4BBSJ

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bbsJ00
2K9QA 5EYRA 5J3LA 2MSYA 2AHQA 1JUPA 2Y30A 1IUFA 4V2FA 1B8IB 2LD5A 1TWHJ 3A01B 5J1YA 3FK6A 1NK2P 4XICA 2Y2ZA 3JR9A 1MBFA 2Y31A 2R7ZJ 1ORKA 5FKOA 3B6AA 1YRNB 1JUSA 2O9LA 1OCTC 4MLOA 1MBEA 1WPKA 1POGA 3Q0UA 4D7MA 1WH5A 1B72A 3IH3A 2ECBA 1VNDA 2ID6A 2DA6A 1H88C 2JJ7A 2DA3A 3GTGJ 1RETA 3ZQFA 1PUFB 1TWAJ 1LE8B 2GM4A 4A3MJ 3WHCA 2E1OA 4Y7NJ 3ZQCA 2DN0A 5K7HA 2R5YB 5FJ8J 4RDUA 3VPRA 2EZLA 4DZPA 4BY1J 3B6CA 1JJ6C 3G1LA 1ETQA 4HNVA 3NARA 3A02A 2MGQA 4AYBN 2YU9J 2KDZA 1EF4A 1XG1A 1WGXA 4W1UA 3TW6A 5F04A 2JK3A 3RZDJ 2PMZN 4FCYA 1XC5A 2YUSA 3IH4A 1Z0XA 1MSFC 1SFOJ 4A3IJ 3HOZJ 1H8AC 2GLOA 4ABZA 1I6HJ 1OCPA 2DA5A 5K7ZA 3RKQA 2L7MP 5EZHA 5FKKA 1ETOA 4A3CJ 1MBKA 4G12A 2XGCA 1IC8A 4D5CA 3L1PA 3M3YJ 2LTPA 2IBDA 3HB9A 2TCTA 4CYCB 2LLKA 1VFCA 2G0EA 5FKMA 4FISA 1G2HA 3LNQA 1ITYA 4IHWA 3CMYA 4BKXA 4A69C 2FD5A 1XS9A 1IJWC 2R92J 3HM5A 3BR3A 5K7FA 2XB0X 2E2JJ 2XB5A 3BG9A 2HDDA 2HXOA 5FKNA 4A3DJ 3JRBA 2VI6A 1X58A 1IRZA 3ZQLA 2W48A 4BBSJ 3BQYA 3FK7A 3CDLA 3RZOJ 4V2GA 4QTRA 3C2BA 1APLC 4A3JJ 2IEKA 3BTJA 4B3AA 1U9OA 2Y0SN 3G1MA 5F0CA 1WCMJ 4JYKA 2EQRA 2X9DA 5EEAA 4IHVA 1LFUP 1QVUA 2L7ZA 4NDLA 2DA2A 2M8GX 4C3HJ 2E19A 2CQQA 1U78A 2M9HA 3HOYJ 2JA6J 2WB1N 4LOCA 2EZKA 4MIMA 3ZOBA 1ETKA 4C2MJ 5IYBJ 2WAQN 4S0HB 2JA7J 1BW6A 2LVSA 5FLMJ 5EG0A 1U8BA 1AU7A 1UMQA 5F27A 3BTLA 5IP7J 2L0KA 1BL0A 3S2DJ 5J1RA 2JWTA 2N8GA 1HDPA 1WI3A 1ETVA 4I6ZA 2LKXA 1ZTRA 4UUTA 4L5EA 2Y9ZA 1ZK8A 5FLVA 5E3LA 2LFBA 1B8IA 1IV6A 5M5XJ 2VPRA 3W6VA 3A01A 2XPVA 3K7AJ 3BG3A 3FIWA 1F36A 4JX5A 3JRIA 1YRNA 1TWGJ 5E3OA 1JKPC 1TWFJ 4A3EJ 1T56A 2O8KA 4QIWN 2MW8A 5E3NA 4BXXJ 3S17J 9ANTA 2EZHA 1A5JA 5F0HA 1FIPA 2LR8A 3BR1A 5F1JA 1FTZA 5GPAA 2R5ZB 1RKTA 3UKGA 3TP0A 4B1RA 2NOGA 1MBJA 3LOCA 3A03A 2CUFA 4XRSG 4Y52J 2DMNA 5F0FA 4X1EA 2CRGA 2X6OA 4W97A 4EEFG 1HLVA 1E3OC 5C4XJ 2NS8A 3CCYA 1PUFA 2HOSA 2IAIA 1D5YA 2EH3A 3E7LA 1HOMA 2NVTJ 1JKOC 3BTIA 3HGYA 3OSFA 2JA5J 3BQZA 1H89C 2HYJA 4DZJA 1JTYA 2JMWA 1JTXA 1OFCX 1JGGA 1DU6A 1O4XA 5C3EJ 3QQAA 2DMTA 3BR0A 1UHSA 2E2IJ 3GTMJ 1ETXA 3GTKJ 1MH3A 3I4MJ 1MSEC 1GV5A 1P7IA 2QCOA 4D7NA 3BR5A 4AC0A 1IDYA 5IPAA 3GTLJ 2CUEA 3S2HJ 1BA5A 2DMQA 2XSDC 2NVXJ 3PM1A 5C4JJ 3JRAA 3QPLA 2R93J 3LSRA 4UUSA 1I50J 1MNMC 4XIDA 1GVDA 3NAUA 5IP6A 1ETWA 2HOAA 5IYCJ 4M3BA 3GTPJ 2GBYA 4BY7J 2K9SA 2HXIA 1S7EA 1VI0A 2COBA 2JA8J 4B4CA 2DMPA 4M3EA 3ZQIA 5GP9A 3S15J 1QPIA 2ECCA 2D5VA 3LSJA 3QPSA 4QSHA 4C3JJ 1W0TA 4A3KJ 4IHYA 4A3BJ 2LK2A 3Q0VA 3D1NI 1IG7A 5IYDJ 2HQ5A 5M5WJ 4M3FA 2XGDA 1AKHA 3BTCA 2ID3A 3ZQGA 5EGOA 5IOZA 2LP0A 2RAEA 4A3GJ 1ZGWA 2AO9A 2VKVA 5M3MJ 5HODA 3M4OJ 2LY9A 1GDTA 3DEWA 4M3GA 2X48A 1Y1VJ 2KT0A 1MBGA 2CQXA 3S1MJ 1JUMA 1JT0A 2CU7A 5GPCA 2OF7A 3MVPA 1ETYA 4MFDA 4J19A 3HKZN 1ENHA 3S16J 3Q0WA 3BT9A 3JREA 4M6VA 3GTJJ 3HEFA 4A93J 3HDDA 3GTQJ 1BW5A 2DTZA 3H3VK 2TRTA 4D5FA 1HF0A 4JP0A 4FE7A 1JT6A 1DU0A 4FE4A 4MO7A 2MG4A 3S1NJ 1HDDC 3MKLA 1AHDP 1A6IA 1NTCA 5FKLA 2ME0A 5C44J 2ZB9A 4M3DA 5M5YJ 3JRHA 2L9RA 4C3IJ 1RR7A 1B72B 1QVTA 2JN6A 4XK4A 3PO2J 2FJ1A 4DYQA 2B63J 1MH4A 1CQTA 3HOUJ 2DA1A 1NK3P 4XRSA 1OJLA 5DTDA 3TP3A 3JRFA 1ZQ3P 3FKIJ 1UG2A 3HOXJ 4IEJA 1BJZA 1LE8A 1MBHA 1GV2A 1X2NA 1ZR2A 2R5ZA 1IGNA 1X2MA 2P81A 1VF9A 1FTTA 3TEDA 4MFEA 2R5YA 3IV5A 1P7JA 2M2EA 4DW6A 5EZGA 2E2HJ 2QF7A 5IP9J 4IHXA 1TWCJ 3S1QJ 1RESA 1RPWA 3OIOA 2FQ4A 2NS7A 3HOVJ 1GUUA 2Y9YA 4I76A 5JLXA 3LSPA 1QRYA 2I10A 2OPTA 4JX6A 3S1RJ 2L7FP 2O7OA 1FIAA 4AUXA 1W0UA 2NVYJ 1U9NA 2K40A 2EZIA 3BG5A 3OSGA 3GTOJ 2ELKA 2VKEA 2M0CA 1JKRC 2HI3A 2HOTA 1Z77A 2DJNA 3FISA 3K2AA 4CYCA 1K83J 1T33A 3F0CA 1Q1VA 3HGGA 1Y1WJ 4FTHA 1FEXA 1WH7A 2R0QC 3I4NJ 1I3QJ 3DCFA 3ZQHA 4UUSB 1HCRA 3LSGA 3SDGA 1TC3C 3SJMA 5JLWA 2WV1A 3HBLA 2M34A 3RQIA 2ME6A 1ZR4A 4DYCA 1R9TJ 5DS9A 3WHBA 1JKQC 3TW7A 2YS9A 5J1UA 5F08A 3CQZJ 2XPUA 3OOUA 3IH2A 2DA4A 2FX0A 4JX4A 4A3FJ 1IDZA 2K9NA 1K61A 2DMUA 5M3FJ 1RKWA 3H0GJ 3Q3SA 2XRLA 5EDNA 3S14J 2H8RA 1F43A 3JRDA 3MN2A 2H1KA 2EBIA 2DA7A 3SFIA 4BBRJ 5EF6A 4GFBA 3JRGA 3PO3J 4XRMA 2VUMJ 4A3LJ 5E3MA 1AKHB 3JRCA 3BR2A 3O8HA 4DYRA 5EGOB 3G1OA 3GBGA 3HOWJ 5EG0B 1ZKGA 1SANA 2XPWA 3BR6A 4X6AJ 1FJLA 5IOYA 2NVQJ 1JJ8C 5BNGA 4RBOA 3O8GA 2CJJA 2XGEA 1GT0C 1LFBA
chains in the Genus database with same CATH superfamily
2A5YB 3H0DA 1R58A 4FHTA 3MFKA 2MSYA 3GEZA 1JUPA 2QSFX 1G59A 2WA0A 2VODA 2Y30A 3WODF 1IUFA 3P9IA 1W36D 2CW0F 4LJZF 1TWHJ 3QP5A 4J00A 3MZYA 1IRFA 4KMUX 3B6AA 3OYNA 5FFXA 1KA8A 4MLOA 2OUMA 4LD5A 2XRNA 5A2QZ 3KP5A 2KP6A 4I0AA 3K4MA 1FYMA 4XONA 1K78B 1SVMA 2K7LA 2D1VA 2P8TA 1J5YA 3J7AO 3JCUC 1WH5A 1MIJA 3IH3A 2DA6A 2GIZA 2JJ7A 2QUFA 4DJAA 2M1BA 3GTGJ 2R7OA 1RETA 4WXDA 1FOKA 3VSLA 2COMA 1SD7A 2FRHA 3GW2A 4CO8A 2BYVE 1PUFB 1BIBA 1ONVA 2HEOA 5J40A 4A3MJ 2K5CA 3S2WA 5LHHA 3DEUA 3F3XA 4Y7NJ 2MBFA 2DN0A 3LQRA 3TOAA 3I3LA 2M45A 1DUXC 1ETQA 4ZYHA 4ZH4F 1S3JA 1SFXA 1QO0D 4BXUA 2YU9J 1TT0A 2KKOA 2ESHA 1T95A 3J81Z 4XRFA 2ZXHA 4GXOA 3H5RA 2JK3A 3HL2A 2PMZN 3KZZA 1XC5A 1OCRH 4YIFA 3QU6A 1Z0XA 3BLYA 2XKPA 3GZ6A 3C18A 1NG6A 1YITI 1I6HJ 5EZHA 3V7CA 5HDNA 5BOXA 1K4SA 1ETOA 4LG3A 2UXNA 3VWBA 1T0FA 3ZQ7A 3MZHA 3HSFA 4OMYA 3A0HC 3CC4I 4M9XA 2GOXB 1EH6A 4B48A 1OYWA 2G7UA 2UWMA 5K5RA 3OOPA 4IHWA 2H8WA 3CMYA 1OYYA 3VEPA 2A69F 3GX4X 1GHCA 5TGTA 3GLLA 4BKXA 3MD2A 4HLYA 1V54H 1PDNC 4EGZA 1HA8A 5CYVA 3RKXA 5CQEA 3BR3A 5K7FA 3FDYA 3M1EA 1R00A 1R6RA 2E2JJ 2XB5A 1YIOA 2OAZA 2KDOA 4KJZA 4PSXA 3LAPA 5FKNA 4CYDA 1X58A 3WU0A 2WV0A 2W48A 2OTJI 3DKWA 4BL0B 2VLAA 1USTA 1MMGA 3CDLA 2DLLA 1X1AA 3BJOA 2O6GE 3U21A 3C2BA 4XBFA 1GLNA 1APLC 5EEGA 4ENNA 3R60A 2E60A 1U9OA 2Y0SN 3G1MA 3VYRB 3M07A 4RGRA 4IHVA 1TQPA 2LDUA 2BY3A 1QVUA 2Z9OA 2EFOA 1I1SA 4ESBA 4C3HJ 2CQQA 3LSHA 1U78A 1R36A 4ZYAA 2Z99A 1PP8F 1J0RA 4IOCF 3KEOA 1O3TA 4RAFA 3CP2A 4MIMA 4XQFA 5EEHA 4V19K 2AXLA 5IYBJ 2CUJA 4LG0A 5TISC 3DV8A 3P9CA 2LVSA 4XL9A 2R7VA 2Z2SB 4F3QA 3BG6A 2HR3A 3WTWC 1ZLJA 1DP3A 1EH8A 3S2DJ 2EFNA 5J1RA 4LLLA 3H9JA 3ERED 2A68F 3I54A 4WXCA 2VN2A 2XAQA 5CJ9A 4XSZF 1V4RA 1WJAA 3CCVI 2L54A 1TZLA 1WJEA 1DQUA 2XAHA 5M5XJ 1F9NA 3FXRA 1IV6A 3K69A 3DPUA 2XPVA 2OQGA 3BG3A 3P5JA 2VL8A 1JGSA 3G4SI 2EIMH 4A3EJ 2HYFA 5J47A 4QIWN 3BPXA 3M8JA 2XAFA 4F91B 2QYOA 9ANTA 1FIPA 4HYEA 2VKHA 4L9TA 2HDCA 4EJVA 3SZGA 4L9NA 3IL2A 1FTZA 3WTUC 5HS9A 2J5PA 5GTHC 4BHPA 2BW3B 2ETHA 5JHFA 5E18F 3GZNB 3ML6A 2JPBA 2QM3A 1A31A 3A03A 2E71A 2HNHA 4Y52J 4FT8A 1K7AA 2EILH 5F0FA 3UNGC 5J8CA 3DBRB 2VE8A 4S05A 2V4JC 4LLNA 1FX7A 1W4MA 4UXNA 1CF7B 2E35A 1JKOC 1Z9CA 3AG3H 3HGYA 3BQZA 3KYCB 2VXZA 4IRIA 2H94A 2HYJA 1JTYA 1JTXA 1LFPA 1OFCX 2MC3A 1Y56A 5LGUA 3H5NA 3ZXSA 3E1SA 4C30A 3HPGA 2WY8Q 3ZN1A 1D8JA 1UB9A 2V1UA 1ETXA 2VJ5A 4IVNA 2VOOA 3E6BA 2L9VA 3FMQA 3OYDA 2V1NA 2FOWA 1KU2A 1P7IA 4BXFA 4D7NA 4YFKF 2YX4A 4YG2F 1O7FA 3I0TA 2GIVA 5K5OA 4OIPF 1I39A 3LFUA 3AL0B 2VB6A 2CUEA 4HF2A 1W5TA 2JSCA 3P9KA 1MJAA 5JVGF 1BA5A 2BY2A 2DMQA 4G6TB 2HOEA 4M9SA 5D8KB 4IKFA 4BU2A 2R93J 1I6XA 2X51A 3I59B 1NG7A 3OYFA 3F21A 2HKOA 3R0JA 4NBQA 1MGTA 1ETWA 2OD5A 3DTIA 5JVTA 2UZKA 4HF1A 4ZZLA 3GTPJ 3HG9A 4KNYA 1SC7A 2AQEA 3T1BA 1QU3A 2K9SA 3I5UA 3F8CA 2E5ZA 3F6OA 1V5GA 2ELJA 3LMMA 2DMPA 2K02A 2NOJB 3S15J 2ECCA 3F6VA 1WSUA 2D5VA 1SMYF 1VQ8I 4PJ0C 4QSHA 4NHJA 1OPCA 2PFBA 4A3BJ 4E70A 3Q0VA 3GVAA 1YJWI 3UR3C 1WJFA 2GQQA 3ZMZA 2HQ5A 5D5UB 5IYDJ 4I09A 5M5WJ 3PQKA 3M7GA 3D5SC 3CO7C 5DM7F 2DAOA 2MABA 4F7ZA 2RAEA 4A3GJ 1ZGWA 2VJIA 1BM9A 6PAXA 3ZMUA 4ZZDA 3EUKL 4OAZA 5M3MJ 2P4WA 1UHWA 1GDTA 5ILSA 1FP2A 1Y1VJ 2W1OA 2CFXA 1EV7A 2NRAC 1MW7A 4HDUA 3RTRA 1E2XA 2FA5A 4RB0A 3S16J 3DWLE 1W7PA 1F4KA 1HSJA 1A35A 2JVHA 3EPZA 2Z33A 2DT5A 3HEFA 4E7IA 1E3HA 2K3FA 4LB5A 5B66C 1P6RA 4IQ4A 3K6GA 4NQWB 1AA7A 2W85A 3HC7A 4EM1A 4YIRX 3GMEA 5F64A 1PUEE 2KPMA 1A6IA 2KZVA 1NTCA 2FBKA 5FKLA 4CGZA 4WK8F 1BN5A 4WF2A 5B3SH 3JW4A 4CH7A 4C3IJ 1RR7A 1X1BA 4PJMA 2JN6A 1B72B 3OYKA 1IF1A 4F52A 3MEXA 2ZFWA 3G6EI 4P1WA 4BE1A 2IGNA 4U0WA 3TP3A 3PSFA 3PQJA 3JRFA 1ZQ3P 1KYZA 2PEXA 3G71I 1LE8A 1BBYA 1MBHA 1Y6IA 3DPTA 1ZR2A 2W24A 4AD9A 3H3UA 3FBNB 4WXHA 3VYTB 1X2MA 4U7BA 2IA0A 2P81A 1VF9A 5L3BA 3PIOF 1B4AA 4A0YA 3ABUA 4EJTA 5E1ZB 3WGIA 1BI1A 5H6RA 2QF7A 2PJRA 2IGOA 3O6BB 3VYUB 3I55I 1TWCJ 3S1QJ 1QHHD 1UG0A 1RESA 4U0VA 1CF7A 2DXIA 2OU2A 3C1DA 4B8XA 4I76A 2E36A 3LSPA 4XKVA 4IOAF 1BR4A 1XPXA 2I10A 2ZCWA 1QZZA 4M6XA 4JX6A 2X4HA 4P96A 2OZUA 2IP2A 3GTOJ 3BJAA 2K86A 2ELKA 2HGCA 3DKXA 3LA3A 2XKOA 2HOTA 1VQOI 4MEYF 3KE2A 4YIIA 3GCMA 2ACJA 4XN0A 2A05A 4PZJA 4HBLA 1MNDA 3K2AA 4HF0A 3ZCOA 4DIQA 2H6BA 1K83J 1T33A 5KHDA 2ZO4A 1SAXA 1X4PA 1Q1VA 4EJWA 4RAGA 3PUBA 3HGGA 4XN3A 1MMDA 1UZCA 4RLFA 3HYIA 2EINH 2JSPA 2KJBA 1Q1HA 4Y17A 4E7HA 1I3QJ 4UUSB 2X1DA 1IV8A 3QYFA 5B1AH 2DFEA 5H6QA 2XIGA 2RNJA 3BP8A 4BNCA 2FOKA 4MHGA 3RQIA 4KICA 4R79A 3DXJF 3R0AA 4XLAA 2XPUA 4A3FJ 3L7WA 2DDAA 2FX0A 1IDZA 3NQOA 2D2WA 1K61A 3PNTA 2M87A 3KEQA 3BY6A 3H0GJ 2XRLA 1UFMA 3S14J 1YJ9I 1XD7A 4L5JA 4GRIA 1IW7F 1QNTA 1TP4A 5HS7A 3OR1C 3L2RA 2DA7A 3SFIA 3SQNA 3TDZC 5ICGA 3JRGA 2X6WA 5CVVA 4RB3C 1YLFA 4UHTA 3JRCA 4IHTA 3T0YA 4DYRA 1FLIA 3BDDA 1O3SA 1ZELA 1P92A 2CW8A 2XPWA 4X6AJ 3PL8A 5IOYA 1IUYA 4KISA 1AWCA 3DTEA 4RBOA 2R4GA 1Z21A 2OQRA 5EYRA 2F4IA 3IAS2 2XASA 4M73A 3LA2A 3K70C 3OYHA 1MDMA 1OCOH 1LQ1A 1B8IB 3FMRA 2LD5A 1UHMA 1UELB 4M72A 3A01B 5J1YA 3AFHA 2M8EA 3FK6A 2CQKA 4XICA 2Y2ZA 1MBFA 2Y31A 2R7ZJ 1JUSA 5CVIA 4JQFA 2R7FA 3DFGA 2H09A 1E17A 1LEAA 3C2GA 3F8FA 1BJAA 1F5TA 2Z1DA 1HW2A 4BJTA 1D0YA 1ON2A 4OWRB 4ENJA 2VASA 1RRJA 1VNDA 2HVSA 4D9JA 2KQRA 4R1HA 3CCJI 1N78A 1DGWY 4RAYA 3GUDA 1ZRDA 1G8XA 1YE9A 4LIVA 3BROA 1BOAA 3GLXA 5CKTA 2NVUB 1LE8B 4ZC3A 3WHCA 2V7FA 1OR7A 3IP4B 2KHMA 3IRRA 2E1OA 3OYEA 1EJ9A 5FD6A 3RKWA 1SVOA 3H9QA 5D8LB 2R5YB 3PNVA 3LFKA 3QP6A 2HQAA 3WE2A 5ILVA 2M4GA 2LC2A 2P7CB 3VPRA 2EZLA 3B6CA 3OIPA 1IN8A 5H2FC 3F23A 3A02A 4ZYGA 1TBXA 1EF4A 3DBLB 4PFOA 1X19A 1XG1A 3FM5A 1YIJI 1R1VA 4W1UA 1IRGA 5HOOA 3OYAA 3DU6A 3RZDJ 2VBYA 2YUSA 3FX3A 3OS2A 1MSFC 2E34A 4K2EA 1LVAA 2GLOA 4LLGF 4ABZA 2DA5A 1USSA 1K6YA 1W5CC 1O3QA 1HKQA 4BQAA 2QBYB 1MBKA 2IGMA 2XGCA 2W7NA 1IC8A 4ITVA 2YR2A 4D5CA 2IVMA 2ISZA 2RREA 2LTPA 2X6YA 3FXOA 2IBDA 3HB9A 4CUGA 1VFCA 2A07F 4FISA 1WKMA 4H4KC 1ITYA 3REOA 5FRMA 4BAYA 3FWEA 3HUGB 4D1QA 2QKMB 4A69C 2R7DA 4RLQA 1XS9A 3I4PA 2LMDA 2XB0X 3G3ZA 1H0MA 1K79A 5HLGA 3BG9A 2KIUA 1Z7LA 2HDDA 2FMYA 2G9WA 1MMSA 1IRZA 2Y0SA 1NHAA 2DFHA 3FK7A 2FSWA 3S3MA 1O7LA 1B9MA 1J9IA 4QTRA 2IJLA 1W36C 1U8RA 1O57A 2IEKA 3BTJA 5F0CA 4JYKA 2GOMA 2EQRA 2VJJA 2X9DA 1Y8RB 3PFIA 2HZDA 3E6MA 4NDLA 2M8GX 3JSPA 4S04A 3S3NA 2EFWA 1UJ8A 3TMOA 4B47A 5HS8A 3F72A 1R23A 2WB1N 3LWFA 2EZKA 1U0JA 4LOCA 4KIFA 2CQNA 3RJPA 3VODA 2JTVA 4XM3A 1XGSA 5E17F 4AVPA 3DEEA 5FO5A 1ETKA 1KQ9A 1U5TB 2DQLA 2WAQN 4N0BA 1BW6A 1FMVA 2IGKA 2W4SA 4CZZA 1AU7A 1UMQA 5F27A 2GZWA 1OCZH 1WJDA 2JRTA 5KAFC 2VPLA 3OYMA 1R1UA 2P5VA 2JWTA 2N8GA 3KZYA 1WI3A 2WB1A 1ZTRA 1U3EM 4UUTA 4L5EA 2Y9ZA 1ZK8A 5FLVA 5E3LA 3WTSC 4XKWA 4NC6A 5L3CA 2RVCA 3A01A 2BOLA 2QZ8A 3M9AA 2ZFUA 4BDZA 2EIJH 5CQGA 4JX5A 1G3TA 3CCEI 2V6EA 1JKPC 1FSHA 2J5OA 3P7NA 4Y15A 4DGWB 4OIQF 4BXXJ 2EZHA 1VQ4I 1A5JA 3HTUA 3GFMA 3BR1A 4UVCA 5F1JA 4A2UA 2BXYA 2DTRA 4IX7A 2L5QA 5JI6A 1RKTA 2WBMA 4XMYA 1WVRA 3Q5FA 1XGNA 4FX0A 3J7ZI 2YX7A 1VQNI 1HW5A 2XVCA 1MBJA 1LDDA 3KCCA 4X1EA 2Z3YA 1WHUA 4OOIA 3CCYA 1PUFA 2HQRA 1D5YA 1N25A 2EH3A 3E7LA 4AIKA 3BTIA 2L9NA 3EQLF 3FXUA 4XR6A 2M7AA 4PJLA 2RQPA 3V8KA 3VSKA 3WU1B 3TBIA 2JA5J 3CJTB 5J6XA 3SXYA 2R3SA 4MNUA 4BJ5C 3BJ6A 1O4XA 5C3EJ 1DU6A 3M8FA 3E6CC 1UHSA 2E2IJ 4BEHB 2ZSIB 3CZ6A 3GTKJ 1MH3A 3HRUA 3PIPF 2WAQA 4RA2A 5ICFA 2IS2A 2CYYA 2Y0MA 2QENA 2QCOA 1GXPA 2V79A 3BR5A 4OIRF 4AC0A 2CG4A 4MGRA 4QLCU 5JFRA 1RNLA 3CESA 4E7KA 2O0YA 3TO6A 3PM1A 4XLNF 3ZPLA 3JRAA 2BE5F 3FZVA 3QPLA 2PN6A 3K4LA 1I50J 3E0JB 1GVDA 2DYSH 2DOEA 2K9MA 1DP7P 4HSTA 5DYMA 3L9FA 3N05A 3CMAI 2HOAA 3QOPA 4HNUA 2L9SA 5FFZA 4M3BA 2GBYA 4BY7J 1R1TA 2HXIA 1IN4A 2ISYA 4Q5SF 1VI0A 2V1XA 1R49A 3FMSA 2ZXJA 3ZQIA 2XV4S 3SEQA 1QPIA 5A2QK 5F6FA 2UXXA 2DU9A 5LRRA 3SZTA 1SFUA 1S9HA 2PG4A 3LSJA 1TLHB 1MNEA 2JZYA 1Y8QB 4A3KJ 2ESNA 4IHYA 2LK2A 3NWSA 1PJRA 4RGXA 2XAGA 2EFQA 3E3VA 3ABTA 2CQ7A 2VQLA 3L2WA 2V1DA 2VONA 2E7XA 5D6EA 2XGDA 4ZYDA 2OCEA 3E6DA 1AKHA 3BTCA 1BOBA 2DOFA 3ZQGA 3FXQA 5IOZA 4YFXF 2LP0A 1H9GA 2PMHA 1B1BA 3ECOA 5LGTA 4WCGA 3M4OJ 2XSJC 5E8GA 2EA2A 1ZGAA 3ABKH 2CU7A 2JQ7A 4YRVA 3HJEA 4MFDA 4AU7A 2QKLB 3HKZN 4B09A 4J19A 2DFFA 3CUQB 1MZBA 3JSOA 2V26A 2D1HA 1RUOA 3JREA 2LY2A 4M6VA 2BHYA 1BC7C 4A93J 5J4VA 3KP4A 1VQLI 2DTZA 4GO1A 3H3VK 2V9KA 4C2TA 3CJNA 3WTZA 2KL4A 4L9VA 1MMNA 1JT6A 3SYTA 4IQJA 4MO7A 2HVRA 2MG4A 2L7KA 4X0GA 1Z7UA 4F93B 2ME0A 1V55H 5M5YJ 4XK4A 1O3RA 1YQAA 1XSXA 1V5FA 2V9VA 1J09A 2UUZA 4IF4A 1LEBA 5IT9Z 1CQTA 3HOUJ 1OQYA 4PCQA 4JOMA 2OBPA 5DTDA 3CCSI 3C3WA 4BQNA 1FYLA 2B7EA 2RGVA 4IEJA 1GV2A 1WRJA 1X2NA 3S32A 3SZPA 2CWEA 2A5WA 2BW3A 2ZMEA 2PJPA 4I0BA 4MFEA 4BE0A 1SFKA 3CO6C 3IV5A 3CMEI 3ABMH 4DW6A 4KFCA 2VKDA 5EZGA 5HVQC 5L3EA 1T98A 2ZSHB 1QZYA 2LG4A 3CLOA 3WG9A 2L01A 4N4OB 4E6KG 1MMAA 2MD0A 3WG7H 1A6QA 1RPWA 1XDSA 1QHGA 2DQRA 1ZARA 3C7JA 3FM3A 1QQIA 5JLXA 3CUQC 1RUNA 2EFPA 4Q48A 2OPTA 1WJCA 4KUMA 2LKSA 1W5SA 3VOEA 2O7OA 2A3SA 2V6CA 4AUXA 3EYYA 3VYSB 2K40A 2LY1A 4Y13A 3S3OA 3IRQA 2VKEA 1T39A 2M0CA 4CCNA 1Z05A 5CPRB 1WQ2A 1FOXA 3V4GA 1Z77A 1LDJA 4CYCA 3D5RC 1B6AA 1P4XA 4YFNF 4KN4X 3DP7A 2ZNYA 1YS6A 1Y1WJ 2QQBA 3T5XA 4FTHA 2W57A 1J59A 1WI9A 4XLCA 2M7BA 2R0QC 3L09A 4XLPF 2RDPA 1TTYA 3I59A 3LSGA 2X1CA 1RIOH 4YELA 2OTLI 4ZTFA 1J75A 3CP8A 2E1MB 2DJIA 1OR7C 2WC2A 4Z2YA 5DS9A 4N9HA 1JKQC 3CQZJ 5F08A 2DA4A 1IRXA 4JX4A 4KT5C 2Y48A 2K9NA 5M3FJ 1TQMA 3ELKA 1RKWA 4KMFA 2IW5A 3D5LA 2E1CA 5EDNA 2FBIA 2G7HA 5DUIA 2FF4A 2KFDA 4A0ZA 1D1BA 2P5LC 2ZKZA 3SHFA 2B0LA 3K1NA 4QWQA 4A3LJ 1TNSA 5E3MA 3Q9SA 5CVUA 2CMPA 3O8HA 4ENKA 1ZYRF 2X6XA 3V8LA 1B59A 2C6YA 3GBGA 1I5ZA 1YHQI 2EV0A 3HRMA 5EG0B 3KLNA 4RM3A 2IPQX 2EPFA 1SANA 2HVQA 2NVQJ 1YFHA 3RSNA 1JJ8C 5BNGA 3O8GA 1S6LA 2XGEA 3ZMSA 1LFBA 5K1YA 3T8TA 2K9QA 3L2VA 5J3LA 5FGMA 5BPIA 1ZG1A 2BHZA 3AG4H 4LFUA 1IN6A 5E8IA 2Z5UA 4ETSA 3A1YA 3TQNA 2RQQA 2PMZA 1MJ9A 3JR9A 1BR2A 1STZA 1ORKA 5FKOA 3S8PA 3V7RA 4I02A 3MZ8A 5HLTA 2VOPA 4NQWA 3DBHB 4Y3OA 2EB7A 1U5TC 1R5ID 3K1MA 1POGA 3FBIB 3CC2I 2O3FA 1OISA 2W00A 2IXSA 2BZTA 4D7MA 1B72A 2JRMA 2ECBA 2ID6A 2F4MB 3HRSA 2DA3A 2FXAA 4XNFA 5IT3A 4UY8I 1IXRC 1YOVB 1BIAA 4QPOA 3ZQFA 3CCUI 1TWAJ 3F9KA 3DKYA 3LL7A 1QA6A 4HG2A 2LREA 3ZQCA 2ZMEB 4U87A 1ZG5A 1IN5A 1X3ZB 4PSWA 4AM3A 2VBZA 5K7HA 2CUZA 3ZQQA 3OR2C 1ZLKA 4DZPA 1JJ6C 1OLTA 3G1LA 3NARA 3ZR8X 4AYBN 2MGQA 3JAMZ 2KDZA 4EVIA 2XC7A 4LGWA 2L2OA 2P6SA 1JI8A 2BBYA 3M1CA 1P4AA 2VQHA 2IS4A 3CF5F 1XB4A 4FCYA 2XAUA 4UV8A 3WTXC 3IH4A 5FRNA 1SFOJ 1H8AC 4XLHA 4OMZA 3W3CA 2EV6A 4EGYA 2L7MP 2VJ4A 3L2CA 1SVLA 2VIXA 5B1BH 2LNBA 2OV7A 3CF2A 4A3CJ 2Q1ZB 4G12A 4HV6A 5GADJ 3K0LA 4HPQA 3L1PA 4BDYA 2TDXA 2KISA 4RMNA 2TCTA 5H20A 1Z6TA 2F6CA 1ZAOA 2CV1A 1G2HA 5GAHJ 2BVMA 3LNQA 1XMXA 4BQQA 1KQ0A 2CH0A 2EIKH 2H27A 4DNCA 3ERMA 3H92A 4JBAA 1LPQA 4HQMA 1MD0A 2FD5A 4ZJZA 2R92J 3HM5A 3MKZA 4IZZA 3GFJA 1HXDA 4GCVA 5JHUA 1FYKA 2MH9A 1MJBA 3E5QA 1HSTA 3ZMVA 1R5HA 3ZQLA 3BQYA 1WWXA 2GWRA 1FWZA 3O3KA 4IO9F 3RZOJ 2Y75A 3TGNA 5K5QA 2K9LA 1XDUA 2IA2A 3G73A 1X3UA 1G6NA 2WAFA 4HSRA 3JTHA 5E79C 1SFEA 4B3AA 2W82A 4GDFA 1V3FA 3E97A 5EEAA 1LFUP 3TOBA 3QODA 2QLZA 2ZBKA 2PX9A 2MLGA 1XGMA 5LHGA 1R71A 3N4MA 4OIOF 1CGPA 3K4BA 4RAZA 3HOYJ 2JA6J 1JXSA 2K85A 1UAAA 1D5VA 1D8KA 3K4KA 4BQOA 1D1CA 4MEXF 2QQ9A 2VC0A 4ENMA 2ZJQF 3T8RA 4BYYA 2JA7J 3EETA 5FLMJ 3RPUD 4IXAA 4B44A 5EG0A 1U8BA 2W25A 3B73A 1FSEA 2LH9A 3BTLA 3QPTA 5IP7J 5LFAA 2L0KA 2CFOA 2M0MA 4LITA 5D5WB 5F1RA 1D0ZA 3QOEA 3KYLA 1HDPA 1G3WA 1ETVA 4YEJA 4BH9A 2JUCA 3DLAA 5L3GA 4I6ZA 2B9SA 2JT1A 3DU5A 1B8IA 3LSMA 1YX3A 2VPRA 3K7AJ 1D3YA 1WFXA 1Y0UA 3MWMA 3FIWA 1FNNA 3RDIA 3A0BC 4IRGA 1OCCH 1Z3YA 4RS8A 1SEUA 2O61A 1QPMA 1R4MB 2R7TA 1TWGJ 5E3OA 2OZ6A 1TWFJ 4PFPA 3EUHA 1T56A 2MW8A 3TL4X 5E3NA 1SD6A 3S17J 2L02A 4PJNA 5F0HA 3RYRA 4E7ZA 3OYJA 2NAZA 1ZGJA 2KJCA 1XCBA 2VC1A 4XOPA 2R5ZB 5ED4A 3HPHA 4KITB 4I99C 3UKGA 3TP0A 4B1RA 2P0WA 3K10A 3TO7A 3H9GA 4XRSG 4CZCA 4B43A 2DMNA 2L4MA 4CCOA 3C2HA 2CRGA 2X6OA 4W97A 1E3OC 5C4XJ 2M4KA 1Z91A 4BS9A 4I2OA 4A6DA 3RKYA 2NVTJ 2ZXIA 4AIDA 3CJRB 1YTYA 3OSFA 4CDGA 4LK0F 5ICEA 2DBBA 3SFZA 1H89C 1YX5A 4DZJA 3L00A 2JMWA 3ZP5A 3BOQA 3CCRI 2IRFG 2Y69H 4FQGA 3QQAA 4ZYEA 4HX8A 2IT0A 4A0XA 4A5MA 1GV5A 1FOWA 1PP7U 2WWYA 2O8XA 3HRTA 1QBJA 1FZPB 1LJ9A 4CICA 1JHHA 1IN7A 1LNWA 3WGGA 4CCLA 2GXAA 3GTLJ 1S7OA 3RPUA 3WU2C 3BG7A 2QQ8A 2FNAA 4HLXA 4IPAA 4PDKA 3U2RA 3QYEA 4BUPA 4HNTA 5C4JJ 4FASD 3WE3A 3K4NA 3LSRA 2F5CA 1MNMC 2ZJRF 4XIDA 5AIPA 3NAUA 4ZDPA 4EATA 4N9IA 2KLOA 3V7SA 3K1PA 1HKTA 4WX9A 4P9FA 5IYCJ 5J4YA 3LA7A 2WY7Q 3E5XA 2RN7A 1FMWA 3HUGA 4GYGA 5TJJA 3ASNH 1DPRA 3IC7A 1S7EA 1EH7A 2COBA 2R7XA 4B4CA 1FPQA 4M3EA 4AVZA 1OKRA 2HTSA 1UCRA 2LRDA 4KYWA 3CMMA 3HHHA 1FP1D 2MFZA 1LDKB 1DDNA 3W2AA 1GXQA 2DK8A 4NB5A 2IS1A 1W0TA 2NNYA 2EWNA 3D1NI 5DD4A 1IG7A 2RNGA 4KA4A 4M3FA 3KETA 1KU3A 4HX4A 2ID3A 2UV1A 4M74A 5B5EC 3SDBA 4EJOA 3OIQA 4R8HA 2VKVA 1X3WB 5HODA 2LY9A 4RB1A 2R7QA 3HKZA 1Z67A 2AQFA 3DEWA 4M3GA 4ESFA 3W6JB 2KT0A 2VXDA 1MBGA 4L0ZB 2CQXA 3S1MJ 4HDVA 2OF7A 1ETYA 1ENHA 2DCEA 2L3DA 3Q0WA 1RC9A 3BT9A 4CA0A 3LQQA 1YS7A 1X1PA 3J81K 4BHBA 3GTQJ 3PNYA 3OMYA 1H9TA 2PLYA 1YO5C 2VQCA 5GAGJ 1VQMI 2TRTA 2GXGA 2WADA 4HZFA 3X2QH 3R4KA 3BZCA 4JP0A 1QGPA 1DU0A 2KRHA 2EJRA 5BMZA 4FE4A 1IXSB 3U1DA 1X1DA 2YSRA 1HDDC 2MLKA 1WZ2A 5ILUA 2KIFA 4M71A 3JRHA 2X85A 2I5UA 4Q47A 3HZJA 4CXFA 5DV5A 4E7JA 1Z6RA 3PO2J 2L4AA 1G3SA 4IL6C 2FJ1A 1RR8C 4KT6A 2B63J 3KIOA 4UUVA 1NK3P 1RZ4A 4LK1F 1XCVA 4XRSA 3FKIJ 1UG2A 2XDVA 1BJZA 4MTDA 1ZHFA 1ZH5A 4XKBA 3JAMK 1TT5B 1FTTA 2R7SA 2HTJA 4MQVA 3R61A 3TEDA 5E1XA 1F1ZA 4ZDLA 5EJCA 1P2FA 2MYSA 4I7HA 4U7DA 1KQ8A 1FOYA 2STTA 2P6TA 3BPVA 2E2HJ 2A6HF 2LF7A 5HDKA 5IP9J 3QRFF 1VTNC 4GYIA 5LEJA 1SD5A 5LEKA 4OAYA 1R7JA 1ACIA 5KVRA 2FQ4A 2LF8A 3HOVJ 1GUUA 2Y9YA 4M9ZA 1BI0A 5D6FA 1KU9A 4EQQA 2F4OB 3W2WA 2EK5A 5CLSA 2L7FP 4BEHA 3OYCA 1FIAA 3J7AY 1W0UA 1IAWA 4UV9A 5LGNA 1AOYA 1JKRC 2KRCA 2HI3A 3AL0C 3HTSB 3FISA 3PJRA 1FY7A 3F0CA 2HZTA 2F5DA 5TRDA 3FXMA 3JTGA 2DOAA 4Z6YA 3M8EA 2FU4A 3KPHA 1WH7A 4Y33A 3ZQHA 4UB8C 4L18B 2WAEA 2FUG2 3OS1A 4A12A 1TC3C 4HA8A 4DQ2A 3WGHA 1S72I 5L3DA 3HBLA 4OINF 5JR3A 2M34A 1KGSA 1ZR4A 2CO5A 2CV2A 4HOBA 1ZG3A 4DYCA 1R9TJ 2DYRH 1I27A 2NNNA 4PK4A 4NUBA 3A4CA 5J1UA 2STWA 1TL8A 3OOUA 1KYWA 4P9UA 3IH2A 3OYGA 2RKHA 1XMAA 3CUOA 2R7WA 3GZ5A 2X1EA 3HOTA 5DD8A 2AS5F 3MMYB 3EDPA 4UVBA 3SEZA 3I53A 3H1CA 2H8RA 5GAEJ 3I71A 4L0YB 3FXJA 3MN2A 4XKCA 2EBIA 2FNPA 2HS5A 2K3PA 5LHIA 2DODA 5CVRA 4BBRJ 5EF6A 4NC7A 3PO3J 2P5KA 1AKHB 5GTIC 4G94A 1ON1A 2BGCA 3BR2A 3S93A 4BACA 2QWWA 1WJ5A 4LG0B 3G1OA 1MKMA 3HOWJ 4EM2A 2A6EF 1ERDA 1XMKA 2ADUA 1ZKGA 3AG2H 4RB2C 2ZNZA 4BGDA 3L2UA 4DBQA 4XLEA 1HBXG 1OMIA 2HWVA 3IUOA 3QAHA 3M3YJ 2CJJA 4HRIA 2LYCA 2PMUA 3QWLA 5FLXZ 3OY9A 3DPLC 3RPQA 2AHQA 4CSWA 4H0EA 2M3AA 3CUQA 4V2FA 5DM6F 3WTVC 3CDHA 2JA2A 1RI7A 3ABLH 2O03A 1NK2P 4TV7A 2LSOA 1NH3A 2GAUA 1YRNB 3BCAA 1REPC 2HQNA 1OCTC 2O9LA 4O3MA 3A2KA 1MBEA 1WPKA 3OYBA 3ZN0A 5D4RA 4P5OA 2WTEA 3Q0UA 4UNOA 2ELHA 2F5VA 4HV5A 2W84A 4AYBA 2LBFB 5J8FA 3MQ0A 1FBSA 2R7RA 2X0LA 4CCJA 1XN7A 5HDGA 3GYHX 3I64A 3CCLI 1I3AA 1H88C 3CD6I 4G8XA 3LSKA 2M30A 3CCMI 3FXKA 3QPHA 4O5VA 2GM4A 4NC8A 5CVJA 5AONA 1EA3A 3MCZA 1A04A 2JVGA 4IRHA 5IT9K 2DFIA 3QYBA 2JPCA 2KRFA 3FXLA 3FF5A 3OL3A 5FJ8J 4FX4A 4BHCA 4RDUA 2CS3A 1ZRCA 2E1NA 4BY1J 1BR1A 2DT7B 5E20A 4HNVA 4L5IA 3DQVC 4DBRA 2XAJA 1WGXA 5LLQA 3TW6A 1BI3A 1XX5A 5F04A 2V9PA 4G7ZF 5FD5A 1VQ9I 3K2ZA 4KN7X 3FHNA 3AAFA 4G7HF 4LIUA 3WTYC 1C0WA 2QVOA 4A3IJ 3HOZJ 4G9YA 2FMLA 1OCPA 5K7ZA 3RKQA 5FKKA 1L0OC 1PVEA 2RV8A 2XUBA 1G4DA 1A36A 5LRSA 2NYXA 2NXNB 3K4CA 2KIMA 3K70D 2K4BA 4F92B 1R4NB 3B02A 5HLIA 2PBIA 4PUSA 4CYCB 3NWTA 2LLKA 2G0EA 5FKMA 3H3ZA 3TO9A 3GFLA 3QU3A 1DPUA 3BC8A 3ASOH 3IHUA 5KNLA 2ICWG 3W6KB 1ZN2A 3GXOA 3ZMTA 3PUFA 1GVJA 3OYIA 3RCOA 1Y39A 1IJWC 3KP7A 2Q0OA 3BWGA 4E4HA 4ZDOA 4RGUA 1KU7A 2K4JA 5HNHA 1R5GA 2QGUA 2HXOA 4A3DJ 3JRBA 2VI6A 3GWZA 3RIRA 4G7OF 4BBSJ 2Q2EB 4V2GA 2BVLA 4AWXB 4IJAA 2CSOA 4A3JJ 3RQ4A 1W1WE 1TNTA 1XSDA 1WCMJ 2QQAA 1P4WA 3V42A 2HKXA 3KLOA 4XORA 2L7ZA 4PJJA 3J80K 2DA2A 2ZC2A 2E19A 4MQ9F 2F2EA 2M9HA 2Z16A 4XSXF 1YI2I 3ZOBA 1ODDA 4A5NA 5DDGA 3I56I 2D45A 5DCMB 4C2MJ 2HFHA 4S0HB 2DK5A 1W7PB 3IKVA 3VDXA 4E7SA 2MH2A 2HYGD 4JK1X 4KIBA 1KZHA 3ULQB 5D4SA 4P55A 1BL0A 1FBUA 4XLFA 2MD5A 3U9GA 2VQGA 2LKXA 3K4JA 2MA3A 1IO2A 2OCCH 2KZGA 4ZTJA 2LFBA 4B3XA 1HKSA 2BY0A 5DCFA 1HW1A 4EV0A 3W6VA 3G2BA 1F36A 1VZ0A 1YW7A 3GO5A 4HAMA 3JRIA 1YRNA 4EJUA 4LB6B 5LD2C 2O8KA 2ZXWH 1ZREA 2DPDA 3O2PE 3DF8A 1X4OA 3ZGKA 4Y4RA 2KMUA 2LR8A 5E1WA 2R7UA 2DI3A 2LBFA 4EMSA 4II2A 3HXLA 3KP6A 5GPAA 1TW3A 3KYDB 1G3YA 2BV6A 3Q9VA 5FB2A 3ZMDA 1D1AA 2NOGA 3LOCA 4A6EA 1S29A 2MC4A 1K4TA 2CUFA 2PJRB 3L2QA 1T38A 2XF7A 3MAJA 2EV5A 4EEFG 3COAC 1HLVA 2NS8A 2HOSA 2IAIA 3TKYA 1HOMA 2VBWA 4PGHA 4N4NB 1LKXA 1U6GA 1YJNI 2YU3A 4RM2A 4EM0B 1Z3XA 2XF5A 1JGGA 2DMTA 3BR0A 3LAJA 3KP3A 1OYIA 1LUJB 3GTMJ 3I4MJ 1T6SA 1MSEC 3CC7I 2F5FA 5KCMA 1U2WA 1VQPI 2DDBA 4QPQA 4BJ6C 3IWFA 3OS0A 5IPAA 1IDYA 1QZEA 1JHFA 3S2HJ 2XSDC 1DGRM 2HPIA 2A6TA 2NVXJ 3HIFA 4LMYA 1VQ7I 5FLXK 4UUSA 3CDIA 2PQ8A 4OU0A 5IP6A 3AG1H 4ANJA 1Z1DA 1PYVA 3K9TA 1LVKA 1J2XA 2LOOA 3H5AA 1ZRFA 2CV0A 2QEXI 3HSEA 1VQ6I 4ASNA 3IWZA 2JA8J 5ICCA 3OV8A 5GP9A 3I9V2 4RGSA 3CCQI 3LSIA 2E7WA 1BI2A 2A61A 2E5NA 3QPSA 3ONQA 2VT2A 2BEOA 1BC8C 2O5RA 1IZ1A 4C3JJ 4BE2A 1SAUA 5LBQA 3KZIC 2GA2A 1YW8A 3PFYA 4ESJA 2Q2EA 2Q8KA 2PI0A 1T08B 3LSTA 2CW7A 1HQCA 4HW0A 4Q4ZF 5EGOA 3OYLA 4KIGA 1V5EA 2IA1A 3H36A 2AO9A 1T0FC 5FROA 4DOZA 3I58A 2X48A 2YPRA 2XROA 2IS6A 1JUMA 1JT0A 1S5LC 5GPCA 4CCKA 1HC8A 4M6YA 3MVPA 5DCMA 1MDMB 1S8NA 3CTAA 4G6DA 3J7YJ 2OA4A 3WTTC 3GTJJ 2QA4I 3KEYA 3HDDA 2M5WA 1BW5A 2OJED 4D5FA 3N97A 2DT6A 2I8DA 2QSGX 1XGOA 4NNJA 3EYIA 1WJBA 1HF0A 4FE7A 2K27A 2VBXA 1FT9A 3FKJA 4I01A 1W7PD 2RC4A 3S1NJ 3MKLA 1TQIA 1AHDP 5C44J 1K78A 2ZB9A 4M3DA 3F8BA 2L9RA 4G6QA 4U0YA 1QVTA 3H35A 2NS0A 3ZRGA 1Y0NA 4DYQA 1T8IA 1MH4A 1L3LA 4MTEA 3D0SA 2DA1A 2AXTC 1OJLA 2DO7A 4CHUA 2ZMEC 2EA4A 4PGGA 4AIHA 4IHSA 3HOXJ 2ZJPF 3TDUC 1N77A 2R5ZA 1IGNA 1P9QC 2FEZA 5D5VB 5L3FA 3F22A 4CCMA 4AIJA 4UB6C 1LB2A 2R5YA 3NEUA 1P7JA 1XSVA 2M2EA 4HQEA 3VFZA 3V8JA 1N75A 1R22A 1YW9A 4XOTA 3U1KA 4IHXA 3RYPA 4E7LA 2GA1A 3OIOA 5KK1A 2HU9A 2FBHA 4J01A 2HPMA 2NS7A 1J7KA 2LKPA 1QRYA 3IAM2 1JE8A 2XHKA 3RI4A 3OWTA 4U88A 2XF6A 3KFWX 4HEA2 3S1RJ 3BZ6A 3PSIA 1E0EA 5HNFA 3HHGA 2NVYJ 4GGGA 1U9NA 3BG5A 2EZIA 3OSGA 3BCBA 2QBYA 3DTKA 2DJNA 3NRVA 1IXCA 1KONA 5IY5H 2ZJ2A 3DLLF 4UVAA 1X1CA 1D0XA 1VQKI 3ISPA 2BY1A 4HX7A 1EKEA 1TW2A 5DEQA 2QSHX 3AKZA 4FETA 3F8NA 3MKWB 3HSRA 1FEXA 2HDWA 3FHZA 3DCFA 1HCRA 3I4NJ 4ON0A 1YG2A 3SDGA 3SJMA 1T2KA 3MKYB 5JLWA 2WV1A 1K6OA 1E3PA 2H1LA 2H6CA 2VE9A 2CGPA 2GXBA 4F55A 1FBQA 1VQ5I 3HOSA 5DUKA 2ME6A 3EUAA 4O6JA 5D5XB 3W2VA 3GFIA 3ECHA 2XGXA 4D0PA 3WHBA 3J80Z 5AIQA 3TW7A 2YS9A 3ROUA 4KDPA 1XTAA 1ULYA 2DPUA 2DMUA 2F48A 3Q3SA 5ERIA 3KX2A 4I98B 3IKTA 3E5UA 4C2UA 3BZKA 3CLQA 3EUHC 5KAIC 1F43A 2OC6A 1SMTA 5BQTA 3JRDA 2FE3A 2H1KA 3KP2A 2FQ3A 3ESWB 2DW4A 2BXZA 3OL4A 2E1MC 4L9JA 4GFBA 1S7AA 2F5EA 2VT3A 4XRMA 2VUMJ 1U5TA 1I1GA 2JUGA 3F8MA 3R6SA 4WWCA 3GF2A 5HLHA 5EGOB 2KIQA 5BS6A 4C9YA 1SD4A 1YYVA 1M1EB 3CJQB 3BR6A 1FJLA 1B9NA 4II3A 5BPDA 2P7VB 1GT0C 3VB2A 1FC3A
chains in the Genus database with same CATH topology
2K9QA 5EYRA 5J3LA 2MSYA 2AHQA 1JUPA 2Y30A 1IUFA 4V2FA 1B8IB 2LD5A 1TWHJ 3A01B 5J1YA 3FK6A 1NK2P 4XICA 2Y2ZA 3JR9A 1MBFA 2Y31A 2R7ZJ 1ORKA 5FKOA 3B6AA 1YRNB 1JUSA 2O9LA 1OCTC 4MLOA 1MBEA 1WPKA 1POGA 3Q0UA 4D7MA 1WH5A 1B72A 3IH3A 2ECBA 1VNDA 2ID6A 2DA6A 1H88C 2JJ7A 2DA3A 3GTGJ 1RETA 3ZQFA 1PUFB 1TWAJ 1LE8B 2GM4A 4A3MJ 3WHCA 2E1OA 4Y7NJ 3ZQCA 2DN0A 5K7HA 2R5YB 5FJ8J 4RDUA 3VPRA 2EZLA 4DZPA 4BY1J 3B6CA 1JJ6C 3G1LA 1ETQA 4HNVA 3NARA 3A02A 2MGQA 4AYBN 2YU9J 2KDZA 1EF4A 1XG1A 1WGXA 4W1UA 3TW6A 5F04A 2JK3A 3RZDJ 2PMZN 4FCYA 1XC5A 2YUSA 3IH4A 1Z0XA 1MSFC 1SFOJ 4A3IJ 3HOZJ 1H8AC 2GLOA 4ABZA 1I6HJ 1OCPA 2DA5A 5K7ZA 3RKQA 2L7MP 5EZHA 5FKKA 1ETOA 4A3CJ 1MBKA 4G12A 2XGCA 1IC8A 4D5CA 3L1PA 3M3YJ 2LTPA 2IBDA 3HB9A 2TCTA 4CYCB 2LLKA 1VFCA 2G0EA 5FKMA 4FISA 1G2HA 3LNQA 1ITYA 4IHWA 3CMYA 4BKXA 4A69C 2FD5A 1XS9A 1IJWC 2R92J 3HM5A 3BR3A 5K7FA 2XB0X 2E2JJ 2XB5A 3BG9A 2HDDA 2HXOA 5FKNA 4A3DJ 3JRBA 2VI6A 1X58A 1IRZA 3ZQLA 2W48A 4BBSJ 3BQYA 3FK7A 3CDLA 3RZOJ 4V2GA 4QTRA 3C2BA 1APLC 4A3JJ 2IEKA 3BTJA 4B3AA 1U9OA 2Y0SN 3G1MA 5F0CA 1WCMJ 4JYKA 2EQRA 2X9DA 5EEAA 4IHVA 1LFUP 1QVUA 2L7ZA 4NDLA 2DA2A 2M8GX 4C3HJ 2E19A 2CQQA 1U78A 2M9HA 3HOYJ 2JA6J 2WB1N 4LOCA 2EZKA 4MIMA 3ZOBA 1ETKA 4C2MJ 5IYBJ 2WAQN 4S0HB 2JA7J 1BW6A 2LVSA 5FLMJ 5EG0A 1U8BA 1AU7A 1UMQA 5F27A 3BTLA 5IP7J 2L0KA 1BL0A 3S2DJ 5J1RA 2JWTA 2N8GA 1HDPA 1WI3A 1ETVA 4I6ZA 2LKXA 1ZTRA 4UUTA 4L5EA 2Y9ZA 1ZK8A 5FLVA 5E3LA 2LFBA 1B8IA 1IV6A 5M5XJ 2VPRA 3W6VA 3A01A 2XPVA 3K7AJ 3BG3A 3FIWA 1F36A 4JX5A 3JRIA 1YRNA 1TWGJ 5E3OA 1JKPC 1TWFJ 4A3EJ 1T56A 2O8KA 4QIWN 2MW8A 5E3NA 4BXXJ 3S17J 9ANTA 2EZHA 1A5JA 5F0HA 1FIPA 2LR8A 3BR1A 5F1JA 1FTZA 5GPAA 2R5ZB 1RKTA 3UKGA 3TP0A 4B1RA 2NOGA 1MBJA 3LOCA 3A03A 2CUFA 4XRSG 4Y52J 2DMNA 5F0FA 4X1EA 2CRGA 2X6OA 4W97A 4EEFG 1HLVA 1E3OC 5C4XJ 2NS8A 3CCYA 1PUFA 2HOSA 2IAIA 1D5YA 2EH3A 3E7LA 1HOMA 2NVTJ 1JKOC 3BTIA 3HGYA 3OSFA 2JA5J 3BQZA 1H89C 2HYJA 4DZJA 1JTYA 2JMWA 1JTXA 1OFCX 1JGGA 1DU6A 1O4XA 5C3EJ 3QQAA 2DMTA 3BR0A 1UHSA 2E2IJ 3GTMJ 1ETXA 3GTKJ 1MH3A 3I4MJ 1MSEC 1GV5A 1P7IA 2QCOA 4D7NA 3BR5A 4AC0A 1IDYA 5IPAA 3GTLJ 2CUEA 3S2HJ 1BA5A 2DMQA 2XSDC 2NVXJ 3PM1A 5C4JJ 3JRAA 3QPLA 2R93J 3LSRA 4UUSA 1I50J 1MNMC 4XIDA 1GVDA 3NAUA 5IP6A 1ETWA 2HOAA 5IYCJ 4M3BA 3GTPJ 2GBYA 4BY7J 2K9SA 2HXIA 1S7EA 1VI0A 2COBA 2JA8J 4B4CA 2DMPA 4M3EA 3ZQIA 5GP9A 3S15J 1QPIA 2ECCA 2D5VA 3LSJA 3QPSA 4QSHA 4C3JJ 1W0TA 4A3KJ 4IHYA 4A3BJ 2LK2A 3Q0VA 3D1NI 1IG7A 5IYDJ 2HQ5A 5M5WJ 4M3FA 2XGDA 1AKHA 3BTCA 2ID3A 3ZQGA 5EGOA 5IOZA 2LP0A 2RAEA 4A3GJ 1ZGWA 2AO9A 2VKVA 5M3MJ 5HODA 3M4OJ 2LY9A 1GDTA 3DEWA 4M3GA 2X48A 1Y1VJ 2KT0A 1MBGA 2CQXA 3S1MJ 1JUMA 1JT0A 2CU7A 5GPCA 2OF7A 3MVPA 1ETYA 4MFDA 4J19A 3HKZN 1ENHA 3S16J 3Q0WA 3BT9A 3JREA 4M6VA 3GTJJ 3HEFA 4A93J 3HDDA 3GTQJ 1BW5A 2DTZA 3H3VK 2TRTA 4D5FA 1HF0A 4JP0A 4FE7A 1JT6A 1DU0A 4FE4A 4MO7A 2MG4A 3S1NJ 1HDDC 3MKLA 1AHDP 1A6IA 1NTCA 5FKLA 2ME0A 5C44J 2ZB9A 4M3DA 5M5YJ 3JRHA 2L9RA 4C3IJ 1RR7A 1B72B 1QVTA 2JN6A 4XK4A 3PO2J 2FJ1A 4DYQA 2B63J 1MH4A 1CQTA 3HOUJ 2DA1A 1NK3P 4XRSA 1OJLA 5DTDA 3TP3A 3JRFA 1ZQ3P 3FKIJ 1UG2A 3HOXJ 4IEJA 1BJZA 1LE8A 1MBHA 1GV2A 1X2NA 1ZR2A 2R5ZA 1IGNA 1X2MA 2P81A 1VF9A 1FTTA 3TEDA 4MFEA 2R5YA 3IV5A 1P7JA 2M2EA 4DW6A 5EZGA 2E2HJ 2QF7A 5IP9J 4IHXA 1TWCJ 3S1QJ 1RESA 1RPWA 3OIOA 2FQ4A 2NS7A 3HOVJ 1GUUA 2Y9YA 4I76A 5JLXA 3LSPA 1QRYA 2I10A 2OPTA 4JX6A 3S1RJ 2L7FP 2O7OA 1FIAA 4AUXA 1W0UA 2NVYJ 1U9NA 2K40A 2EZIA 3BG5A 3OSGA 3GTOJ 2ELKA 2VKEA 2M0CA 1JKRC 2HI3A 2HOTA 1Z77A 2DJNA 3FISA 3K2AA 4CYCA 1K83J 1T33A 3F0CA 1Q1VA 3HGGA 1Y1WJ 4FTHA 1FEXA 1WH7A 2R0QC 3I4NJ 1I3QJ 3DCFA 3ZQHA 4UUSB 1HCRA 3LSGA 3SDGA 1TC3C 3SJMA 5JLWA 2WV1A 3HBLA 2M34A 3RQIA 2ME6A 1ZR4A 4DYCA 1R9TJ 5DS9A 3WHBA 1JKQC 3TW7A 2YS9A 5J1UA 5F08A 3CQZJ 2XPUA 3OOUA 3IH2A 2DA4A 2FX0A 4JX4A 4A3FJ 1IDZA 2K9NA 1K61A 2DMUA 5M3FJ 1RKWA 3H0GJ 3Q3SA 2XRLA 5EDNA 3S14J 2H8RA 1F43A 3JRDA 3MN2A 2H1KA 2EBIA 2DA7A 3SFIA 4BBRJ 5EF6A 4GFBA 3JRGA 3PO3J 4XRMA 2VUMJ 4A3LJ 5E3MA 1AKHB 3JRCA 3BR2A 3O8HA 4DYRA 5EGOB 3G1OA 3GBGA 3HOWJ 5EG0B 1ZKGA 1SANA 2XPWA 3BR6A 4X6AJ 1FJLA 5IOYA 2NVQJ 1JJ8C 5BNGA 4RBOA 3O8GA 2CJJA 2XGEA 1GT0C 1LFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9Q A;  5EYR A;  5J3L A;  2MSY A;  2AHQ A;  1JUP A;  2Y30 A;  1IUF A;  4V2F A;  1B8I B;  2LD5 A;  1TWH J;  3A01 B;  5J1Y A;  3FK6 A;  1NK2 P;  4XIC A;  2Y2Z A;  3JR9 A;  1MBF A;  2Y31 A;  2R7Z J;  1ORK A;  5FKO A;  3B6A A;  1YRN B;  1JUS A;  2O9L A;  1OCT C;  4MLO A;  1MBE A;  1WPK A;  1POG A;  3Q0U A;  4D7M A;  1WH5 A;  1B72 A;  3IH3 A;  2ECB A;  1VND A;  2ID6 A;  2DA6 A;  1H88 C;  2JJ7 A;  2DA3 A;  3GTG J;  1RET A;  3ZQF A;  1PUF B;  1TWA J;  1LE8 B;  2GM4 A;  4A3M J;  3WHC A;  2E1O A;  4Y7N J;  3ZQC A;  2DN0 A;  5K7H A;  2R5Y B;  5FJ8 J;  4RDU A;  3VPR A;  2EZL A;  4DZP A;  4BY1 J;  3B6C A;  1JJ6 C;  3G1L A;  1ETQ A;  4HNV A;  3NAR A;  3A02 A;  2MGQ A;  4AYB N;  2YU9 J;  2KDZ A;  1EF4 A;  1XG1 A;  1WGX A;  4W1U A;  3TW6 A;  5F04 A;  2JK3 A;  3RZD J;  2PMZ N;  4FCY A;  1XC5 A;  2YUS A;  3IH4 A;  1Z0X A;  1MSF C;  1SFO J;  4A3I J;  3HOZ J;  1H8A C;  2GLO A;  4ABZ A;  1I6H J;  1OCP A;  2DA5 A;  5K7Z A;  3RKQ A;  2L7M P;  5EZH A;  5FKK A;  1ETO A;  4A3C J;  1MBK A;  4G12 A;  2XGC A;  1IC8 A;  4D5C A;  3L1P A;  3M3Y J;  2LTP A;  2IBD A;  3HB9 A;  2TCT A;  4CYC B;  2LLK A;  1VFC A;  2G0E A;  5FKM A;  4FIS A;  1G2H A;  3LNQ A;  1ITY A;  4IHW A;  3CMY A;  4BKX A;  4A69 C;  2FD5 A;  1XS9 A;  1IJW C;  2R92 J;  3HM5 A;  3BR3 A;  5K7F A;  2XB0 X;  2E2J J;  2XB5 A;  3BG9 A;  2HDD A;  2HXO A;  5FKN A;  4A3D J;  3JRB A;  2VI6 A;  1X58 A;  1IRZ A;  3ZQL A;  2W48 A;  4BBS J;  3BQY A;  3FK7 A;  3CDL A;  3RZO J;  4V2G A;  4QTR A;  3C2B A;  1APL C;  4A3J J;  2IEK A;  3BTJ A;  4B3A A;  1U9O A;  2Y0S N;  3G1M A;  5F0C A;  1WCM J;  4JYK A;  2EQR A;  2X9D A;  5EEA A;  4IHV A;  1LFU P;  1QVU A;  2L7Z A;  4NDL A;  2DA2 A;  2M8G X;  4C3H J;  2E19 A;  2CQQ A;  1U78 A;  2M9H A;  3HOY J;  2JA6 J;  2WB1 N;  4LOC A;  2EZK A;  4MIM A;  3ZOB A;  1ETK A;  4C2M J;  5IYB J;  2WAQ N;  4S0H B;  2JA7 J;  1BW6 A;  2LVS A;  5FLM J;  5EG0 A;  1U8B A;  1AU7 A;  1UMQ A;  5F27 A;  3BTL A;  5IP7 J;  2L0K A;  1BL0 A;  3S2D J;  5J1R A;  2JWT A;  2N8G A;  1HDP A;  1WI3 A;  1ETV A;  4I6Z A;  2LKX A;  1ZTR A;  4UUT A;  4L5E A;  2Y9Z A;  1ZK8 A;  5FLV A;  5E3L A;  2LFB A;  1B8I A;  1IV6 A;  5M5X J;  2VPR A;  3W6V A;  3A01 A;  2XPV A;  3K7A J;  3BG3 A;  3FIW A;  1F36 A;  4JX5 A;  3JRI A;  1YRN A;  1TWG J;  5E3O A;  1JKP C;  1TWF J;  4A3E J;  1T56 A;  2O8K A;  4QIW N;  2MW8 A;  5E3N A;  4BXX J;  3S17 J;  9ANT A;  2EZH A;  1A5J A;  5F0H A;  1FIP A;  2LR8 A;  3BR1 A;  5F1J A;  1FTZ A;  5GPA A;  2R5Z B;  1RKT A;  3UKG A;  3TP0 A;  4B1R A;  2NOG A;  1MBJ A;  3LOC A;  3A03 A;  2CUF A;  4XRS G;  4Y52 J;  2DMN A;  5F0F A;  4X1E A;  2CRG A;  2X6O A;  4W97 A;  4EEF G;  1HLV A;  1E3O C;  5C4X J;  2NS8 A;  3CCY A;  1PUF A;  2HOS A;  2IAI A;  1D5Y A;  2EH3 A;  3E7L A;  1HOM A;  2NVT J;  1JKO C;  3BTI A;  3HGY A;  3OSF A;  2JA5 J;  3BQZ A;  1H89 C;  2HYJ A;  4DZJ A;  1JTY A;  2JMW A;  1JTX A;  1OFC X;  1JGG A;  1DU6 A;  1O4X A;  5C3E J;  3QQA A;  2DMT A;  3BR0 A;  1UHS A;  2E2I J;  3GTM J;  1ETX A;  3GTK J;  1MH3 A;  3I4M J;  1MSE C;  1GV5 A;  1P7I A;  2QCO A;  4D7N A;  3BR5 A;  4AC0 A;  1IDY A;  5IPA A;  3GTL J;  2CUE A;  3S2H J;  1BA5 A;  2DMQ A;  2XSD C;  2NVX J;  3PM1 A;  5C4J J;  3JRA A;  3QPL A;  2R93 J;  3LSR A;  4UUS A;  1I50 J;  1MNM C;  4XID A;  1GVD A;  3NAU A;  5IP6 A;  1ETW A;  2HOA A;  5IYC J;  4M3B A;  3GTP J;  2GBY A;  4BY7 J;  2K9S A;  2HXI A;  1S7E A;  1VI0 A;  2COB A;  2JA8 J;  4B4C A;  2DMP A;  4M3E A;  3ZQI A;  5GP9 A;  3S15 J;  1QPI A;  2ECC A;  2D5V A;  3LSJ A;  3QPS A;  4QSH A;  4C3J J;  1W0T A;  4A3K J;  4IHY A;  4A3B J;  2LK2 A;  3Q0V A;  3D1N I;  1IG7 A;  5IYD J;  2HQ5 A;  5M5W J;  4M3F A;  2XGD A;  1AKH A;  3BTC A;  2ID3 A;  3ZQG A;  5EGO A;  5IOZ A;  2LP0 A;  2RAE A;  4A3G J;  1ZGW A;  2AO9 A;  2VKV A;  5M3M J;  5HOD A;  3M4O J;  2LY9 A;  1GDT A;  3DEW A;  4M3G A;  2X48 A;  1Y1V J;  2KT0 A;  1MBG A;  2CQX A;  3S1M J;  1JUM A;  1JT0 A;  2CU7 A;  5GPC A;  2OF7 A;  3MVP A;  1ETY A;  4MFD A;  4J19 A;  3HKZ N;  1ENH A;  3S16 J;  3Q0W A;  3BT9 A;  3JRE A;  4M6V A;  3GTJ J;  3HEF A;  4A93 J;  3HDD A;  3GTQ J;  1BW5 A;  2DTZ A;  3H3V K;  2TRT A;  4D5F A;  1HF0 A;  4JP0 A;  4FE7 A;  1JT6 A;  1DU0 A;  4FE4 A;  4MO7 A;  2MG4 A;  3S1N J;  1HDD C;  3MKL A;  1AHD P;  1A6I A;  1NTC A;  5FKL A;  2ME0 A;  5C44 J;  2ZB9 A;  4M3D A;  5M5Y J;  3JRH A;  2L9R A;  4C3I J;  1RR7 A;  1B72 B;  1QVT A;  2JN6 A;  4XK4 A;  3PO2 J;  2FJ1 A;  4DYQ A;  2B63 J;  1MH4 A;  1CQT A;  3HOU J;  2DA1 A;  1NK3 P;  4XRS A;  1OJL A;  5DTD A;  3TP3 A;  3JRF A;  1ZQ3 P;  3FKI J;  1UG2 A;  3HOX J;  4IEJ A;  1BJZ A;  1LE8 A;  1MBH A;  1GV2 A;  1X2N A;  1ZR2 A;  2R5Z A;  1IGN A;  1X2M A;  2P81 A;  1VF9 A;  1FTT A;  3TED A;  4MFE A;  2R5Y A;  3IV5 A;  1P7J A;  2M2E A;  4DW6 A;  5EZG A;  2E2H J;  2QF7 A;  5IP9 J;  4IHX A;  1TWC J;  3S1Q J;  1RES A;  1RPW A;  3OIO A;  2FQ4 A;  2NS7 A;  3HOV J;  1GUU A;  2Y9Y A;  4I76 A;  5JLX A;  3LSP A;  1QRY A;  2I10 A;  2OPT A;  4JX6 A;  3S1R J;  2L7F P;  2O7O A;  1FIA A;  4AUX A;  1W0U A;  2NVY J;  1U9N A;  2K40 A;  2EZI A;  3BG5 A;  3OSG A;  3GTO J;  2ELK A;  2VKE A;  2M0C A;  1JKR C;  2HI3 A;  2HOT A;  1Z77 A;  2DJN A;  3FIS A;  3K2A A;  4CYC A;  1K83 J;  1T33 A;  3F0C A;  1Q1V A;  3HGG A;  1Y1W J;  4FTH A;  1FEX A;  1WH7 A;  2R0Q C;  3I4N J;  1I3Q J;  3DCF A;  3ZQH A;  4UUS B;  1HCR A;  3LSG A;  3SDG A;  1TC3 C;  3SJM A;  5JLW A;  2WV1 A;  3HBL A;  2M34 A;  3RQI A;  2ME6 A;  1ZR4 A;  4DYC A;  1R9T J;  5DS9 A;  3WHB A;  1JKQ C;  3TW7 A;  2YS9 A;  5J1U A;  5F08 A;  3CQZ J;  2XPU A;  3OOU A;  3IH2 A;  2DA4 A;  2FX0 A;  4JX4 A;  4A3F J;  1IDZ A;  2K9N A;  1K61 A;  2DMU A;  5M3F J;  1RKW A;  3H0G J;  3Q3S A;  2XRL A;  5EDN A;  3S14 J;  2H8R A;  1F43 A;  3JRD A;  3MN2 A;  2H1K A;  2EBI A;  2DA7 A;  3SFI A;  4BBR J;  5EF6 A;  4GFB A;  3JRG A;  3PO3 J;  4XRM A;  2VUM J;  4A3L J;  5E3M A;  1AKH B;  3JRC A;  3BR2 A;  3O8H A;  4DYR A;  5EGO B;  3G1O A;  3GBG A;  3HOW J;  5EG0 B;  1ZKG A;  1SAN A;  2XPW A;  3BR6 A;  4X6A J;  1FJL A;  5IOY A;  2NVQ J;  1JJ8 C;  5BNG A;  4RBO A;  3O8G A;  2CJJ A;  2XGE A;  1GT0 C;  1LFB A; 
#chains in the Genus database with same CATH topology
 2A5Y B;  3H0D A;  1R58 A;  4FHT A;  3MFK A;  2MSY A;  3GEZ A;  1JUP A;  2QSF X;  1G59 A;  2WA0 A;  2VOD A;  2Y30 A;  3WOD F;  1IUF A;  3P9I A;  1W36 D;  2CW0 F;  4LJZ F;  1TWH J;  3QP5 A;  4J00 A;  3MZY A;  1IRF A;  4KMU X;  3B6A A;  3OYN A;  5FFX A;  1KA8 A;  4MLO A;  2OUM A;  4LD5 A;  2XRN A;  5A2Q Z;  3KP5 A;  2KP6 A;  4I0A A;  3K4M A;  1FYM A;  4XON A;  1K78 B;  1SVM A;  2K7L A;  2D1V A;  2P8T A;  1J5Y A;  3J7A O;  3JCU C;  1WH5 A;  1MIJ A;  3IH3 A;  2DA6 A;  2GIZ A;  2JJ7 A;  2QUF A;  4DJA A;  2M1B A;  3GTG J;  2R7O A;  1RET A;  4WXD A;  1FOK A;  3VSL A;  2COM A;  1SD7 A;  2FRH A;  3GW2 A;  4CO8 A;  2BYV E;  1PUF B;  1BIB A;  1ONV A;  2HEO A;  5J40 A;  4A3M J;  2K5C A;  3S2W A;  5LHH A;  3DEU A;  3F3X A;  4Y7N J;  2MBF A;  2DN0 A;  3LQR A;  3TOA A;  3I3L A;  2M45 A;  1DUX C;  1ETQ A;  4ZYH A;  4ZH4 F;  1S3J A;  1SFX A;  1QO0 D;  4BXU A;  2YU9 J;  1TT0 A;  2KKO A;  2ESH A;  1T95 A;  3J81 Z;  4XRF A;  2ZXH A;  4GXO A;  3H5R A;  2JK3 A;  3HL2 A;  2PMZ N;  3KZZ A;  1XC5 A;  1OCR H;  4YIF A;  3QU6 A;  1Z0X A;  3BLY A;  2XKP A;  3GZ6 A;  3C18 A;  1NG6 A;  1YIT I;  1I6H J;  5EZH A;  3V7C A;  5HDN A;  5BOX A;  1K4S A;  1ETO A;  4LG3 A;  2UXN A;  3VWB A;  1T0F A;  3ZQ7 A;  3MZH A;  3HSF A;  4OMY A;  3A0H C;  3CC4 I;  4M9X A;  2GOX B;  1EH6 A;  4B48 A;  1OYW A;  2G7U A;  2UWM A;  5K5R A;  3OOP A;  4IHW A;  2H8W A;  3CMY A;  1OYY A;  3VEP A;  2A69 F;  3GX4 X;  1GHC A;  5TGT A;  3GLL A;  4BKX A;  3MD2 A;  4HLY A;  1V54 H;  1PDN C;  4EGZ A;  1HA8 A;  5CYV A;  3RKX A;  5CQE A;  3BR3 A;  5K7F A;  3FDY A;  3M1E A;  1R00 A;  1R6R A;  2E2J J;  2XB5 A;  1YIO A;  2OAZ A;  2KDO A;  4KJZ A;  4PSX A;  3LAP A;  5FKN A;  4CYD A;  1X58 A;  3WU0 A;  2WV0 A;  2W48 A;  2OTJ I;  3DKW A;  4BL0 B;  2VLA A;  1UST A;  1MMG A;  3CDL A;  2DLL A;  1X1A A;  3BJO A;  2O6G E;  3U21 A;  3C2B A;  4XBF A;  1GLN A;  1APL C;  5EEG A;  4ENN A;  3R60 A;  2E60 A;  1U9O A;  2Y0S N;  3G1M A;  3VYR B;  3M07 A;  4RGR A;  4IHV A;  1TQP A;  2LDU A;  2BY3 A;  1QVU A;  2Z9O A;  2EFO A;  1I1S A;  4ESB A;  4C3H J;  2CQQ A;  3LSH A;  1U78 A;  1R36 A;  4ZYA A;  2Z99 A;  1PP8 F;  1J0R A;  4IOC F;  3KEO A;  1O3T A;  4RAF A;  3CP2 A;  4MIM A;  4XQF A;  5EEH A;  4V19 K;  2AXL A;  5IYB J;  2CUJ A;  4LG0 A;  5TIS C;  3DV8 A;  3P9C A;  2LVS A;  4XL9 A;  2R7V A;  2Z2S B;  4F3Q A;  3BG6 A;  2HR3 A;  3WTW C;  1ZLJ A;  1DP3 A;  1EH8 A;  3S2D J;  2EFN A;  5J1R A;  4LLL A;  3H9J A;  3ERE D;  2A68 F;  3I54 A;  4WXC A;  2VN2 A;  2XAQ A;  5CJ9 A;  4XSZ F;  1V4R A;  1WJA A;  3CCV I;  2L54 A;  1TZL A;  1WJE A;  1DQU A;  2XAH A;  5M5X J;  1F9N A;  3FXR A;  1IV6 A;  3K69 A;  3DPU A;  2XPV A;  2OQG A;  3BG3 A;  3P5J A;  2VL8 A;  1JGS A;  3G4S I;  2EIM H;  4A3E J;  2HYF A;  5J47 A;  4QIW N;  3BPX A;  3M8J A;  2XAF A;  4F91 B;  2QYO A;  9ANT A;  1FIP A;  4HYE A;  2VKH A;  4L9T A;  2HDC A;  4EJV A;  3SZG A;  4L9N A;  3IL2 A;  1FTZ A;  3WTU C;  5HS9 A;  2J5P A;  5GTH C;  4BHP A;  2BW3 B;  2ETH A;  5JHF A;  5E18 F;  3GZN B;  3ML6 A;  2JPB A;  2QM3 A;  1A31 A;  3A03 A;  2E71 A;  2HNH A;  4Y52 J;  4FT8 A;  1K7A A;  2EIL H;  5F0F A;  3UNG C;  5J8C A;  3DBR B;  2VE8 A;  4S05 A;  2V4J C;  4LLN A;  1FX7 A;  1W4M A;  4UXN A;  1CF7 B;  2E35 A;  1JKO C;  1Z9C A;  3AG3 H;  3HGY A;  3BQZ A;  3KYC B;  2VXZ A;  4IRI A;  2H94 A;  2HYJ A;  1JTY A;  1JTX A;  1LFP A;  1OFC X;  2MC3 A;  1Y56 A;  5LGU A;  3H5N A;  3ZXS A;  3E1S A;  4C30 A;  3HPG A;  2WY8 Q;  3ZN1 A;  1D8J A;  1UB9 A;  2V1U A;  1ETX A;  2VJ5 A;  4IVN A;  2VOO A;  3E6B A;  2L9V A;  3FMQ A;  3OYD A;  2V1N A;  2FOW A;  1KU2 A;  1P7I A;  4BXF A;  4D7N A;  4YFK F;  2YX4 A;  4YG2 F;  1O7F A;  3I0T A;  2GIV A;  5K5O A;  4OIP F;  1I39 A;  3LFU A;  3AL0 B;  2VB6 A;  2CUE A;  4HF2 A;  1W5T A;  2JSC A;  3P9K A;  1MJA A;  5JVG F;  1BA5 A;  2BY2 A;  2DMQ A;  4G6T B;  2HOE A;  4M9S A;  5D8K B;  4IKF A;  4BU2 A;  2R93 J;  1I6X A;  2X51 A;  3I59 B;  1NG7 A;  3OYF A;  3F21 A;  2HKO A;  3R0J A;  4NBQ A;  1MGT A;  1ETW A;  2OD5 A;  3DTI A;  5JVT A;  2UZK A;  4HF1 A;  4ZZL A;  3GTP J;  3HG9 A;  4KNY A;  1SC7 A;  2AQE A;  3T1B A;  1QU3 A;  2K9S A;  3I5U A;  3F8C A;  2E5Z A;  3F6O A;  1V5G A;  2ELJ A;  3LMM A;  2DMP A;  2K02 A;  2NOJ B;  3S15 J;  2ECC A;  3F6V A;  1WSU A;  2D5V A;  1SMY F;  1VQ8 I;  4PJ0 C;  4QSH A;  4NHJ A;  1OPC A;  2PFB A;  4A3B J;  4E70 A;  3Q0V A;  3GVA A;  1YJW I;  3UR3 C;  1WJF A;  2GQQ A;  3ZMZ A;  2HQ5 A;  5D5U B;  5IYD J;  4I09 A;  5M5W J;  3PQK A;  3M7G A;  3D5S C;  3CO7 C;  5DM7 F;  2DAO A;  2MAB A;  4F7Z A;  2RAE A;  4A3G J;  1ZGW A;  2VJI A;  1BM9 A;  6PAX A;  3ZMU A;  4ZZD A;  3EUK L;  4OAZ A;  5M3M J;  2P4W A;  1UHW A;  1GDT A;  5ILS A;  1FP2 A;  1Y1V J;  2W1O A;  2CFX A;  1EV7 A;  2NRA C;  1MW7 A;  4HDU A;  3RTR A;  1E2X A;  2FA5 A;  4RB0 A;  3S16 J;  3DWL E;  1W7P A;  1F4K A;  1HSJ A;  1A35 A;  2JVH A;  3EPZ A;  2Z33 A;  2DT5 A;  3HEF A;  4E7I A;  1E3H A;  2K3F A;  4LB5 A;  5B66 C;  1P6R A;  4IQ4 A;  3K6G A;  4NQW B;  1AA7 A;  2W85 A;  3HC7 A;  4EM1 A;  4YIR X;  3GME A;  5F64 A;  1PUE E;  2KPM A;  1A6I A;  2KZV A;  1NTC A;  2FBK A;  5FKL A;  4CGZ A;  4WK8 F;  1BN5 A;  4WF2 A;  5B3S H;  3JW4 A;  4CH7 A;  4C3I J;  1RR7 A;  1X1B A;  4PJM A;  2JN6 A;  1B72 B;  3OYK A;  1IF1 A;  4F52 A;  3MEX A;  2ZFW A;  3G6E I;  4P1W A;  4BE1 A;  2IGN A;  4U0W A;  3TP3 A;  3PSF A;  3PQJ A;  3JRF A;  1ZQ3 P;  1KYZ A;  2PEX A;  3G71 I;  1LE8 A;  1BBY A;  1MBH A;  1Y6I A;  3DPT A;  1ZR2 A;  2W24 A;  4AD9 A;  3H3U A;  3FBN B;  4WXH A;  3VYT B;  1X2M A;  4U7B A;  2IA0 A;  2P81 A;  1VF9 A;  5L3B A;  3PIO F;  1B4A A;  4A0Y A;  3ABU A;  4EJT A;  5E1Z B;  3WGI A;  1BI1 A;  5H6R A;  2QF7 A;  2PJR A;  2IGO A;  3O6B B;  3VYU B;  3I55 I;  1TWC J;  3S1Q J;  1QHH D;  1UG0 A;  1RES A;  4U0V A;  1CF7 A;  2DXI A;  2OU2 A;  3C1D A;  4B8X A;  4I76 A;  2E36 A;  3LSP A;  4XKV A;  4IOA F;  1BR4 A;  1XPX A;  2I10 A;  2ZCW A;  1QZZ A;  4M6X A;  4JX6 A;  2X4H A;  4P96 A;  2OZU A;  2IP2 A;  3GTO J;  3BJA A;  2K86 A;  2ELK A;  2HGC A;  3DKX A;  3LA3 A;  2XKO A;  2HOT A;  1VQO I;  4MEY F;  3KE2 A;  4YII A;  3GCM A;  2ACJ A;  4XN0 A;  2A05 A;  4PZJ A;  4HBL A;  1MND A;  3K2A A;  4HF0 A;  3ZCO A;  4DIQ A;  2H6B A;  1K83 J;  1T33 A;  5KHD A;  2ZO4 A;  1SAX A;  1X4P A;  1Q1V A;  4EJW A;  4RAG A;  3PUB A;  3HGG A;  4XN3 A;  1MMD A;  1UZC A;  4RLF A;  3HYI A;  2EIN H;  2JSP A;  2KJB A;  1Q1H A;  4Y17 A;  4E7H A;  1I3Q J;  4UUS B;  2X1D A;  1IV8 A;  3QYF A;  5B1A H;  2DFE A;  5H6Q A;  2XIG A;  2RNJ A;  3BP8 A;  4BNC A;  2FOK A;  4MHG A;  3RQI A;  4KIC A;  4R79 A;  3DXJ F;  3R0A A;  4XLA A;  2XPU A;  4A3F J;  3L7W A;  2DDA A;  2FX0 A;  1IDZ A;  3NQO A;  2D2W A;  1K61 A;  3PNT A;  2M87 A;  3KEQ A;  3BY6 A;  3H0G J;  2XRL A;  1UFM A;  3S14 J;  1YJ9 I;  1XD7 A;  4L5J A;  4GRI A;  1IW7 F;  1QNT A;  1TP4 A;  5HS7 A;  3OR1 C;  3L2R A;  2DA7 A;  3SFI A;  3SQN A;  3TDZ C;  5ICG A;  3JRG A;  2X6W A;  5CVV A;  4RB3 C;  1YLF A;  4UHT A;  3JRC A;  4IHT A;  3T0Y A;  4DYR A;  1FLI A;  3BDD A;  1O3S A;  1ZEL A;  1P92 A;  2CW8 A;  2XPW A;  4X6A J;  3PL8 A;  5IOY A;  1IUY A;  4KIS A;  1AWC A;  3DTE A;  4RBO A;  2R4G A;  1Z21 A;  2OQR A;  5EYR A;  2F4I A;  3IAS 2;  2XAS A;  4M73 A;  3LA2 A;  3K70 C;  3OYH A;  1MDM A;  1OCO H;  1LQ1 A;  1B8I B;  3FMR A;  2LD5 A;  1UHM A;  1UEL B;  4M72 A;  3A01 B;  5J1Y A;  3AFH A;  2M8E A;  3FK6 A;  2CQK A;  4XIC A;  2Y2Z A;  1MBF A;  2Y31 A;  2R7Z J;  1JUS A;  5CVI A;  4JQF A;  2R7F A;  3DFG A;  2H09 A;  1E17 A;  1LEA A;  3C2G A;  3F8F A;  1BJA A;  1F5T A;  2Z1D A;  1HW2 A;  4BJT A;  1D0Y A;  1ON2 A;  4OWR B;  4ENJ A;  2VAS A;  1RRJ A;  1VND A;  2HVS A;  4D9J A;  2KQR A;  4R1H A;  3CCJ I;  1N78 A;  1DGW Y;  4RAY A;  3GUD A;  1ZRD A;  1G8X A;  1YE9 A;  4LIV A;  3BRO A;  1BOA A;  3GLX A;  5CKT A;  2NVU B;  1LE8 B;  4ZC3 A;  3WHC A;  2V7F A;  1OR7 A;  3IP4 B;  2KHM A;  3IRR A;  2E1O A;  3OYE A;  1EJ9 A;  5FD6 A;  3RKW A;  1SVO A;  3H9Q A;  5D8L B;  2R5Y B;  3PNV A;  3LFK A;  3QP6 A;  2HQA A;  3WE2 A;  5ILV A;  2M4G A;  2LC2 A;  2P7C B;  3VPR A;  2EZL A;  3B6C A;  3OIP A;  1IN8 A;  5H2F C;  3F23 A;  3A02 A;  4ZYG A;  1TBX A;  1EF4 A;  3DBL B;  4PFO A;  1X19 A;  1XG1 A;  3FM5 A;  1YIJ I;  1R1V A;  4W1U A;  1IRG A;  5HOO A;  3OYA A;  3DU6 A;  3RZD J;  2VBY A;  2YUS A;  3FX3 A;  3OS2 A;  1MSF C;  2E34 A;  4K2E A;  1LVA A;  2GLO A;  4LLG F;  4ABZ A;  2DA5 A;  1USS A;  1K6Y A;  1W5C C;  1O3Q A;  1HKQ A;  4BQA A;  2QBY B;  1MBK A;  2IGM A;  2XGC A;  2W7N A;  1IC8 A;  4ITV A;  2YR2 A;  4D5C A;  2IVM A;  2ISZ A;  2RRE A;  2LTP A;  2X6Y A;  3FXO A;  2IBD A;  3HB9 A;  4CUG A;  1VFC A;  2A07 F;  4FIS A;  1WKM A;  4H4K C;  1ITY A;  3REO A;  5FRM A;  4BAY A;  3FWE A;  3HUG B;  4D1Q A;  2QKM B;  4A69 C;  2R7D A;  4RLQ A;  1XS9 A;  3I4P A;  2LMD A;  2XB0 X;  3G3Z A;  1H0M A;  1K79 A;  5HLG A;  3BG9 A;  2KIU A;  1Z7L A;  2HDD A;  2FMY A;  2G9W A;  1MMS A;  1IRZ A;  2Y0S A;  1NHA A;  2DFH A;  3FK7 A;  2FSW A;  3S3M A;  1O7L A;  1B9M A;  1J9I A;  4QTR A;  2IJL A;  1W36 C;  1U8R A;  1O57 A;  2IEK A;  3BTJ A;  5F0C A;  4JYK A;  2GOM A;  2EQR A;  2VJJ A;  2X9D A;  1Y8R B;  3PFI A;  2HZD A;  3E6M A;  4NDL A;  2M8G X;  3JSP A;  4S04 A;  3S3N A;  2EFW A;  1UJ8 A;  3TMO A;  4B47 A;  5HS8 A;  3F72 A;  1R23 A;  2WB1 N;  3LWF A;  2EZK A;  1U0J A;  4LOC A;  4KIF A;  2CQN A;  3RJP A;  3VOD A;  2JTV A;  4XM3 A;  1XGS A;  5E17 F;  4AVP A;  3DEE A;  5FO5 A;  1ETK A;  1KQ9 A;  1U5T B;  2DQL A;  2WAQ N;  4N0B A;  1BW6 A;  1FMV A;  2IGK A;  2W4S A;  4CZZ A;  1AU7 A;  1UMQ A;  5F27 A;  2GZW A;  1OCZ H;  1WJD A;  2JRT A;  5KAF C;  2VPL A;  3OYM A;  1R1U A;  2P5V A;  2JWT A;  2N8G A;  3KZY A;  1WI3 A;  2WB1 A;  1ZTR A;  1U3E M;  4UUT A;  4L5E A;  2Y9Z A;  1ZK8 A;  5FLV A;  5E3L A;  3WTS C;  4XKW A;  4NC6 A;  5L3C A;  2RVC A;  3A01 A;  2BOL A;  2QZ8 A;  3M9A A;  2ZFU A;  4BDZ A;  2EIJ H;  5CQG A;  4JX5 A;  1G3T A;  3CCE I;  2V6E A;  1JKP C;  1FSH A;  2J5O A;  3P7N A;  4Y15 A;  4DGW B;  4OIQ F;  4BXX J;  2EZH A;  1VQ4 I;  1A5J A;  3HTU A;  3GFM A;  3BR1 A;  4UVC A;  5F1J A;  4A2U A;  2BXY A;  2DTR A;  4IX7 A;  2L5Q A;  5JI6 A;  1RKT A;  2WBM A;  4XMY A;  1WVR A;  3Q5F A;  1XGN A;  4FX0 A;  3J7Z I;  2YX7 A;  1VQN I;  1HW5 A;  2XVC A;  1MBJ A;  1LDD A;  3KCC A;  4X1E A;  2Z3Y A;  1WHU A;  4OOI A;  3CCY A;  1PUF A;  2HQR A;  1D5Y A;  1N25 A;  2EH3 A;  3E7L A;  4AIK A;  3BTI A;  2L9N A;  3EQL F;  3FXU A;  4XR6 A;  2M7A A;  4PJL A;  2RQP A;  3V8K A;  3VSK A;  3WU1 B;  3TBI A;  2JA5 J;  3CJT B;  5J6X A;  3SXY A;  2R3S A;  4MNU A;  4BJ5 C;  3BJ6 A;  1O4X A;  5C3E J;  1DU6 A;  3M8F A;  3E6C C;  1UHS A;  2E2I J;  4BEH B;  2ZSI B;  3CZ6 A;  3GTK J;  1MH3 A;  3HRU A;  3PIP F;  2WAQ A;  4RA2 A;  5ICF A;  2IS2 A;  2CYY A;  2Y0M A;  2QEN A;  2QCO A;  1GXP A;  2V79 A;  3BR5 A;  4OIR F;  4AC0 A;  2CG4 A;  4MGR A;  4QLC U;  5JFR A;  1RNL A;  3CES A;  4E7K A;  2O0Y A;  3TO6 A;  3PM1 A;  4XLN F;  3ZPL A;  3JRA A;  2BE5 F;  3FZV A;  3QPL A;  2PN6 A;  3K4L A;  1I50 J;  3E0J B;  1GVD A;  2DYS H;  2DOE A;  2K9M A;  1DP7 P;  4HST A;  5DYM A;  3L9F A;  3N05 A;  3CMA I;  2HOA A;  3QOP A;  4HNU A;  2L9S A;  5FFZ A;  4M3B A;  2GBY A;  4BY7 J;  1R1T A;  2HXI A;  1IN4 A;  2ISY A;  4Q5S F;  1VI0 A;  2V1X A;  1R49 A;  3FMS A;  2ZXJ A;  3ZQI A;  2XV4 S;  3SEQ A;  1QPI A;  5A2Q K;  5F6F A;  2UXX A;  2DU9 A;  5LRR A;  3SZT A;  1SFU A;  1S9H A;  2PG4 A;  3LSJ A;  1TLH B;  1MNE A;  2JZY A;  1Y8Q B;  4A3K J;  2ESN A;  4IHY A;  2LK2 A;  3NWS A;  1PJR A;  4RGX A;  2XAG A;  2EFQ A;  3E3V A;  3ABT A;  2CQ7 A;  2VQL A;  3L2W A;  2V1D A;  2VON A;  2E7X A;  5D6E A;  2XGD A;  4ZYD A;  2OCE A;  3E6D A;  1AKH A;  3BTC A;  1BOB A;  2DOF A;  3ZQG A;  3FXQ A;  5IOZ A;  4YFX F;  2LP0 A;  1H9G A;  2PMH A;  1B1B A;  3ECO A;  5LGT A;  4WCG A;  3M4O J;  2XSJ C;  5E8G A;  2EA2 A;  1ZGA A;  3ABK H;  2CU7 A;  2JQ7 A;  4YRV A;  3HJE A;  4MFD A;  4AU7 A;  2QKL B;  3HKZ N;  4B09 A;  4J19 A;  2DFF A;  3CUQ B;  1MZB A;  3JSO A;  2V26 A;  2D1H A;  1RUO A;  3JRE A;  2LY2 A;  4M6V A;  2BHY A;  1BC7 C;  4A93 J;  5J4V A;  3KP4 A;  1VQL I;  2DTZ A;  4GO1 A;  3H3V K;  2V9K A;  4C2T A;  3CJN A;  3WTZ A;  2KL4 A;  4L9V A;  1MMN A;  1JT6 A;  3SYT A;  4IQJ A;  4MO7 A;  2HVR A;  2MG4 A;  2L7K A;  4X0G A;  1Z7U A;  4F93 B;  2ME0 A;  1V55 H;  5M5Y J;  4XK4 A;  1O3R A;  1YQA A;  1XSX A;  1V5F A;  2V9V A;  1J09 A;  2UUZ A;  4IF4 A;  1LEB A;  5IT9 Z;  1CQT A;  3HOU J;  1OQY A;  4PCQ A;  4JOM A;  2OBP A;  5DTD A;  3CCS I;  3C3W A;  4BQN A;  1FYL A;  2B7E A;  2RGV A;  4IEJ A;  1GV2 A;  1WRJ A;  1X2N A;  3S32 A;  3SZP A;  2CWE A;  2A5W A;  2BW3 A;  2ZME A;  2PJP A;  4I0B A;  4MFE A;  4BE0 A;  1SFK A;  3CO6 C;  3IV5 A;  3CME I;  3ABM H;  4DW6 A;  4KFC A;  2VKD A;  5EZG A;  5HVQ C;  5L3E A;  1T98 A;  2ZSH B;  1QZY A;  2LG4 A;  3CLO A;  3WG9 A;  2L01 A;  4N4O B;  4E6K G;  1MMA A;  2MD0 A;  3WG7 H;  1A6Q A;  1RPW A;  1XDS A;  1QHG A;  2DQR A;  1ZAR A;  3C7J A;  3FM3 A;  1QQI A;  5JLX A;  3CUQ C;  1RUN A;  2EFP A;  4Q48 A;  2OPT A;  1WJC A;  4KUM A;  2LKS A;  1W5S A;  3VOE A;  2O7O A;  2A3S A;  2V6C A;  4AUX A;  3EYY A;  3VYS B;  2K40 A;  2LY1 A;  4Y13 A;  3S3O A;  3IRQ A;  2VKE A;  1T39 A;  2M0C A;  4CCN A;  1Z05 A;  5CPR B;  1WQ2 A;  1FOX A;  3V4G A;  1Z77 A;  1LDJ A;  4CYC A;  3D5R C;  1B6A A;  1P4X A;  4YFN F;  4KN4 X;  3DP7 A;  2ZNY A;  1YS6 A;  1Y1W J;  2QQB A;  3T5X A;  4FTH A;  2W57 A;  1J59 A;  1WI9 A;  4XLC A;  2M7B A;  2R0Q C;  3L09 A;  4XLP F;  2RDP A;  1TTY A;  3I59 A;  3LSG A;  2X1C A;  1RIO H;  4YEL A;  2OTL I;  4ZTF A;  1J75 A;  3CP8 A;  2E1M B;  2DJI A;  1OR7 C;  2WC2 A;  4Z2Y A;  5DS9 A;  4N9H A;  1JKQ C;  3CQZ J;  5F08 A;  2DA4 A;  1IRX A;  4JX4 A;  4KT5 C;  2Y48 A;  2K9N A;  5M3F J;  1TQM A;  3ELK A;  1RKW A;  4KMF A;  2IW5 A;  3D5L A;  2E1C A;  5EDN A;  2FBI A;  2G7H A;  5DUI A;  2FF4 A;  2KFD A;  4A0Z A;  1D1B A;  2P5L C;  2ZKZ A;  3SHF A;  2B0L A;  3K1N A;  4QWQ A;  4A3L J;  1TNS A;  5E3M A;  3Q9S A;  5CVU A;  2CMP A;  3O8H A;  4ENK A;  1ZYR F;  2X6X A;  3V8L A;  1B59 A;  2C6Y A;  3GBG A;  1I5Z A;  1YHQ I;  2EV0 A;  3HRM A;  5EG0 B;  3KLN A;  4RM3 A;  2IPQ X;  2EPF A;  1SAN A;  2HVQ A;  2NVQ J;  1YFH A;  3RSN A;  1JJ8 C;  5BNG A;  3O8G A;  1S6L A;  2XGE A;  3ZMS A;  1LFB A;  5K1Y A;  3T8T A;  2K9Q A;  3L2V A;  5J3L A;  5FGM A;  5BPI A;  1ZG1 A;  2BHZ A;  3AG4 H;  4LFU A;  1IN6 A;  5E8I A;  2Z5U A;  4ETS A;  3A1Y A;  3TQN A;  2RQQ A;  2PMZ A;  1MJ9 A;  3JR9 A;  1BR2 A;  1STZ A;  1ORK A;  5FKO A;  3S8P A;  3V7R A;  4I02 A;  3MZ8 A;  5HLT A;  2VOP A;  4NQW A;  3DBH B;  4Y3O A;  2EB7 A;  1U5T C;  1R5I D;  3K1M A;  1POG A;  3FBI B;  3CC2 I;  2O3F A;  1OIS A;  2W00 A;  2IXS A;  2BZT A;  4D7M A;  1B72 A;  2JRM A;  2ECB A;  2ID6 A;  2F4M B;  3HRS A;  2DA3 A;  2FXA A;  4XNF A;  5IT3 A;  4UY8 I;  1IXR C;  1YOV B;  1BIA A;  4QPO A;  3ZQF A;  3CCU I;  1TWA J;  3F9K A;  3DKY A;  3LL7 A;  1QA6 A;  4HG2 A;  2LRE A;  3ZQC A;  2ZME B;  4U87 A;  1ZG5 A;  1IN5 A;  1X3Z B;  4PSW A;  4AM3 A;  2VBZ A;  5K7H A;  2CUZ A;  3ZQQ A;  3OR2 C;  1ZLK A;  4DZP A;  1JJ6 C;  1OLT A;  3G1L A;  3NAR A;  3ZR8 X;  4AYB N;  2MGQ A;  3JAM Z;  2KDZ A;  4EVI A;  2XC7 A;  4LGW A;  2L2O A;  2P6S A;  1JI8 A;  2BBY A;  3M1C A;  1P4A A;  2VQH A;  2IS4 A;  3CF5 F;  1XB4 A;  4FCY A;  2XAU A;  4UV8 A;  3WTX C;  3IH4 A;  5FRN A;  1SFO J;  1H8A C;  4XLH A;  4OMZ A;  3W3C A;  2EV6 A;  4EGY A;  2L7M P;  2VJ4 A;  3L2C A;  1SVL A;  2VIX A;  5B1B H;  2LNB A;  2OV7 A;  3CF2 A;  4A3C J;  2Q1Z B;  4G12 A;  4HV6 A;  5GAD J;  3K0L A;  4HPQ A;  3L1P A;  4BDY A;  2TDX A;  2KIS A;  4RMN A;  2TCT A;  5H20 A;  1Z6T A;  2F6C A;  1ZAO A;  2CV1 A;  1G2H A;  5GAH J;  2BVM A;  3LNQ A;  1XMX A;  4BQQ A;  1KQ0 A;  2CH0 A;  2EIK H;  2H27 A;  4DNC A;  3ERM A;  3H92 A;  4JBA A;  1LPQ A;  4HQM A;  1MD0 A;  2FD5 A;  4ZJZ A;  2R92 J;  3HM5 A;  3MKZ A;  4IZZ A;  3GFJ A;  1HXD A;  4GCV A;  5JHU A;  1FYK A;  2MH9 A;  1MJB A;  3E5Q A;  1HST A;  3ZMV A;  1R5H A;  3ZQL A;  3BQY A;  1WWX A;  2GWR A;  1FWZ A;  3O3K A;  4IO9 F;  3RZO J;  2Y75 A;  3TGN A;  5K5Q A;  2K9L A;  1XDU A;  2IA2 A;  3G73 A;  1X3U A;  1G6N A;  2WAF A;  4HSR A;  3JTH A;  5E79 C;  1SFE A;  4B3A A;  2W82 A;  4GDF A;  1V3F A;  3E97 A;  5EEA A;  1LFU P;  3TOB A;  3QOD A;  2QLZ A;  2ZBK A;  2PX9 A;  2MLG A;  1XGM A;  5LHG A;  1R71 A;  3N4M A;  4OIO F;  1CGP A;  3K4B A;  4RAZ A;  3HOY J;  2JA6 J;  1JXS A;  2K85 A;  1UAA A;  1D5V A;  1D8K A;  3K4K A;  4BQO A;  1D1C A;  4MEX F;  2QQ9 A;  2VC0 A;  4ENM A;  2ZJQ F;  3T8R A;  4BYY A;  2JA7 J;  3EET A;  5FLM J;  3RPU D;  4IXA A;  4B44 A;  5EG0 A;  1U8B A;  2W25 A;  3B73 A;  1FSE A;  2LH9 A;  3BTL A;  3QPT A;  5IP7 J;  5LFA A;  2L0K A;  2CFO A;  2M0M A;  4LIT A;  5D5W B;  5F1R A;  1D0Z A;  3QOE A;  3KYL A;  1HDP A;  1G3W A;  1ETV A;  4YEJ A;  4BH9 A;  2JUC A;  3DLA A;  5L3G A;  4I6Z A;  2B9S A;  2JT1 A;  3DU5 A;  1B8I A;  3LSM A;  1YX3 A;  2VPR A;  3K7A J;  1D3Y A;  1WFX A;  1Y0U A;  3MWM A;  3FIW A;  1FNN A;  3RDI A;  3A0B C;  4IRG A;  1OCC H;  1Z3Y A;  4RS8 A;  1SEU A;  2O61 A;  1QPM A;  1R4M B;  2R7T A;  1TWG J;  5E3O A;  2OZ6 A;  1TWF J;  4PFP A;  3EUH A;  1T56 A;  2MW8 A;  3TL4 X;  5E3N A;  1SD6 A;  3S17 J;  2L02 A;  4PJN A;  5F0H A;  3RYR A;  4E7Z A;  3OYJ A;  2NAZ A;  1ZGJ A;  2KJC A;  1XCB A;  2VC1 A;  4XOP A;  2R5Z B;  5ED4 A;  3HPH A;  4KIT B;  4I99 C;  3UKG A;  3TP0 A;  4B1R A;  2P0W A;  3K10 A;  3TO7 A;  3H9G A;  4XRS G;  4CZC A;  4B43 A;  2DMN A;  2L4M A;  4CCO A;  3C2H A;  2CRG A;  2X6O A;  4W97 A;  1E3O C;  5C4X J;  2M4K A;  1Z91 A;  4BS9 A;  4I2O A;  4A6D A;  3RKY A;  2NVT J;  2ZXI A;  4AID A;  3CJR B;  1YTY A;  3OSF A;  4CDG A;  4LK0 F;  5ICE A;  2DBB A;  3SFZ A;  1H89 C;  1YX5 A;  4DZJ A;  3L00 A;  2JMW A;  3ZP5 A;  3BOQ A;  3CCR I;  2IRF G;  2Y69 H;  4FQG A;  3QQA A;  4ZYE A;  4HX8 A;  2IT0 A;  4A0X A;  4A5M A;  1GV5 A;  1FOW A;  1PP7 U;  2WWY A;  2O8X A;  3HRT A;  1QBJ A;  1FZP B;  1LJ9 A;  4CIC A;  1JHH A;  1IN7 A;  1LNW A;  3WGG A;  4CCL A;  2GXA A;  3GTL J;  1S7O A;  3RPU A;  3WU2 C;  3BG7 A;  2QQ8 A;  2FNA A;  4HLX A;  4IPA A;  4PDK A;  3U2R A;  3QYE A;  4BUP A;  4HNT A;  5C4J J;  4FAS D;  3WE3 A;  3K4N A;  3LSR A;  2F5C A;  1MNM C;  2ZJR F;  4XID A;  5AIP A;  3NAU A;  4ZDP A;  4EAT A;  4N9I A;  2KLO A;  3V7S A;  3K1P A;  1HKT A;  4WX9 A;  4P9F A;  5IYC J;  5J4Y A;  3LA7 A;  2WY7 Q;  3E5X A;  2RN7 A;  1FMW A;  3HUG A;  4GYG A;  5TJJ A;  3ASN H;  1DPR A;  3IC7 A;  1S7E A;  1EH7 A;  2COB A;  2R7X A;  4B4C A;  1FPQ A;  4M3E A;  4AVZ A;  1OKR A;  2HTS A;  1UCR A;  2LRD A;  4KYW A;  3CMM A;  3HHH A;  1FP1 D;  2MFZ A;  1LDK B;  1DDN A;  3W2A A;  1GXQ A;  2DK8 A;  4NB5 A;  2IS1 A;  1W0T A;  2NNY A;  2EWN A;  3D1N I;  5DD4 A;  1IG7 A;  2RNG A;  4KA4 A;  4M3F A;  3KET A;  1KU3 A;  4HX4 A;  2ID3 A;  2UV1 A;  4M74 A;  5B5E C;  3SDB A;  4EJO A;  3OIQ A;  4R8H A;  2VKV A;  1X3W B;  5HOD A;  2LY9 A;  4RB1 A;  2R7Q A;  3HKZ A;  1Z67 A;  2AQF A;  3DEW A;  4M3G A;  4ESF A;  3W6J B;  2KT0 A;  2VXD A;  1MBG A;  4L0Z B;  2CQX A;  3S1M J;  4HDV A;  2OF7 A;  1ETY A;  1ENH A;  2DCE A;  2L3D A;  3Q0W A;  1RC9 A;  3BT9 A;  4CA0 A;  3LQQ A;  1YS7 A;  1X1P A;  3J81 K;  4BHB A;  3GTQ J;  3PNY A;  3OMY A;  1H9T A;  2PLY A;  1YO5 C;  2VQC A;  5GAG J;  1VQM I;  2TRT A;  2GXG A;  2WAD A;  4HZF A;  3X2Q H;  3R4K A;  3BZC A;  4JP0 A;  1QGP A;  1DU0 A;  2KRH A;  2EJR A;  5BMZ A;  4FE4 A;  1IXS B;  3U1D A;  1X1D A;  2YSR A;  1HDD C;  2MLK A;  1WZ2 A;  5ILU A;  2KIF A;  4M71 A;  3JRH A;  2X85 A;  2I5U A;  4Q47 A;  3HZJ A;  4CXF A;  5DV5 A;  4E7J A;  1Z6R A;  3PO2 J;  2L4A A;  1G3S A;  4IL6 C;  2FJ1 A;  1RR8 C;  4KT6 A;  2B63 J;  3KIO A;  4UUV A;  1NK3 P;  1RZ4 A;  4LK1 F;  1XCV A;  4XRS A;  3FKI J;  1UG2 A;  2XDV A;  1BJZ A;  4MTD A;  1ZHF A;  1ZH5 A;  4XKB A;  3JAM K;  1TT5 B;  1FTT A;  2R7S A;  2HTJ A;  4MQV A;  3R61 A;  3TED A;  5E1X A;  1F1Z A;  4ZDL A;  5EJC A;  1P2F A;  2MYS A;  4I7H A;  4U7D A;  1KQ8 A;  1FOY A;  2STT A;  2P6T A;  3BPV A;  2E2H J;  2A6H F;  2LF7 A;  5HDK A;  5IP9 J;  3QRF F;  1VTN C;  4GYI A;  5LEJ A;  1SD5 A;  5LEK A;  4OAY A;  1R7J A;  1ACI A;  5KVR A;  2FQ4 A;  2LF8 A;  3HOV J;  1GUU A;  2Y9Y A;  4M9Z A;  1BI0 A;  5D6F A;  1KU9 A;  4EQQ A;  2F4O B;  3W2W A;  2EK5 A;  5CLS A;  2L7F P;  4BEH A;  3OYC A;  1FIA A;  3J7A Y;  1W0U A;  1IAW A;  4UV9 A;  5LGN A;  1AOY A;  1JKR C;  2KRC A;  2HI3 A;  3AL0 C;  3HTS B;  3FIS A;  3PJR A;  1FY7 A;  3F0C A;  2HZT A;  2F5D A;  5TRD A;  3FXM A;  3JTG A;  2DOA A;  4Z6Y A;  3M8E A;  2FU4 A;  3KPH A;  1WH7 A;  4Y33 A;  3ZQH A;  4UB8 C;  4L18 B;  2WAE A;  2FUG 2;  3OS1 A;  4A12 A;  1TC3 C;  4HA8 A;  4DQ2 A;  3WGH A;  1S72 I;  5L3D A;  3HBL A;  4OIN F;  5JR3 A;  2M34 A;  1KGS A;  1ZR4 A;  2CO5 A;  2CV2 A;  4HOB A;  1ZG3 A;  4DYC A;  1R9T J;  2DYR H;  1I27 A;  2NNN A;  4PK4 A;  4NUB A;  3A4C A;  5J1U A;  2STW A;  1TL8 A;  3OOU A;  1KYW A;  4P9U A;  3IH2 A;  3OYG A;  2RKH A;  1XMA A;  3CUO A;  2R7W A;  3GZ5 A;  2X1E A;  3HOT A;  5DD8 A;  2AS5 F;  3MMY B;  3EDP A;  4UVB A;  3SEZ A;  3I53 A;  3H1C A;  2H8R A;  5GAE J;  3I71 A;  4L0Y B;  3FXJ A;  3MN2 A;  4XKC A;  2EBI A;  2FNP A;  2HS5 A;  2K3P A;  5LHI A;  2DOD A;  5CVR A;  4BBR J;  5EF6 A;  4NC7 A;  3PO3 J;  2P5K A;  1AKH B;  5GTI C;  4G94 A;  1ON1 A;  2BGC A;  3BR2 A;  3S93 A;  4BAC A;  2QWW A;  1WJ5 A;  4LG0 B;  3G1O A;  1MKM A;  3HOW J;  4EM2 A;  2A6E F;  1ERD A;  1XMK A;  2ADU A;  1ZKG A;  3AG2 H;  4RB2 C;  2ZNZ A;  4BGD A;  3L2U A;  4DBQ A;  4XLE A;  1HBX G;  1OMI A;  2HWV A;  3IUO A;  3QAH A;  3M3Y J;  2CJJ A;  4HRI A;  2LYC A;  2PMU A;  3QWL A;  5FLX Z;  3OY9 A;  3DPL C;  3RPQ A;  2AHQ A;  4CSW A;  4H0E A;  2M3A A;  3CUQ A;  4V2F A;  5DM6 F;  3WTV C;  3CDH A;  2JA2 A;  1RI7 A;  3ABL H;  2O03 A;  1NK2 P;  4TV7 A;  2LSO A;  1NH3 A;  2GAU A;  1YRN B;  3BCA A;  1REP C;  2HQN A;  1OCT C;  2O9L A;  4O3M A;  3A2K A;  1MBE A;  1WPK A;  3OYB A;  3ZN0 A;  5D4R A;  4P5O A;  2WTE A;  3Q0U A;  4UNO A;  2ELH A;  2F5V A;  4HV5 A;  2W84 A;  4AYB A;  2LBF B;  5J8F A;  3MQ0 A;  1FBS A;  2R7R A;  2X0L A;  4CCJ A;  1XN7 A;  5HDG A;  3GYH X;  3I64 A;  3CCL I;  1I3A A;  1H88 C;  3CD6 I;  4G8X A;  3LSK A;  2M30 A;  3CCM I;  3FXK A;  3QPH A;  4O5V A;  2GM4 A;  4NC8 A;  5CVJ A;  5AON A;  1EA3 A;  3MCZ A;  1A04 A;  2JVG A;  4IRH A;  5IT9 K;  2DFI A;  3QYB A;  2JPC A;  2KRF A;  3FXL A;  3FF5 A;  3OL3 A;  5FJ8 J;  4FX4 A;  4BHC A;  4RDU A;  2CS3 A;  1ZRC A;  2E1N A;  4BY1 J;  1BR1 A;  2DT7 B;  5E20 A;  4HNV A;  4L5I A;  3DQV C;  4DBR A;  2XAJ A;  1WGX A;  5LLQ A;  3TW6 A;  1BI3 A;  1XX5 A;  5F04 A;  2V9P A;  4G7Z F;  5FD5 A;  1VQ9 I;  3K2Z A;  4KN7 X;  3FHN A;  3AAF A;  4G7H F;  4LIU A;  3WTY C;  1C0W A;  2QVO A;  4A3I J;  3HOZ J;  4G9Y A;  2FML A;  1OCP A;  5K7Z A;  3RKQ A;  5FKK A;  1L0O C;  1PVE A;  2RV8 A;  2XUB A;  1G4D A;  1A36 A;  5LRS A;  2NYX A;  2NXN B;  3K4C A;  2KIM A;  3K70 D;  2K4B A;  4F92 B;  1R4N B;  3B02 A;  5HLI A;  2PBI A;  4PUS A;  4CYC B;  3NWT A;  2LLK A;  2G0E A;  5FKM A;  3H3Z A;  3TO9 A;  3GFL A;  3QU3 A;  1DPU A;  3BC8 A;  3ASO H;  3IHU A;  5KNL A;  2ICW G;  3W6K B;  1ZN2 A;  3GXO A;  3ZMT A;  3PUF A;  1GVJ A;  3OYI A;  3RCO A;  1Y39 A;  1IJW C;  3KP7 A;  2Q0O A;  3BWG A;  4E4H A;  4ZDO A;  4RGU A;  1KU7 A;  2K4J A;  5HNH A;  1R5G A;  2QGU A;  2HXO A;  4A3D J;  3JRB A;  2VI6 A;  3GWZ A;  3RIR A;  4G7O F;  4BBS J;  2Q2E B;  4V2G A;  2BVL A;  4AWX B;  4IJA A;  2CSO A;  4A3J J;  3RQ4 A;  1W1W E;  1TNT A;  1XSD A;  1WCM J;  2QQA A;  1P4W A;  3V42 A;  2HKX A;  3KLO A;  4XOR A;  2L7Z A;  4PJJ A;  3J80 K;  2DA2 A;  2ZC2 A;  2E19 A;  4MQ9 F;  2F2E A;  2M9H A;  2Z16 A;  4XSX F;  1YI2 I;  3ZOB A;  1ODD A;  4A5N A;  5DDG A;  3I56 I;  2D45 A;  5DCM B;  4C2M J;  2HFH A;  4S0H B;  2DK5 A;  1W7P B;  3IKV A;  3VDX A;  4E7S A;  2MH2 A;  2HYG D;  4JK1 X;  4KIB A;  1KZH A;  3ULQ B;  5D4S A;  4P55 A;  1BL0 A;  1FBU A;  4XLF A;  2MD5 A;  3U9G A;  2VQG A;  2LKX A;  3K4J A;  2MA3 A;  1IO2 A;  2OCC H;  2KZG A;  4ZTJ A;  2LFB A;  4B3X A;  1HKS A;  2BY0 A;  5DCF A;  1HW1 A;  4EV0 A;  3W6V A;  3G2B A;  1F36 A;  1VZ0 A;  1YW7 A;  3GO5 A;  4HAM A;  3JRI A;  1YRN A;  4EJU A;  4LB6 B;  5LD2 C;  2O8K A;  2ZXW H;  1ZRE A;  2DPD A;  3O2P E;  3DF8 A;  1X4O A;  3ZGK A;  4Y4R A;  2KMU A;  2LR8 A;  5E1W A;  2R7U A;  2DI3 A;  2LBF A;  4EMS A;  4II2 A;  3HXL A;  3KP6 A;  5GPA A;  1TW3 A;  3KYD B;  1G3Y A;  2BV6 A;  3Q9V A;  5FB2 A;  3ZMD A;  1D1A A;  2NOG A;  3LOC A;  4A6E A;  1S29 A;  2MC4 A;  1K4T A;  2CUF A;  2PJR B;  3L2Q A;  1T38 A;  2XF7 A;  3MAJ A;  2EV5 A;  4EEF G;  3COA C;  1HLV A;  2NS8 A;  2HOS A;  2IAI A;  3TKY A;  1HOM A;  2VBW A;  4PGH A;  4N4N B;  1LKX A;  1U6G A;  1YJN I;  2YU3 A;  4RM2 A;  4EM0 B;  1Z3X A;  2XF5 A;  1JGG A;  2DMT A;  3BR0 A;  3LAJ A;  3KP3 A;  1OYI A;  1LUJ B;  3GTM J;  3I4M J;  1T6S A;  1MSE C;  3CC7 I;  2F5F A;  5KCM A;  1U2W A;  1VQP I;  2DDB A;  4QPQ A;  4BJ6 C;  3IWF A;  3OS0 A;  5IPA A;  1IDY A;  1QZE A;  1JHF A;  3S2H J;  2XSD C;  1DGR M;  2HPI A;  2A6T A;  2NVX J;  3HIF A;  4LMY A;  1VQ7 I;  5FLX K;  4UUS A;  3CDI A;  2PQ8 A;  4OU0 A;  5IP6 A;  3AG1 H;  4ANJ A;  1Z1D A;  1PYV A;  3K9T A;  1LVK A;  1J2X A;  2LOO A;  3H5A A;  1ZRF A;  2CV0 A;  2QEX I;  3HSE A;  1VQ6 I;  4ASN A;  3IWZ A;  2JA8 J;  5ICC A;  3OV8 A;  5GP9 A;  3I9V 2;  4RGS A;  3CCQ I;  3LSI A;  2E7W A;  1BI2 A;  2A61 A;  2E5N A;  3QPS A;  3ONQ A;  2VT2 A;  2BEO A;  1BC8 C;  2O5R A;  1IZ1 A;  4C3J J;  4BE2 A;  1SAU A;  5LBQ A;  3KZI C;  2GA2 A;  1YW8 A;  3PFY A;  4ESJ A;  2Q2E A;  2Q8K A;  2PI0 A;  1T08 B;  3LST A;  2CW7 A;  1HQC A;  4HW0 A;  4Q4Z F;  5EGO A;  3OYL A;  4KIG A;  1V5E A;  2IA1 A;  3H36 A;  2AO9 A;  1T0F C;  5FRO A;  4DOZ A;  3I58 A;  2X48 A;  2YPR A;  2XRO A;  2IS6 A;  1JUM A;  1JT0 A;  1S5L C;  5GPC A;  4CCK A;  1HC8 A;  4M6Y A;  3MVP A;  5DCM A;  1MDM B;  1S8N A;  3CTA A;  4G6D A;  3J7Y J;  2OA4 A;  3WTT C;  3GTJ J;  2QA4 I;  3KEY A;  3HDD A;  2M5W A;  1BW5 A;  2OJE D;  4D5F A;  3N97 A;  2DT6 A;  2I8D A;  2QSG X;  1XGO A;  4NNJ A;  3EYI A;  1WJB A;  1HF0 A;  4FE7 A;  2K27 A;  2VBX A;  1FT9 A;  3FKJ A;  4I01 A;  1W7P D;  2RC4 A;  3S1N J;  3MKL A;  1TQI A;  1AHD P;  5C44 J;  1K78 A;  2ZB9 A;  4M3D A;  3F8B A;  2L9R A;  4G6Q A;  4U0Y A;  1QVT A;  3H35 A;  2NS0 A;  3ZRG A;  1Y0N A;  4DYQ A;  1T8I A;  1MH4 A;  1L3L A;  4MTE A;  3D0S A;  2DA1 A;  2AXT C;  1OJL A;  2DO7 A;  4CHU A;  2ZME C;  2EA4 A;  4PGG A;  4AIH A;  4IHS A;  3HOX J;  2ZJP F;  3TDU C;  1N77 A;  2R5Z A;  1IGN A;  1P9Q C;  2FEZ A;  5D5V B;  5L3F A;  3F22 A;  4CCM A;  4AIJ A;  4UB6 C;  1LB2 A;  2R5Y A;  3NEU A;  1P7J A;  1XSV A;  2M2E A;  4HQE A;  3VFZ A;  3V8J A;  1N75 A;  1R22 A;  1YW9 A;  4XOT A;  3U1K A;  4IHX A;  3RYP A;  4E7L A;  2GA1 A;  3OIO A;  5KK1 A;  2HU9 A;  2FBH A;  4J01 A;  2HPM A;  2NS7 A;  1J7K A;  2LKP A;  1QRY A;  3IAM 2;  1JE8 A;  2XHK A;  3RI4 A;  3OWT A;  4U88 A;  2XF6 A;  3KFW X;  4HEA 2;  3S1R J;  3BZ6 A;  3PSI A;  1E0E A;  5HNF A;  3HHG A;  2NVY J;  4GGG A;  1U9N A;  3BG5 A;  2EZI A;  3OSG A;  3BCB A;  2QBY A;  3DTK A;  2DJN A;  3NRV A;  1IXC A;  1KON A;  5IY5 H;  2ZJ2 A;  3DLL F;  4UVA A;  1X1C A;  1D0X A;  1VQK I;  3ISP A;  2BY1 A;  4HX7 A;  1EKE A;  1TW2 A;  5DEQ A;  2QSH X;  3AKZ A;  4FET A;  3F8N A;  3MKW B;  3HSR A;  1FEX A;  2HDW A;  3FHZ A;  3DCF A;  1HCR A;  3I4N J;  4ON0 A;  1YG2 A;  3SDG A;  3SJM A;  1T2K A;  3MKY B;  5JLW A;  2WV1 A;  1K6O A;  1E3P A;  2H1L A;  2H6C A;  2VE9 A;  2CGP A;  2GXB A;  4F55 A;  1FBQ A;  1VQ5 I;  3HOS A;  5DUK A;  2ME6 A;  3EUA A;  4O6J A;  5D5X B;  3W2V A;  3GFI A;  3ECH A;  2XGX A;  4D0P A;  3WHB A;  3J80 Z;  5AIQ A;  3TW7 A;  2YS9 A;  3ROU A;  4KDP A;  1XTA A;  1ULY A;  2DPU A;  2DMU A;  2F48 A;  3Q3S A;  5ERI A;  3KX2 A;  4I98 B;  3IKT A;  3E5U A;  4C2U A;  3BZK A;  3CLQ A;  3EUH C;  5KAI C;  1F43 A;  2OC6 A;  1SMT A;  5BQT A;  3JRD A;  2FE3 A;  2H1K A;  3KP2 A;  2FQ3 A;  3ESW B;  2DW4 A;  2BXZ A;  3OL4 A;  2E1M C;  4L9J A;  4GFB A;  1S7A A;  2F5E A;  2VT3 A;  4XRM A;  2VUM J;  1U5T A;  1I1G A;  2JUG A;  3F8M A;  3R6S A;  4WWC A;  3GF2 A;  5HLH A;  5EGO B;  2KIQ A;  5BS6 A;  4C9Y A;  1SD4 A;  1YYV A;  1M1E B;  3CJQ B;  3BR6 A;  1FJL A;  1B9N A;  4II3 A;  5BPD A;  2P7V B;  1GT0 C;  3VB2 A;  1FC3 A; 
#chains in the Genus database with same CATH homology
 2K9Q A;  5EYR A;  5J3L A;  2MSY A;  2AHQ A;  1JUP A;  2Y30 A;  1IUF A;  4V2F A;  1B8I B;  2LD5 A;  1TWH J;  3A01 B;  5J1Y A;  3FK6 A;  1NK2 P;  4XIC A;  2Y2Z A;  3JR9 A;  1MBF A;  2Y31 A;  2R7Z J;  1ORK A;  5FKO A;  3B6A A;  1YRN B;  1JUS A;  2O9L A;  1OCT C;  4MLO A;  1MBE A;  1WPK A;  1POG A;  3Q0U A;  4D7M A;  1WH5 A;  1B72 A;  3IH3 A;  2ECB A;  1VND A;  2ID6 A;  2DA6 A;  1H88 C;  2JJ7 A;  2DA3 A;  3GTG J;  1RET A;  3ZQF A;  1PUF B;  1TWA J;  1LE8 B;  2GM4 A;  4A3M J;  3WHC A;  2E1O A;  4Y7N J;  3ZQC A;  2DN0 A;  5K7H A;  2R5Y B;  5FJ8 J;  4RDU A;  3VPR A;  2EZL A;  4DZP A;  4BY1 J;  3B6C A;  1JJ6 C;  3G1L A;  1ETQ A;  4HNV A;  3NAR A;  3A02 A;  2MGQ A;  4AYB N;  2YU9 J;  2KDZ A;  1EF4 A;  1XG1 A;  1WGX A;  4W1U A;  3TW6 A;  5F04 A;  2JK3 A;  3RZD J;  2PMZ N;  4FCY A;  1XC5 A;  2YUS A;  3IH4 A;  1Z0X A;  1MSF C;  1SFO J;  4A3I J;  3HOZ J;  1H8A C;  2GLO A;  4ABZ A;  1I6H J;  1OCP A;  2DA5 A;  5K7Z A;  3RKQ A;  2L7M P;  5EZH A;  5FKK A;  1ETO A;  4A3C J;  1MBK A;  4G12 A;  2XGC A;  1IC8 A;  4D5C A;  3L1P A;  3M3Y J;  2LTP A;  2IBD A;  3HB9 A;  2TCT A;  4CYC B;  2LLK A;  1VFC A;  2G0E A;  5FKM A;  4FIS A;  1G2H A;  3LNQ A;  1ITY A;  4IHW A;  3CMY A;  4BKX A;  4A69 C;  2FD5 A;  1XS9 A;  1IJW C;  2R92 J;  3HM5 A;  3BR3 A;  5K7F A;  2XB0 X;  2E2J J;  2XB5 A;  3BG9 A;  2HDD A;  2HXO A;  5FKN A;  4A3D J;  3JRB A;  2VI6 A;  1X58 A;  1IRZ A;  3ZQL A;  2W48 A;  4BBS J;  3BQY A;  3FK7 A;  3CDL A;  3RZO J;  4V2G A;  4QTR A;  3C2B A;  1APL C;  4A3J J;  2IEK A;  3BTJ A;  4B3A A;  1U9O A;  2Y0S N;  3G1M A;  5F0C A;  1WCM J;  4JYK A;  2EQR A;  2X9D A;  5EEA A;  4IHV A;  1LFU P;  1QVU A;  2L7Z A;  4NDL A;  2DA2 A;  2M8G X;  4C3H J;  2E19 A;  2CQQ A;  1U78 A;  2M9H A;  3HOY J;  2JA6 J;  2WB1 N;  4LOC A;  2EZK A;  4MIM A;  3ZOB A;  1ETK A;  4C2M J;  5IYB J;  2WAQ N;  4S0H B;  2JA7 J;  1BW6 A;  2LVS A;  5FLM J;  5EG0 A;  1U8B A;  1AU7 A;  1UMQ A;  5F27 A;  3BTL A;  5IP7 J;  2L0K A;  1BL0 A;  3S2D J;  5J1R A;  2JWT A;  2N8G A;  1HDP A;  1WI3 A;  1ETV A;  4I6Z A;  2LKX A;  1ZTR A;  4UUT A;  4L5E A;  2Y9Z A;  1ZK8 A;  5FLV A;  5E3L A;  2LFB A;  1B8I A;  1IV6 A;  5M5X J;  2VPR A;  3W6V A;  3A01 A;  2XPV A;  3K7A J;  3BG3 A;  3FIW A;  1F36 A;  4JX5 A;  3JRI A;  1YRN A;  1TWG J;  5E3O A;  1JKP C;  1TWF J;  4A3E J;  1T56 A;  2O8K A;  4QIW N;  2MW8 A;  5E3N A;  4BXX J;  3S17 J;  9ANT A;  2EZH A;  1A5J A;  5F0H A;  1FIP A;  2LR8 A;  3BR1 A;  5F1J A;  1FTZ A;  5GPA A;  2R5Z B;  1RKT A;  3UKG A;  3TP0 A;  4B1R A;  2NOG A;  1MBJ A;  3LOC A;  3A03 A;  2CUF A;  4XRS G;  4Y52 J;  2DMN A;  5F0F A;  4X1E A;  2CRG A;  2X6O A;  4W97 A;  4EEF G;  1HLV A;  1E3O C;  5C4X J;  2NS8 A;  3CCY A;  1PUF A;  2HOS A;  2IAI A;  1D5Y A;  2EH3 A;  3E7L A;  1HOM A;  2NVT J;  1JKO C;  3BTI A;  3HGY A;  3OSF A;  2JA5 J;  3BQZ A;  1H89 C;  2HYJ A;  4DZJ A;  1JTY A;  2JMW A;  1JTX A;  1OFC X;  1JGG A;  1DU6 A;  1O4X A;  5C3E J;  3QQA A;  2DMT A;  3BR0 A;  1UHS A;  2E2I J;  3GTM J;  1ETX A;  3GTK J;  1MH3 A;  3I4M J;  1MSE C;  1GV5 A;  1P7I A;  2QCO A;  4D7N A;  3BR5 A;  4AC0 A;  1IDY A;  5IPA A;  3GTL J;  2CUE A;  3S2H J;  1BA5 A;  2DMQ A;  2XSD C;  2NVX J;  3PM1 A;  5C4J J;  3JRA A;  3QPL A;  2R93 J;  3LSR A;  4UUS A;  1I50 J;  1MNM C;  4XID A;  1GVD A;  3NAU A;  5IP6 A;  1ETW A;  2HOA A;  5IYC J;  4M3B A;  3GTP J;  2GBY A;  4BY7 J;  2K9S A;  2HXI A;  1S7E A;  1VI0 A;  2COB A;  2JA8 J;  4B4C A;  2DMP A;  4M3E A;  3ZQI A;  5GP9 A;  3S15 J;  1QPI A;  2ECC A;  2D5V A;  3LSJ A;  3QPS A;  4QSH A;  4C3J J;  1W0T A;  4A3K J;  4IHY A;  4A3B J;  2LK2 A;  3Q0V A;  3D1N I;  1IG7 A;  5IYD J;  2HQ5 A;  5M5W J;  4M3F A;  2XGD A;  1AKH A;  3BTC A;  2ID3 A;  3ZQG A;  5EGO A;  5IOZ A;  2LP0 A;  2RAE A;  4A3G J;  1ZGW A;  2AO9 A;  2VKV A;  5M3M J;  5HOD A;  3M4O J;  2LY9 A;  1GDT A;  3DEW A;  4M3G A;  2X48 A;  1Y1V J;  2KT0 A;  1MBG A;  2CQX A;  3S1M J;  1JUM A;  1JT0 A;  2CU7 A;  5GPC A;  2OF7 A;  3MVP A;  1ETY A;  4MFD A;  4J19 A;  3HKZ N;  1ENH A;  3S16 J;  3Q0W A;  3BT9 A;  3JRE A;  4M6V A;  3GTJ J;  3HEF A;  4A93 J;  3HDD A;  3GTQ J;  1BW5 A;  2DTZ A;  3H3V K;  2TRT A;  4D5F A;  1HF0 A;  4JP0 A;  4FE7 A;  1JT6 A;  1DU0 A;  4FE4 A;  4MO7 A;  2MG4 A;  3S1N J;  1HDD C;  3MKL A;  1AHD P;  1A6I A;  1NTC A;  5FKL A;  2ME0 A;  5C44 J;  2ZB9 A;  4M3D A;  5M5Y J;  3JRH A;  2L9R A;  4C3I J;  1RR7 A;  1B72 B;  1QVT A;  2JN6 A;  4XK4 A;  3PO2 J;  2FJ1 A;  4DYQ A;  2B63 J;  1MH4 A;  1CQT A;  3HOU J;  2DA1 A;  1NK3 P;  4XRS A;  1OJL A;  5DTD A;  3TP3 A;  3JRF A;  1ZQ3 P;  3FKI J;  1UG2 A;  3HOX J;  4IEJ A;  1BJZ A;  1LE8 A;  1MBH A;  1GV2 A;  1X2N A;  1ZR2 A;  2R5Z A;  1IGN A;  1X2M A;  2P81 A;  1VF9 A;  1FTT A;  3TED A;  4MFE A;  2R5Y A;  3IV5 A;  1P7J A;  2M2E A;  4DW6 A;  5EZG A;  2E2H J;  2QF7 A;  5IP9 J;  4IHX A;  1TWC J;  3S1Q J;  1RES A;  1RPW A;  3OIO A;  2FQ4 A;  2NS7 A;  3HOV J;  1GUU A;  2Y9Y A;  4I76 A;  5JLX A;  3LSP A;  1QRY A;  2I10 A;  2OPT A;  4JX6 A;  3S1R J;  2L7F P;  2O7O A;  1FIA A;  4AUX A;  1W0U A;  2NVY J;  1U9N A;  2K40 A;  2EZI A;  3BG5 A;  3OSG A;  3GTO J;  2ELK A;  2VKE A;  2M0C A;  1JKR C;  2HI3 A;  2HOT A;  1Z77 A;  2DJN A;  3FIS A;  3K2A A;  4CYC A;  1K83 J;  1T33 A;  3F0C A;  1Q1V A;  3HGG A;  1Y1W J;  4FTH A;  1FEX A;  1WH7 A;  2R0Q C;  3I4N J;  1I3Q J;  3DCF A;  3ZQH A;  4UUS B;  1HCR A;  3LSG A;  3SDG A;  1TC3 C;  3SJM A;  5JLW A;  2WV1 A;  3HBL A;  2M34 A;  3RQI A;  2ME6 A;  1ZR4 A;  4DYC A;  1R9T J;  5DS9 A;  3WHB A;  1JKQ C;  3TW7 A;  2YS9 A;  5J1U A;  5F08 A;  3CQZ J;  2XPU A;  3OOU A;  3IH2 A;  2DA4 A;  2FX0 A;  4JX4 A;  4A3F J;  1IDZ A;  2K9N A;  1K61 A;  2DMU A;  5M3F J;  1RKW A;  3H0G J;  3Q3S A;  2XRL A;  5EDN A;  3S14 J;  2H8R A;  1F43 A;  3JRD A;  3MN2 A;  2H1K A;  2EBI A;  2DA7 A;  3SFI A;  4BBR J;  5EF6 A;  4GFB A;  3JRG A;  3PO3 J;  4XRM A;  2VUM J;  4A3L J;  5E3M A;  1AKH B;  3JRC A;  3BR2 A;  3O8H A;  4DYR A;  5EGO B;  3G1O A;  3GBG A;  3HOW J;  5EG0 B;  1ZKG A;  1SAN A;  2XPW A;  3BR6 A;  4X6A J;  1FJL A;  5IOY A;  2NVQ J;  1JJ8 C;  5BNG A;  4RBO A;  3O8G A;  2CJJ A;  2XGE A;  1GT0 C;  1LFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...