;  3FF5 A;  3VSK A;  4IHY A;  3BG5 A;  2XB0 X;  5FFX A;  3DXJ F;  1QPM A;  2IEK A;  2F5C A;  2KIU A;  3WTU C;  4G12 A;  2PJR A;  5E3O A;  1U8R A;  1TC3 C;  2V7F A;  1VQK I;  4LK0 F;  1JJ6 C;  1R00 A;  4YFK F;  3OYM A;  3HUG B;  3OYB A;  4DYQ A;  3TW6 A;  2IW5 A;  2EFW A;  2KRH A;  2JWT A;  4C2T A;  4IRG A;  2ZSI B;  1J9I A;  1OYW A;  5FLV A;  2LYC A;  4RLQ A;  4RB1 A;  4E7L A;  3GUD A;  3TO6 A;  5B66 C;  3TP3 A;  5HNH A;  2VOO A;  1OCP A;  5ED4 A;  2XKO A;  2QQ9 A;  5FKO A;  1FMW A;  5FRO A;  3E3V A;  3KEY A;  3HM5 A;  4E6K G;  2HTJ A;  1ZLK A;  2ZXW H;  2XVC A;  3C18 A;  3H92 A;  3CDI A;  3DPL C;  2Q8K A;  4ENM A;  1BR1 A;  4A0Z A;  1BC8 C;  3IV5 A;  3CME I;  1O3R A;  5CJ9 A;  3MZ8 A;  2CU7 A;  1BI1 A;  2ICW G;  2IVM A;  2KFD A;  3H3Z A;  4U0Y A;  1A35 A;  3E1S A;  3GZN B;  4Z2Y A;  3I59 A;  1U9N A;  4ESB A;  2OZ6 A;  2NNN A;  4XKW A;  1O4X A;  1MGT A;  2X51 A;  1A31 A;  1K79 A;  3LST A;  3ZQC A;  2VQC A;  3RZO J;  4E7J A;  3J7A Y;  3CP2 A;  4XKV A;  4ZDP A;  2HYG D;  1FIP A;  1VND A;  3ZMD A;  4BY1 J;  1IN5 A;  3WG9 A;  2RKH A;  4F55 A;  4E4H A;  1WH5 A;  1C0W A;  4M3G A;  5KCM A;  1Z6R A;  3WTX C;  5IYD J;  5M3M J;  4P5O A;  1P4W A;  3EPZ A;  2G7H A;  2DOA A;  4LFU A;  1HBX G;  4EQQ A;  2EIM H;  4HRI A;  1L0O C;  2CV0 A;  3WGH A;  4NC6 A;  2E35 A;  4AVP A;  5IOZ A;  3FM5 A;  1KQ8 A;  2V1N A;  1RPW A;  1WGX A;  3RQI A;  1XG1 A;  1JT0 A;  3V42 A;  4F7Z A;  5IP7 J;  1GV5 A;  3GTL J;  1IDZ A;  3D5R C;  1LDJ A;  4C3J J;  1MJB A;  2QF7 A;  2XGC A;  1AKH A;  3HDD A;  2X6O A;  3JCU C;  3JTH A;  3VDX A;  1B9N A;  5FKM A;  4HV6 A;  2DLL A;  2HEO A;  3ZQI A;  4I6Z A;  5IP9 J;  1H88 C;  4JYK A;  3HRU A;  3ROU A;  2EA2 A;  2COB A;  2E7W A;  2CFX A;  2OTJ I;  2WV1 A;  1SVL A;  2FSW A;  1RR7 A;  1FSH A;  2L54 A;  2D2W A;  2LK2 A;  4ZYH A;  5FO5 A;  5H6R A;  2R7V A;  1FT9 A;  3MMY B;  4D0P A;  5IOY A;  2Y30 A;  3P9K A;  3J7Z I;  3CLO A;  4AIK A;  2M0C A;  4RM3 A;  1W0U A;  1B6A A;  1ETY A;  3I59 B;  4E70 A;  1I50 J;  4LLG F;  3SYT A;  3AAF A;  3I64 A;  3T0Y A;  4BE2 A;  2XRN A;  2LVS A;  2G7U A;  3LSG A;  4MIM A;  3SZT A;  3A02 A;  4HW0 A;  3LL7 A;  1QQI A;  3KP3 A;  4MQ9 F;  4GDF A;  3ZOB A;  1JGS A;  3OL3 A;  4IRH A;  3L7W A;  1HA8 A;  2HXO A;  2ZBK A;  1GXP A;  5FKN A;  2L5Q A;  5E20 A;  2HR3 A;  4UB6 C;  4NHJ A;  2Z9O A;  3EUK L;  1ZG5 A;  1UHM A;  3G1L A;  4I98 B;  3GXO A;  2QKM B;  4KIS A;  4PFP A;  4U0W A;  1KZH A;  3JSP A;  4BJ5 C;  4IPA A;  3BWG A;  4O5V A;  2HQR A;  3LAP A;  3CTA A;  4BQA A;  3J80 Z;  2VXD A;  1R71 A;  2P5V A;  3OL4 A;  5E1Z B;  1XSD A;  3GLL A;  3MN2 A;  4CCN A;  4XLC A;  2O61 A;  2QM3 A;  4RB0 A;  4IRI A;  3Q5F A;  1EH8 A;  3RPU D;  1HCR A;  2EPF A;  2ZCW A;  4EGZ A;  1GVD A;  4ITV A;  2HDW A;  5IT9 K;  3HRT A;  4G6Q A;  3IRR A;  1F4K A;  1R4M B;  4BUP A;  1XPX A;  5E3M A;  2EFO A;  2WY7 Q;  2PLY A;  1VQM I;  3QU6 A;  1U6G A;  4B3A A;  3C2G A;  1CQT A;  4NBQ A;  2HWV A;  1AKH B;  2ETH A;  1KA8 A;  1BN5 A;  2RVC A;  1KU7 A;  4FHT A;  1U5T A;  2DA4 A;  4HZF A;  3GCM A;  4IVN A;  4PK4 A;  3F9K A;  4M74 A;  2PMZ N;  4BJT A;  1YHQ I;  1GT0 C;  2E1C A;  4AU7 A;  1TT0 A;  5LHG A;  1X58 A;  1YW7 A;  3HJE A;  1ETK A;  2L0K A;  2GAU A;  4J01 A;  1RNL A;  2DFE A;  2IBD A;  4KJZ A;  1FZP B;  4ZYD A;  3KPH A;  2PFB A;  3E6M A;  1SFE A;  4LD5 A;  3KFW X;  5M3F J;  1WWX A;  1E3P A;  3R0A A;  5HDN A;  3GTJ J;  2GQQ A;  1H89 C;  2PBI A;  3QPL A;  1JTX A;  2KT0 A;  1CF7 B;  3H1C A;  4PFO A;  4HYE A;  3KZY A;  4AC0 A;  1SVM A;  2BEO A;  3GME A;  1TP4 A;  2WB1 A;  1P2F A;  4CYC A;  4BJ6 C;  2FRH A;  3ZMU A;  4QPQ A;  4BGD A;  1DQU A;  4RA2 A;  2XAQ A;  1E0E A;  2R7W A;  2P6S A;  2Q1Z B;  3ELK A;  2ZFW A;  3J7Y J;  4P9U A;  5F1J A;  2FOW A;  5F27 A;  4OAZ A;  1ZTR A;  3GLX A;  1QPI A;  1GHC A;  4IEJ A;  1Q1H A;  2HU9 A;  2BY0 A;  3TP0 A;  3DWL E;  2RC4 A;  1PP7 U;  1FMV A;  1BR4 A;  1KU9 A;  3RSN A;  4XSX F;  2KP6 A;  2JPB A;  4LLL A;  1ZGA A;  1QZE A;  1ZAR A;  5EJC A;  3CP8 A;  4CCK A;  3CCM I;  1IG7 A;  2LFB A;  3VYS B;  2XDV A;  4GYI A;  1G4D A;  1BL0 A;  2CWE A;  1Z3Y A;  4WF2 A;  3OYJ A;  2VI6 A;  3HXL A;  2DDB A;  4E7K A;  1SAU A;  1X2M A;  4J00 A;  4AVZ A;  4D5C A;  4O3M A;  2R7S A;  2JTV A;  1YI2 I;  1T38 A;  1R36 A;  3PM1 A;  4DNC A;  4A5M A;  4XOP A;  4BBS J;  1LQ1 A;  2MLG A;  4B8X A;  2O7O A;  3N4M A;  1DU0 A;  5CVR A;  1RES A;  5DCM B;  4ON0 A;  4A3L J;  3BY6 A;  2HDD A;  1DUX C;  1HKQ A;  3TQN A;  1K6Y A;  2ZSH B;  3AL0 B;  1IW7 F;  3ZMS A;  3F8C A;  1KU3 A;  3F22 A;  2A6T A;  1A36 A;  2R7D A;  4V2G A;  1RUO A;  1U5T C;  1WJA A;  4BE0 A;  4HA8 A;  2L7Z A;  1LVK A;  1R1T A;  3V8K A;  4RAG A;  5J1Y A;  3WG7 H;  5GAH J;  1MMG A;  2DMP A;  2QGU A;  3WU1 B;  3F8F A;  2NVU B;  3L1P A;  1VQ7 I;  1UEL B;  3F6V A;  4GYG A;  1UCR A;  1ERD A;  4RB3 C;  3K4L A;  4QWQ A;  5K7F A;  2H27 A;  1BW5 A;  4AYB A;  2BE5 F;  4XQF A;  4WWC A;  1IUY A;  3DKX A;  2EV5 A;  4NQW A;  2JMW A;  3GFJ A;  4L18 B;  4P1W A;  1R58 A;  3TL4 X;  4B09 A;  2MGQ A;  2M30 A;  2CUF A;  2D1H A;  4PDK A;  1MIJ A;  3LSR A;  3L09 A;  2AQF A;  2A3S A;  2EZH A;  5EYR A;  3WTY C;  5HDG A;  2XUB A;  4IQJ A;  2V79 A;  1ZLJ A;  3OYL A;  2JRT A;  3SQN A;  4XON A;  3ASO H;  4XRS A;  2C6Y A;  3JTG A;  3I4P A;  4CDG A;  4MFE A;  2M7B A;  4IOA F;  3HC7 A;  4S05 A;  2LKX A;  3FIW A;  4GFB A;  4I99 C;  4OU0 A;  4E7H A;  4BQO A;  3OYD A;  2ACJ A;  4M9S A;  2WV0 A;  1YIO A;  5D5W B;  3F8N A;  2NS0 A;  3MWM A;  4JBA A;  1QHH D;  2DA6 A;  1OCT C;  4LG0 A;  3A2K A;  3S1R J;  5GAD J;  3K1P A;  1FBQ A;  3ZP5 A;  5E1X A;  2WB1 N;  2VJ4 A;  1I1G A;  3PFY A;  1I39 A;  3ERM A;  1ZQ3 P;  5AIP A;  3LNQ A;  3HOW J;  3BCA A;  4DIQ A;  2IGK A;  4LB5 A;  4XKC A;  1MH3 A;  4HQM A;  1BA5 A;  2LY2 A;  1W7P A;  4M3D A;  3FXQ A;  2DI3 A;  2DMU A;  1I27 A;  2M4G A;  3S1M J;  2X6X A;  2WTE A;  4UV8 A;  5C4X J;  4M3B A;  3JRB A;  3RCO A;  2VE8 A;  5DM7 F;  5JLW A;  1UAA A;  1XCV A;  1MND A;  5DV5 A;  3K4K A;  4LOC A;  1W36 C;  1T0F A;  1BIB A;  1IXR C;  2PQ8 A;  2M3A A;  2E60 A;  3BT9 A;  1FBS A;  4CZZ A;  3D5S C;  2DOE A;  2CUJ A;  3QWL A;  2DYR H;  5F0C A;  1RC9 A;  3FBI B;  4RAF A;  4XKB A;  1VQN I;  4DBQ A;  1XX5 A;  2QSH X;  3ABK H;  2Y31 A;  2YUS A;  1S29 A;  3P9I A;  2P5L C;  4D1Q A;  2NRA C;  1IXC A;  1WHU A;  4XLE A;  1IDY A;  1ODD A;  3RKW A;  1UB9 A;  2OF7 A;  2QSF X;  3JAM K;  2VJ5 A;  4FE4 A;  4HDV A;  2Y9Z A;  1TL8 A;  2ZKZ A;  2M87 A;  3DKW A;  3HTU A;  2WBM A;  1SD6 A;  5CVV A;  1YE9 A;  2DCE A;  3W6J B;  1FY7 A;  4KIC A;  3BG9 A;  5TGT A;  2XC7 A;  2CH0 A;  1FP2 A;  2V9K A;  2X9D A;  3JRI A;  3QYE A;  3I4M J;  1J2X A;  1U78 A;  2F4I A;  2CSO A;  3WTZ A;  2XKP A;  5CQG A;  3CCE I;  3OYN A;  1PUE E;  5HDK A;  3IH2 A;  2CYY A;  2MD5 A;  4D7N A;  3I4N J;  1JTY A;  4X6A J;  4XRM A;  4W1U A;  1WRJ A;  1LEA A;  2H09 A;  2XPW A;  5L3C A;  1Q1V A;  2K85 A;  2BY3 A;  5CYV A;  2COM A;  1T98 A;  4L9V A;  5LEK A;  1TTY A;  3TOB A;  3ZQF A;  2H1K A;  4KIT B;  3K7A J;  4LIV A;  1Z0X A;  3OYA A;  3G2B A;  3MD2 A;  5E3L A;  1APL C;  3TDZ C;  3NRV A;  2ZO4 A;  4CHU A;  4EJT A;  2KRC A;  3I58 A;  2I10 A;  2M8E A;  2KHM A;  1IN8 A;  2FBK A;  1AA7 A;  3GF2 A;  1MMS A;  4L0Z B;  1TW3 A;  3K1N A;  4N4O B;  3IL2 A;  1JGG A;  1B1B A;  4D9J A;  3QYF A;  3PUF A;  5LD2 C;  2DXI A;  3FWE A;  1O7L A;  3VWB A;  1LNW A;  1Y56 A;  2MBF A;  4BBR J;  2WAQ N;  3K4C A;  3EQL F;  3V7C A;  4F92 B;  1I1S A;  2VKD A;  2PMU A;  4ETS A;  3PIP F;  1Y0U A;  1K4T A;  3KZI C;  3VYU B;  2HDC A;  3VYR B;  3OSG A;  2E2I J;  4RS8 A;  2A6E F;  5K1Y A;  2FML A;  3A03 A;  3T1B A;  2GXA A;  4IHT A;  4BEH B;  3WE3 A;  2PMH A;  4C2M J;  5GAE J;  2DA5 A;  3BG3 A;  4MQV A;  3GX4 X;  3UNG C;  4PJL A;  1YO5 C;  4I09 A;  4BQQ A;  3H3V K;  1D8J A;  3M8J A;  1KGS A;  1ZRC A;  2DO7 A;  3S16 J;  1SFO J;  3E6B A;  5F04 A;  2IGN A;  3E97 A;  3GEZ A;  3WTT C;  1Y39 A;  4HSR A;  1KYZ A;  4CA0 A;  4A6D A;  5JHU A;  4W97 A;  1MBK A;  5LHI A;  4A0X A;  1JHH A;  4V2F A;  1FP1 D;  2RN7 A;  3L9F A;  2B9S A;  1VI0 A;  4YRV A;  3FXJ A;  3SHF A;  1P92 A;  4KFC A;  2JSP A;  1NHA A;  1ZR4 A;  2YPR A;  2R3S A;  2XHK A;  2AS5 F;  4A69 C;  2K27 A;  4PUS A;  3G4S I;  1FIA A;  2DTZ A;  1MMA A;  3LAJ A;  3WHC A;  2JUC A;  3U2R A;  2DPU A;  4IL6 C;  4M73 A;  3WGG A;  3PFI A;  4XLF A;  2VKH A;  2A05 A;  1X1C A;  3PSF A;  2AO9 A;  3K2Z A;  4D5F A;  4DYR A;  5DD4 A;  2JSC A;  2RQP A;  3DCF A;  1S6L A;  4FIS A;  5EDN A;  3CMM A;  4ZTF A;  2IA0 A;  2A68 F;  2OZU A;  1X2N A;  3RI4 A;  1NG6 A;  4G8X A;  3LMM A;  4OMZ A;  3K70 D;  3BZ6 A;  3ONQ A;  3CO6 C;  3GBG A;  3HSR A;  2PX9 A;  3GFI A;  3ECO A;  1VQ6 I;  1ZHF A;  2FU4 A;  2EBI A;  3GYH X;  4A5N A;  2OA4 A;  3R61 A;  2HNH A;  3CCQ I;  2L9S A;  2KKO A;  4XRS G;  1ON1 A;  1TWH J;  1YW8 A;  2OCC H;  1H0M A;  3ML6 A;  4YFX F;  1RET A;  1D1C A;  3KEQ A;  4Y52 J;  4AIH A;  1YOV B;  3GTQ J;  4L5E A;  4B1R A;  5HLG A;  4HF2 A;  2PI0 A;  5DCF A;  2DFI A;  1KU2 A;  1RKW A;  2VB6 A;  4HLY A;  4LMY A;  2ZFU A;  3DTE A;  5HLH A;  4PSW A;  1ZGW A;  3K4J A;  5A2Q K;  3M4O J;  1YLF A;  4XM3 A;  2W84 A;  4HNU A;  2E71 A;  5FRN A;  4U88 A;  1UG2 A;  4UUV A;  3S2D J;  2Z5U A;  1AWC A;  2OTL I;  3ECH A;  3S17 J;  4XL9 A;  2EFP A;  2MH2 A;  2Q0O A;  1W4M A;  2VBW A;  2R5Y A;  4H4K C;  4BL0 B;  2F6C A;  1YQA A;  4OIN F;  3I56 I;  2R7T A;  3IP4 B;  2Y9Y A;  3FHN A;  3DU5 A;  1FYL A;  2V26 A;  4CCM A;  2DU9 A;  2A61 A;  1X1P A;  3CCL I;  2LDU A;  2QEX I;  1V5F A;  3HZJ A;  2QUF A;  5FFZ A;  4E7Z A;  3CUO A;  5CQE A;  3OWT A;  1K78 B;  3H9J A;  4A6E A;  2EZI A;  2LNB A;  2F5D A;  2CV1 A;  2ESH A;  4MTD A;  4FT8 A;  1G2H A;  1YS6 A;  2O9L A;  2M5W A;  2ZME C;  5ILU A;  1RIO H;  2W24 A;  3HGG A;  1Z77 A;  3GO5 A;  1K7A A;  4CO8 A;  3M7G A;  2E36 A;  4U7D A;  2ESN A;  2KJC A;  1YX5 A;  5HVQ C;  4Y7N J;  1XGM A;  3K10 A;  3JRC A;  3OIO A;  4A3D J;  3TED A;  2X1D A;  3OR1 C;  4XR6 A;  5BNG A;  2CO5 A;  4MNU A;  4DGW B;  3QP5 A;  3GZ6 A;  4RDU A;  3A1Y A;  3H9G A;  2DJN A;  2W85 A;  1Z7L A;  1J7K A;  2PMZ A;  3K4N A;  4N9H A;  3OR2 C;  3SFI A;  1Y0N A;  1FOX A;  2DMN A;  2ECB A;  1G3T A;  1GLN A;  4QSH A;  3CCV I;  4A3J J;  3SEZ A;  3UKG A;  2OPT A;  4LJZ F;  3WTW C;  3J81 K;  1B72 A;  1ETX A;  2AQE A;  1JE8 A;  1T95 A;  5IP6 A;  3NWT A;  4HX7 A;  3C2H A;  5KVR A;  2DBB A;  2HFH A;  3H36 A;  1YJN I;  2ELH A;  3KX2 A;  5LLQ A;  2PJR B;  5IT9 Z;  2M8G X;  4NC8 A;  2MLK A;  1X19 A;  1DGR M;  4DQ2 A;  4HPQ A;  4DZP A;  3PQK A;  3E5U A;  2LBF A;  2L9N A;  1DU6 A;  4BDY A;  2GM4 A;  2QA4 I;  4AM3 A;  1IC8 A;  3D5L A;  2AHQ A;  3B73 A;  2XGX A;  5LGT A;  2UWM A;  3C3W A;  3Q0U A;  4PZJ A;  4IKF A;  4EM1 A;  1QVT A;  1JUS A;  2OBP A;  2VIX A;  1OJL A;  2KDO A;  3LFU A;  2CV2 A;  1Z05 A;  4XN0 A;  4M9Z A;  3REO A;  5J1U A;  3ABU A;  1D0Y A;  2R7Q A;  3JR9 A;  2X4H A;  3K4B A;  4EVI A;  3G71 I;  5J8F A;  1HDP A;  1IUF A;  4A93 J;  3QU3 A;  4BS9 A;  5BPI A;  1JKR C;  1B9M A;  2OV7 A;  3QYB A;  1M1E B;  2JA5 J;  3SDB A;  1YS7 A;  3CJQ B;  3I71 A;  1R5H A;  3BTI A;  3R4K A;  4I7H A;  1R9T J;  1NK3 P;  4KDP A;  3HPH A;  4UXN A;  4BHP A;  1V54 H;  3LSP A;  4HDU A;  1P7I A;  3VOE A;  9ANT A;  3ZQ7 A;  4I01 A;  4XNF A;  2Y48 A;  3NWS A;  4CH7 A;  3K6G A;  3BR6 A;  5DUI A;  3S3N A;  5HLI A;  2XF6 A;  3WHB A;  1S72 I;  2K7L A;  3ZQL A;  3S15 J;  1JUP A;  2WY8 Q;  2IPQ X;  5TIS C;  2W48 A;  2IAI A;  1SVO A;  3LSH A;  3KP4 A;  1Y6I A;  2VBY A;  4ZC3 A;  3SFZ A;  1ZYR F;  1O3Q A;  3SZG A;  2KZG A;  3I53 A;  2P7C B;  1XDS A;  1LJ9 A;  5D6E A;  3V7R A;  4QTR A;  1XDU A;  5GAG J;  1IV6 A;  1BIA A;  1W1W E;  4Y13 A;  2X6W A;  3F8M A;  1TNS A;  3DP7 A;  3CDL A;  3CDH A;  2K5C A;  3F6O A;  3GFM A;  1X3W B;  3N97 A;  4EEF G;  1F1Z A;  3TOA A;  2ELJ A;  2IA2 A;  1VQL I;  1OCC H;  2GZW A;  2K9Q A;  3PNT A;  3ZRG A;  3HRM A;  4PGG A;  2R0Q C;  2NNY A;  2HOS A;  2K02 A;  3JRD A;  4XMY A;  4G6D A;  2CFO A;  2W25 A;  2MD0 A;  3DV8 A;  3WTV C;  3IC7 A;  4A12 A;  2ZNZ A;  3RTR A;  2HYF A;  3ZXS A;  1RRJ A;  3JRH A;  2BVL A;  3WTS C;  1G6N A;  3WE2 A;  1G59 A;  4EJV A;  2R7R A;  1G3Y A;  5B1B H;  4BHB A;  5GPA A;  4A0Y A;  4PSX A;  1HKS A;  3FXK A;  3RKX A;  1IRF A;  3HRS A;  3T8R A;  4Q47 A;  1R1V A;  4D7M A;  3PIO F;  1F9N A;  3GWZ A;  5M5W J;  2HVS A;  2H94 A;  2J5O A;  2XAH A;  3ULQ B;  4KMF A;  3A01 A;  3TGN A;  2N8G A;  1IV8 A;  2XRL A;  2J5P A;  5FGM A;  1IXS B;  2CQN A;  4BHC A;  1HW5 A;  2HKO A;  3BZC A;  3LSM A;  1EKE A;  1YW9 A;  3I5U A;  2DYS H;  1FSE A;  5BS6 A;  3ZQG A;  5DDG A;  3LQR A;  4HNT A;  4EAT A;  2L9V A;  1LUJ B;  2IS2 A;  4Y3O A;  5DEQ A;  4Y15 A;  4AWX B;  2QCO A;  2LD5 A;  3DEW A;  4HBL A;  1Z6T A;  4JOM A;  1UJ8 A;  2GOX B;  3RPU A;  5BQT A;  2E2J J;  1T2K A;  3AFH A;  1ORK A;  5H20 A;  1IN7 A;  2LF7 A;  1ETQ A;  3IKT A;  2L7M P;  3QPH A;  1OLT A;  5GPC A;  2HI3 A;  3FXO A;  5L3E A;  1KQ9 A;  4S0H B;  2K9M A;  1G3W A;  1I3Q J;  1JUM A;  4C2U A;  2H6C A;  3PSI A;  4AID A;  1W5C C;  2XGD A;  2QBY A;  2P81 A;  2KZV A;  1VFC A;  2O3F A;  3DQV C;  3BR3 A;  4TV7 A;  1R23 A;  2H6B A;  1PP8 F;  3BP8 A;  2W82 A;  2ZJR F;  2DAO A;  1ZRE A;  2FQ3 A;  5D6F A;  3SDG A;  1TW2 A;  5EEA A;  4PCQ A;  2EV0 A;  3PQJ A;  2ZXJ A;  2BOL A;  1FJL A;  5F0F A;  1TWC J;  4BU2 A;  5HLT A;  1BR2 A;  1D0Z A;  3FX3 A;  4XOT A;  1GV2 A;  3W6K B;  5D5U B;  3TW7 A;  1V4R A;  1HW1 A;  1U5T B;  2O0Y A;  4KA4 A;  4CYD A;  3LSJ A;  1WFX A;  1BJZ A;  2DOD A;  4WCG A;  1UHW A;  2EZK A;  3ASN H;  1IGN A;  2EFQ A;  3D0S A;  4MEX F;  2P5K A;  3QAH A;  1F43 A;  3JRG A;  3VOD A;  1BI3 A;  1PJR A;  2L7K A;  5L3G A;  3IAS 2;  1QRY A;  1AOY A;  1IO2 A;  1T8I A;  1U8B A;  5ILV A;  2VPR A;  1LKX A;  2DT6 A;  3KP6 A;  3GTK J;  2RAE A;  3A01 B;  2OU2 A;  2VN2 A;  5FD5 A;  3ABM H;  4M71 A;  1D3Y A;  3HOU J;  5F64 A;  3ZPL A;  1ZN2 A;  4YIR X;  1D5V A;  2O6G E;  5E1W A;  1ZG3 A;  2B63 J;  4ESJ A;  4PJJ A;  1MH4 A;  1RI7 A;  2HOA A;  1R49 A;  3HBL A;  3DLA A;  3W2V A;  1VQP I;  2ZB9 A;  1ZGJ A;  1V55 H;  3DFG A;  3C2B A;  4CYC B;  1XS9 A;  3RQ4 A;  3H5R A;  3HKZ N;  1TQP A;  1Y1V J;  3OY9 A;  4RMN A;  4IQ4 A;  1DP7 P;  3G1M A;  1IJW C;  1MSE C;  1SEU A;  3CJT B;  4AIJ A;  1LFP A;  1Z21 A;  1MBJ A;  2IGO A;  2GLO A;  3JAM Z;  3DBL B;  3A4C A;  2DT5 A;  2QBY B;  3CC4 I;  3S1N J;  1ETO A;  2HVQ A;  2L4A A;  3ZQH A;  3AL0 C;  2DN0 A;  2UUZ A;  4A3M J;  5BMZ A;  4R8H A;  4F93 B;  1R5G A;  2X85 A;  2L01 A;  3K9T A;  1X3Z B;  4HF1 A;  2I5U A;  2FJ1 A;  3CJN A;  3FXM A;  2WAQ A;  2QQB A;  2XB5 A;  2LLK A;  2UV1 A;  3L2U A;  3NQO A;  2BHZ A;  2R7F A;  2VT3 A;  3FM3 A;  2FX0 A;  5GP9 A;  1TWG J;  2JK3 A;  2LKS A;  5HOD A;  1KQ0 A;  1ZKG A;  1YJW I;  2DK8 A;  2M9H A;  5K7H A;  1D1B A;  1YRN A;  3OOP A;  1WJC A;  2JT1 A;  3CD6 I;  3BQY A;  4EJW A;  1R22 A;  2ZXI A;  4DOZ A;  1S3J A;  3CCY A;  4IX7 A;  2E1M B;  4FET A;  5FLM J;  3L2R A;  4HQE A;  2IXS A;  2BXY A;  1X4P A;  3L2Q A;  2FE3 A;  4CZC A;  3I54 A;  4RM2 A;  1ITY A;  1IZ1 A;  3LA7 A;  1REP C;  4Q48 A;  4RGX A;  4LB6 B;  2HZD A;  3F72 A;  2K40 A;  1LB2 A;  3GTG J;  4BH9 A;  5LBQ A;  4KT6 A;  2O8K A;  1AHD P;  5E3N A;  4KN7 X;  4XIC A;  4B47 A;  2KDZ A;  1OPC A;  2NOJ B;  4A3C J;  2JA7 J;  2Y75 A;  1J5Y A;  2L02 A;  1RUN A;  3L2C A;  4BXX J;  3RPQ A;  1V5G A;  1MDM A;  5JLX A;  4FX4 A;  4L5I A;  1FBU A;  3BR2 A;  3RKQ A;  1QBJ A;  2DFH A;  1HQC A;  1SAN A;  2QVO A;  3BTL A;  4Y17 A;  3HOT A;  4LK1 F;  4UB8 C;  1E3O C;  1A04 A;  3BPV A;  1BM9 A;  3U1D A;  3OOU A;  2DA2 A;  2OAZ A;  4NQW B;  5H6Q A;  3QOD A;  3R0J A;  3OIQ A;  5JR3 A;  1IN6 A;  4KIG A;  2JVH A;  1TZL A;  3FMS A;  5HS8 A;  3SJM A;  3FHZ A;  1BI2 A;  1GVJ A;  2ZJ2 A;  1DDN A;  2V1U A;  3SXY A;  4A3F J;  1SC7 A;  4B48 A;  4CCL A;  1B59 A;  1A6I A;  2LTP A;  2V1D A;  3CUQ C;  3ESW B;  3R60 A;  5HS7 A;  1OIS A;  4DZJ A;  5C4J J;  3F8B A;  4A3E J;  2MSY A;  2V4J C;  3CLQ A;  4K2E A;  2O8X A;  3OYE A;  3MKY B;  2ID3 A;  2NYX A;  3GZ5 A;  4R1H A;  1OKR A;  4UUS A;  2GA1 A;  3WOD F;  1FC3 A;  3ZN0 A;  2QWW A;  2VXZ A;  2M7A A;  3OIP A;  1J59 A;  2VON A;  4L0Y B;  3AKZ A;  4XSZ F;  2XAJ A;  1UG0 A;  3BJ6 A;  1YYV A;  4BKX A;  2FEZ A;  2ZXH A;  4LG0 B;  3OSF A;  4AD9 A;  2FNA A;  3F3X A;  3Q3S A;  2AXL A;  3G73 A;  2JUG A;  2PN6 A;  1HXD A;  1XMA A;  1B8I A;  3ZR8 X;  1YRN B;  4L9J A;  1BBY A;  2YU9 J;  1IAW A;  5K7Z A;  2WAF A;  1EH6 A;  3FBN B;  2UXX A;  4FTH A;  2CW7 A;  3JW4 A;  4ZJZ A;  1QZZ A;  1PDN C;  1IRG A;  1W7P B;  4AUX A;  3PL8 A;  3O2P E;  5LGU A;  1U0J A;  3FDY A;  3IWF A;  1LPQ A;  5JI6 A;  1V3F A;  5KAI C;  2GBY A;  4RAZ A;  2LY1 A;  4PJN A;  1T6S A;  3Q9S A;  3EDP A;  4OMY A;  2V9P A;  1T33 A;  1ZAO A;  4EV0 A;  2ZC2 A;  4M72 A;  2NVY J;  1MDM B;  2KMU A;  3S2H J;  3O8H A;  2R7Z J;  2XSD C;  2RQQ A;  4A3K J;  1S9H A;  4C3I J;  2F2E A;  4F91 B;  1G3S A;  1HW2 A;  3K69 A;  1R1U A;  4ZTJ A;  4LLN A;  3L2W A;  3N05 A;  2WAD A;  4BQN A;  1H9T A;  2L3D A;  2XSJ C;  2DA7 A;  2DT7 B;  2IP2 A;  4GXO A;  5F1R A;  4UUT A;  3CQZ J;  2GIV A;  2LMD A; 
#chains in the Genus database with same CATH homology
 5HVQ C;  2Z1D A;  4U7B A;  3K10 A;  4PK4 A;  2X1D A;  3OR1 C;  4XR6 A;  2R7U A;  3F9K A;  4DGW B;  5KNL A;  4BJT A;  3A1Y A;  3H9G A;  4AU7 A;  2JVG A;  1N75 A;  1TT0 A;  1Z7L A;  2PMZ A;  2VL8 A;  3K4N A;  1YX3 A;  3OR2 C;  4YEL A;  4J01 A;  1GLN A;  4KJZ A;  2RNG A;  3SEZ A;  4MLO A;  4IZZ A;  3CZ6 A;  3S93 A;  3IUO A;  3VSL A;  1KON A;  2R7X A;  2AQE A;  1T95 A;  3NWT A;  3C2H A;  3EUA A;  4PFO A;  3OYF A;  1N77 A;  2WB1 A;  3KX2 A;  2MAB A;  3DTK A;  4BJ6 C;  2PJR B;  4NC8 A;  1X19 A;  1DGR M;  4QPQ A;  4BGD A;  1DQU A;  2X6Y A;  4HPQ A;  4LG3 A;  4R79 A;  3H5A A;  1E0E A;  2LBF A;  2L9N A;  2R7W A;  4F52 A;  2Q1Z B;  4BDY A;  2VLA A;  4XLH A;  3D5L A;  5LFA A;  2Y0S A;  4OAZ A;  3ZCO A;  2JA2 A;  1X1D A;  2UWM A;  3OYG A;  2HU9 A;  4IKF A;  3DWL E;  1FMV A;  2V6E A;  2VIX A;  1BR4 A;  3RSN A;  2KDO A;  3LFU A;  2CV2 A;  2KP6 A;  4XN0 A;  2VQG A;  1D0Y A;  2R7Q A;  2VQL A;  2E1M C;  3K4B A;  3CP8 A;  4CCK A;  3HPG A;  4B43 A;  3VYS B;  3OS2 A;  1D0X A;  2KL4 A;  5CKT A;  2XDV A;  4BS9 A;  2KPM A;  2OV7 A;  1Z3Y A;  3QYB A;  3W2A A;  3CF2 A;  3SDB A;  3CJQ B;  2Z2S B;  1MMN A;  3OYJ A;  4Y33 A;  4OWR B;  3BCB A;  3HXL A;  3HPH A;  4E7K A;  1SAU A;  4J00 A;  2IS4 A;  4C9Y A;  2LOO A;  4XNF A;  4AVZ A;  1PYV A;  2R7S A;  4BEH A;  3NWS A;  4PJM A;  4CH7 A;  3K6G A;  1EA3 A;  3TMO A;  4CCO A;  2XF5 A;  3S3N A;  2XF6 A;  4XOP A;  2A5W A;  2WY8 Q;  2W4S A;  3TBI A;  2MC4 A;  4XLA A;  4GRI A;  1K6Y A;  2ZSH B;  3LSH A;  1Y6I A;  4ZC3 A;  3AL0 B;  4ZYA A;  3SZG A;  2OUM A;  2A6T A;  2R4G A;  1MMD A;  2BVM A;  4CCJ A;  1WJA A;  2X6W A;  4BE0 A;  2BW3 A;  1LVK A;  2K5C A;  4CUG A;  2VPL A;  2K9L A;  4E7S A;  2MYS A;  1MMG A;  2VJI A;  1UEL B;  3DTI A;  2ELJ A;  4LIT A;  1ERD A;  3VYT B;  3K4L A;  3ZRG A;  3PNT A;  3ZQQ A;  2QKL B;  4AYB A;  2E5Z A;  4XQF A;  4Y4R A;  3L2V A;  4C30 A;  2KQR A;  4OAY A;  2K3P A;  3DKX A;  4P1W A;  3TL4 X;  4XMY A;  1QU3 A;  1QHG A;  2CFO A;  2MD0 A;  1D1A A;  2X1C A;  4BE1 A;  2AQF A;  3RTR A;  3ZXS A;  3DU6 A;  3S8P A;  2BVL A;  2LC2 A;  4FAS D;  3EUH C;  3OS0 A;  1G59 A;  4IQJ A;  5KHD A;  2R7R A;  2LH9 A;  3OYL A;  2LRD A;  2WA0 A;  4XON A;  1WJ5 A;  4PSX A;  1LDK B;  4JQF A;  2M7B A;  2DJI A;  3HC7 A;  4E7H A;  3OMY A;  4II2 A;  4BQO A;  2HVS A;  3OYD A;  2E5N A;  4BDZ A;  1QHH D;  2FUG 2;  3A2K A;  1JI8 A;  3BC8 A;  2R7O A;  1WJD A;  3LSM A;  3MKZ A;  4F3Q A;  1T0F C;  3BLY A;  2HPM A;  2KLO A;  4HNT A;  4EAT A;  3DPU A;  2VJ4 A;  3PFY A;  2IS2 A;  4Y3O A;  3DKY A;  2X1E A;  4N4N B;  3BCA A;  2L2O A;  4DIQ A;  2IGK A;  4XKC A;  4JOM A;  4NUB A;  2GOX B;  2LY2 A;  3QOE A;  4B44 A;  3AFH A;  1VZ0 A;  1G8X A;  2Q2E B;  2M0M A;  1MNE A;  2IGM A;  1OLT A;  2M4G A;  3I3L A;  4ZDL A;  3W2W A;  2X6X A;  2LRE A;  2K9M A;  4C2U A;  5JHF A;  1X1B A;  3PSI A;  5HNF A;  2IS6 A;  2W00 A;  3RCO A;  2BW3 B;  1UAA A;  3K4M A;  2P0W A;  1MND A;  2CS3 A;  3K4K A;  1P9Q C;  4YEJ A;  2KZV A;  1W36 C;  3M1C A;  3DQV C;  1OR7 C;  3BG7 A;  3S3O A;  2M3A A;  2W1O A;  2E60 A;  2W82 A;  3PJR A;  3D5S C;  3KYL A;  2CUJ A;  1BOB A;  3H0D A;  3DPT A;  2M4K A;  3HL2 A;  2VAS A;  3FBI B;  2BOL A;  2O5R A;  1SFK A;  4XKB A;  4BU2 A;  4DBQ A;  4G6T B;  5HLT A;  1BR2 A;  1D0Z A;  4XOT A;  4D1Q A;  2VJJ A;  3OYC A;  1MW7 A;  3CES A;  4XLE A;  4BXF A;  3K70 C;  1WFX A;  2VQH A;  1NG7 A;  2VJ5 A;  4II3 A;  3OYH A;  2MFZ A;  1X1A A;  3HOS A;  1PJR A;  1X4O A;  2L7K A;  3IAS 2;  4DBR A;  1N78 A;  2WBM A;  3PNV A;  4DJA A;  1LKX A;  2DT6 A;  1YE9 A;  2CW8 A;  2DCE A;  5TGT A;  2XC7 A;  1IRX A;  1DP3 A;  3OYI A;  2CH0 A;  2V9K A;  3W3C A;  1WJF A;  3QYE A;  3VSK A;  2F4I A;  4PJJ A;  2PJR A;  5CQG A;  2V7F A;  3OYN A;  3H9Q A;  3ZGK A;  3DLA A;  3W2V A;  3H35 A;  3OYM A;  2GOM A;  3HUG B;  3OYB A;  4ZDO A;  3RQ4 A;  2KRH A;  2WAE A;  3H5R A;  3LSK A;  4C2T A;  2ZSI B;  2LBF B;  5CPR B;  3OY9 A;  4RMN A;  4IQ4 A;  3BG6 A;  4LIU A;  3HKZ A;  2LYC A;  4RLQ A;  1LFP A;  4E7L A;  1Z21 A;  2IGO A;  4KIT B;  4B3X A;  4LIV A;  3OYA A;  4XN3 A;  2CUZ A;  3G2B A;  3MD2 A;  3A4C A;  4HG2 A;  5HNH A;  5HOO A;  2IS1 A;  2KRC A;  1FMW A;  5FRO A;  3KEY A;  2KHM A;  1AA7 A;  2HVQ A;  3AL0 C;  4E6K G;  2UUZ A;  4N4O B;  2LG4 A;  2HQA A;  3H5N A;  3DPL C;  3OS1 A;  4D9J A;  1BR1 A;  3QYF A;  4F93 B;  5LD2 C;  2DXI A;  2X85 A;  3VWB A;  4ANJ A;  3S3M A;  1Y56 A;  4F92 B;  3K4C A;  2Z16 A;  3E0J B;  2OC6 A;  2F5V A;  2VKD A;  3E1S A;  2WAQ A;  1ZEL A;  4XKW A;  2UV1 A;  3VYU B;  3L2U A;  3VYR B;  4X0G A;  2X51 A;  2VQC A;  4E7J A;  4BEH B;  3J7A Y;  4E7I A;  3S32 A;  3CP2 A;  1D1B A;  4HEA 2;  2HVR A;  4XKV A;  4ZDP A;  1WJC A;  3UNG C;  2ZXI A;  4PJL A;  4DOZ A;  4F55 A;  4E4H A;  4BQQ A;  4NNJ A;  2E1M B;  4FET A;  3M8J A;  3L2R A;  4IX7 A;  5KCM A;  3U21 A;  2IXS A;  3L2Q A;  1X4P A;  4P5O A;  3EPZ A;  4CZC A;  4RM2 A;  2DOA A;  1Z3X A;  4HRI A;  2HZD A;  2IGN A;  2CV0 A;  4HSR A;  4KT6 A;  4CA0 A;  4B47 A;  2NOJ B;  1W36 D;  4YRV A;  1V5G A;  2V1N A;  2JSP A;  3I9V 2;  3PUB A;  3V42 A;  4XOR A;  4PUS A;  3HOT A;  1MMA A;  3D5R C;  4HST A;  3OOU A;  4XLF A;  2VKH A;  1X1C A;  4NQW B;  3PSF A;  3QOD A;  3OIQ A;  3HG9 A;  3IAM 2;  3VDX A;  2RRE A;  2JVH A;  1TZL A;  4ZTF A;  3CMM A;  4BAC A;  1NG6 A;  3LMM A;  1J09 A;  4RLF A;  4B48 A;  4CCL A;  3K70 D;  4QPO A;  3ONQ A;  3GBG A;  2V4J C;  4U87 A;  3OYE A;  2HNH A;  3MKY B;  2CMP A;  2L9S A;  3DEE A;  2R7V A;  1V5E A;  3MMY B;  1DGW Y;  2VXZ A;  2M7A A;  3OIP A;  3LSI A;  3AKZ A;  4RM3 A;  1D1C A;  1UG0 A;  2W7N A;  2ZXH A;  3SYT A;  4BE2 A;  2VB6 A;  3LSG A;  2ZFU A;  3DTE A;  4PSW A;  2JUG A;  3SEQ A;  3K4J A;  3LL7 A;  4XM3 A;  3ZR8 X;  3OL3 A;  4HNU A;  3OYK A;  5FRN A;  1HA8 A;  2WAF A;  3FBN B;  2L5Q A;  2CW7 A;  5FRM A;  4ZJZ A;  4XL9 A;  3EUK L;  3PL8 A;  1R6R A;  1U0J A;  2QKM B;  3FDY A;  4H4K C;  4BL0 B;  4KIS A;  4PFP A;  2F6C A;  2R7T A;  2XAU A;  3IP4 B;  3FHN A;  4BJ5 C;  3DU5 A;  2LY1 A;  4PJN A;  2V26 A;  4CCM A;  3MKW B;  3CJR B;  2VXD A;  3OL4 A;  3PNY A;  1V5F A;  4CCN A;  4XLC A;  4E7Z A;  1WJE A;  2KMU A;  3RPU D;  5CQE A;  1WJB A;  3OWT A;  2RQQ A;  1S9H A;  3H9J A;  4ITV A;  2HDW A;  3UR3 C;  4CSW A;  2CV1 A;  4F91 B;  3FKJ A;  4BUP A;  2HPI A;  2XF7 A;  2WY7 Q;  4ZTJ A;  4NC7 A;  3L2W A;  3C2G A;  3N05 A;  2WAD A;  4BQN A;  2XSJ C;  2DT7 B;  2I8D A;  1YX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...