4BBSJ

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bbsJ00
1E3OC 1JGGA 4A69C 1LFBA 4W97A 3MVPA 3CCYA 5J1UA 3E7LA 2LY9A 3JRHA 1AKHB 2HDDA 1PUFA 1ETWA 4L5EA 5FKKA 1DU6A 1VI0A 5EZGA 4A3FJ 1HLVA 1LE8B 4CYCA 4DYQA 1OCTC 2YS9A 5E3MA 5F1JA 2OPTA 5IYBJ 4FCYA 4A3KJ 1ETOA 1XS9A 3SFIA 3OOUA 2LKXA 2I10A 3IH3A 1GV2A 4MFEA 4C3IJ 2JA5J 3L1PA 2XPWA 4Y7NJ 3A02A 2Y30A 3TP0A 2HOTA 2XRLA 4XRMA 4C2MJ 3GTQJ 3LSPA 2DA2A 3TP3A 3HM5A 1W0UA 1ORKA 2NS7A 4FE4A 4D5CA 4A3EJ 1ETXA 2LD5A 1HF0A 2LLKA 3BR3A 1TWGJ 2P81A 1ITYA 4S0HB 4IHWA 1GDTA 2DA3A 4FISA 4G12A 2DA1A 3LSRA 1JT0A 2VUMJ 2R92J 2XB5A 3JRFA 1D5YA 1YRNA 1ZQ3P 1MBJA 3LSJA 2FX0A 5K7FA 2L7ZA 1TWCJ 2JJ7A 4A3GJ 5M5XJ 2KDZA 3CDLA 1RPWA 4RBOA 2XPUA 1VF9A 1B72B 2VKVA 2XPVA 5HODA 1HOMA 3ZQLA 1ETQA 4A93J 3FISA 3HEFA 3TEDA 2ID6A 4LOCA 1FJLA 2EZIA 1I3QJ 1VFCA 1YRNB 1FTTA 3I4NJ 3ZQFA 4A3LJ 1U9OA 1MH3A 2OF7A 3MN2A 2KT0A 5FKNA 1JKOC 4MO7A 4M6VA 4W1UA 5EDNA 4DYCA 3ZOBA 1GVDA 3G1OA 4D7NA 1T33A 2L0KA 2DMPA 2DTZA 1A5JA 1JKQC 1QVUA 5F0CA 5FKOA 3O8HA 1MBFA 2EZLA 3QQAA 3QPSA 1H89C 3HDDA 2CRGA 3LSGA 1U8BA 4IEJA 2X9DA 3S1QJ 4MFDA 2ID3A 3H3VK 3Q3SA 1IRZA 2LVSA 5M3MJ 3C2BA 2JK3A 2X48A 1U78A 3VPRA 2CQQA 1ETKA 3S2DJ 2O9LA 1ETVA 1H88C 3HOZJ 1TWFJ 2EQRA 3BG5A 5FLVA 1O4XA 1RKTA 5F0FA 1JT6A 2DJNA 1X2NA 4A3IJ 2FQ4A 2K9NA 4Y52J 5EZHA 1APLC 4BY7J 5F27A 2LTPA 3HKZN 1ZR4A 3GTGJ 2VPRA 3TW6A 2DMTA 5F04A 3BR1A 1X2MA 5C4JJ 1T56A 1BA5A 4V2FA 2GLOA 4AUXA 1HDPA 3PO2J 2XGEA 2NVTJ 1LFUP 3JREA 5EF6A 1ZKGA 2NVYJ 5BNGA 3S1RJ 3TW7A 1WH7A 2E2JJ 3BR2A 1FEXA 1NK2P 2LP0A 1ENHA 3B6AA 3IV5A 2XSDC 1MBEA 5DS9A 3GTLJ 4A3DJ 2XGCA 4M3BA 1G2HA 5IYDJ 5IP6A 1F36A 2HQ5A 2HXIA 2FJ1A 1XC5A 2R5ZA 1JJ8C 2JN6A 4I76A 2O8KA 1X58A 2YUSA 2TRTA 1BW6A 4BKXA 3OIOA 1W0TA 2WB1N 3PM1A 5IP9J 2MW8A 2GBYA 3GTPJ 2E1OA 1JKRC 2DMNA 2E19A 4XIDA 4D7MA 2R0QC 2VKEA 1IUFA 3NAUA 4UUSA 4I6ZA 1DU0A 1TC3C 2DA7A 2W48A 2DMQA 1BJZA 2G0EA 1AHDP 1CQTA 2WV1A 3HGYA 5EG0A 2EZKA 1H8AC 4XICA 2TCTA 1SANA 2NVXJ 1HCRA 4V2GA 3FIWA 3SJMA 2COBA 2ECCA 2FD5A 1WI3A 3S16J 5GPCA 1WPKA 3K7AJ 3JRBA 3RZOJ 1IG7A 4MLOA 3ZQGA 4IHXA 3BTJA 3G1MA 4DW6A 5DTDA 3WHCA 5IPAA 1Z0XA 4FTHA 3WHBA 5M5YJ 3HOWJ 2MGQA 3S2HJ 1NTCA 1Z77A 1WCMJ 4A3CJ 2Y9YA 4M3FA 3S15J 2L7FP 4EEFG 2JA8J 3Q0WA 1EF4A 5EG0B 3GTKJ 4B4CA 3DCFA 2K40A 5EGOB 4JX5A 2NS8A 5EGOA 4X6AJ 4B3AA 3JRIA 3I4MJ 2O7OA 1RESA 4BXXJ 3W6VA 1I50J 4DZPA 2ME0A 3D1NI 4QSHA 1GT0C 3UKGA 1JUPA 3GTOJ 5FJ8J 5M3FJ 5E3NA 3FKIJ 1IDZA 5J3LA 4B1RA 2Y31A 2MG4A 3HOUJ 3BQZA 2Y0SN 2R5ZB 1Y1WJ 4UUSB 1LE8A 2CUFA 2R7ZJ 4A3MJ 3A01A 2IAIA 2WAQN 3JRAA 4IHVA 2M34A 2M0CA 3JRCA 5K7ZA 2DN0A 1MNMC 2ECBA 1P7IA 2ME6A 3M3YJ 5IOZA 4MIMA 2E2IJ 3S1MJ 3BG3A 2DMUA 4M3EA 1NK3P 3HOYJ 3BTLA 1RETA 2JA7J 1IC8A 2LK2A 3S14J 1ZGWA 2PMZN 2M9HA 3OSGA 2VI6A 1POGA 2CJJA 5E3LA 5F0HA 1S7EA 2E2HJ 2R5YA 3BQYA 3LOCA 3GBGA 1IGNA 1UG2A 4RDUA 4HNVA 4AC0A 4XRSA 4JX6A 3SDGA 3A01B 1JUMA 5C3EJ 1A6IA 1F43A 4BBSJ 5M5WJ 3S1NJ 1B8IB 2EZHA 5EYRA 5E3OA 5GPAA 1MSFC 4X1EA 1IDYA 2HXOA 1BW5A 3JR9A 2R5YB 3Q0VA 1FTZA 3QPLA 3OSFA 3ZQHA 3BR0A 2X6OA 5EEAA 5FKLA 4GFBA 2DA4A 3BT9A 4ABZA 1JTYA 2EBIA 1ZTRA 2QF7A 3CMYA 5IP7J 1JTXA 2CU7A 4JP0A 3JRGA 1I6HJ 2H1KA 2EH3A 3Q0UA 2M2EA 3M4OJ 1OCPA 5FLMJ 4AYBN 4QTRA 1P7JA 1UHSA 2HYJA 3NARA 3GTJJ 1QVTA 3RKQA 2AHQA 1K61A 1GUUA 1UMQA 2B63J 4M3DA 3BTIA 1AU7A 5C44J 1Y1VJ 1OJLA 5J1YA 2CUEA 5IOYA 4FE7A 3MKLA 1RKWA 2JMWA 3FK7A 2N8GA 4NDLA 1U9NA 3JRDA 2IBDA 1JKPC 1XG1A 3CQZJ 1JUSA 2GM4A 1TWAJ 3B6CA 3HGGA 1B8IA 1OFCX 2H8RA 2D5VA 3IH4A 3RZDJ 2XB0X 3S17J 1RR7A 3PO3J 5GP9A 2CQXA 5K7HA 1QPIA 1GV5A 3K2AA 4UUTA 5F08A 3HOVJ 4XRSG 2K9QA 4D5FA 2NVQJ 3BTCA 5IYCJ 4DZJA 4J19A 3F0CA 4IHYA 1ZR2A 2AO9A 3BG9A 1IJWC 1QRYA 1JJ6C 2R93J 4JYKA 2XGDA 2HI3A 2NOGA 1Q1VA 2JA6J 4C3JJ 3ZQIA 1VNDA 3HOXJ 2JWTA 3BR6A 3H0GJ 3GTMJ 4A3JJ 2RAEA 4JX4A 1SFOJ 1IV6A 4A3BJ 1TWHJ 1K83J 1MBHA 5FKMA 4BBRJ 1MBGA 4XK4A 1B72A 2LFBA 3LNQA 3IH2A 2L7MP 2QCOA 5C4XJ 3ZQCA 3A03A 2YU9J 9ANTA 2HOAA 4DYRA 1AKHA 4QIWN 2M8GX 1MBKA 1FIPA 2DA5A 1WGXA 4C3HJ 2K9SA 1HDDC 2MSYA 1BL0A 3FK6A 3RQIA 4M3GA 2Y9ZA 2HOSA 3HBLA 1R9TJ 2IEKA 4BY1J 2ELKA 4CYCB 1WH5A 1ZK8A 2LR8A 5J1RA 5JLWA 1FIAA 2DA6A 5JLXA 1PUFB 3G1LA 1MH4A 1ETYA 2L9RA 3HB9A 1MSEC 3BR5A 3DEWA 2Y2ZA 2ZB9A 3O8GA
chains in the Genus database with same CATH superfamily
2BXYA 3MFKA 3S3MA 4G7OF 2IT0A 3U21A 3H9GA 1I3AA 2NYXA 1LFBA 4W97A 3H3UA 3F6VA 2E1NA 3CCYA 3E7LA 2R7VA 2LBFA 3JRHA 2F5VA 3GLLA 3KP7A 3GZ6A 5KNLA 5HNHA 1DU6A 1UELB 1VI0A 1YE9A 4Y33A 4A3FJ 1J0RA 3DU5A 1SFUA 2QKMB 3GW2A 3DBRB 2DFFA 2OPTA 3KIOA 4Q4ZF 4ESJA 2VL8A 1BJAA 3HPHA 1R1VA 4XSZF 5E1XA 2LKXA 4IPAA 3RPUA 2BGCA 3IH3A 4PSWA 3TOAA 4PSXA 1GV2A 4DJAA 1YFHA 1TBXA 1ZREA 4XN0A 5CVJA 4AU7A 1JHFA 2DDAA 2Y30A 2VJ4A 1L3LA 1Y8RB 1FP1D 1RI7A 4C9YA 5LGUA 4BQQA 1D1AA 3GTQJ 4XLEA 4RB2C 1Y56A 1TW2A 1W0UA 4ESBA 4FE4A 1R5GA 3DU6A 3E1SA 2E7WA 3ZMZA 3KEYA 2HQAA 4C2UA 4XQFA 4S05A 2LLKA 1TWGJ 2RV8A 3SQNA 4IHWA 1O3SA 4OWRB 1GDTA 2EK5A 3H5NA 4LITA 5HNFA 5IT3A 3HOSA 2VUMJ 1JHHA 3PFIA 1D5YA 2D45A 4JQFA 1E0EA 1TL8A 3GFMA 1XCBA 3H9JA 4AYBA 3KLOA 4BXFA 3F3XA 4P9UA 2KDZA 2GOXB 2ELJA 1RPWA 4RBOA 2D1HA 3PSIA 3JAMZ 2XPVA 2NVUB 2LKPA 5GTHC 5CJ9A 3ZQLA 4IRGA 2ID6A 4LOCA 2VODA 2ZFUA 1I3QJ 1DP3A 1VQMI 3G71I 2CGPA 1SC7A 2XAGA 2IS1A 2HKXA 2KT0A 3SEQA 4HF0A 3E6MA 4D0PA 4QWQA 3W6KB 4E7SA 5EDNA 4AIJA 4DYCA 3ZOBA 1GVDA 2A69F 1SVLA 2RKHA 1MMGA 3OYGA 1A5JA 1KYZA 3HTUA 2ZXHA 2CV0A 4HF2A 2RN7A 3QQAA 5TJJA 4E7KA 2DBBA 4IQ4A 3L09A 1EH8A 4EM1A 2K9MA 3SHFA 1Y0UA 4MFDA 2ID3A 1IRZA 2DO7A 2EIMH 2LVSA 5M3MJ 3C2BA 3WU1B 1MNDA 2FBKA 4HQEA 2X48A 3OYKA 2KKOA 3M7GA 5D6FA 3L2VA 3VPRA 5L3CA 1ZAOA 2CQQA 1S9HA 2HDWA 1V55H 3KETA 1O4XA 2MABA 4ZTFA 1JT6A 3DPUA 2EA4A 4A3IJ 4ON0A 5A2QK 4HG2A 2HFHA 3FXKA 1Z67A 4BY7J 5B1BH 1ZR4A 4IHTA 5ICEA 3GTGJ 1TP4A 4OMYA 3TW6A 2DMTA 5F04A 1OYYA 1K6OA 4MNUA 1X2MA 5C4JJ 1W5TA 2PQ8A 4YG2F 2KISA 1BC7C 1VTNC 2H94A 5EF6A 2X6YA 2QSGX 1ZKGA 2ZJ2A 3FXRA 2RQPA 2DODA 2NVYJ 2JRTA 3S1RJ 2PMZA 2E2JJ 1R5ID 3BR2A 3L2QA 1NK2P 4B09A 4BAYA 4GYGA 1PP8F 3KP3A 2OUMA 3B6AA 3ML6A 2XSDC 1OPCA 5DS9A 4M3BA 1G2HA 2VIXA 2FJ1A 2L4MA 3CCLI 4RAFA 1XDSA 1OYIA 2TRTA 3HYIA 4BKXA 2WAQA 5FGMA 5DUIA 5IP9J 4B43A 2E7XA 3T1BA 2MW8A 2VJIA 2VXDA 2EINH 1DQUA 3CUOA 4ZYAA 5D4RA 1OR7C 4XIDA 5LHHA 3KZYA 2KZGA 3I4PA 4LLLA 1ZHFA 4I6ZA 1I1GA 1YJWI 4CGZA 1VQLI 3K70D 4WCGA 3A2KA 3OYFA 1P2FA 5ED4A 2MC3A 3SEZA 2FNPA 2R7OA 5TISC 2WV1A 1VQOI 1CQTA 3HXLA 4OU0A 2L02A 2QGUA 5DM6F 5E8GA 4E7JA 2ETHA 3R61A 1LVAA 4XICA 3MZHA 2NVXJ 1U2WA 1OCCH 2R7XA 1IRFA 2W4SA 3RPQA 2WY7Q 3DPTA 2COBA 4BEHB 3SJMA 3EUHC 3LL7A 1K78B 3BPVA 3GZ5A 3S16J 1V5EA 1WPKA 2VQHA 2QA4I 1Z6TA 2V9VA 3K9TA 3JRBA 1IG7A 3W6JB 3GEZA 2EV6A 3ZQGA 2A07F 1FPQA 1JXSA 3BTJA 5ILUA 1HSTA 3G1MA 2BW3A 2COMA 3FF5A 5DTDA 2DFHA 2KRHA 1VQKI 5M5YJ 3WG7H 4CH7A 5K5OA 5E1ZB 4PK4A 4L9VA 2L7FP 5FLXZ 2CV1A 1EF4A 3M1CA 3E5XA 4ASNA 4ENJA 4CO8A 5EGOA 4JX5A 2NS8A 5DM7F 2V6EA 4BXXJ 4DGWB 1RESA 1GHCA 4UUVA 1RUOA 1D0YA 2G7HA 1GT0C 2WAFA 4U0WA 2BHYA 1JUPA 3H3ZA 1U3EM 1X1BA 2H1LA 2QUFA 3EDPA 5M3FJ 4KISA 3FKIJ 5LHGA 3CC2I 4O3MA 4CYDA 1O3QA 3WG9A 2MG4A 2WTEA 2VQCA 4OMZA 5DCMA 4A3MJ 5KCMA 2PX9A 2R7DA 3HPGA 3R6SA 1QHGA 2XVCA 2LG4A 1T95A 1X3UA 1MNMC 2ECBA 2ME6A 4LIVA 3J81K 3M3YJ 4G6TB 2E2IJ 2GA1A 3S1MJ 4MEXF 3BG3A 4GRIA 2DMUA 1W5CC 4M3EA 5CPRB 4EATA 1FBSA 2JA7J 2L54A 3KP4A 4ZTJA 1IC8A 1L0OC 2FRHA 2LK2A 3S14J 4RLFA 4YIIA 3CO6C 3K1NA 4L9TA 3OSGA 2VI6A 2JPCA 4LD5A 5E3LA 2STWA 5H6QA 5CYVA 3W2AA 3KCCA 1D1CA 2VBYA 3WGGA 5IT9K 3WGIA 1D1BA 2PN6A 5BOXA 4F52A 2KMUA 4KICA 2XC7A 3DLAA 3VYRB 2IVMA 1VQ6I 4EV0A 4D1QA 1WWXA 4IJAA 3TO6A 2BVLA 1IDYA 1MZBA 1BW5A 4PGGA 2LOOA 3CMAI 1X1AA 4Q48A 3MKYB 3K4KA 4GGGA 3ZQHA 4E4HA 3CC7I 2EV0A 1IN8A 5EEAA 2UV1A 2A61A 1TTYA 4ABZA 4FHTA 3OY9A 2HVRA 2ZNYA 3FXJA 5J47A 3T5XA 5J4YA 3K1PA 2EH3A 2M2EA 2GXBA 1MJ9A 3MZYA 4IVNA 1FMVA 1UAAA 2A05A 2ADUA 2HYJA 1FOKA 5JI6A 3RKQA 5L3FA 1O7LA 3OV8A 2AHQA 3I56I 4BS9A 3WTWC 5EEGA 1UMQA 2W25A 3VDXA 2O61A 3BP8A 4PGHA 1OJLA 3P9KA 2BEOA 3HSEA 2HVQA 4FE7A 4XL9A 2EA2A 4KJZA 2JMWA 2M8EA 1P6RA 1QZZA 2N8GA 4NDLA 1FLIA 5LBQA 2M4GA 5KHDA 1JKPC 1QHHD 1JUSA 1ZH5A 3G73A 3B6CA 3HGGA 2KLOA 3JCUC 1RNLA 2VPLA 2DLLA 1OFCX 4B44A 3MKWB 2H8RA 1WJ5A 4M73A 4IF4A 3P9IA 4IXAA 5CVIA 2Z2SB 2VASA 2L7KA 5F1RA 2R7WA 1QPIA 2DJIA 3K2AA 3G6EI 4XKWA 4HW0A 2KFDA 3R0JA 4KA4A 2PJRA 1OCRH 2K9QA 3BZKA 1LJ9A 1CF7A 1YQAA 3L00A 1H9GA 3BTCA 2NVQJ 4DZJA 2M87A 5J40A 1K7AA 3BG9A 3JTGA 1IJWC 1XD7A 1HW5A 2Y0MA 4D9JA 2HYFA 2NNNA 3AKZA 4HEA2 4AIDA 1MMDA 2XGDA 1TQPA 4TV7A 4YFKF 1NHAA 2JA6J 4BHPA 2Z5UA 5EEHA 2LH9A 1QQIA 1VNDA 1XN7A 2OTLI 5BPIA 3JSOA 3H0GJ 1R7JA 4AIHA 4A3JJ 2WB1A 4N4OB 1SFOJ 4EJOA 1IV6A 1F9NA 4K2EA 1Y8QB 2VONA 1K83J 1MBHA 1R6RA 2KIUA 1T98A 3I0TA 4BBRJ 1B72A 4J00A 3LNQA 5AONA 3N4MA 4WXHA 4BUPA 2LKSA 3J7AY 1Z3XA 1QNTA 2FOKA 3A03A 2V9KA 3OOPA 1EV7A 3ECOA 3AFHA 1PP7U 4DYRA 3REOA 4QIWN 2XDVA 3GVAA 4HZFA 4LLGF 2L9NA 3TBIA 1J09A 3ZPLA 2F5EA 4L18B 2JUCA 2EB7A 5HS9A 2VBZA 5FD5A 3RQIA 4XLCA 3V8KA 2Y9ZA 4KN4X 4A5MA 2IEKA 5F6FA 4CYCB 2Q2EB 1WH5A 2LR8A 1FIAA 4CCMA 4LFUA 2L3DA 1D5VA 4NHJA 2QYOA 2VOOA 3G4SI 2Y2ZA 4YEJA 4IOAF 3O8GA 3VYUB 4DNCA 2YR2A 3J7AO 3S32A 5FROA 1F1ZA 2IW5A 1S7AA 3MVPA 5J1UA 5D8LB 3G3ZA 4HAMA 1Y39A 3MEXA 3QYBA 1X4PA 2V79A 1AKHB 4IZZA 3QRFF 1G59A 2K3FA 2F48A 5FKKA 1X3WB 3K4CA 1MMAA 1IF1A 1ACIA 1A6QA 4CYCA 1OCTC 2BVMA 2HZDA 2ZBKA 3Q9SA 2FMLA 4F92B 1ZRFA 2A5YB 5CKTA 3LA2A 1SD7A 2K9LA 1IN6A 1SFKA 3DKWA 3HRUA 4OOIA 4CCKA 3QPHA 3OOUA 2IGKA 4IHSA 3CCSI 1TQIA 3OIQA 3CCQI 4HX7A 1UZCA 2VC1A 5DYMA 1V5FA 5J6XA 4MTDA 3B02A 4XONA 3CCEI 2XPWA 4Y7NJ 3HSFA 2KIQA 1R36A 3K4MA 5BS6A 1KU2A 2HVSA 4LLNA 2HOTA 2JSCA 2XRLA 2Y75A 3K10A 2FSWA 3I3LA 3VWBA 1DPRA 2DI3A 3LSPA 1IN5A 2DA2A 4PFPA 2M45A 2D2WA 1TT5B 3TP3A 2A5WA 2QWWA 1FC3A 1U5TB 3LSIA 4A12A 3KPHA 1R1TA 5DEQA 4KDPA 1ERDA 2P81A 1FBQA 4BE0A 1T39A 4Q5SF 2MH9A 2DA3A 3BDDA 4FISA 3WTUC 3LSRA 4CZZA 4GDFA 2QBYB 4ENKA 3BG6A 2DFIA 4U0YA 3SZPA 2HTSA 2Y48A 2XB5A 4I09A 4YIRX 1ZQ3P 1STZA 1A04A 5B1AH 4QPOA 3LSJA 4U7DA 3ISPA 1FYMA 3RDIA 2JJ7A 5DCFA 5J4VA 3NWTA 4A3GJ 3OYDA 4RS8A 5ILVA 2B9SA 3OYEA 1R1UA 3ZXSA 1B72B 1SFXA 3F8NA 3SXYA 1SD6A 4I7HA 2F4OB 2CUZA 1FSEA 2OTJI 3ZQFA 1LDDA 3I55I 2QVOA 3V4GA 1LVKA 2PJPA 4RB3C 4W1UA 3ZRGA 4RGXA 1BR2A 3G1OA 1QPMA 4HSTA 2LF7A 2B7EA 2RGVA 3KZZA 3KZIC 5F0CA 5FKOA 1D8KA 3DPLC 3ZMTA 2FQ3A 2EILH 3TOBA 2MD0A 2MBFA 1LB2A 1K78A 3BROA 4DBRA 2E60A 1N77A 1S7OA 3FXUA 4IX7A 3HDDA 2CRGA 1G3SA 4WXDA 2JRMA 3OL3A 4XKCA 3UNGC 1UHMA 2M0MA 2XIGA 2JK3A 3ZCOA 1UFMA 3KP6A 3SDBA 3AL0B 2DQLA 3BJOA 2CW0F 2CH0A 3HOZJ 2EQRA 3BG5A 1RKTA 2JSPA 2ZCWA 3V8JA 1AOYA 5GADJ 1DGRM 1BI2A 2ZSIB 5DUKA 4Y52J 1EKEA 1A35A 2ZMEB 1PDNC 2DK8A 1APLC 1G3YA 3R0AA 3HKZN 3K4NA 2VPRA 4E7LA 1N78A 2E35A 2QQBA 1X3ZB 2GLOA 4AUXA 4UB8C 2QENA 3VSKA 2LF8A 3DQVC 3CP2A 5CQGA 4MTEA 5H2FC 4LIUA 4QPQA 1LFUP 3PUFA 1PJRA 3ERED 2L4AA 4KMFA 2Z1DA 3RPUD 4IQJA 3HC7A 5HLHA 2XKPA 5D5XB 3T8TA 2ZMEC 3CESA 4ZH4F 1XX5A 2O5RA 3F72A 4R8HA 1F36A 2DYSH 2Q2EA 5DV5A 2F5FA 1XC5A 3QU3A 4I76A 5K1YA 2YUSA 1BW6A 5K5QA 4OAYA 4UNOA 3OIOA 3ASOH 1W0TA 2STTA 1BIAA 4ZYHA 3FMSA 2GBYA 1VQNI 2O3FA 1KQ9A 2XF7A 2HPMA 1XSDA 4OIRF 4D7MA 3VSLA 2VKEA 1HC8A 3CDHA 2R7QA 2XROA 1IN7A 4OAZA 1OCZH 2V1XA 4HYEA 1ZYRF 2FE3A 1S6LA 3BOQA 4U87A 3GCMA 4A0XA 1AHDP 3RCOA 4G8XA 2W84A 1ZRDA 3U9GA 5JR3A 1P4AA 2I5UA 2KIFA 4N4NB 3IP4B 1B9NA 5B5EC 2ECCA 1GVJA 1UG0A 5GPCA 2PMUA 3I9V2 4BQOA 1Z6RA 1YOVB 2IGNA 4IHXA 2EFOA 2ZXIA 4KUMA 5CQEA 1U5TA 3PQKA 4OIQF 2W82A 4N9HA 3FXQA 1ZRCA 2CMPA 3MZ8A 5HS7A 2H6CA 4U7BA 1NTCA 1YTYA 3ZQ7A 4MQ9F 4EJTA 1QA6A 2BY1A 5J8FA 5E17F 2F2EA 3CMEI 1ZGJA 3M07A 1KQ8A 1USTA 2JA8J 1LDKB 2OBPA 2KJBA 1ZELA 3DCFA 2DPUA 2E5NA 4BH9A 2HPIA 4X6AJ 2O7OA 4PJNA 4KIFA 3W6VA 2K02A 1XDUA 3ABLH 3D1NI 2P5KA 3E5UA 2AXTC 2E34A 2MYSA 3QAHA 4L0ZB 2ICWG 4C2TA 1ZARA 2CS3A 2WC2A 1W36D 1MDMA 3H0DA 3LSMA 1IDZA 4FX0A 4EGYA 2Y31A 3K4BA 3NWSA 4UV8A 1LKXA 2Y0SN 3ULQB 2XAUA 2FOWA 2XUBA 1LE8A 3HKZA 2R7ZJ 2NRAC 1BI1A 2F4MB 3ESWB 2VBXA 2IAIA 3PFYA 4A6DA 4IHVA 3QPTA 3CF2A 4HNUA 2IXSA 2AQFA 3EUKL 4HBLA 4RM3A 3OR2C 4MIMA 3N97A 4F7ZA 2VE9A 2H09A 2ISYA 4CUGA 1RUNA 2IS2A 1NK3P 3BTLA 1M1EB 2EFQA 2VOPA 1H9TA 2KZVA 2JZYA 3NRVA 3VFZA 3WTTC 2M9HA 4YRVA 1POGA 1TW3A 5F0HA 2V1DA 2R5YA 2LRDA 3LOCA 2I8DA 2PBIA 4E7ZA 3K4JA 4AC0A 2ZC2A 5JHFA 3OIPA 4JK1X 4PJJA 1Z7LA 5LGNA 2L2OA 1BR1A 5FFXA 3EYYA 3QODA 1VQ4I 1PVEA 2QEXI 5EYRA 2XGXA 5KAIC 3OYJA 5E3OA 3CCMI 2WV0A 1G8XA 4FASD 3JR9A 1WI9A 3Q0VA 3QPLA 3OSFA 2CFOA 4HX4A 2DCEA 2Z3YA 3PSFA 4GFBA 1GXQA 5FKLA 3KYDB 4LK0F 1KYWA 5HLGA 2XRNA 1JTXA 1J2XA 4HV6A 2KHMA 3Q0UA 1OCPA 3C1DA 3W2VA 5JHUA 2YU3A 3ZMUA 1D8JA 4QTRA 1P7JA 1XMAA 2VB6A 5FO5A 5BPDA 4E7IA 3PUBA 3LQRA 2ZXWH 4NC6A 4H4KC 4M6XA 1SAXA 2XSJC 4O6JA 3D0SA 3L2WA 4BDZA 2UUZA 3OYMA 3BTIA 3K1MA 1BN5A 3MKZA 1P92A 4AIKA 3E6CC 3EUHA 2CUEA 4G94A 1HKSA 1RKWA 2DFEA 4HLXA 4BEHA 2GOMA 3ERMA 4LG0A 2DXIA 2AXLA 4ZZLA 3JRDA 3AG4H 3SFZA 2PJRB 3CQZJ 4O5VA 4IOCF 1ZN2A 1R5HA 3EETA 2LSOA 2D5VA 4HA8A 2H6BA 3E6DA 3RZDJ 1J7KA 2M3AA 5KVRA 4KITB 4XKVA 2ZXJA 4P5OA 1YS7A 1IV8A 2NAZA 3GO5A 3V7RA 2XHKA 4UVAA 5KK1A 3FXMA 4UUTA 3D5LA 3HOVJ 1FOYA 4CDGA 4HDUA 4BYYA 5F64A 4F3QA 5ILSA 4BQAA 2EV5A 3CJNA 1KU9A 2BZTA 5IYCJ 4M9XA 4J19A 1SEUA 1ZR2A 1WJDA 1BIBA 3GZNB 4M71A 1J59A 5FD6A 2XAJA 4WX9A 1HW2A 4BU2A 2VBWA 4LK1F 3WTVC 2XAFA 3DLLF 3F22A 2MD5A 3HJEA 4Y4RA 4H0EA 2GXAA 1IXRC 2HKOA 2KDOA 1XMXA 2W00A 2P6TA 1SVMA 2WADA 2HNHA 1P9QC 2CYYA 1TT0A 4JBAA 2V1NA 5FKMA 1NG7A 2ZJRF 3ZQQA 4EJUA 2HS5A 2L7MP 2QCOA 1Z1DA 2EPFA 2IRFG 3ZQCA 1UB9A 1LUJB 2YU9J 3CLOA 3ZGKA 2MLKA 3ELKA 3F8FA 1AKHA 1MBKA 4RM2A 1FIPA 2NXNB 1WJFA 5HLTA 4CZCA 2EIKH 2LY1A 3IUOA 4L9JA 1X1PA 2DK5A 5GAHJ 3E6BA 4CCNA 2K7LA 2OZ6A 4M3GA 5AIQA 1R9TJ 3SZGA 1YW9A 1R00A 4JOMA 4NQWA 5J1RA 2QQ8A 2OCEA 2DA6A 4NC8A 3KYCB 5CVRA 2LBFB 1MH4A 3HB9A 5GTIC 5JFRA 3DBLB 3DEWA 1ON1A 3FM5A 1Z91A 2R7UA 3ONQA 3L2UA 4GO1A 1E3OC 1JGGA 2XASA 3AG2H 3K0LA 4A5NA 1HW1A 3SZTA 4A69C 3G2BA 3DTKA 2ESNA 3N05A 3Q5FA 3LQQA 2LY9A 4PFOA 4L5EA 3PNTA 5AIPA 5LD2C 2FU4A 5EZGA 3FXLA 2YS9A 5E3MA 3L7WA 2UXNA 1HKQA 3QWLA 1D0ZA 2M5WA 5IYBJ 3WTXC 1ZLJA 3PIOF 3V8LA 4FCYA 3M8JA 3SFIA 1V3FA 4UB6C 1KU3A 2K3PA 4MFEA 4C3IJ 2JA5J 3U2RA 3L1PA 2JA2A 2VT3A 1B9MA 4PZJA 1BI3A 3GF2A 4ESFA 3H5RA 3TP0A 2C6YA 4XRMA 4C2MJ 2KPMA 2K4JA 3V7CA 1ORKA 4Z6YA 2BY2A 2NS7A 4D5CA 5H20A 1AWCA 3T8RA 2IA1A 1XB4A 3BR3A 2DQRA 1ONVA 3DF8A 3ASNH 4U0VA 3FWEA 2HOEA 1J5YA 3OS2A 4ZYEA 2E5ZA 3M8FA 2DA1A 3ABKH 1IUYA 4ZJZA 3WTSC 1XGOA 2RC4A 3QP6A 3QP5A 1BOAA 2E36A 1VQ8I 5LLQA 5GAEJ 3JRFA 3FM3A 1FX7A 1YRNA 4HRIA 3CD6I 4HX8A 4UXNA 2DT5A 4UVBA 3PNVA 3LSKA 5K7FA 4QLCU 3CTAA 2L7ZA 1TWCJ 2A6EF 5BQTA 1FT9A 2VN2A 4BJ5C 3RKYA 4R79A 3HSRA 4XLPF 2XPUA 3H1CA 1VF9A 2RDPA 1WJCA 2CQ7A 2VKVA 2VJJA 2ZKZA 1MIJA 5HODA 4A93J 3FISA 2FBHA 4XLAA 4PCQA 4NUBA 1YRNB 1O7FA 1FTTA 3I4NJ 3FKJA 4DOZA 1YI2I 1QGPA 1U9OA 2OF7A 4A3LJ 2GAUA 1J9IA 2P5VA 5FKNA 1JKOC 3GFIA 3CP8A 3C7JA 4BJTA 3M9AA 1MGTA 4D7NA 3K2ZA 3KEQA 2DTZA 4LGWA 1QVUA 2CQNA 2HGCA 1MBFA 4YELA 2P5LC 5HDKA 4HF1A 2CSOA 1H89C 1S8NA 2OQRA 3J7ZI 1N75A 5GAGJ 2AS5F 4IEJA 2MLGA 3ABMH 3F8MA 1UHWA 3BZ6A 3Q3SA 2OC6A 4L5IA 4HOBA 1CF7B 2B0LA 2PG4A 2TDXA 4ZZDA 3WE2A 4KFCA 1U78A 4EQQA 1ETVA 4G9YA 1H88C 5FLVA 5ICFA 2E1MC 4XR6A 1LPQA 2QQ9A 1R58A 2DJNA 1X2NA 2FEZA 3E3VA 4DIQA 2A6HF 2FQ4A 2X6XA 2FXAA 3CCVI 2VXZA 4KIGA 1MDMB 4XORA 1RZ4A 2RNJA 2LTPA 5F27A 2NNYA 3FZVA 1MMNA 1IN4A 4BACA 2M1BA 3ABTA 1BC8C 2GZWA 3BR1A 4IRIA 5D5WB 3LAPA 4V2FA 4LB6B 3PIPF 2Z99A 3RI4A 1AA7A 1HDPA 3AG1H 2XGEA 2NVTJ 4BGDA 5DDGA 5LEKA 1LEBA 5TRDA 3HRTA 4XLNF 5BNGA 3TW7A 4PJ0C 1FEXA 2F6CA 2V4JC 5L3DA 3IAM2 3QYEA 3IV5A 1T2KA 1MBEA 2R7SA 4EM2A 3LFUA 3CUQC 3WTZA 2E1CA 5D8KB 2MC4A 1QZYA 5IYDJ 3KP5A 2VLAA 2CV2A 2IS4A 3ROUA 4EJVA 4UV9A 2R5ZA 3GLXA 2MFZA 4CICA 1X58A 4XLFA 4NC7A 1RIOH 4NBQA 2WB1N 3PM1A 2LNBA 4RLQA 1BR4A 2X1CA 2E19A 3F23A 4XLHA 4IL6C 2UZKA 1TNTA 1IUFA 1OLTA 3NAUA 4UUSA 1XSXA 1HBXG 1O3TA 4YFXF 4BNCA 4FETA 3RTRA 2K86A 1WJEA 4ENNA 1RR8C 1R71A 2W48A 2DMQA 1BJZA 4I0BA 4ZYDA 2JQ7A 4IKFA 3HGYA 2UXXA 4BJ6C 3I59B 1H8AC 4E70A 1K6YA 1E17A 4F93B 1WI3A 3TQNA 3QOEA 4J01A 2WAEA 2HEOA 2RQQA 1LDJA 3DTIA 3MMYB 1Z3YA 3S8PA 3RZOJ 1X1CA 3HL2A 4A0YA 4MLOA 1QO0D 4XM3A 4LG3A 4DW6A 2QSHX 1SAUA 2IS6A 3WHCA 1BI0A 1Z0XA 2ELHA 2BY3A 3LA7A 3P5JA 5HDNA 4FTHA 3U1KA 1Z21A 3S2WA 3HOWJ 3C18A 3S2HJ 1YW7A 3J81Z 1Z77A 1WCMJ 2OQGA 2Y9YA 4M3FA 4UVCA 3S15J 3FMRA 2BOLA 4PJLA 4EEFG 2KQRA 1NH3A 5FLXK 4FQGA 4B3AA 3FDYA 1I50J 4DZPA 2ME0A 1B1BA 1F5TA 4QSHA 1X19A 3UKGA 2O8XA 3I5UA 3O3KA 5FJ8J 5DD8A 3PJRA 4ZDPA 5E3NA 2QBYA 2YX7A 5J3LA 4B1RA 1I6XA 2LREA 3KYLA 1Y1WJ 2R5ZB 3O6BB 5HVQC 1U5TC 3M8EA 3A01A 1YIOA 2WAQN 3KX2A 2Z9OA 2IA0A 2M34A 3JRCA 4XOPA 1V54H 5K7ZA 3J80Z 2VE8A 2DN0A 2QZ8A 1R23A 3R4KA 2D1VA 5IOZA 1MKMA 2KIMA 1G3TA 1MJAA 2BXZA 2HQRA 3HOYJ 2WA0A 4I02A 1ZGWA 4P55A 1PYVA 2CJJA 1IZ1A 1LNWA 3E5QA 2QM3A 4FX4A 3TDUC 4KIBA 1VQ9I 3GBGA 2PFBA 1UG2A 1A31A 1MD0A 4HNVA 3TMOA 2MA3A 2GIZA 4RGRA 4WF2A 4XRSA 2W85A 1YJ9I 3SDGA 3A01B 1JUMA 2LC2A 4RMNA 2A6TA 3KFWX 1KU7A 3TL4X 3U1DA 1F43A 4RGUA 2P8TA 5LHIA 2Z16A 2EZHA 5GPAA 2GIVA 5JVGF 4X1EA 1MJBA 4PJMA 3CO7C 2ZJPF 3A4CA 5HDGA 2JTVA 3HTSB 1FTZA 1EJ9A 1OQYA 3NQOA 3DXJF 2OD5A 1UCRA 2Q1ZB 1D0XA 1SD5A 3W2WA 2DA4A 3BT9A 5HLIA 3H92A 1JTYA 2EBIA 4GYIA 2F5DA 3CMYA 3RYPA 2YSRA 2X85A 2OA4A 2DYRH 4L9NA 4A2UA 2CU7A 4JP0A 1SMTA 1I6HJ 3K4LA 2CO5A 2GA2A 2IA2A 3M4OJ 1IXSB 5FLMJ 4AYBN 1W1WE 1UHSA 3I71A 4N0BA 4B48A 1WHUA 3NARA 5ICCA 1QVTA 4A0ZA 1I27A 1MW7A 1K61A 5E20A 4S04A 2FA5A 1E3HA 3DKXA 3X2QH 2B63J 3L2CA 3L2RA 1AU7A 2F4IA 1Y1VJ 3JTHA 2X1EA 3MCZA 3GX4X 5J1YA 1FYLA 5IOYA 1W36C 3MKLA 3FHNA 3IHUA 5IY5H 1ZG1A 2XKOA 1OCOH 1WSUA 1T6SA 4BDYA 1H0MA 2IBDA 3EUAA 3I53A 1KQ0A 5LFAA 4EJWA 1W7PA 4RA2A 3L9FA 4P1WA 5IT9Z 2CUJA 3WU2C 5JVTA 1GXPA 4E7HA 2E71A 1IRXA 3IH4A 2XB0X 4GXOA 3E0JB 2X51A 5D5UB 3IAS2 3S17J 1T08B 2Q8KA 5B66C 1LQ1A 2IJLA 3WGHA 1GV5A 4LJZF 1FNNA 1J75A 2OV7A 4M6YA 2O03A 5F08A 4F91B 1BOBA 3ECHA 1WKMA 1O3RA 1W7PB 1P4XA 1YG2A 1ZLKA 5ERIA 5LEJA 4IHYA 2LDUA 3IWZA 4EMSA 4CXFA 2R93J 4ITVA 1HKTA 4JYKA 2VKHA 2K5CA 2NOGA 2K4BA 4RGSA 1ZGAA 3M1EA 4I98B 3RYRA 3GMEA 4ENMA 3I59A 1XGMA 2V7FA 3HRMA 1QBJA 4FT8A 2ZJQF 1S29A 2CWEA 3LA3A 2HTJA 2RAEA 4HV5A 4HLYA 3COAC 3C2GA 1TWHJ 2J5PA 3EYIA 4BE1A 1MBGA 1Q1HA 3IRRA 4XK4A 2BY0A 2LFBA 3IH2A 3F6OA 2OCCH 3AAFA 2LY2A 4DBQA 2JPBA 3ZN0A 6PAXA 4HQMA 3DV8A 2EFWA 9ANTA 5LRSA 4NB5A 5E79C 3QOPA 2M8GX 1YX5A 1T8IA 2IP2A 4Z2YA 3I54A 3VYTB 1W4MA 4C3HJ 1YHQI 3BG7A 1BL0A 3FK6A 3TO7A 2HOSA 3VB2A 3WTYC 4BY1J 4EM0B 1ZK8A 1TLHB 1W7PD 2W24A 4CA0A 1IRGA 1ZG5A 3F21A 1PUFB 1YJNI 3AG3H 3G1LA 3CMMA 4BHCA 2XAHA 3HRSA 1FY7A 3O2PE 1ETYA 3BY6A 5K5RA 2L9RA 4ANJA 1R4MB 1FYKA 3BR5A 5D6EA 2ZB9A 1TQMA 4M72A 1IO2A 3ZMVA 3ZMSA 4NNJA 5L3EA 4KT6A 3KLNA 4AWXB 3JSPA 3LSTA 2HDDA 1PUFA 1ETWA 3WE3A 2R7TA 1ZG3A 2ZSHB 1QZEA 1HLVA 1LE8B 1VQ5I 3HUGA 2FBIA 3RSNA 4DYQA 1YITI 3OWTA 5F1JA 3OYAA 3OYHA 1D3YA 4UY8I 3IC7A 3OR1C 4A3KJ 2KL4A 1ETOA 1MNEA 1Z7UA 1XS9A 1WJAA 3NEUA 2I10A 2RVCA 1XTAA 2K27A 3HOTA 1HQCA 2P6SA 3DEEA 3MAJA 2KRFA 5CVUA 1K4TA 2EFPA 1K79A 2V26A 3P9CA 3A02A 4PDKA 1XCVA 4II2A 3V7SA 3JW4A 2GWRA 4I0AA 2JVHA 2FNAA 4PUSA 3HM5A 3FHZA 4B3XA 2DU9A 4A3EJ 2CW7A 3GYHX 2E1MB 3S3NA 1ETXA 2LD5A 1HF0A 3CC4I 3DFGA 1EA3A 1ITYA 4S0HB 1XGSA 2CG4A 3TDZC 4G12A 1JT0A 3HIFA 3QU6A 1CGPA 2R92J 4Y17A 2LYCA 5FB2A 3OYLA 4BHBA 4DQ2A 5A2QZ 3KEOA 1MBJA 1V5GA 2FX0A 2NS0A 2PEXA 1FMWA 2X0LA 3K6GA 2IGOA 4AD9A 4BXUA 5M5XJ 3CDLA 4MEYF 4M9SA 1SVOA 1VQPI 2WBMA 1HOMA 1FWZA 4P96A 1ETQA 3HHGA 3HEFA 3IL2A 4BE2A 4OINF 3TEDA 2XF6A 5CLSA 3S93A 1FJLA 2EZIA 1VFCA 2ZNZA 3MN2A 1MH3A 1IW7F 3CUQB 5LRRA 3RJPA 3TO9A 4MO7A 4M6VA 4CCJA 2HZTA 4XRFA 4Y13A 1PUEE 3CZ6A 2QLZA 4EGZA 1I39A 1T33A 2L0KA 3FBIB 2DMPA 1JKQC 2FMYA 4XOTA 5TGTA 2EZLA 3HZJA 2UWMA 3QPSA 2WY8Q 5LGTA 2W7NA 1KGSA 2OAZA 2RNGA 3LSGA 3LWFA 2GXGA 4MHGA 1U8BA 1EH6A 2DT6A 2L9SA 2X9DA 3S1QJ 4G6DA 4M9ZA 3WU0A 3H3VK 4HSRA 3KE2A 1GLNA 4X0GA 1K4SA 4MQVA 4AVZA 3JAMK 2FF4A 3EQLF 1N25A 2HU9A 1ETKA 3S2DJ 2O9LA 2KRCA 1YYVA 4XN3A 1WVRA 1BBYA 2HWVA 1TWFJ 5DCMB 2XAQA 3OYCA 2DOEA 4RAGA 2JVGA 2WWYA 5F0FA 2G9WA 4I01A 1HXDA 4XMYA 1RC9A 5CVVA 4YFNF 3VOEA 2K9NA 1RRJA 5EJCA 2P0WA 4XKBA 4CCLA 1E3PA 1Y0NA 5EZHA 5FRNA 1R49A 1FSHA 4P9FA 3CJRB 3H9QA 1E2XA 3HUGB 3VEPA 1R22A 2QKLB 3CCUI 1Y6IA 4Q47A 3HG9A 1B59A 2M30A 4EVIA 4LG0B 1T56A 2VT2A 3K69A 5D4SA 1BA5A 3ZMDA 3PO2J 3I58A 1S72I 4CSWA 2JT1A 3JREA 4IRHA 2ZFWA 2EJRA 1ULYA 1WJBA 3CJQB 1REPC 1XMKA 3SYTA 1WH7A 2LP0A 1ENHA 2QQAA 4RB1A 2P4WA 1F4KA 3GTLJ 4A3DJ 2XGCA 3OS0A 3UR3C 1OMIA 2H27A 5IP6A 2HQ5A 2HXIA 3H5AA 3KP2A 3LFKA 3VODA 1JJ8C 2JN6A 3R60A 5BMZA 1EH7A 4B47A 2O8KA 1FZPB 2P7VB 4M74A 4N9IA 3LAJA 3RQ4A 2ISZA 2BHZA 2EIJH 1KA8A 1IAWA 3DWLE 1USSA 3FBNB 2E1OA 3GXOA 4BQNA 1JKRC 3GTPJ 2VQLA 2DMNA 4WXCA 2AQEA 2W1OA 3CLQA 2HR3A 2R0QC 3BCAA 4E6KG 1XGNA 3PL8A 3ZR8X 3J7YJ 2Q0OA 5E1WA 2HDCA 2ZO4A 1DU0A 2JUGA 3A0HC 3WODF 2X6WA 1TC3C 1VZ0A 2DA7A 4CHUA 3W3CA 2G0EA 3CDIA 1OISA 2DOFA 4HNTA 4II3A 5J8CA 4I2OA 5EG0A 2VKDA 2DDBA 2EZKA 2FUG2 2TCTA 1SANA 2KP6A 1S5LC 3DTEA 3BLYA 4V2GA 3FIWA 1HCRA 4G7HF 2R3SA 2FD5A 3E97A 2EWNA 4U88A 3T0YA 1YIJI 1LEAA 1SFEA 2J5OA 2VC0A 3OL4A 3K7AJ 3BC8A 2V6CA 2CW8A 3BZCA 3IWFA 2A3SA 2DPDA 2L5QA 3BJAA 1B4AA 2ACJA 1KONA 4G6QA 4KNYA 4RAZA 3IKTA 3MD2A 2OJED 5HOOA 4KYWA 3FMQA 2BW3B 1ODDA 5IPAA 3WHBA 3CJTB 3VYSB 1MMSA 4XNFA 2MGQA 3LSHA 4A3CJ 2H8WA 2BE5F 4A6EA 4G7ZF 3Q0WA 4L0YB 3TGNA 5EG0B 3D5RC 3GTKJ 4B4CA 4OIOF 3OYBA 2V1UA 3DEUA 1B6AA 2K40A 3H36A 5EGOB 1U0JA 3DP7A 1O57A 3V42A 3JRIA 1OKRA 3I4MJ 3LMMA 2ESHA 5L3BA 2Y0SA 3GTOJ 2OZUA 2CFXA 3HOUJ 3S3OA 2YPRA 2R7FA 3BQZA 1Z9CA 5E8IA 1FBUA 3ZN1A 4UUSB 1HSJA 2CUFA 2YX4A 1I1SA 4BL0B 4CCOA 2M7BA 2R4GA 3JRAA 2Z33A 2X4HA 2M0CA 1P7IA 1JI8A 2R7RA 3BJ6A 4V19K 3F8BA 3DBHB 1V4RA 2Y69H 3BCBA 1SMYF 5L3GA 1DDNA 4AM3A 1FOXA 1RETA 3PQJA 3B73A 3RIRA 3FX3A 2PMZN 3K70C 3CCJI 1S3JA 1S7EA 2E2HJ 2K85A 2OU2A 2VQGA 4WK8F 3BQYA 1YX3A 1IGNA 4RDUA 1X4OA 2BV6A 2BBYA 4JX6A 3TKYA 4I99C 4NQWB 4XBFA 2O6GE 5DD4A 5C3EJ 1A6IA 2CQKA 4BBSJ 4WWCA 5M5WJ 3S1NJ 1B8IB 2IGMA 1Z05A 1VQ7I 3OYNA 4UHTA 3CF5F 1MSFC 2HXOA 5B3SH 5ICGA 2P7CB 2V9PA 2R5YB 2EFNA 3D5SC 4B8XA 3BR0A 2RREA 1LFPA 2X6OA 3BWGA 3Q9VA 2DW4A 1T38A 2PI0A 1ZTRA 2QF7A 3GFLA 5IP7J 3C2HA 1DPUA 3PNYA 3JRGA 2PLYA 2H1KA 4XSXF 2L9VA 1R4NB 1TNSA 5FRMA 3GTJJ 3MQ0A 4R1HA 1OR7A 1XSVA 1GUUA 1C0WA 4GCVA 1DGWY 4F55A 1FP2A 3EPZA 4KN7X 1YLFA 4M3DA 4Y15A 3FXOA 1DP7P 2LMDA 5C44J 4ZYGA 1IXCA 2QSFX 3RKXA 4IO9F 4Y3OA 2XV4S 2VJ5A 3FK7A 1YS6A 1W5SA 1U9NA 3BPXA 1XG1A 3C3WA 2GM4A 4OIPF 1TWAJ 3CUQA 2MH2A 1B8IA 3AL0C 3I64A 2GQQA 2ZMEA 1WFXA 3GWZA 1DUXC 3OMYA 2L01A 1RR7A 3PO3J 5GP9A 2CQXA 5K7HA 2DAOA 4RB0A 3H35A 1OYWA 4XRSG 4D5FA 3IRQA 3F8CA 3F0CA 2BYVE 4ZC3A 2AO9A 2DTRA 1JE8A 1QRYA 4AVPA 3ABUA 1JJ6C 4KT5C 4LB5A 3IKVA 1WZ2A 1T0FA 2HI3A 4YIFA 1Q1VA 1NG6A 3OYIA 2HQNA 1YO5C 1JGSA 1P4WA 5D5VB 4C3JJ 1G4DA 3ZQIA 3HOXJ 2JWTA 4LMYA 5H6RA 3BR6A 1U8RA 2DOAA 2M7AA 3GTMJ 1KZHA 4JX4A 2G7UA 2NOJB 1SD4A 4A3BJ 4MGRA 3A0BC 3ZP5A 1FOWA 4HDVA 1X1DA 1U6GA 1UJ8A 2HYGD 5C4XJ 4ETSA 1G3WA 2F5CA 4L5JA 2KJCA 1WRJA 3A1YA 5HS8A 1T0FC 2HOAA 3MWMA 3CCRI 5KAFC 3OS1A 3F9KA 2DA5A 4RAYA 5FFZA 1WGXA 3GFJA 2K9SA 1HDDC 2MSYA 3QYFA 3HBLA 3RKWA 2O0YA 2A68F 2DT7B 1XPXA 1YW8A 2ELKA 1ON2A 1TZLA 1I5ZA 4ZDLA 2IPQX 3GUDA 2X1DA 4ZDOA 5JLWA 5E18F 1BM9A 1WQ2A 3HHHA 5JLXA 3P7NA 2W57A 1HA8A 4KMUX 4HPQA 3J80K 1A36A 1MSEC 2XF5A 1QU3A 1G6NA 2M4KA 3O8HA 4C30A 3DKYA 2PMHA
chains in the Genus database with same CATH topology
1E3OC 1JGGA 4A69C 1LFBA 4W97A 3MVPA 3CCYA 5J1UA 3E7LA 2LY9A 3JRHA 1AKHB 2HDDA 1PUFA 1ETWA 4L5EA 5FKKA 1DU6A 1VI0A 5EZGA 4A3FJ 1HLVA 1LE8B 4CYCA 4DYQA 1OCTC 2YS9A 5E3MA 5F1JA 2OPTA 5IYBJ 4FCYA 4A3KJ 1ETOA 1XS9A 3SFIA 3OOUA 2LKXA 2I10A 3IH3A 1GV2A 4MFEA 4C3IJ 2JA5J 3L1PA 2XPWA 4Y7NJ 3A02A 2Y30A 3TP0A 2HOTA 2XRLA 4XRMA 4C2MJ 3GTQJ 3LSPA 2DA2A 3TP3A 3HM5A 1W0UA 1ORKA 2NS7A 4FE4A 4D5CA 4A3EJ 1ETXA 2LD5A 1HF0A 2LLKA 3BR3A 1TWGJ 2P81A 1ITYA 4S0HB 4IHWA 1GDTA 2DA3A 4FISA 4G12A 2DA1A 3LSRA 1JT0A 2VUMJ 2R92J 2XB5A 3JRFA 1D5YA 1YRNA 1ZQ3P 1MBJA 3LSJA 2FX0A 5K7FA 2L7ZA 1TWCJ 2JJ7A 4A3GJ 5M5XJ 2KDZA 3CDLA 1RPWA 4RBOA 2XPUA 1VF9A 1B72B 2VKVA 2XPVA 5HODA 1HOMA 3ZQLA 1ETQA 4A93J 3FISA 3HEFA 3TEDA 2ID6A 4LOCA 1FJLA 2EZIA 1I3QJ 1VFCA 1YRNB 1FTTA 3I4NJ 3ZQFA 4A3LJ 1U9OA 1MH3A 2OF7A 3MN2A 2KT0A 5FKNA 1JKOC 4MO7A 4M6VA 4W1UA 5EDNA 4DYCA 3ZOBA 1GVDA 3G1OA 4D7NA 1T33A 2L0KA 2DMPA 2DTZA 1A5JA 1JKQC 1QVUA 5F0CA 5FKOA 3O8HA 1MBFA 2EZLA 3QQAA 3QPSA 1H89C 3HDDA 2CRGA 3LSGA 1U8BA 4IEJA 2X9DA 3S1QJ 4MFDA 2ID3A 3H3VK 3Q3SA 1IRZA 2LVSA 5M3MJ 3C2BA 2JK3A 2X48A 1U78A 3VPRA 2CQQA 1ETKA 3S2DJ 2O9LA 1ETVA 1H88C 3HOZJ 1TWFJ 2EQRA 3BG5A 5FLVA 1O4XA 1RKTA 5F0FA 1JT6A 2DJNA 1X2NA 4A3IJ 2FQ4A 2K9NA 4Y52J 5EZHA 1APLC 4BY7J 5F27A 2LTPA 3HKZN 1ZR4A 3GTGJ 2VPRA 3TW6A 2DMTA 5F04A 3BR1A 1X2MA 5C4JJ 1T56A 1BA5A 4V2FA 2GLOA 4AUXA 1HDPA 3PO2J 2XGEA 2NVTJ 1LFUP 3JREA 5EF6A 1ZKGA 2NVYJ 5BNGA 3S1RJ 3TW7A 1WH7A 2E2JJ 3BR2A 1FEXA 1NK2P 2LP0A 1ENHA 3B6AA 3IV5A 2XSDC 1MBEA 5DS9A 3GTLJ 4A3DJ 2XGCA 4M3BA 1G2HA 5IYDJ 5IP6A 1F36A 2HQ5A 2HXIA 2FJ1A 1XC5A 2R5ZA 1JJ8C 2JN6A 4I76A 2O8KA 1X58A 2YUSA 2TRTA 1BW6A 4BKXA 3OIOA 1W0TA 2WB1N 3PM1A 5IP9J 2MW8A 2GBYA 3GTPJ 2E1OA 1JKRC 2DMNA 2E19A 4XIDA 4D7MA 2R0QC 2VKEA 1IUFA 3NAUA 4UUSA 4I6ZA 1DU0A 1TC3C 2DA7A 2W48A 2DMQA 1BJZA 2G0EA 1AHDP 1CQTA 2WV1A 3HGYA 5EG0A 2EZKA 1H8AC 4XICA 2TCTA 1SANA 2NVXJ 1HCRA 4V2GA 3FIWA 3SJMA 2COBA 2ECCA 2FD5A 1WI3A 3S16J 5GPCA 1WPKA 3K7AJ 3JRBA 3RZOJ 1IG7A 4MLOA 3ZQGA 4IHXA 3BTJA 3G1MA 4DW6A 5DTDA 3WHCA 5IPAA 1Z0XA 4FTHA 3WHBA 5M5YJ 3HOWJ 2MGQA 3S2HJ 1NTCA 1Z77A 1WCMJ 4A3CJ 2Y9YA 4M3FA 3S15J 2L7FP 4EEFG 2JA8J 3Q0WA 1EF4A 5EG0B 3GTKJ 4B4CA 3DCFA 2K40A 5EGOB 4JX5A 2NS8A 5EGOA 4X6AJ 4B3AA 3JRIA 3I4MJ 2O7OA 1RESA 4BXXJ 3W6VA 1I50J 4DZPA 2ME0A 3D1NI 4QSHA 1GT0C 3UKGA 1JUPA 3GTOJ 5FJ8J 5M3FJ 5E3NA 3FKIJ 1IDZA 5J3LA 4B1RA 2Y31A 2MG4A 3HOUJ 3BQZA 2Y0SN 2R5ZB 1Y1WJ 4UUSB 1LE8A 2CUFA 2R7ZJ 4A3MJ 3A01A 2IAIA 2WAQN 3JRAA 4IHVA 2M34A 2M0CA 3JRCA 5K7ZA 2DN0A 1MNMC 2ECBA 1P7IA 2ME6A 3M3YJ 5IOZA 4MIMA 2E2IJ 3S1MJ 3BG3A 2DMUA 4M3EA 1NK3P 3HOYJ 3BTLA 1RETA 2JA7J 1IC8A 2LK2A 3S14J 1ZGWA 2PMZN 2M9HA 3OSGA 2VI6A 1POGA 2CJJA 5E3LA 5F0HA 1S7EA 2E2HJ 2R5YA 3BQYA 3LOCA 3GBGA 1IGNA 1UG2A 4RDUA 4HNVA 4AC0A 4XRSA 4JX6A 3SDGA 3A01B 1JUMA 5C3EJ 1A6IA 1F43A 4BBSJ 5M5WJ 3S1NJ 1B8IB 2EZHA 5EYRA 5E3OA 5GPAA 1MSFC 4X1EA 1IDYA 2HXOA 1BW5A 3JR9A 2R5YB 3Q0VA 1FTZA 3QPLA 3OSFA 3ZQHA 3BR0A 2X6OA 5EEAA 5FKLA 4GFBA 2DA4A 3BT9A 4ABZA 1JTYA 2EBIA 1ZTRA 2QF7A 3CMYA 5IP7J 1JTXA 2CU7A 4JP0A 3JRGA 1I6HJ 2H1KA 2EH3A 3Q0UA 2M2EA 3M4OJ 1OCPA 5FLMJ 4AYBN 4QTRA 1P7JA 1UHSA 2HYJA 3NARA 3GTJJ 1QVTA 3RKQA 2AHQA 1K61A 1GUUA 1UMQA 2B63J 4M3DA 3BTIA 1AU7A 5C44J 1Y1VJ 1OJLA 5J1YA 2CUEA 5IOYA 4FE7A 3MKLA 1RKWA 2JMWA 3FK7A 2N8GA 4NDLA 1U9NA 3JRDA 2IBDA 1JKPC 1XG1A 3CQZJ 1JUSA 2GM4A 1TWAJ 3B6CA 3HGGA 1B8IA 1OFCX 2H8RA 2D5VA 3IH4A 3RZDJ 2XB0X 3S17J 1RR7A 3PO3J 5GP9A 2CQXA 5K7HA 1QPIA 1GV5A 3K2AA 4UUTA 5F08A 3HOVJ 4XRSG 2K9QA 4D5FA 2NVQJ 3BTCA 5IYCJ 4DZJA 4J19A 3F0CA 4IHYA 1ZR2A 2AO9A 3BG9A 1IJWC 1QRYA 1JJ6C 2R93J 4JYKA 2XGDA 2HI3A 2NOGA 1Q1VA 2JA6J 4C3JJ 3ZQIA 1VNDA 3HOXJ 2JWTA 3BR6A 3H0GJ 3GTMJ 4A3JJ 2RAEA 4JX4A 1SFOJ 1IV6A 4A3BJ 1TWHJ 1K83J 1MBHA 5FKMA 4BBRJ 1MBGA 4XK4A 1B72A 2LFBA 3LNQA 3IH2A 2L7MP 2QCOA 5C4XJ 3ZQCA 3A03A 2YU9J 9ANTA 2HOAA 4DYRA 1AKHA 4QIWN 2M8GX 1MBKA 1FIPA 2DA5A 1WGXA 4C3HJ 2K9SA 1HDDC 2MSYA 1BL0A 3FK6A 3RQIA 4M3GA 2Y9ZA 2HOSA 3HBLA 1R9TJ 2IEKA 4BY1J 2ELKA 4CYCB 1WH5A 1ZK8A 2LR8A 5J1RA 5JLWA 1FIAA 2DA6A 5JLXA 1PUFB 3G1LA 1MH4A 1ETYA 2L9RA 3HB9A 1MSEC 3BR5A 3DEWA 2Y2ZA 2ZB9A 3O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3O C;  1JGG A;  4A69 C;  1LFB A;  4W97 A;  3MVP A;  3CCY A;  5J1U A;  3E7L A;  2LY9 A;  3JRH A;  1AKH B;  2HDD A;  1PUF A;  1ETW A;  4L5E A;  5FKK A;  1DU6 A;  1VI0 A;  5EZG A;  4A3F J;  1HLV A;  1LE8 B;  4CYC A;  4DYQ A;  1OCT C;  2YS9 A;  5E3M A;  5F1J A;  2OPT A;  5IYB J;  4FCY A;  4A3K J;  1ETO A;  1XS9 A;  3SFI A;  3OOU A;  2LKX A;  2I10 A;  3IH3 A;  1GV2 A;  4MFE A;  4C3I J;  2JA5 J;  3L1P A;  2XPW A;  4Y7N J;  3A02 A;  2Y30 A;  3TP0 A;  2HOT A;  2XRL A;  4XRM A;  4C2M J;  3GTQ J;  3LSP A;  2DA2 A;  3TP3 A;  3HM5 A;  1W0U A;  1ORK A;  2NS7 A;  4FE4 A;  4D5C A;  4A3E J;  1ETX A;  2LD5 A;  1HF0 A;  2LLK A;  3BR3 A;  1TWG J;  2P81 A;  1ITY A;  4S0H B;  4IHW A;  1GDT A;  2DA3 A;  4FIS A;  4G12 A;  2DA1 A;  3LSR A;  1JT0 A;  2VUM J;  2R92 J;  2XB5 A;  3JRF A;  1D5Y A;  1YRN A;  1ZQ3 P;  1MBJ A;  3LSJ A;  2FX0 A;  5K7F A;  2L7Z A;  1TWC J;  2JJ7 A;  4A3G J;  5M5X J;  2KDZ A;  3CDL A;  1RPW A;  4RBO A;  2XPU A;  1VF9 A;  1B72 B;  2VKV A;  2XPV A;  5HOD A;  1HOM A;  3ZQL A;  1ETQ A;  4A93 J;  3FIS A;  3HEF A;  3TED A;  2ID6 A;  4LOC A;  1FJL A;  2EZI A;  1I3Q J;  1VFC A;  1YRN B;  1FTT A;  3I4N J;  3ZQF A;  4A3L J;  1U9O A;  1MH3 A;  2OF7 A;  3MN2 A;  2KT0 A;  5FKN A;  1JKO C;  4MO7 A;  4M6V A;  4W1U A;  5EDN A;  4DYC A;  3ZOB A;  1GVD A;  3G1O A;  4D7N A;  1T33 A;  2L0K A;  2DMP A;  2DTZ A;  1A5J A;  1JKQ C;  1QVU A;  5F0C A;  5FKO A;  3O8H A;  1MBF A;  2EZL A;  3QQA A;  3QPS A;  1H89 C;  3HDD A;  2CRG A;  3LSG A;  1U8B A;  4IEJ A;  2X9D A;  3S1Q J;  4MFD A;  2ID3 A;  3H3V K;  3Q3S A;  1IRZ A;  2LVS A;  5M3M J;  3C2B A;  2JK3 A;  2X48 A;  1U78 A;  3VPR A;  2CQQ A;  1ETK A;  3S2D J;  2O9L A;  1ETV A;  1H88 C;  3HOZ J;  1TWF J;  2EQR A;  3BG5 A;  5FLV A;  1O4X A;  1RKT A;  5F0F A;  1JT6 A;  2DJN A;  1X2N A;  4A3I J;  2FQ4 A;  2K9N A;  4Y52 J;  5EZH A;  1APL C;  4BY7 J;  5F27 A;  2LTP A;  3HKZ N;  1ZR4 A;  3GTG J;  2VPR A;  3TW6 A;  2DMT A;  5F04 A;  3BR1 A;  1X2M A;  5C4J J;  1T56 A;  1BA5 A;  4V2F A;  2GLO A;  4AUX A;  1HDP A;  3PO2 J;  2XGE A;  2NVT J;  1LFU P;  3JRE A;  5EF6 A;  1ZKG A;  2NVY J;  5BNG A;  3S1R J;  3TW7 A;  1WH7 A;  2E2J J;  3BR2 A;  1FEX A;  1NK2 P;  2LP0 A;  1ENH A;  3B6A A;  3IV5 A;  2XSD C;  1MBE A;  5DS9 A;  3GTL J;  4A3D J;  2XGC A;  4M3B A;  1G2H A;  5IYD J;  5IP6 A;  1F36 A;  2HQ5 A;  2HXI A;  2FJ1 A;  1XC5 A;  2R5Z A;  1JJ8 C;  2JN6 A;  4I76 A;  2O8K A;  1X58 A;  2YUS A;  2TRT A;  1BW6 A;  4BKX A;  3OIO A;  1W0T A;  2WB1 N;  3PM1 A;  5IP9 J;  2MW8 A;  2GBY A;  3GTP J;  2E1O A;  1JKR C;  2DMN A;  2E19 A;  4XID A;  4D7M A;  2R0Q C;  2VKE A;  1IUF A;  3NAU A;  4UUS A;  4I6Z A;  1DU0 A;  1TC3 C;  2DA7 A;  2W48 A;  2DMQ A;  1BJZ A;  2G0E A;  1AHD P;  1CQT A;  2WV1 A;  3HGY A;  5EG0 A;  2EZK A;  1H8A C;  4XIC A;  2TCT A;  1SAN A;  2NVX J;  1HCR A;  4V2G A;  3FIW A;  3SJM A;  2COB A;  2ECC A;  2FD5 A;  1WI3 A;  3S16 J;  5GPC A;  1WPK A;  3K7A J;  3JRB A;  3RZO J;  1IG7 A;  4MLO A;  3ZQG A;  4IHX A;  3BTJ A;  3G1M A;  4DW6 A;  5DTD A;  3WHC A;  5IPA A;  1Z0X A;  4FTH A;  3WHB A;  5M5Y J;  3HOW J;  2MGQ A;  3S2H J;  1NTC A;  1Z77 A;  1WCM J;  4A3C J;  2Y9Y A;  4M3F A;  3S15 J;  2L7F P;  4EEF G;  2JA8 J;  3Q0W A;  1EF4 A;  5EG0 B;  3GTK J;  4B4C A;  3DCF A;  2K40 A;  5EGO B;  4JX5 A;  2NS8 A;  5EGO A;  4X6A J;  4B3A A;  3JRI A;  3I4M J;  2O7O A;  1RES A;  4BXX J;  3W6V A;  1I50 J;  4DZP A;  2ME0 A;  3D1N I;  4QSH A;  1GT0 C;  3UKG A;  1JUP A;  3GTO J;  5FJ8 J;  5M3F J;  5E3N A;  3FKI J;  1IDZ A;  5J3L A;  4B1R A;  2Y31 A;  2MG4 A;  3HOU J;  3BQZ A;  2Y0S N;  2R5Z B;  1Y1W J;  4UUS B;  1LE8 A;  2CUF A;  2R7Z J;  4A3M J;  3A01 A;  2IAI A;  2WAQ N;  3JRA A;  4IHV A;  2M34 A;  2M0C A;  3JRC A;  5K7Z A;  2DN0 A;  1MNM C;  2ECB A;  1P7I A;  2ME6 A;  3M3Y J;  5IOZ A;  4MIM A;  2E2I J;  3S1M J;  3BG3 A;  2DMU A;  4M3E A;  1NK3 P;  3HOY J;  3BTL A;  1RET A;  2JA7 J;  1IC8 A;  2LK2 A;  3S14 J;  1ZGW A;  2PMZ N;  2M9H A;  3OSG A;  2VI6 A;  1POG A;  2CJJ A;  5E3L A;  5F0H A;  1S7E A;  2E2H J;  2R5Y A;  3BQY A;  3LOC A;  3GBG A;  1IGN A;  1UG2 A;  4RDU A;  4HNV A;  4AC0 A;  4XRS A;  4JX6 A;  3SDG A;  3A01 B;  1JUM A;  5C3E J;  1A6I A;  1F43 A;  4BBS J;  5M5W J;  3S1N J;  1B8I B;  2EZH A;  5EYR A;  5E3O A;  5GPA A;  1MSF C;  4X1E A;  1IDY A;  2HXO A;  1BW5 A;  3JR9 A;  2R5Y B;  3Q0V A;  1FTZ A;  3QPL A;  3OSF A;  3ZQH A;  3BR0 A;  2X6O A;  5EEA A;  5FKL A;  4GFB A;  2DA4 A;  3BT9 A;  4ABZ A;  1JTY A;  2EBI A;  1ZTR A;  2QF7 A;  3CMY A;  5IP7 J;  1JTX A;  2CU7 A;  4JP0 A;  3JRG A;  1I6H J;  2H1K A;  2EH3 A;  3Q0U A;  2M2E A;  3M4O J;  1OCP A;  5FLM J;  4AYB N;  4QTR A;  1P7J A;  1UHS A;  2HYJ A;  3NAR A;  3GTJ J;  1QVT A;  3RKQ A;  2AHQ A;  1K61 A;  1GUU A;  1UMQ A;  2B63 J;  4M3D A;  3BTI A;  1AU7 A;  5C44 J;  1Y1V J;  1OJL A;  5J1Y A;  2CUE A;  5IOY A;  4FE7 A;  3MKL A;  1RKW A;  2JMW A;  3FK7 A;  2N8G A;  4NDL A;  1U9N A;  3JRD A;  2IBD A;  1JKP C;  1XG1 A;  3CQZ J;  1JUS A;  2GM4 A;  1TWA J;  3B6C A;  3HGG A;  1B8I A;  1OFC X;  2H8R A;  2D5V A;  3IH4 A;  3RZD J;  2XB0 X;  3S17 J;  1RR7 A;  3PO3 J;  5GP9 A;  2CQX A;  5K7H A;  1QPI A;  1GV5 A;  3K2A A;  4UUT A;  5F08 A;  3HOV J;  4XRS G;  2K9Q A;  4D5F A;  2NVQ J;  3BTC A;  5IYC J;  4DZJ A;  4J19 A;  3F0C A;  4IHY A;  1ZR2 A;  2AO9 A;  3BG9 A;  1IJW C;  1QRY A;  1JJ6 C;  2R93 J;  4JYK A;  2XGD A;  2HI3 A;  2NOG A;  1Q1V A;  2JA6 J;  4C3J J;  3ZQI A;  1VND A;  3HOX J;  2JWT A;  3BR6 A;  3H0G J;  3GTM J;  4A3J J;  2RAE A;  4JX4 A;  1SFO J;  1IV6 A;  4A3B J;  1TWH J;  1K83 J;  1MBH A;  5FKM A;  4BBR J;  1MBG A;  4XK4 A;  1B72 A;  2LFB A;  3LNQ A;  3IH2 A;  2L7M P;  2QCO A;  5C4X J;  3ZQC A;  3A03 A;  2YU9 J;  9ANT A;  2HOA A;  4DYR A;  1AKH A;  4QIW N;  2M8G X;  1MBK A;  1FIP A;  2DA5 A;  1WGX A;  4C3H J;  2K9S A;  1HDD C;  2MSY A;  1BL0 A;  3FK6 A;  3RQI A;  4M3G A;  2Y9Z A;  2HOS A;  3HBL A;  1R9T J;  2IEK A;  4BY1 J;  2ELK A;  4CYC B;  1WH5 A;  1ZK8 A;  2LR8 A;  5J1R A;  5JLW A;  1FIA A;  2DA6 A;  5JLX A;  1PUF B;  3G1L A;  1MH4 A;  1ETY A;  2L9R A;  3HB9 A;  1MSE C;  3BR5 A;  3DEW A;  2Y2Z A;  2ZB9 A;  3O8G A; 
#chains in the Genus database with same CATH topology
 2BXY A;  3MFK A;  3S3M A;  4G7O F;  2IT0 A;  3U21 A;  3H9G A;  1I3A A;  2NYX A;  1LFB A;  4W97 A;  3H3U A;  3F6V A;  2E1N A;  3CCY A;  3E7L A;  2R7V A;  2LBF A;  3JRH A;  2F5V A;  3GLL A;  3KP7 A;  3GZ6 A;  5KNL A;  5HNH A;  1DU6 A;  1UEL B;  1VI0 A;  1YE9 A;  4Y33 A;  4A3F J;  1J0R A;  3DU5 A;  1SFU A;  2QKM B;  3GW2 A;  3DBR B;  2DFF A;  2OPT A;  3KIO A;  4Q4Z F;  4ESJ A;  2VL8 A;  1BJA A;  3HPH A;  1R1V A;  4XSZ F;  5E1X A;  2LKX A;  4IPA A;  3RPU A;  2BGC A;  3IH3 A;  4PSW A;  3TOA A;  4PSX A;  1GV2 A;  4DJA A;  1YFH A;  1TBX A;  1ZRE A;  4XN0 A;  5CVJ A;  4AU7 A;  1JHF A;  2DDA A;  2Y30 A;  2VJ4 A;  1L3L A;  1Y8R B;  1FP1 D;  1RI7 A;  4C9Y A;  5LGU A;  4BQQ A;  1D1A A;  3GTQ J;  4XLE A;  4RB2 C;  1Y56 A;  1TW2 A;  1W0U A;  4ESB A;  4FE4 A;  1R5G A;  3DU6 A;  3E1S A;  2E7W A;  3ZMZ A;  3KEY A;  2HQA A;  4C2U A;  4XQF A;  4S05 A;  2LLK A;  1TWG J;  2RV8 A;  3SQN A;  4IHW A;  1O3S A;  4OWR B;  1GDT A;  2EK5 A;  3H5N A;  4LIT A;  5HNF A;  5IT3 A;  3HOS A;  2VUM J;  1JHH A;  3PFI A;  1D5Y A;  2D45 A;  4JQF A;  1E0E A;  1TL8 A;  3GFM A;  1XCB A;  3H9J A;  4AYB A;  3KLO A;  4BXF A;  3F3X A;  4P9U A;  2KDZ A;  2GOX B;  2ELJ A;  1RPW A;  4RBO A;  2D1H A;  3PSI A;  3JAM Z;  2XPV A;  2NVU B;  2LKP A;  5GTH C;  5CJ9 A;  3ZQL A;  4IRG A;  2ID6 A;  4LOC A;  2VOD A;  2ZFU A;  1I3Q J;  1DP3 A;  1VQM I;  3G71 I;  2CGP A;  1SC7 A;  2XAG A;  2IS1 A;  2HKX A;  2KT0 A;  3SEQ A;  4HF0 A;  3E6M A;  4D0P A;  4QWQ A;  3W6K B;  4E7S A;  5EDN A;  4AIJ A;  4DYC A;  3ZOB A;  1GVD A;  2A69 F;  1SVL A;  2RKH A;  1MMG A;  3OYG A;  1A5J A;  1KYZ A;  3HTU A;  2ZXH A;  2CV0 A;  4HF2 A;  2RN7 A;  3QQA A;  5TJJ A;  4E7K A;  2DBB A;  4IQ4 A;  3L09 A;  1EH8 A;  4EM1 A;  2K9M A;  3SHF A;  1Y0U A;  4MFD A;  2ID3 A;  1IRZ A;  2DO7 A;  2EIM H;  2LVS A;  5M3M J;  3C2B A;  3WU1 B;  1MND A;  2FBK A;  4HQE A;  2X48 A;  3OYK A;  2KKO A;  3M7G A;  5D6F A;  3L2V A;  3VPR A;  5L3C A;  1ZAO A;  2CQQ A;  1S9H A;  2HDW A;  1V55 H;  3KET A;  1O4X A;  2MAB A;  4ZTF A;  1JT6 A;  3DPU A;  2EA4 A;  4A3I J;  4ON0 A;  5A2Q K;  4HG2 A;  2HFH A;  3FXK A;  1Z67 A;  4BY7 J;  5B1B H;  1ZR4 A;  4IHT A;  5ICE A;  3GTG J;  1TP4 A;  4OMY A;  3TW6 A;  2DMT A;  5F04 A;  1OYY A;  1K6O A;  4MNU A;  1X2M A;  5C4J J;  1W5T A;  2PQ8 A;  4YG2 F;  2KIS A;  1BC7 C;  1VTN C;  2H94 A;  5EF6 A;  2X6Y A;  2QSG X;  1ZKG A;  2ZJ2 A;  3FXR A;  2RQP A;  2DOD A;  2NVY J;  2JRT A;  3S1R J;  2PMZ A;  2E2J J;  1R5I D;  3BR2 A;  3L2Q A;  1NK2 P;  4B09 A;  4BAY A;  4GYG A;  1PP8 F;  3KP3 A;  2OUM A;  3B6A A;  3ML6 A;  2XSD C;  1OPC A;  5DS9 A;  4M3B A;  1G2H A;  2VIX A;  2FJ1 A;  2L4M A;  3CCL I;  4RAF A;  1XDS A;  1OYI A;  2TRT A;  3HYI A;  4BKX A;  2WAQ A;  5FGM A;  5DUI A;  5IP9 J;  4B43 A;  2E7X A;  3T1B A;  2MW8 A;  2VJI A;  2VXD A;  2EIN H;  1DQU A;  3CUO A;  4ZYA A;  5D4R A;  1OR7 C;  4XID A;  5LHH A;  3KZY A;  2KZG A;  3I4P A;  4LLL A;  1ZHF A;  4I6Z A;  1I1G A;  1YJW I;  4CGZ A;  1VQL I;  3K70 D;  4WCG A;  3A2K A;  3OYF A;  1P2F A;  5ED4 A;  2MC3 A;  3SEZ A;  2FNP A;  2R7O A;  5TIS C;  2WV1 A;  1VQO I;  1CQT A;  3HXL A;  4OU0 A;  2L02 A;  2QGU A;  5DM6 F;  5E8G A;  4E7J A;  2ETH A;  3R61 A;  1LVA A;  4XIC A;  3MZH A;  2NVX J;  1U2W A;  1OCC H;  2R7X A;  1IRF A;  2W4S A;  3RPQ A;  2WY7 Q;  3DPT A;  2COB A;  4BEH B;  3SJM A;  3EUH C;  3LL7 A;  1K78 B;  3BPV A;  3GZ5 A;  3S16 J;  1V5E A;  1WPK A;  2VQH A;  2QA4 I;  1Z6T A;  2V9V A;  3K9T A;  3JRB A;  1IG7 A;  3W6J B;  3GEZ A;  2EV6 A;  3ZQG A;  2A07 F;  1FPQ A;  1JXS A;  3BTJ A;  5ILU A;  1HST A;  3G1M A;  2BW3 A;  2COM A;  3FF5 A;  5DTD A;  2DFH A;  2KRH A;  1VQK I;  5M5Y J;  3WG7 H;  4CH7 A;  5K5O A;  5E1Z B;  4PK4 A;  4L9V A;  2L7F P;  5FLX Z;  2CV1 A;  1EF4 A;  3M1C A;  3E5X A;  4ASN A;  4ENJ A;  4CO8 A;  5EGO A;  4JX5 A;  2NS8 A;  5DM7 F;  2V6E A;  4BXX J;  4DGW B;  1RES A;  1GHC A;  4UUV A;  1RUO A;  1D0Y A;  2G7H A;  1GT0 C;  2WAF A;  4U0W A;  2BHY A;  1JUP A;  3H3Z A;  1U3E M;  1X1B A;  2H1L A;  2QUF A;  3EDP A;  5M3F J;  4KIS A;  3FKI J;  5LHG A;  3CC2 I;  4O3M A;  4CYD A;  1O3Q A;  3WG9 A;  2MG4 A;  2WTE A;  2VQC A;  4OMZ A;  5DCM A;  4A3M J;  5KCM A;  2PX9 A;  2R7D A;  3HPG A;  3R6S A;  1QHG A;  2XVC A;  2LG4 A;  1T95 A;  1X3U A;  1MNM C;  2ECB A;  2ME6 A;  4LIV A;  3J81 K;  3M3Y J;  4G6T B;  2E2I J;  2GA1 A;  3S1M J;  4MEX F;  3BG3 A;  4GRI A;  2DMU A;  1W5C C;  4M3E A;  5CPR B;  4EAT A;  1FBS A;  2JA7 J;  2L54 A;  3KP4 A;  4ZTJ A;  1IC8 A;  1L0O C;  2FRH A;  2LK2 A;  3S14 J;  4RLF A;  4YII A;  3CO6 C;  3K1N A;  4L9T A;  3OSG A;  2VI6 A;  2JPC A;  4LD5 A;  5E3L A;  2STW A;  5H6Q A;  5CYV A;  3W2A A;  3KCC A;  1D1C A;  2VBY A;  3WGG A;  5IT9 K;  3WGI A;  1D1B A;  2PN6 A;  5BOX A;  4F52 A;  2KMU A;  4KIC A;  2XC7 A;  3DLA A;  3VYR B;  2IVM A;  1VQ6 I;  4EV0 A;  4D1Q A;  1WWX A;  4IJA A;  3TO6 A;  2BVL A;  1IDY A;  1MZB A;  1BW5 A;  4PGG A;  2LOO A;  3CMA I;  1X1A A;  4Q48 A;  3MKY B;  3K4K A;  4GGG A;  3ZQH A;  4E4H A;  3CC7 I;  2EV0 A;  1IN8 A;  5EEA A;  2UV1 A;  2A61 A;  1TTY A;  4ABZ A;  4FHT A;  3OY9 A;  2HVR A;  2ZNY A;  3FXJ A;  5J47 A;  3T5X A;  5J4Y A;  3K1P A;  2EH3 A;  2M2E A;  2GXB A;  1MJ9 A;  3MZY A;  4IVN A;  1FMV A;  1UAA A;  2A05 A;  2ADU A;  2HYJ A;  1FOK A;  5JI6 A;  3RKQ A;  5L3F A;  1O7L A;  3OV8 A;  2AHQ A;  3I56 I;  4BS9 A;  3WTW C;  5EEG A;  1UMQ A;  2W25 A;  3VDX A;  2O61 A;  3BP8 A;  4PGH A;  1OJL A;  3P9K A;  2BEO A;  3HSE A;  2HVQ A;  4FE7 A;  4XL9 A;  2EA2 A;  4KJZ A;  2JMW A;  2M8E A;  1P6R A;  1QZZ A;  2N8G A;  4NDL A;  1FLI A;  5LBQ A;  2M4G A;  5KHD A;  1JKP C;  1QHH D;  1JUS A;  1ZH5 A;  3G73 A;  3B6C A;  3HGG A;  2KLO A;  3JCU C;  1RNL A;  2VPL A;  2DLL A;  1OFC X;  4B44 A;  3MKW B;  2H8R A;  1WJ5 A;  4M73 A;  4IF4 A;  3P9I A;  4IXA A;  5CVI A;  2Z2S B;  2VAS A;  2L7K A;  5F1R A;  2R7W A;  1QPI A;  2DJI A;  3K2A A;  3G6E I;  4XKW A;  4HW0 A;  2KFD A;  3R0J A;  4KA4 A;  2PJR A;  1OCR H;  2K9Q A;  3BZK A;  1LJ9 A;  1CF7 A;  1YQA A;  3L00 A;  1H9G A;  3BTC A;  2NVQ J;  4DZJ A;  2M87 A;  5J40 A;  1K7A A;  3BG9 A;  3JTG A;  1IJW C;  1XD7 A;  1HW5 A;  2Y0M A;  4D9J A;  2HYF A;  2NNN A;  3AKZ A;  4HEA 2;  4AID A;  1MMD A;  2XGD A;  1TQP A;  4TV7 A;  4YFK F;  1NHA A;  2JA6 J;  4BHP A;  2Z5U A;  5EEH A;  2LH9 A;  1QQI A;  1VND A;  1XN7 A;  2OTL I;  5BPI A;  3JSO A;  3H0G J;  1R7J A;  4AIH A;  4A3J J;  2WB1 A;  4N4O B;  1SFO J;  4EJO A;  1IV6 A;  1F9N A;  4K2E A;  1Y8Q B;  2VON A;  1K83 J;  1MBH A;  1R6R A;  2KIU A;  1T98 A;  3I0T A;  4BBR J;  1B72 A;  4J00 A;  3LNQ A;  5AON A;  3N4M A;  4WXH A;  4BUP A;  2LKS A;  3J7A Y;  1Z3X A;  1QNT A;  2FOK A;  3A03 A;  2V9K A;  3OOP A;  1EV7 A;  3ECO A;  3AFH A;  1PP7 U;  4DYR A;  3REO A;  4QIW N;  2XDV A;  3GVA A;  4HZF A;  4LLG F;  2L9N A;  3TBI A;  1J09 A;  3ZPL A;  2F5E A;  4L18 B;  2JUC A;  2EB7 A;  5HS9 A;  2VBZ A;  5FD5 A;  3RQI A;  4XLC A;  3V8K A;  2Y9Z A;  4KN4 X;  4A5M A;  2IEK A;  5F6F A;  4CYC B;  2Q2E B;  1WH5 A;  2LR8 A;  1FIA A;  4CCM A;  4LFU A;  2L3D A;  1D5V A;  4NHJ A;  2QYO A;  2VOO A;  3G4S I;  2Y2Z A;  4YEJ A;  4IOA F;  3O8G A;  3VYU B;  4DNC A;  2YR2 A;  3J7A O;  3S32 A;  5FRO A;  1F1Z A;  2IW5 A;  1S7A A;  3MVP A;  5J1U A;  5D8L B;  3G3Z A;  4HAM A;  1Y39 A;  3MEX A;  3QYB A;  1X4P A;  2V79 A;  1AKH B;  4IZZ A;  3QRF F;  1G59 A;  2K3F A;  2F48 A;  5FKK A;  1X3W B;  3K4C A;  1MMA A;  1IF1 A;  1ACI A;  1A6Q A;  4CYC A;  1OCT C;  2BVM A;  2HZD A;  2ZBK A;  3Q9S A;  2FML A;  4F92 B;  1ZRF A;  2A5Y B;  5CKT A;  3LA2 A;  1SD7 A;  2K9L A;  1IN6 A;  1SFK A;  3DKW A;  3HRU A;  4OOI A;  4CCK A;  3QPH A;  3OOU A;  2IGK A;  4IHS A;  3CCS I;  1TQI A;  3OIQ A;  3CCQ I;  4HX7 A;  1UZC A;  2VC1 A;  5DYM A;  1V5F A;  5J6X A;  4MTD A;  3B02 A;  4XON A;  3CCE I;  2XPW A;  4Y7N J;  3HSF A;  2KIQ A;  1R36 A;  3K4M A;  5BS6 A;  1KU2 A;  2HVS A;  4LLN A;  2HOT A;  2JSC A;  2XRL A;  2Y75 A;  3K10 A;  2FSW A;  3I3L A;  3VWB A;  1DPR A;  2DI3 A;  3LSP A;  1IN5 A;  2DA2 A;  4PFP A;  2M45 A;  2D2W A;  1TT5 B;  3TP3 A;  2A5W A;  2QWW A;  1FC3 A;  1U5T B;  3LSI A;  4A12 A;  3KPH A;  1R1T A;  5DEQ A;  4KDP A;  1ERD A;  2P81 A;  1FBQ A;  4BE0 A;  1T39 A;  4Q5S F;  2MH9 A;  2DA3 A;  3BDD A;  4FIS A;  3WTU C;  3LSR A;  4CZZ A;  4GDF A;  2QBY B;  4ENK A;  3BG6 A;  2DFI A;  4U0Y A;  3SZP A;  2HTS A;  2Y48 A;  2XB5 A;  4I09 A;  4YIR X;  1ZQ3 P;  1STZ A;  1A04 A;  5B1A H;  4QPO A;  3LSJ A;  4U7D A;  3ISP A;  1FYM A;  3RDI A;  2JJ7 A;  5DCF A;  5J4V A;  3NWT A;  4A3G J;  3OYD A;  4RS8 A;  5ILV A;  2B9S A;  3OYE A;  1R1U A;  3ZXS A;  1B72 B;  1SFX A;  3F8N A;  3SXY A;  1SD6 A;  4I7H A;  2F4O B;  2CUZ A;  1FSE A;  2OTJ I;  3ZQF A;  1LDD A;  3I55 I;  2QVO A;  3V4G A;  1LVK A;  2PJP A;  4RB3 C;  4W1U A;  3ZRG A;  4RGX A;  1BR2 A;  3G1O A;  1QPM A;  4HST A;  2LF7 A;  2B7E A;  2RGV A;  3KZZ A;  3KZI C;  5F0C A;  5FKO A;  1D8K A;  3DPL C;  3ZMT A;  2FQ3 A;  2EIL H;  3TOB A;  2MD0 A;  2MBF A;  1LB2 A;  1K78 A;  3BRO A;  4DBR A;  2E60 A;  1N77 A;  1S7O A;  3FXU A;  4IX7 A;  3HDD A;  2CRG A;  1G3S A;  4WXD A;  2JRM A;  3OL3 A;  4XKC A;  3UNG C;  1UHM A;  2M0M A;  2XIG A;  2JK3 A;  3ZCO A;  1UFM A;  3KP6 A;  3SDB A;  3AL0 B;  2DQL A;  3BJO A;  2CW0 F;  2CH0 A;  3HOZ J;  2EQR A;  3BG5 A;  1RKT A;  2JSP A;  2ZCW A;  3V8J A;  1AOY A;  5GAD J;  1DGR M;  1BI2 A;  2ZSI B;  5DUK A;  4Y52 J;  1EKE A;  1A35 A;  2ZME B;  1PDN C;  2DK8 A;  1APL C;  1G3Y A;  3R0A A;  3HKZ N;  3K4N A;  2VPR A;  4E7L A;  1N78 A;  2E35 A;  2QQB A;  1X3Z B;  2GLO A;  4AUX A;  4UB8 C;  2QEN A;  3VSK A;  2LF8 A;  3DQV C;  3CP2 A;  5CQG A;  4MTE A;  5H2F C;  4LIU A;  4QPQ A;  1LFU P;  3PUF A;  1PJR A;  3ERE D;  2L4A A;  4KMF A;  2Z1D A;  3RPU D;  4IQJ A;  3HC7 A;  5HLH A;  2XKP A;  5D5X B;  3T8T A;  2ZME C;  3CES A;  4ZH4 F;  1XX5 A;  2O5R A;  3F72 A;  4R8H A;  1F36 A;  2DYS H;  2Q2E A;  5DV5 A;  2F5F A;  1XC5 A;  3QU3 A;  4I76 A;  5K1Y A;  2YUS A;  1BW6 A;  5K5Q A;  4OAY A;  4UNO A;  3OIO A;  3ASO H;  1W0T A;  2STT A;  1BIA A;  4ZYH A;  3FMS A;  2GBY A;  1VQN I;  2O3F A;  1KQ9 A;  2XF7 A;  2HPM A;  1XSD A;  4OIR F;  4D7M A;  3VSL A;  2VKE A;  1HC8 A;  3CDH A;  2R7Q A;  2XRO A;  1IN7 A;  4OAZ A;  1OCZ H;  2V1X A;  4HYE A;  1ZYR F;  2FE3 A;  1S6L A;  3BOQ A;  4U87 A;  3GCM A;  4A0X A;  1AHD P;  3RCO A;  4G8X A;  2W84 A;  1ZRD A;  3U9G A;  5JR3 A;  1P4A A;  2I5U A;  2KIF A;  4N4N B;  3IP4 B;  1B9N A;  5B5E C;  2ECC A;  1GVJ A;  1UG0 A;  5GPC A;  2PMU A;  3I9V 2;  4BQO A;  1Z6R A;  1YOV B;  2IGN A;  4IHX A;  2EFO A;  2ZXI A;  4KUM A;  5CQE A;  1U5T A;  3PQK A;  4OIQ F;  2W82 A;  4N9H A;  3FXQ A;  1ZRC A;  2CMP A;  3MZ8 A;  5HS7 A;  2H6C A;  4U7B A;  1NTC A;  1YTY A;  3ZQ7 A;  4MQ9 F;  4EJT A;  1QA6 A;  2BY1 A;  5J8F A;  5E17 F;  2F2E A;  3CME I;  1ZGJ A;  3M07 A;  1KQ8 A;  1UST A;  2JA8 J;  1LDK B;  2OBP A;  2KJB A;  1ZEL A;  3DCF A;  2DPU A;  2E5N A;  4BH9 A;  2HPI A;  4X6A J;  2O7O A;  4PJN A;  4KIF A;  3W6V A;  2K02 A;  1XDU A;  3ABL H;  3D1N I;  2P5K A;  3E5U A;  2AXT C;  2E34 A;  2MYS A;  3QAH A;  4L0Z B;  2ICW G;  4C2T A;  1ZAR A;  2CS3 A;  2WC2 A;  1W36 D;  1MDM A;  3H0D A;  3LSM A;  1IDZ A;  4FX0 A;  4EGY A;  2Y31 A;  3K4B A;  3NWS A;  4UV8 A;  1LKX A;  2Y0S N;  3ULQ B;  2XAU A;  2FOW A;  2XUB A;  1LE8 A;  3HKZ A;  2R7Z J;  2NRA C;  1BI1 A;  2F4M B;  3ESW B;  2VBX A;  2IAI A;  3PFY A;  4A6D A;  4IHV A;  3QPT A;  3CF2 A;  4HNU A;  2IXS A;  2AQF A;  3EUK L;  4HBL A;  4RM3 A;  3OR2 C;  4MIM A;  3N97 A;  4F7Z A;  2VE9 A;  2H09 A;  2ISY A;  4CUG A;  1RUN A;  2IS2 A;  1NK3 P;  3BTL A;  1M1E B;  2EFQ A;  2VOP A;  1H9T A;  2KZV A;  2JZY A;  3NRV A;  3VFZ A;  3WTT C;  2M9H A;  4YRV A;  1POG A;  1TW3 A;  5F0H A;  2V1D A;  2R5Y A;  2LRD A;  3LOC A;  2I8D A;  2PBI A;  4E7Z A;  3K4J A;  4AC0 A;  2ZC2 A;  5JHF A;  3OIP A;  4JK1 X;  4PJJ A;  1Z7L A;  5LGN A;  2L2O A;  1BR1 A;  5FFX A;  3EYY A;  3QOD A;  1VQ4 I;  1PVE A;  2QEX I;  5EYR A;  2XGX A;  5KAI C;  3OYJ A;  5E3O A;  3CCM I;  2WV0 A;  1G8X A;  4FAS D;  3JR9 A;  1WI9 A;  3Q0V A;  3QPL A;  3OSF A;  2CFO A;  4HX4 A;  2DCE A;  2Z3Y A;  3PSF A;  4GFB A;  1GXQ A;  5FKL A;  3KYD B;  4LK0 F;  1KYW A;  5HLG A;  2XRN A;  1JTX A;  1J2X A;  4HV6 A;  2KHM A;  3Q0U A;  1OCP A;  3C1D A;  3W2V A;  5JHU A;  2YU3 A;  3ZMU A;  1D8J A;  4QTR A;  1P7J A;  1XMA A;  2VB6 A;  5FO5 A;  5BPD A;  4E7I A;  3PUB A;  3LQR A;  2ZXW H;  4NC6 A;  4H4K C;  4M6X A;  1SAX A;  2XSJ C;  4O6J A;  3D0S A;  3L2W A;  4BDZ A;  2UUZ A;  3OYM A;  3BTI A;  3K1M A;  1BN5 A;  3MKZ A;  1P92 A;  4AIK A;  3E6C C;  3EUH A;  2CUE A;  4G94 A;  1HKS A;  1RKW A;  2DFE A;  4HLX A;  4BEH A;  2GOM A;  3ERM A;  4LG0 A;  2DXI A;  2AXL A;  4ZZL A;  3JRD A;  3AG4 H;  3SFZ A;  2PJR B;  3CQZ J;  4O5V A;  4IOC F;  1ZN2 A;  1R5H A;  3EET A;  2LSO A;  2D5V A;  4HA8 A;  2H6B A;  3E6D A;  3RZD J;  1J7K A;  2M3A A;  5KVR A;  4KIT B;  4XKV A;  2ZXJ A;  4P5O A;  1YS7 A;  1IV8 A;  2NAZ A;  3GO5 A;  3V7R A;  2XHK A;  4UVA A;  5KK1 A;  3FXM A;  4UUT A;  3D5L A;  3HOV J;  1FOY A;  4CDG A;  4HDU A;  4BYY A;  5F64 A;  4F3Q A;  5ILS A;  4BQA A;  2EV5 A;  3CJN A;  1KU9 A;  2BZT A;  5IYC J;  4M9X A;  4J19 A;  1SEU A;  1ZR2 A;  1WJD A;  1BIB A;  3GZN B;  4M71 A;  1J59 A;  5FD6 A;  2XAJ A;  4WX9 A;  1HW2 A;  4BU2 A;  2VBW A;  4LK1 F;  3WTV C;  2XAF A;  3DLL F;  3F22 A;  2MD5 A;  3HJE A;  4Y4R A;  4H0E A;  2GXA A;  1IXR C;  2HKO A;  2KDO A;  1XMX A;  2W00 A;  2P6T A;  1SVM A;  2WAD A;  2HNH A;  1P9Q C;  2CYY A;  1TT0 A;  4JBA A;  2V1N A;  5FKM A;  1NG7 A;  2ZJR F;  3ZQQ A;  4EJU A;  2HS5 A;  2L7M P;  2QCO A;  1Z1D A;  2EPF A;  2IRF G;  3ZQC A;  1UB9 A;  1LUJ B;  2YU9 J;  3CLO A;  3ZGK A;  2MLK A;  3ELK A;  3F8F A;  1AKH A;  1MBK A;  4RM2 A;  1FIP A;  2NXN B;  1WJF A;  5HLT A;  4CZC A;  2EIK H;  2LY1 A;  3IUO A;  4L9J A;  1X1P A;  2DK5 A;  5GAH J;  3E6B A;  4CCN A;  2K7L A;  2OZ6 A;  4M3G A;  5AIQ A;  1R9T J;  3SZG A;  1YW9 A;  1R00 A;  4JOM A;  4NQW A;  5J1R A;  2QQ8 A;  2OCE A;  2DA6 A;  4NC8 A;  3KYC B;  5CVR A;  2LBF B;  1MH4 A;  3HB9 A;  5GTI C;  5JFR A;  3DBL B;  3DEW A;  1ON1 A;  3FM5 A;  1Z91 A;  2R7U A;  3ONQ A;  3L2U A;  4GO1 A;  1E3O C;  1JGG A;  2XAS A;  3AG2 H;  3K0L A;  4A5N A;  1HW1 A;  3SZT A;  4A69 C;  3G2B A;  3DTK A;  2ESN A;  3N05 A;  3Q5F A;  3LQQ A;  2LY9 A;  4PFO A;  4L5E A;  3PNT A;  5AIP A;  5LD2 C;  2FU4 A;  5EZG A;  3FXL A;  2YS9 A;  5E3M A;  3L7W A;  2UXN A;  1HKQ A;  3QWL A;  1D0Z A;  2M5W A;  5IYB J;  3WTX C;  1ZLJ A;  3PIO F;  3V8L A;  4FCY A;  3M8J A;  3SFI A;  1V3F A;  4UB6 C;  1KU3 A;  2K3P A;  4MFE A;  4C3I J;  2JA5 J;  3U2R A;  3L1P A;  2JA2 A;  2VT3 A;  1B9M A;  4PZJ A;  1BI3 A;  3GF2 A;  4ESF A;  3H5R A;  3TP0 A;  2C6Y A;  4XRM A;  4C2M J;  2KPM A;  2K4J A;  3V7C A;  1ORK A;  4Z6Y A;  2BY2 A;  2NS7 A;  4D5C A;  5H20 A;  1AWC A;  3T8R A;  2IA1 A;  1XB4 A;  3BR3 A;  2DQR A;  1ONV A;  3DF8 A;  3ASN H;  4U0V A;  3FWE A;  2HOE A;  1J5Y A;  3OS2 A;  4ZYE A;  2E5Z A;  3M8F A;  2DA1 A;  3ABK H;  1IUY A;  4ZJZ A;  3WTS C;  1XGO A;  2RC4 A;  3QP6 A;  3QP5 A;  1BOA A;  2E36 A;  1VQ8 I;  5LLQ A;  5GAE J;  3JRF A;  3FM3 A;  1FX7 A;  1YRN A;  4HRI A;  3CD6 I;  4HX8 A;  4UXN A;  2DT5 A;  4UVB A;  3PNV A;  3LSK A;  5K7F A;  4QLC U;  3CTA A;  2L7Z A;  1TWC J;  2A6E F;  5BQT A;  1FT9 A;  2VN2 A;  4BJ5 C;  3RKY A;  4R79 A;  3HSR A;  4XLP F;  2XPU A;  3H1C A;  1VF9 A;  2RDP A;  1WJC A;  2CQ7 A;  2VKV A;  2VJJ A;  2ZKZ A;  1MIJ A;  5HOD A;  4A93 J;  3FIS A;  2FBH A;  4XLA A;  4PCQ A;  4NUB A;  1YRN B;  1O7F A;  1FTT A;  3I4N J;  3FKJ A;  4DOZ A;  1YI2 I;  1QGP A;  1U9O A;  2OF7 A;  4A3L J;  2GAU A;  1J9I A;  2P5V A;  5FKN A;  1JKO C;  3GFI A;  3CP8 A;  3C7J A;  4BJT A;  3M9A A;  1MGT A;  4D7N A;  3K2Z A;  3KEQ A;  2DTZ A;  4LGW A;  1QVU A;  2CQN A;  2HGC A;  1MBF A;  4YEL A;  2P5L C;  5HDK A;  4HF1 A;  2CSO A;  1H89 C;  1S8N A;  2OQR A;  3J7Z I;  1N75 A;  5GAG J;  2AS5 F;  4IEJ A;  2MLG A;  3ABM H;  3F8M A;  1UHW A;  3BZ6 A;  3Q3S A;  2OC6 A;  4L5I A;  4HOB A;  1CF7 B;  2B0L A;  2PG4 A;  2TDX A;  4ZZD A;  3WE2 A;  4KFC A;  1U78 A;  4EQQ A;  1ETV A;  4G9Y A;  1H88 C;  5FLV A;  5ICF A;  2E1M C;  4XR6 A;  1LPQ A;  2QQ9 A;  1R58 A;  2DJN A;  1X2N A;  2FEZ A;  3E3V A;  4DIQ A;  2A6H F;  2FQ4 A;  2X6X A;  2FXA A;  3CCV I;  2VXZ A;  4KIG A;  1MDM B;  4XOR A;  1RZ4 A;  2RNJ A;  2LTP A;  5F27 A;  2NNY A;  3FZV A;  1MMN A;  1IN4 A;  4BAC A;  2M1B A;  3ABT A;  1BC8 C;  2GZW A;  3BR1 A;  4IRI A;  5D5W B;  3LAP A;  4V2F A;  4LB6 B;  3PIP F;  2Z99 A;  3RI4 A;  1AA7 A;  1HDP A;  3AG1 H;  2XGE A;  2NVT J;  4BGD A;  5DDG A;  5LEK A;  1LEB A;  5TRD A;  3HRT A;  4XLN F;  5BNG A;  3TW7 A;  4PJ0 C;  1FEX A;  2F6C A;  2V4J C;  5L3D A;  3IAM 2;  3QYE A;  3IV5 A;  1T2K A;  1MBE A;  2R7S A;  4EM2 A;  3LFU A;  3CUQ C;  3WTZ A;  2E1C A;  5D8K B;  2MC4 A;  1QZY A;  5IYD J;  3KP5 A;  2VLA A;  2CV2 A;  2IS4 A;  3ROU A;  4EJV A;  4UV9 A;  2R5Z A;  3GLX A;  2MFZ A;  4CIC A;  1X58 A;  4XLF A;  4NC7 A;  1RIO H;  4NBQ A;  2WB1 N;  3PM1 A;  2LNB A;  4RLQ A;  1BR4 A;  2X1C A;  2E19 A;  3F23 A;  4XLH A;  4IL6 C;  2UZK A;  1TNT A;  1IUF A;  1OLT A;  3NAU A;  4UUS A;  1XSX A;  1HBX G;  1O3T A;  4YFX F;  4BNC A;  4FET A;  3RTR A;  2K86 A;  1WJE A;  4ENN A;  1RR8 C;  1R71 A;  2W48 A;  2DMQ A;  1BJZ A;  4I0B A;  4ZYD A;  2JQ7 A;  4IKF A;  3HGY A;  2UXX A;  4BJ6 C;  3I59 B;  1H8A C;  4E70 A;  1K6Y A;  1E17 A;  4F93 B;  1WI3 A;  3TQN A;  3QOE A;  4J01 A;  2WAE A;  2HEO A;  2RQQ A;  1LDJ A;  3DTI A;  3MMY B;  1Z3Y A;  3S8P A;  3RZO J;  1X1C A;  3HL2 A;  4A0Y A;  4MLO A;  1QO0 D;  4XM3 A;  4LG3 A;  4DW6 A;  2QSH X;  1SAU A;  2IS6 A;  3WHC A;  1BI0 A;  1Z0X A;  2ELH A;  2BY3 A;  3LA7 A;  3P5J A;  5HDN A;  4FTH A;  3U1K A;  1Z21 A;  3S2W A;  3HOW J;  3C18 A;  3S2H J;  1YW7 A;  3J81 Z;  1Z77 A;  1WCM J;  2OQG A;  2Y9Y A;  4M3F A;  4UVC A;  3S15 J;  3FMR A;  2BOL A;  4PJL A;  4EEF G;  2KQR A;  1NH3 A;  5FLX K;  4FQG A;  4B3A A;  3FDY A;  1I50 J;  4DZP A;  2ME0 A;  1B1B A;  1F5T A;  4QSH A;  1X19 A;  3UKG A;  2O8X A;  3I5U A;  3O3K A;  5FJ8 J;  5DD8 A;  3PJR A;  4ZDP A;  5E3N A;  2QBY A;  2YX7 A;  5J3L A;  4B1R A;  1I6X A;  2LRE A;  3KYL A;  1Y1W J;  2R5Z B;  3O6B B;  5HVQ C;  1U5T C;  3M8E A;  3A01 A;  1YIO A;  2WAQ N;  3KX2 A;  2Z9O A;  2IA0 A;  2M34 A;  3JRC A;  4XOP A;  1V54 H;  5K7Z A;  3J80 Z;  2VE8 A;  2DN0 A;  2QZ8 A;  1R23 A;  3R4K A;  2D1V A;  5IOZ A;  1MKM A;  2KIM A;  1G3T A;  1MJA A;  2BXZ A;  2HQR A;  3HOY J;  2WA0 A;  4I02 A;  1ZGW A;  4P55 A;  1PYV A;  2CJJ A;  1IZ1 A;  1LNW A;  3E5Q A;  2QM3 A;  4FX4 A;  3TDU C;  4KIB A;  1VQ9 I;  3GBG A;  2PFB A;  1UG2 A;  1A31 A;  1MD0 A;  4HNV A;  3TMO A;  2MA3 A;  2GIZ A;  4RGR A;  4WF2 A;  4XRS A;  2W85 A;  1YJ9 I;  3SDG A;  3A01 B;  1JUM A;  2LC2 A;  4RMN A;  2A6T A;  3KFW X;  1KU7 A;  3TL4 X;  3U1D A;  1F43 A;  4RGU A;  2P8T A;  5LHI A;  2Z16 A;  2EZH A;  5GPA A;  2GIV A;  5JVG F;  4X1E A;  1MJB A;  4PJM A;  3CO7 C;  2ZJP F;  3A4C A;  5HDG A;  2JTV A;  3HTS B;  1FTZ A;  1EJ9 A;  1OQY A;  3NQO A;  3DXJ F;  2OD5 A;  1UCR A;  2Q1Z B;  1D0X A;  1SD5 A;  3W2W A;  2DA4 A;  3BT9 A;  5HLI A;  3H92 A;  1JTY A;  2EBI A;  4GYI A;  2F5D A;  3CMY A;  3RYP A;  2YSR A;  2X85 A;  2OA4 A;  2DYR H;  4L9N A;  4A2U A;  2CU7 A;  4JP0 A;  1SMT A;  1I6H J;  3K4L A;  2CO5 A;  2GA2 A;  2IA2 A;  3M4O J;  1IXS B;  5FLM J;  4AYB N;  1W1W E;  1UHS A;  3I71 A;  4N0B A;  4B48 A;  1WHU A;  3NAR A;  5ICC A;  1QVT A;  4A0Z A;  1I27 A;  1MW7 A;  1K61 A;  5E20 A;  4S04 A;  2FA5 A;  1E3H A;  3DKX A;  3X2Q H;  2B63 J;  3L2C A;  3L2R A;  1AU7 A;  2F4I A;  1Y1V J;  3JTH A;  2X1E A;  3MCZ A;  3GX4 X;  5J1Y A;  1FYL A;  5IOY A;  1W36 C;  3MKL A;  3FHN A;  3IHU A;  5IY5 H;  1ZG1 A;  2XKO A;  1OCO H;  1WSU A;  1T6S A;  4BDY A;  1H0M A;  2IBD A;  3EUA A;  3I53 A;  1KQ0 A;  5LFA A;  4EJW A;  1W7P A;  4RA2 A;  3L9F A;  4P1W A;  5IT9 Z;  2CUJ A;  3WU2 C;  5JVT A;  1GXP A;  4E7H A;  2E71 A;  1IRX A;  3IH4 A;  2XB0 X;  4GXO A;  3E0J B;  2X51 A;  5D5U B;  3IAS 2;  3S17 J;  1T08 B;  2Q8K A;  5B66 C;  1LQ1 A;  2IJL A;  3WGH A;  1GV5 A;  4LJZ F;  1FNN A;  1J75 A;  2OV7 A;  4M6Y A;  2O03 A;  5F08 A;  4F91 B;  1BOB A;  3ECH A;  1WKM A;  1O3R A;  1W7P B;  1P4X A;  1YG2 A;  1ZLK A;  5ERI A;  5LEJ A;  4IHY A;  2LDU A;  3IWZ A;  4EMS A;  4CXF A;  2R93 J;  4ITV A;  1HKT A;  4JYK A;  2VKH A;  2K5C A;  2NOG A;  2K4B A;  4RGS A;  1ZGA A;  3M1E A;  4I98 B;  3RYR A;  3GME A;  4ENM A;  3I59 A;  1XGM A;  2V7F A;  3HRM A;  1QBJ A;  4FT8 A;  2ZJQ F;  1S29 A;  2CWE A;  3LA3 A;  2HTJ A;  2RAE A;  4HV5 A;  4HLY A;  3COA C;  3C2G A;  1TWH J;  2J5P A;  3EYI A;  4BE1 A;  1MBG A;  1Q1H A;  3IRR A;  4XK4 A;  2BY0 A;  2LFB A;  3IH2 A;  3F6O A;  2OCC H;  3AAF A;  2LY2 A;  4DBQ A;  2JPB A;  3ZN0 A;  6PAX A;  4HQM A;  3DV8 A;  2EFW A;  9ANT A;  5LRS A;  4NB5 A;  5E79 C;  3QOP A;  2M8G X;  1YX5 A;  1T8I A;  2IP2 A;  4Z2Y A;  3I54 A;  3VYT B;  1W4M A;  4C3H J;  1YHQ I;  3BG7 A;  1BL0 A;  3FK6 A;  3TO7 A;  2HOS A;  3VB2 A;  3WTY C;  4BY1 J;  4EM0 B;  1ZK8 A;  1TLH B;  1W7P D;  2W24 A;  4CA0 A;  1IRG A;  1ZG5 A;  3F21 A;  1PUF B;  1YJN I;  3AG3 H;  3G1L A;  3CMM A;  4BHC A;  2XAH A;  3HRS A;  1FY7 A;  3O2P E;  1ETY A;  3BY6 A;  5K5R A;  2L9R A;  4ANJ A;  1R4M B;  1FYK A;  3BR5 A;  5D6E A;  2ZB9 A;  1TQM A;  4M72 A;  1IO2 A;  3ZMV A;  3ZMS A;  4NNJ A;  5L3E A;  4KT6 A;  3KLN A;  4AWX B;  3JSP A;  3LST A;  2HDD A;  1PUF A;  1ETW A;  3WE3 A;  2R7T A;  1ZG3 A;  2ZSH B;  1QZE A;  1HLV A;  1LE8 B;  1VQ5 I;  3HUG A;  2FBI A;  3RSN A;  4DYQ A;  1YIT I;  3OWT A;  5F1J A;  3OYA A;  3OYH A;  1D3Y A;  4UY8 I;  3IC7 A;  3OR1 C;  4A3K J;  2KL4 A;  1ETO A;  1MNE A;  1Z7U A;  1XS9 A;  1WJA A;  3NEU A;  2I10 A;  2RVC A;  1XTA A;  2K27 A;  3HOT A;  1HQC A;  2P6S A;  3DEE A;  3MAJ A;  2KRF A;  5CVU A;  1K4T A;  2EFP A;  1K79 A;  2V26 A;  3P9C A;  3A02 A;  4PDK A;  1XCV A;  4II2 A;  3V7S A;  3JW4 A;  2GWR A;  4I0A A;  2JVH A;  2FNA A;  4PUS A;  3HM5 A;  3FHZ A;  4B3X A;  2DU9 A;  4A3E J;  2CW7 A;  3GYH X;  2E1M B;  3S3N A;  1ETX A;  2LD5 A;  1HF0 A;  3CC4 I;  3DFG A;  1EA3 A;  1ITY A;  4S0H B;  1XGS A;  2CG4 A;  3TDZ C;  4G12 A;  1JT0 A;  3HIF A;  3QU6 A;  1CGP A;  2R92 J;  4Y17 A;  2LYC A;  5FB2 A;  3OYL A;  4BHB A;  4DQ2 A;  5A2Q Z;  3KEO A;  1MBJ A;  1V5G A;  2FX0 A;  2NS0 A;  2PEX A;  1FMW A;  2X0L A;  3K6G A;  2IGO A;  4AD9 A;  4BXU A;  5M5X J;  3CDL A;  4MEY F;  4M9S A;  1SVO A;  1VQP I;  2WBM A;  1HOM A;  1FWZ A;  4P96 A;  1ETQ A;  3HHG A;  3HEF A;  3IL2 A;  4BE2 A;  4OIN F;  3TED A;  2XF6 A;  5CLS A;  3S93 A;  1FJL A;  2EZI A;  1VFC A;  2ZNZ A;  3MN2 A;  1MH3 A;  1IW7 F;  3CUQ B;  5LRR A;  3RJP A;  3TO9 A;  4MO7 A;  4M6V A;  4CCJ A;  2HZT A;  4XRF A;  4Y13 A;  1PUE E;  3CZ6 A;  2QLZ A;  4EGZ A;  1I39 A;  1T33 A;  2L0K A;  3FBI B;  2DMP A;  1JKQ C;  2FMY A;  4XOT A;  5TGT A;  2EZL A;  3HZJ A;  2UWM A;  3QPS A;  2WY8 Q;  5LGT A;  2W7N A;  1KGS A;  2OAZ A;  2RNG A;  3LSG A;  3LWF A;  2GXG A;  4MHG A;  1U8B A;  1EH6 A;  2DT6 A;  2L9S A;  2X9D A;  3S1Q J;  4G6D A;  4M9Z A;  3WU0 A;  3H3V K;  4HSR A;  3KE2 A;  1GLN A;  4X0G A;  1K4S A;  4MQV A;  4AVZ A;  3JAM K;  2FF4 A;  3EQL F;  1N25 A;  2HU9 A;  1ETK A;  3S2D J;  2O9L A;  2KRC A;  1YYV A;  4XN3 A;  1WVR A;  1BBY A;  2HWV A;  1TWF J;  5DCM B;  2XAQ A;  3OYC A;  2DOE A;  4RAG A;  2JVG A;  2WWY A;  5F0F A;  2G9W A;  4I01 A;  1HXD A;  4XMY A;  1RC9 A;  5CVV A;  4YFN F;  3VOE A;  2K9N A;  1RRJ A;  5EJC A;  2P0W A;  4XKB A;  4CCL A;  1E3P A;  1Y0N A;  5EZH A;  5FRN A;  1R49 A;  1FSH A;  4P9F A;  3CJR B;  3H9Q A;  1E2X A;  3HUG B;  3VEP A;  1R22 A;  2QKL B;  3CCU I;  1Y6I A;  4Q47 A;  3HG9 A;  1B59 A;  2M30 A;  4EVI A;  4LG0 B;  1T56 A;  2VT2 A;  3K69 A;  5D4S A;  1BA5 A;  3ZMD A;  3PO2 J;  3I58 A;  1S72 I;  4CSW A;  2JT1 A;  3JRE A;  4IRH A;  2ZFW A;  2EJR A;  1ULY A;  1WJB A;  3CJQ B;  1REP C;  1XMK A;  3SYT A;  1WH7 A;  2LP0 A;  1ENH A;  2QQA A;  4RB1 A;  2P4W A;  1F4K A;  3GTL J;  4A3D J;  2XGC A;  3OS0 A;  3UR3 C;  1OMI A;  2H27 A;  5IP6 A;  2HQ5 A;  2HXI A;  3H5A A;  3KP2 A;  3LFK A;  3VOD A;  1JJ8 C;  2JN6 A;  3R60 A;  5BMZ A;  1EH7 A;  4B47 A;  2O8K A;  1FZP B;  2P7V B;  4M74 A;  4N9I A;  3LAJ A;  3RQ4 A;  2ISZ A;  2BHZ A;  2EIJ H;  1KA8 A;  1IAW A;  3DWL E;  1USS A;  3FBN B;  2E1O A;  3GXO A;  4BQN A;  1JKR C;  3GTP J;  2VQL A;  2DMN A;  4WXC A;  2AQE A;  2W1O A;  3CLQ A;  2HR3 A;  2R0Q C;  3BCA A;  4E6K G;  1XGN A;  3PL8 A;  3ZR8 X;  3J7Y J;  2Q0O A;  5E1W A;  2HDC A;  2ZO4 A;  1DU0 A;  2JUG A;  3A0H C;  3WOD F;  2X6W A;  1TC3 C;  1VZ0 A;  2DA7 A;  4CHU A;  3W3C A;  2G0E A;  3CDI A;  1OIS A;  2DOF A;  4HNT A;  4II3 A;  5J8C A;  4I2O A;  5EG0 A;  2VKD A;  2DDB A;  2EZK A;  2FUG 2;  2TCT A;  1SAN A;  2KP6 A;  1S5L C;  3DTE A;  3BLY A;  4V2G A;  3FIW A;  1HCR A;  4G7H F;  2R3S A;  2FD5 A;  3E97 A;  2EWN A;  4U88 A;  3T0Y A;  1YIJ I;  1LEA A;  1SFE A;  2J5O A;  2VC0 A;  3OL4 A;  3K7A J;  3BC8 A;  2V6C A;  2CW8 A;  3BZC A;  3IWF A;  2A3S A;  2DPD A;  2L5Q A;  3BJA A;  1B4A A;  2ACJ A;  1KON A;  4G6Q A;  4KNY A;  4RAZ A;  3IKT A;  3MD2 A;  2OJE D;  5HOO A;  4KYW A;  3FMQ A;  2BW3 B;  1ODD A;  5IPA A;  3WHB A;  3CJT B;  3VYS B;  1MMS A;  4XNF A;  2MGQ A;  3LSH A;  4A3C J;  2H8W A;  2BE5 F;  4A6E A;  4G7Z F;  3Q0W A;  4L0Y B;  3TGN A;  5EG0 B;  3D5R C;  3GTK J;  4B4C A;  4OIO F;  3OYB A;  2V1U A;  3DEU A;  1B6A A;  2K40 A;  3H36 A;  5EGO B;  1U0J A;  3DP7 A;  1O57 A;  3V42 A;  3JRI A;  1OKR A;  3I4M J;  3LMM A;  2ESH A;  5L3B A;  2Y0S A;  3GTO J;  2OZU A;  2CFX A;  3HOU J;  3S3O A;  2YPR A;  2R7F A;  3BQZ A;  1Z9C A;  5E8I A;  1FBU A;  3ZN1 A;  4UUS B;  1HSJ A;  2CUF A;  2YX4 A;  1I1S A;  4BL0 B;  4CCO A;  2M7B A;  2R4G A;  3JRA A;  2Z33 A;  2X4H A;  2M0C A;  1P7I A;  1JI8 A;  2R7R A;  3BJ6 A;  4V19 K;  3F8B A;  3DBH B;  1V4R A;  2Y69 H;  3BCB A;  1SMY F;  5L3G A;  1DDN A;  4AM3 A;  1FOX A;  1RET A;  3PQJ A;  3B73 A;  3RIR A;  3FX3 A;  2PMZ N;  3K70 C;  3CCJ I;  1S3J A;  1S7E A;  2E2H J;  2K85 A;  2OU2 A;  2VQG A;  4WK8 F;  3BQY A;  1YX3 A;  1IGN A;  4RDU A;  1X4O A;  2BV6 A;  2BBY A;  4JX6 A;  3TKY A;  4I99 C;  4NQW B;  4XBF A;  2O6G E;  5DD4 A;  5C3E J;  1A6I A;  2CQK A;  4BBS J;  4WWC A;  5M5W J;  3S1N J;  1B8I B;  2IGM A;  1Z05 A;  1VQ7 I;  3OYN A;  4UHT A;  3CF5 F;  1MSF C;  2HXO A;  5B3S H;  5ICG A;  2P7C B;  2V9P A;  2R5Y B;  2EFN A;  3D5S C;  4B8X A;  3BR0 A;  2RRE A;  1LFP A;  2X6O A;  3BWG A;  3Q9V A;  2DW4 A;  1T38 A;  2PI0 A;  1ZTR A;  2QF7 A;  3GFL A;  5IP7 J;  3C2H A;  1DPU A;  3PNY A;  3JRG A;  2PLY A;  2H1K A;  4XSX F;  2L9V A;  1R4N B;  1TNS A;  5FRM A;  3GTJ J;  3MQ0 A;  4R1H A;  1OR7 A;  1XSV A;  1GUU A;  1C0W A;  4GCV A;  1DGW Y;  4F55 A;  1FP2 A;  3EPZ A;  4KN7 X;  1YLF A;  4M3D A;  4Y15 A;  3FXO A;  1DP7 P;  2LMD A;  5C44 J;  4ZYG A;  1IXC A;  2QSF X;  3RKX A;  4IO9 F;  4Y3O A;  2XV4 S;  2VJ5 A;  3FK7 A;  1YS6 A;  1W5S A;  1U9N A;  3BPX A;  1XG1 A;  3C3W A;  2GM4 A;  4OIP F;  1TWA J;  3CUQ A;  2MH2 A;  1B8I A;  3AL0 C;  3I64 A;  2GQQ A;  2ZME A;  1WFX A;  3GWZ A;  1DUX C;  3OMY A;  2L01 A;  1RR7 A;  3PO3 J;  5GP9 A;  2CQX A;  5K7H A;  2DAO A;  4RB0 A;  3H35 A;  1OYW A;  4XRS G;  4D5F A;  3IRQ A;  3F8C A;  3F0C A;  2BYV E;  4ZC3 A;  2AO9 A;  2DTR A;  1JE8 A;  1QRY A;  4AVP A;  3ABU A;  1JJ6 C;  4KT5 C;  4LB5 A;  3IKV A;  1WZ2 A;  1T0F A;  2HI3 A;  4YIF A;  1Q1V A;  1NG6 A;  3OYI A;  2HQN A;  1YO5 C;  1JGS A;  1P4W A;  5D5V B;  4C3J J;  1G4D A;  3ZQI A;  3HOX J;  2JWT A;  4LMY A;  5H6R A;  3BR6 A;  1U8R A;  2DOA A;  2M7A A;  3GTM J;  1KZH A;  4JX4 A;  2G7U A;  2NOJ B;  1SD4 A;  4A3B J;  4MGR A;  3A0B C;  3ZP5 A;  1FOW A;  4HDV A;  1X1D A;  1U6G A;  1UJ8 A;  2HYG D;  5C4X J;  4ETS A;  1G3W A;  2F5C A;  4L5J A;  2KJC A;  1WRJ A;  3A1Y A;  5HS8 A;  1T0F C;  2HOA A;  3MWM A;  3CCR I;  5KAF C;  3OS1 A;  3F9K A;  2DA5 A;  4RAY A;  5FFZ A;  1WGX A;  3GFJ A;  2K9S A;  1HDD C;  2MSY A;  3QYF A;  3HBL A;  3RKW A;  2O0Y A;  2A68 F;  2DT7 B;  1XPX A;  1YW8 A;  2ELK A;  1ON2 A;  1TZL A;  1I5Z A;  4ZDL A;  2IPQ X;  3GUD A;  2X1D A;  4ZDO A;  5JLW A;  5E18 F;  1BM9 A;  1WQ2 A;  3HHH A;  5JLX A;  3P7N A;  2W57 A;  1HA8 A;  4KMU X;  4HPQ A;  3J80 K;  1A36 A;  1MSE C;  2XF5 A;  1QU3 A;  1G6N A;  2M4K A;  3O8H A;  4C30 A;  3DKY A;  2PMH A; 
#chains in the Genus database with same CATH homology
 1E3O C;  1JGG A;  4A69 C;  1LFB A;  4W97 A;  3MVP A;  3CCY A;  5J1U A;  3E7L A;  2LY9 A;  3JRH A;  1AKH B;  2HDD A;  1PUF A;  1ETW A;  4L5E A;  5FKK A;  1DU6 A;  1VI0 A;  5EZG A;  4A3F J;  1HLV A;  1LE8 B;  4CYC A;  4DYQ A;  1OCT C;  2YS9 A;  5E3M A;  5F1J A;  2OPT A;  5IYB J;  4FCY A;  4A3K J;  1ETO A;  1XS9 A;  3SFI A;  3OOU A;  2LKX A;  2I10 A;  3IH3 A;  1GV2 A;  4MFE A;  4C3I J;  2JA5 J;  3L1P A;  2XPW A;  4Y7N J;  3A02 A;  2Y30 A;  3TP0 A;  2HOT A;  2XRL A;  4XRM A;  4C2M J;  3GTQ J;  3LSP A;  2DA2 A;  3TP3 A;  3HM5 A;  1W0U A;  1ORK A;  2NS7 A;  4FE4 A;  4D5C A;  4A3E J;  1ETX A;  2LD5 A;  1HF0 A;  2LLK A;  3BR3 A;  1TWG J;  2P81 A;  1ITY A;  4S0H B;  4IHW A;  1GDT A;  2DA3 A;  4FIS A;  4G12 A;  2DA1 A;  3LSR A;  1JT0 A;  2VUM J;  2R92 J;  2XB5 A;  3JRF A;  1D5Y A;  1YRN A;  1ZQ3 P;  1MBJ A;  3LSJ A;  2FX0 A;  5K7F A;  2L7Z A;  1TWC J;  2JJ7 A;  4A3G J;  5M5X J;  2KDZ A;  3CDL A;  1RPW A;  4RBO A;  2XPU A;  1VF9 A;  1B72 B;  2VKV A;  2XPV A;  5HOD A;  1HOM A;  3ZQL A;  1ETQ A;  4A93 J;  3FIS A;  3HEF A;  3TED A;  2ID6 A;  4LOC A;  1FJL A;  2EZI A;  1I3Q J;  1VFC A;  1YRN B;  1FTT A;  3I4N J;  3ZQF A;  4A3L J;  1U9O A;  1MH3 A;  2OF7 A;  3MN2 A;  2KT0 A;  5FKN A;  1JKO C;  4MO7 A;  4M6V A;  4W1U A;  5EDN A;  4DYC A;  3ZOB A;  1GVD A;  3G1O A;  4D7N A;  1T33 A;  2L0K A;  2DMP A;  2DTZ A;  1A5J A;  1JKQ C;  1QVU A;  5F0C A;  5FKO A;  3O8H A;  1MBF A;  2EZL A;  3QQA A;  3QPS A;  1H89 C;  3HDD A;  2CRG A;  3LSG A;  1U8B A;  4IEJ A;  2X9D A;  3S1Q J;  4MFD A;  2ID3 A;  3H3V K;  3Q3S A;  1IRZ A;  2LVS A;  5M3M J;  3C2B A;  2JK3 A;  2X48 A;  1U78 A;  3VPR A;  2CQQ A;  1ETK A;  3S2D J;  2O9L A;  1ETV A;  1H88 C;  3HOZ J;  1TWF J;  2EQR A;  3BG5 A;  5FLV A;  1O4X A;  1RKT A;  5F0F A;  1JT6 A;  2DJN A;  1X2N A;  4A3I J;  2FQ4 A;  2K9N A;  4Y52 J;  5EZH A;  1APL C;  4BY7 J;  5F27 A;  2LTP A;  3HKZ N;  1ZR4 A;  3GTG J;  2VPR A;  3TW6 A;  2DMT A;  5F04 A;  3BR1 A;  1X2M A;  5C4J J;  1T56 A;  1BA5 A;  4V2F A;  2GLO A;  4AUX A;  1HDP A;  3PO2 J;  2XGE A;  2NVT J;  1LFU P;  3JRE A;  5EF6 A;  1ZKG A;  2NVY J;  5BNG A;  3S1R J;  3TW7 A;  1WH7 A;  2E2J J;  3BR2 A;  1FEX A;  1NK2 P;  2LP0 A;  1ENH A;  3B6A A;  3IV5 A;  2XSD C;  1MBE A;  5DS9 A;  3GTL J;  4A3D J;  2XGC A;  4M3B A;  1G2H A;  5IYD J;  5IP6 A;  1F36 A;  2HQ5 A;  2HXI A;  2FJ1 A;  1XC5 A;  2R5Z A;  1JJ8 C;  2JN6 A;  4I76 A;  2O8K A;  1X58 A;  2YUS A;  2TRT A;  1BW6 A;  4BKX A;  3OIO A;  1W0T A;  2WB1 N;  3PM1 A;  5IP9 J;  2MW8 A;  2GBY A;  3GTP J;  2E1O A;  1JKR C;  2DMN A;  2E19 A;  4XID A;  4D7M A;  2R0Q C;  2VKE A;  1IUF A;  3NAU A;  4UUS A;  4I6Z A;  1DU0 A;  1TC3 C;  2DA7 A;  2W48 A;  2DMQ A;  1BJZ A;  2G0E A;  1AHD P;  1CQT A;  2WV1 A;  3HGY A;  5EG0 A;  2EZK A;  1H8A C;  4XIC A;  2TCT A;  1SAN A;  2NVX J;  1HCR A;  4V2G A;  3FIW A;  3SJM A;  2COB A;  2ECC A;  2FD5 A;  1WI3 A;  3S16 J;  5GPC A;  1WPK A;  3K7A J;  3JRB A;  3RZO J;  1IG7 A;  4MLO A;  3ZQG A;  4IHX A;  3BTJ A;  3G1M A;  4DW6 A;  5DTD A;  3WHC A;  5IPA A;  1Z0X A;  4FTH A;  3WHB A;  5M5Y J;  3HOW J;  2MGQ A;  3S2H J;  1NTC A;  1Z77 A;  1WCM J;  4A3C J;  2Y9Y A;  4M3F A;  3S15 J;  2L7F P;  4EEF G;  2JA8 J;  3Q0W A;  1EF4 A;  5EG0 B;  3GTK J;  4B4C A;  3DCF A;  2K40 A;  5EGO B;  4JX5 A;  2NS8 A;  5EGO A;  4X6A J;  4B3A A;  3JRI A;  3I4M J;  2O7O A;  1RES A;  4BXX J;  3W6V A;  1I50 J;  4DZP A;  2ME0 A;  3D1N I;  4QSH A;  1GT0 C;  3UKG A;  1JUP A;  3GTO J;  5FJ8 J;  5M3F J;  5E3N A;  3FKI J;  1IDZ A;  5J3L A;  4B1R A;  2Y31 A;  2MG4 A;  3HOU J;  3BQZ A;  2Y0S N;  2R5Z B;  1Y1W J;  4UUS B;  1LE8 A;  2CUF A;  2R7Z J;  4A3M J;  3A01 A;  2IAI A;  2WAQ N;  3JRA A;  4IHV A;  2M34 A;  2M0C A;  3JRC A;  5K7Z A;  2DN0 A;  1MNM C;  2ECB A;  1P7I A;  2ME6 A;  3M3Y J;  5IOZ A;  4MIM A;  2E2I J;  3S1M J;  3BG3 A;  2DMU A;  4M3E A;  1NK3 P;  3HOY J;  3BTL A;  1RET A;  2JA7 J;  1IC8 A;  2LK2 A;  3S14 J;  1ZGW A;  2PMZ N;  2M9H A;  3OSG A;  2VI6 A;  1POG A;  2CJJ A;  5E3L A;  5F0H A;  1S7E A;  2E2H J;  2R5Y A;  3BQY A;  3LOC A;  3GBG A;  1IGN A;  1UG2 A;  4RDU A;  4HNV A;  4AC0 A;  4XRS A;  4JX6 A;  3SDG A;  3A01 B;  1JUM A;  5C3E J;  1A6I A;  1F43 A;  4BBS J;  5M5W J;  3S1N J;  1B8I B;  2EZH A;  5EYR A;  5E3O A;  5GPA A;  1MSF C;  4X1E A;  1IDY A;  2HXO A;  1BW5 A;  3JR9 A;  2R5Y B;  3Q0V A;  1FTZ A;  3QPL A;  3OSF A;  3ZQH A;  3BR0 A;  2X6O A;  5EEA A;  5FKL A;  4GFB A;  2DA4 A;  3BT9 A;  4ABZ A;  1JTY A;  2EBI A;  1ZTR A;  2QF7 A;  3CMY A;  5IP7 J;  1JTX A;  2CU7 A;  4JP0 A;  3JRG A;  1I6H J;  2H1K A;  2EH3 A;  3Q0U A;  2M2E A;  3M4O J;  1OCP A;  5FLM J;  4AYB N;  4QTR A;  1P7J A;  1UHS A;  2HYJ A;  3NAR A;  3GTJ J;  1QVT A;  3RKQ A;  2AHQ A;  1K61 A;  1GUU A;  1UMQ A;  2B63 J;  4M3D A;  3BTI A;  1AU7 A;  5C44 J;  1Y1V J;  1OJL A;  5J1Y A;  2CUE A;  5IOY A;  4FE7 A;  3MKL A;  1RKW A;  2JMW A;  3FK7 A;  2N8G A;  4NDL A;  1U9N A;  3JRD A;  2IBD A;  1JKP C;  1XG1 A;  3CQZ J;  1JUS A;  2GM4 A;  1TWA J;  3B6C A;  3HGG A;  1B8I A;  1OFC X;  2H8R A;  2D5V A;  3IH4 A;  3RZD J;  2XB0 X;  3S17 J;  1RR7 A;  3PO3 J;  5GP9 A;  2CQX A;  5K7H A;  1QPI A;  1GV5 A;  3K2A A;  4UUT A;  5F08 A;  3HOV J;  4XRS G;  2K9Q A;  4D5F A;  2NVQ J;  3BTC A;  5IYC J;  4DZJ A;  4J19 A;  3F0C A;  4IHY A;  1ZR2 A;  2AO9 A;  3BG9 A;  1IJW C;  1QRY A;  1JJ6 C;  2R93 J;  4JYK A;  2XGD A;  2HI3 A;  2NOG A;  1Q1V A;  2JA6 J;  4C3J J;  3ZQI A;  1VND A;  3HOX J;  2JWT A;  3BR6 A;  3H0G J;  3GTM J;  4A3J J;  2RAE A;  4JX4 A;  1SFO J;  1IV6 A;  4A3B J;  1TWH J;  1K83 J;  1MBH A;  5FKM A;  4BBR J;  1MBG A;  4XK4 A;  1B72 A;  2LFB A;  3LNQ A;  3IH2 A;  2L7M P;  2QCO A;  5C4X J;  3ZQC A;  3A03 A;  2YU9 J;  9ANT A;  2HOA A;  4DYR A;  1AKH A;  4QIW N;  2M8G X;  1MBK A;  1FIP A;  2DA5 A;  1WGX A;  4C3H J;  2K9S A;  1HDD C;  2MSY A;  1BL0 A;  3FK6 A;  3RQI A;  4M3G A;  2Y9Z A;  2HOS A;  3HBL A;  1R9T J;  2IEK A;  4BY1 J;  2ELK A;  4CYC B;  1WH5 A;  1ZK8 A;  2LR8 A;  5J1R A;  5JLW A;  1FIA A;  2DA6 A;  5JLX A;  1PUF B;  3G1L A;  1MH4 A;  1ETY A;  2L9R A;  3HB9 A;  1MSE C;  3BR5 A;  3DEW A;  2Y2Z A;  2ZB9 A;  3O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...