4BBSJ

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bbsJ00
3FISA 4QIWN 2R5ZB 4GFBA 4Y52J 2JK3A 3BR2A 2DA4A 4A93J 4NDLA 2L7MP 5IPAA 2KDZA 5F04A 1CQTA 5JLXA 4V2GA 4HNVA 2DA1A 5HODA 1DU6A 1UHSA 3F0CA 5FKOA 3LOCA 3FK7A 1JGGA 1AU7A 3S17J 1HDDC 1TWGJ 3TP0A 1WH5A 3JR9A 1ZQ3P 4A69C 2M8GX 2CUEA 1MSEC 1HOMA 2LLKA 2YS9A 2H8RA 1MNMC 3GTGJ 2HOTA 2EZKA 1LFUP 1D5YA 3S2DJ 5F0FA 4JP0A 1Z0XA 5FKLA 1B8IB 5J3LA 5EGOA 1OJLA 3G1MA 2WV1A 1O4XA 3A01B 3SJMA 4DYRA 3HBLA 2R5ZA 4A3GJ 4J19A 4X6AJ 2Y0SN 5C4JJ 1JKOC 5EZHA 3MN2A 4QTRA 5E3OA 5IYBJ 2I10A 1JUPA 3GTPJ 4Y7NJ 3B6CA 2JA8J 2JJ7A 4FE7A 4XK4A 3BG5A 1RETA 2LP0A 4S0HB 1TWFJ 1H8AC 1I6HJ 1VI0A 2HXOA 5M5XJ 2Y9ZA 1A5JA 4M3EA 1U9OA 1Y1VJ 2EZIA 2FQ4A 2ECCA 2YU9J 3HGYA 2VPRA 3S2HJ 3ZQIA 4M3FA 1JJ6C 1JKQC 5F08A 2E2IJ 1B8IA 4I76A 2LY9A 2DMTA 2QF7A 1DU0A 3A01A 1LFBA 1AKHB 3TP3A 2L7FP 2RAEA 2MG4A 4IHWA 2FJ1A 2DMQA 2ID6A 3MKLA 2VKVA 2OPTA 2DA5A 3JREA 1K83J 2EZLA 3LSJA 1MH4A 1OFCX 5FLVA 2WB1N 1MH3A 3HGGA 5DS9A 4A3DJ 2HDDA 4D7MA 2LTPA 3GTLJ 4A3CJ 1G2HA 2LD5A 4JYKA 1UMQA 2VKEA 1B72B 4LOCA 4MFEA 4A3KJ 1RKTA 1IDYA 1XC5A 4BKXA 1JT6A 4L5EA 1GT0C 1TWHJ 2XPWA 1MSFC 5EDNA 1GDTA 2O9LA 2E2JJ 2E1OA 1P7JA 3H0GJ 5K7HA 3ZQCA 1NK3P 1IRZA 1AKHA 4IHVA 2ECBA 4M3BA 2CQXA 3O8HA 3LSRA 1NK2P 2LVSA 3GTJJ 4A3BJ 1FTZA 2XRLA 1APLC 2L9RA 2LFBA 5J1UA 3RZOJ 2G0EA 4QSHA 3GTKJ 2AHQA 4C3IJ 3RKQA 2L7ZA 1WI3A 3OSFA 2NVXJ 2M34A 1GV2A 3QPLA 1B72A 4D5FA 4DW6A 3GTMJ 4D5CA 4RDUA 2IAIA 1ITYA 4C3JJ 2LK2A 2K9NA 2Y31A 3HEFA 1GV5A 4DYQA 3GTQJ 3H3VK 2EH3A 4A3LJ 5DTDA 3BT9A 3E7LA 1LE8B 2Y2ZA 3OIOA 2FD5A 3MVPA 4BY1J 1IG7A 1JTYA 1ETXA 5EG0A 2DMPA 5J1RA 4M3GA 1RPWA 5EZGA 2M2EA 1A6IA 4W97A 4B1RA 4DZJA 3S14J 2HQ5A 5K7ZA 1BL0A 3BTLA 1VF9A 1WPKA 1IGNA 3HOZJ 5GPCA 1F43A 5GP9A 3IV5A 2TCTA 5E3NA 5E3MA 1JJ8C 2CJJA 1ENHA 2X48A 5BNGA 3M4OJ 3D1NI 1IC8A 1LE8A 1ORKA 3DCFA 5M3FJ 4MIMA 1TWCJ 3ZQFA 1MBFA 4IHYA 3HOXJ 1AHDP 2LR8A 3PO3J 1R9TJ 3IH3A 1H89C 3M3YJ 2TRTA 5IOYA 3K2AA 4MO7A 1QPIA 3BTCA 5IYDJ 2AO9A 3BR0A 2NS7A 3JRDA 3K7AJ 1JTXA 4FE4A 3HOUJ 3PO2J 1JUMA 2ME6A 5E3LA 4UUSB 1X58A 2N8GA 3B6AA 2R7ZJ 1ZGWA 1IJWC 4FTHA 5IP9J 3BQYA 4XRSA 3I4MJ 1HLVA 1PUFB 4DZPA 2O8KA 3A03A 3ZQHA 2NVQJ 4XICA 4BBSJ 4A3IJ 2H1KA 4AC0A 2M0CA 3BR6A 1GVDA 5FKKA 1WH7A 2ID3A 3NAUA 3Q0UA 2EBIA 2DMUA 9ANTA 1X2MA 2JA6J 2D5VA 2HOAA 3HOYJ 4JX4A 3SDGA 3S15J 1U8BA 2QCOA 3LNQA 2P81A 1ETOA 1FIAA 2DA6A 1FEXA 1I3QJ 4AUXA 1RKWA 1W0TA 4ABZA 2XPUA 4UUSA 2DA2A 3ZQGA 2FX0A 2OF7A 1TWAJ 2XGCA 2ELKA 1PUFA 4BXXJ 1MBHA 5FJ8J 2R0QC 1MBGA 4B4CA 2XGEA 2R5YB 3CDLA 4A3EJ 1JUSA 1JKRC 1HF0A 3HB9A 3DEWA 2Y9YA 3ZOBA 2KT0A 1Y1WJ 3LSGA 1FIPA 4C3HJ 3HM5A 5F0HA 5EF6A 1RR7A 1ZTRA 3BTJA 3BR3A 4DYCA 1SANA 2JN6A 3GBGA 3OOUA 3S1RJ 4A3FJ 3S16J 3JRGA 1MBKA 5IYCJ 3QQAA 1T33A 4JX6A 2MGQA 3S1NJ 1POGA 3JRIA 1E3OC 3WHCA 5IP6A 1ZKGA 1VFCA 1ZR2A 1K61A 1WGXA 2R5YA 2HOSA 2Y30A 3Q0VA 5K7FA 5FLMJ 1VNDA 2NVTJ 4CYCB 2DN0A 2PMZN 3ZQLA 3UKGA 1TC3C 2DJNA 2JWTA 2XB0X 3RZDJ 1GUUA 4G12A 1IUFA 3S1QJ 4FISA 5C44J 5JLWA 5F0CA 2E2HJ 2VI6A 3HOVJ 3HKZN 1U9NA 3TW6A 2JMWA 1MBJA 4D7NA 5M3MJ 1S7EA 4M6VA 3TW7A 2JA5J 1P7IA 2R92J 1ETQA 2XB5A 1YRNB 2IBDA 4XRMA 1Z77A 1RESA 2VUMJ 2XGDA 1XS9A 1H88C 2NOGA 2X6OA 2GBYA 4CYCA 1JT0A 1HDPA 2XSDC 2XPVA 2GLOA 1IDZA 1ZR4A 2DA3A 5EEAA 3I4NJ 4EEFG 2JA7J 1ZK8A 4AYBN 5M5YJ 2B63J 3G1LA 1IV6A 2HI3A 4UUTA 1T56A 1OCPA 2ZB9A 4A3JJ 3IH2A 2HXIA 3JRHA 1WCMJ 3Q0WA 2EQRA 3IH4A 4A3MJ 5F27A 5J1YA 3A02A 2K9SA 3O8GA 3RQIA 4JX5A 2X9DA 3QPSA 2K9QA 1YRNA 5GPAA 5EYRA 2NS8A 1Q1VA 4IEJA 3CMYA 3TEDA 1ETYA 2DA7A 2L0KA 4MFDA 2COBA 2K40A 2O7OA 3WHBA 4FCYA 3BQZA 3W6VA 2DTZA 1ETKA 1ETVA 2WAQN 2CQQA 1NTCA 5IOZA 3C2BA 1BJZA 1XG1A 2E19A 4RBOA 1W0UA 1ETWA 2IEKA 3HOWJ 1BA5A 1QVTA 4IHXA 5IP7J 3VPRA 4XIDA 3JRCA 2W48A 2CUFA 1EF4A 1FJLA 3SFIA 1BW5A 2EZHA 2LKXA 2HYJA 5FKNA 1UG2A 2CU7A 2M9HA 1I50J 1FTTA 5C3EJ 3LSPA 4BY7J 3HDDA 5C4XJ 1F36A 5F1JA 3CQZJ 3Q3SA 2DMNA 2MW8A 4I6ZA 3PM1A 1MBEA 4BBRJ 3BTIA 3L1PA 3JRFA 3JRAA 5M5WJ 5FKMA 3BG9A 4M3DA 3BR1A 1SFOJ 1JKPC 3BR5A 2CRGA 3S1MJ 3G1OA 3GTOJ 3JRBA 2MSYA 2GM4A 4XRSG 3FKIJ 2YUSA 3OSGA 1HCRA 5EG0B 4B3AA 4W1UA 4MLOA 2R93J 1X2NA 1BW6A 2ME0A 2NVYJ 3CCYA 3FIWA 1QRYA 3BG3A 4X1EA 1QVUA 1OCTC 4V2FA 3FK6A 4C2MJ 5EGOB 3NARA 1U78A
chains in the Genus database with same CATH superfamily
3FISA 4Y52J 1TQIA 3BR2A 3TBIA 2L54A 2IRFG 5FGMA 2VKHA 2A68F 1HKSA 2LY1A 5J4VA 1CQTA 2PMUA 3QAHA 4V2GA 5HODA 2P7CB 3FK7A 3DPUA 1F4KA 3GVAA 4EJVA 5ILUA 3W6JB 3JR9A 1BR4A 2DPUA 4HF1A 2CUEA 4GXOA 2IT0A 1YITI 3WTXC 2YS9A 2XUBA 2A69F 4BQOA 4HF0A 4BGDA 1MJ9A 2XAQA 3ESWB 5FKLA 2ZNZA 2GA2A 1G59A 1B8IB 2W57A 2XF5A 3K2ZA 2R5ZA 1HC8A 4E7JA 4J19A 2HQRA 3TQNA 2V9PA 2Y0SN 2TDXA 1DPUA 2F6CA 5LD2C 5LEKA 2NRAC 2A6EF 5F64A 2CSOA 2JA8J 3B73A 2VC0A 2QBYB 2KL4A 2A6HF 1H8AC 4B43A 3RKXA 1VI0A 5DV5A 4IF4A 1GHCA 5M5XJ 2Z9OA 5AONA 4BQNA 1IZ1A 1U9OA 2FNAA 2XAUA 4ZYDA 2YU9J 3K9TA 1AOYA 2LDUA 2WA0A 2CH0A 2NVUB 1JJ6C 3MQ0A 4P1WA 3REOA 1V55H 2XHKA 4RM3A 2DMTA 5B66C 3X2QH 1SD5A 4N0BA 1VQ9I 1B9MA 4BNCA 3EPZA 3OYAA 1AKHB 3WG7H 2L7FP 5HLTA 2ZBKA 1REPC 2MG4A 2RQQA 1OLTA 2QZ8A 2ZJRF 3LSMA 3OYBA 2QQ9A 2WB1N 1MH3A 3DF8A 3SDBA 1HW1A 1RI7A 2XAGA 3BG6A 1D1BA 1WJCA 4A3CJ 5CVUA 1OCZH 4L18B 1UMQA 3ABTA 1RKTA 2IPQX 4XMYA 1HSJA 4NBQA 1ZRDA 3KP3A 4RA2A 1GT0C 2V1NA 1XGNA 5EDNA 1BOAA 3I56I 2HS5A 3NWSA 1PP7U 4RGXA 2MC3A 5K1YA 3ZQCA 3ZGKA 1IAWA 2E71A 4WX9A 5LGUA 2DLLA 3V7RA 1YX5A 2EWNA 3DP7A 1H9GA 4XLCA 1ZYRF 1NK2P 3F72A 1IRFA 3WU0A 4M71A 1XGOA 3TL4X 3CCMI 2QSFX 4ENMA 5JVGF 3RZOJ 4BXFA 4BS9A 2G0EA 5D4SA 4L0YB 4NQWB 1LFPA 4E7IA 2L7ZA 3HXLA 3ZMSA 1OPCA 1VQ4I 5EEGA 5LFAA 2K27A 1USTA 1X4PA 3H9QA 3ZQQA 1B72A 2XASA 1UELB 4D5FA 1O3TA 1BC8C 5EEHA 2DBBA 4D5CA 3BP8A 5H6RA 3E6MA 3B02A 3IP4B 5E18F 3BT9A 2GXGA 2R7RA 4FT8A 1R49A 3QP6A 1KU7A 2A5WA 2BBYA 2V6CA 4AWXB 1IG7A 1JTYA 1ETXA 4KFCA 2KJCA 4M9XA 1QZEA 2ZNYA 2IA0A 4M3GA 1A04A 1RUOA 2DYSH 4W97A 3OR1C 2PBIA 4B1RA 3BROA 4XOPA 4DZJA 3IKTA 4EMSA 2R7TA 3A2KA 2D2WA 2OQRA 4RGSA 3C2GA 4GYIA 2O5RA 4UVCA 5ERIA 5K7ZA 4JOMA 3DKYA 1BL0A 3SFZA 4N4NB 2VOPA 1OR7A 3M7GA 4L9TA 3MWMA 3J81K 2IGNA 2Y48A 1SD6A 1F43A 2MD0A 3K4KA 3CUOA 4RAZA 2DTRA 2TCTA 3RYPA 3RDIA 2CJJA 5FROA 1R22A 3QYBA 3VWBA 3OR2C 1OCRH 1IXSB 2ZJ2A 1IC8A 1S72I 2ZFWA 1LE8A 2R7UA 5GADJ 2PQ8A 4MIMA 1VQLI 1TWCJ 2DFFA 2X1EA 3CF5F 1CF7A 4Q5SF 2XV4S 1AHDP 1BI2A 2FA5A 5D8KB 3DEEA 1FZPB 3ONQA 2K4BA 4I98B 3K2AA 3A4CA 4GYGA 1HA8A 1WVRA 1ACIA 2WTEA 4A12A 1E17A 1QQIA 3EDPA 2AO9A 3BR0A 2FSWA 1QHGA 2B0LA 3M8FA 1YQAA 3I5UA 4I01A 1WRJA 2QWWA 5HLIA 4UUSB 2KFDA 5KK1A 4G6QA 5IP9J 3LL7A 1X1DA 5ILVA 2MYSA 1KU9A 1L0OC 1LVKA 4HZFA 3ABLH 1R1TA 2O8KA 2B7EA 3A03A 3DU5A 4MEYF 1U5TA 1XMXA 5LGTA 3OY9A 1KZHA 3H92A 4F3QA 5FKKA 4Y15A 3NAUA 2EBIA 2DMUA 3EYIA 2L7KA 1HXDA 1Z67A 2MBFA 1BIBA 2OA4A 1R23A 1HKQA 3KCCA 1TBXA 4FX0A 4XKBA 3OYNA 4UV9A 2IA1A 2JA6J 2FE3A 3IWZA 4Y13A 2VLAA 2KIFA 4PJMA 2UUZA 4WXCA 3LNQA 2P81A 1SVMA 4V19K 2DOAA 1FEXA 1P2FA 4U88A 1VQOI 2DA2A 3O2PE 3ZQGA 2FX0A 2OF7A 2E1MC 5CVRA 1H9TA 1TWAJ 5K5RA 2VQCA 5FB2A 1PUFA 3MAJA 4BXXJ 4BUPA 3HRMA 2R7OA 3H3UA 4L5JA 3CDLA 3NEUA 4HSRA 2YR2A 1HF0A 3GLLA 1B1BA 3K0LA 2E7XA 3DEWA 1VQ5I 3OMYA 2KT0A 2B9SA 1Z7UA 1Y1WJ 3WTYC 2MH9A 3AAFA 3MZHA 1FPQA 2ICWG 3IAM2 5EF6A 1FYMA 4YFXF 3O3KA 3BR3A 1AA7A 1W5SA 2O03A 1RRJA 1BI3A 3E5QA 3FM5A 4XNFA 3CO7C 5IYCJ 3QQAA 1TZLA 1W7PA 1X1PA 4IVNA 3SZPA 4I02A 2KHMA 2LY2A 1LDDA 1Q1HA 1O7FA 3JRIA 5IP6A 2OZUA 5TJJA 1QPMA 4HV5A 1J0RA 2QQ8A 1P92A 5KAFC 3QOPA 2QKLB 1WGXA 2HOSA 4KIFA 5LGNA 4ETSA 3F8CA 2KLOA 1WQ2A 2M0MA 3UR3C 3ZQLA 1WSUA 4LJZF 1XGSA 3ZQ7A 2XB0X 2IS4A 4CO8A 4XR6A 3KZIC 1VQMI 4DQ2A 5FD6A 2EJRA 2VBZA 5BMZA 2GXAA 3CD6I 2VI6A 4Q48A 4XLPF 1J75A 3HOVJ 2MD5A 1U9NA 4LIVA 4R79A 1Z3YA 2VONA 3TW6A 2CFOA 1MZBA 2Q2EA 2OJED 2HGCA 4HEA2 5LRSA 2QM3A 2JA5J 2LG4A 3F6VA 4NB5A 1P7IA 5E79C 2O61A 2R92J 1ETQA 2XB5A 2E7WA 1YRNB 4PCQA 1RESA 1Z77A 2XGDA 5IT3A 3OYMA 1LB2A 3PQJA 4HDVA 2JVGA 4CYCA 4B44A 4O6JA 2XPVA 1IDZA 1VQNI 3H5RA 4EEFG 4OIRF 1M1EB 3ZRGA 4PDKA 5E8IA 3HRUA 1XDUA 4PSWA 3G1LA 4KUMA 3HL2A 2RQPA 2HI3A 1BR1A 3G3ZA 2CWEA 4A3JJ 4G7OF 3DXJF 3IH2A 4KIBA 3JRHA 2W84A 4RAFA 3Q0WA 2EV6A 2E34A 2GOXB 4L0ZB 4G94A 4YIRX 3LWFA 2F4OB 2XAHA 4JX5A 1GLNA 1XGMA 2L02A 3C2HA 3OWTA 3QPSA 1P9QC 4FETA 3V4GA 2ZO4A 3N97A 5FRNA 1ZG1A 4A0ZA 2O6GE 1F1ZA 2ZKZA 2NS0A 2KIUA 3N05A 4HX7A 4HOBA 4IEJA 4KJZA 5J6XA 3CMYA 4HQEA 2DA7A 2D1HA 4B8XA 2K3PA 3W6KB 3T8RA 3Q5FA 2XC7A 5JVTA 1VQ6I 5DUKA 1IN6A 2DTZA 4E7SA 4HLXA 4LGWA 1DP3A 3D5RC 2BGCA 1NTCA 2CQQA 2RREA 3RPUA 2DI3A 3C2BA 1UJ8A 1BJZA 1V54H 4OWRB 1YS6A 4RBOA 1TTYA 1XD7A 3CDIA 2FQ3A 1T08B 1ETWA 1NG6A 2BXZA 1QVTA 5KNLA 3HUGA 3J7YJ 1IN8A 2W48A 4E6KG 3SFIA 2UZKA 1BW5A 2O3FA 4KISA 2RVCA 2CU7A 1SFXA 3MCZA 3RPQA 3CMEI 1FTTA 3OV8A 3TKYA 1I27A 4CCMA 5C3EJ 1LPQA 2DAOA 4LG3A 5FFXA 4BY7J 2WAQA 1FYLA 1YS7A 1R5ID 2MW8A 2PN6A 3ZMDA 4XKWA 3PM1A 3SZGA 1MBEA 4BEHA 3I55I 3L1PA 3JRAA 4LLGF 2K02A 4HAMA 4M9ZA 3BLYA 5FKMA 2GWRA 5DD8A 2HVSA 1SFOJ 3BR5A 2CRGA 3KPHA 4KA4A 3JRBA 5J40A 3DBLB 1S29A 2A5YB 3FKIJ 4MQ9F 2CUJA 2F4MB 2ZCWA 2DPDA 4D9JA 3Q9SA 3I3LA 3K6GA 1G8XA 2XVCA 1X2NA 2IGKA 3M1EA 2W82A 4UB6C 2NVYJ 3V8KA 2RKHA 3CUQC 3FKJA 5D6FA 3FIWA 3BG3A 1OCTC 4HDUA 2P8TA 6PAXA 3E97A 2V26A 3FK6A 1I3AA 3QYEA 3FM3A 4ITVA 1YG2A 5B5EC 4C2MJ 5EGOB 3NARA 4IZZA 5D5WB 1U78A 3CLQA 4AIJA 2GAUA 4QIWN 1ZG3A 1SFUA 4GFBA 2LRDA 3BWGA 4KN4X 1K6YA 3GW2A 5F04A 3ABUA 5A2QZ 5JLXA 3PIPF 3W2AA 3F3XA 4HV6A 1X3UA 3F0CA 4QWQA 3CCVI 3S17J 2BEOA 2IP2A 3FMSA 3I59A 1RNLA 2FBHA 1IXRC 5KAIC 4A69C 4UNOA 2VC1A 4IQ4A 2M8GX 3DEUA 1FP1D 1MSEC 2HTJA 4EVIA 1LUJB 2J5PA 3VSKA 1KYZA 1ZLJA 4YELA 2RC4A 4HBLA 5HS9A 1OJLA 4A6EA 1QBJA 3LSIA 3A01B 2K5CA 1T2KA 4DYRA 2HKXA 1SFKA 1Z3XA 3HIFA 3JSOA 4LK1F 2DO7A 2EPFA 4CICA 5LBQA 5C4JJ 2CQNA 5EZHA 3MN2A 2DCEA 5IYBJ 3CJQB 2I10A 1X4OA 1XSXA 2VQGA 5CVIA 4A2UA 2STWA 2J5OA 2JJ7A 4I2OA 3LQQA 4XK4A 4XLAA 3DBRB 2ZJQF 1MMAA 1MDMB 3F6OA 3AG1H 5HDKA 3K1MA 4PFOA 3F21A 2Y9ZA 4M3EA 2PLYA 2Y0SA 5D5VB 1Y1VJ 2HU9A 5FLXZ 4BYYA 4FX4A 3ABKH 3IRQA 4CCLA 2ELHA 2G7HA 1B8IA 4L5IA 3H9GA 4LITA 2QF7A 3R6SA 2FBKA 1DU0A 1LFBA 1K4SA 1ZRCA 3TP3A 4RAYA 1FWZA 4F52A 1R36A 2ID6A 1JHFA 2VKVA 3BZKA 5B1AH 3JREA 1MH4A 3IHUA 1WKMA 3F23A 1CGPA 1OFCX 2VE8A 1D0ZA 3TO6A 3HGGA 2Z1DA 5DS9A 3HRSA 2P0WA 4KN7X 4D7MA 3ZXSA 2K9LA 3EYYA 3FF5A 3HTUA 3V8JA 4N9IA 2LD5A 2K3FA 2A6TA 4JYKA 4DNCA 4LOCA 3I0TA 2X4HA 3GZNB 1MKMA 3J80K 4BKXA 4DBRA 1JT6A 3KEQA 1TWHJ 2JPBA 2FRHA 4AU7A 2DFHA 2CV1A 2EK5A 1DDNA 2DFEA 1P7JA 3KP4A 1YX3A 2WB1A 4FQGA 1HSTA 2Y75A 5K7HA 1NK3P 4XLEA 1VZ0A 1AKHA 5FRMA 1R00A 5IT9Z 3FXUA 4G6DA 4M3BA 4ZYAA 2AQEA 3KYLA 3O8HA 1FTZA 5ICFA 5JR3A 2ADUA 2LKSA 3I54A 1TLHB 2L9RA 4PK4A 4QSHA 3GTKJ 2DT7B 3CP2A 3KE2A 2W00A 2JRMA 3KEOA 3GUDA 1BJAA 1VQKI 4EJUA 3OSFA 5DCMB 1GV2A 3DU6A 5L3BA 1U2WA 1W7PD 4C2TA 5ICEA 2MLKA 3K1PA 4F92B 4KMFA 4RDUA 1KYWA 1R5HA 3W2VA 3WTWC 2LK2A 3BDDA 2Y31A 3HEFA 4DYQA 3H3VK 2Y2ZA 2ZMEB 1GXPA 1QU3A 4M72A 1ON2A 4L9NA 2IS6A 2BHYA 1EJ9A 2QSHX 2WAEA 4RGRA 1SEUA 2JT1A 2LYCA 2XRNA 3RTRA 5EG0A 4KDPA 2W25A 4ON0A 2DMPA 4XL9A 5AIPA 4RB1A 1MIJA 3AL0B 1Z05A 4OMYA 1QZZA 3BTLA 1EA3A 1JXSA 1IGNA 3C7JA 1SC7A 4NHJA 1ZAOA 2LKPA 1R7JA 5E1ZB 5E17F 2VL8A 3LA3A 4XKCA 1EH7A 5LLQA 5E3NA 1X3ZB 5E3MA 1JJ8C 3IAS2 1ENHA 1USSA 2X48A 3LAJA 3M4OJ 3D1NI 1LQ1A 1VQ7I 4B09A 2RNJA 1QHHD 2XSJC 4EATA 5M3FJ 3ZQFA 4ESFA 3FX3A 4AD9A 2LR8A 1T8IA 4E7ZA 4G9YA 2Y0MA 4LG0B 2M8EA 2HWVA 2HZDA 5IOYA 3SZTA 1UHMA 4MO7A 2A61A 3PUFA 3S32A 4J00A 2CUZA 3ASNH 2NS7A 3JRDA 1YO5C 4IL6C 3E5UA 4FE4A 4S05A 2JA2A 2CV0A 3B6AA 1ZGWA 4G7HF 4FTHA 2BHZA 2I5UA 3BQYA 2X51A 1NHAA 1R4MB 1TNSA 4DZPA 4KITB 2UWMA 2OD5A 1HW2A 3VOEA 4BBSJ 4XONA 2CQ7A 2HNHA 5D5UB 3CCRI 1A36A 5L3CA 2H1KA 2W7NA 2R7SA 2IXSA 2M0CA 1FOWA 3SHFA 5LHIA 2K9MA 1GVDA 2F2EA 1XX5A 2ID3A 2Z99A 2KRFA 2L4MA 2OCCH 2EIKH 2K86A 4I0BA 3RPUD 4DOZA 3VB2A 3OYCA 3KP5A 4RLQA 3HOYJ 4JX4A 1U8BA 2QCOA 3ZCOA 1D8KA 1FIAA 2FOKA 2KIQA 2H6CA 2KRCA 1I3QJ 4AUXA 1RKWA 3ELKA 3JAMK 2EA4A 2XPUA 3PNVA 4UUSA 4MTDA 4CHUA 2X6XA 5FO5A 3OS1A 2L5QA 3WG9A 1MBHA 3RYRA 3AG4H 4CGZA 1ZG5A 1MBGA 4LK0F 2XGEA 2R5YB 3GFLA 3T0YA 1FLIA 3PNTA 4P55A 5HNHA 1X3WB 2H09A 2BY2A 2VQHA 2Y9YA 3CP8A 3VYUB 4ZYHA 3EUKL 3L00A 2VN2A 1O7LA 4CYDA 5HVQC 3EUHA 4OIPF 4OAYA 2JN6A 4NNJA 4P9UA 3S1RJ 3CCQI 3G4SI 3GLXA 4WXDA 1MBKA 3JRGA 1T33A 1S9HA 1XTAA 2BY3A 3L2VA 2MFZA 1V5EA 1KQ9A 1POGA 2EFOA 2JZYA 1DPRA 5ICCA 1E3OC 3WHCA 4I99C 1VFCA 1EH6A 4RAGA 3PFIA 4E4HA 1U8RA 1ZGJA 3AKZA 1YIOA 5CJ9A 1K61A 4LLLA 2JTVA 2UV1A 3Q0VA 3HG9A 3E5XA 1Y56A 2JUGA 2DN0A 3UKGA 2DJNA 4WXHA 2R7QA 3FMQA 3D0SA 3CJTB 2R4GA 5K5QA 3O6BB 4G12A 2FMYA 4UV8A 2LNBA 3MZYA 3K4MA 4OIOF 4FISA 4LB5A 5JLWA 5F0CA 3EQLF 1G3WA 5HDGA 1PUEE 3S3MA 3GWZA 3P9CA 4ASNA 5LHHA 1XCVA 4A5NA 2JMWA 5B1BH 3H5NA 5DM7F 3JSPA 2DW4A 3TW7A 3ZPLA 4Y17A 3IKVA 4IKFA 4CDGA 2E5ZA 2STTA 5GTHC 1BI1A 3ZR8X 4XRMA 3HPGA 3GX4X 2OAZA 4EJWA 1XS9A 4D1QA 2NOGA 4HQMA 3OS2A 3KYDB 2X6OA 1O57A 4UY8I 3U21A 2A3SA 3D5SC 1T6SA 4IOCF 1JT0A 1HDPA 2DK8A 1ERDA 2GLOA 1ZR4A 3OOPA 5EEAA 3C3WA 1NG7A 3PSFA 4PFPA 1ZK8A 1MJBA 5CQGA 3ZMUA 1YE9A 1YW8A 5DCFA 3DTIA 4ZZLA 3DPTA 3K69A 3KLNA 3TO7A 4LD5A 1D0XA 1IV6A 1R1VA 4UUTA 2LH9A 3LA2A 4YFNF 4MEXF 1ULYA 2ZB9A 4ESJA 1WJBA 3PUBA 1WCMJ 3M8JA 1X1BA 2DQLA 4PUSA 3QPTA 3A02A 2K9SA 2YX7A 4XOTA 4ZTFA 2BZTA 5D5XB 2OBPA 5ED4A 4YEJA 2HPMA 3CJNA 4BQQA 5J8FA 1YRNA 5GPAA 5HS8A 2DODA 3HYIA 2HQNA 3V42A 3TEDA 3CC7I 2WY8Q 1Y39A 4KNYA 4BHPA 2K40A 3N4MA 2LREA 2JPCA 2VE9A 3BJOA 3MKZA 3FXLA 3L2QA 1ETVA 3TOAA 2M4GA 2XAFA 4HPQA 4OMZA 1W36C 1WJDA 1XG1A 1W0UA 1R58A 1JE8A 2CO5A 3V7CA 5D8LB 2JRTA 4IHXA 1FBQA 3QRFF 2CUFA 1Z6RA 5IY5H 1FJLA 2ISZA 2PX9A 2EZHA 3CUQA 4ENNA 2HYJA 1UG2A 4NC6A 3J7AO 1I50J 3HPHA 2IA2A 1SMYF 3CC2I 3Q9VA 3G73A 1OISA 3R0AA 1TNTA 5C4XJ 1KA8A 1WZ2A 1HQCA 2EFWA 3A0HC 3CO6C 3OYGA 3R61A 1A31A 3U9GA 1WJFA 2W1OA 3CMMA 4MGRA 1WFXA 4ZDLA 2XROA 2H6BA 4ENKA 3FHNA 2C6YA 3GTOJ 1R4NB 3RQ4A 1YFHA 1STZA 4CCNA 2GM4A 4XRSG 2YUSA 5E20A 1HCRA 3KP6A 2KZVA 3FXKA 3GFMA 4MLOA 1S3JA 4XLHA 4KT6A 4Y33A 2R93J 5TISC 3CCLI 1BI0A 1BW6A 4ZYGA 1D1CA 2F5DA 3KZYA 4BAYA 2VBWA 1QRYA 2OQGA 3OL3A 3VSLA 1MNDA 1RZ4A 1FC3A 3ZMZA 2GA1A 3AG3H 3I53A 2QKMB 2XKPA 1XSVA 3HTSB 2FMLA 2Y69H 5L3GA 2L2OA 3COAC 4NDLA 3GFJA 4CA0A 2PG4A 1K4TA 2A05A 1U6GA 3EUHC 2HDWA 4HNVA 2IW5A 4PJLA 4HF2A 2JSPA 2DA1A 1MW7A 2JSCA 1UHSA 3BZ6A 1CF7B 3QP5A 4CH7A 5FKOA 2BVLA 3LOCA 1HDDC 2EFQA 3TP0A 3EUAA 4RS8A 1ZGAA 1WH5A 2KIMA 3GO5A 4IPAA 4RMNA 4E7KA 2LLKA 2H8RA 1W5CC 2BW3A 3GTGJ 2P4WA 2EZKA 1T0FC 1LFUP 3MEXA 2HOTA 3S2DJ 1YYVA 1Z0XA 4IXAA 2D1VA 1DQUA 5EGOA 2JVHA 3SYTA 2VBXA 3ECOA 2BVMA 2WV1A 1O4XA 3SJMA 3KETA 2M4KA 3HBLA 2FXAA 2H1LA 3WE3A 3LFKA 2PJPA 1J5YA 4IRHA 1FSHA 4CCOA 2NOJB 2O0YA 1DGRM 3ZP5A 3G6EI 1V5GA 1BC7C 1U5TB 5E3OA 1RIOH 1JUPA 4I7HA 3GTPJ 4BQAA 2MABA 3B6CA 1BN5A 3M8EA 1F5TA 3R60A 2LP0A 4S0HB 5F1RA 1TWFJ 4IQJA 3AFHA 3JTGA 2LBFA 2HXOA 3HSRA 3PL8A 1R1UA 5LHGA 3LSHA 1U3EM 2EZIA 1KONA 3WTVC 3WU1B 3BCBA 4PJNA 3HGYA 1EKEA 2VPRA 3S2HJ 3ZQIA 2DU9A 1E3HA 2M3AA 3QU3A 5DYMA 5F08A 1JKQC 4I76A 2I8DA 2Q0OA 4JBAA 1D8JA 3A01A 2V4JC 2BXYA 3KP2A 4OINF 2RAEA 4H4KC 3GMEA 3E1SA 4U7BA 2FJ1A 3NWTA 1XCBA 3MKLA 2BY0A 2EINH 2K85A 1BM9A 1IN7A 2DOFA 3WU2C 5D4RA 3LSJA 4MHGA 5F6FA 4A3DJ 2VIXA 3VODA 4ZDOA 2NNNA 1T38A 1MDMA 4I0AA 2DT5A 4A3KJ 2QA4I 1IDYA 1XC5A 1N75A 4BDZA 2Z3YA 4HA8A 4L5EA 2X85A 1NH3A 2XF6A 3H1CA 2XKOA 5CKTA 2FF4A 1GDTA 3WTZA 2O9LA 2E2JJ 4A0XA 5HLHA 3M07A 4BJ5C 2E1OA 4XORA 1W1WE 1JHHA 1IRZA 1R6RA 3OYDA 4BJTA 2Z33A 3GCMA 3OYKA 3U1DA 4WF2A 3A0BC 3LSRA 3TDUC 3GTJJ 1FOYA 1APLC 1LEBA 2LFBA 5J1UA 4KMUX 2CGPA 1GVJA 2HVRA 2X6YA 5HNFA 2ZXJA 1I6XA 4BH9A 4C3IJ 1J09A 3OYIA 1K6OA 1T98A 1IV8A 1IW7F 4HX4A 3OIPA 2V9KA 1SVLA 1PVEA 3F8FA 3HSFA 5KVRA 2R7FA 2HZTA 4YRVA 4RB0A 4DW6A 3GTMJ 1I1SA 2AXTC 2ESNA 2BY1A 4P96A 3IC7A 2IAIA 1ITYA 4C3JJ 2K9NA 2Q2EB 5BOXA 1H0MA 2MA3A 4AIHA 5DTDA 2PI0A 4A3LJ 3KYCB 3WTTC 1E0EA 4RB3C 2FD5A 3UNGC 2OC6A 4II3A 2PJRA 2VB6A 4L9JA 4AIDA 3FBNB 4EQQA 1I5ZA 5J1RA 1Z6TA 1A6IA 1OYYA 2QVOA 3ZMTA 2M30A 3S14J 2VPLA 2HQ5A 4G6TB 3RKYA 3F8NA 1K78A 1YOVB 3KZZA 3BPXA 1WPKA 3HOZJ 1FP2A 3DQVC 5GPCA 4QPOA 1QNTA 2HQAA 3HSEA 5GP9A 3IV5A 3H35A 4F55A 4RLFA 4ZC3A 4J01A 2ZMEA 2W4SA 4N4OB 2M7BA 3IUOA 3RIRA 4JQFA 5L3FA 3HRTA 3SEQA 3HOXJ 2DDBA 3HHHA 3PO3J 2MC4A 3FXOA 1W5TA 3IH3A 1B6AA 1F9NA 4HW0A 1QPIA 3BTCA 2MH2A 1J7KA 3BOQA 5IYDJ 4BL0B 5J4YA 3J81Z 4CXFA 3K7AJ 1JTXA 4IRGA 3J7AY 1N25A 1YLFA 4IX7A 2CYYA 2IS1A 2CQKA 3K4CA 2ME6A 5E3LA 1X58A 3E0JB 4AM3A 2R7ZJ 4LMYA 2L9NA 1DGWY 1Y0UA 2XF7A 3HJEA 2EA2A 5H20A 3HUGB 4XRSA 3I4MJ 3H3ZA 3F8MA 1TT5B 4ENJA 3U2RA 2O8XA 1FBUA 2NNYA 2GOMA 4HNTA 4AC0A 4B3XA 4UUVA 4P9FA 3QYFA 4Z2YA 3BR6A 1N78A 4G8XA 3K10A 3OYLA 1ZELA 2QBYA 3QPHA 4Y4RA 1RR8C 2WY7Q 4U7DA 2CMPA 2IGMA 4H0EA 3CJRB 1XN7A 2VASA 4KICA 4ZJZA 4LB6B 4FHTA 3TMOA 4EGZA 4A6DA 4WK8F 4O5VA 5D6EA 4M73A 3DLLF 3ZN1A 2EFNA 3WGGA 3HOTA 4NUBA 1P4WA 1Z91A 3GZ5A 4L9VA 4EGYA 2KP6A 1OQYA 4A3EJ 2L9SA 1JKRC 4B48A 1IO2A 2VJIA 1Z1DA 2GIZA 2ZJPF 2EIJH 4E7LA 4E70A 1FIPA 3WGHA 1MNEA 4C3HJ 5H2FC 3IRRA 4ZTJA 5F0HA 1YIJI 1RR7A 3ROUA 1SFEA 3DLAA 2WWYA 3GBGA 2QYOA 1FMWA 3S93A 1UZCA 4A3FJ 1SVOA 3S16J 1BOBA 4S04A 3H0DA 2DYRH 4JX6A 2ESHA 2DXIA 3DFGA 3S1NJ 4XSZF 3KFWX 3W3CA 1MMDA 1TW3A 3VDXA 2E5NA 4IHTA 3WTUC 1ZKGA 2IVMA 1SAXA 3BCAA 3HOSA 1ODDA 3FHZA 1ZR2A 4XLFA 4DJAA 1LDKB 3D5LA 2R5YA 5K7FA 1B59A 1VNDA 4ZDPA 5FLMJ 1FMVA 1MMSA 2KDOA 2FEZA 2PMZN 1TC3C 2EIMH 4NQWA 1TQMA 3VEPA 3FXQA 3BZCA 1IUFA 2YSRA 1Y0NA 2KJBA 5C44J 4O3MA 4P5OA 3DWLE 1E2XA 3HKZN 2EB7A 2V79A 3DTKA 4UB8C 1C0WA 2YU3A 2ELJA 2IJLA 3WODF 1ZRFA 5JI6A 1V4RA 3DKXA 4ZYEA 4EM1A 5KHDA 1S7EA 4M6VA 5FFZA 2CW7A 2PEXA 1YJ9I 1P6RA 1A35A 3ASOH 2Z5UA 4XM3A 4NC8A 3RI4A 2IBDA 3LAPA 2HKOA 2ZXWH 3ERED 1P4AA 1J9IA 3OS0A 3PIOF 1D5VA 2GBYA 4II2A 2AS5F 3K70C 1XMAA 2XSDC 1FSEA 3S3OA 2F5VA 3KEYA 5E1WA 2DA3A 2ZFUA 2H27A 1QO0D 3I4NJ 3OYJA 2BYVE 1FBSA 4HSTA 2JA7J 1BBYA 4AYBN 1S6LA 2BOLA 5M5YJ 3L2UA 2B63J 3ABMH 2V1XA 3H9JA 1UB9A 3FZVA 3K4JA 3GZ6A 1T56A 2VQLA 4I09A 1MMNA 3GYHX 4XN0A 4LIUA 5ILSA 1VQPI 1UG0A 3ERMA 2RGVA 2VXDA 2EQRA 3MD2A 4MTEA 2WADA 4A3MJ 5J1YA 2DFIA 3O8GA 2ZMEC 3RQIA 1ONVA 2GQQA 4EJOA 1IXCA 4UVAA 3FBIB 2KISA 4YFKF 1Q1VA 3KX2A 2X6WA 1WJEA 4D0PA 4KIGA 1WJ5A 3TDZC 4QLCU 2OTLI 2UXXA 1K79A 2VT3A 2O7OA 4FCYA 2V7FA 2DDAA 3AL0C 3P7NA 5KCMA 2DQRA 3SXYA 3E6BA 2P5LC 2VJJA 1RUNA 4GRIA 2LF7A 2KZGA 5IOZA 3G2BA 3L09A 3NRVA 3PFYA 2R7XA 3CTAA 3JW4A 2ISYA 3HOWJ 1BA5A 4XIDA 1EF4A 1DUXC 3R4KA 2QQAA 2LKXA 3VYRB 5FKNA 3RKWA 1OCCH 2M9HA 1A6QA 2FOWA 2Z16A 3LSPA 4IJAA 2JQ7A 2WV0A 2WAFA 4G7ZF 3HDDA 4C30A 1F36A 1TW2A 3TOBA 3MKWB 3CQZJ 3Q3SA 2HVQA 2W24A 5GAEJ 4I6ZA 2QGUA 1YJWI 2HDCA 5M5WJ 4OAZA 4M3DA 1WJAA 4LLNA 4N9HA 3BR1A 3PJRA 1FYKA 3G1OA 3S1MJ 4OIQF 2MSYA 3VFZA 4RGUA 5A2QK 1YI2I 2HFHA 3OSGA 4RB2C 5CVJA 3CF2A 3PNYA 1J59A 5EG0B 4B3AA 4Q4ZF 1SMTA 1AWCA 3FDYA 1XPXA 3CZ6A 2Q1ZB 3IWFA 3S2WA 4F7ZA 5DDGA 3PQKA 4ZH4F 2X1CA 4U0WA 2QQBA 2L4AA 2ME0A 2FBIA 3CCYA 1XSDA 1IN5A 1HKTA 1T0FA 2OCEA 2YX4A 1KQ8A 1G3TA 1IUYA 1X1AA 1UAAA 2KPMA 2R5ZB 4Y3OA 4XQFA 2QEXI 3T1BA 2JK3A 3GXOA 2DA4A 4A93J 1FOXA 2L7MP 5IPAA 2KDZA 3P5JA 1FT9A 3U1KA 2WBMA 1WI9A 1KU3A 2H94A 3HZJA 2KMUA 1U0JA 1KGSA 3K70D 4K2EA 5L3EA 4PZJA 5BQTA 3BY6A 1DU6A 2KKOA 1AU7A 1JGGA 2FU4A 1TWGJ 1VQ8I 3GF2A 1I1GA 1QGPA 1ZQ3P 2GXBA 3G71I 1JI8A 5B3SH 4EM2A 4YIIA 4HG2A 1HOMA 2E1NA 4XBFA 4DIQA 5AIQA 2CFXA 3ML6A 2P5KA 1MNMC 4M9SA 1D5YA 5HS7A 5F0FA 1G3SA 4JP0A 3CC4I 5J3LA 2E36A 5FLXK 2FNPA 3VYTB 3G1MA 2OV7A 2RN7A 2Z2SB 5DM6F 2E1MB 3ZMVA 4EJTA 4A3GJ 3RCOA 4X6AJ 4PJ0C 4C9YA 4AIKA 3P9IA 3QOEA 1OCOH 1YHQI 1JKOC 4QTRA 2X0LA 3L2CA 3HHGA 4EM0B 4AVZA 5EJCA 1RC9A 3K4NA 5JHFA 3LA7A 2E60A 4Y7NJ 3W2WA 1Z9CA 4YG2F 2QUFA 3I9V2 3K4LA 4FE7A 3BG5A 4CUGA 3LFUA 1RETA 1DP7P 1ZARA 5BPDA 1I6HJ 2ZSIB 1A5JA 2RNGA 2FQ4A 4BE1A 1GXQA 2ECCA 4M3FA 2E2IJ 2LY9A 1V5FA 3S8PA 1ZH5A 1S7AA 1BIAA 2OU2A 4MQVA 5ICGA 1SAUA 2E1CA 5GAGJ 4RM2A 3DTEA 3BPVA 2YPRA 1XDSA 5E8GA 4IHWA 5GAHJ 5IT9K 2DMQA 3JTHA 2OPTA 3MKYB 2DA5A 4F93B 1K83J 2EZLA 4C2UA 3SQNA 4PSXA 2DT6A 3QODA 5FLVA 1WWXA 2HDDA 2LTPA 3GTLJ 4PGHA 2M1BA 1G2HA 4HX8A 2VKEA 4WWCA 1B72B 4GCVA 4MFEA 5HOOA 1Z7LA 5DD4A 3DPLC 3SEZA 1N77A 2R3SA 4KYWA 2XPWA 3E6CC 1MSFC 2VOOA 2F4IA 4BHBA 4XN3A 5BPIA 3GFIA 3CCSI 3BJ6A 3H0GJ 1EH8A 4IHVA 2ECBA 5CQEA 1O3RA 2CQXA 2RDPA 5TRDA 4A3BJ 2LVSA 4OU0A 3OYFA 2XRLA 1G4DA 5JHUA 4Z6YA 2AHQA 3JCUC 4GGGA 3RKQA 2X1DA 1MD0A 2L9VA 1WI3A 3DV8A 4HLYA 2NVXJ 1IN4A 2M34A 3ECHA 3J80Z 3QPLA 2LOOA 2P6TA 3ZN0A 3AG2H 1FX7A 3LSKA 1GV5A 3GTQJ 2EH3A 2M87A 2G9WA 2F48A 3BJAA 3E7LA 4BU2A 1LE8B 3OIOA 3LMMA 3MVPA 5CYVA 2D45A 4YIFA 4BY1J 1TP4A 2QENA 3RJPA 5JFRA 1FNNA 1LDJA 3OIQA 1RPWA 5EZGA 4XLNF 2M2EA 4X0GA 4XKVA 2EV5A 3H36A 4BE0A 4CZCA 1ZHFA 3I71A 3CDHA 1ZREA 3F9KA 3PSIA 1VF9A 4PJJA 1QZYA 4DGWB 2GIVA 1YW7A 2OZ6A 2CV2A 1X1CA 4M74A 1OKRA 2FUG2 1PP8F 2PMHA 3IL2A 3CCEI 5BNGA 4BJ6C 1S8NA 1UFMA 2HEOA 1ORKA 2VKDA 2VT2A 5CPRB 3DCFA 4M6YA 4IHYA 1MBFA 3WGIA 1Y8QB 3CCUI 1ZLKA 4E7HA 5K5OA 1R9TJ 3WE2A 2VODA 2QSGX 2LF8A 4BE2A 1H89C 3M3YJ 2TRTA 4HRIA 2IS2A 1R71A 1W36D 1T39A 2V1DA 1E3PA 1FY7A 3DKWA 1OR7C 1J2XA 4IO9F 1G6NA 3HOUJ 1TQPA 3PO2J 4U87A 3S3NA 4CCJA 1JUMA 2AXLA 2N8GA 2V9VA 1LVAA 3CLOA 1IJWC 3M1CA 1FOKA 5LEJA 2NAZA 3ULQB 1KU2A 1HLVA 1PUFB 2A07F 1ON1A 4UXNA 2P5VA 2PFBA 3CUQB 3ZQHA 2NVQJ 2F5FA 4XICA 3DBHB 1L3LA 4Q47A 3T5XA 4A3IJ 2HYFA 2V6EA 4PGGA 3L7WA 1IRXA 1X19A 5FD5A 2NXNB 2RV8A 4A5MA 1WH7A 1LNWA 1I39A 3FXJA 3Q0UA 9ANTA 4UVBA 1X2MA 2LC2A 2ETHA 2D5VA 2ZXHA 2G7UA 2HOAA 3A1YA 3SDGA 3S15J 3FXMA 1K7AA 2COMA 1ETOA 1OYWA 1P4XA 2CG4A 2DA6A 1W7PB 2UXNA 1W0TA 1WHUA 2QLZA 3R0JA 1OMIA 1T95A 4ABZA 1MGTA 4IHSA 2XGCA 2ELKA 2R7VA 3CMAI 2CW8A 4LFUA 2JUCA 5J8CA 5FJ8J 2DJIA 2R0QC 1U5TC 5CLSA 4B4CA 5GTIC 3GEZA 3F8BA 1JUSA 1YJNI 2P7VB 1UHWA 3HB9A 3ZOBA 1VTNC 2EILH 3LSGA 2KRHA 3HM5A 2R7WA 5BS6A 2AQFA 2VBYA 1ZTRA 3BTJA 5DEQA 3V7SA 4DYCA 1SANA 3OOUA 4M6XA 3JAMZ 1TL8A 3C1DA 3L9FA 3M9AA 1OYIA 3NQOA 4F91B 2MGQA 2XIGA 3KIOA 3TO9A 4R1HA 3HC7A 4HYEA 1O3SA 3MMYB 2LSOA 1MMGA 1LEAA 2CS3A 1YW9A 3LQRA 3LSTA 2BW3B 2Y30A 4CCKA 2F5EA 2NVTJ 1G3YA 3QU6A 4CYCB 2K7LA 4DBQA 3OYEA 2JWTA 1B4AA 2K4JA 3RZDJ 3EETA 1GUUA 3S1QJ 5DCMA 4BACA 3CCJI 5J47A 3TGNA 4BHCA 4A0YA 2E2HJ 5LRRA 3MZ8A 1PJRA 3H5AA 3I4PA 4GO1A 3FMRA 1Y6IA 2ZXIA 2PMZA 1MBJA 4D7NA 4TV7A 5M3MJ 5E1XA 3P9KA 4ESBA 2DOEA 2WC2A 2LBFB 3C18A 4GDFA 1B9NA 2VUMJ 1H88C 3VYSB 5L3DA 3E6DA 4CZZA 4U0YA 5CVVA 2L01A 3CESA 2Q8KA 3V8LA 1W4MA 2OUMA 3F22A 3HKZA 4UHTA 4IRIA 2P6SA 5H6QA 1JGSA 1MJAA 1V3FA 2XGXA 2M7AA 2MLGA 4HNUA 3T8TA 5HLGA 1LKXA 1OCPA 4NC7A 4QPQA 1IF1A 1LJ9A 2HXIA 2KQRA 4R8HA 3IH4A 5HDNA 5F27A 2IGOA 4KT5C 4ZZDA 2M5WA 5TGTA 4CSWA 3MFKA 2X9DA 3RSNA 2K9QA 1D0YA 2ZSHB 5EYRA 3FXRA 4AYBA 1YTYA 2BV6A 4EV0A 2NS8A 1XMKA 1SD7A 3BC8A 3WTSC 1ETYA 4BEHB 2L0KA 1D3YA 4MFDA 4LG0A 4BDYA 2COBA 1PDNC 2HYGD 3WHBA 2CW0F 3BQZA 3ISPA 4B47A 3W6VA 3E3VA 1ETKA 2HTSA 2WAQN 1KQ0A 4ANJA 2E19A 1ZN2A 2ZC2A 1HW5A 2IEKA 3K4BA 5IP7J 4XRFA 3VPRA 3I64A 3JRCA 2DK5A 1S5LC 2F5CA 1EV7A 3OL4A 2XDVA 4U0VA 4JK1X 2XAJA 2HR3A 1S7OA 1XB4A 2L3DA 1QA6A 3QWLA 1TT0A 3BG7A 3K1NA 4WCGA 1Y8RB 2R7DA 2ACJA 5F1JA 3J7ZI 2VJ4A 1R5GA 1IRGA 1PYVA 2DMNA 2H8WA 3FWEA 5DUIA 2EV0A 2VXZA 3JRFA 4BBRJ 2M45A 3BTIA 3BG9A 3L2WA 4MNUA 1JKPC 2GZWA 2HPIA 2PJRB 1SD4A 1BR2A 4FASD 3I59B 3L2RA 4W1UA 2EFPA 2BE5F 1HBXG 2E35A 1O3QA 4BXUA 3KLOA 3KP7A 3I58A 1D1AA 2VJ5A 4XSXF 4AVPA 2V1UA 4X1EA 1K78B 1QVUA 4OOIA 4V2FA 2W85A 2NYXA 2LMDA 4IOAF 2HOEA 3OYHA 1Z21A 2OTJI 1UCRA
chains in the Genus database with same CATH topology
3FISA 4QIWN 2R5ZB 4GFBA 4Y52J 2JK3A 3BR2A 2DA4A 4A93J 4NDLA 2L7MP 5IPAA 2KDZA 5F04A 1CQTA 5JLXA 4V2GA 4HNVA 2DA1A 5HODA 1DU6A 1UHSA 3F0CA 5FKOA 3LOCA 3FK7A 1JGGA 1AU7A 3S17J 1HDDC 1TWGJ 3TP0A 1WH5A 3JR9A 1ZQ3P 4A69C 2M8GX 2CUEA 1MSEC 1HOMA 2LLKA 2YS9A 2H8RA 1MNMC 3GTGJ 2HOTA 2EZKA 1LFUP 1D5YA 3S2DJ 5F0FA 4JP0A 1Z0XA 5FKLA 1B8IB 5J3LA 5EGOA 1OJLA 3G1MA 2WV1A 1O4XA 3A01B 3SJMA 4DYRA 3HBLA 2R5ZA 4A3GJ 4J19A 4X6AJ 2Y0SN 5C4JJ 1JKOC 5EZHA 3MN2A 4QTRA 5E3OA 5IYBJ 2I10A 1JUPA 3GTPJ 4Y7NJ 3B6CA 2JA8J 2JJ7A 4FE7A 4XK4A 3BG5A 1RETA 2LP0A 4S0HB 1TWFJ 1H8AC 1I6HJ 1VI0A 2HXOA 5M5XJ 2Y9ZA 1A5JA 4M3EA 1U9OA 1Y1VJ 2EZIA 2FQ4A 2ECCA 2YU9J 3HGYA 2VPRA 3S2HJ 3ZQIA 4M3FA 1JJ6C 1JKQC 5F08A 2E2IJ 1B8IA 4I76A 2LY9A 2DMTA 2QF7A 1DU0A 3A01A 1LFBA 1AKHB 3TP3A 2L7FP 2RAEA 2MG4A 4IHWA 2FJ1A 2DMQA 2ID6A 3MKLA 2VKVA 2OPTA 2DA5A 3JREA 1K83J 2EZLA 3LSJA 1MH4A 1OFCX 5FLVA 2WB1N 1MH3A 3HGGA 5DS9A 4A3DJ 2HDDA 4D7MA 2LTPA 3GTLJ 4A3CJ 1G2HA 2LD5A 4JYKA 1UMQA 2VKEA 1B72B 4LOCA 4MFEA 4A3KJ 1RKTA 1IDYA 1XC5A 4BKXA 1JT6A 4L5EA 1GT0C 1TWHJ 2XPWA 1MSFC 5EDNA 1GDTA 2O9LA 2E2JJ 2E1OA 1P7JA 3H0GJ 5K7HA 3ZQCA 1NK3P 1IRZA 1AKHA 4IHVA 2ECBA 4M3BA 2CQXA 3O8HA 3LSRA 1NK2P 2LVSA 3GTJJ 4A3BJ 1FTZA 2XRLA 1APLC 2L9RA 2LFBA 5J1UA 3RZOJ 2G0EA 4QSHA 3GTKJ 2AHQA 4C3IJ 3RKQA 2L7ZA 1WI3A 3OSFA 2NVXJ 2M34A 1GV2A 3QPLA 1B72A 4D5FA 4DW6A 3GTMJ 4D5CA 4RDUA 2IAIA 1ITYA 4C3JJ 2LK2A 2K9NA 2Y31A 3HEFA 1GV5A 4DYQA 3GTQJ 3H3VK 2EH3A 4A3LJ 5DTDA 3BT9A 3E7LA 1LE8B 2Y2ZA 3OIOA 2FD5A 3MVPA 4BY1J 1IG7A 1JTYA 1ETXA 5EG0A 2DMPA 5J1RA 4M3GA 1RPWA 5EZGA 2M2EA 1A6IA 4W97A 4B1RA 4DZJA 3S14J 2HQ5A 5K7ZA 1BL0A 3BTLA 1VF9A 1WPKA 1IGNA 3HOZJ 5GPCA 1F43A 5GP9A 3IV5A 2TCTA 5E3NA 5E3MA 1JJ8C 2CJJA 1ENHA 2X48A 5BNGA 3M4OJ 3D1NI 1IC8A 1LE8A 1ORKA 3DCFA 5M3FJ 4MIMA 1TWCJ 3ZQFA 1MBFA 4IHYA 3HOXJ 1AHDP 2LR8A 3PO3J 1R9TJ 3IH3A 1H89C 3M3YJ 2TRTA 5IOYA 3K2AA 4MO7A 1QPIA 3BTCA 5IYDJ 2AO9A 3BR0A 2NS7A 3JRDA 3K7AJ 1JTXA 4FE4A 3HOUJ 3PO2J 1JUMA 2ME6A 5E3LA 4UUSB 1X58A 2N8GA 3B6AA 2R7ZJ 1ZGWA 1IJWC 4FTHA 5IP9J 3BQYA 4XRSA 3I4MJ 1HLVA 1PUFB 4DZPA 2O8KA 3A03A 3ZQHA 2NVQJ 4XICA 4BBSJ 4A3IJ 2H1KA 4AC0A 2M0CA 3BR6A 1GVDA 5FKKA 1WH7A 2ID3A 3NAUA 3Q0UA 2EBIA 2DMUA 9ANTA 1X2MA 2JA6J 2D5VA 2HOAA 3HOYJ 4JX4A 3SDGA 3S15J 1U8BA 2QCOA 3LNQA 2P81A 1ETOA 1FIAA 2DA6A 1FEXA 1I3QJ 4AUXA 1RKWA 1W0TA 4ABZA 2XPUA 4UUSA 2DA2A 3ZQGA 2FX0A 2OF7A 1TWAJ 2XGCA 2ELKA 1PUFA 4BXXJ 1MBHA 5FJ8J 2R0QC 1MBGA 4B4CA 2XGEA 2R5YB 3CDLA 4A3EJ 1JUSA 1JKRC 1HF0A 3HB9A 3DEWA 2Y9YA 3ZOBA 2KT0A 1Y1WJ 3LSGA 1FIPA 4C3HJ 3HM5A 5F0HA 5EF6A 1RR7A 1ZTRA 3BTJA 3BR3A 4DYCA 1SANA 2JN6A 3GBGA 3OOUA 3S1RJ 4A3FJ 3S16J 3JRGA 1MBKA 5IYCJ 3QQAA 1T33A 4JX6A 2MGQA 3S1NJ 1POGA 3JRIA 1E3OC 3WHCA 5IP6A 1ZKGA 1VFCA 1ZR2A 1K61A 1WGXA 2R5YA 2HOSA 2Y30A 3Q0VA 5K7FA 5FLMJ 1VNDA 2NVTJ 4CYCB 2DN0A 2PMZN 3ZQLA 3UKGA 1TC3C 2DJNA 2JWTA 2XB0X 3RZDJ 1GUUA 4G12A 1IUFA 3S1QJ 4FISA 5C44J 5JLWA 5F0CA 2E2HJ 2VI6A 3HOVJ 3HKZN 1U9NA 3TW6A 2JMWA 1MBJA 4D7NA 5M3MJ 1S7EA 4M6VA 3TW7A 2JA5J 1P7IA 2R92J 1ETQA 2XB5A 1YRNB 2IBDA 4XRMA 1Z77A 1RESA 2VUMJ 2XGDA 1XS9A 1H88C 2NOGA 2X6OA 2GBYA 4CYCA 1JT0A 1HDPA 2XSDC 2XPVA 2GLOA 1IDZA 1ZR4A 2DA3A 5EEAA 3I4NJ 4EEFG 2JA7J 1ZK8A 4AYBN 5M5YJ 2B63J 3G1LA 1IV6A 2HI3A 4UUTA 1T56A 1OCPA 2ZB9A 4A3JJ 3IH2A 2HXIA 3JRHA 1WCMJ 3Q0WA 2EQRA 3IH4A 4A3MJ 5F27A 5J1YA 3A02A 2K9SA 3O8GA 3RQIA 4JX5A 2X9DA 3QPSA 2K9QA 1YRNA 5GPAA 5EYRA 2NS8A 1Q1VA 4IEJA 3CMYA 3TEDA 1ETYA 2DA7A 2L0KA 4MFDA 2COBA 2K40A 2O7OA 3WHBA 4FCYA 3BQZA 3W6VA 2DTZA 1ETKA 1ETVA 2WAQN 2CQQA 1NTCA 5IOZA 3C2BA 1BJZA 1XG1A 2E19A 4RBOA 1W0UA 1ETWA 2IEKA 3HOWJ 1BA5A 1QVTA 4IHXA 5IP7J 3VPRA 4XIDA 3JRCA 2W48A 2CUFA 1EF4A 1FJLA 3SFIA 1BW5A 2EZHA 2LKXA 2HYJA 5FKNA 1UG2A 2CU7A 2M9HA 1I50J 1FTTA 5C3EJ 3LSPA 4BY7J 3HDDA 5C4XJ 1F36A 5F1JA 3CQZJ 3Q3SA 2DMNA 2MW8A 4I6ZA 3PM1A 1MBEA 4BBRJ 3BTIA 3L1PA 3JRFA 3JRAA 5M5WJ 5FKMA 3BG9A 4M3DA 3BR1A 1SFOJ 1JKPC 3BR5A 2CRGA 3S1MJ 3G1OA 3GTOJ 3JRBA 2MSYA 2GM4A 4XRSG 3FKIJ 2YUSA 3OSGA 1HCRA 5EG0B 4B3AA 4W1UA 4MLOA 2R93J 1X2NA 1BW6A 2ME0A 2NVYJ 3CCYA 3FIWA 1QRYA 3BG3A 4X1EA 1QVUA 1OCTC 4V2FA 3FK6A 4C2MJ 5EGOB 3NARA 1U78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIS A;  4QIW N;  2R5Z B;  4GFB A;  4Y52 J;  2JK3 A;  3BR2 A;  2DA4 A;  4A93 J;  4NDL A;  2L7M P;  5IPA A;  2KDZ A;  5F04 A;  1CQT A;  5JLX A;  4V2G A;  4HNV A;  2DA1 A;  5HOD A;  1DU6 A;  1UHS A;  3F0C A;  5FKO A;  3LOC A;  3FK7 A;  1JGG A;  1AU7 A;  3S17 J;  1HDD C;  1TWG J;  3TP0 A;  1WH5 A;  3JR9 A;  1ZQ3 P;  4A69 C;  2M8G X;  2CUE A;  1MSE C;  1HOM A;  2LLK A;  2YS9 A;  2H8R A;  1MNM C;  3GTG J;  2HOT A;  2EZK A;  1LFU P;  1D5Y A;  3S2D J;  5F0F A;  4JP0 A;  1Z0X A;  5FKL A;  1B8I B;  5J3L A;  5EGO A;  1OJL A;  3G1M A;  2WV1 A;  1O4X A;  3A01 B;  3SJM A;  4DYR A;  3HBL A;  2R5Z A;  4A3G J;  4J19 A;  4X6A J;  2Y0S N;  5C4J J;  1JKO C;  5EZH A;  3MN2 A;  4QTR A;  5E3O A;  5IYB J;  2I10 A;  1JUP A;  3GTP J;  4Y7N J;  3B6C A;  2JA8 J;  2JJ7 A;  4FE7 A;  4XK4 A;  3BG5 A;  1RET A;  2LP0 A;  4S0H B;  1TWF J;  1H8A C;  1I6H J;  1VI0 A;  2HXO A;  5M5X J;  2Y9Z A;  1A5J A;  4M3E A;  1U9O A;  1Y1V J;  2EZI A;  2FQ4 A;  2ECC A;  2YU9 J;  3HGY A;  2VPR A;  3S2H J;  3ZQI A;  4M3F A;  1JJ6 C;  1JKQ C;  5F08 A;  2E2I J;  1B8I A;  4I76 A;  2LY9 A;  2DMT A;  2QF7 A;  1DU0 A;  3A01 A;  1LFB A;  1AKH B;  3TP3 A;  2L7F P;  2RAE A;  2MG4 A;  4IHW A;  2FJ1 A;  2DMQ A;  2ID6 A;  3MKL A;  2VKV A;  2OPT A;  2DA5 A;  3JRE A;  1K83 J;  2EZL A;  3LSJ A;  1MH4 A;  1OFC X;  5FLV A;  2WB1 N;  1MH3 A;  3HGG A;  5DS9 A;  4A3D J;  2HDD A;  4D7M A;  2LTP A;  3GTL J;  4A3C J;  1G2H A;  2LD5 A;  4JYK A;  1UMQ A;  2VKE A;  1B72 B;  4LOC A;  4MFE A;  4A3K J;  1RKT A;  1IDY A;  1XC5 A;  4BKX A;  1JT6 A;  4L5E A;  1GT0 C;  1TWH J;  2XPW A;  1MSF C;  5EDN A;  1GDT A;  2O9L A;  2E2J J;  2E1O A;  1P7J A;  3H0G J;  5K7H A;  3ZQC A;  1NK3 P;  1IRZ A;  1AKH A;  4IHV A;  2ECB A;  4M3B A;  2CQX A;  3O8H A;  3LSR A;  1NK2 P;  2LVS A;  3GTJ J;  4A3B J;  1FTZ A;  2XRL A;  1APL C;  2L9R A;  2LFB A;  5J1U A;  3RZO J;  2G0E A;  4QSH A;  3GTK J;  2AHQ A;  4C3I J;  3RKQ A;  2L7Z A;  1WI3 A;  3OSF A;  2NVX J;  2M34 A;  1GV2 A;  3QPL A;  1B72 A;  4D5F A;  4DW6 A;  3GTM J;  4D5C A;  4RDU A;  2IAI A;  1ITY A;  4C3J J;  2LK2 A;  2K9N A;  2Y31 A;  3HEF A;  1GV5 A;  4DYQ A;  3GTQ J;  3H3V K;  2EH3 A;  4A3L J;  5DTD A;  3BT9 A;  3E7L A;  1LE8 B;  2Y2Z A;  3OIO A;  2FD5 A;  3MVP A;  4BY1 J;  1IG7 A;  1JTY A;  1ETX A;  5EG0 A;  2DMP A;  5J1R A;  4M3G A;  1RPW A;  5EZG A;  2M2E A;  1A6I A;  4W97 A;  4B1R A;  4DZJ A;  3S14 J;  2HQ5 A;  5K7Z A;  1BL0 A;  3BTL A;  1VF9 A;  1WPK A;  1IGN A;  3HOZ J;  5GPC A;  1F43 A;  5GP9 A;  3IV5 A;  2TCT A;  5E3N A;  5E3M A;  1JJ8 C;  2CJJ A;  1ENH A;  2X48 A;  5BNG A;  3M4O J;  3D1N I;  1IC8 A;  1LE8 A;  1ORK A;  3DCF A;  5M3F J;  4MIM A;  1TWC J;  3ZQF A;  1MBF A;  4IHY A;  3HOX J;  1AHD P;  2LR8 A;  3PO3 J;  1R9T J;  3IH3 A;  1H89 C;  3M3Y J;  2TRT A;  5IOY A;  3K2A A;  4MO7 A;  1QPI A;  3BTC A;  5IYD J;  2AO9 A;  3BR0 A;  2NS7 A;  3JRD A;  3K7A J;  1JTX A;  4FE4 A;  3HOU J;  3PO2 J;  1JUM A;  2ME6 A;  5E3L A;  4UUS B;  1X58 A;  2N8G A;  3B6A A;  2R7Z J;  1ZGW A;  1IJW C;  4FTH A;  5IP9 J;  3BQY A;  4XRS A;  3I4M J;  1HLV A;  1PUF B;  4DZP A;  2O8K A;  3A03 A;  3ZQH A;  2NVQ J;  4XIC A;  4BBS J;  4A3I J;  2H1K A;  4AC0 A;  2M0C A;  3BR6 A;  1GVD A;  5FKK A;  1WH7 A;  2ID3 A;  3NAU A;  3Q0U A;  2EBI A;  2DMU A;  9ANT A;  1X2M A;  2JA6 J;  2D5V A;  2HOA A;  3HOY J;  4JX4 A;  3SDG A;  3S15 J;  1U8B A;  2QCO A;  3LNQ A;  2P81 A;  1ETO A;  1FIA A;  2DA6 A;  1FEX A;  1I3Q J;  4AUX A;  1RKW A;  1W0T A;  4ABZ A;  2XPU A;  4UUS A;  2DA2 A;  3ZQG A;  2FX0 A;  2OF7 A;  1TWA J;  2XGC A;  2ELK A;  1PUF A;  4BXX J;  1MBH A;  5FJ8 J;  2R0Q C;  1MBG A;  4B4C A;  2XGE A;  2R5Y B;  3CDL A;  4A3E J;  1JUS A;  1JKR C;  1HF0 A;  3HB9 A;  3DEW A;  2Y9Y A;  3ZOB A;  2KT0 A;  1Y1W J;  3LSG A;  1FIP A;  4C3H J;  3HM5 A;  5F0H A;  5EF6 A;  1RR7 A;  1ZTR A;  3BTJ A;  3BR3 A;  4DYC A;  1SAN A;  2JN6 A;  3GBG A;  3OOU A;  3S1R J;  4A3F J;  3S16 J;  3JRG A;  1MBK A;  5IYC J;  3QQA A;  1T33 A;  4JX6 A;  2MGQ A;  3S1N J;  1POG A;  3JRI A;  1E3O C;  3WHC A;  5IP6 A;  1ZKG A;  1VFC A;  1ZR2 A;  1K61 A;  1WGX A;  2R5Y A;  2HOS A;  2Y30 A;  3Q0V A;  5K7F A;  5FLM J;  1VND A;  2NVT J;  4CYC B;  2DN0 A;  2PMZ N;  3ZQL A;  3UKG A;  1TC3 C;  2DJN A;  2JWT A;  2XB0 X;  3RZD J;  1GUU A;  4G12 A;  1IUF A;  3S1Q J;  4FIS A;  5C44 J;  5JLW A;  5F0C A;  2E2H J;  2VI6 A;  3HOV J;  3HKZ N;  1U9N A;  3TW6 A;  2JMW A;  1MBJ A;  4D7N A;  5M3M J;  1S7E A;  4M6V A;  3TW7 A;  2JA5 J;  1P7I A;  2R92 J;  1ETQ A;  2XB5 A;  1YRN B;  2IBD A;  4XRM A;  1Z77 A;  1RES A;  2VUM J;  2XGD A;  1XS9 A;  1H88 C;  2NOG A;  2X6O A;  2GBY A;  4CYC A;  1JT0 A;  1HDP A;  2XSD C;  2XPV A;  2GLO A;  1IDZ A;  1ZR4 A;  2DA3 A;  5EEA A;  3I4N J;  4EEF G;  2JA7 J;  1ZK8 A;  4AYB N;  5M5Y J;  2B63 J;  3G1L A;  1IV6 A;  2HI3 A;  4UUT A;  1T56 A;  1OCP A;  2ZB9 A;  4A3J J;  3IH2 A;  2HXI A;  3JRH A;  1WCM J;  3Q0W A;  2EQR A;  3IH4 A;  4A3M J;  5F27 A;  5J1Y A;  3A02 A;  2K9S A;  3O8G A;  3RQI A;  4JX5 A;  2X9D A;  3QPS A;  2K9Q A;  1YRN A;  5GPA A;  5EYR A;  2NS8 A;  1Q1V A;  4IEJ A;  3CMY A;  3TED A;  1ETY A;  2DA7 A;  2L0K A;  4MFD A;  2COB A;  2K40 A;  2O7O A;  3WHB A;  4FCY A;  3BQZ A;  3W6V A;  2DTZ A;  1ETK A;  1ETV A;  2WAQ N;  2CQQ A;  1NTC A;  5IOZ A;  3C2B A;  1BJZ A;  1XG1 A;  2E19 A;  4RBO A;  1W0U A;  1ETW A;  2IEK A;  3HOW J;  1BA5 A;  1QVT A;  4IHX A;  5IP7 J;  3VPR A;  4XID A;  3JRC A;  2W48 A;  2CUF A;  1EF4 A;  1FJL A;  3SFI A;  1BW5 A;  2EZH A;  2LKX A;  2HYJ A;  5FKN A;  1UG2 A;  2CU7 A;  2M9H A;  1I50 J;  1FTT A;  5C3E J;  3LSP A;  4BY7 J;  3HDD A;  5C4X J;  1F36 A;  5F1J A;  3CQZ J;  3Q3S A;  2DMN A;  2MW8 A;  4I6Z A;  3PM1 A;  1MBE A;  4BBR J;  3BTI A;  3L1P A;  3JRF A;  3JRA A;  5M5W J;  5FKM A;  3BG9 A;  4M3D A;  3BR1 A;  1SFO J;  1JKP C;  3BR5 A;  2CRG A;  3S1M J;  3G1O A;  3GTO J;  3JRB A;  2MSY A;  2GM4 A;  4XRS G;  3FKI J;  2YUS A;  3OSG A;  1HCR A;  5EG0 B;  4B3A A;  4W1U A;  4MLO A;  2R93 J;  1X2N A;  1BW6 A;  2ME0 A;  2NVY J;  3CCY A;  3FIW A;  1QRY A;  3BG3 A;  4X1E A;  1QVU A;  1OCT C;  4V2F A;  3FK6 A;  4C2M J;  5EGO B;  3NAR A;  1U78 A; 
#chains in the Genus database with same CATH topology
 3FIS A;  4Y52 J;  1TQI A;  3BR2 A;  3TBI A;  2L54 A;  2IRF G;  5FGM A;  2VKH A;  2A68 F;  1HKS A;  2LY1 A;  5J4V A;  1CQT A;  2PMU A;  3QAH A;  4V2G A;  5HOD A;  2P7C B;  3FK7 A;  3DPU A;  1F4K A;  3GVA A;  4EJV A;  5ILU A;  3W6J B;  3JR9 A;  1BR4 A;  2DPU A;  4HF1 A;  2CUE A;  4GXO A;  2IT0 A;  1YIT I;  3WTX C;  2YS9 A;  2XUB A;  2A69 F;  4BQO A;  4HF0 A;  4BGD A;  1MJ9 A;  2XAQ A;  3ESW B;  5FKL A;  2ZNZ A;  2GA2 A;  1G59 A;  1B8I B;  2W57 A;  2XF5 A;  3K2Z A;  2R5Z A;  1HC8 A;  4E7J A;  4J19 A;  2HQR A;  3TQN A;  2V9P A;  2Y0S N;  2TDX A;  1DPU A;  2F6C A;  5LD2 C;  5LEK A;  2NRA C;  2A6E F;  5F64 A;  2CSO A;  2JA8 J;  3B73 A;  2VC0 A;  2QBY B;  2KL4 A;  2A6H F;  1H8A C;  4B43 A;  3RKX A;  1VI0 A;  5DV5 A;  4IF4 A;  1GHC A;  5M5X J;  2Z9O A;  5AON A;  4BQN A;  1IZ1 A;  1U9O A;  2FNA A;  2XAU A;  4ZYD A;  2YU9 J;  3K9T A;  1AOY A;  2LDU A;  2WA0 A;  2CH0 A;  2NVU B;  1JJ6 C;  3MQ0 A;  4P1W A;  3REO A;  1V55 H;  2XHK A;  4RM3 A;  2DMT A;  5B66 C;  3X2Q H;  1SD5 A;  4N0B A;  1VQ9 I;  1B9M A;  4BNC A;  3EPZ A;  3OYA A;  1AKH B;  3WG7 H;  2L7F P;  5HLT A;  2ZBK A;  1REP C;  2MG4 A;  2RQQ A;  1OLT A;  2QZ8 A;  2ZJR F;  3LSM A;  3OYB A;  2QQ9 A;  2WB1 N;  1MH3 A;  3DF8 A;  3SDB A;  1HW1 A;  1RI7 A;  2XAG A;  3BG6 A;  1D1B A;  1WJC A;  4A3C J;  5CVU A;  1OCZ H;  4L18 B;  1UMQ A;  3ABT A;  1RKT A;  2IPQ X;  4XMY A;  1HSJ A;  4NBQ A;  1ZRD A;  3KP3 A;  4RA2 A;  1GT0 C;  2V1N A;  1XGN A;  5EDN A;  1BOA A;  3I56 I;  2HS5 A;  3NWS A;  1PP7 U;  4RGX A;  2MC3 A;  5K1Y A;  3ZQC A;  3ZGK A;  1IAW A;  2E71 A;  4WX9 A;  5LGU A;  2DLL A;  3V7R A;  1YX5 A;  2EWN A;  3DP7 A;  1H9G A;  4XLC A;  1ZYR F;  1NK2 P;  3F72 A;  1IRF A;  3WU0 A;  4M71 A;  1XGO A;  3TL4 X;  3CCM I;  2QSF X;  4ENM A;  5JVG F;  3RZO J;  4BXF A;  4BS9 A;  2G0E A;  5D4S A;  4L0Y B;  4NQW B;  1LFP A;  4E7I A;  2L7Z A;  3HXL A;  3ZMS A;  1OPC A;  1VQ4 I;  5EEG A;  5LFA A;  2K27 A;  1UST A;  1X4P A;  3H9Q A;  3ZQQ A;  1B72 A;  2XAS A;  1UEL B;  4D5F A;  1O3T A;  1BC8 C;  5EEH A;  2DBB A;  4D5C A;  3BP8 A;  5H6R A;  3E6M A;  3B02 A;  3IP4 B;  5E18 F;  3BT9 A;  2GXG A;  2R7R A;  4FT8 A;  1R49 A;  3QP6 A;  1KU7 A;  2A5W A;  2BBY A;  2V6C A;  4AWX B;  1IG7 A;  1JTY A;  1ETX A;  4KFC A;  2KJC A;  4M9X A;  1QZE A;  2ZNY A;  2IA0 A;  4M3G A;  1A04 A;  1RUO A;  2DYS H;  4W97 A;  3OR1 C;  2PBI A;  4B1R A;  3BRO A;  4XOP A;  4DZJ A;  3IKT A;  4EMS A;  2R7T A;  3A2K A;  2D2W A;  2OQR A;  4RGS A;  3C2G A;  4GYI A;  2O5R A;  4UVC A;  5ERI A;  5K7Z A;  4JOM A;  3DKY A;  1BL0 A;  3SFZ A;  4N4N B;  2VOP A;  1OR7 A;  3M7G A;  4L9T A;  3MWM A;  3J81 K;  2IGN A;  2Y48 A;  1SD6 A;  1F43 A;  2MD0 A;  3K4K A;  3CUO A;  4RAZ A;  2DTR A;  2TCT A;  3RYP A;  3RDI A;  2CJJ A;  5FRO A;  1R22 A;  3QYB A;  3VWB A;  3OR2 C;  1OCR H;  1IXS B;  2ZJ2 A;  1IC8 A;  1S72 I;  2ZFW A;  1LE8 A;  2R7U A;  5GAD J;  2PQ8 A;  4MIM A;  1VQL I;  1TWC J;  2DFF A;  2X1E A;  3CF5 F;  1CF7 A;  4Q5S F;  2XV4 S;  1AHD P;  1BI2 A;  2FA5 A;  5D8K B;  3DEE A;  1FZP B;  3ONQ A;  2K4B A;  4I98 B;  3K2A A;  3A4C A;  4GYG A;  1HA8 A;  1WVR A;  1ACI A;  2WTE A;  4A12 A;  1E17 A;  1QQI A;  3EDP A;  2AO9 A;  3BR0 A;  2FSW A;  1QHG A;  2B0L A;  3M8F A;  1YQA A;  3I5U A;  4I01 A;  1WRJ A;  2QWW A;  5HLI A;  4UUS B;  2KFD A;  5KK1 A;  4G6Q A;  5IP9 J;  3LL7 A;  1X1D A;  5ILV A;  2MYS A;  1KU9 A;  1L0O C;  1LVK A;  4HZF A;  3ABL H;  1R1T A;  2O8K A;  2B7E A;  3A03 A;  3DU5 A;  4MEY F;  1U5T A;  1XMX A;  5LGT A;  3OY9 A;  1KZH A;  3H92 A;  4F3Q A;  5FKK A;  4Y15 A;  3NAU A;  2EBI A;  2DMU A;  3EYI A;  2L7K A;  1HXD A;  1Z67 A;  2MBF A;  1BIB A;  2OA4 A;  1R23 A;  1HKQ A;  3KCC A;  1TBX A;  4FX0 A;  4XKB A;  3OYN A;  4UV9 A;  2IA1 A;  2JA6 J;  2FE3 A;  3IWZ A;  4Y13 A;  2VLA A;  2KIF A;  4PJM A;  2UUZ A;  4WXC A;  3LNQ A;  2P81 A;  1SVM A;  4V19 K;  2DOA A;  1FEX A;  1P2F A;  4U88 A;  1VQO I;  2DA2 A;  3O2P E;  3ZQG A;  2FX0 A;  2OF7 A;  2E1M C;  5CVR A;  1H9T A;  1TWA J;  5K5R A;  2VQC A;  5FB2 A;  1PUF A;  3MAJ A;  4BXX J;  4BUP A;  3HRM A;  2R7O A;  3H3U A;  4L5J A;  3CDL A;  3NEU A;  4HSR A;  2YR2 A;  1HF0 A;  3GLL A;  1B1B A;  3K0L A;  2E7X A;  3DEW A;  1VQ5 I;  3OMY A;  2KT0 A;  2B9S A;  1Z7U A;  1Y1W J;  3WTY C;  2MH9 A;  3AAF A;  3MZH A;  1FPQ A;  2ICW G;  3IAM 2;  5EF6 A;  1FYM A;  4YFX F;  3O3K A;  3BR3 A;  1AA7 A;  1W5S A;  2O03 A;  1RRJ A;  1BI3 A;  3E5Q A;  3FM5 A;  4XNF A;  3CO7 C;  5IYC J;  3QQA A;  1TZL A;  1W7P A;  1X1P A;  4IVN A;  3SZP A;  4I02 A;  2KHM A;  2LY2 A;  1LDD A;  1Q1H A;  1O7F A;  3JRI A;  5IP6 A;  2OZU A;  5TJJ A;  1QPM A;  4HV5 A;  1J0R A;  2QQ8 A;  1P92 A;  5KAF C;  3QOP A;  2QKL B;  1WGX A;  2HOS A;  4KIF A;  5LGN A;  4ETS A;  3F8C A;  2KLO A;  1WQ2 A;  2M0M A;  3UR3 C;  3ZQL A;  1WSU A;  4LJZ F;  1XGS A;  3ZQ7 A;  2XB0 X;  2IS4 A;  4CO8 A;  4XR6 A;  3KZI C;  1VQM I;  4DQ2 A;  5FD6 A;  2EJR A;  2VBZ A;  5BMZ A;  2GXA A;  3CD6 I;  2VI6 A;  4Q48 A;  4XLP F;  1J75 A;  3HOV J;  2MD5 A;  1U9N A;  4LIV A;  4R79 A;  1Z3Y A;  2VON A;  3TW6 A;  2CFO A;  1MZB A;  2Q2E A;  2OJE D;  2HGC A;  4HEA 2;  5LRS A;  2QM3 A;  2JA5 J;  2LG4 A;  3F6V A;  4NB5 A;  1P7I A;  5E79 C;  2O61 A;  2R92 J;  1ETQ A;  2XB5 A;  2E7W A;  1YRN B;  4PCQ A;  1RES A;  1Z77 A;  2XGD A;  5IT3 A;  3OYM A;  1LB2 A;  3PQJ A;  4HDV A;  2JVG A;  4CYC A;  4B44 A;  4O6J A;  2XPV A;  1IDZ A;  1VQN I;  3H5R A;  4EEF G;  4OIR F;  1M1E B;  3ZRG A;  4PDK A;  5E8I A;  3HRU A;  1XDU A;  4PSW A;  3G1L A;  4KUM A;  3HL2 A;  2RQP A;  2HI3 A;  1BR1 A;  3G3Z A;  2CWE A;  4A3J J;  4G7O F;  3DXJ F;  3IH2 A;  4KIB A;  3JRH A;  2W84 A;  4RAF A;  3Q0W A;  2EV6 A;  2E34 A;  2GOX B;  4L0Z B;  4G94 A;  4YIR X;  3LWF A;  2F4O B;  2XAH A;  4JX5 A;  1GLN A;  1XGM A;  2L02 A;  3C2H A;  3OWT A;  3QPS A;  1P9Q C;  4FET A;  3V4G A;  2ZO4 A;  3N97 A;  5FRN A;  1ZG1 A;  4A0Z A;  2O6G E;  1F1Z A;  2ZKZ A;  2NS0 A;  2KIU A;  3N05 A;  4HX7 A;  4HOB A;  4IEJ A;  4KJZ A;  5J6X A;  3CMY A;  4HQE A;  2DA7 A;  2D1H A;  4B8X A;  2K3P A;  3W6K B;  3T8R A;  3Q5F A;  2XC7 A;  5JVT A;  1VQ6 I;  5DUK A;  1IN6 A;  2DTZ A;  4E7S A;  4HLX A;  4LGW A;  1DP3 A;  3D5R C;  2BGC A;  1NTC A;  2CQQ A;  2RRE A;  3RPU A;  2DI3 A;  3C2B A;  1UJ8 A;  1BJZ A;  1V54 H;  4OWR B;  1YS6 A;  4RBO A;  1TTY A;  1XD7 A;  3CDI A;  2FQ3 A;  1T08 B;  1ETW A;  1NG6 A;  2BXZ A;  1QVT A;  5KNL A;  3HUG A;  3J7Y J;  1IN8 A;  2W48 A;  4E6K G;  3SFI A;  2UZK A;  1BW5 A;  2O3F A;  4KIS A;  2RVC A;  2CU7 A;  1SFX A;  3MCZ A;  3RPQ A;  3CME I;  1FTT A;  3OV8 A;  3TKY A;  1I27 A;  4CCM A;  5C3E J;  1LPQ A;  2DAO A;  4LG3 A;  5FFX A;  4BY7 J;  2WAQ A;  1FYL A;  1YS7 A;  1R5I D;  2MW8 A;  2PN6 A;  3ZMD A;  4XKW A;  3PM1 A;  3SZG A;  1MBE A;  4BEH A;  3I55 I;  3L1P A;  3JRA A;  4LLG F;  2K02 A;  4HAM A;  4M9Z A;  3BLY A;  5FKM A;  2GWR A;  5DD8 A;  2HVS A;  1SFO J;  3BR5 A;  2CRG A;  3KPH A;  4KA4 A;  3JRB A;  5J40 A;  3DBL B;  1S29 A;  2A5Y B;  3FKI J;  4MQ9 F;  2CUJ A;  2F4M B;  2ZCW A;  2DPD A;  4D9J A;  3Q9S A;  3I3L A;  3K6G A;  1G8X A;  2XVC A;  1X2N A;  2IGK A;  3M1E A;  2W82 A;  4UB6 C;  2NVY J;  3V8K A;  2RKH A;  3CUQ C;  3FKJ A;  5D6F A;  3FIW A;  3BG3 A;  1OCT C;  4HDU A;  2P8T A;  6PAX A;  3E97 A;  2V26 A;  3FK6 A;  1I3A A;  3QYE A;  3FM3 A;  4ITV A;  1YG2 A;  5B5E C;  4C2M J;  5EGO B;  3NAR A;  4IZZ A;  5D5W B;  1U78 A;  3CLQ A;  4AIJ A;  2GAU A;  4QIW N;  1ZG3 A;  1SFU A;  4GFB A;  2LRD A;  3BWG A;  4KN4 X;  1K6Y A;  3GW2 A;  5F04 A;  3ABU A;  5A2Q Z;  5JLX A;  3PIP F;  3W2A A;  3F3X A;  4HV6 A;  1X3U A;  3F0C A;  4QWQ A;  3CCV I;  3S17 J;  2BEO A;  2IP2 A;  3FMS A;  3I59 A;  1RNL A;  2FBH A;  1IXR C;  5KAI C;  4A69 C;  4UNO A;  2VC1 A;  4IQ4 A;  2M8G X;  3DEU A;  1FP1 D;  1MSE C;  2HTJ A;  4EVI A;  1LUJ B;  2J5P A;  3VSK A;  1KYZ A;  1ZLJ A;  4YEL A;  2RC4 A;  4HBL A;  5HS9 A;  1OJL A;  4A6E A;  1QBJ A;  3LSI A;  3A01 B;  2K5C A;  1T2K A;  4DYR A;  2HKX A;  1SFK A;  1Z3X A;  3HIF A;  3JSO A;  4LK1 F;  2DO7 A;  2EPF A;  4CIC A;  5LBQ A;  5C4J J;  2CQN A;  5EZH A;  3MN2 A;  2DCE A;  5IYB J;  3CJQ B;  2I10 A;  1X4O A;  1XSX A;  2VQG A;  5CVI A;  4A2U A;  2STW A;  2J5O A;  2JJ7 A;  4I2O A;  3LQQ A;  4XK4 A;  4XLA A;  3DBR B;  2ZJQ F;  1MMA A;  1MDM B;  3F6O A;  3AG1 H;  5HDK A;  3K1M A;  4PFO A;  3F21 A;  2Y9Z A;  4M3E A;  2PLY A;  2Y0S A;  5D5V B;  1Y1V J;  2HU9 A;  5FLX Z;  4BYY A;  4FX4 A;  3ABK H;  3IRQ A;  4CCL A;  2ELH A;  2G7H A;  1B8I A;  4L5I A;  3H9G A;  4LIT A;  2QF7 A;  3R6S A;  2FBK A;  1DU0 A;  1LFB A;  1K4S A;  1ZRC A;  3TP3 A;  4RAY A;  1FWZ A;  4F52 A;  1R36 A;  2ID6 A;  1JHF A;  2VKV A;  3BZK A;  5B1A H;  3JRE A;  1MH4 A;  3IHU A;  1WKM A;  3F23 A;  1CGP A;  1OFC X;  2VE8 A;  1D0Z A;  3TO6 A;  3HGG A;  2Z1D A;  5DS9 A;  3HRS A;  2P0W A;  4KN7 X;  4D7M A;  3ZXS A;  2K9L A;  3EYY A;  3FF5 A;  3HTU A;  3V8J A;  4N9I A;  2LD5 A;  2K3F A;  2A6T A;  4JYK A;  4DNC A;  4LOC A;  3I0T A;  2X4H A;  3GZN B;  1MKM A;  3J80 K;  4BKX A;  4DBR A;  1JT6 A;  3KEQ A;  1TWH J;  2JPB A;  2FRH A;  4AU7 A;  2DFH A;  2CV1 A;  2EK5 A;  1DDN A;  2DFE A;  1P7J A;  3KP4 A;  1YX3 A;  2WB1 A;  4FQG A;  1HST A;  2Y75 A;  5K7H A;  1NK3 P;  4XLE A;  1VZ0 A;  1AKH A;  5FRM A;  1R00 A;  5IT9 Z;  3FXU A;  4G6D A;  4M3B A;  4ZYA A;  2AQE A;  3KYL A;  3O8H A;  1FTZ A;  5ICF A;  5JR3 A;  2ADU A;  2LKS A;  3I54 A;  1TLH B;  2L9R A;  4PK4 A;  4QSH A;  3GTK J;  2DT7 B;  3CP2 A;  3KE2 A;  2W00 A;  2JRM A;  3KEO A;  3GUD A;  1BJA A;  1VQK I;  4EJU A;  3OSF A;  5DCM B;  1GV2 A;  3DU6 A;  5L3B A;  1U2W A;  1W7P D;  4C2T A;  5ICE A;  2MLK A;  3K1P A;  4F92 B;  4KMF A;  4RDU A;  1KYW A;  1R5H A;  3W2V A;  3WTW C;  2LK2 A;  3BDD A;  2Y31 A;  3HEF A;  4DYQ A;  3H3V K;  2Y2Z A;  2ZME B;  1GXP A;  1QU3 A;  4M72 A;  1ON2 A;  4L9N A;  2IS6 A;  2BHY A;  1EJ9 A;  2QSH X;  2WAE A;  4RGR A;  1SEU A;  2JT1 A;  2LYC A;  2XRN A;  3RTR A;  5EG0 A;  4KDP A;  2W25 A;  4ON0 A;  2DMP A;  4XL9 A;  5AIP A;  4RB1 A;  1MIJ A;  3AL0 B;  1Z05 A;  4OMY A;  1QZZ A;  3BTL A;  1EA3 A;  1JXS A;  1IGN A;  3C7J A;  1SC7 A;  4NHJ A;  1ZAO A;  2LKP A;  1R7J A;  5E1Z B;  5E17 F;  2VL8 A;  3LA3 A;  4XKC A;  1EH7 A;  5LLQ A;  5E3N A;  1X3Z B;  5E3M A;  1JJ8 C;  3IAS 2;  1ENH A;  1USS A;  2X48 A;  3LAJ A;  3M4O J;  3D1N I;  1LQ1 A;  1VQ7 I;  4B09 A;  2RNJ A;  1QHH D;  2XSJ C;  4EAT A;  5M3F J;  3ZQF A;  4ESF A;  3FX3 A;  4AD9 A;  2LR8 A;  1T8I A;  4E7Z A;  4G9Y A;  2Y0M A;  4LG0 B;  2M8E A;  2HWV A;  2HZD A;  5IOY A;  3SZT A;  1UHM A;  4MO7 A;  2A61 A;  3PUF A;  3S32 A;  4J00 A;  2CUZ A;  3ASN H;  2NS7 A;  3JRD A;  1YO5 C;  4IL6 C;  3E5U A;  4FE4 A;  4S05 A;  2JA2 A;  2CV0 A;  3B6A A;  1ZGW A;  4G7H F;  4FTH A;  2BHZ A;  2I5U A;  3BQY A;  2X51 A;  1NHA A;  1R4M B;  1TNS A;  4DZP A;  4KIT B;  2UWM A;  2OD5 A;  1HW2 A;  3VOE A;  4BBS J;  4XON A;  2CQ7 A;  2HNH A;  5D5U B;  3CCR I;  1A36 A;  5L3C A;  2H1K A;  2W7N A;  2R7S A;  2IXS A;  2M0C A;  1FOW A;  3SHF A;  5LHI A;  2K9M A;  1GVD A;  2F2E A;  1XX5 A;  2ID3 A;  2Z99 A;  2KRF A;  2L4M A;  2OCC H;  2EIK H;  2K86 A;  4I0B A;  3RPU D;  4DOZ A;  3VB2 A;  3OYC A;  3KP5 A;  4RLQ A;  3HOY J;  4JX4 A;  1U8B A;  2QCO A;  3ZCO A;  1D8K A;  1FIA A;  2FOK A;  2KIQ A;  2H6C A;  2KRC A;  1I3Q J;  4AUX A;  1RKW A;  3ELK A;  3JAM K;  2EA4 A;  2XPU A;  3PNV A;  4UUS A;  4MTD A;  4CHU A;  2X6X A;  5FO5 A;  3OS1 A;  2L5Q A;  3WG9 A;  1MBH A;  3RYR A;  3AG4 H;  4CGZ A;  1ZG5 A;  1MBG A;  4LK0 F;  2XGE A;  2R5Y B;  3GFL A;  3T0Y A;  1FLI A;  3PNT A;  4P55 A;  5HNH A;  1X3W B;  2H09 A;  2BY2 A;  2VQH A;  2Y9Y A;  3CP8 A;  3VYU B;  4ZYH A;  3EUK L;  3L00 A;  2VN2 A;  1O7L A;  4CYD A;  5HVQ C;  3EUH A;  4OIP F;  4OAY A;  2JN6 A;  4NNJ A;  4P9U A;  3S1R J;  3CCQ I;  3G4S I;  3GLX A;  4WXD A;  1MBK A;  3JRG A;  1T33 A;  1S9H A;  1XTA A;  2BY3 A;  3L2V A;  2MFZ A;  1V5E A;  1KQ9 A;  1POG A;  2EFO A;  2JZY A;  1DPR A;  5ICC A;  1E3O C;  3WHC A;  4I99 C;  1VFC A;  1EH6 A;  4RAG A;  3PFI A;  4E4H A;  1U8R A;  1ZGJ A;  3AKZ A;  1YIO A;  5CJ9 A;  1K61 A;  4LLL A;  2JTV A;  2UV1 A;  3Q0V A;  3HG9 A;  3E5X A;  1Y56 A;  2JUG A;  2DN0 A;  3UKG A;  2DJN A;  4WXH A;  2R7Q A;  3FMQ A;  3D0S A;  3CJT B;  2R4G A;  5K5Q A;  3O6B B;  4G12 A;  2FMY A;  4UV8 A;  2LNB A;  3MZY A;  3K4M A;  4OIO F;  4FIS A;  4LB5 A;  5JLW A;  5F0C A;  3EQL F;  1G3W A;  5HDG A;  1PUE E;  3S3M A;  3GWZ A;  3P9C A;  4ASN A;  5LHH A;  1XCV A;  4A5N A;  2JMW A;  5B1B H;  3H5N A;  5DM7 F;  3JSP A;  2DW4 A;  3TW7 A;  3ZPL A;  4Y17 A;  3IKV A;  4IKF A;  4CDG A;  2E5Z A;  2STT A;  5GTH C;  1BI1 A;  3ZR8 X;  4XRM A;  3HPG A;  3GX4 X;  2OAZ A;  4EJW A;  1XS9 A;  4D1Q A;  2NOG A;  4HQM A;  3OS2 A;  3KYD B;  2X6O A;  1O57 A;  4UY8 I;  3U21 A;  2A3S A;  3D5S C;  1T6S A;  4IOC F;  1JT0 A;  1HDP A;  2DK8 A;  1ERD A;  2GLO A;  1ZR4 A;  3OOP A;  5EEA A;  3C3W A;  1NG7 A;  3PSF A;  4PFP A;  1ZK8 A;  1MJB A;  5CQG A;  3ZMU A;  1YE9 A;  1YW8 A;  5DCF A;  3DTI A;  4ZZL A;  3DPT A;  3K69 A;  3KLN A;  3TO7 A;  4LD5 A;  1D0X A;  1IV6 A;  1R1V A;  4UUT A;  2LH9 A;  3LA2 A;  4YFN F;  4MEX F;  1ULY A;  2ZB9 A;  4ESJ A;  1WJB A;  3PUB A;  1WCM J;  3M8J A;  1X1B A;  2DQL A;  4PUS A;  3QPT A;  3A02 A;  2K9S A;  2YX7 A;  4XOT A;  4ZTF A;  2BZT A;  5D5X B;  2OBP A;  5ED4 A;  4YEJ A;  2HPM A;  3CJN A;  4BQQ A;  5J8F A;  1YRN A;  5GPA A;  5HS8 A;  2DOD A;  3HYI A;  2HQN A;  3V42 A;  3TED A;  3CC7 I;  2WY8 Q;  1Y39 A;  4KNY A;  4BHP A;  2K40 A;  3N4M A;  2LRE A;  2JPC A;  2VE9 A;  3BJO A;  3MKZ A;  3FXL A;  3L2Q A;  1ETV A;  3TOA A;  2M4G A;  2XAF A;  4HPQ A;  4OMZ A;  1W36 C;  1WJD A;  1XG1 A;  1W0U A;  1R58 A;  1JE8 A;  2CO5 A;  3V7C A;  5D8L B;  2JRT A;  4IHX A;  1FBQ A;  3QRF F;  2CUF A;  1Z6R A;  5IY5 H;  1FJL A;  2ISZ A;  2PX9 A;  2EZH A;  3CUQ A;  4ENN A;  2HYJ A;  1UG2 A;  4NC6 A;  3J7A O;  1I50 J;  3HPH A;  2IA2 A;  1SMY F;  3CC2 I;  3Q9V A;  3G73 A;  1OIS A;  3R0A A;  1TNT A;  5C4X J;  1KA8 A;  1WZ2 A;  1HQC A;  2EFW A;  3A0H C;  3CO6 C;  3OYG A;  3R61 A;  1A31 A;  3U9G A;  1WJF A;  2W1O A;  3CMM A;  4MGR A;  1WFX A;  4ZDL A;  2XRO A;  2H6B A;  4ENK A;  3FHN A;  2C6Y A;  3GTO J;  1R4N B;  3RQ4 A;  1YFH A;  1STZ A;  4CCN A;  2GM4 A;  4XRS G;  2YUS A;  5E20 A;  1HCR A;  3KP6 A;  2KZV A;  3FXK A;  3GFM A;  4MLO A;  1S3J A;  4XLH A;  4KT6 A;  4Y33 A;  2R93 J;  5TIS C;  3CCL I;  1BI0 A;  1BW6 A;  4ZYG A;  1D1C A;  2F5D A;  3KZY A;  4BAY A;  2VBW A;  1QRY A;  2OQG A;  3OL3 A;  3VSL A;  1MND A;  1RZ4 A;  1FC3 A;  3ZMZ A;  2GA1 A;  3AG3 H;  3I53 A;  2QKM B;  2XKP A;  1XSV A;  3HTS B;  2FML A;  2Y69 H;  5L3G A;  2L2O A;  3COA C;  4NDL A;  3GFJ A;  4CA0 A;  2PG4 A;  1K4T A;  2A05 A;  1U6G A;  3EUH C;  2HDW A;  4HNV A;  2IW5 A;  4PJL A;  4HF2 A;  2JSP A;  2DA1 A;  1MW7 A;  2JSC A;  1UHS A;  3BZ6 A;  1CF7 B;  3QP5 A;  4CH7 A;  5FKO A;  2BVL A;  3LOC A;  1HDD C;  2EFQ A;  3TP0 A;  3EUA A;  4RS8 A;  1ZGA A;  1WH5 A;  2KIM A;  3GO5 A;  4IPA A;  4RMN A;  4E7K A;  2LLK A;  2H8R A;  1W5C C;  2BW3 A;  3GTG J;  2P4W A;  2EZK A;  1T0F C;  1LFU P;  3MEX A;  2HOT A;  3S2D J;  1YYV A;  1Z0X A;  4IXA A;  2D1V A;  1DQU A;  5EGO A;  2JVH A;  3SYT A;  2VBX A;  3ECO A;  2BVM A;  2WV1 A;  1O4X A;  3SJM A;  3KET A;  2M4K A;  3HBL A;  2FXA A;  2H1L A;  3WE3 A;  3LFK A;  2PJP A;  1J5Y A;  4IRH A;  1FSH A;  4CCO A;  2NOJ B;  2O0Y A;  1DGR M;  3ZP5 A;  3G6E I;  1V5G A;  1BC7 C;  1U5T B;  5E3O A;  1RIO H;  1JUP A;  4I7H A;  3GTP J;  4BQA A;  2MAB A;  3B6C A;  1BN5 A;  3M8E A;  1F5T A;  3R60 A;  2LP0 A;  4S0H B;  5F1R A;  1TWF J;  4IQJ A;  3AFH A;  3JTG A;  2LBF A;  2HXO A;  3HSR A;  3PL8 A;  1R1U A;  5LHG A;  3LSH A;  1U3E M;  2EZI A;  1KON A;  3WTV C;  3WU1 B;  3BCB A;  4PJN A;  3HGY A;  1EKE A;  2VPR A;  3S2H J;  3ZQI A;  2DU9 A;  1E3H A;  2M3A A;  3QU3 A;  5DYM A;  5F08 A;  1JKQ C;  4I76 A;  2I8D A;  2Q0O A;  4JBA A;  1D8J A;  3A01 A;  2V4J C;  2BXY A;  3KP2 A;  4OIN F;  2RAE A;  4H4K C;  3GME A;  3E1S A;  4U7B A;  2FJ1 A;  3NWT A;  1XCB A;  3MKL A;  2BY0 A;  2EIN H;  2K85 A;  1BM9 A;  1IN7 A;  2DOF A;  3WU2 C;  5D4R A;  3LSJ A;  4MHG A;  5F6F A;  4A3D J;  2VIX A;  3VOD A;  4ZDO A;  2NNN A;  1T38 A;  1MDM A;  4I0A A;  2DT5 A;  4A3K J;  2QA4 I;  1IDY A;  1XC5 A;  1N75 A;  4BDZ A;  2Z3Y A;  4HA8 A;  4L5E A;  2X85 A;  1NH3 A;  2XF6 A;  3H1C A;  2XKO A;  5CKT A;  2FF4 A;  1GDT A;  3WTZ A;  2O9L A;  2E2J J;  4A0X A;  5HLH A;  3M07 A;  4BJ5 C;  2E1O A;  4XOR A;  1W1W E;  1JHH A;  1IRZ A;  1R6R A;  3OYD A;  4BJT A;  2Z33 A;  3GCM A;  3OYK A;  3U1D A;  4WF2 A;  3A0B C;  3LSR A;  3TDU C;  3GTJ J;  1FOY A;  1APL C;  1LEB A;  2LFB A;  5J1U A;  4KMU X;  2CGP A;  1GVJ A;  2HVR A;  2X6Y A;  5HNF A;  2ZXJ A;  1I6X A;  4BH9 A;  4C3I J;  1J09 A;  3OYI A;  1K6O A;  1T98 A;  1IV8 A;  1IW7 F;  4HX4 A;  3OIP A;  2V9K A;  1SVL A;  1PVE A;  3F8F A;  3HSF A;  5KVR A;  2R7F A;  2HZT A;  4YRV A;  4RB0 A;  4DW6 A;  3GTM J;  1I1S A;  2AXT C;  2ESN A;  2BY1 A;  4P96 A;  3IC7 A;  2IAI A;  1ITY A;  4C3J J;  2K9N A;  2Q2E B;  5BOX A;  1H0M A;  2MA3 A;  4AIH A;  5DTD A;  2PI0 A;  4A3L J;  3KYC B;  3WTT C;  1E0E A;  4RB3 C;  2FD5 A;  3UNG C;  2OC6 A;  4II3 A;  2PJR A;  2VB6 A;  4L9J A;  4AID A;  3FBN B;  4EQQ A;  1I5Z A;  5J1R A;  1Z6T A;  1A6I A;  1OYY A;  2QVO A;  3ZMT A;  2M30 A;  3S14 J;  2VPL A;  2HQ5 A;  4G6T B;  3RKY A;  3F8N A;  1K78 A;  1YOV B;  3KZZ A;  3BPX A;  1WPK A;  3HOZ J;  1FP2 A;  3DQV C;  5GPC A;  4QPO A;  1QNT A;  2HQA A;  3HSE A;  5GP9 A;  3IV5 A;  3H35 A;  4F55 A;  4RLF A;  4ZC3 A;  4J01 A;  2ZME A;  2W4S A;  4N4O B;  2M7B A;  3IUO A;  3RIR A;  4JQF A;  5L3F A;  3HRT A;  3SEQ A;  3HOX J;  2DDB A;  3HHH A;  3PO3 J;  2MC4 A;  3FXO A;  1W5T A;  3IH3 A;  1B6A A;  1F9N A;  4HW0 A;  1QPI A;  3BTC A;  2MH2 A;  1J7K A;  3BOQ A;  5IYD J;  4BL0 B;  5J4Y A;  3J81 Z;  4CXF A;  3K7A J;  1JTX A;  4IRG A;  3J7A Y;  1N25 A;  1YLF A;  4IX7 A;  2CYY A;  2IS1 A;  2CQK A;  3K4C A;  2ME6 A;  5E3L A;  1X58 A;  3E0J B;  4AM3 A;  2R7Z J;  4LMY A;  2L9N A;  1DGW Y;  1Y0U A;  2XF7 A;  3HJE A;  2EA2 A;  5H20 A;  3HUG B;  4XRS A;  3I4M J;  3H3Z A;  3F8M A;  1TT5 B;  4ENJ A;  3U2R A;  2O8X A;  1FBU A;  2NNY A;  2GOM A;  4HNT A;  4AC0 A;  4B3X A;  4UUV A;  4P9F A;  3QYF A;  4Z2Y A;  3BR6 A;  1N78 A;  4G8X A;  3K10 A;  3OYL A;  1ZEL A;  2QBY A;  3QPH A;  4Y4R A;  1RR8 C;  2WY7 Q;  4U7D A;  2CMP A;  2IGM A;  4H0E A;  3CJR B;  1XN7 A;  2VAS A;  4KIC A;  4ZJZ A;  4LB6 B;  4FHT A;  3TMO A;  4EGZ A;  4A6D A;  4WK8 F;  4O5V A;  5D6E A;  4M73 A;  3DLL F;  3ZN1 A;  2EFN A;  3WGG A;  3HOT A;  4NUB A;  1P4W A;  1Z91 A;  3GZ5 A;  4L9V A;  4EGY A;  2KP6 A;  1OQY A;  4A3E J;  2L9S A;  1JKR C;  4B48 A;  1IO2 A;  2VJI A;  1Z1D A;  2GIZ A;  2ZJP F;  2EIJ H;  4E7L A;  4E70 A;  1FIP A;  3WGH A;  1MNE A;  4C3H J;  5H2F C;  3IRR A;  4ZTJ A;  5F0H A;  1YIJ I;  1RR7 A;  3ROU A;  1SFE A;  3DLA A;  2WWY A;  3GBG A;  2QYO A;  1FMW A;  3S93 A;  1UZC A;  4A3F J;  1SVO A;  3S16 J;  1BOB A;  4S04 A;  3H0D A;  2DYR H;  4JX6 A;  2ESH A;  2DXI A;  3DFG A;  3S1N J;  4XSZ F;  3KFW X;  3W3C A;  1MMD A;  1TW3 A;  3VDX A;  2E5N A;  4IHT A;  3WTU C;  1ZKG A;  2IVM A;  1SAX A;  3BCA A;  3HOS A;  1ODD A;  3FHZ A;  1ZR2 A;  4XLF A;  4DJA A;  1LDK B;  3D5L A;  2R5Y A;  5K7F A;  1B59 A;  1VND A;  4ZDP A;  5FLM J;  1FMV A;  1MMS A;  2KDO A;  2FEZ A;  2PMZ N;  1TC3 C;  2EIM H;  4NQW A;  1TQM A;  3VEP A;  3FXQ A;  3BZC A;  1IUF A;  2YSR A;  1Y0N A;  2KJB A;  5C44 J;  4O3M A;  4P5O A;  3DWL E;  1E2X A;  3HKZ N;  2EB7 A;  2V79 A;  3DTK A;  4UB8 C;  1C0W A;  2YU3 A;  2ELJ A;  2IJL A;  3WOD F;  1ZRF A;  5JI6 A;  1V4R A;  3DKX A;  4ZYE A;  4EM1 A;  5KHD A;  1S7E A;  4M6V A;  5FFZ A;  2CW7 A;  2PEX A;  1YJ9 I;  1P6R A;  1A35 A;  3ASO H;  2Z5U A;  4XM3 A;  4NC8 A;  3RI4 A;  2IBD A;  3LAP A;  2HKO A;  2ZXW H;  3ERE D;  1P4A A;  1J9I A;  3OS0 A;  3PIO F;  1D5V A;  2GBY A;  4II2 A;  2AS5 F;  3K70 C;  1XMA A;  2XSD C;  1FSE A;  3S3O A;  2F5V A;  3KEY A;  5E1W A;  2DA3 A;  2ZFU A;  2H27 A;  1QO0 D;  3I4N J;  3OYJ A;  2BYV E;  1FBS A;  4HST A;  2JA7 J;  1BBY A;  4AYB N;  1S6L A;  2BOL A;  5M5Y J;  3L2U A;  2B63 J;  3ABM H;  2V1X A;  3H9J A;  1UB9 A;  3FZV A;  3K4J A;  3GZ6 A;  1T56 A;  2VQL A;  4I09 A;  1MMN A;  3GYH X;  4XN0 A;  4LIU A;  5ILS A;  1VQP I;  1UG0 A;  3ERM A;  2RGV A;  2VXD A;  2EQR A;  3MD2 A;  4MTE A;  2WAD A;  4A3M J;  5J1Y A;  2DFI A;  3O8G A;  2ZME C;  3RQI A;  1ONV A;  2GQQ A;  4EJO A;  1IXC A;  4UVA A;  3FBI B;  2KIS A;  4YFK F;  1Q1V A;  3KX2 A;  2X6W A;  1WJE A;  4D0P A;  4KIG A;  1WJ5 A;  3TDZ C;  4QLC U;  2OTL I;  2UXX A;  1K79 A;  2VT3 A;  2O7O A;  4FCY A;  2V7F A;  2DDA A;  3AL0 C;  3P7N A;  5KCM A;  2DQR A;  3SXY A;  3E6B A;  2P5L C;  2VJJ A;  1RUN A;  4GRI A;  2LF7 A;  2KZG A;  5IOZ A;  3G2B A;  3L09 A;  3NRV A;  3PFY A;  2R7X A;  3CTA A;  3JW4 A;  2ISY A;  3HOW J;  1BA5 A;  4XID A;  1EF4 A;  1DUX C;  3R4K A;  2QQA A;  2LKX A;  3VYR B;  5FKN A;  3RKW A;  1OCC H;  2M9H A;  1A6Q A;  2FOW A;  2Z16 A;  3LSP A;  4IJA A;  2JQ7 A;  2WV0 A;  2WAF A;  4G7Z F;  3HDD A;  4C30 A;  1F36 A;  1TW2 A;  3TOB A;  3MKW B;  3CQZ J;  3Q3S A;  2HVQ A;  2W24 A;  5GAE J;  4I6Z A;  2QGU A;  1YJW I;  2HDC A;  5M5W J;  4OAZ A;  4M3D A;  1WJA A;  4LLN A;  4N9H A;  3BR1 A;  3PJR A;  1FYK A;  3G1O A;  3S1M J;  4OIQ F;  2MSY A;  3VFZ A;  4RGU A;  5A2Q K;  1YI2 I;  2HFH A;  3OSG A;  4RB2 C;  5CVJ A;  3CF2 A;  3PNY A;  1J59 A;  5EG0 B;  4B3A A;  4Q4Z F;  1SMT A;  1AWC A;  3FDY A;  1XPX A;  3CZ6 A;  2Q1Z B;  3IWF A;  3S2W A;  4F7Z A;  5DDG A;  3PQK A;  4ZH4 F;  2X1C A;  4U0W A;  2QQB A;  2L4A A;  2ME0 A;  2FBI A;  3CCY A;  1XSD A;  1IN5 A;  1HKT A;  1T0F A;  2OCE A;  2YX4 A;  1KQ8 A;  1G3T A;  1IUY A;  1X1A A;  1UAA A;  2KPM A;  2R5Z B;  4Y3O A;  4XQF A;  2QEX I;  3T1B A;  2JK3 A;  3GXO A;  2DA4 A;  4A93 J;  1FOX A;  2L7M P;  5IPA A;  2KDZ A;  3P5J A;  1FT9 A;  3U1K A;  2WBM A;  1WI9 A;  1KU3 A;  2H94 A;  3HZJ A;  2KMU A;  1U0J A;  1KGS A;  3K70 D;  4K2E A;  5L3E A;  4PZJ A;  5BQT A;  3BY6 A;  1DU6 A;  2KKO A;  1AU7 A;  1JGG A;  2FU4 A;  1TWG J;  1VQ8 I;  3GF2 A;  1I1G A;  1QGP A;  1ZQ3 P;  2GXB A;  3G71 I;  1JI8 A;  5B3S H;  4EM2 A;  4YII A;  4HG2 A;  1HOM A;  2E1N A;  4XBF A;  4DIQ A;  5AIQ A;  2CFX A;  3ML6 A;  2P5K A;  1MNM C;  4M9S A;  1D5Y A;  5HS7 A;  5F0F A;  1G3S A;  4JP0 A;  3CC4 I;  5J3L A;  2E36 A;  5FLX K;  2FNP A;  3VYT B;  3G1M A;  2OV7 A;  2RN7 A;  2Z2S B;  5DM6 F;  2E1M B;  3ZMV A;  4EJT A;  4A3G J;  3RCO A;  4X6A J;  4PJ0 C;  4C9Y A;  4AIK A;  3P9I A;  3QOE A;  1OCO H;  1YHQ I;  1JKO C;  4QTR A;  2X0L A;  3L2C A;  3HHG A;  4EM0 B;  4AVZ A;  5EJC A;  1RC9 A;  3K4N A;  5JHF A;  3LA7 A;  2E60 A;  4Y7N J;  3W2W A;  1Z9C A;  4YG2 F;  2QUF A;  3I9V 2;  3K4L A;  4FE7 A;  3BG5 A;  4CUG A;  3LFU A;  1RET A;  1DP7 P;  1ZAR A;  5BPD A;  1I6H J;  2ZSI B;  1A5J A;  2RNG A;  2FQ4 A;  4BE1 A;  1GXQ A;  2ECC A;  4M3F A;  2E2I J;  2LY9 A;  1V5F A;  3S8P A;  1ZH5 A;  1S7A A;  1BIA A;  2OU2 A;  4MQV A;  5ICG A;  1SAU A;  2E1C A;  5GAG J;  4RM2 A;  3DTE A;  3BPV A;  2YPR A;  1XDS A;  5E8G A;  4IHW A;  5GAH J;  5IT9 K;  2DMQ A;  3JTH A;  2OPT A;  3MKY B;  2DA5 A;  4F93 B;  1K83 J;  2EZL A;  4C2U A;  3SQN A;  4PSX A;  2DT6 A;  3QOD A;  5FLV A;  1WWX A;  2HDD A;  2LTP A;  3GTL J;  4PGH A;  2M1B A;  1G2H A;  4HX8 A;  2VKE A;  4WWC A;  1B72 B;  4GCV A;  4MFE A;  5HOO A;  1Z7L A;  5DD4 A;  3DPL C;  3SEZ A;  1N77 A;  2R3S A;  4KYW A;  2XPW A;  3E6C C;  1MSF C;  2VOO A;  2F4I A;  4BHB A;  4XN3 A;  5BPI A;  3GFI A;  3CCS I;  3BJ6 A;  3H0G J;  1EH8 A;  4IHV A;  2ECB A;  5CQE A;  1O3R A;  2CQX A;  2RDP A;  5TRD A;  4A3B J;  2LVS A;  4OU0 A;  3OYF A;  2XRL A;  1G4D A;  5JHU A;  4Z6Y A;  2AHQ A;  3JCU C;  4GGG A;  3RKQ A;  2X1D A;  1MD0 A;  2L9V A;  1WI3 A;  3DV8 A;  4HLY A;  2NVX J;  1IN4 A;  2M34 A;  3ECH A;  3J80 Z;  3QPL A;  2LOO A;  2P6T A;  3ZN0 A;  3AG2 H;  1FX7 A;  3LSK A;  1GV5 A;  3GTQ J;  2EH3 A;  2M87 A;  2G9W A;  2F48 A;  3BJA A;  3E7L A;  4BU2 A;  1LE8 B;  3OIO A;  3LMM A;  3MVP A;  5CYV A;  2D45 A;  4YIF A;  4BY1 J;  1TP4 A;  2QEN A;  3RJP A;  5JFR A;  1FNN A;  1LDJ A;  3OIQ A;  1RPW A;  5EZG A;  4XLN F;  2M2E A;  4X0G A;  4XKV A;  2EV5 A;  3H36 A;  4BE0 A;  4CZC A;  1ZHF A;  3I71 A;  3CDH A;  1ZRE A;  3F9K A;  3PSI A;  1VF9 A;  4PJJ A;  1QZY A;  4DGW B;  2GIV A;  1YW7 A;  2OZ6 A;  2CV2 A;  1X1C A;  4M74 A;  1OKR A;  2FUG 2;  1PP8 F;  2PMH A;  3IL2 A;  3CCE I;  5BNG A;  4BJ6 C;  1S8N A;  1UFM A;  2HEO A;  1ORK A;  2VKD A;  2VT2 A;  5CPR B;  3DCF A;  4M6Y A;  4IHY A;  1MBF A;  3WGI A;  1Y8Q B;  3CCU I;  1ZLK A;  4E7H A;  5K5O A;  1R9T J;  3WE2 A;  2VOD A;  2QSG X;  2LF8 A;  4BE2 A;  1H89 C;  3M3Y J;  2TRT A;  4HRI A;  2IS2 A;  1R71 A;  1W36 D;  1T39 A;  2V1D A;  1E3P A;  1FY7 A;  3DKW A;  1OR7 C;  1J2X A;  4IO9 F;  1G6N A;  3HOU J;  1TQP A;  3PO2 J;  4U87 A;  3S3N A;  4CCJ A;  1JUM A;  2AXL A;  2N8G A;  2V9V A;  1LVA A;  3CLO A;  1IJW C;  3M1C A;  1FOK A;  5LEJ A;  2NAZ A;  3ULQ B;  1KU2 A;  1HLV A;  1PUF B;  2A07 F;  1ON1 A;  4UXN A;  2P5V A;  2PFB A;  3CUQ B;  3ZQH A;  2NVQ J;  2F5F A;  4XIC A;  3DBH B;  1L3L A;  4Q47 A;  3T5X A;  4A3I J;  2HYF A;  2V6E A;  4PGG A;  3L7W A;  1IRX A;  1X19 A;  5FD5 A;  2NXN B;  2RV8 A;  4A5M A;  1WH7 A;  1LNW A;  1I39 A;  3FXJ A;  3Q0U A;  9ANT A;  4UVB A;  1X2M A;  2LC2 A;  2ETH A;  2D5V A;  2ZXH A;  2G7U A;  2HOA A;  3A1Y A;  3SDG A;  3S15 J;  3FXM A;  1K7A A;  2COM A;  1ETO A;  1OYW A;  1P4X A;  2CG4 A;  2DA6 A;  1W7P B;  2UXN A;  1W0T A;  1WHU A;  2QLZ A;  3R0J A;  1OMI A;  1T95 A;  4ABZ A;  1MGT A;  4IHS A;  2XGC A;  2ELK A;  2R7V A;  3CMA I;  2CW8 A;  4LFU A;  2JUC A;  5J8C A;  5FJ8 J;  2DJI A;  2R0Q C;  1U5T C;  5CLS A;  4B4C A;  5GTI C;  3GEZ A;  3F8B A;  1JUS A;  1YJN I;  2P7V B;  1UHW A;  3HB9 A;  3ZOB A;  1VTN C;  2EIL H;  3LSG A;  2KRH A;  3HM5 A;  2R7W A;  5BS6 A;  2AQF A;  2VBY A;  1ZTR A;  3BTJ A;  5DEQ A;  3V7S A;  4DYC A;  1SAN A;  3OOU A;  4M6X A;  3JAM Z;  1TL8 A;  3C1D A;  3L9F A;  3M9A A;  1OYI A;  3NQO A;  4F91 B;  2MGQ A;  2XIG A;  3KIO A;  3TO9 A;  4R1H A;  3HC7 A;  4HYE A;  1O3S A;  3MMY B;  2LSO A;  1MMG A;  1LEA A;  2CS3 A;  1YW9 A;  3LQR A;  3LST A;  2BW3 B;  2Y30 A;  4CCK A;  2F5E A;  2NVT J;  1G3Y A;  3QU6 A;  4CYC B;  2K7L A;  4DBQ A;  3OYE A;  2JWT A;  1B4A A;  2K4J A;  3RZD J;  3EET A;  1GUU A;  3S1Q J;  5DCM A;  4BAC A;  3CCJ I;  5J47 A;  3TGN A;  4BHC A;  4A0Y A;  2E2H J;  5LRR A;  3MZ8 A;  1PJR A;  3H5A A;  3I4P A;  4GO1 A;  3FMR A;  1Y6I A;  2ZXI A;  2PMZ A;  1MBJ A;  4D7N A;  4TV7 A;  5M3M J;  5E1X A;  3P9K A;  4ESB A;  2DOE A;  2WC2 A;  2LBF B;  3C18 A;  4GDF A;  1B9N A;  2VUM J;  1H88 C;  3VYS B;  5L3D A;  3E6D A;  4CZZ A;  4U0Y A;  5CVV A;  2L01 A;  3CES A;  2Q8K A;  3V8L A;  1W4M A;  2OUM A;  3F22 A;  3HKZ A;  4UHT A;  4IRI A;  2P6S A;  5H6Q A;  1JGS A;  1MJA A;  1V3F A;  2XGX A;  2M7A A;  2MLG A;  4HNU A;  3T8T A;  5HLG A;  1LKX A;  1OCP A;  4NC7 A;  4QPQ A;  1IF1 A;  1LJ9 A;  2HXI A;  2KQR A;  4R8H A;  3IH4 A;  5HDN A;  5F27 A;  2IGO A;  4KT5 C;  4ZZD A;  2M5W A;  5TGT A;  4CSW A;  3MFK A;  2X9D A;  3RSN A;  2K9Q A;  1D0Y A;  2ZSH B;  5EYR A;  3FXR A;  4AYB A;  1YTY A;  2BV6 A;  4EV0 A;  2NS8 A;  1XMK A;  1SD7 A;  3BC8 A;  3WTS C;  1ETY A;  4BEH B;  2L0K A;  1D3Y A;  4MFD A;  4LG0 A;  4BDY A;  2COB A;  1PDN C;  2HYG D;  3WHB A;  2CW0 F;  3BQZ A;  3ISP A;  4B47 A;  3W6V A;  3E3V A;  1ETK A;  2HTS A;  2WAQ N;  1KQ0 A;  4ANJ A;  2E19 A;  1ZN2 A;  2ZC2 A;  1HW5 A;  2IEK A;  3K4B A;  5IP7 J;  4XRF A;  3VPR A;  3I64 A;  3JRC A;  2DK5 A;  1S5L C;  2F5C A;  1EV7 A;  3OL4 A;  2XDV A;  4U0V A;  4JK1 X;  2XAJ A;  2HR3 A;  1S7O A;  1XB4 A;  2L3D A;  1QA6 A;  3QWL A;  1TT0 A;  3BG7 A;  3K1N A;  4WCG A;  1Y8R B;  2R7D A;  2ACJ A;  5F1J A;  3J7Z I;  2VJ4 A;  1R5G A;  1IRG A;  1PYV A;  2DMN A;  2H8W A;  3FWE A;  5DUI A;  2EV0 A;  2VXZ A;  3JRF A;  4BBR J;  2M45 A;  3BTI A;  3BG9 A;  3L2W A;  4MNU A;  1JKP C;  2GZW A;  2HPI A;  2PJR B;  1SD4 A;  1BR2 A;  4FAS D;  3I59 B;  3L2R A;  4W1U A;  2EFP A;  2BE5 F;  1HBX G;  2E35 A;  1O3Q A;  4BXU A;  3KLO A;  3KP7 A;  3I58 A;  1D1A A;  2VJ5 A;  4XSX F;  4AVP A;  2V1U A;  4X1E A;  1K78 B;  1QVU A;  4OOI A;  4V2F A;  2W85 A;  2NYX A;  2LMD A;  4IOA F;  2HOE A;  3OYH A;  1Z21 A;  2OTJ I;  1UCR A; 
#chains in the Genus database with same CATH homology
 3FIS A;  4QIW N;  2R5Z B;  4GFB A;  4Y52 J;  2JK3 A;  3BR2 A;  2DA4 A;  4A93 J;  4NDL A;  2L7M P;  5IPA A;  2KDZ A;  5F04 A;  1CQT A;  5JLX A;  4V2G A;  4HNV A;  2DA1 A;  5HOD A;  1DU6 A;  1UHS A;  3F0C A;  5FKO A;  3LOC A;  3FK7 A;  1JGG A;  1AU7 A;  3S17 J;  1HDD C;  1TWG J;  3TP0 A;  1WH5 A;  3JR9 A;  1ZQ3 P;  4A69 C;  2M8G X;  2CUE A;  1MSE C;  1HOM A;  2LLK A;  2YS9 A;  2H8R A;  1MNM C;  3GTG J;  2HOT A;  2EZK A;  1LFU P;  1D5Y A;  3S2D J;  5F0F A;  4JP0 A;  1Z0X A;  5FKL A;  1B8I B;  5J3L A;  5EGO A;  1OJL A;  3G1M A;  2WV1 A;  1O4X A;  3A01 B;  3SJM A;  4DYR A;  3HBL A;  2R5Z A;  4A3G J;  4J19 A;  4X6A J;  2Y0S N;  5C4J J;  1JKO C;  5EZH A;  3MN2 A;  4QTR A;  5E3O A;  5IYB J;  2I10 A;  1JUP A;  3GTP J;  4Y7N J;  3B6C A;  2JA8 J;  2JJ7 A;  4FE7 A;  4XK4 A;  3BG5 A;  1RET A;  2LP0 A;  4S0H B;  1TWF J;  1H8A C;  1I6H J;  1VI0 A;  2HXO A;  5M5X J;  2Y9Z A;  1A5J A;  4M3E A;  1U9O A;  1Y1V J;  2EZI A;  2FQ4 A;  2ECC A;  2YU9 J;  3HGY A;  2VPR A;  3S2H J;  3ZQI A;  4M3F A;  1JJ6 C;  1JKQ C;  5F08 A;  2E2I J;  1B8I A;  4I76 A;  2LY9 A;  2DMT A;  2QF7 A;  1DU0 A;  3A01 A;  1LFB A;  1AKH B;  3TP3 A;  2L7F P;  2RAE A;  2MG4 A;  4IHW A;  2FJ1 A;  2DMQ A;  2ID6 A;  3MKL A;  2VKV A;  2OPT A;  2DA5 A;  3JRE A;  1K83 J;  2EZL A;  3LSJ A;  1MH4 A;  1OFC X;  5FLV A;  2WB1 N;  1MH3 A;  3HGG A;  5DS9 A;  4A3D J;  2HDD A;  4D7M A;  2LTP A;  3GTL J;  4A3C J;  1G2H A;  2LD5 A;  4JYK A;  1UMQ A;  2VKE A;  1B72 B;  4LOC A;  4MFE A;  4A3K J;  1RKT A;  1IDY A;  1XC5 A;  4BKX A;  1JT6 A;  4L5E A;  1GT0 C;  1TWH J;  2XPW A;  1MSF C;  5EDN A;  1GDT A;  2O9L A;  2E2J J;  2E1O A;  1P7J A;  3H0G J;  5K7H A;  3ZQC A;  1NK3 P;  1IRZ A;  1AKH A;  4IHV A;  2ECB A;  4M3B A;  2CQX A;  3O8H A;  3LSR A;  1NK2 P;  2LVS A;  3GTJ J;  4A3B J;  1FTZ A;  2XRL A;  1APL C;  2L9R A;  2LFB A;  5J1U A;  3RZO J;  2G0E A;  4QSH A;  3GTK J;  2AHQ A;  4C3I J;  3RKQ A;  2L7Z A;  1WI3 A;  3OSF A;  2NVX J;  2M34 A;  1GV2 A;  3QPL A;  1B72 A;  4D5F A;  4DW6 A;  3GTM J;  4D5C A;  4RDU A;  2IAI A;  1ITY A;  4C3J J;  2LK2 A;  2K9N A;  2Y31 A;  3HEF A;  1GV5 A;  4DYQ A;  3GTQ J;  3H3V K;  2EH3 A;  4A3L J;  5DTD A;  3BT9 A;  3E7L A;  1LE8 B;  2Y2Z A;  3OIO A;  2FD5 A;  3MVP A;  4BY1 J;  1IG7 A;  1JTY A;  1ETX A;  5EG0 A;  2DMP A;  5J1R A;  4M3G A;  1RPW A;  5EZG A;  2M2E A;  1A6I A;  4W97 A;  4B1R A;  4DZJ A;  3S14 J;  2HQ5 A;  5K7Z A;  1BL0 A;  3BTL A;  1VF9 A;  1WPK A;  1IGN A;  3HOZ J;  5GPC A;  1F43 A;  5GP9 A;  3IV5 A;  2TCT A;  5E3N A;  5E3M A;  1JJ8 C;  2CJJ A;  1ENH A;  2X48 A;  5BNG A;  3M4O J;  3D1N I;  1IC8 A;  1LE8 A;  1ORK A;  3DCF A;  5M3F J;  4MIM A;  1TWC J;  3ZQF A;  1MBF A;  4IHY A;  3HOX J;  1AHD P;  2LR8 A;  3PO3 J;  1R9T J;  3IH3 A;  1H89 C;  3M3Y J;  2TRT A;  5IOY A;  3K2A A;  4MO7 A;  1QPI A;  3BTC A;  5IYD J;  2AO9 A;  3BR0 A;  2NS7 A;  3JRD A;  3K7A J;  1JTX A;  4FE4 A;  3HOU J;  3PO2 J;  1JUM A;  2ME6 A;  5E3L A;  4UUS B;  1X58 A;  2N8G A;  3B6A A;  2R7Z J;  1ZGW A;  1IJW C;  4FTH A;  5IP9 J;  3BQY A;  4XRS A;  3I4M J;  1HLV A;  1PUF B;  4DZP A;  2O8K A;  3A03 A;  3ZQH A;  2NVQ J;  4XIC A;  4BBS J;  4A3I J;  2H1K A;  4AC0 A;  2M0C A;  3BR6 A;  1GVD A;  5FKK A;  1WH7 A;  2ID3 A;  3NAU A;  3Q0U A;  2EBI A;  2DMU A;  9ANT A;  1X2M A;  2JA6 J;  2D5V A;  2HOA A;  3HOY J;  4JX4 A;  3SDG A;  3S15 J;  1U8B A;  2QCO A;  3LNQ A;  2P81 A;  1ETO A;  1FIA A;  2DA6 A;  1FEX A;  1I3Q J;  4AUX A;  1RKW A;  1W0T A;  4ABZ A;  2XPU A;  4UUS A;  2DA2 A;  3ZQG A;  2FX0 A;  2OF7 A;  1TWA J;  2XGC A;  2ELK A;  1PUF A;  4BXX J;  1MBH A;  5FJ8 J;  2R0Q C;  1MBG A;  4B4C A;  2XGE A;  2R5Y B;  3CDL A;  4A3E J;  1JUS A;  1JKR C;  1HF0 A;  3HB9 A;  3DEW A;  2Y9Y A;  3ZOB A;  2KT0 A;  1Y1W J;  3LSG A;  1FIP A;  4C3H J;  3HM5 A;  5F0H A;  5EF6 A;  1RR7 A;  1ZTR A;  3BTJ A;  3BR3 A;  4DYC A;  1SAN A;  2JN6 A;  3GBG A;  3OOU A;  3S1R J;  4A3F J;  3S16 J;  3JRG A;  1MBK A;  5IYC J;  3QQA A;  1T33 A;  4JX6 A;  2MGQ A;  3S1N J;  1POG A;  3JRI A;  1E3O C;  3WHC A;  5IP6 A;  1ZKG A;  1VFC A;  1ZR2 A;  1K61 A;  1WGX A;  2R5Y A;  2HOS A;  2Y30 A;  3Q0V A;  5K7F A;  5FLM J;  1VND A;  2NVT J;  4CYC B;  2DN0 A;  2PMZ N;  3ZQL A;  3UKG A;  1TC3 C;  2DJN A;  2JWT A;  2XB0 X;  3RZD J;  1GUU A;  4G12 A;  1IUF A;  3S1Q J;  4FIS A;  5C44 J;  5JLW A;  5F0C A;  2E2H J;  2VI6 A;  3HOV J;  3HKZ N;  1U9N A;  3TW6 A;  2JMW A;  1MBJ A;  4D7N A;  5M3M J;  1S7E A;  4M6V A;  3TW7 A;  2JA5 J;  1P7I A;  2R92 J;  1ETQ A;  2XB5 A;  1YRN B;  2IBD A;  4XRM A;  1Z77 A;  1RES A;  2VUM J;  2XGD A;  1XS9 A;  1H88 C;  2NOG A;  2X6O A;  2GBY A;  4CYC A;  1JT0 A;  1HDP A;  2XSD C;  2XPV A;  2GLO A;  1IDZ A;  1ZR4 A;  2DA3 A;  5EEA A;  3I4N J;  4EEF G;  2JA7 J;  1ZK8 A;  4AYB N;  5M5Y J;  2B63 J;  3G1L A;  1IV6 A;  2HI3 A;  4UUT A;  1T56 A;  1OCP A;  2ZB9 A;  4A3J J;  3IH2 A;  2HXI A;  3JRH A;  1WCM J;  3Q0W A;  2EQR A;  3IH4 A;  4A3M J;  5F27 A;  5J1Y A;  3A02 A;  2K9S A;  3O8G A;  3RQI A;  4JX5 A;  2X9D A;  3QPS A;  2K9Q A;  1YRN A;  5GPA A;  5EYR A;  2NS8 A;  1Q1V A;  4IEJ A;  3CMY A;  3TED A;  1ETY A;  2DA7 A;  2L0K A;  4MFD A;  2COB A;  2K40 A;  2O7O A;  3WHB A;  4FCY A;  3BQZ A;  3W6V A;  2DTZ A;  1ETK A;  1ETV A;  2WAQ N;  2CQQ A;  1NTC A;  5IOZ A;  3C2B A;  1BJZ A;  1XG1 A;  2E19 A;  4RBO A;  1W0U A;  1ETW A;  2IEK A;  3HOW J;  1BA5 A;  1QVT A;  4IHX A;  5IP7 J;  3VPR A;  4XID A;  3JRC A;  2W48 A;  2CUF A;  1EF4 A;  1FJL A;  3SFI A;  1BW5 A;  2EZH A;  2LKX A;  2HYJ A;  5FKN A;  1UG2 A;  2CU7 A;  2M9H A;  1I50 J;  1FTT A;  5C3E J;  3LSP A;  4BY7 J;  3HDD A;  5C4X J;  1F36 A;  5F1J A;  3CQZ J;  3Q3S A;  2DMN A;  2MW8 A;  4I6Z A;  3PM1 A;  1MBE A;  4BBR J;  3BTI A;  3L1P A;  3JRF A;  3JRA A;  5M5W J;  5FKM A;  3BG9 A;  4M3D A;  3BR1 A;  1SFO J;  1JKP C;  3BR5 A;  2CRG A;  3S1M J;  3G1O A;  3GTO J;  3JRB A;  2MSY A;  2GM4 A;  4XRS G;  3FKI J;  2YUS A;  3OSG A;  1HCR A;  5EG0 B;  4B3A A;  4W1U A;  4MLO A;  2R93 J;  1X2N A;  1BW6 A;  2ME0 A;  2NVY J;  3CCY A;  3FIW A;  1QRY A;  3BG3 A;  4X1E A;  1QVU A;  1OCT C;  4V2F A;  3FK6 A;  4C2M J;  5EGO B;  3NAR A;  1U78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...