4BBSJ

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bbsJ00
3L1PA 4B4CA 3ZQCA 4JX4A 2EZKA 2FD5A 2O8KA 1LFBA 1JGGA 3RQIA 1CQTA 2K9NA 3OSGA 4GFBA 1ZGWA 1VI0A 3GTGJ 1OJLA 2DA5A 4QTRA 3FK7A 2W48A 3PO2J 4M6VA 2E2IJ 3SJMA 1F43A 3D1NI 4S0HB 5C44J 4D5FA 1MBKA 2VKEA 1TWHJ 1Y1VJ 4DZJA 1DU6A 4UUSA 1I3QJ 1TWFJ 4AUXA 5IYDJ 4UUTA 1O4XA 3MN2A 4FTHA 1BA5A 3JRFA 2COBA 4AYBN 4RBOA 2KT0A 3PO3J 2HDDA 1GV5A 1UMQA 2E1OA 1AHDP 5FLVA 1WGXA 1LE8B 4FISA 1JKQC 2LY9A 1YRNA 4M3EA 1QPIA 1EF4A 3LSGA 1ETVA 1JKRC 2XPVA 3GTJJ 1F36A 3S17J 1MH3A 3QQAA 3S1MJ 3OSFA 3BTCA 4M3GA 2M0CA 2DA7A 1IDYA 4XRMA 2L7MP 1MH4A 1H8AC 4A3DJ 5E3MA 2HYJA 2FJ1A 1WH5A 3CDLA 3S1NJ 2YS9A 2Y0SN 3IH4A 2B63J 2E2JJ 2LTPA 2LFBA 4I76A 2L0KA 3ZQLA 5J1RA 2DTZA 2YUSA 2Y30A 3BG9A 1X58A 1AKHA 1IGNA 2EH3A 3TW7A 5F04A 5IYBJ 4FCYA 3M4OJ 4M3FA 2JWTA 1JUMA 4A3KJ 5EF6A 2JK3A 3E7LA 2KDZA 5J1UA 1RESA 2CU7A 5M5YJ 5EG0B 4V2GA 2DMNA 3HOYJ 2CQXA 1HDDC 2FX0A 3FKIJ 2ID6A 3BR1A 1IRZA 3NAUA 5BNGA 4C3JJ 2JMWA 3BR2A 5IP6A 3ZQHA 2LP0A 3S15J 3BR0A 3A02A 1OCTC 4MFDA 1NTCA 2DMTA 4BBSJ 2XB5A 2MGQA 4A3FJ 1FIAA 4X6AJ 4A3JJ 1MBHA 2M8GX 4NDLA 4A3GJ 2JA6J 2NOGA 1AKHB 2LKXA 1K83J 3LOCA 1MBFA 1IJWC 3LNQA 3BTIA 1HLVA 3GTQJ 3ZQGA 4C3IJ 5EYRA 1IDZA 1Z77A 1PUFB 2HOAA 1APLC 1DU0A 3JRIA 1LE8A 2ZB9A 1G2HA 4BKXA 5F08A 1OFCX 3MKLA 9ANTA 4BBRJ 3B6CA 4A3EJ 2HXIA 3GTPJ 2JA8J 1JUSA 4XIDA 3DEWA 2L7FP 4BY1J 1R9TJ 1W0TA 1AU7A 3ZQIA 5M3FJ 5E3NA 4IHVA 3W6VA 4MLOA 2Y31A 3FISA 5K7HA 1WCMJ 2MSYA 4C2MJ 1ITYA 4A3BJ 1K61A 3A01A 4V2FA 3BT9A 2MG4A 1HDPA 2PMZN 1MSFC 2NVXJ 4DYCA 4A93J 3BR3A 5FLMJ 1A6IA 2JA7J 4D7NA 3H0GJ 4D5CA 1UHSA 3C2BA 1JT0A 3HDDA 3S2DJ 1ORKA 1JJ8C 4JX5A 1HCRA 4G12A 3JRDA 4B3AA 2JA5J 2EZHA 5F0CA 2XGCA 1OCPA 4DYRA 2LR8A 2M9HA 2DA3A 5FKMA 5M5XJ 5EG0A 1SFOJ 4FE4A 2EZIA 3LSJA 4JX6A 1W0UA 2L9RA 4ABZA 1GUUA 2Y9YA 3JR9A 2R0QC 2QF7A 4LOCA 3LSRA 4EEFG 1FTTA 4M3BA 4XK4A 5F1JA 5E3OA 2G0EA 2D5VA 3GTOJ 1P7IA 4Y7NJ 3VPRA 3Q3SA 2VPRA 5EZHA 1ENHA 1XS9A 1ETYA 2CJJA 1FJLA 4IEJA 2ECCA 3FK6A 3A01B 2XPUA 1MBEA 1ZQ3P 4W1UA 1GT0C 3O8GA 1JTYA 1FEXA 2P81A 4AC0A 4IHWA 3HB9A 1NK2P 4XRSA 1X2MA 2XB0X 4B1RA 3G1MA 3NARA 3HGYA 1E3OC 1U9OA 2EQRA 1MNMC 3HOWJ 3I4NJ 1POGA 4JP0A 1VFCA 2R5YB 1ETQA 4MO7A 4A3MJ 1PUFA 4XICA 3BR6A 3HOXJ 3A03A 5F27A 3BQYA 1BW5A 3TEDA 2IAIA 1U78A 5FJ8J 3BG3A 1SANA 4CYCB 2DA6A 3ZOBA 2XPWA 2LK2A 2DJNA 1NK3P 3SFIA 1BL0A 3HOUJ 2N8GA 5C4JJ 2XGDA 2NVYJ 4X1EA 2VUMJ 1QVUA 3B6AA 1ETOA 3HBLA 3BR5A 1H89C 2M34A 2R5ZB 2DA1A 2I10A 2XRLA 1QVTA 2EZLA 2M2EA 1XG1A 2JJ7A 5M5WJ 3WHCA 3I4MJ 5K7FA 4W97A 2EBIA 5IYCJ 5DTDA 1MBJA 2IBDA 2LLKA 1IV6A 1TC3C 1RR7A 3FIWA 1ETWA 5GPAA 3ZQFA 5C4XJ 1B72B 1D5YA 1QRYA 2QCOA 5IP9J 1TWAJ 2NVTJ 4BY7J 1Y1WJ 3K7AJ 3S16J 2CUFA 2VKVA 1RKWA 4L5EA 2CRGA 4DYQA 1WH7A 2RAEA 2WAQN 2GLOA 5EDNA 2WV1A 3IH2A 2E19A 3JRGA 5IPAA 4IHYA 5DS9A 1T56A 1JT6A 3CCYA 3CQZJ 2ME6A 1Z0XA 2Y9ZA 1GV2A 3GBGA 3CMYA 2K9QA 3JREA 2X48A 2O7OA 3O8HA 2ID3A 1JKPC 2Y2ZA 3DCFA 2OPTA 1ZK8A 2H1KA 2VI6A 5FKLA 1VF9A 4HNVA 3Q0VA 4IHXA 3SDGA 2HOSA 3QPSA 4DW6A 2XSDC 3RZOJ 1U8BA 5GPCA 2R5YA 3JRBA 1Q1VA 1BJZA 3HM5A 4MFEA 4J19A 2YU9J 1B8IB 3S14J 1P7JA 2HOTA 2XGEA 2HQ5A 4A69C 2NVQJ 1TWGJ 5IP7J 2AO9A 5IOZA 1GDTA 3TP3A 3QPLA 3HOVJ 4CYCA 5JLWA 2OF7A 2K9SA 1XC5A 5F0FA 1HOMA 2DA2A 3HEFA 2IEKA 3TW6A 5K7ZA 1X2NA 4A3CJ 1IG7A 3TP0A 2R5ZA 1FIPA 1T33A 4A3LJ 2AHQA 5EGOA 3GTMJ 3F0CA 1H88C 2X6OA 3IV5A 3GTKJ 1TWCJ 4MIMA 2TRTA 5GP9A 2HXOA 2O9LA 5E3LA 3BQZA 2MW8A 5FKKA 3RZDJ 1B72A 5J1YA 1WPKA 2CQQA 3G1OA 2DN0A 4XRSG 2DMPA 4UUSB 4DZPA 5FKOA 5M3MJ 1LFUP 4QIWN 1S7EA 5JLXA 2X9DA 1JJ6C 1ZKGA 3BTLA 1ETKA 4Y52J 5F0HA 5C3EJ 1A5JA 2HI3A 4BXXJ 1GVDA 2R93J 5FKNA 1BW6A 1FTZA 2DMUA 2FQ4A 3Q0WA 4QSHA 1YRNB 3HKZN 3LSPA 3H3VK 1RPWA 2ECBA 3Q0UA 5EZGA 5EGOB 1ZR2A 3OOUA 3UKGA 3HOZJ 1JKOC 2NS8A 4RDUA 2CUEA 3PM1A 1IUFA 2TCTA 4FE7A 5HODA 3JRHA 1RETA 5J3LA 4I6ZA 3OIOA 3MVPA 1I50J 3S1RJ 4D7MA 2NS7A 1RKTA 2DMQA 2K40A 1HF0A 2ME0A 3BTJA 2LVSA 3RKQA 3BG5A 3G1LA 2E2HJ 1B8IA 4A3IJ 5EEAA 2WB1N 3GTLJ 1U9NA 3K2AA 1ZTRA 2DA4A 4JYKA 4C3HJ 2JN6A 2GBYA 1MSEC 1JTXA 4M3DA 3WHBA 3S2HJ 3IH3A 5IOYA 1VNDA 1MBGA 2R92J 3JRAA 3HGGA 2LD5A 1I6HJ 1ZR4A 2H8RA 3JRCA 1ETXA 1JUPA 1IC8A 3M3YJ 2L7ZA 1UG2A 2ELKA 2GM4A 3S1QJ 2R7ZJ 1WI3A
chains in the Genus database with same CATH superfamily
1IRXA 3ZQCA 2WWYA 2EZKA 2FD5A 4GO1A 4ON0A 3D5LA 3GZNB 2O8KA 2KFDA 2ESNA 3K0LA 4KUMA 4XLFA 2HNHA 4LFUA 1C0WA 2L3DA 1K6OA 2K4JA 1WKMA 3QPTA 4PK4A 2A5WA 1IW7F 2HVQA 4BEHB 1XSDA 4XBFA 1MBKA 2VKEA 1Y1VJ 4DZJA 4UUSA 3QOPA 1ON1A 4AUXA 2NNYA 3MN2A 1QHGA 1QPMA 2COBA 1E3HA 4RBOA 2KT0A 3HOTA 1GHCA 1UMQA 2DO7A 1P4XA 2E1OA 2BY3A 2H6CA 1AHDP 2H6BA 1FOWA 1WJAA 3K4JA 1WGXA 1PDNC 5FLVA 2XDVA 3BJAA 2LY9A 5CVRA 2CGPA 1MMSA 3HG9A 1YRNA 2HU9A 1QPIA 1EF4A 3AG4H 4F55A 1JKRC 3KYCB 3E6CC 4C9YA 1YIOA 1D1BA 1MH3A 1Y8RB 2L54A 3CCVI 1O7FA 4AVZA 5HNFA 2OCCH 2JUGA 3EYIA 1XSVA 1IDYA 1MMGA 2DFHA 2L7MP 4BGDA 3V7SA 4A3DJ 2P7CB 1LDJA 2FJ1A 1IN5A 1KYZA 2QA4I 3DF8A 3P9CA 1YJNI 2Y0SN 3IH4A 2B63J 2AXTC 2WA0A 2LFBA 2LY1A 3BCAA 4I76A 3OYBA 2QSGX 2KRFA 1BI1A 3RYRA 1YHQI 5E20A 1OISA 1GVJA 2Y30A 1AKHA 2XRNA 1SAXA 1YITI 2VT2A 1UJ8A 5DUKA 5TISC 4CYDA 3NWTA 1HXDA 2PBIA 1XPXA 2JK3A 3TOAA 3W2AA 2EFQA 3B02A 1BIAA 3ABKH 2KDZA 1RESA 2CU7A 5M5YJ 5EG0B 4RB0A 2DMNA 5HNHA 1R6RA 2ID6A 3QP5A 3QRFF 2XASA 2EA4A 3NAUA 4M6YA 1L0OC 1WQ2A 2QM3A 4QPOA 4C3JJ 5ICFA 1KQ9A 1WWXA 3J80Z 3EPZA 4ESJA 1TP4A 3BR0A 4IL6C 5AONA 4C30A 1FOKA 3FXMA 1TNTA 3RQ4A 4UXNA 2MGQA 4A3FJ 4KNYA 3T1BA 1U2WA 1G4DA 4KICA 2P8TA 4A3JJ 1GXQA 1MBHA 1WJ5A 2O0YA 3BWGA 4NDLA 3ZPLA 4A3GJ 5EEGA 5CVVA 4EJVA 1Y56A 3RKXA 2NOGA 4G7HF 3K2ZA 4EGYA 4IHTA 5LGTA 4A2UA 3CTAA 5D4SA 1T8IA 2JZYA 4DJAA 5H2FC 3GTQJ 2VE8A 1Z77A 1PUFB 1APLC 2A07F 1DGWY 3F6OA 5HLTA 1LE8A 3GFMA 4Q47A 2QKMB 3OYCA 4OU0A 2IRFG 3L2RA 3MKLA 9ANTA 4BBRJ 3B6CA 3GTPJ 2JA8J 5JFRA 4XIDA 5HOOA 3ABTA 2K3PA 1R1VA 2V9PA 1W36D 4ZZLA 1R23A 3K1NA 1W0TA 4P1WA 4Q4ZF 3DBLB 4CCKA 5F1RA 2QBYB 2V1NA 3CP8A 2ZNZA 4GRIA 4IHVA 2Y31A 2EPFA 4E7KA 2JRTA 2E71A 4IJAA 1EJ9A 5E18F 4E7IA 3CUQA 3KFWX 5DCFA 1VQPI 1Y6IA 4M71A 3A01A 1Y8QB 2A5YB 1W36C 1VQ8I 1UFMA 4M74A 5B66C 2R7RA 5TRDA 2NVXJ 4DYCA 5GAEJ 5FLMJ 5LD2C 1T38A 2JA7J 1O3RA 2A6TA 1RIOH 3GLXA 3I9V2 2QLZA 3V7RA 4D5CA 3IAM2 3IRRA 3C2BA 3HDDA 3ERMA 1ORKA 1U8RA 2HKOA 1JJ8C 3FHNA 3PSIA 3JRDA 3IC7A 1EV7A 1QHHD 4NHJA 2K5CA 3GMEA 4PJMA 4XSXF 3J80K 1OCPA 3F8MA 3JW4A 4CCMA 4YG2F 5DM6F 4WWCA 2M9HA 1UCRA 3RKWA 1P2FA 1N78A 3DEUA 4KIGA 4PFPA 1QNTA 4FE4A 1A36A 1GUUA 1E3PA 2R0QC 3HRUA 1FSHA 3OYDA 3LSRA 4YELA 1ON2A 3CCJI 4XK4A 1KU2A 1XGSA 1P7IA 1YLFA 4RA2A 1XS9A 3HYIA 3R0JA 1FOXA 3HRTA 1O3TA 1FJLA 2ECCA 2YX7A 2F4IA 3FK6A 1FBSA 3BZCA 3WGIA 4G6TB 3OYNA 5FD6A 2EFOA 1XCVA 1HW2A 4AC0A 2BV6A 3IP4B 3MKYB 1MD0A 2XAFA 1OR7A 2D1HA 1X2MA 3IKTA 3ECOA 4HLXA 4P5OA 2ZBKA 3DV8A 2KJCA 3A2KA 4OWRB 2ZC2A 4UUVA 3AKZA 3B73A 3HOWJ 3I4NJ 4JP0A 1VFCA 2OQRA 4II3A 3UNGC 1K79A 4ZYDA 4MO7A 4A3MJ 2HTSA 3A03A 1VQ6I 5D5VB 1HKSA 1RC9A 3H9GA 5CVIA 2DOFA 4U0WA 2DAOA 2DA6A 2XPWA 3RI4A 1MJAA 2FSWA 2LK2A 3M9AA 1NK3P 5E17F 2ZFUA 4KA4A 4HSTA 3K4NA 2BEOA 2FNPA 3B6AA 4BE2A 2VUMJ 2XF7A 1H89C 2LRDA 1D8JA 2DA1A 3ZR8X 1I39A 3O2PE 2M2EA 2V26A 4ZH4F 2BOLA 5M5WJ 1Y0NA 2GXAA 2OZUA 3GEZA 5HVQC 2XV4S 5DTDA 1JE8A 1J09A 3VSKA 2HZDA 1USTA 5CQGA 1RR7A 1X1DA 1YFHA 1W7PA 5C4XJ 4XKVA 1B72B 3VOEA 5LHHA 1D5YA 4BQOA 2QCOA 2K9LA 3T0YA 4ENNA 1SEUA 3W6KB 2DDAA 2W1OA 3K4MA 3G2BA 2CUFA 4HX4A 2V79A 2XAHA 4L5EA 3P9KA 4EJWA 3HC7A 2OV7A 2RAEA 1BR4A 1ZRCA 3TKYA 2WV1A 4LGWA 2XAUA 2F5EA 3CUQC 5IPAA 4IHYA 1T56A 1ZRFA 3I59B 1Z7LA 2E1MC 2CSOA 1OKRA 2GXGA 1YG2A 2MC3A 3PUFA 3CO6C 1TNSA 2HQNA 3ML6A 3SHFA 3IKVA 1R4MB 2QEXI 2K9QA 2VN2A 4NUBA 3JREA 2HQAA 3W3CA 4HV6A 2O7OA 4PFOA 2OUMA 4RB3C 1XGNA 3TO7A 3WTZA 2ZJ2A 2E7WA 2OPTA 2VI6A 4XN3A 3KP7A 5FKLA 3Q0VA 1AWCA 1X4OA 3V8LA 2XSDC 4FX4A 3JRBA 1Q1VA 4CICA 4L5JA 3I56I 1B8IB 1YX5A 2YU9J 3S14J 2A3SA 4FT8A 3RPUA 1TWGJ 3HRSA 4HV5A 4E7JA 4G94A 3ABUA 3E5QA 4LG0A 1D1AA 4YFKF 4A12A 2HWVA 2HQRA 4WCGA 4HDUA 3MEXA 3E6BA 3CO7C 1G8XA 2Y0MA 2Z5UA 2MC4A 4DNCA 5F0FA 1HOMA 4YIRX 3J7AO 1V54H 1W1WE 1Z3XA 2R7VA 4L9VA 2GIVA 2J5OA 3DKYA 4A3CJ 2HFHA 3TP0A 4XLCA 3MKZA 2R7XA 2FOWA 5JHUA 1KGSA 1OR7C 4XLHA 2CFXA 5L3GA 1T98A 3GTMJ 1H88C 3KZYA 2X6OA 4CHUA 2D45A 1U5TC 3GTKJ 3I0TA 4P96A 2VJ4A 1EA3A 4MIMA 3BROA 2YR2A 2O9LA 3BQZA 3FMSA 4U88A 4HPQA 3CMAI 1X3ZB 3CCMI 3RZDJ 4P55A 2NVUB 2F48A 3HHGA 3ZGKA 4XRSG 4RGUA 4UUSB 3G73A 3GCMA 5H20A 2HR3A 3K1PA 5FKOA 5GTHC 2F5VA 1LFUP 1EH8A 3PIOF 1S7EA 3QYFA 3PFYA 3GXOA 3CJQB 2IPQX 2GA1A 4E6KG 1R22A 2WAEA 1UZCA 2WBMA 1SD7A 1VZ0A 3CCSI 3Q5FA 1IRFA 1PJRA 5LGUA 5GADJ 5LEJA 1FTZA 4F7ZA 5H6RA 1W7PD 3L09A 3TO9A 3F9KA 1BM9A 1YRNB 1UAAA 3ABMH 3LSPA 3LSIA 4Y3OA 1TW3A 4B44A 4N9IA 1JXSA 3WU0A 1TQPA 2VE9A 4MTDA 2VQHA 2VODA 4N4OB 3H9QA 3WTSC 4FE7A 4RB2C 1SD5A 4BACA 3JRHA 2K85A 4I6ZA 2JVGA 2KIUA 4GDFA 1S72I 2M5WA 3CJTB 3HZJA 2VL8A 1OQYA 3TMOA 3S1RJ 2BY2A 1YJWI 4CSWA 1MKMA 1YS6A 2DMQA 3G4SI 1WRJA 4II2A 3ECHA 4KIFA 2IS2A 3F8FA 1LJ9A 2DDBA 4R8HA 4A3IJ 3BCBA 5FFXA 2G7HA 2DA4A 1ZLJA 4YFNF 3FM5A 3MZ8A 2GBYA 3C2HA 3WU1B 4B8XA 2BHYA 2DQRA 4M3DA 1X4PA 3S2HJ 1SD6A 5IOYA 2NRAC 1MBGA 2R92J 2LD5A 4L9TA 3MKWB 1EH7A 1YJ9I 5KHDA 2H8RA 4IX7A 1IC8A 4N9HA 2J5PA 5CKTA 2XVCA 1XMAA 2L7ZA 4YFXF 1YOVB 2OJED 3L1PA 2EK5A 2H27A 5KNLA 3RPUD 3SQNA 3RQIA 3M8FA 2K9NA 3OSGA 3U2RA 4XORA 4GGGA 1FMVA 3V7CA 4M9SA 1O7LA 1X19A 3HL2A 2OC6A 2DA5A 4HNUA 3OYFA 3FK7A 2W48A 3HUGB 3KZIC 2GOMA 2A6EF 4ESFA 5F6FA 3K6GA 3H1CA 4CCLA 3SJMA 4CXFA 2IGKA 5BPDA 4S0HB 3HSRA 3PIPF 5C44J 2HPMA 5D6FA 1T2KA 4E70A 1S9HA 3OS0A 3F23A 2VJJA 2X1EA 4YIFA 2VLAA 4BQNA 3F3XA 4HEA2 2JT1A 4RLQA 3CESA 3JRFA 1N75A 1E2XA 2F5CA 1WJFA 4BHCA 1T08B 4I0AA 1BI3A 1HSJA 1LE8B 4FISA 2HEOA 1S8NA 4U87A 1KA8A 4HX7A 4M3EA 2RC4A 4S05A 2PEXA 1ETVA 2XHKA 1RNLA 4L9JA 2P6TA 3FXJA 2F6CA 1IXSB 2NYXA 3I71A 5TJJA 2EFWA 2DODA 4M3GA 2M0CA 4I98B 3J81Z 3WTYC 4UV8A 1MH4A 1G3SA 1H8AC 3MZYA 2VXDA 2E1MB 3LSHA 2DT7B 3TQNA 2NXNB 1WH5A 3HSEA 2YS9A 3A4CA 3DPTA 3E6DA 4U0VA 2KZGA 2MYSA 4UNOA 2L0KA 2MLKA 5DD4A 4BE0A 4DIQA 1Q1HA 2HDWA 4XN0A 5J1RA 1Z67A 2YUSA 5BPIA 1X58A 5D5WB 2DT6A 1DP7P 1E0EA 4FCYA 2E36A 3WODF 4IPAA 2IS6A 2ACJA 1WFXA 4A3KJ 1PVEA 4HLYA 2PLYA 3E7LA 2DI3A 1BI2A 5LFAA 2E5NA 3HOYJ 2ZSHB 2DLLA 3FKIJ 1HDDC 4I09A 4I7HA 4OOIA 2X4HA 2XKOA 1LPQA 2DQLA 2Q0OA 3BR2A 2Y48A 5IP6A 3F22A 2QSFX 2LP0A 2P5VA 3GF2A 3LL7A 3RJPA 4MFDA 1Z9CA 3L2QA 1TZLA 4X0GA 2OTLI 2A68F 3JTHA 2ZJPF 2O03A 3ISPA 2XB5A 4P9FA 3ZRGA 1G6NA 1BN5A 3E6MA 3BG7A 1KQ8A 1FIAA 1ZREA 3BLYA 2M8GX 2FBKA 4FHTA 4MEYF 3ZXSA 5CVJA 3KP4A 1W5SA 1K83J 1MBFA 2RNJA 3LNQA 2QKLB 3WTTC 2IA1A 3ZQGA 2A05A 2HOAA 4XKBA 3JRIA 2ZB9A 3R6SA 5F08A 2D1VA 2IJLA 4EMSA 3ZN0A 4XMYA 2R7DA 3CZ6A 1XTAA 2Z33A 3DEWA 2L7FP 2EB7A 4U7BA 5B5EC 1QU3A 3LFUA 5JVGF 3KYLA 1AU7A 5M3FJ 3LWFA 2GQQA 2O3FA 4MLOA 1X1PA 2MSYA 2CS3A 4NBQA 4C2MJ 4G9YA 4J01A 1SVMA 2PMUA 2OQGA 4A3BJ 4DBQA 4HF2A 2M4GA 3DXJF 3F6VA 2V9VA 2BBYA 2MG4A 2FOKA 4C2UA 3EETA 2PMZN 1OCRH 3N4MA 2XAJA 2ISZA 3IWFA 1D0YA 2M7BA 3BR3A 4XR6A 1V5EA 1MW7A 2ZNYA 1DDNA 1WI9A 1XGMA 3H0GJ 4F3QA 4WX9A 3S2DJ 2EV0A 4NC8A 4HW0A 3KP3A 4G12A 4B3AA 2CO5A 3RDIA 1ZGAA 3MCZA 2W82A 3HTUA 4M9ZA 1TL8A 4ZYEA 3OYLA 1RZ4A 1UELB 4RAZA 4AYBA 5M5XJ 2CUJA 2VBZA 1MJBA 4IOAF 3GUDA 2RNGA 3LSJA 1SFOJ 4JX6A 4CH7A 4ESBA 2Y9YA 4LOCA 1T6SA 4OIOF 4Q5SF 3DU6A 1HSTA 1B9MA 4M3BA 3IUOA 2BXYA 4CUGA 5JR3A 5K5QA 5E3OA 3GTOJ 2QGUA 2CQNA 2X6WA 3VPRA 1R5GA 3Q3SA 2VPRA 4TV7A 5EZHA 4Y7NJ 2P6SA 5GAHJ 4IRHA 5ILSA 4IEJA 3KPHA 4CCJA 2XPUA 4W1UA 2VONA 1GT0C 3IWZA 2V1XA 3H5NA 1JTYA 2V7FA 1PP7U 3HB9A 1R1TA 1NK2P 2RREA 1O3QA 4Y15A 4KT5C 5HLHA 1KONA 1YW9A 4OMYA 1DPUA 4HF1A 3HGYA 3D0SA 2WV0A 3W2VA 3S3NA 1NHAA 2RN7A 4QLCU 4KMUX 2DCEA 3I53A 4XKCA 2L4AA 5EEHA 4BYYA 1YS7A 1WJBA 1R49A 5F27A 2DJIA 1MNEA 3BQYA 3F21A 3TEDA 2IAIA 4N4NB 2MA3A 4LIUA 3F8BA 1ZH5A 1ONVA 4E7SA 4LG0B 1SVOA 1UHMA 5E1XA 2CW8A 4LK0F 3HKZA 2ISYA 4UVBA 3BG6A 4N0BA 3OIPA 3S2WA 3SFIA 2BHZA 2LF7A 2N8GA 3ZN1A 5JI6A 1T39A 4X1EA 2ELJA 4RAYA 2LYCA 3BR5A 3L2VA 5F64A 2OTJI 2M34A 2ZMEA 1X3WB 4CCOA 3H35A 1QVTA 1YO5C 3ZMTA 5J4YA 2JJ7A 2ZXJA 3O6BB 4NQWA 3KP2A 4PZJA 3OWTA 3WHCA 2KKOA 4D1QA 3R0AA 4L5IA 4AWXB 1MBJA 1IV6A 1TC3C 2NOJB 3FIWA 3RCOA 1A35A 1WJCA 2IP2A 1VQ7I 1G3WA 3KEOA 1QRYA 3M8JA 5CPRB 4YRVA 5HS8A 1K4TA 4MQVA 3L7WA 3LA7A 1IN6A 3K7AJ 3FM3A 2VKVA 2CRGA 1TLHB 2VIXA 3AL0C 2PQ8A 4E7HA 3KETA 5D8LB 2A69F 5EDNA 4PSWA 3IH2A 4PJLA 4RB1A 3FDYA 5DS9A 1MIJA 2VXZA 1R71A 2STWA 1FBQA 1Z3YA 2ME6A 1ZHFA 3H3ZA 3GBGA 2LKPA 2UUZA 5DDGA 4WF2A 1V5GA 1J7KA 2UWMA 4ANJA 5DCMA 2X48A 2ID3A 4XONA 2QQ8A 5LBQA 4L0YB 2PG4A 1WSUA 5FB2A 3FXUA 3BC8A 3OOPA 1QGPA 4M72A 5GPCA 1U8BA 1Y39A 4G6QA 1OCOH 3HM5A 4B09A 2HOTA 2AQFA 2XGEA 1XB4A 2HQ5A 3W6JB 4A69C 1I1SA 1SMYF 1YTYA 2E35A 2QVOA 5LRSA 2FNAA 4P9UA 1GDTA 4KMFA 4IHSA 5J40A 3H36A 1P4AA 3ASNH 3L00A 1MDMA 2KRCA 3TBIA 5JLWA 2F2EA 2H09A 1IUYA 3S3OA 1XC5A 2PN6A 1J9IA 3DPUA 2DA2A 1R7JA 3G71I 1V4RA 2D2WA 2DTRA 4RAFA 3ASOH 2BYVE 1LDKB 1V5FA 1K6YA 3FF5A 4B43A 2R5ZA 3DWLE 1GXPA 2VB6A 1FIPA 1T33A 3KP6A 1N77A 3DTIA 2OZ6A 1FYMA 1WJDA 2V4JC 3IV5A 1DQUA 4OAYA 2P0WA 1H9GA 1MGTA 3ZQQA 3HHHA 5E1ZB 5KAFC 2X1DA 2FA5A 1U5TA 2EIKH 4F92B 3KE2A 1BOBA 1KU9A 5E3LA 5ICEA 2MW8A 3U1KA 1PUEE 1ODDA 3VDXA 1I3AA 4ENMA 2IXSA 2HYGD 5J1YA 3G1OA 3C18A 2VT3A 4ZDOA 4DZPA 3OS2A 2M8EA 4Y13A 1K7AA 3WG9A 5JLXA 3EDPA 1ZKGA 3BTLA 1ETKA 4Y52J 5JHFA 2PJPA 2F5DA 2XC7A 4L9NA 5F0HA 2WY7Q 2XKPA 3PFIA 4FETA 5C3EJ 4CZZA 3N05A 2HI3A 1VQLI 2HTJA 1SC7A 4PJ0C 1TT0A 1GVDA 2ZMEC 2GOXB 2RKHA 3E5XA 3E3VA 2CQ7A 2XSJC 2K9MA 2DYRH 2JVHA 2QQ9A 4QSHA 3HKZN 2XGXA 3H3VK 5TGTA 1SFKA 5EGOB 3OOUA 3D5SC 1IAWA 2NS8A 2DFFA 1IUFA 1UHWA 1HQCA 4WK8F 1TQIA 1RETA 4LLGF 5J3LA 3OIQA 1K78B 3GFLA 3VODA 4D7MA 3M1EA 4CA0A 1TW2A 2K40A 4UHTA 1HF0A 4RGXA 3DLAA 1W4MA 3KIOA 3G1LA 2O61A 5FFZA 4BEHA 1LEBA 3F8NA 5HLGA 4JYKA 2W85A 2XAQA 1SFUA 4LB6B 4BQAA 3CF2A 2XAGA 4EQQA 2ZO4A 4XNFA 4OINF 3WHBA 5D8KB 1ZYRF 3IH3A 2R7UA 1VNDA 2R7QA 3HGGA 1BIBA 4A0YA 4U0YA 1ETXA 3M3YJ 1WJEA 4OMZA 1UG2A 3VYRB 1W5TA 1OCZH 4F91B 2OCEA 2R7ZJ 3S1QJ 2VBXA 1Z91A 2QWWA 3T8TA 2L01A 1X3UA 3TDZC 2HVSA 5DV5A 1B9NA 4Y4RA 4UB8C 3MD2A 2K3FA 1JGGA 1CQTA 2Z2SB 1ZGWA 1VI0A 5AIQA 3GTGJ 2O6GE 5HS7A 3BOQA 4MHGA 3GW2A 4M6VA 3NRVA 2LY2A 4HQMA 3WGGA 1R00A 3BP8A 1E17A 2CH0A 2P7VB 1JHFA 1LEAA 2VBYA 5IYDJ 1ZG3A 4BJ5C 3VSLA 3CDIA 3GYHX 4FTHA 1BA5A 5DYMA 1HA8A 1SAUA 4HNTA 2Q1ZB 2PJRA 3S8PA 2LDUA 3ABLH 3TDUC 2HDDA 1HW5A 1U3EM 3RPQA 1IV8A 2EJRA 1ZGJA 2JPBA 2QSHX 1VQ4I 3SEQA 5L3EA 5J8FA 3LSGA 1FC3A 2CW7A 3L2CA 1ZN2A 2M30A 1QQIA 3VFZA 3S1MJ 3D5RC 3BTCA 1YQAA 4JOMA 4BH9A 4ZZDA 2HGCA 3E97A 2DBBA 2LREA 4LITA 2BVMA 2VOPA 5E3MA 2O8XA 2HYJA 4PJNA 2BW3A 3CDLA 3L2WA 2P4WA 2E2JJ 3T8RA 3WTUC 4K2EA 2YX4A 2EIJH 2G7UA 1O3SA 4BQQA 3BG9A 5ED4A 5HLIA 5IYBJ 5F04A 3HPGA 2XUBA 3FMRA 3GLLA 3TO6A 3ERED 5DD8A 4IRIA 1I1GA 3O3KA 1JGSA 2EFPA 1Z7UA 1QO0D 2KPMA 3FBNB 4V2GA 2CYYA 2CQXA 2FX0A 4UB6C 3QU6A 4F93B 3KYDB 1IRZA 3DPLC 2B9SA 2JMWA 3DKWA 2E7XA 2VKDA 1W5CC 1A6QA 1R5HA 3ZQHA 1WZ2A 2ZXWH 1ERDA 1P6RA 2QBYA 1FWZA 1OCCH 3KZZA 2PFBA 4GXOA 3RTRA 1OCTC 5LHIA 3GX4X 1NTCA 2DMTA 4IRGA 4D0PA 4AD9A 1GLNA 1TT5B 4BBSJ 5B1BH 3MWMA 3QWLA 1CGPA 4HZFA 2PMHA 4BDZA 3ELKA 1VQKI 3AG1H 3LAPA 3JCUC 5FRNA 5K1YA 2RGVA 2ETHA 4V19K 4BE1A 1AKHB 3GFJA 1YX3A 2LKXA 2CFOA 1BI0A 1O57A 3M07A 4UVAA 4HDVA 1IJWC 3BTIA 3CDHA 4BDYA 3OR2C 4ENJA 3OYEA 1T0FC 4C3IJ 1VQ9I 2WAQA 2BY1A 2CV1A 4EM2A 4UY8I 3E0JB 1WVRA 1KZHA 1G2HA 2FF4A 2CV2A 3OYJA 1SD4A 4A3EJ 1P9QC 3TL4X 2JSPA 3LFKA 3EUAA 4PGHA 4BY1J 4GYGA 3BDDA 3ZMUA 5BOXA 3ZQIA 2FU4A 2KIFA 2V6EA 1BR2A 3EQLF 2MH2A 5K7HA 2F4OB 1ITYA 1REPC 5FRMA 3CC2I 1ZAOA 1IXRC 2HYFA 2X1CA 5A2QZ 3BT9A 1A04A 1HDPA 1IN7A 1MSFC 1I6XA 2BE5F 3MMYB 1I27A 2Z9OA 1G3TA 1A6IA 2M87A 4EJUA 4D7NA 2VJ5A 2WAFA 3WE3A 3CUOA 3Q9SA 4JX5A 4LIVA 1HCRA 3IHUA 2BZTA 2JA5J 5DEQA 2EZHA 2R4GA 4BL0B 5F0CA 2HVRA 4IZZA 2DK5A 1LB2A 4LLLA 1TQMA 3KEYA 3CMEI 2JRMA 1TTYA 5FKMA 1CF7A 2OA4A 2DK8A 3JR9A 3J7ZI 1LVKA 1T95A 4DBRA 1XN7A 3K69A 3WU2C 5K5OA 1FLIA 1Y0UA 5F1JA 2G0EA 1Z05A 2O5RA 3GWZA 2DFIA 1OYWA 2EINH 4EV0A 2K7LA 2IGNA 1ETYA 3CUQB 3BPVA 3OL4A 4HOBA 3A01B 3SYTA 3G3ZA 1ZQ3P 4B47A 3O8GA 2V9KA 3ZCOA 4BXFA 1FEXA 4KYWA 4IHWA 3UR3C 4KISA 4XRSA 2IW5A 2XB0X 4UV9A 2LBFA 2Y69H 3G1MA 4PGGA 3NARA 1BBYA 4HSRA 3CJRB 2LKSA 4I02A 4XQFA 2L9NA 1E3OC 4RLFA 2HPIA 1MNMC 2Z1DA 4ITVA 1POGA 4KJZA 2XROA 4BXUA 3C7JA 5FGMA 1V55H 2KP6A 4BS9A 3Q9VA 2FEZA 4XICA 1FNNA 3BR6A 1ZG5A 1VQ5I 2M1BA 3HOXJ 2JUCA 4E7ZA 1BW5A 3H5AA 2YSRA 2DOAA 2STTA 2VKHA 5FJ8J 4RM3A 3DKXA 3BG3A 1FMWA 5D5XB 4AIDA 3HTSB 1MDMB 3ZOBA 4B3XA 1LUJB 1J75A 2DJNA 4UVCA 3VYSB 1BL0A 5C4JJ 2XGDA 2NVYJ 2C6YA 3I59A 2VJIA 2FBIA 3E5UA 2R5ZB 2I10A 2XRLA 1F4KA 2VPLA 2KISA 4RM2A 3SEZA 4ENKA 1N25A 1XG1A 1NG7A 2HKXA 2COMA 1G59A 4OIQF 5K7FA 2CUZA 2ZCWA 4W97A 3W2WA 2WB1A 3HIFA 1U5TB 2HS5A 2IBDA 2LLKA 2DYSH 1H0MA 3CCQI 1ETWA 3ZQFA 3DTEA 4JQFA 3J81K 5IP9J 4BNCA 3DU5A 4CDGA 3TOBA 4MQ9F 1BR1A 2Q2EA 3S16J 1A31A 1ZLKA 5IT3A 1VQOI 1IXCA 4PDKA 1WH7A 4A5MA 4ETSA 2WAQN 1RI7A 2ZFWA 4XRFA 4EJOA 2GLOA 5L3CA 2X51A 3JRGA 4DGWB 2E19A 1IRGA 5ERIA 3DTKA 3LQRA 4XSZF 3KP5A 4I99C 3CQZJ 2L7KA 1JHHA 2WC2A 1Z0XA 1X1AA 1GV2A 2CQKA 1U6GA 3P7NA 5FLXZ 3CMYA 1S5LC 1XDUA 1D3YA 1B6AA 2NAZA 3A0BC 5HDKA 1KYWA 4HRIA 2B0LA 4RMNA 3DCFA 3K4BA 4AIKA 2L02A 3F8CA 1B59A 4HNVA 1QZEA 4IHXA 2VQLA 4LK1F 1M1EB 3QPSA 1W7PB 4DW6A 4M6XA 3RYPA 1JI8A 4Q48A 2R5YA 2VBWA 4XLNF 1BJZA 3QODA 2EWNA 4MFEA 1B1BA 4U7DA 4ZDLA 4J19A 3PJRA 1P7JA 2RVCA 1D8KA 2QQAA 1WHUA 2CWEA 2NVQJ 2R7TA 1DGRM 1STZA 1KQ0A 2BXZA 3LQQA 1HC8A 3TP3A 3QPLA 4R79A 3HOVJ 3OYHA 5GTIC 4Y33A 4CYCA 1MNDA 4DQ2A 1X1CA 3HJEA 2K9SA 2K02A 4ZTJA 2MFZA 2V6CA 3HEFA 5CLSA 2DW4A 2H94A 2IEKA 2RV8A 3FXOA 2LH9A 3LA2A 4HAMA 1X2NA 4XLAA 1IG7A 2WTEA 1FYKA 2DFEA 2IA0A 5ILUA 3FXKA 2DOEA 4A3LJ 2AHQA 1S7OA 4LJZF 2KZVA 1BC8C 1NG6A 3U9GA 1S3JA 5L3BA 3H5RA 3SZTA 2CV0A 3FZVA 2ZJQF 3CF5F 3WTWC 4YEJA 4HX8A 1FYLA 4ASNA 2KL4A 2GAUA 4I01A 5FKKA 4KDPA 4PUSA 2UXNA 2CQQA 2DN0A 3M7GA 4ZC3A 1R5ID 3I3LA 3GO5A 1YE9A 2R7WA 4I2OA 1IN4A 5FLXK 2HDCA 4MEXF 4QIWN 1EKEA 2CW0F 4G6DA 3REOA 4C2TA 3ZMZA 4F52A 3LAJA 4NB5A 2FBHA 2PJRB 3DBRB 1VTNC 4KFCA 2M3AA 1A5JA 2LG4A 3FWEA 4BXXJ 2DPUA 3NQOA 4LD5A 3V4GA 3OV8A 2JPCA 3Q0WA 4H0EA 5HDGA 2I5UA 2VC0A 1RPWA 6PAXA 1J5YA 2ECBA 2QYOA 4A6EA 3UKGA 2X85A 1RR8C 3HOZJ 4I0BA 1JKOC 4O5VA 4B48A 4RDUA 4EGZA 2CUEA 1D0XA 4XLPF 1L3LA 5KCMA 4S04A 3AG2H 5LLQA 2M4KA 3PL8A 3CLQA 2RDPA 3V8JA 4CZCA 1DUXC 3LMMA 3HUGA 1RKTA 3KX2A 2LVSA 2W57A 2BW3B 2XF5A 4LG3A 3X2QH 3CCRI 3RKQA 2E2HJ 3I54A 3BJ6A 5EEAA 1YW8A 2WB1N 2FRHA 3L2UA 3GTLJ 2VASA 3V8KA 1ZTRA 4C3HJ 1G3YA 3OMYA 3LSTA 3K4CA 2JN6A 1J0RA 2XIGA 1JTXA 1MSEC 5D5UB 1FOYA 1HW1A 4RAGA 1XDSA 3FX3A 4IOCF 4NNJA 3NWSA 4G7OF 1ZR4A 1USSA 3JRCA 1RUNA 3M1CA 1JUPA 1PYVA 3R61A 2H1LA 2L9VA 3C3WA 1D0ZA 3PSFA 1WI3A 3ESWB 1H9TA 1MMAA 5L3FA 4B4CA 1ZRDA 4JX4A 2X6XA 1MMNA 1LFBA 2GIZA 2Q8KA 3VEPA 4EVIA 3AFHA 4GFBA 5ICCA 3N97A 2Y75A 1OJLA 4QTRA 2K4BA 4AIJA 3PO2J 3H0DA 2E2IJ 3LA3A 3CCEI 3HOSA 1F43A 3D1NI 4R1HA 2MBFA 3J7YJ 4D5FA 3K1MA 4PCQA 1Z21A 1TWHJ 1DU6A 1I3QJ 1YW7A 1AOYA 1TWFJ 2LSOA 4UUTA 3ZMVA 1O4XA 1D1CA 3JAMZ 1P92A 3T5XA 1P4WA 1XGOA 3I58A 5KAIC 4AYBN 3P5JA 3PO3J 3IAS2 1YI2I 1GV5A 2ZSIB 2KLOA 4OAZA 2IA2A 5J47A 3CD6I 1JKQC 2NNNA 3DQVC 4LMYA 3OL3A 3FKJA 3JSOA 1Z1DA 3CMMA 4ZTFA 1KU7A 2LF8A 4PSXA 2XPVA 1XSXA 3GTJJ 1F36A 3S17J 3QQAA 4L18B 2IGOA 3OSFA 1R58A 3QAHA 5FROA 1QZYA 2DA7A 3WGHA 2GXBA 4LLNA 4XRMA 2OD5A 3EYYA 4HQEA 4RS8A 4XL9A 5LEKA 1BC7C 2JQ7A 4AU7A 3S1NJ 3MAJA 4ZYGA 2LTPA 3WTVC 3VB2A 3BZKA 2W24A 5DM7F 5KK1A 3ZQLA 4YIIA 3TGNA 2X0LA 2KIMA 2DTZA 3FMQA 2DT5A 1IGNA 1DP3A 5E79C 1PP8F 2EH3A 5CJ9A 1FY7A 3TW7A 4IQJA 3M4OJ 1MJ9A 5AIPA 4M3FA 1QBJA 2JWTA 4E4HA 1JUMA 3PQKA 3AAFA 2BGCA 5EF6A 2WADA 4ZYHA 1J59A 2QENA 5DUIA 2YU3A 5J1UA 4EM0B 1CF7B 1FX7A 2EFNA 4IQ4A 3HRMA 1AA7A 5BMZA 3QP6A 2RQQA 3BR1A 5EJCA 1QZZA 5BNGA 1HBXG 1OLTA 2EA2A 1SFXA 2ADUA 2QQBA 3QYEA 3WE2A 2Z16A 3S15J 3K70D 3DP7A 3A02A 3JTGA 3CC4I 2ESHA 3GVAA 2A6HF 3QPHA 1XMKA 3JAMK 1IN8A 3WTXC 3S3MA 2E34A 3GZ5A 2LMDA 4X6AJ 5BQTA 4AIHA 1XD7A 4AM3A 3DEEA 5KVRA 3K70C 1S7AA 3R60A 1B4AA 2LBFB 2JA6J 2V1DA 5K5RA 3BZ6A 4IO9F 2W4SA 2FMLA 2KIQA 3CP2A 2WY8Q 3OYGA 1IF1A 3LOCA 4BU2A 1DPRA 2R7OA 2Z99A 4XKWA 2G9WA 2E1NA 3CCLI 1HLVA 2HZTA 1F5TA 2AXLA 1F9NA 2FQ3A 5EYRA 3RKYA 1IDZA 4M73A 3P9IA 4M9XA 4E7LA 1DU0A 1T0FA 3OR1C 4CGZA 4BKXA 1OFCX 2HXIA 1JUSA 2R7SA 3C2GA 2B7EA 2GA2A 1EH6A 1R9TJ 3PNTA 3BY6A 3SDBA 5E3NA 1LVAA 4HYEA 3W6VA 4RGSA 2EIMH 3FISA 1WCMJ 2LNBA 2IS1A 3OY9A 2IGMA 3E1SA 1K61A 4KT6A 4CO8A 4V2FA 2KHMA 3S93A 4KIBA 1ACIA 2ZKZA 3KCCA 2DPDA 3NEUA 4A93J 2KJBA 4KN7X 3RIRA 1S6LA 1UHSA 2E60A 3OS1A 1JT0A 3KEQA 3OYKA 3K4LA 2PI0A 3DBHB 3CJNA 1YIJI 2JTVA 3IRQA 4LB5A 2XGCA 5FD5A 4DYRA 2LR8A 3VYTB 2IS4A 3ULQB 2DA3A 2QZ8A 5E1WA 5EG0A 1ZG1A 2Q2EB 3J7AY 2W00A 5CVUA 2EZIA 1W0UA 3PNYA 2L9RA 3MQ0A 3QYBA 4ABZA 2QF7A 1FTTA 1LKXA 4EEFG 3SZGA 3HPHA 3QU3A 2MABA 5HDNA 2D5VA 3AL0B 1FBUA 4XM3A 1ENHA 1HKQA 2KMUA 1ZARA 4L0ZB 5D4RA 2CJJA 4G8XA 2CMPA 4OIRF 1MBEA 3BJOA 2VC1A 2FXAA 3K4KA 3F72A 2P81A 4BAYA 5JVTA 4B1RA 4CCNA 1TBXA 5HS9A 2L4MA 4Z6YA 3VYUB 4BHBA 1U9OA 2EQRA 3EUHA 4AVPA 1OPCA 2R5YB 3V42A 4D9JA 1ETQA 3I5UA 1FT9A 3FXRA 4ZYAA 1SMTA 1PUFA 2AQEA 1XX5A 4HG2A 2ZXIA 4A0ZA 1X1BA 2UZKA 1U78A 5LHGA 1MZBA 1VQMI 4XOTA 3ZQ7A 5B3SH 1SANA 2JA2A 4QPQA 4CYCB 1J2XA 3MZHA 5J6XA 2ICWG 2P5KA 3BPXA 3HXLA 2KDOA 3CCUI 4EJTA 3HOUJ 1RUOA 5E8GA 1QVUA 3OYIA 4HF0A 1ETOA 3HBLA 3K9TA 3U21A 1LQ1A 3LSKA 5GAGJ 4KITB 4WXHA 2K86A 2EZLA 2BVLA 3VWBA 5CQEA 3I4MJ 3H9JA 3L9FA 4ZDPA 4BUPA 3EUKL 3SXYA 5CYVA 2EBIA 5IYCJ 2OBPA 1XMXA 1UG0A 1NH3A 1R36A 3KLNA 2UV1A 2QUFA 2W25A 2HOEA 4O6JA 3CC7I 3G6EI 5GPAA 3SZPA 3H3UA 4ZJZA 3GFIA 4QWQA 3QOEA 3IL2A 1TWAJ 3FBIB 2NVTJ 4EM1A 1KU3A 4HA8A 3H92A 1YYVA 4BY7J 4BJTA 1Y1WJ 3OYAA 1RKWA 4DYQA 2F4MB 4PJJA 4XLEA 2YPRA 2CG4A 1QA6A 1RRJA 3PNVA 1D5VA 5IT9Z 2EV6A 2FE3A 2OAZA 5LRRA 1LFPA 2RQPA 2K27A 1MMDA 1JT6A 4G7ZF 4IKFA 2KRHA 3CCYA 1UB9A 1U0JA 2LOOA 2Y9ZA 2I8DA 2BY0A 2M7AA 2ZMEB 3HSFA 2H8WA 2ZXHA 4NQWB 3CLOA 4IVNA 3A1YA 3O8HA 3ROUA 1V3FA 2XF6A 4A5NA 3MFKA 3I55I 1JKPC 2Y2ZA 2EILH 2R3SA 4J00A 3FXQA 2ELHA 2PMZA 5BS6A 2H1KA 1XCBA 1ZK8A 3KLOA 3OYMA 2GZWA 4IXAA 1VF9A 1SVLA 2E1CA 2L5QA 3SDGA 2HOSA 4FQGA 3LSMA 5B1AH 3RZOJ 2KQRA 1F1ZA 3DFGA 5ILVA 2VQGA 4RGRA 5D6EA 3ZMDA 2M0MA 4GCVA 1Z6RA 2E5ZA 5IP7J 2AO9A 1FSEA 4KN4X 4A6DA 3ONQA 4FX0A 5IOZA 3WG7H 1S29A 4JBAA 4H4KC 5LGNA 4EATA 1ULYA 2MD0A 2OF7A 1Z6TA 3ZMSA 5J4VA 3FXLA 2GWRA 2FMYA 2IVMA 2VQCA 2F5FA 3TW6A 5K7ZA 4IF4A 2X6YA 5H6QA 2PX9A 3A0HC 2LC2A 5DCMB 5EGOA 3F0CA 1BOAA 1I5ZA 2MH9A 2DXIA 2Y0SA 3EUHC 1TWCJ 1LNWA 2TRTA 4WXCA 3PUBA 5GP9A 2HXOA 2NS0A 4NC6A 1K78A 1B72A 4JK1X 2JSCA 3RSNA 5IT9K 1R1UA 1WPKA 3AG3H 3C1DA 2ZJRF 2DMPA 4NC7A 4Z2YA 5IY5H 1OYIA 5M3MJ 5A2QK 1FP1D 2X9DA 4Y17A 1JJ6C 4FASD 3SFZA 1FZPB 4A0XA 2R7FA 3S32A 5L3DA 3I4PA 1OYYA 3ZP5A 1BJAA 3I64A 2R93J 4DOZA 5FKNA 1FP2A 1ZELA 2W7NA 2V1UA 1BW6A 2DMUA 2FQ4A 2L9SA 5E8IA 2MD5A 2TDXA 3JSPA 4BJ6C 3PQJA 3COAC 1IZ1A 1SFEA 3Q0UA 5EZGA 1K4SA 1LDDA 1ZR2A 2IT0A 1HKTA 2OU2A 4WXDA 1FPQA 3M8EA 3PM1A 2TCTA 5HODA 5J8CA 1IO2A 3OIOA 3MVPA 1I50J 1VQNI 1OMIA 4GYIA 5FO5A 2NS7A 4MNUA 4MTEA 2ME0A 3BTJA 3BG5A 2A61A 1B8IA 3FHZA 2MLGA 2EV5A 4O3MA 2VOOA 1U9NA 2AS5F 3K2AA 4XOPA 4BHPA 3K10A 2UXXA 2P5LC 4MGRA 4HBLA 5ICGA 4OIPF 3GZ6A 3U1DA 3JRAA 2DU9A 1I6HJ 3DLLF 2W84A 2ELKA 1R4NB 2Z3YA 3R4KA 2GM4A 2M45A 2L2OA 2FUG2
chains in the Genus database with same CATH topology
3L1PA 4B4CA 3ZQCA 4JX4A 2EZKA 2FD5A 2O8KA 1LFBA 1JGGA 3RQIA 1CQTA 2K9NA 3OSGA 4GFBA 1ZGWA 1VI0A 3GTGJ 1OJLA 2DA5A 4QTRA 3FK7A 2W48A 3PO2J 4M6VA 2E2IJ 3SJMA 1F43A 3D1NI 4S0HB 5C44J 4D5FA 1MBKA 2VKEA 1TWHJ 1Y1VJ 4DZJA 1DU6A 4UUSA 1I3QJ 1TWFJ 4AUXA 5IYDJ 4UUTA 1O4XA 3MN2A 4FTHA 1BA5A 3JRFA 2COBA 4AYBN 4RBOA 2KT0A 3PO3J 2HDDA 1GV5A 1UMQA 2E1OA 1AHDP 5FLVA 1WGXA 1LE8B 4FISA 1JKQC 2LY9A 1YRNA 4M3EA 1QPIA 1EF4A 3LSGA 1ETVA 1JKRC 2XPVA 3GTJJ 1F36A 3S17J 1MH3A 3QQAA 3S1MJ 3OSFA 3BTCA 4M3GA 2M0CA 2DA7A 1IDYA 4XRMA 2L7MP 1MH4A 1H8AC 4A3DJ 5E3MA 2HYJA 2FJ1A 1WH5A 3CDLA 3S1NJ 2YS9A 2Y0SN 3IH4A 2B63J 2E2JJ 2LTPA 2LFBA 4I76A 2L0KA 3ZQLA 5J1RA 2DTZA 2YUSA 2Y30A 3BG9A 1X58A 1AKHA 1IGNA 2EH3A 3TW7A 5F04A 5IYBJ 4FCYA 3M4OJ 4M3FA 2JWTA 1JUMA 4A3KJ 5EF6A 2JK3A 3E7LA 2KDZA 5J1UA 1RESA 2CU7A 5M5YJ 5EG0B 4V2GA 2DMNA 3HOYJ 2CQXA 1HDDC 2FX0A 3FKIJ 2ID6A 3BR1A 1IRZA 3NAUA 5BNGA 4C3JJ 2JMWA 3BR2A 5IP6A 3ZQHA 2LP0A 3S15J 3BR0A 3A02A 1OCTC 4MFDA 1NTCA 2DMTA 4BBSJ 2XB5A 2MGQA 4A3FJ 1FIAA 4X6AJ 4A3JJ 1MBHA 2M8GX 4NDLA 4A3GJ 2JA6J 2NOGA 1AKHB 2LKXA 1K83J 3LOCA 1MBFA 1IJWC 3LNQA 3BTIA 1HLVA 3GTQJ 3ZQGA 4C3IJ 5EYRA 1IDZA 1Z77A 1PUFB 2HOAA 1APLC 1DU0A 3JRIA 1LE8A 2ZB9A 1G2HA 4BKXA 5F08A 1OFCX 3MKLA 9ANTA 4BBRJ 3B6CA 4A3EJ 2HXIA 3GTPJ 2JA8J 1JUSA 4XIDA 3DEWA 2L7FP 4BY1J 1R9TJ 1W0TA 1AU7A 3ZQIA 5M3FJ 5E3NA 4IHVA 3W6VA 4MLOA 2Y31A 3FISA 5K7HA 1WCMJ 2MSYA 4C2MJ 1ITYA 4A3BJ 1K61A 3A01A 4V2FA 3BT9A 2MG4A 1HDPA 2PMZN 1MSFC 2NVXJ 4DYCA 4A93J 3BR3A 5FLMJ 1A6IA 2JA7J 4D7NA 3H0GJ 4D5CA 1UHSA 3C2BA 1JT0A 3HDDA 3S2DJ 1ORKA 1JJ8C 4JX5A 1HCRA 4G12A 3JRDA 4B3AA 2JA5J 2EZHA 5F0CA 2XGCA 1OCPA 4DYRA 2LR8A 2M9HA 2DA3A 5FKMA 5M5XJ 5EG0A 1SFOJ 4FE4A 2EZIA 3LSJA 4JX6A 1W0UA 2L9RA 4ABZA 1GUUA 2Y9YA 3JR9A 2R0QC 2QF7A 4LOCA 3LSRA 4EEFG 1FTTA 4M3BA 4XK4A 5F1JA 5E3OA 2G0EA 2D5VA 3GTOJ 1P7IA 4Y7NJ 3VPRA 3Q3SA 2VPRA 5EZHA 1ENHA 1XS9A 1ETYA 2CJJA 1FJLA 4IEJA 2ECCA 3FK6A 3A01B 2XPUA 1MBEA 1ZQ3P 4W1UA 1GT0C 3O8GA 1JTYA 1FEXA 2P81A 4AC0A 4IHWA 3HB9A 1NK2P 4XRSA 1X2MA 2XB0X 4B1RA 3G1MA 3NARA 3HGYA 1E3OC 1U9OA 2EQRA 1MNMC 3HOWJ 3I4NJ 1POGA 4JP0A 1VFCA 2R5YB 1ETQA 4MO7A 4A3MJ 1PUFA 4XICA 3BR6A 3HOXJ 3A03A 5F27A 3BQYA 1BW5A 3TEDA 2IAIA 1U78A 5FJ8J 3BG3A 1SANA 4CYCB 2DA6A 3ZOBA 2XPWA 2LK2A 2DJNA 1NK3P 3SFIA 1BL0A 3HOUJ 2N8GA 5C4JJ 2XGDA 2NVYJ 4X1EA 2VUMJ 1QVUA 3B6AA 1ETOA 3HBLA 3BR5A 1H89C 2M34A 2R5ZB 2DA1A 2I10A 2XRLA 1QVTA 2EZLA 2M2EA 1XG1A 2JJ7A 5M5WJ 3WHCA 3I4MJ 5K7FA 4W97A 2EBIA 5IYCJ 5DTDA 1MBJA 2IBDA 2LLKA 1IV6A 1TC3C 1RR7A 3FIWA 1ETWA 5GPAA 3ZQFA 5C4XJ 1B72B 1D5YA 1QRYA 2QCOA 5IP9J 1TWAJ 2NVTJ 4BY7J 1Y1WJ 3K7AJ 3S16J 2CUFA 2VKVA 1RKWA 4L5EA 2CRGA 4DYQA 1WH7A 2RAEA 2WAQN 2GLOA 5EDNA 2WV1A 3IH2A 2E19A 3JRGA 5IPAA 4IHYA 5DS9A 1T56A 1JT6A 3CCYA 3CQZJ 2ME6A 1Z0XA 2Y9ZA 1GV2A 3GBGA 3CMYA 2K9QA 3JREA 2X48A 2O7OA 3O8HA 2ID3A 1JKPC 2Y2ZA 3DCFA 2OPTA 1ZK8A 2H1KA 2VI6A 5FKLA 1VF9A 4HNVA 3Q0VA 4IHXA 3SDGA 2HOSA 3QPSA 4DW6A 2XSDC 3RZOJ 1U8BA 5GPCA 2R5YA 3JRBA 1Q1VA 1BJZA 3HM5A 4MFEA 4J19A 2YU9J 1B8IB 3S14J 1P7JA 2HOTA 2XGEA 2HQ5A 4A69C 2NVQJ 1TWGJ 5IP7J 2AO9A 5IOZA 1GDTA 3TP3A 3QPLA 3HOVJ 4CYCA 5JLWA 2OF7A 2K9SA 1XC5A 5F0FA 1HOMA 2DA2A 3HEFA 2IEKA 3TW6A 5K7ZA 1X2NA 4A3CJ 1IG7A 3TP0A 2R5ZA 1FIPA 1T33A 4A3LJ 2AHQA 5EGOA 3GTMJ 3F0CA 1H88C 2X6OA 3IV5A 3GTKJ 1TWCJ 4MIMA 2TRTA 5GP9A 2HXOA 2O9LA 5E3LA 3BQZA 2MW8A 5FKKA 3RZDJ 1B72A 5J1YA 1WPKA 2CQQA 3G1OA 2DN0A 4XRSG 2DMPA 4UUSB 4DZPA 5FKOA 5M3MJ 1LFUP 4QIWN 1S7EA 5JLXA 2X9DA 1JJ6C 1ZKGA 3BTLA 1ETKA 4Y52J 5F0HA 5C3EJ 1A5JA 2HI3A 4BXXJ 1GVDA 2R93J 5FKNA 1BW6A 1FTZA 2DMUA 2FQ4A 3Q0WA 4QSHA 1YRNB 3HKZN 3LSPA 3H3VK 1RPWA 2ECBA 3Q0UA 5EZGA 5EGOB 1ZR2A 3OOUA 3UKGA 3HOZJ 1JKOC 2NS8A 4RDUA 2CUEA 3PM1A 1IUFA 2TCTA 4FE7A 5HODA 3JRHA 1RETA 5J3LA 4I6ZA 3OIOA 3MVPA 1I50J 3S1RJ 4D7MA 2NS7A 1RKTA 2DMQA 2K40A 1HF0A 2ME0A 3BTJA 2LVSA 3RKQA 3BG5A 3G1LA 2E2HJ 1B8IA 4A3IJ 5EEAA 2WB1N 3GTLJ 1U9NA 3K2AA 1ZTRA 2DA4A 4JYKA 4C3HJ 2JN6A 2GBYA 1MSEC 1JTXA 4M3DA 3WHBA 3S2HJ 3IH3A 5IOYA 1VNDA 1MBGA 2R92J 3JRAA 3HGGA 2LD5A 1I6HJ 1ZR4A 2H8RA 3JRCA 1ETXA 1JUPA 1IC8A 3M3YJ 2L7ZA 1UG2A 2ELKA 2GM4A 3S1QJ 2R7ZJ 1WI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1P A;  4B4C A;  3ZQC A;  4JX4 A;  2EZK A;  2FD5 A;  2O8K A;  1LFB A;  1JGG A;  3RQI A;  1CQT A;  2K9N A;  3OSG A;  4GFB A;  1ZGW A;  1VI0 A;  3GTG J;  1OJL A;  2DA5 A;  4QTR A;  3FK7 A;  2W48 A;  3PO2 J;  4M6V A;  2E2I J;  3SJM A;  1F43 A;  3D1N I;  4S0H B;  5C44 J;  4D5F A;  1MBK A;  2VKE A;  1TWH J;  1Y1V J;  4DZJ A;  1DU6 A;  4UUS A;  1I3Q J;  1TWF J;  4AUX A;  5IYD J;  4UUT A;  1O4X A;  3MN2 A;  4FTH A;  1BA5 A;  3JRF A;  2COB A;  4AYB N;  4RBO A;  2KT0 A;  3PO3 J;  2HDD A;  1GV5 A;  1UMQ A;  2E1O A;  1AHD P;  5FLV A;  1WGX A;  1LE8 B;  4FIS A;  1JKQ C;  2LY9 A;  1YRN A;  4M3E A;  1QPI A;  1EF4 A;  3LSG A;  1ETV A;  1JKR C;  2XPV A;  3GTJ J;  1F36 A;  3S17 J;  1MH3 A;  3QQA A;  3S1M J;  3OSF A;  3BTC A;  4M3G A;  2M0C A;  2DA7 A;  1IDY A;  4XRM A;  2L7M P;  1MH4 A;  1H8A C;  4A3D J;  5E3M A;  2HYJ A;  2FJ1 A;  1WH5 A;  3CDL A;  3S1N J;  2YS9 A;  2Y0S N;  3IH4 A;  2B63 J;  2E2J J;  2LTP A;  2LFB A;  4I76 A;  2L0K A;  3ZQL A;  5J1R A;  2DTZ A;  2YUS A;  2Y30 A;  3BG9 A;  1X58 A;  1AKH A;  1IGN A;  2EH3 A;  3TW7 A;  5F04 A;  5IYB J;  4FCY A;  3M4O J;  4M3F A;  2JWT A;  1JUM A;  4A3K J;  5EF6 A;  2JK3 A;  3E7L A;  2KDZ A;  5J1U A;  1RES A;  2CU7 A;  5M5Y J;  5EG0 B;  4V2G A;  2DMN A;  3HOY J;  2CQX A;  1HDD C;  2FX0 A;  3FKI J;  2ID6 A;  3BR1 A;  1IRZ A;  3NAU A;  5BNG A;  4C3J J;  2JMW A;  3BR2 A;  5IP6 A;  3ZQH A;  2LP0 A;  3S15 J;  3BR0 A;  3A02 A;  1OCT C;  4MFD A;  1NTC A;  2DMT A;  4BBS J;  2XB5 A;  2MGQ A;  4A3F J;  1FIA A;  4X6A J;  4A3J J;  1MBH A;  2M8G X;  4NDL A;  4A3G J;  2JA6 J;  2NOG A;  1AKH B;  2LKX A;  1K83 J;  3LOC A;  1MBF A;  1IJW C;  3LNQ A;  3BTI A;  1HLV A;  3GTQ J;  3ZQG A;  4C3I J;  5EYR A;  1IDZ A;  1Z77 A;  1PUF B;  2HOA A;  1APL C;  1DU0 A;  3JRI A;  1LE8 A;  2ZB9 A;  1G2H A;  4BKX A;  5F08 A;  1OFC X;  3MKL A;  9ANT A;  4BBR J;  3B6C A;  4A3E J;  2HXI A;  3GTP J;  2JA8 J;  1JUS A;  4XID A;  3DEW A;  2L7F P;  4BY1 J;  1R9T J;  1W0T A;  1AU7 A;  3ZQI A;  5M3F J;  5E3N A;  4IHV A;  3W6V A;  4MLO A;  2Y31 A;  3FIS A;  5K7H A;  1WCM J;  2MSY A;  4C2M J;  1ITY A;  4A3B J;  1K61 A;  3A01 A;  4V2F A;  3BT9 A;  2MG4 A;  1HDP A;  2PMZ N;  1MSF C;  2NVX J;  4DYC A;  4A93 J;  3BR3 A;  5FLM J;  1A6I A;  2JA7 J;  4D7N A;  3H0G J;  4D5C A;  1UHS A;  3C2B A;  1JT0 A;  3HDD A;  3S2D J;  1ORK A;  1JJ8 C;  4JX5 A;  1HCR A;  4G12 A;  3JRD A;  4B3A A;  2JA5 J;  2EZH A;  5F0C A;  2XGC A;  1OCP A;  4DYR A;  2LR8 A;  2M9H A;  2DA3 A;  5FKM A;  5M5X J;  5EG0 A;  1SFO J;  4FE4 A;  2EZI A;  3LSJ A;  4JX6 A;  1W0U A;  2L9R A;  4ABZ A;  1GUU A;  2Y9Y A;  3JR9 A;  2R0Q C;  2QF7 A;  4LOC A;  3LSR A;  4EEF G;  1FTT A;  4M3B A;  4XK4 A;  5F1J A;  5E3O A;  2G0E A;  2D5V A;  3GTO J;  1P7I A;  4Y7N J;  3VPR A;  3Q3S A;  2VPR A;  5EZH A;  1ENH A;  1XS9 A;  1ETY A;  2CJJ A;  1FJL A;  4IEJ A;  2ECC A;  3FK6 A;  3A01 B;  2XPU A;  1MBE A;  1ZQ3 P;  4W1U A;  1GT0 C;  3O8G A;  1JTY A;  1FEX A;  2P81 A;  4AC0 A;  4IHW A;  3HB9 A;  1NK2 P;  4XRS A;  1X2M A;  2XB0 X;  4B1R A;  3G1M A;  3NAR A;  3HGY A;  1E3O C;  1U9O A;  2EQR A;  1MNM C;  3HOW J;  3I4N J;  1POG A;  4JP0 A;  1VFC A;  2R5Y B;  1ETQ A;  4MO7 A;  4A3M J;  1PUF A;  4XIC A;  3BR6 A;  3HOX J;  3A03 A;  5F27 A;  3BQY A;  1BW5 A;  3TED A;  2IAI A;  1U78 A;  5FJ8 J;  3BG3 A;  1SAN A;  4CYC B;  2DA6 A;  3ZOB A;  2XPW A;  2LK2 A;  2DJN A;  1NK3 P;  3SFI A;  1BL0 A;  3HOU J;  2N8G A;  5C4J J;  2XGD A;  2NVY J;  4X1E A;  2VUM J;  1QVU A;  3B6A A;  1ETO A;  3HBL A;  3BR5 A;  1H89 C;  2M34 A;  2R5Z B;  2DA1 A;  2I10 A;  2XRL A;  1QVT A;  2EZL A;  2M2E A;  1XG1 A;  2JJ7 A;  5M5W J;  3WHC A;  3I4M J;  5K7F A;  4W97 A;  2EBI A;  5IYC J;  5DTD A;  1MBJ A;  2IBD A;  2LLK A;  1IV6 A;  1TC3 C;  1RR7 A;  3FIW A;  1ETW A;  5GPA A;  3ZQF A;  5C4X J;  1B72 B;  1D5Y A;  1QRY A;  2QCO A;  5IP9 J;  1TWA J;  2NVT J;  4BY7 J;  1Y1W J;  3K7A J;  3S16 J;  2CUF A;  2VKV A;  1RKW A;  4L5E A;  2CRG A;  4DYQ A;  1WH7 A;  2RAE A;  2WAQ N;  2GLO A;  5EDN A;  2WV1 A;  3IH2 A;  2E19 A;  3JRG A;  5IPA A;  4IHY A;  5DS9 A;  1T56 A;  1JT6 A;  3CCY A;  3CQZ J;  2ME6 A;  1Z0X A;  2Y9Z A;  1GV2 A;  3GBG A;  3CMY A;  2K9Q A;  3JRE A;  2X48 A;  2O7O A;  3O8H A;  2ID3 A;  1JKP C;  2Y2Z A;  3DCF A;  2OPT A;  1ZK8 A;  2H1K A;  2VI6 A;  5FKL A;  1VF9 A;  4HNV A;  3Q0V A;  4IHX A;  3SDG A;  2HOS A;  3QPS A;  4DW6 A;  2XSD C;  3RZO J;  1U8B A;  5GPC A;  2R5Y A;  3JRB A;  1Q1V A;  1BJZ A;  3HM5 A;  4MFE A;  4J19 A;  2YU9 J;  1B8I B;  3S14 J;  1P7J A;  2HOT A;  2XGE A;  2HQ5 A;  4A69 C;  2NVQ J;  1TWG J;  5IP7 J;  2AO9 A;  5IOZ A;  1GDT A;  3TP3 A;  3QPL A;  3HOV J;  4CYC A;  5JLW A;  2OF7 A;  2K9S A;  1XC5 A;  5F0F A;  1HOM A;  2DA2 A;  3HEF A;  2IEK A;  3TW6 A;  5K7Z A;  1X2N A;  4A3C J;  1IG7 A;  3TP0 A;  2R5Z A;  1FIP A;  1T33 A;  4A3L J;  2AHQ A;  5EGO A;  3GTM J;  3F0C A;  1H88 C;  2X6O A;  3IV5 A;  3GTK J;  1TWC J;  4MIM A;  2TRT A;  5GP9 A;  2HXO A;  2O9L A;  5E3L A;  3BQZ A;  2MW8 A;  5FKK A;  3RZD J;  1B72 A;  5J1Y A;  1WPK A;  2CQQ A;  3G1O A;  2DN0 A;  4XRS G;  2DMP A;  4UUS B;  4DZP A;  5FKO A;  5M3M J;  1LFU P;  4QIW N;  1S7E A;  5JLX A;  2X9D A;  1JJ6 C;  1ZKG A;  3BTL A;  1ETK A;  4Y52 J;  5F0H A;  5C3E J;  1A5J A;  2HI3 A;  4BXX J;  1GVD A;  2R93 J;  5FKN A;  1BW6 A;  1FTZ A;  2DMU A;  2FQ4 A;  3Q0W A;  4QSH A;  1YRN B;  3HKZ N;  3LSP A;  3H3V K;  1RPW A;  2ECB A;  3Q0U A;  5EZG A;  5EGO B;  1ZR2 A;  3OOU A;  3UKG A;  3HOZ J;  1JKO C;  2NS8 A;  4RDU A;  2CUE A;  3PM1 A;  1IUF A;  2TCT A;  4FE7 A;  5HOD A;  3JRH A;  1RET A;  5J3L A;  4I6Z A;  3OIO A;  3MVP A;  1I50 J;  3S1R J;  4D7M A;  2NS7 A;  1RKT A;  2DMQ A;  2K40 A;  1HF0 A;  2ME0 A;  3BTJ A;  2LVS A;  3RKQ A;  3BG5 A;  3G1L A;  2E2H J;  1B8I A;  4A3I J;  5EEA A;  2WB1 N;  3GTL J;  1U9N A;  3K2A A;  1ZTR A;  2DA4 A;  4JYK A;  4C3H J;  2JN6 A;  2GBY A;  1MSE C;  1JTX A;  4M3D A;  3WHB A;  3S2H J;  3IH3 A;  5IOY A;  1VND A;  1MBG A;  2R92 J;  3JRA A;  3HGG A;  2LD5 A;  1I6H J;  1ZR4 A;  2H8R A;  3JRC A;  1ETX A;  1JUP A;  1IC8 A;  3M3Y J;  2L7Z A;  1UG2 A;  2ELK A;  2GM4 A;  3S1Q J;  2R7Z J;  1WI3 A; 
#chains in the Genus database with same CATH topology
 1IRX A;  3ZQC A;  2WWY A;  2EZK A;  2FD5 A;  4GO1 A;  4ON0 A;  3D5L A;  3GZN B;  2O8K A;  2KFD A;  2ESN A;  3K0L A;  4KUM A;  4XLF A;  2HNH A;  4LFU A;  1C0W A;  2L3D A;  1K6O A;  2K4J A;  1WKM A;  3QPT A;  4PK4 A;  2A5W A;  1IW7 F;  2HVQ A;  4BEH B;  1XSD A;  4XBF A;  1MBK A;  2VKE A;  1Y1V J;  4DZJ A;  4UUS A;  3QOP A;  1ON1 A;  4AUX A;  2NNY A;  3MN2 A;  1QHG A;  1QPM A;  2COB A;  1E3H A;  4RBO A;  2KT0 A;  3HOT A;  1GHC A;  1UMQ A;  2DO7 A;  1P4X A;  2E1O A;  2BY3 A;  2H6C A;  1AHD P;  2H6B A;  1FOW A;  1WJA A;  3K4J A;  1WGX A;  1PDN C;  5FLV A;  2XDV A;  3BJA A;  2LY9 A;  5CVR A;  2CGP A;  1MMS A;  3HG9 A;  1YRN A;  2HU9 A;  1QPI A;  1EF4 A;  3AG4 H;  4F55 A;  1JKR C;  3KYC B;  3E6C C;  4C9Y A;  1YIO A;  1D1B A;  1MH3 A;  1Y8R B;  2L54 A;  3CCV I;  1O7F A;  4AVZ A;  5HNF A;  2OCC H;  2JUG A;  3EYI A;  1XSV A;  1IDY A;  1MMG A;  2DFH A;  2L7M P;  4BGD A;  3V7S A;  4A3D J;  2P7C B;  1LDJ A;  2FJ1 A;  1IN5 A;  1KYZ A;  2QA4 I;  3DF8 A;  3P9C A;  1YJN I;  2Y0S N;  3IH4 A;  2B63 J;  2AXT C;  2WA0 A;  2LFB A;  2LY1 A;  3BCA A;  4I76 A;  3OYB A;  2QSG X;  2KRF A;  1BI1 A;  3RYR A;  1YHQ I;  5E20 A;  1OIS A;  1GVJ A;  2Y30 A;  1AKH A;  2XRN A;  1SAX A;  1YIT I;  2VT2 A;  1UJ8 A;  5DUK A;  5TIS C;  4CYD A;  3NWT A;  1HXD A;  2PBI A;  1XPX A;  2JK3 A;  3TOA A;  3W2A A;  2EFQ A;  3B02 A;  1BIA A;  3ABK H;  2KDZ A;  1RES A;  2CU7 A;  5M5Y J;  5EG0 B;  4RB0 A;  2DMN A;  5HNH A;  1R6R A;  2ID6 A;  3QP5 A;  3QRF F;  2XAS A;  2EA4 A;  3NAU A;  4M6Y A;  1L0O C;  1WQ2 A;  2QM3 A;  4QPO A;  4C3J J;  5ICF A;  1KQ9 A;  1WWX A;  3J80 Z;  3EPZ A;  4ESJ A;  1TP4 A;  3BR0 A;  4IL6 C;  5AON A;  4C30 A;  1FOK A;  3FXM A;  1TNT A;  3RQ4 A;  4UXN A;  2MGQ A;  4A3F J;  4KNY A;  3T1B A;  1U2W A;  1G4D A;  4KIC A;  2P8T A;  4A3J J;  1GXQ A;  1MBH A;  1WJ5 A;  2O0Y A;  3BWG A;  4NDL A;  3ZPL A;  4A3G J;  5EEG A;  5CVV A;  4EJV A;  1Y56 A;  3RKX A;  2NOG A;  4G7H F;  3K2Z A;  4EGY A;  4IHT A;  5LGT A;  4A2U A;  3CTA A;  5D4S A;  1T8I A;  2JZY A;  4DJA A;  5H2F C;  3GTQ J;  2VE8 A;  1Z77 A;  1PUF B;  1APL C;  2A07 F;  1DGW Y;  3F6O A;  5HLT A;  1LE8 A;  3GFM A;  4Q47 A;  2QKM B;  3OYC A;  4OU0 A;  2IRF G;  3L2R A;  3MKL A;  9ANT A;  4BBR J;  3B6C A;  3GTP J;  2JA8 J;  5JFR A;  4XID A;  5HOO A;  3ABT A;  2K3P A;  1R1V A;  2V9P A;  1W36 D;  4ZZL A;  1R23 A;  3K1N A;  1W0T A;  4P1W A;  4Q4Z F;  3DBL B;  4CCK A;  5F1R A;  2QBY B;  2V1N A;  3CP8 A;  2ZNZ A;  4GRI A;  4IHV A;  2Y31 A;  2EPF A;  4E7K A;  2JRT A;  2E71 A;  4IJA A;  1EJ9 A;  5E18 F;  4E7I A;  3CUQ A;  3KFW X;  5DCF A;  1VQP I;  1Y6I A;  4M71 A;  3A01 A;  1Y8Q B;  2A5Y B;  1W36 C;  1VQ8 I;  1UFM A;  4M74 A;  5B66 C;  2R7R A;  5TRD A;  2NVX J;  4DYC A;  5GAE J;  5FLM J;  5LD2 C;  1T38 A;  2JA7 J;  1O3R A;  2A6T A;  1RIO H;  3GLX A;  3I9V 2;  2QLZ A;  3V7R A;  4D5C A;  3IAM 2;  3IRR A;  3C2B A;  3HDD A;  3ERM A;  1ORK A;  1U8R A;  2HKO A;  1JJ8 C;  3FHN A;  3PSI A;  3JRD A;  3IC7 A;  1EV7 A;  1QHH D;  4NHJ A;  2K5C A;  3GME A;  4PJM A;  4XSX F;  3J80 K;  1OCP A;  3F8M A;  3JW4 A;  4CCM A;  4YG2 F;  5DM6 F;  4WWC A;  2M9H A;  1UCR A;  3RKW A;  1P2F A;  1N78 A;  3DEU A;  4KIG A;  4PFP A;  1QNT A;  4FE4 A;  1A36 A;  1GUU A;  1E3P A;  2R0Q C;  3HRU A;  1FSH A;  3OYD A;  3LSR A;  4YEL A;  1ON2 A;  3CCJ I;  4XK4 A;  1KU2 A;  1XGS A;  1P7I A;  1YLF A;  4RA2 A;  1XS9 A;  3HYI A;  3R0J A;  1FOX A;  3HRT A;  1O3T A;  1FJL A;  2ECC A;  2YX7 A;  2F4I A;  3FK6 A;  1FBS A;  3BZC A;  3WGI A;  4G6T B;  3OYN A;  5FD6 A;  2EFO A;  1XCV A;  1HW2 A;  4AC0 A;  2BV6 A;  3IP4 B;  3MKY B;  1MD0 A;  2XAF A;  1OR7 A;  2D1H A;  1X2M A;  3IKT A;  3ECO A;  4HLX A;  4P5O A;  2ZBK A;  3DV8 A;  2KJC A;  3A2K A;  4OWR B;  2ZC2 A;  4UUV A;  3AKZ A;  3B73 A;  3HOW J;  3I4N J;  4JP0 A;  1VFC A;  2OQR A;  4II3 A;  3UNG C;  1K79 A;  4ZYD A;  4MO7 A;  4A3M J;  2HTS A;  3A03 A;  1VQ6 I;  5D5V B;  1HKS A;  1RC9 A;  3H9G A;  5CVI A;  2DOF A;  4U0W A;  2DAO A;  2DA6 A;  2XPW A;  3RI4 A;  1MJA A;  2FSW A;  2LK2 A;  3M9A A;  1NK3 P;  5E17 F;  2ZFU A;  4KA4 A;  4HST A;  3K4N A;  2BEO A;  2FNP A;  3B6A A;  4BE2 A;  2VUM J;  2XF7 A;  1H89 C;  2LRD A;  1D8J A;  2DA1 A;  3ZR8 X;  1I39 A;  3O2P E;  2M2E A;  2V26 A;  4ZH4 F;  2BOL A;  5M5W J;  1Y0N A;  2GXA A;  2OZU A;  3GEZ A;  5HVQ C;  2XV4 S;  5DTD A;  1JE8 A;  1J09 A;  3VSK A;  2HZD A;  1UST A;  5CQG A;  1RR7 A;  1X1D A;  1YFH A;  1W7P A;  5C4X J;  4XKV A;  1B72 B;  3VOE A;  5LHH A;  1D5Y A;  4BQO A;  2QCO A;  2K9L A;  3T0Y A;  4ENN A;  1SEU A;  3W6K B;  2DDA A;  2W1O A;  3K4M A;  3G2B A;  2CUF A;  4HX4 A;  2V79 A;  2XAH A;  4L5E A;  3P9K A;  4EJW A;  3HC7 A;  2OV7 A;  2RAE A;  1BR4 A;  1ZRC A;  3TKY A;  2WV1 A;  4LGW A;  2XAU A;  2F5E A;  3CUQ C;  5IPA A;  4IHY A;  1T56 A;  1ZRF A;  3I59 B;  1Z7L A;  2E1M C;  2CSO A;  1OKR A;  2GXG A;  1YG2 A;  2MC3 A;  3PUF A;  3CO6 C;  1TNS A;  2HQN A;  3ML6 A;  3SHF A;  3IKV A;  1R4M B;  2QEX I;  2K9Q A;  2VN2 A;  4NUB A;  3JRE A;  2HQA A;  3W3C A;  4HV6 A;  2O7O A;  4PFO A;  2OUM A;  4RB3 C;  1XGN A;  3TO7 A;  3WTZ A;  2ZJ2 A;  2E7W A;  2OPT A;  2VI6 A;  4XN3 A;  3KP7 A;  5FKL A;  3Q0V A;  1AWC A;  1X4O A;  3V8L A;  2XSD C;  4FX4 A;  3JRB A;  1Q1V A;  4CIC A;  4L5J A;  3I56 I;  1B8I B;  1YX5 A;  2YU9 J;  3S14 J;  2A3S A;  4FT8 A;  3RPU A;  1TWG J;  3HRS A;  4HV5 A;  4E7J A;  4G94 A;  3ABU A;  3E5Q A;  4LG0 A;  1D1A A;  4YFK F;  4A12 A;  2HWV A;  2HQR A;  4WCG A;  4HDU A;  3MEX A;  3E6B A;  3CO7 C;  1G8X A;  2Y0M A;  2Z5U A;  2MC4 A;  4DNC A;  5F0F A;  1HOM A;  4YIR X;  3J7A O;  1V54 H;  1W1W E;  1Z3X A;  2R7V A;  4L9V A;  2GIV A;  2J5O A;  3DKY A;  4A3C J;  2HFH A;  3TP0 A;  4XLC A;  3MKZ A;  2R7X A;  2FOW A;  5JHU A;  1KGS A;  1OR7 C;  4XLH A;  2CFX A;  5L3G A;  1T98 A;  3GTM J;  1H88 C;  3KZY A;  2X6O A;  4CHU A;  2D45 A;  1U5T C;  3GTK J;  3I0T A;  4P96 A;  2VJ4 A;  1EA3 A;  4MIM A;  3BRO A;  2YR2 A;  2O9L A;  3BQZ A;  3FMS A;  4U88 A;  4HPQ A;  3CMA I;  1X3Z B;  3CCM I;  3RZD J;  4P55 A;  2NVU B;  2F48 A;  3HHG A;  3ZGK A;  4XRS G;  4RGU A;  4UUS B;  3G73 A;  3GCM A;  5H20 A;  2HR3 A;  3K1P A;  5FKO A;  5GTH C;  2F5V A;  1LFU P;  1EH8 A;  3PIO F;  1S7E A;  3QYF A;  3PFY A;  3GXO A;  3CJQ B;  2IPQ X;  2GA1 A;  4E6K G;  1R22 A;  2WAE A;  1UZC A;  2WBM A;  1SD7 A;  1VZ0 A;  3CCS I;  3Q5F A;  1IRF A;  1PJR A;  5LGU A;  5GAD J;  5LEJ A;  1FTZ A;  4F7Z A;  5H6R A;  1W7P D;  3L09 A;  3TO9 A;  3F9K A;  1BM9 A;  1YRN B;  1UAA A;  3ABM H;  3LSP A;  3LSI A;  4Y3O A;  1TW3 A;  4B44 A;  4N9I A;  1JXS A;  3WU0 A;  1TQP A;  2VE9 A;  4MTD A;  2VQH A;  2VOD A;  4N4O B;  3H9Q A;  3WTS C;  4FE7 A;  4RB2 C;  1SD5 A;  4BAC A;  3JRH A;  2K85 A;  4I6Z A;  2JVG A;  2KIU A;  4GDF A;  1S72 I;  2M5W A;  3CJT B;  3HZJ A;  2VL8 A;  1OQY A;  3TMO A;  3S1R J;  2BY2 A;  1YJW I;  4CSW A;  1MKM A;  1YS6 A;  2DMQ A;  3G4S I;  1WRJ A;  4II2 A;  3ECH A;  4KIF A;  2IS2 A;  3F8F A;  1LJ9 A;  2DDB A;  4R8H A;  4A3I J;  3BCB A;  5FFX A;  2G7H A;  2DA4 A;  1ZLJ A;  4YFN F;  3FM5 A;  3MZ8 A;  2GBY A;  3C2H A;  3WU1 B;  4B8X A;  2BHY A;  2DQR A;  4M3D A;  1X4P A;  3S2H J;  1SD6 A;  5IOY A;  2NRA C;  1MBG A;  2R92 J;  2LD5 A;  4L9T A;  3MKW B;  1EH7 A;  1YJ9 I;  5KHD A;  2H8R A;  4IX7 A;  1IC8 A;  4N9H A;  2J5P A;  5CKT A;  2XVC A;  1XMA A;  2L7Z A;  4YFX F;  1YOV B;  2OJE D;  3L1P A;  2EK5 A;  2H27 A;  5KNL A;  3RPU D;  3SQN A;  3RQI A;  3M8F A;  2K9N A;  3OSG A;  3U2R A;  4XOR A;  4GGG A;  1FMV A;  3V7C A;  4M9S A;  1O7L A;  1X19 A;  3HL2 A;  2OC6 A;  2DA5 A;  4HNU A;  3OYF A;  3FK7 A;  2W48 A;  3HUG B;  3KZI C;  2GOM A;  2A6E F;  4ESF A;  5F6F A;  3K6G A;  3H1C A;  4CCL A;  3SJM A;  4CXF A;  2IGK A;  5BPD A;  4S0H B;  3HSR A;  3PIP F;  5C44 J;  2HPM A;  5D6F A;  1T2K A;  4E70 A;  1S9H A;  3OS0 A;  3F23 A;  2VJJ A;  2X1E A;  4YIF A;  2VLA A;  4BQN A;  3F3X A;  4HEA 2;  2JT1 A;  4RLQ A;  3CES A;  3JRF A;  1N75 A;  1E2X A;  2F5C A;  1WJF A;  4BHC A;  1T08 B;  4I0A A;  1BI3 A;  1HSJ A;  1LE8 B;  4FIS A;  2HEO A;  1S8N A;  4U87 A;  1KA8 A;  4HX7 A;  4M3E A;  2RC4 A;  4S05 A;  2PEX A;  1ETV A;  2XHK A;  1RNL A;  4L9J A;  2P6T A;  3FXJ A;  2F6C A;  1IXS B;  2NYX A;  3I71 A;  5TJJ A;  2EFW A;  2DOD A;  4M3G A;  2M0C A;  4I98 B;  3J81 Z;  3WTY C;  4UV8 A;  1MH4 A;  1G3S A;  1H8A C;  3MZY A;  2VXD A;  2E1M B;  3LSH A;  2DT7 B;  3TQN A;  2NXN B;  1WH5 A;  3HSE A;  2YS9 A;  3A4C A;  3DPT A;  3E6D A;  4U0V A;  2KZG A;  2MYS A;  4UNO A;  2L0K A;  2MLK A;  5DD4 A;  4BE0 A;  4DIQ A;  1Q1H A;  2HDW A;  4XN0 A;  5J1R A;  1Z67 A;  2YUS A;  5BPI A;  1X58 A;  5D5W B;  2DT6 A;  1DP7 P;  1E0E A;  4FCY A;  2E36 A;  3WOD F;  4IPA A;  2IS6 A;  2ACJ A;  1WFX A;  4A3K J;  1PVE A;  4HLY A;  2PLY A;  3E7L A;  2DI3 A;  1BI2 A;  5LFA A;  2E5N A;  3HOY J;  2ZSH B;  2DLL A;  3FKI J;  1HDD C;  4I09 A;  4I7H A;  4OOI A;  2X4H A;  2XKO A;  1LPQ A;  2DQL A;  2Q0O A;  3BR2 A;  2Y48 A;  5IP6 A;  3F22 A;  2QSF X;  2LP0 A;  2P5V A;  3GF2 A;  3LL7 A;  3RJP A;  4MFD A;  1Z9C A;  3L2Q A;  1TZL A;  4X0G A;  2OTL I;  2A68 F;  3JTH A;  2ZJP F;  2O03 A;  3ISP A;  2XB5 A;  4P9F A;  3ZRG A;  1G6N A;  1BN5 A;  3E6M A;  3BG7 A;  1KQ8 A;  1FIA A;  1ZRE A;  3BLY A;  2M8G X;  2FBK A;  4FHT A;  4MEY F;  3ZXS A;  5CVJ A;  3KP4 A;  1W5S A;  1K83 J;  1MBF A;  2RNJ A;  3LNQ A;  2QKL B;  3WTT C;  2IA1 A;  3ZQG A;  2A05 A;  2HOA A;  4XKB A;  3JRI A;  2ZB9 A;  3R6S A;  5F08 A;  2D1V A;  2IJL A;  4EMS A;  3ZN0 A;  4XMY A;  2R7D A;  3CZ6 A;  1XTA A;  2Z33 A;  3DEW A;  2L7F P;  2EB7 A;  4U7B A;  5B5E C;  1QU3 A;  3LFU A;  5JVG F;  3KYL A;  1AU7 A;  5M3F J;  3LWF A;  2GQQ A;  2O3F A;  4MLO A;  1X1P A;  2MSY A;  2CS3 A;  4NBQ A;  4C2M J;  4G9Y A;  4J01 A;  1SVM A;  2PMU A;  2OQG A;  4A3B J;  4DBQ A;  4HF2 A;  2M4G A;  3DXJ F;  3F6V A;  2V9V A;  2BBY A;  2MG4 A;  2FOK A;  4C2U A;  3EET A;  2PMZ N;  1OCR H;  3N4M A;  2XAJ A;  2ISZ A;  3IWF A;  1D0Y A;  2M7B A;  3BR3 A;  4XR6 A;  1V5E A;  1MW7 A;  2ZNY A;  1DDN A;  1WI9 A;  1XGM A;  3H0G J;  4F3Q A;  4WX9 A;  3S2D J;  2EV0 A;  4NC8 A;  4HW0 A;  3KP3 A;  4G12 A;  4B3A A;  2CO5 A;  3RDI A;  1ZGA A;  3MCZ A;  2W82 A;  3HTU A;  4M9Z A;  1TL8 A;  4ZYE A;  3OYL A;  1RZ4 A;  1UEL B;  4RAZ A;  4AYB A;  5M5X J;  2CUJ A;  2VBZ A;  1MJB A;  4IOA F;  3GUD A;  2RNG A;  3LSJ A;  1SFO J;  4JX6 A;  4CH7 A;  4ESB A;  2Y9Y A;  4LOC A;  1T6S A;  4OIO F;  4Q5S F;  3DU6 A;  1HST A;  1B9M A;  4M3B A;  3IUO A;  2BXY A;  4CUG A;  5JR3 A;  5K5Q A;  5E3O A;  3GTO J;  2QGU A;  2CQN A;  2X6W A;  3VPR A;  1R5G A;  3Q3S A;  2VPR A;  4TV7 A;  5EZH A;  4Y7N J;  2P6S A;  5GAH J;  4IRH A;  5ILS A;  4IEJ A;  3KPH A;  4CCJ A;  2XPU A;  4W1U A;  2VON A;  1GT0 C;  3IWZ A;  2V1X A;  3H5N A;  1JTY A;  2V7F A;  1PP7 U;  3HB9 A;  1R1T A;  1NK2 P;  2RRE A;  1O3Q A;  4Y15 A;  4KT5 C;  5HLH A;  1KON A;  1YW9 A;  4OMY A;  1DPU A;  4HF1 A;  3HGY A;  3D0S A;  2WV0 A;  3W2V A;  3S3N A;  1NHA A;  2RN7 A;  4QLC U;  4KMU X;  2DCE A;  3I53 A;  4XKC A;  2L4A A;  5EEH A;  4BYY A;  1YS7 A;  1WJB A;  1R49 A;  5F27 A;  2DJI A;  1MNE A;  3BQY A;  3F21 A;  3TED A;  2IAI A;  4N4N B;  2MA3 A;  4LIU A;  3F8B A;  1ZH5 A;  1ONV A;  4E7S A;  4LG0 B;  1SVO A;  1UHM A;  5E1X A;  2CW8 A;  4LK0 F;  3HKZ A;  2ISY A;  4UVB A;  3BG6 A;  4N0B A;  3OIP A;  3S2W A;  3SFI A;  2BHZ A;  2LF7 A;  2N8G A;  3ZN1 A;  5JI6 A;  1T39 A;  4X1E A;  2ELJ A;  4RAY A;  2LYC A;  3BR5 A;  3L2V A;  5F64 A;  2OTJ I;  2M34 A;  2ZME A;  1X3W B;  4CCO A;  3H35 A;  1QVT A;  1YO5 C;  3ZMT A;  5J4Y A;  2JJ7 A;  2ZXJ A;  3O6B B;  4NQW A;  3KP2 A;  4PZJ A;  3OWT A;  3WHC A;  2KKO A;  4D1Q A;  3R0A A;  4L5I A;  4AWX B;  1MBJ A;  1IV6 A;  1TC3 C;  2NOJ B;  3FIW A;  3RCO A;  1A35 A;  1WJC A;  2IP2 A;  1VQ7 I;  1G3W A;  3KEO A;  1QRY A;  3M8J A;  5CPR B;  4YRV A;  5HS8 A;  1K4T A;  4MQV A;  3L7W A;  3LA7 A;  1IN6 A;  3K7A J;  3FM3 A;  2VKV A;  2CRG A;  1TLH B;  2VIX A;  3AL0 C;  2PQ8 A;  4E7H A;  3KET A;  5D8L B;  2A69 F;  5EDN A;  4PSW A;  3IH2 A;  4PJL A;  4RB1 A;  3FDY A;  5DS9 A;  1MIJ A;  2VXZ A;  1R71 A;  2STW A;  1FBQ A;  1Z3Y A;  2ME6 A;  1ZHF A;  3H3Z A;  3GBG A;  2LKP A;  2UUZ A;  5DDG A;  4WF2 A;  1V5G A;  1J7K A;  2UWM A;  4ANJ A;  5DCM A;  2X48 A;  2ID3 A;  4XON A;  2QQ8 A;  5LBQ A;  4L0Y B;  2PG4 A;  1WSU A;  5FB2 A;  3FXU A;  3BC8 A;  3OOP A;  1QGP A;  4M72 A;  5GPC A;  1U8B A;  1Y39 A;  4G6Q A;  1OCO H;  3HM5 A;  4B09 A;  2HOT A;  2AQF A;  2XGE A;  1XB4 A;  2HQ5 A;  3W6J B;  4A69 C;  1I1S A;  1SMY F;  1YTY A;  2E35 A;  2QVO A;  5LRS A;  2FNA A;  4P9U A;  1GDT A;  4KMF A;  4IHS A;  5J40 A;  3H36 A;  1P4A A;  3ASN H;  3L00 A;  1MDM A;  2KRC A;  3TBI A;  5JLW A;  2F2E A;  2H09 A;  1IUY A;  3S3O A;  1XC5 A;  2PN6 A;  1J9I A;  3DPU A;  2DA2 A;  1R7J A;  3G71 I;  1V4R A;  2D2W A;  2DTR A;  4RAF A;  3ASO H;  2BYV E;  1LDK B;  1V5F A;  1K6Y A;  3FF5 A;  4B43 A;  2R5Z A;  3DWL E;  1GXP A;  2VB6 A;  1FIP A;  1T33 A;  3KP6 A;  1N77 A;  3DTI A;  2OZ6 A;  1FYM A;  1WJD A;  2V4J C;  3IV5 A;  1DQU A;  4OAY A;  2P0W A;  1H9G A;  1MGT A;  3ZQQ A;  3HHH A;  5E1Z B;  5KAF C;  2X1D A;  2FA5 A;  1U5T A;  2EIK H;  4F92 B;  3KE2 A;  1BOB A;  1KU9 A;  5E3L A;  5ICE A;  2MW8 A;  3U1K A;  1PUE E;  1ODD A;  3VDX A;  1I3A A;  4ENM A;  2IXS A;  2HYG D;  5J1Y A;  3G1O A;  3C18 A;  2VT3 A;  4ZDO A;  4DZP A;  3OS2 A;  2M8E A;  4Y13 A;  1K7A A;  3WG9 A;  5JLX A;  3EDP A;  1ZKG A;  3BTL A;  1ETK A;  4Y52 J;  5JHF A;  2PJP A;  2F5D A;  2XC7 A;  4L9N A;  5F0H A;  2WY7 Q;  2XKP A;  3PFI A;  4FET A;  5C3E J;  4CZZ A;  3N05 A;  2HI3 A;  1VQL I;  2HTJ A;  1SC7 A;  4PJ0 C;  1TT0 A;  1GVD A;  2ZME C;  2GOX B;  2RKH A;  3E5X A;  3E3V A;  2CQ7 A;  2XSJ C;  2K9M A;  2DYR H;  2JVH A;  2QQ9 A;  4QSH A;  3HKZ N;  2XGX A;  3H3V K;  5TGT A;  1SFK A;  5EGO B;  3OOU A;  3D5S C;  1IAW A;  2NS8 A;  2DFF A;  1IUF A;  1UHW A;  1HQC A;  4WK8 F;  1TQI A;  1RET A;  4LLG F;  5J3L A;  3OIQ A;  1K78 B;  3GFL A;  3VOD A;  4D7M A;  3M1E A;  4CA0 A;  1TW2 A;  2K40 A;  4UHT A;  1HF0 A;  4RGX A;  3DLA A;  1W4M A;  3KIO A;  3G1L A;  2O61 A;  5FFZ A;  4BEH A;  1LEB A;  3F8N A;  5HLG A;  4JYK A;  2W85 A;  2XAQ A;  1SFU A;  4LB6 B;  4BQA A;  3CF2 A;  2XAG A;  4EQQ A;  2ZO4 A;  4XNF A;  4OIN F;  3WHB A;  5D8K B;  1ZYR F;  3IH3 A;  2R7U A;  1VND A;  2R7Q A;  3HGG A;  1BIB A;  4A0Y A;  4U0Y A;  1ETX A;  3M3Y J;  1WJE A;  4OMZ A;  1UG2 A;  3VYR B;  1W5T A;  1OCZ H;  4F91 B;  2OCE A;  2R7Z J;  3S1Q J;  2VBX A;  1Z91 A;  2QWW A;  3T8T A;  2L01 A;  1X3U A;  3TDZ C;  2HVS A;  5DV5 A;  1B9N A;  4Y4R A;  4UB8 C;  3MD2 A;  2K3F A;  1JGG A;  1CQT A;  2Z2S B;  1ZGW A;  1VI0 A;  5AIQ A;  3GTG J;  2O6G E;  5HS7 A;  3BOQ A;  4MHG A;  3GW2 A;  4M6V A;  3NRV A;  2LY2 A;  4HQM A;  3WGG A;  1R00 A;  3BP8 A;  1E17 A;  2CH0 A;  2P7V B;  1JHF A;  1LEA A;  2VBY A;  5IYD J;  1ZG3 A;  4BJ5 C;  3VSL A;  3CDI A;  3GYH X;  4FTH A;  1BA5 A;  5DYM A;  1HA8 A;  1SAU A;  4HNT A;  2Q1Z B;  2PJR A;  3S8P A;  2LDU A;  3ABL H;  3TDU C;  2HDD A;  1HW5 A;  1U3E M;  3RPQ A;  1IV8 A;  2EJR A;  1ZGJ A;  2JPB A;  2QSH X;  1VQ4 I;  3SEQ A;  5L3E A;  5J8F A;  3LSG A;  1FC3 A;  2CW7 A;  3L2C A;  1ZN2 A;  2M30 A;  1QQI A;  3VFZ A;  3S1M J;  3D5R C;  3BTC A;  1YQA A;  4JOM A;  4BH9 A;  4ZZD A;  2HGC A;  3E97 A;  2DBB A;  2LRE A;  4LIT A;  2BVM A;  2VOP A;  5E3M A;  2O8X A;  2HYJ A;  4PJN A;  2BW3 A;  3CDL A;  3L2W A;  2P4W A;  2E2J J;  3T8R A;  3WTU C;  4K2E A;  2YX4 A;  2EIJ H;  2G7U A;  1O3S A;  4BQQ A;  3BG9 A;  5ED4 A;  5HLI A;  5IYB J;  5F04 A;  3HPG A;  2XUB A;  3FMR A;  3GLL A;  3TO6 A;  3ERE D;  5DD8 A;  4IRI A;  1I1G A;  3O3K A;  1JGS A;  2EFP A;  1Z7U A;  1QO0 D;  2KPM A;  3FBN B;  4V2G A;  2CYY A;  2CQX A;  2FX0 A;  4UB6 C;  3QU6 A;  4F93 B;  3KYD B;  1IRZ A;  3DPL C;  2B9S A;  2JMW A;  3DKW A;  2E7X A;  2VKD A;  1W5C C;  1A6Q A;  1R5H A;  3ZQH A;  1WZ2 A;  2ZXW H;  1ERD A;  1P6R A;  2QBY A;  1FWZ A;  1OCC H;  3KZZ A;  2PFB A;  4GXO A;  3RTR A;  1OCT C;  5LHI A;  3GX4 X;  1NTC A;  2DMT A;  4IRG A;  4D0P A;  4AD9 A;  1GLN A;  1TT5 B;  4BBS J;  5B1B H;  3MWM A;  3QWL A;  1CGP A;  4HZF A;  2PMH A;  4BDZ A;  3ELK A;  1VQK I;  3AG1 H;  3LAP A;  3JCU C;  5FRN A;  5K1Y A;  2RGV A;  2ETH A;  4V19 K;  4BE1 A;  1AKH B;  3GFJ A;  1YX3 A;  2LKX A;  2CFO A;  1BI0 A;  1O57 A;  3M07 A;  4UVA A;  4HDV A;  1IJW C;  3BTI A;  3CDH A;  4BDY A;  3OR2 C;  4ENJ A;  3OYE A;  1T0F C;  4C3I J;  1VQ9 I;  2WAQ A;  2BY1 A;  2CV1 A;  4EM2 A;  4UY8 I;  3E0J B;  1WVR A;  1KZH A;  1G2H A;  2FF4 A;  2CV2 A;  3OYJ A;  1SD4 A;  4A3E J;  1P9Q C;  3TL4 X;  2JSP A;  3LFK A;  3EUA A;  4PGH A;  4BY1 J;  4GYG A;  3BDD A;  3ZMU A;  5BOX A;  3ZQI A;  2FU4 A;  2KIF A;  2V6E A;  1BR2 A;  3EQL F;  2MH2 A;  5K7H A;  2F4O B;  1ITY A;  1REP C;  5FRM A;  3CC2 I;  1ZAO A;  1IXR C;  2HYF A;  2X1C A;  5A2Q Z;  3BT9 A;  1A04 A;  1HDP A;  1IN7 A;  1MSF C;  1I6X A;  2BE5 F;  3MMY B;  1I27 A;  2Z9O A;  1G3T A;  1A6I A;  2M87 A;  4EJU A;  4D7N A;  2VJ5 A;  2WAF A;  3WE3 A;  3CUO A;  3Q9S A;  4JX5 A;  4LIV A;  1HCR A;  3IHU A;  2BZT A;  2JA5 J;  5DEQ A;  2EZH A;  2R4G A;  4BL0 B;  5F0C A;  2HVR A;  4IZZ A;  2DK5 A;  1LB2 A;  4LLL A;  1TQM A;  3KEY A;  3CME I;  2JRM A;  1TTY A;  5FKM A;  1CF7 A;  2OA4 A;  2DK8 A;  3JR9 A;  3J7Z I;  1LVK A;  1T95 A;  4DBR A;  1XN7 A;  3K69 A;  3WU2 C;  5K5O A;  1FLI A;  1Y0U A;  5F1J A;  2G0E A;  1Z05 A;  2O5R A;  3GWZ A;  2DFI A;  1OYW A;  2EIN H;  4EV0 A;  2K7L A;  2IGN A;  1ETY A;  3CUQ B;  3BPV A;  3OL4 A;  4HOB A;  3A01 B;  3SYT A;  3G3Z A;  1ZQ3 P;  4B47 A;  3O8G A;  2V9K A;  3ZCO A;  4BXF A;  1FEX A;  4KYW A;  4IHW A;  3UR3 C;  4KIS A;  4XRS A;  2IW5 A;  2XB0 X;  4UV9 A;  2LBF A;  2Y69 H;  3G1M A;  4PGG A;  3NAR A;  1BBY A;  4HSR A;  3CJR B;  2LKS A;  4I02 A;  4XQF A;  2L9N A;  1E3O C;  4RLF A;  2HPI A;  1MNM C;  2Z1D A;  4ITV A;  1POG A;  4KJZ A;  2XRO A;  4BXU A;  3C7J A;  5FGM A;  1V55 H;  2KP6 A;  4BS9 A;  3Q9V A;  2FEZ A;  4XIC A;  1FNN A;  3BR6 A;  1ZG5 A;  1VQ5 I;  2M1B A;  3HOX J;  2JUC A;  4E7Z A;  1BW5 A;  3H5A A;  2YSR A;  2DOA A;  2STT A;  2VKH A;  5FJ8 J;  4RM3 A;  3DKX A;  3BG3 A;  1FMW A;  5D5X B;  4AID A;  3HTS B;  1MDM B;  3ZOB A;  4B3X A;  1LUJ B;  1J75 A;  2DJN A;  4UVC A;  3VYS B;  1BL0 A;  5C4J J;  2XGD A;  2NVY J;  2C6Y A;  3I59 A;  2VJI A;  2FBI A;  3E5U A;  2R5Z B;  2I10 A;  2XRL A;  1F4K A;  2VPL A;  2KIS A;  4RM2 A;  3SEZ A;  4ENK A;  1N25 A;  1XG1 A;  1NG7 A;  2HKX A;  2COM A;  1G59 A;  4OIQ F;  5K7F A;  2CUZ A;  2ZCW A;  4W97 A;  3W2W A;  2WB1 A;  3HIF A;  1U5T B;  2HS5 A;  2IBD A;  2LLK A;  2DYS H;  1H0M A;  3CCQ I;  1ETW A;  3ZQF A;  3DTE A;  4JQF A;  3J81 K;  5IP9 J;  4BNC A;  3DU5 A;  4CDG A;  3TOB A;  4MQ9 F;  1BR1 A;  2Q2E A;  3S16 J;  1A31 A;  1ZLK A;  5IT3 A;  1VQO I;  1IXC A;  4PDK A;  1WH7 A;  4A5M A;  4ETS A;  2WAQ N;  1RI7 A;  2ZFW A;  4XRF A;  4EJO A;  2GLO A;  5L3C A;  2X51 A;  3JRG A;  4DGW B;  2E19 A;  1IRG A;  5ERI A;  3DTK A;  3LQR A;  4XSZ F;  3KP5 A;  4I99 C;  3CQZ J;  2L7K A;  1JHH A;  2WC2 A;  1Z0X A;  1X1A A;  1GV2 A;  2CQK A;  1U6G A;  3P7N A;  5FLX Z;  3CMY A;  1S5L C;  1XDU A;  1D3Y A;  1B6A A;  2NAZ A;  3A0B C;  5HDK A;  1KYW A;  4HRI A;  2B0L A;  4RMN A;  3DCF A;  3K4B A;  4AIK A;  2L02 A;  3F8C A;  1B59 A;  4HNV A;  1QZE A;  4IHX A;  2VQL A;  4LK1 F;  1M1E B;  3QPS A;  1W7P B;  4DW6 A;  4M6X A;  3RYP A;  1JI8 A;  4Q48 A;  2R5Y A;  2VBW A;  4XLN F;  1BJZ A;  3QOD A;  2EWN A;  4MFE A;  1B1B A;  4U7D A;  4ZDL A;  4J19 A;  3PJR A;  1P7J A;  2RVC A;  1D8K A;  2QQA A;  1WHU A;  2CWE A;  2NVQ J;  2R7T A;  1DGR M;  1STZ A;  1KQ0 A;  2BXZ A;  3LQQ A;  1HC8 A;  3TP3 A;  3QPL A;  4R79 A;  3HOV J;  3OYH A;  5GTI C;  4Y33 A;  4CYC A;  1MND A;  4DQ2 A;  1X1C A;  3HJE A;  2K9S A;  2K02 A;  4ZTJ A;  2MFZ A;  2V6C A;  3HEF A;  5CLS A;  2DW4 A;  2H94 A;  2IEK A;  2RV8 A;  3FXO A;  2LH9 A;  3LA2 A;  4HAM A;  1X2N A;  4XLA A;  1IG7 A;  2WTE A;  1FYK A;  2DFE A;  2IA0 A;  5ILU A;  3FXK A;  2DOE A;  4A3L J;  2AHQ A;  1S7O A;  4LJZ F;  2KZV A;  1BC8 C;  1NG6 A;  3U9G A;  1S3J A;  5L3B A;  3H5R A;  3SZT A;  2CV0 A;  3FZV A;  2ZJQ F;  3CF5 F;  3WTW C;  4YEJ A;  4HX8 A;  1FYL A;  4ASN A;  2KL4 A;  2GAU A;  4I01 A;  5FKK A;  4KDP A;  4PUS A;  2UXN A;  2CQQ A;  2DN0 A;  3M7G A;  4ZC3 A;  1R5I D;  3I3L A;  3GO5 A;  1YE9 A;  2R7W A;  4I2O A;  1IN4 A;  5FLX K;  2HDC A;  4MEX F;  4QIW N;  1EKE A;  2CW0 F;  4G6D A;  3REO A;  4C2T A;  3ZMZ A;  4F52 A;  3LAJ A;  4NB5 A;  2FBH A;  2PJR B;  3DBR B;  1VTN C;  4KFC A;  2M3A A;  1A5J A;  2LG4 A;  3FWE A;  4BXX J;  2DPU A;  3NQO A;  4LD5 A;  3V4G A;  3OV8 A;  2JPC A;  3Q0W A;  4H0E A;  5HDG A;  2I5U A;  2VC0 A;  1RPW A;  6PAX A;  1J5Y A;  2ECB A;  2QYO A;  4A6E A;  3UKG A;  2X85 A;  1RR8 C;  3HOZ J;  4I0B A;  1JKO C;  4O5V A;  4B48 A;  4RDU A;  4EGZ A;  2CUE A;  1D0X A;  4XLP F;  1L3L A;  5KCM A;  4S04 A;  3AG2 H;  5LLQ A;  2M4K A;  3PL8 A;  3CLQ A;  2RDP A;  3V8J A;  4CZC A;  1DUX C;  3LMM A;  3HUG A;  1RKT A;  3KX2 A;  2LVS A;  2W57 A;  2BW3 B;  2XF5 A;  4LG3 A;  3X2Q H;  3CCR I;  3RKQ A;  2E2H J;  3I54 A;  3BJ6 A;  5EEA A;  1YW8 A;  2WB1 N;  2FRH A;  3L2U A;  3GTL J;  2VAS A;  3V8K A;  1ZTR A;  4C3H J;  1G3Y A;  3OMY A;  3LST A;  3K4C A;  2JN6 A;  1J0R A;  2XIG A;  1JTX A;  1MSE C;  5D5U B;  1FOY A;  1HW1 A;  4RAG A;  1XDS A;  3FX3 A;  4IOC F;  4NNJ A;  3NWS A;  4G7O F;  1ZR4 A;  1USS A;  3JRC A;  1RUN A;  3M1C A;  1JUP A;  1PYV A;  3R61 A;  2H1L A;  2L9V A;  3C3W A;  1D0Z A;  3PSF A;  1WI3 A;  3ESW B;  1H9T A;  1MMA A;  5L3F A;  4B4C A;  1ZRD A;  4JX4 A;  2X6X A;  1MMN A;  1LFB A;  2GIZ A;  2Q8K A;  3VEP A;  4EVI A;  3AFH A;  4GFB A;  5ICC A;  3N97 A;  2Y75 A;  1OJL A;  4QTR A;  2K4B A;  4AIJ A;  3PO2 J;  3H0D A;  2E2I J;  3LA3 A;  3CCE I;  3HOS A;  1F43 A;  3D1N I;  4R1H A;  2MBF A;  3J7Y J;  4D5F A;  3K1M A;  4PCQ A;  1Z21 A;  1TWH J;  1DU6 A;  1I3Q J;  1YW7 A;  1AOY A;  1TWF J;  2LSO A;  4UUT A;  3ZMV A;  1O4X A;  1D1C A;  3JAM Z;  1P92 A;  3T5X A;  1P4W A;  1XGO A;  3I58 A;  5KAI C;  4AYB N;  3P5J A;  3PO3 J;  3IAS 2;  1YI2 I;  1GV5 A;  2ZSI B;  2KLO A;  4OAZ A;  2IA2 A;  5J47 A;  3CD6 I;  1JKQ C;  2NNN A;  3DQV C;  4LMY A;  3OL3 A;  3FKJ A;  3JSO A;  1Z1D A;  3CMM A;  4ZTF A;  1KU7 A;  2LF8 A;  4PSX A;  2XPV A;  1XSX A;  3GTJ J;  1F36 A;  3S17 J;  3QQA A;  4L18 B;  2IGO A;  3OSF A;  1R58 A;  3QAH A;  5FRO A;  1QZY A;  2DA7 A;  3WGH A;  2GXB A;  4LLN A;  4XRM A;  2OD5 A;  3EYY A;  4HQE A;  4RS8 A;  4XL9 A;  5LEK A;  1BC7 C;  2JQ7 A;  4AU7 A;  3S1N J;  3MAJ A;  4ZYG A;  2LTP A;  3WTV C;  3VB2 A;  3BZK A;  2W24 A;  5DM7 F;  5KK1 A;  3ZQL A;  4YII A;  3TGN A;  2X0L A;  2KIM A;  2DTZ A;  3FMQ A;  2DT5 A;  1IGN A;  1DP3 A;  5E79 C;  1PP8 F;  2EH3 A;  5CJ9 A;  1FY7 A;  3TW7 A;  4IQJ A;  3M4O J;  1MJ9 A;  5AIP A;  4M3F A;  1QBJ A;  2JWT A;  4E4H A;  1JUM A;  3PQK A;  3AAF A;  2BGC A;  5EF6 A;  2WAD A;  4ZYH A;  1J59 A;  2QEN A;  5DUI A;  2YU3 A;  5J1U A;  4EM0 B;  1CF7 B;  1FX7 A;  2EFN A;  4IQ4 A;  3HRM A;  1AA7 A;  5BMZ A;  3QP6 A;  2RQQ A;  3BR1 A;  5EJC A;  1QZZ A;  5BNG A;  1HBX G;  1OLT A;  2EA2 A;  1SFX A;  2ADU A;  2QQB A;  3QYE A;  3WE2 A;  2Z16 A;  3S15 J;  3K70 D;  3DP7 A;  3A02 A;  3JTG A;  3CC4 I;  2ESH A;  3GVA A;  2A6H F;  3QPH A;  1XMK A;  3JAM K;  1IN8 A;  3WTX C;  3S3M A;  2E34 A;  3GZ5 A;  2LMD A;  4X6A J;  5BQT A;  4AIH A;  1XD7 A;  4AM3 A;  3DEE A;  5KVR A;  3K70 C;  1S7A A;  3R60 A;  1B4A A;  2LBF B;  2JA6 J;  2V1D A;  5K5R A;  3BZ6 A;  4IO9 F;  2W4S A;  2FML A;  2KIQ A;  3CP2 A;  2WY8 Q;  3OYG A;  1IF1 A;  3LOC A;  4BU2 A;  1DPR A;  2R7O A;  2Z99 A;  4XKW A;  2G9W A;  2E1N A;  3CCL I;  1HLV A;  2HZT A;  1F5T A;  2AXL A;  1F9N A;  2FQ3 A;  5EYR A;  3RKY A;  1IDZ A;  4M73 A;  3P9I A;  4M9X A;  4E7L A;  1DU0 A;  1T0F A;  3OR1 C;  4CGZ A;  4BKX A;  1OFC X;  2HXI A;  1JUS A;  2R7S A;  3C2G A;  2B7E A;  2GA2 A;  1EH6 A;  1R9T J;  3PNT A;  3BY6 A;  3SDB A;  5E3N A;  1LVA A;  4HYE A;  3W6V A;  4RGS A;  2EIM H;  3FIS A;  1WCM J;  2LNB A;  2IS1 A;  3OY9 A;  2IGM A;  3E1S A;  1K61 A;  4KT6 A;  4CO8 A;  4V2F A;  2KHM A;  3S93 A;  4KIB A;  1ACI A;  2ZKZ A;  3KCC A;  2DPD A;  3NEU A;  4A93 J;  2KJB A;  4KN7 X;  3RIR A;  1S6L A;  1UHS A;  2E60 A;  3OS1 A;  1JT0 A;  3KEQ A;  3OYK A;  3K4L A;  2PI0 A;  3DBH B;  3CJN A;  1YIJ I;  2JTV A;  3IRQ A;  4LB5 A;  2XGC A;  5FD5 A;  4DYR A;  2LR8 A;  3VYT B;  2IS4 A;  3ULQ B;  2DA3 A;  2QZ8 A;  5E1W A;  5EG0 A;  1ZG1 A;  2Q2E B;  3J7A Y;  2W00 A;  5CVU A;  2EZI A;  1W0U A;  3PNY A;  2L9R A;  3MQ0 A;  3QYB A;  4ABZ A;  2QF7 A;  1FTT A;  1LKX A;  4EEF G;  3SZG A;  3HPH A;  3QU3 A;  2MAB A;  5HDN A;  2D5V A;  3AL0 B;  1FBU A;  4XM3 A;  1ENH A;  1HKQ A;  2KMU A;  1ZAR A;  4L0Z B;  5D4R A;  2CJJ A;  4G8X A;  2CMP A;  4OIR F;  1MBE A;  3BJO A;  2VC1 A;  2FXA A;  3K4K A;  3F72 A;  2P81 A;  4BAY A;  5JVT A;  4B1R A;  4CCN A;  1TBX A;  5HS9 A;  2L4M A;  4Z6Y A;  3VYU B;  4BHB A;  1U9O A;  2EQR A;  3EUH A;  4AVP A;  1OPC A;  2R5Y B;  3V42 A;  4D9J A;  1ETQ A;  3I5U A;  1FT9 A;  3FXR A;  4ZYA A;  1SMT A;  1PUF A;  2AQE A;  1XX5 A;  4HG2 A;  2ZXI A;  4A0Z A;  1X1B A;  2UZK A;  1U78 A;  5LHG A;  1MZB A;  1VQM I;  4XOT A;  3ZQ7 A;  5B3S H;  1SAN A;  2JA2 A;  4QPQ A;  4CYC B;  1J2X A;  3MZH A;  5J6X A;  2ICW G;  2P5K A;  3BPX A;  3HXL A;  2KDO A;  3CCU I;  4EJT A;  3HOU J;  1RUO A;  5E8G A;  1QVU A;  3OYI A;  4HF0 A;  1ETO A;  3HBL A;  3K9T A;  3U21 A;  1LQ1 A;  3LSK A;  5GAG J;  4KIT B;  4WXH A;  2K86 A;  2EZL A;  2BVL A;  3VWB A;  5CQE A;  3I4M J;  3H9J A;  3L9F A;  4ZDP A;  4BUP A;  3EUK L;  3SXY A;  5CYV A;  2EBI A;  5IYC J;  2OBP A;  1XMX A;  1UG0 A;  1NH3 A;  1R36 A;  3KLN A;  2UV1 A;  2QUF A;  2W25 A;  2HOE A;  4O6J A;  3CC7 I;  3G6E I;  5GPA A;  3SZP A;  3H3U A;  4ZJZ A;  3GFI A;  4QWQ A;  3QOE A;  3IL2 A;  1TWA J;  3FBI B;  2NVT J;  4EM1 A;  1KU3 A;  4HA8 A;  3H92 A;  1YYV A;  4BY7 J;  4BJT A;  1Y1W J;  3OYA A;  1RKW A;  4DYQ A;  2F4M B;  4PJJ A;  4XLE A;  2YPR A;  2CG4 A;  1QA6 A;  1RRJ A;  3PNV A;  1D5V A;  5IT9 Z;  2EV6 A;  2FE3 A;  2OAZ A;  5LRR A;  1LFP A;  2RQP A;  2K27 A;  1MMD A;  1JT6 A;  4G7Z F;  4IKF A;  2KRH A;  3CCY A;  1UB9 A;  1U0J A;  2LOO A;  2Y9Z A;  2I8D A;  2BY0 A;  2M7A A;  2ZME B;  3HSF A;  2H8W A;  2ZXH A;  4NQW B;  3CLO A;  4IVN A;  3A1Y A;  3O8H A;  3ROU A;  1V3F A;  2XF6 A;  4A5N A;  3MFK A;  3I55 I;  1JKP C;  2Y2Z A;  2EIL H;  2R3S A;  4J00 A;  3FXQ A;  2ELH A;  2PMZ A;  5BS6 A;  2H1K A;  1XCB A;  1ZK8 A;  3KLO A;  3OYM A;  2GZW A;  4IXA A;  1VF9 A;  1SVL A;  2E1C A;  2L5Q A;  3SDG A;  2HOS A;  4FQG A;  3LSM A;  5B1A H;  3RZO J;  2KQR A;  1F1Z A;  3DFG A;  5ILV A;  2VQG A;  4RGR A;  5D6E A;  3ZMD A;  2M0M A;  4GCV A;  1Z6R A;  2E5Z A;  5IP7 J;  2AO9 A;  1FSE A;  4KN4 X;  4A6D A;  3ONQ A;  4FX0 A;  5IOZ A;  3WG7 H;  1S29 A;  4JBA A;  4H4K C;  5LGN A;  4EAT A;  1ULY A;  2MD0 A;  2OF7 A;  1Z6T A;  3ZMS A;  5J4V A;  3FXL A;  2GWR A;  2FMY A;  2IVM A;  2VQC A;  2F5F A;  3TW6 A;  5K7Z A;  4IF4 A;  2X6Y A;  5H6Q A;  2PX9 A;  3A0H C;  2LC2 A;  5DCM B;  5EGO A;  3F0C A;  1BOA A;  1I5Z A;  2MH9 A;  2DXI A;  2Y0S A;  3EUH C;  1TWC J;  1LNW A;  2TRT A;  4WXC A;  3PUB A;  5GP9 A;  2HXO A;  2NS0 A;  4NC6 A;  1K78 A;  1B72 A;  4JK1 X;  2JSC A;  3RSN A;  5IT9 K;  1R1U A;  1WPK A;  3AG3 H;  3C1D A;  2ZJR F;  2DMP A;  4NC7 A;  4Z2Y A;  5IY5 H;  1OYI A;  5M3M J;  5A2Q K;  1FP1 D;  2X9D A;  4Y17 A;  1JJ6 C;  4FAS D;  3SFZ A;  1FZP B;  4A0X A;  2R7F A;  3S32 A;  5L3D A;  3I4P A;  1OYY A;  3ZP5 A;  1BJA A;  3I64 A;  2R93 J;  4DOZ A;  5FKN A;  1FP2 A;  1ZEL A;  2W7N A;  2V1U A;  1BW6 A;  2DMU A;  2FQ4 A;  2L9S A;  5E8I A;  2MD5 A;  2TDX A;  3JSP A;  4BJ6 C;  3PQJ A;  3COA C;  1IZ1 A;  1SFE A;  3Q0U A;  5EZG A;  1K4S A;  1LDD A;  1ZR2 A;  2IT0 A;  1HKT A;  2OU2 A;  4WXD A;  1FPQ A;  3M8E A;  3PM1 A;  2TCT A;  5HOD A;  5J8C A;  1IO2 A;  3OIO A;  3MVP A;  1I50 J;  1VQN I;  1OMI A;  4GYI A;  5FO5 A;  2NS7 A;  4MNU A;  4MTE A;  2ME0 A;  3BTJ A;  3BG5 A;  2A61 A;  1B8I A;  3FHZ A;  2MLG A;  2EV5 A;  4O3M A;  2VOO A;  1U9N A;  2AS5 F;  3K2A A;  4XOP A;  4BHP A;  3K10 A;  2UXX A;  2P5L C;  4MGR A;  4HBL A;  5ICG A;  4OIP F;  3GZ6 A;  3U1D A;  3JRA A;  2DU9 A;  1I6H J;  3DLL F;  2W84 A;  2ELK A;  1R4N B;  2Z3Y A;  3R4K A;  2GM4 A;  2M45 A;  2L2O A;  2FUG 2; 
#chains in the Genus database with same CATH homology
 3L1P A;  4B4C A;  3ZQC A;  4JX4 A;  2EZK A;  2FD5 A;  2O8K A;  1LFB A;  1JGG A;  3RQI A;  1CQT A;  2K9N A;  3OSG A;  4GFB A;  1ZGW A;  1VI0 A;  3GTG J;  1OJL A;  2DA5 A;  4QTR A;  3FK7 A;  2W48 A;  3PO2 J;  4M6V A;  2E2I J;  3SJM A;  1F43 A;  3D1N I;  4S0H B;  5C44 J;  4D5F A;  1MBK A;  2VKE A;  1TWH J;  1Y1V J;  4DZJ A;  1DU6 A;  4UUS A;  1I3Q J;  1TWF J;  4AUX A;  5IYD J;  4UUT A;  1O4X A;  3MN2 A;  4FTH A;  1BA5 A;  3JRF A;  2COB A;  4AYB N;  4RBO A;  2KT0 A;  3PO3 J;  2HDD A;  1GV5 A;  1UMQ A;  2E1O A;  1AHD P;  5FLV A;  1WGX A;  1LE8 B;  4FIS A;  1JKQ C;  2LY9 A;  1YRN A;  4M3E A;  1QPI A;  1EF4 A;  3LSG A;  1ETV A;  1JKR C;  2XPV A;  3GTJ J;  1F36 A;  3S17 J;  1MH3 A;  3QQA A;  3S1M J;  3OSF A;  3BTC A;  4M3G A;  2M0C A;  2DA7 A;  1IDY A;  4XRM A;  2L7M P;  1MH4 A;  1H8A C;  4A3D J;  5E3M A;  2HYJ A;  2FJ1 A;  1WH5 A;  3CDL A;  3S1N J;  2YS9 A;  2Y0S N;  3IH4 A;  2B63 J;  2E2J J;  2LTP A;  2LFB A;  4I76 A;  2L0K A;  3ZQL A;  5J1R A;  2DTZ A;  2YUS A;  2Y30 A;  3BG9 A;  1X58 A;  1AKH A;  1IGN A;  2EH3 A;  3TW7 A;  5F04 A;  5IYB J;  4FCY A;  3M4O J;  4M3F A;  2JWT A;  1JUM A;  4A3K J;  5EF6 A;  2JK3 A;  3E7L A;  2KDZ A;  5J1U A;  1RES A;  2CU7 A;  5M5Y J;  5EG0 B;  4V2G A;  2DMN A;  3HOY J;  2CQX A;  1HDD C;  2FX0 A;  3FKI J;  2ID6 A;  3BR1 A;  1IRZ A;  3NAU A;  5BNG A;  4C3J J;  2JMW A;  3BR2 A;  5IP6 A;  3ZQH A;  2LP0 A;  3S15 J;  3BR0 A;  3A02 A;  1OCT C;  4MFD A;  1NTC A;  2DMT A;  4BBS J;  2XB5 A;  2MGQ A;  4A3F J;  1FIA A;  4X6A J;  4A3J J;  1MBH A;  2M8G X;  4NDL A;  4A3G J;  2JA6 J;  2NOG A;  1AKH B;  2LKX A;  1K83 J;  3LOC A;  1MBF A;  1IJW C;  3LNQ A;  3BTI A;  1HLV A;  3GTQ J;  3ZQG A;  4C3I J;  5EYR A;  1IDZ A;  1Z77 A;  1PUF B;  2HOA A;  1APL C;  1DU0 A;  3JRI A;  1LE8 A;  2ZB9 A;  1G2H A;  4BKX A;  5F08 A;  1OFC X;  3MKL A;  9ANT A;  4BBR J;  3B6C A;  4A3E J;  2HXI A;  3GTP J;  2JA8 J;  1JUS A;  4XID A;  3DEW A;  2L7F P;  4BY1 J;  1R9T J;  1W0T A;  1AU7 A;  3ZQI A;  5M3F J;  5E3N A;  4IHV A;  3W6V A;  4MLO A;  2Y31 A;  3FIS A;  5K7H A;  1WCM J;  2MSY A;  4C2M J;  1ITY A;  4A3B J;  1K61 A;  3A01 A;  4V2F A;  3BT9 A;  2MG4 A;  1HDP A;  2PMZ N;  1MSF C;  2NVX J;  4DYC A;  4A93 J;  3BR3 A;  5FLM J;  1A6I A;  2JA7 J;  4D7N A;  3H0G J;  4D5C A;  1UHS A;  3C2B A;  1JT0 A;  3HDD A;  3S2D J;  1ORK A;  1JJ8 C;  4JX5 A;  1HCR A;  4G12 A;  3JRD A;  4B3A A;  2JA5 J;  2EZH A;  5F0C A;  2XGC A;  1OCP A;  4DYR A;  2LR8 A;  2M9H A;  2DA3 A;  5FKM A;  5M5X J;  5EG0 A;  1SFO J;  4FE4 A;  2EZI A;  3LSJ A;  4JX6 A;  1W0U A;  2L9R A;  4ABZ A;  1GUU A;  2Y9Y A;  3JR9 A;  2R0Q C;  2QF7 A;  4LOC A;  3LSR A;  4EEF G;  1FTT A;  4M3B A;  4XK4 A;  5F1J A;  5E3O A;  2G0E A;  2D5V A;  3GTO J;  1P7I A;  4Y7N J;  3VPR A;  3Q3S A;  2VPR A;  5EZH A;  1ENH A;  1XS9 A;  1ETY A;  2CJJ A;  1FJL A;  4IEJ A;  2ECC A;  3FK6 A;  3A01 B;  2XPU A;  1MBE A;  1ZQ3 P;  4W1U A;  1GT0 C;  3O8G A;  1JTY A;  1FEX A;  2P81 A;  4AC0 A;  4IHW A;  3HB9 A;  1NK2 P;  4XRS A;  1X2M A;  2XB0 X;  4B1R A;  3G1M A;  3NAR A;  3HGY A;  1E3O C;  1U9O A;  2EQR A;  1MNM C;  3HOW J;  3I4N J;  1POG A;  4JP0 A;  1VFC A;  2R5Y B;  1ETQ A;  4MO7 A;  4A3M J;  1PUF A;  4XIC A;  3BR6 A;  3HOX J;  3A03 A;  5F27 A;  3BQY A;  1BW5 A;  3TED A;  2IAI A;  1U78 A;  5FJ8 J;  3BG3 A;  1SAN A;  4CYC B;  2DA6 A;  3ZOB A;  2XPW A;  2LK2 A;  2DJN A;  1NK3 P;  3SFI A;  1BL0 A;  3HOU J;  2N8G A;  5C4J J;  2XGD A;  2NVY J;  4X1E A;  2VUM J;  1QVU A;  3B6A A;  1ETO A;  3HBL A;  3BR5 A;  1H89 C;  2M34 A;  2R5Z B;  2DA1 A;  2I10 A;  2XRL A;  1QVT A;  2EZL A;  2M2E A;  1XG1 A;  2JJ7 A;  5M5W J;  3WHC A;  3I4M J;  5K7F A;  4W97 A;  2EBI A;  5IYC J;  5DTD A;  1MBJ A;  2IBD A;  2LLK A;  1IV6 A;  1TC3 C;  1RR7 A;  3FIW A;  1ETW A;  5GPA A;  3ZQF A;  5C4X J;  1B72 B;  1D5Y A;  1QRY A;  2QCO A;  5IP9 J;  1TWA J;  2NVT J;  4BY7 J;  1Y1W J;  3K7A J;  3S16 J;  2CUF A;  2VKV A;  1RKW A;  4L5E A;  2CRG A;  4DYQ A;  1WH7 A;  2RAE A;  2WAQ N;  2GLO A;  5EDN A;  2WV1 A;  3IH2 A;  2E19 A;  3JRG A;  5IPA A;  4IHY A;  5DS9 A;  1T56 A;  1JT6 A;  3CCY A;  3CQZ J;  2ME6 A;  1Z0X A;  2Y9Z A;  1GV2 A;  3GBG A;  3CMY A;  2K9Q A;  3JRE A;  2X48 A;  2O7O A;  3O8H A;  2ID3 A;  1JKP C;  2Y2Z A;  3DCF A;  2OPT A;  1ZK8 A;  2H1K A;  2VI6 A;  5FKL A;  1VF9 A;  4HNV A;  3Q0V A;  4IHX A;  3SDG A;  2HOS A;  3QPS A;  4DW6 A;  2XSD C;  3RZO J;  1U8B A;  5GPC A;  2R5Y A;  3JRB A;  1Q1V A;  1BJZ A;  3HM5 A;  4MFE A;  4J19 A;  2YU9 J;  1B8I B;  3S14 J;  1P7J A;  2HOT A;  2XGE A;  2HQ5 A;  4A69 C;  2NVQ J;  1TWG J;  5IP7 J;  2AO9 A;  5IOZ A;  1GDT A;  3TP3 A;  3QPL A;  3HOV J;  4CYC A;  5JLW A;  2OF7 A;  2K9S A;  1XC5 A;  5F0F A;  1HOM A;  2DA2 A;  3HEF A;  2IEK A;  3TW6 A;  5K7Z A;  1X2N A;  4A3C J;  1IG7 A;  3TP0 A;  2R5Z A;  1FIP A;  1T33 A;  4A3L J;  2AHQ A;  5EGO A;  3GTM J;  3F0C A;  1H88 C;  2X6O A;  3IV5 A;  3GTK J;  1TWC J;  4MIM A;  2TRT A;  5GP9 A;  2HXO A;  2O9L A;  5E3L A;  3BQZ A;  2MW8 A;  5FKK A;  3RZD J;  1B72 A;  5J1Y A;  1WPK A;  2CQQ A;  3G1O A;  2DN0 A;  4XRS G;  2DMP A;  4UUS B;  4DZP A;  5FKO A;  5M3M J;  1LFU P;  4QIW N;  1S7E A;  5JLX A;  2X9D A;  1JJ6 C;  1ZKG A;  3BTL A;  1ETK A;  4Y52 J;  5F0H A;  5C3E J;  1A5J A;  2HI3 A;  4BXX J;  1GVD A;  2R93 J;  5FKN A;  1BW6 A;  1FTZ A;  2DMU A;  2FQ4 A;  3Q0W A;  4QSH A;  1YRN B;  3HKZ N;  3LSP A;  3H3V K;  1RPW A;  2ECB A;  3Q0U A;  5EZG A;  5EGO B;  1ZR2 A;  3OOU A;  3UKG A;  3HOZ J;  1JKO C;  2NS8 A;  4RDU A;  2CUE A;  3PM1 A;  1IUF A;  2TCT A;  4FE7 A;  5HOD A;  3JRH A;  1RET A;  5J3L A;  4I6Z A;  3OIO A;  3MVP A;  1I50 J;  3S1R J;  4D7M A;  2NS7 A;  1RKT A;  2DMQ A;  2K40 A;  1HF0 A;  2ME0 A;  3BTJ A;  2LVS A;  3RKQ A;  3BG5 A;  3G1L A;  2E2H J;  1B8I A;  4A3I J;  5EEA A;  2WB1 N;  3GTL J;  1U9N A;  3K2A A;  1ZTR A;  2DA4 A;  4JYK A;  4C3H J;  2JN6 A;  2GBY A;  1MSE C;  1JTX A;  4M3D A;  3WHB A;  3S2H J;  3IH3 A;  5IOY A;  1VND A;  1MBG A;  2R92 J;  3JRA A;  3HGG A;  2LD5 A;  1I6H J;  1ZR4 A;  2H8R A;  3JRC A;  1ETX A;  1JUP A;  1IC8 A;  3M3Y J;  2L7Z A;  1UG2 A;  2ELK A;  2GM4 A;  3S1Q J;  2R7Z J;  1WI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...