3CD6I

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cd6I00
2NXNB 5GADJ 2QA4I 1YI2I 2JQ7A 5GAGJ 3CD6I 3PIPF 1YIJI 1VQOI 1VQKI 2ZJQF 4V19K 3CCSI 2OTLI 1YJWI 1VQ7I 2H8WA 3CCRI 2FOWA 5GAHJ 2K3FA 4IOAF 1YHQI 2ZJRF 1HC8A 3G4SI 1VQPI 1VQ4I 1FOYA 3J7YJ 3CCJI 1VQ6I 3CMAI 3CCMI 2E35A 3J7ZI 3CCQI 1Y39A 1MMSA 1QA6A 2ZJPF 2E36A 1VQNI 4UY8I 3CC2I 1VQMI 3CC7I 4IO9F 3CCEI 3CF5F 3CCVI 1FOWA 1VQ5I 2OTJI 1S72I 5DM6F 3G71I 3PIOF 5JVGF 3I55I 3I56I 3CCUI 3CJTB 3CC4I 1FOXA 2E34A 1YJNI 3DLLF 1ACIA 1YJ9I 4IOCF 3CCLI 5GAEJ 3G6EI 1VQLI 3CMEI 1YITI 1VQ9I 1VQ8I 5DM7F 2QEXI
chains in the Genus database with same CATH superfamily
2ZXJA 5HLHA 1BI2A 5FFXA 3M8EA 1RPWA 2HVQA 4MQ9F 1IGNA 2YUSA 3ZMUA 3H3ZA 3QAHA 1W7PD 4RGUA 2EIKH 3FK7A 2J5PA 1UHMA 2HQRA 5HOOA 3PSFA 4CDGA 1WJEA 1XDSA 3FXUA 1VQOI 2B9SA 1KZHA 3HPGA 2CQXA 4E7LA 3MVPA 1U9NA 1A6QA 5LD2C 4WF2A 2WAQN 2V1DA 3K70D 5L3BA 1KYWA 2CG4A 4P96A 2KIUA 3VOEA 2EFOA 1MBFA 1R1TA 4A3JJ 4PSXA 2E1MC 2P4WA 4HDUA 3KEQA 1D1BA 3HTUA 4BAYA 3HRUA 1WJFA 3JTGA 2EFQA 1M1EB 4H0EA 1D8KA 1TWAJ 4A3LJ 3LAPA 1T2KA 3HOXJ 3K69A 4QIWN 3DTKA 4J00A 2PN6A 2CW0F 3WU1B 2F5EA 3HOUJ 4F91B 2WAEA 1CGPA 3OIQA 1Z05A 4KNYA 3E7LA 3WU0A 1W5TA 5ICGA 3J80Z 1P6RA 1RZ4A 2CS3A 3J81Z 3IRRA 2ME0A 3S32A 4YFKF 3DPTA 4XMYA 3HHHA 4C3IJ 4OIQF 5TISC 3VB2A 5JHUA 3T8TA 1FOWA 2YS9A 3BZCA 4HBLA 4EJUA 2OTJI 1N25A 4Y3OA 1TWHJ 5EDNA 2XASA 1IAWA 4XOTA 4XK4A 3WU2C 3OYLA 2XGEA 3U2RA 1DDNA 3FMRA 1ITYA 5ICFA 1D1CA 4XL9A 4X0GA 4B47A 3TO6A 3HOVJ 2M30A 2Q8KA 3OYEA 3G2BA 2WAFA 2XHKA 1IRXA 4BQQA 1ZGAA 4A3GJ 3KP3A 2I10A 3LSGA 3DLLF 1ACIA 2NOJB 3H3VK 5M5WJ 2DDAA 1D0ZA 1WSUA 4HAMA 2O0YA 5E1XA 5IP6A 3NAUA 3H5RA 5ERIA 2FUG2 2UXXA 1WJAA 3MZ8A 2K27A 4G7ZF 2OQGA 1S7OA 1P7JA 1IN8A 2M8EA 4FETA 4AWXB 1PVEA 4L9NA 2DPUA 4N9HA 1U3EM 2X1CA 2R7XA 2NS0A 4C2MJ 5E18F 2D2WA 4IVNA 5E3NA 2R7FA 3BTIA 1XCBA 1KU3A 3H3UA 3BTJA 2OBPA 3TDZC 2XKPA 4DQ2A 1PYVA 5IT3A 1ETVA 1WGXA 2WB1A 3R6SA 4ZDPA 1FOKA 4CO8A 2DT6A 2O7OA 2HZDA 1QZYA 3VYRB 3VYSB 3LSPA 1K79A 3SDBA 2DOEA 3I4PA 1W0UA 2CV1A 1ETKA 5D4RA 5C4JJ 1V55H 4ZYEA 1DQUA 3BR2A 2FOWA 3JCUC 5EGOB 2ZJRF 2JTVA 1OCPA 1FP2A 2R7UA 3D5LA 3RQIA 4EQQA 1VQPI 2CUEA 4AIJA 4BXXJ 5HLIA 3CO6C 1GVDA 3CUQA 3VWBA 1V5GA 1XMKA 2Z99A 3MN2A 2TDXA 3FKIJ 5CLSA 3JSOA 2PI0A 4OIPF 5GP9A 4ABZA 1OFCX 4KA4A 2JA5J 1R4MB 3W2AA 4BUPA 3ERMA 1Q1HA 1B59A 2E35A 1RUOA 2Z16A 4DOZA 3CCQI 3NWTA 2OUMA 2XAHA 1ZKGA 5KCMA 3TOBA 4CICA 3TL4X 4RLQA 3H0DA 2L7KA 5FJ8J 2W25A 1TWGJ 2EA4A 4D5CA 1MJ9A 4S05A 2VKDA 3BOQA 4ANJA 1APLC 2L02A 3LSHA 2ZXWH 3RZOJ 3DBLB 4A0YA 3CCEI 2M4GA 5FKMA 1ZGJA 2ZMEC 3GXOA 4F3QA 3OYIA 4IHXA 3J81K 3F9KA 5EG0B 1UJ8A 3J80K 1WPKA 4ASNA 4HQEA 3CDHA 1RKTA 3B6AA 1T8IA 1H89C 2Y48A 5CKTA 2VBXA 3M1EA 2M7BA 1N78A 1IV8A 3HKZA 2V26A 1DGRM 3MZHA 2W24A 1G59A 1B4AA 4ENKA 1TW2A 3Q5FA 3ZQQA 4H4KC 2ELKA 1MIJA 1T0FA 4FASD 3DU5A 1BIAA 4XLEA 4A3EJ 3EYIA 2CH0A 5CPRB 5LHIA 3SYTA 4XORA 2HEOA 2BHZA 4DW6A 4RGRA 4GGGA 2P6TA 3H9GA 3KYLA 1B8IA 3BR1A 3PSIA 1BJAA 4MFDA 2DA6A 4FISA 3OYMA 1I1SA 1O7FA 3NARA 1X1BA 2VQGA 3GFIA 4UXNA 3EETA 3RKXA 4IPAA 3WGHA 2H27A 4L9TA 1SD4A 2BVLA 4YIRX 3HRMA 3QP6A 2LRDA 1BI0A 4M9XA 3QOEA 2NAZA 3VEPA 1W5CC 1YW9A 2WBMA 4RM2A 1WI9A 2L5QA 1RI7A 4DZJA 5J47A 1FYLA 1G8XA 2M45A 5JVTA 4G7OF 4NUBA 4ENJA 2DA2A 1WWXA 2JWTA 1JI8A 3BQYA 3IAM2 5AIQA 1NTCA 5FLMJ 2J5OA 2CJJA 2FXAA 3DWLE 5F0FA 4IHSA 3I5UA 4HOBA 2E1OA 2IGNA 3I54A 2BZTA 3ZPLA 2R93J 3CMMA 4XKCA 1YIJI 1XSDA 4M9ZA 2JJ7A 5E1ZB 3ABMH 3OSGA 5JI6A 3W6VA 4HZFA 4AUXA 4BJ5C 1T33A 2V1UA 1RETA 2RREA 1SVOA 2F2EA 1ETXA 1IRFA 5IYDJ 2JT1A 2HTSA 5EZHA 1LE8A 1TNTA 2DQLA 3K0LA 4XRSA 1VQ4I 3ZCOA 3IP4B 3FMQA 2DBBA 5FLXZ 4AVZA 1USSA 3PNTA 3W2VA 2BY0A 3I4NJ 5F64A 5J40A 4PJ0C 4XRMA 3K4JA 2E2IJ 1OCTC 1EF4A 4CZZA 2VE8A 3L2VA 1JXSA 2EINH 3E6DA 2IGKA 4R8HA 2DMUA 2JA6J 2HNHA 4FX0A 3ONQA 3PQKA 2ECCA 5HNHA 1I3QJ 1MKMA 1QO0D 1HW1A 1JUPA 4KIBA 3I4MJ 2UWMA 4I09A 2R7VA 2W85A 4F7ZA 2R7DA 4Y17A 3WG7H 3S2WA 3UKGA 2WADA 3OV8A 4Y52J 1OQYA 1R5HA 3WGGA 2RDPA 4JYKA 4MHGA 4DJAA 2VKEA 3HYIA 2LFBA 4IRGA 2YPRA 5E3OA 5K7HA 3QPLA 3ISPA 2BXYA 4Y4RA 2MSYA 3B6CA 4U0WA 3CMYA 3FM5A 2ZJ2A 3M1CA 4I0AA 4KITB 5ILVA 1UELB 2LF8A 2BOLA 3OYFA 1YO5C 1MMDA 3PO3J 4EMSA 4G6QA 1ETYA 1KGSA 4U0YA 4A12A 2BY2A 5GPCA 4BY7J 4EM0B 3HOZJ 1ZRDA 1KYZA 5HODA 1HLVA 5FB2A 3CUQC 2GM4A 2JVHA 1Y0UA 2DODA 2OAZA 4G9YA 3RJPA 2JPCA 2LY2A 3GWZA 4YG2F 3EUKL 1FNNA 1O3SA 3S2DJ 3K6GA 2F5VA 4KIFA 2EILH 1V3FA 1F36A 2COMA 3L9FA 2K40A 4A93J 4ZZLA 1U5TA 2VOOA 4FTHA 1LEAA 1LPQA 2UZKA 2IS4A 4AYBN 3COAC 3LWFA 2L9NA 4NQWB 2NXNB 2K9QA 1KONA 3DEEA 3SFIA 2XGXA 2HGCA 3ZQGA 1BW6A 5JHFA 1R5ID 2QA4I 4NNJA 1AU7A 2VB6A 3CD6I 3ZR8X 3BZ6A 3BR3A 2VBZA 1XGMA 4L0ZB 5CVIA 5M5YJ 3F21A 5K1YA 3CCRI 2VASA 4N9IA 3CUOA 2V1XA 2EH3A 2FMYA 1ORKA 5DYMA 2ID3A 3NWSA 2M3AA 1LKXA 3CP2A 3JTHA 3K1PA 4D1QA 3ZQFA 5F08A 1S5LC 1ZAOA 3G73A 3TO7A 4E7SA 1BR4A 2W84A 4M3GA 2NVQJ 1OR7A 2JA8J 2OC6A 3MKWB 1U6GA 4HYEA 2RKHA 1USTA 4MFEA 1UHSA 2X85A 5D8LB 2K3PA 1MNDA 3S3OA 1OYIA 5FGMA 4D9JA 2RV8A 1X1CA 5KAIC 1GV2A 1V54H 2DFHA 4E6KG 5LHGA 1YOVB 2HOTA 2E2JJ 2KZVA 4E7JA 2CQKA 2GQQA 1IRZA 3C2GA 3JRIA 1FEXA 2QBYA 3K9TA 1XSVA 3T5XA 2V79A 1SAXA 4HNTA 3CUQB 2PMZA 3K10A 2WV1A 3WTSC 3C18A 5CYVA 1WVRA 3TW7A 3BJAA 4K2EA 2KRFA 5K5RA 1AA7A 3V7CA 1SD7A 1IZ1A 2XDVA 1FLIA 1ZARA 4ESBA 3U21A 2GZWA 5FKLA 1JT6A 2DMNA 5FKKA 2P7VB 4PK4A 4YRVA 5LBQA 1YJ9I 2VQCA 2R0QC 4LJZF 1OMIA 4O6JA 1BL0A 3L7WA 3S2HJ 2KT0A 5CVJA 1RR8C 3HB9A 4EM1A 1D5VA 3V4GA 2R7WA 2FEZA 1XGSA 3HL2A 1ZLKA 1ZG5A 1EH6A 2K4JA 5FKNA 4B44A 2L7MP 1MBKA 4KISA 4B4CA 4EV0A 3HOWJ 1VTNC 4BS9A 2FJ1A 5D8KB 3TQNA 3S1NJ 1XB4A 2LY1A 2VXZA 5IOZA 4ZYDA 2GIZA 4AIDA 3N97A 3CQZJ 1JGGA 3JRHA 1E3HA 1JJ6C 2MFZA 2RGVA 2XB5A 5D6FA 2Y9YA 1ZREA 3HDDA 2CQNA 1TTYA 1SFKA 2R7RA 4C2TA 5EGOA 4RB2C 4OWRB 4ZZDA 3LSRA 1UFMA 2F6CA 2V9KA 3T0YA 3BG5A 2BEOA 4A3MJ 4M6VA 4Q4ZF 3I71A 1ZQ3P 1X3UA 1SD5A 3CO7C 2PEXA 1MMAA 2XF6A 3GZNB 4UUTA 4IOAF 5M3MJ 2HU9A 2C6YA 2L2OA 4EJWA 3RYPA 4XRFA 4ENNA 1TQMA 4FE4A 4L0YB 2I8DA 3PQJA 5LFAA 3GZ6A 1YRNA 2GA2A 4XONA 1Q1VA 4IX7A 2DXIA 2R7QA 1R7JA 5E3LA 3BR0A 2CQQA 3LFKA 5HLGA 3GZ5A 3WTYC 1R23A 2A5YB 4EVIA 1X3WB 1K6YA 3GFMA 5EG0A 5E79C 3M8FA 1WQ2A 2GOMA 4MTDA 4O3MA 3K1MA 2A68F 3KEOA 2DOFA 4Z2YA 4JX6A 1FPQA 5EYRA 1HBXG 2ISZA 2CUFA 2LK2A 2XAQA 2CW7A 5HDGA 4HPQA 4AYBA 2Y75A 1J0RA 1P4AA 3BJ6A 3D1NI 2OQRA 5DTDA 4F92B 1K4TA 5BS6A 3WG9A 3DBRB 5HVQC 1QQIA 5F0HA 3F6OA 2GOXB 1YG2A 2O61A 4A3KJ 2M8GX 3OIPA 4B3XA 2GXGA 2HZTA 2EQRA 3E1SA 1W7PA 3LSTA 3RDIA 4EEFG 5KVRA 2ECBA 1GDTA 2MBFA 1FBQA 2OZUA 3QPSA 2LKPA 3AKZA 1E3PA 3MAJA 1FYMA 1NK3P 4CCMA 4Q47A 3U1DA 4A6EA 2H6CA 2DFEA 1QVUA 2WC2A 2XAJA 2DCEA 2OZ6A 2ELHA 4RB0A 3BQZA 2A69F 4YIFA 2ZBKA 1ZR2A 2GXAA 1JJ8C 1QZZA 5FO5A 1IF1A 3KP2A 3W2WA 1BC8C 3HG9A 1OCOH 4PJMA 2F4IA 4XLFA 5DM7F 5CVRA 5DD8A 2EZIA 5IOYA 1AOYA 1R6RA 5AONA 5GADJ 3CCYA 4BDZA 5HS8A 3A01A 3E6MA 1WH7A 2R7SA 2E19A 4ZYHA 5JLXA 5LGUA 1YTYA 2JQ7A 2DK8A 5L3FA 3PIPF 2XROA 5TRDA 5TGTA 2V9VA 3LOCA 4L9JA 1BOBA 2D5VA 2BYVE 1YJWI 4WXHA 2JMWA 4RM3A 5DUKA 4BNCA 4HX8A 2G0EA 4I01A 4A0ZA 1YHQI 2L4MA 2V4JC 1YYVA 1HC8A 1TQIA 3DTIA 3KX2A 3FKJA 4KMUX 3ZP5A 1MMNA 3BJOA 4ZC3A 1YX3A 2ZFWA 2PX9A 4WXDA 1FOYA 1Z3YA 1H9GA 2E7WA 1LJ9A 5CQEA 1U5TB 2N8GA 1QU3A 4NHJA 3M3YJ 1Z91A 1FJLA 1G3WA 4M3BA 1W36C 1GHCA 3ZOBA 4RA2A 4RDUA 3ZMVA 2P81A 1YQAA 3OWTA 4HF2A 2CV2A 2X1EA 4A3IJ 3M4OJ 4R1HA 2M34A 3BR5A 2H1KA 2R7OA 4BQAA 4ZYAA 4XKVA 1K6OA 5F04A 2R7ZJ 5FROA 4QTRA 3TGNA 3ZQ7A 2NNNA 3I58A 3K4LA 4XKBA 5FLVA 3DP7A 1YW7A 1X58A 2ZCWA 3M8JA 3Q9SA 5FD5A 1GVJA 2YR2A 5K7FA 3WGIA 2QSGX 2HYGD 2X6OA 2LNBA 2B7EA 3S16J 1XMAA 1ETWA 1IDZA 3QU3A 1U2WA 2Z1DA 3DKXA 3HSEA 2G7UA 3VDXA 3FXKA 4B09A 5TJJA 4BEHB 2JPBA 1UAAA 5BOXA 4KYWA 1WCMJ 1A5JA 2W57A 3BLYA 4IHWA 3CLOA 4CXFA 1IG7A 3SDGA 2G7HA 2L4AA 3F8BA 4HDVA 3QYEA 2HVRA 3TP3A 4AIHA 1XS9A 3BCBA 3EUAA 4C2UA 1ZLJA 1IXRC 1YIOA 3HM5A 3WTXC 2UXNA 4CUGA 3AG2H 4PSWA 4B43A 1HCRA 3KLOA 2GBYA 4NQWA 2QUFA 3FDYA 1WZ2A 2QBYB 1EV7A 4Q48A 2IA0A 3RPQA 1SFOJ 2ZSIB 1J09A 1VQ8I 1R4NB 2AS5F 1Y1VJ 3IH4A 2BE5F 3H9QA 1OCCH 4F55A 2QEXI 2Z33A 4UUVA 4BU2A 2K86A 2JSPA 2MD5A 2ADUA 4I0BA 1MDMA 5B1BH 1JKPC 1Z77A 1GUUA 2XAFA 2Z9OA 1IDYA 1P92A 3GTQJ 2DT5A 2BGCA 2QQAA 1O3RA 3FZVA 3IWFA 2ZJQF 3GFJA 3HHGA 1FYKA 1IJWC 3AG4H 4JP0A 3F23A 4HV6A 5GAHJ 1GV5A 4YEJA 4EJVA 2IAIA 2MLGA 3ZN0A 1FMWA 4GYIA 4A6DA 2E71A 1E3OC 3DF8A 1SANA 1X1PA 2HDCA 1I5ZA 5FRMA 9ANTA 1XSXA 2W48A 4D5FA 2VKVA 1Y8QB 3HSRA 2X9DA 3O2PE 2XAUA 1O3TA 4BY1J 1QRYA 4W97A 4EJOA 1TNSA 4EATA 3L2CA 3IL2A 1OKRA 2IRFG 1IRGA 1XN7A 1ZELA 3PNVA 5FD6A 2ZNYA 1TP4A 2XRNA 1BN5A 3KFWX 3OL3A 4BJTA 1X1AA 4L5JA 2CYYA 2K9MA 2F4OB 2NS8A 3OYAA 1FSHA 1QHGA 4EGZA 4Y33A 3BPVA 2H6BA 2O3FA 2FQ4A 3KP5A 3U1KA 1U8RA 5F1JA 1HOMA 2V1NA 3FXOA 5M3FJ 3OMYA 4UB8C 4PZJA 3K2ZA 3E0JB 2HYFA 3JRCA 2MA3A 3CF5F 1TWCJ 2L54A 3DKWA 3S3NA 3OR1C 3S3MA 4MGRA 3P5JA 4C3HJ 4EJTA 2OPTA 1MD0A 3AG3H 2VL8A 4U0VA 1IUYA 4HRIA 4XBFA 2VQHA 4BE0A 2EV0A 5BNGA 3HUGB 2UUZA 2CUJA 5D5WB 1XPXA 3NEUA 3ZQIA 5HDNA 4E7HA 3CJTB 4ZTJA 1YRNB 2IXSA 2FBKA 1I6HJ 4QSHA 2KDZA 1D5YA 1ETQA 1X4OA 2NVXJ 2NVYJ 4RB3C 1SFUA 4AM3A 3ASOH 2GWRA 1YFHA 3LAJA 2R7TA 3A0HC 2VJ5A 1S6LA 2VXDA 2CRGA 1UB9A 1PJRA 1WJCA 2PQ8A 2DTZA 1ZYRF 4LIUA 4DYQA 1HDDC 2HQAA 3BY6A 3HXLA 4UNOA 1G3YA 1N75A 4HNUA 1EJ9A 4ITVA 3VPRA 1J7KA 2IJLA 2QVOA 3A03A 2VKHA 1MBEA 2ICWG 5F1RA 1FY7A 2QLZA 3H92A 5LEJA 1X19A 4ZTFA 3ZN1A 3OIOA 5ICCA 2L01A 2BHYA 2HS5A 2KIMA 2WAQA 3E97A 3IHUA 3FK6A 4GRIA 2HKXA 3BC8A 3D0SA 4MTEA 1H8AC 4G12A 3QWLA 2IVMA 2DMQA 4BBRJ 4U7DA 3LNQA 1E17A 2CU7A 4Y15A 3JSPA 1U8BA 2FD5A 2OV7A 1W7PB 3QODA 1VQKI 4V19K 4CCKA 2EB7A 2VT2A 3MFKA 2E2HJ 1PP8F 2JA7J 2NRAC 1FZPB 2AO9A 4BL0B 5KNLA 5K5OA 5LHHA 5M5XJ 5LEKA 2V9PA 2P6SA 1ZK8A 1CF7B 3DTEA 1B1BA 4IEJA 2BBYA 3CCJI 1IC8A 3TOAA 1F5TA 3OYGA 4Q5SF 5A2QZ 4MNUA 3KPHA 1BM9A 1HSTA 3S14J 2KL4A 2E5NA 3HPHA 1OCRH 2IEKA 2KPMA 3KYCB 5HS9A 3QU6A 1G6NA 4XQFA 3PFYA 3D5SC 2FA5A 2ZJPF 1W1WE 3ZGKA 2H1LA 3OYCA 3A01B 4P1WA 1UG2A 1VF9A 1IN6A 1VQNI 3KYDB 5LGNA 5J8FA 1MZBA 3TW6A 2M0MA 3L2QA 1I1GA 1WFXA 3QQAA 4UVBA 3J7AY 4DNCA 1LVKA 3R0AA 1ZR4A 1JKQC 2CUZA 5BQTA 3LL7A 4C3JJ 4LLGF 1EKEA 2YU3A 2ZO4A 3IC7A 5DM6F 4DIQA 4OMZA 3F8CA 4KN4X 3H5NA 3RYRA 1QVTA 2LG4A 3ZMZA 3CJQB 2EK5A 3GX4X 1LEBA 3CCUI 1KU2A 3GTOJ 3GTJJ 2DW4A 3DKYA 1IUFA 2WWYA 1QHHD 5HLTA 4LD5A 1K4SA 4AU7A 2L3DA 5AIPA 3FXLA 1VNDA 2EPFA 4HA8A 4I02A 3QP5A 3OYNA 2KJCA 2MH2A 1YJNI 3OYJA 2DAOA 2PJRB 5J6XA 2DA1A 5EEGA 1A35A 2GIVA 1I27A 2V6EA 4IKFA 4MO7A 1XC5A 3RZDJ 3Q3SA 4JQFA 1I50J 1TW3A 1X3ZB 4G6TB 4XNFA 4XLNF 4MLOA 5GAEJ 4D7MA 4QPQA 4HLYA 1L3LA 2MYSA 4XSXF 2K5CA 2CV0A 2FNAA 2VE9A 1O4XA 3ASNH 2NNYA 1J59A 1P9QC 2IS2A 1B6AA 3BG3A 2DYRH 2HVSA 3L09A 4ZJZA 1RESA 3OOUA 4C9YA 2QGUA 5H6RA 1E0EA 3G3ZA 2KP6A 2ZB9A 3OL4A 2RC4A 2HI3A 5GAGJ 4GO1A 1MW7A 2OD5A 3GBGA 3O3KA 3LSMA 2QSHX 2M87A 2VODA 3CJRB 4NB5A 4BE1A 3FXQA 4KUMA 3T1BA 4E70A 3WHBA 1VQ7I 1TLHB 2H8WA 4KIGA 2IBDA 3GVAA 3I9V2 2O6GE 3F72A 3FWEA 4QPOA 3ESWB 5DD4A 4ENMA 4OIRF 4C30A 5CVVA 1HSJA 3GYHX 1ZG1A 4IHVA 1HF0A 4MIMA 1VQ6I 2JK3A 3ECOA 4XM3A 5KHDA 4UUSA 2GXBA 1UCRA 1R1VA 2QM3A 1BA5A 5E20A 4LG3A 3J7ZI 2BXZA 1QGPA 1WJDA 2A61A 4P55A 1MDMB 3I0TA 5A2QK 1V5FA 5J3LA 3GCMA 2ETHA 2EZHA 3ABKH 3CC7I 5LGTA 4PFPA 2W1OA 4RAFA 3RQ4A 4WX9A 1ZN2A 2OA4A 4IO9F 1QZEA 1LFPA 4XSZF 1K61A 1T0FC 2CSOA 1VQ5I 2XSJC 4P9UA 1W4MA 2NYXA 1LDJA 1UG0A 1WKMA 1GLNA 1GXPA 2M4KA 2XF5A 2LOOA 3ABUA 4BEHA 2VT3A 3PFIA 1NH3A 2HQ5A 3CTAA 4HLXA 3JRAA 3N4MA 5JVGF 3OOPA 3TKYA 3Q0WA 3RPUD 2JUCA 4LK0F 3BCAA 3I59B 1D0YA 4MEXF 4J01A 4D7NA 3HBLA 4HX7A 2Y0MA 3VSLA 3H1CA 2ZSHB 1MMGA 2CMPA 2FU4A 1VZ0A 2IP2A 3ZMSA 1S29A 1UMQA 3DBHB 2QQBA 1STZA 3VFZA 3RI4A 1YW8A 1ZGWA 2XGCA 5GTHC 2X48A 1Z6RA 3D5RC 2XPWA 4PUSA 3ZXSA 2MW8A 2FSWA 3F3XA 1PDNC 2AXTC 2DOAA 3F22A 3FHNA 2RVCA 4KMFA 2KIQA 1UZCA 5DCFA 1Y0NA 4B1RA 2CW8A 2VBWA 3GLLA 2KHMA 2XB0X 4BXFA 1FTTA 1ULYA 4CCLA 3BG7A 1MBGA 4G6DA 1NG7A 2M5WA 3UNGC 4PDKA 1G3TA 1P4WA 1SVLA 4AIKA 2Q2EA 1ZH5A 2VONA 3H35A 3CCSI 4AVPA 3FIWA 4HQMA 4BQNA 2VC1A 2KQRA 2PFBA 4PJJA 3HOSA 4IJAA 3VYTB 3G4SI 2K02A 4P5OA 3GFLA 1KQ0A 3LQQA 4HSTA 3OYBA 2LH9A 1R5GA 4WK8F 5E17F 2K7LA 2VC0A 5E3MA 2H8RA 3E5XA 2XKOA 5IY5H 4IRIA 3BP8A 4QWQA 2WTEA 2LBFA 1OPCA 4JK1X 1Y39A 1P7IA 1HQCA 4HF0A 5CJ9A 2NVUB 2PJPA 3BR6A 4M72A 1C0WA 3GTPJ 3R4KA 2HOAA 1VQMI 4IXAA 4BHCA 1HW5A 1T95A 3F8FA 3DEUA 3JREA 1AHDP 1DP7P 4FX4A 4W1UA 3FF5A 2DDBA 3HUGA 1HDPA 4CZCA 5J4VA 3TEDA 1FTZA 2KLOA 1SAUA 1G3SA 3KZYA 2XF7A 3ELKA 3C2HA 3IUOA 5FRNA 2A07F 4CCOA 4B8XA 4GXOA 1IXSB 3AL0C 1KA8A 2EZLA 1K78A 3UR3C 2P7CB 3QYBA 1JGSA 3GTKJ 3CC4I 2O5RA 1XDUA 2LTPA 2XUBA 2CFOA 2LSOA 2OCCH 2CWEA 4IQJA 3HTSB 3V8LA 3HGYA 1V4RA 2DA7A 4E4HA 4ON0A 1U5TC 1Y1WJ 5CQGA 5L3GA 5HNFA 3MCZA 1Z1DA 2DFFA 4Z6YA 2NVTJ 4IOCF 1FBSA 5CVUA 4PJLA 4A3DJ 4CA0A 1SD6A 4XLCA 3T8RA 1IO2A 4ESJA 4D0PA 4XOPA 6PAXA 3WTWC 5EZGA 1W36D 1I39A 2MABA 2DT7B 2A3SA 2ESNA 2HTJA 3K4MA 3MZYA 2HWVA 4YIIA 2DA3A 2ME6A 2QF7A 4I7HA 4KT6A 2EJRA 3S8PA 1XX5A 2EFPA 5IT9Z 3MWMA 2JRTA 1UHWA 3C2BA 1ODDA 3JRBA 1GXQA 2H09A 4IQ4A 3SQNA 1JE8A 1L0OC 1HA8A 2VJJA 2WY8Q 1OR7C 2E60A 2MC3A 4BE2A 2XV4S 3PM1A 2EIMH 4ESFA 1CF7A 4B48A 1MNEA 3EDPA 1DU6A 1ZRFA 4U88A 1TZLA 2KIFA 1BOAA 2WB1N 2VLAA 2X6YA 1KQ8A 1S8NA 1JKRC 4WCGA 2JN6A 4A3BJ 4L5IA 2QZ8A 2KRHA 5EEHA 4V2FA 3WTTC 1POGA 1DPRA 1Z9CA 2YU9J 4OIOF 4UV8A 4DZPA 3M07A 1I3AA 5L3EA 3BT9A 4YFNF 2IT0A 3V42A 2CFXA 1MMSA 4HW0A 2DI3A 3HSFA 3W6KB 2QENA 2L7FP 2LMDA 3KZZA 1T39A 3S15J 1JTYA 2ZFUA 1T6SA 2E36A 1XCVA 4E7KA 4IHYA 3M9AA 2LYCA 3AL0B 3CC2I 4XIDA 3IKTA 3FXRA 4A69C 4LFUA 1SMTA 3E6BA 5ILUA 3HJEA 2PMHA 2L9VA 1D1AA 1LVAA 3F8NA 1T38A 2EV5A 5DDGA 1VI0A 1PP7U 3LFUA 4RMNA 1Z0XA 4M71A 5KK1A 2Y9ZA 4MEYF 1HW2A 3ERED 3PIOF 1G2HA 1WI3A 2M7AA 1JHHA 1MBJA 2PJRA 3EUHA 4DGWB 3OS2A 3E3VA 4UUSB 1Z6TA 5J4YA 1W5SA 3V7SA 1QPIA 2HOEA 4N4NB 1MH4A 1FSEA 4HNVA 1K83J 4NBQA 3P9IA 1ZTRA 4II3A 4LG0A 3B73A 3F6VA 3LSKA 3SEQA 2JSCA 4GYGA 1LQ1A 3G1MA 3HKZN 4KFCA 3IH2A 1W0TA 1LNWA 1R58A 4LLNA 3BTLA 5L3DA 4RLFA 2JUGA 5GPAA 2FX0A 5HS7A 4E7IA 1XTAA 5IP9J 1S9HA 2HKOA 1Z7LA 1O57A 1BC7C 2HXIA 4NC6A 2D45A 3CZ6A 3E6CC 2KRCA 4BGDA 4A3CJ 1B9NA 3QRFF 4ZYGA 4IL6C 2BV6A 2XPVA 3Q0UA 5H20A 1YI2I 2Y69H 1WJ5A 5IT9K 1AKHB 3A02A 4I6ZA 2RAEA 4PGHA 2B0LA 3CJNA 4JOMA 2WY7Q 2QCOA 2X4HA 5J1UA 3BPXA 4RAGA 1VFCA 3HOYJ 4LK1F 2OCEA 3W3CA 3MD2A 4RBOA 1WJBA 2K85A 1ON1A 2GAUA 1MNMC 5EF6A 2VOPA 4BKXA 4F52A 2XSDC 2ZKZA 1OYWA 2GA1A 2KDOA 1MGTA 4O5VA 3NRVA 1K7AA 5F27A 2HQNA 2EBIA 1U78A 3LA3A 3GEZA 2G9WA 2JVGA 2HFHA 1LB2A 2BY3A 3JRDA 3J7AO 5DCMA 1LFUP 2DFIA 2ID6A 4UY8I 2LKSA 3ABLH 2O9LA 2QYOA 2XAGA 1PUFB 2QQ8A 3LSJA 3OSFA 2Q2EB 3IV5A 2O8KA 4KT5C 2R92J 3PUFA 5D4SA 2JZYA 1P4XA 3E5QA 1FX7A 2QKLB 2RQQA 2DMTA 3I59A 2W7NA 3ZQCA 2ZXHA 4ZH4F 3ZMDA 4IZZA 5IYBJ 1X4PA 1J9IA 4CYCA 4YFXF 3H0GJ 2Z2SB 1FIAA 2DPDA 1FOXA 1X2MA 4RGSA 1DUXC 3GTMJ 2F4MB 3K70C 4N4OB 2R5YB 2LBFB 1Z7UA 1YS6A 3OYHA 3WE2A 3QPHA 4FCYA 4HV5A 1YS7A 2DTRA 2ESHA 4QLCU 1DPUA 3M7GA 5IYCJ 3BG6A 2E1MB 1TBXA 4G94A 1IN4A 3L2WA 3L1PA 5IPAA 1ERDA 1P2FA 1D8JA 2QSFX 3G6EI 2EV6A 2K9LA 2YX7A 3WHCA 2DJNA 2DQRA 4FT8A 1VQLI 1ZHFA 2KJBA 3EYYA 3PL8A 1PUEE 2HDDA 3FBNB 2RNJA 1K78B 1LDDA 2W4SA 2KKOA 4YELA 2IS1A 2HPMA 2A6HF 5JLWA 1ETOA 2H94A 4M3EA 4BDYA 3X2QH 4I76A 4RS8A 4L5EA 1OYYA 4LLLA 2EA2A 3FXMA 3ULQB 1Y6IA 1JT0A 4X6AJ 3P9CA 3GTLJ 3L2UA 2XRLA 4XLHA 2RNGA 3I3LA 5C4XJ 3KEYA 1MSFC 3VYUB 3EUHC 2E1NA 1GT0C 4RGXA 2OU2A 4IRHA 3R60A 2Y2ZA 1WH5A 4DYRA 1JKOC 4DYCA 3BZKA 2EIJH 1J75A 1F43A 2XPUA 4RAYA 3S1RJ 2FNPA 3HGGA 1Y56A 2BVMA 1WHUA 3OS0A 2GLOA 5J1YA 2E5ZA 3S1QJ 2BW3B 2MD0A 1A04A 5FKOA 1V5EA 2L0KA 2LDUA 3KP6A 3KP4A 1H88C 2WV0A 2V6CA 3QPTA 5BPIA 1OLTA 1TWFJ 3K4NA 2X1DA 4LIVA 3DLAA 5L3CA 2D1HA 4E7ZA 4LB5A 2PMUA 5D5XB 4HF1A 1XGNA 2DK5A 3BG9A 5BMZA 2DA4A 4M73A 3G71I 1REPC 3MQ0A 2W82A 3FMSA 2DLLA 4OU0A 3V7RA 4UVCA 3I56I 1X1DA 2K9SA 2LVSA 3WE3A 1D3YA 2Z3YA 3ABTA 3BROA 3CLQA 3TBIA 1AWCA 3OS1A 3PJRA 4UB6C 1NG6A 3ECHA 3KIOA 4BH9A 3DU6A 4XRSG 2F5CA 4NC8A 4AD9A 2IS6A 3IKVA 3FHZA 2LP0A 2PMZN 3GW2A 3RIRA 4J19A 3FBIB 1YLFA 3CDIA 5H6QA 4EGYA 2BY1A 1T56A 1ZRCA 3BWGA 4GFBA 3SHFA 4XN0A 3JW4A 4NC7A 3WODF 3CF2A 3HRSA 2E1CA 5KAFC 1MSEC 2ELJA 2STWA 2DMPA 3K4KA 1NHAA 4XLAA 2IGOA 1RRJA 5DUIA 3MMYB 2NS7A 1R22A 1BIBA 2VI6A 1XMXA 1F4KA 3TP0A 1SFEA 3ZQHA 3RSNA 4A5NA 2TCTA 1IXCA 2ZMEB 3SZGA 1RIOH 2EFNA 2DO7A 3K4CA 3OYDA 1IN5A 1TL8A 2IGMA 4B3AA 4LG0B 3DPUA 3W6JB 1RC9A 5D5UB 3IRQA 2FMLA 2HYJA 2OJED 1A36A 1BI3A 2K3FA 1T08B 2FBHA 1B72A 1YE9A 2M9HA 3A1YA 2A05A 5K7ZA 1ON2A 2PG4A 4LITA 4M74A 3E5UA 3I53A 1KU9A 5BPDA 4CYDA 2LD5A 2JA2A 3RPUA 1Z21A 2AQFA 1ENHA 2CQ7A 2X6XA 3JAMZ 3JRGA 3CMAI 1FP1D 3CCMI 4OMYA 2IA2A 1RUNA 2ACJA 4R79A 3LSIA 2E7XA 2ZC2A 2RN7A 3GTGJ 4V2GA 1R71A 3V8KA 3PUBA 3C7JA 5J8CA 5JR3A 3RKWA 4PJNA 2Q1ZB 3DXJF 2IW5A 2NOGA 3IH3A 3TO9A 4A0XA 3CESA 2ZNZA 2R5ZA 4XICA 4II2A 1H9TA 2RQPA 3KCCA 3VSKA 4LMYA 5FFZA 4KN7X 4XLPF 1MH3A 5F0CA 3R0JA 4OAZA 4XKWA 3ZQLA 1OISA 4ZDLA 1LFBA 5E8IA 4KDPA 2AHQA 1CQTA 5DV5A 1MBHA 3DEWA 3K2AA 4UV9A 5ILSA 2EWNA 4G8XA 1O3QA 3WTUC 3Q9VA 2Y31A 3LA7A 1DU0A 2VPLA 2A6EF 2TRTA 1R49A 3HEFA 3O8GA 3WTVC 3GF2A 2M2EA 5B3SH 2Q0OA 3IWZA 5DCMB 2VUMJ 2HOSA 1LUJB 3AG1H 1T98A 1TT0A 3L2RA 4OINF 1XD7A 2Z5UA 3DQVC 3SEZA 2W00A 4DBQA 3CP8A 4PFOA 2F5FA 3N05A 1FWZA 4NDLA 1ONVA 1JTXA 4BQOA 2Y30A 2EFWA 3A4CA 1DGWY 1JUMA 4L9VA 2QKMB 4RB1A 3KP7A 1BBYA 3K7AJ 4BHBA 1TT5B 1Z3XA 3CMEI 2ISYA 1YITI 2WA0A 4CYCB 1VQ9I 1AKHA 1QBJA 4CCJA 4L18B 3FXJA 4KICA 4I99C 3U9GA 2Y0SN 1SEUA 1IW7F 1HXDA 2XVCA 3ZMTA 2UV1A 3KLNA 3IAS2 3SZTA 4UVAA 2VJ4A 2FF4A 3PNYA 5LLQA 5FLXK 2OTLI 3A2KA 1BI1A 1U9OA 4BJ6C 2XIGA 3SJMA 1HKTA 3P7NA 5C44J 1RKWA 1KQ9A 3G1LA 3HC7A 1NK2P 1D0XA 5B5EC 1SFXA 4A5MA 5LRSA 5EEAA 1N77A 3FM3A 4MQVA 5LRRA 1A31A 4I2OA 4HX4A 4JX5A 4ETSA 3DFGA 2D1VA 4BYYA 4BACA 5D6EA 5GTIC 3Q0VA 1FMVA 4JX4A 1F1ZA 2P0WA 1HKQA 4S04A 2KMUA 2KISA 1QA6A 4DBRA 1Y8RB 1I6XA 1PUFA 3S1MJ 2LR8A 1J5YA 2DU9A 3B02A 4I98B 2MH9A 5ED4A 3NQOA 3ML6A 5K5QA 3JAMK 2FBIA 1OJLA 4N0BA 4X1EA 1H0MA 2EZKA 3PO2J 4WXCA 3KETA 1QPMA 3HOTA 2LY9A 2YX4A 4BXUA 2VIXA 2IA1A 1Z67A 3CCVI 1XGOA 1SVMA 2QQ9A 1S72I 3A0BC 4M6YA 2VQLA 3TMOA 2P5LC 4A3FJ 4U87A 3K4BA 1LDKB 1FC3A 2R5YA 1IV6A 1G4DA 4CGZA 3I55I 1DP3A 2OF7A 3F8MA 5JFRA 2XC7A 3RKYA 2DJIA 2E34A 3KZIC 5E8GA 2M0CA 2ZXIA 3V8JA 2LC2A 2P8TA 5C3EJ 3H5AA 2A6TA 1B9MA 1YX5A 3RTRA 3L00A 1JHFA 5ICEA 5EJCA 3WTZA 3SZPA 3JR9A 1FT9A 1BR1A 2FRHA 3GMEA 1FBUA 4P9FA 1TQPA 4AC0A 5B1AH 3DV8A 2FE3A 2IPQX 1EA3A 4PCQA 5J1RA 1S7AA 1B8IB 2STTA 5HDKA 1S3JA 2JRMA 3AFHA 2VJIA 2L9SA 3EPZA 1EH8A 3H36A 1R9TJ 4LOCA 2VPRA 4OAYA 4WWCA 3KE2A 2R4GA 3CDLA 3TDUC 2HPIA 4F93B 2X0LA 1O7LA 1R00A 2V7FA 2MGQA 3MEXA 1TC3C 3BDDA 3O8HA 3REOA 3ZRGA 1BW5A 1RR7A 2DA5A 4BHPA 5DS9A 2MLKA 2O03A 2CO5A 2M1BA 4CSWA 3RCOA 4EM2A 3ROUA 2B63J 3HZJA 5IP7J 2AQEA 4M9SA 1FIPA 3JRFA 1SC7A 2K4BA 1SMYF 2K9NA 5DEQA 5D5VB 1QNTA 1X2NA 2QWWA 2FOKA 4HG2A 1A6IA 2BW3A 3S93A 4IHTA 2F5DA 3QOPA 4CCNA 3F0CA 4FHTA 1S7EA 3G1OA 3MKLA 3J7YJ 2MG4A 3GUDA 2VBYA 3C1DA 1F9NA 4CH7A 1WRJA 2LREA 5H2FC 3MKZA 2LKXA 1HKSA 4M3FA 2L7ZA 3HRTA 3AAFA 1LE8B 4BBSJ 2DYSH 2O8XA 3FISA 4IF4A 1ZG3A 3QYFA 4JBAA 1JUSA 4FQGA 2KZGA 4TV7A 2HR3A 3BTCA 3VODA 2LF7A 2HXOA 2CGPA 1R36A 3FX3A 2P5KA 1BJZA 4OOIA 2COBA 3SXYA 3P9KA 1IN7A 2MC4A 2P5VA 3O6BB 4HEA2 4RAZA 3SFZA 4Y7NJ 1B72B 2I5UA 3DCFA 4G7HF 3MKYB 4GCVA 2DN0A 2PBIA 4XR6A 3C3WA 3RKQA 1E2XA 2Y0SA 4XN3A 4M3DA 2X6WA 5B66C 4KJZA 2KFDA 2HDWA 4Y13A 3S17J 2X51A 4HSRA 3R61A 2XGDA 4U7BA 3GO5A 3LMMA 4ZDOA 1BR2A 3OY9A 3OYKA 1J2XA 2AXLA 1R1UA 4M6XA 2L9RA 2A5WA 3HIFA 1RNLA 3I64A 1XG1A 2F48A 2VN2A 3CCLI 3GLXA 4UHTA 3DPLC 4A2UA 5E1WA 2FQ3A 4FE7A 1KU7A 2R5ZB 3LA2A 3OR2C 4S0HB 3H9JA 1MJBA 4PGGA 1EH7A 3K1NA 5F6FA 1MJAA 2PLYA 2ZMEA 1U0JA 2LLKA 4LB6B 4CHUA 3LQRA 4GDFA 1OCZH 2R3SA 2YSRA 3EQLF 4LGWA
chains in the Genus database with same CATH topology
2NXNB 5GADJ 2QA4I 1YI2I 2JQ7A 5GAGJ 3CD6I 3PIPF 1YIJI 1VQOI 1VQKI 2ZJQF 4V19K 3CCSI 2OTLI 1YJWI 1VQ7I 2H8WA 3CCRI 2FOWA 5GAHJ 2K3FA 4IOAF 1YHQI 2ZJRF 1HC8A 3G4SI 1VQPI 1VQ4I 1FOYA 3J7YJ 3CCJI 1VQ6I 3CMAI 3CCMI 2E35A 3J7ZI 3CCQI 1Y39A 1MMSA 1QA6A 2ZJPF 2E36A 1VQNI 4UY8I 3CC2I 1VQMI 3CC7I 4IO9F 3CCEI 3CF5F 3CCVI 1FOWA 1VQ5I 2OTJI 1S72I 5DM6F 3G71I 3PIOF 5JVGF 3I55I 3I56I 3CCUI 3CJTB 3CC4I 1FOXA 2E34A 1YJNI 3DLLF 1ACIA 1YJ9I 4IOCF 3CCLI 5GAEJ 3G6EI 1VQLI 3CMEI 1YITI 1VQ9I 1VQ8I 5DM7F 2QEXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXN B;  5GAD J;  2QA4 I;  1YI2 I;  2JQ7 A;  5GAG J;  3CD6 I;  3PIP F;  1YIJ I;  1VQO I;  1VQK I;  2ZJQ F;  4V19 K;  3CCS I;  2OTL I;  1YJW I;  1VQ7 I;  2H8W A;  3CCR I;  2FOW A;  5GAH J;  2K3F A;  4IOA F;  1YHQ I;  2ZJR F;  1HC8 A;  3G4S I;  1VQP I;  1VQ4 I;  1FOY A;  3J7Y J;  3CCJ I;  1VQ6 I;  3CMA I;  3CCM I;  2E35 A;  3J7Z I;  3CCQ I;  1Y39 A;  1MMS A;  1QA6 A;  2ZJP F;  2E36 A;  1VQN I;  4UY8 I;  3CC2 I;  1VQM I;  3CC7 I;  4IO9 F;  3CCE I;  3CF5 F;  3CCV I;  1FOW A;  1VQ5 I;  2OTJ I;  1S72 I;  5DM6 F;  3G71 I;  3PIO F;  5JVG F;  3I55 I;  3I56 I;  3CCU I;  3CJT B;  3CC4 I;  1FOX A;  2E34 A;  1YJN I;  3DLL F;  1ACI A;  1YJ9 I;  4IOC F;  3CCL I;  5GAE J;  3G6E I;  1VQL I;  3CME I;  1YIT I;  1VQ9 I;  1VQ8 I;  5DM7 F;  2QEX I; 
#chains in the Genus database with same CATH topology
 2ZXJ A;  5HLH A;  1BI2 A;  5FFX A;  3M8E A;  1RPW A;  2HVQ A;  4MQ9 F;  1IGN A;  2YUS A;  3ZMU A;  3H3Z A;  3QAH A;  1W7P D;  4RGU A;  2EIK H;  3FK7 A;  2J5P A;  1UHM A;  2HQR A;  5HOO A;  3PSF A;  4CDG A;  1WJE A;  1XDS A;  3FXU A;  1VQO I;  2B9S A;  1KZH A;  3HPG A;  2CQX A;  4E7L A;  3MVP A;  1U9N A;  1A6Q A;  5LD2 C;  4WF2 A;  2WAQ N;  2V1D A;  3K70 D;  5L3B A;  1KYW A;  2CG4 A;  4P96 A;  2KIU A;  3VOE A;  2EFO A;  1MBF A;  1R1T A;  4A3J J;  4PSX A;  2E1M C;  2P4W A;  4HDU A;  3KEQ A;  1D1B A;  3HTU A;  4BAY A;  3HRU A;  1WJF A;  3JTG A;  2EFQ A;  1M1E B;  4H0E A;  1D8K A;  1TWA J;  4A3L J;  3LAP A;  1T2K A;  3HOX J;  3K69 A;  4QIW N;  3DTK A;  4J00 A;  2PN6 A;  2CW0 F;  3WU1 B;  2F5E A;  3HOU J;  4F91 B;  2WAE A;  1CGP A;  3OIQ A;  1Z05 A;  4KNY A;  3E7L A;  3WU0 A;  1W5T A;  5ICG A;  3J80 Z;  1P6R A;  1RZ4 A;  2CS3 A;  3J81 Z;  3IRR A;  2ME0 A;  3S32 A;  4YFK F;  3DPT A;  4XMY A;  3HHH A;  4C3I J;  4OIQ F;  5TIS C;  3VB2 A;  5JHU A;  3T8T A;  1FOW A;  2YS9 A;  3BZC A;  4HBL A;  4EJU A;  2OTJ I;  1N25 A;  4Y3O A;  1TWH J;  5EDN A;  2XAS A;  1IAW A;  4XOT A;  4XK4 A;  3WU2 C;  3OYL A;  2XGE A;  3U2R A;  1DDN A;  3FMR A;  1ITY A;  5ICF A;  1D1C A;  4XL9 A;  4X0G A;  4B47 A;  3TO6 A;  3HOV J;  2M30 A;  2Q8K A;  3OYE A;  3G2B A;  2WAF A;  2XHK A;  1IRX A;  4BQQ A;  1ZGA A;  4A3G J;  3KP3 A;  2I10 A;  3LSG A;  3DLL F;  1ACI A;  2NOJ B;  3H3V K;  5M5W J;  2DDA A;  1D0Z A;  1WSU A;  4HAM A;  2O0Y A;  5E1X A;  5IP6 A;  3NAU A;  3H5R A;  5ERI A;  2FUG 2;  2UXX A;  1WJA A;  3MZ8 A;  2K27 A;  4G7Z F;  2OQG A;  1S7O A;  1P7J A;  1IN8 A;  2M8E A;  4FET A;  4AWX B;  1PVE A;  4L9N A;  2DPU A;  4N9H A;  1U3E M;  2X1C A;  2R7X A;  2NS0 A;  4C2M J;  5E18 F;  2D2W A;  4IVN A;  5E3N A;  2R7F A;  3BTI A;  1XCB A;  1KU3 A;  3H3U A;  3BTJ A;  2OBP A;  3TDZ C;  2XKP A;  4DQ2 A;  1PYV A;  5IT3 A;  1ETV A;  1WGX A;  2WB1 A;  3R6S A;  4ZDP A;  1FOK A;  4CO8 A;  2DT6 A;  2O7O A;  2HZD A;  1QZY A;  3VYR B;  3VYS B;  3LSP A;  1K79 A;  3SDB A;  2DOE A;  3I4P A;  1W0U A;  2CV1 A;  1ETK A;  5D4R A;  5C4J J;  1V55 H;  4ZYE A;  1DQU A;  3BR2 A;  2FOW A;  3JCU C;  5EGO B;  2ZJR F;  2JTV A;  1OCP A;  1FP2 A;  2R7U A;  3D5L A;  3RQI A;  4EQQ A;  1VQP I;  2CUE A;  4AIJ A;  4BXX J;  5HLI A;  3CO6 C;  1GVD A;  3CUQ A;  3VWB A;  1V5G A;  1XMK A;  2Z99 A;  3MN2 A;  2TDX A;  3FKI J;  5CLS A;  3JSO A;  2PI0 A;  4OIP F;  5GP9 A;  4ABZ A;  1OFC X;  4KA4 A;  2JA5 J;  1R4M B;  3W2A A;  4BUP A;  3ERM A;  1Q1H A;  1B59 A;  2E35 A;  1RUO A;  2Z16 A;  4DOZ A;  3CCQ I;  3NWT A;  2OUM A;  2XAH A;  1ZKG A;  5KCM A;  3TOB A;  4CIC A;  3TL4 X;  4RLQ A;  3H0D A;  2L7K A;  5FJ8 J;  2W25 A;  1TWG J;  2EA4 A;  4D5C A;  1MJ9 A;  4S05 A;  2VKD A;  3BOQ A;  4ANJ A;  1APL C;  2L02 A;  3LSH A;  2ZXW H;  3RZO J;  3DBL B;  4A0Y A;  3CCE I;  2M4G A;  5FKM A;  1ZGJ A;  2ZME C;  3GXO A;  4F3Q A;  3OYI A;  4IHX A;  3J81 K;  3F9K A;  5EG0 B;  1UJ8 A;  3J80 K;  1WPK A;  4ASN A;  4HQE A;  3CDH A;  1RKT A;  3B6A A;  1T8I A;  1H89 C;  2Y48 A;  5CKT A;  2VBX A;  3M1E A;  2M7B A;  1N78 A;  1IV8 A;  3HKZ A;  2V26 A;  1DGR M;  3MZH A;  2W24 A;  1G59 A;  1B4A A;  4ENK A;  1TW2 A;  3Q5F A;  3ZQQ A;  4H4K C;  2ELK A;  1MIJ A;  1T0F A;  4FAS D;  3DU5 A;  1BIA A;  4XLE A;  4A3E J;  3EYI A;  2CH0 A;  5CPR B;  5LHI A;  3SYT A;  4XOR A;  2HEO A;  2BHZ A;  4DW6 A;  4RGR A;  4GGG A;  2P6T A;  3H9G A;  3KYL A;  1B8I A;  3BR1 A;  3PSI A;  1BJA A;  4MFD A;  2DA6 A;  4FIS A;  3OYM A;  1I1S A;  1O7F A;  3NAR A;  1X1B A;  2VQG A;  3GFI A;  4UXN A;  3EET A;  3RKX A;  4IPA A;  3WGH A;  2H27 A;  4L9T A;  1SD4 A;  2BVL A;  4YIR X;  3HRM A;  3QP6 A;  2LRD A;  1BI0 A;  4M9X A;  3QOE A;  2NAZ A;  3VEP A;  1W5C C;  1YW9 A;  2WBM A;  4RM2 A;  1WI9 A;  2L5Q A;  1RI7 A;  4DZJ A;  5J47 A;  1FYL A;  1G8X A;  2M45 A;  5JVT A;  4G7O F;  4NUB A;  4ENJ A;  2DA2 A;  1WWX A;  2JWT A;  1JI8 A;  3BQY A;  3IAM 2;  5AIQ A;  1NTC A;  5FLM J;  2J5O A;  2CJJ A;  2FXA A;  3DWL E;  5F0F A;  4IHS A;  3I5U A;  4HOB A;  2E1O A;  2IGN A;  3I54 A;  2BZT A;  3ZPL A;  2R93 J;  3CMM A;  4XKC A;  1YIJ I;  1XSD A;  4M9Z A;  2JJ7 A;  5E1Z B;  3ABM H;  3OSG A;  5JI6 A;  3W6V A;  4HZF A;  4AUX A;  4BJ5 C;  1T33 A;  2V1U A;  1RET A;  2RRE A;  1SVO A;  2F2E A;  1ETX A;  1IRF A;  5IYD J;  2JT1 A;  2HTS A;  5EZH A;  1LE8 A;  1TNT A;  2DQL A;  3K0L A;  4XRS A;  1VQ4 I;  3ZCO A;  3IP4 B;  3FMQ A;  2DBB A;  5FLX Z;  4AVZ A;  1USS A;  3PNT A;  3W2V A;  2BY0 A;  3I4N J;  5F64 A;  5J40 A;  4PJ0 C;  4XRM A;  3K4J A;  2E2I J;  1OCT C;  1EF4 A;  4CZZ A;  2VE8 A;  3L2V A;  1JXS A;  2EIN H;  3E6D A;  2IGK A;  4R8H A;  2DMU A;  2JA6 J;  2HNH A;  4FX0 A;  3ONQ A;  3PQK A;  2ECC A;  5HNH A;  1I3Q J;  1MKM A;  1QO0 D;  1HW1 A;  1JUP A;  4KIB A;  3I4M J;  2UWM A;  4I09 A;  2R7V A;  2W85 A;  4F7Z A;  2R7D A;  4Y17 A;  3WG7 H;  3S2W A;  3UKG A;  2WAD A;  3OV8 A;  4Y52 J;  1OQY A;  1R5H A;  3WGG A;  2RDP A;  4JYK A;  4MHG A;  4DJA A;  2VKE A;  3HYI A;  2LFB A;  4IRG A;  2YPR A;  5E3O A;  5K7H A;  3QPL A;  3ISP A;  2BXY A;  4Y4R A;  2MSY A;  3B6C A;  4U0W A;  3CMY A;  3FM5 A;  2ZJ2 A;  3M1C A;  4I0A A;  4KIT B;  5ILV A;  1UEL B;  2LF8 A;  2BOL A;  3OYF A;  1YO5 C;  1MMD A;  3PO3 J;  4EMS A;  4G6Q A;  1ETY A;  1KGS A;  4U0Y A;  4A12 A;  2BY2 A;  5GPC A;  4BY7 J;  4EM0 B;  3HOZ J;  1ZRD A;  1KYZ A;  5HOD A;  1HLV A;  5FB2 A;  3CUQ C;  2GM4 A;  2JVH A;  1Y0U A;  2DOD A;  2OAZ A;  4G9Y A;  3RJP A;  2JPC A;  2LY2 A;  3GWZ A;  4YG2 F;  3EUK L;  1FNN A;  1O3S A;  3S2D J;  3K6G A;  2F5V A;  4KIF A;  2EIL H;  1V3F A;  1F36 A;  2COM A;  3L9F A;  2K40 A;  4A93 J;  4ZZL A;  1U5T A;  2VOO A;  4FTH A;  1LEA A;  1LPQ A;  2UZK A;  2IS4 A;  4AYB N;  3COA C;  3LWF A;  2L9N A;  4NQW B;  2NXN B;  2K9Q A;  1KON A;  3DEE A;  3SFI A;  2XGX A;  2HGC A;  3ZQG A;  1BW6 A;  5JHF A;  1R5I D;  2QA4 I;  4NNJ A;  1AU7 A;  2VB6 A;  3CD6 I;  3ZR8 X;  3BZ6 A;  3BR3 A;  2VBZ A;  1XGM A;  4L0Z B;  5CVI A;  5M5Y J;  3F21 A;  5K1Y A;  3CCR I;  2VAS A;  4N9I A;  3CUO A;  2V1X A;  2EH3 A;  2FMY A;  1ORK A;  5DYM A;  2ID3 A;  3NWS A;  2M3A A;  1LKX A;  3CP2 A;  3JTH A;  3K1P A;  4D1Q A;  3ZQF A;  5F08 A;  1S5L C;  1ZAO A;  3G73 A;  3TO7 A;  4E7S A;  1BR4 A;  2W84 A;  4M3G A;  2NVQ J;  1OR7 A;  2JA8 J;  2OC6 A;  3MKW B;  1U6G A;  4HYE A;  2RKH A;  1UST A;  4MFE A;  1UHS A;  2X85 A;  5D8L B;  2K3P A;  1MND A;  3S3O A;  1OYI A;  5FGM A;  4D9J A;  2RV8 A;  1X1C A;  5KAI C;  1GV2 A;  1V54 H;  2DFH A;  4E6K G;  5LHG A;  1YOV B;  2HOT A;  2E2J J;  2KZV A;  4E7J A;  2CQK A;  2GQQ A;  1IRZ A;  3C2G A;  3JRI A;  1FEX A;  2QBY A;  3K9T A;  1XSV A;  3T5X A;  2V79 A;  1SAX A;  4HNT A;  3CUQ B;  2PMZ A;  3K10 A;  2WV1 A;  3WTS C;  3C18 A;  5CYV A;  1WVR A;  3TW7 A;  3BJA A;  4K2E A;  2KRF A;  5K5R A;  1AA7 A;  3V7C A;  1SD7 A;  1IZ1 A;  2XDV A;  1FLI A;  1ZAR A;  4ESB A;  3U21 A;  2GZW A;  5FKL A;  1JT6 A;  2DMN A;  5FKK A;  2P7V B;  4PK4 A;  4YRV A;  5LBQ A;  1YJ9 I;  2VQC A;  2R0Q C;  4LJZ F;  1OMI A;  4O6J A;  1BL0 A;  3L7W A;  3S2H J;  2KT0 A;  5CVJ A;  1RR8 C;  3HB9 A;  4EM1 A;  1D5V A;  3V4G A;  2R7W A;  2FEZ A;  1XGS A;  3HL2 A;  1ZLK A;  1ZG5 A;  1EH6 A;  2K4J A;  5FKN A;  4B44 A;  2L7M P;  1MBK A;  4KIS A;  4B4C A;  4EV0 A;  3HOW J;  1VTN C;  4BS9 A;  2FJ1 A;  5D8K B;  3TQN A;  3S1N J;  1XB4 A;  2LY1 A;  2VXZ A;  5IOZ A;  4ZYD A;  2GIZ A;  4AID A;  3N97 A;  3CQZ J;  1JGG A;  3JRH A;  1E3H A;  1JJ6 C;  2MFZ A;  2RGV A;  2XB5 A;  5D6F A;  2Y9Y A;  1ZRE A;  3HDD A;  2CQN A;  1TTY A;  1SFK A;  2R7R A;  4C2T A;  5EGO A;  4RB2 C;  4OWR B;  4ZZD A;  3LSR A;  1UFM A;  2F6C A;  2V9K A;  3T0Y A;  3BG5 A;  2BEO A;  4A3M J;  4M6V A;  4Q4Z F;  3I71 A;  1ZQ3 P;  1X3U A;  1SD5 A;  3CO7 C;  2PEX A;  1MMA A;  2XF6 A;  3GZN B;  4UUT A;  4IOA F;  5M3M J;  2HU9 A;  2C6Y A;  2L2O A;  4EJW A;  3RYP A;  4XRF A;  4ENN A;  1TQM A;  4FE4 A;  4L0Y B;  2I8D A;  3PQJ A;  5LFA A;  3GZ6 A;  1YRN A;  2GA2 A;  4XON A;  1Q1V A;  4IX7 A;  2DXI A;  2R7Q A;  1R7J A;  5E3L A;  3BR0 A;  2CQQ A;  3LFK A;  5HLG A;  3GZ5 A;  3WTY C;  1R23 A;  2A5Y B;  4EVI A;  1X3W B;  1K6Y A;  3GFM A;  5EG0 A;  5E79 C;  3M8F A;  1WQ2 A;  2GOM A;  4MTD A;  4O3M A;  3K1M A;  2A68 F;  3KEO A;  2DOF A;  4Z2Y A;  4JX6 A;  1FPQ A;  5EYR A;  1HBX G;  2ISZ A;  2CUF A;  2LK2 A;  2XAQ A;  2CW7 A;  5HDG A;  4HPQ A;  4AYB A;  2Y75 A;  1J0R A;  1P4A A;  3BJ6 A;  3D1N I;  2OQR A;  5DTD A;  4F92 B;  1K4T A;  5BS6 A;  3WG9 A;  3DBR B;  5HVQ C;  1QQI A;  5F0H A;  3F6O A;  2GOX B;  1YG2 A;  2O61 A;  4A3K J;  2M8G X;  3OIP A;  4B3X A;  2GXG A;  2HZT A;  2EQR A;  3E1S A;  1W7P A;  3LST A;  3RDI A;  4EEF G;  5KVR A;  2ECB A;  1GDT A;  2MBF A;  1FBQ A;  2OZU A;  3QPS A;  2LKP A;  3AKZ A;  1E3P A;  3MAJ A;  1FYM A;  1NK3 P;  4CCM A;  4Q47 A;  3U1D A;  4A6E A;  2H6C A;  2DFE A;  1QVU A;  2WC2 A;  2XAJ A;  2DCE A;  2OZ6 A;  2ELH A;  4RB0 A;  3BQZ A;  2A69 F;  4YIF A;  2ZBK A;  1ZR2 A;  2GXA A;  1JJ8 C;  1QZZ A;  5FO5 A;  1IF1 A;  3KP2 A;  3W2W A;  1BC8 C;  3HG9 A;  1OCO H;  4PJM A;  2F4I A;  4XLF A;  5DM7 F;  5CVR A;  5DD8 A;  2EZI A;  5IOY A;  1AOY A;  1R6R A;  5AON A;  5GAD J;  3CCY A;  4BDZ A;  5HS8 A;  3A01 A;  3E6M A;  1WH7 A;  2R7S A;  2E19 A;  4ZYH A;  5JLX A;  5LGU A;  1YTY A;  2JQ7 A;  2DK8 A;  5L3F A;  3PIP F;  2XRO A;  5TRD A;  5TGT A;  2V9V A;  3LOC A;  4L9J A;  1BOB A;  2D5V A;  2BYV E;  1YJW I;  4WXH A;  2JMW A;  4RM3 A;  5DUK A;  4BNC A;  4HX8 A;  2G0E A;  4I01 A;  4A0Z A;  1YHQ I;  2L4M A;  2V4J C;  1YYV A;  1HC8 A;  1TQI A;  3DTI A;  3KX2 A;  3FKJ A;  4KMU X;  3ZP5 A;  1MMN A;  3BJO A;  4ZC3 A;  1YX3 A;  2ZFW A;  2PX9 A;  4WXD A;  1FOY A;  1Z3Y A;  1H9G A;  2E7W A;  1LJ9 A;  5CQE A;  1U5T B;  2N8G A;  1QU3 A;  4NHJ A;  3M3Y J;  1Z91 A;  1FJL A;  1G3W A;  4M3B A;  1W36 C;  1GHC A;  3ZOB A;  4RA2 A;  4RDU A;  3ZMV A;  2P81 A;  1YQA A;  3OWT A;  4HF2 A;  2CV2 A;  2X1E A;  4A3I J;  3M4O J;  4R1H A;  2M34 A;  3BR5 A;  2H1K A;  2R7O A;  4BQA A;  4ZYA A;  4XKV A;  1K6O A;  5F04 A;  2R7Z J;  5FRO A;  4QTR A;  3TGN A;  3ZQ7 A;  2NNN A;  3I58 A;  3K4L A;  4XKB A;  5FLV A;  3DP7 A;  1YW7 A;  1X58 A;  2ZCW A;  3M8J A;  3Q9S A;  5FD5 A;  1GVJ A;  2YR2 A;  5K7F A;  3WGI A;  2QSG X;  2HYG D;  2X6O A;  2LNB A;  2B7E A;  3S16 J;  1XMA A;  1ETW A;  1IDZ A;  3QU3 A;  1U2W A;  2Z1D A;  3DKX A;  3HSE A;  2G7U A;  3VDX A;  3FXK A;  4B09 A;  5TJJ A;  4BEH B;  2JPB A;  1UAA A;  5BOX A;  4KYW A;  1WCM J;  1A5J A;  2W57 A;  3BLY A;  4IHW A;  3CLO A;  4CXF A;  1IG7 A;  3SDG A;  2G7H A;  2L4A A;  3F8B A;  4HDV A;  3QYE A;  2HVR A;  3TP3 A;  4AIH A;  1XS9 A;  3BCB A;  3EUA A;  4C2U A;  1ZLJ A;  1IXR C;  1YIO A;  3HM5 A;  3WTX C;  2UXN A;  4CUG A;  3AG2 H;  4PSW A;  4B43 A;  1HCR A;  3KLO A;  2GBY A;  4NQW A;  2QUF A;  3FDY A;  1WZ2 A;  2QBY B;  1EV7 A;  4Q48 A;  2IA0 A;  3RPQ A;  1SFO J;  2ZSI B;  1J09 A;  1VQ8 I;  1R4N B;  2AS5 F;  1Y1V J;  3IH4 A;  2BE5 F;  3H9Q A;  1OCC H;  4F55 A;  2QEX I;  2Z33 A;  4UUV A;  4BU2 A;  2K86 A;  2JSP A;  2MD5 A;  2ADU A;  4I0B A;  1MDM A;  5B1B H;  1JKP C;  1Z77 A;  1GUU A;  2XAF A;  2Z9O A;  1IDY A;  1P92 A;  3GTQ J;  2DT5 A;  2BGC A;  2QQA A;  1O3R A;  3FZV A;  3IWF A;  2ZJQ F;  3GFJ A;  3HHG A;  1FYK A;  1IJW C;  3AG4 H;  4JP0 A;  3F23 A;  4HV6 A;  5GAH J;  1GV5 A;  4YEJ A;  4EJV A;  2IAI A;  2MLG A;  3ZN0 A;  1FMW A;  4GYI A;  4A6D A;  2E71 A;  1E3O C;  3DF8 A;  1SAN A;  1X1P A;  2HDC A;  1I5Z A;  5FRM A;  9ANT A;  1XSX A;  2W48 A;  4D5F A;  2VKV A;  1Y8Q B;  3HSR A;  2X9D A;  3O2P E;  2XAU A;  1O3T A;  4BY1 J;  1QRY A;  4W97 A;  4EJO A;  1TNS A;  4EAT A;  3L2C A;  3IL2 A;  1OKR A;  2IRF G;  1IRG A;  1XN7 A;  1ZEL A;  3PNV A;  5FD6 A;  2ZNY A;  1TP4 A;  2XRN A;  1BN5 A;  3KFW X;  3OL3 A;  4BJT A;  1X1A A;  4L5J A;  2CYY A;  2K9M A;  2F4O B;  2NS8 A;  3OYA A;  1FSH A;  1QHG A;  4EGZ A;  4Y33 A;  3BPV A;  2H6B A;  2O3F A;  2FQ4 A;  3KP5 A;  3U1K A;  1U8R A;  5F1J A;  1HOM A;  2V1N A;  3FXO A;  5M3F J;  3OMY A;  4UB8 C;  4PZJ A;  3K2Z A;  3E0J B;  2HYF A;  3JRC A;  2MA3 A;  3CF5 F;  1TWC J;  2L54 A;  3DKW A;  3S3N A;  3OR1 C;  3S3M A;  4MGR A;  3P5J A;  4C3H J;  4EJT A;  2OPT A;  1MD0 A;  3AG3 H;  2VL8 A;  4U0V A;  1IUY A;  4HRI A;  4XBF A;  2VQH A;  4BE0 A;  2EV0 A;  5BNG A;  3HUG B;  2UUZ A;  2CUJ A;  5D5W B;  1XPX A;  3NEU A;  3ZQI A;  5HDN A;  4E7H A;  3CJT B;  4ZTJ A;  1YRN B;  2IXS A;  2FBK A;  1I6H J;  4QSH A;  2KDZ A;  1D5Y A;  1ETQ A;  1X4O A;  2NVX J;  2NVY J;  4RB3 C;  1SFU A;  4AM3 A;  3ASO H;  2GWR A;  1YFH A;  3LAJ A;  2R7T A;  3A0H C;  2VJ5 A;  1S6L A;  2VXD A;  2CRG A;  1UB9 A;  1PJR A;  1WJC A;  2PQ8 A;  2DTZ A;  1ZYR F;  4LIU A;  4DYQ A;  1HDD C;  2HQA A;  3BY6 A;  3HXL A;  4UNO A;  1G3Y A;  1N75 A;  4HNU A;  1EJ9 A;  4ITV A;  3VPR A;  1J7K A;  2IJL A;  2QVO A;  3A03 A;  2VKH A;  1MBE A;  2ICW G;  5F1R A;  1FY7 A;  2QLZ A;  3H92 A;  5LEJ A;  1X19 A;  4ZTF A;  3ZN1 A;  3OIO A;  5ICC A;  2L01 A;  2BHY A;  2HS5 A;  2KIM A;  2WAQ A;  3E97 A;  3IHU A;  3FK6 A;  4GRI A;  2HKX A;  3BC8 A;  3D0S A;  4MTE A;  1H8A C;  4G12 A;  3QWL A;  2IVM A;  2DMQ A;  4BBR J;  4U7D A;  3LNQ A;  1E17 A;  2CU7 A;  4Y15 A;  3JSP A;  1U8B A;  2FD5 A;  2OV7 A;  1W7P B;  3QOD A;  1VQK I;  4V19 K;  4CCK A;  2EB7 A;  2VT2 A;  3MFK A;  2E2H J;  1PP8 F;  2JA7 J;  2NRA C;  1FZP B;  2AO9 A;  4BL0 B;  5KNL A;  5K5O A;  5LHH A;  5M5X J;  5LEK A;  2V9P A;  2P6S A;  1ZK8 A;  1CF7 B;  3DTE A;  1B1B A;  4IEJ A;  2BBY A;  3CCJ I;  1IC8 A;  3TOA A;  1F5T A;  3OYG A;  4Q5S F;  5A2Q Z;  4MNU A;  3KPH A;  1BM9 A;  1HST A;  3S14 J;  2KL4 A;  2E5N A;  3HPH A;  1OCR H;  2IEK A;  2KPM A;  3KYC B;  5HS9 A;  3QU6 A;  1G6N A;  4XQF A;  3PFY A;  3D5S C;  2FA5 A;  2ZJP F;  1W1W E;  3ZGK A;  2H1L A;  3OYC A;  3A01 B;  4P1W A;  1UG2 A;  1VF9 A;  1IN6 A;  1VQN I;  3KYD B;  5LGN A;  5J8F A;  1MZB A;  3TW6 A;  2M0M A;  3L2Q A;  1I1G A;  1WFX A;  3QQA A;  4UVB A;  3J7A Y;  4DNC A;  1LVK A;  3R0A A;  1ZR4 A;  1JKQ C;  2CUZ A;  5BQT A;  3LL7 A;  4C3J J;  4LLG F;  1EKE A;  2YU3 A;  2ZO4 A;  3IC7 A;  5DM6 F;  4DIQ A;  4OMZ A;  3F8C A;  4KN4 X;  3H5N A;  3RYR A;  1QVT A;  2LG4 A;  3ZMZ A;  3CJQ B;  2EK5 A;  3GX4 X;  1LEB A;  3CCU I;  1KU2 A;  3GTO J;  3GTJ J;  2DW4 A;  3DKY A;  1IUF A;  2WWY A;  1QHH D;  5HLT A;  4LD5 A;  1K4S A;  4AU7 A;  2L3D A;  5AIP A;  3FXL A;  1VND A;  2EPF A;  4HA8 A;  4I02 A;  3QP5 A;  3OYN A;  2KJC A;  2MH2 A;  1YJN I;  3OYJ A;  2DAO A;  2PJR B;  5J6X A;  2DA1 A;  5EEG A;  1A35 A;  2GIV A;  1I27 A;  2V6E A;  4IKF A;  4MO7 A;  1XC5 A;  3RZD J;  3Q3S A;  4JQF A;  1I50 J;  1TW3 A;  1X3Z B;  4G6T B;  4XNF A;  4XLN F;  4MLO A;  5GAE J;  4D7M A;  4QPQ A;  4HLY A;  1L3L A;  2MYS A;  4XSX F;  2K5C A;  2CV0 A;  2FNA A;  2VE9 A;  1O4X A;  3ASN H;  2NNY A;  1J59 A;  1P9Q C;  2IS2 A;  1B6A A;  3BG3 A;  2DYR H;  2HVS A;  3L09 A;  4ZJZ A;  1RES A;  3OOU A;  4C9Y A;  2QGU A;  5H6R A;  1E0E A;  3G3Z A;  2KP6 A;  2ZB9 A;  3OL4 A;  2RC4 A;  2HI3 A;  5GAG J;  4GO1 A;  1MW7 A;  2OD5 A;  3GBG A;  3O3K A;  3LSM A;  2QSH X;  2M87 A;  2VOD A;  3CJR B;  4NB5 A;  4BE1 A;  3FXQ A;  4KUM A;  3T1B A;  4E70 A;  3WHB A;  1VQ7 I;  1TLH B;  2H8W A;  4KIG A;  2IBD A;  3GVA A;  3I9V 2;  2O6G E;  3F72 A;  3FWE A;  4QPO A;  3ESW B;  5DD4 A;  4ENM A;  4OIR F;  4C30 A;  5CVV A;  1HSJ A;  3GYH X;  1ZG1 A;  4IHV A;  1HF0 A;  4MIM A;  1VQ6 I;  2JK3 A;  3ECO A;  4XM3 A;  5KHD A;  4UUS A;  2GXB A;  1UCR A;  1R1V A;  2QM3 A;  1BA5 A;  5E20 A;  4LG3 A;  3J7Z I;  2BXZ A;  1QGP A;  1WJD A;  2A61 A;  4P55 A;  1MDM B;  3I0T A;  5A2Q K;  1V5F A;  5J3L A;  3GCM A;  2ETH A;  2EZH A;  3ABK H;  3CC7 I;  5LGT A;  4PFP A;  2W1O A;  4RAF A;  3RQ4 A;  4WX9 A;  1ZN2 A;  2OA4 A;  4IO9 F;  1QZE A;  1LFP A;  4XSZ F;  1K61 A;  1T0F C;  2CSO A;  1VQ5 I;  2XSJ C;  4P9U A;  1W4M A;  2NYX A;  1LDJ A;  1UG0 A;  1WKM A;  1GLN A;  1GXP A;  2M4K A;  2XF5 A;  2LOO A;  3ABU A;  4BEH A;  2VT3 A;  3PFI A;  1NH3 A;  2HQ5 A;  3CTA A;  4HLX A;  3JRA A;  3N4M A;  5JVG F;  3OOP A;  3TKY A;  3Q0W A;  3RPU D;  2JUC A;  4LK0 F;  3BCA A;  3I59 B;  1D0Y A;  4MEX F;  4J01 A;  4D7N A;  3HBL A;  4HX7 A;  2Y0M A;  3VSL A;  3H1C A;  2ZSH B;  1MMG A;  2CMP A;  2FU4 A;  1VZ0 A;  2IP2 A;  3ZMS A;  1S29 A;  1UMQ A;  3DBH B;  2QQB A;  1STZ A;  3VFZ A;  3RI4 A;  1YW8 A;  1ZGW A;  2XGC A;  5GTH C;  2X48 A;  1Z6R A;  3D5R C;  2XPW A;  4PUS A;  3ZXS A;  2MW8 A;  2FSW A;  3F3X A;  1PDN C;  2AXT C;  2DOA A;  3F22 A;  3FHN A;  2RVC A;  4KMF A;  2KIQ A;  1UZC A;  5DCF A;  1Y0N A;  4B1R A;  2CW8 A;  2VBW A;  3GLL A;  2KHM A;  2XB0 X;  4BXF A;  1FTT A;  1ULY A;  4CCL A;  3BG7 A;  1MBG A;  4G6D A;  1NG7 A;  2M5W A;  3UNG C;  4PDK A;  1G3T A;  1P4W A;  1SVL A;  4AIK A;  2Q2E A;  1ZH5 A;  2VON A;  3H35 A;  3CCS I;  4AVP A;  3FIW A;  4HQM A;  4BQN A;  2VC1 A;  2KQR A;  2PFB A;  4PJJ A;  3HOS A;  4IJA A;  3VYT B;  3G4S I;  2K02 A;  4P5O A;  3GFL A;  1KQ0 A;  3LQQ A;  4HST A;  3OYB A;  2LH9 A;  1R5G A;  4WK8 F;  5E17 F;  2K7L A;  2VC0 A;  5E3M A;  2H8R A;  3E5X A;  2XKO A;  5IY5 H;  4IRI A;  3BP8 A;  4QWQ A;  2WTE A;  2LBF A;  1OPC A;  4JK1 X;  1Y39 A;  1P7I A;  1HQC A;  4HF0 A;  5CJ9 A;  2NVU B;  2PJP A;  3BR6 A;  4M72 A;  1C0W A;  3GTP J;  3R4K A;  2HOA A;  1VQM I;  4IXA A;  4BHC A;  1HW5 A;  1T95 A;  3F8F A;  3DEU A;  3JRE A;  1AHD P;  1DP7 P;  4FX4 A;  4W1U A;  3FF5 A;  2DDB A;  3HUG A;  1HDP A;  4CZC A;  5J4V A;  3TED A;  1FTZ A;  2KLO A;  1SAU A;  1G3S A;  3KZY A;  2XF7 A;  3ELK A;  3C2H A;  3IUO A;  5FRN A;  2A07 F;  4CCO A;  4B8X A;  4GXO A;  1IXS B;  3AL0 C;  1KA8 A;  2EZL A;  1K78 A;  3UR3 C;  2P7C B;  3QYB A;  1JGS A;  3GTK J;  3CC4 I;  2O5R A;  1XDU A;  2LTP A;  2XUB A;  2CFO A;  2LSO A;  2OCC H;  2CWE A;  4IQJ A;  3HTS B;  3V8L A;  3HGY A;  1V4R A;  2DA7 A;  4E4H A;  4ON0 A;  1U5T C;  1Y1W J;  5CQG A;  5L3G A;  5HNF A;  3MCZ A;  1Z1D A;  2DFF A;  4Z6Y A;  2NVT J;  4IOC F;  1FBS A;  5CVU A;  4PJL A;  4A3D J;  4CA0 A;  1SD6 A;  4XLC A;  3T8R A;  1IO2 A;  4ESJ A;  4D0P A;  4XOP A;  6PAX A;  3WTW C;  5EZG A;  1W36 D;  1I39 A;  2MAB A;  2DT7 B;  2A3S A;  2ESN A;  2HTJ A;  3K4M A;  3MZY A;  2HWV A;  4YII A;  2DA3 A;  2ME6 A;  2QF7 A;  4I7H A;  4KT6 A;  2EJR A;  3S8P A;  1XX5 A;  2EFP A;  5IT9 Z;  3MWM A;  2JRT A;  1UHW A;  3C2B A;  1ODD A;  3JRB A;  1GXQ A;  2H09 A;  4IQ4 A;  3SQN A;  1JE8 A;  1L0O C;  1HA8 A;  2VJJ A;  2WY8 Q;  1OR7 C;  2E60 A;  2MC3 A;  4BE2 A;  2XV4 S;  3PM1 A;  2EIM H;  4ESF A;  1CF7 A;  4B48 A;  1MNE A;  3EDP A;  1DU6 A;  1ZRF A;  4U88 A;  1TZL A;  2KIF A;  1BOA A;  2WB1 N;  2VLA A;  2X6Y A;  1KQ8 A;  1S8N A;  1JKR C;  4WCG A;  2JN6 A;  4A3B J;  4L5I A;  2QZ8 A;  2KRH A;  5EEH A;  4V2F A;  3WTT C;  1POG A;  1DPR A;  1Z9C A;  2YU9 J;  4OIO F;  4UV8 A;  4DZP A;  3M07 A;  1I3A A;  5L3E A;  3BT9 A;  4YFN F;  2IT0 A;  3V42 A;  2CFX A;  1MMS A;  4HW0 A;  2DI3 A;  3HSF A;  3W6K B;  2QEN A;  2L7F P;  2LMD A;  3KZZ A;  1T39 A;  3S15 J;  1JTY A;  2ZFU A;  1T6S A;  2E36 A;  1XCV A;  4E7K A;  4IHY A;  3M9A A;  2LYC A;  3AL0 B;  3CC2 I;  4XID A;  3IKT A;  3FXR A;  4A69 C;  4LFU A;  1SMT A;  3E6B A;  5ILU A;  3HJE A;  2PMH A;  2L9V A;  1D1A A;  1LVA A;  3F8N A;  1T38 A;  2EV5 A;  5DDG A;  1VI0 A;  1PP7 U;  3LFU A;  4RMN A;  1Z0X A;  4M71 A;  5KK1 A;  2Y9Z A;  4MEY F;  1HW2 A;  3ERE D;  3PIO F;  1G2H A;  1WI3 A;  2M7A A;  1JHH A;  1MBJ A;  2PJR A;  3EUH A;  4DGW B;  3OS2 A;  3E3V A;  4UUS B;  1Z6T A;  5J4Y A;  1W5S A;  3V7S A;  1QPI A;  2HOE A;  4N4N B;  1MH4 A;  1FSE A;  4HNV A;  1K83 J;  4NBQ A;  3P9I A;  1ZTR A;  4II3 A;  4LG0 A;  3B73 A;  3F6V A;  3LSK A;  3SEQ A;  2JSC A;  4GYG A;  1LQ1 A;  3G1M A;  3HKZ N;  4KFC A;  3IH2 A;  1W0T A;  1LNW A;  1R58 A;  4LLN A;  3BTL A;  5L3D A;  4RLF A;  2JUG A;  5GPA A;  2FX0 A;  5HS7 A;  4E7I A;  1XTA A;  5IP9 J;  1S9H A;  2HKO A;  1Z7L A;  1O57 A;  1BC7 C;  2HXI A;  4NC6 A;  2D45 A;  3CZ6 A;  3E6C C;  2KRC A;  4BGD A;  4A3C J;  1B9N A;  3QRF F;  4ZYG A;  4IL6 C;  2BV6 A;  2XPV A;  3Q0U A;  5H20 A;  1YI2 I;  2Y69 H;  1WJ5 A;  5IT9 K;  1AKH B;  3A02 A;  4I6Z A;  2RAE A;  4PGH A;  2B0L A;  3CJN A;  4JOM A;  2WY7 Q;  2QCO A;  2X4H A;  5J1U A;  3BPX A;  4RAG A;  1VFC A;  3HOY J;  4LK1 F;  2OCE A;  3W3C A;  3MD2 A;  4RBO A;  1WJB A;  2K85 A;  1ON1 A;  2GAU A;  1MNM C;  5EF6 A;  2VOP A;  4BKX A;  4F52 A;  2XSD C;  2ZKZ A;  1OYW A;  2GA1 A;  2KDO A;  1MGT A;  4O5V A;  3NRV A;  1K7A A;  5F27 A;  2HQN A;  2EBI A;  1U78 A;  3LA3 A;  3GEZ A;  2G9W A;  2JVG A;  2HFH A;  1LB2 A;  2BY3 A;  3JRD A;  3J7A O;  5DCM A;  1LFU P;  2DFI A;  2ID6 A;  4UY8 I;  2LKS A;  3ABL H;  2O9L A;  2QYO A;  2XAG A;  1PUF B;  2QQ8 A;  3LSJ A;  3OSF A;  2Q2E B;  3IV5 A;  2O8K A;  4KT5 C;  2R92 J;  3PUF A;  5D4S A;  2JZY A;  1P4X A;  3E5Q A;  1FX7 A;  2QKL B;  2RQQ A;  2DMT A;  3I59 A;  2W7N A;  3ZQC A;  2ZXH A;  4ZH4 F;  3ZMD A;  4IZZ A;  5IYB J;  1X4P A;  1J9I A;  4CYC A;  4YFX F;  3H0G J;  2Z2S B;  1FIA A;  2DPD A;  1FOX A;  1X2M A;  4RGS A;  1DUX C;  3GTM J;  2F4M B;  3K70 C;  4N4O B;  2R5Y B;  2LBF B;  1Z7U A;  1YS6 A;  3OYH A;  3WE2 A;  3QPH A;  4FCY A;  4HV5 A;  1YS7 A;  2DTR A;  2ESH A;  4QLC U;  1DPU A;  3M7G A;  5IYC J;  3BG6 A;  2E1M B;  1TBX A;  4G94 A;  1IN4 A;  3L2W A;  3L1P A;  5IPA A;  1ERD A;  1P2F A;  1D8J A;  2QSF X;  3G6E I;  2EV6 A;  2K9L A;  2YX7 A;  3WHC A;  2DJN A;  2DQR A;  4FT8 A;  1VQL I;  1ZHF A;  2KJB A;  3EYY A;  3PL8 A;  1PUE E;  2HDD A;  3FBN B;  2RNJ A;  1K78 B;  1LDD A;  2W4S A;  2KKO A;  4YEL A;  2IS1 A;  2HPM A;  2A6H F;  5JLW A;  1ETO A;  2H94 A;  4M3E A;  4BDY A;  3X2Q H;  4I76 A;  4RS8 A;  4L5E A;  1OYY A;  4LLL A;  2EA2 A;  3FXM A;  3ULQ B;  1Y6I A;  1JT0 A;  4X6A J;  3P9C A;  3GTL J;  3L2U A;  2XRL A;  4XLH A;  2RNG A;  3I3L A;  5C4X J;  3KEY A;  1MSF C;  3VYU B;  3EUH C;  2E1N A;  1GT0 C;  4RGX A;  2OU2 A;  4IRH A;  3R60 A;  2Y2Z A;  1WH5 A;  4DYR A;  1JKO C;  4DYC A;  3BZK A;  2EIJ H;  1J75 A;  1F43 A;  2XPU A;  4RAY A;  3S1R J;  2FNP A;  3HGG A;  1Y56 A;  2BVM A;  1WHU A;  3OS0 A;  2GLO A;  5J1Y A;  2E5Z A;  3S1Q J;  2BW3 B;  2MD0 A;  1A04 A;  5FKO A;  1V5E A;  2L0K A;  2LDU A;  3KP6 A;  3KP4 A;  1H88 C;  2WV0 A;  2V6C A;  3QPT A;  5BPI A;  1OLT A;  1TWF J;  3K4N A;  2X1D A;  4LIV A;  3DLA A;  5L3C A;  2D1H A;  4E7Z A;  4LB5 A;  2PMU A;  5D5X B;  4HF1 A;  1XGN A;  2DK5 A;  3BG9 A;  5BMZ A;  2DA4 A;  4M73 A;  3G71 I;  1REP C;  3MQ0 A;  2W82 A;  3FMS A;  2DLL A;  4OU0 A;  3V7R A;  4UVC A;  3I56 I;  1X1D A;  2K9S A;  2LVS A;  3WE3 A;  1D3Y A;  2Z3Y A;  3ABT A;  3BRO A;  3CLQ A;  3TBI A;  1AWC A;  3OS1 A;  3PJR A;  4UB6 C;  1NG6 A;  3ECH A;  3KIO A;  4BH9 A;  3DU6 A;  4XRS G;  2F5C A;  4NC8 A;  4AD9 A;  2IS6 A;  3IKV A;  3FHZ A;  2LP0 A;  2PMZ N;  3GW2 A;  3RIR A;  4J19 A;  3FBI B;  1YLF A;  3CDI A;  5H6Q A;  4EGY A;  2BY1 A;  1T56 A;  1ZRC A;  3BWG A;  4GFB A;  3SHF A;  4XN0 A;  3JW4 A;  4NC7 A;  3WOD F;  3CF2 A;  3HRS A;  2E1C A;  5KAF C;  1MSE C;  2ELJ A;  2STW A;  2DMP A;  3K4K A;  1NHA A;  4XLA A;  2IGO A;  1RRJ A;  5DUI A;  3MMY B;  2NS7 A;  1R22 A;  1BIB A;  2VI6 A;  1XMX A;  1F4K A;  3TP0 A;  1SFE A;  3ZQH A;  3RSN A;  4A5N A;  2TCT A;  1IXC A;  2ZME B;  3SZG A;  1RIO H;  2EFN A;  2DO7 A;  3K4C A;  3OYD A;  1IN5 A;  1TL8 A;  2IGM A;  4B3A A;  4LG0 B;  3DPU A;  3W6J B;  1RC9 A;  5D5U B;  3IRQ A;  2FML A;  2HYJ A;  2OJE D;  1A36 A;  1BI3 A;  2K3F A;  1T08 B;  2FBH A;  1B72 A;  1YE9 A;  2M9H A;  3A1Y A;  2A05 A;  5K7Z A;  1ON2 A;  2PG4 A;  4LIT A;  4M74 A;  3E5U A;  3I53 A;  1KU9 A;  5BPD A;  4CYD A;  2LD5 A;  2JA2 A;  3RPU A;  1Z21 A;  2AQF A;  1ENH A;  2CQ7 A;  2X6X A;  3JAM Z;  3JRG A;  3CMA I;  1FP1 D;  3CCM I;  4OMY A;  2IA2 A;  1RUN A;  2ACJ A;  4R79 A;  3LSI A;  2E7X A;  2ZC2 A;  2RN7 A;  3GTG J;  4V2G A;  1R71 A;  3V8K A;  3PUB A;  3C7J A;  5J8C A;  5JR3 A;  3RKW A;  4PJN A;  2Q1Z B;  3DXJ F;  2IW5 A;  2NOG A;  3IH3 A;  3TO9 A;  4A0X A;  3CES A;  2ZNZ A;  2R5Z A;  4XIC A;  4II2 A;  1H9T A;  2RQP A;  3KCC A;  3VSK A;  4LMY A;  5FFZ A;  4KN7 X;  4XLP F;  1MH3 A;  5F0C A;  3R0J A;  4OAZ A;  4XKW A;  3ZQL A;  1OIS A;  4ZDL A;  1LFB A;  5E8I A;  4KDP A;  2AHQ A;  1CQT A;  5DV5 A;  1MBH A;  3DEW A;  3K2A A;  4UV9 A;  5ILS A;  2EWN A;  4G8X A;  1O3Q A;  3WTU C;  3Q9V A;  2Y31 A;  3LA7 A;  1DU0 A;  2VPL A;  2A6E F;  2TRT A;  1R49 A;  3HEF A;  3O8G A;  3WTV C;  3GF2 A;  2M2E A;  5B3S H;  2Q0O A;  3IWZ A;  5DCM B;  2VUM J;  2HOS A;  1LUJ B;  3AG1 H;  1T98 A;  1TT0 A;  3L2R A;  4OIN F;  1XD7 A;  2Z5U A;  3DQV C;  3SEZ A;  2W00 A;  4DBQ A;  3CP8 A;  4PFO A;  2F5F A;  3N05 A;  1FWZ A;  4NDL A;  1ONV A;  1JTX A;  4BQO A;  2Y30 A;  2EFW A;  3A4C A;  1DGW Y;  1JUM A;  4L9V A;  2QKM B;  4RB1 A;  3KP7 A;  1BBY A;  3K7A J;  4BHB A;  1TT5 B;  1Z3X A;  3CME I;  2ISY A;  1YIT I;  2WA0 A;  4CYC B;  1VQ9 I;  1AKH A;  1QBJ A;  4CCJ A;  4L18 B;  3FXJ A;  4KIC A;  4I99 C;  3U9G A;  2Y0S N;  1SEU A;  1IW7 F;  1HXD A;  2XVC A;  3ZMT A;  2UV1 A;  3KLN A;  3IAS 2;  3SZT A;  4UVA A;  2VJ4 A;  2FF4 A;  3PNY A;  5LLQ A;  5FLX K;  2OTL I;  3A2K A;  1BI1 A;  1U9O A;  4BJ6 C;  2XIG A;  3SJM A;  1HKT A;  3P7N A;  5C44 J;  1RKW A;  1KQ9 A;  3G1L A;  3HC7 A;  1NK2 P;  1D0X A;  5B5E C;  1SFX A;  4A5M A;  5LRS A;  5EEA A;  1N77 A;  3FM3 A;  4MQV A;  5LRR A;  1A31 A;  4I2O A;  4HX4 A;  4JX5 A;  4ETS A;  3DFG A;  2D1V A;  4BYY A;  4BAC A;  5D6E A;  5GTI C;  3Q0V A;  1FMV A;  4JX4 A;  1F1Z A;  2P0W A;  1HKQ A;  4S04 A;  2KMU A;  2KIS A;  1QA6 A;  4DBR A;  1Y8R B;  1I6X A;  1PUF A;  3S1M J;  2LR8 A;  1J5Y A;  2DU9 A;  3B02 A;  4I98 B;  2MH9 A;  5ED4 A;  3NQO A;  3ML6 A;  5K5Q A;  3JAM K;  2FBI A;  1OJL A;  4N0B A;  4X1E A;  1H0M A;  2EZK A;  3PO2 J;  4WXC A;  3KET A;  1QPM A;  3HOT A;  2LY9 A;  2YX4 A;  4BXU A;  2VIX A;  2IA1 A;  1Z67 A;  3CCV I;  1XGO A;  1SVM A;  2QQ9 A;  1S72 I;  3A0B C;  4M6Y A;  2VQL A;  3TMO A;  2P5L C;  4A3F J;  4U87 A;  3K4B A;  1LDK B;  1FC3 A;  2R5Y A;  1IV6 A;  1G4D A;  4CGZ A;  3I55 I;  1DP3 A;  2OF7 A;  3F8M A;  5JFR A;  2XC7 A;  3RKY A;  2DJI A;  2E34 A;  3KZI C;  5E8G A;  2M0C A;  2ZXI A;  3V8J A;  2LC2 A;  2P8T A;  5C3E J;  3H5A A;  2A6T A;  1B9M A;  1YX5 A;  3RTR A;  3L00 A;  1JHF A;  5ICE A;  5EJC A;  3WTZ A;  3SZP A;  3JR9 A;  1FT9 A;  1BR1 A;  2FRH A;  3GME A;  1FBU A;  4P9F A;  1TQP A;  4AC0 A;  5B1A H;  3DV8 A;  2FE3 A;  2IPQ X;  1EA3 A;  4PCQ A;  5J1R A;  1S7A A;  1B8I B;  2STT A;  5HDK A;  1S3J A;  2JRM A;  3AFH A;  2VJI A;  2L9S A;  3EPZ A;  1EH8 A;  3H36 A;  1R9T J;  4LOC A;  2VPR A;  4OAY A;  4WWC A;  3KE2 A;  2R4G A;  3CDL A;  3TDU C;  2HPI A;  4F93 B;  2X0L A;  1O7L A;  1R00 A;  2V7F A;  2MGQ A;  3MEX A;  1TC3 C;  3BDD A;  3O8H A;  3REO A;  3ZRG A;  1BW5 A;  1RR7 A;  2DA5 A;  4BHP A;  5DS9 A;  2MLK A;  2O03 A;  2CO5 A;  2M1B A;  4CSW A;  3RCO A;  4EM2 A;  3ROU A;  2B63 J;  3HZJ A;  5IP7 J;  2AQE A;  4M9S A;  1FIP A;  3JRF A;  1SC7 A;  2K4B A;  1SMY F;  2K9N A;  5DEQ A;  5D5V B;  1QNT A;  1X2N A;  2QWW A;  2FOK A;  4HG2 A;  1A6I A;  2BW3 A;  3S93 A;  4IHT A;  2F5D A;  3QOP A;  4CCN A;  3F0C A;  4FHT A;  1S7E A;  3G1O A;  3MKL A;  3J7Y J;  2MG4 A;  3GUD A;  2VBY A;  3C1D A;  1F9N A;  4CH7 A;  1WRJ A;  2LRE A;  5H2F C;  3MKZ A;  2LKX A;  1HKS A;  4M3F A;  2L7Z A;  3HRT A;  3AAF A;  1LE8 B;  4BBS J;  2DYS H;  2O8X A;  3FIS A;  4IF4 A;  1ZG3 A;  3QYF A;  4JBA A;  1JUS A;  4FQG A;  2KZG A;  4TV7 A;  2HR3 A;  3BTC A;  3VOD A;  2LF7 A;  2HXO A;  2CGP A;  1R36 A;  3FX3 A;  2P5K A;  1BJZ A;  4OOI A;  2COB A;  3SXY A;  3P9K A;  1IN7 A;  2MC4 A;  2P5V A;  3O6B B;  4HEA 2;  4RAZ A;  3SFZ A;  4Y7N J;  1B72 B;  2I5U A;  3DCF A;  4G7H F;  3MKY B;  4GCV A;  2DN0 A;  2PBI A;  4XR6 A;  3C3W A;  3RKQ A;  1E2X A;  2Y0S A;  4XN3 A;  4M3D A;  2X6W A;  5B66 C;  4KJZ A;  2KFD A;  2HDW A;  4Y13 A;  3S17 J;  2X51 A;  4HSR A;  3R61 A;  2XGD A;  4U7B A;  3GO5 A;  3LMM A;  4ZDO A;  1BR2 A;  3OY9 A;  3OYK A;  1J2X A;  2AXL A;  1R1U A;  4M6X A;  2L9R A;  2A5W A;  3HIF A;  1RNL A;  3I64 A;  1XG1 A;  2F48 A;  2VN2 A;  3CCL I;  3GLX A;  4UHT A;  3DPL C;  4A2U A;  5E1W A;  2FQ3 A;  4FE7 A;  1KU7 A;  2R5Z B;  3LA2 A;  3OR2 C;  4S0H B;  3H9J A;  1MJB A;  4PGG A;  1EH7 A;  3K1N A;  5F6F A;  1MJA A;  2PLY A;  2ZME A;  1U0J A;  2LLK A;  4LB6 B;  4CHU A;  3LQR A;  4GDF A;  1OCZ H;  2R3S A;  2YSR A;  3EQL F;  4LGW A; 
#chains in the Genus database with same CATH homology
 2NXN B;  5GAD J;  2QA4 I;  1YI2 I;  2JQ7 A;  5GAG J;  3CD6 I;  3PIP F;  1YIJ I;  1VQO I;  1VQK I;  2ZJQ F;  4V19 K;  3CCS I;  2OTL I;  1YJW I;  1VQ7 I;  2H8W A;  3CCR I;  2FOW A;  5GAH J;  2K3F A;  4IOA F;  1YHQ I;  2ZJR F;  1HC8 A;  3G4S I;  1VQP I;  1VQ4 I;  1FOY A;  3J7Y J;  3CCJ I;  1VQ6 I;  3CMA I;  3CCM I;  2E35 A;  3J7Z I;  3CCQ I;  1Y39 A;  1MMS A;  1QA6 A;  2ZJP F;  2E36 A;  1VQN I;  4UY8 I;  3CC2 I;  1VQM I;  3CC7 I;  4IO9 F;  3CCE I;  3CF5 F;  3CCV I;  1FOW A;  1VQ5 I;  2OTJ I;  1S72 I;  5DM6 F;  3G71 I;  3PIO F;  5JVG F;  3I55 I;  3I56 I;  3CCU I;  3CJT B;  3CC4 I;  1FOX A;  2E34 A;  1YJN I;  3DLL F;  1ACI A;  1YJ9 I;  4IOC F;  3CCL I;  5GAE J;  3G6E I;  1VQL I;  3CME I;  1YIT I;  1VQ9 I;  1VQ8 I;  5DM7 F;  2QEX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...