4GCVA

Structure of a putative transcription factor (pa1374)from pseudomonas aeruginosa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
146
structure length
145
Chain Sequence
CPIARSLERVGEWWSILIMRDALQGLRRFDEFSRSLDIAPNMLTRRLNALVEAGLLERQPYSQRPRYQYVPTAKGEDFRVVLMAFVAWGNRHYAQQGQSVQLVERTSGRPVRSFMAALADGRTVPLEQCTVQAGPAASEEMRQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative transcription protein
publication title The X-ray crystal structure of PA1374 from Pseudomonas aeruginosa, a putative oxidative-stress sensing transcriptional regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 29
structure length 145
sequence length 146
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gcvA00
3GLXA 1S6LA 3V8LA 3HRMA 2OA4A 4FX0A 3WGGA 2ZCWA 5HOOA 2CG4A 3HHHA 4CXFA 4LB6B 3F22A 3WGHA 3EETA 1J9IA 3WTVC 2P6SA 2CWEA 5CVUA 2XAHA 2EB7A 4I09A 3HTSB 1YIOA 4JQFA 2PJPA 1EV7A 2NAZA 1MZBA 1XSDA 3NRVA 2GA2A 2Q0OA 4WXHA 2V1XA 4N0BA 1FOKA 3DV8A 4GYGA 3KE2A 1QGPA 3DEUA 4MEXF 2VT3A 2F5DA 2KKOA 2EA4A 1R7JA 4H0EA 4PDKA 2L01A 2DLLA 4MGRA 2XASA 4Q4ZF 4EM0B 3K0LA 3F8MA 2Z99A 1XSVA 4KN4X 1LDKB 3GXOA 1SFXA 3FM3A 4EMSA 4KUMA 3GUDA 1XB4A 2EFPA 5L3BA 5BS6A 2P5LC 4M6YA 2GAUA 3LA2A 3R6SA 2FBIA 2G9WA 5FO5A 1LVAA 4CGZA 3CO6C 3IWZA 2VOPA 2VBZA 2QVOA 1VTNC 4G9YA 1XCVA 3IKVA 4RS8A 2W24A 5FLXZ 3QP5A 1LEBA 4L5IA 3RPUA 3ULQB 1SD4A 3SZTA 2FMLA 4O3MA 2DT5A 5CYVA 4RB3C 2NNYA 1H9TA 4UNOA 2IA1A 4M74A 1C0WA 2M87A 4P55A 3KFWX 1JHHA 4OINF 5BPIA 2X0LA 3RKYA 4LLNA 2GQQA 1DPRA 3P9IA 4EJUA 1YS7A 4EM1A 3T1BA 1B59A 2FMYA 4XSXF 4WF2A 1G3YA 2ZNZA 3I4PA 1F9NA 3KZZA 5HDNA 2Z33A 1ZREA 3ECOA 1BBYA 5FFXA 2KIFA 3GZ5A 1UHMA 1O3QA 5LHGA 1OKRA 2ZFWA 2CYYA 1U78A 1HSJA 4NHJA 1DP7P 5J6XA 2GXBA 3I53A 1QZZA 5JFRA 3DPTA 4XLNF 2BE5F 2MLGA 4I0BA 3CJNA 4BXUA 1LNWA 4HA8A 1XN7A 3DXJF 4IJAA 1FNNA 2F5EA 3M9AA 3HHGA 2ELHA 1R22A 2QQAA 4Q5SF 2CQKA 3RYPA 2PG4A 2DQRA 4G8XA 2JSCA 1HKQA 5ICCA 3LAPA 2FQ3A 2HKXA 1XDSA 1XD7A 4EJOA 2FOKA 3K9TA 3U9GA 3I59A 3R0AA 4U0YA 4ZYGA 4L9TA 2MH9A 3KP6A 5LLQA 5DD8A 1CF7A 2IW5A 3ZPLA 5HDKA 5H6QA 5E17F 2TDXA 4B8XA 3GO5A 5DUKA 4BH9A 4ON0A 4LK0F 4GO1A 4G94A 3R61A 1FY7A 2M45A 3WTYC 1UFMA 4UHTA 1O3TA 4KIGA 1Q1HA 4KIFA 3E6MA 4IF4A 4RAZA 1FP1D 1HQCA 1F5TA 3GF2A 2DW4A 4UV9A 4MQVA 2PI0A 3DKWA 5D5WB 4ZH4F 4LD5A 5FD6A 1U6GA 4ENNA 2P6TA 2ADUA 4CICA 1GXQA 4OIQF 2IRFG 1TNSA 5DDGA 1IXSB 3PQJA 4MHGA 2Y48A 3EDPA 5E1ZB 4TV7A 3EYIA 4OU0A 2A6HF 2VN2A 5LBQA 2VBYA 1K79A 4JK1X 1CF7B 2KIUA 1IN7A 3IRQA 4AWXB 1TW2A 2DAOA 3KEOA 1FYMA 2D45A 5TRDA 4EGZA 5FD5A 3RDIA 2CGPA 1IN8A 1S8NA 1WI9A 2Z5UA 3ECHA 5D4RA 2JRTA 3P7NA 4YG2F 1XDUA 3M1EA 1OR7A 1TQPA 1XSXA 4UXNA 4XBFA 2CSOA 3KEQA 3JTGA 1MKMA 2W85A 3QPTA 1Y0UA 2LSOA 5K5OA 3KCCA 3F8CA 2QBYA 5CVIA 3F8NA 2RVCA 3CUQB 3TO7A 1BC8C 2GXGA 1BJAA 3IRRA 2PMUA 3R4KA 4F7ZA 3F72A 1J59A 1DDNA 2NNNA 1B6AA 5DCMA 2VT2A 2QLZA 2OBPA 2QUFA 3ZQ7A 3ZP5A 2A3SA 1Z9CA 3GFMA 3NEUA 4LLGF 2ZO4A 3KLNA 2YPRA 3GYHX 3TOBA 3BP8A 2XAGA 4UUVA 2FNAA 5D8LB 1LJ9A 3K1PA 3QPHA 3HTUA 1FSHA 4BHPA 2DQLA 4ENMA 1KQ0A 2VOOA 4YIIA 2GWRA 2UXXA 3R60A 1P4XA 2AXLA 4KMUX 1ON2A 2XRNA 1AOYA 1FC3A 4G6QA 2DK5A 2ZBKA 4NQWA 3D5LA 3BY6A 4CDGA 5D8KB 3F23A 1WRJA 5IT9Z 2MLKA 2L54A 4HQEA 1RIOH 4N9HA 1MDMA 2STTA 2HOEA 4QWQA 1BI1A 1NHAA 2XROA 2KJBA 2YX7A 1XGSA 3P9KA 4M9SA 1IN6A 5IT3A 3GFJA 1I6XA 3GEZA 1K7AA 3ML6A 2HWVA 5H6RA 2DU9A 4IRIA 5D5XB 3HYIA 5LGNA 1G3TA 2QM3A 1BI0A 1SMTA 3T8RA 2HTJA 4JBAA 1P6RA 4LJZF 3Q9SA 1WWXA 3K1MA 3I5UA 1P4AA 5ERIA 2YU3A 1R36A 2ISZA 1IUYA 1B9NA 3EYYA 4M72A 4MTEA 3TOAA 1R00A 3K69A 4A12A 2HS5A 2FA5A 1K78A 2ZJ2A 3U1DA 3F3XA 1YYVA 1YTYA 3BWGA 2DI3A 5ILUA 5F1RA 4OIRF 4IHTA 4RGXA 2C6YA 2FEZA 3SFZA 3E6DA 2NYXA 1EH8A 1H0MA 3BDDA 3L2CA 1PUEE 4HQMA 5EEHA 2OQRA 1MDMB 1T2KA 4RB0A 4GXOA 3LWFA 3MEXA 4U7DA 2VXZA 4O6JA 3HSEA 2G7HA 3WGIA 2VBXA 2EJRA 2QWWA 2XKOA 2HTSA 2HYGD 4I98B 2BV6A 5J8FA 4LG0A 3Q9VA 3ZMSA 2G7UA 4WXCA 2MD5A 1RNLA 3GW2A 3TO6A 2HZTA 3FHZA 1G4DA 4KYWA 5L3EA 1JXSA 4HX8A 5TJJA 1QO0D 4DQ2A 5LGTA 2RN7A 3M8FA 1ODDA 1YW7A 5D6EA 4L9VA 4CZZA 1SD7A 2EK5A 1P2FA 3BJAA 1WSUA 4I2OA 1FLIA 4EJWA 1K78B 2E1NA 4HF1A 4L18B 2WV0A 3FXUA 5BMZA 3H92A 2HR3A 4G7ZF 1KYZA 1XMAA 1LQ1A 3N4MA 1REPC 2IA0A 1PDNC 2K86A 5EEGA 3JSOA 4ZZLA 4L9NA 3E5UA 3N97A 2P5KA 1YFHA 4NB5A 1RI7A 4ZYDA 1XGOA 2XVCA 3V7RA 2DPDA 3GFIA 3ABUA 2H6CA 4LG0B 1WQ2A 2PBIA 4A5NA 4LGWA 4ZYEA 2W84A 2A68F 2K02A 5HLIA 2V79A 2H27A 4G7HF 2QQ9A 4I0AA 1KA8A 4RGUA 3T0YA 2K27A 1LDDA 2BYVE 3FXQA 2K4BA 2DBBA 3GZ6A 1IRGA 2EV0A 2GA1A 2VE9A 4A6DA 4U7BA 4EV0A 3W6KB 4OOIA 3FMSA 5JVTA 4EVIA 4HV5A 2P4WA 2IJLA 2YX4A 5A2QK 1SFUA 1ZRFA 1QBJA 1GHCA 1BI2A 1HW1A 4ESFA 3FXRA 2EA2A 3ZMVA 2FNPA 3HUGA 1FZPB 1OYIA 4KMFA 2EFOA 2P8TA 2P7VB 4U88A 3AAFA 1ZYRF 1QPMA 5CVRA 1O57A 3C7JA 1B4AA 1STZA 3O6BB 3G73A 3TDUC 3FWEA 1S7OA 2XHKA 2HEOA 2HQRA 2VBWA 3J80Z 4MTDA 4PCQA 3SQNA 4A0YA 3JAMK 3MWMA 2YSRA 5JHUA 1KQ9A 2CFXA 2RGVA 1Z7UA 5LEJA 2EFQA 2IA2A 1R5GA 1W7PD 4EM2A 4A5MA 5LEKA 2VC0A 1P92A 1HXDA 2UZKA 1QZYA 2RNJA 4GCVA 1ZGJA 3K2ZA 2MA3A 5ILSA 3HRTA 3MFKA 2FXAA 1IZ1A 2FF4A 4OIOF 3CUQC 4AIJA 4R79A 1MD0A 1U8RA 4IPAA 4A2UA 3WTZA 2BBYA 4BYYA 1YG2A 4KA4A 4P9FA 5JR3A 5CJ9A 3RIRA 3K1NA 2BEOA 3H3ZA 3D0SA 1UB9A 1MGTA 2PMHA 1YW8A 5ED4A 5HLGA 3WTUC 3CUQA 1T38A 1KU7A 3HRSA 2E1CA 4GGGA 3I71A 4QLCU 1USSA 1SFEA 2ETHA 1MJAA 3SHFA 2ZMEA 4RAYA 2P5VA 4ZZDA 2O0YA 1HSTA 1ZN2A 2DK8A 3GWZA 5AONA 5BOXA 2H94A 4OMYA 1JE8A 2HGCA 2GZWA 2O3FA 1CGPA 1PP7U 1JHFA 1SMYF 3R0JA 4HDUA 1JGSA 4S04A 3TGNA 4ENJA 3CUOA 2V6CA 4P5OA 4OIPF 2LF7A 1TTYA 2RQPA 2FU4A 4FHTA 1ZLKA 1KU3A 2FBKA 3MAJA 4A6EA 2CO5A 3IL2A 2DO7A 3E97A 4UV8A 1BIAA 5LRRA 2YR2A 3I64A 3COAC 3RYRA 5FFZA 2RKHA 2UXNA 4A0ZA 4AIKA 1R1UA 4RB2C 3JW4A 5FLXK 5CVJA 2FRHA 4G6DA 4XSZF 2WTEA 1ZG1A 3LQQA 3IC7A 2QENA 4ETSA 4M6XA 4HAMA 2O61A 1FSEA 2PFBA 4ESJA 4HLYA 2XV4S 1G3WA 4MEYF 1P4WA 2R7DA 1IXCA 4UVAA 2ZMEB 1FBQA 1HKTA 3E6CC 1T0FA 3HOTA 4R8HA 4WCGA 2HDCA 5ICGA 1HW5A 2DTRA 1G6NA 2OAZA 1BI3A 4UVBA 3RTRA 4U0VA 1ZRDA 2HFHA 3EQLF 3KP5A 3V7CA 3MQ0A 3IKTA 1HKSA 3PFIA 2MC3A 3I0TA 5KK1A 4IRHA 2W25A 3WTSC 3ROUA 2HKOA 1TLHB 6PAXA 4PGHA 2NS0A 1O3RA 1R5HA 4L0YB 1PP8F 5LHHA 3RI4A 5DUIA 2E7XA 3GFLA 2PEXA 1SAXA 2X4HA 3L7WA 4LFUA 1IRFA 2Z3YA 4A0XA 3W6JB 1BN5A 2IP2A 3WU0A 4Q47A 2PLYA 3LAJA 2V1DA 1TQMA 1L0OC 4U0WA 4EJVA 1U3EM 1FBUA 4KT5C 2IT0A 1E2XA 4IRGA 2M30A 1FYKA 3MCZA 3WE3A 3QAHA 4YFKF 4M9XA 3E6BA 1FWZA 4KDPA 3T5XA 4MQ9F 3DQVC 3WTWC 2K4JA 5HVQC 3G3ZA 3VEPA 1BC7C 4WX9A 1G3SA 1SD6A 4HOBA 1YQAA 1AWCA 1Z6RA 3ZMUA 3WTTC 1IXRC 1YW9A 4HX7A 3B73A 3KZYA 2B0LA 2JPBA 1V4RA 2Y0MA 5KVRA 2A07F 4CYDA 2ZKZA 3F6VA 3ZN0A 2VE8A 5HS7A 3FZVA 3FMQA 1X3UA 2M1BA 3KP2A 3GVAA 3J81K 4ASNA 1FPQA 3DP7A 4LLLA 2ESNA 2DPUA 4P9UA 1I1GA 1OPCA 1ON1A 2W57A 3BROA 2OZ6A 3HRUA 2J5OA 1T6SA 5L3CA 2XAJA 1XCBA 3FF5A 3WODF 3OV8A 1T98A 2XUBA 1I5ZA 3LA3A 1DPUA 3RPQA 4HF2A 3QRFF 1Z6TA 2Y75A 3TKYA 2MBFA 2NRAC 3TDZC 2R7FA 3IWFA 1J0RA 4M73A 2FSWA 5DV5A 1RZ4A 2Q2EA 4KICA 2PQ8A 3E5XA 3WU1B 4UVCA 2JTVA 2FE3A 4WXDA 3O2PE 2LDUA 4HW0A 2KJCA 1GVJA 4HF0A 3MZHA 5E8GA 2VODA 1MJBA 3KETA 5DYMA 2KRFA 2VC1A 1OYWA 3IHUA 3JSPA 1ZLJA 2O8XA 5DCFA 1V3FA 1ONVA 2L3DA 4L5JA 3DPLC 1RUOA 1LB2A 1R58A 1FP2A 3CO7C 1FT9A 3ELKA 4LMYA 3SZPA 2XIGA 5CVVA 4AIHA 1OMIA 3P9CA 1WKMA 5HLHA 4L0ZB 2WWYA 4OMZA 1S7AA 4Y17A 2H6BA 4ENKA 3GX4X 5D4SA 4D0PA 1ULYA 4L9JA 4IVNA 2F5FA 2F2EA 1OYYA 3M7GA 3O3KA 5LRSA 4HYEA 5DEQA 2ISYA 3QOPA 3DF8A 4EGYA 2RV8A 1ZARA 2HYFA 1FBSA 2L4MA 2H09A 1ZAOA 4RGSA 4BHBA 2A5YB 5K5RA 4DNCA 3H3UA 2JPCA 2PN6A 3RKXA 5IT9K 5LGUA 1HW2A 3TQNA 3QP6A 3VB2A 2ZNYA 1U5TC 3ZN1A 4M9ZA 1QQIA 2O6GE 1ZRCA 2A69F 2EFWA 4KFCA 5E1XA 2QYOA 2LNBA 1S3JA 1K6OA 2Q8KA 2OQGA 4ESBA 2ACJA 2EFNA 5FB2A 4IHSA 2LKPA 4YFNF 4IXAA 1U5TA 1W5SA 2STWA 1O3SA 4I7HA 3FMRA 4WK8F 3MZYA 3L00A 5H20A 4RB1A 4Z2YA 1UHWA 2XGXA 1XMKA 3REOA 1KGSA 2M8EA 2QQBA 4HZFA 4FT8A 2DFIA 1IN4A 2OU2A 3V8KA 5AIQA 3F8FA 5LHIA 5K5QA 1O7LA 1SD5A 4PGGA 4RGRA 4EJTA 1YLFA 4GYIA 2JZYA 3Q5FA 1BM9A 3VFZA 2F5CA 2EV5A 2M5WA 4EQQA 3BPXA 2WC2A 5HS9A 3BOQA 4HLXA 1I1SA 1YO5C 3LFKA 1D5VA 2AS5F 3DFGA 3M8EA 2GIVA 5BQTA 3HIFA 1H9GA 1W7PA 4E70A 2COMA 2K7LA 3JTHA 1D8JA 1B1BA 1S29A 3KP3A 1USTA 3ERED 1LDJA 3PQKA 3ZMDA 5F64A 1A04A 1TBXA 1YS6A 4HBLA 4HDVA 5D5UB 3CTAA 1UCRA 3J81Z 3NQOA 3HOSA 1IF1A 2V1UA 1L3LA 4I02A 3F6OA 1U5TB 3V8JA 3FX3A 1Z91A 2E7WA 1ZHFA 1ZG3A 4O5VA 5D5VB 4S05A 3WTXC 3I54A 2QZ8A 3KLOA 5AIPA 3C1DA 5L3DA 2OD5A 4XLPF 4AVPA 3LA7A 4Y13A 3CDHA 2ESHA 2HQNA 5ILVA 1XGMA 3WE2A 1R23A 1HBXG 4Y15A 1ZG5A 3I59B 1MJ9A 4M71A 3L09A 3BJOA 4XRFA 5JI6A 3VOEA 1IW7F 1IAWA 2FBHA 3RKWA 3T8TA 3FM5A 1KQ8A 1W7PB 5E20A 1FYLA 4LB5A 2L02A 3BPVA 4N9IA 3ZMZA 4LK1F 2J5PA 2D1HA 4HV6A 4P96A 2Z9OA 1FX7A 2MH2A 2EWNA 2XAQA 1W4MA 3WG9A 5HDGA 1I27A 4YFXF 2P7CB 1ZGAA 5HS8A 1F4KA 1KYWA 1J2XA 1XGNA 4G7OF 4BHCA 4I01A 3RJPA 1QNTA 1TQIA 2A6EF 5E1WA 3HSFA 5DD4A 5ICFA 4BAYA 3SXYA 4KN7X 2L4AA 3BZ6A 5K1YA 1B9MA 4CHUA 2RDPA 1BIBA 1D3YA 5BPDA 3BJ6A 4HX4A 4ZYHA 2O03A 2JT1A 4Q48A 5E18F 1KU9A 1D8KA 5CLSA 1J75A 2IPQX 3J7AO 5F6FA 4CO8A 3KP4A 5D6FA 1ZH5A 2BGCA 3S2WA 4MNUA 1U2WA 4BQAA 2VONA 3OOPA 4YIFA 1RUNA 4AD9A 1Z1DA 1R1TA 3CLOA 1GXPA 1J7KA 3B02A 5L3FA 3V4GA 5A2QZ 1J5YA 3U2RA 1W5TA 3J80K 3TO9A 2D2WA 3E5QA 2LF8A 1Z05A 3LQRA 3ISPA 3C3WA 3EUHA 4R1HA 2RC4A 3I58A 2KIMA 2A61A 2IVMA 3F8BA 4FX4A 5J8CA 5FGMA 1F1ZA 2QBYB 1E17A 2ZXJA 3V7SA 1EH7A 4KNYA 4B09A 3ZMTA 1BOAA 2UWMA 1O7FA 5ICEA 4PZJA 4WWCA 4BNCA 5L3GA 1DUXC 1TW3A 3QU6A 1IN5A 2V9VA 2OZUA 3LSTA 3E3VA 3L9FA 1LEAA 3VODA 1R1VA 2CW0F 5DCMB 3JAMZ 3QU3A 1KU2A 2D1VA 3C18A 3KP7A 3F21A 3ABTA 3HSRA 4K2EA 4KIBA 2XAFA 2XKPA 1T39A 2EV6A 2R3SA 5E8IA 1TNTA 1EH6A
chains in the Genus database with same CATH superfamily
4XQFA 3GLXA 3HEFA 4CCJA 2KL4A 1WJBA 1S6LA 3V8LA 3HRMA 3HXLA 2OA4A 4FX0A 3WGGA 2ZCWA 1VF9A 2E19A 3M8JA 4FTHA 1ETVA 2L2OA 1YX3A 5GP9A 5HOOA 4I99C 2CG4A 3HHHA 3MKWB 2DA2A 3ZR8X 4CXFA 3CCUI 5FLMJ 4LB6B 3U1KA 2W4SA 4XN3A 1HCRA 3F22A 3WGHA 1K83J 2QSHX 3EETA 4NQWB 3JRIA 2GOMA 4MO7A 1J9IA 1ORKA 4ZYAA 5EGOB 3SYTA 3DKYA 3WTVC 2P6SA 3B6CA 2K9NA 3QYFA 1S9HA 1GLNA 2ZSHB 4DIQA 2CWEA 5CVUA 2KISA 2XAHA 4XONA 3EPZA 2EB7A 4I09A 3HTSB 1YIOA 4JQFA 3OS0A 2PJPA 1EV7A 2NAZA 1MZBA 4RLFA 1U8BA 1XSDA 1IO2A 3NRVA 5B3SH 2GA2A 2Q0OA 4WXHA 4F91B 1V55H 2V1XA 3MKZA 4GFBA 4N0BA 1FOKA 3GTOJ 2HOSA 1OCRH 2UV1A 3DV8A 2F48A 2JVHA 5J3LA 3JRGA 4GYGA 3W3CA 4YIRX 3KE2A 1S72I 1QGPA 3DEUA 4MEXF 4A3GJ 2IGOA 1QHGA 2VT3A 3O8GA 2F5DA 2KPMA 2KKOA 2WAQN 4A3JJ 1RRJA 2KMUA 2EA4A 1YITI 2IXSA 1R7JA 1Y8QB 4Y3OA 5CKTA 2E36A 4H0EA 4PDKA 1NK3P 2R92J 1AKHA 2L01A 2DLLA 4MGRA 2XASA 5TGTA 1P7IA 4Q4ZF 3BT9A 2ME0A 4EM0B 4Y7NJ 3K0LA 3F8MA 2Z99A 2L9RA 1XSVA 4A3BJ 1WHUA 2L7KA 2ZSIB 4KN4X 4IQJA 1LDKB 1IRZA 3MKLA 3MKYB 2VJ5A 5JLXA 4CCMA 3CZ6A 3GXOA 2DDBA 3OIPA 4X6AJ 1SFXA 3FM3A 4FCYA 1XX5A 2I10A 4EMSA 4KUMA 3GUDA 1XB4A 5KAFC 4XLCA 3BR6A 4ZDPA 3OYIA 4PSWA 2L7MP 2EFPA 3BG5A 5L3BA 5BS6A 2HOAA 4KITB 2H8RA 3MZ8A 1HLVA 4BEHA 1JT0A 4IHWA 2K85A 2K9SA 3PM1A 1VQNI 4RAGA 4C3JJ 4N4NB 2P5LC 4M6YA 2GAUA 2ZXIA 1X1AA 1VQPI 2K5CA 3LA2A 3R6SA 2FBIA 2G9WA 1TP4A 5FO5A 1LVAA 4CGZA 3CO6C 2VPRA 3IWZA 4A93J 2VBZA 3ZQLA 2XF5A 2VOPA 1XG1A 2QVOA 1VTNC 1Y6IA 4G9YA 1OJLA 1XCVA 3K4MA 3CJRB 3S14J 3IKVA 1W1WE 2JUCA 4RS8A 2W24A 4CA0A 5FLXZ 2M4GA 3QP5A 2O8KA 2E5NA 1LEBA 4DYQA 3CC2I 4L5IA 3RPUA 1VFCA 5EG0B 3OYDA 3ULQB 1SD4A 3SZTA 2FMLA 4O3MA 5GPAA 2DT5A 1VNDA 1DGWY 5CYVA 4RB3C 3PSIA 3DTKA 2NNYA 1OCOH 3L2UA 1H9TA 4B1RA 1XS9A 4UNOA 2IA1A 4M74A 3X2QH 2W7NA 1U9OA 2L7FP 4X1EA 1C0WA 4IQ4A 2M87A 2Z16A 3FXOA 1Z3YA 2NVYJ 4P55A 3KFWX 1JHHA 1RESA 4OINF 5BPIA 2X0LA 2DXIA 3RKYA 4LLNA 2GQQA 1W0UA 1CQTA 1DPRA 1T95A 3P9IA 1AKHB 4DZPA 4EJUA 3ERMA 1YS7A 4EM1A 1B59A 2FMYA 4XSXF 3T1BA 4WF2A 1G3YA 5F1JA 2ZNZA 3BG9A 3I4PA 5BNGA 1F9NA 3KZZA 1ETWA 3N05A 2R7OA 1AA7A 5HDNA 2Z33A 1ZREA 1JKQC 3L2QA 3ECOA 3TW6A 1BBYA 5FFXA 2KIFA 3OSGA 2AHQA 4HEA2 3GZ5A 2WB1N 5FKMA 4I76A 1UHMA 2Z2SB 1O3QA 3PO3J 1D0YA 5LHGA 4Y33A 4JX6A 1OKRA 2ZFWA 2CYYA 3BR0A 1U78A 1JTYA 4BEHB 2DOEA 1HSJA 1N75A 4NHJA 1JJ8C 1DP7P 5J6XA 2GXBA 3I53A 3JRBA 3BZCA 2VB6A 2E2HJ 1QZZA 4IL6C 2QKLB 5JFRA 4NNJA 2VQLA 3DPTA 2LVSA 3CD6I 5CQGA 2CQQA 3AL0B 4XLNF 3H3VK 3LSKA 2BE5F 2MLGA 2EIKH 4I0BA 2QKMB 3CJNA 4BXUA 3A1YA 2QSGX 5HNHA 1QRYA 1LNWA 2MABA 4B3XA 2X9DA 4HA8A 4ITVA 1XN7A 1UG0A 3DXJF 3PNTA 4IJAA 5J4YA 1FNNA 2LLKA 2F5EA 4XLAA 2ZJRF 2GBYA 3M9AA 3HHGA 2VKDA 2ELHA 3FXJA 1R9TJ 1R22A 3LSJA 2QQAA 4IZZA 4Q5SF 1TWFJ 2CV2A 2CQKA 2P81A 3RYPA 2DODA 2PG4A 3IAM2 5GAGJ 2DQRA 4XIDA 2XF7A 4G8XA 2JSCA 2X1DA 1HKQA 5ICCA 2FQ3A 3LAPA 2HKXA 3I4NJ 1XDSA 1XD7A 4EJOA 3H9JA 5M5WJ 1NG6A 2FOKA 2OJED 3K9TA 3U9GA 3HOXJ 1QA6A 2MC4A 3I59A 4XRMA 2KQRA 4BXFA 2R5YA 3R0AA 4U0YA 2R93J 4ZYGA 2OCEA 1Q1VA 4L9TA 1X4PA 2R5ZA 1FOYA 2MH9A 5J1YA 3KP6A 5K7FA 5LLQA 5DD8A 4E4HA 1OCPA 1CF7A 4P1WA 2IW5A 1FIPA 4F3QA 3ZPLA 4AUXA 5HDKA 5H6QA 1G59A 4QIWN 5E17F 3ABKH 2TDXA 4B8XA 1BW5A 3GO5A 5DUKA 3HM5A 1R71A 3GCMA 2EZIA 4BQOA 4AU7A 4XKWA 4FE4A 3VPRA 4BH9A 4EATA 5KCMA 4CYCB 5FRMA 3CLQA 4ON0A 2QGUA 1M1EB 4LK0F 5J1RA 3MN2A 4GO1A 3G71I 3KYDB 4G94A 2LY1A 3R61A 4N4OB 4BDYA 2IS4A 1FY7A 1V54H 3ZQHA 2M45A 3WTYC 3Q3SA 1UFMA 3PL8A 4UHTA 1O3TA 4KIGA 2Y0SA 1FOWA 4NC6A 1Q1HA 4KIFA 2BHYA 4OWRB 3E6MA 4IF4A 4RAZA 3BCBA 2DFEA 2XGDA 5M3MJ 2EZHA 1FP1D 4ANJA 3K6GA 1HQCA 3HDDA 1F5TA 3GF2A 2DW4A 5HNFA 4A3DJ 2X6YA 5FLVA 4UV9A 4MQVA 2CFOA 2PI0A 3DKWA 5D5WB 3L1PA 4ZH4F 4LD5A 5FD6A 1U6GA 5EF6A 2P6TA 2DMQA 4ENNA 2ADUA 4C2MJ 4CICA 1GXQA 1Y8RB 2IRFG 5GADJ 4OIQF 1TNSA 5DDGA 3S8PA 2VPLA 1IXSB 3PQJA 5IOYA 3JRDA 2LG4A 3HBLA 4MHGA 2Y48A 3EDPA 2LR8A 5E1ZB 4BJ6C 4TV7A 3G6EI 3EYIA 4OU0A 2R5YB 3S1RJ 4ZC3A 1MNDA 2A6HF 3OL3A 5EYRA 3L2RA 3OYMA 3OS2A 2VN2A 5LBQA 2VBYA 1MH4A 1K79A 1OR7C 4JK1X 2E60A 2BY1A 3FXMA 1CF7B 2KIUA 3IH2A 1IN7A 3VSLA 3IRQA 3K4JA 4AWXB 2HZDA 1QZEA 1TW2A 2OF7A 5B5EC 2DAOA 5F0FA 1BJZA 3RQIA 3OYJA 1VQ4I 3KEOA 1FYMA 2D45A 1RETA 3TBIA 4EGZA 5TRDA 5FD5A 3RDIA 2W48A 1IN8A 2CGPA 2HPIA 1UG2A 1S8NA 1WI9A 2Z5UA 1A36A 2MFZA 2E2IJ 5E3OA 2X1CA 1SFOJ 3ECHA 4XOTA 5D4RA 2XGCA 1YHQI 1X58A 4PFOA 2JRTA 3FXLA 3M4OJ 2NS8A 2A6TA 3P7NA 4YG2F 1XDUA 3RZDJ 3M1EA 4DZJA 1OR7A 1TQPA 1XSXA 2JWTA 3IP4B 4UXNA 4C3HJ 3I56I 4XBFA 1H89C 2CSOA 3KEQA 3JTGA 3CCRI 3CCSI 2VKHA 3D5SC 1K61A 3P5JA 1LKXA 1MKMA 2W85A 3QPTA 3SZGA 1Y0UA 4ZDOA 2LSOA 5K5OA 2PJRA 3KCCA 3F8CA 2QBYA 1TT5B 1TWCJ 5CVIA 4E7LA 1Z21A 4Y52J 4DW6A 3F8NA 2JRMA 1QHHD 2RVCA 5K7ZA 3CMAI 1ZQ3P 3ZRGA 3H5NA 3PFYA 4PJMA 3FK7A 3CUQB 4NC8A 3TO7A 2BVLA 1BC8C 4II3A 5KNLA 4D5FA 3A0BC 2GXGA 1BJAA 2HQAA 4BY1J 1S5LC 3IRRA 2PMUA 2CMPA 3S16J 3G1LA 3CMMA 3DEEA 3R4KA 1H88C 1AHDP 2DN0A 4F7ZA 5GTIC 3F72A 2L7ZA 1J59A 1TC3C 1DDNA 3S15J 2BY3A 2VKEA 1YI2I 2NNNA 1B6AA 2ECCA 5DCMA 2VT2A 2QLZA 2OBPA 2QUFA 3ZQ7A 3ZP5A 2A3SA 1UJ8A 1Z9CA 2VQHA 3GFMA 3FIWA 3NEUA 4LLGF 5E3LA 2ZO4A 3LSHA 3KLNA 5C4JJ 2YPRA 3I55I 2DA5A 3HPGA 2HI3A 3WG7H 2KDOA 3GYHX 3TOBA 3BP8A 2XAGA 3K4LA 1I39A 4UUVA 2FNAA 2AQEA 2HVSA 5D8LB 1LJ9A 3K1PA 3KEYA 5J4VA 3QPHA 3HTUA 2BZTA 4BJ5C 4F52A 1FSHA 4BHPA 2DQLA 4ENMA 1KQ0A 2VOOA 1MSFC 4YIIA 2GWRA 4BY7J 2UXXA 3SDBA 5F0HA 1OQYA 3TMOA 3R60A 1P4XA 4MFDA 2AXLA 4KMUX 1ZELA 1ON2A 3HGGA 4XM3A 3DPUA 1MBGA 4MFEA 2XRNA 2JA5J 1AOYA 1FC3A 4G6QA 2R7SA 4CH7A 2DK5A 1UELB 2COBA 2ZBKA 4NQWA 1D0XA 3VYSB 1DQUA 3D5LA 4ZJZA 1QVUA 3BY6A 4CDGA 5D8KB 3DU5A 3F23A 4B44A 1WRJA 3HOZJ 5IT9Z 2MLKA 2L54A 3G1MA 4HQEA 1RIOH 4N9HA 1MDMA 2STTA 2HOEA 2LKSA 4QWQA 1HF0A 4NBQA 3GTLJ 1BI1A 4QPOA 1NHAA 5E3NA 2XROA 4BE1A 2KJBA 1BR1A 2YX7A 3FBIB 1XGSA 3HGYA 1S7EA 1HDDC 1ZR4A 4AM3A 3P9KA 4M9SA 4Z6YA 4IX7A 4RM3A 1IN6A 5IT3A 3GFJA 1I6XA 3OYLA 3CC4I 2X6XA 1P7JA 2DT6A 3GEZA 1Y56A 1K7AA 4YEJA 3KIOA 3ML6A 2HWVA 3BZKA 4XKVA 5H6RA 2DTZA 2DU9A 1VQ7I 4IRIA 1D1BA 5D5XB 3HYIA 3CMYA 5LGNA 3S3MA 1G3TA 2QM3A 1WJCA 2WA0A 2DT7B 1YJNI 1E0EA 2LRDA 2EIJH 1BI0A 1SMTA 3T8RA 1R49A 2HTJA 3KX2A 2QF7A 4JBAA 3OYHA 1MH3A 2KHMA 4IKFA 1P6RA 4LJZF 3Q9SA 3JR9A 1WWXA 3OWTA 3K1MA 3I5UA 1P4AA 2K9QA 5ERIA 3S3OA 4XOPA 3I3LA 2YU3A 3E0JB 1R36A 2ISZA 1IUYA 3M3YJ 3OL4A 1B9NA 3EYYA 4M72A 4MTEA 3TOAA 1R00A 3K69A 3ASOH 2GIZA 4A12A 2HS5A 3CC7I 2FA5A 1K78A 2ZJ2A 2L9NA 3U1DA 3F3XA 2ZC2A 4UUTA 1YYVA 1YTYA 3JRHA 4ZDLA 3BWGA 2DI3A 5ILUA 5F1RA 4OIRF 4IHTA 4RGXA 1XPXA 2C6YA 2FEZA 2DA7A 3SFZA 2EPFA 4MLOA 3RQ4A 4AYBN 5FROA 2LOOA 3E6DA 2NYXA 1EH8A 4XR6A 1YX5A 2KP6A 4RLQA 4DBRA 1H0MA 1H8AC 3RZOJ 1OFCX 3BDDA 3L2CA 1PUEE 4HQMA 5EEHA 2RREA 2WBMA 3PNVA 2LMDA 2OQRA 1MDMB 3PSFA 2EQRA 1T2KA 4RB0A 4GXOA 1N78A 3LWFA 3MEXA 1ZKGA 4U7DA 3S17J 4GDFA 2VXZA 4O6JA 3PNYA 3HSEA 9ANTA 4V19K 4A3EJ 2G7HA 2EILH 3WGIA 2CQ7A 2VBXA 2EJRA 2QWWA 2XB5A 2XKOA 1FIAA 2HTSA 2HYGD 1RPWA 4I98B 4IOCF 1WCMJ 2BV6A 5J8FA 4BDZA 4FASD 4LG0A 5EG0A 4HG2A 3Q9VA 3ZMSA 1ENHA 1ZR2A 2G7UA 3FBNB 4LIVA 4CZCA 2V4JC 3OYBA 2JUGA 3E7LA 4WXCA 3OYAA 2JSPA 3LNQA 3A03A 2MD5A 1RNLA 2OV7A 2I8DA 3GW2A 3TO6A 2HZTA 3V42A 3FHZA 1G4DA 4KYWA 3FKJA 2ZXHA 2HVRA 1T8IA 1FMVA 5L3EA 5J40A 3DBRB 4HX8A 3ESWB 4PK4A 5TJJA 4DGWB 4IHVA 1HOMA 1JXSA 1QO0D 4DQ2A 5LGTA 2RN7A 3M8FA 3H1CA 3LSPA 1ODDA 1YW7A 5D6EA 1Z3XA 4L9VA 4CZZA 1SD7A 2EK5A 1P2FA 2Y69H 3BJAA 4A3LJ 1WSUA 4I2OA 1FLIA 4RM2A 4M3BA 4EJWA 1K78B 5M3FJ 3AL0C 1K4SA 2E1NA 1ETXA 3AG2H 4FISA 4HF1A 4L18B 2CW8A 2WV0A 1DP3A 3FXUA 2VQCA 4RAFA 3RCOA 2VJ4A 4E7HA 4NC7A 1FJLA 5BMZA 1DU6A 3H92A 1IC8A 4OAZA 2HR3A 4G7ZF 4Y4RA 1KYZA 1XMAA 1LQ1A 4FQGA 3HPHA 3N4MA 1REPC 2IA0A 4F55A 2B7EA 3CP2A 4QSHA 1W0TA 1LPQA 1PDNC 2K86A 5EEGA 3JSOA 3C2BA 4ZZLA 3G2BA 5IOZA 4L9NA 3E5UA 3N97A 2P5KA 2JA7J 1YFHA 4NB5A 3OY9A 1RI7A 4ZYDA 1XGOA 2XVCA 1MMNA 3S32A 3V7RA 4ABZA 1NTCA 4BJTA 2DPDA 3GFIA 2LC2A 3ABUA 2ZB9A 2ME6A 1IUFA 4XKBA 4FETA 4DJAA 2H6CA 1D5YA 4LG0B 3JRFA 2VQGA 1WQ2A 2PBIA 4A5NA 4RMNA 1W36D 2BHZA 4LGWA 4ZYEA 2FX0A 2W84A 3QYEA 2A68F 2CUEA 2CV0A 4NUBA 2K02A 5HLIA 2V79A 3BR2A 2H27A 4G7HF 2KZGA 2QQ9A 3HKZN 4I0AA 1KA8A 1ETQA 1VQOI 4RGUA 1TZLA 3T0YA 1VQKI 2K27A 1LDDA 2CQXA 2CUJA 2LYCA 1WJDA 2BYVE 3FXQA 2K4BA 2DOFA 2DBBA 1X4OA 3GZ6A 3UR3C 1IRGA 2EV0A 2F4IA 1D1AA 4HSTA 2GA1A 5HODA 3CP8A 2VE9A 4A6DA 2KLOA 1UHSA 4U7BA 4EV0A 3W6KB 4OOIA 3FMSA 5JVTA 4UUSA 4EVIA 3OYKA 3UKGA 4HV5A 2P4WA 1RKWA 2JJ7A 3H9GA 2IJLA 2DFHA 4JOMA 2YX4A 2F4OB 5A2QK 1SFUA 3PO2J 2CV1A 5IY5H 4XORA 1ZRFA 1QBJA 3AG1H 1GHCA 1BI2A 4XK4A 2M7BA 1HW1A 4ESFA 3FXRA 1JTXA 2EA2A 3ZMVA 2FNPA 3HUGA 4CYCA 1FZPB 1OYIA 4DOZA 4GRIA 4KMFA 3DBHB 1ETOA 1LE8B 2EFOA 2P8TA 1IGNA 2P7VB 4U88A 4G12A 2M0MA 3AAFA 1IRXA 3K4CA 1EJ9A 1ZYRF 1QPMA 5CVRA 3D1NI 2IGNA 1O57A 3C7JA 5JHFA 1B4AA 2H1KA 2DJNA 3WHBA 3J7YJ 3L2VA 2VUMJ 2VJJA 1STZA 3O6BB 1X1DA 3G73A 3TDUC 3FWEA 1A35A 3KYCB 1S7OA 1VQ8I 2X1EA 2XHKA 2HEOA 2HQRA 2XPWA 3H9QA 2VBWA 3J80Z 2E1MB 4MTDA 2NXNB 3H5RA 2KRHA 4PCQA 1SAUA 3SQNA 4A0YA 3JAMK 1UMQA 3GMEA 2VXDA 1GV2A 3MWMA 3UNGC 2YSRA 5JHUA 1KQ9A 2CFXA 2RGVA 3MD2A 2IBDA 1SVOA 2KT0A 3ABMH 1OLTA 1Z7UA 3JRAA 1XC5A 4IHXA 2PMZA 5LEJA 1X19A 4J19A 2EFQA 4PFPA 2IA2A 1R5GA 1W7PD 4D9JA 4EM2A 4E7IA 5HLTA 4A5MA 5LEKA 2VC0A 4II2A 4BBRJ 1P92A 1HXDA 1PVEA 4A69C 1QZYA 2UZKA 2RNJA 4KISA 3VYRB 4UUSB 1BL0A 4CSWA 4GCVA 1JI8A 5EDNA 2QQ8A 1JGGA 1BW6A 2Q1ZB 1ZGJA 3K2ZA 2XC7A 2MA3A 5ILSA 3HRTA 3ZXSA 3MFKA 2FXAA 4BKXA 2IAIA 2JN6A 2OUMA 1IZ1A 1WGXA 3HUGB 2FF4A 1JKRC 4OIOF 2H8WA 2WAEA 1AU7A 3CUQC 4XKCA 4IO9F 4AIJA 5DM6F 1X1PA 4R79A 2E5ZA 3GTPJ 3BG6A 3FKIJ 4CCLA 1MD0A 2WAFA 1U8RA 2ZJQF 4IPAA 2CUFA 5FKKA 4A2UA 4B4CA 4KJZA 2Y2ZA 1O4XA 3WTZA 2LD5A 3OIOA 4BUPA 2Z1DA 2HU9A 2BBYA 2M9HA 1FMWA 4BYYA 2IS1A 1YG2A 2ZMEC 1HDPA 2HDWA 2O5RA 4KA4A 4P9FA 5JR3A 5CJ9A 4BBSJ 3RIRA 2LBFB 1A6QA 3K1NA 4DYCA 3OYCA 2BEOA 1FEXA 3OYGA 3DLLF 3H3ZA 4NDLA 3D0SA 2XB0X 3E1SA 2DYRH 4D7NA 4AYBA 1UB9A 1V5FA 1EA3A 1MGTA 2PMHA 3A0HC 1NG7A 1YW8A 2LFBA 3CJTB 5ED4A 3PJRA 1JUMA 5HLGA 3WTUC 3OR2C 3CUQA 1T38A 1KU7A 3S3NA 4F92B 3HRSA 2E1CA 4GGGA 1TWAJ 1YIJI 3I71A 4QLCU 1USSA 2MYSA 1SFEA 3KZIC 3VYUB 3OSFA 2CU7A 3AG4H 1YJWI 2HXOA 1MBKA 2OPTA 3F0CA 1WZ2A 2ETHA 1MJAA 3SHFA 1JUSA 3ABLH 2ZMEA 3ZQIA 5C44J 4U87A 4RAYA 2P5VA 2WADA 4ZZDA 2CQNA 3K4KA 2O0YA 3CESA 4HNUA 5CQEA 3BQZA 1HSTA 1ZN2A 2DK8A 3GWZA 5AONA 4G6TB 5BOXA 2H94A 4OMYA 1JE8A 1B8IA 3H36A 4QTRA 2HGCA 2GZWA 2O3FA 2KIQA 1RKTA 3HZJA 3OYNA 1CGPA 1PP7U 1MMAA 1JHFA 5IYBJ 1SMYF 3R0JA 4HDUA 2LH9A 1JGSA 2R7UA 2BXZA 3SDGA 4S04A 3TGNA 1V5GA 2WAQA 4ENJA 1B72B 1GVDA 5M5XJ 3CUOA 2V6CA 4P5OA 4OIPF 2BY0A 2LF7A 1TTYA 2RQPA 2FU4A 3H35A 1VQMI 1W5CC 4FHTA 2VJIA 3OR1C 1ZLKA 1KU3A 3K70C 1WFXA 2FBKA 1MMGA 5IP7J 3K4NA 3MAJA 1GT0C 4A6EA 2CO5A 3IL2A 2DO7A 3E97A 4UV8A 5JVGF 2M4KA 4CCKA 4B3AA 4HNTA 1OCZH 1BIAA 5LRRA 2YR2A 3I64A 1TWHJ 3BCAA 3COAC 3RYRA 5FFZA 1I3QJ 2RKHA 2UXNA 4A0ZA 2M8GX 2DYSH 4AIKA 1R1UA 1R4MB 4RB2C 1NH3A 3JW4A 2WY7Q 4JX4A 4M3DA 4XMYA 5CVJA 5FLXK 2FRHA 3IV5A 4G6DA 4XSZF 2R7QA 2E1OA 2WTEA 1ZG1A 1I50J 1Z77A 2NOGA 3LQQA 3IC7A 2QENA 2V1NA 4ETSA 2JVGA 2TRTA 4M6XA 4HAMA 4CUGA 1YJ9I 2R0QC 2O61A 2B9SA 5J1UA 1FSEA 3JCUC 2PFBA 4ESJA 4HLYA 2XV4S 1G3WA 1EF4A 4MEYF 1P4WA 2R7DA 1IXCA 1X2MA 4BS9A 3W2AA 4UVAA 3C2HA 2VIXA 5GAHJ 2MSYA 2DOAA 2ZMEB 1FBQA 1HKTA 1ZK8A 5KHDA 1EH6A 3E6CC 1RC9A 4ZTJA 1T0FA 3HOTA 2MW8A 2BW3A 4R8HA 2GM4A 4UB8C 1N25A 4WCGA 4BE2A 2HDCA 4C2TA 3LSIA 5ICGA 1HW5A 3C2GA 3HB9A 2DTRA 3BG7A 4L5EA 1B8IB 1G6NA 2OAZA 4PJJA 1BI3A 2IS2A 4BGDA 2DFFA 4UVBA 3RTRA 3FDYA 3TP0A 4U0VA 1ZRDA 2HFHA 2M3AA 3EQLF 3KP5A 4X0GA 2HNHA 3V7CA 2DMUA 3MQ0A 1JUPA 3IKTA 1HKSA 1MBEA 3PFIA 2MC3A 3CCLI 3S1NJ 3L2WA 3I0TA 5KK1A 1VQ9I 2V9KA 2K40A 2W25A 4IRHA 3WTSC 3SJMA 3ROUA 2HKOA 1TLHB 4BE0A 3DTIA 4PJ0C 2L9SA 6PAXA 4PGHA 2L0KA 2NS0A 2CRGA 1O3RA 1D0ZA 1R5HA 2CJJA 1U0JA 4XRSG 3AKZA 4L0YB 2F4MB 1PP8F 5LHHA 5FRNA 3RI4A 5FKNA 5DUIA 2E7XA 3GFLA 2PEXA 1SAXA 2X4HA 3BLYA 1HA8A 4E7KA 3HOVJ 1VI0A 3L7WA 3OOUA 5C3EJ 3CCJI 4LFUA 2WB1A 1IRFA 2Z3YA 4A0XA 2HOTA 3OIQA 1WJAA 2K3PA 3W6JB 1BN5A 2IP2A 4A3MJ 3H5AA 3JRCA 2E71A 1WH7A 3WU0A 2HXIA 2JK3A 4Q47A 2HQ5A 1GUUA 5DM7F 2NS7A 3LAJA 2V1DA 1IJWC 2PLYA 3CCMI 1TQMA 1L0OC 4U0WA 3IAS2 3CF5F 3BTLA 4EJVA 1U3EM 2P0WA 2W82A 2DMTA 1FBUA 4KT5C 3O8HA 1R4NB 4XICA 1E2XA 2IT0A 2FD5A 3A2KA 4IRGA 3FXKA 2M30A 1FYKA 3MCZA 3WE3A 3QAHA 4V2GA 4YFKF 4M9XA 3E6BA 1FWZA 3W2VA 4KDPA 2BW3B 3T5XA 1VQ5I 4MQ9F 2W1OA 1TL8A 3DQVC 2Y30A 3WTWC 2K4JA 4W1UA 5B1BH 5HVQC 3G3ZA 3VEPA 1BC7C 3NARA 4J01A 3Q0VA 4WX9A 1SD6A 1G3SA 2XAUA 4HOBA 1YQAA 2VL8A 2FJ1A 1AWCA 1Z6RA 2AO9A 3BG3A 3ZMUA 3WTTC 1IXRC 2KFDA 1YW9A 4HX7A 1Y1WJ 2A05A 3VYTB 3B73A 3KZYA 1BOBA 4HSRA 3HOWJ 2B0LA 3S93A 4XN0A 2JPBA 4RBOA 1V4RA 2ELKA 2Y0MA 5KVRA 1MSEC 2M7AA 2A07F 1OCCH 4CYDA 1WI3A 2ZKZA 3F6VA 2M0CA 3ZN0A 3EUAA 2VE8A 2ELJA 5HS7A 3FZVA 2EZKA 3FMQA 1X3UA 2M1BA 3M1CA 5EZGA 1Z67A 3KP2A 3GVAA 1ZTRA 3J81K 2Y0SN 4XLEA 2HYJA 2O7OA 3BTCA 4ASNA 5M5YJ 3DCFA 2XDVA 1FPQA 3AG3H 3DP7A 1DGRM 1PJRA 3GBGA 4LLLA 3CDLA 4BU2A 2ESNA 2DPUA 4IEJA 4P9UA 1I1GA 5CPRB 1OPCA 1ON1A 2W57A 3NAUA 3BROA 1VQ6I 2OZ6A 5IPAA 3HRUA 3GTMJ 1A6IA 3Q0UA 2J5OA 1IV8A 1T6SA 5L3CA 1UAAA 4J00A 2XAJA 1XCBA 3FF5A 4IHYA 2DMPA 3VSKA 2DJIA 5E3MA 1WJ5A 3WODF 2V7FA 3OV8A 1T98A 2XUBA 1I5ZA 3DU6A 1K4TA 1X3WB 3BC8A 2OC6A 3LA3A 4HPQA 1DPUA 3RPQA 1NK2P 4HF2A 2CS3A 2CW7A 3QRFF 3FHNA 1RR7A 2V26A 1Z6TA 2BOLA 2Y75A 4JX5A 4E6KG 2ZXWH 3TKYA 2ID3A 2VLAA 2R7WA 2MBFA 2M2EA 2NRAC 2IS6A 3TDZC 2R7FA 3IWFA 1J0RA 4M73A 2WY8Q 2FSWA 2RAEA 2JMWA 3HJEA 5DV5A 3ZQQA 3GTQJ 3HC7A 1ETKA 3DLAA 1UZCA 1RZ4A 2Q2EA 4XNFA 4KICA 2PQ8A 3TL4X 3E5XA 3WU1B 4UVCA 2M34A 2JTVA 2FE3A 2F5VA 2LTPA 3BTIA 4WXDA 4V2FA 3O2PE 3DEWA 1TWGJ 2LDUA 1LUJB 4HW0A 5C4XJ 5K7HA 2KJCA 1GVJA 3SEQA 3RPUD 2A5WA 2ID6A 4HF0A 2PX9A 4PUSA 4UY8I 5F04A 3MZHA 2W00A 5E8GA 2VODA 1MJBA 3KETA 5DYMA 2E1MC 1F43A 1HC8A 3CDIA 1YE9A 2K3FA 2KRFA 2VC1A 4D5CA 1LE8A 1OYWA 3IHUA 4LIUA 1ZLJA 2O8XA 2OCCH 3JSPA 3HG9A 3FK6A 5DCFA 4QPQA 3H0DA 2F6CA 3KYLA 4BXXJ 1V3FA 1ONVA 3PIOF 2L3DA 1JJ6C 4L5JA 2V6EA 3DPLC 1RUOA 1LB2A 3NWSA 1R58A 3DBLB 3GTKJ 1E3PA 3BTJA 1FP2A 3CO7C 1FT9A 3ELKA 2AXTC 3QOEA 2FUG2 3BR3A 3K7AJ 4LMYA 1LVKA 3SZPA 1OCTC 2XIGA 3LMMA 1MNMC 1GDTA 5CVVA 2KRCA 4AIHA 2Y9YA 1OMIA 3P9CA 1WKMA 2BVMA 2JA6J 5HLHA 4L0ZB 2WWYA 2QEXI 1X3ZB 4OMZA 1S7AA 4Y17A 2H6BA 4ENKA 1FTZA 1W36C 3GX4X 4A3KJ 5D4SA 2Q2EB 4D0PA 1SEUA 1ULYA 2KDZA 4L9JA 3G4SI 2CH0A 2RNGA 4IVNA 2F5FA 3QPSA 3CMEI 4M3FA 3W6VA 3S2HJ 2TCTA 2F2EA 1OYYA 3K2AA 4LG3A 2E2JJ 3M7GA 3ZCOA 3O3KA 1ACIA 5LRSA 3CCQI 1K6YA 5EJCA 4A3FJ 4HYEA 5GTHC 3JREA 5DEQA 1D1CA 2ISYA 3WU2C 5B66C 3QOPA 3QQAA 3DF8A 2L9VA 3TEDA 4EGYA 2RV8A 1ZARA 2G0EA 2ECBA 2HYFA 2L4MA 2H09A 3FISA 1ZAOA 1WJEA 4RGSA 4BHBA 2A5YB 1T56A 5K5RA 4DNCA 3BR1A 3CCVI 3H3UA 2JPCA 4C30A 2PN6A 2BY2A 3IUOA 3RKXA 5IT9K 4BQQA 2EIMH 2R7XA 3HL2A 2NOJB 2GLOA 2X48A 5LGUA 1HW2A 4A3IJ 3TQNA 4ZTFA 3ZQGA 3I9V2 5KAIC 3QP6A 3VB2A 2ZNYA 2IGMA 1U5TC 3LSGA 4YRVA 2LBFA 3ZN1A 1MBFA 4M9ZA 1QQIA 2O6GE 2DCEA 1ZRCA 4A3CJ 4EEFG 2A69F 2LY9A 3B6AA 2EFWA 4KFCA 4UB6C 1SVMA 1FTTA 2YS9A 1MW7A 2OTJI 5E1XA 1X1BA 2DDAA 2QYOA 4MIMA 3GTJJ 2LNBA 1S3JA 2IGKA 4PSXA 1VZ0A 1K6OA 5LFAA 2Q8KA 4BACA 2OQGA 2QCOA 2LK2A 2EBIA 1SC7A 4DBQA 2ZFUA 2MG4A 4ESBA 2ACJA 5J47A 2EFNA 2QSFX 1PUFA 1YRNA 1MIJA 5FB2A 3CJQB 1Y39A 4IHSA 2LKPA 4YFNF 1Y1VJ 4IXAA 1U5TA 1W5SA 4YELA 4BQNA 2STWA 3W2WA 1O3SA 4I7HA 3FMRA 4WK8F 3MZYA 3L00A 4S0HB 5H20A 5B1AH 4RB1A 4Z2YA 3Q0WA 1UHWA 2O9LA 2XGXA 1XMKA 3REOA 3G1OA 1KGSA 2M8EA 2QQBA 4HZFA 3RKQA 3LOCA 4FT8A 3SEZA 3J7ZI 3A02A 2DFIA 1IN4A 2OU2A 3K10A 3V8KA 5AIQA 1A31A 3HOYJ 3F8FA 5LHIA 5F0CA 1B72A 5K5QA 1J09A 1O7LA 3PIPF 1SD5A 4PGGA 4RGRA 3OYEA 2X6WA 3QODA 1YLFA 4GYIA 4EJTA 2JZYA 3Q5FA 2XPVA 1BM9A 3VFZA 1MBJA 1QPIA 1ITYA 4C3IJ 2F5CA 2EV5A 2M5WA 1LFBA 4EQQA 3BPXA 2WC2A 5HS9A 3BOQA 4HLXA 5DTDA 1KONA 1I1SA 2DA4A 1GV5A 1YO5C 2DA1A 3LFKA 1D5VA 1WH5A 2AS5F 3DFGA 1TT0A 3M8EA 2GIVA 2MGQA 5BQTA 3HIFA 2WV1A 1MNEA 1H9GA 1W7PA 1V5EA 5IP6A 3F9KA 4E70A 3VDXA 2COMA 2FOWA 2XPUA 2K7LA 1WPKA 4HRIA 3JTHA 1D8JA 1B1BA 3QWLA 2V9PA 2BXYA 1S29A 3KP3A 1USTA 3ERED 1LDJA 3PQKA 3ZMDA 5F64A 1A04A 1TBXA 1YS6A 4HBLA 4HDVA 5D5UB 5GAEJ 3CTAA 3CCEI 1UCRA 3J81Z 3NQOA 3HOSA 1IF1A 2V1UA 1PUFB 3ZQFA 1YRNB 1L3LA 4I02A 3QPLA 2HPMA 2GOXB 3F6OA 2LY2A 1LFUP 1U5TB 2XSJC 3V8JA 3ASNH 3FX3A 1BR2A 3M07A 1XTAA 1MMDA 2LREA 1ZGWA 1Z91A 3DKXA 2E7WA 1ZHFA 1ZG3A 2CUZA 3I4MJ 2NVUB 4O5VA 1BA5A 4RA2A 5D5VB 4S05A 3WTXC 3IH3A 3I54A 2QZ8A 3KLOA 5AIPA 3C1DA 1EKEA 1JT6A 2NVQJ 1T33A 2NVTJ 5L3DA 2OD5A 4XLPF 3PUFA 4AVPA 2B63J 3LA7A 4D7MA 4CCOA 4Y13A 3CDHA 2ESHA 2HQNA 3CF2A 5ILVA 1XGMA 3WE2A 5IYDJ 1WJFA 2X6OA 1N77A 3ZGKA 4F93B 3S2DJ 1R23A 1BR4A 4Y15A 3OMYA 1HBXG 2XRLA 1ZG5A 3S1MJ 3I59B 2NVXJ 3HOUJ 1MJ9A 5GPCA 4M71A 3L09A 2VI6A 3SFIA 4PJLA 2R5ZB 1E3HA 3K70D 1I6HJ 3BJOA 4XRFA 2UUZA 1IV6A 2R4GA 5JI6A 2OTLI 1FOXA 3LFUA 3VOEA 2R7ZJ 5IP9J 1R5ID 1IW7F 1IAWA 3LSRA 2YU9J 2FBHA 1WVRA 1MMSA 4DYRA 3RKWA 3T8TA 3FM5A 1SVLA 1KQ8A 2JA8J 1T0FC 5FKOA 1W7PB 5E20A 5EZHA 4D1QA 1FYLA 4LB5A 2L02A 3BPVA 4LITA 4N9IA 3GZNB 1SANA 3ZMZA 4LK1F 5FKLA 2ICWG 2J5PA 2EINH 2D1HA 5F08A 1X2NA 1IDYA 4HV6A 1U9NA 4CCNA 2R7RA 1XMXA 4P96A 4AIDA 1FX7A 3GLLA 2MH2A 2XGEA 2Z9OA 3BR5A 2EWNA 2XAQA 2D5VA 1W4MA 3KPHA 3WG9A 2JA2A 5HDGA 1I27A 4YFXF 2P7CB 1ZGAA 5HS8A 5EEAA 1F4KA 3J7AY 1KYWA 3D5RC 5JLWA 2I5UA 1J2XA 1XGNA 3MVPA 2DA3A 4G7OF 2EH3A 4BHCA 4I01A 3RJPA 1QNTA 1TQIA 2A6EF 5E1WA 1Y0NA 3HSFA 5DD4A 3DTEA 1X1CA 3NWTA 3ZOBA 5DS9A 2YUSA 5ICFA 4BAYA 1VQLI 2IEKA 1IDZA 3SXYA 2LKXA 4KN7X 5E79C 2L4AA 3BZ6A 4M6VA 4JYKA 5K1YA 1B9MA 4CHUA 2RDPA 1DU0A 3VWBA 1BIBA 4PJNA 1KZHA 1D3YA 2N8GA 5BPDA 3EUKL 3HKZA 4RDUA 4AVZA 3BJ6A 3A01A 4OAYA 4HX4A 4FE7A 4ZYHA 1JKOC 5TISC 2LP0A 2O03A 4KT6A 2R7TA 2R7VA 2JT1A 4C9YA 2GXAA 4Q48A 5E18F 1KU9A 2EZLA 1D8KA 1SFKA 5CLSA 1J75A 2IPQX 5H2FC 3J7AO 5F6FA 4CO8A 3KP4A 5D6FA 1G2HA 3EUHC 4BL0B 1ZH5A 3AFHA 2BGCA 3S2WA 4MNUA 1U2WA 3TP3A 1LFPA 4BQAA 4JP0A 4C2UA 2VONA 4W97A 4LOCA 3OOPA 4YIFA 1RUNA 3WHCA 4AD9A 2HVQA 1RR8C 1Z1DA 4HNVA 2VASA 4XRSA 1R1TA 2Y9ZA 3CLOA 1GXPA 3LSMA 3OYFA 5F27A 1IG7A 2X51A 4M3EA 2E35A 3CCYA 3IH4A 1J7KA 3B02A 5L3FA 5IYCJ 3V4GA 5A2QZ 1J5YA 3U2RA 1W5TA 3J80K 3TO9A 4AC0A 2DMNA 4M3GA 2D2WA 3E5QA 2LF8A 1Z05A 3LQRA 2QA4I 1A5JA 3ISPA 3C3WA 3EUHA 1T08B 1OISA 4R1HA 5LD2C 2RC4A 3I58A 1R6RA 2KIMA 2A61A 2IVMA 2AQFA 3F8BA 4FX4A 5J8CA 3MMYB 5EGOA 2VKVA 3CQZJ 5FGMA 1F1ZA 1I3AA 4B47A 5FJ8J 1ERDA 3LL7A 1PYVA 2PJRB 3PUBA 2QBYB 1QU3A 1G8XA 2H1LA 1E17A 3QYBA 2ZXJA 1Z7LA 3V7SA 3K4BA 3S1QJ 1MBHA 3H0GJ 4E7JA 1EH7A 1JKPC 4B09A 4KNYA 3ZMTA 1Z0XA 2HDDA 2E34A 2MD0A 2RQQA 2PMZN 4IOAF 1BOAA 3GTGJ 4I6ZA 2XF6A 2L5QA 3DWLE 4B43A 2UWMA 1ETYA 1O7FA 5ICEA 4PZJA 1APLC 4WWCA 4BNCA 2XSDC 5L3GA 1DUXC 1TW3A 3QU6A 4B48A 1IN5A 2V9VA 2OZUA 3BQYA 3E3VA 3LSTA 3ZQCA 3L9FA 3OS1A 3TW7A 1LEAA 1E3OC 4E7ZA 2FQ4A 3VODA 1R1VA 3A4CA 3A01B 2CW0F 5DCMB 3JAMZ 3QU3A 1KU2A 4XL9A 3U21A 3RSNA 2D1VA 4H4KC 3C18A 3KP7A 4XLFA 3F21A 4E7SA 3ABTA 1POGA 3HSRA 2K9LA 4K2EA 3ONQA 4KIBA 2DA6A 2JQ7A 2XAFA 1P9QC 2XKPA 1QVTA 1YOVB 2ZJPF 1T39A 2EV6A 2K9MA 2X85A 2R3SA 1F36A 4XLHA 5E8IA 2Y31A 1TNTA 2KZVA 1FBSA
chains in the Genus database with same CATH topology
3GLXA 1S6LA 3V8LA 3HRMA 2OA4A 4FX0A 3WGGA 2ZCWA 5HOOA 2CG4A 3HHHA 4CXFA 4LB6B 3F22A 3WGHA 3EETA 1J9IA 3WTVC 2P6SA 2CWEA 5CVUA 2XAHA 2EB7A 4I09A 3HTSB 1YIOA 4JQFA 2PJPA 1EV7A 2NAZA 1MZBA 1XSDA 3NRVA 2GA2A 2Q0OA 4WXHA 2V1XA 4N0BA 1FOKA 3DV8A 4GYGA 3KE2A 1QGPA 3DEUA 4MEXF 2VT3A 2F5DA 2KKOA 2EA4A 1R7JA 4H0EA 4PDKA 2L01A 2DLLA 4MGRA 2XASA 4Q4ZF 4EM0B 3K0LA 3F8MA 2Z99A 1XSVA 4KN4X 1LDKB 3GXOA 1SFXA 3FM3A 4EMSA 4KUMA 3GUDA 1XB4A 2EFPA 5L3BA 5BS6A 2P5LC 4M6YA 2GAUA 3LA2A 3R6SA 2FBIA 2G9WA 5FO5A 1LVAA 4CGZA 3CO6C 3IWZA 2VOPA 2VBZA 2QVOA 1VTNC 4G9YA 1XCVA 3IKVA 4RS8A 2W24A 5FLXZ 3QP5A 1LEBA 4L5IA 3RPUA 3ULQB 1SD4A 3SZTA 2FMLA 4O3MA 2DT5A 5CYVA 4RB3C 2NNYA 1H9TA 4UNOA 2IA1A 4M74A 1C0WA 2M87A 4P55A 3KFWX 1JHHA 4OINF 5BPIA 2X0LA 3RKYA 4LLNA 2GQQA 1DPRA 3P9IA 4EJUA 1YS7A 4EM1A 3T1BA 1B59A 2FMYA 4XSXF 4WF2A 1G3YA 2ZNZA 3I4PA 1F9NA 3KZZA 5HDNA 2Z33A 1ZREA 3ECOA 1BBYA 5FFXA 2KIFA 3GZ5A 1UHMA 1O3QA 5LHGA 1OKRA 2ZFWA 2CYYA 1U78A 1HSJA 4NHJA 1DP7P 5J6XA 2GXBA 3I53A 1QZZA 5JFRA 3DPTA 4XLNF 2BE5F 2MLGA 4I0BA 3CJNA 4BXUA 1LNWA 4HA8A 1XN7A 3DXJF 4IJAA 1FNNA 2F5EA 3M9AA 3HHGA 2ELHA 1R22A 2QQAA 4Q5SF 2CQKA 3RYPA 2PG4A 2DQRA 4G8XA 2JSCA 1HKQA 5ICCA 3LAPA 2FQ3A 2HKXA 1XDSA 1XD7A 4EJOA 2FOKA 3K9TA 3U9GA 3I59A 3R0AA 4U0YA 4ZYGA 4L9TA 2MH9A 3KP6A 5LLQA 5DD8A 1CF7A 2IW5A 3ZPLA 5HDKA 5H6QA 5E17F 2TDXA 4B8XA 3GO5A 5DUKA 4BH9A 4ON0A 4LK0F 4GO1A 4G94A 3R61A 1FY7A 2M45A 3WTYC 1UFMA 4UHTA 1O3TA 4KIGA 1Q1HA 4KIFA 3E6MA 4IF4A 4RAZA 1FP1D 1HQCA 1F5TA 3GF2A 2DW4A 4UV9A 4MQVA 2PI0A 3DKWA 5D5WB 4ZH4F 4LD5A 5FD6A 1U6GA 4ENNA 2P6TA 2ADUA 4CICA 1GXQA 4OIQF 2IRFG 1TNSA 5DDGA 1IXSB 3PQJA 4MHGA 2Y48A 3EDPA 5E1ZB 4TV7A 3EYIA 4OU0A 2A6HF 2VN2A 5LBQA 2VBYA 1K79A 4JK1X 1CF7B 2KIUA 1IN7A 3IRQA 4AWXB 1TW2A 2DAOA 3KEOA 1FYMA 2D45A 5TRDA 4EGZA 5FD5A 3RDIA 2CGPA 1IN8A 1S8NA 1WI9A 2Z5UA 3ECHA 5D4RA 2JRTA 3P7NA 4YG2F 1XDUA 3M1EA 1OR7A 1TQPA 1XSXA 4UXNA 4XBFA 2CSOA 3KEQA 3JTGA 1MKMA 2W85A 3QPTA 1Y0UA 2LSOA 5K5OA 3KCCA 3F8CA 2QBYA 5CVIA 3F8NA 2RVCA 3CUQB 3TO7A 1BC8C 2GXGA 1BJAA 3IRRA 2PMUA 3R4KA 4F7ZA 3F72A 1J59A 1DDNA 2NNNA 1B6AA 5DCMA 2VT2A 2QLZA 2OBPA 2QUFA 3ZQ7A 3ZP5A 2A3SA 1Z9CA 3GFMA 3NEUA 4LLGF 2ZO4A 3KLNA 2YPRA 3GYHX 3TOBA 3BP8A 2XAGA 4UUVA 2FNAA 5D8LB 1LJ9A 3K1PA 3QPHA 3HTUA 1FSHA 4BHPA 2DQLA 4ENMA 1KQ0A 2VOOA 4YIIA 2GWRA 2UXXA 3R60A 1P4XA 2AXLA 4KMUX 1ON2A 2XRNA 1AOYA 1FC3A 4G6QA 2DK5A 2ZBKA 4NQWA 3D5LA 3BY6A 4CDGA 5D8KB 3F23A 1WRJA 5IT9Z 2MLKA 2L54A 4HQEA 1RIOH 4N9HA 1MDMA 2STTA 2HOEA 4QWQA 1BI1A 1NHAA 2XROA 2KJBA 2YX7A 1XGSA 3P9KA 4M9SA 1IN6A 5IT3A 3GFJA 1I6XA 3GEZA 1K7AA 3ML6A 2HWVA 5H6RA 2DU9A 4IRIA 5D5XB 3HYIA 5LGNA 1G3TA 2QM3A 1BI0A 1SMTA 3T8RA 2HTJA 4JBAA 1P6RA 4LJZF 3Q9SA 1WWXA 3K1MA 3I5UA 1P4AA 5ERIA 2YU3A 1R36A 2ISZA 1IUYA 1B9NA 3EYYA 4M72A 4MTEA 3TOAA 1R00A 3K69A 4A12A 2HS5A 2FA5A 1K78A 2ZJ2A 3U1DA 3F3XA 1YYVA 1YTYA 3BWGA 2DI3A 5ILUA 5F1RA 4OIRF 4IHTA 4RGXA 2C6YA 2FEZA 3SFZA 3E6DA 2NYXA 1EH8A 1H0MA 3BDDA 3L2CA 1PUEE 4HQMA 5EEHA 2OQRA 1MDMB 1T2KA 4RB0A 4GXOA 3LWFA 3MEXA 4U7DA 2VXZA 4O6JA 3HSEA 2G7HA 3WGIA 2VBXA 2EJRA 2QWWA 2XKOA 2HTSA 2HYGD 4I98B 2BV6A 5J8FA 4LG0A 3Q9VA 3ZMSA 2G7UA 4WXCA 2MD5A 1RNLA 3GW2A 3TO6A 2HZTA 3FHZA 1G4DA 4KYWA 5L3EA 1JXSA 4HX8A 5TJJA 1QO0D 4DQ2A 5LGTA 2RN7A 3M8FA 1ODDA 1YW7A 5D6EA 4L9VA 4CZZA 1SD7A 2EK5A 1P2FA 3BJAA 1WSUA 4I2OA 1FLIA 4EJWA 1K78B 2E1NA 4HF1A 4L18B 2WV0A 3FXUA 5BMZA 3H92A 2HR3A 4G7ZF 1KYZA 1XMAA 1LQ1A 3N4MA 1REPC 2IA0A 1PDNC 2K86A 5EEGA 3JSOA 4ZZLA 4L9NA 3E5UA 3N97A 2P5KA 1YFHA 4NB5A 1RI7A 4ZYDA 1XGOA 2XVCA 3V7RA 2DPDA 3GFIA 3ABUA 2H6CA 4LG0B 1WQ2A 2PBIA 4A5NA 4LGWA 4ZYEA 2W84A 2A68F 2K02A 5HLIA 2V79A 2H27A 4G7HF 2QQ9A 4I0AA 1KA8A 4RGUA 3T0YA 2K27A 1LDDA 2BYVE 3FXQA 2K4BA 2DBBA 3GZ6A 1IRGA 2EV0A 2GA1A 2VE9A 4A6DA 4U7BA 4EV0A 3W6KB 4OOIA 3FMSA 5JVTA 4EVIA 4HV5A 2P4WA 2IJLA 2YX4A 5A2QK 1SFUA 1ZRFA 1QBJA 1GHCA 1BI2A 1HW1A 4ESFA 3FXRA 2EA2A 3ZMVA 2FNPA 3HUGA 1FZPB 1OYIA 4KMFA 2EFOA 2P8TA 2P7VB 4U88A 3AAFA 1ZYRF 1QPMA 5CVRA 1O57A 3C7JA 1B4AA 1STZA 3O6BB 3G73A 3TDUC 3FWEA 1S7OA 2XHKA 2HEOA 2HQRA 2VBWA 3J80Z 4MTDA 4PCQA 3SQNA 4A0YA 3JAMK 3MWMA 2YSRA 5JHUA 1KQ9A 2CFXA 2RGVA 1Z7UA 5LEJA 2EFQA 2IA2A 1R5GA 1W7PD 4EM2A 4A5MA 5LEKA 2VC0A 1P92A 1HXDA 2UZKA 1QZYA 2RNJA 4GCVA 1ZGJA 3K2ZA 2MA3A 5ILSA 3HRTA 3MFKA 2FXAA 1IZ1A 2FF4A 4OIOF 3CUQC 4AIJA 4R79A 1MD0A 1U8RA 4IPAA 4A2UA 3WTZA 2BBYA 4BYYA 1YG2A 4KA4A 4P9FA 5JR3A 5CJ9A 3RIRA 3K1NA 2BEOA 3H3ZA 3D0SA 1UB9A 1MGTA 2PMHA 1YW8A 5ED4A 5HLGA 3WTUC 3CUQA 1T38A 1KU7A 3HRSA 2E1CA 4GGGA 3I71A 4QLCU 1USSA 1SFEA 2ETHA 1MJAA 3SHFA 2ZMEA 4RAYA 2P5VA 4ZZDA 2O0YA 1HSTA 1ZN2A 2DK8A 3GWZA 5AONA 5BOXA 2H94A 4OMYA 1JE8A 2HGCA 2GZWA 2O3FA 1CGPA 1PP7U 1JHFA 1SMYF 3R0JA 4HDUA 1JGSA 4S04A 3TGNA 4ENJA 3CUOA 2V6CA 4P5OA 4OIPF 2LF7A 1TTYA 2RQPA 2FU4A 4FHTA 1ZLKA 1KU3A 2FBKA 3MAJA 4A6EA 2CO5A 3IL2A 2DO7A 3E97A 4UV8A 1BIAA 5LRRA 2YR2A 3I64A 3COAC 3RYRA 5FFZA 2RKHA 2UXNA 4A0ZA 4AIKA 1R1UA 4RB2C 3JW4A 5FLXK 5CVJA 2FRHA 4G6DA 4XSZF 2WTEA 1ZG1A 3LQQA 3IC7A 2QENA 4ETSA 4M6XA 4HAMA 2O61A 1FSEA 2PFBA 4ESJA 4HLYA 2XV4S 1G3WA 4MEYF 1P4WA 2R7DA 1IXCA 4UVAA 2ZMEB 1FBQA 1HKTA 3E6CC 1T0FA 3HOTA 4R8HA 4WCGA 2HDCA 5ICGA 1HW5A 2DTRA 1G6NA 2OAZA 1BI3A 4UVBA 3RTRA 4U0VA 1ZRDA 2HFHA 3EQLF 3KP5A 3V7CA 3MQ0A 3IKTA 1HKSA 3PFIA 2MC3A 3I0TA 5KK1A 4IRHA 2W25A 3WTSC 3ROUA 2HKOA 1TLHB 6PAXA 4PGHA 2NS0A 1O3RA 1R5HA 4L0YB 1PP8F 5LHHA 3RI4A 5DUIA 2E7XA 3GFLA 2PEXA 1SAXA 2X4HA 3L7WA 4LFUA 1IRFA 2Z3YA 4A0XA 3W6JB 1BN5A 2IP2A 3WU0A 4Q47A 2PLYA 3LAJA 2V1DA 1TQMA 1L0OC 4U0WA 4EJVA 1U3EM 1FBUA 4KT5C 2IT0A 1E2XA 4IRGA 2M30A 1FYKA 3MCZA 3WE3A 3QAHA 4YFKF 4M9XA 3E6BA 1FWZA 4KDPA 3T5XA 4MQ9F 3DQVC 3WTWC 2K4JA 5HVQC 3G3ZA 3VEPA 1BC7C 4WX9A 1G3SA 1SD6A 4HOBA 1YQAA 1AWCA 1Z6RA 3ZMUA 3WTTC 1IXRC 1YW9A 4HX7A 3B73A 3KZYA 2B0LA 2JPBA 1V4RA 2Y0MA 5KVRA 2A07F 4CYDA 2ZKZA 3F6VA 3ZN0A 2VE8A 5HS7A 3FZVA 3FMQA 1X3UA 2M1BA 3KP2A 3GVAA 3J81K 4ASNA 1FPQA 3DP7A 4LLLA 2ESNA 2DPUA 4P9UA 1I1GA 1OPCA 1ON1A 2W57A 3BROA 2OZ6A 3HRUA 2J5OA 1T6SA 5L3CA 2XAJA 1XCBA 3FF5A 3WODF 3OV8A 1T98A 2XUBA 1I5ZA 3LA3A 1DPUA 3RPQA 4HF2A 3QRFF 1Z6TA 2Y75A 3TKYA 2MBFA 2NRAC 3TDZC 2R7FA 3IWFA 1J0RA 4M73A 2FSWA 5DV5A 1RZ4A 2Q2EA 4KICA 2PQ8A 3E5XA 3WU1B 4UVCA 2JTVA 2FE3A 4WXDA 3O2PE 2LDUA 4HW0A 2KJCA 1GVJA 4HF0A 3MZHA 5E8GA 2VODA 1MJBA 3KETA 5DYMA 2KRFA 2VC1A 1OYWA 3IHUA 3JSPA 1ZLJA 2O8XA 5DCFA 1V3FA 1ONVA 2L3DA 4L5JA 3DPLC 1RUOA 1LB2A 1R58A 1FP2A 3CO7C 1FT9A 3ELKA 4LMYA 3SZPA 2XIGA 5CVVA 4AIHA 1OMIA 3P9CA 1WKMA 5HLHA 4L0ZB 2WWYA 4OMZA 1S7AA 4Y17A 2H6BA 4ENKA 3GX4X 5D4SA 4D0PA 1ULYA 4L9JA 4IVNA 2F5FA 2F2EA 1OYYA 3M7GA 3O3KA 5LRSA 4HYEA 5DEQA 2ISYA 3QOPA 3DF8A 4EGYA 2RV8A 1ZARA 2HYFA 1FBSA 2L4MA 2H09A 1ZAOA 4RGSA 4BHBA 2A5YB 5K5RA 4DNCA 3H3UA 2JPCA 2PN6A 3RKXA 5IT9K 5LGUA 1HW2A 3TQNA 3QP6A 3VB2A 2ZNYA 1U5TC 3ZN1A 4M9ZA 1QQIA 2O6GE 1ZRCA 2A69F 2EFWA 4KFCA 5E1XA 2QYOA 2LNBA 1S3JA 1K6OA 2Q8KA 2OQGA 4ESBA 2ACJA 2EFNA 5FB2A 4IHSA 2LKPA 4YFNF 4IXAA 1U5TA 1W5SA 2STWA 1O3SA 4I7HA 3FMRA 4WK8F 3MZYA 3L00A 5H20A 4RB1A 4Z2YA 1UHWA 2XGXA 1XMKA 3REOA 1KGSA 2M8EA 2QQBA 4HZFA 4FT8A 2DFIA 1IN4A 2OU2A 3V8KA 5AIQA 3F8FA 5LHIA 5K5QA 1O7LA 1SD5A 4PGGA 4RGRA 4EJTA 1YLFA 4GYIA 2JZYA 3Q5FA 1BM9A 3VFZA 2F5CA 2EV5A 2M5WA 4EQQA 3BPXA 2WC2A 5HS9A 3BOQA 4HLXA 1I1SA 1YO5C 3LFKA 1D5VA 2AS5F 3DFGA 3M8EA 2GIVA 5BQTA 3HIFA 1H9GA 1W7PA 4E70A 2COMA 2K7LA 3JTHA 1D8JA 1B1BA 1S29A 3KP3A 1USTA 3ERED 1LDJA 3PQKA 3ZMDA 5F64A 1A04A 1TBXA 1YS6A 4HBLA 4HDVA 5D5UB 3CTAA 1UCRA 3J81Z 3NQOA 3HOSA 1IF1A 2V1UA 1L3LA 4I02A 3F6OA 1U5TB 3V8JA 3FX3A 1Z91A 2E7WA 1ZHFA 1ZG3A 4O5VA 5D5VB 4S05A 3WTXC 3I54A 2QZ8A 3KLOA 5AIPA 3C1DA 5L3DA 2OD5A 4XLPF 4AVPA 3LA7A 4Y13A 3CDHA 2ESHA 2HQNA 5ILVA 1XGMA 3WE2A 1R23A 1HBXG 4Y15A 1ZG5A 3I59B 1MJ9A 4M71A 3L09A 3BJOA 4XRFA 5JI6A 3VOEA 1IW7F 1IAWA 2FBHA 3RKWA 3T8TA 3FM5A 1KQ8A 1W7PB 5E20A 1FYLA 4LB5A 2L02A 3BPVA 4N9IA 3ZMZA 4LK1F 2J5PA 2D1HA 4HV6A 4P96A 2Z9OA 1FX7A 2MH2A 2EWNA 2XAQA 1W4MA 3WG9A 5HDGA 1I27A 4YFXF 2P7CB 1ZGAA 5HS8A 1F4KA 1KYWA 1J2XA 1XGNA 4G7OF 4BHCA 4I01A 3RJPA 1QNTA 1TQIA 2A6EF 5E1WA 3HSFA 5DD4A 5ICFA 4BAYA 3SXYA 4KN7X 2L4AA 3BZ6A 5K1YA 1B9MA 4CHUA 2RDPA 1BIBA 1D3YA 5BPDA 3BJ6A 4HX4A 4ZYHA 2O03A 2JT1A 4Q48A 5E18F 1KU9A 1D8KA 5CLSA 1J75A 2IPQX 3J7AO 5F6FA 4CO8A 3KP4A 5D6FA 1ZH5A 2BGCA 3S2WA 4MNUA 1U2WA 4BQAA 2VONA 3OOPA 4YIFA 1RUNA 4AD9A 1Z1DA 1R1TA 3CLOA 1GXPA 1J7KA 3B02A 5L3FA 3V4GA 5A2QZ 1J5YA 3U2RA 1W5TA 3J80K 3TO9A 2D2WA 3E5QA 2LF8A 1Z05A 3LQRA 3ISPA 3C3WA 3EUHA 4R1HA 2RC4A 3I58A 2KIMA 2A61A 2IVMA 3F8BA 4FX4A 5J8CA 5FGMA 1F1ZA 2QBYB 1E17A 2ZXJA 3V7SA 1EH7A 4KNYA 4B09A 3ZMTA 1BOAA 2UWMA 1O7FA 5ICEA 4PZJA 4WWCA 4BNCA 5L3GA 1DUXC 1TW3A 3QU6A 1IN5A 2V9VA 2OZUA 3LSTA 3E3VA 3L9FA 1LEAA 3VODA 1R1VA 2CW0F 5DCMB 3JAMZ 3QU3A 1KU2A 2D1VA 3C18A 3KP7A 3F21A 3ABTA 3HSRA 4K2EA 4KIBA 2XAFA 2XKPA 1T39A 2EV6A 2R3SA 5E8IA 1TNTA 1EH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLX A;  1S6L A;  3V8L A;  3HRM A;  2OA4 A;  4FX0 A;  3WGG A;  2ZCW A;  5HOO A;  2CG4 A;  3HHH A;  4CXF A;  4LB6 B;  3F22 A;  3WGH A;  3EET A;  1J9I A;  3WTV C;  2P6S A;  2CWE A;  5CVU A;  2XAH A;  2EB7 A;  4I09 A;  3HTS B;  1YIO A;  4JQF A;  2PJP A;  1EV7 A;  2NAZ A;  1MZB A;  1XSD A;  3NRV A;  2GA2 A;  2Q0O A;  4WXH A;  2V1X A;  4N0B A;  1FOK A;  3DV8 A;  4GYG A;  3KE2 A;  1QGP A;  3DEU A;  4MEX F;  2VT3 A;  2F5D A;  2KKO A;  2EA4 A;  1R7J A;  4H0E A;  4PDK A;  2L01 A;  2DLL A;  4MGR A;  2XAS A;  4Q4Z F;  4EM0 B;  3K0L A;  3F8M A;  2Z99 A;  1XSV A;  4KN4 X;  1LDK B;  3GXO A;  1SFX A;  3FM3 A;  4EMS A;  4KUM A;  3GUD A;  1XB4 A;  2EFP A;  5L3B A;  5BS6 A;  2P5L C;  4M6Y A;  2GAU A;  3LA2 A;  3R6S A;  2FBI A;  2G9W A;  5FO5 A;  1LVA A;  4CGZ A;  3CO6 C;  3IWZ A;  2VOP A;  2VBZ A;  2QVO A;  1VTN C;  4G9Y A;  1XCV A;  3IKV A;  4RS8 A;  2W24 A;  5FLX Z;  3QP5 A;  1LEB A;  4L5I A;  3RPU A;  3ULQ B;  1SD4 A;  3SZT A;  2FML A;  4O3M A;  2DT5 A;  5CYV A;  4RB3 C;  2NNY A;  1H9T A;  4UNO A;  2IA1 A;  4M74 A;  1C0W A;  2M87 A;  4P55 A;  3KFW X;  1JHH A;  4OIN F;  5BPI A;  2X0L A;  3RKY A;  4LLN A;  2GQQ A;  1DPR A;  3P9I A;  4EJU A;  1YS7 A;  4EM1 A;  3T1B A;  1B59 A;  2FMY A;  4XSX F;  4WF2 A;  1G3Y A;  2ZNZ A;  3I4P A;  1F9N A;  3KZZ A;  5HDN A;  2Z33 A;  1ZRE A;  3ECO A;  1BBY A;  5FFX A;  2KIF A;  3GZ5 A;  1UHM A;  1O3Q A;  5LHG A;  1OKR A;  2ZFW A;  2CYY A;  1U78 A;  1HSJ A;  4NHJ A;  1DP7 P;  5J6X A;  2GXB A;  3I53 A;  1QZZ A;  5JFR A;  3DPT A;  4XLN F;  2BE5 F;  2MLG A;  4I0B A;  3CJN A;  4BXU A;  1LNW A;  4HA8 A;  1XN7 A;  3DXJ F;  4IJA A;  1FNN A;  2F5E A;  3M9A A;  3HHG A;  2ELH A;  1R22 A;  2QQA A;  4Q5S F;  2CQK A;  3RYP A;  2PG4 A;  2DQR A;  4G8X A;  2JSC A;  1HKQ A;  5ICC A;  3LAP A;  2FQ3 A;  2HKX A;  1XDS A;  1XD7 A;  4EJO A;  2FOK A;  3K9T A;  3U9G A;  3I59 A;  3R0A A;  4U0Y A;  4ZYG A;  4L9T A;  2MH9 A;  3KP6 A;  5LLQ A;  5DD8 A;  1CF7 A;  2IW5 A;  3ZPL A;  5HDK A;  5H6Q A;  5E17 F;  2TDX A;  4B8X A;  3GO5 A;  5DUK A;  4BH9 A;  4ON0 A;  4LK0 F;  4GO1 A;  4G94 A;  3R61 A;  1FY7 A;  2M45 A;  3WTY C;  1UFM A;  4UHT A;  1O3T A;  4KIG A;  1Q1H A;  4KIF A;  3E6M A;  4IF4 A;  4RAZ A;  1FP1 D;  1HQC A;  1F5T A;  3GF2 A;  2DW4 A;  4UV9 A;  4MQV A;  2PI0 A;  3DKW A;  5D5W B;  4ZH4 F;  4LD5 A;  5FD6 A;  1U6G A;  4ENN A;  2P6T A;  2ADU A;  4CIC A;  1GXQ A;  4OIQ F;  2IRF G;  1TNS A;  5DDG A;  1IXS B;  3PQJ A;  4MHG A;  2Y48 A;  3EDP A;  5E1Z B;  4TV7 A;  3EYI A;  4OU0 A;  2A6H F;  2VN2 A;  5LBQ A;  2VBY A;  1K79 A;  4JK1 X;  1CF7 B;  2KIU A;  1IN7 A;  3IRQ A;  4AWX B;  1TW2 A;  2DAO A;  3KEO A;  1FYM A;  2D45 A;  5TRD A;  4EGZ A;  5FD5 A;  3RDI A;  2CGP A;  1IN8 A;  1S8N A;  1WI9 A;  2Z5U A;  3ECH A;  5D4R A;  2JRT A;  3P7N A;  4YG2 F;  1XDU A;  3M1E A;  1OR7 A;  1TQP A;  1XSX A;  4UXN A;  4XBF A;  2CSO A;  3KEQ A;  3JTG A;  1MKM A;  2W85 A;  3QPT A;  1Y0U A;  2LSO A;  5K5O A;  3KCC A;  3F8C A;  2QBY A;  5CVI A;  3F8N A;  2RVC A;  3CUQ B;  3TO7 A;  1BC8 C;  2GXG A;  1BJA A;  3IRR A;  2PMU A;  3R4K A;  4F7Z A;  3F72 A;  1J59 A;  1DDN A;  2NNN A;  1B6A A;  5DCM A;  2VT2 A;  2QLZ A;  2OBP A;  2QUF A;  3ZQ7 A;  3ZP5 A;  2A3S A;  1Z9C A;  3GFM A;  3NEU A;  4LLG F;  2ZO4 A;  3KLN A;  2YPR A;  3GYH X;  3TOB A;  3BP8 A;  2XAG A;  4UUV A;  2FNA A;  5D8L B;  1LJ9 A;  3K1P A;  3QPH A;  3HTU A;  1FSH A;  4BHP A;  2DQL A;  4ENM A;  1KQ0 A;  2VOO A;  4YII A;  2GWR A;  2UXX A;  3R60 A;  1P4X A;  2AXL A;  4KMU X;  1ON2 A;  2XRN A;  1AOY A;  1FC3 A;  4G6Q A;  2DK5 A;  2ZBK A;  4NQW A;  3D5L A;  3BY6 A;  4CDG A;  5D8K B;  3F23 A;  1WRJ A;  5IT9 Z;  2MLK A;  2L54 A;  4HQE A;  1RIO H;  4N9H A;  1MDM A;  2STT A;  2HOE A;  4QWQ A;  1BI1 A;  1NHA A;  2XRO A;  2KJB A;  2YX7 A;  1XGS A;  3P9K A;  4M9S A;  1IN6 A;  5IT3 A;  3GFJ A;  1I6X A;  3GEZ A;  1K7A A;  3ML6 A;  2HWV A;  5H6R A;  2DU9 A;  4IRI A;  5D5X B;  3HYI A;  5LGN A;  1G3T A;  2QM3 A;  1BI0 A;  1SMT A;  3T8R A;  2HTJ A;  4JBA A;  1P6R A;  4LJZ F;  3Q9S A;  1WWX A;  3K1M A;  3I5U A;  1P4A A;  5ERI A;  2YU3 A;  1R36 A;  2ISZ A;  1IUY A;  1B9N A;  3EYY A;  4M72 A;  4MTE A;  3TOA A;  1R00 A;  3K69 A;  4A12 A;  2HS5 A;  2FA5 A;  1K78 A;  2ZJ2 A;  3U1D A;  3F3X A;  1YYV A;  1YTY A;  3BWG A;  2DI3 A;  5ILU A;  5F1R A;  4OIR F;  4IHT A;  4RGX A;  2C6Y A;  2FEZ A;  3SFZ A;  3E6D A;  2NYX A;  1EH8 A;  1H0M A;  3BDD A;  3L2C A;  1PUE E;  4HQM A;  5EEH A;  2OQR A;  1MDM B;  1T2K A;  4RB0 A;  4GXO A;  3LWF A;  3MEX A;  4U7D A;  2VXZ A;  4O6J A;  3HSE A;  2G7H A;  3WGI A;  2VBX A;  2EJR A;  2QWW A;  2XKO A;  2HTS A;  2HYG D;  4I98 B;  2BV6 A;  5J8F A;  4LG0 A;  3Q9V A;  3ZMS A;  2G7U A;  4WXC A;  2MD5 A;  1RNL A;  3GW2 A;  3TO6 A;  2HZT A;  3FHZ A;  1G4D A;  4KYW A;  5L3E A;  1JXS A;  4HX8 A;  5TJJ A;  1QO0 D;  4DQ2 A;  5LGT A;  2RN7 A;  3M8F A;  1ODD A;  1YW7 A;  5D6E A;  4L9V A;  4CZZ A;  1SD7 A;  2EK5 A;  1P2F A;  3BJA A;  1WSU A;  4I2O A;  1FLI A;  4EJW A;  1K78 B;  2E1N A;  4HF1 A;  4L18 B;  2WV0 A;  3FXU A;  5BMZ A;  3H92 A;  2HR3 A;  4G7Z F;  1KYZ A;  1XMA A;  1LQ1 A;  3N4M A;  1REP C;  2IA0 A;  1PDN C;  2K86 A;  5EEG A;  3JSO A;  4ZZL A;  4L9N A;  3E5U A;  3N97 A;  2P5K A;  1YFH A;  4NB5 A;  1RI7 A;  4ZYD A;  1XGO A;  2XVC A;  3V7R A;  2DPD A;  3GFI A;  3ABU A;  2H6C A;  4LG0 B;  1WQ2 A;  2PBI A;  4A5N A;  4LGW A;  4ZYE A;  2W84 A;  2A68 F;  2K02 A;  5HLI A;  2V79 A;  2H27 A;  4G7H F;  2QQ9 A;  4I0A A;  1KA8 A;  4RGU A;  3T0Y A;  2K27 A;  1LDD A;  2BYV E;  3FXQ A;  2K4B A;  2DBB A;  3GZ6 A;  1IRG A;  2EV0 A;  2GA1 A;  2VE9 A;  4A6D A;  4U7B A;  4EV0 A;  3W6K B;  4OOI A;  3FMS A;  5JVT A;  4EVI A;  4HV5 A;  2P4W A;  2IJL A;  2YX4 A;  5A2Q K;  1SFU A;  1ZRF A;  1QBJ A;  1GHC A;  1BI2 A;  1HW1 A;  4ESF A;  3FXR A;  2EA2 A;  3ZMV A;  2FNP A;  3HUG A;  1FZP B;  1OYI A;  4KMF A;  2EFO A;  2P8T A;  2P7V B;  4U88 A;  3AAF A;  1ZYR F;  1QPM A;  5CVR A;  1O57 A;  3C7J A;  1B4A A;  1STZ A;  3O6B B;  3G73 A;  3TDU C;  3FWE A;  1S7O A;  2XHK A;  2HEO A;  2HQR A;  2VBW A;  3J80 Z;  4MTD A;  4PCQ A;  3SQN A;  4A0Y A;  3JAM K;  3MWM A;  2YSR A;  5JHU A;  1KQ9 A;  2CFX A;  2RGV A;  1Z7U A;  5LEJ A;  2EFQ A;  2IA2 A;  1R5G A;  1W7P D;  4EM2 A;  4A5M A;  5LEK A;  2VC0 A;  1P92 A;  1HXD A;  2UZK A;  1QZY A;  2RNJ A;  4GCV A;  1ZGJ A;  3K2Z A;  2MA3 A;  5ILS A;  3HRT A;  3MFK A;  2FXA A;  1IZ1 A;  2FF4 A;  4OIO F;  3CUQ C;  4AIJ A;  4R79 A;  1MD0 A;  1U8R A;  4IPA A;  4A2U A;  3WTZ A;  2BBY A;  4BYY A;  1YG2 A;  4KA4 A;  4P9F A;  5JR3 A;  5CJ9 A;  3RIR A;  3K1N A;  2BEO A;  3H3Z A;  3D0S A;  1UB9 A;  1MGT A;  2PMH A;  1YW8 A;  5ED4 A;  5HLG A;  3WTU C;  3CUQ A;  1T38 A;  1KU7 A;  3HRS A;  2E1C A;  4GGG A;  3I71 A;  4QLC U;  1USS A;  1SFE A;  2ETH A;  1MJA A;  3SHF A;  2ZME A;  4RAY A;  2P5V A;  4ZZD A;  2O0Y A;  1HST A;  1ZN2 A;  2DK8 A;  3GWZ A;  5AON A;  5BOX A;  2H94 A;  4OMY A;  1JE8 A;  2HGC A;  2GZW A;  2O3F A;  1CGP A;  1PP7 U;  1JHF A;  1SMY F;  3R0J A;  4HDU A;  1JGS A;  4S04 A;  3TGN A;  4ENJ A;  3CUO A;  2V6C A;  4P5O A;  4OIP F;  2LF7 A;  1TTY A;  2RQP A;  2FU4 A;  4FHT A;  1ZLK A;  1KU3 A;  2FBK A;  3MAJ A;  4A6E A;  2CO5 A;  3IL2 A;  2DO7 A;  3E97 A;  4UV8 A;  1BIA A;  5LRR A;  2YR2 A;  3I64 A;  3COA C;  3RYR A;  5FFZ A;  2RKH A;  2UXN A;  4A0Z A;  4AIK A;  1R1U A;  4RB2 C;  3JW4 A;  5FLX K;  5CVJ A;  2FRH A;  4G6D A;  4XSZ F;  2WTE A;  1ZG1 A;  3LQQ A;  3IC7 A;  2QEN A;  4ETS A;  4M6X A;  4HAM A;  2O61 A;  1FSE A;  2PFB A;  4ESJ A;  4HLY A;  2XV4 S;  1G3W A;  4MEY F;  1P4W A;  2R7D A;  1IXC A;  4UVA A;  2ZME B;  1FBQ A;  1HKT A;  3E6C C;  1T0F A;  3HOT A;  4R8H A;  4WCG A;  2HDC A;  5ICG A;  1HW5 A;  2DTR A;  1G6N A;  2OAZ A;  1BI3 A;  4UVB A;  3RTR A;  4U0V A;  1ZRD A;  2HFH A;  3EQL F;  3KP5 A;  3V7C A;  3MQ0 A;  3IKT A;  1HKS A;  3PFI A;  2MC3 A;  3I0T A;  5KK1 A;  4IRH A;  2W25 A;  3WTS C;  3ROU A;  2HKO A;  1TLH B;  6PAX A;  4PGH A;  2NS0 A;  1O3R A;  1R5H A;  4L0Y B;  1PP8 F;  5LHH A;  3RI4 A;  5DUI A;  2E7X A;  3GFL A;  2PEX A;  1SAX A;  2X4H A;  3L7W A;  4LFU A;  1IRF A;  2Z3Y A;  4A0X A;  3W6J B;  1BN5 A;  2IP2 A;  3WU0 A;  4Q47 A;  2PLY A;  3LAJ A;  2V1D A;  1TQM A;  1L0O C;  4U0W A;  4EJV A;  1U3E M;  1FBU A;  4KT5 C;  2IT0 A;  1E2X A;  4IRG A;  2M30 A;  1FYK A;  3MCZ A;  3WE3 A;  3QAH A;  4YFK F;  4M9X A;  3E6B A;  1FWZ A;  4KDP A;  3T5X A;  4MQ9 F;  3DQV C;  3WTW C;  2K4J A;  5HVQ C;  3G3Z A;  3VEP A;  1BC7 C;  4WX9 A;  1G3S A;  1SD6 A;  4HOB A;  1YQA A;  1AWC A;  1Z6R A;  3ZMU A;  3WTT C;  1IXR C;  1YW9 A;  4HX7 A;  3B73 A;  3KZY A;  2B0L A;  2JPB A;  1V4R A;  2Y0M A;  5KVR A;  2A07 F;  4CYD A;  2ZKZ A;  3F6V A;  3ZN0 A;  2VE8 A;  5HS7 A;  3FZV A;  3FMQ A;  1X3U A;  2M1B A;  3KP2 A;  3GVA A;  3J81 K;  4ASN A;  1FPQ A;  3DP7 A;  4LLL A;  2ESN A;  2DPU A;  4P9U A;  1I1G A;  1OPC A;  1ON1 A;  2W57 A;  3BRO A;  2OZ6 A;  3HRU A;  2J5O A;  1T6S A;  5L3C A;  2XAJ A;  1XCB A;  3FF5 A;  3WOD F;  3OV8 A;  1T98 A;  2XUB A;  1I5Z A;  3LA3 A;  1DPU A;  3RPQ A;  4HF2 A;  3QRF F;  1Z6T A;  2Y75 A;  3TKY A;  2MBF A;  2NRA C;  3TDZ C;  2R7F A;  3IWF A;  1J0R A;  4M73 A;  2FSW A;  5DV5 A;  1RZ4 A;  2Q2E A;  4KIC A;  2PQ8 A;  3E5X A;  3WU1 B;  4UVC A;  2JTV A;  2FE3 A;  4WXD A;  3O2P E;  2LDU A;  4HW0 A;  2KJC A;  1GVJ A;  4HF0 A;  3MZH A;  5E8G A;  2VOD A;  1MJB A;  3KET A;  5DYM A;  2KRF A;  2VC1 A;  1OYW A;  3IHU A;  3JSP A;  1ZLJ A;  2O8X A;  5DCF A;  1V3F A;  1ONV A;  2L3D A;  4L5J A;  3DPL C;  1RUO A;  1LB2 A;  1R58 A;  1FP2 A;  3CO7 C;  1FT9 A;  3ELK A;  4LMY A;  3SZP A;  2XIG A;  5CVV A;  4AIH A;  1OMI A;  3P9C A;  1WKM A;  5HLH A;  4L0Z B;  2WWY A;  4OMZ A;  1S7A A;  4Y17 A;  2H6B A;  4ENK A;  3GX4 X;  5D4S A;  4D0P A;  1ULY A;  4L9J A;  4IVN A;  2F5F A;  2F2E A;  1OYY A;  3M7G A;  3O3K A;  5LRS A;  4HYE A;  5DEQ A;  2ISY A;  3QOP A;  3DF8 A;  4EGY A;  2RV8 A;  1ZAR A;  2HYF A;  1FBS A;  2L4M A;  2H09 A;  1ZAO A;  4RGS A;  4BHB A;  2A5Y B;  5K5R A;  4DNC A;  3H3U A;  2JPC A;  2PN6 A;  3RKX A;  5IT9 K;  5LGU A;  1HW2 A;  3TQN A;  3QP6 A;  3VB2 A;  2ZNY A;  1U5T C;  3ZN1 A;  4M9Z A;  1QQI A;  2O6G E;  1ZRC A;  2A69 F;  2EFW A;  4KFC A;  5E1X A;  2QYO A;  2LNB A;  1S3J A;  1K6O A;  2Q8K A;  2OQG A;  4ESB A;  2ACJ A;  2EFN A;  5FB2 A;  4IHS A;  2LKP A;  4YFN F;  4IXA A;  1U5T A;  1W5S A;  2STW A;  1O3S A;  4I7H A;  3FMR A;  4WK8 F;  3MZY A;  3L00 A;  5H20 A;  4RB1 A;  4Z2Y A;  1UHW A;  2XGX A;  1XMK A;  3REO A;  1KGS A;  2M8E A;  2QQB A;  4HZF A;  4FT8 A;  2DFI A;  1IN4 A;  2OU2 A;  3V8K A;  5AIQ A;  3F8F A;  5LHI A;  5K5Q A;  1O7L A;  1SD5 A;  4PGG A;  4RGR A;  4EJT A;  1YLF A;  4GYI A;  2JZY A;  3Q5F A;  1BM9 A;  3VFZ A;  2F5C A;  2EV5 A;  2M5W A;  4EQQ A;  3BPX A;  2WC2 A;  5HS9 A;  3BOQ A;  4HLX A;  1I1S A;  1YO5 C;  3LFK A;  1D5V A;  2AS5 F;  3DFG A;  3M8E A;  2GIV A;  5BQT A;  3HIF A;  1H9G A;  1W7P A;  4E70 A;  2COM A;  2K7L A;  3JTH A;  1D8J A;  1B1B A;  1S29 A;  3KP3 A;  1UST A;  3ERE D;  1LDJ A;  3PQK A;  3ZMD A;  5F64 A;  1A04 A;  1TBX A;  1YS6 A;  4HBL A;  4HDV A;  5D5U B;  3CTA A;  1UCR A;  3J81 Z;  3NQO A;  3HOS A;  1IF1 A;  2V1U A;  1L3L A;  4I02 A;  3F6O A;  1U5T B;  3V8J A;  3FX3 A;  1Z91 A;  2E7W A;  1ZHF A;  1ZG3 A;  4O5V A;  5D5V B;  4S05 A;  3WTX C;  3I54 A;  2QZ8 A;  3KLO A;  5AIP A;  3C1D A;  5L3D A;  2OD5 A;  4XLP F;  4AVP A;  3LA7 A;  4Y13 A;  3CDH A;  2ESH A;  2HQN A;  5ILV A;  1XGM A;  3WE2 A;  1R23 A;  1HBX G;  4Y15 A;  1ZG5 A;  3I59 B;  1MJ9 A;  4M71 A;  3L09 A;  3BJO A;  4XRF A;  5JI6 A;  3VOE A;  1IW7 F;  1IAW A;  2FBH A;  3RKW A;  3T8T A;  3FM5 A;  1KQ8 A;  1W7P B;  5E20 A;  1FYL A;  4LB5 A;  2L02 A;  3BPV A;  4N9I A;  3ZMZ A;  4LK1 F;  2J5P A;  2D1H A;  4HV6 A;  4P96 A;  2Z9O A;  1FX7 A;  2MH2 A;  2EWN A;  2XAQ A;  1W4M A;  3WG9 A;  5HDG A;  1I27 A;  4YFX F;  2P7C B;  1ZGA A;  5HS8 A;  1F4K A;  1KYW A;  1J2X A;  1XGN A;  4G7O F;  4BHC A;  4I01 A;  3RJP A;  1QNT A;  1TQI A;  2A6E F;  5E1W A;  3HSF A;  5DD4 A;  5ICF A;  4BAY A;  3SXY A;  4KN7 X;  2L4A A;  3BZ6 A;  5K1Y A;  1B9M A;  4CHU A;  2RDP A;  1BIB A;  1D3Y A;  5BPD A;  3BJ6 A;  4HX4 A;  4ZYH A;  2O03 A;  2JT1 A;  4Q48 A;  5E18 F;  1KU9 A;  1D8K A;  5CLS A;  1J75 A;  2IPQ X;  3J7A O;  5F6F A;  4CO8 A;  3KP4 A;  5D6F A;  1ZH5 A;  2BGC A;  3S2W A;  4MNU A;  1U2W A;  4BQA A;  2VON A;  3OOP A;  4YIF A;  1RUN A;  4AD9 A;  1Z1D A;  1R1T A;  3CLO A;  1GXP A;  1J7K A;  3B02 A;  5L3F A;  3V4G A;  5A2Q Z;  1J5Y A;  3U2R A;  1W5T A;  3J80 K;  3TO9 A;  2D2W A;  3E5Q A;  2LF8 A;  1Z05 A;  3LQR A;  3ISP A;  3C3W A;  3EUH A;  4R1H A;  2RC4 A;  3I58 A;  2KIM A;  2A61 A;  2IVM A;  3F8B A;  4FX4 A;  5J8C A;  5FGM A;  1F1Z A;  2QBY B;  1E17 A;  2ZXJ A;  3V7S A;  1EH7 A;  4KNY A;  4B09 A;  3ZMT A;  1BOA A;  2UWM A;  1O7F A;  5ICE A;  4PZJ A;  4WWC A;  4BNC A;  5L3G A;  1DUX C;  1TW3 A;  3QU6 A;  1IN5 A;  2V9V A;  2OZU A;  3LST A;  3E3V A;  3L9F A;  1LEA A;  3VOD A;  1R1V A;  2CW0 F;  5DCM B;  3JAM Z;  3QU3 A;  1KU2 A;  2D1V A;  3C18 A;  3KP7 A;  3F21 A;  3ABT A;  3HSR A;  4K2E A;  4KIB A;  2XAF A;  2XKP A;  1T39 A;  2EV6 A;  2R3S A;  5E8I A;  1TNT A;  1EH6 A; 
#chains in the Genus database with same CATH topology
 4XQF A;  3GLX A;  3HEF A;  4CCJ A;  2KL4 A;  1WJB A;  1S6L A;  3V8L A;  3HRM A;  3HXL A;  2OA4 A;  4FX0 A;  3WGG A;  2ZCW A;  1VF9 A;  2E19 A;  3M8J A;  4FTH A;  1ETV A;  2L2O A;  1YX3 A;  5GP9 A;  5HOO A;  4I99 C;  2CG4 A;  3HHH A;  3MKW B;  2DA2 A;  3ZR8 X;  4CXF A;  3CCU I;  5FLM J;  4LB6 B;  3U1K A;  2W4S A;  4XN3 A;  1HCR A;  3F22 A;  3WGH A;  1K83 J;  2QSH X;  3EET A;  4NQW B;  3JRI A;  2GOM A;  4MO7 A;  1J9I A;  1ORK A;  4ZYA A;  5EGO B;  3SYT A;  3DKY A;  3WTV C;  2P6S A;  3B6C A;  2K9N A;  3QYF A;  1S9H A;  1GLN A;  2ZSH B;  4DIQ A;  2CWE A;  5CVU A;  2KIS A;  2XAH A;  4XON A;  3EPZ A;  2EB7 A;  4I09 A;  3HTS B;  1YIO A;  4JQF A;  3OS0 A;  2PJP A;  1EV7 A;  2NAZ A;  1MZB A;  4RLF A;  1U8B A;  1XSD A;  1IO2 A;  3NRV A;  5B3S H;  2GA2 A;  2Q0O A;  4WXH A;  4F91 B;  1V55 H;  2V1X A;  3MKZ A;  4GFB A;  4N0B A;  1FOK A;  3GTO J;  2HOS A;  1OCR H;  2UV1 A;  3DV8 A;  2F48 A;  2JVH A;  5J3L A;  3JRG A;  4GYG A;  3W3C A;  4YIR X;  3KE2 A;  1S72 I;  1QGP A;  3DEU A;  4MEX F;  4A3G J;  2IGO A;  1QHG A;  2VT3 A;  3O8G A;  2F5D A;  2KPM A;  2KKO A;  2WAQ N;  4A3J J;  1RRJ A;  2KMU A;  2EA4 A;  1YIT I;  2IXS A;  1R7J A;  1Y8Q B;  4Y3O A;  5CKT A;  2E36 A;  4H0E A;  4PDK A;  1NK3 P;  2R92 J;  1AKH A;  2L01 A;  2DLL A;  4MGR A;  2XAS A;  5TGT A;  1P7I A;  4Q4Z F;  3BT9 A;  2ME0 A;  4EM0 B;  4Y7N J;  3K0L A;  3F8M A;  2Z99 A;  2L9R A;  1XSV A;  4A3B J;  1WHU A;  2L7K A;  2ZSI B;  4KN4 X;  4IQJ A;  1LDK B;  1IRZ A;  3MKL A;  3MKY B;  2VJ5 A;  5JLX A;  4CCM A;  3CZ6 A;  3GXO A;  2DDB A;  3OIP A;  4X6A J;  1SFX A;  3FM3 A;  4FCY A;  1XX5 A;  2I10 A;  4EMS A;  4KUM A;  3GUD A;  1XB4 A;  5KAF C;  4XLC A;  3BR6 A;  4ZDP A;  3OYI A;  4PSW A;  2L7M P;  2EFP A;  3BG5 A;  5L3B A;  5BS6 A;  2HOA A;  4KIT B;  2H8R A;  3MZ8 A;  1HLV A;  4BEH A;  1JT0 A;  4IHW A;  2K85 A;  2K9S A;  3PM1 A;  1VQN I;  4RAG A;  4C3J J;  4N4N B;  2P5L C;  4M6Y A;  2GAU A;  2ZXI A;  1X1A A;  1VQP I;  2K5C A;  3LA2 A;  3R6S A;  2FBI A;  2G9W A;  1TP4 A;  5FO5 A;  1LVA A;  4CGZ A;  3CO6 C;  2VPR A;  3IWZ A;  4A93 J;  2VBZ A;  3ZQL A;  2XF5 A;  2VOP A;  1XG1 A;  2QVO A;  1VTN C;  1Y6I A;  4G9Y A;  1OJL A;  1XCV A;  3K4M A;  3CJR B;  3S14 J;  3IKV A;  1W1W E;  2JUC A;  4RS8 A;  2W24 A;  4CA0 A;  5FLX Z;  2M4G A;  3QP5 A;  2O8K A;  2E5N A;  1LEB A;  4DYQ A;  3CC2 I;  4L5I A;  3RPU A;  1VFC A;  5EG0 B;  3OYD A;  3ULQ B;  1SD4 A;  3SZT A;  2FML A;  4O3M A;  5GPA A;  2DT5 A;  1VND A;  1DGW Y;  5CYV A;  4RB3 C;  3PSI A;  3DTK A;  2NNY A;  1OCO H;  3L2U A;  1H9T A;  4B1R A;  1XS9 A;  4UNO A;  2IA1 A;  4M74 A;  3X2Q H;  2W7N A;  1U9O A;  2L7F P;  4X1E A;  1C0W A;  4IQ4 A;  2M87 A;  2Z16 A;  3FXO A;  1Z3Y A;  2NVY J;  4P55 A;  3KFW X;  1JHH A;  1RES A;  4OIN F;  5BPI A;  2X0L A;  2DXI A;  3RKY A;  4LLN A;  2GQQ A;  1W0U A;  1CQT A;  1DPR A;  1T95 A;  3P9I A;  1AKH B;  4DZP A;  4EJU A;  3ERM A;  1YS7 A;  4EM1 A;  1B59 A;  2FMY A;  4XSX F;  3T1B A;  4WF2 A;  1G3Y A;  5F1J A;  2ZNZ A;  3BG9 A;  3I4P A;  5BNG A;  1F9N A;  3KZZ A;  1ETW A;  3N05 A;  2R7O A;  1AA7 A;  5HDN A;  2Z33 A;  1ZRE A;  1JKQ C;  3L2Q A;  3ECO A;  3TW6 A;  1BBY A;  5FFX A;  2KIF A;  3OSG A;  2AHQ A;  4HEA 2;  3GZ5 A;  2WB1 N;  5FKM A;  4I76 A;  1UHM A;  2Z2S B;  1O3Q A;  3PO3 J;  1D0Y A;  5LHG A;  4Y33 A;  4JX6 A;  1OKR A;  2ZFW A;  2CYY A;  3BR0 A;  1U78 A;  1JTY A;  4BEH B;  2DOE A;  1HSJ A;  1N75 A;  4NHJ A;  1JJ8 C;  1DP7 P;  5J6X A;  2GXB A;  3I53 A;  3JRB A;  3BZC A;  2VB6 A;  2E2H J;  1QZZ A;  4IL6 C;  2QKL B;  5JFR A;  4NNJ A;  2VQL A;  3DPT A;  2LVS A;  3CD6 I;  5CQG A;  2CQQ A;  3AL0 B;  4XLN F;  3H3V K;  3LSK A;  2BE5 F;  2MLG A;  2EIK H;  4I0B A;  2QKM B;  3CJN A;  4BXU A;  3A1Y A;  2QSG X;  5HNH A;  1QRY A;  1LNW A;  2MAB A;  4B3X A;  2X9D A;  4HA8 A;  4ITV A;  1XN7 A;  1UG0 A;  3DXJ F;  3PNT A;  4IJA A;  5J4Y A;  1FNN A;  2LLK A;  2F5E A;  4XLA A;  2ZJR F;  2GBY A;  3M9A A;  3HHG A;  2VKD A;  2ELH A;  3FXJ A;  1R9T J;  1R22 A;  3LSJ A;  2QQA A;  4IZZ A;  4Q5S F;  1TWF J;  2CV2 A;  2CQK A;  2P81 A;  3RYP A;  2DOD A;  2PG4 A;  3IAM 2;  5GAG J;  2DQR A;  4XID A;  2XF7 A;  4G8X A;  2JSC A;  2X1D A;  1HKQ A;  5ICC A;  2FQ3 A;  3LAP A;  2HKX A;  3I4N J;  1XDS A;  1XD7 A;  4EJO A;  3H9J A;  5M5W J;  1NG6 A;  2FOK A;  2OJE D;  3K9T A;  3U9G A;  3HOX J;  1QA6 A;  2MC4 A;  3I59 A;  4XRM A;  2KQR A;  4BXF A;  2R5Y A;  3R0A A;  4U0Y A;  2R93 J;  4ZYG A;  2OCE A;  1Q1V A;  4L9T A;  1X4P A;  2R5Z A;  1FOY A;  2MH9 A;  5J1Y A;  3KP6 A;  5K7F A;  5LLQ A;  5DD8 A;  4E4H A;  1OCP A;  1CF7 A;  4P1W A;  2IW5 A;  1FIP A;  4F3Q A;  3ZPL A;  4AUX A;  5HDK A;  5H6Q A;  1G59 A;  4QIW N;  5E17 F;  3ABK H;  2TDX A;  4B8X A;  1BW5 A;  3GO5 A;  5DUK A;  3HM5 A;  1R71 A;  3GCM A;  2EZI A;  4BQO A;  4AU7 A;  4XKW A;  4FE4 A;  3VPR A;  4BH9 A;  4EAT A;  5KCM A;  4CYC B;  5FRM A;  3CLQ A;  4ON0 A;  2QGU A;  1M1E B;  4LK0 F;  5J1R A;  3MN2 A;  4GO1 A;  3G71 I;  3KYD B;  4G94 A;  2LY1 A;  3R61 A;  4N4O B;  4BDY A;  2IS4 A;  1FY7 A;  1V54 H;  3ZQH A;  2M45 A;  3WTY C;  3Q3S A;  1UFM A;  3PL8 A;  4UHT A;  1O3T A;  4KIG A;  2Y0S A;  1FOW A;  4NC6 A;  1Q1H A;  4KIF A;  2BHY A;  4OWR B;  3E6M A;  4IF4 A;  4RAZ A;  3BCB A;  2DFE A;  2XGD A;  5M3M J;  2EZH A;  1FP1 D;  4ANJ A;  3K6G A;  1HQC A;  3HDD A;  1F5T A;  3GF2 A;  2DW4 A;  5HNF A;  4A3D J;  2X6Y A;  5FLV A;  4UV9 A;  4MQV A;  2CFO A;  2PI0 A;  3DKW A;  5D5W B;  3L1P A;  4ZH4 F;  4LD5 A;  5FD6 A;  1U6G A;  5EF6 A;  2P6T A;  2DMQ A;  4ENN A;  2ADU A;  4C2M J;  4CIC A;  1GXQ A;  1Y8R B;  2IRF G;  5GAD J;  4OIQ F;  1TNS A;  5DDG A;  3S8P A;  2VPL A;  1IXS B;  3PQJ A;  5IOY A;  3JRD A;  2LG4 A;  3HBL A;  4MHG A;  2Y48 A;  3EDP A;  2LR8 A;  5E1Z B;  4BJ6 C;  4TV7 A;  3G6E I;  3EYI A;  4OU0 A;  2R5Y B;  3S1R J;  4ZC3 A;  1MND A;  2A6H F;  3OL3 A;  5EYR A;  3L2R A;  3OYM A;  3OS2 A;  2VN2 A;  5LBQ A;  2VBY A;  1MH4 A;  1K79 A;  1OR7 C;  4JK1 X;  2E60 A;  2BY1 A;  3FXM A;  1CF7 B;  2KIU A;  3IH2 A;  1IN7 A;  3VSL A;  3IRQ A;  3K4J A;  4AWX B;  2HZD A;  1QZE A;  1TW2 A;  2OF7 A;  5B5E C;  2DAO A;  5F0F A;  1BJZ A;  3RQI A;  3OYJ A;  1VQ4 I;  3KEO A;  1FYM A;  2D45 A;  1RET A;  3TBI A;  4EGZ A;  5TRD A;  5FD5 A;  3RDI A;  2W48 A;  1IN8 A;  2CGP A;  2HPI A;  1UG2 A;  1S8N A;  1WI9 A;  2Z5U A;  1A36 A;  2MFZ A;  2E2I J;  5E3O A;  2X1C A;  1SFO J;  3ECH A;  4XOT A;  5D4R A;  2XGC A;  1YHQ I;  1X58 A;  4PFO A;  2JRT A;  3FXL A;  3M4O J;  2NS8 A;  2A6T A;  3P7N A;  4YG2 F;  1XDU A;  3RZD J;  3M1E A;  4DZJ A;  1OR7 A;  1TQP A;  1XSX A;  2JWT A;  3IP4 B;  4UXN A;  4C3H J;  3I56 I;  4XBF A;  1H89 C;  2CSO A;  3KEQ A;  3JTG A;  3CCR I;  3CCS I;  2VKH A;  3D5S C;  1K61 A;  3P5J A;  1LKX A;  1MKM A;  2W85 A;  3QPT A;  3SZG A;  1Y0U A;  4ZDO A;  2LSO A;  5K5O A;  2PJR A;  3KCC A;  3F8C A;  2QBY A;  1TT5 B;  1TWC J;  5CVI A;  4E7L A;  1Z21 A;  4Y52 J;  4DW6 A;  3F8N A;  2JRM A;  1QHH D;  2RVC A;  5K7Z A;  3CMA I;  1ZQ3 P;  3ZRG A;  3H5N A;  3PFY A;  4PJM A;  3FK7 A;  3CUQ B;  4NC8 A;  3TO7 A;  2BVL A;  1BC8 C;  4II3 A;  5KNL A;  4D5F A;  3A0B C;  2GXG A;  1BJA A;  2HQA A;  4BY1 J;  1S5L C;  3IRR A;  2PMU A;  2CMP A;  3S16 J;  3G1L A;  3CMM A;  3DEE A;  3R4K A;  1H88 C;  1AHD P;  2DN0 A;  4F7Z A;  5GTI C;  3F72 A;  2L7Z A;  1J59 A;  1TC3 C;  1DDN A;  3S15 J;  2BY3 A;  2VKE A;  1YI2 I;  2NNN A;  1B6A A;  2ECC A;  5DCM A;  2VT2 A;  2QLZ A;  2OBP A;  2QUF A;  3ZQ7 A;  3ZP5 A;  2A3S A;  1UJ8 A;  1Z9C A;  2VQH A;  3GFM A;  3FIW A;  3NEU A;  4LLG F;  5E3L A;  2ZO4 A;  3LSH A;  3KLN A;  5C4J J;  2YPR A;  3I55 I;  2DA5 A;  3HPG A;  2HI3 A;  3WG7 H;  2KDO A;  3GYH X;  3TOB A;  3BP8 A;  2XAG A;  3K4L A;  1I39 A;  4UUV A;  2FNA A;  2AQE A;  2HVS A;  5D8L B;  1LJ9 A;  3K1P A;  3KEY A;  5J4V A;  3QPH A;  3HTU A;  2BZT A;  4BJ5 C;  4F52 A;  1FSH A;  4BHP A;  2DQL A;  4ENM A;  1KQ0 A;  2VOO A;  1MSF C;  4YII A;  2GWR A;  4BY7 J;  2UXX A;  3SDB A;  5F0H A;  1OQY A;  3TMO A;  3R60 A;  1P4X A;  4MFD A;  2AXL A;  4KMU X;  1ZEL A;  1ON2 A;  3HGG A;  4XM3 A;  3DPU A;  1MBG A;  4MFE A;  2XRN A;  2JA5 J;  1AOY A;  1FC3 A;  4G6Q A;  2R7S A;  4CH7 A;  2DK5 A;  1UEL B;  2COB A;  2ZBK A;  4NQW A;  1D0X A;  3VYS B;  1DQU A;  3D5L A;  4ZJZ A;  1QVU A;  3BY6 A;  4CDG A;  5D8K B;  3DU5 A;  3F23 A;  4B44 A;  1WRJ A;  3HOZ J;  5IT9 Z;  2MLK A;  2L54 A;  3G1M A;  4HQE A;  1RIO H;  4N9H A;  1MDM A;  2STT A;  2HOE A;  2LKS A;  4QWQ A;  1HF0 A;  4NBQ A;  3GTL J;  1BI1 A;  4QPO A;  1NHA A;  5E3N A;  2XRO A;  4BE1 A;  2KJB A;  1BR1 A;  2YX7 A;  3FBI B;  1XGS A;  3HGY A;  1S7E A;  1HDD C;  1ZR4 A;  4AM3 A;  3P9K A;  4M9S A;  4Z6Y A;  4IX7 A;  4RM3 A;  1IN6 A;  5IT3 A;  3GFJ A;  1I6X A;  3OYL A;  3CC4 I;  2X6X A;  1P7J A;  2DT6 A;  3GEZ A;  1Y56 A;  1K7A A;  4YEJ A;  3KIO A;  3ML6 A;  2HWV A;  3BZK A;  4XKV A;  5H6R A;  2DTZ A;  2DU9 A;  1VQ7 I;  4IRI A;  1D1B A;  5D5X B;  3HYI A;  3CMY A;  5LGN A;  3S3M A;  1G3T A;  2QM3 A;  1WJC A;  2WA0 A;  2DT7 B;  1YJN I;  1E0E A;  2LRD A;  2EIJ H;  1BI0 A;  1SMT A;  3T8R A;  1R49 A;  2HTJ A;  3KX2 A;  2QF7 A;  4JBA A;  3OYH A;  1MH3 A;  2KHM A;  4IKF A;  1P6R A;  4LJZ F;  3Q9S A;  3JR9 A;  1WWX A;  3OWT A;  3K1M A;  3I5U A;  1P4A A;  2K9Q A;  5ERI A;  3S3O A;  4XOP A;  3I3L A;  2YU3 A;  3E0J B;  1R36 A;  2ISZ A;  1IUY A;  3M3Y J;  3OL4 A;  1B9N A;  3EYY A;  4M72 A;  4MTE A;  3TOA A;  1R00 A;  3K69 A;  3ASO H;  2GIZ A;  4A12 A;  2HS5 A;  3CC7 I;  2FA5 A;  1K78 A;  2ZJ2 A;  2L9N A;  3U1D A;  3F3X A;  2ZC2 A;  4UUT A;  1YYV A;  1YTY A;  3JRH A;  4ZDL A;  3BWG A;  2DI3 A;  5ILU A;  5F1R A;  4OIR F;  4IHT A;  4RGX A;  1XPX A;  2C6Y A;  2FEZ A;  2DA7 A;  3SFZ A;  2EPF A;  4MLO A;  3RQ4 A;  4AYB N;  5FRO A;  2LOO A;  3E6D A;  2NYX A;  1EH8 A;  4XR6 A;  1YX5 A;  2KP6 A;  4RLQ A;  4DBR A;  1H0M A;  1H8A C;  3RZO J;  1OFC X;  3BDD A;  3L2C A;  1PUE E;  4HQM A;  5EEH A;  2RRE A;  2WBM A;  3PNV A;  2LMD A;  2OQR A;  1MDM B;  3PSF A;  2EQR A;  1T2K A;  4RB0 A;  4GXO A;  1N78 A;  3LWF A;  3MEX A;  1ZKG A;  4U7D A;  3S17 J;  4GDF A;  2VXZ A;  4O6J A;  3PNY A;  3HSE A;  9ANT A;  4V19 K;  4A3E J;  2G7H A;  2EIL H;  3WGI A;  2CQ7 A;  2VBX A;  2EJR A;  2QWW A;  2XB5 A;  2XKO A;  1FIA A;  2HTS A;  2HYG D;  1RPW A;  4I98 B;  4IOC F;  1WCM J;  2BV6 A;  5J8F A;  4BDZ A;  4FAS D;  4LG0 A;  5EG0 A;  4HG2 A;  3Q9V A;  3ZMS A;  1ENH A;  1ZR2 A;  2G7U A;  3FBN B;  4LIV A;  4CZC A;  2V4J C;  3OYB A;  2JUG A;  3E7L A;  4WXC A;  3OYA A;  2JSP A;  3LNQ A;  3A03 A;  2MD5 A;  1RNL A;  2OV7 A;  2I8D A;  3GW2 A;  3TO6 A;  2HZT A;  3V42 A;  3FHZ A;  1G4D A;  4KYW A;  3FKJ A;  2ZXH A;  2HVR A;  1T8I A;  1FMV A;  5L3E A;  5J40 A;  3DBR B;  4HX8 A;  3ESW B;  4PK4 A;  5TJJ A;  4DGW B;  4IHV A;  1HOM A;  1JXS A;  1QO0 D;  4DQ2 A;  5LGT A;  2RN7 A;  3M8F A;  3H1C A;  3LSP A;  1ODD A;  1YW7 A;  5D6E A;  1Z3X A;  4L9V A;  4CZZ A;  1SD7 A;  2EK5 A;  1P2F A;  2Y69 H;  3BJA A;  4A3L J;  1WSU A;  4I2O A;  1FLI A;  4RM2 A;  4M3B A;  4EJW A;  1K78 B;  5M3F J;  3AL0 C;  1K4S A;  2E1N A;  1ETX A;  3AG2 H;  4FIS A;  4HF1 A;  4L18 B;  2CW8 A;  2WV0 A;  1DP3 A;  3FXU A;  2VQC A;  4RAF A;  3RCO A;  2VJ4 A;  4E7H A;  4NC7 A;  1FJL A;  5BMZ A;  1DU6 A;  3H92 A;  1IC8 A;  4OAZ A;  2HR3 A;  4G7Z F;  4Y4R A;  1KYZ A;  1XMA A;  1LQ1 A;  4FQG A;  3HPH A;  3N4M A;  1REP C;  2IA0 A;  4F55 A;  2B7E A;  3CP2 A;  4QSH A;  1W0T A;  1LPQ A;  1PDN C;  2K86 A;  5EEG A;  3JSO A;  3C2B A;  4ZZL A;  3G2B A;  5IOZ A;  4L9N A;  3E5U A;  3N97 A;  2P5K A;  2JA7 J;  1YFH A;  4NB5 A;  3OY9 A;  1RI7 A;  4ZYD A;  1XGO A;  2XVC A;  1MMN A;  3S32 A;  3V7R A;  4ABZ A;  1NTC A;  4BJT A;  2DPD A;  3GFI A;  2LC2 A;  3ABU A;  2ZB9 A;  2ME6 A;  1IUF A;  4XKB A;  4FET A;  4DJA A;  2H6C A;  1D5Y A;  4LG0 B;  3JRF A;  2VQG A;  1WQ2 A;  2PBI A;  4A5N A;  4RMN A;  1W36 D;  2BHZ A;  4LGW A;  4ZYE A;  2FX0 A;  2W84 A;  3QYE A;  2A68 F;  2CUE A;  2CV0 A;  4NUB A;  2K02 A;  5HLI A;  2V79 A;  3BR2 A;  2H27 A;  4G7H F;  2KZG A;  2QQ9 A;  3HKZ N;  4I0A A;  1KA8 A;  1ETQ A;  1VQO I;  4RGU A;  1TZL A;  3T0Y A;  1VQK I;  2K27 A;  1LDD A;  2CQX A;  2CUJ A;  2LYC A;  1WJD A;  2BYV E;  3FXQ A;  2K4B A;  2DOF A;  2DBB A;  1X4O A;  3GZ6 A;  3UR3 C;  1IRG A;  2EV0 A;  2F4I A;  1D1A A;  4HST A;  2GA1 A;  5HOD A;  3CP8 A;  2VE9 A;  4A6D A;  2KLO A;  1UHS A;  4U7B A;  4EV0 A;  3W6K B;  4OOI A;  3FMS A;  5JVT A;  4UUS A;  4EVI A;  3OYK A;  3UKG A;  4HV5 A;  2P4W A;  1RKW A;  2JJ7 A;  3H9G A;  2IJL A;  2DFH A;  4JOM A;  2YX4 A;  2F4O B;  5A2Q K;  1SFU A;  3PO2 J;  2CV1 A;  5IY5 H;  4XOR A;  1ZRF A;  1QBJ A;  3AG1 H;  1GHC A;  1BI2 A;  4XK4 A;  2M7B A;  1HW1 A;  4ESF A;  3FXR A;  1JTX A;  2EA2 A;  3ZMV A;  2FNP A;  3HUG A;  4CYC A;  1FZP B;  1OYI A;  4DOZ A;  4GRI A;  4KMF A;  3DBH B;  1ETO A;  1LE8 B;  2EFO A;  2P8T A;  1IGN A;  2P7V B;  4U88 A;  4G12 A;  2M0M A;  3AAF A;  1IRX A;  3K4C A;  1EJ9 A;  1ZYR F;  1QPM A;  5CVR A;  3D1N I;  2IGN A;  1O57 A;  3C7J A;  5JHF A;  1B4A A;  2H1K A;  2DJN A;  3WHB A;  3J7Y J;  3L2V A;  2VUM J;  2VJJ A;  1STZ A;  3O6B B;  1X1D A;  3G73 A;  3TDU C;  3FWE A;  1A35 A;  3KYC B;  1S7O A;  1VQ8 I;  2X1E A;  2XHK A;  2HEO A;  2HQR A;  2XPW A;  3H9Q A;  2VBW A;  3J80 Z;  2E1M B;  4MTD A;  2NXN B;  3H5R A;  2KRH A;  4PCQ A;  1SAU A;  3SQN A;  4A0Y A;  3JAM K;  1UMQ A;  3GME A;  2VXD A;  1GV2 A;  3MWM A;  3UNG C;  2YSR A;  5JHU A;  1KQ9 A;  2CFX A;  2RGV A;  3MD2 A;  2IBD A;  1SVO A;  2KT0 A;  3ABM H;  1OLT A;  1Z7U A;  3JRA A;  1XC5 A;  4IHX A;  2PMZ A;  5LEJ A;  1X19 A;  4J19 A;  2EFQ A;  4PFP A;  2IA2 A;  1R5G A;  1W7P D;  4D9J A;  4EM2 A;  4E7I A;  5HLT A;  4A5M A;  5LEK A;  2VC0 A;  4II2 A;  4BBR J;  1P92 A;  1HXD A;  1PVE A;  4A69 C;  1QZY A;  2UZK A;  2RNJ A;  4KIS A;  3VYR B;  4UUS B;  1BL0 A;  4CSW A;  4GCV A;  1JI8 A;  5EDN A;  2QQ8 A;  1JGG A;  1BW6 A;  2Q1Z B;  1ZGJ A;  3K2Z A;  2XC7 A;  2MA3 A;  5ILS A;  3HRT A;  3ZXS A;  3MFK A;  2FXA A;  4BKX A;  2IAI A;  2JN6 A;  2OUM A;  1IZ1 A;  1WGX A;  3HUG B;  2FF4 A;  1JKR C;  4OIO F;  2H8W A;  2WAE A;  1AU7 A;  3CUQ C;  4XKC A;  4IO9 F;  4AIJ A;  5DM6 F;  1X1P A;  4R79 A;  2E5Z A;  3GTP J;  3BG6 A;  3FKI J;  4CCL A;  1MD0 A;  2WAF A;  1U8R A;  2ZJQ F;  4IPA A;  2CUF A;  5FKK A;  4A2U A;  4B4C A;  4KJZ A;  2Y2Z A;  1O4X A;  3WTZ A;  2LD5 A;  3OIO A;  4BUP A;  2Z1D A;  2HU9 A;  2BBY A;  2M9H A;  1FMW A;  4BYY A;  2IS1 A;  1YG2 A;  2ZME C;  1HDP A;  2HDW A;  2O5R A;  4KA4 A;  4P9F A;  5JR3 A;  5CJ9 A;  4BBS J;  3RIR A;  2LBF B;  1A6Q A;  3K1N A;  4DYC A;  3OYC A;  2BEO A;  1FEX A;  3OYG A;  3DLL F;  3H3Z A;  4NDL A;  3D0S A;  2XB0 X;  3E1S A;  2DYR H;  4D7N A;  4AYB A;  1UB9 A;  1V5F A;  1EA3 A;  1MGT A;  2PMH A;  3A0H C;  1NG7 A;  1YW8 A;  2LFB A;  3CJT B;  5ED4 A;  3PJR A;  1JUM A;  5HLG A;  3WTU C;  3OR2 C;  3CUQ A;  1T38 A;  1KU7 A;  3S3N A;  4F92 B;  3HRS A;  2E1C A;  4GGG A;  1TWA J;  1YIJ I;  3I71 A;  4QLC U;  1USS A;  2MYS A;  1SFE A;  3KZI C;  3VYU B;  3OSF A;  2CU7 A;  3AG4 H;  1YJW I;  2HXO A;  1MBK A;  2OPT A;  3F0C A;  1WZ2 A;  2ETH A;  1MJA A;  3SHF A;  1JUS A;  3ABL H;  2ZME A;  3ZQI A;  5C44 J;  4U87 A;  4RAY A;  2P5V A;  2WAD A;  4ZZD A;  2CQN A;  3K4K A;  2O0Y A;  3CES A;  4HNU A;  5CQE A;  3BQZ A;  1HST A;  1ZN2 A;  2DK8 A;  3GWZ A;  5AON A;  4G6T B;  5BOX A;  2H94 A;  4OMY A;  1JE8 A;  1B8I A;  3H36 A;  4QTR A;  2HGC A;  2GZW A;  2O3F A;  2KIQ A;  1RKT A;  3HZJ A;  3OYN A;  1CGP A;  1PP7 U;  1MMA A;  1JHF A;  5IYB J;  1SMY F;  3R0J A;  4HDU A;  2LH9 A;  1JGS A;  2R7U A;  2BXZ A;  3SDG A;  4S04 A;  3TGN A;  1V5G A;  2WAQ A;  4ENJ A;  1B72 B;  1GVD A;  5M5X J;  3CUO A;  2V6C A;  4P5O A;  4OIP F;  2BY0 A;  2LF7 A;  1TTY A;  2RQP A;  2FU4 A;  3H35 A;  1VQM I;  1W5C C;  4FHT A;  2VJI A;  3OR1 C;  1ZLK A;  1KU3 A;  3K70 C;  1WFX A;  2FBK A;  1MMG A;  5IP7 J;  3K4N A;  3MAJ A;  1GT0 C;  4A6E A;  2CO5 A;  3IL2 A;  2DO7 A;  3E97 A;  4UV8 A;  5JVG F;  2M4K A;  4CCK A;  4B3A A;  4HNT A;  1OCZ H;  1BIA A;  5LRR A;  2YR2 A;  3I64 A;  1TWH J;  3BCA A;  3COA C;  3RYR A;  5FFZ A;  1I3Q J;  2RKH A;  2UXN A;  4A0Z A;  2M8G X;  2DYS H;  4AIK A;  1R1U A;  1R4M B;  4RB2 C;  1NH3 A;  3JW4 A;  2WY7 Q;  4JX4 A;  4M3D A;  4XMY A;  5CVJ A;  5FLX K;  2FRH A;  3IV5 A;  4G6D A;  4XSZ F;  2R7Q A;  2E1O A;  2WTE A;  1ZG1 A;  1I50 J;  1Z77 A;  2NOG A;  3LQQ A;  3IC7 A;  2QEN A;  2V1N A;  4ETS A;  2JVG A;  2TRT A;  4M6X A;  4HAM A;  4CUG A;  1YJ9 I;  2R0Q C;  2O61 A;  2B9S A;  5J1U A;  1FSE A;  3JCU C;  2PFB A;  4ESJ A;  4HLY A;  2XV4 S;  1G3W A;  1EF4 A;  4MEY F;  1P4W A;  2R7D A;  1IXC A;  1X2M A;  4BS9 A;  3W2A A;  4UVA A;  3C2H A;  2VIX A;  5GAH J;  2MSY A;  2DOA A;  2ZME B;  1FBQ A;  1HKT A;  1ZK8 A;  5KHD A;  1EH6 A;  3E6C C;  1RC9 A;  4ZTJ A;  1T0F A;  3HOT A;  2MW8 A;  2BW3 A;  4R8H A;  2GM4 A;  4UB8 C;  1N25 A;  4WCG A;  4BE2 A;  2HDC A;  4C2T A;  3LSI A;  5ICG A;  1HW5 A;  3C2G A;  3HB9 A;  2DTR A;  3BG7 A;  4L5E A;  1B8I B;  1G6N A;  2OAZ A;  4PJJ A;  1BI3 A;  2IS2 A;  4BGD A;  2DFF A;  4UVB A;  3RTR A;  3FDY A;  3TP0 A;  4U0V A;  1ZRD A;  2HFH A;  2M3A A;  3EQL F;  3KP5 A;  4X0G A;  2HNH A;  3V7C A;  2DMU A;  3MQ0 A;  1JUP A;  3IKT A;  1HKS A;  1MBE A;  3PFI A;  2MC3 A;  3CCL I;  3S1N J;  3L2W A;  3I0T A;  5KK1 A;  1VQ9 I;  2V9K A;  2K40 A;  2W25 A;  4IRH A;  3WTS C;  3SJM A;  3ROU A;  2HKO A;  1TLH B;  4BE0 A;  3DTI A;  4PJ0 C;  2L9S A;  6PAX A;  4PGH A;  2L0K A;  2NS0 A;  2CRG A;  1O3R A;  1D0Z A;  1R5H A;  2CJJ A;  1U0J A;  4XRS G;  3AKZ A;  4L0Y B;  2F4M B;  1PP8 F;  5LHH A;  5FRN A;  3RI4 A;  5FKN A;  5DUI A;  2E7X A;  3GFL A;  2PEX A;  1SAX A;  2X4H A;  3BLY A;  1HA8 A;  4E7K A;  3HOV J;  1VI0 A;  3L7W A;  3OOU A;  5C3E J;  3CCJ I;  4LFU A;  2WB1 A;  1IRF A;  2Z3Y A;  4A0X A;  2HOT A;  3OIQ A;  1WJA A;  2K3P A;  3W6J B;  1BN5 A;  2IP2 A;  4A3M J;  3H5A A;  3JRC A;  2E71 A;  1WH7 A;  3WU0 A;  2HXI A;  2JK3 A;  4Q47 A;  2HQ5 A;  1GUU A;  5DM7 F;  2NS7 A;  3LAJ A;  2V1D A;  1IJW C;  2PLY A;  3CCM I;  1TQM A;  1L0O C;  4U0W A;  3IAS 2;  3CF5 F;  3BTL A;  4EJV A;  1U3E M;  2P0W A;  2W82 A;  2DMT A;  1FBU A;  4KT5 C;  3O8H A;  1R4N B;  4XIC A;  1E2X A;  2IT0 A;  2FD5 A;  3A2K A;  4IRG A;  3FXK A;  2M30 A;  1FYK A;  3MCZ A;  3WE3 A;  3QAH A;  4V2G A;  4YFK F;  4M9X A;  3E6B A;  1FWZ A;  3W2V A;  4KDP A;  2BW3 B;  3T5X A;  1VQ5 I;  4MQ9 F;  2W1O A;  1TL8 A;  3DQV C;  2Y30 A;  3WTW C;  2K4J A;  4W1U A;  5B1B H;  5HVQ C;  3G3Z A;  3VEP A;  1BC7 C;  3NAR A;  4J01 A;  3Q0V A;  4WX9 A;  1SD6 A;  1G3S A;  2XAU A;  4HOB A;  1YQA A;  2VL8 A;  2FJ1 A;  1AWC A;  1Z6R A;  2AO9 A;  3BG3 A;  3ZMU A;  3WTT C;  1IXR C;  2KFD A;  1YW9 A;  4HX7 A;  1Y1W J;  2A05 A;  3VYT B;  3B73 A;  3KZY A;  1BOB A;  4HSR A;  3HOW J;  2B0L A;  3S93 A;  4XN0 A;  2JPB A;  4RBO A;  1V4R A;  2ELK A;  2Y0M A;  5KVR A;  1MSE C;  2M7A A;  2A07 F;  1OCC H;  4CYD A;  1WI3 A;  2ZKZ A;  3F6V A;  2M0C A;  3ZN0 A;  3EUA A;  2VE8 A;  2ELJ A;  5HS7 A;  3FZV A;  2EZK A;  3FMQ A;  1X3U A;  2M1B A;  3M1C A;  5EZG A;  1Z67 A;  3KP2 A;  3GVA A;  1ZTR A;  3J81 K;  2Y0S N;  4XLE A;  2HYJ A;  2O7O A;  3BTC A;  4ASN A;  5M5Y J;  3DCF A;  2XDV A;  1FPQ A;  3AG3 H;  3DP7 A;  1DGR M;  1PJR A;  3GBG A;  4LLL A;  3CDL A;  4BU2 A;  2ESN A;  2DPU A;  4IEJ A;  4P9U A;  1I1G A;  5CPR B;  1OPC A;  1ON1 A;  2W57 A;  3NAU A;  3BRO A;  1VQ6 I;  2OZ6 A;  5IPA A;  3HRU A;  3GTM J;  1A6I A;  3Q0U A;  2J5O A;  1IV8 A;  1T6S A;  5L3C A;  1UAA A;  4J00 A;  2XAJ A;  1XCB A;  3FF5 A;  4IHY A;  2DMP A;  3VSK A;  2DJI A;  5E3M A;  1WJ5 A;  3WOD F;  2V7F A;  3OV8 A;  1T98 A;  2XUB A;  1I5Z A;  3DU6 A;  1K4T A;  1X3W B;  3BC8 A;  2OC6 A;  3LA3 A;  4HPQ A;  1DPU A;  3RPQ A;  1NK2 P;  4HF2 A;  2CS3 A;  2CW7 A;  3QRF F;  3FHN A;  1RR7 A;  2V26 A;  1Z6T A;  2BOL A;  2Y75 A;  4JX5 A;  4E6K G;  2ZXW H;  3TKY A;  2ID3 A;  2VLA A;  2R7W A;  2MBF A;  2M2E A;  2NRA C;  2IS6 A;  3TDZ C;  2R7F A;  3IWF A;  1J0R A;  4M73 A;  2WY8 Q;  2FSW A;  2RAE A;  2JMW A;  3HJE A;  5DV5 A;  3ZQQ A;  3GTQ J;  3HC7 A;  1ETK A;  3DLA A;  1UZC A;  1RZ4 A;  2Q2E A;  4XNF A;  4KIC A;  2PQ8 A;  3TL4 X;  3E5X A;  3WU1 B;  4UVC A;  2M34 A;  2JTV A;  2FE3 A;  2F5V A;  2LTP A;  3BTI A;  4WXD A;  4V2F A;  3O2P E;  3DEW A;  1TWG J;  2LDU A;  1LUJ B;  4HW0 A;  5C4X J;  5K7H A;  2KJC A;  1GVJ A;  3SEQ A;  3RPU D;  2A5W A;  2ID6 A;  4HF0 A;  2PX9 A;  4PUS A;  4UY8 I;  5F04 A;  3MZH A;  2W00 A;  5E8G A;  2VOD A;  1MJB A;  3KET A;  5DYM A;  2E1M C;  1F43 A;  1HC8 A;  3CDI A;  1YE9 A;  2K3F A;  2KRF A;  2VC1 A;  4D5C A;  1LE8 A;  1OYW A;  3IHU A;  4LIU A;  1ZLJ A;  2O8X A;  2OCC H;  3JSP A;  3HG9 A;  3FK6 A;  5DCF A;  4QPQ A;  3H0D A;  2F6C A;  3KYL A;  4BXX J;  1V3F A;  1ONV A;  3PIO F;  2L3D A;  1JJ6 C;  4L5J A;  2V6E A;  3DPL C;  1RUO A;  1LB2 A;  3NWS A;  1R58 A;  3DBL B;  3GTK J;  1E3P A;  3BTJ A;  1FP2 A;  3CO7 C;  1FT9 A;  3ELK A;  2AXT C;  3QOE A;  2FUG 2;  3BR3 A;  3K7A J;  4LMY A;  1LVK A;  3SZP A;  1OCT C;  2XIG A;  3LMM A;  1MNM C;  1GDT A;  5CVV A;  2KRC A;  4AIH A;  2Y9Y A;  1OMI A;  3P9C A;  1WKM A;  2BVM A;  2JA6 J;  5HLH A;  4L0Z B;  2WWY A;  2QEX I;  1X3Z B;  4OMZ A;  1S7A A;  4Y17 A;  2H6B A;  4ENK A;  1FTZ A;  1W36 C;  3GX4 X;  4A3K J;  5D4S A;  2Q2E B;  4D0P A;  1SEU A;  1ULY A;  2KDZ A;  4L9J A;  3G4S I;  2CH0 A;  2RNG A;  4IVN A;  2F5F A;  3QPS A;  3CME I;  4M3F A;  3W6V A;  3S2H J;  2TCT A;  2F2E A;  1OYY A;  3K2A A;  4LG3 A;  2E2J J;  3M7G A;  3ZCO A;  3O3K A;  1ACI A;  5LRS A;  3CCQ I;  1K6Y A;  5EJC A;  4A3F J;  4HYE A;  5GTH C;  3JRE A;  5DEQ A;  1D1C A;  2ISY A;  3WU2 C;  5B66 C;  3QOP A;  3QQA A;  3DF8 A;  2L9V A;  3TED A;  4EGY A;  2RV8 A;  1ZAR A;  2G0E A;  2ECB A;  2HYF A;  2L4M A;  2H09 A;  3FIS A;  1ZAO A;  1WJE A;  4RGS A;  4BHB A;  2A5Y B;  1T56 A;  5K5R A;  4DNC A;  3BR1 A;  3CCV I;  3H3U A;  2JPC A;  4C30 A;  2PN6 A;  2BY2 A;  3IUO A;  3RKX A;  5IT9 K;  4BQQ A;  2EIM H;  2R7X A;  3HL2 A;  2NOJ B;  2GLO A;  2X48 A;  5LGU A;  1HW2 A;  4A3I J;  3TQN A;  4ZTF A;  3ZQG A;  3I9V 2;  5KAI C;  3QP6 A;  3VB2 A;  2ZNY A;  2IGM A;  1U5T C;  3LSG A;  4YRV A;  2LBF A;  3ZN1 A;  1MBF A;  4M9Z A;  1QQI A;  2O6G E;  2DCE A;  1ZRC A;  4A3C J;  4EEF G;  2A69 F;  2LY9 A;  3B6A A;  2EFW A;  4KFC A;  4UB6 C;  1SVM A;  1FTT A;  2YS9 A;  1MW7 A;  2OTJ I;  5E1X A;  1X1B A;  2DDA A;  2QYO A;  4MIM A;  3GTJ J;  2LNB A;  1S3J A;  2IGK A;  4PSX A;  1VZ0 A;  1K6O A;  5LFA A;  2Q8K A;  4BAC A;  2OQG A;  2QCO A;  2LK2 A;  2EBI A;  1SC7 A;  4DBQ A;  2ZFU A;  2MG4 A;  4ESB A;  2ACJ A;  5J47 A;  2EFN A;  2QSF X;  1PUF A;  1YRN A;  1MIJ A;  5FB2 A;  3CJQ B;  1Y39 A;  4IHS A;  2LKP A;  4YFN F;  1Y1V J;  4IXA A;  1U5T A;  1W5S A;  4YEL A;  4BQN A;  2STW A;  3W2W A;  1O3S A;  4I7H A;  3FMR A;  4WK8 F;  3MZY A;  3L00 A;  4S0H B;  5H20 A;  5B1A H;  4RB1 A;  4Z2Y A;  3Q0W A;  1UHW A;  2O9L A;  2XGX A;  1XMK A;  3REO A;  3G1O A;  1KGS A;  2M8E A;  2QQB A;  4HZF A;  3RKQ A;  3LOC A;  4FT8 A;  3SEZ A;  3J7Z I;  3A02 A;  2DFI A;  1IN4 A;  2OU2 A;  3K10 A;  3V8K A;  5AIQ A;  1A31 A;  3HOY J;  3F8F A;  5LHI A;  5F0C A;  1B72 A;  5K5Q A;  1J09 A;  1O7L A;  3PIP F;  1SD5 A;  4PGG A;  4RGR A;  3OYE A;  2X6W A;  3QOD A;  1YLF A;  4GYI A;  4EJT A;  2JZY A;  3Q5F A;  2XPV A;  1BM9 A;  3VFZ A;  1MBJ A;  1QPI A;  1ITY A;  4C3I J;  2F5C A;  2EV5 A;  2M5W A;  1LFB A;  4EQQ A;  3BPX A;  2WC2 A;  5HS9 A;  3BOQ A;  4HLX A;  5DTD A;  1KON A;  1I1S A;  2DA4 A;  1GV5 A;  1YO5 C;  2DA1 A;  3LFK A;  1D5V A;  1WH5 A;  2AS5 F;  3DFG A;  1TT0 A;  3M8E A;  2GIV A;  2MGQ A;  5BQT A;  3HIF A;  2WV1 A;  1MNE A;  1H9G A;  1W7P A;  1V5E A;  5IP6 A;  3F9K A;  4E70 A;  3VDX A;  2COM A;  2FOW A;  2XPU A;  2K7L A;  1WPK A;  4HRI A;  3JTH A;  1D8J A;  1B1B A;  3QWL A;  2V9P A;  2BXY A;  1S29 A;  3KP3 A;  1UST A;  3ERE D;  1LDJ A;  3PQK A;  3ZMD A;  5F64 A;  1A04 A;  1TBX A;  1YS6 A;  4HBL A;  4HDV A;  5D5U B;  5GAE J;  3CTA A;  3CCE I;  1UCR A;  3J81 Z;  3NQO A;  3HOS A;  1IF1 A;  2V1U A;  1PUF B;  3ZQF A;  1YRN B;  1L3L A;  4I02 A;  3QPL A;  2HPM A;  2GOX B;  3F6O A;  2LY2 A;  1LFU P;  1U5T B;  2XSJ C;  3V8J A;  3ASN H;  3FX3 A;  1BR2 A;  3M07 A;  1XTA A;  1MMD A;  2LRE A;  1ZGW A;  1Z91 A;  3DKX A;  2E7W A;  1ZHF A;  1ZG3 A;  2CUZ A;  3I4M J;  2NVU B;  4O5V A;  1BA5 A;  4RA2 A;  5D5V B;  4S05 A;  3WTX C;  3IH3 A;  3I54 A;  2QZ8 A;  3KLO A;  5AIP A;  3C1D A;  1EKE A;  1JT6 A;  2NVQ J;  1T33 A;  2NVT J;  5L3D A;  2OD5 A;  4XLP F;  3PUF A;  4AVP A;  2B63 J;  3LA7 A;  4D7M A;  4CCO A;  4Y13 A;  3CDH A;  2ESH A;  2HQN A;  3CF2 A;  5ILV A;  1XGM A;  3WE2 A;  5IYD J;  1WJF A;  2X6O A;  1N77 A;  3ZGK A;  4F93 B;  3S2D J;  1R23 A;  1BR4 A;  4Y15 A;  3OMY A;  1HBX G;  2XRL A;  1ZG5 A;  3S1M J;  3I59 B;  2NVX J;  3HOU J;  1MJ9 A;  5GPC A;  4M71 A;  3L09 A;  2VI6 A;  3SFI A;  4PJL A;  2R5Z B;  1E3H A;  3K70 D;  1I6H J;  3BJO A;  4XRF A;  2UUZ A;  1IV6 A;  2R4G A;  5JI6 A;  2OTL I;  1FOX A;  3LFU A;  3VOE A;  2R7Z J;  5IP9 J;  1R5I D;  1IW7 F;  1IAW A;  3LSR A;  2YU9 J;  2FBH A;  1WVR A;  1MMS A;  4DYR A;  3RKW A;  3T8T A;  3FM5 A;  1SVL A;  1KQ8 A;  2JA8 J;  1T0F C;  5FKO A;  1W7P B;  5E20 A;  5EZH A;  4D1Q A;  1FYL A;  4LB5 A;  2L02 A;  3BPV A;  4LIT A;  4N9I A;  3GZN B;  1SAN A;  3ZMZ A;  4LK1 F;  5FKL A;  2ICW G;  2J5P A;  2EIN H;  2D1H A;  5F08 A;  1X2N A;  1IDY A;  4HV6 A;  1U9N A;  4CCN A;  2R7R A;  1XMX A;  4P96 A;  4AID A;  1FX7 A;  3GLL A;  2MH2 A;  2XGE A;  2Z9O A;  3BR5 A;  2EWN A;  2XAQ A;  2D5V A;  1W4M A;  3KPH A;  3WG9 A;  2JA2 A;  5HDG A;  1I27 A;  4YFX F;  2P7C B;  1ZGA A;  5HS8 A;  5EEA A;  1F4K A;  3J7A Y;  1KYW A;  3D5R C;  5JLW A;  2I5U A;  1J2X A;  1XGN A;  3MVP A;  2DA3 A;  4G7O F;  2EH3 A;  4BHC A;  4I01 A;  3RJP A;  1QNT A;  1TQI A;  2A6E F;  5E1W A;  1Y0N A;  3HSF A;  5DD4 A;  3DTE A;  1X1C A;  3NWT A;  3ZOB A;  5DS9 A;  2YUS A;  5ICF A;  4BAY A;  1VQL I;  2IEK A;  1IDZ A;  3SXY A;  2LKX A;  4KN7 X;  5E79 C;  2L4A A;  3BZ6 A;  4M6V A;  4JYK A;  5K1Y A;  1B9M A;  4CHU A;  2RDP A;  1DU0 A;  3VWB A;  1BIB A;  4PJN A;  1KZH A;  1D3Y A;  2N8G A;  5BPD A;  3EUK L;  3HKZ A;  4RDU A;  4AVZ A;  3BJ6 A;  3A01 A;  4OAY A;  4HX4 A;  4FE7 A;  4ZYH A;  1JKO C;  5TIS C;  2LP0 A;  2O03 A;  4KT6 A;  2R7T A;  2R7V A;  2JT1 A;  4C9Y A;  2GXA A;  4Q48 A;  5E18 F;  1KU9 A;  2EZL A;  1D8K A;  1SFK A;  5CLS A;  1J75 A;  2IPQ X;  5H2F C;  3J7A O;  5F6F A;  4CO8 A;  3KP4 A;  5D6F A;  1G2H A;  3EUH C;  4BL0 B;  1ZH5 A;  3AFH A;  2BGC A;  3S2W A;  4MNU A;  1U2W A;  3TP3 A;  1LFP A;  4BQA A;  4JP0 A;  4C2U A;  2VON A;  4W97 A;  4LOC A;  3OOP A;  4YIF A;  1RUN A;  3WHC A;  4AD9 A;  2HVQ A;  1RR8 C;  1Z1D A;  4HNV A;  2VAS A;  4XRS A;  1R1T A;  2Y9Z A;  3CLO A;  1GXP A;  3LSM A;  3OYF A;  5F27 A;  1IG7 A;  2X51 A;  4M3E A;  2E35 A;  3CCY A;  3IH4 A;  1J7K A;  3B02 A;  5L3F A;  5IYC J;  3V4G A;  5A2Q Z;  1J5Y A;  3U2R A;  1W5T A;  3J80 K;  3TO9 A;  4AC0 A;  2DMN A;  4M3G A;  2D2W A;  3E5Q A;  2LF8 A;  1Z05 A;  3LQR A;  2QA4 I;  1A5J A;  3ISP A;  3C3W A;  3EUH A;  1T08 B;  1OIS A;  4R1H A;  5LD2 C;  2RC4 A;  3I58 A;  1R6R A;  2KIM A;  2A61 A;  2IVM A;  2AQF A;  3F8B A;  4FX4 A;  5J8C A;  3MMY B;  5EGO A;  2VKV A;  3CQZ J;  5FGM A;  1F1Z A;  1I3A A;  4B47 A;  5FJ8 J;  1ERD A;  3LL7 A;  1PYV A;  2PJR B;  3PUB A;  2QBY B;  1QU3 A;  1G8X A;  2H1L A;  1E17 A;  3QYB A;  2ZXJ A;  1Z7L A;  3V7S A;  3K4B A;  3S1Q J;  1MBH A;  3H0G J;  4E7J A;  1EH7 A;  1JKP C;  4B09 A;  4KNY A;  3ZMT A;  1Z0X A;  2HDD A;  2E34 A;  2MD0 A;  2RQQ A;  2PMZ N;  4IOA F;  1BOA A;  3GTG J;  4I6Z A;  2XF6 A;  2L5Q A;  3DWL E;  4B43 A;  2UWM A;  1ETY A;  1O7F A;  5ICE A;  4PZJ A;  1APL C;  4WWC A;  4BNC A;  2XSD C;  5L3G A;  1DUX C;  1TW3 A;  3QU6 A;  4B48 A;  1IN5 A;  2V9V A;  2OZU A;  3BQY A;  3E3V A;  3LST A;  3ZQC A;  3L9F A;  3OS1 A;  3TW7 A;  1LEA A;  1E3O C;  4E7Z A;  2FQ4 A;  3VOD A;  1R1V A;  3A4C A;  3A01 B;  2CW0 F;  5DCM B;  3JAM Z;  3QU3 A;  1KU2 A;  4XL9 A;  3U21 A;  3RSN A;  2D1V A;  4H4K C;  3C18 A;  3KP7 A;  4XLF A;  3F21 A;  4E7S A;  3ABT A;  1POG A;  3HSR A;  2K9L A;  4K2E A;  3ONQ A;  4KIB A;  2DA6 A;  2JQ7 A;  2XAF A;  1P9Q C;  2XKP A;  1QVT A;  1YOV B;  2ZJP F;  1T39 A;  2EV6 A;  2K9M A;  2X85 A;  2R3S A;  1F36 A;  4XLH A;  5E8I A;  2Y31 A;  1TNT A;  2KZV A;  1FBS A; 
#chains in the Genus database with same CATH homology
 3GLX A;  1S6L A;  3V8L A;  3HRM A;  2OA4 A;  4FX0 A;  3WGG A;  2ZCW A;  5HOO A;  2CG4 A;  3HHH A;  4CXF A;  4LB6 B;  3F22 A;  3WGH A;  3EET A;  1J9I A;  3WTV C;  2P6S A;  2CWE A;  5CVU A;  2XAH A;  2EB7 A;  4I09 A;  3HTS B;  1YIO A;  4JQF A;  2PJP A;  1EV7 A;  2NAZ A;  1MZB A;  1XSD A;  3NRV A;  2GA2 A;  2Q0O A;  4WXH A;  2V1X A;  4N0B A;  1FOK A;  3DV8 A;  4GYG A;  3KE2 A;  1QGP A;  3DEU A;  4MEX F;  2VT3 A;  2F5D A;  2KKO A;  2EA4 A;  1R7J A;  4H0E A;  4PDK A;  2L01 A;  2DLL A;  4MGR A;  2XAS A;  4Q4Z F;  4EM0 B;  3K0L A;  3F8M A;  2Z99 A;  1XSV A;  4KN4 X;  1LDK B;  3GXO A;  1SFX A;  3FM3 A;  4EMS A;  4KUM A;  3GUD A;  1XB4 A;  2EFP A;  5L3B A;  5BS6 A;  2P5L C;  4M6Y A;  2GAU A;  3LA2 A;  3R6S A;  2FBI A;  2G9W A;  5FO5 A;  1LVA A;  4CGZ A;  3CO6 C;  3IWZ A;  2VOP A;  2VBZ A;  2QVO A;  1VTN C;  4G9Y A;  1XCV A;  3IKV A;  4RS8 A;  2W24 A;  5FLX Z;  3QP5 A;  1LEB A;  4L5I A;  3RPU A;  3ULQ B;  1SD4 A;  3SZT A;  2FML A;  4O3M A;  2DT5 A;  5CYV A;  4RB3 C;  2NNY A;  1H9T A;  4UNO A;  2IA1 A;  4M74 A;  1C0W A;  2M87 A;  4P55 A;  3KFW X;  1JHH A;  4OIN F;  5BPI A;  2X0L A;  3RKY A;  4LLN A;  2GQQ A;  1DPR A;  3P9I A;  4EJU A;  1YS7 A;  4EM1 A;  3T1B A;  1B59 A;  2FMY A;  4XSX F;  4WF2 A;  1G3Y A;  2ZNZ A;  3I4P A;  1F9N A;  3KZZ A;  5HDN A;  2Z33 A;  1ZRE A;  3ECO A;  1BBY A;  5FFX A;  2KIF A;  3GZ5 A;  1UHM A;  1O3Q A;  5LHG A;  1OKR A;  2ZFW A;  2CYY A;  1U78 A;  1HSJ A;  4NHJ A;  1DP7 P;  5J6X A;  2GXB A;  3I53 A;  1QZZ A;  5JFR A;  3DPT A;  4XLN F;  2BE5 F;  2MLG A;  4I0B A;  3CJN A;  4BXU A;  1LNW A;  4HA8 A;  1XN7 A;  3DXJ F;  4IJA A;  1FNN A;  2F5E A;  3M9A A;  3HHG A;  2ELH A;  1R22 A;  2QQA A;  4Q5S F;  2CQK A;  3RYP A;  2PG4 A;  2DQR A;  4G8X A;  2JSC A;  1HKQ A;  5ICC A;  3LAP A;  2FQ3 A;  2HKX A;  1XDS A;  1XD7 A;  4EJO A;  2FOK A;  3K9T A;  3U9G A;  3I59 A;  3R0A A;  4U0Y A;  4ZYG A;  4L9T A;  2MH9 A;  3KP6 A;  5LLQ A;  5DD8 A;  1CF7 A;  2IW5 A;  3ZPL A;  5HDK A;  5H6Q A;  5E17 F;  2TDX A;  4B8X A;  3GO5 A;  5DUK A;  4BH9 A;  4ON0 A;  4LK0 F;  4GO1 A;  4G94 A;  3R61 A;  1FY7 A;  2M45 A;  3WTY C;  1UFM A;  4UHT A;  1O3T A;  4KIG A;  1Q1H A;  4KIF A;  3E6M A;  4IF4 A;  4RAZ A;  1FP1 D;  1HQC A;  1F5T A;  3GF2 A;  2DW4 A;  4UV9 A;  4MQV A;  2PI0 A;  3DKW A;  5D5W B;  4ZH4 F;  4LD5 A;  5FD6 A;  1U6G A;  4ENN A;  2P6T A;  2ADU A;  4CIC A;  1GXQ A;  4OIQ F;  2IRF G;  1TNS A;  5DDG A;  1IXS B;  3PQJ A;  4MHG A;  2Y48 A;  3EDP A;  5E1Z B;  4TV7 A;  3EYI A;  4OU0 A;  2A6H F;  2VN2 A;  5LBQ A;  2VBY A;  1K79 A;  4JK1 X;  1CF7 B;  2KIU A;  1IN7 A;  3IRQ A;  4AWX B;  1TW2 A;  2DAO A;  3KEO A;  1FYM A;  2D45 A;  5TRD A;  4EGZ A;  5FD5 A;  3RDI A;  2CGP A;  1IN8 A;  1S8N A;  1WI9 A;  2Z5U A;  3ECH A;  5D4R A;  2JRT A;  3P7N A;  4YG2 F;  1XDU A;  3M1E A;  1OR7 A;  1TQP A;  1XSX A;  4UXN A;  4XBF A;  2CSO A;  3KEQ A;  3JTG A;  1MKM A;  2W85 A;  3QPT A;  1Y0U A;  2LSO A;  5K5O A;  3KCC A;  3F8C A;  2QBY A;  5CVI A;  3F8N A;  2RVC A;  3CUQ B;  3TO7 A;  1BC8 C;  2GXG A;  1BJA A;  3IRR A;  2PMU A;  3R4K A;  4F7Z A;  3F72 A;  1J59 A;  1DDN A;  2NNN A;  1B6A A;  5DCM A;  2VT2 A;  2QLZ A;  2OBP A;  2QUF A;  3ZQ7 A;  3ZP5 A;  2A3S A;  1Z9C A;  3GFM A;  3NEU A;  4LLG F;  2ZO4 A;  3KLN A;  2YPR A;  3GYH X;  3TOB A;  3BP8 A;  2XAG A;  4UUV A;  2FNA A;  5D8L B;  1LJ9 A;  3K1P A;  3QPH A;  3HTU A;  1FSH A;  4BHP A;  2DQL A;  4ENM A;  1KQ0 A;  2VOO A;  4YII A;  2GWR A;  2UXX A;  3R60 A;  1P4X A;  2AXL A;  4KMU X;  1ON2 A;  2XRN A;  1AOY A;  1FC3 A;  4G6Q A;  2DK5 A;  2ZBK A;  4NQW A;  3D5L A;  3BY6 A;  4CDG A;  5D8K B;  3F23 A;  1WRJ A;  5IT9 Z;  2MLK A;  2L54 A;  4HQE A;  1RIO H;  4N9H A;  1MDM A;  2STT A;  2HOE A;  4QWQ A;  1BI1 A;  1NHA A;  2XRO A;  2KJB A;  2YX7 A;  1XGS A;  3P9K A;  4M9S A;  1IN6 A;  5IT3 A;  3GFJ A;  1I6X A;  3GEZ A;  1K7A A;  3ML6 A;  2HWV A;  5H6R A;  2DU9 A;  4IRI A;  5D5X B;  3HYI A;  5LGN A;  1G3T A;  2QM3 A;  1BI0 A;  1SMT A;  3T8R A;  2HTJ A;  4JBA A;  1P6R A;  4LJZ F;  3Q9S A;  1WWX A;  3K1M A;  3I5U A;  1P4A A;  5ERI A;  2YU3 A;  1R36 A;  2ISZ A;  1IUY A;  1B9N A;  3EYY A;  4M72 A;  4MTE A;  3TOA A;  1R00 A;  3K69 A;  4A12 A;  2HS5 A;  2FA5 A;  1K78 A;  2ZJ2 A;  3U1D A;  3F3X A;  1YYV A;  1YTY A;  3BWG A;  2DI3 A;  5ILU A;  5F1R A;  4OIR F;  4IHT A;  4RGX A;  2C6Y A;  2FEZ A;  3SFZ A;  3E6D A;  2NYX A;  1EH8 A;  1H0M A;  3BDD A;  3L2C A;  1PUE E;  4HQM A;  5EEH A;  2OQR A;  1MDM B;  1T2K A;  4RB0 A;  4GXO A;  3LWF A;  3MEX A;  4U7D A;  2VXZ A;  4O6J A;  3HSE A;  2G7H A;  3WGI A;  2VBX A;  2EJR A;  2QWW A;  2XKO A;  2HTS A;  2HYG D;  4I98 B;  2BV6 A;  5J8F A;  4LG0 A;  3Q9V A;  3ZMS A;  2G7U A;  4WXC A;  2MD5 A;  1RNL A;  3GW2 A;  3TO6 A;  2HZT A;  3FHZ A;  1G4D A;  4KYW A;  5L3E A;  1JXS A;  4HX8 A;  5TJJ A;  1QO0 D;  4DQ2 A;  5LGT A;  2RN7 A;  3M8F A;  1ODD A;  1YW7 A;  5D6E A;  4L9V A;  4CZZ A;  1SD7 A;  2EK5 A;  1P2F A;  3BJA A;  1WSU A;  4I2O A;  1FLI A;  4EJW A;  1K78 B;  2E1N A;  4HF1 A;  4L18 B;  2WV0 A;  3FXU A;  5BMZ A;  3H92 A;  2HR3 A;  4G7Z F;  1KYZ A;  1XMA A;  1LQ1 A;  3N4M A;  1REP C;  2IA0 A;  1PDN C;  2K86 A;  5EEG A;  3JSO A;  4ZZL A;  4L9N A;  3E5U A;  3N97 A;  2P5K A;  1YFH A;  4NB5 A;  1RI7 A;  4ZYD A;  1XGO A;  2XVC A;  3V7R A;  2DPD A;  3GFI A;  3ABU A;  2H6C A;  4LG0 B;  1WQ2 A;  2PBI A;  4A5N A;  4LGW A;  4ZYE A;  2W84 A;  2A68 F;  2K02 A;  5HLI A;  2V79 A;  2H27 A;  4G7H F;  2QQ9 A;  4I0A A;  1KA8 A;  4RGU A;  3T0Y A;  2K27 A;  1LDD A;  2BYV E;  3FXQ A;  2K4B A;  2DBB A;  3GZ6 A;  1IRG A;  2EV0 A;  2GA1 A;  2VE9 A;  4A6D A;  4U7B A;  4EV0 A;  3W6K B;  4OOI A;  3FMS A;  5JVT A;  4EVI A;  4HV5 A;  2P4W A;  2IJL A;  2YX4 A;  5A2Q K;  1SFU A;  1ZRF A;  1QBJ A;  1GHC A;  1BI2 A;  1HW1 A;  4ESF A;  3FXR A;  2EA2 A;  3ZMV A;  2FNP A;  3HUG A;  1FZP B;  1OYI A;  4KMF A;  2EFO A;  2P8T A;  2P7V B;  4U88 A;  3AAF A;  1ZYR F;  1QPM A;  5CVR A;  1O57 A;  3C7J A;  1B4A A;  1STZ A;  3O6B B;  3G73 A;  3TDU C;  3FWE A;  1S7O A;  2XHK A;  2HEO A;  2HQR A;  2VBW A;  3J80 Z;  4MTD A;  4PCQ A;  3SQN A;  4A0Y A;  3JAM K;  3MWM A;  2YSR A;  5JHU A;  1KQ9 A;  2CFX A;  2RGV A;  1Z7U A;  5LEJ A;  2EFQ A;  2IA2 A;  1R5G A;  1W7P D;  4EM2 A;  4A5M A;  5LEK A;  2VC0 A;  1P92 A;  1HXD A;  2UZK A;  1QZY A;  2RNJ A;  4GCV A;  1ZGJ A;  3K2Z A;  2MA3 A;  5ILS A;  3HRT A;  3MFK A;  2FXA A;  1IZ1 A;  2FF4 A;  4OIO F;  3CUQ C;  4AIJ A;  4R79 A;  1MD0 A;  1U8R A;  4IPA A;  4A2U A;  3WTZ A;  2BBY A;  4BYY A;  1YG2 A;  4KA4 A;  4P9F A;  5JR3 A;  5CJ9 A;  3RIR A;  3K1N A;  2BEO A;  3H3Z A;  3D0S A;  1UB9 A;  1MGT A;  2PMH A;  1YW8 A;  5ED4 A;  5HLG A;  3WTU C;  3CUQ A;  1T38 A;  1KU7 A;  3HRS A;  2E1C A;  4GGG A;  3I71 A;  4QLC U;  1USS A;  1SFE A;  2ETH A;  1MJA A;  3SHF A;  2ZME A;  4RAY A;  2P5V A;  4ZZD A;  2O0Y A;  1HST A;  1ZN2 A;  2DK8 A;  3GWZ A;  5AON A;  5BOX A;  2H94 A;  4OMY A;  1JE8 A;  2HGC A;  2GZW A;  2O3F A;  1CGP A;  1PP7 U;  1JHF A;  1SMY F;  3R0J A;  4HDU A;  1JGS A;  4S04 A;  3TGN A;  4ENJ A;  3CUO A;  2V6C A;  4P5O A;  4OIP F;  2LF7 A;  1TTY A;  2RQP A;  2FU4 A;  4FHT A;  1ZLK A;  1KU3 A;  2FBK A;  3MAJ A;  4A6E A;  2CO5 A;  3IL2 A;  2DO7 A;  3E97 A;  4UV8 A;  1BIA A;  5LRR A;  2YR2 A;  3I64 A;  3COA C;  3RYR A;  5FFZ A;  2RKH A;  2UXN A;  4A0Z A;  4AIK A;  1R1U A;  4RB2 C;  3JW4 A;  5FLX K;  5CVJ A;  2FRH A;  4G6D A;  4XSZ F;  2WTE A;  1ZG1 A;  3LQQ A;  3IC7 A;  2QEN A;  4ETS A;  4M6X A;  4HAM A;  2O61 A;  1FSE A;  2PFB A;  4ESJ A;  4HLY A;  2XV4 S;  1G3W A;  4MEY F;  1P4W A;  2R7D A;  1IXC A;  4UVA A;  2ZME B;  1FBQ A;  1HKT A;  3E6C C;  1T0F A;  3HOT A;  4R8H A;  4WCG A;  2HDC A;  5ICG A;  1HW5 A;  2DTR A;  1G6N A;  2OAZ A;  1BI3 A;  4UVB A;  3RTR A;  4U0V A;  1ZRD A;  2HFH A;  3EQL F;  3KP5 A;  3V7C A;  3MQ0 A;  3IKT A;  1HKS A;  3PFI A;  2MC3 A;  3I0T A;  5KK1 A;  4IRH A;  2W25 A;  3WTS C;  3ROU A;  2HKO A;  1TLH B;  6PAX A;  4PGH A;  2NS0 A;  1O3R A;  1R5H A;  4L0Y B;  1PP8 F;  5LHH A;  3RI4 A;  5DUI A;  2E7X A;  3GFL A;  2PEX A;  1SAX A;  2X4H A;  3L7W A;  4LFU A;  1IRF A;  2Z3Y A;  4A0X A;  3W6J B;  1BN5 A;  2IP2 A;  3WU0 A;  4Q47 A;  2PLY A;  3LAJ A;  2V1D A;  1TQM A;  1L0O C;  4U0W A;  4EJV A;  1U3E M;  1FBU A;  4KT5 C;  2IT0 A;  1E2X A;  4IRG A;  2M30 A;  1FYK A;  3MCZ A;  3WE3 A;  3QAH A;  4YFK F;  4M9X A;  3E6B A;  1FWZ A;  4KDP A;  3T5X A;  4MQ9 F;  3DQV C;  3WTW C;  2K4J A;  5HVQ C;  3G3Z A;  3VEP A;  1BC7 C;  4WX9 A;  1G3S A;  1SD6 A;  4HOB A;  1YQA A;  1AWC A;  1Z6R A;  3ZMU A;  3WTT C;  1IXR C;  1YW9 A;  4HX7 A;  3B73 A;  3KZY A;  2B0L A;  2JPB A;  1V4R A;  2Y0M A;  5KVR A;  2A07 F;  4CYD A;  2ZKZ A;  3F6V A;  3ZN0 A;  2VE8 A;  5HS7 A;  3FZV A;  3FMQ A;  1X3U A;  2M1B A;  3KP2 A;  3GVA A;  3J81 K;  4ASN A;  1FPQ A;  3DP7 A;  4LLL A;  2ESN A;  2DPU A;  4P9U A;  1I1G A;  1OPC A;  1ON1 A;  2W57 A;  3BRO A;  2OZ6 A;  3HRU A;  2J5O A;  1T6S A;  5L3C A;  2XAJ A;  1XCB A;  3FF5 A;  3WOD F;  3OV8 A;  1T98 A;  2XUB A;  1I5Z A;  3LA3 A;  1DPU A;  3RPQ A;  4HF2 A;  3QRF F;  1Z6T A;  2Y75 A;  3TKY A;  2MBF A;  2NRA C;  3TDZ C;  2R7F A;  3IWF A;  1J0R A;  4M73 A;  2FSW A;  5DV5 A;  1RZ4 A;  2Q2E A;  4KIC A;  2PQ8 A;  3E5X A;  3WU1 B;  4UVC A;  2JTV A;  2FE3 A;  4WXD A;  3O2P E;  2LDU A;  4HW0 A;  2KJC A;  1GVJ A;  4HF0 A;  3MZH A;  5E8G A;  2VOD A;  1MJB A;  3KET A;  5DYM A;  2KRF A;  2VC1 A;  1OYW A;  3IHU A;  3JSP A;  1ZLJ A;  2O8X A;  5DCF A;  1V3F A;  1ONV A;  2L3D A;  4L5J A;  3DPL C;  1RUO A;  1LB2 A;  1R58 A;  1FP2 A;  3CO7 C;  1FT9 A;  3ELK A;  4LMY A;  3SZP A;  2XIG A;  5CVV A;  4AIH A;  1OMI A;  3P9C A;  1WKM A;  5HLH A;  4L0Z B;  2WWY A;  4OMZ A;  1S7A A;  4Y17 A;  2H6B A;  4ENK A;  3GX4 X;  5D4S A;  4D0P A;  1ULY A;  4L9J A;  4IVN A;  2F5F A;  2F2E A;  1OYY A;  3M7G A;  3O3K A;  5LRS A;  4HYE A;  5DEQ A;  2ISY A;  3QOP A;  3DF8 A;  4EGY A;  2RV8 A;  1ZAR A;  2HYF A;  1FBS A;  2L4M A;  2H09 A;  1ZAO A;  4RGS A;  4BHB A;  2A5Y B;  5K5R A;  4DNC A;  3H3U A;  2JPC A;  2PN6 A;  3RKX A;  5IT9 K;  5LGU A;  1HW2 A;  3TQN A;  3QP6 A;  3VB2 A;  2ZNY A;  1U5T C;  3ZN1 A;  4M9Z A;  1QQI A;  2O6G E;  1ZRC A;  2A69 F;  2EFW A;  4KFC A;  5E1X A;  2QYO A;  2LNB A;  1S3J A;  1K6O A;  2Q8K A;  2OQG A;  4ESB A;  2ACJ A;  2EFN A;  5FB2 A;  4IHS A;  2LKP A;  4YFN F;  4IXA A;  1U5T A;  1W5S A;  2STW A;  1O3S A;  4I7H A;  3FMR A;  4WK8 F;  3MZY A;  3L00 A;  5H20 A;  4RB1 A;  4Z2Y A;  1UHW A;  2XGX A;  1XMK A;  3REO A;  1KGS A;  2M8E A;  2QQB A;  4HZF A;  4FT8 A;  2DFI A;  1IN4 A;  2OU2 A;  3V8K A;  5AIQ A;  3F8F A;  5LHI A;  5K5Q A;  1O7L A;  1SD5 A;  4PGG A;  4RGR A;  4EJT A;  1YLF A;  4GYI A;  2JZY A;  3Q5F A;  1BM9 A;  3VFZ A;  2F5C A;  2EV5 A;  2M5W A;  4EQQ A;  3BPX A;  2WC2 A;  5HS9 A;  3BOQ A;  4HLX A;  1I1S A;  1YO5 C;  3LFK A;  1D5V A;  2AS5 F;  3DFG A;  3M8E A;  2GIV A;  5BQT A;  3HIF A;  1H9G A;  1W7P A;  4E70 A;  2COM A;  2K7L A;  3JTH A;  1D8J A;  1B1B A;  1S29 A;  3KP3 A;  1UST A;  3ERE D;  1LDJ A;  3PQK A;  3ZMD A;  5F64 A;  1A04 A;  1TBX A;  1YS6 A;  4HBL A;  4HDV A;  5D5U B;  3CTA A;  1UCR A;  3J81 Z;  3NQO A;  3HOS A;  1IF1 A;  2V1U A;  1L3L A;  4I02 A;  3F6O A;  1U5T B;  3V8J A;  3FX3 A;  1Z91 A;  2E7W A;  1ZHF A;  1ZG3 A;  4O5V A;  5D5V B;  4S05 A;  3WTX C;  3I54 A;  2QZ8 A;  3KLO A;  5AIP A;  3C1D A;  5L3D A;  2OD5 A;  4XLP F;  4AVP A;  3LA7 A;  4Y13 A;  3CDH A;  2ESH A;  2HQN A;  5ILV A;  1XGM A;  3WE2 A;  1R23 A;  1HBX G;  4Y15 A;  1ZG5 A;  3I59 B;  1MJ9 A;  4M71 A;  3L09 A;  3BJO A;  4XRF A;  5JI6 A;  3VOE A;  1IW7 F;  1IAW A;  2FBH A;  3RKW A;  3T8T A;  3FM5 A;  1KQ8 A;  1W7P B;  5E20 A;  1FYL A;  4LB5 A;  2L02 A;  3BPV A;  4N9I A;  3ZMZ A;  4LK1 F;  2J5P A;  2D1H A;  4HV6 A;  4P96 A;  2Z9O A;  1FX7 A;  2MH2 A;  2EWN A;  2XAQ A;  1W4M A;  3WG9 A;  5HDG A;  1I27 A;  4YFX F;  2P7C B;  1ZGA A;  5HS8 A;  1F4K A;  1KYW A;  1J2X A;  1XGN A;  4G7O F;  4BHC A;  4I01 A;  3RJP A;  1QNT A;  1TQI A;  2A6E F;  5E1W A;  3HSF A;  5DD4 A;  5ICF A;  4BAY A;  3SXY A;  4KN7 X;  2L4A A;  3BZ6 A;  5K1Y A;  1B9M A;  4CHU A;  2RDP A;  1BIB A;  1D3Y A;  5BPD A;  3BJ6 A;  4HX4 A;  4ZYH A;  2O03 A;  2JT1 A;  4Q48 A;  5E18 F;  1KU9 A;  1D8K A;  5CLS A;  1J75 A;  2IPQ X;  3J7A O;  5F6F A;  4CO8 A;  3KP4 A;  5D6F A;  1ZH5 A;  2BGC A;  3S2W A;  4MNU A;  1U2W A;  4BQA A;  2VON A;  3OOP A;  4YIF A;  1RUN A;  4AD9 A;  1Z1D A;  1R1T A;  3CLO A;  1GXP A;  1J7K A;  3B02 A;  5L3F A;  3V4G A;  5A2Q Z;  1J5Y A;  3U2R A;  1W5T A;  3J80 K;  3TO9 A;  2D2W A;  3E5Q A;  2LF8 A;  1Z05 A;  3LQR A;  3ISP A;  3C3W A;  3EUH A;  4R1H A;  2RC4 A;  3I58 A;  2KIM A;  2A61 A;  2IVM A;  3F8B A;  4FX4 A;  5J8C A;  5FGM A;  1F1Z A;  2QBY B;  1E17 A;  2ZXJ A;  3V7S A;  1EH7 A;  4KNY A;  4B09 A;  3ZMT A;  1BOA A;  2UWM A;  1O7F A;  5ICE A;  4PZJ A;  4WWC A;  4BNC A;  5L3G A;  1DUX C;  1TW3 A;  3QU6 A;  1IN5 A;  2V9V A;  2OZU A;  3LST A;  3E3V A;  3L9F A;  1LEA A;  3VOD A;  1R1V A;  2CW0 F;  5DCM B;  3JAM Z;  3QU3 A;  1KU2 A;  2D1V A;  3C18 A;  3KP7 A;  3F21 A;  3ABT A;  3HSR A;  4K2E A;  4KIB A;  2XAF A;  2XKP A;  1T39 A;  2EV6 A;  2R3S A;  5E8I A;  1TNT A;  1EH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...