2JUGA

Multienzyme docking in hybrid megasynthetases
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
78
structure length
78
Chain Sequence
GPLGSSAGALLAHAASLGVRLWVEGERLRFQAPPGVMTPELQSRLGGARHELIALLRQLQPSSQGGSLLAPVARNGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TubC protein
publication title Multienzyme docking in hybrid megasynthetases
pubmed doi rcsb
source organism Angiococcus disciformis
molecule tags Biosynthetic protein
total genus 10
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18563 TubC_N TubC N-terminal docking domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1830 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2jugA01
2JUGA
chains in the Genus database with same CATH superfamily
3FXRA 5LFAA 2HTJA 2XGXA 2BBYA 1IRGA 2COBA 2KIMA 3KYDB 4U7DA 1N75A 4BGDA 2PI0A 4JBAA 2ZXHA 2BV6A 3GO5A 3A0HC 4R1HA 2DA4A 1E3HA 1MZBA 1NK2P 4U0VA 1S7AA 2H8WA 3U2RA 1T98A 2DQRA 1YS6A 2QGUA 2M34A 4UUVA 3J7ZI 2R93J 3J81K 4IRHA 1MJ9A 4NHJA 4ZDOA 2BY3A 2OUMA 5DEQA 5LGTA 1WFXA 1ZREA 2PJRB 1IGNA 1EKEA 1E2XA 1ENHA 3MZYA 1LE8A 1OQYA 1UG0A 3IC7A 3SZPA 3T8TA 4AIHA 2Y69H 2X6WA 3HOYJ 1G2HA 4RM3A 4ANJA 4NC7A 5FO5A 3V7CA 1YG2A 2XB5A 2R5ZA 2UXXA 3P5JA 4U7BA 3GFLA 3AG2H 2LF7A 1Y8QB 3QWLA 1K4TA 5F0CA 4HOBA 2OAZA 2DMTA 1DU6A 3LWFA 1TNSA 5LLQA 3HOZJ 1W7PD 2X6OA 3QU6A 1YHQI 3M3YJ 1XCBA 4M6VA 3IH3A 4OOIA 4CCNA 5HDNA 3MFKA 1F9NA 4KMUX 4DBQA 2WY8Q 3IH2A 2K9MA 4E7KA 3S3NA 3WGHA 1D5YA 4Y13A 3L1PA 5KAFC 2BE5F 3ERED 2CMPA 2FRHA 2H1LA 4BHBA 3LSRA 2E19A 3KZYA 4MO7A 5DTDA 1R1TA 4WXCA 4O6JA 5ERIA 2DOEA 3T8RA 4ZZLA 5GPAA 5M5XJ 2BXZA 4FE7A 3E1SA 3TOBA 3L2QA 1B9MA 3D5LA 3ULQB 4KFCA 2Z33A 4LGWA 1H9TA 3HZJA 4UVAA 3U9GA 4MIMA 3L9FA 4XKWA 2KDZA 2XKPA 2OV7A 3S1RJ 1LE8B 4ZC3A 2QQBA 1FP1D 5HLHA 2CFOA 3NQOA 3X2QH 3C2HA 5GAGJ 2K3PA 4I6ZA 1T33A 3FMRA 2H8RA 2TCTA 2GLOA 3IAM2 2R5ZB 1KQ0A 3N97A 3CC7I 4AM3A 4ENMA 2V1XA 4Y15A 1IN4A 4V2FA 4ZTFA 3DKWA 3CO6C 4A6DA 3CCJI 3FIWA 5D6FA 3AG1H 2BYVE 3EUKL 3KLNA 3OIOA 4RB0A 5E8IA 1W4MA 1D3YA 1IXCA 4HX8A 3HSFA 4P9UA 4XR6A 1I3AA 3LA7A 2EFWA 3MMYB 5DCMA 5BPIA 3SZGA 4WX9A 1XDSA 3SZTA 2VXZA 5CVUA 5L3CA 1H0MA 3PJRA 1FX7A 4OAYA 2HQ5A 1S7EA 4ENNA 2ZSIB 3ERMA 4L0YB 1SD4A 3IH4A 3DBHB 2Y75A 5EEHA 3IRQA 4PSXA 1BC7C 4NUBA 4OU0A 2D1HA 3MKZA 1A36A 5IYCJ 3ECOA 3LSTA 1XMKA 5LEJA 1N25A 1MMGA 2FMLA 2L02A 5M5YJ 4LITA 2HR3A 2LDUA 4QLCU 3FBIB 4AVPA 1DUXC 5EGOA 1VTNC 1P2FA 2XVCA 3M4OJ 2P5VA 2WTEA 2DA2A 3IWZA 2PJPA 4LB6B 1IF1A 2O3FA 5J1YA 2XF6A 4XLEA 3HPGA 1HF0A 2KZGA 1O3SA 3LSMA 3BG5A 3JRHA 3J7AY 4BQQA 5E79C 1TT0A 4EJVA 1IXSB 3M07A 2NS0A 1U9OA 2VKVA 1MSFC 2R5YA 5IYDJ 1OCRH 3M7GA 2HQAA 3IHUA 2XC7A 3ZMDA 1MNDA 1BI1A 1KU3A 1FLIA 3W2AA 5KCMA 5DCMB 1JUPA 4XN3A 5IOYA 1BI2A 3BJAA 4BJ6C 3T5XA 4AWXB 1B72A 2R7FA 1EH6A 1IDYA 2RV8A 2DW4A 2LFBA 5L3DA 1MIJA 4IO9F 2OQRA 2M0MA 1WJCA 1D1AA 2HOAA 3R61A 2MC3A 4A3BJ 3W6JB 4HNUA 2ZJRF 2DMUA 3JW4A 5FLXZ 3MZHA 4ESJA 3DP7A 4ZJZA 5HVQC 1SVMA 2FSWA 2Z1DA 2M4KA 2ZJPF 1X2NA 2CW0F 2ZNYA 3K10A 4B4CA 1B9NA 4N4OB 3OIPA 2XSJC 5HS7A 3GTOJ 5EGOB 2KJBA 1XG1A 4XICA 5IP6A 2WB1N 1VQ8I 5DV5A 3DTIA 3LQRA 4OAZA 2ZO4A 3CCUI 2LKSA 4MHGA 1G59A 3F21A 5DCFA 3RI4A 1XTAA 3C2GA 1A35A 2XASA 4J19A 5LD2C 5DM7F 3ISPA 2X6XA 4H4KC 2EV5A 4AUXA 1TWGJ 2P5LC 4I01A 1QO0D 3JAMK 5D8KB 1YFHA 2JJ7A 4Y4RA 2IA0A 3KP4A 4XOTA 3CJRB 4LG3A 2HDDA 5HLTA 3OYLA 4DGWB 4V19K 1LVKA 2DAOA 2KRHA 1S6LA 2OC6A 2RQPA 3I9V2 4HDVA 3HG9A 2VJ5A 4S0HB 2XAGA 3OYGA 4YFXF 4Y7NJ 1IUFA 3K2AA 1B72B 3U1DA 1P4WA 4BU2A 4J01A 3OYFA 3OR1C 3OSFA 2R7TA 2FX0A 1FIPA 2MYSA 3H35A 4CH7A 1J2XA 2L9SA 2PEXA 1UB9A 2R4GA 1DGRM 4CZCA 5CQEA 4KIFA 1RKTA 3J80K 1RI7A 4E7LA 2O6GE 3CQZJ 5D6EA 3GTKJ 2E71A 4XORA 4CCKA 3SFZA 1BBYA 2MG4A 2EWNA 3TP0A 5E3MA 3QYEA 4L9TA 1ETQA 2LKPA 2EZLA 2HVRA 1YW7A 4BKXA 4B1RA 1T08B 3BZCA 3CCYA 3GCMA 3ZN1A 4BNCA 4ETSA 1FMVA 5HDKA 3IKTA 2O03A 3TMOA 1Z1DA 1DP3A 2B0LA 2DT7B 3E0JB 2HKOA 3BR0A 1A6QA 3CUOA 3F72A 3G4SI 1KYWA 1BIAA 1TZLA 2QSHX 1G3TA 1HW1A 1R4NB 2LSOA 3ZQ7A 3VYSB 3ML6A 1R6RA 3PFIA 1ZGWA 1LEBA 1YO5C 2FBKA 5H20A 2XAFA 3CUQA 3IKVA 2WAEA 4KDPA 2ELKA 2R7OA 1HW5A 1RUNA 4M3EA 2KMUA 1DGWY 3CUQC 3WTWC 3MKLA 5CVIA 2QM3A 1SFUA 2LKXA 1LFPA 2VASA 5E1XA 2VIXA 3I58A 1ON1A 3G1LA 2CV1A 1D1CA 3BWGA 2DFIA 2ZC2A 1WSUA 3HSEA 5F1RA 1W0TA 4BQAA 2R3SA 3NRVA 4HSTA 3KX2A 4LIUA 3OYAA 2KQRA 1TW3A 2DBBA 4S05A 3LNQA 3BR6A 1RIOH 4IJAA 1GT0C 1CQTA 3K70C 2MA3A 5EJCA 1MMAA 3E6MA 5KNLA 4BDZA 2QLZA 3FZVA 2FUG2 4WXDA 2V9PA 2DXIA 3BR1A 1S5LC 2GBYA 2V6EA 3SEQA 4F92B 1XSXA 2P81A 3TQNA 1TW2A 2Z16A 5DS9A 1IN8A 1WJDA 2MSYA 1W5CC 1IC8A 2Q2EB 2WV0A 3E6CC 4FCYA 1BOBA 3BCAA 3MEXA 1P92A 2V9VA 1K83J 2W00A 5L3BA 4G6TB 2OQGA 3GTMJ 2EFQA 3PQKA 3WE2A 4BJ5C 4RAFA 4IHTA 1AOYA 4XKVA 2EB7A 3WU2C 3LL7A 4CYCA 2G0EA 3I56I 1TWAJ 3CUQB 4UHTA 3F8BA 3LSGA 5J4VA 1I27A 4A3MJ 2JA2A 3Q9VA 2AS5F 1FJLA 1JXSA 2F5CA 1EH7A 1WI3A 2DK5A 5J1RA 3GXOA 4Z6YA 2XAUA 4BE2A 1IN6A 4XRSA 1IV6A 4N9HA 1PUFA 2E7XA 1X3UA 3ZMZA 3L7WA 3CCQI 3CF2A 3HGGA 2FE3A 3WTTC 1BR4A 4XMYA 5L3FA 2CU7A 2RKHA 4G94A 1V4RA 1Z9CA 4L5IA 1YRNA 4ITVA 4KYWA 1MW7A 1ZLJA 1EF4A 3WTUC 2OTLI 3K4CA 1BL0A 2M2EA 5TJJA 1ZK8A 4Z2YA 3LSKA 4EATA 3ZRGA 2H27A 3FKJA 3V7RA 1S9HA 1H89C 1FYLA 4PJMA 4IRIA 2AHQA 1RESA 2FNPA 3CO7C 4LK0F 1I1GA 4J00A 1I1SA 1T38A 2OZ6A 1KU9A 5M3MJ 1HDPA 3GLLA 4XKCA 3ZMUA 2W25A 5K5RA 4HV6A 2RN7A 5D8LB 3TW7A 3NAUA 1JT0A 5EZHA 2I8DA 4KN7X 4OMYA 1J75A 2JUCA 4A3DJ 2E60A 3WGGA 3HRUA 4BY1J 1PUFB 1QZZA 2ZB9A 4RB2C 4E70A 3B6CA 4ESBA 3B73A 2KPMA 5BS6A 1ZELA 1XB4A 5F0HA 2L7ZA 3ABUA 2DO7A 5CVVA 3RYRA 4C3IJ 3D1NI 4EGZA 4KNYA 1IW7F 2VE8A 5E1WA 1IO2A 2GIZA 3CJTB 1REPC 1FNNA 1YRNB 3EUHA 3SDBA 4IOAF 3VODA 3AAFA 3DV8A 1Y56A 4HAMA 3KEYA 3L2CA 2W7NA 3QOPA 3OWTA 3K70D 4P5OA 1ZGAA 3F8FA 1MD0A 4DZPA 3E97A 3O2PE 3OYDA 1C0WA 4PFOA 3EDPA 1ZRCA 2R7XA 4XL9A 1D5VA 4PDKA 5HS8A 1OCOH 4BH9A 1SVLA 2F5DA 4BXUA 4C2TA 3KFWX 1X4PA 3EUAA 3O8HA 1HSTA 2DTRA 3WTXC 4M73A 4JYKA 1K78B 4MNUA 4XLHA 1SD5A 1TBXA 1Z0XA 2DLLA 1LFBA 5EDNA 1YJNI 3FK6A 3ZOBA 2KRFA 3TW6A 3GFMA 3LA2A 1GHCA 5A2QZ 2YU9J 2CV0A 4ZDLA 5EEAA 1FIAA 3ZQFA 3BG9A 3K4LA 3GTPJ 3JRCA 3NEUA 4A3FJ 2IGOA 2X9DA 4UV8A 3WU0A 3F23A 2EFOA 2A68F 3FWEA 4MGRA 1VQNI 1IDZA 3A01A 5J3LA 1R4MB 1OPCA 2K9NA 1G6NA 4BL0B 4KISA 1U0JA 3BTJA 1FBUA 4HF1A 3OYMA 4IXAA 1K79A 2L4MA 2L7FP 3BTCA 3CCMI 1KU2A 3GW2A 3JRFA 1ZQ3P 4YIIA 3H36A 3S1NJ 2LRDA 3H1CA 4D7MA 3I5UA 3P9CA 5E18F 3MKWB 5EG0A 4C2MJ 5IT9K 3BCBA 2CO5A 3ABMH 4A3KJ 1AKHA 2V4JC 4CCJA 1I39A 2K27A 3RSNA 1VQPI 3FHZA 1QZEA 1KQ8A 5CJ9A 1FEXA 2KL4A 3FX3A 1WVRA 2OD5A 1F1ZA 3BPXA 4C9YA 3F6OA 2H94A 1JTYA 3WG7H 3KYCB 1X1PA 4U87A 5ED4A 5D5VB 4Q4ZF 2VC0A 1YJWI 2DYRH 5ILVA 2HOSA 2HU9A 3JRBA 1G3WA 4ZH4F 1Z91A 4ZDPA 1ETWA 3BQZA 1NHAA 3FXUA 4HPQA 1GDTA 1VQ7I 1GLNA 2NVUB 2NVQJ 4GXOA 4Y33A 1DQUA 1KONA 1T0FA 2IEKA 5FRMA 4HV5A 2R7ZJ 1QQIA 5B5EC 1EA3A 3A01B 2E1NA 2LREA 2LY1A 2GA1A 1T0FC 3CLQA 4XN0A 2R7SA 3K4JA 2IAIA 4Y17A 2RQQA 4A0ZA 2PJRA 4CCOA 3ZMTA 2STWA 2LTPA 1ONVA 3GF2A 3WE3A 3MVPA 4M3GA 2VUMJ 1Y0NA 3QODA 2EZKA 1YQAA 4NC6A 2Q8KA 1J5YA 2EK5A 1W36C 4XM3A 2L01A 5HLIA 2O7OA 2LYCA 3BJOA 4WCGA 2KDOA 1V5GA 4HQEA 5EG0B 1S29A 2N8GA 2JA6J 2F2EA 3CESA 3FXLA 1MH3A 3PM1A 3B02A 4UB8C 1AKHB 2X51A 3QP5A 1R23A 2VPRA 1WRJA 4RA2A 3GFJA 1TWHJ 4XSZF 1MBHA 4TV7A 5CVRA 2F5VA 2A3SA 2L9VA 1B6AA 4A6EA 3CCVI 3RQIA 3M1CA 3QRFF 3S1MJ 1JHHA 4JX6A 1X3WB 1L0OC 3TOAA 2DFEA 2CJJA 3E5XA 2VJJA 2A5WA 3V4GA 2Y9YA 2VN2A 4IKFA 2O0YA 4B3XA 1ZARA 4D1QA 3H0GJ 2R7UA 4FQGA 1NH3A 3VYTB 1WPKA 1Z3XA 2W82A 2M30A 3FHNA 4L9NA 4C3HJ 2KLOA 1MMDA 3RKXA 2BXYA 1AA7A 3U1KA 3DCFA 3H5NA 4L5JA 1WI9A 3UR3C 4RGXA 1J59A 1SC7A 2M4GA 5E3NA 2O8XA 4CUGA 3ZQQA 1F43A 2JQ7A 3SEZA 1MBEA 4QSHA 1OLTA 2IGMA 2LG4A 3W6VA 2EFNA 3BR2A 3DQVC 3JSOA 4GDFA 1RETA 3BG3A 1T2KA 1H9GA 2HOTA 3GYHX 3HOUJ 4Q47A 1KQ9A 2X85A 2UV1A 5AIPA 3CCRI 5D5UB 3L2RA 2P6TA 2QF7A 3BTLA 3N05A 3ZR8X 3M8FA 2EQRA 4IHSA 5FJ8J 3Q0WA 4P9FA 1IJWC 2DA3A 2DFFA 2QQ8A 3PQJA 2K02A 2CUZA 2EV6A 3CMAI 4LJZF 2IBDA 5F1JA 5E1ZB 3LQQA 1Z6RA 3DF8A 3BQYA 2AXLA 2XRNA 2AO9A 1ZTRA 3CP2A 1PP7U 1DPRA 2AQFA 2ZXIA 2JPCA 5IOZA 4I98B 4D0PA 4OWRB 1XGOA 2FQ4A 2CQ7A 4CO8A 4FHTA 4CDGA 1SMYF 1SFEA 1LEAA 5E17F 1J0RA 4EM2A 3OYEA 3MAJA 2M5WA 1Y0UA 2PX9A 3ESWB 2E1CA 5GTHC 5FGMA 4HQMA 1H88C 4I0BA 4WK8F 2R92J 3KP7A 2EBIA 2VBXA 1Z05A 1VQKI 2E5ZA 2IP2A 3CJQB 3S17J 5J47A 4FX4A 3AG3H 2JVGA 3HHGA 4XLNF 2V9KA 2XSDC 3S2HJ 1BI0A 2ZMEA 3S16J 1W36D 5FKNA 3I3LA 5J6XA 2OZUA 3BPVA 1YW9A 4RGSA 4KITB 2ZMEC 4E7SA 3V7SA 3OYBA 3GTJJ 3HOSA 3JRDA 1W5SA 1K6YA 3REOA 2WADA 4RS8A 3DPTA 1QU3A 3OYCA 1G4DA 3Q3SA 2HYGD 2VOPA 2X4HA 3K1PA 2L3DA 2YR2A 1HQCA 2HEOA 2LNBA 3PL8A 2PLYA 4LLGF 2HXOA 2K4BA 4BACA 4II3A 1UAAA 1B1BA 1QPIA 4E7JA 2OTJI 2P6SA 1IN5A 3AL0C 3DTEA 3TL4X 4C3JJ 3MKYB 2IS6A 2Q0OA 2Y2ZA 3LAJA 4EVIA 5BMZA 3K7AJ 1SANA 3F8NA 3S14J 1A31A 2MD5A 2VQCA 2E1OA 3OOUA 4HLXA 3VPRA 3OYJA 2V1NA 2ME6A 2VB6A 3M9AA 2M87A 3J7YJ 1T8IA 2CQXA 4IX7A 2OPTA 2K9SA 4CGZA 1ITYA 5FLMJ 5H2FC 4KUMA 2HYJA 5AONA 1CF7B 2ICWG 2YX4A 2ZMEB 1GXQA 3S1QJ 1YLFA 3PNVA 3M8EA 5CVJA 3R6SA 1WZ2A 1P4AA 2PMUA 1S3JA 3SDGA 4U0WA 3DFGA 4L9VA 3G73A 1TWFJ 1ZHFA 5LBQA 5DUIA 3K4MA 1WGXA 1WWXA 3QPLA 2BOLA 3RCOA 2JA7J 2DOAA 3DXJF 3W2WA 3V8LA 2L2OA 2XGCA 3JRIA 1MH4A 5EEGA 2EJRA 1OKRA 1BW6A 2JA8J 1APLC 1N77A 2V1UA 3AL0B 4DYQA 3Q5FA 2IXSA 2GA2A 3HUGA 1VQ6I 1RUOA 2EZHA 2QSGX 3L2UA 2AXTC 1X1CA 4KIGA 1R58A 3A4CA 4YRVA 4CICA 4XSXF 4Y3OA 2HTSA 2A6HF 4ESFA 3GEZA 2VQHA 1RR7A 3HL2A 1S7OA 3L2VA 3GUDA 2PFBA 3C7JA 3C1DA 2DU9A 4L18B 3CDIA 2B63J 4MEYF 1STZA 2JRTA 4YIFA 4EM0B 2ZFWA 1ULYA 1D1BA 1S72I 2CQNA 3ASOH 3LSPA 2ID3A 1ORKA 4P1WA 1FBQA 3ZPLA 2GAUA 4YFKF 4CYDA 4EM1A 3EQLF 1V3FA 4A5NA 1MMSA 3WHCA 4DNCA 1Z67A 4CSWA 3SJMA 2V26A 1BOAA 2ZXWH 4UUTA 1BM9A 1P9QC 4YIRX 4PCQA 4G6QA 4U88A 1MJBA 1X1DA 2DDAA 4I0AA 5HNHA 2M0CA 4ABZA 3GBGA 1CGPA 3PFYA 3QU3A 2FNAA 2XF5A 1ETXA 3S3MA 1JKRC 4BHCA 2G9WA 2GWRA 5LRRA 1WQ2A 4DOZA 6PAXA 3TO9A 1JUSA 3K69A 1SFKA 2L54A 2NVXJ 1OR7A 2LK2A 4BHPA 2VXDA 5FLXK 2L5QA 2FBHA 1TT5B 3HUGB 1EH8A 4X0GA 4GYGA 4XQFA 1IRXA 3ZQGA 3QQAA 2XPUA 3W6KB 1OR7C 4HA8A 2Q2EA 1K61A 5D5WB 3ZGKA 4EEFG 5L3GA 2UXNA 3V42A 2QENA 3K2ZA 3PO3J 4LFUA 1NG6A 1JGSA 1Y1VJ 2ISYA 3VEPA 1O7LA 1Y1WJ 1SFOJ 5E20A 4M6XA 5L3EA 3O8GA 2M8GX 3ABLH 3HKZN 3RPQA 5K7HA 2EA4A 4HW0A 2M3AA 2GIVA 4DJAA 1VF9A 2MGQA 3LFUA 3QPHA 3A2KA 2O8KA 4PJJA 3E6DA 2R7DA 2V1DA 3K1NA 3P9IA 2WAFA 1UZCA 4B48A 2FOWA 2RVCA 5E3LA 2X1CA 5HNFA 4N4NB 4Y52J 4IHXA 5F08A 4CCLA 1VQMI 2A6EF 3P9KA 2Y0SN 2E36A 2R7WA 4L5EA 4XBFA 2NXNB 1NG7A 3HSRA 4WXHA 1QVUA 4JX5A 3ROUA 2HPIA 4F55A 2RC4A 3LFKA 2DMQA 2QQ9A 2ESNA 4YG2F 1O3TA 2DJNA 3UNGC 2ZJQF 3I0TA 3OL4A 2KHMA 4ON0A 1LQ1A 2E2IJ 1YW8A 1MBGA 1MBKA 4M9SA 2DODA 3PUBA 4PJNA 3CMYA 2JK3A 1BN5A 2HZDA 4XRMA 1NTCA 1O4XA 4MLOA 1U3EM 3OYHA 5DDGA 2VLAA 4IHVA 1FBSA 5JVTA 4BEHA 1WJAA 1HC8A 3JSPA 4MTDA 2W57A 3H3ZA 1FMWA 5JHUA 1R1VA 2BHZA 3GZ6A 2A05A 3FMSA 2ZNZA 3OYIA 1B8IB 5FFXA 1AWCA 4E7IA 1D0ZA 2F4MB 1G3YA 3ZXSA 4LLLA 2ZCWA 3SHFA 5LGUA 4AYBA 1JGGA 3TO6A 2JTVA 2K3FA 2BZTA 2VKDA 4N9IA 1FP2A 3N4MA 4GYIA 4A3LJ 2DJIA 3FM3A 3F8CA 1MJAA 2I5UA 1VI0A 1Z6TA 1XSVA 2A61A 1LJ9A 3HKZA 1AHDP 1T95A 3HGYA 5BNGA 4OINF 2PMHA 3E3VA 1YS7A 2Q1ZB 4KIBA 4EJOA 2QCOA 3QPTA 5C44J 3GTQJ 2VKEA 2J5PA 1I3QJ 1JT6A 3PO2J 3BROA 3VYUB 3P7NA 2LP0A 2MC4A 3GZ5A 1RZ4A 3VSLA 1ZG1A 1ZG5A 2LF8A 2DN0A 4D5CA 2E34A 3HPHA 5FKOA 1F4KA 4BBSJ 3HEFA 2F5FA 3HTSB 2Y0SA 1OCZH 3BJ6A 4BJTA 1U5TA 3A1YA 5LHHA 4BEHB 3I71A 4HNTA 5B1BH 4B43A 2M7BA 3DEUA 1U5TC 4RAZA 1TC3C 5KVRA 4F91B 5EF6A 3WGIA 4WF2A 3EYIA 3HRTA 1XGSA 2I10A 1HKTA 4O5VA 4IVNA 4FTHA 5DD4A 3UKGA 1K78A 3AFHA 1OMIA 1TWCJ 2STTA 2TDXA 1V55H 4HNVA 2ME0A 1BIBA 3CMEI 3VWBA 2IGKA 3BG7A 1K6OA 1XN7A 1P4XA 5J8CA 2D1VA 1MNEA 3B6AA 3HOXJ 3FXJA 5IP7J 2W24A 2LMDA 2FA5A 2QVOA 4RBOA 1FSEA 3QYBA 3MN2A 3G6EI 2EV0A 4D5FA 3WTYC 3H5AA 4DBRA 3FMQA 2FU4A 2X0LA 2K4JA 2CYYA 3EETA 3R0JA 1MKMA 2E2HJ 4ASNA 4HF2A 1ZKGA 2GM4A 4G8XA 1GVJA 1XCVA 2TRTA 5ILUA 2X1EA 4G7HF 3OYKA 1LFUP 2CUJA 3S3OA 1MBJA 1U5TB 2H1KA 5KHDA 3KETA 2CRGA 2RNJA 1I6HJ 3VDXA 3KEOA 3KLOA 2PG4A 5D5XB 3C3WA 5JI6A 3DPUA 2UWMA 1TTYA 3MD2A 4AIJA 2DK8A 2GOMA 1DP7P 5FKMA 5J8FA 1GV5A 2ESHA 2VOOA 1D8KA 4CHUA 1KGSA 2FD5A 1FOKA 2W4SA 3R4KA 3VOEA 2DA5A 1O3RA 2JSCA 3IWFA 4E7ZA 4NB5A 1U78A 2IA1A 2K9QA 1KYZA 3BR3A 4F3QA 1ETOA 5D4RA 2ZSHB 4G7OF 1FOXA 5GTIC 4RGUA 4AIKA 1JE8A 1SFXA 4RAYA 3H5RA 1BJZA 4L9JA 2ZBKA 3K1MA 5DYMA 1AU7A 2Z5UA 3LOCA 1WH5A 5JVGF 1VZ0A 2P8TA 2DCEA 4RGRA 1HKQA 3H9GA 2Z2SB 3BC8A 5HODA 3KE2A 4R8HA 1K7AA 3I4NJ 5K5QA 2DT6A 3S93A 2W84A 1Z7LA 4A93J 2GQQA 1O3QA 5D4SA 2HGCA 1FYKA 2CW8A 4ENKA 3QYFA 3HC7A 2CFXA 2MD0A 4DIQA 1VFCA 4UVBA 1UMQA 5LHGA 4IQJA 2J5OA 3GX4X 3DTKA 2DTZA 1MBFA 3AG4H 1QGPA 5F0FA 3HTUA 2UUZA 2XV4S 1P7IA 1FOWA 3H92A 5JLWA 4IF4A 2HVSA 2QYOA 3BTIA 4QTRA 3IRRA 1K4SA 4NDLA 2QSFX 4R79A 5CYVA 4IPAA 2Y48A 2KIQA 5ICCA 3JTGA 1SEUA 3MZ8A 2PBIA 2H6CA 3JRAA 3OL3A 4RM2A 2JRMA 3CP8A 3G1OA 1HBXG 9ANTA 1QA6A 4KT5C 1J09A 5A2QK 4PUSA 3VFZA 1BR2A 3C18A 1OISA 1HLVA 4JP0A 1YX5A 1KA8A 3ZQCA 1UHWA 4M9XA 3FM5A 5B66C 3TEDA 3IV5A 4CXFA 3ECHA 2ZXJA 4FE4A 2FOKA 4II2A 2OBPA 3RYPA 3H3UA 3BLYA 4UV9A 4I76A 3LMMA 4M6YA 4XOPA 4YFNF 1FWZA 3GFIA 1TQPA 1UELB 4PGGA 3RQ4A 3T0YA 3VYRB 3ZQLA 3J81Z 1A6IA 2KISA 3TGNA 3K6GA 1DU0A 2PN6A 2EIKH 1SD7A 2WV1A 4BE0A 3CTAA 1SD6A 1ZRDA 3DPLC 4AC0A 2MABA 3J7AO 1FT9A 4UUSB 2AQEA 5ICGA 4ZYAA 4M9ZA 3CDHA 3HOTA 2LOOA 3HIFA 1RKWA 2JA5J 1RNLA 2DPUA 4G7ZF 1BA5A 4FISA 3OS1A 5M3FJ 4I7HA 1FC3A 5JLXA 1DDNA 3G2BA 4G6DA 3ZQHA 4B09A 3OV8A 2XDVA 3JTHA 3BZKA 4RB3C 1ERDA 3I54A 2A69F 1BI3A 4FT8A 2OCEA 3D5RC 3FF5A 4RLQA 3FBNB 1U6GA 3LSHA 1LDKB 5J4YA 1R49A 2L9RA 5J1UA 5F64A 1LNWA 2JPBA 4QPOA 5IY5H 2ID6A 2P5KA 2D5VA 4ZYHA 2ELJA 2Z9OA 3E5QA 2M8EA 2BY2A 1QBJA 5FRNA 1W5TA 4A3JJ 5DD8A 3F8MA 2F5EA 1W0UA 3PSFA 2YPRA 2H09A 3G71I 2R7QA 1V5FA 2V79A 4A69C 1XMXA 2RNGA 1R1UA 3PSIA 4GFBA 3GZNB 2LBFA 2KP6A 3H3VK 1QPMA 3RTRA 2RAEA 3VSKA 1G3SA 3MWMA 2MW8A 2WWYA 2L9NA 4K2EA 2MH9A 4D7NA 3FDYA 1FZPB 1P7JA 5F27A 3KEQA 1I6XA 1ON2A 1OCPA 3A03A 4X6AJ 1D8JA 4HEA2 1LVAA 3JRGA 4RAGA 2DPDA 3IAS2 2HPMA 1LUJB 1JTXA 4KJZA 2CG4A 5H6RA 3OY9A 1R71A 1IZ1A 3K4KA 2WY7Q 4I02A 5BPDA 4DZJA 2E2JJ 1JI8A 3O6BB 1ETVA 5DUKA 2KIUA 2IS2A 1IG7A 1IRFA 2Z99A 4PJ0C 4MQVA 2IS1A 2RGVA 5GPCA 1R36A 1XC5A 2BVLA 1Y39A 3NARA 1HXDA 1XMAA 4I09A 4IOCF 1LDDA 2MLKA 3DKYA 1D0YA 2PMZN 4A3IJ 2JN6A 2NS8A 5K7ZA 2LH9A 1QNTA 4PSWA 1VQ4I 2IPQX 1XPXA 4EGYA 3GWZA 2HWVA 3C2BA 2RDPA 4I99C 2LBFB 2DA6A 4A2UA 2WBMA 2VJIA 4EMSA 1HW2A 3DU5A 1CF7A 5BQTA 4OIQF 2GXAA 4B47A 4UNOA 3M1EA 3HYIA 3S2WA 1BR1A 3GMEA 1E3PA 2OF7A 2JVHA 1T39A 2V7FA 3HHHA 3KZIC 1Q1VA 4A5MA 1OYWA 1WJEA 2MBFA 2YSRA 3PIPF 3OYNA 2O5RA 3SFIA 4IZZA 3GTGJ 4LIVA 2K85A 2DQLA 2KFDA 3S15J 2VQLA 5FD6A 1LB2A 3CLOA 1XSDA 4LG0A 2CSOA 1MMNA 2JSPA 4XIDA 1SAUA 4JQFA 1U8RA 1ETKA 1HA8A 1P6RA 2ECCA 2O61A 1TNTA 3TO7A 2DDBA 5HLGA 3FXOA 2VONA 4M72A 3F22A 5IYBJ 2NVYJ 3CZ6A 5F04A 4G9YA 2QUFA 4MQ9F 2W1OA 4W97A 2IJLA 4DQ2A 1XD7A 5B1AH 4JK1X 2BHYA 1VNDA 1R5ID 3I53A 4P55A 4O3MA 1X58A 5KK1A 2BVMA 2E7WA 3JREA 2GXGA 2HNHA 5H6QA 5TGTA 2XUBA 1XX5A 4LD5A 2XGDA 3ABKH 3FXMA 1BW5A 1ZLKA 2IS4A 1O7FA 2M45A 2R0QC 3DBRB 1FSHA 4ZYGA 3CD6I 2VBYA 4HX7A 1OYYA 4XLCA 3JAMZ 3H9JA 2EPFA 4PFPA 2XKOA 1ZG3A 3ZQIA 2Z3YA 2FBIA 2PMZA 1JKOC 2VJ4A 2OJED 4JX4A 3FK7A 2DA7A 5HS9A 1VQOI 1ODDA 2JT1A 2UZKA 5IP9J 2IGNA 2KRCA 1S8NA 4BXFA 2R7RA 3OOPA 1ETYA 4LOCA 2GZWA 2XAHA 2Y30A 4LG0B 4DYRA 1T6SA 4LLNA 1PP8F 4GCVA 2W85A 2LR8A 3J80Z 1L3LA 4L0ZB 3KP2A 4X1EA 2A07F 1WJBA 2MLGA 5E3OA 1YTYA 2BEOA 3QPSA 3KYLA 3HRMA 1JHFA 3E6BA 1YIOA 1PJRA 1X1AA 1QRYA 4F52A 2NOGA 2VI6A 2ETHA 3DEEA 2D45A 3OIQA 4LMYA 3SXYA 2EFPA 1LKXA 2X1DA 5JR3A 4HSRA 1Q1HA 1VQ5I 5LGNA 4ZZDA 3ZN0A 3W3CA 4A0XA 4OIPF 4AIDA 4A3CJ 4OIRF 5ILSA 1QHHD 3Q9SA 3HOVJ 1USSA 5K5OA 5GADJ 3RJPA 1JUMA 3HXLA 3RPUA 1IAWA 2WC2A 4LB5A 4WWCA 2XAQA 2R5YB 1H8AC 5AIQA 3WODF 4M3BA 4BUPA 1UJ8A 3F9KA 4NNJA 5FLVA 4OIOF 4IEJA 3RKYA 4A3EJ 3CMMA 4B8XA 2JMWA 3V8JA 3DEWA 4ZTJA 2DMPA 2XIGA 2OCCH 3S32A 3TDZC 5C4XJ 2H6BA 3BP8A 1PVEA 5IPAA 3LAPA 3BDDA 4FASD 2M1BA 2Y9ZA 4DW6A 2A6TA 4AYBN 2YUSA 5IT3A 1USTA 3U21A 1U8BA 3PNYA 4XLFA 3TDUC 3BZ6A 4RMNA 3A0BC 3ZMVA 2QBYA 3E7LA 4CCMA 4LK1F 2HXIA 4MFEA 5DM6F 4JOMA 1YX3A 2XF7A 3ABTA 1HCRA 1F5TA 4ENJA 3DLAA 5FB2A 5FFZA 3A02A 1B8IA 5F6FA 4B44A 3LA3A 5TRDA 1DPUA 4FETA 2QEXI 3D0SA 3FXQA 3BR5A 3I59A 4M3FA 1PDNC 1ZAOA 4BS9A 3R0AA 2IW5A 1FTTA 1U9NA 2LC2A 3KIOA 2IT0A 2P7CB 3HM5A 1VQ9I 4EV0A 1YIJI 1TQIA 3Q0UA 2ZFUA 1UFMA 3SYTA 1XGNA 2K40A 1XDUA 1HKSA 2BW3A 2ISZA 1MSEC 1X3ZB 1X4OA 4BAYA 4M74A 1R9TJ 3BT9A 3L09A 2B9SA 5GP9A 4AVZA 1IUYA 2WB1A 3GVAA 2NNNA 2KT0A 2K5CA 4C2UA 4EJTA 4UVCA 1I5ZA 2VBZA 3TBIA 1E17A 1GXPA 3HJEA 2HS5A 5EZGA 3TP3A 4KT6A 2FQ3A 2MH2A 1PYVA 5B3SH 3CDLA 4BYYA 1XS9A 2BGCA 4IRGA 5CQGA 4MFDA 1ZH5A 2QBYB 5CKTA 3S8PA 2FF4A 4E7HA 4PK4A 3W2VA 4M3DA 2DMNA 4ZYDA 1PUEE 5EYRA 2XAJA 3BG6A 1B59A 3T1BA 5GAHJ 1X1BA 3COAC 3OS2A 3K0LA 1LDJA 3WTSC 2P4WA 2HZTA 2IVMA 3K4BA 1ZR2A 2F6CA 4A0YA 4XLAA 2P7VB 1YYVA 5KAIC 3VB2A 4HYEA 1IV8A 2HQNA 1ZYRF 3I59B 2JUGA 3BY6A 1YE9A 1G8XA 2HQRA 5E8GA 1W1WE 4GGGA 2YS9A 3IUOA 1UG2A 2QQAA 4RLFA 2CH0A 1Z3YA 2K9LA 2QA4I 2ECBA 3MCZA 3RKQA 2WAQN 2BW3B 3BOQA 1ZGJA 1ZR4A 5FROA 3CC2I 1R5HA 3AKZA 1O57A 2FEZA 1YITI 3DLLF 4PJLA 4BY7J 2VE9A 4HDUA 3CCSI 4IL6C 3ZMSA 4A12A 2QWWA 1OCTC 1V5EA 4HRIA 3WU1B 3DWLE 4BQOA 1A04A 2K86A 2BY0A 4I2OA 2OU2A 1EV7A 2L0KA 3S2DJ 1OYIA 4HG2A 3LSIA 4YEJA 3RPUD 1SVOA 2B7EA 1JKPC 3FXKA 3EYYA 3CC4I 2HYFA 4YELA 2VT3A 1ACIA 2Y31A 4UB6C 1FOYA 2NOJB 4F7ZA 3K4NA 2HKXA 2HFHA 1Z77A 3OSGA 4FX0A 4CA0A 1JKQC 2DA1A 2NYXA 4MTEA 3M8JA 4HX4A 2KKOA 5J40A 1NK3P 1J9IA 3OR2C 5FD5A 4KA4A 3RIRA 3V8KA 2VPLA 4Q5SF 2CS3A 2VODA 3E5UA 2DYSH 2QKMB 3KPHA 4KICA 2G7UA 5CPRB 5FKLA 2FJ1A 4XK4A 2O9LA 1OCCH 2D2WA 2VQGA 2E35A 4GO1A 3HB9A 1XGMA 4CYCB 4NBQA 2CWEA 1YI2I 2ELHA 2C6YA 1Z21A 5GAEJ 3K9TA 2OA4A 3G3ZA 4XLPF 3IP4B 1TL8A 3G1MA 3QP6A 3SQNA 5ICEA 2ZKZA 4E4HA 1WJFA 3HDDA 3KCCA 3WTVC 3QOEA 4E6KG 1ZRFA 1KU7A 1E0EA 1MNMC 2VL8A 5JHFA 3Q0VA 4IHWA 1HSJA 1TLHB 1WJ5A 3CJNA 3RZDJ 3QAHA 3H0DA 3WHBA 4BDYA 3ZCOA 2WAQA 3ELKA 3KP3A 2LVSA 3O3KA 1RR8C 2XPWA 4N0BA 1U2WA 4QIWN 1IXRC 1R7JA 1FY7A 2DT5A 2JZYA 2RREA 3RZOJ 2A5YB 2E5NA 2DOFA 2KIFA 2P0WA 2CUEA 2X48A 4CZZA 2GXBA 2HVQA 4DYCA 4A3GJ 1Z7UA 1QZYA 1TP4A 1SAXA 3F3XA 1BC8C 3KZZA 4IQ4A 1Y8RB 4UY8I 1QHGA 3EUHC 2DI3A 1TQMA 3FKIJ 2HDCA 2NNYA 1WH7A 1WHUA 4M71A 5C4JJ 5IT9Z 3ONQA 1YJ9I 5M5WJ 1GV2A 2NVTJ 3TKYA 4UXNA 4D9JA 3LSJA 4ZYEA 2CV2A 3L00A 1RPWA 2FXAA 1POGA 2QKLB 3DU6A 3HRSA 1OFCX 2VT2A 4HZFA 3RKWA 3ZP5A 4F93B 2QZ8A 5BOXA 3JCUC 2XB0X 2VC1A 4Q48A 1GVDA 5TISC 2F48A 1V54H 2CGPA 1FPQA 5LHIA 4XRSG 1JJ8C 3PUFA 1VQLI 3HOWJ 3H9QA 5CLSA 1SMTA 3WG9A 1T56A 1X2MA 1R00A 4XRFA 1R5GA 4KN4X 3GTLJ 1KZHA 5ICFA 2WA0A 3FISA 2NAZA 2LLKA 2M7AA 4EJWA 1GUUA 2K7LA 2EILH 1MDMA 3L2WA 5HDGA 4OMZA 1R22A 1UCRA 1BJAA 5K7FA 5JFRA 2E1MC 2F4OB 1HDDC 2CW7A 4EJUA 1HOMA 3NWSA 2EINH 4UUSA 1F36A 1Y6IA 1W7PA 5HOOA 5K1YA 1EJ9A 4NQWA 2XRLA 2NS7A 3F0CA 2F4IA 2YU3A 1M1EB 1YOVB 1UHSA 2YX7A 4U0YA 2JWTA 4B3AA 2XHKA 3EPZA 3MQ0A 4NC8A 1UHMA 4V2GA 2EIMH 1FTZA 4G12A 4AU7A 1N78A 1RRJA 3NWTA 1WCMJ 2DFHA 3CF5F 2HOEA 1J7KA 2EH3A 4HBLA 4HLYA 2PQ8A 2XPVA 1JJ6C 2LY9A 2L4AA 2LY2A 1B4AA 2HI3A 5LEKA 4RDUA 2LD5A 5FKKA 5C3EJ 3WTZA 3JR9A 1D0XA 2CUFA 2MFZA 2ZJ2A 4EQQA 2R7VA 1A5JA 1RC9A 2E1MB 3KP5A 1MDMB 1LPQA 4RB1A 3D5SC 2L7KA 2GOXB 4QWQA 3PIOF 1IRZA 2ADUA 2NRAC 3I4PA 2XGEA 3I64A 4AD9A 3DBLB 2L7MP 2G7HA 1I50J 4QPQA 4HF0A 2VBWA 4C30A 1W7PB 3I55I 3OS0A 3I4MJ 4BE1A 1OJLA 2HDWA 2Y0MA 3PNTA 4NQWB 1ZN2A 1IN7A 1WKMA 3R60A 4PZJA 4IHYA 3KP6A 4XNFA 2V6CA 4H0EA 4W1UA 3F6VA 2EA2A 4KMFA 2M9HA 4S04A 4P96A 2IA2A 3CCEI 3CCLI 2X6YA 2COMA 2KZVA 2ACJA 2EIJH 4XONA 4BQNA 2EZIA 3DKXA 2VKHA 2FMYA 3GLXA 4PGHA 3RDIA 1E3OC 3ASNH 4BBRJ 3IL2A 3HBLA 3OMYA 2IRFG 1QVTA 2BY1A 2W48A 1X19A 2CQKA 4BXXJ 4MEXF 1MGTA 1FYMA 5LRSA 4GRIA 2XROA 2CQQA 2KJCA 4XKBA
chains in the Genus database with same CATH topology
2IS4A 4P5OA 5LFAA 2HPIA 4F55A 3OYDA 4PFOA 1N75A 4BGDA 4XLCA 2R7XA 3UNGC 4XL9A 2ZXHA 3H9JA 3OL4A 4PFPA 2KHMA 2PMZA 4C2TA 1X4PA 4PJNA 2VJ4A 3PUBA 3EUAA 2HZDA 4MLOA 4ZDOA 2IGNA 4XLHA 2KRCA 3OYHA 2OUMA 4BXFA 2R7RA 1WFXA 2VLAA 2PJRB 4BEHA 1WJAA 1UG0A 2CV0A 4ZDLA 1FMWA 2X6WA 3K4LA 4RM3A 3OYIA 4ANJA 4NC7A 4E7IA 1D0ZA 2IGOA 1WJBA 4U7BA 3ZXSA 4AYBA 3KYLA 2VKDA 4BL0B 1PJRA 4KISA 1U0JA 1X1AA 4CCNA 2DJIA 4F52A 3DEEA 3OIQA 4DBQA 2WY8Q 3OYMA 2K9MA 4E7KA 3S3NA 1LKXA 2X1DA 4HSRA 3HKZA 1T95A 2LRDA 2CMPA 2Q1ZB 3W3CA 3MKWB 3BCBA 3VYUB 1QHHD 2MC4A 2V4JC 3VSLA 3HXLA 4CCJA 3E1SA 3RSNA 3L2QA 3D5LA 3HPHA 4BUPA 2KL4A 3F9KA 4NNJA 2Y0SA 4BJTA 4XKWA 4C9YA 3A1YA 4BEHB 2OV7A 3CMMA 4HNTA 4U87A 4ZC3A 4B43A 4ZTJA 2CFOA 2M7BA 2HU9A 3S32A 3C2HA 4ZDPA 2K3PA 4HPQA 1GLNA 4F91B 3IAM2 4Y33A 1DQUA 1KONA 4FASD 5FRMA 2A6TA 1EA3A 3U21A 3PNYA 4XLFA 4ZTFA 2LREA 2LY1A 1T0FC 4XN0A 4RMNA 3AFHA 2R7SA 3K4JA 2RQQA 2PJRA 3EUKL 4CCMA 4CCOA 4JOMA 1YX3A 2XF7A 3QODA 4XR6A 3MMYB 3VWBA 2IGKA 3DLAA 3BG7A 1MNEA 1W36C 4XM3A 3SZGA 2VXZA 3PJRA 4B44A 4OAYA 2LYCA 4FETA 3QYBA 2KDOA 1V5GA 2ZSIB 3H5AA 4DBRA 4BS9A 3CESA 2X51A 4PSXA 4NUBA 2LC2A 3MKZA 2ZFUA 2X1EA 1MMGA 3SYTA 4LITA 3OYKA 2BW3A 2CUJA 3S3OA 3FBIB 5KHDA 1X4OA 2F5VA 4AVZA 3VDXA 2WB1A 3M1CA 2K5CA 3DPUA 4C2UA 3MD2A 2UWMA 2XF6A 4XLEA 2GOMA 3HPGA 3TBIA 3LSMA 4KT6A 3J7AY 4BQQA 2W4SA 1TT0A 1PYVA 2VJJA 2A5WA 4E7ZA 4IKFA 4B3XA 2HQAA 5CQGA 4D1QA 2R7UA 5CKTA 4F3QA 3S8PA 4E7HA 4PK4A 3VYTB 3W2VA 2XC7A 1MNDA 1Z3XA 2W82A 3FHNA 2ZSHB 3BG6A 3W2AA 5KCMA 2KLOA 4XN3A 1X1BA 1MMDA 1AA7A 4BJ6C 3OS2A 3H5NA 3H5RA 3K4BA 3UR3C 2F6CA 4XLAA 2M4GA 4CUGA 1WJCA 1VZ0A 1D1AA 2M0MA 3SEZA 3ZQQA 2DCEA 2JUGA 1OLTA 2IGMA 1YE9A 1G8XA 2LG4A 3H9GA 2Z2SB 3BC8A 4HNUA 3DQVC 3IUOA 2DT6A 3S93A 1Z7LA 4RLFA 2CH0A 1Z3YA 2K9LA 4ZJZA 5HVQC 2Z1DA 2X85A 2UV1A 2M4KA 2CW8A 3K10A 2BW3B 3QYFA 3HC7A 2MD0A 4N4OB 5FROA 4DIQA 3AKZA 3OIPA 3L2RA 2XSJC 4IQJA 4PJLA 3N05A 3ZR8X 3DTKA 3DTIA 4OAZA 1G59A 1V5EA 4HRIA 2CUZA 2UUZA 3C2GA 3DWLE 4BQOA 5LD2C 2HVSA 2X6XA 4H4KC 4HG2A 3CP2A 3LSIA 4YEJA 3RPUD 2AQFA 4R79A 2ZXIA 4Y4RA 4XOTA 3CJRB 4LG3A 5HLTA 4YELA 3OYLA 4DGWB 4OWRB 1LVKA 2KRHA 2OC6A 3I9V2 3HG9A 2VJ5A 2NOJB 3OYGA 3K4NA 3OL3A 4RM2A 3OYEA 3CP8A 4BU2A 4CA0A 4J01A 1J09A 3OYFA 3OR1C 2R7TA 3M8JA 4PUSA 1BR2A 2MYSA 3H35A 4CH7A 2L9SA 2R4GA 1DGRM 3OR2C 1YX5A 4CZCA 2E5ZA 5CQEA 2VPLA 2CS3A 3CJQB 4E7LA 2QKMB 5CPRB 4II2A 2JVGA 2V9KA 4XORA 3BLYA 4CCKA 3LMMA 4XOPA 2VQGA 1W36D 3QYEA 1UELB 3I3LA 3RQ4A 3VYRB 2HVRA 1Z21A 4KITB 3K6GA 4E7SA 3IP4B 3OYBA 4BE0A 1FMVA 3DPLC 3HOSA 4E4HA 1K6YA 2MABA 1WJFA 3TMOA 2AQEA 3QOEA 4ZYAA 2WADA 4E6KG 2DT7B 3DPTA 3E0JB 1DP3A 3HOTA 1QU3A 2LOOA 1E0EA 2VL8A 5JHFA 3OYCA 1WJ5A 1TZLA 3OS1A 3VYSB 1R6RA 3H0DA 4BDYA 3ZCOA 3PL8A 2WAQA 3G2BA 4BACA 2WAEA 4II3A 2XDVA 1UAAA 4E7JA 2R7OA 2W7NA 1ERDA 3AL0C 2KMUA 1DGWY 3DTEA 2RREA 3D5RC 3TL4X 4RLQA 3MKYB 3FBNB 2IS6A 2E5NA 2P0WA 3LSHA 1LFPA 2VASA 2HVQA 2VIXA 1LDKB 2VQCA 4IQ4A 2CV1A 3OOUA 1D1CA 3OYJA 2V1NA 1QHGA 2VB6A 3EUHC 4QPOA 4HSTA 3KX2A 4IX7A 3ONQA 4LIUA 3OYAA 2KQRA 3K70C 4D9JA 2ELJA 1MMAA 4BDZA 5KNLA 3PNVA 5FRNA 2FUG2 2CV2A 2DXIA 2QKLB 3DU6A 2V6EA 3SEQA 3PSFA 4F92B 2R7QA 1V5FA 2Z16A 4F93B 1WJDA 2RNGA 2Q2EB 3PSIA 1BOBA 3BCAA 3K4MA 2LBFA 3H9QA 2KP6A 2BOLA 3RTRA 2W00A 3RCOA 2DOAA 4G6TB 3VSKA 3W2WA 4BJ5C 2WA0A 2L2OA 4XKVA 2M7AA 3LL7A 1N77A 2L9NA 3AL0B 3L2WA 2IXSA 3FDYA 3LSGA 2E1MC 2JA2A 2CW7A 3L2UA 1X1CA 3NWSA 4HEA2 3A4CA 4YRVA 3IAS2 4Y3OA 1Y6IA 2HPMA 2VQHA 5HOOA 3HL2A 2XAUA 4KJZA 3L2VA 3OY9A 3K4KA 4BE2A 2F4IA 2WY7Q 1JI8A 3EPZA 4NC8A 2IS2A 3CF2A 2IS1A 1D1BA 1BR4A 4XMYA 4P1WA 2BVLA 4AU7A 1N78A 3NWTA 3DKYA 1D0YA 4ITVA 1MW7A 2LH9A 4CSWA 2V26A 4PSWA 1P9QC 2LY2A 3K4CA 2LBFB 1X1DA 3LSKA 4EATA 5HNHA 3ZRGA 2WBMA 2VJIA 3GBGA 1D0XA 3PFYA 2MFZA 2XF5A 3FKJA 3S3MA 3DU5A 2R7VA 1S9HA 4DOZA 4B47A 4PJMA 2E1MB 1SFKA 4J00A 1BR1A 2VXDA 2JVHA 3D5SC 2L5QA 3HUGB 2L7KA 2V7FA 2GOXB 4XKCA 4X0GA 1WJEA 4XQFA 1IRXA 3OYNA 1OR7C 2O5RA 4IZZA 4QPQA 4C30A 4LIVA 3ZGKA 2I8DA 3OS0A 4BE1A 2VQLA 3V42A 4NQWB 2HDWA 3PNTA 1NG6A 1MMNA 2E60A 2JSPA 1SAUA 4XNFA 4JQFA 1HA8A 2X6YA 2KZVA 2M3AA 4DJAA 3LFUA 2KPMA 4XONA 3A2KA 1ZELA 4BQNA 3DKXA 3CZ6A 2VKHA 4PJJA 2W1OA 3OMYA 2WAFA 4B48A 2BVMA 2X1CA 3SDBA 1X19A 5HNFA 5TGTA 2HNHA 4N4NB 1Y56A 3KEYA 4CCLA 4GRIA 2R7WA 1NG7A 3OWTA 3K70D 4XKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUG A; 
#chains in the Genus database with same CATH topology
 3FXR A;  5LFA A;  2HTJ A;  2XGX A;  2BBY A;  1IRG A;  2COB A;  2KIM A;  3KYD B;  4U7D A;  1N75 A;  4BGD A;  2PI0 A;  4JBA A;  2ZXH A;  2BV6 A;  3GO5 A;  3A0H C;  4R1H A;  2DA4 A;  1E3H A;  1MZB A;  1NK2 P;  4U0V A;  1S7A A;  2H8W A;  3U2R A;  1T98 A;  2DQR A;  1YS6 A;  2QGU A;  2M34 A;  4UUV A;  3J7Z I;  2R93 J;  3J81 K;  4IRH A;  1MJ9 A;  4NHJ A;  4ZDO A;  2BY3 A;  2OUM A;  5DEQ A;  5LGT A;  1WFX A;  1ZRE A;  2PJR B;  1IGN A;  1EKE A;  1E2X A;  1ENH A;  3MZY A;  1LE8 A;  1OQY A;  1UG0 A;  3IC7 A;  3SZP A;  3T8T A;  4AIH A;  2Y69 H;  2X6W A;  3HOY J;  1G2H A;  4RM3 A;  4ANJ A;  4NC7 A;  5FO5 A;  3V7C A;  1YG2 A;  2XB5 A;  2R5Z A;  2UXX A;  3P5J A;  4U7B A;  3GFL A;  3AG2 H;  2LF7 A;  1Y8Q B;  3QWL A;  1K4T A;  5F0C A;  4HOB A;  2OAZ A;  2DMT A;  1DU6 A;  3LWF A;  1TNS A;  5LLQ A;  3HOZ J;  1W7P D;  2X6O A;  3QU6 A;  1YHQ I;  3M3Y J;  1XCB A;  4M6V A;  3IH3 A;  4OOI A;  4CCN A;  5HDN A;  3MFK A;  1F9N A;  4KMU X;  4DBQ A;  2WY8 Q;  3IH2 A;  2K9M A;  4E7K A;  3S3N A;  3WGH A;  1D5Y A;  4Y13 A;  3L1P A;  5KAF C;  2BE5 F;  3ERE D;  2CMP A;  2FRH A;  2H1L A;  4BHB A;  3LSR A;  2E19 A;  3KZY A;  4MO7 A;  5DTD A;  1R1T A;  4WXC A;  4O6J A;  5ERI A;  2DOE A;  3T8R A;  4ZZL A;  5GPA A;  5M5X J;  2BXZ A;  4FE7 A;  3E1S A;  3TOB A;  3L2Q A;  1B9M A;  3D5L A;  3ULQ B;  4KFC A;  2Z33 A;  4LGW A;  1H9T A;  3HZJ A;  4UVA A;  3U9G A;  4MIM A;  3L9F A;  4XKW A;  2KDZ A;  2XKP A;  2OV7 A;  3S1R J;  1LE8 B;  4ZC3 A;  2QQB A;  1FP1 D;  5HLH A;  2CFO A;  3NQO A;  3X2Q H;  3C2H A;  5GAG J;  2K3P A;  4I6Z A;  1T33 A;  3FMR A;  2H8R A;  2TCT A;  2GLO A;  3IAM 2;  2R5Z B;  1KQ0 A;  3N97 A;  3CC7 I;  4AM3 A;  4ENM A;  2V1X A;  4Y15 A;  1IN4 A;  4V2F A;  4ZTF A;  3DKW A;  3CO6 C;  4A6D A;  3CCJ I;  3FIW A;  5D6F A;  3AG1 H;  2BYV E;  3EUK L;  3KLN A;  3OIO A;  4RB0 A;  5E8I A;  1W4M A;  1D3Y A;  1IXC A;  4HX8 A;  3HSF A;  4P9U A;  4XR6 A;  1I3A A;  3LA7 A;  2EFW A;  3MMY B;  5DCM A;  5BPI A;  3SZG A;  4WX9 A;  1XDS A;  3SZT A;  2VXZ A;  5CVU A;  5L3C A;  1H0M A;  3PJR A;  1FX7 A;  4OAY A;  2HQ5 A;  1S7E A;  4ENN A;  2ZSI B;  3ERM A;  4L0Y B;  1SD4 A;  3IH4 A;  3DBH B;  2Y75 A;  5EEH A;  3IRQ A;  4PSX A;  1BC7 C;  4NUB A;  4OU0 A;  2D1H A;  3MKZ A;  1A36 A;  5IYC J;  3ECO A;  3LST A;  1XMK A;  5LEJ A;  1N25 A;  1MMG A;  2FML A;  2L02 A;  5M5Y J;  4LIT A;  2HR3 A;  2LDU A;  4QLC U;  3FBI B;  4AVP A;  1DUX C;  5EGO A;  1VTN C;  1P2F A;  2XVC A;  3M4O J;  2P5V A;  2WTE A;  2DA2 A;  3IWZ A;  2PJP A;  4LB6 B;  1IF1 A;  2O3F A;  5J1Y A;  2XF6 A;  4XLE A;  3HPG A;  1HF0 A;  2KZG A;  1O3S A;  3LSM A;  3BG5 A;  3JRH A;  3J7A Y;  4BQQ A;  5E79 C;  1TT0 A;  4EJV A;  1IXS B;  3M07 A;  2NS0 A;  1U9O A;  2VKV A;  1MSF C;  2R5Y A;  5IYD J;  1OCR H;  3M7G A;  2HQA A;  3IHU A;  2XC7 A;  3ZMD A;  1MND A;  1BI1 A;  1KU3 A;  1FLI A;  3W2A A;  5KCM A;  5DCM B;  1JUP A;  4XN3 A;  5IOY A;  1BI2 A;  3BJA A;  4BJ6 C;  3T5X A;  4AWX B;  1B72 A;  2R7F A;  1EH6 A;  1IDY A;  2RV8 A;  2DW4 A;  2LFB A;  5L3D A;  1MIJ A;  4IO9 F;  2OQR A;  2M0M A;  1WJC A;  1D1A A;  2HOA A;  3R61 A;  2MC3 A;  4A3B J;  3W6J B;  4HNU A;  2ZJR F;  2DMU A;  3JW4 A;  5FLX Z;  3MZH A;  4ESJ A;  3DP7 A;  4ZJZ A;  5HVQ C;  1SVM A;  2FSW A;  2Z1D A;  2M4K A;  2ZJP F;  1X2N A;  2CW0 F;  2ZNY A;  3K10 A;  4B4C A;  1B9N A;  4N4O B;  3OIP A;  2XSJ C;  5HS7 A;  3GTO J;  5EGO B;  2KJB A;  1XG1 A;  4XIC A;  5IP6 A;  2WB1 N;  1VQ8 I;  5DV5 A;  3DTI A;  3LQR A;  4OAZ A;  2ZO4 A;  3CCU I;  2LKS A;  4MHG A;  1G59 A;  3F21 A;  5DCF A;  3RI4 A;  1XTA A;  3C2G A;  1A35 A;  2XAS A;  4J19 A;  5LD2 C;  5DM7 F;  3ISP A;  2X6X A;  4H4K C;  2EV5 A;  4AUX A;  1TWG J;  2P5L C;  4I01 A;  1QO0 D;  3JAM K;  5D8K B;  1YFH A;  2JJ7 A;  4Y4R A;  2IA0 A;  3KP4 A;  4XOT A;  3CJR B;  4LG3 A;  2HDD A;  5HLT A;  3OYL A;  4DGW B;  4V19 K;  1LVK A;  2DAO A;  2KRH A;  1S6L A;  2OC6 A;  2RQP A;  3I9V 2;  4HDV A;  3HG9 A;  2VJ5 A;  4S0H B;  2XAG A;  3OYG A;  4YFX F;  4Y7N J;  1IUF A;  3K2A A;  1B72 B;  3U1D A;  1P4W A;  4BU2 A;  4J01 A;  3OYF A;  3OR1 C;  3OSF A;  2R7T A;  2FX0 A;  1FIP A;  2MYS A;  3H35 A;  4CH7 A;  1J2X A;  2L9S A;  2PEX A;  1UB9 A;  2R4G A;  1DGR M;  4CZC A;  5CQE A;  4KIF A;  1RKT A;  3J80 K;  1RI7 A;  4E7L A;  2O6G E;  3CQZ J;  5D6E A;  3GTK J;  2E71 A;  4XOR A;  4CCK A;  3SFZ A;  1BBY A;  2MG4 A;  2EWN A;  3TP0 A;  5E3M A;  3QYE A;  4L9T A;  1ETQ A;  2LKP A;  2EZL A;  2HVR A;  1YW7 A;  4BKX A;  4B1R A;  1T08 B;  3BZC A;  3CCY A;  3GCM A;  3ZN1 A;  4BNC A;  4ETS A;  1FMV A;  5HDK A;  3IKT A;  2O03 A;  3TMO A;  1Z1D A;  1DP3 A;  2B0L A;  2DT7 B;  3E0J B;  2HKO A;  3BR0 A;  1A6Q A;  3CUO A;  3F72 A;  3G4S I;  1KYW A;  1BIA A;  1TZL A;  2QSH X;  1G3T A;  1HW1 A;  1R4N B;  2LSO A;  3ZQ7 A;  3VYS B;  3ML6 A;  1R6R A;  3PFI A;  1ZGW A;  1LEB A;  1YO5 C;  2FBK A;  5H20 A;  2XAF A;  3CUQ A;  3IKV A;  2WAE A;  4KDP A;  2ELK A;  2R7O A;  1HW5 A;  1RUN A;  4M3E A;  2KMU A;  1DGW Y;  3CUQ C;  3WTW C;  3MKL A;  5CVI A;  2QM3 A;  1SFU A;  2LKX A;  1LFP A;  2VAS A;  5E1X A;  2VIX A;  3I58 A;  1ON1 A;  3G1L A;  2CV1 A;  1D1C A;  3BWG A;  2DFI A;  2ZC2 A;  1WSU A;  3HSE A;  5F1R A;  1W0T A;  4BQA A;  2R3S A;  3NRV A;  4HST A;  3KX2 A;  4LIU A;  3OYA A;  2KQR A;  1TW3 A;  2DBB A;  4S05 A;  3LNQ A;  3BR6 A;  1RIO H;  4IJA A;  1GT0 C;  1CQT A;  3K70 C;  2MA3 A;  5EJC A;  1MMA A;  3E6M A;  5KNL A;  4BDZ A;  2QLZ A;  3FZV A;  2FUG 2;  4WXD A;  2V9P A;  2DXI A;  3BR1 A;  1S5L C;  2GBY A;  2V6E A;  3SEQ A;  4F92 B;  1XSX A;  2P81 A;  3TQN A;  1TW2 A;  2Z16 A;  5DS9 A;  1IN8 A;  1WJD A;  2MSY A;  1W5C C;  1IC8 A;  2Q2E B;  2WV0 A;  3E6C C;  4FCY A;  1BOB A;  3BCA A;  3MEX A;  1P92 A;  2V9V A;  1K83 J;  2W00 A;  5L3B A;  4G6T B;  2OQG A;  3GTM J;  2EFQ A;  3PQK A;  3WE2 A;  4BJ5 C;  4RAF A;  4IHT A;  1AOY A;  4XKV A;  2EB7 A;  3WU2 C;  3LL7 A;  4CYC A;  2G0E A;  3I56 I;  1TWA J;  3CUQ B;  4UHT A;  3F8B A;  3LSG A;  5J4V A;  1I27 A;  4A3M J;  2JA2 A;  3Q9V A;  2AS5 F;  1FJL A;  1JXS A;  2F5C A;  1EH7 A;  1WI3 A;  2DK5 A;  5J1R A;  3GXO A;  4Z6Y A;  2XAU A;  4BE2 A;  1IN6 A;  4XRS A;  1IV6 A;  4N9H A;  1PUF A;  2E7X A;  1X3U A;  3ZMZ A;  3L7W A;  3CCQ I;  3CF2 A;  3HGG A;  2FE3 A;  3WTT C;  1BR4 A;  4XMY A;  5L3F A;  2CU7 A;  2RKH A;  4G94 A;  1V4R A;  1Z9C A;  4L5I A;  1YRN A;  4ITV A;  4KYW A;  1MW7 A;  1ZLJ A;  1EF4 A;  3WTU C;  2OTL I;  3K4C A;  1BL0 A;  2M2E A;  5TJJ A;  1ZK8 A;  4Z2Y A;  3LSK A;  4EAT A;  3ZRG A;  2H27 A;  3FKJ A;  3V7R A;  1S9H A;  1H89 C;  1FYL A;  4PJM A;  4IRI A;  2AHQ A;  1RES A;  2FNP A;  3CO7 C;  4LK0 F;  1I1G A;  4J00 A;  1I1S A;  1T38 A;  2OZ6 A;  1KU9 A;  5M3M J;  1HDP A;  3GLL A;  4XKC A;  3ZMU A;  2W25 A;  5K5R A;  4HV6 A;  2RN7 A;  5D8L B;  3TW7 A;  3NAU A;  1JT0 A;  5EZH A;  2I8D A;  4KN7 X;  4OMY A;  1J75 A;  2JUC A;  4A3D J;  2E60 A;  3WGG A;  3HRU A;  4BY1 J;  1PUF B;  1QZZ A;  2ZB9 A;  4RB2 C;  4E70 A;  3B6C A;  4ESB A;  3B73 A;  2KPM A;  5BS6 A;  1ZEL A;  1XB4 A;  5F0H A;  2L7Z A;  3ABU A;  2DO7 A;  5CVV A;  3RYR A;  4C3I J;  3D1N I;  4EGZ A;  4KNY A;  1IW7 F;  2VE8 A;  5E1W A;  1IO2 A;  2GIZ A;  3CJT B;  1REP C;  1FNN A;  1YRN B;  3EUH A;  3SDB A;  4IOA F;  3VOD A;  3AAF A;  3DV8 A;  1Y56 A;  4HAM A;  3KEY A;  3L2C A;  2W7N A;  3QOP A;  3OWT A;  3K70 D;  4P5O A;  1ZGA A;  3F8F A;  1MD0 A;  4DZP A;  3E97 A;  3O2P E;  3OYD A;  1C0W A;  4PFO A;  3EDP A;  1ZRC A;  2R7X A;  4XL9 A;  1D5V A;  4PDK A;  5HS8 A;  1OCO H;  4BH9 A;  1SVL A;  2F5D A;  4BXU A;  4C2T A;  3KFW X;  1X4P A;  3EUA A;  3O8H A;  1HST A;  2DTR A;  3WTX C;  4M73 A;  4JYK A;  1K78 B;  4MNU A;  4XLH A;  1SD5 A;  1TBX A;  1Z0X A;  2DLL A;  1LFB A;  5EDN A;  1YJN I;  3FK6 A;  3ZOB A;  2KRF A;  3TW6 A;  3GFM A;  3LA2 A;  1GHC A;  5A2Q Z;  2YU9 J;  2CV0 A;  4ZDL A;  5EEA A;  1FIA A;  3ZQF A;  3BG9 A;  3K4L A;  3GTP J;  3JRC A;  3NEU A;  4A3F J;  2IGO A;  2X9D A;  4UV8 A;  3WU0 A;  3F23 A;  2EFO A;  2A68 F;  3FWE A;  4MGR A;  1VQN I;  1IDZ A;  3A01 A;  5J3L A;  1R4M B;  1OPC A;  2K9N A;  1G6N A;  4BL0 B;  4KIS A;  1U0J A;  3BTJ A;  1FBU A;  4HF1 A;  3OYM A;  4IXA A;  1K79 A;  2L4M A;  2L7F P;  3BTC A;  3CCM I;  1KU2 A;  3GW2 A;  3JRF A;  1ZQ3 P;  4YII A;  3H36 A;  3S1N J;  2LRD A;  3H1C A;  4D7M A;  3I5U A;  3P9C A;  5E18 F;  3MKW B;  5EG0 A;  4C2M J;  5IT9 K;  3BCB A;  2CO5 A;  3ABM H;  4A3K J;  1AKH A;  2V4J C;  4CCJ A;  1I39 A;  2K27 A;  3RSN A;  1VQP I;  3FHZ A;  1QZE A;  1KQ8 A;  5CJ9 A;  1FEX A;  2KL4 A;  3FX3 A;  1WVR A;  2OD5 A;  1F1Z A;  3BPX A;  4C9Y A;  3F6O A;  2H94 A;  1JTY A;  3WG7 H;  3KYC B;  1X1P A;  4U87 A;  5ED4 A;  5D5V B;  4Q4Z F;  2VC0 A;  1YJW I;  2DYR H;  5ILV A;  2HOS A;  2HU9 A;  3JRB A;  1G3W A;  4ZH4 F;  1Z91 A;  4ZDP A;  1ETW A;  3BQZ A;  1NHA A;  3FXU A;  4HPQ A;  1GDT A;  1VQ7 I;  1GLN A;  2NVU B;  2NVQ J;  4GXO A;  4Y33 A;  1DQU A;  1KON A;  1T0F A;  2IEK A;  5FRM A;  4HV5 A;  2R7Z J;  1QQI A;  5B5E C;  1EA3 A;  3A01 B;  2E1N A;  2LRE A;  2LY1 A;  2GA1 A;  1T0F C;  3CLQ A;  4XN0 A;  2R7S A;  3K4J A;  2IAI A;  4Y17 A;  2RQQ A;  4A0Z A;  2PJR A;  4CCO A;  3ZMT A;  2STW A;  2LTP A;  1ONV A;  3GF2 A;  3WE3 A;  3MVP A;  4M3G A;  2VUM J;  1Y0N A;  3QOD A;  2EZK A;  1YQA A;  4NC6 A;  2Q8K A;  1J5Y A;  2EK5 A;  1W36 C;  4XM3 A;  2L01 A;  5HLI A;  2O7O A;  2LYC A;  3BJO A;  4WCG A;  2KDO A;  1V5G A;  4HQE A;  5EG0 B;  1S29 A;  2N8G A;  2JA6 J;  2F2E A;  3CES A;  3FXL A;  1MH3 A;  3PM1 A;  3B02 A;  4UB8 C;  1AKH B;  2X51 A;  3QP5 A;  1R23 A;  2VPR A;  1WRJ A;  4RA2 A;  3GFJ A;  1TWH J;  4XSZ F;  1MBH A;  4TV7 A;  5CVR A;  2F5V A;  2A3S A;  2L9V A;  1B6A A;  4A6E A;  3CCV I;  3RQI A;  3M1C A;  3QRF F;  3S1M J;  1JHH A;  4JX6 A;  1X3W B;  1L0O C;  3TOA A;  2DFE A;  2CJJ A;  3E5X A;  2VJJ A;  2A5W A;  3V4G A;  2Y9Y A;  2VN2 A;  4IKF A;  2O0Y A;  4B3X A;  1ZAR A;  4D1Q A;  3H0G J;  2R7U A;  4FQG A;  1NH3 A;  3VYT B;  1WPK A;  1Z3X A;  2W82 A;  2M30 A;  3FHN A;  4L9N A;  4C3H J;  2KLO A;  1MMD A;  3RKX A;  2BXY A;  1AA7 A;  3U1K A;  3DCF A;  3H5N A;  4L5J A;  1WI9 A;  3UR3 C;  4RGX A;  1J59 A;  1SC7 A;  2M4G A;  5E3N A;  2O8X A;  4CUG A;  3ZQQ A;  1F43 A;  2JQ7 A;  3SEZ A;  1MBE A;  4QSH A;  1OLT A;  2IGM A;  2LG4 A;  3W6V A;  2EFN A;  3BR2 A;  3DQV C;  3JSO A;  4GDF A;  1RET A;  3BG3 A;  1T2K A;  1H9G A;  2HOT A;  3GYH X;  3HOU J;  4Q47 A;  1KQ9 A;  2X85 A;  2UV1 A;  5AIP A;  3CCR I;  5D5U B;  3L2R A;  2P6T A;  2QF7 A;  3BTL A;  3N05 A;  3ZR8 X;  3M8F A;  2EQR A;  4IHS A;  5FJ8 J;  3Q0W A;  4P9F A;  1IJW C;  2DA3 A;  2DFF A;  2QQ8 A;  3PQJ A;  2K02 A;  2CUZ A;  2EV6 A;  3CMA I;  4LJZ F;  2IBD A;  5F1J A;  5E1Z B;  3LQQ A;  1Z6R A;  3DF8 A;  3BQY A;  2AXL A;  2XRN A;  2AO9 A;  1ZTR A;  3CP2 A;  1PP7 U;  1DPR A;  2AQF A;  2ZXI A;  2JPC A;  5IOZ A;  4I98 B;  4D0P A;  4OWR B;  1XGO A;  2FQ4 A;  2CQ7 A;  4CO8 A;  4FHT A;  4CDG A;  1SMY F;  1SFE A;  1LEA A;  5E17 F;  1J0R A;  4EM2 A;  3OYE A;  3MAJ A;  2M5W A;  1Y0U A;  2PX9 A;  3ESW B;  2E1C A;  5GTH C;  5FGM A;  4HQM A;  1H88 C;  4I0B A;  4WK8 F;  2R92 J;  3KP7 A;  2EBI A;  2VBX A;  1Z05 A;  1VQK I;  2E5Z A;  2IP2 A;  3CJQ B;  3S17 J;  5J47 A;  4FX4 A;  3AG3 H;  2JVG A;  3HHG A;  4XLN F;  2V9K A;  2XSD C;  3S2H J;  1BI0 A;  2ZME A;  3S16 J;  1W36 D;  5FKN A;  3I3L A;  5J6X A;  2OZU A;  3BPV A;  1YW9 A;  4RGS A;  4KIT B;  2ZME C;  4E7S A;  3V7S A;  3OYB A;  3GTJ J;  3HOS A;  3JRD A;  1W5S A;  1K6Y A;  3REO A;  2WAD A;  4RS8 A;  3DPT A;  1QU3 A;  3OYC A;  1G4D A;  3Q3S A;  2HYG D;  2VOP A;  2X4H A;  3K1P A;  2L3D A;  2YR2 A;  1HQC A;  2HEO A;  2LNB A;  3PL8 A;  2PLY A;  4LLG F;  2HXO A;  2K4B A;  4BAC A;  4II3 A;  1UAA A;  1B1B A;  1QPI A;  4E7J A;  2OTJ I;  2P6S A;  1IN5 A;  3AL0 C;  3DTE A;  3TL4 X;  4C3J J;  3MKY B;  2IS6 A;  2Q0O A;  2Y2Z A;  3LAJ A;  4EVI A;  5BMZ A;  3K7A J;  1SAN A;  3F8N A;  3S14 J;  1A31 A;  2MD5 A;  2VQC A;  2E1O A;  3OOU A;  4HLX A;  3VPR A;  3OYJ A;  2V1N A;  2ME6 A;  2VB6 A;  3M9A A;  2M87 A;  3J7Y J;  1T8I A;  2CQX A;  4IX7 A;  2OPT A;  2K9S A;  4CGZ A;  1ITY A;  5FLM J;  5H2F C;  4KUM A;  2HYJ A;  5AON A;  1CF7 B;  2ICW G;  2YX4 A;  2ZME B;  1GXQ A;  3S1Q J;  1YLF A;  3PNV A;  3M8E A;  5CVJ A;  3R6S A;  1WZ2 A;  1P4A A;  2PMU A;  1S3J A;  3SDG A;  4U0W A;  3DFG A;  4L9V A;  3G73 A;  1TWF J;  1ZHF A;  5LBQ A;  5DUI A;  3K4M A;  1WGX A;  1WWX A;  3QPL A;  2BOL A;  3RCO A;  2JA7 J;  2DOA A;  3DXJ F;  3W2W A;  3V8L A;  2L2O A;  2XGC A;  3JRI A;  1MH4 A;  5EEG A;  2EJR A;  1OKR A;  1BW6 A;  2JA8 J;  1APL C;  1N77 A;  2V1U A;  3AL0 B;  4DYQ A;  3Q5F A;  2IXS A;  2GA2 A;  3HUG A;  1VQ6 I;  1RUO A;  2EZH A;  2QSG X;  3L2U A;  2AXT C;  1X1C A;  4KIG A;  1R58 A;  3A4C A;  4YRV A;  4CIC A;  4XSX F;  4Y3O A;  2HTS A;  2A6H F;  4ESF A;  3GEZ A;  2VQH A;  1RR7 A;  3HL2 A;  1S7O A;  3L2V A;  3GUD A;  2PFB A;  3C7J A;  3C1D A;  2DU9 A;  4L18 B;  3CDI A;  2B63 J;  4MEY F;  1STZ A;  2JRT A;  4YIF A;  4EM0 B;  2ZFW A;  1ULY A;  1D1B A;  1S72 I;  2CQN A;  3ASO H;  3LSP A;  2ID3 A;  1ORK A;  4P1W A;  1FBQ A;  3ZPL A;  2GAU A;  4YFK F;  4CYD A;  4EM1 A;  3EQL F;  1V3F A;  4A5N A;  1MMS A;  3WHC A;  4DNC A;  1Z67 A;  4CSW A;  3SJM A;  2V26 A;  1BOA A;  2ZXW H;  4UUT A;  1BM9 A;  1P9Q C;  4YIR X;  4PCQ A;  4G6Q A;  4U88 A;  1MJB A;  1X1D A;  2DDA A;  4I0A A;  5HNH A;  2M0C A;  4ABZ A;  3GBG A;  1CGP A;  3PFY A;  3QU3 A;  2FNA A;  2XF5 A;  1ETX A;  3S3M A;  1JKR C;  4BHC A;  2G9W A;  2GWR A;  5LRR A;  1WQ2 A;  4DOZ A;  6PAX A;  3TO9 A;  1JUS A;  3K69 A;  1SFK A;  2L54 A;  2NVX J;  1OR7 A;  2LK2 A;  4BHP A;  2VXD A;  5FLX K;  2L5Q A;  2FBH A;  1TT5 B;  3HUG B;  1EH8 A;  4X0G A;  4GYG A;  4XQF A;  1IRX A;  3ZQG A;  3QQA A;  2XPU A;  3W6K B;  1OR7 C;  4HA8 A;  2Q2E A;  1K61 A;  5D5W B;  3ZGK A;  4EEF G;  5L3G A;  2UXN A;  3V42 A;  2QEN A;  3K2Z A;  3PO3 J;  4LFU A;  1NG6 A;  1JGS A;  1Y1V J;  2ISY A;  3VEP A;  1O7L A;  1Y1W J;  1SFO J;  5E20 A;  4M6X A;  5L3E A;  3O8G A;  2M8G X;  3ABL H;  3HKZ N;  3RPQ A;  5K7H A;  2EA4 A;  4HW0 A;  2M3A A;  2GIV A;  4DJA A;  1VF9 A;  2MGQ A;  3LFU A;  3QPH A;  3A2K A;  2O8K A;  4PJJ A;  3E6D A;  2R7D A;  2V1D A;  3K1N A;  3P9I A;  2WAF A;  1UZC A;  4B48 A;  2FOW A;  2RVC A;  5E3L A;  2X1C A;  5HNF A;  4N4N B;  4Y52 J;  4IHX A;  5F08 A;  4CCL A;  1VQM I;  2A6E F;  3P9K A;  2Y0S N;  2E36 A;  2R7W A;  4L5E A;  4XBF A;  2NXN B;  1NG7 A;  3HSR A;  4WXH A;  1QVU A;  4JX5 A;  3ROU A;  2HPI A;  4F55 A;  2RC4 A;  3LFK A;  2DMQ A;  2QQ9 A;  2ESN A;  4YG2 F;  1O3T A;  2DJN A;  3UNG C;  2ZJQ F;  3I0T A;  3OL4 A;  2KHM A;  4ON0 A;  1LQ1 A;  2E2I J;  1YW8 A;  1MBG A;  1MBK A;  4M9S A;  2DOD A;  3PUB A;  4PJN A;  3CMY A;  2JK3 A;  1BN5 A;  2HZD A;  4XRM A;  1NTC A;  1O4X A;  4MLO A;  1U3E M;  3OYH A;  5DDG A;  2VLA A;  4IHV A;  1FBS A;  5JVT A;  4BEH A;  1WJA A;  1HC8 A;  3JSP A;  4MTD A;  2W57 A;  3H3Z A;  1FMW A;  5JHU A;  1R1V A;  2BHZ A;  3GZ6 A;  2A05 A;  3FMS A;  2ZNZ A;  3OYI A;  1B8I B;  5FFX A;  1AWC A;  4E7I A;  1D0Z A;  2F4M B;  1G3Y A;  3ZXS A;  4LLL A;  2ZCW A;  3SHF A;  5LGU A;  4AYB A;  1JGG A;  3TO6 A;  2JTV A;  2K3F A;  2BZT A;  2VKD A;  4N9I A;  1FP2 A;  3N4M A;  4GYI A;  4A3L J;  2DJI A;  3FM3 A;  3F8C A;  1MJA A;  2I5U A;  1VI0 A;  1Z6T A;  1XSV A;  2A61 A;  1LJ9 A;  3HKZ A;  1AHD P;  1T95 A;  3HGY A;  5BNG A;  4OIN F;  2PMH A;  3E3V A;  1YS7 A;  2Q1Z B;  4KIB A;  4EJO A;  2QCO A;  3QPT A;  5C44 J;  3GTQ J;  2VKE A;  2J5P A;  1I3Q J;  1JT6 A;  3PO2 J;  3BRO A;  3VYU B;  3P7N A;  2LP0 A;  2MC4 A;  3GZ5 A;  1RZ4 A;  3VSL A;  1ZG1 A;  1ZG5 A;  2LF8 A;  2DN0 A;  4D5C A;  2E34 A;  3HPH A;  5FKO A;  1F4K A;  4BBS J;  3HEF A;  2F5F A;  3HTS B;  2Y0S A;  1OCZ H;  3BJ6 A;  4BJT A;  1U5T A;  3A1Y A;  5LHH A;  4BEH B;  3I71 A;  4HNT A;  5B1B H;  4B43 A;  2M7B A;  3DEU A;  1U5T C;  4RAZ A;  1TC3 C;  5KVR A;  4F91 B;  5EF6 A;  3WGI A;  4WF2 A;  3EYI A;  3HRT A;  1XGS A;  2I10 A;  1HKT A;  4O5V A;  4IVN A;  4FTH A;  5DD4 A;  3UKG A;  1K78 A;  3AFH A;  1OMI A;  1TWC J;  2STT A;  2TDX A;  1V55 H;  4HNV A;  2ME0 A;  1BIB A;  3CME I;  3VWB A;  2IGK A;  3BG7 A;  1K6O A;  1XN7 A;  1P4X A;  5J8C A;  2D1V A;  1MNE A;  3B6A A;  3HOX J;  3FXJ A;  5IP7 J;  2W24 A;  2LMD A;  2FA5 A;  2QVO A;  4RBO A;  1FSE A;  3QYB A;  3MN2 A;  3G6E I;  2EV0 A;  4D5F A;  3WTY C;  3H5A A;  4DBR A;  3FMQ A;  2FU4 A;  2X0L A;  2K4J A;  2CYY A;  3EET A;  3R0J A;  1MKM A;  2E2H J;  4ASN A;  4HF2 A;  1ZKG A;  2GM4 A;  4G8X A;  1GVJ A;  1XCV A;  2TRT A;  5ILU A;  2X1E A;  4G7H F;  3OYK A;  1LFU P;  2CUJ A;  3S3O A;  1MBJ A;  1U5T B;  2H1K A;  5KHD A;  3KET A;  2CRG A;  2RNJ A;  1I6H J;  3VDX A;  3KEO A;  3KLO A;  2PG4 A;  5D5X B;  3C3W A;  5JI6 A;  3DPU A;  2UWM A;  1TTY A;  3MD2 A;  4AIJ A;  2DK8 A;  2GOM A;  1DP7 P;  5FKM A;  5J8F A;  1GV5 A;  2ESH A;  2VOO A;  1D8K A;  4CHU A;  1KGS A;  2FD5 A;  1FOK A;  2W4S A;  3R4K A;  3VOE A;  2DA5 A;  1O3R A;  2JSC A;  3IWF A;  4E7Z A;  4NB5 A;  1U78 A;  2IA1 A;  2K9Q A;  1KYZ A;  3BR3 A;  4F3Q A;  1ETO A;  5D4R A;  2ZSH B;  4G7O F;  1FOX A;  5GTI C;  4RGU A;  4AIK A;  1JE8 A;  1SFX A;  4RAY A;  3H5R A;  1BJZ A;  4L9J A;  2ZBK A;  3K1M A;  5DYM A;  1AU7 A;  2Z5U A;  3LOC A;  1WH5 A;  5JVG F;  1VZ0 A;  2P8T A;  2DCE A;  4RGR A;  1HKQ A;  3H9G A;  2Z2S B;  3BC8 A;  5HOD A;  3KE2 A;  4R8H A;  1K7A A;  3I4N J;  5K5Q A;  2DT6 A;  3S93 A;  2W84 A;  1Z7L A;  4A93 J;  2GQQ A;  1O3Q A;  5D4S A;  2HGC A;  1FYK A;  2CW8 A;  4ENK A;  3QYF A;  3HC7 A;  2CFX A;  2MD0 A;  4DIQ A;  1VFC A;  4UVB A;  1UMQ A;  5LHG A;  4IQJ A;  2J5O A;  3GX4 X;  3DTK A;  2DTZ A;  1MBF A;  3AG4 H;  1QGP A;  5F0F A;  3HTU A;  2UUZ A;  2XV4 S;  1P7I A;  1FOW A;  3H92 A;  5JLW A;  4IF4 A;  2HVS A;  2QYO A;  3BTI A;  4QTR A;  3IRR A;  1K4S A;  4NDL A;  2QSF X;  4R79 A;  5CYV A;  4IPA A;  2Y48 A;  2KIQ A;  5ICC A;  3JTG A;  1SEU A;  3MZ8 A;  2PBI A;  2H6C A;  3JRA A;  3OL3 A;  4RM2 A;  2JRM A;  3CP8 A;  3G1O A;  1HBX G;  9ANT A;  1QA6 A;  4KT5 C;  1J09 A;  5A2Q K;  4PUS A;  3VFZ A;  1BR2 A;  3C18 A;  1OIS A;  1HLV A;  4JP0 A;  1YX5 A;  1KA8 A;  3ZQC A;  1UHW A;  4M9X A;  3FM5 A;  5B66 C;  3TED A;  3IV5 A;  4CXF A;  3ECH A;  2ZXJ A;  4FE4 A;  2FOK A;  4II2 A;  2OBP A;  3RYP A;  3H3U A;  3BLY A;  4UV9 A;  4I76 A;  3LMM A;  4M6Y A;  4XOP A;  4YFN F;  1FWZ A;  3GFI A;  1TQP A;  1UEL B;  4PGG A;  3RQ4 A;  3T0Y A;  3VYR B;  3ZQL A;  3J81 Z;  1A6I A;  2KIS A;  3TGN A;  3K6G A;  1DU0 A;  2PN6 A;  2EIK H;  1SD7 A;  2WV1 A;  4BE0 A;  3CTA A;  1SD6 A;  1ZRD A;  3DPL C;  4AC0 A;  2MAB A;  3J7A O;  1FT9 A;  4UUS B;  2AQE A;  5ICG A;  4ZYA A;  4M9Z A;  3CDH A;  3HOT A;  2LOO A;  3HIF A;  1RKW A;  2JA5 J;  1RNL A;  2DPU A;  4G7Z F;  1BA5 A;  4FIS A;  3OS1 A;  5M3F J;  4I7H A;  1FC3 A;  5JLX A;  1DDN A;  3G2B A;  4G6D A;  3ZQH A;  4B09 A;  3OV8 A;  2XDV A;  3JTH A;  3BZK A;  4RB3 C;  1ERD A;  3I54 A;  2A69 F;  1BI3 A;  4FT8 A;  2OCE A;  3D5R C;  3FF5 A;  4RLQ A;  3FBN B;  1U6G A;  3LSH A;  1LDK B;  5J4Y A;  1R49 A;  2L9R A;  5J1U A;  5F64 A;  1LNW A;  2JPB A;  4QPO A;  5IY5 H;  2ID6 A;  2P5K A;  2D5V A;  4ZYH A;  2ELJ A;  2Z9O A;  3E5Q A;  2M8E A;  2BY2 A;  1QBJ A;  5FRN A;  1W5T A;  4A3J J;  5DD8 A;  3F8M A;  2F5E A;  1W0U A;  3PSF A;  2YPR A;  2H09 A;  3G71 I;  2R7Q A;  1V5F A;  2V79 A;  4A69 C;  1XMX A;  2RNG A;  1R1U A;  3PSI A;  4GFB A;  3GZN B;  2LBF A;  2KP6 A;  3H3V K;  1QPM A;  3RTR A;  2RAE A;  3VSK A;  1G3S A;  3MWM A;  2MW8 A;  2WWY A;  2L9N A;  4K2E A;  2MH9 A;  4D7N A;  3FDY A;  1FZP B;  1P7J A;  5F27 A;  3KEQ A;  1I6X A;  1ON2 A;  1OCP A;  3A03 A;  4X6A J;  1D8J A;  4HEA 2;  1LVA A;  3JRG A;  4RAG A;  2DPD A;  3IAS 2;  2HPM A;  1LUJ B;  1JTX A;  4KJZ A;  2CG4 A;  5H6R A;  3OY9 A;  1R71 A;  1IZ1 A;  3K4K A;  2WY7 Q;  4I02 A;  5BPD A;  4DZJ A;  2E2J J;  1JI8 A;  3O6B B;  1ETV A;  5DUK A;  2KIU A;  2IS2 A;  1IG7 A;  1IRF A;  2Z99 A;  4PJ0 C;  4MQV A;  2IS1 A;  2RGV A;  5GPC A;  1R36 A;  1XC5 A;  2BVL A;  1Y39 A;  3NAR A;  1HXD A;  1XMA A;  4I09 A;  4IOC F;  1LDD A;  2MLK A;  3DKY A;  1D0Y A;  2PMZ N;  4A3I J;  2JN6 A;  2NS8 A;  5K7Z A;  2LH9 A;  1QNT A;  4PSW A;  1VQ4 I;  2IPQ X;  1XPX A;  4EGY A;  3GWZ A;  2HWV A;  3C2B A;  2RDP A;  4I99 C;  2LBF B;  2DA6 A;  4A2U A;  2WBM A;  2VJI A;  4EMS A;  1HW2 A;  3DU5 A;  1CF7 A;  5BQT A;  4OIQ F;  2GXA A;  4B47 A;  4UNO A;  3M1E A;  3HYI A;  3S2W A;  1BR1 A;  3GME A;  1E3P A;  2OF7 A;  2JVH A;  1T39 A;  2V7F A;  3HHH A;  3KZI C;  1Q1V A;  4A5M A;  1OYW A;  1WJE A;  2MBF A;  2YSR A;  3PIP F;  3OYN A;  2O5R A;  3SFI A;  4IZZ A;  3GTG J;  4LIV A;  2K85 A;  2DQL A;  2KFD A;  3S15 J;  2VQL A;  5FD6 A;  1LB2 A;  3CLO A;  1XSD A;  4LG0 A;  2CSO A;  1MMN A;  2JSP A;  4XID A;  1SAU A;  4JQF A;  1U8R A;  1ETK A;  1HA8 A;  1P6R A;  2ECC A;  2O61 A;  1TNT A;  3TO7 A;  2DDB A;  5HLG A;  3FXO A;  2VON A;  4M72 A;  3F22 A;  5IYB J;  2NVY J;  3CZ6 A;  5F04 A;  4G9Y A;  2QUF A;  4MQ9 F;  2W1O A;  4W97 A;  2IJL A;  4DQ2 A;  1XD7 A;  5B1A H;  4JK1 X;  2BHY A;  1VND A;  1R5I D;  3I53 A;  4P55 A;  4O3M A;  1X58 A;  5KK1 A;  2BVM A;  2E7W A;  3JRE A;  2GXG A;  2HNH A;  5H6Q A;  5TGT A;  2XUB A;  1XX5 A;  4LD5 A;  2XGD A;  3ABK H;  3FXM A;  1BW5 A;  1ZLK A;  2IS4 A;  1O7F A;  2M45 A;  2R0Q C;  3DBR B;  1FSH A;  4ZYG A;  3CD6 I;  2VBY A;  4HX7 A;  1OYY A;  4XLC A;  3JAM Z;  3H9J A;  2EPF A;  4PFP A;  2XKO A;  1ZG3 A;  3ZQI A;  2Z3Y A;  2FBI A;  2PMZ A;  1JKO C;  2VJ4 A;  2OJE D;  4JX4 A;  3FK7 A;  2DA7 A;  5HS9 A;  1VQO I;  1ODD A;  2JT1 A;  2UZK A;  5IP9 J;  2IGN A;  2KRC A;  1S8N A;  4BXF A;  2R7R A;  3OOP A;  1ETY A;  4LOC A;  2GZW A;  2XAH A;  2Y30 A;  4LG0 B;  4DYR A;  1T6S A;  4LLN A;  1PP8 F;  4GCV A;  2W85 A;  2LR8 A;  3J80 Z;  1L3L A;  4L0Z B;  3KP2 A;  4X1E A;  2A07 F;  1WJB A;  2MLG A;  5E3O A;  1YTY A;  2BEO A;  3QPS A;  3KYL A;  3HRM A;  1JHF A;  3E6B A;  1YIO A;  1PJR A;  1X1A A;  1QRY A;  4F52 A;  2NOG A;  2VI6 A;  2ETH A;  3DEE A;  2D45 A;  3OIQ A;  4LMY A;  3SXY A;  2EFP A;  1LKX A;  2X1D A;  5JR3 A;  4HSR A;  1Q1H A;  1VQ5 I;  5LGN A;  4ZZD A;  3ZN0 A;  3W3C A;  4A0X A;  4OIP F;  4AID A;  4A3C J;  4OIR F;  5ILS A;  1QHH D;  3Q9S A;  3HOV J;  1USS A;  5K5O A;  5GAD J;  3RJP A;  1JUM A;  3HXL A;  3RPU A;  1IAW A;  2WC2 A;  4LB5 A;  4WWC A;  2XAQ A;  2R5Y B;  1H8A C;  5AIQ A;  3WOD F;  4M3B A;  4BUP A;  1UJ8 A;  3F9K A;  4NNJ A;  5FLV A;  4OIO F;  4IEJ A;  3RKY A;  4A3E J;  3CMM A;  4B8X A;  2JMW A;  3V8J A;  3DEW A;  4ZTJ A;  2DMP A;  2XIG A;  2OCC H;  3S32 A;  3TDZ C;  5C4X J;  2H6B A;  3BP8 A;  1PVE A;  5IPA A;  3LAP A;  3BDD A;  4FAS D;  2M1B A;  2Y9Z A;  4DW6 A;  2A6T A;  4AYB N;  2YUS A;  5IT3 A;  1UST A;  3U21 A;  1U8B A;  3PNY A;  4XLF A;  3TDU C;  3BZ6 A;  4RMN A;  3A0B C;  3ZMV A;  2QBY A;  3E7L A;  4CCM A;  4LK1 F;  2HXI A;  4MFE A;  5DM6 F;  4JOM A;  1YX3 A;  2XF7 A;  3ABT A;  1HCR A;  1F5T A;  4ENJ A;  3DLA A;  5FB2 A;  5FFZ A;  3A02 A;  1B8I A;  5F6F A;  4B44 A;  3LA3 A;  5TRD A;  1DPU A;  4FET A;  2QEX I;  3D0S A;  3FXQ A;  3BR5 A;  3I59 A;  4M3F A;  1PDN C;  1ZAO A;  4BS9 A;  3R0A A;  2IW5 A;  1FTT A;  1U9N A;  2LC2 A;  3KIO A;  2IT0 A;  2P7C B;  3HM5 A;  1VQ9 I;  4EV0 A;  1YIJ I;  1TQI A;  3Q0U A;  2ZFU A;  1UFM A;  3SYT A;  1XGN A;  2K40 A;  1XDU A;  1HKS A;  2BW3 A;  2ISZ A;  1MSE C;  1X3Z B;  1X4O A;  4BAY A;  4M74 A;  1R9T J;  3BT9 A;  3L09 A;  2B9S A;  5GP9 A;  4AVZ A;  1IUY A;  2WB1 A;  3GVA A;  2NNN A;  2KT0 A;  2K5C A;  4C2U A;  4EJT A;  4UVC A;  1I5Z A;  2VBZ A;  3TBI A;  1E17 A;  1GXP A;  3HJE A;  2HS5 A;  5EZG A;  3TP3 A;  4KT6 A;  2FQ3 A;  2MH2 A;  1PYV A;  5B3S H;  3CDL A;  4BYY A;  1XS9 A;  2BGC A;  4IRG A;  5CQG A;  4MFD A;  1ZH5 A;  2QBY B;  5CKT A;  3S8P A;  2FF4 A;  4E7H A;  4PK4 A;  3W2V A;  4M3D A;  2DMN A;  4ZYD A;  1PUE E;  5EYR A;  2XAJ A;  3BG6 A;  1B59 A;  3T1B A;  5GAH J;  1X1B A;  3COA C;  3OS2 A;  3K0L A;  1LDJ A;  3WTS C;  2P4W A;  2HZT A;  2IVM A;  3K4B A;  1ZR2 A;  2F6C A;  4A0Y A;  4XLA A;  2P7V B;  1YYV A;  5KAI C;  3VB2 A;  4HYE A;  1IV8 A;  2HQN A;  1ZYR F;  3I59 B;  2JUG A;  3BY6 A;  1YE9 A;  1G8X A;  2HQR A;  5E8G A;  1W1W E;  4GGG A;  2YS9 A;  3IUO A;  1UG2 A;  2QQA A;  4RLF A;  2CH0 A;  1Z3Y A;  2K9L A;  2QA4 I;  2ECB A;  3MCZ A;  3RKQ A;  2WAQ N;  2BW3 B;  3BOQ A;  1ZGJ A;  1ZR4 A;  5FRO A;  3CC2 I;  1R5H A;  3AKZ A;  1O57 A;  2FEZ A;  1YIT I;  3DLL F;  4PJL A;  4BY7 J;  2VE9 A;  4HDU A;  3CCS I;  4IL6 C;  3ZMS A;  4A12 A;  2QWW A;  1OCT C;  1V5E A;  4HRI A;  3WU1 B;  3DWL E;  4BQO A;  1A04 A;  2K86 A;  2BY0 A;  4I2O A;  2OU2 A;  1EV7 A;  2L0K A;  3S2D J;  1OYI A;  4HG2 A;  3LSI A;  4YEJ A;  3RPU D;  1SVO A;  2B7E A;  1JKP C;  3FXK A;  3EYY A;  3CC4 I;  2HYF A;  4YEL A;  2VT3 A;  1ACI A;  2Y31 A;  4UB6 C;  1FOY A;  2NOJ B;  4F7Z A;  3K4N A;  2HKX A;  2HFH A;  1Z77 A;  3OSG A;  4FX0 A;  4CA0 A;  1JKQ C;  2DA1 A;  2NYX A;  4MTE A;  3M8J A;  4HX4 A;  2KKO A;  5J40 A;  1NK3 P;  1J9I A;  3OR2 C;  5FD5 A;  4KA4 A;  3RIR A;  3V8K A;  2VPL A;  4Q5S F;  2CS3 A;  2VOD A;  3E5U A;  2DYS H;  2QKM B;  3KPH A;  4KIC A;  2G7U A;  5CPR B;  5FKL A;  2FJ1 A;  4XK4 A;  2O9L A;  1OCC H;  2D2W A;  2VQG A;  2E35 A;  4GO1 A;  3HB9 A;  1XGM A;  4CYC B;  4NBQ A;  2CWE A;  1YI2 I;  2ELH A;  2C6Y A;  1Z21 A;  5GAE J;  3K9T A;  2OA4 A;  3G3Z A;  4XLP F;  3IP4 B;  1TL8 A;  3G1M A;  3QP6 A;  3SQN A;  5ICE A;  2ZKZ A;  4E4H A;  1WJF A;  3HDD A;  3KCC A;  3WTV C;  3QOE A;  4E6K G;  1ZRF A;  1KU7 A;  1E0E A;  1MNM C;  2VL8 A;  5JHF A;  3Q0V A;  4IHW A;  1HSJ A;  1TLH B;  1WJ5 A;  3CJN A;  3RZD J;  3QAH A;  3H0D A;  3WHB A;  4BDY A;  3ZCO A;  2WAQ A;  3ELK A;  3KP3 A;  2LVS A;  3O3K A;  1RR8 C;  2XPW A;  4N0B A;  1U2W A;  4QIW N;  1IXR C;  1R7J A;  1FY7 A;  2DT5 A;  2JZY A;  2RRE A;  3RZO J;  2A5Y B;  2E5N A;  2DOF A;  2KIF A;  2P0W A;  2CUE A;  2X48 A;  4CZZ A;  2GXB A;  2HVQ A;  4DYC A;  4A3G J;  1Z7U A;  1QZY A;  1TP4 A;  1SAX A;  3F3X A;  1BC8 C;  3KZZ A;  4IQ4 A;  1Y8R B;  4UY8 I;  1QHG A;  3EUH C;  2DI3 A;  1TQM A;  3FKI J;  2HDC A;  2NNY A;  1WH7 A;  1WHU A;  4M71 A;  5C4J J;  5IT9 Z;  3ONQ A;  1YJ9 I;  5M5W J;  1GV2 A;  2NVT J;  3TKY A;  4UXN A;  4D9J A;  3LSJ A;  4ZYE A;  2CV2 A;  3L00 A;  1RPW A;  2FXA A;  1POG A;  2QKL B;  3DU6 A;  3HRS A;  1OFC X;  2VT2 A;  4HZF A;  3RKW A;  3ZP5 A;  4F93 B;  2QZ8 A;  5BOX A;  3JCU C;  2XB0 X;  2VC1 A;  4Q48 A;  1GVD A;  5TIS C;  2F48 A;  1V54 H;  2CGP A;  1FPQ A;  5LHI A;  4XRS G;  1JJ8 C;  3PUF A;  1VQL I;  3HOW J;  3H9Q A;  5CLS A;  1SMT A;  3WG9 A;  1T56 A;  1X2M A;  1R00 A;  4XRF A;  1R5G A;  4KN4 X;  3GTL J;  1KZH A;  5ICF A;  2WA0 A;  3FIS A;  2NAZ A;  2LLK A;  2M7A A;  4EJW A;  1GUU A;  2K7L A;  2EIL H;  1MDM A;  3L2W A;  5HDG A;  4OMZ A;  1R22 A;  1UCR A;  1BJA A;  5K7F A;  5JFR A;  2E1M C;  2F4O B;  1HDD C;  2CW7 A;  4EJU A;  1HOM A;  3NWS A;  2EIN H;  4UUS A;  1F36 A;  1Y6I A;  1W7P A;  5HOO A;  5K1Y A;  1EJ9 A;  4NQW A;  2XRL A;  2NS7 A;  3F0C A;  2F4I A;  2YU3 A;  1M1E B;  1YOV B;  1UHS A;  2YX7 A;  4U0Y A;  2JWT A;  4B3A A;  2XHK A;  3EPZ A;  3MQ0 A;  4NC8 A;  1UHM A;  4V2G A;  2EIM H;  1FTZ A;  4G12 A;  4AU7 A;  1N78 A;  1RRJ A;  3NWT A;  1WCM J;  2DFH A;  3CF5 F;  2HOE A;  1J7K A;  2EH3 A;  4HBL A;  4HLY A;  2PQ8 A;  2XPV A;  1JJ6 C;  2LY9 A;  2L4A A;  2LY2 A;  1B4A A;  2HI3 A;  5LEK A;  4RDU A;  2LD5 A;  5FKK A;  5C3E J;  3WTZ A;  3JR9 A;  1D0X A;  2CUF A;  2MFZ A;  2ZJ2 A;  4EQQ A;  2R7V A;  1A5J A;  1RC9 A;  2E1M B;  3KP5 A;  1MDM B;  1LPQ A;  4RB1 A;  3D5S C;  2L7K A;  2GOX B;  4QWQ A;  3PIO F;  1IRZ A;  2ADU A;  2NRA C;  3I4P A;  2XGE A;  3I64 A;  4AD9 A;  3DBL B;  2L7M P;  2G7H A;  1I50 J;  4QPQ A;  4HF0 A;  2VBW A;  4C30 A;  1W7P B;  3I55 I;  3OS0 A;  3I4M J;  4BE1 A;  1OJL A;  2HDW A;  2Y0M A;  3PNT A;  4NQW B;  1ZN2 A;  1IN7 A;  1WKM A;  3R60 A;  4PZJ A;  4IHY A;  3KP6 A;  4XNF A;  2V6C A;  4H0E A;  4W1U A;  3F6V A;  2EA2 A;  4KMF A;  2M9H A;  4S04 A;  4P96 A;  2IA2 A;  3CCE I;  3CCL I;  2X6Y A;  2COM A;  2KZV A;  2ACJ A;  2EIJ H;  4XON A;  4BQN A;  2EZI A;  3DKX A;  2VKH A;  2FMY A;  3GLX A;  4PGH A;  3RDI A;  1E3O C;  3ASN H;  4BBR J;  3IL2 A;  3HBL A;  3OMY A;  2IRF G;  1QVT A;  2BY1 A;  2W48 A;  1X19 A;  2CQK A;  4BXX J;  4MEX F;  1MGT A;  1FYM A;  5LRS A;  4GRI A;  2XRO A;  2CQQ A;  2KJC A;  4XKB A; 
#chains in the Genus database with same CATH homology
 2IS4 A;  4P5O A;  5LFA A;  2HPI A;  4F55 A;  3OYD A;  4PFO A;  1N75 A;  4BGD A;  4XLC A;  2R7X A;  3UNG C;  4XL9 A;  2ZXH A;  3H9J A;  3OL4 A;  4PFP A;  2KHM A;  2PMZ A;  4C2T A;  1X4P A;  4PJN A;  2VJ4 A;  3PUB A;  3EUA A;  2HZD A;  4MLO A;  4ZDO A;  2IGN A;  4XLH A;  2KRC A;  3OYH A;  2OUM A;  4BXF A;  2R7R A;  1WFX A;  2VLA A;  2PJR B;  4BEH A;  1WJA A;  1UG0 A;  2CV0 A;  4ZDL A;  1FMW A;  2X6W A;  3K4L A;  4RM3 A;  3OYI A;  4ANJ A;  4NC7 A;  4E7I A;  1D0Z A;  2IGO A;  1WJB A;  4U7B A;  3ZXS A;  4AYB A;  3KYL A;  2VKD A;  4BL0 B;  1PJR A;  4KIS A;  1U0J A;  1X1A A;  4CCN A;  2DJI A;  4F52 A;  3DEE A;  3OIQ A;  4DBQ A;  2WY8 Q;  3OYM A;  2K9M A;  4E7K A;  3S3N A;  1LKX A;  2X1D A;  4HSR A;  3HKZ A;  1T95 A;  2LRD A;  2CMP A;  2Q1Z B;  3W3C A;  3MKW B;  3BCB A;  3VYU B;  1QHH D;  2MC4 A;  2V4J C;  3VSL A;  3HXL A;  4CCJ A;  3E1S A;  3RSN A;  3L2Q A;  3D5L A;  3HPH A;  4BUP A;  2KL4 A;  3F9K A;  4NNJ A;  2Y0S A;  4BJT A;  4XKW A;  4C9Y A;  3A1Y A;  4BEH B;  2OV7 A;  3CMM A;  4HNT A;  4U87 A;  4ZC3 A;  4B43 A;  4ZTJ A;  2CFO A;  2M7B A;  2HU9 A;  3S32 A;  3C2H A;  4ZDP A;  2K3P A;  4HPQ A;  1GLN A;  4F91 B;  3IAM 2;  4Y33 A;  1DQU A;  1KON A;  4FAS D;  5FRM A;  2A6T A;  1EA3 A;  3U21 A;  3PNY A;  4XLF A;  4ZTF A;  2LRE A;  2LY1 A;  1T0F C;  4XN0 A;  4RMN A;  3AFH A;  2R7S A;  3K4J A;  2RQQ A;  2PJR A;  3EUK L;  4CCM A;  4CCO A;  4JOM A;  1YX3 A;  2XF7 A;  3QOD A;  4XR6 A;  3MMY B;  3VWB A;  2IGK A;  3DLA A;  3BG7 A;  1MNE A;  1W36 C;  4XM3 A;  3SZG A;  2VXZ A;  3PJR A;  4B44 A;  4OAY A;  2LYC A;  4FET A;  3QYB A;  2KDO A;  1V5G A;  2ZSI B;  3H5A A;  4DBR A;  4BS9 A;  3CES A;  2X51 A;  4PSX A;  4NUB A;  2LC2 A;  3MKZ A;  2ZFU A;  2X1E A;  1MMG A;  3SYT A;  4LIT A;  3OYK A;  2BW3 A;  2CUJ A;  3S3O A;  3FBI B;  5KHD A;  1X4O A;  2F5V A;  4AVZ A;  3VDX A;  2WB1 A;  3M1C A;  2K5C A;  3DPU A;  4C2U A;  3MD2 A;  2UWM A;  2XF6 A;  4XLE A;  2GOM A;  3HPG A;  3TBI A;  3LSM A;  4KT6 A;  3J7A Y;  4BQQ A;  2W4S A;  1TT0 A;  1PYV A;  2VJJ A;  2A5W A;  4E7Z A;  4IKF A;  4B3X A;  2HQA A;  5CQG A;  4D1Q A;  2R7U A;  5CKT A;  4F3Q A;  3S8P A;  4E7H A;  4PK4 A;  3VYT B;  3W2V A;  2XC7 A;  1MND A;  1Z3X A;  2W82 A;  3FHN A;  2ZSH B;  3BG6 A;  3W2A A;  5KCM A;  2KLO A;  4XN3 A;  1X1B A;  1MMD A;  1AA7 A;  4BJ6 C;  3OS2 A;  3H5N A;  3H5R A;  3K4B A;  3UR3 C;  2F6C A;  4XLA A;  2M4G A;  4CUG A;  1WJC A;  1VZ0 A;  1D1A A;  2M0M A;  3SEZ A;  3ZQQ A;  2DCE A;  2JUG A;  1OLT A;  2IGM A;  1YE9 A;  1G8X A;  2LG4 A;  3H9G A;  2Z2S B;  3BC8 A;  4HNU A;  3DQV C;  3IUO A;  2DT6 A;  3S93 A;  1Z7L A;  4RLF A;  2CH0 A;  1Z3Y A;  2K9L A;  4ZJZ A;  5HVQ C;  2Z1D A;  2X85 A;  2UV1 A;  2M4K A;  2CW8 A;  3K10 A;  2BW3 B;  3QYF A;  3HC7 A;  2MD0 A;  4N4O B;  5FRO A;  4DIQ A;  3AKZ A;  3OIP A;  3L2R A;  2XSJ C;  4IQJ A;  4PJL A;  3N05 A;  3ZR8 X;  3DTK A;  3DTI A;  4OAZ A;  1G59 A;  1V5E A;  4HRI A;  2CUZ A;  2UUZ A;  3C2G A;  3DWL E;  4BQO A;  5LD2 C;  2HVS A;  2X6X A;  4H4K C;  4HG2 A;  3CP2 A;  3LSI A;  4YEJ A;  3RPU D;  2AQF A;  4R79 A;  2ZXI A;  4Y4R A;  4XOT A;  3CJR B;  4LG3 A;  5HLT A;  4YEL A;  3OYL A;  4DGW B;  4OWR B;  1LVK A;  2KRH A;  2OC6 A;  3I9V 2;  3HG9 A;  2VJ5 A;  2NOJ B;  3OYG A;  3K4N A;  3OL3 A;  4RM2 A;  3OYE A;  3CP8 A;  4BU2 A;  4CA0 A;  4J01 A;  1J09 A;  3OYF A;  3OR1 C;  2R7T A;  3M8J A;  4PUS A;  1BR2 A;  2MYS A;  3H35 A;  4CH7 A;  2L9S A;  2R4G A;  1DGR M;  3OR2 C;  1YX5 A;  4CZC A;  2E5Z A;  5CQE A;  2VPL A;  2CS3 A;  3CJQ B;  4E7L A;  2QKM B;  5CPR B;  4II2 A;  2JVG A;  2V9K A;  4XOR A;  3BLY A;  4CCK A;  3LMM A;  4XOP A;  2VQG A;  1W36 D;  3QYE A;  1UEL B;  3I3L A;  3RQ4 A;  3VYR B;  2HVR A;  1Z21 A;  4KIT B;  3K6G A;  4E7S A;  3IP4 B;  3OYB A;  4BE0 A;  1FMV A;  3DPL C;  3HOS A;  4E4H A;  1K6Y A;  2MAB A;  1WJF A;  3TMO A;  2AQE A;  3QOE A;  4ZYA A;  2WAD A;  4E6K G;  2DT7 B;  3DPT A;  3E0J B;  1DP3 A;  3HOT A;  1QU3 A;  2LOO A;  1E0E A;  2VL8 A;  5JHF A;  3OYC A;  1WJ5 A;  1TZL A;  3OS1 A;  3VYS B;  1R6R A;  3H0D A;  4BDY A;  3ZCO A;  3PL8 A;  2WAQ A;  3G2B A;  4BAC A;  2WAE A;  4II3 A;  2XDV A;  1UAA A;  4E7J A;  2R7O A;  2W7N A;  1ERD A;  3AL0 C;  2KMU A;  1DGW Y;  3DTE A;  2RRE A;  3D5R C;  3TL4 X;  4RLQ A;  3MKY B;  3FBN B;  2IS6 A;  2E5N A;  2P0W A;  3LSH A;  1LFP A;  2VAS A;  2HVQ A;  2VIX A;  1LDK B;  2VQC A;  4IQ4 A;  2CV1 A;  3OOU A;  1D1C A;  3OYJ A;  2V1N A;  1QHG A;  2VB6 A;  3EUH C;  4QPO A;  4HST A;  3KX2 A;  4IX7 A;  3ONQ A;  4LIU A;  3OYA A;  2KQR A;  3K70 C;  4D9J A;  2ELJ A;  1MMA A;  4BDZ A;  5KNL A;  3PNV A;  5FRN A;  2FUG 2;  2CV2 A;  2DXI A;  2QKL B;  3DU6 A;  2V6E A;  3SEQ A;  3PSF A;  4F92 B;  2R7Q A;  1V5F A;  2Z16 A;  4F93 B;  1WJD A;  2RNG A;  2Q2E B;  3PSI A;  1BOB A;  3BCA A;  3K4M A;  2LBF A;  3H9Q A;  2KP6 A;  2BOL A;  3RTR A;  2W00 A;  3RCO A;  2DOA A;  4G6T B;  3VSK A;  3W2W A;  4BJ5 C;  2WA0 A;  2L2O A;  4XKV A;  2M7A A;  3LL7 A;  1N77 A;  2L9N A;  3AL0 B;  3L2W A;  2IXS A;  3FDY A;  3LSG A;  2E1M C;  2JA2 A;  2CW7 A;  3L2U A;  1X1C A;  3NWS A;  4HEA 2;  3A4C A;  4YRV A;  3IAS 2;  4Y3O A;  1Y6I A;  2HPM A;  2VQH A;  5HOO A;  3HL2 A;  2XAU A;  4KJZ A;  3L2V A;  3OY9 A;  3K4K A;  4BE2 A;  2F4I A;  2WY7 Q;  1JI8 A;  3EPZ A;  4NC8 A;  2IS2 A;  3CF2 A;  2IS1 A;  1D1B A;  1BR4 A;  4XMY A;  4P1W A;  2BVL A;  4AU7 A;  1N78 A;  3NWT A;  3DKY A;  1D0Y A;  4ITV A;  1MW7 A;  2LH9 A;  4CSW A;  2V26 A;  4PSW A;  1P9Q C;  2LY2 A;  3K4C A;  2LBF B;  1X1D A;  3LSK A;  4EAT A;  5HNH A;  3ZRG A;  2WBM A;  2VJI A;  3GBG A;  1D0X A;  3PFY A;  2MFZ A;  2XF5 A;  3FKJ A;  3S3M A;  3DU5 A;  2R7V A;  1S9H A;  4DOZ A;  4B47 A;  4PJM A;  2E1M B;  1SFK A;  4J00 A;  1BR1 A;  2VXD A;  2JVH A;  3D5S C;  2L5Q A;  3HUG B;  2L7K A;  2V7F A;  2GOX B;  4XKC A;  4X0G A;  1WJE A;  4XQF A;  1IRX A;  3OYN A;  1OR7 C;  2O5R A;  4IZZ A;  4QPQ A;  4C30 A;  4LIV A;  3ZGK A;  2I8D A;  3OS0 A;  4BE1 A;  2VQL A;  3V42 A;  4NQW B;  2HDW A;  3PNT A;  1NG6 A;  1MMN A;  2E60 A;  2JSP A;  1SAU A;  4XNF A;  4JQF A;  1HA8 A;  2X6Y A;  2KZV A;  2M3A A;  4DJA A;  3LFU A;  2KPM A;  4XON A;  3A2K A;  1ZEL A;  4BQN A;  3DKX A;  3CZ6 A;  2VKH A;  4PJJ A;  2W1O A;  3OMY A;  2WAF A;  4B48 A;  2BVM A;  2X1C A;  3SDB A;  1X19 A;  5HNF A;  5TGT A;  2HNH A;  4N4N B;  1Y56 A;  3KEY A;  4CCL A;  4GRI A;  2R7W A;  1NG7 A;  3OWT A;  3K70 D;  4XKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...