4GCVA

Structure of a putative transcription factor (pa1374)from pseudomonas aeruginosa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
146
structure length
145
Chain Sequence
CPIARSLERVGEWWSILIMRDALQGLRRFDEFSRSLDIAPNMLTRRLNALVEAGLLERQPYSQRPRYQYVPTAKGEDFRVVLMAFVAWGNRHYAQQGQSVQLVERTSGRPVRSFMAALADGRTVPLEQCTVQAGPAASEEMRQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of PA1374 from Pseudomonas aeruginosa, a putative oxidative-stress sensing transcriptional regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transcription
molecule keywords Putative transcription protein
total genus 29
structure length 145
sequence length 146
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gcvA00
4LK0F 1G3WA 5JI6A 4ETSA 3GVAA 3WU1B 4RB1A 2V1XA 5LBQA 4P96A 4BHCA 2XAFA 4I7HA 1EH6A 2H09A 2FRHA 2P8TA 2K7LA 2MA3A 5E1WA 1Q1HA 2FU4A 4L9JA 2EFQA 3F8FA 2QBYB 1K6OA 3NEUA 4LMYA 1G3TA 1T39A 2ZJ2A 2OZUA 1K78A 1ZN2A 3LQRA 3V4GA 3ZN0A 4GO1A 3FMSA 3HYIA 3JAMK 1RNLA 2QQ9A 3MQ0A 5EEHA 3B73A 1G3SA 1W4MA 3PQJA 5CVIA 5KVRA 1UHWA 3N4MA 2KRFA 3E5QA 2DO7A 2DQLA 2TDXA 1QO0D 3EDPA 1XSXA 4LB5A 2JZYA 3DFGA 4RS8A 4H0EA 2EWNA 3TO6A 1LDJA 1FZPB 2OBPA 2QYOA 2HGCA 4EV0A 3QOPA 5H6QA 1TNTA 5K1YA 3HUGA 2E7WA 4AIHA 4WWCA 4RGXA 5DYMA 4HF0A 2A69F 2QM3A 4L0YB 2IA0A 3F8NA 1IXSB 3ECOA 1TQIA 5D6FA 1MJ9A 3GFMA 3R0AA 1KYZA 3BPXA 3JAMZ 2GZWA 4L9TA 4N9HA 4DNCA 3VODA 1IUYA 3JTGA 4NHJA 2HR3A 2X0LA 4KN7X 3NRVA 1YW8A 2K02A 1XDUA 2L54A 2VC0A 1MJBA 1J5YA 3LA7A 1E2XA 2VBWA 3K1MA 1IN6A 4ESJA 1BN5A 3E3VA 3HHGA 3GFIA 4WXHA 4I98B 4G7ZF 1CF7A 1YG2A 4HX4A 5TJJA 3SZPA 2FMLA 4HBLA 4F7ZA 3J80Z 4HLYA 2P6SA 1H9TA 4MEYF 2LSOA 2QQBA 2H94A 1NHAA 2PMUA 3LFKA 2HTJA 3QP5A 1OYYA 1STZA 3T5XA 2E7XA 4PGHA 3HIFA 2IA1A 5E8GA 2VXZA 3GFJA 2V79A 3BJOA 3TKYA 1RI7A 1R1UA 4FX0A 4KNYA 4UV9A 5LGUA 5BMZA 3RJPA 1BIBA 3FM3A 3HTSB 1MDMB 4S05A 2EFNA 5AONA 1P92A 1CGPA 3I59A 5HS7A 1JXSA 3F21A 5K5RA 4EM1A 3SHFA 4UUVA 1ZAOA 3SZTA 1ZRDA 2RNJA 3DQVC 3IHUA 1S29A 1HQCA 3O2PE 2VE8A 2DAOA 1WQ2A 1FOKA 4HQEA 2AS5F 4B09A 3RKXA 5FD6A 1B9NA 2V9VA 2V1DA 1SD6A 4IJAA 2C6YA 1HSTA 3AAFA 4L9VA 4FHTA 1GHCA 5D6EA 2FA5A 1UFMA 1P2FA 2J5OA 3ZP5A 4PDKA 1IF1A 1ONVA 4UHTA 3WTWC 4MTDA 1HKSA 2XRNA 1L3LA 1RIOH 5A2QZ 3EQLF 5D5VB 2K4BA 2V1UA 5L3FA 1WI9A 3C18A 1QNTA 2FSWA 2W57A 3M9AA 1IN7A 3JSOA 2YX4A 2A6EF 1K79A 3MZHA 3I58A 4WX9A 3SQNA 3R6SA 2R3SA 2HQRA 1WWXA 1KYWA 1RUNA 2EFPA 4GXOA 3L2CA 2Q8KA 2IJLA 3GYHX 5FLXZ 1MZBA 2HTSA 2JPBA 1G3YA 3DP7A 1T6SA 4BYYA 4HAMA 3KCCA 2BYVE 5HDGA 3Q9SA 3VEPA 3I5UA 1KQ9A 2M30A 4B8XA 1O7LA 2LDUA 4EJVA 2G9WA 4LFUA 4ZZLA 4PZJA 1TW2A 3FHZA 2EA2A 4OMZA 1J7KA 1O3SA 3JSPA 1U5TB 4RAYA 4HV6A 2MD5A 2F2EA 5D8KB 3REOA 5IT9Z 5LHHA 1FP1D 3C3WA 4BAYA 5LGNA 3HSEA 3E5XA 2KIMA 1R1TA 3U1DA 4IF4A 5LGTA 4CHUA 5D8LB 4QWQA 1IRGA 1ULYA 1U5TA 2FEZA 2W84A 4I0AA 1WSUA 2IA2A 3FX3A 2V6CA 1SD5A 2CYYA 1QPMA 1YLFA 2Z3YA 4KIBA 1JHFA 4Y15A 4EVIA 5ICCA 5LHIA 4IVNA 2STTA 1XMKA 3LAPA 2R7FA 2WTEA 2CW0F 4O5VA 2HOEA 3HRSA 2O0YA 2A3SA 2RV8A 2VT3A 3WTXC 3KP4A 2XHKA 3KZYA 1V4RA 5HDKA 5EEGA 1KU9A 2P5KA 3KEOA 2DTRA 4OIOF 1AOYA 3CUQA 3ELKA 1KU3A 3MWMA 4JK1X 4N9IA 5D5XB 2A61A 5DD4A 1IZ1A 5FLXK 2D1VA 3RPQA 4HX7A 3FMRA 1E17A 2DPUA 1IXRC 2IVMA 2VC1A 5CVJA 1ZG5A 2DU9A 2H6BA 1T0FA 3I64A 3COAC 4OMYA 2FNPA 4RGSA 4G8XA 2Z33A 5FFXA 3GEZA 4KIFA 1OYIA 3R61A 5JVTA 3S2WA 2KJBA 4LG0A 4LLLA 4G7HF 5FD5A 2P7VB 5DUIA 2ADUA 4Y17A 1QZYA 2A6HF 4L0ZB 3IKVA 4M72A 1FT9A 3WU0A 5A2QK 4M74A 2ELHA 4P9FA 1ZARA 4IRIA 1UB9A 3P9IA 1PP8F 1W5SA 3E6MA 3QPTA 3RKYA 5DD8A 1Z7UA 4EGZA 3IRQA 4CGZA 3E97A 5L3DA 1OMIA 2GXGA 2PBIA 4K2EA 3KE2A 4HF1A 1SFXA 2RN7A 2L4AA 2QQAA 4WXDA 3G73A 4RB2C 4WCGA 2NS0A 3LSTA 4R8HA 2YU3A 1ZRFA 1X3UA 5CVUA 2L3DA 2BV6A 3LWFA 2MLGA 1KA8A 2Q2EA 2UXXA 4JQFA 3M8FA 3VFZA 2PLYA 1D5VA 1FP2A 3E6DA 2OQRA 2CFXA 2PEXA 3WG9A 2HYGD 4GYGA 3MFKA 3DKWA 1USSA 1U78A 1CF7B 4RGUA 2PN6A 1MJAA 2DT5A 2L4MA 2EFOA 1YTYA 2GAUA 3BJ6A 3MCZA 5BPDA 4NQWA 2RC4A 3WGIA 1A04A 2P5LC 2MLKA 4U0YA 4BHPA 3GZ6A 4IPAA 4KDPA 1ZG1A 4UXNA 4KA4A 3CUQC 3F3XA 1QZZA 5D5UB 4MQ9F 3ZMSA 1Z6RA 3F22A 3R4KA 2QBYA 4Z2YA 4LD5A 3ZN1A 3WTSC 1F4KA 4KICA 2JTVA 1YO5C 3PQKA 3BDDA 3D5LA 4I2OA 2QVOA 5D4SA 1SFEA 3W6KB 3KP6A 1KU2A 1O3TA 3T0YA 1BOAA 4BH9A 3CUQB 1U3EM 3ZMUA 1EH8A 2Z9OA 5LRSA 2M5WA 4ZH4F 1O57A 1LEAA 3L09A 4BQAA 2K86A 1B9MA 1KQ0A 3BWGA 1MD0A 5CLSA 2O3FA 2RKHA 2GQQA 3FZVA 4EGYA 1WKMA 2DK8A 1ZG3A 2XVCA 4I01A 5LHGA 3RDIA 2XAHA 4ZYHA 5ILUA 4A6DA 5D5WB 2KIUA 3Q9VA 2B0LA 3KFWX 2OZ6A 2CSOA 2PMHA 2VT2A 1DPRA 2P5VA 2Y75A 3HOTA 2M1BA 2OD5A 2LNBA 3ABUA 5JFRA 3W6JB 5DV5A 2YSRA 4Q5SF 2XKOA 2R7DA 3FF5A 2EB7A 1FC3A 4LG0B 4U7BA 3BPVA 1YW7A 3GWZA 2VBXA 4XLPF 3LA3A 2DPDA 4ZYEA 1W7PD 1USTA 2BGCA 2CO5A 4U7DA 1D3YA 4IHTA 4D0PA 1T98A 4P5OA 3I4PA 1REPC 2ZO4A 1LJ9A 4EMSA 2W24A 1OPCA 3K1PA 3P7NA 3K0LA 1OKRA 1BM9A 6PAXA 5D4RA 2PJPA 4A12A 1RUOA 5ICEA 3QP6A 2W25A 4Q47A 4UNOA 5CYVA 1IN4A 1FYLA 3NQOA 1TQMA 1S3JA 4G6DA 4MQVA 1O3RA 3R60A 1HKQA 1HXDA 1DDNA 5BOXA 1W7PB 2P4WA 2QLZA 1C0WA 4CDGA 1AWCA 1BBYA 5K5QA 4HA8A 3DPTA 4PGGA 2Q0OA 1XSVA 2DFIA 4ON0A 1Z9CA 4G7OF 3ZPLA 1Z6TA 4IXAA 3IL2A 1FYMA 4QLCU 2A68F 3C1DA 2HKOA 4AIKA 3G3ZA 4OIPF 3F6VA 2D45A 3O6BB 2P6TA 3KZZA 2F5FA 3LQQA 4FT8A 1Z05A 3KP3A 3TGNA 4WF2A 3DEUA 3J81Z 2FMYA 5HLGA 3HRUA 1FBSA 2XUBA 2NNYA 4M6XA 3DV8A 5FO5A 3E5UA 3SXYA 3JTHA 1SFUA 4HZFA 1KU7A 2O03A 3M8EA 4HX8A 4HDUA 1TW3A 1ZGAA 3M7GA 3KLOA 2FE3A 4UV8A 2K4JA 2ZMEA 5L3CA 2EJRA 4OU0A 4WXCA 1XDSA 1XGSA 2XASA 2STWA 2DBBA 3KLNA 4M6YA 1SMYF 5CJ9A 4HQMA 2WWYA 1SMTA 3T1BA 2VBZA 1D8KA 3GXOA 1PUEE 1YIOA 3J80K 4KMFA 5E20A 1MDMA 2M87A 1FBUA 2G7HA 4LB6B 3BJAA 2HKXA 1QQIA 1S7OA 1SD7A 1F1ZA 3V7SA 3CO7C 3RYPA 3B02A 4HLXA 1IAWA 5J8CA 3IC7A 4I02A 5CVVA 4AWXB 4M9ZA 1DP7P 4A2UA 1FLIA 4RB0A 4A0XA 3T8TA 4G9YA 2GIVA 2UXNA 1GVJA 1TQPA 1H0MA 5ILSA 1YFHA 4UVAA 5K5OA 2VE9A 4S04A 2ZFWA 3CO6C 2NAZA 1R7JA 3O3KA 2Z99A 2CQKA 3J81K 2L02A 3H92A 4EJOA 2X4HA 4DQ2A 2H6CA 3IKTA 1U8RA 1DPUA 1XD7A 3ABTA 4ESFA 3P9CA 4BXUA 2UZKA 4G6QA 3CTAA 3GUDA 2COMA 3WTTC 2JT1A 2ESHA 2H27A 1K78B 4RAZA 1ON1A 2NRAC 2QZ8A 4YFKF 3WTUC 2NYXA 3EETA 1H9GA 3CJNA 1JE8A 1HBXG 4XRFA 5E1XA 4CZZA 4XBFA 1I1GA 2G7UA 2ETHA 3FXUA 4KT5C 2DQRA 4KN4X 2HZTA 2IRFG 5FB2A 1G4DA 4L9NA 2GXBA 1U5TC 2YPRA 1I6XA 1XGOA 5DEQA 2ZKZA 3KEQA 4AVPA 1BI2A 3U9GA 3VB2A 4FX4A 3C7JA 2LF8A 2FBKA 3EYYA 4IRGA 2KKOA 3BP8A 4UVBA 2DI3A 3GLXA 1LVAA 1L0OC 4EM0B 4ENMA 4XLNF 3N97A 2IT0A 5IT3A 2ZMEB 4BNCA 2QWWA 3E6CC 4A6EA 3KP5A 2XROA 1TTYA 3F72A 1S6LA 4KUMA 1B1BA 5CVRA 3WTVC 1F5TA 2O61A 4NB5A 1LEBA 5JR3A 2XAGA 2DW4A 5HDNA 4L18B 2M45A 4RB3C 2J5PA 1ODDA 1ZLJA 2P7CB 1BC7C 1RZ4A 3MZYA 4XSXF 3GFLA 2ISYA 4Q48A 1R5GA 3GW2A 3SFZA 2KJCA 2JRTA 3TO9A 2GWRA 4BHBA 1FSEA 1Z1DA 1HKTA 3K9TA 3L9FA 5F6FA 2CWEA 2OAZA 1BI3A 1MGTA 1XSDA 3ZMVA 4HDVA 2MBFA 3HHHA 2W85A 3K69A 1B59A 1HSJA 5AIQA 4HF2A 2VBYA 1BC8C 1R23A 3I59B 2HEOA 2HS5A 4U88A 2VOOA 1MKMA 3CUOA 5DCMA 2BEOA 3H3UA 2DLLA 3TOBA 4M9SA 4OIRF 1J9IA 1ZHFA 2PI0A 4OOIA 1FNNA 4R79A 4EJWA 1D8JA 3QU3A 1OYWA 5E17F 2XV4S 5BPIA 1FWZA 3RI4A 3ZMZA 5DUKA 1OR7A 2K27A 3ERED 5LRRA 2EA4A 4YIIA 5L3EA 3ISPA 2OQGA 4AD9A 3RIRA 2VN2A 4CYDA 1QBJA 1GXQA 3L00A 3K2ZA 2ZXJA 2WV0A 3QPHA 5BQTA 2VODA 1R5HA 2PQ8A 1Y0UA 3BOQA 2IPQX 3HSRA 1FX7A 4WK8F 5JHUA 4JBAA 3HOSA 3EUHA 4ENNA 4HYEA 2A07F 3H3ZA 4M71A 1ZGJA 1P4WA 3RKWA 1ZLKA 3P9KA 1W7PA 3ZMDA 3ZQ7A 1FPQA 3ML6A 2XAJA 1YW9A 4OINF 1LDDA 3ULQB 4I09A 1TLHB 2GA2A 2RGVA 1IN5A 3FM5A 5F1RA 4MGRA 4ZYDA 2ACJA 2FBHA 2O6GE 1O3QA 1R00A 2WC2A 3RTRA 4GGGA 3QAHA 2EV6A 1IXCA 4GYIA 2Z5UA 3TO7A 5ERIA 2XKPA 1KGSA 3R0JA 5H6RA 1EV7A 4UVCA 3F6OA 2ISZA 3TDZC 5J8FA 4EM2A 2F5CA 4KYWA 2L01A 1GXPA 3I54A 2D2WA 1G6NA 3J7AO 1SAXA 2HQNA 4L5IA 5DCFA 3V8JA 1B4AA 1S7AA 4M73A 3WTYC 1J59A 1T38A 4YIFA 2ZNYA 3OV8A 4P55A 3JW4A 3DXJF 2F5DA 1R58A 2XAQA 5F64A 1YQAA 1W5TA 3WODF 2FF4A 2IP2A 2Y0MA 2HWVA 1Z91A 2MH9A 2BE5F 2HFHA 3KP2A 2Y48A 3TQNA 3DF8A 4ENJA 1B6AA 4MHGA 3U2RA 3LAJA 1P4AA 5ICGA 4CICA 1J0RA 3GO5A 3FWEA 4CO8A 3HSFA 5E18F 3WTZA 4IHSA 2RDPA 3TOAA 4I0BA 4GCVA 1XMAA 3ECHA 4EQQA 4IRHA 1T2KA 2JPCA 1XGNA 1J2XA 4LLNA 3FMQA 4Y13A 5ICFA 2FOKA 2YR2A 1DUXC 2EV0A 3WGGA 5HLHA 1LNWA 2LKPA 2XIGA 2CGPA 2QUFA 1I1SA 1U2WA 1I5ZA 4MNUA 2RVCA 4ESBA 2EV5A 4G94A 3GF2A 4KIGA 3M1EA 3WGHA 4MEXF 3GX4X 1ZH5A 2AXLA 4HW0A 4O6JA 1UCRA 2BBYA 4ZZDA 2EK5A 4ENKA 1TBXA 3I71A 1K7AA 2EFWA 1P4XA 5HOOA 5ED4A 4L5JA 5FGMA 4E70A 2UWMA 1ZREA 1IRFA 2XGXA 4A0ZA 1SD4A 2PFBA 3KP7A 4AIJA 2CG4A 5IT9K 3FXRA 4U0WA 2OU2A 5E8IA 3V7RA 4A0YA 2FQ3A 5BS6A 1R1VA 4LK1F 3IRRA 3F8MA 1I27A 1FSHA 3IWFA 3BROA 1BI0A 2A5YB 3EYIA 2O8XA 5LLQA 3ZMTA 3KETA 1LB2A 5DCMB 3I53A 3V8LA 4Q4ZF 4CXFA 1R36A 3CLOA 1PP7U 2DK5A 3BY6A 2YX7A 4TV7A 1V3FA 2FNAA 2ZNZA 2HYFA 3MAJA 5HS8A 3RPUA 2KIFA 5DDGA 4R1HA 1PDNC 3HRMA 3I0TA 3V8KA 5LEJA 4XSZF 3L7WA 3OOPA 2JSCA 2MH2A 1FBQA 1JHHA 4KFCA 3V7CA 4N0BA 2LF7A 2MC3A 3RYRA 3MEXA 3D0SA 1BI1A 1EH7A 5TRDA 5L3BA 2GA1A 1YYVA 4HOBA 2RQPA 2VOPA 4P9UA 1XB4A 3LA2A 4ZYGA 1KQ8A 1F9NA 3T8RA 2NNNA 2E1CA 3DPLC 3WE2A 4PCQA 5L3GA 2ZCWA 4LGWA 1O7FA 3VOEA 4YFNF 2IW5A 3E6BA 3GZ5A 2PG4A 3CDHA 4LLGF 1ON2A 4EJUA 1HW2A 3K1NA 1IN8A 4EJTA 1HW1A 3Q5FA 4HV5A 3ROUA 1ZRCA 1XCVA 4KMUX 1LQ1A 1XCBA 3F23A 1S8NA 1VTNC 1P6RA 2F5EA 4U0VA 3HRTA 4ASNA 3TDUC 1IW7F 1FYKA 3FXQA 2FXAA 4O3MA 5HVQC 3WE3A 5J6XA 4RGRA 2M8EA 2E1NA 4A5MA 5AIPA 5FFZA 5H20A 3BZ6A 3HTUA 4MTEA 4YG2F 1WRJA 1YS6A 5HLIA 2HDCA 3IWZA 2D1HA 1JGSA 2OA4A 3QU6A 4A5NA 4M9XA 1FY7A 2ESNA 1HW5A 4YFXF 3PFIA 5E1ZB 1UHMA 5LEKA 1U6GA 1J75A 1BJAA 1BIAA 4LJZF 4OIQF 5HS9A 1QGPA 1YS7A 1ZYRF 3F8BA 2FBIA 2ZBKA 1XGMA 2VONA 1LDKB 3F8CA 1R22A 1XN7A 3QRFF 5ILVA 2QENA 5KK1A 1TNSA
chains in the Genus database with same CATH superfamily
3S3NA 4LK0F 4BKXA 1G3WA 5JI6A 2ECCA 1WPKA 1MNEA 4MLOA 4DOZA 2GBYA 2JA2A 4ETSA 3GVAA 3WU1B 4N4OB 2GIZA 4RB1A 2V1XA 3NARA 2NVTJ 2ELJA 2ELKA 4G12A 5FKOA 5LBQA 1X3WB 1DGRM 1NTCA 4P96A 4BHCA 2XAFA 4I7HA 1D0XA 1EH6A 2H09A 2FRHA 2DYSH 1IUFA 4F91B 2P8TA 2ME0A 1RR7A 2K7LA 2GXAA 2MA3A 5E1WA 1Q1HA 4EEFG 1BR1A 2FU4A 1SAUA 3HOZJ 3LMMA 4L9JA 4RAFA 1WJAA 1YJNI 1QVUA 2EFQA 3F8FA 2QBYB 4LMYA 3NEUA 2VQLA 1K6OA 2QSHX 1G3TA 3BTIA 1T39A 2ZJ2A 1I6HJ 2OZUA 1K78A 1ZN2A 1QRYA 2ZJQF 5EGOA 3LQRA 4I99C 1T08B 3TP3A 3V4GA 1SFKA 1WH5A 3ZN0A 1FOXA 1HDPA 4GO1A 2IS2A 3MZ8A 3FMSA 1XTAA 3HYIA 3JAMK 3DWLE 2Q1ZB 4RLQA 5FROA 2HZDA 3K4MA 1IG7A 1RNLA 2QQ9A 3MQ0A 4BS9A 5EEHA 3B73A 1G3SA 2L9NA 1W4MA 1A6QA 3PQJA 5CVIA 1FJLA 4LIUA 2KPMA 5KVRA 1W0UA 2QEXI 1UHWA 3CCMI 5IP7J 3N4MA 2KRFA 2IEKA 3E5QA 2DO7A 3OS0A 2DQLA 2TDXA 1QO0D 3EDPA 3GCMA 1XSXA 4LB5A 2DCEA 3FXLA 2JZYA 3DFGA 4RS8A 5TISC 4BBRJ 4H0EA 2EWNA 2JMWA 5FKMA 1D0ZA 4MFDA 3WU2C 2K9NA 3TO6A 1LDJA 3ABLH 3FK7A 1FZPB 2OBPA 4BQOA 4NC8A 2QYOA 4XORA 2HGCA 4EV0A 1VQ4I 4X0GA 3QOPA 2I10A 1FMVA 5DS9A 2LTPA 5H6QA 2JQ7A 3LSRA 1TNTA 4ZDLA 3FHNA 5K1YA 2CJJA 2CUEA 3HUGA 2E7WA 2KDOA 4AIHA 4WWCA 4RGXA 3H9GA 4CYCA 5DYMA 4HF0A 2A69F 3PNTA 2QM3A 2F5VA 2Y31A 5F0FA 4L0YB 2IA0A 3Q3SA 3CMEI 1ERDA 3S3OA 3F8NA 2R92J 1IXSB 3ECOA 1VQ5I 2B9SA 1TQIA 3EUHC 1FIPA 4JOMA 2NVXJ 2WB1N 5D6FA 3ASNH 1MJ9A 1PVEA 3GFMA 1MH3A 3R0AA 3H9QA 1KYZA 2KIQA 5DM7F 3BPXA 1ZR4A 2VUMJ 3JAMZ 2GZWA 2X1DA 4L9TA 1UMQA 2E5ZA 3TL4X 2RQQA 4N9HA 4DNCA 3VODA 1IUYA 2QKMB 2XDVA 3JTGA 2EILH 4NHJA 2R7OA 2HR3A 3PIOF 2X0LA 1UJ8A 4KN7X 3NRVA 4C3HJ 1VQPI 1YW8A 2K02A 3BQYA 1XDUA 2L54A 2VC0A 1MJBA 1J5YA 5J1RA 3LA7A 1E2XA 2VBWA 2EINH 3K1MA 1B72B 4XLHA 1IN6A 5JLXA 5B3SH 4MIMA 2VQCA 4ESJA 5CQGA 3HKZN 1WJFA 1BN5A 2V6EA 4JP0A 5FKLA 4XRSG 3FDYA 3G4SI 3S1NJ 1FEXA 3E3VA 3HHGA 2XB5A 4AYBN 3GFIA 4WXHA 2LC2A 4I98B 4G7ZF 1CF7A 2IGMA 1YG2A 1MBKA 2OUMA 4FE4A 4HX4A 2QQ8A 5TJJA 2A6TA 3SZPA 4A3FJ 2FMLA 4HBLA 4F7ZA 1YE9A 2M3AA 3J80Z 2O9LA 1OR7C 2W48A 3BT9A 4HLYA 3K4JA 3HB9A 2P6SA 1H9TA 1ETYA 4MEYF 2LSOA 2QQBA 3BR0A 2V26A 3DKXA 5C44J 1DU0A 2H94A 1HC8A 1NHAA 2PMUA 5K7HA 4XRMA 1AA7A 2I8DA 1QZEA 2LK2A 2K9QA 3I55I 3LFKA 2HTJA 3DTEA 3QP5A 1IGNA 3RZDJ 1OYYA 1STZA 3DEEA 2E7XA 4PGHA 3T5XA 2DDBA 4BGDA 4BQNA 5FKNA 3HIFA 3BG7A 3GMEA 4BJ6C 2IA1A 2GLOA 5E8GA 1N77A 4CCNA 2K9LA 1TWHJ 3GFJA 2VXZA 2V79A 2G0EA 2E19A 3ZCOA 3BJOA 4DZPA 1TWAJ 3TKYA 4CUGA 4B4CA 4ZDPA 3A2KA 3EUKL 4C2MJ 2VIXA 4CCKA 3GLLA 1RI7A 1R1UA 2VL8A 3DTKA 4FX0A 1TWFJ 1K4SA 2M4GA 4KNYA 4UV9A 5LGUA 5BMZA 3RJPA 1BIBA 1T33A 2JUGA 1Y39A 3BC8A 3HBLA 3FM3A 1ETVA 3S2HJ 4X6AJ 5F08A 3HTSB 1MDMB 4S05A 3CMYA 2EFNA 5AONA 3A01A 2R7ZJ 1P92A 1CGPA 3BTCA 3I59A 5HS7A 3BCBA 2BY3A 3LOCA 1ZELA 5K5RA 3F21A 1JXSA 1TWGJ 3DLAA 3HKZA 2R7QA 2FJ1A 1WJCA 4EM1A 1XPXA 3M07A 1JKQC 3SHFA 4UUVA 1ZAOA 1S5LC 2EIMH 3SZTA 1OCPA 2LY2A 2RNJA 1ZRDA 3OYDA 2DA2A 3DQVC 3IHUA 2NS7A 3KIOA 1S29A 4NC6A 3IAS2 2Z1DA 1HQCA 2PJRB 4BE0A 3O2PE 2VE8A 2DAOA 1WQ2A 2DA7A 3CCRI 1YRNA 1FOKA 2B7EA 1YHQI 4HQEA 2AS5F 3FXJA 3OYLA 4B09A 3RKXA 5FD6A 1B9NA 3BTJA 4F52A 1DU6A 2V9VA 2V1DA 2VB6A 3GZNB 5FJ8J 1SD6A 1NG6A 2NOJB 4IJAA 1UAAA 1BR2A 2C6YA 4AIDA 1HSTA 4DYRA 2DJNA 2QCOA 3AAFA 5GTHC 4L9VA 2HU9A 1ZTRA 4DW6A 2HNHA 2L9SA 5GAEJ 4FHTA 2ID3A 1ETQA 4I76A 4E4HA 1ZGWA 1GHCA 4JYKA 3CDLA 4V2FA 2ZSHB 5D6EA 2FA5A 3CF2A 4MFEA 4PJ0C 1UFMA 1D0YA 1P2FA 4AVZA 3SDGA 2J5OA 4L5EA 1G59A 3LSJA 3ZP5A 4PDKA 1IF1A 3S17J 4BUPA 2X85A 1D1CA 1ONVA 5EEAA 2R0QC 4UHTA 1A6IA 4W97A 2XSDC 3DLLF 3WTWC 2IGKA 4MTDA 3ABMH 2DODA 1HKSA 2BHZA 2XRNA 1L3LA 2BW3B 1RIOH 2ZXWH 3OS1A 1OCRH 5A2QZ 3EQLF 5D5VB 2DN0A 2K4BA 2V1UA 3OYEA 3H3VK 2JA8J 2PMZN 5L3FA 1JKPC 1WI9A 3C18A 1H8AC 2M34A 1QNTA 1OLTA 2FSWA 1N75A 2FD5A 2W57A 1BW6A 3M9AA 1IN7A 3O8GA 3HPHA 4II3A 2A05A 3JSOA 3K70C 1FTZA 1X1BA 2YX4A 2A6EF 1K79A 3MZHA 2BVLA 3GTPJ 4CH7A 4XOTA 3NWTA 3I58A 1V55H 4WX9A 3SQNA 3CLQA 2R3SA 3R6SA 4CZCA 2MD0A 5FKKA 5E3LA 2MFZA 2HQRA 4CA0A 1JUPA 1WWXA 1KYWA 1VQLI 3VYUB 1A36A 2BOLA 1RUNA 2JK3A 2EFPA 3BCAA 4GXOA 3L2CA 2Q8KA 3IH2A 4V2GA 4KJZA 2IJLA 3HEFA 4F55A 1SVMA 4E7JA 3GYHX 4II2A 5FLXZ 1MZBA 2HTSA 2CV0A 2JPBA 1G3YA 4BL0B 3DP7A 3GTOJ 1T6SA 4BYYA 4HAMA 3KCCA 2BYVE 4BE1A 5HDGA 3QPLA 3CCLI 3Q9SA 3VEPA 4XR6A 3I5UA 1KQ9A 2M30A 4B8XA 1O7LA 3QQAA 3V42A 2LDUA 4EJVA 2G9WA 3JRIA 2MABA 4LFUA 4ZZLA 4PZJA 1TW2A 4XKBA 3FHZA 2K3FA 3PNVA 2EA2A 3E0JB 4OMZA 1J7KA 2VKHA 4AU7A 2DA3A 3JSPA 1O3SA 1I50J 2WY8Q 1U5TB 4RAYA 3SEZA 3LSKA 4HV6A 2MD5A 3L2QA 2RNGA 2F2EA 1KONA 2WV1A 2BXYA 4DYQA 4HNVA 5D8KB 3REOA 3HOUJ 5IT9Z 1N25A 5LHHA 1FP1D 3CC2I 3C3WA 4BAYA 1ETWA 3AL0C 5LGNA 3HSEA 3E5XA 1K6YA 4DBQA 1YX5A 2KIMA 1R1TA 3U1DA 4IF4A 5LGTA 4RBOA 3JRCA 4CHUA 3LL7A 2EIJH 3IAM2 4HPQA 5K7ZA 5J40A 2R5YB 5D8LB 4QWQA 3JRAA 1IRGA 3S1QJ 1ULYA 1U5TA 2FEZA 3H0DA 1IC8A 4CCOA 2W84A 3BR3A 2QKLB 2VKEA 4I0AA 4PJNA 1RETA 2R5ZA 1WSUA 2IA2A 3LFUA 4FCYA 1D5YA 4IOAF 3RQ4A 2VJ5A 2YU9J 3FX3A 2CRGA 4B3AA 2V6CA 1SD5A 2LP0A 2CYYA 1QPMA 2ICWG 1YLFA 1A35A 2Z3YA 4KIBA 2KMUA 1JHFA 4Y15A 4EVIA 5ICCA 5LHIA 4IVNA 4I6ZA 2STTA 1XMKA 1WJDA 3LAPA 2V7FA 2R7FA 2WTEA 2CW0F 4O5VA 2HVQA 3PIPF 2HOEA 2KT0A 3HRSA 2O0YA 2A3SA 3HOYJ 2RV8A 2VT3A 1K83J 3WTXC 3BG3A 3KP4A 3H5RA 2XHKA 3KZYA 1V4RA 2JA5J 1Z21A 5HDKA 1Y56A 5EEGA 4UUSA 1E3HA 2DXIA 4W1UA 1KU9A 3G6EI 2HXIA 2P5KA 3KEOA 2EH3A 3QYFA 2V9PA 2CW8A 2DTRA 4B44A 4OIOF 3KEYA 1AOYA 1VQNI 3U21A 2AO9A 3CUQA 3ELKA 4GRIA 1KU3A 1MW7A 4XIDA 1BOBA 2ZJRF 3MWMA 4JK1X 4N9IA 3ZQGA 3DU6A 3C2BA 5D5XB 3HDDA 3HC7A 3VWBA 2L9VA 4IQJA 2A61A 3CCUI 5CPRB 5DD4A 1IZ1A 1OCZH 5FLXK 1E3PA 2D1VA 3RPQA 1R9TJ 4HX7A 3M4OJ 3FMRA 2DT6A 3FISA 1E17A 3BZKA 2MC4A 2DPUA 2XGCA 1IXRC 2IVMA 5EGOB 4PJMA 2VC1A 2TCTA 3JRGA 2VQGA 2K9MA 5CVJA 2H8RA 1WZ2A 1ZG5A 2DU9A 3Q0VA 2H6BA 3MKYB 1T0FA 1VI0A 4UUTA 3Q0UA 3I64A 3COAC 1TL8A 1JI8A 1XS9A 2E2JJ 4Y33A 4OMYA 1XMXA 2E1MC 2FNPA 4RGSA 5FRNA 4G8XA 2Z33A 2A5WA 2DMQA 2MW8A 3QODA 1Y0NA 3A0HC 2JVHA 5IP6A 3HOXJ 2E35A 3E1SA 5FFXA 3GEZA 4KIFA 3S8PA 1LE8B 1OYIA 4RLFA 3R61A 5JVTA 3H9JA 3S2WA 2KJBA 4NUBA 4LG0A 4LLLA 4G7HF 2X48A 5GADJ 2LVSA 5FD5A 2P7VB 5DUIA 2ADUA 4Y17A 1QZYA 2A6HF 4L0ZB 3IKVA 4M72A 1HLVA 1FT9A 3WU0A 5KAIC 5A2QK 4M74A 2ELHA 4KT6A 4BXXJ 1Z0XA 1OCOH 9ANTA 1WHUA 4P9FA 1ZARA 4IRIA 1Z67A 3QOEA 4XKVA 1UB9A 3P9IA 1PP8F 2HOTA 1W5SA 5EYRA 3D1NI 3E6MA 1EJ9A 1IRZA 1X1CA 3QPTA 1PUFB 3RKYA 4GDFA 5DD8A 1JTXA 1MMNA 1TWCJ 2XB0X 1Z7UA 4EGZA 4HSRA 3K4BA 1Z3YA 3IRQA 3CQZJ 3J7ZI 2IAIA 4CGZA 1W1WE 2ZC2A 3E97A 2UV1A 4PSXA 5L3DA 1VQOI 1OMIA 3PUFA 2GXGA 2PBIA 2M7BA 1UZCA 5IYDJ 4K2EA 2UUZA 1JJ6C 3HOWJ 3KE2A 3CZ6A 3OIOA 2X1EA 4HF1A 1VQ6I 1SFXA 2RN7A 2L4AA 2QQAA 3K4KA 4WXDA 1I3AA 3G73A 3BR2A 4FQGA 4RB2C 3W3CA 4WCGA 2NS0A 3LSTA 4R8HA 2VJ4A 1R6RA 2YU3A 1ZRFA 1X3UA 2CQQA 4IQ4A 5CVUA 2W1OA 2L3DA 2BY2A 2Y0SA 2DTZA 1B8IA 2BV6A 3LWFA 2MLGA 1KA8A 4BJ5C 3OYIA 1Z77A 2Q2EA 1VFCA 3L2WA 4FASD 2KHMA 2UXXA 4JQFA 3M8FA 3PSFA 2MG4A 3VFZA 2PLYA 1D5VA 1FP2A 3E6DA 2OQRA 4DJAA 2KISA 2CFXA 4XICA 2PEXA 1W5CC 2X9DA 1QU3A 3WG9A 2HYGD 1VQ7I 3BZCA 4GYGA 3MFKA 3H35A 1MBHA 1JUMA 3DKWA 1USSA 1U78A 2RAEA 2VXDA 1CF7B 4RGUA 2PN6A 1MJAA 2H1KA 2DT5A 2XC7A 2L4MA 2EFOA 2R5ZB 1YTYA 2GAUA 3BJ6A 3MCZA 5BPDA 4RM3A 4NQWA 2RC4A 1PYVA 3WGIA 3HM5A 1A04A 1WFXA 1B72A 3OYGA 2P5LC 3AKZA 2MLKA 4U0YA 2R4GA 2XSJC 4BHPA 4Y4RA 3GZ6A 4IPAA 2LLKA 4KDPA 1ZG1A 4UXNA 5IP9J 4KA4A 3CUQC 3F3XA 1QZZA 1MMAA 2WAFA 5J3LA 4MQ9F 5D5UB 4XONA 3ZMSA 1Z6RA 2VKVA 2F4MB 3AG4H 2L2OA 3F22A 3R4KA 2QBYA 4Z2YA 4LD5A 4BY7J 3ZN1A 3WTSC 1F4KA 5IYBJ 4KICA 4CCJA 1IRXA 5M3MJ 1TT0A 2JTVA 1YO5C 2HOSA 3OWTA 3PQKA 3BDDA 2HPMA 3D5LA 3UR3C 1IV8A 4I2OA 4C3JJ 1RR8C 3MKWB 2H1LA 2QVOA 5D4SA 2HDWA 1SFEA 3W6KB 3KP6A 1WH7A 1KU2A 1O3TA 3T0YA 3MKZA 2B63J 3CF5F 1BOAA 2L7MP 4BH9A 3CUQB 3ZMUA 1U3EM 1EH8A 2IS4A 3FXKA 4ANJA 2Z9OA 3KYCB 5LRSA 2M5WA 4ZH4F 1O57A 1LEAA 3L09A 4BQAA 1S72I 3DBLB 2K86A 1B9MA 2CV2A 1LFPA 1KQ0A 1VQMI 1HCRA 3BWGA 1MD0A 3GTLJ 5CLSA 2O3FA 2RKHA 2GQQA 2X6YA 3FZVA 4EGYA 2PJRA 1WKMA 1U8BA 3AFHA 3VYTB 1MBGA 2DK8A 2O7OA 1ZG3A 3ZGKA 4BE2A 2XRLA 4ITVA 2XVCA 4I01A 5LHGA 1JGGA 5GAHJ 3TEDA 3RDIA 3HGGA 3S3MA 2XAHA 4ZYHA 5E79C 5ILUA 4A6DA 4X1EA 3MKLA 5D5WB 2KIUA 3Q9VA 4MO7A 2B0LA 4NC7A 4NBQA 3KFWX 2OZ6A 2Z2SB 2CSOA 2PMHA 4XL9A 1MSEC 2VT2A 1DPRA 4XRSA 2DT7B 2P5VA 2Y75A 3HOTA 2M1BA 2VJIA 4JX5A 2OD5A 2LNBA 3ABUA 5JFRA 2M0MA 2KP6A 1X2NA 3LSMA 3W6JB 5DV5A 5K7FA 2YSRA 5GAGJ 4IHXA 4Q5SF 1VF9A 2XKOA 2R7DA 4E7LA 2Y69H 1PJRA 3FF5A 2EB7A 3A02A 1E0EA 1FC3A 4LG0B 4U7BA 3VDXA 3BPVA 1YW7A 3GWZA 2VBXA 5B1AH 4XLPF 3RZOJ 3W2VA 3CP8A 1LE8A 3LA3A 2DPDA 3ZQHA 4ZYEA 1W7PD 1USTA 2BGCA 3S1RJ 1QVTA 2CO5A 4U7DA 1D3YA 2FQ4A 3CCVI 5IPAA 4IHTA 5J4YA 2FOWA 2JUCA 2WAQA 2F4IA 2M0CA 4D0PA 4D7MA 1T98A 4P5OA 3BG9A 3I4PA 1REPC 2ZO4A 1HOMA 1JUSA 4A93J 2CMPA 4ZTFA 1LJ9A 4C2TA 5EG0A 4EMSA 2GOMA 2W24A 1OPCA 3K1PA 3P7NA 1YJWI 5J4VA 3K0LA 1OKRA 2CS3A 1BM9A 1YOVB 4M3BA 4J19A 5FLMJ 1LPQA 6PAXA 5D4RA 4M3EA 2PJPA 4A12A 2WB1A 1RUOA 5ICEA 3QP6A 2W25A 4Q47A 5HNHA 5CYVA 4UNOA 3GTQJ 2OTJI 4Y52J 1I3QJ 3JRHA 1IN4A 1FYLA 3NQOA 1TQMA 1S3JA 2VJJA 4FISA 4G6DA 3CCJI 1ETOA 3FBIB 3ZQQA 4MQVA 4CYCB 4XLFA 2EZIA 1IJWC 1O3RA 3FIWA 5HNFA 1ETKA 3TBIA 3R60A 1M1EB 3RQIA 1EF4A 1HKQA 1HXDA 1DDNA 5BOXA 1W7PB 1MMDA 3PNYA 2P4WA 2WBMA 2QLZA 5M5XJ 1MMSA 1C0WA 4CDGA 1AWCA 2ZXIA 1H89C 2FUG2 1ZQ3P 1BBYA 1FMWA 1WJ5A 2N8GA 5J1UA 4HA8A 5K5QA 1MBFA 1AKHB 3DPTA 3OYNA 4PGGA 3H1CA 3IUOA 2Q0OA 4OAYA 3ZQFA 1XSVA 2DFIA 5EG0B 1V54H 4ZTJA 3BG6A 4ON0A 4D1QA 1SEUA 1Z9CA 4G7OF 3DPUA 1FOYA 3ZPLA 1Z6TA 4IXAA 1NK2P 4U87A 3IL2A 1FYMA 4QLCU 2A68F 3C2GA 3C1DA 2HKOA 4AIKA 3JRBA 2F6CA 5LD2C 3G3ZA 1MNDA 4FETA 4OIPF 3K70D 5DM6F 3BQZA 3JR9A 2P81A 3OL3A 5IY5H 4IEJA 3F6VA 3MVPA 2CV1A 1WCMJ 3O6BB 2MYSA 2D45A 2P6TA 3KZZA 3S2DJ 4M6VA 2OJED 3ZQIA 2F5FA 2M9HA 2ZSIB 4BEHB 2QA4I 3LQQA 4FT8A 1Z05A 2AQFA 2QGUA 3KP3A 3TGNA 1UHSA 4C9YA 4WF2A 3DEUA 4QTRA 3J81Z 2FMYA 5HLTA 5HLGA 3HRUA 1FBSA 2XUBA 3MMYB 2NNYA 4M6XA 1VQ8I 3DV8A 5M5WJ 5F0HA 5FO5A 3E5UA 3SXYA 2AQEA 2JWTA 3JTHA 1IO2A 3I56I 3HJEA 1G8XA 2KRCA 3HG9A 1SFUA 4HZFA 1KU7A 4XLCA 2O03A 4C3IJ 3ESWB 3H5AA 3M8EA 2X6OA 4HX8A 4QSHA 2DA1A 4HDUA 2TRTA 1TW3A 3I9V2 2V9KA 1ZGAA 4CCMA 3M7GA 3KLOA 1H88C 2FE3A 4IHYA 4UV8A 2K4JA 3H0GJ 3ZOBA 2ZMEA 3KYDB 5L3CA 3RKQA 2EJRA 4OU0A 1X2MA 4WXCA 2QF7A 1XDSA 4PFOA 1XGSA 2XASA 5H2FC 2STWA 2DBBA 3DTIA 3KLNA 4M6YA 1SMYF 3G1MA 3L2RA 2E71A 5CJ9A 4HQMA 3A01B 2WWYA 1SMTA 3G2BA 1PUFA 3CCYA 1GLNA 2W7NA 2IGOA 3K7AJ 3T1BA 2VBZA 1D8KA 3AL0B 3GXOA 1PUEE 3S14J 5B66C 2KZVA 1YIOA 3J80K 2E34A 4KMFA 1XX5A 4E7ZA 5E20A 1MDMA 4XQFA 2M87A 2W00A 1FBUA 3OR2C 2G7HA 1VZ0A 3BJAA 4H4KC 4LB6B 2HKXA 4AC0A 4XOPA 1F43A 3HOVJ 2M7AA 1QQIA 1S7OA 1SD7A 1F1ZA 2CUFA 3V7SA 3CO7C 1R4NB 3A03A 2DJIA 4DYCA 3RYPA 1KZHA 1G2HA 2K9SA 3B02A 3DBRB 4HLXA 1O4XA 4M3FA 1TZLA 3TP0A 1IAWA 5J8CA 3IC7A 4NQWB 3OYBA 4I02A 3W2WA 1V5FA 5CVVA 4AWXB 2LKXA 3LSIA 3K4LA 3RSNA 4M9ZA 2CH0A 1DP7P 2OPTA 4B1RA 1WJBA 2DMUA 5J47A 4A2UA 1FLIA 4RB0A 3OR1C 4B43A 2WADA 4JX4A 4A0XA 4DBRA 3T8TA 4G9YA 2GIVA 5KAFC 1AU7A 2UXNA 1GVJA 2VLAA 1TQPA 1H0MA 3QPSA 5ILSA 3FBNB 1HA8A 2GOXB 4AUXA 4UVAA 1YFHA 4D7NA 1POGA 2CUZA 3KZIC 1YX3A 1BR4A 4A3LJ 5K5OA 3CJTB 3K6GA 4B48A 3S93A 2VE9A 4S04A 2ZFWA 3ZR8X 3J7AY 3CO6C 3BR6A 2NAZA 1P7IA 1R7JA 4XMYA 3O3KA 2Z99A 1T0FC 3EPZA 1P9QC 2DOAA 4LITA 2CQKA 3J81K 4G6TB 1W36D 1Y1VJ 2VASA 2DYRH 2F4OB 2L02A 1MNMC 1SVOA 2XF5A 3H92A 4CCLA 4EJOA 2X4HA 4A3IJ 4LOCA 2LFBA 4DQ2A 4OAZA 4XKWA 3PO2J 2H6CA 1OCTC 3CDIA 2BHYA 3TW7A 3IKTA 3OYCA 1U8RA 2R7UA 1DPUA 2JA6J 1XD7A 3ABTA 4E7IA 3IH4A 1FOWA 4ESFA 3P9CA 4BXUA 2UZKA 4G6QA 2IXSA 1JT0A 5KNLA 3O8HA 1V5EA 3G1LA 3CTAA 4DGWB 1T8IA 3GUDA 2COMA 3AG1H 4NNJA 4YEJA 4C30A 3WTTC 4B3XA 2JT1A 4XKCA 1RPWA 2ESHA 2VQHA 4PSWA 2H27A 3QWLA 1ACIA 1K78B 3PUBA 3GTKJ 3OMYA 1T95A 4RAZA 1ON1A 3BR1A 2NRAC 2L0KA 2AXTC 3NAUA 2DDAA 3JCUC 2QZ8A 3K4NA 4YFKF 3WTUC 3OY9A 1X19A 5BNGA 5M5YJ 3EETA 2NYXA 1H9GA 4EATA 3CJNA 4UB8C 1JE8A 3CJRB 1X4PA 1HBXG 1UG2A 4XRFA 2DMTA 5E1XA 4CZZA 4XBFA 3GTJJ 2ZJPF 1I1GA 4ZDOA 2G7UA 1RRJA 2ETHA 3FXUA 4KT5C 2DQRA 4ABZA 3B6CA 4KN4X 2HZTA 2IRFG 5FB2A 3FXOA 2NVUB 2WAQN 3K2AA 1G4DA 3ZXSA 1MBJA 4L9NA 4E7SA 1X1DA 2GXBA 1U5TC 2YPRA 1I6XA 1XGOA 5DEQA 3VSLA 2ZKZA 3KEQA 4AVPA 4QPQA 1BI2A 3U9GA 3VB2A 4FX4A 3C7JA 2LF8A 2FBKA 3EYYA 4IRGA 1YITI 3I4MJ 2KKOA 3BP8A 4UVBA 2DI3A 3GLXA 1LVAA 5J1YA 1L0OC 5HODA 3GTGJ 3SYTA 4EM0B 4XLNF 4ENMA 3ZQCA 3N97A 2IT0A 1GV2A 2EIKH 1GV5A 5IT3A 2ZMEB 4BNCA 1JJ8C 2QWWA 3SEQA 1IDYA 1N78A 3E6CC 2WA0A 2X1CA 2ECBA 1LKXA 4A6EA 3KP5A 2XROA 1NG7A 1TTYA 3F72A 1V5GA 1S6LA 4D9JA 4KUMA 1B1BA 2EZLA 5CVRA 3WTVC 1F5TA 2O61A 4NB5A 1LEBA 1SFOJ 2LBFB 5JR3A 3AG3H 2XAGA 2PMZA 2DW4A 1X1PA 2XPWA 2R7XA 3UKGA 5HDNA 3M3YJ 1Y6IA 1OFCX 4L18B 2M45A 4RB3C 1OJLA 2Y9YA 2J5PA 1ODDA 2JVGA 3LSGA 2XAUA 4A3DJ 1ZLJA 2P7CB 3X2QH 1BC7C 1RZ4A 3MZYA 4XSXF 2EBIA 3GFLA 2CW7A 2HQ5A 2ISYA 4Q48A 1R5GA 3GW2A 1X4OA 1U9OA 3SFZA 3QYEA 1Y8RB 2KJCA 2L7FP 2JRTA 4B47A 3TO9A 2GWRA 4BHBA 3CCSI 1R4MB 4BU2A 4A3KJ 3FKIJ 2YUSA 1D1BA 1X1AA 1FSEA 1Z1DA 1HKTA 3K9TA 3L9FA 2RREA 4P1WA 1MMGA 5F6FA 2CWEA 4XN0A 2OAZA 1BJZA 2CU7A 1BI3A 2DA4A 5EJCA 4D5FA 2GM4A 1MGTA 1XSDA 3DEWA 3ZMVA 2E2HJ 2IBDA 4HDVA 2MBFA 4RA2A 3HHHA 1OQYA 2LBFA 2O5RA 2W85A 3K69A 3CCEI 3OIPA 4F93B 4UUSB 1B59A 2BY0A 4CSWA 1HSJA 5AIQA 4DIQA 4HF2A 2VBYA 3M1CA 4PJJA 1BC8C 1R23A 3U1KA 2O8KA 3I59B 3LSHA 3PSIA 2HEOA 2HS5A 4U88A 2VOOA 4PJLA 1MKMA 4S0HB 3ZQLA 1GT0C 3CUOA 5DCMA 4BY1J 2BEOA 3H3UA 2DLLA 4YRVA 1RC9A 3TOBA 4M9SA 3FXMA 4OIRF 1J9IA 2COBA 2X6WA 5JHFA 1NK3P 1ZHFA 2ME6A 3FK6A 4OOIA 1FNNA 4R79A 3N05A 2PI0A 1BL0A 2LYCA 2OF7A 3MN2A 3L2UA 2DOEA 3RPUD 3D5RC 1MBEA 4EJWA 1D8JA 3S16J 3QU3A 4A69C 1SC7A 1OYWA 5E17F 2XV4S 1P7JA 5BPIA 1FWZA 3OYJA 3RI4A 2LKSA 4JX6A 3ZMZA 1MH4A 5DUKA 4BDYA 2KQRA 4UB6C 1OR7A 2K27A 3ERED 5LRRA 2EA4A 4YIIA 2XGDA 5EDNA 5L3EA 3OIQA 2EPFA 4ZJZA 1RESA 3ISPA 3DCFA 1Q1VA 5GP9A 2OQGA 4AD9A 3RIRA 2VN2A 4HRIA 4CYDA 1QBJA 3W6VA 1GXQA 3L00A 1R71A 4KITB 3K2ZA 1ZR2A 2X51A 4AM3A 2MGQA 2WAEA 2ZXJA 3CJQB 2WV0A 4YIRX 1Z3XA 3QPHA 5BQTA 4HNTA 2VODA 1ETXA 2JJ7A 2JRMA 3D5SC 1R5HA 1VQKI 2Y0SN 2PQ8A 1UELB 4BXFA 3OYHA 1S7EA 4LIVA 3I4NJ 1Y0UA 3BOQA 2IPQX 3HSRA 1FX7A 4WK8F 2NXNB 1TT5B 5JHUA 3EUAA 4M3DA 4JBAA 3HOSA 3EUHA 4ENNA 4HYEA 2A07F 3H3ZA 4M71A 5F27A 1ZGJA 2D5VA 3KX2A 1P4WA 1ZK8A 3RKWA 1ZKGA 1W7PA 1R5ID 3A1YA 3P9KA 1ZLKA 3ZMDA 3ZQ7A 1FPQA 3ML6A 3CC4I 2XAJA 4D5CA 1FIAA 1YW9A 4OINF 1LDDA 1VQ9I 2BZTA 3I3LA 3ULQB 4I09A 2Y30A 1TLHB 2GA2A 3OSFA 2DA6A 2KFDA 3HPGA 2RGVA 4DZJA 5E3NA 2KZGA 1EA3A 4FTHA 2E5NA 5JVGF 1LFBA 1IN5A 3FM5A 3HZJA 2Y2ZA 5F1RA 3VSKA 3OYFA 1VNDA 4XNFA 5F0CA 3BTLA 2DMNA 2ZFUA 2VPLA 5IOYA 4MGRA 4ZYDA 3DKYA 2ACJA 2FBHA 2O6GE 1O3QA 3G1OA 3PFYA 1R00A 2WC2A 5DTDA 1XG1A 3RTRA 4GGGA 2KDZA 3QAHA 2EV6A 2L9RA 1IXCA 1BA5A 5CKTA 1YJ9I 4GYIA 2Z5UA 3TO7A 5ERIA 2ZXHA 2XKPA 1KGSA 2HI3A 3R0JA 2R7VA 5H6RA 1EV7A 4UVCA 3F6OA 2ISZA 1SVLA 3TDZC 2IS6A 1CQTA 5J8FA 4N4NB 2HXOA 4EM2A 2F5CA 1JT6A 4KYWA 2ZB9A 2L01A 1GXPA 3VYRB 3I54A 2LREA 2D2WA 1G6NA 5F04A 3J7AO 2OCCH 1SAXA 2HQNA 4L5IA 5DCFA 3V8JA 1B4AA 1S7AA 1DGWY 4M73A 3WTYC 2OV7A 1LFUP 2QSFX 3H36A 4BACA 1J59A 1T38A 4YIFA 2ZNYA 3OV8A 4P55A 2Q2EB 3JW4A 3KYLA 3DXJF 2M2EA 2F5DA 2OC6A 1R58A 2XAQA 5F64A 1YQAA 1MSFC 1W5TA 3WODF 1OCCH 2FF4A 2IP2A 2E36A 2Y0MA 2HWVA 1Z91A 2MH9A 2L7ZA 2BE5F 2HFHA 3KP2A 2Y48A 1ORKA 3TQNA 5KCMA 1QPIA 1ENHA 4HG2A 2XGEA 1X58A 3DF8A 4ENJA 1B6AA 4MHGA 3GBGA 3U2RA 3UNGC 3LAJA 3CMAI 2LRDA 1P4AA 2R7TA 2Y9ZA 5ICGA 2R7WA 3DBHB 4CICA 1J0RA 3GTMJ 3GO5A 3FWEA 4CO8A 4RMNA 3HSFA 2CQXA 5E18F 1K4TA 4Y7NJ 3WTZA 3HXLA 4IHSA 2RDPA 4C2UA 4IKFA 3TOAA 1ITYA 2BY1A 4I0BA 2E60A 1TC3C 4GCVA 2VI6A 1XMAA 5EZHA 4NDLA 5E3OA 3ECHA 5C3EJ 1RKWA 4EQQA 4IRHA 1T2KA 2K3PA 4HEA2 1RKTA 2JPCA 1XGNA 1J2XA 1D1AA 4Y3OA 3Q0WA 2Z16A 4LLNA 5C4XJ 3SJMA 1W0TA 3WG7H 2DFEA 4HNUA 3FMQA 4M3GA 4LG3A 3PJRA 4Y13A 5ICFA 4UY8I 1Y8QB 1BW5A 2FOKA 2YR2A 1DUXC 2EV0A 5CQEA 4ZC3A 4A3BJ 3WGGA 3M8JA 5B5EC 5HLHA 1LNWA 2LKPA 2XIGA 2CGPA 2QUFA 1F36A 3CP2A 1I1SA 1U2WA 1I5ZA 5FLVA 2JSPA 4MNUA 2RVCA 4ESBA 2EV5A 2W82A 3GF2A 4G94A 3OSGA 4XK4A 1LUJB 1IDZA 2M8GX 3TMOA 2V4JC 3VPRA 4KIGA 2IGNA 4Z6YA 2CQNA 3M1EA 3PM1A 4OWRB 3WGHA 4MEXF 2EZHA 3BR5A 2KL4A 3PL8A 3GX4X 1ZH5A 2AXLA 4HW0A 1OISA 3HUGB 4O6JA 1UCRA 2BBYA 4ZZDA 2WY7Q 3A0BC 5GPAA 2H8WA 3OS2A 2EK5A 5EZGA 4ENKA 1TBXA 2E1MB 3I71A 4PFPA 2DA5A 1K7AA 2NVQJ 2ID6A 2EFWA 4IOCF 1APLC 3PO3J 3W2AA 3K4CA 4RAGA 4RM2A 3OYMA 2VPRA 1P4XA 5HOOA 1JKOC 5ED4A 4L5JA 5FGMA 4E70A 2UWMA 2DFHA 3SDBA 1IRFA 3LNQA 1ZREA 2XGXA 3FKJA 4A0ZA 1DP3A 1SD4A 2CUJA 1A5JA 2MSYA 5C4JJ 2PFBA 3S1MJ 3KP7A 1GVDA 3BLYA 1XC5A 5FRMA 4BBSJ 3J7YJ 4AIJA 4KISA 3NWSA 1QHGA 2CG4A 2DFFA 2LY1A 2FX0A 2KRHA 5IT9K 3FXRA 4U0WA 5B1BH 4BJTA 4RDUA 1SANA 2OU2A 2BXZA 4PK4A 5E8IA 3V7RA 2CQ7A 1GUUA 4J00A 4A0YA 2FQ3A 2E2IJ 4XN3A 5BS6A 4F92B 2W4SA 2E1OA 5M3FJ 1R1VA 4LK1F 2LY9A 1I39A 3JRFA 1QA6A 3IRRA 3F8MA 3A4CA 1I27A 1FSHA 3IWFA 4E6KG 3JREA 1E3OC 3WHBA 3BROA 3IP4B 2JA7J 5JLWA 1BI0A 2NVYJ 1WI3A 2A5YB 2HPIA 3DU5A 2O8XA 1JKRC 3EYIA 5LLQA 3ZMTA 3KETA 2PX9A 2P0WA 1LB2A 4QPOA 1FTTA 3KPHA 5DCMB 5KHDA 3I53A 4IO9F 4A3JJ 1DQUA 3OOUA 3V8LA 4Q4ZF 2EZKA 4CXFA 2BW3A 3OYAA 1R36A 3CLOA 3E7LA 5E3MA 1PP7U 2X6XA 2LH9A 2DK5A 3BY6A 2R93J 3CC7I 2YX7A 4TV7A 1V3FA 2FNAA 2ZNZA 4XM3A 2HYFA 3BG5A 3P5JA 3MAJA 5HS8A 3RPUA 3ZRGA 2KIFA 2KLOA 3OL4A 5DDGA 3S32A 4QIWN 4R1HA 1PDNC 1AHDP 1A31A 4IL6C 3ERMA 3HRMA 2YS9A 3I0TA 3AG2H 3V8KA 4FE7A 5LEJA 4XSZF 4BDZA 2NS8A 3L7WA 3OOPA 1MIJA 2JSCA 2MH2A 2M4KA 1FBQA 1JHHA 1K61A 2QSGX 2LD5A 4KFCA 4GFBA 3V7CA 4N0BA 2LF7A 2MC3A 3RCOA 3RYRA 3MEXA 3D0SA 5GTIC 1BI1A 1EH7A 4IZZA 2AHQA 5L3BA 5TRDA 1LVKA 2GA1A 1Z7LA 1YYVA 4HOBA 2R5YA 2RQPA 3F9KA 4F3QA 2VOPA 2DOFA 5IOZA 1WVRA 4P9UA 1HDDC 1XB4A 1Y1WJ 1HF0A 3LA2A 4ZYGA 1KQ8A 2DMPA 2V1NA 1F9NA 3T8RA 4IHVA 1S9HA 2EQRA 2LG4A 2NNNA 1B8IB 2ZMEC 3DPLC 3WE2A 2E1CA 4PCQA 5L3GA 1YRNB 2ZCWA 4LGWA 1O7FA 3VOEA 1TP4A 4YFNF 5GPCA 2IW5A 3OYKA 3K10A 2HQAA 3E6BA 3GZ5A 2PG4A 4XLEA 3CDHA 4HSTA 2NOGA 4LLGF 4XLAA 1ON2A 4EJUA 2CFOA 1U0JA 3CD6I 4BEHA 2IS1A 1IV6A 1HW2A 3K1NA 1IN8A 1QHHD 3WHCA 4J01A 3MD2A 3ASOH 1HW1A 3L1PA 4EJTA 4A3GJ 3Q5FA 2L5QA 4HV5A 4A3CJ 2HVSA 3ONQA 4ZYAA 2XPVA 3ROUA 1ZRCA 2JN6A 1NH3A 2HVRA 3TW6A 1XCVA 2BVMA 3IH3A 4KMUX 4PUSA 1LQ1A 1XCBA 2LMDA 1S8NA 3F23A 1VTNC 1P6RA 2F5EA 4U0VA 2LR8A 3HRTA 4V19K 4ASNA 2L7KA 3TDUC 1IW7F 1FYKA 3FXQA 3CESA 3IV5A 2FXAA 1WJEA 4O3MA 5HVQC 3WE3A 2HYJA 5J6XA 3VYSB 2XF7A 4RGRA 2K85A 2M8EA 3CMMA 1AKHA 3HL2A 2E1NA 2HDDA 3QYBA 2R7RA 2HOAA 4A5MA 5AIPA 1EKEA 5FFZA 5H20A 4A3EJ 1JTYA 5TGTA 3G71I 3BZ6A 1W36C 2OCEA 2VKDA 3HTUA 4MTEA 4YG2F 1WRJA 3JRDA 3C2HA 4E7KA 3F0CA 4YELA 2I5UA 1YS6A 5HLIA 3SFIA 2HDCA 1GDTA 3IWZA 1X3ZB 2LOOA 2K40A 2D1HA 1JGSA 2OA4A 3QU6A 4A5NA 4A3MJ 2OTLI 4M9XA 1FY7A 1UG0A 1T56A 5IYCJ 2F48A 5F1JA 2ESNA 1HW5A 4YFXF 3PFIA 5E1ZB 1UHMA 5LEKA 1U6GA 5EF6A 1J75A 1BJAA 1BIAA 3L2VA 1YI2I 4LJZF 3H5NA 4BQQA 4OIQF 2R7SA 5HS9A 1J09A 1QGPA 1YS7A 1U9NA 1ZYRF 3B6AA 2XPUA 1R49A 4IHWA 4AYBA 3HGYA 3F8BA 4IX7A 2FBIA 2ZBKA 2K5CA 1XGMA 3CCQI 2VONA 1LDKB 2XF6A 3S15J 3F8CA 1R22A 1XN7A 4E7HA 1WGXA 3QRFF 1YIJI 5ILVA 3SZGA 2QENA 5KK1A 1TNSA 3ABKH 3LSPA 5LFAA
chains in the Genus database with same CATH topology
4LK0F 1G3WA 5JI6A 4ETSA 3GVAA 3WU1B 4RB1A 2V1XA 5LBQA 4P96A 4BHCA 2XAFA 4I7HA 1EH6A 2H09A 2FRHA 2P8TA 2K7LA 2MA3A 5E1WA 1Q1HA 2FU4A 4L9JA 2EFQA 3F8FA 2QBYB 1K6OA 3NEUA 4LMYA 1G3TA 1T39A 2ZJ2A 2OZUA 1K78A 1ZN2A 3LQRA 3V4GA 3ZN0A 4GO1A 3FMSA 3HYIA 3JAMK 1RNLA 2QQ9A 3MQ0A 5EEHA 3B73A 1G3SA 1W4MA 3PQJA 5CVIA 5KVRA 1UHWA 3N4MA 2KRFA 3E5QA 2DO7A 2DQLA 2TDXA 1QO0D 3EDPA 1XSXA 4LB5A 2JZYA 3DFGA 4RS8A 4H0EA 2EWNA 3TO6A 1LDJA 1FZPB 2OBPA 2QYOA 2HGCA 4EV0A 3QOPA 5H6QA 1TNTA 5K1YA 3HUGA 2E7WA 4AIHA 4WWCA 4RGXA 5DYMA 4HF0A 2A69F 2QM3A 4L0YB 2IA0A 3F8NA 1IXSB 3ECOA 1TQIA 5D6FA 1MJ9A 3GFMA 3R0AA 1KYZA 3BPXA 3JAMZ 2GZWA 4L9TA 4N9HA 4DNCA 3VODA 1IUYA 3JTGA 4NHJA 2HR3A 2X0LA 4KN7X 3NRVA 1YW8A 2K02A 1XDUA 2L54A 2VC0A 1MJBA 1J5YA 3LA7A 1E2XA 2VBWA 3K1MA 1IN6A 4ESJA 1BN5A 3E3VA 3HHGA 3GFIA 4WXHA 4I98B 4G7ZF 1CF7A 1YG2A 4HX4A 5TJJA 3SZPA 2FMLA 4HBLA 4F7ZA 3J80Z 4HLYA 2P6SA 1H9TA 4MEYF 2LSOA 2QQBA 2H94A 1NHAA 2PMUA 3LFKA 2HTJA 3QP5A 1OYYA 1STZA 3T5XA 2E7XA 4PGHA 3HIFA 2IA1A 5E8GA 2VXZA 3GFJA 2V79A 3BJOA 3TKYA 1RI7A 1R1UA 4FX0A 4KNYA 4UV9A 5LGUA 5BMZA 3RJPA 1BIBA 3FM3A 3HTSB 1MDMB 4S05A 2EFNA 5AONA 1P92A 1CGPA 3I59A 5HS7A 1JXSA 3F21A 5K5RA 4EM1A 3SHFA 4UUVA 1ZAOA 3SZTA 1ZRDA 2RNJA 3DQVC 3IHUA 1S29A 1HQCA 3O2PE 2VE8A 2DAOA 1WQ2A 1FOKA 4HQEA 2AS5F 4B09A 3RKXA 5FD6A 1B9NA 2V9VA 2V1DA 1SD6A 4IJAA 2C6YA 1HSTA 3AAFA 4L9VA 4FHTA 1GHCA 5D6EA 2FA5A 1UFMA 1P2FA 2J5OA 3ZP5A 4PDKA 1IF1A 1ONVA 4UHTA 3WTWC 4MTDA 1HKSA 2XRNA 1L3LA 1RIOH 5A2QZ 3EQLF 5D5VB 2K4BA 2V1UA 5L3FA 1WI9A 3C18A 1QNTA 2FSWA 2W57A 3M9AA 1IN7A 3JSOA 2YX4A 2A6EF 1K79A 3MZHA 3I58A 4WX9A 3SQNA 3R6SA 2R3SA 2HQRA 1WWXA 1KYWA 1RUNA 2EFPA 4GXOA 3L2CA 2Q8KA 2IJLA 3GYHX 5FLXZ 1MZBA 2HTSA 2JPBA 1G3YA 3DP7A 1T6SA 4BYYA 4HAMA 3KCCA 2BYVE 5HDGA 3Q9SA 3VEPA 3I5UA 1KQ9A 2M30A 4B8XA 1O7LA 2LDUA 4EJVA 2G9WA 4LFUA 4ZZLA 4PZJA 1TW2A 3FHZA 2EA2A 4OMZA 1J7KA 1O3SA 3JSPA 1U5TB 4RAYA 4HV6A 2MD5A 2F2EA 5D8KB 3REOA 5IT9Z 5LHHA 1FP1D 3C3WA 4BAYA 5LGNA 3HSEA 3E5XA 2KIMA 1R1TA 3U1DA 4IF4A 5LGTA 4CHUA 5D8LB 4QWQA 1IRGA 1ULYA 1U5TA 2FEZA 2W84A 4I0AA 1WSUA 2IA2A 3FX3A 2V6CA 1SD5A 2CYYA 1QPMA 1YLFA 2Z3YA 4KIBA 1JHFA 4Y15A 4EVIA 5ICCA 5LHIA 4IVNA 2STTA 1XMKA 3LAPA 2R7FA 2WTEA 2CW0F 4O5VA 2HOEA 3HRSA 2O0YA 2A3SA 2RV8A 2VT3A 3WTXC 3KP4A 2XHKA 3KZYA 1V4RA 5HDKA 5EEGA 1KU9A 2P5KA 3KEOA 2DTRA 4OIOF 1AOYA 3CUQA 3ELKA 1KU3A 3MWMA 4JK1X 4N9IA 5D5XB 2A61A 5DD4A 1IZ1A 5FLXK 2D1VA 3RPQA 4HX7A 3FMRA 1E17A 2DPUA 1IXRC 2IVMA 2VC1A 5CVJA 1ZG5A 2DU9A 2H6BA 1T0FA 3I64A 3COAC 4OMYA 2FNPA 4RGSA 4G8XA 2Z33A 5FFXA 3GEZA 4KIFA 1OYIA 3R61A 5JVTA 3S2WA 2KJBA 4LG0A 4LLLA 4G7HF 5FD5A 2P7VB 5DUIA 2ADUA 4Y17A 1QZYA 2A6HF 4L0ZB 3IKVA 4M72A 1FT9A 3WU0A 5A2QK 4M74A 2ELHA 4P9FA 1ZARA 4IRIA 1UB9A 3P9IA 1PP8F 1W5SA 3E6MA 3QPTA 3RKYA 5DD8A 1Z7UA 4EGZA 3IRQA 4CGZA 3E97A 5L3DA 1OMIA 2GXGA 2PBIA 4K2EA 3KE2A 4HF1A 1SFXA 2RN7A 2L4AA 2QQAA 4WXDA 3G73A 4RB2C 4WCGA 2NS0A 3LSTA 4R8HA 2YU3A 1ZRFA 1X3UA 5CVUA 2L3DA 2BV6A 3LWFA 2MLGA 1KA8A 2Q2EA 2UXXA 4JQFA 3M8FA 3VFZA 2PLYA 1D5VA 1FP2A 3E6DA 2OQRA 2CFXA 2PEXA 3WG9A 2HYGD 4GYGA 3MFKA 3DKWA 1USSA 1U78A 1CF7B 4RGUA 2PN6A 1MJAA 2DT5A 2L4MA 2EFOA 1YTYA 2GAUA 3BJ6A 3MCZA 5BPDA 4NQWA 2RC4A 3WGIA 1A04A 2P5LC 2MLKA 4U0YA 4BHPA 3GZ6A 4IPAA 4KDPA 1ZG1A 4UXNA 4KA4A 3CUQC 3F3XA 1QZZA 5D5UB 4MQ9F 3ZMSA 1Z6RA 3F22A 3R4KA 2QBYA 4Z2YA 4LD5A 3ZN1A 3WTSC 1F4KA 4KICA 2JTVA 1YO5C 3PQKA 3BDDA 3D5LA 4I2OA 2QVOA 5D4SA 1SFEA 3W6KB 3KP6A 1KU2A 1O3TA 3T0YA 1BOAA 4BH9A 3CUQB 1U3EM 3ZMUA 1EH8A 2Z9OA 5LRSA 2M5WA 4ZH4F 1O57A 1LEAA 3L09A 4BQAA 2K86A 1B9MA 1KQ0A 3BWGA 1MD0A 5CLSA 2O3FA 2RKHA 2GQQA 3FZVA 4EGYA 1WKMA 2DK8A 1ZG3A 2XVCA 4I01A 5LHGA 3RDIA 2XAHA 4ZYHA 5ILUA 4A6DA 5D5WB 2KIUA 3Q9VA 2B0LA 3KFWX 2OZ6A 2CSOA 2PMHA 2VT2A 1DPRA 2P5VA 2Y75A 3HOTA 2M1BA 2OD5A 2LNBA 3ABUA 5JFRA 3W6JB 5DV5A 2YSRA 4Q5SF 2XKOA 2R7DA 3FF5A 2EB7A 1FC3A 4LG0B 4U7BA 3BPVA 1YW7A 3GWZA 2VBXA 4XLPF 3LA3A 2DPDA 4ZYEA 1W7PD 1USTA 2BGCA 2CO5A 4U7DA 1D3YA 4IHTA 4D0PA 1T98A 4P5OA 3I4PA 1REPC 2ZO4A 1LJ9A 4EMSA 2W24A 1OPCA 3K1PA 3P7NA 3K0LA 1OKRA 1BM9A 6PAXA 5D4RA 2PJPA 4A12A 1RUOA 5ICEA 3QP6A 2W25A 4Q47A 4UNOA 5CYVA 1IN4A 1FYLA 3NQOA 1TQMA 1S3JA 4G6DA 4MQVA 1O3RA 3R60A 1HKQA 1HXDA 1DDNA 5BOXA 1W7PB 2P4WA 2QLZA 1C0WA 4CDGA 1AWCA 1BBYA 5K5QA 4HA8A 3DPTA 4PGGA 2Q0OA 1XSVA 2DFIA 4ON0A 1Z9CA 4G7OF 3ZPLA 1Z6TA 4IXAA 3IL2A 1FYMA 4QLCU 2A68F 3C1DA 2HKOA 4AIKA 3G3ZA 4OIPF 3F6VA 2D45A 3O6BB 2P6TA 3KZZA 2F5FA 3LQQA 4FT8A 1Z05A 3KP3A 3TGNA 4WF2A 3DEUA 3J81Z 2FMYA 5HLGA 3HRUA 1FBSA 2XUBA 2NNYA 4M6XA 3DV8A 5FO5A 3E5UA 3SXYA 3JTHA 1SFUA 4HZFA 1KU7A 2O03A 3M8EA 4HX8A 4HDUA 1TW3A 1ZGAA 3M7GA 3KLOA 2FE3A 4UV8A 2K4JA 2ZMEA 5L3CA 2EJRA 4OU0A 4WXCA 1XDSA 1XGSA 2XASA 2STWA 2DBBA 3KLNA 4M6YA 1SMYF 5CJ9A 4HQMA 2WWYA 1SMTA 3T1BA 2VBZA 1D8KA 3GXOA 1PUEE 1YIOA 3J80K 4KMFA 5E20A 1MDMA 2M87A 1FBUA 2G7HA 4LB6B 3BJAA 2HKXA 1QQIA 1S7OA 1SD7A 1F1ZA 3V7SA 3CO7C 3RYPA 3B02A 4HLXA 1IAWA 5J8CA 3IC7A 4I02A 5CVVA 4AWXB 4M9ZA 1DP7P 4A2UA 1FLIA 4RB0A 4A0XA 3T8TA 4G9YA 2GIVA 2UXNA 1GVJA 1TQPA 1H0MA 5ILSA 1YFHA 4UVAA 5K5OA 2VE9A 4S04A 2ZFWA 3CO6C 2NAZA 1R7JA 3O3KA 2Z99A 2CQKA 3J81K 2L02A 3H92A 4EJOA 2X4HA 4DQ2A 2H6CA 3IKTA 1U8RA 1DPUA 1XD7A 3ABTA 4ESFA 3P9CA 4BXUA 2UZKA 4G6QA 3CTAA 3GUDA 2COMA 3WTTC 2JT1A 2ESHA 2H27A 1K78B 4RAZA 1ON1A 2NRAC 2QZ8A 4YFKF 3WTUC 2NYXA 3EETA 1H9GA 3CJNA 1JE8A 1HBXG 4XRFA 5E1XA 4CZZA 4XBFA 1I1GA 2G7UA 2ETHA 3FXUA 4KT5C 2DQRA 4KN4X 2HZTA 2IRFG 5FB2A 1G4DA 4L9NA 2GXBA 1U5TC 2YPRA 1I6XA 1XGOA 5DEQA 2ZKZA 3KEQA 4AVPA 1BI2A 3U9GA 3VB2A 4FX4A 3C7JA 2LF8A 2FBKA 3EYYA 4IRGA 2KKOA 3BP8A 4UVBA 2DI3A 3GLXA 1LVAA 1L0OC 4EM0B 4ENMA 4XLNF 3N97A 2IT0A 5IT3A 2ZMEB 4BNCA 2QWWA 3E6CC 4A6EA 3KP5A 2XROA 1TTYA 3F72A 1S6LA 4KUMA 1B1BA 5CVRA 3WTVC 1F5TA 2O61A 4NB5A 1LEBA 5JR3A 2XAGA 2DW4A 5HDNA 4L18B 2M45A 4RB3C 2J5PA 1ODDA 1ZLJA 2P7CB 1BC7C 1RZ4A 3MZYA 4XSXF 3GFLA 2ISYA 4Q48A 1R5GA 3GW2A 3SFZA 2KJCA 2JRTA 3TO9A 2GWRA 4BHBA 1FSEA 1Z1DA 1HKTA 3K9TA 3L9FA 5F6FA 2CWEA 2OAZA 1BI3A 1MGTA 1XSDA 3ZMVA 4HDVA 2MBFA 3HHHA 2W85A 3K69A 1B59A 1HSJA 5AIQA 4HF2A 2VBYA 1BC8C 1R23A 3I59B 2HEOA 2HS5A 4U88A 2VOOA 1MKMA 3CUOA 5DCMA 2BEOA 3H3UA 2DLLA 3TOBA 4M9SA 4OIRF 1J9IA 1ZHFA 2PI0A 4OOIA 1FNNA 4R79A 4EJWA 1D8JA 3QU3A 1OYWA 5E17F 2XV4S 5BPIA 1FWZA 3RI4A 3ZMZA 5DUKA 1OR7A 2K27A 3ERED 5LRRA 2EA4A 4YIIA 5L3EA 3ISPA 2OQGA 4AD9A 3RIRA 2VN2A 4CYDA 1QBJA 1GXQA 3L00A 3K2ZA 2ZXJA 2WV0A 3QPHA 5BQTA 2VODA 1R5HA 2PQ8A 1Y0UA 3BOQA 2IPQX 3HSRA 1FX7A 4WK8F 5JHUA 4JBAA 3HOSA 3EUHA 4ENNA 4HYEA 2A07F 3H3ZA 4M71A 1ZGJA 1P4WA 3RKWA 1ZLKA 3P9KA 1W7PA 3ZMDA 3ZQ7A 1FPQA 3ML6A 2XAJA 1YW9A 4OINF 1LDDA 3ULQB 4I09A 1TLHB 2GA2A 2RGVA 1IN5A 3FM5A 5F1RA 4MGRA 4ZYDA 2ACJA 2FBHA 2O6GE 1O3QA 1R00A 2WC2A 3RTRA 4GGGA 3QAHA 2EV6A 1IXCA 4GYIA 2Z5UA 3TO7A 5ERIA 2XKPA 1KGSA 3R0JA 5H6RA 1EV7A 4UVCA 3F6OA 2ISZA 3TDZC 5J8FA 4EM2A 2F5CA 4KYWA 2L01A 1GXPA 3I54A 2D2WA 1G6NA 3J7AO 1SAXA 2HQNA 4L5IA 5DCFA 3V8JA 1B4AA 1S7AA 4M73A 3WTYC 1J59A 1T38A 4YIFA 2ZNYA 3OV8A 4P55A 3JW4A 3DXJF 2F5DA 1R58A 2XAQA 5F64A 1YQAA 1W5TA 3WODF 2FF4A 2IP2A 2Y0MA 2HWVA 1Z91A 2MH9A 2BE5F 2HFHA 3KP2A 2Y48A 3TQNA 3DF8A 4ENJA 1B6AA 4MHGA 3U2RA 3LAJA 1P4AA 5ICGA 4CICA 1J0RA 3GO5A 3FWEA 4CO8A 3HSFA 5E18F 3WTZA 4IHSA 2RDPA 3TOAA 4I0BA 4GCVA 1XMAA 3ECHA 4EQQA 4IRHA 1T2KA 2JPCA 1XGNA 1J2XA 4LLNA 3FMQA 4Y13A 5ICFA 2FOKA 2YR2A 1DUXC 2EV0A 3WGGA 5HLHA 1LNWA 2LKPA 2XIGA 2CGPA 2QUFA 1I1SA 1U2WA 1I5ZA 4MNUA 2RVCA 4ESBA 2EV5A 4G94A 3GF2A 4KIGA 3M1EA 3WGHA 4MEXF 3GX4X 1ZH5A 2AXLA 4HW0A 4O6JA 1UCRA 2BBYA 4ZZDA 2EK5A 4ENKA 1TBXA 3I71A 1K7AA 2EFWA 1P4XA 5HOOA 5ED4A 4L5JA 5FGMA 4E70A 2UWMA 1ZREA 1IRFA 2XGXA 4A0ZA 1SD4A 2PFBA 3KP7A 4AIJA 2CG4A 5IT9K 3FXRA 4U0WA 2OU2A 5E8IA 3V7RA 4A0YA 2FQ3A 5BS6A 1R1VA 4LK1F 3IRRA 3F8MA 1I27A 1FSHA 3IWFA 3BROA 1BI0A 2A5YB 3EYIA 2O8XA 5LLQA 3ZMTA 3KETA 1LB2A 5DCMB 3I53A 3V8LA 4Q4ZF 4CXFA 1R36A 3CLOA 1PP7U 2DK5A 3BY6A 2YX7A 4TV7A 1V3FA 2FNAA 2ZNZA 2HYFA 3MAJA 5HS8A 3RPUA 2KIFA 5DDGA 4R1HA 1PDNC 3HRMA 3I0TA 3V8KA 5LEJA 4XSZF 3L7WA 3OOPA 2JSCA 2MH2A 1FBQA 1JHHA 4KFCA 3V7CA 4N0BA 2LF7A 2MC3A 3RYRA 3MEXA 3D0SA 1BI1A 1EH7A 5TRDA 5L3BA 2GA1A 1YYVA 4HOBA 2RQPA 2VOPA 4P9UA 1XB4A 3LA2A 4ZYGA 1KQ8A 1F9NA 3T8RA 2NNNA 2E1CA 3DPLC 3WE2A 4PCQA 5L3GA 2ZCWA 4LGWA 1O7FA 3VOEA 4YFNF 2IW5A 3E6BA 3GZ5A 2PG4A 3CDHA 4LLGF 1ON2A 4EJUA 1HW2A 3K1NA 1IN8A 4EJTA 1HW1A 3Q5FA 4HV5A 3ROUA 1ZRCA 1XCVA 4KMUX 1LQ1A 1XCBA 3F23A 1S8NA 1VTNC 1P6RA 2F5EA 4U0VA 3HRTA 4ASNA 3TDUC 1IW7F 1FYKA 3FXQA 2FXAA 4O3MA 5HVQC 3WE3A 5J6XA 4RGRA 2M8EA 2E1NA 4A5MA 5AIPA 5FFZA 5H20A 3BZ6A 3HTUA 4MTEA 4YG2F 1WRJA 1YS6A 5HLIA 2HDCA 3IWZA 2D1HA 1JGSA 2OA4A 3QU6A 4A5NA 4M9XA 1FY7A 2ESNA 1HW5A 4YFXF 3PFIA 5E1ZB 1UHMA 5LEKA 1U6GA 1J75A 1BJAA 1BIAA 4LJZF 4OIQF 5HS9A 1QGPA 1YS7A 1ZYRF 3F8BA 2FBIA 2ZBKA 1XGMA 2VONA 1LDKB 3F8CA 1R22A 1XN7A 3QRFF 5ILVA 2QENA 5KK1A 1TNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK0 F;  1G3W A;  5JI6 A;  4ETS A;  3GVA A;  3WU1 B;  4RB1 A;  2V1X A;  5LBQ A;  4P96 A;  4BHC A;  2XAF A;  4I7H A;  1EH6 A;  2H09 A;  2FRH A;  2P8T A;  2K7L A;  2MA3 A;  5E1W A;  1Q1H A;  2FU4 A;  4L9J A;  2EFQ A;  3F8F A;  2QBY B;  1K6O A;  3NEU A;  4LMY A;  1G3T A;  1T39 A;  2ZJ2 A;  2OZU A;  1K78 A;  1ZN2 A;  3LQR A;  3V4G A;  3ZN0 A;  4GO1 A;  3FMS A;  3HYI A;  3JAM K;  1RNL A;  2QQ9 A;  3MQ0 A;  5EEH A;  3B73 A;  1G3S A;  1W4M A;  3PQJ A;  5CVI A;  5KVR A;  1UHW A;  3N4M A;  2KRF A;  3E5Q A;  2DO7 A;  2DQL A;  2TDX A;  1QO0 D;  3EDP A;  1XSX A;  4LB5 A;  2JZY A;  3DFG A;  4RS8 A;  4H0E A;  2EWN A;  3TO6 A;  1LDJ A;  1FZP B;  2OBP A;  2QYO A;  2HGC A;  4EV0 A;  3QOP A;  5H6Q A;  1TNT A;  5K1Y A;  3HUG A;  2E7W A;  4AIH A;  4WWC A;  4RGX A;  5DYM A;  4HF0 A;  2A69 F;  2QM3 A;  4L0Y B;  2IA0 A;  3F8N A;  1IXS B;  3ECO A;  1TQI A;  5D6F A;  1MJ9 A;  3GFM A;  3R0A A;  1KYZ A;  3BPX A;  3JAM Z;  2GZW A;  4L9T A;  4N9H A;  4DNC A;  3VOD A;  1IUY A;  3JTG A;  4NHJ A;  2HR3 A;  2X0L A;  4KN7 X;  3NRV A;  1YW8 A;  2K02 A;  1XDU A;  2L54 A;  2VC0 A;  1MJB A;  1J5Y A;  3LA7 A;  1E2X A;  2VBW A;  3K1M A;  1IN6 A;  4ESJ A;  1BN5 A;  3E3V A;  3HHG A;  3GFI A;  4WXH A;  4I98 B;  4G7Z F;  1CF7 A;  1YG2 A;  4HX4 A;  5TJJ A;  3SZP A;  2FML A;  4HBL A;  4F7Z A;  3J80 Z;  4HLY A;  2P6S A;  1H9T A;  4MEY F;  2LSO A;  2QQB A;  2H94 A;  1NHA A;  2PMU A;  3LFK A;  2HTJ A;  3QP5 A;  1OYY A;  1STZ A;  3T5X A;  2E7X A;  4PGH A;  3HIF A;  2IA1 A;  5E8G A;  2VXZ A;  3GFJ A;  2V79 A;  3BJO A;  3TKY A;  1RI7 A;  1R1U A;  4FX0 A;  4KNY A;  4UV9 A;  5LGU A;  5BMZ A;  3RJP A;  1BIB A;  3FM3 A;  3HTS B;  1MDM B;  4S05 A;  2EFN A;  5AON A;  1P92 A;  1CGP A;  3I59 A;  5HS7 A;  1JXS A;  3F21 A;  5K5R A;  4EM1 A;  3SHF A;  4UUV A;  1ZAO A;  3SZT A;  1ZRD A;  2RNJ A;  3DQV C;  3IHU A;  1S29 A;  1HQC A;  3O2P E;  2VE8 A;  2DAO A;  1WQ2 A;  1FOK A;  4HQE A;  2AS5 F;  4B09 A;  3RKX A;  5FD6 A;  1B9N A;  2V9V A;  2V1D A;  1SD6 A;  4IJA A;  2C6Y A;  1HST A;  3AAF A;  4L9V A;  4FHT A;  1GHC A;  5D6E A;  2FA5 A;  1UFM A;  1P2F A;  2J5O A;  3ZP5 A;  4PDK A;  1IF1 A;  1ONV A;  4UHT A;  3WTW C;  4MTD A;  1HKS A;  2XRN A;  1L3L A;  1RIO H;  5A2Q Z;  3EQL F;  5D5V B;  2K4B A;  2V1U A;  5L3F A;  1WI9 A;  3C18 A;  1QNT A;  2FSW A;  2W57 A;  3M9A A;  1IN7 A;  3JSO A;  2YX4 A;  2A6E F;  1K79 A;  3MZH A;  3I58 A;  4WX9 A;  3SQN A;  3R6S A;  2R3S A;  2HQR A;  1WWX A;  1KYW A;  1RUN A;  2EFP A;  4GXO A;  3L2C A;  2Q8K A;  2IJL A;  3GYH X;  5FLX Z;  1MZB A;  2HTS A;  2JPB A;  1G3Y A;  3DP7 A;  1T6S A;  4BYY A;  4HAM A;  3KCC A;  2BYV E;  5HDG A;  3Q9S A;  3VEP A;  3I5U A;  1KQ9 A;  2M30 A;  4B8X A;  1O7L A;  2LDU A;  4EJV A;  2G9W A;  4LFU A;  4ZZL A;  4PZJ A;  1TW2 A;  3FHZ A;  2EA2 A;  4OMZ A;  1J7K A;  1O3S A;  3JSP A;  1U5T B;  4RAY A;  4HV6 A;  2MD5 A;  2F2E A;  5D8K B;  3REO A;  5IT9 Z;  5LHH A;  1FP1 D;  3C3W A;  4BAY A;  5LGN A;  3HSE A;  3E5X A;  2KIM A;  1R1T A;  3U1D A;  4IF4 A;  5LGT A;  4CHU A;  5D8L B;  4QWQ A;  1IRG A;  1ULY A;  1U5T A;  2FEZ A;  2W84 A;  4I0A A;  1WSU A;  2IA2 A;  3FX3 A;  2V6C A;  1SD5 A;  2CYY A;  1QPM A;  1YLF A;  2Z3Y A;  4KIB A;  1JHF A;  4Y15 A;  4EVI A;  5ICC A;  5LHI A;  4IVN A;  2STT A;  1XMK A;  3LAP A;  2R7F A;  2WTE A;  2CW0 F;  4O5V A;  2HOE A;  3HRS A;  2O0Y A;  2A3S A;  2RV8 A;  2VT3 A;  3WTX C;  3KP4 A;  2XHK A;  3KZY A;  1V4R A;  5HDK A;  5EEG A;  1KU9 A;  2P5K A;  3KEO A;  2DTR A;  4OIO F;  1AOY A;  3CUQ A;  3ELK A;  1KU3 A;  3MWM A;  4JK1 X;  4N9I A;  5D5X B;  2A61 A;  5DD4 A;  1IZ1 A;  5FLX K;  2D1V A;  3RPQ A;  4HX7 A;  3FMR A;  1E17 A;  2DPU A;  1IXR C;  2IVM A;  2VC1 A;  5CVJ A;  1ZG5 A;  2DU9 A;  2H6B A;  1T0F A;  3I64 A;  3COA C;  4OMY A;  2FNP A;  4RGS A;  4G8X A;  2Z33 A;  5FFX A;  3GEZ A;  4KIF A;  1OYI A;  3R61 A;  5JVT A;  3S2W A;  2KJB A;  4LG0 A;  4LLL A;  4G7H F;  5FD5 A;  2P7V B;  5DUI A;  2ADU A;  4Y17 A;  1QZY A;  2A6H F;  4L0Z B;  3IKV A;  4M72 A;  1FT9 A;  3WU0 A;  5A2Q K;  4M74 A;  2ELH A;  4P9F A;  1ZAR A;  4IRI A;  1UB9 A;  3P9I A;  1PP8 F;  1W5S A;  3E6M A;  3QPT A;  3RKY A;  5DD8 A;  1Z7U A;  4EGZ A;  3IRQ A;  4CGZ A;  3E97 A;  5L3D A;  1OMI A;  2GXG A;  2PBI A;  4K2E A;  3KE2 A;  4HF1 A;  1SFX A;  2RN7 A;  2L4A A;  2QQA A;  4WXD A;  3G73 A;  4RB2 C;  4WCG A;  2NS0 A;  3LST A;  4R8H A;  2YU3 A;  1ZRF A;  1X3U A;  5CVU A;  2L3D A;  2BV6 A;  3LWF A;  2MLG A;  1KA8 A;  2Q2E A;  2UXX A;  4JQF A;  3M8F A;  3VFZ A;  2PLY A;  1D5V A;  1FP2 A;  3E6D A;  2OQR A;  2CFX A;  2PEX A;  3WG9 A;  2HYG D;  4GYG A;  3MFK A;  3DKW A;  1USS A;  1U78 A;  1CF7 B;  4RGU A;  2PN6 A;  1MJA A;  2DT5 A;  2L4M A;  2EFO A;  1YTY A;  2GAU A;  3BJ6 A;  3MCZ A;  5BPD A;  4NQW A;  2RC4 A;  3WGI A;  1A04 A;  2P5L C;  2MLK A;  4U0Y A;  4BHP A;  3GZ6 A;  4IPA A;  4KDP A;  1ZG1 A;  4UXN A;  4KA4 A;  3CUQ C;  3F3X A;  1QZZ A;  5D5U B;  4MQ9 F;  3ZMS A;  1Z6R A;  3F22 A;  3R4K A;  2QBY A;  4Z2Y A;  4LD5 A;  3ZN1 A;  3WTS C;  1F4K A;  4KIC A;  2JTV A;  1YO5 C;  3PQK A;  3BDD A;  3D5L A;  4I2O A;  2QVO A;  5D4S A;  1SFE A;  3W6K B;  3KP6 A;  1KU2 A;  1O3T A;  3T0Y A;  1BOA A;  4BH9 A;  3CUQ B;  1U3E M;  3ZMU A;  1EH8 A;  2Z9O A;  5LRS A;  2M5W A;  4ZH4 F;  1O57 A;  1LEA A;  3L09 A;  4BQA A;  2K86 A;  1B9M A;  1KQ0 A;  3BWG A;  1MD0 A;  5CLS A;  2O3F A;  2RKH A;  2GQQ A;  3FZV A;  4EGY A;  1WKM A;  2DK8 A;  1ZG3 A;  2XVC A;  4I01 A;  5LHG A;  3RDI A;  2XAH A;  4ZYH A;  5ILU A;  4A6D A;  5D5W B;  2KIU A;  3Q9V A;  2B0L A;  3KFW X;  2OZ6 A;  2CSO A;  2PMH A;  2VT2 A;  1DPR A;  2P5V A;  2Y75 A;  3HOT A;  2M1B A;  2OD5 A;  2LNB A;  3ABU A;  5JFR A;  3W6J B;  5DV5 A;  2YSR A;  4Q5S F;  2XKO A;  2R7D A;  3FF5 A;  2EB7 A;  1FC3 A;  4LG0 B;  4U7B A;  3BPV A;  1YW7 A;  3GWZ A;  2VBX A;  4XLP F;  3LA3 A;  2DPD A;  4ZYE A;  1W7P D;  1UST A;  2BGC A;  2CO5 A;  4U7D A;  1D3Y A;  4IHT A;  4D0P A;  1T98 A;  4P5O A;  3I4P A;  1REP C;  2ZO4 A;  1LJ9 A;  4EMS A;  2W24 A;  1OPC A;  3K1P A;  3P7N A;  3K0L A;  1OKR A;  1BM9 A;  6PAX A;  5D4R A;  2PJP A;  4A12 A;  1RUO A;  5ICE A;  3QP6 A;  2W25 A;  4Q47 A;  4UNO A;  5CYV A;  1IN4 A;  1FYL A;  3NQO A;  1TQM A;  1S3J A;  4G6D A;  4MQV A;  1O3R A;  3R60 A;  1HKQ A;  1HXD A;  1DDN A;  5BOX A;  1W7P B;  2P4W A;  2QLZ A;  1C0W A;  4CDG A;  1AWC A;  1BBY A;  5K5Q A;  4HA8 A;  3DPT A;  4PGG A;  2Q0O A;  1XSV A;  2DFI A;  4ON0 A;  1Z9C A;  4G7O F;  3ZPL A;  1Z6T A;  4IXA A;  3IL2 A;  1FYM A;  4QLC U;  2A68 F;  3C1D A;  2HKO A;  4AIK A;  3G3Z A;  4OIP F;  3F6V A;  2D45 A;  3O6B B;  2P6T A;  3KZZ A;  2F5F A;  3LQQ A;  4FT8 A;  1Z05 A;  3KP3 A;  3TGN A;  4WF2 A;  3DEU A;  3J81 Z;  2FMY A;  5HLG A;  3HRU A;  1FBS A;  2XUB A;  2NNY A;  4M6X A;  3DV8 A;  5FO5 A;  3E5U A;  3SXY A;  3JTH A;  1SFU A;  4HZF A;  1KU7 A;  2O03 A;  3M8E A;  4HX8 A;  4HDU A;  1TW3 A;  1ZGA A;  3M7G A;  3KLO A;  2FE3 A;  4UV8 A;  2K4J A;  2ZME A;  5L3C A;  2EJR A;  4OU0 A;  4WXC A;  1XDS A;  1XGS A;  2XAS A;  2STW A;  2DBB A;  3KLN A;  4M6Y A;  1SMY F;  5CJ9 A;  4HQM A;  2WWY A;  1SMT A;  3T1B A;  2VBZ A;  1D8K A;  3GXO A;  1PUE E;  1YIO A;  3J80 K;  4KMF A;  5E20 A;  1MDM A;  2M87 A;  1FBU A;  2G7H A;  4LB6 B;  3BJA A;  2HKX A;  1QQI A;  1S7O A;  1SD7 A;  1F1Z A;  3V7S A;  3CO7 C;  3RYP A;  3B02 A;  4HLX A;  1IAW A;  5J8C A;  3IC7 A;  4I02 A;  5CVV A;  4AWX B;  4M9Z A;  1DP7 P;  4A2U A;  1FLI A;  4RB0 A;  4A0X A;  3T8T A;  4G9Y A;  2GIV A;  2UXN A;  1GVJ A;  1TQP A;  1H0M A;  5ILS A;  1YFH A;  4UVA A;  5K5O A;  2VE9 A;  4S04 A;  2ZFW A;  3CO6 C;  2NAZ A;  1R7J A;  3O3K A;  2Z99 A;  2CQK A;  3J81 K;  2L02 A;  3H92 A;  4EJO A;  2X4H A;  4DQ2 A;  2H6C A;  3IKT A;  1U8R A;  1DPU A;  1XD7 A;  3ABT A;  4ESF A;  3P9C A;  4BXU A;  2UZK A;  4G6Q A;  3CTA A;  3GUD A;  2COM A;  3WTT C;  2JT1 A;  2ESH A;  2H27 A;  1K78 B;  4RAZ A;  1ON1 A;  2NRA C;  2QZ8 A;  4YFK F;  3WTU C;  2NYX A;  3EET A;  1H9G A;  3CJN A;  1JE8 A;  1HBX G;  4XRF A;  5E1X A;  4CZZ A;  4XBF A;  1I1G A;  2G7U A;  2ETH A;  3FXU A;  4KT5 C;  2DQR A;  4KN4 X;  2HZT A;  2IRF G;  5FB2 A;  1G4D A;  4L9N A;  2GXB A;  1U5T C;  2YPR A;  1I6X A;  1XGO A;  5DEQ A;  2ZKZ A;  3KEQ A;  4AVP A;  1BI2 A;  3U9G A;  3VB2 A;  4FX4 A;  3C7J A;  2LF8 A;  2FBK A;  3EYY A;  4IRG A;  2KKO A;  3BP8 A;  4UVB A;  2DI3 A;  3GLX A;  1LVA A;  1L0O C;  4EM0 B;  4ENM A;  4XLN F;  3N97 A;  2IT0 A;  5IT3 A;  2ZME B;  4BNC A;  2QWW A;  3E6C C;  4A6E A;  3KP5 A;  2XRO A;  1TTY A;  3F72 A;  1S6L A;  4KUM A;  1B1B A;  5CVR A;  3WTV C;  1F5T A;  2O61 A;  4NB5 A;  1LEB A;  5JR3 A;  2XAG A;  2DW4 A;  5HDN A;  4L18 B;  2M45 A;  4RB3 C;  2J5P A;  1ODD A;  1ZLJ A;  2P7C B;  1BC7 C;  1RZ4 A;  3MZY A;  4XSX F;  3GFL A;  2ISY A;  4Q48 A;  1R5G A;  3GW2 A;  3SFZ A;  2KJC A;  2JRT A;  3TO9 A;  2GWR A;  4BHB A;  1FSE A;  1Z1D A;  1HKT A;  3K9T A;  3L9F A;  5F6F A;  2CWE A;  2OAZ A;  1BI3 A;  1MGT A;  1XSD A;  3ZMV A;  4HDV A;  2MBF A;  3HHH A;  2W85 A;  3K69 A;  1B59 A;  1HSJ A;  5AIQ A;  4HF2 A;  2VBY A;  1BC8 C;  1R23 A;  3I59 B;  2HEO A;  2HS5 A;  4U88 A;  2VOO A;  1MKM A;  3CUO A;  5DCM A;  2BEO A;  3H3U A;  2DLL A;  3TOB A;  4M9S A;  4OIR F;  1J9I A;  1ZHF A;  2PI0 A;  4OOI A;  1FNN A;  4R79 A;  4EJW A;  1D8J A;  3QU3 A;  1OYW A;  5E17 F;  2XV4 S;  5BPI A;  1FWZ A;  3RI4 A;  3ZMZ A;  5DUK A;  1OR7 A;  2K27 A;  3ERE D;  5LRR A;  2EA4 A;  4YII A;  5L3E A;  3ISP A;  2OQG A;  4AD9 A;  3RIR A;  2VN2 A;  4CYD A;  1QBJ A;  1GXQ A;  3L00 A;  3K2Z A;  2ZXJ A;  2WV0 A;  3QPH A;  5BQT A;  2VOD A;  1R5H A;  2PQ8 A;  1Y0U A;  3BOQ A;  2IPQ X;  3HSR A;  1FX7 A;  4WK8 F;  5JHU A;  4JBA A;  3HOS A;  3EUH A;  4ENN A;  4HYE A;  2A07 F;  3H3Z A;  4M71 A;  1ZGJ A;  1P4W A;  3RKW A;  1ZLK A;  3P9K A;  1W7P A;  3ZMD A;  3ZQ7 A;  1FPQ A;  3ML6 A;  2XAJ A;  1YW9 A;  4OIN F;  1LDD A;  3ULQ B;  4I09 A;  1TLH B;  2GA2 A;  2RGV A;  1IN5 A;  3FM5 A;  5F1R A;  4MGR A;  4ZYD A;  2ACJ A;  2FBH A;  2O6G E;  1O3Q A;  1R00 A;  2WC2 A;  3RTR A;  4GGG A;  3QAH A;  2EV6 A;  1IXC A;  4GYI A;  2Z5U A;  3TO7 A;  5ERI A;  2XKP A;  1KGS A;  3R0J A;  5H6R A;  1EV7 A;  4UVC A;  3F6O A;  2ISZ A;  3TDZ C;  5J8F A;  4EM2 A;  2F5C A;  4KYW A;  2L01 A;  1GXP A;  3I54 A;  2D2W A;  1G6N A;  3J7A O;  1SAX A;  2HQN A;  4L5I A;  5DCF A;  3V8J A;  1B4A A;  1S7A A;  4M73 A;  3WTY C;  1J59 A;  1T38 A;  4YIF A;  2ZNY A;  3OV8 A;  4P55 A;  3JW4 A;  3DXJ F;  2F5D A;  1R58 A;  2XAQ A;  5F64 A;  1YQA A;  1W5T A;  3WOD F;  2FF4 A;  2IP2 A;  2Y0M A;  2HWV A;  1Z91 A;  2MH9 A;  2BE5 F;  2HFH A;  3KP2 A;  2Y48 A;  3TQN A;  3DF8 A;  4ENJ A;  1B6A A;  4MHG A;  3U2R A;  3LAJ A;  1P4A A;  5ICG A;  4CIC A;  1J0R A;  3GO5 A;  3FWE A;  4CO8 A;  3HSF A;  5E18 F;  3WTZ A;  4IHS A;  2RDP A;  3TOA A;  4I0B A;  4GCV A;  1XMA A;  3ECH A;  4EQQ A;  4IRH A;  1T2K A;  2JPC A;  1XGN A;  1J2X A;  4LLN A;  3FMQ A;  4Y13 A;  5ICF A;  2FOK A;  2YR2 A;  1DUX C;  2EV0 A;  3WGG A;  5HLH A;  1LNW A;  2LKP A;  2XIG A;  2CGP A;  2QUF A;  1I1S A;  1U2W A;  1I5Z A;  4MNU A;  2RVC A;  4ESB A;  2EV5 A;  4G94 A;  3GF2 A;  4KIG A;  3M1E A;  3WGH A;  4MEX F;  3GX4 X;  1ZH5 A;  2AXL A;  4HW0 A;  4O6J A;  1UCR A;  2BBY A;  4ZZD A;  2EK5 A;  4ENK A;  1TBX A;  3I71 A;  1K7A A;  2EFW A;  1P4X A;  5HOO A;  5ED4 A;  4L5J A;  5FGM A;  4E70 A;  2UWM A;  1ZRE A;  1IRF A;  2XGX A;  4A0Z A;  1SD4 A;  2PFB A;  3KP7 A;  4AIJ A;  2CG4 A;  5IT9 K;  3FXR A;  4U0W A;  2OU2 A;  5E8I A;  3V7R A;  4A0Y A;  2FQ3 A;  5BS6 A;  1R1V A;  4LK1 F;  3IRR A;  3F8M A;  1I27 A;  1FSH A;  3IWF A;  3BRO A;  1BI0 A;  2A5Y B;  3EYI A;  2O8X A;  5LLQ A;  3ZMT A;  3KET A;  1LB2 A;  5DCM B;  3I53 A;  3V8L A;  4Q4Z F;  4CXF A;  1R36 A;  3CLO A;  1PP7 U;  2DK5 A;  3BY6 A;  2YX7 A;  4TV7 A;  1V3F A;  2FNA A;  2ZNZ A;  2HYF A;  3MAJ A;  5HS8 A;  3RPU A;  2KIF A;  5DDG A;  4R1H A;  1PDN C;  3HRM A;  3I0T A;  3V8K A;  5LEJ A;  4XSZ F;  3L7W A;  3OOP A;  2JSC A;  2MH2 A;  1FBQ A;  1JHH A;  4KFC A;  3V7C A;  4N0B A;  2LF7 A;  2MC3 A;  3RYR A;  3MEX A;  3D0S A;  1BI1 A;  1EH7 A;  5TRD A;  5L3B A;  2GA1 A;  1YYV A;  4HOB A;  2RQP A;  2VOP A;  4P9U A;  1XB4 A;  3LA2 A;  4ZYG A;  1KQ8 A;  1F9N A;  3T8R A;  2NNN A;  2E1C A;  3DPL C;  3WE2 A;  4PCQ A;  5L3G A;  2ZCW A;  4LGW A;  1O7F A;  3VOE A;  4YFN F;  2IW5 A;  3E6B A;  3GZ5 A;  2PG4 A;  3CDH A;  4LLG F;  1ON2 A;  4EJU A;  1HW2 A;  3K1N A;  1IN8 A;  4EJT A;  1HW1 A;  3Q5F A;  4HV5 A;  3ROU A;  1ZRC A;  1XCV A;  4KMU X;  1LQ1 A;  1XCB A;  3F23 A;  1S8N A;  1VTN C;  1P6R A;  2F5E A;  4U0V A;  3HRT A;  4ASN A;  3TDU C;  1IW7 F;  1FYK A;  3FXQ A;  2FXA A;  4O3M A;  5HVQ C;  3WE3 A;  5J6X A;  4RGR A;  2M8E A;  2E1N A;  4A5M A;  5AIP A;  5FFZ A;  5H20 A;  3BZ6 A;  3HTU A;  4MTE A;  4YG2 F;  1WRJ A;  1YS6 A;  5HLI A;  2HDC A;  3IWZ A;  2D1H A;  1JGS A;  2OA4 A;  3QU6 A;  4A5N A;  4M9X A;  1FY7 A;  2ESN A;  1HW5 A;  4YFX F;  3PFI A;  5E1Z B;  1UHM A;  5LEK A;  1U6G A;  1J75 A;  1BJA A;  1BIA A;  4LJZ F;  4OIQ F;  5HS9 A;  1QGP A;  1YS7 A;  1ZYR F;  3F8B A;  2FBI A;  2ZBK A;  1XGM A;  2VON A;  1LDK B;  3F8C A;  1R22 A;  1XN7 A;  3QRF F;  5ILV A;  2QEN A;  5KK1 A;  1TNS A; 
#chains in the Genus database with same CATH topology
 3S3N A;  4LK0 F;  4BKX A;  1G3W A;  5JI6 A;  2ECC A;  1WPK A;  1MNE A;  4MLO A;  4DOZ A;  2GBY A;  2JA2 A;  4ETS A;  3GVA A;  3WU1 B;  4N4O B;  2GIZ A;  4RB1 A;  2V1X A;  3NAR A;  2NVT J;  2ELJ A;  2ELK A;  4G12 A;  5FKO A;  5LBQ A;  1X3W B;  1DGR M;  1NTC A;  4P96 A;  4BHC A;  2XAF A;  4I7H A;  1D0X A;  1EH6 A;  2H09 A;  2FRH A;  2DYS H;  1IUF A;  4F91 B;  2P8T A;  2ME0 A;  1RR7 A;  2K7L A;  2GXA A;  2MA3 A;  5E1W A;  1Q1H A;  4EEF G;  1BR1 A;  2FU4 A;  1SAU A;  3HOZ J;  3LMM A;  4L9J A;  4RAF A;  1WJA A;  1YJN I;  1QVU A;  2EFQ A;  3F8F A;  2QBY B;  4LMY A;  3NEU A;  2VQL A;  1K6O A;  2QSH X;  1G3T A;  3BTI A;  1T39 A;  2ZJ2 A;  1I6H J;  2OZU A;  1K78 A;  1ZN2 A;  1QRY A;  2ZJQ F;  5EGO A;  3LQR A;  4I99 C;  1T08 B;  3TP3 A;  3V4G A;  1SFK A;  1WH5 A;  3ZN0 A;  1FOX A;  1HDP A;  4GO1 A;  2IS2 A;  3MZ8 A;  3FMS A;  1XTA A;  3HYI A;  3JAM K;  3DWL E;  2Q1Z B;  4RLQ A;  5FRO A;  2HZD A;  3K4M A;  1IG7 A;  1RNL A;  2QQ9 A;  3MQ0 A;  4BS9 A;  5EEH A;  3B73 A;  1G3S A;  2L9N A;  1W4M A;  1A6Q A;  3PQJ A;  5CVI A;  1FJL A;  4LIU A;  2KPM A;  5KVR A;  1W0U A;  2QEX I;  1UHW A;  3CCM I;  5IP7 J;  3N4M A;  2KRF A;  2IEK A;  3E5Q A;  2DO7 A;  3OS0 A;  2DQL A;  2TDX A;  1QO0 D;  3EDP A;  3GCM A;  1XSX A;  4LB5 A;  2DCE A;  3FXL A;  2JZY A;  3DFG A;  4RS8 A;  5TIS C;  4BBR J;  4H0E A;  2EWN A;  2JMW A;  5FKM A;  1D0Z A;  4MFD A;  3WU2 C;  2K9N A;  3TO6 A;  1LDJ A;  3ABL H;  3FK7 A;  1FZP B;  2OBP A;  4BQO A;  4NC8 A;  2QYO A;  4XOR A;  2HGC A;  4EV0 A;  1VQ4 I;  4X0G A;  3QOP A;  2I10 A;  1FMV A;  5DS9 A;  2LTP A;  5H6Q A;  2JQ7 A;  3LSR A;  1TNT A;  4ZDL A;  3FHN A;  5K1Y A;  2CJJ A;  2CUE A;  3HUG A;  2E7W A;  2KDO A;  4AIH A;  4WWC A;  4RGX A;  3H9G A;  4CYC A;  5DYM A;  4HF0 A;  2A69 F;  3PNT A;  2QM3 A;  2F5V A;  2Y31 A;  5F0F A;  4L0Y B;  2IA0 A;  3Q3S A;  3CME I;  1ERD A;  3S3O A;  3F8N A;  2R92 J;  1IXS B;  3ECO A;  1VQ5 I;  2B9S A;  1TQI A;  3EUH C;  1FIP A;  4JOM A;  2NVX J;  2WB1 N;  5D6F A;  3ASN H;  1MJ9 A;  1PVE A;  3GFM A;  1MH3 A;  3R0A A;  3H9Q A;  1KYZ A;  2KIQ A;  5DM7 F;  3BPX A;  1ZR4 A;  2VUM J;  3JAM Z;  2GZW A;  2X1D A;  4L9T A;  1UMQ A;  2E5Z A;  3TL4 X;  2RQQ A;  4N9H A;  4DNC A;  3VOD A;  1IUY A;  2QKM B;  2XDV A;  3JTG A;  2EIL H;  4NHJ A;  2R7O A;  2HR3 A;  3PIO F;  2X0L A;  1UJ8 A;  4KN7 X;  3NRV A;  4C3H J;  1VQP I;  1YW8 A;  2K02 A;  3BQY A;  1XDU A;  2L54 A;  2VC0 A;  1MJB A;  1J5Y A;  5J1R A;  3LA7 A;  1E2X A;  2VBW A;  2EIN H;  3K1M A;  1B72 B;  4XLH A;  1IN6 A;  5JLX A;  5B3S H;  4MIM A;  2VQC A;  4ESJ A;  5CQG A;  3HKZ N;  1WJF A;  1BN5 A;  2V6E A;  4JP0 A;  5FKL A;  4XRS G;  3FDY A;  3G4S I;  3S1N J;  1FEX A;  3E3V A;  3HHG A;  2XB5 A;  4AYB N;  3GFI A;  4WXH A;  2LC2 A;  4I98 B;  4G7Z F;  1CF7 A;  2IGM A;  1YG2 A;  1MBK A;  2OUM A;  4FE4 A;  4HX4 A;  2QQ8 A;  5TJJ A;  2A6T A;  3SZP A;  4A3F J;  2FML A;  4HBL A;  4F7Z A;  1YE9 A;  2M3A A;  3J80 Z;  2O9L A;  1OR7 C;  2W48 A;  3BT9 A;  4HLY A;  3K4J A;  3HB9 A;  2P6S A;  1H9T A;  1ETY A;  4MEY F;  2LSO A;  2QQB A;  3BR0 A;  2V26 A;  3DKX A;  5C44 J;  1DU0 A;  2H94 A;  1HC8 A;  1NHA A;  2PMU A;  5K7H A;  4XRM A;  1AA7 A;  2I8D A;  1QZE A;  2LK2 A;  2K9Q A;  3I55 I;  3LFK A;  2HTJ A;  3DTE A;  3QP5 A;  1IGN A;  3RZD J;  1OYY A;  1STZ A;  3DEE A;  2E7X A;  4PGH A;  3T5X A;  2DDB A;  4BGD A;  4BQN A;  5FKN A;  3HIF A;  3BG7 A;  3GME A;  4BJ6 C;  2IA1 A;  2GLO A;  5E8G A;  1N77 A;  4CCN A;  2K9L A;  1TWH J;  3GFJ A;  2VXZ A;  2V79 A;  2G0E A;  2E19 A;  3ZCO A;  3BJO A;  4DZP A;  1TWA J;  3TKY A;  4CUG A;  4B4C A;  4ZDP A;  3A2K A;  3EUK L;  4C2M J;  2VIX A;  4CCK A;  3GLL A;  1RI7 A;  1R1U A;  2VL8 A;  3DTK A;  4FX0 A;  1TWF J;  1K4S A;  2M4G A;  4KNY A;  4UV9 A;  5LGU A;  5BMZ A;  3RJP A;  1BIB A;  1T33 A;  2JUG A;  1Y39 A;  3BC8 A;  3HBL A;  3FM3 A;  1ETV A;  3S2H J;  4X6A J;  5F08 A;  3HTS B;  1MDM B;  4S05 A;  3CMY A;  2EFN A;  5AON A;  3A01 A;  2R7Z J;  1P92 A;  1CGP A;  3BTC A;  3I59 A;  5HS7 A;  3BCB A;  2BY3 A;  3LOC A;  1ZEL A;  5K5R A;  3F21 A;  1JXS A;  1TWG J;  3DLA A;  3HKZ A;  2R7Q A;  2FJ1 A;  1WJC A;  4EM1 A;  1XPX A;  3M07 A;  1JKQ C;  3SHF A;  4UUV A;  1ZAO A;  1S5L C;  2EIM H;  3SZT A;  1OCP A;  2LY2 A;  2RNJ A;  1ZRD A;  3OYD A;  2DA2 A;  3DQV C;  3IHU A;  2NS7 A;  3KIO A;  1S29 A;  4NC6 A;  3IAS 2;  2Z1D A;  1HQC A;  2PJR B;  4BE0 A;  3O2P E;  2VE8 A;  2DAO A;  1WQ2 A;  2DA7 A;  3CCR I;  1YRN A;  1FOK A;  2B7E A;  1YHQ I;  4HQE A;  2AS5 F;  3FXJ A;  3OYL A;  4B09 A;  3RKX A;  5FD6 A;  1B9N A;  3BTJ A;  4F52 A;  1DU6 A;  2V9V A;  2V1D A;  2VB6 A;  3GZN B;  5FJ8 J;  1SD6 A;  1NG6 A;  2NOJ B;  4IJA A;  1UAA A;  1BR2 A;  2C6Y A;  4AID A;  1HST A;  4DYR A;  2DJN A;  2QCO A;  3AAF A;  5GTH C;  4L9V A;  2HU9 A;  1ZTR A;  4DW6 A;  2HNH A;  2L9S A;  5GAE J;  4FHT A;  2ID3 A;  1ETQ A;  4I76 A;  4E4H A;  1ZGW A;  1GHC A;  4JYK A;  3CDL A;  4V2F A;  2ZSH B;  5D6E A;  2FA5 A;  3CF2 A;  4MFE A;  4PJ0 C;  1UFM A;  1D0Y A;  1P2F A;  4AVZ A;  3SDG A;  2J5O A;  4L5E A;  1G59 A;  3LSJ A;  3ZP5 A;  4PDK A;  1IF1 A;  3S17 J;  4BUP A;  2X85 A;  1D1C A;  1ONV A;  5EEA A;  2R0Q C;  4UHT A;  1A6I A;  4W97 A;  2XSD C;  3DLL F;  3WTW C;  2IGK A;  4MTD A;  3ABM H;  2DOD A;  1HKS A;  2BHZ A;  2XRN A;  1L3L A;  2BW3 B;  1RIO H;  2ZXW H;  3OS1 A;  1OCR H;  5A2Q Z;  3EQL F;  5D5V B;  2DN0 A;  2K4B A;  2V1U A;  3OYE A;  3H3V K;  2JA8 J;  2PMZ N;  5L3F A;  1JKP C;  1WI9 A;  3C18 A;  1H8A C;  2M34 A;  1QNT A;  1OLT A;  2FSW A;  1N75 A;  2FD5 A;  2W57 A;  1BW6 A;  3M9A A;  1IN7 A;  3O8G A;  3HPH A;  4II3 A;  2A05 A;  3JSO A;  3K70 C;  1FTZ A;  1X1B A;  2YX4 A;  2A6E F;  1K79 A;  3MZH A;  2BVL A;  3GTP J;  4CH7 A;  4XOT A;  3NWT A;  3I58 A;  1V55 H;  4WX9 A;  3SQN A;  3CLQ A;  2R3S A;  3R6S A;  4CZC A;  2MD0 A;  5FKK A;  5E3L A;  2MFZ A;  2HQR A;  4CA0 A;  1JUP A;  1WWX A;  1KYW A;  1VQL I;  3VYU B;  1A36 A;  2BOL A;  1RUN A;  2JK3 A;  2EFP A;  3BCA A;  4GXO A;  3L2C A;  2Q8K A;  3IH2 A;  4V2G A;  4KJZ A;  2IJL A;  3HEF A;  4F55 A;  1SVM A;  4E7J A;  3GYH X;  4II2 A;  5FLX Z;  1MZB A;  2HTS A;  2CV0 A;  2JPB A;  1G3Y A;  4BL0 B;  3DP7 A;  3GTO J;  1T6S A;  4BYY A;  4HAM A;  3KCC A;  2BYV E;  4BE1 A;  5HDG A;  3QPL A;  3CCL I;  3Q9S A;  3VEP A;  4XR6 A;  3I5U A;  1KQ9 A;  2M30 A;  4B8X A;  1O7L A;  3QQA A;  3V42 A;  2LDU A;  4EJV A;  2G9W A;  3JRI A;  2MAB A;  4LFU A;  4ZZL A;  4PZJ A;  1TW2 A;  4XKB A;  3FHZ A;  2K3F A;  3PNV A;  2EA2 A;  3E0J B;  4OMZ A;  1J7K A;  2VKH A;  4AU7 A;  2DA3 A;  3JSP A;  1O3S A;  1I50 J;  2WY8 Q;  1U5T B;  4RAY A;  3SEZ A;  3LSK A;  4HV6 A;  2MD5 A;  3L2Q A;  2RNG A;  2F2E A;  1KON A;  2WV1 A;  2BXY A;  4DYQ A;  4HNV A;  5D8K B;  3REO A;  3HOU J;  5IT9 Z;  1N25 A;  5LHH A;  1FP1 D;  3CC2 I;  3C3W A;  4BAY A;  1ETW A;  3AL0 C;  5LGN A;  3HSE A;  3E5X A;  1K6Y A;  4DBQ A;  1YX5 A;  2KIM A;  1R1T A;  3U1D A;  4IF4 A;  5LGT A;  4RBO A;  3JRC A;  4CHU A;  3LL7 A;  2EIJ H;  3IAM 2;  4HPQ A;  5K7Z A;  5J40 A;  2R5Y B;  5D8L B;  4QWQ A;  3JRA A;  1IRG A;  3S1Q J;  1ULY A;  1U5T A;  2FEZ A;  3H0D A;  1IC8 A;  4CCO A;  2W84 A;  3BR3 A;  2QKL B;  2VKE A;  4I0A A;  4PJN A;  1RET A;  2R5Z A;  1WSU A;  2IA2 A;  3LFU A;  4FCY A;  1D5Y A;  4IOA F;  3RQ4 A;  2VJ5 A;  2YU9 J;  3FX3 A;  2CRG A;  4B3A A;  2V6C A;  1SD5 A;  2LP0 A;  2CYY A;  1QPM A;  2ICW G;  1YLF A;  1A35 A;  2Z3Y A;  4KIB A;  2KMU A;  1JHF A;  4Y15 A;  4EVI A;  5ICC A;  5LHI A;  4IVN A;  4I6Z A;  2STT A;  1XMK A;  1WJD A;  3LAP A;  2V7F A;  2R7F A;  2WTE A;  2CW0 F;  4O5V A;  2HVQ A;  3PIP F;  2HOE A;  2KT0 A;  3HRS A;  2O0Y A;  2A3S A;  3HOY J;  2RV8 A;  2VT3 A;  1K83 J;  3WTX C;  3BG3 A;  3KP4 A;  3H5R A;  2XHK A;  3KZY A;  1V4R A;  2JA5 J;  1Z21 A;  5HDK A;  1Y56 A;  5EEG A;  4UUS A;  1E3H A;  2DXI A;  4W1U A;  1KU9 A;  3G6E I;  2HXI A;  2P5K A;  3KEO A;  2EH3 A;  3QYF A;  2V9P A;  2CW8 A;  2DTR A;  4B44 A;  4OIO F;  3KEY A;  1AOY A;  1VQN I;  3U21 A;  2AO9 A;  3CUQ A;  3ELK A;  4GRI A;  1KU3 A;  1MW7 A;  4XID A;  1BOB A;  2ZJR F;  3MWM A;  4JK1 X;  4N9I A;  3ZQG A;  3DU6 A;  3C2B A;  5D5X B;  3HDD A;  3HC7 A;  3VWB A;  2L9V A;  4IQJ A;  2A61 A;  3CCU I;  5CPR B;  5DD4 A;  1IZ1 A;  1OCZ H;  5FLX K;  1E3P A;  2D1V A;  3RPQ A;  1R9T J;  4HX7 A;  3M4O J;  3FMR A;  2DT6 A;  3FIS A;  1E17 A;  3BZK A;  2MC4 A;  2DPU A;  2XGC A;  1IXR C;  2IVM A;  5EGO B;  4PJM A;  2VC1 A;  2TCT A;  3JRG A;  2VQG A;  2K9M A;  5CVJ A;  2H8R A;  1WZ2 A;  1ZG5 A;  2DU9 A;  3Q0V A;  2H6B A;  3MKY B;  1T0F A;  1VI0 A;  4UUT A;  3Q0U A;  3I64 A;  3COA C;  1TL8 A;  1JI8 A;  1XS9 A;  2E2J J;  4Y33 A;  4OMY A;  1XMX A;  2E1M C;  2FNP A;  4RGS A;  5FRN A;  4G8X A;  2Z33 A;  2A5W A;  2DMQ A;  2MW8 A;  3QOD A;  1Y0N A;  3A0H C;  2JVH A;  5IP6 A;  3HOX J;  2E35 A;  3E1S A;  5FFX A;  3GEZ A;  4KIF A;  3S8P A;  1LE8 B;  1OYI A;  4RLF A;  3R61 A;  5JVT A;  3H9J A;  3S2W A;  2KJB A;  4NUB A;  4LG0 A;  4LLL A;  4G7H F;  2X48 A;  5GAD J;  2LVS A;  5FD5 A;  2P7V B;  5DUI A;  2ADU A;  4Y17 A;  1QZY A;  2A6H F;  4L0Z B;  3IKV A;  4M72 A;  1HLV A;  1FT9 A;  3WU0 A;  5KAI C;  5A2Q K;  4M74 A;  2ELH A;  4KT6 A;  4BXX J;  1Z0X A;  1OCO H;  9ANT A;  1WHU A;  4P9F A;  1ZAR A;  4IRI A;  1Z67 A;  3QOE A;  4XKV A;  1UB9 A;  3P9I A;  1PP8 F;  2HOT A;  1W5S A;  5EYR A;  3D1N I;  3E6M A;  1EJ9 A;  1IRZ A;  1X1C A;  3QPT A;  1PUF B;  3RKY A;  4GDF A;  5DD8 A;  1JTX A;  1MMN A;  1TWC J;  2XB0 X;  1Z7U A;  4EGZ A;  4HSR A;  3K4B A;  1Z3Y A;  3IRQ A;  3CQZ J;  3J7Z I;  2IAI A;  4CGZ A;  1W1W E;  2ZC2 A;  3E97 A;  2UV1 A;  4PSX A;  5L3D A;  1VQO I;  1OMI A;  3PUF A;  2GXG A;  2PBI A;  2M7B A;  1UZC A;  5IYD J;  4K2E A;  2UUZ A;  1JJ6 C;  3HOW J;  3KE2 A;  3CZ6 A;  3OIO A;  2X1E A;  4HF1 A;  1VQ6 I;  1SFX A;  2RN7 A;  2L4A A;  2QQA A;  3K4K A;  4WXD A;  1I3A A;  3G73 A;  3BR2 A;  4FQG A;  4RB2 C;  3W3C A;  4WCG A;  2NS0 A;  3LST A;  4R8H A;  2VJ4 A;  1R6R A;  2YU3 A;  1ZRF A;  1X3U A;  2CQQ A;  4IQ4 A;  5CVU A;  2W1O A;  2L3D A;  2BY2 A;  2Y0S A;  2DTZ A;  1B8I A;  2BV6 A;  3LWF A;  2MLG A;  1KA8 A;  4BJ5 C;  3OYI A;  1Z77 A;  2Q2E A;  1VFC A;  3L2W A;  4FAS D;  2KHM A;  2UXX A;  4JQF A;  3M8F A;  3PSF A;  2MG4 A;  3VFZ A;  2PLY A;  1D5V A;  1FP2 A;  3E6D A;  2OQR A;  4DJA A;  2KIS A;  2CFX A;  4XIC A;  2PEX A;  1W5C C;  2X9D A;  1QU3 A;  3WG9 A;  2HYG D;  1VQ7 I;  3BZC A;  4GYG A;  3MFK A;  3H35 A;  1MBH A;  1JUM A;  3DKW A;  1USS A;  1U78 A;  2RAE A;  2VXD A;  1CF7 B;  4RGU A;  2PN6 A;  1MJA A;  2H1K A;  2DT5 A;  2XC7 A;  2L4M A;  2EFO A;  2R5Z B;  1YTY A;  2GAU A;  3BJ6 A;  3MCZ A;  5BPD A;  4RM3 A;  4NQW A;  2RC4 A;  1PYV A;  3WGI A;  3HM5 A;  1A04 A;  1WFX A;  1B72 A;  3OYG A;  2P5L C;  3AKZ A;  2MLK A;  4U0Y A;  2R4G A;  2XSJ C;  4BHP A;  4Y4R A;  3GZ6 A;  4IPA A;  2LLK A;  4KDP A;  1ZG1 A;  4UXN A;  5IP9 J;  4KA4 A;  3CUQ C;  3F3X A;  1QZZ A;  1MMA A;  2WAF A;  5J3L A;  4MQ9 F;  5D5U B;  4XON A;  3ZMS A;  1Z6R A;  2VKV A;  2F4M B;  3AG4 H;  2L2O A;  3F22 A;  3R4K A;  2QBY A;  4Z2Y A;  4LD5 A;  4BY7 J;  3ZN1 A;  3WTS C;  1F4K A;  5IYB J;  4KIC A;  4CCJ A;  1IRX A;  5M3M J;  1TT0 A;  2JTV A;  1YO5 C;  2HOS A;  3OWT A;  3PQK A;  3BDD A;  2HPM A;  3D5L A;  3UR3 C;  1IV8 A;  4I2O A;  4C3J J;  1RR8 C;  3MKW B;  2H1L A;  2QVO A;  5D4S A;  2HDW A;  1SFE A;  3W6K B;  3KP6 A;  1WH7 A;  1KU2 A;  1O3T A;  3T0Y A;  3MKZ A;  2B63 J;  3CF5 F;  1BOA A;  2L7M P;  4BH9 A;  3CUQ B;  3ZMU A;  1U3E M;  1EH8 A;  2IS4 A;  3FXK A;  4ANJ A;  2Z9O A;  3KYC B;  5LRS A;  2M5W A;  4ZH4 F;  1O57 A;  1LEA A;  3L09 A;  4BQA A;  1S72 I;  3DBL B;  2K86 A;  1B9M A;  2CV2 A;  1LFP A;  1KQ0 A;  1VQM I;  1HCR A;  3BWG A;  1MD0 A;  3GTL J;  5CLS A;  2O3F A;  2RKH A;  2GQQ A;  2X6Y A;  3FZV A;  4EGY A;  2PJR A;  1WKM A;  1U8B A;  3AFH A;  3VYT B;  1MBG A;  2DK8 A;  2O7O A;  1ZG3 A;  3ZGK A;  4BE2 A;  2XRL A;  4ITV A;  2XVC A;  4I01 A;  5LHG A;  1JGG A;  5GAH J;  3TED A;  3RDI A;  3HGG A;  3S3M A;  2XAH A;  4ZYH A;  5E79 C;  5ILU A;  4A6D A;  4X1E A;  3MKL A;  5D5W B;  2KIU A;  3Q9V A;  4MO7 A;  2B0L A;  4NC7 A;  4NBQ A;  3KFW X;  2OZ6 A;  2Z2S B;  2CSO A;  2PMH A;  4XL9 A;  1MSE C;  2VT2 A;  1DPR A;  4XRS A;  2DT7 B;  2P5V A;  2Y75 A;  3HOT A;  2M1B A;  2VJI A;  4JX5 A;  2OD5 A;  2LNB A;  3ABU A;  5JFR A;  2M0M A;  2KP6 A;  1X2N A;  3LSM A;  3W6J B;  5DV5 A;  5K7F A;  2YSR A;  5GAG J;  4IHX A;  4Q5S F;  1VF9 A;  2XKO A;  2R7D A;  4E7L A;  2Y69 H;  1PJR A;  3FF5 A;  2EB7 A;  3A02 A;  1E0E A;  1FC3 A;  4LG0 B;  4U7B A;  3VDX A;  3BPV A;  1YW7 A;  3GWZ A;  2VBX A;  5B1A H;  4XLP F;  3RZO J;  3W2V A;  3CP8 A;  1LE8 A;  3LA3 A;  2DPD A;  3ZQH A;  4ZYE A;  1W7P D;  1UST A;  2BGC A;  3S1R J;  1QVT A;  2CO5 A;  4U7D A;  1D3Y A;  2FQ4 A;  3CCV I;  5IPA A;  4IHT A;  5J4Y A;  2FOW A;  2JUC A;  2WAQ A;  2F4I A;  2M0C A;  4D0P A;  4D7M A;  1T98 A;  4P5O A;  3BG9 A;  3I4P A;  1REP C;  2ZO4 A;  1HOM A;  1JUS A;  4A93 J;  2CMP A;  4ZTF A;  1LJ9 A;  4C2T A;  5EG0 A;  4EMS A;  2GOM A;  2W24 A;  1OPC A;  3K1P A;  3P7N A;  1YJW I;  5J4V A;  3K0L A;  1OKR A;  2CS3 A;  1BM9 A;  1YOV B;  4M3B A;  4J19 A;  5FLM J;  1LPQ A;  6PAX A;  5D4R A;  4M3E A;  2PJP A;  4A12 A;  2WB1 A;  1RUO A;  5ICE A;  3QP6 A;  2W25 A;  4Q47 A;  5HNH A;  5CYV A;  4UNO A;  3GTQ J;  2OTJ I;  4Y52 J;  1I3Q J;  3JRH A;  1IN4 A;  1FYL A;  3NQO A;  1TQM A;  1S3J A;  2VJJ A;  4FIS A;  4G6D A;  3CCJ I;  1ETO A;  3FBI B;  3ZQQ A;  4MQV A;  4CYC B;  4XLF A;  2EZI A;  1IJW C;  1O3R A;  3FIW A;  5HNF A;  1ETK A;  3TBI A;  3R60 A;  1M1E B;  3RQI A;  1EF4 A;  1HKQ A;  1HXD A;  1DDN A;  5BOX A;  1W7P B;  1MMD A;  3PNY A;  2P4W A;  2WBM A;  2QLZ A;  5M5X J;  1MMS A;  1C0W A;  4CDG A;  1AWC A;  2ZXI A;  1H89 C;  2FUG 2;  1ZQ3 P;  1BBY A;  1FMW A;  1WJ5 A;  2N8G A;  5J1U A;  4HA8 A;  5K5Q A;  1MBF A;  1AKH B;  3DPT A;  3OYN A;  4PGG A;  3H1C A;  3IUO A;  2Q0O A;  4OAY A;  3ZQF A;  1XSV A;  2DFI A;  5EG0 B;  1V54 H;  4ZTJ A;  3BG6 A;  4ON0 A;  4D1Q A;  1SEU A;  1Z9C A;  4G7O F;  3DPU A;  1FOY A;  3ZPL A;  1Z6T A;  4IXA A;  1NK2 P;  4U87 A;  3IL2 A;  1FYM A;  4QLC U;  2A68 F;  3C2G A;  3C1D A;  2HKO A;  4AIK A;  3JRB A;  2F6C A;  5LD2 C;  3G3Z A;  1MND A;  4FET A;  4OIP F;  3K70 D;  5DM6 F;  3BQZ A;  3JR9 A;  2P81 A;  3OL3 A;  5IY5 H;  4IEJ A;  3F6V A;  3MVP A;  2CV1 A;  1WCM J;  3O6B B;  2MYS A;  2D45 A;  2P6T A;  3KZZ A;  3S2D J;  4M6V A;  2OJE D;  3ZQI A;  2F5F A;  2M9H A;  2ZSI B;  4BEH B;  2QA4 I;  3LQQ A;  4FT8 A;  1Z05 A;  2AQF A;  2QGU A;  3KP3 A;  3TGN A;  1UHS A;  4C9Y A;  4WF2 A;  3DEU A;  4QTR A;  3J81 Z;  2FMY A;  5HLT A;  5HLG A;  3HRU A;  1FBS A;  2XUB A;  3MMY B;  2NNY A;  4M6X A;  1VQ8 I;  3DV8 A;  5M5W J;  5F0H A;  5FO5 A;  3E5U A;  3SXY A;  2AQE A;  2JWT A;  3JTH A;  1IO2 A;  3I56 I;  3HJE A;  1G8X A;  2KRC A;  3HG9 A;  1SFU A;  4HZF A;  1KU7 A;  4XLC A;  2O03 A;  4C3I J;  3ESW B;  3H5A A;  3M8E A;  2X6O A;  4HX8 A;  4QSH A;  2DA1 A;  4HDU A;  2TRT A;  1TW3 A;  3I9V 2;  2V9K A;  1ZGA A;  4CCM A;  3M7G A;  3KLO A;  1H88 C;  2FE3 A;  4IHY A;  4UV8 A;  2K4J A;  3H0G J;  3ZOB A;  2ZME A;  3KYD B;  5L3C A;  3RKQ A;  2EJR A;  4OU0 A;  1X2M A;  4WXC A;  2QF7 A;  1XDS A;  4PFO A;  1XGS A;  2XAS A;  5H2F C;  2STW A;  2DBB A;  3DTI A;  3KLN A;  4M6Y A;  1SMY F;  3G1M A;  3L2R A;  2E71 A;  5CJ9 A;  4HQM A;  3A01 B;  2WWY A;  1SMT A;  3G2B A;  1PUF A;  3CCY A;  1GLN A;  2W7N A;  2IGO A;  3K7A J;  3T1B A;  2VBZ A;  1D8K A;  3AL0 B;  3GXO A;  1PUE E;  3S14 J;  5B66 C;  2KZV A;  1YIO A;  3J80 K;  2E34 A;  4KMF A;  1XX5 A;  4E7Z A;  5E20 A;  1MDM A;  4XQF A;  2M87 A;  2W00 A;  1FBU A;  3OR2 C;  2G7H A;  1VZ0 A;  3BJA A;  4H4K C;  4LB6 B;  2HKX A;  4AC0 A;  4XOP A;  1F43 A;  3HOV J;  2M7A A;  1QQI A;  1S7O A;  1SD7 A;  1F1Z A;  2CUF A;  3V7S A;  3CO7 C;  1R4N B;  3A03 A;  2DJI A;  4DYC A;  3RYP A;  1KZH A;  1G2H A;  2K9S A;  3B02 A;  3DBR B;  4HLX A;  1O4X A;  4M3F A;  1TZL A;  3TP0 A;  1IAW A;  5J8C A;  3IC7 A;  4NQW B;  3OYB A;  4I02 A;  3W2W A;  1V5F A;  5CVV A;  4AWX B;  2LKX A;  3LSI A;  3K4L A;  3RSN A;  4M9Z A;  2CH0 A;  1DP7 P;  2OPT A;  4B1R A;  1WJB A;  2DMU A;  5J47 A;  4A2U A;  1FLI A;  4RB0 A;  3OR1 C;  4B43 A;  2WAD A;  4JX4 A;  4A0X A;  4DBR A;  3T8T A;  4G9Y A;  2GIV A;  5KAF C;  1AU7 A;  2UXN A;  1GVJ A;  2VLA A;  1TQP A;  1H0M A;  3QPS A;  5ILS A;  3FBN B;  1HA8 A;  2GOX B;  4AUX A;  4UVA A;  1YFH A;  4D7N A;  1POG A;  2CUZ A;  3KZI C;  1YX3 A;  1BR4 A;  4A3L J;  5K5O A;  3CJT B;  3K6G A;  4B48 A;  3S93 A;  2VE9 A;  4S04 A;  2ZFW A;  3ZR8 X;  3J7A Y;  3CO6 C;  3BR6 A;  2NAZ A;  1P7I A;  1R7J A;  4XMY A;  3O3K A;  2Z99 A;  1T0F C;  3EPZ A;  1P9Q C;  2DOA A;  4LIT A;  2CQK A;  3J81 K;  4G6T B;  1W36 D;  1Y1V J;  2VAS A;  2DYR H;  2F4O B;  2L02 A;  1MNM C;  1SVO A;  2XF5 A;  3H92 A;  4CCL A;  4EJO A;  2X4H A;  4A3I J;  4LOC A;  2LFB A;  4DQ2 A;  4OAZ A;  4XKW A;  3PO2 J;  2H6C A;  1OCT C;  3CDI A;  2BHY A;  3TW7 A;  3IKT A;  3OYC A;  1U8R A;  2R7U A;  1DPU A;  2JA6 J;  1XD7 A;  3ABT A;  4E7I A;  3IH4 A;  1FOW A;  4ESF A;  3P9C A;  4BXU A;  2UZK A;  4G6Q A;  2IXS A;  1JT0 A;  5KNL A;  3O8H A;  1V5E A;  3G1L A;  3CTA A;  4DGW B;  1T8I A;  3GUD A;  2COM A;  3AG1 H;  4NNJ A;  4YEJ A;  4C30 A;  3WTT C;  4B3X A;  2JT1 A;  4XKC A;  1RPW A;  2ESH A;  2VQH A;  4PSW A;  2H27 A;  3QWL A;  1ACI A;  1K78 B;  3PUB A;  3GTK J;  3OMY A;  1T95 A;  4RAZ A;  1ON1 A;  3BR1 A;  2NRA C;  2L0K A;  2AXT C;  3NAU A;  2DDA A;  3JCU C;  2QZ8 A;  3K4N A;  4YFK F;  3WTU C;  3OY9 A;  1X19 A;  5BNG A;  5M5Y J;  3EET A;  2NYX A;  1H9G A;  4EAT A;  3CJN A;  4UB8 C;  1JE8 A;  3CJR B;  1X4P A;  1HBX G;  1UG2 A;  4XRF A;  2DMT A;  5E1X A;  4CZZ A;  4XBF A;  3GTJ J;  2ZJP F;  1I1G A;  4ZDO A;  2G7U A;  1RRJ A;  2ETH A;  3FXU A;  4KT5 C;  2DQR A;  4ABZ A;  3B6C A;  4KN4 X;  2HZT A;  2IRF G;  5FB2 A;  3FXO A;  2NVU B;  2WAQ N;  3K2A A;  1G4D A;  3ZXS A;  1MBJ A;  4L9N A;  4E7S A;  1X1D A;  2GXB A;  1U5T C;  2YPR A;  1I6X A;  1XGO A;  5DEQ A;  3VSL A;  2ZKZ A;  3KEQ A;  4AVP A;  4QPQ A;  1BI2 A;  3U9G A;  3VB2 A;  4FX4 A;  3C7J A;  2LF8 A;  2FBK A;  3EYY A;  4IRG A;  1YIT I;  3I4M J;  2KKO A;  3BP8 A;  4UVB A;  2DI3 A;  3GLX A;  1LVA A;  5J1Y A;  1L0O C;  5HOD A;  3GTG J;  3SYT A;  4EM0 B;  4XLN F;  4ENM A;  3ZQC A;  3N97 A;  2IT0 A;  1GV2 A;  2EIK H;  1GV5 A;  5IT3 A;  2ZME B;  4BNC A;  1JJ8 C;  2QWW A;  3SEQ A;  1IDY A;  1N78 A;  3E6C C;  2WA0 A;  2X1C A;  2ECB A;  1LKX A;  4A6E A;  3KP5 A;  2XRO A;  1NG7 A;  1TTY A;  3F72 A;  1V5G A;  1S6L A;  4D9J A;  4KUM A;  1B1B A;  2EZL A;  5CVR A;  3WTV C;  1F5T A;  2O61 A;  4NB5 A;  1LEB A;  1SFO J;  2LBF B;  5JR3 A;  3AG3 H;  2XAG A;  2PMZ A;  2DW4 A;  1X1P A;  2XPW A;  2R7X A;  3UKG A;  5HDN A;  3M3Y J;  1Y6I A;  1OFC X;  4L18 B;  2M45 A;  4RB3 C;  1OJL A;  2Y9Y A;  2J5P A;  1ODD A;  2JVG A;  3LSG A;  2XAU A;  4A3D J;  1ZLJ A;  2P7C B;  3X2Q H;  1BC7 C;  1RZ4 A;  3MZY A;  4XSX F;  2EBI A;  3GFL A;  2CW7 A;  2HQ5 A;  2ISY A;  4Q48 A;  1R5G A;  3GW2 A;  1X4O A;  1U9O A;  3SFZ A;  3QYE A;  1Y8R B;  2KJC A;  2L7F P;  2JRT A;  4B47 A;  3TO9 A;  2GWR A;  4BHB A;  3CCS I;  1R4M B;  4BU2 A;  4A3K J;  3FKI J;  2YUS A;  1D1B A;  1X1A A;  1FSE A;  1Z1D A;  1HKT A;  3K9T A;  3L9F A;  2RRE A;  4P1W A;  1MMG A;  5F6F A;  2CWE A;  4XN0 A;  2OAZ A;  1BJZ A;  2CU7 A;  1BI3 A;  2DA4 A;  5EJC A;  4D5F A;  2GM4 A;  1MGT A;  1XSD A;  3DEW A;  3ZMV A;  2E2H J;  2IBD A;  4HDV A;  2MBF A;  4RA2 A;  3HHH A;  1OQY A;  2LBF A;  2O5R A;  2W85 A;  3K69 A;  3CCE I;  3OIP A;  4F93 B;  4UUS B;  1B59 A;  2BY0 A;  4CSW A;  1HSJ A;  5AIQ A;  4DIQ A;  4HF2 A;  2VBY A;  3M1C A;  4PJJ A;  1BC8 C;  1R23 A;  3U1K A;  2O8K A;  3I59 B;  3LSH A;  3PSI A;  2HEO A;  2HS5 A;  4U88 A;  2VOO A;  4PJL A;  1MKM A;  4S0H B;  3ZQL A;  1GT0 C;  3CUO A;  5DCM A;  4BY1 J;  2BEO A;  3H3U A;  2DLL A;  4YRV A;  1RC9 A;  3TOB A;  4M9S A;  3FXM A;  4OIR F;  1J9I A;  2COB A;  2X6W A;  5JHF A;  1NK3 P;  1ZHF A;  2ME6 A;  3FK6 A;  4OOI A;  1FNN A;  4R79 A;  3N05 A;  2PI0 A;  1BL0 A;  2LYC A;  2OF7 A;  3MN2 A;  3L2U A;  2DOE A;  3RPU D;  3D5R C;  1MBE A;  4EJW A;  1D8J A;  3S16 J;  3QU3 A;  4A69 C;  1SC7 A;  1OYW A;  5E17 F;  2XV4 S;  1P7J A;  5BPI A;  1FWZ A;  3OYJ A;  3RI4 A;  2LKS A;  4JX6 A;  3ZMZ A;  1MH4 A;  5DUK A;  4BDY A;  2KQR A;  4UB6 C;  1OR7 A;  2K27 A;  3ERE D;  5LRR A;  2EA4 A;  4YII A;  2XGD A;  5EDN A;  5L3E A;  3OIQ A;  2EPF A;  4ZJZ A;  1RES A;  3ISP A;  3DCF A;  1Q1V A;  5GP9 A;  2OQG A;  4AD9 A;  3RIR A;  2VN2 A;  4HRI A;  4CYD A;  1QBJ A;  3W6V A;  1GXQ A;  3L00 A;  1R71 A;  4KIT B;  3K2Z A;  1ZR2 A;  2X51 A;  4AM3 A;  2MGQ A;  2WAE A;  2ZXJ A;  3CJQ B;  2WV0 A;  4YIR X;  1Z3X A;  3QPH A;  5BQT A;  4HNT A;  2VOD A;  1ETX A;  2JJ7 A;  2JRM A;  3D5S C;  1R5H A;  1VQK I;  2Y0S N;  2PQ8 A;  1UEL B;  4BXF A;  3OYH A;  1S7E A;  4LIV A;  3I4N J;  1Y0U A;  3BOQ A;  2IPQ X;  3HSR A;  1FX7 A;  4WK8 F;  2NXN B;  1TT5 B;  5JHU A;  3EUA A;  4M3D A;  4JBA A;  3HOS A;  3EUH A;  4ENN A;  4HYE A;  2A07 F;  3H3Z A;  4M71 A;  5F27 A;  1ZGJ A;  2D5V A;  3KX2 A;  1P4W A;  1ZK8 A;  3RKW A;  1ZKG A;  1W7P A;  1R5I D;  3A1Y A;  3P9K A;  1ZLK A;  3ZMD A;  3ZQ7 A;  1FPQ A;  3ML6 A;  3CC4 I;  2XAJ A;  4D5C A;  1FIA A;  1YW9 A;  4OIN F;  1LDD A;  1VQ9 I;  2BZT A;  3I3L A;  3ULQ B;  4I09 A;  2Y30 A;  1TLH B;  2GA2 A;  3OSF A;  2DA6 A;  2KFD A;  3HPG A;  2RGV A;  4DZJ A;  5E3N A;  2KZG A;  1EA3 A;  4FTH A;  2E5N A;  5JVG F;  1LFB A;  1IN5 A;  3FM5 A;  3HZJ A;  2Y2Z A;  5F1R A;  3VSK A;  3OYF A;  1VND A;  4XNF A;  5F0C A;  3BTL A;  2DMN A;  2ZFU A;  2VPL A;  5IOY A;  4MGR A;  4ZYD A;  3DKY A;  2ACJ A;  2FBH A;  2O6G E;  1O3Q A;  3G1O A;  3PFY A;  1R00 A;  2WC2 A;  5DTD A;  1XG1 A;  3RTR A;  4GGG A;  2KDZ A;  3QAH A;  2EV6 A;  2L9R A;  1IXC A;  1BA5 A;  5CKT A;  1YJ9 I;  4GYI A;  2Z5U A;  3TO7 A;  5ERI A;  2ZXH A;  2XKP A;  1KGS A;  2HI3 A;  3R0J A;  2R7V A;  5H6R A;  1EV7 A;  4UVC A;  3F6O A;  2ISZ A;  1SVL A;  3TDZ C;  2IS6 A;  1CQT A;  5J8F A;  4N4N B;  2HXO A;  4EM2 A;  2F5C A;  1JT6 A;  4KYW A;  2ZB9 A;  2L01 A;  1GXP A;  3VYR B;  3I54 A;  2LRE A;  2D2W A;  1G6N A;  5F04 A;  3J7A O;  2OCC H;  1SAX A;  2HQN A;  4L5I A;  5DCF A;  3V8J A;  1B4A A;  1S7A A;  1DGW Y;  4M73 A;  3WTY C;  2OV7 A;  1LFU P;  2QSF X;  3H36 A;  4BAC A;  1J59 A;  1T38 A;  4YIF A;  2ZNY A;  3OV8 A;  4P55 A;  2Q2E B;  3JW4 A;  3KYL A;  3DXJ F;  2M2E A;  2F5D A;  2OC6 A;  1R58 A;  2XAQ A;  5F64 A;  1YQA A;  1MSF C;  1W5T A;  3WOD F;  1OCC H;  2FF4 A;  2IP2 A;  2E36 A;  2Y0M A;  2HWV A;  1Z91 A;  2MH9 A;  2L7Z A;  2BE5 F;  2HFH A;  3KP2 A;  2Y48 A;  1ORK A;  3TQN A;  5KCM A;  1QPI A;  1ENH A;  4HG2 A;  2XGE A;  1X58 A;  3DF8 A;  4ENJ A;  1B6A A;  4MHG A;  3GBG A;  3U2R A;  3UNG C;  3LAJ A;  3CMA I;  2LRD A;  1P4A A;  2R7T A;  2Y9Z A;  5ICG A;  2R7W A;  3DBH B;  4CIC A;  1J0R A;  3GTM J;  3GO5 A;  3FWE A;  4CO8 A;  4RMN A;  3HSF A;  2CQX A;  5E18 F;  1K4T A;  4Y7N J;  3WTZ A;  3HXL A;  4IHS A;  2RDP A;  4C2U A;  4IKF A;  3TOA A;  1ITY A;  2BY1 A;  4I0B A;  2E60 A;  1TC3 C;  4GCV A;  2VI6 A;  1XMA A;  5EZH A;  4NDL A;  5E3O A;  3ECH A;  5C3E J;  1RKW A;  4EQQ A;  4IRH A;  1T2K A;  2K3P A;  4HEA 2;  1RKT A;  2JPC A;  1XGN A;  1J2X A;  1D1A A;  4Y3O A;  3Q0W A;  2Z16 A;  4LLN A;  5C4X J;  3SJM A;  1W0T A;  3WG7 H;  2DFE A;  4HNU A;  3FMQ A;  4M3G A;  4LG3 A;  3PJR A;  4Y13 A;  5ICF A;  4UY8 I;  1Y8Q B;  1BW5 A;  2FOK A;  2YR2 A;  1DUX C;  2EV0 A;  5CQE A;  4ZC3 A;  4A3B J;  3WGG A;  3M8J A;  5B5E C;  5HLH A;  1LNW A;  2LKP A;  2XIG A;  2CGP A;  2QUF A;  1F36 A;  3CP2 A;  1I1S A;  1U2W A;  1I5Z A;  5FLV A;  2JSP A;  4MNU A;  2RVC A;  4ESB A;  2EV5 A;  2W82 A;  3GF2 A;  4G94 A;  3OSG A;  4XK4 A;  1LUJ B;  1IDZ A;  2M8G X;  3TMO A;  2V4J C;  3VPR A;  4KIG A;  2IGN A;  4Z6Y A;  2CQN A;  3M1E A;  3PM1 A;  4OWR B;  3WGH A;  4MEX F;  2EZH A;  3BR5 A;  2KL4 A;  3PL8 A;  3GX4 X;  1ZH5 A;  2AXL A;  4HW0 A;  1OIS A;  3HUG B;  4O6J A;  1UCR A;  2BBY A;  4ZZD A;  2WY7 Q;  3A0B C;  5GPA A;  2H8W A;  3OS2 A;  2EK5 A;  5EZG A;  4ENK A;  1TBX A;  2E1M B;  3I71 A;  4PFP A;  2DA5 A;  1K7A A;  2NVQ J;  2ID6 A;  2EFW A;  4IOC F;  1APL C;  3PO3 J;  3W2A A;  3K4C A;  4RAG A;  4RM2 A;  3OYM A;  2VPR A;  1P4X A;  5HOO A;  1JKO C;  5ED4 A;  4L5J A;  5FGM A;  4E70 A;  2UWM A;  2DFH A;  3SDB A;  1IRF A;  3LNQ A;  1ZRE A;  2XGX A;  3FKJ A;  4A0Z A;  1DP3 A;  1SD4 A;  2CUJ A;  1A5J A;  2MSY A;  5C4J J;  2PFB A;  3S1M J;  3KP7 A;  1GVD A;  3BLY A;  1XC5 A;  5FRM A;  4BBS J;  3J7Y J;  4AIJ A;  4KIS A;  3NWS A;  1QHG A;  2CG4 A;  2DFF A;  2LY1 A;  2FX0 A;  2KRH A;  5IT9 K;  3FXR A;  4U0W A;  5B1B H;  4BJT A;  4RDU A;  1SAN A;  2OU2 A;  2BXZ A;  4PK4 A;  5E8I A;  3V7R A;  2CQ7 A;  1GUU A;  4J00 A;  4A0Y A;  2FQ3 A;  2E2I J;  4XN3 A;  5BS6 A;  4F92 B;  2W4S A;  2E1O A;  5M3F J;  1R1V A;  4LK1 F;  2LY9 A;  1I39 A;  3JRF A;  1QA6 A;  3IRR A;  3F8M A;  3A4C A;  1I27 A;  1FSH A;  3IWF A;  4E6K G;  3JRE A;  1E3O C;  3WHB A;  3BRO A;  3IP4 B;  2JA7 J;  5JLW A;  1BI0 A;  2NVY J;  1WI3 A;  2A5Y B;  2HPI A;  3DU5 A;  2O8X A;  1JKR C;  3EYI A;  5LLQ A;  3ZMT A;  3KET A;  2PX9 A;  2P0W A;  1LB2 A;  4QPO A;  1FTT A;  3KPH A;  5DCM B;  5KHD A;  3I53 A;  4IO9 F;  4A3J J;  1DQU A;  3OOU A;  3V8L A;  4Q4Z F;  2EZK A;  4CXF A;  2BW3 A;  3OYA A;  1R36 A;  3CLO A;  3E7L A;  5E3M A;  1PP7 U;  2X6X A;  2LH9 A;  2DK5 A;  3BY6 A;  2R93 J;  3CC7 I;  2YX7 A;  4TV7 A;  1V3F A;  2FNA A;  2ZNZ A;  4XM3 A;  2HYF A;  3BG5 A;  3P5J A;  3MAJ A;  5HS8 A;  3RPU A;  3ZRG A;  2KIF A;  2KLO A;  3OL4 A;  5DDG A;  3S32 A;  4QIW N;  4R1H A;  1PDN C;  1AHD P;  1A31 A;  4IL6 C;  3ERM A;  3HRM A;  2YS9 A;  3I0T A;  3AG2 H;  3V8K A;  4FE7 A;  5LEJ A;  4XSZ F;  4BDZ A;  2NS8 A;  3L7W A;  3OOP A;  1MIJ A;  2JSC A;  2MH2 A;  2M4K A;  1FBQ A;  1JHH A;  1K61 A;  2QSG X;  2LD5 A;  4KFC A;  4GFB A;  3V7C A;  4N0B A;  2LF7 A;  2MC3 A;  3RCO A;  3RYR A;  3MEX A;  3D0S A;  5GTI C;  1BI1 A;  1EH7 A;  4IZZ A;  2AHQ A;  5L3B A;  5TRD A;  1LVK A;  2GA1 A;  1Z7L A;  1YYV A;  4HOB A;  2R5Y A;  2RQP A;  3F9K A;  4F3Q A;  2VOP A;  2DOF A;  5IOZ A;  1WVR A;  4P9U A;  1HDD C;  1XB4 A;  1Y1W J;  1HF0 A;  3LA2 A;  4ZYG A;  1KQ8 A;  2DMP A;  2V1N A;  1F9N A;  3T8R A;  4IHV A;  1S9H A;  2EQR A;  2LG4 A;  2NNN A;  1B8I B;  2ZME C;  3DPL C;  3WE2 A;  2E1C A;  4PCQ A;  5L3G A;  1YRN B;  2ZCW A;  4LGW A;  1O7F A;  3VOE A;  1TP4 A;  4YFN F;  5GPC A;  2IW5 A;  3OYK A;  3K10 A;  2HQA A;  3E6B A;  3GZ5 A;  2PG4 A;  4XLE A;  3CDH A;  4HST A;  2NOG A;  4LLG F;  4XLA A;  1ON2 A;  4EJU A;  2CFO A;  1U0J A;  3CD6 I;  4BEH A;  2IS1 A;  1IV6 A;  1HW2 A;  3K1N A;  1IN8 A;  1QHH D;  3WHC A;  4J01 A;  3MD2 A;  3ASO H;  1HW1 A;  3L1P A;  4EJT A;  4A3G J;  3Q5F A;  2L5Q A;  4HV5 A;  4A3C J;  2HVS A;  3ONQ A;  4ZYA A;  2XPV A;  3ROU A;  1ZRC A;  2JN6 A;  1NH3 A;  2HVR A;  3TW6 A;  1XCV A;  2BVM A;  3IH3 A;  4KMU X;  4PUS A;  1LQ1 A;  1XCB A;  2LMD A;  1S8N A;  3F23 A;  1VTN C;  1P6R A;  2F5E A;  4U0V A;  2LR8 A;  3HRT A;  4V19 K;  4ASN A;  2L7K A;  3TDU C;  1IW7 F;  1FYK A;  3FXQ A;  3CES A;  3IV5 A;  2FXA A;  1WJE A;  4O3M A;  5HVQ C;  3WE3 A;  2HYJ A;  5J6X A;  3VYS B;  2XF7 A;  4RGR A;  2K85 A;  2M8E A;  3CMM A;  1AKH A;  3HL2 A;  2E1N A;  2HDD A;  3QYB A;  2R7R A;  2HOA A;  4A5M A;  5AIP A;  1EKE A;  5FFZ A;  5H20 A;  4A3E J;  1JTY A;  5TGT A;  3G71 I;  3BZ6 A;  1W36 C;  2OCE A;  2VKD A;  3HTU A;  4MTE A;  4YG2 F;  1WRJ A;  3JRD A;  3C2H A;  4E7K A;  3F0C A;  4YEL A;  2I5U A;  1YS6 A;  5HLI A;  3SFI A;  2HDC A;  1GDT A;  3IWZ A;  1X3Z B;  2LOO A;  2K40 A;  2D1H A;  1JGS A;  2OA4 A;  3QU6 A;  4A5N A;  4A3M J;  2OTL I;  4M9X A;  1FY7 A;  1UG0 A;  1T56 A;  5IYC J;  2F48 A;  5F1J A;  2ESN A;  1HW5 A;  4YFX F;  3PFI A;  5E1Z B;  1UHM A;  5LEK A;  1U6G A;  5EF6 A;  1J75 A;  1BJA A;  1BIA A;  3L2V A;  1YI2 I;  4LJZ F;  3H5N A;  4BQQ A;  4OIQ F;  2R7S A;  5HS9 A;  1J09 A;  1QGP A;  1YS7 A;  1U9N A;  1ZYR F;  3B6A A;  2XPU A;  1R49 A;  4IHW A;  4AYB A;  3HGY A;  3F8B A;  4IX7 A;  2FBI A;  2ZBK A;  2K5C A;  1XGM A;  3CCQ I;  2VON A;  1LDK B;  2XF6 A;  3S15 J;  3F8C A;  1R22 A;  1XN7 A;  4E7H A;  1WGX A;  3QRF F;  1YIJ I;  5ILV A;  3SZG A;  2QEN A;  5KK1 A;  1TNS A;  3ABK H;  3LSP A;  5LFA A; 
#chains in the Genus database with same CATH homology
 4LK0 F;  1G3W A;  5JI6 A;  4ETS A;  3GVA A;  3WU1 B;  4RB1 A;  2V1X A;  5LBQ A;  4P96 A;  4BHC A;  2XAF A;  4I7H A;  1EH6 A;  2H09 A;  2FRH A;  2P8T A;  2K7L A;  2MA3 A;  5E1W A;  1Q1H A;  2FU4 A;  4L9J A;  2EFQ A;  3F8F A;  2QBY B;  1K6O A;  3NEU A;  4LMY A;  1G3T A;  1T39 A;  2ZJ2 A;  2OZU A;  1K78 A;  1ZN2 A;  3LQR A;  3V4G A;  3ZN0 A;  4GO1 A;  3FMS A;  3HYI A;  3JAM K;  1RNL A;  2QQ9 A;  3MQ0 A;  5EEH A;  3B73 A;  1G3S A;  1W4M A;  3PQJ A;  5CVI A;  5KVR A;  1UHW A;  3N4M A;  2KRF A;  3E5Q A;  2DO7 A;  2DQL A;  2TDX A;  1QO0 D;  3EDP A;  1XSX A;  4LB5 A;  2JZY A;  3DFG A;  4RS8 A;  4H0E A;  2EWN A;  3TO6 A;  1LDJ A;  1FZP B;  2OBP A;  2QYO A;  2HGC A;  4EV0 A;  3QOP A;  5H6Q A;  1TNT A;  5K1Y A;  3HUG A;  2E7W A;  4AIH A;  4WWC A;  4RGX A;  5DYM A;  4HF0 A;  2A69 F;  2QM3 A;  4L0Y B;  2IA0 A;  3F8N A;  1IXS B;  3ECO A;  1TQI A;  5D6F A;  1MJ9 A;  3GFM A;  3R0A A;  1KYZ A;  3BPX A;  3JAM Z;  2GZW A;  4L9T A;  4N9H A;  4DNC A;  3VOD A;  1IUY A;  3JTG A;  4NHJ A;  2HR3 A;  2X0L A;  4KN7 X;  3NRV A;  1YW8 A;  2K02 A;  1XDU A;  2L54 A;  2VC0 A;  1MJB A;  1J5Y A;  3LA7 A;  1E2X A;  2VBW A;  3K1M A;  1IN6 A;  4ESJ A;  1BN5 A;  3E3V A;  3HHG A;  3GFI A;  4WXH A;  4I98 B;  4G7Z F;  1CF7 A;  1YG2 A;  4HX4 A;  5TJJ A;  3SZP A;  2FML A;  4HBL A;  4F7Z A;  3J80 Z;  4HLY A;  2P6S A;  1H9T A;  4MEY F;  2LSO A;  2QQB A;  2H94 A;  1NHA A;  2PMU A;  3LFK A;  2HTJ A;  3QP5 A;  1OYY A;  1STZ A;  3T5X A;  2E7X A;  4PGH A;  3HIF A;  2IA1 A;  5E8G A;  2VXZ A;  3GFJ A;  2V79 A;  3BJO A;  3TKY A;  1RI7 A;  1R1U A;  4FX0 A;  4KNY A;  4UV9 A;  5LGU A;  5BMZ A;  3RJP A;  1BIB A;  3FM3 A;  3HTS B;  1MDM B;  4S05 A;  2EFN A;  5AON A;  1P92 A;  1CGP A;  3I59 A;  5HS7 A;  1JXS A;  3F21 A;  5K5R A;  4EM1 A;  3SHF A;  4UUV A;  1ZAO A;  3SZT A;  1ZRD A;  2RNJ A;  3DQV C;  3IHU A;  1S29 A;  1HQC A;  3O2P E;  2VE8 A;  2DAO A;  1WQ2 A;  1FOK A;  4HQE A;  2AS5 F;  4B09 A;  3RKX A;  5FD6 A;  1B9N A;  2V9V A;  2V1D A;  1SD6 A;  4IJA A;  2C6Y A;  1HST A;  3AAF A;  4L9V A;  4FHT A;  1GHC A;  5D6E A;  2FA5 A;  1UFM A;  1P2F A;  2J5O A;  3ZP5 A;  4PDK A;  1IF1 A;  1ONV A;  4UHT A;  3WTW C;  4MTD A;  1HKS A;  2XRN A;  1L3L A;  1RIO H;  5A2Q Z;  3EQL F;  5D5V B;  2K4B A;  2V1U A;  5L3F A;  1WI9 A;  3C18 A;  1QNT A;  2FSW A;  2W57 A;  3M9A A;  1IN7 A;  3JSO A;  2YX4 A;  2A6E F;  1K79 A;  3MZH A;  3I58 A;  4WX9 A;  3SQN A;  3R6S A;  2R3S A;  2HQR A;  1WWX A;  1KYW A;  1RUN A;  2EFP A;  4GXO A;  3L2C A;  2Q8K A;  2IJL A;  3GYH X;  5FLX Z;  1MZB A;  2HTS A;  2JPB A;  1G3Y A;  3DP7 A;  1T6S A;  4BYY A;  4HAM A;  3KCC A;  2BYV E;  5HDG A;  3Q9S A;  3VEP A;  3I5U A;  1KQ9 A;  2M30 A;  4B8X A;  1O7L A;  2LDU A;  4EJV A;  2G9W A;  4LFU A;  4ZZL A;  4PZJ A;  1TW2 A;  3FHZ A;  2EA2 A;  4OMZ A;  1J7K A;  1O3S A;  3JSP A;  1U5T B;  4RAY A;  4HV6 A;  2MD5 A;  2F2E A;  5D8K B;  3REO A;  5IT9 Z;  5LHH A;  1FP1 D;  3C3W A;  4BAY A;  5LGN A;  3HSE A;  3E5X A;  2KIM A;  1R1T A;  3U1D A;  4IF4 A;  5LGT A;  4CHU A;  5D8L B;  4QWQ A;  1IRG A;  1ULY A;  1U5T A;  2FEZ A;  2W84 A;  4I0A A;  1WSU A;  2IA2 A;  3FX3 A;  2V6C A;  1SD5 A;  2CYY A;  1QPM A;  1YLF A;  2Z3Y A;  4KIB A;  1JHF A;  4Y15 A;  4EVI A;  5ICC A;  5LHI A;  4IVN A;  2STT A;  1XMK A;  3LAP A;  2R7F A;  2WTE A;  2CW0 F;  4O5V A;  2HOE A;  3HRS A;  2O0Y A;  2A3S A;  2RV8 A;  2VT3 A;  3WTX C;  3KP4 A;  2XHK A;  3KZY A;  1V4R A;  5HDK A;  5EEG A;  1KU9 A;  2P5K A;  3KEO A;  2DTR A;  4OIO F;  1AOY A;  3CUQ A;  3ELK A;  1KU3 A;  3MWM A;  4JK1 X;  4N9I A;  5D5X B;  2A61 A;  5DD4 A;  1IZ1 A;  5FLX K;  2D1V A;  3RPQ A;  4HX7 A;  3FMR A;  1E17 A;  2DPU A;  1IXR C;  2IVM A;  2VC1 A;  5CVJ A;  1ZG5 A;  2DU9 A;  2H6B A;  1T0F A;  3I64 A;  3COA C;  4OMY A;  2FNP A;  4RGS A;  4G8X A;  2Z33 A;  5FFX A;  3GEZ A;  4KIF A;  1OYI A;  3R61 A;  5JVT A;  3S2W A;  2KJB A;  4LG0 A;  4LLL A;  4G7H F;  5FD5 A;  2P7V B;  5DUI A;  2ADU A;  4Y17 A;  1QZY A;  2A6H F;  4L0Z B;  3IKV A;  4M72 A;  1FT9 A;  3WU0 A;  5A2Q K;  4M74 A;  2ELH A;  4P9F A;  1ZAR A;  4IRI A;  1UB9 A;  3P9I A;  1PP8 F;  1W5S A;  3E6M A;  3QPT A;  3RKY A;  5DD8 A;  1Z7U A;  4EGZ A;  3IRQ A;  4CGZ A;  3E97 A;  5L3D A;  1OMI A;  2GXG A;  2PBI A;  4K2E A;  3KE2 A;  4HF1 A;  1SFX A;  2RN7 A;  2L4A A;  2QQA A;  4WXD A;  3G73 A;  4RB2 C;  4WCG A;  2NS0 A;  3LST A;  4R8H A;  2YU3 A;  1ZRF A;  1X3U A;  5CVU A;  2L3D A;  2BV6 A;  3LWF A;  2MLG A;  1KA8 A;  2Q2E A;  2UXX A;  4JQF A;  3M8F A;  3VFZ A;  2PLY A;  1D5V A;  1FP2 A;  3E6D A;  2OQR A;  2CFX A;  2PEX A;  3WG9 A;  2HYG D;  4GYG A;  3MFK A;  3DKW A;  1USS A;  1U78 A;  1CF7 B;  4RGU A;  2PN6 A;  1MJA A;  2DT5 A;  2L4M A;  2EFO A;  1YTY A;  2GAU A;  3BJ6 A;  3MCZ A;  5BPD A;  4NQW A;  2RC4 A;  3WGI A;  1A04 A;  2P5L C;  2MLK A;  4U0Y A;  4BHP A;  3GZ6 A;  4IPA A;  4KDP A;  1ZG1 A;  4UXN A;  4KA4 A;  3CUQ C;  3F3X A;  1QZZ A;  5D5U B;  4MQ9 F;  3ZMS A;  1Z6R A;  3F22 A;  3R4K A;  2QBY A;  4Z2Y A;  4LD5 A;  3ZN1 A;  3WTS C;  1F4K A;  4KIC A;  2JTV A;  1YO5 C;  3PQK A;  3BDD A;  3D5L A;  4I2O A;  2QVO A;  5D4S A;  1SFE A;  3W6K B;  3KP6 A;  1KU2 A;  1O3T A;  3T0Y A;  1BOA A;  4BH9 A;  3CUQ B;  1U3E M;  3ZMU A;  1EH8 A;  2Z9O A;  5LRS A;  2M5W A;  4ZH4 F;  1O57 A;  1LEA A;  3L09 A;  4BQA A;  2K86 A;  1B9M A;  1KQ0 A;  3BWG A;  1MD0 A;  5CLS A;  2O3F A;  2RKH A;  2GQQ A;  3FZV A;  4EGY A;  1WKM A;  2DK8 A;  1ZG3 A;  2XVC A;  4I01 A;  5LHG A;  3RDI A;  2XAH A;  4ZYH A;  5ILU A;  4A6D A;  5D5W B;  2KIU A;  3Q9V A;  2B0L A;  3KFW X;  2OZ6 A;  2CSO A;  2PMH A;  2VT2 A;  1DPR A;  2P5V A;  2Y75 A;  3HOT A;  2M1B A;  2OD5 A;  2LNB A;  3ABU A;  5JFR A;  3W6J B;  5DV5 A;  2YSR A;  4Q5S F;  2XKO A;  2R7D A;  3FF5 A;  2EB7 A;  1FC3 A;  4LG0 B;  4U7B A;  3BPV A;  1YW7 A;  3GWZ A;  2VBX A;  4XLP F;  3LA3 A;  2DPD A;  4ZYE A;  1W7P D;  1UST A;  2BGC A;  2CO5 A;  4U7D A;  1D3Y A;  4IHT A;  4D0P A;  1T98 A;  4P5O A;  3I4P A;  1REP C;  2ZO4 A;  1LJ9 A;  4EMS A;  2W24 A;  1OPC A;  3K1P A;  3P7N A;  3K0L A;  1OKR A;  1BM9 A;  6PAX A;  5D4R A;  2PJP A;  4A12 A;  1RUO A;  5ICE A;  3QP6 A;  2W25 A;  4Q47 A;  4UNO A;  5CYV A;  1IN4 A;  1FYL A;  3NQO A;  1TQM A;  1S3J A;  4G6D A;  4MQV A;  1O3R A;  3R60 A;  1HKQ A;  1HXD A;  1DDN A;  5BOX A;  1W7P B;  2P4W A;  2QLZ A;  1C0W A;  4CDG A;  1AWC A;  1BBY A;  5K5Q A;  4HA8 A;  3DPT A;  4PGG A;  2Q0O A;  1XSV A;  2DFI A;  4ON0 A;  1Z9C A;  4G7O F;  3ZPL A;  1Z6T A;  4IXA A;  3IL2 A;  1FYM A;  4QLC U;  2A68 F;  3C1D A;  2HKO A;  4AIK A;  3G3Z A;  4OIP F;  3F6V A;  2D45 A;  3O6B B;  2P6T A;  3KZZ A;  2F5F A;  3LQQ A;  4FT8 A;  1Z05 A;  3KP3 A;  3TGN A;  4WF2 A;  3DEU A;  3J81 Z;  2FMY A;  5HLG A;  3HRU A;  1FBS A;  2XUB A;  2NNY A;  4M6X A;  3DV8 A;  5FO5 A;  3E5U A;  3SXY A;  3JTH A;  1SFU A;  4HZF A;  1KU7 A;  2O03 A;  3M8E A;  4HX8 A;  4HDU A;  1TW3 A;  1ZGA A;  3M7G A;  3KLO A;  2FE3 A;  4UV8 A;  2K4J A;  2ZME A;  5L3C A;  2EJR A;  4OU0 A;  4WXC A;  1XDS A;  1XGS A;  2XAS A;  2STW A;  2DBB A;  3KLN A;  4M6Y A;  1SMY F;  5CJ9 A;  4HQM A;  2WWY A;  1SMT A;  3T1B A;  2VBZ A;  1D8K A;  3GXO A;  1PUE E;  1YIO A;  3J80 K;  4KMF A;  5E20 A;  1MDM A;  2M87 A;  1FBU A;  2G7H A;  4LB6 B;  3BJA A;  2HKX A;  1QQI A;  1S7O A;  1SD7 A;  1F1Z A;  3V7S A;  3CO7 C;  3RYP A;  3B02 A;  4HLX A;  1IAW A;  5J8C A;  3IC7 A;  4I02 A;  5CVV A;  4AWX B;  4M9Z A;  1DP7 P;  4A2U A;  1FLI A;  4RB0 A;  4A0X A;  3T8T A;  4G9Y A;  2GIV A;  2UXN A;  1GVJ A;  1TQP A;  1H0M A;  5ILS A;  1YFH A;  4UVA A;  5K5O A;  2VE9 A;  4S04 A;  2ZFW A;  3CO6 C;  2NAZ A;  1R7J A;  3O3K A;  2Z99 A;  2CQK A;  3J81 K;  2L02 A;  3H92 A;  4EJO A;  2X4H A;  4DQ2 A;  2H6C A;  3IKT A;  1U8R A;  1DPU A;  1XD7 A;  3ABT A;  4ESF A;  3P9C A;  4BXU A;  2UZK A;  4G6Q A;  3CTA A;  3GUD A;  2COM A;  3WTT C;  2JT1 A;  2ESH A;  2H27 A;  1K78 B;  4RAZ A;  1ON1 A;  2NRA C;  2QZ8 A;  4YFK F;  3WTU C;  2NYX A;  3EET A;  1H9G A;  3CJN A;  1JE8 A;  1HBX G;  4XRF A;  5E1X A;  4CZZ A;  4XBF A;  1I1G A;  2G7U A;  2ETH A;  3FXU A;  4KT5 C;  2DQR A;  4KN4 X;  2HZT A;  2IRF G;  5FB2 A;  1G4D A;  4L9N A;  2GXB A;  1U5T C;  2YPR A;  1I6X A;  1XGO A;  5DEQ A;  2ZKZ A;  3KEQ A;  4AVP A;  1BI2 A;  3U9G A;  3VB2 A;  4FX4 A;  3C7J A;  2LF8 A;  2FBK A;  3EYY A;  4IRG A;  2KKO A;  3BP8 A;  4UVB A;  2DI3 A;  3GLX A;  1LVA A;  1L0O C;  4EM0 B;  4ENM A;  4XLN F;  3N97 A;  2IT0 A;  5IT3 A;  2ZME B;  4BNC A;  2QWW A;  3E6C C;  4A6E A;  3KP5 A;  2XRO A;  1TTY A;  3F72 A;  1S6L A;  4KUM A;  1B1B A;  5CVR A;  3WTV C;  1F5T A;  2O61 A;  4NB5 A;  1LEB A;  5JR3 A;  2XAG A;  2DW4 A;  5HDN A;  4L18 B;  2M45 A;  4RB3 C;  2J5P A;  1ODD A;  1ZLJ A;  2P7C B;  1BC7 C;  1RZ4 A;  3MZY A;  4XSX F;  3GFL A;  2ISY A;  4Q48 A;  1R5G A;  3GW2 A;  3SFZ A;  2KJC A;  2JRT A;  3TO9 A;  2GWR A;  4BHB A;  1FSE A;  1Z1D A;  1HKT A;  3K9T A;  3L9F A;  5F6F A;  2CWE A;  2OAZ A;  1BI3 A;  1MGT A;  1XSD A;  3ZMV A;  4HDV A;  2MBF A;  3HHH A;  2W85 A;  3K69 A;  1B59 A;  1HSJ A;  5AIQ A;  4HF2 A;  2VBY A;  1BC8 C;  1R23 A;  3I59 B;  2HEO A;  2HS5 A;  4U88 A;  2VOO A;  1MKM A;  3CUO A;  5DCM A;  2BEO A;  3H3U A;  2DLL A;  3TOB A;  4M9S A;  4OIR F;  1J9I A;  1ZHF A;  2PI0 A;  4OOI A;  1FNN A;  4R79 A;  4EJW A;  1D8J A;  3QU3 A;  1OYW A;  5E17 F;  2XV4 S;  5BPI A;  1FWZ A;  3RI4 A;  3ZMZ A;  5DUK A;  1OR7 A;  2K27 A;  3ERE D;  5LRR A;  2EA4 A;  4YII A;  5L3E A;  3ISP A;  2OQG A;  4AD9 A;  3RIR A;  2VN2 A;  4CYD A;  1QBJ A;  1GXQ A;  3L00 A;  3K2Z A;  2ZXJ A;  2WV0 A;  3QPH A;  5BQT A;  2VOD A;  1R5H A;  2PQ8 A;  1Y0U A;  3BOQ A;  2IPQ X;  3HSR A;  1FX7 A;  4WK8 F;  5JHU A;  4JBA A;  3HOS A;  3EUH A;  4ENN A;  4HYE A;  2A07 F;  3H3Z A;  4M71 A;  1ZGJ A;  1P4W A;  3RKW A;  1ZLK A;  3P9K A;  1W7P A;  3ZMD A;  3ZQ7 A;  1FPQ A;  3ML6 A;  2XAJ A;  1YW9 A;  4OIN F;  1LDD A;  3ULQ B;  4I09 A;  1TLH B;  2GA2 A;  2RGV A;  1IN5 A;  3FM5 A;  5F1R A;  4MGR A;  4ZYD A;  2ACJ A;  2FBH A;  2O6G E;  1O3Q A;  1R00 A;  2WC2 A;  3RTR A;  4GGG A;  3QAH A;  2EV6 A;  1IXC A;  4GYI A;  2Z5U A;  3TO7 A;  5ERI A;  2XKP A;  1KGS A;  3R0J A;  5H6R A;  1EV7 A;  4UVC A;  3F6O A;  2ISZ A;  3TDZ C;  5J8F A;  4EM2 A;  2F5C A;  4KYW A;  2L01 A;  1GXP A;  3I54 A;  2D2W A;  1G6N A;  3J7A O;  1SAX A;  2HQN A;  4L5I A;  5DCF A;  3V8J A;  1B4A A;  1S7A A;  4M73 A;  3WTY C;  1J59 A;  1T38 A;  4YIF A;  2ZNY A;  3OV8 A;  4P55 A;  3JW4 A;  3DXJ F;  2F5D A;  1R58 A;  2XAQ A;  5F64 A;  1YQA A;  1W5T A;  3WOD F;  2FF4 A;  2IP2 A;  2Y0M A;  2HWV A;  1Z91 A;  2MH9 A;  2BE5 F;  2HFH A;  3KP2 A;  2Y48 A;  3TQN A;  3DF8 A;  4ENJ A;  1B6A A;  4MHG A;  3U2R A;  3LAJ A;  1P4A A;  5ICG A;  4CIC A;  1J0R A;  3GO5 A;  3FWE A;  4CO8 A;  3HSF A;  5E18 F;  3WTZ A;  4IHS A;  2RDP A;  3TOA A;  4I0B A;  4GCV A;  1XMA A;  3ECH A;  4EQQ A;  4IRH A;  1T2K A;  2JPC A;  1XGN A;  1J2X A;  4LLN A;  3FMQ A;  4Y13 A;  5ICF A;  2FOK A;  2YR2 A;  1DUX C;  2EV0 A;  3WGG A;  5HLH A;  1LNW A;  2LKP A;  2XIG A;  2CGP A;  2QUF A;  1I1S A;  1U2W A;  1I5Z A;  4MNU A;  2RVC A;  4ESB A;  2EV5 A;  4G94 A;  3GF2 A;  4KIG A;  3M1E A;  3WGH A;  4MEX F;  3GX4 X;  1ZH5 A;  2AXL A;  4HW0 A;  4O6J A;  1UCR A;  2BBY A;  4ZZD A;  2EK5 A;  4ENK A;  1TBX A;  3I71 A;  1K7A A;  2EFW A;  1P4X A;  5HOO A;  5ED4 A;  4L5J A;  5FGM A;  4E70 A;  2UWM A;  1ZRE A;  1IRF A;  2XGX A;  4A0Z A;  1SD4 A;  2PFB A;  3KP7 A;  4AIJ A;  2CG4 A;  5IT9 K;  3FXR A;  4U0W A;  2OU2 A;  5E8I A;  3V7R A;  4A0Y A;  2FQ3 A;  5BS6 A;  1R1V A;  4LK1 F;  3IRR A;  3F8M A;  1I27 A;  1FSH A;  3IWF A;  3BRO A;  1BI0 A;  2A5Y B;  3EYI A;  2O8X A;  5LLQ A;  3ZMT A;  3KET A;  1LB2 A;  5DCM B;  3I53 A;  3V8L A;  4Q4Z F;  4CXF A;  1R36 A;  3CLO A;  1PP7 U;  2DK5 A;  3BY6 A;  2YX7 A;  4TV7 A;  1V3F A;  2FNA A;  2ZNZ A;  2HYF A;  3MAJ A;  5HS8 A;  3RPU A;  2KIF A;  5DDG A;  4R1H A;  1PDN C;  3HRM A;  3I0T A;  3V8K A;  5LEJ A;  4XSZ F;  3L7W A;  3OOP A;  2JSC A;  2MH2 A;  1FBQ A;  1JHH A;  4KFC A;  3V7C A;  4N0B A;  2LF7 A;  2MC3 A;  3RYR A;  3MEX A;  3D0S A;  1BI1 A;  1EH7 A;  5TRD A;  5L3B A;  2GA1 A;  1YYV A;  4HOB A;  2RQP A;  2VOP A;  4P9U A;  1XB4 A;  3LA2 A;  4ZYG A;  1KQ8 A;  1F9N A;  3T8R A;  2NNN A;  2E1C A;  3DPL C;  3WE2 A;  4PCQ A;  5L3G A;  2ZCW A;  4LGW A;  1O7F A;  3VOE A;  4YFN F;  2IW5 A;  3E6B A;  3GZ5 A;  2PG4 A;  3CDH A;  4LLG F;  1ON2 A;  4EJU A;  1HW2 A;  3K1N A;  1IN8 A;  4EJT A;  1HW1 A;  3Q5F A;  4HV5 A;  3ROU A;  1ZRC A;  1XCV A;  4KMU X;  1LQ1 A;  1XCB A;  3F23 A;  1S8N A;  1VTN C;  1P6R A;  2F5E A;  4U0V A;  3HRT A;  4ASN A;  3TDU C;  1IW7 F;  1FYK A;  3FXQ A;  2FXA A;  4O3M A;  5HVQ C;  3WE3 A;  5J6X A;  4RGR A;  2M8E A;  2E1N A;  4A5M A;  5AIP A;  5FFZ A;  5H20 A;  3BZ6 A;  3HTU A;  4MTE A;  4YG2 F;  1WRJ A;  1YS6 A;  5HLI A;  2HDC A;  3IWZ A;  2D1H A;  1JGS A;  2OA4 A;  3QU6 A;  4A5N A;  4M9X A;  1FY7 A;  2ESN A;  1HW5 A;  4YFX F;  3PFI A;  5E1Z B;  1UHM A;  5LEK A;  1U6G A;  1J75 A;  1BJA A;  1BIA A;  4LJZ F;  4OIQ F;  5HS9 A;  1QGP A;  1YS7 A;  1ZYR F;  3F8B A;  2FBI A;  2ZBK A;  1XGM A;  2VON A;  1LDK B;  3F8C A;  1R22 A;  1XN7 A;  3QRF F;  5ILV A;  2QEN A;  5KK1 A;  1TNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...